2E1MB

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
90
Chain Sequence
AATQTWTGDLAIVTIPFSSLRFVKVTPPFSYKKRRAVIETHYDQATKVLLEFSRRWWEFTEADWKRELDAIAPGLYDYYQQWGEDDAEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
total genus 14
structure length 90
sequence length 90
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mB02
2E1MB
chains in the Genus database with same CATH superfamily
3TO6A 4RA2A 2L02A 1VTNC 4XK4A 3CMYA 1P2FA 2QSHX 1LQ1A 4I99C 3S16J 1PUFA 2XB0X 3UNGC 2DOEA 5DDGA 4IL6C 2CQ7A 4MTDA 3FMQA 5D5XB 2WADA 5ICCA 1EJ9A 4ZDLA 3DWLE 2L9NA 1YS7A 1F1ZA 3KP3A 4XKVA 1WFXA 4D0PA 3M1EA 3JSPA 1K83J 2CW0F 2JSPA 1SC7A 3ZPLA 5FRMA 3ABLH 4ZTFA 2QUFA 4L9NA 2CV2A 1EA3A 1SFEA 1UJ8A 3C2BA 1W5SA 2LVSA 3QOEA 3LMMA 2BHZA 1ULYA 2M4KA 2JK3A 2XKPA 5FKNA 4JYKA 1IUYA 5J1UA 1ZN2A 3GX4X 4KIBA 3SXYA 3G1OA 3KP5A 5GAEJ 3FMRA 1YITI 4ZDOA 2BXYA 2ZBKA 4JK1X 2YU3A 5E3OA 2MH9A 3N05A 4Y33A 1PDNC 2RKHA 4YFNF 3F23A 2E5NA 4EM0B 5EYRA 2TDXA 2W4SA 5EZGA 4AVZA 4IHWA 3F8FA 2IGNA 4HSTA 4CXFA 1H9GA 5J3LA 3CUQC 4BJ5C 4DZPA 1V54H 4C2TA 1MW7A 1USSA 3SDGA 2F6CA 2Z1DA 5CYVA 1VQ9I 4ZDPA 1B9MA 4U7BA 3PJRA 4W1UA 3DLLF 2LG4A 3CCQI 3N4MA 2Q2EA 4YFKF 3R0JA 4LK1F 3IH2A 3GBGA 5JVGF 4X0GA 1NTCA 5E18F 2JUGA 5LEKA 3R60A 4J00A 2DPUA 3OY9A 2OC6A 4BGDA 2ZJ2A 4CCMA 2R4GA 2GZWA 5H20A 3LWFA 3LSKA 1P4XA 1IDYA 1SD6A 1TNSA 3BG5A 4NDLA 2ZFUA 4NQWA 2VJJA 2F5CA 1MBFA 3PSIA 2W7NA 2HXOA 4I2OA 2JJ7A 4HW0A 3RKWA 3BTIA 4GRIA 5CVUA 1BOBA 1AKHB 5FLXK 1IF1A 3ZXSA 3BTCA 3DKWA 3VEPA 3M7GA 3K7AJ 4RAYA 2IPQX 1CF7B 5M3MJ 5IT9Z 1U5TA 3VFZA 4OIPF 3BR2A 4EJUA 3EYYA 1R1UA 3F8CA 1IC8A 3FXRA 4KMFA 2AO9A 4DIQA 2VOOA 4RAGA 3GW2A 3P7NA 1P9QC 5CVRA 2XKOA 4ESBA 4CGZA 2NYXA 1TWHJ 4D5CA 1U9OA 2V7FA 3QU3A 2RNJA 3D0SA 3HIFA 3QODA 2X4HA 3WU0A 5BNGA 4XQFA 2R5YA 3I54A 2X6XA 3CJTB 2QA4I 1H89C 2JQ7A 2R7VA 4GXOA 4Y3OA 4F93B 2HPIA 3I59B 1GXQA 5JHUA 4O6JA 1I39A 2HTSA 4KISA 3IH3A 1MMAA 5M5XJ 1JKRC 3MZ8A 2GWRA 1I3AA 3T1BA 2X51A 5DM7F 1FJLA 4D7MA 2Y9YA 2XAFA 1E3OC 1B6AA 3CF5F 3CC7I 2JMWA 4H0EA 3LAPA 4HX7A 2PMZN 4XRSA 1YS6A 3IL2A 2VQHA 3HZJA 1STZA 2XRLA 1RETA 1EV7A 4AIDA 1M1EB 3IKVA 4NNJA 4DOZA 2MD5A 2LD5A 1BR1A 2YX7A 5D8LB 3WTTC 4E7KA 4ZJZA 2RQPA 3W2WA 3V7SA 1JJ8C 4KFCA 3BLYA 2VASA 2PJRA 4HNUA 3RPQA 5FJ8J 4EJOA 1MKMA 1YJ9I 3IWZA 5ICGA 5ILUA 1B4AA 3KEQA 1VF9A 3ML6A 5IT3A 1DU0A 2VQCA 3CTAA 4F92B 3L7WA 1QZZA 3B73A 3WU1B 4ENKA 2IA0A 4P9FA 5E79C 4I0AA 3O6BB 4A3EJ 3I9V2 1A36A 1KQ0A 4LJZF 5DV5A 3CJRB 3MFKA 3PL8A 4O3MA 2NS0A 4UVCA 1OLTA 3S2WA 2LK2A 3HOUJ 2BY2A 1AHDP 3MKWB 3MD2A 1R00A 5K5QA 2HKXA 1JHHA 5HNHA 2CH0A 3GZNB 1PJRA 4HEA2 1G3WA 3DEEA 5EDNA 5FRNA 2BV6A 5IYBJ 3TGNA 4A6EA 1R23A 3LSMA 3ZP5A 2X85A 5D5VB 2IW5A 5IYDJ 2P5VA 4FT8A 3BC8A 2ME0A 1FOKA 5CQEA 1X19A 3RZOJ 1LVAA 2ADUA 1D0XA 1RR7A 2K85A 1X1PA 3W6JB 1VQ4I 3U9GA 4Y52J 4DQ2A 4LIUA 2FUG2 3IWFA 5D8KB 2JA5J 3DF8A 4PDKA 1X4PA 5F27A 4LG3A 3H35A 1MNMC 3DLAA 1BW5A 4YG2F 2EB7A 3IRQA 4UUSB 3G4SI 2FBHA 2KIUA 3SFZA 1GV2A 1KYWA 2KIFA 1K78A 1D8KA 2FOWA 2XIGA 3BP8A 3OYDA 2RREA 1RZ4A 1T2KA 3X2QH 3NQOA 3D5RC 4D9JA 3W6KB 1WJAA 1VFCA 1D1BA 5GADJ 4HZFA 4LFUA 5E1XA 4HYEA 3HSRA 1T56A 4OMZA 3BJ6A 2W1OA 2GOXB 3EDPA 2EK5A 3QYBA 2ZCWA 2ID3A 2M34A 3K4KA 3HTUA 1WJBA 1ZYRF 3LFKA 2VQGA 1UAAA 2P0WA 4HV6A 1SANA 5BS6A 3WE3A 3PUFA 1L3LA 1JUSA 1R4NB 2MFZA 5C44J 1WHUA 2A6EF 4MQ9F 3M9AA 1SFOJ 3H0DA 2PMZA 2BZTA 2JA7J 4IRIA 1EKEA 4G94A 1S7OA 4E7HA 1V3FA 3JRIA 4L9TA 2MABA 3QU6A 5FKMA 2ZJQF 1P4AA 3C7JA 2Z16A 1X2NA 3L1PA 1Q1VA 1Z1DA 2QCOA 3RPUD 1NK3P 2QQ9A 2VLAA 5HVQC 1U2WA 2VUMJ 5K1YA 2X9DA 4M9SA 2CU7A 1O7FA 4PSXA 4RB3C 2KT0A 2KZGA 2R5ZB 2MH2A 3H3ZA 4ON0A 2L54A 2GAUA 3HRTA 3DU6A 3OSGA 3Q5FA 3V8JA 3JREA 2FU4A 4FX4A 3CUQA 2O5RA 5E8IA 3Q0UA 2OTJI 2DJNA 4PFPA 4ASNA 3ZQHA 1F4KA 1W5CC 2F5EA 3ZMTA 3FBIB 2LKPA 3L2RA 2UXNA 1OQYA 3RYPA 2R7TA 3HSFA 3I71A 4YIRX 1VQ7I 3GTKJ 1OFCX 1QO0D 4L9VA 2TRTA 3E5UA 1YJNI 2DOFA 1ETWA 3FM3A 1ZLJA 2Y69H 3GFJA 5IP6A 1Y39A 4XOPA 1T33A 3K0LA 4C3JJ 3DQVC 3BZKA 4FHTA 3IC7A 2L9VA 4HX8A 1A6QA 4MEYF 2P6SA 1R5ID 2EZIA 1XSDA 1S7EA 3VSKA 4Q5SF 2LLKA 2P5LC 1JE8A 5LFAA 2E2IJ 3B02A 3K6GA 3KX2A 2IJLA 3O8GA 2DDBA 4RLFA 3W3CA 2ZFWA 4BQNA 1JTYA 1O7LA 1UHSA 2ZXHA 3PNVA 4CYDA 1BR4A 3ZMUA 1WJDA 1OMIA 1XPXA 3FZVA 3S93A 1NG6A 3OIPA 1JGGA 5DCMA 3G71I 4GYIA 4EJVA 2B7EA 5JI6A 3FIWA 5FFZA 1SFUA 2V9PA 3R4KA 3HM5A 2RVCA 3WG7H 3CCLI 5A2QK 4IHTA 4GGGA 4XLHA 2DA4A 3Q9VA 2EV0A 2FOKA 5J6XA 3RKXA 2O7OA 2LFBA 2PMHA 3MVPA 3RQ4A 2YUSA 3FXUA 4BEHA 2EWNA 4XBFA 4XKWA 1O3RA 5F64A 2Y9ZA 1A6IA 2W48A 5F0FA 1KQ8A 2EFOA 2KQRA 1FIAA 3CCRI 3SZGA 2P4WA 3VYSB 3MMYB 1A04A 3S1QJ 3QPTA 2XPVA 2RDPA 1BOAA 3V7RA 1GHCA 2DYRH 1ENHA 5FKKA 1MJAA 2AQFA 3GO5A 3U1KA 1OCZH 2BW3A 1D5VA 1JXSA 4XN3A 5KK1A 3VYTB 4ESFA 2ISZA 2LOOA 3Q0WA 4CUGA 3HPHA 1XSVA 3NWSA 1B9NA 1ZH5A 3T5XA 1JUPA 1QVTA 2VKVA 3VODA 2FMLA 2JUCA 4BJ6C 2B9SA 4ZH4F 3EUHA 1HA8A 3AG3H 5LHGA 1B8IA 1JGSA 4MO7A 3TP0A 2ID6A 3ZQIA 3OYAA 2K7LA 5JLXA 5JR3A 5C4JJ 3HOYJ 1JT6A 1IXSB 1ZKGA 5J47A 1WPKA 1ZRCA 5GAHJ 1QNTA 1U3EM 2JPCA 2QBYA 4UY8I 2BE5F 2NVQJ 3C2HA 3WGHA 1I27A 3FWEA 4KMUX 3CLOA 1WJCA 3L00A 1ACIA 1AWCA 3I55I 1UG0A 3OYNA 3FDYA 4Y15A 2UWMA 1D0ZA 4ENNA 3KLNA 1SVMA 2NOGA 1RR8C 1F5TA 1I5ZA 1XGMA 2LNBA 3A01A 4HDUA 1J59A 1N25A 1G4DA 3L09A 4QWQA 5EG0B 1ZREA 2P7VB 4HX4A 4FASD 4HNVA 4JX6A 2CQKA 4IZZA 1YW7A 2ZXWH 2LKSA 3RCOA 3WG9A 4DNCA 2O8XA 3A02A 1IW7F 4YRVA 4A0XA 3E0JB 4N9IA 1MSFC 3E7LA 3DFGA 4LIVA 1U6GA 1WI9A 1OR7A 1BC7C 4UUVA 5GPAA 2O8KA 3BROA 3PUBA 3IHUA 2UV1A 3RZDJ 2VKHA 4BY1J 2CO5A 3TP3A 3ERED 2R0QC 1T0FC 3J80K 2WWYA 2OCCH 2XGCA 2OUMA 1EH6A 1YRNB 1N77A 3SQNA 4PJMA 5CVJA 4EM1A 1I3QJ 3H9GA 3RSNA 2RN7A 4C9YA 3WTXC 1Z7LA 1O57A 1GT0C 3JRGA 2CW8A 4P55A 2QSFX 4JOMA 4KYWA 4NC7A 1KU7A 2CUZA 1IN6A 1UELB 4U0WA 4V19K 1SFXA 2K9QA 3KLOA 2CV1A 4KNYA 2M87A 1REPC 1YJWI 3TOBA 1FOXA 3W2VA 3CCJI 3H36A 1HQCA 2WC2A 2OV7A 6PAXA 4M74A 5L3FA 2R7UA 1TQMA 4CH7A 1YLFA 4QSHA 2KKOA 3ZN0A 3CCUI 4HPQA 4XOTA 3F3XA 5IYCJ 3BQYA 2JTVA 1LNWA 1LKXA 3IP4B 3J7AY 4IHVA 1T08B 2UUZA 1X3UA 5KAFC 3LNQA 1D0YA 3K10A 2ELKA 2QGUA 1XGOA 3V7CA 2JA6J 2V1NA 1B1BA 4Q4ZF 4M6YA 3FISA 1WCMJ 1IN7A 5M5WJ 2GA1A 2L4AA 1FWZA 3OYHA 1OYWA 3F0CA 3JR9A 1GVJA 1IXRC 4G6QA 5A2QZ 2W85A 1MMGA 5E17F 5E20A 2XF6A 2IRFG 1KU3A 2Q0OA 1ORKA 1W5TA 1A35A 4AU7A 4MHGA 3J7ZI 3DKYA 1E17A 1ON1A 1T8IA 1GV5A 4LD5A 1XX5A 1W7PB 4L9JA 5JVTA 1OCRH 4S04A 5J4VA 2IGMA 4A5NA 2OCEA 4XLEA 3QWLA 3ZMSA 2E19A 4DYRA 1IN5A 2BY0A 5EJCA 1QGPA 5KCMA 2X6WA 1TTYA 2KRHA 1R22A 2MBFA 1MH3A 5D5WB 1B72B 4KN4X 5CKTA 1PVEA 2EIKH 2HVQA 3E5QA 2KLOA 2DMUA 3IH4A 4BHPA 5DS9A 1S7AA 5F1JA 1KU2A 1QBJA 2LF7A 1XCBA 1FX7A 2DA3A 2G7HA 4WXCA 2LRDA 5HLHA 1VQPI 2DA1A 3ZMZA 2COMA 2VE8A 2HQ5A 4M3FA 1QRYA 2M30A 3OOUA 3ABKH 3LAJA 4II2A 3S17J 4KIGA 1E3HA 4UUTA 5BMZA 3KZZA 3S1RJ 4LLLA 1R4MB 1ETOA 4KT6A 3F6OA 3Q3SA 3K69A 2VPLA 2K86A 2EIMH 2K9SA 2ESHA 2XV4S 1QPIA 2ZXJA 1BA5A 2HOEA 2BY1A 5CJ9A 4A3GJ 1IRGA 3I3LA 2Y0SN 3BG7A 3OIOA 1OJLA 3H5NA 1LUJB 1J2XA 3DTKA 3VSLA 1QZYA 1JHFA 1V4RA 1LE8B 1VQ5I 2CG4A 1QPMA 4MIMA 4XLFA 3V42A 2PQ8A 4A0YA 2QQAA 4EVIA 4XLAA 4EATA 3SZPA 1IAWA 3KETA 1K4TA 2V6EA 2R7OA 1BN5A 1LDJA 2IA2A 3WTWC 2LBFA 1ZK8A 2E7WA 3U21A 2Z2SB 2P7CB 2QZ8A 2HOTA 3HEFA 2PN6A 3GWZA 5E3NA 1PUEE 5LGUA 3HOXJ 3A2KA 1ON2A 2XASA 4EJTA 2A5WA 4HAMA 1ZR2A 3TMOA 2MD0A 2XUBA 4UVBA 3PSFA 3LQRA 3SDBA 4IKFA 3GYHX 1GDTA 1O3QA 3GXOA 2Y48A 3S3MA 1TQIA 4FISA 3J80Z 2VJIA 3ZQGA 4IF4A 1RKTA 2GOMA 