2E1MB

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
90
Chain Sequence
AATQTWTGDLAIVTIPFSSLRFVKVTPPFSYKKRRAVIETHYDQATKVLLEFSRRWWEFTEADWKRELDAIAPGLYDYYQQWGEDDAEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-glutamate oxidase
publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
total genus 14
structure length 90
sequence length 90
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mB02
2E1MB
chains in the Genus database with same CATH superfamily
1IDZA 1LFBA 1BOAA 2O3FA 3BDDA 5D4SA 2VUMJ 3HUGA 1J0RA 1UELB 5BQTA 2M4GA 3JRFA 2XPVA 5JVGF 1WKMA 2Y69H 5FKKA 2GXBA 4QTRA 1XC5A 5K1YA 2ZXJA 1MBHA 2P6SA 4U0WA 4E7JA 1BR1A 2FA5A 1IN6A 4HX4A 3ZMUA 3S1RJ 2LNBA 3DTIA 1AWCA 1OCTC 5E20A 3OYHA 2EV0A 1RC9A 3D5LA 3A0HC 2DAOA 2EIJH 4PJMA 4M9SA 1S7EA 1KZHA 2HR3A 2HOTA 5ICEA 2EZIA 2ETHA 3ABLH 3LSKA 5JLWA 2E2HJ 2L02A 4IHWA 3OR1C 5FRNA 3TQNA 1TP4A 4DBRA 5E79C 2XHKA 3BR5A 3CCVI 3K2ZA 1O7LA 4XLNF 2X1CA 1DDNA 5D6FA 1XN7A 1U2WA 3SFZA 4MEYF 4IQJA 4YIIA 4HW0A 5M3MJ 2Z9OA 1ETQA 4WX9A 4XLCA 1TWAJ 5FROA 1PUFA 4Y13A 3WTWC 4BQQA 3WTYC 2HDDA 2DPDA 1LUJB 4NHJA 4O3MA 2MH9A 1Z21A 4M3BA 1A31A 1ORKA 1OPCA 2M2EA 2DA4A 5ED4A 3FXJA 4BHBA 2O03A 2CQXA 1WJFA 1FOXA 4IVNA 1R71A 1ENHA 5IT3A 4I2OA 1JJ6C 1IXSB 2EFQA 2RQQA 1IUFA 4FQGA 4QSHA 5DM6F 4M3GA 2CW0F 1REPC 3BZKA 1HKSA 3G1OA 2Y0SA 4S04A 3HOZJ 3I53A 2QCOA 1WJDA 3N97A 3MKLA 2EILH 2LKSA 4HX8A 5IPAA 3L09A 2BBYA 2WV0A 3R6SA 1O57A 3HIFA 5FB2A 2QKMB 3AFHA 5DD4A 3RKYA 5LLQA 1J2XA 2DMPA 4HYEA 2HOSA 1SFOJ 2XF5A 4OIOF 3NEUA 3VYUB 5JHFA 3RCOA 1L0OC 3R4KA 3BCBA 2PG4A 4XSXF 5F27A 1BR2A 3P9CA 3REOA 1AKHB 4MHGA 3DU6A 3L2UA 2O8KA 3ZN1A 3SQNA 4M6YA 1ZG3A 1WI3A 3WODF 2XKOA 5D4RA 3B6AA 2VKVA 4HV6A 2VC1A 2LP0A 2WAFA 3HRTA 1CF7B 2BEOA 2Z1DA 1NG7A 2ZB9A 3T5XA 3E7LA 5GAGJ 3Q0UA 3VYRB 5ICGA 5DS9A 1WJ5A 5JFRA 2KHMA 3IUOA 3Q5FA 4CYCA 4KNYA 4OWRB 1U5TC 1X3WB 4OINF 4YIRX 4K2EA 5FLMJ 2PJRB 2ME6A 3ASOH 2EWNA 4RAZA 5FLXZ 4BXUA 3QWLA 3HYIA 2VASA 2KP6A 2JVGA 3O6BB 3P9KA 1UG0A 1Z6TA 2DA2A 3QOEA 5F64A 2ID3A 5E8GA 3IH2A 2P7CB 2O8XA 3CLOA 3CCYA 4F7ZA 3LSPA 3CMAI 3COAC 3F8NA 4V19K 2F5EA 3CTAA 4EM2A 4CXFA 3V7SA 1RKTA 1KU7A 2KZVA 2IXSA 4L9TA 4P9UA 2NOGA 1S29A 4G6QA 1FTZA 2W57A 3MEXA 2W85A 2K02A 3S1QJ 2VOOA 1HKQA 2ZXIA 4FASD 3OYEA 1JHHA 2F5VA 1R5GA 4AVZA 1FX7A 1ZAOA 2XF7A 1QNTA 4U0YA 3IRRA 2DMUA 2DW4A 3OYAA 3WTSC 2JZYA 4MIMA 1BIBA 4M9XA 1ZELA 4EEFG 5DM7F 4MLOA 3EUKL 1W7PB 1GVDA 3OYCA 3AG2H 3BTIA 1P4WA 1SFEA 1QZZA 2DTRA 3L2QA 4BAYA 3X2QH 4IX7A 4ESJA 2E1MB 2UZKA 3S2DJ 1MMGA 4UB8C 1T08B 3H92A 2YU3A 3BROA 3HRUA 2A61A 2FEZA 3CESA 3Q9VA 1Y1WJ 1NTCA 2ISYA 4ENJA 5JVTA 5HNFA 1D8KA 4B47A 4KISA 4IRIA 3DBRB 3JRIA 2K85A 3NRVA 3GTPJ 2E35A 1A5JA 2ZJ2A 2HKOA 1S8NA 3D0SA 5EG0A 1W36C 2P5VA 2IJLA 2YX4A 3L7WA 3E6DA 1N25A 2VBZA 4Y3OA 2Q2EA 1Y8QB 1HBXG 1XB4A 3J81K 2DQLA 4DZPA 1V54H 5D5UB 5TGTA 2EH3A 3CUQB 3OYFA 1Z7UA 3LWFA 3ZR8X 2CO5A 2OUMA 3K70D 2FSWA 1SVMA 3I71A 2BXZA 2R5YA 1XGSA 1X1PA 3T8RA 2IGNA 2E5NA 1BL0A 5IT9Z 5HDGA 4S05A 4IHYA 1IGNA 3RPUD 2D1HA 2MLKA 3SHFA 4DIQA 2W84A 2DBBA 2WWYA 4C30A 4D5FA 3DPTA 2LFBA 4LLGF 5F1RA 1PP8F 2IGMA 2RVCA 2EJRA 5LHIA 3J7AO 1QVTA 3TBIA 3WGGA 5LGNA 1SFKA 2M0MA 2Y30A 2D45A 3IRQA 5FGMA 3HUGB 4AD9A 2WY8Q 2KT0A 2XV4S 2IA2A 3GF2A 4ABZA 3A2KA 3I59A 2D2WA 2FNAA 3QAHA 3RPUA 3KPHA 1H88C 3WGIA 3HSFA 3OYBA 4I01A 3NWTA 3ZQLA 1BOBA 3JRGA 2BZTA 1K6YA 5HDKA 2HVSA 3RDIA 3RPQA 4LJZF 4PZJA 6PAXA 1BC7C 3DXJF 1FOYA 4Q47A 1HF0A 3M1EA 1D5VA 1WFXA 5EGOA 2TRTA 2XVCA 5J4YA 1MMDA 2EFNA 4IJAA 1TWHJ 3PO2J 2X1DA 3E5UA 1WHUA 3EUAA 3DBHB 5CYVA 4G6TB 1FY7A 1E0EA 4OAYA 1BJZA 1R4NB 3LNQA 1FP2A 2MH2A 2NS8A 4RAFA 3K4CA 3RIRA 2XAHA 3S93A 3PNTA 3AG1H 4XLHA 4CZZA 2O5RA 2R7QA 4WK8F 2QA4I 1PUFB 3MD2A 3GZ6A 3VWBA 2FOWA 3ZCOA 3BQYA 3IWFA 4E7KA 2KIFA 3H3ZA 4UY8I 3KYDB 4QWQA 3L2VA 2XAFA 3AL0B 3H3UA 3ZMZA 3WTVC 3D1NI 1WVRA 1VQ5I 2L2OA 4HV5A 2XSJC 1V5GA 1Z3XA 2A07F 1TTYA 2ELHA 2OZUA 1IO2A 3C1DA 3BZCA 1GV5A 2DA1A 2ZJQF 1ETKA 2VJ5A 2JK3A 3ABUA 2KFDA 2UV1A 5EDNA 3E3VA 3EYYA 1KQ9A 1YOVB 2M7BA 3CO7C 4E7LA 1FJLA 3GTGJ 4LGWA 2R7ZJ 1D3YA 3QRFF 3B73A 2NNYA 1JT6A 4HDVA 2HOEA 4HA8A 3W2VA 3BTCA 5K5QA 3ECOA 5CQEA 1YJWI 2HVRA 4YFXF 1QBJA 1BW5A 4PFOA 3LA3A 2PN6A 4KA4A 1B1BA 2RKHA 1ETVA 3S32A 1PP7U 1ZGWA 4DYRA 2JA5J 4KIGA 3HRSA 1UFMA 4TV7A 1G6NA 1OISA 2EK5A 3IKTA 1IAWA 2LREA 2E2JJ 1GLNA 1WH5A 4A3KJ 2HQRA 1XD7A 2E2IJ 3OY9A 3OYGA 4DBQA 1IRGA 3C2HA 4DOZA 1POGA 5HDNA 2IW5A 2C6YA 3BJAA 2L4MA 1MBJA 1R23A 4XLFA 3OYDA 4BXXJ 1BJAA 4DGWB 1WWXA 5TISC 3LFUA 4XLEA 3KP2A 1UMQA 3A0BC 3V7CA 2BYVE 3HHGA 3GTOJ 1JE8A 4CYCB 4I0AA 5BS6A 2L7MP 5LFAA 5FKOA 2QVOA 2GOXB 4C2TA 4XKWA 2Y75A 3TP3A 3PIPF 1DU6A 1ZN2A 2DODA 3EQLF 3TW7A 2P6TA 1S6LA 2YS9A 5E3OA 3HGGA 4MEXF 4NC8A 4A6DA 1JI8A 2DOFA 4RGSA 5J40A 2RC4A 3DTEA 3K9TA 4PJJA 1LE8A 3D5SC 4KFCA 3BR0A 5E17F 2HTSA 2IEKA 5H6RA 5LD2C 1OMIA 5E18F 5DYMA 2ZSHB 2X9DA 2MGQA 5HS8A 3VSKA 3PL8A 4NNJA 3CDLA 2XAUA 3GFMA 5EYRA 4CH7A 3FHNA 2RDPA 3SYTA 2PLYA 1K61A 1QZYA 3MVPA 2MD0A 3S8PA 3FXQA 2NYXA 1X3ZB 3M7GA 3ZXSA 4ZDOA 3DTKA 4CCLA 1JGGA 2E60A 4IF4A 1DQUA 4A5MA 3FXMA 1GDTA 1BM9A 3IL2A 4B43A 4FETA 2KDZA 5F0HA 3WG9A 5C4XJ 4C3IJ 1RIOH 1IV6A 2EV6A 1B6AA 4DNCA 1FT9A 1W5CC 2E1NA 2MD5A 3P9IA 4KICA 4AU7A 1R58A 2BHZA 2F4OB 1OKRA 1RESA 1B72A 4CHUA 4B4CA 1IDYA 2FQ3A 2H8WA 5H20A 2HQNA 4ZJZA 1W0TA 2V9KA 3H5RA 3F22A 1YW8A 2CW8A 3UR3C 2PJRA 2KPMA 4XBFA 1ZLJA 1BBYA 1ZG1A 1FTTA 1R5ID 2A68F 5F0CA 4MTDA 2VE9A 1WJCA 3GTQJ 1D1BA 2BXYA 3ZMVA 3H5AA 1E3PA 3FIWA 2LR8A 5EG0B 3J7YJ 3KLNA 2CQNA 1OJLA 1VF9A 1FPQA 2CQQA 2Q2EB 1ZGAA 2X51A 2OA4A 2B9SA 3KIOA 2OBPA 1A6QA 2LDUA 1K79A 1BI1A 2M8GX 4XRFA 3A02A 2CWEA 3WTTC 3M3YJ 1E17A 3ISPA 3F72A 4UV8A 4AVPA 1OYYA 2CMPA 1QU3A 4U88A 3BQZA 2H1KA 2NAZA 1P2FA 4RGUA 4KIFA 4ZDPA 3CUOA 2A69F 3F6OA 2IA0A 3DKXA 3MWMA 4RB3C 4A3IJ 3FXKA 5ERIA 2ZFWA 1ITYA 1R6RA 1W7PA 1XG1A 3CMYA 1E2XA 2P4WA 4XN3A 5D8KB 2AS5F 2D5VA 1ZKGA 1B4AA 2L7FP 2VT3A 1H0MA 3AG4H 4LFUA 5KK1A 3FM5A 1BN5A 5FFZA 4ZYHA 2K9SA 2GBYA 1O3SA 3IAS2 2LY9A 1RR7A 2E19A 1OLTA 4Y15A 2DDAA 4Y17A 4BYYA 2TCTA 2Z16A 1BI3A 3RKQA 1YS6A 1SD5A 3N4MA 4ON0A 4JX5A 2KRFA 3GVAA 2I8DA 1UHMA 3DCFA 1I1SA 2K3PA 3GLLA 1FYMA 5H6QA 3VYSB 4RGXA 2ADUA 3HOXJ 3SXYA 3L2CA 1MJBA 4IRHA 2A6TA 5AIPA 5EGOB 4R8HA 3ABMH 1OYWA 3CP8A 3K4KA 4NBQA 5J3LA 4U7BA 1VQPI 3CCEI 4XKVA 2HWVA 2HPMA 3FZVA 1APLC 3ULQB 3EUHC 4A3DJ 4DYCA 3A01A 3D5RC 4AWXB 1XPXA 4OIQF 2STTA 3CUQA 1FBUA 1ON1A 4XMYA 1D1CA 2HYJA 1IRFA 2OPTA 4BQNA 5DTDA 1TZLA 2DFFA 3FBNB 4YRVA 1WJBA 3FISA 1XGOA 2QSFX 1P92A 2LVSA 2QKLB 3F8MA 1LQ1A 5L3CA 1IZ1A 1J5YA 4E7SA 4CZCA 4U7DA 4ZTJA 3L00A 1U9NA 3E97A 2K3FA 1MMAA 3BT9A 2GOMA 1V5EA 1D1AA 3DBLB 4L0ZB 1F5TA 3FDYA 3CUQC 3RI4A 3OS0A 1LNWA 3R0AA 3U21A 3CMEI 3BZ6A 1KA8A 5E3LA 5JLXA 2ESHA 2FX0A 1QVUA 1GXPA 5FLXK 3PM1A 1LDDA 2Z3YA 1S72I 2XC7A 3KE2A 4JX4A 1QHHD 1S5LC 1DGRM 4G9YA 3CJQB 1GVJA 3QP5A 2ZMEB 1KONA 2MFZA 5IOZA 1DGWY 2R4GA 4AIJA 4CGZA 3Q0VA 2JA8J 1ETXA 1MMSA 5FRMA 4PSWA 2OZ6A 5D6EA 1N78A 1RETA 2DK5A 2W00A 1ZTRA 4BE2A 3DP7A 3V42A 4WCGA 4A3BJ 3JSPA 3FMSA 1R36A 2O0YA 3IH4A 1T0FA 2JA6J 4HX7A 3HHHA 4OIRF 3WTUC 1QZEA 3GWZA 2VLAA 4A0YA 4F92B 3MZ8A 3RZOJ 2ACJA 1ULYA 1VZ0A 4CCJA 2V1UA 3ECHA 3V7RA 2COMA 2ZBKA 1PUEE 1I6HJ 2E36A 3GEZA 2OC6A 1Y0UA 1QA6A 2MC3A 2BGCA 3H9JA 5KAFC 1YQAA 3GXOA 3JREA 2QSHX 1ZHFA 1T0FC 1XDUA 2VXZA 4P96A 1ZARA 2F5CA 4XRSG 3QPTA 3W2AA 4GXOA 2EFPA 1JTXA 5K7FA 2PI0A 1PDNC 2KQRA 4FX4A 3WGHA 2CFOA 5DCFA 4Q5SF 