2ECCA

Solution structure of the second homeobox domain of human homeodomain leucine zipper-encoding gene (homez)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
GSSGSSGKRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the second Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Homeobox and leucine zipper protein Homez
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eccA00
4BY1J 2DA3A 5DTDA 1FEXA 1U9OA 1TWFJ 1NTCA 3WHBA 1MNMC 3S2HJ 3K2AA 2GBYA 3B6AA 1IG7A 2VUMJ 3PM1A 1JTXA 1I50J 2LR8A 3JRIA 2H8RA 1EF4A 2ZB9A 5F0HA 2MG4A 1X2NA 1TWHJ 2VI6A 3SDGA 5FJ8J 1LE8A 2XGCA 2ME0A 1RKWA 4NDLA 3JRFA 3JRHA 2GM4A 3PO2J 1S7EA 1IRZA 1X58A 2X6OA 3DCFA 1MBKA 5J3LA 1ZR4A 2DTZA 3BG5A 2O7OA 5JLXA 3JRBA 2XGDA 2R92J 3GTGJ 4JP0A 3MKLA 3M4OJ 5FKMA 2Y9ZA 4I76A 1HDPA 1JKOC 2JJ7A 5J1RA 1OCTC 3D1NI 3S17J 4JYKA 1U9NA 4V2GA 5M5YJ 1P7JA 4M3BA 1XC5A 4Y7NJ 3Q0VA 2E2JJ 3GTOJ 3A01B 2COBA 3S16J 2D5VA 3HEFA 3QPSA 3VPRA 5K7FA 3MVPA 1FTTA 3PO3J 1Q1VA 3BT9A 3BR2A 2OPTA 1H89C 3GTPJ 1IDYA 2FQ4A 3LSJA 1QVUA 4JX4A 1I3QJ 4A3JJ 4Y52J 3MN2A 4IHYA 3TEDA 4A3IJ 4EEFG 3O8GA 5GPCA 4XRMA 4C2MJ 5F1JA 2DN0A 4V2FA 2EQRA 2L9RA 2R5ZA 1FJLA 1UG2A 3B6CA 4MLOA 1ZK8A 1JUPA 2Y31A 3JRCA 3G1OA 4C3JJ 1BJZA 1T56A 2M0CA 3HOXJ 2EZIA 3HOZJ 3BR1A 1AKHB 2JA8J 4IHVA 3JRGA 2DMPA 2X48A 1LE8B 2HXOA 3HGGA 4IEJA 4BY7J 2DJNA 1IV6A 3LSRA 1WGXA 1Y1VJ 4QTRA 4W1UA 2RAEA 2EZHA 1YRNB 1YRNA 4A3DJ 5EGOA 3TP3A 2KT0A 4X6AJ 2DMTA 4IHWA 1JTYA 1F43A 5C4XJ 3JREA 4MFEA 3A02A 5IP9J 1SFOJ 1ZKGA 3RQIA 1PUFB 1O4XA 5F04A 3JRDA 5EF6A 3GTLJ 3BQYA 1WPKA 3HOUJ 5J1YA 3GTKJ 3Q3SA 5J1UA 5EG0A 4A3CJ 1ETXA 2YUSA 2QF7A 2JMWA 3E7LA 3IV5A 1ITYA 3ZQLA 2K9SA 1HOMA 4BBSJ 3ZQCA 1JT6A 3NARA 3BR3A 1WCMJ 2WV1A 5EYRA 5K7HA 1R9TJ 1T33A 1JGGA 2OF7A 2XB5A 2MSYA 1DU0A 3HGYA 1TWCJ 1UHSA 3OOUA 2XPUA 2ID6A 2DA7A 2ECBA 3BTLA 1HCRA 2EZLA 1Y1WJ 2CU7A 2JN6A 2M9HA 3ZQIA 2I10A 2EBIA 2IEKA 4FCYA 4M3DA 4A3GJ 1NK3P 2M2EA 5HODA 1LFUP 1IJWC 1VF9A 2ECCA 3S15J 2JK3A 4C3IJ 5IYDJ 2L0KA 5M3MJ 1K83J 3OSFA 4ABZA 3UKGA 1B72A 1VFCA 2NS8A 3CQZJ 1U8BA 1QRYA 5FKLA 3LSPA 5F08A 3RZOJ 3BR0A 1G2HA 3IH2A 2ELKA 2MW8A 1Z0XA 2LKXA 2Y0SN 1OCPA 2KDZA 4D7MA 1I6HJ 5JLWA 3S1MJ 1JUSA 2JWTA 1BA5A 1K61A 2EH3A 2LK2A 4JX6A 2JA7J 2O8KA 3IH3A 5IP6A 4IHXA 4DZJA 3W6VA 4M6VA 3DEWA 2LTPA 3IH4A 3H3VK 1AU7A 2NVTJ 1FIPA 5FKNA 4DYRA 3CMYA 1GV5A 3S1RJ 1RR7A 2XPVA 5E3OA 5F0FA 4AUXA 4XRSG 5E3NA 2DA6A 3OSGA 4A69C 4JX5A 2XPWA 5FLMJ 3TW7A 1MSEC 2R5YA 4FTHA 1ETOA 1OJLA 3K7AJ 4A3MJ 2HQ5A 4RDUA 2DA4A 2VKVA 2X9DA 4BKXA 1POGA 3S1NJ 1RESA 1ETKA 3GBGA 4S0HB 1MBGA 3ZOBA 5FKOA 2R0QC 1ETVA 2CJJA 4C3HJ 4DYCA 1B8IA 1H88C 1TC3C 3BR5A 5E3MA 2W48A 2N8GA 3HDDA 3O8HA 3F0CA 1X2MA 3I4MJ 2M34A 4AC0A 4A3KJ 4CYCB 2M8GX 5FKKA 1CQTA 2LLKA 5BNGA 1P7IA 2NVYJ 1IUFA 1ENHA 4A3LJ 3FK7A 4MO7A 1VI0A 1W0UA 3ZQFA 2K40A 4BXXJ 1ZTRA 1ZQ3P 4XRSA 1ZR2A 1AHDP 1OFCX 2DA2A 2LY9A 1GUUA 1JKQC 1RPWA 2LFBA 2NVXJ 3HOVJ 4QIWN 4D7NA 3S14J 2QCOA 4X1EA 3LNQA 3RZDJ 2VPRA 2WB1N 3H0GJ 2HOAA 5GPAA 5F0CA 4UUTA 5IYCJ 2HOSA 4DZPA 1WH5A 2TRTA 1TWAJ 5EGOB 1JKRC 4M3GA 3I4NJ 2AHQA 2ME6A 1MH3A 2K9NA 4A93J 2NS7A 3SFIA 5IOYA 1XS9A 4M3EA 2XB0X 1HLVA 5C44J 5EEAA 4J19A 2CUEA 3QQAA 1GT0C 5EG0B 1TWGJ 5C4JJ 1LFBA 5M5XJ 3RKQA 2HXIA 2XRLA 3WHCA 5M5WJ 2LD5A 4XICA 3S2DJ 1U78A 2LVSA 1GDTA 2L7FP 1B72B 5M3FJ 1JJ8C 5K7ZA 3BTIA 5C3EJ 5GP9A 1DU6A 2E2HJ 1FTZA 2DMUA 2IBDA 3OIOA 4W97A 9ANTA 4CYCA 1IDZA 2FX0A 1BL0A 1JJ6C 1JT0A 2FD5A 3HKZN 2ID3A 1WI3A 2DA1A 1HF0A 1NK2P 2R7ZJ 3LOCA 1QPIA 2E1OA 1BW6A 2EZKA 2HOTA 2Y9YA 1ETQA 3BTCA 3ZQHA 1E3OC 2L7ZA 3ZQGA 2GLOA 2MGQA 3BR6A 1JKPC 1PUFA 4HNVA 3S1QJ 2DMNA 1BW5A 3CCYA 2LP0A 2O9LA 2XGEA 3LSGA 3TP0A 3BG3A 3FKIJ 2YU9J 3M3YJ 2JA5J 2H1KA 1RETA 1WH7A 5IP7J 2K9QA 1MBFA 2FJ1A 3JRAA 4A3FJ 4LOCA 2Y2ZA 4BBRJ 3SJMA 3HOWJ 2E19A 5IPAA 2XSDC 5DS9A 2L7MP 1MBHA 3NAUA 1VNDA 1H8AC 1B8IB 1W0TA 1MH4A 4QSHA 1AKHA 2WAQN 4XK4A 3HBLA 1A6IA 1IC8A 2CQQA 3A03A 3HB9A 2NOGA 5EZGA 1UMQA 1ETWA 2P81A 1D5YA 2R5YB 4DYQA 4A3BJ 3CDLA 2HYJA 2PMZN 5EZHA 2R5ZB 4D5FA 3L1PA 2CUFA 4G12A 2VKEA 4MFDA 3Q0UA 5IYBJ 2CRGA 2DMQA 1XG1A 1IGNA 3Q0WA 1JUMA 1RKTA 2G0EA 4M3FA 4B1RA 3GTJJ 4GFBA 4DW6A 5IOZA 4A3EJ 5E3LA 4I6ZA 2E2IJ 4FE7A 2R93J 3GTQJ 4FE4A 4FISA 2NVQJ 3BQZA 3FIWA 4L5EA 4AYBN 2DA5A 1ETYA 4RBOA 3BTJA 3BG9A 4MIMA 4D5CA 3A01A 2TCTA 3QPLA 1SANA 4B4CA 1MSFC 1A5JA 1HDDC 2B63J 1GVDA 4B3AA 1FIAA 2CQXA 3FISA 3HOYJ 2AO9A 3G1LA 3G1MA 5EDNA 3GTMJ 1GV2A 3C2BA 2HDDA 1QVTA 3FK6A 5FLVA 1MBJA 4UUSA 1ORKA 4UUSB 1F36A 5F27A 2YS9A 2HI3A 2Y30A 1APLC 3TW6A 2JA6J 3JR9A 2IAIA 1ZGWA 1Z77A 3HM5A 4XIDA 1MBEA
chains in the Genus database with same CATH superfamily
5BPIA 3GX4X 3F72A 4B44A 4A0ZA 1TWFJ 3CCMI 1MNMC 3IWZA 3S2HJ 2GBYA 2YX4A 3LSIA 1I50J 1WZ2A 2LR8A 2H8RA 2ZB9A 2MG4A 3CF2A 3SDGA 1LE8A 2KHMA 1T0FA 3GFLA 3OS2A 2LY1A 3PO2J 2IVMA 1IRZA 1Z9CA 1CF7A 1DQUA 3W2WA 2O7OA 3J7AY 2XGDA 2DYRH 3H9QA 2PI0A 3GLXA 4LIUA 4JP0A 2G7HA 4ZZDA 2QQBA 2GA2A 2XF6A 3CJRB 3CJNA 3K4KA 2E36A 2UV1A 4QPQA 2XUBA 4X0GA 1V54H 5M5YJ 5JHUA 1N75A 2NRAC 4Y7NJ 3GTOJ 4M9XA 3DTEA 5K5OA 2COBA 3CLQA 3ZMTA 3S16J 4EMSA 3V8KA 3W2VA 1QHHD 2OZUA 3VPRA 3A2KA 3DU6A 1VQKI 3E6BA 5L3EA 4XKWA 1ZG3A 1FTTA 4CCNA 3PO3J 5JI6A 1G4DA 1SAXA 3BT9A 2E71A 2P5KA 2DFHA 1RR8C 3LSJA 3HPHA 5CVUA 5FD6A 4UNOA 2QA4I 4A3IJ 2HVQA 3DF8A 4EEFG 2P7CB 2KIMA 3ISPA 5A2QZ 3ZXSA 3DWLE 3VYRB 2IS4A 2E1CA 2EA4A 3OWTA 2Y31A 5LGTA 3DBRB 4CH7A 2ZJ2A 2DXIA 2EZIA 3K1MA 2WV0A 2UXXA 1MGTA 1AKHB 4KN7X 3RTRA 4BHPA 1QO0D 2JA8J 2W7NA 1EKEA 1U2WA 3JCUC 1X4OA 4PSXA 4PJNA 3NQOA 1A36A 3WTXC 3HGGA 1Z91A 2ZFUA 1QZZA 2DODA 1T8IA 1Y1VJ 4XLNF 3RJPA 4BQNA 1ZAOA 2EZHA 2PG4A 3TDUC 3R0JA 2VKHA 5D4RA 2F5EA 1K7AA 1F43A 2I5UA 3JREA 4MFEA 2KFDA 2Y75A 2OCEA 5IP9J 1QHGA 3F8MA 1PUFB 3WTWC 1O4XA 1BC7C 3KP3A 3W2AA 4XR6A 2Z33A 5EF6A 2CQNA 3P9IA 2VXZA 3NWTA 1IN4A 3Q3SA 4KDPA 1XCVA 4XLHA 2VQGA 1OLTA 3KX2A 2WAEA 3ULQB 3FX3A 1I1GA 2JMWA 1XGOA 2W25A 2CYYA 3S32A 2V4JC 4AD9A 1C0WA 1HA8A 2DT7B 1JT6A 1T98A 2F5CA 3BDDA 3NARA 2KMUA 3VSLA 5LLQA 3BR3A 1WCMJ 1HXDA 1VTNC 2X1CA 1JGGA 2F5FA 1LEBA 1DU0A 4ZDOA 3OOUA 2BYVE 2PQ8A 1M1EB 3LSTA 5DD8A 5E1ZB 2ID6A 3KP5A 2ECBA 2GXAA 2M5WA 5KAFC 4MQ9F 4UV8A 1OQYA 2EBIA 3LAJA 3TMOA 1NK3P 2FRHA 1LFUP 3IKTA 1FOXA 2VKDA 4HV6A 1LFPA 3QYFA 3ROUA 3S15J 1DPRA 2L0KA 3WTTC 1MD0A 3CC7I 2X51A 2A5YB 2VPLA 2B9SA 1R22A 5E20A 4RAZA 2DQLA 3L2VA 3ERED 1ZH5A 2GOXB 2RQPA 3BOQA 1U8BA 3FM5A 4BXUA 3A1YA 5F08A 4LLLA 3I56I 2D2WA 3G6EI 4Q48A 1TL8A 3LMMA 4KIFA 2BY0A 1G2HA 2WB1A 2MW8A 2J5PA 2XKPA 2KDZA 3CCQI 2EIMH 3OMYA 1BA5A 1V5EA 1ZGAA 1OISA 1XMKA 1ON2A 3DKYA 4IRHA 4YIIA 3CCLI 4M6VA 2HQRA 3DEWA 1MDMA 3CC4I 3QYEA 2BOLA 3H9GA 4KUMA 3L00A 4NC8A 5FKNA 4AYBA 4DYRA 2QVOA 1RR7A 4RGUA 3GZNB 4UHTA 4PJMA 5IT9K 1R7JA 2CH0A 4OU0A 3I71A 3QP5A 1MSEC 2FE3A 4N4OB 2IT0A 4WF2A 1OJLA 1SMYF 3K7AJ 1R5ID 3HL2A 2HQ5A 1FMVA 2VKVA 1KA8A 1POGA 2HOEA 2Q1ZB 1UZCA 1RESA 3GBGA 2VE9A 1FSHA 2FMYA 4M73A 3ZOBA 2W84A 3ABLH 5DUIA 1QA6A 3AFHA 1XDSA 1H88C 5E3MA 3FMQA 1R5HA 1WJBA 1Y6IA 1SC7A 3K69A 5JVGF 4F52A 2M34A 4HX8A 3FM3A 3O6BB 1TW3A 3V4GA 3WE3A 1V3FA 4LFUA 2EB7A 3OOPA 4XSXF 1EV7A 4U87A 3BC8A 3TKYA 2VT2A 4YRVA 3ZQQA 4HOBA 1MMAA 2QEXI 2PN6A 1WVRA 1P7IA 2QGUA 3LL7A 3MKWB 5LHIA 4A3LJ 4MO7A 1W0UA 3V7CA 2DLLA 2RGVA 2JZYA 4UB6C 2RQQA 2LBFB 3REOA 1ZTRA 3K70D 3U21A 4XRSA 1ZR2A 2F4OB 2DA2A 4II3A 4QPOA 4ZH4F 3PNTA 4FQGA 3R6SA 2CQKA 3M1CA 2K3FA 3DU5A 2CG4A 4QIWN 2CV1A 4I99C 4X1EA 2JUGA 2VPRA 2QQ8A 1OCCH 2STTA 2BY1A 1O3QA 3FHZA 2BY2A 2XAFA 4BQOA 2CV2A 2DAOA 2RREA 3OYLA 2UWMA 2PJRA 2FOWA 4DZPA 1H0MA 1TZLA 2F6CA 3KZYA 3I4NJ 1HKQA 3KLNA 1UELB 4KFCA 4A93J 2NS7A 1FC3A 1Y8RB 3OYAA 1SEUA 1HLVA 2F4MB 2OC6A 1BI1A 4MHGA 4L5JA 5C44J 2QBYA 1OCZH 1Y8QB 1PYVA 2IPQX 3AG3H 2R7UA 1GT0C 4RMNA 1V5FA 5EG0B 2M7BA 3RCOA 3PQKA 3BJAA 1YG2A 2HTSA 2XRLA 2LD5A 1I1SA 4XICA 5E1WA 1IUYA 4ZYHA 4I0BA 3HUGA 1RUOA 1HW5A 4LG0A 3OYHA 4Y4RA 5M3FJ 4F3QA 2V9VA 3BTIA 4R1HA 5C3EJ 2FXAA 1DU6A 1FTZA 3RQ4A 3P7NA 3OIOA 4M6XA 3COAC 3M7GA 4TV7A 5FFXA 9ANTA 2OU2A 3D5LA 5DYMA 2FX0A 1BL0A 3R60A 2A6EF 2BHZA 2FF4A 1T6SA 2V1NA 1QPIA 3WTZA 2E1OA 2HOTA 2Y9YA 2L7ZA 1IXCA 4IQ4A 2R7QA 5BOXA 2DMNA 5ICEA 2O9LA 1KONA 5D8LB 3VWBA 3TP0A 2QENA 1LB2A 5HNHA 2LREA 2OA4A 5CVJA 3OYBA 4ZDPA 3S3OA 1RETA 4HF2A 1WH7A 4EJWA 4XLAA 2Y2ZA 5F64A 2LNBA 3IWFA 1AOYA 2EFNA 2XSDC 5DS9A 3PUBA 4BH9A 3WG7H 1JHHA 2VB6A 1OR7C 2JQ7A 1VNDA 1IN6A 2X4HA 4Q47A 1W0TA 2VJJA 3KP4A 2EFOA 2HGCA 4A5NA 2M3AA 4BGDA 1X3ZB 4EGZA 2PJPA 1EH6A 1KGSA 2MBFA 3PUFA 1IC8A 3A03A 1DDNA 1B9NA 4IRIA 4IHTA 4HNUA 3V7SA 3B73A 2BVMA 3ZMZA 4Q4ZF 2H8WA 2Z16A 5EZHA 2IP2A 1G3WA 2CUFA 4G12A 4MFDA 1TQPA 1PVEA 4AVPA 1ONVA 3PFIA 1S7AA 2VC1A 1FOWA 2LRDA 3W3CA 1OR7A 5J4YA 1OPCA 2G0EA 