2ECCA

Solution structure of the second homeobox domain of human homeodomain leucine zipper-encoding gene (homez)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
GSSGSSGKRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Homeobox and leucine zipper protein Homez
publication title Solution Structure of the second Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)
rcsb
source organism Homo sapiens
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eccA00
1P7IA 1K83J 2K9NA 3LOCA 1JJ8C 3NARA 4B3AA 2YUSA 2LVSA 3I4NJ 2NVYJ 4MFEA 3BR5A 3LNQA 2B63J 3UKGA 2GBYA 1TC3C 1JKPC 1FJLA 1AHDP 3HBLA 3ZQHA 3JRHA 3ZQLA 1ETQA 3WHCA 1MNMC 2L7MP 3FIWA 1B72B 2HXIA 2M8GX 3JRBA 2CQXA 2EH3A 2COBA 1PUFB 5M3FJ 4IHYA 2VKVA 1LE8A 1MSFC 2HOTA 1DU6A 2G0EA 1ZTRA 1B8IA 1P7JA 2ZB9A 1MH3A 3JRIA 3SDGA 2ID6A 4W1UA 3BTLA 5EGOA 4A93J 2L9RA 4W97A 5GP9A 3JRGA 1S7EA 2HYJA 4MO7A 5F08A 4QIWN 5EDNA 4UUTA 1IC8A 5IYDJ 1X2MA 2DA6A 4M3EA 3RKQA 1LFBA 3HOUJ 4XRSG 4A3CJ 3DCFA 1FEXA 4QTRA 3GTGJ 3BR2A 3HKZN 4FCYA 1SFOJ 4B4CA 5C44J 1OCPA 4FE7A 5BNGA 1ZR2A 3LSJA 1JJ6C 3CDLA 1IDZA 4RBOA 1BJZA 3TW6A 3OIOA 2ME0A 4A3DJ 2IBDA 3S14J 1H8AC 1XS9A 2CQQA 1ETKA 1RETA 5E3OA 3ZQFA 2YS9A 4D7MA 4DZJA 1ITYA 4M3BA 3FK7A 5E3NA 1JGGA 2XGEA 1MBKA 5IOYA 5C4XJ 2EZKA 2CJJA 1AU7A 5F1JA 3S16J 3LSRA 1IUFA 2X9DA 4D5CA 4X6AJ 1QRYA 2HXOA 1ZR4A 1D5YA 1JUPA 5EEAA 4AUXA 4Y7NJ 1IJWC 5K7FA 2EBIA 3C2BA 3BR3A 4A3IJ 2Y0SN 1K61A 1HLVA 5M5YJ 5EG0A 4FISA 1ETVA 3S2DJ 3HOWJ 1VNDA 9ANTA 5EYRA 2HOSA 1ETXA 2LFBA 1Z0XA 3BG9A 4A3KJ 4B1RA 2D5VA 3HDDA 4D7NA 2R5ZA 2WV1A 4CYCA 1JTYA 3BG3A 2Y31A 1OFCX 1HOMA 2FJ1A 1XC5A 4V2GA 2Y9ZA 5DTDA 5IP7J 2KDZA 1I3QJ 1ZGWA 3BR0A 5E3LA 4XICA 2R93J 2DJNA 4IHVA 4A3MJ 2JA5J 1GV5A 2QCOA 3G1OA 2CUEA 4BY7J 5IYCJ 2M9HA 4X1EA 1MBGA 3CCYA 5IOZA 2E2IJ 2DA1A 3DEWA 3G1MA 1UMQA 1QPIA 4C3JJ 1TWCJ 3JRCA 3A01A 1LE8B 2CU7A 4AC0A 4BBRJ 2IEKA 3PM1A 3G1LA 4MFDA 5GPAA 4XRSA 4MIMA 4UUSA 1B8IB 3S17J 1GVDA 2O7OA 4A69C 4M6VA 2DA2A 2AO9A 3IH4A 5IYBJ 5EGOB 3TP3A 3OSGA 2GLOA 4DYRA 1VI0A 2O8KA 1WH7A 3K7AJ 4IHXA 3PO2J 3WHBA 4J19A 3H0GJ 4MLOA 1U9OA 5HODA 2DA4A 1YRNB 2DA5A 2XB5A 1UHSA 3K2AA 3ZQGA 4Y52J 1E3OC 1ZK8A 1BL0A 3HOZJ 3H3VK 2E2JJ 1GV2A 1WCMJ 5F0HA 3BT9A 4GFBA 3JRFA 4A3GJ 2RAEA 4V2FA 3JR9A 3L1PA 5FJ8J 2Y9YA 2OPTA 5JLXA 3CQZJ 1ENHA 2M0CA 1ETWA 3ZQIA 1RESA 3LSGA 1MBJA 2N8GA 2HI3A 3GBGA 5J3LA 1TWAJ 2E2HJ 1ETOA 1JT0A 2M2EA 1GT0C 3D1NI 4LOCA 1WH5A 4S0HB 2NVXJ 5J1UA 2EZLA 5F04A 4DZPA 1BW5A 5EZGA 1RPWA 5F0CA 3GTMJ 5EG0B 3BTIA 5M3MJ 2H1KA 1NK2P 4IHWA 4D5FA 2GM4A 3GTLJ 1POGA 3HOYJ 1T56A 1Y1WJ 5M5WJ 3FK6A 2R0QC 2R5YB 3JREA 2H8RA 2ECCA 1X2NA 3HB9A 4C2MJ 3GTJJ 3HOVJ 1QVTA 4CYCB 2XRLA 1W0UA 1ZKGA 5K7ZA 2LY9A 4DW6A 3HOXJ 2PMZN 2IAIA 3LSPA 1R9TJ 3HGGA 3SJMA 2XPVA 3QPSA 3TP0A 3BR1A 3MN2A 3IV5A 3S1RJ 4BBSJ 1DU0A 3MVPA 1WPKA 2JJ7A 1O4XA 1G2HA 5M5XJ 2TRTA 1MBEA 5JLWA 2I10A 4NDLA 2DMTA 4A3BJ 3CMYA 5C4JJ 2WB1N 1VF9A 2L0KA 5EF6A 1JUMA 1JT6A 2XGCA 1SANA 2L7FP 3VPRA 3GTPJ 2JA7J 5FLVA 1AKHA 3S1QJ 2K9SA 4M3GA 3BR6A 2HOAA 2LD5A 1APLC 3JRDA 3A01B 1U8BA 3GTKJ 2FX0A 1RKTA 2XPUA 1VFCA 4JX5A 4UUSB 1UG2A 2Y30A 1T33A 4FTHA 4JP0A 2FD5A 2LR8A 3B6CA 1F36A 3O8HA 1IG7A 3BQZA 1TWHJ 2DMNA 2E1OA 1NTCA 1A6IA 1JKRC 1CQTA 3Q0UA 2JN6A 2ECBA 5F27A 2DN0A 2JA6J 3RQIA 2JK3A 2QF7A 3GTQJ 2AHQA 2R92J 1MBFA 3F0CA 3TEDA 1I6HJ 2ELKA 4JX4A 4JX6A 4DYCA 4I6ZA 4L5EA 3RZOJ 2K40A 3BQYA 4XK4A 1NK3P 2VPRA 3IH3A 2DA7A 3FISA 5FKKA 3S1NJ 2W48A 3MKLA 2EQRA 1IGNA 3PO3J 2VUMJ 4BXXJ 2XGDA 1OCTC 2XSDC 5K7HA 4XRMA 4A3LJ 4AYBN 5FKLA 3HGYA 3E7LA 4BKXA 1LFUP 1IRZA 1JKQC 2ME6A 1FTZA 2LP0A 4C3HJ 2DTZA 2FQ4A 1HDPA 3BTCA 4A3FJ 1QVUA 2EZHA 1JKOC 3A02A 4QSHA 1A5JA 3I4MJ 1F43A 5F0FA 2E19A 2Y2ZA 4BY1J 5FLMJ 1XG1A 5FKNA 4M3DA 1B72A 5DS9A 2OF7A 1EF4A 2HQ5A 3O8GA 1YRNA 4ABZA 3Q0WA 1PUFA 5IP6A 3S1MJ 5J1RA 1FIPA 2X6OA 2NVTJ 2L7ZA 4A3EJ 2K9QA 2TCTA 1IV6A 3GTOJ 1BA5A 1MSEC 1X58A 1JTXA 1TWGJ 2R7ZJ 3W6VA 2DMQA 5FKOA 1HF0A 1WI3A 3B6AA 4FE4A 1OJLA 5IPAA 1GUUA 2R5ZB 4I76A 3JRAA 1AKHB 2DMUA 5GPCA 2DMPA 4C3IJ 1WGXA 2CRGA 2NS8A 4A3JJ 3NAUA 2XPWA 3BTJA 1ORKA 2NVQJ 2YU9J 1W0TA 1HDDC 2MSYA 1MH4A 1U78A 1TWFJ 1H89C 3SFIA 3HEFA 4EEFG 2LTPA 1RKWA 2KT0A 3S2HJ 2MW8A 5FKMA 1IDYA 2VKEA 1H88C 5EZHA 3A03A 2O9LA 5E3MA 2MGQA 1ETYA 3IH2A 3OOUA 3ZOBA 4G12A 3M4OJ 2NOGA 3ZQCA 2EZIA 1RR7A 2JA8J 2R5YA 5J1YA 4IEJA 3S15J 2NS7A 1MBHA 2P81A 3BG5A 1Q1VA 1U9NA 1BW6A 3QQAA 5C3EJ 2LK2A 3QPLA 2X48A 2VI6A 1Z77A 1ZQ3P 2ID3A 3M3YJ 1GDTA 4DYQA 1FIAA 1JUSA 4JYKA 1HCRA 3TW7A 4M3FA 2LKXA 3HM5A 2MG4A 2XB0X 1I50J 3Q0VA 2CUFA 3RZDJ 2DA3A 2LLKA 2M34A 2JMWA 4HNVA 2HDDA 2WAQN 1FTTA 4XIDA 3OSFA 4RDUA 3FKIJ 2JWTA 1Y1VJ 5IP9J 3Q3SA
chains in the Genus database with same CATH superfamily
1P7IA 1K83J 2W1OA 3LOCA 2DFFA 1OCZH 3NARA 1SD4A 3FM5A 1G3WA 2MH2A 1VQ4I 2PJRB 4G7OF 4XN3A 1UELB 4HDVA 1WI9A 2DI3A 1AWCA 3QYBA 2LY1A 5ILSA 3OWTA 4L9TA 4UY8I 1DPUA 1I3AA 1FJLA 4J00A 1V3FA 2M45A 5CVJA 3HBLA 4V19K 5LGTA 3ML6A 2YX7A 1ETQA 3P7NA 3G4SI 3ZQLA 5JVTA 1T39A 3ZR8X 1SC7A 2R7TA 2GA2A 4CUGA 3OYKA 2L7MP 3F8FA 4G6QA 4D0PA 2DAOA 4MHGA 1VQOI 4EJWA 1G8XA 4XSZF 2JVGA 1B72B 1PUFB 1PVEA 4WXCA 3ZQ7A 4IHYA 3KP3A 1LE8A 3BPVA 2O03A 1OPCA 2MFZA 3HHGA 2V1NA 4C9YA 1B8IA 2CV1A 5D6EA 2RNJA 1E2XA 4P55A 5DEQA 3WTTC 4L9JA 1MH3A 2ID6A 5FROA 1XN7A 5BMZA 1W5SA 3W2WA 4EV0A 1JHFA 5CKTA 3QYFA 5GP9A 4MEXF 3KP6A 4UV9A 5EDNA 3BOQA 3SFZA 5IT3A 1IC8A 2UWMA 1NG7A 3FHZA 2RREA 1UHMA 2CS3A 2IW5A 2NS0A 4A2UA 4WCGA 1LFBA 3RKQA 4XRSG 1FEXA 2AS5F 3H5NA 2KIFA 4FCYA 1SFOJ 4B4CA 4C2TA 1FNNA 4FX4A 3RCOA 2R3SA 2E34A 1X1AA 2X51A 2ME0A 2HDWA 4EQQA 1MGTA 2VJ4A 1XS9A 4J01A 1XCVA 5IT9K 1ETKA 1RETA 3J80K 2O3FA 3FHNA 2B9SA 2MC3A 3ASNH 4KIGA 3HUGA 1U5TB 4M3BA 2WWYA 2MABA 4Q48A 3GLXA 4F91B 1O3QA 1LVAA 5HLHA 5C4XJ 2EZKA 2CJJA 4QPQA 2QA4I 3LSRA 2X9DA 3W6KB 2E1CA 4C2UA 5ICGA 5LHHA 4PJLA 4ESBA 3CJQB 1PDNC 2HR3A 3OYGA 1D5YA 2F48A 1YS6A 4U88A 1SAXA 3K4KA 2EBIA 4D9JA 2IA1A 2W84A 2Y0SN 1K61A 2DQRA 2VT3A 5EG0A 2CV2A 5KNLA 3S2DJ 3QP5A 4ZYEA 3SQNA 2R4GA 2EJRA 1SMTA 1Z0XA 2LSOA 1QZZA 1XDSA 4L9VA 5EEHA 1IO2A 3GO5A 3CJTB 2D5VA 1E3PA 2WV1A 3QOPA 4CYCA 1VQKI 4ZZDA 2FJ1A 3HL2A 1TNSA 2DOFA 1QQIA 3J7YJ 5DTDA 2FRHA 2KDZA 1YIOA 1MIJA 3RJPA 2R93J 2PQ8A 3KIOA 1W5CC 4XKVA 4DIQA 2TDXA 5K1YA 3GFIA 2QCOA 1X3UA 2CUEA 4BY7J 5LBQA 1FYMA 2M9HA 2X6YA 3CMYA 3DEWA 2KIQA 5GTIC 1W7PB 3G1MA 2IRFG 2HVQA 4C3JJ 2P5LC 2BW3A 3I5UA 2R7WA 1LKXA 4MNUA 1YE9A 1DQUA 3KETA 4E4HA 4UVBA 4AC0A 4BBRJ 1K4TA 2FMYA 2YU3A 3W2VA 3K0LA 1BIAA 1PP8F 1K78A 3P5JA 5LRSA 1T8IA 1T38A 3GF2A 3TP3A 1ZHFA 1VI0A 1DDNA 1WH7A 1G59A 2VBZA 4IKFA 1XMXA 4XOTA 3H0GJ 5HOOA 4MLOA 1TT0A 3F8CA 4IOCF 1YRNB 4O3MA 3ZQGA 4I09A 2DTRA 2ZMEB 1FOKA 1E3OC 2D2WA 2VJJA 2NAZA 5H20A 1XMAA 1LDJA 3I54A 1VQ8I 3HOZJ 4HF1A 3T8RA 1WCMJ 2OU2A 1T95A 3CESA 2QZ8A 4CXFA 4RB0A 3DPUA 2CSOA 2KFDA 1IXRC 2G7HA 2Y9YA 3BG6A 5JLXA 3CQZJ 3O3KA 3C2GA 3ZQIA 1RESA 3LSGA 3SHFA 1JXSA 2PJPA 2XSJC 1I39A 3CUQC 4DGWB 3Q5FA 2RGVA 3HTUA 3FXUA 3PL8A 2HI3A 1P92A 1HW5A 1O3TA 2ADUA 1ETOA 2WADA 4XNFA 3ULQB 4KUMA 2OTLI 1GT0C 3BJ6A 3DTIA 3QPHA 3D1NI 1MDMA 2J5PA 4ETSA 2NVXJ 4L0ZB 1MNDA 2IS2A 1YW8A 4XLCA 1YX5A 4BJ5C 3ZPLA 3FXMA 3R6SA 1MJBA 4HX7A 2KL4A 2I5UA 3GTMJ 3FXQA 3IAS2 1NK2P 2ESHA 4IHWA 4D5FA 2GM4A 1POGA 4ENKA 1WJBA 2H6CA 4JQFA 5GTHC 1FSEA 2XRNA 4II2A 3FDYA 1XTAA 2V4JC 4C2MJ 3CJRB 3FXJA 1QVTA 2QENA 3LWFA 1FY7A 1W0UA 3HOXJ 2FA5A 3OS1A 3MCZA 1KYZA 2OAZA 3V7CA 1TZLA 1KU7A 3BR1A 4EM1A 3HSEA 4OIQF 2X85A 1O4XA 1G2HA 2KPMA 4LFUA 3OYNA 2ZXHA 5M5XJ 5ED4A 3JAMK 2TRTA 3K4CA 1YFHA 1MBEA 2I10A 4AVPA 4Z6YA 2DMTA 4A3BJ 3SEQA 2X6XA 5C4JJ 2ELJA 2JT1A 3KE2A 4LMYA 3HRUA 1HQCA 1WHUA 3F8NA 1VF9A 4ZYGA 3H3UA 5EF6A 3IRQA 2EPFA 3WODF 2XGCA 1JT6A 2L01A 3O2PE 2ZJQF 4HSTA 1SANA 1OMIA 1N77A 1OYYA 1XSDA 2JA7J 1AKHA 3S1QJ 2HQRA 4B47A 3V4GA 1O3SA 3L2QA 2LD5A 4IQJA 3HOSA 2OZ6A 1UAAA 3CC2I 2EB7A 2M3AA 1G6NA 4UUSB 1UG2A 3GUDA 3IAM2 3RPUD 2VXDA 4IOAF 4YFNF 1ZELA 2LREA 2Z5UA 4X0GA 3O8HA 1E3HA 3OYCA 2OQRA 2E1OA 1NTCA 3SZGA 1D1CA 2ECBA 2DOEA 1XX5A 4XBFA 3GEZA 2JK3A 2QF7A 2X6WA 3GTQJ 4XLFA 2AHQA 2NYXA 2R92J 1Y6IA 1HXDA 4F52A 4H0EA 2EFWA 2QEXI 5E1XA 1RUOA 4JX4A 2MD5A 2IGMA 2LG4A 4XK4A 4OAZA 1NK3P 3GZ6A 2K85A 5AONA 2W57A 5CVRA 3SZPA 3U1DA 2DA7A 2QYOA 1R23A 2F5FA 2ZXWH 4PZJA 3HG9A 3HRMA 2W48A 2E35A 4XLEA 2EWNA 2OCCH 4O6JA 1YO5C 4LG0A 4BUPA 4DOZA 1OCTC 5F64A 3WG7H 2XSDC 3R61A 5K7HA 3KYDB 2VQGA 5KHDA 5IY5H 5L3DA 1T08B 3L9FA 1LPQA 4A3LJ 3RTRA 3MZ8A 2IP2A 3E7LA 4I0BA 1D8JA 2HQAA 2W4SA 1Z1DA 3OYIA 2R7VA 2QLZA 3IP4B 5CJ9A 5JI6A 2V9PA 3ZCOA 3J81Z 2AQEA 2FQ4A 2KQRA 4NQWB 4D1QA 3AL0B 3S3MA 2DFIA 3BTCA 5GAEJ 5LEKA 4ZDPA 4CA0A 2GA1A 2ICWG 4HX8A 1BC8C 2V9KA 4HV5A 4QSHA 2XASA 1USTA 4AD9A 3I4MJ 5F0FA 1R36A 