2E1MB

Crystal structure of l-glutamate oxidase from streptomyces sp. x-119-6
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
90
Chain Sequence
AATQTWTGDLAIVTIPFSSLRFVKVTPPFSYKKRRAVIETHYDQATKVLLEFSRRWWEFTEADWKRELDAIAPGLYDYYQQWGEDDAEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of l-glutamate oxidase from Streptomyces sp. X-119-6
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords L-glutamate oxidase
total genus 14
structure length 90
sequence length 90
ec nomenclature ec 1.4.3.11: L-glutamate oxidase.
pdb deposition date 2006-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2e1mB02
2E1MB
chains in the Genus database with same CATH superfamily
1P4XA 1H9GA 1FNNA 5E79C 3GLLA 2HDWA 2IPQX 1Z6TA 3F3XA 3HRUA 4RGXA 3E3VA 2CUFA 4LOCA 1GXQA 4A69C 3SFIA 1OYIA 3TO7A 2GXBA 4EJWA 4KICA 1FIAA 1S3JA 1WQ2A 2CMPA 3CP8A 4MNUA 5FJ8J 3DP7A 3PQJA 1XGSA 2OAZA 1PDNC 1WHUA 3KP6A 1VQMI 1OCRH 1FTTA 1L3LA 1NHAA 2E7WA 4BKXA 3F23A 2CV2A 5FLXK 1YE9A 1FZPB 1G2HA 1MD0A 5FLMJ 1PJRA 1G59A 1X3WB 4JOMA 1AU7A 4Q5SF 3IL2A 3D5RC 3WGIA 5KK1A 1SFOJ 1GLNA 3H3ZA 1ULYA 2QSFX 5HOOA 4UUSA 3MZ8A 1AWCA 2K9LA 4XRSG 4HNUA 3L2UA 3Q0WA 1QNTA 4B47A 3W6JB 2FSWA 2D2WA 3I5UA 3CMMA 3H3UA 4EJTA 1AOYA 2XAFA 3Q9VA 1BR1A 4PUSA 1QVTA 4CDGA 4J00A 3HXLA 1OQYA 3WTWC 2EV0A 1ZAOA 1R6RA 2F5CA 1W0TA 2CGPA 3RYPA 4A12A 1OKRA 3AG2H 2E2JJ 3HZJA 5DM7F 4GRIA 2E1OA 4E7SA 3OS2A 3PQKA 1J2XA 1EH6A 1LB2A 5DTDA 3IAM2 5F04A 1OMIA 4UB8C 3KP7A 2DMUA 2QKMB 4N4OB 3HHHA 4MFEA 2AS5F 2IVMA 1X1PA 3MQ0A 2CS3A 3T0YA 1OCTC 3R60A 2Y30A 3BPXA 2ZSIB 5KAFC 4DYQA 4WF2A 4PFOA 5BS6A 2M87A 5LHGA 4YRVA 3H5NA 4NNJA 1RUOA 2MW8A 3FMRA 2CW7A 3K2AA 2DOAA 4HYEA 4CCKA 4PJNA 3TOAA 1B9NA 3E97A 4RA2A 3I0TA 2OTJI 5FGMA 3C2GA 4ESFA 3O6BB 3V4GA 3UKGA 1JE8A 1G3WA 1LVAA 2FA5A 3V8JA 2DCEA 4HOBA 5HDKA 4L9VA 2R4GA 2IA0A 2DOEA 4EEFG 3FK6A 3MWMA 2R7ZJ 1VQ6I 3HRTA 1TQMA 4IPAA 3SFZA 5L3EA 4U7BA 1NTCA 3I58A 3WG7H 1GHCA 2E1MC 4XRFA 4XNFA 4AC0A 1N77A 4XKVA 1HSJA 4FE7A 5KHDA 3KFWX 2EFWA 1J5YA 4CYDA 1S29A 2NS0A 3H9QA 3NRVA 2L9SA 1XSDA 4A6DA 4DZPA 3DBRB 3M8EA 2COMA 5CLSA 1WH7A 1IO2A 3SEQA 2DK5A 2O8XA 4S05A 1W36D 5HS9A 3UR3C 2W48A 1X4PA 1Y1VJ 2GIZA 4F55A 3CC7I 3S17J 1KU9A 3M7GA 4KT5C 2W1OA 1XSXA 3L2QA 5J3LA 2M45A 4II3A 2FBIA 2IS4A 3ZQFA 2OD5A 2IEKA 1QRYA 2K9MA 2QBYA 3ML6A 2P6TA 1MH4A 3NARA 1A6QA 5F1RA 2DFHA 4IEJA 1VF9A 2X6OA 3DCFA 1LUJB 3ZXSA 1EJ9A 4AM3A 2P7VB 2CQKA 3IKTA 2KRFA 2HEOA 2XIGA 2HPIA 4GGGA 1V4RA 4ESBA 2BOLA 2HOTA 3WU2C 2XV4S 2WAQA 5GPCA 3JRBA 1K78A 5E18F 2XAGA 3RJPA 1D0YA 4LIUA 1K78B 3FXRA 2R7FA 5JLWA 3NQOA 1FYMA 3I4NJ 1IW7F 4HX4A 5EEHA 1KONA 4OOIA 2KQRA 3BTJA 3OYJA 3ZPLA 1W36C 3J81K 1ETOA 1UJ8A 1I3QJ 2V1NA 4G9YA 3N05A 2ZB9A 4W1UA 2JZYA 2Y2ZA 1BIAA 4NQWB 4ESJA 1D8KA 3DV8A 2CRGA 2DO7A 3FK7A 4XBFA 4M6XA 5HLHA 4IHYA 4EATA 1P92A 2JTVA 4F91B 2L4MA 1E3OC 2BY2A 1XSVA 1A04A 1U8BA 5CVIA 1DP3A 3FZVA 3PUFA 1IRXA 5F27A 1AKHB 3I64A 3CF2A 4BQQA 1F43A 3S8PA 5J4YA 3F6VA 1WJFA 3ZP5A 4ZTFA 1OPCA 2RGVA 4ENKA 4FTHA 4OMYA 1R1VA 3HKZN 3J7ZI 3K4KA 4MIMA 2RDPA 3K4NA 1FPQA 2HQAA 2F4OB 2KISA 5BQTA 1HOMA 2HGCA 4M3FA 3U1KA 2Z5UA 1E0EA 1P2FA 4H4KC 3DEEA 2KMUA 2MH2A 4Q48A 1X2NA 2H1LA 3LSGA 1JTXA 3GBGA 1YS7A 3LMMA 5IY5H 1DPRA 1SVMA 4MHGA 4LIVA 2LKXA 2VASA 1VQKI 3ECOA 3GTMJ 3WODF 3FXKA 2M2EA 1JJ8C 2V4JC 5F64A 3VSKA 4ZC3A 3HC7A 2ZFUA 3RI4A 2I8DA 2JRMA 2LRDA 3FMSA 2FEZA 3C3WA 3GVAA 2X9DA 2GA2A 3TEDA 3ZQCA 3BZ6A 4M71A 2VKHA 1H88C 3Q9SA 3FXOA 3LSRA 1IAWA 3CF5F 3QYFA 2QQ8A 1I39A 1A36A 3PO3J 2EJRA 3IV5A 3S3OA 3ZMTA 3OS0A 3Q0VA 4U0YA 4UUVA 4HSRA 4CXFA 4XIDA 2VPLA 4XSXF 2XHKA 4KA4A 3MVPA 4RAYA 2BY3A 3MKZA 1NG7A 1OYYA 2R3SA 1T95A 1MBJA 1R71A 4HX8A 1ETWA 2O9LA 5BPIA 1IGNA 2P5LC 2Q2EA 5DEQA 2FD5A 1T08B 4YIIA 1SEUA 2KJCA 5DUKA 4WK8F 1WZ2A 1MKMA 1WSUA 4BGDA 1LFUP 2JVGA 2O6GE 2H09A 2W84A 4PJ0C 4UVBA 3G1MA 3QYBA 1V5EA 3S2DJ 4CCOA 3GTKJ 2WY7Q 1YI2I 1DDNA 4M3EA 4A5NA 2XC7A 2XGEA 1BA5A 4I99C 4CCMA 1HC8A 1Y1WJ 2Y48A 3FX3A 3KIOA 3JRFA 3QP6A 3F21A 1UMQA 3WTTC 3HOYJ 2P6SA 3BC8A 5D5WB 1YS6A 3V7CA 1LPQA 1V3FA 2L7FP 1FMWA 3E6BA 3CTAA 4NC8A 1BOBA 3CDLA 4BAYA 5M3FJ 5GAEJ 1LDJA 4DZJA 2BW3B 2VI6A 3C2HA 1ETYA 1E17A 3DLAA 4D0PA 1K4SA 2VJJA 4LB5A 2IP2A 2ZMEC 4MEYF 1MMSA 3HIFA 1FWZA 2HVSA 3FKJA 1MGTA 3K1PA 4BDYA 3BQZA 5D6FA 4XLFA 3WHCA 5D5UB 4IRIA 5F0HA 2PMZN 3BG5A 1PP8F 4OWRB 2VPRA 1OCZH 4HNTA 2FUG2 3F6OA 2WA0A 5JHUA 5DCFA 2XDVA 3I59B 1AA7A 2W25A 5KAIC 2P7CB 3MAJA 2QF7A 1XC5A 3OIQA 4IO9F 1CGPA 2CUEA 5LGTA 1DGRM 3I71A 2ELKA 4RAFA 2QBYB 2OU2A 4DIQA 3ZGKA 3A01B 1J75A 1S7EA 1EV7A 3K70C 2NYXA 4I7HA 1HKSA 2FU4A 1R5GA 2IT0A 1FX7A 2LH9A 2VN2A 3MD2A 2DLLA 1FP1D 1IUFA 1SVOA 5KCMA 3LSJA 3CCMI 2BEOA 2FRHA 5CVVA 3BTLA 2ECCA 3MZHA 2WWYA 1D5VA 1D1AA 2MH9A 2E2HJ 1NK3P 3HTUA 4RLQA 2ISYA 1V5FA 4L0YB 4HG2A 1XB4A 3QOPA 1R7JA 2VJ4A 3L2WA 4PZJA 2DTZA 4DYCA 3ABLH 5IT3A 1EA3A 5K7HA 3I59A 1R9TJ 1A35A 5JVGF 2A6EF 2K9NA 1W4MA 3DTEA 4R79A 3OR2C 4KMUX 3S2HJ 3RSNA 5M5WJ 3QU3A 2HS5A 3HPGA 4MO7A 3DTKA 5FO5A 5J1UA 1ZG5A 4CYCA 3HGGA 3KX2A 2HKXA 3GTPJ 2E34A 3PM1A 4BBRJ 3L09A 4MEXF 4LB6B 4L0ZB 5F08A 3VODA 1XS9A 3LSTA 2M4GA 1YJNI 3BJAA 2PFBA 3OIPA 4UVAA 4JQFA 1BW5A 2XAQA 2BW3A 1HBXG 4OU0A 2L9VA 2LK2A 2XGDA 3OY9A 2WY8Q 4L9TA 5HVQC 2L5QA 2KIMA 4HBLA 2PEXA 3GTOJ 3LAJA 2BVMA 4UV9A 2QKLB 5HDGA 3BLYA 1M1EB 2MC3A 3FXJA 5JI6A 1VQ4I 1TC3C 1Z21A 3E6DA 1S7AA 2RQPA 5J4VA 4NC6A 3HM5A 3SEZA 1TNTA 2FMYA 2X51A 5L3BA 4NDLA 4ENJA 1BM9A 2EFQA 2EFPA 3TW6A 1B72A 1ZQ3P 4BU2A 1YITI 4M6YA 2GOMA 1PP7U 2R7SA 1IN6A 4XORA 2QCOA 4QWQA 4RDUA 2G0EA 2VBWA 3TDUC 1BJZA 1VQ7I 4D1QA 3AL0C 1S8NA 2CJJA 2HQRA 2ZJRF 1YFHA 3GZ5A 2KP6A 2M5WA 4QPQA 2OA4A 2K9QA 2YR2A 2LDUA 4A3MJ 4D7MA 2B7EA 2L01A 2MD0A 3AFHA 2R7UA 4HSTA 2QQBA 1VQNI 4RS8A 3GCMA 2DI3A 3GUDA 2K85A 2DPDA 2CW0F 2ZO4A 3MN2A 3HG9A 4R8HA 3HBLA 2ZJQF 2OBPA 2E7XA 2O03A 3LNQA 3J80Z 4RLFA 3CCEI 2LNBA 1FT9A 2M0MA 2RC4A 4K2EA 3BP8A 3WE3A 2NNNA 3PFIA 5GAHJ 4KJZA 2EZHA 1LEBA 5GTHC 3ZQGA 1OCPA 4LMYA 3ROUA 1GT0C 5H6QA 3K69A 1J09A 3HTSB 4DNCA 4UUTA 2CQ7A 2EFOA 3EPZA 4HA8A 1LEAA 1U5TA 1V54H 4QIWN 2HKOA 1QO0D 2DXIA 4I02A 3WU1B 5HS7A 4HRIA 3ABTA 3QP5A 2HI3A 2CUJA 4KIBA 3BR2A 3TQNA 1R49A 4YEJA 3I55I 1FOKA 2L02A 5LEKA 5FKMA 1PYVA 1T6SA 1IV8A 4HAMA 3OYCA 3W2AA 4PSXA 2HFHA 3DBHB 4IHVA 1JHFA 1H89C 1YLFA 4RB0A 3I3LA 1HF0A 2Y31A 3KZZA 3LAPA 4LJZF 3H0GJ 1BJAA 3R6SA 1FOXA 3CC4I 4LG0B 2XROA 1HA8A 4L18B 3BR1A 2XAJA 1MNDA 1TL8A 2ZJPF 1TW2A 3QODA 1JUMA 2MA3A 1RPWA 2VC1A 1ON1A 3PNYA 4C3JJ 2KL4A 3ZRGA 1XMAA 2A6HF 2V9VA 3RPUA 2W00A 2OTLI 1E2XA 2PMZA 2Z99A 1LNWA 3MZYA 5E3MA 2PLYA 4EJOA 4U0WA 4C2UA 4NQWA 3S1RJ 3BG9A 3CDIA 1Y0UA 5CVRA 5B1AH 4HV5A 3W2WA 2I10A 1IN7A 1Y6IA 3HL2A 2ZXWH 4LK0F 1R58A 5ILUA 3FM5A 3K6GA 2QYOA 5HNHA 1BOAA 2KJBA 3CJRB 2IS1A 1D5YA 1BL0A 1CQTA 2EBIA 2R7DA 5GPAA 3TL4X 1O3TA 3K1MA 2HQ5A 3KEOA 4Q47A 4YG2F 2JA7J 2PJRB 1FY7A 3FHZA 3A0BC 3EETA 4E4HA 2R7OA 3KP5A 4BACA 2LKSA 2F4IA 2M8GX 3EQLF 5CJ9A 4IX7A 5DD8A 5E3OA 1ZKGA 3T8TA 1UB9A 1J59A 3JAMK 2FNAA 1MH3A 2QQ9A 2LBFB 1Z7LA 1VQOI 5HLTA 1PUEE 1ZK8A 4HNVA 3E5XA 2V6CA 3L1PA 3BROA 4IZZA 3H5AA 1NH3A 3BTCA 2VE8A 3ZCOA 4ZYHA 1RZ4A 3HRMA 1YW7A 4AVZA 3ASOH 2BV6A 5JFRA 2HZDA 1ZG3A 2V79A 1TWFJ 3KYLA 1U78A 2ZNYA 3WTZA 2VOPA 4Y13A 4P5OA 4KN4X 4RAZA 5LFAA 5D4SA 1I5ZA 2ZFWA 2JSCA 4JX4A 1W7PB 3IKVA 2DAOA 4BJ5C 2HYJA 4ENMA 1A5JA 2WADA 4RAGA 2NNYA 1C0WA 1X58A 2FBKA 4FX0A 3P7NA 1NG6A 5J8FA 1R22A 4KFCA 3CCUI 3IH3A 4ON0A 1UFMA 2F5FA 1XD7A 2LP0A 3VDXA 1X1BA 4Y4RA 3CCQI 