3H92A

The crystal structure of one domain of the protein with unknown function from methanocaldococcus jannaschii
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
ETKLEEERNHLEELLEKVEEDYEGINYDEVLEALKLFKDNYELPKSKIKRKIRIFLIKENILFLNPQKGTLKPQSYLVWNAIKRML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized ATP-binding protein MJECL15
publication title The crystal structure of one domain of the protein with unknown function from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2009-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3h92A00
4B09A 3U9GA 2FSWA 4HQMA 3IC7A 1QZZA 1C0WA 1DPRA 1IN6A 5JFRA 1W5TA 2XHKA 1T0FA 2HGCA 1R58A 4RB0A 4AIJA 5DCFA 3WGGA 1U5TB 2KRFA 1S7OA 3V8JA 3ISPA 2EFOA 2OQRA 1LEAA 1XMAA 2RDPA 3HRTA 5HS7A 1HXDA 3HRMA 2FBIA 3KCCA 3AAFA 1OMIA 2FA5A 2KJCA 4PGHA 2DT5A 4YFNF 3WTSC 4ETSA 2P5VA 2YR2A 3LAJA 1T98A 1O3RA 1IUYA 4A2UA 2OZUA 1G3TA 1IN4A 3RDIA 5BPIA 3ZPLA 5H20A 3RPUA 3WGIA 3KP3A 4OIPF 3HHHA 2NNNA 1RNLA 3QOPA 1KU3A 5JHUA 3VOEA 4KA4A 5FB2A 2CQKA 2BEOA 5L3DA 1PUEE 2EK5A 4HLYA 2XKOA 3ROUA 2LF7A 1BI0A 3IWZA 3WODF 1QBJA 3LQRA 3M1EA 3ECHA 1R7JA 4QWQA 4N9HA 1IN8A 1OKRA 2L4MA 5EEGA 2JSCA 4RB2C 3EETA 2PMUA 5LHHA 2ZMEA 1I27A 1XN7A 5FLXZ 1U78A 2L02A 3Q9SA 1UB9A 3CUQC 2FQ3A 4IXAA 3GF2A 1ZLKA 2QENA 1ZRFA 1U2WA 2COMA 4WF2A 2O3FA 3KZYA 5FFZA 4L5IA 5E18F 1J59A 2Y0MA 4KUMA 1W4MA 1Z91A 4CICA 3H3UA 4MNUA 2EV0A 4RAYA 4XSZF 4HX7A 2H27A 2O6GE 1F5TA 3ML6A 2V1XA 2X0LA 1CGPA 4L9TA 1YG2A 5HS8A 1IAWA 3TQNA 4LGWA 4ZYEA 4YG2F 1USSA 5E1WA 1O7LA 1ZGJA 1QQIA 4ASNA 2V1UA 2P8TA 2QVOA 5D4SA 3F6VA 3P9KA 2TDXA 4KN7X 2A68F 1MZBA 3FXQA 4I0BA 3RKXA 1XGMA 2VN2A 1OYYA 1FP1D 1BI1A 2Z9OA 2FBKA 2K27A 4R79A 3REOA 3F8CA 3Q9VA 2DU9A 4GO1A 1I5ZA 4HF2A 2ESNA 2VBZA 3T1BA 3VB2A 1KU2A 1OR7A 4BAYA 4U7BA 2VBXA 5LBQA 1D5VA 2GXBA 3M9AA 1XGNA 1R5HA 5E20A 1OPCA 1CF7A 2XAGA 1L3LA 2KJBA 4H0EA 5JI6A 3R60A 5D8LB 2MLGA 1XDSA 2VBWA 3WGHA 4P5OA 2EV6A 4IRGA 3TO9A 2RN7A 3L09A 5AONA 5J6XA 1T38A 2PJPA 1T39A 2STWA 1ZH5A 6PAXA 2P5LC 4MHGA 5KVRA 3RJPA 4I02A 4EJVA 4PDKA 1G3WA 4U0VA 5DD4A 3KP6A 3HSFA 1MKMA 2A6HF 2M30A 3LQQA 1TLHB 4RGRA 4OMYA 3BPXA 3H3ZA 1O3QA 5FD6A 1Z05A 1OYIA 2KKOA 5IT9Z 3RTRA 3SFZA 1B59A 4EVIA 1WI9A 1D8JA 3IKVA 3WG9A 3KLOA 5ICGA 3O3KA 1YTYA 2GXGA 5K5OA 5LHGA 1S6LA 3MZYA 1K79A 5D4RA 3WU1B 3SZTA 4NHJA 3O6BB 5ED4A 4EV0A 1ONVA 2OBPA 3IKTA 1TNTA 4Z2YA 4KT5C 4KMFA 3GZ6A 1RIOH 4LK1F 2L3DA 2GA2A 2D1HA 3F72A 4D0PA 3T5XA 3ZMDA 3W6JB 2H94A 1JHHA 1IXRC 2M87A 2EV5A 2PFBA 3E5UA 1O3SA 2F5FA 1BIBA 1WWXA 4TV7A 1BIAA 1IF1A 2P6TA 2O0YA 4AVPA 2AXLA 4M72A 4BXUA 2DBBA 4U7DA 1O7FA 1HBXG 4R1HA 1ON1A 2HS5A 1V3FA 5DEQA 4ESFA 4ENJA 1ZG1A 3SHFA 2B0LA 4LJZF 2R7FA 3P7NA 3FXRA 1TBXA 1XSXA 2DFIA 3JSOA 1FY7A 2FXAA 1YLFA 5TRDA 1HQCA 5HLHA 2W85A 1BC8C 4KICA 1YFHA 4MQ9F 1EV7A 4YIFA 2PBIA 4LLGF 4KMUX 4M71A 3J7AO 1MGTA 2ZO4A 3L2CA 1ULYA 4AD9A 4IPAA 4U0YA 3R4KA 3GYHX 4YIIA 3MQ0A 4NB5A 2QBYB 2OD5A 1FC3A 1IRGA 3I5UA 4Y13A 2DQLA 1KYZA 3BOQA 2ISZA 1J75A 2EWNA 1FYKA 3JAMZ 5D6EA 3VEPA 4MGRA 4UNOA 2DK8A 3PQKA 3ECOA 3MFKA 1GXQA 2BGCA 3PFIA 3I58A 4L9NA 3HSRA 1XMKA 2K02A 4M9SA 4GYGA 3R0AA 2A3SA 5LGTA 5BOXA 3N4MA 5E8IA 1F4KA 1LVAA 2QBYA 2HYFA 1D3YA 1ON2A 4ZZLA 1ZGAA 2OQGA 1K78A 5H6RA 1UCRA 2D45A 3CUQA 4GYIA 2DTRA 3LAPA 2Z3YA 3C3WA 4HA8A 1O57A 5HLIA 3N97A 2V1DA 3ZMZA 3FHZA 2XKPA 2HR3A 5FO5A 3GWZA 1MJAA 1B9NA 1Z6TA 1LDDA 3MCZA 1FZPB 2OU2A 3K1NA 4L0YB 2DPDA 2VC0A 2UZKA 5JR3A 2JTVA 2EJRA 4BQAA 2CYYA 3RYPA 1VTNC 2E7WA 3V4GA 4K2EA 1IW7F 2EA2A 3G3ZA 2DW4A 4F7ZA 4CZZA 5DYMA 2A6EF 5LGUA 4YFKF 1YW8A 3FMQA 4ON0A 3E6MA 1FBSA 1NHAA 2XV4S 4N9IA 2W25A 1KU9A 4A0ZA 3RI4A 3MZHA 2UXNA 4EQQA 4HV6A 2Z33A 2EFQA 2RGVA 4UVCA 3CO6C 3LWFA 2CWEA 1R00A 5L3FA 4JBAA 2CO5A 5E8GA 5LGNA 2DK5A 3RYRA 5LRSA 3EUHA 3LFKA 2RQPA 4UXNA 1USTA 4ZH4F 4A6DA 3FM5A 1XCBA 4XLPF 2Z5UA 3HOTA 1FT9A 3GX4X 2EFPA 3F8BA 3TDZC 4M74A 4WXCA 1SD7A 1XB4A 5ILSA 2YX4A 4R8HA 4BYYA 4L0ZB 2OZ6A 4BHCA 5ICCA 1FOKA 1I1GA 2Q8KA 4Y17A 2ZMEB 5TJJA 1DPUA 2H6CA 3J80K 3K69A 3V7SA 1R1TA 4OU0A 1O3TA 1U3EM 3R61A 1P4XA 2KIFA 4HF0A 3O2PE 1SMTA 4Q48A 5FFXA 1FLIA 2EFWA 4CDGA 2F5DA 3K0LA 5A2QK 2ZJ2A 3EYYA 2NNYA 4CXFA 1RI7A 3QRFF 2HZTA 2PI0A 3QPTA 5AIPA 2J5OA 2NRAC 5E1ZB 1XSDA 2HKXA 3T8RA 5IT3A 2NS0A 4WK8F 2F5EA 4AIHA 2LKPA 2JT1A 2R3SA 3QU3A 1J7KA 3M8FA 5DUKA 1FSHA 1P2FA 3FM3A 3BWGA 1P4AA 2GA1A 3FMRA 2PMHA 2FF4A 1EH7A 4OIOF 2XASA 2YX7A 5CVJA 1D8KA 5AIQA 4KN4X 3KP5A 1L0OC 3IWFA 5FD5A 5HDKA 1PDNC 3QAHA 4OIRF 1H9GA 3JTGA 2FEZA 4RGXA 1RZ4A 4LLLA 4GCVA 2XUBA 2QUFA 4A0YA 2GIVA 3ABTA 2QQBA 3WE2A 4HX8A 1LQ1A 1IN5A 2LNBA 3FZVA 4I2OA 2BYVE 3WTUC 4FHTA 4G94A 2G7HA 1BOAA 1CF7B 2PN6A 2HWVA 1LB2A 1H9TA 2QWWA 2H6BA 1WQ2A 1Q1HA 4CO8A 3SXYA 4CGZA 3TO6A 2BBYA 3COAC 3GFJA 2ADUA 2HTSA 1HW1A 2GZWA 3ZMUA 1XGOA 3IHUA 1W7PA 3CLOA 4ZZDA 3ZN0A 3ZN1A 2IW5A 2IT0A 4L9JA 1KQ9A 2XAQA 3FF5A 2W24A 3TOBA 4P55A 1MJ9A 4HAMA 1R23A 4HV5A 2R7DA 3EYIA 4O6JA 1J5YA 3LSTA 3K9TA 1JE8A 4AIKA 2DQRA 4KFCA 4HF1A 2YSRA 2VE9A 5K5RA 4Q4ZF 3ZMVA 1DDNA 2FMYA 1TW2A 2V9VA 2XVCA 2FU4A 3KETA 2LSOA 3F21A 1FBUA 2FRHA 3OOPA 2NYXA 2FNPA 3BPVA 4EJTA 4HBLA 4PGGA 1UHWA 2NAZA 2QM3A 2EFNA 1U5TC 1BM9A 2CW0F 1SFXA 2E7XA 2QQAA 1KGSA 4DNCA 4I98B 3V8LA 5CVIA 5BS6A 4NQWA 1HKSA 1MD0A 1LDKB 2L54A 1A04A 4E70A 2ZNZA 2K4BA 2C6YA 2IRFG 4RGSA 1YS6A 3U1DA 3FXUA 3I53A 2EB7A 4WXDA 1Z1DA 4Y15A 2M8EA 3LA2A 3ZP5A 4A0XA 1JXSA 4A5MA 4EGYA 3WE3A 2XAJA 1TQPA 3E5QA 4FT8A 3K1PA 3DQVC 1B4AA 3GO5A 3JSPA 3F3XA 4PCQA 3V7RA 3HYIA 4BHPA 4OINF 5BMZA 2P7CB 2YU3A 3F22A 4P96A 1JHFA 5CJ9A 2ZCWA 3OV8A 1SD4A 4MTEA 2STTA 1ZARA 3HUGA 2CGPA 2HEOA 3F23A 1STZA 2A69F 1SFUA 2HFHA 1B9MA 3I54A 1SD5A 3J80Z 5LLQA 2ACJA 4IHSA 3I4PA 4WCGA 3BY6A 4EM0B 2DLLA 2BV6A 2XGXA 3HRSA 5F64A 1FP2A 5BQTA 4UVAA 5DD8A 1EH8A 4KDPA 4FX4A 3I59A 3WTXC 3C1DA 2OAZA 1SAXA 3DKWA 1P92A 4O5VA 2VXZA 1YW9A 4EJWA 3ZMTA 3L00A 2IA1A 2RKHA 4G7HF 1QGPA 5FLXK 2VBYA 4HDVA 4MQVA 5KK1A 2J5PA 1K7AA 3GFLA 1SD6A 5ICEA 2HKOA 4EM2A 5K5QA 4M9XA 2D1VA 4OMZA 2IA2A 3KEOA 2W57A 4OIQF 2XIGA 1K78B 4I7HA 3QP6A 1BJAA 4CHUA 4KIFA 3CUQB 2FNAA 1I6XA 2CG4A 1U8RA 3BJOA 3TDUC 2VOOA 4XRFA 2JPBA 1P4WA 1YO5C 4LG0B 3L7WA 1TQIA 4HOBA 1H0MA 3BJ6A 1XGSA 1REPC 3VFZA 3HSEA 4A5NA 2QLZA 3IRRA 3S2WA 5D5XB 2IJLA 2HYGD 4HQEA 1SFEA 2HQNA 1KQ8A 2GWRA 2E1NA 3IL2A 5DUIA 3IRQA 4KYWA 3KZZA 2WC2A 1ZYRF 1HSTA 3BZ6A 5L3CA 1UHMA 3DP7A 1MJBA 2H09A 3G73A 4JQFA 1IZ1A 4LG0A 1ODDA 4XLNF 1IRFA 3EQLF 1DUXC 3M7GA 2YPRA 2JRTA 3TGNA 4G9YA 1KQ0A 1XDUA 2JZYA 2PEXA 4A6EA 3QU6A 2G7UA 3TO7A 3V8KA 3WTWC 1WKMA 3ULQB 4ESBA 2PLYA 4A12A 2CSOA 5JVTA 2K4JA 2BE5F 1G4DA 4BH9A 3HTUA 4FX0A 3KLNA 4PZJA 1ZLJA 3QP5A 3D5LA 1R1VA 5E1XA 4ENMA 2ISYA 3E97A 3HIFA 1I1SA 2MA3A 4S04A 4HX4A 1EH6A 3KP7A 4G7OF 2UXXA 2RC4A 5LEJA 3P9CA 4MTDA 4O3MA 5LRRA 2ZNYA 2GQQA 1G6NA 3I71A 5IT9K 5HLGA 4L5JA 2AS5F 3SQNA 2JPCA 5HVQC 2QZ8A 1BC7C 3RKYA 3WTYC 2HQRA 1S7AA 2P7VB 1J9IA 2A61A 1YS7A 3F8MA 3RPQA 2A07F 2IPQX 3WTTC 1R5GA 3TKYA 4U0WA 3FMSA 1YIOA 3C7JA 2KIMA 2F2EA 3NQOA 4HLXA 2PQ8A 2V79A 4EM1A 3W6KB 2MLKA 2W84A 4WX9A 3EDPA 2K7LA 3PQJA 4HYEA 5DV5A 3E5XA 3LA3A 4LD5A 4UUVA 4G7ZF 1U5TA 3ABUA 4GGGA 2ZXJA 4HZFA 5EEHA 1MDMB 2XRNA 3T8TA 2VT3A 3GW2A 4QLCU 2E1CA 4RGUA 4M6XA 2HOEA 1PP8F 3B02A 2WV0A 1XCVA 4CYDA 2IA0A 1QNTA 2WTEA 4LMYA 3GLXA 3ZQ7A 5BPDA 2LF8A 5ICFA 2ZFWA 3J81K 5DDGA 3DPTA 3GUDA 2LDUA 2DI3A 1LJ9A 2CFXA 3BP8A 2P6SA 2ZKZA 3DF8A 1SMYF 1MDMA 3VODA 5HDGA 2A5YB 1XD7A 3C18A 2G9WA 2GAUA 1FX7A 3FWEA 3D0SA 3DEUA 1TNSA 3CJNA 1J2XA 4ZYGA 1BBYA 3K1MA 5ILVA 1FSEA 5J8FA 4HW0A 5LEKA 1GXPA 2Y75A 4I01A 1B1BA 1IXSB 1TQMA 2FE3A 3F6OA 