1DUXC 3U2RA 2AHQA 1WZ2A 1G3SA 1FZPB 5J1UA 2Z2SB 4B48A 2PQ8A 3BPVA 4FHTA 4AC0A 1K83J 5M5XJ 1LE8B 3I5UA 2LKXA 3EETA 4AM3A 1WRJA 2LBFA 2XRLA 4LIUA 4WXCA 2MSYA 3AL0C 3HEFA 4NDLA 4XICA 3RQ4A 3OYLA 2XGCA 2LMDA 4PGHA 1K78A 3MKYB 2KKOA 2LG4A 5KVRA 4OIPF 5FKLA 2A6HF 1OR7A 2OD5A 3E0JB 3SDBA 4JOMA 3IHUA 5D8LB 4CYDA 2H94A 3ABKH 3HBLA 1X58A 3KCCA 5IYCJ 3BG3A 4RB0A 2L9VA 1VFCA 2F4MB 3MZHA 1G3WA 5IT9K 3GO5A 1TQPA 4RLFA 1VQKI 2DPUA 1TLHB 2H6BA 3W6VA 2DQRA 2LK2A 2XPWA 2HI3A 4L0YB 4IQ4A 2KRHA 3FXRA 1OYIA 1IN4A 4RLQA 3OMYA 1U9OA 1ETWA 2DJIA 2MLGA 4MGRA 3OYMA 1U0JA 1IXRC 2DJNA 3SJMA 1O3RA 1ODDA 4ZYEA 1OR7C 3ZGKA 3JRHA 1VQ6I 1HSJA 2ZXWH 3QU6A 3U1KA 1B72B 1OCZH 2B7EA 3OR2C 4U87A 2EIMH 3HOYJ 2VN2A 2QSGX 2HQ5A 3V4GA 2DDBA 1MGTA 3CJRB 5E1WA 1JKQC 2W1OA 2JA7J 4M3DA 4KJZA 3Q9SA 1ZR4A 2Q8KA 4I98B 2FBIA 2EZLA 2JMWA 4N9IA 3QU3A 5JI6A 4FE7A 1VQ4I 4BGDA 2NNNA 1G59A 3GTMJ 2IVMA 4RGRA 2E1OA 2HVQA 4QPQA 1OCCH 4ZZLA 5L3DA 1TL8A 5C44J 4ESBA 2FOKA 3WU1B 2VKDA 2CV2A 2DA7A 1X4OA 3QYEA 1OCOH 5FO5A 1ZR2A 2TDXA 2M3AA 1YW9A 3AAFA 1VTNC 4G7OF 4M74A 4M3FA 1CGPA 3NQOA 3VB2A 3RYRA 2EFWA 2LKPA 2OF7A 4BKXA 3HGYA 4EJTA 2IA1A 2VPRA 4FTHA 3KP6A 3LSTA 2K86A 5AONA 3TOBA 4HBLA 1SVLA 1LDJA 3E5QA 1TWCJ 2STWA 2BY0A 4KN4X 1PVEA 2F4IA 3MAJA 3P7NA 2NVQJ 2PX9A 1QQIA 2VBWA 1FMVA 4IOAF 1FSHA 2IRFG 4PUSA 3PNVA 4HQMA 1MIJA 4A93J 4JBAA 5BPIA 1QHGA 4I99C 3OS2A 4D7MA 4Y4RA 3AKZA 4ENNA 4A3EJ 3H35A 3ASNH 3ZPLA 4PK4A 3VSLA 2DOEA 3CP2A 2HQAA 3WU2C 3IV5A 3SDGA 4L18B 5KNLA 1MSEC 3WTZA 1DU0A 3I3LA 3R61A 3ABTA 2GIVA 2CUJA 2WAQN 1K6OA 2GXAA 3DKWA 3ZQGA 2EINH 3CC4I 3OIPA 3OYKA 4BDZA 3A01B 2A5WA 1Z9CA 5C4JJ 1S7OA 2P7VB 3W3CA 4ENKA 1LPQA 1O3QA 3IH3A 4BE1A 3C3WA 3IWZA 4MFDA 1LJ9A 2W7NA 1HXDA 2R7DA 4W1UA 3SZTA 2XROA 5M3FJ 4G94A 2LD5A 2IPQX 1YLFA 3BC8A 3BLYA 2KJBA 3BPXA 3NAUA 2PJPA 3UKGA 4XOTA 4A3CJ 2HYGD 3FHZA 4IHVA 3QPLA 2EZHA 4A3MJ 2VQCA 3WE3A 2KMUA 1LVAA 5HLHA 2B0LA 1R9TJ 1TC3C 3HOUJ 3ZQHA 2IS1A 2JA2A 2L7KA 1NK2P 2BHYA 1FLIA 1FWZA 2EZKA 4QIWN 4UVCA 1ZYRF 3G6EI 3CCJI 1KYWA 2FNPA 5E1ZB 5LHHA 3RTRA 3I4MJ 3S16J 4F91B 2IGKA 3ZQQA 2CJJA 1MJ9A 2XIGA 2HGCA 4UHTA 4HNTA 2QQBA 1HW2A 4N4OB 3TGNA 2KRCA 4F55A 3ESWB 4LD5A 4JK1X 1FYLA 5LRRA 3TMOA 3V8LA 1MKMA 1RUOA 3K70C 4ITVA 3QQAA 1EH6A 1SD7A 1AA7A 3E6MA 3F8CA 3J80Z 3K1PA 2CS3A 4F52A 1XTAA 1MH4A 2F48A 3KP5A 1G2HA 1RPWA 2L3DA 2ME0A 4BE0A 3PUBA 1FYKA 1WGXA 1STZA 3HOSA 2HS5A 4E6KG 3HTUA 2VBYA 3JTGA 3ZRGA 3OL4A 3RZDJ 4FE4A 5CVUA 3IP4B 4J01A 2EA2A 2V1XA 2XGEA 4LOCA 3M8EA 1A36A 2OCEA 4BHPA 3CQZJ 3HOWJ 3CF2A 1KU2A 3C2GA 1UG2A 1V4RA 4XM3A 2Y31A 4HG2A 2DLLA 1JUPA 4ZYDA 4HSRA 1PYVA 4EJOA 2X1EA 3I55I 1NHAA 1SVOA 4I09A 2E7XA 3KP4A 1U6GA 3DLAA 1ONVA 3KEYA 2M34A 1MZBA 3ML6A 2OTLI 5IOYA 5JHUA 1A6IA 3S2WA 5CLSA 4BUPA 2XKPA 4BBSJ 4UVAA 2JRTA 1IG7A 4LB5A 2L9RA 3HDDA 3WTXC 3GCMA 2LBFB 2ZMEA 1WPKA 3DEUA 2IS6A 2DN0A 4P9FA 5TRDA 1BC8C 3GTLJ 2W24A 2GM4A 3PJRA 3KZYA 2CFXA 4CCKA 2DOAA 2HDWA 1XS9A 1K78B 2XPUA 4N0BA 2E34A 3K0LA 3A1YA 2VBXA 1UJ8A 2NS0A 4EJUA 3S17J 2Y48A 2A6EF 2LSOA 3J7AY 5HLGA 3K69A 1B9NA 4B44A 1R49A 1KGSA 3ZQIA 1YIOA 2V1NA 4B3AA 4PJLA 1UCRA 2ZMEC 4I0BA 4E4HA 3S3MA 4CA0A 3GX4X 2OQRA 4M3EA 1B8IA 2ELJA 4IPAA 2VJJA 3F8FA 4DYQA 2UXNA 2RNGA 1FNNA 1T56A 5J8FA 2FBKA 1V5FA 3OOPA 3VYTB 1J09A 1GT0C 2K40A 1AHDP 1P9QC 2XB0X 3PSFA 4PSXA 1MNEA 2CW7A 2BV6A 2XF6A 4X1EA 4MTEA 2P5KA 3PFYA 3ZMTA 2HKXA 2J5PA 3H1CA 4UVBA 3ROUA 1XMKA 5DUKA 1EF4A 4NQWA 3KYCB 5GTHC 1FIAA 1X1DA 1TT5B 3GTKJ 1XGMA 2RN7A 2Z33A 2COBA 1SMTA 3I54A 2K4JA 1XSDA 3GFIA 3SFIA 4OAZA 1NK3P 2BE5F 3LL7A 1KU9A 2XGXA 5B1AH 3S3OA 4QLCU 4M9ZA 3ZQCA 2ZNZA 4ANJA 2R92J 1TQMA 1BI2A 3KZIC 5LGTA 4A3JJ 2KISA 5K7HA 4M71A 4V2FA 1SEUA 3FKIJ 3LA7A 3VEPA 2LTPA 5HODA 4UUTA 2ZO4A 1F4KA 1W4MA 2MW8A 3F6VA 2MC4A 4V2GA 3CO6C 2R7WA 3H3VK 2KJCA 2OV7A 2PBIA 3GZ5A 1AOYA 4O5VA 3DWLE 2G0EA 2VOPA 2W48A 1HDPA 3WE2A 5IP7J 5EEGA 2R7UA 1SAUA 4XNFA 3CCUI 2OJED 5B66C 1ZH5A 3HPHA 1N77A 1V55H 2XUBA 4LK1F 5ICCA 5E3NA 3QYBA 1YTYA 2CG4A 5FFXA 3TW6A 3CCRI 1VQ9I 3F3XA 1T39A 3ELKA 4J19A 2LF8A 2QM3A 4RMNA 3KEOA 2X6WA 1OFCX 2LC2A 2RV8A 1S9HA 3TDUC 4AYBN 1G8XA 1JT0A 1CQTA 1IJWC 2VODA 1YS7A 3BP8A 2VQHA 2A05A 3FK6A 4ZC3A 3LSRA 1KQ8A 1P7JA 3WG7H 4XOPA 2PMHA 5LGUA 2E7WA 2Z99A 3BG6A 2P8TA 2QGUA 4L5IA 3CCSI 3LQQA 3CCQI 2K9NA 1H89C 3K4BA 1UAAA 1YE9A 2XAGA 3JCUC 1EJ9A 1FSEA 2IS4A 2JUCA 5GAEJ 1LEBA 2QQAA 3RQIA 1YJ9I 1ZQ3P 1Z77A 2O9LA 3F9KA 1Z0XA 3V8KA 1NH3A 5BMZA 1JKPC 1IW7F 3TDZC 2ZJPF 2M45A 3OYJA 1K4TA 4KMUX 1USTA 2HZDA 4ZYGA 1ZGJA 2KIUA 4P1WA 4B09A 1JGSA 3WU0A 4AIHA 5ILSA 2M8EA 4AIDA 4DW6A 3DEEA 2E71A 2V9PA 5AIQA 1EH7A 1T8IA 1X4PA 3DQVC 3RJPA 5F08A 2FE3A 1MNMC 2L9SA 1SFXA 4M72A 1TNSA 4A3GJ 4BY7J 2WA0A 2RGVA 1FOWA 1Y1VJ 1VNDA 2FMYA 4NC6A 4B1RA 3N05A 2VONA 4D7NA 2XGDA 1X1BA 4BJTA 4HF2A 1T95A 2VE8A 4M6XA 1SD6A 4A69C 3ZP5A 3R0JA 1U8BA 1O3TA 2ZSIB 1SC7A 3K4JA 4IHTA 3P5JA 3SEQA 1W5TA 2ZNYA 3IAM2 4ZH4F 1Q1VA 2WAQA 1ETOA 4L9JA 4UXNA 1KYZA 1F36A 2ECBA 1OQYA 1TNTA 1Z6RA 1YITI 3JW4A 4I7HA 3GUDA 4RA2A 4U0VA 1R7JA 1XCVA 1K4SA 4ESFA 2R7VA 2FU4A 3HZJA 1FC3A 4P55A 3ZOBA 5FJ8J 4H0EA 3EDPA 4FISA 2NS7A 2V1DA 4OOIA 1GV2A 2JTVA 4NC7A 1S7AA 3KZZA 3U1DA 1IV8A 4BJ5C 2L0KA 5K5RA 3MN2A 4PGGA 4DJAA 4WXDA 2DMNA 2QEXI 3JR9A 4GGGA 2CU7A 3TO7A 5CPRB 2NOJB 2V6CA 4A0ZA 5A2QZ 3TP0A 5CKTA 2YX7A 3LQRA 3GMEA 2OU2A 3S2HJ 2V26A 3GZNB 2P81A 2IT0A 1Y8RB 3JRCA 1YI2I 3BJ6A 3O8HA 4RAYA 4BNCA 3DU5A 4LB6B 3KEQA 4XL9A 1W0UA 3DPLC 4II3A 2R93J 3ZMDA 1LB2A 1Q1HA 2V9VA 2CH0A 1KQ0A 3FWEA 1D0YA 2A5YB 1TW3A 1HSTA 3I9V2 4GYIA 4A3FJ 1LEAA 2MG4A 4XLPF 2F5FA 1BI0A 2KIQA 3A4CA 3LMMA 3E6BA 3OOUA 1ZLKA 1EV7A 1I1GA 2JN6A 1I3AA 2H8RA 2R7SA 4EATA 3C2BA 4Z2YA 1JXSA 2XAJA 2X85A 3I4NJ 4A2UA 1IF1A 2Z5UA 2P5LC 1D5YA 2M5WA 4C9YA 1JKRC 4ZTFA 2VL8A 2M9HA 3G2BA 2JJ7A 5DV5A 1QPIA 2O61A 4Q48A 3LOCA 1U8RA 1WCMJ 1WJEA 1Y0NA 2DT5A 3G3ZA 3CJTB 5J47A 1ZREA 1D0ZA 4GRIA 3LSGA 1X19A 1A04A 4RS8A 3JRBA 1UHSA 3H9GA 5FD6A 3A03A 3FF5A 2CV1A 2VI6A 4HF1A 1T6SA 1FOKA 3VOEA 2DYSH 2MABA 2P0WA 1MBKA 4C3JJ 1MMNA 2R3SA 5J8CA 2Y9ZA 1JUMA 3H5NA 5HOOA 2UXXA 3O8GA 3Q3SA 4D1QA 2GA1A 3L1PA 2R7TA 1B8IB 1VQ7I 4G7ZF 5GAHJ 3SEZA 2E1CA 2K9MA 1RR8C 2R7FA 4EMSA 1XCBA 4R1HA 4JX6A 3HKZN 4ASNA 3BG5A 4Y52J 1RUNA 4B3XA 1YX3A 4Y33A 2JWTA 1HCRA 2V4JC 4IXAA 2BY2A 3F21A 3OV8A 4G8XA 2I5UA 4OMYA 1HW1A 5B3SH 4LLLA 3L2RA 1UZCA 2IBDA 4IKFA 1FBSA 2GZWA 4NQWB 3QOPA 4FX0A 3BR1A 3K7AJ 3M1CA 1WJAA 2WV1A 5HLIA 2L7ZA 3OYIA 3TKYA 3I4PA 4IZZA 1AU7A 5F1JA 5J1YA 1HKTA 3K10A 2BVLA 4BHCA 3S14J 5EEAA 5DD8A 2KL4A 3OWTA 2EQRA 2PFBA 2B63J 2HFHA 2EPFA 1ETYA 1E3HA 4A0XA 4G6DA 1XDSA 4CICA 1X1AA 3FMRA 2V79A 2NXNB 4BEHA 3EYIA 2QLZA 1XMXA 4RB1A 9ANTA 2Y2ZA 1IN8A 5J6XA 1QRYA 4II2A 3KFWX 3JSOA 1T38A 4E7IA 2M0CA 1DPRA 1MNDA 3KP3A 1LVKA 1JHFA 4PDKA 5H2FC 3CDIA 4LLNA 3ZQFA 4BBRJ 1FEXA 5EEHA 2X6XA 3MCZA 2L5QA 1P4AA 3QODA 2DK8A 2ELKA 2JUGA 4IOCF 2X6OA 3EPZA 3FBIB 5GADJ 1T2KA 5HNHA 2XDVA 4BQOA 2KDOA 2AQFA 4MQVA 2EFOA 1MSFC 4L9VA 1SANA 1F43A 2DYRH 2VIXA 1B59A 2X6YA 5K5OA 2CYYA 1MBGA 2Y9YA 1T33A 2VT2A 3LAPA 1W1WE 2DA5A 3K6GA 4HRIA 1U5TA 3WHBA 3O2PE 2M7AA 2FD5A 4X0GA 5ILVA 1EA3A 5BNGA 1H9GA 4I6ZA 3LSJA 3GTJJ 2CUZA 4XK4A 2FRHA 2JSPA 3T1BA 2M30A 1IN5A 2DFIA 2HPIA 4JQFA 2G7UA 4KYWA 2GWRA 1J7KA 2HU9A 4UNOA 3H0DA 4XIDA 3L2WA 5DDGA 3CC7I 4B8XA 3KYLA 3JAMZ 2CQKA 3MKZA 4EVIA 4BJ6C 2DA3A 2GXGA 2HNHA 3R60A 3J80K 2KIMA 2VB6A 1YJNI 2D1VA 2LOOA 4EQQA 5GPCA 3IC7A 3TEDA 3T8TA 4HF0A 4LITA 4LG0A 5LEKA 1HC8A 