2E1MB

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
90
Chain Sequence
AATQTWTGDLAIVTIPFSSLRFVKVTPPFSYKKRRAVIETHYDQATKVLLEFSRRWWEFTEADWKRELDAIAPGLYDYYQQWGEDDAEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 14
structure length 90
sequence length 90
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mB02
2E1MB
chains in the Genus database with same CATH superfamily
5FD5A 4AWXB 2W24A 3E6DA 3PSIA 2K4JA 1W5SA 2DK8A 4FE4A 4DBRA 1IG7A 1LE8B 4XLEA 2L7KA 1XSVA 3OOUA 4XKBA 1TQPA 3ERMA 1ZLJA 4BYYA 4M9XA 2BXZA 2HYFA 2PEXA 3OS0A 1ZGAA 2OZ6A 5DV5A 1RETA 3TOBA 1Z0XA 2MLKA 2ZNZA 4P1WA 4V2GA 4F52A 3EUAA 2NYXA 2ZC2A 4A3JJ 4HA8A 2FBIA 3TO7A 3J81K 1Z6TA 2CU7A 1FPQA 2L7FP 4EM0B 3PNYA 1MMGA 2STWA 5CLSA 3CDHA 3SZPA 2IJLA 1U5TA 1Z3XA 2AXLA 3BG3A 3HKZA 1SD5A 1TW2A 3MD2A 2ECBA 3S2HJ 3MFKA 3ZP5A 3H5AA 1EF4A 1MSFC 3IV5A 1WWXA 2VBZA 1ON2A 2BVMA 2J5OA 1V55H 4DNCA 1CQTA 2XRLA 1ZR4A 2M4KA 5H2FC 2HDWA 2HOAA 3OYCA 2DU9A 3HPGA 2XF5A 4EQQA 3GW2A 1MSEC 3HOTA 3CMEI 1TWHJ 3S3NA 4YEJA 5F04A 4UB6C 1ZAOA 4YFNF 4I02A 3B6AA 1O3TA 3IWZA 1YW9A 3F6OA 3A0BC 3HOWJ 3K9TA 2DCEA 1MBJA 1UFMA 1TZLA 3OIQA 4XKCA 1JKOC 1AA7A 3ZMSA 4AVZA 1YIOA 2YX7A 2L7MP 2V9KA 1R6RA 3ZQHA 4RGRA 3BQYA 3OY9A 3JTHA 4HNUA 1BJZA 1FIAA 4OIRF 1JI8A 2XPWA 4F91B 1XS9A 2MA3A 1FYLA 3V4GA 1TLHB 3DBLB 4E7SA 2ZKZA 1ZGWA 5HS9A 2NNYA 4A3EJ 1EJ9A 2CSOA 4HYEA 4GO1A 2PFBA 2F5CA 3BTIA 1POGA 5L3BA 2IT0A 4BL0B 3KFWX 2ESHA 2OZUA 3OL4A 2JPCA 3QPHA 4L5IA 1W7PD 1ULYA 3RQ4A 3TMOA 2IS6A 1ETKA 2MW8A 2DFEA 3WG7H 3KZZA 4F92B 4NDLA 5D8KB 1VQ8I 3FMSA 1LPQA 2HR3A 4FTHA 3QPLA 3ELKA 4AM3A 3L1PA 2KT0A 3GCMA 5B1AH 2GXAA 2L7ZA 2MC4A 3HHGA 3LWFA 5LEKA 2E1CA 1V54H 5CVIA 1LVAA 5DEQA 2PMUA 4BACA 1E17A 4YFXF 4HX4A 3BCAA 1O3QA 2N8GA 2QGUA 2QKLB 3FXRA 4MLOA 2ID6A 3QU3A 2OA4A 2A68F 4KYWA 1U2WA 2QSFX 4HSTA 1YOVB 3RIRA 2ELHA 2HQNA 9ANTA 2KRCA 5A2QZ 3ZQLA 1QU3A 5J1YA 4WXHA 4I76A 4UXNA 2E7XA 3V8LA 3GEZA 5ILVA 3WE2A 1S8NA 1IF1A 2H6BA 2EFWA 2JMWA 1ZH5A 4FX4A 4A3CJ 4XOTA 4NC8A 2DFFA 3VYSB 4D1QA 4D5CA 3OYMA 3TO6A 1U9NA 3LA3A 3IKTA 1K78A 1WJ5A 4BHBA 2M45A 1MNEA 2EV0A 4KIBA 3EDPA 2LY1A 3QOEA 2W00A 1G2HA 1FZPB 3I9V2 4RLFA 4M74A 1LNWA 2CQNA 4LLGF 4U0WA 5H6RA 3WGIA 3K1NA 4RBOA 2QYOA 1QNTA 4M9ZA 4XR6A 1VQLI 2CQKA 1Z3YA 4HNVA 1TWGJ 3S2WA 1KZHA 3CP8A 2DMPA 3CJRB 2R5ZB 4DJAA 5LLQA 2LH9A 1A6IA 5JVGF 2KRHA 2QA4I 1YHQI 2DT6A 2JN6A 1T39A 1Z91A 3N4MA 2F2EA 4KT6A 3OYHA 1QGPA 2E60A 2H6CA 2CV2A 3E6MA 4DGWB 2PMHA 1VI0A 2BE5F 1FBSA 2NNNA 2HZDA 3S1MJ 5C4JJ 5HNHA 1I6XA 2R7ZJ 4UNOA 1RKTA 3DPTA 4MHGA 1U3EM 2JSPA 4N9HA 3LSKA 3MZ8A 3FXQA 1K78B 2IA1A 5KK1A 4ITVA 2W48A 4ZTJA 4R8HA 2DJIA 1MBHA 3UKGA 3SYTA 2EA2A 3HKZN 1JT6A 2FF4A 1WJAA 2K4BA 3HEFA 2DOAA 4TV7A 3CO7C 1T8IA 3M1CA 4IHYA 3A02A 2EFNA 4RB3C 2Y0MA 4UHTA 2K9LA 3IH3A 2BW3A 4BY7J 3LSRA 5FRNA 5FLXK 1BR1A 4IXAA 5FKLA 4CO8A 4RDUA 1O57A 5D5XB 1S7EA 3L2RA 4KDPA 2VOPA 3E0JB 2F5FA 1R7JA 4CDGA 5EZHA 1DP7P 1YITI 3DV8A 1H9GA 2M2EA 4CZZA 2M34A 4U7DA 3NWSA 1Q1HA 1DDNA 1XGMA 2F48A 1FC3A 2KIFA 4B3XA 2IAIA 4ZDOA 4CH7A 3M4OJ 2L54A 2LC2A 1I5ZA 2P5VA 3OR1C 4BXFA 1R71A 1UHMA 4BGDA 4EV0A 5IYBJ 2OCCH 5LFAA 2L9NA 4E7JA 3BG7A 2JRTA 3FDYA 1DU0A 3G73A 5B5EC 2WTEA 3ZOBA 2P0WA 1ODDA 1R5GA 1K7AA 3S1RJ 4OAZA 1SAXA 1KU7A 1APLC 2DMQA 4E70A 4Y4RA 1XDUA 4I2OA 3DPLC 1KGSA 2BOLA 1ZR2A 2W85A 2WA0A 4FISA 1H89C 4V19K 2ZCWA 1D0ZA 2JA6J 5BQTA 1S29A 4PCQA 2F5EA 1G8XA 3L2UA 1X1PA 4G6TB 3L9FA 3HSEA 4CYCA 3H36A 4A6DA 1RUNA 3FBIB 1WZ2A 1S5LC 3N05A 3ECOA 3CQZJ 2RC4A 3KYDB 3BT9A 5ICCA 3K2AA 3KIOA 1T0FC 4F55A 4GFBA 2KISA 2TRTA 3CMAI 4BQQA 2R4GA 1IGNA 5JLWA 1AKHA 1IN7A 2DFIA 3I55I 1O4XA 2VASA 2RNJA 4G6DA 2MG4A 2VBXA 2ZBKA 4RA2A 1QVUA 3SEZA 2H94A 3CUQC 4XLHA 3K7AJ 4BHCA 4B1RA 4MTDA 1MMNA 2QBYA 4CXFA 2MGQA 1TC3C 3GF2A 2HOEA 3VSLA 4IX7A 2YU3A 5DCMB 3I3LA 2E2JJ 1OR7C 1JKRC 4I0BA 4CCJA 4IRIA 4HQMA 4BH9A 5J1UA 4A12A 2GQQA 3WHBA 2XV4S 2R7XA 1ZG5A 2X6OA 2HEOA 3R0AA 5M3FJ 1GT0C 2YS9A 1PP8F 3LSJA 5D5VB 3F23A 4EJTA 4UVCA 3E6CC 1FOYA 2ME6A 4E6KG 2LKPA 2CV0A 2FMLA 1ZK8A 2RQQA 3UR3C 2H8RA 2IXSA 2VE8A 3W2AA 5FLXZ 2YX4A 3GTQJ 3T5XA 2E1OA 2FXAA 1TW3A 3F0CA 4PFOA 4RB2C 1J59A 2DQLA 1H8AC 2XKOA 1D5YA 4LIUA 1MJBA 3O8GA 3H1CA 3LSMA 1F9NA 1X3ZB 3CUOA 4IKFA 4DOZA 1X3WB 2K7LA 2QBYB 2PQ8A 2IS4A 1QZEA 4JX6A 1XSXA 3K4BA 3CC4I 4NHJA 3PJRA 4PSXA 2IVMA 2JTVA 2Y30A 5AIPA 5IY5H 2G7HA 2STTA 1P7IA 5C4XJ 2K5CA 1F5TA 4CHUA 5L3EA 4BE0A 4KN4X 2ZJQF 4F3QA 4YELA 4H4KC 4ZH4F 2Z16A 2VE9A 2EINH 2HXOA 3E5QA 4GDFA 2EFQA 1R1TA 3FKIJ 4PGHA 4HF0A 2FOKA 4ESFA 2HOSA 3CC7I 1IN6A 4WF2A 1VQ6I 1UCRA 3G1LA 1OLTA 1ETWA 3CF2A 2DYRH 1QZYA 4A3MJ 2VKHA 4JQFA 4PJNA 4A0ZA 3A1YA 3ECHA 3FHNA 3GXOA 1FOXA 2BHYA 4XKWA 2QKMB 1E0EA 3LSGA 1QA6A 2V26A 3CDLA 3ZCOA 1P4XA 6PAXA 3CZ6A 3DEEA 4ZYAA 3CCYA 3TDUC 3GTJJ 2L0KA 2VXZA 4HBLA 4CCKA 4XQFA 2Q2EA 4XSXF 1Z67A 5D8LB 1TWCJ 2CGPA 4KUMA 4EJOA 3SZTA 3GWZA 4LD5A 5E1WA 2HYJA 3DQVC 4B44A 2GLOA 1ZN2A 4ZTFA 2XAJA 2DFHA 1GHCA 3CCVI 2VN2A 4C3IJ 2QSHX 4FQGA 4MO7A 1YLFA 5C3EJ 1O7FA 4J00A 1FLIA 1WJCA 1YFHA 2FU4A 4KJZA 3AG1H 4XONA 1YRNB 1TT5B 2FNAA 5F6FA 3CP2A 1ERDA 3LA7A 2QWWA 3D0SA 4IRGA 1SFKA 3A2KA 3FIWA 4EATA 4CCMA 1IJWC 1ZREA 4LLLA 2V1NA 5JLXA 2ZJ2A 1DP3A 1P4AA 5LRRA 3KP4A 2KZVA 3FISA 2HXIA 2TCTA 2F5DA 3S32A 4I6ZA 1MMSA 2QM3A 1OYWA 3CMYA 1RPWA 5IP7J 3JRAA 1G3SA 4IZZA 2IA2A 2FBKA 1S9HA 2K40A 2P5KA 2V1XA 1MMAA 1JUPA 3IRQA 1RC9A 3FM3A 3V7SA 1WI9A 4LK1F 3WTXC 2Z9OA 3VYUB 3MKYB 2Z3YA 3KEYA 4IRHA 3SQNA 3GTPJ 2L02A 1OQYA 3CUQA 3TP0A 2VJJA 3DEWA 3KZYA 5GPCA 2DMNA 3SFIA 3ASNH 1RIOH 1KU9A 4C3HJ 2CW8A 5LHHA 4DYQA 2NS0A 1X4OA 3NQOA 2E5NA 3HYIA 5D4RA 5DD8A 4YRVA 2WV1A 1OR7A 1JT0A 1R5HA 3IHUA 1HLVA 1TL8A 3OYGA 1LDDA 4A93J 2X6YA 3LSHA 3BPXA 5JHUA 3HSFA 3R0JA 3B02A 4A0YA 1JXSA 3U1KA 3RSNA 1XD7A 3FHZA 3KETA 2QQ9A 3DKYA 4BDYA 3IL2A 4MIMA 2M87A 1IO2A 1XG1A 2MC3A 1HW2A 4LB5A 1S6LA 3FK6A 3X2QH 4BS9A 3CJQB 2DMUA 4ZYDA 4IHWA 4GCVA 2UXXA 1MDMB 2EILH 4L9TA 1MJ9A 2MSYA 1OMIA 1S72I 1MGTA 2ZB9A 3HOXJ 5IT9Z 4CCOA 4RLQA 1I39A 5FJ8J 1FT9A 1JTYA 2M0MA 3CTAA 1MBKA 1P92A 4PGGA 5F1RA 2L5QA 4CYDA 4U87A 3PQJA 1EH6A 4W1UA 1D1CA 3RYPA 2XB5A 1R22A 5TJJA 4FT8A 1MIJA 4HSRA 3CCRI 2CW7A 3DTIA 2DOFA 1HOMA 3HM5A 3EYIA 5J4YA 3OS1A 2M0CA 2GBYA 2LD5A 3FXLA 3K4LA 1ETXA 3HPHA 1VQ7I 3RPQA 2DA2A 4HX7A 2RQPA 3HG9A 4RAFA 3TP3A 2DK5A 3PSFA 4W97A 3EUKL 1WJBA 5JFRA 1IN5A 3TKYA 5IYCJ 1HC8A 1ZG1A 1UZCA 4EVIA 1Z7LA 5ERIA 2DTZA 2LP0A 3RYRA 4XLAA 1Z6RA 3IAS2 3BOQA 3C2BA 1X1AA 3KE2A 5EF6A 1AOYA 3DF8A 3V8JA 1Y0NA 5ILUA 1BC8C 2FQ4A 1B9NA 1ZGJA 3KCCA 1QO0D 4BHPA 4WWCA 3S16J 3F8NA 5EZGA 3BJOA 3ZQQA 5GAGJ 1SAUA 3JW4A 1KA8A 2MH2A 3L2QA 3GZ5A 3W6JB 4R1HA 2D45A 1OKRA 1P9QC 2IP2A 1C0WA 1FP1D 1N25A 4NNJA 3FKJA 5KHDA 3FK7A 1FSHA 3P5JA 4CA0A 3AG3H 1HDDC 4ANJA 3IKVA 3RDIA 2DDBA 4XIDA 4CSWA 3IP4B 2XF7A 5F1JA 3A0HC 3J7YJ 1D5VA 2AXTC 4ENNA 3IWFA 1LJ9A 4AIDA 4CUGA 2MD0A 5K5QA 2EZHA 5M5WJ 4ENKA 1TP4A 5FKKA 1IUYA 1WQ2A 4DYRA 2JQ7A 4D7NA 2A6HF 2KIUA 4L5JA 3NWTA 3VB2A 4UUVA 2KMUA 3RPUA 3GVAA 1X1CA 5IYDJ 2X6XA 4U0VA 1Y6IA 2XB0X 1BN5A 1IAWA 1WHUA 3T8RA 3K0LA 3QU6A 1F36A 5HLIA 5IOYA 5DUKA 3J80Z 4P9FA 2W4SA 1XMAA 2BY0A 2EA4A 1YO5C 3PO2J 1OCCH 2XVCA 4XLNF 3LAJA 1TNSA 3H0GJ 3CCSI 3KZIC 4KITB 1FOWA 2W84A 3QYFA 5A2QK 1X19A 4BBRJ 4PFPA 3ROUA 2LY2A 3CJNA 2XC7A 3OYJA 2XGDA 4NC6A 3QWLA 3LL7A 1B6AA 3JCUC 2RN7A 1WRJA 1EH8A 2IGKA 3BCBA 2EV5A 1GDTA 3FM5A 1ZKGA 1S7OA 2GOMA 2GAUA 1TNTA 3GUDA 4MEXF 3W2VA 4ABZA 1RESA 1R00A 5BOXA 4ENMA 