5E20A

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the 2,3-dichlorophenol bound form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLDKKHMVRIKLSEKAIDTFYQALEISNRVYKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides sp. cbdb1
total genus 59
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e20A00
1KA8A 5EEGA 1T39A 1J7KA 2DT5A 4U0VA 1NHAA 1FT9A 1KYZA 4MGRA 3WE3A 1T98A 3KE2A 1R5GA 1FPQA 4U7BA 3CTAA 3DFGA 3IRQA 3RIRA 1MGTA 1P4AA 1JGSA 1W7PA 1BI0A 4OIPF 2HQNA 2ESHA 4HZFA 4YFNF 4HX8A 1KQ9A 1EH8A 2ZXJA 2G9WA 4AWXB 1R23A 2FMLA 2CQKA 2XGXA 2WV0A 3HRUA 3M8FA 4ZYDA 1YO5C 1TLHB 3DKWA 1QO0D 1B1BA 3WTWC 1FP1D 2HDCA 5HS9A 1IXCA 3CJNA 2M5WA 3I59A 5CVUA 3J81K 1KQ8A 3IHUA 4A5MA 2P7VB 4K2EA 5HLHA 2BYVE 2XUBA 1W5SA 2FOKA 2V6CA 2ZMEB 2A68F 5D8LB 4OU0A 3GLXA 2W85A 5IT3A 4A12A 1J59A 1OYWA 1QZYA 2XHKA 1O3TA 2RGVA 1J75A 1SD6A 4ENKA 3W6KB 1YTYA 2HQRA 3ULQB 1FYMA 5DDGA 1D3YA 3K1PA 3DPLC 3V7CA 3R0JA 3IL2A 4L5IA 1MDMA 4DQ2A 2BBYA 1KU3A 1K7AA 4ZYHA 3RYRA 1ZGAA 3I58A 1R1UA 3RKYA 5CJ9A 4CICA 3DV8A 4YFXF 3LA2A 1OYYA 5HDNA 2XRNA 1JHHA 1YS6A 5L3DA 1FOKA 1SMYF 3ECHA 5D6FA 5BPDA 5LEKA 4HAMA 2D1VA 4WF2A 4LK1F 1XSXA 1R00A 3LFKA 1XSDA 5FFXA 2HR3A 2ZNYA 2ESNA 3FM3A 3U2RA 4UHTA 1WQ2A 1FSEA 5KVRA 1BIAA 2MH9A 2YPRA 2D1HA 1KU2A 1ZG5A 1LVAA 2PQ8A 2EB7A 4M74A 3J7AO 1I1GA 1TTYA 2ADUA 5FD5A 3LSTA 1ON2A 4UV8A 1PP7U 2GXBA 3F72A 5FFZA 4HV6A 1E17A 5AIQA 3FX3A 3CUOA 3L2CA 6PAXA 1CF7B 5L3FA 3JTHA 1RI7A 4PCQA 2QQAA 4OIOF 3K2ZA 4XLNF 3DEUA 3R0AA 2Q8KA 1HSTA 4ZZDA 1BJAA 2NRAC 1XGOA 2QBYA 3RJPA 3TO7A 4BHPA 1H0MA 2EFWA 5K5QA 1OPCA 5CVRA 3F8BA 1QZZA 4I01A 2Z99A 5F6FA 1V4RA 5J6XA 5D4SA 3P7NA 1QBJA 4P9UA 4GCVA 5E20A 4YIFA 3HYIA 4R8HA 3GX4X 2ELHA 3GWZA 1U5TA 5L3BA 3GW2A 2DTRA 1F5TA 2DQLA 1ODDA 3HTUA 3T0YA 2UZKA 1I27A 2HKOA 1K78A 3PFIA 1D8JA 2OA4A 2R7FA 3ZQ7A 1IN8A 1OMIA 3WGIA 3GFMA 3Q5FA 1W4MA 4KUMA 3IWZA 1YW7A 1WRJA 3EYYA 5E8IA 3L00A 1Y0UA 1QGPA 4AVPA 4OOIA 4S05A 4KN7X 2YX7A 4L0ZB 1U3EM 4GGGA 2O8XA 4KIBA 2Z9OA 2H09A 3QAHA 4LFUA 5DYMA 2M8EA 2OQRA 2ZKZA 3MZHA 2L02A 2PI0A 2XKOA 4FHTA 3KCCA 3ZMZA 2VONA 5CLSA 3COAC 3M8EA 3TOBA 2P6TA 4L0YB 5HS8A 2VXZA 2JT1A 1IN6A 4HA8A 2DPDA 2RC4A 1ZN2A 3WTVC 4NHJA 3FZVA 4KMFA 2GA2A 2ZNZA 3BWGA 5DCMA 2PN6A 1SD7A 3R60A 4M6XA 3HSRA 1T0FA 2X0LA 1QNTA 1DDNA 3GUDA 2K4BA 1U2WA 3FMQA 3E6CC 2HTSA 3SFZA 4AIKA 4UVCA 2JPBA 2QUFA 4EM2A 2YX4A 4Y13A 4MQVA 3BZ6A 5JVTA 4RB1A 3C7JA 2OAZA 4I09A 2FNPA 3HRMA 3ZPLA 1ZARA 2LDUA 3LA3A 4ASNA 2BV6A 1CGPA 1IRGA 1F4KA 2XAJA 3I64A 4LMYA 3EQLF 1HW5A 1USTA 4IPAA 4HX7A 3WTTC 4PGHA 1A04A 3KEQA 3GZ6A 2GAUA 2H94A 4UVAA 1R1VA 3J80Z 2XV4S 2GZWA 2OD5A 4R79A 4EGYA 2P8TA 5LGTA 4EJTA 4BYYA 2RNJA 3F8CA 1U78A 3LQQA 1BC7C 3TGNA 1PDNC 3QOPA 1W5TA 3B02A 2HWVA 4XSZF 4PZJA 2FNAA 3V7RA 2EA4A 2EFPA 1F1ZA 4NQWA 1WI9A 3TQNA 1ULYA 1O7FA 4RB2C 1CF7A 3BPXA 4LK0F 5L3GA 4WWCA 3ZMSA 5HLIA 2UWMA 3LQRA 1KU9A 3M7GA 1XDSA 4HQEA 3HHHA 1KQ0A 4ON0A 1IN5A 2IA2A 4CYDA 5LGUA 1FC3A 3FF5A 3QU3A 1P6RA 2JZYA 1HKSA 4BHCA 2VC1A 1Z7UA 1HW1A 3KZYA 2FBKA 5LRSA 2P4WA 1XMKA 4WK8F 2W84A 4XRFA 1BI3A 3K1MA 3RTRA 4LD5A 5IT9K 3R4KA 2IPQX 3E5QA 3BOQA 2P7CB 3OOPA 3FWEA 3C18A 2O0YA 2XAHA 1LJ9A 3ZN1A 5HVQC 4HLXA 2VOOA 3F8FA 1BN5A 2EJRA 1UCRA 3V8KA 3I53A 4OMYA 4M71A 3E5XA 1KU7A 2MD5A 2VT2A 5FLXZ 4ETSA 1WWXA 3I0TA 4EJUA 2L54A 3HSFA 1IAWA 2L3DA 2FEZA 4HLYA 1XGSA 1Z91A 4M73A 4MNUA 2K27A 5ICGA 4OMZA 1J0RA 3O6BB 2V79A 4HX4A 1USSA 4OIQF 3BJAA 1FNNA 2FSWA 1LEAA 4ENMA 1XCBA 4H0EA 4AIJA 5H6QA 4LLLA 1LQ1A 2QWWA 3FXUA 3EDPA 2P5KA 3MEXA 1QQIA 1J2XA 1S29A 2K7LA 4E70A 2RV8A 2IRFG 2HGCA 5LRRA 4G7ZF 4LG0A 1BI1A 4KICA 4I0BA 5A2QZ 4EV0A 1TQPA 1LEBA 3BJOA 4IVNA 5BOXA 1XD7A 1ZGJA 1ZHFA 1Z6TA 4XBFA 4RAZA 5J8FA 5E18F 3V8LA 2DPUA 2EA2A 4KIGA 1SD5A 1BC8C 1ZRFA 5HLGA 3JAMZ 2RKHA 2ZBKA 2E7XA 1TNSA 2KRFA 2L4MA 5HDKA 2FBIA 2IJLA 1LNWA 5AIPA 1Q1HA 1WKMA 3I4PA 4ZYGA 2IT0A 4KFCA 2HOEA 1Z6RA 3IKTA 1R36A 1S8NA 3T1BA 2O3FA 1AWCA 3D0SA 4BHBA 1MJ9A 2PFBA 1IZ1A 4HF0A 1HSJA 2PMUA 3HRTA 2A07F 4EJOA 4M6YA 4G7HF 4JK1X 3G73A 2VE8A 1S7OA 2NAZA 2VBWA 1B6AA 2VBXA 3EYIA 2FMYA 4JBAA 3MZYA 3RYPA 1BI2A 1O3SA 1MJBA 3H92A 2G7HA 1BIBA 3VFZA 5DD4A 3VODA 1DUXC 2MH2A 2MLKA 1TQIA 1FZPB 4LLNA 2CG4A 2HZTA 4UV9A 1O3QA 3WTXC 2GQQA 1YW8A 3CUQB 1S3JA 1FP2A 3KP3A 5JR3A 1H9GA 2M87A 1ON1A 1ZREA 2LNBA 5EEHA 4A5NA 3FXQA 3I5UA 3ABTA 2D45A 4WCGA 5E1XA 5L3EA 2EWNA 1YLFA 4O6JA 5ILSA 1FBSA 4AD9A 5LHIA 1P4XA 3RKWA 3KP4A 4KIFA 4UVBA 4CGZA 1O3RA 1HKTA 4HDVA 1G3SA 5H6RA 2QZ8A 4S04A 1LB2A 3EETA 5HDGA 2BE5F 1ZG3A 5ICFA 4BQAA 2EFOA 4TV7A 3RKXA 4Y15A 1BOAA 3E5UA 3IKVA 3E3VA 4RGUA 3CUQC 2XASA 4QWQA 4ZH4F 3HRSA 3ZMUA 2M30A 1XMAA 1MJAA 5D5XB 2QM3A 5D8KB 4HDUA 4IHSA 2YSRA 3V7SA 3BPVA 5TRDA 2FBHA 2FU4A 2VT3A 4HF2A 2LSOA 2BEOA 2FQ3A 3QPTA 3HIFA 5ILVA 4QLCU 5ERIA 3T8TA 4G6DA 4I02A 4XSXF 4G94A 1LDDA 4A6DA 3KEOA 5BS6A 3TDZC 1IW7F 1RIOH 2CGPA 2OZ6A 2MBFA 4U0YA 2HKXA 3DQVC 4D0PA 1DPRA 2O61A 1DP7P 4BXUA 3L09A 1YW9A 2HEOA 2AXLA 1B59A 4WXDA 4F7ZA 4ENJA 5ICCA 2CYYA 5BMZA 2KIFA 1FWZA 2IVMA 2ZMEA 1FSHA 4HOBA 2Z3YA 2KIMA 3HSEA 3RPUA 1P92A 2VODA 2JSCA 3MQ0A 3HOSA 4A0YA 1GXQA 1K6OA 2L4AA 5JFRA 3I59B 3J81Z 3IRRA 3SHFA 3TKYA 4M9XA 1VTNC 3QP6A 1Z9CA 3ZN0A 2F2EA 5DUIA 3JSPA 2K02A 5DEQA 4PDKA 3GYHX 2J5PA 4UXNA 2Y75A 2HTJA 2FA5A 4KMUX 3L7WA 1GXPA 4HF1A 1OYIA 1FX7A 3HHGA 3H3UA 5F64A 4LJZF 5LBQA 1UHMA 3FM5A 3GVAA 2ISZA 4WXHA 2VN2A 3HOTA 5FGMA 3W6JB 4HBLA 1OR7A 2CW0F 1K79A 3GF2A 1MDMB 1R22A 2LF7A 2KJBA 3FHZA 3C3WA 1PUEE 3REOA 3BROA 1JE8A 4IXAA 1MZBA 3F22A 2DBBA 1QPMA 4Z2YA 3GZ5A 1RZ4A 1D5VA 2C6YA 4UNOA 2DI3A 3GEZA 2PMHA 2Q2EA 3TO9A 3RDIA 1KGSA 1ZAOA 3IC7A 2A6EF 3SXYA 5D5UB 1UFMA 5DV5A 4PGGA 2PEXA 3E6MA 2A61A 2COMA 1FBUA 2E1NA 2ZCWA 4CDGA 3U9GA 3ECOA 3R6SA 2Q0OA 2F5DA 3GFIA 1IF1A 2YU3A 3DXJF 1IUYA 1J5YA 1RNLA 4ESBA 5CYVA 3PQJA 4BNCA 1SD4A 4IF4A 3E6BA 1E2XA 4EJVA 3F6VA 1IN7A 4HV5A 4LLGF 4CHUA 2Z33A 2NNNA 1YG2A 1ZYRF 5J8CA 3ISPA 2RVCA 2E1CA 3K69A 4G9YA 4IRGA 3U1DA 3PQKA 2QQ9A 2CO5A 2OQGA 4A0ZA 3SZTA 2ETHA 2A69F 3F23A 2XKPA 2QBYB 3P9KA 3FMRA 2XAFA 4IRIA 1R58A 4EJWA 1FYKA 3IWFA 1HQCA 1B4AA 5CVVA 4XLPF 1T6SA 3ELKA 2V1DA 2F5CA 4M9SA 1GHCA 1G3YA 2RDPA 1UB9A 1ZRCA 3WU1B 1JHFA 2HYFA 5F1RA 4L5JA 4FX0A 3CLOA 1U5TB 3K9TA 1EV7A 4KA4A 4L9TA 3MWMA 4GO1A 2A5YB 1YYVA 2BGCA 3K1NA 1K78B 4LGWA 4L9JA 3ZMVA 4UUVA 3HTSB 4IJAA 1MKMA 3DP7A 2STWA 4P9FA 2F5FA 4G8XA 3BDDA 2DU9A 1P4WA 4RGRA 4I7HA 1SFEA 5JHUA 2HS5A 1RUOA 3Q9SA 4R1HA 2EK5A 2P6SA 3KP2A 3KETA 2G7UA 4I0AA 1G3WA 4HW0A 2HFHA 4RGSA 1U5TC 1HW2A 1W7PD 1TNTA 2XVCA 4ZZLA 4DNCA 4M72A 5E1WA 3WE2A 2FE3A 2VE9A 3BY6A 4ESFA 1SFXA 4LB5A 4O3MA 2MLGA 4L9NA 4JQFA 4MEXF 4L9VA 4ENNA 5KK1A 1U6GA 2O6GE 3H3ZA 4KNYA 2IP2A 4LB6B 2PJPA 2OZUA 2K4JA 3CDHA 1HXDA 5DCMB 3OV8A 2L01A 2Z5UA 2H6BA 3V8JA 2JPCA 2IA1A 2STTA 3F3XA 1R1TA 4RS8A 3VOEA 4P55A 4MHGA 2DAOA 4ZYEA 4EMSA 4WXCA 1G6NA 1X3UA 3J80K 1TBXA 3BP8A 1REPC 3WGGA 3K0LA 5HOOA 3QPHA 2CWEA 2QQBA 4RGXA 4GYIA 3N4MA 1S7AA 4HQMA 2EFNA 4B09A 5D5VB 1IN4A 4Y17A 3LA7A 2V1XA 1S6LA 2F5EA 2ZJ2A 1J9IA 1ZH5A 4U88A 2R7DA 2YR2A 3I71A 4BAYA 5BQTA 1ZLJA 4IHTA 3MFKA 2DO7A 4FX4A 3S2WA 3LAPA 4MTDA 3M1EA 2PG4A 2OBPA 1RUNA 4I98B 1PP8F 1SAXA 2MA3A 3JTGA 1I1SA 4AIHA 4IRHA 2B0LA 1ZG1A 1O57A 3KFWX 1G3TA 3QP5A 5K1YA 5LGNA 5AONA 3HUGA 2QLZA 2XAGA 1OKRA 1V3FA 3WG9A 3NRVA 1FY7A 3KLOA 5E8GA 3F8NA 1FLIA 2KJCA 3P9CA 3AAFA 2EV5A 3MAJA 5ILUA 2OU2A 1HBXG 1C0WA 4EM1A 4P96A 5LHHA 2A6HF 3QU6A 2W57A 2WWYA 1IXSB 1LDKB 2RQPA 4GXOA 4N0BA 2PLYA 3GFLA 4Q47A 3EUHA 3T8RA 1STZA 3WTYC 4O5VA 3NEUA 1ZRDA 3ZP5A 3NQOA 2DK5A 1AOYA 2A3SA 3CO6C 5DD8A 1XGMA 3KP5A 5FLXK 2XROA 2M1BA 3FMSA 4KT5C 1T2KA 3KP7A 1XN7A 2XAQA 4KN4X 1TW2A 3QRFF 4Q5SF 5IT9Z 2FF4A 2W24A 2VC0A 2VBYA 2UXXA 3WTUC 4ESJA 1DPUA 2X4HA 2DLLA 2Y48A 3F8MA 2GXGA 1O7LA 3ZMTA 1L0OC 4L18B 2KIUA 2H6CA 1XCVA 2ZFWA 3F21A 4I2OA 2E7WA 1YFHA 4A6EA 2LKPA 4MTEA 1Z1DA 5ICEA 3F6OA 4KDPA 4Q48A 2GIVA 4CO8A 2LF8A 1W7PB 2M45A 1H9TA 5A2QK 5K5OA 1XDUA 4EVIA 3CO7C 3KLNA 2ACJA 3RI4A 3ML6A 3KP6A 1SMTA 1YS7A 2QENA 5HS7A 5D4RA 5D6EA 3DPTA 4B8XA 3WODF 3LWFA 3KZZA 4YG2F 3RPQA 4Q4ZF 3GFJA 5CVJA 3JAMK 1UHWA 5E17F 4WX9A 2VBZA 5LLQA 4M9ZA 2ISYA 2R3SA 1XGNA 3ERED 1HKQA 1ZLKA 4LG0B 5E1ZB 1B9MA 4KYWA 3SQNA 3MCZA 1YQAA 2TDXA 4RAYA 3WTSC 5FD6A 3D5LA 4YFKF 2GA1A 4EGZA 2NS0A 2KKOA 2V9VA 5L3CA 1TW3A 2QYOA 3TOAA 3N97A 2VOPA 4HYEA 4P5OA 3B73A 2FXAA 2FRHA 1EH7A 2DFIA 2O03A 1LDJA 2AS5F 4NB5A 1JXSA 1P2FA 1XB4A 5BPIA 2NNYA 3VB2A 1BBYA 1ONVA 3DF8A 2J5OA 3G3ZA 3CUQA 3BJ6A 4MQ9F 2JRTA 2P5LC 3I54A 2DQRA 3L9FA 2EFQA 2MC3A 4U7DA 3ABUA 5LEJA 2H27A 3TDUC 2XIGA 1IRFA 3JSOA 1R5HA 1SFUA 4RB0A 5DCFA 1GVJA 1B9NA 2Y0MA 1IXRC 2CFXA 2EV6A 4OIRF 1I5ZA 1F9NA 3P9IA 1Z05A 3M9AA 4N9HA 2GWRA 1U8RA 1WSUA 4YIIA 3T5XA 2PBIA 3FXRA 2JTVA 4GYGA 3E97A 2QVOA 5TJJA 4CZZA 2IW5A 2NYXA 5LHGA 2DK8A 3VEPA 3LAJA 4N9IA 1T38A 3TO6A 1R7JA 2P5VA 2RN7A 3JW4A 3O3KA 2ZO4A 1TQMA 2D2WA 1G4DA 5JI6A 3SZPA 2HYGD 4G7OF 4EM0B 3R61A 4OINF 2CSOA 2WTEA 2W25A 1FYLA 2IA0A 5FB2A 4BH9A 2EV0A 3O2PE 3WTZA 5K5RA 4A0XA 4RB3C 2UXNA 1BM9A 1L3LA 5DUKA 3GXOA 1EH6A 3Q9VA 4G6QA 3ZMDA 3GO5A 3C1DA 1FBQA 1I6XA 1MD0A 4EQQA 3V4GA 2V1UA 2DW4A 3WGHA 4CXFA 4U0WA 3WU0A 5FO5A 2K86A 5CVIA 4A2UA 3E6DA 1KYWA 1YIOA 3ROUA 5H20A 1XSVA 5D5WB 2WC2A 4MEYF 1D8KA 5ED4A 4FT8A
chains in the Genus database with same CATH superfamily
1KA8A 1Y1VJ 5EEGA 3OSGA 1T39A 5CQEA 2WBMA 3M07A 1J7KA 2DT5A 4U0VA 1NHAA 3BR0A 1FT9A 2EIKH 5JLXA 4A3BJ 1KYZA 1Z21A 2L9VA 4PJJA 4MGRA 3WE3A 1T98A 3K4KA 2BHYA 1R5GA 3KE2A 1FPQA 4U7BA 4BKXA 3CTAA 3DFGA 4JOMA 3IRQA 3GMEA 3RIRA 1MGTA 1P4AA 1JGSA 1W7PA 2XAUA 1BI0A 2M7BA 4OIPF 1LKXA 2HQNA 1W0TA 2ESHA 4HZFA 4YFNF 1QRYA 4HX8A 1P9QC 1KQ9A 1BA5A 2Y9YA 1EH8A 2M9HA 2MD0A 2ZXJA 4B1RA 2G9WA 1Z3XA 1KONA 2CFOA 1R23A 2FMLA 3CP8A 4AWXB 3HJEA 2XGDA 2O5RA 2CQKA 2XDVA 2XGXA 2MG4A 4YRVA 2WV0A 3HRUA 1JJ6C 3M8FA 4ZYDA 2A5WA 1V55H 2KDZA 1TLHB 3DKWA 1QO0D 1Y56A 1YO5C 1JKQC 1B1BA 3WTWC 2HZDA 1FP1D 2HDCA 3DBHB 5HS9A 4C9YA 1IXCA 5GADJ 3CJNA 2M5WA 3I59A 5F04A 5CVUA 2OCCH 3J81K 3PNVA 1KQ8A 5F08A 1YIJI 2M0CA 3IHUA 4A5MA 5IP7J 2M2EA 3LSRA 1HA8A 2DJNA 3GTGJ 2P7VB 2JMWA 4K2EA 5HLHA 2BYVE 2XUBA 1W5SA 2MYSA 1ETQA 2COBA 2FOKA 2TCTA 2V6CA 3IUOA 3PNTA 2ZMEB 1N78A 3JRGA 2A68F 1VNDA 2VQCA 5D8LB 2DMPA 4OU0A 1XS9A 5DM6F 1X3WB 3GLXA 2W85A 5IT3A 3DBLB 4RA2A 1FOYA 2Y0SA 4A12A 1J59A 3VSKA 2IGNA 1OYWA 1QZYA 2VXDA 2XHKA 2ZJPF 2CUEA 1O3TA 1ZQ3P 1PJRA 1VZ0A 2RGVA 4V2GA 1J75A 1SD6A 4ENKA 1FIPA 3W6KB 1YTYA 3HOYJ 3ZXSA 2HQRA 1WI3A 2L5QA 2E2IJ 3ULQB 1FYMA 5DDGA 1D3YA 3K1PA 3DPLC 3V7CA 2JA8J 2LYCA 1P7IA 3R0JA 3IL2A 4L5IA 2BXYA 1MDMA 1A6IA 1IGNA 4LIVA 1OFCX 1WJCA 4DQ2A 3PM1A 2BBYA 1KU3A 4A3GJ 3Q3SA 2KDOA 1K7AA 4ZYHA 5FKNA 3LSIA 3RYRA 1X3ZB 1ZGAA 1U8BA 3I55I 3I58A 1R1UA 3RKYA 2GXAA 2KZVA 5CJ9A 4CICA 3ASNH 3OYFA 1HF0A 5F0FA 4HPQA 1VI0A 3DV8A 2E71A 4YFXF 3LA2A 1OYYA 2FX0A 5HDNA 2XRNA 1JHHA 1LFPA 2XSDC 3I4NJ 1YS6A 5L3DA 1FOKA 1SMYF 2EZLA 3ECHA 2Y69H 2ZMEC 5D6FA 5BPDA 5LEKA 4HAMA 2D1VA 4ZTFA 2L7FP 4S0HB 4WF2A 4LK1F 1XSXA 3A02A 5B66C 2V9PA 1R00A 1E3HA 3LFKA 4PJMA 1XSDA 5FFXA 1DP3A 1J09A 2HR3A 2ZNYA 2ESNA 3FM3A 3U2RA 1MBHA 4UHTA 1GT0C 3OL4A 1WQ2A 2Y0SN 1VQMI 1FSEA 5KVRA 1BIAA 1VQKI 2MH9A 2BY3A 2YPRA 2D1HA 1ZELA 4A3FJ 1LE8B 4FASD 3PNYA 4ZTJA 5E79C 1SEUA 1KU2A 1ZG5A 1LVAA 2PQ8A 1FMVA 1R4MB 2EB7A 4KJZA 4ABZA 4BBRJ 4M74A 1WJAA 2X6WA 4AM3A 4BE2A 5M5YJ 3J7AO 1I1GA 1TTYA 2ADUA 5FD5A 2BVLA 3LSTA 1ON2A 1QHHD 4UV8A 1ZR2A 2K40A 2XRLA 2WAFA 3CCQI 3ZQCA 1PP7U 3Q0VA 2GXBA 1MBKA 3S17J 1R49A 1JKRC 3F72A 5FFZA 1ZKGA 2GBYA 2Q2EB 4HV6A 3IAM2 2CS3A 3AG2H 4PK4A 5AIQA 4KT6A 1E17A 2B9SA 5EG0A 5M3FJ 3FX3A 4OWRB 2V7FA 3CUOA 4EATA 3L2CA 6PAXA 1CF7B 