3H92A

The crystal structure of one domain of the protein with unknown function from methanocaldococcus jannaschii
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
ETKLEEERNHLEELLEKVEEDYEGINYDEVLEALKLFKDNYELPKSKIKRKIRIFLIKENILFLNPQKGTLKPQSYLVWNAIKRML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized ATP-binding protein MJECL15
publication title The crystal structure of one domain of the protein with unknown function from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h92A00
5F64A 3O2PE 1K78B 1FYKA 2HWVA 4IVNA 5E20A 4RB0A 3CLOA 4AIJA 5LBQA 1BI0A 1V4RA 5K1YA 4Y13A 5E18F 2MLGA 2FBIA 1CF7A 5FD5A 3ZQ7A 3F8FA 5LRSA 1JHFA 4ETSA 3R0AA 5D5XB 1MJ9A 4EV0A 5E17F 3P7NA 1ZG5A 4EQQA 2LKPA 1QO0D 5L3GA 1YW7A 2GA1A 3I54A 3HRMA 4UVBA 2Z33A 3VB2A 5DCFA 1T39A 1J2XA 4ESJA 2EA4A 3CJNA 2EFOA 3CUQA 3E5QA 5FGMA 1I1SA 4JK1X 3NQOA 4BQAA 4ESFA 4KIFA 4LD5A 4LFUA 3VODA 2WWYA 1WKMA 4WCGA 2W85A 2L02A 4MHGA 3I58A 1XGNA 3IRQA 4HF2A 3DXJF 4HAMA 1ODDA 4B09A 3KEQA 1KGSA 2FEZA 2OZ6A 1FBQA 1ZAOA 5DUIA 4EJTA 4I0AA 5FLXK 1KA8A 2ESHA 1U5TA 3FF5A 4ENNA 5ICGA 3F6VA 1HKQA 3WTVC 1FYMA 5HOOA 3FM5A 4BHPA 2Y75A 4ZH4F 5BPIA 4HX4A 5K5RA 1BOAA 3V7CA 2V1DA 3V4GA 2HR3A 2HQRA 3IKVA 4WXCA 3K69A 3N97A 2XKPA 3M8EA 4A2UA 2BYVE 2H6BA 5L3DA 4HQMA 4KFCA 1YQAA 5L3BA 3JSOA 2PMHA 2VE9A 5KVRA 3U1DA 3CO6C 2DK8A 2ISZA 4RGUA 5E1ZB 3MWMA 2OBPA 1H9TA 3WE2A 3T5XA 2ETHA 3BWGA 4M71A 4OU0A 3MCZA 1T2KA 2FE3A 2RVCA 4M72A 4ZZDA 3AAFA 4BHCA 1IN8A 3GVAA 1EV7A 1FX7A 2M5WA 2XASA 1QBJA 5CVVA 4G7ZF 1HW5A 1R5HA 2P5VA 4M9SA 3I64A 1IRFA 3E5XA 4BNCA 2YR2A 4XLPF 1KQ9A 1R23A 3F23A 3H3UA 5AONA 2GXBA 1ULYA 1OPCA 3GFMA 4ZYEA 2K27A 2O8XA 3RYPA 3GF2A 3EYIA 4XSXF 3FMRA 4RGSA 3KLOA 3ZMZA 4Q48A 3I59B 2EFQA 2DBBA 3EQLF 1LEAA 3KLNA 5L3FA 2IP2A 2CSOA 4ESBA 1BIAA 4HX8A 2KRFA 1FSHA 2FA5A 3JAMK 4OIRF 1YG2A 3HTUA 4LLGF 4BAYA 2DT5A 2FSWA 1SD6A 2HZTA 4UHTA 2XKOA 3BJOA 4YFXF 5J8CA 1DP7P 3P9KA 1IXRC 1EH6A 2P5KA 2HTSA 3T8TA 1H0MA 3V7SA 4RB1A 3ZMTA 2DAOA 2ZKZA 2RGVA 5ICEA 2RDPA 3GFLA 1SFXA 3MFKA 1QGPA 1HKSA 3HRSA 2A6EF 3QPHA 5K5OA 2QWWA 4A12A 1ZARA 2QQ9A 2FMYA 2Q0OA 3RKWA 1Z7UA 4QLCU 3B02A 1E17A 1OKRA 4ZZLA 4FX4A 2GIVA 2K02A 4UNOA 1D8JA 2ISYA 3F8CA 4P9FA 5BPDA 6PAXA 3LA3A 3V8KA 3D0SA 5JI6A 1SFEA 4HBLA 2FOKA 3K1MA 3WTXC 4S04A 3ELKA 3OOPA 3WTWC 1O57A 4IPAA 2K86A 3BP8A 4BHBA 5LEJA 2A68F 1XMKA 1OYWA 3G3ZA 3J7AO 1WWXA 5D5VB 4LG0A 2E7XA 5ICFA 1HQCA 2LSOA 5E8IA 3ZMVA 3J80Z 2L4AA 1Z9CA 2ELHA 3TO9A 5J8FA 3ECHA 1MDMA 1E2XA 3EETA 2XVCA 2GQQA 4G6QA 1STZA 2XIGA 1KQ0A 2L54A 1UCRA 4UUVA 2MC3A 1YIOA 4D0PA 2LNBA 4LJZF 2IPQX 1RZ4A 4ASNA 2OQGA 2M1BA 2EJRA 1TQMA 2RV8A 3GUDA 1Y0UA 1XD7A 5CLSA 4RAZA 1CF7B 2HFHA 4KIGA 3ZMDA 2HKXA 3VOEA 3REOA 5JFRA 4CO8A 1YW9A 3F22A 1H9GA 2E1NA 2FXAA 4M73A 3FHZA 1IN6A 2KJCA 1R1VA 3KP4A 2COMA 3DF8A 4FT8A 2FQ3A 2BBYA 4N9HA 4I0BA 2R3SA 3J81K 5HLHA 1BI1A 3RPQA 2CWEA 2QQAA 4CHUA 4Q5SF 2JT1A 1ZRCA 1YLFA 2CFXA 1USSA 1O3TA 3HOTA 1U2WA 2GZWA 2RKHA 1K79A 2XAFA 2MD5A 3LWFA 2QUFA 1R1UA 1USTA 1REPC 3R4KA 5DUKA 2A3SA 3EYYA 1F5TA 3RDIA 1XSVA 1Q1HA 2O0YA 3GZ6A 5HLIA 3E97A 2EV0A 2LF7A 4L9TA 2XAJA 5DEQA 2YPRA 3C7JA 1Z6RA 4IHSA 2Z9OA 2GAUA 2RN7A 1WQ2A 2P8TA 4I02A 1OR7A 4KA4A 4YG2F 2UXXA 5HVQC 4RB3C 2L01A 3IRRA 5DD8A 1HW2A 2ZO4A 1ZREA 1SFUA 4EGZA 1FBUA 1ZH5A 5JHUA 2QLZA 3Q5FA 3I53A 1HBXG 3J80K 3O3KA 2STTA 1TNSA 4ZYDA 2AXLA 1R36A 2DK5A 3K0LA 3RKYA 3TOBA 3VEPA 5TJJA 2V79A 2VBXA 5D4SA 1FP1D 1EH8A 3LA7A 3I4PA 1BN5A 4HW0A 3ECOA 1B6AA 2H27A 3JTGA 2HYGD 1O7LA 5BS6A 4HF1A 1I27A 4A0XA 4L5IA 3SFZA 1BIBA 4ENKA 2ZNYA 1TQPA 3FX3A 4LK0F 4OOIA 2X0LA 2DQLA 3MZHA 4JBAA 2KIMA 5JVTA 1XCVA 1ZGAA 3I5UA 1P4AA 2IVMA 1LDJA 4I01A 5DCMB 2V9VA 1FWZA 1W7PA 1XB4A 1B59A 2VONA 1L3LA 1U8RA 4WWCA 2D1VA 5LEKA 5D5WB 5HDNA 2EV5A 2M87A 2FRHA 4A0YA 2EB7A 3RI4A 1P2FA 3ERED 2PFBA 3DV8A 4EJVA 3BZ6A 2XHKA 4GYIA 4CDGA 1AWCA 1B9MA 3W6JB 4G7HF 4KT5C 3U2RA 4L5JA 3M9AA 1BJAA 2QM3A 3P9IA 2LF8A 2JPBA 1Z6TA 4FHTA 1KYWA 4JQFA 4PDKA 4AD9A 5D5UB 1IZ1A 3IC7A 5BMZA 1J9IA 2G7HA 3HHHA 4A6DA 1SMTA 5FO5A 3QOPA 3P9CA 5LHIA 1IUYA 3R61A 2HQNA 2EFNA 1K78A 2QBYB 5IT9K 5HS8A 2NAZA 1QNTA 4ENJA 3MZYA 3GZ5A 5TRDA 3DP7A 5LRRA 3D5LA 5FFXA 4YFKF 1R5GA 5H20A 2GWRA 2CG4A 4A5NA 3JW4A 1ZHFA 3HYIA 2HS5A 1TW3A 3HSRA 2M45A 1ON2A 1T98A 2ZFWA 4HF0A 2Z99A 4PGGA 4XSZF 4G6DA 1ZG3A 3SQNA 2HDCA 2VE8A 2JZYA 4I09A 4UV8A 4U0VA 3ZMSA 3JSPA 2DTRA 1OYYA 4B8XA 3E6DA 4IF4A 4AVPA 2XUBA 1KYZA 4KUMA 4NHJA 3E6MA 2ZMEB 4I7HA 1UHMA 2RQPA 4MGRA 4EM0B 2XAGA 2PBIA 5LGTA 2VC1A 1YS6A 4RGXA 1FY7A 2OQRA 2CGPA 3GXOA 1LDKB 1MD0A 4EVIA 2F2EA 5FB2A 1WI9A 5ILSA 3ZN1A 4R8HA 1IF1A 2XROA 1TW2A 1G3TA 4EJUA 2PQ8A 5HDGA 3B73A 1FP2A 2IRFG 3E6BA 3RTRA 2E7WA 4LLLA 3IL2A 3CDHA 5AIQA 1FZPB 4GO1A 1J5YA 1S29A 3R0JA 1JE8A 1WSUA 3GEZA 4HZFA 4GYGA 3TKYA 2VBZA 5CYVA 5CVUA 4Q47A 3HTSB 5FFZA 2NS0A 3HUGA 3F8MA 3ZMUA 1HSJA 3M8FA 4G94A 2DPDA 4LMYA 1QPMA 1U5TC 4IJAA 4MQVA 3BDDA 1OMIA 1XGOA 2R7DA 4HQEA 1LVAA 1S7OA 1K7AA 1DDNA 2Y48A 3F72A 4HV5A 4WF2A 1IN5A 2DW4A 3FM3A 2JTVA 3E3VA 3QPTA 1TBXA 4EM2A 1OYIA 4YFNF 4IRHA 1BI2A 2KJBA 1J0RA 2OD5A 5H6QA 3ZPLA 4NB5A 1IXSB 2BE5F 3KETA 3DKWA 2EWNA 1L0OC 3QP5A 4OIOF 1R00A 1JHHA 4U7BA 3OV8A 1HW1A 1YYVA 3T8RA 5A2QZ 3K1NA 1KU3A 2CW0F 2YU3A 2X4HA 3C3WA 4RB2C 2WV0A 4HYEA 3WTTC 4KN4X 4KMFA 1ZRFA 4MEYF 1FT9A 1RIOH 2A69F 3F8BA 4CXFA 4P55A 3IHUA 4LGWA 5HS7A 1EH7A 2ZXJA 3S2WA 2D1HA 4WX9A 1I5ZA 1SMYF 4KNYA 2W24A 3E5UA 5CVIA 2LDUA 3DQVC 2VOPA 3VFZA 2D45A 3BROA 1SD4A 1F9NA 2ESNA 3I59A 1G6NA 1UHWA 4M6YA 5K5QA 1XGMA 4Z2YA 4UXNA 5LLQA 3BPVA 3U9GA 2DI3A 4XBFA 5FD6A 1NHAA 5ILVA 2Z5UA 2EA2A 2A6HF 5ICCA 4L0YB 1R22A 2A61A 2QQBA 3WU1B 4P96A 4KMUX 4UVAA 5EEGA 2H09A 3KP5A 2VT3A 3PQJA 3EUHA 5H6RA 4KICA 1P92A 1B9NA 3F6OA 2A5YB 2E1CA 3DEUA 3T0YA 4O6JA 3MQ0A 1UFMA 2W57A 2RNJA 1T38A 3T1BA 2DU9A 2DPUA 2QZ8A 1W4MA 4M9ZA 4F7ZA 4UV9A 4N9IA 2K4JA 4IXAA 4HDVA 3NEUA 3CUQB 3FXRA 5DDGA 1BBYA 3LAPA 5ERIA 4FX0A 2JPCA 3M1EA 1LEBA 2VXZA 3O6BB 3TDZC 3HRUA 1LNWA 4I98B 1PDNC 1TTYA 2IJLA 5J6XA 4L0ZB 3KEOA 1F4KA 1WRJA 2Q8KA 2CQKA 1Z91A 3ULQB 2Q2EA 2PG4A 3Q9SA 3LFKA 3PFIA 2O03A 2IA2A 2IA1A 2R7FA 3M7GA 4KDPA 2YX4A 3N4MA 1U5TB 3GLXA 4HA8A 5D8LB 2PEXA 2PLYA 3BPXA 3TDUC 3WGHA 4U0YA 1J59A 2IT0A 1KU2A 3HOSA 3I0TA 1I1GA 3WE3A 1JXSA 2RC4A 5BQTA 4A5MA 4AWXB 2P7CB 4K2EA 1LB2A 1FC3A 2JRTA 3GFJA 5HS9A 5LHGA 3RJPA 3CO7C 3KZYA 3F8NA 4CICA 2MH2A 4DNCA 3H92A 4G7OF 2PMUA 3COAC 1FOKA 2BEOA 3IKTA 1ZN2A 3DPLC 1O7FA 3Q9VA 1FSEA 2ZNZA 3SZPA 1O3RA 4OIPF 1ON1A 1C0WA 1W7PD 3ROUA 2J5PA 1AOYA 1X3UA 2F5DA 2FNAA 1VTNC 3QRFF 1SD5A 3FZVA 2DLLA 3R6SA 1D3YA 4YIFA 3I71A 4LLNA 2MH9A 3MAJA 5LHHA 4EJWA 3SXYA 4L9VA 2HKOA 1DPUA 4RS8A 1MJBA 4M6XA 3LQQA 4EM1A 1IN4A 2L3DA 1ZLJA 1D5VA 3W6KB 1IAWA 4N0BA 5DV5A 1QQIA 3ZP5A 2UXNA 2NNYA 3FMQA 1SAXA 4YIIA 1GVJA 3L00A 3GWZA 1D8KA 1GXQA 4IRGA 5CVRA 3JAMZ 4AIKA 4WXHA 1BM9A 1MGTA 2WC2A 1P4WA 1RNLA 2EV6A 4IRIA 1PUEE 1HXDA 1S8NA 2DQRA 2XAHA 4DQ2A 2ADUA 5ILUA 1XN7A 3FXUA 5D6FA 2G7UA 4MNUA 1IXCA 1IN7A 1RI7A 3KP3A 4MQ9F 4H0EA 3QU6A 5E1WA 4GXOA 1G3SA 3LSTA 4TV7A 3DPTA 3G73A 4IHTA 3QP6A 1GHCA 2F5FA 4MTDA 4A0ZA 4KIBA 4HLXA 1PP8F 3L7WA 4HOBA 2VOOA 2F5EA 3HSEA 4XRFA 1MZBA 1O3QA 2EK5A 2OAZA 3IWZA 3TO7A 1U6GA 1Z05A 4O5VA 2W84A 2KIUA 2ZCWA 1BC7C 5LGUA 5CJ9A 3TO6A 1B1BA 5DD4A 1YFHA 4EMSA 4PZJA 5DYMA 3EDPA 4OIQF 4RGRA 2HOEA 4L18B 4M9XA 4LB6B 3WU0A 2HTJA 1IW7F 2YSRA 5L3EA 4PCQA 4U7DA 3WG9A 5E1XA 3WODF 1G4DA 4Q4ZF 2VN2A 3JTHA 4GCVA 1BI3A 2Y0MA 2GA2A 2VBWA 3KE2A 3RKXA 2FBHA 3BJ6A 4R79A 1TNTA 2IA0A 1KQ8A 3WTZA 3K2ZA 3KP7A 4G9YA 4L9JA 4LG0B 1G3YA 4A6EA 2CO5A 1ZG1A 4OMZA 3LQRA 3FMSA 3QU3A 1MJAA 1XMAA 3R60A 4XLNF 5BOXA 1YO5C 4BXUA 4UVCA 2YX7A 2NYXA 4OMYA 3V8LA 2OZUA 5JR3A 3SZTA 2MBFA 1MDMB 3L09A 2CYYA 4GGGA 3CUQC 3H3ZA 5D6EA 3WGIA 1LJ9A 1TLHB 1I6XA 5DCMA 4AIHA 4P5OA 4CGZA 3ZN0A 3KP6A 2VC0A 2K7LA 2J5OA 1MKMA 2UWMA 1S7AA 1XDSA 3WTSC 3ABTA 2P6SA 2P4WA 2WTEA 3L9FA 1W5TA 1XCBA 1KU9A 4G8XA 4WK8F 3DFGA 1P6RA 2V1XA 3C1DA 3GW2A 1HSTA 3QAHA 2H6CA 2IW5A 2M8EA 4M74A 1S6LA 1LQ1A 1S3JA 2QVOA 1J7KA 3J81Z 1ONVA 4E70A 4BYYA 2L4MA 2XGXA 2EFWA 2JSCA 2XRNA 4P9UA 1HKTA 4KYWA 2HEOA 5CVJA 2VT2A 3BOQA 1TQIA 5F1RA 1U3EM 2QBYA 3GYHX 2DO7A 2EFPA 4HLYA 1XSDA 3BY6A 2MLKA 1Z1DA 5HLGA 1FLIA 3TGNA 1ZRDA 4Y17A 2GXGA 2H94A 3RIRA 2UZKA 4MEXF 1YS7A 1V3FA 1XGSA 4U0WA 1FPQA 4CYDA 2MA3A 2TDXA 1G3WA 3RPUA 2Z3YA 4ZYHA 4CZZA 4S05A 2O61A 2FF4A 2ZMEA 2FMLA 2V6CA 4U88A 3K1PA 5D8KB 2VODA 3E6CC 2BV6A 1U78A 5ED4A 3BJAA 4QWQA 3WTUC 4EJOA 5KK1A 1DUXC 3LAJA 4HV6A 3KCCA 2KIFA 2G9WA 3HHGA 4RAYA 2A07F 4ZYGA 4O3MA 1RUOA 2W25A 1R58A 5D4RA 1QZYA 2B0LA 1RUNA 1R1TA 2D2WA 2C6YA 1P4XA 4ON0A 3WGGA 1YW8A 4MTEA 3NRVA 2FBKA 3F21A 2P5LC 3LA2A 4Y15A 3TQNA 5IT3A 2KKOA 2P7VB 1KU7A 3KFWX 1XSXA 4HDUA 1ZYRF 2PJPA 3FWEA 3HSFA 1ZLKA 2PI0A 2ACJA 3V7RA 4BH9A 3C18A 3ML6A 3ABUA 3HRTA 1K6OA 2VBYA 2FNPA 3GX4X 1ZGJA 1T0FA 5F6FA 3F3XA 4R1HA 4WXDA 1FYLA 3MEXA 2XV4S 2ZBKA 1QZZA 2V1UA 4L9NA 5FLXZ 1JGSA 2P6TA 3L2CA 2HYFA 3CUOA 3GFIA 3TOAA 5EEHA 3WTYC 1FBSA 2M30A 3HIFA 4HX7A 1W7PB 2NRAC 2OA4A 5E8GA 3V8JA 3CTAA 2O3FA 2PN6A 3RYRA 1A04A 1W5SA 1SD7A 2AS5F 1UB9A 1O3SA 4EGYA 2DFIA 3GO5A 4LK1F 4I2OA 3KP2A 1R7JA 3PQKA 1GXPA 2STWA 5L3CA 3FXQA 2F5CA 3ISPA 2FU4A 4NQWA 1XDUA 2OU2A 2QYOA 1F1ZA 2HGCA 2QENA 5LGNA 5A2QK 1PP7U 2K4BA 1J75A 2O6GE 4ENMA 1IRGA 3IWFA 5IT9Z 2NNNA 2ZJ2A 1FNNA 1B4AA 5AIPA 4PGHA 2XAQA 1BC8C 1T6SA 4KN7X 5HDKA 1DPRA 3K9TA 4LB5A 1LDDA 3SHFA 3KZZA 1CGPA 2BGCA 4OINF 1YTYA
chains in the Genus database with same CATH superfamily
5F64A 3O2PE 1K78B 1X4PA 1FYKA 3CCRI 2HWVA 4IVNA 4IZZA 5E20A 2YU9J 4RB0A 1X2NA 3CLOA 4AIJA 2IS4A 2QCOA 5LBQA 1BI0A 2IBDA 1V4RA 4ZYAA 5K1YA 1LE8A 4PJJA 4Y13A 3OSFA 1FJLA 3TMOA 1WJDA 5F0HA 4XL9A 3FXJA 5E18F 5EGOA 2MLGA 3DBHB 2FBIA 1Y8QB 1JGGA 1CF7A 2QQ8A 5FD5A 3ZQ7A 1Z21A 2WAFA 3F8FA 2LREA 3H9GA 5LRSA 1X2MA 1IV8A 3S16J 2X51A 1JHFA 4ETSA 3ZQQA 3R0AA 5D5XB 4XKWA 2LY9A 2PX9A 1MJ9A 4EV0A 5E17F 3P7NA 1ZG5A 2DA7A 4EQQA 2LKPA 1QO0D 4E7HA 3ZR8X 5L3GA 1N75A 1YW7A 4C30A 2GA1A 3I54A 4A3GJ 4MO7A 3HRMA 4UVBA 2NS8A 2Z33A 3IV5A 3VB2A 2L7KA 5DCFA 1T39A 1J2XA 3CCYA 4ESJA 2EA4A 3CJNA 3HXLA 5E3LA 3J7AY 3W3CA 2EFOA 3S1NJ 3CUQA 2LLKA 2ZFUA 3E5QA 4UUSA 5FGMA 1I1SA 3IP4B 2X6YA 4JK1X 3NQOA 2X9DA 4BQAA 2M7BA 2ZJPF 2CU7A 4N4OB 3OYNA 4ESFA 2ZXHA 2ZC2A 3E1SA 2R7WA 2X85A 1B72A 4KIFA 1ETXA 4LD5A 4LFUA 2DOAA 3KYLA 3BG5A 1W1WE 2F4MB 4CA0A 3VODA 3V42A 1FOWA 3JR9A 1MSFC 2WWYA 4ZDPA 1WKMA 3DLLF 4WCGA 1Z3XA 4GFBA 2W85A 2L02A 4MHGA 3I58A 1XGNA 5EEAA 2V1NA 3IRQA 4HF2A 3OYHA 3ZQCA 3DXJF 1ETOA 1QPIA 4HAMA 4DGWB 2LYCA 1DU6A 2W4SA 2L9VA 1ODDA 4B09A 3KEQA 3VDXA 1KGSA 2FEZA 2OZ6A 5M5WJ 1FBQA 1SFOJ 1ZAOA 5DUIA 4EJTA 4X6AJ 2VKEA 2FQ4A 4I0AA 2TCTA 5FLXK 5GAGJ 2BY0A 2BY1A 1KA8A 1AU7A 3A2KA 4Z6YA 2ESHA 2X48A 3G2BA 1U5TA 3FF5A 2V9KA 5E3OA 2WB1A 4ENNA 1FIPA 4QTRA 3CESA 5ICGA 2A05A 3F6VA 1HKQA 3WTVC 3H0DA 1FYMA 3FKJA 2WBMA 5HOOA 4IHYA 1MH3A 2ICWG 3HUGB 3CZ6A 3FM5A 4FE4A 2LRDA 4BHPA 1Y1VJ 2DMPA 2VKVA 5E3MA 1H8AC 2Y75A 4ZH4F 2BOLA 5BPIA 4HX4A 1BR4A 4MIMA 5K5RA 2VI6A 2E71A 3GTJJ 2LC2A 4BQQA 1BOAA 3MKWB 4XR6A 1T08B 1GV2A 3V7CA 2V1DA 3BZCA 3V4GA 4KITB 2EH3A 2F5VA 2HR3A 2HQRA 2BVLA 4B47A 2DA1A 3LSPA 3IKVA 5K7FA 4WXCA 1OFCX 3K69A 1TL8A 1HC8A 2ECCA 4XOTA 3N97A 1XMXA 2XKPA 1ZQ3P 4BY1J 3FKIJ 3M8EA 4A2UA 2HOTA 2BYVE 2H6BA 2LG4A 3QQAA 5L3DA 5GTIC 4HQMA 3S32A 3ZQLA 1YQAA 4KFCA 1YOVB 1SVMA 5FRMA 2XF6A 3HGYA 3Q3SA 1R6RA 2PMHA 5L3BA 3JSOA 2VE9A 3ZQIA 3AG4H 2HPMA 5KVRA 3U1DA 5IP6A 3CO6C 2E19A 5EG0A 2AQFA 2DK8A 2ISZA 3EPZA 4RGUA 2Y30A 1IG7A 3CQZJ 5E1ZB 1JUPA 2NVQJ 2OC6A 2OBPA 3MWMA 4RLQA 1H9TA 3WE2A 3T5XA 3S3OA 5GPAA 1DGRM 2ETHA 3BWGA 3BCAA 4M71A 4OU0A 3MCZA 4IEJA 1T2KA 2FE3A 2RVCA 