3LSHA 5M5WJ 4EM1A 4GO1A 3UNGC 4C2UA 3BR2A 4Q4ZF 4RDUA 5L3FA 3PIOF 3CZ6A 5LHGA 2PMZN 2G9WA 4N9HA 1G3YA 2JPBA 1HW5A 3QPSA 5B1BH 3B6CA 5D5XB 2DMQA 2WTEA 3FMQA 3PQJA 1R22A 3C7JA 1QGPA 1RKWA 2K27A 3PO3J 1W36D 1T98A 5J4VA 3C18A 5DUIA 1JJ8C 2QBYA 4AYBA 4QPOA 4XRSA 3F8BA 3M9AA 1I27A 1SD4A 1FIPA 3ERMA 2OAZA 1C0WA 3ZN0A 4LMYA 1MD0A 2HZTA 3CLQA 3I56I 1USSA 3BTLA 2BOLA 3HPGA 4XRMA 4FCYA 1Z91A 5DCMA 2W82A 1H9TA 3M07A 2HEOA 2NVXJ 2XASA 4HAMA 4O6JA 4MQ9F 5F0FA 3CCLI 1P4XA 2L9NA 5E8IA 4HDUA 2Q1ZB 1TW2A 3TOAA 1GUUA 4UV9A 5L3BA 3NWSA 1R00A 4A6EA 2LF7A 1VQMI 2H1LA 5FD5A 1YFHA 2BY3A 1MBFA 4KDPA 4JYKA 3PQKA 3M8FA 2IS2A 1F1ZA 5K7ZA 2V7FA 3PNYA 1UB9A 1ZK8A 4OU0A 2DO7A 1KU3A 4CCOA 5IY5H 1SMYF 2RQPA 2DI3A 4ETSA 2N8GA 5GPAA 1V3FA 1MBEA 3DV8A 2YSRA 2K9QA 4C2MJ 3JRDA 3E6CC 3QPHA 1GHCA 1R1TA 1YG2A 2DU9A 3H0GJ 1HLVA 3BJOA 3HG9A 3CD6I 3ONQA 2OCCH 4BU2A 1QPMA 4F3QA 2DCEA 5D5WB 4PJ0C 3K1MA 5CVIA 2DT6A 3HRMA 2AQEA 5KAIC 1Z67A 3OS1A 4F93B 2QYOA 2BY1A 2LY1A 3L9FA 3FKJA 2H27A 5LEJA 1S3JA 1YRNA 4XLAA 1I39A 5HS9A 2O6GE 1RZ4A 2WB1N 1TWGJ 4WWCA 2R5ZA 1ACIA 4HLYA 2DFEA 2NVUB 1ZRDA 1O7FA 3BR6A 2QZ8A 3OIQA 4BDYA 2OTJI 4EGZA 3KX2A 1MH3A 2AO9A 3PFIA 2G7HA 1R5HA 1XGNA 2MBFA 1M1EB 3QYFA 1Y6IA 2ZC2A 4ZYAA 2EBIA 2CUFA 4A12A 3DKYA 1HA8A 4A3LJ 1YIJI 3G1LA 1F9NA 1MW7A 1U78A 3LSMA 3VFZA 4M73A 1ZRCA 3HOVJ 4HNVA 5IYDJ 2WC2A 4H4KC 3T0YA 3MKWB 3W6KB 4YIFA 2IGOA 3CDHA 3BTJA 4A5NA 4OMZA 5DEQA 3FXLA 5IYBJ 2NVTJ 4I76A 2X4HA 4HSTA 5ICFA 3JRAA 1X3UA 2FMLA 1MDMA 4L5JA 1FP1D 5KHDA 5FLVA 5LBQA 5IP6A 1HQCA 3OYNA 4P5OA 1R1UA 2BW3A 2IP2A 4CCMA 4EV0A 1Z7LA 4XKCA 5D5VB 2K9LA 5E3MA 3G4SI 1XSXA 2M4KA 1LKXA 5EJCA 4C3HJ 4CDGA 4BL0B 4YFKF 3IKVA 4EJWA 4X6AJ 4IHSA 3HTSB 1QO0D 2QUFA 2H09A 3GYHX 4J00A 1XMAA 2Q0OA 3FXUA 3S1MJ 5JR3A 4G12A 3FXOA 2GIZA 4KMFA 2HXIA 2VQGA 1SFUA 3M4OJ 1ZG5A 3MFKA 4AUXA 4G7HF 2ESNA 1R4MB 2M1BA 2EIKH 3TL4X 3S3NA 5CJ9A 3NARA 4PCQA 3HSEA 2DXIA 3OL3A 1Z3YA 4XSZF 2VPLA 4UUSA 3BWGA 2DTZA 2VJ4A 5L3GA 4DZJA 2R0QC 5BPDA 1TWFJ 1E3OC 1X2NA 2PEXA 3FM3A 4HQEA 3S1NJ 2ZJRF 2PMUA 3LFKA 2AXTC 3OSGA 1YO5C 3RKXA 4BEHB 2GA2A 5F04A 4BXFA 2K5CA 3KP7A 3K1NA 3TO9A 1L3LA 3LSIA 4UUVA 2ZCWA 1XSVA 4DQ2A 1B9MA 1NG6A 3FX3A 5J1RA 1OCPA 2L4AA 4WXHA 5L3EA 1WH7A 2VC0A 1GXQA 3HKZA 4HOBA 1HOMA 1H8AC 2M87A 3I58A 2KLOA 2KZGA 4NB5A 4CSWA 2JT1A 5B5EC 2CGPA 3LA2A 3CCMI 1WI9A 4KITB 2Y0SN 1I3QJ 4RAGA 5CVRA 4XONA 3W2WA 1ON2A 4HNUA 5FKNA 3LAJA 4EGYA 2HDCA 1A35A 1JUSA 1J59A 3M8JA 1I50J 3HXLA 4KT6A 3J81Z 2FF4A 3G1MA 2JPCA 3Q0WA 3SZPA 1U5TB 3H36A 3O3KA 4CCNA 1IN7A 1W5SA 4YEJA 2ICWG 1TT0A 2YPRA 5F6FA 3J7ZI 1G3TA 3DLLF 4E7HA 2JVHA 1FMWA 5HVQC 4BY1J 2F6CA 3K4MA 2J5OA 1TBXA 1SAXA 4RM2A 3BOQA 1VQLI 1UHWA 2L54A 2CV0A 4E7ZA 3RSNA 1O4XA 2QENA 4MNUA 2NVYJ 4HPQA 3KETA 3VPRA 3F23A 3ERED 2JQ7A 2GQQA 1ERDA 3DF8A 4D9JA 3GFJA 3K4LA 1IRZA 4CUGA 1IC8A 4LG0B 3MQ0A 5A2QK 3H9QA 3HSRA 3OIOA 5BOXA 3QP6A 1HDDC 3GBGA 2HTJA 4FT8A 2WBMA 4MFEA 2H6CA 5TJJA 1Y39A 4GFBA 4ZZDA 2AXLA 3WHCA 3HOTA 2FJ1A 4XKBA 4LIVA 4L5EA 3F0CA 3MMYB 1JKOC 2OQGA 4BQAA 2LH9A 2CQ7A 2LRDA 3GW2A 4XQFA 4D5CA 1LDKB 2EA4A 3HB9A 4EM0B 2QBYB 3U9GA 3MZYA 4KT5C 2CRGA 3PSIA 3SZGA 1YX5A 4UB6C 3BR3A 4NUBA 3CJNA 4D0PA 3DEWA 1AKHA 1OCRH 1VQ8I 4KUMA 3BG9A 1G4DA 2MYSA 2LLKA 5DCMB 4IEJA 2GLOA 1D8JA 5M5YJ 3G73A 1DP3A 5CQGA 3G71I 3ZQ7A 2QF7A 2WY7Q 5CVJA 1FBQA 3GFLA 4PFPA 2FBHA 3E1SA 4JP0A 1Z1DA 1LFPA 1CF7A 1DP7P 2A3SA 4KIBA 1Z05A 3V8JA 1IRXA 5FKMA 1P7IA 2BVMA 4PJNA 2VJIA 4YG2F 5HLTA 1IXCA 1IUYA 2XAQA 1EKEA 2FXAA 1XX5A 4CO8A 4XN0A 4S0HB 2PMZA 2K4BA 1I5ZA 2VXDA 4YELA 1D0XA 4GCVA 3RKWA 3OSFA 4MO7A 5EZHA 2O7OA 3ZMSA 4ENMA 3GLXA 5EZGA 4E70A 4RB2C 4W97A 4BACA 2WADA 2QWWA 2UWMA 1R1VA 1TQIA 4BS9A 2R7OA 2CUEA 4HLXA 5C3EJ 2ISZA 4AIKA 4LG3A 2UUZA 2E5ZA 1X2MA 4LK0F 4ZDLA 1VQOI 1W7PD 2W25A 3VODA 1YRNB 5CVVA 2YU9J 4HEA2 2Y0MA 2ID6A 2MA3A 2R5YB 2R5ZB 4BH9A 4GYGA 2FQ4A 2X0LA 3HL2A 1BIAA 4KN7X 3CMMA 3RYPA 4YFNF 5IP9J 3PUFA 4I02A 2RAEA 2GAUA 5GTIC 4HZFA 5GP9A 3B02A 2DFHA 3VDXA 5EF6A 3BY6A 2R7RA 2IAIA 1J75A 2R7XA 3I64A 1EH8A 5HS7A 2EB7A 2LY2A 2VKHA 4GDFA 3I59B 3EUHA 1ZRFA 2VKEA 2L01A 1BA5A 3DPUA 4IO9F 2NRAC 1JTYA 2DT7B 2I10A 3AG3H 1WSUA 1J9IA 3E5XA 1YW7A 1N75A 4M6VA 3FK7A 1MDMB 1DPUA 2F5DA 2WAEA 3CF5F 2QQ9A 3K2AA 1WQ2A 1K7AA 2EV5A 2BW3B 2X48A 3KLOA 3K4NA 2JRMA 5E1XA 3W6JB 1BW6A 2YUSA 2E1MC 3S15J 2WB1A 2QQ8A 5LRSA 2HXOA 1VI0A 4RBOA 2ZXHA 2RREA 1YHQI 2JSCA 1VQNI 2CSOA 2DA6A 1P6RA 2F2EA 2ZFUA 4XORA 1Y56A 3CC2I 1YYVA 4IRGA 2DMTA 3HC7A 4Y7NJ 2V6EA 3HJEA 2XRNA 2LYCA 2RNJA 3TO6A 2K7LA 1RRJA 5KCMA 2YR2A 1BR4A 4Z6YA 1I6XA 4IHXA 3BCAA 1RI7A 4UUSB 2FUG2 2ZKZA 2W4SA 1PJRA 4RM3A 1U3EM 2ECCA 3DFGA 2HOAA 3BG7A 1X1CA 3JTHA 4XR6A 4IL6C 1LFUP 3HM5A 2XB5A 4R79A 4WF2A 3I0TA 4L9NA 1MJAA 4N4NB 3JAMK 2HYFA 2VQLA 5ILUA 2XSDC 1RNLA 4EJVA
chains in the Genus database with same CATH topology
3IP4B 4LITA 4J01A 3LSHA 1UELB 2M4GA 3UNGC 4C2UA 4AU7A 3CF2A 3CZ6A 3C2GA 4XM3A 4E7JA 1BR1A 4ZJZA 4HG2A 2V9KA 3H5RA 4HSRA 2PJRA 2CW8A 3DTIA 1PYVA 3UR3C 2KPMA 3OYHA 2X1EA 3D5LA 1WJCA 3DLAA 3KEYA 1D1BA 4PJMA 3H5AA 1W36D 4AYBA 4QPOA 4BUPA 3LSKA 3OR1C 5FRNA 2LBFB 2Q2EB 4DBRA 2IS6A 3HPGA 2BOLA 2W82A 2X51A 3PJRA 2X1CA 4CCKA 2DOAA 2HDWA 2L9NA 4IQJA 2Q1ZB 3A1YA 4XLCA 5FROA 3NWSA 2CMPA 3J7AY 4BQQA 4B44A 1QU3A 1Z21A 2IS2A 2V1NA 2V7FA 3PNYA 4PJLA 4ZDPA 4E4HA 3S3MA 4CA0A 4CCOA 3DKXA 1WJFA 1R6RA 2ELJA 2VJJA 4XN3A 2RQQA 2RNGA 3HG9A 1V5FA 3ONQA 3VYTB 1J09A 4BU2A 2Y0SA 1P9QC 4F3QA 2DCEA 3PSFA 4PSXA 1MNEA 3IAS2 2CW7A 2DT6A 1OLTA 2AQEA 2XF6A 1WJDA 3OS1A 2Z16A 4F93B 2LY1A 3PFYA 3FKJA 2I8DA 2QKMB 3AFHA 2K3PA 1X1DA 4XLAA 3VYSB 2A6TA 2XF5A 3K4KA 3CP8A 4OAZA 3VYUB 5JHFA 4U7BA 3RCOA 3BCBA 4XKVA 3LL7A 2HPMA 3OIQA 4BDYA 3S3OA 1BR2A 4ANJA 3EUHC 3KX2A 3DU6A 3L2UA 3D5RC 3QYFA 1Y6IA 4ZYAA 4XMYA 3DKYA 1HA8A 1D1CA 2WAFA 4BQNA 1MW7A 2MC4A 1TZLA 1NG7A 2Z1DA 3FBNB 3LSMA 4YRVA 2R7WA 1WJBA 2OV7A 4H4KC 3MKWB 3VYRB 2IGOA 2QKLB 3DWLE 1WJ5A 2KHMA 3IUOA 4E7SA 4CZCA 4OWRB 4ZTJA 2R7UA 1MMAA 1SAUA 4HSTA 2PJRB 2GOMA 1V5EA 1D1AA 4XNFA 5KHDA 3HPHA 3FDYA 2VASA 3OYNA 4P5OA 1N77A 2KP6A 3OS0A 2BW3A 2JVGA 3QYBA 3U21A 4CCMA 1UG0A 1Z7LA 4XKCA 2K9LA 3QOEA 2M4KA 1LKXA 4BL0B 2XC7A 1QHHD 1DGRM 3CJQB 4J00A 1KONA 2MFZA 4RMNA 2KZVA 1DGWY 2VQGA 2X6WA 2IXSA 2LC2A 2R4GA 1S9HA 1G8XA 5FRMA 4PSWA 1N78A 2W00A 3TL4X 4BE2A 2VQHA 3V42A 4ZC3A 3S3NA 4XOPA 2DXIA 3OL3A 3BG6A 2ZXIA 1Z3YA 2VPLA 4FASD 3OYEA 2F5VA 2VJ4A 4AVZA 3K4BA 1UAAA 1YE9A 2IS4A 2VLAA 2XF7A 4F92B 3F9KA 1VZ0A 4CCJA 3OYAA 1ZELA 4MLOA 3EUKL 2OC6A 3OYJA 4BEHB 3OYCA 4BXFA 3H9JA 2HZDA 2K5CA 3L2QA 4P1WA 3LSIA 4IX7A 3DEEA 2E1MB 1NG6A 2VXZA 1T0FC 1X4PA 3DQVC 1MMGA 3W2AA 2L9SA 3HKZA 3CESA 2KLOA 2KQRA 2CFOA 2WA0A 4CSWA 5HNFA 4B47A 4KITB 4KISA 3N05A 3W2WA 4XONA 4HNUA 2Z2SB 4B48A 1X1BA 4BJTA 1W36C 1T95A 3M8JA 3HXLA 4KT6A 4Y3OA 2LBFA 2ZSIB 4CCNA 3K4JA 4YEJA 4LIUA 1TT0A 3SEQA 3IAM2 2WAQA 3AL0C 5TGTA 3OYFA 3RQ4A 3OYLA 3ZR8X 4E7HA 2JVHA 2OUMA 1FMWA 2LG4A 5HVQC 3MKYB 2F6CA 3K70D 3K4MA 2R7VA 3E0JB 3SDBA 4JOMA 4RM2A 2IGNA 2E5NA 4NC7A 2CV0A 4E7ZA 3RSNA 4BJ5C 3RPUD 4DJAA 4RLFA 4HPQA 4DIQA 5CPRB 2NOJB 4C30A 3DPTA 5CKTA 2IGMA 1ERDA 4IQ4A 2KRHA 3K4LA 4D9JA 4RLQA 3OMYA 2V26A 2DJIA 3TBIA 4CUGA 1SFKA 2M0MA 3H9QA 3HUGB 3OYMA 1U0JA 3DU5A 2WY8Q 1OR7C 3GBGA 3ZGKA 4XL9A 3A2KA 2WBMA 3DPLC 4II3A 3OR2C 4U87A 2CH0A 3HOTA 4XKBA 3CJRB 1D0YA 3OYBA 3NWTA 1BOBA 2W1OA 4LIVA 3I9V2 1K6YA 2HVSA 4KJZA 3MMYB 2LH9A 2LRDA 3LMMA 3A4CA 3OOUA 4XQFA 4BGDA 2R7SA 1WFXA 