3HRUA 1ZN2A 4RS8A 3JAMK 1F9NA 5D5UB 3B73A 4XBFA 4YFXF 1W7PB 1QO0D 4G6QA 3QPHA 2VC1A 4P9FA 4IJAA 4DQ2A 4RB3C 1T6SA 1XSVA 3DPLC 3BJAA 3V7CA 3WTZA 2VONA 1GHCA 3MAJA 2O61A 1ZG3A 4KIGA 4S05A 4RAZA 2EA4A 3E3VA 5ILUA 2RNJA 5HS9A 1G3YA 3HOSA 2HDCA 4UHTA 3GFMA 4GXOA 2IVMA 1DP7P 3MWMA 1TW3A 3SZPA 5L3EA 1V4RA 2IP2A 1KA8A 1HKQA 3KP2A 1ZREA 5D6FA 4HDUA 3CO7C 4LB5A 1IXCA 2M1BA 2PG4A 2VE8A 1YYVA 4UV9A 3ELKA 1S8NA 1T2KA 2MC3A 4I09A 1AWCA 1IN7A 1FBQA 1BI3A 1Y0UA 5HDNA 4OOIA 5H6QA 3HTSB 1KU7A 3KP4A 5LHIA 4LB6B 1BI2A 3HHGA 3I64A 3MEXA 4AWXB 4KNYA 1R22A 2Q2EA 2Z99A 1UFMA 4ESJA 1RUOA 1LDJA 4IHTA 1S29A 1B6AA 2L01A 2L4AA 3F8FA 2V6CA 1P6RA 4WXHA 4RB1A 2D2WA 4WWCA 5J8CA 4KIBA 2M45A 5E17F 1E17A 3WU0A 3ERED 3ZMSA 1WRJA 2DAOA 5D5VB 2QYOA 5L3GA 3M8EA 1QPMA 4LK0F 3CTAA 2M5WA 4I0AA 5FGMA 4ENNA 5CVRA 4Q5SF 2FOKA 2P4WA 1X3UA 1Z9CA 3K2ZA 4XSXF 4MEYF 2QQ9A 2MH9A 3R6SA 4M6YA 2F5CA 1GVJA 3TOAA 4UVBA 2RV8A 3I59B 3KFWX 4BHBA 5HOOA 2RVCA 4BNCA 3RIRA 1PP7U 1AOYA 2VOPA 3GZ5A 1HW5A 2OA4A 1RUNA 3DXJF 3LA7A 1G3SA 1U6GA 4G6DA 1R1UA 2K86A 3CDHA 3NRVA 5A2QZ 4MEXF 5F6FA 2ZBKA 2DO7A 2MH2A 1HKTA 3GEZA 5K1YA 5CYVA 1J0RA 3GVAA 3GFIA 3BROA 4U88A 3J81Z 1FYLA 3GXOA 1Z7UA 1F1ZA 4JK1X 1LNWA 1FYMA 3H92A 2KIUA 3JTHA 2WWYA 5DCMB 2ETHA 1QZYA 4Q47A 1ZG5A 3Q5FA 2UWMA 5D5WB 2X4HA 5CLSA 3I0TA 4M73A 1E2XA 3NEUA 3WTVC 1W7PD 1R36A 2Y48A 1LEBA 3DFGA 4ZYHA 3R0JA 3P9IA 1S3JA 1ZRDA 2XAFA 3E6DA 1TTYA 2XAHA 3BDDA 5DCMA 2VODA 1YW7A 3RKWA 2ELHA 2VT2A 3KE2A 4EJOA 4L18B 3FX3A 1FPQA 1W5SA 1Z6RA 1ZAOA 4IF4A 2P5KA 2HTJA 4EGZA 1BN5A 5D8KB 2ESHA 4L9VA 4M9ZA 4LFUA 1K6OA 4UV8A 3E6BA 4ZYDA 3E6CC 4IVNA 2Q0OA 5ERIA 1HW2A 5CVVA 3CUOA 5L3BA 1KYWA 3KEQA 4G8XA 2O8XA 1WSUA 5F1RA 2FBHA 1FNNA 3F8NA 3U2RA 2O03A 4LLNA 4IRIA 4P9UA 1OYWA 3JW4A 2DPUA 4EJUA 1FWZA 1HSJA 1YQAA 4B8XA 5CVUA 2MD5A 2MBFA 1ZHFA 2XROA 3DV8A 4ENKA 3L9FA 4IRHA 2FMLA 1ZRCA 3T0YA 4EMSA 1JGSA 4N0BA
chains in the Genus database with same CATH superfamily
4B09A 1VFCA 3U9GA 3KPHA 4ZYAA 3RQ4A 2M9HA 3BR2A 2FSWA 2HXOA 1EJ9A 3IV5A 5E79C 4HQMA 3IC7A 5DTDA 3S17J 4X1EA 3OYBA 1QZZA 4E7IA 1C0WA 3W6VA 3S32A 1DPRA 1IN6A 3JRHA 1Z0XA 1Y1WJ 1R71A 4LG3A 3M3YJ 5JFRA 5HNFA 1JT0A 1W5TA 2BXZA 2XHKA 2ECBA 3S3MA 1WGXA 3OYDA 1MBKA 1T0FA 2BY1A 4XLEA 2HGCA 1N78A 1YHQI 1R58A 2WAQN 4RB0A 1UELB 4OAYA 4AIJA 4E7LA 2OTLI 1FMVA 5DCFA 3WGGA 2R7UA 1U5TB 1EKEA 2KRFA 1UJ8A 1S7OA 3HOUJ 4QSHA 4W97A 3V8JA 3ISPA 2EFOA 3LSJA 1JTYA 3ZQLA 2X51A 2Z2SB 2OQRA 1LEAA 1XMAA 2BVMA 2RDPA 3HRTA 2HDWA 2O5RA 3OYFA 5HS7A 5DM7F 1FMWA 1HXDA 3HRMA 5B3SH 1JKOC 4N4NB 1U8BA 5M5YJ 4IZZA 2FBIA 3KCCA 3AAFA 1OMIA 3OYAA 2FA5A 1N25A 2KJCA 2XC7A 4PGHA 1TC3C 1X1PA 2DT5A 4CSWA 4YFNF 3WTSC 4ETSA 3K4JA 4QPQA 3PSFA 2H1LA 2P5VA 4A3IJ 2YR2A 3LAJA 4A3LJ 1T98A 3PNVA 1O3RA 2CH0A 3CESA 3MVPA 1IUYA 4A2UA 2OZUA 3VSLA 1X4PA 1G3TA 1M1EB 1IN4A 2RQQA 5J4YA 3RDIA 5BPIA 1OCTC 3ZPLA 5H20A 3K4NA 3IH4A 1YRNB 3RPUA 3WGIA 2DOFA 3KP3A 2XGCA 4OIPF 2DYRH 3HHHA 1JUMA 2CQXA 4RM2A 2NNNA 5EGOA 1RNLA 3QOPA 3H0GJ 2LBFB 1KU3A 5JHUA 2BW3B 2H8WA 3VOEA 2MFZA 1G59A 4KA4A 3ABMH 4IOAF 1P9QC 3BCAA 2FJ1A 5FB2A 4PSXA 2CQKA 2BEOA 5L3DA 5M5XJ 2K9QA 2HOAA 1N77A 2EK5A 4HLYA 1PUEE 2XKOA 3TL4X 3ROUA 1NH3A 4ANJA 2LF7A 1BI0A 3IWZA 3S1MJ 3WODF 4F3QA 1QBJA 3NARA 4D7MA 5GADJ 2JA5J 3LQRA 2ID6A 3PNTA 1HF0A 2KDOA 3M1EA 3ECHA 1R7JA 4QWQA 3I4MJ 2WA0A 4N9HA 2WV1A 1IN8A 3OWTA 1OKRA 2L4MA 5EEGA 2JSCA 3BTCA 4RB2C 1ETOA 3EETA 2PMUA 1XC5A 5LHHA 2ZMEA 2F6CA 1YRNA 4D5CA 2ZB9A 1X2NA 1I27A 5K7HA 1XN7A 5FLXZ 1U78A 3Q3SA 2L02A 5GAHJ 3Q9SA 1UB9A 2VB6A 3CUQC 5HODA 2KZGA 2FQ3A 4IXAA 2VUMJ 4AYBN 1SFOJ 4RAFA 3GF2A 1DGRM 3BG6A 4NNJA 1WI3A 2LBFA 1ZLKA 2QENA 1ZRFA 4I76A 1U2WA 2COMA 4WF2A 2O3FA 3KZYA 5FFZA 3ZQCA 1DU6A 4L5IA 5E18F 4B1RA 1J59A 2Y0MA 4KUMA 1W4MA 3AG2H 1Z67A 3H9QA 1GV2A 1F36A 4BY7J 1QHHD 1Z91A 2UV1A 2VL8A 4CICA 2L7MP 2OF7A 1DU0A 3H3UA 3DBLB 4MNUA 2EV0A 4RAYA 4XSZF 2XDVA 4XICA 3HOWJ 4HX7A 2H27A 2O6GE 1F5TA 5C44J 3ML6A 1Z3XA 2V1XA 2L7ZA 2X0LA 4XLAA 4L9TA 4AUXA 4C30A 4CYCB 1CGPA 1IRXA 1YG2A 5HS8A 1IAWA 2W82A 3H9JA 1AU7A 5JLXA 3TQNA 1T95A 4JX5A 4LGWA 3L1PA 3QYBA 3S1NJ 3A0HC 3OR1C 4ZYEA 4YG2F 1USSA 5E1WA 4C3IJ 1ZK8A 5EG0A 1R4MB 1O7LA 1ZGJA 3HZJA 4BACA 2A05A 3ZQHA 1QQIA 3SEZA 4ASNA 4ZJZA 2V1UA 2P8TA 2QVOA 5D4SA 3F6VA 3P9KA 2VI6A 1QU3A 1TP4A 2TDXA 3PIOF 1SANA 2VJ4A 3BQZA 4KN7X 2A68F 2Y2ZA 5EEAA 1MZBA 3FXQA 4I0BA 3RKXA 3UNGC 1XGMA 2VN2A 2ME6A 1OYYA 4BJ5C 1WJBA 3HDDA 1FP1D 1BI1A 2Z9OA 2FBKA 2WBMA 2K27A 3FK6A 4R79A 3QOEA 3REOA 2W00A 2LFBA 5KNLA 3F8CA 3Q9VA 3W2AA 1ETQA 2DU9A 2Q2EB 4GO1A 3Q0WA 4FISA 1ITYA 4GDFA 1MMDA 1I5ZA 3KYDB 1S9HA 5J40A 4MFDA 3BG7A 5EDNA 2CFOA 3CC7I 4HF2A 2ESNA 2VBZA 2KRHA 3DWLE 4PJNA 1K83J 1YITI 3T1BA 3SYTA 3VB2A 1D1AA 3GTGJ 4Y7NJ 4XRSG 3EUHC 3VYTB 2YU9J 4JP0A 3WHCA 1KU2A 1X1AA 1OR7A 4DZPA 3CP2A 4BAYA 5H2FC 4U7BA 2VBXA 2OC6A 2VXDA 4ZDLA 5LBQA 3I3LA 1D5VA 2R4GA 2GXBA 1SFKA 3M9AA 2V9KA 1OJLA 2BOLA 1XGNA 1R5HA 2RNGA 5E20A 1OPCA 1CF7A 2ECCA 2XAGA 1L3LA 5E3MA 3J7AY 2KJBA 1H89C 3KYLA 4H0EA 3OS0A 2L0KA 5JI6A 3R60A 5D8LB 2MLGA 1B72B 5CPRB 2Y30A 5JVGF 1XDSA 2AQFA 4IHYA 2VBWA 3U21A 3WGHA 4P5OA 2EV6A 4IRGA 3TO9A 3TBIA 1XPXA 2RN7A 3L09A 5AONA 5J6XA 1T38A 2PJPA 1R5ID 1T39A 4HEA2 2STWA 1ZH5A 4A3JJ 6PAXA 1Q1VA 2P5LC 4MHGA 3RZDJ 5KVRA 2E5NA 3RJPA 4I02A 2CJJA 4UB6C 4EJVA 4PDKA 1G3WA 4U0VA 5TGTA 5DD4A 3KP6A 3HSFA 2MD0A 3BR0A 1MKMA 2A6HF 2M30A 3LQQA 1TLHB 4RGRA 3CC4I 4OMYA 3BPXA 3H3ZA 2XPUA 1O3QA 3GLLA 3D5RC 5FD6A 1Z05A 1OYIA 2KKOA 3GZNB 3W2WA 3FKIJ 5IT9Z 1P7IA 1A35A 3RTRA 4G12A 3SFZA 1B59A 2CU7A 4EVIA 4C3JJ 1WI9A 2XB0X 5GPCA 2F4IA 5B1BH 2R7QA 1D8JA 2I8DA 3IKVA 3MKZA 3UKGA 1BJZA 1X3ZB 4BEHB 4IEJA 4FQGA 2R7XA 2BY0A 3WG9A 3KLOA 1QVTA 4II2A 5FKOA 5ICGA 3HBLA 3O3KA 1YTYA 2GXGA 2KRCA 5K5OA 2DMUA 3W3CA 2VLAA 1E3PA 2QKMB 3PUFA 1OFCX 5LHGA 3OYNA 4A3CJ 1S6LA 3MZYA 1K79A 3GTLJ 5D4RA 3WU1B 3A03A 1ZR4A 3SZTA 1ETVA 4NHJA 2QKLB 1BR4A 1JT6A 1OCPA 3BT9A 3O6BB 5ED4A 3CCJI 4AC0A 3K10A 1ONVA 2OBPA 4EV0A 1X1CA 1TNTA 4Z2YA 3IKTA 1A6IA 4KT5C 4KMFA 3GZ6A 4KISA 1RIOH 2KP6A 4LK1F 1QVUA 2L3DA 1OCOH 2GA2A 2IEKA 4P1WA 2D1HA 2BHYA 2E34A 3F72A 4D0PA 2LK2A 4LIVA 3T5XA 3ZMDA 3W6JB 3LSHA 1MBHA 3GTQJ 5F0HA 1FOWA 2LG4A 3DPUA 5LD2C 2H94A 1JHHA 1IXRC 3AL0B 2M87A 2EV5A 4BEHA 2PFBA 1YIJI 3E5UA 2HVSA 1O3SA 2KHMA 5IP6A 1IG7A 3G6EI 2F5FA 4LIUA 4B44A 1ORKA 2QSHX 3I9V2 1BIBA 1WWXA 4TV7A 1BIAA 1IF1A 4B3XA 2P6TA 1D0YA 4AU7A 3EPZA 2O0YA 4AVPA 2HYJA 2AXLA 4M72A 2XGDA 2GXAA 4BXUA 5JHFA 3H35A 3LSPA 1D1BA 1SVMA 2DBBA 3CQZJ 4U7DA 2DJIA 1O7FA 3L2UA 4NBQA 1HBXG 3ONQA 4R1HA 2MABA 4HNTA 1UMQA 3H0DA 1ON1A 3A4CA 4PFPA 5IYBJ 2HS5A 3K4BA 1V3FA 5DEQA 1E3HA 4ESFA 4ENJA 1ZG1A 3SHFA 1J09A 1VQOI 2B0LA 1S72I 4LJZF 2R7FA 3P7NA 2Y9ZA 1V55H 2EZLA 3FXRA 1TBXA 2CUEA 1XSXA 2DFIA 3JRFA 2JSPA 3LL7A 3JSOA 1FY7A 1MH3A 2FXAA 4J00A 4XLCA 1YLFA 2ELJA 5TRDA 1HQCA 5HLHA 1OISA 2W85A 1BC8C 2K85A 4KICA 1YFHA 4MQ9F 4YELA 5B66C 1RC9A 1EV7A 4YIFA 2K9SA 2L7FP 3OR2C 2PBIA 4LLGF 2DA4A 4KMUX 4M71A 3J7AO 1MGTA 2ZO4A 3S3NA 2V1NA 3L2CA 1ULYA 4AD9A 4IPAA 4U0YA 3L2VA 2QCOA 4XKBA 3R4KA 2ZXWH 3GYHX 1IUFA 4YIIA 3MQ0A 4NB5A 2QBYB 3DEWA 2OD5A 1FC3A 3CJQB 2HI3A 3OSGA 2WB1A 1IRGA 3I5UA 4Y13A 2DA1A 4B43A 2DQLA 3OY9A 1LFUP 1KYZA 2NOJB 3BOQA 2ISZA 1J75A 2EWNA 1FYKA 4RM3A 3JAMZ 5D6EA 3TW7A 4LITA 1RPWA 3VEPA 4MGRA 4UNOA 2DK8A 2IBDA 3PQKA 3ECOA 2LY2A 3MFKA 2E1MB 1GXQA 2BGCA 2KMUA 3PFIA 3I58A 4L9NA 3HSRA 1XMKA 2K02A 4M9SA 4GYGA 3I4NJ 3R0AA 2A3SA 2Q1ZB 5LGTA 5BOXA 2X6YA 3N4MA 5E8IA 3C2GA 2X6XA 1HOMA 1F4KA 1LVAA 3OIPA 3VSKA 4W1UA 2QBYA 1GLNA 1D3YA 2HYFA 2ME0A 1YX3A 1IDYA 1ON2A 3H9GA 3AKZA 5E3OA 