5E20A

Crystal structure of the organohalide sensing rdhr-cbdba1625 transcriptional regulator in the 2,3-dichlorophenol bound form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
169
structure length
169
Chain Sequence
LEVLFQGPNEFETLELEHLLWVNITQVKHSIERAWTRELKSLNLSTEKFAILHELMCLGGESTPHTLARRIVFEPHSVSAIVSRMEKDGLIIKTKDLDKKHMVRIKLSEKAIDTFYQALEISNRVYKQMMASITREEKVELSKTLTKLRNHTLPLTHKHTKTLTPFKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structures of RdhRCbdbA1625 provide insight into sensing of chloroaromatic compounds by MarR-type regulators
rcsb
source organism Dehalococcoides sp. cbdb1
molecule tags Transcription
total genus 59
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5e20A00
1IW7F 2JRTA 5K1YA 2IT0A 4L9TA 5L3GA 1R58A 5L3DA 3W6JB 3RKWA 3BOQA 4HA8A 1W7PB 2VN2A 1I6XA 4HV6A 1T39A 3ISPA 3FWEA 2CFXA 2KJBA 3DQVC 1BM9A 5FLXK 1MDMA 3LSTA 4L5IA 1MGTA 2M30A 3RTRA 2PBIA 1S7OA 3CO7C 4WF2A 5BOXA 5JFRA 5DEQA 1WI9A 4YFNF 1LQ1A 4EQQA 2F5FA 1X3UA 3LAPA 3IRRA 4K2EA 3F23A 4YIFA 3AAFA 1B6AA 2FE3A 1J9IA 3K0LA 5HDKA 1KU9A 2HTSA 1EH6A 4LGWA 3REOA 5DDGA 2ZJ2A 5HS7A 1I1SA 5LGUA 1XMKA 1FYLA 1LEBA 1G4DA 5LGNA 5L3FA 4HF2A 2GWRA 4WX9A 2WV0A 3GO5A 3KZYA 2TDXA 4P55A 3IC7A 4KDPA 2JPCA 1DPUA 2L4MA 4ASNA 4EM2A 1R1VA 1P2FA 2A61A 1HW2A 2E1CA 3MQ0A 2RC4A 1Z9CA 2EV0A 4M71A 2X4HA 3EDPA 3Q9VA 1P4XA 2DPDA 1BOAA 4LLLA 3MWMA 1SD5A 1EV7A 2WC2A 4A5NA 2RGVA 3D5LA 3IHUA 3BWGA 2VC1A 5HLIA 1R23A 4UNOA 3HRMA 1W4MA 1ZYRF 2EFWA 1G3TA 4U7DA 4CYDA 2QZ8A 1JGSA 4I0BA 1WWXA 2MC3A 5E1ZB 2FMLA 4BHBA 4BH9A 3ECOA 2COMA 4KT5C 2IW5A 1O57A 3CUQC 3J81Z 2JPBA 4QWQA 1ZHFA 1K78B 1S8NA 2CYYA 1JE8A 3BPXA 2XKOA 1S7AA 2OZ6A 2MH9A 3ELKA 1Z1DA 1IXRC 2D1VA 3WGGA 3FXRA 4G6QA 4RB3C 4EGZA 5IT9K 2CW0F 2V79A 2P5KA 4GO1A 5J6XA 2BBYA 1IAWA 4KIFA 3LA2A 4U88A 5DUIA 3ULQB 3F3XA 4ZYEA 4G7ZF 2EK5A 3RI4A 2ZKZA 2QBYA 3BROA 3P9KA 1LB2A 4UVAA 2O61A 4P5OA 3I5UA 3JAMK 2EFQA 4AIKA 1LNWA 2K86A 4BXUA 3RKYA 4L9VA 1BN5A 2YSRA 1LDDA 1WRJA 2HKXA 3RPQA 4EJUA 2ZNYA 4EJVA 4LLNA 1ZG5A 4FT8A 2FEZA 3LA7A 2M5WA 2ETHA 4S04A 1IN6A 2L4AA 3CUQB 1KU3A 2PMHA 5E20A 3LWFA 3KFWX 3MCZA 5ILUA 4L5JA 3JSPA 3DXJF 3BJOA 3O3KA 5BPIA 4I09A 3C1DA 3QU6A 3KE2A 1TNTA 3WE3A 1R36A 4RGUA 1YS6A 1S3JA 5EEGA 4L18B 1GXPA 2G7HA 2HOEA 5CVJA 2FBHA 3OV8A 4NQWA 3HOSA 5JVTA 1KU7A 2L3DA 3RKXA 2EV6A 2FXAA 1F9NA 4BYYA 2L54A 1KQ8A 4KMFA 4ZYHA 4B09A 4O3MA 2RN7A 3S2WA 1YO5C 2DFIA 3GUDA 3QPHA 3G3ZA 4M9XA 5E17F 2YPRA 1J0RA 3FXQA 2VT2A 5DCMB 4Y13A 2KKOA 3D0SA 5E1XA 3CTAA 3V8JA 4JK1X 2UZKA 2D45A 3T0YA 3WU1B 4P96A 1ZREA 2LDUA 2XROA 4P9UA 1QQIA 1SD6A 4ENKA 2HFHA 4UHTA 1IZ1A 1TTYA 1H0MA 2BV6A 2FA5A 2XV4S 3LFKA 1A04A 1UB9A 2ELHA 4IF4A 3SXYA 4BQAA 4M6XA 3RYPA 4MQ9F 4LD5A 5LHIA 5F64A 5F6FA 4JBAA 3ZMUA 2M1BA 3PQJA 4L9NA 3M8EA 5A2QZ 1S6LA 5ICGA 3KP5A 1R5GA 3R6SA 3N4MA 4XLPF 3E6DA 1ZG3A 3FX3A 4GXOA 4KICA 3MAJA 4RAZA 1K6OA 3U2RA 2Z3YA 3DEUA 1STZA 1IXCA 2EFOA 1OR7A 2VOOA 3ECHA 3EYIA 1FPQA 5K5RA 1U6GA 2F2EA 1YFHA 1ZH5A 3LQQA 2BGCA 4XRFA 2LF8A 1PP7U 4EMSA 4YFKF 1U5TA 2CG4A 4NHJA 2GXGA 4A6EA 5D5UB 3IKVA 4G6DA 1BIAA 2H6CA 3K2ZA 5D8LB 3M7GA 2Q0OA 4Q4ZF 1FP2A 5BPDA 4XSXF 2GXBA 3GZ5A 2V1XA 3N97A 3ZMZA 3L7WA 1W5SA 1XD7A 4UV9A 1IN5A 3LQRA 2VC0A 1WQ2A 4WK8F 5DUKA 5LEJA 3TO7A 4IRIA 2PJPA 2OQGA 3DFGA 3CLOA 1SD7A 5D5XB 1ZARA 3ZP5A 3E6MA 3FMSA 2K7LA 3J80Z 5LLQA 3HYIA 5ICFA 4EM1A 2RV8A 1TQMA 2STWA 3M9AA 5FFXA 4O6JA 5DD4A 4EJTA 3DP7A 2QVOA 1XDUA 3WG9A 2A6HF 3M8FA 2FBKA 4PZJA 1HKQA 4XSZF 4ZYDA 3KZZA 2MLKA 3GWZA 1SAXA 2GAUA 3RYRA 4LFUA 3F8BA 2B0LA 2OA4A 4BNCA 2E1NA 1I5ZA 2P6TA 1LDJA 2QQBA 4WXCA 2W84A 5LGTA 5L3BA 1YTYA 1T98A 3GEZA 4O5VA 2MH2A 2NS0A 2LNBA 2ESNA 3E6CC 1MDMB 1CF7B 2O03A 3E5XA 1OMIA 3SZPA 4G9YA 3FM5A 1W7PA 3HSRA 4MQVA 1O7LA 5BS6A 3WTXC 2J5OA 5AIQA 4RB2C 1LJ9A 1O3RA 2JSCA 1HQCA 3E5QA 5FLXZ 2RNJA 3TOBA 4A0ZA 4DNCA 2RKHA 3WU0A 1HBXG 2QLZA 3R4KA 3HIFA 3F8CA 3NEUA 2V9VA 2P8TA 1SMYF 4ETSA 3SHFA 3MZYA 3TOAA 1OYIA 4ESFA 1P4WA 1SFUA 3H3ZA 5E18F 2GA2A 4BAYA 1QO0D 1XSVA 2PQ8A 4LJZF 4ENMA 4A12A 1BI3A 1QGPA 1XGOA 2EFNA 1IN7A 2Y0MA 4IJAA 4OIPF 2V6CA 1JHFA 2BYVE 2A68F 3RJPA 3FZVA 1KGSA 1YW9A 2QENA 1XSDA 2CO5A 1HW1A 2VBYA 4I0AA 1FY7A 2AS5F 1BC8C 3HUGA 2V1UA 2HR3A 2W85A 4M74A 3T1BA 2M87A 4N9HA 1ZN2A 4U0WA 3GZ6A 1F1ZA 3KCCA 1SFXA 1RUNA 2K4JA 4A2UA 2G9WA 3SZTA 2FSWA 1O3SA 2HYFA 2ISYA 3W6KB 2P7CB 4HAMA 2HQRA 4GGGA 2X0LA 3I54A 4U0VA 4CICA 1ZG1A 3KP2A 2UXNA 1TNSA 1R5HA 2NRAC 2LF7A 3ZMVA 3PQKA 5D4RA 1Z05A 2PG4A 4OIOF 5CVUA 4ENNA 1XMAA 3TGNA 1R1TA 4HV5A 1OYWA 1H9TA 2XVCA 5FGMA 1BI2A 2EA2A 2VODA 3VOEA 3E5UA 4KN7X 2DQRA 4EJOA 2NAZA 1S29A 5L3EA 3RPUA 1K78A 1I27A 1HKTA 5E8GA 4MTDA 1DPRA 3C18A 1LDKB 3F6VA 2UWMA 3K1PA 4AWXB 1H9GA 2QBYB 3R0AA 2DW4A 3BDDA 1GXQA 2O6GE 5H20A 2IRFG 1IXSB 3J7AO 1J7KA 3NQOA 4HLYA 4I98B 5ICEA 1ZLKA 2YX4A 1PUEE 1WKMA 5H6QA 5IT3A 3O6BB 2FRHA 5CLSA 3BZ6A 3BPVA 3QPTA 5CVIA 1TW2A 3GFMA 1P4AA 2QM3A 3OOPA 4KMUX 3DKWA 3QP6A 1QZYA 2NYXA 1GVJA 2HWVA 2XAQA 2HKOA 5CVRA 4Q47A 1E17A 4IVNA 3IKTA 4LB5A 2WTEA 2HEOA 3CUQA 3GF2A 2NNYA 1RUOA 4CZZA 1BI0A 2PN6A 1AOYA 3E6BA 1L0OC 4A5MA 5CJ9A 3WTYC 1HW5A 2CQKA 2Y48A 1LEAA 4YIIA 2EWNA 2JT1A 3BJAA 2IA1A 2VONA 4HW0A 1Z6RA 5H6RA 4RB1A 5FO5A 1YQAA 2J5PA 5JI6A 2XGXA 3BJ6A 3KEQA 1U5TC 3BY6A 2PI0A 3HRSA 1XCVA 2DBBA 3DV8A 1FOKA 1P6RA 3I59B 3R60A 5FB2A 1R1UA 3U1DA 2H27A 3CO6C 5LHGA 5LEKA 2V1DA 1G6NA 2GQQA 4AD9A 1RNLA 3JW4A 5JHUA 4DQ2A 5J8CA 2A3SA 3MEXA 2OU2A 4ESBA 1FYKA 1T2KA 1O3TA 4XLNF 2OAZA 1JHHA 1SFEA 2GA1A 5ED4A 4PCQA 5A2QK 4HDUA 3I71A 1USSA 3NRVA 2FMYA 3EUHA 3JTGA 5DV5A 1D8KA 2PMUA 2W24A 2HQNA 2VE9A 3C3WA 2IJLA 3ML6A 3TDZC 1MJ9A 1KU2A 2ZBKA 5AIPA 4ON0A 2VT3A 2XASA 1T38A 4LB6B 3GXOA 2DTRA 4BHPA 2YR2A 1FX7A 4RGSA 1DUXC 4HX7A 3VODA 1KQ9A 4KA4A 2A69F 1FP1D 4IHTA 4LLGF 1O7FA 1Y0UA 4S05A 2A5YB 3F8NA 1B59A 1Z6TA 1U5TB 3I4PA 5JR3A 1VTNC 3ZN1A 4I2OA 1FT9A 4A0YA 2ZFWA 5AONA 2PFBA 4UXNA 1T0FA 3C7JA 1UFMA 4KIBA 4MNUA 3L09A 1EH8A 2HYGD 1ON2A 1K7AA 2VBXA 4TV7A 5DCFA 5CVVA 4CHUA 2O8XA 1DDNA 2DK8A 2QUFA 2KIFA 1ONVA 2ZMEB 2DPUA 2PLYA 4U0YA 2KIUA 2P7VB 3IRQA 4HOBA 1ZAOA 4UVBA 5TRDA 3R0JA 4FHTA 1G3WA 1FBSA 4LG0A 3J80K 1XGMA 3GFLA 3IWZA 1JXSA 3DF8A 3VEPA 1FZPB 4L9JA 1J75A 1U2WA 2M45A 4QLCU 4HYEA 3M1EA 2IVMA 1EH7A 3K9TA 2PEXA 4RGRA 1ULYA 3R61A 1V3FA 3BP8A 2ESHA 2HS5A 3LA3A 4OINF 3T8TA 2GZWA 3KLOA 1DP7P 2DK5A 3L2CA 3DPTA 3WTSC 3E3VA 2ZCWA 1L3LA 5K5OA 3TQNA 2W57A 3WTUC 4LMYA 3IWFA 1ZGJA 2DLLA 1SD4A 2FNAA 2VE8A 4OIQF 2CWEA 5EEHA 1D3YA 5D6FA 2DO7A 1UCRA 4RGXA 5LHHA 4ZYGA 1IRGA 3V7RA 3KP3A 3EQLF 3L00A 1ON1A 3VFZA 2Z5UA 3P9CA 1CGPA 3ZQ7A 3L9FA 4G94A 1XN7A 1IUYA 1FNNA 2IA0A 5E8IA 1FSEA 1ZRFA 5KK1A 2DQLA 3ROUA 1I1GA 3ZMSA 2RVCA 2VBWA 4Y17A 1FC3A 1Z91A 4WXDA 3ABTA 3HSEA 5HS8A 3JTHA 5CYVA 1PDNC 5HLHA 2LSOA 1R00A 3V7SA 4H0EA 4YG2F 3GFJA 2LKPA 1CF7A 4ESJA 1HKSA 3KEOA 1B1BA 3H92A 3RDIA 4WXHA 3P7NA 3V8KA 4MEXF 4HZFA 4HF0A 4MTEA 1QBJA 2E7XA 3JSOA 4OIRF 2QWWA 1F4KA 4GCVA 1B9MA 4F7ZA 4M9ZA 2ISZA 3IL2A 4PGGA 3F21A 1D8JA 6PAXA 4A6DA 2FOKA 4HLXA 1FBQA 2FU4A 4Q48A 1J2XA 3MFKA 4AIHA 3SQNA 2IPQX 5HDGA 3K1MA 3GFIA 3FMQA 2L02A 1XGSA 3O2PE 1BJAA 1TW3A 1B4AA 1YLFA 4L0YB 1G3SA 1FWZA 1TBXA 1BIBA 3GX4X 4PDKA 5L3CA 4N0BA 2XHKA 4KIGA 2R7FA 1YIOA 5D4SA 3F22A 4A0XA 3ERED 4HBLA 1ZGAA 1D5VA 2BE5F 4CO8A 2KIMA 1W7PD 1FYMA 2XAGA 2STTA 3WTTC 3F72A 2H09A 5TJJA 5KVRA 4I7HA 2EB7A 1XGNA 1Z7UA 2K4BA 3FHZA 4RS8A 4ZH4F 4KFCA 1XB4A 2Z9OA 1NHAA 3K1NA 4LK1F 5J8FA 4I01A 4JQFA 1OPCA 2A6EF 5K5QA 3J81K 1HSJA 1FBUA 3F6OA 2BEOA 2FF4A 3WGHA 2JZYA 1UHMA 3Q9SA 4BHCA 4OMYA 2XRNA 4U7BA 2FNPA 4ZZLA 3FF5A 1RZ4A 2EV5A 4MGRA 5ICCA 1USTA 1V4RA 2AXLA 4IRGA 4WWCA 3HTSB 4M72A 1KYZA 2MA3A 4M6YA 3GVAA 3WTZA 2WWYA 4EGYA 2ZNZA 4OMZA 2Z33A 5BMZA 2OZUA 5DYMA 3U9GA 5E1WA 2D2WA 1KYWA 2O0YA 2FQ3A 3T5XA 3ABUA 4CGZA 2FBIA 3HTUA 4MEYF 3HRUA 3RIRA 2VBZA 5IT9Z 4AIJA 3QP5A 2IA2A 4HQEA 3F8FA 3KP7A 5LRSA 1U78A 3HOTA 2K02A 3ZMDA 3V8LA 4HDVA 4CXFA 2H6BA 1WSUA 2DAOA 2P4WA 1MKMA 2XIGA 4HQMA 1FSHA 3QAHA 1U3EM 2QQAA 1O3QA 1F5TA 4WCGA 1MZBA 3JAMZ 2XAHA 4ZZDA 1QNTA 3ZPLA 3GYHX 2F5DA 4R8HA 1YYVA 4Z2YA 1XDSA 4UV8A 1K79A 4YFXF 1BC7C 3WTWC 4M9SA 4MHGA 2MBFA 2P6SA 5DD8A 4RAYA 1R7JA 5F1RA 1MJAA 5HS9A 2Q8KA 3HHGA 2IP2A 2DI3A 2EA4A 2OBPA 1IN8A 1REPC 1ZLJA 2GIVA 2XKPA 5ILVA 4KNYA 4NB5A 2F5CA 2ZO4A 4UVCA 1QZZA 3WGIA 1LVAA 2YU3A 3E97A 2Q2EA 5ILSA 4B8XA 2OQRA 4IHSA 2G7UA 1QPMA 4FX4A 1IF1A 2NNNA 3KP6A 3QRFF 3GLXA 2JTVA 5HVQC 4HF1A 4HX8A 4OOIA 2E7WA 3GW2A 2EFPA 4EV0A 2A07F 2L01A 2RDPA 5D8KB 3I53A 1Q1HA 4EVIA 1UHWA 1YW7A 3EYYA 1OYYA 3EETA 5DCMA 1RIOH 2Z99A 3PFIA 1RI7A 3KETA 2O3FA 3I59A 4L0ZB 1BI1A 3TDUC 3ZMTA 4IRHA 2QQ9A 2UXXA 4KN4X 4KYWA 5FFZA 3MZHA 1J59A 3I58A 3FM3A 5D6EA 3SFZA 3G73A 2CGPA 3HHHA 3FXUA 3P9IA 2ADUA 1IRFA 2F5EA 1IN4A 3T8RA 4CDGA 1OKRA 1TQPA 4GYGA 3I64A 2OD5A 5HLGA 4R79A 4ENJA 2DT5A 2EJRA 2VOPA 2XUBA 1HXDA 4UUVA 1W5TA 1U8RA 4LK0F 4AVPA 2P5VA 3ZN0A 4Q5SF 2DU9A 2H94A 2ZXJA 4FX0A 1MD0A 3V7CA 2R3SA 4M73A 3TO6A 1R22A 1SMTA 2D1HA 1FLIA 2Y75A 1P92A 2CSOA 2HGCA 5HDNA 2ACJA 2W25A 3HRTA 4G7HF 2YX7A 1ZRDA 5LBQA 5LRRA 3Q5FA 2VXZA 4N9IA 2K27A 2P5LC 3HSFA 1MJBA 4PGHA 2C6YA 3WTVC 3I0TA 2M8EA 3H3UA 4RB0A 1TLHB 1YG2A 3TKYA 2HTJA 1TQIA 1XSXA 1T6SA 1BBYA 2KJCA 4XBFA 2MD5A 1E2XA 3VB2A 3DPLC 1KQ0A 2MLGA 2QYOA 3CJNA 4G7OF 4E70A 4G8XA 1HSTA 3B73A 4LG0B 5BQTA 1J5YA 3V4GA 2HDCA 2KRFA 2ZMEA 5D5WB 4I02A 1G3YA 5HOOA 3TO9A 3CDHA 1ODDA 3FMRA 2HZTA 4EJWA 4IPAA 3KP4A 2XAJA 3F8MA 1XCBA 2RQPA 3CUOA 4Y15A 4HX4A 2XAFA 4GYIA 3WE2A 5FD5A 5FD6A 3K69A 3QOPA 1PP8F 1C0WA 3LAJA 4P9FA 5ERIA 1YS7A 1KA8A 1YW8A 1GHCA 3WODF 3COAC 4OU0A 3KLNA 4IXAA 2R7DA 4D0PA 1AWCA 1B9NA 5D5VB 3QU3A 3B02A 4R1HA 1ZRCA 4KUMA 4EM0B
chains in the Genus database with same CATH superfamily
1IW7F 2JRTA 2LFBA 3BC8A 5K1YA 2KDZA 1K83J 1UHSA 1X1DA 3I4NJ 1W0TA 2JA2A 2IT0A 1QHHD 4L9TA 1ENHA 2L7FP 5L3GA 3Q0VA 1R58A 1V54H 5L3DA 3GTMJ 2L9SA 1UJ8A 3W6JB 2HYJA 3RKWA 2GIZA 3BOQA 4HA8A 5EG0B 2L9RA 2RREA 2WY8Q 5F1JA 3S15J 1W7PB 2VN2A 1DGRM 1OFCX 1I6XA 3RZDJ 4HV6A 5F27A 4XICA 3MMYB 5HNHA 2WV1A 4YIRX 2VQHA 1IGNA 4FE7A 5F08A 1T39A 3ISPA 3FWEA 2CFXA 2KJBA 3GBGA 5FKNA 2EZIA 1BM9A 3DQVC 5FLXK 1MDMA 3LSTA 4L5IA 1MGTA 2M30A 3RTRA 2PBIA 3SJMA 1S7OA 2MYSA 3S1NJ 3CO7C 4WF2A 5IP7J 1MSEC 3JRCA 5BOXA 2K3PA 2FUG2 3CCMI 5JFRA 3VSLA 2JQ7A 2ICWG 2VLAA 2HDDA 5DEQA 4PSWA 1WI9A 4UB6C 4YFNF 1LQ1A 2DMTA 4EQQA 2F5FA 4OAYA 1X3UA 3LAPA 3IRRA 4K2EA 4BE1A 4ZC3A 5IP6A 1HA8A 1PUFA 1MMSA 2E36A 4YIFA 3F23A 3AAFA 2M0MA 1B6AA 2FE3A 2AXTC 1J9IA 3TBIA 2GXAA 3K0LA 5HDKA 1KU9A 1MBFA 3DU5A 3AG4H 4F91B 2HTSA 3HGYA 1EH6A 4LGWA 1WJFA 2B63J 2IBDA 3REOA 5DDGA 3QQAA 1TWHJ 2ZJ2A 2ZB9A 3CCQI 4B43A 1VQMI 5HS7A 1I1SA 2VKDA 5LGUA 1XMKA 2DJIA 1FYLA 1LEBA 1G4DA 5LGNA 5L3FA 2OJED 4HF2A 2KRHA 2GWRA 3ASOH 2R92J 2M34A 2XF7A 4WX9A 2IS4A 1A6IA 2BW3B 4XOTA 2ZJPF 2WV0A 3CMYA 1MMNA 3GO5A 2XPUA 2QKLB 2P0WA 3KZYA 3S1MJ 5E79C 4XKCA 2TDXA 4P55A 3IC7A 4KDPA 3PNYA 2JPCA 3HUGB 3M4OJ 1DPUA 2L4MA 2EZHA 4ASNA 4EM2A 3CD6I 4QPQA 3CJTB 2WBMA 3KYLA 2BVMA 1R1VA 1P2FA 2A61A 5KAFC 1HW2A 2E1CA 3MQ0A 2O8KA 2RC4A 1Z9CA 1IRZA 2EV0A 4M71A 2X4HA 5EZGA 2KZVA 3EDPA 3Q9VA 1P4XA 4PFOA 2DPDA 2EZKA 3CC7I 1BOAA 1U9NA 2DDAA 4LLLA 1A36A 2WAQA 3OYLA 3MWMA 3CCRI 1SD5A 1EV7A 2QCOA 2WC2A 1WJ5A 4A5NA 2RGVA 3D5LA 2LG4A 2K9QA 3BQYA 2V26A 3IHUA 3BWGA 3K4MA 2VC1A 5HLIA 4ZTFA 1R23A 2HPMA 3HRMA 3DTKA 4UNOA 1W4MA 1ZYRF 2EFWA 1XMXA 3OYGA 3QPLA 2E5ZA 1G3TA 4U7DA 4CYDA 2QZ8A 1JGSA 4I0BA 1WWXA 2MC3A 5E1ZB 1QRYA 3SDBA 3A03A 2FMLA 5BNGA 4BHBA 2JN6A 4BH9A 3ECOA 3CCJI 2LKXA 2COMA 2X85A 5FLVA 2OCCH 4KT5C 2LD5A 3Q0UA 3MKZA 3HG9A 2IW5A 4PFPA 3A0HC 1O57A 3CUQC 3J81Z 1VQPI 2JPBA 4QWQA 1ZHFA 2CU7A 1K78B 1S8NA 5EEAA 2CYYA 1JE8A 1HDPA 4Y3OA 4BEHA 