1LDKB 4EATA 2X85A 1G59A 1MMDA 2X1DA 3PSIA 2HVQA 3SZGA 3EUAA 4QPQA 1YX5A 4C9YA 4G6TB 4NUBA 4ZTFA 2VL8A 1E0EA 4OAYA 2MYSA 2VKDA 3G2BA 2CV2A 1DP3A 1X4OA 3K4CA 5CQGA 3QYEA 1WJEA 3S93A 2M3AA 2WY7Q 1D0ZA 4GRIA 3PNTA 4PFPA 4XLHA 3E1SA 1X19A 3LSGA 2O5RA 2R7QA 3H9GA 1LFPA 3MD2A 1IRXA 3VWBA 3ZCOA 2CV1A 2BVMA 4PJNA 2MABA 2P0WA 2VJIA 5HLTA 1MMNA 4E7KA 3L2VA 3AL0B 5HOOA 3H5NA 4XN0A 2L2OA 4D1QA 2PMZA 2R7TA 2XSJC 2VXDA 2F4IA 1V5GA 1Z3XA 3SEZA 2K9MA 4YELA 1D0XA 1FMVA 4PUSA 4B3XA 4BACA 3PNVA 2VJ5A 2UV1A 1YX3A 2WADA 2UWMA 4BS9A 4Y33A 1QHGA 2R7OA 3OS2A 2V4JC 4Y4RA 3AKZA 2M7BA 3H35A 4LG3A 4E7LA 2UUZA 3L2RA 2E5ZA 4PK4A 3VSLA 4IKFA 4ZDLA 3CP2A 2HQAA 4NQWB 3W2VA 5KNLA 3M1CA 4HEA2 5CQEA 1WJAA 2HVRA 3I3LA 3OYIA 4PFOA 4IZZA 3HL2A 2CUJA 3CMMA 3K10A 3S32A 2BVLA 2KL4A 3OWTA 3OIPA 3OYKA 4BDZA 2A5WA 2LREA 1GLNA 3W3CA 3OY9A 3OYGA 4DBQA 1X1AA 3C2HA 3VDXA 4DOZA 4BE1A 2R7RA 4BEHA 2R7XA 2W7NA 4II2A 2LY2A 4E7IA 4XLFA 3OYDA 2VKHA 1MNDA 4DGWB 1LVKA 3BC8A 3LFUA 3BLYA 4XLEA 3DPUA 2DT7B 2X6XA 2L5QA 3QODA 5LFAA 4XOTA 1N75A 2JUGA 2GOXB 4C2TA 3FBIB 3EPZA 2WAEA 4XKWA 5HNHA 2VQCA 2KMUA 2XDVA 4BQOA 2IS1A 2KDOA 2AQFA 2JA2A 2L7KA 2BW3B 4NC8A 2VIXA 2X6YA 3K4NA 1JI8A 3DTEA 4PJJA 3RTRA 3D5SC 3K6GA 4HRIA 2E1MC 2M7AA 2WB1A 4F91B 4X0GA 2IGKA 3ZQQA 5LD2C 1EA3A 2ZSHB 2ZXHA 2RREA 3VSKA 3PL8A 2ZFUA 4XORA 1Y56A 4HNTA 4NNJA 2CUZA 4N4OB 2KRCA 2JSPA 2XAUA 4CH7A 3HC7A 4F55A 3FHNA 2V6EA 3SYTA 2LYCA 3TMOA 5KCMA 2HPIA 2MD0A 4JQFA 1BR4A 3S8PA 3K70C 4ITVA 3BCAA 2HU9A 2FUG2 1AA7A 2W4SA 1PJRA 3H0DA 4RM3A 3L2WA 3ZXSA 3KYLA 2CS3A 4F52A 3DTKA 4ZDOA 3BG7A 1X1CA 4XR6A 4CCLA 3MKZA 2E60A 4BJ6C 4R79A 2HNHA 4BE0A 1DQUA 2VB6A 3PUBA 4N4NB 2LOOA 3HOSA 2VQLA 4B43A 4FETA 4E6KG 3ZRGA 3OL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1M B; 
#chains in the Genus database with same CATH topology
 1IDZ A;  1LFB A;  1BOA A;  2O3F A;  3BDD A;  5D4S A;  2VUM J;  3HUG A;  1J0R A;  1UEL B;  5BQT A;  2M4G A;  3JRF A;  2XPV A;  5JVG F;  1WKM A;  2Y69 H;  5FKK A;  2GXB A;  4QTR A;  1XC5 A;  5K1Y A;  2ZXJ A;  1MBH A;  2P6S A;  4U0W A;  4E7J A;  1BR1 A;  2FA5 A;  1IN6 A;  4HX4 A;  3ZMU A;  3S1R J;  2LNB A;  3DTI A;  1AWC A;  1OCT C;  5E20 A;  3OYH A;  2EV0 A;  1RC9 A;  3D5L A;  3A0H C;  2DAO A;  2EIJ H;  4PJM A;  4M9S A;  1S7E A;  1KZH A;  2HR3 A;  2HOT A;  5ICE A;  2EZI A;  2ETH A;  3ABL H;  3LSK A;  5JLW A;  2E2H J;  2L02 A;  4IHW A;  3OR1 C;  5FRN A;  3TQN A;  1TP4 A;  4DBR A;  5E79 C;  2XHK A;  3BR5 A;  3CCV I;  3K2Z A;  1O7L A;  4XLN F;  2X1C A;  1DDN A;  5D6F A;  1XN7 A;  1U2W A;  3SFZ A;  4MEY F;  4IQJ A;  4YII A;  4HW0 A;  5M3M J;  2Z9O A;  1ETQ A;  4WX9 A;  4XLC A;  1TWA J;  5FRO A;  1PUF A;  4Y13 A;  3WTW C;  4BQQ A;  3WTY C;  2HDD A;  2DPD A;  1LUJ B;  4NHJ A;  4O3M A;  2MH9 A;  1Z21 A;  4M3B A;  1A31 A;  1ORK A;  1OPC A;  2M2E A;  2DA4 A;  5ED4 A;  3FXJ A;  4BHB A;  2O03 A;  2CQX A;  1WJF A;  1FOX A;  4IVN A;  1R71 A;  1ENH A;  5IT3 A;  4I2O A;  1JJ6 C;  1IXS B;  2EFQ A;  2RQQ A;  1IUF A;  4FQG A;  4QSH A;  5DM6 F;  4M3G A;  2CW0 F;  1REP C;  3BZK A;  1HKS A;  3G1O A;  2Y0S A;  4S04 A;  3HOZ J;  3I53 A;  2QCO A;  1WJD A;  3N97 A;  3MKL A;  2EIL H;  2LKS A;  4HX8 A;  5IPA A;  3L09 A;  2BBY A;  2WV0 A;  3R6S A;  1O57 A;  3HIF A;  5FB2 A;  2QKM B;  3AFH A;  5DD4 A;  3RKY A;  5LLQ A;  1J2X A;  2DMP A;  4HYE A;  2HOS A;  1SFO J;  2XF5 A;  4OIO F;  3NEU A;  3VYU B;  5JHF A;  3RCO A;  1L0O C;  3R4K A;  3BCB A;  2PG4 A;  4XSX F;  5F27 A;  1BR2 A;  3P9C A;  3REO A;  1AKH B;  4MHG A;  3DU6 A;  3L2U A;  2O8K A;  3ZN1 A;  3SQN A;  4M6Y A;  1ZG3 A;  1WI3 A;  3WOD F;  2XKO A;  5D4R A;  3B6A A;  2VKV A;  4HV6 A;  2VC1 A;  2LP0 A;  2WAF A;  3HRT A;  1CF7 B;  2BEO A;  2Z1D A;  1NG7 A;  2ZB9 A;  3T5X A;  3E7L A;  5GAG J;  3Q0U A;  3VYR B;  5ICG A;  5DS9 A;  1WJ5 A;  5JFR A;  2KHM A;  3IUO A;  3Q5F A;  4CYC A;  4KNY A;  4OWR B;  1U5T C;  1X3W B;  4OIN F;  4YIR X;  4K2E A;  5FLM J;  2PJR B;  2ME6 A;  3ASO H;  2EWN A;  4RAZ A;  5FLX Z;  4BXU A;  3QWL A;  3HYI A;  2VAS A;  2KP6 A;  2JVG A;  3O6B B;  3P9K A;  1UG0 A;  1Z6T A;  2DA2 A;  3QOE A;  5F64 A;  2ID3 A;  5E8G A;  3IH2 A;  2P7C B;  2O8X A;  3CLO A;  3CCY A;  4F7Z A;  3LSP A;  3CMA I;  3COA C;  3F8N A;  4V19 K;  2F5E A;  3CTA A;  4EM2 A;  4CXF A;  3V7S A;  1RKT A;  1KU7 A;  2KZV A;  2IXS A;  4L9T A;  4P9U A;  2NOG A;  1S29 A;  4G6Q A;  1FTZ A;  2W57 A;  3MEX A;  2W85 A;  2K02 A;  3S1Q J;  2VOO A;  1HKQ A;  2ZXI A;  4FAS D;  3OYE A;  1JHH A;  2F5V A;  1R5G A;  4AVZ A;  1FX7 A;  1ZAO A;  2XF7 A;  1QNT A;  4U0Y A;  3IRR A;  2DMU A;  2DW4 A;  3OYA A;  3WTS C;  2JZY A;  4MIM A;  1BIB A;  4M9X A;  1ZEL A;  4EEF G;  5DM7 F;  4MLO A;  3EUK L;  1W7P B;  1GVD A;  3OYC A;  3AG2 H;  3BTI A;  1P4W A;  1SFE A;  1QZZ A;  2DTR A;  3L2Q A;  4BAY A;  3X2Q H;  4IX7 A;  4ESJ A;  2E1M B;  2UZK A;  3S2D J;  1MMG A;  4UB8 C;  1T08 B;  3H92 A;  2YU3 A;  3BRO A;  3HRU A;  2A61 A;  2FEZ A;  3CES A;  3Q9V A;  1Y1W J;  1NTC A;  2ISY A;  4ENJ A;  5JVT A;  5HNF A;  1D8K A;  4B47 A;  4KIS A;  4IRI A;  3DBR B;  3JRI A;  2K85 A;  3NRV A;  3GTP J;  2E35 A;  1A5J A;  2ZJ2 A;  2HKO A;  1S8N A;  3D0S A;  5EG0 A;  1W36 C;  2P5V A;  2IJL A;  2YX4 A;  3L7W A;  3E6D A;  1N25 A;  2VBZ A;  4Y3O A;  2Q2E A;  1Y8Q B;  1HBX G;  1XB4 A;  3J81 K;  2DQL A;  4DZP A;  1V54 H;  5D5U B;  5TGT A;  2EH3 A;  3CUQ B;  3OYF A;  1Z7U A;  3LWF A;  3ZR8 X;  2CO5 A;  2OUM A;  3K70 D;  2FSW A;  1SVM A;  3I71 A;  2BXZ A;  2R5Y A;  1XGS A;  1X1P A;  3T8R A;  2IGN A;  2E5N A;  1BL0 A;  5IT9 Z;  5HDG A;  4S05 A;  4IHY A;  1IGN A;  3RPU D;  2D1H A;  2MLK A;  3SHF A;  4DIQ A;  2W84 A;  2DBB A;  2WWY A;  4C30 A;  4D5F A;  3DPT A;  2LFB A;  4LLG F;  5F1R A;  1PP8 F;  2IGM A;  2RVC A;  2EJR A;  5LHI A;  3J7A O;  1QVT A;  3TBI A;  3WGG A;  5LGN A;  1SFK A;  2M0M A;  2Y30 A;  2D45 A;  3IRQ A;  5FGM A;  3HUG B;  4AD9 A;  2WY8 Q;  2KT0 A;  2XV4 S;  2IA2 A;  3GF2 A;  4ABZ A;  3A2K A;  3I59 A;  2D2W A;  2FNA A;  3QAH A;  3RPU A;  3KPH A;  1H88 C;  3WGI A;  3HSF A;  3OYB A;  4I01 A;  3NWT A;  3ZQL A;  1BOB A;  3JRG A;  2BZT A;  1K6Y A;  5HDK A;  2HVS A;  3RDI A;  3RPQ A;  4LJZ F;  4PZJ A;  6PAX A;  1BC7 C;  3DXJ F;  1FOY A;  4Q47 A;  1HF0 A;  3M1E A;  1D5V A;  1WFX A;  5EGO A;  2TRT A;  2XVC A;  5J4Y A;  1MMD A;  2EFN A;  4IJA A;  1TWH J;  3PO2 J;  2X1D A;  3E5U A;  1WHU A;  3EUA A;  3DBH B;  5CYV A;  4G6T B;  1FY7 A;  1E0E A;  4OAY A;  1BJZ A;  1R4N B;  3LNQ A;  1FP2 A;  2MH2 A;  2NS8 A;  4RAF A;  3K4C A;  3RIR A;  2XAH A;  3S93 A;  3PNT A;  3AG1 H;  4XLH A;  4CZZ A;  2O5R A;  2R7Q A;  4WK8 F;  2QA4 I;  1PUF B;  3MD2 A;  3GZ6 A;  3VWB A;  2FOW A;  3ZCO A;  3BQY A;  3IWF A;  4E7K A;  2KIF A;  3H3Z A;  4UY8 I;  3KYD B;  4QWQ A;  3L2V A;  2XAF A;  3AL0 B;  3H3U A;  3ZMZ A;  3WTV C;  3D1N I;  1WVR A;  1VQ5 I;  2L2O A;  4HV5 A;  2XSJ C;  1V5G A;  1Z3X A;  2A07 F;  1TTY A;  2ELH A;  2OZU A;  1IO2 A;  3C1D A;  3BZC A;  1GV5 A;  2DA1 A;  2ZJQ F;  1ETK A;  2VJ5 A;  2JK3 A;  3ABU A;  2KFD A;  2UV1 A;  5EDN A;  3E3V A;  3EYY A;  1KQ9 A;  1YOV B;  2M7B A;  3CO7 C;  4E7L A;  1FJL A;  3GTG J;  4LGW A;  2R7Z J;  1D3Y A;  3QRF F;  3B73 A;  2NNY A;  1JT6 A;  4HDV A;  2HOE A;  4HA8 A;  3W2V A;  3BTC A;  5K5Q A;  3ECO A;  5CQE A;  1YJW I;  2HVR A;  4YFX F;  1QBJ A;  1BW5 A;  4PFO A;  3LA3 A;  2PN6 A;  4KA4 A;  1B1B A;  2RKH