4ZZLA 1ZGAA 2OQGA 1K78A 5H6RA 1UCRA 2D45A 1XTAA 5FROA 3BG5A 5CQGA 3FXMA 4KITB 3CUQA 3JRGA 2M7BA 4GYIA 1BOBA 4XRSA 3OS2A 2DTRA 5J47A 1TWHJ 2QSFX 3LAPA 2Z3YA 3C3WA 4HA8A 1O57A 5HLIA 3N97A 2V1DA 3ZMZA 3NAUA 2JA8J 2JA2A 1LPQA 3FHZA 2XKPA 2EILH 2HR3A 5FO5A 3GWZA 1MJAA 2X1DA 1XX5A 2M8GX 1B9NA 1Z6TA 4BE1A 1LDDA 3HEFA 3MCZA 1FZPB 4Y33A 2Y31A 3A1YA 2OU2A 4QPOA 2K40A 3K1NA 3SFIA 2L2OA 2ZJPF 4L0YB 4BBSJ 2DPDA 2VC0A 2UZKA 2B63J 1EF4A 5JR3A 3SEQA 3GTJJ 3SDGA 2JTVA 2EJRA 1V5FA 4IHXA 4BQAA 3OOUA 2CYYA 3RYPA 2DTZA 4A3GJ 3HPGA 1VTNC 2HVRA 3L2RA 3F9KA 2E7WA 1EA3A 3V4GA 2DN0A 1FOYA 1ZELA 4HPQA 5GTHC 4K2EA 2CV1A 1IW7F 2F48A 4C2MJ 2EA2A 3G3ZA 2DW4A 2V6EA 4F7ZA 3BTJA 4CZZA 2CW8A 1ETKA 5DYMA 2DA6A 2A6EF 1ZR2A 5DM6F 3GCMA 5LGUA 1WJFA 1YW8A 2Z16A 3FMQA 4ON0A 4YFKF 3E6MA 1LVKA 1LUJB 2XV4S 1FBSA 1NHAA 2HU9A 1G8XA 1TL8A 4N9IA 2HPMA 2BXYA 2W25A 1KU9A 4A0ZA 4BBRJ 3RI4A 3MZHA 2UXNA 5F27A 4EQQA 1Y1VJ 1JKRC 4E7ZA 4HV6A 2Z33A 2EFQA 2K9LA 5BNGA 1MMGA 2RGVA 2R7SA 4UVCA 4HSTA 4XORA 3CO6C 2DXIA 3WU2C 3CCRI 2XGEA 3ABLH 3LWFA 2CWEA 1R00A 5L3FA 4JBAA 2CO5A 5E8GA 5LGNA 1IJWC 3S2HJ 1K4SA 2K3FA 2DK5A 3B6AA 3M1CA 3RYRA 4IHWA 5LRSA 1IDZA 3EUHA 4JX4A 3LFKA 2RQPA 3CDLA 2HVQA 4UXNA 2UUZA 1USTA 4ZH4F 4C2UA 5B5EC 4A6DA 3FM5A 1T33A 1V5EA 2CUZA 1XCBA 5EGOB 3CCSI 1JJ8C 4XLPF 2Z5UA 2GBYA 3TP3A 3HOTA 1FT9A 3BZCA 3GX4X 2O7OA 2EFPA 1RKTA 3F8BA 3TDZC 4J01A 2CUFA 2EIMH 4M74A 4DGWB 4WXCA 4NC7A 4XM3A 1SD7A 1XB4A 5J3LA 5ILSA 2YX4A 3IAS2 3PNYA 4R8HA 2YUSA 4BE0A 4BYYA 1ZKGA 4L0ZB 2OZ6A 4D9JA 4BHCA 3L2WA 5ICCA 2NVYJ 1FOKA 2GM4A 2I5UA 1I1GA 2Q8KA 1ETWA 4Y17A 2ZMEB 4BQOA 2R7RA 5TJJA 2W7NA 1DPUA 2NVQJ 1JTXA 2H6CA 3OYCA 4BQQA 2EIJH 3M07A 3J80K 3K69A 3V7SA 1R1TA 4OU0A 1O3TA 1U3EM 3R61A 1P4XA 2KIFA 4HF0A 2QA4I 3O2PE 1SMTA 2EH3A 4Q48A 5FFXA 2VIXA 1FLIA 2EFWA 4CDGA 2F5DA 1BW6A 2FX0A 3K0LA 3GTPJ 2R93J 1VQ8I 3LSGA 5A2QK 4IL6C 2H8RA 2ZJ2A 3EYYA 2DDBA 2FQ4A 2HNHA 2P0WA 4CXFA 1RI7A 2NNYA 1HC8A 3WHBA 3GMEA 2LREA 4PUSA 1NK2P 2IS4A 3QRFF 2HZTA 2PI0A 2XAUA 3DKXA 2B7EA 4F92B 1ZQ3P 4IO9F 2KFDA 4Z6YA 3QPTA 3BZKA 5AIPA 2J5OA 2NRAC 1WJAA 2NOGA 5E1ZB 1IV8A 1XSDA 2NVUB 2HKXA 3T8RA 5IT3A 2NS0A 2DJNA 2V26A 3OIQA 4DZJA 3E0JB 4WK8F 2F5EA 4AIHA 2LKPA 2JT1A 2R3SA 3QU3A 1J7KA 2NS8A 3M8FA 2PJRA 3BLYA 5DUKA 1FSHA 2VKVA 1P2FA 2ZJRF 3FM3A 3J7YJ 5EG0B 2O9LA 3CCVI 4I99C 1WCMJ 5GP9A 1FTZA 2WAFA 3BWGA 4RLQA 1P4AA 2K9MA 4XIDA 1ZGWA 3F0CA 2GA1A 3FDYA 1X3WB 4A93J 2XF7A 2PMHA 2QGUA 2FF4A 3FMRA 1EH7A 4OIOF 3ASOH 2XASA 2YX7A 3CJTB 4BUPA 1APLC 3PJRA 4II3A 4XL9A 5CVJA 2EBIA 4AM3A 1WFXA 1D8KA 2OUMA 5AIQA 2Y0SA 4KN4X 3KP5A 3HG9A 1L0OC 4QIWN 3CCUI 2LP0A 3IWFA 2HZDA 5FD5A 5HDKA 1V5GA 1PDNC 2DOAA 3QAHA 5F0CA 3QODA 4OIRF 3HM5A 1H9GA 3JTGA 2DA2A 2ZSHB 3FXJA 2FEZA 3C2BA 4RGXA 5IOZA 1YJ9I 4NDLA 4BY1J 1RZ4A 4LLLA 3IH2A 4GCVA 1Y0NA 2XUBA 2QUFA 4A0YA 4XN3A 2GIVA 2DYSH 2QQBA 3ABTA 3WE2A 4HX8A 1VQ5I 1LQ1A 1IN5A 2LNBA 3FZVA 4RAGA 2VJ5A 4I2OA 3D5SC 4HG2A 2BYVE 5KAIC 3WTUC 4LOCA 4FHTA 4G94A 2G7HA 1U9OA 2CS3A 3A0BC 4F93B 4QTRA 3BR3A 1BOAA 3CCMI 1SC7A 4BXXJ 1CF7B 2PN6A 2HWVA 5FRMA 1LB2A 4AVZA 3ASNH 2L9NA 1UZCA 3DKYA 3S93A 1H9TA 3OYGA 2QWWA 1B8IB 2AHQA 1SVLA 2E35A 4A3MJ 2PMZA 2QSGX 2KLOA 2QF7A 5FLVA 2H6BA 1FJLA 1WQ2A 1Q1HA 3CF2A 4CO8A 3SXYA 4CGZA 3TO6A 1BR2A 2BBYA 3VDXA 3HL2A 3COAC 3GFJA 2ADUA 1Z7LA 2MGQA 2IGKA 2HTSA 5K7FA 1HW1A 2GZWA 3ZMUA 3VWBA 1LE8B 3K4LA 1XGOA 1WH5A 3IHUA 2OCCH 1W7PA 4PJJA 1TWAJ 2W1OA 3CLOA 4X6AJ 4ZZDA 3JCUC 4C3HJ 3RCOA 4CCJA 1TWCJ 3ZN0A 2IAIA 3ZN1A 2IW5A 2IT0A 4L9JA 3H5RA 1KQ9A 2HPIA 2XAQA 2W24A 3FF5A 2LOOA 1KZHA 3TOBA 2OTJI 1TT5B 4P55A 3I55I 4F52A 1MJ9A 4HAMA 1R23A 4HV5A 2R7DA 4NQWB 3CDIA 3DCFA 2JVGA 3EYIA 4O6JA 1J5YA 1B8IA 2HQ5A 3LSTA 2HDDA 1LFPA 1R6RA 3K9TA 1JE8A 3DTEA 3X2QH 2R7ZJ 3JRIA 4AIKA 2DQRA 4KFCA 3VYRB 4HF1A 2YSRA 5HNHA 1W0TA 2VE9A 5K5RA 5DS9A 2ZFUA 3TW6A 4Q4ZF 1VQLI 4MIMA 2XPVA 3ZMVA 1DDNA 4DYQA 3CCQI 2FMYA 1TW2A 2V9VA 2XVCA 1WPKA 3BR1A 3FBNB 2FU4A 4DIQA 3KETA 1LE8A 2LSOA 2VKHA 3F21A 1FBUA 2FRHA 3OOPA 4PSWA 2NYXA 2FNPA 3BPVA 3RPUD 4EJTA 4HBLA 4PGGA 1UHWA 2NAZA 2QM3A 2EFNA 2R92J 1U5TC 1BM9A 2CW0F 4UY8I 1I6HJ 2Z1DA 1SFXA 3LSIA 3GTMJ 2E7XA 1A31A 2QQAA 1KGSA 4CCOA 4DNCA 1W36D 5GAGJ 2IGNA 4I98B 4N4OB 3V8LA 1JI8A 1MNDA 5CVIA 3H36A 4CCNA 5BS6A 4PJLA 1MNMC 2XRLA 4NQWA 1HKSA 1MD0A 3ZRGA 1LDKB 2L54A 1W36C 1A04A 2LD5A 2ID3A 3CCYA 1RR8C 4E70A 1VQ9I 4NUBA 1LKXA 2ZNZA 3MN2A 2K4BA 5F08A 2C6YA 2IRFG 4RGSA 5FLMJ 1Z3YA 3FIWA 4RA2A 1YS6A 1YJWI 3U1DA 3FXUA 3I53A 3HPHA 3CP8A 1VQ7I 2EB7A 1X4OA 4WXDA 1Z1DA 2R7WA 3KYCB 4M3BA 4Y15A 4GFBA 1IRZA 2M8EA 3LA2A 3ZP5A 5IYCJ 2DFFA 4A0XA 1JXSA 4A5MA 4EGYA 4G6TB 3WE3A 4FTHA 4IOCF 2XAJA 2EZHA 1TQPA 3E5QA 4FT8A 2LKXA 3K1PA 4E6KG 3AG3H 4XONA 3DQVC 2CQQA 1B4AA 3GO5A 5M5WJ 3CCEI 3JSPA 3RSNA 3QPLA 4DYRA 2VPLA 3F3XA 4PCQA 2MYSA 3V7RA 3HYIA 2IGOA 4OINF 4BHPA 5BMZA 2P7CB 2YU3A 3E1SA 3F22A 4P96A 1JHFA 3KX2A 5CJ9A 3DU5A 4B4CA 2RREA 2L9VA 2ZCWA 3OV8A 1SD4A 4IKFA 4MTEA 2STTA 3CJRB 2JVHA 1ZARA 5CKTA 3HUGA 3H5NA 2X1EA 2W48A 2CGPA 2WY7Q 1MBFA 2LY9A 2HEOA 4V2GA 1VQMI 3F23A 1STZA 2A69F 4X0GA 1SFUA 2HFHA 4RDUA 4OWRB 2LLKA 1B9MA 3I54A 1SD5A 3E7LA 4M3EA 1AKHA 1VQ4I 1R49A 3J80Z 5LLQA 2E2JJ 1BA5A 4L5EA 1I3AA 2CUJA 2ACJA 4IHSA 2E71A 3I4PA 4M6VA 1Z77A 5EZHA 2M4GA 4WCGA 3BY6A 4EM0B 2DLLA 4PK4A 1Z21A 1Y8QB 3OYMA 2BV6A 2XGXA 2KQRA 2H1KA 3HRSA 5F64A 1FP2A 2XPWA 5BQTA 1JKPC 1MBGA 4UVAA 3HXLA 1PYVA 3SJMA 5DD8A 1Y39A 2JK3A 1EH8A 4KDPA 2M3AA 3D1NI 1MMSA 4FX4A 2DT6A 1IO2A 1RR7A 2X6WA 3I59A 4S0HB 1MBEA 1GT0C 3EUKL 2VQCA 4ITVA 2DMQA 1GDTA 3WTXC 3C1DA 3A2KA 2DODA 2OAZA 3HOXJ 1GV5A 1SAXA 3DKWA 1P92A 4XMYA 4DOZA 4O5VA 3ZXSA 2VXZA 3VPRA 1YW9A 1D0ZA 3LSMA 4EJWA 1FTTA 2L9SA 1R4NB 1FEXA 2ZSIB 2VQHA 3B6CA 3ZMTA 4XQFA 3GTKJ 3IP4B 2JRMA 3L00A 3OYKA 2IA1A 1D5YA 2RKHA 4G7HF 3FXOA 1QGPA 5FLXK 4NC6A 2VBYA 1OLTA 1XMXA 4HDVA 1DGWY 3BTIA 3O8GA 4MQVA 5KK1A 2J5PA 2P81A 3DTIA 1K7AA 3GFLA 2ELKA 1SD6A 2LMDA 2M34A 5ICEA 2HKOA 4EM2A 4MO7A 2KZVA 2VPRA 3FISA 3HKZA 4E7SA 2FD5A 5K5QA 2RAEA 4M9XA 2D1VA 4OMZA 2IA2A 3KEOA 2W57A 4FE7A 4OIQF 2WY8Q 2XIGA 1K78B 4I7HA 3QP6A 3S2DJ 1MBJA 1BJAA 4CHUA 2X1CA 4KIFA 3BG9A 3CUQB 5M3FJ 2FNAA 1I6XA 2CG4A 1U8RA 3BJOA 2Y0SN 2K3PA 3TDUC 2VOOA 4XRFA 2JPBA 1P4WA 1ETXA 1YO5C 4LG0B 3BTLA 4A69C 2A6TA 5GAEJ 3L7WA 1TQIA 4HOBA 1H0MA 3BJ6A 4BS9A 1XGSA 2VJIA 3JRDA 1REPC 3VFZA 3HSEA 1QZEA 2QLZA 4A5NA 3LSKA 2EINH 1FIPA 3IRRA 3S2WA 1U9NA 5D5XB 2IJLA 3IH3A 2EZKA 2HYGD 4HQEA 2X6OA 2KL4A 1SFEA 2HQNA 3BCBA 2GWRA 1KQ8A 2E2HJ 2E1NA 1FOXA 3IL2A 1WHUA 4Y3OA 5DUIA 2M4KA 3IRQA 3L2QA 4KYWA 1S5LC 3KZZA 4J19A 1PUFB 1JGGA 2WC2A 2X85A 3IAM2 2F5VA 1ZYRF 2IXSA 1HSTA 5J1YA 1AHDP 3BZ6A 3H5AA 5L3CA 1UHMA 1BL0A 1JUPA 3DP7A 1MJBA 1X1DA 2H09A 3U1KA 3G73A 2ZC2A 4ZDPA 3A01A 2K5CA 1IZ1A 4JQFA 3TEDA 1WH7A 4LG0A 2KPMA 1ODDA 3KIOA 4D1QA 1QPIA 4XLNF 1IRFA 3EQLF 5C3EJ 1IV6A 3BR5A 3IUOA 4KJZA 1DUXC 3M7GA 2YPRA 2JRTA 4UUSB 1XS9A 3OL4A 3TGNA 4G9YA 1KQ0A 2O8KA 2PMZN 1VNDA 1XDUA 4IHVA 2JZYA 2R0QC 2PEXA 4V2FA 4A6EA 5TISC 1GUUA 3QU6A 1DP3A 2G7UA 1A6QA 2V4JC 4XNFA 3OYLA 3TO7A 3V8KA 1H88C 3K2AA 1PUFA 3WTWC 4MLOA 4FCYA 4CH7A 1RKWA 1WKMA 3CMMA 3RZOJ 4U87A 3ULQB 1X2MA 3QYFA 3K4MA 4ESBA 3G71I 4A3EJ 1ACIA 2PLYA 4FE4A 4A12A 1BW5A 2CSOA 4BL0B 2K4JA 5JVTA 2BE5F 1G4DA 2JUGA 4ZC3A 4BH9A 5FKNA 1HDDC 1MNEA 1QA6A 4UUSA 3HTUA 5KAFC 3QQAA 1H8AC 3S16J 2E36A 4IQJA 3K4CA 1G2HA 3WG7H 4FX0A 3KLNA 4PZJA 1ZLJA 2HQAA 3KZIC 3ZOBA 3AG4H 2JA6J 1MH4A 3QP5A 3D5LA 1R1VA 5E1XA 1SEUA 4ENMA 1YX5A 2ISYA 4PFOA 4DJAA 4XLHA 3E97A 3HIFA 2MW8A 2BHZA 1I1SA 2MA3A 5C4JJ 3ERMA 4S04A 4HX4A 1EH6A 3BC8A 3KP7A 3AFHA 3LOCA 