4XR6A 1HKTA 2X1DA 1TNSA 1XX5A 2RN7A 4G6QA 5E20A 4GXOA 3B6AA 3LQQA 1TT0A 1OR7A 4XOTA 1U0JA 3CUQC 4PJJA 3LQRA 2CV1A 2EV5A 3DTIA 5CVUA 2BHYA 4O6JA 4XQFA 1APLC 3PL8A 1BR4A 2K3FA 1UHMA 3RPQA 3ZMSA 3CCSI 4RMNA 3PNTA 1WFXA 2X1CA 1VQLI 1X19A 5B5EC 1VQPI 2AHQA 4Z6YA 4XLAA 1YG2A 4E7JA 3KEQA 3G1OA 2R7RA 1XGOA 1QVUA 1B59A 4UVCA 4XONA 5LHHA 2VC0A 1JHHA 1OCOH 1K61A 1FSEA 3S14J 3K7AJ 1H8AC 1GDTA 2EA4A 4XKCA 3VB2A 2F6CA 1LQ1A 1XGMA 1RKTA 4I01A 2ZXHA 2WAEA 1MW7A 1R1UA 2K40A 2RQQA 4CH7A 1Y8RB 2BXZA 2ELHA 2LR8A 4J19A 1GVJA 2YU3A 3D5SC 3HPHA 3O2PE 2XVCA 2DA6A 4ZDPA 3HOTA 3L9FA 2JPCA 1GV2A 2UZKA 1TT5B 3P9IA 1VI0A 3JRIA 2LTPA 5CQEA 4FT8A 2F2EA 4YIFA 2BZTA 3RPUD 2FBHA 1OFCX 4GCVA 1G3SA 2L9NA 2A3SA 2VKVA 3CLQA 4C9YA 3R4KA 4YFXF 1SFEA 4QTRA 3LSIA 2A5YB 2BE5F 1IDYA 3ZQLA 2NOJB 4M9XA 3HUGA 2Q0OA 2BY1A 3RZDJ 2GLOA 3CCYA 1IRFA 2DA1A 2VT3A 3JCUC 3VYRB 3CD6I 1KU7A 1PVEA 1I1SA 2B0LA 2R0QC 1FTZA 2LMDA 1P7JA 1RC9A 2DDBA 4NB5A 1QZYA 4OIPF 3X2QH 5C3EJ 4YFKF 5DV5A 4O5VA 2XF7A 6PAXA 4BBSJ 4FX4A 5JLXA 2V1XA 4RB3C 4WCGA 3OYAA 3JSOA 1MSEC 4A3DJ 1MNMC 2XAHA 4E7LA 3CZ6A 3BCBA 1YIJI 3WG9A 3TKYA 3KE2A 2A07F 1VQ9I 2UUZA 4EMSA 5IYCJ 2R7WA 1IXCA 1G3YA 3WTYC 3DKWA 5D8LB 1HCRA 2DPUA 2M30A 2GM4A 2ZMEA 2W4SA 4A93J 4A3EJ 4QSHA 4X1EA 3VEPA 4CCNA 1HXDA 1USSA 3K4LA 3ULQB 3ZQQA 2QLZA 4ZH4F 4XRMA 5H2FC 5FFZA 3MFKA 4N0BA 1XG1A 3O3KA 5L3FA 4S0HB 1U2WA 4EGZA 1WJCA 3KP2A 1RI7A 1X1DA 3G1LA 4QLCU 2Z9OA 2HVRA 4IRGA 5CKTA 4YFNF 1YRNB 3C18A 5IP6A 1G8XA 3BPVA 1XPXA 2PMHA 3FHNA 3HSEA 4G94A 4LD5A 4BJTA 2H6CA 1FC3A 3CUQA 4P55A 5CYVA 4BH9A 2LD5A 1FBSA 1S5LC 3SYTA 4F93B 1R4NB 3KP4A 2F48A 4GO1A 2GIVA 3FF5A 4IF4A 2AXTC 2RV8A 1JT6A 4I09A 2EZIA 1OLTA 2R5YA 1J9IA 1SFKA 5EGOA 1Z1DA 9ANTA 4IL6C 1T0FC 3C1DA 5L3DA 2KKOA 2L7MP 2E71A 4A2UA 1ZYRF 5TRDA 1BI0A 2DMTA 1BW6A 1R5ID 5E17F 4BNCA 1WWXA 4FCYA 2C6YA 3B02A 4PK4A 1YO5C 4UNOA 4M9SA 1ZLJA 2WV1A 2Q8KA 2KDZA 1KYZA 2FF4A 2EWNA 3WTUC 2QEXI 2BYVE 3I4PA 4UB6C 3MCZA 2FXAA 1HW1A 4IKFA 4BE2A 3F8MA 1JUPA 2D1VA 2PBIA 3HRSA 4TV7A 4P96A 3WTVC 2OJED 4UHTA 1K83J 2R7TA 1DU6A 3GO5A 2GOXB 4ZDOA 3K1NA 5HODA 5ICCA 4EGYA 1ZGJA 3N4MA 3HDDA 3RZOJ 4BXXJ 1DU0A 3QPHA 3CLOA 4OMZA 3E5QA 3FBNB 1SC7A 3JRDA 2ZXIA 1NK2P 2VBYA 4X0GA 2E60A 4CCLA 3KEYA 2X0LA 1T56A 4XLCA 4AUXA 3F72A 3BR0A 1UELB 2E5ZA 5EF6A 3GX4X 4B48A 4U88A 2V9PA 2CQNA 2NXNB 4GDFA 1Z6RA 1X4OA 1BR2A 2IW5A 2AXLA 2EINH 3G3ZA 2QSHX 4PGHA 5D5VB 4OIOF 1FBUA 1ETKA 2F5DA 2UV1A 5ICFA 3GZNB 1K79A 3CQZJ 3IHUA 1FLIA 1WRJA 2EA2A 4G6TB 1YRNA 4M72A 1FOYA 3O8GA 5EG0B 1LE8A 5E1XA 1TW3A 5CVJA 1S9HA 1Z0XA 1RUNA 3M3YJ 1R23A 3S3MA 3DU5A 2JN6A 4N9IA 2ZNZA 4Y15A 4BQOA 1JGSA 2OCCH 4AYBA 2XPWA 5FLVA 4S04A 3H35A 2CYYA 2MYSA 2N8GA 2ZMEB 4BHPA 3IAS2 2LKPA 3FXQA 2FMLA 3U1DA 2STWA 3CMAI 2VUMJ 1Y56A 2M4KA 4A3LJ 2LY1A 4A5MA 1K4TA 2DMQA 4LLNA 1SD4A 2ZXJA 4IRHA 1MBHA 4A3BJ 1WI3A 2W85A 2E19A 2DA4A 2HYGD 4NBQA 1H0MA 4KIGA 3BOQA 2MD5A 1IDZA 1ETXA 4ZJZA 1WPKA 1XTAA 2DU9A 2CG4A 2VE9A 2MBFA 4L9NA 1ZR2A 5L3GA 4HPQA 2XASA 1CF7A 1R36A 4NC7A 3DF8A 4G7OF 2GBYA 1MJBA 3I56I 1FJLA 4LITA 3RKYA 5EZGA 3H36A 4EJUA 2Y0MA 2K86A 2P81A 2EPFA 4HDUA 3IWZA 5JHFA 1MDMB 1ITYA 1SD6A 4BQNA 4J01A 2WC2A 2IXSA 3JTGA 1REPC 4BQAA 2FNPA 3PO2J 1IUYA 1B8IA 3OV8A 1X1AA 4XOPA 3NEUA 2HDDA 2XRNA 2M9HA 3R0AA 5H20A 4LLLA 2ELJA 4AU7A 5HDNA 3FMQA 2PN6A 3OYKA 2RNJA 4KUMA 3GW2A 4I0AA 2GXAA 2V6EA 1UCRA 4OIQF 2E2IJ 2QA4I 1BC7C 2Y0SN 2V1DA 5FKNA 3Q5FA 1IRZA 3LSMA 3CJNA 1Q1HA 1HQCA 3CP2A 1T38A 5EEGA 1O7FA 1S72I 4BY1J 2E1CA 4NHJA 3JRCA 4CCJA 3GTGJ 2H1KA 5DCMB 1B6AA 3K4MA 3CC2I 3MKLA 2CUZA 4CZZA 2Z1DA 4KISA 1R4MB 2ZCWA 2A61A 4NUBA 1MMNA 2EH3A 3OYLA 2VONA 3BY6A 3CCJI 3W2VA 2Z33A 4C3IJ 3DEUA 2O3FA 4D7NA 3KP3A 4HLXA 1SFUA 3QWLA 1K7AA 3BR6A 3H5RA 4IOCF 4KT6A 3LA7A 4LG3A 4AIJA 4XLEA 2A69F 3ZN1A 4IXAA 2Y69H 4B1RA 1EKEA 1W7PA 2VBZA 1SANA 3GZ6A 3BZCA 5M5YJ 3GTJJ 3S32A 2D45A 4FHTA 3FXUA 3OYNA 2P4WA 2V7FA 1QZEA 2VLAA 2KFDA 2MG4A 1SAUA 2MGQA 3B73A 2X6WA 1W5CC 2YU9J 5FKKA 2M8EA 2UWMA 2OQGA 4BS9A 3ZQIA 5J6XA 3D0SA 2IRFG 3J81Z 1XMKA 1V5GA 1D8JA 3ECHA 2V9KA 3LSPA 3ERMA 2O61A 1BC8C 5JVTA 1O3RA 1DUXC 3F8NA 1PUFB 4G7HF 1RIOH 2YS9A 1Y0NA 5HS8A 3OYDA 3LOCA 3F8FA 4WX9A 4XL9A 4HLYA 3U21A 4A3JJ 3S16J 2HNHA 4Y3OA 4A3IJ 5K7FA 4IHSA 4P1WA 4EVIA 3OYBA 1YX3A 3HJEA 2B63J 3IC7A 3AG3H 1N75A 2R7QA 2QVOA 3ZR8X 4D5CA 1GV5A 2VBXA 2QM3A 1W1WE 1OISA 5DM6F 3IH4A 4O3MA 2O0YA 1VTNC 1IXRC 4II2A 1L0OC 1TWGJ 5B3SH 5FKLA 1TWAJ 5IOZA 1IJWC 2ISZA 4L5IA 4KDPA 1QZZA 2OF7A 2PQ8A 1P4AA 2DFIA 2LF8A 4RGUA 1MZBA 1B4AA 1IV6A 5DS9A 4BE1A 2FQ4A 1WH5A 3CCVI 3IWFA 3M9AA 1LDDA 3LSHA 2VIXA 3V8LA 1ZGWA 2EQRA 3HOUJ 2MSYA 4YIRX 4B8XA 5E3NA 2BVLA 2WAQN 3F8CA 4LG0A 4BYYA 2ME6A 1LDKB 2KRHA 3L2RA 2A68F 4FASD 2CQQA 4HF1A 3NAUA 3BG7A 1MDMA 3PUBA 1LVKA 1U5TC 1U9NA 4DGWB 5K5OA 3HB9A 2CO5A 3RDIA 2VQCA 2WTEA 4PGGA 3M1EA 3F22A 5ERIA 4AYBN 4RBOA 1IRGA 2HDCA 3S93A 2W82A 1ZRFA 2YUSA 4JX5A 3OYEA 2E1MB 4RM2A 4M6VA 2EFNA 4BXFA 5AONA 1DQUA 1ZRCA 2HU9A 3PSFA 3FISA 3TO9A 5FROA 1P4WA 2XSJC 4G12A 2K27A 3BDDA 4ZZDA 5LGNA 1YW9A 1N25A 5BNGA 1Y39A 1Q1VA 4BEHA 2GQQA 2B9SA 2V1UA 1XCBA 4XLNF 2HOSA 2VOOA 2F5EA 2ICWG 4ZDLA 3TP0A 1Z9CA 5CPRB 1KYWA 5LGUA 2XB5A 3EDPA 4PDKA 2LSOA 4HF0A 3HKZA 2OC6A 3KZYA 4GYIA 5DUIA 1W7PD 3HHGA 4XICA 3ZMZA 1IXSB 4JBAA 5D5XB 4C3HJ 1H9TA 2OQRA 1V55H 3L2CA 2ZBKA 5BOXA 4A3CJ 3BJOA 1KQ8A 4RB1A 4G6DA 4I76A 4AVPA 2XPVA 5JR3A 2DOFA 1JUSA 1TLHB 2LF7A 2JWTA 4MLOA 2LY2A 2XB0X 3AG4H 4C2MJ 2EILH 3HGYA 3FXLA 1ZRDA 2DA7A 1MMGA 5C4XJ 2CQXA 1RR7A 2Y9YA 3CMYA 3I53A 2JRTA 1HDPA 1KQ9A 3WE2A 3LL7A 5LRRA 3T1BA 2HZTA 3HOVJ 3BTIA 1SVLA 2M34A 2PG4A 2WB1A 3QRFF 3GYHX 5LEJA 1ZGAA 2EZLA 4Y17A 2MABA 3WHBA 4CA0A 1WJEA 2COBA 2Y0SA 1MBGA 1ONVA 3H3VK 2ECBA 5EJCA 4HEA2 1DPUA 2G7UA 2Z3YA 4JK1X 4OAZA 5LBQA 1T0FA 3VPRA 3U2RA 4XN0A 4DW6A 3RIRA 2VQHA 3VOEA 5L3CA 1WJDA 4KITB 1ZELA 1O4XA 1F4KA 1T8IA 1ZREA 1ENHA 1KA8A 3COAC 2K02A 3ABUA 3OYHA 2TRTA 2EIMH 1Z91A 2Y75A 5AIQA 1B8IB 4BEHB 1IC8A 1TQPA 3HOZJ 3QOEA 3FWEA 1UAAA 1T39A 1IN4A 2DYSH 3EUKL 3Q3SA 3W6VA 2W57A 3AKZA 2ZSHB 3UNGC 2DA5A 2L3DA 1I3AA 2E35A 4LGWA 2STTA 3M1CA 1HKQA 3I9V2 1ZARA 2TCTA 3SQNA 4WWCA 2H8RA 4BE0A 2QZ8A 2NVYJ 3OYGA 2DFEA 2ESHA 4E7ZA 1O7LA 2GXGA 3HSRA 2GZWA 1IF1A 3DPUA 2MFZA 1KGSA 4LFUA 1VQ5I 2H6BA 2L7KA 4M9ZA 1D1BA 3BR5A 1YW8A 2CFXA 2XUBA 4W97A 4Y7NJ 4HQEA 1I6HJ 4ZYAA 4HF2A 1ZLKA 3ZOBA 3V7SA 4IHTA 2E5NA 2M3AA 1TQIA 4A0ZA 1USTA 2AO9A 2IGNA 3J80K 4M3GA 2HTSA 1AKHA 2D1HA 2HPMA 1XMXA 4PCQA 4I6ZA 3OL3A 3OSGA 4N4NB 2IBDA 3HOSA 5B66C 1STZA 1D0XA 2PX9A 4AIDA 3DPLC 5DD4A 4V19K 1MIJA 5EDNA 5J1RA 3DBLB 3VYSB 2R5YB 1X2MA 3R0JA 3MMYB 2K5CA 3LSKA 2EIKH 2ZJ2A 4EM2A 1SFXA 2W24A 3ONQA 1F36A 4OAYA 1N78A 5M3MJ 5D4RA 2OZ6A 5KNLA 1LKXA 3K4CA 1WKMA 3TDZC 1MBFA 3AL0B 3E0JB 1ZH5A 2IA1A 2XPUA 2KLOA 2D5VA 2JUGA 5H6RA 3HOWJ 2J5OA 3C2BA 3TOBA 1QU3A 2LVSA 4UV8A 3P5JA 1SAXA 3TW7A 4FQGA 4MTEA 3BZKA 2IAIA 5EG0A 3RKXA 3KYDB 3PSIA 3RTRA 4H0EA 2M1BA 3JRHA 2QSGX 2IS6A 3ERED 4JP0A 3S1NJ 3OOPA 4Y33A 2CWEA 3P9CA 5FD5A 2LOOA 1VQ8I 1JI8A 2NVXJ 1K6YA 2LFBA 2OV7A 4F92B 4XRSA 4IHWA 1FMVA 2ZKZA 2Q1ZB 2BY0A 5E3LA 4IJAA 3AAFA 3H9JA 1ZR4A 1JKQC 1ERDA 4F7ZA 2K9SA 1R1TA 3E6CC 5IP9J 2JA2A 1UG2A 1MBKA 4XM3A 4DOZA 2DQLA 3OIOA 3M07A 3CDHA 4M74A 3ZMUA 3ABKH 3L2VA 3BR3A 3DWLE 3K0LA 5J1YA 2WAFA 2O8KA 1MMAA 3KYCB 3GFMA 1O3QA 3CO7C 2QGUA 2ADUA 1W5SA 2DMNA 3E7LA 3VFZA 2VT2A 4AWXB 1DP7P 2K4JA 2QENA 2XGXA 3IUOA 1QQIA 5EYRA 5ILSA 1F9NA 2DT5A 2L4AA 1ZTRA 4JX6A 4G8XA 4ABZA 2PI0A 3OL4A 4ETSA 