3PL8A 5IPAA 5B3SH 3JTHA 2VB6A 5L3FA 2JJ7A 4BQNA 1RI7A 4H4KC 4F55A 4PCQA 4Y3OA 2QQAA 2QEXI 2GM4A 4OIOF 3P5JA 3K2ZA 3HG9A 4XLNF 3DEUA 3R0AA 2Q8KA 1Y1WJ 3E7LA 2XGCA 1RRJA 3FXMA 1WH5A 1QHGA 1HSTA 1OR7C 2YUSA 4ZZDA 1BJAA 3DEWA 1XPXA 2NRAC 1XGOA 4C3JJ 5GAGJ 4XKVA 2QBYA 1X19A 2LLKA 3RJPA 4D5FA 3TO7A 2CQ7A 4V2FA 4CYCB 3DU6A 2O8KA 2E1OA 2KRHA 2PMZA 4BHPA 2LP0A 1H0MA 1T08B 3FBNB 1A5JA 3CMMA 2EFWA 4D1QA 5K5QA 1OPCA 5CVRA 2RAEA 2X6XA 4XK4A 2V26A 3F8BA 1QZZA 4I01A 3C2BA 2Z99A 5F6FA 3CF5F 1V4RA 5J6XA 2CUFA 4E7SA 5D4SA 2I10A 2PX9A 5EEAA 3P7NA 1EKEA 3H5AA 1QBJA 2VLAA 2WV1A 4NC7A 4P9UA 1LUJB 1D1BA 4GCVA 3OWTA 2Z1DA 4HSRA 5E20A 4E6KG 3ABMH 4YIFA 4Y7NJ 3HYIA 4R8HA 1VQ5I 2FQ4A 3OYLA 1Y8QB 3GX4X 3CCVI 2ELHA 3GWZA 5E3LA 1AKHB 4MIMA 1U5TA 2DOFA 5L3BA 3GW2A 2E19A 2DTRA 2BY2A 3K4BA 1F5TA 2DQLA 1ODDA 3QYBA 2VUMJ 3HGYA 3TEDA 3DEEA 1AU7A 3T0YA 2UZKA 1I27A 4BY1J 2HKOA 4E7JA 1K78A 3PFIA 1D8JA 2OA4A 2R7FA 3BTCA 5FKKA 3ZQ7A 2EZHA 1IN8A 1OMIA 3BQYA 3WGIA 2EIMH 3GFMA 3Q5FA 1W4MA 4KUMA 3RZOJ 3IWZA 2VJIA 1YW7A 1WRJA 1AHDP 3EYYA 4RLQA 3A0BC 2PMZN 4CZCA 5E8IA 3L00A 2OCEA 3MMYB 2R7XA 1Y0UA 2KFDA 1IDYA 2Q1ZB 1Z0XA 3ZQQA 1QGPA 2IS2A 2OF7A 3G4SI 1X1CA 3BCBA 4OOIA 4AVPA 2Y31A 5F0CA 5FLVA 4S05A 4KN7X 2YX7A 2E5ZA 1EA3A 1OCPA 4L0ZB 3CCJI 1U3EM 4GGGA 5CKTA 1S5LC 2BVMA 2O8XA 4KIBA 5JVGF 2H09A 1YI2I 2Z9OA 2IS4A 1IO2A 2KHMA 3QAHA 4Z6YA 4LFUA 1OJLA 5DYMA 3CC2I 2M8EA 1I3QJ 4XLFA 3S16J 2OQRA 3W2VA 3FKIJ 2ZKZA 3PUFA 3MZHA 2L02A 3DBRB 2PI0A 2EH3A 3UNGC 2XKOA 4FHTA 4X0GA 2VKDA 3KCCA 3ZMZA 1K4TA 4M3DA 3QODA 2VONA 5CLSA 3COAC 1IJWC 3M8EA 3AG3H 3TOBA 2P6TA 4L0YB 1TP4A 5HS8A 2VXZA 4IO9F 3HEFA 2JT1A 1IN6A 4HA8A 3KYLA 2DPDA 2RC4A 2XF7A 2DDBA 4AIDA 1ZN2A 2Z2SB 3WTVC 4NHJA 1GLNA 2BXZA 3KPHA 2DN0A 4IQ4A 3SEZA 1W36C 2LD5A 3FZVA 4KMFA 2GA2A 3AG4H 2PJRB 2ZNZA 3BWGA 1MSFC 2AO9A 5DCMA 3CZ6A 4D5CA 3ASOH 3A1YA 2PN6A 1SD7A 2K3FA 3R60A 3IV5A 4M6XA 3ONQA 1BOBA 3HSRA 1T0FA 2X0LA 1QNTA 1DDNA 3GUDA 4ZDLA 3SZGA 2K4BA 2F4IA 1U2WA 3FMQA 3E6CC 2QA4I 4UUTA 2HTSA 3SFZA 1DU0A 3OY9A 4AIKA 3HOVJ 4CCLA 1M1EB 1T56A 2X1DA 4UVCA 2ELKA 2JPBA 2BZTA 2W1OA 1JUPA 2QUFA 3DU5A 4EM2A 2YX4A 2R0QC 4QPQA 5LD2C 3FKJA 4Y13A 3ESWB 4MQVA 4CCMA 3BZ6A 5JVTA 3CCSI 1DQUA 4RB1A 3C7JA 1UMQA 2OAZA 4I09A 2FNPA 2Y30A 3BR1A 3HRMA 1ZARA 3VWBA 3ZPLA 3HL2A 2LDUA 3LA3A 4ASNA 2YU9J 2BV6A 1CGPA 3W2WA 3S1RJ 2MFZA 1IRGA 1F4KA 2XAJA 2XPWA 3I64A 4LG3A 2DMNA 4LMYA 1JTYA 3EQLF 1HW5A 1USTA 2XPUA 3V42A 5EGOA 2ZB9A 4IPAA 4HX7A 3WTTC 3MVPA 4PGHA 1A04A 3DKXA 2L9SA 4B43A 3KEQA 5K7HA 3GZ6A 1LE8A 4QSHA 2M0MA 2GAUA 2H94A 2P81A 4UVAA 4B48A 4JX4A 1APLC 1AA7A 1R1VA 1VFCA 2X6OA 3J80Z 3D5RC 2XV4S 1WH7A 4DYQA 2GZWA 2M4GA 2OD5A 3S2DJ 4R79A 4EGYA 1QU3A 2P8TA 5LGTA 4EJTA 4BYYA 2RNJA 3BG7A 3F8CA 1U78A 3LQQA 2JA6J 4BEHB 1RESA 3TGNA 1BC7C 1PDNC 3QOPA 1W5TA 3B02A 2HWVA 1H8AC 4XSZF 3J7ZI 1RR7A 4PZJA 2X51A 2FNAA 3V7RA 3ABLH 3QPLA 1MNEA 2FD5A 3H0DA 2EA4A 2EFPA 1F1ZA 4NQWA 1WI9A 2VJJA 2JA7J 3TQNA 4DOZA 1YJWI 1ULYA 1D0ZA 2JN6A 1O7FA 4RB2C 1CF7A 3JCUC 3BPXA 3NARA 1V5FA 4LK0F 5L3GA 5KHDA 4WWCA 3HZJA 4CSWA 1Y6IA 3ZMSA 2AHQA 5HLIA 3GTJJ 2UWMA 3FK7A 3LQRA 2OV7A 3S1NJ 4E4HA 1KU9A 3M7GA 1G59A 3BR5A 1MMNA 2KT0A 1XDSA 4HQEA 4IKFA 2IGOA 2ECCA 4CYCA 3A4CA 2DMTA 4I76A 2I5UA 3J7AY 3HHHA 3HUGB 1KQ0A 3L2RA 1JI8A 3VYUB 3GTQJ 4ON0A 1IN5A 2IA2A 4XOTA 2VKEA 4CYDA 5LGUA 1FC3A 3CMEI 3FF5A 5GPCA 3GLLA 2OC6A 2WADA 3WHBA 3MKZA 3QU3A 1P6RA 2JZYA 2LR8A 3TL4X 1HKSA 4A3EJ 5IYDJ 4BHCA 4M6VA 2VC1A 1Z3YA 1Z7UA 2DA1A 3GTOJ 1HW1A 2DOAA 3K4LA 3CJQB 3KZYA 3MKWB 2MC4A 2FBKA 5LRSA 2P4WA 1XMKA 4WK8F 2W84A 3GTLJ 2X9DA 4XRFA 4A93J 1BI3A 3K1MA 3RTRA 1X1BA 4LD5A 5IT9K 1MSEC 4F91B 3R4KA 2K85A 2IPQX 2LBFA 3E5QA 3L2VA 3BOQA 1FOXA 1D0YA 5KAFC 2P7CB 3OOPA 2QSGX 3FWEA 3S93A 3C18A 1WJFA 2O0YA 2XAHA 2VI6A 4G12A 2XGEA 1E3OC 5IOZA 3JR9A 1LJ9A 3ZN1A 5HVQC 4C2UA 2HXOA 3FHNA 4E7ZA 3H35A 4HLXA 3CC7I 3F8FA 2VOOA 1BN5A 2EJRA 1NH3A 1ENHA 1UCRA 4JP0A 1OCTC 3V8KA 1VQLI 3I53A 4OMYA 4M71A 3E5XA 2JVHA 1XC5A 1KU7A 2MD5A 4RLFA 2VT2A 4XLCA 5FLXZ 3G6EI 4ETSA 4IX7A 4Y52J 3VYSB 1WWXA 3OYJA 3PIOF 3I0TA 9ANTA 4EJUA 3K4NA 2L54A 2IS6A 2EQRA 4BY7J 5E3MA 3HSFA 2HVQA 1MBFA 2CJJA 4DZJA 1IAWA 2L3DA 2FEZA 4HLYA 1XGSA 1Z91A 2XB0X 4XN0A 5DS9A 4M73A 2RQQA 4MNUA 1N25A 2V4JC 2K27A 5ICGA 4OMZA 1CQTA 2V6EA 1J0RA 2FOWA 2ICWG 3O6BB 3HGGA 2V79A 1B8IA 2V9KA 4HX4A 4QIWN 1B72A 1USSA 1SVMA 1S7EA 1ETVA 2DA2A 2L9NA 3JRBA 4OIQF 3BJAA 3FK6A 1FNNA 3EUHC 2FSWA 1LEAA 4ENMA 1XCBA 4H0EA 3HM5A 4PUSA 4BXXJ 4AIJA 4A3LJ 1GUUA 2ZSHB 5H6QA 4LLLA 2HI3A 3TW6A 1LQ1A 1U9NA 4CA0A 3CQZJ 2QWWA 3FXUA 2XB5A 4ZC3A 3AL0C 3EDPA 3HDDA 2P5KA 3MEXA 4D7NA 1QQIA 1J2XA 1S29A 2K7LA 4E70A 4MLOA 2RV8A 1IUFA 4JX5A 2LK2A 2IRFG 2HGCA 3A01B 5LRRA 4G7ZF 4LG0A 4FTHA 2NXNB 1BI1A 4KICA 2UUZA 4I0BA 4DBRA 5A2QZ 3I56I 4EV0A 1TQPA 1LEBA 3BJOA 1VQPI 2DFHA 2M34A 3LSKA 4IVNA 5BOXA 1XD7A 1ZGJA 1ZHFA 3MD2A 4UUSA 1Z6TA 5FROA 4XBFA 4RAZA 5J8FA 5E18F 3TP0A 3V8LA 4CUGA 2DPUA 2DOEA 2EA2A 4J00A 2Y9ZA 4KIGA 4ITVA 4GRIA 4QTRA 2BOLA 1SD5A 1BC8C 3GZNB 1ZRFA 1SFOJ 5HLGA 3CDIA 3JAMZ 2ZFUA 2RKHA 2DFEA 3BG9A 2ZBKA 1ETXA 2E7XA 1TNSA 4ZJZA 3OYAA 2KRFA 2L4MA 5J40A 1BR1A 4C2TA 3TMOA 5HDKA 2FBIA 2IJLA 1LNWA 1ACIA 5AIPA 1Q1HA 1WKMA 3I4PA 4B4CA 4ZYGA 2IT0A 4KFCA 2IGKA 2HOEA 1Z6RA 3IKTA 1R36A 1S8NA 3T1BA 2B63J 4II2A 2O3FA 1AWCA 2DA5A 3D0SA 4PFOA 4BHBA 1MJ9A 2HDWA 2NOJB 2L7MP 2PFBA 2YS9A 1IZ1A 4HF0A 1HSJA 2PMUA 3HRTA 2A07F 4EJOA 4M6YA 4N4OB 4G7HF 1XTAA 1IV8A 4CH7A 4JK1X 2W00A 2X48A 2E5NA 2VE8A 4FE7A 3G73A 1S7OA 2MSYA 2NAZA 3S1MJ 2DT7B 3BG3A 2VBWA 1B6AA 2VBXA 3EYIA 2VKHA 3GBGA 2FMYA 2LH9A 4JBAA 4AVZA 1XG1A 3MZYA 4BQOA 3RYPA 1IV6A 1G2HA 1BI2A 4B44A 5HNHA 1MBGA 2E60A 4BACA 1O3SA 3RKQA 2VPLA 4EEFG 2HPIA 1MJBA 3H92A 3DTKA 4DYCA 2G7HA 3S15J 1SVLA 1BIBA 4W97A 3VFZA 3H5RA 5DD4A 4IL6C 1VQOI 1VQ9I 1D1CA 3BR6A 3VODA 2CW8A 2DA6A 3Q0WA 1DUXC 4HNUA 4HNTA 1YRNB 2MH2A 2MLKA 3HXLA 1K4SA 4KISA 2ID6A 1TQIA 3CP2A 4LOCA 4XKCA 1Z7LA 1FZPB 3VSLA 4NUBA 4LLNA 2CG4A 2HZTA 4UV9A 1O3QA 3WTXC 2IS1A 2GQQA 1Z67A 1YW8A 3CUQB 3S3NA 4N4NB 2A6TA 2DT6A 3U1KA 1S3JA 1FP2A 3OYNA 3DLLF 1FOWA 4NC8A 2CH0A 3OSFA 4PJ0C 2CMPA 3JRIA 4DJAA 1SANA 3I9V2 4IZZA 3A0HC 4Y33A 2L2OA 3KP3A 4DZPA 5JR3A 5FRMA 1H9GA 2M87A 3S32A 1ON1A 1ZREA 3IH3A 2LNBA 5EDNA 2ZXIA 3JRDA 2R92J 5EEHA 1ZGWA 3CJTB 4A5NA 3FXQA 5IOYA 3L2QA 3I5UA 1DU6A 3ABTA 4BJTA 2D45A 2UV1A 4WCGA 4CCJA 5E1XA 5L3EA 2EWNA 1YLFA 4O6JA 4AU7A 4BU2A 5GAEJ 3N05A 5ILSA 1FBSA 3PO2J 4FE4A 4AD9A 1TZLA 2KLOA 2QKLB 5LHIA 1P4XA 3RKWA 3KP4A 4KIFA 2W48A 4UVBA 2H8WA 1NG7A 5EYRA 5IP6A 5LFAA 4CGZA 1O3RA 1DGWY 2LY9A 4BJ6C 1HKTA 4HDVA 2JK3A 3VYTB 1G3SA 3OR2C 5H6RA 2QZ8A 4S04A 1UJ8A 1W5CC 1LB2A 3EETA 3LL7A 5HDGA 2BE5F 5EZGA 1OCCH 1V5EA 1ZG3A 1JT0A 3MKYB 5ICFA 4BQAA 2EFOA 5GTHC 3H3VK 4UB6C 4TV7A 3RKXA 4Y15A 4PJLA 1BOAA 3E5UA 2R7ZJ 3LFUA 3IKVA 3E3VA 4IHYA 2X6YA 4RGUA 3CUQC 4A3CJ 4XKBA 2XASA 2WB1A 2E34A 3G2BA 1SC7A 3CLQA 4NNJA 4QWQA 4ZH4F 1TC3C 2H1KA 3ZQHA 4X1EA 3HRSA 2IBDA 2F4MB 3ZMUA 2M30A 1XMAA 3WHCA 1MJAA 2LFBA 2QM3A 5D5XB 5D8KB 1HC8A 2ELJA 5M5XJ 1N75A 4HDUA 4IHSA 2M8GX 1PUFB 2YSRA 3L1PA 3V7SA 3JRCA 1Y8RB 3BPVA 4HG2A 4G6TB 4AC0A 5TRDA 2FBHA 2FU4A 2VT3A 3M1CA 4HF2A 2E36A 2LSOA 1IDZA 3ZGKA 3HOWJ 1GVDA 2L7ZA 2KP6A 2BEOA 2X85A 4XICA 4UB8C 2WY7Q 2FQ3A 3HPGA 3QPTA 3HIFA 2NVYJ 3H9QA 4QLCU 5ILVA 5ERIA 3U21A 2EZIA 1R4NB 3T8TA 4G6DA 2QF7A 2LC2A 3OL3A 1UHSA 4I02A 3MZ8A 2VQHA 5EJCA 3TBIA 4XSXF 4XN3A 4G94A 2LKXA 1LDDA 2VKVA 4A6DA 4RAGA 1S72I 3KEOA 5BS6A 3TDZC 2R5ZB 2ZC2A 1IW7F 2IXSA 4J01A 1RIOH 3LSGA 4IHWA 2CGPA 3F0CA 2OZ6A 2MBFA 1BW5A 2WB1N 2HKXA 4U0YA 3DQVC 2R7QA 3L2UA 5TGTA 4D0PA 1DPRA 3Q0UA 3CJRB 3A03A 4LIUA 1TT5B 2O61A 1DP7P 4BQQA 4B3XA 4BXUA 3L09A 1YW9A 2HEOA 2LG4A 2AXLA 1B59A 4WXDA 1X1AA 2JVGA 1ZR4A 1HDPA 4F7ZA 4ENJA 1H89C 5ICCA 2CYYA 5BMZA 3KX2A 3L2WA 2KIFA 1UELB 1ZK8A 1FWZA 4E7HA 1HDDC 2CW7A 4BE0A 1BR2A 3CF2A 2NS8A 4F52A 2IVMA 2ZMEA 2CV1A 1FSHA 4HOBA 2VQLA 2Z3YA 2F4OB 2KIMA 1JKOC 1QA6A 1S9HA 1X58A 5IYBJ 1ORKA 4E7LA 1WJ5A 3HSEA 1D5YA 2IAIA 1FIAA 2O7OA 1P92A 3H36A 3RPUA 2VODA 2JSCA 3MQ0A 4C3HJ 2NOGA 2DDAA 3HOSA 5IY5H 4A0YA 1VQ4I 2KRCA 1GXQA 1K6OA 2L4AA 2N8GA 5JFRA 3LMMA 1WCMJ 3I59B 4B47A 4HSTA 2OUMA 1MW7A 5HNFA 2DXIA 4I6ZA 3J81Z 4C30A 3IRRA 3FXLA 2LRDA 3SHFA 3TKYA 3H1CA 4M9XA 1VTNC 2JRMA 3QP6A 3NAUA 1Z9CA 2K9NA 3ZN0A 2F2EA 5DUIA 3JSPA 2K02A 3QPSA 4IEJA 2KISA 5DEQA 2CRGA 4PDKA 2ZXWH 2M3AA 3GYHX 2J5PA 4UXNA 2Y75A 1R6RA 2HTJA 2FA5A 4KMUX 3L7WA 3VYRB 2R7WA 1GXPA 2QQ8A 4XRSG 4AYBN 1OYIA 2K9QA 3B6AA 4HF1A 1FX7A 1BJZA 3HHGA 3H3UA 5F64A 4LJZF 5LBQA 1UHMA 3FM5A 1YHQI 5FRNA 3BLYA 3GVAA 2ISZA 2VPRA 3D5SC 1BL0A 3IH2A 4WXHA 2VN2A 3HOTA 5FGMA 3W6JB 4HBLA 1PVEA 1OR7A 2CW0F 1K79A 2EBIA 3GF2A 2HVSA 1BR4A 1MDMB 1R22A 2VQGA 2LF7A 2KJBA 2LTPA 4YEJA 2E2JJ 3FHZA 1ZTRA 4ZDOA 3HOUJ 3C3WA 2HU9A 4PSXA 1PUEE 2EINH 3MN2A 1ITYA 2MGQA 2K5CA 5M5WJ 3REOA 3BROA 1JE8A 4IXAA 4RM3A 1MZBA 3SFIA 5KNLA 3F22A 2DBBA 1WJDA 3I3LA 2K9SA 1QPMA 4Z2YA 2H8RA 3GZ5A 1RZ4A 1D5VA 2P0WA 4MO7A 2BY0A 2C6YA 5FKLA 2DI3A 2AQEA 4UNOA 3GEZA 1GV5A 2PMHA 2Q2EA 3G1OA 3TO9A 4QPOA 3RDIA 1KGSA 3BG5A 1ZAOA 3IC7A 2I8DA 2R7TA 2A6EF 1MNMC 3IAS2 1JTXA 3SXYA 5D5UB 3S14J 2VJ4A 1UFMA 5DV5A 1RKTA 4BGDA 5FLMJ 4PGGA 4XM3A 2PEXA 3E6MA 2A61A 3CCUI 2COMA 5F0HA 4PJNA 1FBUA 1T8IA 5IYCJ 2E1NA 2ZCWA 1ERDA 3RCOA 4CDGA 3U9GA 4V19K 3ECOA 3R6SA 2VJ5A 2Q0OA 4XIDA 2F5DA 3GFIA 2HQAA 1IF1A 2YU3A 3DXJF 1W1WE 1IUYA 2A05A 1UZCA 4HRIA 4RDUA 1J5YA 3EPZA 1RNLA 3J7YJ 4ESBA 4E7KA 1MH4A 5CYVA 2NVQJ 3PQJA 4BNCA 1SD4A 4IF4A 3K70C 3E6BA 1UG0A 1E2XA 4EJVA 5KAIC 3SDBA 3F6VA 1E3PA 5K7ZA 2DA4A 1IN7A 3CCEI 2M4KA 4A3DJ 4HV5A 4LLGF 4CHUA 1T95A 3HBLA 4P1WA 3BG6A 3H9GA 2NNNA 2Z33A 1A35A 3K7AJ 1YG2A 1ZYRF 5J8CA 4PSWA 1NG6A 3ISPA 2RVCA 2CUJA 2K9MA 3ERMA 3K69A 3OIOA 2E1CA 4G9YA 2NS7A 2AQFA 4IRGA 2XC7A 2DTZA 2LY2A 3U1DA 5E3NA 3PQKA 2QQ9A 2CO5A 2OQGA 3OYMA 4A0ZA 3SZTA 2ETHA 2A69F 3F23A 2FUG2 2K3PA 2XKPA 1AKHA 3O8GA 1YE9A 2QBYB 2WY8Q 2W4SA 3I4MJ 3P9KA 3FMRA 2XAFA 4IRIA 3PO3J 1R58A 1FEXA 4EJWA 1FYKA 2DMQA 1A6QA 3SJMA 2ECBA 3IWFA 1HQCA 1B4AA 4XRSA 3QQAA 5CVVA 4XLPF 3RZDJ 1T6SA 2BY1A 2JSPA 3ELKA 1VQ8I 3LSHA 2VIXA 1I50J 2IEKA 2V1DA 5JLWA 2F5CA 4NC6A 2OPTA 4M9SA 2Z16A 4HEA2 2B7EA 4BDZA 1GHCA 1WVRA 2ME0A 3TW7A 3AL0B 1G3YA 2RDPA 3QYEA 4XMYA 1UB9A 1ZRCA 3FISA 2XPVA 5FKOA 3WU1B 1PYVA 1JHFA 3DTIA 2HYFA 1K6YA 1V5GA 5F1RA 4L5JA 2KMUA 2DFFA 3S3OA 4BE1A 3KYCB 4FX0A 4JYKA 3CLOA 1U5TB 3F9KA 5E3OA 4RBOA 3KYDB 3K9TA 4F3QA 2QGUA 1EV7A 4KA4A 4L9TA 3MWMA 1IC8A 1ETYA 2R7RA 4PFPA 4GO1A 2A5YB 2KIQA 2KL4A 1YYVA 2BGCA 4DIQA 3K1NA 1SVOA 1K78B 1MNDA 2LMDA 4L9JA 4LGWA 3GCMA 3ZMVA 1MMSA 4UUVA 3HTSB 5FJ8J 3HOXJ 1YX5A 4IJAA 3M8JA 1W36D 1MKMA 3DP7A 5J4VA 4XNFA 3CC4I 2STWA 4P9FA 1JUSA 2F5FA 4G8XA 3BDDA 2CU7A 2DU9A 1P4WA 1OISA 4RGRA 2RNGA 5J1YA 4I7HA 3ZOBA 1U0JA 5TISC 1SFEA 5JHUA 3CMAI 2HS5A 1RUOA 3Q9SA 4R1HA 2EK5A 2P6SA 3KP2A 3KETA 4BDYA 2G7UA 4I0AA 1G3WA 3OS2A 4HW0A 2PJRA 3H5NA 3GTKJ 2HFHA 4RGSA 3JREA 3OYHA 1U5TC 1HW2A 1W7PD 1JUMA 1TNTA 2XVCA 4M72A 4DNCA 3WE2A 5E1WA 4ZZLA 2FE3A 2VE9A 2XF5A 3BY6A 1RR8C 1SAUA 3RQ4A 1OQYA 2O9LA 4ESFA 3DPUA 1TL8A 3MKLA 2EPFA 3CCRI 3OYDA 1SFXA 4LB5A 2JA2A 4O3MA 2MLGA 4L9NA 4M3EA 4JQFA 4HNVA 1VF9A 3LSJA 4MEXF 4L9VA 4ENNA 1EF4A 5KK1A 1U6GA 2O6GE 1NK2P 3H3ZA 4GFBA 4UY8I 3JRHA 1JKPC 4IHVA 1VQ6I 4KNYA 2IP2A 2R7SA 4LB6B 2PJPA 1TWGJ 2OZUA 2K4JA 3NWTA 3CDHA 4F93B 1HXDA 5DCMB 5J1UA 4FQGA 3OV8A 2HOSA 2Z5UA 2L01A 1X2NA 2H6BA 2JUGA 3V8JA 2JPCA 2IA1A 4ANJA 1HCRA 3RQIA 4KITB 1FJLA 5B5EC 1GDTA 2STTA 3F3XA 3BZCA 1R1TA 2JWTA 2NVXJ 4RS8A 3VOEA 4BUPA 1IRZA 3W2AA 2LOOA 2X1EA 4P55A 2ZJRF 4MHGA 2DAOA 4ZYEA 3FXOA 2K9LA 2JQ7A 4EMSA 1TT0A 4WXCA 