4M72A 1ETKA 4ZZDA 3AAFA 3H5NA 4BHCA 3H5RA 1IN8A 3FISA 3GVAA 1EV7A 2VL8A 2W48A 1FX7A 2DYSH 2M5WA 2XASA 1IJWC 4Y7NJ 3HKZN 2ZSIB 1QBJA 5CVVA 1YHQI 4G7ZF 1WJBA 1HW5A 3GMEA 4BQNA 1R5HA 2H1KA 2P5VA 4M9SA 4A3JJ 2B7EA 3H0GJ 3I64A 1R5ID 1IRFA 3E5XA 3LSHA 3M07A 4BNCA 1VI0A 3S3MA 2YR2A 2R7VA 4XLPF 1KQ9A 1R23A 3F23A 3H3UA 5AONA 2G0EA 2GXBA 3TP0A 3HL2A 1ULYA 1X1BA 1OPCA 3FXLA 2GM4A 2K9SA 3GFMA 1MMSA 4ZYEA 2K27A 5J1RA 2O8XA 2DXIA 3GF2A 3RYPA 4RM3A 4XSXF 5IP9J 3EYIA 3FXMA 1BR1A 3FMRA 3L2RA 4RGSA 5IYDJ 4PJMA 3F0CA 3G1LA 1EJ9A 3KLOA 3ZMZA 2ME0A 4EATA 4NUBA 4ZTJA 4Q48A 5GAEJ 3I59B 3KYCB 3D1NI 2EFQA 3IUOA 2DBBA 1XS9A 2I8DA 3HOZJ 1RETA 1E3PA 3EQLF 3K70C 3O8HA 1LEAA 1F36A 3K4LA 3KLNA 1OQYA 5L3FA 1BW6A 1QHHD 2IP2A 3MKLA 2B63J 3VSLA 2CSOA 4ESBA 1BIAA 4OAYA 3OOUA 4HX8A 2KRFA 1FSHA 1F43A 1GV5A 2FA5A 1OCTC 1AA7A 3JAMK 4OIRF 4C3HJ 2KZGA 1H89C 4PK4A 4QIWN 1YG2A 3HTUA 2HVQA 4LLGF 4BAYA 2DT5A 2FSWA 1SD6A 5CQGA 2HZTA 4UHTA 3DWLE 1S7EA 2XKOA 3OYJA 3BJOA 5F27A 4YFXF 2M8GX 1D1CA 5J8CA 1DP7P 1EKEA 1JKOC 3BTJA 5J4VA 3P9KA 1IXRC 1G2HA 1EH6A 2P5KA 2HTSA 3T8TA 2NXNB 3DLAA 3QODA 4PFOA 1H0MA 3V7SA 4RB1A 3ZMTA 4JP0A 1YX5A 2DAOA 2OCCH 2ZKZA 4XRMA 2IGOA 2RGVA 5ICEA 2LMDA 2RDPA 4AC0A 3GFLA 2XPUA 4Y4RA 1SFXA 4HEA2 3MFKA 1K6YA 1YRNB 1MIJA 1QGPA 1HKSA 2CQQA 3HRSA 3S3NA 2A6EF 3QPHA 2HI3A 2OTLI 1S72I 5K5OA 2QWWA 4A12A 4GRIA 2E5NA 1ZARA 2QQ9A 1NH3A 1N77A 3FIWA 2VPLA 2FMYA 2Q0OA 3RKWA 1Z7UA 4QLCU 3BTCA 1X3ZB 3B02A 1E17A 4E7ZA 3OYMA 1OKRA 3HB9A 4ZZLA 3OL4A 3FXOA 4FX4A 2GIVA 2MC4A 2K02A 5CKTA 1U0JA 4UNOA 1D8JA 2ISYA 1Y8RB 2VQLA 3F8CA 4P9FA 5BPDA 3HBLA 6PAXA 3FHNA 3GTLJ 3ZRGA 3LA3A 1SANA 4QPQA 2P0WA 4BDYA 2LD5A 3V8KA 3RKQA 3D0SA 1DGWY 5JI6A 2R0QC 3ZQHA 4XKCA 5C3EJ 1SFEA 4HBLA 2CJJA 2FOKA 3OYKA 3DPUA 3K1MA 2CUJA 3WTXC 3U1KA 2RQQA 1MMNA 3ELKA 4S04A 2Q2EB 3OOPA 4FE7A 2UUZA 5HLTA 3WTWC 1O57A 4BACA 4IPAA 5FJ8J 4BU2A 1TWCJ 1I39A 2L7MP 2JSPA 2EZHA 2K86A 1Y39A 3BP8A 4BHBA 5LEJA 2A68F 3C2HA 5FRNA 1XMKA 3KYDB 1WPKA 1E3OC 1OYWA 4OWRB 3G3ZA 3J7AO 1WWXA 5D5VB 4IOAF 5IPAA 2BHZA 3VPRA 4LG0A 3GTMJ 2E7XA 3BT9A 3X2QH 1IDZA 5ICFA 1VQ4I 2DTZA 1HQCA 2BXYA 4LITA 4M3BA 3SEQA 4XRSA 2LSOA 5E8IA 1TT0A 3S2HJ 2E1MB 3LFUA 1Z3YA 3ZMVA 3J80Z 2L4AA 4A3DJ 4F52A 2ID3A 2ELHA 1Z9CA 3TO9A 5J8FA 3ECHA 4A3LJ 1MDMA 1E2XA 3EETA 4B44A 3G6EI 1WCMJ 4UB8C 2YS9A 2Y9ZA 5M5XJ 2XVCA 4XIDA 2GQQA 1Y1WJ 1YITI 3KZIC 1FTTA 4G6QA 1STZA 4M3FA 3G1MA 2XIGA 1KQ0A 2VXDA 3DKYA 2L54A 1UCRA 2V7FA 3KIOA 4UUVA 2MC3A 4DIQA 2KISA 1YIOA 3PL8A 3SEZA 2L5QA 3TEDA 4D0PA 1VQ9I 1P9QC 1TP4A 2LNBA 4LJZF 2IPQX 1RZ4A 4D5FA 4ASNA 1KZHA 1LFPA 2E34A 2OQGA 2M1BA 4A3CJ 2EJRA 3OYCA 1TQMA 2RV8A 3CC4I 2V4JC 1HCRA 1YI2I 4NC6A 4B3XA 3BR1A 3GUDA 4B1RA 3CCEI 4ZJZA 3OS0A 1Y0UA 5E3NA 5F0FA 1XD7A 3ZOBA 5CLSA 4RAZA 1CF7B 2HFHA 4KIGA 3ZMDA 1R4NB 1RPWA 2HKXA 3VOEA 2DDBA 1OCRH 3REOA 1BJZA 1P7JA 2Y2ZA 1X3WB 5JFRA 4AIDA 3G4SI 1VQKI 2ELKA 4CO8A 2O8KA 1YW9A 3F22A 1H9GA 2E1NA 2FXAA 3OIQA 4M73A 3FHZA 2E35A 3ABLH 1IN6A 2KJCA 5B5EC 4Y52J 1YJ9I 4II3A 3OS2A 2IS1A 1R1VA 3KP4A 3A1YA 5B1AH 2COMA 5M3MJ 2PJRA 2X6WA 3DF8A 3H3VK 2IS2A 3HPGA 4FT8A 2FQ3A 3AG2H 1HA8A 2BBYA 4N9HA 4I0BA 2R3SA 2BY3A 3J81K 5HLHA 1BI1A 4M3EA 4UY8I 3RPQA 3ABKH 3Q0WA 2OV7A 2CWEA 2QQAA 4FETA 2IGMA 4CHUA 3CCQI 4HRIA 1TWGJ 4QSHA 3UR3C 3JRHA 2O9LA 4Q5SF 4XM3A 2JT1A 1ZRCA 1YLFA 2KT0A 1N78A 2CFXA 3PFYA 1USSA 1LKXA 2KRCA 1O3TA 1XTAA 2DFEA 2QSHX 3HOTA 2L7FP 1U2WA 1GDTA 2GZWA 2RKHA 4BKXA 4F92B 1X1AA 3IAM2 1K79A 2EIKH 2XAFA 3D5RC 3CCVI 3QOEA 2MD5A 3LWFA 2LP0A 4I99C 5FKLA 2QUFA 3A0BC 1R1UA 1USTA 2VJ5A 2BXZA 1REPC 3R4KA 5DUKA 3NWTA 2A3SA 3EYYA 3L2UA 1F5TA 2E1OA 3RDIA 2A6TA 1XSVA 1Q1HA 1TWAJ 3SFIA 4RM2A 3E7LA 2LK2A 1UHSA 2O0YA 3GZ6A 2LH9A 4RDUA 4JX6A 3CCUI 1I6HJ 2Y31A 3A01B 5HLIA 1POGA 4RAGA 3H35A 4XLEA 3E97A 1U9NA 4DOZA 2EV0A 2LF7A 2QSGX 4L9TA 2XAJA 3PUFA 5DEQA 1W36D 2Z1DA 2COBA 3FBIB 1YX3A 2V6EA 2YPRA 3C7JA 4KT6A 1MBEA 1Z6RA 3CC7I 2EINH 2R5YA 4IHSA 2Z9OA 2R7QA 2GAUA 2RN7A 2WV1A 1K4TA 1PYVA 1WQ2A 3CMYA 3MKZA 2CUFA 2P8TA 2AQEA 4I02A 1OR7A 1AKHB 4KA4A 1OLTA 2QSFX 4YG2F 2UXXA 1BL0A 2JA8J 2DCEA 1QU3A 1E3HA 2F4OB 5HVQC 2LY2A 5EDNA 4RB3C 2EQRA 2L01A 1ZR2A 1ETVA 3IRRA 5DD8A 2ZMEC 4XLHA 5TGTA 3UNGC 1HW2A 1VQ6I 2ZO4A 1ZREA 1PUFB 2XPVA 2NVTJ 2GBYA 4EGZA 1SFUA 3HM5A 1FBUA 1ZH5A 5JHUA 2QLZA 3Q5FA 2M4KA 3RQIA 1X4OA 2DA4A 3I53A 3S1MJ 1HBXG 3J80K 3RCOA 2ID6A 3O3KA 3ZXSA 4ITVA 1QVUA 1S5LC 2STTA 1TNSA 2X6XA 4ZYDA 2AXLA 1S9HA 3DBLB 1R36A 1Y0NA 2DK5A 5GPCA 1W0UA 3K0LA 2HOSA 3RKYA 4XLCA 3TOBA 3VEPA 4DJAA 2KMUA 5B3SH 4RBOA 5TJJA 3CJQB 3OYFA 2V79A 4IQJA 3WG7H 3ZCOA 2DN0A 1T33A 2VBXA 5IOZA 3CP2A 2CV0A 5D4SA 4NBQA 1FP1D 1EH8A 3CCJI 3LA7A 2CV2A 5EZGA 2LOOA 3I4PA 1BN5A 3MZ8A 3EUHC 3QPSA 4BE2A 2DJNA 2R7XA 4HW0A 3ECOA 1B6AA 1WGXA 1YJNI 3JTGA 2H27A 1ZGWA 1P7IA 2HYGD 1O7LA 5BS6A 4HF1A 1I27A 3OYLA 1UJ8A 3W2AA 4HSTA 2KDOA 1VF9A 4A0XA 4L5IA 2FX0A 3SFZA 1WFXA 1BIBA 4ENKA 3OYAA 1Z7LA 2ZNYA 4HPQA 2R5ZA 1TQPA 3FX3A 3AL0B 4LK0F 3LMMA 4OOIA 2X0LA 1B8IA 2VJJA 2DQLA 3KX2A 3MZHA 2E5ZA 4JBAA 2QKMB 2KIMA 5JVTA 1I50J 3HG9A 1XCVA 1ZGAA 3HPHA 3I5UA 1P4AA 2IVMA 4ZTFA 2O7OA 4MFEA 2IEKA 3JRGA 2DFFA 1LDJA 2DT6A 3SYTA 4I01A 5DCMB 4AUXA 2V9VA 1FWZA 1W7PA 1XB4A 2LKXA 1B59A 3BLYA 4CCLA 2VONA 1L3LA 1TWHJ 1U8RA 4WWCA 2D1VA 3AG1H 5LEKA 5D5WB 5HDNA 2EV5A 2M87A 1V55H 2FRHA 2LBFA 4A0YA 1WJ5A 2EB7A 3RI4A 1P2FA 2GIZA 3BG9A 3ERED 2JVGA 5KAFC 3DKXA 4RAFA 2PFBA 3DV8A 4CYCB 3S8PA 3KEYA 2DMQA 4EJVA 3MD2A 3K4KA 3BZ6A 2K3FA 1MBFA 2XHKA 5K7ZA 4FCYA 4GYIA 3W6VA 2HU9A 2K9LA 1WI3A 4CDGA 1XX5A 1VZ0A 3L2WA 1AWCA 2XC7A 1B9MA 3W6JB 4G7HF 4KT5C 2HXOA 3U2RA 4L5JA 1A31A 3CF2A 2JA5J 3M9AA 1BJAA 2QM3A 2WAQA 4BEHA 2W00A 3G71I 3P9IA 2LF8A 1GT0C 2JPBA 1Z6TA 4FHTA 1KYWA 4YELA 4C9YA 3CDLA 4JQFA 4PDKA 1OCPA 4AD9A 2OCEA 2BW3A 2CUEA 3S2DJ 5D5UB 1IZ1A 2DT7B 3IC7A 5BMZA 1J9IA 2G7HA 4F3QA 3HHHA 4A6DA 1SMTA 2DDAA 3K4MA 5FO5A 3QOPA 3P9CA 4BBSJ 2E1MC 5LHIA 1ZELA 2DOFA 2MD0A 1IUYA 2JA2A 4DYCA 3R61A 2CW7A 2HQNA 1FOYA 2EFNA 1YIJI 2MW8A 2DMTA 3OYDA 1XPXA 4BQOA 1K78A 3JRDA 2CH0A 2K3PA 2RAEA 2QBYB 5IT9K 2K85A 5HS8A 2NAZA 5J47A 3BQYA 3LSMA 2BHYA 1QNTA 4ENJA 2YUSA 3MZYA 3GZ5A 3OIPA 3A02A 5TRDA 3DP7A 5LRRA 3D5LA 5FFXA 4YFKF 3S93A 1R5GA 5H20A 2GWRA 2BZTA 2CG4A 3BCBA 4OAZA 4A5NA 3PUBA 5DS9A 3JW4A 1T56A 1ZHFA 5BNGA 2WA0A 3HYIA 2HS5A 4CCNA 3EUKL 3LSIA 3M3YJ 1TW3A 3B6AA 3HSRA 2JRMA 3HOVJ 4A69C 4E7JA 3PIOF 2M45A 2JA6J 1ON2A 1T98A 2ZFWA 1IRZA 4HF0A 3JRCA 2Z99A 4JYKA 4PGGA 2PMZN 4XSZF 3HEFA 2KP6A 2JUGA 3CJRB 4G6DA 1ZG3A 3SQNA 2HDCA 2VE8A 3AFHA 2L2OA 2L9RA 2JZYA 4I09A 4PJ0C 5FROA 1JJ8C 2Y0SN 4UV8A 4U0VA 4W1UA 4RA2A 1OISA 3ZMSA 3JSPA 2HDDA 2OTJI 2IS6A 2DTRA 1WJAA 2L7ZA 1OYYA 4B8XA 3E6DA 4IF4A 2X1CA 5TISC 2XUBA 3TL4X 1KYZA 4AVPA 4KUMA 2E2HJ 4NHJA 3TW7A 3E6MA 4P1WA 2ZMEB 4I7HA 1TZLA 2N8GA 1UHMA 1PVEA 2RQPA 4MGRA 4EM0B 4XICA 2XAGA 2PBIA 3S1RJ 3W2VA 1ENHA 2VC1A 5LGTA 2L9SA 1YS6A 4RGXA 4N4NB 1QHGA 4A3EJ 1FY7A 2OQRA 3E0JB 5GAHJ 2CGPA 1HDPA 1ETQA 1JTYA 2DMNA 3OL3A 1BA5A 3GXOA 1LDKB 1MD0A 2DJIA 4EVIA 4V2FA 3HOUJ 2F2EA 5FB2A 1WI9A 3BTLA 5ILSA 3ZN1A 2QA4I 2WADA 4R8HA 1QA6A 1IF1A 2XROA 4XORA 1TW2A 1G3TA 1APLC 2ZSHB 3N05A 1OCOH 2PQ8A 4EJUA 2M4GA 3PJRA 2KIQA 2L0KA 5FKOA 5HNFA 5HDGA 2R4GA 3B73A 4FISA 3VYSB 1FP2A 3DCFA 1MMDA 2QF7A 2IRFG 1Z77A 3E6BA 2F6CA 2M0CA 1G8XA 3RTRA 2E7WA 3FDYA 3CCSI 2KRHA 3OS1A 4LLLA 3IL2A 3JRIA 3CDHA 1BR2A 3DBRB 5AIQA 1FZPB 4IHXA 4GO1A 4B43A 1J5YA 1S29A 3R0JA 1JE8A 1WSUA 3GEZA 4HZFA 2MYSA 4GYGA 4AYBN 3VYTB 4XLAA 1MBGA 3TKYA 2VBZA 4X1EA 5CYVA 1R9TJ 4Y3OA 5CVUA 4Q47A 3HTSB 5FFZA 2NS0A 1OCZH 3HUGA 3F8MA 3BR5A 3ZMUA 4E4HA 1HSJA 3M8FA 4G94A 2DPDA 4LMYA 1QPMA 3IAS2 2XF7A 1U5TC 3QYFA 4IJAA 5JVGF 4MQVA 1MSEC 3BDDA 3H1CA 9ANTA 1OMIA 1XGOA 2R7DA 4HQEA 4PJLA 1NG7A 3HOWJ 1LVAA 1S7OA 1K7AA 3S1QJ 1DDNA 5DTDA 2OF7A 4JX5A 2Y48A 3F72A 4HV5A 1UZCA 1X1CA 1IN5A 4WF2A 4CH7A 1R49A 1LVKA 4XKBA 2DW4A 1UG0A 3M1CA 3FM3A 1RR7A 2JTVA 3BG7A 3E3VA 3QPTA 1TBXA 4EM2A 1OYIA 2VJIA 2HVSA 4YFNF 3OR2C 4IRHA 3FK7A 1BI2A 4W97A 2KJBA 4NDLA 1J0RA 2OD5A 5H6QA 3A03A 1A6QA 2M7AA 4XK4A 3ZPLA 2XRLA 3CCLI 4NB5A 1IXSB 1VQOI 2BE5F 3KETA 3DKWA 4IHVA 5JLWA 3CF5F 2EWNA 4PSWA 5B1BH 2Y9YA 3I56I 1L0OC 3QP5A 4CCJA 4OIOF 1R00A 1JHHA 4U7BA 3OV8A 5F1JA 4ZC3A 4NNJA 5J3LA 3G1OA 1HW1A 4BJ5C 1A35A 1YYVA 3UKGA 2EPFA 3I4NJ 3T8RA 4DBQA 1LFUP 3OWTA 5A2QZ 1H88C 3K1NA 1KU3A 1FOXA 1V5FA 2CW0F 2VIXA 2YU3A 2X4HA 3C3WA 3BG6A 4RB2C 1VQ7I 2DOEA 3CDIA 2AO9A 5GTHC 2WV0A 4HYEA 3I9V2 1Y56A 4B3AA 3WTTC 4KN4X 3LL7A 4KMFA 1ZRFA 4MEYF 4NQWB 1FT9A 1RIOH 2MSYA 2A69F 3ERMA 3F8BA 2CV1A 3DTIA 3HZJA 3J7YJ 2XSJC 4CXFA 4P55A 3IHUA 4LGWA 3PNYA 5HS7A 4DBRA 3ZQFA 1IGNA 1EH7A 1IUFA 2MGQA 2ZXJA 4YRVA 3S2WA 2D1HA 4WX9A 2JQ7A 2CW8A 1SFKA 1SMYF 1I5ZA 2W24A 3FBNB 4KNYA 2FD5A 5JHFA 3GBGA 2K5CA 3E5UA 2QEXI 3K10A 2LDUA 3B6CA 3DQVC 5CVIA 4IX7A 1MNMC 2VOPA 3VFZA 2D45A 3BROA 3DEEA 1SD4A 1F9NA 2ESNA 2FOWA 2Z2SB 1G6NA 3I59A 3AL0C 1UHWA 3A0HC 4M6YA 1I3QJ 4HG2A 5K5QA 2L9NA 1W5CC 3C2BA 1XGMA 3RZDJ 4Z2YA 4UXNA 4I76A 5LLQA 3JCUC 3BPVA 1X1PA 3U9GA 2DI3A 2QKLB 4HNTA 4XBFA 3OIOA 4BUPA 1NHAA 5FD6A 5ILVA 3L2VA 2Z5UA 1GUUA 2EA2A 2WB1N 1CQTA 4IHWA 3RZOJ 3VSKA 2A6HF 1MMGA 2R92J 5ICCA 1W0TA 4L0YB 1R22A 2CQXA 1LE8B 4DYQA 5FKKA 2A61A 2QQBA 1NG6A 2VB6A 3WU1B 4P96A 5EGOB 4KMUX 4UVAA 1ERDA 5EEGA 3AG3H 2H09A 3KP5A 4BS9A 2XAUA 2VT3A 3PQJA 4J01A 3EUHA 5CQEA 4KICA 5H6RA 2VKDA 3QPLA 4YIRX 1P92A 1B9NA 1SC7A 3F6OA 2A5YB 5M5YJ 2MG4A 3OY9A 2E1CA 3DEUA 4AVZA 3T0YA 5DM7F 2WY7Q 3MQ0A 4O6JA 1UFMA 2W57A 2RNJA 1T38A 3T1BA 3ZQGA 2DU9A 2DPUA 2KHMA 3CMEI 2QZ8A 4PFPA 1W4MA 4M9ZA 4F7ZA 2DA6A 4UV9A 3Q0UA 3WU2C 2ZXIA 4N9IA 1YRNA 1D1AA 3I3LA 2CS3A 2K4JA 4IXAA 4HDVA 3NEUA 3CUQB 1ITYA 2ECBA 2FJ1A 2NOJB 3FXRA 1BBYA 3OMYA 5DDGA 4UUSB 1HLVA 2OJED 5ERIA 4FX0A 3LAPA 2JPCA 2CUZA 2NS7A 3M1EA 1LEBA 3GTKJ 1JUSA 1JKPC 2VXZA 1B72B 1ZK8A 2E2IJ 3O6BB 4IQ4A 3TDZC 3HRUA 3OSGA 1LNWA 3K4BA 4I98B 1PDNC 4F55A 2K9NA 1TTYA 4IOCF 2IJLA 1ACIA 5J6XA 4L0ZB 3KEOA 2LKSA 2VJ4A 3BC8A 3NAUA 1F4KA 2H1LA 2ZJRF 3C2GA 1WRJA 2HPIA 2Q8KA 1YE9A 2CQKA 1Z91A 2H8WA 3ULQB 2VQGA 2Q2EA 4ZDLA 4BJTA 2PG4A 3Q9SA 3LFKA 3PFIA 2O03A 2IA2A 2IA1A 1VQLI 2R7FA 3M7GA 4DYRA 4KDPA 2YX4A 3N4MA 1U5TB 2DA2A 3GLXA 4D7MA 4XNFA 4HA8A 5EF6A 5D8LB 2PEXA 5CPRB 2PLYA 3BPXA 3TDUC 3A4CA 3WGHA 4U0YA 3IH4A 1J59A 2IT0A 3CC2I 4AM3A 1KU2A 3S17J 1NK2P 4D1QA 3I0TA 3HOSA 1I1GA 3WE3A 1JXSA 4FASD 2RC4A 5BQTA 4A5MA 1I3AA 1TT5B 4AWXB 2P7CB 4K2EA 1LB2A 2VQCA 1FC3A 2JMWA 2KFDA 2HYJA 2LFBA 2JRTA 4B4CA 3GFJA 5HS9A 4BL0B 2HOAA 3RJPA 5LHGA 3KZYA 3CO7C 2WY8Q 5JLXA 3F8NA 3EUAA 4BXFA 4CICA 3LNQA 2MH2A 4DNCA 3HOYJ 3GCMA 3H92A 3O8GA 3D5SC 2AXTC 4G7OF 4A3FJ 3K70D 2E2JJ 2PMUA 4M6VA 3COAC 1FOKA 2X1DA 1Y6IA 2BEOA 3IKTA 2TRTA 4IO9F 1ZN2A 2O5RA 3HDDA 3DPLC 1O7FA 3Q9VA 1AHDP 1FSEA 2ZNZA 1FMWA 3SZPA 2UV1A 1O3RA 4OIPF 1ON1A 4E7KA 3BG3A 1C0WA 1W7PD 4JX4A 5EG0B 3ROUA 4C2UA 3CMAI 1WJCA 2J5PA 3PO3J 2IXSA 1AOYA 1X3UA 2F5DA 2EZLA 2CQNA 1O4XA 2FNAA 4U87A 1VTNC 3QRFF 1SD5A 3FZVA 4UB6C 5EJCA 2DLLA 3R6SA 1D3YA 4YIFA 3I71A 3F9KA 4LLNA 2MH9A 3MAJA 2JK3A 5LHHA 4EJWA 2KZVA 5J40A 5KCMA 2X6OA 3SXYA 4PJNA 3L1PA 4L9VA 5IY5H 1VQNI 2DA3A 2HKOA 3SDBA 1DPUA 5IYCJ 2LY1A 5C4JJ 3JRAA 3OYEA 3M4OJ 4RS8A 3CP8A 1MJBA 4M6XA 3LQQA 4EM1A 5IYBJ 1WJFA 1IN4A 1PJRA 3NWSA 2L3DA 1ZLJA 3GTOJ 1D5VA 3PSIA 3W6KB 1JKRC 3SZGA 3MMYB 1IAWA 4N0BA 3GZNB 3H9QA 4RLFA 5DV5A 2CRGA 1QQIA 3ZP5A 3K4JA 3I55I 2UXNA 2NNYA 3FMQA 1ETYA 4IL6C 2EILH 1SAXA 4YIIA 4V2GA 4RMNA 1GVJA 2NVUB 2DMUA 3L00A 5C44J 3GWZA 1D8KA 1GXQA 1T0FC 4IRGA 2R93J 5CVRA 3JAMZ 4AIKA 4G6TB 1JKQC 4WXHA 4A93J 5F08A 1BM9A 2M34A 2M9HA 1MGTA 5EZHA 2WC2A 3H9JA 2VUMJ 1P4WA 1RNLA 3U21A 2EV6A 4IRIA 1PUEE 1HXDA 1MBJA 1S8NA 2DQRA 