3BPXA 2CFOA 2A5WA 2NXNB 2XKOA 1I3QJ 1S7AA 3OWTA 1B8IA 2O7OA 1HDDC 2OZ6A 3U21A 2MH9A 3ELKA 1Z1DA 1X4OA 1IXRC 3BG3A 1X2MA 2D1VA 3GTQJ 3WGGA 2W48A 1LFPA 3EUAA 1EKEA 3FXRA 4G6QA 4RB3C 3CMEI 1V5EA 4XNFA 4EGZA 2DYSH 2CUZA 1MNMC 5IT9K 1T33A 2CW0F 2V79A 2P5KA 3PSIA 1Z77A 4GO1A 5J6XA 2BBYA 1IAWA 4KIFA 1ORKA 3WU2C 4CSWA 3A4CA 3LA2A 4U88A 3NWTA 5DUIA 4LIVA 3ULQB 3F3XA 3LSKA 4ZYEA 4G7ZF 4PJLA 2EK5A 3RI4A 1MMAA 2ZKZA 2YS9A 3IV5A 3BROA 2GOXB 2QBYA 1NG6A 2XRLA 3P9KA 3H5RA 1LB2A 1JKPC 3S1RJ 4E7KA 5KNLA 4UY8I 4UVAA 2K40A 2WB1A 2O61A 4P5OA 4BUPA 3I5UA 5EZHA 1HCRA 3K4KA 1EA3A 1MH3A 3JAMK 2EFQA 1LNWA 4AIKA 2K85A 3ZQFA 2K86A 3M07A 4BXUA 2ME6A 3RKYA 4L9VA 2IAIA 1BN5A 2E1MC 2YSRA 2ID3A 1LDDA 2IXSA 1ETKA 2K5CA 1WRJA 2XPWA 3ZGKA 2JUCA 1G8XA 3B6CA 1JUMA 2ELKA 2HKXA 3RPQA 5DTDA 4EJUA 2VXDA 2ZNYA 4EJVA 4LLNA 2M4KA 1ZG5A 1D1AA 3VYRB 1I3AA 4FT8A 2DA3A 2FEZA 3LA7A 4CUGA 2M5WA 2ETHA 2TRTA 4S04A 1IN6A 1ERDA 3SFIA 3EUHC 2L4AA 3CUQB 3IH3A 2JA8J 1KU3A 2PMHA 4EATA 5E20A 2Y0SA 4AYBN 2LREA 2Z1DA 3LWFA 4D7NA 1VQ4I 3I55I 3KFWX 2VJ4A 2L9VA 3MCZA 5ILUA 2XPVA 4L5JA 5EDNA 3JSPA 4A3IJ 3DXJF 3BJOA 3O3KA 4XK4A 5BPIA 2E35A 4HSRA 1MBGA 4I09A 1KZHA 3C1DA 2PJRA 3WHCA 3QU6A 3KE2A 1TNTA 1Y6IA 3WE3A 1VF9A 1R36A 4BE2A 3H1CA 1OCPA 4RGUA 1YS6A 1Y1WJ 1S3JA 5EEGA 1YI2I 4L18B 1GXPA 2G7HA 3CP2A 1LE8B 2HOEA 5CVJA 4II3A 1E0EA 2FBHA 2DT6A 3OV8A 4NQWA 4IOAF 3S3NA 4IX7A 3HOSA 5JVTA 2CQXA 1VI0A 2NVTJ 4XN0A 1KU7A 2JK3A 1U9OA 3FK6A 2L3DA 3RKXA 2EV6A 2LK2A 2R5ZB 3PIPF 2R5YB 2FXAA 1E3HA 1F9NA 4BYYA 5FKOA 2L54A 1KQ8A 1R6RA 4KMFA 3WHBA 5IOYA 1R4NB 4ZYHA 4B09A 4O3MA 2RN7A 4ZJZA 2M8GX 4PSXA 2M4GA 3S2WA 1YO5C 1T0FC 2DFIA 3GUDA 1IJWC 3QPHA 2XB0X 3G3ZA 1FIAA 4M9XA 4M6VA 4HNTA 5F04A 3AG1H 5E17F 2VQLA 2YPRA 4HEA2 3OYCA 2BY3A 1J0RA 3FXQA 2VT2A 3TMOA 2BHZA 4DOZA 2E1MB 1WH5A 5DCMB 4Y13A 3CC4I 2KKOA 1VQ5I 3D0SA 5FJ8J 5E1XA 3CTAA 3GTKJ 1IG7A 3LSGA 3V8JA 5IY5H 4JK1X 2UZKA 4XLHA 5F0FA 2D45A 2CMPA 2CUJA 4FCYA 3T0YA 2NOJB 3CDIA 3WU1B 4CCNA 4P96A 3SEZA 5DM7F 4B1RA 5IPAA 1MNDA 4HG2A 1ZREA 2LDUA 1N77A 4HNVA 2XROA 3QYFA 1BJZA 3H9QA 4P9UA 5FRNA 1QQIA 1SD6A 4ENKA 1WGXA 2HFHA 4UHTA 2MABA 1IZ1A 3BR1A 4DYRA 3RZOJ 2LBFA 1TTYA 4EEFG 1H0MA 2X1EA 2BV6A 2FA5A 2XV4S 3LFKA 5EJCA 1A04A 2CQ7A 3BG5A 1UB9A 2ELHA 4IF4A 3SXYA 4BQAA 4M6XA 2JA5J 3RYPA 4MQ9F 4LD5A 5LHIA 3JREA 4E7SA 1VQNI 3GTLJ 5F64A 1DP3A 5F6FA 4JBAA 3ZMUA 2M1BA 3PQJA 2E2JJ 4L9NA 4LOCA 2QSFX 4J01A 2ZJRF 2F4MB 3M8EA 5CPRB 5A2QZ 3DEWA 4RAGA 4RLQA 1JTXA 1S6LA 5ICGA 5IP9J 3KP5A 4C2MJ 1R5GA 3R6SA 3IAM2 5K7HA 2X6WA 3K4BA 2OPTA 2PMZN 4XLPF 3N4MA 4E7JA 3E6DA 5FKMA 1X3WB 2R7WA 1ZG3A 3FX3A 4DYQA 4GXOA 4KICA 4BDZA 3MAJA 5EF6A 3DBRB 3J7AY 4RAZA 3S14J 3H3VK 1K6OA 3U2RA 2Z3YA 3DEUA 2NVXJ 1LPQA 1STZA 1IXCA 1T8IA 5J1YA 2EFOA 1OR7A 2VOOA 3ECHA 3EYIA 3C2BA 1FPQA 4HSTA 5K5RA 1U6GA 2F2EA 2OCEA 2BXZA 1YFHA 1A31A 1ZH5A 3LQQA 2BGCA 4XRFA 2LF8A 1PP7U 4EMSA 1TWAJ 4YFKF 2VL8A 2NVUB 1U5TA 2R7TA 2CG4A 4NHJA 4HNUA 4C2TA 2IS6A 2ELJA 2GXGA 4A6EA 5D5UB 1ETWA 3IKVA 2E5NA 3BLYA 4G6DA 5J3LA 1BIAA 4H4KC 2H6CA 5EGOB 2X9DA 2W1OA 3OIQA 3K2ZA 5D8LB 1ZTRA 3M7GA 2Q0OA 2K3FA 4Q4ZF 1FP2A 3OYNA 2DCEA 5BPDA 4A3DJ 1GUUA 4XSXF 2GXBA 3GZ5A 4A3LJ 1T56A 2V1XA 1X4PA 4C30A 3CP8A 3PNVA 3ZMZA 5IOZA 3LSRA 3N97A 1LFBA 1DGWY 4CCLA 1RR8C 1R49A 3L7WA 1W5SA 1XD7A 3OIPA 1IN5A 3LQRA 3PL8A 4UV9A 2VC0A 4GDFA 4MFDA 1WQ2A 4W1UA 2VPRA 4WK8F 4XONA 5DUKA 2GBYA 1Y8QB 5LEJA 3NAUA 2VASA 2Y2ZA 1NTCA 3TO7A 4IRIA 2PJPA 2CV1A 3ZQIA 1JJ6C 2OQGA 3ONQA 2DT7B 4J00A 3DFGA 3HXLA 3HOXJ 1D0ZA 3JRAA 5J40A 4ZYAA 3CLOA 3RKQA 3GLLA 2CV0A 2R7RA 1SD7A 1OCCH 2AQEA 4P1WA 1A6QA 3SZGA 4DZPA 5B3SH 5D5XB 4FASD 3DPUA 4FISA 1ZARA 4C3IJ 3E6MA 3ZP5A 3FMSA 2K7LA 3LSJA 4BQOA 3ZQCA 1F43A 3HOYJ 3ZXSA 3J80Z 5LLQA 3HYIA 4XN3A 4LG3A 5ICFA 3JRFA 2XB5A 3GTGJ 3K10A 4CYCA 4EM1A 2OV7A 2RV8A 4E4HA 3BQZA 1TQMA 2STWA 1H89C 3DLLF 1MSFC 3M9AA 3PO2J 4L5EA 1XS9A 4A3MJ 5FFXA 3A02A 4O6JA 1QZEA 5DD4A 1VQ7I 4EJTA 3DP7A 2QVOA 1U0JA 1XDUA 1AKHA 3F0CA 2K9SA 4XRSA 2OF7A 3WG9A 3K2AA 2A6HF 2X6XA 3LSMA 3M8FA 2FBKA 4X6AJ 4PZJA 1HKQA 2BVLA 1YITI 5J47A 4I76A 5E3MA 1MW7A 4XSZF 4ZYDA 2VPLA 2ZC2A 4KT6A 3DTEA 1R9TJ 2V9KA 3KZZA 2MLKA 4A3CJ 2M7BA 1Q1VA 3P5JA 1BR1A 3LSPA 2MC4A 3GWZA 1SAXA 2GAUA 3QOEA 2BXYA 2FD5A 3RYRA 1GT0C 4LFUA 3F8BA 2CW8A 4BACA 2B0LA 2DA5A 2JSPA 2OA4A 2O5RA 3TEDA 4BNCA 2E1NA 1IUFA 1I5ZA 3L2UA 2P6TA 1LDJA 2QQBA 4WXCA 3S3MA 3QODA 2MG4A 4RM3A 2W84A 4MO7A 5LGTA 3JR9A 1TT0A 3BG7A 4BL0B 2KDOA 1X19A 2L7KA 5L3BA 2WY7Q 1YTYA 1T98A 4FETA 3BT9A 3GEZA 2W00A 2XGCA 4O5VA 2MH2A 2NS0A 1Z21A 5M5YJ 2LNBA 1WJDA 2ESNA 3E6CC 1MDMB 1CF7B 2O03A 3E5XA 5EG0A 1OMIA 2EINH 3JRBA 3SZPA 4G9YA 3FM5A 3M3YJ 2ZXHA 1W7PA 2EH3A 3K70D 4E7HA 3KYCB 3HSRA 4BJ6C 4MQVA 3MKYB 3HGGA 2VI6A 1O7LA 2F48A 5BS6A 4XKWA 3FISA 3WTXC 2VJJA 2J5OA 3IP4B 3JRHA 3W6VA 5AIQA 4RB2C 3CMMA 1FJLA 1LJ9A 3ZRGA 1O3RA 3LFUA 2JSCA 1HQCA 3E5QA 1S7EA 5FLXZ 2RNJA 2HVSA 3F9KA 3DCFA 4IOCF 3TOBA 4A0ZA 2VQCA 4DNCA 1EJ9A 4XL9A 2VJ5A 2DDBA 1OJLA 2RKHA 3WU0A 2HXIA 1HBXG 3PUFA 1JJ8C 2QLZA 3R4KA 4RM2A 3HIFA 4FE4A 3FXOA 3PFYA 2NVYJ 2VJIA 2L0KA 1WJCA 3F8CA 3NEUA 1IV6A 2V9VA 3BG6A 4PJ0C 2P8TA 4A93J 1SMYF 4ETSA 2RNGA 1OCZH 3Q3SA 2VKEA 3SHFA 3MZYA 3TOAA 1OYIA 1ETVA 4ESFA 1P4WA 4AC0A 4ZDPA 1SFUA 3H3ZA 5E18F 2LY9A 2GA2A 1JT6A 4BAYA 1QO0D 1XSVA 3TL4X 2PQ8A 4LJZF 2R4GA 4M3DA 4AYBA 4ENMA 2A6TA 2R7UA 3A1YA 4A12A 1WJEA 4J19A 1W0UA 1RRJA 4F92B 1BI3A 1QGPA 2FX0A 1XGOA 4X1EA 2EFNA 5GAHJ 1IN7A 3BZKA 4UUSA 1WJAA 2Y0MA 4IJAA 4OIPF 2V6CA 3QYBA 2D5VA 3L2QA 4I6ZA 1HLVA 1JHFA 2XGDA 3W3CA 1R5ID 3OYIA 2BYVE 2A68F 4NUBA 4BQQA 2CUFA 2QSHX 3E7LA 2LOOA 1O4XA 4DBRA 1N25A 2HVQA 1IC8A 2N8GA 1BL0A 3S93A 4ZDLA 3RJPA 3FZVA 1KGSA 5M5WJ 1XTAA 1OCTC 1YW9A 2QENA 5B1AH 1XSDA 1IRXA 2CO5A 2UUZA 3OYJA 4BY7J 2UV1A 1F36A 2EZLA 1HW1A 2VBYA 4I0AA 1VQOI 1FY7A 4M3GA 2AS5F 1BC8C 3JRIA 3ABLH 1LKXA 3HUGA 2V1UA 3HDDA 1FTTA 3QWLA 1QVTA 1SANA 2HR3A 3K7AJ 2QGUA 5B66C 3OS0A 1MBKA 2W85A 2IS2A 2VB6A 2K9MA 4M74A 3T1BA 3G2BA 3L2RA 2M87A 3BR3A 4N9HA 1ZN2A 4RDUA 4BBRJ 1X3ZB 3S16J 4PJJA 4U0WA 3GZ6A 2E60A 1F1ZA 3KCCA 1SFXA 1RUNA 2K4JA 2KFDA 4IL6C 4A2UA 2G9WA 5GPAA 2HNHA 3J7ZI 3SZTA 1WZ2A 5E3LA 2FSWA 1O3SA 2HYFA 2JMWA 2WADA 2IGMA 2ISYA 3W6KB 2P7CB 4HAMA 2HQRA 1LFUP 4GGGA 2X0LA 3I54A 4U0VA 4CICA 1ZG1A 3KP2A 2UXNA 1R5HA 1TNSA 2JWTA 4D9JA 2NRAC 2LF7A 3BTCA 3ZMVA 2JJ7A 2V4JC 3B6AA 3PQKA 5D4RA 1Z05A 2PG4A 4OIOF 5CVUA 4ENNA 1XMAA 2DYRH 3TGNA 1R1TA 4HV5A 3JCUC 1OYWA 1H9TA 5K7ZA 1GLNA 2XVCA 3HKZA 1SEUA 5FGMA 1BI2A 2EA2A 4XLFA 2VODA 2EBIA 3VOEA 3E5UA 4KN7X 2DQRA 4EJOA 2NAZA 1YRNA 3ESWB 4A3BJ 3C2GA 2E2HJ 1MIJA 1YX3A 1S29A 3CF5F 5L3EA 4C9YA 2QA4I 3RPUA 1K78A 5KAIC 1I27A 1HKTA 1UELB 5E8GA 4BJ5C 1OCRH 1S72I 1NK2P 4MTDA 1DPRA 4DBQA 1G2HA 2CQQA 1LDKB 1RPWA 3C18A 2XDVA 3G6EI 1GV5A 3F6VA 1S9HA 4BXXJ 3OSFA 2UWMA 2LP0A 1JI8A 4MLOA 2HQAA 2XC7A 3K1PA 4AWXB 4I99C 1H9GA 2QBYB 3R0AA 3ERMA 1MNEA 4JX5A 4BS9A 3A01B 2DA6A 1YJWI 2DW4A 3BDDA 2XSJC 4XRMA 1GXQA 2LMDA 2O6GE 5H20A 3ABKH 3OYFA 2IRFG 1IXSB 2IGNA 4G6TB 1OLTA 3J7AO 3CDLA 5GP9A 2KMUA 4E7ZA 1TL8A 1SFKA 3DBLB 3TW7A 1J7KA 3SYTA 1E3OC 3DU6A 1X1BA 3NQOA 4HLYA 4I98B 5ICEA 1VQ9I 4F3QA 1ZLKA 2YX4A 1PUEE 1WKMA 2EPFA 5J4YA 3LNQA 3OIOA 9ANTA 3BTJA 5KHDA 3GMEA 5H6QA 5IT3A 4V19K 2DA7A 1BW6A 3O6BB 2FRHA 3SEQA 5CLSA 1QVUA 1ETOA 3BZ6A 3BPVA 3QPTA 5CVIA 4BDYA 2LRDA 1HOMA 1BR2A 1TW2A 3GFMA 3NARA 3H35A 1OQYA 1Z7LA 3I4MJ 2ECBA 4M3EA 3WG7H 4B44A 1P4AA 2F5VA 1X2NA 1B72B 2QM3A 1YE9A 1P7IA 1Y8RB 2BOLA 3OOPA 4KMUX 5C44J 3GZNB 2Q1ZB 3DKWA 3QP6A 3HPHA 1QZYA 3OS2A 2ID6A 2M9HA 2NYXA 1N78A 3G4SI 1GVJA 2HWVA 2XAQA 2HKOA 5CVRA 4Q47A 2IEKA 1XX5A 1E17A 2LC2A 4IVNA 1PVEA 2L9NA 3IKTA 4BE0A 5HNFA 2GLOA 2M3AA 4LB5A 2Q2EB 1MH4A 3JRGA 2CH0A 2WTEA 3MVPA 3MKWB 2HEOA 2HU9A 3CUQA 3GF2A 4RLFA 1ETQA 2NNYA 1RUOA 4CZZA 1AA7A 1BI0A 2PN6A 1AOYA 1E3PA 3E6BA 2AHQA 1L0OC 4A5MA 5CJ9A 3MKLA 3WTYC 2ZJQF 2HOTA 1HW5A 3D1NI 3DKXA 1MBEA 3K4JA 2CQKA 2Y48A 3ZR8X 1LEAA 4YIIA 2W4SA 2EWNA 2JT1A 3BJAA 2IA1A 1GDTA 2HOSA 2VONA 4HW0A 1Z6RA 5H6RA 1I39A 3H9GA 4RB1A 4Y52J 3CCLI 5FO5A 1YQAA 4XLCA 2J5PA 5HODA 4B4CA 1LE8A 5JI6A 5E3OA 1HC8A 4XRSG 1QU3A 2XGXA 3RQ4A 2WAQN 4BY1J 1NH3A 2R7OA 2QKMB 2LYCA 3BJ6A 3ZQGA 3KEQA 1JT0A 1U5TC 3HM5A 3BY6A 1JKQC 4IHVA 4IZZA 2R5ZA 2PI0A 3HRSA 1XCVA 2DBBA 3DV8A 1DU0A 1FOKA 1K4TA 1P6RA 3I59B 2ZFUA 3R60A 5FB2A 2HQ5A 3HC7A 1R1UA 5FLMJ 5E3NA 3U1DA 3IH4A 3FHNA 2B7EA 1R71A 3CO6C 3OSGA 2H27A 5LHGA 5LEKA 2V1DA 1G6NA 2GQQA 1YOVB 4AD9A 1RNLA 4C3HJ 5M3FJ 3JW4A 1D1BA 3Q0WA 2ECCA 2LKSA 3TP3A 5JHUA 2GM4A 2Z16A 1ZGWA 4DQ2A 5J8CA 2H8RA 2A3SA 3MEXA 2IS1A 2OU2A 4ESBA 1FYKA 4DYCA 1T2KA 1O3TA 5GTIC 4XLNF 2OAZA 1JHHA 1SFEA 2GA1A 2Y31A 5ED4A 3H5AA 4PCQA 5A2QK 4HDUA 1UG0A 2I5UA 3I71A 1USSA 3NRVA 4CCOA 2ZMEC 2FMYA 3EUHA 3U1KA 3JTGA 5DV5A 1RC9A 2DA1A 1WVRA 1D8KA 3H0GJ 1VNDA 2PMUA 2W24A 5C3EJ 3DEEA 4LITA 2HQNA 2VE9A 3C3WA 2COBA 5CQEA 1MBHA 3HOWJ 2IJLA 2EILH 2M7AA 3ML6A 3TDZC 1D5YA 2V1NA 1FOXA 1VFCA 4Y4RA 1MJ9A 1KU2A 2ZBKA 2HI3A 5AIPA 4ON0A 3OYMA 1U8BA 2QQ8A 2VT3A 2QF7A 2XASA 1T38A 3H5NA 2JRMA 4LB6B 3GXOA 4PK4A 2DTRA 4BHPA 2YR2A 4XKBA 1FX7A 3K4CA 2JA7J 5HLTA 2KIQA 4RGSA 1YIJI 1DUXC 5B1BH 4HX7A 3VODA 1KQ9A 4XORA 2HZDA 2A69F 2BHYA 4KA4A 1LUJB 2LLKA 1A35A 4A3EJ 1FP1D 4IHTA 4LLGF 4HRIA 1O7FA 1FMWA 1Y0UA 4S05A 2A5YB 1RETA 3F8NA 1B59A 1Z6TA 4X0GA 1U5TB 2XSDC 2R7XA 3I4PA 5JR3A 1VTNC 4DZJA 4B48A 4KISA 3ZN1A 1IV8A 4B3XA 4I2OA 1FT9A 4A0YA 1VQLI 3IH2A 1ZQ3P 2ZFWA 5AONA 3KPHA 3GTPJ 2PFBA 4UXNA 1T0FA 4A3JJ 3C7JA 3D5SC 1UFMA 4KIBA 4MNUA 5F0HA 3L09A 2VQGA 1Z67A 3C2HA 1EH8A 2HYGD 1ON2A 1UG2A 5GAGJ 1K7AA 2KHMA 3FXMA 4HPQA 3ZQHA 2E19A 2VBXA 4TV7A 1I50J 5DCFA 5CVVA 4CHUA 2AO9A 3OY9A 2O8XA 2TCTA 1DDNA 3BR0A 3J7YJ 2ZSHB 2DK8A 2Y0SN 5EYRA 3L2VA 4S0HB 5EGOA 3FKIJ 2QUFA 2KIFA 1ONVA 2MW8A 4BKXA 2BZTA 2ZMEB 2DPUA 2PLYA 4U0YA 1VQ8I 1Y56A 2YUSA 1R4MB 4XR6A 3D5RC 2MD0A 4NC8A 3K4NA 3I56I 2KIUA 2P7VB 3UR3C 3ZOBA 3IRQA 4HOBA 1UZCA 1Z0XA 1ZAOA 4UVBA 5TRDA 3R0JA 3HZJA 2NS7A 1OISA 3BR2A 4FHTA 2R7QA 2I10A 3OR1C 1G3WA 4CCKA 1FBSA 2E2IJ 2X1DA 4LG0A 3J80K 3BTLA 1DU6A 1XGMA 2L5QA 3GFLA 3IWZA 1JXSA 3DBHB 3DF8A 3VEPA 3K6GA 1FZPB 3MN2A 4L9JA 1J75A 1A5JA 1U2WA 2M45A 1N75A 4QLCU 3OYKA 4HYEA 4D5FA 3M1EA 2IVMA 1EH7A 1W1WE 1WPKA 3K9TA 2PEXA 4RGRA 1ULYA 2LY1A 3R61A 1V3FA 2BY1A 1WCMJ 3BP8A 2ESHA 1AKHB 2HS5A 3LA3A 4OINF 1YHQI 3T8TA 2GZWA 3TW6A 3HJEA 5LD2C 3KLOA 1X1CA 3OYEA 1DP7P 2DK5A 2WAEA 3L2CA 1TWFJ 3DPTA 3FIWA 3WTSC 3E3VA 2ZCWA 5DM6F 1L3LA 5K5OA 3TQNA 2W57A 2ME0A 3WTUC 4LMYA 3IWFA 1ZGJA 2DLLA 3JRDA 1SD4A 3DKYA 3CLQA 3ASNH 2FNAA 2VE8A 4OIQF 2ZXIA 2CWEA 5EEHA 1D3YA 3VYTB 3ABMH 5D6FA 2R7ZJ 5JVGF 3HOUJ 1UCRA 2DO7A 3RCOA 4C2UA 4RGXA 5LHHA 4V2GA 3NWSA 2KPMA 3SDGA 4ZYGA 3LL7A 1IRGA 2F4IA 2A05A 2G0EA 2Y30A 3FBIB 3V7RA 3KP3A 5JHFA 1P7JA 1OCOH 2L7MP 4RAFA 3EQLF 3L00A 3RQIA 4BQNA 1ON1A 3VFZA 4D1QA 1WH7A 3H0DA 2Z5UA 3P9CA 4XM3A 1CGPA 3ZQ7A 3QYEA 4II2A 3L9FA 2PX9A 4G94A 1XN7A 1IUYA 1FNNA 2IA0A 5E8IA 1FSEA 1ZRFA 5KK1A 2HOAA 2DQLA 4BGDA 3ROUA 1I1GA 2NOGA 3FBNB 1T95A 2HVRA 3ZMSA 3O8HA 2RVCA 1VQKI 2VBWA 4CZCA 2GOMA 4Y17A 2DOFA 3ZQLA 2MGQA 1FC3A 1V55H 2CJJA 3BR6A 4A3KJ 3CCSI 1Z91A 4IEJA 4BJTA 2DXIA 4WXDA 3ABTA 2MFZA 3HSEA 5HS8A 3JTHA 1ZKGA 5CYVA 1EF4A 1V5GA 1SVMA 2DA4A 1PDNC 5HLHA 2LSOA 1R00A 2Y69H 3V7SA 5KCMA 4H0EA 3DTIA 3O8GA 4YG2F 3GFJA 1XC5A 3OMYA 2OUMA 2Y9YA 1BW5A 2LKPA 3S32A 1CF7A 1GVDA 3CQZJ 2DA2A 4ESJA 2DMPA 1HKSA 3KEOA 1PUFB 1K61A 1B1BA 4NC6A 3H92A 4IHYA 4RBOA 4JYKA 3RDIA 1RESA 4WXHA 3P7NA 3V8KA 3AG2H 4MEXF 3G1LA 4D5CA 4HZFA 4HF0A 4MTEA 1QBJA 2E7XA 1FOWA 3V42A 2QSGX 1ZR2A 3KEYA 3JSOA 2BY2A 4OIRF 2QWWA 3EPZA 1F4KA 4GCVA 1B9MA 3GCMA 4F7ZA 5B5EC 4M9ZA 4GFBA 1GV2A 2ISZA 1FMVA 2DFFA 3IL2A 4PGGA 3F21A 1D8JA 6PAXA 