3U1DA 3S15J 3QPSA 2A61A 3HOSA 5FD6A 1DPUA 2BGCA 5L3BA 3A0HC 3K4LA 1FLIA 2E7XA 3OOPA 3CD6I 3KP2A 4KUMA 1BR2A 2ECBA 2AXTC 1SD5A 2CSOA 3MKZA 4J01A 2XGEA 2KP6A 2D45A 3K70D 1ZGAA 4RAFA 1L0OC 3L9FA 3H9QA 5ED4A 1LVKA 4R1HA 3L2CA 1J09A 1DPRA 1HKQA 2XF7A 1Y1WJ 4A3LJ 4RGSA 4BQAA 1MIJA 1ETQA 1UHWA 2EJRA 3ROUA 2IAIA 5B66C 2EIJH 2HWVA 2VBZA 2W00A 1VQKI 2MC4A 2H09A 2QKMB 3WTZA 1USTA 2WAQN 3LFUA 3RPUA 4L5IA 2ZJPF 1TT0A 2V9VA 5IPAA 3BR3A 5GAGJ 4IVNA 3JAMK 1UCRA 4Y17A 4IQJA 1ZR4A 2IVMA 3CLQA 3S1NJ 3RQIA 4E7ZA 5LRSA 1MDMA 1YE9A 1GVDA 4ITVA 1YW8A 1MNDA 2ZMEC 2ELJA 2TCTA 3KEOA 4C2MJ 3ZOBA 2LREA 4JX4A 2ZMEB 3BG6A 2MLGA 1D1CA 2R7FA 3PNYA 1FOWA 5HDKA 2EZHA 5EGOB 1IGNA 2EILH 3K1NA 3GTMJ 2Y2ZA 2M7AA 1WKMA 2KFDA 3NEUA 2P81A 2FX0A 1S9HA 2IS4A 4ZZDA 2DPDA 1TQPA 2CQNA 4F52A 3CP2A 2Y0SA 3CP8A 3WE2A 4BBSJ 1BI2A 3CESA 4QLCU 3BPVA 4M9XA 2PX9A 3LA7A 4G7ZF 2IS6A 5ERIA 4U0YA 4UHTA 3HSEA 1WH7A 5LBQA 2A69F 3ASOH 1WSUA 4KT5C 2VJ4A 1PP7U 1XC5A 3HUGB 3HRMA 3OYLA 3IKTA 1ETYA 2R7RA 3TDUC 4U0VA 2E2JJ 3S2HJ 2VT2A 2IS1A 1HKSA 1SAXA 1JKPC 1VQ6I 4FE7A 4B44A 3DP7A 2DLLA 3F6VA 3V4GA 3C2GA 3HBLA 5TRDA 2HQAA 3CC4I 4RS8A 4UB6C 2Q1ZB 4MTEA 3OS0A 1RI7A 2RGVA 4OU0A 2STWA 2HVRA 3BPXA 3U2RA 3FXQA 3TDZC 4IJAA 3G2BA 1R36A 4A5MA 1V5GA 1YI2I 1LPQA 1WVRA 2DBBA 3WHBA 2XVCA 4HLYA 1LFUP 2DQRA 2X6YA 1XMAA 1H9TA 4I76A 3E6BA 4GCVA 3WTVC 2JN6A 4IPAA 1BIAA 3CJNA 3OS1A 4A3BJ 4X6AJ 3RKQA 2DAOA 3A03A 4N0BA 2EA4A 3L2UA 4FE4A 1HW1A 1LJ9A 4R79A 1MNEA 4PJ0C 3BR6A 3OL4A 2E36A 1G59A 3LSTA 1HF0A 1R71A 1G3TA 4M71A 4OINF 2GQQA 4OOIA 3P9KA 1SMTA 5F04A 2LP0A 3GUDA 3JSOA 4BE2A 2NS8A 4NUBA 4MEXF 4G8XA 2HEOA 1I6XA 2CUJA 2NS7A 3ZN1A 2V1DA 2DXIA 4FETA 5IY5H 3NRVA 1OISA 3O8HA 2ECCA 1WI3A 1APLC 2DJIA 1HSJA 1XGSA 2E1NA 1ONVA 2WAQA 3E5XA 3FBNB 4ZYGA 3OYJA 1R9TJ 3O3KA 4I7HA 3FMSA 2VC0A 4RAZA 4PCQA 3DU5A 2FRHA 1TP4A 1W1WE 3NWTA 3VDXA 2IS2A 2R7DA 2XAJA 3K4JA 3P9IA 4KDPA 2E71A 2I10A 3K70C 5L3DA 1ZRDA 1MJ9A 3QPHA 3B6AA 4I02A 1ZLKA 1J9IA 3BWGA 4I09A 2DQLA 2ZJRF 4RGUA 3SEZA 1XS9A 2HPMA 1ZRFA 1OPCA 2E34A 2XPWA 3HC7A 1W4MA 3BTLA 3TQNA 2B63J 1S6LA 2WAFA 3KIOA 5J8FA 2M2EA 3NARA 5FLXZ 3OYBA 2HDCA 1FYMA 1BI3A 3SHFA 2DN0A 2WTEA 4B3AA 4B43A 2VXZA 3P9CA 2M45A 4E6KG 1FT9A 4ANJA 4KICA 4BNCA 4BQQA 3BDDA 1A5JA 5GP9A 1AA7A 5HLTA 4XICA 3K4BA 3ECHA 1OCTC 4RDUA 4XIDA 3T8TA 1Y0NA 3F8MA 4BUPA 1I1GA 2F4IA 3PFYA 3OMYA 1D8JA 5D6FA 5EZHA 2Z99A 4BHCA 2IEKA 4LG0B 1Z9CA 1BM9A 1W0UA 4HLXA 3JAMZ 3MWMA 3HB9A 1ETVA 2R92J 2MC3A 1R5GA 4U7DA 3ISPA 1X1BA 4ZYDA 1MMSA 4BE1A 1S72I 1MBHA 3M07A 1POGA 4ZYHA 5BQTA 4A3KJ 5JFRA 1HBXG 2CYYA 2VC1A 5K5OA 4PJLA 4C2UA 2MSYA 4WWCA 4NHJA 1WRJA 4XRFA 2XF5A 1U9NA 2WV1A 2PLYA 1FMWA 5DD4A 2DOAA 2VE9A 2X0LA 4RLQA 2KRCA 3EETA 4C30A 4RM3A 1KZHA 1R7JA 2FD5A 2KJBA 1B59A 2KMUA 2DDAA 1YHQI 3EYIA 1SVOA 4MGRA 3G6EI 1X1DA 4UB8C 2MA3A 3KYDB 3L2VA 5KNLA 3LSHA 3M8EA 1K61A 3O2PE 4XLCA 1ZHFA 1V5FA 1FY7A 2CUEA 2WY7Q 4DJAA 2XRNA 3LSGA 3GEZA 4P9UA 2DT5A 1DGWY 4Y4RA 3E6MA 3A4CA 4RB0A 4YELA 1AKHA 1NK2P 2L01A 4A3MJ 3K4MA 3ZCOA 4G7HF 1S29A 5J1YA 2FQ4A 2ELHA 4ZYEA 2VB6A 4AM3A 2FE3A 4MFEA 1HDDC 5BPIA 3WGGA 3OSFA 2QLZA 2FJ1A 4Y7NJ 3VYUB 4M3GA 5LLQA 1MMNA 5K7HA 4CYCB 2JSCA 4CZCA 1BC8C 4G12A 3MN2A 3KE2A 1SD7A 3CCEI 3CCYA 2FF4A 3S3NA 1HW2A 2D2WA 1C0WA 2F5DA 1TWAJ 1ZTRA 2K4JA 3OYFA 5AIPA 1PUFB 3OYKA 2ACJA 2IT0A 2OPTA 3C3WA 3I59A 4YEJA 2JWTA 1J75A 4RB1A 1A31A 1RRJA 1R1TA 2X1DA 3KZIC 4I01A 3CDLA 3OYGA 5EEHA 4B4CA 1T95A 5FKLA 3WTSC 4IHXA 3CCVI 2VBYA 2LTPA 4B1RA 4BH9A 1V55H 3M1CA 5KVRA 2YR2A 1RPWA 1XSXA 2OQRA 4HG2A 5ILVA 3MZHA 2Y0MA 3SEQA 2CFOA 2EFWA 3F21A 3LL7A 2R7ZJ 3PIOF 1WJ5A 3JW4A 3D5SC 2NNYA 3UKGA 1H0MA 4CCKA 4DBQA 2L7MP 3H5AA 2K9LA 2HQRA 3GTPJ 2LY1A 1MJBA 4IXAA 2R3SA 5B3SH 3FXJA 1ODDA 4K2EA 2KHMA 3LSIA 1FYKA 4OIOF 4XM3A 1XMKA 4B3XA 1BW6A 4A12A 2DODA 1FMVA 1SEUA 1R58A 4HRIA 3ZQQA 1D1AA 4RM2A 2O6GE 2FNPA 3ZR8X 1ZELA 2WV0A 5D4SA 2G9WA 2F4OB 3S32A 3JCUC 5FLVA 4GFBA 4N4OB 5F0HA 2AHQA 5J1RA 4CA0A 1X3ZB 2Q2EB 2KIMA 4F7ZA 1IDZA 2H94A 1RKWA 2STTA 2Z5UA 3DTEA 3MAJA 1WZ2A 1QQIA 1Z3XA 2PFBA 5EF6A 2K9NA 2M1BA 2DO7A 1NH3A 1WJFA 1H8AC 3H92A 4UV9A 3UR3C 1X1AA 2KPMA 3C1DA 5KAIC 2VL8A 1MBEA 4GO1A 5HOOA 4LITA 1OCOH 4IRHA 3COAC 5J4YA 2DTRA 2OU2A 4GYGA 4NQWB 3WODF 3JRBA 4S05A 5C4XJ 4BY7J 4P5OA 2EV5A 1FSEA 2DT6A 1R49A 2IGKA 3I4MJ 2UZKA 2JT1A 2XAQA 2BHYA 3CMMA 5F0CA 1X1CA 2GIZA 3HGGA 4BYYA 1ZG3A 1O4XA 1HC8A 1U5TB 4NBQA 3J81K 1CQTA 3AL0B 5HDGA 1YW9A 2A68F 1G6NA 1ETXA 3OR2C 1DP3A 3SZTA 4UUSA 2K3PA 4NC8A 4EM2A 2XAUA 5B1AH 4L18B 4LLGF 3M3YJ 1LDKB 4M72A 2R5YB 3WU2C 3I53A 3OS2A 2JA8J 2GXGA 1R5HA 3OYCA 1S3JA 1S5LC 5CQGA 3SYTA 3WTUC 5AONA 2QF7A 2BXZA 5GTHC 5E3MA 3I5UA 2D5VA 4HBLA 5DD8A 1D3YA 1X2MA 3H0GJ 4D5FA 4KA4A 2GBYA 3L2WA 1TWGJ 3BJAA 3HKZN 3E3VA 2KDOA 1DP7P 3OL3A 3H3VK 4IHSA 2ISYA 4IHYA 4A3DJ 3G3ZA 1G8XA 4Q48A 1IUFA 3J7YJ 4BACA 2E1MC 2B0LA 4PJJA 4IOCF 1T98A 1FBQA 4HQMA 2DT7B 1K79A 2E1MB 1VQLI 1Z67A 2EQRA 4QPQA 1XTAA 2ME6A 2O0YA 5TGTA 5DEQA 3CCSI 4BDZA 2W84A 1JKQC 4HF2A 1VQNI 3JRAA 1XDSA 1QHHD 2M9HA 2DK5A 4A3JJ 3HG9A 3EPZA 3VWBA 3MCZA 3ABMH 4D7NA 1IJWC 3BY6A 3V8LA 2PJRB 3RI4A 1MBKA 3GTQJ 3I64A 4EGYA 1VQOI 3D1NI 4ABZA 2QENA 1HCRA 2XB5A 2FMYA 5E1ZB 3VOEA 2XAGA 2QM3A 1UMQA 2FEZA 1TLHB 2A5YB 2M4GA 2R5ZA 2X6OA 1HSTA 2XROA 1Z7UA 3CMAI 5LGNA 4A6DA 3QP5A 2Q8KA 2QEXI 2CUFA 2F5VA 4BXXJ 1YX5A 3ABTA 1O3SA 3D5LA 3DPLC 4WF2A 2BY3A 2XGDA 2QYOA 1XD7A 4HOBA 2DMQA 3QQAA 3CCMI 3BOQA 3I58A 3HRUA 3SJMA 1ERDA 2OF7A 3DXJF 2YPRA 1P92A 4QIWN 3CJQB 4PFOA 5D6EA 4ETSA 1R1VA 3PIPF 1IRXA 1JT0A 2QQBA 2LMDA 1AOYA 5M5YJ 3BG9A 1CGPA 4BQOA 1WH5A 2J5OA 3KEYA 1UZCA 2HYGD 4HNTA 2H1LA 2XDVA 2XGXA 4RGRA 1DGRM 2YU9J 2EINH 5CPRB 1K7AA 4UNOA 4OWRB 2LY9A 1Z0XA 3M8JA 2VJ5A 3ZQCA 1J5YA 4L0YB 1W36C 2FBKA 3LSRA 3RDIA 3CC2I 1J7KA 1X4OA 3ONQA 4FCYA 3H3UA 3OYMA 1FBUA 1UFMA 3IAS2 1IRZA 2K4BA 1Y0UA 1K78B 2DW4A 1KONA 2JRTA 4WX9A 2FQ3A 2LF8A 4CDGA 3GMEA 1QVUA 1Z05A 4CO8A 2IBDA 1KQ9A 1BI1A 3GF2A 1E3PA 1FTTA 1ZG5A 1ZAOA 5DUKA 5IOZA 2GM4A 2VT3A 3FXKA 1WGXA 2W25A 3FKIJ 1I6HJ 4G9YA 2ZNYA 4L5EA 2VODA 2VBXA 1U0JA 2OBPA 4V2GA 4PUSA 1K4SA 5F1RA 3DV8A 3HKZA 5J8CA 2NVXJ 2M8GX 3HGYA 3HOVJ 2L7FP 4DBRA 4DZJA 5BOXA 2EH3A 3K2AA 3HXLA 4XKBA 1VI0A 4RB2C 3NAUA 5DUIA 4JBAA 2EA2A 1XB4A 3QP6A 3J81Z 2OD5A 1JUMA 2X1CA 2L9SA 3C18A 2DA7A 3OV8A 4YFXF 5ILSA 1ZG1A 4HV5A 4S0HB 2OJED 2E2HJ 5K7ZA 2BYVE 2M0MA 3CO6C 2GXAA 2G7UA 4FX0A 2ICWG 1QU3A 4BHBA 3AAFA 3OYIA 1AU7A 3HRSA 4DW6A 4EGZA 3OYEA 1HLVA 4IQ4A 3BQZA 4M3BA 4OAYA 4A69C 4N9HA 5L3CA 2HI3A 3V8KA 1IXCA 3PQJA 4B47A 5JHFA 4M73A 3CUQB 4E7JA 2HU9A 1FTZA 4XL9A 2OTLI 1I50J 2RNGA 5F08A 4E7IA 4F55A 2R7QA 5ICFA 1MGTA 2FBIA 4A3FJ 3ECOA 1F36A 4B48A 4Q47A 4LGWA 5JLWA 4V2FA 5GTIC 1RESA 1TZLA 5E8GA 2L5QA 5DM6F 2VOPA 5HLGA 1YQAA 1BL0A 4DYQA 4LLNA 2O03A 3M4OJ 3FM5A 3S8PA 2JRMA 4N4NB 1DU6A 3TOAA 3WTYC 3GCMA 5HS7A 3FX3A 5IP9J 1S8NA 2PI0A 1FNNA 4F91B 5EG0A 3FK7A 4WXDA 1DQUA 3FHNA 4BBRJ 1GUUA 3TW6A 2EFPA 5L3GA 3K4CA 4PGGA 4R8HA 2VKEA 2P5KA 3E6CC 1YO5C 2HVSA 4XLNF 2LC2A 3I4PA 5GPCA 5ICEA 3HHHA 3F8NA 1ZARA 2Y30A 4BL0B 1FIPA 5CVIA 3KP7A 4E70A 2HOSA 3GFMA 2XC7A 4E7SA 3LOCA 2L2OA 1RUNA 1SVLA 2ZC2A 4AYBN 5B1BH 4OAZA 2LR8A 3ZMVA 3QPLA 5M3FJ 2EFNA 3PQKA 5FFXA 3ZGKA 3I56I 2HS5A 5HNFA 4UXNA 3J7AO 5DCMB 4I0BA 4G6DA 2IP2A 2OQGA 2ESNA 3BZ6A 1Y1VJ 2K5CA 3CF2A 1YRNA 3CUOA 2HYJA 1T0FA 2EBIA 1WJEA 2NAZA 3OR1C 2HDDA 1NHAA 4BE0A 3DPTA 4BEHB 2KZVA 1KA8A 3FKJA 4M3EA 4ESJA 3HTSB 5D5UB 2RQQA 