3CZ6A 4G7OF 2UXXA 2CV2A 2RC4A 1ZTRA 3O8HA 4D5FA 3FXKA 5LEJA 4I6ZA 4BJTA 1XG1A 2I10A 3P9CA 2VKDA 4MTDA 4O3MA 2BY2A 5LRRA 2MSYA 4UUTA 3HGYA 3HJEA 2ZNYA 4ABZA 2GQQA 2W4SA 1G6NA 3I71A 2FUG2 5IT9K 2Y69H 1W5CC 5HLGA 4L5JA 2AS5F 3SQNA 2JPCA 5HVQC 2QZ8A 4XKVA 4CUGA 4CZCA 1BC7C 3RKYA 3WTYC 2IS2A 4ZDOA 2HQRA 1S7AA 2P7VB 5FKLA 1QRYA 1TT0A 2X48A 1VF9A 2CMPA 4RBOA 1J9IA 3G4SI 2A61A 3MD2A 3AL0C 2LYCA 3QWLA 1YS7A 3VYSB 3F8MA 2JA7J 5F1JA 3RPQA 2EIKH 2KISA 2PX9A 2K9NA 1VQPI 2ZXIA 2A07F 2VQGA 2IPQX 2JWTA 3WTTC 1R5GA 2EQRA 4U0WA 3TKYA 3FMSA 4EATA 1YIOA 3S1QJ 1Y8RB 3C7JA 2AXTC 2KIMA 2F2EA 3HB9A 3NQOA 2PQ8A 2V79A 4HLXA 4EM1A 3CF5F 3W6KB 4ZTFA 4E7JA 2MLKA 2W84A 4WX9A 3EDPA 3S14J 1JJ6C 3PIPF 2E60A 3K4KA 2K7LA 3CCLI 3PQJA 2PJRB 3FKJA 4F91B 4HYEA 5DV5A 3E5XA 3LA3A 4LD5A 4UUVA 1U5TA 4G7ZF 3ABUA 4GGGA 2ZXJA 4HZFA 2Y9YA 5EEHA 2ICWG 1MDMB 2XRNA 3T8TA 2VT3A 4ZTJA 3GW2A 4QLCU 2WAEA 2E1CA 4RGUA 2L7KA 4M6XA 2HOEA 4E7KA 4PJ0C 1PP8F 3B02A 4BDZA 1MSEC 2R7TA 2WV0A 3A02A 1HLVA 3JRBA 2EPFA 1XCVA 4CYDA 5IY5H 5M3MJ 2IA0A 1QNTA 1ETYA 2DT7B 2WTEA 4LMYA 3GLXA 3ZQ7A 2LKSA 5BPDA 4EEFG 2LF8A 2OPTA 2XSJC 2NVXJ 5ICFA 2ZFWA 2E1OA 3J81K 5DDGA 4CA0A 3DPTA 3C2HA 3GUDA 2LDUA 3HC7A 1F43A 2DI3A 1LJ9A 2CFXA 3W2VA 2KDZA 2VASA 1D0XA 2LC2A 3BP8A 2GLOA 2P6SA 2ZKZA 4FETA 4IQ4A 3DF8A 1SMYF 3ZGKA 3G1OA 1MDMA 4XN0A 3VODA 3TP0A 1NG6A 5LFAA 5HDGA 2A5YB 5JLWA 1XD7A 3C18A 2G9WA 1TWGJ 2GAUA 4YEJA 1FX7A 3FWEA 1SVOA 3D0SA 3DEUA 1YI2I 1VZ0A 1TNSA 3CJNA 3J7ZI 2BW3A 1J2XA 4M3GA 3V42A 3AG1H 2OJED 2NS7A 4ZYGA 3CD6I 1BBYA 2E1MC 3K1MA 2CQ7A 4DW6A 1Y56A 3HKZN 3LMMA 4V19K 3S1RJ 4XOPA 1D1CA 2MC4A 5ILVA 1FSEA 2DA5A 5J8FA 2WB1N 4HW0A 2IGMA 5LEKA 1GXPA 1E3OC 5EYRA 1I50J 3PM1A 1RETA 5FKMA 2Y75A 1SAUA 4I01A 1B1BA 1IXSB 5EF6A 1TQMA 2BY3A 2FE3A 3F6OA 4H4KC 2GOXB 3HRUA 1ZN2A 4RS8A 5CQEA 3JREA 2YS9A 2VJJA 3JAMK 1F9NA 5E3LA 5D5UB 3EUAA 3DLLF 3B73A 3VYUB 2TCTA 3DTKA 4XBFA 4YFXF 3P5JA 1W7PB 3CMAI 1QO0D 2HOSA 3M8JA 4G6QA 3QPHA 3SZGA 2VC1A 4BU2A 4P9FA 2QEXI 3FK7A 4IJAA 3MKLA 4HSRA 4DQ2A 4RB3C 1T6SA 1XSVA 3DPLC 5FRNA 3BJAA 3V7CA 1UAAA 9ANTA 3WTZA 3OS1A 4XK4A 2VONA 1GHCA 3MAJA 2NXNB 2O61A 2M0MA 2G0EA 1ZG3A 4KIGA 4S05A 1YJNI 4B47A 4RAZA 2EA4A 3E3VA 5ILUA 2RNJA 5HS9A 3OYHA 1Y6IA 1G3YA 3HOSA 4RLFA 2HDCA 4CYCA 4UHTA 3G1MA 3RQIA 1T0FC 3GFMA 4GXOA 3G1LA 2E5ZA 2IVMA 2LR8A 2XF5A 5J1RA 2R7OA 3PL8A 1DP7P 3MWMA 5E3NA 1TW3A 5GPAA 3SZPA 3I56I 4DBQA 5L3EA 3OSFA 1V4RA 1IC8A 4E4HA 2IP2A 4A3KJ 1KA8A 1HKQA 3KP2A 1HCRA 1VQ6I 1ZREA 5D6FA 4HDUA 1RESA 3CO7C 3JR9A 4A3FJ 1IXCA 2JJ7A 5KHDA 4LB5A 5FJ8J 2M1BA 3DU6A 2HOTA 3DBHB 2PG4A 1K61A 2VE8A 3ZQFA 1YYVA 4UV9A 1WJEA 3S8PA 3ELKA 1S8NA 4B3AA 1T2KA 2DFHA 2MC3A 4CCLA 3OIOA 4I09A 1AWCA 1IN7A 1FBQA 1BI3A 1Y0UA 4NC8A 2DOEA 5HDNA 4OOIA 2CV0A 3PO3J 2IS6A 5H6QA 3HTSB 5FKKA 3PUBA 1KU7A 3KP4A 5F04A 5LHIA 5HLTA 5IPAA 4LB6B 1BI2A 4GRIA 5IOYA 3HHGA 3I64A 1S7EA 3MEXA 3SDBA 4AWXB 4KNYA 1R22A 2Q2EA 2Z99A 3K70D 2FOWA 1UFMA 5J4VA 4XOTA 3PO2J 4ESJA 1RUOA 1LDJA 4IHTA 1OCZH 1S29A 4B48A 1B6AA 2L01A 2L4AA 4D7NA 3F8FA 2DMPA 1W0UA 2V6CA 3H1CA 1P6RA 4WXHA 4RB1A 2D2WA 3K70C 4MFEA 2DCEA 4WWCA 3H3VK 3HGGA 5J8CA 3PFYA 4KIBA 2M45A 4FASD 5E17F 1X1BA 1E17A 3WU0A 3ERED 3ZMSA 3CC2I 3HUGB 1WRJA 2DAOA 2GIZA 2WAQA 2JN6A 1WJ5A 5D5VB 2QYOA 5L3GA 3M8EA 1QPMA 3G2BA 1VI0A 4LK0F 3CTAA 1JUSA 1X58A 2COBA 2M5WA 1AKHB 3GTOJ 1I39A 2OCEA 4I0AA 5J1UA 5FGMA 4HRIA 3OL3A 4ENNA 2M0CA 5C4XJ 1K6YA 1B72A 5CVRA 2XB5A 2FOKA 2P4WA 1X3UA 2BVLA 1Z9CA 4Q5SF 2IS1A 4YIRX 3K2ZA 1NK3P 2DMTA 4XSXF 4MEYF 2ZMEC 2QQ9A 1V54H 2MH9A 3ZR8X 3FBIB 2CRGA 3UR3C 2XSDC 1VQNI 3R6SA 4M6YA 2F5CA 4AIDA 5IP9J 1ERDA 1GVJA 3TOAA 4UVBA 4C2TA 2RV8A 3I59B 3KFWX 2VQLA 4BHBA 5HOOA 2RVCA 3ABKH 2OV7A 4BE2A 4BNCA 3MMYB 2F4OB 3OYEA 4HNUA 1WJCA 3RIRA 1LFBA 4DBRA 1PP7U 5K7ZA 1PJRA 1AOYA 2VOPA 2GOMA 3GZ5A 1HW5A 2OA4A 1ENHA 1K4TA 1RUNA 1X19A 3DXJF 1HA8A 3LA7A 1G3SA 3OYJA 2ZJQF 3MKYB 1U6GA 1YE9A 4G6DA 1R1UA 2K86A 2R5YB 3CDHA 2KIQA 1WJDA 3NRVA 4BKXA 3OMYA 1GVDA 2LRDA 1R9TJ 2AQEA 2CW7A 4CCKA 5A2QZ 4MEXF 1MW7A 4A3DJ 1U0JA 3RKQA 4DYCA 5B1AH 3K6GA 5F6FA 3DBRB 3BG3A 2ZBKA 1UG0A 2DO7A 2JMWA 2MH2A 1HKTA 4M3FA 3GEZA 5K1YA 5CYVA 2QQ8A 1J0RA 3GVAA 1MSFC 3MKWB 3GFIA 3LSRA 1N75A 1T08B 1JKQC 3Q0UA 3BROA 4OAZA 4RMNA 4A3BJ 4U88A 3J81Z 1FYLA 3GXOA 4M3DA 2D5VA 1Z7UA 1F1ZA 5GTIC 4JK1X 4XRMA 1LNWA 4AYBA 2AO9A 2R5YA 3H92A 3QPSA 1FYMA 2KIUA 3JTHA 2WWYA 5DCMB 1W1WE 2DA3A 2ETHA 1QZYA 3FHNA 1MIJA 5KCMA 4KT6A 4Q47A 1ZG5A 3ZQGA 2JQ7A 3LFUA 2X9DA 3Q5FA 3PSIA 3ZCOA 3TMOA 2WADA 2UWMA 1OCRH 5D5WB 2X4HA 3BQYA 5CLSA 2N8GA 3I0TA 3FXLA 3DLAA 1I3QJ 1BR1A 2VKEA 4M73A 2E2IJ 1E2XA 3HOZJ 3NEUA 3WTVC 1W7PD 3CMYA 3LNQA 1R36A 3A01B 3S3OA 1OR7C 1T8IA 1E0EA 3K7AJ 4BDYA 1DQUA 2DDAA 2Y48A 1LEBA 3NWTA 4UB8C 3DFGA 2R5ZB 3M4OJ 3HOVJ 4JYKA 4ZYHA 3JRCA 3R0JA 3P9IA 1S3JA 2HXIA 1PVEA 1WVRA 1RRJA 1ZRDA 1OQYA 3Q0VA 2XAFA 2V9PA 2E19A 3E6DA 1TTYA 1TZLA 2XAHA 2L5QA 3BDDA 5DCMA 2VODA 1YW7A 3RKWA 3ESWB 2ELHA 1OCCH 2VT2A 3KE2A 1VQKI 1AA7A 3BR6A 4EJOA 1YOVB 1NTCA 4XKCA 3ZQQA 4L18B 3FX3A 1FPQA 1QHGA 2DA7A 1W5SA 1Z6RA 2M2EA 1ZAOA 4IF4A 2V7FA 3GBGA 2P5KA 1O4XA 2HTJA 4EGZA 3QYEA 1BN5A 5D8KB 2LTPA 3KEYA 2ESHA 4L9VA 4M9ZA 2LVSA 1MMNA 2M7AA 4LFUA 1WZ2A 1K6OA 4UV8A 2R5ZA 1UHSA 3E6BA 4ZYDA 3E6CC 3NWSA 2DMNA 1T56A 4JX6A 4IVNA 2KT0A 2Q0OA 5IP7J 3ZQIA 4Y4RA 2TRTA 5ERIA 1HW2A 2CQNA 1A5JA 2EZIA 5CVVA 3CUOA 5EJCA 1KYWA 2A5WA 3KEQA 4G8XA 4XLFA 4BQNA 4BXFA 5L3BA 1HDPA 3CMEI 3HOYJ 4C9YA 2O8XA 1WSUA 3S15J 5F1RA 3OYIA 2XF6A 2BZTA 2FBHA 1FNNA 1POGA 3F8NA 4HNVA 4JOMA 3U2RA 2O03A 4LLNA 5IYDJ 2LY1A 2R7VA 1CQTA 4IRIA 4P9UA 2JUCA 3MZ8A 1NG7A 1OYWA 1UG2A 3JW4A 2DPUA 4EJUA 5EZGA 4XKWA 1FWZA 1HSJA 1YQAA 2MG4A 5F0FA 4B8XA 3N05A 4BJ6C 1P7JA 4IX7A 5CVUA 1TWFJ 1FIAA 2MD5A 2MBFA 2B9SA 1ZHFA 1A36A 4CCMA 4XR6A 2XROA 1IGNA 2F4MB 3DV8A 4ENKA 3DEEA 1KONA 4PJMA 3L9FA 4YRVA 4IRHA 4BGDA 2FMLA 1ZRCA 1MMAA 2ZXHA 3CLQA 2LH9A 3JRAA 3T0YA 2NVTJ 4Y52J 4E7HA 4EMSA 1JGSA 2L9RA 4F55A 4N0BA 2DFEA
chains in the Genus database with same CATH topology
4B09A 3U9GA 2FSWA 4HQMA 3IC7A 1QZZA 1C0WA 1DPRA 1IN6A 5JFRA 1W5TA 2XHKA 1T0FA 2HGCA 1R58A 4RB0A 4AIJA 5DCFA 3WGGA 1U5TB 2KRFA 1S7OA 3V8JA 3ISPA 2EFOA 2OQRA 1LEAA 1XMAA 2RDPA 3HRTA 5HS7A 1HXDA 3HRMA 2FBIA 3KCCA 3AAFA 1OMIA 2FA5A 2KJCA 4PGHA 2DT5A 4YFNF 3WTSC 4ETSA 2P5VA 2YR2A 3LAJA 1T98A 1O3RA 1IUYA 4A2UA 2OZUA 1G3TA 1IN4A 3RDIA 5BPIA 3ZPLA 5H20A 3RPUA 3WGIA 3KP3A 4OIPF 3HHHA 2NNNA 1RNLA 3QOPA 1KU3A 5JHUA 3VOEA 4KA4A 5FB2A 2CQKA 2BEOA 5L3DA 1PUEE 2EK5A 4HLYA 2XKOA 3ROUA 2LF7A 1BI0A 3IWZA 3WODF 1QBJA 3LQRA 3M1EA 3ECHA 1R7JA 4QWQA 4N9HA 1IN8A 1OKRA 2L4MA 5EEGA 2JSCA 4RB2C 3EETA 2PMUA 5LHHA 2ZMEA 1I27A 1XN7A 5FLXZ 1U78A 2L02A 3Q9SA 1UB9A 3CUQC 2FQ3A 4IXAA 3GF2A 1ZLKA 2QENA 1ZRFA 1U2WA 2COMA 4WF2A 2O3FA 3KZYA 5FFZA 4L5IA 5E18F 1J59A 2Y0MA 4KUMA 1W4MA 1Z91A 4CICA 3H3UA 4MNUA 2EV0A 4RAYA 4XSZF 4HX7A 2H27A 2O6GE 1F5TA 3ML6A 2V1XA 2X0LA 1CGPA 4L9TA 1YG2A 5HS8A 1IAWA 3TQNA 4LGWA 4ZYEA 4YG2F 1USSA 5E1WA 1O7LA 1ZGJA 1QQIA 4ASNA 2V1UA 2P8TA 2QVOA 5D4SA 3F6VA 3P9KA 2TDXA 4KN7X 2A68F 1MZBA 3FXQA 4I0BA 3RKXA 1XGMA 2VN2A 1OYYA 1FP1D 1BI1A 2Z9OA 2FBKA 2K27A 4R79A 3REOA 3F8CA 3Q9VA 2DU9A 4GO1A 1I5ZA 4HF2A 2ESNA 2VBZA 3T1BA 3VB2A 1KU2A 1OR7A 4BAYA 4U7BA 2VBXA 5LBQA 1D5VA 2GXBA 3M9AA 1XGNA 1R5HA 5E20A 1OPCA 1CF7A 2XAGA 1L3LA 2KJBA 4H0EA 5JI6A 3R60A 5D8LB 2MLGA 1XDSA 2VBWA 3WGHA 4P5OA 2EV6A 4IRGA 3TO9A 2RN7A 3L09A 5AONA 5J6XA 1T38A 2PJPA 1T39A 2STWA 1ZH5A 6PAXA 2P5LC 4MHGA 5KVRA 3RJPA 4I02A 4EJVA 4PDKA 1G3WA 4U0VA 5DD4A 3KP6A 3HSFA 1MKMA 2A6HF 2M30A 3LQQA 1TLHB 4RGRA 4OMYA 3BPXA 