2XAHA 4DQ2A 3JRBA 2ADUA 5ILUA 1XN7A 1LUJB 3FXUA 1D0XA 1X58A 5D6FA 1MMAA 4PSXA 2G7UA 4MNUA 1IXCA 1IN7A 1RI7A 3KP3A 3NARA 2A5WA 4MQ9F 3QU6A 5E1WA 4H0EA 1MH4A 1JJ6C 1MBKA 1G3SA 4GXOA 3LSTA 4TV7A 3DPTA 3LOCA 3OYIA 3G73A 3QP6A 4IHTA 2F5FA 1GHCA 4MTDA 4A0ZA 4KIBA 3A01A 3HC7A 4HLXA 3VYUB 5K7HA 2KLOA 1PP8F 3WHCA 3L7WA 3BR3A 4HOBA 1X19A 3LSKA 2ZJQF 5GADJ 2VOOA 2CQ7A 2E60A 2F5EA 3DU5A 2W1OA 3HSEA 4XRFA 1U8BA 1MZBA 1K4SA 1O3QA 3BR2A 4XN0A 2EK5A 2OAZA 4M3GA 3IWZA 1TWFJ 1AKHA 3GLLA 5F04A 1FTZA 3TO7A 3RSNA 1XC5A 1U6GA 1Z05A 4O5VA 4KISA 2W84A 5M3FJ 2KIUA 2ZCWA 4NC7A 4J19A 1BC7C 3BQZA 4M3DA 1DQUA 4G12A 5LGUA 2E36A 5CJ9A 1PUFA 2BVMA 1B1BA 5DD4A 3TO6A 1YFHA 2GOXB 4E6KG 5F0CA 1KONA 1OR7C 4DZJA 4EMSA 4PZJA 5DYMA 4HNUA 1U9OA 3EDPA 4OIQF 4RGRA 2HOEA 4L18B 4M9XA 1GVDA 4D7NA 4LB6B 3WU0A 2HTJA 1IW7F 2YSRA 5L3EA 5EYRA 4ABZA 5IP7J 4PCQA 4U7DA 3WG9A 5E1XA 3WODF 1G4DA 4Q4ZF 4A3MJ 2VN2A 3GTQJ 3JTHA 1LFBA 4GCVA 1BI3A 3DTKA 5FKMA 5FLMJ 2HQ5A 1J09A 4V19K 2EZKA 2Y0MA 2GA2A 2VBWA 1NK3P 3KE2A 2CFOA 2D5VA 3RKXA 2VKHA 2FBHA 3BJ6A 3FXKA 5GP9A 4R79A 1TNTA 5KHDA 2IA0A 2MABA 1KQ8A 2OUMA 2IGNA 3WTZA 1VNDA 4XN3A 3K2ZA 2DYRH 3KP7A 2KDZA 4G9YA 2DFHA 4L9JA 4LG0B 1G3YA 4A6EA 2CO5A 1ZG1A 4OMZA 3LQRA 2K40A 2X1EA 3FMSA 1W36C 3QU3A 1MJAA 2WAEA 1XMAA 3KPHA 3R60A 4XLNF 1K83J 1JTXA 5BOXA 4ANJA 1YO5C 4BXUA 4UVCA 2YX7A 2GXAA 2NYXA 4IKFA 4OMYA 3V8LA 2OZUA 3PSFA 5JR3A 3SZTA 3QWLA 2MBFA 1MDMB 3L09A 1BW5A 2CYYA 4ZDOA 2QGUA 4GGGA 1RRJA 3CUQC 3H3ZA 3IH2A 3WHBA 1VFCA 2XB5A 5D6EA 3WGIA 4C3IJ 3PIPF 2EIMH 3S14J 1LJ9A 1UAAA 1Q1VA 4KJZA 3GTPJ 1TLHB 1V54H 1I6XA 5DCMA 1R71A 4AIHA 2R7TA 4P5OA 2JWTA 4CGZA 3ZN0A 3KP6A 2VC0A 2K7LA 1FIAA 3MVPA 2J5OA 1MKMA 2UWMA 4Y33A 2ME6A 1S7AA 2LVSA 4UUTA 2M0MA 1XDSA 3WTSC 5LFAA 2VQHA 4A3BJ 3ABTA 4FTHA 2JA7J 2R7ZJ 4A3IJ 2F48A 2P6SA 2P4WA 2WTEA 3L9FA 1W5TA 3FK6A 1XCBA 1KU9A 2XSDC 2Y69H 2DA5A 4CYCA 4G8XA 4CCMA 4WK8F 3DFGA 2XF5A 4XQFA 2W7NA 1P6RA 2V1XA 3C1DA 4MFDA 1Z0XA 3DEWA 3GW2A 3M8JA 2LR8A 1BOBA 1HSTA 3QAHA 2IAIA 2H6CA 3TP3A 3J7ZI 2IW5A 2M8EA 1T95A 4M74A 1S6LA 5J1YA 1LQ1A 1S3JA 4D9JA 2QVOA 1FMVA 3W2WA 1J7KA 1SAUA 1UG2A 3J81Z 1ONVA 4E70A 4I6ZA 4BYYA 2L4MA 4CUGA 4F93B 2XGXA 2EFWA 2JSCA 2XRNA 1G59A 1MNEA 4PUSA 4S0HB 4P9UA 3RPUD 1HKTA 2OPTA 2PJRB 4KYWA 1VQMI 3BTIA 3PNTA 2NOGA 3RQ4A 3TW6A 1A5JA 1IO2A 2HEOA 5CVJA 4L5EA 2VT2A 4BBRJ 1Z67A 3BOQA 2NVXJ 1VQ8I 1TQIA 2ZB9A 4LIVA 5F1RA 2R7UA 2W82A 1U3EM 2QBYA 3GYHX 1ZKGA 2DO7A 2EFPA 5J4YA 4HLYA 2RNGA 1E0EA 1XSDA 1V5GA 3BY6A 4BDZA 2XB0X 2HZDA 2GLOA 1JI8A 2MLKA 1Z1DA 1X1DA 5HLGA 1FLIA 3TGNA 1ZTRA 2V9PA 4AU7A 1ZRDA 4NC8A 4Y17A 1WHUA 2Q1ZB 4XOPA 2XDVA 2GXGA 2R7SA 1MW7A 2KPMA 5FKNA 3GTGJ 2H94A 1QZEA 4HSRA 3TBIA 3RIRA 4F91B 1QVTA 1A6IA 3PM1A 2UZKA 1JUMA 3ABMH 3OR1C 4MEXF 4LIUA 1IC8A 4C2MJ 1YS7A 2GOMA 1IDYA 1MNDA 4GDFA 1M1EB 1UMQA 2I10A 1V3FA 2HNHA 2K9MA 1RR8C 1XGSA 4U0WA 1FPQA 4CZCA 3IH3A 3K7AJ 4CYDA 5KNLA 2MA3A 2VPRA 1WH5A 4C3JJ 2H8RA 2TDXA 4CCKA 1G3WA 3RPUA 2Z3YA 4ZYHA 4CZZA 2M2EA 4JOMA 4S05A 2ELJA 4HNVA 1WZ2A 1DP3A 2O61A 2BY2A 1OCCH 1D5YA 2FF4A 2ZMEA 2FMLA 2V6CA 4U88A 2R5YB 4CSWA 3K1PA 5D8KB 2VODA 3E6CC 1ETWA 2BV6A 1UELB 1U78A 4E7IA 5J1UA 1EF4A 5LD2C 5ED4A 3BJAA 3HJEA 4QWQA 4BJ6C 1HF0A 2HQAA 3HOXJ 3WTUC 3PO2J 3VWBA 5HNHA 4EJOA 4D5CA 5KK1A 1DUXC 4QPOA 3LAJA 4LG3A 5B66C 4HV6A 3BR6A 3KCCA 2P81A 2JVHA 2KIFA 4YEJA 2G9WA 3HHGA 4RAYA 2R7RA 3L2QA 2A07F 5IOYA 1TC3C 1HOMA 2FUG2 3MKYB 4ZYGA 2EBIA 2NVYJ 3BR0A 3CJTB 4H4KC 4O3MA 1RUOA 2W25A 1R58A 5FLVA 3DTEA 5D4RA 3ASOH 1JT0A 1IV6A 5C4XJ 1QZYA 2WAQN 2B0LA 3CLQA 2HXIA 4LOCA 1RUNA 1R1TA 3HGGA 4E7LA 2D2WA 2C6YA 1P4XA 2JN6A 4ON0A 3LSGA 3WGGA 1YW8A 4A3KJ 4MTEA 3Q0VA 3NRVA 2FBKA 3F21A 2P5LC 4XMYA 2DODA 2ZXWH 2MFZA 3LA2A 1VQ5I 4Y15A 1GLNA 4II2A 3TQNA 5IT3A 2KKOA 2P7VB 2XGEA 1LPQA 3CD6I 1KU7A 4B48A 1FEXA 3KFWX 1XSXA 4HDUA 1ZYRF 2PJPA 3FWEA 3JREA 3HSFA 1ZLKA 1RKWA 1RKTA 2PI0A 2IGKA 2ACJA 3V7RA 4BH9A 3C18A 1VQPI 3CMMA 1QRYA 1DU0A 3HKZA 3ML6A 3ABUA 1SEUA 2V26A 3HRTA 1T8IA 1K6OA 2XPWA 2PMZA 1IRXA 1WJEA 1JT6A 2VBYA 3H5AA 2FNPA 2R7OA 3GX4X 1ZGJA 4FQGA 2M3AA 3K4CA 1T0FA 5F6FA 4E7SA 2HVRA 3F3XA 4R1HA 4WXDA 2R5ZB 2B9SA 2Y0SA 1WH7A 1B8IB 2XGDA 3PNVA 1FYLA 3MEXA 2XV4S 2ZBKA 1QZZA 2V1UA 4L9NA 2VASA 5H2FC 5FLXZ 1JGSA 2P6TA 3L2CA 3P5JA 2HYFA 1SVLA 3S15J 3QYBA 3CUOA 3SJMA 3GFIA 4J00A 4C2TA 3TOAA 1OJLA 4BE1A 5EEHA 3WTYC 1FBSA 2M30A 1SVOA 3HIFA 3MN2A 2KQRA 3BZKA 4HX7A 1W7PB 3ZGKA 2NRAC 2OA4A 3H36A 3OYGA 2K9QA 5E8GA 3V8JA 3LSRA 2EIJH 2RREA 1MBHA 2XGCA 3DU6A 1RESA 4XONA 3CTAA 1D0YA 2F4IA 2O3FA 4XRSG 2PN6A 4MLOA 3RYRA 1V5EA 2JUCA 3K2AA 2LBFB 1A04A 1W5SA 3VYRB 1SD7A 2AS5F 1UB9A 1O3SA 4EGYA 2DFIA 5DM6F 1R4MB 3K6GA 3GO5A 5KAIC 4LK1F 2EZIA 2HDWA 4I2OA 3KP2A 3OYBA 3ASNH 1R7JA 3PQKA 1GXPA 3ESWB 1ORKA 2Z16A 4XLFA 4BGDA 5L3CA 3FXQA 2STWA 2CMPA 2F5CA 4BY7J 3ISPA 4EEFG 4BXXJ 2FU4A 3K4NA 4NQWA 1XDUA 2OU2A 2QYOA 1WVRA 3SDGA 1F1ZA 2HGCA 3LSJA 1A36A 2QENA 2I5UA 3QYEA 4BEHB 1NTCA 3I4MJ 5LGNA 4DW6A 5A2QK 4XKVA 1PP7U 3CCMI 5E79C 4X0GA 2K4BA 1J75A 2O6GE 4ENMA 1IRGA 1N25A 1D1BA 3IWFA 4AYBA 1HDDC 4BE0A 5IT9Z 2NNNA 1YJWI 1RC9A 1XG1A 1FNNA 2BW3B 2ZJ2A 1B4AA 5AIPA 3JRFA 1K61A 2JJ7A 4PGHA 2KL4A 1ZR4A 2VLAA 2XAQA 1BC8C 1T6SA 4DZPA 4KN7X 5HDKA 1DPRA 2LTPA 3K9TA 4LB5A 3ONQA 4CCOA 3AKZA 1LDDA 3SHFA 1EA3A 3KZZA 5HODA 1CGPA 2BGCA 1D0ZA 2AHQA 4OINF 1YTYA
chains in the Genus database with same CATH topology
5F64A 3O2PE 1K78B 1FYKA 2HWVA 4IVNA 5E20A 4RB0A 3CLOA 4AIJA 5LBQA 1BI0A 1V4RA 5K1YA 4Y13A 5E18F 2MLGA 2FBIA 1CF7A 5FD5A 3ZQ7A 3F8FA 5LRSA 1JHFA 4ETSA 3R0AA 5D5XB 1MJ9A 4EV0A 5E17F 3P7NA 1ZG5A 4EQQA 2LKPA 1QO0D 5L3GA 1YW7A 2GA1A 3I54A 3HRMA 4UVBA 2Z33A 3VB2A 5DCFA 1T39A 1J2XA 4ESJA 2EA4A 3CJNA 2EFOA 3CUQA 3E5QA 5FGMA 1I1SA 4JK1X 3NQOA 4BQAA 4ESFA 4KIFA 4LD5A 4LFUA 3VODA 2WWYA 1WKMA 4WCGA 2W85A 2L02A 4MHGA 3I58A 1XGNA 3IRQA 4HF2A 3DXJF 4HAMA 1ODDA 4B09A 3KEQA 1KGSA 2FEZA 2OZ6A 1FBQA 1ZAOA 5DUIA 4EJTA 4I0AA 5FLXK 1KA8A 2ESHA 1U5TA 3FF5A 4ENNA 5ICGA 3F6VA 1HKQA 3WTVC 1FYMA 5HOOA 3FM5A 4BHPA 2Y75A 4ZH4F 5BPIA 4HX4A 5K5RA 1BOAA 3V7CA 2V1DA 3V4GA 2HR3A 2HQRA 3IKVA 4WXCA 3K69A 3N97A 2XKPA 3M8EA 4A2UA 2BYVE 2H6BA 5L3DA 4HQMA 4KFCA 1YQAA 5L3BA 3JSOA 2PMHA 2VE9A 5KVRA 3U1DA 3CO6C 2DK8A 2ISZA 4RGUA 5E1ZB 3MWMA 2OBPA 1H9TA 3WE2A 3T5XA 2ETHA 3BWGA 4M71A 4OU0A 3MCZA 1T2KA 2FE3A 2RVCA 4M72A 4ZZDA 3AAFA 4BHCA 1IN8A 3GVAA 1EV7A 1FX7A 2M5WA 2XASA 1QBJA 5CVVA 4G7ZF 1HW5A 1R5HA 2P5VA 4M9SA 3I64A 1IRFA 3E5XA 4BNCA 2YR2A 4XLPF 1KQ9A 1R23A 3F23A 3H3UA 5AONA 2GXBA 1ULYA 1OPCA 3GFMA 4ZYEA 2K27A 2O8XA 3RYPA 3GF2A 3EYIA 4XSXF 3FMRA 4RGSA 3KLOA 3ZMZA 4Q48A 3I59B 2EFQA 2DBBA 3EQLF 1LEAA 3KLNA 5L3FA 2IP2A 2CSOA 4ESBA 1BIAA 4HX8A 2KRFA 1FSHA 2FA5A 3JAMK 4OIRF 1YG2A 3HTUA 4LLGF 4BAYA 2DT5A 2FSWA 1SD6A 2HZTA 4UHTA 2XKOA 3BJOA 4YFXF 5J8CA 1DP7P 3P9KA 1IXRC 1EH6A 2P5KA 2HTSA 3T8TA 1H0MA 3V7SA 4RB1A 3ZMTA 2DAOA 2ZKZA 2RGVA 5ICEA 2RDPA 3GFLA 1SFXA 3MFKA 1QGPA 1HKSA 3HRSA 2A6EF 3QPHA 5K5OA 2QWWA 4A12A 1ZARA 2QQ9A 2FMYA 2Q0OA 3RKWA 1Z7UA 4QLCU 3B02A 1E17A 1OKRA 4ZZLA 4FX4A 2GIVA 2K02A 4UNOA 1D8JA 2ISYA 3F8CA 4P9FA 5BPDA 6PAXA 3LA3A 3V8KA 3D0SA 5JI6A 1SFEA 4HBLA 2FOKA 3K1MA 3WTXC 4S04A 3ELKA 3OOPA 3WTWC 1O57A 4IPAA 2K86A 3BP8A 4BHBA 5LEJA 2A68F 1XMKA 1OYWA 3G3ZA 3J7AO 1WWXA 5D5VB 4LG0A 2E7XA 5ICFA 1HQCA 2LSOA 5E8IA 3ZMVA 3J80Z 2L4AA 1Z9CA 2ELHA 3TO9A 5J8FA 3ECHA 1MDMA 1E2XA 3EETA 2XVCA 2GQQA 4G6QA 1STZA 2XIGA 1KQ0A 2L54A 1UCRA 4UUVA 2MC3A 1YIOA 4D0PA 2LNBA 4LJZF 2IPQX 1RZ4A 4ASNA 2OQGA 2M1BA 2EJRA 1TQMA 2RV8A 3GUDA 1Y0UA 1XD7A 5CLSA 4RAZA 1CF7B 2HFHA 4KIGA 3ZMDA 2HKXA 3VOEA 3REOA 5JFRA 4CO8A 1YW9A 3F22A 1H9GA 2E1NA 2FXAA 4M73A 3FHZA 1IN6A 2KJCA 1R1VA 3KP4A 2COMA 3DF8A 4FT8A 2FQ3A 2BBYA 4N9HA 4I0BA 2R3SA 3J81K 5HLHA 1BI1A 3RPQA 2CWEA 2QQAA 4CHUA 4Q5SF 2JT1A 1ZRCA 1YLFA 2CFXA 1USSA 1O3TA 3HOTA 1U2WA 2GZWA 2RKHA 1K79A 2XAFA 2MD5A 3LWFA 2QUFA 1R1UA 1USTA 1REPC 3R4KA 5DUKA 2A3SA 3EYYA 1F5TA 3RDIA 1XSVA 1Q1HA 2O0YA 3GZ6A 5HLIA 3E97A 2EV0A 2LF7A 4L9TA 2XAJA 5DEQA 2YPRA 3C7JA 1Z6RA 4IHSA 2Z9OA 2GAUA 2RN7A 1WQ2A 2P8TA 4I02A 1OR7A 4KA4A 4YG2F 2UXXA 5HVQC 4RB3C 2L01A 3IRRA 5DD8A 1HW2A 2ZO4A 1ZREA 1SFUA 4EGZA 1FBUA 1ZH5A 5JHUA 2QLZA 3Q5FA 3I53A 1HBXG 3J80K 3O3KA 2STTA 1TNSA 4ZYDA 2AXLA 1R36A 2DK5A 3K0LA 3RKYA 3TOBA 3VEPA 5TJJA 2V79A 2VBXA 5D4SA 1FP1D 1EH8A 3LA7A 3I4PA 1BN5A 4HW0A 3ECOA 1B6AA 2H27A 3JTGA 2HYGD 1O7LA 5BS6A 4HF1A 1I27A 4A0XA 4L5IA 3SFZA 1BIBA 4ENKA 2ZNYA 1TQPA 3FX3A 4LK0F 4OOIA 2X0LA 2DQLA 3MZHA 4JBAA 2KIMA 5JVTA 1XCVA 1ZGAA 3I5UA 1P4AA 2IVMA 1LDJA 4I01A 5DCMB 2V9VA 1FWZA 1W7PA 1XB4A 1B59A 2VONA 1L3LA 1U8RA 4WWCA 2D1VA 5LEKA 5D5WB 5HDNA 2EV5A 2M87A 2FRHA 4A0YA 2EB7A 3RI4A 1P2FA 3ERED 2PFBA 3DV8A 4EJVA 3BZ6A 2XHKA 4GYIA 4CDGA 1AWCA 1B9MA 3W6JB 4G7HF 4KT5C 3U2RA 4L5JA 3M9AA 1BJAA 2QM3A 3P9IA 2LF8A 2JPBA 1Z6TA 4FHTA 1KYWA 4JQFA 4PDKA 4AD9A 5D5UB 1IZ1A 3IC7A 5BMZA 1J9IA 2G7HA 3HHHA 4A6DA 1SMTA 5FO5A 3QOPA 3P9CA 5LHIA 1IUYA 3R61A 2HQNA 2EFNA 1K78A 2QBYB 5IT9K 5HS8A 2NAZA 1QNTA 4ENJA 3MZYA 3GZ5A 5TRDA 3DP7A 5LRRA 3D5LA 5FFXA 4YFKF 1R5GA 5H20A 2GWRA 2CG4A 4A5NA 3JW4A 1ZHFA 3HYIA 2HS5A 1TW3A 3HSRA 2M45A 1ON2A 1T98A 2ZFWA 4HF0A 2Z99A 4PGGA 4XSZF 4G6DA 1ZG3A 3SQNA 2HDCA 2VE8A 2JZYA 4I09A 4UV8A 4U0VA 3ZMSA 3JSPA 2DTRA 1OYYA 4B8XA 3E6DA 4IF4A 4AVPA 2XUBA 1KYZA 4KUMA 4NHJA 3E6MA 2ZMEB 4I7HA 1UHMA 2RQPA 4MGRA 4EM0B 2XAGA 2PBIA 5LGTA 2VC1A 1YS6A 4RGXA 1FY7A 2OQRA 2CGPA 3GXOA 1LDKB 1MD0A 4EVIA 2F2EA 5FB2A 1WI9A 5ILSA 3ZN1A 4R8HA 1IF1A 2XROA 1TW2A 1G3TA 4EJUA 2PQ8A 5HDGA 3B73A 1FP2A 2IRFG 3E6BA 3RTRA 2E7WA 4LLLA 3IL2A 3CDHA 5AIQA 1FZPB 4GO1A 1J5YA 1S29A 3R0JA 1JE8A 1WSUA 3GEZA 4HZFA 4GYGA 3TKYA 2VBZA 5CYVA 5CVUA 4Q47A 3HTSB 5FFZA 2NS0A 3HUGA 3F8MA 3ZMUA 1HSJA 3M8FA 4G94A 2DPDA 4LMYA 1QPMA 1U5TC 4IJAA 4MQVA 3BDDA 1OMIA 1XGOA 2R7DA 4HQEA 1LVAA 1S7OA 1K7AA 1DDNA 2Y48A 3F72A 4HV5A 4WF2A 1IN5A 2DW4A 3FM3A 2JTVA 3E3VA 3QPTA 1TBXA 4EM2A 1OYIA 4YFNF 4IRHA 1BI2A 2KJBA 1J0RA 2OD5A 5H6QA 3ZPLA 4NB5A 1IXSB 2BE5F 3KETA 3DKWA 2EWNA 1L0OC 3QP5A 4OIOF 1R00A 1JHHA 4U7BA 3OV8A 1HW1A 1YYVA 3T8RA 5A2QZ 3K1NA 1KU3A 2CW0F 2YU3A 2X4HA 3C3WA 4RB2C 2WV0A 4HYEA 3WTTC 4KN4X 4KMFA 1ZRFA 4MEYF 1FT9A 1RIOH 2A69F 3F8BA 4CXFA 4P55A 3IHUA 4LGWA 5HS7A 1EH7A 2ZXJA 3S2WA 2D1HA 4WX9A 1I5ZA 1SMYF 4KNYA 2W24A 3E5UA 5CVIA 2LDUA 3DQVC 2VOPA 3VFZA 2D45A 3BROA 1SD4A 1F9NA 2ESNA 3I59A 1G6NA 1UHWA 4M6YA 5K5QA 1XGMA 4Z2YA 4UXNA 5LLQA 3BPVA 3U9GA 2DI3A 4XBFA 5FD6A 1NHAA 5ILVA 2Z5UA 2EA2A 2A6HF 5ICCA 4L0YB 1R22A 2A61A 2QQBA 3WU1B 4P96A 4KMUX 4UVAA 5EEGA 2H09A 3KP5A 2VT3A 3PQJA 3EUHA 5H6RA 4KICA 1P92A 1B9NA 3F6OA 2A5YB 2E1CA 3DEUA 3T0YA 4O6JA 3MQ0A 1UFMA 2W57A 2RNJA 1T38A 3T1BA 2DU9A 2DPUA 2QZ8A 1W4MA 4M9ZA 4F7ZA 4UV9A 4N9IA 2K4JA 4IXAA 4HDVA 3NEUA 3CUQB 3FXRA 5DDGA 1BBYA 3LAPA 5ERIA 4FX0A 2JPCA 3M1EA 1LEBA 2VXZA 3O6BB 3TDZC 3HRUA 1LNWA 4I98B 1PDNC 1TTYA 2IJLA 5J6XA 4L0ZB 3KEOA 1F4KA 1WRJA 2Q8KA 2CQKA 1Z91A 3ULQB 2Q2EA 2PG4A 3Q9SA 3LFKA 3PFIA 2O03A 2IA2A 2IA1A 2R7FA 3M7GA 4KDPA 2YX4A 3N4MA 1U5TB 3GLXA 4HA8A 5D8LB 2PEXA 2PLYA 3BPXA 3TDUC 3WGHA 4U0YA 1J59A 2IT0A 1KU2A 3HOSA 3I0TA 1I1GA 3WE3A 1JXSA 2RC4A 5BQTA 4A5MA 4AWXB 2P7CB 4K2EA 1LB2A 1FC3A 2JRTA 3GFJA 5HS9A 5LHGA 3RJPA 3CO7C 3KZYA 3F8NA 4CICA 2MH2A 4DNCA 3H92A 4G7OF 2PMUA 3COAC 1FOKA 2BEOA 3IKTA 1ZN2A 3DPLC 1O7FA 3Q9VA 1FSEA 2ZNZA 3SZPA 1O3RA 4OIPF 1ON1A 1C0WA 1W7PD 3ROUA 2J5PA 1AOYA 1X3UA 2F5DA 2FNAA 1VTNC 3QRFF 1SD5A 3FZVA 2DLLA 3R6SA 1D3YA 4YIFA 3I71A 4LLNA 2MH9A 3MAJA 5LHHA 4EJWA 3SXYA 4L9VA 2HKOA 1DPUA 4RS8A 1MJBA 4M6XA 3LQQA 4EM1A 1IN4A 2L3DA 1ZLJA 1D5VA 3W6KB 1IAWA 4N0BA 5DV5A 1QQIA 3ZP5A 2UXNA 2NNYA 3FMQA 1SAXA 4YIIA 1GVJA 3L00A 3GWZA 1D8KA 1GXQA 