2RAEA 1W0TA 1HXDA 3R6SA 2CFXA 2KJCA 3EUKL 2A6TA 4XLPF 1FBSA 4G7OF 3BR1A 4RBOA 1RIOH 2DA2A 2Z3YA 4P1WA 3CDHA 4IOAF 2VN2A 1JKOC 2YS9A 3HYIA 5IOYA 3F9KA 2LKXA 1OYYA 2IA1A 2M7BA 4AD9A 4EJWA 3IRRA 2BW3B 1U8RA 1SAUA 2HZTA 2XHKA 2FA5A 3TEDA 2L4MA 1OCCH 4A3CJ 3W2AA 3ELKA 3PNTA 3EUHC 1VNDA 3BT9A 4XSXF 1SFKA 1IN4A 1RC9A 2QVOA 1TL8A 1MZBA 4KN7X 3TKYA 3BCBA 3F72A 2LYCA 1ITYA 2YX4A 1B8IB 3K1PA 3E6DA 1XCVA 2NRAC 2Z9OA 3K9TA 1Y8RB 1IRFA 2VONA 3P5JA 5LHHA 4WCGA 2HYFA 4MFDA 1YYVA 2OAZA 3DKXA 4F3QA 3HOWJ 2MG4A 3DBRB 3HPGA 1MBJA 2J5PA 4HF1A 4QTRA 4OIRF 3G1LA 2ZB9A 2QBYB 2DMPA 1W7PA 1LB2A 1HW5A 2CW7A 1UHMA 3VYRB 1PP8F 1BJZA 2O61A 4XMYA 4WK8F 1T6SA 2VPRA 4M6XA 3A01B 3E1SA 4LB5A 1B72A 2L9RA 3L2QA 1MH4A 3BTJA 3DEUA 5BPDA 2M8EA 1YX3A 2DCEA 2F2EA 3MQ0A 4Z6YA 4CHUA 2V79A 3LQQA 2DFEA 2WY8Q 4ZZLA 3GZ6A 4I98B 3QRFF 3MKYB 2DI3A 4J19A 2HR3A 1OR7C 3PO2J 4IX7A 4IO9F 5H6RA 2Y75A 3TO7A 3AG2H 1TWFJ 5EEGA 1XGNA 4HDVA 1LEBA 2DTZA 1IZ1A 1MBGA 4CCOA 1FPQA 3B6CA 4KJZA 2H27A 1IV6A 4PK4A 3KYLA 3PM1A 1XN7A 3RIRA 2NOJB 4BDYA 5HDNA 1O3TA 3AKZA 1MSEC 4AYBA 3OIQA 3S14J 4A3IJ 1Y6IA 4E4HA 4AVPA 4UVAA 2HQNA 2DFHA 2R93J 5FROA 3ABUA 3W6VA 2FNAA 1WWXA 4BXFA 1X3WB 1Z3YA 5K7FA 5FO5A 3K2ZA 2I8DA 3EUAA 3LSJA 2CWEA 4EV0A 1F43A 1BI0A 1SD4A 1UG2A 2K3FA 1BBYA 2GXBA 1LE8A 1VZ0A 1P7IA 4CCJA 1FP2A 4BU2A 2M3AA 1E0EA 1G3YA 4ZC3A 1ZGWA 2GLOA 4LOCA 2DYSH 2COBA 3G1MA 3RKYA 3CDIA 3WHCA 5HLIA 1HKTA 3FXOA 2HXIA 3TO9A 4DGWB 2XPUA 2JZYA 2HZDA 2P6TA 4FTHA 3RYRA 3F8BA 3LA3A 4QPOA 2A3SA 4I6ZA 2PEXA 4XKCA 4FQGA 1FYLA 4XONA 2FSWA 2LSOA 2GIVA 3VB2A 2MGQA 4HF0A 1F9NA 4A2UA 2BVLA 1N78A 5C3EJ 4XR6A 2OZ6A 2NVUB 4HSRA 4HQEA 1K6OA 3KPHA 4XSZF 1DUXC 2PMUA 4MLOA 5H2FC 2EPFA 2H8RA 3GTOJ 3H1CA 4IRGA 2V6CA 4JQFA 5LRRA 1P6RA 1MMDA 4PSWA 5LGTA 3OWTA 3BCAA 1TW2A 3LA2A 4ZTJA 2K40A 1X58A 2NNNA 4NB5A 4TV7A 2NVYJ 3KZYA 2JVGA 4RGXA 3N97A 5LD2C 2K02A 5HODA 2H8WA 4AWXB 3R0AA 2NVTJ 1YTYA 1FOYA 3LSPA 1HOMA 1FEXA 3GLLA 2O3FA 3T0YA 5DTDA 4ENMA 2EFQA 4EQQA 1IG7A 2KRFA 3JTHA 1TW3A 1JI8A 1JJ6C 9ANTA 2CV0A 4M9ZA 2X1EA 1CF7A 3QOPA 3GLXA 2XSDC 2L3DA 1KYZA 3S3OA 2R7SA 2DA6A 3FF5A 4JX5A 3GZ5A 4P96A 2NXNB 1Z6TA 2DMTA 1XDUA 2JVHA 2RC4A 3ULQB 1Z77A 3CZ6A 3PFIA 5EEAA 2L7KA 2FXAA 3ZQLA 2VBWA 2E1CA 1Z91A 2LY2A 1E2XA 3FXLA 3TBIA 4M6VA 4XRMA 3FXMA 3FHZA 4CZZA 2ETHA 1BIBA 1D5YA 1EH7A 4M3DA 5LEJA 4ZYAA 1YIOA 4PGHA 1KGSA 2MYSA 2RV8A 2V26A 4XORA 4PZJA 1VQ8I 2R7XA 3HL2A 3WGIA 2WAEA 4LB6B 1FC3A 3ZMDA 2WBMA 2CQXA 5FD5A 2ZMEA 2W82A 3KYCB 3ERMA 3CMEI 4KIFA 5EGOA 3VPRA 3F22A 3DBHB 2H1KA 3CQZJ 4WXHA 2KDZA 2Z33A 4YIFA 1W7PD 3JRHA 1H88C 2V4JC 1K6YA 5DYMA 2M5WA 4B8XA 3M8FA 3G73A 2WB1N 2MW8A 2EV6A 3MZYA 4KITB 2ZKZA 2HDWA 2OA4A 2VXDA 2PG4A 4LMYA 4HA8A 4AIJA 2VQLA 2JPBA 1P7JA 3JRFA 3CO7C 1MD0A 3HUGA 2E60A 2LBFB 1P4WA 2GA2A 4A0ZA 1LFBA 1OKRA 3ZRGA 2CGPA 3H9JA 4X1EA 2QSGX 3IV5A 4XN0A 3GTJJ 4CCNA 2O9LA 2W57A 3IAM2 2VI6A 4YIIA 1IO2A 1U78A 1ZQ3P 3E97A 4BJTA 3KCCA 3BZCA 3KP4A 5IP7J 2KL4A 3H5RA 2KIQA 2V9KA 1YIJI 4GDFA 1OYIA 4U87A 3GTLJ 1IN8A 2BEOA 2V1XA 1W36D 3I4NJ 3DCFA 3I0TA 2C6YA 2VIXA 3S2DJ 5H6QA 3KP6A 4H4KC 2PBIA 5L3EA 2DFIA 1QHGA 2H6BA 4NC6A 1TBXA 4L0ZB 4EEFG 3ESWB 5CLSA 2G0EA 1FSHA 2K9MA 1EH8A 1V5EA 2E1OA 2HKOA 5FKOA 3SFIA 2CMPA 3JRCA 5DCFA 2A6HF 1ZGJA 2CJJA 2W24A 5K5RA 3EQLF 2QQ8A 1U5TC 1LEAA 2ZXIA 3JTGA 2X48A 3TW7A 3AL0C 1XMXA 1Z6RA 5E1WA 3RJPA 2XAHA 1G3SA 2OZUA 2EZLA 2DFFA 3DPUA 3K4NA 2BOLA 3QAHA 4C3IJ 2V1UA 2LH9A 3HJEA 1BJAA 3S1MJ 1RUOA 1XG1A 2Y31A 4AIKA 2A07F 3HDDA 1QZEA 4JP0A 4II3A 3RTRA 5FGMA 3AFHA 4U88A 5CVVA 2A05A 1IV8A 1TNTA 4LK0F 2CRGA 1JTXA 4EMSA 5KHDA 2E5ZA 1J0RA 3MKLA 2DK8A 4ENJA 2DA5A 2F4MB 2JA2A 1RNLA 5HS8A 1MDMB 3TL4X 5B5EC 2IGOA 1GLNA 2HGCA 2CQQA 1G2HA 5LHIA 1NG7A 2M0CA 2VKDA 4MQVA 3IUOA 2EZKA 1KU9A 3QYEA 1N75A 2CS3A 3A0BC 2HNHA 4O5VA 1Z21A 2UXXA 3GFIA 3DEWA 2D1HA 4A93J 3QYFA 3FK6A 3AG1H 1ETKA 1TWCJ 4BKXA 2WA0A 2L0KA 2IXSA 4C3HJ 3BR0A 4G6TB 5TJJA 5D4RA 1T39A 1PYVA 2DU9A 3KFWX 3Q0VA 3PO3J 2AQEA 4B09A 3ZQFA 5FLMJ 2YSRA 4Y13A 4OMYA 4RMNA 3BR5A 4IEJA 1TT5B 2BVMA 1YFHA 2QKLB 2WB1A 2LDUA 5HS9A 1LFPA 2P8TA 5AIQA 1T38A 5F6FA 1DDNA 4AIHA 3HOZJ 4E7LA 3Q9SA 2R7WA 2PJPA 1VQMI 1TC3C 4XNFA 2F48A 4AC0A 5IT9K 5J40A 4CICA 4LG0A 2F5FA 2HTJA 4XRSG 1R6RA 3BG3A 2ZSHB 1Q1HA 4CSWA 2AS5F 3ZQ7A 2ZSIB 2ZO4A 1SMYF 2N8GA 4AUXA 4BS9A 2L7ZA 2I5UA 3GTGJ 2HOAA 5E3LA 4BXUA 3AG4H 2ZNZA 2BBYA 1FP1D 5TISC 3GVAA 1U8BA 1FZPB 1YG2A 2K27A 3ASNH 1I1SA 2QWWA 3JRDA 4DYCA 3DBLB 1EF4A 5FB2A 3GFLA 4Z2YA 1Y8QB 4W97A 4D1QA 2MLKA 4BAYA 2D1VA 2KISA 1OCPA 2H6CA 4L5JA 1QA6A 2E35A 1LDDA 2AXLA 1YOVB 3BJOA 3K1MA 2HFHA 1UB9A 4UV8A 4CCLA 2XSJC 3HHGA 4MNUA 3HOTA 1WQ2A 3DTIA 1HDPA 1GXPA 3MEXA 3R61A 3A1YA 4CYCA 4PJNA 4OIQF 3REOA 1Y56A 3T8RA 2DMNA
chains in the Genus database with same CATH topology
3C2HA 4BEHB 1X1BA 1WJCA 2KZVA 3FKJA 4BE1A 1UG0A 3OYNA 2RQQA 3FDYA 2UWMA 1D0ZA 3EUKL 3UNGC 2A6TA 4PJLA 4C2UA 4P1WA 2WADA 2XF5A 4ZDLA 3DWLE 2L9NA 4FASD 1FMWA 2DOAA 3F9KA 4RLQA 2KRCA 4XKVA 4IZZA 4C30A 1WFXA 4RM3A 2M7BA 2JSPA 2KMUA 3RCOA 5FRMA 2BW3B 1SAUA 4ZTFA 4YRVA 2CV2A 1EA3A 3E0JB 1X1DA 3W2AA 3L2VA 3QOEA 3LMMA 5KNLA 3LSHA 3PNTA 4LIVA 3EUHC 4XLCA 2M4KA 1V5FA 4DJAA 2WY7Q 3LSGA 1SFKA 3PUBA 2UV1A 1DGWY 4Y4RA 4YELA 3A4CA 4ZDOA 2VKHA 3BCBA 2LYCA 3K4MA 3ZCOA 4Y33A 3N05A 1T0FC 2E5NA 2VB6A 2OUMA 3DKXA 4F3QA 2W4SA 3HPGA 1N77A 4AVZA 4PJMA 2IGNA 4HSTA 3VYUB 3H9GA 1MMNA 3RSNA 4BJ5C 4CZCA 4C9YA 1Z7LA 2CW7A 4C2TA 3VYRB 1MW7A 2CW8A 2F6CA 4JOMA 3S3NA 2Z1DA 4NC7A 2CUZA 4ZDPA 1UELB 3OYFA 4XMYA 4U7BA 2CV1A 3PJRA 3OYKA 2LG4A 3W2VA 2OV7A 3E1SA 4YEJA 2R7UA 3L2QA 3GBGA 4CH7A 4X0GA 1YX3A 2JUGA 4HPQA 4J00A 2DCEA 3OY9A 4XOTA 2X1DA 2OC6A 2WY8Q 4CCMA 4BGDA 2R4GA 3MKYB 3LSKA 1LKXA 3IP4B 3OYGA 1OR7C 1T95A 4IX7A 3J7AY 2ZFUA 2VJJA 2UUZA 3M1CA 4CCOA 1D0YA 3K10A 3PSIA 4HG2A 4KJZA 2W7NA 4PK4A 3KYLA 2V1NA 3SEQA 2CFOA 2NOJB 4BDYA 3AKZA 3LL7A 4AYBA 3OIQA 4GRIA 1BOBA 1WJ5A 1Y6IA 3D5SC 4E4HA 3OYHA 3ZXSA 5FROA 4CCKA 4DBQA 3H5AA 2K9LA 4BXFA 1MMGA 1Z3YA 2LY1A 2XF6A 2I8DA 3EUAA 4AU7A 4DIQA 2KHMA 3DKYA 3LSIA 1P9QC 4XM3A 4B3XA 1FMVA 1VZ0A 2V7FA 4HRIA 3ZQQA 4CCJA 1D1AA 4RM2A 4BU2A 2IGMA 3QODA 2M3AA 1E0EA 3ZR8X 4XLEA 1ZELA 4XQFA 4ZC3A 2X6XA 5KCMA 2X6WA 3S32A 2KRHA 4N4OB 2R7VA 4CA0A 4Y3OA 4F93B 4DGWB 2Q2EB 2HPIA 3DTEA 2HZDA 1Z3XA 4KISA 1MMAA 4QPOA 5CKTA 2HVQA 1WJFA 2KLOA 4XKCA 3UR3C 1X1AA 4XONA 2KPMA 2X51A 2VL8A 5HOOA 1N78A 2BVLA 4LITA 2LRDA 4NQWB 4XR6A 4HSRA 4P5OA 4MLOA 2DT6A 2VQHA 2IGKA 3OOUA 4II2A 4NNJA 3CMMA 4DOZA 1BR1A 4JQFA 1MMDA 4PSWA 4E7KA 3OWTA 4ZJZA 3BCAA 4ZTJA 1X1CA 3W2WA 4KT6A 2JVGA 2VPLA 3BLYA 2VASA 2PJRA 4HNUA 5LD2C 3AL0B 3I3LA 3OR2C 1DP3A 3BG7A 3H5NA 2K3PA 3DTKA 3VSLA 2VQCA 4NC8A 4F92B 2XAUA 1JI8A 1LDKB 4XLFA 3V42A 3OS2A 2CV0A 4XLAA 4EATA 3OYCA 2X1EA 5CQGA 3SYTA 3I9V2 3S3OA 2V6EA 2R7OA 2R7SA 3CJRB 2LBFA 3PL8A 3U21A 2Z2SB 3L2WA 1OLTA 2KDOA 2JVHA 3OL3A 3CZ6A 3MD2A 3MKWB 2L7KA 1G8XA 5HNHA 2CH0A 1PJRA 4HEA2 4BACA 3A2KA 2E1MC 2LY2A 3DEEA 3TBIA 2A5WA 5FRNA 4PJJA 3LSMA 2X85A 3TMOA 2DT7B 2MD0A 2E1MB 3BC8A 4ZYAA 3PSFA 3SDBA 4IKFA 5CQEA 2MYSA 4QPQA 1X19A 2V26A 3S3MA 4XORA 1D0XA 5TGTA 3HL2A 4BDZA 2R7XA 2WAEA 2VJIA 4LIUA 1QHHD 2GOMA 2FUG2 2WBMA 3HG9A 3EPZA 3VWBA 2W82A 1X4PA 4LG3A 2PJRB 3H35A 3HOSA 3DLAA 3K4LA 2V4JC 1BR2A 1K6YA 3MKZA 4J01A 2KP6A 3K70D 3H9QA 1LVKA 2M4GA 4KITB 1J09A 2RREA 3OYDA 2HDWA 3D5RC 2XF7A 2VXDA 4D9JA 1WJAA 2F5VA 1D1BA 2VQLA 1YX5A 2W00A 2E60A 2LBFB 3D5LA 2MC4A 3DPLC 3ZRGA 2QKMB 