2ECCA

Solution structure of the second homeobox domain of human homeodomain leucine zipper-encoding gene (homez)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
GSSGSSGKRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox and leucine zipper protein Homez
publication title Solution Structure of the second Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eccA00
2M8GX 9ANTA 3ZQLA 1TWFJ 2HDDA 3K2AA 2XGEA 4I6ZA 4IHWA 4C3HJ 2LKXA 1QVUA 3BR0A 4DYCA 1HDDC 1AHDP 3BR2A 3G1OA 1LE8B 3HOXJ 4QSHA 3S2HJ 1RETA 4JX6A 1P7IA 3D1NI 3RQIA 1JTYA 2K9NA 5EF6A 1W0TA 1MSEC 1GT0C 1GVDA 1WCMJ 4MLOA 3DCFA 1BJZA 2L7MP 3JRIA 2GLOA 3GTPJ 4BBSJ 2R5ZA 1T33A 4AUXA 3HOZJ 1IDYA 3H0GJ 3JRDA 1AKHB 1ETQA 2E19A 3HOYJ 3OSFA 2CQXA 4D5FA 1JKQC 5J1UA 3K7AJ 1TWCJ 4UUSA 2DA6A 5IYCJ 4W97A 2LY9A 4FCYA 3GTMJ 1MBJA 1ZKGA 4V2GA 1DU6A 2DTZA 5F1JA 1FIPA 1XC5A 3HM5A 1MBKA 2NVYJ 3ZQFA 4V2FA 3PO3J 5E3LA 3F0CA 1JJ6C 2CU7A 2M9HA 4Y7NJ 1APLC 2IEKA 3S14J 5EGOA 1BA5A 3CMYA 2DJNA 1U78A 3S2DJ 4IHYA 1K83J 4M3BA 3S17J 1ETWA 1XS9A 2JMWA 3IH3A 2JJ7A 4B3AA 2ME0A 2NVQJ 5EZHA 1A5JA 5GP9A 4BXXJ 1ZK8A 2QCOA 2MGQA 3CDLA 2DN0A 1ETXA 2TCTA 3B6AA 2R5YB 2DA1A 3A02A 3LSRA 2G0EA 1YRNA 3S15J 5DTDA 2LFBA 2ZB9A 1FIAA 4A3DJ 3LSGA 4LOCA 4M3FA 2VUMJ 1ZR4A 4A3CJ 2XGCA 2CQQA 2X6OA 1POGA 3PO2J 4AC0A 4A3EJ 5JLXA 4IHXA 4MFDA 5J1YA 3JRBA 4AYBN 4IHVA 1QPIA 2FQ4A 2R0QC 2AHQA 1NTCA 2M0CA 5EG0A 2JA7J 2ID6A 2AO9A 1Q1VA 5F27A 3I4MJ 3O8HA 4JYKA 3G1MA 4XRMA 1VF9A 5FKNA 2KT0A 4C3JJ 3ZQCA 1Y1WJ 4JX4A 2HOTA 4A3BJ 2L7FP 3FKIJ 1X58A 2VPRA 2R5ZB 2DA7A 1JTXA 1XG1A 3BQZA 2O7OA 3M4OJ 1U9OA 3ZQGA 5M5WJ 1RKTA 2RAEA 3O8GA 2FX0A 4MFEA 3W6VA 3TEDA 3HEFA 4FE4A 4UUTA 1JUPA 4UUSB 1MBHA 2DMPA 2Y2ZA 3HGYA 5E3NA 4B4CA 2COBA 4DZPA 4L5EA 3SFIA 5K7FA 3HKZN 1IRZA 1SFOJ 2PMZN 3A03A 2L0KA 5BNGA 1MNMC 2LR8A 1O4XA 5F0HA 3ZQIA 5EGOB 3S1RJ 3RZOJ 2XSDC 1I50J 4M3DA 3OIOA 4MO7A 1WH7A 5F0CA 1JUSA 3VPRA 4D5CA 3BG3A 3JRGA 4HNVA 1HLVA 1X2MA 2JN6A 4M3EA 2OPTA 2DMTA 1E3OC 4CYCA 1IGNA 3JRAA 3RKQA 3IH4A 5J3LA 3LNQA 2MSYA 3JRCA 4RBOA 1ENHA 1JUMA 2DA3A 5GPCA 4XICA 4C2MJ 4D7NA 5IP7J 1TWHJ 1YRNB 3C2BA 2XGDA 2JK3A 1TWAJ 4FISA 4BY1J 1R9TJ 3HOWJ 3WHBA 1W0UA 1GUUA 2XB0X 5J1RA 4J19A 1ZGWA 1FTTA 4S0HB 2H1KA 2Y0SN 3TW6A 2N8GA 1JT0A 2XPUA 2DA5A 5FJ8J 4BKXA 5EG0B 1FJLA 2HQ5A 1B8IA 3SJMA 4QIWN 1UHSA 2WV1A 1BW5A 4W1UA 2DMUA 2XPVA 3BR3A 1MSFC 1TC3C 2E2IJ 2D5VA 3UKGA 1ETVA 4X1EA 1G2HA 1RR7A 4BBRJ 1F43A 1Z0XA 1ORKA 2CUEA 2FJ1A 2NOGA 2DMNA 4X6AJ 5E3MA 3PM1A 3HB9A 1LFBA 1I6HJ 4BY7J 1QRYA 5EEAA 2X48A 3JRHA 1JGGA 2QF7A 2Y9ZA 3IV5A 5M5XJ 2ME6A 1HCRA 4C3IJ 2EZKA 4IEJA 1QVTA 1ZQ3P 2LP0A 2KDZA 1RESA 2DMQA 2EQRA 2CRGA 4XK4A 3NAUA 4XRSA 1IJWC 4EEFG 3GTQJ 2H8RA 1ETYA 5M3FJ 1ITYA 3B6CA 4DW6A 1IDZA 1IC8A 2LLKA 3BTLA 1IG7A 2O8KA 2M34A 4CYCB 1EF4A 4QTRA 2LVSA 2R93J 1OFCX 5HODA 4MIMA 4FTHA 2VKVA 5FKMA 2EH3A 5EYRA 2OF7A 3OOUA 1MBGA 1ETKA 2YS9A 1SANA 5IP9J 1ZTRA 1Y1VJ 1WGXA 4A3KJ 2E2HJ 3GBGA 2XRLA 2Y30A 3TW7A 4DYRA 3S1MJ 5JLWA 4DZJA 4A3FJ 2NS8A 5EZGA 2R7ZJ 3LSJA 1OCPA 1JKPC 3FK7A 3WHCA 5IYBJ 5IYDJ 1JKOC 5IPAA 3S16J 2Y9YA 3I4NJ 2MG4A 1B8IB 2WAQN 1MH3A 1K61A 4JP0A 3QPLA 1DU0A 2NVXJ 3E7LA 2XB5A 2JWTA 2HOSA 2HOAA 3BG9A 1GV2A 2CJJA 2B63J 3GTOJ 3Q0VA 1MBEA 4A3MJ 4A3JJ 5FKKA 5E3OA 4M6VA 4G12A 1OJLA 2P81A 3BTIA 3HOVJ 1U9NA 2I10A 3MN2A 1GDTA 3JR9A 2JA6J 4M3GA 5F0FA 1NK3P 1IUFA 2HI3A 5K7ZA 1T56A 2DA2A 3BR6A 3TP0A 1WPKA 5C4XJ 2ID3A 2K9SA 1UG2A 1FEXA 2LTPA 5IOZA 3LSPA 3A01B 1BL0A 3G1LA 3GTLJ 1LFUP 3BT9A 5K7HA 5C44J 3SDGA 2HXOA 2O9LA 3FIWA 4A3LJ 2CUFA 3L1PA 5DS9A 3CQZJ 3BTCA 1ZR2A 1OCTC 2IBDA 2Y31A 3NARA 1X2NA 3RZDJ 1MH4A 4I76A 3S1QJ 4XIDA 1JJ8C 5F04A 5IP6A 1PUFA 3HDDA 2JA8J 1B72A 4FE7A 2JA5J 1CQTA 2HXIA 3BR5A 3FK6A 5C4JJ 2M2EA 3GTGJ 2VI6A 4A93J 3HBLA 5M5YJ 3BTJA 1GV5A 4GFBA 3ZQHA 1H8AC 2L9RA 2XPWA 2YUSA 2YU9J 1F36A 4A69C 3QQAA 1LE8A 5F08A 2MW8A 4XRSG 4DYQA 3GTJJ 1FTZA 3A01A 3TP3A 1U8BA 2TRTA 2X9DA 2NVTJ 3H3VK 1H88C 2WB1N 2EZIA 3MKLA 3QPSA 1VFCA 1HF0A 4D7MA 5FLVA 1IV6A 3IH2A 1VI0A 1JKRC 1I3QJ 4A3GJ 1A6IA 2K9QA 4NDLA 1AKHA 2FD5A 2EZHA 5FKOA 1WI3A 4RDUA 3BQYA 3BR1A 1H89C 5FKLA 4JX5A 3CCYA 5M3MJ 1D5YA 5IOYA 1JT6A 3M3YJ 2IAIA 5EDNA 3BG5A 1HOMA 1WH5A 1AU7A 1TWGJ 3Q0WA 3S1NJ 1VNDA 3LOCA 3GTKJ 2VKEA 2R92J 3JREA 2NS7A 1UMQA 1BW6A 3Q3SA 1HDPA 4B1RA 1P7JA 3MVPA 1MBFA 4A3IJ 1RKWA 1Z77A 5FLMJ 2ECBA 2E2JJ 3OSGA 1ETOA 2W48A 2R5YA 3JRFA 1RPWA 4ABZA 2LD5A 1NK2P 4Y52J 2DA4A 2L7ZA 2GM4A 2HYJA 2K40A 2LK2A 1PUFB 2E1OA 3FISA 1B72B 2ELKA 3HOUJ 3Q0UA 3HGGA 3ZOBA 2ECCA 2EBIA 5C3EJ 2EZLA 2GBYA 3DEWA 5GPAA 1S7EA
chains in the Genus database with same CATH superfamily
3QOPA 1TWFJ 3QU6A 4IVNA 2HGCA 1YHQI 2HDDA 3P7NA 1H9TA 2XGEA 4I6ZA 5ILUA 4G6DA 3W6JB 1AHDP 2MBFA 2DW4A 5F6FA 2D45A 4XR6A 4KFCA 2VOOA 4KIGA 4P9UA 4AIDA 2F5EA 3S2HJ 1KA8A 2K86A 4JQFA 4C9YA 3HRUA 4ZH4F 3CESA 3H5NA 1W0TA 1YITI 1EH7A 1ON1A 3GFLA 2L4AA 1V54H 1WCMJ 2K4JA 4RGSA 2L7MP 4BBSJ 3QP5A 1QGPA 3GFJA 5DEQA 4S05A 3DBHB 4D0PA 1AKHB 3ASOH 1ETQA 4WWCA 2IS2A 4L9JA 4D5FA 4M6XA 1XMAA 3CCRI 1O3TA 1TTYA 4UUSA 3ZMVA 3KP6A 2EINH 3QU3A 3GTMJ 4HYEA 1ZKGA 3OR1C 2X1CA 4V2GA 1UELB 3ZQFA 1MBKA 2NVYJ 2D1HA 5IT9Z 1IRGA 4HV5A 1YJWI 3WTWC 1JJ6C 1APLC 3CMYA 2DJNA 3S2DJ 1FLIA 2GAUA 4M3BA 2M3AA 2WB1A 5DV5A 2BY3A 1XD7A 2HU9A 1ETWA 4UVBA 5D5WB 5HS8A 3ML6A 1EA3A 3IH3A 2JJ7A 2PJRA 1VQ4I 2GIZA 3W2WA 2L9NA 1IZ1A 1IXSB 2JUGA 5EZHA 5GP9A 1LDDA 4HRIA 3CDLA 4XORA 2NOJB 2TCTA 3J7ZI 3RKXA 4YFNF 2HQNA 4UHTA 2DK8A 1W1WE 1YRNA 5DTDA 1GLNA 3CTAA 5KAFC 1O57A 4M9SA 4UV8A 3U2RA 2XGCA 1UAAA 3PO2J 2OD5A 2G9WA 4I02A 2W24A 4QPOA 2FBKA 5B1BH 3K4NA 3LSTA 2FQ4A 2B0LA 2AHQA 1T38A 1IXRC 2M0CA 3D5RC 4QPQA 2GXBA 5IT9K 3R0JA 2ID6A 3AG1H 3I4MJ 3DTIA 1MMSA 2OZ6A 3VYRB 5HNHA 2IW5A 4G7OF 2IGMA 4LFUA 2YSRA 4C3JJ 3I56I 3AFHA 4M73A 4EQQA 2HOTA 4OAYA 4EJTA 4A3BJ 1OYWA 2RC4A 2UUZA 2P8TA 2VPRA 5DCMA 3ULQB 4XLCA 1U9OA 3LSKA 3DBLB 2OBPA 1STZA 1UG0A 2Z33A 3BZCA 2IS1A 1DPRA 3L00A 1RKTA 1BR2A 5LHGA 4UUTA 3G4SI 1JUPA 4EJUA 3S3OA 5LD2C 3L9FA 5E3NA 3V8LA 2QUFA 2PMUA 2NAZA 1R22A 1XDUA 3A03A 4G94A 1MNMC 2LR8A 2Q0OA 3RZOJ 3K4MA 1W5CC 2G7HA 2XSDC 4HF0A 2P6TA 1ZELA 1G3SA 3A1YA 1JUSA 3VPRA 3BG3A 1EKEA 3BP8A 4YEJA 1X2MA 2JN6A 4M3EA 5E8GA 3WODF 2QM3A 2Z2SB 2ADUA 3JRAA 3RKQA 3GMEA 2CMPA 2DPDA 3QPTA 4ENJA 4AM3A 1FBQA 2K9MA 4ZC3A 2RNGA 4EVIA 1BC7C 2DA3A 1UFMA 3F8BA 2BW3A 4XICA 4C2MJ 3LFKA 3H9JA 3ZMTA 5IP7J 1A31A 2LOOA 3IRQA 2XGDA 2IA1A 1OYYA 4U0WA 5F64A 3RQ4A 2BE5F 4CDGA 2VASA 3CCEI 3F23A 2H8WA 2V79A 3KP5A 5TGTA 3E6MA 3REOA 3HOWJ 3F8FA 1GUUA 1RZ4A 4LLGF 3CO7C 3V7CA 1RNLA 2BZTA 4S0HB 1Z21A 2H1KA 2F48A 2VBZA 4YIRX 1TBXA 4X0GA 2X1DA 5EG0B 2IA0A 2DT6A 5GTIC 1LNWA 4R79A 1BW5A 4XONA 2XPVA 2JTVA 4CHUA 4HX7A 1K79A 1X1BA 3WU2C 2E2IJ 1EH8A 4HF2A 4PGGA 2X1EA 2HYGD 3UKGA 2Z5UA 2HZDA 4RM2A 1ETVA 3GXOA 2QKLB 5J4YA 3OIPA 3H1CA 1D0XA 3ISPA 1F43A 4WXHA 1FPQA 3OYIA 1VZ0A 4ZZLA 1D8JA 2NOGA 2A68F 2GQQA 2YX7A 1FMWA 2KQRA 1OCZH 3VWBA 2Y75A 3KLOA 1LFBA 1I6HJ 2I8DA 3Q9VA 4ZJZA 1U0JA 4IX7A 1R7JA 3CLOA 2X48A 4IOCF 4FX4A 1G3TA 3KP4A 3KEQA 2VN2A 1Q1HA 2QGUA 5GADJ 2Y9ZA 5E1WA 3IV5A 1LJ9A 1IN8A 4HX4A 2V9PA 3OYFA 5J8FA 1ZQ3P 2LP0A 1ZN2A 1RESA 2E60A 2MYSA 1MMGA 4GYIA 4XRSA 1FY7A 2F5FA 1I6XA 3HHHA 1ZRFA 4L0YB 4DW6A 1IDZA 4BACA 1IC8A 2LLKA 3HC7A 3OIQA 3ASNH 2WBMA 3BJOA 4OINF 4A0YA 3CCJI 2DOAA 3FM3A 3VSKA 1WJFA 2KIUA 2CV1A 4IHSA 2X0LA 1MDMA 2M4GA 2EH3A 5EYRA 5HLHA 3L2VA 2OF7A 1Y56A 3OOUA 3SYTA 3EYYA 1T8IA 4N4NB 3HKZA 2VC0A 2DO7A 2ZMEA 5IP9J 1Y1VJ 2HVRA 3S1MJ 4A3FJ 5EZGA 1X1AA 4AD9A 2KLOA 4XKCA 3WHCA 5IYDJ 3HTSB 1IF1A 5IPAA 2E36A 4CSWA 2IVMA 3RKWA 3LSHA 1HW1A 1B8IB 2WAQN 4KISA 3H9QA 4CICA 3TO6A 3M1CA 1MH3A 4JP0A 4KMUX 3QPLA 3PUFA 4GGGA 2NVXJ 2VOPA 3E7LA 2CQKA 2XB5A 4Z6YA 2XC7A 1SFKA 2HOAA 1LKXA 3IAS2 1GV2A 2DDBA 4I09A 3OYHA 2O8XA 3T0YA 2HFHA 3VYTB 3B02A 3HHGA 4A3MJ 2KRFA 1L0OC 4G12A 3BTIA 1U9NA 4B48A 4PSXA 4GXOA 1RUNA 3TDUC 4RB2C 2KZGA 4L9VA 1QBJA 1T56A 2DA2A 3BR6A 4YRVA 3MQ0A 3TP0A 1HSTA 2KJBA 1WPKA 1JE8A 2L5QA 4Y33A 1VQKI 4B47A 5HLTA 2BYVE 1UG2A 1FEXA 1ONVA 2LTPA 4Y4RA 3FX3A 5IOZA 3LSPA 4LB5A 1T95A 4RLFA 1X1PA 4O5VA 2JPCA 1BL0A 3MCZA 3PSIA 2FSWA 4C2UA 1DDNA 3I71A 3C2GA 4BE1A 1LFUP 1I27A 4G9YA 2PEXA 1Z05A 2HYFA 2HXOA 4ANJA 3CUQB 5HDKA 2R7UA 4NBQA 3HUGA 4ON0A 1DQUA 2HZTA 1O3RA 3CQZJ 1V5GA 2CFOA 1OCTC 3DEUA 4R8HA 3T1BA 1X2NA 3E5XA 4XIDA 4RAFA 4PJMA 3HDDA 2JA8J 1B72A 3EUKL 1OYIA 3C1DA 3HOSA 3QRFF 5BOXA 2DCEA 4HNUA 2WA0A 2IS6A 2H94A 3HSEA 3GTGJ 1G3YA 1RI7A 1BI1A 1FOXA 5F1RA 1ZRCA 1DGRM 3EUHC 1SD5A 3TBIA 1OR7C 2V1DA 2K3FA 2X6XA 4FQGA 4XNFA 2OTJI 2UV1A 1LE8A 3SFZA 5F08A 2ZJRF 2MW8A 3RCOA 5FLXZ 3O3KA 4DYQA 3ZPLA 2HVSA 4DIQA 1TP4A 1U8BA 1IRFA 4UVCA 5GAHJ 1A6QA 3KYCB 2XAUA 2X85A 1Y8RB 