3ULQB 2VLAA 1JHHA 1SVLA 4XMYA 3KEQA 1W4MA 3OWTA 3OYEA 1YS7A 2G0EA 1UHWA 2ZMEC 1SD6A 2QQAA 4G8XA 5HLTA 1XMKA 2V79A 1J0RA 2NXNB 4NBQA 2IGMA 3B6CA 2KJBA 4X0GA 4KMFA 3WU1B 2GM4A 3M8JA 3VOEA 1EV7A 2F5VA 1E3OC 1T56A 4IEJA 3UNGC 4HDVA 5EJCA 5CPRB 5J6XA 4XM3A 3ZPLA 3G4SI 4KISA 4RGUA 1G3YA 3H3VK 3Q9SA 1IXCA 2EV6A 3AG2H 3PNTA 4RAZA 4BQAA 2DA6A 1MKMA 5LGNA 1FWZA 2IEKA 2XGXA 3AFHA 5CQEA 1SD4A 2VC1A 3TO9A 2RKHA 2HZTA 1T33A 4JX5A 4HNTA 3CCQI 2UUZA 2COBA 2FX0A 3K1MA 3VSKA 3HUGB 4ESJA 4M9SA 3ML6A 3OYAA 2GXGA 3FWEA 1GV5A 1S3JA 1BOAA 2H09A 5K7ZA 2VJ4A 3Q5FA 1JUSA 2KRFA 2EK5A 2LNBA 2JUCA 2LFBA 4JK1X 4I7HA 4BU2A 2BZTA 3I53A 2R7UA 1MBEA 3ZQCA 3OSFA 2ZJRF 2NS8A 3MN2A 5LHGA 2AQEA 3GTLJ 2CYYA 5EEGA 1WI3A 5DD4A 2MH9A 2H1LA 2F6CA 1MJAA 5DYMA 3LSPA 3FXOA 3OSGA 1B8IA 4LB6B 2R5ZA 2G7UA 2GA1A 3OYLA 2HQ5A 4MQ9F 4OAYA 2FRHA 3OYDA 4A5MA 1QPIA 5HVQC 2E35A 3EYYA 5BNGA 4BE1A 1I27A 2E2IJ 2DBBA 3HRUA 2QUFA 4NQWA 4RMNA 1AHDP 2LLKA 1HCRA 2HS5A 4PJMA 4HLYA 2H8WA 3I4NJ 1ETOA 2JA5J 3V42A 4N0BA 3KLOA 4HZFA 4B4CA 2LRDA 2OJED 2F4OB 2W1OA 3MKZA 1KQ9A 4KNYA 1OCZH 3H5NA 2UWMA 2OV7A 5IP6A 5IP9J 1BA5A 2XAQA 2QQBA 3BLYA 3PIPF 1ONVA 3VDXA 4J19A 4UUTA 1R1VA 1WFXA 2CO5A 2EIJH 3OIOA 4JBAA 2DO7A 2G9WA 5B3SH 3O8HA 3Q0UA 3KP2A 5F64A 1DGWY 3A03A 3JRDA 2EQRA 2IBDA 1P4WA 2E19A 4I01A 2Y9ZA 1YYVA 3GFIA 5FKNA 1DPUA 2Y75A 1B8IB 1J75A 5FLVA 4P5OA 1KQ8A 2M7BA 3F8BA 1BIBA 1X2MA 4D0PA 2EIMH 1HA8A 2V9PA 2H1KA 2V6CA 4E7KA 1EH7A 4IL6C 1RKWA 3F6VA 3F8MA 4HAMA 2A05A 1VQ5I 4NQWB 2E36A 4XKVA 2IS2A 3L2VA 1LFUP 1R1UA 3KEOA 1FOKA 1KU2A 2GA2A 2UZKA 3BPVA 1BW6A 3WODF 1PUFB 1DU6A 4AIJA 2HQAA 1NHAA 1Z21A 4G7HF 2LF7A 1QPMA 3BJ6A 2X51A 1F1ZA 1O3RA 3W2WA 4QSHA 4Q5SF 4JX4A 4CZCA 1BBYA 1BM9A 1GXQA 4IHTA 2K3PA 2QZ8A 5F0HA 1K6OA 2PN6A 3W3CA 3JAMZ 5CYVA 2ZMEA 2M7AA 1XC5A 1SANA 4HOBA 2OQGA 4KN7X 2RV8A 5AONA 3H9QA 2DT5A 5HOOA 4Q4ZF 4NUBA 2NVUB 2BY2A 2BGCA 3ZMTA 2C6YA 5DS9A 2HTSA 4P9UA 4GXOA 1QZZA 1HQCA 5HDKA 2ZXIA 2E5ZA 4EJUA 3DKWA 1BOBA 4G94A 3BG6A 2O5RA 3AL0C 1V3FA 1WH7A 1JKPC 1IRGA 4QWQA 1U0JA 2JA2A 3C1DA 3DWLE 1FJLA 2PI0A 1MZBA 4BEHB 4AVPA 5TRDA 1W36C 1R36A 1DUXC 2P5LC 2QLZA 4HV5A 4AUXA 3DXJF 2DQRA 3G6EI 2K9MA 3E1SA 5E1ZB 1MBFA 3L7WA 2DA7A 3LQQA 4Q47A 2O61A 1FY7A 1YX3A 1BC7C 2ZMEB 4F93B 2GZWA 1N75A 2RAEA 1I1SA 3L2WA 3CO6C 5HODA 3C3WA 3M7GA 2PJPA 2P6TA 2VBWA 3GMEA 5DCMA 1J2XA 2FBHA 4WX9A 4LG0B 1VQKI 3ABKH 3BJAA 3MZHA 4KMUX 3HC7A 4BJ6C 3JREA 3M3YJ 1I3QJ 4DBQA 2D1HA 1P6RA 4XLCA 3SDBA 2M4GA 3AAFA 4C9YA 4MTEA 4L9NA 2EZKA 1Y8RB 3CC2I 3J7AO 2LR8A 3OIPA 3RI4A 1NG7A 2OD5A 2JVHA 2DODA 4M3EA 3ESWB 4M3FA 3GTOJ 4AIKA 3BZCA 4Q48A 1IDZA 2X0LA 4S05A 3T8TA 2NOGA 5LGTA 1RR8C 1VQ9I 1VQPI 2HPMA 1NG6A 4J01A 1D0YA 1AWCA 1K61A 4OU0A 3E97A 5EGOB 4FE7A 4KICA 4C3JJ 4A3FJ 3KP6A 5TGTA 5E8GA 2VI6A 1USSA 3ZQGA 1YW8A 5B66C 4IQ4A 1N77A 1LDJA 2LYCA 3FMRA 3F8FA 3LNQA 5BMZA 5E17F 1U8BA 1SEUA 4IF4A 1L0OC 1GVJA 1XX5A 5CQGA 2Y0SA 3TOAA 4E7ZA 3S1QJ 3GO5A 4AU7A 4A3DJ 1NK2P 4UVBA 1MBGA 2Q0OA 1JKQC 1A36A 5FFZA 3OOPA 3PUBA 2A07F 2B7EA 3LFKA 4LMYA 3I58A 1Y1WJ 1HKSA 3BQZA 5E20A 3ZMZA 3BDDA 4R79A 3M9AA 4A3IJ 3I4MJ 3BC8A 1XMXA 2K9SA 3NARA 3U9GA 3BR5A 4Y17A 3KP3A 5E3OA 2EPFA 1H88C 2CUFA 1OFCX 3BR6A 3NAUA 1F43A 4WXDA 2H27A 3A01A 4V2FA 5F0CA 3MVPA 4HW0A 2ESNA 2JRMA 2QSGX 4E7IA 5F27A 2VQHA 3GBGA 3GLXA 5EG0A 2NOJB 4A6EA 4IHVA 2K02A 3CCJI 1MD0A 1Z05A 4BQOA 3I71A 3Q0VA 1XDSA 2VT3A 2IGOA 4HX8A 4DW6A 2DPDA 4EJVA 1KONA 5EEAA 2BYVE 3CJTB 4KIGA 1KU3A 4NB5A 3SDGA 2Y69H 2BY1A 3FZVA 3MMYB 3HGYA 2K9QA 4PJLA 1YRNA 2HI3A 2Z2SB 3BR2A 2HPIA 2WV0A 1LVKA 1QHGA 2WB1A 3H9JA 2X6WA 2DPUA 5IT9K 1YS6A 3M1EA 2VKEA 3D5LA 3GTMJ 4KA4A 2DXIA 4MNUA 2R93J 2YU9J 3A01B 1ON1A 2VKDA 2R7SA 1OPCA 1SFEA 3JRGA 5ICGA 1XTAA 4A3KJ 5EG0B 4G12A 3ZN0A 2Q1ZB 1X3UA 2FMYA 4PJ0C 4A5NA 2DT7B 3N97A 1WSUA 2E1MB 3G3ZA 4IO9F 3KP7A 1B9MA 4BXUA 1SMTA 3MZYA 5J3LA 2JA7J 2NVQJ 1XGNA 3RKXA 5L3GA 1L3LA 5E8IA 5GPAA 5J40A 1D1AA 4B43A 1ZTRA 2PMZA 4G9YA 4XRMA 1D3YA 5EYRA 5GP9A 3L09A 3H35A 2MBFA 2FOWA 1LB2A 4FASD 5FRMA 3G1OA 2XSJC 4A0XA 5KAFC 3RPUD 2P7VB 2DDAA 1W5CC 2F4IA 3H5RA 1BW5A 3E5UA 3LQRA 3AL0B 3SFZA 2CQ7A 3ZN1A 2NAZA 2LOOA 3QYBA 4BY1J 3WTZA 1MDMA 1R5ID 3QAHA 4FHTA 2CRGA 3F9KA 1LEAA 2ECCA 1T0FA 2A6EF 1P2FA 5ILSA 5HLGA 1W0TA 5D6FA 4FX0A 2R7DA 4I0AA 2GOXB 5M5YJ 1LFBA 1MH4A 1GV2A 2F4MB 2HKOA 3RKQA 1R23A 2K3FA 4G7OF 1KYZA 3TW6A 2FD5A 1KYWA 4HDUA 2P8TA 3G2BA 1T95A 2HVQA 3CESA 1J09A 4RAGA 2XROA 3RZDJ 2RGVA 1IN4A 1B59A 3VPRA 2I8DA 2MFZA 2V4JC 4DQ2A 2W57A 1ZQ3P 1Y39A 2MLGA 2VQLA 1ZLKA 3ABUA 1IRZA 3OL3A 5E3NA 2VKVA 2R7QA 5FO5A 1X2NA 1VQNI 1ZRFA 1I3AA 1YG2A 3C2GA 1HSJA 2D1VA 2Y0SN 3PQKA 1OCTC 1O7LA 1YJNI 1TBXA 4WK8F 3P9IA 3J80K 1K4TA 5LRSA 1N78A 2HWVA 3GTGJ 2WADA 2VQCA 2YSRA 1GVDA 2YR2A 1BJAA 1EA3A 1OCPA 5LEJA 1D0XA 1USTA 3S15J 2VT2A 4RGXA 1RI7A 1LFPA 3GX4X 1X1BA 2E71A 4YIFA 3OMYA 3I54A 4BBSJ 2CW0F 3K1PA 4EGYA 1AU7A 4AYBA 4XOPA 4ZJZA 2FQ3A 5HS7A 1XSDA 1ITYA 4U88A 1CGPA 4UV9A 2E34A 4M6YA 1Z1DA 2XGEA 1ETVA 1W0UA 3PL8A 3HOVJ 3JRCA 4N4OB 5AIQA 2JJ7A 1TWFJ 2JWTA 1UG2A 1D8KA 3PM1A 3H0DA 3OYIA 2CV1A 3HTSB 3HOZJ 4K2EA 1IUFA 3ZR8X 1UAAA 1HKTA 4LIVA 4YFKF 2LSOA 1IRFA 1EKEA 2M9HA 2D2WA 1QHHD 3ABMH 2FE3A 1BI1A 3DLAA 3QP6A 2LKXA 1MW7A 2W25A 5CVRA 2HVRA 4PZJA 2XAHA 3MAJA 1G3TA 1G3WA 2X1DA 3DTKA 3IUOA 4KFCA 1WVRA 2WB1N 3M8EA 1SFXA 2JPBA 2OC6A 3RKYA 5KCMA 5IPAA 5FB2A 2M5WA 2OPTA 2LBFA 3D5RC 2XHKA 1FEXA 4KT5C 5JVTA 2ACJA 3ONQA 5TISC 5J4VA 1IDYA 3C2HA 4LITA 1A6QA 1CF7B 4HPQA 4HF2A 2X85A 1I6HJ 2DLLA 1UG0A 2HQRA 2I5UA 3FXMA 2XUBA 5D5WB 2O9LA 4B8XA 3MKWB 1STZA 2VBYA 5CVVA 1S7AA 5D4SA 1B72B 3WU2C 3BWGA 2OCEA 3RJPA 3CCMI 2PMZN 2ADUA 3HRTA 5HDGA 2HTJA 4OINF 4Y7NJ 4BXXJ 3LFUA 1XPXA 2K27A 2XAFA 4OIQF 4ZDLA 1FIPA 3JRFA 1J5YA 4ESBA 1JE8A 2VC0A 4Z2YA 4U0YA 3GLLA 4JYKA 5KNLA 2BHZA 2VIXA 1X58A 4ZDPA 3GFLA 3CD6I 2EFPA 4JP0A 5E18F 3WTUC 4ZZLA 2GIVA 2M1BA 2LBFB 1H0MA 4XN3A 1TQMA 3C18A 4B3AA 1IXSB 4CCLA 4HRIA 1FX7A 5ED4A 1OYIA 3PFYA 2R7TA 4M73A 2IW5A 5M5XJ 3HL2A 2NVXJ 2R7OA 1IV8A 4BAYA 3I4PA 4XRSG 5DDGA 3KYCB 1XB4A 3DU6A 2P6SA 1RR7A 3R60A 2EZLA 3K4NA 3VWBA 3HUGA 2JZYA 3W6KB 1G6NA 5LHIA 4L0YB 3BTLA 1WGXA 4AIHA 1DQUA 3I5UA 4ETSA 2L9SA 1VFCA 1LKXA 3ZXSA 3Q0WA 1ZYRF 4C2MJ 4HQEA 3VFZA 4E4HA 4IPAA 1OCOH 4AD9A 4XRFA 1B1BA 2D5VA 4I99C 4BQNA 4P96A 2R92J 3PO3J 1MH3A 2B9SA 5GADJ 3QYEA 4M72A 4IOCF 2R7VA 4D7MA 2LY9A 4XSZF 5J1RA 1ETYA 3EPZA 4ZYGA 2XF6A 4A3BJ 1ZRDA 2XAGA 3H9GA 1F4KA 3GFJA 1UJ8A 4ON0A 4EEFG 5LGUA 3GTKJ 3S17J 3SEQA 2CWEA 3RKWA 1HSTA 2Y31A 2IPQX 3JRBA 1YTYA 2MABA 3CCUI 1IC8A 5GAEJ 1FTZA 2EH3A 5H6QA 1DGRM 1FBUA 1QVTA 5JR3A 1W1WE 2ISYA 2XRNA 5JHFA 2KKOA 4ENJA 1BI3A 1WKMA 2RDPA 4HF1A 3LOCA 3SHFA 4AYBN 2ME0A 5CVJA 1T6SA 3JTGA 2IS1A 4O6JA 1JGSA 2HU9A 3A4CA 2CG4A 3SJMA 1JJ6C 2ELKA 3P7NA 2X1EA 4II2A 3F21A 3JAMK 4M3GA 2ZSIB 4EMSA 4UB8C 2R0QC 3QRFF 3OS2A 2DOEA 3LAPA 2Y9YA 5CVUA 3TW7A 1VZ0A 1ZG3A 4XNFA 1HKQA 1RNLA 5D5UB 3VODA 4EM2A 1FMWA 3TL4X 3GYHX 1IXRC 3EUHC 1QRYA 1J7KA 3HOSA 4OWRB 1U5TB 1FP2A 2LG4A 2V6EA 3J7AY 3IRRA 2Y2ZA 2KJCA 4ASNA 1VNDA 1T2KA 1V4RA 1QBJA 4L0ZB 2ZFWA 2P4WA 2WC2A 1YQAA 1YIJI 4C2UA 2R3SA 1T98A 5EEHA 3RZOJ 2L2OA 2MD5A 2ZFUA 4WXCA 4MEYF 4M6VA 1QQIA 3OR2C 4N9IA 2DYSH 1R58A 1VQ4I 3I0TA 4M71A 1SMYF 2ICWG 2KIMA 2JSCA 2KL4A 3KLNA 1D1BA 4BJTA 4FCYA 3FF5A 2KDOA 3P9KA 3ABTA 1IRXA 1HF0A 2OF7A 2KQRA 1PUFA 5GAHJ 3IAM2 2QVOA 1NTCA 4NC7A 2GIZA 3K10A 3ISPA 3WU0A 2QF7A 2FJ1A 3PNVA 2DN0A 5EDNA 3CCLI 2L4MA 2PBIA 