1FSHA 1JKPC 3W6KB 1ETQA 4XLHA 2VXZA 1QPIA 2BBYA 4PSWA 3EUHC 3J7YJ 2PMUA 1U3EM 1YTYA 2FE3A 3ZQ7A 1MSFC 1X3ZB 2HVQA 1BN5A 2IGOA 4UXNA 5FD6A 3FM3A 1BBYA 4N9HA 1U5TB 2R93J 1Z7UA 3AG1H 2RKHA 1A6IA 1RKWA 2NS8A 4ZYDA 2Y9ZA 1JXSA 3KCCA 4XK4A 3GLXA 1TBXA 3A03A 4E70A 1A31A 3CJTB 2DT6A 2JA6J 1WJBA 2HR3A 1YYVA 4KNYA 4CHUA 2VJIA 1JKRC 2DFFA 4E7IA 4KMFA 2RAEA 3DFGA 3G4SI 3QPTA 2BHZA 2NVTJ 1YHQI 1VZ0A 2F4MB 4BY7J 2EZKA 3VSLA 5TGTA 1F5TA 4D5FA 1BI3A 3ABMH 4ANJA 4A0XA 3BT9A 2HYFA 5F1JA 1FBQA 3SHFA 4IOAF 1MJAA 2WB1N 3KZIC 2NS7A 5TJJA 2JA8J 1XCVA 2XSDC 4MQVA 4V2FA 3E1SA 4E7HA 1CF7B 4Y52J 1Y8QB 3BG3A 3WU0A 3SZGA 5HNFA 2HTJA 2EB7A 5HLIA 2I5UA 2VJ5A 2XRLA 5F0FA 3CJQB 2MLGA 4EM1A 2VKDA 3LFUA 2JVHA 4BXUA 2DYRH 2JMWA 1HDDC 1ETVA 2E36A 3EYYA 2L54A 1B72B 2JA5J 3OR1C 1SD7A 2IA2A 4XKWA 1LJ9A 2ZC2A 2LYCA 4UUSB 3ZN0A 2XF6A 5IOYA 1D1CA 4HDVA 3NWSA 2CV0A 1POGA 3M8FA 4F3QA 5DYMA 5FRMA 1YOVB 2O5RA 4ITVA 1OJLA 2DTRA 2JPBA 1QPMA 3F8BA 4XSZF 2YPRA 3ZMDA 4AD9A 3SZTA 1HW2A 2KIUA 2L9RA 4OIRF 2LBFA 1OCCH 3O8HA 3QU6A 2NVQJ 3BCAA 4MTDA 3IRQA 5LLQA 2IGKA 4D9JA 2DN0A 3OYIA 2NOGA 2CSOA 3WTSC 3FKIJ 2ID6A 3PFYA 3JR9A 1RETA 4CZCA 1Z3XA 3WTXC 4AIKA 1GVDA 5LD2C 1WI9A 2NRAC 1FEXA 2JSPA 3QPSA 1Z05A 1WCMJ 4GYGA 2UXXA 5AIPA 2YSRA 1U6GA 4P9UA 2CH0A 3FDYA 2VKEA 2DW4A 1KQ0A 4M3BA 4BHBA 3CUOA 4ZZLA 3QYEA 3ZMVA 2G9WA 1DGWY 4DYRA 2OZUA 1D3YA 1JTYA 2WBMA 3DKYA 1YX5A 3JTHA 3GFLA 5GAGJ 3GFJA 3MKWB 3EUHA 3JAMZ 4E7KA 2F5VA 1O3SA 3L00A 3I54A 3IH2A 5ICGA 3ZQHA 3K2ZA 2TDXA 3H1CA 2XKOA 3PJRA 2X4HA 3PNVA 4OINF 3T5XA 2Z2SB 3OSFA 1BI2A 1O57A 2O7OA 4B09A 5ICEA 2R92J 1X1CA 4M73A 5K5QA 4KN7X 2QUFA 1ACIA 1Z67A 2P0WA 4WXDA 4XMYA 1KZHA 4EM0B 1HSTA 2ESNA 4FISA 3TGNA 1OR7C 2XF5A 4F52A 5GTIC 5IPAA 3FBIB 2FQ3A 4ASNA 4Z2YA 1UHSA 2M0CA 3G73A 5A2QK 2DK8A 1ZG1A 3BG6A 3HOXJ 4A3FJ 3OWTA 1LFBA 1R00A 3V8KA 3MEXA 3LWFA 4I98B 1G4DA 2R5ZA 3G2BA 1JKOC 3TP3A 1U8RA 5E1WA 2NVUB 1XGNA 4FE4A 2LY9A 1ON2A 2J5PA 5A2QZ 2M7AA 3WGHA 1S7OA 3DQVC 1P6RA 1IN8A 5F6FA 2R7VA 1RRJA 2X85A 4IHXA 5K7ZA 4HZFA 2HOEA 5KVRA 1W5TA 3GF2A 2LG4A 1PUFA 2HOAA 3REOA 2GA1A 2DJIA 3ESWB 2BXYA 4LK1F 1HLVA 3DLLF 1VNDA 3HYIA 4BHCA 3U9GA 1P9QC 5EGOB 4HQMA 4EQQA 3KLNA 4V2GA 3A02A 3ISPA 2DQRA 3BQYA 3B6CA 4RM3A 1MBEA 3BJ6A 3GXOA 2L0KA 1P7IA 2IGMA 4ENNA 1I27A 5LRSA 5GADJ 2X48A 3A4CA 3F0CA 5J8CA 1FP2A 1WJAA 3I4MJ 5C44J 2KZVA 4M3DA 2VB6A 3DU6A 1T98A 1UHWA 2DBBA 3RYRA 3BWGA 2FOWA 3TMOA 1TZLA 5M5XJ 3P9KA 5C4JJ 2IS2A 3F9KA 3K10A 1YJWI 3JREA 3T8RA 3S3NA 3RKQA 3WGGA 3SJMA 1QHGA 4CO8A 4IVNA 4IQ4A 1FOWA 5EEAA 2AQEA 1JJ6C 3KLOA 1E3PA 4BUPA 5IT9K 1RNLA 3PIPF 1WJ5A 2A6TA 3G6EI 1MMDA 1GXPA 2VL8A 1SD5A 2EK5A 5D6EA 2LREA 5DDGA 4B4CA 4P9FA 2CW8A 1U9OA 4KIFA 2L2OA 4XKBA 4FETA 1QHHD 1TWHJ 3SDGA 3D1NI 3J7AO 4HV6A 4A6EA 4BL0B 2P8TA 5FRNA 3RQ4A 2YX4A 2WV0A 1KU3A 1UZCA 4RGRA 4A0YA 3CMEI 2JUCA 2KHMA 4B43A 3MKYB 1EH8A 3OYMA 1BI1A 3K4BA 1B1BA 5E1ZB 5D8KB 3DKXA 2VODA 5IYDJ 1BIBA 4A3GJ 2AQFA 2HWVA 3R61A 1B9MA 3K4JA 1MJ9A 3DXJF 5FFXA 2ME0A 4U87A 2H94A 4AIHA 1JGGA 1EF4A 2KPMA 3GEZA 1I1GA 4E6KG 3RKWA 4CUGA 2V26A 3ASNH 3W3CA 1J0RA 5TISC 3H0DA 2IJLA 3DEWA 1E3HA 2M7BA 2MLKA 3HSFA 4C30A 1W0UA 3N97A 2XGCA 2E1NA 3K70D 2VQLA 2P5VA 3HUGB 2X6XA 3VYUB 1SMYF 4CICA 3JRGA 4BDZA 4RB2C 2JT1A 2KIFA 1TWCJ 2ID3A 2RREA 4DJAA 4ZYGA 2A5WA 3E5UA 2VQGA 5BPDA 3GTQJ 3S15J 1D0ZA 3QQAA 3M8JA 4RGSA 4DQ2A 1G3TA 3FIWA 5EZHA 5BMZA 1T2KA 1G6NA 4GFBA 1RESA 5J40A 1UG0A 2ETHA 3SXYA 2KZGA 2K3PA 3VWBA 3L7WA 2K7LA 1RR8C 3H92A 3J7AY 4LLGF 3FXMA 1XN7A 4U7DA 3KETA 2FOKA 1LFPA 5CQGA 3H9GA 1ZN2A 4CGZA 2EIJH 3LA3A 4DBQA 5HLGA 3KPHA 5ILVA 5J47A 1IN5A 2DDAA 3S2WA 4B3XA 3A0HC 3A01A 3S1MJ 1T33A 4XLPF 2BGCA 1ORKA 2OCEA 5K1YA 2X1EA 4CSWA 2QQAA 4UY8I 3JSPA 1WVRA 4YELA 1YIOA 1EH7A 3GMEA 2JQ7A 4PJMA 2RNGA 2XKPA 4I0BA 4QPOA 1XDUA 2OPTA 2DT7B 2DA3A 3OOUA 2P5KA 4G7ZF 3GWZA 1LE8B 3RCOA 3GTLJ 3SZPA 5FKOA 3IRRA 2OUMA 2FX0A 3LFKA 3OYFA 1GUUA 1ODDA 4L5JA 5IP7J 2Z16A 3Q0UA 4I2OA 5ED4A 2PJPA 1R5HA 3DPTA 3G71I 4R1HA 4DBRA 3CCRI 3TO6A 3RQIA 4L9JA 1FIPA 1IG7A 4B3AA 1J7KA 3OS1A 2KIQA 2HQNA 2UXNA 4PFPA 1K6OA 1ZHFA 5FLXZ 2ACJA 4L5EA 2L7ZA 4EJVA 2KRCA 1SMTA 1TTYA 1YJ9I 1HW5A 3E6MA 1X3UA 2MC4A 2W7NA 2JK3A 3EUAA 4KYWA 4C2TA 2K4BA 3QAHA 3M4OJ 2GAUA 3LA2A 4WXCA 2X6YA 3IP4B 1Z3YA 2YX7A 3CCLI 1IZ1A 5B1BH 4XN3A 2DA2A 2QWWA 2CU7A 3C7JA 4HX7A 5K5RA 1TP4A 3A2KA 4ZYEA 3K9TA 3V7RA 2LLKA 3HEFA 2PJRA 2DODA 1QBJA 1KU2A 4MGRA 3EYIA 4MFDA 1QGPA 4CYCB 5E8GA 4B44A 5GP9A 1QA6A 2DJNA 3JRAA 4X6AJ 5DCMA 4IQJA 2R5ZB 1Z77A 4A3KJ 2RVCA 3D5LA 5FB2A 1S6LA 3A1YA 2A05A 2EV6A 3ELKA 2LC2A 2H27A 2Q2EB 3TBIA 1I50J 2H8WA 1YQAA 3VYTB 4HW0A 2VXDA 1AHDP 2KT0A 1JT0A 2HXIA 4EV0A 2G7HA 3S1QJ 5IT9Z 2NAZA 2FJ1A 3CO6C 2GWRA 4MQ9F 1I6XA 3CESA 4BJ6C 4JYKA 2HXOA 1XDSA 4Q4ZF 5LHIA 3SDBA 1VFCA 4WXHA 3GFIA 2JJ7A 4ZTJA 1F1ZA 1FYLA 4U0VA 2KDOA 3NWTA 3JW4A 3OMYA 5F0CA 2R7XA 4PJLA 2CFOA 3V42A 1MNEA 2XAUA 1WGXA 5E8IA 3PIOF 3CUQB 1FYKA 3QPLA 1OYWA 2DMPA 5IYBJ
chains in the Genus database with same CATH topology
2BVMA 2QKLB 3BLYA 2HVQA 1Y56A 2IGOA 1Z21A 2M4KA 2HDWA 2LY1A 3SEZA 2X51A 4BU2A 2GOMA 2R7SA 4XORA 3CP8A 2CMPA 4ZJZA 2DT6A 3AL0C 1WJBA 4D1QA 2KP6A 4QPQA 2VJIA 4E7IA 2MD0A 3AFHA 2R7UA 4HSTA 2CV2A 1YE9A 4HPQA 1VZ0A 3VSLA 4NC7A 5TGTA 1PJRA 1G59A 4ANJA 4JOMA 4LITA 3HG9A 3D5RC 1GLNA 5HOOA 3E1SA 4E7HA 4RLFA 2K9LA 5JHFA 4HNUA 2M0MA 4BQNA 3SZGA 3L2UA 4J01A 5HNFA 4B47A 2IXSA 2VJ5A 4KJZA 3CJQB 3CMMA 2VKDA 1BR1A 4PUSA 1X1AA 1J09A 4XOPA 3LFUA 2JVHA 4J00A 3EPZA 3HXLA 2ELJA 4AU7A 1R6RA 3OYKA 3OR1C 2DXIA 2V6EA 4XKWA 4HRIA 2LYCA 2XF6A 4GRIA 1D1CA 3NWSA 2CUJA 2CV0A 4E7SA 3OS2A 4YEJA 4F3QA 5FRMA 3IAM2 3LSMA 2O5RA 4ITVA 1PYVA 3CP2A 2QKMB 4N4OB 2CS3A 3OYCA 3W2AA 4PSXA 4CCJA 2LBFA 2ZSIB 3K4MA 4PFOA 3I3LA 2CUZA 4YRVA 3H5NA 4NNJA 2Z1DA 4KISA 3BCAA 2CW7A 2DOAA 2IGKA 4D9JA 4NUBA 4CCKA 3OYIA 1MMNA 4PJNA 3OYLA 3W2VA 1HA8A 3PFYA 4CZCA 1Z3XA 3C2GA 1MNDA 5LD2C 3H5RA 3QODA 2DCEA 4KT6A 2JSPA 4LG3A 3PNYA 4XLEA 2KL4A 3ZRGA 2R4GA 2W00A 2CH0A 2PMZA 3FDYA 3S32A 3QYEA 1DGWY 3OYNA 4C2UA 2WBMA 4U7BA 2V7FA 2VLAA 3DKYA 1YX5A 1SAUA 2E1MC 4XNFA 2X6WA 3W2WA 3MKWB 1N77A 4XKVA 4E7KA 1Y6IA 2F5VA 5KHDA 3HL2A 2UWMA 4BS9A 1V5GA 3K6GA 3H9QA 3PJRA 2L9SA 2V9KA 5HNHA 3PNVA 3CJRB 2Z2SB 2IS1A 3TL4X 1X1CA 3OYDA 3SEQA 4XL9A 1W36D 2PJRB 3U21A 3UR3C 2P0WA 2HNHA 1X4PA 4Y3OA 4XMYA 2R7OA 4E4HA 4F55A 4P1WA 3OYBA 1OR7C 1YX3A 2W1OA 2XF5A 4F52A 3FBIB 3L2QA 4BACA 2F4IA 1N75A 2R7QA 4IX7A 3ZR8X 4II3A 3BG6A 3OWTA 2IS4A 2LBFB 1Z7LA 5HLTA 2K9MA 4IZZA 3H5AA 3ZCOA 4II2A 4AVZA 3G2BA 3ZXSA 2HZDA 3KYLA 4P5OA 5LFAA 4BJ5C 2M7AA 3DQVC 2WADA 2HPIA 2BOLA 4BE1A 2R7VA 1NG6A 2WAQA 2X85A 3LSHA 2VIXA 3VDXA 1D0YA 2LG4A 4LIUA 1X1BA 4Y4RA 2DJIA 4XR6A 2BVLA 2X1DA 1KONA 1LDKB 2KQRA 2KRHA 3OYJA 4FASD 3L2RA 1TT0A 3BG7A 1W36C 4XOTA 1U0JA 3PUBA 4PJJA 1LVKA 1P9QC 2V1NA 4DGWB 2CV1A 3N05A 3DTIA 4XQFA 3PL8A 1BR4A 2VQCA 4NQWB 4RMNA 3PNTA 4RM3A 1WFXA 2X1CA 3S93A 1X19A 2W82A 3OYEA 2E1MB 4EATA 2IGMA 4RM2A 4F91B 4BXFA 4XLAA 4E7JA 1DQUA 3A4CA 1WJAA 2HU9A 2R7RA 3PSFA 2KZVA 1DP3A 1IRXA 4XONA 5FROA 2XSJC 2VB6A 3DU6A 3CF2A 3TMOA 4BQQA 1TZLA 4XKCA 3S8PA 2F6CA 4BEHA 2IS2A 1WJFA 2ZXHA 4ZTFA 3F9KA 3K10A 2WAEA 1MW7A 2RQQA 4CH7A 3S3NA 4ZDLA 3K4KA 3K4NA 1QHGA 2HQAA 5CPRB 4IQ4A 3D5SC 2AQEA 3HPHA 4BUPA 4H4KC 1E0EA 3DEEA 2KMUA 4ZDPA 3HOTA 1WJ5A 2A6TA 3HKZA 1MMDA 2VL8A 2OC6A 3LSGA 5CQEA 3GBGA 2LREA 3LMMA 2CW8A 4LIVA 2L2OA 2VASA 4FETA 1QHHD 4XKBA 3RPUD 4BL0B 2L9NA 2V4JC 4C9YA 5FRNA 3VSKA 4ZC3A 3RQ4A 3HC7A 