1K6OA 4ESBA 4GFBA 1EH8A 1AA7A 3CUQC 4NHJA 5EJCA 4A3EJ 3AG2H 5E3LA 1LNWA 3QOPA 3V8JA 1CGPA 3K4CA 2R93J 2BHYA 3JAMZ 4IHSA 4L5EA 3RKYA 4CGZA 1ETYA 4RS8A 1GXPA 4EV0A 3DTKA 3BTJA 3BG9A 4MIMA 5HVQC 1LQ1A 4QWQA 2CUJA 3DPTA 2K27A 3QOEA 4D5CA 1XPXA 1XN7A 4HF0A 1SD7A 2E7WA 3ASNH 4BEHB 1MSFC 4BJ6C 3OY9A 1Z67A 2YX7A 4E4HA 3PIOF 2QZ8A 3F6OA 3SHFA 3HOYJ 2JUCA 1W36D 4I0AA 3H0DA 2R7WA 4IXAA 1BJAA 5J8FA 2HNHA 3GO5A 3LWFA 3QU3A 3IKVA 4HBLA 2NOJB 3H3UA 3LQQA 2FSWA 3C2BA 1Z6TA 1QVTA 1MBJA 4BJ5C 3QWLA 2PMZA 4U7BA 3HYIA 2HI3A 1BIBA 4RAYA 4E6KG 2R7OA 4Q5SF 1E0EA 1F1ZA 4CO8A 1W7PD 3JR9A 2KJBA 1ZGWA 3SZPA 3OYNA 3AG4H 4Z6YA 4GDFA 1ZRFA 2ZKZA 2DBBA 5B3SH 1E17A 1X19A 3N4MA 3D5RC 4PSWA 3E1SA 4E7ZA 1FEXA 1U9OA 3OL4A 3I0TA 1QZYA 2P0WA 3EUKL 4E7JA 2VUMJ 4P55A 2RNJA 3GXOA 2LF7A 1EF4A 4KN4X 1S72I 1RKWA 3AAFA 2GM4A 4JQFA 3KYLA 1QQIA 2FU4A 1X58A 1EJ9A 2D1VA 3T8TA 1MBKA 2W4SA 5GAHJ 2ZFWA 1R6RA 3H36A 4ON0A 5JLXA 4GXOA 3JRBA 5GTHC 2R92J 3GTGJ 1NG7A 3SZGA 2VOOA 3E6MA 1TW2A 5FKMA 3IC7A 3WG9A 3DXJF 2XAUA 1JKOC 2XAHA 3NEUA 3DPUA 4PGGA 2HS5A 3S17J 4JYKA 1WI9A 2MLGA 3ABKH 2DFEA 3FDYA 1KU2A 2FA5A 3V7RA 3OYCA 1R1UA 4PFPA 1BBYA 2CUZA 2EV5A 5CJ9A 2EINH 3Q0VA 3WTUC 5ICCA 5KHDA 4BS9A 1S5LC 3C18A 3HEFA 3ELKA 1ZRDA 3EUHC 2B0LA 2FBIA 2GIZA 4PK4A 2DK5A 1RIOH 3MWMA 1VQPI 1XB4A 3I9V2 3C2GA 3PNYA 3C7JA 1LJ9A 1Q1VA 1R58A 3BR2A 4EJVA 2IA2A 5E18F 4JX4A 4Y52J 2BY3A 2QWWA 4IHYA 2VIXA 1OMIA 2W57A 1YX5A 2DN0A 1XGMA 2L9RA 3OS1A 1YW7A 3B6CA 5LGUA 3HUGB 3ZCOA 1BIAA 5J6XA 4P96A 3HHGA 4HDUA 5D5XB 2KZGA 2IS1A 1SAUA 2LG4A 2M0CA 4BHBA 3I54A 4E7IA 4CUGA 4C30A 6PAXA 2DYSH 3JRGA 2KRFA 4HX7A 4KICA 1ZHFA 4IEJA 5CQEA 1IV6A 4E7KA 2VQLA 2HYGD 2K7LA 1WGXA 4W1UA 5FRMA 4HX4A 1OKRA 2M4GA 2L7KA 3TDZC 4B3XA 5K5QA 5EGOA 2B7EA 3GUDA 1O3RA 1RRJA 4IHWA 1JTYA 3E5XA 1QBJA 4KISA 1PP8F 5C4XJ 3U2RA 5B5EC 3OYGA 2GOMA 4II2A 5TGTA 1VQ9I 3ZQ7A 3BQYA 1IN8A 1WWXA 2NAZA 3HOTA 4IJAA 2K02A 2P5LC 3HOUJ 2XC7A 5CQGA 2Y48A 5J1UA 4RGXA 3UNGC 2VOPA 2PBIA 2IW5A 4WX9A 3IAM2 5HS7A 3S2WA 1T39A 1K4SA 2M8EA 2EFWA 2FUG2 1RI7A 5HLHA 5D4SA 1A04A 4BBSJ 1XX5A 3L09A 4CICA 3JTGA 4HQEA 4DQ2A 2IA1A 5K7HA 4UXNA 3AL0C 2OF7A 2EV0A 2E7XA 3HGYA 5FGMA 1UHSA 2WY7Q 4ZZLA 3J7AO 2QSFX 2W85A 2DA7A 2NVUB 2LF8A 4IPAA 2JN6A 3WGGA 2A5WA 4A3GJ 4O6JA 3FXRA 2F2EA 1YIJI 1VF9A 1OCRH 3V8LA 2L9SA 1Z7UA 4RAGA 3WU1B 2AS5F 5CVVA 5M3MJ 3F3XA 1U8RA 2LBFA 1R5GA 4ABZA 1HBXG 4D9JA 1B72A 4LB5A 4CYDA 1QZEA 1T08B 1G3SA 2ZO4A 5E17F 1QRYA 4F93B 3FXJA 5FKLA 3LSPA 4RB0A 3RZOJ 2VQHA 2CQ7A 3BZKA 2KJCA 2OJED 3BR0A 4YFXF 3QODA 3IH2A 5KNLA 4KJZA 2CV0A 2CWEA 2ACJA 2Y0SN 5LBQA 3U1KA 2X6XA 4D7MA 3MKZA 2ETHA 3S1MJ 1IXSB 5JHFA 2KDOA 3CUOA 1B9MA 2JA7J 2O8KA 3IH3A 3I5UA 1FPQA 3HTUA 5JVTA 4M6YA 3MD2A 3W6VA 5DDGA 5KK1A 4M72A 3D5SC 4FETA 1XD7A 5TISC 5ICGA 5DM6F 4LG3A 1BR1A 4U88A 3BY6A 4LK1F 5F0FA 4XRSG 5FRNA 5E3NA 2DA6A 2P5VA 3SEQA 2JRMA 4JX5A 5D6EA 1JXSA 2OD5A 2BW3B 5FLMJ 1ETOA 1USTA 3Q9VA 3OYIA 4RDUA 1WJDA 2DA4A 4BKXA 4YFKF 4S0HB 5K1YA 4ANJA 2EWNA 4C3HJ 1PDNC 3KFWX 4MTEA 5GTIC 2N8GA 1X1BA 3HZJA 3GYHX 3HDDA 3GWZA 3O8HA 2KRCA 1X2MA 5FLXZ 2GQQA 5LFAA 4YIRX 4A3KJ 1R1TA 3GFMA 3F9KA 2JVHA 2ZNZA 3A0BC 3VOEA 3DLAA 1IW7F 4OIOF 1D8KA 2MC4A 1IUFA 1IV8A 3DLLF 1N25A 1VI0A 4P1WA 3ZQFA 2GZWA 3VEPA 3P5JA 5ILSA 2Z3YA 3ABTA 3FBIB 3KP6A 3OYMA 4ZJZA 1K6YA 4WXDA 1AHDP 1ZELA 3JW4A 3G4SI 2LFBA 4GYIA 3S14J 2V9PA 3AL0B 1IRXA 2QCOA 3BP8A 3VDXA 3LNQA 1D5VA 2Z1DA 1KQ0A 3UR3C 3GZ5A 2XHKA 3I53A 1ODDA 2WB1N 4XN3A 3F8CA 3KYDB 1ZARA 2DW4A 4Z2YA 3CCJI 1N78A 4ENMA 1J2XA 1D0YA 2QSGX 3SYTA 2UUZA 4E7HA 5DCMA 4EM1A 3VODA 1A6QA 2WAFA 3EETA 5LRRA 2G9WA 1TWAJ 2ZXJA 2K9LA 2YR2A 1JKRC 2V1UA 1BI2A 2OAZA 1FYKA 2MH2A 5HLIA 3AKZA 3CMMA 3MMYB 3L2RA 4GRIA 2QLZA 3SFIA 3ZR8X 2EFPA 4XKCA 2XB0X 1O7FA 2Q2EA 2ELHA 3K9TA 4XN0A 1Z21A 2LYCA 1XCBA 5EEAA 2R7SA 5F6FA 2MFZA 3WGHA 1W7PB 3KCCA 5C4JJ 3G3ZA 1ZG5A 1LFBA 1U5TC 1W7PA 2HXIA 5M5XJ 4BACA 3RKQA 2RC4A 3JSPA 3OYFA 1LDKB 4XLFA 1LPQA 3K70C 3EUAA 2BBYA 4Y15A 2L7FP 4RGRA 1WJFA 4WK8F 3MZYA 4UVAA 2X0LA 3RPUA 3PSFA 4KNYA 1LKXA 4F92B 3I64A 4CCMA 5E8GA 3DQVC 5B1BH 2IBDA 2OTLI 2DO7A 2KRHA 2A61A 2HU9A 5CVRA 1EA3A 2XDVA 3H9JA 2ID3A 1TNTA 4DGWB 2UZKA 1HF0A 4IRGA 1BW6A 2EZKA 1JGSA 1YOVB 3BTCA 3CDIA 5J4VA 4R79A 3HSRA 4BDZA 1WJAA 1XMAA 3ZQGA 1W36C 2MGQA 2K3PA 2GLOA 4H0EA 3ABMH 3MKYB 1PUFA 1L3LA 1BW5A 2JSCA 3CCYA 4HAMA 1P4WA 1KYWA 4DIQA 3LSGA 2V1XA 3ZP5A 3BG3A 3M3YJ 2YU9J 3HSFA 2V79A 1SD5A 3HRUA 1IN7A 2VBZA 2ZCWA 2H1KA 1U0JA 4E7SA 1WHUA 2KISA 3T8RA 2FJ1A 1P6RA 3JRAA 3EQLF 4BBRJ 1Z7LA 2FEZA 4HLXA 3KZZA 3TO7A 3BJ6A 1B8IB 2HVRA 1MH4A 5D5WB 2MABA 3V42A 3DKWA 2DU9A 4QSHA 5FLXK 2WAQN 2NYXA 4EATA 1T38A 5JR3A 3IP4B 2D1HA 2W00A 3HBLA 3CESA 2A69F 3HB9A 5CKTA 2FBHA 5EZGA 1ETWA 4L9NA 1FWZA 2WA0A 4NUBA 3CDLA 1WRJA 2R5ZB 2Q0OA 3G73A 4L0ZB 2AXTC 3QYBA 3Q0UA 5IYBJ 2HDWA 2CRGA 3CCEI 1XG1A 1IGNA 2BEOA 3T0YA 1BC8C 3F21A 1S3JA 2XVCA 3J81K 1RKTA 2LSOA 2HPIA 4M3FA 3IHUA 1YS7A 4A5MA 3FXKA 5IOZA 2DOEA 2E2IJ 4FE7A 4EM0B 4FX0A 1FBQA 2COMA 4LB6B 4FE4A 3M8JA 5DV5A 1QPMA 3B02A 1IF1A 3FIWA 1FBSA 1FNNA 3FMSA 2ZMEA 4RBOA 1S29A 2HEOA 3BCAA 2W1OA 4HSTA 4BDYA 3M9AA 4XKVA 1X1PA 4LLGF 4F91B 1E3HA 2DOAA 1EH7A 1SANA 4A6DA 5GAGJ 1A5JA 2CFOA 2CS3A 1LUJB 4XBFA 2AO9A 2HZTA 4RM2A 2GXGA 1NG6A 1RC9A 2QQAA 1FT9A 4HPQA 2X6YA 2JPCA 5L3DA 3N05A 3BPXA 2XF7A 1GV2A 2HDDA 1VZ0A 2E60A 2KQRA 2G7UA 2W24A 4IO9F 2YS9A 2HQAA 1YFHA 5L3BA 2Y30A 2WADA 4HQMA 2WTEA 3C3WA 5H20A 1ZG1A 3W6KB 1Z77A 4IQJA 3BPVA 1SVOA 2OZ6A 4D0PA 3ZMVA 3VFZA 3RI4A 2V26A 4EVIA 4BE0A 2RVCA 3TL4X 3A0HC 4BY1J 5BMZA 2DA3A 4XKBA 3ZMUA 2NXNB 1YJWI 4ENJA 1FOKA 1MMDA 4DBQA 3B6AA 3NRVA 1IG7A 3GEZA 3PM1A 5EEHA 2F48A 4RB2C 2FNAA 4P5OA 1IRGA 5F0HA 2BZTA 1X2NA 2VI6A 2HR3A 4NDLA 3JRHA 1S7EA 3DCFA 5J3LA 4B8XA 2DTZA 1N77A 3BG5A 3E5QA 4PZJA 1Z05A 5JFRA 1X1CA 4N0BA 3BG6A 1X1AA 3H35A 1REPC 5ILUA 4BQAA 3M4OJ 3P9KA 1G59A 2Y9ZA 4XLPF 3FMRA 2QQ9A 1HDPA 2ADUA 1QNTA 2JJ7A 5J1RA 4OWRB 1OCTC 3D1NI 3FBNB 3F8NA 3TOBA 1TNSA 4CA0A 1GVJA 4EGYA 2E2JJ 3CZ6A 1VQ4I 3A01B 3DBLB 1A31A 4P9UA 2D5VA 3MAJA 3QPSA 3KEQA 2ELJA 4U0VA 1P4AA 3I59B 3KEYA 1WFXA 1WJ5A 3FXQA 1R71A 3FKJA 3OR1C 3O3KA 1H89C 3DPLC 3GTPJ 4OAYA 5K5RA 1I3QJ 2DPUA 3U1DA 1HQCA 3GLLA 2CO5A 3MN2A 3CCRI 1S8NA 3TGNA 3E97A 3TEDA 1XSVA 2GAUA 2XASA 3DV8A 3O8GA 4LGWA 5F1JA 3J7YJ 2IA0A 3ZMSA 4BQQA 2VBXA 1UAAA 3OS0A 3RYPA 4M71A 1T2KA 4XLEA 3K4MA 3JRCA 4C3JJ 4Y17A 1BJZA 5LHGA 2HTJA 3J80K 1U6GA 4KIBA 3HOXJ 1V5GA 3SFZA 2MC3A 1VQ5I 2K4JA 4PFOA 3TBIA 2QKLB 2X48A 1LE8B 4BY7J 5FD5A 2KIUA 1P9QC 3LSRA 2LY2A 3LSMA 4QTRA 1YRNB 2IS6A 1YRNA 4A3DJ 2R3SA 2P6SA 3EDPA 5H6RA 3TP3A 3WTYC 1V4RA 4UV9A 2KZVA 1P4XA 2DMTA 2E34A 4BNCA 2L01A 2E1MC 1BOAA 3A02A 1Z3YA 3C1DA 3H1CA 2O8XA 3BCBA 2ESNA 4AU7A 1RNLA 2XAQA 3GTLJ 5AIQA 2GWRA 1WSUA 1WPKA 5DEQA 4BXFA 3IRQA 1MJ9A 2XF5A 5J1YA 3Q9SA 4RM3A 2ZC2A 4UY8I 4A3CJ 4DOZA 5L3GA 4HA8A 4Y3OA 4A0XA 3E7LA 1FYLA 2M1BA 1QU3A 3ZQLA 2DK8A 1Y0UA 3J81Z 2A07F 1HOMA 2QM3A 3ERMA 3TO9A 2JA2A 2M45A 5EYRA 2ZBKA 4AWXB 2VBWA 1R9TJ 2VE8A 2LKPA 4ZDLA 1GLNA 2XB5A 2MSYA 2IJLA 4F55A 2XPUA 3PIPF 2GIVA 4DNCA 4AIHA 4ESJA 3BTLA 1HCRA 4WXCA 2EZLA 1Y1WJ 2M9HA 3FWEA 2I10A 3KPHA 4M3DA 5LGNA 1HKTA 2M2EA 5F1RA 2HQNA 2IGMA 2VASA 1O3TA 3PL8A 1HSTA 1R23A 1L0OC 2JK3A 4C3IJ 4RAFA 1K83J 5IYDJ 3M8EA 3OSFA 3UKGA 4MNUA 1OCOH 2JVGA 2PFBA 1Z6RA 2NS8A 2VQCA 3CQZJ 3ONQA 3WU0A 4B47A 1F4KA 1DGWY 1MNDA 4UUVA 2DDAA 1SFUA 3CTAA 4BAYA 4ESFA 4KA4A 3S3NA 2XV4S 2KLOA 1Z0XA 2ZMEB 5ILVA 4LD5A 1OCPA 4I2OA 4AIDA 5KVRA 5JLWA 1JUSA 2H6BA 3MCZA 4PJ0C 3G2BA 2LK2A 4PGHA 3I3LA 1T95A 4XMYA 1E3PA 2LTPA 3IH4A 5IT3A 4EJUA 2F4IA 3GCMA 4L9VA 4YEJA 4G8XA 1R36A 3CMYA 2P8TA 3MEXA 3S1RJ 2XPVA 3KZIC 4ZYEA 1GHCA 4AUXA 1I39A 2CW8A 3KIOA 3OSGA 2X85A 5AONA 2PMUA 1TT5B 2L5QA 1HW2A 3H3ZA 2L4AA 2BW3A 2K5CA 4DJAA 3LA7A 1FP2A 3M07A 4IF4A 3T1BA 4A3MJ 4AVZA 2H09A 5DCFA 3EPZA 2F5VA 2R4GA 4U0WA 3KP2A 3R61A 1G3YA 4YELA 1ETVA 5CYVA 1B8IA 2L2OA 1TC3C 2W48A 3U9GA 1LDJA 1SFKA 3CCUI 4FASD 3F0CA 1K79A 2ZXHA 2IXSA 4AC0A 3IRRA 5GAEJ 2Z9OA 2E1NA 5ICFA 4NB5A 3OR2C 2M8GX 4IKFA 4HEA2 4B09A 5FKKA 1CQTA 2E5NA 2LLKA 5DD4A 2LH9A 4KT5C 5BNGA 3HC7A 4OMZA 1ENHA 2OV7A 2EJRA 3FK7A 1SVMA 2KL4A 3L2CA 1ZYRF 4BXXJ 3LFUA 3K1PA 1ZQ3P 1DGRM 1H9GA 1Z3XA 1GUUA 2XKOA 2WWYA 1JKQC 1RPWA 2NVXJ 3HOVJ 4M9ZA 3EYIA 2DT6A 4D7NA 1VQ6I 5H2FC 3RZDJ 1LEAA 3CO7C 2HVSA 2JTVA 1DP3A 5J8CA 3RDIA 1U3EM 1GXQA 3HTSB 2ICWG 4WCGA 1P92A 3HIFA 5F0CA 2D45A 3K1NA 3ABUA 2Z2SB 4UUTA 1FZPB 3TQNA 2XAJA 2HOSA 3L9FA 5B1AH 1X4PA 3OYEA 3LSKA 5EGOB 4E7LA 1Y0NA 1TTYA 4M3GA 4R8HA 1FOYA 2AHQA 2Z99A 2ME6A 2IGOA 1J75A 2K9NA 4ZYGA 2R7VA 2MA3A 3E0JB 2HZDA 1Q1HA 4M74A 2ZXWH 5LEJA 1JE8A 2LMDA 3LA3A 2R7DA 4ZTFA 4O3MA 1UB9A 2CUEA 5EEGA 3ZN0A 