1ZARA 3E3VA 3HJEA 1IW7F 2BV6A 5BPIA 4BUPA 3DKXA 1V5EA 2KLOA 4AC0A 4U7BA 1YI2I 1H9TA 3DBHB 3BR1A 3VEPA 3TDZC 1JHFA 2EZIA 2FEZA 4HLXA 1TQIA 1R4NB 3IC7A 4L5EA 5E3LA 3ZMDA 4DIQA 1GUUA 5FLMJ 3KPHA 1BIAA 3SXYA 2VUMJ 1T08B 1WPKA 1P7JA 2Y48A 4RS8A 2LKSA 4HG2A 3J81Z 1Y0UA 4YIRX 5DCFA 1PP7U 3V7CA 1M1EB 4M3DA 2CFOA 2RREA 5KVRA 3ZMVA 4KIFA 5L3DA 3EETA 2VODA 1DPRA 4P55A 4GYGA 1FYKA 5FFXA 4OIOF 1E3HA 1RUOA 2PJRA 2QENA 3OYNA 3C7JA 1TWAJ 4LK0F 3LSTA 2XPUA 3QPSA 2R7RA 2VQGA 3ZRGA 2JVGA 4BEHA 5L3FA 2OTJI 2FNPA 3KP5A 1OJLA 3CLQA 3R61A 3L00A 5IT3A 5GTIC 5J8FA 3PIOF 1HDPA 2IRFG 5IOZA 4A2UA 2E1MC 3JR9A 3KYLA 2YUSA 2BEOA 2EFOA 2CQQA 2M3AA 2BXYA 2L9VA 4LOCA 1B4AA 2Z99A 1MNMC 4GGGA 4O5VA 1YX5A 2UXNA 3VYRB 2NRAC 2Q8KA 4DZJA 4X1EA 3I64A 4HEA2 3EQLF 5CKTA 4PUSA 1T38A 1V5FA 3BR0A 2LMDA 4LG0A 3QPTA 1LDKB 1E2XA 2O8KA 4YG2F 2P7CB 5K7HA 2DAOA 3OV8A 3Q3SA 1O3SA 1RZ4A 2HFHA 1MNDA 3MQ0A 3FXKA 3DFGA 4XL9A 5J47A 2WAQA 3GZNB 2PJRB 3RTRA 4BDZA 2WAEA 5J8CA 2YPRA 2KZGA 1W36D 1U78A 4B09A 1YJWI 2KP6A 3QOPA 1JTXA 5KAIC 3HOUJ 2HNHA 4D5FA 2AHQA 3DBRB 4QLCU 4D9JA 1PDNC 3FX3A 2HOTA 2VONA 3H3ZA 2L9RA 5BS6A 2EBIA 3FBNB 4QTRA 1R49A 2CQXA 1K6YA 2ZSHB 3TEDA 3QODA 3DP7A 5EGOA 5LD2C 1PUEE 5F08A 2W7NA 2DW4A 1E3PA 2MYSA 3L2CA 4S04A 2CUJA 2EIKH 1ZHFA 1NK3P 3IH4A 3WG9A 3EUHA 4BE2A 2A61A 4FETA 4XN0A 3E6BA 4I09A 2NVYJ 4X6AJ 4A3LJ 5K5RA 2O3FA 4LG3A 4ZYHA 4IHXA 5FD6A 2I10A 1U8RA 1SFUA 2KPMA 4XBFA 1ZRCA 4BKXA 3E7LA 1PJRA 5K7FA 1OISA 1W7PA 1BR4A 2JA8J 4M3BA 1OCRH 2Z1DA 2ISZA 4YIIA 1UHSA 3TGNA 3O6BB 1W5TA 4MFEA 5CJ9A 2BW3B 5LBQA 3MKLA 4ZYEA 4XRSA 3S2DJ 3S8PA 3JSOA 2IGNA 3U1DA 3AG4H 4UV8A 3G71I 3HB9A 1ZELA 5FROA 4GYIA 1LEBA 3U21A 1IV6A 1HXDA 3K6GA 2WY8Q 2FSWA 2ETHA 2LDUA 4QIWN 1A5JA 2BVLA 2E7WA 3B73A 3LMMA 1R9TJ 3BP8A 3ZGKA 3U2RA 4ZZDA 2AO9A 1TTYA 3HIFA 2CUZA 1BI2A 1FYMA 3WE3A 2PLYA 4IOAF 3Q9VA 2LF8A 4LJZF 3OYKA 5FKMA 1K83J 4ZC3A 1W7PB 2O7OA 2OAZA 1HW5A 3HOYJ 1ENHA 1Y1VJ 5DUIA 2X1CA 3I59A 4DZPA 2XASA 3HTUA 5L3CA 1VTNC 4OIPF 3M07A 2ZO4A 1XCBA 2QEXI 2R7WA 3OYFA 4UVAA 2CUEA 2R7FA 4Y3OA 2CFXA 4II3A 3WGHA 4CYCB 4IHSA 5HLHA 2RVCA 3F72A 2CS3A 2M8GX 1YJ9I 1UB9A 4E7HA 5HDNA 3KX2A 4RAYA 2P81A 3MWMA 2ZJPF 3E5XA 1G4DA 1PVEA 3COAC 1WJFA 2HKXA 2M30A 2XPVA 3M8FA 2OU2A 4E7LA 3O2PE 3AKZA 5K1YA 3WGGA 1SFOJ 3LSIA 2V1DA 1AKHB 4B47A 3REOA 2X9DA 1TT0A 2OQRA 2X48A 2E2HJ 4LLNA 1WCMJ 2Z5UA 3R4KA 5D6EA 3S93A 4A69C 2LK2A 2UV1A 3ZQ7A 4RB0A 1FNNA 2RNGA 1KQ0A 3HDDA 3F22A 3WTVC 3I59B 2GWRA 5JI6A 3WHCA 1Z9CA 1VF9A 3K4CA 1VQOI 2QCOA 3DLLF 3S14J 1YW7A 2VJIA 5C44J 1D8JA 2ZXWH 2VOOA 2DJNA 2IA0A 3F8CA 4JOMA 3I56I 2O6GE 2Z33A 1WJEA 2B0LA 4L9JA 3IH2A 4XORA 3HHHA 2WAQN 2VB6A 3O3KA 1RRJA 3H3UA 1SVMA 2OBPA 3CDIA 1A04A 3RCOA 1A31A 4Y52J 1FTTA 3FXJA 4RB1A 4LFUA 2PG4A 1MMDA 3R6SA 3BROA 3HRSA 3QQAA 1JJ8C 3HRMA 3ERED 1X1DA 2AQFA 4QPOA 5HS8A 2E1NA 1ETQA 2CH0A 2GXBA 2WBMA 3HGGA 2X4HA 3H92A 1Y8QB 3FXUA 3WTTC 2HGCA 4QPQA 1U6GA 4UUSA 1K79A 2LVSA 1Y56A 4XLPF 3K70D 5BPDA 5F0FA 2HDCA 4LGWA 2ID3A 1NH3A 4MQVA 4Z6YA 3GZ6A 3K70C 1XGOA 3HXLA 2FUG2 1FMVA 3DCFA 2JK3A 3F3XA 4WCGA 4MGRA 2M8EA 1ORKA 4Y15A 2XSDC 3JRHA 2CJJA 2KIQA 4XK4A 1SD7A 5ICFA 4O3MA 2L3DA 3J7ZI 4GRIA 4CCNA 1Z77A 4HV6A 3V8KA 2DA1A 5DM7F 3CLOA 1WH5A 2VXDA 5H20A 4BJ5C 3CCEI 1REPC 2VPLA 2J5PA 2DMTA 2EWNA 3BZKA 1HBXG 2V1UA 3LA2A 2Q2EB 1WJDA 2NS7A 2XDVA 2A6TA 3ABLH 3K69A 1HW1A 2LTPA 4OOIA 4PSWA 4EGZA 4UUSB 4MFDA 4UY8I 5E3MA 4XICA 3MEXA 3TBIA 1I1GA 1LQ1A 3BG5A 4DYCA 1OYYA 3T1BA 2K86A 2HDDA 3MCZA 3S3MA 1A35A 3G1MA 1J9IA 3ZQIA 4IJAA 2O03A 5DM6F 4IVNA 2NVTJ 3P9CA 3NEUA 3BG9A 1U5TC 2B63J 3BR3A 2K9NA 4G6QA 3WTYC 2AS5F 4C2TA 4Y33A 2EB7A 2O0YA 2KHMA 2ELJA 2PX9A 2XKPA 3ASOH 3BTJA 1R4MB 4PJJA 2DA5A 1V5GA 3K4KA 5FKOA 1FSEA 1ACIA 1GLNA 2KDZA 4RM3A 2WY7Q 4EJWA 4EM1A 4Y13A 3S3OA 4F7ZA 3RQIA 3K4JA 5K5OA 1SC7A 1U9OA 1CF7A 3BY6A 3ZQFA 3GFMA 1YE9A 2HYGD 3K4MA 3CUQB 4S0HB 4OMYA 1JUMA 3ZMUA 2DTRA 1IN8A 2VPRA 4CGZA 1B72A 3BTCA 3T0YA 1VQMI 5GTHC 4H0EA 2OUMA 4M6XA 1BI0A 2R5YA 3FMQA 1LUJB 2XIGA 4RGSA 3HSRA 2KFDA 1Q1VA 2CMPA 3BZ6A 2L4AA 2JUGA 3QP5A 3JSPA 4RM2A 1BR2A 4IQJA 3HZJA 2W82A 3CMMA 5M3MJ 1K4SA 3D5SC 3DU5A 4PK4A 1GXPA 1X4PA 2ZXJA 4BNCA 4N4NB 1UELB 1JGGA 5FGMA 4L9VA 3OYBA 2COMA 5HNFA 2K85A 3DPUA 2DI3A 1PYVA 2JT1A 4XLFA 2WWYA 3JRIA 3W6VA 2VL8A 2A5WA 2TDXA 1LE8A 2V9VA 4G7ZF 3WTSC 4I98B 3VYTB 4A3GJ 2R5YB 1G59A 4OMZA 1IZ1A 2XGCA 3TQNA 2O8XA 2V7FA 3DTEA 3WTWC 2A5YB 1FBQA 3K2ZA 3NRVA 2QQ8A 4PDKA 5E79C 2A3SA 1XN7A 3CF5F 1UMQA 1SVOA 2L01A 4L18B 1I50J 1XCVA 2DA3A 3HBLA 3PFIA 2EJRA 2XAUA 2OTLI 3DEUA 3SZGA 5B1BH 3PUFA 3S1NJ 2LREA 5DTDA 2VJ5A 1Z7UA 2WAFA 2BY3A 2A69F 4B48A 2DA4A 1BL0A 4CICA 5ICEA 5E1XA 2BBYA 4C30A 3D1NI 2FA5A 3V7RA 2HVSA 2ZNYA 1XGSA 2ZXHA
chains in the Genus database with same CATH topology
3VYUB 5CQGA 3MKYB 3KEYA 2Y0SA 4E7ZA 4AU7A 3PSIA 2VJJA 4DBRA 2CFOA 2RREA 4XLEA 2L7KA 3OOUA 2CW8A 3PUBA 4XKBA 1X4OA 2E5NA 4YRVA 2PJRA 4R79A 3OYGA 3OS0A 3OYNA 2X6YA 3LSHA 3BC8A 2R7RA 2VQGA 3ZRGA 2JVGA 4BEHA 4P1WA 4F52A 3EUAA 3RSNA 3DKYA 4BDYA 3PNYA 1MMGA 2E1MC 3KYLA 4BS9A 3CJQB 1Z3XA 2M3AA 3HKZA 3MD2A 3VYRB 1YX5A 4E7IA 2VQHA 3H5AA 3GBGA 2NOJB 4HEA2 2BVMA 5CKTA 4RLQA 4CCOA 4PUSA 2M4KA 1V5FA 4BQOA 2M0MA 2HDWA 3OYCA 1LDKB 3HPGA 2IGOA 2XF5A 2L5QA 4U87A 3HOTA 3S3NA 4YEJA 1D1CA 1KONA 1MNDA 4HSRA 4XL9A 2CW7A 3DTIA 2WAQA 2PJRB 3MMYB 2DCEA 3RTRA 4BDZA 2WAEA 1TZLA 3OIQA 4XKCA 3OS1A 1W36D 4PJLA 2Z2SB 1AA7A 3K4LA 4AVZA 2KP6A 2HPIA 3HPHA 1LVKA 1QHGA 2V9KA 1R6RA 2WB1A 2HNHA 3HG9A 3H9JA 2X6WA 3OY9A 3D5LA 3PSFA 4D9JA 4HNUA 2DXIA 3EUKL 1WJBA 1JI8A 4F91B 3FBNB 4E7SA 1K6YA 2ZSHB 2VKDA 3QODA 5LD2C 2R7SA 2W7NA 1Z7LA 2MYSA 4BL0B 2CUJA 4XLAA 3IAS2 3OL4A 3RQ4A 1X1AA 2Q1ZB 3TMOA 2IS6A 2DT7B 2E1MB 4BE2A 4FETA 4XN0A 4F92B 3ZQQA 1SAUA 3L2QA 1D1AA 4B43A 2PMZA 4LG3A 1P9QC 2KPMA 2MC4A 4NNJA 3FKJA 5KHDA 3H35A 5FRMA 1PJRA 4FASD 2XSJC 3RPUD 4CA0A 4BACA 1BR4A 4ANJA 2Z1DA 3BCAA 4CSWA 3IP4B 2XF7A 2QKLB 2F4IA 4MLOA 3H5RA 2BW3B 4CUGA 2MD0A 3AL0B 4HSTA 3S8PA 2IGNA 2KRCA 1QU3A 2LOOA 3QYBA 5FROA 1ZELA 3NWTA 3F9KA 2KMUA 3U21A 3K6GA 1X1CA 2WY8Q 2X6XA 1Y6IA 4XOTA 4NC8A 3VYSB 4D1QA 3OYMA 2BVLA 2GOXB 3LMMA 3ZGKA 1WJ5A 1MNEA 2LY1A 3QOEA 2W4SA 2W00A 3I9V2 4RLFA 2CUZA 3G2BA 1T95A 2HVQA 3CESA 1J09A 4KITB 3OYKA 4XR6A 3QYFA 4ZC3A 1X19A 1Z3YA 2I8DA 2MFZA 4PFPA 2V4JC 2LY2A 3CJRB 3CP8A 4DJAA 2XC7A 2X1CA 3OYJA 2LH9A 2KRHA 2VQLA 3LL7A 3OL3A 2DT6A 2R7QA 2R7WA 2IGKA 3BCBA 3OYFA 3C2GA 4KT6A 3OYHA 2E60A 2CV2A 2GOMA 4Y3OA 4DGWB 1N78A 3W2VA 4II3A 2WADA 2VQCA 2HZDA 2VLAA 5HNHA 4XMYA 2CS3A 3OWTA 3OYEA 1EA3A 3DPTA 4E7HA 1D0XA 2JSPA 3KX2A 3LSKA 5HLTA 1LFPA 1WJFA 1X1BA 2IGMA 3OMYA 4E7LA 4X0GA 3AKZA 4ITVA 3LSIA 4AYBA 3M8JA 4XOPA 2F5VA 4ZTJA 4B47A 4ZJZA 3UNGC 2DJIA 1TT0A 5CPRB 3SYTA 4XM3A 3S93A 4KISA 1WJAA 2UV1A 3PL8A 2DOAA 2RNGA 4N4OB 3PNTA 3M1CA 3AFHA 3K4CA 2K9LA 5CQEA 2BW3A 2VJIA 5FRNA 1BR1A 4HNTA 3H0DA 2UUZA 3VSKA 3OYIA 2CV1A 3L2RA 3HUGB 3E0JB 4JOMA 3ZR8X 1UAAA 4LIVA 3OYAA 1WJEA 4XORA 3NWSA 1QHHD 2VB6A 2VJ4A 4B3XA 3DLAA 4ZDOA 1MW7A 4CH7A 2HVRA 2X1DA 2LC2A 3DTKA 3IUOA 4BU2A 3RCOA 3OR1C 4BXFA 2R7UA 4BGDA 1MMDA 2OC6A 5KCMA 3D5RC 2LBFA 2AQEA 1X1DA 2AQFA 4QPOA 5LFAA 2L9NA 4E7JA 3BG7A 3FDYA 2CH0A 3ONQA 2WBMA 2F6CA 2P0WA 3C2HA 4LITA 4HPQA 4OAZA 2X85A 4QPQA 1UG0A 3OYLA 4Y4RA 4OAYA 3DPLC 2BOLA 3OYDA 3MKWB 2WA0A 1Y56A 5HVQC 4BE1A 3K70D 4RMNA 1D0ZA 4PJMA 1G8XA 3L2UA 3V42A 3K70C 4G6TB 3HXLA 2FUG2 1FMVA 2LRDA 3LFUA 2W1OA 3FBIB 3MKZA 4ZDLA 2UWMA 