4A6DA 1Y1VJ 2FOKA 4RMNA 1TT5B 2X1CA 4HLXA 1FBQA 2FU4A 4Q48A 1IO2A 1J2XA 4AIHA 3MFKA 3BTIA 2F6CA 4NC7A 3SQNA 3CF2A 2IPQX 2KISA 1ETYA 5HDGA 2H1KA 4FTHA 3K1MA 1Y39A 3GFIA 4UUSB 3CMAI 2VIXA 1TP4A 3FMQA 4F93B 2L02A 1XGSA 3O2PE 4XLEA 1BJAA 1TW3A 4A69C 1W36D 1ETXA 1B4AA 3DLAA 4B47A 1YLFA 3VSKA 4L0YB 2H1LA 4OWRB 1D0XA 3IAS2 1G3SA 1FWZA 5IYBJ 1TBXA 1J09A 1BIBA 3GX4X 4KJZA 4B3AA 2DMQA 3PSFA 2BW3A 4C3JJ 5F0CA 3FDYA 4PDKA 5L3CA 4N0BA 1PYVA 2XHKA 1YJNI 2WA0A 4KIGA 4F55A 2R7FA 1DQUA 1X58A 1YIOA 1IDZA 2V6EA 1NG7A 5D4SA 1TC3C 2EQRA 3F22A 3PM1A 4A0XA 1TZLA 3ERED 1ITYA 1FEXA 4HBLA 1ZGAA 2H8WA 1D5VA 2BE5F 2KLOA 1I6HJ 5H2FC 5GPCA 4CO8A 3H36A 2KIMA 5IYCJ 1W7PD 2YU9J 5C4JJ 4QPOA 2XF6A 5IYDJ 1FYMA 3VDXA 2XAGA 4UB8C 2STTA 3WTTC 4Y7NJ 4OAZA 5TGTA 3TP0A 4BBSJ 2NVQJ 3F72A 3W2AA 2H09A 3AG3H 2OC6A 5TJJA 4BXFA 4AM3A 5KVRA 3LMMA 5C4XJ 2OTLI 4I7HA 3UKGA 1APLC 2EB7A 1XGNA 1Z7UA 2K4BA 3FK7A 3FHZA 4RS8A 4ITVA 4ZH4F 4KFCA 1XB4A 2Z9OA 1NHAA 4G12A 2RAEA 3K1NA 3BG9A 2KP6A 2DJNA 1G59A 2JA6J 1Z3XA 4LK1F 5J8FA 1JTYA 4I01A 3OYBA 4JQFA 1OPCA 2A6EF 5K5QA 5J4VA 2JVHA 3J81K 4A3GJ 1HSJA 1FBUA 3F6OA 4DGWB 2CS3A 2MSYA 1IDYA 2VKHA 4BEHB 2BEOA 1WJBA 2FF4A 3WGHA 1W5CC 2JUGA 2JZYA 2DMUA 2R0QC 1UHMA 3Q9SA 1H8AC 2CV2A 4BHCA 3W2WA 2XRNA 4OMYA 4U7BA 2CRGA 4ZTJA 3KYDB 1TWCJ 1B8IB 2FNPA 4ZZLA 3FF5A 1RZ4A 3M8JA 2EV5A 1YRNB 4MGRA 5ICCA 4BU2A 2DFEA 4JX6A 1USTA 1V4RA 2QEXI 2AXLA 4QSHA 4JOMA 4AVZA 1MMGA 2B9SA 4IRGA 4WWCA 3HBLA 3A0BC 3HTSB 4M72A 1KYZA 2MA3A 4M6YA 3GVAA 4PUSA 3WTZA 2JVGA 2WWYA 4EGYA 2Z2SB 3G71I 2ZSIB 4XKVA 3PO3J 2ZNZA 4OMZA 2Z33A 2EIMH 5BMZA 2OZUA 4F52A 5DYMA 3U9GA 5E1WA 2KZGA 2D2WA 1KYWA 2KT0A 1MMDA 2O0YA 4FQGA 4KITB 2FQ3A 3T5XA 3ABUA 4CGZA 2PMZA 2FBIA 2DFHA 3HTUA 4QIWN 2DN0A 3HRUA 4MEYF 4A3FJ 3VYSB 3RIRA 2VBZA 2L2OA 1JKOC 1V5FA 2M2EA 4CCJA 5IT9Z 4AIJA 3QP5A 1LVKA 2L7ZA 2IA2A 2KQRA 2FJ1A 4HQEA 2LVSA 3QPSA 4Y33A 3IUOA 3F8FA 4N4NB 3I3LA 3KP7A 5LRSA 1S5LC 1U78A 3HOTA 3KZIC 2K02A 1QA6A 3ZMDA 3A01A 2F4OB 2HXOA 3V8LA 4CXFA 4DIQA 2H6BA 4HDVA 2AQFA 2CUEA 3EUKL 2DAOA 2P4WA 5FROA 3S3OA 1MKMA 1WSUA 3ZQQA 2XIGA 4IHXA 4HQMA 2M0CA 2K9LA 1FSHA 3QAHA 1U3EM 3LOCA 2QQAA 1X1AA 1O3QA 1UMQA 1F5TA 4WCGA 1MZBA 3JAMZ 3AL0C 1Y0NA 3LSHA 2XAHA 3CCUI 3VWBA 4ZZDA 1QNTA 5J1UA 3ZPLA 3GYHX 2F5DA 4R8HA 3BR5A 4IO9F 1M1EB 4ABZA 4XOPA 4AIDA 4XQFA 1YYVA 4Z2YA 1XDSA 3AKZA 4UV8A 1K79A 2DMNA 4YFXF 1BC7C 3WTWC 4M9SA 4MHGA 2MBFA 2P6SA 5DD8A 4RAYA 1R7JA 5F1RA 1MJAA 4D7MA 2PJRB 4M3FA 2LR8A 5HS9A 1Z3YA 2Q8KA 3H9JA 1BOBA 3HHGA 3S2HJ 3CCEI 2IP2A 2DI3A 2EA4A 2DOAA 1B72A 3CJQB 2OBPA 3HL2A 2XAUA 5K7FA 3N05A 1IN8A 4NQWB 1REPC 1ZK8A 1ZLJA 2K9NA 2GIVA 3MD2A 4U87A 2XKPA 3RPUD 5ILVA 4LIUA 1HF0A 4KNYA 4NB5A 2F5CA 2ZO4A 4NBQA 5CQGA 4UVCA 1QZZA 3WGIA 1LVAA 3HOZJ 2ZXWH 2YU3A 3E97A 2Q2EA 3OL4A 5ILSA 1RR7A 4B8XA 1X1PA 2OQRA 2CQNA 3HEFA 4IHSA 1FOYA 2G7UA 1QPMA 4FX4A 1IF1A 2R93J 4UUTA 2NNNA 1OR7C 1SAUA 3S8PA 3KP6A 3QRFF 2E34A 2I8DA 1XPXA 3GLXA 3BCBA 2JTVA 5HVQC 4HF1A 4HX8A 4OOIA 3BCAA 2E7WA 3GW2A 2FQ4A 2W82A 2X48A 2EFPA 4CA0A 2R5YA 3BZCA 3E1SA 2O9LA 3I9V2 4EV0A 2A07F 1TWGJ 5JLXA 2L01A 2RDPA 4MFEA 2VUMJ 5D8KB 3I53A 1FTZA 2LY2A 1Q1HA 4EVIA 3AL0B 2Y9ZA 4AU7A 3X2QH 1UHWA 1YW7A 3EYYA 1ZR4A 4IQ4A 1OYYA 3EETA 5DCMA 2DODA 1RIOH 2XGEA 2Z99A 3PFIA 3CJRB 2LBFB 3K4LA 1RI7A 3KETA 2O3FA 3DWLE 3I59A 4L0ZB 1BI1A 3TDUC 3ZMTA 4IRHA 2QQ9A 4JX4A 2UXXA 5JLWA 3G1MA 2V7FA 4KN4X 4KYWA 5FFZA 2V9PA 3MZHA 1JUPA 1J59A 2OTJI 3I58A 3FM3A 5D6EA 1T08B 5DS9A 3SFZA 4Z6YA 3ZCOA 3OL3A 1JGGA 2IGOA 3G73A 3HKZN 2CGPA 3HHHA 3GTOJ 3FXUA 3P9IA 2ADUA 1K6YA 1IRFA 2F5EA 1IN4A 3T8RA 1VQ6I 3K70C 4CDGA 1OKRA 1TQPA 1RKTA 4GYGA 5LFAA 3I64A 2OD5A 4M3BA 5HLGA 3PIOF 2EIJH 1D0YA 4R79A 3FKJA 1WHUA 3UNGC 2R7SA 4ENJA 2DT5A 3S1QJ 2EJRA 2VOPA 3VPRA 2E71A 4GRIA 1ACIA 3CZ6A 4NNJA 2XUBA 1HXDA 4XLAA 3CCVI 4UUVA 2EIKH 1W5TA 1UAAA 1U8RA 4LK0F 4CH7A 4ZDOA 4AVPA 2P5VA 1NK3P 3KIOA 3ZN0A 4Q5SF 5FKLA 2DU9A 2H94A 2ZXJA 2LTPA 3KX2A 3OS1A 4FX0A 3OYAA 1SFOJ 1P9QC 1MD0A 3V7CA 2WB1N 2R3SA 4M73A 3TO6A 1R22A 1SMTA 2D1HA 1FLIA 1SC7A 2Y75A 1P92A 3L2WA 2CSOA 2R7VA 2HGCA 5HDNA 3RSNA 2ACJA 2VKVA 3E0JB 2W25A 3HRTA 4DW6A 4G7HF 1PJRA 2NS8A 1K4SA 2YX7A 1ZRDA 5GTHC 4IKFA 5LBQA 1WFXA 5LRRA 3Q5FA 2HDWA 2VXZA 4CCMA 4N9IA 5GADJ 1SVOA 2DTZA 2K27A 3PUBA 2BY0A 2P5LC 3HSFA 1MJBA 2FOWA 4DJAA 5FKKA 1CQTA 4PGHA 1MBJA 2IGKA 3PJRA 4QTRA 2C6YA 3WTVC 3I0TA 3S2DJ 1W36C 2M8EA 3H3UA 4RB0A 3OYHA 1QPIA 4PJMA 3GTJJ 3M1CA 1YJ9I 1TLHB 1H88C 1YG2A 3TKYA 2X6YA 2HTJA 1BR4A 1RKWA 4JP0A 1TQIA 1XSXA 5TISC 1T6SA 1BBYA 2X6OA 4E7IA 1ZELA 2KJCA 2WAFA 2X51A 1AU7A 1POGA 4XBFA 2MD5A 2HPIA 1E2XA 3VB2A 2LH9A 3DPLC 1KQ0A 2MLGA 2QYOA 2KL4A 3G1OA 3CJNA 4G7OF 1YX5A 4NDLA 3HPGA 4E70A 4G8XA 3L1PA 4YRVA 1HSTA 3CESA 3MZ8A 4YELA 3HB9A 3B73A 5CKTA 4RA2A 4LG0B 5BQTA 4XIDA 4N4OB 5FRMA 5M5XJ 1J5YA 3V4GA 2HDCA 2KRFA 3VYUB 2ZMEA 2KRCA 5D5WB 4CYCB 4I02A 1KONA 1XG1A 4E7LA 2CW7A 1G3YA 5HOOA 3TO9A 3CDHA 4YEJA 2W7NA 1ODDA 3FMRA 4PJNA 2HZTA 4W97A 4EJWA 4IPAA 3W2VA 3KP4A 5J1RA 2XAJA 5M3MJ 3FXKA 3FXLA 3F8MA 1XCBA 3CC2I 1JKRC 1QHGA 2RQPA 3A2KA 3CUOA 2P81A 4Y15A 4HX4A 2XAFA 2RQQA 1JUSA 4GYIA 3WE2A 3AFHA 5FD5A 2E1OA 5FD6A 3K69A 3QOPA 4E6KG 1PP8F 1C0WA 3LAJA 3OOUA 3OYDA 4P9FA 1FIPA 5ERIA 4MIMA 1YS7A 1KA8A 1YW8A 1GHCA 2XF5A 3WODF 1D1CA 3COAC 4OU0A 1BA5A 3KLNA 4IQJA 4XMYA 4IXAA 2R7DA 1AHDP 4D0PA 1AWCA 5GAEJ 3FXJA 1B9NA 4IHWA 5D5VB 1WI3A 1VZ0A 3LSIA 3QU3A 3B02A 1SVLA 3OR2C 4R1HA 3CCYA 4V2FA 3PNTA 1ZRCA 4KUMA 4ANJA 2DOEA 4AUXA 4EM0B 3S17J 3HOVJ
chains in the Genus database with same CATH topology
1IW7F 2JRTA 5K1YA 2IT0A 4L9TA 5L3GA 1R58A 5L3DA 3W6JB 3RKWA 3BOQA 4HA8A 1W7PB 2VN2A 1I6XA 4HV6A 1T39A 3ISPA 3FWEA 2CFXA 2KJBA 3DQVC 1BM9A 5FLXK 1MDMA 3LSTA 4L5IA 1MGTA 2M30A 3RTRA 2PBIA 1S7OA 3CO7C 4WF2A 5BOXA 5JFRA 5DEQA 1WI9A 4YFNF 1LQ1A 4EQQA 2F5FA 1X3UA 3LAPA 3IRRA 4K2EA 3F23A 4YIFA 3AAFA 1B6AA 2FE3A 1J9IA 3K0LA 5HDKA 1KU9A 2HTSA 1EH6A 4LGWA 3REOA 5DDGA 2ZJ2A 5HS7A 1I1SA 5LGUA 1XMKA 1FYLA 1LEBA 1G4DA 5LGNA 5L3FA 4HF2A 2GWRA 4WX9A 2WV0A 3GO5A 3KZYA 2TDXA 4P55A 3IC7A 4KDPA 2JPCA 1DPUA 2L4MA 4ASNA 4EM2A 1R1VA 1P2FA 2A61A 1HW2A 2E1CA 3MQ0A 2RC4A 1Z9CA 2EV0A 4M71A 2X4HA 3EDPA 3Q9VA 1P4XA 2DPDA 1BOAA 4LLLA 3MWMA 1SD5A 1EV7A 2WC2A 4A5NA 2RGVA 3D5LA 3IHUA 3BWGA 2VC1A 5HLIA 1R23A 4UNOA 3HRMA 1W4MA 1ZYRF 2EFWA 1G3TA 4U7DA 4CYDA 2QZ8A 1JGSA 4I0BA 1WWXA 2MC3A 5E1ZB 2FMLA 4BHBA 4BH9A 3ECOA 2COMA 4KT5C 2IW5A 1O57A 3CUQC 3J81Z 2JPBA 4QWQA 1ZHFA 1K78B 1S8NA 2CYYA 1JE8A 3BPXA 2XKOA 1S7AA 2OZ6A 2MH9A 3ELKA 1Z1DA 1IXRC 2D1VA 3WGGA 3FXRA 4G6QA 4RB3C 4EGZA 5IT9K 2CW0F 2V79A 2P5KA 4GO1A 5J6XA 2BBYA 1IAWA 4KIFA 3LA2A 4U88A 5DUIA 3ULQB 3F3XA 4ZYEA 4G7ZF 2EK5A 3RI4A 2ZKZA 2QBYA 3BROA 3P9KA 1LB2A 4UVAA 2O61A 4P5OA 3I5UA 3JAMK 2EFQA 4AIKA 1LNWA 2K86A 4BXUA 3RKYA 4L9VA 1BN5A 2YSRA 1LDDA 1WRJA 2HKXA 3RPQA 4EJUA 2ZNYA 4EJVA 4LLNA 1ZG5A 4FT8A 2FEZA 3LA7A 2M5WA 2ETHA 4S04A 1IN6A 2L4AA 3CUQB 1KU3A 2PMHA 5E20A 3LWFA 3KFWX 3MCZA 5ILUA 4L5JA 3JSPA 3DXJF 3BJOA 3O3KA 5BPIA 4I09A 3C1DA 3QU6A 3KE2A 1TNTA 3WE3A 1R36A 4RGUA 1YS6A 1S3JA 5EEGA 4L18B 1GXPA 2G7HA 2HOEA 5CVJA 2FBHA 3OV8A 4NQWA 3HOSA 5JVTA 1KU7A 2L3DA 3RKXA 2EV6A 2FXAA 1F9NA 4BYYA 2L54A 1KQ8A 4KMFA 4ZYHA 4B09A 4O3MA 2RN7A 3S2WA 1YO5C 2DFIA 3GUDA 3QPHA 3G3ZA 4M9XA 5E17F 2YPRA 1J0RA 3FXQA 2VT2A 5DCMB 4Y13A 2KKOA 3D0SA 5E1XA 3CTAA 3V8JA 4JK1X 2UZKA 2D45A 3T0YA 3WU1B 4P96A 1ZREA 2LDUA 2XROA 4P9UA 1QQIA 1SD6A 4ENKA 2HFHA 4UHTA 1IZ1A 1TTYA 1H0MA 2BV6A 2FA5A 2XV4S 3LFKA 1A04A 1UB9A 2ELHA 4IF4A 3SXYA 4BQAA 4M6XA 3RYPA 4MQ9F 4LD5A 5LHIA 5F64A 5F6FA 4JBAA 3ZMUA 2M1BA 3PQJA 4L9NA 3M8EA 5A2QZ 1S6LA 5ICGA 3KP5A 1R5GA 3R6SA 3N4MA 4XLPF 3E6DA 1ZG3A 3FX3A 4GXOA 4KICA 3MAJA 4RAZA 1K6OA 3U2RA 2Z3YA 3DEUA 1STZA 1IXCA 2EFOA 1OR7A 2VOOA 3ECHA 3EYIA 1FPQA 5K5RA 1U6GA 2F2EA 1YFHA 1ZH5A 3LQQA 2BGCA 4XRFA 2LF8A 1PP7U 4EMSA 4YFKF 1U5TA 2CG4A 4NHJA 2GXGA 4A6EA 5D5UB 3IKVA 4G6DA 1BIAA 2H6CA 3K2ZA 5D8LB 3M7GA 2Q0OA 4Q4ZF 1FP2A 5BPDA 4XSXF 2GXBA 3GZ5A 2V1XA 3N97A 3ZMZA 3L7WA 1W5SA 1XD7A 4UV9A 1IN5A 3LQRA 2VC0A 1WQ2A 4WK8F 5DUKA 5LEJA 3TO7A 4IRIA 2PJPA 2OQGA 3DFGA 3CLOA 1SD7A 5D5XB 1ZARA 3ZP5A 3E6MA 3FMSA 2K7LA 3J80Z 5LLQA 3HYIA 5ICFA 4EM1A 2RV8A 1TQMA 2STWA 3M9AA 5FFXA 4O6JA 5DD4A 4EJTA 3DP7A 2QVOA 1XDUA 3WG9A 2A6HF 3M8FA 2FBKA 4PZJA 1HKQA 4XSZF 4ZYDA 3KZZA 2MLKA 3GWZA 1SAXA 2GAUA 3RYRA 4LFUA 3F8BA 2B0LA 2OA4A 4BNCA 2E1NA 1I5ZA 2P6TA 1LDJA 2QQBA 4WXCA 2W84A 5LGTA 5L3BA 1YTYA 1T98A 3GEZA 4O5VA 2MH2A 2NS0A 2LNBA 2ESNA 3E6CC 1MDMB 1CF7B 2O03A 3E5XA 1OMIA 3SZPA 4G9YA 3FM5A 1W7PA 3HSRA 4MQVA 1O7LA 5BS6A 3WTXC 2J5OA 5AIQA 4RB2C 1LJ9A 1O3RA 2JSCA 1HQCA 3E5QA 5FLXZ 2RNJA 3TOBA 4A0ZA 4DNCA 2RKHA 3WU0A 1HBXG 2QLZA 3R4KA 3HIFA 3F8CA 3NEUA 2V9VA 2P8TA 1SMYF 4ETSA 3SHFA 3MZYA 3TOAA 1OYIA 4ESFA 1P4WA 1SFUA 3H3ZA 5E18F 2GA2A 4BAYA 1QO0D 1XSVA 2PQ8A 4LJZF 4ENMA 4A12A 1BI3A 1QGPA 1XGOA 2EFNA 1IN7A 2Y0MA 4IJAA 4OIPF 2V6CA 1JHFA 2BYVE 2A68F 3RJPA 3FZVA 1KGSA 1YW9A 2QENA 1XSDA 2CO5A 1HW1A 2VBYA 4I0AA 1FY7A 2AS5F 1BC8C 3HUGA 2V1UA 2HR3A 2W85A 4M74A 3T1BA 2M87A 4N9HA 1ZN2A 4U0WA 3GZ6A 1F1ZA 3KCCA 1SFXA 1RUNA 2K4JA 4A2UA 2G9WA 3SZTA 2FSWA 1O3SA 2HYFA 2ISYA 3W6KB 2P7CB 4HAMA 2HQRA 4GGGA 2X0LA 3I54A 4U0VA 4CICA 1ZG1A 3KP2A 2UXNA 1TNSA 1R5HA 2NRAC 2LF7A 3ZMVA 3PQKA 5D4RA 1Z05A 2PG4A 4OIOF 5CVUA 4ENNA 1XMAA 3TGNA 1R1TA 4HV5A 1OYWA 1H9TA 2XVCA 5FGMA 1BI2A 2EA2A 2VODA 3VOEA 3E5UA 4KN7X 2DQRA 4EJOA 2NAZA 1S29A 5L3EA 3RPUA 1K78A 1I27A 1HKTA 5E8GA 4MTDA 1DPRA 3C18A 1LDKB 3F6VA 2UWMA 3K1PA 4AWXB 1H9GA 2QBYB 3R0AA 2DW4A 3BDDA 1GXQA 2O6GE 5H20A 2IRFG 1IXSB 3J7AO 1J7KA 3NQOA 4HLYA 4I98B 5ICEA 1ZLKA 2YX4A 1PUEE 1WKMA 5H6QA 5IT3A 3O6BB 2FRHA 5CLSA 3BZ6A 3BPVA 3QPTA 5CVIA 1TW2A 3GFMA 1P4AA 2QM3A 3OOPA 4KMUX 3DKWA 3QP6A 1QZYA 2NYXA 1GVJA 2HWVA 2XAQA 2HKOA 5CVRA 4Q47A 1E17A 4IVNA 3IKTA 4LB5A 2WTEA 2HEOA 3CUQA 3GF2A 2NNYA 1RUOA 4CZZA 1BI0A 2PN6A 1AOYA 3E6BA 1L0OC 4A5MA 5CJ9A 3WTYC 1HW5A 2CQKA 2Y48A 1LEAA 4YIIA 2EWNA 2JT1A 3BJAA 2IA1A 2VONA 4HW0A 1Z6RA 5H6RA 4RB1A 5FO5A 1YQAA 2J5PA 5JI6A 2XGXA 3BJ6A 3KEQA 1U5TC 3BY6A 2PI0A 3HRSA 1XCVA 2DBBA 3DV8A 1FOKA 1P6RA 3I59B 3R60A 5FB2A 1R1UA 3U1DA 2H27A 3CO6C 5LHGA 5LEKA 2V1DA 1G6NA 2GQQA 4AD9A 1RNLA 3JW4A 5JHUA 4DQ2A 5J8CA 2A3SA 3MEXA 2OU2A 4ESBA 1FYKA 1T2KA 1O3TA 4XLNF 2OAZA 1JHHA 1SFEA 2GA1A 5ED4A 4PCQA 5A2QK 4HDUA 3I71A 1USSA 3NRVA 2FMYA 3EUHA 3JTGA 5DV5A 1D8KA 2PMUA 2W24A 2HQNA 2VE9A 3C3WA 2IJLA 3ML6A 3TDZC 1MJ9A 1KU2A 2ZBKA 5AIPA 4ON0A 2VT3A 2XASA 1T38A 4LB6B 3GXOA 2DTRA 4BHPA 2YR2A 1FX7A 4RGSA 1DUXC 4HX7A 3VODA 1KQ9A 4KA4A 2A69F 1FP1D 4IHTA 4LLGF 1O7FA 1Y0UA 4S05A 2A5YB 3F8NA 1B59A 1Z6TA 1U5TB 3I4PA 5JR3A 1VTNC 3ZN1A 4I2OA 1FT9A 4A0YA 2ZFWA 5AONA 2PFBA 4UXNA 1T0FA 3C7JA 1UFMA 4KIBA 4MNUA 3L09A 1EH8A 2HYGD 1ON2A 1K7AA 2VBXA 4TV7A 5DCFA 5CVVA 4CHUA 2O8XA 1DDNA 2DK8A 2QUFA 2KIFA 1ONVA 2ZMEB 2DPUA 2PLYA 4U0YA 2KIUA 2P7VB 3IRQA 4HOBA 1ZAOA 4UVBA 5TRDA 3R0JA 4FHTA 1G3WA 1FBSA 4LG0A 3J80K 1XGMA 3GFLA 3IWZA 1JXSA 3DF8A 3VEPA 1FZPB 4L9JA 1J75A 1U2WA 2M45A 4QLCU 4HYEA 3M1EA 2IVMA 1EH7A 3K9TA 2PEXA 4RGRA 1ULYA 3R61A 1V3FA 3BP8A 2ESHA 2HS5A 3LA3A 4OINF 3T8TA 2GZWA 3KLOA 1DP7P 2DK5A 3L2CA 3DPTA 3WTSC 3E3VA 2ZCWA 1L3LA 5K5OA 3TQNA 2W57A 3WTUC 4LMYA 3IWFA 1ZGJA 2DLLA 1SD4A 2FNAA 2VE8A 4OIQF 2CWEA 5EEHA 1D3YA 5D6FA 2DO7A 1UCRA 4RGXA 5LHHA 4ZYGA 1IRGA 3V7RA 3KP3A 3EQLF 3L00A 1ON1A 3VFZA 2Z5UA 3P9CA 1CGPA 3ZQ7A 3L9FA 4G94A 1XN7A 1IUYA 1FNNA 2IA0A 5E8IA 1FSEA 1ZRFA 5KK1A 2DQLA 3ROUA 1I1GA 3ZMSA 2RVCA 2VBWA 4Y17A 1FC3A 1Z91A 4WXDA 3ABTA 3HSEA 5HS8A 3JTHA 5CYVA 1PDNC 5HLHA 2LSOA 1R00A 3V7SA 4H0EA 4YG2F 3GFJA 2LKPA 1CF7A 4ESJA 1HKSA 3KEOA 1B1BA 3H92A 3RDIA 4WXHA 3P7NA 3V8KA 4MEXF 4HZFA 4HF0A 4MTEA 