1G6NA 4FCYA 3S1QJ 1X3UA 3SDGA 1TBXA 3BP8A 3J80K 3WGGA 1REPC 4DGWB 1DGRM 2R4GA 3K0LA 1FMWA 3G71I 5HOOA 2OTJI 3QPHA 2CWEA 2ID3A 2QQBA 4RGXA 1OCZH 4GYIA 3N4MA 3BC8A 3RSNA 1S7AA 4HQMA 3CMYA 3OYGA 4BEHA 3H0GJ 3HPHA 2EFNA 3M4OJ 3O8HA 4B09A 5D5VB 1R5ID 1IN4A 4Y17A 3LA7A 2V1XA 1S6LA 2F5EA 2ZJ2A 1J9IA 1ZH5A 4U88A 5ED4A 1HOMA 2M7AA 2R7DA 4XRMA 2YR2A 1QVUA 3ZQFA 2OTLI 3I71A 4BAYA 1IRXA 5BQTA 5EGOB 3LOCA 3FBIB 1ZLJA 1WZ2A 4IHTA 1O4XA 3MFKA 1I3AA 1RC9A 3K70D 2NVTJ 2DYRH 2DO7A 3DCFA 2KZGA 2HDDA 4FX4A 2MW8A 3S2WA 3LAPA 1LVKA 4MTDA 2HPMA 2DA7A 3M1EA 4DW6A 5K7FA 1T0FC 3DTEA 2PG4A 2OBPA 1RUNA 1A36A 3BT9A 1VQ7I 1MMAA 1WJBA 4I98B 1PP8F 1SAXA 3K2AA 3SYTA 1Y0NA 2MA3A 3JTGA 1I1SA 4RAFA 3QWLA 2XSJC 5EF6A 4AIHA 4IRHA 2B0LA 2WAEA 1ZG1A 2HQ5A 3EUKL 1O57A 3QYFA 4BL0B 2CQQA 5J1RA 4OAZA 3KFWX 1G3TA 5H2FC 4B3AA 3QP5A 2CQNA 1I39A 4NQWB 3K4CA 5AONA 5LGNA 5K1YA 3HUGA 2QLZA 2XAGA 3OR1C 3AKZA 2L0KA 1OKRA 1V3FA 2BW3B 3WG9A 4XQFA 2E2HJ 2DJIA 3NRVA 1FY7A 2QCOA 3KLOA 3F8NA 5E8GA 1FLIA 2KJCA 4A3IJ 2LVSA 1TWAJ 3P9CA 3OIQA 4L5EA 3ZQIA 4XORA 2HOTA 4IOAF 2R5YB 3AAFA 1X4PA 2EV5A 3OYKA 3MAJA 5ILUA 4LITA 1ETWA 2CV0A 1OCRH 2Y2ZA 5JHFA 2OU2A 1HBXG 1C0WA 4EM1A 4P96A 3H9JA 4U87A 1NK3P 5LHHA 2A6HF 4RM2A 5HLTA 3QU6A 4D9JA 3HKZA 2QSHX 2HNHA 2W57A 2WWYA 1IXSB 2RREA 3HOZJ 1LDKB 3LSMA 2RQPA 1JJ8C 2DA3A 4GXOA 4N0BA 3JRFA 2PLYA 3GFLA 1MH3A 3E0JB 4Q47A 3EUHA 3T8RA 1STZA 3WTYC 4O5VA 1YX3A 3NEUA 3B6CA 1ZRDA 1G8XA 3ZP5A 3KIOA 3NQOA 2DK5A 1JT6A 1AOYA 1UG2A 3HB9A 1LFBA 2A3SA 3CO6C 4BBSJ 4DYRA 1GV2A 4BS9A 4CCKA 5C3EJ 5DD8A 1XGMA 2CUZA 3KP5A 5FLXK 2XROA 2M1BA 1N77A 3FMSA 2V1NA 5F1JA 1XMXA 4KT5C 2NVUB 1T2KA 4XLEA 3BTLA 2LY1A 3KP7A 1XN7A 2XAQA 1X4OA 3S8PA 4KN4X 1QVTA 1TW2A 3QRFF 4Q5SF 5IT9Z 1IG7A 3OYEA 1EJ9A 2FF4A 2W7NA 2LBFB 2W24A 2VC0A 2VBYA 1Q1VA 2UXXA 4M3BA 3WTUC 1OLTA 4ESJA 1DPUA 5GP9A 2X4HA 1TWFJ 2F48A 2DLLA 3VDXA 2HYJA 5KCMA 5CQGA 2Y48A 3F8MA 5B1BH 4C2MJ 2L7KA 2GXGA 1O7LA 3ZMTA 1L0OC 1WPKA 4L18B 1MMGA 3OS0A 4J19A 5J47A 2KIUA 2H6CA 1XCVA 3FIWA 3HKZN 1H88C 2ZFWA 1W0UA 1K83J 3CCMI 3F21A 2E35A 1Y39A 1POGA 4I2OA 2E7WA 3CDLA 3BTIA 3WG7H 2CQXA 1YFHA 4A6EA 1X1PA 2LKPA 2IGMA 4MTEA 1Z1DA 4DBQA 2W82A 2QSFX 5ICEA 3OYCA 4XKWA 3F6OA 2JUCA 3QOEA 1HLVA 1E0EA 4KDPA 2ME6A 4Q48A 1MBJA 2R7UA 2XF6A 4AYBA 2GIZA 2WA0A 2GIVA 4CO8A 3A01A 4CCNA 2LF8A 3AG1H 1W7PB 2M45A 1H9TA 1WJEA 5A2QK 3IP4B 1MBEA 1B8IB 4NBQA 1XDUA 5K5OA 1UAAA 4EVIA 2ZJQF 4XOPA 4A3MJ 1LFUP 5B1AH 4MFEA 4RMNA 3S3MA 3CO7C 1B72B 3KLNA 2ACJA 4A3KJ 3RI4A 3ML6A 3KP6A 1SMTA 3UKGA 1R9TJ 2H1LA 1YS7A 2E1MB 2QENA 3FXKA 5HS7A 4IHXA 5D4RA 5D6EA 3DPTA 4B8XA 1OCOH 5M3MJ 1BW6A 5C4JJ 3WODF 3LWFA 3KZZA 4IQJA 4BJ5C 2EILH 4YG2F 3RPQA 4Q4ZF 1RPWA 1X1DA 3C2HA 3GFJA 5CVJA 3JAMK 1UHWA 1T33A 5E17F 3BCAA 4A69C 4WX9A 2EIJH 3VPRA 2AXTC 2VBZA 5LLQA 3DLAA 4M9ZA 3PUBA 2R7VA 3IH4A 2ISYA 4A3JJ 4ZYAA 3S2HJ 2R3SA 4W1UA 1XGNA 3ERED 1F43A 1HKQA 1ZLKA 4LG0B 5E1ZB 3G1LA 3OS1A 1B9MA 4KYWA 3SQNA 4I99C 3MCZA 1YQAA 2TDXA 3BZKA 4RAYA 3WTSC 3PSFA 2VL8A 3CCLI 5FD6A 3CD6I 4UUSB 4XL9A 3D5LA 1QPIA 4ZDPA 4YFKF 2GA1A 3W3CA 3OOUA 4FISA 3PFYA 2NS0A 3X2QH 4EGZA 1D1AA 3PSIA 2KQRA 1WFXA 3LSPA 2DCEA 2KKOA 2V9VA 4BXFA 5L3CA 3RPUD 1TW3A 1D0XA 2QYOA 5IP9J 3TOAA 3N97A 3WU2C 3DWLE 2E1MC 2DODA 2MABA 4HYEA 1NTCA 4P5OA 1ETOA 2VOPA 3K6GA 4OAYA 3B73A 2FXAA 3M3YJ 1F36A 2FRHA 1SFKA 2DYSH 1EH7A 4CCOA 1K61A 2DFIA 1MMDA 2F6CA 2O03A 2R93J 1LDJA 3CESA 5FKMA 2GOXB 2ZSIB 4NB5A 4Y4RA 2AS5F 1JXSA 1P2FA 1XB4A 2KPMA 5BPIA 3BQZA 1RKWA 1KZHA 1YRNA 2NNYA 1RETA 4MFDA 3VB2A 1BBYA 1ONVA 5DTDA 1YJNI 3JRAA 3DF8A 2J5OA 3G3ZA 5GPAA 3CUQA 3BJ6A 1A31A 3C2GA 4MQ9F 2DMUA 2HXIA 2JRTA 3K10A 2P5LC 2CV2A 3A2KA 1QZEA 2F5VA 2G0EA 2DQRA 3I54A 3L9FA 4YELA 2EFQA 2MC3A 4U7DA 3TP3A 3ABUA 3K4JA 4NDLA 5LEJA 2BHZA 2H27A 4XR6A 3TDUC 2QKMB 1Z77A 1YJ9I 1I6HJ 2XIGA 1TWCJ 1IRFA 3JSOA 1R5HA 1SFUA 5BNGA 4XLHA 4AUXA 4RB0A 5DCFA 1GVJA 1B9NA 2Y0MA 2BW3A 1IXRC 1WHUA 3OYBA 1P7JA 2CFXA 2X1CA 3FDYA 2EV6A 4OIRF 1I5ZA 2HVRA 1TWHJ 1F9NA 3P9IA 1Z05A 3AFHA 3M9AA 1FTTA 4N9HA 3G1MA 2GLOA 2WAQA 2GWRA 1U8RA 2R5YA 1WSUA 4YIIA 3KZIC 3T5XA 2PBIA 3GTMJ 3FXRA 3EUAA 2JTVA 4GYGA 2VASA 3E97A 2QVOA 3ZQGA 1ETKA 2R7OA 5EG0B 5TJJA 3BR3A 1X2MA 4CZZA 4C3IJ 4XLAA 3E1SA 4D7MA 5CPRB 2IW5A 2NYXA 3ABKH 3NWSA 3UR3C 4M3GA 5LHGA 2DK8A 3VEPA 4FETA 3ZCOA 3LAJA 3GTPJ 5DM7F 5C4XJ 3HC7A 4N9IA 2ZXHA 1T38A 3TO6A 1R7JA 2FJ1A 2HOAA 2P5VA 2RN7A 3JW4A 3O3KA 3KEYA 3CCYA 2ZO4A 1TQMA 2D2WA 1G4DA 5JI6A 3FXJA 3SZPA 2HYGD 1VQNI 1PUFA 1WGXA 4G7OF 4EM0B 3R61A 5GAHJ 4OINF 2CSOA 2LKSA 2TRTA 2WTEA 2W25A 5EZHA 1FYLA 2IA0A 2OJED 3BR2A 5FB2A 4BH9A 2EV0A 4XONA 5GTIC 1YOVB 3O2PE 1XX5A 3WTZA 5K5RA 4A0XA 5J4YA 1MIJA 4RB3C 1JGGA 1YITI 2GOMA 3ZRGA 2UXNA 1BM9A 3DKYA 1L3LA 5DUKA 3ZR8X 3GXOA 1EH6A 2JA5J 3Q9VA 4G6QA 3ZMDA 3GO5A 3C1DA 1FBQA 1I6XA 4YIRX 2L9RA 1MD0A 2WAQN 4EQQA 3W6VA 3V4GA 2V1UA 3OIPA 1R71A 2DW4A 3LNQA 2D5VA 3K4MA 3WGHA 3PJRA 4M3FA 4CXFA 4JX6A 4U0WA 3ZQLA 4X6AJ 4II3A 3WU0A 1V54H 3D1NI 5FO5A 3SEQA 3PIPF 5F27A 5HODA 4GDFA 4E7IA 3BTJA 4F92B 2K86A 5CVIA 2R5ZA 4A2UA 3E6DA 5J3LA 1KYWA 3OYIA 1YIOA 3ROUA 2EZKA 5H20A 1XSVA 5D5WB 5C44J 1LPQA 1FTZA 2LREA 2WC2A 1U9OA 3OMYA 4MEYF 4IOCF 1D8KA 3HTUA 4FT8A
chains in the Genus database with same CATH topology
1KA8A 5EEGA 1T39A 1J7KA 2DT5A 4U0VA 1NHAA 1FT9A 1KYZA 4MGRA 3WE3A 1T98A 3KE2A 1R5GA 1FPQA 4U7BA 3CTAA 3DFGA 3IRQA 3RIRA 1MGTA 1P4AA 1JGSA 1W7PA 1BI0A 4OIPF 2HQNA 2ESHA 4HZFA 4YFNF 4HX8A 1KQ9A 1EH8A 2ZXJA 2G9WA 4AWXB 1R23A 2FMLA 2CQKA 2XGXA 2WV0A 3HRUA 3M8FA 4ZYDA 1YO5C 1TLHB 3DKWA 1QO0D 1B1BA 3WTWC 1FP1D 2HDCA 5HS9A 1IXCA 3CJNA 2M5WA 3I59A 5CVUA 3J81K 1KQ8A 3IHUA 4A5MA 2P7VB 4K2EA 5HLHA 2BYVE 2XUBA 1W5SA 2FOKA 2V6CA 2ZMEB 2A68F 5D8LB 4OU0A 3GLXA 2W85A 5IT3A 4A12A 1J59A 1OYWA 1QZYA 2XHKA 1O3TA 2RGVA 1J75A 1SD6A 4ENKA 3W6KB 1YTYA 2HQRA 3ULQB 1FYMA 5DDGA 1D3YA 3K1PA 3DPLC 3V7CA 3R0JA 3IL2A 4L5IA 1MDMA 4DQ2A 2BBYA 1KU3A 1K7AA 4ZYHA 3RYRA 1ZGAA 3I58A 1R1UA 3RKYA 5CJ9A 4CICA 3DV8A 4YFXF 3LA2A 1OYYA 5HDNA 2XRNA 1JHHA 1YS6A 5L3DA 1FOKA 1SMYF 3ECHA 5D6FA 5BPDA 5LEKA 4HAMA 2D1VA 4WF2A 4LK1F 1XSXA 1R00A 3LFKA 1XSDA 5FFXA 2HR3A 2ZNYA 2ESNA 3FM3A 3U2RA 4UHTA 1WQ2A 1FSEA 5KVRA 1BIAA 2MH9A 2YPRA 2D1HA 1KU2A 1ZG5A 1LVAA 2PQ8A 2EB7A 4M74A 3J7AO 1I1GA 1TTYA 2ADUA 5FD5A 3LSTA 1ON2A 4UV8A 1PP7U 2GXBA 3F72A 5FFZA 4HV6A 1E17A 5AIQA 3FX3A 3CUOA 3L2CA 6PAXA 1CF7B 5L3FA 3JTHA 1RI7A 4PCQA 2QQAA 4OIOF 3K2ZA 4XLNF 3DEUA 3R0AA 2Q8KA 1HSTA 4ZZDA 1BJAA 2NRAC 1XGOA 2QBYA 3RJPA 3TO7A 4BHPA 1H0MA 2EFWA 5K5QA 1OPCA 5CVRA 3F8BA 1QZZA 4I01A 2Z99A 5F6FA 1V4RA 5J6XA 5D4SA 3P7NA 1QBJA 4P9UA 4GCVA 5E20A 4YIFA 3HYIA 4R8HA 3GX4X 2ELHA 3GWZA 1U5TA 5L3BA 3GW2A 2DTRA 1F5TA 2DQLA 1ODDA 3HTUA 3T0YA 2UZKA 1I27A 2HKOA 1K78A 3PFIA 1D8JA 2OA4A 2R7FA 3ZQ7A 1IN8A 1OMIA 3WGIA 3GFMA 3Q5FA 1W4MA 4KUMA 3IWZA 1YW7A 1WRJA 3EYYA 5E8IA 3L00A 1Y0UA 1QGPA 4AVPA 4OOIA 4S05A 4KN7X 2YX7A 4L0ZB 1U3EM 4GGGA 2O8XA 4KIBA 2Z9OA 2H09A 3QAHA 4LFUA 5DYMA 2M8EA 2OQRA 2ZKZA 3MZHA 2L02A 2PI0A 2XKOA 4FHTA 3KCCA 3ZMZA 2VONA 5CLSA 3COAC 3M8EA 3TOBA 2P6TA 4L0YB 5HS8A 2VXZA 2JT1A 1IN6A 4HA8A 2DPDA 2RC4A 1ZN2A 3WTVC 4NHJA 3FZVA 4KMFA 2GA2A 2ZNZA 3BWGA 5DCMA 2PN6A 1SD7A 3R60A 4M6XA 3HSRA 1T0FA 2X0LA 1QNTA 1DDNA 3GUDA 2K4BA 1U2WA 3FMQA 3E6CC 2HTSA 3SFZA 4AIKA 4UVCA 2JPBA 2QUFA 4EM2A 2YX4A 4Y13A 4MQVA 3BZ6A 5JVTA 4RB1A 3C7JA 2OAZA 4I09A 2FNPA 3HRMA 3ZPLA 1ZARA 2LDUA 3LA3A 4ASNA 2BV6A 1CGPA 1IRGA 1F4KA 2XAJA 3I64A 4LMYA 3EQLF 1HW5A 1USTA 4IPAA 4HX7A 3WTTC 4PGHA 1A04A 3KEQA 3GZ6A 2GAUA 2H94A 4UVAA 1R1VA 3J80Z 2XV4S 2GZWA 2OD5A 4R79A 4EGYA 2P8TA 5LGTA 4EJTA 4BYYA 2RNJA 3F8CA 1U78A 3LQQA 1BC7C 3TGNA 1PDNC 3QOPA 1W5TA 3B02A 2HWVA 4XSZF 4PZJA 2FNAA 3V7RA 2EA4A 2EFPA 1F1ZA 4NQWA 1WI9A 3TQNA 1ULYA 1O7FA 4RB2C 1CF7A 3BPXA 4LK0F 5L3GA 4WWCA 3ZMSA 5HLIA 2UWMA 3LQRA 1KU9A 3M7GA 1XDSA 4HQEA 3HHHA 1KQ0A 4ON0A 1IN5A 2IA2A 4CYDA 5LGUA 1FC3A 3FF5A 3QU3A 1P6RA 2JZYA 1HKSA 4BHCA 2VC1A 1Z7UA 1HW1A 3KZYA 2FBKA 5LRSA 2P4WA 1XMKA 4WK8F 2W84A 4XRFA 1BI3A 3K1MA 3RTRA 4LD5A 5IT9K 3R4KA 2IPQX 3E5QA 3BOQA 2P7CB 3OOPA 3FWEA 3C18A 2O0YA 2XAHA 1LJ9A 3ZN1A 5HVQC 4HLXA 2VOOA 3F8FA 1BN5A 2EJRA 1UCRA 3V8KA 3I53A 4OMYA 4M71A 3E5XA 1KU7A 2MD5A 2VT2A 5FLXZ 4ETSA 1WWXA 3I0TA 4EJUA 2L54A 3HSFA 1IAWA 2L3DA 2FEZA 4HLYA 1XGSA 1Z91A 4M73A 4MNUA 2K27A 5ICGA 4OMZA 1J0RA 3O6BB 2V79A 4HX4A 1USSA 4OIQF 3BJAA 1FNNA 2FSWA 1LEAA 4ENMA 1XCBA 4H0EA 4AIJA 5H6QA 4LLLA 1LQ1A 2QWWA 3FXUA 3EDPA 2P5KA 3MEXA 1QQIA 1J2XA 1S29A 2K7LA 4E70A 2RV8A 2IRFG 2HGCA 5LRRA 4G7ZF 4LG0A 1BI1A 4KICA 4I0BA 5A2QZ 4EV0A 1TQPA 1LEBA 3BJOA 4IVNA 5BOXA 1XD7A 1ZGJA 1ZHFA 1Z6TA 4XBFA 4RAZA 5J8FA 5E18F 3V8LA 2DPUA 2EA2A 4KIGA 1SD5A 1BC8C 1ZRFA 5HLGA 3JAMZ 2RKHA 2ZBKA 2E7XA 1TNSA 2KRFA 2L4MA 5HDKA 2FBIA 2IJLA 1LNWA 5AIPA 1Q1HA 1WKMA 3I4PA 4ZYGA 2IT0A 4KFCA 2HOEA 1Z6RA 3IKTA 1R36A 1S8NA 3T1BA 2O3FA 1AWCA 3D0SA 4BHBA 1MJ9A 2PFBA 1IZ1A 4HF0A 1HSJA 2PMUA 3HRTA 2A07F 4EJOA 4M6YA 4G7HF 4JK1X 3G73A 2VE8A 1S7OA 2NAZA 2VBWA 1B6AA 2VBXA 3EYIA 2FMYA 4JBAA 3MZYA 3RYPA 1BI2A 1O3SA 1MJBA 3H92A 2G7HA 1BIBA 3VFZA 5DD4A 3VODA 1DUXC 2MH2A 2MLKA 1TQIA 1FZPB 4LLNA 2CG4A 2HZTA 4UV9A 1O3QA 3WTXC 2GQQA 1YW8A 3CUQB 1S3JA 1FP2A 3KP3A 5JR3A 1H9GA 2M87A 1ON1A 1ZREA 2LNBA 5EEHA 4A5NA 3FXQA 3I5UA 3ABTA 2D45A 4WCGA 5E1XA 5L3EA 2EWNA 1YLFA 4O6JA 5ILSA 1FBSA 4AD9A 5LHIA 1P4XA 3RKWA 3KP4A 4KIFA 4UVBA 4CGZA 1O3RA 1HKTA 4HDVA 1G3SA 5H6RA 2QZ8A 4S04A 1LB2A 3EETA 5HDGA 2BE5F 1ZG3A 5ICFA 4BQAA 2EFOA 4TV7A 3RKXA 4Y15A 1BOAA 3E5UA 3IKVA 3E3VA 4RGUA 3CUQC 2XASA 4QWQA 4ZH4F 3HRSA 3ZMUA 2M30A 1XMAA 1MJAA 5D5XB 2QM3A 5D8KB 4HDUA 4IHSA 2YSRA 3V7SA 3BPVA 5TRDA 2FBHA 2FU4A 2VT3A 4HF2A 2LSOA 2BEOA 2FQ3A 3QPTA 3HIFA 5ILVA 4QLCU 5ERIA 3T8TA 4G6DA 4I02A 4XSXF 4G94A 1LDDA 4A6DA 3KEOA 5BS6A 3TDZC 1IW7F 1RIOH 2CGPA 2OZ6A 2MBFA 4U0YA 2HKXA 3DQVC 4D0PA 1DPRA 2O61A 1DP7P 4BXUA 3L09A 1YW9A 2HEOA 2AXLA 1B59A 4WXDA 4F7ZA 4ENJA 5ICCA 2CYYA 5BMZA 2KIFA 1FWZA 2IVMA 2ZMEA 1FSHA 4HOBA 2Z3YA 2KIMA 3HSEA 3RPUA 1P92A 2VODA 2JSCA 3MQ0A 3HOSA 4A0YA 1GXQA 1K6OA 2L4AA 5JFRA 3I59B 3J81Z 3IRRA 3SHFA 3TKYA 4M9XA 1VTNC 3QP6A 1Z9CA 3ZN0A 2F2EA 5DUIA 3JSPA 2K02A 5DEQA 4PDKA 3GYHX 2J5PA 4UXNA 2Y75A 2HTJA 2FA5A 4KMUX 3L7WA 1GXPA 4HF1A 1OYIA 1FX7A 3HHGA 3H3UA 5F64A 4LJZF 5LBQA 1UHMA 3FM5A 3GVAA 2ISZA 4WXHA 2VN2A 3HOTA 5FGMA 3W6JB 4HBLA 1OR7A 2CW0F 1K79A 3GF2A 1MDMB 1R22A 2LF7A 2KJBA 3FHZA 3C3WA 1PUEE 3REOA 3BROA 1JE8A 4IXAA 1MZBA 3F22A 2DBBA 1QPMA 4Z2YA 3GZ5A 1RZ4A 1D5VA 2C6YA 4UNOA 2DI3A 3GEZA 2PMHA 2Q2EA 3TO9A 3RDIA 1KGSA 1ZAOA 3IC7A 2A6EF 3SXYA 5D5UB 1UFMA 5DV5A 4PGGA 2PEXA 3E6MA 2A61A 2COMA 1FBUA 2E1NA 2ZCWA 4CDGA 3U9GA 3ECOA 3R6SA 2Q0OA 2F5DA 3GFIA 1IF1A 2YU3A 3DXJF 1IUYA 1J5YA 1RNLA 4ESBA 5CYVA 3PQJA 4BNCA 1SD4A 4IF4A 3E6BA 1E2XA 4EJVA 3F6VA 1IN7A 4HV5A 4LLGF 4CHUA 2Z33A 2NNNA 1YG2A 1ZYRF 5J8CA 3ISPA 2RVCA 2E1CA 3K69A 4G9YA 4IRGA 3U1DA 3PQKA 2QQ9A 2CO5A 2OQGA 4A0ZA 3SZTA 2ETHA 2A69F 3F23A 2XKPA 2QBYB 3P9KA 3FMRA 2XAFA 4IRIA 1R58A 4EJWA 1FYKA 3IWFA 1HQCA 1B4AA 5CVVA 4XLPF 1T6SA 3ELKA 2V1DA 2F5CA 4M9SA 1GHCA 1G3YA 2RDPA 1UB9A 1ZRCA 3WU1B 1JHFA 2HYFA 5F1RA 4L5JA 4FX0A 3CLOA 1U5TB 3K9TA 1EV7A 4KA4A 4L9TA 3MWMA 4GO1A 2A5YB 1YYVA 2BGCA 3K1NA 1K78B 4LGWA 4L9JA 3ZMVA 4UUVA 3HTSB 4IJAA 1MKMA 3DP7A 2STWA 4P9FA 2F5FA 4G8XA 3BDDA 2DU9A 1P4WA 4RGRA 4I7HA 1SFEA 5JHUA 2HS5A 1RUOA 3Q9SA 4R1HA 2EK5A 2P6SA 3KP2A 3KETA 2G7UA 4I0AA 1G3WA 4HW0A 2HFHA 4RGSA 1U5TC 1HW2A 1W7PD 1TNTA 2XVCA 4ZZLA 4DNCA 4M72A 5E1WA 3WE2A 2FE3A 2VE9A 3BY6A 4ESFA 1SFXA 4LB5A 4O3MA 2MLGA 4L9NA 4JQFA 4MEXF 4L9VA 4ENNA 5KK1A 1U6GA 2O6GE 3H3ZA 4KNYA 2IP2A 4LB6B 2PJPA 2OZUA 2K4JA 3CDHA 1HXDA 5DCMB 3OV8A 