3H9JA 3LFUA 2W1OA 4XN0A 4CCNA 2GOXB 1ERDA 3QYBA 3IAM2 3K4KA 1TT0A 3CJQB 1WJBA 4PFOA 4BJTA 2VQGA 1UAAA 2P0WA 2KL4A 3H5RA 1IRXA 2V9KA 4IQJA 4U87A 4E7ZA 2MFZA 4BQOA 1YE9A 1W36D 2VIXA 4ITVA 1MNDA 3KEYA 3H0DA 2ELJA 2PMZA 4H4KC 4HNTA 2XDVA 1DGRM 2LREA 5CPRB 1QHGA 4OWRB 4E7HA 3BG6A 1D1CA 3PNYA 3M8JA 2MABA 2VJ5A 2Z16A 2K9MA 1W36C 2M7AA 1V5EA 3RPUD 2CMPA 1X4OA 3ONQA 2VLAA 1S9HA 5HVQC 2IS4A 3OYMA 4F52A 3IAS2 3CP2A 2Y0SA 3CP8A 4PSXA 1KONA 3CESA 2ZXIA 2IS6A 3AL0C 3DU6A 2O5RA 2VJ4A 3DPUA 3K4NA 3HUGB 4PFPA 2BOLA 3OYLA 2LH9A 2R7RA 3FBIB 2IS1A 3L2RA 4II3A 3RTRA 3AFHA 2R7TA 1U0JA 4B44A 4PUSA 3HKZA 3C2GA 2HQAA 5KHDA 2E5ZA 2Q1ZB 3OS0A 4DBRA 2HVRA 2JA2A 3HXLA 4XKBA 4XOPA 3G2BA 3TL4X 1V5GA 2IGOA 3DQVC 1GLNA 1NG7A 2VKDA 2X1CA 3IUOA 2L9SA 2X6YA 3QYEA 1N75A 2CS3A 2HNHA 3VSKA 1Z21A 2M0MA 3QYFA 3OS1A 1QU3A 5LFAA 2WA0A 2IXSA 3L2UA 4G6TB 3K6GA 3KX2A 4RLFA 3OYIA 1PYVA 3W3CA 4BQNA 4R79A 3OYEA 4IQ4A 1MNEA 2AQEA 2ZXHA 3PNVA 4OAYA 3OL4A 1BR4A 1G59A 1WJDA 4RMNA 3S93A 1NG6A 3OIPA 4B47A 5JHFA 2BVMA 2QKLB 4E7JA 2WB1A 1LFPA 2HU9A 4XL9A 4BE2A 4E7LA 2RNGA 4NUBA 2R7WA 4E7IA 4F55A 2CUJA 2R7QA 2DXIA 4XNFA 4FETA 4B48A 4XLHA 2DJIA 1R6RA 1TZLA 2L5QA 2WAQA 3FBNB 3OYJA 3RQ4A 4BEHA 2ZSHB 4XKWA 3DU5A 3NWTA 4CSWA 3S8PA 3VDXA 2IS2A 2ZSIB 4N4NB 2KQRA 3K4JA 3SZGA 3VYSB 4BS9A 3K70C 3MMYB 4F91B 1DQUA 3FHNA 3K4CA 3SEZA 2HVSA 2HPMA 2LC2A 3HC7A 2AQFA 2BW3A 4XN3A 3VYTB 4BL0B 2LOOA 2WAFA 4CUGA 2XC7A 3HPHA 4E7SA 2L2OA 3NWSA 3OYBA 4OAZA 4D1QA 4B43A 2VXZA 4BJ6C 4E6KG 4ANJA 4BQQA 1HA8A 1AA7A 3ZGKA 5HLTA 3K4BA 5HNFA 4BUPA 4CCLA 2XSJC 3PFYA 2F4IA 3OMYA 3HOTA 3OYAA 2K5CA 3DTIA 3CF2A 1WJEA 3A1YA 3OR1C 4PJNA 1Y56A 4BE0A 3DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1M B; 
#chains in the Genus database with same CATH topology
 3TO6 A;  4RA2 A;  2L02 A;  1VTN C;  4XK4 A;  3CMY A;  1P2F A;  2QSH X;  1LQ1 A;  4I99 C;  3S16 J;  1PUF A;  2XB0 X;  3UNG C;  2DOE A;  5DDG A;  4IL6 C;  2CQ7 A;  4MTD A;  3FMQ A;  5D5X B;  2WAD A;  5ICC A;  1EJ9 A;  4ZDL A;  3DWL E;  2L9N A;  1YS7 A;  1F1Z A;  3KP3 A;  4XKV A;  1WFX A;  4D0P A;  3M1E A;  3JSP A;  1K83 J;  2CW0 F;  2JSP A;  1SC7 A;  3ZPL A;  5FRM A;  3ABL H;  4ZTF A;  2QUF A;  4L9N A;  2CV2 A;  1EA3 A;  1SFE A;  1UJ8 A;  3C2B A;  1W5S A;  2LVS A;  3QOE A;  3LMM A;  2BHZ A;  1ULY A;  2M4K A;  2JK3 A;  2XKP A;  5FKN A;  4JYK A;  1IUY A;  5J1U A;  1ZN2 A;  3GX4 X;  4KIB A;  3SXY A;  3G1O A;  3KP5 A;  5GAE J;  3FMR A;  1YIT I;  4ZDO A;  2BXY A;  2ZBK A;  4JK1 X;  2YU3 A;  5E3O A;  2MH9 A;  3N05 A;  4Y33 A;  1PDN C;  2RKH A;  4YFN F;  3F23 A;  2E5N A;  4EM0 B;  5EYR A;  2TDX A;  2W4S A;  5EZG A;  4AVZ A;  4IHW A;  3F8F A;  2IGN A;  4HST A;  4CXF A;  1H9G A;  5J3L A;  3CUQ C;  4BJ5 C;  4DZP A;  1V54 H;  4C2T A;  1MW7 A;  1USS A;  3SDG A;  2F6C A;  2Z1D A;  5CYV A;  1VQ9 I;  4ZDP A;  1B9M A;  4U7B A;  3PJR A;  4W1U A;  3DLL F;  2LG4 A;  3CCQ I;  3N4M A;  2Q2E A;  4YFK F;  3R0J A;  4LK1 F;  3IH2 A;  3GBG A;  5JVG F;  4X0G A;  1NTC A;  5E18 F;  2JUG A;  5LEK A;  3R60 A;  4J00 A;  2DPU A;  3OY9 A;  2OC6 A;  4BGD A;  2ZJ2 A;  4CCM A;  2R4G A;  2GZW A;  5H20 A;  3LWF A;  3LSK A;  1P4X A;  1IDY A;  1SD6 A;  1TNS A;  3BG5 A;  4NDL A;  2ZFU A;  4NQW A;  2VJJ A;  2F5C A;  1MBF A;  3PSI A;  2W7N A;  2HXO A;  4I2O A;  2JJ7 A;  4HW0 A;  3RKW A;  3BTI A;  4GRI A;  5CVU A;  1BOB A;  1AKH B;  5FLX K;  1IF1 A;  3ZXS A;  3BTC A;  3DKW A;  3VEP A;  3M7G A;  3K7A J;  4RAY A;  2IPQ X;  1CF7 B;  5M3M J;  5IT9 Z;  1U5T A;  3VFZ A;  4OIP F;  3BR2 A;  4EJU A;  3EYY A;  1R1U A;  3F8C A;  1IC8 A;  3FXR A;  4KMF A;  2AO9 A;  4DIQ A;  2VOO A;  4RAG A;  3GW2 A;  3P7N A;  1P9Q C;  5CVR A;  2XKO A;  4ESB A;  4CGZ A;  2NYX A;  1TWH J;  4D5C A;  1U9O A;  2V7F A;  3QU3 A;  2RNJ A;  3D0S A;  3HIF A;  3QOD A;  2X4H A;  3WU0 A;  5BNG A;  4XQF A;  2R5Y A;  3I54 A;  2X6X A;  3CJT B;  2QA4 I;  1H89 C;  2JQ7 A;  2R7V A;  4GXO A;  4Y3O A;  4F93 B;  2HPI A;  3I59 B;  1GXQ A;  5JHU A;  4O6J A;  1I39 A;  2HTS A;  4KIS A;  3IH3 A;  1MMA A;  5M5X J;  1JKR C;  3MZ8 A;  2GWR A;  1I3A A;  3T1B A;  2X51 A;  5DM7 F;  1FJL A;  4D7M A;  2Y9Y A;  2XAF A;  1E3O C;  1B6A A;  3CF5 F;  3CC7 I;  2JMW A;  4H0E A;  3LAP A;  4HX7 A;  2PMZ N;  4XRS A;  1YS6 A;  3IL2 A;  2VQH A;  3HZJ A;  1STZ A;  2XRL A;  1RET A;  1EV7 A;  4AID A;  1M1E B;  3IKV A;  4NNJ A;  4DOZ A;  2MD5 A;  2LD5 A;  1BR1 A;  2YX7 A;  5D8L B;  3WTT C;  4E7K A;  4ZJZ A;  2RQP A;  3W2W A;  3V7S A;  1JJ8 C;  4KFC A;  3BLY A;  2VAS A;  2PJR A;  4HNU A;  3RPQ A;  5FJ8 J;  4EJO A;  1MKM A;  1YJ9 I;  3IWZ A;  5ICG A;  5ILU A;  1B4A A;  3KEQ A;  1VF9 A;  3ML6 A;  5IT3 A;  1DU0 A;  2VQC A;  3CTA A;  4F92 B;  3L7W A;  1QZZ A;  3B73 A;  3WU1 B;  4ENK A;  2IA0 A;  4P9F A;  5E79 C;  4I0A A;  3O6B B;  4A3E J;  3I9V 2;  1A36 A;  1KQ0 A;  4LJZ F;  5DV5 A;  3CJR B;  3MFK A;  3PL8 A;  4O3M A;  2NS0 A;  4UVC A;  1OLT A;  3S2W A;  2LK2 A;  3HOU J;  2BY2 A;  1AHD P;  3MKW B;  3MD2 A;  1R00 A;  5K5Q A;  2HKX A;  1JHH A;  5HNH A;  2CH0 A;  3GZN B;  1PJR A;  4HEA 2;  1G3W A;  3DEE A;  5EDN A;  5FRN A;  2BV6 A;  5IYB J;  3TGN A;  4A6E A;  1R23 A;  3LSM A;  3ZP5 A;  2X85 A;  5D5V B;  2IW5 A;  5IYD J;  2P5V A;  4FT8 A;  3BC8 A;  2ME0 A;  1FOK A;  5CQE A;  1X19 A;  3RZO J;  1LVA A;  2ADU A;  1D0X A;  1RR7 A;  2K85 A;  1X1P A;  3W6J B;  1VQ4 I;  3U9G A;  4Y52 J;  4DQ2 A;  4LIU A;  2FUG 2;  3IWF A;  5D8K B;  2JA5 J;  3DF8 A;  4PDK A;  1X4P A;  5F27 A;  4LG3 A;  3H35 A;  1MNM C;  3DLA A;  1BW5 A;  4YG2 F;  2EB7 A;  3IRQ A;  4UUS B;  3G4S I;  2FBH A;  2KIU A;  3SFZ A;  1GV2 A;  1KYW A;  2KIF A;  1K78 A;  1D8K A;  2FOW A;  2XIG A;  3BP8 A;  3OYD A;  2RRE A;  1RZ4 A;  1T2K A;  3X2Q H;  3NQO A;  3D5R C;  4D9J A;  3W6K B;  1WJA A;  1VFC A;  1D1B A;  5GAD J;  4HZF A;  4LFU A;  5E1X A;  4HYE A;  3HSR A;  1T56 A;  4OMZ A;  3BJ6 A;  2W1O A;  2GOX B;  3EDP A;  2EK5 A;  3QYB A;  2ZCW A;  2ID3 A;  2M34 A;  3K4K A;  3HTU A;  1WJB A;  1ZYR F;  3LFK A;  2VQG A;  1UAA A;  2P0W A;  4HV6 A;  1SAN A;  5BS6 A;  3WE3 A;  3PUF A;  1L3L A;  1JUS A;  1R4N B;  2MFZ A;  5C44 J;  1WHU A;  2A6E F;  4MQ9 F;  3M9A A;  1SFO J;  3H0D A;  2PMZ A;  2BZT A;  2JA7 J;  4IRI A;  1EKE A;  4G94 A;  1S7O A;  4E7H A;  1V3F A;  3JRI A;  4L9T A;  2MAB A;  3QU6 A;  5FKM A;  2ZJQ F;  1P4A A;  3C7J A;  2Z16 A;  1X2N A;  3L1P A;  1Q1V A;  1Z1D A;  2QCO A;  3RPU D;  1NK3 P;  2QQ9 A;  2VLA A;  5HVQ C;  1U2W A;  2VUM J;  5K1Y A;  2X9D A;  4M9S A;  2CU7 A;  1O7F A;  4PSX A;  4RB3 C;  2KT0 A;  2KZG A;  2R5Z B;  2MH2 A;  3H3Z A;  4ON0 A;  2L54 A;  2GAU A;  3HRT A;  3DU6 A;  3OSG A;  3Q5F A;  3V8J A;  3JRE A;  2FU4 A;  4FX4 A;  3CUQ A;  2O5R A;  5E8I A;  3Q0U A;  2OTJ I;  2DJN A;  4PFP A;  4ASN A;  3ZQH A;  1F4K A;  1W5C C;  2F5E A;  3ZMT A;  3FBI B;  2LKP A;  3L2R A;  2UXN A;  1OQY A;  3RYP A;  2R7T A;  3HSF A;  3I71 A;  4YIR X;  1VQ7 I;  3GTK J;  1OFC X;  1QO0 D;  4L9V A;  2TRT A;  3E5U A;  1YJN I;  2DOF A;  1ETW A;  3FM3 A;  1ZLJ A;  2Y69 H;  3GFJ A;  5IP6 A;  1Y39 A;  4XOP A;  1T33 A;  3K0L A;  4C3J J;  3DQV C;  3BZK A;  4FHT A;  3IC7 A;  2L9V A;  4HX8 A;  1A6Q A;  4MEY F;  2P6S A;  1R5I D;  2EZI A;  1XSD A;  1S7E A;  3VSK A;  4Q5S F;  2LLK A;  2P5L C;  1JE8 A;  5LFA A;  2E2I J;  3B02 A;  3K6G A;  3KX2 A;  2IJL A;  3O8G A;  2DDB A;  4RLF A;  3W3C A;  2ZFW A;  4BQN A;  1JTY