2E19A 4M73A 5ILUA 4BY1J 2D45A 1GLNA 2VIXA 1RC9A 2X1EA 5FKNA 2OF7A 3IC7A 3J7AY 4ABZA 1BIBA 5F1RA 3Q0WA 5IP6A 2V9VA 2NVTJ 3VDXA 3GTOJ 2K9QA 3K10A 5H2FC 2LBFB 2L2OA 4P9FA 1Y39A 3DBLB 1IN8A 1UFMA 3CP2A 4HNTA 1MSEC 1OKRA 3AFHA 4BYYA 3G3ZA 3OYLA 1XCBA 1JTXA 4PFOA 1RUNA 3GFJA 2A69F 2FOWA 2DMQA 3H92A 5FKOA 1FT9A 4YELA 4AVZA 2A5WA 2EA4A 4FE4A 2PI0A 2NOJB 5IPAA 3MMYB 2X1CA 1GUUA 4IPAA 6PAXA 2XV4S 3I59B 4I76A 1OYIA 1DP3A 1LEBA 2DMPA 4CZZA 1SAUA 2EINH 4ZYAA 1WGXA 2CRGA 2XAQA 1XD7A 5TRDA 2LMDA 4HQEA 4OMYA 1ORKA 1HDDC 2MSYA 3E5UA 5KAIC 3E6CC 1MH4A 4A5MA 4MQ9F 3RKYA 2CO5A 2OV7A 3BZ6A 1G3YA 3VEPA 1RI7A 2ZJPF 4XLPF 2VKHA 1IDYA 1H88C 1KU2A 3A03A 3VFZA 1YIJI 1FBSA 2ZFWA 3ZOBA 4G7ZF 2NVUB 4G12A 4BQQA 2NOGA 2EZIA 5TGTA 1LQ1A 2STTA 3EUKL 2L7KA 2Q0OA 4EJOA 3EETA 1A31A 2BY0A 2P81A 4BE0A 1U9NA 1BW6A 1Z9CA 2FXAA 5D5VB 3VYTB 2ID3A 1TP4A 3M3YJ 4DYQA 4EMSA 4F7ZA 4JYKA 4Y4RA 1HCRA 1R5GA 1X1CA 3QYEA 3LFKA 1SFUA 5LEJA 4LLLA 3W6JB 2XB0X 2BHZA 3Q0VA 2CUFA 3RZDJ 3ZN1A 3SYTA 1UCRA 4EM2A 3HZJA 2DA3A 1GXQA 2M34A 2EV6A 4XIDA 1YI2I 2Y75A 3S32A 4LITA 3K70D 4MGRA 4E7SA 5BPDA 4YFXF 3HRSA 4OIOF 1V55H 2K9NA 1JJ8C 4M9XA 2LVSA 4L5JA 2WC2A 4MFEA 4EGZA 3BROA 3BR5A 3LNQA 4CCMA 2E36A 2X4HA 4GXOA 1AHDP 3ZQHA 4CCNA 2JPBA 2VLAA 3WHCA 1UHWA 3AKZA 1MNMC 2MYSA 1IRGA 4NNJA 5EEGA 1RNLA 3MD2A 5FB2A 4RB3C 3VYSB 2W25A 3ERED 1IN6A 3B02A 3LAJA 1TL8A 2WAEA 3DBHB 5M3FJ 4IL6C 2HOTA 2KJCA 4CZCA 1DU6A 1IRFA 3VSKA 3EUHA 4RGUA 3JRIA 3SDGA 4W1UA 1G3SA 4F93B 4XONA 4A0XA 5EGOA 2KP6A 1ZN2A 4IRHA 4W97A 3GCMA 3K9TA 4MO7A 2JRMA 1D3YA 4UUTA 5IYDJ 1R58A 1X2MA 2DA6A 2VB6A 1WJEA 3KPHA 4A3CJ 3DQVC 2RNGA 1BI0A 3E97A 5C44J 1JJ6C 1WJDA 2K4BA 5GAGJ 1OYWA 3CDLA 2COMA 2H09A 2HDCA 3OYDA 3P9CA 1TNTA 1I6XA 3S14J 1I27A 2ZMEC 2CQQA 4PSXA 3TDUC 1STZA 3I55I 3DEUA 1FYKA 3OOPA 2UXXA 3PQJA 1FYLA 3MAJA 5AIPA 1W7PD 1BOAA 1ITYA 2DBBA 3KYLA 1IW7F 2BXZA 2BV6A 1QZEA 2XGEA 1S5LC 1MBKA 3O6BB 5IOYA 1R1VA 2W7NA 1ZH5A 5CQGA 3C2HA 3GXOA 3OS0A 2KZVA 2A05A 5CVUA 2LF7A 2K9LA 2KRCA 4HLYA 2VBWA 5DM7F 4G7HF 1AU7A 3S16J 1I1GA 4ITVA 1IUFA 4B48A 3N05A 3HTSB 1FMWA 1JUPA 5E8IA 4BAYA 1VQ9I 1TTYA 1TLHB 1HKTA 5M5YJ 2XGXA 3G2BA 4FISA 1ETVA 1GXPA 2G7UA 3VSLA 5GAHJ 1X1BA 1ZREA 1B9NA 2UUZA 3R0JA 2LFBA 5LGUA 3EYIA 4HW0A 4XORA 2VONA 2DFHA 3BG9A 1Z3YA 4KFCA 1IRXA 1B1BA 4OINF 4BXFA 3H9GA 2K86A 3ZQQA 2R5ZA 4FASD 2P4WA 2CQ7A 3H3ZA 4HX4A 3SEZA 1XC5A 2IVMA 1N75A 2Y9ZA 3M8JA 4RAZA 5IP7J 4Z2YA 3BR0A 3DLAA 2LKSA 2DJNA 1W36C 1XGSA 1GV5A 2BZTA 1VTNC 4BHCA 1BR4A 3KP5A 3OYFA 3CCYA 5IOZA 4ZDLA 2E2IJ 2VBXA 5KVRA 3V8KA 3EQLF 4WX9A 1KQ0A 4RAYA 5H6QA 3L2CA 1LJ9A 3NEUA 1PJRA 2XF7A 2OJED 5J4VA 1R1UA 4N9HA 3U9GA 3A01A 1ULYA 2W82A 3Q9SA 5J8FA 2CU7A 1LE8B 4KMFA 3DV8A 5GPAA 3V8LA 3MKZA 1B8IB 4YIRX 3CTAA 1GVDA 2O7OA 3U2RA 4M6VA 2DA2A 3CCRI 3CLOA 5IYBJ 2HU9A 2K02A 3PUBA 3OSGA 2GLOA 2Z33A 4IHXA 1V54H 1DPRA 3WHBA 2DFEA 1W36D 1U9OA 2DA4A 4XSXF 4NUBA 2DA5A 2XB5A 3K2AA 3T5XA 1SEUA 3K1NA 4Y52J 2P7VB 1ZK8A 2IGKA 1L0OC 2M7BA 3M8EA 2KISA 4MTEA 2Q2EA 1GV2A 3BT9A 3AG3H 1YJWI 3H5RA 3QP6A 3E6MA 1I1SA 4V2FA 2EFQA 2JUCA 2EIJH 1SVOA 3DWLE 3M7GA 1YG2A 3CCVI 2NNYA 3HUGB 2HWVA 1TT5B 4HRIA 3A0HC 4XLNF 4AM3A 1ONVA 4RB2C 3DKXA 2DPDA 4IX7A 3ZMSA 2E5NA 3GBGA 1R6RA 5CLSA 1TWAJ 3SXYA 2QSGX 3HRTA 3M07A 1F1ZA 5DD8A 2M1BA 4BU2A 3T1BA 2LDUA 2MD0A 3I64A 4U0YA 3G71I 4KIBA 2XAGA 4BJTA 3OIPA 1WH5A 5ICFA 4HAMA 4S0HB 5L3CA 2GXBA 5FFXA 2VC1A 2HTJA 3E6BA 4P1WA 5ERIA 1ACIA 5F0CA 3CF5F 4KNYA 2GXAA 5FO5A 5EG0B 5M3MJ 4I7HA 3GTLJ 2EILH 3HOYJ 5HS7A 1X4PA 3TOBA 1WRJA 1Y1WJ 2BGCA 2CW0F 5B1AH 2R0QC 4NHJA 2R5YB 2H8RA 1S7AA 3ZMVA 1Y8RB 1R5ID 1MMAA 1X2NA 2H94A 1MW7A 2FU4A 3DFGA 4KISA 3HB9A 3VB2A 2F5DA 3AL0C 4AIJA 5E18F 4CYCB 1ZKGA 2IAIA 3LAPA 3SJMA 2I8DA 2XPVA 5DD4A 1QBJA 3MN2A 2V1UA 3IV5A 3S1RJ 1DU0A 1WPKA 2JJ7A 1K6OA 4RM2A 4E7LA 2F4IA 2H6BA 5JLWA 3JTHA 3S2WA 3S93A 3PQKA 4B3XA 1JUMA 3RPQA 1I5ZA 2XAHA 3VPRA 1PP7U 2Q8KA 1XB4A 3GTPJ 2OTJI 2P6TA 4Y13A 2BW3B 2XF5A 3BR6A 1A6QA 3CC7I 1UG0A 3KEOA 1U0JA 2C6YA 4HPQA 3JRDA 1BI3A 2VQCA 3F22A 2ZC2A 2FX0A 4FETA 1X4OA 1RKTA 3BWGA 4JX5A 5A2QK 2A6TA 1A35A 1K78B 3MZYA 2XDVA 4A0YA 2RDPA 5KK1A 3WGHA 4BHPA 2FD5A 2O5RA 1R7JA 2QGUA 2L4AA 3B6CA 1F36A 2CGPA 3BQZA 4IF4A 2DMNA 1FLIA 4CHUA 2QQ8A 1A6IA 2YPRA 2CYYA 3CCEI 5DM6F 3HKZA 3MZHA 2DU9A 4JBAA 5E20A 5DCFA 2JA6J 5KAFC 3H36A 1FX7A 2L54A 2RKHA 1R71A 3RQIA 1SD5A 4EM0B 1GHCA 3HXLA 3F0CA 1FP2A 3TEDA 1EJ9A 1I6HJ 2R7DA 1OLTA 2KMUA 2XKPA 2FUG2 3WU1B 2HYFA 3EDPA 4L5EA 3RZOJ 2CFOA 4CCJA 3FBIB 4WF2A 4LG3A 3OYHA 3VWBA 2VPRA 4AIHA 5L3EA 3FISA 2PBIA 4XN0A 4P9UA 3N4MA 3S1NJ 3T8TA 4CCLA 2K9MA 3KX2A 3PO3J 2PMHA 1D5VA 1VQ6I 2XGDA 2HFHA 3GFMA 1MDMB 3PFYA 3H9JA 1ZRFA 2GAUA 2PFBA 1HBXG 1XGMA 2V6CA 1LDKB 2LKPA 2LRDA 3RKWA 1XGNA 2L5QA 2V79A 4ENNA 1LFUP 1HKSA 4XKWA 2IA0A 2BVLA 3LA7A 4N4NB 1KQ9A 1T6SA 3J80Z 4L0YB 2OZUA 3ZN0A 4II3A 1F9NA 5HDNA 1T0FC 2JRTA 1DGRM 3WTYC 3A2KA 2M87A 2LC2A 3ZGKA 3LSKA 4Y17A 5DUIA 1QVUA 5KCMA 1O3RA 5H6RA 3A02A 4RGXA 1F43A 4XKCA 5L3BA 2DT5A 4L18B 1MNEA 5TJJA 1XG1A 2WTEA 4WWCA 2PEXA 2HQ5A 1YRNA 3RQ4A 5HDKA 2DYRH 5J1RA 3ABMH 2X6OA 3K1PA 3L7WA 1ZLKA 4RLFA 2V1XA 3DF8A 5LGNA 4HBLA 2HTSA 1X58A 3IKVA 2R7ZJ 3V8JA 2GIZA 4RGRA 2L9NA 3QRFF 1WI3A 3I58A 5HLTA 1E0EA 4U7DA 3TO7A 1S8NA 5HS8A 1AKHB 4NC6A 1FC3A 2DMUA 2VJ5A 3MKYB 5D5UB 2OA4A 4C3IJ 3K4JA 5FLXZ 2CV0A 5GADJ 4M72A 3NAUA 2NNNA 3TOAA 1AA7A 3BTJA 3L2UA 4G8XA 3KZZA 1QA6A 2JVHA 2HKXA 1KYWA 4KT6A 3K4MA 4Q47A 2CWEA 4S04A 3ISPA 4BQAA 2W00A 4E7JA 4EEFG 2KT0A 3C1DA 2MW8A 3ZXSA 4ENJA 2VKEA 3FX3A 1VQLI 1ZG1A 3QU6A 3DEEA 4H4KC 2MGQA 1ETYA 2IGOA 3NWSA 3IH2A 1TQIA 5J8CA 4XQFA 2IXSA 3LQQA 1BI2A 3ZQCA 1RR7A 1JI8A 2GIVA 3IUOA 2NS7A 1XSVA 2VOPA 3DPLC 4AYBA 1Q1VA 3L09A 3BJAA 3QQAA 5L3FA 2X48A 1OCOH 2EFOA 3WTZA 4JK1X 1D0ZA 4HOBA 1FIAA 3LL7A 2Y48A 4CSWA 2CQNA 4M3FA 4U87A 2ZJRF 4CICA 2HPMA 4G94A 2E7WA 2ZJ2A 4PSWA 3H1CA 2PG4A 3UNGC 5D5WB 4ZC3A 2GZWA 1R4MB 3FZVA 2FE3A 4LG0B 4IRGA 1FTTA 3OSFA 1EH8A 4CCOA 2OBPA 1IAWA 1F4KA 3FKIJ 2JWTA 3GMEA 3FXKA 3Q3SA 1P4WA 4DNCA 2ACJA 2HNHA 3M8FA 4R79A 2M4KA 2YUSA 2P7CB 3SDBA 5JVGF 2NVYJ 3I4NJ 1P6RA 2A07F 3DKWA 4KDPA 1O57A 4XR6A 2GBYA 1TC3C 1JKPC 3ZMZA 2M8EA 3PFIA 1ON2A 1K7AA 2IS6A 1J75A 2V1DA 1MZBA 2MBFA 3JRHA 4I01A 3COAC 1KU3A 1EA3A 1KA8A 2PMZA 3WTUC 1VQ7I 3QU3A 1FOWA 1WSUA 1K6YA 2CQXA 3JRBA 1O7FA 3I0TA 3LSIA 4BEHA 3BDDA 4G6DA 2VKVA 3HPHA 4ON0A 1S29A 3M9AA 3S3NA 3F8BA 1IV8A 2ZCWA 1OCRH 2G0EA 2JPCA 3HC7A 3IHUA 2ZB9A 4BQNA 1YTYA 3W2AA 2Z99A 3DPTA 3GZ5A 2HEOA 3BTLA 1IN5A 2QKLB 2NRAC 2L9RA 3AG2H 1LEAA 4QIWN 3I56I 3TBIA 4PJ0C 3A1YA 1FSHA 2DLLA 2L3DA 3BR2A 3HKZN 1G3TA 5BNGA 2KZGA 2FEZA 1JE8A 1DP7P 3CO7C 1BJZA 3TW6A 2IT0A 4YIIA 4A3DJ 4Q5SF 5J40A 2JZYA 3U21A 4KITB 1H8AC 1YLFA 1E17A 5LRRA 2P0WA 3IWZA 2M4GA 5D6FA 2ISYA 2CFXA 5DV5A 3BP8A 4DZJA 4YFKF 3FK7A 4AIKA 5E3NA 3Q9VA 2ETHA 3CCLI 3CCSI 3QWLA 2K27A 2HYGD 2KRFA 1ZGJA 1Z7UA 5F1JA 4IJAA 1LDDA 2D1VA 3K69A 3LSHA 4D5CA 2E5ZA 2R7XA 1QRYA 2JSCA 3HSFA 3JSPA 1YJ9I 1ERDA 3SZTA 2WA0A 2R7OA 3NQOA 2VE9A 1IJWC 4Y7NJ 5K7FA 4GRIA 1MD0A 3D0SA 4DBQA 3C2BA 3P9KA 3BR3A 4A3IJ 4I99C 4B44A 1L3LA 1HLVA 1LNWA 3W3CA 2K3FA 5AIQA 3K70C 1MJ9A 3IKTA 4RAFA 1J0RA 1VNDA 2KRHA 5EYRA 4ZTJA 9ANTA 4PJMA 2PMUA 2HOSA 1ETXA 5D4SA 3BJOA 1U5TC 5JR3A 2FBIA 1IN7A 2JTVA 3S3OA 4L9NA 3KEYA 4QLCU 2QQBA 4A3KJ 3PSFA 1RR8C 2BYVE 1JTYA 3BLYA 4KYWA 1OFCX 4L5IA 4EJUA 1HOMA 1Z6RA 1TQMA 3OR1C 1BOBA 1ZGWA 2YSRA 3KLOA 1FOXA 3HYIA 1XMKA 5E3LA 2VJIA 1X3WB 4XICA 2R7QA 3G1OA 4M74A 1NH3A 2CG4A 1G4DA 2DDBA 2PN6A 4IZZA 4DQ2A 1WVRA 4BGDA 4XLAA 1UMQA 2DPUA 1QPIA 1Y8QB 1HSTA 3KCCA 3HIFA 3CMAI 4E6KG 2P5KA 3V42A 4HF0A 1KGSA 4E7KA 4F3QA 5D8KB 3S17J 2GQQA 5K5OA 4ZYDA 3DLLF 1SFKA 1ZRDA 2AO9A 3IH4A 3FXOA 5EGOB 2E1MB 1A04A 1M1EB 2IPQX 4DYRA 3WTVC 3K7AJ 2PLYA 3I9V2 4XM3A 2ISZA 4J19A 1VQMI 5E1ZB 4BQOA 2A3SA 3IRRA 2R7UA 1J7KA 4MEYF 4WXHA 3PIPF 4BACA 4I02A 3M1CA 3H3VK 3IWFA 2ZFUA 2EA2A 1DUXC 4GFBA 2IA2A 1YQAA 4KJZA 2RAEA 3JRFA 4A3GJ 3CUQA 2WAFA 3JR9A 3WE3A 1JGSA 5FJ8J 3FM3A 5HLGA 3BCBA 2HOEA 1KQ8A 2OPTA 1KU9A 3HHHA 4QPOA 2XROA 1ENHA 2OC6A 1ZRCA 2N8GA 2IS1A 1CF7A 4OIPF 3E5QA 5J3LA 2FNAA 3CP8A 2EV0A 1N25A 3OYEA 3FF5A 2WY7Q 1J2XA 2K5CA 1MMSA 1JT0A 1W1WE 4ZDOA 4LOCA 3WU0A 5J1UA 2VODA 5CPRB 3GVAA 2EZLA 5E79C 5F04A 4QWQA 1BW5A 1WZ2A 4RM3A 5EZGA 2DK8A 3BTIA 3ZP5A 2H1KA 4U0WA 2DT7B 2F5VA 2DW4A 4YEJA 4I2OA 1QZYA 2WAQA 3RIRA 4LB5A 1S6LA 3EYYA 3JREA 3TMOA 3KLNA 2DQLA 2BEOA 1FPQA 1KZHA 2ZO4A 4HSRA 3HOVJ 2CUJA 2QBYA 4HEA2 1YX3A 2XRLA 4N0BA 4CH7A 1BN5A 2LY9A 1Z6TA 2PMZN 5HNFA 3LSPA 1UJ8A 5FGMA 1UZCA 3QPSA 4ZTFA 3TP0A 3I4PA 1LUJB 2V26A 4BBSJ 4UV8A 4GCVA 2FSWA 2Z9OA 2A68F 2KIMA 1QPMA 3DP7A 3KFWX 1XGOA 3ABTA 1ZYRF 2K4JA 4R8HA 3LA2A 1QGPA 4M3GA 4HV6A 3CCMI 