2AQFA 2DCEA 2L54A 3CP8A 1TWGJ 4MGRA 3LAPA 4L18B 2IS2A 1YQAA 3RPQA 1KQ9A 4BL0B 3FHNA 3ZPLA 1BI0A 5M5WJ 2CW7A 3S2DJ 1YS6A 3EYYA 2OQGA 4PCQA 2LVSA 2A3SA 4I02A 1FYMA 1B72B 4G9YA 1JJ8C 1BOBA 4PJJA 4LITA 1TT0A 2M0MA 3SQNA 2E2HJ 1IXRC 5BPDA 1D0ZA 2VJ5A 2O5RA 2P6TA 1XGSA 1YHQI 4HNTA 4CYCA 1Y39A 2P4WA 3K4NA 1XSDA 3DBHB 2XSJC 3E3VA 4S05A 3FXOA 2FD5A 4G6TB 3T5XA 5DCMB 5HS8A 2DT5A 3HKZN 3OYKA 2DQRA 1G6NA 1NK2P 2R7ZJ 2C6YA 1ETQA 2HKOA 1BN5A 2MH9A 2OUMA 3CD6I 4J00A 4OOIA 1SFEA 3K4JA 1JKPC 3RKXA 2F5DA 3S1QJ 4JOMA 3HPGA 3G71I 4MEXF 2AXLA 3FKIJ 4IL6C 2OTJI 4GO1A 1IO2A 5IP7J 4BU2A 2K9QA 3PSIA 1MBFA 2Y0SA 5FFZA 2H94A 4LOCA 3H5AA 4E70A 2PJRB 3ML6A 2V7FA 3HOWJ 3R4KA 2E19A 1I6XA 3IUOA 3FF5A 3KP7A 2L7MP 4RGSA 1H8AC 3CLOA 3D0SA 2VN2A 3CJQB 3CUQA 1AKHA 1MIJA 3LSHA 3Q5FA 2HWVA 3H92A 5HS9A 2VODA 1Z1DA 4XK4A 1A6IA 4HW0A 4XNFA 2CQQA 5ED4A 4ZYDA 3ECOA 4LJZF 1FLIA 1D5YA 2KIFA 3BZ6A 4FHTA 3KETA 4OIQF 2HYJA 3F8BA 1STZA 1E2XA 3WE2A 4KITB 3PNVA 4NQWB 5KAIC 4AIJA 1TQIA 1XTAA 3Q0WA 5E79C 1JUMA 1WJCA 4IOAF 2R7XA 4HG2A 3CMAI 1WQ2A 1DPUA 1ULYA 4LG0B 3DFGA 3K6GA 3ZN1A 3GTJJ 2HDCA 4Y33A 5IT9Z 2HKXA 2YPRA 4I6ZA 1O3SA 4EM2A 1R4MB 4OAZA 5ERIA 5LRSA 4HYEA 4IZZA 3E5UA 3BQZA 4KT6A 4UB8C 5E1XA 4AYBN 2DA5A 3HRMA 4F7ZA 2O3FA 3JAMK 3A01A 4N9IA 1ZREA 1KU9A 1OYYA 2FNPA 2TCTA 1S9HA 4ASNA 1YO5C 1UCRA 4K2EA 1VQNI 4B4CA 4RLQA 2B63J 2R7RA 1YX3A 1GVDA 2EIJH 4B3AA 2CQXA 2PEXA 4WXHA 4C9YA 3CC2I 4Y13A 3G1MA 3GTMJ 4KIGA 1X3UA 2VL8A 3HKZA 3FK6A 3J80Z 1YLFA 4UUSA 1J0RA 3ZRGA 3FZVA 3BROA 2H1LA 1NH3A 5F27A 2DI3A 2Z5UA 3RKWA 2W82A 4A2UA 3LQRA 3TW6A 2JA6J 2NS0A 3BWGA 1WJEA 2LC2A 1RUNA 4MEYF 3SZTA 1D1BA 3L2WA 1IZ1A 2Y0MA 1K78B 2K85A 1UHMA 4G7HF 4BUPA 3FXLA 3HM5A 1ACIA 2M4KA 4XIDA 2JSPA 5LD2C 1MBEA 1FSEA 2VXDA 1YIOA 1YW9A 3LFKA 4PUSA 3K4LA 1MMGA 5DTDA 2PX9A 1NTCA 3PQJA 3WHBA 3K2AA 2BGCA 1MW7A 5L3CA 4G7ZF 1JTXA 4HDVA 2YU3A 3JRIA 1HC8A 4EJTA 1NHAA 2V6CA 1TWHJ 5FJ8J 2L4MA 2A6HF 2LOOA 2XGCA 3QAHA 2ME0A 2LKSA 5D5UB 3JRFA 4H4KC 3TOAA 2M87A 2EPFA 4JBAA 2X6OA 1ZR4A 3WODF 5J47A 2CGPA 3RSNA 1MMSA 2WC2A 2ZJPF 2A6TA 3S93A 2ZSIB 5BQTA 3DP7A 4BJTA 2E5ZA 3MKLA 3MQ0A 1XDUA 1ZGJA 4I76A 2ZXIA 2VJIA 4D1QA 1W5TA 1U9NA 4V2GA 1J9IA 4HSRA 3VSKA 4G6DA 2XROA 1P7JA 4M3BA 2KKOA 4P9FA 4CCOA 1XC5A 5B66C 2L02A 1SD6A 1TP4A 2H6CA 2KIQA 3LA2A 4FT8A 4AIKA 3JSOA 3ASOH 3I55I 4HV5A 2M30A 1XGNA 4ZYAA 5K7FA 3I59A 3MVPA 2BE5F 2E35A 4DBRA 3ECHA 3F8FA 5CPRB 3CUQB 1V55H 5H6QA 2OPTA 1IDYA 2FQ4A 1QVUA 3C2HA 3OYJA 3K10A 4A3JJ 4M9SA 1OYIA 4XRMA 5GPCA 4C2MJ 2RN7A 4XORA 4V2FA 3DEEA 2EQRA 4NBQA 2V1DA 3CCVI 1K4TA 2R5ZA 1KYZA 1FJLA 3RPUD 1UG2A 1W5CC 4MLOA 1ZK8A 4QLCU 1JUPA 2Q8KA 4XQFA 2IRFG 2MLKA 3G1OA 1J7KA 3WGIA 1ZN2A 1T56A 2MYSA 3HOZJ 1ON1A 3BR1A 3A4CA 1FMWA 4RLFA 4YFNF 4U7DA 1W1WE 1ZRCA 2VONA 4XOTA 4IHVA 1S6LA 5CVIA 2DMPA 1YITI 2R7FA 4CCLA 2HXOA 2CSOA 3HRSA 1USSA 2DJNA 1KU7A 2EFQA 5HDNA 1YJNI 2RAEA 3QU6A 1U5TB 4IVNA 3IL2A 2CMPA 4V19K 4NQWA 1U5TA 2X1EA 1G3TA 2OQRA 3GVAA 2DFIA 2KT0A 4UVBA 4X6AJ 5LEKA 4RA2A 4A12A 2K9MA 4L5IA 2QKMB 1BI3A 1SFOJ 1ZKGA 3RQIA 2X1DA 5F04A 3F6VA 1MNEA 3ZMDA 5E8IA 3JRDA 1WKMA 1R49A 1UFMA 2QBYB 5DM7F 3CDHA 3GTKJ 3X2QH 4JK1X 2DOFA 4YG2F 5EG0A 3R0AA 1ETXA 1HW1A 2KPMA 3FXMA 4CCKA 2YUSA 5HLTA 2QF7A 1MZBA 5J40A 2L9VA 5IY5H 3E6DA 3IV5A 3H5NA 3QPTA 1ITYA 3GZ6A 1R00A 2WY8Q 2FOKA 4G94A 2K9SA 3GFIA 3KEOA 3ZQCA 5CLSA 2BXZA 3NWSA 3AG1H 4GYGA 2WV1A 4J01A 5GADJ 1D1CA 3KYCB 1T33A 1TWCJ 3E6CC 3OIPA 3K4BA 1XSXA 2DTRA 4RB3C 4XL9A 3FXUA 3QPHA 1FP1D 1D0XA 2CU7A 3ZQIA 4BYYA 4BE2A 1LVAA 2XRNA 2IEKA 4FCYA 3HG9A 1CF7B 1YYVA 1KZHA 5HODA 4HZFA 1IJWC 3WTVC 2ECCA 2ZNYA 3CF5F 2V9KA 1ZLKA 3K2ZA 2K4BA 1VQMI 3KLOA 2FBKA 1VFCA 4OMYA 3BLYA 3HSEA 1IN5A 3H5RA 1PJRA 2MD0A 3CMEI 2XGXA 4BE1A 4I09A 2O0YA 2ELKA 1VQLI 2LKXA 2BVLA 1TBXA 3IAS2 3VYTB 1I6HJ 4I01A 2JWTA 2GXBA 1OYWA 1K61A 4I98B 3CP2A 2EH3A 3GF2A 4JX6A 1FX7A 5IP6A 4EJOA 4IHXA 1SVLA 4DZJA 4GCVA 1B6AA 2RDPA 4CZZA 2JPBA 3H3VK 1AU7A 2NVTJ 1FIPA 1GV5A 2A05A 2K86A 5FROA 5E3OA 4I7HA 4LMYA 4ZTJA 4A69C 2XPWA 2P7VB 1D8JA 4NC6A 1ERDA 3TW7A 2R5YA 4FTHA 5HDGA 1YI2I 2ISZA 2EA2A 1YE9A 1IRFA 2X9DA 1P2FA 2CW0F 1YJ9I 3RYRA 1K78A 3S8PA 4LLNA 3S1NJ 1IAWA 1ETKA 3I4PA 1MBGA 5FKOA 2R0QC 2CJJA 4DYCA 2DPDA 4B48A 4ENKA 4GGGA 3BR5A 4ZC3A 1QGPA 3VB2A 3J7ZI 4HRIA 1I27A 3N97A 2QSHX 1JHFA 3HXLA 3TO6A 2V6EA 5LHHA 4HF1A 3I4MJ 2ISYA 5HDKA 1SFXA 2VJ4A 3GFJA 1HSJA 1O57A 4XSZF 4CYCB 1UJ8A 2DFFA 2VT3A 3MFKA 2A68F 4BEHA 2NVYJ 4WWCA 2FMLA 1AWCA 1YW8A 4O5VA 3EUHA 2K40A 4OIRF 2RNGA 2Y69H 1VQ7I 2O61A 3OV8A 3PJRA 4NC7A 2VLAA 2EILH 1OFCX 2LY9A 1JI8A 4KMFA 3O2PE 1J5YA 3SEZA 2ZJQF 4MTDA 2H27A 3M8FA 3KE2A 3H0GJ 1B4AA 4IOCF 4C2TA 1T0FC 1W4MA 1HKSA 2HOAA 2WAQA 5FO5A 5GPAA 2ESHA 1I5ZA 1VQOI 2J5OA 5IYCJ 2VC0A 1WH5A 2TRTA 3K0LA 1ZLJA 1FY7A 1PP7U 4ITVA 4ENNA 4G7OF 1PUEE 1TLHB 1YTYA 3BJOA 4LIVA 1BR2A 1MH3A 2TDXA 1Y56A 5TRDA 3M1EA 5IOYA 1XS9A 1O7LA 1SMTA 4M3EA 2FQ3A 4PJLA 1BM9A 5FB2A 4CXFA 4J19A 3QQAA 2GA1A 4IX7A 4CHUA 1XMXA 2HFHA 2IGNA 4PDKA 3WHCA 3HJEA 4HLYA 1U78A 2QYOA 1LVKA 5D5VB 3HHHA 1GDTA 1KQ8A 4N4NB 2QUFA 2BXYA 2ZJRF 1SD4A 5K7ZA 4EQQA 1B1BA 1VQ8I 4OIPF 5GP9A 3MZHA 1R1VA 2O6GE 2DMUA 4KMUX 3RIRA 4LK0F 3ESWB 4W97A 1IDZA 4XONA 2YSRA 5BS6A 1JJ6C 1JT0A 3HOSA 3ZGKA 4KYWA 1MJAA 1RZ4A 4NNJA 1WI3A 2DA1A 3JTHA 3LOCA 5TJJA 1W5SA 5D8KB 1MDMB 2R7TA 4N9HA 3HRTA 3ZQHA 1E3OC 4OINF 3BZCA 3BR6A 3WU2C 3L2QA 1DP7P 3W6JB 2JRTA 4L9TA 4HNVA 5KCMA 4CCJA 1D3YA 2CFXA 1UG0A 2UXNA 2VBYA 2LP0A 2NNYA 2XGEA 3MZ8A 3F23A 1S7OA 1UHWA 1X1DA 1I3AA 2JA5J 1MMNA 2O03A 3PFYA 2PLYA 1B59A 2DJIA 2I8DA 3BG7A 4A3FJ 3GMEA 4RB1A 3I58A 3SJMA 4CDGA 3QRFF 5HOOA 5IPAA 4XOPA 2ZSHB 3OIQA 1D1AA 1MBHA 3NAUA 3GW2A 2EV6A 4ETSA 3L2UA 1G8XA 2XAGA 5HLGA 4CZCA 2OCCH 3DTIA 3P9CA 2X6WA 4CSWA 1FBUA 2Q2EB 2JT1A 3VYUB 5A2QK 4YIFA 2DDBA 2M7AA 2NOGA 1UMQA 4C2UA 2P81A 2ZMEC 1H9TA 2RKHA 3CJTB 4DYQA 2R5YB 4A0YA 4A3BJ 2PMZN 2HPMA 1J09A 2NNNA 4D5FA 3L1PA 2AQEA 2VKEA 4L0YB 4MQVA 2DMQA 1F9NA 2PMHA 3SXYA 2STWA 4U0YA 3CCSI 4XM3A 1MKMA 3L7WA 2L3DA 4B1RA 5L3FA 4DW6A 2L9NA 2MD5A 3GTQJ 5HNFA 5D6FA 4FISA 4BHCA 4S04A 3DEUA 1F5TA 2NVQJ 3VYSB 4XLCA 4A6EA 1R4NB 2KP6A 2LDUA 3WTSC 2EK5A 1DUXC 3QPLA 3DKXA 2BV6A 2RV8A 3F22A 2IGKA 4AM3A 1TQMA 2XIGA 1HDDC 5DUKA 2EIKH 1A35A 1FIAA 1KU3A 1LDDA 3FISA 3G1LA 5EDNA 2OBPA 1J59A 5FLVA 2WBMA 2HYFA 1ORKA 4UUSB 1F36A 4G6QA 1APLC 3S3MA 4XRFA 3OYDA 4FX4A 3QP6A 3CO6C 5AIPA 1BR4A 3OL3A 2IAIA 4UVCA 3SDBA 1MJBA 4B43A 4L9JA 1X3WB 2E1MB
chains in the Genus database with same CATH topology
4BY1J 2DA3A 5DTDA 1FEXA 1U9OA 1TWFJ 1NTCA 3WHBA 1MNMC 3S2HJ 3K2AA 2GBYA 3B6AA 1IG7A 2VUMJ 3PM1A 1JTXA 1I50J 2LR8A 3JRIA 2H8RA 1EF4A 2ZB9A 5F0HA 2MG4A 1X2NA 1TWHJ 2VI6A 3SDGA 5FJ8J 1LE8A 2XGCA 2ME0A 1RKWA 4NDLA 3JRFA 3JRHA 2GM4A 3PO2J 1S7EA 1IRZA 1X58A 2X6OA 3DCFA 1MBKA 5J3LA 1ZR4A 2DTZA 3BG5A 2O7OA 5JLXA 3JRBA 2XGDA 2R92J 3GTGJ 4JP0A 3MKLA 3M4OJ 5FKMA 2Y9ZA 4I76A 1HDPA 1JKOC 2JJ7A 5J1RA 1OCTC 3D1NI 3S17J 4JYKA 1U9NA 4V2GA 5M5YJ 1P7JA 4M3BA 1XC5A 4Y7NJ 3Q0VA 2E2JJ 3GTOJ 3A01B 2COBA 3S16J 2D5VA 3HEFA 3QPSA 3VPRA 5K7FA 3MVPA 1FTTA 3PO3J 1Q1VA 3BT9A 3BR2A 2OPTA 1H89C 3GTPJ 1IDYA 2FQ4A 3LSJA 1QVUA 4JX4A 1I3QJ 4A3JJ 4Y52J 3MN2A 4IHYA 3TEDA 4A3IJ 4EEFG 3O8GA 5GPCA 4XRMA 4C2MJ 5F1JA 2DN0A 4V2FA 2EQRA 2L9RA 2R5ZA 1FJLA 1UG2A 3B6CA 4MLOA 1ZK8A 1JUPA 2Y31A 3JRCA 3G1OA 4C3JJ 1BJZA 1T56A 2M0CA 3HOXJ 2EZIA 3HOZJ 3BR1A 1AKHB 2JA8J 4IHVA 3JRGA 2DMPA 2X48A 1LE8B 2HXOA 3HGGA 4IEJA 4BY7J 2DJNA 1IV6A 3LSRA 1WGXA 1Y1VJ 4QTRA 4W1UA 2RAEA 2EZHA 1YRNB 1YRNA 4A3DJ 5EGOA 3TP3A 2KT0A 4X6AJ 2DMTA 4IHWA 1JTYA 1F43A 5C4XJ 3JREA 4MFEA 3A02A 5IP9J 1SFOJ 1ZKGA 3RQIA 1PUFB 1O4XA 5F04A 3JRDA 5EF6A 3GTLJ 3BQYA 1WPKA 3HOUJ 5J1YA 3GTKJ 3Q3SA 5J1UA 5EG0A 4A3CJ 1ETXA 2YUSA 2QF7A 2JMWA 3E7LA 3IV5A 1ITYA 3ZQLA 2K9SA 1HOMA 4BBSJ 3ZQCA 1JT6A 3NARA 3BR3A 1WCMJ 2WV1A 5EYRA 5K7HA 1R9TJ 1T33A 1JGGA 2OF7A 2XB5A 2MSYA 1DU0A 3HGYA 1TWCJ 1UHSA 3OOUA 2XPUA 2ID6A 2DA7A 2ECBA 3BTLA 1HCRA 2EZLA 1Y1WJ 2CU7A 2JN6A 2M9HA 3ZQIA 2I10A 2EBIA 2IEKA 4FCYA 4M3DA 4A3GJ 1NK3P 2M2EA 5HODA 1LFUP 1IJWC 1VF9A 2ECCA 3S15J 2JK3A 4C3IJ 5IYDJ 2L0KA 5M3MJ 1K83J 3OSFA 4ABZA 3UKGA 1B72A 1VFCA 2NS8A 3CQZJ 1U8BA 1QRYA 5FKLA 3LSPA 5F08A 3RZOJ 3BR0A 1G2HA 3IH2A 2ELKA 2MW8A 1Z0XA 2LKXA 2Y0SN 1OCPA 2KDZA 4D7MA 1I6HJ 5JLWA 3S1MJ 1JUSA 2JWTA 1BA5A 1K61A 2EH3A 2LK2A 4JX6A 2JA7J 2O8KA 3IH3A 5IP6A 4IHXA 4DZJA 3W6VA 4M6VA 3DEWA 2LTPA 3IH4A 3H3VK 1AU7A 2NVTJ 1FIPA 5FKNA 4DYRA 3CMYA 1GV5A 3S1RJ 1RR7A 2XPVA 5E3OA 5F0FA 4AUXA 4XRSG 5E3NA 2DA6A 3OSGA 4A69C 4JX5A 2XPWA 5FLMJ 3TW7A 1MSEC 2R5YA 4FTHA 1ETOA 1OJLA 3K7AJ 4A3MJ 2HQ5A 4RDUA 2DA4A 2VKVA 2X9DA 4BKXA 1POGA 3S1NJ 1RESA 1ETKA 3GBGA 4S0HB 1MBGA 3ZOBA 5FKOA 2R0QC 1ETVA 