1IV6A 1JKRC 4UB8C 2F6CA 2JSPA 4M9ZA 2IGKA 5DD4A 4U88A 5EJCA 3LQQA 2ZNYA 2K9QA 2FD5A 1WJAA 5FD5A 5L3DA 4ZYDA 4IO9F 1NH3A 3MEXA 4BXUA 3I9V2 5FKLA 1ZLKA 4JX5A 1K6YA 1AOYA 2ELHA 5HLIA 1JT6A 3M3YJ 1PYVA 4RM3A 1KQ0A 2IAIA 3JSPA 2CUJA 1G3WA 4LIUA 4I0AA 2MLGA 4NQWA 5GAGJ 1AU7A 3FXKA 1OPCA 3LOCA 1UB9A 2F5CA 2HWVA 2GXGA 3KZYA 4GO1A 2K85A 3SHFA 1MJ9A 3DEEA 2FNAA 3WTVC 4B1RA 1P7JA 2VT3A 4CZCA 2KJCA 1HW5A 2A05A 1Z77A 2XVCA 2ZXWH 4CH7A 2LRDA 2ZJQF 1RPWA 3HSRA 1YTYA 2BXZA 3LAJA 3ZCOA 5H20A 1PUFB 2GM4A 4UY8I 1W36D 4OMYA 5H6QA 2DTRA 1JI8A 4U0VA 2Y0MA 3K6GA 3SEQA 3AKZA 2DFEA 5C3EJ 3T5XA 2Z3YA 3DEWA 1ZYRF 1S7EA 5GPAA 5HNFA 1WJEA 9ANTA 4PUSA 4HLYA 4YIFA 3ZQLA 2EIMH 2RNJA 4KT6A 5K1YA 1U8RA 1G8XA 3K2AA 1T98A 4C3HJ 3BR0A 3BR2A 2K9LA 4M71A 2XF6A 2C6YA 4HF1A 3IHUA 4Y15A 4IPAA 3TQNA 1RETA 1DP7P 3LQRA 4B44A 3RQIA 1JTYA 2BV6A 3K10A 2F4MB 4IL6C 5EF6A 4MLOA 3DCFA 2GA2A 3V7SA 2R7SA 4U0YA 2IRFG 4AUXA 1Z7UA 4DGWB 4CCLA 3H0GJ 4XLAA 2MABA 3JRDA 2E19A 1T39A 2OTLI 2CO5A 1MD0A 4EV0A 2D1VA 3TOBA 2XV4S 3SZPA 1MBJA 1VQ7I 4KIBA 3I59A 1DU6A 3DLAA 5IT3A 1XC5A 3BOQA 4V2FA 1BM9A 5E3LA 3F0CA 4MTDA 4HQMA 5ICFA 4Y7NJ 3S14J 2IEKA 1S72I 1J75A 2XHKA 1U78A 1K83J 2DODA 3H3UA 2PBIA 3DWLE 1K6OA 3CF2A 2A6TA 1N25A 4BQNA 2ME0A 2NVQJ 3I58A 2QA4I 1KU9A 3KZZA 4IRGA 1A5JA 2HTSA 1W7PA 2QCOA 2QYOA 5FRMA 5K5QA 2M8EA 3B6AA 3J7AY 4JBAA 3KCCA 3A02A 2G0EA 2XGXA 3EUHA 2ZB9A 1BJAA 2FEZA 3ECHA 1X3WB 4A3DJ 1OR7A 1IV8A 2AXTC 3FXMA 2X6OA 4E7SA 1POGA 1VQNI 2FNPA 1OQYA 2RREA 1LB2A 4HOBA 5LBQA 2R3SA 2ISZA 1FBUA 1E17A 1WHUA 3EPZA 2OA4A 2QZ8A 3BG6A 4IHVA 3WGHA 4MEXF 1RC9A 1NTCA 2KHMA 2BVMA 5LFAA 2IJLA 4LG0A 2Y69H 3U21A 3WG9A 1XSDA 1Z3XA 5CLSA 2MC3A 2RKHA 4B3XA 3G1MA 4XRMA 3N97A 1XPXA 1SC7A 4EM1A 4YG2F 5FKNA 3OS1A 3CO6C 3ZQCA 2JPBA 4JX4A 3ELKA 1DP3A 3V4GA 3G3ZA 4IF4A 3JSOA 4BJ5C 4XLNF 2XDVA 2R5ZB 1JTXA 3A0BC 3BQZA 3K2ZA 1TNSA 3M4OJ 3TL4X 1X1DA 3GVAA 1J7KA 1S6LA 1ODDA 2HOEA 1R1VA 1E2XA 3E5UA 5D5UB 4CCKA 3JTGA 3KIOA 2RAEA 4MFEA 5L3EA 4BDZA 4E7IA 3TEDA 4FE4A 4ESFA 1CF7B 1W36C 5J6XA 5DM6F 2EPFA 5HS9A 3B73A 3WGIA 1EH6A 1JXSA 2DMPA 1X3ZB 1IN6A 3DTKA 3QWLA 4A12A 2BHZA 2OV7A 4BJ6C 2FE3A 1R5ID 3SFIA 5K7FA 4U7DA 4HDUA 2CQNA 3BJ6A 3DKYA 2HDCA 2LBFA 3PL8A 4ZDOA 3KX2A 4CO8A 3GZ5A 5F0HA 1O4XA 4MTEA 3ZQIA 5EGOB 2EIKH 2PJPA 2O0YA 4L9TA 2L02A 2O6GE 2ESNA 5F0CA 4RB1A 2XAHA 4HNVA 1U3EM 5CVJA 2OCCH 4CYCA 1SVMA 1N78A 1N77A 2K3PA 1LDKB 3IH4A 5E8IA 3MKZA 2UZKA 2MSYA 4RBOA 3PNYA 1ENHA 4D7NA 3FXUA 1O3SA 1TWHJ 4XSXF 3C18A 1FP1D 3AAFA 2STTA 2EFPA 4BY1J 2PG4A 4CUGA 1P92A 1W0UA 3PJRA 2VKHA 4OIQF 1XB4A 4BEHB 3AG2H 2HNHA 4Q5SF 1MKMA 4J19A 1ZGWA 2ZJPF 2OC6A 2XPUA 2DA5A 4LB6B 3P9KA 1Z67A 3SJMA 3KP2A 4ENMA 2EJRA 2KP6A 4QIWN 3I64A 2VE9A 1BIBA 1QA6A 1MSFC 1TW2A 2D5VA 1IAWA 1YOVB 3RJPA 1XGOA 1YLFA 1P9QC 2J5PA 1RR7A 1G2HA 2RGVA 3W2VA 1MDMB 2CUEA 3M8FA 2EFNA 3RSNA 5E3MA 3FXJA 3R4KA 2WY8Q 1YG2A 4KUMA 1KYWA 1R5GA 3M7GA 1HKTA 3HRMA 5D5XB 2Z9OA 2ZFUA 3WTUC 2E34A 3JTHA 2QF7A 2W85A 2HVQA 5B3SH 2XAQA 3I0TA 2EZKA 2ZMEC 4IEJA 2KDZA 2EQRA 2DMQA 3M1EA 3NAUA 3ABLH 4F92B 1IJWC 1D1CA 2GIVA 3VSLA 2H8RA 5M3FJ 1VQMI 2DPUA 3B6CA 3GUDA 3GWZA 4RAYA 4XKBA 1IG7A 1YS7A 4IQ4A 3G73A 2V7FA 3AL0B 4QTRA 4II2A 3S93A 4AU7A 2QBYA 1EV7A 2CUZA 4KN7X 5CVUA 1I5ZA 3F6VA 3VYSB 5FRNA 3PQKA 5HODA 1FYLA 3TO7A 4PJ0C 1ULYA 4N9IA 5FKMA 2KIQA 2XRNA 2BOLA 1HW2A 2Q2EB 1BI2A 1MBGA 3G6EI 1SANA 2E5NA 3LAPA 3MZHA 3PNTA 3L2QA 1WGXA 3GBGA 2F4OB 2XRLA 2LY1A 2VBYA 5JLWA 3GFIA 3IP4B 4OMZA 2WAEA 2ZSHB 1YX5A 1PP8F 3FK7A 1WSUA 4C30A 5IYBJ 4BH9A 1JKOC 3FXOA 3GF2A 1U6GA 3OYLA 4M6YA 4HDVA 1V3FA 2DQRA 3CCVI 5GTHC 1HXDA 1O7LA 2DYSH 4QWQA 2A61A 1U5TC 2HOSA 1NG7A 5E17F 3BG9A 1TZLA 5FD6A 3P9CA 1QZZA 1FT9A 3GTOJ 3CCUI 4OIOF 2E71A 2CQ7A 5FKKA 4M6VA 1OJLA 4HNTA 3OV8A 4XKVA 4E6KG 1HA8A 5F0FA 3PIPF 4L18B 2MH9A 2DI3A 2LC2A 5C4XJ 4I01A 2V1NA 3CD6I 2K9SA 4XLEA 3PUBA 1FSEA 4KITB 3R60A 2M87A 1R4NB 4GCVA 1I3AA 4CGZA 3P5JA 4KA4A 1T6SA 1RIOH 2VJIA 3BT9A 3S2WA 4BHBA 4ZYGA 5K7HA 4A6EA 2O9LA 3E6DA 2CUFA 3WGGA 1J5YA 3HPHA 2O03A 4Q48A 4ZZDA 4WX9A 2IT0A 1IW7F 3NARA 2VT2A 5DYMA 1Z7LA 2KMUA 4I76A 3S1QJ 1DPUA 1JJ8C 2KRHA 5ERIA 4BS9A 1CQTA 1YS6A 1XX5A 5KNLA 3A4CA 4YFXF 1SVOA 1HKSA 4A93J 2DLLA 2V6EA 1Z3YA 2EB7A 3BTJA 1GV5A 1OCOH 1VQ8I 4GFBA 5D5VB 2IS4A 1XSXA 3ZQHA 1H8AC 2L2OA 2LREA 3PIOF 1LEBA 4XKWA 1VQ6I 2XPWA 1RR8C 4NC6A 2VQLA 5HS7A 1BR4A 3WG7H 2H6BA 1KONA 3BPVA 3VDXA 4RLQA 3GTJJ 2WWYA 4FT8A 3I4PA 2WAFA 4RB3C 2PX9A 5AONA 4S04A 1IXCA 3PSFA 1H88C 1YW7A 3BZKA 1FYKA 2PI0A 2VJ5A 4BE0A 1KGSA 3OYCA 5FLVA 4A3GJ 1A6IA 4LMYA 3KP3A 1AKHA 3OYKA 1MGTA 1TQMA 3L2UA 3BQYA 1H89C 2W1OA 3A0HC 1FP2A 4F93B 1XCBA 3UNGC 1D5YA 3L2WA 4KMFA 4DBRA 2LKSA 2KZVA 1WJBA 5EDNA 2H6CA 5LHHA 4XN3A 1ERDA 2EILH 4WXCA 2VBWA 2CW8A 2WAQA 2Q1ZB 3RIRA 3E3VA 3S1NJ 1VNDA 3ROUA 4ETSA 3GTKJ 4NNJA 1F9NA 1F5TA 1UMQA 2B9SA 4IZZA 2FOWA 1MBFA 4DOZA 4I7HA 4ZYEA 1RKWA 1ZHFA 2L3DA 1J09A 2ECBA 2X6WA 2ZNZA 3T8RA 4Y52J 1BI0A 3ZR8X 1P4XA 2BXYA 2HYJA 2EWNA 2LK2A 3NWTA 4P9FA 4RB0A 1QZEA 1S7OA 4CZZA 6PAXA 2BHYA 2ELKA 2MLKA 2QSFX 1SD7A 2GWRA 3Q0UA 3PFYA 2HPIA 5CJ9A 2OQRA 2JUCA 2PQ8A 2W82A 1R58A 3WE3A 5JHFA 3CJNA 2A5YB 5L3BA 2DFFA 3HOTA 1SFUA 4IHWA 3L7WA 3X2QH 1S3JA 3FXRA 4E7ZA 1QVUA 2LKXA 1HDDC 1Z6TA 3FDYA 1MZBA 3H5RA 5J47A 3PQJA 1TL8A 3P9IA 3HOXJ 2CWEA 2QKMB 3AG4H 2O61A 1U5TA 4UXNA 1I1SA 4JX6A 2CFXA 2R7OA 3VOEA 1ZAOA 3IC7A 2A6EF 1MSEC 1O7FA 4JK1X 1QHGA 2ZSIB 2NVUB 1GVDA 4CXFA 4XBFA 3L2RA 2QSGX 5E18F 1PUEE 1HSJA 1T33A 2VKDA 2JZYA 1MMNA 4NUBA 2MC4A 3HXLA 4BQOA 4BGDA 3RPUD 4BUPA 2CQXA 1JKQC 3U9GA 5J1UA 1TWCJ 2DA6A 5H2FC 2EFQA 2LY9A 5IYCJ 3HG9A 3OYGA 1XGNA 3RKYA 1K78B 2MA3A 1VQLI 2DTZA 3FKJA 5F1JA 1QNTA 1FIPA 3DTEA 4CCNA 1D1AA 5LGTA 4HAMA 1J59A 2M9HA 5FB2A 1YX3A 4B43A 1J2XA 2I5UA 1LQ1A 3OYMA 4IHYA 1S7AA 3GX4X 1XMXA 1XGSA 1R23A 4AWXB 3S17J 4L5JA 3TGNA 1XS9A 2JMWA 2K5CA 1KQ9A 4B3AA 2PN6A 2AS5F 4L0ZB 2OQGA 3TKYA 3DU6A 5FO5A 4BXXJ 4WF2A 3ESWB 3CUQC 5D8LB 5AIQA 4IHTA 2MGQA 2DN0A 4HG2A 4U7BA 1ETXA 1X4OA 2VQGA 1UZCA 2R5YB 1YO5C 2WV0A 2DFHA 2LFBA 4EGZA 1FIAA 2W84A 4LOCA 5FGMA 4A3CJ 1GVJA 2VL8A 3FXLA 2CQQA 2RQQA 2XF5A 1NHAA 3DP7A 3S3MA 5ICEA 1GXPA 2IA2A 4AC0A 4G7ZF 3K70D 1TT5B 5BQTA 4A3EJ 2A3SA 3WTZA 4MFDA 1FYMA 4MEYF 4AYBN 3MKYB 1I1GA 3E6BA 1R49A 3IKVA 2R0QC 2FXAA 1QPIA 5EG0A 5JI6A 1X1CA 1WJDA 2JA7J 2PFBA 3HTUA 2RQPA 1R71A 1Q1VA 1MIJA 2XKOA 3O8HA 2XF7A 4XLFA 4Q47A 3K69A 2A69F 3ZMSA 3SDBA 1SMTA 4G7HF 2DBBA 5LRRA 4Y13A 2KT0A 2FBHA 4EM0B 1XDSA 2G7UA 3C3WA 1YJNI 4A6DA 5FLXK 3OL4A 3OL3A 1DUXC 4O6JA 3ZN1A 2DA7A 2L9SA 1A36A 2R7DA 4LITA 1TQIA 4O3MA 3LA2A 3O8GA 4BQQA 3W6VA 3DKXA 2P5KA 1V55H 2XSJC 3CMAI 3FBIB 4GRIA 2VLAA 2DDAA 4UUSB 5BMZA 3IWFA 1MBHA 2Y2ZA 1ON2A 4B4CA 2WTEA 5LEKA 2COBA 2GXAA 4L5EA 1FMVA 3FBNB 4PCQA 1LPQA 2PMZN 5DM7F 1ZG3A 4MNUA 2L0KA 1SFXA 5BNGA 3MFKA 3J81Z 3DLLF 2R7XA 1WZ2A 3F8NA 4ZYHA 1UCRA 4HPQA 2L7KA 1I50J 4M3DA 3JAMZ 3FZVA 4D5CA 2JRMA 5JHUA 3JRGA 1FNNA 2ICWG 3H3ZA 2OU2A 2R7RA 4KDPA 2PJRB 2H09A 2DMTA 2OPTA 1SEUA 1E3OC 4J01A 2ESHA 5ICGA 4BHPA 1PVEA 1IGNA 4PZJA 3RI4A 3RPQA 3HZJA 3LNQA 3QODA 4A0XA 3BJAA 4BE2A 3HYIA 5GPCA 4DNCA 2M1BA 3E97A 3OS0A 2WY7Q 2LY2A 4M9XA 3OYEA 1YRNB 4XLPF 4BU2A 3IKTA 3C2BA 2JK3A 4LIVA 3GYHX 1B59A 1B6AA 1S29A 3BY6A 3DF8A 2J5OA 1R9TJ 2M30A 4NC8A 2HTJA 1OCRH 3ABKH 2XB0X 4IRHA 2L01A 3K4LA 5BS6A 5J1RA 4DBQA 2LDUA 1FTTA 1JGSA 3MKWB 2Y0SN 3TW6A 4BQAA 2N8GA 3FMSA 1B8IA 3HRSA 5AIPA 4RGXA 3ABTA 3J81K 3D5LA 3VYUB 1UHSA 3BPXA 2WV1A 4IXAA 1FSHA 4W1UA 1SFEA 2DMUA 1QHHD 1OISA 3F72A 1BI3A 4OOIA 2R7WA 2WC2A 3WTSC 3JAMK 2P0WA 1KYZA 3N4MA 5DUKA 2YU3A 2BBYA 2LG4A 4BBRJ 4I2OA 2P7CB 3GCMA 1Z0XA 4XLHA 5DCMB 1ORKA 4ASNA 4AIKA 2FJ1A 3CCMI 4H4KC 1QPMA 5KAIC 2DMNA 2R7VA 1KQ8A 3PNVA 2W25A 3QOEA 2E1MB 3HB9A 3CMMA 1FOWA 2BY0A 1QRYA 5EEHA 3CCLI 4HSTA 3K0LA 4PFPA 2WADA 1WVRA 3OYJA 1XGMA 2M5WA 5CQEA 1JGGA 1EJ9A 5CYVA 1TW3A 3LMMA 4UB6C 5H6RA 4B8XA 5M5XJ 4G6QA 5E20A 2EV6A 1QVTA 4CCOA 1KU2A 3SZTA 2VB6A 4AVZA 2CRGA 3FMQA 2MH2A 3CUQA 4EEFG 3GTQJ 4EJOA 3IAM2 4ESJA 5BPIA 2P7VB 4IQJA 3WTYC 4EGYA 2O8KA 2M34A 5KHDA 3ECOA 2LVSA 3M8EA 1Z9CA 4F91B 1D5VA 3CJQB 2NRAC 2VKVA 2BW3B 2X4HA 4Q4ZF 1YJ9I 1T0FC 1QO0D 3O2PE 2ZBKA 1J9IA 2RDPA 2EV0A 2YS9A 3AG3H 3BWGA 3COAC 4A3KJ 3C2HA 3KFWX 4RMNA 3FHNA 4ITVA 2LKPA 2FA5A 2V4JC 2VQHA 1KZHA 2Y30A 1HBXG 3F8MA 4G8XA 4DZJA 4HQEA 2R7ZJ 2FF4A 1OCPA 3K4JA 3LSJA 2GOMA 1V5EA 1M1EB 3F6OA 3CJTB 1MNDA 1YQAA 2CG4A 3GW2A 5FFZA 1WRJA 2Y9YA 4IJAA 5ILVA 2MG4A 3K1MA 1K61A 2E35A 1DU0A 3D5SC 2BY1A 4KNYA 3D0SA 2VQCA 2OUMA 2JWTA 5DUIA 2JVGA 5D8KB 4BL0B 4P96A 2DJIA 1FOYA 4ZTFA 4NHJA 5ILSA 1MNEA 3WTTC 5D6FA 2LNBA 4A3JJ 5E3OA 2QWWA 2P81A 1OLTA 2FBIA 5CVVA 1F4KA 2I10A 2FMYA 3TO9A 2JA6J 3HOVJ 2Z99A 1Z91A 