5E20A

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the 2,3-dichlorophenol bound form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLDKKHMVRIKLSEKAIDTFYQALEISNRVYKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides sp. cbdb1
molecule tags Transcription
total genus 59
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e20A00
2RGVA 3SQNA 5E1WA 3L2CA 4LB5A 4ZH4F 2YSRA 3K69A 1TNSA 2PMUA 1K78A 2E7XA 4BNCA 2MD5A 2K7LA 2LF7A 3M9AA 4KUMA 3EYYA 4G94A 2FQ3A 1G3WA 3FM3A 3FWEA 2ZJ2A 3KZZA 2IJLA 4PGGA 2M8EA 4LGWA 2VC1A 2XAFA 2EFWA 1MDMB 4WXCA 5L3GA 3CUQC 3FXQA 1LB2A 4EM1A 3TQNA 1UHMA 2VE9A 2STWA 4IHTA 3PQKA 2G7HA 2ZNYA 5DUKA 3T8TA 3TOAA 2PG4A 4ON0A 5ICGA 3H3UA 4CYDA 3WTWC 3HSRA 2FSWA 4KN4X 2UZKA 1OMIA 3Q9SA 1IN7A 3M1EA 3IWFA 4UNOA 5HDKA 1XGSA 3E6CC 3EYIA 3FMSA 3WODF 4I98B 1BC8C 3MQ0A 4MGRA 3BOQA 1GHCA 4M9ZA 2QQAA 4AIJA 3F8FA 5D5VB 1H9TA 5DD8A 2VE8A 2FEZA 4L9NA 2L3DA 5LEKA 2EJRA 2Y48A 2ZMEB 4HDUA 2AXLA 4P5OA 3GZ5A 2O0YA 4UVCA 1T38A 2KIMA 1D3YA 3KE2A 2EK5A 3FXUA 3HSFA 3LFKA 2K86A 2VBWA 2R3SA 1LQ1A 4IF4A 1OYWA 2A61A 2Z33A 4ENKA 2VXZA 3BZ6A 5IT9Z 2J5OA 1U5TA 1HW5A 2RV8A 5JHUA 3MCZA 3GUDA 1ZREA 3J7AO 2WWYA 2M87A 1SMYF 3RDIA 2FF4A 1XDSA 5AONA 5FFZA 3WTVC 1PDNC 5LEJA 2X4HA 1G3YA 1FWZA 1W4MA 5K5QA 2G7UA 2HQNA 2NNYA 2DQRA 5AIPA 1KQ9A 2GA1A 2W25A 4IJAA 4XSZF 3CO6C 4PDKA 3JW4A 4B09A 4GCVA 4EM2A 1HQCA 2O3FA 1PUEE 4GXOA 2LF8A 3GFJA 1G3TA 2LNBA 5ILVA 5HOOA 5E17F 2KRFA 3KP3A 3Q5FA 2H94A 2E7WA 2VBXA 3D0SA 2XAQA 4I2OA 2YX7A 4A5NA 3I59A 3JSPA 4KN7X 5L3DA 2MH2A 3IKVA 1T2KA 2HKOA 4D0PA 4R1HA 4M73A 4BAYA 4JBAA 3LA2A 3ZQ7A 2VBYA 4LD5A 2A3SA 2EV5A 3V4GA 2HDCA 1TW2A 1MJ9A 2UWMA 3ZN0A 3GX4X 1IUYA 5BOXA 3SXYA 4IRIA 4LLGF 1RUNA 3KLOA 3IRQA 1ZN2A 4BHPA 1ZRCA 2P7VB 4NHJA 3M7GA 3GFMA 3KP6A 1B9MA 4XLPF 1REPC 3F21A 4UVBA 2QLZA 3DXJF 1O57A 2DU9A 2XVCA 2ELHA 1KYWA 3W6KB 1USTA 1I1GA 1U8RA 3F8CA 1S3JA 3FM5A 5ILUA 4KIGA 5L3EA 3HRSA 2FE3A 4CGZA 5JFRA 3FHZA 4YFKF 2V6CA 2W24A 1ZLJA 2XGXA 5DD4A 3WU1B 1K78B 2GQQA 3FX3A 1YO5C 1ZH5A 4CXFA 1B4AA 5FLXK 4FX0A 1Z1DA 1QZZA 2V1DA 2DW4A 1ZHFA 4G7HF 4HV5A 4MQVA 2Q2EA 1TLHB 2MLGA 6PAXA 2PFBA 5FD5A 4RB2C 1RZ4A 4U0YA 3U2RA 2STTA 2ZCWA 2JPCA 2H27A 4BHCA 4DQ2A 3WE2A 3OV8A 1RIOH 4IRGA 2DAOA 4HZFA 3Q9VA 1TW3A 1XGOA 1LJ9A 2E1NA 2L01A 1LDJA 2NNNA 4I02A 2ZXJA 4G7OF 3HHHA 3ZMZA 4FT8A 2HQRA 2QUFA 5LHIA 4Q5SF 3JTHA 4KICA 5LHGA 1B1BA 2QENA 4ESFA 2OAZA 4OIQF 3GFLA 3MZYA 3R4KA 1FZPB 4WWCA 3I53A 1U3EM 1Z7UA 4ZYEA 3ABUA 2J5PA 4YFNF 2COMA 3EDPA 5D4RA 2JSCA 1KYZA 2FOKA 2NAZA 5EEGA 4L18B 5L3BA 5LGUA 2BEOA 5FD6A 4HX4A 1KU7A 3RPUA 2PJPA 1R36A 1SD7A 3SZPA 2M30A 2NRAC 3KEQA 3CDHA 4OIRF 4HQEA 4EJTA 1P92A 3E5UA 3KETA 4L5JA 4NQWA 1XD7A 5D6FA 2O8XA 1T39A 2V1UA 2L4AA 3JTGA 2RC4A 1IRFA 1FPQA 5E8IA 1QPMA 1U5TB 3F8BA 5JVTA 4PZJA 1YLFA 5ICEA 5HDNA 1G4DA 3TOBA 4OMZA 1BIAA 3IKTA 4DNCA 3B02A 4HYEA 3MAJA 1YW8A 3ROUA 2D1VA 3WU0A 1BBYA 4ENJA 1KU9A 4S05A 3WGGA 2GAUA 1O3QA 1UHWA 2QBYA 1QNTA 2CYYA 1EV7A 4MEYF 3CO7C 3LQRA 3SFZA 3M8EA 4ENNA 5HLHA 4EV0A 1BOAA 4WF2A 2TDXA 3HTSB 3R0AA 2JTVA 2EFQA 4WK8F 3HOSA 2K27A 5CYVA 2CQKA 3QOPA 1XSDA 3GO5A 4L9VA 1AOYA 5D6EA 3V7SA 5F1RA 3U9GA 3WG9A 2VT3A 3ULQB 3WE3A 4UXNA 3I59B 3RTRA 3I5UA 3ISPA 3MEXA 3QU6A 1E17A 1V4RA 1XDUA 1OYIA 3CTAA 3MFKA 4Z2YA 3DF8A 3GXOA 2O6GE 2D1HA 1IRGA 2VBZA 5DYMA 3ML6A 2VN2A 5CJ9A 3GF2A 3GFIA 3WTZA 2ISZA 3DP7A 1IAWA 2DI3A 3EQLF 2W85A 4G8XA 4NB5A 5JI6A 1R1UA 3L00A 4EJOA 3V8JA 3E6MA 4LLLA 2GA2A 3HHGA 4CICA 2FMLA 2L4MA 4MHGA 4ZZDA 4PGHA 2H6BA 1X3UA 3HIFA 2H09A 1ZRDA 4YIFA 4EGZA 3EETA 3K2ZA 1YFHA 1JXSA 1JHHA 4MQ9F 1B9NA 5KVRA 4GO1A 3I0TA 3P7NA 1I6XA 2XIGA 3IC7A 2CWEA 2DK5A 2G9WA 1IXCA 5FLXZ 1FYKA 4LK0F 2A6EF 1OKRA 1SD6A 1U6GA 2QVOA 4LG0A 1B59A 2Z5UA 3DPLC 2D2WA 1Y0UA 4HV6A 3WTSC 3WTYC 1G6NA 1IN4A 1F1ZA 5E18F 3ZN1A 2JT1A 4KA4A 2OU2A 1LDKB 2F2EA 1MZBA 4OU0A 1ZRFA 1EH7A 1D8KA 1TBXA 3ZMTA 3ABTA 2PQ8A 3P9CA 1HW1A 3F8NA 4L5IA 1J5YA 2YX4A 5HS8A 2YU3A 1ZYRF 2KIUA 3FXRA 4WXDA 3TGNA 1BN5A 4ZZLA 1F9NA 1WI9A 1Z05A 4A6DA 2ZO4A 3FMRA 2XKPA 3SHFA 4H0EA 4BHBA 1XGNA 3C7JA 1FSHA 2OBPA 2HYFA 4ZYHA 4KMUX 1S29A 3ZMUA 1YTYA 2HKXA 1KGSA 3WGIA 1S7AA 1ZARA 1HSJA 4EJUA 3TO6A 5LBQA 4HLYA 1TQIA 1YYVA 1XCBA 2Y75A 2DK8A 1FSEA 3CUQA 5BQTA 2XAJA 1O7FA 3LAJA 3O6BB 4ETSA 2FU4A 1ODDA 3G73A 3BPVA 2BYVE 1YS7A 2QQ9A 5D5XB 2MBFA 4KIFA 3FZVA 1WWXA 1GVJA 2IW5A 2FBIA 2IRFG 1W7PA 4UV8A 2EV0A 2CO5A 2GXBA 1RNLA 2XAHA 2P5VA 1Z9CA 3F3XA 3ZMDA 2HOEA 3LA3A 3C18A 2R7FA 4IVNA 2O03A 2A07F 4A0ZA 2QBYB 5A2QZ 3P9IA 5J6XA 2XRNA 4YIIA 3W6JB 3TDUC 2M1BA 2XHKA 1B6AA 1J0RA 1WKMA 3PQJA 1OPCA 4ENMA 3KCCA 2IVMA 4OINF 1D5VA 1FP1D 3COAC 3V8KA 4GYIA 1YG2A 1RUOA 5LRSA 1OYYA 2D45A 3MWMA 4I0AA 2P4WA 4KT5C 1J7KA 3K1NA 3V7RA 4WXHA 1DPRA 2QYOA 3VOEA 4HOBA 3HOTA 2OZ6A 3L09A 4I01A 1KU2A 1XN7A 2A6HF 1DP7P 1H9GA 3IWZA 4KYWA 4LLNA 1CGPA 4FX4A 2RN7A 5FO5A 4BYYA 3KP2A 2XASA 4ZYGA 1K6OA 4M71A 3H92A 4HLXA 1WQ2A 4AIHA 3T5XA 4UV9A 2W84A 3O3KA 5D5WB 1HBXG 4LK1F 1XMKA 2V79A 3HRTA 3BJAA 2P6TA 3I54A 2Q0OA 3I71A 5DDGA 4RGRA 3EUHA 3T1BA 1IW7F 4MEXF 3IRRA 1JGSA 2A68F 3LSTA 3JSOA 3I4PA 4ESJA 2LSOA 5E1ZB 1DPUA 1V3FA 4RB1A 4L9JA 2DBBA 4RB3C 2FRHA 5H20A 2KJBA 1ZG5A 2QQBA 4EJWA 4KDPA 4R79A 4O5VA 3F8MA 3ECOA 2K02A 2A69F 3TKYA 2L54A 2M45A 3O2PE 1U2WA 1K79A 1BJAA 4ESBA 4LG0B 3REOA 4O3MA 2CSOA 1FX7A 5DCFA 4Q47A 2ACJA 5DEQA 4HA8A 4KFCA 2MH9A 4AIKA 2IT0A 1ZGAA 1QZYA 1MGTA 2V9VA 3SZTA 1BI1A 4OMYA 1BM9A 5K5RA 4TV7A 2ISYA 1KQ8A 3RJPA 1RI7A 1L3LA 3DEUA 1R7JA 1T98A 4Y17A 4MNUA 3HTUA 2HFHA 1FBUA 1SD4A 4I7HA 2F5CA 2KJCA 2HEOA 4RGUA 1HW2A 4M9XA 4FHTA 4O6JA 3J80Z 1I1SA 4XBFA 1GXQA 4KMFA 4HF2A 4IPAA 1R5HA 1O7LA 2MC3A 3HSEA 1IF1A 5HS7A 2P7CB 1YQAA 4M74A 2BBYA 4L0YB 2ESHA 1R22A 2RQPA 2VONA 4UUVA 2XUBA 2JRTA 1JHFA 4P9UA 2FNPA 5ICCA 2B0LA 4RGSA 1S8NA 1IZ1A 3QAHA 2ADUA 5E20A 1KQ0A 1G3SA 3TO9A 4BH9A 1IXSB 4L9TA 3GVAA 1BIBA 1FBQA 2EA2A 3DPTA 4JK1X 2MLKA 4G7ZF 4CZZA 1HXDA 1USSA 4A2UA 3OOPA 1WRJA 2FBHA 3GWZA 3WGHA 1D8JA 2RDPA 1SMTA 2ETHA 1VTNC 2Q8KA 3CUQB 3ERED 1U78A 5A2QK 4UHTA 1ON2A 3IL2A 1FY7A 2IA1A 5HLGA 1I27A 4EM0B 3T8RA 3DV8A 2GZWA 2LKPA 5ICFA 4LMYA 4Y13A 5H6RA 3F6OA 3KLNA 1KA8A 1C0WA 3E97A 2IP2A 4U88A 1W7PB 1FLIA 1U5TC 2XROA 4MTDA 3N97A 2KKOA 3VFZA 1L0OC 1YW9A 1QBJA 4PCQA 1TTYA 1IN8A 2RNJA 4OIOF 3DFGA 4HF0A 5JR3A 3TDZC 1P2FA 1HKTA 2Z99A 3ECHA 1I5ZA 5CVJA 4Q4ZF 4ASNA 2WTEA 4HQMA 5HVQC 2C6YA 3BROA 4AD9A 3P9KA 2XKOA 5E1XA 3T0YA 3K9TA 1MD0A 1TNTA 5ILSA 2IA2A 2RKHA 3J81K 1FYLA 2VC0A 3WTUC 4BQAA 2CGPA 4CO8A 4M6YA 1MKMA 5J8CA 1STZA 1P4XA 3KP4A 4JQFA 1YS6A 3LQQA 1LVAA 1MJAA 2PEXA 4P9FA 4P55A 2DT5A 1BI0A 4WCGA 2Z9OA 2FBKA 3BJOA 1R5GA 2WC2A 4HW0A 4G6DA 2VT2A 1ZGJA 4M6XA 2PLYA 2CFXA 2HTSA 3RYRA 5IT3A 2BGCA 3HRMA 2P5KA 2NYXA 1W7PD 3BWGA 2EFOA 1UB9A 5D8LB 4KNYA 3K0LA 5H6QA 3VB2A 5D4SA 3S2WA 4OIPF 3RYPA 2DPUA 5LGTA 1CF7A 4CHUA 3GYHX 3LWFA 4A0XA 2F5EA 2IPQX 5DCMA 5CLSA 3BY6A 1R1TA 3L7WA 5D5UB 2V1XA 1FT9A 5HS9A 1J2XA 4LJZF 5F6FA 4HX8A 4F7ZA 3G3ZA 1Z6RA 2Y0MA 5BS6A 2F5DA 4UVAA 3ZP5A 2HZTA 5LHHA 1HKQA 4EJVA 2E1CA 4IHSA 4IRHA 4L0ZB 2QWWA 1ZG1A 2DLLA 3GZ6A 1W5SA 3I64A 2CW0F 3J80K 1DUXC 1XB4A 2HWVA 3KP5A 1XGMA 3QP6A 3R6SA 2ZBKA 4OOIA 2P5LC 2R7DA 3E5XA 1A04A 1FNNA 2HS5A 1AWCA 2OZUA 4ZYDA 2LDUA 1ONVA 1T0FA 2X0LA 1R23A 1ON1A 2DO7A 3FMQA 2UXXA 3AAFA 1O3RA 2FXAA 1UFMA 3CJNA 1BC7C 2DTRA 2GIVA 3F23A 2FNAA 3BP8A 2EWNA 4YFXF 2P6SA 4Y15A 3DKWA 3RKWA 1QO0D 2KIFA 3D5LA 3HYIA 1HSTA 3NQOA 3F22A 1J75A 2HGCA 3PFIA 5HDGA 1Z91A 4I09A 3E5QA 1LNWA 4AWXB 3ZPLA 1J9IA 4K2EA 2ESNA 3JAMK 1O3SA 3LAPA 5CVRA 3M8FA 2OA4A 2P8TA 4U0VA 1ZLKA 1OR7A 4GYGA 5BMZA 2H6CA 3F72A 2BV6A 5E8GA 4QLCU 2OD5A 1EH8A 1XSVA 4LB6B 4P96A 2PN6A 5L3FA 4G9YA 4IXAA 1E2XA 4A0YA 1TQPA 2QZ8A 2XV4S 1MDMA 1MJBA 4RB0A 3E3VA 2OQGA 4M72A 1ZG3A 3QPTA 2YR2A 1SAXA 3LA7A 4RS8A 5K1YA 3RKYA 4YG2F 2PBIA 1NHAA 2RVCA 1SD5A 3HRUA 4EMSA 3QPHA 2ZFWA 4GGGA 3H3ZA 1LEBA 2IA0A 4HBLA 1P4AA 1YW7A 3ZMSA 2HYGD 4R8HA 3TO7A 1T6SA 4U7BA 3RI4A 5BPIA 1FOKA 2VOPA 2K4JA 5K5OA 5HLIA 3RIRA 2L02A 3J81Z 2EB7A 4WX9A 1S7OA 2PI0A 2UXNA 1XCVA 1DDNA 2F5FA 3KFWX 3BDDA 1PP8F 4U7DA 5FFXA 4A6EA 4XSXF 4RGXA 1W5TA 2ZMEA 3MZHA 4HX7A 1QGPA 2M5WA 5FGMA 2AS5F 3ELKA 4HAMA 2FMYA 5AIQA 5BPDA 5CVUA 1ZAOA 2YPRA 2WV0A 5CVVA 2VODA 1SFUA 2EA4A 3RKXA 3CUOA 4RAYA 5J8FA 1R58A 3QRFF 5KK1A 5LGNA 3FF5A 2BE5F 3I58A 4QWQA 3V7CA 4RAZA 2DFIA 3WTTC 2HR3A 1BI3A 1ULYA 2QM3A 2GXGA 1Z6TA 3NEUA 1YIOA 1FBSA 5LLQA 4XRFA 1F5TA 2EFPA 2JPBA 5L3CA 4U0WA 1EH6A 4EVIA 5ERIA 1IN5A 3R61A 2OQRA 2GWRA 2DPDA 5IT9K 4A5MA 1CF7B 1FC3A 4MTEA 2XAGA 3VEPA 4HF1A 1GXPA 4EGYA 3C3WA 3RPQA 5ED4A 1TQMA 4M9SA 5TRDA 5DCMB 3WTXC 2O61A 4EQQA 1IXRC 1K7AA 3KP7A 3QU3A 1R1VA 2K4BA 1PP7U 1JE8A 1XSXA 2DQLA 3B73A 3ZMVA 3QP5A 1P6RA 1P4WA 3BPXA 3GEZA 1SFEA 4LFUA 4BXUA 4KIBA 3IHUA 3NRVA 1XMAA 2JZYA 1H0MA 1BI2A 1FP2A 3KEOA 4N9HA 1O3TA 2VOOA 2EFNA 2CG4A 1KU3A 1UCRA 2FA5A 4AVPA 2EV6A 3R0JA 1R00A 5FB2A 3L9FA 3KZYA 3GLXA 1IN6A 1LDDA 3F6VA 2ZKZA 3U1DA 1Q1HA 3BJ6A 1SFXA 1S6LA 2PMHA 2W57A 1F4KA 5LRRA 1WSUA 2MA3A 3GW2A 2ZNZA 3CLOA 4CDGA 3R60A 3V8LA 5DUIA 4N9IA 3E6DA 3VODA 3HUGA 4B8XA 4XLNF 4N0BA 3N4MA 1QQIA 3JAMZ 2A5YB 3K1MA 3C1DA 4HDVA 5D8KB 5F64A 1HKSA 5DV5A 4Q48A 5TJJA 1LEAA 4G6QA 4I0BA 2NS0A 4E70A 1J59A 2HTJA 4A12A 1FYMA 4S04A 5CVIA 2Z3YA 3E6BA 3DQVC 3K1PA 5EEHA
chains in the Genus database with same CATH superfamily
2RGVA 3SQNA 1G8XA 5E1WA 3L2CA 2LD5A 4LB5A 4ZH4F 2YSRA 3HZJA 4A3LJ 3K69A 4PK4A 4LOCA 4BBRJ 1TNSA 1N78A 1MMGA 1MNEA 2HI3A 5F0FA 2PMUA 1SAUA 3S3OA 1WJ5A 2K9SA 4PJ0C 1K78A 3QODA 1ZKGA 4A69C 2EH3A 2E7XA 2ZB9A 4BNCA 2MD5A 4F55A 2V7FA 2K7LA 1RETA 2LF7A 3M9AA 4KUMA 1SANA 3EYYA 4BS9A 4G94A 1JGGA 2FQ3A 1G3WA 2LKXA 1WZ2A 3FKIJ 3HOZJ 3FM3A 2NVUB 3RKQA 1RR7A 3OYJA 3FWEA 2ZJ2A 3E0JB 3KZZA 2IJLA 4PGGA 3ZGKA 3CJTB 2XDVA 4F91B 2DFHA 2M8EA 4LGWA 2VC1A 2XAFA 2EFWA 1MDMB 2XB0X 1T0FC 4WXCA 5L3GA 3CUQC 3FXQA 3L2QA 1LB2A 1QRYA 2CJJA 2KRHA 4M3EA 4EM1A 4IZZA 1UG0A 3TQNA 1P7IA 1UHMA 2VE9A 2STWA 2DT6A 1Z77A 2OCCH 2WV1A 4XOTA 1DP3A 2VKDA 4IHTA 2E2HJ 3HPGA 3PQKA 2G7HA 3A01A 2QGUA 2XGDA 2X1EA 2ZNYA 4QPOA 5DUKA 1QHGA 2HVSA 2F5VA 3T8TA 2RAEA 3TOAA 2PG4A 1SC7A 4ON0A 1OQYA 2ZSHB 5ICGA 2O8KA 2KMUA 3H3UA 4CYDA 1IGNA 2XPVA 3WTWC 1TT0A 3VPRA 3HSRA 3HDDA 2DN0A 2FSWA 3H36A 4KN4X 2UZKA 1W36C 5IPAA 1OMIA 3Q9SA 1HC8A 3ZQIA 1YJ9I 1IN7A 2YU9J 3M1EA 3IWFA 4UNOA 4ZDPA 5HDKA 3E7LA 1XGSA 3E6CC 5F08A 4BY1J 3EYIA 3BR0A 3UNGC 2BY0A 3FMSA 2RNGA 3WODF 4I98B 1BC8C 2HPMA 3MQ0A 4MGRA 3BZKA 3BOQA 3NWSA 2Y0SA 4JX5A 2K9QA 4BJ6C 2Y31A 2VXDA 1R4MB 3OS1A 1GHCA 2M4KA 3GMEA 4M9ZA 3BT9A 3BG9A 3CCRI 1WVRA 1X1CA 4UY8I 1VQNI 2QQAA 4AIJA 3F8FA 3AG1H 2DDAA 2P0WA 5D5VB 1H9TA 5DD8A 1SVMA 3CD6I 1OCRH 2VE8A 3MKLA 1LE8B 3M3YJ 2KIQA 3IP4B 2FEZA 5M3MJ 4L9NA 2L3DA 5LEKA 2R7ZJ 2EJRA 2Y48A 4LITA 2ZMEB 2JVHA 4HDUA 2AXLA 2FOWA 3BLYA 4P5OA 4RM3A 3GZ5A 1TWGJ 2JMWA 3S1MJ 1IRZA 1WGXA 3SEQA 4V2GA 2ELJA 4ITVA 2O0YA 4UVCA 4E7LA 3IV5A 1T38A 5IP7J 3JRCA 5KAFC 2BY1A 2KIMA 1D3YA 4XLCA 4G6TB 5M5WJ 2QKMB 3KE2A 2EK5A 3FXUA 2ZC2A 3HSFA 3LFKA 1KZHA 2EQRA 4FASD 1WJAA 2ME0A 2K86A 3IH4A 4CCJA 2VBWA 2R3SA 1LQ1A 5E3LA 4XKBA 4IF4A 1OYWA 1Y0NA 2ECBA 1TWFJ 5CKTA 2A61A 2Z33A 4ENKA 3I3LA 1WJBA 2VXZA 3BZ6A 2E34A 5IT9Z 2J5OA 1U5TA 5B1BH 1WCMJ 1HW5A 1IC8A 2RV8A 4I6ZA 5JHUA 3MCZA 3GUDA 2VB6A 1ZREA 3J7AO 3HB9A 3VYTB 1I39A 2WWYA 2M87A 1SMYF 1FTTA 2WAQN 2E2IJ 2JVGA 2DA6A 4XK4A 4NC8A 3RDIA 5EZHA 2FF4A 2M7AA 1XDSA 2XAUA 4XLAA 2CS3A 5AONA 2A6TA 5FFZA 2BVMA 4NBQA 5GTHC 1I3AA 3WTVC 1PDNC 1K61A 5LEJA 1RPWA 2X4HA 2M9HA 1G3YA 2IS1A 5CQGA 1FWZA 1W4MA 4BDYA 5K5QA 1JUMA 3K4CA 3EUHC 4W1UA 2G7UA 5H2FC 2HQNA 2E35A 4AYBA 2EBIA 4HNTA 3L1PA 2KDZA 2NNYA 5KAIC 2DQRA 