1BR1A 2HOAA 2HS5A 2STWA 3A01B 1U8BA 1JHHA 3GTKJ 4HZFA 2H1LA 3CF2A 3GWZA 5B3SH 1IF1A 1V5EA 2V7FA 3BG7A 4KICA 2HZDA 3B73A 2VC0A 4IHSA 2Z2SB 4FTHA 1H0MA 4HA8A 4JP0A 2LR8A 4N4OB 2HGCA 3RI4A 2IJLA 3A0BC 1UB9A 3Q0UA 1CQTA 2JN6A 3ELKA 4P96A 2DN0A 3BPXA 3E6DA 3FXLA 2P8TA 4A5NA 5LLQA 2WV0A 3RDIA 5JHUA 3KZIC 2XAJA 4A6DA 3CD6I 2B7EA 2RC4A 1MKMA 2Q2EB 4LK1F 1MBFA 1NG6A 1WJ5A 4C30A 4PGHA 2ELKA 4JX6A 1TQPA 4DYCA 3I3LA 3I71A 4DJAA 2RV8A 2K40A 2ZNYA 3CCQI 4GO1A 1VZ0A 3MQ0A 2O0YA 3CUOA 1X19A 3MKLA 3D5SC 1IZ1A 1J59A 2VKDA 2Y69H 1S72I 5DCMA 1X1DA 3JTGA 5ILVA 3HOTA 2CQKA 3V7RA 1TBXA 3D5LA 4BKXA 1JKQC 2FQ3A 2PJRA 2LP0A 3F72A 4E7ZA 3NWTA 2XAFA 5CYVA 3EPZA 4G6TB 3CJNA 2VT2A 1V4RA 3DKYA 4YG2F 1VQNI 4A3FJ 4IVNA 2EZHA 2LH9A 1A5JA 4P5OA 1B9MA 2Y2ZA 3NRVA 4GDFA 4RGSA 5FLMJ 4PUSA 1Z91A 1B72A 5HS9A 1SMYF 1EF4A 1D1BA 2VASA 3OV8A 4UB8C 1PUFA 2M30A 2TCTA 5E8GA 2MA3A 3K4LA 2LF8A 4AWXB 3F9KA 3CDIA 4IRIA 2XUBA 1TWGJ 4HG2A 5D8LB 4EJVA 2W85A 3W6VA 3T0YA 3B6AA 5FRNA 1OJLA 5D5XB 1EH7A 4LLGF 2YX4A 4CYDA 2Q1ZB 3JRAA 5GPCA 1Z21A 1HSJA 4IO9F 2J5OA 2CW7A 3ZMDA 4UHTA 2XPWA 3L2RA 1A36A 5EJCA 2YU9J 4NB5A 3LQRA 2QQ9A 1U78A 1TWFJ 1ODDA 3R0AA 4ZJZA 3OIQA 2VXZA 3HEFA 1SVMA 2VL8A 4OU0A 3L2WA 2H8WA 1HC8A 1BJAA 1HW1A 1V5FA 2FBHA 1RKWA 1U5TA 3PNYA 3S2HJ 5FKMA 1AOYA 5EZHA 2O9LA 5E3MA 3JCUC 3OL3A 2BE5F 5ICEA 2XC7A 2QSFX 3BY6A 3M4OJ 2KDOA 3CLQA 5DYMA 3FBNB 2R5YA 4IEJA 1CGPA 3S15J 2A6HF 1MBHA 2L9VA 2RQQA 2XVCA 2ZKZA 1R5HA 3MWMA 5C3EJ 5FLXK 2FNPA 1R1TA 1Z77A 2VI6A 1TW2A 4PDKA 2XAUA 1GDTA 3C7JA 1JUSA 2IS4A 3TW7A 1OR7C 1H9GA 2LKXA 3HM5A 5DDGA 3WTWC 4FQGA 3VYRB 4BH9A 1I50J 3GX4X 4GGGA 4A12A 4AIDA 1LVKA 3LA3A 1U8RA 2JMWA 4HNVA 3CMEI 2HDDA 2WAQN 3A4CA 2BOLA 3F8MA 2F5EA 4OMZA 3FMSA 3OR2C 3X2QH 2F2EA 3L00A 3OYMA 1XDUA 4B8XA 2BVMA 5IP9J 4UNOA 4UB6C 4BDYA 2AQFA 1LB2A 1Z3XA 4B3AA 2P6SA 1RZ4A 2VQLA 2B63J 4I98B 3UKGA 1R00A 4DBRA 2KHMA 4JOMA 2AXTC 3KZYA 2FBKA 1P2FA 4HDUA 1HA8A 2ZBKA 1YYVA 5LHIA 2GWRA 1W7PA 4NBQA 4YIFA 4MTDA 3FIWA 3PUFA 2HXIA 2M8GX 2QKMB 2EH3A 3WG9A 2COBA 5IT9Z 1EH6A 4Y3OA 1MSFC 2EIKH 1WJAA 1X3ZB 5HNHA 3FWEA 1ZTRA 1P7JA 2WB1A 1S3JA 2ZXIA 3GW2A 2GOMA 2BY2A 4M9SA 4PJJA 4A6EA 5E17F 2AXLA 1YITI 4A93J 2IGNA 3JRGA 1S7EA 1R4NB 2DODA 2HYJA 5F08A 2RQPA 3ABLH 4OOIA 4IXAA 1PUEE 4M3EA 3EUHC 3CMMA 1Q1HA 3HOUJ 3DCFA 3V7SA 4QTRA 4N9IA 3GTGJ 3IL2A 2ZMEA 2BY3A 2DCEA 1OCPA 2E1MC 4FE7A 1ZR2A 3LSJA 4CDGA 1IDZA 4RBOA 3KEQA 2LY2A 3ECOA 4Y33A 5CVIA 2HVSA 3OIOA 2FF4A 2VPLA 2IBDA 2ESNA 3ASOH 4WXDA 2LOOA 4LK0F 4ESJA 5JHFA 1Y56A 1XPXA 4XMYA 5E3OA 2QM3A 1BR2A 3ZQFA 3J81K 2YS9A 4LJZF 3WTSC 4D7MA 3DU6A 1DGWY 2DJIA 3KP4A 3RSNA 1FMVA 4GYIA 1GVJA 1KONA 3DTEA 5FD6A 1JGGA 2HVRA 3HPGA 4F55A 2Z1DA 2EK5A 2KIUA 3TDZC 3GFLA 1FBUA 4Q4ZF 1W5TA 1Y0NA 3S8PA 4X6AJ 2HXOA 4PGGA 3UR3C 1ZR4A 2EV5A 5E1WA 5EEAA 3TO6A 3OYJA 1WQ2A 3FKJA 4NC8A 4AUXA 3ESWB 1SVLA 5HVQC 5A2QZ 3PNTA 4UVCA 3PSIA 2BBYA 3OL4A 3ZRGA 3HOWJ 1J5YA 1WJFA 1QHHD 1YW7A 2DO7A 4BNCA 2F5CA 2WY8Q 1X1PA 3TO9A 3WTXC 4B1RA 3OY9A 3HDDA 4D7NA 3BG3A 2Y31A 3K4BA 5LFAA 3FMRA 4M6YA 3F21A 2MLGA 3F3XA 4V2GA 4KIFA 2LYCA 1I3QJ 2KJBA 4XKBA 4ZH4F 3CO6C 3OS2A 4IHVA 4ASNA 4A3MJ 4FT8A 2JA5J 1ON1A 2UV1A 5IYCJ 4X1EA 1MBGA 3ABKH 2DA1A 3K2ZA 1HKQA 4XOPA 3E1SA 4GYGA 2GOXB 2DOAA 1QNTA 4UXNA 1TWCJ 3GZNB 3JRCA 2G9WA 4LB6B 4BE1A 4NC7A 4ZYHA 1RRJA 3ECHA 2QVOA 4BEHB 3CCUI 2HQNA 1ZARA 2O8XA 2IEKA 3PM1A 3G1LA 4MFDA 4XRSA 3OYBA 4MIMA 1K79A 4UUSA 3WU2C 4A69C 5F6FA 4YRVA 4LIUA 4U7BA 2ELHA 3FMQA 2O8KA 1D1AA 2YR2A 2M7AA 3PO2J 1EV7A 5HODA 2F6CA 3AG4H 1UHSA 4KMUX 3VODA 5B1BH 2X1DA 4I0AA 4BXUA 4E7HA 1BL0A 2JA2A 3ABUA 2E2JJ 4MQVA 5F0HA 4OIRF 3L1PA 4ANJA 3ONQA 3D5RC 1QO0D 4LGWA 1V5GA 3M1EA 3H0DA 4XRFA 2M0CA 1SFXA 1ETWA 2VN2A 4PK4A 3OYAA 1MBJA 5J47A 1RIOH 1P4XA 2DYSH 3VOEA 2XHKA 3QAHA 3PNVA 1XSXA 2E2HJ 1LFPA 3C18A 2MH9A 2XIGA 3LSMA 3LSTA 3QODA 4FHTA 3RKXA 5B66C 2M2EA 2OQGA 4BE2A 1BI1A 2JQ7A 2OD5A 4KN4X 4U0VA 1VQ5I 2H27A 2CH0A 3LMMA 3R60A 3JAMZ 4DZPA 1J9IA 1RPWA 2A61A 3FXRA 1B6AA 1D0YA 2K3PA 4RS8A 2D1HA 3ERMA 4NQWA 1USSA 5K5QA 1T56A 5M5WJ 3FK6A 4OAYA 1ZLJA 3K6GA 3LFUA 2Y0MA 3R4KA 2JUGA 2ECCA 2L9SA 3F6OA 3GTJJ 2FMLA 5K7ZA 4DW6A 4UVAA 2R7RA 1R9TJ 3HGGA 2E7XA 4HYEA 2OCEA 4CGZA 4M71A 2O6GE 1YOVB 2LBFA 4IHTA 3GYHX 5LHGA 3MVPA 1QU3A 2QQAA 2QUFA 4K2EA 3ZMUA 4HF2A 3DU5A 2HPIA 2ZSIB 4NDLA 5J6XA 1MMGA 2L4MA 2WB1N 1PYVA 2L0KA 1T2KA 1OCCH 4LIVA 4HNUA 1IUYA 4BJ6C 5D4RA 2L7FP 5JFRA 3I59A 5FLVA 2K9SA 3CC4I 1APLC 2CMPA 3DTKA 4HLXA 3KYCB 4BHBA 3ZMTA 1P9QC 3JSOA 2XPUA 3OMYA 5LD2C 1VFCA 1OR7A 1B4AA 2A6EF 2Y30A 1T33A 4XL9A 1REPC 5FRMA 1P4AA 3F6VA 4RMNA 5FD5A 1IG7A 4RA2A 3BZKA 2V6EA 1TWHJ 4CO8A 4ESFA 1JKRC 1OISA 2ZSHB 5DUKA 2HKOA 1FBQA 4S05A 3BZCA 4TV7A 5F27A 4EATA 4E70A 5CQEA 1Z67A 5K5RA 2W24A 4EGYA 3L2VA 1YS7A 3H5AA 3N97A 3ROUA 1YW9A 1YHQI 1T98A 2M0MA 2XKOA 2GXGA 3PJRA 1ZG5A 1ZAOA 2HZTA 3BCAA 4KA4A 2DXIA 3CUQB 1U3EM 3K1MA 1ZG3A 2BY1A 5HLIA 2VQHA 2QSHX 4I6ZA 3J7AO 1WFXA 2O61A 3H35A 2E1NA 5J4YA 3H9QA 2K7LA 1MMNA 4F92B 3MKWB 3BQYA 1WKMA 2VOOA 3IH3A 1YJNI 3C3WA 2EIMH 1Y0UA 1CF7B 3KP2A 1BC7C 1MJAA 3E0JB 5FKKA 2B0LA 2VBYA 2EQRA 1IGNA 1R22A 2VUMJ 1WJCA 2E71A 4KN7X 1B59A 4BXXJ 4CCKA 4EJTA 4BS9A 4XRMA 1BM9A 1T0FA 4AYBN 2QWWA 5FKLA 1ZGAA 3HGYA 2Y0SA 3TL4X 4E7IA 1IRZA 3P9IA 1BBYA 2BHYA 2ME6A 4LLNA 1FTZA 4C3HJ 1U6GA 4WK8F 2DTZA 2RVCA 1HDPA 1J09A 4G9YA 4B09A 4RAGA 3G73A 3DXJF 1C0WA 1JKOC 1U2WA 2EFNA 2VE8A 2CW8A 1S7OA 5BQTA 1O7LA 3QOEA 2QBYB 1OQYA 2MLKA 3HJEA 1FZPB 4M3DA 2F4OB 5DS9A 4PFPA 3O8GA 3U1KA 3AAFA 2P5VA 4O5VA 3S1MJ 4M6XA 3GLLA 1FIPA 1BA5A 2L7ZA 2DDAA 4A3EJ 1IV6A 3BC8A 3RPUA 2DT6A 5FFZA 3EUAA 3TQNA 3I53A 3MEXA 3REOA 1Z7LA 2MC4A 2DK5A 2Z16A 1HF0A 5L3GA 3HSRA 1Z05A 3WGIA 2ZXJA 2R5ZB 1SD7A 4BL0B 3E3VA 4RLQA 3WE2A 1IN4A 5TISC 4BDZA 2CUZA 1D8KA 4FX0A 2NS8A 2Z3YA 3RYPA 1TW3A 1WWXA 4A3JJ 1FOYA 4OWRB 2NVQJ 1W0TA 1FWZA 4XLHA 4EVIA 4KT5C 1H89C 3SFIA 4PCQA 2EFPA 1EKEA 2LNBA 1F5TA 4R1HA 4RB1A 4UUVA 2F4MB 2LTPA 3TKYA 5CVVA 2OUMA 2UXNA 1FP1D 4M9ZA 1NHAA 3WGGA 4AU7A 3QPTA 5ICCA 3DBRB 1SFEA 3J7ZI 1VQPI 3OOUA 3CDHA 5B5EC 4HQMA 2ZNZA 2RN7A 2XF6A 1QHGA 3JW4A 1MMDA 2X0LA 3TGNA 5BS6A 1IXCA 2M5WA 2JA8J 1HW2A 5J1YA 3F23A 1K4SA 3BG5A 4B43A 3K4NA 1S9HA 2LK2A 3QPLA 4IQ4A 3E5XA 1ZQ3P 4ENMA 1IXSB 1W4MA 2KLOA 2A5YB 2UZKA 3MFKA 2BXYA 3G6EI 2NXNB 2MG4A 3RYRA 1R49A 2JSPA 4PJNA 3PIOF 3KP7A 2FOKA 4Y15A 3CCJI 3CZ6A 1N78A 2LLKA 2PX9A 2R7FA 2WBMA 2KKOA 4LD5A 3AG1H 2R7SA 1SD6A 4RDUA 5DCMB 3VYUB 5BPIA 4A0ZA 5HDGA 2E60A 5BOXA 1H9TA 4ZZLA 1Y1VJ 2L02A 1D0XA
chains in the Genus database with same CATH topology
1P7IA 1K83J 2K9NA 3LOCA 1JJ8C 3NARA 4B3AA 2YUSA 2LVSA 3I4NJ 2NVYJ 4MFEA 3BR5A 3LNQA 2B63J 3UKGA 2GBYA 1TC3C 1JKPC 1FJLA 1AHDP 3HBLA 3ZQHA 3JRHA 3ZQLA 1ETQA 3WHCA 1MNMC 2L7MP 3FIWA 1B72B 2HXIA 2M8GX 3JRBA 2CQXA 2EH3A 2COBA 1PUFB 5M3FJ 4IHYA 2VKVA 1LE8A 1MSFC 2HOTA 1DU6A 2G0EA 1ZTRA 1B8IA 1P7JA 2ZB9A 1MH3A 3JRIA 3SDGA 2ID6A 4W1UA 3BTLA 5EGOA 4A93J 2L9RA 4W97A 5GP9A 3JRGA 1S7EA 2HYJA 4MO7A 5F08A 4QIWN 5EDNA 4UUTA 1IC8A 5IYDJ 1X2MA 2DA6A 4M3EA 3RKQA 1LFBA 3HOUJ 4XRSG 4A3CJ 3DCFA 1FEXA 4QTRA 3GTGJ 3BR2A 3HKZN 4FCYA 1SFOJ 4B4CA 5C44J 1OCPA 4FE7A 5BNGA 1ZR2A 3LSJA 1JJ6C 3CDLA 1IDZA 4RBOA 1BJZA 3TW6A 3OIOA 2ME0A 4A3DJ 2IBDA 3S14J 1H8AC 1XS9A 2CQQA 1ETKA 1RETA 5E3OA 3ZQFA 2YS9A 4D7MA 4DZJA 1ITYA 4M3BA 3FK7A 5E3NA 1JGGA 2XGEA 1MBKA 5IOYA 5C4XJ 2EZKA 2CJJA 1AU7A 5F1JA 3S16J 3LSRA 1IUFA 2X9DA 4D5CA 4X6AJ 1QRYA 2HXOA 1ZR4A 1D5YA 1JUPA 5EEAA 4AUXA 4Y7NJ 1IJWC 5K7FA 2EBIA 3C2BA 3BR3A 4A3IJ 2Y0SN 1K61A 1HLVA 5M5YJ 5EG0A 4FISA 1ETVA 3S2DJ 3HOWJ 1VNDA 9ANTA 5EYRA 2HOSA 1ETXA 2LFBA 1Z0XA 3BG9A 4A3KJ 4B1RA 2D5VA 3HDDA 4D7NA 2R5ZA 2WV1A 4CYCA 1JTYA 3BG3A 2Y31A 1OFCX 1HOMA 2FJ1A 1XC5A 4V2GA 2Y9ZA 5DTDA 5IP7J 2KDZA 1I3QJ 1ZGWA 3BR0A 5E3LA 4XICA 2R93J 2DJNA 4IHVA 4A3MJ 2JA5J 1GV5A 2QCOA 3G1OA 2CUEA 4BY7J 5IYCJ 2M9HA 4X1EA 1MBGA 3CCYA 5IOZA 2E2IJ 2DA1A 3DEWA 3G1MA 1UMQA 1QPIA 4C3JJ 1TWCJ 3JRCA 3A01A 1LE8B 2CU7A 4AC0A 4BBRJ 2IEKA 3PM1A 3G1LA 4MFDA 5GPAA 4XRSA 4MIMA 4UUSA 1B8IB 3S17J 1GVDA 2O7OA 4A69C 4M6VA 2DA2A 2AO9A 3IH4A 5IYBJ 5EGOB 3TP3A 3OSGA 2GLOA 4DYRA 1VI0A 2O8KA 1WH7A 3K7AJ 4IHXA 3PO2J 3WHBA 4J19A 3H0GJ 4MLOA 1U9OA 5HODA 2DA4A 1YRNB 2DA5A 2XB5A 1UHSA 3K2AA 3ZQGA 4Y52J 1E3OC 1ZK8A 1BL0A 3HOZJ 3H3VK 2E2JJ 1GV2A 1WCMJ 5F0HA 3BT9A 4GFBA 3JRFA 4A3GJ 2RAEA 4V2FA 3JR9A 3L1PA 5FJ8J 2Y9YA 2OPTA 5JLXA 3CQZJ 1ENHA 2M0CA 1ETWA 3ZQIA 1RESA 3LSGA 1MBJA 2N8GA 2HI3A 3GBGA 5J3LA 1TWAJ 2E2HJ 1ETOA 1JT0A 2M2EA 1GT0C 3D1NI 4LOCA 1WH5A 4S0HB 2NVXJ 5J1UA 2EZLA 5F04A 4DZPA 1BW5A 5EZGA 1RPWA 5F0CA 3GTMJ 5EG0B 3BTIA 5M3MJ 2H1KA 1NK2P 4IHWA 4D5FA 2GM4A 3GTLJ 1POGA 3HOYJ 1T56A 1Y1WJ 5M5WJ 3FK6A 2R0QC 2R5YB 3JREA 2H8RA 2ECCA 