2ZFUA 2I8DA 2LRDA 3LSIA 2KHMA 4B43A 3MKYB 3OYMA 3K4BA 2NOJB 2VKHA 3DKXA 2AQFA 3QYFA 3VYRB 3K4JA 4MLOA 4U87A 2LY2A 3S3OA 3OS0A 2KPMA 4E6KG 4CUGA 1MMGA 2V26A 4HSRA 3W3CA 2VPLA 3H0DA 2M7BA 4C30A 2XF7A 3K70D 2VQLA 3LL7A 3HUGB 3OYAA 2X6XA 1NG7A 3VYUB 3MKZA 4E7LA 1T95A 3CZ6A 3BCBA 4BDZA 2WB1A 4DJAA 2RREA 2MABA 2UUZA 2R7WA 4CA0A 2A5WA 1WJEA 2Y0SA 2VQGA 4HEA2 1D0ZA 4BGDA 3M8JA 4OAZA 2JVGA 2W4SA 4XN0A 4CCNA 2VQHA 1UG0A 3K4LA 1WJDA 4KITB 1ZELA 3ZQQA 3QYBA 3VWBA 2K3PA 1V5EA 3J7AY 3OYHA 4CCOA 2WY7Q 1WJCA 1LFPA 5CQGA 3H9GA 4BEHB 1X1DA 4DBQA 3QOEA 1UAAA 2XC7A 2HVRA 3EUKL 4CCMA 2ZSHB 5CKTA 3AKZA 3UNGC 1G8XA 4B3XA 3BC8A 3M1CA 3I9V2 3FHNA 4BJTA 1FMWA 4NC8A 1BOBA 4BE0A 2X1EA 4CSWA 3SYTA 4F93B 3OYGA 2BW3B 4YELA 3C2HA 4E7ZA 3DLAA 3DPUA 4PJMA 2MFZA 1OLTA 2VJJA 2RNGA 2L7KA 1SFKA 1T0FC 1D1BA 4QPOA 2DT7B 3OOUA 2HVSA 3FKJA 4ZYAA 4BDYA 4XLFA 3RCOA 2E5NA 2M3AA 2OUMA 2IGNA 3OYFA 2HPMA 3OL3A 4PK4A 2Z16A 4N4NB 3HOSA 3DPTA 1D0XA 4DBRA 4OWRB 3DPLC 4HNTA 3OS1A 2FUG2 3VYSB 2WA0A 4PFPA 3MMYB 4IKFA 2XDVA 4BE2A 2K5CA 3LSKA 1AA7A 3ONQA 2KRCA 3OIQA 4OAYA 1N78A 5KNLA 2MC4A 2W7NA 2R7TA 1DGRM 1LKXA 3K4CA 3EUAA 3AL0B 4DIQA 2GOXB 3E0JB 3ZGKA 4ZDOA 4C2TA 2KLOA 2JUGA 2X6YA 3IP4B 3K70C 1QU3A 1Z3YA 4XN3A 3MD2A 2LH9A 5KCMA 3A2KA 3FBNB 3PSIA 2ZXIA 3RTRA 4X0GA 2PJRA 2E60A 4CCLA 3KEYA 2IS6A 4XLCA 1D1AA 1UELB 4Y33A 2E5ZA 4RLQA 4B44A 2LOOA 1JI8A 1V5FA 4HG2A 4B48A 1K6YA 2OV7A 2VJ4A 3L2WA 4F92B 1X4OA 4IQJA 1BR2A 1FMVA 2Q1ZB 3D5LA 3H9JA 1EA3A 1ERDA 3A1YA 2LC2A 2Q2EB 3TBIA 2JA2A 2UV1A 3DTEA 3VYTB 4R79A 2VXDA 3OR2C 3RSNA 4XM3A 4DOZA 3HPGA 3DTKA 3L2VA 3DWLE 4G6TB 2WAFA 3KX2A 1MMAA 1S9HA 3CESA 4BJ6C 3IUOA 3S3MA 3DU5A 3SDBA 4ZTJA 2M4GA 4BQOA 4AYBA 3OIPA 3OL4A 4JQFA 2KDOA 3H35A 3NWTA 3OMYA 2BW3A 2MYSA 2R7XA 4PJLA 2VXZA 4XLHA 2CFOA 3V42A 4PSWA 1MNEA 3OY9A 2WY8Q 3EUHC 2XAUA 3IAS2 5HVQC 2L5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1M B; 
#chains in the Genus database with same CATH topology
 1P4X A;  1H9G A;  1FNN A;  5E79 C;  3GLL A;  2HDW A;  2IPQ X;  1Z6T A;  3F3X A;  3HRU A;  4RGX A;  3E3V A;  2CUF A;  4LOC A;  1GXQ A;  4A69 C;  3SFI A;  1OYI A;  3TO7 A;  2GXB A;  4EJW A;  4KIC A;  1FIA A;  1S3J A;  1WQ2 A;  2CMP A;  3CP8 A;  4MNU A;  5FJ8 J;  3DP7 A;  3PQJ A;  1XGS A;  2OAZ A;  1PDN C;  1WHU A;  3KP6 A;  1VQM I;  1OCR H;  1FTT A;  1L3L A;  1NHA A;  2E7W A;  4BKX A;  3F23 A;  2CV2 A;  5FLX K;  1YE9 A;  1FZP B;  1G2H A;  1MD0 A;  5FLM J;  1PJR A;  1G59 A;  1X3W B;  4JOM A;  1AU7 A;  4Q5S F;  3IL2 A;  3D5R C;  3WGI A;  5KK1 A;  1SFO J;  1GLN A;  3H3Z A;  1ULY A;  2QSF X;  5HOO A;  4UUS A;  3MZ8 A;  1AWC A;  2K9L A;  4XRS G;  4HNU A;  3L2U A;  3Q0W A;  1QNT A;  4B47 A;  3W6J B;  2FSW A;  2D2W A;  3I5U A;  3CMM A;  3H3U A;  4EJT A;  1AOY A;  2XAF A;  3Q9V A;  1BR1 A;  4PUS A;  1QVT A;  4CDG A;  4J00 A;  3HXL A;  1OQY A;  3WTW C;  2EV0 A;  1ZAO A;  1R6R A;  2F5C A;  1W0T A;  2CGP A;  3RYP A;  4A12 A;  1OKR A;  3AG2 H;  2E2J J;  3HZJ A;  5DM7 F;  4GRI A;  2E1O A;  4E7S A;  3OS2 A;  3PQK A;  1J2X A;  1EH6 A;  1LB2 A;  5DTD A;  3IAM 2;  5F04 A;  1OMI A;  4UB8 C;  3KP7 A;  2DMU A;  2QKM B;  4N4O B;  3HHH A;  4MFE A;  2AS5 F;  2IVM A;  1X1P A;  3MQ0 A;  2CS3 A;  3T0Y A;  1OCT C;  3R60 A;  2Y30 A;  3BPX A;  2ZSI B;  5KAF C;  4DYQ A;  4WF2 A;  4PFO A;  5BS6 A;  2M87 A;  5LHG A;  4YRV A;  3H5N A;  4NNJ A;  1RUO A;  2MW8 A;  3FMR A;  2CW7 A;  3K2A A;  2DOA A;  4HYE A;  4CCK A;  4PJN A;  3TOA A;  1B9N A;  3E97 A;  4RA2 A;  3I0T A;  2OTJ I;  5FGM A;  3C2G A;  4ESF A;  3O6B B;  3V4G A;  3UKG A;  1JE8 A;  1G3W A;  1LVA A;  2FA5 A;  3V8J A;  2DCE A;  4HOB A;  5HDK A;  4L9V A;  2R4G A;  2IA0 A;  2DOE A;  4EEF G;  3FK6 A;  3MWM A;  2R7Z J;  1VQ6 I;  3HRT A;  1TQM A;  4IPA A;  3SFZ A;  5L3E A;  4U7B A;  1NTC A;  3I58 A;  3WG7 H;  1GHC A;  2E1M C;  4XRF A;  4XNF A;  4AC0 A;  1N77 A;  4XKV A;  1HSJ A;  4FE7 A;  5KHD A;  3KFW X;  2EFW A;  1J5Y A;  4CYD A;  1S29 A;  2NS0 A;  3H9Q A;  3NRV A;  2L9S A;  1XSD A;  4A6D A;  4DZP A;  3DBR B;  3M8E A;  2COM A;  5CLS A;  1WH7 A;  1IO2 A;  3SEQ A;  2DK5 A;  2O8X A;  4S05 A;  1W36 D;  5HS9 A;  3UR3 C;  2W48 A;  1X4P A;  1Y1V J;  2GIZ A;  4F55 A;  3CC7 I;  3S17 J;  1KU9 A;  3M7G A;  4KT5 C;  2W1O A;  1XSX A;  3L2Q A;  5J3L A;  2M45 A;  4II3 A;  2FBI A;  2IS4 A;  3ZQF A;  2OD5 A;  2IEK A;  1QRY A;  2K9M A;  2QBY A;  3ML6 A;  2P6T A;  1MH4 A;  3NAR A;  1A6Q A;  5F1R A;  2DFH A;  4IEJ A;  1VF9 A;  2X6O A;  3DCF A;  1LUJ B;  3ZXS A;  1EJ9 A;  4AM3 A;  2P7V B;  2CQK A;  3IKT A;  2KRF A;  2HEO A;  2XIG A;  2HPI A;  4GGG A;  1V4R A;  4ESB A;  2BOL A;  2HOT A;  3WU2 C;  2XV4 S;  2WAQ A;  5GPC A;  3JRB A;  1K78 A;  5E18 F;  2XAG A;  3RJP A;  1D0Y A;  4LIU A;  1K78 B;  3FXR A;  2R7F A;  5JLW A;  3NQO A;  1FYM A;  3I4N J;  1IW7 F;  4HX4 A;  5EEH A;  1KON A;  4OOI A;  2KQR A;  3BTJ A;  3OYJ A;  3ZPL A;  1W36 C;  3J81 K;  1ETO A;  1UJ8 A;  1I3Q J;  2V1N A;  4G9Y A;  3N05 A;  2ZB9 A;  4W1U A;  2JZY A;  2Y2Z A;  1BIA A;  4NQW B;  4ESJ A;  1D8K A;  3DV8 A;  2CRG A;  2DO7 A;  3FK7 A;  4XBF A;  4M6X A;  5HLH A;  4IHY A;  4EAT A;  1P92 A;  2JTV A;  4F91 B;  2L4M A;  1E3O C;  2BY2 A;  1XSV A;  1A04 A;  1U8B A;  5CVI A;  1DP3 A;  3FZV A;  3PUF A;  1IRX A;  5F27 A;  1AKH B;  3I64 A;  3CF2 A;  4BQQ A;  1F43 A;  3S8P A;  5J4Y A;  3F6V A;  1WJF A;  3ZP5 A;  4ZTF A;  1OPC A;  2RGV A;  4ENK A;  4FTH A;  4OMY A;  1R1V A;  3HKZ N;  3J7Z I;  3K4K A;  4MIM A;  2RDP A;  3K4N A;  1FPQ A;  2HQA A;  2F4O B;  2KIS A;  5BQT A;  1HOM A;  2HGC A;  4M3F A;  3U1K A;  2Z5U A;  1E0E A;  1P2F A;  4H4K C;  3DEE A;  2KMU A;  2MH2 A;  4Q48 A;  1X2N A;  2H1L A;  3LSG A;  1JTX A;  3GBG A;  1YS7 A;  3LMM A;  5IY5 H;  1DPR A;  1SVM A;  4MHG A;  4LIV A;  2LKX A;  2VAS A;  1VQK I;  3ECO A;  3GTM J;  3WOD F;  3FXK A;  2M2E A;  1JJ8 C;  2V4J C;  5F64 A;  3VSK A;  4ZC3 A;  3HC7 A;  2ZFU A;  3RI4 A;  2I8D A;  2JRM A;  2LRD A;  3FMS A;  2FEZ A;  3C3W A;  3GVA A;  2X9D A;  2GA2 A;  3TED A;  3ZQC A;  3BZ6 A;  4M71 A;  2VKH A;  1H88 C;  3Q9S A;  3FXO A;  3LSR A;  1IAW A;  3CF5 F;  3QYF A;  2QQ8 A;  1I39 A;  1A36 A;  3PO3 J;  2EJR A;  3IV5 A;  3S3O A;  3ZMT A;  3OS0 A;  3Q0V A;  4U0Y A;  4UUV A;  4HSR A;  4CXF A;  4XID A;  2VPL A;  4XSX F;  2XHK A;  4KA4 A;  3MVP A;  4RAY A;  2BY3 A;  3MKZ A;  1NG7 A;  1OYY A;  2R3S A;  1T95 A;  1MBJ A;  1R71 A;  4HX8 A;  1ETW A;  2O9L A;  5BPI A;  1IGN A;  2P5L C;  2Q2E A;  5DEQ A;  2FD5 A;  1T08 B;  4YII A;  1SEU A;  2KJC A;  5DUK A;  4WK8 F;  1WZ2 A;  1MKM A;  1WSU A;  4BGD A;  1LFU P;  2JVG A;  2O6G E;  2H09 A;  2W84 A;  4PJ0 C;  4UVB A;  3G1M A;  3QYB A;  1V5E A;  3S2D J;  4CCO A;  3GTK J;  2WY7 Q;  1YI2 I;  1DDN A;  4M3E A;  4A5N A;  2XC7 A;  2XGE A;  1BA5 A;  4I99 C;  4CCM A;  1HC8 A;  1Y1W J;  2Y48 A;  3FX3 A;  3KIO A;  3JRF A;  3QP6 A;  3F21 A;  1UMQ A;  3WTT C;  3HOY J;  2P6S A;  3BC8 A;  5D5W B;  1YS6 A;  3V7C A;  1LPQ A;  1V3F A;  2L7F P;  1FMW A;  3E6B A;  3CTA A;  4NC8 A;  1BOB A;  3CDL A;  4BAY A;  5M3F J;  5GAE J;  1LDJ A;  4DZJ A;  2BW3 B;  2VI6 A;  3C2H A;  1ETY A;  1E17 A;  3DLA A;  4D0P A;  1K4S A;  2VJJ A;  4LB5 A;  2IP2 A;  2ZME C;  4MEY F;  1MMS A;  3HIF A;  1FWZ A;  2HVS A;  3FKJ A;  1MGT A;  3K1P A;  4BDY A;  3BQZ A;  5D6F A;  4XLF A;  3WHC A;  5D5U B;  4IRI A;  5F0H A;  2PMZ N;  3BG5 A;  1PP8 F;  4OWR B;  2VPR A;  1OCZ H;  4HNT A;  2FUG 2;  