4IRGA 5CVRA 3JAMZ 4AIKA 4WXHA 1BM9A 1MGTA 2WC2A 1P4WA 1RNLA 2EV6A 4IRIA 1PUEE 1HXDA 1S8NA 2DQRA 2XAHA 4DQ2A 2ADUA 5ILUA 1XN7A 3FXUA 5D6FA 2G7UA 4MNUA 1IXCA 1IN7A 1RI7A 3KP3A 4MQ9F 4H0EA 3QU6A 5E1WA 4GXOA 1G3SA 3LSTA 4TV7A 3DPTA 3G73A 4IHTA 3QP6A 1GHCA 2F5FA 4MTDA 4A0ZA 4KIBA 4HLXA 1PP8F 3L7WA 4HOBA 2VOOA 2F5EA 3HSEA 4XRFA 1MZBA 1O3QA 2EK5A 2OAZA 3IWZA 3TO7A 1U6GA 1Z05A 4O5VA 2W84A 2KIUA 2ZCWA 1BC7C 5LGUA 5CJ9A 3TO6A 1B1BA 5DD4A 1YFHA 4EMSA 4PZJA 5DYMA 3EDPA 4OIQF 4RGRA 2HOEA 4L18B 4M9XA 4LB6B 3WU0A 2HTJA 1IW7F 2YSRA 5L3EA 4PCQA 4U7DA 3WG9A 5E1XA 3WODF 1G4DA 4Q4ZF 2VN2A 3JTHA 4GCVA 1BI3A 2Y0MA 2GA2A 2VBWA 3KE2A 3RKXA 2FBHA 3BJ6A 4R79A 1TNTA 2IA0A 1KQ8A 3WTZA 3K2ZA 3KP7A 4G9YA 4L9JA 4LG0B 1G3YA 4A6EA 2CO5A 1ZG1A 4OMZA 3LQRA 3FMSA 3QU3A 1MJAA 1XMAA 3R60A 4XLNF 5BOXA 1YO5C 4BXUA 4UVCA 2YX7A 2NYXA 4OMYA 3V8LA 2OZUA 5JR3A 3SZTA 2MBFA 1MDMB 3L09A 2CYYA 4GGGA 3CUQC 3H3ZA 5D6EA 3WGIA 1LJ9A 1TLHB 1I6XA 5DCMA 4AIHA 4P5OA 4CGZA 3ZN0A 3KP6A 2VC0A 2K7LA 2J5OA 1MKMA 2UWMA 1S7AA 1XDSA 3WTSC 3ABTA 2P6SA 2P4WA 2WTEA 3L9FA 1W5TA 1XCBA 1KU9A 4G8XA 4WK8F 3DFGA 1P6RA 2V1XA 3C1DA 3GW2A 1HSTA 3QAHA 2H6CA 2IW5A 2M8EA 4M74A 1S6LA 1LQ1A 1S3JA 2QVOA 1J7KA 3J81Z 1ONVA 4E70A 4BYYA 2L4MA 2XGXA 2EFWA 2JSCA 2XRNA 4P9UA 1HKTA 4KYWA 2HEOA 5CVJA 2VT2A 3BOQA 1TQIA 5F1RA 1U3EM 2QBYA 3GYHX 2DO7A 2EFPA 4HLYA 1XSDA 3BY6A 2MLKA 1Z1DA 5HLGA 1FLIA 3TGNA 1ZRDA 4Y17A 2GXGA 2H94A 3RIRA 2UZKA 4MEXF 1YS7A 1V3FA 1XGSA 4U0WA 1FPQA 4CYDA 2MA3A 2TDXA 1G3WA 3RPUA 2Z3YA 4ZYHA 4CZZA 4S05A 2O61A 2FF4A 2ZMEA 2FMLA 2V6CA 4U88A 3K1PA 5D8KB 2VODA 3E6CC 2BV6A 1U78A 5ED4A 3BJAA 4QWQA 3WTUC 4EJOA 5KK1A 1DUXC 3LAJA 4HV6A 3KCCA 2KIFA 2G9WA 3HHGA 4RAYA 2A07F 4ZYGA 4O3MA 1RUOA 2W25A 1R58A 5D4RA 1QZYA 2B0LA 1RUNA 1R1TA 2D2WA 2C6YA 1P4XA 4ON0A 3WGGA 1YW8A 4MTEA 3NRVA 2FBKA 3F21A 2P5LC 3LA2A 4Y15A 3TQNA 5IT3A 2KKOA 2P7VB 1KU7A 3KFWX 1XSXA 4HDUA 1ZYRF 2PJPA 3FWEA 3HSFA 1ZLKA 2PI0A 2ACJA 3V7RA 4BH9A 3C18A 3ML6A 3ABUA 3HRTA 1K6OA 2VBYA 2FNPA 3GX4X 1ZGJA 1T0FA 5F6FA 3F3XA 4R1HA 4WXDA 1FYLA 3MEXA 2XV4S 2ZBKA 1QZZA 2V1UA 4L9NA 5FLXZ 1JGSA 2P6TA 3L2CA 2HYFA 3CUOA 3GFIA 3TOAA 5EEHA 3WTYC 1FBSA 2M30A 3HIFA 4HX7A 1W7PB 2NRAC 2OA4A 5E8GA 3V8JA 3CTAA 2O3FA 2PN6A 3RYRA 1A04A 1W5SA 1SD7A 2AS5F 1UB9A 1O3SA 4EGYA 2DFIA 3GO5A 4LK1F 4I2OA 3KP2A 1R7JA 3PQKA 1GXPA 2STWA 5L3CA 3FXQA 2F5CA 3ISPA 2FU4A 4NQWA 1XDUA 2OU2A 2QYOA 1F1ZA 2HGCA 2QENA 5LGNA 5A2QK 1PP7U 2K4BA 1J75A 2O6GE 4ENMA 1IRGA 3IWFA 5IT9Z 2NNNA 2ZJ2A 1FNNA 1B4AA 5AIPA 4PGHA 2XAQA 1BC8C 1T6SA 4KN7X 5HDKA 1DPRA 3K9TA 4LB5A 1LDDA 3SHFA 3KZZA 1CGPA 2BGCA 4OINF 1YTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F64 A;  3O2P E;  1K78 B;  1FYK A;  2HWV A;  4IVN A;  5E20 A;  4RB0 A;  3CLO A;  4AIJ A;  5LBQ A;  1BI0 A;  1V4R A;  5K1Y A;  4Y13 A;  5E18 F;  2MLG A;  2FBI A;  1CF7 A;  5FD5 A;  3ZQ7 A;  3F8F A;  5LRS A;  1JHF A;  4ETS A;  3R0A A;  5D5X B;  1MJ9 A;  4EV0 A;  5E17 F;  3P7N A;  1ZG5 A;  4EQQ A;  2LKP A;  1QO0 D;  5L3G A;  1YW7 A;  2GA1 A;  3I54 A;  3HRM A;  4UVB A;  2Z33 A;  3VB2 A;  5DCF A;  1T39 A;  1J2X A;  4ESJ A;  2EA4 A;  3CJN A;  2EFO A;  3CUQ A;  3E5Q A;  5FGM A;  1I1S A;  4JK1 X;  3NQO A;  4BQA A;  4ESF A;  4KIF A;  4LD5 A;  4LFU A;  3VOD A;  2WWY A;  1WKM A;  4WCG A;  2W85 A;  2L02 A;  4MHG A;  3I58 A;  1XGN A;  3IRQ A;  4HF2 A;  3DXJ F;  4HAM A;  1ODD A;  4B09 A;  3KEQ A;  1KGS A;  2FEZ A;  2OZ6 A;  1FBQ A;  1ZAO A;  5DUI A;  4EJT A;  4I0A A;  5FLX K;  1KA8 A;  2ESH A;  1U5T A;  3FF5 A;  4ENN A;  5ICG A;  3F6V A;  1HKQ A;  3WTV C;  1FYM A;  5HOO A;  3FM5 A;  4BHP A;  2Y75 A;  4ZH4 F;  5BPI A;  4HX4 A;  5K5R A;  1BOA A;  3V7C A;  2V1D A;  3V4G A;  2HR3 A;  2HQR A;  3IKV A;  4WXC A;  3K69 A;  3N97 A;  2XKP A;  3M8E A;  4A2U A;  2BYV E;  2H6B A;  5L3D A;  4HQM A;  4KFC A;  1YQA A;  5L3B A;  3JSO A;  2PMH A;  2VE9 A;  5KVR A;  3U1D A;  3CO6 C;  2DK8 A;  2ISZ A;  4RGU A;  5E1Z B;  3MWM A;  2OBP A;  1H9T A;  3WE2 A;  3T5X A;  2ETH A;  3BWG A;  4M71 A;  4OU0 A;  3MCZ A;  1T2K A;  2FE3 A;  2RVC A;  4M72 A;  4ZZD A;  3AAF A;  4BHC A;  1IN8 A;  3GVA A;  1EV7 A;  1FX7 A;  2M5W A;  2XAS A;  1QBJ A;  5CVV A;  4G7Z F;  1HW5 A;  1R5H A;  2P5V A;  4M9S A;  3I64 A;  1IRF A;  3E5X A;  4BNC A;  2YR2 A;  4XLP F;  1KQ9 A;  1R23 A;  3F23 A;  3H3U A;  5AON A;  2GXB A;  1ULY A;  1OPC A;  3GFM A;  4ZYE A;  2K27 A;  2O8X A;  3RYP A;  3GF2 A;  3EYI A;  4XSX F;  3FMR A;  4RGS A;  3KLO A;  3ZMZ A;  4Q48 A;  3I59 B;  2EFQ A;  2DBB A;  3EQL F;  1LEA A;  3KLN A;  5L3F A;  2IP2 A;  2CSO A;  4ESB A;  1BIA A;  4HX8 A;  2KRF A;  1FSH A;  2FA5 A;  3JAM K;  4OIR F;  1YG2 A;  3HTU A;  4LLG F;  4BAY A;  2DT5 A;  2FSW A;  1SD6 A;  2HZT A;  4UHT A;  2XKO A;  3BJO A;  4YFX F;  5J8C A;  1DP7 P;  3P9K A;  1IXR C;  1EH6 A;  2P5K A;  2HTS A;  3T8T A;  1H0M A;  3V7S A;  4RB1 A;  3ZMT A;  2DAO A;  2ZKZ A;  2RGV A;  5ICE A;  2RDP A;  3GFL A;  1SFX A;  3MFK A;  1QGP A;  1HKS A;  3HRS A;  2A6E F;  3QPH A;  5K5O A;  2QWW A;  4A12 A;  1ZAR A;  2QQ9 A;  2FMY A;  2Q0O A;  3RKW A;  1Z7U A;  4QLC U;  3B02 A;  1E17 A;  1OKR A;  4ZZL A;  4FX4 A;  2GIV A;  2K02 A;  4UNO A;  1D8J A;  2ISY A;  3F8C A;  4P9F A;  5BPD A;  6PAX A;  3LA3 A;  3V8K A;  3D0S A;  5JI6 A;  1SFE A;  4HBL A;  2FOK A;  3K1M A;  3WTX C;  4S04 A;  3ELK A;  3OOP A;  3WTW C;  1O57 A;  4IPA A;  2K86 A;  3BP8 A;  4BHB A;  5LEJ A;  2A68 F;  1XMK A;  1OYW A;  3G3Z A;  3J7A O;  1WWX A;  5D5V B;  4LG0 A;  2E7X A;  5ICF A;  1HQC A;  2LSO A;  5E8I A;  3ZMV A;  3J80 Z;  2L4A A;  1Z9C A;  2ELH A;  3TO9 A;  5J8F A;  3ECH A;  1MDM A;  1E2X A;  3EET A;  2XVC A;  2GQQ A;  4G6Q A;  1STZ A;  2XIG A;  1KQ0 A;  2L54 A;  1UCR A;  4UUV A;  2MC3 A;  1YIO A;  4D0P A;  2LNB A;  4LJZ F;  2IPQ X;  1RZ4 A;  4ASN A;  2OQG A;  2M1B A;  2EJR A;  1TQM A;  2RV8 A;  3GUD A;  1Y0U A;  1XD7 A;  5CLS A;  4RAZ A;  1CF7 B;  2HFH A;  4KIG A;  3ZMD A;  2HKX A;  3VOE A;  3REO A;  5JFR A;  4CO8 A;  1YW9 A;  3F22 A;  1H9G A;  2E1N A;  2FXA A;  4M73 A;  3FHZ A;  1IN6 A;  2KJC A;  1R1V A;  3KP4 A;  2COM A;  3DF8 A;  4FT8 A;  2FQ3 A;  2BBY A;  4N9H A;  4I0B A;  2R3S A;  3J81 K;  5HLH A;  1BI1 A;  3RPQ A;  2CWE A;  2QQA A;  4CHU A;  4Q5S F;  2JT1 A;  1ZRC A;  1YLF A;  2CFX A;  1USS A;  1O3T A;  3HOT A;  1U2W A;  2GZW A;  2RKH A;  1K79 A;  2XAF A;  2MD5 A;  3LWF A;  2QUF A;  1R1U A;  1UST A;  1REP C;  3R4K A;  5DUK A;  2A3S A;  3EYY A;  1F5T A;  3RDI A;  1XSV A;  1Q1H A;  2O0Y A;  3GZ6 A;  5HLI A;  3E97 A;  2EV0 A;  2LF7 A;  4L9T A;  2XAJ A;  5DEQ A;  2YPR A;  3C7J A;  1Z6R A;  4IHS A;  2Z9O A;  2GAU A;  2RN7 A;  1WQ2 A;  2P8T A;  4I02 A;  1OR7 A;  4KA4 A;  4YG2 F;  2UXX A;  5HVQ C;  4RB3 C;  2L01 A;  3IRR A;  5DD8 A;  1HW2 A;  2ZO4 A;  1ZRE A;  1SFU A;  4EGZ A;  1FBU A;  1ZH5 A;  5JHU A;  2QLZ A;  3Q5F A;  3I53 A;  1HBX G;  3J80 K;  3O3K A;  2STT A;  1TNS A;  4ZYD A;  2AXL A;  1R36 A;  2DK5 A;  3K0L A;  3RKY A;  3TOB A;  3VEP A;  5TJJ A;  2V79 A;  2VBX A;  5D4S A;  1FP1 D;  1EH8 A;  3LA7 A;  3I4P A;  1BN5 A;  4HW0 A;  3ECO A;  1B6A A;  2H27 A;  3JTG A;  2HYG D;  1O7L A;  5BS6 A;  4HF1 A;  1I27 A;  4A0X A;  4L5I A;  3SFZ A;  1BIB A;  4ENK A;  2ZNY A;  1TQP A;  3FX3 A;  4LK0 F;  4OOI A;  2X0L A;  2DQL A;  3MZH A;  4JBA A;  2KIM A;  5JVT A;  1XCV A;  1ZGA A;  3I5U A;  1P4A A;  2IVM A;  1LDJ A;  4I01 A;  5DCM B;  2V9V A;  1FWZ A;  1W7P A;  1XB4 A;  1B59 A;  2VON A;  1L3L A;  1U8R A;  4WWC A;  2D1V A;  5LEK A;  5D5W B;  5HDN A;  2EV5 A;  2M87 A;  2FRH A;  4A0Y A;  2EB7 A;  3RI4 A;  1P2F A;  3ERE D;  2PFB A;  3DV8 A;  4EJV A;  3BZ6 A;  2XHK A;  4GYI A;  4CDG A;  1AWC A;  1B9M A;  3W6J B;  4G7H F;  4KT5 C;  3U2R A;  4L5J A;  3M9A A;  1BJA A;  2QM3 A;  3P9I A;  2LF8 A;  2JPB A;  1Z6T A;  4FHT A;  1KYW A;  4JQF A;  4PDK A;  4AD9 A;  5D5U B;  1IZ1 A;  3IC7 A;  5BMZ A;  1J9I A;  2G7H A;  3HHH A;  4A6D A;  1SMT A;  5FO5 A;  3QOP A;  3P9C A;  5LHI A;  1IUY A;  3R61 A;  2HQN A;  2EFN A;  1K78 A;  2QBY B;  5IT9 K;  5HS8 A;  2NAZ A;  1QNT A;  4ENJ A;  3MZY A;  3GZ5 A;  5TRD A;  3DP7 A;  5LRR A;  3D5L A;  5FFX A;  4YFK F;  1R5G A;  5H20 A;  2GWR A;  2CG4 A;  4A5N A;  3JW4 A;  1ZHF A;  3HYI A;  2HS5 A;  1TW3 A;  3HSR A;  2M45 A;  1ON2 A;  1T98 A;  2ZFW A;  4HF0 A;  2Z99 A;  4PGG A;  4XSZ F;  4G6D A;  1ZG3 A;  3SQN A;  2HDC A;  2VE8 A;  2JZY A;  4I09 A;  4UV8 A;  4U0V A;  3ZMS A;  3JSP A;  2DTR A;  1OYY A;  4B8X A;  3E6D A;  4IF4 A;  4AVP A;  2XUB A;  1KYZ A;  4KUM A;  4NHJ A;  3E6M A;  2ZME B;  4I7H A;  1UHM A;  2RQP A;  4MGR A;  4EM0 B;  2XAG A;  2PBI A;  5LGT A;  2VC1 A;  1YS6 A;  4RGX A;  1FY7 A;  2OQR A;  2CGP A;  3GXO A;  1LDK B;  1MD0 A;  4EVI A;  2F2E A;  5FB2 A;  1WI9 A;  5ILS A;  3ZN1 A;  4R8H A;  1IF1 A;  2XRO A;  1TW2 A;  1G3T A;  4EJU A;  2PQ8 A;  5HDG A;  3B73 A;  1FP2 A;  2IRF G;  3E6B A;  3RTR A;  2E7W A;  4LLL A;  3IL2 A;  3CDH A;  5AIQ A;  1FZP B;  4GO1 A;  1J5Y A;  1S29 A;  3R0J A;  1JE8 A;  1WSU A;  3GEZ A;  4HZF A;  4GYG A;  3TKY A;  2VBZ A;  5CYV A;  5CVU A;  4Q47 A;  3HTS B;  5FFZ A;  2NS0 A;  3HUG A;  3F8M A;  3ZMU A;  1HSJ A;  3M8F A;  4G94 A;  2DPD A;  4LMY A;  1QPM A;  1U5T C;  4IJA A;  4MQV A;  3BDD A;  1OMI A;  1XGO A;  2R7D A;  4HQE A;  1LVA A;  1S7O A;  1K7A A;  1DDN A;  2Y48 A;  3F72 A;  4HV5 A;  4WF2 A;  1IN5 A;  2DW4 A;  3FM3 A;  2JTV A;  3E3V A;  3QPT A;  1TBX A;  4EM2 A;  1OYI A;  4YFN F;  4IRH A;  1BI2 A;  2KJB A;  1J0R A;  2OD5 A;  5H6Q A;  3ZPL A;  4NB5 A;  1IXS B;  2BE5 F;  3KET A;  3DKW A;  2EWN A;  1L0O C;  3QP5 A;  4OIO F;  1R00 A;  1JHH A;  4U7B A;  3OV8 A;  1HW1 A;  1YYV A;  3T8R A;  5A2Q Z;  3K1N A;  1KU3 A;  2CW0 F;  2YU3 A;  2X4H A;  3C3W A;  4RB2 C;  2WV0 A;  4HYE A;  3WTT C;  4KN4 X;  4KMF A;  1ZRF A;  4MEY F;  1FT9 A;  1RIO H;  2A69 F;  3F8B A;  4CXF A;  4P55 A;  3IHU A;  4LGW A;  5HS7 A;  1EH7 A;  2ZXJ A;  3S2W A;  2D1H A;  4WX9 A;  1I5Z A;  1SMY F;  4KNY A;  2W24 A;  3E5U A;  5CVI A;  2LDU A;  3DQV C;  2VOP A;  3VFZ A;  2D45 A;  3BRO A;  1SD4 A;  1F9N A;  2ESN A;  3I59 A;  1G6N A;  1UHW A;  4M6Y A;  5K5Q A;  1XGM A;  4Z2Y A;  4UXN A;  5LLQ A;  3BPV A;  3U9G A;  2DI3 A;  4XBF A;  5FD6 A;  1NHA A;  5ILV A;  2Z5U A;  2EA2 A;  2A6H F;  5ICC A;  4L0Y B;  1R22 A;  2A61 A;  2QQB A;  3WU1 B;  4P96 A;  4KMU X;  4UVA A;  5EEG A;  2H09 A;  3KP5 A;  2VT3 A;  3PQJ A;  3EUH A;  5H6R A;  4KIC A;  1P92 A;  1B9N A;  3F6O A;  2A5Y B;  2E1C A;  3DEU A;  3T0Y A;  4O6J A;  3MQ0 A;  1UFM A;  2W57 A;  2RNJ A;  1T38 A;  3T1B A;  2DU9 A;  2DPU A;  2QZ8 A;  1W4M A;  4M9Z A;  4F7Z A;  4UV9 A;  4N9I A;  2K4J A;  4IXA A;  4HDV A;  3NEU A;  3CUQ B;  3FXR A;  5DDG A;  1BBY A;  3LAP A;  5ERI A;  4FX0 A;  2JPC A;  3M1E A;  1LEB A;  2VXZ A;  3O6B B;  3TDZ C;  3HRU A;  1LNW A;  4I98 B;  1PDN C;  1TTY A;  2IJL A;  5J6X A;  4L0Z B;  3KEO A;  1F4K A;  1WRJ A;  2Q8K A;  2CQK A;  1Z91 A;  3ULQ B;  2Q2E A;  2PG4 A;  3Q9S A;  3LFK A;  3PFI A;  2O03 A;  2IA2 A;  2IA1 A;  2R7F A;  3M7G A;  4KDP A;  2YX4 A;  3N4M A;  1U5T B;  3GLX A;  4HA8 A;  5D8L B;  2PEX A;  2PLY A;  3BPX A;  3TDU C;  3WGH A;  4U0Y A;  1J59 A;  2IT0 A;  1KU2 A;  3HOS A;  3I0T A;  1I1G A;  3WE3 A;  1JXS A;  2RC4 A;  5BQT A;  4A5M A;  4AWX B;  2P7C B;  4K2E A;  1LB2 A;  1FC3 A;  2JRT A;  3GFJ A;  5HS9 A;  5LHG A;  3RJP A;  3CO7 C;  3KZY A;  3F8N A;  4CIC A;  2MH2 A;  4DNC A;  3H92 A;  4G7O F;  2PMU A;  3COA C;  1FOK A;  2BEO A;  3IKT A;  1ZN2 A;  3DPL C;  1O7F A;  3Q9V A;  1FSE A;  2ZNZ A;  3SZP A;  1O3R A;  4OIP F;  1ON1 A;  1C0W A;  1W7P D;  3ROU A;  2J5P A;  1AOY A;  1X3U