A;  1O7L A;  1UHS A;  2ZXH A;  3PNV A;  4CYD A;  1BR4 A;  3ZMU A;  1WJD A;  1OMI A;  1XPX A;  3FZV A;  3S93 A;  1NG6 A;  3OIP A;  1JGG A;  5DCM A;  3G71 I;  4GYI A;  4EJV A;  2B7E A;  5JI6 A;  3FIW A;  5FFZ A;  1SFU A;  2V9P A;  3R4K A;  3HM5 A;  2RVC A;  3WG7 H;  3CCL I;  5A2Q K;  4IHT A;  4GGG A;  4XLH A;  2DA4 A;  3Q9V A;  2EV0 A;  2FOK A;  5J6X A;  3RKX A;  2O7O A;  2LFB A;  2PMH A;  3MVP A;  3RQ4 A;  2YUS A;  3FXU A;  4BEH A;  2EWN A;  4XBF A;  4XKW A;  1O3R A;  5F64 A;  2Y9Z A;  1A6I A;  2W48 A;  5F0F A;  1KQ8 A;  2EFO A;  2KQR A;  1FIA A;  3CCR I;  3SZG A;  2P4W A;  3VYS B;  3MMY B;  1A04 A;  3S1Q J;  3QPT A;  2XPV A;  2RDP A;  1BOA A;  3V7R A;  1GHC A;  2DYR H;  1ENH A;  5FKK A;  1MJA A;  2AQF A;  3GO5 A;  3U1K A;  1OCZ H;  2BW3 A;  1D5V A;  1JXS A;  4XN3 A;  5KK1 A;  3VYT B;  4ESF A;  2ISZ A;  2LOO A;  3Q0W A;  4CUG A;  3HPH A;  1XSV A;  3NWS A;  1B9N A;  1ZH5 A;  3T5X A;  1JUP A;  1QVT A;  2VKV A;  3VOD A;  2FML A;  2JUC A;  4BJ6 C;  2B9S A;  4ZH4 F;  3EUH A;  1HA8 A;  3AG3 H;  5LHG A;  1B8I A;  1JGS A;  4MO7 A;  3TP0 A;  2ID6 A;  3ZQI A;  3OYA A;  2K7L A;  5JLX A;  5JR3 A;  5C4J J;  3HOY J;  1JT6 A;  1IXS B;  1ZKG A;  5J47 A;  1WPK A;  1ZRC A;  5GAH J;  1QNT A;  1U3E M;  2JPC A;  2QBY A;  4UY8 I;  2BE5 F;  2NVQ J;  3C2H A;  3WGH A;  1I27 A;  3FWE A;  4KMU X;  3CLO A;  1WJC A;  3L00 A;  1ACI A;  1AWC A;  3I55 I;  1UG0 A;  3OYN A;  3FDY A;  4Y15 A;  2UWM A;  1D0Z A;  4ENN A;  3KLN A;  1SVM A;  2NOG A;  1RR8 C;  1F5T A;  1I5Z A;  1XGM A;  2LNB A;  3A01 A;  4HDU A;  1J59 A;  1N25 A;  1G4D A;  3L09 A;  4QWQ A;  5EG0 B;  1ZRE A;  2P7V B;  4HX4 A;  4FAS D;  4HNV A;  4JX6 A;  2CQK A;  4IZZ A;  1YW7 A;  2ZXW H;  2LKS A;  3RCO A;  3WG9 A;  4DNC A;  2O8X A;  3A02 A;  1IW7 F;  4YRV A;  4A0X A;  3E0J B;  4N9I A;  1MSF C;  3E7L A;  3DFG A;  4LIV A;  1U6G A;  1WI9 A;  1OR7 A;  1BC7 C;  4UUV A;  5GPA A;  2O8K A;  3BRO A;  3PUB A;  3IHU A;  2UV1 A;  3RZD J;  2VKH A;  4BY1 J;  2CO5 A;  3TP3 A;  3ERE D;  2R0Q C;  1T0F C;  3J80 K;  2WWY A;  2OCC H;  2XGC A;  2OUM A;  1EH6 A;  1YRN B;  1N77 A;  3SQN A;  4PJM A;  5CVJ A;  4EM1 A;  1I3Q J;  3H9G A;  3RSN A;  2RN7 A;  4C9Y A;  3WTX C;  1Z7L A;  1O57 A;  1GT0 C;  3JRG A;  2CW8 A;  4P55 A;  2QSF X;  4JOM A;  4KYW A;  4NC7 A;  1KU7 A;  2CUZ A;  1IN6 A;  1UEL B;  4U0W A;  4V19 K;  1SFX A;  2K9Q A;  3KLO A;  2CV1 A;  4KNY A;  2M87 A;  1REP C;  1YJW I;  3TOB A;  1FOX A;  3W2V A;  3CCJ I;  3H36 A;  1HQC A;  2WC2 A;  2OV7 A;  6PAX A;  4M74 A;  5L3F A;  2R7U A;  1TQM A;  4CH7 A;  1YLF A;  4QSH A;  2KKO A;  3ZN0 A;  3CCU I;  4HPQ A;  4XOT A;  3F3X A;  5IYC J;  3BQY A;  2JTV A;  1LNW A;  1LKX A;  3IP4 B;  3J7A Y;  4IHV A;  1T08 B;  2UUZ A;  1X3U A;  5KAF C;  3LNQ A;  1D0Y A;  3K10 A;  2ELK A;  2QGU A;  1XGO A;  3V7C A;  2JA6 J;  2V1N A;  1B1B A;  4Q4Z F;  4M6Y A;  3FIS A;  1WCM J;  1IN7 A;  5M5W J;  2GA1 A;  2L4A A;  1FWZ A;  3OYH A;  1OYW A;  3F0C A;  3JR9 A;  1GVJ A;  1IXR C;  4G6Q A;  5A2Q Z;  2W85 A;  1MMG A;  5E17 F;  5E20 A;  2XF6 A;  2IRF G;  1KU3 A;  2Q0O A;  1ORK A;  1W5T A;  1A35 A;  4AU7 A;  4MHG A;  3J7Z I;  3DKY A;  1E17 A;  1ON1 A;  1T8I A;  1GV5 A;  4LD5 A;  1XX5 A;  1W7P B;  4L9J A;  5JVT A;  1OCR H;  4S04 A;  5J4V A;  2IGM A;  4A5N A;  2OCE A;  4XLE A;  3QWL A;  3ZMS A;  2E19 A;  4DYR A;  1IN5 A;  2BY0 A;  5EJC A;  1QGP A;  5KCM A;  2X6W A;  1TTY A;  2KRH A;  1R22 A;  2MBF A;  1MH3 A;  5D5W B;  1B72 B;  4KN4 X;  5CKT A;  1PVE A;  2EIK H;  2HVQ A;  3E5Q A;  2KLO A;  2DMU A;  3IH4 A;  4BHP A;  5DS9 A;  1S7A A;  5F1J A;  1KU2 A;  1QBJ A;  2LF7 A;  1XCB A;  1FX7 A;  2DA3 A;  2G7H A;  4WXC A;  2LRD A;  5HLH A;  1VQP I;  2DA1 A;  3ZMZ A;  2COM A;  2VE8 A;  2HQ5 A;  4M3F A;  1QRY A;  2M30 A;  3OOU A;  3ABK H;  3LAJ A;  4II2 A;  3S17 J;  4KIG A;  1E3H A;  4UUT A;  5BMZ A;  3KZZ A;  3S1R J;  4LLL A;  1R4M B;  1ETO A;  4KT6 A;  3F6O A;  3Q3S A;  3K69 A;  2VPL A;  2K86 A;  2EIM H;  2K9S A;  2ESH A;  2XV4 S;  1QPI A;  2ZXJ A;  1BA5 A;  2HOE A;  2BY1 A;  5CJ9 A;  4A3G J;  1IRG A;  3I3L A;  2Y0S N;  3BG7 A;  3OIO A;  1OJL A;  3H5N A;  1LUJ B;  1J2X A;  3DTK A;  3VSL A;  1QZY A;  1JHF A;  1V4R A;  1LE8 B;  1VQ5 I;  2CG4 A;  1QPM A;  4MIM A;  4XLF A;  3V42 A;  2PQ8 A;  4A0Y A;  2QQA A;  4EVI A;  4XLA A;  4EAT A;  3SZP A;  1IAW A;  3KET A;  1K4T A;  2V6E A;  2R7O A;  1BN5 A;  1LDJ A;  2IA2 A;  3WTW C;  2LBF A;  1ZK8 A;  2E7W A;  3U21 A;  2Z2S B;  2P7C B;  2QZ8 A;  2HOT A;  3HEF A;  2PN6 A;  3GWZ A;  5E3N A;  1PUE E;  5LGU A;  3HOX J;  3A2K A;  1ON2 A;  2XAS A;  4EJT A;  2A5W A;  4HAM A;  1ZR2 A;  3TMO A;  2MD0 A;  2XUB A;  4UVB A;  3PSF A;  3LQR A;  3SDB A;  4IKF A;  3GYH X;  1GDT A;  1O3Q A;  3GXO A;  2Y48 A;  3S3M A;  1TQI A;  4FIS A;  3J80 Z;  2VJI A;  3ZQG A;  4IF4 A;  1RKT A;  2GOM A;  3U1D A;  3S15 J;  3QPS A;  2A61 A;  3HOS A;  5FD6 A;  1DPU A;  2BGC A;  5L3B A;  3A0H C;  3K4L A;  1FLI A;  2E7X A;  3OOP A;  3CD6 I;  3KP2 A;  4KUM A;  1BR2 A;  2ECB A;  2AXT C;  1SD5 A;  2CSO A;  3MKZ A;  4J01 A;  2XGE A;  2KP6 A;  2D45 A;  3K70 D;  1ZGA A;  4RAF A;  1L0O C;  3L9F A;  3H9Q A;  5ED4 A;  1LVK A;  4R1H A;  3L2C A;  1J09 A;  1DPR A;  1HKQ A;  2XF7 A;  1Y1W J;  4A3L J;  4RGS A;  4BQA A;  1MIJ A;  1ETQ A;  1UHW A;  2EJR A;  3ROU A;  2IAI A;  5B66 C;  2EIJ H;  2HWV A;  2VBZ A;  2W00 A;  1VQK I;  2MC4 A;  2H09 A;  2QKM B;  3WTZ A;  1UST A;  2WAQ N;  3LFU A;  3RPU A;  4L5I A;  2ZJP F;  1TT0 A;  2V9V A;  5IPA A;  3BR3 A;  5GAG J;  4IVN A;  3JAM K;  1UCR A;  4Y17 A;  4IQJ A;  1ZR4 A;  2IVM A;  3CLQ A;  3S1N J;  3RQI A;  4E7Z A;  5LRS A;  1MDM A;  1YE9 A;  1GVD A;  4ITV A;  1YW8 A;  1MND A;  2ZME C;  2ELJ A;  2TCT A;  3KEO A;  4C2M J;  3ZOB A;  2LRE A;  4JX4 A;  2ZME B;  3BG6 A;  2MLG A;  1D1C A;  2R7F A;  3PNY A;  1FOW A;  5HDK A;  2EZH A;  5EGO B;  1IGN A;  2EIL H;  3K1N A;  3GTM J;  2Y2Z A;  2M7A A;  1WKM A;  2KFD A;  3NEU A;  2P81 A;  2FX0 A;  1S9H A;  2IS4 A;  4ZZD A;  2DPD A;  1TQP A;  2CQN A;  4F52 A;  3CP2 A;  2Y0S A;  3CP8 A;  3WE2 A;  4BBS J;  1BI2 A;  3CES A;  4QLC U;  3BPV A;  4M9X A;  2PX9 A;  3LA7 A;  4G7Z F;  2IS6 A;  5ERI A;  4U0Y A;  4UHT A;  3HSE A;  1WH7 A;  5LBQ A;  2A69 F;  3ASO H;  1WSU A;  4KT5 C;  2VJ4 A;  1PP7 U;  1XC5 A;  3HUG B;  3HRM A;  3OYL A;  3IKT A;  1ETY A;  2R7R A;  3TDU C;  4U0V A;  2E2J J;  3S2H J;  2VT2 A;  2IS1 A;  1HKS A;  1SAX A;  1JKP C;  1VQ6 I;  4FE7 A;  4B44 A;  3DP7 A;  2DLL A;  3F6V A;  3V4G A;  3C2G A;  3HBL A;  5TRD A;  2HQA A;  3CC4 I;  4RS8 A;  4UB6 C;  2Q1Z B;  4MTE A;  3OS0 A;  1RI7 A;  2RGV A;  4OU0 A;  2STW A;  2HVR A;  3BPX A;  3U2R A;  3FXQ A;  3TDZ C;  4IJA A;  3G2B A;  1R36 A;  4A5M A;  1V5G A;  1YI2 I;  1LPQ A;  1WVR A;  2DBB A;  3WHB A;  2XVC A;  4HLY A;  1LFU P;  2DQR A;  2X6Y A;  1XMA A;  1H9T A;  4I76 A;  3E6B A;  4GCV A;  3WTV C;  2JN6 A;  4IPA A;  1BIA A;  3CJN A;  3OS1 A;  4A3B J;  4X6A J;  3RKQ A;  2DAO A;  3A03 A;  4N0B A;  2EA4 A;  3L2U A;  4FE4 A;  1HW1 A;  1LJ9 A;  4R79 A;  1MNE A;  4PJ0 C;  3BR6 A;  3OL4 A;  2E36 A;  1G59 A;  3LST A;  1HF0 A;  1R71 A;  1G3T A;  4M71 A;  4OIN F;  2GQQ A;  4OOI A;  3P9K A;  1SMT A;  5F04 A;  2LP0 A;  3GUD A;  3JSO A;  4BE2 A;  2NS8 A;  4NUB A;  4MEX F;  4G8X A;  2HEO A;  1I6X A;  2CUJ A;  2NS7 A;  3ZN1 A;  2V1D A;  2DXI A;  4FET A;  5IY5 H;  3NRV