3L2CA 1NK3P 1IUFA 1BR1A 5K7ZA 2YR2A 5D6EA 1FOKA 2VE8A 3MZYA 2Q8KA 1LVKA 2NNYA 3CCQI 2QQ9A 1IN5A 4TV7A 4E7KA 1USSA 2GA1A 2VIXA 2HDWA 3HL2A 1OKRA 2AQEA 3BCBA 2CW7A 5GAEJ 1D0ZA 2L54A 3I54A 1YIJI 2STWA 1YI2I 1PP7U 3GTLJ 2FOKA 4NB5A 3SDGA 1TQPA 2CH0A 2NYXA 1WWXA 4PSWA 2OAZA 1MJAA 2Y31A 1AA7A 2XIGA 1SD6A 3BC8A 5K5OA 2OCEA 3VEPA 5JVTA 5F04A 5IP6A 1PUFA 2ACJA 3FXQA 2JA5J 3RPUA 3CDIA 5TJJA 3BR5A 1YYVA 1B9MA 2AQFA 3ZGKA 1I39A 2M2EA 5C4JJ 1HQCA 3RDIA 4ZTJA 3HBLA 4HLXA 4UVAA 5TISC 3WU0A 3Q5FA 5LHIA 3F22A 2ZMEB 3ZMDA 1A04A 2YUSA 1F36A 2CW0F 3CP2A 4A69C 4PDKA 2EK5A 3QQAA 1MW7A 3ZP5A 3ZMUA 2VXZA 4HV6A 2IGOA 3LA3A 3OYDA 4IKFA 3G2BA 4XRSG 2XAFA 2F4IA 1FTZA 1D3YA 3OR2C 3A01A 3TP3A 4I98B 2TRTA 2X9DA 3H3VK 2PMHA 2WB1N 3H5AA 4DQ2A 2YX4A 3MKLA 3QPSA 4XOPA 1HF0A 4ZDLA 2KPMA 1S8NA 4D7MA 3IL2A 4PJJA 1V4RA 1VI0A 3IH2A 4RA2A 3SQNA 1XN7A 3QP6A 3OYAA 4WCGA 1O3QA 4M72A 3QYFA 4ENNA 4WXDA 4Y3OA 1XTAA 1WI3A 2EV5A 3F8CA 2EFOA 3BR1A 1FWZA 1TNTA 5JR3A 4DJAA 5M3MJ 2ZJ2A 3W6KB 2FMLA 1K4SA 1FX7A 5HLGA 4GDFA 1LDJA 1UHWA 2VJ4A 2ZXJA 3U1KA 1A35A 3HRTA 1HOMA 2ZFWA 1W5TA 3KYDB 2DAOA 1WH5A 2B7EA 2P5VA 2NS0A 3JW4A 5JFRA 1VQ5I 1TWGJ 4IRIA 5LEJA 5L3GA 1U5TB 1RUOA 3T8TA 2HS5A 4HSRA 1S9HA 2VKEA 4GYGA 3NEUA 5CPRB 2R92J 1Y0NA 2E7XA 3JREA 1B1BA 1BW6A 3F3XA 3R61A 4P1WA 2KIMA 2CV0A 2R7FA 2QVOA 5D4SA 1TLHB 3MVPA 4F3QA 4A3IJ 3HUGB 2E2JJ 2ZXHA 3HPGA 1ETOA 2W48A 3CZ6A 4FX0A 3DU5A 5BPDA 2HPMA 1XSVA 3K4KA 4LGWA 1T0FA 3CCSI 3AL0C 2DA4A 4P55A 5LRSA 1YW9A 2E1OA 3FISA 1B72B 2O5RA 3HOUJ 3HGGA 4N0BA 2ECCA 2EBIA 1T2KA 1DGWY 1BOAA 4L9NA 2EZLA 2CSOA 2H1LA 2YPRA 3OSGA 2OZUA 2M8GX 2M7AA 2LYCA 2LH9A 2QQBA 3MD2A 2ISYA 4LD5A 2XUBA 2M7BA 2DT7B 4DYCA 3N05A 3PFIA 3G1OA 3S3NA 1G59A 1LE8B 2VONA 3DKWA 1P2FA 3E0JB 3QPHA 3CF5F 4QSHA 3TDZC 5LLQA 3GEZA 3DPTA 1ZARA 3J80Z 1P7IA 2QQAA 3BG7A 5CVIA 3D1NI 2K9NA 1MJBA 1GT0C 3ZMZA 1BJZA 3JRIA 2GLOA 2CYYA 3GTPJ 3WU1B 2R5ZA 1KU3A 3HOZJ 1IDYA 2KKOA 3I3LA 3CC2I 1BIAA 4HA8A 3I5UA 4QLCU 1VQ9I 3HOYJ 2A5WA 2KRCA 3OSFA 1BC8C 3V7RA 3DQVC 3VFZA 4LLLA 1CF7A 1ZREA 3K7AJ 3F9KA 4E70A 4W97A 4Z2YA 4AVPA 4FCYA 4R1HA 3BDDA 1IO2A 2ZO4A 4CCMA 3QAHA 2VODA 1MMDA 3KP7A 1ZRDA 3HM5A 3PO3J 2UXNA 2KIFA 3E1SA 2ELJA 5HDNA 2CU7A 5J40A 3BLYA 2NNNA 3FF5A 4RAZA 1N75A 1LUJB 2M4KA 3SEZA 5EGOA 4D9JA 1BA5A 1R4MB 4NQWB 2E1CA 3V8KA 3U1DA 3HSFA 5LGUA 2A6HF 3TOAA 1C0WA 4EJWA 3ERMA 2CV2A 3CC7I 3H35A 4G6TB 4A0ZA 1Y0UA 1W7PD 5DDGA 3LA7A 1J0RA 5HDGA 3J80K 1ZK8A 3QYEA 4XMYA 3Q9SA 3MWMA 3HJEA 3SXYA 1W5SA 2RV8A 1E3HA 2HQAA 4AIJA 2UWMA 2DA1A 4I99C 5L3CA 3LSRA 1QU3A 3S15J 1B9NA 1OCCH 2V6CA 3DXJF 3CUOA 3LSGA 4M3FA 2VUMJ 3V8JA 1ZR4A 1SAUA 4BAYA 5JVGF 3M8JA 2BEOA 4IOAF 1AWCA 5E79C 5D4RA 5JLXA 4BEHA 4E4HA 4IHXA 1WJ5A 2X51A 4P5OA 2XROA 5J1YA 2O3FA 3KETA 3FM5A 2EA2A 3IRRA 3JRBA 2FUG2 2LF8A 4LG3A 3KEOA 3CC4I 2DQLA 3DPLC 3A2KA 3S8PA 2DK5A 4N4OB 2AO9A 4M74A 5F27A 3DV8A 4LLNA 2E1NA 4EM2A 4JYKA 3CP8A 3V42A 4OIRF 1PDNC 1V5FA 1VF9A 2LF7A 1ZG1A 3E6CC 1P4WA 3CDHA 1LVAA 3K4BA 4EMSA 1Y1WJ 1ZGAA 4NC7A 2ZKZA 2L7FP 2W57A 3FKIJ 1R5HA 1IN7A 1X58A 4HEA2 5FROA 2MD0A 1IN4A 4FHTA 3K9TA 1XG1A 4XN0A 1Y6IA 5EEGA 2M0MA 2GZWA 2O7OA 2F5DA 1HKQA 3K1NA 2VBXA 4KIFA 3ZQGA 5M5WJ 1P4AA 1K4TA 2FX0A 3DFGA 1L3LA 3HEFA 4B09A 4EATA 1WFXA 4CCJA 3HGYA 2FQ3A 4E7HA 3I59B 4DZPA 3I53A 3HKZN 3J7AO 1IRZA 1SFOJ 3J7YJ 2W00A 1SMYF 2XAGA 3GLLA 1FZPB 4PJNA 4YFKF 4PK4A 3S1RJ 1ZGJA 2K7LA 1VTNC 4HBLA 4MHGA 5B1AH 1NG6A 3C7JA 2LSOA 4KT5C 3OIOA 4MO7A 1Y8QB 1WH7A 1WQ2A 4OIPF 3MZ8A 1HLVA 2ZC2A 1FC3A 1WJCA 5J3LA 3K4CA 1W7PB 4JOMA 4UV9A 3JRCA 5CQGA 1JUMA 2DFIA 2FRHA 3ZXSA 2Q2EA 2R7TA 5LGNA 1SAXA 3GO5A 4LJZF 1TWAJ 1YIOA 3FWEA 4KICA 4OU0A 4FISA 4ESBA 1YFHA 3H0DA 3BCAA 3WHBA 3RYPA 3BZ6A 2BGCA 1X4PA 2COMA 2W7NA 2MD5A 3KEYA 5DCFA 3LFUA 4UNOA 2L9VA 2JA2A 5FJ8J 3OYNA 1JT0A 4BKXA 1FJLA 2QLZA 2A07F 2HQ5A 4LG0B 4C2TA 3NQOA 1E3PA 5CVRA 3BR3A 1TC3C 2Y48A 2L4MA 3NRVA 2X6YA 3CMEI 2IPQX 1FBSA 4YIIA 2V26A 1XCVA 4X1EA 1XMKA 3GLXA 3OMYA 4RS8A 2D2WA 1BN5A 4HW0A 5TRDA 4X6AJ 4AYBA 1R00A 3LWFA 3PM1A 4HX8A 2DYRH 2HR3A 2V1UA 2IGNA 4BY7J 5EEAA 2HKOA 4CA0A 5B66C 1UHMA 2DT5A 2VJJA 3JRHA 3KZIC 3S32A 1MMAA 4L5IA 2F2EA 4BHCA 3ABMH 4BYYA 4XSZF 1H9GA 2EIJH 2GOXB 4PFOA 2ME6A 2LBFB 4C3IJ 1HCRA 5A2QZ 2EFWA 3OYBA 3KLNA 4BNCA 1Z6RA 3W3CA 4XK4A 2JSCA 1SD4A 3R0AA 2CS3A 4ZYAA 3FHZA 1ETYA 1ITYA 4MQ9F 2LMDA 3BTLA 1REPC 2CGPA 4CYCB 3MMYB 1EF4A 1S5LC 2ETHA 4OWRB 2KISA 3DBRB 4H0EA 3FMRA 2XAJA 2TDXA 2R93J 1OFCX 3RYRA 2F5VA 4Y17A 4MIMA 1U2WA 3ABUA 4RGUA 4FTHA 2DXIA 2K4BA 1D0YA 1WI9A 1ACIA 1GHCA 4OAZA 2AXLA 1YE9A 4F7ZA 1ETKA 5KK1A 2PMZA 5HOOA 1ZTRA 1PJRA 4ZDPA 2E2HJ 1YW8A 4HZFA 3TMOA 2KFDA 3TW7A 4DYRA 2K02A 2BY2A 2NS8A 3BROA 4F52A 2JT1A 4XL9A 1X19A 4BXFA 1F1ZA 1JKPC 2P4WA 1LEAA 2VXDA 1VQPI 1R6RA 3S16J 1JHFA 3I4NJ 3H36A 3EUAA 3VODA 1VQOI 3OS2A 5A2QK 2ZCWA 1UJ8A 2V1XA 4LK0F 4UUVA 3R6SA 3ONQA 4EJVA 3H92A 2CJJA 2R7QA 4A2UA 2B63J 3Q0VA 1MBEA 5DD8A 4FASD 3M9AA 4AIHA 4KYWA 5J8CA 4KN4X 4V19K 3M07A 3OOPA 3UR3C 4J00A 3MN2A 2VPLA 1GDTA 3JR9A 2M45A 4M3GA 4K2EA 1GXQA 2HEOA 2HI3A 2UXXA 5B5EC 5ICCA 3OWTA 2P5LC 2Y0SA 3WTXC 2QEXI 3F21A 4PJLA 1B4AA 1X3UA 3IUOA 2ID3A 2VC1A 3QYBA 4A5NA 4YELA 1LFPA 2DOEA 3A01B 2K27A 4BDYA 4XOTA 1IRXA 3W2AA 3G1LA 1ZH5A 2V9KA 3GFMA 5C44J 2JRTA 1ZLJA 3FIWA 4A3LJ 3L1PA 5DS9A 5KCMA 3BTCA 1ZR2A 3EETA 3MAJA 2IBDA 5E1XA 3RZDJ 2IP2A 4U87A 1MH4A 1ZG5A 5J4VA 4MGRA 3L09A 2JVHA 5KVRA 1G4DA 2QBYB 4FE7A 5IY5H 2HXIA 3FK6A 2QENA 3G71I 2KDOA 4ENKA 2VI6A 1JHHA 5M5YJ 2KL4A 1H0MA 4FETA 2PLYA 1QZYA 3EQLF 4KJZA 2L9RA 5FFXA 5L3FA 1P6RA 5ED4A 4I0BA 2YU9J 3RTRA 4E7JA 4N9HA 2EA4A 2E7WA 2W4SA 3JCUC 2XKPA 3K70C 3CJRB 2HKXA 4F55A 2Z1DA 1KU7A 2NVTJ 2DOFA 2NXNB 4XQFA 2EZIA 2ZXIA 4RGRA 1VFCA 3H9GA 2JQ7A 1E0EA 2H27A 1T08B 4MQVA 3EYIA 3CLQA 3DPUA 1QQIA 3GZNB 1I3QJ 3K1PA 3LSIA 4D1QA 1R36A 5K5RA 4NDLA 1Y39A 2EZHA 4BJTA 4PGHA 1USTA 4LK1F 3KE2A 5FKOA 1SVLA 4RDUA 2XASA 3CCYA 3EDPA 1D1BA 1K78A 1BOBA 5CKTA 1RRJA 1R1TA 3KYLA 3WE2A 1Z1DA 5IOYA 1D8KA 3ERED 3LSMA 1BBYA 2E1MC 4XM3A 3BG5A 2QSHX 4A5MA 3ZQQA 2MFZA 3OY9A 1HC8A 1TT0A 3E5QA 2HQRA 1IUYA 1R1UA 3I55I 2V9VA 3Q0WA 2BVLA 4RAGA 2IXSA 4E7LA 4XRFA 2Z16A 4WK8F 3VB2A 2RN7A 2P6SA 2FU4A 3LL7A 3ZQ7A 2NS7A 3GZ6A 3Q3SA 1HDPA 5E1ZB 5HVQC 2RVCA 3ZRGA 3IWZA 5FLMJ 2R5YA 1W4MA 2R4GA 2E5ZA 3JRFA 4ABZA 2LD5A 1NK2P 4CYDA 2L7ZA 2OJED 2K40A 2QQ8A 1K7AA 3ZN0A 4II3A 1CGPA 3KPHA 1WKMA 3ZOBA 3O6BB 3SZGA 3NWSA 1OMIA 2DU9A 2GBYA 3HIFA 1G6NA
chains in the Genus database with same CATH topology
2M8GX 9ANTA 3ZQLA 1TWFJ 2HDDA 3K2AA 2XGEA 4I6ZA 4IHWA 4C3HJ 2LKXA 1QVUA 3BR0A 4DYCA 1HDDC 1AHDP 3BR2A 3G1OA 1LE8B 3HOXJ 4QSHA 3S2HJ 1RETA 4JX6A 1P7IA 3D1NI 3RQIA 1JTYA 2K9NA 5EF6A 1W0TA 1MSEC 1GT0C 1GVDA 1WCMJ 4MLOA 3DCFA 1BJZA 2L7MP 3JRIA 2GLOA 3GTPJ 4BBSJ 2R5ZA 1T33A 4AUXA 3HOZJ 1IDYA 3H0GJ 3JRDA 1AKHB 1ETQA 2E19A 3HOYJ 3OSFA 2CQXA 4D5FA 1JKQC 5J1UA 3K7AJ 1TWCJ 4UUSA 2DA6A 5IYCJ 4W97A 2LY9A 4FCYA 3GTMJ 1MBJA 1ZKGA 4V2GA 1DU6A 2DTZA 5F1JA 1FIPA 1XC5A 3HM5A 1MBKA 2NVYJ 3ZQFA 4V2FA 3PO3J 5E3LA 3F0CA 1JJ6C 2CU7A 2M9HA 4Y7NJ 1APLC 2IEKA 3S14J 5EGOA 1BA5A 3CMYA 2DJNA 1U78A 3S2DJ 4IHYA 1K83J 4M3BA 3S17J 1ETWA 1XS9A 2JMWA 3IH3A 2JJ7A 4B3AA 2ME0A 2NVQJ 5EZHA 1A5JA 5GP9A 4BXXJ 1ZK8A 2QCOA 2MGQA 3CDLA 2DN0A 1ETXA 2TCTA 3B6AA 2R5YB 2DA1A 3A02A 3LSRA 2G0EA 1YRNA 3S15J 5DTDA 2LFBA 2ZB9A 1FIAA 4A3DJ 3LSGA 4LOCA 4M3FA 2VUMJ 1ZR4A 4A3CJ 2XGCA 2CQQA 2X6OA 1POGA 3PO2J 4AC0A 4A3EJ 5JLXA 4IHXA 4MFDA 5J1YA 3JRBA 4AYBN 4IHVA 1QPIA 2FQ4A 2R0QC 2AHQA 1NTCA 2M0CA 5EG0A 2JA7J 2ID6A 2AO9A 1Q1VA 5F27A 3I4MJ 3O8HA 4JYKA 3G1MA 4XRMA 1VF9A 5FKNA 2KT0A 4C3JJ 3ZQCA 1Y1WJ 4JX4A 2HOTA 4A3BJ 2L7FP 3FKIJ 1X58A 2VPRA 2R5ZB 2DA7A 1JTXA 1XG1A 3BQZA 2O7OA 3M4OJ 1U9OA 3ZQGA 5M5WJ 1RKTA 2RAEA 3O8GA 2FX0A 4MFEA 3W6VA 3TEDA 3HEFA 4FE4A 4UUTA 1JUPA 4UUSB 1MBHA 2DMPA 2Y2ZA 3HGYA 5E3NA 4B4CA 2COBA 4DZPA 4L5EA 3SFIA 5K7FA 3HKZN 1IRZA 1SFOJ 2PMZN 3A03A 2L0KA 5BNGA 1MNMC 2LR8A 1O4XA 5F0HA 3ZQIA 5EGOB 3S1RJ 3RZOJ 2XSDC 1I50J 4M3DA 3OIOA 4MO7A 1WH7A 5F0CA 1JUSA 3VPRA 4D5CA 3BG3A 3JRGA 4HNVA 1HLVA 1X2MA 2JN6A 4M3EA 2OPTA 2DMTA 1E3OC 4CYCA 1IGNA 3JRAA 3RKQA 3IH4A 5J3LA 3LNQA 2MSYA 3JRCA 4RBOA 1ENHA 1JUMA 2DA3A 5GPCA 4XICA 4C2MJ 4D7NA 5IP7J 1TWHJ 1YRNB 3C2BA 2XGDA 2JK3A 1TWAJ 4FISA 4BY1J 1R9TJ 3HOWJ 3WHBA 1W0UA 1GUUA 2XB0X 5J1RA 4J19A 1ZGWA 1FTTA 4S0HB 2H1KA 2Y0SN 3TW6A 2N8GA 1JT0A 2XPUA 2DA5A 5FJ8J 4BKXA 5EG0B 1FJLA 2HQ5A 1B8IA 3SJMA 4QIWN 1UHSA 2WV1A 1BW5A 4W1UA 2DMUA 2XPVA 3BR3A 1MSFC 1TC3C 2E2IJ 2D5VA 3UKGA 1ETVA 4X1EA 1G2HA 1RR7A 4BBRJ 1F43A 1Z0XA 1ORKA 2CUEA 2FJ1A 2NOGA 2DMNA 4X6AJ 5E3MA 3PM1A 3HB9A 1LFBA 1I6HJ 4BY7J 1QRYA 5EEAA 2X48A 3JRHA 1JGGA 2QF7A 2Y9ZA 3IV5A 5M5XJ 2ME6A 1HCRA 4C3IJ 