3RQIA 4PSWA 5AIPA 1KQ9A 2L9NA 3EUKL 4DZJA 2GA1A 3HOVJ 2W25A 4IJAA 3AFHA 4XSZF 2R7RA 2LBFA 3CO6C 3W2VA 4PDKA 3MKZA 2R5YA 1PUFA 3JW4A 5KNLA 1NK2P 4B09A 4DOZA 4GCVA 3F9KA 1HQCA 4EM2A 1JUSA 3H9QA 1K6YA 5F1JA 4BE0A 2KZGA 3CMMA 2GOMA 3H5NA 3ZQLA 4C2TA 3DBRB 2QSHX 2O3FA 1PUEE 4GXOA 1M1EB 2LF8A 3GFJA 3OR2C 1G3TA 2LNBA 4DBRA 5ILVA 5HOOA 5E17F 2KRFA 3KP3A 2XGEA 3ZRGA 1GUUA 3Q5FA 2H94A 2E7WA 2VBXA 2XGCA 3D0SA 2XAQA 2CQQA 3I9V2 3PNYA 4I2OA 2YX7A 4A5NA 3C2HA 3BTIA 3I59A 3JSPA 5EDNA 2BY2A 4A3IJ 4KN7X 1G59A 4KJZA 5L3DA 3BR1A 2MH2A 1YRNA 4Y4RA 3IKVA 1T2KA 2HKOA 4D0PA 4R1HA 1QVUA 1ETXA 3PIOF 2CV1A 4PFPA 4M73A 4BAYA 2I5UA 4JBAA 4JX4A 3LA2A 1N75A 2BY3A 3ZQ7A 4XRSA 1VQ9I 2VBYA 4LD5A 5IOYA 2A3SA 3GTOJ 2EV5A 3CF5F 3S2DJ 3V4GA 3W2WA 1GV5A 5FLMJ 1WJDA 2HDCA 1TW2A 2HQAA 5DM6F 1MJ9A 3DU6A 4PUSA 2UWMA 2VPRA 2DOEA 2KL4A 3ZN0A 3GX4X 1IUYA 5BOXA 2CUZA 3SXYA 4IRIA 1U9OA 2CW8A 1VQKI 4LLGF 1RUNA 1A31A 3KLOA 3IRQA 2DDBA 3HUGB 1ZN2A 1JTXA 4BHPA 1ZRCA 3QWLA 2ZJPF 2P7VB 4NHJA 3CP8A 4XR6A 1R6RA 4IQJA 1UELB 3M7GA 1DGWY 3G1MA 1BL0A 1D1CA 3GFMA 3KP6A 1B9MA 4XLPF 1REPC 4LG3A 3F21A 2VQGA 4UVBA 4XKVA 3L2UA 2QLZA 3K4LA 2X1CA 5TISC 3DXJF 1VF9A 3BR2A 1O57A 2DU9A 2XVCA 4HEA2 2IGOA 2HXIA 2ELHA 1KYWA 4Z6YA 2DMPA 3W6KB 1USTA 5J4VA 1I1GA 1U8RA 5C4XJ 2JUCA 2F4MB 1S3JA 3F8CA 3FM5A 4KIGA 2HVQA 5E79C 2M7BA 4DGWB 5ILUA 5L3EA 2DODA 3HRSA 2FE3A 2LYCA 4CGZA 5JFRA 3ABLH 3FHZA 4YFKF 2V6CA 2W24A 1ZLJA 2UUZA 1TC3C 4P1WA 2XGXA 4HSRA 1WJEA 2O7OA 3Q0VA 5DD4A 5J40A 2RREA 3WU1B 2DA7A 1K78B 4PJMA 2GQQA 1JKRC 3FX3A 5HLTA 1YO5C 4BE1A 1ZH5A 4CXFA 1LKXA 4V19K 3S1QJ 1B4AA 5FLXK 4FX0A 1ENHA 5EGOA 1UG2A 3HM5A 1Z1DA 3CLQA 1TP4A 2DMNA 1QZZA 2V1DA 2DW4A 5EF6A 1ZHFA 3A03A 4G7HF 4HV5A 4MQVA 1OCPA 2Q2EA 2MYSA 2MABA 2PMZA 3FHNA 1T95A 1X1AA 1TLHB 2MLGA 4HNVA 3M8JA 1X4OA 6PAXA 3AKZA 2PFBA 3LSGA 5FD5A 4RB2C 1RZ4A 4IX7A 2W00A 3U2RA 4U0YA 2STTA 2LK2A 2ZCWA 2JPCA 2H27A 4BHCA 3CJQB 4DQ2A 4D9JA 3WE2A 3FBIB 3GBGA 1V5EA 3OV8A 4IRGA 3A01B 1RIOH 3FKJA 1FOWA 4RAGA 2DAOA 4HZFA 3Q9VA 1TW3A 3SDGA 1XGOA 1LJ9A 2E1NA 1WJCA 2L01A 3VSLA 4C3IJ 3GTGJ 3OYNA 4A3BJ 1LDJA 1HDPA 3BR5A 2IS2A 2NNNA 1X3ZB 4I02A 2ZJRF 2ZXJA 1IG7A 5GAHJ 1H89C 4ZYAA 1ETKA 3HHHA 4G7OF 3ZMZA 1A35A 1D1BA 3FXKA 2HQRA 2QUFA 4FT8A 3H3VK 5LHIA 4Q5SF 2A5WA 4A3KJ 3JTHA 1I3QJ 1WHUA 4KICA 5LHGA 4E7HA 1B1BA 2QENA 4ESFA 2OAZA 4OIQF 1F43A 1OLTA 3GFLA 3MZYA 3R4KA 1FZPB 3I53A 4WWCA 1E3HA 1U3EM 3H5RA 3KX2A 4M3BA 1Z7UA 2OJED 1BW6A 4ZYEA 2BOLA 2L9VA 3ABUA 2OPTA 5JVGF 2J5PA 4YFNF 2COMA 3EDPA 5D4RA 1R5ID 2JSCA 1KYZA 2FOKA 5B66C 3ZQHA 1KONA 2ZXHA 3DWLE 2NAZA 3J7YJ 5EEGA 1BJZA 3JRDA 4L18B 5L3BA 2HYJA 5LGUA 2BEOA 1Z0XA 5FD6A 4HX4A 1KU7A 3RPUA 2PJPA 1R36A 1GDTA 4RA2A 1SD7A 2WB1N 2X48A 3SZPA 3S93A 2M30A 3UKGA 2NRAC 4IHXA 3KEQA 3CDHA 4OIRF 1AKHA 3PUFA 2V4JC 2XF6A 4HQEA 5EEAA 4EJTA 1P92A 3S17J 3E5UA 3KETA 4L5JA 4CCNA 4NQWA 1XD7A 3CF2A 2CUFA 3K4BA 4PSXA 5D6FA 1W0TA 3DU5A 3G71I 2O8XA 2DMUA 1SFOJ 1T39A 2V1UA 3CCUI 2NVYJ 2L4AA 3JTGA 2RC4A 2H8RA 1IRFA 1TWCJ 1FPQA 4A3DJ 5E8IA 1QPMA 1U5TB 3F8BA 5JVTA 4PZJA 1MIJA 1YLFA 5ICEA 1K4SA 5HDNA 1G4DA 3TOBA 3ABKH 4OMZA 2H1LA 2DA1A 1BIAA 5KHDA 1X2NA 3IKTA 4DNCA 3B02A 9ANTA 4HYEA 3MAJA 1Y39A 1YW8A 4A3JJ 2E1MB 3ROUA 2D1VA 3WU0A 1BBYA 3A0HC 2I10A 3W3CA 3L2VA 4ENJA 1KU9A 4S05A 3WGGA 3NARA 2GAUA 1O3QA 5FJ8J 1UHWA 5C44J 1QNTA 2QBYA 2CYYA 1EV7A 4MEYF 3CO7C 3LQRA 5GADJ 3PNVA 3SFZA 3M8EA 2X9DA 4M3GA 4ENNA 5HLHA 3IH2A 4ZTFA 4ZDLA 4EV0A 1BOAA 3HXLA 4WF2A 2TDXA 3HTSB 2XF5A 3R0AA 2LBFB 4AIDA 2JTVA 1TT5B 4NNJA 2R5YB 2EFQA 4E7IA 2QQ8A 1PUFB 1ITYA 4WK8F 3HOSA 2K27A 2M0MA 4A3MJ 2AHQA 3H9JA 3KEYA 2CQKA 5CYVA 2WADA 5K7HA 3QOPA 2HU9A 3JRAA 1ZR4A 1Y8RB 1XSDA 2HXOA 3GO5A 2IXSA 4XRMA 4CCKA 4L9VA 1QVTA 1MBKA 1AOYA 4BJTA 5D6EA 3V7SA 1NK3P 3A2KA 5F1RA 1YOVB 3S3NA 3U9GA 3WG9A 2X85A 1YIJI 2KHMA 2L9SA 2VT3A 3ULQB 4DW6A 3WE3A 2HZDA 4UXNA 3I59B 3RTRA 3I5UA 1XMXA 3ISPA 3IAS2 3MEXA 3QU6A 4BL0B 1JJ6C 1E17A 2LY9A 1V4RA 1XDUA 1OYIA 3OL3A 3CC7I 3CTAA 3MFKA 1MMSA 4Z2YA 2JUGA 4DYRA 3DF8A 3GXOA 2O6GE 1YRNB 4ANJA 2D1HA 2DOAA 2Q1ZB 1IRGA 2IGNA 3LSRA 2VBZA 2DMQA 3ML6A 2MFZA 2VN2A 4II3A 5DYMA 4MLOA 3EUAA 1TL8A 5CJ9A 4B3XA 3GF2A 3GFIA 3WTZA 1ETVA 2ISZA 2NVTJ 2DJIA 2K40A 3DP7A 3S1NJ 1IAWA 3ZQGA 2DI3A 3EQLF 2W85A 4G8XA 4NB5A 4RM2A 3JRHA 5JI6A 4U87A 1R1UA 3L00A 1WH5A 2PX9A 2O9LA 3QQAA 3ASNH 4EJOA 3EPZA 1BW5A 3V8JA 2F4IA 3E6MA 4LLLA 2GA2A 3HHGA 4CICA 1SFKA 5EG0A 2FMLA 4C30A 5F27A 2L4MA 1JKOC 2P81A 4MHGA 4ZZDA 3FDYA 3H9GA 4PGHA 2H6BA 1X3UA 4IOAF 3QYBA 1X2MA 3HIFA 4XORA 2H09A 3GTKJ 5J1RA 2X6OA 1VNDA 1O4XA 3PFYA 2CQ7A 1CQTA 4CA0A 1ZRDA 4BKXA 4YIFA 3VYUB 3H0GJ 4QSHA 3HC7A 4EGZA 3C2GA 2OV7A 5EJCA 3EETA 1YJWI 3K2ZA 1YFHA 1JXSA 4C2UA 4A3EJ 1JHHA 4MQ9F 1B9NA 2ZFUA 4GO1A 5KVRA 3PSIA 3I0TA 3S1RJ 3P7NA 1I6XA 2XIGA 3IC7A 2CWEA 2DK5A 2G9WA 3SFIA 1IXCA 5FLXZ 1FYKA 4LK0F 2A6EF 1OKRA 1XS9A 1R71A 1SD6A 5GP9A 1U6GA 2QVOA 4LG0A 1JJ8C 3FIWA 1B59A 2Z5UA 3LMMA 3DPLC 2D2WA 4CYCA 1Y0UA 2JSPA 4HV6A 5E3MA 3WTSC 3WTYC 5IY5H 4AU7A 1G6NA 1OR7C 1IN4A 2JWTA 2JA6J 1DU6A 1F1ZA 4QTRA 1RRJA 1PVEA 3G2BA 4MIMA 4JOMA 1MMAA 5E18F 3ZN1A 2JT1A 4X1EA 5EGOB 3SYTA 4KA4A 2M2EA 2L9RA 2OU2A 5B1AH 1LDKB 3J7AY 2F2EA 3PNTA 1MZBA 2Q2EB 2WAQA 4C2MJ 2K9NA 4AVZA 2R92J 4OU0A 1ZRFA 1EH7A 5DM7F 1D8KA 2R7XA 1TBXA 5JLWA 2L7ZA 1HCRA 3ZMTA 1RKTA 3ABTA 2PQ8A 3P9CA 1HW1A 1N77A 3F8NA 1YJNI 4L5IA 2QCOA 1XX5A 3S8PA 3QPSA 1J5YA 2YX4A 5HS8A 2CUEA 2YU3A 5M3FJ 1ZYRF 2KIUA 4ZDOA 2MC4A 4BGDA 3FXRA 4WXDA 2IEKA 1ZQ3P 2VJ5A 3TGNA 1BN5A 4ZZLA 2BVLA 1ZK8A 2XC7A 1F9NA 4JYKA 3QOEA 1FOYA 1WI9A 1X1DA 2Y30A 1LFPA 1NG7A 1Z05A 4BQQA 1LUJB 5E3NA 4A6DA 4J01A 2ZO4A 3CQZJ 3FMRA 1B72A 2ZJQF 4IHVA 3FXOA 3W6VA 2XKPA 2WY7Q 2TRTA 2H1KA 3SHFA 4H0EA 2LC2A 3GTPJ 2DCEA 2LRDA 4BHBA 2E71A 1XGNA 3PJRA 2M0CA 2FD5A 2L7FP 3C7JA 1FSHA 3I56I 5FROA 1MBEA 2OBPA 3PSFA 3CMEI 1U8BA 2HYFA 4ZYHA 4BXFA 4KMUX 1S29A 3TEDA 3VWBA 3ZMUA 1YTYA 2HKXA 1JT0A 1KGSA 3WGIA 3DBLB 1S7AA 1ZARA 3MZ8A 2EZIA 1HSJA 2MD0A 4EJUA 3LOCA 3TO6A 5LBQA 4HLYA 2E5ZA 4II2A 4FE4A 3AG3H 1VQLI 1OCCH 2YS9A 1TQIA 2ZMEC 4YIRX 1YYVA 1XCBA 2LG4A 2Y75A 3VDXA 2DK8A 1FSEA 1Y8QB 3CUQA 5BQTA 2XAJA 1O7FA 3A0BC 3BCBA 3O6BB 4HNUA 3LAJA 4FETA 4BQOA 1HA8A 1I6HJ 4BQNA 4ETSA 1K83J 2FU4A 1AKHB 1ETOA 1ODDA 3G73A 3BPVA 2BYVE 4NQWB 4XN0A 1YS7A 3OYIA 4XKCA 2QQ9A 3HGGA 3HL2A 5D5XB 4KISA 2E5NA 2MBFA 2ME6A 5J1YA 3AL0B 4KIFA 2VI6A 3LSHA 3FZVA 3GTJJ 4BU2A 1WWXA 1GVJA 2IW5A 2FBIA 3QYEA 2IRFG 2NVQJ 1W7PA 4UV8A 2EV0A 2CO5A 1UZCA 3BR3A 2X1DA 2GXBA 1UMQA 4GRIA 3A02A 1RNLA 3TW7A 2XAHA 2P5VA 1Z9CA 3RZDJ 3F3XA 3ZMDA 4OWRB 1JKPC 3K4KA 2HOEA 3OYHA 3LA3A 3WU2C 5FKMA 3C18A 4NUBA 4XN3A 2LTPA 4DIQA 3PO2J 2R7FA 4DBQA 5J3LA 4IVNA 2O03A 5F0HA 2A07F 4JX6A 2F6CA 2CV0A 4A0ZA 2KZVA 2QBYB 2NOGA 3OS0A 5A2QZ 3P9IA 5J6XA 2XRNA 4F93B 2E60A 4YIIA 3K4MA 5GAEJ 1A6QA 1WPKA 3W6JB 3TDUC 2M1BA 2XHKA 4D5CA 1RR8C 1B6AA 1J0RA 1WKMA 2M4GA 2WAFA 1OPCA 3HGYA 3PQJA 2K3FA 2VKHA 3MMYB 4ZC3A 4ENMA 3KCCA 2IVMA 2XPUA 3DEWA 1NG6A 2EIJH 4OINF 1D5VA 3IAM2 1YX5A 1FP1D 4C3HJ 1RC9A 3V8KA 3COAC 1UAAA 4GYIA 1YG2A 2B7EA 2K9LA 1RUOA 5LRSA 1WI3A 1OYYA 3K4NA 3OOUA 2D45A 4IHWA 3MWMA 1FTZA 4I0AA 2P4WA 4KT5C 1J7KA 3K1NA 3V7RA 3RPUD 1YI2I 4WXHA 1DPRA 2JN6A 2QYOA 3ONQA 1X19A 3VOEA 4HOBA 3HOTA 1BR2A 2E19A 3CCQI 2QF7A 2OZ6A 1PJRA 2VJIA 4B44A 1SEUA 4IQ4A 1T08B 2L2OA 4Y7NJ 3L09A 5IYDJ 4I01A 1KU2A 1XN7A 1XTAA 3FXMA 4C3JJ 2MW8A 5C3EJ 4XLFA 2A6HF 3ZCOA 1H9GA 1DP7P 3IWZA 4KYWA 3JCUC 4LLNA 4HG2A 4PJLA 1CGPA 3FISA 3OMYA 4MFEA 4FX4A 2RN7A 2IS6A 5FO5A 2LY2A 3LFUA 4BYYA 3KP2A 2XASA 4ZYGA 1K6OA 1D0XA 3ESWB 4M71A 1JT6A 3H92A 4HLXA 1WQ2A 4AIHA 3T5XA 2DOFA 4XKWA 4Y3OA 2JA2A 4BE2A 3HJEA 4UV9A 5FKNA 2W82A 4IOCF 1JI8A 2ID3A 2W84A 3O3KA 5IOZA 5D5WB 2ELKA 1F36A 1HBXG 4LK1F 2OTJI 2A05A 2GXAA 1XMKA 4HSTA 1BA5A 2VPLA 3L2WA 1LFUP 3KPHA 1VQ8I 3GTQJ 2V79A 3A1YA 3HRTA 3BJAA 2P6TA 1R9TJ 3I54A 5EG0B 2Q0OA 3I71A 5DDGA 5K7FA 2JA8J 4RGRA 2K85A 3D1NI 2K9MA 3EUHA 1MMDA 4AUXA 2VKVA 3T1BA 1IW7F 4MEXF 3IRRA 3I4NJ 1JGSA 1X3WB 2A68F 3LSTA 4UUSA 3JSOA 3I4PA 4ESJA 2LSOA 5E1ZB 2KP6A 1UHSA 4XM3A 3ZXSA 1DPUA 1V3FA 1U0JA 4RB1A 4L9JA 1N25A 2DBBA 4RB3C 2LP0A 2COBA 3G6EI 2YUSA 4QIWN 1V5FA 2FRHA 2LLKA 4ZJZA 1FOXA 5H20A 2KJBA 3KYLA 1ZG5A 2PJRA 2QQBA 4EJWA 2DA4A 4KDPA 3CDLA 1U9NA 4UUTA 3S32A 1OISA 2KFDA 3ZQFA 1EF4A 3WG7H 4R79A 4O5VA 4XIDA 3F8MA 3ECOA 2K02A 2A69F 2AXTC 1D1AA 2WB1A 3TKYA 2L54A 3K4JA 4YELA 4RDUA 2M45A 3O2PE 1SVOA 1U2WA 2O5RA 2X51A 2NOJB 2K3PA 1K79A 1BJAA 4ESBA 1K4TA 3GTLJ 1BR1A 1VQ5I 4LG0B 1WJFA 3REOA 4XMYA 4O3MA 2CSOA 2AO9A 4FQGA 2EIMH 4CYCB 1VQPI 1FX7A 3LSMA 3AG2H 3JRFA 2NVXJ 5DCFA 1W0UA 4BEHA 4Q47A 2ACJA 3OS2A 2W48A 3AG4H 3ERMA 5DEQA 4HA8A 2R7WA 4KFCA 2MH9A 1SVLA 4RLFA 5LFAA 5FKKA 1S72I 4AIKA 2IT0A 1ZGAA 1FIAA 2DA3A 1QZYA 3LSIA 1XG1A 2MG4A 3BTLA 1MGTA 2V9VA 3H35A 3SZTA 4NC7A 1BI1A 5KCMA 4OMYA 3O8GA 1BM9A 5K5RA 2GIZA 4TV7A 5DS9A 2W1OA 3G4SI 3MKWB 2QSGX 2ISYA 1YE9A 4RAFA 1KQ8A 3RJPA 1RI7A 1DQUA 4AM3A 2Y2ZA 1L3LA 1NH3A 3DEUA 1Y1VJ 1R7JA 1T98A 2EINH 3M07A 4Y17A 4MNUA 1H8AC 2X6XA 3HTUA 2HFHA 5FRMA 1ACIA 1FBUA 1Z7LA 4PFOA 2M34A 1SD4A 4I7HA 2F5CA 3MVPA 2XF7A 4UB8C 3S16J 2KJCA 3PIPF 2CV2A 2HEOA 4RGUA 1HW2A 1DGRM 1BOBA 4FHTA 1Z3YA 4M9XA 4O6JA 3J80Z 1I1SA 4XBFA 3CMYA 1GXQA 4KMFA 3CCVI 4HF2A 4IPAA 2VASA 1VQ4I 1R5HA 1O7LA 5E3OA 2MC3A 3HSEA 1T56A 4ABZA 1IF1A 5HS7A 5LD2C 3JR9A 3DTEA 3K70D 4D5FA 2P7CB 1YQAA 4M74A 2VL8A 5HNFA 2BBYA 4OAZA 4L0YB 2LY1A 2ESHA 1FIPA 1ORKA 2AQFA 1R22A 2RQPA 1B72B 2VONA 4UUVA 2Y9ZA 3L2RA 2ECCA 2JRTA 2XUBA 1JHFA 4IEJA 4P9UA 5GTIC 2FNPA 4D7NA 5B3SH 5ICCA 4CUGA 3CCSI 2B0LA 4RGSA 1S8NA 2FX0A 3I55I 2BXYA 1IZ1A 1GLNA 3QAHA 2ADUA 5E20A 1KQ0A 3OYEA 1G3SA 3TO9A 4BH9A 1A6IA 3TP0A 1IXSB 4L9TA 3JRBA 3GVAA 1BIBA 1FBQA 1Z21A 2EA2A 3MD2A 3DPTA 4J19A 3BG6A 4JK1X 3DLAA 2MLKA 4G7ZF 4CZZA 1HXDA 1USSA 2OF7A 4A2UA 1OCOH 3HKZN 3GZNB 3OOPA 1WRJA 3UR3C 3M1CA 5J4YA 1FMVA 1VFCA 1J09A 2FBHA 3GWZA 3WGHA 1D8JA 2RDPA 1E0EA 1MBJA 3DBHB 1SMTA 3DEEA 2ETHA 2EZHA 1A36A 1AHDP 2LVSA 1IDZA 2Z16A 1VTNC 2Q8KA 3DPUA 3CUQB 3ERED 3BTCA 1U78A 2RQQA 2NS7A 1HLVA 5A2QK 4UHTA 1ON2A 3IL2A 1FY7A 3WHCA 2IA1A 5HLGA 2E2JJ 1I27A 3Q0WA 3VYSB 4EM0B 3T8RA 1X58A 3DV8A 3TP3A 2GZWA 2LKPA 2LOOA 5ICFA 3CMAI 4CZCA 4LMYA 4LIVA 4Y13A 5H6RA 3F6OA 3KLNA 1KA8A 4F52A 5GPAA 3OYKA 1C0WA 3E97A 4FCYA 1QU3A 2HNHA 2IP2A 4LIUA 4U88A 3NWTA 1W7PB 4IL6C 1FLIA 1U5TC 2XROA 4MTDA 3N97A 2KKOA 1FEXA 5CQEA 4E7KA 3VFZA 3OY9A 1L0OC 1YW9A 3SEZA 2EZLA 1QBJA 4PCQA 1TTYA 1Y6IA 5IYBJ 1IN8A 2RNJA 2E1MC 5B5EC 4OIOF 3DFGA 2CQNA 4HF0A 2H8WA 5JR3A 1GV2A 3TDZC 1P2FA 1QZEA 1HKTA 2OC6A 2Z99A 3ECHA 3OYFA 4DZPA 1I5ZA 2KISA 4GDFA 1PYVA 5CVJA 1MNMC 4Q4ZF 4ASNA 2WTEA 2OCEA 4HQMA 5HVQC 2C6YA 1WFXA 2W7NA 3BROA 4OAYA 1QPIA 4AD9A 5JLXA 2HVRA 1X1PA 3P9KA 2XKOA 3PUBA 5E1XA 3T0YA 4PJJA 4XL9A 1POGA 3K9TA 2EZKA 1MD0A 1Q1VA 1TNTA 5ILSA 2EPFA 3CC2I 2IA2A 2RKHA 3J81K 1FYLA 2VC0A 3WTUC 2XSDC 2BZTA 1ZTRA 2KRCA 2CGPA 4BQAA 3H0DA 4FISA 4CO8A 1IV6A 4M6YA 2WA0A 1MKMA 5J8CA 1STZA 3BR6A 3IUOA 3LSKA 3A4CA 1TZLA 1P4XA 2BW3A 3KP4A 3S3MA 4JQFA 1YS6A 3LQQA 3QPLA 1LVAA 1GT0C 1MJAA 2PEXA 4P9FA 3OWTA 4P55A 1BR4A 2LREA 1D0ZA 2DT5A 4CCLA 1BI0A 1V55H 4WCGA 2Z9OA 2FBKA 3BJOA 4W97A 1R5GA 1MSEC 4XNFA 4I76A 2WC2A 4HW0A 1ETWA 4G6DA 2VT2A 2TCTA 2DFFA 2QA4I 1ZGJA 4M6XA 2PLYA 2CFXA 2HTSA 3RYRA 5IT3A 2BGCA 3HRMA 2P5KA 2M8GX 4NDLA 2NYXA 2R7OA 2R7TA 1W7PD 2LR8A 1OJLA 3MKYB 4IKFA 3BWGA 3F0CA 1W36D 2EFOA 3O8HA 3FK6A 2HPIA 1UB9A 5D8LB 2BHZA 4DYQA 4KNYA 1LPQA 1D5YA 3K0LA 1IJWC 2AQEA 5H6QA 1S9HA 3VB2A 3OYCA 3ZQCA 3OYAA 5D4SA 4YRVA 3S2WA 4BACA 5FKLA 4OIPF 3RYPA 1VI0A 2DPUA 5LGTA 1CF7A 1HF0A 4CHUA 2DTZA 3GYHX 2L7MP 3LWFA 2VKEA 4A0XA 2F5EA 4UUSB 