1X2NA 3HB9A 4C2MJ 3GTJJ 3HOVJ 1QVTA 4CYCB 2XRLA 1W0UA 1ZKGA 5K7ZA 2LY9A 4DW6A 3HOXJ 2PMZN 2IAIA 3LSPA 1R9TJ 3HGGA 3SJMA 2XPVA 3QPSA 3TP0A 3BR1A 3MN2A 3IV5A 3S1RJ 4BBSJ 1DU0A 3MVPA 1WPKA 2JJ7A 1O4XA 1G2HA 5M5XJ 2TRTA 1MBEA 5JLWA 2I10A 4NDLA 2DMTA 4A3BJ 3CMYA 5C4JJ 2WB1N 1VF9A 2L0KA 5EF6A 1JUMA 1JT6A 2XGCA 1SANA 2L7FP 3VPRA 3GTPJ 2JA7J 5FLVA 1AKHA 3S1QJ 2K9SA 4M3GA 3BR6A 2HOAA 2LD5A 1APLC 3JRDA 3A01B 1U8BA 3GTKJ 2FX0A 1RKTA 2XPUA 1VFCA 4JX5A 4UUSB 1UG2A 2Y30A 1T33A 4FTHA 4JP0A 2FD5A 2LR8A 3B6CA 1F36A 3O8HA 1IG7A 3BQZA 1TWHJ 2DMNA 2E1OA 1NTCA 1A6IA 1JKRC 1CQTA 3Q0UA 2JN6A 2ECBA 5F27A 2DN0A 2JA6J 3RQIA 2JK3A 2QF7A 3GTQJ 2AHQA 2R92J 1MBFA 3F0CA 3TEDA 1I6HJ 2ELKA 4JX4A 4JX6A 4DYCA 4I6ZA 4L5EA 3RZOJ 2K40A 3BQYA 4XK4A 1NK3P 2VPRA 3IH3A 2DA7A 3FISA 5FKKA 3S1NJ 2W48A 3MKLA 2EQRA 1IGNA 3PO3J 2VUMJ 4BXXJ 2XGDA 1OCTC 2XSDC 5K7HA 4XRMA 4A3LJ 4AYBN 5FKLA 3HGYA 3E7LA 4BKXA 1LFUP 1IRZA 1JKQC 2ME6A 1FTZA 2LP0A 4C3HJ 2DTZA 2FQ4A 1HDPA 3BTCA 4A3FJ 1QVUA 2EZHA 1JKOC 3A02A 4QSHA 1A5JA 3I4MJ 1F43A 5F0FA 2E19A 2Y2ZA 4BY1J 5FLMJ 1XG1A 5FKNA 4M3DA 1B72A 5DS9A 2OF7A 1EF4A 2HQ5A 3O8GA 1YRNA 4ABZA 3Q0WA 1PUFA 5IP6A 3S1MJ 5J1RA 1FIPA 2X6OA 2NVTJ 2L7ZA 4A3EJ 2K9QA 2TCTA 1IV6A 3GTOJ 1BA5A 1MSEC 1X58A 1JTXA 1TWGJ 2R7ZJ 3W6VA 2DMQA 5FKOA 1HF0A 1WI3A 3B6AA 4FE4A 1OJLA 5IPAA 1GUUA 2R5ZB 4I76A 3JRAA 1AKHB 2DMUA 5GPCA 2DMPA 4C3IJ 1WGXA 2CRGA 2NS8A 4A3JJ 3NAUA 2XPWA 3BTJA 1ORKA 2NVQJ 2YU9J 1W0TA 1HDDC 2MSYA 1MH4A 1U78A 1TWFJ 1H89C 3SFIA 3HEFA 4EEFG 2LTPA 1RKWA 2KT0A 3S2HJ 2MW8A 5FKMA 1IDYA 2VKEA 1H88C 5EZHA 3A03A 2O9LA 5E3MA 2MGQA 1ETYA 3IH2A 3OOUA 3ZOBA 4G12A 3M4OJ 2NOGA 3ZQCA 2EZIA 1RR7A 2JA8J 2R5YA 5J1YA 4IEJA 3S15J 2NS7A 1MBHA 2P81A 3BG5A 1Q1VA 1U9NA 1BW6A 3QQAA 5C3EJ 2LK2A 3QPLA 2X48A 2VI6A 1Z77A 1ZQ3P 2ID3A 3M3YJ 1GDTA 4DYQA 1FIAA 1JUSA 4JYKA 1HCRA 3TW7A 4M3FA 2LKXA 3HM5A 2MG4A 2XB0X 1I50J 3Q0VA 2CUFA 3RZDJ 2DA3A 2LLKA 2M34A 2JMWA 4HNVA 2HDDA 2WAQN 1FTTA 4XIDA 3OSFA 4RDUA 3FKIJ 2JWTA 1Y1VJ 5IP9J 3Q3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7I A;  1K83 J;  2K9N A;  3LOC A;  1JJ8 C;  3NAR A;  4B3A A;  2YUS A;  2LVS A;  3I4N J;  2NVY J;  4MFE A;  3BR5 A;  3LNQ A;  2B63 J;  3UKG A;  2GBY A;  1TC3 C;  1JKP C;  1FJL A;  1AHD P;  3HBL A;  3ZQH A;  3JRH A;  3ZQL A;  1ETQ A;  3WHC A;  1MNM C;  2L7M P;  3FIW A;  1B72 B;  2HXI A;  2M8G X;  3JRB A;  2CQX A;  2EH3 A;  2COB A;  1PUF B;  5M3F J;  4IHY A;  2VKV A;  1LE8 A;  1MSF C;  2HOT A;  1DU6 A;  2G0E A;  1ZTR A;  1B8I A;  1P7J A;  2ZB9 A;  1MH3 A;  3JRI A;  3SDG A;  2ID6 A;  4W1U A;  3BTL A;  5EGO A;  4A93 J;  2L9R A;  4W97 A;  5GP9 A;  3JRG A;  1S7E A;  2HYJ A;  4MO7 A;  5F08 A;  4QIW N;  5EDN A;  4UUT A;  1IC8 A;  5IYD J;  1X2M A;  2DA6 A;  4M3E A;  3RKQ A;  1LFB A;  3HOU J;  4XRS G;  4A3C J;  3DCF A;  1FEX A;  4QTR A;  3GTG J;  3BR2 A;  3HKZ N;  4FCY A;  1SFO J;  4B4C A;  5C44 J;  1OCP A;  4FE7 A;  5BNG A;  1ZR2 A;  3LSJ A;  1JJ6 C;  3CDL A;  1IDZ A;  4RBO A;  1BJZ A;  3TW6 A;  3OIO A;  2ME0 A;  4A3D J;  2IBD A;  3S14 J;  1H8A C;  1XS9 A;  2CQQ A;  1ETK A;  1RET A;  5E3O A;  3ZQF A;  2YS9 A;  4D7M A;  4DZJ A;  1ITY A;  4M3B A;  3FK7 A;  5E3N A;  1JGG A;  2XGE A;  1MBK A;  5IOY A;  5C4X J;  2EZK A;  2CJJ A;  1AU7 A;  5F1J A;  3S16 J;  3LSR A;  1IUF A;  2X9D A;  4D5C A;  4X6A J;  1QRY A;  2HXO A;  1ZR4 A;  1D5Y A;  1JUP A;  5EEA A;  4AUX A;  4Y7N J;  1IJW C;  5K7F A;  2EBI A;  3C2B A;  3BR3 A;  4A3I J;  2Y0S N;  1K61 A;  1HLV A;  5M5Y J;  5EG0 A;  4FIS A;  1ETV A;  3S2D J;  3HOW J;  1VND A;  9ANT A;  5EYR A;  2HOS A;  1ETX A;  2LFB A;  1Z0X A;  3BG9 A;  4A3K J;  4B1R A;  2D5V A;  3HDD A;  4D7N A;  2R5Z A;  2WV1 A;  4CYC A;  1JTY A;  3BG3 A;  2Y31 A;  1OFC X;  1HOM A;  2FJ1 A;  1XC5 A;  4V2G A;  2Y9Z A;  5DTD A;  5IP7 J;  2KDZ A;  1I3Q J;  1ZGW A;  3BR0 A;  5E3L A;  4XIC A;  2R93 J;  2DJN A;  4IHV A;  4A3M J;  2JA5 J;  1GV5 A;  2QCO A;  3G1O A;  2CUE A;  4BY7 J;  5IYC J;  2M9H A;  4X1E A;  1MBG A;  3CCY A;  5IOZ A;  2E2I J;  2DA1 A;  3DEW A;  3G1M A;  1UMQ A;  1QPI A;  4C3J J;  1TWC J;  3JRC A;  3A01 A;  1LE8 B;  2CU7 A;  4AC0 A;  4BBR J;  2IEK A;  3PM1 A;  3G1L A;  4MFD A;  5GPA A;  4XRS A;  4MIM A;  4UUS A;  1B8I B;  3S17 J;  1GVD A;  2O7O A;  4A69 C;  4M6V A;  2DA2 A;  2AO9 A;  3IH4 A;  5IYB J;  5EGO B;  3TP3 A;  3OSG A;  2GLO A;  4DYR A;  1VI0 A;  2O8K A;  1WH7 A;  3K7A J;  4IHX A;  3PO2 J;  3WHB A;  4J19 A;  3H0G J;  4MLO A;  1U9O A;  5HOD A;  2DA4 A;  1YRN B;  2DA5 A;  2XB5 A;  1UHS A;  3K2A A;  3ZQG A;  4Y52 J;  1E3O C;  1ZK8 A;  1BL0 A;  3HOZ J;  3H3V K;  2E2J J;  1GV2 A;  1WCM J;  5F0H A;  3BT9 A;  4GFB A;  3JRF A;  4A3G J;  2RAE A;  4V2F A;  3JR9 A;  3L1P A;  5FJ8 J;  2Y9Y A;  2OPT A;  5JLX A;  3CQZ J;  1ENH A;  2M0C A;  1ETW A;  3ZQI A;  1RES A;  3LSG A;  1MBJ A;  2N8G A;  2HI3 A;  3GBG A;  5J3L A;  1TWA J;  2E2H J;  1ETO A;  1JT0 A;  2M2E A;  1GT0 C;  3D1N I;  4LOC A;  1WH5 A;  4S0H B;  2NVX J;  5J1U A;  2EZL A;  5F04 A;  4DZP A;  1BW5 A;  5EZG A;  1RPW A;  5F0C A;  3GTM J;  5EG0 B;  3BTI A;  5M3M J;  2H1K A;  1NK2 P;  4IHW A;  4D5F A;  2GM4 A;  3GTL J;  1POG A;  3HOY J;  1T56 A;  1Y1W J;  5M5W J;  3FK6 A;  2R0Q C;  2R5Y B;  3JRE A;  2H8R A;  2ECC A;  1X2N A;  3HB9 A;  4C2M J;  3GTJ J;  3HOV J;  1QVT A;  4CYC B;  2XRL A;  1W0U A;  1ZKG A;  5K7Z A;  2LY9 A;  4DW6 A;  3HOX J;  2PMZ N;  2IAI A;  3LSP A;  1R9T J;  3HGG A;  3SJM A;  2XPV A;  3QPS A;  3TP0 A;  3BR1 A;  3MN2 A;  3IV5 A;  3S1R J;  4BBS J;  1DU0 A;  3MVP A;  1WPK A;  2JJ7 A;  1O4X A;  1G2H A;  5M5X J;  2TRT A;  1MBE A;  5JLW A;  2I10 A;  4NDL A;  2DMT A;  4A3B J;  3CMY A;  5C4J J;  2WB1 N;  1VF9 A;  2L0K A;  5EF6 A;  1JUM A;  1JT6 A;  2XGC A;  1SAN A;  2L7F P;  3VPR A;  3GTP J;  2JA7 J;  5FLV A;  1AKH A;  3S1Q J;  2K9S A;  4M3G A;  3BR6 A;  2HOA A;  2LD5 A;  1APL C;  3JRD A;  3A01 B;  1U8B A;  3GTK J;  2FX0 A;  1RKT A;  2XPU A;  1VFC A;  4JX5 A;  4UUS B;  1UG2 A;  2Y30 A;  1T33 A;  4FTH A;  4JP0 A;  2FD5 A;  2LR8 A;  3B6C A;  1F36 A;  3O8H A;  1IG7 A;  3BQZ A;  1TWH J;  2DMN A;  2E1O A;  1NTC A;  1A6I A;  1JKR C;  1CQT A;  3Q0U A;  2JN6 A;  2ECB A;  5F27 A;  2DN0 A;  2JA6 J;  3RQI A;  2JK3 A;  2QF7 A;  3GTQ J;  2AHQ A;  2R92 J;  1MBF A;  3F0C A;  3TED A;  1I6H J;  2ELK A;  4JX4 A;  4JX6 A;  4DYC A;  4I6Z A;  4L5E A;  3RZO J;  2K40 A;  3BQY A;  4XK4 A;  1NK3 P;  2VPR A;  3IH3 A;  2DA7 A;  3FIS A;  5FKK A;  3S1N J;  2W48 A;  3MKL A;  2EQR A;  1IGN A;  3PO3 J;  2VUM J;  4BXX J;  2XGD A;  1OCT C;  2XSD C;  5K7H A;  4XRM A;  4A3L J;  4AYB N;  5FKL A;  3HGY A;  3E7L A;  4BKX A;  1LFU P;  1IRZ A;  1JKQ C;  2ME6 A;  1FTZ A;  2LP0 A;  4C3H J;  2DTZ A;  2FQ4 A;  1HDP A;  3BTC A;  4A3F J;  1QVU A;  2EZH A;  1JKO C;  3A02 A;  4QSH A;  1A5J A;  3I4M J;  1F43 A;  5F0F A;  2E19 A;  2Y2Z A;  4BY1 J;  5FLM J;  1XG1 A;  5FKN A;  4M3D A;  1B72 A;  5DS9 A;  2OF7 A;  1EF4 A;  2HQ5 A;  3O8G A;  1YRN A;  4ABZ A;  3Q0W A;  1PUF A;  5IP6 A;  3S1M J;  5J1R A;  1FIP A;  2X6O A;  2NVT J;  2L7Z A;  4A3E J;  2K9Q A;  2TCT A;  1IV6 A;  3GTO J;  1BA5 A;  1MSE C;  1X58 A;  1JTX A;  1TWG J;  2R7Z J;  3W6V A;  2DMQ A;  5FKO A;  1HF0 A;  1WI3 A;  3B6A A;  4FE4 A;  1OJL A;  5IPA A;  1GUU A;  2R5Z B;  4I76 A;  3JRA A;  1AKH B;  2DMU A;  5GPC A;  2DMP A;  4C3I J;  1WGX A;  2CRG A;  2NS8 A;  4A3J J;  3NAU A;  2XPW A;  3BTJ A;  1ORK A;  2NVQ J;  2YU9 J;  1W0T A;  1HDD C;  2MSY A;  1MH4 A;  1U78 A;  1TWF J;  1H89 C;  3SFI A;  3HEF A;  4EEF G;  2LTP A;  1RKW A;  2KT0 A;  3S2H J;  2MW8 A;  5FKM A;  1IDY A;  2VKE A;  1H88 C;  5EZH A;  3A03 A;  2O9L A;  5E3M A;  2MGQ A;  1ETY A;  3IH2 A;  3OOU A;  3ZOB A;  4G12 A;  3M4O J;  2NOG A;  3ZQC A;  2EZI A;  1RR7 A;  2JA8 J;  2R5Y A;  5J1Y A;  4IEJ A;  3S15 J;  2NS7 A;  1MBH A;  2P81 A;  3BG5 A;  1Q1V A;  1U9N A;  1BW6 A;  3QQA A;  5C3E J;  2LK2 A;  3QPL A;  2X48 A;  2VI6 A;  1Z77 A;  1ZQ3 P;  2ID3 A;  3M3Y J;  1GDT A;  4DYQ A;  1FIA A;  1JUS A;  4JYK A;  1HCR A;  3TW7 A;  4M3F A;  2LKX A;  3HM5 A;  2MG4 A;  2XB0 X;  1I50 J;  3Q0V A;  2CUF A;  3RZD J;  2DA3 A;  2LLK A;  2M34 A;  2JMW A;  4HNV A;  2HDD A;  2WAQ N;  1FTT A;  4XID A;  3OSF A;  4RDU A;  3FKI J;  2JWT A;  1Y1V J;  5IP9 J;  3Q3S A; 
#chains in the Genus database with same CATH topology