3H5NA 3N05A 2OV7A 3BLYA 5KNLA 4F55A 1T0FC 2VIXA 3VDXA 1WFXA 4ZDPA 4BQQA 2R4GA 4GRIA 4CCNA 2LBFB 2VASA 1DGWY 4XN3A 3SEZA 4XLHA 4CCLA 4HRIA 2VXDA 1MMNA 4BJ5C 2VPLA 3PFYA 2R7TA 3VSLA 2Q2EB 4IX7A 1WJDA 4P5OA 2XDVA 2A6TA 3HL2A 3I3LA 2M7BA 1OR7C 2R7OA 1HA8A 4PSWA 4CCJA 4E7KA 3DU6A 3TBIA 2R7XA 4NQWB 4XKVA 2IS2A 3K4NA 3L2VA 3VWBA 3S3MA 1DQUA 2HQAA 1Z21A 2L9SA 1LKXA 3ZXSA 4E6KG 2CV0A 3UR3C 2RQQA 3W2AA 2IXSA 4E4HA 2X51A 4C2TA 4Y33A 3W2WA 4PFOA 2KHMA 2ELJA 4CZCA 4LIUA 4BQNA 4PJJA 2K3PA 1V5GA 3K4KA 3LSMA 4IKFA 3QYEA 2R7VA 1GLNA 4DOZA 4RM3A 2WY7Q 3EPZA 3W3CA 2XF6A 2M7AA 3H9GA 3S3OA 2IS4A 3K4BA 3K4JA 3SEQA 3H9QA 5HOOA 3PJRA 4PSXA 4NUBA 1YE9A 3K4MA 2MABA 2K5CA 1DGRM 4BE0A 4F3QA 5JHFA 4YELA 4H4KC 2Z16A 2ZXIA 2E5ZA 2OUMA 2IS1A 1BOBA 2HU9A 3A4CA 3BG6A 2O5RA 3AL0C 2X1EA 4II2A 1U0JA 2JA2A 3DWLE 2CMPA 2ZSIB 4BEHB 2JUGA 1OLTA 3OS2A 3CF2A 1W36C 4RM2A 1BR2A 1VZ0A 4XNFA 4IQJA 2VKHA 2W82A 4JQFA 4PJNA 3CMMA 1FMWA 3A1YA 3TL4X 3FHNA 2K9MA 3EUHC 4XKWA 2QKMB 3E1SA 3D5SC 3DU5A 3LSGA 4PK4A 4OWRB 2V26A 3ZCOA 3HOSA 1E0EA 2LG4A 2V6EA 3J7AY 3CZ6A 3DEEA 1YX3A 4ZYAA 1X4PA 4F93B 1N75A 4N4NB 3L2WA 2VXZA 1UELB 4C2UA 4CCKA 4XQFA 2L2OA 2ZFUA 3OYBA 3OR2C 5HNFA 3DPUA 3HC7A 1PYVA 4BJ6C 4XLFA 2KL4A 3DQVC 4B44A 1D1BA 4DBQA 2VL8A 4ZTFA 2A5WA 4XLCA 4BJTA 2KDOA 3SDBA 1IRXA 3VYTB 2M4GA 1G59A 4C9YA 2KQRA 4J00A 3IAM2 1WJCA 2V7FA 3DTEA 4KJZA 1ERDA 4XONA 3OIPA 4NC7A 3CP2A 1NG7A 3A2KA 1SFKA 3K10A 4EATA 4CCMA 2JVHA 3PNVA 2V1NA 1DP3A 2KZVA 4BUPA 1V5EA 2KLOA 3DKXA 3S32A 4U7BA 2XAUA 2HPMA 1NG6A 4J01A 1D0YA 3SZGA 4IZZA 2LREA 1S9HA 2VJ5A 2WAFA 5TGTA 4DIQA 4B48A 4IQ4A 1N77A 2LYCA 1MMAA 4C30A 2HVSA 4HG2A 2ZXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1M B; 
#chains in the Genus database with same CATH topology
 5FD5 A;  4AWX B;  2W24 A;  3E6D A;  3PSI A;  2K4J A;  1W5S A;  2DK8 A;  4FE4 A;  4DBR A;  1IG7 A;  1LE8 B;  4XLE A;  2L7K A;  1XSV A;  3OOU A;  4XKB A;  1TQP A;  3ERM A;  1ZLJ A;  4BYY A;  4M9X A;  2BXZ A;  2HYF A;  2PEX A;  3OS0 A;  1ZGA A;  2OZ6 A;  5DV5 A;  1RET A;  3TOB A;  1Z0X A;  2MLK A;  2ZNZ A;  4P1W A;  4V2G A;  4F52 A;  3EUA A;  2NYX A;  2ZC2 A;  4A3J J;  4HA8 A;  2FBI A;  3TO7 A;  3J81 K;  1Z6T A;  2CU7 A;  1FPQ A;  2L7F P;  4EM0 B;  3PNY A;  1MMG A;  2STW A;  5CLS A;  3CDH A;  3SZP A;  2IJL A;  1U5T A;  1Z3X A;  2AXL A;  3BG3 A;  3HKZ A;  1SD5 A;  1TW2 A;  3MD2 A;  2ECB A;  3S2H J;  3MFK A;  3ZP5 A;  3H5A A;  1EF4 A;  1MSF C;  3IV5 A;  1WWX A;  2VBZ A;  1ON2 A;  2BVM A;  2J5O A;  1V55 H;  4DNC A;  1CQT A;  2XRL A;  1ZR4 A;  2M4K A;  5H2F C;  2HDW A;  2HOA A;  3OYC A;  2DU9 A;  3HPG A;  2XF5 A;  4EQQ A;  3GW2 A;  1MSE C;  3HOT A;  3CME I;  1TWH J;  3S3N A;  4YEJ A;  5F04 A;  4UB6 C;  1ZAO A;  4YFN F;  4I02 A;  3B6A A;  1O3T A;  3IWZ A;  1YW9 A;  3F6O A;  3A0B C;  3HOW J;  3K9T A;  2DCE A;  1MBJ A;  1UFM A;  1TZL A;  3OIQ A;  4XKC A;  1JKO C;  1AA7 A;  3ZMS A;  4AVZ A;  1YIO A;  2YX7 A;  2L7M P;  2V9K A;  1R6R A;  3ZQH A;  4RGR A;  3BQY A;  3OY9 A;  3JTH A;  4HNU A;  1BJZ A;  1FIA A;  4OIR F;  1JI8 A;  2XPW A;  4F91 B;  1XS9 A;  2MA3 A;  1FYL A;  3V4G A;  1TLH B;  3DBL B;  4E7S A;  2ZKZ A;  1ZGW A;  5HS9 A;  2NNY A;  4A3E J;  1EJ9 A;  2CSO A;  4HYE A;  4GO1 A;  2PFB A;  2F5C A;  3BTI A;  1POG A;  5L3B A;  2IT0 A;  4BL0 B;  3KFW X;  2ESH A;  2OZU A;  3OL4 A;  2JPC A;  3QPH A;  4L5I A;  1W7P D;  1ULY A;  3RQ4 A;  3TMO A;  2IS6 A;  1ETK A;  2MW8 A;  2DFE A;  3WG7 H;  3KZZ A;  4F92 B;  4NDL A;  5D8K B;  1VQ8 I;  3FMS A;  1LPQ A;  2HR3 A;  4FTH A;  3QPL A;  3ELK A;  4AM3 A;  3L1P A;  2KT0 A;  3GCM A;  5B1A H;  2GXA A;  2L7Z A;  2MC4 A;  3HHG A;  3LWF A;  5LEK A;  2E1C A;  1V54 H;  5CVI A;  1LVA A;  5DEQ A;  2PMU A;  4BAC A;  1E17 A;  4YFX F;  4HX4 A;  3BCA A;  1O3Q A;  2N8G A;  2QGU A;  2QKL B;  3FXR A;  4MLO A;  2ID6 A;  3QU3 A;  2OA4 A;  2A68 F;  4KYW A;  1U2W A;  2QSF X;  4HST A;  1YOV B;  3RIR A;  2ELH A;  2HQN A;  9ANT A;  2KRC A;  5A2Q Z;  3ZQL A;  1QU3 A;  5J1Y A;  4WXH A;  4I76 A;  4UXN A;  2E7X A;  3V8L A;  3GEZ A;  5ILV A;  3WE2 A;  1S8N A;  1IF1 A;  2H6B A;  2EFW A;  2JMW A;  1ZH5 A;  4FX4 A;  4A3C J;  4XOT A;  4NC8 A;  2DFF A;  3VYS B;  4D1Q A;  4D5C A;  3OYM A;  3TO6 A;  1U9N A;  3LA3 A;  3IKT A;  1K78 A;  1WJ5 A;  4BHB A;  2M45 A;  1MNE A;  2EV0 A;  4KIB A;  3EDP A;  2LY1 A;  3QOE A;  2W00 A;  1G2H A;  1FZP B;  3I9V 2;  4RLF A;  4M74 A;  1LNW A;  2CQN A;  4LLG F;  4U0W A;  5H6R A;  3WGI A;  3K1N A;  4RBO A;  2QYO A;  1QNT A;  4M9Z A;  4XR6 A;  1VQL I;  2CQK A;  1Z3Y A;  4HNV A;  1TWG J;  3S2W A;  1KZH A;  3CP8 A;  2DMP A;  3CJR B;  2R5Z B;  4DJA A;  5LLQ A;  2LH9 A;  1A6I A;  5JVG F;  2KRH A;  2QA4 I;  1YHQ I;  2DT6 A;  2JN6 A;  1T39 A;  1Z91 A;  3N4M A;  2F2E A;  4KT6 A;  3OYH A;  1QGP A;  2E60 A;  2H6C A;  2CV2 A;  3E6M A;  4DGW B;  2PMH A;  1VI0 A;  2BE5 F;  1FBS A;  2NNN A;  2HZD A;  3S1M J;  5C4J J;  5HNH A;  1I6X A;  2R7Z J;  4UNO A;  1RKT A;  3DPT A;  4MHG A;  1U3E M;  2JSP A;  4N9H A;  3LSK A;  3MZ8 A;  3FXQ A;  1K78 B;  2IA1 A;  5KK1 A;  4ITV A;  2W48 A;  4ZTJ A;  4R8H A;  2DJI A;  1MBH A;  3UKG A;  3SYT A;  2EA2 A;  3HKZ N;  1JT6 A;  2FF4 A;  1WJA A;  2K4B A;  3HEF A;  2DOA A;  4TV7 A;  3CO7 C;  1T8I A;  3M1C A;  4IHY A;  3A02 A;  2EFN A;  4RB3 C;  2Y0M A;  4UHT A;  2K9L A;  3IH3 A;  2BW3 A;  4BY7 J;  3LSR A;  5FRN A;  5FLX K;  1BR1 A;  4IXA A;  5FKL A;  4CO8 A;  4RDU A;  1O57 A;  5D5X B;  1S7E A;  3L2R A;  4KDP A;  2VOP A;  3E0J B;  2F5F A;  1R7J A;  4CDG A;  5EZH A;  1DP7 P;  1YIT I;  3DV8 A;  1H9G A;  2M2E A;  4CZZ A;  2M34 A;  4U7D A;  3NWS A;  1Q1H A;  1DDN A;  1XGM A;  2F48 A;  1FC3 A;  2KIF A;  4B3X A;  2IAI A;  4ZDO A;  4CH7 A;  3M4O J;  2L54 A;  2LC2 A;  1I5Z A;  2P5V A;  3OR1 C;  4BXF A;  1R71 A;  1UHM A;  4BGD A;  4EV0 A;  5IYB J;  2OCC H;  5LFA A;  2L9N A;  4E7J A;  3BG7 A;  2JRT A;  3FDY A;  1DU0 A;  3G73 A;  5B5E C;  2WTE A;  3ZOB A;  2P0W A;  1ODD A;  1R5G A;  1K7A A;  3S1R J;  4OAZ A;  1SAX A;  1KU7 A;  1APL C;  2DMQ A;  4E70 A;  4Y4R A;  1XDU A;  4I2O A;  3DPL C;  1KGS A;  2BOL A;  1ZR2 A;  2W85 A;  2WA0 A;  4FIS A;  1H89 C;  4V19 K;  2ZCW A;  1D0Z A;  2JA6 J;  5BQT A;  1S29 A;  4PCQ A;  2F5E A;  1G8X A;  3L2U A;  1X1P A;  4G6T B;  3L9F A;  3HSE A;  4CYC A;  3H36 A;  4A6D A;  1RUN A;  3FBI B;  1WZ2 A;  1S5L C;  3N05 A;  3ECO A;  3CQZ J;  2RC4 A;  3KYD B;  3BT9 A;  5ICC A;  3K2A A;  3KIO A;  1T0F C;  4F55 A;  4GFB A;  2KIS A;  2TRT A;  3CMA I;  4BQQ A;  2R4G A;  1IGN A;  5JLW A;  1AKH A;  1IN7 A;  2DFI A;  3I55 I;  1O4X A;  2VAS A;  2RNJ A;  4G6D A;  2MG4 A;  2VBX A;  2ZBK A;  4RA2 A;  1QVU A;  3SEZ A;  2H94 A;  3CUQ C;  4XLH A;  3K7A J;  4BHC A;  4B1R A;  4MTD A;  1MMN A;  2QBY A;  4CXF A;  2MGQ A;  1TC3 C;  3GF2 A;  2HOE A;  3VSL A;  4IX7 A;  2YU3 A;  5DCM B;  3I3L A;  2E2J J;  1OR7 C;  1JKR C;  4I0B A;  4CCJ A;  4IRI A;  4HQM A;  4BH9 A;  5J1U A;  4A12 A;  2GQQ A;  3WHB A;  2XV4 S;  2R7X A;  1ZG5 A;  2X6O A;  2HEO A;  3R0A A;  5M3F J;  1GT0 C;  2YS9 A;  1PP8 F;  3LSJ A;  5D5V B;  3F23 A;  4EJT A;  4UVC A;  3E6C C;  1FOY A;  2ME6 A;  4E6K G;  2LKP A;  2CV0 A;  2FML A;  1ZK8 A;  2RQQ A;  3UR3 C;  2H8R A;  2IXS A;  2VE8 A;  3W2A A;  5FLX Z;  2YX4 A;  3GTQ J;  3T5X A;  2E1O A;  2FXA A;  1TW3 A;  3F0C A;  4PFO A;  4RB2 C;  1J59 A;  2DQL A;  1H8A C;  2XKO A;  1D5Y A;  