A;  1OIS A;  3O8H A;  2ECC A;  1WI3 A;  1APL C;  2DJI A;  1HSJ A;  1XGS A;  2E1N A;  1ONV A;  2WAQ A;  3E5X A;  3FBN B;  4ZYG A;  3OYJ A;  1R9T J;  3O3K A;  4I7H A;  3FMS A;  2VC0 A;  4RAZ A;  4PCQ A;  3DU5 A;  2FRH A;  1TP4 A;  1W1W E;  3NWT A;  3VDX A;  2IS2 A;  2R7D A;  2XAJ A;  3K4J A;  3P9I A;  4KDP A;  2E71 A;  2I10 A;  3K70 C;  5L3D A;  1ZRD A;  1MJ9 A;  3QPH A;  3B6A A;  4I02 A;  1ZLK A;  1J9I A;  3BWG A;  4I09 A;  2DQL A;  2ZJR F;  4RGU A;  3SEZ A;  1XS9 A;  2HPM A;  1ZRF A;  1OPC A;  2E34 A;  2XPW A;  3HC7 A;  1W4M A;  3BTL A;  3TQN A;  2B63 J;  1S6L A;  2WAF A;  3KIO A;  5J8F A;  2M2E A;  3NAR A;  5FLX Z;  3OYB A;  2HDC A;  1FYM A;  1BI3 A;  3SHF A;  2DN0 A;  2WTE A;  4B3A A;  4B43 A;  2VXZ A;  3P9C A;  2M45 A;  4E6K G;  1FT9 A;  4ANJ A;  4KIC A;  4BNC A;  4BQQ A;  3BDD A;  1A5J A;  5GP9 A;  1AA7 A;  5HLT A;  4XIC A;  3K4B A;  3ECH A;  1OCT C;  4RDU A;  4XID A;  3T8T A;  1Y0N A;  3F8M A;  4BUP A;  1I1G A;  2F4I A;  3PFY A;  3OMY A;  1D8J A;  5D6F A;  5EZH A;  2Z99 A;  4BHC A;  2IEK A;  4LG0 B;  1Z9C A;  1BM9 A;  1W0U A;  4HLX A;  3JAM Z;  3MWM A;  3HB9 A;  1ETV A;  2R92 J;  2MC3 A;  1R5G A;  4U7D A;  3ISP A;  1X1B A;  4ZYD A;  1MMS A;  4BE1 A;  1S72 I;  1MBH A;  3M07 A;  1POG A;  4ZYH A;  5BQT A;  4A3K J;  5JFR A;  1HBX G;  2CYY A;  2VC1 A;  5K5O A;  4PJL A;  4C2U A;  2MSY A;  4WWC A;  4NHJ A;  1WRJ A;  4XRF A;  2XF5 A;  1U9N A;  2WV1 A;  2PLY A;  1FMW A;  5DD4 A;  2DOA A;  2VE9 A;  2X0L A;  4RLQ A;  2KRC A;  3EET A;  4C30 A;  4RM3 A;  1KZH A;  1R7J A;  2FD5 A;  2KJB A;  1B59 A;  2KMU A;  2DDA A;  1YHQ I;  3EYI A;  1SVO A;  4MGR A;  3G6E I;  1X1D A;  4UB8 C;  2MA3 A;  3KYD B;  3L2V A;  5KNL A;  3LSH A;  3M8E A;  1K61 A;  3O2P E;  4XLC A;  1ZHF A;  1V5F A;  1FY7 A;  2CUE A;  2WY7 Q;  4DJA A;  2XRN A;  3LSG A;  3GEZ A;  4P9U A;  2DT5 A;  1DGW Y;  4Y4R A;  3E6M A;  3A4C A;  4RB0 A;  4YEL A;  1AKH A;  1NK2 P;  2L01 A;  4A3M J;  3K4M A;  3ZCO A;  4G7H F;  1S29 A;  5J1Y A;  2FQ4 A;  2ELH A;  4ZYE A;  2VB6 A;  4AM3 A;  2FE3 A;  4MFE A;  1HDD C;  5BPI A;  3WGG A;  3OSF A;  2QLZ A;  2FJ1 A;  4Y7N J;  3VYU B;  4M3G A;  5LLQ A;  1MMN A;  5K7H A;  4CYC B;  2JSC A;  4CZC A;  1BC8 C;  4G12 A;  3MN2 A;  3KE2 A;  1SD7 A;  3CCE I;  3CCY A;  2FF4 A;  3S3N A;  1HW2 A;  2D2W A;  1C0W A;  2F5D A;  1TWA J;  1ZTR A;  2K4J A;  3OYF A;  5AIP A;  1PUF B;  3OYK A;  2ACJ A;  2IT0 A;  2OPT A;  3C3W A;  3I59 A;  4YEJ A;  2JWT A;  1J75 A;  4RB1 A;  1A31 A;  1RRJ A;  1R1T A;  2X1D A;  3KZI C;  4I01 A;  3CDL A;  3OYG A;  5EEH A;  4B4C A;  1T95 A;  5FKL A;  3WTS C;  4IHX A;  3CCV I;  2VBY A;  2LTP A;  4B1R A;  4BH9 A;  1V55 H;  3M1C A;  5KVR A;  2YR2 A;  1RPW A;  1XSX A;  2OQR A;  4HG2 A;  5ILV A;  3MZH A;  2Y0M A;  3SEQ A;  2CFO A;  2EFW A;  3F21 A;  3LL7 A;  2R7Z J;  3PIO F;  1WJ5 A;  3JW4 A;  3D5S C;  2NNY A;  3UKG A;  1H0M A;  4CCK A;  4DBQ A;  2L7M P;  3H5A A;  2K9L A;  2HQR A;  3GTP J;  2LY1 A;  1MJB A;  4IXA A;  2R3S A;  5B3S H;  3FXJ A;  1ODD A;  4K2E A;  2KHM A;  3LSI A;  1FYK A;  4OIO F;  4XM3 A;  1XMK A;  4B3X A;  1BW6 A;  4A12 A;  2DOD A;  1FMV A;  1SEU A;  1R58 A;  4HRI A;  3ZQQ A;  1D1A A;  4RM2 A;  2O6G E;  2FNP A;  3ZR8 X;  1ZEL A;  2WV0 A;  5D4S A;  2G9W A;  2F4O B;  3S32 A;  3JCU C;  5FLV A;  4GFB A;  4N4O B;  5F0H A;  2AHQ A;  5J1R A;  4CA0 A;  1X3Z B;  2Q2E B;  2KIM A;  4F7Z A;  1IDZ A;  2H94 A;  1RKW A;  2STT A;  2Z5U A;  3DTE A;  3MAJ A;  1WZ2 A;  1QQI A;  1Z3X A;  2PFB A;  5EF6 A;  2K9N A;  2M1B A;  2DO7 A;  1NH3 A;  1WJF A;  1H8A C;  3H92 A;  4UV9 A;  3UR3 C;  1X1A A;  2KPM A;  3C1D A;  5KAI C;  2VL8 A;  1MBE A;  4GO1 A;  5HOO A;  4LIT A;  1OCO H;  4IRH A;  3COA C;  5J4Y A;  2DTR A;  2OU2 A;  4GYG A;  4NQW B;  3WOD F;  3JRB A;  4S05 A;  5C4X J;  4BY7 J;  4P5O A;  2EV5 A;  1FSE A;  2DT6 A;  1R49 A;  2IGK A;  3I4M J;  2UZK A;  2JT1 A;  2XAQ A;  2BHY A;  3CMM A;  5F0C A;  1X1C A;  2GIZ A;  3HGG A;  4BYY A;  1ZG3 A;  1O4X A;  1HC8 A;  1U5T B;  4NBQ A;  3J81 K;  1CQT A;  3AL0 B;  5HDG A;  1YW9 A;  2A68 F;  1G6N A;  1ETX A;  3OR2 C;  1DP3 A;  3SZT A;  4UUS A;  2K3P A;  4NC8 A;  4EM2 A;  2XAU A;  5B1A H;  4L18 B;  4LLG F;  3M3Y J;  1LDK B;  4M72 A;  2R5Y B;  3WU2 C;  3I53 A;  3OS2 A;  2JA8 J;  2GXG A;  1R5H A;  3OYC A;  1S3J A;  1S5L C;  5CQG A;  3SYT A;  3WTU C;  5AON A;  2QF7 A;  2BXZ A;  5GTH C;  5E3M A;  3I5U A;  2D5V A;  4HBL A;  5DD8 A;  1D3Y A;  1X2M A;  3H0G J;  4D5F A;  4KA4 A;  2GBY A;  3L2W A;  1TWG J;  3BJA A;  3HKZ N;  3E3V A;  2KDO A;  1DP7 P;  3OL3 A;  3H3V K;  4IHS A;  2ISY A;  4IHY A;  4A3D J;  3G3Z A;  1G8X A;  4Q48 A;  1IUF A;  3J7Y J;  4BAC A;  2E1M C;  2B0L A;  4PJJ A;  4IOC F;  1T98 A;  1FBQ A;  4HQM A;  2DT7 B;  1K79 A;  2E1M B;  1VQL I;  1Z67 A;  2EQR A;  4QPQ A;  1XTA A;  2ME6 A;  2O0Y A;  5TGT A;  5DEQ A;  3CCS I;  4BDZ A;  2W84 A;  1JKQ C;  4HF2 A;  1VQN I;  3JRA A;  1XDS A;  1QHH D;  2M9H A;  2DK5 A;  4A3J J;  3HG9 A;  3EPZ A;  3VWB A;  3MCZ A;  3ABM H;  4D7N A;  1IJW C;  3BY6 A;  3V8L A;  2PJR B;  3RI4 A;  1MBK A;  3GTQ J;  3I64 A;  4EGY A;  1VQO I;  3D1N I;  4ABZ A;  2QEN A;  1HCR A;  2XB5 A;  2FMY A;  5E1Z B;  3VOE A;  2XAG A;  2QM3 A;  1UMQ A;  2FEZ A;  1TLH B;  2A5Y B;  2M4G A;  2R5Z A;  2X6O A;  1HST A;  2XRO A;  1Z7U A;  3CMA I;  5LGN A;  4A6D A;  3QP5 A;  2Q8K A;  2QEX I;  2CUF A;  2F5V A;  4BXX J;  1YX5 A;  3ABT A;  1O3S A;  3D5L A;  3DPL C;  4WF2 A;  2BY3 A;  2XGD A;  2QYO A;  1XD7 A;  4HOB A;  2DMQ A;  3QQA A;  3CCM I;  3BOQ A;  3I58 A;  3HRU A;  3SJM A;  1ERD A;  2OF7 A;  3DXJ F;  2YPR A;  1P92 A;  4QIW N;  3CJQ B;  4PFO A;  5D6E A;  4ETS A;  1R1V A;  3PIP F;  1IRX A;  1JT0 A;  2QQB A;  2LMD A;  1AOY A;  5M5Y J;  3BG9 A;  1CGP A;  4BQO A;  1WH5 A;  2J5O A;  3KEY A;  1UZC A;  2HYG D;  4HNT A;  2H1L A;  2XDV A;  2XGX A;  4RGR A;  1DGR M;  2YU9 J;  2EIN H;  5CPR B;  1K7A A;  4UNO A;  4OWR B;  2LY9 A;  1Z0X A;  3M8J A;  2VJ5 A;  3ZQC A;  1J5Y A;  4L0Y B;  1W36 C;  2FBK A;  3LSR A;  3RDI A;  3CC2 I;  1J7K A;  1X4O A;  3ONQ A;  4FCY A;  3H3U A;  3OYM A;  1FBU A;  1UFM A;  3IAS 2;  1IRZ A;  2K4B A;  1Y0U A;  1K78 B;  2DW4 A;  1KON A;  2JRT A;  4WX9 A;  2FQ3 A;  2LF8 A;  4CDG A;  3GME A;  1QVU A;  1Z05 A;  4CO8 A;  2IBD A;  1KQ9 A;  1BI1 A;  3GF2 A;  1E3P A;  1FTT A;  1ZG5 A;  1ZAO A;  5DUK A;  5IOZ A;  2GM4 A;  2VT3 A;  3FXK A;  1WGX A;  2W25 A;  3FKI J;  1I6H J;  4G9Y A;  2ZNY A;  4L5E A;  2VOD A;  2VBX A;  1U0J A;  2OBP A;  4V2G A;  4PUS A;  1K4S A;  5F1R A;  3DV8 A;  3HKZ A;  5J8C A;  2NVX J;  2M8G X;  3HGY A;  3HOV J;  2L7F P;  4DBR A;  4DZJ A;  5BOX A;  2EH3 A;  3K2A A;  3HXL A;  4XKB A;  1VI0 A;  4RB2 C;  3NAU A;  5DUI A;  4JBA A;  2EA2 A;  1XB4 A;  3QP6 A;  3J81 Z;  2OD5 A;  1JUM A;  2X1C A;  2L9S A;  3C18 A;  2DA7 A;  3OV8 A;  4YFX F;  5ILS A;  1ZG1 A;  4HV5 A;  4S0H B;  2OJE D;  2E2H J;  5K7Z A;  2BYV E;  2M0M A;  3CO6 C;  2GXA A;  2G7U A;  4FX0 A;  2ICW G;  1QU3 A;  4BHB A;  3AAF A;  3OYI A;  1AU7 A;  3HRS A;  4DW6 A;  4EGZ A;  3OYE A;  1HLV A;  4IQ4 A;  3BQZ A;  4M3B A;  4OAY A;  4A69 C;  4N9H A;  5L3C A;  2HI3 A;  3V8K A;  1IXC A;  3PQJ A;  4B47 A;  5JHF A;  4M73 A;  3CUQ B;  4E7J A;  2HU9 A;  1FTZ A;  4XL9 A;  2OTL I;  1I50 J;  2RNG A;  5F08 A;  4E7I A;  4F55 A;  2R7Q A;  5ICF A;  1MGT A;  2FBI A;  4A3F J;  3ECO A;  1F36 A;  