 1P7I A;  1K83 J;  2W1O A;  3LOC A;  2DFF A;  1OCZ H;  3NAR A;  1SD4 A;  3FM5 A;  1G3W A;  2MH2 A;  1VQ4 I;  2PJR B;  4G7O F;  4XN3 A;  1UEL B;  4HDV A;  1WI9 A;  2DI3 A;  1AWC A;  3QYB A;  2LY1 A;  5ILS A;  3OWT A;  4L9T A;  4UY8 I;  1DPU A;  1I3A A;  1FJL A;  4J00 A;  1V3F A;  2M45 A;  5CVJ A;  3HBL A;  4V19 K;  5LGT A;  3ML6 A;  2YX7 A;  1ETQ A;  3P7N A;  3G4S I;  3ZQL A;  5JVT A;  1T39 A;  3ZR8 X;  1SC7 A;  2R7T A;  2GA2 A;  4CUG A;  3OYK A;  2L7M P;  3F8F A;  4G6Q A;  4D0P A;  2DAO A;  4MHG A;  1VQO I;  4EJW A;  1G8X A;  4XSZ F;  2JVG A;  1B72 B;  1PUF B;  1PVE A;  4WXC A;  3ZQ7 A;  4IHY A;  3KP3 A;  1LE8 A;  3BPV A;  2O03 A;  1OPC A;  2MFZ A;  3HHG A;  2V1N A;  4C9Y A;  1B8I A;  2CV1 A;  5D6E A;  2RNJ A;  1E2X A;  4P55 A;  5DEQ A;  3WTT C;  4L9J A;  1MH3 A;  2ID6 A;  5FRO A;  1XN7 A;  5BMZ A;  1W5S A;  3W2W A;  4EV0 A;  1JHF A;  5CKT A;  3QYF A;  5GP9 A;  4MEX F;  3KP6 A;  4UV9 A;  5EDN A;  3BOQ A;  3SFZ A;  5IT3 A;  1IC8 A;  2UWM A;  1NG7 A;  3FHZ A;  2RRE A;  1UHM A;  2CS3 A;  2IW5 A;  2NS0 A;  4A2U A;  4WCG A;  1LFB A;  3RKQ A;  4XRS G;  1FEX A;  2AS5 F;  3H5N A;  2KIF A;  4FCY A;  1SFO J;  4B4C A;  4C2T A;  1FNN A;  4FX4 A;  3RCO A;  2R3S A;  2E34 A;  1X1A A;  2X51 A;  2ME0 A;  2HDW A;  4EQQ A;  1MGT A;  2VJ4 A;  1XS9 A;  4J01 A;  1XCV A;  5IT9 K;  1ETK A;  1RET A;  3J80 K;  2O3F A;  3FHN A;  2B9S A;  2MC3 A;  3ASN H;  4KIG A;  3HUG A;  1U5T B;  4M3B A;  2WWY A;  2MAB A;  4Q48 A;  3GLX A;  4F91 B;  1O3Q A;  1LVA A;  5HLH A;  5C4X J;  2EZK A;  2CJJ A;  4QPQ A;  2QA4 I;  3LSR A;  2X9D A;  3W6K B;  2E1C A;  4C2U A;  5ICG A;  5LHH A;  4PJL A;  4ESB A;  3CJQ B;  1PDN C;  2HR3 A;  3OYG A;  1D5Y A;  2F48 A;  1YS6 A;  4U88 A;  1SAX A;  3K4K A;  2EBI A;  4D9J A;  2IA1 A;  2W84 A;  2Y0S N;  1K61 A;  2DQR A;  2VT3 A;  5EG0 A;  2CV2 A;  5KNL A;  3S2D J;  3QP5 A;  4ZYE A;  3SQN A;  2R4G A;  2EJR A;  1SMT A;  1Z0X A;  2LSO A;  1QZZ A;  1XDS A;  4L9V A;  5EEH A;  1IO2 A;  3GO5 A;  3CJT B;  2D5V A;  1E3P A;  2WV1 A;  3QOP A;  4CYC A;  1VQK I;  4ZZD A;  2FJ1 A;  3HL2 A;  1TNS A;  2DOF A;  1QQI A;  3J7Y J;  5DTD A;  2FRH A;  2KDZ A;  1YIO A;  1MIJ A;  3RJP A;  2R93 J;  2PQ8 A;  3KIO A;  1W5C C;  4XKV A;  4DIQ A;  2TDX A;  5K1Y A;  3GFI A;  2QCO A;  1X3U A;  2CUE A;  4BY7 J;  5LBQ A;  1FYM A;  2M9H A;  2X6Y A;  3CMY A;  3DEW A;  2KIQ A;  5GTI C;  1W7P B;  3G1M A;  2IRF G;  2HVQ A;  4C3J J;  2P5L C;  2BW3 A;  3I5U A;  2R7W A;  1LKX A;  4MNU A;  1YE9 A;  1DQU A;  3KET A;  4E4H A;  4UVB A;  4AC0 A;  4BBR J;  1K4T A;  2FMY A;  2YU3 A;  3W2V A;  3K0L A;  1BIA A;  1PP8 F;  1K78 A;  3P5J A;  5LRS A;  1T8I A;  1T38 A;  3GF2 A;  3TP3 A;  1ZHF A;  1VI0 A;  1DDN A;  1WH7 A;  1G59 A;  2VBZ A;  4IKF A;  1XMX A;  4XOT A;  3H0G J;  5HOO A;  4MLO A;  1TT0 A;  3F8C A;  4IOC F;  1YRN B;  4O3M A;  3ZQG A;  4I09 A;  2DTR A;  2ZME B;  1FOK A;  1E3O C;  2D2W A;  2VJJ A;  2NAZ A;  5H20 A;  1XMA A;  1LDJ A;  3I54 A;  1VQ8 I;  3HOZ J;  4HF1 A;  3T8R A;  1WCM J;  2OU2 A;  1T95 A;  3CES A;  2QZ8 A;  4CXF A;  4RB0 A;  3DPU A;  2CSO A;  2KFD A;  1IXR C;  2G7H A;  2Y9Y A;  3BG6 A;  5JLX A;  3CQZ J;  3O3K A;  3C2G A;  3ZQI A;  1RES A;  3LSG A;  3SHF A;  1JXS A;  2PJP A;  2XSJ C;  1I39 A;  3CUQ C;  4DGW B;  3Q5F A;  2RGV A;  3HTU A;  3FXU A;  3PL8 A;  2HI3 A;  1P92 A;  1HW5 A;  1O3T A;  2ADU A;  1ETO A;  2WAD A;  4XNF A;  3ULQ B;  4KUM A;  2OTL I;  1GT0 C;  3BJ6 A;  3DTI A;  3QPH A;  3D1N I;  1MDM A;  2J5P A;  4ETS A;  2NVX J;  4L0Z B;  1MND A;  2IS2 A;  1YW8 A;  4XLC A;  1YX5 A;  4BJ5 C;  3ZPL A;  3FXM A;  3R6S A;  1MJB A;  4HX7 A;  2KL4 A;  2I5U A;  3GTM J;  3FXQ A;  3IAS 2;  1NK2 P;  2ESH A;  4IHW A;  4D5F A;  2GM4 A;  1POG A;  4ENK A;  1WJB A;  2H6C A;  4JQF A;  5GTH C;  1FSE A;  2XRN A;  4II2 A;  3FDY A;  1XTA A;  2V4J C;  4C2M J;  3CJR B;  3FXJ A;  1QVT A;  2QEN A;  3LWF A;  1FY7 A;  1W0U A;  3HOX J;  2FA5 A;  3OS1 A;  3MCZ A;  1KYZ A;  2OAZ A;  3V7C A;  1TZL A;  1KU7 A;  3BR1 A;  4EM1 A;  3HSE A;  4OIQ F;  2X85 A;  1O4X A;  1G2H A;  2KPM A;  4LFU A;  3OYN A;  2ZXH A;  5M5X J;  5ED4 A;  3JAM K;  2TRT A;  3K4C A;  1YFH A;  1MBE A;  2I10 A;  4AVP A;  4Z6Y A;  2DMT A;  4A3B J;  3SEQ A;  2X6X A;  5C4J J;  2ELJ A;  2JT1 A;  3KE2 A;  4LMY A;  3HRU A;  1HQC A;  1WHU A;  3F8N A;  1VF9 A;  4ZYG A;  3H3U A;  5EF6 A;  3IRQ A;  2EPF A;  3WOD F;  2XGC A;  1JT6 A;  2L01 A;  3O2P E;  2ZJQ F;  4HST A;  1SAN A;  1OMI A;  1N77 A;  1OYY A;  1XSD A;  2JA7 J;  1AKH A;  3S1Q J;  2HQR A;  4B47 A;  3V4G A;  1O3S A;  3L2Q A;  2LD5 A;  4IQJ A;  3HOS A;  2OZ6 A;  1UAA A;  3CC2 I;  2EB7 A;  2M3A A;  1G6N A;  4UUS B;  1UG2 A;  3GUD A;  3IAM 2;  3RPU D;  2VXD A;  4IOA F;  4YFN F;  1ZEL A;  2LRE A;  2Z5U A;  4X0G A;  3O8H A;  1E3H A;  3OYC A;  2OQR A;  2E1O A;  1NTC A;  3SZG A;  1D1C A;  2ECB A;  2DOE A;  1XX5 A;  4XBF A;  3GEZ A;  2JK3 A;  2QF7 A;  2X6W A;  3GTQ J;  4XLF A;  2AHQ A;  2NYX A;  2R92 J;  1Y6I A;  1HXD A;  4F52 A;  4H0E A;  2EFW A;  2QEX I;  5E1X A;  1RUO A;  4JX4 A;  2MD5 A;  2IGM A;  2LG4 A;  4XK4 A;  4OAZ A;  1NK3 P;  3GZ6 A;  2K85 A;  5AON A;  2W57 A;  5CVR A;  3SZP A;  3U1D A;  2DA7 A;  2QYO A;  1R23 A;  2F5F A;  2ZXW H;  4PZJ A;  3HG9 A;  3HRM A;  2W48 A;  2E35 A;  4XLE A;  2EWN A;  2OCC H;  4O6J A;  1YO5 C;  4LG0 A;  4BUP A;  4DOZ A;  1OCT C;  5F64 A;  3WG7 H;  2XSD C;  3R61 A;  5K7H A;  3KYD B;  2VQG A;  5KHD A;  5IY5 H;  5L3D A;  1T08 B;  3L9F A;  1LPQ A;  4A3L J;  3RTR A;  3MZ8 A;  2IP2 A;  3E7L A;  4I0B A;  1D8J A;  2HQA A;  2W4S A;  1Z1D A;  3OYI A;  2R7V A;  2QLZ A;  3IP4 B;  5CJ9 A;  5JI6 A;  2V9P A;  3ZCO A;  3J81 Z;  2AQE A;  2FQ4 A;  2KQR A;  4NQW B;  4D1Q A;  3AL0 B;  3S3M A;  2DFI A;  3BTC A;  5GAE J;  5LEK A;  4ZDP A;  4CA0 A;  2GA1 A;  2ICW G;  4HX8 A;  1BC8 C;  2V9K A;  4HV5 A;  4QSH A;  2XAS A;  1UST A;  4AD9 A;  3I4M J;  5F0F A;  1R36 A;  2E19 A;  4M73 A;  5ILU A;  4BY1 J;  2D45 A;  1GLN A;  2VIX A;  1RC9 A;  2X1E A;  5FKN A;  2OF7 A;  3IC7 A;  3J7A Y;  4ABZ A;  1BIB A;  5F1R A;  3Q0W A;  5IP6 A;  2V9V A;  2NVT J;  3VDX A;  3GTO J;  2K9Q A;  3K10 A;  5H2F C;  2LBF B;  2L2O A;  4P9F A;  1Y39 A;  3DBL B;  1IN8 A;  1UFM A;  3CP2 A;  4HNT A;  1MSE C;  1OKR A;  3AFH A;  4BYY A;  3G3Z A;  3OYL A;  1XCB A;  1JTX A;  4PFO A;  1RUN A;  3GFJ A;  2A69 F;  2FOW A;  2DMQ A;  3H92 A;  5FKO A;  1FT9 A;  4YEL A;  4AVZ A;  2A5W A;  2EA4 A;  4FE4 A;  2PI0 A;  2NOJ B;  5IPA A;  3MMY B;  2X1C A;  1GUU A;  4IPA A;  6PAX A;  2XV4 S;  3I59 B;  4I76 A;  1OYI A;  1DP3 A;  1LEB A;  2DMP A;  4CZZ A;  1SAU A;  2EIN H;  4ZYA A;  1WGX A;  2CRG A;  2XAQ A;  1XD7 A;  5TRD A;  2LMD A;  4HQE A;  4OMY A;  1ORK A;  1HDD C;  2MSY A;  3E5U A;  5KAI C;  3E6C C;  1MH4 A;  4A5M A;  4MQ9 F;  3RKY A;  2CO5 A;  2OV7 A;  3BZ6 A;  1G3Y A;  3VEP A;  1RI7 A;  2ZJP F;  4XLP F;  2VKH A;  1IDY A;  1H88 C;  1KU2 A;  3A03 A;  3VFZ A;  1YIJ I;  1FBS A;  2ZFW A;  3ZOB A;  4G7Z F;  2NVU B;  4G12 A;  4BQQ A;  2NOG A;  2EZI A;  5TGT A;  1LQ1 A;  2STT A;  3EUK L;  2L7K A;  2Q0O A;  4EJO A;  3EET A;  1A31 A;  2BY0 A;  2P81 A;  4BE0 A;  1U9N A;  1BW6 A;  1Z9C A;  2FXA A;  5D5V B;  3VYT B;  2ID3 A;  1TP4 A;  3M3Y J;  4DYQ A;  4EMS A;  4F7Z A;  4JYK A;  4Y4R A;  1HCR A;  1R5G A;  1X1C A;  3QYE A;  3LFK A;  1SFU A;  5LEJ A;  4LLL A;  3W6J B;  2XB0 X;  2BHZ A;  3Q0V A;  2CUF A;  3RZD J;  3ZN1 A;  3SYT A;  1UCR A;  4EM2 A;  3HZJ A;  2DA3 A;  1GXQ A;  2M34 A;  2EV6 A;  4XID A;  1YI2 I;  2Y75 A;  3S32 A;  4LIT A;  3K70 D;  4MGR A;  4E7S A;  5BPD A;  4YFX F;  3HRS A;  4OIO F;  1V55 H;  2K9N A;  1JJ8 C;  4M9X A;  2LVS A;  4L5J A;  2WC2 A;  4MFE A;  4EGZ A;  3BRO A;  3BR5 A;  3LNQ A;  4CCM A;  2E36 A;  2X4H A;  4GXO A;  1AHD P;  3ZQH A;  4CCN A;  2JPB A;  2VLA A;  3WHC A;  1UHW A;  3AKZ A;  1MNM C;  2MYS A;  1IRG A;  4NNJ A;  5EEG A;  1RNL A;  3MD2 A;  5FB2 A;  4RB3 C;  3VYS B;  2W25 A;  3ERE D;  1IN6 A;  3B02 A;  3LAJ A;  1TL8 A;  2WAE A;  3DBH B;  5M3F J;  4IL6 C;  2HOT A;  2KJC A;  4CZC A;  1DU6 A;  1IRF A;  3VSK A;  3EUH A;  4RGU A;  3JRI A;  3SDG A;  4W1U A;  1G3S A;  4F93 B;  4XON A;  4A0X A;  5EGO A;  2KP6 A;  1ZN2 A;  4IRH A;  4W97 A;  3GCM A;  3K9T A;  4MO7 A;  2JRM A;  1D3Y A;  4UUT A;  5IYD J;  1R58 A;  1X2M A;  2DA6 A;  2VB6 A;  1WJE A;  3KPH A;  4A3C J;  3DQV C;  2RNG A;  1BI0 A;  3E97 A;  5C44 J;  1JJ6 C;  1WJD A;  2K4B A;  5GAG J;  1OYW A;  3CDL A;  2COM A;  2H09 A;  2HDC A;  3OYD A;  3P9C A;  1TNT A;  1I6X A;  3S14 J;  1I27 A;  2ZME C;  2CQQ A;  4PSX A;  3TDU C;  1STZ A;  3I55 I;  3DEU A;  1FYK A;  3OOP A;  2UXX A;  3PQJ A;  1FYL A;  3MAJ A;  5AIP A;  1W7P D;  1BOA A;  1ITY A;  2DBB A;  3KYL A;  1IW7 F;  2BXZ A;  2BV6 A;  1QZE A;  2XGE A;  1S5L C;  1MBK A;  3O6B B;  5IOY A;  1R1V A;  2W7N A;  1ZH5 A;  5CQG A;  3C2H A;  3GXO A;  3OS0 A;  2KZV A;  2A05 A;  5CVU A;  2LF7 A;  2K9L A;  2KRC A;  4HLY A;  2VBW A;  5DM7 F;  