2CJJA 4C3HJ 4DYCA 1B8IA 1H88C 1TC3C 3BR5A 5E3MA 2W48A 2N8GA 3HDDA 3O8HA 3F0CA 1X2MA 3I4MJ 2M34A 4AC0A 4A3KJ 4CYCB 2M8GX 5FKKA 1CQTA 2LLKA 5BNGA 1P7IA 2NVYJ 1IUFA 1ENHA 4A3LJ 3FK7A 4MO7A 1VI0A 1W0UA 3ZQFA 2K40A 4BXXJ 1ZTRA 1ZQ3P 4XRSA 1ZR2A 1AHDP 1OFCX 2DA2A 2LY9A 1GUUA 1JKQC 1RPWA 2LFBA 2NVXJ 3HOVJ 4QIWN 4D7NA 3S14J 2QCOA 4X1EA 3LNQA 3RZDJ 2VPRA 2WB1N 3H0GJ 2HOAA 5GPAA 5F0CA 4UUTA 5IYCJ 2HOSA 4DZPA 1WH5A 2TRTA 1TWAJ 5EGOB 1JKRC 4M3GA 3I4NJ 2AHQA 2ME6A 1MH3A 2K9NA 4A93J 2NS7A 3SFIA 5IOYA 1XS9A 4M3EA 2XB0X 1HLVA 5C44J 5EEAA 4J19A 2CUEA 3QQAA 1GT0C 5EG0B 1TWGJ 5C4JJ 1LFBA 5M5XJ 3RKQA 2HXIA 2XRLA 3WHCA 5M5WJ 2LD5A 4XICA 3S2DJ 1U78A 2LVSA 1GDTA 2L7FP 1B72B 5M3FJ 1JJ8C 5K7ZA 3BTIA 5C3EJ 5GP9A 1DU6A 2E2HJ 1FTZA 2DMUA 2IBDA 3OIOA 4W97A 9ANTA 4CYCA 1IDZA 2FX0A 1BL0A 1JJ6C 1JT0A 2FD5A 3HKZN 2ID3A 1WI3A 2DA1A 1HF0A 1NK2P 2R7ZJ 3LOCA 1QPIA 2E1OA 1BW6A 2EZKA 2HOTA 2Y9YA 1ETQA 3BTCA 3ZQHA 1E3OC 2L7ZA 3ZQGA 2GLOA 2MGQA 3BR6A 1JKPC 1PUFA 4HNVA 3S1QJ 2DMNA 1BW5A 3CCYA 2LP0A 2O9LA 2XGEA 3LSGA 3TP0A 3BG3A 3FKIJ 2YU9J 3M3YJ 2JA5J 2H1KA 1RETA 1WH7A 5IP7J 2K9QA 1MBFA 2FJ1A 3JRAA 4A3FJ 4LOCA 2Y2ZA 4BBRJ 3SJMA 3HOWJ 2E19A 5IPAA 2XSDC 5DS9A 2L7MP 1MBHA 3NAUA 1VNDA 1H8AC 1B8IB 1W0TA 1MH4A 4QSHA 1AKHA 2WAQN 4XK4A 3HBLA 1A6IA 1IC8A 2CQQA 3A03A 3HB9A 2NOGA 5EZGA 1UMQA 1ETWA 2P81A 1D5YA 2R5YB 4DYQA 4A3BJ 3CDLA 2HYJA 2PMZN 5EZHA 2R5ZB 4D5FA 3L1PA 2CUFA 4G12A 2VKEA 4MFDA 3Q0UA 5IYBJ 2CRGA 2DMQA 1XG1A 1IGNA 3Q0WA 1JUMA 1RKTA 2G0EA 4M3FA 4B1RA 3GTJJ 4GFBA 4DW6A 5IOZA 4A3EJ 5E3LA 4I6ZA 2E2IJ 4FE7A 2R93J 3GTQJ 4FE4A 4FISA 2NVQJ 3BQZA 3FIWA 4L5EA 4AYBN 2DA5A 1ETYA 4RBOA 3BTJA 3BG9A 4MIMA 4D5CA 3A01A 2TCTA 3QPLA 1SANA 4B4CA 1MSFC 1A5JA 1HDDC 2B63J 1GVDA 4B3AA 1FIAA 2CQXA 3FISA 3HOYJ 2AO9A 3G1LA 3G1MA 5EDNA 3GTMJ 1GV2A 3C2BA 2HDDA 1QVTA 3FK6A 5FLVA 1MBJA 4UUSA 1ORKA 4UUSB 1F36A 5F27A 2YS9A 2HI3A 2Y30A 1APLC 3TW6A 2JA6J 3JR9A 2IAIA 1ZGWA 1Z77A 3HM5A 4XIDA 1MBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 J;  2DA3 A;  5DTD A;  1FEX A;  1U9O A;  1TWF J;  1NTC A;  3WHB A;  1MNM C;  3S2H J;  3K2A A;  2GBY A;  3B6A A;  1IG7 A;  2VUM J;  3PM1 A;  1JTX A;  1I50 J;  2LR8 A;  3JRI A;  2H8R A;  1EF4 A;  2ZB9 A;  5F0H A;  2MG4 A;  1X2N A;  1TWH J;  2VI6 A;  3SDG A;  5FJ8 J;  1LE8 A;  2XGC A;  2ME0 A;  1RKW A;  4NDL A;  3JRF A;  3JRH A;  2GM4 A;  3PO2 J;  1S7E A;  1IRZ A;  1X58 A;  2X6O A;  3DCF A;  1MBK A;  5J3L A;  1ZR4 A;  2DTZ A;  3BG5 A;  2O7O A;  5JLX A;  3JRB A;  2XGD A;  2R92 J;  3GTG J;  4JP0 A;  3MKL A;  3M4O J;  5FKM A;  2Y9Z A;  4I76 A;  1HDP A;  1JKO C;  2JJ7 A;  5J1R A;  1OCT C;  3D1N I;  3S17 J;  4JYK A;  1U9N A;  4V2G A;  5M5Y J;  1P7J A;  4M3B A;  1XC5 A;  4Y7N J;  3Q0V A;  2E2J J;  3GTO J;  3A01 B;  2COB A;  3S16 J;  2D5V A;  3HEF A;  3QPS A;  3VPR A;  5K7F A;  3MVP A;  1FTT A;  3PO3 J;  1Q1V A;  3BT9 A;  3BR2 A;  2OPT A;  1H89 C;  3GTP J;  1IDY A;  2FQ4 A;  3LSJ A;  1QVU A;  4JX4 A;  1I3Q J;  4A3J J;  4Y52 J;  3MN2 A;  4IHY A;  3TED A;  4A3I J;  4EEF G;  3O8G A;  5GPC A;  4XRM A;  4C2M J;  5F1J A;  2DN0 A;  4V2F A;  2EQR A;  2L9R A;  2R5Z A;  1FJL A;  1UG2 A;  3B6C A;  4MLO A;  1ZK8 A;  1JUP A;  2Y31 A;  3JRC A;  3G1O A;  4C3J J;  1BJZ A;  1T56 A;  2M0C A;  3HOX J;  2EZI A;  3HOZ J;  3BR1 A;  1AKH B;  2JA8 J;  4IHV A;  3JRG A;  2DMP A;  2X48 A;  1LE8 B;  2HXO A;  3HGG A;  4IEJ A;  4BY7 J;  2DJN A;  1IV6 A;  3LSR A;  1WGX A;  1Y1V J;  4QTR A;  4W1U A;  2RAE A;  2EZH A;  1YRN B;  1YRN A;  4A3D J;  5EGO A;  3TP3 A;  2KT0 A;  4X6A J;  2DMT A;  4IHW A;  1JTY A;  1F43 A;  5C4X J;  3JRE A;  4MFE A;  3A02 A;  5IP9 J;  1SFO J;  1ZKG A;  3RQI A;  1PUF B;  1O4X A;  5F04 A;  3JRD A;  5EF6 A;  3GTL J;  3BQY A;  1WPK A;  3HOU J;  5J1Y A;  3GTK J;  3Q3S A;  5J1U A;  5EG0 A;  4A3C J;  1ETX A;  2YUS A;  2QF7 A;  2JMW A;  3E7L A;  3IV5 A;  1ITY A;  3ZQL A;  2K9S A;  1HOM A;  4BBS J;  3ZQC A;  1JT6 A;  3NAR A;  3BR3 A;  1WCM J;  2WV1 A;  5EYR A;  5K7H A;  1R9T J;  1T33 A;  1JGG A;  2OF7 A;  2XB5 A;  2MSY A;  1DU0 A;  3HGY A;  1TWC J;  1UHS A;  3OOU A;  2XPU A;  2ID6 A;  2DA7 A;  2ECB A;  3BTL A;  1HCR A;  2EZL A;  1Y1W J;  2CU7 A;  2JN6 A;  2M9H A;  3ZQI A;  2I10 A;  2EBI A;  2IEK A;  4FCY A;  4M3D A;  4A3G J;  1NK3 P;  2M2E A;  5HOD A;  1LFU P;  1IJW C;  1VF9 A;  2ECC A;  3S15 J;  2JK3 A;  4C3I J;  5IYD J;  2L0K A;  5M3M J;  1K83 J;  3OSF A;  4ABZ A;  3UKG A;  1B72 A;  1VFC A;  2NS8 A;  3CQZ J;  1U8B A;  1QRY A;  5FKL A;  3LSP A;  5F08 A;  3RZO J;  3BR0 A;  1G2H A;  3IH2 A;  2ELK A;  2MW8 A;  1Z0X A;  2LKX A;  2Y0S N;  1OCP A;  2KDZ A;  4D7M A;  1I6H J;  5JLW A;  3S1M J;  1JUS A;  2JWT A;  1BA5 A;  1K61 A;  2EH3 A;  2LK2 A;  4JX6 A;  2JA7 J;  2O8K A;  3IH3 A;  5IP6 A;  4IHX A;  4DZJ A;  3W6V A;  4M6V A;  3DEW A;  2LTP A;  3IH4 A;  3H3V K;  1AU7 A;  2NVT J;  1FIP A;  5FKN A;  4DYR A;  3CMY A;  1GV5 A;  3S1R J;  1RR7 A;  2XPV A;  5E3O A;  5F0F A;  4AUX A;  4XRS G;  5E3N A;  2DA6 A;  3OSG A;  4A69 C;  4JX5 A;  2XPW A;  5FLM J;  3TW7 A;  1MSE C;  2R5Y A;  4FTH A;  1ETO A;  1OJL A;  3K7A J;  4A3M J;  2HQ5 A;  4RDU A;  2DA4 A;  2VKV A;  2X9D A;  4BKX A;  1POG A;  3S1N J;  1RES A;  1ETK A;  3GBG A;  4S0H B;  1MBG A;  3ZOB A;  5FKO A;  2R0Q C;  1ETV A;  2CJJ A;  4C3H J;  4DYC A;  1B8I A;  1H88 C;  1TC3 C;  3BR5 A;  5E3M A;  2W48 A;  2N8G A;  3HDD A;  3O8H A;  3F0C A;  1X2M A;  3I4M J;  2M34 A;  4AC0 A;  4A3K J;  4CYC B;  2M8G X;  5FKK A;  1CQT A;  2LLK A;  5BNG A;  1P7I A;  2NVY J;  1IUF A;  1ENH A;  4A3L J;  3FK7 A;  4MO7 A;  1VI0 A;  1W0U A;  3ZQF A;  2K40 A;  4BXX J;  1ZTR A;  1ZQ3 P;  4XRS A;  1ZR2 A;  1AHD P;  1OFC X;  2DA2 A;  2LY9 A;  1GUU A;  1JKQ C;  1RPW A;  2LFB A;  2NVX J;  3HOV J;  4QIW N;  4D7N A;  3S14 J;  2QCO A;  4X1E A;  3LNQ A;  3RZD J;  2VPR A;  2WB1 N;  3H0G J;  2HOA A;  5GPA A;  5F0C A;  4UUT A;  5IYC J;  2HOS A;  4DZP A;  1WH5 A;  2TRT A;  1TWA J;  5EGO B;  1JKR C;  4M3G A;  3I4N J;  2AHQ A;  2ME6 A;  1MH3 A;  2K9N A;  4A93 J;  2NS7 A;  3SFI A;  5IOY A;  1XS9 A;  4M3E A;  2XB0 X;  1HLV A;  5C44 J;  5EEA A;  4J19 A;  2CUE A;  3QQA A;  1GT0 C;  5EG0 B;  1TWG J;  5C4J J;  1LFB A;  5M5X J;  3RKQ A;  2HXI A;  2XRL A;  3WHC A;  5M5W J;  2LD5 A;  4XIC A;  3S2D J;  1U78 A;  2LVS A;  1GDT A;  2L7F P;  1B72 B;  5M3F J;  1JJ8 C;  5K7Z A;  3BTI A;  5C3E J;  5GP9 A;  1DU6 A;  2E2H J;  1FTZ A;  2DMU A;  2IBD A;  3OIO A;  4W97 A;  9ANT A;  4CYC A;  1IDZ A;  2FX0 A;  1BL0 A;  1JJ6 C;  1JT0 A;  2FD5 A;  3HKZ N;  2ID3 A;  1WI3 A;  2DA1 A;  1HF0 A;  1NK2 P;  2R7Z J;  3LOC A;  1QPI A;  2E1O A;  1BW6 A;  2EZK A;  2HOT A;  2Y9Y A;  1ETQ A;  3BTC A;  3ZQH A;  1E3O C;  2L7Z A;  3ZQG A;  2GLO A;  2MGQ A;  3BR6 A;  1JKP C;  1PUF A;  4HNV A;  3S1Q J;  2DMN A;  1BW5 A;  3CCY A;  2LP0 A;  2O9L A;  2XGE A;  3LSG A;  3TP0 A;  3BG3 A;  3FKI J;  2YU9 J;  3M3Y J;  2JA5 J;  2H1K A;  1RET A;  1WH7 A;  5IP7 J;  2K9Q A;  1MBF A;  2FJ1 A;  3JRA A;  4A3F J;  4LOC A;  2Y2Z A;  4BBR J;  3SJM A;  3HOW J;  2E19 A;  5IPA A;  2XSD C;  5DS9 A;  2L7M P;  1MBH A;  3NAU A;  1VND A;  1H8A C;  1B8I B;  1W0T A;  1MH4 A;  4QSH A;  1AKH A;  2WAQ N;  4XK4 A;  3HBL A;  1A6I A;  1IC8 A;  2CQQ A;  3A03 A;  3HB9 A;  2NOG A;  5EZG A;  1UMQ A;  1ETW A;  2P81 A;  1D5Y A;  2R5Y B;  4DYQ A;  4A3B J;  3CDL A;  2HYJ A;  2PMZ N;  5EZH A;  2R5Z B;  4D5F A;  3L1P A;  2CUF A;  4G12 A;  2VKE A;  4MFD A;  3Q0U A;  5IYB J;  2CRG A;  2DMQ A;  1XG1 A;  1IGN A;  3Q0W A;  1JUM A;  1RKT A;  2G0E A;  4M3F A;  4B1R A;  3GTJ J;  4GFB A;  4DW6 A;  5IOZ A;  4A3E J;  5E3L A;  4I6Z A;  2E2I J;  4FE7 A;  2R93 J;  3GTQ J;  4FE4 A;  4FIS A;  2NVQ J;  3BQZ A;  3FIW A;  4L5E A;  4AYB N;  2DA5 A;  1ETY A;  4RBO A;  3BTJ A;  3BG9 A;  4MIM A;  4D5C A;  3A01 A;  2TCT A;  3QPL A;  1SAN A;  4B4C A;  1MSF C;  1A5J A;  1HDD C;  2B63 J;  1GVD A;  4B3A A;  1FIA A;  2CQX A;  3FIS A;  3HOY J;  2AO9 A;  3G1L A;  3G1M A;  5EDN A;  3GTM J;  1GV2 A;  3C2B A;  2HDD A;  1QVT A;  3FK6 A;  5FLV A;  1MBJ A;  4UUS A;  1ORK A;  4UUS B;  1F36 A;  5F27 A;  2YS9 A;  2HI3 A;  2Y30 A;  1APL C;  3TW6 A;  2JA6 J;  3JR9 A;  2IAI A;  1ZGW A;  1Z77 A;  3HM5 A;  4XID A;  1MBE A; 
#chains in the Genus database with same CATH topology