A;  2F5D A;  2FNA A;  1VTN C;  3QRF F;  1SD5 A;  3FZV A;  2DLL A;  3R6S A;  1D3Y A;  4YIF A;  3I71 A;  4LLN A;  2MH9 A;  3MAJ A;  5LHH A;  4EJW A;  3SXY A;  4L9V A;  2HKO A;  1DPU A;  4RS8 A;  1MJB A;  4M6X A;  3LQQ A;  4EM1 A;  1IN4 A;  2L3D A;  1ZLJ A;  1D5V A;  3W6K B;  1IAW A;  4N0B A;  5DV5 A;  1QQI A;  3ZP5 A;  2UXN A;  2NNY A;  3FMQ A;  1SAX A;  4YII A;  1GVJ A;  3L00 A;  3GWZ A;  1D8K A;  1GXQ A;  4IRG A;  5CVR A;  3JAM Z;  4AIK A;  4WXH A;  1BM9 A;  1MGT A;  2WC2 A;  1P4W A;  1RNL A;  2EV6 A;  4IRI A;  1PUE E;  1HXD A;  1S8N A;  2DQR A;  2XAH A;  4DQ2 A;  2ADU A;  5ILU A;  1XN7 A;  3FXU A;  5D6F A;  2G7U A;  4MNU A;  1IXC A;  1IN7 A;  1RI7 A;  3KP3 A;  4MQ9 F;  4H0E A;  3QU6 A;  5E1W A;  4GXO A;  1G3S A;  3LST A;  4TV7 A;  3DPT A;  3G73 A;  4IHT A;  3QP6 A;  1GHC A;  2F5F A;  4MTD A;  4A0Z A;  4KIB A;  4HLX A;  1PP8 F;  3L7W A;  4HOB A;  2VOO A;  2F5E A;  3HSE A;  4XRF A;  1MZB A;  1O3Q A;  2EK5 A;  2OAZ A;  3IWZ A;  3TO7 A;  1U6G A;  1Z05 A;  4O5V A;  2W84 A;  2KIU A;  2ZCW A;  1BC7 C;  5LGU A;  5CJ9 A;  3TO6 A;  1B1B A;  5DD4 A;  1YFH A;  4EMS A;  4PZJ A;  5DYM A;  3EDP A;  4OIQ F;  4RGR A;  2HOE A;  4L18 B;  4M9X A;  4LB6 B;  3WU0 A;  2HTJ A;  1IW7 F;  2YSR A;  5L3E A;  4PCQ A;  4U7D A;  3WG9 A;  5E1X A;  3WOD F;  1G4D A;  4Q4Z F;  2VN2 A;  3JTH A;  4GCV A;  1BI3 A;  2Y0M A;  2GA2 A;  2VBW A;  3KE2 A;  3RKX A;  2FBH A;  3BJ6 A;  4R79 A;  1TNT A;  2IA0 A;  1KQ8 A;  3WTZ A;  3K2Z A;  3KP7 A;  4G9Y A;  4L9J A;  4LG0 B;  1G3Y A;  4A6E A;  2CO5 A;  1ZG1 A;  4OMZ A;  3LQR A;  3FMS A;  3QU3 A;  1MJA A;  1XMA A;  3R60 A;  4XLN F;  5BOX A;  1YO5 C;  4BXU A;  4UVC A;  2YX7 A;  2NYX A;  4OMY A;  3V8L A;  2OZU A;  5JR3 A;  3SZT A;  2MBF A;  1MDM B;  3L09 A;  2CYY A;  4GGG A;  3CUQ C;  3H3Z A;  5D6E A;  3WGI A;  1LJ9 A;  1TLH B;  1I6X A;  5DCM A;  4AIH A;  4P5O A;  4CGZ A;  3ZN0 A;  3KP6 A;  2VC0 A;  2K7L A;  2J5O A;  1MKM A;  2UWM A;  1S7A A;  1XDS A;  3WTS C;  3ABT A;  2P6S A;  2P4W A;  2WTE A;  3L9F A;  1W5T A;  1XCB A;  1KU9 A;  4G8X A;  4WK8 F;  3DFG A;  1P6R A;  2V1X A;  3C1D A;  3GW2 A;  1HST A;  3QAH A;  2H6C A;  2IW5 A;  2M8E A;  4M74 A;  1S6L A;  1LQ1 A;  1S3J A;  2QVO A;  1J7K A;  3J81 Z;  1ONV A;  4E70 A;  4BYY A;  2L4M A;  2XGX A;  2EFW A;  2JSC A;  2XRN A;  4P9U A;  1HKT A;  4KYW A;  2HEO A;  5CVJ A;  2VT2 A;  3BOQ A;  1TQI A;  5F1R A;  1U3E M;  2QBY A;  3GYH X;  2DO7 A;  2EFP A;  4HLY A;  1XSD A;  3BY6 A;  2MLK A;  1Z1D A;  5HLG A;  1FLI A;  3TGN A;  1ZRD A;  4Y17 A;  2GXG A;  2H94 A;  3RIR A;  2UZK A;  4MEX F;  1YS7 A;  1V3F A;  1XGS A;  4U0W A;  1FPQ A;  4CYD A;  2MA3 A;  2TDX A;  1G3W A;  3RPU A;  2Z3Y A;  4ZYH A;  4CZZ A;  4S05 A;  2O61 A;  2FF4 A;  2ZME A;  2FML A;  2V6C A;  4U88 A;  3K1P A;  5D8K B;  2VOD A;  3E6C C;  2BV6 A;  1U78 A;  5ED4 A;  3BJA A;  4QWQ A;  3WTU C;  4EJO A;  5KK1 A;  1DUX C;  3LAJ A;  4HV6 A;  3KCC A;  2KIF A;  2G9W A;  3HHG A;  4RAY A;  2A07 F;  4ZYG A;  4O3M A;  1RUO A;  2W25 A;  1R58 A;  5D4R A;  1QZY A;  2B0L A;  1RUN A;  1R1T A;  2D2W A;  2C6Y A;  1P4X A;  4ON0 A;  3WGG A;  1YW8 A;  4MTE A;  3NRV A;  2FBK A;  3F21 A;  2P5L C;  3LA2 A;  4Y15 A;  3TQN A;  5IT3 A;  2KKO A;  2P7V B;  1KU7 A;  3KFW X;  1XSX A;  4HDU A;  1ZYR F;  2PJP A;  3FWE A;  3HSF A;  1ZLK A;  2PI0 A;  2ACJ A;  3V7R A;  4BH9 A;  3C18 A;  3ML6 A;  3ABU A;  3HRT A;  1K6O A;  2VBY A;  2FNP A;  3GX4 X;  1ZGJ A;  1T0F A;  5F6F A;  3F3X A;  4R1H A;  4WXD A;  1FYL A;  3MEX A;  2XV4 S;  2ZBK A;  1QZZ A;  2V1U A;  4L9N A;  5FLX Z;  1JGS A;  2P6T A;  3L2C A;  2HYF A;  3CUO A;  3GFI A;  3TOA A;  5EEH A;  3WTY C;  1FBS A;  2M30 A;  3HIF A;  4HX7 A;  1W7P B;  2NRA C;  2OA4 A;  5E8G A;  3V8J A;  3CTA A;  2O3F A;  2PN6 A;  3RYR A;  1A04 A;  1W5S A;  1SD7 A;  2AS5 F;  1UB9 A;  1O3S A;  4EGY A;  2DFI A;  3GO5 A;  4LK1 F;  4I2O A;  3KP2 A;  1R7J A;  3PQK A;  1GXP A;  2STW A;  5L3C A;  3FXQ A;  2F5C A;  3ISP A;  2FU4 A;  4NQW A;  1XDU A;  2OU2 A;  2QYO A;  1F1Z A;  2HGC A;  2QEN A;  5LGN A;  5A2Q K;  1PP7 U;  2K4B A;  1J75 A;  2O6G E;  4ENM A;  1IRG A;  3IWF A;  5IT9 Z;  2NNN A;  2ZJ2 A;  1FNN A;  1B4A A;  5AIP A;  4PGH A;  2XAQ A;  1BC8 C;  1T6S A;  4KN7 X;  5HDK A;  1DPR A;  3K9T A;  4LB5 A;  1LDD A;  3SHF A;  3KZZ A;  1CGP A;  2BGC A;  4OIN F;  1YTY A; 
#chains in the Genus database with same CATH topology
 5F64 A;  3O2P E;  1K78 B;  1X4P A;  1FYK A;  3CCR I;  2HWV A;  4IVN A;  4IZZ A;  5E20 A;  2YU9 J;  4RB0 A;  1X2N A;  3CLO A;  4AIJ A;  2IS4 A;  2QCO A;  5LBQ A;  1BI0 A;  2IBD A;  1V4R A;  4ZYA A;  5K1Y A;  1LE8 A;  4PJJ A;  4Y13 A;  3OSF A;  1FJL A;  3TMO A;  1WJD A;  5F0H A;  4XL9 A;  3FXJ A;  5E18 F;  5EGO A;  2MLG A;  3DBH B;  2FBI A;  1Y8Q B;  1JGG A;  1CF7 A;  2QQ8 A;  5FD5 A;  3ZQ7 A;  1Z21 A;  2WAF A;  3F8F A;  2LRE A;  3H9G A;  5LRS A;  1X2M A;  1IV8 A;  3S16 J;  2X51 A;  1JHF A;  4ETS A;  3ZQQ A;  3R0A A;  5D5X B;  4XKW A;  2LY9 A;  2PX9 A;  1MJ9 A;  4EV0 A;  5E17 F;  3P7N A;  1ZG5 A;  2DA7 A;  4EQQ A;  2LKP A;  1QO0 D;  4E7H A;  3ZR8 X;  5L3G A;  1N75 A;  1YW7 A;  4C30 A;  2GA1 A;  3I54 A;  4A3G J;  4MO7 A;  3HRM A;  4UVB A;  2NS8 A;  2Z33 A;  3IV5 A;  3VB2 A;  2L7K A;  5DCF A;  1T39 A;  1J2X A;  3CCY A;  4ESJ A;  2EA4 A;  3CJN A;  3HXL A;  5E3L A;  3J7A Y;  3W3C A;  2EFO A;  3S1N J;  3CUQ A;  2LLK A;  2ZFU A;  3E5Q A;  4UUS A;  5FGM A;  1I1S A;  3IP4 B;  2X6Y A;  4JK1 X;  3NQO A;  2X9D A;  4BQA A;  2M7B A;  2ZJP F;  2CU7 A;  4N4O B;  3OYN A;  4ESF A;  2ZXH A;  2ZC2 A;  3E1S A;  2R7W A;  2X85 A;  1B72 A;  4KIF A;  1ETX A;  4LD5 A;  4LFU A;  2DOA A;  3KYL A;  3BG5 A;  1W1W E;  2F4M B;  4CA0 A;  3VOD A;  3V42 A;  1FOW A;  3JR9 A;  1MSF C;  2WWY A;  4ZDP A;  1WKM A;  3DLL F;  4WCG A;  1Z3X A;  4GFB A;  2W85 A;  2L02 A;  4MHG A;  3I58 A;  1XGN A;  5EEA A;  2V1N A;  3IRQ A;  4HF2 A;  3OYH A;  3ZQC A;  3DXJ F;  1ETO A;  1QPI A;  4HAM A;  4DGW B;  2LYC A;  1DU6 A;  2W4S A;  2L9V A;  1ODD A;  4B09 A;  3KEQ A;  3VDX A;  1KGS A;  2FEZ A;  2OZ6 A;  5M5W J;  1FBQ A;  1SFO J;  1ZAO A;  5DUI A;  4EJT A;  4X6A J;  2VKE A;  2FQ4 A;  4I0A A;  2TCT A;  5FLX K;  5GAG J;  2BY0 A;  2BY1 A;  1KA8 A;  1AU7 A;  3A2K A;  4Z6Y A;  2ESH A;  2X48 A;  3G2B A;  1U5T A;  3FF5 A;  2V9K A;  5E3O A;  2WB1 A;  4ENN A;  1FIP A;  4QTR A;  3CES A;  5ICG A;  2A05 A;  3F6V A;  1HKQ A;  3WTV C;  3H0D A;  1FYM A;  3FKJ A;  2WBM A;  5HOO A;  4IHY A;  1MH3 A;  2ICW G;  3HUG B;  3CZ6 A;  3FM5 A;  4FE4 A;  2LRD A;  4BHP A;  1Y1V J;  2DMP A;  2VKV A;  5E3M A;  1H8A C;  2Y75 A;  4ZH4 F;  2BOL A;  5BPI A;  4HX4 A;  1BR4 A;  4MIM A;  5K5R A;  2VI6 A;  2E71 A;  3GTJ J;  2LC2 A;  4BQQ A;  1BOA A;  3MKW B;  4XR6 A;  1T08 B;  1GV2 A;  3V7C A;  2V1D A;  3BZC A;  3V4G A;  4KIT B;  2EH3 A;  2F5V A;  2HR3 A;  2HQR A;  2BVL A;  4B47 A;  2DA1 A;  3LSP A;  3IKV A;  5K7F A;  4WXC A;  1OFC X;  3K69 A;  1TL8 A;  1HC8 A;  2ECC A;  4XOT A;  3N97 A;  1XMX A;  2XKP A;  1ZQ3 P;  4BY1 J;  3FKI J;  3M8E A;  4A2U A;  2HOT A;  2BYV E;  2H6B A;  2LG4 A;  3QQA A;  5L3D A;  5GTI C;  4HQM A;  3S32 A;  3ZQL A;  1YQA A;  4KFC A;  1YOV B;  1SVM A;  5FRM A;  2XF6 A;  3HGY A;  3Q3S A;  1R6R A;  2PMH A;  5L3B A;  3JSO A;  2VE9 A;  3ZQI A;  3AG4 H;  2HPM A;  5KVR A;  3U1D A;  5IP6 A;  3CO6 C;  2E19 A;  5EG0 A;  2AQF A;  2DK8 A;  2ISZ A;  3EPZ A;  4RGU A;  2Y30 A;  1IG7 A;  3CQZ J;  5E1Z B;  1JUP A;  2NVQ J;  2OC6 A;  2OBP A;  3MWM A;  4RLQ A;  1H9T A;  3WE2 A;  3T5X A;  3S3O A;  5GPA A;  1DGR M;  2ETH A;  3BWG A;  3BCA A;  4M71 A;  4OU0 A;  3MCZ A;  4IEJ A;  1T2K A;  2FE3 A;  2RVC A;  4M72 A;  1ETK A;  4ZZD A;  3AAF A;  3H5N A;  4BHC A;  3H5R A;  1IN8 A;  3FIS A;  3GVA A;  1EV7 A;  2VL8 A;  2W48 A;  1FX7 A;  2DYS H;  2M5W A;  2XAS A;  1IJW C;  4Y7N J;  3HKZ N;  2ZSI B;  1QBJ A;  5CVV A;  1YHQ I;  4G7Z F;  1WJB A;  1HW5 A;  3GME A;  4BQN A;  1R5H A;  2H1K A;  2P5V A;  4M9S A;  4A3J J;  2B7E A;  3H0G J;  3I64 A;  1R5I D;  1IRF A;  3E5X A;  3LSH A;  3M07 A;  4BNC A;  1VI0 A;  3S3M A;  2YR2 A;  2R7V A;  4XLP F;  1KQ9 A;  1R23 A;  3F23 A;  3H3U A;  5AON A;  2G0E A;  2GXB A;  3TP0 A;  3HL2 A;  1ULY A;  1X1B A;  1OPC A;  3FXL A;  2GM4 A;  2K9S A;  3GFM A;  1MMS A;  4ZYE A;  2K27 A;  5J1R A;  2O8X A;  2DXI A;  3GF2 A;  3RYP A;  4RM3 A;  4XSX F;  5IP9 J;  3EYI A;  3FXM A;  1BR1 A;  3FMR A;  3L2R A;  4RGS A;  5IYD J;  4PJM A;  3F0C A;  3G1L A;  1EJ9 A;  3KLO A;  3ZMZ A;  2ME0 A;  4EAT A;  4NUB A;  4ZTJ A;  4Q48 A;  5GAE J;  3I59 B;  3KYC B;  3D1N I;  2EFQ A;  3IUO A;  2DBB A;  1XS9 A;  2I8D A;  3HOZ J;  1RET A;  1E3P A;  3EQL F;  3K70 C;  3O8H A;  1LEA A;  1F36 A;  3K4L A;  3KLN A;  1OQY A;  5L3F A;  1BW6 A;  1QHH D;  2IP2 A;  3MKL A;  2B63 J;  3VSL A;  2CSO A;  4ESB A;  1BIA A;  4OAY A;  3OOU A;  4HX8 A;  2KRF A;  1FSH A;  1F43 A;  1GV5 A;  2FA5 A;  1OCT C;  1AA7 A;  3JAM K;  4OIR F;  4C3H J;  2KZG A;  1H89 C;  4PK4 A;  4QIW N;  1YG2 A;  3HTU A;  2HVQ A;  4LLG F;  4BAY A;  2DT5 A;  2FSW A;  1SD6 A;  5CQG A;  2HZT A;  4UHT A;  3DWL E;  1S7E A;  2XKO A;  3OYJ A;  3BJO A;  5F27 A;  4YFX F;  2M8G X;  1D1C A;  5J8C A;  1DP7 P;  1EKE A;  1JKO C;  3BTJ A;  5J4V A;  3P9K A;  1IXR C;  1G2H A;  1EH6 A;  2P5K A;  2HTS A;  3T8T A;  2NXN B;  3DLA A;  3QOD A;  4PFO A;  1H0M A;  3V7S A;  4RB1 A;  3ZMT A;  4JP0 A;  1YX5 A;  2DAO A;  2OCC H;  2ZKZ A;  4XRM A;  2IGO A;  2RGV A;  5ICE A;  2LMD A;  2RDP A;  4AC0 A;  3GFL A;  2XPU A;  4Y4R A;  1SFX A;  4HEA 2;  3MFK A;  1K6Y A;  1YRN B;  1MIJ A;  1QGP A;  1HKS A;  2CQQ A;  3HRS A;  3S3N A;  2A6E F;  3QPH A;  2HI3 A;  2OTL I;  1S72 I;  5K5O A;  2QWW A;  4A12 A;  4GRI A;  2E5N A;  1ZAR A;  2QQ9 A;  1NH3 A;  1N77 A;  3FIW A;  2VPL A;  2FMY A;  2Q0O A;  3RKW A;  1Z7U A;  4QLC U;  3BTC A;  1X3Z B;  3B02 A;  1E17 A;  4E7Z A;  3OYM A;  1OKR A;  3HB9 A;  4ZZL A;  3OL4 A;  3FXO A;  4FX4 A;  2GIV A;  2MC4 A;  2K02 A;  5CKT A;  1U0J A;  4UNO A;  1D8J A;  2ISY A;  1Y8R B;  2VQL A;  3F8C A;  4P9F A;  5BPD A;  3HBL A;  6PAX A;  3FHN A;  3GTL J;  3ZRG A;  3LA3 A;  1SAN A;  4QPQ A;  2P0W A;  4BDY A;  2LD5 A;  3V8K A;  3RKQ A;  3D0S A;  1DGW Y;  5JI6 A;  2R0Q C;  3ZQH A;  4XKC A;  5C3E J;  1SFE A;  4HBL A;  2CJJ A;  2FOK A;  3OYK A;  3DPU A;  3K1M A;  2CUJ A;  3WTX C;  3U1K A;  2RQQ A;  1MMN A;  3ELK A;  4S04 A;  2Q2E B;  3OOP A;  4FE7 A;  2UUZ A;  5HLT A;  3WTW C;  1O57 A;  4BAC A;  4IPA A;  5FJ8 J;  4BU2 A;  1TWC J;  1I39 A;  2L7M P;  2JSP A;  2EZH A;  2K86 A;  1Y39 A;  3BP8 A;  4BHB A;  5LEJ A;  2A68 F;  3C2H A;  5FRN A;  1XMK A;  3KYD B;  1WPK A;  1E3O C;  1OYW A;  4OWR B;  3G3Z A;  3J7A O;  1WWX A;  5D5V B;  4IOA F;  5IPA A;  2BHZ A;  3VPR A;  4LG0 A;  3GTM J;  2E7X A;  3BT9 A;  3X2Q H;  1IDZ A;  5ICF A;  1VQ4 I;  2DTZ A;  1HQC A;  2BXY A;  4LIT A;  4M3B A;  3SEQ A;  4XRS A;  2LSO A;  5E8I A;  1TT0 A;  3S2H J;  2E1M B;  3LFU A;  1Z3Y A;  3ZMV A;  3J80 Z;  2L4A A;  4A3D J;  4F52 A;  2ID3 A;  2ELH A;  1Z9C A;  3TO9 A;  5J8F A;  3ECH A;  4A3L J;  1MDM A;  1E2X A;  3EET A;  4B44 A;  3G6E I;  1WCM J;  4UB8 C;  2YS9 A;  2Y9Z A;  5M5X J;  2XVC A;  4XID A;  2GQQ A;  1Y1W J;  1YIT I;  3KZI C;  1FTT A;  4G6Q A;  1STZ A;  4M3F A;  3G1M A;  2XIG A;  1KQ0 A;  2VXD A;  3DKY A;  2L54 A;  1UCR A;  2V7F A;  3KIO A;  4UUV A;  2MC3 A;  4DIQ A;  2KIS A;  1YIO A;  3PL8 A;  3SEZ A;  2L5Q A;  3TED A;  4D0P A;  1VQ9 I;  1P9Q C;  1TP4 A;  2LNB A;  4LJZ F;  2IPQ X;  1RZ4 A;  4D5F A;  4ASN A;  1KZH A;  1LFP A;  2E34 A;  2OQG A;  2M1B A;  4A3C J;  2EJR A;  3OYC A;  1TQM