2EZKA 4IEJA 1QVTA 1ZQ3P 2LP0A 2KDZA 1RESA 2DMQA 2EQRA 2CRGA 4XK4A 3NAUA 4XRSA 1IJWC 4EEFG 3GTQJ 2H8RA 1ETYA 5M3FJ 1ITYA 3B6CA 4DW6A 1IDZA 1IC8A 2LLKA 3BTLA 1IG7A 2O8KA 2M34A 4CYCB 1EF4A 4QTRA 2LVSA 2R93J 1OFCX 5HODA 4MIMA 4FTHA 2VKVA 5FKMA 2EH3A 5EYRA 2OF7A 3OOUA 1MBGA 1ETKA 2YS9A 1SANA 5IP9J 1ZTRA 1Y1VJ 1WGXA 4A3KJ 2E2HJ 3GBGA 2XRLA 2Y30A 3TW7A 4DYRA 3S1MJ 5JLWA 4DZJA 4A3FJ 2NS8A 5EZGA 2R7ZJ 3LSJA 1OCPA 1JKPC 3FK7A 3WHCA 5IYBJ 5IYDJ 1JKOC 5IPAA 3S16J 2Y9YA 3I4NJ 2MG4A 1B8IB 2WAQN 1MH3A 1K61A 4JP0A 3QPLA 1DU0A 2NVXJ 3E7LA 2XB5A 2JWTA 2HOSA 2HOAA 3BG9A 1GV2A 2CJJA 2B63J 3GTOJ 3Q0VA 1MBEA 4A3MJ 4A3JJ 5FKKA 5E3OA 4M6VA 4G12A 1OJLA 2P81A 3BTIA 3HOVJ 1U9NA 2I10A 3MN2A 1GDTA 3JR9A 2JA6J 4M3GA 5F0FA 1NK3P 1IUFA 2HI3A 5K7ZA 1T56A 2DA2A 3BR6A 3TP0A 1WPKA 5C4XJ 2ID3A 2K9SA 1UG2A 1FEXA 2LTPA 5IOZA 3LSPA 3A01B 1BL0A 3G1LA 3GTLJ 1LFUP 3BT9A 5K7HA 5C44J 3SDGA 2HXOA 2O9LA 3FIWA 4A3LJ 2CUFA 3L1PA 5DS9A 3CQZJ 3BTCA 1ZR2A 1OCTC 2IBDA 2Y31A 3NARA 1X2NA 3RZDJ 1MH4A 4I76A 3S1QJ 4XIDA 1JJ8C 5F04A 5IP6A 1PUFA 3HDDA 2JA8J 1B72A 4FE7A 2JA5J 1CQTA 2HXIA 3BR5A 3FK6A 5C4JJ 2M2EA 3GTGJ 2VI6A 4A93J 3HBLA 5M5YJ 3BTJA 1GV5A 4GFBA 3ZQHA 1H8AC 2L9RA 2XPWA 2YUSA 2YU9J 1F36A 4A69C 3QQAA 1LE8A 5F08A 2MW8A 4XRSG 4DYQA 3GTJJ 1FTZA 3A01A 3TP3A 1U8BA 2TRTA 2X9DA 2NVTJ 3H3VK 1H88C 2WB1N 2EZIA 3MKLA 3QPSA 1VFCA 1HF0A 4D7MA 5FLVA 1IV6A 3IH2A 1VI0A 1JKRC 1I3QJ 4A3GJ 1A6IA 2K9QA 4NDLA 1AKHA 2FD5A 2EZHA 5FKOA 1WI3A 4RDUA 3BQYA 3BR1A 1H89C 5FKLA 4JX5A 3CCYA 5M3MJ 1D5YA 5IOYA 1JT6A 3M3YJ 2IAIA 5EDNA 3BG5A 1HOMA 1WH5A 1AU7A 1TWGJ 3Q0WA 3S1NJ 1VNDA 3LOCA 3GTKJ 2VKEA 2R92J 3JREA 2NS7A 1UMQA 1BW6A 3Q3SA 1HDPA 4B1RA 1P7JA 3MVPA 1MBFA 4A3IJ 1RKWA 1Z77A 5FLMJ 2ECBA 2E2JJ 3OSGA 1ETOA 2W48A 2R5YA 3JRFA 1RPWA 4ABZA 2LD5A 1NK2P 4Y52J 2DA4A 2L7ZA 2GM4A 2HYJA 2K40A 2LK2A 1PUFB 2E1OA 3FISA 1B72B 2ELKA 3HOUJ 3Q0UA 3HGGA 3ZOBA 2ECCA 2EBIA 5C3EJ 2EZLA 2GBYA 3DEWA 5GPAA 1S7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8G X;  9ANT A;  3ZQL A;  1TWF J;  2HDD A;  3K2A A;  2XGE A;  4I6Z A;  4IHW A;  4C3H J;  2LKX A;  1QVU A;  3BR0 A;  4DYC A;  1HDD C;  1AHD P;  3BR2 A;  3G1O A;  1LE8 B;  3HOX J;  4QSH A;  3S2H J;  1RET A;  4JX6 A;  1P7I A;  3D1N I;  3RQI A;  1JTY A;  2K9N A;  5EF6 A;  1W0T A;  1MSE C;  1GT0 C;  1GVD A;  1WCM J;  4MLO A;  3DCF A;  1BJZ A;  2L7M P;  3JRI A;  2GLO A;  3GTP J;  4BBS J;  2R5Z A;  1T33 A;  4AUX A;  3HOZ J;  1IDY A;  3H0G J;  3JRD A;  1AKH B;  1ETQ A;  2E19 A;  3HOY J;  3OSF A;  2CQX A;  4D5F A;  1JKQ C;  5J1U A;  3K7A J;  1TWC J;  4UUS A;  2DA6 A;  5IYC J;  4W97 A;  2LY9 A;  4FCY A;  3GTM J;  1MBJ A;  1ZKG A;  4V2G A;  1DU6 A;  2DTZ A;  5F1J A;  1FIP A;  1XC5 A;  3HM5 A;  1MBK A;  2NVY J;  3ZQF A;  4V2F A;  3PO3 J;  5E3L A;  3F0C A;  1JJ6 C;  2CU7 A;  2M9H A;  4Y7N J;  1APL C;  2IEK A;  3S14 J;  5EGO A;  1BA5 A;  3CMY A;  2DJN A;  1U78 A;  3S2D J;  4IHY A;  1K83 J;  4M3B A;  3S17 J;  1ETW A;  1XS9 A;  2JMW A;  3IH3 A;  2JJ7 A;  4B3A A;  2ME0 A;  2NVQ J;  5EZH A;  1A5J A;  5GP9 A;  4BXX J;  1ZK8 A;  2QCO A;  2MGQ A;  3CDL A;  2DN0 A;  1ETX A;  2TCT A;  3B6A A;  2R5Y B;  2DA1 A;  3A02 A;  3LSR A;  2G0E A;  1YRN A;  3S15 J;  5DTD A;  2LFB A;  2ZB9 A;  1FIA A;  4A3D J;  3LSG A;  4LOC A;  4M3F A;  2VUM J;  1ZR4 A;  4A3C J;  2XGC A;  2CQQ A;  2X6O A;  1POG A;  3PO2 J;  4AC0 A;  4A3E J;  5JLX A;  4IHX A;  4MFD A;  5J1Y A;  3JRB A;  4AYB N;  4IHV A;  1QPI A;  2FQ4 A;  2R0Q C;  2AHQ A;  1NTC A;  2M0C A;  5EG0 A;  2JA7 J;  2ID6 A;  2AO9 A;  1Q1V A;  5F27 A;  3I4M J;  3O8H A;  4JYK A;  3G1M A;  4XRM A;  1VF9 A;  5FKN A;  2KT0 A;  4C3J J;  3ZQC A;  1Y1W J;  4JX4 A;  2HOT A;  4A3B J;  2L7F P;  3FKI J;  1X58 A;  2VPR A;  2R5Z B;  2DA7 A;  1JTX A;  1XG1 A;  3BQZ A;  2O7O A;  3M4O J;  1U9O A;  3ZQG A;  5M5W J;  1RKT A;  2RAE A;  3O8G A;  2FX0 A;  4MFE A;  3W6V A;  3TED A;  3HEF A;  4FE4 A;  4UUT A;  1JUP A;  4UUS B;  1MBH A;  2DMP A;  2Y2Z A;  3HGY A;  5E3N A;  4B4C A;  2COB A;  4DZP A;  4L5E A;  3SFI A;  5K7F A;  3HKZ N;  1IRZ A;  1SFO J;  2PMZ N;  3A03 A;  2L0K A;  5BNG A;  1MNM C;  2LR8 A;  1O4X A;  5F0H A;  3ZQI A;  5EGO B;  3S1R J;  3RZO J;  2XSD C;  1I50 J;  4M3D A;  3OIO A;  4MO7 A;  1WH7 A;  5F0C A;  1JUS A;  3VPR A;  4D5C A;  3BG3 A;  3JRG A;  4HNV A;  1HLV A;  1X2M A;  2JN6 A;  4M3E A;  2OPT A;  2DMT A;  1E3O C;  4CYC A;  1IGN A;  3JRA A;  3RKQ A;  3IH4 A;  5J3L A;  3LNQ A;  2MSY A;  3JRC A;  4RBO A;  1ENH A;  1JUM A;  2DA3 A;  5GPC A;  4XIC A;  4C2M J;  4D7N A;  5IP7 J;  1TWH J;  1YRN B;  3C2B A;  2XGD A;  2JK3 A;  1TWA J;  4FIS A;  4BY1 J;  1R9T J;  3HOW J;  3WHB A;  1W0U A;  1GUU A;  2XB0 X;  5J1R A;  4J19 A;  1ZGW A;  1FTT A;  4S0H B;  2H1K A;  2Y0S N;  3TW6 A;  2N8G A;  1JT0 A;  2XPU A;  2DA5 A;  5FJ8 J;  4BKX A;  5EG0 B;  1FJL A;  2HQ5 A;  1B8I A;  3SJM A;  4QIW N;  1UHS A;  2WV1 A;  1BW5 A;  4W1U A;  2DMU A;  2XPV A;  3BR3 A;  1MSF C;  1TC3 C;  2E2I J;  2D5V A;  3UKG A;  1ETV A;  4X1E A;  1G2H A;  1RR7 A;  4BBR J;  1F43 A;  1Z0X A;  1ORK A;  2CUE A;  2FJ1 A;  2NOG A;  2DMN A;  4X6A J;  5E3M A;  3PM1 A;  3HB9 A;  1LFB A;  1I6H J;  4BY7 J;  1QRY A;  5EEA A;  2X48 A;  3JRH A;  1JGG A;  2QF7 A;  2Y9Z A;  3IV5 A;  5M5X J;  2ME6 A;  1HCR A;  4C3I J;  2EZK A;  4IEJ A;  1QVT A;  1ZQ3 P;  2LP0 A;  2KDZ A;  1RES A;  2DMQ A;  2EQR A;  2CRG A;  4XK4 A;  3NAU A;  4XRS A;  1IJW C;  4EEF G;  3GTQ J;  2H8R A;  1ETY A;  5M3F J;  1ITY A;  3B6C A;  4DW6 A;  1IDZ A;  1IC8 A;  2LLK A;  3BTL A;  1IG7 A;  2O8K A;  2M34 A;  4CYC B;  1EF4 A;  4QTR A;  2LVS A;  2R93 J;  1OFC X;  5HOD A;  4MIM A;  4FTH A;  2VKV A;  5FKM A;  2EH3 A;  5EYR A;  2OF7 A;  3OOU A;  1MBG A;  1ETK A;  2YS9 A;  1SAN A;  5IP9 J;  1ZTR A;  1Y1V J;  1WGX A;  4A3K J;  2E2H J;  3GBG A;  2XRL A;  2Y30 A;  3TW7 A;  4DYR A;  3S1M J;  5JLW A;  4DZJ A;  4A3F J;  2NS8 A;  5EZG A;  2R7Z J;  3LSJ A;  1OCP A;  1JKP C;  3FK7 A;  3WHC A;  5IYB J;  5IYD J;  1JKO C;  5IPA A;  3S16 J;  2Y9Y A;  3I4N J;  2MG4 A;  1B8I B;  2WAQ N;  1MH3 A;  1K61 A;  4JP0 A;  3QPL A;  1DU0 A;  2NVX J;  3E7L A;  2XB5 A;  2JWT A;  2HOS A;  2HOA A;  3BG9 A;  1GV2 A;  2CJJ A;  2B63 J;  3GTO J;  3Q0V A;  1MBE A;  4A3M J;  4A3J J;  5FKK A;  5E3O A;  4M6V A;  4G12 A;  1OJL A;  2P81 A;  3BTI A;  3HOV J;  1U9N A;  2I10 A;  3MN2 A;  1GDT A;  3JR9 A;  2JA6 J;  4M3G A;  5F0F A;  1NK3 P;  1IUF A;  2HI3 A;  5K7Z A;  1T56 A;  2DA2 A;  3BR6 A;  3TP0 A;  1WPK A;  5C4X J;  2ID3 A;  2K9S A;  1UG2 A;  1FEX A;  2LTP A;  5IOZ A;  3LSP A;  3A01 B;  1BL0 A;  3G1L A;  3GTL J;  1LFU P;  3BT9 A;  5K7H A;  5C44 J;  3SDG A;  2HXO A;  2O9L A;  3FIW A;  4A3L J;  2CUF A;  3L1P A;  5DS9 A;  3CQZ J;  3BTC A;  1ZR2 A;  1OCT C;  2IBD A;  2Y31 A;  3NAR A;  1X2N A;  3RZD J;  1MH4 A;  4I76 A;  3S1Q J;  4XID A;  1JJ8 C;  5F04 A;  5IP6 A;  1PUF A;  3HDD A;  2JA8 J;  1B72 A;  4FE7 A;  2JA5 J;  1CQT A;  2HXI A;  3BR5 A;  3FK6 A;  5C4J J;  2M2E A;  3GTG J;  2VI6 A;  4A93 J;  3HBL A;  5M5Y J;  3BTJ A;  1GV5 A;  4GFB A;  3ZQH A;  1H8A C;  2L9R A;  2XPW A;  2YUS A;  2YU9 J;  1F36 A;  4A69 C;  3QQA A;  1LE8 A;  5F08 A;  2MW8 A;  4XRS G;  4DYQ A;  3GTJ J;  1FTZ A;  3A01 A;  3TP3 A;  1U8B A;  2TRT A;  2X9D A;  2NVT J;  3H3V K;  1H88 C;  2WB1 N;  2EZI A;  3MKL A;  3QPS A;  1VFC A;  1HF0 A;  4D7M A;  5FLV A;  1IV6 A;  3IH2 A;  1VI0 A;  1JKR C;  1I3Q J;  4A3G J;  1A6I A;  2K9Q A;  4NDL A;  1AKH A;  2FD5 A;  2EZH A;  5FKO A;  1WI3 A;  4RDU A;  3BQY A;  3BR1 A;  1H89 C;  5FKL A;  4JX5 A;  3CCY A;  5M3M J;  1D5Y A;  5IOY A;  1JT6 A;  3M3Y J;  2IAI A;  5EDN A;  3BG5 A;  1HOM A;  1WH5 A;  1AU7 A;  1TWG J;  3Q0W A;  3S1N J;  1VND A;  3LOC A;  3GTK J;  2VKE A;  2R92 J;  3JRE A;  2NS7 A;  1UMQ A;  1BW6 A;  3Q3S A;  1HDP A;  4B1R A;  1P7J A;  3MVP A;  1MBF A;  4A3I J;  1RKW A;  1Z77 A;  5FLM J;  2ECB A;  2E2J J;  3OSG A;  1ETO A;  2W48 A;  2R5Y A;  3JRF A;  1RPW A;  4ABZ A;  2LD5 A;  1NK2 P;  4Y52 J;  2DA4 A;  2L7Z A;  2GM4 A;  2HYJ A;  2K40 A;  2LK2 A;  1PUF B;  2E1O A;  3FIS A;  1B72 B;  2ELK A;  3HOU J;  3Q0U A;  3HGG A;  3ZOB A;  2ECC A;  2EBI A;  5C3E J;  2EZL A;  2GBY A;  3DEW A;  5GPA A;  1S7E A; 
#chains in the Genus database with same CATH topology