2L01A 2Z5UA 2H6BA 3V8JA 2JPCA 2IA1A 2STTA 3F3XA 1R1TA 4RS8A 3VOEA 4P55A 4MHGA 2DAOA 4ZYEA 4EMSA 4WXCA 1G6NA 1X3UA 3J80K 1TBXA 3BP8A 1REPC 3WGGA 3K0LA 5HOOA 3QPHA 2CWEA 2QQBA 4RGXA 4GYIA 3N4MA 1S7AA 4HQMA 2EFNA 4B09A 5D5VB 1IN4A 4Y17A 3LA7A 2V1XA 1S6LA 2F5EA 2ZJ2A 1J9IA 1ZH5A 4U88A 2R7DA 2YR2A 3I71A 4BAYA 5BQTA 1ZLJA 4IHTA 3MFKA 2DO7A 4FX4A 3S2WA 3LAPA 4MTDA 3M1EA 2PG4A 2OBPA 1RUNA 4I98B 1PP8F 1SAXA 2MA3A 3JTGA 1I1SA 4AIHA 4IRHA 2B0LA 1ZG1A 1O57A 3KFWX 1G3TA 3QP5A 5K1YA 5LGNA 5AONA 3HUGA 2QLZA 2XAGA 1OKRA 1V3FA 3WG9A 3NRVA 1FY7A 3KLOA 5E8GA 3F8NA 1FLIA 2KJCA 3P9CA 3AAFA 2EV5A 3MAJA 5ILUA 2OU2A 1HBXG 1C0WA 4EM1A 4P96A 5LHHA 2A6HF 3QU6A 2W57A 2WWYA 1IXSB 1LDKB 2RQPA 4GXOA 4N0BA 2PLYA 3GFLA 4Q47A 3EUHA 3T8RA 1STZA 3WTYC 4O5VA 3NEUA 1ZRDA 3ZP5A 3NQOA 2DK5A 1AOYA 2A3SA 3CO6C 5DD8A 1XGMA 3KP5A 5FLXK 2XROA 2M1BA 3FMSA 4KT5C 1T2KA 3KP7A 1XN7A 2XAQA 4KN4X 1TW2A 3QRFF 4Q5SF 5IT9Z 2FF4A 2W24A 2VC0A 2VBYA 2UXXA 3WTUC 4ESJA 1DPUA 2X4HA 2DLLA 2Y48A 3F8MA 2GXGA 1O7LA 3ZMTA 1L0OC 4L18B 2KIUA 2H6CA 1XCVA 2ZFWA 3F21A 4I2OA 2E7WA 1YFHA 4A6EA 2LKPA 4MTEA 1Z1DA 5ICEA 3F6OA 4KDPA 4Q48A 2GIVA 4CO8A 2LF8A 1W7PB 2M45A 1H9TA 5A2QK 5K5OA 1XDUA 4EVIA 3CO7C 3KLNA 2ACJA 3RI4A 3ML6A 3KP6A 1SMTA 1YS7A 2QENA 5HS7A 5D4RA 5D6EA 3DPTA 4B8XA 3WODF 3LWFA 3KZZA 4YG2F 3RPQA 4Q4ZF 3GFJA 5CVJA 3JAMK 1UHWA 5E17F 4WX9A 2VBZA 5LLQA 4M9ZA 2ISYA 2R3SA 1XGNA 3ERED 1HKQA 1ZLKA 4LG0B 5E1ZB 1B9MA 4KYWA 3SQNA 3MCZA 1YQAA 2TDXA 4RAYA 3WTSC 5FD6A 3D5LA 4YFKF 2GA1A 4EGZA 2NS0A 2KKOA 2V9VA 5L3CA 1TW3A 2QYOA 3TOAA 3N97A 2VOPA 4HYEA 4P5OA 3B73A 2FXAA 2FRHA 1EH7A 2DFIA 2O03A 1LDJA 2AS5F 4NB5A 1JXSA 1P2FA 1XB4A 5BPIA 2NNYA 3VB2A 1BBYA 1ONVA 3DF8A 2J5OA 3G3ZA 3CUQA 3BJ6A 4MQ9F 2JRTA 2P5LC 3I54A 2DQRA 3L9FA 2EFQA 2MC3A 4U7DA 3ABUA 5LEJA 2H27A 3TDUC 2XIGA 1IRFA 3JSOA 1R5HA 1SFUA 4RB0A 5DCFA 1GVJA 1B9NA 2Y0MA 1IXRC 2CFXA 2EV6A 4OIRF 1I5ZA 1F9NA 3P9IA 1Z05A 3M9AA 4N9HA 2GWRA 1U8RA 1WSUA 4YIIA 3T5XA 2PBIA 3FXRA 2JTVA 4GYGA 3E97A 2QVOA 5TJJA 4CZZA 2IW5A 2NYXA 5LHGA 2DK8A 3VEPA 3LAJA 4N9IA 1T38A 3TO6A 1R7JA 2P5VA 2RN7A 3JW4A 3O3KA 2ZO4A 1TQMA 2D2WA 1G4DA 5JI6A 3SZPA 2HYGD 4G7OF 4EM0B 3R61A 4OINF 2CSOA 2WTEA 2W25A 1FYLA 2IA0A 5FB2A 4BH9A 2EV0A 3O2PE 3WTZA 5K5RA 4A0XA 4RB3C 2UXNA 1BM9A 1L3LA 5DUKA 3GXOA 1EH6A 3Q9VA 4G6QA 3ZMDA 3GO5A 3C1DA 1FBQA 1I6XA 1MD0A 4EQQA 3V4GA 2V1UA 2DW4A 3WGHA 4CXFA 4U0WA 3WU0A 5FO5A 2K86A 5CVIA 4A2UA 3E6DA 1KYWA 1YIOA 3ROUA 5H20A 1XSVA 5D5WB 2WC2A 4MEYF 1D8KA 5ED4A 4FT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KA8 A;  5EEG A;  1T39 A;  1J7K A;  2DT5 A;  4U0V A;  1NHA A;  1FT9 A;  1KYZ A;  4MGR A;  3WE3 A;  1T98 A;  3KE2 A;  1R5G A;  1FPQ A;  4U7B A;  3CTA A;  3DFG A;  3IRQ A;  3RIR A;  1MGT A;  1P4A A;  1JGS A;  1W7P A;  1BI0 A;  4OIP F;  2HQN A;  2ESH A;  4HZF A;  4YFN F;  4HX8 A;  1KQ9 A;  1EH8 A;  2ZXJ A;  2G9W A;  4AWX B;  1R23 A;  2FML A;  2CQK A;  2XGX A;  2WV0 A;  3HRU A;  3M8F A;  4ZYD A;  1YO5 C;  1TLH B;  3DKW A;  1QO0 D;  1B1B A;  3WTW C;  1FP1 D;  2HDC A;  5HS9 A;  1IXC A;  3CJN A;  2M5W A;  3I59 A;  5CVU A;  3J81 K;  1KQ8 A;  3IHU A;  4A5M A;  2P7V B;  4K2E A;  5HLH A;  2BYV E;  2XUB A;  1W5S A;  2FOK A;  2V6C A;  2ZME B;  2A68 F;  5D8L B;  4OU0 A;  3GLX A;  2W85 A;  5IT3 A;  4A12 A;  1J59 A;  1OYW A;  1QZY A;  2XHK A;  1O3T A;  2RGV A;  1J75 A;  1SD6 A;  4ENK A;  3W6K B;  1YTY A;  2HQR A;  3ULQ B;  1FYM A;  5DDG A;  1D3Y A;  3K1P A;  3DPL C;  3V7C A;  3R0J A;  3IL2 A;  4L5I A;  1MDM A;  4DQ2 A;  2BBY A;  1KU3 A;  1K7A A;  4ZYH A;  3RYR A;  1ZGA A;  3I58 A;  1R1U A;  3RKY A;  5CJ9 A;  4CIC A;  3DV8 A;  4YFX F;  3LA2 A;  1OYY A;  5HDN A;  2XRN A;  1JHH A;  1YS6 A;  5L3D A;  1FOK A;  1SMY F;  3ECH A;  5D6F A;  5BPD A;  5LEK A;  4HAM A;  2D1V A;  4WF2 A;  4LK1 F;  1XSX A;  1R00 A;  3LFK A;  1XSD A;  5FFX A;  2HR3 A;  2ZNY A;  2ESN A;  3FM3 A;  3U2R A;  4UHT A;  1WQ2 A;  1FSE A;  5KVR A;  1BIA A;  2MH9 A;  2YPR A;  2D1H A;  1KU2 A;  1ZG5 A;  1LVA A;  2PQ8 A;  2EB7 A;  4M74 A;  3J7A O;  1I1G A;  1TTY A;  2ADU A;  5FD5 A;  3LST A;  1ON2 A;  4UV8 A;  1PP7 U;  2GXB A;  3F72 A;  5FFZ A;  4HV6 A;  1E17 A;  5AIQ A;  3FX3 A;  3CUO A;  3L2C A;  6PAX A;  1CF7 B;  5L3F A;  3JTH A;  1RI7 A;  4PCQ A;  2QQA A;  4OIO F;  3K2Z A;  4XLN F;  3DEU A;  3R0A A;  2Q8K A;  1HST A;  4ZZD A;  1BJA A;  2NRA C;  1XGO A;  2QBY A;  3RJP A;  3TO7 A;  4BHP A;  1H0M A;  2EFW A;  5K5Q A;  1OPC A;  5CVR A;  3F8B A;  1QZZ A;  4I01 A;  2Z99 A;  5F6F A;  1V4R A;  5J6X A;  5D4S A;  3P7N A;  1QBJ A;  4P9U A;  4GCV A;  5E20 A;  4YIF A;  3HYI A;  4R8H A;  3GX4 X;  2ELH A;  3GWZ A;  1U5T A;  5L3B A;  3GW2 A;  2DTR A;  1F5T A;  2DQL A;  1ODD A;  3HTU A;  3T0Y A;  2UZK A;  1I27 A;  2HKO A;  1K78 A;  3PFI A;  1D8J A;  2OA4 A;  2R7F A;  3ZQ7 A;  1IN8 A;  1OMI A;  3WGI A;  3GFM A;  3Q5F A;  1W4M A;  4KUM A;  3IWZ A;  1YW7 A;  1WRJ A;  3EYY A;  5E8I A;  3L00 A;  1Y0U A;  1QGP A;  4AVP A;  4OOI A;  4S05 A;  4KN7 X;  2YX7 A;  4L0Z B;  1U3E M;  4GGG A;  2O8X A;  4KIB A;  2Z9O A;  2H09 A;  3QAH A;  4LFU A;  5DYM A;  2M8E A;  2OQR A;  2ZKZ A;  3MZH A;  2L02 A;  2PI0 A;  2XKO A;  4FHT A;  3KCC A;  3ZMZ A;  2VON A;  5CLS A;  3COA C;  3M8E A;  3TOB A;  2P6T A;  4L0Y B;  5HS8 A;  2VXZ A;  2JT1 A;  1IN6 A;  4HA8 A;  2DPD A;  2RC4 A;  1ZN2 A;  3WTV C;  4NHJ A;  3FZV A;  4KMF A;  2GA2 A;  2ZNZ A;  3BWG A;  5DCM A;  2PN6 A;  1SD7 A;  3R60 A;  4M6X A;  3HSR A;  1T0F A;  2X0L A;  1QNT A;  1DDN A;  3GUD A;  2K4B A;  1U2W A;  3FMQ A;  3E6C C;  2HTS A;  3SFZ A;  4AIK A;  4UVC A;  2JPB A;  2QUF A;  4EM2 A;  2YX4 A;  4Y13 A;  4MQV A;  3BZ6 A;  5JVT A;  4RB1 A;  3C7J A;  2OAZ A;  4I09 A;  2FNP A;  3HRM A;  3ZPL A;  1ZAR A;  2LDU A;  3LA3 A;  4ASN A;  2BV6 A;  1CGP A;  1IRG A;  1F4K A;  2XAJ A;  3I64 A;  4LMY A;  3EQL F;  1HW5 A;  1UST A;  4IPA A;  4HX7 A;  3WTT C;  4PGH A;  1A04 A;  3KEQ A;  3GZ6 A;  2GAU A;  2H94 A;  4UVA A;  1R1V A;  3J80 Z;  2XV4 S;  2GZW A;  2OD5 A;  4R79 A;  4EGY A;  2P8T A;  5LGT A;  4EJT A;  4BYY A;  2RNJ A;  3F8C A;  1U78 A;  3LQQ A;  1BC7 C;  3TGN A;  1PDN C;  3QOP A;  1W5T A;  3B02 A;  2HWV A;  4XSZ F;  4PZJ A;  2FNA A;  3V7R A;  2EA4 A;  2EFP A;  1F1Z A;  4NQW A;  1WI9 A;  3TQN A;  1ULY A;  1O7F A;  4RB2 C;  1CF7 A;  3BPX A;  4LK0 F;  5L3G A;  4WWC A;  3ZMS A;  5HLI A;  2UWM A;  3LQR A;  1KU9 A;  3M7G A;  1XDS A;  4HQE A;  3HHH A;  1KQ0 A;  4ON0 A;  1IN5 A;  2IA2 A;  4CYD A;  5LGU A;  1FC3 A;  3FF5 A;  3QU3 A;  1P6R A;  2JZY A;  1HKS A;  4BHC A;  2VC1 A;  1Z7U A;  1HW1 A;  3KZY A;  2FBK A;  5LRS A;  2P4W A;  1XMK A;  4WK8 F;  2W84 A;  4XRF A;  1BI3 A;  3K1M A;  3RTR A;  4LD5 A;  5IT9 K;  3R4K A;  2IPQ X;  3E5Q A;  3BOQ A;  2P7C B;  3OOP A;  3FWE A;  3C18 A;  2O0Y A;  2XAH A;  1LJ9 A;  3ZN1 A;  5HVQ C;  4HLX A;  2VOO A;  3F8F A;  1BN5 A;  2EJR A;  1UCR A;  3V8K A;  3I53 A;  4OMY A;  4M71 A;  3E5X A;  1KU7 A;  2MD5 A;  2VT2 A;  5FLX Z;  4ETS A;  1WWX A;  3I0T A;  4EJU A;  2L54 A;  3HSF A;  1IAW A;  2L3D A;  2FEZ A;  4HLY A;  1XGS A;  1Z91 A;  4M73 A;  4MNU A;  2K27 A;  5ICG A;  4OMZ A;  1J0R A;  3O6B B;  2V79 A;  4HX4 A;  1USS A;  4OIQ F;  3BJA A;  1FNN A;  2FSW A;  1LEA A;  4ENM A;  1XCB A;  4H0E A;  4AIJ A;  5H6Q A;  4LLL A;  1LQ1 A;  2QWW A;  3FXU A;  3EDP A;  2P5K A;  3MEX A;  1QQI A;  1J2X A;  1S29 A;  2K7L A;  4E70 A;  2RV8 A;  2IRF G;  2HGC A;  5LRR A;  4G7Z F;  4LG0 A;  1BI1 A;  4KIC A;  4I0B A;  5A2Q Z;  4EV0 A;  1TQP A;  1LEB A;  3BJO A;  4IVN A;  5BOX A;  1XD7 A;  1ZGJ A;  1ZHF A;  1Z6T A;  4XBF A;  4RAZ A;  5J8F A;  5E18 F;  3V8L A;  2DPU A;  2EA2 A;  4KIG A;  1SD5 A;  1BC8 C;  1ZRF A;  5HLG A;  3JAM Z;  2RKH A;  2ZBK A;  2E7X A;  1TNS A;  2KRF A;  2L4M A;  5HDK A;  2FBI A;  2IJL A;  1LNW A;  5AIP A;  1Q1H A;  1WKM A;  3I4P A;  4ZYG A;  2IT0 A;  4KFC A;  2HOE A;  1Z6R A;  3IKT A;  1R36 A;  1S8N A;  3T1B A;  2O3F A;  1AWC A;  3D0S A;  4BHB A;  1MJ9 A;  2PFB A;  1IZ1 A;  4HF0 A;  1HSJ A;  2PMU A;  3HRT A;  2A07 F;  4EJO A;  4M6Y A;  4G7H F;  4JK1 X;  3G73 A;  2VE8 A;  1S7O A;  2NAZ A;  2VBW A;  1B6A A;  2VBX A;  3EYI A;  2FMY A;  4JBA A;  3MZY A;  3RYP A;  1BI2 A;  1O3S A;  1MJB A;  3H92 A;  2G7H A;  1BIB A;  3VFZ A;  5DD4 A;  3VOD A;  1DUX C;  2MH2 A;  2MLK A;  1TQI A;  1FZP B;  4LLN A;  2CG4 A;  2HZT A;  4UV9 A;  1O3Q A;  3WTX C;  2GQQ A;  1YW8 A;  3CUQ B;  1S3J A;  1FP2 A;  3KP3 A;  5JR3 A;  1H9G A;  2M87 A;  1ON1 A;  1ZRE A;  2LNB A;  5EEH A;  4A5N A;  3FXQ A;  3I5U A;  3ABT A;  2D45 A;  4WCG A;  5E1X A;  5L3E A;  2EWN A;  1YLF A;  4O6J A;  5ILS A;  1FBS A;  4AD9 A;  5LHI A;  1P4X A;  3RKW A;  3KP4 A;  4KIF A;  4UVB A;  4CGZ A;  1O3R A;  1HKT A;  4HDV A;  1G3S A;  5H6R A;  2QZ8 A;  4S04 A;  1LB2 A;  3EET A;  5HDG A;  2BE5 F;  1ZG3 A;  5ICF A;  4BQA A;  2EFO A;  4TV7 A;  3RKX A;  4Y15 A;  1BOA A;  3E5U A;  3IKV A;  3E3V A;  4RGU A;  3CUQ C;  2XAS A;  4QWQ A;  4ZH4 F;  3HRS A;  3ZMU A;  2M30 A;  1XMA A;  1MJA A;  5D5X B;  2QM3 A;  5D8K B;  4HDU A;  4IHS A;  2YSR A;  3V7S A;  3BPV A;  5TRD A;  2FBH A;  2FU4 A;  2VT3 A;  4HF2 A;  2LSO A;  2BEO A;  2FQ3 A;  3QPT A;  3HIF A;  5ILV A;  4QLC U;  5ERI A;  3T8T A;  4G6D A;  4I02 A;  4XSX F;  4G94 A;  1LDD A;  4A6D A;  3KEO A;  5BS6 A;  3TDZ C;  1IW7 F;  1RIO H;  2CGP A;  2OZ6 A;  2MBF A;  4U0Y A;  2HKX A;  3DQV C;  4D0P A;  1DPR A;  2O61 A;  1DP7 P;  4BXU A;  3L09 A;  1YW9 A;  2HEO A;  2AXL A;  1B59 A;  4WXD A;  4F7Z A;  4ENJ A;  5ICC A;  2CYY A;  5BMZ A;  2KIF A;  1FWZ A;  2IVM A;  2ZME A;  1FSH A;  4HOB A;  2Z3Y A;  2KIM A;  3HSE A;  3RPU A;  1P92 A;  2VOD A;  2JSC A;  3MQ0 A;  3HOS A;  4A0Y A;  1GXQ A;  1K6O A;  2L4A A;  5JFR A;  3I59 B;  3J81 Z;  3IRR A;  3SHF A;  3TKY A;  4M9X A;  1VTN C;  3QP6 A;  1Z9C A;  3ZN0 A;  2F2E A;  5DUI A;  3JSP A;  2K02 A;  5DEQ A;  4PDK A;  3GYH X;  2J5P A;  4UXN A;  2Y75 A;  2HTJ A;  2FA5 A;  4KMU X;  3L7W A;  1GXP A;  4HF1 A;  1OYI A;  1FX7 A;  3HHG A;  3H3U A;  5F64 A;  4LJZ F;  5LBQ A;  1UHM A;  3FM5 A;  3GVA A;  2ISZ A;  4WXH A;  2VN2 A;  3HOT A;  5FGM A;  3W6J B;  4HBL A;  1OR7 A;  2CW0 F;  1K79 A;  3GF2 A;  1MDM B;  1R22 A;  2LF7 A;  2KJB A;  3FHZ A;  3C3W A;  1PUE E;  3REO A;  3BRO A;  1JE8 A;  4IXA A;  1MZB A;  3F22 A;  2DBB A;  1QPM A;  4Z2Y A;  3GZ5 A;  1RZ4 A;  1D5V A;  2C6Y A;  4UNO A;  2DI3 A;  3GEZ A;  2PMH A;  2Q2E A;  3TO9 A;  3RDI A;  1KGS A;  1ZAO A;  3IC7 A;  2A6E F;  3SXY A;  5D5U B;  1UFM A;  5DV5 A;  4PGG A;  2PEX A;  3E6M A;  2A61 A;  2COM A;  1FBU A;  2E1N A;  2ZCW A;  4CDG A;  3U9G A;  3ECO A;  3R6S A;  2Q0O A;  2F5D A;  3GFI A;  1IF1 A;  2YU3 A;  3DXJ F;  1IUY A;  1J5Y A;  1RNL A;  4ESB A;  5CYV A;  3PQJ A;  4BNC A;  1SD4 A;  4IF4 A;  3E6B A;  1E2X A;  4EJV A;  3F6V A;  1IN7 A;  4HV5 A;  4LLG F;  4CHU A;  2Z33 A;  2NNN A;  1YG2 A;  1ZYR F;  5J8C A;  3ISP A;  2RVC A;  2E1C A;  3K69 A;  4G9Y A;  4IRG A;  3U1D A;  3PQK A;  2QQ9 A;  2CO5 A;  2OQG A;  4A0Z A;  3SZT A;  2ETH A;  2A69 F;  3F23 A;  2XKP A;  2QBY B;  3P9K A;  3FMR A;  2XAF A;  4IRI A;  1R58 A;  4EJW A;  1FYK A;  3IWF A;  1HQC A;  1B4A A;  5CVV A;  4XLP F;  1T6S A;  3ELK A;  2V1D A;  2F5C A;  4M9S A;  1GHC A;  1G3Y A;  2RDP A;  1UB9 A;  1ZRC A;  3WU1 B;  1JHF A;  2HYF A;  5F1R A;  4L5J A;  4FX0 A;  3CLO A;  1U5T B;  3K9T A;  1EV7 A;  4KA4 A;  4L9T A;  3MWM A;  4GO1 A;  2A5Y B;  1YYV A;  2BGC A;  3K1N A;  1K78 B;  4LGW A;  4L9J A;  3ZMV A;  4UUV A;  3HTS B;  4IJA A;  1MKM A;  3DP7 A;  2STW A;  4P9F A;  2F5F A;  4G8X A;  3BDD A;  2DU9 A;  1P4W A;  4RGR A;  