3H3ZA 1O3QA 5FD6A 1Z05A 1OYIA 2KKOA 5IT9Z 3RTRA 3SFZA 1B59A 4EVIA 1WI9A 1D8JA 3IKVA 3WG9A 3KLOA 5ICGA 3O3KA 1YTYA 2GXGA 5K5OA 5LHGA 1S6LA 3MZYA 1K79A 5D4RA 3WU1B 3SZTA 4NHJA 3O6BB 5ED4A 4EV0A 1ONVA 2OBPA 3IKTA 1TNTA 4Z2YA 4KT5C 4KMFA 3GZ6A 1RIOH 4LK1F 2L3DA 2GA2A 2D1HA 3F72A 4D0PA 3T5XA 3ZMDA 3W6JB 2H94A 1JHHA 1IXRC 2M87A 2EV5A 2PFBA 3E5UA 1O3SA 2F5FA 1BIBA 1WWXA 4TV7A 1BIAA 1IF1A 2P6TA 2O0YA 4AVPA 2AXLA 4M72A 4BXUA 2DBBA 4U7DA 1O7FA 1HBXG 4R1HA 1ON1A 2HS5A 1V3FA 5DEQA 4ESFA 4ENJA 1ZG1A 3SHFA 2B0LA 4LJZF 2R7FA 3P7NA 3FXRA 1TBXA 1XSXA 2DFIA 3JSOA 1FY7A 2FXAA 1YLFA 5TRDA 1HQCA 5HLHA 2W85A 1BC8C 4KICA 1YFHA 4MQ9F 1EV7A 4YIFA 2PBIA 4LLGF 4KMUX 4M71A 3J7AO 1MGTA 2ZO4A 3L2CA 1ULYA 4AD9A 4IPAA 4U0YA 3R4KA 3GYHX 4YIIA 3MQ0A 4NB5A 2QBYB 2OD5A 1FC3A 1IRGA 3I5UA 4Y13A 2DQLA 1KYZA 3BOQA 2ISZA 1J75A 2EWNA 1FYKA 3JAMZ 5D6EA 3VEPA 4MGRA 4UNOA 2DK8A 3PQKA 3ECOA 3MFKA 1GXQA 2BGCA 3PFIA 3I58A 4L9NA 3HSRA 1XMKA 2K02A 4M9SA 4GYGA 3R0AA 2A3SA 5LGTA 5BOXA 3N4MA 5E8IA 1F4KA 1LVAA 2QBYA 2HYFA 1D3YA 1ON2A 4ZZLA 1ZGAA 2OQGA 1K78A 5H6RA 1UCRA 2D45A 3CUQA 4GYIA 2DTRA 3LAPA 2Z3YA 3C3WA 4HA8A 1O57A 5HLIA 3N97A 2V1DA 3ZMZA 3FHZA 2XKPA 2HR3A 5FO5A 3GWZA 1MJAA 1B9NA 1Z6TA 1LDDA 3MCZA 1FZPB 2OU2A 3K1NA 4L0YB 2DPDA 2VC0A 2UZKA 5JR3A 2JTVA 2EJRA 4BQAA 2CYYA 3RYPA 1VTNC 2E7WA 3V4GA 4K2EA 1IW7F 2EA2A 3G3ZA 2DW4A 4F7ZA 4CZZA 5DYMA 2A6EF 5LGUA 4YFKF 1YW8A 3FMQA 4ON0A 3E6MA 1FBSA 1NHAA 2XV4S 4N9IA 2W25A 1KU9A 4A0ZA 3RI4A 3MZHA 2UXNA 4EQQA 4HV6A 2Z33A 2EFQA 2RGVA 4UVCA 3CO6C 3LWFA 2CWEA 1R00A 5L3FA 4JBAA 2CO5A 5E8GA 5LGNA 2DK5A 3RYRA 5LRSA 3EUHA 3LFKA 2RQPA 4UXNA 1USTA 4ZH4F 4A6DA 3FM5A 1XCBA 4XLPF 2Z5UA 3HOTA 1FT9A 3GX4X 2EFPA 3F8BA 3TDZC 4M74A 4WXCA 1SD7A 1XB4A 5ILSA 2YX4A 4R8HA 4BYYA 4L0ZB 2OZ6A 4BHCA 5ICCA 1FOKA 1I1GA 2Q8KA 4Y17A 2ZMEB 5TJJA 1DPUA 2H6CA 3J80K 3K69A 3V7SA 1R1TA 4OU0A 1O3TA 1U3EM 3R61A 1P4XA 2KIFA 4HF0A 3O2PE 1SMTA 4Q48A 5FFXA 1FLIA 2EFWA 4CDGA 2F5DA 3K0LA 5A2QK 2ZJ2A 3EYYA 2NNYA 4CXFA 1RI7A 3QRFF 2HZTA 2PI0A 3QPTA 5AIPA 2J5OA 2NRAC 5E1ZB 1XSDA 2HKXA 3T8RA 5IT3A 2NS0A 4WK8F 2F5EA 4AIHA 2LKPA 2JT1A 2R3SA 3QU3A 1J7KA 3M8FA 5DUKA 1FSHA 1P2FA 3FM3A 3BWGA 1P4AA 2GA1A 3FMRA 2PMHA 2FF4A 1EH7A 4OIOF 2XASA 2YX7A 5CVJA 1D8KA 5AIQA 4KN4X 3KP5A 1L0OC 3IWFA 5FD5A 5HDKA 1PDNC 3QAHA 4OIRF 1H9GA 3JTGA 2FEZA 4RGXA 1RZ4A 4LLLA 4GCVA 2XUBA 2QUFA 4A0YA 2GIVA 3ABTA 2QQBA 3WE2A 4HX8A 1LQ1A 1IN5A 2LNBA 3FZVA 4I2OA 2BYVE 3WTUC 4FHTA 4G94A 2G7HA 1BOAA 1CF7B 2PN6A 2HWVA 1LB2A 1H9TA 2QWWA 2H6BA 1WQ2A 1Q1HA 4CO8A 3SXYA 4CGZA 3TO6A 2BBYA 3COAC 3GFJA 2ADUA 2HTSA 1HW1A 2GZWA 3ZMUA 1XGOA 3IHUA 1W7PA 3CLOA 4ZZDA 3ZN0A 3ZN1A 2IW5A 2IT0A 4L9JA 1KQ9A 2XAQA 3FF5A 2W24A 3TOBA 4P55A 1MJ9A 4HAMA 1R23A 4HV5A 2R7DA 3EYIA 4O6JA 1J5YA 3LSTA 3K9TA 1JE8A 4AIKA 2DQRA 4KFCA 4HF1A 2YSRA 2VE9A 5K5RA 4Q4ZF 3ZMVA 1DDNA 2FMYA 1TW2A 2V9VA 2XVCA 2FU4A 3KETA 2LSOA 3F21A 1FBUA 2FRHA 3OOPA 2NYXA 2FNPA 3BPVA 4EJTA 4HBLA 4PGGA 1UHWA 2NAZA 2QM3A 2EFNA 1U5TC 1BM9A 2CW0F 1SFXA 2E7XA 2QQAA 1KGSA 4DNCA 4I98B 3V8LA 5CVIA 5BS6A 4NQWA 1HKSA 1MD0A 1LDKB 2L54A 1A04A 4E70A 2ZNZA 2K4BA 2C6YA 2IRFG 4RGSA 1YS6A 3U1DA 3FXUA 3I53A 2EB7A 4WXDA 1Z1DA 4Y15A 2M8EA 3LA2A 3ZP5A 4A0XA 1JXSA 4A5MA 4EGYA 3WE3A 2XAJA 1TQPA 3E5QA 4FT8A 3K1PA 3DQVC 1B4AA 3GO5A 3JSPA 3F3XA 4PCQA 3V7RA 3HYIA 4BHPA 4OINF 5BMZA 2P7CB 2YU3A 3F22A 4P96A 1JHFA 5CJ9A 2ZCWA 3OV8A 1SD4A 4MTEA 2STTA 1ZARA 3HUGA 2CGPA 2HEOA 3F23A 1STZA 2A69F 1SFUA 2HFHA 1B9MA 3I54A 1SD5A 3J80Z 5LLQA 2ACJA 4IHSA 3I4PA 4WCGA 3BY6A 4EM0B 2DLLA 2BV6A 2XGXA 3HRSA 5F64A 1FP2A 5BQTA 4UVAA 5DD8A 1EH8A 4KDPA 4FX4A 3I59A 3WTXC 3C1DA 2OAZA 1SAXA 3DKWA 1P92A 4O5VA 2VXZA 1YW9A 4EJWA 3ZMTA 3L00A 2IA1A 2RKHA 4G7HF 1QGPA 5FLXK 2VBYA 4HDVA 4MQVA 5KK1A 2J5PA 1K7AA 3GFLA 1SD6A 5ICEA 2HKOA 4EM2A 5K5QA 4M9XA 2D1VA 4OMZA 2IA2A 3KEOA 2W57A 4OIQF 2XIGA 1K78B 4I7HA 3QP6A 1BJAA 4CHUA 4KIFA 3CUQB 2FNAA 1I6XA 2CG4A 1U8RA 3BJOA 3TDUC 2VOOA 4XRFA 2JPBA 1P4WA 1YO5C 4LG0B 3L7WA 1TQIA 4HOBA 1H0MA 3BJ6A 1XGSA 1REPC 3VFZA 3HSEA 4A5NA 2QLZA 3IRRA 3S2WA 5D5XB 2IJLA 2HYGD 4HQEA 1SFEA 2HQNA 1KQ8A 2GWRA 2E1NA 3IL2A 5DUIA 3IRQA 4KYWA 3KZZA 2WC2A 1ZYRF 1HSTA 3BZ6A 5L3CA 1UHMA 3DP7A 1MJBA 2H09A 3G73A 4JQFA 1IZ1A 4LG0A 1ODDA 4XLNF 1IRFA 3EQLF 1DUXC 3M7GA 2YPRA 2JRTA 3TGNA 4G9YA 1KQ0A 1XDUA 2JZYA 2PEXA 4A6EA 3QU6A 2G7UA 3TO7A 3V8KA 3WTWC 1WKMA 3ULQB 4ESBA 2PLYA 4A12A 2CSOA 5JVTA 2K4JA 2BE5F 1G4DA 4BH9A 3HTUA 4FX0A 3KLNA 4PZJA 1ZLJA 3QP5A 3D5LA 1R1VA 5E1XA 4ENMA 2ISYA 3E97A 3HIFA 1I1SA 2MA3A 4S04A 4HX4A 1EH6A 3KP7A 4G7OF 2UXXA 2RC4A 5LEJA 3P9CA 4MTDA 4O3MA 5LRRA 2ZNYA 2GQQA 1G6NA 3I71A 5IT9K 5HLGA 4L5JA 2AS5F 3SQNA 2JPCA 5HVQC 2QZ8A 1BC7C 3RKYA 3WTYC 2HQRA 1S7AA 2P7VB 1J9IA 2A61A 1YS7A 3F8MA 3RPQA 2A07F 2IPQX 3WTTC 1R5GA 3TKYA 4U0WA 3FMSA 1YIOA 3C7JA 2KIMA 2F2EA 3NQOA 4HLXA 2PQ8A 2V79A 4EM1A 3W6KB 2MLKA 2W84A 4WX9A 3EDPA 2K7LA 3PQJA 4HYEA 5DV5A 3E5XA 3LA3A 4LD5A 4UUVA 4G7ZF 1U5TA 3ABUA 4GGGA 2ZXJA 4HZFA 5EEHA 1MDMB 2XRNA 3T8TA 2VT3A 3GW2A 4QLCU 2E1CA 4RGUA 4M6XA 2HOEA 1PP8F 3B02A 2WV0A 1XCVA 4CYDA 2IA0A 1QNTA 2WTEA 4LMYA 3GLXA 3ZQ7A 5BPDA 2LF8A 5ICFA 2ZFWA 3J81K 5DDGA 3DPTA 3GUDA 2LDUA 2DI3A 1LJ9A 2CFXA 3BP8A 2P6SA 2ZKZA 3DF8A 1SMYF 1MDMA 3VODA 5HDGA 2A5YB 1XD7A 3C18A 2G9WA 2GAUA 1FX7A 3FWEA 3D0SA 3DEUA 1TNSA 3CJNA 1J2XA 4ZYGA 1BBYA 3K1MA 5ILVA 1FSEA 5J8FA 4HW0A 5LEKA 1GXPA 2Y75A 4I01A 1B1BA 1IXSB 1TQMA 2FE3A 3F6OA 3HRUA 1ZN2A 4RS8A 3JAMK 1F9NA 5D5UB 3B73A 4XBFA 4YFXF 1W7PB 1QO0D 4G6QA 3QPHA 2VC1A 4P9FA 4IJAA 4DQ2A 4RB3C 1T6SA 1XSVA 3DPLC 3BJAA 3V7CA 3WTZA 2VONA 1GHCA 3MAJA 2O61A 1ZG3A 4KIGA 4S05A 4RAZA 2EA4A 3E3VA 5ILUA 2RNJA 5HS9A 1G3YA 3HOSA 2HDCA 4UHTA 3GFMA 4GXOA 2IVMA 1DP7P 3MWMA 1TW3A 3SZPA 5L3EA 1V4RA 2IP2A 1KA8A 1HKQA 3KP2A 1ZREA 5D6FA 4HDUA 3CO7C 4LB5A 1IXCA 2M1BA 2PG4A 2VE8A 1YYVA 4UV9A 3ELKA 1S8NA 1T2KA 2MC3A 4I09A 1AWCA 1IN7A 1FBQA 1BI3A 1Y0UA 5HDNA 4OOIA 5H6QA 3HTSB 1KU7A 3KP4A 5LHIA 4LB6B 1BI2A 3HHGA 3I64A 3MEXA 4AWXB 4KNYA 1R22A 2Q2EA 2Z99A 1UFMA 4ESJA 1RUOA 1LDJA 4IHTA 1S29A 1B6AA 2L01A 2L4AA 3F8FA 2V6CA 1P6RA 4WXHA 4RB1A 2D2WA 4WWCA 5J8CA 4KIBA 2M45A 5E17F 1E17A 3WU0A 3ERED 3ZMSA 1WRJA 2DAOA 5D5VB 2QYOA 5L3GA 3M8EA 1QPMA 4LK0F 3CTAA 2M5WA 4I0AA 5FGMA 4ENNA 5CVRA 4Q5SF 2FOKA 2P4WA 1X3UA 1Z9CA 3K2ZA 4XSXF 4MEYF 2QQ9A 2MH9A 3R6SA 4M6YA 2F5CA 1GVJA 3TOAA 4UVBA 2RV8A 3I59B 3KFWX 4BHBA 5HOOA 2RVCA 4BNCA 3RIRA 1PP7U 1AOYA 2VOPA 3GZ5A 1HW5A 2OA4A 1RUNA 3DXJF 3LA7A 1G3SA 1U6GA 4G6DA 1R1UA 2K86A 3CDHA 3NRVA 5A2QZ 4MEXF 5F6FA 2ZBKA 2DO7A 2MH2A 1HKTA 3GEZA 5K1YA 5CYVA 1J0RA 3GVAA 3GFIA 3BROA 4U88A 3J81Z 1FYLA 3GXOA 1Z7UA 1F1ZA 4JK1X 1LNWA 1FYMA 3H92A 2KIUA 3JTHA 2WWYA 5DCMB 2ETHA 1QZYA 4Q47A 1ZG5A 3Q5FA 2UWMA 5D5WB 2X4HA 5CLSA 3I0TA 4M73A 1E2XA 3NEUA 3WTVC 1W7PD 1R36A 2Y48A 1LEBA 3DFGA 4ZYHA 3R0JA 3P9IA 1S3JA 1ZRDA 2XAFA 3E6DA 1TTYA 2XAHA 3BDDA 5DCMA 2VODA 1YW7A 3RKWA 2ELHA 2VT2A 3KE2A 4EJOA 4L18B 3FX3A 1FPQA 1W5SA 1Z6RA 1ZAOA 4IF4A 2P5KA 2HTJA 4EGZA 1BN5A 5D8KB 2ESHA 4L9VA 4M9ZA 4LFUA 1K6OA 4UV8A 3E6BA 4ZYDA 3E6CC 4IVNA 2Q0OA 5ERIA 1HW2A 5CVVA 3CUOA 5L3BA 1KYWA 3KEQA 4G8XA 2O8XA 1WSUA 5F1RA 2FBHA 1FNNA 3F8NA 3U2RA 2O03A 4LLNA 4IRIA 4P9UA 1OYWA 3JW4A 2DPUA 4EJUA 1FWZA 1HSJA 1YQAA 4B8XA 5CVUA 2MD5A 2MBFA 1ZHFA 2XROA 3DV8A 4ENKA 3L9FA 4IRHA 2FMLA 1ZRCA 3T0YA 4EMSA 1JGSA 4N0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B09 A;  3U9G A;  2FSW A;  4HQM A;  3IC7 A;  1QZZ A;  1C0W A;  1DPR A;  1IN6 A;  5JFR A;  1W5T A;  2XHK A;  1T0F A;  2HGC A;  1R58 A;  4RB0 A;  4AIJ A;  5DCF A;  3WGG A;  1U5T B;  2KRF