A;  2RV8 A;  3CC4 I;  2V4J C;  1HCR A;  1YI2 I;  4NC6 A;  4B3X A;  3BR1 A;  3GUD A;  4B1R A;  3CCE I;  4ZJZ A;  3OS0 A;  1Y0U A;  5E3N A;  5F0F A;  1XD7 A;  3ZOB A;  5CLS A;  4RAZ A;  1CF7 B;  2HFH A;  4KIG A;  3ZMD A;  1R4N B;  1RPW A;  2HKX A;  3VOE A;  2DDB A;  1OCR H;  3REO A;  1BJZ A;  1P7J A;  2Y2Z A;  1X3W B;  5JFR A;  4AID A;  3G4S I;  1VQK I;  2ELK A;  4CO8 A;  2O8K A;  1YW9 A;  3F22 A;  1H9G A;  2E1N A;  2FXA A;  3OIQ A;  4M73 A;  3FHZ A;  2E35 A;  3ABL H;  1IN6 A;  2KJC A;  5B5E C;  4Y52 J;  1YJ9 I;  4II3 A;  3OS2 A;  2IS1 A;  1R1V A;  3KP4 A;  3A1Y A;  5B1A H;  2COM A;  5M3M J;  2PJR A;  2X6W A;  3DF8 A;  3H3V K;  2IS2 A;  3HPG A;  4FT8 A;  2FQ3 A;  3AG2 H;  1HA8 A;  2BBY A;  4N9H A;  4I0B A;  2R3S A;  2BY3 A;  3J81 K;  5HLH A;  1BI1 A;  4M3E A;  4UY8 I;  3RPQ A;  3ABK H;  3Q0W A;  2OV7 A;  2CWE A;  2QQA A;  4FET A;  2IGM A;  4CHU A;  3CCQ I;  4HRI A;  1TWG J;  4QSH A;  3UR3 C;  3JRH A;  2O9L A;  4Q5S F;  4XM3 A;  2JT1 A;  1ZRC A;  1YLF A;  2KT0 A;  1N78 A;  2CFX A;  3PFY A;  1USS A;  1LKX A;  2KRC A;  1O3T A;  1XTA A;  2DFE A;  2QSH X;  3HOT A;  2L7F P;  1U2W A;  1GDT A;  2GZW A;  2RKH A;  4BKX A;  4F92 B;  1X1A A;  3IAM 2;  1K79 A;  2EIK H;  2XAF A;  3D5R C;  3CCV I;  3QOE A;  2MD5 A;  3LWF A;  2LP0 A;  4I99 C;  5FKL A;  2QUF A;  3A0B C;  1R1U A;  1UST A;  2VJ5 A;  2BXZ A;  1REP C;  3R4K A;  5DUK A;  3NWT A;  2A3S A;  3EYY A;  3L2U A;  1F5T A;  2E1O A;  3RDI A;  2A6T A;  1XSV A;  1Q1H A;  1TWA J;  3SFI A;  4RM2 A;  3E7L A;  2LK2 A;  1UHS A;  2O0Y A;  3GZ6 A;  2LH9 A;  4RDU A;  4JX6 A;  3CCU I;  1I6H J;  2Y31 A;  3A01 B;  5HLI A;  1POG A;  4RAG A;  3H35 A;  4XLE A;  3E97 A;  1U9N A;  4DOZ A;  2EV0 A;  2LF7 A;  2QSG X;  4L9T A;  2XAJ A;  3PUF A;  5DEQ A;  1W36 D;  2Z1D A;  2COB A;  3FBI B;  1YX3 A;  2V6E A;  2YPR A;  3C7J A;  4KT6 A;  1MBE A;  1Z6R A;  3CC7 I;  2EIN H;  2R5Y A;  4IHS A;  2Z9O A;  2R7Q A;  2GAU A;  2RN7 A;  2WV1 A;  1K4T A;  1PYV A;  1WQ2 A;  3CMY A;  3MKZ A;  2CUF A;  2P8T A;  2AQE A;  4I02 A;  1OR7 A;  1AKH B;  4KA4 A;  1OLT A;  2QSF X;  4YG2 F;  2UXX A;  1BL0 A;  2JA8 J;  2DCE A;  1QU3 A;  1E3H A;  2F4O B;  5HVQ C;  2LY2 A;  5EDN A;  4RB3 C;  2EQR A;  2L01 A;  1ZR2 A;  1ETV A;  3IRR A;  5DD8 A;  2ZME C;  4XLH A;  5TGT A;  3UNG C;  1HW2 A;  1VQ6 I;  2ZO4 A;  1ZRE A;  1PUF B;  2XPV A;  2NVT J;  2GBY A;  4EGZ A;  1SFU A;  3HM5 A;  1FBU A;  1ZH5 A;  5JHU A;  2QLZ A;  3Q5F A;  2M4K A;  3RQI A;  1X4O A;  2DA4 A;  3I53 A;  3S1M J;  1HBX G;  3J80 K;  3RCO A;  2ID6 A;  3O3K A;  3ZXS A;  4ITV A;  1QVU A;  1S5L C;  2STT A;  1TNS A;  2X6X A;  4ZYD A;  2AXL A;  1S9H A;  3DBL B;  1R36 A;  1Y0N A;  2DK5 A;  5GPC A;  1W0U A;  3K0L A;  2HOS A;  3RKY A;  4XLC A;  3TOB A;  3VEP A;  4DJA A;  2KMU A;  5B3S H;  4RBO A;  5TJJ A;  3CJQ B;  3OYF A;  2V79 A;  4IQJ A;  3WG7 H;  3ZCO A;  2DN0 A;  1T33 A;  2VBX A;  5IOZ A;  3CP2 A;  2CV0 A;  5D4S A;  4NBQ A;  1FP1 D;  1EH8 A;  3CCJ I;  3LA7 A;  2CV2 A;  5EZG A;  2LOO A;  3I4P A;  1BN5 A;  3MZ8 A;  3EUH C;  3QPS A;  4BE2 A;  2DJN A;  2R7X A;  4HW0 A;  3ECO A;  1B6A A;  1WGX A;  1YJN I;  3JTG A;  2H27 A;  1ZGW A;  1P7I A;  2HYG D;  1O7L A;  5BS6 A;  4HF1 A;  1I27 A;  3OYL A;  1UJ8 A;  3W2A A;  4HST A;  2KDO A;  1VF9 A;  4A0X A;  4L5I A;  2FX0 A;  3SFZ A;  1WFX A;  1BIB A;  4ENK A;  3OYA A;  1Z7L A;  2ZNY A;  4HPQ A;  2R5Z A;  1TQP A;  3FX3 A;  3AL0 B;  4LK0 F;  3LMM A;  4OOI A;  2X0L A;  1B8I A;  2VJJ A;  2DQL A;  3KX2 A;  3MZH A;  2E5Z A;  4JBA A;  2QKM B;  2KIM A;  5JVT A;  1I50 J;  3HG9 A;  1XCV A;  1ZGA A;  3HPH A;  3I5U A;  1P4A A;  2IVM A;  4ZTF A;  2O7O A;  4MFE A;  2IEK A;  3JRG A;  2DFF A;  1LDJ A;  2DT6 A;  3SYT A;  4I01 A;  5DCM B;  4AUX A;  2V9V A;  1FWZ A;  1W7P A;  1XB4 A;  2LKX A;  1B59 A;  3BLY A;  4CCL A;  2VON A;  1L3L A;  1TWH J;  1U8R A;  4WWC A;  2D1V A;  3AG1 H;  5LEK A;  5D5W B;  5HDN A;  2EV5 A;  2M87 A;  1V55 H;  2FRH A;  2LBF A;  4A0Y A;  1WJ5 A;  2EB7 A;  3RI4 A;  1P2F A;  2GIZ A;  3BG9 A;  3ERE D;  2JVG A;  5KAF C;  3DKX A;  4RAF A;  2PFB A;  3DV8 A;  4CYC B;  3S8P A;  3KEY A;  2DMQ A;  4EJV A;  3MD2 A;  3K4K A;  3BZ6 A;  2K3F A;  1MBF A;  2XHK A;  5K7Z A;  4FCY A;  4GYI A;  3W6V A;  2HU9 A;  2K9L A;  1WI3 A;  4CDG A;  1XX5 A;  1VZ0 A;  3L2W A;  1AWC A;  2XC7 A;  1B9M A;  3W6J B;  4G7H F;  4KT5 C;  2HXO A;  3U2R A;  4L5J A;  1A31 A;  3CF2 A;  2JA5 J;  3M9A A;  1BJA A;  2QM3 A;  2WAQ A;  4BEH A;  2W00 A;  3G71 I;  3P9I A;  2LF8 A;  1GT0 C;  2JPB A;  1Z6T A;  4FHT A;  1KYW A;  4YEL A;  4C9Y A;  3CDL A;  4JQF A;  4PDK A;  1OCP A;  4AD9 A;  2OCE A;  2BW3 A;  2CUE A;  3S2D J;  5D5U B;  1IZ1 A;  2DT7 B;  3IC7 A;  5BMZ A;  1J9I A;  2G7H A;  4F3Q A;  3HHH A;  4A6D A;  1SMT A;  2DDA A;  3K4M A;  5FO5 A;  3QOP A;  3P9C A;  4BBS J;  2E1M C;  5LHI A;  1ZEL A;  2DOF A;  2MD0 A;  1IUY A;  2JA2 A;  4DYC A;  3R61 A;  2CW7 A;  2HQN A;  1FOY A;  2EFN A;  1YIJ I;  2MW8 A;  2DMT A;  3OYD A;  1XPX A;  4BQO A;  1K78 A;  3JRD A;  2CH0 A;  2K3P A;  2RAE A;  2QBY B;  5IT9 K;  2K85 A;  5HS8 A;  2NAZ A;  5J47 A;  3BQY A;  3LSM A;  2BHY A;  1QNT A;  4ENJ A;  2YUS A;  3MZY A;  3GZ5 A;  3OIP A;  3A02 A;  5TRD A;  3DP7 A;  5LRR A;  3D5L A;  5FFX A;  4YFK F;  3S93 A;  1R5G A;  5H20 A;  2GWR A;  2BZT A;  2CG4 A;  3BCB A;  4OAZ A;  4A5N A;  3PUB A;  5DS9 A;  3JW4 A;  1T56 A;  1ZHF A;  5BNG A;  2WA0 A;  3HYI A;  2HS5 A;  4CCN A;  3EUK L;  3LSI A;  3M3Y J;  1TW3 A;  3B6A A;  3HSR A;  2JRM A;  3HOV J;  4A69 C;  4E7J A;  3PIO F;  2M45 A;  2JA6 J;  1ON2 A;  1T98 A;  2ZFW A;  1IRZ A;  4HF0 A;  3JRC A;  2Z99 A;  4JYK A;  4PGG A;  2PMZ N;  4XSZ F;  3HEF A;  2KP6 A;  2JUG A;  3CJR B;  4G6D A;  1ZG3 A;  3SQN A;  2HDC A;  2VE8 A;  3AFH A;  2L2O A;  2L9R A;  2JZY A;  4I09 A;  4PJ0 C;  5FRO A;  1JJ8 C;  2Y0S N;  4UV8 A;  4U0V A;  4W1U A;  4RA2 A;  1OIS A;  3ZMS A;  3JSP A;  2HDD A;  2OTJ I;  2IS6 A;  2DTR A;  1WJA A;  2L7Z A;  1OYY A;  4B8X A;  3E6D A;  4IF4 A;  2X1C A;  5TIS C;  2XUB A;  3TL4 X;  1KYZ A;  4AVP A;  4KUM A;  2E2H J;  4NHJ A;  3TW7 A;  3E6M A;  4P1W A;  2ZME B;  4I7H A;  1TZL A;  2N8G A;  1UHM A;  1PVE A;  2RQP A;  4MGR A;  4EM0 B;  4XIC A;  2XAG A;  2PBI A;  3S1R J;  3W2V A;  1ENH A;  2VC1 A;  5LGT A;  2L9S A;  1YS6 A;  4RGX A;  4N4N B;  1QHG A;  4A3E J;  1FY7 A;  2OQR A;  3E0J B;  5GAH J;  2CGP A;  1HDP A;  1ETQ A;  1JTY A;  2DMN A;  3OL3 A;  1BA5 A;  3GXO A;  1LDK B;  1MD0 A;  2DJI A;  4EVI A;  4V2F A;  3HOU J;  2F2E A;  5FB2 A;  1WI9 A;  3BTL A;  5ILS A;  3ZN1 A;  2QA4 I;  2WAD A;  4R8H A;  1QA6 A;  1IF1 A;  2XRO A;  4XOR A;  1TW2 A;  1G3T A;  1APL C;  2ZSH B;  3N05 A;  1OCO H;  2PQ8 A;  4EJU A;  2M4G A;  3PJR A;  2KIQ A;  2L0K A;  5FKO A;  5HNF A;  5HDG A;  2R4G A;  3B73 A;  4FIS A;  3VYS B;  1FP2 A;  3DCF A;  1MMD A;  2QF7 A;  2IRF G;  1Z77 A;  3E6B A;  2F6C A;  2M0C A;  1G8X A;  3RTR A;  2E7W A;  3FDY A;  3CCS I;  2KRH A;  3OS1 A;  4LLL A;  3IL2 A;  3JRI A;  3CDH A;  1BR2 A;  3DBR B;  5AIQ A;  1FZP B;  4IHX A;  4GO1 A;  4B43 A;  1J5Y A;  1S29 A;  3R0J A;  1JE8 A;  1WSU A;  3GEZ A;  4HZF A;  2MYS A;  4GYG A;  4AYB N;  3VYT B;  4XLA A;  1MBG A;  3TKY A;  2VBZ A;  4X1E A;  5CYV A;  1R9T J;  4Y3O A;  5CVU A;  4Q47 A;  3HTS B;  5FFZ A;  2NS0 A;  1OCZ H;  3HUG A;  3F8M A;  3BR5 A;  3ZMU A;  4E4H A;  1HSJ A;  3M8F A;  4G94 A;  2DPD A;  4LMY A;  1QPM A;  3IAS 2;  2XF7 A;  1U5T C;  3QYF A;  4IJA A;  5JVG F;  4MQV A;  1MSE C;  3BDD A;  3H1C A;  9ANT A;  1OMI A;  1XGO A;  2R7D A;  4HQE A;  4PJL A;  1NG7 A;  3HOW J;  1LVA A;  1S7O A;  1K7A A;  3S1Q J;  1DDN A;  5DTD A;  2OF7 A;  4JX5 A;  2Y48 A;  3F72 A;  4HV5 A;  1UZC A;  1X1C A;  1IN5 A;  4WF2 A;  4CH7 A;  1R49 A;  1LVK A;  4XKB A;  2DW4 A;  1UG0 A;  3M1C A;  3FM3 A;  1RR7 A;  2JTV A;  3BG7 A;  3E3V A;  3QPT A;  1TBX A;  4EM2 A;  1OYI A;  2VJI A;  2HVS A;  4YFN F;  3OR2 C;  4IRH A;  3FK7 A;  1BI2 A;  4W97 A;  2KJB A;  4NDL A;  1J0R A;  2OD5 A;  5H6Q A;  3A03 A;  1A6Q A;  2M7A A;  4XK4 A;  3ZPL A;  2XRL A;  3CCL I;  4NB5 A;  1IXS B;  1VQO I;  2BE5 F;  3KET A;  3DKW A;  4IHV A;  5JLW A;  3CF5 F;  2EWN A;  4PSW A;  5B1B H;  2Y9Y A;  3I56 I;  1L0O C;  3QP5 A;  4CCJ A;  4OIO F;  1R00 A;  1JHH A;  4U7B A;  3OV8 A;  5F1J A;  4ZC3 A;  4NNJ A;  5J3L A;  3G1O A;  1HW1 A;  4BJ5 C;  1A35 A;  1YYV A;  3UKG A;  2EPF A;  3I4N J;  3T8R A;  4DBQ A;  1LFU P;  3OWT A;  5A2Q Z;  1H88 C;  3K1N A;  1KU3 A;  1FOX A;  1V5F A;  2CW0 F;  2VIX A;  2YU3 A;  2X4H A;  3C3W A;  3BG6 A;  4RB2 C;  1VQ7 I;  2DOE A;  3CDI A;  2AO9 A;  5GTH C;  2WV0 A;  4HYE A;  3I9V 2;  1Y56 A;  4B3A A;  3WTT C;  4KN4 X;  3LL7 A;  4KMF A;  1ZRF A;  4MEY F;  4NQW B;  1FT9 A;  1RIO H;  2MSY A;  2A69 F;  3ERM A;  3F8B A;  2CV1 A;  3DTI A;  3HZJ A;  3J7Y J;  2XSJ C;  4CXF A;  4P55 A;  3IHU A;  4LGW A;  3PNY A;  5HS7 A;  4DBR A;  3ZQF A;  1IGN A;  1EH7 A;  1IUF A;  2MGQ A;  2ZXJ A;  4YRV A;  3S2W A;  2D1H A;  4WX9 A;  2JQ7 A;  2CW8 A;  1SFK A;  1SMY F;  1I5Z A;  2W24 A;  3FBN B;  4KNY A;  2FD5 A;  5JHF A;  3GBG A;  2K5C A;  3E5U A;  2QEX I;  3K10 A;  2LDU A;  3B6C A;  3DQV C;  5CVI A;  4IX7 A;  1MNM C;  2VOP A;  3VFZ A;  2D45 A;  3BRO A;  3DEE A;  1SD4 A;  1F9N A;  2ESN A;  2FOW A;  2Z2S B;  1G6N A;  3I59 A;  3AL0 C;  1UHW A;  3A0H C;  4M6Y A;  1I3Q J;  4HG2 A;  5K5Q A;  2L9N A;  1W5C C;  3C2B A;  1XGM A;  3RZD J;  4Z2Y A;  4UXN A;  4I76 A;  5LLQ A;  3JCU C;  3BPV A;  1X1P A;  3U9G A;  2DI3 A;  2QKL B;  4HNT A;  4XBF A;  3OIO A;  4BUP A;  1NHA A;  5FD6 A;  5ILV A;  3L2V A;  2Z5U A;  1GUU A;  2EA2 A;  2WB1 N;  1CQT A;  4IHW A;  3RZO J;  3VSK A;  2A6H F;  1MMG A;  2R92 J;  5ICC A;  1W0T A;  4L0Y B;  1R22 A;  2CQX A;  1LE8 B;  4DYQ A;  5FKK A;  2A61 A;  2QQB A;  1NG6 A;  2VB6 A;  3WU1 B;  4P96 A;  5EGO B;  4KMU X;  4UVA A;  1ERD A;  5EEG A;  3AG3 H;  2H09 A;  3KP5 A;  4BS9 A;  2XAU A;  2VT3 A;  3PQJ A;  4J01 A;  3EUH A;  5CQE A;  4KIC A;  5H6R A;  2VKD A;  3QPL A;  4YIR X;  1P92 A;  1B9N A;  1SC7 A;  3F6O A;  2A5Y B;  5M5Y J;  2MG4 A;  3OY9 A;  2E1C A;  3DEU A;  4AVZ A;  3T0Y A;  5DM7 F;  2WY7 Q;  3MQ0 A;  4O6J A;  1UFM A;  2W57 A;  2RNJ A;  1T38 A;  3T1B A;  3ZQG A;  2DU9 A;  2DPU A;  2KHM A;  3CME I;  2QZ8 A;  4PFP A;  1W4M A;  4M9Z A;  4F7Z A;  2DA6 A;  4UV9 A;  3Q0U A;  3WU2 C;  2ZXI A;  4N9I A;  1YRN A;  1D1A A;  3I3L A;  2CS3 A;  2K4J A;  4IXA A;  4HDV A;  3NEU A;  3CUQ B;  1ITY A;  2ECB A;  2FJ1 A;  2NOJ B;  3FXR A;  1BBY A;  3OMY A;  5DDG A;  4UUS B;  1HLV A;  2OJE D;  5ERI A;  4FX0 A;  3LAP A;  2JPC A;  2CUZ A;  2NS7 A;  3M1E A;  1LEB A;  3GTK J;  1JUS A;  1JKP C;  2VXZ A;  1B72 B;  1ZK8 A;  2E2I J;  3O6B B;  4IQ4 A;  3TDZ C;  3HRU A;  3OSG A;  1LNW A;  3K4B A;  4I98 B;  1PDN C;  4F55 A;  2K9N A;  1TTY A;  4IOC F;  2IJL A;  1ACI A;  5J6X A;  4L0Z B;  3KEO A;  2LKS A;  2VJ4 A;  3BC8 A;  3NAU A;  1F4K A;  2H1L A;  2ZJR F;  3C2G A;  1WRJ A;  2HPI A;  2Q8K A;  1YE9 A;  2CQK A;  1Z91 A;  2H8W A;  3ULQ B;  2VQG A;  2Q2E A;  4ZDL A;  4BJT A;  2PG4 A;  3Q9S A;  3LFK A;  3PFI A;  2O03 A;  2IA2 A;  2IA1 A;  1VQL I;  2R7F A;  3M7G A;  4DYR A;  4KDP A;  2YX4 A;  3N4M A;  1U5T B;  2DA2 A;  3GLX A;  4D7M A;  4XNF A;  4HA8 A;  5EF6 A;  5D8L B;  2PEX A;  5CPR B;  2PLY A;  3BPX A;  3TDU C;  3A4C A;  3WGH A;  4U0Y A;  3IH4 A;  1J59 A;  2IT0 A;  3CC2 I;  4AM3 A;  1KU2 A;  3S17 J;  1NK2 P;  4D1Q A;  3I0T A;  3HOS A;  1I1G A;  3WE3 A;  1JXS A;  4FAS D;  2RC4 A;  5BQT A;  4A5M A;  1I3A A;  1TT5 B;  4AWX B;  2P7C B;  4K2E A;  1LB2 A;  2VQC A;  1FC3 A;  2JMW A;  2KFD A;  2HYJ A;  2LFB A;  2JRT A;  4B4C A;  3GFJ A;  5HS9 A;  4BL0 B;  2HOA A;  3RJP A;  5LHG A;  3KZY A;  3CO7 C;  2WY8 Q;  5JLX A;  3F8N A;  3EUA A;  4BXF A;  4CIC A;  3LNQ A;  2MH2 A;  4DNC A;  3HOY J;  3GCM A;  3H92 A;  3O8G A;  3D5S C;  2AXT C;  4G7O F;  4A3F J;  3K70 D;  2E2J J;  2PMU A;  4M6V A;  3COA C;  1FOK A;  2X1D A;  1Y6I A;  2BEO A;  3IKT A;  2TRT A;  4IO9 F;  1ZN2 A;  2O5R A;  3HDD A;  3DPL C;  1O7F A;  3Q9V A;  1AHD P;  1FSE A;  2ZNZ A;  1FMW A;  3SZP A;  2UV1 A;  1O3R A;  4OIP F;  1ON1 A;  4E7K A;  3BG3 A;  1C0W A;  1W7P D;  4JX4 A;  5EG0 B;  3ROU A;  4C2U A;  3CMA I;  1WJC A;  2J5P A;  3PO3 J;  2IXS A;  1AOY A;  1X3U A;  2F5D A;  2EZL A;  2CQN A;  1O4X A;  2FNA A;  4U87 A;  1VTN C;  3QRF F;  1SD5 A;  3FZV A;  4UB6 C;  5EJC A;  2DLL A;  3R6S A;  1D3Y A;  4YIF A;  3I71 A;  3F9K A;  4LLN A;  2MH9 A;  3MAJ A;  2JK3 A;  5LHH A;  4EJW A;  2KZV A;  5J40 A;  5KCM A;  2X6O A;  3SXY A;  4PJN A;  3L1P A;  4L9V A;  5IY5 H;  1VQN I;  2DA3 A;  2HKO A;  3SDB A;  1DPU A;  5IYC J;  2LY1 A;  5C4J J;  3JRA A;  3OYE A;  3M4O J;  4RS8 A;  3CP8 A;  1MJB A;  4M6X A;  3LQQ A;  4EM1 A;  5IYB J;  1WJF A;  1IN4 A;  1PJR A;  3NWS A;  2L3D A;  1ZLJ A;  3GTO J;  1D5V A;  3PSI A;  3W6K B;  1JKR C;  3SZG A;  3MMY B;  1IAW A;  4N0B A;  3GZN B;  3H9Q A;  4RLF A;  5DV5 A;  2CRG A;  1QQI A;  3ZP5 A;  3K4J A;  3I55 I;  2UXN A;  2NNY A;  3FMQ A;  1ETY A;  4IL6 C;  2EIL H;  1SAX A;  4YII A;  4V2G A;  4RMN A;  1GVJ A;  2NVU B;  2DMU A;  3L00 A;  5C44 J;  3GWZ A;  1D8K A;  1GXQ A;  1T0F C;  4IRG A;  2R93 J;  5CVR A;  3JAM Z;  4AIK A;  4G6T B;  1JKQ C;  4WXH A;  4A93 J;  5F08 A;  1BM9 A;  2M34 A;  2M9H A;  1MGT A;  5EZH A;  2WC2 A;  3H9J A;  2VUM J;  1P4W A;  1RNL A;  3U21 A;  2EV6 A;  4IRI A;  1PUE E;  1HXD A;  1MBJ A;  1S8N A;  2DQR A;  2XAH A;  4DQ2 A;  3JRB A;  2ADU A;  5ILU A;  1XN7 A;  1LUJ B;  3FXU A;  1D0X A;  1X58 A;  5D6F A;  1MMA A;  4PSX A;  2G7U A;  4MNU A;  1IXC A;  1IN7 A;  1RI7 A;  3KP3 A;  3NAR A;  2A5W A;  4MQ9 F;  3QU6 A;  5E1W A;  4H0E A;  1MH4 A;  1JJ6 C;  1MBK A;  1G3S A;  4GXO A;  3LST A;  4TV7 A;  3DPT A;  3LOC A;  3OYI A;  3G73 A;  3QP6 A;  4IHT A;  2F5F A;  1GHC A;  4MTD A;  4A0Z A;  4KIB A;  3A01 A;  3HC7 A;  4HLX A;  3VYU B;  5K7H A;  2KLO A;  1PP8 F;  3WHC A;  3L7W A;  3BR3 A;  4HOB A;  1X19 A;  3LSK A;  2ZJQ F;  5GAD J;  2VOO A;  2CQ7 A;  2E60 A;  2F5E A;  3DU5 A;  2W1O A;  3HSE A;  4XRF A;  1U8B A;  1MZB A;  1K4S A;  1O3Q A;  3BR2 A;  4XN0 A;  2EK5 A;  2OAZ A;  4M3G A;  3IWZ A;  1TWF J;  1AKH A;  3GLL A;  5F04 A;  1FTZ A;  3TO7 A;  3RSN A;  1XC5 A;  1U6G A;  1Z05 A;  4O5V A;  4KIS A;  2W84 A;  5M3F J;  2KIU A;  2ZCW A;  4NC7 A;  4J19 A;  1BC7 C;  3BQZ A;  4M3D A;  1DQU A;  4G12 A;  5LGU A;  2E36 A;  5CJ9 A;  1PUF A;  2BVM A;  1B1B A;  5DD4 A;  3TO6 A;  1YFH A;  2GOX B;  4E6K G;  5F0C A;  1KON A;  1OR7 C;  4DZJ A;  4EMS A;  4PZJ A;  5DYM A;  4HNU A;  1U9O A;  3EDP A;  4OIQ F;  4RGR A;  2HOE A;  4L18 B;  4M9X A;  1GVD A;  4D7N A;  4LB6 B;  3WU0 A;  2HTJ A;  1IW7 F;  2YSR A;  5L3E A;  5EYR A;  4ABZ A;  5IP7 J;  4PCQ A;  4U7D A;  3WG9 A;  5E1X A;  3WOD F;  1G4D A;  4Q4Z F;  4A3M J;  2VN2 A;  3GTQ J;  3JTH A;  1LFB A;  4GCV A;  1BI3 A;  3DTK A;  5FKM A;  5FLM J;  2HQ5 A;  1J09 A;  4V19 K;  2EZK A;  2Y0M A;  2GA2 A;  2VBW A;  1NK3 P;  3KE2 A;  2CFO A;  2D5V A;  3RKX A;  2VKH A;  2FBH A;  3BJ6 A;  3FXK A;  5GP9 A;  4R79 A;  1TNT A;  5KHD A;  2IA0 A;  2MAB A;  1KQ8 A;  2OUM A;  2IGN A;  3WTZ A;  1VND A;  4XN3 A;  3K2Z A;  2DYR H;  3KP7 A;  2KDZ A;  4G9Y A;  2DFH A;  4L9J A;  4LG0 B;  1G3Y A;  4A6E A;  2CO5 A;  1ZG1 A;  4OMZ A;  3LQR A;  2K40 A;  2X1E A;  3FMS A;  1W36 C;  3QU3 A;  1MJA A;  2WAE A;  1XMA A;  3KPH A;  3R60 A;  4XLN F;  1K83 J;  1JTX A;  5BOX A;  4ANJ A;  1YO5 C;  4BXU A;  4UVC A;  2YX7 A;  2GXA A;  2NYX A;  4IKF A;  4OMY A;  3V8L A;  2OZU A;  3PSF A;  5JR3 A;  3SZT A;  3QWL A;  2MBF A;  1MDM B;  3L09 A;  1BW5 A;  2CYY A;  4ZDO A;  2QGU A;  4GGG A;  1RRJ A;  3CUQ C;  3H3Z A;  3IH2 A;  3WHB A;  1VFC A;  2XB5 A;  5D6E A;  3WGI A;  4C3I J;  3PIP F;  2EIM H;  3S14 J;  1LJ9 A;  1UAA A;  1Q1V A;  4KJZ A;  3GTP J;  1TLH B;  1V54 H;  1I6X A;  5DCM A;  1R71 A;  4AIH A;  2R7T A;  4P5O A;  2JWT A;  4CGZ A;  3ZN0 A;  3KP6 A;  2VC0 A;  2K7L A;  1FIA A;  3MVP A;  2J5O A;  1MKM A;  2UWM A;  4Y33 A;  2ME6 A;  1S7A A;  2LVS A;  4UUT A;  2M0M A;  1XDS A;  3WTS C;  5LFA A;  2VQH A;  4A3B J;  3ABT A;  4FTH A;  2JA7 J;  2R7Z J;  4A3I J;  2F48 A;  2P6S A;  2P4W A;  2WTE A;  3L9F A;  1W5T A;  3FK6 A;  1XCB A;  1KU9 A;  2XSD C;  2Y69 H;  2DA5 A;  4CYC A;  4G8X A;  4CCM A;  4WK8 F;  3DFG A;  2XF5 A;  4XQF A;  2W7N A;  1P6R A;  2V1X A;  3C1D A;  4MFD A;  1Z0X A;  3DEW A;  3GW2 A;  3M8J A;  2LR8 A;  1BOB A;  1HST A;  3QAH A;  2IAI A;  2H6C A;  3TP3 A;  3J7Z I;  2IW5 A;  2M8E A;  1T95 A;  4M74 A;  1S6L A;  5J1Y A;  1LQ1 A;  1S3J A;  4D9J A;  2QVO A;  1FMV A;  3W2W A;  1J7K A;  1SAU A;  1UG2 A;  3J81 Z;  1ONV A;  4E70 A;  4I6Z A;  4BYY A;  2L4M A;  4CUG A;  4F93 B;  2XGX A;  2EFW A;  2JSC A;  2XRN A;  1G59 A;  1MNE A;  4PUS A;  4S0H B;  4P9U A;  3RPU D;  1HKT A;  2OPT A;  2PJR B;  4KYW A;  1VQM I;  3BTI A;  3PNT A;  2NOG A;  3RQ4 A;  3TW6 A;  1A5J A;  1IO2 A;  2HEO A;  5CVJ A;  4L5E A;  2VT2 A;  4BBR J;  1Z67 A;  3BOQ A;  2NVX J;  1VQ8 I;  1TQI A;  2ZB9 A;  4LIV A;  5F1R A;  2R7U A;  2W82 A;  1U3E M;  2QBY A;  3GYH X;  1ZKG A;  2DO7 A;  2EFP A;  5J4Y A;  4HLY A;  2RNG A;  1E0E A;  1XSD A;  1V5G A;  3BY6 A;  4BDZ A;  2XB0 X;  2HZD A;  2GLO A;  1JI8 A;  2MLK A;  1Z1D A;  1X1D A;  5HLG A;  1FLI A;  3TGN A;  1ZTR A;  2V9P A;  4AU7 A;  1ZRD A;  4NC8 A;  4Y17 A;  1WHU A;  2Q1Z B;  4XOP A;  2XDV A;  2GXG A;  2R7S A;  1MW7 A;  2KPM A;  5FKN A;  3GTG J;  2H94 A;  1QZE A;  4HSR A;  3TBI A;  3RIR A;  4F91 B;  1QVT A;  1A6I A;  3PM1 A;  2UZK A;  1JUM A;  3ABM H;  3OR1 C;  4MEX F;  4LIU A;  1IC8 A;  4C2M J;  1YS7 A;  2GOM A;  1IDY A;  1MND A;  4GDF A;  1M1E B;  1UMQ A;  2I10 A;  1V3F A;  2HNH A;  2K9M A;  1RR8 C;  1XGS A;  4U0W A;  1FPQ A;  4CZC A;  3IH3 A;  3K7A J;  4CYD A;  5KNL A;  2MA3 A;  2VPR A;  1WH5 A;  4C3J J;  2H8R A;  2TDX A;  4CCK A;  1G3W A;  3RPU A;  2Z3Y A;  4ZYH A;  4CZZ A;  2M2E A;  4JOM A;  4S05 A;  2ELJ A;  4HNV A;  1WZ2 A;  1DP3 A;  2O61 A;  2BY2 A;  1OCC H;  1D5Y A;  2FF4 A;  2ZME A;  2FML A;  2V6C A;  4U88 A;  2R5Y B;  4CSW A;  3K1P A;  5D8K B;  2VOD A;  3E6C C;  1ETW A;  2BV6 A;  1UEL B;  1U78 A;  4E7I A;  5J1U A;  1EF4 A;  5LD2 C;  5ED4 A;  3BJA A;  3HJE A;  4QWQ A;  4BJ6 C;  1HF0 A;  2HQA A;  3HOX J;  3WTU C;  3PO2 J;  3VWB A;  5HNH A;  4EJO A;  4D5C A;  5KK1 A;  1DUX C;  4QPO A;  3LAJ A;  4LG3 A;  5B66 C;  4HV6 A;  3BR6 A;  3KCC A;  2P81 A;  2JVH A;  2KIF A;  4YEJ A;  2G9W A;  3HHG A;  4RAY A;  2R7R A;  3L2Q A;  2A07 F;  5IOY A;  1TC3 C;  1HOM A;  2FUG 2;  3MKY B;  4ZYG A;  2EBI A;  2NVY J;  3BR0 A;  3CJT B;  4H4K C;  4O3M A;  1RUO A;  2W25 A;  1R58 A;  5FLV A;  3DTE A;  5D4R A;  3ASO H;  1JT0 A;  1IV6 A;  5C4X J;  1QZY A;  2WAQ N;  2B0L A;  3CLQ A;  2HXI A;  4LOC A;  1RUN A;  1R1T A;  3HGG A;  4E7L A;  2D2W A;  2C6Y A;  1P4X A;  2JN6 A;  4ON0 A;  3LSG A;  3WGG A;  1YW8 A;  4A3K J;  4MTE A;  3Q0V A;  3NRV A;  2FBK A;  3F21 A;  2P5L C;  4XMY A;  2DOD A;  2ZXW H;  2MFZ A;  3LA2 A;  1VQ5 I;  4Y15 A;  1GLN A;  4II2 A;  3TQN A;  5IT3 A;  2KKO A;  2P7V B;  2XGE A;  1LPQ A;  3CD6 I;  1KU7 A;  4B48 A;  1FEX A;  3KFW X;  1XSX A;  4HDU A;  1ZYR F;  2PJP A;  3FWE A;  3JRE A;  3HSF A;  1ZLK A;  1RKW A;  1RKT A;  2PI0 A;  2IGK A;  2ACJ A;  3V7R A;  4BH9 A;  3C18 A;  1VQP I;  3CMM A;  1QRY A;  1DU0 A;  3HKZ A;  3ML6 A;  3ABU A;  1SEU A;  2V26 A;  3HRT A;  1T8I A;  1K6O A;  2XPW A;  2PMZ A;  1IRX A;  1WJE A;  1JT6 A;  2VBY A;  3H5A A;  2FNP A;  2R7O A;  3GX4 X;  1ZGJ A;  4FQG A;  2M3A A;  3K4C A;  1T0F A;  5F6F A;  4E7S A;  2HVR A;  3F3X A;  4R1H A;  4WXD A;  2R5Z B;  2B9S A;  2Y0S A;  1WH7 A;  1B8I B;  2XGD A;  3PNV A;  1FYL A;  3MEX A;  2XV4 S;  2ZBK A;  1QZZ A;  2V1U A;  4L9N A;  2VAS A;  5H2F C;  5FLX Z;  1JGS A;  2P6T A;  3L2C A;  3P5J A;  2HYF A;  1SVL A;  3S15 J;  3QYB A;  3CUO A;  3SJM A;  3GFI A;  4J00 A;  4C2T A;  3TOA A;  1OJL A;  4BE1 A;  5EEH A;  3WTY C;  1FBS A;  2M30 A;  1SVO A;  3HIF A;  3MN2 A;  2KQR A;  3BZK A;  4HX7 A;  1W7P B;  3ZGK A;  2NRA C;  2OA4 A;  3H36 A;  3OYG A;  2K9Q A;  5E8G A;  3V8J A;  3LSR A;  2EIJ H;  2RRE A;  1MBH A;  2XGC A;  3DU6 A;  1RES A;  4XON A;  3CTA A;  1D0Y A;  2F4I A;  2O3F A;  4XRS G;  2PN6 A;  4MLO A;  3RYR A;  1V5E A;  2JUC A;  3K2A A;  2LBF B;  1A04 A;  1W5S A;  3VYR B;  1SD7 A;  2AS5 F;  1UB9 A;  1O3S A;  4EGY A;  2DFI A;  5DM6 F;  1R4M B;  3K6G A;  3GO5 A;  5KAI C;  4LK1 F;  2EZI A;  2HDW A;  4I2O A;  3KP2 A;  3OYB A;  3ASN H;  1R7J A;  3PQK A;  1GXP A;  3ESW B;  1ORK A;  2Z16 A;  4XLF A;  4BGD A;  5L3C A;  3FXQ A;  2STW A;  2CMP A;  2F5C A;  4BY7 J;  3ISP A;  4EEF G;  4BXX J;  2FU4 A;  3K4N A;  4NQW A;  1XDU A;  2OU2 A;  2QYO A;  1WVR A;  3SDG A;  1F1Z A;  2HGC A;  3LSJ A;  1A36 A;  2QEN A;  2I5U A;  3QYE A;  4BEH B;  1NTC A;  3I4M J;  5LGN A;  4DW6 A;  5A2Q K;  4XKV A;  1PP7 U;  3CCM I;  5E79 C;  4X0G A;  2K4B A;  1J75 A;  2O6G E;  4ENM A;  1IRG A;  1N25 A;  1D1B A;  3IWF A;  4AYB A;  1HDD C;  4BE0 A;  5IT9 Z;  2NNN A;  1YJW I;  1RC9 A;  1XG1 A;  1FNN A;  2BW3 B;  2ZJ2 A;  1B4A A;  5AIP A;  3JRF A;  1K61 A;  2JJ7 A;  4PGH A;  2KL4 A;  1ZR4 A;  2VLA A;  2XAQ A;  1BC8 C;  1T6S A;  4DZP A;  4KN7 X;  5HDK A;  1DPR A;  2LTP A;  3K9T A;  4LB5 A;  3ONQ A;  4CCO A;  3AKZ A;  1LDD A;  3SHF A;  1EA3 A;  3KZZ A;  5HOD A;  1CGP A;  2BGC A;  1D0Z A;  2AHQ A;  4OIN F;  1YTY A; 
#chains in the Genus database with same CATH homology
 5F64 A;  3O2P E;  1K78 B;  1FYK A;  2HWV A;  4IVN A;  5E20 A;  4RB0 A;  3CLO A;  4AIJ A;  5LBQ A;  1BI0 A;  1V4R A;  5K1Y A;  4Y13 A;  5E18 F;  2MLG A;  2FBI A;  1CF7 A;  5FD5 A;  3ZQ7 A;  3F8F A;  5LRS A;  1JHF A;  4ETS A;  3R0A A;  5D5X B;  1MJ9 A;  4EV0 A;  5E17 F;  3P7N A;  1ZG5 A;  4EQQ A;  2LKP A;  1QO0 D;  5L3G A;  1YW7 A;  2GA1 A;  3I54 A;  3HRM A;  4UVB A;  2Z33 A;  3VB2 A;  5DCF A;  1T39 A;  1J2X A;  4ESJ A;  2EA4 A;  3CJN A;  2EFO A;  3CUQ A;  3E5Q A;  5FGM A;  1I1S A;  4JK1 X;  3NQO A;  4BQA A;  4ESF A;  4KIF A;  4LD5 A;  4LFU A;  3VOD A;  2WWY A;  1WKM A;  4WCG A;  2W85 A;  2L02 A;  4MHG A;  3I58 A;  1XGN A;  3IRQ A;  4HF2 A;  3DXJ F;  4HAM A;  1ODD A;  4B09 A;  3KEQ A;  1KGS A;  2FEZ A;  2OZ6 A;  1FBQ A;  1ZAO A;  5DUI A;  4EJT A;  4I0A A;  5FLX K;  1KA8 A;  2ESH A;  1U5T A;  3FF5 A;  4ENN A;  5ICG A;  3F6V A;  1HKQ A;  3WTV C;  1FYM A;  5HOO A;  3FM5 A;  4BHP A;  2Y75 A;  4ZH4 F;  5BPI A;  4HX4 A;  5K5R A;  1BOA A;  3V7C A;  2V1D A;  3V4G A;  2HR3 A;  2HQR A;  3IKV A;  4WXC A;  3K69 A;  3N97 A;  2XKP A;  3M8E A;  4A2U A;  2BYV E;  2H6B A;  5L3D A;  4HQM A;  4KFC A;  1YQA A;  5L3B A;  3JSO A;  2PMH A;  2VE9 A;  5KVR A;  3U1D A;  3CO6 C;  2DK8 A;  2ISZ A;  4RGU A;  5E1Z B;  3MWM A;  2OBP A;  1H9T A;  3WE2 A;  3T5X A;  2ETH A;  3BWG A;  4M71 A;  4OU0 A;  3MCZ A;  1T2K A;  2FE3 A;  2RVC A;  4M72 A;  4ZZD A;  3AAF A;  4BHC A;  1IN8 A;  3GVA A;  1EV7 A;  1FX7 A;  2M5W A;  2XAS A;  1QBJ A;  5CVV A;  4G7Z F;  1HW5 A;  1R5H A;  2P5V A;  4M9S A;  3I64 A;  1IRF A;  3E5X A;  4BNC A;  2YR2 A;  4XLP F;  1KQ9 A;  1R23 A;  3F23 A;  3H3U A;  5AON A;  2GXB A;  1ULY A;  1OPC A;  3GFM A;  4ZYE A;  2K27 A;  2O8X A;  3RYP A;  3GF2 