1YITI 2IPQX 4A3GJ 5DCMA 3D5RC 2ZXWH 4X0GA 2XRLA 3FK7A 2DYRH 3GTMJ 2WAEA 5CLSA 5EYRA 3BY6A 3CCMI 3JRIA 1R1TA 2VJJA 1B8IA 3L7WA 2WBMA 1IDYA 5D5UB 1DU0A 2JJ7A 1E3PA 2V1XA 2PJRB 3MN2A 1FT9A 3GLLA 5HS9A 3SDBA 2IGKA 1J2XA 2MSYA 4HX8A 4LJZF 2DYSH 5F6FA 1QA6A 1V54H 2FUG2 4F7ZA 4ZTJA 3G3ZA 4G12A 1IO2A 1Z6RA 2VIXA 2Y0MA 1R49A 1EJ9A 5BS6A 2F5DA 3QYFA 4I99C 4UVAA 2F4OB 3ZP5A 1MMNA 2WY8Q 3RCOA 2HZTA 5GPCA 3K6GA 2GM4A 2Y0SN 1A5JA 4IO9F 1GVDA 5LHHA 1HKQA 4EJVA 3TL4X 2E1CA 4E4HA 4IHSA 4IRHA 3SJMA 4L0ZB 2QWWA 3SZGA 1ZG1A 2DLLA 3GZ6A 1W5SA 3I64A 1Y56A 2CW0F 3J80K 5F04A 2CMPA 1DUXC 2V26A 2JQ7A 1XB4A 2HWVA 4CH7A 2R7SA 1T8IA 3KP5A 2B63J 1XGMA 4E6KG 4BEHB 3QP6A 2IGMA 1NTCA 2CQXA 3PO3J 3R6SA 2ZBKA 3FBNB 3NAUA 4OOIA 2P5LC 2R7DA 1JKQC 1VQ7I 3E5XA 2DXIA 1A04A 1FNNA 2HS5A 2QKLB 5M5YJ 4XLHA 1AWCA 2OZUA 4L5EA 3HOYJ 2QSFX 3M4OJ 4ZYDA 2R5ZA 2X6YA 2LDUA 1X4PA 1ONVA 3H1CA 2HDWA 3DTKA 3D5SC 1FJLA 1T0FA 1RESA 1R4NB 2X0LA 3DTIA 4BBSJ 1R23A 1ON1A 2JA7J 2NS8A 3BCAA 5JHFA 2CH0A 2DO7A 3FMQA 2Y9YA 4DJAA 1ZGWA 2E1OA 2UXXA 4CSWA 3AAFA 2OUMA 1O3RA 2FXAA 3RZOJ 1UFMA 3CJNA 1BC7C 3HOWJ 3BQYA 2DTRA 2GIVA 3F23A 2FNAA 5M5XJ 1AA7A 2LMDA 2HOAA 1XC5A 3BP8A 2EWNA 3OIQA 4YFXF 2P6SA 5F0CA 3ABMH 4Y15A 1P7JA 3DKWA 3RKWA 3TBIA 2R0QC 1QO0D 5HODA 2KIFA 3D5LA 3HYIA 1HSTA 3NQOA 3Q3SA 5HNHA 3P5JA 3F22A 1J75A 2HGCA 3K7AJ 3PFIA 5HDGA 1Z91A 4I09A 3E5QA 3G1OA 1LNWA 2EIKH 4A3FJ 4AWXB 3ZPLA 1J9IA 1Y1WJ 4GFBA 4K2EA 2ESNA 3JAMK 2VQLA 1O3SA 3LAPA 5CVRA 1JTYA 1W1WE 3FXLA 3J7ZI 3M8FA 1VZ0A 3OSFA 2OA4A 4E7JA 1WH7A 4BUPA 4AYBN 3LNQA 2P8TA 4U0VA 3HOXJ 3BG3A 4FTHA 4CCOA 4EATA 1ZLKA 3PL8A 4RLQA 3C2BA 1VQMI 1OR7A 1MBFA 4GYGA 4HRIA 2Z2SB 5BMZA 3OL4A 2H6CA 3ASOH 2FQ4A 3HOUJ 3F72A 3JRGA 3V42A 3TMOA 2DJNA 2BV6A 3S2HJ 1MBHA 2LFBA 5E8GA 3VYRB 4B48A 4QLCU 2OTLI 2OD5A 3DCFA 1EH8A 1XSVA 4LB6B 4P96A 2PN6A 4MO7A 2ZXIA 5L3FA 4G9YA 4IXAA 1E2XA 2E36A 1UJ8A 1TQPA 4A0YA 2QZ8A 2XV4S 2CUJA 3CP2A 4M3FA 2B9SA 3Q0UA 5K7ZA 1MDMA 1OCTC 3RQ4A 1MJBA 4RB0A 3E3VA 2OQGA 4M72A 1ZG3A 3QPTA 4BY7J 3OSGA 2YR2A 1SAXA 2NXNB 3LA7A 4RS8A 5K1YA 3TW6A 2UV1A 1LFBA 3RKYA 4N4OB 2ZSIB 4YG2F 2L7KA 2PBIA 3BTJA 1NHAA 2RVCA 4B4CA 1T33A 1AU7A 1JUPA 5EZGA 3DKXA 1SD5A 3HRUA 1MW7A 4N4NB 4EMSA 2VLAA 2ICWG 3AL0C 2XSJC 3KIOA 3QPHA 2ZFWA 5FRNA 2DFEA 4F3QA 4V2FA 4GGGA 4B43A 3H3ZA 3PM1A 1E3OC 1LEBA 3CCEI 3BQZA 2IA0A 3CDIA 3HPHA 2BHYA 4QPQA 4HBLA 4Y52J 1EKEA 1Z67A 2IS4A 2DA5A 3W2AA 1P4AA 3OIOA 3BG5A 1YW7A 3ZMSA 2HYGD 4R8HA 3TO7A 1I50J 1S5LC 1RKWA 3N05A 5IP9J 2DMTA 1T6SA 2BXZA 4YEJA 4U7BA 3RI4A 5C4JJ 5BPIA 1FOKA 2VOPA 2K4JA 4C9YA 5K5OA 3OYBA 5HLIA 3ZQQA 3RIRA 3KYCB 3X2QH 2L02A 1QHHD 3J81Z 2EB7A 1HDDC 4WX9A 2LH9A 2R7VA 1S7OA 2PI0A 2UXNA 4FE7A 1XCVA 1DDNA 2W4SA 3CCLI 2F5FA 5FLVA 4Y33A 3KFWX 3IH3A 3BDDA 1PP8F 1LE8A 3OIPA 4U7DA 5FFXA 4A6EA 1OFCX 4BJ5C 4KITB 4BXXJ 3BZCA 4XSXF 4RGXA 1ERDA 1V5GA 2CFOA 1W5TA 2ZMEA 3VSKA 3MZHA 2G0EA 5IYCJ 4HX7A 1QGPA 2M5WA 3CCYA 5FGMA 5J1UA 2AS5F 4E7SA 3ELKA 1XPXA 1ZR2A 2R4GA 2FMYA 4HAMA 5AIQA 5BPDA 5CVUA 1ETYA 1ZAOA 2BW3B 4D1QA 1HOMA 2YPRA 4XRSG 2WV0A 3GCMA 2VQCA 3HG9A 2QEXI 5CVVA 2VODA 1SFUA 2EA4A 1D0YA 2V9PA 1MNDA 3RKXA 3CUOA 1ZELA 4RAYA 3JREA 2L5QA 1LVKA 3ZR8X 5J8FA 4BDZA 3CC4I 2FJ1A 1R58A 3CZ6A 3QRFF 5KK1A 1OCZH 4MFDA 3OR1C 5LGNA 2M3AA 2BE5F 3FF5A 3I58A 4QWQA 3V7CA 4RAZA 2IBDA 2DFIA 3WTTC 2HR3A 4F92B 3S14J 4M6VA 1BI3A 1ULYA 2QM3A 2GXGA 1Z6TA 1IV8A 3NEUA 1YIOA 1FBSA 5LLQA 2JA5J 4XRFA 2EILH 3K2AA 2F48A 1F5TA 3BC8A 2V1NA 2EFPA 2JPBA 2PMZN 5CPRB 2HOTA 5L3CA 4U0WA 1EH6A 4EVIA 5ERIA 1IN5A 3R61A 5DTDA 2R7QA 3DKYA 3CJRB 2DA2A 4XQFA 2OQRA 4A93J 2GWRA 2CRGA 2DPDA 3I4MJ 5IT9K 4A5MA 1CF7B 1FC3A 4MTEA 2XAGA 3VEPA 3LL7A 4HF1A 1GXPA 3KYDB 4EGYA 3C3WA 4JP0A 3RPQA 5ED4A 2V9KA 1TQMA 2Y69H 2HQ5A 3G1LA 4M9SA 5TRDA 5DCMB 2X6WA 5BNGA 3WTXC 4X6AJ 4B3AA 2O61A 4EQQA 1IXRC 3B6AA 3LSPA 2Z1DA 2LKSA 1K7AA 3KP7A 3CCJI 3QU3A 1B8IB 2K4BA 1R1VA 3HKZA 1X1BA 1PP7U 1JE8A 1XSXA 2DQLA 3B73A 4RBOA 4AC0A 5TGTA 3WHBA 4EEFG 3K70C 1FMWA 3ZMVA 4IHYA 3QP5A 3CESA 1P6RA 2KQRA 4M3DA 1P4WA 3BPXA 3GEZA 4UB6C 2CW7A 1W5CC 3LSJA 1MSFC 1SFEA 1APLC 4LFUA 4A3CJ 2K5CA 3FXJA 4BXUA 4KIBA 1Z3XA 3IHUA 3NRVA 1MH4A 1XMAA 2I8DA 4PJNA 1ETQA 2N8GA 3S15J 4CCMA 2JZYA 3HEFA 1H0MA 1BI2A 3H5AA 3ZOBA 4RMNA 1FP2A 3KEOA 1EA3A 4N9HA 4B47A 1O3TA 3E1SA 2MGQA 2VOOA 2EFNA 2CG4A 1YHQI 1KU3A 3OYMA 1UCRA 2FA5A 3BG7A 3U1KA 2GLOA 4AVPA 3DLLF 1IUFA 2EV6A 2ID6A 1P9QC 3R0JA 1R00A 2DT7B 5FB2A 3B6CA 3L9FA 1S7EA 2JK3A 1MBGA 2CU7A 3KZYA 4B1RA 5J47A 2KDOA 3GLXA 1IN6A 5IP6A 1LDDA 2HOSA 3F6VA 2ZKZA 3U1DA 1Q1HA 2JRMA 1SFXA 1S6LA 2PMHA 2W57A 3BJ6A 4HPQA 2KPMA 1IRXA 2R7UA 4J00A 4E7ZA 1MH3A 1F4KA 5LRRA 2XPWA 1WSUA 2MA3A 3GW2A 2R5ZB 2ZNZA 3CLOA 3K10A 2IAIA 3OYDA 2VUMJ 4CDGA 4XOPA 1VQOI 5FKOA 3R60A 3V8LA 5DUIA 4N9IA 5GAGJ 2KLOA 3OYGA 3E6DA 4XONA 4DYCA 2R93J 3U21A 2GBYA 3VODA 3HUGA 4XICA 4B8XA 4XLNF 2L0KA 4N0BA 3N4MA 1QQIA 3JAMZ 2A5YB 1TWHJ 3K1MA 3RSNA 1G2HA 3C1DA 4HDVA 5D8KB 2V6EA 5F64A 1HKSA 4S0HB 5DV5A 3OYLA 3HBLA 4D7MA 2XB5A 1TWAJ 4Q48A 1LEAA 5TJJA 2VQHA 2D5VA 4NC6A 4G6QA 4I0BA 2KT0A 2NS0A 4E70A 1J59A 4H4KC 2HTJA 2HDDA 1VQ6I 2VJ4A 1YX3A 4A12A 4XLEA 3KZIC 1H88C 1FYMA 4S04A 5CVIA 4KT6A 2Z3YA 3E6BA 2GOXB 3DQVC 3K1PA 5EEHA
chains in the Genus database with same CATH topology
2RGVA 3SQNA 5E1WA 3L2CA 4LB5A 4ZH4F 2YSRA 3K69A 1TNSA 2PMUA 1K78A 2E7XA 4BNCA 2MD5A 2K7LA 2LF7A 3M9AA 4KUMA 3EYYA 4G94A 2FQ3A 1G3WA 3FM3A 3FWEA 2ZJ2A 3KZZA 2IJLA 4PGGA 2M8EA 4LGWA 2VC1A 2XAFA 2EFWA 1MDMB 4WXCA 5L3GA 3CUQC 3FXQA 1LB2A 4EM1A 3TQNA 1UHMA 2VE9A 2STWA 4IHTA 3PQKA 2G7HA 2ZNYA 5DUKA 3T8TA 3TOAA 2PG4A 4ON0A 5ICGA 3H3UA 4CYDA 3WTWC 3HSRA 2FSWA 4KN4X 2UZKA 1OMIA 3Q9SA 1IN7A 3M1EA 3IWFA 4UNOA 5HDKA 1XGSA 3E6CC 3EYIA 3FMSA 3WODF 4I98B 1BC8C 3MQ0A 4MGRA 3BOQA 1GHCA 4M9ZA 2QQAA 4AIJA 3F8FA 5D5VB 1H9TA 5DD8A 2VE8A 2FEZA 4L9NA 2L3DA 5LEKA 2EJRA 2Y48A 2ZMEB 4HDUA 2AXLA 4P5OA 3GZ5A 2O0YA 4UVCA 1T38A 2KIMA 1D3YA 3KE2A 2EK5A 3FXUA 3HSFA 3LFKA 2K86A 2VBWA 2R3SA 1LQ1A 4IF4A 1OYWA 2A61A 2Z33A 4ENKA 2VXZA 3BZ6A 5IT9Z 2J5OA 1U5TA 1HW5A 2RV8A 5JHUA 3MCZA 3GUDA 1ZREA 3J7AO 2WWYA 2M87A 1SMYF 3RDIA 2FF4A 1XDSA 5AONA 5FFZA 3WTVC 1PDNC 5LEJA 2X4HA 1G3YA 1FWZA 1W4MA 5K5QA 2G7UA 2HQNA 2NNYA 2DQRA 5AIPA 1KQ9A 2GA1A 2W25A 4IJAA 4XSZF 3CO6C 4PDKA 3JW4A 4B09A 4GCVA 4EM2A 1HQCA 2O3FA 1PUEE 4GXOA 2LF8A 3GFJA 1G3TA 2LNBA 5ILVA 5HOOA 5E17F 2KRFA 3KP3A 3Q5FA 2H94A 2E7WA 2VBXA 3D0SA 2XAQA 4I2OA 2YX7A 4A5NA 3I59A 3JSPA 4KN7X 5L3DA 2MH2A 3IKVA 1T2KA 2HKOA 4D0PA 4R1HA 4M73A 4BAYA 4JBAA 3LA2A 3ZQ7A 2VBYA 4LD5A 2A3SA 2EV5A 3V4GA 2HDCA 1TW2A 1MJ9A 2UWMA 3ZN0A 3GX4X 1IUYA 5BOXA 3SXYA 4IRIA 4LLGF 1RUNA 3KLOA 3IRQA 1ZN2A 4BHPA 1ZRCA 2P7VB 4NHJA 3M7GA 3GFMA 3KP6A 1B9MA 4XLPF 1REPC 3F21A 4UVBA 2QLZA 3DXJF 1O57A 2DU9A 2XVCA 2ELHA 1KYWA 3W6KB 1USTA 1I1GA 1U8RA 3F8CA 1S3JA 3FM5A 5ILUA 4KIGA 5L3EA 3HRSA 2FE3A 4CGZA 5JFRA 3FHZA 4YFKF 2V6CA 2W24A 1ZLJA 2XGXA 5DD4A 3WU1B 1K78B 2GQQA 3FX3A 1YO5C 1ZH5A 4CXFA 1B4AA 5FLXK 4FX0A 1Z1DA 1QZZA 2V1DA 2DW4A 1ZHFA 4G7HF 4HV5A 4MQVA 2Q2EA 1TLHB 2MLGA 6PAXA 2PFBA 5FD5A 4RB2C 1RZ4A 4U0YA 3U2RA 2STTA 2ZCWA 2JPCA 2H27A 4BHCA 4DQ2A 3WE2A 3OV8A 1RIOH 4IRGA 2DAOA 4HZFA 3Q9VA 1TW3A 1XGOA 1LJ9A 2E1NA 2L01A 1LDJA 2NNNA 4I02A 2ZXJA 4G7OF 3HHHA 3ZMZA 4FT8A 2HQRA 2QUFA 5LHIA 4Q5SF 3JTHA 4KICA 5LHGA 1B1BA 2QENA 4ESFA 2OAZA 4OIQF 3GFLA 3MZYA 3R4KA 1FZPB 4WWCA 3I53A 1U3EM 1Z7UA 4ZYEA 3ABUA 2J5PA 4YFNF 2COMA 3EDPA 5D4RA 2JSCA 1KYZA 2FOKA 2NAZA 5EEGA 4L18B 5L3BA 5LGUA 2BEOA 5FD6A 4HX4A 1KU7A 3RPUA 2PJPA 1R36A 1SD7A 3SZPA 2M30A 2NRAC 3KEQA 3CDHA 4OIRF 4HQEA 4EJTA 1P92A 3E5UA 3KETA 4L5JA 4NQWA 1XD7A 5D6FA 2O8XA 1T39A 2V1UA 2L4AA 3JTGA 2RC4A 1IRFA 1FPQA 5E8IA 1QPMA 1U5TB 3F8BA 5JVTA 4PZJA 1YLFA 5ICEA 5HDNA 1G4DA 3TOBA 4OMZA 1BIAA 3IKTA 4DNCA 3B02A 4HYEA 3MAJA 1YW8A 3ROUA 2D1VA 3WU0A 1BBYA 4ENJA 1KU9A 4S05A 3WGGA 2GAUA 1O3QA 1UHWA 2QBYA 1QNTA 2CYYA 1EV7A 4MEYF 3CO7C 3LQRA 3SFZA 3M8EA 4ENNA 5HLHA 4EV0A 1BOAA 4WF2A 2TDXA 3HTSB 3R0AA 2JTVA 2EFQA 4WK8F 3HOSA 2K27A 5CYVA 2CQKA 3QOPA 1XSDA 3GO5A 4L9VA 1AOYA 5D6EA 3V7SA 5F1RA 3U9GA 3WG9A 2VT3A 3ULQB 3WE3A 4UXNA 3I59B 3RTRA 3I5UA 3ISPA 3MEXA 3QU6A 1E17A 1V4RA 1XDUA 1OYIA 3CTAA 3MFKA 4Z2YA 3DF8A 3GXOA 2O6GE 2D1HA 1IRGA 2VBZA 5DYMA 3ML6A 2VN2A 5CJ9A 3GF2A 3GFIA 3WTZA 2ISZA 3DP7A 1IAWA 2DI3A 3EQLF 2W85A 4G8XA 4NB5A 5JI6A 1R1UA 3L00A 4EJOA 3V8JA 3E6MA 4LLLA 2GA2A 3HHGA 4CICA 2FMLA 2L4MA 4MHGA 4ZZDA 4PGHA 2H6BA 1X3UA 3HIFA 2H09A 1ZRDA 4YIFA 4EGZA 3EETA 3K2ZA 1YFHA 1JXSA 1JHHA 4MQ9F 1B9NA 5KVRA 4GO1A 3I0TA 3P7NA 1I6XA 2XIGA 3IC7A 2CWEA 2DK5A 2G9WA 1IXCA 5FLXZ 1FYKA 4LK0F 2A6EF 1OKRA 1SD6A 1U6GA 2QVOA 4LG0A 1B59A 2Z5UA 3DPLC 2D2WA 1Y0UA 4HV6A 3WTSC 3WTYC 1G6NA 1IN4A 1F1ZA 5E18F 3ZN1A 2JT1A 4KA4A 2OU2A 1LDKB 2F2EA 1MZBA 4OU0A 1ZRFA 1EH7A 1D8KA 1TBXA 3ZMTA 3ABTA 2PQ8A 3P9CA 1HW1A 3F8NA 4L5IA 1J5YA 2YX4A 5HS8A 2YU3A 1ZYRF 2KIUA 3FXRA 4WXDA 3TGNA 1BN5A 4ZZLA 1F9NA 1WI9A 1Z05A 4A6DA 2ZO4A 3FMRA 2XKPA 3SHFA 4H0EA 4BHBA 1XGNA 3C7JA 1FSHA 2OBPA 2HYFA 4ZYHA 4KMUX 1S29A 3ZMUA 1YTYA 2HKXA 1KGSA 3WGIA 1S7AA 1ZARA 1HSJA 4EJUA 3TO6A 5LBQA 4HLYA 1TQIA 1YYVA 1XCBA 2Y75A 2DK8A 1FSEA 3CUQA 5BQTA 2XAJA 1O7FA 3LAJA 3O6BB 4ETSA 2FU4A 1ODDA 3G73A 3BPVA 2BYVE 1YS7A 2QQ9A 5D5XB 2MBFA 4KIFA 3FZVA 1WWXA 1GVJA 2IW5A 2FBIA 2IRFG 1W7PA 4UV8A 2EV0A 2CO5A 2GXBA 1RNLA 2XAHA 2P5VA 1Z9CA 3F3XA 3ZMDA 2HOEA 3LA3A 3C18A 2R7FA 4IVNA 2O03A 2A07F 4A0ZA 2QBYB 5A2QZ 3P9IA 5J6XA 2XRNA 4YIIA 3W6JB 3TDUC 2M1BA 2XHKA 1B6AA 1J0RA 1WKMA 3PQJA 1OPCA 4ENMA 3KCCA 2IVMA 4OINF 1D5VA 1FP1D 3COAC 3V8KA 4GYIA 1YG2A 1RUOA 5LRSA 1OYYA 2D45A 3MWMA 4I0AA 2P4WA 4KT5C 1J7KA 3K1NA 3V7RA 4WXHA 1DPRA 2QYOA 3VOEA 4HOBA 3HOTA 2OZ6A 3L09A 4I01A 1KU2A 1XN7A 2A6HF 1DP7P 1H9GA 3IWZA 4KYWA 4LLNA 1CGPA 4FX4A 2RN7A 5FO5A 4BYYA 3KP2A 2XASA 4ZYGA 1K6OA 4M71A 3H92A 4HLXA 1WQ2A 4AIHA 3T5XA 4UV9A 2W84A 3O3KA 5D5WB 1HBXG 4LK1F 1XMKA 2V79A 3HRTA 3BJAA 2P6TA 3I54A 2Q0OA 3I71A 5DDGA 4RGRA 3EUHA 3T1BA 1IW7F 4MEXF 3IRRA 1JGSA 2A68F 3LSTA 3JSOA 3I4PA 4ESJA 2LSOA 5E1ZB 1DPUA 1V3FA 4RB1A 4L9JA 2DBBA 4RB3C 2FRHA 5H20A 2KJBA 1ZG5A 2QQBA 4EJWA 4KDPA 4R79A 4O5VA 3F8MA 3ECOA 2K02A 2A69F 3TKYA 2L54A 2M45A 3O2PE 1U2WA 1K79A 1BJAA 4ESBA 4LG0B 3REOA 4O3MA 2CSOA 1FX7A 5DCFA 4Q47A 2ACJA 5DEQA 4HA8A 4KFCA 2MH9A 4AIKA 2IT0A 1ZGAA 1QZYA 1MGTA 2V9VA 3SZTA 1BI1A 4OMYA 1BM9A 5K5RA 4TV7A 2ISYA 1KQ8A 3RJPA 1RI7A 1L3LA 3DEUA 1R7JA 1T98A 4Y17A 4MNUA 3HTUA 2HFHA 1FBUA 1SD4A 4I7HA 2F5CA 2KJCA 2HEOA 4RGUA 1HW2A 4M9XA 4FHTA 4O6JA 3J80Z 1I1SA 4XBFA 1GXQA 4KMFA 4HF2A 4IPAA 1R5HA 1O7LA 2MC3A 3HSEA 1IF1A 5HS7A 2P7CB 1YQAA 4M74A 2BBYA 4L0YB 2ESHA 1R22A 2RQPA 2VONA 4UUVA 2XUBA 2JRTA 1JHFA 4P9UA 2FNPA 5ICCA 2B0LA 4RGSA 1S8NA 1IZ1A 3QAHA 2ADUA 5E20A 1KQ0A 1G3SA 3TO9A 4BH9A 1IXSB 4L9TA 3GVAA 1BIBA 1FBQA 2EA2A 3DPTA 4JK1X 2MLKA 4G7ZF 4CZZA 1HXDA 1USSA 4A2UA 3OOPA 1WRJA 2FBHA 3GWZA 3WGHA 1D8JA 2RDPA 1SMTA 2ETHA 1VTNC 2Q8KA 3CUQB 3ERED 1U78A 5A2QK 4UHTA 1ON2A 3IL2A 1FY7A 2IA1A 5HLGA 1I27A 4EM0B 3T8RA 3DV8A 2GZWA 2LKPA 5ICFA 4LMYA 4Y13A 5H6RA 3F6OA 3KLNA 1KA8A 1C0WA 3E97A 2IP2A 4U88A 1W7PB 1FLIA 1U5TC 2XROA 4MTDA 3N97A 2KKOA 3VFZA 1L0OC 1YW9A 1QBJA 4PCQA 1TTYA 1IN8A 2RNJA 4OIOF 3DFGA 4HF0A 5JR3A 3TDZC 1P2FA 1HKTA 2Z99A 3ECHA 1I5ZA 5CVJA 4Q4ZF 4ASNA 2WTEA 4HQMA 5HVQC 2C6YA 3BROA 4AD9A 3P9KA 2XKOA 5E1XA 3T0YA 3K9TA 1MD0A 1TNTA 5ILSA 2IA2A 2RKHA 3J81K 1FYLA 2VC0A 3WTUC 4BQAA 2CGPA 4CO8A 4M6YA 1MKMA 5J8CA 1STZA 1P4XA 3KP4A 4JQFA 1YS6A 3LQQA 1LVAA 1MJAA 2PEXA 4P9FA 4P55A 2DT5A 1BI0A 4WCGA 2Z9OA 2FBKA 3BJOA 1R5GA 2WC2A 4HW0A 4G6DA 2VT2A 1ZGJA 4M6XA 2PLYA 2CFXA 2HTSA 3RYRA 5IT3A 2BGCA 3HRMA 2P5KA 2NYXA 1W7PD 3BWGA 