3F6O A;  2WA0 A;  5JHU A;  5DCF A;  2XDV A;  3I59 B;  1AA7 A;  2W25 A;  5KAI C;  2P7C B;  3MAJ A;  2QF7 A;  1XC5 A;  3OIQ A;  4IO9 F;  1CGP A;  2CUE A;  5LGT A;  1DGR M;  3I71 A;  2ELK A;  4RAF A;  2QBY B;  2OU2 A;  4DIQ A;  3ZGK A;  3A01 B;  1J75 A;  1S7E A;  1EV7 A;  3K70 C;  2NYX A;  4I7H A;  1HKS A;  2FU4 A;  1R5G A;  2IT0 A;  1FX7 A;  2LH9 A;  2VN2 A;  3MD2 A;  2DLL A;  1FP1 D;  1IUF A;  1SVO A;  5KCM A;  3LSJ A;  3CCM I;  2BEO A;  2FRH A;  5CVV A;  3BTL A;  2ECC A;  3MZH A;  2WWY A;  1D5V A;  1D1A A;  2MH9 A;  2E2H J;  1NK3 P;  3HTU A;  4RLQ A;  2ISY A;  1V5F A;  4L0Y B;  4HG2 A;  1XB4 A;  3QOP A;  1R7J A;  2VJ4 A;  3L2W A;  4PZJ A;  2DTZ A;  4DYC A;  3ABL H;  5IT3 A;  1EA3 A;  5K7H A;  3I59 A;  1R9T J;  1A35 A;  5JVG F;  2A6E F;  2K9N A;  1W4M A;  3DTE A;  4R79 A;  3OR2 C;  4KMU X;  3S2H J;  3RSN A;  5M5W J;  3QU3 A;  2HS5 A;  3HPG A;  4MO7 A;  3DTK A;  5FO5 A;  5J1U A;  1ZG5 A;  4CYC A;  3HGG A;  3KX2 A;  2HKX A;  3GTP J;  2E34 A;  3PM1 A;  4BBR J;  3L09 A;  4MEX F;  4LB6 B;  4L0Z B;  5F08 A;  3VOD A;  1XS9 A;  3LST A;  2M4G A;  1YJN I;  3BJA A;  2PFB A;  3OIP A;  4UVA A;  4JQF A;  1BW5 A;  2XAQ A;  2BW3 A;  1HBX G;  4OU0 A;  2L9V A;  2LK2 A;  2XGD A;  3OY9 A;  2WY8 Q;  4L9T A;  5HVQ C;  2L5Q A;  2KIM A;  4HBL A;  2PEX A;  3GTO J;  3LAJ A;  2BVM A;  4UV9 A;  2QKL B;  5HDG A;  3BLY A;  1M1E B;  2MC3 A;  3FXJ A;  5JI6 A;  1VQ4 I;  1TC3 C;  1Z21 A;  3E6D A;  1S7A A;  2RQP A;  5J4V A;  4NC6 A;  3HM5 A;  3SEZ A;  1TNT A;  2FMY A;  2X51 A;  5L3B A;  4NDL A;  4ENJ A;  1BM9 A;  2EFQ A;  2EFP A;  3TW6 A;  1B72 A;  1ZQ3 P;  4BU2 A;  1YIT I;  4M6Y A;  2GOM A;  1PP7 U;  2R7S A;  1IN6 A;  4XOR A;  2QCO A;  4QWQ A;  4RDU A;  2G0E A;  2VBW A;  3TDU C;  1BJZ A;  1VQ7 I;  4D1Q A;  3AL0 C;  1S8N A;  2CJJ A;  2HQR A;  2ZJR F;  1YFH A;  3GZ5 A;  2KP6 A;  2M5W A;  4QPQ A;  2OA4 A;  2K9Q A;  2YR2 A;  2LDU A;  4A3M J;  4D7M A;  2B7E A;  2L01 A;  2MD0 A;  3AFH A;  2R7U A;  4HST A;  2QQB A;  1VQN I;  4RS8 A;  3GCM A;  2DI3 A;  3GUD A;  2K85 A;  2DPD A;  2CW0 F;  2ZO4 A;  3MN2 A;  3HG9 A;  4R8H A;  3HBL A;  2ZJQ F;  2OBP A;  2E7X A;  2O03 A;  3LNQ A;  3J80 Z;  4RLF A;  3CCE I;  2LNB A;  1FT9 A;  2M0M A;  2RC4 A;  4K2E A;  3BP8 A;  3WE3 A;  2NNN A;  3PFI A;  5GAH J;  4KJZ A;  2EZH A;  1LEB A;  5GTH C;  3ZQG A;  1OCP A;  4LMY A;  3ROU A;  1GT0 C;  5H6Q A;  3K69 A;  1J09 A;  3HTS B;  4DNC A;  4UUT A;  2CQ7 A;  2EFO A;  3EPZ A;  4HA8 A;  1LEA A;  1U5T A;  1V54 H;  4QIW N;  2HKO A;  1QO0 D;  2DXI A;  4I02 A;  3WU1 B;  5HS7 A;  4HRI A;  3ABT A;  3QP5 A;  2HI3 A;  2CUJ A;  4KIB A;  3BR2 A;  3TQN A;  1R49 A;  4YEJ A;  3I55 I;  1FOK A;  2L02 A;  5LEK A;  5FKM A;  1PYV A;  1T6S A;  1IV8 A;  4HAM A;  3OYC A;  3W2A A;  4PSX A;  2HFH A;  3DBH B;  4IHV A;  1JHF A;  1H89 C;  1YLF A;  4RB0 A;  3I3L A;  1HF0 A;  2Y31 A;  3KZZ A;  3LAP A;  4LJZ F;  3H0G J;  1BJA A;  3R6S A;  1FOX A;  3CC4 I;  4LG0 B;  2XRO A;  1HA8 A;  4L18 B;  3BR1 A;  2XAJ A;  1MND A;  1TL8 A;  2ZJP F;  1TW2 A;  3QOD A;  1JUM A;  2MA3 A;  1RPW A;  2VC1 A;  1ON1 A;  3PNY A;  4C3J J;  2KL4 A;  3ZRG A;  1XMA A;  2A6H F;  2V9V A;  3RPU A;  2W00 A;  2OTL I;  1E2X A;  2PMZ A;  2Z99 A;  1LNW A;  3MZY A;  5E3M A;  2PLY A;  4EJO A;  4U0W A;  4C2U A;  4NQW A;  3S1R J;  3BG9 A;  3CDI A;  1Y0U A;  5CVR A;  5B1A H;  4HV5 A;  3W2W A;  2I10 A;  1IN7 A;  1Y6I A;  3HL2 A;  2ZXW H;  4LK0 F;  1R58 A;  5ILU A;  3FM5 A;  3K6G A;  2QYO A;  5HNH A;  1BOA A;  2KJB A;  3CJR B;  2IS1 A;  1D5Y A;  1BL0 A;  1CQT A;  2EBI A;  2R7D A;  5GPA A;  3TL4 X;  1O3T A;  3K1M A;  2HQ5 A;  3KEO A;  4Q47 A;  4YG2 F;  2JA7 J;  2PJR B;  1FY7 A;  3FHZ A;  3A0B C;  3EET A;  4E4H A;  2R7O A;  3KP5 A;  4BAC A;  2LKS A;  2F4I A;  2M8G X;  3EQL F;  5CJ9 A;  4IX7 A;  5DD8 A;  5E3O A;  1ZKG A;  3T8T A;  1UB9 A;  1J59 A;  3JAM K;  2FNA A;  1MH3 A;  2QQ9 A;  2LBF B;  1Z7L A;  1VQO I;  5HLT A;  1PUE E;  1ZK8 A;  4HNV A;  3E5X A;  2V6C A;  3L1P A;  3BRO A;  4IZZ A;  3H5A A;  1NH3 A;  3BTC A;  2VE8 A;  3ZCO A;  4ZYH A;  1RZ4 A;  3HRM A;  1YW7 A;  4AVZ A;  3ASO H;  2BV6 A;  5JFR A;  2HZD A;  1ZG3 A;  2V79 A;  1TWF J;  3KYL A;  1U78 A;  2ZNY A;  3WTZ A;  2VOP A;  4Y13 A;  4P5O A;  4KN4 X;  4RAZ A;  5LFA A;  5D4S A;  1I5Z A;  2ZFW A;  2JSC A;  4JX4 A;  1W7P B;  3IKV A;  2DAO A;  4BJ5 C;  2HYJ A;  4ENM A;  1A5J A;  2WAD A;  4RAG A;  2NNY A;  1C0W A;  1X58 A;  2FBK A;  4FX0 A;  3P7N A;  1NG6 A;  5J8F A;  1R22 A;  4KFC A;  3CCU I;  3IH3 A;  4ON0 A;  1UFM A;  2F5F A;  1XD7 A;  2LP0 A;  3VDX A;  1X1B A;  4Y4R A;  3CCQ I;  4XR6 A;  1HKT A;  2X1D A;  1TNS A;  1XX5 A;  2RN7 A;  4G6Q A;  5E20 A;  4GXO A;  3B6A A;  3LQQ A;  1TT0 A;  1OR7 A;  4XOT A;  1U0J A;  3CUQ C;  4PJJ A;  3LQR A;  2CV1 A;  2EV5 A;  3DTI A;  5CVU A;  2BHY A;  4O6J A;  4XQF A;  1APL C;  3PL8 A;  1BR4 A;  2K3F A;  1UHM A;  3RPQ A;  3ZMS A;  3CCS I;  4RMN A;  3PNT A;  1WFX A;  2X1C A;  1VQL I;  1X19 A;  5B5E C;  1VQP I;  2AHQ A;  4Z6Y A;  4XLA A;  1YG2 A;  4E7J A;  3KEQ A;  3G1O A;  2R7R A;  1XGO A;  1QVU A;  1B59 A;  4UVC A;  4XON A;  5LHH A;  2VC0 A;  1JHH A;  1OCO H;  1K61 A;  1FSE A;  3S14 J;  3K7A J;  1H8A C;  1GDT A;  2EA4 A;  4XKC A;  3VB2 A;  2F6C A;  1LQ1 A;  1XGM A;  1RKT A;  4I01 A;  2ZXH A;  2WAE A;  1MW7 A;  1R1U A;  2K40 A;  2RQQ A;  4CH7 A;  1Y8R B;  2BXZ A;  2ELH A;  2LR8 A;  4J19 A;  1GVJ A;  2YU3 A;  3D5S C;  3HPH A;  3O2P E;  2XVC A;  2DA6 A;  4ZDP A;  3HOT A;  3L9F A;  2JPC A;  1GV2 A;  2UZK A;  1TT5 B;  3P9I A;  1VI0 A;  3JRI A;  2LTP A;  5CQE A;  4FT8 A;  2F2E A;  4YIF A;  2BZT A;  3RPU D;  2FBH A;  1OFC X;  4GCV A;  1G3S A;  2L9N A;  2A3S A;  2VKV A;  3CLQ A;  4C9Y A;  3R4K A;  4YFX F;  1SFE A;  4QTR A;  3LSI A;  2A5Y B;  2BE5 F;  1IDY A;  3ZQL A;  2NOJ B;  4M9X A;  3HUG A;  2Q0O A;  2BY1 A;  3RZD J;  2GLO A;  3CCY A;  1IRF A;  2DA1 A;  2VT3 A;  3JCU C;  3VYR B;  3CD6 I;  1KU7 A;  1PVE A;  1I1S A;  2B0L A;  2R0Q C;  1FTZ A;  2LMD A;  1P7J A;  1RC9 A;  2DDB A;  4NB5 A;  1QZY A;  4OIP F;  3X2Q H;  5C3E J;  4YFK F;  5DV5 A;  4O5V A;  2XF7 A;  6PAX A;  4BBS J;  4FX4 A;  5JLX A;  2V1X A;  4RB3 C;  4WCG A;  3OYA A;  3JSO A;  1MSE C;  4A3D J;  1MNM C;  2XAH A;  4E7L A;  3CZ6 A;  3BCB A;  1YIJ I;  3WG9 A;  3TKY A;  3KE2 A;  2A07 F;  1VQ9 I;  2UUZ A;  4EMS A;  5IYC J;  2R7W A;  1IXC A;  1G3Y A;  3WTY C;  3DKW A;  5D8L B;  1HCR A;  2DPU A;  2M30 A;  2GM4 A;  2ZME A;  2W4S A;  4A93 J;  4A3E J;  4QSH A;  4X1E A;  3VEP A;  4CCN A;  1HXD A;  1USS A;  3K4L A;  3ULQ B;  3ZQQ A;  2QLZ A;  4ZH4 F;  4XRM A;  5H2F C;  5FFZ A;  3MFK A;  4N0B A;  1XG1 A;  3O3K A;  5L3F A;  4S0H B;  1U2W A;  4EGZ A;  1WJC A;  3KP2 A;  1RI7 A;  1X1D A;  3G1L A;  4QLC U;  2Z9O A;  2HVR A;  4IRG A;  5CKT A;  4YFN F;  1YRN B;  3C18 A;  5IP6 A;  1G8X A;  3BPV A;  1XPX A;  2PMH A;  3FHN A;  3HSE A;  4G94 A;  4LD5 A;  4BJT A;  2H6C A;  1FC3 A;  3CUQ A;  4P55 A;  5CYV A;  4BH9 A;  2LD5 A;  1FBS A;  1S5L C;  3SYT A;  4F93 B;  1R4N B;  3KP4 A;  2F48 A;  4GO1 A;  2GIV A;  3FF5 A;  4IF4 A;  2AXT C;  2RV8 A;  1JT6 A;  4I09 A;  2EZI A;  1OLT A;  2R5Y A;  1J9I A;  1SFK A;  5EGO A;  1Z1D A;  9ANT A;  4IL6 C;  1T0F C;  3C1D A;  5L3D A;  2KKO A;  2L7M P;  2E71 A;  4A2U A;  1ZYR F;  5TRD A;  1BI0 A;  2DMT A;  1BW6 A;  1R5I D;  5E17 F;  4BNC A;  1WWX A;  4FCY A;  2C6Y A;  3B02 A;  4PK4 A;  1YO5 C;  4UNO