4G7H F;  1AU7 A;  3S16 J;  1I1G A;  4ITV A;  1IUF A;  4B48 A;  3N05 A;  3HTS B;  1FMW A;  1JUP A;  5E8I A;  4BAY A;  1VQ9 I;  1TTY A;  1TLH B;  1HKT A;  5M5Y J;  2XGX A;  3G2B A;  4FIS A;  1ETV A;  1GXP A;  2G7U A;  3VSL A;  5GAH J;  1X1B A;  1ZRE A;  1B9N A;  2UUZ A;  3R0J A;  2LFB A;  5LGU A;  3EYI A;  4HW0 A;  4XOR A;  2VON A;  2DFH A;  3BG9 A;  1Z3Y A;  4KFC A;  1IRX A;  1B1B A;  4OIN F;  4BXF A;  3H9G A;  2K86 A;  3ZQQ A;  2R5Z A;  4FAS D;  2P4W A;  2CQ7 A;  3H3Z A;  4HX4 A;  3SEZ A;  1XC5 A;  2IVM A;  1N75 A;  2Y9Z A;  3M8J A;  4RAZ A;  5IP7 J;  4Z2Y A;  3BR0 A;  3DLA A;  2LKS A;  2DJN A;  1W36 C;  1XGS A;  1GV5 A;  2BZT A;  1VTN C;  4BHC A;  1BR4 A;  3KP5 A;  3OYF A;  3CCY A;  5IOZ A;  4ZDL A;  2E2I J;  2VBX A;  5KVR A;  3V8K A;  3EQL F;  4WX9 A;  1KQ0 A;  4RAY A;  5H6Q A;  3L2C A;  1LJ9 A;  3NEU A;  1PJR A;  2XF7 A;  2OJE D;  5J4V A;  1R1U A;  4N9H A;  3U9G A;  3A01 A;  1ULY A;  2W82 A;  3Q9S A;  5J8F A;  2CU7 A;  1LE8 B;  4KMF A;  3DV8 A;  5GPA A;  3V8L A;  3MKZ A;  1B8I B;  4YIR X;  3CTA A;  1GVD A;  2O7O A;  3U2R A;  4M6V A;  2DA2 A;  3CCR I;  3CLO A;  5IYB J;  2HU9 A;  2K02 A;  3PUB A;  3OSG A;  2GLO A;  2Z33 A;  4IHX A;  1V54 H;  1DPR A;  3WHB A;  2DFE A;  1W36 D;  1U9O A;  2DA4 A;  4XSX F;  4NUB A;  2DA5 A;  2XB5 A;  3K2A A;  3T5X A;  1SEU A;  3K1N A;  4Y52 J;  2P7V B;  1ZK8 A;  2IGK A;  1L0O C;  2M7B A;  3M8E A;  2KIS A;  4MTE A;  2Q2E A;  1GV2 A;  3BT9 A;  3AG3 H;  1YJW I;  3H5R A;  3QP6 A;  3E6M A;  1I1S A;  4V2F A;  2EFQ A;  2JUC A;  2EIJ H;  1SVO A;  3DWL E;  3M7G A;  1YG2 A;  3CCV I;  2NNY A;  3HUG B;  2HWV A;  1TT5 B;  4HRI A;  3A0H C;  4XLN F;  4AM3 A;  1ONV A;  4RB2 C;  3DKX A;  2DPD A;  4IX7 A;  3ZMS A;  2E5N A;  3GBG A;  1R6R A;  5CLS A;  1TWA J;  3SXY A;  2QSG X;  3HRT A;  3M07 A;  1F1Z A;  5DD8 A;  2M1B A;  4BU2 A;  3T1B A;  2LDU A;  2MD0 A;  3I64 A;  4U0Y A;  3G71 I;  4KIB A;  2XAG A;  4BJT A;  3OIP A;  1WH5 A;  5ICF A;  4HAM A;  4S0H B;  5L3C A;  2GXB A;  5FFX A;  2VC1 A;  2HTJ A;  3E6B A;  4P1W A;  5ERI A;  1ACI A;  5F0C A;  3CF5 F;  4KNY A;  2GXA A;  5FO5 A;  5EG0 B;  5M3M J;  4I7H A;  3GTL J;  2EIL H;  3HOY J;  5HS7 A;  1X4P A;  3TOB A;  1WRJ A;  1Y1W J;  2BGC A;  2CW0 F;  5B1A H;  2R0Q C;  4NHJ A;  2R5Y B;  2H8R A;  1S7A A;  3ZMV A;  1Y8R B;  1R5I D;  1MMA A;  1X2N A;  2H94 A;  1MW7 A;  2FU4 A;  3DFG A;  4KIS A;  3HB9 A;  3VB2 A;  2F5D A;  3AL0 C;  4AIJ A;  5E18 F;  4CYC B;  1ZKG A;  2IAI A;  3LAP A;  3SJM A;  2I8D A;  2XPV A;  5DD4 A;  1QBJ A;  3MN2 A;  2V1U A;  3IV5 A;  3S1R J;  1DU0 A;  1WPK A;  2JJ7 A;  1K6O A;  4RM2 A;  4E7L A;  2F4I A;  2H6B A;  5JLW A;  3JTH A;  3S2W A;  3S93 A;  3PQK A;  4B3X A;  1JUM A;  3RPQ A;  1I5Z A;  2XAH A;  3VPR A;  1PP7 U;  2Q8K A;  1XB4 A;  3GTP J;  2OTJ I;  2P6T A;  4Y13 A;  2BW3 B;  2XF5 A;  3BR6 A;  1A6Q A;  3CC7 I;  1UG0 A;  3KEO A;  1U0J A;  2C6Y A;  4HPQ A;  3JRD A;  1BI3 A;  2VQC A;  3F22 A;  2ZC2 A;  2FX0 A;  4FET A;  1X4O A;  1RKT A;  3BWG A;  4JX5 A;  5A2Q K;  2A6T A;  1A35 A;  1K78 B;  3MZY A;  2XDV A;  4A0Y A;  2RDP A;  5KK1 A;  3WGH A;  4BHP A;  2FD5 A;  2O5R A;  1R7J A;  2QGU A;  2L4A A;  3B6C A;  1F36 A;  2CGP A;  3BQZ A;  4IF4 A;  2DMN A;  1FLI A;  4CHU A;  2QQ8 A;  1A6I A;  2YPR A;  2CYY A;  3CCE I;  5DM6 F;  3HKZ A;  3MZH A;  2DU9 A;  4JBA A;  5E20 A;  5DCF A;  2JA6 J;  5KAF C;  3H36 A;  1FX7 A;  2L54 A;  2RKH A;  1R71 A;  3RQI A;  1SD5 A;  4EM0 B;  1GHC A;  3HXL A;  3F0C A;  1FP2 A;  3TED A;  1EJ9 A;  1I6H J;  2R7D A;  1OLT A;  2KMU A;  2XKP A;  2FUG 2;  3WU1 B;  2HYF A;  3EDP A;  4L5E A;  3RZO J;  2CFO A;  4CCJ A;  3FBI B;  4WF2 A;  4LG3 A;  3OYH A;  3VWB A;  2VPR A;  4AIH A;  5L3E A;  3FIS A;  2PBI A;  4XN0 A;  4P9U A;  3N4M A;  3S1N J;  3T8T A;  4CCL A;  2K9M A;  3KX2 A;  3PO3 J;  2PMH A;  1D5V A;  1VQ6 I;  2XGD A;  2HFH A;  3GFM A;  1MDM B;  3PFY A;  3H9J A;  1ZRF A;  2GAU A;  2PFB A;  1HBX G;  1XGM A;  2V6C A;  1LDK B;  2LKP A;  2LRD A;  3RKW A;  1XGN A;  2L5Q A;  2V79 A;  4ENN A;  1LFU P;  1HKS A;  4XKW A;  2IA0 A;  2BVL A;  3LA7 A;  4N4N B;  1KQ9 A;  1T6S A;  3J80 Z;  4L0Y B;  2OZU A;  3ZN0 A;  4II3 A;  1F9N A;  5HDN A;  1T0F C;  2JRT A;  1DGR M;  3WTY C;  3A2K A;  2M87 A;  2LC2 A;  3ZGK A;  3LSK A;  4Y17 A;  5DUI A;  1QVU A;  5KCM A;  1O3R A;  5H6R A;  3A02 A;  4RGX A;  1F43 A;  4XKC A;  5L3B A;  2DT5 A;  4L18 B;  1MNE A;  5TJJ A;  1XG1 A;  2WTE A;  4WWC A;  2PEX A;  2HQ5 A;  1YRN A;  3RQ4 A;  5HDK A;  2DYR H;  5J1R A;  3ABM H;  2X6O A;  3K1P A;  3L7W A;  1ZLK A;  4RLF A;  2V1X A;  3DF8 A;  5LGN A;  4HBL A;  2HTS A;  1X58 A;  3IKV A;  2R7Z J;  3V8J A;  2GIZ A;  4RGR A;  2L9N A;  3QRF F;  1WI3 A;  3I58 A;  5HLT A;  1E0E A;  4U7D A;  3TO7 A;  1S8N A;  5HS8 A;  1AKH B;  4NC6 A;  1FC3 A;  2DMU A;  2VJ5 A;  3MKY B;  5D5U B;  2OA4 A;  4C3I J;  3K4J A;  5FLX Z;  2CV0 A;  5GAD J;  4M72 A;  3NAU A;  2NNN A;  3TOA A;  1AA7 A;  3BTJ A;  3L2U A;  4G8X A;  3KZZ A;  1QA6 A;  2JVH A;  2HKX A;  1KYW A;  4KT6 A;  3K4M A;  4Q47 A;  2CWE A;  4S04 A;  3ISP A;  4BQA A;  2W00 A;  4E7J A;  4EEF G;  2KT0 A;  3C1D A;  2MW8 A;  3ZXS A;  4ENJ A;  2VKE A;  3FX3 A;  1VQL I;  1ZG1 A;  3QU6 A;  3DEE A;  4H4K C;  2MGQ A;  1ETY A;  2IGO A;  3NWS A;  3IH2 A;  1TQI A;  5J8C A;  4XQF A;  2IXS A;  3LQQ A;  1BI2 A;  3ZQC A;  1RR7 A;  1JI8 A;  2GIV A;  3IUO A;  2NS7 A;  1XSV A;  2VOP A;  3DPL C;  4AYB A;  1Q1V A;  3L09 A;  3BJA A;  3QQA A;  5L3F A;  2X48 A;  1OCO H;  2EFO A;  3WTZ A;  4JK1 X;  1D0Z A;  4HOB A;  1FIA A;  3LL7 A;  2Y48 A;  4CSW A;  2CQN A;  4M3F A;  4U87 A;  2ZJR F;  4CIC A;  2HPM A;  4G94 A;  2E7W A;  2ZJ2 A;  4PSW A;  3H1C A;  2PG4 A;  3UNG C;  5D5W B;  4ZC3 A;  2GZW A;  1R4M B;  3FZV A;  2FE3 A;  4LG0 B;  4IRG A;  1FTT A;  3OSF A;  1EH8 A;  4CCO A;  2OBP A;  1IAW A;  1F4K A;  3FKI J;  2JWT A;  3GME A;  3FXK A;  3Q3S A;  1P4W A;  4DNC A;  2ACJ A;  2HNH A;  3M8F A;  4R79 A;  2M4K A;  2YUS A;  2P7C B;  3SDB A;  5JVG F;  2NVY J;  3I4N J;  1P6R A;  2A07 F;  3DKW A;  4KDP A;  1O57 A;  4XR6 A;  2GBY A;  1TC3 C;  1JKP C;  3ZMZ A;  2M8E A;  3PFI A;  1ON2 A;  1K7A A;  2IS6 A;  1J75 A;  2V1D A;  1MZB A;  2MBF A;  3JRH A;  4I01 A;  3COA C;  1KU3 A;  1EA3 A;  1KA8 A;  2PMZ A;  3WTU C;  1VQ7 I;  3QU3 A;  1FOW A;  1WSU A;  1K6Y A;  2CQX A;  3JRB A;  1O7F A;  3I0T A;  3LSI A;  4BEH A;  3BDD A;  4G6D A;  2VKV A;  3HPH A;  4ON0 A;  1S29 A;  3M9A A;  3S3N A;  3F8B A;  1IV8 A;  2ZCW A;  1OCR H;  2G0E A;  2JPC A;  3HC7 A;  3IHU A;  2ZB9 A;  4BQN A;  1YTY A;  3W2A A;  2Z99 A;  3DPT A;  3GZ5 A;  2HEO A;  3BTL A;  1IN5 A;  2QKL B;  2NRA C;  2L9R A;  3AG2 H;  1LEA A;  4QIW N;  3I56 I;  3TBI A;  4PJ0 C;  3A1Y A;  1FSH A;  2DLL A;  2L3D A;  3BR2 A;  3HKZ N;  1G3T A;  5BNG A;  2KZG A;  2FEZ A;  1JE8 A;  1DP7 P;  3CO7 C;  1BJZ A;  3TW6 A;  2IT0 A;  4YII A;  4A3D J;  4Q5S F;  5J40 A;  2JZY A;  3U21 A;  4KIT B;  1H8A C;  1YLF A;  1E17 A;  5LRR A;  2P0W A;  3IWZ A;  2M4G A;  5D6F A;  2ISY A;  2CFX A;  5DV5 A;  3BP8 A;  4DZJ A;  4YFK F;  3FK7 A;  4AIK A;  5E3N A;  3Q9V A;  2ETH A;  3CCL I;  3CCS I;  3QWL A;  2K27 A;  2HYG D;  2KRF A;  1ZGJ A;  1Z7U A;  5F1J A;  4IJA A;  1LDD A;  2D1V A;  3K69 A;  3LSH A;  4D5C A;  2E5Z A;  2R7X A;  1QRY A;  2JSC A;  3HSF A;  3JSP A;  1YJ9 I;  1ERD A;  3SZT A;  2WA0 A;  2R7O A;  3NQO A;  2VE9 A;  1IJW C;  4Y7N J;  5K7F A;  4GRI A;  1MD0 A;  3D0S A;  4DBQ A;  3C2B A;  3P9K A;  3BR3 A;  4A3I J;  4I99 C;  4B44 A;  1L3L A;  1HLV A;  1LNW A;  3W3C A;  2K3F A;  5AIQ A;  3K70 C;  1MJ9 A;  3IKT A;  4RAF A;  1J0R A;  1VND A;  2KRH A;  5EYR A;  4ZTJ A;  9ANT A;  4PJM A;  2PMU A;  2HOS A;  1ETX A;  5D4S A;  3BJO A;  1U5T C;  5JR3 A;  2FBI A;  1IN7 A;  2JTV A;  3S3O A;  4L9N A;  3KEY A;  4QLC U;  2QQB A;  4A3K J;  3PSF A;  1RR8 C;  2BYV E;  1JTY A;  3BLY A;  4KYW A;  1OFC X;  4L5I A;  4EJU A;  1HOM A;  1Z6R A;  1TQM A;  3OR1 C;  1BOB A;  1ZGW A;  2YSR A;  3KLO A;  1FOX A;  3HYI A;  1XMK A;  5E3L A;  2VJI A;  1X3W B;  4XIC A;  2R7Q A;  3G1O A;  4M74 A;  1NH3 A;  2CG4 A;  1G4D A;  2DDB A;  2PN6 A;  4IZZ A;  4DQ2 A;  1WVR A;  4BGD A;  4XLA A;  1UMQ A;  2DPU A;  1QPI A;  1Y8Q B;  1HST A;  3KCC A;  3HIF A;  3CMA I;  4E6K G;  2P5K A;  3V42 A;  4HF0 A;  1KGS A;  4E7K A;  4F3Q A;  5D8K B;  3S17 J;  2GQQ A;  5K5O A;  4ZYD A;  3DLL F;  1SFK A;  1ZRD A;  2AO9 A;  3IH4 A;  3FXO A;  5EGO B;  2E1M B;  1A04 A;  1M1E B;  2IPQ X;  4DYR A;  3WTV C;  3K7A J;  2PLY A;  3I9V 2;  4XM3 A;  2ISZ A;  4J19 A;  1VQM I;  5E1Z B;  4BQO A;  2A3S A;  3IRR A;  2R7U A;  1J7K A;  4MEY F;  4WXH A;  3PIP F;  