1QBJA 2E7XA 3JSOA 4OIRF 2QWWA 1F4KA 4GCVA 1B9MA 4F7ZA 4M9ZA 2ISZA 3IL2A 4PGGA 3F21A 1D8JA 6PAXA 4A6DA 2FOKA 4HLXA 1FBQA 2FU4A 4Q48A 1J2XA 3MFKA 4AIHA 3SQNA 2IPQX 5HDGA 3K1MA 3GFIA 3FMQA 2L02A 1XGSA 3O2PE 1BJAA 1TW3A 1B4AA 1YLFA 4L0YB 1G3SA 1FWZA 1TBXA 1BIBA 3GX4X 4PDKA 5L3CA 4N0BA 2XHKA 4KIGA 2R7FA 1YIOA 5D4SA 3F22A 4A0XA 3ERED 4HBLA 1ZGAA 1D5VA 2BE5F 4CO8A 2KIMA 1W7PD 1FYMA 2XAGA 2STTA 3WTTC 3F72A 2H09A 5TJJA 5KVRA 4I7HA 2EB7A 1XGNA 1Z7UA 2K4BA 3FHZA 4RS8A 4ZH4F 4KFCA 1XB4A 2Z9OA 1NHAA 3K1NA 4LK1F 5J8FA 4I01A 4JQFA 1OPCA 2A6EF 5K5QA 3J81K 1HSJA 1FBUA 3F6OA 2BEOA 2FF4A 3WGHA 2JZYA 1UHMA 3Q9SA 4BHCA 4OMYA 2XRNA 4U7BA 2FNPA 4ZZLA 3FF5A 1RZ4A 2EV5A 4MGRA 5ICCA 1USTA 1V4RA 2AXLA 4IRGA 4WWCA 3HTSB 4M72A 1KYZA 2MA3A 4M6YA 3GVAA 3WTZA 2WWYA 4EGYA 2ZNZA 4OMZA 2Z33A 5BMZA 2OZUA 5DYMA 3U9GA 5E1WA 2D2WA 1KYWA 2O0YA 2FQ3A 3T5XA 3ABUA 4CGZA 2FBIA 3HTUA 4MEYF 3HRUA 3RIRA 2VBZA 5IT9Z 4AIJA 3QP5A 2IA2A 4HQEA 3F8FA 3KP7A 5LRSA 1U78A 3HOTA 2K02A 3ZMDA 3V8LA 4HDVA 4CXFA 2H6BA 1WSUA 2DAOA 2P4WA 1MKMA 2XIGA 4HQMA 1FSHA 3QAHA 1U3EM 2QQAA 1O3QA 1F5TA 4WCGA 1MZBA 3JAMZ 2XAHA 4ZZDA 1QNTA 3ZPLA 3GYHX 2F5DA 4R8HA 1YYVA 4Z2YA 1XDSA 4UV8A 1K79A 4YFXF 1BC7C 3WTWC 4M9SA 4MHGA 2MBFA 2P6SA 5DD8A 4RAYA 1R7JA 5F1RA 1MJAA 5HS9A 2Q8KA 3HHGA 2IP2A 2DI3A 2EA4A 2OBPA 1IN8A 1REPC 1ZLJA 2GIVA 2XKPA 5ILVA 4KNYA 4NB5A 2F5CA 2ZO4A 4UVCA 1QZZA 3WGIA 1LVAA 2YU3A 3E97A 2Q2EA 5ILSA 4B8XA 2OQRA 4IHSA 2G7UA 1QPMA 4FX4A 1IF1A 2NNNA 3KP6A 3QRFF 3GLXA 2JTVA 5HVQC 4HF1A 4HX8A 4OOIA 2E7WA 3GW2A 2EFPA 4EV0A 2A07F 2L01A 2RDPA 5D8KB 3I53A 1Q1HA 4EVIA 1UHWA 1YW7A 3EYYA 1OYYA 3EETA 5DCMA 1RIOH 2Z99A 3PFIA 1RI7A 3KETA 2O3FA 3I59A 4L0ZB 1BI1A 3TDUC 3ZMTA 4IRHA 2QQ9A 2UXXA 4KN4X 4KYWA 5FFZA 3MZHA 1J59A 3I58A 3FM3A 5D6EA 3SFZA 3G73A 2CGPA 3HHHA 3FXUA 3P9IA 2ADUA 1IRFA 2F5EA 1IN4A 3T8RA 4CDGA 1OKRA 1TQPA 4GYGA 3I64A 2OD5A 5HLGA 4R79A 4ENJA 2DT5A 2EJRA 2VOPA 2XUBA 1HXDA 4UUVA 1W5TA 1U8RA 4LK0F 4AVPA 2P5VA 3ZN0A 4Q5SF 2DU9A 2H94A 2ZXJA 4FX0A 1MD0A 3V7CA 2R3SA 4M73A 3TO6A 1R22A 1SMTA 2D1HA 1FLIA 2Y75A 1P92A 2CSOA 2HGCA 5HDNA 2ACJA 2W25A 3HRTA 4G7HF 2YX7A 1ZRDA 5LBQA 5LRRA 3Q5FA 2VXZA 4N9IA 2K27A 2P5LC 3HSFA 1MJBA 4PGHA 2C6YA 3WTVC 3I0TA 2M8EA 3H3UA 4RB0A 1TLHB 1YG2A 3TKYA 2HTJA 1TQIA 1XSXA 1T6SA 1BBYA 2KJCA 4XBFA 2MD5A 1E2XA 3VB2A 3DPLC 1KQ0A 2MLGA 2QYOA 3CJNA 4G7OF 4E70A 4G8XA 1HSTA 3B73A 4LG0B 5BQTA 1J5YA 3V4GA 2HDCA 2KRFA 2ZMEA 5D5WB 4I02A 1G3YA 5HOOA 3TO9A 3CDHA 1ODDA 3FMRA 2HZTA 4EJWA 4IPAA 3KP4A 2XAJA 3F8MA 1XCBA 2RQPA 3CUOA 4Y15A 4HX4A 2XAFA 4GYIA 3WE2A 5FD5A 5FD6A 3K69A 3QOPA 1PP8F 1C0WA 3LAJA 4P9FA 5ERIA 1YS7A 1KA8A 1YW8A 1GHCA 3WODF 3COAC 4OU0A 3KLNA 4IXAA 2R7DA 4D0PA 1AWCA 1B9NA 5D5VB 3QU3A 3B02A 4R1HA 1ZRCA 4KUMA 4EM0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 F;  2JRT A;  5K1Y A;  2IT0 A;  4L9T A;  5L3G A;  1R58 A;  5L3D A;  3W6J B;  3RKW A;  3BOQ A;  4HA8 A;  1W7P B;  2VN2 A;  1I6X A;  4HV6 A;  1T39 A;  3ISP A;  3FWE A;  2CFX A;  2KJB A;  3DQV C;  1BM9 A;  5FLX K;  1MDM A;  3LST A;  4L5I A;  1MGT A;  2M30 A;  3RTR A;  2PBI A;  1S7O A;  3CO7 C;  4WF2 A;  5BOX A;  5JFR A;  5DEQ A;  1WI9 A;  4YFN F;  1LQ1 A;  4EQQ A;  2F5F A;  1X3U A;  3LAP A;  3IRR A;  4K2E A;  3F23 A;  4YIF A;  3AAF A;  1B6A A;  2FE3 A;  1J9I A;  3K0L A;  5HDK A;  1KU9 A;  2HTS A;  1EH6 A;  4LGW A;  3REO A;  5DDG A;  2ZJ2 A;  5HS7 A;  1I1S A;  5LGU A;  1XMK A;  1FYL A;  1LEB A;  1G4D A;  5LGN A;  5L3F A;  4HF2 A;  2GWR A;  4WX9 A;  2WV0 A;  3GO5 A;  3KZY A;  2TDX A;  4P55 A;  3IC7 A;  4KDP A;  2JPC A;  1DPU A;  2L4M A;  4ASN A;  4EM2 A;  1R1V A;  1P2F A;  2A61 A;  1HW2 A;  2E1C A;  3MQ0 A;  2RC4 A;  1Z9C A;  2EV0 A;  4M71 A;  2X4H A;  3EDP A;  3Q9V A;  1P4X A;  2DPD A;  1BOA A;  4LLL A;  3MWM A;  1SD5 A;  1EV7 A;  2WC2 A;  4A5N A;  2RGV A;  3D5L A;  3IHU A;  3BWG A;  2VC1 A;  5HLI A;  1R23 A;  4UNO A;  3HRM A;  1W4M A;  1ZYR F;  2EFW A;  1G3T A;  4U7D A;  4CYD A;  2QZ8 A;  1JGS A;  4I0B A;  1WWX A;  2MC3 A;  5E1Z B;  2FML A;  4BHB A;  4BH9 A;  3ECO A;  2COM A;  4KT5 C;  2IW5 A;  1O57 A;  3CUQ C;  3J81 Z;  2JPB A;  4QWQ A;  1ZHF A;  1K78 B;  1S8N A;  2CYY A;  1JE8 A;  3BPX A;  2XKO A;  1S7A A;  2OZ6 A;  2MH9 A;  3ELK A;  1Z1D A;  1IXR C;  2D1V A;  3WGG A;  3FXR A;  4G6Q A;  4RB3 C;  4EGZ A;  5IT9 K;  2CW0 F;  2V79 A;  2P5K A;  4GO1 A;  5J6X A;  2BBY A;  1IAW A;  4KIF A;  3LA2 A;  4U88 A;  5DUI A;  3ULQ B;  3F3X A;  4ZYE A;  4G7Z F;  2EK5 A;  3RI4 A;  2ZKZ A;  2QBY A;  3BRO A;  3P9K A;  1LB2 A;  4UVA A;  2O61 A;  4P5O A;  3I5U A;  3JAM K;  2EFQ A;  4AIK A;  1LNW A;  2K86 A;  4BXU A;  3RKY A;  4L9V A;  1BN5 A;  2YSR A;  1LDD A;  1WRJ A;  2HKX A;  3RPQ A;  4EJU A;  2ZNY A;  4EJV A;  4LLN A;  1ZG5 A;  4FT8 A;  2FEZ A;  3LA7 A;  2M5W A;  2ETH A;  4S04 A;  1IN6 A;  2L4A A;  3CUQ B;  1KU3 A;  2PMH A;  5E20 A;  3LWF A;  3KFW X;  3MCZ A;  5ILU A;  4L5J A;  3JSP A;  3DXJ F;  3BJO A;  3O3K A;  5BPI A;  4I09 A;  3C1D A;  3QU6 A;  3KE2 A;  1TNT A;  3WE3 A;  1R36 A;  4RGU A;  1YS6 A;  1S3J A;  5EEG A;  4L18 B;  1GXP A;  2G7H A;  2HOE A;  5CVJ A;  2FBH A;  3OV8 A;  4NQW A;  3HOS A;  5JVT A;  1KU7 A;  2L3D A;  3RKX A;  2EV6 A;  2FXA A;  1F9N A;  4BYY A;  2L54 A;  1KQ8 A;  4KMF A;  4ZYH A;  4B09 A;  4O3M A;  2RN7 A;  3S2W A;  1YO5 C;  2DFI A;  3GUD A;  3QPH A;  3G3Z A;  4M9X A;  5E17 F;  2YPR A;  1J0R A;  3FXQ A;  2VT2 A;  5DCM B;  4Y13 A;  2KKO A;  3D0S A;  5E1X A;  3CTA A;  3V8J A;  4JK1 X;  2UZK A;  2D45 A;  3T0Y A;  3WU1 B;  4P96 A;  1ZRE A;  2LDU A;  2XRO A;  4P9U A;  1QQI A;  1SD6 A;  4ENK A;  2HFH A;  4UHT A;  1IZ1 A;  1TTY A;  1H0M A;  2BV6 A;  2FA5 A;  2XV4 S;  3LFK A;  1A04 A;  1UB9 A;  2ELH A;  4IF4 A;  3SXY A;  4BQA A;  4M6X A;  3RYP A;  4MQ9 F;  4LD5 A;  5LHI A;  5F64 A;  5F6F A;  4JBA A;  3ZMU A;  2M1B A;  3PQJ A;  4L9N A;  3M8E A;  5A2Q Z;  1S6L A;  5ICG A;  3KP5 A;  1R5G A;  3R6S A;  3N4M A;  4XLP F;  3E6D A;  1ZG3 A;  3FX3 A;  4GXO A;  4KIC A;  3MAJ A;  4RAZ A;  1K6O A;  3U2R A;  2Z3Y A;  3DEU A;  1STZ A;  1IXC A;  2EFO A;  1OR7 A;  2VOO A;  3ECH A;  3EYI A;  1FPQ A;  5K5R A;  1U6G A;  2F2E A;  1YFH A;  1ZH5 A;  3LQQ A;  2BGC A;  4XRF A;  2LF8 A;  1PP7 U;  4EMS A;  4YFK F;  1U5T A;  2CG4 A;  4NHJ A;  2GXG A;  4A6E A;  5D5U B;  3IKV A;  4G6D A;  1BIA A;  2H6C A;  3K2Z A;  5D8L B;  3M7G A;  2Q0O A;  4Q4Z F;  1FP2 A;  5BPD A;  4XSX F;  2GXB A;  3GZ5 A;  2V1X A;  3N97 A;  3ZMZ A;  3L7W A;  1W5S A;  1XD7 A;  4UV9 A;  1IN5 A;  3LQR A;  2VC0 A;  1WQ2 A;  4WK8 F;  5DUK A;  5LEJ A;  3TO7 A;  4IRI A;  2PJP A;  2OQG A;  3DFG A;  3CLO A;  1SD7 A;  5D5X B;  1ZAR A;  3ZP5 A;  3E6M A;  3FMS A;  2K7L A;  3J80 Z;  5LLQ A;  3HYI A;  5ICF A;  4EM1 A;  2RV8 A;  1TQM A;  2STW A;  3M9A A;  5FFX A;  4O6J A;  5DD4 A;  4EJT A;  3DP7 A;  2QVO A;  1XDU A;  3WG9 A;  2A6H F;  3M8F A;  2FBK A;  4PZJ A;  1HKQ A;  4XSZ F;  4ZYD A;  3KZZ A;  2MLK A;  3GWZ A;  1SAX A;  2GAU A;  3RYR A;  4LFU A;  3F8B A;  2B0L A;  2OA4 A;  4BNC A;  2E1N A;  1I5Z A;  2P6T A;  1LDJ A;  2QQB A;  4WXC A;  2W84 A;  5LGT A;  5L3B A;  1YTY A;  1T98 A;  3GEZ A;  4O5V A;  2MH2 A;  2NS0 A;  2LNB A;  2ESN A;  3E6C C;  1MDM B;  1CF7 B;  2O03 A;  3E5X A;  1OMI A;  3SZP A;  4G9Y A;  3FM5 A;  1W7P A;  3HSR A;  4MQV A;  1O7L A;  5BS6 A;  3WTX C;  2J5O A;  5AIQ A;  4RB2 C;  1LJ9 A;  1O3R A;  2JSC A;  1HQC A;  3E5Q A;  5FLX Z;  2RNJ A;  3TOB A;  4A0Z A;  4DNC A;  2RKH A;  3WU0 A;  1HBX G;  2QLZ A;  3R4K A;  3HIF A;  3F8C A;  3NEU A;  2V9V A;  2P8T A;  1SMY F;  4ETS A;  3SHF A;  3MZY A;  3TOA A;  1OYI A;  4ESF A;  1P4W A;  1SFU A;  3H3Z A;  5E18 F;  2GA2 A;  4BAY A;  1QO0 D;  1XSV A;  2PQ8 A;  4LJZ F;  4ENM A;  4A12 A;  1BI3 A;  1QGP A;  1XGO A;  2EFN A;  1IN7 A;  2Y0M A;  4IJA A;  4OIP F;  2V6C A;  1JHF A;  2BYV E;  2A68 F;  3RJP A;  3FZV A;  1KGS A;  1YW9 A;  2QEN A;  1XSD A;  2CO5 A;  1HW1 A;  2VBY A;  4I0A A;  1FY7 A;  2AS5 F;  1BC8 C;  3HUG A;  2V1U A;  2HR3 A;  2W85 A;  4M74 A;  3T1B A;  2M87 A;  4N9H A;  1ZN2 A;  4U0W A;  3GZ6 A;  1F1Z A;  3KCC A;  1SFX A;  1RUN A;  2K4J A;  4A2U A;  2G9W A;  3SZT A;  2FSW A;  1O3S A;  2HYF A;  2ISY A;  3W6K B;  2P7C B;  4HAM A;  2HQR A;  4GGG A;  2X0L A;  3I54 A;  4U0V A;  4CIC A;  1ZG1 A;  3KP2 A;  2UXN A;  1TNS A;  1R5H A;  2NRA C;  2LF7 A;  3ZMV A;  3PQK A;  5D4R A;  1Z05 A;  2PG4 A;  4OIO F;  5CVU A;  4ENN A;  1XMA A;  3TGN A;  1R1T A;  4HV5 A;  1OYW A;  1H9T A;  2XVC A;  5FGM A;  1BI2 A;  2EA2 A;  2VOD A;  3VOE A;  3E5U A;  4KN7 X;  2DQR A;  4EJO A;  2NAZ A;  1S29 A;  5L3E A;  3RPU A;  1K78 A;  1I27 A;  1HKT A;  5E8G A;  4MTD A;  1DPR A;  3C18 A;  1LDK B;  3F6V A;  2UWM A;  3K1P A;  4AWX B;  1H9G A;  2QBY B;  3R0A A;  2DW4 A;  3BDD A;  1GXQ A;  2O6G E;  5H20 A;  2IRF G;  1IXS B;  3J7A O;  1J7K A;  3NQO A;  4HLY A;  4I98 B;  5ICE A;  1ZLK A;  2YX4 A;  1PUE E;  1WKM A;  5H6Q A;  5IT3 A;  3O6B B;  2FRH A;  5CLS A;  3BZ6 A;  3BPV A;  3QPT A;  5CVI A;  1TW2 A;  3GFM A;  1P4A A;  2QM3 A;  3OOP A;  4KMU X;  3DKW A;  3QP6 A;  1QZY A;  2NYX A;  1GVJ A;  2HWV A;  2XAQ A;  2HKO A;  5CVR A;  4Q47 A;  1E17 A;  4IVN A;  3IKT A;  4LB5 A;  2WTE A;  2HEO A;  3CUQ A;  3GF2 A;  2NNY A;  1RUO A;  4CZZ A;  1BI0 A;  2PN6 A;  1AOY A;  3E6B A;  1L0O C;  4A5M A;  5CJ9 A;  3WTY C;  1HW5 A;  2CQK A;  2Y48 A;  1LEA A;  4YII A;  2EWN A;  2JT1 A;  3BJA A;  2IA1 A;  2VON A;  4HW0 A;  1Z6R A;  5H6R A;  4RB1 A;  5FO5 A;  1YQA A;  2J5P A;  5JI6 A;  2XGX A;  3BJ6 A;  3KEQ A;  1U5T C;  3BY6 A;  2PI0 A;  3HRS A;  1XCV A;  2DBB A;  3DV8 A;  1FOK A;  1P6R A;  3I59 B;  3R60 A;  5FB2 A;  1R1U A;  3U1D A;  2H27 A;  3CO6 C;  5LHG A;  5LEK A;  2V1D A;  1G6N A;  2GQQ A;  4AD9 A;  1RNL A;  3JW4 A;  5JHU A;  4DQ2 A;  5J8C A;  2A3S A;  3MEX A;  2OU2 A;  4ESB A;  1FYK A;  1T2K A;  1O3T A;  4XLN F;  2OAZ A;  1JHH A;  1SFE A;  2GA1 A;  5ED4 A;  4PCQ A;  5A2Q K;  4HDU A;  3I71 A;  1USS A;  3NRV A;  2FMY A;  3EUH A;  3JTG A;  5DV5 A;  1D8K A;  2PMU A;  2W24 A;  2HQN A;  2VE9 A;  3C3W A;  2IJL A;  3ML6 A;  3TDZ C;  1MJ9 A;  1KU2 A;  2ZBK A;  5AIP A;  4ON0 A;  2VT3 A;  2XAS A;  1T38 A;  4LB6 B;  3GXO A;  2DTR A;  4BHP A;  2YR2 A;  1FX7 A;  4RGS A;  1DUX C;  4HX7 A;  3VOD A;  1KQ9 A;  4KA4 A;  2A69 F;  1FP1 D;  4IHT A;  4LLG F;  1O7F A;  1Y0U A;  4S05 A;  2A5Y B;  3F8N A;  1B59 A;  1Z6T A;  1U5T B;  3I4P A;  5JR3 A;  1VTN C;  3ZN1 A;  4I2O A;  1FT9 A;  4A0Y A;  2ZFW A;  5AON A;  2PFB A;  4UXN A;  1T0F A;  3C7J A;  1UFM A;  4KIB A;  4MNU A;  3L09 A;  1EH8 A;  2HYG D;  1ON2 A;  1K7A A;  2VBX A;  4TV7 A;  5DCF A;  5CVV A;  4CHU A;  2O8X A;  1DDN A;  2DK8 A;  2QUF A;  2KIF A;  1ONV A;  2ZME B;  2DPU A;  2PLY A;  4U0Y A;  2KIU A;  2P7V B;  3IRQ A;  4HOB A;  1ZAO A;  4UVB A;  5TRD A;  3R0J A;  4FHT A;  1G3W A;  1FBS A;  4LG0 A;  3J80 K;  1XGM A;  3GFL A;  3IWZ A;  1JXS A;  3DF8 A;  3VEP A;  1FZP B;  4L9J A;  1J75 A;  1U2W A;  2M45 A;  4QLC U;  4HYE A;  3M1E A;  2IVM A;  1EH7 A;  3K9T A;  2PEX A;  4RGR A;  1ULY A;  3R61 A;  1V3F A;  3BP8 A;  2ESH A;  2HS5 A;  3LA3 A;  4OIN F;  3T8T A;  2GZW A;  3KLO A;  1DP7 P;  2DK5 A;  3L2C A;  3DPT A;  3WTS C;  3E3V A;  2ZCW A;  1L3L A;  5K5O A;  3TQN A;  2W57 A;  3WTU C;  4LMY A;  3IWF A;  1ZGJ A;  2DLL A;  1SD4 A;  2FNA A;  2VE8 A;  4OIQ F;  2CWE A;  5EEH A;  1D3Y A;  5D6F A;  2DO7 A;  1UCR A;  4RGX A;  5LHH A;  4ZYG A;  1IRG A;  3V7R A;  3KP3 A;  3EQL F;  3L00 A;  1ON1 A;  3VFZ A;  2Z5U A;  3P9C A;  1CGP A;  3ZQ7 A;  3L9F A;  4G94 A;  1XN7 A;  1IUY A;  1FNN A;  2IA0 A;  5E8I A;  1FSE A;  1ZRF A;  5KK1 A;  2DQL A;  3ROU A;  1I1G A;  