A;  1S7O A;  3V8J A;  3ISP A;  2EFO A;  2OQR A;  1LEA A;  1XMA A;  2RDP A;  3HRT A;  5HS7 A;  1HXD A;  3HRM A;  2FBI A;  3KCC A;  3AAF A;  1OMI A;  2FA5 A;  2KJC A;  4PGH A;  2DT5 A;  4YFN F;  3WTS C;  4ETS A;  2P5V A;  2YR2 A;  3LAJ A;  1T98 A;  1O3R A;  1IUY A;  4A2U A;  2OZU A;  1G3T A;  1IN4 A;  3RDI A;  5BPI A;  3ZPL A;  5H20 A;  3RPU A;  3WGI A;  3KP3 A;  4OIP F;  3HHH A;  2NNN A;  1RNL A;  3QOP A;  1KU3 A;  5JHU A;  3VOE A;  4KA4 A;  5FB2 A;  2CQK A;  2BEO A;  5L3D A;  1PUE E;  2EK5 A;  4HLY A;  2XKO A;  3ROU A;  2LF7 A;  1BI0 A;  3IWZ A;  3WOD F;  1QBJ A;  3LQR A;  3M1E A;  3ECH A;  1R7J A;  4QWQ A;  4N9H A;  1IN8 A;  1OKR A;  2L4M A;  5EEG A;  2JSC A;  4RB2 C;  3EET A;  2PMU A;  5LHH A;  2ZME A;  1I27 A;  1XN7 A;  5FLX Z;  1U78 A;  2L02 A;  3Q9S A;  1UB9 A;  3CUQ C;  2FQ3 A;  4IXA A;  3GF2 A;  1ZLK A;  2QEN A;  1ZRF A;  1U2W A;  2COM A;  4WF2 A;  2O3F A;  3KZY A;  5FFZ A;  4L5I A;  5E18 F;  1J59 A;  2Y0M A;  4KUM A;  1W4M A;  1Z91 A;  4CIC A;  3H3U A;  4MNU A;  2EV0 A;  4RAY A;  4XSZ F;  4HX7 A;  2H27 A;  2O6G E;  1F5T A;  3ML6 A;  2V1X A;  2X0L A;  1CGP A;  4L9T A;  1YG2 A;  5HS8 A;  1IAW A;  3TQN A;  4LGW A;  4ZYE A;  4YG2 F;  1USS A;  5E1W A;  1O7L A;  1ZGJ A;  1QQI A;  4ASN A;  2V1U A;  2P8T A;  2QVO A;  5D4S A;  3F6V A;  3P9K A;  2TDX A;  4KN7 X;  2A68 F;  1MZB A;  3FXQ A;  4I0B A;  3RKX A;  1XGM A;  2VN2 A;  1OYY A;  1FP1 D;  1BI1 A;  2Z9O A;  2FBK A;  2K27 A;  4R79 A;  3REO A;  3F8C A;  3Q9V A;  2DU9 A;  4GO1 A;  1I5Z A;  4HF2 A;  2ESN A;  2VBZ A;  3T1B A;  3VB2 A;  1KU2 A;  1OR7 A;  4BAY A;  4U7B A;  2VBX A;  5LBQ A;  1D5V A;  2GXB A;  3M9A A;  1XGN A;  1R5H A;  5E20 A;  1OPC A;  1CF7 A;  2XAG A;  1L3L A;  2KJB A;  4H0E A;  5JI6 A;  3R60 A;  5D8L B;  2MLG A;  1XDS A;  2VBW A;  3WGH A;  4P5O A;  2EV6 A;  4IRG A;  3TO9 A;  2RN7 A;  3L09 A;  5AON A;  5J6X A;  1T38 A;  2PJP A;  1T39 A;  2STW A;  1ZH5 A;  6PAX A;  2P5L C;  4MHG A;  5KVR A;  3RJP A;  4I02 A;  4EJV A;  4PDK A;  1G3W A;  4U0V A;  5DD4 A;  3KP6 A;  3HSF A;  1MKM A;  2A6H F;  2M30 A;  3LQQ A;  1TLH B;  4RGR A;  4OMY A;  3BPX A;  3H3Z A;  1O3Q A;  5FD6 A;  1Z05 A;  1OYI A;  2KKO A;  5IT9 Z;  3RTR A;  3SFZ A;  1B59 A;  4EVI A;  1WI9 A;  1D8J A;  3IKV A;  3WG9 A;  3KLO A;  5ICG A;  3O3K A;  1YTY A;  2GXG A;  5K5O A;  5LHG A;  1S6L A;  3MZY A;  1K79 A;  5D4R A;  3WU1 B;  3SZT A;  4NHJ A;  3O6B B;  5ED4 A;  4EV0 A;  1ONV A;  2OBP A;  3IKT A;  1TNT A;  4Z2Y A;  4KT5 C;  4KMF A;  3GZ6 A;  1RIO H;  4LK1 F;  2L3D A;  2GA2 A;  2D1H A;  3F72 A;  4D0P A;  3T5X A;  3ZMD A;  3W6J B;  2H94 A;  1JHH A;  1IXR C;  2M87 A;  2EV5 A;  2PFB A;  3E5U A;  1O3S A;  2F5F A;  1BIB A;  1WWX A;  4TV7 A;  1BIA A;  1IF1 A;  2P6T A;  2O0Y A;  4AVP A;  2AXL A;  4M72 A;  4BXU A;  2DBB A;  4U7D A;  1O7F A;  1HBX G;  4R1H A;  1ON1 A;  2HS5 A;  1V3F A;  5DEQ A;  4ESF A;  4ENJ A;  1ZG1 A;  3SHF A;  2B0L A;  4LJZ F;  2R7F A;  3P7N A;  3FXR A;  1TBX A;  1XSX A;  2DFI A;  3JSO A;  1FY7 A;  2FXA A;  1YLF A;  5TRD A;  1HQC A;  5HLH A;  2W85 A;  1BC8 C;  4KIC A;  1YFH A;  4MQ9 F;  1EV7 A;  4YIF A;  2PBI A;  4LLG F;  4KMU X;  4M71 A;  3J7A O;  1MGT A;  2ZO4 A;  3L2C A;  1ULY A;  4AD9 A;  4IPA A;  4U0Y A;  3R4K A;  3GYH X;  4YII A;  3MQ0 A;  4NB5 A;  2QBY B;  2OD5 A;  1FC3 A;  1IRG A;  3I5U A;  4Y13 A;  2DQL A;  1KYZ A;  3BOQ A;  2ISZ A;  1J75 A;  2EWN A;  1FYK A;  3JAM Z;  5D6E A;  3VEP A;  4MGR A;  4UNO A;  2DK8 A;  3PQK A;  3ECO A;  3MFK A;  1GXQ A;  2BGC A;  3PFI A;  3I58 A;  4L9N A;  3HSR A;  1XMK A;  2K02 A;  4M9S A;  4GYG A;  3R0A A;  2A3S A;  5LGT A;  5BOX A;  3N4M A;  5E8I A;  1F4K A;  1LVA A;  2QBY A;  2HYF A;  1D3Y A;  1ON2 A;  4ZZL A;  1ZGA A;  2OQG A;  1K78 A;  5H6R A;  1UCR A;  2D45 A;  3CUQ A;  4GYI A;  2DTR A;  3LAP A;  2Z3Y A;  3C3W A;  4HA8 A;  1O57 A;  5HLI A;  3N97 A;  2V1D A;  3ZMZ A;  3FHZ A;  2XKP A;  2HR3 A;  5FO5 A;  3GWZ A;  1MJA A;  1B9N A;  1Z6T A;  1LDD A;  3MCZ A;  1FZP B;  2OU2 A;  3K1N A;  4L0Y B;  2DPD A;  2VC0 A;  2UZK A;  5JR3 A;  2JTV A;  2EJR A;  4BQA A;  2CYY A;  3RYP A;  1VTN C;  2E7W A;  3V4G A;  4K2E A;  1IW7 F;  2EA2 A;  3G3Z A;  2DW4 A;  4F7Z A;  4CZZ A;  5DYM A;  2A6E F;  5LGU A;  4YFK F;  1YW8 A;  3FMQ A;  4ON0 A;  3E6M A;  1FBS A;  1NHA A;  2XV4 S;  4N9I A;  2W25 A;  1KU9 A;  4A0Z A;  3RI4 A;  3MZH A;  2UXN A;  4EQQ A;  4HV6 A;  2Z33 A;  2EFQ A;  2RGV A;  4UVC A;  3CO6 C;  3LWF A;  2CWE A;  1R00 A;  5L3F A;  4JBA A;  2CO5 A;  5E8G A;  5LGN A;  2DK5 A;  3RYR A;  5LRS A;  3EUH A;  3LFK A;  2RQP A;  4UXN A;  1UST A;  4ZH4 F;  4A6D A;  3FM5 A;  1XCB A;  4XLP F;  2Z5U A;  3HOT A;  1FT9 A;  3GX4 X;  2EFP A;  3F8B A;  3TDZ C;  4M74 A;  4WXC A;  1SD7 A;  1XB4 A;  5ILS A;  2YX4 A;  4R8H A;  4BYY A;  4L0Z B;  2OZ6 A;  4BHC A;  5ICC A;  1FOK A;  1I1G A;  2Q8K A;  4Y17 A;  2ZME B;  5TJJ A;  1DPU A;  2H6C A;  3J80 K;  3K69 A;  3V7S A;  1R1T A;  4OU0 A;  1O3T A;  1U3E M;  3R61 A;  1P4X A;  2KIF A;  4HF0 A;  3O2P E;  1SMT A;  4Q48 A;  5FFX A;  1FLI A;  2EFW A;  4CDG A;  2F5D A;  3K0L A;  5A2Q K;  2ZJ2 A;  3EYY A;  2NNY A;  4CXF A;  1RI7 A;  3QRF F;  2HZT A;  2PI0 A;  3QPT A;  5AIP A;  2J5O A;  2NRA C;  5E1Z B;  1XSD A;  2HKX A;  3T8R A;  5IT3 A;  2NS0 A;  4WK8 F;  2F5E A;  4AIH A;  2LKP A;  2JT1 A;  2R3S A;  3QU3 A;  1J7K A;  3M8F A;  5DUK A;  1FSH A;  1P2F A;  3FM3 A;  3BWG A;  1P4A A;  2GA1 A;  3FMR A;  2PMH A;  2FF4 A;  1EH7 A;  4OIO F;  2XAS A;  2YX7 A;  5CVJ A;  1D8K A;  5AIQ A;  4KN4 X;  3KP5 A;  1L0O C;  3IWF A;  5FD5 A;  5HDK A;  1PDN C;  3QAH A;  4OIR F;  1H9G A;  3JTG A;  2FEZ A;  4RGX A;  1RZ4 A;  4LLL A;  4GCV A;  2XUB A;  2QUF A;  4A0Y A;  2GIV A;  3ABT A;  2QQB A;  3WE2 A;  4HX8 A;  1LQ1 A;  1IN5 A;  2LNB A;  3FZV A;  4I2O A;  2BYV E;  3WTU C;  4FHT A;  4G94 A;  2G7H A;  1BOA A;  1CF7 B;  2PN6 A;  2HWV A;  1LB2 A;  1H9T A;  2QWW A;  2H6B A;  1WQ2 A;  1Q1H A;  4CO8 A;  3SXY A;  4CGZ A;  3TO6 A;  2BBY A;  3COA C;  3GFJ A;  2ADU A;  2HTS A;  1HW1 A;  2GZW A;  3ZMU A;  1XGO A;  3IHU A;  1W7P A;  3CLO A;  4ZZD A;  3ZN0 A;  3ZN1 A;  2IW5 A;  2IT0 A;  4L9J A;  1KQ9 A;  2XAQ A;  3FF5 A;  2W24 A;  3TOB A;  4P55 A;  1MJ9 A;  4HAM A;  1R23 A;  4HV5 A;  2R7D A;  3EYI A;  4O6J A;  1J5Y A;  3LST A;  3K9T A;  1JE8 A;  4AIK A;  2DQR A;  4KFC A;  4HF1 A;  2YSR A;  2VE9 A;  5K5R A;  4Q4Z F;  3ZMV A;  1DDN A;  2FMY A;  1TW2 A;  2V9V A;  2XVC A;  2FU4 A;  3KET A;  2LSO A;  3F21 A;  1FBU A;  2FRH A;  3OOP A;  2NYX A;  2FNP A;  3BPV A;  4EJT A;  4HBL A;  4PGG A;  1UHW A;  2NAZ A;  2QM3 A;  2EFN A;  1U5T C;  1BM9 A;  2CW0 F;  1SFX A;  2E7X A;  2QQA A;  1KGS A;  4DNC A;  4I98 B;  3V8L A;  5CVI A;  5BS6 A;  4NQW A;  1HKS A;  1MD0 A;  1LDK B;  2L54 A;  1A04 A;  4E70 A;  2ZNZ A;  2K4B A;  2C6Y A;  2IRF G;  4RGS A;  1YS6 A;  3U1D A;  3FXU A;  3I53 A;  2EB7 A;  4WXD A;  1Z1D A;  4Y15 A;  2M8E A;  3LA2 A;  3ZP5 A;  4A0X A;  1JXS A;  4A5M A;  4EGY A;  3WE3 A;  2XAJ A;  1TQP A;  3E5Q A;  4FT8 A;  3K1P A;  3DQV C;  1B4A A;  3GO5 A;  3JSP A;  3F3X A;  4PCQ A;  3V7R A;  3HYI A;  4BHP A;  4OIN F;  5BMZ A;  2P7C B;  2YU3 A;  3F22 A;  4P96 A;  1JHF A;  5CJ9 A;  2ZCW A;  3OV8 A;  1SD4 A;  4MTE A;  2STT A;  1ZAR A;  3HUG A;  2CGP A;  2HEO A;  3F23 A;  1STZ A;  2A69 F;  1SFU A;  2HFH A;  1B9M A;  3I54 A;  1SD5 A;  3J80 Z;  5LLQ A;  2ACJ A;  4IHS A;  3I4P A;  4WCG A;  3BY6 A;  4EM0 B;  2DLL A;  2BV6 A;  2XGX A;  3HRS A;  5F64 A;  1FP2 A;  5BQT A;  4UVA A;  5DD8 A;  1EH8 A;  4KDP A;  