A;  4M9S A;  1ZLJ A;  2WV1 A;  2Q8K A;  2KDZ A;  1KYZ A;  2FF4 A;  2EWN A;  3WTU C;  2QEX I;  2BYV E;  3I4P A;  4UB6 C;  3MCZ A;  2FXA A;  1HW1 A;  4IKF A;  4BE2 A;  3F8M A;  1JUP A;  2D1V A;  2PBI A;  3HRS A;  4TV7 A;  4P96 A;  3WTV C;  2OJE D;  4UHT A;  1K83 J;  2R7T A;  1DU6 A;  3GO5 A;  2GOX B;  4ZDO A;  3K1N A;  5HOD A;  5ICC A;  4EGY A;  1ZGJ A;  3N4M A;  3HDD A;  3RZO J;  4BXX J;  1DU0 A;  3QPH A;  3CLO A;  4OMZ A;  3E5Q A;  3FBN B;  1SC7 A;  3JRD A;  2ZXI A;  1NK2 P;  2VBY A;  4X0G A;  2E60 A;  4CCL A;  3KEY A;  2X0L A;  1T56 A;  4XLC A;  4AUX A;  3F72 A;  3BR0 A;  1UEL B;  2E5Z A;  5EF6 A;  3GX4 X;  4B48 A;  4U88 A;  2V9P A;  2CQN A;  2NXN B;  4GDF A;  1Z6R A;  1X4O A;  1BR2 A;  2IW5 A;  2AXL A;  2EIN H;  3G3Z A;  2QSH X;  4PGH A;  5D5V B;  4OIO F;  1FBU A;  1ETK A;  2F5D A;  2UV1 A;  5ICF A;  3GZN B;  1K79 A;  3CQZ J;  3IHU A;  1FLI A;  1WRJ A;  2EA2 A;  4G6T B;  1YRN A;  4M72 A;  1FOY A;  3O8G A;  5EG0 B;  1LE8 A;  5E1X A;  1TW3 A;  5CVJ A;  1S9H A;  1Z0X A;  1RUN A;  3M3Y J;  1R23 A;  3S3M A;  3DU5 A;  2JN6 A;  4N9I A;  2ZNZ A;  4Y15 A;  4BQO A;  1JGS A;  2OCC H;  4AYB A;  2XPW A;  5FLV A;  4S04 A;  3H35 A;  2CYY A;  2MYS A;  2N8G A;  2ZME B;  4BHP A;  3IAS 2;  2LKP A;  3FXQ A;  2FML A;  3U1D A;  2STW A;  3CMA I;  2VUM J;  1Y56 A;  2M4K A;  4A3L J;  2LY1 A;  4A5M A;  1K4T A;  2DMQ A;  4LLN A;  1SD4 A;  2ZXJ A;  4IRH A;  1MBH A;  4A3B J;  1WI3 A;  2W85 A;  2E19 A;  2DA4 A;  2HYG D;  4NBQ A;  1H0M A;  4KIG A;  3BOQ A;  2MD5 A;  1IDZ A;  1ETX A;  4ZJZ A;  1WPK A;  1XTA A;  2DU9 A;  2CG4 A;  2VE9 A;  2MBF A;  4L9N A;  1ZR2 A;  5L3G A;  4HPQ A;  2XAS A;  1CF7 A;  1R36 A;  4NC7 A;  3DF8 A;  4G7O F;  2GBY A;  1MJB A;  3I56 I;  1FJL A;  4LIT A;  3RKY A;  5EZG A;  3H36 A;  4EJU A;  2Y0M A;  2K86 A;  2P81 A;  2EPF A;  4HDU A;  3IWZ A;  5JHF A;  1MDM B;  1ITY A;  1SD6 A;  4BQN A;  4J01 A;  2WC2 A;  2IXS A;  3JTG A;  1REP C;  4BQA A;  2FNP A;  3PO2 J;  1IUY A;  1B8I A;  3OV8 A;  1X1A A;  4XOP A;  3NEU A;  2HDD A;  2XRN A;  2M9H A;  3R0A A;  5H20 A;  4LLL A;  2ELJ A;  4AU7 A;  5HDN A;  3FMQ A;  2PN6 A;  3OYK A;  2RNJ A;  4KUM A;  3GW2 A;  4I0A A;  2GXA A;  2V6E A;  1UCR A;  4OIQ F;  2E2I J;  2QA4 I;  1BC7 C;  2Y0S N;  2V1D A;  5FKN A;  3Q5F A;  1IRZ A;  3LSM A;  3CJN A;  1Q1H A;  1HQC A;  3CP2 A;  1T38 A;  5EEG A;  1O7F A;  1S72 I;  4BY1 J;  2E1C A;  4NHJ A;  3JRC A;  4CCJ A;  3GTG J;  2H1K A;  5DCM B;  1B6A A;  3K4M A;  3CC2 I;  3MKL A;  2CUZ A;  4CZZ A;  2Z1D A;  4KIS A;  1R4M B;  2ZCW A;  2A61 A;  4NUB A;  1MMN A;  2EH3 A;  3OYL A;  2VON A;  3BY6 A;  3CCJ I;  3W2V A;  2Z33 A;  4C3I J;  3DEU A;  2O3F A;  4D7N A;  3KP3 A;  4HLX A;  1SFU A;  3QWL A;  1K7A A;  3BR6 A;  3H5R A;  4IOC F;  4KT6 A;  3LA7 A;  4LG3 A;  4AIJ A;  4XLE A;  2A69 F;  3ZN1 A;  4IXA A;  2Y69 H;  4B1R A;  1EKE A;  1W7P A;  2VBZ A;  1SAN A;  3GZ6 A;  3BZC A;  5M5Y J;  3GTJ J;  3S32 A;  2D45 A;  4FHT A;  3FXU A;  3OYN A;  2P4W A;  2V7F A;  1QZE A;  2VLA A;  2KFD A;  2MG4 A;  1SAU A;  2MGQ A;  3B73 A;  2X6W A;  1W5C C;  2YU9 J;  5FKK A;  2M8E A;  2UWM A;  2OQG A;  4BS9 A;  3ZQI A;  5J6X A;  3D0S A;  2IRF G;  3J81 Z;  1XMK A;  1V5G A;  1D8J A;  3ECH A;  2V9K A;  3LSP A;  3ERM A;  2O61 A;  1BC8 C;  5JVT A;  1O3R A;  1DUX C;  3F8N A;  1PUF B;  4G7H F;  1RIO H;  2YS9 A;  1Y0N A;  5HS8 A;  3OYD A;  3LOC A;  3F8F A;  4WX9 A;  4XL9 A;  4HLY A;  3U21 A;  4A3J J;  3S16 J;  2HNH A;  4Y3O A;  4A3I J;  5K7F A;  4IHS A;  4P1W A;  4EVI A;  3OYB A;  1YX3 A;  3HJE A;  2B63 J;  3IC7 A;  3AG3 H;  1N75 A;  2R7Q A;  2QVO A;  3ZR8 X;  4D5C A;  1GV5 A;  2VBX A;  2QM3 A;  1W1W E;  1OIS A;  5DM6 F;  3IH4 A;  4O3M A;  2O0Y A;  1VTN C;  1IXR C;  4II2 A;  1L0O C;  1TWG J;  5B3S H;  5FKL A;  1TWA J;  5IOZ A;  1IJW C;  2ISZ A;  4L5I A;  4KDP A;  1QZZ A;  2OF7 A;  2PQ8 A;  1P4A A;  2DFI A;  2LF8 A;  4RGU A;  1MZB A;  1B4A A;  1IV6 A;  5DS9 A;  4BE1 A;  2FQ4 A;  1WH5 A;  3CCV I;  3IWF A;  3M9A A;  1LDD A;  3LSH A;  2VIX A;  3V8L A;  1ZGW A;  2EQR A;  3HOU J;  2MSY A;  4YIR X;  4B8X A;  5E3N A;  2BVL A;  2WAQ N;  3F8C A;  4LG0 A;  4BYY A;  2ME6 A;  1LDK B;  2KRH A;  3L2R A;  2A68 F;  4FAS D;  2CQQ A;  4HF1 A;  3NAU A;  3BG7 A;  1MDM A;  3PUB A;  1LVK A;  1U5T C;  1U9N A;  4DGW B;  5K5O A;  3HB9 A;  2CO5 A;  3RDI A;  2VQC A;  2WTE A;  4PGG A;  3M1E A;  3F22 A;  5ERI A;  4AYB N;  4RBO A;  1IRG A;  2HDC A;  3S93 A;  2W82 A;  1ZRF A;  2YUS A;  4JX5 A;  3OYE A;  2E1M B;  4RM2 A;  4M6V A;  2EFN A;  4BXF A;  5AON A;  1DQU A;  1ZRC A;  2HU9 A;  3PSF A;  3FIS A;  3TO9 A;  5FRO A;  1P4W A;  2XSJ C;  4G12 A;  2K27 A;  3BDD A;  4ZZD A;  5LGN A;  1YW9 A;  1N25 A;  5BNG A;  1Y39 A;  1Q1V A;  4BEH A;  2GQQ A;  2B9S A;  2V1U A;  1XCB A;  4XLN F;  2HOS A;  2VOO A;  2F5E A;  2ICW G;  4ZDL A;  3TP0 A;  1Z9C A;  5CPR B;  1KYW A;  5LGU A;  2XB5 A;  3EDP A;  4PDK A;  2LSO A;  4HF0 A;  3HKZ A;  2OC6 A;  3KZY A;  4GYI A;  5DUI A;  1W7P D;  3HHG A;  4XIC A;  3ZMZ A;  1IXS B;  4JBA A;  5D5X B;  4C3H J;  1H9T A;  2OQR A;  1V55 H;  3L2C A;  2ZBK A;  5BOX A;  4A3C J;  3BJO A;  1KQ8 A;  4RB1 A;  4G6D A;  4I76 A;  4AVP A;  2XPV A;  5JR3 A;  2DOF A;  1JUS A;  1TLH B;  2LF7 A;  2JWT A;  4MLO A;  2LY2 A;  2XB0 X;  3AG4 H;  4C2M J;  2EIL H;  3HGY A;  3FXL A;  1ZRD A;  2DA7 A;  1MMG A;  5C4X J;  2CQX A;  1RR7 A;  2Y9Y A;  3CMY A;  3I53 A;  2JRT A;  1HDP A;  1KQ9 A;  3WE2 A;  3LL7 A;  5LRR A;  3T1B A;  2HZT A;  3HOV J;  3BTI A;  1SVL A;  2M34 A;  2PG4 A;  2WB1 A;  3QRF F;  3GYH X;  5LEJ A;  1ZGA A;  2EZL A;  4Y17 A;  2MAB A;  3WHB A;  4CA0 A;  1WJE A;  2COB A;  2Y0S A;  1MBG A;  1ONV A;  3H3V K;  2ECB A;  5EJC A;  4HEA 2;  1DPU A;  2G7U A;  2Z3Y A;  4JK1 X;  4OAZ A;  5LBQ A;  1T0F A;  3VPR A;  3U2R A;  4XN0 A;  4DW6 A;  3RIR A;  2VQH A;  3VOE A;  5L3C A;  1WJD A;  4KIT B;  1ZEL A;  1O4X A;  1F4K A;  1T8I A;  1ZRE A;  1ENH A;  1KA8 A;  3COA C;  2K02 A;  3ABU A;  3OYH A;  2TRT A;  2EIM H;  1Z91 A;  2Y75 A;  5AIQ A;  1B8I B;  4BEH B;  1IC8 A;  1TQP A;  3HOZ J;  3QOE A;  3FWE A;  1UAA A;  1T39 A;  1IN4 A;  2DYS H;  3EUK L;  3Q3S A;  3W6V A;  2W57 A;  3AKZ A;  2ZSH B;  3UNG C;  2DA5 A;  2L3D A;  1I3A A;  2E35 A;  4LGW A;  2STT A;  3M1C A;  1HKQ A;  3I9V 2;  1ZAR A;  2TCT A;  3SQN A;  4WWC A;  2H8R A;  4BE0 A;  2QZ8 A;  2NVY J;  3OYG A;  2DFE A;  2ESH A;  4E7Z A;  1O7L A;  2GXG A;  3HSR A;  2GZW A;  1IF1 A;  3DPU A;  2MFZ A;  1KGS A;  4LFU A;  1VQ5 I;  2H6B A;  2L7K A;  4M9Z A;  1D1B A;  3BR5 A;  1YW8 A;  2CFX A;  2XUB A;  4W97 A;  4Y7N J;  4HQE A;  1I6H J;  4ZYA A;  4HF2 A;  1ZLK A;  3ZOB A;  3V7S A;  4IHT A;  2E5N A;  2M3A A;  1TQI A;  4A0Z A;  1UST A;  2AO9 A;  2IGN A;  3J80 K;  4M3G A;  2HTS A;  1AKH A;  2D1H A;  2HPM A;  1XMX A;  4PCQ A;  4I6Z A;  3OL3 A;  3OSG A;  4N4N B;  2IBD A;  3HOS A;  5B66 C;  1STZ A;  1D0X A;  2PX9 A;  4AID A;  3DPL C;  5DD4 A;  4V19 K;  1MIJ A;  5EDN A;  5J1R A;  3DBL B;  3VYS B;  2R5Y B;  1X2M A;  3R0J A;  3MMY B;  2K5C A;  3LSK A;  2EIK H;  2ZJ2 A;  4EM2 A;  1SFX A;  2W24 A;  3ONQ A;  1F36 A;  4OAY A;  1N78 A;  5M3M J;  5D4R A;  2OZ6 A;  5KNL A;  1LKX A;  3K4C A;  1WKM A;  3TDZ C;  1MBF A;  3AL0 B;  3E0J B;  1ZH5 A;  2IA1 A;  2XPU A;  2KLO A;  2D5V A;  2JUG A;  5H6R A;  3HOW J;  2J5O A;  3C2B A;  3TOB A;  1QU3 A;  2LVS A;  4UV8 A;  3P5J A;  1SAX A;  3TW7 A;  4FQG A;  4MTE A;  3BZK