A;  3EYI A;  4XSX F;  3FMR A;  4RGS A;  3KLO A;  3ZMZ A;  4Q48 A;  3I59 B;  2EFQ A;  2DBB A;  3EQL F;  1LEA A;  3KLN A;  5L3F A;  2IP2 A;  2CSO A;  4ESB A;  1BIA A;  4HX8 A;  2KRF A;  1FSH A;  2FA5 A;  3JAM K;  4OIR F;  1YG2 A;  3HTU A;  4LLG F;  4BAY A;  2DT5 A;  2FSW A;  1SD6 A;  2HZT A;  4UHT A;  2XKO A;  3BJO A;  4YFX F;  5J8C A;  1DP7 P;  3P9K A;  1IXR C;  1EH6 A;  2P5K A;  2HTS A;  3T8T A;  1H0M A;  3V7S A;  4RB1 A;  3ZMT A;  2DAO A;  2ZKZ A;  2RGV A;  5ICE A;  2RDP A;  3GFL A;  1SFX A;  3MFK A;  1QGP A;  1HKS A;  3HRS A;  2A6E F;  3QPH A;  5K5O A;  2QWW A;  4A12 A;  1ZAR A;  2QQ9 A;  2FMY A;  2Q0O A;  3RKW A;  1Z7U A;  4QLC U;  3B02 A;  1E17 A;  1OKR A;  4ZZL A;  4FX4 A;  2GIV A;  2K02 A;  4UNO A;  1D8J A;  2ISY A;  3F8C A;  4P9F A;  5BPD A;  6PAX A;  3LA3 A;  3V8K A;  3D0S A;  5JI6 A;  1SFE A;  4HBL A;  2FOK A;  3K1M A;  3WTX C;  4S04 A;  3ELK A;  3OOP A;  3WTW C;  1O57 A;  4IPA A;  2K86 A;  3BP8 A;  4BHB A;  5LEJ A;  2A68 F;  1XMK A;  1OYW A;  3G3Z A;  3J7A O;  1WWX A;  5D5V B;  4LG0 A;  2E7X A;  5ICF A;  1HQC A;  2LSO A;  5E8I A;  3ZMV A;  3J80 Z;  2L4A A;  1Z9C A;  2ELH A;  3TO9 A;  5J8F A;  3ECH A;  1MDM A;  1E2X A;  3EET A;  2XVC A;  2GQQ A;  4G6Q A;  1STZ A;  2XIG A;  1KQ0 A;  2L54 A;  1UCR A;  4UUV A;  2MC3 A;  1YIO A;  4D0P A;  2LNB A;  4LJZ F;  2IPQ X;  1RZ4 A;  4ASN A;  2OQG A;  2M1B A;  2EJR A;  1TQM A;  2RV8 A;  3GUD A;  1Y0U A;  1XD7 A;  5CLS A;  4RAZ A;  1CF7 B;  2HFH A;  4KIG A;  3ZMD A;  2HKX A;  3VOE A;  3REO A;  5JFR A;  4CO8 A;  1YW9 A;  3F22 A;  1H9G A;  2E1N A;  2FXA A;  4M73 A;  3FHZ A;  1IN6 A;  2KJC A;  1R1V A;  3KP4 A;  2COM A;  3DF8 A;  4FT8 A;  2FQ3 A;  2BBY A;  4N9H A;  4I0B A;  2R3S A;  3J81 K;  5HLH A;  1BI1 A;  3RPQ A;  2CWE A;  2QQA A;  4CHU A;  4Q5S F;  2JT1 A;  1ZRC A;  1YLF A;  2CFX A;  1USS A;  1O3T A;  3HOT A;  1U2W A;  2GZW A;  2RKH A;  1K79 A;  2XAF A;  2MD5 A;  3LWF A;  2QUF A;  1R1U A;  1UST A;  1REP C;  3R4K A;  5DUK A;  2A3S A;  3EYY A;  1F5T A;  3RDI A;  1XSV A;  1Q1H A;  2O0Y A;  3GZ6 A;  5HLI A;  3E97 A;  2EV0 A;  2LF7 A;  4L9T A;  2XAJ A;  5DEQ A;  2YPR A;  3C7J A;  1Z6R A;  4IHS A;  2Z9O A;  2GAU A;  2RN7 A;  1WQ2 A;  2P8T A;  4I02 A;  1OR7 A;  4KA4 A;  4YG2 F;  2UXX A;  5HVQ C;  4RB3 C;  2L01 A;  3IRR A;  5DD8 A;  1HW2 A;  2ZO4 A;  1ZRE A;  1SFU A;  4EGZ A;  1FBU A;  1ZH5 A;  5JHU A;  2QLZ A;  3Q5F A;  3I53 A;  1HBX G;  3J80 K;  3O3K A;  2STT A;  1TNS A;  4ZYD A;  2AXL A;  1R36 A;  2DK5 A;  3K0L A;  3RKY A;  3TOB A;  3VEP A;  5TJJ A;  2V79 A;  2VBX A;  5D4S A;  1FP1 D;  1EH8 A;  3LA7 A;  3I4P A;  1BN5 A;  4HW0 A;  3ECO A;  1B6A A;  2H27 A;  3JTG A;  2HYG D;  1O7L A;  5BS6 A;  4HF1 A;  1I27 A;  4A0X A;  4L5I A;  3SFZ A;  1BIB A;  4ENK A;  2ZNY A;  1TQP A;  3FX3 A;  4LK0 F;  4OOI A;  2X0L A;  2DQL A;  3MZH A;  4JBA A;  2KIM A;  5JVT A;  1XCV A;  1ZGA A;  3I5U A;  1P4A A;  2IVM A;  1LDJ A;  4I01 A;  5DCM B;  2V9V A;  1FWZ A;  1W7P A;  1XB4 A;  1B59 A;  2VON A;  1L3L A;  1U8R A;  4WWC A;  2D1V A;  5LEK A;  5D5W B;  5HDN A;  2EV5 A;  2M87 A;  2FRH A;  4A0Y A;  2EB7 A;  3RI4 A;  1P2F A;  3ERE D;  2PFB A;  3DV8 A;  4EJV A;  3BZ6 A;  2XHK A;  4GYI A;  4CDG A;  1AWC A;  1B9M A;  3W6J B;  4G7H F;  4KT5 C;  3U2R A;  4L5J A;  3M9A A;  1BJA A;  2QM3 A;  3P9I A;  2LF8 A;  2JPB A;  1Z6T A;  4FHT A;  1KYW A;  4JQF A;  4PDK A;  4AD9 A;  5D5U B;  1IZ1 A;  3IC7 A;  5BMZ A;  1J9I A;  2G7H A;  3HHH A;  4A6D A;  1SMT A;  5FO5 A;  3QOP A;  3P9C A;  5LHI A;  1IUY A;  3R61 A;  2HQN A;  2EFN A;  1K78 A;  2QBY B;  5IT9 K;  5HS8 A;  2NAZ A;  1QNT A;  4ENJ A;  3MZY A;  3GZ5 A;  5TRD A;  3DP7 A;  5LRR A;  3D5L A;  5FFX A;  4YFK F;  1R5G A;  5H20 A;  2GWR A;  2CG4 A;  4A5N A;  3JW4 A;  1ZHF A;  3HYI A;  2HS5 A;  1TW3 A;  3HSR A;  2M45 A;  1ON2 A;  1T98 A;  2ZFW A;  4HF0 A;  2Z99 A;  4PGG A;  4XSZ F;  4G6D A;  1ZG3 A;  3SQN A;  2HDC A;  2VE8 A;  2JZY A;  4I09 A;  4UV8 A;  4U0V A;  3ZMS A;  3JSP A;  2DTR A;  1OYY A;  4B8X A;  3E6D A;  4IF4 A;  4AVP A;  2XUB A;  1KYZ A;  4KUM A;  4NHJ A;  3E6M A;  2ZME B;  4I7H A;  1UHM A;  2RQP A;  4MGR A;  4EM0 B;  2XAG A;  2PBI A;  5LGT A;  2VC1 A;  1YS6 A;  4RGX A;  1FY7 A;  2OQR A;  2CGP A;  3GXO A;  1LDK B;  1MD0 A;  4EVI A;  2F2E A;  5FB2 A;  1WI9 A;  5ILS A;  3ZN1 A;  4R8H A;  1IF1 A;  2XRO A;  1TW2 A;  1G3T A;  4EJU A;  2PQ8 A;  5HDG A;  3B73 A;  1FP2 A;  2IRF G;  3E6B A;  3RTR A;  2E7W A;  4LLL A;  3IL2 A;  3CDH A;  5AIQ A;  1FZP B;  4GO1 A;  1J5Y A;  1S29 A;  3R0J A;  1JE8 A;  1WSU A;  3GEZ A;  4HZF A;  4GYG A;  3TKY A;  2VBZ A;  5CYV A;  5CVU A;  4Q47 A;  3HTS B;  5FFZ A;  2NS0 A;  3HUG A;  3F8M A;  3ZMU A;  1HSJ A;  3M8F A;  4G94 A;  2DPD A;  4LMY A;  1QPM A;  1U5T C;  4IJA A;  4MQV A;  3BDD A;  1OMI A;  1XGO A;  2R7D A;  4HQE A;  1LVA A;  1S7O A;  1K7A A;  1DDN A;  2Y48 A;  3F72 A;  4HV5 A;  4WF2 A;  1IN5 A;  2DW4 A;  3FM3 A;  2JTV A;  3E3V A;  3QPT A;  1TBX A;  4EM2 A;  1OYI A;  4YFN F;  4IRH A;  1BI2 A;  2KJB A;  1J0R A;  2OD5 A;  5H6Q A;  3ZPL A;  4NB5 A;  1IXS B;  2BE5 F;  3KET A;  3DKW A;  2EWN A;  1L0O C;  3QP5 A;  4OIO F;  1R00 A;  1JHH A;  4U7B A;  3OV8 A;  1HW1 A;  1YYV A;  3T8R A;  5A2Q Z;  3K1N A;  1KU3 A;  2CW0 F;  2YU3 A;  2X4H A;  3C3W A;  4RB2 C;  2WV0 A;  4HYE A;  3WTT C;  4KN4 X;  4KMF A;  1ZRF A;  4MEY F;  1FT9 A;  1RIO H;  2A69 F;  3F8B A;  4CXF A;  4P55 A;  3IHU A;  4LGW A;  5HS7 A;  1EH7 A;  2ZXJ A;  3S2W A;  2D1H A;  4WX9 A;  1I5Z A;  1SMY F;  4KNY A;  2W24 A;  3E5U A;  5CVI A;  2LDU A;  3DQV C;  2VOP A;  3VFZ A;  2D45 A;  3BRO A;  1SD4 A;  1F9N A;  2ESN A;  3I59 A;  1G6N A;  1UHW A;  4M6Y A;  5K5Q A;  1XGM A;  4Z2Y A;  4UXN A;  5LLQ A;  3BPV A;  3U9G A;  2DI3 A;  4XBF A;  5FD6 A;  1NHA A;  5ILV A;  2Z5U A;  2EA2 A;  2A6H F;  5ICC A;  4L0Y B;  1R22 A;  2A61 A;  2QQB A;  3WU1 B;  4P96 A;  4KMU X;  4UVA A;  5EEG A;  2H09 A;  3KP5 A;  2VT3 A;  3PQJ A;  3EUH A;  5H6R A;  4KIC A;  1P92 A;  1B9N A;  3F6O A;  2A5Y B;  2E1C A;  3DEU A;  3T0Y A;  4O6J A;  3MQ0 A;  1UFM A;  2W57 A;  2RNJ A;  1T38 A;  3T1B A;  2DU9 A;  2DPU A;  2QZ8 A;  1W4M A;  4M9Z A;  4F7Z A;  4UV9 A;  4N9I A;  2K4J A;  4IXA A;  4HDV A;  3NEU A;  3CUQ B;  3FXR A;  5DDG A;  1BBY A;  3LAP A;  5ERI A;  4FX0 A;  2JPC A;  3M1E A;  1LEB A;  2VXZ A;  3O6B B;  3TDZ C;  3HRU A;  1LNW A;  4I98 B;  1PDN C;  1TTY A;  2IJL A;  5J6X A;  4L0Z B;  3KEO A;  1F4K A;  1WRJ A;  2Q8K A;  2CQK A;  1Z91 A;  3ULQ B;  2Q2E A;  2PG4 A;  3Q9S A;  3LFK A;  3PFI A;  2O03 A;  2IA2 A;  2IA1 A;  2R7F A;  3M7G A;  4KDP A;  2YX4 A;  3N4M A;  1U5T B;  3GLX A;  4HA8 A;  5D8L B;  2PEX A;  2PLY A;  3BPX A;  3TDU C;  3WGH A;  4U0Y A;  1J59 A;  2IT0 A;  1KU2 A;  3HOS A;  3I0T A;  1I1G A;  3WE3 A;  1JXS A;  2RC4 A;  5BQT A;  4A5M A;  4AWX B;  2P7C B;  4K2E A;  1LB2 A;  1FC3 A;  2JRT A;  3GFJ A;  5HS9 A;  5LHG A;  3RJP A;  3CO7 C;  3KZY A;  3F8N A;  4CIC A;  2MH2 A;  4DNC A;  3H92 A;  4G7O F;  2PMU A;  3COA C;  1FOK A;  2BEO A;  3IKT A;  1ZN2 A;  3DPL C;  1O7F A;  3Q9V A;  1FSE A;  2ZNZ A;  3SZP A;  1O3R A;  4OIP F;  1ON1 A;  1C0W A;  1W7P D;  3ROU A;  2J5P A;  1AOY A;  1X3U A;  2F5D A;  2FNA A;  1VTN C;  3QRF F;  1SD5 A;  3FZV A;  2DLL A;  3R6S A;  1D3Y A;  4YIF A;  3I71 A;  4LLN A;  2MH9 A;  3MAJ A;  5LHH A;  4EJW A;  3SXY A;  4L9V A;  2HKO A;  1DPU A;  4RS8 A;  1MJB A;  4M6X A;  3LQQ A;  4EM1 A;  1IN4 A;  2L3D A;  1ZLJ A;  1D5V A;  3W6K B;  1IAW A;  4N0B A;  5DV5 A;  1QQI A;  3ZP5 A;  2UXN A;  2NNY A;  3FMQ A;  1SAX A;  4YII A;  1GVJ A;  3L00 A;  3GWZ A;  1D8K A;  1GXQ A;  4IRG A;  5CVR A;  3JAM Z;  4AIK A;  4WXH A;  1BM9 A;  1MGT A;  2WC2 A;  1P4W A;  1RNL A;  2EV6 A;  4IRI A;  1PUE E;  1HXD A;  1S8N A;  2DQR A;  2XAH A;  4DQ2 A;  2ADU A;  5ILU A;  1XN7 A;  3FXU A;  5D6F A;  2G7U A;  4MNU A;  1IXC A;  1IN7 A;  1RI7 A;  3KP3 A;  4MQ9 F;  4H0E A;  3QU6 A;  5E1W A;  4GXO A;  1G3S A;  3LST A;  4TV7 A;  3DPT A;  3G73 A;  4IHT A;  3QP6 A;  1GHC A;  2F5F A;  4MTD A;  4A0Z A;  4KIB A;  4HLX A;  1PP8 F;  3L7W A;  4HOB A;  2VOO A;  2F5E A;  3HSE A;  4XRF A;  1MZB A;  1O3Q A;  2EK5 A;  2OAZ A;  3IWZ A;  3TO7 A;  1U6G A;  1Z05 A;  4O5V A;  2W84 A;  2KIU A;  2ZCW A;  1BC7 C;  5LGU A;  5CJ9 A;  3TO6 A;  1B1B A;  5DD4 A;  1YFH A;  4EMS A;  4PZJ A;  5DYM A;  3EDP A;  4OIQ F;  4RGR A;  2HOE A;  4L18 B;  4M9X A;  4LB6 B;  3WU0 A;  2HTJ A;  1IW7 F;  2YSR A;  5L3E A;  4PCQ A;  4U7D A;  3WG9 A;  5E1X A;  3WOD F;  1G4D A;  4Q4Z F;  2VN2 A;  3JTH A;  4GCV A;  1BI3 A;  2Y0M A;  2GA2 A;  2VBW A;  3KE2 A;  3RKX A;  2FBH A;  3BJ6 A;  4R79 A;  1TNT A;  2IA0 A;  1KQ8 A;  3WTZ A;  3K2Z A;  3KP7 A;  4G9Y A;  4L9J A;  4LG0 B;  1G3Y A;  4A6E A;  2CO5 A;  1ZG1 A;  4OMZ A;  3LQR A;  3FMS A;  3QU3 A;  1MJA A;  1XMA A;  3R60 A;  4XLN F;  5BOX A;  1YO5 C;  4BXU A;  4UVC A;  2YX7 A;  2NYX A;  4OMY A;  3V8L A;  2OZU A;  5JR3 A;  3SZT A;  2MBF A;  1MDM B;  3L09 A;  2CYY A;  4GGG A;  3CUQ C;  3H3Z A;  5D6E A;  3WGI A;  1LJ9 A;  1TLH B;  1I6X A;  5DCM A;  4AIH A;  4P5O A;  4CGZ A;  3ZN0 A;  3KP6 A;  2VC0 A;  2K7L A;  2J5O A;  1MKM A;  2UWM A;  1S7A A;  1XDS A;  3WTS C;  3ABT A;  2P6S A;  2P4W A;  2WTE A;  3L9F A;  1W5T A;  1XCB A;  1KU9 A;  4G8X A;  4WK8 F;  3DFG A;  1P6R A;  2V1X A;  3C1D A;  3GW2 A;  1HST A;  3QAH A;  2H6C A;  2IW5 A;  2M8E A;  4M74 A;  1S6L A;  1LQ1 A;  1S3J A;  2QVO A;  1J7K A;  3J81 Z;  1ONV A;  4E70 A;  4BYY A;  2L4M A;  2XGX A;  2EFW A;  2JSC A;  2XRN A;  4P9U A;  1HKT A;  4KYW A;  2HEO A;  5CVJ A;  2VT2 A;  3BOQ A;  1TQI A;  5F1R A;  1U3E M;  2QBY A;  3GYH X;  2DO7 A;  2EFP A;  4HLY A;  1XSD A;  3BY6 A;  2MLK A;  1Z1D A;  5HLG A;  1FLI A;  3TGN A;  1ZRD A;  4Y17 A;  2GXG A;  2H94 A;  3RIR A;  2UZK A;  4MEX F;  1YS7 A;  1V3F A;  1XGS A;  4U0W A;  1FPQ A;  4CYD A;  2MA3 A;  2TDX A;  1G3W A;  3RPU A;  2Z3Y A;  4ZYH A;  4CZZ A;  4S05 A;  2O61 A;  2FF4 A;  2ZME A;  2FML A;  2V6C A;  4U88 A;  3K1P A;  5D8K B;  2VOD A;  3E6C C;  2BV6 A;  1U78 A;  5ED4 A;  3BJA A;  4QWQ A;  3WTU C;  4EJO A;  5KK1 A;  1DUX C;  3LAJ A;  4HV6 A;  3KCC A;  2KIF A;  2G9W A;  3HHG A;  4RAY A;  2A07 F;  4ZYG A;  4O3M A;  1RUO A;  2W25 A;  1R58 A;  5D4R A;  1QZY A;  2B0L A;  1RUN A;  1R1T A;  2D2W A;  2C6Y A;  1P4X A;  4ON0 A;  3WGG A;  1YW8 A;  4MTE A;  3NRV A;  2FBK A;  3F21 A;  2P5L C;  3LA2 A;  4Y15 A;  3TQN A;  5IT3 A;  2KKO A;  2P7V B;  1KU7 A;  3KFW X;  1XSX A;  4HDU A;  1ZYR F;  2PJP A;  3FWE A;  3HSF A;  1ZLK A;  2PI0 A;  2ACJ A;  3V7R A;  4BH9 A;  3C18 A;  3ML6 A;  3ABU A;  3HRT A;  1K6O A;  2VBY A;  2FNP A;  3GX4 X;  1ZGJ A;  1T0F A;  5F6F A;  3F3X A;  4R1H A;  4WXD A;  1FYL A;  3MEX A;  2XV4 S;  2ZBK A;  1QZZ A;  2V1U A;  4L9N A;  5FLX Z;  1JGS A;  2P6T A;  3L2C A;  2HYF A;  3CUO A;  3GFI A;  3TOA A;  5EEH A;  3WTY C;  1FBS A;  2M30 A;  3HIF A;  4HX7 A;  1W7P B;  2NRA C;  2OA4 A;  5E8G A;  3V8J A;  3CTA A;  2O3F A;  2PN6 A;  3RYR A;  1A04 A;  1W5S A;  1SD7 A;  2AS5 F;  1UB9 A;  1O3S A;  4EGY A;  2DFI A;  3GO5 A;  4LK1 F;  4I2O A;  3KP2 A;  1R7J A;  3PQK A;  1GXP A;  2STW A;  5L3C A;  3FXQ A;  2F5C A;  3ISP A;  2FU4 A;  4NQW A;  1XDU A;  2OU2 A;  2QYO A;  1F1Z A;  2HGC A;  2QEN A;  5LGN A;  5A2Q K;  1PP7 U;  2K4B A;  1J75 A;  2O6G E;  4ENM A;  1IRG A;  3IWF A;  5IT9 Z;  2NNN A;  2ZJ2 A;  1FNN A;  1B4A A;  5AIP A;  4PGH A;  2XAQ A;  1BC8 C;  1T6S A;  4KN7 X;  5HDK A;  1DPR A;  3K9T A;  4LB5 A;  1LDD A;  3SHF A;  3KZZ A;  1CGP A;  2BGC A;  4OIN F;  1YTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...