4FX4 A;  3I59 A;  3WTX C;  3C1D A;  2OAZ A;  1SAX A;  3DKW A;  1P92 A;  4O5V A;  2VXZ A;  1YW9 A;  4EJW A;  3ZMT A;  3L00 A;  2IA1 A;  2RKH A;  4G7H F;  1QGP A;  5FLX K;  2VBY A;  4HDV A;  4MQV A;  5KK1 A;  2J5P A;  1K7A A;  3GFL A;  1SD6 A;  5ICE A;  2HKO A;  4EM2 A;  5K5Q A;  4M9X A;  2D1V A;  4OMZ A;  2IA2 A;  3KEO A;  2W57 A;  4OIQ F;  2XIG A;  1K78 B;  4I7H A;  3QP6 A;  1BJA A;  4CHU A;  4KIF A;  3CUQ B;  2FNA A;  1I6X A;  2CG4 A;  1U8R A;  3BJO A;  3TDU C;  2VOO A;  4XRF A;  2JPB A;  1P4W A;  1YO5 C;  4LG0 B;  3L7W A;  1TQI A;  4HOB A;  1H0M A;  3BJ6 A;  1XGS A;  1REP C;  3VFZ A;  3HSE A;  4A5N A;  2QLZ A;  3IRR A;  3S2W A;  5D5X B;  2IJL A;  2HYG D;  4HQE A;  1SFE A;  2HQN A;  1KQ8 A;  2GWR A;  2E1N A;  3IL2 A;  5DUI A;  3IRQ A;  4KYW A;  3KZZ A;  2WC2 A;  1ZYR F;  1HST A;  3BZ6 A;  5L3C A;  1UHM A;  3DP7 A;  1MJB A;  2H09 A;  3G73 A;  4JQF A;  1IZ1 A;  4LG0 A;  1ODD A;  4XLN F;  1IRF A;  3EQL F;  1DUX C;  3M7G A;  2YPR A;  2JRT A;  3TGN A;  4G9Y A;  1KQ0 A;  1XDU A;  2JZY A;  2PEX A;  4A6E A;  3QU6 A;  2G7U A;  3TO7 A;  3V8K A;  3WTW C;  1WKM A;  3ULQ B;  4ESB A;  2PLY A;  4A12 A;  2CSO A;  5JVT A;  2K4J A;  2BE5 F;  1G4D A;  4BH9 A;  3HTU A;  4FX0 A;  3KLN A;  4PZJ A;  1ZLJ A;  3QP5 A;  3D5L A;  1R1V A;  5E1X A;  4ENM A;  2ISY A;  3E97 A;  3HIF A;  1I1S A;  2MA3 A;  4S04 A;  4HX4 A;  1EH6 A;  3KP7 A;  4G7O F;  2UXX A;  2RC4 A;  5LEJ A;  3P9C A;  4MTD A;  4O3M A;  5LRR A;  2ZNY A;  2GQQ A;  1G6N A;  3I71 A;  5IT9 K;  5HLG A;  4L5J A;  2AS5 F;  3SQN A;  2JPC A;  5HVQ C;  2QZ8 A;  1BC7 C;  3RKY A;  3WTY C;  2HQR A;  1S7A A;  2P7V B;  1J9I A;  2A61 A;  1YS7 A;  3F8M A;  3RPQ A;  2A07 F;  2IPQ X;  3WTT C;  1R5G A;  3TKY A;  4U0W A;  3FMS A;  1YIO A;  3C7J A;  2KIM A;  2F2E A;  3NQO A;  4HLX A;  2PQ8 A;  2V79 A;  4EM1 A;  3W6K B;  2MLK A;  2W84 A;  4WX9 A;  3EDP A;  2K7L A;  3PQJ A;  4HYE A;  5DV5 A;  3E5X A;  3LA3 A;  4LD5 A;  4UUV A;  4G7Z F;  1U5T A;  3ABU A;  4GGG A;  2ZXJ A;  4HZF A;  5EEH A;  1MDM B;  2XRN A;  3T8T A;  2VT3 A;  3GW2 A;  4QLC U;  2E1C A;  4RGU A;  4M6X A;  2HOE A;  1PP8 F;  3B02 A;  2WV0 A;  1XCV A;  4CYD A;  2IA0 A;  1QNT A;  2WTE A;  4LMY A;  3GLX A;  3ZQ7 A;  5BPD A;  2LF8 A;  5ICF A;  2ZFW A;  3J81 K;  5DDG A;  3DPT A;  3GUD A;  2LDU A;  2DI3 A;  1LJ9 A;  2CFX A;  3BP8 A;  2P6S A;  2ZKZ A;  3DF8 A;  1SMY F;  1MDM A;  3VOD A;  5HDG A;  2A5Y B;  1XD7 A;  3C18 A;  2G9W A;  2GAU A;  1FX7 A;  3FWE A;  3D0S A;  3DEU A;  1TNS A;  3CJN A;  1J2X A;  4ZYG A;  1BBY A;  3K1M A;  5ILV A;  1FSE A;  5J8F A;  4HW0 A;  5LEK A;  1GXP A;  2Y75 A;  4I01 A;  1B1B A;  1IXS B;  1TQM A;  2FE3 A;  3F6O A;  3HRU A;  1ZN2 A;  4RS8 A;  3JAM K;  1F9N A;  5D5U B;  3B73 A;  4XBF A;  4YFX F;  1W7P B;  1QO0 D;  4G6Q A;  3QPH A;  2VC1 A;  4P9F A;  4IJA A;  4DQ2 A;  4RB3 C;  1T6S A;  1XSV A;  3DPL C;  3BJA A;  3V7C A;  3WTZ A;  2VON A;  1GHC A;  3MAJ A;  2O61 A;  1ZG3 A;  4KIG A;  4S05 A;  4RAZ A;  2EA4 A;  3E3V A;  5ILU A;  2RNJ A;  5HS9 A;  1G3Y A;  3HOS A;  2HDC A;  4UHT A;  3GFM A;  4GXO A;  2IVM A;  1DP7 P;  3MWM A;  1TW3 A;  3SZP A;  5L3E A;  1V4R A;  2IP2 A;  1KA8 A;  1HKQ A;  3KP2 A;  1ZRE A;  5D6F A;  4HDU A;  3CO7 C;  4LB5 A;  1IXC A;  2M1B A;  2PG4 A;  2VE8 A;  1YYV A;  4UV9 A;  3ELK A;  1S8N A;  1T2K A;  2MC3 A;  4I09 A;  1AWC A;  1IN7 A;  1FBQ A;  1BI3 A;  1Y0U A;  5HDN A;  4OOI A;  5H6Q A;  3HTS B;  1KU7 A;  3KP4 A;  5LHI A;  4LB6 B;  1BI2 A;  3HHG A;  3I64 A;  3MEX A;  4AWX B;  4KNY A;  1R22 A;  2Q2E A;  2Z99 A;  1UFM A;  4ESJ A;  1RUO A;  1LDJ A;  4IHT A;  1S29 A;  1B6A A;  2L01 A;  2L4A A;  3F8F A;  2V6C A;  1P6R A;  4WXH A;  4RB1 A;  2D2W A;  4WWC A;  5J8C A;  4KIB A;  2M45 A;  5E17 F;  1E17 A;  3WU0 A;  3ERE D;  3ZMS A;  1WRJ A;  2DAO A;  5D5V B;  2QYO A;  5L3G A;  3M8E A;  1QPM A;  4LK0 F;  3CTA A;  2M5W A;  4I0A A;  5FGM A;  4ENN A;  5CVR A;  4Q5S F;  2FOK A;  2P4W A;  1X3U A;  1Z9C A;  3K2Z A;  4XSX F;  4MEY F;  2QQ9 A;  2MH9 A;  3R6S A;  4M6Y A;  2F5C A;  1GVJ A;  3TOA A;  4UVB A;  2RV8 A;  3I59 B;  3KFW X;  4BHB A;  5HOO A;  2RVC A;  4BNC A;  3RIR A;  1PP7 U;  1AOY A;  2VOP A;  3GZ5 A;  1HW5 A;  2OA4 A;  1RUN A;  3DXJ F;  3LA7 A;  1G3S A;  1U6G A;  4G6D A;  1R1U A;  2K86 A;  3CDH A;  3NRV A;  5A2Q Z;  4MEX F;  5F6F A;  2ZBK A;  2DO7 A;  2MH2 A;  1HKT A;  3GEZ A;  5K1Y A;  5CYV A;  1J0R A;  3GVA A;  3GFI A;  3BRO A;  4U88 A;  3J81 Z;  1FYL A;  3GXO A;  1Z7U A;  1F1Z A;  4JK1 X;  1LNW A;  1FYM A;  3H92 A;  2KIU A;  3JTH A;  2WWY A;  5DCM B;  2ETH A;  1QZY A;  4Q47 A;  1ZG5 A;  3Q5F A;  2UWM A;  5D5W B;  2X4H A;  5CLS A;  3I0T A;  4M73 A;  1E2X A;  3NEU A;  3WTV C;  1W7P D;  1R36 A;  2Y48 A;  1LEB A;  3DFG A;  4ZYH A;  3R0J A;  3P9I A;  1S3J A;  1ZRD A;  2XAF A;  3E6D A;  1TTY A;  2XAH A;  3BDD A;  5DCM A;  2VOD A;  1YW7 A;  3RKW A;  2ELH A;  2VT2 A;  3KE2 A;  4EJO A;  4L18 B;  3FX3 A;  1FPQ A;  1W5S A;  1Z6R A;  1ZAO A;  4IF4 A;  2P5K A;  2HTJ A;  4EGZ A;  1BN5 A;  5D8K B;  2ESH A;  4L9V A;  4M9Z A;  4LFU A;  1K6O A;  4UV8 A;  3E6B A;  4ZYD A;  3E6C C;  4IVN A;  2Q0O A;  5ERI A;  1HW2 A;  5CVV A;  3CUO A;  5L3B A;  1KYW A;  3KEQ A;  4G8X A;  2O8X A;  1WSU A;  5F1R A;  2FBH A;  1FNN A;  3F8N A;  3U2R A;  2O03 A;  4LLN A;  4IRI A;  4P9U A;  1OYW A;  3JW4 A;  2DPU A;  4EJU A;  1FWZ A;  1HSJ A;  1YQA A;  4B8X A;  5CVU A;  2MD5 A;  2MBF A;  1ZHF A;  2XRO A;  3DV8 A;  4ENK A;  3L9F A;  4IRH A;  2FML A;  1ZRC A;  3T0Y A;  4EMS A;  1JGS A;  4N0B A; 
#chains in the Genus database with same CATH topology
 4B09 A;  1VFC A;  3U9G A;  3KPH A;  4ZYA A;  3RQ4 A;  2M9H A;  3BR2 A;  2FSW A;  2HXO A;  1EJ9 A;  3IV5 A;  5E79 C;  4HQM A;  3IC7 A;  5DTD A;  3S17 J;  4X1E A;  3OYB A;  1QZZ A;  4E7I A;  1C0W A;  3W6V A;  3S32 A;  1DPR A;  1IN6 A;  3JRH A;  1Z0X A;  1Y1W J;  1R71 A;  4LG3 A;  3M3Y J;  5JFR A;  5HNF A;  1JT0 A;  1W5T A;  2BXZ A;  2XHK A;  2ECB A;  3S3M A;  1WGX A;  3OYD A;  1MBK A;  1T0F A;  2BY1 A;  4XLE A;  2HGC A;  1N78 A;  1YHQ I;  1R58 A;  2WAQ N;  4RB0 A;  1UEL B;  4OAY A;  4AIJ A;  4E7L A;  2OTL I;  1FMV A;  5DCF A;  3WGG A;  2R7U A;  1U5T B;  1EKE A;  2KRF A;  1UJ8 A;  1S7O A;  3HOU J;  4QSH A;  4W97 A;  3V8J A;  3ISP A;  2EFO A;  3LSJ A;  1JTY A;  3ZQL A;  2X51 A;  2Z2S B;  2OQR A;  1LEA A;  1XMA A;  2BVM A;  2RDP A;  3HRT A;  2HDW A;  2O5R A;  3OYF A;  5HS7 A;  5DM7 F;  1FMW A;  1HXD A;  3HRM A;  5B3S H;  1JKO C;  4N4N B;  1U8B A;  5M5Y J;  4IZZ A;  2FBI A;  3KCC A;  3AAF A;  1OMI A;  3OYA A;  2FA5 A;  1N25 A;  2KJC A;  2XC7 A;  4PGH A;  1TC3 C;  1X1P A;  2DT5 A;  4CSW A;  4YFN F;  3WTS C;  4ETS A;  3K4J A;  4QPQ A;  3PSF A;  2H1L A;  2P5V A;  4A3I J;  2YR2 A;  3LAJ A;  4A3L J;  1T98 A;  3PNV A;  1O3R A;  2CH0 A;  3CES A;  3MVP A;  1IUY A;  4A2U A;  2OZU A;  3VSL A;  1X4P A;  1G3T A;  1M1E B;  1IN4 A;  2RQQ A;  5J4Y A;  3RDI A;  5BPI A;  1OCT C;  3ZPL A;  5H20 A;  3K4N A;  3IH4 A;  1YRN B;  3RPU A;  3WGI A;  2DOF A;  3KP3 A;  2XGC A;  4OIP F;  2DYR H;  3HHH A;  1JUM A;  2CQX A;  4RM2 A;  2NNN A;  5EGO A;  1RNL A;  3QOP A;  3H0G J;  2LBF B;  1KU3 A;  5JHU A;  2BW3 B;  2H8W A;  3VOE A;  2MFZ A;  1G59 A;  4KA4 A;  3ABM H;  4IOA F;  1P9Q C;  3BCA A;  2FJ1 A;  5FB2 A;  4PSX A;  2CQK A;  2BEO A;  5L3D A;  5M5X J;  2K9Q A;  2HOA A;  1N77 A;  2EK5 A;  4HLY A;  1PUE E;  2XKO A;  3TL4 X;  3ROU A;  1NH3 A;  4ANJ A;  2LF7 A;  1BI0 A;  3IWZ A;  3S1M J;  3WOD F;  4F3Q A;  1QBJ A;  3NAR A;  4D7M A;  5GAD J;  