2EFOA 1UB9A 5D8LB 4KNYA 3K0LA 5H6QA 3VB2A 5D4SA 3S2WA 4OIPF 3RYPA 2DPUA 5LGTA 1CF7A 4CHUA 3GYHX 3LWFA 4A0XA 2F5EA 2IPQX 5DCMA 5CLSA 3BY6A 1R1TA 3L7WA 5D5UB 2V1XA 1FT9A 5HS9A 1J2XA 4LJZF 5F6FA 4HX8A 4F7ZA 3G3ZA 1Z6RA 2Y0MA 5BS6A 2F5DA 4UVAA 3ZP5A 2HZTA 5LHHA 1HKQA 4EJVA 2E1CA 4IHSA 4IRHA 4L0ZB 2QWWA 1ZG1A 2DLLA 3GZ6A 1W5SA 3I64A 2CW0F 3J80K 1DUXC 1XB4A 2HWVA 3KP5A 1XGMA 3QP6A 3R6SA 2ZBKA 4OOIA 2P5LC 2R7DA 3E5XA 1A04A 1FNNA 2HS5A 1AWCA 2OZUA 4ZYDA 2LDUA 1ONVA 1T0FA 2X0LA 1R23A 1ON1A 2DO7A 3FMQA 2UXXA 3AAFA 1O3RA 2FXAA 1UFMA 3CJNA 1BC7C 2DTRA 2GIVA 3F23A 2FNAA 3BP8A 2EWNA 4YFXF 2P6SA 4Y15A 3DKWA 3RKWA 1QO0D 2KIFA 3D5LA 3HYIA 1HSTA 3NQOA 3F22A 1J75A 2HGCA 3PFIA 5HDGA 1Z91A 4I09A 3E5QA 1LNWA 4AWXB 3ZPLA 1J9IA 4K2EA 2ESNA 3JAMK 1O3SA 3LAPA 5CVRA 3M8FA 2OA4A 2P8TA 4U0VA 1ZLKA 1OR7A 4GYGA 5BMZA 2H6CA 3F72A 2BV6A 5E8GA 4QLCU 2OD5A 1EH8A 1XSVA 4LB6B 4P96A 2PN6A 5L3FA 4G9YA 4IXAA 1E2XA 4A0YA 1TQPA 2QZ8A 2XV4S 1MDMA 1MJBA 4RB0A 3E3VA 2OQGA 4M72A 1ZG3A 3QPTA 2YR2A 1SAXA 3LA7A 4RS8A 5K1YA 3RKYA 4YG2F 2PBIA 1NHAA 2RVCA 1SD5A 3HRUA 4EMSA 3QPHA 2ZFWA 4GGGA 3H3ZA 1LEBA 2IA0A 4HBLA 1P4AA 1YW7A 3ZMSA 2HYGD 4R8HA 3TO7A 1T6SA 4U7BA 3RI4A 5BPIA 1FOKA 2VOPA 2K4JA 5K5OA 5HLIA 3RIRA 2L02A 3J81Z 2EB7A 4WX9A 1S7OA 2PI0A 2UXNA 1XCVA 1DDNA 2F5FA 3KFWX 3BDDA 1PP8F 4U7DA 5FFXA 4A6EA 4XSXF 4RGXA 1W5TA 2ZMEA 3MZHA 4HX7A 1QGPA 2M5WA 5FGMA 2AS5F 3ELKA 4HAMA 2FMYA 5AIQA 5BPDA 5CVUA 1ZAOA 2YPRA 2WV0A 5CVVA 2VODA 1SFUA 2EA4A 3RKXA 3CUOA 4RAYA 5J8FA 1R58A 3QRFF 5KK1A 5LGNA 3FF5A 2BE5F 3I58A 4QWQA 3V7CA 4RAZA 2DFIA 3WTTC 2HR3A 1BI3A 1ULYA 2QM3A 2GXGA 1Z6TA 3NEUA 1YIOA 1FBSA 5LLQA 4XRFA 1F5TA 2EFPA 2JPBA 5L3CA 4U0WA 1EH6A 4EVIA 5ERIA 1IN5A 3R61A 2OQRA 2GWRA 2DPDA 5IT9K 4A5MA 1CF7B 1FC3A 4MTEA 2XAGA 3VEPA 4HF1A 1GXPA 4EGYA 3C3WA 3RPQA 5ED4A 1TQMA 4M9SA 5TRDA 5DCMB 3WTXC 2O61A 4EQQA 1IXRC 1K7AA 3KP7A 3QU3A 1R1VA 2K4BA 1PP7U 1JE8A 1XSXA 2DQLA 3B73A 3ZMVA 3QP5A 1P6RA 1P4WA 3BPXA 3GEZA 1SFEA 4LFUA 4BXUA 4KIBA 3IHUA 3NRVA 1XMAA 2JZYA 1H0MA 1BI2A 1FP2A 3KEOA 4N9HA 1O3TA 2VOOA 2EFNA 2CG4A 1KU3A 1UCRA 2FA5A 4AVPA 2EV6A 3R0JA 1R00A 5FB2A 3L9FA 3KZYA 3GLXA 1IN6A 1LDDA 3F6VA 2ZKZA 3U1DA 1Q1HA 3BJ6A 1SFXA 1S6LA 2PMHA 2W57A 1F4KA 5LRRA 1WSUA 2MA3A 3GW2A 2ZNZA 3CLOA 4CDGA 3R60A 3V8LA 5DUIA 4N9IA 3E6DA 3VODA 3HUGA 4B8XA 4XLNF 4N0BA 3N4MA 1QQIA 3JAMZ 2A5YB 3K1MA 3C1DA 4HDVA 5D8KB 5F64A 1HKSA 5DV5A 4Q48A 5TJJA 1LEAA 4G6QA 4I0BA 2NS0A 4E70A 1J59A 2HTJA 4A12A 1FYMA 4S04A 5CVIA 2Z3YA 3E6BA 3DQVC 3K1PA 5EEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGV A;  3SQN A;  5E1W A;  3L2C A;  4LB5 A;  4ZH4 F;  2YSR A;  3K69 A;  1TNS A;  2PMU A;  1K78 A;  2E7X A;  4BNC A;  2MD5 A;  2K7L A;  2LF7 A;  3M9A A;  4KUM A;  3EYY A;  4G94 A;  2FQ3 A;  1G3W A;  3FM3 A;  3FWE A;  2ZJ2 A;  3KZZ A;  2IJL A;  4PGG A;  2M8E A;  4LGW A;  2VC1 A;  2XAF A;  2EFW A;  1MDM B;  4WXC A;  5L3G A;  3CUQ C;  3FXQ A;  1LB2 A;  4EM1 A;  3TQN A;  1UHM A;  2VE9 A;  2STW A;  4IHT A;  3PQK A;  2G7H A;  2ZNY A;  5DUK A;  3T8T A;  3TOA A;  2PG4 A;  4ON0 A;  5ICG A;  3H3U A;  4CYD A;  3WTW C;  3HSR A;  2FSW A;  4KN4 X;  2UZK A;  1OMI A;  3Q9S A;  1IN7 A;  3M1E A;  3IWF A;  4UNO A;  5HDK A;  1XGS A;  3E6C C;  3EYI A;  3FMS A;  3WOD F;  4I98 B;  1BC8 C;  3MQ0 A;  4MGR A;  3BOQ A;  1GHC A;  4M9Z A;  2QQA A;  4AIJ A;  3F8F A;  5D5V B;  1H9T A;  5DD8 A;  2VE8 A;  2FEZ A;  4L9N A;  2L3D A;  5LEK A;  2EJR A;  2Y48 A;  2ZME B;  4HDU A;  2AXL A;  4P5O A;  3GZ5 A;  2O0Y A;  4UVC A;  1T38 A;  2KIM A;  1D3Y A;  3KE2 A;  2EK5 A;  3FXU A;  3HSF A;  3LFK A;  2K86 A;  2VBW A;  2R3S A;  1LQ1 A;  4IF4 A;  1OYW A;  2A61 A;  2Z33 A;  4ENK A;  2VXZ A;  3BZ6 A;  5IT9 Z;  2J5O A;  1U5T A;  1HW5 A;  2RV8 A;  5JHU A;  3MCZ A;  3GUD A;  1ZRE A;  3J7A O;  2WWY A;  2M87 A;  1SMY F;  3RDI A;  2FF4 A;  1XDS A;  5AON A;  5FFZ A;  3WTV C;  1PDN C;  5LEJ A;  2X4H A;  1G3Y A;  1FWZ A;  1W4M A;  5K5Q A;  2G7U A;  2HQN A;  2NNY A;  2DQR A;  5AIP A;  1KQ9 A;  2GA1 A;  2W25 A;  4IJA A;  4XSZ F;  3CO6 C;  4PDK A;  3JW4 A;  4B09 A;  4GCV A;  4EM2 A;  1HQC A;  2O3F A;  1PUE E;  4GXO A;  2LF8 A;  3GFJ A;  1G3T A;  2LNB A;  5ILV A;  5HOO A;  5E17 F;  2KRF A;  3KP3 A;  3Q5F A;  2H94 A;  2E7W A;  2VBX A;  3D0S A;  2XAQ A;  4I2O A;  2YX7 A;  4A5N A;  3I59 A;  3JSP A;  4KN7 X;  5L3D A;  2MH2 A;  3IKV A;  1T2K A;  2HKO A;  4D0P A;  4R1H A;  4M73 A;  4BAY A;  4JBA A;  3LA2 A;  3ZQ7 A;  2VBY A;  4LD5 A;  2A3S A;  2EV5 A;  3V4G A;  2HDC A;  1TW2 A;  1MJ9 A;  2UWM A;  3ZN0 A;  3GX4 X;  1IUY A;  5BOX A;  3SXY A;  4IRI A;  4LLG F;  1RUN A;  3KLO A;  3IRQ A;  1ZN2 A;  4BHP A;  1ZRC A;  2P7V B;  4NHJ A;  3M7G A;  3GFM A;  3KP6 A;  1B9M A;  4XLP F;  1REP C;  3F21 A;  4UVB A;  2QLZ A;  3DXJ F;  1O57 A;  2DU9 A;  2XVC A;  2ELH A;  1KYW A;  3W6K B;  1UST A;  1I1G A;  1U8R A;  3F8C A;  1S3J A;  3FM5 A;  5ILU A;  4KIG A;  5L3E A;  3HRS A;  2FE3 A;  4CGZ A;  5JFR A;  3FHZ A;  4YFK F;  2V6C A;  2W24 A;  1ZLJ A;  2XGX A;  5DD4 A;  3WU1 B;  1K78 B;  2GQQ A;  3FX3 A;  1YO5 C;  1ZH5 A;  4CXF A;  1B4A A;  5FLX K;  4FX0 A;  1Z1D A;  1QZZ A;  2V1D A;  2DW4 A;  1ZHF A;  4G7H F;  4HV5 A;  4MQV A;  2Q2E A;  1TLH B;  2MLG A;  6PAX A;  2PFB A;  5FD5 A;  4RB2 C;  1RZ4 A;  4U0Y A;  3U2R A;  2STT A;  2ZCW A;  2JPC A;  2H27 A;  4BHC A;  4DQ2 A;  3WE2 A;  3OV8 A;  1RIO H;  4IRG A;  2DAO A;  4HZF A;  3Q9V A;  1TW3 A;  1XGO A;  1LJ9 A;  2E1N A;  2L01 A;  1LDJ A;  2NNN A;  4I02 A;  2ZXJ A;  4G7O F;  3HHH A;  3ZMZ A;  4FT8 A;  2HQR A;  2QUF A;  5LHI A;  4Q5S F;  3JTH A;  4KIC A;  5LHG A;  1B1B A;  2QEN A;  4ESF A;  2OAZ A;  4OIQ F;  3GFL A;  3MZY A;  3R4K A;  1FZP B;  4WWC A;  3I53 A;  1U3E M;  1Z7U A;  4ZYE A;  3ABU A;  2J5P A;  4YFN F;  2COM A;  3EDP A;  5D4R A;  2JSC A;  1KYZ A;  2FOK A;  2NAZ A;  5EEG A;  4L18 B;  5L3B A;  5LGU A;  2BEO A;  5FD6 A;  4HX4 A;  1KU7 A;  3RPU A;  2PJP A;  1R36 A;  1SD7 A;  3SZP A;  2M30 A;  2NRA C;  3KEQ A;  3CDH A;  4OIR F;  4HQE A;  4EJT A;  1P92 A;  3E5U A;  3KET A;  4L5J A;  4NQW A;  1XD7 A;  5D6F A;  2O8X A;  1T39 A;  2V1U A;  2L4A A;  3JTG A;  2RC4 A;  1IRF A;  1FPQ A;  5E8I A;  1QPM A;  1U5T B;  3F8B A;  5JVT A;  4PZJ A;  1YLF A;  5ICE A;  5HDN A;  1G4D A;  3TOB A;  4OMZ A;  1BIA A;  3IKT A;  4DNC A;  3B02 A;  4HYE A;  3MAJ A;  1YW8 A;  3ROU A;  2D1V A;  3WU0 A;  1BBY A;  4ENJ A;  1KU9 A;  4S05 A;  3WGG A;  2GAU A;  1O3Q A;  1UHW A;  2QBY A;  1QNT A;  2CYY A;  1EV7 A;  4MEY F;  3CO7 C;  3LQR A;  3SFZ A;  3M8E A;  4ENN A;  5HLH A;  4EV0 A;  1BOA A;  4WF2 A;  2TDX A;  3HTS B;  3R0A A;  2JTV A;  2EFQ A;  4WK8 F;  3HOS A;  2K27 A;  5CYV A;  2CQK A;  3QOP A;  1XSD A;  3GO5 A;  4L9V A;  1AOY A;  5D6E A;  3V7S A;  5F1R A;  3U9G A;  3WG9 A;  2VT3 A;  3ULQ B;  3WE3 A;  4UXN A;  3I59 B;  3RTR A;  3I5U A;  3ISP A;  3MEX A;  3QU6 A;  1E17 A;  1V4R A;  1XDU A;  1OYI A;  3CTA A;  3MFK A;  4Z2Y A;  3DF8 A;  3GXO A;  2O6G E;  2D1H A;  1IRG A;  2VBZ A;  5DYM A;  3ML6 A;  2VN2 A;  5CJ9 A;  3GF2 A;  3GFI A;  3WTZ A;  2ISZ A;  3DP7 A;  1IAW A;  2DI3 A;  3EQL F;  2W85 A;  4G8X A;  4NB5 A;  5JI6 A;  1R1U A;  3L00 A;  4EJO A;  3V8J A;  3E6M A;  4LLL A;  2GA2 A;  3HHG A;  4CIC A;  2FML A;  2L4M A;  4MHG A;  4ZZD A;  4PGH A;  2H6B A;  1X3U A;  3HIF A;  2H09 A;  1ZRD A;  4YIF A;  4EGZ A;  3EET A;  3K2Z A;  1YFH A;  1JXS A;  1JHH A;  4MQ9 F;  1B9N A;  5KVR A;  4GO1 A;  3I0T A;  3P7N A;  1I6X A;  2XIG A;  3IC7 A;  2CWE A;  2DK5 A;  2G9W A;  1IXC A;  5FLX Z;  1FYK A;  4LK0 F;  2A6E F;  1OKR A;  1SD6 A;  1U6G A;  2QVO A;  4LG0 A;  1B59 A;  2Z5U A;  3DPL C;  2D2W A;  1Y0U A;  4HV6 A;  3WTS C;  3WTY C;  1G6N A;  1IN4 A;  1F1Z A;  5E18 F;  3ZN1 A;  2JT1 A;  4KA4 A;  2OU2 A;  1LDK B;  2F2E A;  1MZB A;  4OU0 A;  1ZRF A;  1EH7 A;  1D8K A;  1TBX A;  3ZMT A;  3ABT A;  2PQ8 A;  3P9C A;  1HW1 A;  3F8N A;  4L5I A;  1J5Y A;  2YX4 A;  5HS8 A;  2YU3 A;  1ZYR F;  2KIU A;  3FXR A;  4WXD A;  3TGN A;  1BN5 A;  4ZZL A;  1F9N A;  1WI9 A;  1Z05 A;  4A6D A;  2ZO4 A;  3FMR A;  2XKP A;  3SHF A;  4H0E A;  4BHB A;  1XGN A;  3C7J A;  1FSH A;  2OBP A;  2HYF A;  4ZYH A;  4KMU X;  1S29 A;  3ZMU A;  1YTY A;  2HKX A;  1KGS A;  3WGI A;  1S7A A;  1ZAR A;  1HSJ A;  4EJU A;  3TO6 A;  5LBQ A;  4HLY A;  1TQI A;  1YYV A;  1XCB A;  2Y75 A;  2DK8 A;  1FSE A;  3CUQ A;  5BQT A;  2XAJ A;  1O7F A;  3LAJ A;  3O6B B;  4ETS A;  2FU4 A;  1ODD A;  3G73 A;  3BPV A;  2BYV E;  1YS7 A;  2QQ9 A;  5D5X B;  2MBF A;  4KIF A;  3FZV A;  1WWX A;  1GVJ A;  2IW5 A;  2FBI A;  2IRF G;  1W7P A;  4UV8 A;  2EV0 A;  2CO5 A;  2GXB A;  1RNL A;  2XAH A;  2P5V A;  1Z9C A;  3F3X A;  3ZMD A;  2HOE A;  3LA3 A;  3C18 A;  2R7F A;  4IVN A;  2O03 A;  2A07 F;  4A0Z A;  2QBY B;  5A2Q Z;  3P9I A;  5J6X A;  2XRN A;  4YII A;  3W6J B;  3TDU C;  2M1B A;  2XHK A;  1B6A A;  1J0R A;  1WKM A;  3PQJ A;  1OPC A;  4ENM A;  3KCC A;  2IVM A;  4OIN F;  1D5V A;  1FP1 D;  3COA C;  3V8K A;  4GYI A;  1YG2 A;  1RUO A;  5LRS A;  1OYY A;  2D45 A;  3MWM A;  4I0A A;  2P4W A;  4KT5 C;  1J7K A;  3K1N A;  3V7R A;  4WXH A;  1DPR A;  2QYO A;  3VOE A;  4HOB A;  3HOT A;  2OZ6 A;  3L09 A;  4I01 A;  1KU2 A;  1XN7 A;  2A6H F;  1DP7 P;  1H9G A;  3IWZ A;  4KYW A;  4LLN A;  1CGP A;  4FX4 A;  2RN7 A;  5FO5 A;  4BYY A;  3KP2 A;  2XAS A;  4ZYG A;  1K6O A;  4M71 A;  3H92 A;  4HLX A;  1WQ2 A;  4AIH A;  3T5X A;  4UV9 A;  2W84 A;  3O3K A;  5D5W B;  1HBX G;  4LK1 F;  1XMK A;  2V79 A;  3HRT A;  3BJA A;  2P6T A;  3I54 A;  2Q0O A;  3I71 A;  5DDG A;  4RGR A;  3EUH A;  3T1B A;  1IW7 F;  4MEX F;  3IRR A;  1JGS A;  2A68 F;  3LST A;  3JSO A;  3I4P A;  4ESJ A;  2LSO A;  5E1Z B;  1DPU A;  1V3F A;  4RB1 A;  4L9J A;  2DBB A;  4RB3 C;  2FRH A;  5H20 A;  2KJB A;  1ZG5 A;  2QQB A;  4EJW A;  4KDP A;  4R79 A;  4O5V A;  3F8M A;  3ECO A;  2K02 A;  2A69 F;  3TKY A;  2L54 A;  2M45 A;  3O2P E;  1U2W A;  1K79 A;  1BJA A;  4ESB A;  4LG0 B;  3REO A;  4O3M A;  2CSO A;  1FX7 A;  5DCF A;  4Q47 A;  2ACJ A;  5DEQ A;  4HA8 A;  4KFC A;  2MH9 A;  4AIK A;  2IT0 A;  1ZGA A;  1QZY A;  1MGT A;  2V9V A;  3SZT A;  1BI1 A;  4OMY A;  1BM9 A;  5K5R A;  4TV7 A;  2ISY A;  1KQ8 A;  3RJP A;  1RI7 A;  1L3L A;  3DEU A;  1R7J A;  1T98 A;  4Y17 A;  4MNU A;  3HTU A;  2HFH A;  1FBU A;  1SD4 A;  4I7H A;  2F5C A;  2KJC A;  2HEO A;  4RGU A;  1HW2 A;  4M9X A;  4FHT A;  4O6J A;  3J80 Z;  1I1S A;  4XBF A;  1GXQ A;  4KMF A;  4HF2 A;  4IPA A;  1R5H A;  1O7L A;  2MC3 A;  3HSE A;  1IF1 A;  5HS7 A;  2P7C B;  1YQA A;  4M74 A;  2BBY A;  4L0Y B;  2ESH A;  1R22 A;  2RQP A;  2VON A;  4UUV A;  2XUB A;  2JRT A;  1JHF A;  4P9U A;  2FNP A;  5ICC A;  2B0L A;  4RGS A;  1S8N A;  1IZ1 A;  3QAH A;  2ADU A;  5E20 A;  1KQ0 A;  1G3S A;  3TO9 A;  4BH9 A;  1IXS B;  4L9T A;  3GVA A;  1BIB A;  1FBQ A;  2EA2 A;  3DPT A;  4JK1 X;  2MLK A;  4G7Z F;  4CZZ A;  1HXD A;  1USS A;  4A2U A;  3OOP A;  1WRJ A;  2FBH A;  3GWZ A;  3WGH A;  1D8J A;  2RDP A;  1SMT A;  2ETH A;  1VTN C;  2Q8K A;  3CUQ B;  3ERE D;  1U78 A;  5A2Q K;  4UHT A;  1ON2 A;  3IL2 A;  1FY7 A;  2IA1 A;  5HLG A;  1I27 A;  4EM0 B;  3T8R A;  3DV8 A;  2GZW A;  2LKP A;  5ICF A;  4LMY A;  4Y13 A;  5H6R A;  3F6O A;  3KLN A;  1KA8 A;  1C0W A;  3E97 A;  2IP2 A;  4U88 A;  1W7P B;  1FLI A;  1U5T C;  2XRO A;  4MTD A;  3N97 A;  2KKO A;  3VFZ A;  1L0O C;  1YW9 A;  1QBJ A;  4PCQ A;  1TTY A;  1IN8 A;  2RNJ A;  4OIO F;  3DFG A;  4HF0 A;  5JR3 A;  3TDZ C;  1P2F A;  1HKT A;  2Z99 A;  3ECH A;  1I5Z A;  5CVJ A;  4Q4Z F;  4ASN A;  2WTE A;  4HQM A;  5HVQ C;  2C6Y A;  3BRO A;  4AD9 A;  3P9K A;  2XKO A;  5E1X