4LIU A;  1MJB A;  3O8G A;  3H1C A;  3LSM A;  1F9N A;  1X3Z B;  3CUO A;  4IKF A;  4DOZ A;  1X3W B;  2K7L A;  2QBY B;  2PQ8 A;  2IS4 A;  1QZE A;  4JX6 A;  1XSX A;  3K4B A;  3CC4 I;  4NHJ A;  3PJR A;  4PSX A;  2IVM A;  2JTV A;  2Y30 A;  5AIP A;  5IY5 H;  2G7H A;  2STT A;  1P7I A;  5C4X J;  2K5C A;  1F5T A;  4CHU A;  5L3E A;  4BE0 A;  4KN4 X;  2ZJQ F;  4F3Q A;  4YEL A;  4H4K C;  4ZH4 F;  2Z16 A;  2VE9 A;  2EIN H;  2HXO A;  3E5Q A;  4GDF A;  2EFQ A;  1R1T A;  3FKI J;  4PGH A;  4HF0 A;  2FOK A;  4ESF A;  2HOS A;  3CC7 I;  1IN6 A;  4WF2 A;  1VQ6 I;  1UCR A;  3G1L A;  1OLT A;  1ETW A;  3CF2 A;  2DYR H;  1QZY A;  4A3M J;  2VKH A;  4JQF A;  4PJN A;  4A0Z A;  3A1Y A;  3ECH A;  3FHN A;  3GXO A;  1FOX A;  2BHY A;  4XKW A;  2QKM B;  1E0E A;  3LSG A;  1QA6 A;  2V26 A;  3CDL A;  3ZCO A;  1P4X A;  6PAX A;  3CZ6 A;  3DEE A;  4ZYA A;  3CCY A;  3TDU C;  3GTJ J;  2L0K A;  2VXZ A;  4HBL A;  4CCK A;  4XQF A;  2Q2E A;  4XSX F;  1Z67 A;  5D8L B;  1TWC J;  2CGP A;  4KUM A;  4EJO A;  3SZT A;  3GWZ A;  4LD5 A;  5E1W A;  2HYJ A;  3DQV C;  4B44 A;  2GLO A;  1ZN2 A;  4ZTF A;  2XAJ A;  2DFH A;  1GHC A;  3CCV I;  2VN2 A;  4C3I J;  2QSH X;  4FQG A;  4MO7 A;  1YLF A;  5C3E J;  1O7F A;  4J00 A;  1FLI A;  1WJC A;  1YFH A;  2FU4 A;  4KJZ A;  3AG1 H;  4XON A;  1YRN B;  1TT5 B;  2FNA A;  5F6F A;  3CP2 A;  1ERD A;  3LA7 A;  2QWW A;  3D0S A;  4IRG A;  1SFK A;  3A2K A;  3FIW A;  4EAT A;  4CCM A;  1IJW C;  1ZRE A;  4LLL A;  2V1N A;  5JLX A;  2ZJ2 A;  1DP3 A;  1P4A A;  5LRR A;  3KP4 A;  2KZV A;  3FIS A;  2HXI A;  2TCT A;  2F5D A;  3S32 A;  4I6Z A;  1MMS A;  2QM3 A;  1OYW A;  3CMY A;  1RPW A;  5IP7 J;  3JRA A;  1G3S A;  4IZZ A;  2IA2 A;  2FBK A;  1S9H A;  2K40 A;  2P5K A;  2V1X A;  1MMA A;  1JUP A;  3IRQ A;  1RC9 A;  3FM3 A;  3V7S A;  1WI9 A;  4LK1 F;  3WTX C;  2Z9O A;  3VYU B;  3MKY B;  2Z3Y A;  3KEY A;  4IRH A;  3SQN A;  3GTP J;  2L02 A;  1OQY A;  3CUQ A;  3TP0 A;  2VJJ A;  3DEW A;  3KZY A;  5GPC A;  2DMN A;  3SFI A;  3ASN H;  1RIO H;  1KU9 A;  4C3H J;  2CW8 A;  5LHH A;  4DYQ A;  2NS0 A;  1X4O A;  3NQO A;  2E5N A;  3HYI A;  5D4R A;  5DD8 A;  4YRV A;  2WV1 A;  1OR7 A;  1JT0 A;  1R5H A;  3IHU A;  1HLV A;  1TL8 A;  3OYG A;  1LDD A;  4A93 J;  2X6Y A;  3LSH A;  3BPX A;  5JHU A;  3HSF A;  3R0J A;  3B02 A;  4A0Y A;  1JXS A;  3U1K A;  3RSN A;  1XD7 A;  3FHZ A;  3KET A;  2QQ9 A;  3DKY A;  4BDY A;  3IL2 A;  4MIM A;  2M87 A;  1IO2 A;  1XG1 A;  2MC3 A;  1HW2 A;  4LB5 A;  1S6L A;  3FK6 A;  3X2Q H;  4BS9 A;  3CJQ B;  2DMU A;  4ZYD A;  4IHW A;  4GCV A;  2UXX A;  1MDM B;  2EIL H;  4L9T A;  1MJ9 A;  2MSY A;  1OMI A;  1S72 I;  1MGT A;  2ZB9 A;  3HOX J;  5IT9 Z;  4CCO A;  4RLQ A;  1I39 A;  5FJ8 J;  1FT9 A;  1JTY A;  2M0M A;  3CTA A;  1MBK A;  1P92 A;  4PGG A;  5F1R A;  2L5Q A;  4CYD A;  4U87 A;  3PQJ A;  1EH6 A;  4W1U A;  1D1C A;  3RYP A;  2XB5 A;  1R22 A;  5TJJ A;  4FT8 A;  1MIJ A;  4HSR A;  3CCR I;  2CW7 A;  3DTI A;  2DOF A;  1HOM A;  3HM5 A;  3EYI A;  5J4Y A;  3OS1 A;  2M0C A;  2GBY A;  2LD5 A;  3FXL A;  3K4L A;  1ETX A;  3HPH A;  1VQ7 I;  3RPQ A;  2DA2 A;  4HX7 A;  2RQP A;  3HG9 A;  4RAF A;  3TP3 A;  2DK5 A;  3PSF A;  4W97 A;  3EUK L;  1WJB A;  5JFR A;  1IN5 A;  3TKY A;  5IYC J;  1HC8 A;  1ZG1 A;  1UZC A;  4EVI A;  1Z7L A;  5ERI A;  2DTZ A;  2LP0 A;  3RYR A;  4XLA A;  1Z6R A;  3IAS 2;  3BOQ A;  3C2B A;  1X1A A;  3KE2 A;  5EF6 A;  1AOY A;  3DF8 A;  3V8J A;  1Y0N A;  5ILU A;  1BC8 C;  2FQ4 A;  1B9N A;  1ZGJ A;  3KCC A;  1QO0 D;  4BHP A;  4WWC A;  3S16 J;  3F8N A;  5EZG A;  3BJO A;  3ZQQ A;  5GAG J;  1SAU A;  3JW4 A;  1KA8 A;  2MH2 A;  3L2Q A;  3GZ5 A;  3W6J B;  4R1H A;  2D45 A;  1OKR A;  1P9Q C;  2IP2 A;  1C0W A;  1FP1 D;  1N25 A;  4NNJ A;  3FKJ A;  5KHD A;  3FK7 A;  1FSH A;  3P5J A;  4CA0 A;  3AG3 H;  1HDD C;  4ANJ A;  3IKV A;  3RDI A;  2DDB A;  4XID A;  4CSW A;  3IP4 B;  2XF7 A;  5F1J A;  3A0H C;  3J7Y J;  1D5V A;  2AXT C;  4ENN A;  3IWF A;  1LJ9 A;  4AID A;  4CUG A;  2MD0 A;  5K5Q A;  2EZH A;  5M5W J;  4ENK A;  1TP4 A;  5FKK A;  1IUY A;  1WQ2 A;  4DYR A;  2JQ7 A;  4D7N A;  2A6H F;  2KIU A;  4L5J A;  3NWT A;  3VB2 A;  4UUV A;  2KMU A;  3RPU A;  3GVA A;  1X1C A;  5IYD J;  2X6X A;  4U0V A;  1Y6I A;  2XB0 X;  1BN5 A;  1IAW A;  1WHU A;  3T8R A;  3K0L A;  3QU6 A;  1F36 A;  5HLI A;  5IOY A;  5DUK A;  3J80 Z;  4P9F A;  2W4S A;  1XMA A;  2BY0 A;  2EA4 A;  1YO5 C;  3PO2 J;  1OCC H;  2XVC A;  4XLN F;  3LAJ A;  1TNS A;  3H0G J;  3CCS I;  3KZI C;  4KIT B;  1FOW A;  2W84 A;  3QYF A;  5A2Q K;  1X19 A;  4BBR J;  4PFP A;  3ROU A;  2LY2 A;  3CJN A;  2XC7 A;  3OYJ A;  2XGD A;  4NC6 A;  3QWL A;  3LL7 A;  1B6A A;  3JCU C;  2RN7 A;  1WRJ A;  1EH8 A;  2IGK A;  3BCB A;  2EV5 A;  1GDT A;  3FM5 A;  1ZKG A;  1S7O A;  2GOM A;  2GAU A;  1TNT A;  3GUD A;  4MEX F;  3W2V A;  4ABZ A;  1RES A;  1R00 A;  5BOX A;  4ENM A;  3ULQ B;  2VLA A;  1JHH A;  1SVL A;  4XMY A;  3KEQ A;  1W4M A;  3OWT A;  3OYE A;  1YS7 A;  2G0E A;  1UHW A;  2ZME C;  1SD6 A;  2QQA A;  4G8X A;  5HLT A;  1XMK A;  2V79 A;  1J0R A;  2NXN B;  4NBQ A;  2IGM A;  3B6C A;  2KJB A;  4X0G A;  4KMF A;  3WU1 B;  2GM4 A;  3M8J A;  3VOE A;  1EV7 A;  2F5V A;  1E3O C;  1T56 A;  4IEJ A;  3UNG C;  4HDV A;  5EJC A;  5CPR B;  5J6X A;  4XM3 A;  3ZPL A;  3G4S I;  4KIS A;  4RGU A;  1G3Y A;  3H3V K;  3Q9S A;  1IXC A;  2EV6 A;  3AG2 H;  3PNT A;  4RAZ A;  4BQA A;  2DA6 A;  1MKM A;  5LGN A;  1FWZ A;  2IEK A;  2XGX A;  3AFH A;  5CQE A;  1SD4 A;  2VC1 A;  3TO9 A;  2RKH A;  2HZT A;  1T33 A;  4JX5 A;  4HNT A;  3CCQ I;  2UUZ A;  2COB A;  2FX0 A;  3K1M A;  3VSK A;  3HUG B;  4ESJ A;  4M9S A;  3ML6 A;  3OYA A;  2GXG A;  3FWE A;  1GV5 A;  1S3J A;  1BOA A;  2H09 A;  5K7Z A;  2VJ4 A;  3Q5F A;  1JUS A;  2KRF A;  2EK5 A;  2LNB A;  2JUC A;  2LFB A;  4JK1 X;  4I7H A;  4BU2 A;  2BZT A;  3I53 A;  2R7U A;  1MBE A;  3ZQC A;  3OSF A;  2ZJR F;  2NS8 A;  3MN2 A;  5LHG A;  2AQE A;  3GTL J;  2CYY A;  5EEG A;  1WI3 A;  5DD4 A;  2MH9 A;  2H1L A;  2F6C A;  1MJA A;  5DYM A;  3LSP A;  3FXO A;  3OSG A;  1B8I A;  4LB6 B;  2R5Z A;  2G7U A;  2GA1 A;  3OYL A;  2HQ5 A;  4MQ9 F;  4OAY A;  2FRH A;  3OYD A;  4A5M A;  1QPI A;  5HVQ C;  2E35 A;  3EYY A;  5BNG A;  4BE1 A;  1I27 A;  2E2I J;  2DBB A;  3HRU A;  2QUF A;  4NQW A;  4RMN A;  1AHD P;  2LLK A;  1HCR A;  2HS5 A;  4PJM A;  4HLY A;  2H8W A;  3I4N J;  1ETO A;  2JA5 J;  3V42 A;  4N0B A;  3KLO A;  4HZF A;  4B4C A;  2LRD A;  2OJE D;  2F4O B;  2W1O A;  3MKZ A;  1KQ9 A;  4KNY A;  1OCZ H;  3H5N A;  2UWM A;  2OV7 A;  5IP6 A;  5IP9 J;  1BA5 A;  2XAQ A;  2QQB A;  3BLY A;  3PIP F;  1ONV A;  3VDX A;  4J19 A;  4UUT A;  1R1V A;  1WFX A;  2CO5 A;  2EIJ H;  3OIO A;  4JBA A;  2DO7 A;  2G9W A;  5B3S H;  3O8H A;  3Q0U A;  3KP2 A;  5F64 A;  1DGW Y;  3A03 A;  3JRD A;  2EQR A;  2IBD A;  1P4W A;  2E19 A;  4I01 A;  2Y9Z A;  1YYV A;  3GFI A;  5FKN A;  1DPU A;  2Y75 A;  1B8I B;  1J75 A;  5FLV A;  4P5O A;  1KQ8 A;  2M7B A;  3F8B A;  1BIB A;  1X2M A;  4D0P A;  2EIM H;  1HA8 A;  2V9P A;  2H1K A;  2V6C A;  4E7K A;  1EH7 A;  4IL6 C;  1RKW A;  3F6V A;  3F8M A;  4HAM A;  2A05 A;  1VQ5 I;  4NQW B;  2E36 A;  4XKV A;  2IS2 A;  3L2V A;  1LFU P;  1R1U A;  3KEO A;  1FOK A;  1KU2 A;  2GA2 A;  2UZK A;  3BPV A;  1BW6 A;  3WOD F;  1PUF B;  1DU6 A;  4AIJ A;  2HQA A;  1NHA A;  1Z21 A;  4G7H F;  2LF7 A;  1QPM A;  3BJ6 A;  2X51 A;  1F1Z A;  1O3R A;  