4I7H A;  1SFE A;  5JHU A;  2HS5 A;  1RUO A;  3Q9S A;  4R1H A;  2EK5 A;  2P6S A;  3KP2 A;  3KET A;  2G7U A;  4I0A A;  1G3W A;  4HW0 A;  2HFH A;  4RGS A;  1U5T C;  1HW2 A;  1W7P D;  1TNT A;  2XVC A;  4ZZL A;  4DNC A;  4M72 A;  5E1W A;  3WE2 A;  2FE3 A;  2VE9 A;  3BY6 A;  4ESF A;  1SFX A;  4LB5 A;  4O3M A;  2MLG A;  4L9N A;  4JQF A;  4MEX F;  4L9V A;  4ENN A;  5KK1 A;  1U6G A;  2O6G E;  3H3Z A;  4KNY A;  2IP2 A;  4LB6 B;  2PJP A;  2OZU A;  2K4J A;  3CDH A;  1HXD A;  5DCM B;  3OV8 A;  2L01 A;  2Z5U A;  2H6B A;  3V8J A;  2JPC A;  2IA1 A;  2STT A;  3F3X A;  1R1T A;  4RS8 A;  3VOE A;  4P55 A;  4MHG A;  2DAO A;  4ZYE A;  4EMS A;  4WXC A;  1G6N A;  1X3U A;  3J80 K;  1TBX A;  3BP8 A;  1REP C;  3WGG A;  3K0L A;  5HOO A;  3QPH A;  2CWE A;  2QQB A;  4RGX A;  4GYI A;  3N4M A;  1S7A A;  4HQM A;  2EFN A;  4B09 A;  5D5V B;  1IN4 A;  4Y17 A;  3LA7 A;  2V1X A;  1S6L A;  2F5E A;  2ZJ2 A;  1J9I A;  1ZH5 A;  4U88 A;  2R7D A;  2YR2 A;  3I71 A;  4BAY A;  5BQT A;  1ZLJ A;  4IHT A;  3MFK A;  2DO7 A;  4FX4 A;  3S2W A;  3LAP A;  4MTD A;  3M1E A;  2PG4 A;  2OBP A;  1RUN A;  4I98 B;  1PP8 F;  1SAX A;  2MA3 A;  3JTG A;  1I1S A;  4AIH A;  4IRH A;  2B0L A;  1ZG1 A;  1O57 A;  3KFW X;  1G3T A;  3QP5 A;  5K1Y A;  5LGN A;  5AON A;  3HUG A;  2QLZ A;  2XAG A;  1OKR A;  1V3F A;  3WG9 A;  3NRV A;  1FY7 A;  3KLO A;  5E8G A;  3F8N A;  1FLI A;  2KJC A;  3P9C A;  3AAF A;  2EV5 A;  3MAJ A;  5ILU A;  2OU2 A;  1HBX G;  1C0W A;  4EM1 A;  4P96 A;  5LHH A;  2A6H F;  3QU6 A;  2W57 A;  2WWY A;  1IXS B;  1LDK B;  2RQP A;  4GXO A;  4N0B A;  2PLY A;  3GFL A;  4Q47 A;  3EUH A;  3T8R A;  1STZ A;  3WTY C;  4O5V A;  3NEU A;  1ZRD A;  3ZP5 A;  3NQO A;  2DK5 A;  1AOY A;  2A3S A;  3CO6 C;  5DD8 A;  1XGM A;  3KP5 A;  5FLX K;  2XRO A;  2M1B A;  3FMS A;  4KT5 C;  1T2K A;  3KP7 A;  1XN7 A;  2XAQ A;  4KN4 X;  1TW2 A;  3QRF F;  4Q5S F;  5IT9 Z;  2FF4 A;  2W24 A;  2VC0 A;  2VBY A;  2UXX A;  3WTU C;  4ESJ A;  1DPU A;  2X4H A;  2DLL A;  2Y48 A;  3F8M A;  2GXG A;  1O7L A;  3ZMT A;  1L0O C;  4L18 B;  2KIU A;  2H6C A;  1XCV A;  2ZFW A;  3F21 A;  4I2O A;  2E7W A;  1YFH A;  4A6E A;  2LKP A;  4MTE A;  1Z1D A;  5ICE A;  3F6O A;  4KDP A;  4Q48 A;  2GIV A;  4CO8 A;  2LF8 A;  1W7P B;  2M45 A;  1H9T A;  5A2Q K;  5K5O A;  1XDU A;  4EVI A;  3CO7 C;  3KLN A;  2ACJ A;  3RI4 A;  3ML6 A;  3KP6 A;  1SMT A;  1YS7 A;  2QEN A;  5HS7 A;  5D4R A;  5D6E A;  3DPT A;  4B8X A;  3WOD F;  3LWF A;  3KZZ A;  4YG2 F;  3RPQ A;  4Q4Z F;  3GFJ A;  5CVJ A;  3JAM K;  1UHW A;  5E17 F;  4WX9 A;  2VBZ A;  5LLQ A;  4M9Z A;  2ISY A;  2R3S A;  1XGN A;  3ERE D;  1HKQ A;  1ZLK A;  4LG0 B;  5E1Z B;  1B9M A;  4KYW A;  3SQN A;  3MCZ A;  1YQA A;  2TDX A;  4RAY A;  3WTS C;  5FD6 A;  3D5L A;  4YFK F;  2GA1 A;  4EGZ A;  2NS0 A;  2KKO A;  2V9V A;  5L3C A;  1TW3 A;  2QYO A;  3TOA A;  3N97 A;  2VOP A;  4HYE A;  4P5O A;  3B73 A;  2FXA A;  2FRH A;  1EH7 A;  2DFI A;  2O03 A;  1LDJ A;  2AS5 F;  4NB5 A;  1JXS A;  1P2F A;  1XB4 A;  5BPI A;  2NNY A;  3VB2 A;  1BBY A;  1ONV A;  3DF8 A;  2J5O A;  3G3Z A;  3CUQ A;  3BJ6 A;  4MQ9 F;  2JRT A;  2P5L C;  3I54 A;  2DQR A;  3L9F A;  2EFQ A;  2MC3 A;  4U7D A;  3ABU A;  5LEJ A;  2H27 A;  3TDU C;  2XIG A;  1IRF A;  3JSO A;  1R5H A;  1SFU A;  4RB0 A;  5DCF A;  1GVJ A;  1B9N A;  2Y0M A;  1IXR C;  2CFX A;  2EV6 A;  4OIR F;  1I5Z A;  1F9N A;  3P9I A;  1Z05 A;  3M9A A;  4N9H A;  2GWR A;  1U8R A;  1WSU A;  4YII A;  3T5X A;  2PBI A;  3FXR A;  2JTV A;  4GYG A;  3E97 A;  2QVO A;  5TJJ A;  4CZZ A;  2IW5 A;  2NYX A;  5LHG A;  2DK8 A;  3VEP A;  3LAJ A;  4N9I A;  1T38 A;  3TO6 A;  1R7J A;  2P5V A;  2RN7 A;  3JW4 A;  3O3K A;  2ZO4 A;  1TQM A;  2D2W A;  1G4D A;  5JI6 A;  3SZP A;  2HYG D;  4G7O F;  4EM0 B;  3R61 A;  4OIN F;  2CSO A;  2WTE A;  2W25 A;  1FYL A;  2IA0 A;  5FB2 A;  4BH9 A;  2EV0 A;  3O2P E;  3WTZ A;  5K5R A;  4A0X A;  4RB3 C;  2UXN A;  1BM9 A;  1L3L A;  5DUK A;  3GXO A;  1EH6 A;  3Q9V A;  4G6Q A;  3ZMD A;  3GO5 A;  3C1D A;  1FBQ A;  1I6X A;  1MD0 A;  4EQQ A;  3V4G A;  2V1U A;  2DW4 A;  3WGH A;  4CXF A;  4U0W A;  3WU0 A;  5FO5 A;  2K86 A;  5CVI A;  4A2U A;  3E6D A;  1KYW A;  1YIO A;  3ROU A;  5H20 A;  1XSV A;  5D5W B;  2WC2 A;  4MEY F;  1D8K A;  5ED4 A;  4FT8 A; 
#chains in the Genus database with same CATH topology
 1KA8 A;  1Y1V J;  5EEG A;  3OSG A;  1T39 A;  5CQE A;  2WBM A;  3M07 A;  1J7K A;  2DT5 A;  4U0V A;  1NHA A;  3BR0 A;  1FT9 A;  2EIK H;  5JLX A;  4A3B J;  1KYZ A;  1Z21 A;  2L9V A;  4PJJ A;  4MGR A;  3WE3 A;  1T98 A;  3K4K A;  2BHY A;  1R5G A;  3KE2 A;  1FPQ A;  4U7B A;  4BKX A;  3CTA A;  3DFG A;  4JOM A;  3IRQ A;  3GME A;  3RIR A;  1MGT A;  1P4A A;  1JGS A;  1W7P A;  2XAU A;  1BI0 A;  2M7B A;  4OIP F;  1LKX A;  2HQN A;  1W0T A;  2ESH A;  4HZF A;  4YFN F;  1QRY A;  4HX8 A;  1P9Q C;  1KQ9 A;  1BA5 A;  2Y9Y A;  1EH8 A;  2M9H A;  2MD0 A;  2ZXJ A;  4B1R A;  2G9W A;  1Z3X A;  1KON A;  2CFO A;  1R23 A;  2FML A;  3CP8 A;  4AWX B;  3HJE A;  2XGD A;  2O5R A;  2CQK A;  2XDV A;  2XGX A;  2MG4 A;  4YRV A;  2WV0 A;  3HRU A;  1JJ6 C;  3M8F A;  4ZYD A;  2A5W A;  1V55 H;  2KDZ A;  1TLH B;  3DKW A;  1QO0 D;  1Y56 A;  1YO5 C;  1JKQ C;  1B1B A;  3WTW C;  2HZD A;  1FP1 D;  2HDC A;  3DBH B;  5HS9 A;  4C9Y A;  1IXC A;  5GAD J;  3CJN A;  2M5W A;  3I59 A;  5F04 A;  5CVU A;  2OCC H;  3J81 K;  3PNV A;  1KQ8 A;  5F08 A;  1YIJ I;  2M0C A;  3IHU A;  4A5M A;  5IP7 J;  2M2E A;  3LSR A;  1HA8 A;  2DJN A;  3GTG J;  2P7V B;  2JMW A;  4K2E A;  5HLH A;  2BYV E;  2XUB A;  1W5S A;  2MYS A;  1ETQ A;  2COB A;  2FOK A;  2TCT A;  2V6C A;  3IUO A;  3PNT A;  2ZME B;  1N78 A;  3JRG A;  2A68 F;  1VND A;  2VQC A;  5D8L B;  2DMP A;  4OU0 A;  1XS9 A;  5DM6 F;  1X3W B;  3GLX A;  2W85 A;  5IT3 A;  3DBL B;  4RA2 A;  1FOY A;  2Y0S A;  4A12 A;  1J59 A;  3VSK A;  2IGN A;  1OYW A;  1QZY A;  2VXD A;  2XHK A;  2ZJP F;  2CUE A;  1O3T A;  1ZQ3 P;  1PJR A;  1VZ0 A;  2RGV A;  4V2G A;  1J75 A;  1SD6 A;  4ENK A;  1FIP A;  3W6K B;  1YTY A;  3HOY J;  3ZXS A;  2HQR A;  1WI3 A;  2L5Q A;  2E2I J;  3ULQ B;  1FYM A;  5DDG A;  1D3Y A;  3K1P A;  3DPL C;  3V7C A;  2JA8 J;  2LYC A;  1P7I A;  3R0J A;  3IL2 A;  4L5I A;  2BXY A;  1MDM A;  1A6I A;  1IGN A;  4LIV A;  1OFC X;  1WJC A;  4DQ2 A;  3PM1 A;  2BBY A;  1KU3 A;  4A3G J;  3Q3S A;  2KDO A;  1K7A A;  4ZYH A;  5FKN A;  3LSI A;  3RYR A;  1X3Z B;  1ZGA A;  1U8B A;  3I55 I;  3I58 A;  1R1U A;  3RKY A;  2GXA A;  2KZV A;  5CJ9 A;  4CIC A;  3ASN H;  3OYF A;  1HF0 A;  5F0F A;  4HPQ A;  1VI0 A;  3DV8 A;  2E71 A;  4YFX F;  3LA2 A;  1OYY A;  2FX0 A;  5HDN A;  2XRN A;  1JHH A;  1LFP A;  2XSD C;  3I4N J;  1YS6 A;  5L3D A;  1FOK A;  1SMY F;  2EZL A;  3ECH A;  2Y69 H;  2ZME C;  5D6F A;  5BPD A;  5LEK A;  4HAM A;  2D1V A;  4ZTF A;  2L7F P;  4S0H B;  4WF2 A;  4LK1 F;  1XSX A;  3A02 A;  5B66 C;  2V9P A;  1R00 A;  1E3H A;  3LFK A;  4PJM A;  1XSD A;  5FFX A;  1DP3 A;  1J09 A;  2HR3 A;  2ZNY A;  2ESN A;  3FM3 A;  3U2R A;  1MBH A;  4UHT A;  1GT0 C;  3OL4 A;  1WQ2 A;  2Y0S N;  1VQM I;  1FSE A;  5KVR A;  1BIA A;  1VQK I;  2MH9 A;  2BY3 A;  2YPR A;  2D1H A;  1ZEL A;  4A3F J;  1LE8 B;  4FAS D;  3PNY A;  4ZTJ A;  5E79 C;  1SEU A;  1KU2 A;  1ZG5 A;  1LVA A;  2PQ8 A;  1FMV A;  1R4M B;  2EB7 A;  4KJZ A;  4ABZ A;  4BBR J;  4M74 A;  1WJA A;  2X6W A;  4AM3 A;  4BE2 A;  5M5Y J;  3J7A O;  1I1G A;  1TTY A;  2ADU A;  5FD5 A;  2BVL A;  3LST A;  1ON2 A;  1QHH D;  4UV8 A;  1ZR2 A;  2K40 A;  2XRL A;  2WAF A;  3CCQ I;  3ZQC A;  1PP7 U;  3Q0V A;  2GXB A;  1MBK A;  3S17 J;  1R49 A;  1JKR C;  3F72 A;  5FFZ A;  1ZKG A;  2GBY A;  2Q2E B;  4HV6 A;  3IAM 2;  2CS3 A;  3AG2 H;  4PK4 A;  5AIQ A;  4KT6 A;  1E17 A;  2B9S A;  5EG0 A;  5M3F J;  3FX3 A;  4OWR B;  2V7F A;  3CUO A;  4EAT A;  3L2C A;  6PAX A;  1CF7 B;  3PL8 A;  5IPA A;  5B3S H;  3JTH A;  2VB6 A;  5L3F A;  2JJ7 A;  4BQN A;  1RI7 A;  4H4K C;  4F55 A;  4PCQ A;  4Y3O A;  2QQA A;  2QEX I;  2GM4 A;  4OIO F;  3P5J A;  3K2Z A;  3HG9 A;  4XLN F;  3DEU A;  3R0A A;  2Q8K A;  1Y1W J;  3E7L A;  2XGC A;  1RRJ A;  3FXM A;  1WH5 A;  1QHG A;  1HST A;  1OR7 C;  2YUS A;  4ZZD A;  1BJA A;  3DEW A;  1XPX A;  2NRA C;  1XGO A;  4C3J J;  5GAG J;  4XKV A;  2QBY A;  1X19 A;  2LLK A;  3RJP A;  4D5F A;  3TO7 A;  2CQ7 A;  4V2F A;  4CYC B;  3DU6 A;  2O8K A;  2E1O A;  2KRH A;  2PMZ A;  4BHP A;  2LP0 A;  1H0M A;  1T08 B;  3FBN B;  1A5J A;  3CMM A;  2EFW A;  4D1Q A;  5K5Q A;  1OPC A;  5CVR A;  2RAE A;  2X6X A;  4XK4 A;  2V26 A;  3F8B A;  1QZZ A;  4I01 A;  3C2B A;  2Z99 A;  5F6F A;  3CF5 F;  1V4R A;  5J6X A;  2CUF A;  4E7S A;  5D4S A;  2I10 A;  2PX9 A;  5EEA A;  3P7N A;  1EKE A;  3H5A A;  1QBJ A;  2VLA A;  2WV1 A;  4NC7 A;  4P9U A;  1LUJ B;  1D1B A;  4GCV A;  3OWT A;  2Z1D A;  4HSR A;  5E20 A;  4E6K G;  3ABM H;  4YIF A;  4Y7N J;  3HYI A;  4R8H A;  1VQ5 I;  2FQ4 A;  3OYL A;  1Y8Q B;  3GX4 X;  3CCV I;  2ELH A;  3GWZ A;  5E3L A;  1AKH B;  4MIM A;  1U5T A;  2DOF A;  5L3B A;  3GW2 A;  2E19 A;  2DTR A;  2BY2 A;  3K4B A;  1F5T A;  2DQL A;  1ODD A;  3QYB A;  2VUM J;  3HGY A;  3TED A;  3DEE A;  1AU7 A;  3T0Y A;  2UZK A;  1I27 A;  4BY1 J;  2HKO A;  4E7J A;  1K78 A;  3PFI A;  1D8J A;  2OA4 A;  2R7F A;  3BTC A;  5FKK A;  3ZQ7 A;  2EZH A;  1IN8 A;  1OMI A;  3BQY A;  3WGI A;  2EIM H;  3GFM A;  3Q5F A;  1W4M A;  4KUM A;  3RZO J;  3IWZ A;  2VJI A;  1YW7 A;  1WRJ A;  1AHD P;  3EYY A;  4RLQ A;  3A0B C;  2PMZ N;  4CZC A;  5E8I A;  3L00 A;  2OCE A;  3MMY B;  2R7X A;  1Y0U A;  2KFD A;  1IDY A;  2Q1Z B;  1Z0X A;  3ZQQ A;  1QGP A;  2IS2 A;  2OF7 A;  3G4S I;  1X1C A;  3BCB A;  4OOI A;  4AVP A;  2Y31 A;  5F0C A;  5FLV A;  4S05 A;  4KN7 X;  2YX7 A;  2E5Z A;  1EA3 A;  1OCP A;  4L0Z B;  3CCJ I;  1U3E M;  4GGG A;  5CKT A;  1S5L C;  2BVM A;  2O8X A;  4KIB A;  5JVG F;  2H09 A;  1YI2 I;  2Z9O A;  2IS4 A;  1IO2 A;  2KHM A;  3QAH A;  4Z6Y A;  4LFU A;  1OJL A;  5DYM A;  3CC2 I;  2M8E A;  1I3Q J;  4XLF A;  3S16 J;  2OQR A;  3W2V A;  3FKI J;  2ZKZ A;  3PUF A;  3MZH A;  2L02 A;  3DBR B;  2PI0 A;  2EH3 A;  3UNG C;  2XKO A;  4FHT A;  4X0G A;  2VKD A;  3KCC A;  3ZMZ A;  1K4T A;  4M3D A;  3QOD A;  2VON A;  5CLS A;  3COA C;  1IJW C;  3M8E A;  3AG3 H;  3TOB A;  2P6T A;  4L0Y B;  1TP4 A;  5HS8 A;  2VXZ A;  4IO9 F;  3HEF A;  2JT1 A;  1IN6 A;  4HA8 A;  3KYL A;  2DPD A;  2RC4 A;  2XF7 A;  2DDB A;  4AID A;  1ZN2 A;  2Z2S B;  3WTV C;  4NHJ A;  1GLN A;  2BXZ A;  3KPH A;  2DN0 A;  4IQ4 A;  3SEZ A;  1W36 C;  2LD5 A;  3FZV A;  4KMF A;  2GA2 A;  3AG4 H;  2PJR B;  2ZNZ A;  3BWG A;  1MSF C;  2AO9 A;  5DCM A;  3CZ6 A;  4D5C A;  3ASO H;  3A1Y A;  2PN6 A;  1SD7 A;  2K3F A;  3R60 A;  3IV5 A;  4M6X A;  3ONQ A;  1BOB A;  3HSR A;  1T0F A;  2X0L A;  1QNT A;  1DDN A;  3GUD A;  4ZDL A;  3SZG A;  2K4B A;  2F4I A;  1U2W A;  3FMQ A;  3E6C C;  2QA4 I;  4UUT A;  2HTS A;  3SFZ A;  1DU0 A;  3OY9 A;  4AIK A;  3HOV J;  4CCL A;  1M1E B;  1T56 A;  2X1D A;  4UVC A;  2ELK A;  2JPB A;  2BZT A;  2W1O A;  1JUP A;  2QUF A;  3DU5 A;  4EM2 A;  2YX4 A;  2R0Q C;  4QPQ A;  5LD2 C;  3FKJ A;  4Y13 A;  3ESW B;  4MQV A;  4CCM A;  3BZ6 A;  5JVT A;  3CCS I;  1DQU A;  4RB1 A;  3C7J A;  1UMQ A;  2OAZ A;  4I09 A;  2FNP A;  2Y30 A;  3BR1 A;  3HRM A;  1ZAR A;  3VWB A;  3ZPL A;  3HL2 A;  2LDU A;  3LA3 A;  4ASN A;  2YU9 J;  2BV6 A;  1CGP A;  3W2W A;  3S1R J;  2MFZ A;  1IRG A;  1F4K A;  2XAJ A;  2XPW A;  3I64 A;  4LG3 A;  2DMN A;  4LMY A;  1JTY A;  3EQL F;  1HW5 A;  1UST A;  2XPU A;  3V42 A;  5EGO A;  2ZB9 A;  4IPA A;  4HX7 A;  3WTT C;  3MVP A;  4PGH A;  1A04 A;  3DKX A;  2L9S A;  4B43 A;  3KEQ A;  5K7H A;  3GZ6 A;  1LE8 A;  4QSH A;  2M0M A;  2GAU A;  2H94 A;  2P81 A;  4UVA A;  4B48 A;  4JX4 A;  1APL C;  1AA7 A;  1R1V A;  1VFC A;  2X6O A;  3J80 Z;  3D5R C;  2XV4 S;  1WH7 A;  4DYQ A;  2GZW A;  2M4G A;  2OD5 A;  3S2D J;  4R79 A;  4EGY A;  1QU3 A;  2P8T A;  5LGT A;  4EJT A;  4BYY A;  2RNJ A;  3BG7 A;  3F8C A;  1U78 A;  3LQQ A;  2JA6 J;  4BEH B;  1RES A;  3TGN A;  1BC7 C;  1PDN C;  3QOP A;  1W5T A;  3B02 A;  2HWV A;  1H8A C;  4XSZ F;  3J7Z I;  1RR7 A;  4PZJ A;  2X51 A;  2FNA A;  3V7R A;  3ABL H;  3QPL A;  1MNE A;  2FD5 A;  3H0D A;  2EA4 A;  2EFP A;  1F1Z A;  4NQW A;  1WI9 A;  2VJJ A;  2JA7 J;  3TQN A;  4DOZ A;  1YJW I;  1ULY A;  1D0Z A;  2JN6 A;  1O7F A;  4RB2 C;  1CF7 A;  3JCU C;  3BPX A;  3NAR A;  1V5F A;  4LK0 F;  5L3G A;  5KHD A;  4WWC A;  3HZJ A;  4CSW A;  1Y6I A;  3ZMS A;  2AHQ A;  5HLI A;  3GTJ J;  2UWM A;  3FK7 A;  3LQR A;  2OV7 A;  3S1N J;  4E4H A;  1KU9 A;  3M7G A;  1G59 A;  3BR5 A;  1MMN A;  2KT0 A;  1XDS A;  4HQE A;  4IKF A;  2IGO A;  2ECC A;  4CYC A;  3A4C A;  2DMT A;  4I76 A;  2I5U A;  3J7A Y;  3HHH A;  3HUG B;  1KQ0 A;  3L2R A;  1JI8 A;  3VYU B;  3GTQ J;  4ON0 A;  1IN5 A;  2IA2 A;  4XOT A;  2VKE A;  4CYD A;  5LGU A;  1FC3 A;  3CME I;  3FF5 A;  5GPC A;  3GLL A;  2OC6 A;  2WAD A;  3WHB A;  3MKZ A;  3QU3 A;  1P6R A;  2JZY A;  2LR8 A;  3TL4 X;  1HKS A;  4A3E J;  5IYD J;  4BHC A;  4M6V A;  2VC1 A;  1Z3Y A;  1Z7U A;  2DA1 A;  3GTO J;  1HW1 A;  2DOA A;  3K4L A;  3CJQ B;  3KZY A;  3MKW B;  2MC4 A;  2FBK A;  5LRS A;  2P4W A;  1XMK A;  4WK8 F;  2W84 A;  3GTL J;  2X9D A;  4XRF A;  4A93 J;  1BI3 A;  3K1M A;  3RTR A;  1X1B A;  4LD5 A;  5IT9 K;  1MSE C;  4F91 B;  3R4K A;  2K85 A;  2IPQ X;  2LBF A;  3E5Q A;  3L2V A;  3BOQ A;  1FOX A;  1D0Y A;  5KAF C;  2P7C B;  3OOP A;  2QSG X;  3FWE A;  3S93 A;  3C18 A;  1WJF A;  2O0Y A;  2XAH A;  2VI6 A;  4G12 A;  2XGE A;  1E3O C;  5IOZ A;  3JR9 A;  1LJ9 A;  3ZN1 A;  5HVQ C;  4C2U A;  2HXO A;  3FHN A;  4E7Z A;  3H35 A;  4HLX A;  3CC7 I;  3F8F A;  2VOO A;  1BN5 A;  2EJR A;  1NH3 A;  1ENH A;  1UCR A;  4JP0 A;  1OCT C;  3V8K A;  1VQL I;  3I53 A;  4OMY A;  4M71 A;  3E5X A;  2JVH A;  1XC5 A;  1KU7 A;  2MD5 A;  4RLF A;  2VT2 A;  4XLC A;  5FLX Z;  3G6E I;  4ETS A;  4IX7 A;  4Y52 J;  3VYS B;  1WWX A;  3OYJ A;  3PIO F;  3I0T A;  9ANT A;  4EJU A;  3K4N A;  2L54 A;  2IS6 A;  2EQR A;  4BY7 J;  5E3M A;  3HSF A;  2HVQ A;  1MBF A;  2CJJ A;  4DZJ A;  1IAW A;  2L3D A;  2FEZ A;  4HLY A;  1XGS A;  1Z91 A;  2XB0 X;  4XN0 A;  5DS9 A;  4M73 A;  2RQQ A;  4MNU A;  1N25 A;  2V4J C;  2K27 A;  5ICG A;  4OMZ A;  1CQT A;  2V6E A;  1J0R A;  2FOW A;  2ICW G;  3O6B B;  3HGG A;  2V79 A;  1B8I A;  2V9K A;  4HX4 A;  4QIW N;  1B72 A;  1USS A;  1SVM A;  1S7E A;  1ETV A;  2DA2 A;  2L9N A;  3JRB A;  4OIQ F;  3BJA A;  3FK6 A;  1FNN A;  3EUH C;  2FSW A;  1LEA A;  4ENM A;  1XCB A;  4H0E A;  3HM5 A;  4PUS A;  4BXX J;  4AIJ A;  4A3L J;  1GUU A;  2ZSH B;  5H6Q A;  4LLL A;  2HI3 A;  3TW6 A;  1LQ1 A;  1U9N A;  4CA0 A;  3CQZ J;  2QWW A;  3FXU A;  2XB5 A;  4ZC3 A;  3AL0 C;  3EDP A;  3HDD A;  2P5K A;  3MEX A;  4D7N A;  1QQI A;  1J2X A;  1S29 A;  2K7L A;  4E70 A;  4MLO A;  2RV8 A;  1IUF A;  4JX5 A;  2LK2 A;  2IRF G;  2HGC A;  3A01 B;  5LRR A;  4G7Z F;  4LG0 A;  4FTH A;  2NXN B;  1BI1 A;  4KIC A;  2UUZ A;  4I0B A;  4DBR A;  5A2Q Z;  3I56 I;  4EV0 A;  1TQP A;  1LEB A;  3BJO A;  1VQP I;  2DFH A;  2M34 A;  3LSK A;  4IVN A;  5BOX A;  1XD7 A;  1ZGJ A;  1ZHF A;  3MD2 A;  4UUS A;  1Z6T A;  5FRO A;  4XBF A;  4RAZ A;  5J8F A;  5E18 F;  3TP0 A;  3V8L A;  4CUG A;  2DPU A;  2DOE A;  2EA2 A;  4J00 A;  2Y9Z A;  4KIG A;  4ITV A;  4GRI A;  4QTR A;  2BOL A;  1SD5 A;  1BC8 C;  3GZN B;  1ZRF A;  1SFO J;  5HLG A;  3CDI A;  3JAM Z;  2ZFU A;  2RKH A;  2DFE A;  3BG9 A;  2ZBK A;  1ETX A;  2E7X A;  1TNS A;  4ZJZ A;  3OYA A;  2KRF A;  2L4M A;  5J40 A;  1BR1 A;  4C2T A;  3TMO A;  5HDK A;  2FBI A;  2IJL A;  1LNW A;  1ACI A;  5AIP A;  1Q1H A;  1WKM A;  3I4P A;  4B4C A;  4ZYG A;  2IT0 A;  4KFC A;  2IGK A;  2HOE A;  1Z6R A;  3IKT A;  1R36 A;  1S8N A;  3T1B A;  2B63 J;  4II2 A;  2O3F A;  1AWC A;  2DA5 A;  3D0S A;  4PFO A;  4BHB A;  1MJ9 A;  2HDW A;  2NOJ B;  2L7M P;  2PFB A;  2YS9 A;  1IZ1 A;  4HF0 A;  1HSJ A;  2PMU A;  3HRT A;  2A07 F;  4EJO A;  4M6Y A;  4N4O B;  4G7H F;  1XTA A;  1IV8 A;  4CH7 A;  4JK1 X;  2W00 A;  2X48 A;  2E5N A;  2VE8 A;  4FE7 A;  3G73 A;  1S7O A;  2MSY A;  2NAZ A;  3S1M J;  2DT7 B;  3BG3 A;  2VBW A;  1B6A A;  2VBX A;  3EYI A;  2VKH A;  3GBG A;  2FMY A;  2LH9 A;  4JBA A;  4AVZ A;  1XG1 A;  3MZY A;  4BQO A;  3RYP A;  1IV6 A;  1G2H A;  1BI2 A;  4B44 A;  5HNH A;  1MBG A;  2E60 A;  4BAC A;  1O3S A;  3RKQ A;  2VPL A;  4EEF G;  2HPI A;  1MJB A;  3H92 A;  3DTK A;  4DYC A;  2G7H A;  3S15 J;  1SVL A;  1BIB A;  4W97 A;  3VFZ A;  3H5R A;  5DD4 A;  4IL6 C;  1VQO I;  1VQ9 I;  1D1C A;  3BR6 A;  3VOD A;  2CW8 A;  2DA6 A;  3Q0W A;  1DUX C;  4HNU A;  4HNT A;  1YRN B;  2MH2 A;  2MLK A;  3HXL A;  1K4S A;  4KIS A;  2ID6 A;  1TQI A;  3CP2 A;  4LOC A;  4XKC A;  1Z7L A;  1FZP B;  3VSL A;  4NUB A;  4LLN A;  2CG4 A;  2HZT A;  4UV9 A;  1O3Q A;  3WTX C;  2IS1 A;  2GQQ A;  1Z67 A;  1YW8 A;  3CUQ B;  3S3N A;  4N4N B;  2A6T A;  2DT6 A;  3U1K A;  1S3J A;  1FP2 A;  3OYN A;  3DLL F;  1FOW A;  4NC8 A;  2CH0 A;  3OSF A;  4PJ0 C;  2CMP A;  3JRI A;  4DJA A;  1SAN A;  3I9V 2;  4IZZ A;  3A0H C;  4Y33 A;  2L2O A;  3KP3 A;  4DZP A;  5JR3 A;  5FRM A;  1H9G A;  2M87 A;  3S32 A;  1ON1 A;  1ZRE A;  3IH3 A;  2LNB A;  5EDN A;  2ZXI A;  3JRD A;  2R92 J;  5EEH A;  1ZGW A;  3CJT B;  4A5N A;  3FXQ A;  5IOY A;  3L2Q A;  3I5U A;  1DU6 A;  3ABT A;  4BJT A;  2D45 A;  2UV1 A;  4WCG A;  4CCJ A;  5E1X A;  5L3E A;  2EWN A;  1YLF A;  4O6J A;  4AU7 A;  4BU2 A;  5GAE J;  3N05 A;  5ILS A;  1FBS A;  3PO2 J;  4FE4 A;  4AD9 A;  1TZL A;  2KLO A;  2QKL B;  5LHI A;  1P4X A;  3RKW A;  3KP4 A;  4KIF A;  2W48 A;  4UVB A;  2H8W A;  1NG7 A;  5EYR A;  5IP6 A;  5LFA A;  4CGZ A;  1O3R A;  1DGW Y;  2LY9 A;  4BJ6 C;  1HKT A;  4HDV A;  2JK3 A;  3VYT B;  1G3S A;  3OR2 C;  5H6R A;  2QZ8 A;  4S04 A;  1UJ8 A;  1W5C C;  1LB2 A;  3EET A;  3LL7 A;  5HDG A;  2BE5 F;  5EZG A;  1OCC H;  1V5E A;  1ZG3 A;  1JT0 A;  3MKY B;  5ICF A;  4BQA A;  2EFO A;  5GTH C;  3H3V K;  4UB6 C;  4TV7 A;  3RKX A;  4Y15 A;  4PJL A;  1BOA A;  3E5U A;  2R7Z J;  3LFU A;  3IKV A;  3E3V A;  4IHY A;  2X6Y A;  4RGU A;  3CUQ C;  4A3C J;  4XKB A;  2XAS A;  2WB1 A;  2E34 A;  3G2B A;  1SC7 A;  3CLQ A;  4NNJ A;  4QWQ A;  4ZH4 F;  1TC3 C;  2H1K A;  3ZQH A;  4X1E A;  3HRS A;  2IBD A;  2F4M B;  3ZMU A;  2M30 A;  1XMA A;  3WHC A;  1MJA A;  2LFB A;  2QM3 A;  5D5X B;  5D8K B;  1HC8 A;  2ELJ A;  5M5X J;  1N75 A;  4HDU A;  4IHS A;  2M8G X;  1PUF B;  2YSR A;  3L1P A;  3V7S A;  3JRC A;  1Y8R B;  3BPV A;  4HG2 A;  4G6T B;  4AC0 A;  5TRD A;  2FBH A;  2FU4 A;  2VT3 A;  3M1C A;  4HF2 A;  2E36 A;  2LSO A;  1IDZ A;  3ZGK A;  3HOW J;  1GVD A;  2L7Z A;  2KP6 A;  2BEO A;  2X85 A;  4XIC A;  4UB8 C;  2WY7 Q;  2FQ3 A;  3HPG A;  3QPT A;  3HIF A;  2NVY J;  3H9Q A;  4QLC U;  5ILV A;  5ERI A;  3U21 A;  2EZI A;  1R4N B;  3T8T A;  4G6D A;  2QF7 A;  2LC2 A;  3OL3 A;  1UHS A;  4I02 A;  3MZ8 A;  2VQH A;  5EJC A;  3TBI A;  4XSX F;  4XN3 A;  4G94 A;  2LKX A;  1LDD A;  2VKV A;  4A6D A;  4RAG A;  1S72 I;  3KEO A;  5BS6 A;  3TDZ C;  2R5Z B;  2ZC2 A;  1IW7 F;  2IXS A;  4J01 A;  1RIO H;  3LSG A;  4IHW A;  2CGP A;  3F0C A;  2OZ6 A;  2MBF A;  1BW5 A;  2WB1 N;  2HKX A;  4U0Y A;  3DQV C;  2R7Q A;  3L2U A;  5TGT A;  4D0P A;  1DPR A;  3Q0U A;  3CJR B;  3A03 A;  4LIU A;  1TT5 B;  2O61 A;  1DP7 P;  4BQQ A;  4B3X A;  4BXU A;  3L09 A;  1YW9 A;  2HEO A;  2LG4 A;  2AXL A;  1B59 A;  4WXD A;  1X1A A;  2JVG A;  1ZR4 A;  1HDP A;  4F7Z A;  4ENJ A;  1H89 C;  5ICC A;  2CYY A;  5BMZ A;  3KX2 A;  3L2W A;  2KIF A;  1UEL B;  1ZK8 A;  1FWZ A;  4E7H A;  1HDD C;  2CW7 A;  4BE0 A;  1BR2 A;  3CF2 A;  2NS8 A;  4F52 A;  2IVM A;  2ZME A;  2CV1 A;  1FSH A;  4HOB A;  2VQL A;  2Z3Y A;  2F4O B;  2KIM A;  1JKO C;  1QA6 A;  1S9H A;  1X58 A;  5IYB J;  1ORK A;  4E7L A;  1WJ5 A;  3HSE A;  1D5Y A;  2IAI A;  1FIA A;  2O7O A;  1P92 A;  3H36 A;  3RPU A;  2VOD A;  2JSC A;  3MQ0 A;  4C3H J;  2NOG A;  2DDA A;  3HOS A;  5IY5 H;  4A0Y A;  1VQ4 I;  2KRC A;  1GXQ A;  1K6O A;  2L4A A;  2N8G A;  5JFR A;  3LMM A;  1WCM J;  3I59 B;  4B47 A;  4HST A;  2OUM A;  1MW7 A;  5HNF A;  2DXI A;  4I6Z A;  3J81 Z;  4C30 A;  3IRR A;  3FXL A;  2LRD A;  3SHF A;  3TKY A;  3H1C A;  4M9X A;  1VTN C;  2JRM A;  3QP6 A;  3NAU A;  1Z9C A;  2K9N A;  3ZN0 A;  2F2E A;  5DUI A;  3JSP A;  2K02 A;  3QPS A;  4IEJ A;  2KIS A;  5DEQ A;  2CRG A;  4PDK A;  2ZXW H;  2M3A A;  3GYH X;  2J5P A;  4UXN A;  2Y75 A;  1R6R A;  2HTJ A;  2FA5 A;  4KMU X;  3L7W A;  3VYR B;  2R7W A;  1GXP A;  2QQ8 A;  4XRS G;  4AYB N;  1OYI A;  2K9Q A;  3B6A A;  4HF1 A;  1FX7 A;  1BJZ A;  3HHG A;  3H3U A;  5F64 A;  4LJZ F;  5LBQ A;  1UHM A;  3FM5 A;  1YHQ I;  5FRN A;  3BLY A;  3GVA A;  2ISZ A;  2VPR A;  3D5S C;  1BL0 A;  3IH2 A;  4WXH A;  2VN2 A;  3HOT A;  5FGM A;  3W6J B;  4HBL A;  1PVE A;  1OR7 A;  2CW0 F;  1K79 A;  2EBI A;  3GF2 A;  2HVS A;  1BR4 A;  1MDM B;  1R22 A;  2VQG A;  2LF7 A;  2KJB A;  2LTP A;  4YEJ A;  2E2J J;  3FHZ A;  1ZTR A;  4ZDO A;  3HOU J;  3C3W A;  2HU9 A;  4PSX A;  1PUE E;  2EIN H;  3MN2 A;  1ITY A;  2MGQ A;  2K5C A;  5M5W J;  3REO A;  3BRO A;  1JE8 A;  4IXA A;  4RM3 A;  1MZB A;  3SFI A;  5KNL A;  3F22 A;  2DBB A;  1WJD A;  3I3L A;  2K9S A;  1QPM A;  4Z2Y A;  2H8R A;  3GZ5 A;  1RZ4 A;  1D5V A;  2P0W A;  4MO7 A;  2BY0 A;  2C6Y A;  5FKL A;  2DI3 A;  2AQE A;  4UNO A;  3GEZ A;  1GV5 A;  2PMH A;  2Q2E A;  3G1O A;  3TO9 A;  4QPO A;  3RDI A;  1KGS A;  3BG5 A;  1ZAO A;  3IC7 A;  2I8D A;  2R7T A;  2A6E F;  1MNM C;  3IAS 2;  1JTX A;  3SXY A;  5D5U B;  3S14 J;  2VJ4 A;  1UFM A;  5DV5 A;  1RKT A;  4BGD A;  5FLM J;  4PGG A;  4XM3 A;  2PEX A;  3E6M A;  2A61 A;  3CCU I;  2COM A;  5F0H A;  4PJN A;  1FBU A;  1T8I A;  5IYC J;  2E1N A;  2ZCW A;  1ERD A;  3RCO A;  4CDG A;  3U9G A;  4V19 K;  3ECO A;  3R6S A;  2VJ5 A;  2Q0O A;  4XID A;  2F5D A;  3GFI A;  2HQA A;  1IF1 A;  2YU3 A;  3DXJ F;  1W1W E;  1IUY A;  2A05 A;  1UZC A;  4HRI A;  4RDU A;  1J5Y A;  3EPZ A;  1RNL A;  3J7Y J;  4ESB A;  4E7K A;  1MH4 A;  5CYV A;  2NVQ J;  3PQJ A;  4BNC A;  1SD4 A;  4IF4 A;  3K70 C;  3E6B A;  1UG0 A;  1E2X A;  4EJV A;  5KAI C;  3SDB A;  3F6V A;  1E3P A;  5K7Z A;  2DA4 A;  1IN7 A;  3CCE I;  2M4K A;  4A3D J;  4HV5 A;  4LLG F;  4CHU A;  1T95 A;  3HBL A;  4P1W A;  3BG6 A;  3H9G A;  2NNN A;  2Z33 A;  1A35 A;  3K7A J;  1YG2 A;  1ZYR F;  5J8C A;  4PSW A;  1NG6 A;  3ISP A;  2RVC A;  2CUJ A;  2K9M A;  3ERM A;  3K69 A;  3OIO A;  2E1C A;  4G9Y A;  2NS7 A;  2AQF A;  4IRG A;  2XC7 A;  2DTZ A;  2LY2 A;  3U1D A;  5E3N A;  3PQK A;  2QQ9 A;  2CO5 A;  2OQG A;  3OYM A;  4A0Z A;  3SZT A;  2ETH A;  2A69 F;  3F23 A;  2FUG 2;  2K3P A;  2XKP A;  1AKH A;  3O8G A;  1YE9 A;  2QBY B;  2WY8 Q;  2W4S A;  3I4M J;  3P9K A;  3FMR A;  2XAF A;  4IRI A;  3PO3 J;  1R58 A;  1FEX A;  4EJW A;  1FYK A;  2DMQ A;  1A6Q A;  3SJM A;  2ECB A;  3IWF A;  1HQC A;  1B4A A;  4XRS A;  3QQA A;  5CVV A;  4XLP F;  3RZD J;  1T6S A;  2BY1 A;  2JSP A;  3ELK A;  1VQ8 I;  3LSH A;  2VIX A;  1I50 J;  2IEK A;  2V1D A;  5JLW A;  2F5C A;  4NC6 A;  2OPT A;  4M9S A;  2Z16 A;  4HEA 2;  2B7E A;  4BDZ A;  1GHC A;  1WVR A;  2ME0 A;  3TW7 A;  3AL0 B;  1G3Y A;  2RDP A;  3QYE A;  4XMY A;  1UB9 A;  1ZRC A;  3FIS A;  2XPV A;  5FKO A;  3WU1 B;  1PYV