A;  1ETV A;  3S32 A;  1PP7 U;  1ZGW A;  4DYR A;  2JA5 J;  4KIG A;  3HRS A;  1UFM A;  4TV7 A;  1G6N A;  1OIS A;  2EK5 A;  3IKT A;  1IAW A;  2LRE A;  2E2J J;  1GLN A;  1WH5 A;  4A3K J;  2HQR A;  1XD7 A;  2E2I J;  3OY9 A;  3OYG A;  4DBQ A;  1IRG A;  3C2H A;  4DOZ A;  1POG A;  5HDN A;  2IW5 A;  2C6Y A;  3BJA A;  2L4M A;  1MBJ A;  1R23 A;  4XLF A;  3OYD A;  4BXX J;  1BJA A;  4DGW B;  1WWX A;  5TIS C;  3LFU A;  4XLE A;  3KP2 A;  1UMQ A;  3A0B C;  3V7C A;  2BYV E;  3HHG A;  3GTO J;  1JE8 A;  4CYC B;  4I0A A;  5BS6 A;  2L7M P;  5LFA A;  5FKO A;  2QVO A;  2GOX B;  4C2T A;  4XKW A;  2Y75 A;  3TP3 A;  3PIP F;  1DU6 A;  1ZN2 A;  2DOD A;  3EQL F;  3TW7 A;  2P6T A;  1S6L A;  2YS9 A;  5E3O A;  3HGG A;  4MEX F;  4NC8 A;  4A6D A;  1JI8 A;  2DOF A;  4RGS A;  5J40 A;  2RC4 A;  3DTE A;  3K9T A;  4PJJ A;  1LE8 A;  3D5S C;  4KFC A;  3BR0 A;  5E17 F;  2HTS A;  2IEK A;  5H6R A;  5LD2 C;  1OMI A;  5E18 F;  5DYM A;  2ZSH B;  2X9D A;  2MGQ A;  5HS8 A;  3VSK A;  3PL8 A;  4NNJ A;  3CDL A;  2XAU A;  3GFM A;  5EYR A;  4CH7 A;  3FHN A;  2RDP A;  3SYT A;  2PLY A;  1K61 A;  1QZY A;  3MVP A;  2MD0 A;  3S8P A;  3FXQ A;  2NYX A;  1X3Z B;  3M7G A;  3ZXS A;  4ZDO A;  3DTK A;  4CCL A;  1JGG A;  2E60 A;  4IF4 A;  1DQU A;  4A5M A;  3FXM A;  1GDT A;  1BM9 A;  3IL2 A;  4B43 A;  4FET A;  2KDZ A;  5F0H A;  3WG9 A;  5C4X J;  4C3I J;  1RIO H;  1IV6 A;  2EV6 A;  1B6A A;  4DNC A;  1FT9 A;  1W5C C;  2E1N A;  2MD5 A;  3P9I A;  4KIC A;  4AU7 A;  1R58 A;  2BHZ A;  2F4O B;  1OKR A;  1RES A;  1B72 A;  4CHU A;  4B4C A;  1IDY A;  2FQ3 A;  2H8W A;  5H20 A;  2HQN A;  4ZJZ A;  1W0T A;  2V9K A;  3H5R A;  3F22 A;  1YW8 A;  2CW8 A;  3UR3 C;  2PJR A;  2KPM A;  4XBF A;  1ZLJ A;  1BBY A;  1ZG1 A;  1FTT A;  1R5I D;  2A68 F;  5F0C A;  4MTD A;  2VE9 A;  1WJC A;  3GTQ J;  1D1B A;  2BXY A;  3ZMV A;  3H5A A;  1E3P A;  3FIW A;  2LR8 A;  5EG0 B;  3J7Y J;  3KLN A;  2CQN A;  1OJL A;  1VF9 A;  1FPQ A;  2CQQ A;  2Q2E B;  1ZGA A;  2X51 A;  2OA4 A;  2B9S A;  3KIO A;  2OBP A;  1A6Q A;  2LDU A;  1K79 A;  1BI1 A;  2M8G X;  4XRF A;  3A02 A;  2CWE A;  3WTT C;  3M3Y J;  1E17 A;  3ISP A;  3F72 A;  4UV8 A;  4AVP A;  1OYY A;  2CMP A;  1QU3 A;  4U88 A;  3BQZ A;  2H1K A;  2NAZ A;  1P2F A;  4RGU A;  4KIF A;  4ZDP A;  3CUO A;  2A69 F;  3F6O A;  2IA0 A;  3DKX A;  3MWM A;  4RB3 C;  4A3I J;  3FXK A;  5ERI A;  2ZFW A;  1ITY A;  1R6R A;  1W7P A;  1XG1 A;  3CMY A;  1E2X A;  2P4W A;  4XN3 A;  5D8K B;  2AS5 F;  2D5V A;  1ZKG A;  1B4A A;  2L7F P;  2VT3 A;  1H0M A;  3AG4 H;  4LFU A;  5KK1 A;  3FM5 A;  1BN5 A;  5FFZ A;  4ZYH A;  2K9S A;  2GBY A;  1O3S A;  3IAS 2;  2LY9 A;  1RR7 A;  2E19 A;  1OLT A;  4Y15 A;  2DDA A;  4Y17 A;  4BYY A;  2TCT A;  2Z16 A;  1BI3 A;  3RKQ A;  1YS6 A;  1SD5 A;  3N4M A;  4ON0 A;  4JX5 A;  2KRF A;  3GVA A;  2I8D A;  1UHM A;  3DCF A;  1I1S A;  2K3P A;  3GLL A;  1FYM A;  5H6Q A;  3VYS B;  4RGX A;  2ADU A;  3HOX J;  3SXY A;  3L2C A;  1MJB A;  4IRH A;  2A6T A;  5AIP A;  5EGO B;  4R8H A;  3ABM H;  1OYW A;  3CP8 A;  3K4K A;  4NBQ A;  5J3L A;  4U7B A;  1VQP I;  3CCE I;  4XKV A;  2HWV A;  2HPM A;  3FZV A;  1APL C;  3ULQ B;  3EUH C;  4A3D J;  4DYC A;  3A01 A;  3D5R C;  4AWX B;  1XPX A;  4OIQ F;  2STT A;  3CUQ A;  1FBU A;  1ON1 A;  4XMY A;  1D1C A;  2HYJ A;  1IRF A;  2OPT A;  4BQN A;  5DTD A;  1TZL A;  2DFF A;  3FBN B;  4YRV A;  1WJB A;  3FIS A;  1XGO A;  2QSF X;  1P92 A;  2LVS A;  2QKL B;  3F8M A;  1LQ1 A;  5L3C A;  1IZ1 A;  1J5Y A;  4E7S A;  4CZC A;  4U7D A;  4ZTJ A;  3L00 A;  1U9N A;  3E97 A;  2K3F A;  1MMA A;  3BT9 A;  2GOM A;  1V5E A;  1D1A A;  3DBL B;  4L0Z B;  1F5T A;  3FDY A;  3CUQ C;  3RI4 A;  3OS0 A;  1LNW A;  3R0A A;  3U21 A;  3CME I;  3BZ6 A;  1KA8 A;  5E3L A;  5JLX A;  2ESH A;  2FX0 A;  1QVU A;  1GXP A;  5FLX K;  3PM1 A;  1LDD A;  2Z3Y A;  1S72 I;  2XC7 A;  3KE2 A;  4JX4 A;  1QHH D;  1S5L C;  1DGR M;  4G9Y A;  3CJQ B;  1GVJ A;  3QP5 A;  2ZME B;  1KON A;  2MFZ A;  5IOZ A;  1DGW Y;  2R4G A;  4AIJ A;  4CGZ A;  3Q0V A;  2JA8 J;  1ETX A;  1MMS A;  5FRM A;  4PSW A;  2OZ6 A;  5D6E A;  1N78 A;  1RET A;  2DK5 A;  2W00 A;  1ZTR A;  4BE2 A;  3DP7 A;  3V42 A;  4WCG A;  4A3B J;  3JSP A;  3FMS A;  1R36 A;  2O0Y A;  3IH4 A;  1T0F A;  2JA6 J;  4HX7 A;  3HHH A;  4OIR F;  3WTU C;  1QZE A;  3GWZ A;  2VLA A;  4A0Y A;  4F92 B;  3MZ8 A;  3RZO J;  2ACJ A;  1ULY A;  1VZ0 A;  4CCJ A;  2V1U A;  3ECH A;  3V7R A;  2COM A;  2ZBK A;  1PUE E;  1I6H J;  2E36 A;  3GEZ A;  2OC6 A;  1Y0U A;  1QA6 A;  2MC3 A;  2BGC A;  3H9J A;  5KAF C;  1YQA A;  3GXO A;  3JRE A;  2QSH X;  1ZHF A;  1T0F C;  1XDU A;  2VXZ A;  4P96 A;  1ZAR A;  2F5C A;  4XRS G;  3QPT A;  3W2A A;  4GXO A;  2EFP A;  1JTX A;  5K7F A;  2PI0 A;  1PDN C;  2KQR A;  4FX4 A;  3WGH A;  2CFO A;  5DCF A;  4Q5S F;  1DUX C;  3U2R A;  2AHQ A;  1WZ2 A;  1G3S A;  1FZP B;  5J1U A;  2Z2S B;  4B48 A;  2PQ8 A;  3BPV A;  4FHT A;  4AC0 A;  1K83 J;  5M5X J;  1LE8 B;  3I5U A;  2LKX A;  3EET A;  4AM3 A;  1WRJ A;  2LBF A;  2XRL A;  4LIU A;  4WXC A;  2MSY A;  3AL0 C;  3HEF A;  4NDL A;  4XIC A;  3RQ4 A;  3OYL A;  2XGC A;  2LMD A;  4PGH A;  1K78 A;  3MKY B;  2KKO A;  2LG4 A;  5KVR A;  4OIP F;  5FKL A;  2A6H F;  1OR7 A;  2OD5 A;  3E0J B;  3SDB A;  4JOM A;  3IHU A;  5D8L B;  4CYD A;  2H94 A;  3ABK H;  3HBL A;  1X58 A;  3KCC A;  5IYC J;  3BG3 A;  4RB0 A;  2L9V A;  1VFC A;  2F4M B;  3MZH A;  1G3W A;  5IT9 K;  3GO5 A;  1TQP A;  4RLF A;  1VQK I;  2DPU A;  1TLH B;  2H6B A;  3W6V A;  2DQR A;  2LK2 A;  2XPW A;  2HI3 A;  4L0Y B;  4IQ4 A;  2KRH A;  3FXR A;  1OYI A;  1IN4 A;  4RLQ A;  3OMY A;  1U9O A;  1ETW A;  2DJI A;  2MLG A;  4MGR A;  3OYM A;  1U0J A;  1IXR C;  2DJN A;  3SJM A;  1O3R A;  1ODD A;  4ZYE A;  1OR7 C;  3ZGK A;  3JRH A;  1VQ6 I;  1HSJ A;  2ZXW H;  3QU6 A;  3U1K A;  1B72 B;  1OCZ H;  2B7E A;  3OR2 C;  4U87 A;  2EIM H;  3HOY J;  2VN2 A;  2QSG X;  2HQ5 A;  3V4G A;  2DDB A;  1MGT A;  3CJR B;  5E1W A;  1JKQ C;  2W1O A;  2JA7 J;  4M3D A;  4KJZ A;  3Q9S A;  1ZR4 A;  2Q8K A;  4I98 B;  2FBI A;  2EZL A;  2JMW A;  4N9I A;  3QU3 A;  5JI6 A;  4FE7 A;  1VQ4 I;  4BGD A;  2NNN A;  1G59 A;  3GTM J;  2IVM A;  4RGR A;  2E1O A;  2HVQ A;  4QPQ A;  1OCC H;  4ZZL A;  5L3D A;  1TL8 A;  5C44 J;  4ESB A;  2FOK A;  3WU1 B;  2VKD A;  2CV2 A;  2DA7 A;  1X4O A;  3QYE A;  1OCO H;  5FO5 A;  1ZR2 A;  2TDX A;  2M3A A;  1YW9 A;  3AAF A;  1VTN C;  4G7O F;  4M74 A;  4M3F A;  1CGP A;  3NQO A;  3VB2 A;  3RYR A;  2EFW A;  2LKP A;  2OF7 A;  4BKX A;  3HGY A;  4EJT A;  2IA1 A;  2VPR A;  4FTH A;  3KP6 A;  3LST A;  2K86 A;  5AON A;  3TOB A;  4HBL A;  1SVL A;  1LDJ A;  3E5Q A;  1TWC J;  2STW A;  2BY0 A;  4KN4 X;  1PVE A;  2F4I A;  3MAJ A;  3P7N A;  2NVQ J;  2PX9 A;  1QQI A;  2VBW A;  1FMV A;  4IOA F;  1FSH A;  2IRF G;  4PUS A;  3PNV A;  4HQM A;  1MIJ A;  4A93 J;  4JBA A;  5BPI A;  1QHG A;  4I99 C;  3OS2 A;  4D7M A;  4Y4R A;  3AKZ A;  4ENN A;  4A3E J;  3H35 A;  3ASN H;  3ZPL A;  4PK4 A;  3VSL A;  2DOE A;  3CP2 A;  2HQA A;  3WU2 C;  3IV5 A;  3SDG A;  4L18 B;  5KNL A;  1MSE C;  3WTZ A;  1DU0 A;  3I3L A;  3R61 A;  3ABT A;  2GIV A;  2CUJ A;  2WAQ N;  1K6O A;  2GXA A;  3DKW A;  3ZQG A;  2EIN H;  3CC4 I;  3OIP A;  3OYK A;  4BDZ A;  3A01 B;  2A5W A;  1Z9C A;  5C4J J;  1S7O A;  2P7V B;  3W3C A;  4ENK A;  1LPQ A;  1O3Q A;  3IH3 A;  4BE1 A;  3C3W A;  3IWZ A;  4MFD A;  1LJ9 A;  2W7N A;  1HXD A;  2R7D A;  