A;  3T0Y A;  3K9T A;  1MD0 A;  1TNT A;  5ILS A;  2IA2 A;  2RKH A;  3J81 K;  1FYL A;  2VC0 A;  3WTU C;  4BQA A;  2CGP A;  4CO8 A;  4M6Y A;  1MKM A;  5J8C A;  1STZ A;  1P4X A;  3KP4 A;  4JQF A;  1YS6 A;  3LQQ A;  1LVA A;  1MJA A;  2PEX A;  4P9F A;  4P55 A;  2DT5 A;  1BI0 A;  4WCG A;  2Z9O A;  2FBK A;  3BJO A;  1R5G A;  2WC2 A;  4HW0 A;  4G6D A;  2VT2 A;  1ZGJ A;  4M6X A;  2PLY A;  2CFX A;  2HTS A;  3RYR A;  5IT3 A;  2BGC A;  3HRM A;  2P5K A;  2NYX A;  1W7P D;  3BWG A;  2EFO A;  1UB9 A;  5D8L B;  4KNY A;  3K0L A;  5H6Q A;  3VB2 A;  5D4S A;  3S2W A;  4OIP F;  3RYP A;  2DPU A;  5LGT A;  1CF7 A;  4CHU A;  3GYH X;  3LWF A;  4A0X A;  2F5E A;  2IPQ X;  5DCM A;  5CLS A;  3BY6 A;  1R1T A;  3L7W A;  5D5U B;  2V1X A;  1FT9 A;  5HS9 A;  1J2X A;  4LJZ F;  5F6F A;  4HX8 A;  4F7Z A;  3G3Z A;  1Z6R A;  2Y0M A;  5BS6 A;  2F5D A;  4UVA A;  3ZP5 A;  2HZT A;  5LHH A;  1HKQ A;  4EJV A;  2E1C A;  4IHS A;  4IRH A;  4L0Z B;  2QWW A;  1ZG1 A;  2DLL A;  3GZ6 A;  1W5S A;  3I64 A;  2CW0 F;  3J80 K;  1DUX C;  1XB4 A;  2HWV A;  3KP5 A;  1XGM A;  3QP6 A;  3R6S A;  2ZBK A;  4OOI A;  2P5L C;  2R7D A;  3E5X A;  1A04 A;  1FNN A;  2HS5 A;  1AWC A;  2OZU A;  4ZYD A;  2LDU A;  1ONV A;  1T0F A;  2X0L A;  1R23 A;  1ON1 A;  2DO7 A;  3FMQ A;  2UXX A;  3AAF A;  1O3R A;  2FXA A;  1UFM A;  3CJN A;  1BC7 C;  2DTR A;  2GIV A;  3F23 A;  2FNA A;  3BP8 A;  2EWN A;  4YFX F;  2P6S A;  4Y15 A;  3DKW A;  3RKW A;  1QO0 D;  2KIF A;  3D5L A;  3HYI A;  1HST A;  3NQO A;  3F22 A;  1J75 A;  2HGC A;  3PFI A;  5HDG A;  1Z91 A;  4I09 A;  3E5Q A;  1LNW A;  4AWX B;  3ZPL A;  1J9I A;  4K2E A;  2ESN A;  3JAM K;  1O3S A;  3LAP A;  5CVR A;  3M8F A;  2OA4 A;  2P8T A;  4U0V A;  1ZLK A;  1OR7 A;  4GYG A;  5BMZ A;  2H6C A;  3F72 A;  2BV6 A;  5E8G A;  4QLC U;  2OD5 A;  1EH8 A;  1XSV A;  4LB6 B;  4P96 A;  2PN6 A;  5L3F A;  4G9Y A;  4IXA A;  1E2X A;  4A0Y A;  1TQP A;  2QZ8 A;  2XV4 S;  1MDM A;  1MJB A;  4RB0 A;  3E3V A;  2OQG A;  4M72 A;  1ZG3 A;  3QPT A;  2YR2 A;  1SAX A;  3LA7 A;  4RS8 A;  5K1Y A;  3RKY A;  4YG2 F;  2PBI A;  1NHA A;  2RVC A;  1SD5 A;  3HRU A;  4EMS A;  3QPH A;  2ZFW A;  4GGG A;  3H3Z A;  1LEB A;  2IA0 A;  4HBL A;  1P4A A;  1YW7 A;  3ZMS A;  2HYG D;  4R8H A;  3TO7 A;  1T6S A;  4U7B A;  3RI4 A;  5BPI A;  1FOK A;  2VOP A;  2K4J A;  5K5O A;  5HLI A;  3RIR A;  2L02 A;  3J81 Z;  2EB7 A;  4WX9 A;  1S7O A;  2PI0 A;  2UXN A;  1XCV A;  1DDN A;  2F5F A;  3KFW X;  3BDD A;  1PP8 F;  4U7D A;  5FFX A;  4A6E A;  4XSX F;  4RGX A;  1W5T A;  2ZME A;  3MZH A;  4HX7 A;  1QGP A;  2M5W A;  5FGM A;  2AS5 F;  3ELK A;  4HAM A;  2FMY A;  5AIQ A;  5BPD A;  5CVU A;  1ZAO A;  2YPR A;  2WV0 A;  5CVV A;  2VOD A;  1SFU A;  2EA4 A;  3RKX A;  3CUO A;  4RAY A;  5J8F A;  1R58 A;  3QRF F;  5KK1 A;  5LGN A;  3FF5 A;  2BE5 F;  3I58 A;  4QWQ A;  3V7C A;  4RAZ A;  2DFI A;  3WTT C;  2HR3 A;  1BI3 A;  1ULY A;  2QM3 A;  2GXG A;  1Z6T A;  3NEU A;  1YIO A;  1FBS A;  5LLQ A;  4XRF A;  1F5T A;  2EFP A;  2JPB A;  5L3C A;  4U0W A;  1EH6 A;  4EVI A;  5ERI A;  1IN5 A;  3R61 A;  2OQR A;  2GWR A;  2DPD A;  5IT9 K;  4A5M A;  1CF7 B;  1FC3 A;  4MTE A;  2XAG A;  3VEP A;  4HF1 A;  1GXP A;  4EGY A;  3C3W A;  3RPQ A;  5ED4 A;  1TQM A;  4M9S A;  5TRD A;  5DCM B;  3WTX C;  2O61 A;  4EQQ A;  1IXR C;  1K7A A;  3KP7 A;  3QU3 A;  1R1V A;  2K4B A;  1PP7 U;  1JE8 A;  1XSX A;  2DQL A;  3B73 A;  3ZMV A;  3QP5 A;  1P6R A;  1P4W A;  3BPX A;  3GEZ A;  1SFE A;  4LFU A;  4BXU A;  4KIB A;  3IHU A;  3NRV A;  1XMA A;  2JZY A;  1H0M A;  1BI2 A;  1FP2 A;  3KEO A;  4N9H A;  1O3T A;  2VOO A;  2EFN A;  2CG4 A;  1KU3 A;  1UCR A;  2FA5 A;  4AVP A;  2EV6 A;  3R0J A;  1R00 A;  5FB2 A;  3L9F A;  3KZY A;  3GLX A;  1IN6 A;  1LDD A;  3F6V A;  2ZKZ A;  3U1D A;  1Q1H A;  3BJ6 A;  1SFX A;  1S6L A;  2PMH A;  2W57 A;  1F4K A;  5LRR A;  1WSU A;  2MA3 A;  3GW2 A;  2ZNZ A;  3CLO A;  4CDG A;  3R60 A;  3V8L A;  5DUI A;  4N9I A;  3E6D A;  3VOD A;  3HUG A;  4B8X A;  4XLN F;  4N0B A;  3N4M A;  1QQI A;  3JAM Z;  2A5Y B;  3K1M A;  3C1D A;  4HDV A;  5D8K B;  5F64 A;  1HKS A;  5DV5 A;  4Q48 A;  5TJJ A;  1LEA A;  4G6Q A;  4I0B A;  2NS0 A;  4E70 A;  1J59 A;  2HTJ A;  4A12 A;  1FYM A;  4S04 A;  5CVI A;  2Z3Y A;  3E6B A;  3DQV C;  3K1P A;  5EEH A; 
#chains in the Genus database with same CATH topology
 2RGV A;  3SQN A;  1G8X A;  5E1W A;  3L2C A;  2LD5 A;  4LB5 A;  4ZH4 F;  2YSR A;  3HZJ A;  4A3L J;  3K69 A;  4PK4 A;  4LOC A;  4BBR J;  1TNS A;  1N78 A;  1MMG A;  1MNE A;  2HI3 A;  5F0F A;  2PMU A;  1SAU A;  3S3O A;  1WJ5 A;  2K9S A;  4PJ0 C;  1K78 A;  3QOD A;  1ZKG A;  4A69 C;  2EH3 A;  2E7X A;  2ZB9 A;  4BNC A;  2MD5 A;  4F55 A;  2V7F A;  2K7L A;  1RET A;  2LF7 A;  3M9A A;  4KUM A;  1SAN A;  3EYY A;  4BS9 A;  4G94 A;  1JGG A;  2FQ3 A;  1G3W A;  2LKX A;  1WZ2 A;  3FKI J;  3HOZ J;  3FM3 A;  2NVU B;  3RKQ A;  1RR7 A;  3OYJ A;  3FWE A;  2ZJ2 A;  3E0J B;  3KZZ A;  2IJL A;  4PGG A;  3ZGK A;  3CJT B;  2XDV A;  4F91 B;  2DFH A;  2M8E A;  4LGW A;  2VC1 A;  2XAF A;  2EFW A;  1MDM B;  2XB0 X;  1T0F C;  4WXC A;  5L3G A;  3CUQ C;  3FXQ A;  3L2Q A;  1LB2 A;  1QRY A;  2CJJ A;  2KRH A;  4M3E A;  4EM1 A;  4IZZ A;  1UG0 A;  3TQN A;  1P7I A;  1UHM A;  2VE9 A;  2STW A;  2DT6 A;  1Z77 A;  2OCC H;  2WV1 A;  4XOT A;  1DP3 A;  2VKD A;  4IHT A;  2E2H J;  3HPG A;  3PQK A;  2G7H A;  3A01 A;  2QGU A;  2XGD A;  2X1E A;  2ZNY A;  4QPO A;  5DUK A;  1QHG A;  2HVS A;  2F5V A;  3T8T A;  2RAE A;  3TOA A;  2PG4 A;  1SC7 A;  4ON0 A;  1OQY A;  2ZSH B;  5ICG A;  2O8K A;  2KMU A;  3H3U A;  4CYD A;  1IGN A;  2XPV A;  3WTW C;  1TT0 A;  3VPR A;  3HSR A;  3HDD A;  2DN0 A;  2FSW A;  3H36 A;  4KN4 X;  2UZK A;  1W36 C;  5IPA A;  1OMI A;  3Q9S A;  1HC8 A;  3ZQI A;  1YJ9 I;  1IN7 A;  2YU9 J;  3M1E A;  3IWF A;  4UNO A;  4ZDP A;  5HDK A;  3E7L A;  1XGS A;  3E6C C;  5F08 A;  4BY1 J;  3EYI A;  3BR0 A;  3UNG C;  2BY0 A;  3FMS A;  2RNG A;  3WOD F;  4I98 B;  1BC8 C;  2HPM A;  3MQ0 A;  4MGR A;  3BZK A;  3BOQ A;  3NWS A;  2Y0S A;  4JX5 A;  2K9Q A;  4BJ6 C;  2Y31 A;  2VXD A;  1R4M B;  3OS1 A;  1GHC A;  2M4K A;  3GME A;  4M9Z A;  3BT9 A;  3BG9 A;  3CCR I;  1WVR A;  1X1C A;  4UY8 I;  1VQN I;  2QQA A;  4AIJ A;  3F8F A;  3AG1 H;  2DDA A;  2P0W A;  5D5V B;  1H9T A;  5DD8 A;  1SVM A;  3CD6 I;  1OCR H;  2VE8 A;  3MKL A;  1LE8 B;  3M3Y J;  2KIQ A;  3IP4 B;  2FEZ A;  5M3M J;  4L9N A;  2L3D A;  5LEK A;  2R7Z J;  2EJR A;  2Y48 A;  4LIT A;  2ZME B;  2JVH A;  4HDU A;  2AXL A;  2FOW A;  3BLY A;  4P5O A;  4RM3 A;  3GZ5 A;  1TWG J;  2JMW A;  3S1M J;  1IRZ A;  1WGX A;  3SEQ A;  4V2G A;  2ELJ A;  4ITV A;  2O0Y A;  4UVC A;  4E7L A;  3IV5 A;  1T38 A;  5IP7 J;  3JRC A;  5KAF C;  2BY1 A;  2KIM A;  1D3Y A;  4XLC A;  4G6T B;  5M5W J;  2QKM B;  3KE2 A;  2EK5 A;  3FXU A;  2ZC2 A;  3HSF A;  3LFK A;  1KZH A;  2EQR A;  4FAS D;  1WJA A;  2ME0 A;  2K86 A;  3IH4 A;  4CCJ A;  2VBW A;  2R3S A;  1LQ1 A;  5E3L A;  4XKB A;  4IF4 A;  1OYW A;  1Y0N A;  2ECB A;  1TWF J;  5CKT A;  2A61 A;  2Z33 A;  4ENK A;  3I3L A;  1WJB A;  2VXZ A;  3BZ6 A;  2E34 A;  5IT9 Z;  2J5O A;  1U5T A;  5B1B H;  1WCM J;  1HW5 A;  1IC8 A;  2RV8 A;  4I6Z A;  5JHU A;  3MCZ A;  3GUD A;  2VB6 A;  1ZRE A;  3J7A O;  3HB9 A;  3VYT B;  1I39 A;  2WWY A;  2M87 A;  1SMY F;  1FTT A;  2WAQ N;  2E2I J;  2JVG A;  2DA6 A;  4XK4 A;  4NC8 A;  3RDI A;  5EZH A;  2FF4 A;  2M7A A;  1XDS A;  2XAU A;  4XLA A;  2CS3 A;  5AON A;  2A6T A;  5FFZ A;  2BVM A;  4NBQ A;  5GTH C;  1I3A A;  3WTV C;  1PDN C;  1K61 A;  5LEJ A;  1RPW A;  2X4H A;  2M9H A;  1G3Y A;  2IS1 A;  5CQG A;  1FWZ A;  1W4M A;  4BDY A;  5K5Q A;  1JUM A;  3K4C A;  3EUH C;  4W1U A;  2G7U A;  5H2F C;  2HQN A;  2E35 A;  4AYB A;  2EBI A;  4HNT A;  3L1P A;  2KDZ A;  2NNY A;  5KAI C;  2DQR A;  3RQI A;  4PSW A;  5AIP A;  1KQ9 A;  2L9N A;  3EUK L;  4DZJ A;  2GA1 A;  3HOV J;  2W25 A;  4IJA A;  3AFH A;  4XSZ F;  2R7R A;  2LBF A;  3CO6 C;  3W2V A;  4PDK A;  3MKZ A;  2R5Y A;  1PUF A;  3JW4 A;  5KNL A;  1NK2 P;  4B09 A;  4DOZ A;  4GCV A;  3F9K A;  1HQC A;  4EM2 A;  1JUS A;  3H9Q A;  1K6Y A;  5F1J A;  4BE0 A;  2KZG A;  3CMM A;  2GOM A;  3H5N A;  3ZQL A;  4C2T A;  3DBR B;  2QSH X;  2O3F A;  1PUE E;  4GXO A;  1M1E B;  2LF8 A;  3GFJ A;  3OR2 C;  1G3T A;  2LNB A;  4DBR A;  5ILV A;  5HOO A;  5E17 F;  2KRF A;  3KP3 A;  2XGE A;  3ZRG A;  1GUU A;  3Q5F A;  2H94 A;  2E7W A;  2VBX A;  2XGC A;  3D0S A;  2XAQ A;  2CQQ A;  3I9V 2;  3PNY A;  4I2O A;  2YX7 A;  4A5N A;  3C2H A;  3BTI A;  3I59 A;  3JSP A;  5EDN A;  2BY2 A;  4A3I J;  4KN7 X;  1G59 A;  4KJZ A;  5L3D A;  3BR1 A;  2MH2 A;  1YRN A;  4Y4R A;  3IKV A;  1T2K A;  2HKO A;  4D0P A;  4R1H A;  1QVU A;  1ETX A;  3PIO F;  2CV1 A;  4PFP A;  4M73 A;  4BAY A;  2I5U A;  4JBA A;  4JX4 A;  3LA2 A;  1N75 A;  2BY3 A;  3ZQ7 A;  4XRS A;  1VQ9 I;  2VBY A;  4LD5 A;  5IOY A;  2A3S A;  3GTO J;  2EV5 A;  3CF5 F;  3S2D J;  3V4G A;  3W2W A;  1GV5 A;  5FLM J;  1WJD A;  2HDC A;  1TW2 A;  2HQA A;  5DM6 F;  1MJ9 A;  3DU6 A;  4PUS A;  2UWM A;  2VPR A;  2DOE A;  2KL4 A;  3ZN0 A;  3GX4 X;  1IUY A;  5BOX A;  2CUZ A;  3SXY A;  4IRI A;  1U9O A;  2CW8 A;  1VQK I;  4LLG F;  1RUN A;  1A31 A;  3KLO A;  3IRQ A;  2DDB A;  3HUG B;  1ZN2 A;  1JTX A;  4BHP A;  1ZRC A;  3QWL A;  2ZJP F;  2P7V B;  4NHJ A;  3CP8 A;  4XR6 A;  1R6R A;  4IQJ A;  1UEL B;  3M7G A;  1DGW Y;  3G1M A;  1BL0 A;  1D1C A;  3GFM A;  3KP6 A;  1B9M A;  4XLP F;  1REP C;  4LG3 A;  3F21 A;  2VQG A;  4UVB A;  4XKV A;  3L2U A;  2QLZ A;  3K4L A;  2X1C A;  5TIS C;  3DXJ F;  1VF9 A;  3BR2 A;  1O57 A;  2DU9 A;  2XVC A;  4HEA 2;  2IGO A;  2HXI A;  2ELH A;  1KYW A;  4Z6Y A;  2DMP A;  3W6K B;  1UST A;  5J4V A;  1I1G A;  1U8R A;  5C4X J;  2JUC A;  2F4M B;  1S3J A;  3F8C A;  3FM5 A;  4KIG A;  2HVQ A;  5E79 C;  2M7B A;  4DGW B;  5ILU A;  5L3E A;  2DOD A;  3HRS A;  2FE3 A;  2LYC A;  4CGZ A;  5JFR A;  3ABL H;  3FHZ A;  4YFK F;  2V6C A;  2W24 A;  1ZLJ A;  2UUZ A;  1TC3 C;  4P1W A;  2XGX A;  4HSR A;  1WJE A;  2O7O A;  3Q0V A;  5DD4 A;  5J40 A;  2RRE A;  3WU1 B;  2DA7 A;  1K78 B;  4PJM A;  2GQQ A;  1JKR C;  3FX3 A;  5HLT A;  1YO5 C;  4BE1 A;  1ZH5 A;  4CXF A;  1LKX A;  4V19 K;  3S1Q J;  1B4A A;  5FLX K;  4FX0 A;  1ENH A;  5EGO A;  1UG2 A;  3HM5 A;  1Z1D A;  3CLQ A;  1TP4 A;  2DMN A;  1QZZ A;  2V1D A;  2DW4 A;  5EF6 A;  1ZHF A;  3A03 A;  4G7H F;  4HV5 A;  4MQV A;  1OCP A;  2Q2E A;  2MYS A;  2MAB A;  2PMZ A;  3FHN A;  1T95 A;  1X1A A;  1TLH B;  2MLG A;  4HNV A;  3M8J A;  1X4O A;  6PAX A;  3AKZ A;  2PFB A;  3LSG A;  5FD5 A;  4RB2 C;  1RZ4 A;  4IX7 A;  2W00 A;  3U2R A;  4U0Y A;  2STT A;  2LK2 A;  2ZCW A;  2JPC A;  2H27 A;  4BHC A;  3CJQ B;  4DQ2 A;  4D9J A;  3WE2 A;  3FBI B;  3GBG A;  1V5E A;  3OV8 A;  4IRG A;  3A01 B;  1RIO H;  3FKJ A;  1FOW A;  4RAG A;  2DAO A;  4HZF A;  3Q9V A;  1TW3 A;  3SDG A;  1XGO A;  1LJ9 A;  2E1N A;  1WJC A;  2L01 A;  3VSL A;  4C3I J;  3GTG J;  3OYN A;  4A3B J;  1LDJ A;  1HDP A;  3BR5 A;  2IS2 A;  2NNN A;  1X3Z B;  4I02 A;  2ZJR F;  2ZXJ A;  1IG7 A;  5GAH J;  1H89 C;  4ZYA A;  1ETK A;  3HHH A;  4G7O F;  3ZMZ A;  1A35 A;  1D1B A;  3FXK A;  2HQR A;  2QUF A;  4FT8 A;  3H3V K;  5LHI A;  4Q5S F;  2A5W A;  4A3K J;  3JTH A;  1I3Q J;  1WHU A;  4KIC A;  5LHG A;  4E7H A;  1B1B A;  2QEN A;  4ESF A;  2OAZ A;  4OIQ F;  1F43 A;  1OLT A;  3GFL A;  3MZY A;  3R4K A;  1FZP B;  3I53 A;  4WWC A;  1E3H A;  1U3E M;  3H5R A;  3KX2 A;  4M3B A;  1Z7U A;  2OJE D;  1BW6 A;  4ZYE A;  2BOL A;  2L9V A;  3ABU A;  2OPT A;  5JVG F;  2J5P A;  4YFN F;  2COM A;  3EDP A;  5D4R A;  1R5I D;  2JSC A;  1KYZ A;  2FOK A;  5B66 C;  3ZQH A;  1KON A;  2ZXH A;  3DWL E;  2NAZ A;  3J7Y J;  5EEG A;  1BJZ A;  3JRD A;  4L18 B;  5L3B A;  2HYJ A;  5LGU A;  2BEO A;  1Z0X A;  5FD6 A;  4HX4 A;  1KU7 A;  3RPU A;  2PJP A;  1R36 A;  1GDT A;  4RA2 A;  1SD7 A;  2WB1 N;  2X48 A;  3SZP A;  3S93 A;  2M30 A;  3UKG A;  2NRA C;  4IHX A;  3KEQ A;  3CDH A;  4OIR F;  1AKH A;  3PUF A;  2V4J C;  2XF6 A;  4HQE A;  5EEA A;  4EJT A;  1P92 A;  3S17 J;  3E5U A;  3KET A;  4L5J A;  4CCN A;  4NQW A;  1XD7 A;  3CF2 A;  2CUF A;  3K4B A;  4PSX A;  5D6F A;  1W0T A;  3DU5 A;  3G71 I;  2O8X A;  2DMU A;  1SFO J;  1T39 A;  2V1U A;  3CCU I;  2NVY J;  2L4A A;  3JTG A;  2RC4 A;  2H8R A;  1IRF A;  1TWC J;  1FPQ A;  4A3D J;  5E8I A;  1QPM A;  1U5T B;  3F8B A;  5JVT A;  4PZJ A;  1MIJ A;  1YLF A;  5ICE A;  1K4S A;  5HDN A;  1G4D A;  3TOB A;  3ABK H;  4OMZ A;  2H1L A;  2DA1 A;  1BIA A;  5KHD A;  1X2N A;  3IKT A;  4DNC A;  3B02 A;  9ANT A;  4HYE A;  3MAJ A;  1Y39 A;  1YW8 A;  4A3J J;  2E1M B;  3ROU A;  2D1V A;  3WU0 A;  1BBY A;  3A0H C;  2I10 A;  3W3C A;  3L2V A;  4ENJ A;  1KU9 A;  4S05 A;  3WGG A;  3NAR A;  2GAU A;  1O3Q A;  5FJ8 J;  1UHW A;  5C44 J;  1QNT A;  2QBY A;  2CYY A;  1EV7 A;  4MEY F;  3CO7 C;  3LQR A;  5GAD J;  3PNV A;  3SFZ A;  3M8E A;  2X9D A;  4M3G A;  4ENN A;  5HLH A;  3IH2 A;  4ZTF A;  4ZDL A;  4EV0 A;  1BOA A;  3HXL A;  4WF2 A;  2TDX A;  3HTS B;  2XF5 A;  3R0A A;  2LBF B;  4AID A;  2JTV A;  1TT5 B;  4NNJ A;  2R5Y B;  2EFQ A;  4E7I A;  2QQ8 A;  1PUF B;  1ITY A;  4WK8 F;  3HOS A;  2K27 A;  2M0M A;  4A3M J;  2AHQ A;  3H9J A;  3KEY A;  2CQK A;  5CYV A;  2WAD A;  5K7H A;  3QOP A;  2HU9 A;  3JRA A;  1ZR4 A;  1Y8R B;  1XSD A;  2HXO A;  3GO5 A;  2IXS A;  4XRM A;  4CCK A;  4L9V A;  1QVT A;  1MBK A;  1AOY A;  4BJT A;  5D6E A;  3V7S A;  1NK3 P;  3A2K A;  5F1R A;  1YOV B;  3S3N A;  3U9G A;  3WG9 A;  2X85 A;  1YIJ I;  2KHM A;  2L9S A;  2VT3 A;  3ULQ B;  4DW6 A;  3WE3 A;  2HZD A;  4UXN A;  3I59 B;  3RTR A;  3I5U A;  1XMX A;  3ISP A;  3IAS 2;  3MEX A;  3QU6 A;  4BL0 B;  1JJ6 C;  1E17 A;  2LY9 A;  1V4R A;  1XDU A;  1OYI A;  3OL3 A;  3CC7 I;  3CTA A;  3MFK A;  1MMS A;  4Z2Y A;  2JUG A;  4DYR A;  3DF8 A;  3GXO A;  2O6G E;  1YRN B;  4ANJ A;  2D1H A;  2DOA A;  2Q1Z B;  1IRG A;  2IGN A;  3LSR A;  2VBZ A;  2DMQ A;  3ML6 A;  2MFZ A;  2VN2 A;  4II3 A;  5DYM A;  4MLO A;  3EUA A;  1TL8 A;  5CJ9 A;  4B3X A;  3GF2 A;  3GFI A;  3WTZ A;  1ETV A;  2ISZ A;  2NVT J;  2DJI A;  2K40 A;  3DP7 A;  3S1N J;  1IAW A;  3ZQG A;  2DI3 A;  3EQL F;  2W85 A;  4G8X A;  4NB5 A;  4RM2 A;  3JRH A;  5JI6 A;  4U87 A;  1R1U A;  3L00 A;  1WH5 A;  2PX9 A;  2O9L A;  3QQA A;  3ASN H;  4EJO A;  3EPZ A;  1BW5 A;  3V8J A;  2F4I A;  3E6M A;  4LLL A;  2GA2 A;  3HHG A;  4CIC A;  1SFK A;  5EG0 A;  2FML A;  4C30 A;  5F27 A;  2L4M A;  1JKO C;  2P81 A;  4MHG A;  4ZZD A;  3FDY A;  3H9G A;  4PGH A;  2H6B A;  1X3U A;  4IOA F;  3QYB A;  1X2M A;  3HIF A;  4XOR A;  2H09 A;  3GTK J;  5J1R A;  2X6O A;  1VND A;  1O4X A;  3PFY A;  2CQ7 A;  1CQT A;  4CA0 A;  1ZRD A;  4BKX A;  4YIF A;  3VYU B;  3H0G J;  4QSH A;  3HC7 A;  4EGZ A;  3C2G A;  2OV7 A;  5EJC A;  3EET A;  1YJW I;  3K2Z A;  1YFH A;  1JXS A;  4C2U A;  4A3E J;  1JHH A;  4MQ9 F;  1B9N A;  2ZFU A;  4GO1 A;  5KVR A;  3PSI A;  3I0T A;  3S1R J;  3P7N A;  1I6X A;  2XIG A;  3IC7 A;  2CWE A;  2DK5 A;  2G9W A;  3SFI A;  1IXC A;  5FLX Z;  1FYK A;  4LK0 F;  2A6E F;  1OKR A;  1XS9 A;  1R71 A;  1SD6 A;  5GP9 A;  1U6G A;  2QVO A;  4LG0 A;  1JJ8 C;  3FIW A;  1B59 A;  2Z5U A;  3LMM A;  3DPL C;  2D2W A;  4CYC A;  1Y0U A;  2JSP A;  4HV6 A;  5E3M A;  3WTS C;  3WTY C;  5IY5 H;  4AU7 A;  1G6N A;  1OR7 C;  1IN4 A;  2JWT A;  2JA6 J;  1DU6 A;  1F1Z A;  4QTR A;  1RRJ A;  1PVE A;  3G2B A;  4MIM A;  4JOM A;  1MMA A;  5E18 F;  3ZN1 A;  2JT1 A;  4X1E A;  5EGO B;  3SYT A;  4KA4 A;  2M2E A;  2L9R A;  2OU2 A;  5B1A H;  1LDK B;  3J7A Y;  2F2E A;  3PNT A;  1MZB A;  2Q2E B;  2WAQ A;  4C2M J;  2K9N A;  4AVZ A;  2R92 J;  4OU0 A;  1ZRF A;  1EH7 A;  5DM7 F;  1D8K A;  2R7X A;  1TBX A;  5JLW A;  2L7Z A;  1HCR A;  3ZMT A;  1RKT A;  3ABT A;  2PQ8 A;  3P9C A;  1HW1 A;  1N77 A;  3F8N A;  1YJN I;  4L5I A;  2QCO A;  1XX5 A;  3S8P A;  3QPS A;  1J5Y A;  2YX4 A;  5HS8 A;  2CUE A;  2YU3 A;  5M3F J;  1ZYR F;  2KIU A;  4ZDO A;  2MC4 A;  4BGD A;  3FXR A;  4WXD A;  2IEK A;  1ZQ3 P;  2VJ5 A;  3TGN A;  1BN5 A;  4ZZL A;  2BVL A;  1ZK8 A;  2XC7 A;  1F9N A;  4JYK A;  3QOE A;  1FOY A;  1WI9 A;  1X1D A;  2Y30 A;  1LFP A;  1NG7 A;  1Z05 A;  4BQQ A;  1LUJ B;  5E3N A;  4A6D A;  4J01 A;  2ZO4 A;  3CQZ J;  3FMR A;  1B72 A;  2ZJQ F;  4IHV A;  3FXO A;  3W6V A;  2XKP A;  2WY7 Q;  2TRT A;  2H1K A;  3SHF A;  4H0E A;  2LC2 A;  3GTP J;  2DCE A;  2LRD A;  4BHB A;  2E71 A;  1XGN A;  3PJR A;  2M0C A;  2FD5 A;  2L7F P;  3C7J A;  1FSH A;  3I56 I;  5FRO A;  1MBE A;  2OBP A;  3PSF A;  3CME I;  1U8B A;  2HYF A;  4ZYH A;  4BXF A;  4KMU X;  1S29 A;  3TED A;  3VWB A;  3ZMU A;  1YTY A;  2HKX A;  1JT0 A;  1KGS A;  3WGI A;  3DBL B;  1S7A A;  1ZAR A;  3MZ8 A;  2EZI A;  1HSJ A;  2MD0 A;  4EJU A;  3LOC A;  3TO6 A;  5LBQ A;  4HLY A;  2E5Z A;  4II2 A;  4FE4 A;  3AG3 H;  1VQL I;  1OCC H;  2YS9 A;  1TQI A;  2ZME C;  4YIR X;  1YYV A;  1XCB A;  2LG4 A;  2Y75 A;  3VDX A;  2DK8 A;  1FSE A;  1Y8Q B;  3CUQ A;  5BQT A;  2XAJ A;  1O7F A;  3A0B C;  3BCB A;  3O6B B;  4HNU A;  3LAJ A;  4FET A;  4BQO A;  1HA8 A;  1I6H J;  4BQN A;  4ETS A;  1K83 J;  2FU4 A;  1AKH B;  1ETO A;  1ODD A;  3G73 A;  3BPV A;  2BYV E;  4NQW B;  4XN0 A;  1YS7 A;  3OYI A;  4XKC A;  2QQ9 A;  3HGG A;  3HL2 A;  5D5X B;  4KIS A;  2E5N A;  2MBF A;  2ME6 A;  5J1Y A;  3AL0 B;  4KIF A;  2VI6 A;  3LSH A;  3FZV A;  3GTJ J;  4BU2 A;  1WWX A;  1GVJ A;  2IW5 A;  2FBI A;  3QYE A;  2IRF G;  2NVQ J;  1W7P A;  4UV8 A;  2EV0 A;  2CO5 A;  1UZC A;  3BR3 A;  2X1D A;  2GXB A;  1UMQ A;  4GRI A;  3A02 A;  1RNL A;  3TW7 A;  2XAH A;  2P5V A;  1Z9C A;  3RZD J;  3F3X A;  3ZMD A;  4OWR B;  1JKP C;  3K4K A;  2HOE A;  3OYH A;  3LA3 A;  3WU2 C;  5FKM A;  3C18 A;  4NUB A;  4XN3 A;  2LTP A;  4DIQ A;  3PO2 J;  2R7F A;  4DBQ A;  5J3L A;  4IVN A;  2O03 A;  5F0H A;  2A07 F;  4JX6 A;  2F6C A;  2CV0 A;  4A0Z A;  2KZV A;  2QBY B;  2NOG A;  3OS0 A;  5A2Q Z;  3P9I A;  5J6X A;  2XRN A;  4F93 B;  2E60 A;  4YII A;  3K4M A;  5GAE J;  1A6Q A;  1WPK A;  3W6J B;  3TDU C;  2M1B A;  2XHK A;  4D5C A;  1RR8 C;  1B6A A;  1J0R A;  1WKM A;  2M4G A;  2WAF A;  1OPC A;  3HGY A;  3PQJ A;  2K3F A;  2VKH A;  3MMY B;  4ZC3 A;  4ENM A;  3KCC A;  2IVM A;  2XPU A;  3DEW A;  1NG6 A;  2EIJ H;  4OIN F;  1D5V A;  3IAM 2;  1YX5 A;  1FP1 D;  4C3H J;  1RC9 A;  3V8K A;  3COA C;  1UAA A;  4GYI A;  1YG2 A;  2B7E A;  2K9L A;  1RUO A;  5LRS A;  1WI3 A;  1OYY A;  3K4N A;  3OOU A;  2D45 A;  4IHW A;  3MWM A;  1FTZ A;  4I0A A;  2P4W A;  4KT5 C;  1J7K A;  3K1N A;  3V7R A;  3RPU D;  1YI2 I;  4WXH A;  1DPR A;  2JN6 A;  2QYO A;  3ONQ A;  1X19 A;  3VOE A;  4HOB A;  3HOT A;  1BR2 A;  2E19 A;  3CCQ I;  2QF7 A;  2OZ6 A;  1PJR A;  2VJI A;  4B44 A;  1SEU A;  4IQ4 A;  1T08 B;  2L2O A;  4Y7N J;  3L09 A;  5IYD J;  4I01 A;  1KU2 A;  1XN7 A;  1XTA A;  3FXM A;  4C3J J;  2MW8 A;  5C3E J;  4XLF A;  2A6H F;  3ZCO A;  1H9G A;  1DP7 P;  3IWZ A;  4KYW A;  3JCU C;  4LLN A;  4HG2 A;  4PJL A;  1CGP A;  3FIS A;  3OMY A;  4MFE A;  4FX4 A;  2RN7 A;  2IS6 A;  5FO5 A;  2LY2 A;  3LFU A;  4BYY A;  3KP2 A;  2XAS A;  4ZYG A;  1K6O A;  1D0X A;  3ESW B;  4M71 A;  1JT6 A;  3H92 A;  4HLX A;  1WQ2 A;  4AIH A;  3T5X A;  2DOF A;  4XKW A;  4Y3O A;  2JA2 A;  4BE2 A;  3HJE A;  4UV9 A;  5FKN A;  2W82 A;  4IOC F;  1JI8 A;  2ID3 A;  2W84 A;  3O3K A;  5IOZ A;  5D5W B;  2ELK A;  1F36 A;  1HBX G;  4LK1 F;  2OTJ I;  2A05 A;  2GXA A;  1XMK A;  4HST A;  1BA5 A;  2VPL A;  3L2W A;  1LFU P;  3KPH A;  1VQ8 I;  3GTQ J;  2V79 A;  3A1Y A;  3HRT A;  3BJA A;  2P6T A;  1R9T J;  3I54 A;  5EG0 B;  2Q0O A;  3I71 A;  5DDG A;  5K7F A;  2JA8 J;  4RGR A;  2K85 A;  3D1N I;  2K9M A;  3EUH A;  1MMD A;  4AUX A;  2VKV A;  3T1B A;  1IW7 F;  4MEX F;  3IRR A;  3I4N J;  1JGS A;  1X3W B;  2A68 F;  3LST A;  4UUS A;  3JSO A;  3I4P A;  4ESJ A;  2LSO A;  5E1Z B;  2KP6 A;  1UHS A;  4XM3 A;  3ZXS A;  1DPU A;  1V3F A;  1U0J A;  4RB1 A;  4L9J A;  1N25 A;  2DBB A;  4RB3 C;  2LP0 A;  2COB A;  3G6E I;  2YUS A;  4QIW N;  1V5F A;  2FRH A;  2LLK A;  4ZJZ A;  1FOX A;  5H20 A;  2KJB A;  3KYL A;  1ZG5 A;  2PJR A;  2QQB A;  4EJW A;  2DA4 A;  4KDP A;  3CDL A;  1U9N A;  4UUT A;  3S32 A;  1OIS A;  2KFD A;  3ZQF A;  1EF4 A;  3WG7 H;  4R79 A;  4O5V A;  4XID A;  3F8M A;  3ECO A;  2K02 A;  2A69 F;  2AXT C;  1D1A A;  2WB1 A;  3TKY A;  2L54 A;  3K4J A;  4YEL A;  4RDU A;  2M45 A;  3O2P E;  1SVO A;  1U2W A;  2O5R A;  2X51 A;  2NOJ B;  2K3P A;  1K79 A;  1BJA A;  4ESB A;  1K4T A;  3GTL J;  1BR1 A;  1VQ5 I;  4LG0 B;  1WJF A;  3REO A;  4XMY A;  4O3M A;  2CSO A;  2AO9 A;  4FQG A;  2EIM H;  4CYC B;  1VQP I;  1FX7 A;  3LSM A;  3AG2 H;  3JRF A;  2NVX J;  5DCF A;  1W0U A;  4BEH A;  4Q47 A;  2ACJ A;  3OS2 A;  2W48 A;  3AG4 H;  3ERM A;  5DEQ A;  4HA8 A;  2R7W A;  4KFC A;  2MH9 A;  1SVL A;  4RLF A;  5LFA A;  5FKK A;  1S72 I;  4AIK A;  2IT0 A;  1ZGA A;  1FIA A;  2DA3 A;  1QZY A;  3LSI A;  1XG1 A;  2MG4 A;  3BTL A;  1MGT A;  2V9V A;  3H35 A;  3SZT A;  4NC7 A;  1BI1 A;  5KCM A;  4OMY A;  3O8G A;  1BM9 A;  5K5R A;  2GIZ A;  4TV7 A;  5DS9 A;  2W1O A;  3G4S I;  3MKW B;  2QSG X;  2ISY A;  1YE9 A;  4RAF A;  1KQ8 A;  3RJP A;  1RI7 A;  1DQU A;  4AM3 A;  2Y2Z A;  1L3L A;  1NH3 A;  3DEU A;  1Y1V J;  1R7J A;  1T98 A;  2EIN H;  3M07 A;  4Y17 A;  4MNU A;  1H8A C;  2X6X A;  3HTU A;  2HFH A;  5FRM A;  1ACI A;  1FBU A;  1Z7L A;  4PFO A;  2M34 A;  1SD4 A;  4I7H A;  2F5C A;  3MVP A;  2XF7 A;  4UB8 C;  3S16 J;  2KJC A;  3PIP F;  2CV2 A;  2HEO A;  4RGU A;  1HW2 A;  1DGR M;  1BOB A;  4FHT A;  1Z3Y A;  4M9X A;  4O6J A;  3J80 Z;  1I1S A;  4XBF A;  3CMY A;  1GXQ A;  4KMF A;  3CCV I;  4HF2 A;  4IPA A;  2VAS A;  1VQ4 I;  1R5H A;  1O7L A;  5E3O A;  2MC3 A;  3HSE A;  1T56 A;  4ABZ A;  1IF1 A;  5HS7 A;  5LD2 C;  3JR9 A;  3DTE A;  3K70 D;  4D5F A;  2P7C B;  1YQA A;  4M74 A;  2VL8 A;  5HNF A;  2BBY A;  4OAZ A;  4L0Y B;  2LY1 A;  2ESH A;  1FIP A;  1ORK A;  2AQF A;  1R22 A;  2RQP A;  1B72 B;  2VON A;  4UUV A;  2Y9Z A;  3L2R A;  2ECC A;  2JRT A;  2XUB A;  1JHF A;  4IEJ A;  4P9U A;  5GTI C;  2FNP A;  4D7N A;  5B3S H;  5ICC A;  4CUG A;  3CCS I;  2B0L A;  4RGS A;  1S8N A;  2FX0 A;  3I55 I;  2BXY A;  1IZ1 A;  1GLN A;  3QAH A;  2ADU A;  5E20 A;  1KQ0 A;  3OYE A;  1G3S A;  3TO9 A;  4BH9 A;  1A6I A;  3TP0 A;  1IXS B;  4L9T A;  3JRB A;  3GVA A;  1BIB A;  1FBQ A;  1Z21 A;  2EA2 A;  3MD2 A;  3DPT A;  4J19 A;  3BG6 A;  4JK1 X;  3DLA A;  2MLK A;  4G7Z F;  4CZZ A;  1HXD A;  1USS A;  2OF7 A;  4A2U A;  1OCO H;  3HKZ N;  3GZN B;  3OOP A;  1WRJ A;  3UR3 C;  3M1C A;  5J4Y A;  1FMV A;  1VFC A;  1J09 A;  2FBH A;  3GWZ A;  3WGH A;  1D8J A;  2RDP A;  1E0E A;  1MBJ A;  3DBH B;  1SMT A;  3DEE A;  2ETH A;  2EZH A;  1A36 A;  1AHD P;  2LVS A;  1IDZ A;  2Z16 A;  1VTN C;  2Q8K A;  3DPU A;  3CUQ B;  3ERE D;  3BTC A;  1U78 A;  2RQQ A;  2NS7 A;  1HLV A;  5A2Q K;  4UHT A;  1ON2 A;  3IL2 A;  1FY7 A;  3WHC A;  2IA1 A;  5HLG A;  2E2J J;  1I27 A;  3Q0W A;  3VYS B;  4EM0 B;  3T8R A;  1X58 A;  3DV8 A;  3TP3 A;  2GZW A;  2LKP A;  2LOO A;  5ICF A;  3CMA I;  4CZC A;  4LMY A;  4LIV A;  4Y13 A;  5H6R A;  3F6O A;  3KLN A;  1KA8 A;  4F52 A;  5GPA A;  3OYK A;  1C0W A;  3E97 A;  4FCY A;  1QU3 A;  2HNH A;  2IP2 A;  4LIU A;  4U88 A;  3NWT