 5BPI A;  3GX4 X;  3F72 A;  4B44 A;  4A0Z A;  1TWF J;  3CCM I;  1MNM C;  3IWZ A;  3S2H J;  2GBY A;  2YX4 A;  3LSI A;  1I50 J;  1WZ2 A;  2LR8 A;  2H8R A;  2ZB9 A;  2MG4 A;  3CF2 A;  3SDG A;  1LE8 A;  2KHM A;  1T0F A;  3GFL A;  3OS2 A;  2LY1 A;  3PO2 J;  2IVM A;  1IRZ A;  1Z9C A;  1CF7 A;  1DQU A;  3W2W A;  2O7O A;  3J7A Y;  2XGD A;  2DYR H;  3H9Q A;  2PI0 A;  3GLX A;  4LIU A;  4JP0 A;  2G7H A;  4ZZD A;  2QQB A;  2GA2 A;  2XF6 A;  3CJR B;  3CJN A;  3K4K A;  2E36 A;  2UV1 A;  4QPQ A;  2XUB A;  4X0G A;  1V54 H;  5M5Y J;  5JHU A;  1N75 A;  2NRA C;  4Y7N J;  3GTO J;  4M9X A;  3DTE A;  5K5O A;  2COB A;  3CLQ A;  3ZMT A;  3S16 J;  4EMS A;  3V8K A;  3W2V A;  1QHH D;  2OZU A;  3VPR A;  3A2K A;  3DU6 A;  1VQK I;  3E6B A;  5L3E A;  4XKW A;  1ZG3 A;  1FTT A;  4CCN A;  3PO3 J;  5JI6 A;  1G4D A;  1SAX A;  3BT9 A;  2E71 A;  2P5K A;  2DFH A;  1RR8 C;  3LSJ A;  3HPH A;  5CVU A;  5FD6 A;  4UNO A;  2QA4 I;  4A3I J;  2HVQ A;  3DF8 A;  4EEF G;  2P7C B;  2KIM A;  3ISP A;  5A2Q Z;  3ZXS A;  3DWL E;  3VYR B;  2IS4 A;  2E1C A;  2EA4 A;  3OWT A;  2Y31 A;  5LGT A;  3DBR B;  4CH7 A;  2ZJ2 A;  2DXI A;  2EZI A;  3K1M A;  2WV0 A;  2UXX A;  1MGT A;  1AKH B;  4KN7 X;  3RTR A;  4BHP A;  1QO0 D;  2JA8 J;  2W7N A;  1EKE A;  1U2W A;  3JCU C;  1X4O A;  4PSX A;  4PJN A;  3NQO A;  1A36 A;  3WTX C;  3HGG A;  1Z91 A;  2ZFU A;  1QZZ A;  2DOD A;  1T8I A;  1Y1V J;  4XLN F;  3RJP A;  4BQN A;  1ZAO A;  2EZH A;  2PG4 A;  3TDU C;  3R0J A;  2VKH A;  5D4R A;  2F5E A;  1K7A A;  1F43 A;  2I5U A;  3JRE A;  4MFE A;  2KFD A;  2Y75 A;  2OCE A;  5IP9 J;  1QHG A;  3F8M A;  1PUF B;  3WTW C;  1O4X A;  1BC7 C;  3KP3 A;  3W2A A;  4XR6 A;  2Z33 A;  5EF6 A;  2CQN A;  3P9I A;  2VXZ A;  3NWT A;  1IN4 A;  3Q3S A;  4KDP A;  1XCV A;  4XLH A;  2VQG A;  1OLT A;  3KX2 A;  2WAE A;  3ULQ B;  3FX3 A;  1I1G A;  2JMW A;  1XGO A;  2W25 A;  2CYY A;  3S32 A;  2V4J C;  4AD9 A;  1C0W A;  1HA8 A;  2DT7 B;  1JT6 A;  1T98 A;  2F5C A;  3BDD A;  3NAR A;  2KMU A;  3VSL A;  5LLQ A;  3BR3 A;  1WCM J;  1HXD A;  1VTN C;  2X1C A;  1JGG A;  2F5F A;  1LEB A;  1DU0 A;  4ZDO A;  3OOU A;  2BYV E;  2PQ8 A;  1M1E B;  3LST A;  5DD8 A;  5E1Z B;  2ID6 A;  3KP5 A;  2ECB A;  2GXA A;  2M5W A;  5KAF C;  4MQ9 F;  4UV8 A;  1OQY A;  2EBI A;  3LAJ A;  3TMO A;  1NK3 P;  2FRH A;  1LFU P;  3IKT A;  1FOX A;  2VKD A;  4HV6 A;  1LFP A;  3QYF A;  3ROU A;  3S15 J;  1DPR A;  2L0K A;  3WTT C;  1MD0 A;  3CC7 I;  2X51 A;  2A5Y B;  2VPL A;  2B9S A;  1R22 A;  5E20 A;  4RAZ A;  2DQL A;  3L2V A;  3ERE D;  1ZH5 A;  2GOX B;  2RQP A;  3BOQ A;  1U8B A;  3FM5 A;  4BXU A;  3A1Y A;  5F08 A;  4LLL A;  3I56 I;  2D2W A;  3G6E I;  4Q48 A;  1TL8 A;  3LMM A;  4KIF A;  2BY0 A;  1G2H A;  2WB1 A;  2MW8 A;  2J5P A;  2XKP A;  2KDZ A;  3CCQ I;  2EIM H;  3OMY A;  1BA5 A;  1V5E A;  1ZGA A;  1OIS A;  1XMK A;  1ON2 A;  3DKY A;  4IRH A;  4YII A;  3CCL I;  4M6V A;  2HQR A;  3DEW A;  1MDM A;  3CC4 I;  3QYE A;  2BOL A;  3H9G A;  4KUM A;  3L00 A;  4NC8 A;  5FKN A;  4AYB A;  4DYR A;  2QVO A;  1RR7 A;  4RGU A;  3GZN B;  4UHT A;  4PJM A;  5IT9 K;  1R7J A;  2CH0 A;  4OU0 A;  3I71 A;  3QP5 A;  1MSE C;  2FE3 A;  4N4O B;  2IT0 A;  4WF2 A;  1OJL A;  1SMY F;  3K7A J;  1R5I D;  3HL2 A;  2HQ5 A;  1FMV A;  2VKV A;  1KA8 A;  1POG A;  2HOE A;  2Q1Z B;  1UZC A;  1RES A;  3GBG A;  2VE9 A;  1FSH A;  2FMY A;  4M73 A;  3ZOB A;  2W84 A;  3ABL H;  5DUI A;  1QA6 A;  3AFH A;  1XDS A;  1H88 C;  5E3M A;  3FMQ A;  1R5H A;  1WJB A;  1Y6I A;  1SC7 A;  3K69 A;  5JVG F;  4F52 A;  2M34 A;  4HX8 A;  3FM3 A;  3O6B B;  1TW3 A;  3V4G A;  3WE3 A;  1V3F A;  4LFU A;  2EB7 A;  3OOP A;  4XSX F;  1EV7 A;  4U87 A;  3BC8 A;  3TKY A;  2VT2 A;  4YRV A;  3ZQQ A;  4HOB A;  1MMA A;  2QEX I;  2PN6 A;  1WVR A;  1P7I A;  2QGU A;  3LL7 A;  3MKW B;  5LHI A;  4A3L J;  4MO7 A;  1W0U A;  3V7C A;  2DLL A;  2RGV A;  2JZY A;  4UB6 C;  2RQQ A;  2LBF B;  3REO A;  1ZTR A;  3K70 D;  3U21 A;  4XRS A;  1ZR2 A;  2F4O B;  2DA2 A;  4II3 A;  4QPO A;  4ZH4 F;  3PNT A;  4FQG A;  3R6S A;  2CQK A;  3M1C A;  2K3F A;  3DU5 A;  2CG4 A;  4QIW N;  2CV1 A;  4I99 C;  4X1E A;  2JUG A;  2VPR A;  2QQ8 A;  1OCC H;  2STT A;  2BY1 A;  1O3Q A;  3FHZ A;  2BY2 A;  2XAF A;  4BQO A;  2CV2 A;  2DAO A;  2RRE A;  3OYL A;  2UWM A;  2PJR A;  2FOW A;  4DZP A;  1H0M A;  1TZL A;  2F6C A;  3KZY A;  3I4N J;  1HKQ A;  3KLN A;  1UEL B;  4KFC A;  4A93 J;  2NS7 A;  1FC3 A;  1Y8R B;  3OYA A;  1SEU A;  1HLV A;  2F4M B;  2OC6 A;  1BI1 A;  4MHG A;  4L5J A;  5C44 J;  2QBY A;  1OCZ H;  1Y8Q B;  1PYV A;  2IPQ X;  3AG3 H;  2R7U A;  1GT0 C;  4RMN A;  1V5F A;  5EG0 B;  2M7B A;  3RCO A;  3PQK A;  3BJA A;  1YG2 A;  2HTS A;  2XRL A;  2LD5 A;  1I1S A;  4XIC A;  5E1W A;  1IUY A;  4ZYH A;  4I0B A;  3HUG A;  1RUO A;  1HW5 A;  4LG0 A;  3OYH A;  4Y4R A;  5M3F J;  4F3Q A;  2V9V A;  3BTI A;  4R1H A;  5C3E J;  2FXA A;  1DU6 A;  1FTZ A;  3RQ4 A;  3P7N A;  3OIO A;  4M6X A;  3COA C;  3M7G A;  4TV7 A;  5FFX A;  9ANT A;  2OU2 A;  3D5L A;  5DYM A;  2FX0 A;  1BL0 A;  3R60 A;  2A6E F;  2BHZ A;  2FF4 A;  1T6S A;  2V1N A;  1QPI A;  3WTZ A;  2E1O A;  2HOT A;  2Y9Y A;  2L7Z A;  1IXC A;  4IQ4 A;  2R7Q A;  5BOX A;  2DMN A;  5ICE A;  2O9L A;  1KON A;  5D8L B;  3VWB A;  3TP0 A;  2QEN A;  1LB2 A;  5HNH A;  2LRE A;  2OA4 A;  5CVJ A;  3OYB A;  4ZDP A;  3S3O A;  1RET A;  4HF2 A;  1WH7 A;  4EJW A;  4XLA A;  2Y2Z A;  5F64 A;  2LNB A;  3IWF A;  1AOY A;  2EFN A;  2XSD C;  5DS9 A;  3PUB A;  4BH9 A;  3WG7 H;  1JHH A;  2VB6 A;  1OR7 C;  2JQ7 A;  1VND A;  1IN6 A;  2X4H A;  4Q47 A;  1W0T A;  2VJJ A;  3KP4 A;  2EFO A;  2HGC A;  4A5N A;  2M3A A;  4BGD A;  1X3Z B;  4EGZ A;  2PJP A;  1EH6 A;  1KGS A;  2MBF A;  3PUF A;  1IC8 A;  3A03 A;  1DDN A;  1B9N A;  4IRI A;  4IHT A;  4HNU A;  3V7S A;  3B73 A;  2BVM A;  3ZMZ A;  4Q4Z F;  2H8W A;  2Z16 A;  5EZH A;  2IP2 A;  1G3W A;  2CUF A;  4G12 A;  4MFD A;  1TQP A;  1PVE A;  4AVP A;  1ONV A;  3PFI A;  1S7A A;  2VC1 A;  1FOW A;  2LRD A;  3W3C A;  1OR7 A;  5J4Y A;  1OPC A;  2G0E A;  1K6O A;  4ESB A;  4GFB A;  1EH8 A;  1AA7 A;  3CUQ C;  4NHJ A;  5EJC A;  4A3E J;  3AG2 H;  5E3L A;  1LNW A;  3QOP A;  3V8J A;  1CGP A;  3K4C A;  2R93 J;  2BHY A;  3JAM Z;  4IHS A;  4L5E A;  3RKY A;  4CGZ A;  1ETY A;  4RS8 A;  1GXP A;  4EV0 A;  3DTK A;  3BTJ A;  3BG9 A;  4MIM A;  5HVQ C;  1LQ1 A;  4QWQ A;  2CUJ A;  3DPT A;  2K27 A;  3QOE A;  4D5C A;  1XPX A;  1XN7 A;  4HF0 A;  1SD7 A;  2E7W A;  3ASN H;  4BEH B;  1MSF C;  4BJ6 C;  3OY9 A;  1Z67 A;  2YX7 A;  4E4H A;  3PIO F;  2QZ8 A;  3F6O A;  3SHF A;  3HOY J;  2JUC A;  1W36 D;  4I0A A;  3H0D A;  2R7W A;  4IXA A;  1BJA A;  5J8F A;  2HNH A;  3GO5 A;  3LWF A;  3QU3 A;  3IKV A;  4HBL A;  2NOJ B;  3H3U A;  3LQQ A;  2FSW A;  3C2B A;  1Z6T A;  1QVT A;  1MBJ A;  4BJ5 C;  3QWL A;  2PMZ A;  4U7B A;  3HYI A;  2HI3 A;  1BIB A;  4RAY A;  4E6K G;  2R7O A;  4Q5S F;  1E0E A;  1F1Z A;  4CO8 A;  1W7P D;  3JR9 A;  2KJB A;  1ZGW A;  3SZP A;  3OYN A;  3AG4 H;  4Z6Y A;  4GDF A;  1ZRF A;  2ZKZ A;  2DBB A;  5B3S H;  1E17 A;  1X19 A;  3N4M A;  3D5R C;  4PSW A;  3E1S A;  4E7Z A;  1FEX A;  1U9O A;  3OL4 A;  3I0T A;  1QZY A;  2P0W A;  3EUK L;  4E7J A;  2VUM J;  4P55 A;  2RNJ A;  3GXO A;  2LF7 A;  1EF4 A;  4KN4 X;  1S72 I;  1RKW A;  3AAF A;  2GM4 A;  4JQF A;  3KYL A;  1QQI A;  2FU4 A;  1X58 A;  1EJ9 A;  2D1V A;  3T8T A;  1MBK A;  2W4S A;  5GAH J;  2ZFW A;  1R6R A;  3H36 A;  4ON0 A;  5JLX A;  4GXO A;  3JRB A;  5GTH C;  2R92 J;  3GTG J;  1NG7 A;  3SZG A;  2VOO A;  3E6M A;  1TW2 A;  5FKM A;  3IC7 A;  3WG9 A;  3DXJ F;  2XAU A;  1JKO C;  2XAH A;  3NEU A;  3DPU A;  4PGG A;  2HS5 A;  3S17 J;  4JYK A;  1WI9 A;  2MLG A;  3ABK H;  2DFE A;  3FDY A;  1KU2 A;  2FA5 A;  3V7R A;  3OYC A;  1R1U A;  4PFP A;  1BBY A;  2CUZ A;  2EV5 A;  5CJ9 A;  2EIN H;  3Q0V A;  3WTU C;  5ICC A;  5KHD A;  4BS9 A;  1S5L C;  3C18 A;  3HEF A;  3ELK A;  1ZRD A;  3EUH C;  2B0L A;  2FBI A;  2GIZ A;  4PK4 A;  2DK5 A;  1RIO H;  3MWM A;  1VQP I;  1XB4 A;  3I9V 2;  3C2G A;  3PNY A;  3C7J A;  1LJ9 A;  1Q1V A;  1R58 A;  3BR2 A;  4EJV A;  2IA2 A;  5E18 F;  4JX4 A;  4Y52 J;  2BY3 A;  2QWW A;  4IHY A;  2VIX A;  1OMI A;  2W57 A;  1YX5 A;  2DN0 A;  1XGM A;  2L9R A;  3OS1 A;  1YW7 A;  3B6C A;  5LGU A;  3HUG B;  3ZCO A;  1BIA A;  5J6X A;  4P96 A;  3HHG A;  4HDU A;  5D5X B;  2KZG A;  2IS1 A;  1SAU A;  2LG4 A;  2M0C A;  4BHB A;  3I54 A;  4E7I A;  4CUG A;  4C30 A;  6PAX A;  2DYS H;  3JRG A;  2KRF A;  4HX7 A;  4KIC A;  1ZHF A;  4IEJ A;  5CQE A;  1IV6 A;  4E7K A;  2VQL A;  2HYG D;  2K7L A;  1WGX A;  4W1U A;  5FRM A;  4HX4 A;  1OKR A;  2M4G A;  2L7K A;  3TDZ C;  4B3X A;  5K5Q A;  5EGO A;  2B7E A;  3GUD A;  1O3R A;  1RRJ A;  4IHW A;  1JTY A;  3E5X A;  1QBJ A;  4KIS A;  1PP8 F;  5C4X J;  3U2R A;  5B5E C;  3OYG A;  2GOM A;  4II2 A;  5TGT A;  1VQ9 I;  3ZQ7 A;  3BQY A;  1IN8 A;  1WWX A;  2NAZ A;  3HOT A;  4IJA A;  2K02 A;  2P5L C;  3HOU J;  2XC7 A;  5CQG A;  2Y48 A;  5J1U A;  4RGX A;  3UNG C;  2VOP A;  