 3QOP A;  1TWF J;  3QU6 A;  4IVN A;  2HGC A;  1YHQ I;  2HDD A;  3P7N A;  1H9T A;  2XGE A;  4I6Z A;  5ILU A;  4G6D A;  3W6J B;  1AHD P;  2MBF A;  2DW4 A;  5F6F A;  2D45 A;  4XR6 A;  4KFC A;  2VOO A;  4KIG A;  4P9U A;  4AID A;  2F5E A;  3S2H J;  1KA8 A;  2K86 A;  4JQF A;  4C9Y A;  3HRU A;  4ZH4 F;  3CES A;  3H5N A;  1W0T A;  1YIT I;  1EH7 A;  1ON1 A;  3GFL A;  2L4A A;  1V54 H;  1WCM J;  2K4J A;  4RGS A;  2L7M P;  4BBS J;  3QP5 A;  1QGP A;  3GFJ A;  5DEQ A;  4S05 A;  3DBH B;  4D0P A;  1AKH B;  3ASO H;  1ETQ A;  4WWC A;  2IS2 A;  4L9J A;  4D5F A;  4M6X A;  1XMA A;  3CCR I;  1O3T A;  1TTY A;  4UUS A;  3ZMV A;  3KP6 A;  2EIN H;  3QU3 A;  3GTM J;  4HYE A;  1ZKG A;  3OR1 C;  2X1C A;  4V2G A;  1UEL B;  3ZQF A;  1MBK A;  2NVY J;  2D1H A;  5IT9 Z;  1IRG A;  4HV5 A;  1YJW I;  3WTW C;  1JJ6 C;  1APL C;  3CMY A;  2DJN A;  3S2D J;  1FLI A;  2GAU A;  4M3B A;  2M3A A;  2WB1 A;  5DV5 A;  2BY3 A;  1XD7 A;  2HU9 A;  1ETW A;  4UVB A;  5D5W B;  5HS8 A;  3ML6 A;  1EA3 A;  3IH3 A;  2JJ7 A;  2PJR A;  1VQ4 I;  2GIZ A;  3W2W A;  2L9N A;  1IZ1 A;  1IXS B;  2JUG A;  5EZH A;  5GP9 A;  1LDD A;  4HRI A;  3CDL A;  4XOR A;  2NOJ B;  2TCT A;  3J7Z I;  3RKX A;  4YFN F;  2HQN A;  4UHT A;  2DK8 A;  1W1W E;  1YRN A;  5DTD A;  1GLN A;  3CTA A;  5KAF C;  1O57 A;  4M9S A;  4UV8 A;  3U2R A;  2XGC A;  1UAA A;  3PO2 J;  2OD5 A;  2G9W A;  4I02 A;  2W24 A;  4QPO A;  2FBK A;  5B1B H;  3K4N A;  3LST A;  2FQ4 A;  2B0L A;  2AHQ A;  1T38 A;  1IXR C;  2M0C A;  3D5R C;  4QPQ A;  2GXB A;  5IT9 K;  3R0J A;  2ID6 A;  3AG1 H;  3I4M J;  3DTI A;  1MMS A;  2OZ6 A;  3VYR B;  5HNH A;  2IW5 A;  4G7O F;  2IGM A;  4LFU A;  2YSR A;  4C3J J;  3I56 I;  3AFH A;  4M73 A;  4EQQ A;  2HOT A;  4OAY A;  4EJT A;  4A3B J;  1OYW A;  2RC4 A;  2UUZ A;  2P8T A;  2VPR A;  5DCM A;  3ULQ B;  4XLC A;  1U9O A;  3LSK A;  3DBL B;  2OBP A;  1STZ A;  1UG0 A;  2Z33 A;  3BZC A;  2IS1 A;  1DPR A;  3L00 A;  1RKT A;  1BR2 A;  5LHG A;  4UUT A;  3G4S I;  1JUP A;  4EJU A;  3S3O A;  5LD2 C;  3L9F A;  5E3N A;  3V8L A;  2QUF A;  2PMU A;  2NAZ A;  1R22 A;  1XDU A;  3A03 A;  4G94 A;  1MNM C;  2LR8 A;  2Q0O A;  3RZO J;  3K4M A;  1W5C C;  2G7H A;  2XSD C;  4HF0 A;  2P6T A;  1ZEL A;  1G3S A;  3A1Y A;  1JUS A;  3VPR A;  3BG3 A;  1EKE A;  3BP8 A;  4YEJ A;  1X2M A;  2JN6 A;  4M3E A;  5E8G A;  3WOD F;  2QM3 A;  2Z2S B;  2ADU A;  3JRA A;  3RKQ A;  3GME A;  2CMP A;  2DPD A;  3QPT A;  4ENJ A;  4AM3 A;  1FBQ A;  2K9M A;  4ZC3 A;  2RNG A;  4EVI A;  1BC7 C;  2DA3 A;  1UFM A;  3F8B A;  2BW3 A;  4XIC A;  4C2M J;  3LFK A;  3H9J A;  3ZMT A;  5IP7 J;  1A31 A;  2LOO A;  3IRQ A;  2XGD A;  2IA1 A;  1OYY A;  4U0W A;  5F64 A;  3RQ4 A;  2BE5 F;  4CDG A;  2VAS A;  3CCE I;  3F23 A;  2H8W A;  2V79 A;  3KP5 A;  5TGT A;  3E6M A;  3REO A;  3HOW J;  3F8F A;  1GUU A;  1RZ4 A;  4LLG F;  3CO7 C;  3V7C A;  1RNL A;  2BZT A;  4S0H B;  1Z21 A;  2H1K A;  2F48 A;  2VBZ A;  4YIR X;  1TBX A;  4X0G A;  2X1D A;  5EG0 B;  2IA0 A;  2DT6 A;  5GTI C;  1LNW A;  4R79 A;  1BW5 A;  4XON A;  2XPV A;  2JTV A;  4CHU A;  4HX7 A;  1K79 A;  1X1B A;  3WU2 C;  2E2I J;  1EH8 A;  4HF2 A;  4PGG A;  2X1E A;  2HYG D;  3UKG A;  2Z5U A;  2HZD A;  4RM2 A;  1ETV A;  3GXO A;  2QKL B;  5J4Y A;  3OIP A;  3H1C A;  1D0X A;  3ISP A;  1F43 A;  4WXH A;  1FPQ A;  3OYI A;  1VZ0 A;  4ZZL A;  1D8J A;  2NOG A;  2A68 F;  2GQQ A;  2YX7 A;  1FMW A;  2KQR A;  1OCZ H;  3VWB A;  2Y75 A;  3KLO A;  1LFB A;  1I6H J;  2I8D A;  3Q9V A;  4ZJZ A;  1U0J A;  4IX7 A;  1R7J A;  3CLO A;  2X48 A;  4IOC F;  4FX4 A;  1G3T A;  3KP4 A;  3KEQ A;  2VN2 A;  1Q1H A;  2QGU A;  5GAD J;  2Y9Z A;  5E1W A;  3IV5 A;  1LJ9 A;  1IN8 A;  4HX4 A;  2V9P A;  3OYF A;  5J8F A;  1ZQ3 P;  2LP0 A;  1ZN2 A;  1RES A;  2E60 A;  2MYS A;  1MMG A;  4GYI A;  4XRS A;  1FY7 A;  2F5F A;  1I6X A;  3HHH A;  1ZRF A;  4L0Y B;  4DW6 A;  1IDZ A;  4BAC A;  1IC8 A;  2LLK A;  3HC7 A;  3OIQ A;  3ASN H;  2WBM A;  3BJO A;  4OIN F;  4A0Y A;  3CCJ I;  2DOA A;  3FM3 A;  3VSK A;  1WJF A;  2KIU A;  2CV1 A;  4IHS A;  2X0L A;  1MDM A;  2M4G A;  2EH3 A;  5EYR A;  5HLH A;  3L2V A;  2OF7 A;  1Y56 A;  3OOU A;  3SYT A;  3EYY A;  1T8I A;  4N4N B;  3HKZ A;  2VC0 A;  2DO7 A;  2ZME A;  5IP9 J;  1Y1V J;  2HVR A;  3S1M J;  4A3F J;  5EZG A;  1X1A A;  4AD9 A;  2KLO A;  4XKC A;  3WHC A;  5IYD J;  3HTS B;  1IF1 A;  5IPA A;  2E36 A;  4CSW A;  2IVM A;  3RKW A;  3LSH A;  1HW1 A;  1B8I B;  2WAQ N;  4KIS A;  3H9Q A;  4CIC A;  3TO6 A;  3M1C A;  1MH3 A;  4JP0 A;  4KMU X;  3QPL A;  3PUF A;  4GGG A;  2NVX J;  2VOP A;  3E7L A;  2CQK A;  2XB5 A;  4Z6Y A;  2XC7 A;  1SFK A;  2HOA A;  1LKX A;  3IAS 2;  1GV2 A;  2DDB A;  4I09 A;  3OYH A;  2O8X A;  3T0Y A;  2HFH A;  3VYT B;  3B02 A;  3HHG A;  4A3M J;  2KRF A;  1L0O C;  4G12 A;  3BTI A;  1U9N A;  4B48 A;  4PSX A;  4GXO A;  1RUN A;  3TDU C;  4RB2 C;  2KZG A;  4L9V A;  1QBJ A;  1T56 A;  2DA2 A;  3BR6 A;  4YRV A;  3MQ0 A;  3TP0 A;  1HST A;  2KJB A;  1WPK A;  1JE8 A;  2L5Q A;  4Y33 A;  1VQK I;  4B47 A;  5HLT A;  2BYV E;  1UG2 A;  1FEX A;  1ONV A;  2LTP A;  4Y4R A;  3FX3 A;  5IOZ A;  3LSP A;  4LB5 A;  1T95 A;  4RLF A;  1X1P A;  4O5V A;  2JPC A;  1BL0 A;  3MCZ A;  3PSI A;  2FSW A;  4C2U A;  1DDN A;  3I71 A;  3C2G A;  4BE1 A;  1LFU P;  1I27 A;  4G9Y A;  2PEX A;  1Z05 A;  2HYF A;  2HXO A;  4ANJ A;  3CUQ B;  5HDK A;  2R7U A;  4NBQ A;  3HUG A;  4ON0 A;  1DQU A;  2HZT A;  1O3R A;  3CQZ J;  1V5G A;  2CFO A;  1OCT C;  3DEU A;  4R8H A;  3T1B A;  1X2N A;  3E5X A;  4XID A;  4RAF A;  4PJM A;  3HDD A;  2JA8 J;  1B72 A;  3EUK L;  1OYI A;  3C1D A;  3HOS A;  3QRF F;  5BOX A;  2DCE A;  4HNU A;  2WA0 A;  2IS6 A;  2H94 A;  3HSE A;  3GTG J;  1G3Y A;  1RI7 A;  1BI1 A;  1FOX A;  5F1R A;  1ZRC A;  1DGR M;  3EUH C;  1SD5 A;  3TBI A;  1OR7 C;  2V1D A;  2K3F A;  2X6X A;  4FQG A;  4XNF A;  2OTJ I;  2UV1 A;  1LE8 A;  3SFZ A;  5F08 A;  2ZJR F;  2MW8 A;  3RCO A;  5FLX Z;  3O3K A;  4DYQ A;  3ZPL A;  2HVS A;  4DIQ A;  1TP4 A;  1U8B A;  1IRF A;  4UVC A;  5GAH J;  1A6Q A;  3KYC B;  2XAU A;  2X85 A;  1Y8R B;  1IV6 A;  1JKR C;  4UB8 C;  2F6C A;  2JSP A;  4M9Z A;  2IGK A;  5DD4 A;  4U88 A;  5EJC A;  3LQQ A;  2ZNY A;  2K9Q A;  2FD5 A;  1WJA A;  5FD5 A;  5L3D A;  4ZYD A;  4IO9 F;  1NH3 A;  3MEX A;  4BXU A;  3I9V 2;  5FKL A;  1ZLK A;  4JX5 A;  1K6Y A;  1AOY A;  2ELH A;  5HLI A;  1JT6 A;  3M3Y J;  1PYV A;  4RM3 A;  1KQ0 A;  2IAI A;  3JSP A;  2CUJ A;  1G3W A;  4LIU A;  4I0A A;  2MLG A;  4NQW A;  5GAG J;  1AU7 A;  3FXK A;  1OPC A;  3LOC A;  1UB9 A;  2F5C A;  2HWV A;  2GXG A;  3KZY A;  4GO1 A;  2K85 A;  3SHF A;  1MJ9 A;  3DEE A;  2FNA A;  3WTV C;  4B1R A;  1P7J A;  2VT3 A;  4CZC A;  2KJC A;  1HW5 A;  2A05 A;  1Z77 A;  2XVC A;  2ZXW H;  4CH7 A;  2LRD A;  2ZJQ F;  1RPW A;  3HSR A;  1YTY A;  2BXZ A;  3LAJ A;  3ZCO A;  5H20 A;  1PUF B;  2GM4 A;  4UY8 I;  1W36 D;  4OMY A;  5H6Q A;  2DTR A;  1JI8 A;  4U0V A;  2Y0M A;  3K6G A;  3SEQ A;  3AKZ A;  2DFE A;  5C3E J;  3T5X A;  2Z3Y A;  3DEW A;  1ZYR F;  1S7E A;  5GPA A;  5HNF A;  1WJE A;  9ANT A;  4PUS A;  4HLY A;  4YIF A;  3ZQL A;  2EIM H;  2RNJ A;  4KT6 A;  5K1Y A;  1U8R A;  1G8X A;  3K2A A;  1T98 A;  4C3H J;  3BR0 A;  3BR2 A;  2K9L A;  4M71 A;  2XF6 A;  2C6Y A;  4HF1 A;  3IHU A;  4Y15 A;  4IPA A;  3TQN A;  1RET A;  1DP7 P;  3LQR A;  4B44 A;  3RQI A;  1JTY A;  2BV6 A;  3K10 A;  2F4M B;  4IL6 C;  5EF6 A;  4MLO A;  3DCF A;  2GA2 A;  3V7S A;  2R7S A;  4U0Y A;  2IRF G;  4AUX A;  1Z7U A;  4DGW B;  4CCL A;  3H0G J;  4XLA A;  2MAB A;  3JRD A;  2E19 A;  1T39 A;  2OTL I;  2CO5 A;  1MD0 A;  4EV0 A;  2D1V A;  3TOB A;  2XV4 S;  3SZP A;  1MBJ A;  1VQ7 I;  4KIB A;  3I59 A;  1DU6 A;  3DLA A;  5IT3 A;  1XC5 A;  3BOQ A;  4V2F A;  1BM9 A;  5E3L A;  3F0C A;  4MTD A;  4HQM A;  5ICF A;  4Y7N J;  3S14 J;  2IEK A;  1S72 I;  1J75 A;  2XHK A;  1U78 A;  1K83 J;  2DOD A;  3H3U A;  2PBI A;  3DWL E;  1K6O A;  3CF2 A;  2A6T A;  1N25 A;  4BQN A;  2ME0 A;  2NVQ J;  3I58 A;  2QA4 I;  1KU9 A;  3KZZ A;  4IRG A;  1A5J A;  2HTS A;  1W7P A;  2QCO A;  2QYO A;  5FRM A;  5K5Q A;  2M8E A;  3B6A A;  3J7A Y;  4JBA A;  3KCC A;  3A02 A;  2G0E A;  2XGX A;  3EUH A;  2ZB9 A;  1BJA A;  2FEZ A;  3ECH A;  1X3W B;  4A3D J;  1OR7 A;  1IV8 A;  2AXT C;  3FXM A;  2X6O A;  4E7S A;  1POG A;  1VQN I;  2FNP A;  1OQY A;  2RRE A;  1LB2 A;  4HOB A;  5LBQ A;  2R3S A;  2ISZ A;  1FBU A;  1E17 A;  1WHU A;  3EPZ A;  2OA4 A;  2QZ8 A;  3BG6 A;  4IHV A;  3WGH A;  4MEX F;  1RC9 A;  1NTC A;  2KHM A;  2BVM A;  5LFA A;  2IJL A;  4LG0 A;  2Y69 H;  3U21 A;  3WG9 A;  1XSD A;  1Z3X A;  5CLS A;  2MC3 A;  2RKH A;  4B3X A;  3G1M A;  4XRM A;  3N97 A;  1XPX A;  1SC7 A;  4EM1 A;  4YG2 F;  5FKN A;  3OS1 A;  3CO6 C;  3ZQC A;  2JPB A;  4JX4 A;  3ELK A;  1DP3 A;  3V4G A;  3G3Z A;  4IF4 A;  3JSO A;  4BJ5 C;  4XLN F;  2XDV A;  2R5Z B;  1JTX A;  3A0B C;  3BQZ A;  3K2Z A;  1TNS A;  3M4O J;  3TL4 X;  1X1D A;  3GVA A;  1J7K A;  1S6L A;  1ODD A;  2HOE A;  1R1V A;  1E2X A;  3E5U A;  5D5U B;  4CCK A;  3JTG A;  