4B48 A;  4Q47 A;  4LGW A;  5JLW A;  4V2F A;  5GTI C;  1RES A;  1TZL A;  5E8G A;  2L5Q A;  5DM6 F;  2VOP A;  5HLG A;  1YQA A;  1BL0 A;  4DYQ A;  4LLN A;  2O03 A;  3M4O J;  3FM5 A;  3S8P A;  2JRM A;  4N4N B;  1DU6 A;  3TOA A;  3WTY C;  3GCM A;  5HS7 A;  3FX3 A;  5IP9 J;  1S8N A;  2PI0 A;  1FNN A;  4F91 B;  5EG0 A;  3FK7 A;  4WXD A;  1DQU A;  3FHN A;  4BBR J;  1GUU A;  3TW6 A;  2EFP A;  5L3G A;  3K4C A;  4PGG A;  4R8H A;  2VKE A;  2P5K A;  3E6C C;  1YO5 C;  2HVS A;  4XLN F;  2LC2 A;  3I4P A;  5GPC A;  5ICE A;  3HHH A;  3F8N A;  1ZAR A;  2Y30 A;  4BL0 B;  1FIP A;  5CVI A;  3KP7 A;  4E70 A;  2HOS A;  3GFM A;  2XC7 A;  4E7S A;  3LOC A;  2L2O A;  1RUN A;  1SVL A;  2ZC2 A;  4AYB N;  5B1B H;  4OAZ A;  2LR8 A;  3ZMV A;  3QPL A;  5M3F J;  2EFN A;  3PQK A;  5FFX A;  3ZGK A;  3I56 I;  2HS5 A;  5HNF A;  4UXN A;  3J7A O;  5DCM B;  4I0B A;  4G6D A;  2IP2 A;  2OQG A;  2ESN A;  3BZ6 A;  1Y1V J;  2K5C A;  3CF2 A;  1YRN A;  3CUO A;  2HYJ A;  1T0F A;  2EBI A;  1WJE A;  2NAZ A;  3OR1 C;  2HDD A;  1NHA A;  4BE0 A;  3DPT A;  4BEH B;  2KZV A;  1KA8 A;  3FKJ A;  4M3E A;  4ESJ A;  3HTS B;  5D5U B;  2RQQ A;  2RAE A;  1W0T A;  1HXD A;  3R6S A;  2CFX A;  2KJC A;  3EUK L;  2A6T A;  4XLP F;  1FBS A;  4G7O F;  3BR1 A;  4RBO A;  1RIO H;  2DA2 A;  2Z3Y A;  4P1W A;  3CDH A;  4IOA F;  2VN2 A;  1JKO C;  2YS9 A;  3HYI A;  5IOY A;  3F9K A;  2LKX A;  1OYY A;  2IA1 A;  2M7B A;  4AD9 A;  4EJW A;  3IRR A;  2BW3 B;  1U8R A;  1SAU A;  2HZT A;  2XHK A;  2FA5 A;  3TED A;  2L4M A;  1OCC H;  4A3C J;  3W2A A;  3ELK A;  3PNT A;  3EUH C;  1VND A;  3BT9 A;  4XSX F;  1SFK A;  1IN4 A;  1RC9 A;  2QVO A;  1TL8 A;  1MZB A;  4KN7 X;  3TKY A;  3BCB A;  3F72 A;  2LYC A;  1ITY A;  2YX4 A;  1B8I B;  3K1P A;  3E6D A;  1XCV A;  2NRA C;  2Z9O A;  3K9T A;  1Y8R B;  1IRF A;  2VON A;  3P5J A;  5LHH A;  4WCG A;  2HYF A;  4MFD A;  1YYV A;  2OAZ A;  3DKX A;  4F3Q A;  3HOW J;  2MG4 A;  3DBR B;  3HPG A;  1MBJ A;  2J5P A;  4HF1 A;  4QTR A;  4OIR F;  3G1L A;  2ZB9 A;  2QBY B;  2DMP A;  1W7P A;  1LB2 A;  1HW5 A;  2CW7 A;  1UHM A;  3VYR B;  1PP8 F;  1BJZ A;  2O61 A;  4XMY A;  4WK8 F;  1T6S A;  2VPR A;  4M6X A;  3A01 B;  3E1S A;  4LB5 A;  1B72 A;  2L9R A;  3L2Q A;  1MH4 A;  3BTJ A;  3DEU A;  5BPD A;  2M8E A;  1YX3 A;  2DCE A;  2F2E A;  3MQ0 A;  4Z6Y A;  4CHU A;  2V79 A;  3LQQ A;  2DFE A;  2WY8 Q;  4ZZL A;  3GZ6 A;  4I98 B;  3QRF F;  3MKY B;  2DI3 A;  4J19 A;  2HR3 A;  1OR7 C;  3PO2 J;  4IX7 A;  4IO9 F;  5H6R A;  2Y75 A;  3TO7 A;  3AG2 H;  1TWF J;  5EEG A;  1XGN A;  4HDV A;  1LEB A;  2DTZ A;  1IZ1 A;  1MBG A;  4CCO A;  1FPQ A;  3B6C A;  4KJZ A;  2H27 A;  1IV6 A;  4PK4 A;  3KYL A;  3PM1 A;  1XN7 A;  3RIR A;  2NOJ B;  4BDY A;  5HDN A;  1O3T A;  3AKZ A;  1MSE C;  4AYB A;  3OIQ A;  3S14 J;  4A3I J;  1Y6I A;  4E4H A;  4AVP A;  4UVA A;  2HQN A;  2DFH A;  2R93 J;  5FRO A;  3ABU A;  3W6V A;  2FNA A;  1WWX A;  4BXF A;  1X3W B;  1Z3Y A;  5K7F A;  5FO5 A;  3K2Z A;  2I8D A;  3EUA A;  3LSJ A;  2CWE A;  4EV0 A;  1F43 A;  1BI0 A;  1SD4 A;  1UG2 A;  2K3F A;  1BBY A;  2GXB A;  1LE8 A;  1VZ0 A;  1P7I A;  4CCJ A;  1FP2 A;  4BU2 A;  2M3A A;  1E0E A;  1G3Y A;  4ZC3 A;  1ZGW A;  2GLO A;  4LOC A;  2DYS H;  2COB A;  3G1M A;  3RKY A;  3CDI A;  3WHC A;  5HLI A;  1HKT A;  3FXO A;  2HXI A;  3TO9 A;  4DGW B;  2XPU A;  2JZY A;  2HZD A;  2P6T A;  4FTH A;  3RYR A;  3F8B A;  3LA3 A;  4QPO A;  2A3S A;  4I6Z A;  2PEX A;  4XKC A;  4FQG A;  1FYL A;  4XON A;  2FSW A;  2LSO A;  2GIV A;  3VB2 A;  2MGQ A;  4HF0 A;  1F9N A;  4A2U A;  2BVL A;  1N78 A;  5C3E J;  4XR6 A;  2OZ6 A;  2NVU B;  4HSR A;  4HQE A;  1K6O A;  3KPH A;  4XSZ F;  1DUX C;  2PMU A;  4MLO A;  5H2F C;  2EPF A;  2H8R A;  3GTO J;  3H1C A;  4IRG A;  2V6C A;  4JQF A;  5LRR A;  1P6R A;  1MMD A;  4PSW A;  5LGT A;  3OWT A;  3BCA A;  1TW2 A;  3LA2 A;  4ZTJ A;  2K40 A;  1X58 A;  2NNN A;  4NB5 A;  4TV7 A;  2NVY J;  3KZY A;  2JVG A;  4RGX A;  3N97 A;  5LD2 C;  2K02 A;  5HOD A;  2H8W A;  4AWX B;  3R0A A;  2NVT J;  1YTY A;  1FOY A;  3LSP A;  1HOM A;  1FEX A;  3GLL A;  2O3F A;  3T0Y A;  5DTD A;  4ENM A;  2EFQ A;  4EQQ A;  1IG7 A;  2KRF A;  3JTH A;  1TW3 A;  1JI8 A;  1JJ6 C;  9ANT A;  2CV0 A;  4M9Z A;  2X1E A;  1CF7 A;  3QOP A;  3GLX A;  2XSD C;  2L3D A;  1KYZ A;  3S3O A;  2R7S A;  2DA6 A;  3FF5 A;  4JX5 A;  3GZ5 A;  4P96 A;  2NXN B;  1Z6T A;  2DMT A;  1XDU A;  2JVH A;  2RC4 A;  3ULQ B;  1Z77 A;  3CZ6 A;  3PFI A;  5EEA A;  2L7K A;  2FXA A;  3ZQL A;  2VBW A;  2E1C A;  1Z91 A;  2LY2 A;  1E2X A;  3FXL A;  3TBI A;  4M6V A;  4XRM A;  3FXM A;  3FHZ A;  4CZZ A;  2ETH A;  1BIB A;  1D5Y A;  1EH7 A;  4M3D A;  5LEJ A;  4ZYA A;  1YIO A;  4PGH A;  1KGS A;  2MYS A;  2RV8 A;  2V26 A;  4XOR A;  4PZJ A;  1VQ8 I;  2R7X A;  3HL2 A;  3WGI A;  2WAE A;  4LB6 B;  1FC3 A;  3ZMD A;  2WBM A;  2CQX A;  5FD5 A;  2ZME A;  2W82 A;  3KYC B;  3ERM A;  3CME I;  4KIF A;  5EGO A;  3VPR A;  3F22 A;  3DBH B;  2H1K A;  3CQZ J;  4WXH A;  2KDZ A;  2Z33 A;  4YIF A;  1W7P D;  3JRH A;  1H88 C;  2V4J C;  1K6Y A;  5DYM A;  2M5W A;  4B8X A;  3M8F A;  3G73 A;  2WB1 N;  2MW8 A;  2EV6 A;  3MZY A;  4KIT B;  2ZKZ A;  2HDW A;  2OA4 A;  2VXD A;  2PG4 A;  4LMY A;  4HA8 A;  4AIJ A;  2VQL A;  2JPB A;  1P7J A;  3JRF A;  3CO7 C;  1MD0 A;  3HUG A;  2E60 A;  2LBF B;  1P4W A;  2GA2 A;  4A0Z A;  1LFB A;  1OKR A;  3ZRG A;  2CGP A;  3H9J A;  4X1E A;  2QSG X;  3IV5 A;  4XN0 A;  3GTJ J;  4CCN A;  2O9L A;  2W57 A;  3IAM 2;  2VI6 A;  4YII A;  1IO2 A;  1U78 A;  1ZQ3 P;  3E97 A;  4BJT A;  3KCC A;  3BZC A;  3KP4 A;  5IP7 J;  2KL4 A;  3H5R A;  2KIQ A;  2V9K A;  1YIJ I;  4GDF A;  1OYI A;  4U87 A;  3GTL J;  1IN8 A;  2BEO A;  2V1X A;  1W36 D;  3I4N J;  3DCF A;  3I0T A;  2C6Y A;  2VIX A;  3S2D J;  5H6Q A;  3KP6 A;  4H4K C;  2PBI A;  5L3E A;  2DFI A;  1QHG A;  2H6B A;  4NC6 A;  1TBX A;  4L0Z B;  4EEF G;  3ESW B;  5CLS A;  2G0E A;  1FSH A;  2K9M A;  1EH8 A;  1V5E A;  2E1O A;  2HKO A;  5FKO A;  3SFI A;  2CMP A;  3JRC A;  5DCF A;  2A6H F;  1ZGJ A;  2CJJ A;  2W24 A;  5K5R A;  3EQL F;  2QQ8 A;  1U5T C;  1LEA A;  2ZXI A;  3JTG A;  2X48 A;  3TW7 A;  3AL0 C;  1XMX A;  1Z6R A;  5E1W A;  3RJP A;  2XAH A;  1G3S A;  2OZU A;  2EZL A;  2DFF A;  3DPU A;  3K4N A;  2BOL A;  3QAH A;  4C3I J;  2V1U A;  2LH9 A;  3HJE A;  1BJA A;  3S1M J;  1RUO A;  1XG1 A;  2Y31 A;  4AIK A;  2A07 F;  3HDD A;  1QZE A;  4JP0 A;  4II3 A;  3RTR A;  5FGM A;  3AFH A;  4U88 A;  5CVV A;  2A05 A;  1IV8 A;  1TNT A;  4LK0 F;  2CRG A;  1JTX A;  4EMS A;  5KHD A;  2E5Z A;  1J0R A;  3MKL A;  2DK8 A;  4ENJ A;  2DA5 A;  2F4M B;  2JA2 A;  1RNL A;  5HS8 A;  1MDM B;  3TL4 X;  5B5E C;  2IGO A;  1GLN A;  2HGC A;  2CQQ A;  1G2H A;  5LHI A;  1NG7 A;  2M0C A;  2VKD A;  4MQV A;  3IUO A;  2EZK A;  1KU9 A;  3QYE A;  1N75 A;  2CS3 A;  3A0B C;  2HNH A;  4O5V A;  1Z21 A;  2UXX A;  3GFI A;  3DEW A;  2D1H A;  4A93 J;  3QYF A;  3FK6 A;  3AG1 H;  1ETK A;  1TWC J;  4BKX A;  2WA0 A;  2L0K A;  2IXS A;  4C3H J;  3BR0 A;  4G6T B;  5TJJ A;  5D4R A;  1T39 A;  1PYV A;  2DU9 A;  3KFW X;  3Q0V A;  3PO3 J;  2AQE A;  4B09 A;  3ZQF A;  5FLM J;  2YSR A;  4Y13 A;  4OMY A;  4RMN A;  3BR5 A;  4IEJ A;  1TT5 B;  2BVM A;  1YFH A;  2QKL B;  2WB1 A;  2LDU A;  5HS9 A;  1LFP A;  2P8T A;  5AIQ A;  1T38 A;  5F6F A;  1DDN A;  4AIH A;  3HOZ J;  4E7L A;  3Q9S A;  2R7W A;  2PJP A;  1VQM I;  1TC3 C;  4XNF A;  2F48 A;  4AC0 A;  5IT9 K;  5J40 A;  4CIC A;  4LG0 A;  2F5F A;  2HTJ A;  4XRS G;  1R6R A;  3BG3 A;  2ZSH B;  1Q1H A;  4CSW A;  2AS5 F;  3ZQ7 A;  2ZSI B;  2ZO4 A;  1SMY F;  2N8G A;  4AUX A;  4BS9 A;  2L7Z A;  2I5U A;  3GTG J;  2HOA A;  5E3L A;  4BXU A;  3AG4 H;  2ZNZ A;  2BBY A;  1FP1 D;  5TIS C;  3GVA A;  1U8B A;  1FZP B;  1YG2 A;  2K27 A;  3ASN H;  1I1S A;  2QWW A;  3JRD A;  4DYC A;  3DBL B;  1EF4 A;  5FB2 A;  3GFL A;  4Z2Y A;  1Y8Q B;  4W97 A;  4D1Q A;  2MLK A;  4BAY A;  2D1V A;  2KIS A;  1OCP A;  2H6C A;  4L5J A;  1QA6 A;  2E35 A;  1LDD A;  2AXL A;  1YOV B;  3BJO A;  3K1M A;  2HFH A;  1UB9 A;  4UV8 A;  4CCL A;  2XSJ C;  3HHG A;  4MNU A;  3HOT A;  1WQ2 A;  3DTI A;  1HDP A;  1GXP A;  3MEX A;  3R61 A;  3A1Y A;  4CYC A;  4PJN A;  4OIQ F;  3REO A;  1Y56 A;  3T8R A;  2DMN A; 