2PBI A;  2IW5 A;  4WX9 A;  3IAM 2;  5HS7 A;  3S2W A;  1T39 A;  1K4S A;  2M8E A;  2EFW A;  2FUG 2;  1RI7 A;  5HLH A;  5D4S A;  1A04 A;  4BBS J;  1XX5 A;  3L09 A;  4CIC A;  3JTG A;  4HQE A;  4DQ2 A;  2IA1 A;  5K7H A;  4UXN A;  3AL0 C;  2OF7 A;  2EV0 A;  2E7X A;  3HGY A;  5FGM A;  1UHS A;  2WY7 Q;  4ZZL A;  3J7A O;  2QSF X;  2W85 A;  2DA7 A;  2NVU B;  2LF8 A;  4IPA A;  2JN6 A;  3WGG A;  2A5W A;  4A3G J;  4O6J A;  3FXR A;  2F2E A;  1YIJ I;  1VF9 A;  1OCR H;  3V8L A;  2L9S A;  1Z7U A;  4RAG A;  3WU1 B;  2AS5 F;  5CVV A;  5M3M J;  3F3X A;  1U8R A;  2LBF A;  1R5G A;  4ABZ A;  1HBX G;  4D9J A;  1B72 A;  4LB5 A;  4CYD A;  1QZE A;  1T08 B;  1G3S A;  2ZO4 A;  5E17 F;  1QRY A;  4F93 B;  3FXJ A;  5FKL A;  3LSP A;  4RB0 A;  3RZO J;  2VQH A;  2CQ7 A;  3BZK A;  2KJC A;  2OJE D;  3BR0 A;  4YFX F;  3QOD A;  3IH2 A;  5KNL A;  4KJZ A;  2CV0 A;  2CWE A;  2ACJ A;  2Y0S N;  5LBQ A;  3U1K A;  2X6X A;  4D7M A;  3MKZ A;  2ETH A;  3S1M J;  1IXS B;  5JHF A;  2KDO A;  3CUO A;  1B9M A;  2JA7 J;  2O8K A;  3IH3 A;  3I5U A;  1FPQ A;  3HTU A;  5JVT A;  4M6Y A;  3MD2 A;  3W6V A;  5DDG A;  5KK1 A;  4M72 A;  3D5S C;  4FET A;  1XD7 A;  5TIS C;  5ICG A;  5DM6 F;  4LG3 A;  1BR1 A;  4U88 A;  3BY6 A;  4LK1 F;  5F0F A;  4XRS G;  5FRN A;  5E3N A;  2DA6 A;  2P5V A;  3SEQ A;  2JRM A;  4JX5 A;  5D6E A;  1JXS A;  2OD5 A;  2BW3 B;  5FLM J;  1ETO A;  1UST A;  3Q9V A;  3OYI A;  4RDU A;  1WJD A;  2DA4 A;  4BKX A;  4YFK F;  4S0H B;  5K1Y A;  4ANJ A;  2EWN A;  4C3H J;  1PDN C;  3KFW X;  4MTE A;  5GTI C;  2N8G A;  1X1B A;  3HZJ A;  3GYH X;  3HDD A;  3GWZ A;  3O8H A;  2KRC A;  1X2M A;  5FLX Z;  2GQQ A;  5LFA A;  4YIR X;  4A3K J;  1R1T A;  3GFM A;  3F9K A;  2JVH A;  2ZNZ A;  3A0B C;  3VOE A;  3DLA A;  1IW7 F;  4OIO F;  1D8K A;  2MC4 A;  1IUF A;  1IV8 A;  3DLL F;  1N25 A;  1VI0 A;  4P1W A;  3ZQF A;  2GZW A;  3VEP A;  3P5J A;  5ILS A;  2Z3Y A;  3ABT A;  3FBI B;  3KP6 A;  3OYM A;  4ZJZ A;  1K6Y A;  4WXD A;  1AHD P;  1ZEL A;  3JW4 A;  3G4S I;  2LFB A;  4GYI A;  3S14 J;  2V9P A;  3AL0 B;  1IRX A;  2QCO A;  3BP8 A;  3VDX A;  3LNQ A;  1D5V A;  2Z1D A;  1KQ0 A;  3UR3 C;  3GZ5 A;  2XHK A;  3I53 A;  1ODD A;  2WB1 N;  4XN3 A;  3F8C A;  3KYD B;  1ZAR A;  2DW4 A;  4Z2Y A;  3CCJ I;  1N78 A;  4ENM A;  1J2X A;  1D0Y A;  2QSG X;  3SYT A;  2UUZ A;  4E7H A;  5DCM A;  4EM1 A;  3VOD A;  1A6Q A;  2WAF A;  3EET A;  5LRR A;  2G9W A;  1TWA J;  2ZXJ A;  2K9L A;  2YR2 A;  1JKR C;  2V1U A;  1BI2 A;  2OAZ A;  1FYK A;  2MH2 A;  5HLI A;  3AKZ A;  3CMM A;  3MMY B;  3L2R A;  4GRI A;  2QLZ A;  3SFI A;  3ZR8 X;  2EFP A;  4XKC A;  2XB0 X;  1O7F A;  2Q2E A;  2ELH A;  3K9T A;  4XN0 A;  1Z21 A;  2LYC A;  1XCB A;  5EEA A;  2R7S A;  5F6F A;  2MFZ A;  3WGH A;  1W7P B;  3KCC A;  5C4J J;  3G3Z A;  1ZG5 A;  1LFB A;  1U5T C;  1W7P A;  2HXI A;  5M5X J;  4BAC A;  3RKQ A;  2RC4 A;  3JSP A;  3OYF A;  1LDK B;  4XLF A;  1LPQ A;  3K70 C;  3EUA A;  2BBY A;  4Y15 A;  2L7F P;  4RGR A;  1WJF A;  4WK8 F;  3MZY A;  4UVA A;  2X0L A;  3RPU A;  3PSF A;  4KNY A;  1LKX A;  4F92 B;  3I64 A;  4CCM A;  5E8G A;  3DQV C;  5B1B H;  2IBD A;  2OTL I;  2DO7 A;  2KRH A;  2A61 A;  2HU9 A;  5CVR A;  1EA3 A;  2XDV A;  3H9J A;  2ID3 A;  1TNT A;  4DGW B;  2UZK A;  1HF0 A;  4IRG A;  1BW6 A;  2EZK A;  1JGS A;  1YOV B;  3BTC A;  3CDI A;  5J4V A;  4R79 A;  3HSR A;  4BDZ A;  1WJA A;  1XMA A;  3ZQG A;  1W36 C;  2MGQ A;  2K3P A;  2GLO A;  4H0E A;  3ABM H;  3MKY B;  1PUF A;  1L3L A;  1BW5 A;  2JSC A;  3CCY A;  4HAM A;  1P4W A;  1KYW A;  4DIQ A;  3LSG A;  2V1X A;  3ZP5 A;  3BG3 A;  3M3Y J;  2YU9 J;  3HSF A;  2V79 A;  1SD5 A;  3HRU A;  1IN7 A;  2VBZ A;  2ZCW A;  2H1K A;  1U0J A;  4E7S A;  1WHU A;  2KIS A;  3T8R A;  2FJ1 A;  1P6R A;  3JRA A;  3EQL F;  4BBR J;  1Z7L A;  2FEZ A;  4HLX A;  3KZZ A;  3TO7 A;  3BJ6 A;  1B8I B;  2HVR A;  1MH4 A;  5D5W B;  2MAB A;  3V42 A;  3DKW A;  2DU9 A;  4QSH A;  5FLX K;  2WAQ N;  2NYX A;  4EAT A;  1T38 A;  5JR3 A;  3IP4 B;  2D1H A;  2W00 A;  3HBL A;  3CES A;  2A69 F;  3HB9 A;  5CKT A;  2FBH A;  5EZG A;  1ETW A;  4L9N A;  1FWZ A;  2WA0 A;  4NUB A;  3CDL A;  1WRJ A;  2R5Z B;  2Q0O A;  3G73 A;  4L0Z B;  2AXT C;  3QYB A;  3Q0U A;  5IYB J;  2HDW A;  2CRG A;  3CCE I;  1XG1 A;  1IGN A;  2BEO A;  3T0Y A;  1BC8 C;  3F21 A;  1S3J A;  2XVC A;  3J81 K;  1RKT A;  2LSO A;  2HPI A;  4M3F A;  3IHU A;  1YS7 A;  4A5M A;  3FXK A;  5IOZ A;  2DOE A;  2E2I J;  4FE7 A;  4EM0 B;  4FX0 A;  1FBQ A;  2COM A;  4LB6 B;  4FE4 A;  3M8J A;  5DV5 A;  1QPM A;  3B02 A;  1IF1 A;  3FIW A;  1FBS A;  1FNN A;  3FMS A;  2ZME A;  4RBO A;  1S29 A;  2HEO A;  3BCA A;  2W1O A;  4HST A;  4BDY A;  3M9A A;  4XKV A;  1X1P A;  4LLG F;  4F91 B;  1E3H A;  2DOA A;  1EH7 A;  1SAN A;  4A6D A;  5GAG J;  1A5J A;  2CFO A;  2CS3 A;  1LUJ B;  4XBF A;  2AO9 A;  2HZT A;  4RM2 A;  2GXG A;  1NG6 A;  1RC9 A;  2QQA A;  1FT9 A;  4HPQ A;  2X6Y A;  2JPC A;  5L3D A;  3N05 A;  3BPX A;  2XF7 A;  1GV2 A;  2HDD A;  1VZ0 A;  2E60 A;  2KQR A;  2G7U A;  2W24 A;  4IO9 F;  2YS9 A;  2HQA A;  1YFH A;  5L3B A;  2Y30 A;  2WAD A;  4HQM A;  2WTE A;  3C3W A;  5H20 A;  1ZG1 A;  3W6K B;  1Z77 A;  4IQJ A;  3BPV A;  1SVO A;  2OZ6 A;  4D0P A;  3ZMV A;  3VFZ A;  3RI4 A;  2V26 A;  4EVI A;  4BE0 A;  2RVC A;  3TL4 X;  3A0H C;  4BY1 J;  5BMZ A;  2DA3 A;  4XKB A;  3ZMU A;  2NXN B;  1YJW I;  4ENJ A;  1FOK A;  1MMD A;  4DBQ A;  3B6A A;  3NRV A;  1IG7 A;  3GEZ A;  3PM1 A;  5EEH A;  2F48 A;  4RB2 C;  2FNA A;  4P5O A;  1IRG A;  5F0H A;  2BZT A;  1X2N A;  2VI6 A;  2HR3 A;  4NDL A;  3JRH A;  1S7E A;  3DCF A;  5J3L A;  4B8X A;  2DTZ A;  1N77 A;  3BG5 A;  3E5Q A;  4PZJ A;  1Z05 A;  5JFR A;  1X1C A;  4N0B A;  3BG6 A;  1X1A A;  3H35 A;  1REP C;  5ILU A;  4BQA A;  3M4O J;  3P9K A;  1G59 A;  2Y9Z A;  4XLP F;  3FMR A;  2QQ9 A;  1HDP A;  2ADU A;  1QNT A;  2JJ7 A;  5J1R A;  4OWR B;  1OCT C;  3D1N I;  3FBN B;  3F8N A;  3TOB A;  1TNS A;  4CA0 A;  1GVJ A;  4EGY A;  2E2J J;  3CZ6 A;  1VQ4 I;  3A01 B;  3DBL B;  1A31 A;  4P9U A;  2D5V A;  3MAJ A;  3QPS A;  3KEQ A;  2ELJ A;  4U0V A;  1P4A A;  3I59 B;  3KEY A;  1WFX A;  1WJ5 A;  3FXQ A;  1R71 A;  3FKJ A;  3OR1 C;  3O3K A;  1H89 C;  3DPL C;  3GTP J;  4OAY A;  5K5R A;  1I3Q J;  2DPU A;  3U1D A;  1HQC A;  3GLL A;  2CO5 A;  3MN2 A;  3CCR I;  1S8N A;  3TGN A;  3E97 A;  3TED A;  1XSV A;  2GAU A;  2XAS A;  3DV8 A;  3O8G A;  4LGW A;  5F1J A;  3J7Y J;  2IA0 A;  3ZMS A;  4BQQ A;  2VBX A;  1UAA A;  3OS0 A;  3RYP A;  4M71 A;  1T2K A;  4XLE A;  3K4M A;  3JRC A;  4C3J J;  4Y17 A;  1BJZ A;  5LHG A;  2HTJ A;  3J80 K;  1U6G A;  4KIB A;  3HOX J;  1V5G A;  3SFZ A;  2MC3 A;  1VQ5 I;  2K4J A;  4PFO A;  3TBI A;  2QKL B;  2X48 A;  1LE8 B;  4BY7 J;  5FD5 A;  2KIU A;  1P9Q C;  3LSR A;  2LY2 A;  3LSM A;  4QTR A;  1YRN B;  2IS6 A;  1YRN A;  4A3D J;  2R3S A;  2P6S A;  3EDP A;  5H6R A;  3TP3 A;  3WTY C;  1V4R A;  4UV9 A;  2KZV A;  1P4X A;  2DMT A;  2E34 A;  4BNC A;  2L01 A;  2E1M C;  1BOA A;  3A02 A;  1Z3Y A;  3C1D A;  3H1C A;  2O8X A;  3BCB A;  2ESN A;  4AU7 A;  1RNL A;  2XAQ A;  3GTL J;  5AIQ A;  2GWR A;  1WSU A;  1WPK A;  5DEQ A;  4BXF A;  3IRQ A;  1MJ9 A;  2XF5 A;  5J1Y A;  3Q9S A;  4RM3 A;  2ZC2 A;  4UY8 I;  4A3C J;  4DOZ A;  5L3G A;  4HA8 A;  4Y3O A;  4A0X A;  3E7L A;  1FYL A;  2M1B A;  1QU3 A;  3ZQL A;  2DK8 A;  1Y0U A;  3J81 Z;  2A07 F;  1HOM A;  2QM3 A;  3ERM A;  3TO9 A;  2JA2 A;  2M45 A;  5EYR A;  2ZBK A;  4AWX B;  2VBW A;  1R9T J;  2VE8 A;  2LKP A;  4ZDL A;  1GLN A;  2XB5 A;  2MSY A;  2IJL A;  4F55 A;  2XPU A;  3PIP F;  2GIV A;  4DNC A;  4AIH A;  4ESJ A;  3BTL A;  1HCR A;  4WXC A;  2EZL A;  1Y1W J;  2M9H A;  3FWE A;  2I10 A;  3KPH A;  4M3D A;  5LGN A;  1HKT A;  2M2E A;  5F1R A;  2HQN A;  2IGM A;  2VAS A;  1O3T A;  3PL8 A;  1HST A;  1R23 A;  1L0O C;  2JK3 A;  4C3I J;  4RAF A;  1K83 J;  5IYD J;  3M8E A;  3OSF A;  3UKG A;  4MNU A;  1OCO H;  2JVG A;  2PFB A;  1Z6R A;  2NS8 A;  2VQC A;  3CQZ J;  3ONQ A;  3WU0 A;  4B47 A;  1F4K A;  1DGW Y;  1MND A;  4UUV A;  2DDA A;  1SFU A;  3CTA A;  4BAY A;  4ESF A;  4KA4 A;  3S3N A;  2XV4 S;  2KLO A;  1Z0X A;  2ZME B;  5ILV A;  4LD5 A;  1OCP A;  4I2O A;  4AID A;  5KVR A;  5JLW A;  1JUS A;  2H6B A;  3MCZ A;  4PJ0 C;  3G2B A;  2LK2 A;  4PGH A;  3I3L A;  1T95 A;  4XMY A;  1E3P A;  2LTP A;  3IH4 A;  5IT3 A;  4EJU A;  2F4I A;  3GCM A;  4L9V A;  4YEJ A;  4G8X A;  1R36 A;  3CMY A;  2P8T A;  3MEX A;  3S1R J;  2XPV A;  3KZI C;  4ZYE A;  1GHC A;  4AUX A;  1I39 A;  2CW8 A;  3KIO A;  3OSG A;  2X85 A;  5AON A;  2PMU A;  1TT5 B;  2L5Q A;  1HW2 A;  3H3Z A;  2L4A A;  2BW3 A;  2K5C A;  4DJA A;  3LA7 A;  1FP2 A;  