3W2W A;  4QSH A;  4Q5S F;  4JX4 A;  4CZC A;  1BBY A;  1BM9 A;  1GXQ A;  4IHT A;  2K3P A;  2QZ8 A;  5F0H A;  1K6O A;  2PN6 A;  3W3C A;  3JAM Z;  5CYV A;  2ZME A;  2M7A A;  1XC5 A;  1SAN A;  4HOB A;  2OQG A;  4KN7 X;  2RV8 A;  5AON A;  3H9Q A;  2DT5 A;  5HOO A;  4Q4Z F;  4NUB A;  2NVU B;  2BY2 A;  2BGC A;  3ZMT A;  2C6Y A;  5DS9 A;  2HTS A;  4P9U A;  4GXO A;  1QZZ A;  1HQC A;  5HDK A;  2ZXI A;  2E5Z A;  4EJU A;  3DKW A;  1BOB A;  4G94 A;  3BG6 A;  2O5R A;  3AL0 C;  1V3F A;  1WH7 A;  1JKP C;  1IRG A;  4QWQ A;  1U0J A;  2JA2 A;  3C1D A;  3DWL E;  1FJL A;  2PI0 A;  1MZB A;  4BEH B;  4AVP A;  5TRD A;  1W36 C;  1R36 A;  1DUX C;  2P5L C;  2QLZ A;  4HV5 A;  4AUX A;  3DXJ F;  2DQR A;  3G6E I;  2K9M A;  3E1S A;  5E1Z B;  1MBF A;  3L7W A;  2DA7 A;  3LQQ A;  4Q47 A;  2O61 A;  1FY7 A;  1YX3 A;  1BC7 C;  2ZME B;  4F93 B;  2GZW A;  1N75 A;  2RAE A;  1I1S A;  3L2W A;  3CO6 C;  5HOD A;  3C3W A;  3M7G A;  2PJP A;  2P6T A;  2VBW A;  3GME A;  5DCM A;  1J2X A;  2FBH A;  4WX9 A;  4LG0 B;  1VQK I;  3ABK H;  3BJA A;  3MZH A;  4KMU X;  3HC7 A;  4BJ6 C;  3JRE A;  3M3Y J;  1I3Q J;  4DBQ A;  2D1H A;  1P6R A;  4XLC A;  3SDB A;  2M4G A;  3AAF A;  4C9Y A;  4MTE A;  4L9N A;  2EZK A;  1Y8R B;  3CC2 I;  3J7A O;  2LR8 A;  3OIP A;  3RI4 A;  1NG7 A;  2OD5 A;  2JVH A;  2DOD A;  4M3E A;  3ESW B;  4M3F A;  3GTO J;  4AIK A;  3BZC A;  4Q48 A;  1IDZ A;  2X0L A;  4S05 A;  3T8T A;  2NOG A;  5LGT A;  1RR8 C;  1VQ9 I;  1VQP I;  2HPM A;  1NG6 A;  4J01 A;  1D0Y A;  1AWC A;  1K61 A;  4OU0 A;  3E97 A;  5EGO B;  4FE7 A;  4KIC A;  4C3J J;  4A3F J;  3KP6 A;  5TGT A;  5E8G A;  2VI6 A;  1USS A;  3ZQG A;  1YW8 A;  5B66 C;  4IQ4 A;  1N77 A;  1LDJ A;  2LYC A;  3FMR A;  3F8F A;  3LNQ A;  5BMZ A;  5E17 F;  1U8B A;  1SEU A;  4IF4 A;  1L0O C;  1GVJ A;  1XX5 A;  5CQG A;  2Y0S A;  3TOA A;  4E7Z A;  3S1Q J;  3GO5 A;  4AU7 A;  4A3D J;  1NK2 P;  4UVB A;  1MBG A;  2Q0O A;  1JKQ C;  1A36 A;  5FFZ A;  3OOP A;  3PUB A;  2A07 F;  2B7E A;  3LFK A;  4LMY A;  3I58 A;  1Y1W J;  1HKS A;  3BQZ A;  5E20 A;  3ZMZ A;  3BDD A;  4R79 A;  3M9A A;  4A3I J;  3I4M J;  3BC8 A;  1XMX A;  2K9S A;  3NAR A;  3U9G A;  3BR5 A;  4Y17 A;  3KP3 A;  5E3O A;  2EPF A;  1H88 C;  2CUF A;  1OFC X;  3BR6 A;  3NAU A;  1F43 A;  4WXD A;  2H27 A;  3A01 A;  4V2F A;  5F0C A;  3MVP A;  4HW0 A;  2ESN A;  2JRM A;  2QSG X;  4E7I A;  5F27 A;  2VQH A;  3GBG A;  3GLX A;  5EG0 A;  2NOJ B;  4A6E A;  4IHV A;  2K02 A;  3CCJ I;  1MD0 A;  1Z05 A;  4BQO A;  3I71 A;  3Q0V A;  1XDS A;  2VT3 A;  2IGO A;  4HX8 A;  4DW6 A;  2DPD A;  4EJV A;  1KON A;  5EEA A;  2BYV E;  3CJT B;  4KIG A;  1KU3 A;  4NB5 A;  3SDG A;  2Y69 H;  2BY1 A;  3FZV A;  3MMY B;  3HGY A;  2K9Q A;  4PJL A;  1YRN A;  2HI3 A;  2Z2S B;  3BR2 A;  2HPI A;  2WV0 A;  1LVK A;  1QHG A;  2WB1 A;  3H9J A;  2X6W A;  2DPU A;  5IT9 K;  1YS6 A;  3M1E A;  2VKE A;  3D5L A;  3GTM J;  4KA4 A;  2DXI A;  4MNU A;  2R93 J;  2YU9 J;  3A01 B;  1ON1 A;  2VKD A;  2R7S A;  1OPC A;  1SFE A;  3JRG A;  5ICG A;  1XTA A;  4A3K J;  5EG0 B;  4G12 A;  3ZN0 A;  2Q1Z B;  1X3U A;  2FMY A;  4PJ0 C;  4A5N A;  2DT7 B;  3N97 A;  1WSU A;  2E1M B;  3G3Z A;  4IO9 F;  3KP7 A;  1B9M A;  4BXU A;  1SMT A;  3MZY A;  5J3L A;  2JA7 J;  2NVQ J;  1XGN A;  3RKX A;  5L3G A;  1L3L A;  5E8I A;  5GPA A;  5J40 A;  1D1A A;  4B43 A;  1ZTR A;  2PMZ A;  4G9Y A;  4XRM A;  1D3Y A;  5EYR A;  5GP9 A;  3L09 A;  3H35 A;  2MBF A;  2FOW A;  1LB2 A;  4FAS D;  5FRM A;  3G1O A;  2XSJ C;  4A0X A;  5KAF C;  3RPU D;  2P7V B;  2DDA A;  1W5C C;  2F4I A;  3H5R A;  1BW5 A;  3E5U A;  3LQR A;  3AL0 B;  3SFZ A;  2CQ7 A;  3ZN1 A;  2NAZ A;  2LOO A;  3QYB A;  4BY1 J;  3WTZ A;  1MDM A;  1R5I D;  3QAH A;  4FHT A;  2CRG A;  3F9K A;  1LEA A;  2ECC A;  1T0F A;  2A6E F;  1P2F A;  5ILS A;  5HLG A;  1W0T A;  5D6F A;  4FX0 A;  2R7D A;  4I0A A;  2GOX B;  5M5Y J;  1LFB A;  1MH4 A;  1GV2 A;  2F4M B;  2HKO A;  3RKQ A;  1R23 A;  2K3F A;  4G7O F;  1KYZ A;  3TW6 A;  2FD5 A;  1KYW A;  4HDU A;  2P8T A;  3G2B A;  1T95 A;  2HVQ A;  3CES A;  1J09 A;  4RAG A;  2XRO A;  3RZD J;  2RGV A;  1IN4 A;  1B59 A;  3VPR A;  2I8D A;  2MFZ A;  2V4J C;  4DQ2 A;  2W57 A;  1ZQ3 P;  1Y39 A;  2MLG A;  2VQL A;  1ZLK A;  3ABU A;  1IRZ A;  3OL3 A;  5E3N A;  2VKV A;  2R7Q A;  5FO5 A;  1X2N A;  1VQN I;  1ZRF A;  1I3A A;  1YG2 A;  3C2G A;  1HSJ A;  2D1V A;  2Y0S N;  3PQK A;  1OCT C;  1O7L A;  1YJN I;  1TBX A;  4WK8 F;  3P9I A;  3J80 K;  1K4T A;  5LRS A;  1N78 A;  2HWV A;  3GTG J;  2WAD A;  2VQC A;  2YSR A;  1GVD A;  2YR2 A;  1BJA A;  1EA3 A;  1OCP A;  5LEJ A;  1D0X A;  1UST A;  3S15 J;  2VT2 A;  4RGX A;  1RI7 A;  1LFP A;  3GX4 X;  1X1B A;  2E71 A;  4YIF A;  3OMY A;  3I54 A;  4BBS J;  2CW0 F;  3K1P A;  4EGY A;  1AU7 A;  4AYB A;  4XOP A;  4ZJZ A;  2FQ3 A;  5HS7 A;  1XSD A;  1ITY A;  4U88 A;  1CGP A;  4UV9 A;  2E34 A;  4M6Y A;  1Z1D A;  2XGE A;  1ETV A;  1W0U A;  3PL8 A;  3HOV J;  3JRC A;  4N4O B;  5AIQ A;  2JJ7 A;  1TWF J;  2JWT A;  1UG2 A;  1D8K A;  3PM1 A;  3H0D A;  3OYI A;  2CV1 A;  3HTS B;  3HOZ J;  4K2E A;  1IUF A;  3ZR8 X;  1UAA A;  1HKT A;  4LIV A;  4YFK F;  2LSO A;  1IRF A;  1EKE A;  2M9H A;  2D2W A;  1QHH D;  3ABM H;  2FE3 A;  1BI1 A;  3DLA A;  3QP6 A;  2LKX A;  1MW7 A;  2W25 A;  5CVR A;  2HVR A;  4PZJ A;  2XAH A;  3MAJ A;  1G3T A;  1G3W A;  2X1D A;  3DTK A;  3IUO A;  4KFC A;  1WVR A;  2WB1 N;  3M8E A;  1SFX A;  2JPB A;  2OC6 A;  3RKY A;  5KCM A;  5IPA A;  5FB2 A;  2M5W A;  2OPT A;  2LBF A;  3D5R C;  2XHK A;  1FEX A;  4KT5 C;  5JVT A;  2ACJ A;  3ONQ A;  5TIS C;  5J4V A;  1IDY A;  3C2H A;  4LIT A;  1A6Q A;  1CF7 B;  4HPQ A;  4HF2 A;  2X85 A;  1I6H J;  2DLL A;  1UG0 A;  2HQR A;  2I5U A;  3FXM A;  2XUB A;  5D5W B;  2O9L A;  4B8X A;  3MKW B;  1STZ A;  2VBY A;  5CVV A;  1S7A A;  5D4S A;  1B72 B;  3WU2 C;  3BWG A;  2OCE A;  3RJP A;  3CCM I;  2PMZ N;  2ADU A;  3HRT A;  5HDG A;  2HTJ A;  4OIN F;  4Y7N J;  4BXX J;  3LFU A;  1XPX A;  2K27 A;  2XAF A;  4OIQ F;  4ZDL A;  1FIP A;  3JRF A;  1J5Y A;  4ESB A;  1JE8 A;  2VC0 A;  4Z2Y A;  4U0Y A;  3GLL A;  4JYK A;  5KNL A;  2BHZ A;  2VIX A;  1X58 A;  4ZDP A;  3GFL A;  3CD6 I;  2EFP A;  4JP0 A;  5E18 F;  3WTU C;  4ZZL A;  2GIV A;  2M1B A;  2LBF B;  1H0M A;  4XN3 A;  1TQM A;  3C18 A;  4B3A A;  1IXS B;  4CCL A;  4HRI A;  1FX7 A;  5ED4 A;  1OYI A;  3PFY A;  2R7T A;  4M73 A;  2IW5 A;  5M5X J;  3HL2 A;  2NVX J;  2R7O A;  1IV8 A;  4BAY A;  3I4P A;  4XRS G;  5DDG A;  3KYC B;  1XB4 A;  3DU6 A;  2P6S A;  1RR7 A;  3R60 A;  2EZL A;  3K4N A;  3VWB A;  3HUG A;  2JZY A;  3W6K B;  1G6N A;  5LHI A;  4L0Y B;  3BTL A;  1WGX A;  4AIH A;  1DQU A;  3I5U A;  4ETS A;  2L9S A;  1VFC A;  1LKX A;  3ZXS A;  3Q0W A;  1ZYR F;  4C2M J;  4HQE A;  3VFZ A;  4E4H A;  4IPA A;  1OCO H;  4AD9 A;  4XRF A;  1B1B A;  2D5V A;  4I99 C;  4BQN A;  4P96 A;  2R92 J;  3PO3 J;  1MH3 A;  2B9S A;  5GAD J;  3QYE A;  4M72 A;  4IOC F;  2R7V A;  4D7M A;  2LY9 A;  4XSZ F;  5J1R A;  1ETY A;  3EPZ A;  4ZYG A;  2XF6 A;  4A3B J;  1ZRD A;  2XAG A;  3H9G A;  1F4K A;  3GFJ A;  1UJ8 A;  4ON0 A;  4EEF G;  5LGU A;  3GTK J;  3S17 J;  3SEQ A;  2CWE A;  3RKW A;  1HST A;  2Y31 A;  2IPQ X;  3JRB A;  1YTY A;  2MAB A;  3CCU I;  1IC8 A;  5GAE J;  1FTZ A;  2EH3 A;  5H6Q A;  1DGR M;  1FBU A;  1QVT A;  5JR3 A;  1W1W E;  2ISY A;  2XRN A;  5JHF A;  2KKO A;  4ENJ A;  1BI3 A;  1WKM A;  2RDP A;  4HF1 