A;  1JHF A;  3DTI A;  2HYF A;  1K6Y A;  1V5G A;  5F1R A;  4L5J A;  2KMU A;  2DFF A;  3S3O A;  4BE1 A;  3KYC B;  4FX0 A;  4JYK A;  3CLO A;  1U5T B;  3F9K A;  5E3O A;  4RBO A;  3KYD B;  3K9T A;  4F3Q A;  2QGU A;  1EV7 A;  4KA4 A;  4L9T A;  3MWM A;  1IC8 A;  1ETY A;  2R7R A;  4PFP A;  4GO1 A;  2A5Y B;  2KIQ A;  2KL4 A;  1YYV A;  2BGC A;  4DIQ A;  3K1N A;  1SVO A;  1K78 B;  1MND A;  2LMD A;  4L9J A;  4LGW A;  3GCM A;  3ZMV A;  1MMS A;  4UUV A;  3HTS B;  5FJ8 J;  3HOX J;  1YX5 A;  4IJA A;  3M8J A;  1W36 D;  1MKM A;  3DP7 A;  5J4V A;  4XNF A;  3CC4 I;  2STW A;  4P9F A;  1JUS A;  2F5F A;  4G8X A;  3BDD A;  2CU7 A;  2DU9 A;  1P4W A;  1OIS A;  4RGR A;  2RNG A;  5J1Y A;  4I7H A;  3ZOB A;  1U0J A;  5TIS C;  1SFE A;  5JHU A;  3CMA I;  2HS5 A;  1RUO A;  3Q9S A;  4R1H A;  2EK5 A;  2P6S A;  3KP2 A;  3KET A;  4BDY A;  2G7U A;  4I0A A;  1G3W A;  3OS2 A;  4HW0 A;  2PJR A;  3H5N A;  3GTK J;  2HFH A;  4RGS A;  3JRE A;  3OYH A;  1U5T C;  1HW2 A;  1W7P D;  1JUM A;  1TNT A;  2XVC A;  4M72 A;  4DNC A;  3WE2 A;  5E1W A;  4ZZL A;  2FE3 A;  2VE9 A;  2XF5 A;  3BY6 A;  1RR8 C;  1SAU A;  3RQ4 A;  1OQY A;  2O9L A;  4ESF A;  3DPU A;  1TL8 A;  3MKL A;  2EPF A;  3CCR I;  3OYD A;  1SFX A;  4LB5 A;  2JA2 A;  4O3M A;  2MLG A;  4L9N A;  4M3E A;  4JQF A;  4HNV A;  1VF9 A;  3LSJ A;  4MEX F;  4L9V A;  4ENN A;  1EF4 A;  5KK1 A;  1U6G A;  2O6G E;  1NK2 P;  3H3Z A;  4GFB A;  4UY8 I;  3JRH A;  1JKP C;  4IHV A;  1VQ6 I;  4KNY A;  2IP2 A;  2R7S A;  4LB6 B;  2PJP A;  1TWG J;  2OZU A;  2K4J A;  3NWT A;  3CDH A;  4F93 B;  1HXD A;  5DCM B;  5J1U A;  4FQG A;  3OV8 A;  2HOS A;  2Z5U A;  2L01 A;  1X2N A;  2H6B A;  2JUG A;  3V8J A;  2JPC A;  2IA1 A;  4ANJ A;  1HCR A;  3RQI A;  4KIT B;  1FJL A;  5B5E C;  1GDT A;  2STT A;  3F3X A;  3BZC A;  1R1T A;  2JWT A;  2NVX J;  4RS8 A;  3VOE A;  4BUP A;  1IRZ A;  3W2A A;  2LOO A;  2X1E A;  4P55 A;  2ZJR F;  4MHG A;  2DAO A;  4ZYE A;  3FXO A;  2K9L A;  2JQ7 A;  4EMS A;  1TT0 A;  4WXC A;  1G6N A;  4FCY A;  3S1Q J;  1X3U A;  3SDG A;  1TBX A;  3BP8 A;  3J80 K;  3WGG A;  1REP C;  4DGW B;  1DGR M;  2R4G A;  3K0L A;  1FMW A;  3G71 I;  5HOO A;  2OTJ I;  3QPH A;  2CWE A;  2ID3 A;  2QQB A;  4RGX A;  1OCZ H;  4GYI A;  3N4M A;  3BC8 A;  3RSN A;  1S7A A;  4HQM A;  3CMY A;  3OYG A;  4BEH A;  3H0G J;  3HPH A;  2EFN A;  3M4O J;  3O8H A;  4B09 A;  5D5V B;  1R5I D;  1IN4 A;  4Y17 A;  3LA7 A;  2V1X A;  1S6L A;  2F5E A;  2ZJ2 A;  1J9I A;  1ZH5 A;  4U88 A;  5ED4 A;  1HOM A;  2M7A A;  2R7D A;  4XRM A;  2YR2 A;  1QVU A;  3ZQF A;  2OTL I;  3I71 A;  4BAY A;  1IRX A;  5BQT A;  5EGO B;  3LOC A;  3FBI B;  1ZLJ A;  1WZ2 A;  4IHT A;  1O4X A;  3MFK A;  1I3A A;  1RC9 A;  3K70 D;  2NVT J;  2DYR H;  2DO7 A;  3DCF A;  2KZG A;  2HDD A;  4FX4 A;  2MW8 A;  3S2W A;  3LAP A;  1LVK A;  4MTD A;  2HPM A;  2DA7 A;  3M1E A;  4DW6 A;  5K7F A;  1T0F C;  3DTE A;  2PG4 A;  2OBP A;  1RUN A;  1A36 A;  3BT9 A;  1VQ7 I;  1MMA A;  1WJB A;  4I98 B;  1PP8 F;  1SAX A;  3K2A A;  3SYT A;  1Y0N A;  2MA3 A;  3JTG A;  1I1S A;  4RAF A;  3QWL A;  2XSJ C;  5EF6 A;  4AIH A;  4IRH A;  2B0L A;  2WAE A;  1ZG1 A;  2HQ5 A;  3EUK L;  1O57 A;  3QYF A;  4BL0 B;  2CQQ A;  5J1R A;  4OAZ A;  3KFW X;  1G3T A;  5H2F C;  4B3A A;  3QP5 A;  2CQN A;  1I39 A;  4NQW B;  3K4C A;  5AON A;  5LGN A;  5K1Y A;  3HUG A;  2QLZ A;  2XAG A;  3OR1 C;  3AKZ A;  2L0K A;  1OKR A;  1V3F A;  2BW3 B;  3WG9 A;  4XQF A;  2E2H J;  2DJI A;  3NRV A;  1FY7 A;  2QCO A;  3KLO A;  3F8N A;  5E8G A;  1FLI A;  2KJC A;  4A3I J;  2LVS A;  1TWA J;  3P9C A;  3OIQ A;  4L5E A;  3ZQI A;  4XOR A;  2HOT A;  4IOA F;  2R5Y B;  3AAF A;  1X4P A;  2EV5 A;  3OYK A;  3MAJ A;  5ILU A;  4LIT A;  1ETW A;  2CV0 A;  1OCR H;  2Y2Z A;  5JHF A;  2OU2 A;  1HBX G;  1C0W A;  4EM1 A;  4P96 A;  3H9J A;  4U87 A;  1NK3 P;  5LHH A;  2A6H F;  4RM2 A;  5HLT A;  3QU6 A;  4D9J A;  3HKZ A;  2QSH X;  2HNH A;  2W57 A;  2WWY A;  1IXS B;  2RRE A;  3HOZ J;  1LDK B;  3LSM A;  2RQP A;  1JJ8 C;  2DA3 A;  4GXO A;  4N0B A;  3JRF A;  2PLY A;  3GFL A;  1MH3 A;  3E0J B;  4Q47 A;  3EUH A;  3T8R A;  1STZ A;  3WTY C;  4O5V A;  1YX3 A;  3NEU A;  3B6C A;  1ZRD A;  1G8X A;  3ZP5 A;  3KIO A;  3NQO A;  2DK5 A;  1JT6 A;  1AOY A;  1UG2 A;  3HB9 A;  1LFB A;  2A3S A;  3CO6 C;  4BBS J;  4DYR A;  1GV2 A;  4BS9 A;  4CCK A;  5C3E J;  5DD8 A;  1XGM A;  2CUZ A;  3KP5 A;  5FLX K;  2XRO A;  2M1B A;  1N77 A;  3FMS A;  2V1N A;  5F1J A;  1XMX A;  4KT5 C;  2NVU B;  1T2K A;  4XLE A;  3BTL A;  2LY1 A;  3KP7 A;  1XN7 A;  2XAQ A;  1X4O A;  3S8P A;  4KN4 X;  1QVT A;  1TW2 A;  3QRF F;  4Q5S F;  5IT9 Z;  1IG7 A;  3OYE A;  1EJ9 A;  2FF4 A;  2W7N A;  2LBF B;  2W24 A;  2VC0 A;  2VBY A;  1Q1V A;  2UXX A;  4M3B A;  3WTU C;  1OLT A;  4ESJ A;  1DPU A;  5GP9 A;  2X4H A;  1TWF J;  2F48 A;  2DLL A;  3VDX A;  2HYJ A;  5KCM A;  5CQG A;  2Y48 A;  3F8M A;  5B1B H;  4C2M J;  2L7K A;  2GXG A;  1O7L A;  3ZMT A;  1L0O C;  1WPK A;  4L18 B;  1MMG A;  3OS0 A;  4J19 A;  5J47 A;  2KIU A;  2H6C A;  1XCV A;  3FIW A;  3HKZ N;  1H88 C;  2ZFW A;  1W0U A;  1K83 J;  3CCM I;  3F21 A;  2E35 A;  1Y39 A;  1POG A;  4I2O A;  2E7W A;  3CDL A;  3BTI A;  3WG7 H;  2CQX A;  1YFH A;  4A6E A;  1X1P A;  2LKP A;  2IGM A;  4MTE A;  1Z1D A;  4DBQ A;  2W82 A;  2QSF X;  5ICE A;  3OYC A;  4XKW A;  3F6O A;  2JUC A;  3QOE A;  1HLV A;  1E0E A;  4KDP A;  2ME6 A;  4Q48 A;  1MBJ A;  2R7U A;  2XF6 A;  4AYB A;  2GIZ A;  2WA0 A;  2GIV A;  4CO8 A;  3A01 A;  4CCN A;  2LF8 A;  3AG1 H;  1W7P B;  2M45 A;  1H9T A;  1WJE A;  5A2Q K;  3IP4 B;  1MBE A;  1B8I B;  4NBQ A;  1XDU A;  5K5O A;  1UAA A;  4EVI A;  2ZJQ F;  4XOP A;  4A3M J;  1LFU P;  5B1A H;  4MFE A;  4RMN A;  3S3M A;  3CO7 C;  1B72 B;  3KLN A;  2ACJ A;  4A3K J;  3RI4 A;  3ML6 A;  3KP6 A;  1SMT A;  3UKG A;  1R9T J;  2H1L A;  1YS7 A;  2E1M B;  2QEN A;  3FXK A;  5HS7 A;  4IHX A;  5D4R A;  5D6E A;  3DPT A;  4B8X A;  1OCO H;  5M3M J;  1BW6 A;  5C4J J;  3WOD F;  3LWF A;  3KZZ A;  4IQJ A;  4BJ5 C;  2EIL H;  4YG2 F;  3RPQ A;  4Q4Z F;  1RPW A;  1X1D A;  3C2H A;  3GFJ A;  5CVJ A;  3JAM K;  1UHW A;  1T33 A;  5E17 F;  3BCA A;  4A69 C;  4WX9 A;  2EIJ H;  3VPR A;  2AXT C;  2VBZ A;  5LLQ A;  3DLA A;  4M9Z A;  3PUB A;  2R7V A;  3IH4 A;  2ISY A;  4A3J J;  4ZYA A;  3S2H J;  2R3S A;  4W1U A;  1XGN A;  3ERE D;  1F43 A;  1HKQ A;  1ZLK A;  4LG0 B;  5E1Z B;  3G1L A;  3OS1 A;  1B9M A;  4KYW A;  3SQN A;  4I99 C;  3MCZ A;  1YQA A;  2TDX A;  3BZK A;  4RAY A;  3WTS C;  3PSF A;  2VL8 A;  3CCL I;  5FD6 A;  3CD6 I;  4UUS B;  4XL9 A;  3D5L A;  1QPI A;  4ZDP A;  4YFK F;  2GA1 A;  3W3C A;  3OOU A;  4FIS A;  3PFY A;  2NS0 A;  3X2Q H;  4EGZ A;  1D1A A;  3PSI A;  2KQR A;  1WFX A;  3LSP A;  2DCE A;  2KKO A;  2V9V A;  4BXF A;  5L3C A;  3RPU D;  1TW3 A;  1D0X A;  2QYO A;  5IP9 J;  3TOA A;  3N97 A;  3WU2 C;  3DWL E;  2E1M C;  2DOD A;  2MAB A;  4HYE A;  1NTC A;  4P5O A;  1ETO A;  2VOP A;  3K6G A;  4OAY A;  3B73 A;  2FXA A;  3M3Y J;  1F36 A;  2FRH A;  1SFK A;  2DYS H;  1EH7 A;  4CCO A;  1K61 A;  2DFI A;  1MMD A;  2F6C A;  2O03 A;  2R93 J;  1LDJ A;  3CES A;  5FKM A;  2GOX B;  2ZSI B;  4NB5 A;  4Y4R A;  2AS5 F;  1JXS A;  1P2F A;  1XB4 A;  2KPM A;  5BPI A;  3BQZ A;  1RKW A;  1KZH A;  1YRN A;  2NNY A;  1RET A;  4MFD A;  3VB2 A;  1BBY A;  1ONV A;  5DTD A;  1YJN I;  3JRA A;  3DF8 A;  2J5O A;  3G3Z A;  5GPA A;  3CUQ A;  3BJ6 A;  1A31 A;  3C2G A;  4MQ9 F;  2DMU A;  2HXI A;  2JRT A;  3K10 A;  2P5L C;  2CV2 A;  3A2K A;  1QZE A;  2F5V A;  2G0E A;  2DQR A;  3I54 A;  3L9F A;  4YEL A;  2EFQ A;  2MC3 A;  4U7D A;  3TP3 A;  3ABU A;  3K4J A;  4NDL A;  5LEJ A;  2BHZ A;  2H27 A;  4XR6 A;  3TDU C;  2QKM B;  1Z77 A;  1YJ9 I;  1I6H J;  2XIG A;  1TWC J;  1IRF A;  3JSO A;  1R5H A;  1SFU A;  5BNG A;  4XLH A;  4AUX A;  4RB0 A;  5DCF A;  1GVJ A;  1B9N A;  2Y0M A;  2BW3 A;  1IXR C;  1WHU A;  3OYB A;  1P7J A;  2CFX A;  2X1C A;  3FDY A;  2EV6 A;  4OIR F;  1I5Z A;  2HVR A;  1TWH J;  1F9N A;  3P9I A;  1Z05 A;  3AFH A;  3M9A A;  1FTT A;  4N9H A;  3G1M A;  2GLO A;  2WAQ A;  2GWR A;  1U8R A;  2R5Y A;  1WSU A;  4YII A;  3KZI C;  3T5X A;  2PBI A;  3GTM J;  3FXR A;  3EUA A;  2JTV A;  4GYG A;  2VAS A;  3E97 A;  2QVO A;  3ZQG A;  1ETK A;  2R7O A;  5EG0 B;  5TJJ A;  3BR3 A;  1X2M A;  4CZZ A;  4C3I J;  4XLA A;  3E1S A;  4D7M A;  5CPR B;  2IW5 A;  2NYX A;  3ABK H;  3NWS A;  3UR3 C;  4M3G A;  5LHG A;  2DK8 A;  3VEP A;  4FET A;  3ZCO A;  3LAJ A;  3GTP J;  5DM7 F;  5C4X J;  3HC7 A;  4N9I A;  2ZXH A;  1T38 A;  3TO6 A;  1R7J A;  2FJ1 A;  2HOA A;  2P5V A;  2RN7 A;  3JW4 A;  3O3K A;  3KEY A;  3CCY A;  2ZO4 A;  1TQM A;  2D2W A;  1G4D A;  5JI6 A;  3FXJ A;  3SZP A;  2HYG D;  1VQN I;  1PUF A;  1WGX A;  4G7O F;  4EM0 B;  3R61 A;  5GAH J;  4OIN F;  2CSO A;  2LKS A;  2TRT A;  2WTE A;  2W25 A;  5EZH A;  1FYL A;  2IA0 A;  2OJE D;  3BR2 A;  5FB2 A;  4BH9 A;  2EV0 A;  4XON A;  5GTI C;  1YOV B;  3O2P E;  1XX5 A;  3WTZ A;  5K5R A;  4A0X A;  5J4Y A;  1MIJ A;  4RB3 C;  1JGG A;  1YIT I;  2GOM A;  3ZRG A;  2UXN A;  1BM9 A;  3DKY A;  1L3L A;  5DUK A;  3ZR8 X;  3GXO A;  1EH6 A;  2JA5 J;  3Q9V A;  4G6Q A;  3ZMD A;  3GO5 A;  3C1D A;  1FBQ A;  1I6X A;  4YIR X;  2L9R A;  1MD0 A;  2WAQ N;  4EQQ A;  3W6V A;  3V4G A;  2V1U A;  3OIP A;  1R71 A;  2DW4 A;  3LNQ A;  2D5V A;  3K4M A;  3WGH A;  3PJR A;  4M3F A;  4CXF A;  4JX6 A;  4U0W A;  3ZQL A;  4X6A J;  4II3 A;  3WU0 A;  1V54 H;  3D1N I;  5FO5 A;  3SEQ A;  3PIP F;  5F27 A;  5HOD A;  4GDF A;  4E7I A;  3BTJ A;  4F92 B;  2K86 A;  5CVI A;  2R5Z A;  4A2U A;  3E6D A;  5J3L A;  1KYW A;  3OYI A;  1YIO A;  3ROU A;  2EZK A;  5H20 A;  1XSV A;  5D5W B;  5C44 J;  1LPQ A;  1FTZ A;  2LRE A;  2WC2 A;  1U9O A;  3OMY A;  4MEY F;  4IOC F;  1D8K A;  3HTU A;  4FT8 A; 
#chains in the Genus database with same CATH homology
 1KA8 A;  5EEG A;  1T39 A;  1J7K A;  2DT5 A;  4U0V A;  1NHA A;  1FT9 A;  1KYZ A;  4MGR A;  3WE3 A;  1T98 A;  3KE2 A;  1R5G A;  1FPQ A;  4U7B A;  3CTA A;  3DFG A;  3IRQ A;  3RIR A;  1MGT A;  1P4A A;  1JGS A;  1W7P A;  1BI0 A;  4OIP F;  2HQN A;  2ESH A;  4HZF A;  4YFN F;  4HX8 A;  1KQ9 A;  1EH8 A;  2ZXJ A;  2G9W A;  4AWX B;  1R23 A;  2FML A;  2CQK A;  2XGX A;  2WV0 A;  3HRU A;  3M8F A;  4ZYD A;  1YO5 C;  1TLH B;  3DKW A;  1QO0 D;  1B1B A;  3WTW C;  1FP1 D;  2HDC A;  5HS9 A;  1IXC A;  3CJN A;  2M5W A;  3I59 A;  5CVU A;  3J81 K;  1KQ8 A;  3IHU A;  4A5M A;  2P7V B;  4K2E A;  5HLH A;  2BYV E;  2XUB A;  1W5S A;  2FOK A;  2V6C A;  2ZME B;  2A68 F;  5D8L B;  4OU0 A;  3GLX A;  2W85 A;  5IT3 A;  4A12 A;  1J59 A;  1OYW A;  1QZY A;  2XHK A;  1O3T A;  2RGV A;  1J75 A;  1SD6 A;  4ENK A;  3W6K B;  1YTY A;  2HQR A;  3ULQ B;  1FYM A;  5DDG A;  1D3Y A;  3K1P A;  3DPL C;  3V7C A;  3R0J A;  3IL2 A;  4L5I A;  1MDM A;  4DQ2 A;  2BBY A;  1KU3 A;  1K7A A;  4ZYH A;  3RYR A;  1ZGA A;  3I58 A;  1R1U A;  3RKY A;  5CJ9 A;  4CIC A;  3DV8 A;  4YFX F;  3LA2 A;  1OYY A;  5HDN A;  2XRN A;  1JHH A;  1YS6 A;  5L3D A;  1FOK A;  1SMY F;  3ECH A;  5D6F A;  5BPD A;  5LEK A;  4HAM A;  2D1V A;  4WF2 A;  4LK1 F;  1XSX A;  1R00 A;  3LFK A;  1XSD A;  5FFX A;  2HR3 A;  2ZNY A;  2ESN A;  3FM3 A;  3U2R A;  4UHT A;  1WQ2 A;  1FSE A;  5KVR A;  1BIA A;  2MH9 A;  2YPR A;  2D1H A;  1KU2 A;  1ZG5 A;  1LVA A;  2PQ8 A;  2EB7 A;  4M74 A;  3J7A O;  1I1G A;  1TTY A;  2ADU A;  5FD5 A;  3LST A;  1ON2 A;  4UV8 A;  1PP7 U;  2GXB A;  3F72 A;  5FFZ A;  4HV6 A;  1E17 A;  5AIQ A;  3FX3 A;  3CUO A;  3L2C A;  6PAX A;  1CF7 B;  5L3F A;  3JTH A;  1RI7 A;  4PCQ A;  2QQA A;  4OIO F;  3K2Z A;  4XLN F;  3DEU A;  3R0A A;  