3M07 A;  4IF4 A;  3T1B A;  4A3M J;  4AVZ A;  2H09 A;  5DCF A;  3EPZ A;  2F5V A;  2R4G A;  4U0W A;  3KP2 A;  3R61 A;  1G3Y A;  4YEL A;  1ETV A;  5CYV A;  1B8I A;  2L2O A;  1TC3 C;  2W48 A;  3U9G A;  1LDJ A;  1SFK A;  3CCU I;  4FAS D;  3F0C A;  1K79 A;  2ZXH A;  2IXS A;  4AC0 A;  3IRR A;  5GAE J;  2Z9O A;  2E1N A;  5ICF A;  4NB5 A;  3OR2 C;  2M8G X;  4IKF A;  4HEA 2;  4B09 A;  5FKK A;  1CQT A;  2E5N A;  2LLK A;  5DD4 A;  2LH9 A;  4KT5 C;  5BNG A;  3HC7 A;  4OMZ A;  1ENH A;  2OV7 A;  2EJR A;  3FK7 A;  1SVM A;  2KL4 A;  3L2C A;  1ZYR F;  4BXX J;  3LFU A;  3K1P A;  1ZQ3 P;  1DGR M;  1H9G A;  1Z3X A;  1GUU A;  2XKO A;  2WWY A;  1JKQ C;  1RPW A;  2NVX J;  3HOV J;  4M9Z A;  3EYI A;  2DT6 A;  4D7N A;  1VQ6 I;  5H2F C;  3RZD J;  1LEA A;  3CO7 C;  2HVS A;  2JTV A;  1DP3 A;  5J8C A;  3RDI A;  1U3E M;  1GXQ A;  3HTS B;  2ICW G;  4WCG A;  1P92 A;  3HIF A;  5F0C A;  2D45 A;  3K1N A;  3ABU A;  2Z2S B;  4UUT A;  1FZP B;  3TQN A;  2XAJ A;  2HOS A;  3L9F A;  5B1A H;  1X4P A;  3OYE A;  3LSK A;  5EGO B;  4E7L A;  1Y0N A;  1TTY A;  4M3G A;  4R8H A;  1FOY A;  2AHQ A;  2Z99 A;  2ME6 A;  2IGO A;  1J75 A;  2K9N A;  4ZYG A;  2R7V A;  2MA3 A;  3E0J B;  2HZD A;  1Q1H A;  4M74 A;  2ZXW H;  5LEJ A;  1JE8 A;  2LMD A;  3LA3 A;  2R7D A;  4ZTF A;  4O3M A;  1UB9 A;  2CUE A;  5EEG A;  3ZN0 A;  2AQF A;  2DCE A;  2L54 A;  3CP8 A;  1TWG J;  4MGR A;  3LAP A;  4L18 B;  2IS2 A;  1YQA A;  3RPQ A;  1KQ9 A;  4BL0 B;  3FHN A;  3ZPL A;  1BI0 A;  5M5W J;  2CW7 A;  3S2D J;  1YS6 A;  3EYY A;  2OQG A;  4PCQ A;  2LVS A;  2A3S A;  4I02 A;  1FYM A;  1B72 B;  4G9Y A;  1JJ8 C;  1BOB A;  4PJJ A;  4LIT A;  1TT0 A;  2M0M A;  3SQN A;  2E2H J;  1IXR C;  5BPD A;  1D0Z A;  2VJ5 A;  2O5R A;  2P6T A;  1XGS A;  1YHQ I;  4HNT A;  4CYC A;  1Y39 A;  2P4W A;  3K4N A;  1XSD A;  3DBH B;  2XSJ C;  3E3V A;  4S05 A;  3FXO A;  2FD5 A;  4G6T B;  3T5X A;  5DCM B;  5HS8 A;  2DT5 A;  3HKZ N;  3OYK A;  2DQR A;  1G6N A;  1NK2 P;  2R7Z J;  2C6Y A;  1ETQ A;  2HKO A;  1BN5 A;  2MH9 A;  2OUM A;  3CD6 I;  4J00 A;  4OOI A;  1SFE A;  3K4J A;  1JKP C;  3RKX A;  2F5D A;  3S1Q J;  4JOM A;  3HPG A;  3G71 I;  4MEX F;  2AXL A;  3FKI J;  4IL6 C;  2OTJ I;  4GO1 A;  1IO2 A;  5IP7 J;  4BU2 A;  2K9Q A;  3PSI A;  1MBF A;  2Y0S A;  5FFZ A;  2H94 A;  4LOC A;  3H5A A;  4E70 A;  2PJR B;  3ML6 A;  2V7F A;  3HOW J;  3R4K A;  2E19 A;  1I6X A;  3IUO A;  3FF5 A;  3KP7 A;  2L7M P;  4RGS A;  1H8A C;  3CLO A;  3D0S A;  2VN2 A;  3CJQ B;  3CUQ A;  1AKH A;  1MIJ A;  3LSH A;  3Q5F A;  2HWV A;  3H92 A;  5HS9 A;  2VOD A;  1Z1D A;  4XK4 A;  1A6I A;  4HW0 A;  4XNF A;  2CQQ A;  5ED4 A;  4ZYD A;  3ECO A;  4LJZ F;  1FLI A;  1D5Y A;  2KIF A;  3BZ6 A;  4FHT A;  3KET A;  4OIQ F;  2HYJ A;  3F8B A;  1STZ A;  1E2X A;  3WE2 A;  4KIT B;  3PNV A;  4NQW B;  5KAI C;  4AIJ A;  1TQI A;  1XTA A;  3Q0W A;  5E79 C;  1JUM A;  1WJC A;  4IOA F;  2R7X A;  4HG2 A;  3CMA I;  1WQ2 A;  1DPU A;  1ULY A;  4LG0 B;  3DFG A;  3K6G A;  3ZN1 A;  3GTJ J;  2HDC A;  4Y33 A;  5IT9 Z;  2HKX A;  2YPR A;  4I6Z A;  1O3S A;  4EM2 A;  1R4M B;  4OAZ A;  5ERI A;  5LRS A;  4HYE A;  4IZZ A;  3E5U A;  3BQZ A;  4KT6 A;  4UB8 C;  5E1X A;  4AYB N;  2DA5 A;  3HRM A;  4F7Z A;  2O3F A;  3JAM K;  3A01 A;  4N9I A;  1ZRE A;  1KU9 A;  1OYY A;  2FNP A;  2TCT A;  1S9H A;  4ASN A;  1YO5 C;  1UCR A;  4K2E A;  1VQN I;  4B4C A;  4RLQ A;  2B63 J;  2R7R A;  1YX3 A;  1GVD A;  2EIJ H;  4B3A A;  2CQX A;  2PEX A;  4WXH A;  4C9Y A;  3CC2 I;  4Y13 A;  3G1M A;  3GTM J;  4KIG A;  1X3U A;  2VL8 A;  3HKZ A;  3FK6 A;  3J80 Z;  1YLF A;  4UUS A;  1J0R A;  3ZRG A;  3FZV A;  3BRO A;  2H1L A;  1NH3 A;  5F27 A;  2DI3 A;  2Z5U A;  3RKW A;  2W82 A;  4A2U A;  3LQR A;  3TW6 A;  2JA6 J;  2NS0 A;  3BWG A;  1WJE A;  2LC2 A;  1RUN A;  4MEY F;  3SZT A;  1D1B A;  3L2W A;  1IZ1 A;  2Y0M A;  1K78 B;  2K85 A;  1UHM A;  4G7H F;  4BUP A;  3FXL A;  3HM5 A;  1ACI A;  2M4K A;  4XID A;  2JSP A;  5LD2 C;  1MBE A;  1FSE A;  2VXD A;  1YIO A;  1YW9 A;  3LFK A;  4PUS A;  3K4L A;  1MMG A;  5DTD A;  2PX9 A;  1NTC A;  3PQJ A;  3WHB A;  3K2A A;  2BGC A;  1MW7 A;  5L3C A;  4G7Z F;  1JTX A;  4HDV A;  2YU3 A;  3JRI A;  1HC8 A;  4EJT A;  1NHA A;  2V6C A;  1TWH J;  5FJ8 J;  2L4M A;  2A6H F;  2LOO A;  2XGC A;  3QAH A;  2ME0 A;  2LKS A;  5D5U B;  3JRF A;  4H4K C;  3TOA A;  2M87 A;  2EPF A;  4JBA A;  2X6O A;  1ZR4 A;  3WOD F;  5J47 A;  2CGP A;  3RSN A;  1MMS A;  2WC2 A;  2ZJP F;  2A6T A;  3S93 A;  2ZSI B;  5BQT A;  3DP7 A;  4BJT A;  2E5Z A;  3MKL A;  3MQ0 A;  1XDU A;  1ZGJ A;  4I76 A;  2ZXI A;  2VJI A;  4D1Q A;  1W5T A;  1U9N A;  4V2G A;  1J9I A;  4HSR A;  3VSK A;  4G6D A;  2XRO A;  1P7J A;  4M3B A;  2KKO A;  4P9F A;  4CCO A;  1XC5 A;  5B66 C;  2L02 A;  1SD6 A;  1TP4 A;  2H6C A;  2KIQ A;  3LA2 A;  4FT8 A;  4AIK A;  3JSO A;  3ASO H;  3I55 I;  4HV5 A;  2M30 A;  1XGN A;  4ZYA A;  5K7F A;  3I59 A;  3MVP A;  2BE5 F;  2E35 A;  4DBR A;  3ECH A;  3F8F A;  5CPR B;  3CUQ B;  1V55 H;  5H6Q A;  2OPT A;  1IDY A;  2FQ4 A;  1QVU A;  3C2H A;  3OYJ A;  3K10 A;  4A3J J;  4M9S A;  1OYI A;  4XRM A;  5GPC A;  4C2M J;  2RN7 A;  4XOR A;  4V2F A;  3DEE A;  2EQR A;  4NBQ A;  2V1D A;  3CCV I;  1K4T A;  2R5Z A;  1KYZ A;  1FJL A;  3RPU D;  1UG2 A;  1W5C C;  4MLO A;  1ZK8 A;  4QLC U;  1JUP A;  2Q8K A;  4XQF A;  2IRF G;  2MLK A;  3G1O A;  1J7K A;  3WGI A;  1ZN2 A;  1T56 A;  2MYS A;  3HOZ J;  1ON1 A;  3BR1 A;  3A4C A;  1FMW A;  4RLF A;  4YFN F;  4U7D A;  1W1W E;  1ZRC A;  2VON A;  4XOT A;  4IHV A;  1S6L A;  5CVI A;  2DMP A;  1YIT I;  2R7F A;  4CCL A;  2HXO A;  2CSO A;  3HRS A;  1USS A;  2DJN A;  1KU7 A;  2EFQ A;  5HDN A;  1YJN I;  2RAE A;  3QU6 A;  1U5T B;  4IVN A;  3IL2 A;  2CMP A;  4V19 K;  4NQW A;  1U5T A;  2X1E A;  1G3T A;  2OQR A;  3GVA A;  2DFI A;  2KT0 A;  4UVB A;  4X6A J;  5LEK A;  4RA2 A;  4A12 A;  2K9M A;  4L5I A;  2QKM B;  1BI3 A;  1SFO J;  1ZKG A;  3RQI A;  2X1D A;  5F04 A;  3F6V A;  1MNE A;  3ZMD A;  5E8I A;  3JRD A;  1WKM A;  1R49 A;  1UFM A;  2QBY B;  5DM7 F;  3CDH A;  3GTK J;  3X2Q H;  4JK1 X;  2DOF A;  4YG2 F;  5EG0 A;  3R0A A;  1ETX A;  1HW1 A;  2KPM A;  3FXM A;  4CCK A;  2YUS A;  5HLT A;  2QF7 A;  1MZB A;  5J40 A;  2L9V A;  5IY5 H;  3E6D A;  3IV5 A;  3H5N A;  3QPT A;  1ITY A;  3GZ6 A;  1R00 A;  2WY8 Q;  2FOK A;  4G94 A;  2K9S A;  3GFI A;  3KEO A;  3ZQC A;  5CLS A;  2BXZ A;  3NWS A;  3AG1 H;  4GYG A;  2WV1 A;  4J01 A;  5GAD J;  1D1C A;  3KYC B;  1T33 A;  1TWC J;  3E6C C;  3OIP A;  3K4B A;  1XSX A;  2DTR A;  4RB3 C;  4XL9 A;  3FXU A;  3QPH A;  1FP1 D;  1D0X A;  2CU7 A;  3ZQI A;  4BYY A;  4BE2 A;  1LVA A;  2XRN A;  2IEK A;  4FCY A;  3HG9 A;  1CF7 B;  1YYV A;  1KZH A;  5HOD A;  4HZF A;  1IJW C;  3WTV C;  2ECC A;  2ZNY A;  3CF5 F;  2V9K A;  1ZLK A;  3K2Z A;  2K4B A;  1VQM I;  3KLO A;  2FBK A;  1VFC A;  4OMY A;  3BLY A;  3HSE A;  1IN5 A;  3H5R A;  1PJR A;  2MD0 A;  3CME I;  2XGX A;  4BE1 A;  4I09 A;  2O0Y A;  2ELK A;  1VQL I;  2LKX A;  2BVL A;  1TBX A;  3IAS 2;  3VYT B;  1I6H J;  4I01 A;  2JWT A;  2GXB A;  1OYW A;  1K61 A;  4I98 B;  3CP2 A;  2EH3 A;  3GF2 A;  4JX6 A;  1FX7 A;  5IP6 A;  4EJO A;  4IHX A;  1SVL A;  4DZJ A;  4GCV A;  1B6A A;  2RDP A;  4CZZ A;  2JPB A;  3H3V K;  1AU7 A;  2NVT J;  1FIP A;  1GV5 A;  2A05 A;  2K86 A;  5FRO A;  5E3O A;  4I7H A;  4LMY A;  4ZTJ A;  4A69 C;  2XPW A;  2P7V B;  1D8J A;  4NC6 A;  1ERD A;  3TW7 A;  2R5Y A;  4FTH A;  5HDG A;  1YI2 I;  2ISZ A;  2EA2 A;  1YE9 A;  1IRF A;  2X9D A;  1P2F A;  2CW0 F;  1YJ9 I;  3RYR A;  1K78 A;  3S8P A;  4LLN A;  3S1N J;  1IAW A;  1ETK A;  3I4P A;  1MBG A;  5FKO A;  2R0Q C;  2CJJ A;  4DYC A;  2DPD A;  4B48 A;  4ENK A;  4GGG A;  3BR5 A;  4ZC3 A;  1QGP A;  3VB2 A;  3J7Z I;  4HRI A;  1I27 A;  3N97 A;  2QSH X;  1JHF A;  3HXL A;  3TO6 A;  2V6E A;  5LHH A;  4HF1 A;  3I4M J;  2ISY A;  5HDK A;  1SFX A;  2VJ4 A;  3GFJ A;  1HSJ A;  1O57 A;  4XSZ F;  4CYC B;  1UJ8 A;  2DFF A;  2VT3 A;  3MFK A;  2A68 F;  4BEH A;  2NVY J;  4WWC A;  2FML A;  1AWC A;  1YW8 A;  4O5V A;  3EUH A;  2K40 A;  4OIR F;  2RNG A;  2Y69 H;  1VQ7 I;  2O61 A;  3OV8 A;  3PJR A;  4NC7 A;  2VLA A;  2EIL H;  1OFC X;  2LY9 A;  1JI8 A;  4KMF A;  3O2P E;  1J5Y A;  3SEZ A;  2ZJQ F;  4MTD A;  2H27 A;  3M8F A;  3KE2 A;  3H0G J;  1B4A A;  4IOC F;  4C2T A;  1T0F C;  1W4M A;  1HKS A;  2HOA A;  2WAQ A;  5FO5 A;  5GPA A;  2ESH A;  1I5Z A;  1VQO I;  2J5O A;  5IYC J;  2VC0 A;  1WH5 A;  2TRT A;  3K0L A;  1ZLJ A;  1FY7 A;  1PP7 U;  4ITV A;  4ENN A;  4G7O F;  1PUE E;  1TLH B;  1YTY A;  3BJO A;  4LIV A;  1BR2 A;  1MH3 A;  2TDX A;  1Y56 A;  5TRD A;  3M1E A;  5IOY A;  1XS9 A;  1O7L A;  