4W1U A;  3SZT A;  2XRO A;  5M3F J;  4G94 A;  2LD5 A;  2IPQ X;  1YLF A;  3BC8 A;  3BLY A;  2KJB A;  3BPX A;  3NAU A;  2PJP A;  3UKG A;  4XOT A;  4A3C J;  2HYG D;  3FHZ A;  4IHV A;  3QPL A;  2EZH A;  4A3M J;  2VQC A;  3WE3 A;  2KMU A;  1LVA A;  5HLH A;  2B0L A;  1R9T J;  1TC3 C;  3HOU J;  3ZQH A;  2IS1 A;  2JA2 A;  2L7K A;  1NK2 P;  2BHY A;  1FLI A;  1FWZ A;  2EZK A;  4QIW N;  4UVC A;  1ZYR F;  3G6E I;  3CCJ I;  1KYW A;  2FNP A;  5E1Z B;  5LHH A;  3RTR A;  3I4M J;  3S16 J;  4F91 B;  2IGK A;  3ZQQ A;  2CJJ A;  1MJ9 A;  2XIG A;  2HGC A;  4UHT A;  4HNT A;  2QQB A;  1HW2 A;  4N4O B;  3TGN A;  2KRC A;  4F55 A;  3ESW B;  4LD5 A;  4JK1 X;  1FYL A;  5LRR A;  3TMO A;  3V8L A;  1MKM A;  1RUO A;  3K70 C;  4ITV A;  3QQA A;  1EH6 A;  1SD7 A;  1AA7 A;  3E6M A;  3F8C A;  3J80 Z;  3K1P A;  2CS3 A;  4F52 A;  1XTA A;  1MH4 A;  2F48 A;  3KP5 A;  1G2H A;  1RPW A;  2L3D A;  2ME0 A;  4BE0 A;  3PUB A;  1FYK A;  1WGX A;  1STZ A;  3HOS A;  2HS5 A;  4E6K G;  3HTU A;  2VBY A;  3JTG A;  3ZRG A;  3OL4 A;  3RZD J;  4FE4 A;  5CVU A;  3IP4 B;  4J01 A;  2EA2 A;  2V1X A;  2XGE A;  4LOC A;  3M8E A;  1A36 A;  2OCE A;  4BHP A;  3CQZ J;  3HOW J;  3CF2 A;  1KU2 A;  3C2G A;  1UG2 A;  1V4R A;  4XM3 A;  2Y31 A;  4HG2 A;  2DLL A;  1JUP A;  4ZYD A;  4HSR A;  1PYV A;  4EJO A;  2X1E A;  3I55 I;  1NHA A;  1SVO A;  4I09 A;  2E7X A;  3KP4 A;  1U6G A;  3DLA A;  1ONV A;  3KEY A;  2M34 A;  1MZB A;  3ML6 A;  2OTL I;  5IOY A;  5JHU A;  1A6I A;  3S2W A;  5CLS A;  4BUP A;  2XKP A;  4BBS J;  4UVA A;  2JRT A;  1IG7 A;  4LB5 A;  2L9R A;  3HDD A;  3WTX C;  3GCM A;  2LBF B;  2ZME A;  1WPK A;  3DEU A;  2IS6 A;  2DN0 A;  4P9F A;  5TRD A;  1BC8 C;  3GTL J;  2W24 A;  2GM4 A;  3PJR A;  3KZY A;  2CFX A;  4CCK A;  2DOA A;  2HDW A;  1XS9 A;  1K78 B;  2XPU A;  4N0B A;  2E34 A;  3K0L A;  3A1Y A;  2VBX A;  1UJ8 A;  2NS0 A;  4EJU A;  3S17 J;  2Y48 A;  2A6E F;  2LSO A;  3J7A Y;  5HLG A;  3K69 A;  1B9N A;  4B44 A;  1R49 A;  1KGS A;  3ZQI A;  1YIO A;  2V1N A;  4B3A A;  4PJL A;  1UCR A;  2ZME C;  4I0B A;  4E4H A;  3S3M A;  4CA0 A;  3GX4 X;  2OQR A;  4M3E A;  1B8I A;  2ELJ A;  4IPA A;  2VJJ A;  3F8F A;  4DYQ A;  2UXN A;  2RNG A;  1FNN A;  1T56 A;  5J8F A;  2FBK A;  1V5F A;  3OOP A;  3VYT B;  1J09 A;  1GT0 C;  2K40 A;  1AHD P;  1P9Q C;  2XB0 X;  3PSF A;  4PSX A;  1MNE A;  2CW7 A;  2BV6 A;  2XF6 A;  4X1E A;  4MTE A;  2P5K A;  3PFY A;  3ZMT A;  2HKX A;  2J5P A;  3H1C A;  4UVB A;  3ROU A;  1XMK A;  5DUK A;  1EF4 A;  4NQW A;  3KYC B;  5GTH C;  1FIA A;  1X1D A;  1TT5 B;  3GTK J;  1XGM A;  2RN7 A;  2Z33 A;  2COB A;  1SMT A;  3I54 A;  2K4J A;  1XSD A;  3GFI A;  3SFI A;  4OAZ A;  1NK3 P;  2BE5 F;  3LL7 A;  1KU9 A;  2XGX A;  5B1A H;  3S3O A;  4QLC U;  4M9Z A;  3ZQC A;  2ZNZ A;  4ANJ A;  2R92 J;  1TQM A;  1BI2 A;  3KZI C;  5LGT A;  4A3J J;  2KIS A;  5K7H A;  4M71 A;  4V2F A;  1SEU A;  3FKI J;  3LA7 A;  3VEP A;  2LTP A;  5HOD A;  4UUT A;  2ZO4 A;  1F4K A;  1W4M A;  2MW8 A;  3F6V A;  2MC4 A;  4V2G A;  3CO6 C;  2R7W A;  3H3V K;  2KJC A;  2OV7 A;  2PBI A;  3GZ5 A;  1AOY A;  4O5V A;  3DWL E;  2G0E A;  2VOP A;  2W48 A;  1HDP A;  3WE2 A;  5IP7 J;  5EEG A;  2R7U A;  1SAU A;  4XNF A;  3CCU I;  2OJE D;  5B66 C;  1ZH5 A;  3HPH A;  1N77 A;  1V55 H;  2XUB A;  4LK1 F;  5ICC A;  5E3N A;  3QYB A;  1YTY A;  2CG4 A;  5FFX A;  3TW6 A;  3CCR I;  1VQ9 I;  3F3X A;  1T39 A;  3ELK A;  4J19 A;  2LF8 A;  2QM3 A;  4RMN A;  3KEO A;  2X6W A;  1OFC X;  2LC2 A;  2RV8 A;  1S9H A;  3TDU C;  4AYB N;  1G8X A;  1JT0 A;  1CQT A;  1IJW C;  2VOD A;  1YS7 A;  3BP8 A;  2VQH A;  2A05 A;  3FK6 A;  4ZC3 A;  3LSR A;  1KQ8 A;  1P7J A;  3WG7 H;  4XOP A;  2PMH A;  5LGU A;  2E7W A;  2Z99 A;  3BG6 A;  2P8T A;  2QGU A;  4L5I A;  3CCS I;  3LQQ A;  3CCQ I;  2K9N A;  1H89 C;  3K4B A;  1UAA A;  1YE9 A;  2XAG A;  3JCU C;  1EJ9 A;  1FSE A;  2IS4 A;  2JUC A;  5GAE J;  1LEB A;  2QQA A;  3RQI A;  1YJ9 I;  1ZQ3 P;  1Z77 A;  2O9L A;  3F9K A;  1Z0X A;  3V8K A;  1NH3 A;  5BMZ A;  1JKP C;  1IW7 F;  3TDZ C;  2ZJP F;  2M45 A;  3OYJ A;  1K4T A;  4KMU X;  1UST A;  2HZD A;  4ZYG A;  1ZGJ A;  2KIU A;  4P1W A;  4B09 A;  1JGS A;  3WU0 A;  4AIH A;  5ILS A;  2M8E A;  4AID A;  4DW6 A;  3DEE A;  2E71 A;  2V9P A;  5AIQ A;  1EH7 A;  1T8I A;  1X4P A;  3DQV C;  3RJP A;  5F08 A;  2FE3 A;  1MNM C;  2L9S A;  1SFX A;  4M72 A;  1TNS A;  4A3G J;  4BY7 J;  2WA0 A;  2RGV A;  1FOW A;  1Y1V J;  1VND A;  2FMY A;  4NC6 A;  4B1R A;  3N05 A;  2VON A;  4D7N A;  2XGD A;  1X1B A;  4BJT A;  4HF2 A;  1T95 A;  2VE8 A;  4M6X A;  1SD6 A;  4A69 C;  3ZP5 A;  3R0J A;  1U8B A;  1O3T A;  2ZSI B;  1SC7 A;  3K4J A;  4IHT A;  3P5J A;  3SEQ A;  1W5T A;  2ZNY A;  3IAM 2;  4ZH4 F;  1Q1V A;  2WAQ A;  1ETO A;  4L9J A;  4UXN A;  1KYZ A;  1F36 A;  2ECB A;  1OQY A;  1TNT A;  1Z6R A;  1YIT I;  3JW4 A;  4I7H A;  3GUD A;  4RA2 A;  4U0V A;  1R7J A;  1XCV A;  1K4S A;  4ESF A;  2R7V A;  2FU4 A;  3HZJ A;  1FC3 A;  4P55 A;  3ZOB A;  5FJ8 J;  4H0E A;  3EDP A;  4FIS A;  2NS7 A;  2V1D A;  4OOI A;  1GV2 A;  2JTV A;  4NC7 A;  1S7A A;  3KZZ A;  3U1D A;  1IV8 A;  4BJ5 C;  2L0K A;  5K5R A;  3MN2 A;  4PGG A;  4DJA A;  4WXD A;  2DMN A;  2QEX I;  3JR9 A;  4GGG A;  2CU7 A;  3TO7 A;  5CPR B;  2NOJ B;  2V6C A;  4A0Z A;  5A2Q Z;  3TP0 A;  5CKT A;  2YX7 A;  3LQR A;  3GME A;  2OU2 A;  3S2H J;  2V26 A;  3GZN B;  2P81 A;  2IT0 A;  1Y8R B;  3JRC A;  1YI2 I;  3BJ6 A;  3O8H A;  4RAY A;  4BNC A;  3DU5 A;  4LB6 B;  3KEQ A;  4XL9 A;  1W0U A;  3DPL C;  4II3 A;  2R93 J;  3ZMD A;  1LB2 A;  1Q1H A;  2V9V A;  2CH0 A;  1KQ0 A;  3FWE A;  1D0Y A;  2A5Y B;  1TW3 A;  1HST A;  3I9V 2;  4GYI A;  4A3F J;  1LEA A;  2MG4 A;  4XLP F;  2F5F A;  1BI0 A;  2KIQ A;  3A4C A;  3LMM A;  3E6B A;  3OOU A;  1ZLK A;  1EV7 A;  1I1G A;  2JN6 A;  1I3A A;  2H8R A;  2R7S A;  4EAT A;  3C2B A;  4Z2Y A;  1JXS A;  2XAJ A;  2X85 A;  3I4N J;  4A2U A;  1IF1 A;  2Z5U A;  2P5L C;  1D5Y A;  2M5W A;  4C9Y A;  1JKR C;  4ZTF A;  2VL8 A;  2M9H A;  3G2B A;  2JJ7 A;  5DV5 A;  1QPI A;  2O61 A;  4Q48 A;  3LOC A;  1U8R A;  1WCM J;  1WJE A;  1Y0N A;  2DT5 A;  3G3Z A;  3CJT B;  5J47 A;  1ZRE A;  1D0Z A;  4GRI A;  3LSG A;  1X19 A;  1A04 A;  4RS8 A;  3JRB A;  1UHS A;  3H9G A;  5FD6 A;  3A03 A;  3FF5 A;  2CV1 A;  2VI6 A;  4HF1 A;  1T6S A;  1FOK A;  3VOE A;  2DYS H;  2MAB A;  2P0W A;  1MBK A;  4C3J J;  1MMN A;  2R3S A;  5J8C A;  2Y9Z A;  1JUM A;  3H5N A;  5HOO A;  2UXX A;  3O8G A;  3Q3S A;  4D1Q A;  2GA1 A;  3L1P A;  2R7T A;  1B8I B;  1VQ7 I;  4G7Z F;  5GAH J;  3SEZ A;  2E1C A;  2K9M A;  1RR8 C;  2R7F A;  4EMS A;  1XCB A;  4R1H A;  4JX6 A;  3HKZ N;  4ASN A;  3BG5 A;  4Y52 J;  1RUN A;  4B3X A;  1YX3 A;  4Y33 A;  2JWT A;  1HCR A;  2V4J C;  4IXA A;  2BY2 A;  3F21 A;  3OV8 A;  4G8X A;  2I5U A;  4OMY A;  1HW1 A;  5B3S H;  4LLL A;  3L2R A;  1UZC A;  2IBD A;  4IKF A;  1FBS A;  2GZW A;  4NQW B;  3QOP A;  4FX0 A;  3BR1 A;  3K7A J;  3M1C A;  1WJA A;  2WV1 A;  5HLI A;  2L7Z A;  3OYI A;  3TKY A;  3I4P A;  4IZZ A;  1AU7 A;  5F1J A;  5J1Y A;  1HKT A;  3K10 A;  2BVL A;  4BHC A;  3S14 J;  5EEA A;  5DD8 A;  2KL4 A;  3OWT A;  2EQR A;  2PFB A;  2B63 J;  2HFH A;  2EPF A;  1ETY A;  1E3H A;  4A0X A;  4G6D A;  1XDS A;  4CIC A;  1X1A A;  3FMR A;  2V79 A;  2NXN B;  4BEH A;  3EYI A;  2QLZ A;  1XMX A;  4RB1 A;  9ANT A;  2Y2Z A;  1IN8 A;  5J6X A;  1QRY A;  4II2 A;  3KFW X;  3JSO A;  1T38 A;  4E7I A;  