A;  1W7P B;  4IL6 C;  1FLI A;  1U5T C;  2XRO A;  4MTD A;  3N97 A;  2KKO A;  1FEX A;  5CQE A;  4E7K A;  3VFZ A;  3OY9 A;  1L0O C;  1YW9 A;  3SEZ A;  2EZL A;  1QBJ A;  4PCQ A;  1TTY A;  1Y6I A;  5IYB J;  1IN8 A;  2RNJ A;  2E1M C;  5B5E C;  4OIO F;  3DFG A;  2CQN A;  4HF0 A;  2H8W A;  5JR3 A;  1GV2 A;  3TDZ C;  1P2F A;  1QZE A;  1HKT A;  2OC6 A;  2Z99 A;  3ECH A;  3OYF A;  4DZP A;  1I5Z A;  2KIS A;  4GDF A;  1PYV A;  5CVJ A;  1MNM C;  4Q4Z F;  4ASN A;  2WTE A;  2OCE A;  4HQM A;  5HVQ C;  2C6Y A;  1WFX A;  2W7N A;  3BRO A;  4OAY A;  1QPI A;  4AD9 A;  5JLX A;  2HVR A;  1X1P A;  3P9K A;  2XKO A;  3PUB A;  5E1X A;  3T0Y A;  4PJJ A;  4XL9 A;  1POG A;  3K9T A;  2EZK A;  1MD0 A;  1Q1V A;  1TNT A;  5ILS A;  2EPF A;  3CC2 I;  2IA2 A;  2RKH A;  3J81 K;  1FYL A;  2VC0 A;  3WTU C;  2XSD C;  2BZT A;  1ZTR A;  2KRC A;  2CGP A;  4BQA A;  3H0D A;  4FIS A;  4CO8 A;  1IV6 A;  4M6Y A;  2WA0 A;  1MKM A;  5J8C A;  1STZ A;  3BR6 A;  3IUO A;  3LSK A;  3A4C A;  1TZL A;  1P4X A;  2BW3 A;  3KP4 A;  3S3M A;  4JQF A;  1YS6 A;  3LQQ A;  3QPL A;  1LVA A;  1GT0 C;  1MJA A;  2PEX A;  4P9F A;  3OWT A;  4P55 A;  1BR4 A;  2LRE A;  1D0Z A;  2DT5 A;  4CCL A;  1BI0 A;  1V55 H;  4WCG A;  2Z9O A;  2FBK A;  3BJO A;  4W97 A;  1R5G A;  1MSE C;  4XNF A;  4I76 A;  2WC2 A;  4HW0 A;  1ETW A;  4G6D A;  2VT2 A;  2TCT A;  2DFF A;  2QA4 I;  1ZGJ A;  4M6X A;  2PLY A;  2CFX A;  2HTS A;  3RYR A;  5IT3 A;  2BGC A;  3HRM A;  2P5K A;  2M8G X;  4NDL A;  2NYX A;  2R7O A;  2R7T A;  1W7P D;  2LR8 A;  1OJL A;  3MKY B;  4IKF A;  3BWG A;  3F0C A;  1W36 D;  2EFO A;  3O8H A;  3FK6 A;  2HPI A;  1UB9 A;  5D8L B;  2BHZ A;  4DYQ A;  4KNY A;  1LPQ A;  1D5Y A;  3K0L A;  1IJW C;  2AQE A;  5H6Q A;  1S9H A;  3VB2 A;  3OYC A;  3ZQC A;  3OYA A;  5D4S A;  4YRV A;  3S2W A;  4BAC A;  5FKL A;  4OIP F;  3RYP A;  1VI0 A;  2DPU A;  5LGT A;  1CF7 A;  1HF0 A;  4CHU A;  2DTZ A;  3GYH X;  2L7M P;  3LWF A;  2VKE A;  4A0X A;  2F5E A;  4UUS B;  1YIT I;  2IPQ X;  4A3G J;  5DCM A;  3D5R C;  2ZXW H;  4X0G A;  2XRL A;  3FK7 A;  2DYR H;  3GTM J;  2WAE A;  5CLS A;  5EYR A;  3BY6 A;  3CCM I;  3JRI A;  1R1T A;  2VJJ A;  1B8I A;  3L7W A;  2WBM A;  1IDY A;  5D5U B;  1DU0 A;  2JJ7 A;  1E3P A;  2V1X A;  2PJR B;  3MN2 A;  1FT9 A;  3GLL A;  5HS9 A;  3SDB A;  2IGK A;  1J2X A;  2MSY A;  4HX8 A;  4LJZ F;  2DYS H;  5F6F A;  1QA6 A;  1V54 H;  2FUG 2;  4F7Z A;  4ZTJ A;  3G3Z A;  4G12 A;  1IO2 A;  1Z6R A;  2VIX A;  2Y0M A;  1R49 A;  1EJ9 A;  5BS6 A;  2F5D A;  3QYF A;  4I99 C;  4UVA A;  2F4O B;  3ZP5 A;  1MMN A;  2WY8 Q;  3RCO A;  2HZT A;  5GPC A;  3K6G A;  2GM4 A;  2Y0S N;  1A5J A;  4IO9 F;  1GVD A;  5LHH A;  1HKQ A;  4EJV A;  3TL4 X;  2E1C A;  4E4H A;  4IHS A;  4IRH A;  3SJM A;  4L0Z B;  2QWW A;  3SZG A;  1ZG1 A;  2DLL A;  3GZ6 A;  1W5S A;  3I64 A;  1Y56 A;  2CW0 F;  3J80 K;  5F04 A;  2CMP A;  1DUX C;  2V26 A;  2JQ7 A;  1XB4 A;  2HWV A;  4CH7 A;  2R7S A;  1T8I A;  3KP5 A;  2B63 J;  1XGM A;  4E6K G;  4BEH B;  3QP6 A;  2IGM A;  1NTC A;  2CQX A;  3PO3 J;  3R6S A;  2ZBK A;  3FBN B;  3NAU A;  4OOI A;  2P5L C;  2R7D A;  1JKQ C;  1VQ7 I;  3E5X A;  2DXI A;  1A04 A;  1FNN A;  2HS5 A;  2QKL B;  5M5Y J;  4XLH A;  1AWC A;  2OZU A;  4L5E A;  3HOY J;  2QSF X;  3M4O J;  4ZYD A;  2R5Z A;  2X6Y A;  2LDU A;  1X4P A;  1ONV A;  3H1C A;  2HDW A;  3DTK A;  3D5S C;  1FJL A;  1T0F A;  1RES A;  1R4N B;  2X0L A;  3DTI A;  4BBS J;  1R23 A;  1ON1 A;  2JA7 J;  2NS8 A;  3BCA A;  5JHF A;  2CH0 A;  2DO7 A;  3FMQ A;  2Y9Y A;  4DJA A;  1ZGW A;  2E1O A;  2UXX A;  4CSW A;  3AAF A;  2OUM A;  1O3R A;  2FXA A;  3RZO J;  1UFM A;  3CJN A;  1BC7 C;  3HOW J;  3BQY A;  2DTR A;  2GIV A;  3F23 A;  2FNA A;  5M5X J;  1AA7 A;  2LMD A;  2HOA A;  1XC5 A;  3BP8 A;  2EWN A;  3OIQ A;  4YFX F;  2P6S A;  5F0C A;  3ABM H;  4Y15 A;  1P7J A;  3DKW A;  3RKW A;  3TBI A;  2R0Q C;  1QO0 D;  5HOD A;  2KIF A;  3D5L A;  3HYI A;  1HST A;  3NQO A;  3Q3S A;  5HNH A;  3P5J A;  3F22 A;  1J75 A;  2HGC A;  3K7A J;  3PFI A;  5HDG A;  1Z91 A;  4I09 A;  3E5Q A;  3G1O A;  1LNW A;  2EIK H;  4A3F J;  4AWX B;  3ZPL A;  1J9I A;  1Y1W J;  4GFB A;  4K2E A;  2ESN A;  3JAM K;  2VQL A;  1O3S A;  3LAP A;  5CVR A;  1JTY A;  1W1W E;  3FXL A;  3J7Z I;  3M8F A;  1VZ0 A;  3OSF A;  2OA4 A;  4E7J A;  1WH7 A;  4BUP A;  4AYB N;  3LNQ A;  2P8T A;  4U0V A;  3HOX J;  3BG3 A;  4FTH A;  4CCO A;  4EAT A;  1ZLK A;  3PL8 A;  4RLQ A;  3C2B A;  1VQM I;  1OR7 A;  1MBF A;  4GYG A;  4HRI A;  2Z2S B;  5BMZ A;  3OL4 A;  2H6C A;  3ASO H;  2FQ4 A;  3HOU J;  3F72 A;  3JRG A;  3V42 A;  3TMO A;  2DJN A;  2BV6 A;  3S2H J;  1MBH A;  2LFB A;  5E8G A;  3VYR B;  4B48 A;  4QLC U;  2OTL I;  2OD5 A;  3DCF A;  1EH8 A;  1XSV A;  4LB6 B;  4P96 A;  2PN6 A;  4MO7 A;  2ZXI A;  5L3F A;  4G9Y A;  4IXA A;  1E2X A;  2E36 A;  1UJ8 A;  1TQP A;  4A0Y A;  2QZ8 A;  2XV4 S;  2CUJ A;  3CP2 A;  4M3F A;  2B9S A;  3Q0U A;  5K7Z A;  1MDM A;  1OCT C;  3RQ4 A;  1MJB A;  4RB0 A;  3E3V A;  2OQG A;  4M72 A;  1ZG3 A;  3QPT A;  4BY7 J;  3OSG A;  2YR2 A;  1SAX A;  2NXN B;  3LA7 A;  4RS8 A;  5K1Y A;  3TW6 A;  2UV1 A;  1LFB A;  3RKY A;  4N4O B;  2ZSI B;  4YG2 F;  2L7K A;  2PBI A;  3BTJ A;  1NHA A;  2RVC A;  4B4C A;  1T33 A;  1AU7 A;  1JUP A;  5EZG A;  3DKX A;  1SD5 A;  3HRU A;  1MW7 A;  4N4N B;  4EMS A;  2VLA A;  2ICW G;  3AL0 C;  2XSJ C;  3KIO A;  3QPH A;  2ZFW A;  5FRN A;  2DFE A;  4F3Q A;  4V2F A;  4GGG A;  4B43 A;  3H3Z A;  3PM1 A;  1E3O C;  1LEB A;  3CCE I;  3BQZ A;  2IA0 A;  3CDI A;  3HPH A;  2BHY A;  4QPQ A;  4HBL A;  4Y52 J;  1EKE A;  1Z67 A;  2IS4 A;  2DA5 A;  3W2A A;  1P4A A;  3OIO A;  3BG5 A;  1YW7 A;  3ZMS A;  2HYG D;  4R8H A;  3TO7 A;  1I50 J;  1S5L C;  1RKW A;  3N05 A;  5IP9 J;  2DMT A;  1T6S A;  2BXZ A;  4YEJ A;  4U7B A;  3RI4 A;  5C4J J;  5BPI A;  1FOK A;  2VOP A;  2K4J A;  4C9Y A;  5K5O A;  3OYB A;  5HLI A;  3ZQQ A;  3RIR A;  3KYC B;  3X2Q H;  2L02 A;  1QHH D;  3J81 Z;  2EB7 A;  1HDD C;  4WX9 A;  2LH9 A;  2R7V A;  1S7O A;  2PI0 A;  2UXN A;  4FE7 A;  1XCV A;  1DDN A;  2W4S A;  3CCL I;  2F5F A;  5FLV A;  4Y33 A;  3KFW X;  3IH3 A;  3BDD A;  1PP8 F;  1LE8 A;  3OIP A;  4U7D A;  5FFX A;  4A6E A;  1OFC X;  4BJ5 C;  4KIT B;  4BXX J;  3BZC A;  4XSX F;  4RGX A;  1ERD A;  1V5G A;  2CFO A;  1W5T A;  2ZME A;  3VSK A;  3MZH A;  2G0E A;  5IYC J;  4HX7 A;  1QGP A;  2M5W A;  3CCY A;  5FGM A;  5J1U A;  2AS5 F;  4E7S A;  3ELK A;  1XPX A;  1ZR2 A;  2R4G A;  2FMY A;  4HAM A;  5AIQ A;  5BPD A;  5CVU A;  1ETY A;  1ZAO A;  2BW3 B;  4D1Q A;  1HOM A;  2YPR A;  4XRS G;  2WV0 A;  3GCM A;  2VQC A;  3HG9 A;  2QEX I;  5CVV A;  2VOD A;  1SFU A;  2EA4 A;  1D0Y A;  2V9P A;  1MND A;  3RKX A;  3CUO A;  1ZEL A;  4RAY A;  3JRE A;  2L5Q A;  1LVK A;  3ZR8 X;  5J8F A;  4BDZ A;  3CC4 I;  2FJ1 A;  1R58 A;  3CZ6 A;  3QRF F;  5KK1 A;  1OCZ H;  4MFD A;  3OR1 C;  5LGN A;  2M3A A;  2BE5 F;  3FF5 A;  3I58 A;  4QWQ A;  3V7C A;  4RAZ A;  2IBD A;  2DFI A;  3WTT C;  2HR3 A;  4F92 B;  3S14 J;  4M6V A;  1BI3 A;  1ULY A;  2QM3 A;  2GXG A;  1Z6T A;  1IV8 A;  3NEU A;  1YIO A;  1FBS A;  5LLQ A;  2JA5 J;  4XRF A;  2EIL H;  3K2A A;  2F48 A;  1F5T A;  3BC8 A;  2V1N A;  2EFP A;  2JPB A;  2PMZ N;  5CPR B;  2HOT A;  5L3C A;  4U0W A;  1EH6 A;  4EVI A;  5ERI A;  1IN5 A;  3R61 A;  5DTD A;  2R7Q A;  3DKY A;  3CJR B;  2DA2 A;  4XQF A;  2OQR A;  4A93 J;  2GWR A;  2CRG A;  2DPD A;  3I4M J;  5IT9 K;  4A5M A;  1CF7 B;  1FC3 A;  4MTE A;  2XAG A;  3VEP A;  3LL7 A;  4HF1 A;  1GXP A;  3KYD B;  4EGY A;  3C3W A;  4JP0 A;  3RPQ A;  5ED4 A;  2V9K A;  1TQM A;  2Y69 H;  2HQ5 A;  3G1L A;  4M9S A;  5TRD A;  5DCM B;  2X6W A;  5BNG A;  3WTX C;  4X6A J;  4B3A A;  2O61 A;  4EQQ A;  1IXR C;  3B6A A;  3LSP A;  2Z1D A;  2LKS A;  1K7A A;  3KP7 A;  3CCJ I;  3QU3 A;  1B8I B;  2K4B A;  1R1V A;  3HKZ A;  1X1B A;  1PP7 U;  1JE8 A;  1XSX A;  2DQL A;  3B73 A;  4RBO A;  4AC0 A;  5TGT A;  3WHB A;  4EEF G;  3K70 C;  1FMW A;  3ZMV A;  4IHY A;  3QP5 A;  3CES A;  1P6R A;  2KQR A;  4M3D A;  1P4W A;  3BPX A;  3GEZ A;  4UB6 C;  2CW7 A;  1W5C C;  3LSJ A;  1MSF C;  1SFE A;  1APL C;  4LFU A;  4A3C J;  2K5C A;  3FXJ A;  4BXU A;  4KIB A;  1Z3X A;  3IHU A;  3NRV A;  1MH4 A;  1XMA A;  2I8D A;  4PJN A;  1ETQ A;  2N8G A;  3S15 J;  4CCM A;  2JZY A;  3HEF A;  1H0M A;  1BI2 A;  3H5A A;  3ZOB A;  4RMN A;  1FP2 A;  3KEO A;  1EA3 A;  4N9H A;  4B47 A;  1O3T A;  3E1S A;  2MGQ A;  2VOO A;  2EFN A;  2CG4 A;  1YHQ I;  1KU3 A;  3OYM A;  1UCR A;  2FA5 A;  3BG7 A;  3U1K A;  2GLO A;  4AVP A;  3DLL F;  1IUF A;  2EV6 A;  2ID6 A;  1P9Q C;  3R0J A;  1R00 A;  2DT7 B;  5FB2 A;  3B6C A;  3L9F A;  1S7E A;  2JK3 A;  1MBG A;  2CU7 A;  3KZY A;  4B1R A;  5J47 A;  2KDO A;  3GLX A;  1IN6 A;  5IP6 A;  1LDD A;  2HOS A;  3F6V A;  2ZKZ A;  3U1D A;  1Q1H A;  2JRM A;  1SFX A;  1S6L A;  2PMH A;  2W57 A;  3BJ6 A;  4HPQ A;  2KPM A;  1IRX A;  2R7U A;  4J00 A;  4E7Z A;  1MH3 A;  1F4K A;  5LRR A;  2XPW A;  1WSU A;  2MA3 A;  3GW2 A;  2R5Z B;  2ZNZ A;  3CLO A;  3K10 A;  2IAI A;  3OYD A;  2VUM J;  4CDG A;  4XOP A;  1VQO I;  5FKO A;  3R60 A;  3V8L A;  5DUI A;  4N9I A;  5GAG J;  2KLO A;  3OYG A;  3E6D A;  4XON A;  4DYC A;  2R93 J;  3U21 A;  2GBY A;  3VOD A;  3HUG A;  4XIC A;  4B8X A;  4XLN F;  2L0K A;  4N0B A;  3N4M A;  1QQI A;  3JAM Z;  2A5Y B;  1TWH J;  3K1M A;  3RSN A;  1G2H A;  3C1D A;  4HDV A;  5D8K B;  2V6E A;  5F64 A;  1HKS A;  4S0H B;  5DV5 A;  3OYL A;  3HBL A;  4D7M A;  2XB5 A;  1TWA J;  4Q48 A;  1LEA A;  5TJJ A;  2VQH A;  2D5V A;  4NC6 A;  4G6Q A;  4I0B A;  2KT0 A;  2NS0 A;  4E70 A;  1J59 A;  4H4K C;  2HTJ A;  2HDD A;  1VQ6 I;  2VJ4 A;  1YX3 A;  4A12 A;  4XLE A;  3KZI C;  1H88 C;  1FYM A;  4S04 A;  5CVI A;  4KT6 A;  2Z3Y A;  3E6B A;  2GOX B;  3DQV C;  3K1P A;  5EEH A; 
#chains in the Genus database with same CATH homology
 2RGV A;  3SQN A;  5E1W A;  3L2C A;  4LB5 A;  4ZH4 F;  2YSR A;  3K69 A;  1TNS A;  2PMU A;  1K78 A;  2E7X A;  4BNC A;  2MD5 A;  2K7L A;  2LF7 A;  3M9A A;  4KUM A;  3EYY A;  4G94 A;  2FQ3 A;  1G3W A;  3FM3 A;  3FWE A;  2ZJ2 A;  3KZZ A;  2IJL A;  4PGG A;  2M8E A;  4LGW A;  2VC1 A;  2XAF A;  2EFW A;  1MDM B;  4WXC A;  5L3G A;  3CUQ C;  3FXQ A;  1LB2 A;  4EM1 A;  3TQN A;  1UHM A;  2VE9 A;  2STW A;  4IHT A;  3PQK A;  2G7H A;  2ZNY A;  5DUK A;  3T8T A;  3TOA A;  2PG4 A;  4ON0 A;  5ICG A;  3H3U A;  4CYD A;  3WTW C;  3HSR A;  2FSW A;  4KN4 X;  2UZK A;  1OMI A;  3Q9S A;  1IN7 A;  3M1E A;  3IWF A;  4UNO A;  5HDK A;  1XGS A;  3E6C C;  3EYI A;  3FMS A;  3WOD F;  4I98 B;  1BC8 C;  3MQ0 A;  4MGR A;  3BOQ A;  1GHC A;  4M9Z A;  2QQA A;  4AIJ A;  3F8F A;  5D5V B;  1H9T A;  5DD8 A;  2VE8 A;  2FEZ A;  4L9N A;  2L3D A;  5LEK A;  2EJR A;  2Y48 A;  2ZME B;  4HDU A;  2AXL A;  4P5O A;  3GZ5 A;  2O0Y A;  4UVC A;  1T38 A;  2KIM A;  1D3Y A;  3KE2 A;  2EK5 A;  3FXU A;  3HSF A;  3LFK A;  2K86 A;  2VBW A;  2R3S A;  1LQ1 A;  4IF4 A;  1OYW A;  2A61 A;  2Z33 A;  4ENK A;  2VXZ A;  3BZ6 A;  5IT9 Z;  2J5O A;  1U5T A;  1HW5 A;  2RV8 A;  5JHU A;  3MCZ A;  3GUD A;  1ZRE A;  3J7A O;  2WWY A;  2M87 A;  1SMY F;  3RDI A;  2FF4 A;  1XDS A;  5AON A;  5FFZ A;  3WTV C;  1PDN C;  5LEJ A;  2X4H A;  1G3Y A;  1FWZ A;  1W4M A;  5K5Q A;  2G7U A;  2HQN A;  2NNY A;  2DQR A;  5AIP A;  1KQ9 A;  2GA1 A;  2W25 A;  4IJA A;  4XSZ F;  3CO6 C;  4PDK A;  3JW4 A;  4B09 A;  4GCV A;  4EM2 A;  1HQC A;  2O3F A;  1PUE E;  4GXO A;  2LF8 A;  3GFJ A;  1G3T A;  2LNB A;  5ILV A;  5HOO A;  5E17 F;  2KRF A;  3KP3 A;  3Q5F A;  2H94 A;  2E7W A;  2VBX A;  3D0S A;  2XAQ A;  4I2O A;  2YX7 A;  4A5N A;  3I59 A;  3JSP A;  4KN7 