3KIO A;  2RAE A;  4MFE A;  5L3E A;  4BDZ A;  4E7I A;  3TED A;  4FE4 A;  4ESF A;  1CF7 B;  1W36 C;  5J6X A;  5DM6 F;  2EPF A;  5HS9 A;  3B73 A;  3WGI A;  1EH6 A;  1JXS A;  2DMP A;  1X3Z B;  1IN6 A;  3DTK A;  3QWL A;  4A12 A;  2BHZ A;  2OV7 A;  4BJ6 C;  2FE3 A;  1R5I D;  3SFI A;  5K7F A;  4U7D A;  4HDU A;  2CQN A;  3BJ6 A;  3DKY A;  2HDC A;  2LBF A;  3PL8 A;  4ZDO A;  3KX2 A;  4CO8 A;  3GZ5 A;  5F0H A;  1O4X A;  4MTE A;  3ZQI A;  5EGO B;  2EIK H;  2PJP A;  2O0Y A;  4L9T A;  2L02 A;  2O6G E;  2ESN A;  5F0C A;  4RB1 A;  2XAH A;  4HNV A;  1U3E M;  5CVJ A;  2OCC H;  4CYC A;  1SVM A;  1N78 A;  1N77 A;  2K3P A;  1LDK B;  3IH4 A;  5E8I A;  3MKZ A;  2UZK A;  2MSY A;  4RBO A;  3PNY A;  1ENH A;  4D7N A;  3FXU A;  1O3S A;  1TWH J;  4XSX F;  3C18 A;  1FP1 D;  3AAF A;  2STT A;  2EFP A;  4BY1 J;  2PG4 A;  4CUG A;  1P92 A;  1W0U A;  3PJR A;  2VKH A;  4OIQ F;  1XB4 A;  4BEH B;  3AG2 H;  2HNH A;  4Q5S F;  1MKM A;  4J19 A;  1ZGW A;  2ZJP F;  2OC6 A;  2XPU A;  2DA5 A;  4LB6 B;  3P9K A;  1Z67 A;  3SJM A;  3KP2 A;  4ENM A;  2EJR A;  2KP6 A;  4QIW N;  3I64 A;  2VE9 A;  1BIB A;  1QA6 A;  1MSF C;  1TW2 A;  2D5V A;  1IAW A;  1YOV B;  3RJP A;  1XGO A;  1YLF A;  1P9Q C;  2J5P A;  1RR7 A;  1G2H A;  2RGV A;  3W2V A;  1MDM B;  2CUE A;  3M8F A;  2EFN A;  3RSN A;  5E3M A;  3FXJ A;  3R4K A;  2WY8 Q;  1YG2 A;  4KUM A;  1KYW A;  1R5G A;  3M7G A;  1HKT A;  3HRM A;  5D5X B;  2Z9O A;  2ZFU A;  3WTU C;  2E34 A;  3JTH A;  2QF7 A;  2W85 A;  2HVQ A;  5B3S H;  2XAQ A;  3I0T A;  2EZK A;  2ZME C;  4IEJ A;  2KDZ A;  2EQR A;  2DMQ A;  3M1E A;  3NAU A;  3ABL H;  4F92 B;  1IJW C;  1D1C A;  2GIV A;  3VSL A;  2H8R A;  5M3F J;  1VQM I;  2DPU A;  3B6C A;  3GUD A;  3GWZ A;  4RAY A;  4XKB A;  1IG7 A;  1YS7 A;  4IQ4 A;  3G73 A;  2V7F A;  3AL0 B;  4QTR A;  4II2 A;  3S93 A;  4AU7 A;  2QBY A;  1EV7 A;  2CUZ A;  4KN7 X;  5CVU A;  1I5Z A;  3F6V A;  3VYS B;  5FRN A;  3PQK A;  5HOD A;  1FYL A;  3TO7 A;  4PJ0 C;  1ULY A;  4N9I A;  5FKM A;  2KIQ A;  2XRN A;  2BOL A;  1HW2 A;  2Q2E B;  1BI2 A;  1MBG A;  3G6E I;  1SAN A;  2E5N A;  3LAP A;  3MZH A;  3PNT A;  3L2Q A;  1WGX A;  3GBG A;  2F4O B;  2XRL A;  2LY1 A;  2VBY A;  5JLW A;  3GFI A;  3IP4 B;  4OMZ A;  2WAE A;  2ZSH B;  1YX5 A;  1PP8 F;  3FK7 A;  1WSU A;  4C30 A;  5IYB J;  4BH9 A;  1JKO C;  3FXO A;  3GF2 A;  1U6G A;  3OYL A;  4M6Y A;  4HDV A;  1V3F A;  2DQR A;  3CCV I;  5GTH C;  1HXD A;  1O7L A;  2DYS H;  4QWQ A;  2A61 A;  1U5T C;  2HOS A;  1NG7 A;  5E17 F;  3BG9 A;  1TZL A;  5FD6 A;  3P9C A;  1QZZ A;  1FT9 A;  3GTO J;  3CCU I;  4OIO F;  2E71 A;  2CQ7 A;  5FKK A;  4M6V A;  1OJL A;  4HNT A;  3OV8 A;  4XKV A;  4E6K G;  1HA8 A;  5F0F A;  3PIP F;  4L18 B;  2MH9 A;  2DI3 A;  2LC2 A;  5C4X J;  4I01 A;  2V1N A;  3CD6 I;  2K9S A;  4XLE A;  3PUB A;  1FSE A;  4KIT B;  3R60 A;  2M87 A;  1R4N B;  4GCV A;  1I3A A;  4CGZ A;  3P5J A;  4KA4 A;  1T6S A;  1RIO H;  2VJI A;  3BT9 A;  3S2W A;  4BHB A;  4ZYG A;  5K7H A;  4A6E A;  2O9L A;  3E6D A;  2CUF A;  3WGG A;  1J5Y A;  3HPH A;  2O03 A;  4Q48 A;  4ZZD A;  4WX9 A;  2IT0 A;  1IW7 F;  3NAR A;  2VT2 A;  5DYM A;  1Z7L A;  2KMU A;  4I76 A;  3S1Q J;  1DPU A;  1JJ8 C;  2KRH A;  5ERI A;  4BS9 A;  1CQT A;  1YS6 A;  1XX5 A;  5KNL A;  3A4C A;  4YFX F;  1SVO A;  1HKS A;  4A93 J;  2DLL A;  2V6E A;  1Z3Y A;  2EB7 A;  3BTJ A;  1GV5 A;  1OCO H;  1VQ8 I;  4GFB A;  5D5V B;  2IS4 A;  1XSX A;  3ZQH A;  1H8A C;  2L2O A;  2LRE A;  3PIO F;  1LEB A;  4XKW A;  1VQ6 I;  2XPW A;  1RR8 C;  4NC6 A;  2VQL A;  5HS7 A;  1BR4 A;  3WG7 H;  2H6B A;  1KON A;  3BPV A;  3VDX A;  4RLQ A;  3GTJ J;  2WWY A;  4FT8 A;  3I4P A;  2WAF A;  4RB3 C;  2PX9 A;  5AON A;  4S04 A;  1IXC A;  3PSF A;  1H88 C;  1YW7 A;  3BZK A;  1FYK A;  2PI0 A;  2VJ5 A;  4BE0 A;  1KGS A;  3OYC A;  5FLV A;  4A3G J;  1A6I A;  4LMY A;  3KP3 A;  1AKH A;  3OYK A;  1MGT A;  1TQM A;  3L2U A;  3BQY A;  1H89 C;  2W1O A;  3A0H C;  1FP2 A;  4F93 B;  1XCB A;  3UNG C;  1D5Y A;  3L2W A;  4KMF A;  4DBR A;  2LKS A;  2KZV A;  1WJB A;  5EDN A;  2H6C A;  5LHH A;  4XN3 A;  1ERD A;  2EIL H;  4WXC A;  2VBW A;  2CW8 A;  2WAQ A;  2Q1Z B;  3RIR A;  3E3V A;  3S1N J;  1VND A;  3ROU A;  4ETS A;  3GTK J;  4NNJ A;  1F9N A;  1F5T A;  1UMQ A;  2B9S A;  4IZZ A;  2FOW A;  1MBF A;  4DOZ A;  4I7H A;  4ZYE A;  1RKW A;  1ZHF A;  2L3D A;  1J09 A;  2ECB A;  2X6W A;  2ZNZ A;  3T8R A;  4Y52 J;  1BI0 A;  3ZR8 X;  1P4X A;  2BXY A;  2HYJ A;  2EWN A;  2LK2 A;  3NWT A;  4P9F A;  4RB0 A;  1QZE A;  1S7O A;  4CZZ A;  6PAX A;  2BHY A;  2ELK A;  2MLK A;  2QSF X;  1SD7 A;  2GWR A;  3Q0U A;  3PFY A;  2HPI A;  5CJ9 A;  2OQR A;  2JUC A;  2PQ8 A;  2W82 A;  1R58 A;  3WE3 A;  5JHF A;  3CJN A;  2A5Y B;  5L3B A;  2DFF A;  3HOT A;  1SFU A;  4IHW A;  3L7W A;  3X2Q H;  1S3J A;  3FXR A;  4E7Z A;  1QVU A;  2LKX A;  1HDD C;  1Z6T A;  3FDY A;  1MZB A;  3H5R A;  5J47 A;  3PQJ A;  1TL8 A;  3P9I A;  3HOX J;  2CWE A;  2QKM B;  3AG4 H;  2O61 A;  1U5T A;  4UXN A;  1I1S A;  4JX6 A;  2CFX A;  2R7O A;  3VOE A;  1ZAO A;  3IC7 A;  2A6E F;  1MSE C;  1O7F A;  4JK1 X;  1QHG A;  2ZSI B;  2NVU B;  1GVD A;  4CXF A;  4XBF A;  3L2R A;  2QSG X;  5E18 F;  1PUE E;  1HSJ A;  1T33 A;  2VKD A;  2JZY A;  1MMN A;  4NUB A;  2MC4 A;  3HXL A;  4BQO A;  4BGD A;  3RPU D;  4BUP A;  2CQX A;  1JKQ C;  3U9G A;  5J1U A;  1TWC J;  2DA6 A;  5H2F C;  2EFQ A;  2LY9 A;  5IYC J;  3HG9 A;  3OYG A;  1XGN A;  3RKY A;  1K78 B;  2MA3 A;  1VQL I;  2DTZ A;  3FKJ A;  5F1J A;  1QNT A;  1FIP A;  3DTE A;  4CCN A;  1D1A A;  5LGT A;  4HAM A;  1J59 A;  2M9H A;  5FB2 A;  1YX3 A;  4B43 A;  1J2X A;  2I5U A;  1LQ1 A;  3OYM A;  4IHY A;  1S7A A;  3GX4 X;  1XMX A;  1XGS A;  1R23 A;  4AWX B;  3S17 J;  4L5J A;  3TGN A;  1XS9 A;  2JMW A;  2K5C A;  1KQ9 A;  4B3A A;  2PN6 A;  2AS5 F;  4L0Z B;  2OQG A;  3TKY A;  3DU6 A;  5FO5 A;  4BXX J;  4WF2 A;  3ESW B;  3CUQ C;  5D8L B;  5AIQ A;  4IHT A;  2MGQ A;  2DN0 A;  4HG2 A;  4U7B A;  1ETX A;  1X4O A;  2VQG A;  1UZC A;  2R5Y B;  1YO5 C;  2WV0 A;  2DFH A;  2LFB A;  4EGZ A;  1FIA A;  2W84 A;  4LOC A;  5FGM A;  4A3C J;  1GVJ A;  2VL8 A;  3FXL A;  2CQQ A;  2RQQ A;  2XF5 A;  1NHA A;  3DP7 A;  3S3M A;  5ICE A;  1GXP A;  2IA2 A;  4AC0 A;  4G7Z F;  3K70 D;  1TT5 B;  5BQT A;  4A3E J;  2A3S A;  3WTZ A;  4MFD A;  1FYM A;  4MEY F;  4AYB N;  3MKY B;  1I1G A;  3E6B A;  1R49 A;  3IKV A;  2R0Q C;  2FXA A;  1QPI A;  5EG0 A;  5JI6 A;  1X1C A;  1WJD A;  2JA7 J;  2PFB A;  3HTU A;  2RQP A;  1R71 A;  1Q1V A;  1MIJ A;  2XKO A;  3O8H A;  2XF7 A;  4XLF A;  4Q47 A;  3K69 A;  2A69 F;  3ZMS A;  3SDB A;  1SMT A;  4G7H F;  2DBB A;  5LRR A;  4Y13 A;  2KT0 A;  2FBH A;  4EM0 B;  1XDS A;  2G7U A;  3C3W A;  1YJN I;  4A6D A;  5FLX K;  3OL4 A;  3OL3 A;  1DUX C;  4O6J A;  3ZN1 A;  2DA7 A;  2L9S A;  1A36 A;  2R7D A;  4LIT A;  1TQI A;  4O3M A;  3LA2 A;  3O8G A;  4BQQ A;  3W6V A;  3DKX A;  2P5K A;  1V55 H;  2XSJ C;  3CMA I;  3FBI B;  4GRI A;  2VLA A;  2DDA A;  4UUS B;  5BMZ A;  3IWF A;  1MBH A;  2Y2Z A;  1ON2 A;  4B4C A;  2WTE A;  5LEK A;  2COB A;  2GXA A;  4L5E A;  1FMV A;  3FBN B;  4PCQ A;  1LPQ A;  2PMZ N;  5DM7 F;  1ZG3 A;  4MNU A;  2L0K A;  1SFX A;  5BNG A;  3MFK A;  3J81 Z;  3DLL F;  2R7X A;  1WZ2 A;  3F8N A;  4ZYH A;  1UCR A;  4HPQ A;  2L7K A;  1I50 J;  4M3D A;  3JAM Z;  3FZV A;  4D5C A;  2JRM A;  5JHU A;  3JRG A;  1FNN A;  2ICW G;  3H3Z A;  2OU2 A;  2R7R A;  4KDP A;  2PJR B;  2H09 A;  2DMT A;  2OPT A;  1SEU A;  1E3O C;  4J01 A;  2ESH A;  5ICG A;  4BHP A;  1PVE A;  1IGN A;  4PZJ A;  3RI4 A;  3RPQ A;  3HZJ A;  3LNQ A;  3QOD A;  4A0X A;  3BJA A;  4BE2 A;  3HYI A;  5GPC A;  4DNC A;  2M1B A;  3E97 A;  3OS0 A;  2WY7 Q;  2LY2 A;  4M9X A;  3OYE A;  1YRN B;  4XLP F;  4BU2 A;  3IKT A;  3C2B A;  2JK3 A;  4LIV A;  3GYH X;  1B59 A;  1B6A A;  1S29 A;  3BY6 A;  3DF8 A;  2J5O A;  1R9T J;  2M30 A;  4NC8 A;  2HTJ A;  1OCR H;  3ABK H;  2XB0 X;  4IRH A;  2L01 A;  3K4L A;  5BS6 A;  5J1R A;  4DBQ A;  2LDU A;  1FTT A;  1JGS A;  3MKW B;  2Y0S N;  3TW6 A;  4BQA A;  2N8G A;  3FMS A;  1B8I A;  3HRS A;  5AIP A;  4RGX A;  3ABT A;  3J81 K;  3D5L A;  3VYU B;  1UHS A;  3BPX A;  2WV1 A;  4IXA A;  1FSH A;  4W1U A;  1SFE A;  2DMU A;  1QHH D;  1OIS A;  3F72 A;  1BI3 A;  4OOI A;  2R7W A;  2WC2 A;  3WTS C;  3JAM K;  2P0W A;  1KYZ A;  3N4M A;  5DUK A;  2YU3 A;  2BBY A;  2LG4 A;  4BBR J;  4I2O A;  2P7C B;  3GCM A;  1Z0X A;  4XLH A;  5DCM B;  1ORK A;  4ASN A;  4AIK A;  2FJ1 A;  3CCM I;  4H4K C;  1QPM A;  5KAI C;  2DMN A;  2R7V A;  1KQ8 A;  3PNV A;  2W25 A;  3QOE A;  2E1M B;  3HB9 A;  3CMM A;  1FOW A;  2BY0 A;  1QRY A;  5EEH A;  3CCL I;  4HST