2M0C A;  1DPR A;  1MND A;  3KP3 A;  1LVK A;  1JHF A;  4PDK A;  5H2F C;  3CDI A;  4LLN A;  3ZQF A;  4BBR J;  1FEX A;  5EEH A;  2X6X A;  3MCZ A;  2L5Q A;  1P4A A;  3QOD A;  2DK8 A;  2ELK A;  2JUG A;  4IOC F;  2X6O A;  3EPZ A;  3FBI B;  5GAD J;  1T2K A;  5HNH A;  2XDV A;  4BQO A;  2KDO A;  2AQF A;  4MQV A;  2EFO A;  1MSF C;  4L9V A;  1SAN A;  1F43 A;  2DYR H;  2VIX A;  1B59 A;  2X6Y A;  5K5O A;  2CYY A;  1MBG A;  2Y9Y A;  1T33 A;  2VT2 A;  3LAP A;  1W1W E;  2DA5 A;  3K6G A;  4HRI A;  1U5T A;  3WHB A;  3O2P E;  2M7A A;  2FD5 A;  4X0G A;  5ILV A;  1EA3 A;  5BNG A;  1H9G A;  4I6Z A;  3LSJ A;  3GTJ J;  2CUZ A;  4XK4 A;  2FRH A;  2JSP A;  3T1B A;  2M30 A;  1IN5 A;  2DFI A;  2HPI A;  4JQF A;  2G7U A;  4KYW A;  2GWR A;  1J7K A;  2HU9 A;  4UNO A;  3H0D A;  4XID A;  3L2W A;  5DDG A;  3CC7 I;  4B8X A;  3KYL A;  3JAM Z;  2CQK A;  3MKZ A;  4EVI A;  4BJ6 C;  2DA3 A;  2GXG A;  2HNH A;  3R60 A;  3J80 K;  2KIM A;  2VB6 A;  1YJN I;  2D1V A;  2LOO A;  4EQQ A;  5GPC A;  3IC7 A;  3TED A;  3T8T A;  4HF0 A;  4LIT A;  4LG0 A;  5LEK A;  1HC8 A;  3LSH A;  5M5W J;  4EM1 A;  4GO1 A;  3UNG C;  4C2U A;  3BR2 A;  4Q4Z F;  4RDU A;  5L3F A;  3PIO F;  3CZ6 A;  5LHG A;  2PMZ N;  2G9W A;  4N9H A;  1G3Y A;  2JPB A;  1HW5 A;  3QPS A;  5B1B H;  3B6C A;  5D5X B;  2DMQ A;  2WTE A;  3FMQ A;  3PQJ A;  1R22 A;  3C7J A;  1QGP A;  1RKW A;  2K27 A;  3PO3 J;  1W36 D;  1T98 A;  5J4V A;  3C18 A;  5DUI A;  1JJ8 C;  2QBY A;  4AYB A;  4QPO A;  4XRS A;  3F8B A;  3M9A A;  1I27 A;  1SD4 A;  1FIP A;  3ERM A;  2OAZ A;  1C0W A;  3ZN0 A;  4LMY A;  1MD0 A;  2HZT A;  3CLQ A;  3I56 I;  1USS A;  3BTL A;  2BOL A;  3HPG A;  4XRM A;  4FCY A;  1Z91 A;  5DCM A;  2W82 A;  1H9T A;  3M07 A;  2HEO A;  2NVX J;  2XAS A;  4HAM A;  4O6J A;  4MQ9 F;  5F0F A;  3CCL I;  1P4X A;  2L9N A;  5E8I A;  4HDU A;  2Q1Z B;  1TW2 A;  3TOA A;  1GUU A;  4UV9 A;  5L3B A;  3NWS A;  1R00 A;  4A6E A;  2LF7 A;  1VQM I;  2H1L A;  5FD5 A;  1YFH A;  2BY3 A;  1MBF A;  4KDP A;  4JYK A;  3PQK A;  3M8F A;  2IS2 A;  1F1Z A;  5K7Z A;  2V7F A;  3PNY A;  1UB9 A;  1ZK8 A;  4OU0 A;  2DO7 A;  1KU3 A;  4CCO A;  5IY5 H;  1SMY F;  2RQP A;  2DI3 A;  4ETS A;  2N8G A;  5GPA A;  1V3F A;  1MBE A;  3DV8 A;  2YSR A;  2K9Q A;  4C2M J;  3JRD A;  3E6C C;  3QPH A;  1GHC A;  1R1T A;  1YG2 A;  2DU9 A;  3H0G J;  1HLV A;  3BJO A;  3HG9 A;  3CD6 I;  3ONQ A;  2OCC H;  4BU2 A;  1QPM A;  4F3Q A;  2DCE A;  5D5W B;  4PJ0 C;  3K1M A;  5CVI A;  2DT6 A;  3HRM A;  2AQE A;  5KAI C;  1Z67 A;  3OS1 A;  4F93 B;  2QYO A;  2BY1 A;  2LY1 A;  3L9F A;  3FKJ A;  2H27 A;  5LEJ A;  1S3J A;  1YRN A;  4XLA A;  1I39 A;  5HS9 A;  2O6G E;  1RZ4 A;  2WB1 N;  1TWG J;  4WWC A;  2R5Z A;  1ACI A;  4HLY A;  2DFE A;  2NVU B;  1ZRD A;  1O7F A;  3BR6 A;  2QZ8 A;  3OIQ A;  4BDY A;  2OTJ I;  4EGZ A;  3KX2 A;  1MH3 A;  2AO9 A;  3PFI A;  2G7H A;  1R5H A;  1XGN A;  2MBF A;  1M1E B;  3QYF A;  1Y6I A;  2ZC2 A;  4ZYA A;  2EBI A;  2CUF A;  4A12 A;  3DKY A;  1HA8 A;  4A3L J;  1YIJ I;  3G1L A;  1F9N A;  1MW7 A;  1U78 A;  3LSM A;  3VFZ A;  4M73 A;  1ZRC A;  3HOV J;  4HNV A;  5IYD J;  2WC2 A;  4H4K C;  3T0Y A;  3MKW B;  3W6K B;  4YIF A;  2IGO A;  3CDH A;  3BTJ A;  4A5N A;  4OMZ A;  5DEQ A;  3FXL A;  5IYB J;  2NVT J;  4I76 A;  2X4H A;  4HST A;  5ICF A;  3JRA A;  1X3U A;  2FML A;  1MDM A;  4L5J A;  1FP1 D;  5KHD A;  5FLV A;  5LBQ A;  5IP6 A;  1HQC A;  3OYN A;  4P5O A;  1R1U A;  2BW3 A;  2IP2 A;  4CCM A;  4EV0 A;  1Z7L A;  4XKC A;  5D5V B;  2K9L A;  5E3M A;  3G4S I;  1XSX A;  2M4K A;  1LKX A;  5EJC A;  4C3H J;  4CDG A;  4BL0 B;  4YFK F;  3IKV A;  4EJW A;  4X6A J;  4IHS A;  3HTS B;  1QO0 D;  2QUF A;  2H09 A;  3GYH X;  4J00 A;  1XMA A;  2Q0O A;  3FXU A;  3S1M J;  5JR3 A;  4G12 A;  3FXO A;  2GIZ A;  4KMF A;  2HXI A;  2VQG A;  1SFU A;  3M4O J;  1ZG5 A;  3MFK A;  4AUX A;  4G7H F;  2ESN A;  1R4M B;  2M1B A;  2EIK H;  3TL4 X;  3S3N A;  5CJ9 A;  3NAR A;  4PCQ A;  3HSE A;  2DXI A;  3OL3 A;  1Z3Y A;  4XSZ F;  2VPL A;  4UUS A;  3BWG A;  2DTZ A;  2VJ4 A;  5L3G A;  4DZJ A;  2R0Q C;  5BPD A;  1TWF J;  1E3O C;  1X2N A;  2PEX A;  3FM3 A;  4HQE A;  3S1N J;  2ZJR F;  2PMU A;  3LFK A;  2AXT C;  3OSG A;  1YO5 C;  3RKX A;  4BEH B;  2GA2 A;  5F04 A;  4BXF A;  2K5C A;  3KP7 A;  3K1N A;  3TO9 A;  1L3L A;  3LSI A;  4UUV A;  2ZCW A;  1XSV A;  4DQ2 A;  1B9M A;  1NG6 A;  3FX3 A;  5J1R A;  1OCP A;  2L4A A;  4WXH A;  5L3E A;  1WH7 A;  2VC0 A;  1GXQ A;  3HKZ A;  4HOB A;  1HOM A;  1H8A C;  2M87 A;  3I58 A;  2KLO A;  2KZG A;  4NB5 A;  4CSW A;  2JT1 A;  5B5E C;  2CGP A;  3LA2 A;  3CCM I;  1WI9 A;  4KIT B;  2Y0S N;  1I3Q J;  4RAG A;  5CVR A;  4XON A;  3W2W A;  1ON2 A;  4HNU A;  5FKN A;  3LAJ A;  4EGY A;  2HDC A;  1A35 A;  1JUS A;  1J59 A;  3M8J A;  1I50 J;  3HXL A;  4KT6 A;  3J81 Z;  2FF4 A;  3G1M A;  2JPC A;  3Q0W A;  3SZP A;  1U5T B;  3H36 A;  3O3K A;  4CCN A;  1IN7 A;  1W5S A;  4YEJ A;  2ICW G;  1TT0 A;  2YPR A;  5F6F A;  3J7Z I;  1G3T A;  3DLL F;  4E7H A;  2JVH A;  1FMW A;  5HVQ C;  4BY1 J;  2F6C A;  3K4M A;  2J5O A;  1TBX A;  1SAX A;  4RM2 A;  3BOQ A;  1VQL I;  1UHW A;  2L54 A;  2CV0 A;  4E7Z A;  3RSN A;  1O4X A;  2QEN A;  4MNU A;  2NVY J;  4HPQ A;  3KET A;  3VPR A;  3F23 A;  3ERE D;  2JQ7 A;  2GQQ A;  1ERD A;  3DF8 A;  4D9J A;  3GFJ A;  3K4L A;  1IRZ A;  4CUG A;  1IC8 A;  4LG0 B;  3MQ0 A;  5A2Q K;  3H9Q A;  3HSR A;  3OIO A;  5BOX A;  3QP6 A;  1HDD C;  3GBG A;  2HTJ A;  4FT8 A;  2WBM A;  4MFE A;  2H6C A;  5TJJ A;  1Y39 A;  4GFB A;  4ZZD A;  2AXL A;  3WHC A;  3HOT A;  2FJ1 A;  4XKB A;  4LIV A;  4L5E A;  3F0C A;  3MMY B;  1JKO C;  2OQG A;  4BQA A;  2LH9 A;  2CQ7 A;  2LRD A;  3GW2 A;  4XQF A;  4D5C A;  1LDK B;  2EA4 A;  3HB9 A;  4EM0 B;  2QBY B;  3U9G A;  3MZY A;  4KT5 C;  2CRG A;  3PSI A;  3SZG A;  1YX5 A;  4UB6 C;  3BR3 A;  4NUB A;  3CJN A;  4D0P A;  3DEW A;  1AKH A;  1OCR H;  1VQ8 I;  4KUM A;  3BG9 A;  1G4D A;  2MYS A;  2LLK A;  5DCM B;  4IEJ A;  2GLO A;  1D8J A;  5M5Y J;  3G73 A;  1DP3 A;  5CQG A;  3G71 I;  3ZQ7 A;  2QF7 A;  2WY7 Q;  5CVJ A;  1FBQ A;  3GFL A;  4PFP A;  2FBH A;  3E1S A;  4JP0 A;  1Z1D A;  1LFP A;  1CF7 A;  1DP7 P;  2A3S A;  4KIB A;  1Z05 A;  3V8J A;  1IRX A;  5FKM A;  1P7I A;  2BVM A;  4PJN A;  2VJI A;  4YG2 F;  5HLT A;  1IXC A;  1IUY A;  2XAQ A;  1EKE A;  2FXA A;  1XX5 A;  4CO8 A;  4XN0 A;  4S0H B;  2PMZ A;  2K4B A;  1I5Z A;  2VXD A;  4YEL A;  1D0X A;  4GCV A;  3RKW A;  3OSF A;  4MO7 A;  5EZH A;  2O7O A;  3ZMS A;  4ENM A;  3GLX A;  5EZG A;  4E70 A;  4RB2 C;  4W97 A;  4BAC A;  2WAD A;  2QWW A;  2UWM A;  1R1V A;  1TQI A;  4BS9 A;  2R7O A;  2CUE A;  4HLX A;  5C3E J;  2ISZ A;  4AIK A;  4LG3 A;  2UUZ A;  2E5Z A;  1X2M A;  4LK0 F;  4ZDL A;  1VQO I;  1W7P D;  2W25 A;  3VOD A;  1YRN B;  5CVV A;  2YU9 J;  4HEA 2;  2Y0M A;  2ID6 A;  2MA3 A;  2R5Y B;  2R5Z B;  4BH9 A;  4GYG A;  2FQ4 A;  2X0L A;  3HL2 A;  1BIA A;  4KN7 X;  3CMM A;  3RYP A;  4YFN F;  5IP9 J;  3PUF A;  4I02 A;  2RAE A;  2GAU A;  5GTI C;  4HZF A;  5GP9 A;  3B02 A;  2DFH A;  3VDX A;  5EF6 A;  3BY6 A;  2R7R A;  2IAI A;  1J75 A;  2R7X A;  3I64 A;  1EH8 A;  5HS7 A;  2EB7 A;  2LY2 A;  2VKH A;  4GDF A;  3I59 B;  3EUH A;  1ZRF A;  2VKE A;  2L01 A;  1BA5 A;  3DPU A;  4IO9 F;  2NRA C;  1JTY A;  2DT7 B;  2I10 A;  3AG3 H;  1WSU A;  1J9I A;  3E5X A;  1YW7 A;  1N75 A;  4M6V A;  3FK7 A;  1MDM B;  1DPU A;  2F5D A;  2WAE A;  3CF5 F;  2QQ9 A;  3K2A A;  1WQ2 A;  1K7A A;  2EV5 A;  2BW3 B;  2X48 A;  3KLO A;  3K4N A;  2JRM A;  5E1X A;  3W6J B;  1BW6 A;  2YUS A;  2E1M C;  3S15 J;  2WB1 A;  2QQ8 A;  5LRS A;  2HXO A;  1VI0 A;  4RBO A;  2ZXH A;  2RRE A;  1YHQ I;  2JSC A;  1VQN I;  2CSO A;  2DA6 A;  1P6R A;  2F2E A;  2ZFU A;  4XOR A;  1Y56 A;  3CC2 I;  1YYV A;  4IRG A;  2DMT A;  3HC7 A;  4Y7N J;  2V6E A;  3HJE A;  2XRN A;  2LYC A;  2RNJ A;  3TO6 A;  2K7L A;  1RRJ A;  5KCM A;  2YR2 A;  1BR4 A;  4Z6Y A;  1I6X A;  4IHX A;  3BCA A;  1RI7 A;  4UUS B;  2FUG 2;  2ZKZ A;  2W4S A;  1PJR A;  4RM3 A;  1U3E M;  2ECC A;  3DFG A;  2HOA A;  3BG7 A;  1X1C A;  3JTH A;  4XR6 A;  4IL6 C;  1LFU P;  3HM5 A;  2XB5 A;  4R79 A;  4WF2 A;  3I0T A;  4L9N A;  1MJA A;  4N4N B;  3JAM K;  2HYF A;  2VQL A;  5ILU A;  2XSD C;  1RNL A;  4EJV A; 