3ZMS A;  2RVC A;  2VBW A;  4Y17 A;  1FC3 A;  1Z91 A;  4WXD A;  3ABT A;  3HSE A;  5HS8 A;  3JTH A;  5CYV A;  1PDN C;  5HLH A;  2LSO A;  1R00 A;  3V7S A;  4H0E A;  4YG2 F;  3GFJ A;  2LKP A;  1CF7 A;  4ESJ A;  1HKS A;  3KEO A;  1B1B A;  3H92 A;  3RDI A;  4WXH A;  3P7N A;  3V8K A;  4MEX F;  4HZF A;  4HF0 A;  4MTE A;  1QBJ A;  2E7X A;  3JSO A;  4OIR F;  2QWW A;  1F4K A;  4GCV A;  1B9M A;  4F7Z A;  4M9Z A;  2ISZ A;  3IL2 A;  4PGG A;  3F21 A;  1D8J A;  6PAX A;  4A6D A;  2FOK A;  4HLX A;  1FBQ A;  2FU4 A;  4Q48 A;  1J2X A;  3MFK A;  4AIH A;  3SQN A;  2IPQ X;  5HDG A;  3K1M A;  3GFI A;  3FMQ A;  2L02 A;  1XGS A;  3O2P E;  1BJA A;  1TW3 A;  1B4A A;  1YLF A;  4L0Y B;  1G3S A;  1FWZ A;  1TBX A;  1BIB A;  3GX4 X;  4PDK A;  5L3C A;  4N0B A;  2XHK A;  4KIG A;  2R7F A;  1YIO A;  5D4S A;  3F22 A;  4A0X A;  3ERE D;  4HBL A;  1ZGA A;  1D5V A;  2BE5 F;  4CO8 A;  2KIM A;  1W7P D;  1FYM A;  2XAG A;  2STT A;  3WTT C;  3F72 A;  2H09 A;  5TJJ A;  5KVR A;  4I7H A;  2EB7 A;  1XGN A;  1Z7U A;  2K4B A;  3FHZ A;  4RS8 A;  4ZH4 F;  4KFC A;  1XB4 A;  2Z9O A;  1NHA A;  3K1N A;  4LK1 F;  5J8F A;  4I01 A;  4JQF A;  1OPC A;  2A6E F;  5K5Q A;  3J81 K;  1HSJ A;  1FBU A;  3F6O A;  2BEO A;  2FF4 A;  3WGH A;  2JZY A;  1UHM A;  3Q9S A;  4BHC A;  4OMY A;  2XRN A;  4U7B A;  2FNP A;  4ZZL A;  3FF5 A;  1RZ4 A;  2EV5 A;  4MGR A;  5ICC A;  1UST A;  1V4R A;  2AXL A;  4IRG A;  4WWC A;  3HTS B;  4M72 A;  1KYZ A;  2MA3 A;  4M6Y A;  3GVA A;  3WTZ A;  2WWY A;  4EGY A;  2ZNZ A;  4OMZ A;  2Z33 A;  5BMZ A;  2OZU A;  5DYM A;  3U9G A;  5E1W A;  2D2W A;  1KYW A;  2O0Y A;  2FQ3 A;  3T5X A;  3ABU A;  4CGZ A;  2FBI A;  3HTU A;  4MEY F;  3HRU A;  3RIR A;  2VBZ A;  5IT9 Z;  4AIJ A;  3QP5 A;  2IA2 A;  4HQE A;  3F8F A;  3KP7 A;  5LRS A;  1U78 A;  3HOT A;  2K02 A;  3ZMD A;  3V8L A;  4HDV A;  4CXF A;  2H6B A;  1WSU A;  2DAO A;  2P4W A;  1MKM A;  2XIG A;  4HQM A;  1FSH A;  3QAH A;  1U3E M;  2QQA A;  1O3Q A;  1F5T A;  4WCG A;  1MZB A;  3JAM Z;  2XAH A;  4ZZD A;  1QNT A;  3ZPL A;  3GYH X;  2F5D A;  4R8H A;  1YYV A;  4Z2Y A;  1XDS A;  4UV8 A;  1K79 A;  4YFX F;  1BC7 C;  3WTW C;  4M9S A;  4MHG A;  2MBF A;  2P6S A;  5DD8 A;  4RAY A;  1R7J A;  5F1R A;  1MJA A;  5HS9 A;  2Q8K A;  3HHG A;  2IP2 A;  2DI3 A;  2EA4 A;  2OBP A;  1IN8 A;  1REP C;  1ZLJ A;  2GIV A;  2XKP A;  5ILV A;  4KNY A;  4NB5 A;  2F5C A;  2ZO4 A;  4UVC A;  1QZZ A;  3WGI A;  1LVA A;  2YU3 A;  3E97 A;  2Q2E A;  5ILS A;  4B8X A;  2OQR A;  4IHS A;  2G7U A;  1QPM A;  4FX4 A;  1IF1 A;  2NNN A;  3KP6 A;  3QRF F;  3GLX A;  2JTV A;  5HVQ C;  4HF1 A;  4HX8 A;  4OOI A;  2E7W A;  3GW2 A;  2EFP A;  4EV0 A;  2A07 F;  2L01 A;  2RDP A;  5D8K B;  3I53 A;  1Q1H A;  4EVI A;  1UHW A;  1YW7 A;  3EYY A;  1OYY A;  3EET A;  5DCM A;  1RIO H;  2Z99 A;  3PFI A;  1RI7 A;  3KET A;  2O3F A;  3I59 A;  4L0Z B;  1BI1 A;  3TDU C;  3ZMT A;  4IRH A;  2QQ9 A;  2UXX A;  4KN4 X;  4KYW A;  5FFZ A;  3MZH A;  1J59 A;  3I58 A;  3FM3 A;  5D6E A;  3SFZ A;  3G73 A;  2CGP A;  3HHH A;  3FXU A;  3P9I A;  2ADU A;  1IRF A;  2F5E A;  1IN4 A;  3T8R A;  4CDG A;  1OKR A;  1TQP A;  4GYG A;  3I64 A;  2OD5 A;  5HLG A;  4R79 A;  4ENJ A;  2DT5 A;  2EJR A;  2VOP A;  2XUB A;  1HXD A;  4UUV A;  1W5T A;  1U8R A;  4LK0 F;  4AVP A;  2P5V A;  3ZN0 A;  4Q5S F;  2DU9 A;  2H94 A;  2ZXJ A;  4FX0 A;  1MD0 A;  3V7C A;  2R3S A;  4M73 A;  3TO6 A;  1R22 A;  1SMT A;  2D1H A;  1FLI A;  2Y75 A;  1P92 A;  2CSO A;  2HGC A;  5HDN A;  2ACJ A;  2W25 A;  3HRT A;  4G7H F;  2YX7 A;  1ZRD A;  5LBQ A;  5LRR A;  3Q5F A;  2VXZ A;  4N9I A;  2K27 A;  2P5L C;  3HSF A;  1MJB A;  4PGH A;  2C6Y A;  3WTV C;  3I0T A;  2M8E A;  3H3U A;  4RB0 A;  1TLH B;  1YG2 A;  3TKY A;  2HTJ A;  1TQI A;  1XSX A;  1T6S A;  1BBY A;  2KJC A;  4XBF A;  2MD5 A;  1E2X A;  3VB2 A;  3DPL C;  1KQ0 A;  2MLG A;  2QYO A;  3CJN A;  4G7O F;  4E70 A;  4G8X A;  1HST A;  3B73 A;  4LG0 B;  5BQT A;  1J5Y A;  3V4G A;  2HDC A;  2KRF A;  2ZME A;  5D5W B;  4I02 A;  1G3Y A;  5HOO A;  3TO9 A;  3CDH A;  1ODD A;  3FMR A;  2HZT A;  4EJW A;  4IPA A;  3KP4 A;  2XAJ A;  3F8M A;  1XCB A;  2RQP A;  3CUO A;  4Y15 A;  4HX4 A;  2XAF A;  4GYI A;  3WE2 A;  5FD5 A;  5FD6 A;  3K69 A;  3QOP A;  1PP8 F;  1C0W A;  3LAJ A;  4P9F A;  5ERI A;  1YS7 A;  1KA8 A;  1YW8 A;  1GHC A;  3WOD F;  3COA C;  4OU0 A;  3KLN A;  4IXA A;  2R7D A;  4D0P A;  1AWC A;  1B9N A;  5D5V B;  3QU3 A;  3B02 A;  4R1H A;  1ZRC A;  4KUM A;  4EM0 B; 
#chains in the Genus database with same CATH topology
 1IW7 F;  2JRT A;  2LFB A;  3BC8 A;  5K1Y A;  2KDZ A;  1K83 J;  1UHS A;  1X1D A;  3I4N J;  1W0T A;  2JA2 A;  2IT0 A;  1QHH D;  4L9T A;  1ENH A;  2L7F P;  5L3G A;  3Q0V A;  1R58 A;  1V54 H;  5L3D A;  3GTM J;  2L9S A;  1UJ8 A;  3W6J B;  2HYJ A;  3RKW A;  2GIZ A;  3BOQ A;  4HA8 A;  5EG0 B;  2L9R A;  2RRE A;  2WY8 Q;  5F1J A;  3S15 J;  1W7P B;  2VN2 A;  1DGR M;  1OFC X;  1I6X A;  3RZD J;  4HV6 A;  5F27 A;  4XIC A;  3MMY B;  5HNH A;  2WV1 A;  4YIR X;  2VQH A;  1IGN A;  4FE7 A;  5F08 A;  1T39 A;  3ISP A;  3FWE A;  2CFX A;  2KJB A;  3GBG A;  5FKN A;  2EZI A;  1BM9 A;  3DQV C;  5FLX K;  1MDM A;  3LST A;  4L5I A;  1MGT A;  2M30 A;  3RTR A;  2PBI A;  3SJM A;  1S7O A;  2MYS A;  3S1N J;  3CO7 C;  4WF2 A;  5IP7 J;  1MSE C;  3JRC A;  5BOX A;  2K3P A;  2FUG 2;  3CCM I;  5JFR A;  3VSL A;  2JQ7 A;  2ICW G;  2VLA A;  2HDD A;  5DEQ A;  4PSW A;  1WI9 A;  4UB6 C;  4YFN F;  1LQ1 A;  2DMT A;  4EQQ A;  2F5F A;  4OAY A;  1X3U A;  3LAP A;  3IRR A;  4K2E A;  4BE1 A;  4ZC3 A;  5IP6 A;  1HA8 A;  1PUF A;  1MMS A;  2E36 A;  4YIF A;  3F23 A;  3AAF A;  2M0M A;  1B6A A;  2FE3 A;  2AXT C;  1J9I A;  3TBI A;  2GXA A;  3K0L A;  5HDK A;  1KU9 A;  1MBF A;  3DU5 A;  3AG4 H;  4F91 B;  2HTS A;  3HGY A;  1EH6 A;  4LGW A;  1WJF A;  2B63 J;  2IBD A;  3REO A;  5DDG A;  3QQA A;  1TWH J;  2ZJ2 A;  2ZB9 A;  3CCQ I;  4B43 A;  1VQM I;  5HS7 A;  1I1S A;  2VKD A;  5LGU A;  1XMK A;  2DJI A;  1FYL A;  1LEB A;  1G4D A;  5LGN A;  5L3F A;  2OJE D;  4HF2 A;  2KRH A;  2GWR A;  3ASO H;  2R92 J;  2M34 A;  2XF7 A;  4WX9 A;  2IS4 A;  1A6I A;  2BW3 B;  4XOT A;  2ZJP F;  2WV0 A;  3CMY A;  1MMN A;  3GO5 A;  2XPU A;  2QKL B;  2P0W A;  3KZY A;  3S1M J;  5E79 C;  4XKC A;  2TDX A;  4P55 A;  3IC7 A;  4KDP A;  3PNY A;  2JPC A;  3HUG B;  3M4O J;  1DPU A;  2L4M A;  2EZH A;  4ASN A;  4EM2 A;  3CD6 I;  4QPQ A;  3CJT B;  2WBM A;  3KYL A;  2BVM A;  1R1V A;  1P2F A;  2A61 A;  5KAF C;  1HW2 A;  2E1C A;  3MQ0 A;  2O8K A;  2RC4 A;  1Z9C A;  1IRZ A;  2EV0 A;  4M71 A;  2X4H A;  5EZG A;  2KZV A;  3EDP A;  3Q9V A;  1P4X A;  4PFO A;  2DPD A;  2EZK A;  3CC7 I;  1BOA A;  1U9N A;  2DDA A;  4LLL A;  1A36 A;  2WAQ A;  3OYL A;  3MWM A;  3CCR I;  1SD5 A;  1EV7 A;  2QCO A;  2WC2 A;  1WJ5 A;  4A5N A;  2RGV A;  3D5L A;  2LG4 A;  2K9Q A;  3BQY A;  2V26 A;  3IHU A;  3BWG A;  3K4M A;  2VC1 A;  5HLI A;  4ZTF A;  1R23 A;  2HPM A;  3HRM A;  3DTK A;  4UNO A;  1W4M A;  1ZYR F;  2EFW A;  1XMX A;  3OYG A;  3QPL A;  2E5Z A;  1G3T A;  4U7D A;  4CYD A;  2QZ8 A;  1JGS A;  4I0B A;  1WWX A;  2MC3 A;  5E1Z B;  1QRY A;  3SDB A;  3A03 A;  2FML A;  5BNG A;  4BHB A;  2JN6 A;  4BH9 A;  3ECO A;  3CCJ I;  2LKX A;  2COM A;  2X85 A;  5FLV A;  2OCC H;  4KT5 C;  2LD5 A;  3Q0U A;  3MKZ A;  3HG9 A;  2IW5 A;  4PFP A;  3A0H C;  1O57 A;  3CUQ C;  3J81 Z;  1VQP I;  2JPB A;  4QWQ A;  1ZHF A;  2CU7 A;  1K78 B;  1S8N A;  5EEA A;  2CYY A;  1JE8 A;  1HDP A;  4Y3O A;  4BEH A;  3BPX A;  2CFO A;  2A5W A;  2NXN B;  2XKO A;  1I3Q J;  1S7A A;  3OWT A;  1B8I A;  2O7O A;  1HDD C;  2OZ6 A;  3U21 A;  2MH9 A;  3ELK A;  1Z1D A;  1X4O A;  1IXR C;  3BG3 A;  1X2M A;  2D1V A;  3GTQ J;  3WGG A;  2W48 A;  1LFP A;  3EUA A;  1EKE A;  3FXR A;  4G6Q A;  4RB3 C;  3CME I;  1V5E A;  4XNF A;  4EGZ A;  2DYS H;  2CUZ A;  1MNM C;  5IT9 K;  1T33 A;  2CW0 F;  2V79 A;  2P5K A;  3PSI A;  1Z77 A;  4GO1 A;  5J6X A;  2BBY A;  1IAW A;  4KIF A;  1ORK A;  3WU2 C;  4CSW A;  3A4C A;  3LA2 A;  4U88 A;  3NWT A;  5DUI A;  4LIV A;  3ULQ B;  3F3X A;  3LSK A;  4ZYE A;  4G7Z F;  4PJL A;  2EK5 A;  3RI4 A;  1MMA A;  2ZKZ A;  2YS9 A;  3IV5 A;  3BRO A;  2GOX B;  2QBY A;  1NG6 A;  2XRL A;  3P9K A;  3H5R A;  1LB2 A;  1JKP C;  3S1R J;  4E7K A;  5KNL A;  4UY8 I;  4UVA A;  2K40 A;  2WB1 A;  2O61 A;  4P5O A;  4BUP A;  3I5U A;  5EZH A;  1HCR A;  3K4K A;  1EA3 A;  1MH3 A;  3JAM K;  2EFQ A;  1LNW A;  4AIK A;  2K85 A;  3ZQF A;  2K86 A;  3M07 A;  4BXU A;  2ME6 A;  3RKY A;  4L9V A;  2IAI A;  1BN5 A;  2E1M C;  2YSR A;  2ID3 A;  1LDD A;  2IXS A;  1ETK A;  2K5C A;  1WRJ A;  2XPW A;  3ZGK A;  2JUC A;  1G8X A;  3B6C A;  1JUM A;  2ELK A;  2HKX A;  3RPQ A;  5DTD A;  4EJU A;  2VXD A;  2ZNY A;  4EJV A;  4LLN A;  2M4K A;  1ZG5 A;  1D1A A;  3VYR B;  1I3A A;  4FT8 A;  2DA3 A;  2FEZ A;  3LA7 A;  4CUG A;  2M5W A;  2ETH A;  2TRT A;  4S04 A;  1IN6 A;  1ERD A;  3SFI A;  3EUH C;  2L4A A;  3CUQ B;  3IH3 A;  2JA8 J;  1KU3 A;  2PMH A;  4EAT A;  5E20 A;  2Y0S A;  4AYB N;  2LRE A;  2Z1D A;  3LWF A;  4D7N A;  1VQ4 I;  3I55 I;  3KFW X;  2VJ4 A;  2L9V A;  3MCZ A;  5ILU A;  2XPV A;  4L5J A;  5EDN A;  3JSP A;  4A3I J;  3DXJ F;  3BJO A;  3O3K A;  4XK4 A;  5BPI A;  2E35 A;  4HSR A;  1MBG A;  4I09 A;  1KZH A;  3C1D A;  2PJR A;  3WHC A;  3QU6 A;  3KE2 A;  1TNT A;  1Y6I A;  3WE3 A;  1VF9 A;  1R36 A;  4BE2 A;  3H1C A;  1OCP A;  4RGU A;  1YS6 A;  1Y1W J;  1S3J A;  5EEG A;  1YI2 I;  4L18 B;  1GXP A;  2G7H A;  3CP2 A;  1LE8 B;  2HOE A;  5CVJ A;  4II3 A;  1E0E A;  2FBH A;  2DT6 A;  3OV8 A;  4NQW A;  4IOA F;  3S3N A;  4IX7 A;  3HOS A;  5JVT A;  2CQX A;  1VI0 A;  2NVT J;  4XN0 A;  1KU7 A;  2JK3 A;  1U9O A;  3FK6 A;  2L3D A;  3RKX A;  2EV6 A;  2LK2 A;  2R5Z B;  3PIP F;  2R5Y B;  2FXA A;  1E3H A;  1F9N A;  4BYY A;  5FKO A;  2L54 A;  1KQ8 A;  1R6R A;  4KMF A;  3WHB A;  5IOY A;  1R4N B;  4ZYH A;  4B09 A;  4O3M A;  2RN7 A;  4ZJZ A;  2M8G X;  4PSX A;  2M4G A;  3S2W A;  1YO5 C;  1T0F C;  2DFI A;  3GUD A;  1IJW C;  3QPH A;  2XB0 X;  3G3Z A;  1FIA A;  4M9X A;  4M6V A;  4HNT A;  5F04 A;  3AG1 H;  5E17 F;  2VQL A;  2YPR A;  4HEA 2;  3OYC A;  2BY3 A;  1J0R A;  3FXQ A;  2VT2 A;  3TMO A;  2BHZ A;  4DOZ A;  2E1M B;  1WH5 A;  5DCM B;  4Y13 A;  3CC4 I;  2KKO A;  1VQ5 I;  3D0S A;  5FJ8 J;  5E1X A;  3CTA A;  3GTK J;  1IG7 A;  3LSG A;  3V8J A;  5IY5 H;  4JK1 X;  2UZK A;  4XLH A;  5F0F A;  2D45 A;  2CMP A;  2CUJ A;  4FCY A;  3T0Y A;  2NOJ B;  3CDI A;  3WU1 B;  4CCN A;  4P96 A;  3SEZ A;  5DM7 F;  4B1R A;  5IPA A;  1MND A;  4HG2 A;  1ZRE A;  2LDU A;  1N77 A;  4HNV A;  2XRO A;  3QYF A;  1BJZ A;  3H9Q A;  4P9U A;  5FRN A;  1QQI A;  1SD6 A;  4ENK A;  1WGX A;  2HFH A;  4UHT A;  2MAB A;  1IZ1 A;  3BR1 A;  4DYR A;  3RZO J;  2LBF A;  1TTY A;  4EEF G;  1H0M A;  2X1E A;  2BV6 A;  2FA5 A;  2XV4 S;  3LFK A;  5EJC A;  1A04 A;  2CQ7 A;  3BG5 A;  1UB9 A;  2ELH A;  4IF4 A;  3SXY A;  4BQA A;  4M6X A;  2JA5 J;  3RYP A;  4MQ9 F;  4LD5 A;  5LHI A;  3JRE A;  4E7S A;  1VQN I;  3GTL J;  5F64 A;  1DP3 A;  5F6F A;  4JBA A;  3ZMU A;  2M1B A;  3PQJ A;  2E2J J;  4L9N A;  4LOC A;  2QSF X;  4J01 A;  2ZJR F;  2F4M B;  3M8E A;  5CPR B;  5A2Q Z;  3DEW A;  4RAG A;  4RLQ A;  1JTX A;  1S6L A;  5ICG A;  5IP9 J;  3KP5 A;  4C2M J;  1R5G A;  3R6S A;  3IAM 2;  5K7H A;  2X6W A;  3K4B A;  2OPT A;  2PMZ N;  4XLP F;  3N4M A;  4E7J A;  3E6D A;  5FKM A;  1X3W B;  2R7W A;  1ZG3 A;  3FX3 A;  4DYQ A;  4GXO A;  4KIC A;  4BDZ A;  3MAJ A;  5EF6 A;  3DBR B;  3J7A Y;  4RAZ A;  3S14 J;  3H3V K;  1K6O A;  3U2R A;  2Z3Y A;  3DEU A;  2NVX J;  1LPQ A;  1STZ A;  1IXC A;  1T8I A;  5J1Y A;  2EFO A;  1OR7 A;  2VOO A;  3ECH A;  