A;  3LOC A;  3SHF A;  4AYB N;  2ME0 A;  5CVJ A;  1T6S A;  3JTG A;  2IS1 A;  4O6J A;  1JGS A;  2HU9 A;  3A4C A;  2CG4 A;  3SJM A;  1JJ6 C;  2ELK A;  3P7N A;  2X1E A;  4II2 A;  3F21 A;  3JAM K;  4M3G A;  2ZSI B;  4EMS A;  4UB8 C;  2R0Q C;  3QRF F;  3OS2 A;  2DOE A;  3LAP A;  2Y9Y A;  5CVU A;  3TW7 A;  1VZ0 A;  1ZG3 A;  4XNF A;  1HKQ A;  1RNL A;  5D5U B;  3VOD A;  4EM2 A;  1FMW A;  3TL4 X;  3GYH X;  1IXR C;  3EUH C;  1QRY A;  1J7K A;  3HOS A;  4OWR B;  1U5T B;  1FP2 A;  2LG4 A;  2V6E A;  3J7A Y;  3IRR A;  2Y2Z A;  2KJC A;  4ASN A;  1VND A;  1T2K A;  1V4R A;  1QBJ A;  4L0Z B;  2ZFW A;  2P4W A;  2WC2 A;  1YQA A;  1YIJ I;  4C2U A;  2R3S A;  1T98 A;  5EEH A;  3RZO J;  2L2O A;  2MD5 A;  2ZFU A;  4WXC A;  4MEY F;  4M6V A;  1QQI A;  3OR2 C;  4N9I A;  2DYS H;  1R58 A;  1VQ4 I;  3I0T A;  4M71 A;  1SMY F;  2ICW G;  2KIM A;  2JSC A;  2KL4 A;  3KLN A;  1D1B A;  4BJT A;  4FCY A;  3FF5 A;  2KDO A;  3P9K A;  3ABT A;  1IRX A;  1HF0 A;  2OF7 A;  2KQR A;  1PUF A;  5GAH J;  3IAM 2;  2QVO A;  1NTC A;  4NC7 A;  2GIZ A;  3K10 A;  3ISP A;  3WU0 A;  2QF7 A;  2FJ1 A;  3PNV A;  2DN0 A;  5EDN A;  3CCL I;  2L4M A;  2PBI A;  1ZAR A;  3E3V A;  3HJE A;  1IW7 F;  2BV6 A;  5BPI A;  4BUP A;  3DKX A;  1V5E A;  2KLO A;  4AC0 A;  4U7B A;  1YI2 I;  1H9T A;  3DBH B;  3BR1 A;  3VEP A;  3TDZ C;  1JHF A;  2EZI A;  2FEZ A;  4HLX A;  1TQI A;  1R4N B;  3IC7 A;  4L5E A;  5E3L A;  3ZMD A;  4DIQ A;  1GUU A;  5FLM J;  3KPH A;  1BIA A;  3SXY A;  2VUM J;  1T08 B;  1WPK A;  1P7J A;  2Y48 A;  4RS8 A;  2LKS A;  4HG2 A;  3J81 Z;  1Y0U A;  4YIR X;  5DCF A;  1PP7 U;  3V7C A;  1M1E B;  4M3D A;  2CFO A;  2RRE A;  5KVR A;  3ZMV A;  4KIF A;  5L3D A;  3EET A;  2VOD A;  1DPR A;  4P55 A;  4GYG A;  1FYK A;  5FFX A;  4OIO F;  1E3H A;  1RUO A;  2PJR A;  2QEN A;  3OYN A;  3C7J A;  1TWA J;  4LK0 F;  3LST A;  2XPU A;  3QPS A;  2R7R A;  2VQG A;  3ZRG A;  2JVG A;  4BEH A;  5L3F A;  2OTJ I;  2FNP A;  3KP5 A;  1OJL A;  3CLQ A;  3R61 A;  3L00 A;  5IT3 A;  5GTI C;  5J8F A;  3PIO F;  1HDP A;  2IRF G;  5IOZ A;  4A2U A;  2E1M C;  3JR9 A;  3KYL A;  2YUS A;  2BEO A;  2EFO A;  2CQQ A;  2M3A A;  2BXY A;  2L9V A;  4LOC A;  1B4A A;  2Z99 A;  1MNM C;  4GGG A;  4O5V A;  1YX5 A;  2UXN A;  3VYR B;  2NRA C;  2Q8K A;  4DZJ A;  4X1E A;  3I64 A;  4HEA 2;  3EQL F;  5CKT A;  4PUS A;  1T38 A;  1V5F A;  3BR0 A;  2LMD A;  4LG0 A;  3QPT A;  1LDK B;  1E2X A;  2O8K A;  4YG2 F;  2P7C B;  5K7H A;  2DAO A;  3OV8 A;  3Q3S A;  1O3S A;  1RZ4 A;  2HFH A;  1MND A;  3MQ0 A;  3FXK A;  3DFG A;  4XL9 A;  5J47 A;  2WAQ A;  3GZN B;  2PJR B;  3RTR A;  4BDZ A;  2WAE A;  5J8C A;  2YPR A;  2KZG A;  1W36 D;  1U78 A;  4B09 A;  1YJW I;  2KP6 A;  3QOP A;  1JTX A;  5KAI C;  3HOU J;  2HNH A;  4D5F A;  2AHQ A;  3DBR B;  4QLC U;  4D9J A;  1PDN C;  3FX3 A;  2HOT A;  2VON A;  3H3Z A;  2L9R A;  5BS6 A;  2EBI A;  3FBN B;  4QTR A;  1R49 A;  2CQX A;  1K6Y A;  2ZSH B;  3TED A;  3QOD A;  3DP7 A;  5EGO A;  5LD2 C;  1PUE E;  5F08 A;  2W7N A;  2DW4 A;  1E3P A;  2MYS A;  3L2C A;  4S04 A;  2CUJ A;  2EIK H;  1ZHF A;  1NK3 P;  3IH4 A;  3WG9 A;  3EUH A;  4BE2 A;  2A61 A;  4FET A;  4XN0 A;  3E6B A;  4I09 A;  2NVY J;  4X6A J;  4A3L J;  5K5R A;  2O3F A;  4LG3 A;  4ZYH A;  4IHX A;  5FD6 A;  2I10 A;  1U8R A;  1SFU A;  2KPM A;  4XBF A;  1ZRC A;  4BKX A;  3E7L A;  1PJR A;  5K7F A;  1OIS A;  1W7P A;  1BR4 A;  2JA8 J;  4M3B A;  1OCR H;  2Z1D A;  2ISZ A;  4YII A;  1UHS A;  3TGN A;  3O6B B;  1W5T A;  4MFE A;  5CJ9 A;  2BW3 B;  5LBQ A;  3MKL A;  4ZYE A;  4XRS A;  3S2D J;  3S8P A;  3JSO A;  2IGN A;  3U1D A;  3AG4 H;  4UV8 A;  3G71 I;  3HB9 A;  1ZEL A;  5FRO A;  4GYI A;  1LEB A;  3U21 A;  1IV6 A;  1HXD A;  3K6G A;  2WY8 Q;  2FSW A;  2ETH A;  2LDU A;  4QIW N;  1A5J A;  2BVL A;  2E7W A;  3B73 A;  3LMM A;  1R9T J;  3BP8 A;  3ZGK A;  3U2R A;  4ZZD A;  2AO9 A;  1TTY A;  3HIF A;  2CUZ A;  1BI2 A;  1FYM A;  3WE3 A;  2PLY A;  4IOA F;  3Q9V A;  2LF8 A;  4LJZ F;  3OYK A;  5FKM A;  1K83 J;  4ZC3 A;  1W7P B;  2O7O A;  2OAZ A;  1HW5 A;  3HOY J;  1ENH A;  1Y1V J;  5DUI A;  2X1C A;  3I59 A;  4DZP A;  2XAS A;  3HTU A;  5L3C A;  1VTN C;  4OIP F;  3M07 A;  2ZO4 A;  1XCB A;  2QEX I;  2R7W A;  3OYF A;  4UVA A;  2CUE A;  2R7F A;  4Y3O A;  2CFX A;  4II3 A;  3WGH A;  4CYC B;  4IHS A;  5HLH A;  2RVC A;  3F72 A;  2CS3 A;  2M8G X;  1YJ9 I;  1UB9 A;  4E7H A;  5HDN A;  3KX2 A;  4RAY A;  2P81 A;  3MWM A;  2ZJP F;  3E5X A;  1G4D A;  1PVE A;  3COA C;  1WJF A;  2HKX A;  2M30 A;  2XPV A;  3M8F A;  2OU2 A;  4E7L A;  3O2P E;  3AKZ A;  5K1Y A;  3WGG A;  1SFO J;  3LSI A;  2V1D A;  1AKH B;  4B47 A;  3REO A;  2X9D A;  1TT0 A;  2OQR A;  2X48 A;  2E2H J;  4LLN A;  1WCM J;  2Z5U A;  3R4K A;  5D6E A;  3S93 A;  4A69 C;  2LK2 A;  2UV1 A;  3ZQ7 A;  4RB0 A;  1FNN A;  2RNG A;  1KQ0 A;  3HDD A;  3F22 A;  3WTV C;  3I59 B;  2GWR A;  5JI6 A;  3WHC A;  1Z9C A;  1VF9 A;  3K4C A;  1VQO I;  2QCO A;  3DLL F;  3S14 J;  1YW7 A;  2VJI A;  5C44 J;  1D8J A;  2ZXW H;  2VOO A;  2DJN A;  2IA0 A;  3F8C A;  4JOM A;  3I56 I;  2O6G E;  2Z33 A;  1WJE A;  2B0L A;  4L9J A;  3IH2 A;  4XOR A;  3HHH A;  2WAQ N;  2VB6 A;  3O3K A;  1RRJ A;  3H3U A;  1SVM A;  2OBP A;  3CDI A;  1A04 A;  3RCO A;  1A31 A;  4Y52 J;  1FTT A;  3FXJ A;  4RB1 A;  4LFU A;  2PG4 A;  1MMD A;  3R6S A;  3BRO A;  3HRS A;  3QQA A;  1JJ8 C;  3HRM A;  3ERE D;  1X1D A;  2AQF A;  4QPO A;  5HS8 A;  2E1N A;  1ETQ A;  2CH0 A;  2GXB A;  2WBM A;  3HGG A;  2X4H A;  3H92 A;  1Y8Q B;  3FXU A;  3WTT C;  2HGC A;  4QPQ A;  1U6G A;  4UUS A;  1K79 A;  2LVS A;  1Y56 A;  4XLP F;  3K70 D;  5BPD A;  5F0F A;  2HDC A;  4LGW A;  2ID3 A;  1NH3 A;  4MQV A;  4Z6Y A;  3GZ6 A;  3K70 C;  1XGO A;  3HXL A;  2FUG 2;  1FMV A;  3DCF A;  2JK3 A;  3F3X A;  4WCG A;  4MGR A;  2M8E A;  1ORK A;  4Y15 A;  2XSD C;  3JRH A;  2CJJ A;  2KIQ A;  4XK4 A;  1SD7 A;  5ICF A;  4O3M A;  2L3D A;  3J7Z I;  4GRI A;  4CCN A;  1Z77 A;  4HV6 A;  3V8K A;  2DA1 A;  5DM7 F;  3CLO A;  1WH5 A;  2VXD A;  5H20 A;  4BJ5 C;  3CCE I;  1REP C;  2VPL A;  2J5P A;  2DMT A;  2EWN A;  3BZK A;  1HBX G;  2V1U A;  3LA2 A;  2Q2E B;  1WJD A;  2NS7 A;  2XDV A;  2A6T A;  3ABL H;  3K69 A;  1HW1 A;  2LTP A;  4OOI A;  4PSW A;  4EGZ A;  4UUS B;  4MFD A;  4UY8 I;  5E3M A;  4XIC A;  3MEX A;  3TBI A;  1I1G A;  1LQ1 A;  3BG5 A;  4DYC A;  1OYY A;  3T1B A;  2K86 A;  2HDD A;  3MCZ A;  3S3M A;  1A35 A;  3G1M A;  1J9I A;  3ZQI A;  4IJA A;  2O03 A;  5DM6 F;  4IVN A;  2NVT J;  3P9C A;  3NEU A;  3BG9 A;  1U5T C;  2B63 J;  3BR3 A;  2K9N A;  4G6Q A;  3WTY C;  2AS5 F;  4C2T A;  4Y33 A;  2EB7 A;  2O0Y A;  2KHM A;  2ELJ A;  2PX9 A;  2XKP A;  3ASO H;  3BTJ A;  1R4M B;  4PJJ A;  2DA5 A;  1V5G A;  3K4K A;  5FKO A;  1FSE A;  1ACI A;  1GLN A;  2KDZ A;  4RM3 A;  2WY7 Q;  4EJW A;  4EM1 A;  4Y13 A;  3S3O A;  4F7Z A;  3RQI A;  3K4J A;  5K5O A;  1SC7 A;  1U9O A;  1CF7 A;  3BY6 A;  3ZQF A;  3GFM A;  1YE9 A;  2HYG D;  3K4M A;  3CUQ B;  4S0H B;  4OMY A;  1JUM A;  3ZMU A;  2DTR A;  1IN8 A;  2VPR A;  4CGZ A;  1B72 A;  3BTC A;  3T0Y A;  1VQM I;  5GTH C;  4H0E A;  2OUM A;  4M6X A;  1BI0 A;  2R5Y A;  3FMQ A;  1LUJ B;  2XIG A;  4RGS A;  3HSR A;  2KFD A;  1Q1V A;  2CMP A;  3BZ6 A;  2L4A A;  2JUG A;  3QP5 A;  3JSP A;  4RM2 A;  1BR2 A;  4IQJ A;  3HZJ A;  2W82 A;  3CMM A;  5M3M J;  1K4S A;  3D5S C;  3DU5 A;  4PK4 A;  1GXP A;  1X4P A;  2ZXJ A;  4BNC A;  4N4N B;  1UEL B;  1JGG A;  5FGM A;  4L9V A;  3OYB A;  2COM A;  5HNF A;  2K85 A;  3DPU A;  2DI3 A;  1PYV A;  2JT1 A;  4XLF A;  2WWY A;  3JRI A;  3W6V A;  2VL8 A;  2A5W A;  2TDX A;  1LE8 A;  2V9V A;  4G7Z F;  3WTS C;  4I98 B;  3VYT B;  4A3G J;  2R5Y B;  1G59 A;  4OMZ A;  1IZ1 A;  2XGC A;  3TQN A;  2O8X A;  2V7F A;  3DTE A;  3WTW C;  2A5Y B;  1FBQ A;  3K2Z A;  3NRV A;  2QQ8 A;  4PDK A;  5E79 C;  2A3S A;  1XN7 A;  3CF5 F;  1UMQ A;  1SVO A;  2L01 A;  4L18 B;  1I50 J;  1XCV A;  2DA3 A;  3HBL A;  3PFI A;  2EJR A;  2XAU A;  2OTL I;  3DEU A;  3SZG A;  5B1B H;  3PUF A;  3S1N J;  2LRE A;  5DTD A;  2VJ5 A;  1Z7U A;  2WAF A;  2BY3 A;  2A69 F;  4B48 A;  2DA4 A;  1BL0 A;  4CIC A;  5ICE A;  5E1X A;  2BBY A;  4C30 A;  3D1N I;  2FA5 A;  3V7R A;  2HVS A;  2ZNY A;  1XGS A;  2ZXH A; 