A;  3K0L A;  4PFP A;  2WAD A;  1WVR A;  3OYJ A;  1XGM A;  2M5W A;  5CQE A;  1JGG A;  1EJ9 A;  5CYV A;  1TW3 A;  3LMM A;  4UB6 C;  5H6R A;  4B8X A;  5M5X J;  4G6Q A;  5E20 A;  2EV6 A;  1QVT A;  4CCO A;  1KU2 A;  3SZT A;  2VB6 A;  4AVZ A;  2CRG A;  3FMQ A;  2MH2 A;  3CUQ A;  4EEF G;  3GTQ J;  4EJO A;  3IAM 2;  4ESJ A;  5BPI A;  2P7V B;  4IQJ A;  3WTY C;  4EGY A;  2O8K A;  2M34 A;  5KHD A;  3ECO A;  2LVS A;  3M8E A;  1Z9C A;  4F91 B;  1D5V A;  3CJQ B;  2NRA C;  2VKV A;  2BW3 B;  2X4H A;  4Q4Z F;  1YJ9 I;  1T0F C;  1QO0 D;  3O2P E;  2ZBK A;  1J9I A;  2RDP A;  2EV0 A;  2YS9 A;  3AG3 H;  3BWG A;  3COA C;  4A3K J;  3C2H A;  3KFW X;  4RMN A;  3FHN A;  4ITV A;  2LKP A;  2FA5 A;  2V4J C;  2VQH A;  1KZH A;  2Y30 A;  1HBX G;  3F8M A;  4G8X A;  4DZJ A;  4HQE A;  2R7Z J;  2FF4 A;  1OCP A;  3K4J A;  3LSJ A;  2GOM A;  1V5E A;  1M1E B;  3F6O A;  3CJT B;  1MND A;  1YQA A;  2CG4 A;  3GW2 A;  5FFZ A;  1WRJ A;  2Y9Y A;  4IJA A;  5ILV A;  2MG4 A;  3K1M A;  1K61 A;  2E35 A;  1DU0 A;  3D5S C;  2BY1 A;  4KNY A;  3D0S A;  2VQC A;  2OUM A;  2JWT A;  5DUI A;  2JVG A;  5D8K B;  4BL0 B;  4P96 A;  2DJI A;  1FOY A;  4ZTF A;  4NHJ A;  5ILS A;  1MNE A;  3WTT C;  5D6F A;  2LNB A;  4A3J J;  5E3O A;  2QWW A;  2P81 A;  1OLT A;  2FBI A;  5CVV A;  1F4K A;  2I10 A;  2FMY A;  3TO9 A;  2JA6 J;  3HOV J;  2Z99 A;  1Z91 A;  3L2C A;  1NK3 P;  1IUF A;  1BR1 A;  5K7Z A;  2YR2 A;  5D6E A;  1FOK A;  2VE8 A;  3MZY A;  2Q8K A;  1LVK A;  2NNY A;  3CCQ I;  2QQ9 A;  1IN5 A;  4TV7 A;  4E7K A;  1USS A;  2GA1 A;  2VIX A;  2HDW A;  3HL2 A;  1OKR A;  2AQE A;  3BCB A;  2CW7 A;  5GAE J;  1D0Z A;  2L54 A;  3I54 A;  1YIJ I;  2STW A;  1YI2 I;  1PP7 U;  3GTL J;  2FOK A;  4NB5 A;  3SDG A;  1TQP A;  2CH0 A;  2NYX A;  1WWX A;  4PSW A;  2OAZ A;  1MJA A;  2Y31 A;  1AA7 A;  2XIG A;  1SD6 A;  3BC8 A;  5K5O A;  2OCE A;  3VEP A;  5JVT A;  5F04 A;  5IP6 A;  1PUF A;  2ACJ A;  3FXQ A;  2JA5 J;  3RPU A;  3CDI A;  5TJJ A;  3BR5 A;  1YYV A;  1B9M A;  2AQF A;  3ZGK A;  1I39 A;  2M2E A;  5C4J J;  1HQC A;  3RDI A;  4ZTJ A;  3HBL A;  4HLX A;  4UVA A;  5TIS C;  3WU0 A;  3Q5F A;  5LHI A;  3F22 A;  2ZME B;  3ZMD A;  1A04 A;  2YUS A;  1F36 A;  2CW0 F;  3CP2 A;  4A69 C;  4PDK A;  2EK5 A;  3QQA A;  1MW7 A;  3ZP5 A;  3ZMU A;  2VXZ A;  4HV6 A;  2IGO A;  3LA3 A;  3OYD A;  4IKF A;  3G2B A;  4XRS G;  2XAF A;  2F4I A;  1FTZ A;  1D3Y A;  3OR2 C;  3A01 A;  3TP3 A;  4I98 B;  2TRT A;  2X9D A;  3H3V K;  2PMH A;  2WB1 N;  3H5A A;  4DQ2 A;  2YX4 A;  3MKL A;  3QPS A;  4XOP A;  1HF0 A;  4ZDL A;  2KPM A;  1S8N A;  4D7M A;  3IL2 A;  4PJJ A;  1V4R A;  1VI0 A;  3IH2 A;  4RA2 A;  3SQN A;  1XN7 A;  3QP6 A;  3OYA A;  4WCG A;  1O3Q A;  4M72 A;  3QYF A;  4ENN A;  4WXD A;  4Y3O A;  1XTA A;  1WI3 A;  2EV5 A;  3F8C A;  2EFO A;  3BR1 A;  1FWZ A;  1TNT A;  5JR3 A;  4DJA A;  5M3M J;  2ZJ2 A;  3W6K B;  2FML A;  1K4S A;  1FX7 A;  5HLG A;  4GDF A;  1LDJ A;  1UHW A;  2VJ4 A;  2ZXJ A;  3U1K A;  1A35 A;  3HRT A;  1HOM A;  2ZFW A;  1W5T A;  3KYD B;  2DAO A;  1WH5 A;  2B7E A;  2P5V A;  2NS0 A;  3JW4 A;  5JFR A;  1VQ5 I;  1TWG J;  4IRI A;  5LEJ A;  5L3G A;  1U5T B;  1RUO A;  3T8T A;  2HS5 A;  4HSR A;  1S9H A;  2VKE A;  4GYG A;  3NEU A;  5CPR B;  2R92 J;  1Y0N A;  2E7X A;  3JRE A;  1B1B A;  1BW6 A;  3F3X A;  3R61 A;  4P1W A;  2KIM A;  2CV0 A;  2R7F A;  2QVO A;  5D4S A;  1TLH B;  3MVP A;  4F3Q A;  4A3I J;  3HUG B;  2E2J J;  2ZXH A;  3HPG A;  1ETO A;  2W48 A;  3CZ6 A;  4FX0 A;  3DU5 A;  5BPD A;  2HPM A;  1XSV A;  3K4K A;  4LGW A;  1T0F A;  3CCS I;  3AL0 C;  2DA4 A;  4P55 A;  5LRS A;  1YW9 A;  2E1O A;  3FIS A;  1B72 B;  2O5R A;  3HOU J;  3HGG A;  4N0B A;  2ECC A;  2EBI A;  1T2K A;  1DGW Y;  1BOA A;  4L9N A;  2EZL A;  2CSO A;  2H1L A;  2YPR A;  3OSG A;  2OZU A;  2M8G X;  2M7A A;  2LYC A;  2LH9 A;  2QQB A;  3MD2 A;  2ISY A;  4LD5 A;  2XUB A;  2M7B A;  2DT7 B;  4DYC A;  3N05 A;  3PFI A;  3G1O A;  3S3N A;  1G59 A;  1LE8 B;  2VON A;  3DKW A;  1P2F A;  3E0J B;  3QPH A;  3CF5 F;  4QSH A;  3TDZ C;  5LLQ A;  3GEZ A;  3DPT A;  1ZAR A;  3J80 Z;  1P7I A;  2QQA A;  3BG7 A;  5CVI A;  3D1N I;  2K9N A;  1MJB A;  1GT0 C;  3ZMZ A;  1BJZ A;  3JRI A;  2GLO A;  2CYY A;  3GTP J;  3WU1 B;  2R5Z A;  1KU3 A;  3HOZ J;  1IDY A;  2KKO A;  3I3L A;  3CC2 I;  1BIA A;  4HA8 A;  3I5U A;  4QLC U;  1VQ9 I;  3HOY J;  2A5W A;  2KRC A;  3OSF A;  1BC8 C;  3V7R A;  3DQV C;  3VFZ A;  4LLL A;  1CF7 A;  1ZRE A;  3K7A J;  3F9K A;  4E70 A;  4W97 A;  4Z2Y A;  4AVP A;  4FCY A;  4R1H A;  3BDD A;  1IO2 A;  2ZO4 A;  4CCM A;  3QAH A;  2VOD A;  1MMD A;  3KP7 A;  1ZRD A;  3HM5 A;  3PO3 J;  2UXN A;  2KIF A;  3E1S A;  2ELJ A;  5HDN A;  2CU7 A;  5J40 A;  3BLY A;  2NNN A;  3FF5 A;  4RAZ A;  1N75 A;  1LUJ B;  2M4K A;  3SEZ A;  5EGO A;  4D9J A;  1BA5 A;  1R4M B;  4NQW B;  2E1C A;  3V8K A;  3U1D A;  3HSF A;  5LGU A;  2A6H F;  3TOA A;  1C0W A;  4EJW A;  3ERM A;  2CV2 A;  3CC7 I;  3H35 A;  4G6T B;  4A0Z A;  1Y0U A;  1W7P D;  5DDG A;  3LA7 A;  1J0R A;  5HDG A;  3J80 K;  1ZK8 A;  3QYE A;  4XMY A;  3Q9S A;  3MWM A;  3HJE A;  3SXY A;  1W5S A;  2RV8 A;  1E3H A;  2HQA A;  4AIJ A;  2UWM A;  2DA1 A;  4I99 C;  5L3C A;  3LSR A;  1QU3 A;  3S15 J;  1B9N A;  1OCC H;  2V6C A;  3DXJ F;  3CUO A;  3LSG A;  4M3F A;  2VUM J;  3V8J A;  1ZR4 A;  1SAU A;  4BAY A;  5JVG F;  3M8J A;  2BEO A;  4IOA F;  1AWC A;  5E79 C;  5D4R A;  5JLX A;  4BEH A;  4E4H A;  4IHX A;  1WJ5 A;  2X51 A;  4P5O A;  2XRO A;  5J1Y A;  2O3F A;  3KET A;  3FM5 A;  2EA2 A;  3IRR A;  3JRB A;  2FUG 2;  2LF8 A;  4LG3 A;  3KEO A;  3CC4 I;  2DQL A;  3DPL C;  3A2K A;  3S8P A;  2DK5 A;  4N4O B;  2AO9 A;  4M74 A;  5F27 A;  3DV8 A;  4LLN A;  2E1N A;  4EM2 A;  4JYK A;  3CP8 A;  3V42 A;  4OIR F;  1PDN C;  1V5F A;  1VF9 A;  2LF7 A;  1ZG1 A;  3E6C C;  1P4W A;  3CDH A;  1LVA A;  3K4B A;  4EMS A;  1Y1W J;  1ZGA A;  4NC7 A;  2ZKZ A;  2L7F P;  2W57 A;  3FKI J;  1R5H A;  1IN7 A;  1X58 A;  4HEA 2;  5FRO A;  2MD0 A;  1IN4 A;  4FHT A;  3K9T A;  1XG1 A;  4XN0 A;  1Y6I A;  5EEG A;  2M0M A;  2GZW A;  2O7O A;  2F5D A;  1HKQ A;  3K1N A;  2VBX A;  4KIF A;  3ZQG A;  5M5W J;  1P4A A;  1K4T A;  2FX0 A;  3DFG A;  1L3L A;  3HEF A;  4B09 A;  4EAT A;  1WFX A;  4CCJ A;  3HGY A;  2FQ3 A;  4E7H A;  3I59 B;  4DZP A;  3I53 A;  3HKZ N;  3J7A O;  1IRZ A;  1SFO J;  3J7Y J;  2W00 A;  1SMY F;  2XAG A;  3GLL A;  1FZP B;  4PJN A;  4YFK F;  4PK4 A;  3S1R J;  1ZGJ A;  2K7L A;  1VTN C;  4HBL A;  4MHG A;  5B1A H;  1NG6 A;  3C7J A;  2LSO A;  4KT5 C;  3OIO A;  4MO7 A;  1Y8Q B;  1WH7 A;  1WQ2 A;  4OIP F;  3MZ8 A;  1HLV A;  2ZC2 A;  1FC3 A;  1WJC A;  5J3L A;  3K4C A;  1W7P B;  4JOM A;  4UV9 A;  3JRC A;  5CQG A;  1JUM A;  2DFI A;  2FRH A;  3ZXS A;  2Q2E A;  2R7T A;  5LGN A;  1SAX A;  3GO5 A;  4LJZ F;  1TWA J;  1YIO A;  3FWE A;  4KIC A;  4OU0 A;  4FIS A;  4ESB A;  1YFH A;  3H0D A;  3BCA A;  3WHB A;  3RYP A;  3BZ6 A;  2BGC A;  1X4P A;  2COM A;  2W7N A;  2MD5 A;  3KEY A;  5DCF A;  3LFU A;  4UNO A;  2L9V A;  2JA2 A;  5FJ8 J;  3OYN A;  1JT0 A;  4BKX A;  1FJL A;  2QLZ A;  2A07 F;  2HQ5 A;  4LG0 B;  4C2T A;  3NQO A;  1E3P A;  5CVR A;  3BR3 A;  1TC3 C;  2Y48 A;  2L4M A;  3NRV A;  2X6Y A;  3CME I;  2IPQ X;  1FBS A;  4YII A;  2V26 A;  1XCV A;  4X1E A;  1XMK A;  3GLX A;  3OMY A;  4RS8 A;  2D2W A;  1BN5 A;  4HW0 A;  5TRD A;  4X6A J;  4AYB A;  1R00 A;  3LWF A;  3PM1 A;  4HX8 A;  2DYR H;  2HR3 A;  2V1U A;  2IGN A;  4BY7 J;  5EEA A;  2HKO A;  4CA0 A;  5B66 C;  1UHM A;  2DT5 A;  2VJJ A;  3JRH A;  3KZI C;  3S32 A;  1MMA A;  4L5I A;  2F2E A;  4BHC A;  3ABM H;  4BYY A;  4XSZ F;  1H9G A;  2EIJ H;  2GOX B;  4PFO A;  2ME6 A;  2LBF B;  4C3I J;  1HCR A;  5A2Q Z;  2EFW A;  3OYB A;  3KLN A;  4BNC A;  1Z6R A;  3W3C A;  4XK4 A;  2JSC A;  1SD4 A;  3R0A A;  2CS3 A;  4ZYA A;  3FHZ A;  1ETY A;  1ITY A;  4MQ9 F;  2LMD A;  3BTL A;  1REP C;  2CGP A;  4CYC B;  3MMY B;  1EF4 A;  1S5L C;  2ETH A;  4OWR B;  2KIS A;  3DBR B;  4H0E A;  3FMR A;  2XAJ A;  2TDX A;  2R93 J;  1OFC X;  3RYR A;  2F5V A;  4Y17 A;  4MIM A;  1U2W A;  3ABU A;  4RGU A;  4FTH A;  2DXI A;  2K4B A;  1D0Y A;  1WI9 A;  1ACI A;  1GHC A;  4OAZ A;  2AXL A;  1YE9 A;  4F7Z A;  1ETK A;  5KK1 A;  2PMZ A;  5HOO A;  1ZTR A;  1PJR A;  4ZDP A;  2E2H J;  1YW8 A;  4HZF A;  3TMO A;  2KFD A;  3TW7 A;  4DYR A;  2K02 A;  2BY2 A;  2NS8 A;  3BRO A;  4F52 A;  2JT1 A;  4XL9 A;  1X19 A;  4BXF A;  1F1Z A;  1JKP C;  2P4W A;  1LEA A;  2VXD A;  1VQP I;  1R6R A;  3S16 J;  1JHF A;  3I4N J;  3H36 A;  3EUA A;  3VOD A;  1VQO I;  3OS2 A;  5A2Q K;  2ZCW A;  1UJ8 A;  2V1X A;  4LK0 F;  4UUV A;  3R6S A;  3ONQ A;  4EJV A;  3H92 A;  