#chains in the Genus database with same CATH homology
 3IP4 B;  4LIT A;  4J01 A;  3LSH A;  1UEL B;  2M4G A;  3UNG C;  4C2U A;  4AU7 A;  3CF2 A;  3CZ6 A;  3C2G A;  4XM3 A;  4E7J A;  1BR1 A;  4ZJZ A;  4HG2 A;  2V9K A;  3H5R A;  4HSR A;  2PJR A;  2CW8 A;  3DTI A;  1PYV A;  3UR3 C;  2KPM A;  3OYH A;  2X1E A;  3D5L A;  1WJC A;  3DLA A;  3KEY A;  1D1B A;  4PJM A;  3H5A A;  1W36 D;  4AYB A;  4QPO A;  4BUP A;  3LSK A;  3OR1 C;  5FRN A;  2LBF B;  2Q2E B;  4DBR A;  2IS6 A;  3HPG A;  2BOL A;  2W82 A;  2X51 A;  3PJR A;  2X1C A;  4CCK A;  2DOA A;  2HDW A;  2L9N A;  4IQJ A;  2Q1Z B;  3A1Y A;  4XLC A;  5FRO A;  3NWS A;  2CMP A;  3J7A Y;  4BQQ A;  4B44 A;  1QU3 A;  1Z21 A;  2IS2 A;  2V1N A;  2V7F A;  3PNY A;  4PJL A;  4ZDP A;  4E4H A;  3S3M A;  4CA0 A;  4CCO A;  3DKX A;  1WJF A;  1R6R A;  2ELJ A;  2VJJ A;  4XN3 A;  2RQQ A;  2RNG A;  3HG9 A;  1V5F A;  3ONQ A;  3VYT B;  1J09 A;  4BU2 A;  2Y0S A;  1P9Q C;  4F3Q A;  2DCE A;  3PSF A;  4PSX A;  1MNE A;  3IAS 2;  2CW7 A;  2DT6 A;  1OLT A;  2AQE A;  2XF6 A;  1WJD A;  3OS1 A;  2Z16 A;  4F93 B;  2LY1 A;  3PFY A;  3FKJ A;  2I8D A;  2QKM B;  3AFH A;  2K3P A;  1X1D A;  4XLA A;  3VYS B;  2A6T A;  2XF5 A;  3K4K A;  3CP8 A;  4OAZ A;  3VYU B;  5JHF A;  4U7B A;  3RCO A;  3BCB A;  4XKV A;  3LL7 A;  2HPM A;  3OIQ A;  4BDY A;  3S3O A;  1BR2 A;  4ANJ A;  3EUH C;  3KX2 A;  3DU6 A;  3L2U A;  3D5R C;  3QYF A;  1Y6I A;  4ZYA A;  4XMY A;  3DKY A;  1HA8 A;  1D1C A;  2WAF A;  4BQN A;  1MW7 A;  2MC4 A;  1TZL A;  1NG7 A;  2Z1D A;  3FBN B;  3LSM A;  4YRV A;  2R7W A;  1WJB A;  2OV7 A;  4H4K C;  3MKW B;  3VYR B;  2IGO A;  2QKL B;  3DWL E;  1WJ5 A;  2KHM A;  3IUO A;  4E7S A;  4CZC A;  4OWR B;  4ZTJ A;  2R7U A;  1MMA A;  1SAU A;  4HST A;  2PJR B;  2GOM A;  1V5E A;  1D1A A;  4XNF A;  5KHD A;  3HPH A;  3FDY A;  2VAS A;  3OYN A;  4P5O A;  1N77 A;  2KP6 A;  3OS0 A;  2BW3 A;  2JVG A;  3QYB A;  3U21 A;  4CCM A;  1UG0 A;  1Z7L A;  4XKC A;  2K9L A;  3QOE A;  2M4K A;  1LKX A;  4BL0 B;  2XC7 A;  1QHH D;  1DGR M;  3CJQ B;  4J00 A;  1KON A;  2MFZ A;  4RMN A;  2KZV A;  1DGW Y;  2VQG A;  2X6W A;  2IXS A;  2LC2 A;  2R4G A;  1S9H A;  1G8X A;  5FRM A;  4PSW A;  1N78 A;  2W00 A;  3TL4 X;  4BE2 A;  2VQH A;  3V42 A;  4ZC3 A;  3S3N A;  4XOP A;  2DXI A;  3OL3 A;  3BG6 A;  2ZXI A;  1Z3Y A;  2VPL A;  4FAS D;  3OYE A;  2F5V A;  2VJ4 A;  4AVZ A;  3K4B A;  1UAA A;  1YE9 A;  2IS4 A;  2VLA A;  2XF7 A;  4F92 B;  3F9K A;  1VZ0 A;  4CCJ A;  3OYA A;  1ZEL A;  4MLO A;  3EUK L;  2OC6 A;  3OYJ A;  4BEH B;  3OYC A;  4BXF A;  3H9J A;  2HZD A;  2K5C A;  3L2Q A;  4P1W A;  3LSI A;  4IX7 A;  3DEE A;  2E1M B;  1NG6 A;  2VXZ A;  1T0F C;  1X4P A;  3DQV C;  1MMG A;  3W2A A;  2L9S A;  3HKZ A;  3CES A;  2KLO A;  2KQR A;  2CFO A;  2WA0 A;  4CSW A;  5HNF A;  4B47 A;  4KIT B;  4KIS A;  3N05 A;  3W2W A;  4XON A;  4HNU A;  2Z2S B;  4B48 A;  1X1B A;  4BJT A;  1W36 C;  1T95 A;  3M8J A;  3HXL A;  4KT6 A;  4Y3O A;  2LBF A;  2ZSI B;  4CCN A;  3K4J A;  4YEJ A;  4LIU A;  1TT0 A;  3SEQ A;  3IAM 2;  2WAQ A;  3AL0 C;  5TGT A;  3OYF A;  3RQ4 A;  3OYL A;  3ZR8 X;  4E7H A;  2JVH A;  2OUM A;  1FMW A;  2LG4 A;  5HVQ C;  3MKY B;  2F6C A;  3K70 D;  3K4M A;  2R7V A;  3E0J B;  3SDB A;  4JOM A;  4RM2 A;  2IGN A;  2E5N A;  4NC7 A;  2CV0 A;  4E7Z A;  3RSN A;  4BJ5 C;  3RPU D;  4DJA A;  4RLF A;  4HPQ A;  4DIQ A;  5CPR B;  2NOJ B;  4C30 A;  3DPT A;  5CKT A;  2IGM A;  1ERD A;  4IQ4 A;  2KRH A;  3K4L A;  4D9J A;  4RLQ A;  3OMY A;  2V26 A;  2DJI A;  3TBI A;  4CUG A;  1SFK A;  2M0M A;  3H9Q A;  3HUG B;  3OYM A;  1U0J A;  3DU5 A;  2WY8 Q;  1OR7 C;  3GBG A;  3ZGK A;  4XL9 A;  3A2K A;  2WBM A;  3DPL C;  4II3 A;  3OR2 C;  4U87 A;  2CH0 A;  3HOT A;  4XKB A;  3CJR B;  1D0Y A;  3OYB A;  3NWT A;  1BOB A;  2W1O A;  4LIV A;  3I9V 2;  1K6Y A;  2HVS A;  4KJZ A;  3MMY B;  2LH9 A;  2LRD A;  3LMM A;  3A4C A;  3OOU A;  4XQF A;  4BGD A;  2R7S A;  1WFX A;  1LDK B;  4EAT A;  2X85 A;  1G59 A;  1MMD A;  2X1D A;  3PSI A;  2HVQ A;  3SZG A;  3EUA A;  4QPQ A;  1YX5 A;  4C9Y A;  4G6T B;  4NUB A;  4ZTF A;  2VL8 A;  1E0E A;  4OAY A;  2MYS A;  2VKD A;  3G2B A;  2CV2 A;  1DP3 A;  1X4O A;  3K4C A;  5CQG A;  3QYE A;  1WJE A;  3S93 A;  2M3A A;  2WY7 Q;  1D0Z A;  4GRI A;  3PNT A;  4PFP A;  4XLH A;  3E1S A;  1X19 A;  3LSG A;  2O5R A;  2R7Q A;  3H9G A;  1LFP A;  3MD2 A;  1IRX A;  3VWB A;  3ZCO A;  2CV1 A;  2BVM A;  4PJN A;  2MAB A;  2P0W A;  2VJI A;  5HLT A;  1MMN A;  4E7K A;  3L2V A;  3AL0 B;  5HOO A;  3H5N A;  4XN0 A;  2L2O A;  4D1Q A;  2PMZ A;  2R7T A;  2XSJ C;  2VXD A;  2F4I A;  1V5G A;  1Z3X A;  3SEZ A;  2K9M A;  4YEL A;  1D0X A;  1FMV A;  4PUS A;  4B3X A;  4BAC A;  3PNV A;  2VJ5 A;  2UV1 A;  1YX3 A;  2WAD A;  2UWM A;  4BS9 A;  4Y33 A;  1QHG A;  2R7O A;  3OS2 A;  2V4J C;  4Y4R A;  3AKZ A;  2M7B A;  3H35 A;  4LG3 A;  4E7L A;  2UUZ A;  3L2R A;  2E5Z A;  4PK4 A;  3VSL A;  4IKF A;  4ZDL A;  3CP2 A;  2HQA A;  4NQW B;  3W2V A;  5KNL A;  3M1C A;  4HEA 2;  5CQE A;  1WJA A;  2HVR A;  3I3L A;  3OYI A;  4PFO A;  4IZZ A;  3HL2 A;  2CUJ A;  3CMM A;  3K10 A;  3S32 A;  2BVL A;  2KL4 A;  3OWT A;  3OIP A;  3OYK A;  4BDZ A;  2A5W A;  2LRE A;  1GLN A;  3W3C A;  3OY9 A;  3OYG A;  4DBQ A;  1X1A A;  3C2H A;  3VDX A;  4DOZ A;  4BE1 A;  2R7R A;  4BEH A;  2R7X A;  2W7N A;  4II2 A;  2LY2 A;  4E7I A;  4XLF A;  3OYD A;  2VKH A;  1MND A;  4DGW B;  1LVK A;  3BC8 A;  3LFU A;  3BLY A;  4XLE A;  3DPU A;  2DT7 B;  2X6X A;  2L5Q A;  3QOD A;  5LFA A;  4XOT A;  1N75 A;  2JUG A;  2GOX B;  4C2T A;  3FBI B;  3EPZ A;  2WAE A;  4XKW A;  5HNH A;  2VQC A;  2KMU A;  2XDV A;  4BQO A;  2IS1 A;  2KDO A;  2AQF A;  2JA2 A;  2L7K A;  2BW3 B;  4NC8 A;  2VIX A;  2X6Y A;  3K4N A;  1JI8 A;  3DTE A;  4PJJ A;  3RTR A;  3D5S C;  3K6G A;  4HRI A;  2E1M C;  2M7A A;  2WB1 A;  4F91 B;  4X0G A;  2IGK A;  3ZQQ A;  5LD2 C;  1EA3 A;  2ZSH B;  2ZXH A;  2RRE A;  3VSK A;  3PL8 A;  2ZFU A;  4XOR A;  1Y56 A;  4HNT A;  4NNJ A;  2CUZ A;  4N4O B;  2KRC A;  2JSP A;  2XAU A;  4CH7 A;  3HC7 A;  4F55 A;  3FHN A;  2V6E A;  3SYT A;  2LYC A;  3TMO A;  5KCM A;  2HPI A;  2MD0 A;  4JQF A;  1BR4 A;  3S8P A;  3K70 C;  4ITV A;  3BCA A;  2HU9 A;  2FUG 2;  1AA7 A;  2W4S A;  1PJR A;  3H0D A;  4RM3 A;  3L2W A;  3ZXS A;  3KYL A;  2CS3 A;  4F52 A;  3DTK A;  4ZDO A;  3BG7 A;  1X1C A;  4XR6 A;  4CCL A;  3MKZ A;  2E60 A;  4BJ6 C;  4R79 A;  2HNH A;  4BE0 A;  1DQU A;  2VB6 A;  3PUB A;  4N4N B;  2LOO A;  3HOS A;  2VQL A;  4B43 A;  4FET A;  4E6K G;  3ZRG A;  3OL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...