2Q8K A;  1HST A;  4ZZD A;  1BJA A;  2NRA C;  1XGO A;  2QBY A;  3RJP A;  3TO7 A;  4BHP A;  1H0M A;  2EFW A;  5K5Q A;  1OPC A;  5CVR A;  3F8B A;  1QZZ A;  4I01 A;  2Z99 A;  5F6F A;  1V4R A;  5J6X A;  5D4S A;  3P7N A;  1QBJ A;  4P9U A;  4GCV A;  5E20 A;  4YIF A;  3HYI A;  4R8H A;  3GX4 X;  2ELH A;  3GWZ A;  1U5T A;  5L3B A;  3GW2 A;  2DTR A;  1F5T A;  2DQL A;  1ODD A;  3HTU A;  3T0Y A;  2UZK A;  1I27 A;  2HKO A;  1K78 A;  3PFI A;  1D8J A;  2OA4 A;  2R7F A;  3ZQ7 A;  1IN8 A;  1OMI A;  3WGI A;  3GFM A;  3Q5F A;  1W4M A;  4KUM A;  3IWZ A;  1YW7 A;  1WRJ A;  3EYY A;  5E8I A;  3L00 A;  1Y0U A;  1QGP A;  4AVP A;  4OOI A;  4S05 A;  4KN7 X;  2YX7 A;  4L0Z B;  1U3E M;  4GGG A;  2O8X A;  4KIB A;  2Z9O A;  2H09 A;  3QAH A;  4LFU A;  5DYM A;  2M8E A;  2OQR A;  2ZKZ A;  3MZH A;  2L02 A;  2PI0 A;  2XKO A;  4FHT A;  3KCC A;  3ZMZ A;  2VON A;  5CLS A;  3COA C;  3M8E A;  3TOB A;  2P6T A;  4L0Y B;  5HS8 A;  2VXZ A;  2JT1 A;  1IN6 A;  4HA8 A;  2DPD A;  2RC4 A;  1ZN2 A;  3WTV C;  4NHJ A;  3FZV A;  4KMF A;  2GA2 A;  2ZNZ A;  3BWG A;  5DCM A;  2PN6 A;  1SD7 A;  3R60 A;  4M6X A;  3HSR A;  1T0F A;  2X0L A;  1QNT A;  1DDN A;  3GUD A;  2K4B A;  1U2W A;  3FMQ A;  3E6C C;  2HTS A;  3SFZ A;  4AIK A;  4UVC A;  2JPB A;  2QUF A;  4EM2 A;  2YX4 A;  4Y13 A;  4MQV A;  3BZ6 A;  5JVT A;  4RB1 A;  3C7J A;  2OAZ A;  4I09 A;  2FNP A;  3HRM A;  3ZPL A;  1ZAR A;  2LDU A;  3LA3 A;  4ASN A;  2BV6 A;  1CGP A;  1IRG A;  1F4K A;  2XAJ A;  3I64 A;  4LMY A;  3EQL F;  1HW5 A;  1UST A;  4IPA A;  4HX7 A;  3WTT C;  4PGH A;  1A04 A;  3KEQ A;  3GZ6 A;  2GAU A;  2H94 A;  4UVA A;  1R1V A;  3J80 Z;  2XV4 S;  2GZW A;  2OD5 A;  4R79 A;  4EGY A;  2P8T A;  5LGT A;  4EJT A;  4BYY A;  2RNJ A;  3F8C A;  1U78 A;  3LQQ A;  1BC7 C;  3TGN A;  1PDN C;  3QOP A;  1W5T A;  3B02 A;  2HWV A;  4XSZ F;  4PZJ A;  2FNA A;  3V7R A;  2EA4 A;  2EFP A;  1F1Z A;  4NQW A;  1WI9 A;  3TQN A;  1ULY A;  1O7F A;  4RB2 C;  1CF7 A;  3BPX A;  4LK0 F;  5L3G A;  4WWC A;  3ZMS A;  5HLI A;  2UWM A;  3LQR A;  1KU9 A;  3M7G A;  1XDS A;  4HQE A;  3HHH A;  1KQ0 A;  4ON0 A;  1IN5 A;  2IA2 A;  4CYD A;  5LGU A;  1FC3 A;  3FF5 A;  3QU3 A;  1P6R A;  2JZY A;  1HKS A;  4BHC A;  2VC1 A;  1Z7U A;  1HW1 A;  3KZY A;  2FBK A;  5LRS A;  2P4W A;  1XMK A;  4WK8 F;  2W84 A;  4XRF A;  1BI3 A;  3K1M A;  3RTR A;  4LD5 A;  5IT9 K;  3R4K A;  2IPQ X;  3E5Q A;  3BOQ A;  2P7C B;  3OOP A;  3FWE A;  3C18 A;  2O0Y A;  2XAH A;  1LJ9 A;  3ZN1 A;  5HVQ C;  4HLX A;  2VOO A;  3F8F A;  1BN5 A;  2EJR A;  1UCR A;  3V8K A;  3I53 A;  4OMY A;  4M71 A;  3E5X A;  1KU7 A;  2MD5 A;  2VT2 A;  5FLX Z;  4ETS A;  1WWX A;  3I0T A;  4EJU A;  2L54 A;  3HSF A;  1IAW A;  2L3D A;  2FEZ A;  4HLY A;  1XGS A;  1Z91 A;  4M73 A;  4MNU A;  2K27 A;  5ICG A;  4OMZ A;  1J0R A;  3O6B B;  2V79 A;  4HX4 A;  1USS A;  4OIQ F;  3BJA A;  1FNN A;  2FSW A;  1LEA A;  4ENM A;  1XCB A;  4H0E A;  4AIJ A;  5H6Q A;  4LLL A;  1LQ1 A;  2QWW A;  3FXU A;  3EDP A;  2P5K A;  3MEX A;  1QQI A;  1J2X A;  1S29 A;  2K7L A;  4E70 A;  2RV8 A;  2IRF G;  2HGC A;  5LRR A;  4G7Z F;  4LG0 A;  1BI1 A;  4KIC A;  4I0B A;  5A2Q Z;  4EV0 A;  1TQP A;  1LEB A;  3BJO A;  4IVN A;  5BOX A;  1XD7 A;  1ZGJ A;  1ZHF A;  1Z6T A;  4XBF A;  4RAZ A;  5J8F A;  5E18 F;  3V8L A;  2DPU A;  2EA2 A;  4KIG A;  1SD5 A;  1BC8 C;  1ZRF A;  5HLG A;  3JAM Z;  2RKH A;  2ZBK A;  2E7X A;  1TNS A;  2KRF A;  2L4M A;  5HDK A;  2FBI A;  2IJL A;  1LNW A;  5AIP A;  1Q1H A;  1WKM A;  3I4P A;  4ZYG A;  2IT0 A;  4KFC A;  2HOE A;  1Z6R A;  3IKT A;  1R36 A;  1S8N A;  3T1B A;  2O3F A;  1AWC A;  3D0S A;  4BHB A;  1MJ9 A;  2PFB A;  1IZ1 A;  4HF0 A;  1HSJ A;  2PMU A;  3HRT A;  2A07 F;  4EJO A;  4M6Y A;  4G7H F;  4JK1 X;  3G73 A;  2VE8 A;  1S7O A;  2NAZ A;  2VBW A;  1B6A A;  2VBX A;  3EYI A;  2FMY A;  4JBA A;  3MZY A;  3RYP A;  1BI2 A;  1O3S A;  1MJB A;  3H92 A;  2G7H A;  1BIB A;  3VFZ A;  5DD4 A;  3VOD A;  1DUX C;  2MH2 A;  2MLK A;  1TQI A;  1FZP B;  4LLN A;  2CG4 A;  2HZT A;  4UV9 A;  1O3Q A;  3WTX C;  2GQQ A;  1YW8 A;  3CUQ B;  1S3J A;  1FP2 A;  3KP3 A;  5JR3 A;  1H9G A;  2M87 A;  1ON1 A;  1ZRE A;  2LNB A;  5EEH A;  4A5N A;  3FXQ A;  3I5U A;  3ABT A;  2D45 A;  4WCG A;  5E1X A;  5L3E A;  2EWN A;  1YLF A;  4O6J A;  5ILS A;  1FBS A;  4AD9 A;  5LHI A;  1P4X A;  3RKW A;  3KP4 A;  4KIF A;  4UVB A;  4CGZ A;  1O3R A;  1HKT A;  4HDV A;  1G3S A;  5H6R A;  2QZ8 A;  4S04 A;  1LB2 A;  3EET A;  5HDG A;  2BE5 F;  1ZG3 A;  5ICF A;  4BQA A;  2EFO A;  4TV7 A;  3RKX A;  4Y15 A;  1BOA A;  3E5U A;  3IKV A;  3E3V A;  4RGU A;  3CUQ C;  2XAS A;  4QWQ A;  4ZH4 F;  3HRS A;  3ZMU A;  2M30 A;  1XMA A;  1MJA A;  5D5X B;  2QM3 A;  5D8K B;  4HDU A;  4IHS A;  2YSR A;  3V7S A;  3BPV A;  5TRD A;  2FBH A;  2FU4 A;  2VT3 A;  4HF2 A;  2LSO A;  2BEO A;  2FQ3 A;  3QPT A;  3HIF A;  5ILV A;  4QLC U;  5ERI A;  3T8T A;  4G6D A;  4I02 A;  4XSX F;  4G94 A;  1LDD A;  4A6D A;  3KEO A;  5BS6 A;  3TDZ C;  1IW7 F;  1RIO H;  2CGP A;  2OZ6 A;  2MBF A;  4U0Y A;  2HKX A;  3DQV C;  4D0P A;  1DPR A;  2O61 A;  1DP7 P;  4BXU A;  3L09 A;  1YW9 A;  2HEO A;  2AXL A;  1B59 A;  4WXD A;  4F7Z A;  4ENJ A;  5ICC A;  2CYY A;  5BMZ A;  2KIF A;  1FWZ A;  2IVM A;  2ZME A;  1FSH A;  4HOB A;  2Z3Y A;  2KIM A;  3HSE A;  3RPU A;  1P92 A;  2VOD A;  2JSC A;  3MQ0 A;  3HOS A;  4A0Y A;  1GXQ A;  1K6O A;  2L4A A;  5JFR A;  3I59 B;  3J81 Z;  3IRR A;  3SHF A;  3TKY A;  4M9X A;  1VTN C;  3QP6 A;  1Z9C A;  3ZN0 A;  2F2E A;  5DUI A;  3JSP A;  2K02 A;  5DEQ A;  4PDK A;  3GYH X;  2J5P A;  4UXN A;  2Y75 A;  2HTJ A;  2FA5 A;  4KMU X;  3L7W A;  1GXP A;  4HF1 A;  1OYI A;  1FX7 A;  3HHG A;  3H3U A;  5F64 A;  4LJZ F;  5LBQ A;  1UHM A;  3FM5 A;  3GVA A;  2ISZ A;  4WXH A;  2VN2 A;  3HOT A;  5FGM A;  3W6J B;  4HBL A;  1OR7 A;  2CW0 F;  1K79 A;  3GF2 A;  1MDM B;  1R22 A;  2LF7 A;  2KJB A;  3FHZ A;  3C3W A;  1PUE E;  3REO A;  3BRO A;  1JE8 A;  4IXA A;  1MZB A;  3F22 A;  2DBB A;  1QPM A;  4Z2Y A;  3GZ5 A;  1RZ4 A;  1D5V A;  2C6Y A;  4UNO A;  2DI3 A;  3GEZ A;  2PMH A;  2Q2E A;  3TO9 A;  3RDI A;  1KGS A;  1ZAO A;  3IC7 A;  2A6E F;  3SXY A;  5D5U B;  1UFM A;  5DV5 A;  4PGG A;  2PEX A;  3E6M A;  2A61 A;  2COM A;  1FBU A;  2E1N A;  2ZCW A;  4CDG A;  3U9G A;  3ECO A;  3R6S A;  2Q0O A;  2F5D A;  3GFI A;  1IF1 A;  2YU3 A;  3DXJ F;  1IUY A;  1J5Y A;  1RNL A;  4ESB A;  5CYV A;  3PQJ A;  4BNC A;  1SD4 A;  4IF4 A;  3E6B A;  1E2X A;  4EJV A;  3F6V A;  1IN7 A;  4HV5 A;  4LLG F;  4CHU A;  2Z33 A;  2NNN A;  1YG2 A;  1ZYR F;  5J8C A;  3ISP A;  2RVC A;  2E1C A;  3K69 A;  4G9Y A;  4IRG A;  3U1D A;  3PQK A;  2QQ9 A;  2CO5 A;  2OQG A;  4A0Z A;  3SZT A;  2ETH A;  2A69 F;  3F23 A;  2XKP A;  2QBY B;  3P9K A;  3FMR A;  2XAF A;  4IRI A;  1R58 A;  4EJW A;  1FYK A;  3IWF A;  1HQC A;  1B4A A;  5CVV A;  4XLP F;  1T6S A;  3ELK A;  2V1D A;  2F5C A;  4M9S A;  1GHC A;  1G3Y A;  2RDP A;  1UB9 A;  1ZRC A;  3WU1 B;  1JHF A;  2HYF A;  5F1R A;  4L5J A;  4FX0 A;  3CLO A;  1U5T B;  3K9T A;  1EV7 A;  4KA4 A;  4L9T A;  3MWM A;  4GO1 A;  2A5Y B;  1YYV A;  2BGC A;  3K1N A;  1K78 B;  4LGW A;  4L9J A;  3ZMV A;  4UUV A;  3HTS B;  4IJA A;  1MKM A;  3DP7 A;  2STW A;  4P9F A;  2F5F A;  4G8X A;  3BDD A;  2DU9 A;  1P4W A;  4RGR A;  4I7H A;  1SFE A;  5JHU A;  2HS5 A;  1RUO A;  3Q9S A;  4R1H A;  2EK5 A;  2P6S A;  3KP2 A;  3KET A;  2G7U A;  4I0A A;  1G3W A;  4HW0 A;  2HFH A;  4RGS A;  1U5T C;  1HW2 A;  1W7P D;  1TNT A;  2XVC A;  4ZZL A;  4DNC A;  4M72 A;  5E1W A;  3WE2 A;  2FE3 A;  2VE9 A;  3BY6 A;  4ESF A;  1SFX A;  4LB5 A;  4O3M A;  2MLG A;  4L9N A;  4JQF A;  4MEX F;  4L9V A;  4ENN A;  5KK1 A;  1U6G A;  2O6G E;  3H3Z A;  4KNY A;  2IP2 A;  4LB6 B;  2PJP A;  2OZU A;  2K4J A;  3CDH A;  1HXD A;  5DCM B;  3OV8 A;  2L01 A;  2Z5U A;  2H6B A;  3V8J A;  2JPC A;  2IA1 A;  2STT A;  3F3X A;  1R1T A;  4RS8 A;  3VOE A;  4P55 A;  4MHG A;  2DAO A;  4ZYE A;  4EMS A;  4WXC A;  1G6N A;  1X3U A;  3J80 K;  1TBX A;  3BP8 A;  1REP C;  3WGG A;  3K0L A;  5HOO A;  3QPH A;  2CWE A;  2QQB A;  4RGX A;  4GYI A;  3N4M A;  1S7A A;  4HQM A;  2EFN A;  4B09 A;  5D5V B;  1IN4 A;  4Y17 A;  3LA7 A;  2V1X A;  1S6L A;  2F5E A;  2ZJ2 A;  1J9I A;  1ZH5 A;  4U88 A;  2R7D A;  2YR2 A;  3I71 A;  4BAY A;  5BQT A;  1ZLJ A;  4IHT A;  3MFK A;  2DO7 A;  4FX4 A;  3S2W A;  3LAP A;  4MTD A;  3M1E A;  2PG4 A;  2OBP A;  1RUN A;  4I98 B;  1PP8 F;  1SAX A;  2MA3 A;  3JTG A;  1I1S A;  4AIH A;  4IRH A;  2B0L A;  1ZG1 A;  1O57 A;  3KFW X;  1G3T A;  3QP5 A;  5K1Y A;  5LGN A;  5AON A;  3HUG A;  2QLZ A;  2XAG A;  1OKR A;  1V3F A;  3WG9 A;  3NRV A;  1FY7 A;  3KLO A;  5E8G A;  3F8N A;  1FLI A;  2KJC A;  3P9C A;  3AAF A;  2EV5 A;  3MAJ A;  5ILU A;  2OU2 A;  1HBX G;  1C0W A;  4EM1 A;  4P96 A;  5LHH A;  2A6H F;  3QU6 A;  2W57 A;  2WWY A;  1IXS B;  1LDK B;  2RQP A;  4GXO A;  4N0B A;  2PLY A;  3GFL A;  4Q47 A;  3EUH A;  3T8R A;  1STZ A;  3WTY C;  4O5V A;  3NEU A;  1ZRD A;  3ZP5 A;  3NQO A;  2DK5 A;  1AOY A;  2A3S A;  3CO6 C;  5DD8 A;  1XGM A;  3KP5 A;  5FLX K;  2XRO A;  2M1B A;  3FMS A;  4KT5 C;  1T2K A;  3KP7 A;  1XN7 A;  2XAQ A;  4KN4 X;  1TW2 A;  3QRF F;  4Q5S F;  5IT9 Z;  2FF4 A;  2W24 A;  2VC0 A;  2VBY A;  2UXX A;  3WTU C;  4ESJ A;  1DPU A;  2X4H A;  2DLL A;  2Y48 A;  3F8M A;  2GXG A;  1O7L A;  3ZMT A;  1L0O C;  4L18 B;  2KIU A;  2H6C A;  1XCV A;  2ZFW A;  3F21 A;  4I2O A;  2E7W A;  1YFH A;  4A6E A;  2LKP A;  4MTE A;  1Z1D A;  5ICE A;  3F6O A;  4KDP A;  4Q48 A;  2GIV A;  4CO8 A;  2LF8 A;  1W7P B;  2M45 A;  1H9T A;  5A2Q K;  5K5O A;  1XDU A;  4EVI A;  3CO7 C;  3KLN A;  2ACJ A;  3RI4 A;  3ML6 A;  3KP6 A;  1SMT A;  1YS7 A;  2QEN A;  5HS7 A;  5D4R A;  5D6E A;  3DPT A;  4B8X A;  3WOD F;  3LWF A;  3KZZ A;  4YG2 F;  3RPQ A;  4Q4Z F;  3GFJ A;  5CVJ A;  3JAM K;  1UHW A;  5E17 F;  4WX9 A;  2VBZ A;  5LLQ A;  4M9Z A;  2ISY A;  2R3S A;  1XGN A;  3ERE D;  1HKQ A;  1ZLK A;  4LG0 B;  5E1Z B;  1B9M A;  4KYW A;  3SQN A;  3MCZ A;  1YQA A;  2TDX A;  4RAY A;  3WTS C;  5FD6 A;  3D5L A;  4YFK F;  2GA1 A;  4EGZ A;  2NS0 A;  2KKO A;  2V9V A;  5L3C A;  1TW3 A;  2QYO A;  3TOA A;  3N97 A;  2VOP A;  4HYE A;  4P5O A;  3B73 A;  2FXA A;  2FRH A;  1EH7 A;  2DFI A;  2O03 A;  1LDJ A;  2AS5 F;  4NB5 A;  1JXS A;  1P2F A;  1XB4 A;  5BPI A;  2NNY A;  3VB2 A;  1BBY A;  1ONV A;  3DF8 A;  2J5O A;  3G3Z A;  3CUQ A;  3BJ6 A;  4MQ9 F;  2JRT A;  2P5L C;  3I54 A;  2DQR A;  3L9F A;  2EFQ A;  2MC3 A;  4U7D A;  3ABU A;  5LEJ A;  2H27 A;  3TDU C;  2XIG A;  1IRF A;  3JSO A;  1R5H A;  1SFU A;  4RB0 A;  5DCF A;  1GVJ A;  1B9N A;  2Y0M A;  1IXR C;  2CFX A;  2EV6 A;  4OIR F;  1I5Z A;  1F9N A;  3P9I A;  1Z05 A;  3M9A A;  4N9H A;  2GWR A;  1U8R A;  1WSU A;  4YII A;  3T5X A;  2PBI A;  3FXR A;  2JTV A;  4GYG A;  3E97 A;  2QVO A;  5TJJ A;  4CZZ A;  2IW5 A;  2NYX A;  5LHG A;  2DK8 A;  3VEP A;  3LAJ A;  4N9I A;  1T38 A;  3TO6 A;  1R7J A;  2P5V A;  2RN7 A;  3JW4 A;  3O3K A;  2ZO4 A;  1TQM A;  2D2W A;  1G4D A;  5JI6 A;  3SZP A;  2HYG D;  4G7O F;  4EM0 B;  3R61 A;  4OIN F;  2CSO A;  2WTE A;  2W25 A;  1FYL A;  2IA0 A;  5FB2 A;  4BH9 A;  2EV0 A;  3O2P E;  3WTZ A;  5K5R A;  4A0X A;  4RB3 C;  2UXN A;  1BM9 A;  1L3L A;  5DUK A;  3GXO A;  1EH6 A;  3Q9V A;  4G6Q A;  3ZMD A;  3GO5 A;  3C1D A;  1FBQ A;  1I6X A;  1MD0 A;  4EQQ A;  3V4G A;  2V1U A;  2DW4 A;  3WGH A;  4CXF A;  4U0W A;  3WU0 A;  5FO5 A;  2K86 A;  5CVI A;  4A2U A;  3E6D A;  1KYW A;  1YIO A;  3ROU A;  5H20 A;  1XSV A;  5D5W B;  2WC2 A;  4MEY F;  1D8K A;  5ED4 A;  4FT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...