#chains in the Genus database with same CATH homology
 3VYU B;  5CQG A;  3MKY B;  3KEY A;  2Y0S A;  4E7Z A;  4AU7 A;  3PSI A;  2VJJ A;  4DBR A;  2CFO A;  2RRE A;  4XLE A;  2L7K A;  3OOU A;  2CW8 A;  3PUB A;  4XKB A;  1X4O A;  2E5N A;  4YRV A;  2PJR A;  4R79 A;  3OYG A;  3OS0 A;  3OYN A;  2X6Y A;  3LSH A;  3BC8 A;  2R7R A;  2VQG A;  3ZRG A;  2JVG A;  4BEH A;  4P1W A;  4F52 A;  3EUA A;  3RSN A;  3DKY A;  4BDY A;  3PNY A;  1MMG A;  2E1M C;  3KYL A;  4BS9 A;  3CJQ B;  1Z3X A;  2M3A A;  3HKZ A;  3MD2 A;  3VYR B;  1YX5 A;  4E7I A;  2VQH A;  3H5A A;  3GBG A;  2NOJ B;  4HEA 2;  2BVM A;  5CKT A;  4RLQ A;  4CCO A;  4PUS A;  2M4K A;  1V5F A;  4BQO A;  2M0M A;  2HDW A;  3OYC A;  1LDK B;  3HPG A;  2IGO A;  2XF5 A;  2L5Q A;  4U87 A;  3HOT A;  3S3N A;  4YEJ A;  1D1C A;  1KON A;  1MND A;  4HSR A;  4XL9 A;  2CW7 A;  3DTI A;  2WAQ A;  2PJR B;  3MMY B;  2DCE A;  3RTR A;  4BDZ A;  2WAE A;  1TZL A;  3OIQ A;  4XKC A;  3OS1 A;  1W36 D;  4PJL A;  2Z2S B;  1AA7 A;  3K4L A;  4AVZ A;  2KP6 A;  2HPI A;  3HPH A;  1LVK A;  1QHG A;  2V9K A;  1R6R A;  2WB1 A;  2HNH A;  3HG9 A;  3H9J A;  2X6W A;  3OY9 A;  3D5L A;  3PSF A;  4D9J A;  4HNU A;  2DXI A;  3EUK L;  1WJB A;  1JI8 A;  4F91 B;  3FBN B;  4E7S A;  1K6Y A;  2ZSH B;  2VKD A;  3QOD A;  5LD2 C;  2R7S A;  2W7N A;  1Z7L A;  2MYS A;  4BL0 B;  2CUJ A;  4XLA A;  3IAS 2;  3OL4 A;  3RQ4 A;  1X1A A;  2Q1Z B;  3TMO A;  2IS6 A;  2DT7 B;  2E1M B;  4BE2 A;  4FET A;  4XN0 A;  4F92 B;  3ZQQ A;  1SAU A;  3L2Q A;  1D1A A;  4B43 A;  2PMZ A;  4LG3 A;  1P9Q C;  2KPM A;  2MC4 A;  4NNJ A;  3FKJ A;  5KHD A;  3H35 A;  5FRM A;  1PJR A;  4FAS D;  2XSJ C;  3RPU D;  4CA0 A;  4BAC A;  1BR4 A;  4ANJ A;  2Z1D A;  3BCA A;  4CSW A;  3IP4 B;  2XF7 A;  2QKL B;  2F4I A;  4MLO A;  3H5R A;  2BW3 B;  4CUG A;  2MD0 A;  3AL0 B;  4HST A;  3S8P A;  2IGN A;  2KRC A;  1QU3 A;  2LOO A;  3QYB A;  5FRO A;  1ZEL A;  3NWT A;  3F9K A;  2KMU A;  3U21 A;  3K6G A;  1X1C A;  2WY8 Q;  2X6X A;  1Y6I A;  4XOT A;  4NC8 A;  3VYS B;  4D1Q A;  3OYM A;  2BVL A;  2GOX B;  3LMM A;  3ZGK A;  1WJ5 A;  1MNE A;  2LY1 A;  3QOE A;  2W4S A;  2W00 A;  3I9V 2;  4RLF A;  2CUZ A;  3G2B A;  1T95 A;  2HVQ A;  3CES A;  1J09 A;  4KIT B;  3OYK A;  4XR6 A;  3QYF A;  4ZC3 A;  1X19 A;  1Z3Y A;  2I8D A;  2MFZ A;  4PFP A;  2V4J C;  2LY2 A;  3CJR B;  3CP8 A;  4DJA A;  2XC7 A;  2X1C A;  3OYJ A;  2LH9 A;  2KRH A;  2VQL A;  3LL7 A;  3OL3 A;  2DT6 A;  2R7Q A;  2R7W A;  2IGK A;  3BCB A;  3OYF A;  3C2G A;  4KT6 A;  3OYH A;  2E60 A;  2CV2 A;  2GOM A;  4Y3O A;  4DGW B;  1N78 A;  3W2V A;  4II3 A;  2WAD A;  2VQC A;  2HZD A;  2VLA A;  5HNH A;  4XMY A;  2CS3 A;  3OWT A;  3OYE A;  1EA3 A;  3DPT A;  4E7H A;  1D0X A;  2JSP A;  3KX2 A;  3LSK A;  5HLT A;  1LFP A;  1WJF A;  1X1B A;  2IGM A;  3OMY A;  4E7L A;  4X0G A;  3AKZ A;  4ITV A;  3LSI A;  4AYB A;  3M8J A;  4XOP A;  2F5V A;  4ZTJ A;  4B47 A;  4ZJZ A;  3UNG C;  2DJI A;  1TT0 A;  5CPR B;  3SYT A;  4XM3 A;  3S93 A;  4KIS A;  1WJA A;  2UV1 A;  3PL8 A;  2DOA A;  2RNG A;  4N4O B;  3PNT A;  3M1C A;  3AFH A;  3K4C A;  2K9L A;  5CQE A;  2BW3 A;  2VJI A;  5FRN A;  1BR1 A;  4HNT A;  3H0D A;  2UUZ A;  3VSK A;  3OYI A;  2CV1 A;  3L2R A;  3HUG B;  3E0J B;  4JOM A;  3ZR8 X;  1UAA A;  4LIV A;  3OYA A;  1WJE A;  4XOR A;  3NWS A;  1QHH D;  2VB6 A;  2VJ4 A;  4B3X A;  3DLA A;  4ZDO A;  1MW7 A;  4CH7 A;  2HVR A;  2X1D A;  2LC2 A;  3DTK A;  3IUO A;  4BU2 A;  3RCO A;  3OR1 C;  4BXF A;  2R7U A;  4BGD A;  1MMD A;  2OC6 A;  5KCM A;  3D5R C;  2LBF A;  2AQE A;  1X1D A;  2AQF A;  4QPO A;  5LFA A;  2L9N A;  4E7J A;  3BG7 A;  3FDY A;  2CH0 A;  3ONQ A;  2WBM A;  2F6C A;  2P0W A;  3C2H A;  4LIT A;  4HPQ A;  4OAZ A;  2X85 A;  4QPQ A;  1UG0 A;  3OYL A;  4Y4R A;  4OAY A;  3DPL C;  2BOL A;  3OYD A;  3MKW B;  2WA0 A;  1Y56 A;  5HVQ C;  4BE1 A;  3K70 D;  4RMN A;  1D0Z A;  4PJM A;  1G8X A;  3L2U A;  3V42 A;  3K70 C;  4G6T B;  3HXL A;  2FUG 2;  1FMV A;  2LRD A;  3LFU A;  2W1O A;  3FBI B;  3MKZ A;  4ZDL A;  2UWM A;  3H5N A;  3N05 A;  2OV7 A;  3BLY A;  5KNL A;  4F55 A;  1T0F C;  2VIX A;  3VDX A;  1WFX A;  4ZDP A;  4BQQ A;  2R4G A;  4GRI A;  4CCN A;  2LBF B;  2VAS A;  1DGW Y;  4XN3 A;  3SEZ A;  4XLH A;  4CCL A;  4HRI A;  2VXD A;  1MMN A;  4BJ5 C;  2VPL A;  3PFY A;  2R7T A;  3VSL A;  2Q2E B;  4IX7 A;  1WJD A;  4P5O A;  2XDV A;  2A6T A;  3HL2 A;  3I3L A;  2M7B A;  1OR7 C;  2R7O A;  1HA8 A;  4PSW A;  4CCJ A;  4E7K A;  3DU6 A;  3TBI A;  2R7X A;  4NQW B;  4XKV A;  2IS2 A;  3K4N A;  3L2V A;  3VWB A;  3S3M A;  1DQU A;  2HQA A;  1Z21 A;  2L9S A;  1LKX A;  3ZXS A;  4E6K G;  2CV0 A;  3UR3 C;  2RQQ A;  3W2A A;  2IXS A;  4E4H A;  2X51 A;  4C2T A;  4Y33 A;  3W2W A;  4PFO A;  2KHM A;  2ELJ A;  4CZC A;  4LIU A;  4BQN A;  4PJJ A;  2K3P A;  1V5G A;  3K4K A;  3LSM A;  4IKF A;  3QYE A;  2R7V A;  1GLN A;  4DOZ A;  4RM3 A;  2WY7 Q;  3EPZ A;  3W3C A;  2XF6 A;  2M7A A;  3H9G A;  3S3O A;  2IS4 A;  3K4B A;  3K4J A;  3SEQ A;  3H9Q A;  5HOO A;  3PJR A;  4PSX A;  4NUB A;  1YE9 A;  3K4M A;  2MAB A;  2K5C A;  1DGR M;  4BE0 A;  4F3Q A;  5JHF A;  4YEL A;  4H4K C;  2Z16 A;  2ZXI A;  2E5Z A;  2OUM A;  2IS1 A;  1BOB A;  2HU9 A;  3A4C A;  3BG6 A;  2O5R A;  3AL0 C;  2X1E A;  4II2 A;  1U0J A;  2JA2 A;  3DWL E;  2CMP A;  2ZSI B;  4BEH B;  2JUG A;  1OLT A;  3OS2 A;  3CF2 A;  1W36 C;  4RM2 A;  1BR2 A;  1VZ0 A;  4XNF A;  4IQJ A;  2VKH A;  2W82 A;  4JQF A;  4PJN A;  3CMM A;  1FMW A;  3A1Y A;  3TL4 X;  3FHN A;  2K9M A;  3EUH C;  4XKW A;  2QKM B;  3E1S A;  3D5S C;  3DU5 A;  3LSG A;  4PK4 A;  4OWR B;  2V26 A;  3ZCO A;  3HOS A;  1E0E A;  2LG4 A;  2V6E A;  3J7A Y;  3CZ6 A;  3DEE A;  1YX3 A;  4ZYA A;  1X4P A;  4F93 B;  1N75 A;  4N4N B;  3L2W A;  2VXZ A;  1UEL B;  4C2U A;  4CCK A;  4XQF A;  2L2O A;  2ZFU A;  3OYB A;  3OR2 C;  5HNF A;  3DPU A;  3HC7 A;  1PYV A;  4BJ6 C;  4XLF A;  2KL4 A;  3DQV C;  4B44 A;  1D1B A;  4DBQ A;  2VL8 A;  4ZTF A;  2A5W A;  4XLC A;  4BJT A;  2KDO A;  3SDB A;  1IRX A;  3VYT B;  2M4G A;  1G59 A;  4C9Y A;  2KQR A;  4J00 A;  3IAM 2;  1WJC A;  2V7F A;  3DTE A;  4KJZ A;  1ERD A;  4XON A;  3OIP A;  4NC7 A;  3CP2 A;  1NG7 A;  3A2K A;  1SFK A;  3K10 A;  4EAT A;  4CCM A;  2JVH A;  3PNV A;  2V1N A;  1DP3 A;  2KZV A;  4BUP A;  1V5E A;  2KLO A;  3DKX A;  3S32 A;  4U7B A;  2XAU A;  2HPM A;  1NG6 A;  4J01 A;  1D0Y A;  3SZG A;  4IZZ A;  2LRE A;  1S9H A;  2VJ5 A;  2WAF A;  5TGT A;  4DIQ A;  4B48 A;  4IQ4 A;  1N77 A;  2LYC A;  1MMA A;  4C30 A;  2HVS A;  4HG2 A;  2ZXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...