1SMT A;  4M3E A;  2FQ3 A;  4PJL A;  1BM9 A;  5FB2 A;  4CXF A;  4J19 A;  3QQA A;  2GA1 A;  4IX7 A;  4CHU A;  1XMX A;  2HFH A;  2IGN A;  4PDK A;  3WHC A;  3HJE A;  4HLY A;  1U78 A;  2QYO A;  1LVK A;  5D5V B;  3HHH A;  1GDT A;  1KQ8 A;  4N4N B;  2QUF A;  2BXY A;  2ZJR F;  1SD4 A;  5K7Z A;  4EQQ A;  1B1B A;  1VQ8 I;  4OIP F;  5GP9 A;  3MZH A;  1R1V A;  2O6G E;  2DMU A;  4KMU X;  3RIR A;  4LK0 F;  3ESW B;  4W97 A;  1IDZ A;  4XON A;  2YSR A;  5BS6 A;  1JJ6 C;  1JT0 A;  3HOS A;  3ZGK A;  4KYW A;  1MJA A;  1RZ4 A;  4NNJ A;  1WI3 A;  2DA1 A;  3JTH A;  3LOC A;  5TJJ A;  1W5S A;  5D8K B;  1MDM B;  2R7T A;  4N9H A;  3HRT A;  3ZQH A;  1E3O C;  4OIN F;  3BZC A;  3BR6 A;  3WU2 C;  3L2Q A;  1DP7 P;  3W6J B;  2JRT A;  4L9T A;  4HNV A;  5KCM A;  4CCJ A;  1D3Y A;  2CFX A;  1UG0 A;  2UXN A;  2VBY A;  2LP0 A;  2NNY A;  2XGE A;  3MZ8 A;  3F23 A;  1S7O A;  1UHW A;  1X1D A;  1I3A A;  2JA5 J;  1MMN A;  2O03 A;  3PFY A;  2PLY A;  1B59 A;  2DJI A;  2I8D A;  3BG7 A;  4A3F J;  3GME A;  4RB1 A;  3I58 A;  3SJM A;  4CDG A;  3QRF F;  5HOO A;  5IPA A;  4XOP A;  2ZSH B;  3OIQ A;  1D1A A;  1MBH A;  3NAU A;  3GW2 A;  2EV6 A;  4ETS A;  3L2U A;  1G8X A;  2XAG A;  5HLG A;  4CZC A;  2OCC H;  3DTI A;  3P9C A;  2X6W A;  4CSW A;  1FBU A;  2Q2E B;  2JT1 A;  3VYU B;  5A2Q K;  4YIF A;  2DDB A;  2M7A A;  2NOG A;  1UMQ A;  4C2U A;  2P81 A;  2ZME C;  1H9T A;  2RKH A;  3CJT B;  4DYQ A;  2R5Y B;  4A0Y A;  4A3B J;  2PMZ N;  2HPM A;  1J09 A;  2NNN A;  4D5F A;  3L1P A;  2AQE A;  2VKE A;  4L0Y B;  4MQV A;  2DMQ A;  1F9N A;  2PMH A;  3SXY A;  2STW A;  4U0Y A;  3CCS I;  4XM3 A;  1MKM A;  3L7W A;  2L3D A;  4B1R A;  5L3F A;  4DW6 A;  2L9N A;  2MD5 A;  3GTQ J;  5HNF A;  5D6F A;  4FIS A;  4BHC A;  4S04 A;  3DEU A;  1F5T A;  2NVQ J;  3VYS B;  4XLC A;  4A6E A;  1R4N B;  2KP6 A;  2LDU A;  3WTS C;  2EK5 A;  1DUX C;  3QPL A;  3DKX A;  2BV6 A;  2RV8 A;  3F22 A;  2IGK A;  4AM3 A;  1TQM A;  2XIG A;  1HDD C;  5DUK A;  2EIK H;  1A35 A;  1FIA A;  1KU3 A;  1LDD A;  3FIS A;  3G1L A;  5EDN A;  2OBP A;  1J59 A;  5FLV A;  2WBM A;  2HYF A;  1ORK A;  4UUS B;  1F36 A;  4G6Q A;  1APL C;  3S3M A;  4XRF A;  3OYD A;  4FX4 A;  3QP6 A;  3CO6 C;  5AIP A;  1BR4 A;  3OL3 A;  2IAI A;  4UVC A;  3SDB A;  1MJB A;  4B43 A;  4L9J A;  1X3W B;  2E1M B; 
#chains in the Genus database with same CATH homology
 4BY1 J;  2DA3 A;  5DTD A;  1FEX A;  1U9O A;  1TWF J;  1NTC A;  3WHB A;  1MNM C;  3S2H J;  3K2A A;  2GBY A;  3B6A A;  1IG7 A;  2VUM J;  3PM1 A;  1JTX A;  1I50 J;  2LR8 A;  3JRI A;  2H8R A;  1EF4 A;  2ZB9 A;  5F0H A;  2MG4 A;  1X2N A;  1TWH J;  2VI6 A;  3SDG A;  5FJ8 J;  1LE8 A;  2XGC A;  2ME0 A;  1RKW A;  4NDL A;  3JRF A;  3JRH A;  2GM4 A;  3PO2 J;  1S7E A;  1IRZ A;  1X58 A;  2X6O A;  3DCF A;  1MBK A;  5J3L A;  1ZR4 A;  2DTZ A;  3BG5 A;  2O7O A;  5JLX A;  3JRB A;  2XGD A;  2R92 J;  3GTG J;  4JP0 A;  3MKL A;  3M4O J;  5FKM A;  2Y9Z A;  4I76 A;  1HDP A;  1JKO C;  2JJ7 A;  5J1R A;  1OCT C;  3D1N I;  3S17 J;  4JYK A;  1U9N A;  4V2G A;  5M5Y J;  1P7J A;  4M3B A;  1XC5 A;  4Y7N J;  3Q0V A;  2E2J J;  3GTO J;  3A01 B;  2COB A;  3S16 J;  2D5V A;  3HEF A;  3QPS A;  3VPR A;  5K7F A;  3MVP A;  1FTT A;  3PO3 J;  1Q1V A;  3BT9 A;  3BR2 A;  2OPT A;  1H89 C;  3GTP J;  1IDY A;  2FQ4 A;  3LSJ A;  1QVU A;  4JX4 A;  1I3Q J;  4A3J J;  4Y52 J;  3MN2 A;  4IHY A;  3TED A;  4A3I J;  4EEF G;  3O8G A;  5GPC A;  4XRM A;  4C2M J;  5F1J A;  2DN0 A;  4V2F A;  2EQR A;  2L9R A;  2R5Z A;  1FJL A;  1UG2 A;  3B6C A;  4MLO A;  1ZK8 A;  1JUP A;  2Y31 A;  3JRC A;  3G1O A;  4C3J J;  1BJZ A;  1T56 A;  2M0C A;  3HOX J;  2EZI A;  3HOZ J;  3BR1 A;  1AKH B;  2JA8 J;  4IHV A;  3JRG A;  2DMP A;  2X48 A;  1LE8 B;  2HXO A;  3HGG A;  4IEJ A;  4BY7 J;  2DJN A;  1IV6 A;  3LSR A;  1WGX A;  1Y1V J;  4QTR A;  4W1U A;  2RAE A;  2EZH A;  1YRN B;  1YRN A;  4A3D J;  5EGO A;  3TP3 A;  2KT0 A;  4X6A J;  2DMT A;  4IHW A;  1JTY A;  1F43 A;  5C4X J;  3JRE A;  4MFE A;  3A02 A;  5IP9 J;  1SFO J;  1ZKG A;  3RQI A;  1PUF B;  1O4X A;  5F04 A;  3JRD A;  5EF6 A;  3GTL J;  3BQY A;  1WPK A;  3HOU J;  5J1Y A;  3GTK J;  3Q3S A;  5J1U A;  5EG0 A;  4A3C J;  1ETX A;  2YUS A;  2QF7 A;  2JMW A;  3E7L A;  3IV5 A;  1ITY A;  3ZQL A;  2K9S A;  1HOM A;  4BBS J;  3ZQC A;  1JT6 A;  3NAR A;  3BR3 A;  1WCM J;  2WV1 A;  5EYR A;  5K7H A;  1R9T J;  1T33 A;  1JGG A;  2OF7 A;  2XB5 A;  2MSY A;  1DU0 A;  3HGY A;  1TWC J;  1UHS A;  3OOU A;  2XPU A;  2ID6 A;  2DA7 A;  2ECB A;  3BTL A;  1HCR A;  2EZL A;  1Y1W J;  2CU7 A;  2JN6 A;  2M9H A;  3ZQI A;  2I10 A;  2EBI A;  2IEK A;  4FCY A;  4M3D A;  4A3G J;  1NK3 P;  2M2E A;  5HOD A;  1LFU P;  1IJW C;  1VF9 A;  2ECC A;  3S15 J;  2JK3 A;  4C3I J;  5IYD J;  2L0K A;  5M3M J;  1K83 J;  3OSF A;  4ABZ A;  3UKG A;  1B72 A;  1VFC A;  2NS8 A;  3CQZ J;  1U8B A;  1QRY A;  5FKL A;  3LSP A;  5F08 A;  3RZO J;  3BR0 A;  1G2H A;  3IH2 A;  2ELK A;  2MW8 A;  1Z0X A;  2LKX A;  2Y0S N;  1OCP A;  2KDZ A;  4D7M A;  1I6H J;  5JLW A;  3S1M J;  1JUS A;  2JWT A;  1BA5 A;  1K61 A;  2EH3 A;  2LK2 A;  4JX6 A;  2JA7 J;  2O8K A;  3IH3 A;  5IP6 A;  4IHX A;  4DZJ A;  3W6V A;  4M6V A;  3DEW A;  2LTP A;  3IH4 A;  3H3V K;  1AU7 A;  2NVT J;  1FIP A;  5FKN A;  4DYR A;  3CMY A;  1GV5 A;  3S1R J;  1RR7 A;  2XPV A;  5E3O A;  5F0F A;  4AUX A;  4XRS G;  5E3N A;  2DA6 A;  3OSG A;  4A69 C;  4JX5 A;  2XPW A;  5FLM J;  3TW7 A;  1MSE C;  2R5Y A;  4FTH A;  1ETO A;  1OJL A;  3K7A J;  4A3M J;  2HQ5 A;  4RDU A;  2DA4 A;  2VKV A;  2X9D A;  4BKX A;  1POG A;  3S1N J;  1RES A;  1ETK A;  3GBG A;  4S0H B;  1MBG A;  3ZOB A;  5FKO A;  2R0Q C;  1ETV A;  2CJJ A;  4C3H J;  4DYC A;  1B8I A;  1H88 C;  1TC3 C;  3BR5 A;  5E3M A;  2W48 A;  2N8G A;  3HDD A;  3O8H A;  3F0C A;  1X2M A;  3I4M J;  2M34 A;  4AC0 A;  4A3K J;  4CYC B;  2M8G X;  5FKK A;  1CQT A;  2LLK A;  5BNG A;  1P7I A;  2NVY J;  1IUF A;  1ENH A;  4A3L J;  3FK7 A;  4MO7 A;  1VI0 A;  1W0U A;  3ZQF A;  2K40 A;  4BXX J;  1ZTR A;  1ZQ3 P;  4XRS A;  1ZR2 A;  1AHD P;  1OFC X;  2DA2 A;  2LY9 A;  1GUU A;  1JKQ C;  1RPW A;  2LFB A;  2NVX J;  3HOV J;  4QIW N;  4D7N A;  3S14 J;  2QCO A;  4X1E A;  3LNQ A;  3RZD J;  2VPR A;  2WB1 N;  3H0G J;  2HOA A;  5GPA A;  5F0C A;  4UUT A;  5IYC J;  2HOS A;  4DZP A;  1WH5 A;  2TRT A;  1TWA J;  5EGO B;  1JKR C;  4M3G A;  3I4N J;  2AHQ A;  2ME6 A;  1MH3 A;  2K9N A;  4A93 J;  2NS7 A;  3SFI A;  5IOY A;  1XS9 A;  4M3E A;  2XB0 X;  1HLV A;  5C44 J;  5EEA A;  4J19 A;  2CUE A;  3QQA A;  1GT0 C;  5EG0 B;  1TWG J;  5C4J J;  1LFB A;  5M5X J;  3RKQ A;  2HXI A;  2XRL A;  3WHC A;  5M5W J;  2LD5 A;  4XIC A;  3S2D J;  1U78 A;  2LVS A;  1GDT A;  2L7F P;  1B72 B;  5M3F J;  1JJ8 C;  5K7Z A;  3BTI A;  5C3E J;  5GP9 A;  1DU6 A;  2E2H J;  1FTZ A;  2DMU A;  2IBD A;  3OIO A;  4W97 A;  9ANT A;  4CYC A;  1IDZ A;  2FX0 A;  1BL0 A;  1JJ6 C;  1JT0 A;  2FD5 A;  3HKZ N;  2ID3 A;  1WI3 A;  2DA1 A;  1HF0 A;  1NK2 P;  2R7Z J;  3LOC A;  1QPI A;  2E1O A;  1BW6 A;  2EZK A;  2HOT A;  2Y9Y A;  1ETQ A;  3BTC A;  3ZQH A;  1E3O C;  2L7Z A;  3ZQG A;  2GLO A;  2MGQ A;  3BR6 A;  1JKP C;  1PUF A;  4HNV A;  3S1Q J;  2DMN A;  1BW5 A;  3CCY A;  2LP0 A;  2O9L A;  2XGE A;  3LSG A;  3TP0 A;  3BG3 A;  3FKI J;  2YU9 J;  3M3Y J;  2JA5 J;  2H1K A;  1RET A;  1WH7 A;  5IP7 J;  2K9Q A;  1MBF A;  2FJ1 A;  3JRA A;  4A3F J;  4LOC A;  2Y2Z A;  4BBR J;  3SJM A;  3HOW J;  2E19 A;  5IPA A;  2XSD C;  5DS9 A;  2L7M P;  1MBH A;  3NAU A;  1VND A;  1H8A C;  1B8I B;  1W0T A;  1MH4 A;  4QSH A;  1AKH A;  2WAQ N;  4XK4 A;  3HBL A;  1A6I A;  1IC8 A;  2CQQ A;  3A03 A;  3HB9 A;  2NOG A;  5EZG A;  1UMQ A;  1ETW A;  2P81 A;  1D5Y A;  2R5Y B;  4DYQ A;  4A3B J;  3CDL A;  2HYJ A;  2PMZ N;  5EZH A;  2R5Z B;  4D5F A;  3L1P A;  2CUF A;  4G12 A;  2VKE A;  4MFD A;  3Q0U A;  5IYB J;  2CRG A;  2DMQ A;  1XG1 A;  1IGN A;  3Q0W A;  1JUM A;  1RKT A;  2G0E A;  4M3F A;  4B1R A;  3GTJ J;  4GFB A;  4DW6 A;  5IOZ A;  4A3E J;  5E3L A;  4I6Z A;  2E2I J;  4FE7 A;  2R93 J;  3GTQ J;  4FE4 A;  4FIS A;  2NVQ J;  3BQZ A;  3FIW A;  4L5E A;  4AYB N;  2DA5 A;  1ETY A;  4RBO A;  3BTJ A;  3BG9 A;  4MIM A;  4D5C A;  3A01 A;  2TCT A;  3QPL A;  1SAN A;  4B4C A;  1MSF C;  1A5J A;  1HDD C;  2B63 J;  1GVD A;  4B3A A;  1FIA A;  2CQX A;  3FIS A;  3HOY J;  2AO9 A;  3G1L A;  3G1M A;  5EDN A;  3GTM J;  1GV2 A;  3C2B A;  2HDD A;  1QVT A;  3FK6 A;  5FLV A;  1MBJ A;  4UUS A;  1ORK A;  4UUS B;  1F36 A;  5F27 A;  2YS9 A;  2HI3 A;  2Y30 A;  1APL C;  3TW6 A;  2JA6 J;  3JR9 A;  2IAI A;  1ZGW A;  1Z77 A;  3HM5 A;  4XID A;  1MBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...