4BAC A;  4I02 A;  3M1C A;  3H3V K;  3IWF A;  2ZFU A;  2EA2 A;  1DUX C;  4GFB A;  2IA2 A;  1YQA A;  4KJZ A;  2RAE A;  3JRF A;  4A3G J;  3CUQ A;  2WAF A;  3JR9 A;  3WE3 A;  1JGS A;  5FJ8 J;  3FM3 A;  5HLG A;  3BCB A;  2HOE A;  1KQ8 A;  2OPT A;  1KU9 A;  3HHH A;  4QPO A;  2XRO A;  1ENH A;  2OC6 A;  1ZRC A;  2N8G A;  2IS1 A;  1CF7 A;  4OIP F;  3E5Q A;  5J3L A;  2FNA A;  3CP8 A;  2EV0 A;  1N25 A;  3OYE A;  3FF5 A;  2WY7 Q;  1J2X A;  2K5C A;  1MMS A;  1JT0 A;  1W1W E;  4ZDO A;  4LOC A;  3WU0 A;  5J1U A;  2VOD A;  5CPR B;  3GVA A;  2EZL A;  5E79 C;  5F04 A;  4QWQ A;  1BW5 A;  1WZ2 A;  4RM3 A;  5EZG A;  2DK8 A;  3BTI A;  3ZP5 A;  2H1K A;  4U0W A;  2DT7 B;  2F5V A;  2DW4 A;  4YEJ A;  4I2O A;  1QZY A;  2WAQ A;  3RIR A;  4LB5 A;  1S6L A;  3EYY A;  3JRE A;  3TMO A;  3KLN A;  2DQL A;  2BEO A;  1FPQ A;  1KZH A;  2ZO4 A;  4HSR A;  3HOV J;  2CUJ A;  2QBY A;  4HEA 2;  1YX3 A;  2XRL A;  4N0B A;  4CH7 A;  1BN5 A;  2LY9 A;  1Z6T A;  2PMZ N;  5HNF A;  3LSP A;  1UJ8 A;  5FGM A;  1UZC A;  3QPS A;  4ZTF A;  3TP0 A;  3I4P A;  1LUJ B;  2V26 A;  4BBS J;  4UV8 A;  4GCV A;  2FSW A;  2Z9O A;  2A68 F;  2KIM A;  1QPM A;  3DP7 A;  3KFW X;  1XGO A;  3ABT A;  1ZYR F;  2K4J A;  4R8H A;  3LA2 A;  1QGP A;  4M3G A;  4HV6 A;  3CCM I;  1BR1 A;  2HOA A;  2HS5 A;  2STW A;  3A01 B;  1U8B A;  1JHH A;  3GTK J;  4HZF A;  2H1L A;  3CF2 A;  3GWZ A;  5B3S H;  1IF1 A;  1V5E A;  2V7F A;  3BG7 A;  4KIC A;  2HZD A;  3B73 A;  2VC0 A;  4IHS A;  2Z2S B;  4FTH A;  1H0M A;  4HA8 A;  4JP0 A;  2LR8 A;  4N4O B;  2HGC A;  3RI4 A;  2IJL A;  3A0B C;  1UB9 A;  3Q0U A;  1CQT A;  2JN6 A;  3ELK A;  4P96 A;  2DN0 A;  3BPX A;  3E6D A;  3FXL A;  2P8T A;  4A5N A;  5LLQ A;  2WV0 A;  3RDI A;  5JHU A;  3KZI C;  2XAJ A;  4A6D A;  3CD6 I;  2B7E A;  2RC4 A;  1MKM A;  2Q2E B;  4LK1 F;  1MBF A;  1NG6 A;  1WJ5 A;  4C30 A;  4PGH A;  2ELK A;  4JX6 A;  1TQP A;  4DYC A;  3I3L A;  3I71 A;  4DJA A;  2RV8 A;  2K40 A;  2ZNY A;  3CCQ I;  4GO1 A;  1VZ0 A;  3MQ0 A;  2O0Y A;  3CUO A;  1X19 A;  3MKL A;  3D5S C;  1IZ1 A;  1J59 A;  2VKD A;  2Y69 H;  1S72 I;  5DCM A;  1X1D A;  3JTG A;  5ILV A;  3HOT A;  2CQK A;  3V7R A;  1TBX A;  3D5L A;  4BKX A;  1JKQ C;  2FQ3 A;  2PJR A;  2LP0 A;  3F72 A;  4E7Z A;  3NWT A;  2XAF A;  5CYV A;  3EPZ A;  4G6T B;  3CJN A;  2VT2 A;  1V4R A;  3DKY A;  4YG2 F;  1VQN I;  4A3F J;  4IVN A;  2EZH A;  2LH9 A;  1A5J A;  4P5O A;  1B9M A;  2Y2Z A;  3NRV A;  4GDF A;  4RGS A;  5FLM J;  4PUS A;  1Z91 A;  1B72 A;  5HS9 A;  1SMY F;  1EF4 A;  1D1B A;  2VAS A;  3OV8 A;  4UB8 C;  1PUF A;  2M30 A;  2TCT A;  5E8G A;  2MA3 A;  3K4L A;  2LF8 A;  4AWX B;  3F9K A;  3CDI A;  4IRI A;  2XUB A;  1TWG J;  4HG2 A;  5D8L B;  4EJV A;  2W85 A;  3W6V A;  3T0Y A;  3B6A A;  5FRN A;  1OJL A;  5D5X B;  1EH7 A;  4LLG F;  2YX4 A;  4CYD A;  2Q1Z B;  3JRA A;  5GPC A;  1Z21 A;  1HSJ A;  4IO9 F;  2J5O A;  2CW7 A;  3ZMD A;  4UHT A;  2XPW A;  3L2R A;  1A36 A;  5EJC A;  2YU9 J;  4NB5 A;  3LQR A;  2QQ9 A;  1U78 A;  1TWF J;  1ODD A;  3R0A A;  4ZJZ A;  3OIQ A;  2VXZ A;  3HEF A;  1SVM A;  2VL8 A;  4OU0 A;  3L2W A;  2H8W A;  1HC8 A;  1BJA A;  1HW1 A;  1V5F A;  2FBH A;  1RKW A;  1U5T A;  3PNY A;  3S2H J;  5FKM A;  1AOY A;  5EZH A;  2O9L A;  5E3M A;  3JCU C;  3OL3 A;  2BE5 F;  5ICE A;  2XC7 A;  2QSF X;  3BY6 A;  3M4O J;  2KDO A;  3CLQ A;  5DYM A;  3FBN B;  2R5Y A;  4IEJ A;  1CGP A;  3S15 J;  2A6H F;  1MBH A;  2L9V A;  2RQQ A;  2XVC A;  2ZKZ A;  1R5H A;  3MWM A;  5C3E J;  5FLX K;  2FNP A;  1R1T A;  1Z77 A;  2VI6 A;  1TW2 A;  4PDK A;  2XAU A;  1GDT A;  3C7J A;  1JUS A;  2IS4 A;  3TW7 A;  1OR7 C;  1H9G A;  2LKX A;  3HM5 A;  5DDG A;  3WTW C;  4FQG A;  3VYR B;  4BH9 A;  1I50 J;  3GX4 X;  4GGG A;  4A12 A;  4AID A;  1LVK A;  3LA3 A;  1U8R A;  2JMW A;  4HNV A;  3CME I;  2HDD A;  2WAQ N;  3A4C A;  2BOL A;  3F8M A;  2F5E A;  4OMZ A;  3FMS A;  3OR2 C;  3X2Q H;  2F2E A;  3L00 A;  3OYM A;  1XDU A;  4B8X A;  2BVM A;  5IP9 J;  4UNO A;  4UB6 C;  4BDY A;  2AQF A;  1LB2 A;  1Z3X A;  4B3A A;  2P6S A;  1RZ4 A;  2VQL A;  2B63 J;  4I98 B;  3UKG A;  1R00 A;  4DBR A;  2KHM A;  4JOM A;  2AXT C;  3KZY A;  2FBK A;  1P2F A;  4HDU A;  1HA8 A;  2ZBK A;  1YYV A;  5LHI A;  2GWR A;  1W7P A;  4NBQ A;  4YIF A;  4MTD A;  3FIW A;  3PUF A;  2HXI A;  2M8G X;  2QKM B;  2EH3 A;  3WG9 A;  2COB A;  5IT9 Z;  1EH6 A;  4Y3O A;  1MSF C;  2EIK H;  1WJA A;  1X3Z B;  5HNH A;  3FWE A;  1ZTR A;  1P7J A;  2WB1 A;  1S3J A;  2ZXI A;  3GW2 A;  2GOM A;  2BY2 A;  4M9S A;  4PJJ A;  4A6E A;  5E17 F;  2AXL A;  1YIT I;  4A93 J;  2IGN A;  3JRG A;  1S7E A;  1R4N B;  2DOD A;  2HYJ A;  5F08 A;  2RQP A;  3ABL H;  4OOI A;  4IXA A;  1PUE E;  4M3E A;  3EUH C;  3CMM A;  1Q1H A;  3HOU J;  3DCF A;  3V7S A;  4QTR A;  4N9I A;  3GTG J;  3IL2 A;  2ZME A;  2BY3 A;  2DCE A;  1OCP A;  2E1M C;  4FE7 A;  1ZR2 A;  3LSJ A;  4CDG A;  1IDZ A;  4RBO A;  3KEQ A;  2LY2 A;  3ECO A;  4Y33 A;  5CVI A;  2HVS A;  3OIO A;  2FF4 A;  2VPL A;  2IBD A;  2ESN A;  3ASO H;  4WXD A;  2LOO A;  4LK0 F;  4ESJ A;  5JHF A;  1Y56 A;  1XPX A;  4XMY A;  5E3O A;  2QM3 A;  1BR2 A;  3ZQF A;  3J81 K;  2YS9 A;  4LJZ F;  3WTS C;  4D7M A;  3DU6 A;  1DGW Y;  2DJI A;  3KP4 A;  3RSN A;  1FMV A;  4GYI A;  1GVJ A;  1KON A;  3DTE A;  5FD6 A;  1JGG A;  2HVR A;  3HPG A;  4F55 A;  2Z1D A;  2EK5 A;  2KIU A;  3TDZ C;  3GFL A;  1FBU A;  4Q4Z F;  1W5T A;  1Y0N A;  3S8P A;  4X6A J;  2HXO A;  4PGG A;  3UR3 C;  1ZR4 A;  2EV5 A;  5E1W A;  5EEA A;  3TO6 A;  3OYJ A;  1WQ2 A;  3FKJ A;  4NC8 A;  4AUX A;  3ESW B;  1SVL A;  5HVQ C;  5A2Q Z;  3PNT A;  4UVC A;  3PSI A;  2BBY A;  3OL4 A;  3ZRG A;  3HOW J;  1J5Y A;  1WJF A;  1QHH D;  1YW7 A;  2DO7 A;  4BNC A;  2F5C A;  2WY8 Q;  1X1P A;  3TO9 A;  3WTX C;  4B1R A;  3OY9 A;  3HDD A;  4D7N A;  3BG3 A;  2Y31 A;  3K4B A;  5LFA A;  3FMR A;  4M6Y A;  3F21 A;  2MLG A;  3F3X A;  4V2G A;  4KIF A;  2LYC A;  1I3Q J;  2KJB A;  4XKB A;  4ZH4 F;  3CO6 C;  3OS2 A;  4IHV A;  4ASN A;  4A3M J;  4FT8 A;  2JA5 J;  1ON1 A;  2UV1 A;  5IYC J;  4X1E A;  1MBG A;  3ABK H;  2DA1 A;  3K2Z A;  1HKQ A;  4XOP A;  3E1S A;  4GYG A;  2GOX B;  2DOA A;  1QNT A;  4UXN A;  1TWC J;  3GZN B;  3JRC A;  2G9W A;  4LB6 B;  4BE1 A;  4NC7 A;  4ZYH A;  1RRJ A;  3ECH A;  2QVO A;  4BEH B;  3CCU I;  2HQN A;  1ZAR A;  2O8X A;  2IEK A;  3PM1 A;  3G1L A;  4MFD A;  4XRS A;  3OYB A;  4MIM A;  1K79 A;  4UUS A;  3WU2 C;  4A69 C;  5F6F A;  4YRV A;  4LIU A;  4U7B A;  2ELH A;  3FMQ A;  2O8K A;  1D1A A;  2YR2 A;  2M7A A;  3PO2 J;  1EV7 A;  5HOD A;  2F6C A;  3AG4 H;  1UHS A;  4KMU X;  3VOD A;  5B1B H;  2X1D A;  4I0A A;  4BXU A;  4E7H A;  1BL0 A;  2JA2 A;  3ABU A;  2E2J J;  4MQV A;  5F0H A;  4OIR F;  3L1P A;  4ANJ A;  3ONQ A;  3D5R C;  1QO0 D;  4LGW A;  1V5G A;  3M1E A;  3H0D A;  4XRF A;  2M0C A;  1SFX A;  1ETW A;  2VN2 A;  4PK4 A;  3OYA A;  1MBJ A;  5J47 A;  1RIO H;  1P4X A;  2DYS H;  3VOE A;  2XHK A;  3QAH A;  3PNV A;  1XSX A;  2E2H J;  1LFP A;  3C18 A;  2MH9 A;  2XIG A;  3LSM A;  3LST A;  3QOD A;  4FHT A;  3RKX A;  5B66 C;  2M2E A;  2OQG A;  4BE2 A;  1BI1 A;  2JQ7 A;  2OD5 A;  4KN4 X;  4U0V A;  1VQ5 I;  2H27 A;  2CH0 A;  3LMM A;  3R60 A;  3JAM Z;  4DZP A;  1J9I A;  1RPW A;  2A61 A;  3FXR A;  1B6A A;  1D0Y A;  2K3P A;  4RS8 A;  2D1H A;  3ERM A;  4NQW A;  1USS A;  5K5Q A;  1T56 A;  5M5W J;  3FK6 A;  4OAY A;  1ZLJ A;  3K6G A;  3LFU A;  2Y0M A;  3R4K A;  2JUG A;  2ECC A;  2L9S A;  3F6O A;  3GTJ J;  2FML A;  5K7Z A;  4DW6 A;  4UVA A;  2R7R A;  1R9T J;  3HGG A;  2E7X A;  4HYE A;  2OCE A;  4CGZ A;  4M71 A;  2O6G E;  1YOV B;  2LBF A;  4IHT A;  3GYH X;  5LHG A;  3MVP A;  1QU3 A;  2QQA A;  2QUF A;  4K2E A;  3ZMU A;  4HF2 A;  3DU5 A;  2HPI A;  2ZSI B;  4NDL A;  5J6X A;  1MMG A;  2L4M A;  2WB1 N;  1PYV A;  2L0K A;  1T2K A;  1OCC H;  4LIV A;  4HNU A;  1IUY A;  4BJ6 C;  5D4R A;  2L7F P;  5JFR A;  3I59 A;  5FLV A;  2K9S A;  3CC4 I;  1APL C;  2CMP A;  3DTK A;  4HLX A;  3KYC B;  4BHB A;  3ZMT A;  1P9Q C;  3JSO A;  2XPU A;  3OMY A;  5LD2 C;  1VFC A;  1OR7 A;  1B4A A;  2A6E F;  2Y30 A;  1T33 A;  4XL9 A;  1REP C;  5FRM A;  1P4A A;  3F6V A;  4RMN A;  5FD5 A;  1IG7 A;  4RA2 A;  3BZK A;  2V6E A;  1TWH J;  4CO8 A;  4ESF A;  1JKR C;  1OIS A;  2ZSH B;  5DUK A;  2HKO A;  1FBQ A;  4S05 A;  3BZC A;  4TV7 A;  5F27 A;  4EAT A;  4E70 A;  5CQE A;  1Z67 A;  5K5R A;  2W24 A;  4EGY A;  3L2V A;  1YS7 A;  3H5A A;  3N97 A;  3ROU A;  1YW9 A;  1YHQ I;  1T98 A;  2M0M A;  2XKO A;  2GXG A;  3PJR A;  1ZG5 A;  1ZAO A;  2HZT A;  3BCA A;  4KA4 A;  2DXI A;  3CUQ B;  1U3E M;  3K1M A;  1ZG3 A;  2BY1 A;  5HLI A;  2VQH A;  2QSH X;  4I6Z A;  3J7A O;  1WFX