#chains in the Genus database with same CATH homology
 3C2H A;  4BEH B;  1X1B A;  1WJC A;  2KZV A;  3FKJ A;  4BE1 A;  1UG0 A;  3OYN A;  2RQQ A;  3FDY A;  2UWM A;  1D0Z A;  3EUK L;  3UNG C;  2A6T A;  4PJL A;  4C2U A;  4P1W A;  2WAD A;  2XF5 A;  4ZDL A;  3DWL E;  2L9N A;  4FAS D;  1FMW A;  2DOA A;  3F9K A;  4RLQ A;  2KRC A;  4XKV A;  4IZZ A;  4C30 A;  1WFX A;  4RM3 A;  2M7B A;  2JSP A;  2KMU A;  3RCO A;  5FRM A;  2BW3 B;  1SAU A;  4ZTF A;  4YRV A;  2CV2 A;  1EA3 A;  3E0J B;  1X1D A;  3W2A A;  3L2V A;  3QOE A;  3LMM A;  5KNL A;  3LSH A;  3PNT A;  4LIV A;  3EUH C;  4XLC A;  2M4K A;  1V5F A;  4DJA A;  2WY7 Q;  3LSG A;  1SFK A;  3PUB A;  2UV1 A;  1DGW Y;  4Y4R A;  4YEL A;  3A4C A;  4ZDO A;  2VKH A;  3BCB A;  2LYC A;  3K4M A;  3ZCO A;  4Y33 A;  3N05 A;  1T0F C;  2E5N A;  2VB6 A;  2OUM A;  3DKX A;  4F3Q A;  2W4S A;  3HPG A;  1N77 A;  4AVZ A;  4PJM A;  2IGN A;  4HST A;  3VYU B;  3H9G A;  1MMN A;  3RSN A;  4BJ5 C;  4CZC A;  4C9Y A;  1Z7L A;  2CW7 A;  4C2T A;  3VYR B;  1MW7 A;  2CW8 A;  2F6C A;  4JOM A;  3S3N A;  2Z1D A;  4NC7 A;  2CUZ A;  4ZDP A;  1UEL B;  3OYF A;  4XMY A;  4U7B A;  2CV1 A;  3PJR A;  3OYK A;  2LG4 A;  3W2V A;  2OV7 A;  3E1S A;  4YEJ A;  2R7U A;  3L2Q A;  3GBG A;  4CH7 A;  4X0G A;  1YX3 A;  2JUG A;  4HPQ A;  4J00 A;  2DCE A;  3OY9 A;  4XOT A;  2X1D A;  2OC6 A;  2WY8 Q;  4CCM A;  4BGD A;  2R4G A;  3MKY B;  3LSK A;  1LKX A;  3IP4 B;  3OYG A;  1OR7 C;  1T95 A;  4IX7 A;  3J7A Y;  2ZFU A;  2VJJ A;  2UUZ A;  3M1C A;  4CCO A;  1D0Y A;  3K10 A;  3PSI A;  4HG2 A;  4KJZ A;  2W7N A;  4PK4 A;  3KYL A;  2V1N A;  3SEQ A;  2CFO A;  2NOJ B;  4BDY A;  3AKZ A;  3LL7 A;  4AYB A;  3OIQ A;  4GRI A;  1BOB A;  1WJ5 A;  1Y6I A;  3D5S C;  4E4H A;  3OYH A;  3ZXS A;  5FRO A;  4CCK A;  4DBQ A;  3H5A A;  2K9L A;  4BXF A;  1MMG A;  1Z3Y A;  2LY1 A;  2XF6 A;  2I8D A;  3EUA A;  4AU7 A;  4DIQ A;  2KHM A;  3DKY A;  3LSI A;  1P9Q C;  4XM3 A;  4B3X A;  1FMV A;  1VZ0 A;  2V7F A;  4HRI A;  3ZQQ A;  4CCJ A;  1D1A A;  4RM2 A;  4BU2 A;  2IGM A;  3QOD A;  2M3A A;  1E0E A;  3ZR8 X;  4XLE A;  1ZEL A;  4XQF A;  4ZC3 A;  2X6X A;  5KCM A;  2X6W A;  3S32 A;  2KRH A;  4N4O B;  2R7V A;  4CA0 A;  4Y3O A;  4F93 B;  4DGW B;  2Q2E B;  2HPI A;  3DTE A;  2HZD A;  1Z3X A;  4KIS A;  1MMA A;  4QPO A;  5CKT A;  2HVQ A;  1WJF A;  2KLO A;  4XKC A;  3UR3 C;  1X1A A;  4XON A;  2KPM A;  2X51 A;  2VL8 A;  5HOO A;  1N78 A;  2BVL A;  4LIT A;  2LRD A;  4NQW B;  4XR6 A;  4HSR A;  4P5O A;  4MLO A;  2DT6 A;  2VQH A;  2IGK A;  3OOU A;  4II2 A;  4NNJ A;  3CMM A;  4DOZ A;  1BR1 A;  4JQF A;  1MMD A;  4PSW A;  4E7K A;  3OWT A;  4ZJZ A;  3BCA A;  4ZTJ A;  1X1C A;  3W2W A;  4KT6 A;  2JVG A;  2VPL A;  3BLY A;  2VAS A;  2PJR A;  4HNU A;  5LD2 C;  3AL0 B;  3I3L A;  3OR2 C;  1DP3 A;  3BG7 A;  3H5N A;  2K3P A;  3DTK A;  3VSL A;  2VQC A;  4NC8 A;  4F92 B;  2XAU A;  1JI8 A;  1LDK B;  4XLF A;  3V42 A;  3OS2 A;  2CV0 A;  4XLA A;  4EAT A;  3OYC A;  2X1E A;  5CQG A;  3SYT A;  3I9V 2;  3S3O A;  2V6E A;  2R7O A;  2R7S A;  3CJR B;  2LBF A;  3PL8 A;  3U21 A;  2Z2S B;  3L2W A;  1OLT A;  2KDO A;  2JVH A;  3OL3 A;  3CZ6 A;  3MD2 A;  3MKW B;  2L7K A;  1G8X A;  5HNH A;  2CH0 A;  1PJR A;  4HEA 2;  4BAC A;  3A2K A;  2E1M C;  2LY2 A;  3DEE A;  3TBI A;  2A5W A;  5FRN A;  4PJJ A;  3LSM A;  2X85 A;  3TMO A;  2DT7 B;  2MD0 A;  2E1M B;  3BC8 A;  4ZYA A;  3PSF A;  3SDB A;  4IKF A;  5CQE A;  2MYS A;  4QPQ A;  1X19 A;  2V26 A;  3S3M A;  4XOR A;  1D0X A;  5TGT A;  3HL2 A;  4BDZ A;  2R7X A;  2WAE A;  2VJI A;  4LIU A;  1QHH D;  2GOM A;  2FUG 2;  2WBM A;  3HG9 A;  3EPZ A;  3VWB A;  2W82 A;  1X4P A;  4LG3 A;  2PJR B;  3H35 A;  3HOS A;  3DLA A;  3K4L A;  2V4J C;  1BR2 A;  1K6Y A;  3MKZ A;  4J01 A;  2KP6 A;  3K70 D;  3H9Q A;  1LVK A;  2M4G A;  4KIT B;  1J09 A;  2RRE A;  3OYD A;  2HDW A;  3D5R C;  2XF7 A;  2VXD A;  4D9J A;  1WJA A;  2F5V A;  1D1B A;  2VQL A;  1YX5 A;  2W00 A;  2E60 A;  2LBF B;  3D5L A;  2MC4 A;  3DPL C;  3ZRG A;  2QKM B;  3H9J A;  3LFU A;  2W1O A;  4XN0 A;  4CCN A;  2GOX B;  1ERD A;  3QYB A;  3IAM 2;  3K4K A;  1TT0 A;  3CJQ B;  1WJB A;  4PFO A;  4BJT A;  2VQG A;  1UAA A;  2P0W A;  2KL4 A;  3H5R A;  1IRX A;  2V9K A;  4IQJ A;  4U87 A;  4E7Z A;  2MFZ A;  4BQO A;  1YE9 A;  1W36 D;  2VIX A;  4ITV A;  1MND A;  3KEY A;  3H0D A;  2ELJ A;  2PMZ A;  4H4K C;  4HNT A;  2XDV A;  1DGR M;  2LRE A;  5CPR B;  1QHG A;  4OWR B;  4E7H A;  3BG6 A;  1D1C A;  3PNY A;  3M8J A;  2MAB A;  2VJ5 A;  2Z16 A;  2K9M A;  1W36 C;  2M7A A;  1V5E A;  3RPU D;  2CMP A;  1X4O A;  3ONQ A;  2VLA A;  1S9H A;  5HVQ C;  2IS4 A;  3OYM A;  4F52 A;  3IAS 2;  3CP2 A;  2Y0S A;  3CP8 A;  4PSX A;  1KON A;  3CES A;  2ZXI A;  2IS6 A;  3AL0 C;  3DU6 A;  2O5R A;  2VJ4 A;  3DPU A;  3K4N A;  3HUG B;  4PFP A;  2BOL A;  3OYL A;  2LH9 A;  2R7R A;  3FBI B;  2IS1 A;  3L2R A;  4II3 A;  3RTR A;  3AFH A;  2R7T A;  1U0J A;  4B44 A;  4PUS A;  3HKZ A;  3C2G A;  2HQA A;  5KHD A;  2E5Z A;  2Q1Z B;  3OS0 A;  4DBR A;  2HVR A;  2JA2 A;  3HXL A;  4XKB A;  4XOP A;  3G2B A;  3TL4 X;  1V5G A;  2IGO A;  3DQV C;  1GLN A;  1NG7 A;  2VKD A;  2X1C A;  3IUO A;  2L9S A;  2X6Y A;  3QYE A;  1N75 A;  2CS3 A;  2HNH A;  3VSK A;  1Z21 A;  2M0M A;  3QYF A;  3OS1 A;  1QU3 A;  5LFA A;  2WA0 A;  2IXS A;  3L2U A;  4G6T B;  3K6G A;  3KX2 A;  4RLF A;  3OYI A;  1PYV A;  3W3C A;  4BQN A;  4R79 A;  3OYE A;  4IQ4 A;  1MNE A;  2AQE A;  2ZXH A;  3PNV A;  4OAY A;  3OL4 A;  1BR4 A;  1G59 A;  1WJD A;  4RMN A;  3S93 A;  1NG6 A;  3OIP A;  4B47 A;  5JHF A;  2BVM A;  2QKL B;  4E7J A;  2WB1 A;  1LFP A;  2HU9 A;  4XL9 A;  4BE2 A;  4E7L A;  2RNG A;  4NUB A;  2R7W A;  4E7I A;  4F55 A;  2CUJ A;  2R7Q A;  2DXI A;  4XNF A;  4FET A;  4B48 A;  4XLH A;  2DJI A;  1R6R A;  1TZL A;  2L5Q A;  2WAQ A;  3FBN B;  3OYJ A;  3RQ4 A;  4BEH A;  2ZSH B;  4XKW A;  3DU5 A;  3NWT A;  4CSW A;  3S8P A;  3VDX A;  2IS2 A;  2ZSI B;  4N4N B;  2KQR A;  3K4J A;  3SZG A;  3VYS B;  4BS9 A;  3K70 C;  3MMY B;  4F91 B;  1DQU A;  3FHN A;  3K4C A;  3SEZ A;  2HVS A;  2HPM A;  2LC2 A;  3HC7 A;  2AQF A;  2BW3 A;  4XN3 A;  3VYT B;  4BL0 B;  2LOO A;  2WAF A;  4CUG A;  2XC7 A;  3HPH A;  4E7S A;  2L2O A;  3NWS A;  3OYB A;  4OAZ A;  4D1Q A;  4B43 A;  2VXZ A;  4BJ6 C;  4E6K G;  4ANJ A;  4BQQ A;  1HA8 A;  1AA7 A;  3ZGK A;  5HLT A;  3K4B A;  5HNF A;  4BUP A;  4CCL A;  2XSJ C;  3PFY A;  2F4I A;  3OMY A;  3HOT A;  3OYA A;  2K5C A;  3DTI A;  3CF2 A;  1WJE A;  3A1Y A;  3OR1 C;  4PJN A;  1Y56 A;  4BE0 A;  3DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...