3EYI A;  3C2B A;  1FPQ A;  4HST A;  5K5R A;  1U6G A;  2F2E A;  2OCE A;  2BXZ A;  1YFH A;  1A31 A;  1ZH5 A;  3LQQ A;  2BGC A;  4XRF A;  2LF8 A;  1PP7 U;  4EMS A;  1TWA J;  4YFK F;  2VL8 A;  2NVU B;  1U5T A;  2R7T A;  2CG4 A;  4NHJ A;  4HNU A;  4C2T A;  2IS6 A;  2ELJ A;  2GXG A;  4A6E A;  5D5U B;  1ETW A;  3IKV A;  2E5N A;  3BLY A;  4G6D A;  5J3L A;  1BIA A;  4H4K C;  2H6C A;  5EGO B;  2X9D A;  2W1O A;  3OIQ A;  3K2Z A;  5D8L B;  1ZTR A;  3M7G A;  2Q0O A;  2K3F A;  4Q4Z F;  1FP2 A;  3OYN A;  2DCE A;  5BPD A;  4A3D J;  1GUU A;  4XSX F;  2GXB A;  3GZ5 A;  4A3L J;  1T56 A;  2V1X A;  1X4P A;  4C30 A;  3CP8 A;  3PNV A;  3ZMZ A;  5IOZ A;  3LSR A;  3N97 A;  1LFB A;  1DGW Y;  4CCL A;  1RR8 C;  1R49 A;  3L7W A;  1W5S A;  1XD7 A;  3OIP A;  1IN5 A;  3LQR A;  3PL8 A;  4UV9 A;  2VC0 A;  4GDF A;  4MFD A;  1WQ2 A;  4W1U A;  2VPR A;  4WK8 F;  4XON A;  5DUK A;  2GBY A;  1Y8Q B;  5LEJ A;  3NAU A;  2VAS A;  2Y2Z A;  1NTC A;  3TO7 A;  4IRI A;  2PJP A;  2CV1 A;  3ZQI A;  1JJ6 C;  2OQG A;  3ONQ A;  2DT7 B;  4J00 A;  3DFG A;  3HXL A;  3HOX J;  1D0Z A;  3JRA A;  5J40 A;  4ZYA A;  3CLO A;  3RKQ A;  3GLL A;  2CV0 A;  2R7R A;  1SD7 A;  1OCC H;  2AQE A;  4P1W A;  1A6Q A;  3SZG A;  4DZP A;  5B3S H;  5D5X B;  4FAS D;  3DPU A;  4FIS A;  1ZAR A;  4C3I J;  3E6M A;  3ZP5 A;  3FMS A;  2K7L A;  3LSJ A;  4BQO A;  3ZQC A;  1F43 A;  3HOY J;  3ZXS A;  3J80 Z;  5LLQ A;  3HYI A;  4XN3 A;  4LG3 A;  5ICF A;  3JRF A;  2XB5 A;  3GTG J;  3K10 A;  4CYC A;  4EM1 A;  2OV7 A;  2RV8 A;  4E4H A;  3BQZ A;  1TQM A;  2STW A;  1H89 C;  3DLL F;  1MSF C;  3M9A A;  3PO2 J;  4L5E A;  1XS9 A;  4A3M J;  5FFX A;  3A02 A;  4O6J A;  1QZE A;  5DD4 A;  1VQ7 I;  4EJT A;  3DP7 A;  2QVO A;  1U0J A;  1XDU A;  1AKH A;  3F0C A;  2K9S A;  4XRS A;  2OF7 A;  3WG9 A;  3K2A A;  2A6H F;  2X6X A;  3LSM A;  3M8F A;  2FBK A;  4X6A J;  4PZJ A;  1HKQ A;  2BVL A;  1YIT I;  5J47 A;  4I76 A;  5E3M A;  1MW7 A;  4XSZ F;  4ZYD A;  2VPL A;  2ZC2 A;  4KT6 A;  3DTE A;  1R9T J;  2V9K A;  3KZZ A;  2MLK A;  4A3C J;  2M7B A;  1Q1V A;  3P5J A;  1BR1 A;  3LSP A;  2MC4 A;  3GWZ A;  1SAX A;  2GAU A;  3QOE A;  2BXY A;  2FD5 A;  3RYR A;  1GT0 C;  4LFU A;  3F8B A;  2CW8 A;  4BAC A;  2B0L A;  2DA5 A;  2JSP A;  2OA4 A;  2O5R A;  3TED A;  4BNC A;  2E1N A;  1IUF A;  1I5Z A;  3L2U A;  2P6T A;  1LDJ A;  2QQB A;  4WXC A;  3S3M A;  3QOD A;  2MG4 A;  4RM3 A;  2W84 A;  4MO7 A;  5LGT A;  3JR9 A;  1TT0 A;  3BG7 A;  4BL0 B;  2KDO A;  1X19 A;  2L7K A;  5L3B A;  2WY7 Q;  1YTY A;  1T98 A;  4FET A;  3BT9 A;  3GEZ A;  2W00 A;  2XGC A;  4O5V A;  2MH2 A;  2NS0 A;  1Z21 A;  5M5Y J;  2LNB A;  1WJD A;  2ESN A;  3E6C C;  1MDM B;  1CF7 B;  2O03 A;  3E5X A;  5EG0 A;  1OMI A;  2EIN H;  3JRB A;  3SZP A;  4G9Y A;  3FM5 A;  3M3Y J;  2ZXH A;  1W7P A;  2EH3 A;  3K70 D;  4E7H A;  3KYC B;  3HSR A;  4BJ6 C;  4MQV A;  3MKY B;  3HGG A;  2VI6 A;  1O7L A;  2F48 A;  5BS6 A;  4XKW A;  3FIS A;  3WTX C;  2VJJ A;  2J5O A;  3IP4 B;  3JRH A;  3W6V A;  5AIQ A;  4RB2 C;  3CMM A;  1FJL A;  1LJ9 A;  3ZRG A;  1O3R A;  3LFU A;  2JSC A;  1HQC A;  3E5Q A;  1S7E A;  5FLX Z;  2RNJ A;  2HVS A;  3F9K A;  3DCF A;  4IOC F;  3TOB A;  4A0Z A;  2VQC A;  4DNC A;  1EJ9 A;  4XL9 A;  2VJ5 A;  2DDB A;  1OJL A;  2RKH A;  3WU0 A;  2HXI A;  1HBX G;  3PUF A;  1JJ8 C;  2QLZ A;  3R4K A;  4RM2 A;  3HIF A;  4FE4 A;  3FXO A;  3PFY A;  2NVY J;  2VJI A;  2L0K A;  1WJC A;  3F8C A;  3NEU A;  1IV6 A;  2V9V A;  3BG6 A;  4PJ0 C;  2P8T A;  4A93 J;  1SMY F;  4ETS A;  2RNG A;  1OCZ H;  3Q3S A;  2VKE A;  3SHF A;  3MZY A;  3TOA A;  1OYI A;  1ETV A;  4ESF A;  1P4W A;  4AC0 A;  4ZDP A;  1SFU A;  3H3Z A;  5E18 F;  2LY9 A;  2GA2 A;  1JT6 A;  4BAY A;  1QO0 D;  1XSV A;  3TL4 X;  2PQ8 A;  4LJZ F;  2R4G A;  4M3D A;  4AYB A;  4ENM A;  2A6T A;  2R7U A;  3A1Y A;  4A12 A;  1WJE A;  4J19 A;  1W0U A;  1RRJ A;  4F92 B;  1BI3 A;  1QGP A;  2FX0 A;  1XGO A;  4X1E A;  2EFN A;  5GAH J;  1IN7 A;  3BZK A;  4UUS A;  1WJA A;  2Y0M A;  4IJA A;  4OIP F;  2V6C A;  3QYB A;  2D5V A;  3L2Q A;  4I6Z A;  1HLV A;  1JHF A;  2XGD A;  3W3C A;  1R5I D;  3OYI A;  2BYV E;  2A68 F;  4NUB A;  4BQQ A;  2CUF A;  2QSH X;  3E7L A;  2LOO A;  1O4X A;  4DBR A;  1N25 A;  2HVQ A;  1IC8 A;  2N8G A;  1BL0 A;  3S93 A;  4ZDL A;  3RJP A;  3FZV A;  1KGS A;  5M5W J;  1XTA A;  1OCT C;  1YW9 A;  2QEN A;  5B1A H;  1XSD A;  1IRX A;  2CO5 A;  2UUZ A;  3OYJ A;  4BY7 J;  2UV1 A;  1F36 A;  2EZL A;  1HW1 A;  2VBY A;  4I0A A;  1VQO I;  1FY7 A;  4M3G A;  2AS5 F;  1BC8 C;  3JRI A;  3ABL H;  1LKX A;  3HUG A;  2V1U A;  3HDD A;  1FTT A;  3QWL A;  1QVT A;  1SAN A;  2HR3 A;  3K7A J;  2QGU A;  5B66 C;  3OS0 A;  1MBK A;  2W85 A;  2IS2 A;  2VB6 A;  2K9M A;  4M74 A;  3T1B A;  3G2B A;  3L2R A;  2M87 A;  3BR3 A;  4N9H A;  1ZN2 A;  4RDU A;  4BBR J;  1X3Z B;  3S16 J;  4PJJ A;  4U0W A;  3GZ6 A;  2E60 A;  1F1Z A;  3KCC A;  1SFX A;  1RUN A;  2K4J A;  2KFD A;  4IL6 C;  4A2U A;  2G9W A;  5GPA A;  2HNH A;  3J7Z I;  3SZT A;  1WZ2 A;  5E3L A;  2FSW A;  1O3S A;  2HYF A;  2JMW A;  2WAD A;  2IGM A;  2ISY A;  3W6K B;  2P7C B;  4HAM A;  2HQR A;  1LFU P;  4GGG A;  2X0L A;  3I54 A;  4U0V A;  4CIC A;  1ZG1 A;  3KP2 A;  2UXN A;  1R5H A;  1TNS A;  2JWT A;  4D9J A;  2NRA C;  2LF7 A;  3BTC A;  3ZMV A;  2JJ7 A;  2V4J C;  3B6A A;  3PQK A;  5D4R A;  1Z05 A;  2PG4 A;  4OIO F;  5CVU A;  4ENN A;  1XMA A;  2DYR H;  3TGN A;  1R1T A;  4HV5 A;  3JCU C;  1OYW A;  1H9T A;  5K7Z A;  1GLN A;  2XVC A;  3HKZ A;  1SEU A;  5FGM A;  1BI2 A;  2EA2 A;  4XLF A;  2VOD A;  2EBI A;  3VOE A;  3E5U A;  4KN7 X;  2DQR A;  4EJO A;  2NAZ A;  1YRN A;  3ESW B;  4A3B J;  3C2G A;  2E2H J;  1MIJ A;  1YX3 A;  1S29 A;  3CF5 F;  5L3E A;  4C9Y A;  2QA4 I;  3RPU A;  1K78 A;  5KAI C;  1I27 A;  1HKT A;  1UEL B;  5E8G A;  4BJ5 C;  1OCR H;  1S72 I;  1NK2 P;  4MTD A;  1DPR A;  4DBQ A;  1G2H A;  2CQQ A;  1LDK B;  1RPW A;  3C18 A;  2XDV A;  3G6E I;  1GV5 A;  3F6V A;  1S9H A;  4BXX J;  3OSF A;  2UWM A;  2LP0 A;  1JI8 A;  4MLO A;  2HQA A;  2XC7 A;  3K1P A;  4AWX B;  4I99 C;  1H9G A;  2QBY B;  3R0A A;  3ERM A;  1MNE A;  4JX5 A;  4BS9 A;  3A01 B;  2DA6 A;  1YJW I;  2DW4 A;  3BDD A;  2XSJ C;  4XRM A;  1GXQ A;  2LMD A;  2O6G E;  5H20 A;  3ABK H;  3OYF A;  2IRF G;  1IXS B;  2IGN A;  4G6T B;  1OLT A;  3J7A O;  3CDL A;  5GP9 A;  2KMU A;  4E7Z A;  1TL8 A;  1SFK A;  3DBL B;  3TW7 A;  1J7K A;  3SYT A;  1E3O C;  3DU6 A;  1X1B A;  3NQO A;  4HLY A;  4I98 B;  5ICE A;  1VQ9 I;  4F3Q A;  1ZLK A;  2YX4 A;  1PUE E;  1WKM A;  2EPF A;  5J4Y A;  3LNQ A;  3OIO A;  9ANT A;  3BTJ A;  5KHD A;  3GME A;  5H6Q A;  5IT3 A;  4V19 K;  2DA7 A;  1BW6 A;  3O6B B;  2FRH A;  3SEQ A;  5CLS A;  1QVU A;  1ETO A;  3BZ6 A;  3BPV A;  3QPT A;  5CVI A;  4BDY A;  2LRD A;  1HOM A;  1BR2 A;  1TW2 A;  3GFM A;  3NAR A;  3H35 A;  1OQY A;  1Z7L A;  3I4M J;  2ECB A;  4M3E A;  3WG7 H;  4B44 A;  1P4A A;  2F5V A;  1X2N A;  1B72 B;  2QM3 A;  1YE9 A;  1P7I A;  1Y8R B;  2BOL A;  3OOP A;  4KMU X;  5C44 J;  3GZN B;  2Q1Z B;  3DKW A;  3QP6 A;  3HPH A;  1QZY A;  3OS2 A;  2ID6 A;  2M9H A;  2NYX A;  1N78 A;  3G4S I;  1GVJ A;  2HWV A;  2XAQ A;  2HKO A;  5CVR A;  4Q47 A;  2IEK A;  1XX5 A;  1E17 A;  2LC2 A;  4IVN A;  1PVE A;  2L9N A;  3IKT A;  4BE0 A;  5HNF A;  2GLO A;  2M3A A;  4LB5 A;  2Q2E B;  1MH4 A;  3JRG A;  2CH0 A;  2WTE A;  3MVP A;  3MKW B;  2HEO A;  2HU9 A;  3CUQ A;  3GF2 A;  4RLF A;  1ETQ A;  2NNY A;  1RUO A;  4CZZ A;  1AA7 A;  1BI0 A;  2PN6 A;  1AOY A;  1E3P A;  3E6B A;  2AHQ A;  1L0O C;  4A5M A;  5CJ9 A;  3MKL A;  3WTY C;  2ZJQ F;  2HOT A;  1HW5 A;  3D1N I;  3DKX A;  1MBE A;  3K4J A;  2CQK A;  2Y48 A;  3ZR8 X;  1LEA A;  4YII A;  2W4S A;  2EWN A;  2JT1 A;  3BJA A;  2IA1 A;  1GDT A;  2HOS A;  2VON A;  4HW0 A;  1Z6R A;  5H6R A;  1I39 A;  3H9G A;  4RB1 A;  4Y52 J;  3CCL I;  5FO5 A;  1YQA A;  4XLC A;  2J5P A;  5HOD A;  4B4C A;  1LE8 A;  5JI6 A;  5E3O A;  1HC8 A;  4XRS G;  1QU3 A;  2XGX A;  3RQ4 A;  2WAQ N;  4BY1 J;  1NH3 A;  2R7O A;  2QKM B;  2LYC A;  3BJ6 A;  3ZQG A;  3KEQ A;  1JT0 A;  1U5T C;  3HM5 A;  3BY6 A;  1JKQ C;  4IHV A;  4IZZ A;  2R5Z A;  2PI0 A;  3HRS A;  1XCV A;  2DBB A;  3DV8 A;  1DU0 A;  1FOK A;  1K4T A;  1P6R A;  3I59 B;  2ZFU A;  3R60 A;  5FB2 A;  2HQ5 A;  3HC7 A;  1R1U A;  5FLM J;  5E3N A;  3U1D A;  3IH4 A;  3FHN A;  2B7E A;  1R71 A;  3CO6 C;  3OSG A;  2H27 A;  5LHG A;  5LEK A;  2V1D A;  1G6N A;  2GQQ A;  1YOV B;  4AD9 A;  1RNL A;  4C3H J;  5M3F J;  3JW4 A;  1D1B A;  3Q0W A;  2ECC A;  2LKS A;  3TP3 A;  5JHU A;  2GM4 A;  2Z16 A;  1ZGW A;  4DQ2 A;  5J8C A;  2H8R A;  2A3S A;  3MEX A;  2IS1 A;  2OU2 A;  4ESB A;  1FYK A;  4DYC A;  1T2K A;  1O3T A;  5GTI C;  4XLN F;  2OAZ A;  1JHH A;  1SFE A;  2GA1 A;  2Y31 A;  5ED4 A;  3H5A A;  4PCQ A;  5A2Q K;  4HDU A;  1UG0 A;  2I5U A;  3I71 A;  1USS A;  3NRV A;  4CCO A;  2ZME C;  2FMY A;  3EUH A;  3U1K A;  3JTG A;  5DV5 A;  1RC9 A;  2DA1 A;  1WVR A;  1D8K A;  3H0G J;  1VND A;  2PMU A;  2W24 A;  5C3E J;  3DEE A;  4LIT A;  2HQN A;  2VE9 A;  3C3W A;  2COB A;  5CQE A;  1MBH A;  3HOW J;  2IJL A;  2EIL H;  2M7A A;  3ML6 A;  3TDZ C;  1D5Y A;  2V1N A;  1FOX A;  1VFC A;  4Y4R A;  1MJ9 A;  1KU2 A;  2ZBK A;  2HI3 A;  5AIP A;  4ON0 A;  3OYM A;  1U8B A;  2QQ8 A;  2VT3 A;  2QF7 A;  2XAS A;  1T38 A;  3H5N A;  2JRM A;  4LB6 B;  3GXO A;  4PK4 A;  2DTR A;  4BHP A;  2YR2 A;  4XKB A;  1FX7 A;  3K4C A;  2JA7 J;  5HLT A;  2KIQ A;  4RGS A;  1YIJ I;  1DUX C;  5B1B H;  4HX7 A;  3VOD A;  1KQ9 A;  4XOR A;  2HZD A;  2A69 F;  2BHY A;  4KA4 A;  1LUJ B;  2LLK A;  1A35 A;  4A3E J;  1FP1 D;  4IHT A;  4LLG F;  4HRI A;  1O7F A;  1FMW A;  1Y0U A;  4S05 A;  2A5Y B;  1RET A;  3F8N A;  1B59 A;  1Z6T A;  4X0G A;  1U5T B;  2XSD C;  2R7X A;  3I4P A;  5JR3 A;  1VTN C;  4DZJ A;  4B48 A;  4KIS A;  3ZN1 A;  1IV8 A;  4B3X A;  4I2O A;  1FT9 A;  4A0Y A;  1VQL I;  3IH2 A;  1ZQ3 P;  2ZFW A;  5AON A;  3KPH A;  3GTP J;  2PFB A;  4UXN A;  1T0F A;  4A3J J;  3C7J A;  3D5S C;  1UFM A;  4KIB A;  4MNU A;  5F0H A;  3L09 A;  2VQG A;  1Z67 A;  3C2H A;  1EH8 A;  2HYG D;  1ON2 A;  1UG2 A;  5GAG J;  1K7A A;  2KHM A;  3FXM A;  4HPQ A;  3ZQH A;  2E19 A;  2VBX A;  4TV7 A;  1I50 J;  5DCF A;  5CVV A;  4CHU A;  2AO9 A;  3OY9 A;  2O8X A;  2TCT A;  1DDN A;  3BR0 A;  3J7Y J;  2ZSH B;  2DK8 A;  2Y0S N;  5EYR A;  3L2V A;  4S0H B;  5EGO A;  3FKI J;  2QUF A;  2KIF A;  1ONV A;  2MW8 A;  4BKX A;  2BZT A;  2ZME B;  2DPU A;  2PLY A;  4U0Y A;  1VQ8 I;  1Y56 A;  2YUS A;  1R4M B;  4XR6 A;  3D5R C;  2MD0 A;  4NC8 A;  3K4N A;  3I56 I;  2KIU A;  2P7V B;  3UR3 C;  3ZOB A;  3IRQ A;  4HOB A;  1UZC A;  1Z0X A;  1ZAO A;  4UVB A;  5TRD A;  3R0J A;  3HZJ A;  2NS7 A;  1OIS A;  3BR2 A;  4FHT A;  2R7Q A;  2I10 A;  3OR1 C;  1G3W A;  4CCK A;  1FBS A;  2E2I J;  2X1D A;  4LG0 A;  3J80 K;  3BTL A;  1DU6 A;  1XGM A;  2L5Q A;  3GFL A;  3IWZ A;  1JXS A;  3DBH B;  3DF8 A;  3VEP A;  3K6G A;  1FZP B;  3MN2 A;  4L9J A;  1J75 A;  1A5J A;  1U2W A;  2M45 A;  1N75 A;  4QLC U;  3OYK A;  4HYE A;  4D5F A;  3M1E A;  2IVM A;  1EH7 A;  1W1W E;  1WPK A;  3K9T A;  2PEX A;  4RGR A;  1ULY A;  2LY1 A;  3R61 A;  1V3F A;  2BY1 A;  1WCM J;  3BP8 A;  2ESH A;  1AKH B;  2HS5 A;  3LA3 A;  4OIN F;  1YHQ I;  3T8T A;  2GZW A;  3TW6 A;  3HJE A;  5LD2 C;  3KLO A;  1X1C A;  3OYE A;  1DP7 P;  2DK5 A;  2WAE A;  3L2C A;  1TWF J;  3DPT A;  3FIW A;  3WTS C;  3E3V A;  2ZCW A;  5DM6 F;  1L3L A;  5K5O A;  3TQN A;  2W57 A;  2ME0 A;  3WTU C;  4LMY A;  3IWF A;  1ZGJ A;  2DLL A;  3JRD A;  1SD4 A;  3DKY A;  3CLQ A;  3ASN H;  2FNA A;  2VE8 A;  4OIQ F;  2ZXI A;  2CWE A;  5EEH A;  1D3Y A;  3VYT B;  3ABM H;  5D6F A;  2R7Z J;  5JVG F;  3HOU J;  1UCR A;  2DO7 A;  3RCO A;  4C2U A;  4RGX A;  5LHH A;  4V2G A;  3NWS A;  2KPM A;  3SDG A;  4ZYG A;  3LL7 A;  1IRG A;  2F4I A;  2A05 A;  2G0E A;  2Y30 A;  3FBI B;  3V7R A;  3KP3 A;  5JHF A;  1P7J A;  1OCO H;  2L7M P;  4RAF A;  3EQL F;  3L00 A;  3RQI A;  4BQN A;  1ON1 A;  3VFZ A;  4D1Q A;  1WH7 A;  3H0D A;  2Z5U A;  3P9C A;  4XM3 A;  1CGP A;  3ZQ7 A;  3QYE A;  4II2 A;  3L9F A;  2PX9 A;  4G94 A;  1XN7 A;  1IUY A;  1FNN A;  2IA0 A;  5E8I A;  1FSE A;  1ZRF A;  5KK1 A;  2HOA A;  2DQL A;  4BGD A;  3ROU A;  1I1G A;  2NOG A;  3FBN B;  1T95 A;  2HVR A;  3ZMS A;  3O8H A;  2RVC A;  1VQK I;  2VBW A;  4CZC A;  2GOM A;  4Y17 A;  2DOF A;  3ZQL A;  2MGQ A;  1FC3 A;  1V55 H;  2CJJ A;  3BR6 A;  4A3K J;  3CCS I;  1Z91 A;  4IEJ A;  4BJT A;  2DXI A;  4WXD A;  3ABT A;  2MFZ A;  3HSE A;  5HS8 A;  3JTH A;  1ZKG A;  5CYV A;  1EF4 A;  1V5G A;  1SVM A;  2DA4 A;  1PDN C;  5HLH A;  2LSO A;  1R00 A;  2Y69 H;  3V7S A;  5KCM A;  4H0E A;  3DTI A;  3O8G A;  4YG2 F;  3GFJ A;  1XC5 A;  3OMY A;  2OUM A;  2Y9Y A;  1BW5 A;  2LKP A;  3S32 A;  1CF7 A;  1GVD A;  3CQZ J;  2DA2 A;  4ESJ A;  2DMP A;  1HKS A;  3KEO A;  1PUF B;  1K61 A;  1B1B A;  4NC6 A;  3H92 A;  4IHY A;  4RBO A;  4JYK A;  3RDI A;  1RES A;  4WXH A;  3P7N A;  3V8K A;  3AG2 H;  4MEX F;  3G1L A;  4D5C A;  4HZF A;  4HF0 A;  4MTE A;  1QBJ A;  2E7X A;  1FOW A;  3V42 A;  2QSG X;  1ZR2 A;  3KEY A;  3JSO A;  2BY2 A;  4OIR F;  2QWW A;  3EPZ A;  1F4K A;  4GCV A;  1B9M A;  3GCM A;  4F7Z A;  5B5E C;  4M9Z A;  4GFB A;  1GV2 A;  2ISZ A;  1FMV A;  2DFF A;  3IL2 A;  4PGG A;  3F21 A;  1D8J A;  6PAX A;  4A6D A;  1Y1V J;  2FOK A;  4RMN A;  1TT5 B;  2X1C A;  4HLX A;  1FBQ A;  2FU4 A;  4Q48 A;  1IO2 A;  1J2X A;  4AIH A;  3MFK A;  3BTI A;  2F6C A;  4NC7 A;  3SQN A;  3CF2 A;  2IPQ X;  2KIS A;  1ETY A;  5HDG A;  2H1K A;  4FTH A;  3K1M A;  1Y39 A;  3GFI A;  4UUS B;  3CMA I;  2VIX A;  1TP4 A;  3FMQ A;  4F93 B;  2L02 A;  1XGS A;  3O2P E;  4XLE A;  1BJA A;  1TW3 A;  4A69 C;  1W36 D;  1ETX A;  1B4A A;  3DLA A;  4B47 A;  1YLF A;  3VSK A;  4L0Y B;  2H1L A;  4OWR B;  1D0X A;  3IAS 2;  1G3S A;  1FWZ A;  5IYB J;  1TBX A;  1J09 A;  1BIB A;  3GX4 X;  4KJZ A;  4B3A A;  2DMQ A;  3PSF A;  2BW3 A;  4C3J J;  5F0C A;  3FDY A;  4PDK A;  5L3C A;  4N0B A;  1PYV A;  2XHK A;  1YJN I;  2WA0 A;  4KIG A;  4F55 A;  2R7F A;  1DQU A;  1X58 A;  1YIO A;  1IDZ A;  2V6E A;  1NG7 A;  5D4S A;  1TC3 C;  2EQR A;  3F22 A;  3PM1 A;  4A0X A;  1TZL A;  3ERE D;  1ITY A;  1FEX A;  4HBL A;  1ZGA A;  2H8W A;  1D5V A;  2BE5 F;  2KLO A;  1I6H J;  5H2F C;  5GPC A;  4CO8 A;  3H36 A;  2KIM A;  5IYC J;  1W7P D;  2YU9 J;  5C4J J;  4QPO A;  2XF6 A;  5IYD J;  1FYM A;  3VDX A;  2XAG A;  4UB8 C;  2STT A;  3WTT C;  4Y7N J;  4OAZ A;  5TGT A;  3TP0 A;  4BBS J;  2NVQ J;  3F72 A;  3W2A A;  2H09 A;  3AG3 H;  2OC6 A;  5TJJ A;  4BXF A;  4AM3 A;  5KVR A;  3LMM A;  5C4X J;  2OTL I;  4I7H A;  3UKG A;  1APL C;  2EB7 A;  1XGN A;  1Z7U A;  2K4B A;  3FK7 A;  3FHZ A;  4RS8 A;  4ITV A;  4ZH4 F;  4KFC A;  1XB4 A;  2Z9O A;  1NHA A;  4G12 A;  2RAE A;  3K1N A;  3BG9 A;  2KP6 A;  2DJN A;  1G59 A;  2JA6 J;  1Z3X A;  4LK1 F;  5J8F A;  1JTY A;  4I01 A;  3OYB A;  4JQF A;  1OPC A;  2A6E F;  5K5Q A;  5J4V A;  2JVH A;  3J81 K;  4A3G J;  1HSJ A;  1FBU A;  3F6O A;  4DGW B;  2CS3 A;  2MSY A;  1IDY A;  2VKH A;  4BEH B;  2BEO A;  1WJB A;  2FF4 A;  3WGH A;  1W5C C;  2JUG A;  2JZY A;  2DMU A;  2R0Q C;  1UHM A;  3Q9S A;  1H8A C;  2CV2 A;  4BHC A;  3W2W A;  2XRN A;  4OMY A;  4U7B A;  2CRG A;  4ZTJ A;  3KYD B;  1TWC J;  1B8I B;  2FNP A;  4ZZL A;  3FF5 A;  1RZ4 A;  3M8J A;  2EV5 A;  1YRN B;  4MGR A;  5ICC A;  4BU2 A;  2DFE A;  4JX6 A;  1UST A;  1V4R A;  2QEX I;  2AXL A;  4QSH A;  4JOM A;  4AVZ A;  1MMG A;  2B9S A;  4IRG A;  4WWC A;  3HBL A;  3A0B C;  3HTS B;  4M72 A;  1KYZ A;  2MA3 A;  4M6Y A;  3GVA A;  4PUS A;  3WTZ A;  2JVG A;  2WWY A;  4EGY A;  2Z2S B;  3G71 I;  2ZSI B;  4XKV A;  3PO3 J;  2ZNZ A;  4OMZ A;  2Z33 A;  2EIM H;  5BMZ A;  2OZU A;  4F52 A;  5DYM A;  3U9G A;  5E1W A;  2KZG A;  2D2W A;  1KYW A;  2KT0 A;  1MMD A;  2O0Y A;  4FQG A;  4KIT B;  2FQ3 A;  3T5X A;  3ABU A;  4CGZ A;  2PMZ A;  2FBI A;  2DFH A;  3HTU A;  4QIW N;  2DN0 A;  3HRU A;  4MEY F;  4A3F J;  3VYS B;  3RIR A;  2VBZ A;  2L2O A;  1JKO C;  1V5F A;  2M2E A;  4CCJ A;  5IT9 Z;  4AIJ A;  3QP5 A;  1LVK A;  2L7Z A;  2IA2 A;  2KQR A;  2FJ1 A;  4HQE A;  2LVS A;  3QPS A;  4Y33 A;  3IUO A;  3F8F A;  4N4N B;  3I3L A;  3KP7 A;  5LRS A;  1S5L C;  1U78 A;  3HOT A;  3KZI C;  2K02 A;  1QA6 A;  3ZMD A;  3A01 A;  2F4O B;  2HXO A;  3V8L A;  4CXF A;  4DIQ A;  2H6B A;  4HDV A;  2AQF A;  2CUE A;  3EUK L;  2DAO A;  2P4W A;  5FRO A;  3S3O A;  1MKM A;  1WSU A;  3ZQQ A;  2XIG A;  4IHX A;  4HQM A;  2M0C A;  2K9L A;  1FSH A;  3QAH A;  1U3E M;  3LOC A;  2QQA A;  1X1A A;  1O3Q A;  1UMQ A;  1F5T A;  4WCG A;  1MZB A;  3JAM Z;  3AL0 C;  1Y0N A;  3LSH A;  2XAH A;  3CCU I;  3VWB A;  4ZZD A;  1QNT A;  5J1U A;  3ZPL A;  3GYH X;  2F5D A;  4R8H A;  3BR5 A;  4IO9 F;  1M1E B;  4ABZ A;  4XOP A;  4AID A;  4XQF A;  1YYV A;  4Z2Y A;  1XDS A;  3AKZ A;  4UV8 A;  1K79 A;  2DMN A;  4YFX F;  1BC7 C;  3WTW C;  4M9S A;  4MHG A;  2MBF A;  2P6S A;  5DD8 A;  4RAY A;  1R7J A;  5F1R A;  1MJA A;  4D7M A;  2PJR B;  4M3F A;  2LR8 A;  5HS9 A;  1Z3Y A;  2Q8K A;  3H9J A;  1BOB A;  3HHG A;  3S2H J;  3CCE I;  2IP2 A;  2DI3 A;  2EA4 A;  2DOA A;  1B72 A;  3CJQ B;  2OBP A;  3HL2 A;  2XAU A;  5K7F A;  3N05 A;  1IN8 A;  4NQW B;  1REP C;  1ZK8 A;  1ZLJ A;  2K9N A;  2GIV A;  3MD2 A;  4U87 A;  2XKP A;  3RPU D;  5ILV A;  4LIU A;  1HF0 A;  4KNY A;  4NB5 A;  2F5C A;  2ZO4 A;  4NBQ A;  5CQG A;  4UVC A;  1QZZ A;  3WGI A;  1LVA A;  3HOZ J;  2ZXW H;  2YU3 A;  3E97 A;  2Q2E A;  3OL4 A;  5ILS A;  1RR7 A;  4B8X A;  1X1P A;  2OQR A;  2CQN A;  3HEF A;  4IHS A;  1FOY A;  2G7U A;  1QPM A;  4FX4 A;  1IF1 A;  2R93 J;  4UUT A;  2NNN A;  1OR7 C;  1SAU A;  3S8P A;  3KP6 A;  3QRF F;  2E34 A;  2I8D A;  1XPX A;  3GLX A;  3BCB A;  2JTV A;  5HVQ C;  4HF1 A;  4HX8 A;  4OOI A;  3BCA A;  2E7W A;  3GW2 A;  2FQ4 A;  2W82 A;  2X48 A;  2EFP A;  4CA0 A;  2R5Y A;  3BZC A;  3E1S A;  2O9L A;  3I9V 2;  4EV0 A;  2A07 F;  1TWG J;  5JLX A;  2L01 A;  2RDP A;  4MFE A;  2VUM J;  5D8K B;  3I53 A;  1FTZ A;  2LY2 A;  1Q1H A;  4EVI A;  3AL0 B;  2Y9Z A;  4AU7 A;  3X2Q H;  1UHW A;  1YW7 A;  3EYY A;  1ZR4 A;  4IQ4 A;  1OYY A;  3EET A;  5DCM A;  2DOD A;  1RIO H;  2XGE A;  2Z99 A;  3PFI A;  3CJR B;  2LBF B;  3K4L A;  1RI7 A;  3KET A;  2O3F A;  3DWL E;  3I59 A;  4L0Z B;  1BI1 A;  3TDU C;  3ZMT A;  4IRH A;  2QQ9 A;  4JX4 A;  2UXX A;  5JLW A;  3G1M A;  2V7F A;  4KN4 X;  4KYW A;  5FFZ A;  2V9P A;  3MZH A;  1JUP A;  1J59 A;  2OTJ I;  3I58 A;  3FM3 A;  5D6E A;  1T08 B;  5DS9 A;  3SFZ A;  4Z6Y A;  3ZCO A;  3OL3 A;  1JGG A;  2IGO A;  3G73 A;  3HKZ N;  2CGP A;  3HHH A;  3GTO J;  3FXU A;  3P9I A;  2ADU A;  1K6Y A;  1IRF A;  2F5E A;  1IN4 A;  3T8R A;  1VQ6 I;  3K70 C;  4CDG A;  1OKR A;  1TQP A;  1RKT A;  4GYG A;  5LFA A;  3I64 A;  2OD5 A;  4M3B A;  5HLG A;  3PIO F;  2EIJ H;  1D0Y A;  4R79 A;  3FKJ A;  1WHU A;  3UNG C;  2R7S A;  4ENJ A;  2DT5 A;  3S1Q J;  2EJR A;  2VOP A;  3VPR A;  2E71 A;  4GRI A;  1ACI A;  3CZ6 A;  4NNJ A;  2XUB A;  1HXD A;  4XLA A;  3CCV I;  4UUV A;  2EIK H;  1W5T A;  1UAA A;  1U8R A;  4LK0 F;  4CH7 A;  4ZDO A;  4AVP A;  2P5V A;  1NK3 P;  3KIO A;  3ZN0 A;  4Q5S F;  5FKL A;  2DU9 A;  2H94 A;  2ZXJ A;  2LTP A;  3KX2 A;  3OS1 A;  4FX0 A;  3OYA A;  1SFO J;  1P9Q C;  1MD0 A;  3V7C A;  2WB1 N;  2R3S A;  4M73 A;  3TO6 A;  1R22 A;  1SMT A;  2D1H A;  1FLI A;  1SC7 A;  2Y75 A;  1P92 A;  3L2W A;  2CSO A;  2R7V A;  2HGC A;  5HDN A;  3RSN A;  2ACJ A;  2VKV A;  3E0J B;  2W25 A;  3HRT A;  4DW6 A;  4G7H F;  1PJR A;  2NS8 A;  1K4S A;  2YX7 A;  1ZRD A;  5GTH C;  4IKF A;  5LBQ A;  1WFX A;  5LRR A;  3Q5F A;  2HDW A;  2VXZ A;  4CCM A;  4N9I A;  5GAD J;  1SVO A;  2DTZ A;  2K27 A;  3PUB A;  2BY0 A;  2P5L C;  3HSF A;  1MJB A;  2FOW A;  4DJA A;  5FKK A;  1CQT A;  4PGH A;  1MBJ A;  2IGK A;  3PJR A;  4QTR A;  2C6Y A;  3WTV C;  3I0T A;  3S2D J;  1W36 C;  2M8E A;  3H3U A;  4RB0 A;  3OYH A;  1QPI A;  4PJM A;  3GTJ J;  3M1C A;  1YJ9 I;  1TLH B;  1H88 C;  1YG2 A;  3TKY A;  2X6Y A;  2HTJ A;  1BR4 A;  1RKW A;  4JP0 A;  1TQI A;  1XSX A;  5TIS C;  1T6S A;  1BBY A;  2X6O A;  4E7I A;  1ZEL A;  2KJC A;  2WAF A;  2X51 A;  1AU7 A;  1POG A;  4XBF A;  2MD5 A;  2HPI A;  1E2X A;  3VB2 A;  2LH9 A;  3DPL C;  1KQ0 A;  2MLG A;  2QYO A;  2KL4 A;  3G1O A;  3CJN A;  4G7O F;  1YX5 A;  4NDL A;  3HPG A;  4E70 A;  4G8X A;  3L1P A;  4YRV A;  1HST A;  3CES A;  3MZ8 A;  4YEL A;  3HB9 A;  3B73 A;  5CKT A;  4RA2 A;  4LG0 B;  5BQT A;  4XID A;  4N4O B;  5FRM A;  5M5X J;  1J5Y A;  3V4G A;  2HDC A;  2KRF A;  3VYU B;  2ZME A;  2KRC A;  5D5W B;  4CYC B;  4I02 A;  1KON A;  1XG1 A;  4E7L A;  2CW7 A;  1G3Y A;  5HOO A;  3TO9 A;  3CDH A;  4YEJ A;  2W7N A;  1ODD A;  3FMR A;  4PJN A;  2HZT A;  4W97 A;  4EJW A;  4IPA A;  3W2V A;  3KP4 A;  5J1R A;  2XAJ A;  5M3M J;  3FXK A;  3FXL A;  3F8M A;  1XCB A;  3CC2 I;  1JKR C;  1QHG A;  2RQP A;  3A2K A;  3CUO A;  2P81 A;  4Y15 A;  4HX4 A;  2XAF A;  2RQQ A;  1JUS A;  4GYI A;  3WE2 A;  3AFH A;  5FD5 A;  2E1O A;  5FD6 A;  3K69 A;  3QOP A;  4E6K G;  1PP8 F;  1C0W A;  3LAJ A;  3OOU A;  3OYD A;  4P9F A;  1FIP A;  5ERI A;  4MIM A;  1YS7 A;  1KA8 A;  1YW8 A;  1GHC A;  2XF5 A;  3WOD F;  1D1C A;  3COA C;  4OU0 A;  1BA5 A;  3KLN A;  4IQJ A;  4XMY A;  4IXA A;  2R7D A;  1AHD P;  4D0P A;  1AWC A;  5GAE J;  3FXJ A;  1B9N A;  4IHW A;  5D5V B;  1WI3 A;  1VZ0 A;  3LSI A;  3QU3 A;  3B02 A;  1SVL A;  3OR2 C;  4R1H A;  3CCY A;  4V2F A;  3PNT A;  1ZRC A;  4KUM A;  4ANJ A;  2DOE A;  4AUX A;  4EM0 B;  3S17 J;  3HOV J; 
#chains in the Genus database with same CATH homology