A;  2O61 A;  3H35 A;  2E1N A;  5J4Y A;  3H9Q A;  2K7L A;  1MMN A;  4F92 B;  3MKW B;  3BQY A;  1WKM A;  2VOO A;  3IH3 A;  1YJN I;  3C3W A;  2EIM H;  1Y0U A;  1CF7 B;  3KP2 A;  1BC7 C;  1MJA A;  3E0J B;  5FKK A;  2B0L A;  2VBY A;  2EQR A;  1IGN A;  1R22 A;  2VUM J;  1WJC A;  2E71 A;  4KN7 X;  1B59 A;  4BXX J;  4CCK A;  4EJT A;  4BS9 A;  4XRM A;  1BM9 A;  1T0F A;  4AYB N;  2QWW A;  5FKL A;  1ZGA A;  3HGY A;  2Y0S A;  3TL4 X;  4E7I A;  1IRZ A;  3P9I A;  1BBY A;  2BHY A;  2ME6 A;  4LLN A;  1FTZ A;  4C3H J;  1U6G A;  4WK8 F;  2DTZ A;  2RVC A;  1HDP A;  1J09 A;  4G9Y A;  4B09 A;  4RAG A;  3G73 A;  3DXJ F;  1C0W A;  1JKO C;  1U2W A;  2EFN A;  2VE8 A;  2CW8 A;  1S7O A;  5BQT A;  1O7L A;  3QOE A;  2QBY B;  1OQY A;  2MLK A;  3HJE A;  1FZP B;  4M3D A;  2F4O B;  5DS9 A;  4PFP A;  3O8G A;  3U1K A;  3AAF A;  2P5V A;  4O5V A;  3S1M J;  4M6X A;  3GLL A;  1FIP A;  1BA5 A;  2L7Z A;  2DDA A;  4A3E J;  1IV6 A;  3BC8 A;  3RPU A;  2DT6 A;  5FFZ A;  3EUA A;  3TQN A;  3I53 A;  3MEX A;  3REO A;  1Z7L A;  2MC4 A;  2DK5 A;  2Z16 A;  1HF0 A;  5L3G A;  3HSR A;  1Z05 A;  3WGI A;  2ZXJ A;  2R5Z B;  1SD7 A;  4BL0 B;  3E3V A;  4RLQ A;  3WE2 A;  1IN4 A;  5TIS C;  4BDZ A;  2CUZ A;  1D8K A;  4FX0 A;  2NS8 A;  2Z3Y A;  3RYP A;  1TW3 A;  1WWX A;  4A3J J;  1FOY A;  4OWR B;  2NVQ J;  1W0T A;  1FWZ A;  4XLH A;  4EVI A;  4KT5 C;  1H89 C;  3SFI A;  4PCQ A;  2EFP A;  1EKE A;  2LNB A;  1F5T A;  4R1H A;  4RB1 A;  4UUV A;  2F4M B;  2LTP A;  3TKY A;  5CVV A;  2OUM A;  2UXN A;  1FP1 D;  4M9Z A;  1NHA A;  3WGG A;  4AU7 A;  3QPT A;  5ICC A;  3DBR B;  1SFE A;  3J7Z I;  1VQP I;  3OOU A;  3CDH A;  5B5E C;  4HQM A;  2ZNZ A;  2RN7 A;  2XF6 A;  1QHG A;  3JW4 A;  1MMD A;  2X0L A;  3TGN A;  5BS6 A;  1IXC A;  2M5W A;  2JA8 J;  1HW2 A;  5J1Y A;  3F23 A;  1K4S A;  3BG5 A;  4B43 A;  3K4N A;  1S9H A;  2LK2 A;  3QPL A;  4IQ4 A;  3E5X A;  1ZQ3 P;  4ENM A;  1IXS B;  1W4M A;  2KLO A;  2A5Y B;  2UZK A;  3MFK A;  2BXY A;  3G6E I;  2NXN B;  2MG4 A;  3RYR A;  1R49 A;  2JSP A;  4PJN A;  3PIO F;  3KP7 A;  2FOK A;  4Y15 A;  3CCJ I;  3CZ6 A;  1N78 A;  2LLK A;  2PX9 A;  2R7F A;  2WBM A;  2KKO A;  4LD5 A;  3AG1 H;  2R7S A;  1SD6 A;  4RDU A;  5DCM B;  3VYU B;  5BPI A;  4A0Z A;  5HDG A;  2E60 A;  5BOX A;  1H9T A;  4ZZL A;  1Y1V J;  2L02 A;  1D0X A; 
#chains in the Genus database with same CATH homology
 1P7I A;  1K83 J;  2K9N A;  3LOC A;  1JJ8 C;  3NAR A;  4B3A A;  2YUS A;  2LVS A;  3I4N J;  2NVY J;  4MFE A;  3BR5 A;  3LNQ A;  2B63 J;  3UKG A;  2GBY A;  1TC3 C;  1JKP C;  1FJL A;  1AHD P;  3HBL A;  3ZQH A;  3JRH A;  3ZQL A;  1ETQ A;  3WHC A;  1MNM C;  2L7M P;  3FIW A;  1B72 B;  2HXI A;  2M8G X;  3JRB A;  2CQX A;  2EH3 A;  2COB A;  1PUF B;  5M3F J;  4IHY A;  2VKV A;  1LE8 A;  1MSF C;  2HOT A;  1DU6 A;  2G0E A;  1ZTR A;  1B8I A;  1P7J A;  2ZB9 A;  1MH3 A;  3JRI A;  3SDG A;  2ID6 A;  4W1U A;  3BTL A;  5EGO A;  4A93 J;  2L9R A;  4W97 A;  5GP9 A;  3JRG A;  1S7E A;  2HYJ A;  4MO7 A;  5F08 A;  4QIW N;  5EDN A;  4UUT A;  1IC8 A;  5IYD J;  1X2M A;  2DA6 A;  4M3E A;  3RKQ A;  1LFB A;  3HOU J;  4XRS G;  4A3C J;  3DCF A;  1FEX A;  4QTR A;  3GTG J;  3BR2 A;  3HKZ N;  4FCY A;  1SFO J;  4B4C A;  5C44 J;  1OCP A;  4FE7 A;  5BNG A;  1ZR2 A;  3LSJ A;  1JJ6 C;  3CDL A;  1IDZ A;  4RBO A;  1BJZ A;  3TW6 A;  3OIO A;  2ME0 A;  4A3D J;  2IBD A;  3S14 J;  1H8A C;  1XS9 A;  2CQQ A;  1ETK A;  1RET A;  5E3O A;  3ZQF A;  2YS9 A;  4D7M A;  4DZJ A;  1ITY A;  4M3B A;  3FK7 A;  5E3N A;  1JGG A;  2XGE A;  1MBK A;  5IOY A;  5C4X J;  2EZK A;  2CJJ A;  1AU7 A;  5F1J A;  3S16 J;  3LSR A;  1IUF A;  2X9D A;  4D5C A;  4X6A J;  1QRY A;  2HXO A;  1ZR4 A;  1D5Y A;  1JUP A;  5EEA A;  4AUX A;  4Y7N J;  1IJW C;  5K7F A;  2EBI A;  3C2B A;  3BR3 A;  4A3I J;  2Y0S N;  1K61 A;  1HLV A;  5M5Y J;  5EG0 A;  4FIS A;  1ETV A;  3S2D J;  3HOW J;  1VND A;  9ANT A;  5EYR A;  2HOS A;  1ETX A;  2LFB A;  1Z0X A;  3BG9 A;  4A3K J;  4B1R A;  2D5V A;  3HDD A;  4D7N A;  2R5Z A;  2WV1 A;  4CYC A;  1JTY A;  3BG3 A;  2Y31 A;  1OFC X;  1HOM A;  2FJ1 A;  1XC5 A;  4V2G A;  2Y9Z A;  5DTD A;  5IP7 J;  2KDZ A;  1I3Q J;  1ZGW A;  3BR0 A;  5E3L A;  4XIC A;  2R93 J;  2DJN A;  4IHV A;  4A3M J;  2JA5 J;  1GV5 A;  2QCO A;  3G1O A;  2CUE A;  4BY7 J;  5IYC J;  2M9H A;  4X1E A;  1MBG A;  3CCY A;  5IOZ A;  2E2I J;  2DA1 A;  3DEW A;  3G1M A;  1UMQ A;  1QPI A;  4C3J J;  1TWC J;  3JRC A;  3A01 A;  1LE8 B;  2CU7 A;  4AC0 A;  4BBR J;  2IEK A;  3PM1 A;  3G1L A;  4MFD A;  5GPA A;  4XRS A;  4MIM A;  4UUS A;  1B8I B;  3S17 J;  1GVD A;  2O7O A;  4A69 C;  4M6V A;  2DA2 A;  2AO9 A;  3IH4 A;  5IYB J;  5EGO B;  3TP3 A;  3OSG A;  2GLO A;  4DYR A;  1VI0 A;  2O8K A;  1WH7 A;  3K7A J;  4IHX A;  3PO2 J;  3WHB A;  4J19 A;  3H0G J;  4MLO A;  1U9O A;  5HOD A;  2DA4 A;  1YRN B;  2DA5 A;  2XB5 A;  1UHS A;  3K2A A;  3ZQG A;  4Y52 J;  1E3O C;  1ZK8 A;  1BL0 A;  3HOZ J;  3H3V K;  2E2J J;  1GV2 A;  1WCM J;  5F0H A;  3BT9 A;  4GFB A;  3JRF A;  4A3G J;  2RAE A;  4V2F A;  3JR9 A;  3L1P A;  5FJ8 J;  2Y9Y A;  2OPT A;  5JLX A;  3CQZ J;  1ENH A;  2M0C A;  1ETW A;  3ZQI A;  1RES A;  3LSG A;  1MBJ A;  2N8G A;  2HI3 A;  3GBG A;  5J3L A;  1TWA J;  2E2H J;  1ETO A;  1JT0 A;  2M2E A;  1GT0 C;  3D1N I;  4LOC A;  1WH5 A;  4S0H B;  2NVX J;  5J1U A;  2EZL A;  5F04 A;  4DZP A;  1BW5 A;  5EZG A;  1RPW A;  5F0C A;  3GTM J;  5EG0 B;  3BTI A;  5M3M J;  2H1K A;  1NK2 P;  4IHW A;  4D5F A;  2GM4 A;  3GTL J;  1POG A;  3HOY J;  1T56 A;  1Y1W J;  5M5W J;  3FK6 A;  2R0Q C;  2R5Y B;  3JRE A;  2H8R A;  2ECC A;  1X2N A;  3HB9 A;  4C2M J;  3GTJ J;  3HOV J;  1QVT A;  4CYC B;  2XRL A;  1W0U A;  1ZKG A;  5K7Z A;  2LY9 A;  4DW6 A;  3HOX J;  2PMZ N;  2IAI A;  3LSP A;  1R9T J;  3HGG A;  3SJM A;  2XPV A;  3QPS A;  3TP0 A;  3BR1 A;  3MN2 A;  3IV5 A;  3S1R J;  4BBS J;  1DU0 A;  3MVP A;  1WPK A;  2JJ7 A;  1O4X A;  1G2H A;  5M5X J;  2TRT A;  1MBE A;  5JLW A;  2I10 A;  4NDL A;  2DMT A;  4A3B J;  3CMY A;  5C4J J;  2WB1 N;  1VF9 A;  2L0K A;  5EF6 A;  1JUM A;  1JT6 A;  2XGC A;  1SAN A;  2L7F P;  3VPR A;  3GTP J;  2JA7 J;  5FLV A;  1AKH A;  3S1Q J;  2K9S A;  4M3G A;  3BR6 A;  2HOA A;  2LD5 A;  1APL C;  3JRD A;  3A01 B;  1U8B A;  3GTK J;  2FX0 A;  1RKT A;  2XPU A;  1VFC A;  4JX5 A;  4UUS B;  1UG2 A;  2Y30 A;  1T33 A;  4FTH A;  4JP0 A;  2FD5 A;  2LR8 A;  3B6C A;  1F36 A;  3O8H A;  1IG7 A;  3BQZ A;  1TWH J;  2DMN A;  2E1O A;  1NTC A;  1A6I A;  1JKR C;  1CQT A;  3Q0U A;  2JN6 A;  2ECB A;  5F27 A;  2DN0 A;  2JA6 J;  3RQI A;  2JK3 A;  2QF7 A;  3GTQ J;  2AHQ A;  2R92 J;  1MBF A;  3F0C A;  3TED A;  1I6H J;  2ELK A;  4JX4 A;  4JX6 A;  4DYC A;  4I6Z A;  4L5E A;  3RZO J;  2K40 A;  3BQY A;  4XK4 A;  1NK3 P;  2VPR A;  3IH3 A;  2DA7 A;  3FIS A;  5FKK A;  3S1N J;  2W48 A;  3MKL A;  2EQR A;  1IGN A;  3PO3 J;  2VUM J;  4BXX J;  2XGD A;  1OCT C;  2XSD C;  5K7H A;  4XRM A;  4A3L J;  4AYB N;  5FKL A;  3HGY A;  3E7L A;  4BKX A;  1LFU P;  1IRZ A;  1JKQ C;  2ME6 A;  1FTZ A;  2LP0 A;  4C3H J;  2DTZ A;  2FQ4 A;  1HDP A;  3BTC A;  4A3F J;  1QVU A;  2EZH A;  1JKO C;  3A02 A;  4QSH A;  1A5J A;  3I4M J;  1F43 A;  5F0F A;  2E19 A;  2Y2Z A;  4BY1 J;  5FLM J;  1XG1 A;  5FKN A;  4M3D A;  1B72 A;  5DS9 A;  2OF7 A;  1EF4 A;  2HQ5 A;  3O8G A;  1YRN A;  4ABZ A;  3Q0W A;  1PUF A;  5IP6 A;  3S1M J;  5J1R A;  1FIP A;  2X6O A;  2NVT J;  2L7Z A;  4A3E J;  2K9Q A;  2TCT A;  1IV6 A;  3GTO J;  1BA5 A;  1MSE C;  1X58 A;  1JTX A;  1TWG J;  2R7Z J;  3W6V A;  2DMQ A;  5FKO A;  1HF0 A;  1WI3 A;  3B6A A;  4FE4 A;  1OJL A;  5IPA A;  1GUU A;  2R5Z B;  4I76 A;  3JRA A;  1AKH B;  2DMU A;  5GPC A;  2DMP A;  4C3I J;  1WGX A;  2CRG A;  2NS8 A;  4A3J J;  3NAU A;  2XPW A;  3BTJ A;  1ORK A;  2NVQ J;  2YU9 J;  1W0T A;  1HDD C;  2MSY A;  1MH4 A;  1U78 A;  1TWF J;  1H89 C;  3SFI A;  3HEF A;  4EEF G;  2LTP A;  1RKW A;  2KT0 A;  3S2H J;  2MW8 A;  5FKM A;  1IDY A;  2VKE A;  1H88 C;  5EZH A;  3A03 A;  2O9L A;  5E3M A;  2MGQ A;  1ETY A;  3IH2 A;  3OOU A;  3ZOB A;  4G12 A;  3M4O J;  2NOG A;  3ZQC A;  2EZI A;  1RR7 A;  2JA8 J;  2R5Y A;  5J1Y A;  4IEJ A;  3S15 J;  2NS7 A;  1MBH A;  2P81 A;  3BG5 A;  1Q1V A;  1U9N A;  1BW6 A;  3QQA A;  5C3E J;  2LK2 A;  3QPL A;  2X48 A;  2VI6 A;  1Z77 A;  1ZQ3 P;  2ID3 A;  3M3Y J;  1GDT A;  4DYQ A;  1FIA A;  1JUS A;  4JYK A;  1HCR A;  3TW7 A;  4M3F A;  2LKX A;  3HM5 A;  2MG4 A;  2XB0 X;  1I50 J;  3Q0V A;  2CUF A;  3RZD J;  2DA3 A;  2LLK A;  2M34 A;  2JMW A;  4HNV A;  2HDD A;  2WAQ N;  1FTT A;  4XID A;  3OSF A;  4RDU A;  3FKI J;  2JWT A;  1Y1V J;  5IP9 J;  3Q3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...