A;  2IAI A;  5EG0 A;  3RKX A;  3KYD B;  3PSI A;  3RTR A;  4H0E A;  2M1B A;  3JRH A;  2QSG X;  2IS6 A;  3ERE D;  4JP0 A;  3S1N J;  3OOP A;  4Y33 A;  2CWE A;  3P9C A;  5FD5 A;  2LOO A;  1VQ8 I;  1JI8 A;  2NVX J;  1K6Y A;  2LFB A;  2OV7 A;  4F92 B;  4XRS A;  4IHW A;  1FMV A;  2ZKZ A;  2Q1Z B;  2BY0 A;  5E3L A;  4IJA A;  3AAF A;  3H9J A;  1ZR4 A;  1JKQ C;  1ERD A;  4F7Z A;  2K9S A;  1R1T A;  3E6C C;  5IP9 J;  2JA2 A;  1UG2 A;  1MBK A;  4XM3 A;  4DOZ A;  2DQL A;  3OIO A;  3M07 A;  3CDH A;  4M74 A;  3ZMU A;  3ABK H;  3L2V A;  3BR3 A;  3DWL E;  3K0L A;  5J1Y A;  2WAF A;  2O8K A;  1MMA A;  3KYC B;  3GFM A;  1O3Q A;  3CO7 C;  2QGU A;  2ADU A;  1W5S A;  2DMN A;  3E7L A;  3VFZ A;  2VT2 A;  4AWX B;  1DP7 P;  2K4J A;  2QEN A;  2XGX A;  3IUO A;  1QQI A;  5EYR A;  5ILS A;  1F9N A;  2DT5 A;  2L4A A;  1ZTR A;  4JX6 A;  4G8X A;  4ABZ A;  2PI0 A;  3OL4 A;  4ETS A;  1FSH A;  1JKP C;  3W6K B;  1ETQ A;  4XLH A;  2VXZ A;  1QPI A;  2BBY A;  4PSW A;  3EUH C;  3J7Y J;  2PMU A;  1U3E M;  1YTY A;  2FE3 A;  3ZQ7 A;  1MSF C;  1X3Z B;  2HVQ A;  1BN5 A;  2IGO A;  4UXN A;  5FD6 A;  3FM3 A;  1BBY A;  4N9H A;  1U5T B;  2R93 J;  1Z7U A;  3AG1 H;  2RKH A;  1A6I A;  1RKW A;  2NS8 A;  4ZYD A;  2Y9Z A;  1JXS A;  3KCC A;  4XK4 A;  3GLX A;  1TBX A;  3A03 A;  4E70 A;  1A31 A;  3CJT B;  2DT6 A;  2JA6 J;  1WJB A;  2HR3 A;  1YYV A;  4KNY A;  4CHU A;  2VJI A;  1JKR C;  2DFF A;  4E7I A;  4KMF A;  2RAE A;  3DFG A;  3G4S I;  3QPT A;  2BHZ A;  2NVT J;  1YHQ I;  1VZ0 A;  2F4M B;  4BY7 J;  2EZK A;  3VSL A;  5TGT A;  1F5T A;  4D5F A;  1BI3 A;  3ABM H;  4ANJ A;  4A0X A;  3BT9 A;  2HYF A;  5F1J A;  1FBQ A;  3SHF A;  4IOA F;  1MJA A;  2WB1 N;  3KZI C;  2NS7 A;  5TJJ A;  2JA8 J;  1XCV A;  2XSD C;  4MQV A;  4V2F A;  3E1S A;  4E7H A;  1CF7 B;  4Y52 J;  1Y8Q B;  3BG3 A;  3WU0 A;  3SZG A;  5HNF A;  2HTJ A;  2EB7 A;  5HLI A;  2I5U A;  2VJ5 A;  2XRL A;  5F0F A;  3CJQ B;  2MLG A;  4EM1 A;  2VKD A;  3LFU A;  2JVH A;  4BXU A;  2DYR H;  2JMW A;  1HDD C;  1ETV A;  2E36 A;  3EYY A;  2L54 A;  1B72 B;  2JA5 J;  3OR1 C;  1SD7 A;  2IA2 A;  4XKW A;  1LJ9 A;  2ZC2 A;  2LYC A;  4UUS B;  3ZN0 A;  2XF6 A;  5IOY A;  1D1C A;  4HDV A;  3NWS A;  2CV0 A;  1POG A;  3M8F A;  4F3Q A;  5DYM A;  5FRM A;  1YOV B;  2O5R A;  4ITV A;  1OJL A;  2DTR A;  2JPB A;  1QPM A;  3F8B A;  4XSZ F;  2YPR A;  3ZMD A;  4AD9 A;  3SZT A;  1HW2 A;  2KIU A;  2L9R A;  4OIR F;  2LBF A;  1OCC H;  3O8H A;  3QU6 A;  2NVQ J;  3BCA A;  4MTD A;  3IRQ A;  5LLQ A;  2IGK A;  4D9J A;  2DN0 A;  3OYI A;  2NOG A;  2CSO A;  3WTS C;  3FKI J;  2ID6 A;  3PFY A;  3JR9 A;  1RET A;  4CZC A;  1Z3X A;  3WTX C;  4AIK A;  1GVD A;  5LD2 C;  1WI9 A;  2NRA C;  1FEX A;  2JSP A;  3QPS A;  1Z05 A;  1WCM J;  4GYG A;  2UXX A;  5AIP A;  2YSR A;  1U6G A;  4P9U A;  2CH0 A;  3FDY A;  2VKE A;  2DW4 A;  1KQ0 A;  4M3B A;  4BHB A;  3CUO A;  4ZZL A;  3QYE A;  3ZMV A;  2G9W A;  1DGW Y;  4DYR A;  2OZU A;  1D3Y A;  1JTY A;  2WBM A;  3DKY A;  1YX5 A;  3JTH A;  3GFL A;  5GAG J;  3GFJ A;  3MKW B;  3EUH A;  3JAM Z;  4E7K A;  2F5V A;  1O3S A;  3L00 A;  3I54 A;  3IH2 A;  5ICG A;  3ZQH A;  3K2Z A;  2TDX A;  3H1C A;  2XKO A;  3PJR A;  2X4H A;  3PNV A;  4OIN F;  3T5X A;  2Z2S B;  3OSF A;  1BI2 A;  1O57 A;  2O7O A;  4B09 A;  5ICE A;  2R92 J;  1X1C A;  4M73 A;  5K5Q A;  4KN7 X;  2QUF A;  1ACI A;  1Z67 A;  2P0W A;  4WXD A;  4XMY A;  1KZH A;  4EM0 B;  1HST A;  2ESN A;  4FIS A;  3TGN A;  1OR7 C;  2XF5 A;  4F52 A;  5GTI C;  5IPA A;  3FBI B;  2FQ3 A;  4ASN A;  4Z2Y A;  1UHS A;  2M0C A;  3G73 A;  5A2Q K;  2DK8 A;  1ZG1 A;  3BG6 A;  3HOX J;  4A3F J;  3OWT A;  1LFB A;  1R00 A;  3V8K A;  3MEX A;  3LWF A;  4I98 B;  1G4D A;  2R5Z A;  3G2B A;  1JKO C;  3TP3 A;  1U8R A;  5E1W A;  2NVU B;  1XGN A;  4FE4 A;  2LY9 A;  1ON2 A;  2J5P A;  5A2Q Z;  2M7A A;  3WGH A;  1S7O A;  3DQV C;  1P6R A;  1IN8 A;  5F6F A;  2R7V A;  1RRJ A;  2X85 A;  4IHX A;  5K7Z A;  4HZF A;  2HOE A;  5KVR A;  1W5T A;  3GF2 A;  2LG4 A;  1PUF A;  2HOA A;  3REO A;  2GA1 A;  2DJI A;  3ESW B;  2BXY A;  4LK1 F;  1HLV A;  3DLL F;  1VND A;  3HYI A;  4BHC A;  3U9G A;  1P9Q C;  5EGO B;  4HQM A;  4EQQ A;  3KLN A;  4V2G A;  3A02 A;  3ISP A;  2DQR A;  3BQY A;  3B6C A;  4RM3 A;  1MBE A;  3BJ6 A;  3GXO A;  2L0K A;  1P7I A;  2IGM A;  4ENN A;  1I27 A;  5LRS A;  5GAD J;  2X48 A;  3A4C A;  3F0C A;  5J8C A;  1FP2 A;  1WJA A;  3I4M J;  5C44 J;  2KZV A;  4M3D A;  2VB6 A;  3DU6 A;  1T98 A;  1UHW A;  2DBB A;  3RYR A;  3BWG A;  2FOW A;  3TMO A;  1TZL A;  5M5X J;  3P9K A;  5C4J J;  2IS2 A;  3F9K A;  3K10 A;  1YJW I;  3JRE A;  3T8R A;  3S3N A;  3RKQ A;  3WGG A;  3SJM A;  1QHG A;  4CO8 A;  4IVN A;  4IQ4 A;  1FOW A;  5EEA A;  2AQE A;  1JJ6 C;  3KLO A;  1E3P A;  4BUP A;  5IT9 K;  1RNL A;  3PIP F;  1WJ5 A;  2A6T A;  3G6E I;  1MMD A;  1GXP A;  2VL8 A;  1SD5 A;  2EK5 A;  5D6E A;  2LRE A;  5DDG A;  4B4C A;  4P9F A;  2CW8 A;  1U9O A;  4KIF A;  2L2O A;  4XKB A;  4FET A;  1QHH D;  1TWH J;  3SDG A;  3D1N I;  3J7A O;  4HV6 A;  4A6E A;  4BL0 B;  2P8T A;  5FRN A;  3RQ4 A;  2YX4 A;  2WV0 A;  1KU3 A;  1UZC A;  4RGR A;  4A0Y A;  3CME I;  2JUC A;  2KHM A;  4B43 A;  3MKY B;  1EH8 A;  3OYM A;  1BI1 A;  3K4B A;  1B1B A;  5E1Z B;  5D8K B;  3DKX A;  2VOD A;  5IYD J;  1BIB A;  4A3G J;  2AQF A;  2HWV A;  3R61 A;  1B9M A;  3K4J A;  1MJ9 A;  3DXJ F;  5FFX A;  2ME0 A;  4U87 A;  2H94 A;  4AIH A;  1JGG A;  1EF4 A;  2KPM A;  3GEZ A;  1I1G A;  4E6K G;  3RKW A;  4CUG A;  2V26 A;  3ASN H;  3W3C A;  1J0R A;  5TIS C;  3H0D A;  2IJL A;  3DEW A;  1E3H A;  2M7B A;  2MLK A;  3HSF A;  4C30 A;  1W0U A;  3N97 A;  2XGC A;  2E1N A;  3K70 D;  2VQL A;  2P5V A;  3HUG B;  2X6X A;  3VYU B;  1SMY F;  4CIC A;  3JRG A;  4BDZ A;  4RB2 C;  2JT1 A;  2KIF A;  1TWC J;  2ID3 A;  2RRE A;  4DJA A;  4ZYG A;  2A5W A;  3E5U A;  2VQG A;  5BPD A;  3GTQ J;  3S15 J;  1D0Z A;  3QQA A;  3M8J A;  4RGS A;  4DQ2 A;  1G3T A;  3FIW A;  5EZH A;  5BMZ A;  1T2K A;  1G6N A;  4GFB A;  1RES A;  5J40 A;  1UG0 A;  2ETH A;  3SXY A;  2KZG A;  2K3P A;  3VWB A;  3L7W A;  2K7L A;  1RR8 C;  3H92 A;  3J7A Y;  4LLG F;  3FXM A;  1XN7 A;  4U7D A;  3KET A;  2FOK A;  1LFP A;  5CQG A;  3H9G A;  1ZN2 A;  4CGZ A;  2EIJ H;  3LA3 A;  4DBQ A;  5HLG A;  3KPH A;  5ILV A;  5J47 A;  1IN5 A;  2DDA A;  3S2W A;  4B3X A;  3A0H C;  3A01 A;  3S1M J;  1T33 A;  4XLP F;  2BGC A;  1ORK A;  2OCE A;  5K1Y A;  2X1E A;  4CSW A;  2QQA A;  4UY8 I;  3JSP A;  1WVR A;  4YEL A;  1YIO A;  1EH7 A;  3GME A;  2JQ7 A;  4PJM A;  2RNG A;  2XKP A;  4I0B A;  4QPO A;  1XDU A;  2OPT A;  2DT7 B;  2DA3 A;  3OOU A;  2P5K A;  4G7Z F;  3GWZ A;  1LE8 B;  3RCO A;  3GTL J;  3SZP A;  5FKO A;  3IRR A;  2OUM A;  2FX0 A;  3LFK A;  3OYF A;  1GUU A;  1ODD A;  4L5J A;  5IP7 J;  2Z16 A;  3Q0U A;  4I2O A;  5ED4 A;  2PJP A;  1R5H A;  3DPT A;  3G71 I;  4R1H A;  4DBR A;  3CCR I;  3TO6 A;  3RQI A;  4L9J A;  1FIP A;  1IG7 A;  4B3A A;  1J7K A;  3OS1 A;  2KIQ A;  2HQN A;  2UXN A;  4PFP A;  1K6O A;  1ZHF A;  5FLX Z;  2ACJ A;  4L5E A;  2L7Z A;  4EJV A;  2KRC A;  1SMT A;  1TTY A;  1YJ9 I;  1HW5 A;  3E6M A;  1X3U A;  2MC4 A;  2W7N A;  2JK3 A;  3EUA A;  4KYW A;  4C2T A;  2K4B A;  3QAH A;  3M4O J;  2GAU A;  3LA2 A;  4WXC A;  2X6Y A;  3IP4 B;  1Z3Y A;  2YX7 A;  3CCL I;  1IZ1 A;  5B1B H;  4XN3 A;  2DA2 A;  2QWW A;  2CU7 A;  3C7J A;  4HX7 A;  5K5R A;  1TP4 A;  3A2K A;  4ZYE A;  3K9T A;  3V7R A;  2LLK A;  3HEF A;  2PJR A;  2DOD A;  1QBJ A;  1KU2 A;  4MGR A;  3EYI A;  4MFD A;  1QGP A;  4CYC B;  5E8G A;  4B44 A;  5GP9 A;  1QA6 A;  2DJN A;  3JRA A;  4X6A J;  5DCM A;  4IQJ A;  2R5Z B;  1Z77 A;  4A3K J;  2RVC A;  3D5L A;  5FB2 A;  1S6L A;  3A1Y A;  2A05 A;  2EV6 A;  3ELK A;  2LC2 A;  2H27 A;  2Q2E B;  3TBI A;  1I50 J;  2H8W A;  1YQA A;  3VYT B;  4HW0 A;  2VXD A;  1AHD P;  2KT0 A;  1JT0 A;  2HXI A;  4EV0 A;  2G7H A;  3S1Q J;  5IT9 Z;  2NAZ A;  2FJ1 A;  3CO6 C;  2GWR A;  4MQ9 F;  1I6X A;  3CES A;  4BJ6 C;  4JYK A;  2HXO A;  1XDS A;  4Q4Z F;  5LHI A;  3SDB A;  1VFC A;  4WXH A;  3GFI A;  2JJ7 A;  4ZTJ A;  1F1Z A;  1FYL A;  4U0V A;  2KDO A;  3NWT A;  3JW4 A;  3OMY A;  5F0C A;  2R7X A;  4PJL A;  2CFO A;  3V42 A;  1MNE A;  2XAU A;  1WGX A;  5E8I A;  3PIO F;  3CUQ B;  1FYK A;  3QPL A;  1OYW A;  2DMP A;  5IYB J; 