 1IW7 F;  2JRT A;  5K1Y A;  2IT0 A;  4L9T A;  5L3G A;  1R58 A;  5L3D A;  3W6J B;  3RKW A;  3BOQ A;  4HA8 A;  1W7P B;  2VN2 A;  1I6X A;  4HV6 A;  1T39 A;  3ISP A;  3FWE A;  2CFX A;  2KJB A;  3DQV C;  1BM9 A;  5FLX K;  1MDM A;  3LST A;  4L5I A;  1MGT A;  2M30 A;  3RTR A;  2PBI A;  1S7O A;  3CO7 C;  4WF2 A;  5BOX A;  5JFR A;  5DEQ A;  1WI9 A;  4YFN F;  1LQ1 A;  4EQQ A;  2F5F A;  1X3U A;  3LAP A;  3IRR A;  4K2E A;  3F23 A;  4YIF A;  3AAF A;  1B6A A;  2FE3 A;  1J9I A;  3K0L A;  5HDK A;  1KU9 A;  2HTS A;  1EH6 A;  4LGW A;  3REO A;  5DDG A;  2ZJ2 A;  5HS7 A;  1I1S A;  5LGU A;  1XMK A;  1FYL A;  1LEB A;  1G4D A;  5LGN A;  5L3F A;  4HF2 A;  2GWR A;  4WX9 A;  2WV0 A;  3GO5 A;  3KZY A;  2TDX A;  4P55 A;  3IC7 A;  4KDP A;  2JPC A;  1DPU A;  2L4M A;  4ASN A;  4EM2 A;  1R1V A;  1P2F A;  2A61 A;  1HW2 A;  2E1C A;  3MQ0 A;  2RC4 A;  1Z9C A;  2EV0 A;  4M71 A;  2X4H A;  3EDP A;  3Q9V A;  1P4X A;  2DPD A;  1BOA A;  4LLL A;  3MWM A;  1SD5 A;  1EV7 A;  2WC2 A;  4A5N A;  2RGV A;  3D5L A;  3IHU A;  3BWG A;  2VC1 A;  5HLI A;  1R23 A;  4UNO A;  3HRM A;  1W4M A;  1ZYR F;  2EFW A;  1G3T A;  4U7D A;  4CYD A;  2QZ8 A;  1JGS A;  4I0B A;  1WWX A;  2MC3 A;  5E1Z B;  2FML A;  4BHB A;  4BH9 A;  3ECO A;  2COM A;  4KT5 C;  2IW5 A;  1O57 A;  3CUQ C;  3J81 Z;  2JPB A;  4QWQ A;  1ZHF A;  1K78 B;  1S8N A;  2CYY A;  1JE8 A;  3BPX A;  2XKO A;  1S7A A;  2OZ6 A;  2MH9 A;  3ELK A;  1Z1D A;  1IXR C;  2D1V A;  3WGG A;  3FXR A;  4G6Q A;  4RB3 C;  4EGZ A;  5IT9 K;  2CW0 F;  2V79 A;  2P5K A;  4GO1 A;  5J6X A;  2BBY A;  1IAW A;  4KIF A;  3LA2 A;  4U88 A;  5DUI A;  3ULQ B;  3F3X A;  4ZYE A;  4G7Z F;  2EK5 A;  3RI4 A;  2ZKZ A;  2QBY A;  3BRO A;  3P9K A;  1LB2 A;  4UVA A;  2O61 A;  4P5O A;  3I5U A;  3JAM K;  2EFQ A;  4AIK A;  1LNW A;  2K86 A;  4BXU A;  3RKY A;  4L9V A;  1BN5 A;  2YSR A;  1LDD A;  1WRJ A;  2HKX A;  3RPQ A;  4EJU A;  2ZNY A;  4EJV A;  4LLN A;  1ZG5 A;  4FT8 A;  2FEZ A;  3LA7 A;  2M5W A;  2ETH A;  4S04 A;  1IN6 A;  2L4A A;  3CUQ B;  1KU3 A;  2PMH A;  5E20 A;  3LWF A;  3KFW X;  3MCZ A;  5ILU A;  4L5J A;  3JSP A;  3DXJ F;  3BJO A;  3O3K A;  5BPI A;  4I09 A;  3C1D A;  3QU6 A;  3KE2 A;  1TNT A;  3WE3 A;  1R36 A;  4RGU A;  1YS6 A;  1S3J A;  5EEG A;  4L18 B;  1GXP A;  2G7H A;  2HOE A;  5CVJ A;  2FBH A;  3OV8 A;  4NQW A;  3HOS A;  5JVT A;  1KU7 A;  2L3D A;  3RKX A;  2EV6 A;  2FXA A;  1F9N A;  4BYY A;  2L54 A;  1KQ8 A;  4KMF A;  4ZYH A;  4B09 A;  4O3M A;  2RN7 A;  3S2W A;  1YO5 C;  2DFI A;  3GUD A;  3QPH A;  3G3Z A;  4M9X A;  5E17 F;  2YPR A;  1J0R A;  3FXQ A;  2VT2 A;  5DCM B;  4Y13 A;  2KKO A;  3D0S A;  5E1X A;  3CTA A;  3V8J A;  4JK1 X;  2UZK A;  2D45 A;  3T0Y A;  3WU1 B;  4P96 A;  1ZRE A;  2LDU A;  2XRO A;  4P9U A;  1QQI A;  1SD6 A;  4ENK A;  2HFH A;  4UHT A;  1IZ1 A;  1TTY A;  1H0M A;  2BV6 A;  2FA5 A;  2XV4 S;  3LFK A;  1A04 A;  1UB9 A;  2ELH A;  4IF4 A;  3SXY A;  4BQA A;  4M6X A;  3RYP A;  4MQ9 F;  4LD5 A;  5LHI A;  5F64 A;  5F6F A;  4JBA A;  3ZMU A;  2M1B A;  3PQJ A;  4L9N A;  3M8E A;  5A2Q Z;  1S6L A;  5ICG A;  3KP5 A;  1R5G A;  3R6S A;  3N4M A;  4XLP F;  3E6D A;  1ZG3 A;  3FX3 A;  4GXO A;  4KIC A;  3MAJ A;  4RAZ A;  1K6O A;  3U2R A;  2Z3Y A;  3DEU A;  1STZ A;  1IXC A;  2EFO A;  1OR7 A;  2VOO A;  3ECH A;  3EYI A;  1FPQ A;  5K5R A;  1U6G A;  2F2E A;  1YFH A;  1ZH5 A;  3LQQ A;  2BGC A;  4XRF A;  2LF8 A;  1PP7 U;  4EMS A;  4YFK F;  1U5T A;  2CG4 A;  4NHJ A;  2GXG A;  4A6E A;  5D5U B;  3IKV A;  4G6D A;  1BIA A;  2H6C A;  3K2Z A;  5D8L B;  3M7G A;  2Q0O A;  4Q4Z F;  1FP2 A;  5BPD A;  4XSX F;  2GXB A;  3GZ5 A;  2V1X A;  3N97 A;  3ZMZ A;  3L7W A;  1W5S A;  1XD7 A;  4UV9 A;  1IN5 A;  3LQR A;  2VC0 A;  1WQ2 A;  4WK8 F;  5DUK A;  5LEJ A;  3TO7 A;  4IRI A;  2PJP A;  2OQG A;  3DFG A;  3CLO A;  1SD7 A;  5D5X B;  1ZAR A;  3ZP5 A;  3E6M A;  3FMS A;  2K7L A;  3J80 Z;  5LLQ A;  3HYI A;  5ICF A;  4EM1 A;  2RV8 A;  1TQM A;  2STW A;  3M9A A;  5FFX A;  4O6J A;  5DD4 A;  4EJT A;  3DP7 A;  2QVO A;  1XDU A;  3WG9 A;  2A6H F;  3M8F A;  2FBK A;  4PZJ A;  1HKQ A;  4XSZ F;  4ZYD A;  3KZZ A;  2MLK A;  3GWZ A;  1SAX A;  2GAU A;  3RYR A;  4LFU A;  3F8B A;  2B0L A;  2OA4 A;  4BNC A;  2E1N A;  1I5Z A;  2P6T A;  1LDJ A;  2QQB A;  4WXC A;  2W84 A;  5LGT A;  5L3B A;  1YTY A;  1T98 A;  3GEZ A;  4O5V A;  2MH2 A;  2NS0 A;  2LNB A;  2ESN A;  3E6C C;  1MDM B;  1CF7 B;  2O03 A;  3E5X A;  1OMI A;  3SZP A;  4G9Y A;  3FM5 A;  1W7P A;  3HSR A;  4MQV A;  1O7L A;  5BS6 A;  3WTX C;  2J5O A;  5AIQ A;  4RB2 C;  1LJ9 A;  1O3R A;  2JSC A;  1HQC A;  3E5Q A;  5FLX Z;  2RNJ A;  3TOB A;  4A0Z A;  4DNC A;  2RKH A;  3WU0 A;  1HBX G;  2QLZ A;  3R4K A;  3HIF A;  3F8C A;  3NEU A;  2V9V A;  2P8T A;  1SMY F;  4ETS A;  3SHF A;  3MZY A;  3TOA A;  1OYI A;  4ESF A;  1P4W A;  1SFU A;  3H3Z A;  5E18 F;  2GA2 A;  4BAY A;  1QO0 D;  1XSV A;  2PQ8 A;  4LJZ F;  4ENM A;  4A12 A;  1BI3 A;  1QGP A;  1XGO A;  2EFN A;  1IN7 A;  2Y0M A;  4IJA A;  4OIP F;  2V6C A;  1JHF A;  2BYV E;  2A68 F;  3RJP A;  3FZV A;  1KGS A;  1YW9 A;  2QEN A;  1XSD A;  2CO5 A;  1HW1 A;  2VBY A;  4I0A A;  1FY7 A;  2AS5 F;  1BC8 C;  3HUG A;  2V1U A;  2HR3 A;  2W85 A;  4M74 A;  3T1B A;  2M87 A;  4N9H A;  1ZN2 A;  4U0W A;  3GZ6 A;  1F1Z A;  3KCC A;  1SFX A;  1RUN A;  2K4J A;  4A2U A;  2G9W A;  3SZT A;  2FSW A;  1O3S A;  2HYF A;  2ISY A;  3W6K B;  2P7C B;  4HAM A;  2HQR A;  4GGG A;  2X0L A;  3I54 A;  4U0V A;  4CIC A;  1ZG1 A;  3KP2 A;  2UXN A;  1TNS A;  1R5H A;  2NRA C;  2LF7 A;  3ZMV A;  3PQK A;  5D4R A;  1Z05 A;  2PG4 A;  4OIO F;  5CVU A;  4ENN A;  1XMA A;  3TGN A;  1R1T A;  4HV5 A;  1OYW A;  1H9T A;  2XVC A;  5FGM A;  1BI2 A;  2EA2 A;  2VOD A;  3VOE A;  3E5U A;  4KN7 X;  2DQR A;  4EJO A;  2NAZ A;  1S29 A;  5L3E A;  3RPU A;  1K78 A;  1I27 A;  1HKT A;  5E8G A;  4MTD A;  1DPR A;  3C18 A;  1LDK B;  3F6V A;  2UWM A;  3K1P A;  4AWX B;  1H9G A;  2QBY B;  3R0A A;  2DW4 A;  3BDD A;  1GXQ A;  2O6G E;  5H20 A;  2IRF G;  1IXS B;  3J7A O;  1J7K A;  3NQO A;  4HLY A;  4I98 B;  5ICE A;  1ZLK A;  2YX4 A;  1PUE E;  1WKM A;  5H6Q A;  5IT3 A;  3O6B B;  2FRH A;  5CLS A;  3BZ6 A;  3BPV A;  3QPT A;  5CVI A;  1TW2 A;  3GFM A;  1P4A A;  2QM3 A;  3OOP A;  4KMU X;  3DKW A;  3QP6 A;  1QZY A;  2NYX A;  1GVJ A;  2HWV A;  2XAQ A;  2HKO A;  5CVR A;  4Q47 A;  1E17 A;  4IVN A;  3IKT A;  4LB5 A;  2WTE A;  2HEO A;  3CUQ A;  3GF2 A;  2NNY A;  1RUO A;  4CZZ A;  1BI0 A;  2PN6 A;  1AOY A;  3E6B A;  1L0O C;  4A5M A;  5CJ9 A;  3WTY C;  1HW5 A;  2CQK A;  2Y48 A;  1LEA A;  4YII A;  2EWN A;  2JT1 A;  3BJA A;  2IA1 A;  2VON A;  4HW0 A;  1Z6R A;  5H6R A;  4RB1 A;  5FO5 A;  1YQA A;  2J5P A;  5JI6 A;  2XGX A;  3BJ6 A;  3KEQ A;  1U5T C;  3BY6 A;  2PI0 A;  3HRS A;  1XCV A;  2DBB A;  3DV8 A;  1FOK A;  1P6R A;  3I59 B;  3R60 A;  5FB2 A;  1R1U A;  3U1D A;  2H27 A;  3CO6 C;  5LHG A;  5LEK A;  2V1D A;  1G6N A;  2GQQ A;  4AD9 A;  1RNL A;  3JW4 A;  5JHU A;  4DQ2 A;  5J8C A;  2A3S A;  3MEX A;  2OU2 A;  4ESB A;  1FYK A;  1T2K A;  1O3T A;  4XLN F;  2OAZ A;  1JHH A;  1SFE A;  2GA1 A;  5ED4 A;  4PCQ A;  5A2Q K;  4HDU A;  3I71 A;  1USS A;  3NRV A;  2FMY A;  3EUH A;  3JTG A;  5DV5 A;  1D8K A;  2PMU A;  2W24 A;  2HQN A;  2VE9 A;  3C3W A;  2IJL A;  3ML6 A;  3TDZ C;  1MJ9 A;  1KU2 A;  2ZBK A;  5AIP A;  4ON0 A;  2VT3 A;  2XAS A;  1T38 A;  4LB6 B;  3GXO A;  2DTR A;  4BHP A;  2YR2 A;  1FX7 A;  4RGS A;  1DUX C;  4HX7 A;  3VOD A;  1KQ9 A;  4KA4 A;  2A69 F;  1FP1 D;  4IHT A;  4LLG F;  1O7F A;  1Y0U A;  4S05 A;  2A5Y B;  3F8N A;  1B59 A;  1Z6T A;  1U5T B;  3I4P A;  5JR3 A;  1VTN C;  3ZN1 A;  4I2O A;  1FT9 A;  4A0Y A;  2ZFW A;  5AON A;  2PFB A;  4UXN A;  1T0F A;  3C7J A;  1UFM A;  4KIB A;  4MNU A;  3L09 A;  1EH8 A;  2HYG D;  1ON2 A;  1K7A A;  2VBX A;  4TV7 A;  5DCF A;  5CVV A;  4CHU A;  2O8X A;  1DDN A;  2DK8 A;  2QUF A;  2KIF A;  1ONV A;  2ZME B;  2DPU A;  2PLY A;  4U0Y A;  2KIU A;  2P7V B;  3IRQ A;  4HOB A;  1ZAO A;  4UVB A;  5TRD A;  3R0J A;  4FHT A;  1G3W A;  1FBS A;  4LG0 A;  3J80 K;  1XGM A;  3GFL A;  3IWZ A;  1JXS A;  3DF8 A;  3VEP A;  1FZP B;  4L9J A;  1J75 A;  1U2W A;  2M45 A;  4QLC U;  4HYE A;  3M1E A;  2IVM A;  1EH7 A;  3K9T A;  2PEX A;  4RGR A;  1ULY A;  3R61 A;  1V3F A;  3BP8 A;  2ESH A;  2HS5 A;  3LA3 A;  4OIN F;  3T8T A;  2GZW A;  3KLO A;  1DP7 P;  2DK5 A;  3L2C A;  3DPT A;  3WTS C;  3E3V A;  2ZCW A;  1L3L A;  5K5O A;  3TQN A;  2W57 A;  3WTU C;  4LMY A;  3IWF A;  1ZGJ A;  2DLL A;  1SD4 A;  2FNA A;  2VE8 A;  4OIQ F;  2CWE A;  5EEH A;  1D3Y A;  5D6F A;  2DO7 A;  1UCR A;  4RGX A;  5LHH A;  4ZYG A;  1IRG A;  3V7R A;  3KP3 A;  3EQL F;  3L00 A;  1ON1 A;  3VFZ A;  2Z5U A;  3P9C A;  1CGP A;  3ZQ7 A;  3L9F A;  4G94 A;  1XN7 A;  1IUY A;  1FNN A;  2IA0 A;  5E8I A;  1FSE A;  1ZRF A;  5KK1 A;  2DQL A;  3ROU A;  1I1G A;  3ZMS A;  2RVC A;  2VBW A;  4Y17 A;  1FC3 A;  1Z91 A;  4WXD A;  3ABT A;  3HSE A;  5HS8 A;  3JTH A;  5CYV A;  1PDN C;  5HLH A;  2LSO A;  1R00 A;  3V7S A;  4H0E A;  4YG2 F;  3GFJ A;  2LKP A;  1CF7 A;  4ESJ A;  1HKS A;  3KEO A;  1B1B A;  3H92 A;  3RDI A;  4WXH A;  3P7N A;  3V8K A;  4MEX F;  4HZF A;  4HF0 A;  4MTE A;  1QBJ A;  2E7X A;  3JSO A;  4OIR F;  2QWW A;  1F4K A;  4GCV A;  1B9M A;  4F7Z A;  4M9Z A;  2ISZ A;  3IL2 A;  4PGG A;  3F21 A;  1D8J A;  6PAX A;  4A6D A;  2FOK A;  4HLX A;  1FBQ A;  2FU4 A;  4Q48 A;  1J2X A;  3MFK A;  4AIH A;  3SQN A;  2IPQ X;  5HDG A;  3K1M A;  3GFI A;  3FMQ A;  2L02 A;  1XGS A;  3O2P E;  1BJA A;  1TW3 A;  1B4A A;  1YLF A;  4L0Y B;  1G3S A;  1FWZ A;  1TBX A;  1BIB A;  3GX4 X;  4PDK A;  5L3C A;  4N0B A;  2XHK A;  4KIG A;  2R7F A;  1YIO A;  5D4S A;  3F22 A;  4A0X A;  3ERE D;  4HBL A;  1ZGA A;  1D5V A;  2BE5 F;  4CO8 A;  2KIM A;  1W7P D;  1FYM A;  2XAG A;  2STT A;  3WTT C;  3F72 A;  2H09 A;  5TJJ A;  5KVR A;  4I7H A;  2EB7 A;  1XGN A;  1Z7U A;  2K4B A;  3FHZ A;  4RS8 A;  4ZH4 F;  4KFC A;  1XB4 A;  2Z9O A;  1NHA A;  3K1N A;  4LK1 F;  5J8F A;  4I01 A;  4JQF A;  1OPC A;  2A6E F;  5K5Q A;  3J81 K;  1HSJ A;  1FBU A;  3F6O A;  2BEO A;  2FF4 A;  3WGH A;  2JZY A;  1UHM A;  3Q9S A;  4BHC A;  4OMY A;  2XRN A;  4U7B A;  2FNP A;  4ZZL A;  3FF5 A;  1RZ4 A;  2EV5 A;  4MGR A;  5ICC A;  1UST A;  1V4R A;  2AXL A;  4IRG A;  4WWC A;  3HTS B;  4M72 A;  1KYZ A;  2MA3 A;  4M6Y A;  3GVA A;  3WTZ A;  2WWY A;  4EGY A;  2ZNZ A;  4OMZ A;  2Z33 A;  5BMZ A;  2OZU A;  5DYM A;  3U9G A;  5E1W A;  2D2W A;  1KYW A;  2O0Y A;  2FQ3 A;  3T5X A;  3ABU A;  4CGZ A;  2FBI A;  3HTU A;  4MEY F;  3HRU A;  3RIR A;  2VBZ A;  5IT9 Z;  4AIJ A;  3QP5 A;  2IA2 A;  4HQE A;  3F8F A;  3KP7 A;  5LRS A;  1U78 A;  3HOT A;  2K02 A;  3ZMD A;  3V8L A;  4HDV A;  4CXF A;  2H6B A;  1WSU A;  2DAO A;  2P4W A;  1MKM A;  2XIG A;  4HQM A;  1FSH A;  3QAH A;  1U3E M;  2QQA A;  1O3Q A;  1F5T A;  4WCG A;  1MZB A;  3JAM Z;  2XAH A;  4ZZD A;  1QNT A;  3ZPL A;  3GYH X;  2F5D A;  4R8H A;  1YYV A;  4Z2Y A;  1XDS A;  4UV8 A;  1K79 A;  4YFX F;  1BC7 C;  3WTW C;  4M9S A;  4MHG A;  2MBF A;  2P6S A;  5DD8 A;  4RAY A;  1R7J A;  5F1R A;  1MJA A;  5HS9 A;  2Q8K A;  3HHG A;  2IP2 A;  2DI3 A;  2EA4 A;  2OBP A;  1IN8 A;  1REP C;  1ZLJ A;  2GIV A;  2XKP A;  5ILV A;  4KNY A;  4NB5 A;  2F5C A;  2ZO4 A;  4UVC A;  1QZZ A;  3WGI A;  1LVA A;  2YU3 A;  3E97 A;  2Q2E A;  5ILS A;  4B8X A;  2OQR A;  4IHS A;  2G7U A;  1QPM A;  4FX4 A;  1IF1 A;  2NNN A;  3KP6 A;  3QRF F;  3GLX A;  2JTV A;  5HVQ C;  4HF1 A;  4HX8 A;  4OOI A;  2E7W A;  3GW2 A;  2EFP A;  4EV0 A;  2A07 F;  2L01 A;  2RDP A;  5D8K B;  3I53 A;  1Q1H A;  4EVI A;  1UHW A;  1YW7 A;  3EYY A;  1OYY A;  3EET A;  5DCM A;  1RIO H;  2Z99 A;  3PFI A;  1RI7 A;  3KET A;  2O3F A;  3I59 A;  4L0Z B;  1BI1 A;  3TDU C;  3ZMT A;  4IRH A;  2QQ9 A;  2UXX A;  4KN4 X;  4KYW A;  5FFZ A;  3MZH A;  1J59 A;  3I58 A;  3FM3 A;  5D6E A;  3SFZ A;  3G73 A;  2CGP A;  3HHH A;  3FXU A;  3P9I A;  2ADU A;  1IRF A;  2F5E A;  1IN4 A;  3T8R A;  4CDG A;  1OKR A;  1TQP A;  4GYG A;  3I64 A;  2OD5 A;  5HLG A;  4R79 A;  4ENJ A;  2DT5 A;  2EJR A;  2VOP A;  2XUB A;  1HXD A;  4UUV A;  1W5T A;  1U8R A;  4LK0 F;  4AVP A;  2P5V A;  3ZN0 A;  4Q5S F;  2DU9 A;  2H94 A;  2ZXJ A;  4FX0 A;  1MD0 A;  3V7C A;  2R3S A;  4M73 A;  3TO6 A;  1R22 A;  1SMT A;  2D1H A;  1FLI A;  2Y75 A;  1P92 A;  2CSO A;  2HGC A;  5HDN A;  2ACJ A;  2W25 A;  3HRT A;  4G7H F;  2YX7 A;  1ZRD A;  5LBQ A;  5LRR A;  3Q5F A;  2VXZ A;  4N9I A;  2K27 A;  2P5L C;  3HSF A;  1MJB A;  4PGH A;  2C6Y A;  3WTV C;  3I0T A;  2M8E A;  3H3U A;  4RB0 A;  1TLH B;  1YG2 A;  3TKY A;  2HTJ A;  1TQI A;  1XSX A;  1T6S A;  1BBY A;  2KJC A;  4XBF A;  2MD5 A;  1E2X A;  3VB2 A;  3DPL C;  1KQ0 A;  2MLG A;  2QYO A;  3CJN A;  4G7O F;  4E70 A;  4G8X A;  1HST A;  3B73 A;  4LG0 B;  5BQT A;  1J5Y A;  3V4G A;  2HDC A;  2KRF A;  2ZME A;  5D5W B;  4I02 A;  1G3Y A;  5HOO A;  3TO9 A;  3CDH A;  1ODD A;  3FMR A;  2HZT A;  4EJW A;  4IPA A;  3KP4 A;  2XAJ A;  3F8M A;  1XCB A;  2RQP A;  3CUO A;  4Y15 A;  4HX4 A;  2XAF A;  4GYI A;  3WE2 A;  5FD5 A;  5FD6 A;  3K69 A;  3QOP A;  1PP8 F;  1C0W A;  3LAJ A;  4P9F A;  5ERI A;  1YS7 A;  1KA8 A;  1YW8 A;  1GHC A;  3WOD F;  3COA C;  4OU0 A;  3KLN A;  4IXA A;  2R7D A;  4D0P A;  1AWC A;  1B9N A;  5D5V B;  3QU3 A;  3B02 A;  4R1H A;  1ZRC A;  4KUM A;  4EM0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...