X;  5L3D A;  2MH2 A;  3IKV A;  1T2K A;  2HKO A;  4D0P A;  4R1H A;  4M73 A;  4BAY A;  4JBA A;  3LA2 A;  3ZQ7 A;  2VBY A;  4LD5 A;  2A3S A;  2EV5 A;  3V4G A;  2HDC A;  1TW2 A;  1MJ9 A;  2UWM A;  3ZN0 A;  3GX4 X;  1IUY A;  5BOX A;  3SXY A;  4IRI A;  4LLG F;  1RUN A;  3KLO A;  3IRQ A;  1ZN2 A;  4BHP A;  1ZRC A;  2P7V B;  4NHJ A;  3M7G A;  3GFM A;  3KP6 A;  1B9M A;  4XLP F;  1REP C;  3F21 A;  4UVB A;  2QLZ A;  3DXJ F;  1O57 A;  2DU9 A;  2XVC A;  2ELH A;  1KYW A;  3W6K B;  1UST A;  1I1G A;  1U8R A;  3F8C A;  1S3J A;  3FM5 A;  5ILU A;  4KIG A;  5L3E A;  3HRS A;  2FE3 A;  4CGZ A;  5JFR A;  3FHZ A;  4YFK F;  2V6C A;  2W24 A;  1ZLJ A;  2XGX A;  5DD4 A;  3WU1 B;  1K78 B;  2GQQ A;  3FX3 A;  1YO5 C;  1ZH5 A;  4CXF A;  1B4A A;  5FLX K;  4FX0 A;  1Z1D A;  1QZZ A;  2V1D A;  2DW4 A;  1ZHF A;  4G7H F;  4HV5 A;  4MQV A;  2Q2E A;  1TLH B;  2MLG A;  6PAX A;  2PFB A;  5FD5 A;  4RB2 C;  1RZ4 A;  4U0Y A;  3U2R A;  2STT A;  2ZCW A;  2JPC A;  2H27 A;  4BHC A;  4DQ2 A;  3WE2 A;  3OV8 A;  1RIO H;  4IRG A;  2DAO A;  4HZF A;  3Q9V A;  1TW3 A;  1XGO A;  1LJ9 A;  2E1N A;  2L01 A;  1LDJ A;  2NNN A;  4I02 A;  2ZXJ A;  4G7O F;  3HHH A;  3ZMZ A;  4FT8 A;  2HQR A;  2QUF A;  5LHI A;  4Q5S F;  3JTH A;  4KIC A;  5LHG A;  1B1B A;  2QEN A;  4ESF A;  2OAZ A;  4OIQ F;  3GFL A;  3MZY A;  3R4K A;  1FZP B;  4WWC A;  3I53 A;  1U3E M;  1Z7U A;  4ZYE A;  3ABU A;  2J5P A;  4YFN F;  2COM A;  3EDP A;  5D4R A;  2JSC A;  1KYZ A;  2FOK A;  2NAZ A;  5EEG A;  4L18 B;  5L3B A;  5LGU A;  2BEO A;  5FD6 A;  4HX4 A;  1KU7 A;  3RPU A;  2PJP A;  1R36 A;  1SD7 A;  3SZP A;  2M30 A;  2NRA C;  3KEQ A;  3CDH A;  4OIR F;  4HQE A;  4EJT A;  1P92 A;  3E5U A;  3KET A;  4L5J A;  4NQW A;  1XD7 A;  5D6F A;  2O8X A;  1T39 A;  2V1U A;  2L4A A;  3JTG A;  2RC4 A;  1IRF A;  1FPQ A;  5E8I A;  1QPM A;  1U5T B;  3F8B A;  5JVT A;  4PZJ A;  1YLF A;  5ICE A;  5HDN A;  1G4D A;  3TOB A;  4OMZ A;  1BIA A;  3IKT A;  4DNC A;  3B02 A;  4HYE A;  3MAJ A;  1YW8 A;  3ROU A;  2D1V A;  3WU0 A;  1BBY A;  4ENJ A;  1KU9 A;  4S05 A;  3WGG A;  2GAU A;  1O3Q A;  1UHW A;  2QBY A;  1QNT A;  2CYY A;  1EV7 A;  4MEY F;  3CO7 C;  3LQR A;  3SFZ A;  3M8E A;  4ENN A;  5HLH A;  4EV0 A;  1BOA A;  4WF2 A;  2TDX A;  3HTS B;  3R0A A;  2JTV A;  2EFQ A;  4WK8 F;  3HOS A;  2K27 A;  5CYV A;  2CQK A;  3QOP A;  1XSD A;  3GO5 A;  4L9V A;  1AOY A;  5D6E A;  3V7S A;  5F1R A;  3U9G A;  3WG9 A;  2VT3 A;  3ULQ B;  3WE3 A;  4UXN A;  3I59 B;  3RTR A;  3I5U A;  3ISP A;  3MEX A;  3QU6 A;  1E17 A;  1V4R A;  1XDU A;  1OYI A;  3CTA A;  3MFK A;  4Z2Y A;  3DF8 A;  3GXO A;  2O6G E;  2D1H A;  1IRG A;  2VBZ A;  5DYM A;  3ML6 A;  2VN2 A;  5CJ9 A;  3GF2 A;  3GFI A;  3WTZ A;  2ISZ A;  3DP7 A;  1IAW A;  2DI3 A;  3EQL F;  2W85 A;  4G8X A;  4NB5 A;  5JI6 A;  1R1U A;  3L00 A;  4EJO A;  3V8J A;  3E6M A;  4LLL A;  2GA2 A;  3HHG A;  4CIC A;  2FML A;  2L4M A;  4MHG A;  4ZZD A;  4PGH A;  2H6B A;  1X3U A;  3HIF A;  2H09 A;  1ZRD A;  4YIF A;  4EGZ A;  3EET A;  3K2Z A;  1YFH A;  1JXS A;  1JHH A;  4MQ9 F;  1B9N A;  5KVR A;  4GO1 A;  3I0T A;  3P7N A;  1I6X A;  2XIG A;  3IC7 A;  2CWE A;  2DK5 A;  2G9W A;  1IXC A;  5FLX Z;  1FYK A;  4LK0 F;  2A6E F;  1OKR A;  1SD6 A;  1U6G A;  2QVO A;  4LG0 A;  1B59 A;  2Z5U A;  3DPL C;  2D2W A;  1Y0U A;  4HV6 A;  3WTS C;  3WTY C;  1G6N A;  1IN4 A;  1F1Z A;  5E18 F;  3ZN1 A;  2JT1 A;  4KA4 A;  2OU2 A;  1LDK B;  2F2E A;  1MZB A;  4OU0 A;  1ZRF A;  1EH7 A;  1D8K A;  1TBX A;  3ZMT A;  3ABT A;  2PQ8 A;  3P9C A;  1HW1 A;  3F8N A;  4L5I A;  1J5Y A;  2YX4 A;  5HS8 A;  2YU3 A;  1ZYR F;  2KIU A;  3FXR A;  4WXD A;  3TGN A;  1BN5 A;  4ZZL A;  1F9N A;  1WI9 A;  1Z05 A;  4A6D A;  2ZO4 A;  3FMR A;  2XKP A;  3SHF A;  4H0E A;  4BHB A;  1XGN A;  3C7J A;  1FSH A;  2OBP A;  2HYF A;  4ZYH A;  4KMU X;  1S29 A;  3ZMU A;  1YTY A;  2HKX A;  1KGS A;  3WGI A;  1S7A A;  1ZAR A;  1HSJ A;  4EJU A;  3TO6 A;  5LBQ A;  4HLY A;  1TQI A;  1YYV A;  1XCB A;  2Y75 A;  2DK8 A;  1FSE A;  3CUQ A;  5BQT A;  2XAJ A;  1O7F A;  3LAJ A;  3O6B B;  4ETS A;  2FU4 A;  1ODD A;  3G73 A;  3BPV A;  2BYV E;  1YS7 A;  2QQ9 A;  5D5X B;  2MBF A;  4KIF A;  3FZV A;  1WWX A;  1GVJ A;  2IW5 A;  2FBI A;  2IRF G;  1W7P A;  4UV8 A;  2EV0 A;  2CO5 A;  2GXB A;  1RNL A;  2XAH A;  2P5V A;  1Z9C A;  3F3X A;  3ZMD A;  2HOE A;  3LA3 A;  3C18 A;  2R7F A;  4IVN A;  2O03 A;  2A07 F;  4A0Z A;  2QBY B;  5A2Q Z;  3P9I A;  5J6X A;  2XRN A;  4YII A;  3W6J B;  3TDU C;  2M1B A;  2XHK A;  1B6A A;  1J0R A;  1WKM A;  3PQJ A;  1OPC A;  4ENM A;  3KCC A;  2IVM A;  4OIN F;  1D5V A;  1FP1 D;  3COA C;  3V8K A;  4GYI A;  1YG2 A;  1RUO A;  5LRS A;  1OYY A;  2D45 A;  3MWM A;  4I0A A;  2P4W A;  4KT5 C;  1J7K A;  3K1N A;  3V7R A;  4WXH A;  1DPR A;  2QYO A;  3VOE A;  4HOB A;  3HOT A;  2OZ6 A;  3L09 A;  4I01 A;  1KU2 A;  1XN7 A;  2A6H F;  1DP7 P;  1H9G A;  3IWZ A;  4KYW A;  4LLN A;  1CGP A;  4FX4 A;  2RN7 A;  5FO5 A;  4BYY A;  3KP2 A;  2XAS A;  4ZYG A;  1K6O A;  4M71 A;  3H92 A;  4HLX A;  1WQ2 A;  4AIH A;  3T5X A;  4UV9 A;  2W84 A;  3O3K A;  5D5W B;  1HBX G;  4LK1 F;  1XMK A;  2V79 A;  3HRT A;  3BJA A;  2P6T A;  3I54 A;  2Q0O A;  3I71 A;  5DDG A;  4RGR A;  3EUH A;  3T1B A;  1IW7 F;  4MEX F;  3IRR A;  1JGS A;  2A68 F;  3LST A;  3JSO A;  3I4P A;  4ESJ A;  2LSO A;  5E1Z B;  1DPU A;  1V3F A;  4RB1 A;  4L9J A;  2DBB A;  4RB3 C;  2FRH A;  5H20 A;  2KJB A;  1ZG5 A;  2QQB A;  4EJW A;  4KDP A;  4R79 A;  4O5V A;  3F8M A;  3ECO A;  2K02 A;  2A69 F;  3TKY A;  2L54 A;  2M45 A;  3O2P E;  1U2W A;  1K79 A;  1BJA A;  4ESB A;  4LG0 B;  3REO A;  4O3M A;  2CSO A;  1FX7 A;  5DCF A;  4Q47 A;  2ACJ A;  5DEQ A;  4HA8 A;  4KFC A;  2MH9 A;  4AIK A;  2IT0 A;  1ZGA A;  1QZY A;  1MGT A;  2V9V A;  3SZT A;  1BI1 A;  4OMY A;  1BM9 A;  5K5R A;  4TV7 A;  2ISY A;  1KQ8 A;  3RJP A;  1RI7 A;  1L3L A;  3DEU A;  1R7J A;  1T98 A;  4Y17 A;  4MNU A;  3HTU A;  2HFH A;  1FBU A;  1SD4 A;  4I7H A;  2F5C A;  2KJC A;  2HEO A;  4RGU A;  1HW2 A;  4M9X A;  4FHT A;  4O6J A;  3J80 Z;  1I1S A;  4XBF A;  1GXQ A;  4KMF A;  4HF2 A;  4IPA A;  1R5H A;  1O7L A;  2MC3 A;  3HSE A;  1IF1 A;  5HS7 A;  2P7C B;  1YQA A;  4M74 A;  2BBY A;  4L0Y B;  2ESH A;  1R22 A;  2RQP A;  2VON A;  4UUV A;  2XUB A;  2JRT A;  1JHF A;  4P9U A;  2FNP A;  5ICC A;  2B0L A;  4RGS A;  1S8N A;  1IZ1 A;  3QAH A;  2ADU A;  5E20 A;  1KQ0 A;  1G3S A;  3TO9 A;  4BH9 A;  1IXS B;  4L9T A;  3GVA A;  1BIB A;  1FBQ A;  2EA2 A;  3DPT A;  4JK1 X;  2MLK A;  4G7Z F;  4CZZ A;  1HXD A;  1USS A;  4A2U A;  3OOP A;  1WRJ A;  2FBH A;  3GWZ A;  3WGH A;  1D8J A;  2RDP A;  1SMT A;  2ETH A;  1VTN C;  2Q8K A;  3CUQ B;  3ERE D;  1U78 A;  5A2Q K;  4UHT A;  1ON2 A;  3IL2 A;  1FY7 A;  2IA1 A;  5HLG A;  1I27 A;  4EM0 B;  3T8R A;  3DV8 A;  2GZW A;  2LKP A;  5ICF A;  4LMY A;  4Y13 A;  5H6R A;  3F6O A;  3KLN A;  1KA8 A;  1C0W A;  3E97 A;  2IP2 A;  4U88 A;  1W7P B;  1FLI A;  1U5T C;  2XRO A;  4MTD A;  3N97 A;  2KKO A;  3VFZ A;  1L0O C;  1YW9 A;  1QBJ A;  4PCQ A;  1TTY A;  1IN8 A;  2RNJ A;  4OIO F;  3DFG A;  4HF0 A;  5JR3 A;  3TDZ C;  1P2F A;  1HKT A;  2Z99 A;  3ECH A;  1I5Z A;  5CVJ A;  4Q4Z F;  4ASN A;  2WTE A;  4HQM A;  5HVQ C;  2C6Y A;  3BRO A;  4AD9 A;  3P9K A;  2XKO A;  5E1X A;  3T0Y A;  3K9T A;  1MD0 A;  1TNT A;  5ILS A;  2IA2 A;  2RKH A;  3J81 K;  1FYL A;  2VC0 A;  3WTU C;  4BQA A;  2CGP A;  4CO8 A;  4M6Y A;  1MKM A;  5J8C A;  1STZ A;  1P4X A;  3KP4 A;  4JQF A;  1YS6 A;  3LQQ A;  1LVA A;  1MJA A;  2PEX A;  4P9F A;  4P55 A;  2DT5 A;  1BI0 A;  4WCG A;  2Z9O A;  2FBK A;  3BJO A;  1R5G A;  2WC2 A;  4HW0 A;  4G6D A;  2VT2 A;  1ZGJ A;  4M6X A;  2PLY A;  2CFX A;  2HTS A;  3RYR A;  5IT3 A;  2BGC A;  3HRM A;  2P5K A;  2NYX A;  1W7P D;  3BWG A;  2EFO A;  1UB9 A;  5D8L B;  4KNY A;  3K0L A;  5H6Q A;  3VB2 A;  5D4S A;  3S2W A;  4OIP F;  3RYP A;  2DPU A;  5LGT A;  1CF7 A;  4CHU A;  3GYH X;  3LWF A;  4A0X A;  2F5E A;  2IPQ X;  5DCM A;  5CLS A;  3BY6 A;  1R1T A;  3L7W A;  5D5U B;  2V1X A;  1FT9 A;  5HS9 A;  1J2X A;  4LJZ F;  5F6F A;  4HX8 A;  4F7Z A;  3G3Z A;  1Z6R A;  2Y0M A;  5BS6 A;  2F5D A;  4UVA A;  3ZP5 A;  2HZT A;  5LHH A;  1HKQ A;  4EJV A;  2E1C A;  4IHS A;  4IRH A;  4L0Z B;  2QWW A;  1ZG1 A;  2DLL A;  3GZ6 A;  1W5S A;  3I64 A;  2CW0 F;  3J80 K;  1DUX C;  1XB4 A;  2HWV A;  3KP5 A;  1XGM A;  3QP6 A;  3R6S A;  2ZBK A;  4OOI A;  2P5L C;  2R7D A;  3E5X A;  1A04 A;  1FNN A;  2HS5 A;  1AWC A;  2OZU A;  4ZYD A;  2LDU A;  1ONV A;  1T0F A;  2X0L A;  1R23 A;  1ON1 A;  2DO7 A;  3FMQ A;  2UXX A;  3AAF A;  1O3R A;  2FXA A;  1UFM A;  3CJN A;  1BC7 C;  2DTR A;  2GIV A;  3F23 A;  2FNA A;  3BP8 A;  2EWN A;  4YFX F;  2P6S A;  4Y15 A;  3DKW A;  3RKW A;  1QO0 D;  2KIF A;  3D5L A;  3HYI A;  1HST A;  3NQO A;  3F22 A;  1J75 A;  2HGC A;  3PFI A;  5HDG A;  1Z91 A;  4I09 A;  3E5Q A;  1LNW A;  4AWX B;  3ZPL A;  1J9I A;  4K2E A;  2ESN A;  3JAM K;  1O3S A;  3LAP A;  5CVR A;  3M8F A;  2OA4 A;  2P8T A;  4U0V A;  1ZLK A;  1OR7 A;  4GYG A;  5BMZ A;  2H6C A;  3F72 A;  2BV6 A;  5E8G A;  4QLC U;  2OD5 A;  1EH8 A;  1XSV A;  4LB6 B;  4P96 A;  2PN6 A;  5L3F A;  4G9Y A;  4IXA A;  1E2X A;  4A0Y A;  1TQP A;  2QZ8 A;  2XV4 S;  1MDM A;  1MJB A;  4RB0 A;  3E3V A;  2OQG A;  4M72 A;  1ZG3 A;  3QPT A;  2YR2 A;  1SAX A;  3LA7 A;  4RS8 A;  5K1Y A;  3RKY A;  4YG2 F;  2PBI A;  1NHA A;  2RVC A;  1SD5 A;  3HRU A;  4EMS A;  3QPH A;  2ZFW A;  4GGG A;  3H3Z A;  1LEB A;  2IA0 A;  4HBL A;  1P4A A;  1YW7 A;  3ZMS A;  2HYG D;  4R8H A;  3TO7 A;  1T6S A;  4U7B A;  3RI4 A;  5BPI A;  1FOK A;  2VOP A;  2K4J A;  5K5O A;  5HLI A;  3RIR A;  2L02 A;  3J81 Z;  2EB7 A;  4WX9 A;  1S7O A;  2PI0 A;  2UXN A;  1XCV A;  1DDN A;  2F5F A;  3KFW X;  3BDD A;  1PP8 F;  4U7D A;  5FFX A;  4A6E A;  4XSX F;  4RGX A;  1W5T A;  2ZME A;  3MZH A;  4HX7 A;  1QGP A;  2M5W A;  5FGM A;  2AS5 F;  3ELK A;  4HAM A;  2FMY A;  5AIQ A;  5BPD A;  5CVU A;  1ZAO A;  2YPR A;  2WV0 A;  5CVV A;  2VOD A;  1SFU A;  2EA4 A;  3RKX A;  3CUO A;  4RAY A;  5J8F A;  1R58 A;  3QRF F;  5KK1 A;  5LGN A;  3FF5 A;  2BE5 F;  3I58 A;  4QWQ A;  3V7C A;  4RAZ A;  2DFI A;  3WTT C;  2HR3 A;  1BI3 A;  1ULY A;  2QM3 A;  2GXG A;  1Z6T A;  3NEU A;  1YIO A;  1FBS A;  5LLQ A;  4XRF A;  1F5T A;  2EFP A;  2JPB A;  5L3C A;  4U0W A;  1EH6 A;  4EVI A;  5ERI A;  1IN5 A;  3R61 A;  2OQR A;  2GWR A;  2DPD A;  5IT9 K;  4A5M A;  1CF7 B;  1FC3 A;  4MTE A;  2XAG A;  3VEP A;  4HF1 A;  1GXP A;  4EGY A;  3C3W A;  3RPQ A;  5ED4 A;  1TQM A;  4M9S A;  5TRD A;  5DCM B;  3WTX C;  2O61 A;  4EQQ A;  1IXR C;  1K7A A;  3KP7 A;  3QU3 A;  1R1V A;  2K4B A;  1PP7 U;  1JE8 A;  1XSX A;  2DQL A;  3B73 A;  3ZMV A;  3QP5 A;  1P6R A;  1P4W A;  3BPX A;  3GEZ A;  1SFE A;  4LFU A;  4BXU A;  4KIB A;  3IHU A;  3NRV A;  1XMA A;  2JZY A;  1H0M A;  1BI2 A;  1FP2 A;  3KEO A;  4N9H A;  1O3T A;  2VOO A;  2EFN A;  2CG4 A;  1KU3 A;  1UCR A;  2FA5 A;  4AVP A;  2EV6 A;  3R0J A;  1R00 A;  5FB2 A;  3L9F A;  3KZY A;  3GLX A;  1IN6 A;  1LDD A;  3F6V A;  2ZKZ A;  3U1D A;  1Q1H A;  3BJ6 A;  1SFX A;  1S6L A;  2PMH A;  2W57 A;  1F4K A;  5LRR A;  1WSU A;  2MA3 A;  3GW2 A;  2ZNZ A;  3CLO A;  4CDG A;  3R60 A;  3V8L A;  5DUI A;  4N9I A;  3E6D A;  3VOD A;  3HUG A;  4B8X A;  4XLN F;  4N0B A;  3N4M A;  1QQI A;  3JAM Z;  2A5Y B;  3K1M A;  3C1D A;  4HDV A;  5D8K B;  5F64 A;  1HKS A;  5DV5 A;  4Q48 A;  5TJJ A;  1LEA A;  4G6Q A;  4I0B A;  2NS0 A;  4E70 A;  1J59 A;  2HTJ A;  4A12 A;  1FYM A;  4S04 A;  5CVI A;  2Z3Y A;  3E6B A;  3DQV C;  3K1P A;  5EEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...