#chains in the Genus database with same CATH homology
 2BVM A;  2QKL B;  3BLY A;  2HVQ A;  1Y56 A;  2IGO A;  1Z21 A;  2M4K A;  2HDW A;  2LY1 A;  3SEZ A;  2X51 A;  4BU2 A;  2GOM A;  2R7S A;  4XOR A;  3CP8 A;  2CMP A;  4ZJZ A;  2DT6 A;  3AL0 C;  1WJB A;  4D1Q A;  2KP6 A;  4QPQ A;  2VJI A;  4E7I A;  2MD0 A;  3AFH A;  2R7U A;  4HST A;  2CV2 A;  1YE9 A;  4HPQ A;  1VZ0 A;  3VSL A;  4NC7 A;  5TGT A;  1PJR A;  1G59 A;  4ANJ A;  4JOM A;  4LIT A;  3HG9 A;  3D5R C;  1GLN A;  5HOO A;  3E1S A;  4E7H A;  4RLF A;  2K9L A;  5JHF A;  4HNU A;  2M0M A;  4BQN A;  3SZG A;  3L2U A;  4J01 A;  5HNF A;  4B47 A;  2IXS A;  2VJ5 A;  4KJZ A;  3CJQ B;  3CMM A;  2VKD A;  1BR1 A;  4PUS A;  1X1A A;  1J09 A;  4XOP A;  3LFU A;  2JVH A;  4J00 A;  3EPZ A;  3HXL A;  2ELJ A;  4AU7 A;  1R6R A;  3OYK A;  3OR1 C;  2DXI A;  2V6E A;  4XKW A;  4HRI A;  2LYC A;  2XF6 A;  4GRI A;  1D1C A;  3NWS A;  2CUJ A;  2CV0 A;  4E7S A;  3OS2 A;  4YEJ A;  4F3Q A;  5FRM A;  3IAM 2;  3LSM A;  2O5R A;  4ITV A;  1PYV A;  3CP2 A;  2QKM B;  4N4O B;  2CS3 A;  3OYC A;  3W2A A;  4PSX A;  4CCJ A;  2LBF A;  2ZSI B;  3K4M A;  4PFO A;  3I3L A;  2CUZ A;  4YRV A;  3H5N A;  4NNJ A;  2Z1D A;  4KIS A;  3BCA A;  2CW7 A;  2DOA A;  2IGK A;  4D9J A;  4NUB A;  4CCK A;  3OYI A;  1MMN A;  4PJN A;  3OYL A;  3W2V A;  1HA8 A;  3PFY A;  4CZC A;  1Z3X A;  3C2G A;  1MND A;  5LD2 C;  3H5R A;  3QOD A;  2DCE A;  4KT6 A;  2JSP A;  4LG3 A;  3PNY A;  4XLE A;  2KL4 A;  3ZRG A;  2R4G A;  2W00 A;  2CH0 A;  2PMZ A;  3FDY A;  3S32 A;  3QYE A;  1DGW Y;  3OYN A;  4C2U A;  2WBM A;  4U7B A;  2V7F A;  2VLA A;  3DKY A;  1YX5 A;  1SAU A;  2E1M C;  4XNF A;  2X6W A;  3W2W A;  3MKW B;  1N77 A;  4XKV A;  4E7K A;  1Y6I A;  2F5V A;  5KHD A;  3HL2 A;  2UWM A;  4BS9 A;  1V5G A;  3K6G A;  3H9Q A;  3PJR A;  2L9S A;  2V9K A;  5HNH A;  3PNV A;  3CJR B;  2Z2S B;  2IS1 A;  3TL4 X;  1X1C A;  3OYD A;  3SEQ A;  4XL9 A;  1W36 D;  2PJR B;  3U21 A;  3UR3 C;  2P0W A;  2HNH A;  1X4P A;  4Y3O A;  4XMY A;  2R7O A;  4E4H A;  4F55 A;  4P1W A;  3OYB A;  1OR7 C;  1YX3 A;  2W1O A;  2XF5 A;  4F52 A;  3FBI B;  3L2Q A;  4BAC A;  2F4I A;  1N75 A;  2R7Q A;  4IX7 A;  3ZR8 X;  4II3 A;  3BG6 A;  3OWT A;  2IS4 A;  2LBF B;  1Z7L A;  5HLT A;  2K9M A;  4IZZ A;  3H5A A;  3ZCO A;  4II2 A;  4AVZ A;  3G2B A;  3ZXS A;  2HZD A;  3KYL A;  4P5O A;  5LFA A;  4BJ5 C;  2M7A A;  3DQV C;  2WAD A;  2HPI A;  2BOL A;  4BE1 A;  2R7V A;  1NG6 A;  2WAQ A;  2X85 A;  3LSH A;  2VIX A;  3VDX A;  1D0Y A;  2LG4 A;  4LIU A;  1X1B A;  4Y4R A;  2DJI A;  4XR6 A;  2BVL A;  2X1D A;  1KON A;  1LDK B;  2KQR A;  2KRH A;  3OYJ A;  4FAS D;  3L2R A;  1TT0 A;  3BG7 A;  1W36 C;  4XOT A;  1U0J A;  3PUB A;  4PJJ A;  1LVK A;  1P9Q C;  2V1N A;  4DGW B;  2CV1 A;  3N05 A;  3DTI A;  4XQF A;  3PL8 A;  1BR4 A;  2VQC A;  4NQW B;  4RMN A;  3PNT A;  4RM3 A;  1WFX A;  2X1C A;  3S93 A;  1X19 A;  2W82 A;  3OYE A;  2E1M B;  4EAT A;  2IGM A;  4RM2 A;  4F91 B;  4BXF A;  4XLA A;  4E7J A;  1DQU A;  3A4C A;  1WJA A;  2HU9 A;  2R7R A;  3PSF A;  2KZV A;  1DP3 A;  1IRX A;  4XON A;  5FRO A;  2XSJ C;  2VB6 A;  3DU6 A;  3CF2 A;  3TMO A;  4BQQ A;  1TZL A;  4XKC A;  3S8P A;  2F6C A;  4BEH A;  2IS2 A;  1WJF A;  2ZXH A;  4ZTF A;  3F9K A;  3K10 A;  2WAE A;  1MW7 A;  2RQQ A;  4CH7 A;  3S3N A;  4ZDL A;  3K4K A;  3K4N A;  1QHG A;  2HQA A;  5CPR B;  4IQ4 A;  3D5S C;  2AQE A;  3HPH A;  4BUP A;  4H4K C;  1E0E A;  3DEE A;  2KMU A;  4ZDP A;  3HOT A;  1WJ5 A;  2A6T A;  3HKZ A;  1MMD A;  2VL8 A;  2OC6 A;  3LSG A;  5CQE A;  3GBG A;  2LRE A;  3LMM A;  2CW8 A;  4LIV A;  2L2O A;  2VAS A;  4FET A;  1QHH D;  4XKB A;  3RPU D;  4BL0 B;  2L9N A;  2V4J C;  4C9Y A;  5FRN A;  3VSK A;  4ZC3 A;  3RQ4 A;  3HC7 A;  2ZFU A;  2I8D A;  2LRD A;  3LSI A;  2KHM A;  4B43 A;  3MKY B;  3OYM A;  3K4B A;  2NOJ B;  2VKH A;  3DKX A;  2AQF A;  3QYF A;  3VYR B;  3K4J A;  4MLO A;  4U87 A;  2LY2 A;  3S3O A;  3OS0 A;  2KPM A;  4E6K G;  4CUG A;  1MMG A;  2V26 A;  4HSR A;  3W3C A;  2VPL A;  3H0D A;  2M7B A;  4C30 A;  2XF7 A;  3K70 D;  2VQL A;  3LL7 A;  3HUG B;  3OYA A;  2X6X A;  1NG7 A;  3VYU B;  3MKZ A;  4E7L A;  1T95 A;  3CZ6 A;  3BCB A;  4BDZ A;  2WB1 A;  4DJA A;  2RRE A;  2MAB A;  2UUZ A;  2R7W A;  4CA0 A;  2A5W A;  1WJE A;  2Y0S A;  2VQG A;  4HEA 2;  1D0Z A;  4BGD A;  3M8J A;  4OAZ A;  2JVG A;  2W4S A;  4XN0 A;  4CCN A;  2VQH A;  1UG0 A;  3K4L A;  1WJD A;  4KIT B;  1ZEL A;  3ZQQ A;  3QYB A;  3VWB A;  2K3P A;  1V5E A;  3J7A Y;  3OYH A;  4CCO A;  2WY7 Q;  1WJC A;  1LFP A;  5CQG A;  3H9G A;  4BEH B;  1X1D A;  4DBQ A;  3QOE A;  1UAA A;  2XC7 A;  2HVR A;  3EUK L;  4CCM A;  2ZSH B;  5CKT A;  3AKZ A;  3UNG C;  1G8X A;  4B3X A;  3BC8 A;  3M1C A;  3I9V 2;  3FHN A;  4BJT A;  1FMW A;  4NC8 A;  1BOB A;  4BE0 A;  2X1E A;  4CSW A;  3SYT A;  4F93 B;  3OYG A;  2BW3 B;  4YEL A;  3C2H A;  4E7Z A;  3DLA A;  3DPU A;  4PJM A;  2MFZ A;  1OLT A;  2VJJ A;  2RNG A;  2L7K A;  1SFK A;  1T0F C;  1D1B A;  4QPO A;  2DT7 B;  3OOU A;  2HVS A;  3FKJ A;  4ZYA A;  4BDY A;  4XLF A;  3RCO A;  2E5N A;  2M3A A;  2OUM A;  2IGN A;  3OYF A;  2HPM A;  3OL3 A;  4PK4 A;  2Z16 A;  4N4N B;  3HOS A;  3DPT A;  1D0X A;  4DBR A;  4OWR B;  3DPL C;  4HNT A;  3OS1 A;  2FUG 2;  3VYS B;  2WA0 A;  4PFP A;  3MMY B;  4IKF A;  2XDV A;  4BE2 A;  2K5C A;  3LSK A;  1AA7 A;  3ONQ A;  2KRC A;  3OIQ A;  4OAY A;  1N78 A;  5KNL A;  2MC4 A;  2W7N A;  2R7T A;  1DGR M;  1LKX A;  3K4C A;  3EUA A;  3AL0 B;  4DIQ A;  2GOX B;  3E0J B;  3ZGK A;  4ZDO A;  4C2T A;  2KLO A;  2JUG A;  2X6Y A;  3IP4 B;  3K70 C;  1QU3 A;  1Z3Y A;  4XN3 A;  3MD2 A;  2LH9 A;  5KCM A;  3A2K A;  3FBN B;  3PSI A;  2ZXI A;  3RTR A;  4X0G A;  2PJR A;  2E60 A;  4CCL A;  3KEY A;  2IS6 A;  4XLC A;  1D1A A;  1UEL B;  4Y33 A;  2E5Z A;  4RLQ A;  4B44 A;  2LOO A;  1JI8 A;  1V5F A;  4HG2 A;  4B48 A;  1K6Y A;  2OV7 A;  2VJ4 A;  3L2W A;  4F92 B;  1X4O A;  4IQJ A;  1BR2 A;  1FMV A;  2Q1Z B;  3D5L A;  3H9J A;  1EA3 A;  1ERD A;  3A1Y A;  2LC2 A;  2Q2E B;  3TBI A;  2JA2 A;  2UV1 A;  3DTE A;  3VYT B;  4R79 A;  2VXD A;  3OR2 C;  3RSN A;  4XM3 A;  4DOZ A;  3HPG A;  3DTK A;  3L2V A;  3DWL E;  4G6T B;  2WAF A;  3KX2 A;  1MMA A;  1S9H A;  3CES A;  4BJ6 C;  3IUO A;  3S3M A;  3DU5 A;  3SDB A;  4ZTJ A;  2M4G A;  4BQO A;  4AYB A;  3OIP A;  3OL4 A;  4JQF A;  2KDO A;  3H35 A;  3NWT A;  3OMY A;  2BW3 A;  2MYS A;  2R7X A;  4PJL A;  2VXZ A;  4XLH A;  2CFO A;  3V42 A;  4PSW A;  1MNE A;  3OY9 A;  2WY8 Q;  3EUH C;  2XAU A;  3IAS 2;  5HVQ C;  2L5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...