2CJJ A;  2R7Q A;  4A2U A;  2B63 J;  3Q0V A;  1MBE A;  5DD8 A;  4FAS D;  3M9A A;  4AIH A;  4KYW A;  5J8C A;  4KN4 X;  4V19 K;  3M07 A;  3OOP A;  3UR3 C;  4J00 A;  3MN2 A;  2VPL A;  1GDT A;  3JR9 A;  2M45 A;  4M3G A;  4K2E A;  1GXQ A;  2HEO A;  2HI3 A;  2UXX A;  5B5E C;  5ICC A;  3OWT A;  2P5L C;  2Y0S A;  3WTX C;  2QEX I;  3F21 A;  4PJL A;  1B4A A;  1X3U A;  3IUO A;  2ID3 A;  2VC1 A;  3QYB A;  4A5N A;  4YEL A;  1LFP A;  2DOE A;  3A01 B;  2K27 A;  4BDY A;  4XOT A;  1IRX A;  3W2A A;  3G1L A;  1ZH5 A;  2V9K A;  3GFM A;  5C44 J;  2JRT A;  1ZLJ A;  3FIW A;  4A3L J;  3L1P A;  5DS9 A;  5KCM A;  3BTC A;  1ZR2 A;  3EET A;  3MAJ A;  2IBD A;  5E1X A;  3RZD J;  2IP2 A;  4U87 A;  1MH4 A;  1ZG5 A;  5J4V A;  4MGR A;  3L09 A;  2JVH A;  5KVR A;  1G4D A;  2QBY B;  4FE7 A;  5IY5 H;  2HXI A;  3FK6 A;  2QEN A;  3G71 I;  2KDO A;  4ENK A;  2VI6 A;  1JHH A;  5M5Y J;  2KL4 A;  1H0M A;  4FET A;  2PLY A;  1QZY A;  3EQL F;  4KJZ A;  2L9R A;  5FFX A;  5L3F A;  1P6R A;  5ED4 A;  4I0B A;  2YU9 J;  3RTR A;  4E7J A;  4N9H A;  2EA4 A;  2E7W A;  2W4S A;  3JCU C;  2XKP A;  3K70 C;  3CJR B;  2HKX A;  4F55 A;  2Z1D A;  1KU7 A;  2NVT J;  2DOF A;  2NXN B;  4XQF A;  2EZI A;  2ZXI A;  4RGR A;  1VFC A;  3H9G A;  2JQ7 A;  1E0E A;  2H27 A;  1T08 B;  4MQV A;  3EYI A;  3CLQ A;  3DPU A;  1QQI A;  3GZN B;  1I3Q J;  3K1P A;  3LSI A;  4D1Q A;  1R36 A;  5K5R A;  4NDL A;  1Y39 A;  2EZH A;  4BJT A;  4PGH A;  1UST A;  4LK1 F;  3KE2 A;  5FKO A;  1SVL A;  4RDU A;  2XAS A;  3CCY A;  3EDP A;  1D1B A;  1K78 A;  1BOB A;  5CKT A;  1RRJ A;  1R1T A;  3KYL A;  3WE2 A;  1Z1D A;  5IOY A;  1D8K A;  3ERE D;  3LSM A;  1BBY A;  2E1M C;  4XM3 A;  3BG5 A;  2QSH X;  4A5M A;  3ZQQ A;  2MFZ A;  3OY9 A;  1HC8 A;  1TT0 A;  3E5Q A;  2HQR A;  1IUY A;  1R1U A;  3I55 I;  2V9V A;  3Q0W A;  2BVL A;  4RAG A;  2IXS A;  4E7L A;  4XRF A;  2Z16 A;  4WK8 F;  3VB2 A;  2RN7 A;  2P6S A;  2FU4 A;  3LL7 A;  3ZQ7 A;  2NS7 A;  3GZ6 A;  3Q3S A;  1HDP A;  5E1Z B;  5HVQ C;  2RVC A;  3ZRG A;  3IWZ A;  5FLM J;  2R5Y A;  1W4M A;  2R4G A;  2E5Z A;  3JRF A;  4ABZ A;  2LD5 A;  1NK2 P;  4CYD A;  2L7Z A;  2OJE D;  2K40 A;  2QQ8 A;  1K7A A;  3ZN0 A;  4II3 A;  1CGP A;  3KPH A;  1WKM A;  3ZOB A;  3O6B B;  3SZG A;  3NWS A;  1OMI A;  2DU9 A;  2GBY A;  3HIF A;  1G6N A; 
#chains in the Genus database with same CATH homology
 2M8G X;  9ANT A;  3ZQL A;  1TWF J;  2HDD A;  3K2A A;  2XGE A;  4I6Z A;  4IHW A;  4C3H J;  2LKX A;  1QVU A;  3BR0 A;  4DYC A;  1HDD C;  1AHD P;  3BR2 A;  3G1O A;  1LE8 B;  3HOX J;  4QSH A;  3S2H J;  1RET A;  4JX6 A;  1P7I A;  3D1N I;  3RQI A;  1JTY A;  2K9N A;  5EF6 A;  1W0T A;  1MSE C;  1GT0 C;  1GVD A;  1WCM J;  4MLO A;  3DCF A;  1BJZ A;  2L7M P;  3JRI A;  2GLO A;  3GTP J;  4BBS J;  2R5Z A;  1T33 A;  4AUX A;  3HOZ J;  1IDY A;  3H0G J;  3JRD A;  1AKH B;  1ETQ A;  2E19 A;  3HOY J;  3OSF A;  2CQX A;  4D5F A;  1JKQ C;  5J1U A;  3K7A J;  1TWC J;  4UUS A;  2DA6 A;  5IYC J;  4W97 A;  2LY9 A;  4FCY A;  3GTM J;  1MBJ A;  1ZKG A;  4V2G A;  1DU6 A;  2DTZ A;  5F1J A;  1FIP A;  1XC5 A;  3HM5 A;  1MBK A;  2NVY J;  3ZQF A;  4V2F A;  3PO3 J;  5E3L A;  3F0C A;  1JJ6 C;  2CU7 A;  2M9H A;  4Y7N J;  1APL C;  2IEK A;  3S14 J;  5EGO A;  1BA5 A;  3CMY A;  2DJN A;  1U78 A;  3S2D J;  4IHY A;  1K83 J;  4M3B A;  3S17 J;  1ETW A;  1XS9 A;  2JMW A;  3IH3 A;  2JJ7 A;  4B3A A;  2ME0 A;  2NVQ J;  5EZH A;  1A5J A;  5GP9 A;  4BXX J;  1ZK8 A;  2QCO A;  2MGQ A;  3CDL A;  2DN0 A;  1ETX A;  2TCT A;  3B6A A;  2R5Y B;  2DA1 A;  3A02 A;  3LSR A;  2G0E A;  1YRN A;  3S15 J;  5DTD A;  2LFB A;  2ZB9 A;  1FIA A;  4A3D J;  3LSG A;  4LOC A;  4M3F A;  2VUM J;  1ZR4 A;  4A3C J;  2XGC A;  2CQQ A;  2X6O A;  1POG A;  3PO2 J;  4AC0 A;  4A3E J;  5JLX A;  4IHX A;  4MFD A;  5J1Y A;  3JRB A;  4AYB N;  4IHV A;  1QPI A;  2FQ4 A;  2R0Q C;  2AHQ A;  1NTC A;  2M0C A;  5EG0 A;  2JA7 J;  2ID6 A;  2AO9 A;  1Q1V A;  5F27 A;  3I4M J;  3O8H A;  4JYK A;  3G1M A;  4XRM A;  1VF9 A;  5FKN A;  2KT0 A;  4C3J J;  3ZQC A;  1Y1W J;  4JX4 A;  2HOT A;  4A3B J;  2L7F P;  3FKI J;  1X58 A;  2VPR A;  2R5Z B;  2DA7 A;  1JTX A;  1XG1 A;  3BQZ A;  2O7O A;  3M4O J;  1U9O A;  3ZQG A;  5M5W J;  1RKT A;  2RAE A;  3O8G A;  2FX0 A;  4MFE A;  3W6V A;  3TED A;  3HEF A;  4FE4 A;  4UUT A;  1JUP A;  4UUS B;  1MBH A;  2DMP A;  2Y2Z A;  3HGY A;  5E3N A;  4B4C A;  2COB A;  4DZP A;  4L5E A;  3SFI A;  5K7F A;  3HKZ N;  1IRZ A;  1SFO J;  2PMZ N;  3A03 A;  2L0K A;  5BNG A;  1MNM C;  2LR8 A;  1O4X A;  5F0H A;  3ZQI A;  5EGO B;  3S1R J;  3RZO J;  2XSD C;  1I50 J;  4M3D A;  3OIO A;  4MO7 A;  1WH7 A;  5F0C A;  1JUS A;  3VPR A;  4D5C A;  3BG3 A;  3JRG A;  4HNV A;  1HLV A;  1X2M A;  2JN6 A;  4M3E A;  2OPT A;  2DMT A;  1E3O C;  4CYC A;  1IGN A;  3JRA A;  3RKQ A;  3IH4 A;  5J3L A;  3LNQ A;  2MSY A;  3JRC A;  4RBO A;  1ENH A;  1JUM A;  2DA3 A;  5GPC A;  4XIC A;  4C2M J;  4D7N A;  5IP7 J;  1TWH J;  1YRN B;  3C2B A;  2XGD A;  2JK3 A;  1TWA J;  4FIS A;  4BY1 J;  1R9T J;  3HOW J;  3WHB A;  1W0U A;  1GUU A;  2XB0 X;  5J1R A;  4J19 A;  1ZGW A;  1FTT A;  4S0H B;  2H1K A;  2Y0S N;  3TW6 A;  2N8G A;  1JT0 A;  2XPU A;  2DA5 A;  5FJ8 J;  4BKX A;  5EG0 B;  1FJL A;  2HQ5 A;  1B8I A;  3SJM A;  4QIW N;  1UHS A;  2WV1 A;  1BW5 A;  4W1U A;  2DMU A;  2XPV A;  3BR3 A;  1MSF C;  1TC3 C;  2E2I J;  2D5V A;  3UKG A;  1ETV A;  4X1E A;  1G2H A;  1RR7 A;  4BBR J;  1F43 A;  1Z0X A;  1ORK A;  2CUE A;  2FJ1 A;  2NOG A;  2DMN A;  4X6A J;  5E3M A;  3PM1 A;  3HB9 A;  1LFB A;  1I6H J;  4BY7 J;  1QRY A;  5EEA A;  2X48 A;  3JRH A;  1JGG A;  2QF7 A;  2Y9Z A;  3IV5 A;  5M5X J;  2ME6 A;  1HCR A;  4C3I J;  2EZK A;  4IEJ A;  1QVT A;  1ZQ3 P;  2LP0 A;  2KDZ A;  1RES A;  2DMQ A;  2EQR A;  2CRG A;  4XK4 A;  3NAU A;  4XRS A;  1IJW C;  4EEF G;  3GTQ J;  2H8R A;  1ETY A;  5M3F J;  1ITY A;  3B6C A;  4DW6 A;  1IDZ A;  1IC8 A;  2LLK A;  3BTL A;  1IG7 A;  2O8K A;  2M34 A;  4CYC B;  1EF4 A;  4QTR A;  2LVS A;  2R93 J;  1OFC X;  5HOD A;  4MIM A;  4FTH A;  2VKV A;  5FKM A;  2EH3 A;  5EYR A;  2OF7 A;  3OOU A;  1MBG A;  1ETK A;  2YS9 A;  1SAN A;  5IP9 J;  1ZTR A;  1Y1V J;  1WGX A;  4A3K J;  2E2H J;  3GBG A;  2XRL A;  2Y30 A;  3TW7 A;  4DYR A;  3S1M J;  5JLW A;  4DZJ A;  4A3F J;  2NS8 A;  5EZG A;  2R7Z J;  3LSJ A;  1OCP A;  1JKP C;  3FK7 A;  3WHC A;  5IYB J;  5IYD J;  1JKO C;  5IPA A;  3S16 J;  2Y9Y A;  3I4N J;  2MG4 A;  1B8I B;  2WAQ N;  1MH3 A;  1K61 A;  4JP0 A;  3QPL A;  1DU0 A;  2NVX J;  3E7L A;  2XB5 A;  2JWT A;  2HOS A;  2HOA A;  3BG9 A;  1GV2 A;  2CJJ A;  2B63 J;  3GTO J;  3Q0V A;  1MBE A;  4A3M J;  4A3J J;  5FKK A;  5E3O A;  4M6V A;  4G12 A;  1OJL A;  2P81 A;  3BTI A;  3HOV J;  1U9N A;  2I10 A;  3MN2 A;  1GDT A;  3JR9 A;  2JA6 J;  4M3G A;  5F0F A;  1NK3 P;  1IUF A;  2HI3 A;  5K7Z A;  1T56 A;  2DA2 A;  3BR6 A;  3TP0 A;  1WPK A;  5C4X J;  2ID3 A;  2K9S A;  1UG2 A;  1FEX A;  2LTP A;  5IOZ A;  3LSP A;  3A01 B;  1BL0 A;  3G1L A;  3GTL J;  1LFU P;  3BT9 A;  5K7H A;  5C44 J;  3SDG A;  2HXO A;  2O9L A;  3FIW A;  4A3L J;  2CUF A;  3L1P A;  5DS9 A;  3CQZ J;  3BTC A;  1ZR2 A;  1OCT C;  2IBD A;  2Y31 A;  3NAR A;  1X2N A;  3RZD J;  1MH4 A;  4I76 A;  3S1Q J;  4XID A;  1JJ8 C;  5F04 A;  5IP6 A;  1PUF A;  3HDD A;  2JA8 J;  1B72 A;  4FE7 A;  2JA5 J;  1CQT A;  2HXI A;  3BR5 A;  3FK6 A;  5C4J J;  2M2E A;  3GTG J;  2VI6 A;  4A93 J;  3HBL A;  5M5Y J;  3BTJ A;  1GV5 A;  4GFB A;  3ZQH A;  1H8A C;  2L9R A;  2XPW A;  2YUS A;  2YU9 J;  1F36 A;  4A69 C;  3QQA A;  1LE8 A;  5F08 A;  2MW8 A;  4XRS G;  4DYQ A;  3GTJ J;  1FTZ A;  3A01 A;  3TP3 A;  1U8B A;  2TRT A;  2X9D A;  2NVT J;  3H3V K;  1H88 C;  2WB1 N;  2EZI A;  3MKL A;  3QPS A;  1VFC A;  1HF0 A;  4D7M A;  5FLV A;  1IV6 A;  3IH2 A;  1VI0 A;  1JKR C;  1I3Q J;  4A3G J;  1A6I A;  2K9Q A;  4NDL A;  1AKH A;  2FD5 A;  2EZH A;  5FKO A;  1WI3 A;  4RDU A;  3BQY A;  3BR1 A;  1H89 C;  5FKL A;  4JX5 A;  3CCY A;  5M3M J;  1D5Y A;  5IOY A;  1JT6 A;  3M3Y J;  2IAI A;  5EDN A;  3BG5 A;  1HOM A;  1WH5 A;  1AU7 A;  1TWG J;  3Q0W A;  3S1N J;  1VND A;  3LOC A;  3GTK J;  2VKE A;  2R92 J;  3JRE A;  2NS7 A;  1UMQ A;  1BW6 A;  3Q3S A;  1HDP A;  4B1R A;  1P7J A;  3MVP A;  1MBF A;  4A3I J;  1RKW A;  1Z77 A;  5FLM J;  2ECB A;  2E2J J;  3OSG A;  1ETO A;  2W48 A;  2R5Y A;  3JRF A;  1RPW A;  4ABZ A;  2LD5 A;  1NK2 P;  4Y52 J;  2DA4 A;  2L7Z A;  2GM4 A;  2HYJ A;  2K40 A;  2LK2 A;  1PUF B;  2E1O A;  3FIS A;  1B72 B;  2ELK A;  3HOU J;  3Q0U A;  3HGG A;  3ZOB A;  2ECC A;  2EBI A;  5C3E J;  2EZL A;  2GBY A;  3DEW A;  5GPA A;  1S7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...