2JA5 J;  3LQR A;  2ID6 A;  3PNT A;  1HF0 A;  2KDO A;  3M1E A;  3ECH A;  1R7J A;  4QWQ A;  3I4M J;  2WA0 A;  4N9H A;  2WV1 A;  1IN8 A;  3OWT A;  1OKR A;  2L4M A;  5EEG A;  2JSC A;  3BTC A;  4RB2 C;  1ETO A;  3EET A;  2PMU A;  1XC5 A;  5LHH A;  2ZME A;  2F6C A;  1YRN A;  4D5C A;  2ZB9 A;  1X2N A;  1I27 A;  5K7H A;  1XN7 A;  5FLX Z;  1U78 A;  3Q3S A;  2L02 A;  5GAH J;  3Q9S A;  1UB9 A;  2VB6 A;  3CUQ C;  5HOD A;  2KZG A;  2FQ3 A;  4IXA A;  2VUM J;  4AYB N;  1SFO J;  4RAF A;  3GF2 A;  1DGR M;  3BG6 A;  4NNJ A;  1WI3 A;  2LBF A;  1ZLK A;  2QEN A;  1ZRF A;  4I76 A;  1U2W A;  2COM A;  4WF2 A;  2O3F A;  3KZY A;  5FFZ A;  3ZQC A;  1DU6 A;  4L5I A;  5E18 F;  4B1R A;  1J59 A;  2Y0M A;  4KUM A;  1W4M A;  3AG2 H;  1Z67 A;  3H9Q A;  1GV2 A;  1F36 A;  4BY7 J;  1QHH D;  1Z91 A;  2UV1 A;  2VL8 A;  4CIC A;  2L7M P;  2OF7 A;  1DU0 A;  3H3U A;  3DBL B;  4MNU A;  2EV0 A;  4RAY A;  4XSZ F;  2XDV A;  4XIC A;  3HOW J;  4HX7 A;  2H27 A;  2O6G E;  1F5T A;  5C44 J;  3ML6 A;  1Z3X A;  2V1X A;  2L7Z A;  2X0L A;  4XLA A;  4L9T A;  4AUX A;  4C30 A;  4CYC B;  1CGP A;  1IRX A;  1YG2 A;  5HS8 A;  1IAW A;  2W82 A;  3H9J A;  1AU7 A;  5JLX A;  3TQN A;  1T95 A;  4JX5 A;  4LGW A;  3L1P A;  3QYB A;  3S1N J;  3A0H C;  3OR1 C;  4ZYE A;  4YG2 F;  1USS A;  5E1W A;  4C3I J;  1ZK8 A;  5EG0 A;  1R4M B;  1O7L A;  1ZGJ A;  3HZJ A;  4BAC A;  2A05 A;  3ZQH A;  1QQI A;  3SEZ A;  4ASN A;  4ZJZ A;  2V1U A;  2P8T A;  2QVO A;  5D4S A;  3F6V A;  3P9K A;  2VI6 A;  1QU3 A;  1TP4 A;  2TDX A;  3PIO F;  1SAN A;  2VJ4 A;  3BQZ A;  4KN7 X;  2A68 F;  2Y2Z A;  5EEA A;  1MZB A;  3FXQ A;  4I0B A;  3RKX A;  3UNG C;  1XGM A;  2VN2 A;  2ME6 A;  1OYY A;  4BJ5 C;  1WJB A;  3HDD A;  1FP1 D;  1BI1 A;  2Z9O A;  2FBK A;  2WBM A;  2K27 A;  3FK6 A;  4R79 A;  3QOE A;  3REO A;  2W00 A;  2LFB A;  5KNL A;  3F8C A;  3Q9V A;  3W2A A;  1ETQ A;  2DU9 A;  2Q2E B;  4GO1 A;  3Q0W A;  4FIS A;  1ITY A;  4GDF A;  1MMD A;  1I5Z A;  3KYD B;  1S9H A;  5J40 A;  4MFD A;  3BG7 A;  5EDN A;  2CFO A;  3CC7 I;  4HF2 A;  2ESN A;  2VBZ A;  2KRH A;  3DWL E;  4PJN A;  1K83 J;  1YIT I;  3T1B A;  3SYT A;  3VB2 A;  1D1A A;  3GTG J;  4Y7N J;  4XRS G;  3EUH C;  3VYT B;  2YU9 J;  4JP0 A;  3WHC A;  1KU2 A;  1X1A A;  1OR7 A;  4DZP A;  3CP2 A;  4BAY A;  5H2F C;  4U7B A;  2VBX A;  2OC6 A;  2VXD A;  4ZDL A;  5LBQ A;  3I3L A;  1D5V A;  2R4G A;  2GXB A;  1SFK A;  3M9A A;  2V9K A;  1OJL A;  2BOL A;  1XGN A;  1R5H A;  2RNG A;  5E20 A;  1OPC A;  1CF7 A;  2ECC A;  2XAG A;  1L3L A;  5E3M A;  3J7A Y;  2KJB A;  1H89 C;  3KYL A;  4H0E A;  3OS0 A;  2L0K A;  5JI6 A;  3R60 A;  5D8L B;  2MLG A;  1B72 B;  5CPR B;  2Y30 A;  5JVG F;  1XDS A;  2AQF A;  4IHY A;  2VBW A;  3U21 A;  3WGH A;  4P5O A;  2EV6 A;  4IRG A;  3TO9 A;  3TBI A;  1XPX A;  2RN7 A;  3L09 A;  5AON A;  5J6X A;  1T38 A;  2PJP A;  1R5I D;  1T39 A;  4HEA 2;  2STW A;  1ZH5 A;  4A3J J;  6PAX A;  1Q1V A;  2P5L C;  4MHG A;  3RZD J;  5KVR A;  2E5N A;  3RJP A;  4I02 A;  2CJJ A;  4UB6 C;  4EJV A;  4PDK A;  1G3W A;  4U0V A;  5TGT A;  5DD4 A;  3KP6 A;  3HSF A;  2MD0 A;  3BR0 A;  1MKM A;  2A6H F;  2M30 A;  3LQQ A;  1TLH B;  4RGR A;  3CC4 I;  4OMY A;  3BPX A;  3H3Z A;  2XPU A;  1O3Q A;  3GLL A;  3D5R C;  5FD6 A;  1Z05 A;  1OYI A;  2KKO A;  3GZN B;  3W2W A;  3FKI J;  5IT9 Z;  1P7I A;  1A35 A;  3RTR A;  4G12 A;  3SFZ A;  1B59 A;  2CU7 A;  4EVI A;  4C3J J;  1WI9 A;  2XB0 X;  5GPC A;  2F4I A;  5B1B H;  2R7Q A;  1D8J A;  2I8D A;  3IKV A;  3MKZ A;  3UKG A;  1BJZ A;  1X3Z B;  4BEH B;  4IEJ A;  4FQG A;  2R7X A;  2BY0 A;  3WG9 A;  3KLO A;  1QVT A;  4II2 A;  5FKO A;  5ICG A;  3HBL A;  3O3K A;  1YTY A;  2GXG A;  2KRC A;  5K5O A;  2DMU A;  3W3C A;  2VLA A;  1E3P A;  2QKM B;  3PUF A;  1OFC X;  5LHG A;  3OYN A;  4A3C J;  1S6L A;  3MZY A;  1K79 A;  3GTL J;  5D4R A;  3WU1 B;  3A03 A;  1ZR4 A;  3SZT A;  1ETV A;  4NHJ A;  2QKL B;  1BR4 A;  1JT6 A;  1OCP A;  3BT9 A;  3O6B B;  5ED4 A;  3CCJ I;  4AC0 A;  3K10 A;  1ONV A;  2OBP A;  4EV0 A;  1X1C A;  1TNT A;  4Z2Y A;  3IKT A;  1A6I A;  4KT5 C;  4KMF A;  3GZ6 A;  4KIS A;  1RIO H;  2KP6 A;  4LK1 F;  1QVU A;  2L3D A;  1OCO H;  2GA2 A;  2IEK A;  4P1W A;  2D1H A;  2BHY A;  2E34 A;  3F72 A;  4D0P A;  2LK2 A;  4LIV A;  3T5X A;  3ZMD A;  3W6J B;  3LSH A;  1MBH A;  3GTQ J;  5F0H A;  1FOW A;  2LG4 A;  3DPU A;  5LD2 C;  2H94 A;  1JHH A;  1IXR C;  3AL0 B;  2M87 A;  2EV5 A;  4BEH A;  2PFB A;  1YIJ I;  3E5U A;  2HVS A;  1O3S A;  2KHM A;  5IP6 A;  1IG7 A;  3G6E I;  2F5F A;  4LIU A;  4B44 A;  1ORK A;  2QSH X;  3I9V 2;  1BIB A;  1WWX A;  4TV7 A;  1BIA A;  1IF1 A;  4B3X A;  2P6T A;  1D0Y A;  4AU7 A;  3EPZ A;  2O0Y A;  4AVP A;  2HYJ A;  2AXL A;  4M72 A;  2XGD A;  2GXA A;  4BXU A;  5JHF A;  3H35 A;  3LSP A;  1D1B A;  1SVM A;  2DBB A;  3CQZ J;  4U7D A;  2DJI A;  1O7F A;  3L2U A;  4NBQ A;  1HBX G;  3ONQ A;  4R1H A;  2MAB A;  4HNT A;  1UMQ A;  3H0D A;  1ON1 A;  3A4C A;  4PFP A;  5IYB J;  2HS5 A;  3K4B A;  1V3F A;  5DEQ A;  1E3H A;  4ESF A;  4ENJ A;  1ZG1 A;  3SHF A;  1J09 A;  1VQO I;  2B0L A;  1S72 I;  4LJZ F;  2R7F A;  3P7N A;  2Y9Z A;  1V55 H;  2EZL A;  3FXR A;  1TBX A;  2CUE A;  1XSX A;  2DFI A;  3JRF A;  2JSP A;  3LL7 A;  3JSO A;  1FY7 A;  1MH3 A;  2FXA A;  4J00 A;  4XLC A;  1YLF A;  2ELJ A;  5TRD A;  1HQC A;  5HLH A;  1OIS A;  2W85 A;  1BC8 C;  2K85 A;  4KIC A;  1YFH A;  4MQ9 F;  4YEL A;  5B66 C;  1RC9 A;  1EV7 A;  4YIF A;  2K9S A;  2L7F P;  3OR2 C;  2PBI A;  4LLG F;  2DA4 A;  4KMU X;  4M71 A;  3J7A O;  1MGT A;  2ZO4 A;  3S3N A;  2V1N A;  3L2C A;  1ULY A;  4AD9 A;  4IPA A;  4U0Y A;  3L2V A;  2QCO A;  4XKB A;  3R4K A;  2ZXW H;  3GYH X;  1IUF A;  4YII A;  3MQ0 A;  4NB5 A;  2QBY B;  3DEW A;  2OD5 A;  1FC3 A;  3CJQ B;  2HI3 A;  3OSG A;  2WB1 A;  1IRG A;  3I5U A;  4Y13 A;  2DA1 A;  4B43 A;  2DQL A;  3OY9 A;  1LFU P;  1KYZ A;  2NOJ B;  3BOQ A;  2ISZ A;  1J75 A;  2EWN A;  1FYK A;  4RM3 A;  3JAM Z;  5D6E A;  3TW7 A;  4LIT A;  1RPW A;  3VEP A;  4MGR A;  4UNO A;  2DK8 A;  2IBD A;  3PQK A;  3ECO A;  2LY2 A;  3MFK A;  2E1M B;  1GXQ A;  2BGC A;  2KMU A;  3PFI A;  3I58 A;  4L9N A;  3HSR A;  1XMK A;  2K02 A;  4M9S A;  4GYG A;  3I4N J;  3R0A A;  2A3S A;  2Q1Z B;  5LGT A;  5BOX A;  2X6Y A;  3N4M A;  5E8I A;  3C2G A;  2X6X A;  1HOM A;  1F4K A;  1LVA A;  3OIP A;  3VSK A;  4W1U A;  2QBY A;  1GLN A;  1D3Y A;  2HYF A;  2ME0 A;  1YX3 A;  1IDY A;  1ON2 A;  3H9G A;  3AKZ A;  5E3O A;  4ZZL A;  1ZGA A;  2OQG A;  1K78 A;  5H6R A;  1UCR A;  2D45 A;  1XTA A;  5FRO A;  3BG5 A;  5CQG A;  3FXM A;  4KIT B;  3CUQ A;  3JRG A;  2M7B A;  4GYI A;  1BOB A;  4XRS A;  3OS2 A;  2DTR A;  5J47 A;  1TWH J;  2QSF X;  3LAP A;  2Z3Y A;  3C3W A;  4HA8 A;  1O57 A;  5HLI A;  3N97 A;  2V1D A;  3ZMZ A;  3NAU A;  2JA8 J;  2JA2 A;  1LPQ A;  3FHZ A;  2XKP A;  2EIL H;  2HR3 A;  5FO5 A;  3GWZ A;  1MJA A;  2X1D A;  1XX5 A;  2M8G X;  1B9N A;  1Z6T A;  4BE1 A;  1LDD A;  3HEF A;  3MCZ A;  1FZP B;  4Y33 A;  2Y31 A;  3A1Y A;  2OU2 A;  4QPO A;  2K40 A;  3K1N A;  3SFI A;  2L2O A;  2ZJP F;  4L0Y B;  4BBS J;  2DPD A;  2VC0 A;  2UZK A;  2B63 J;  1EF4 A;  5JR3 A;  3SEQ A;  3GTJ J;  3SDG A;  2JTV A;  2EJR A;  1V5F A;  4IHX A;  4BQA A;  3OOU A;  2CYY A;  3RYP A;  2DTZ A;  4A3G J;  3HPG A;  1VTN C;  2HVR A;  3L2R A;  3F9K A;  2E7W A;  1EA3 A;  3V4G A;  2DN0 A;  1FOY A;  1ZEL A;  4HPQ A;  5GTH C;  4K2E A;  2CV1 A;  1IW7 F;  2F48 A;  4C2M J;  2EA2 A;  3G3Z A;  2DW4 A;  2V6E A;  4F7Z A;  3BTJ A;  4CZZ A;  2CW8 A;  1ETK A;  5DYM A;  2DA6 A;  2A6E F;  1ZR2 A;  5DM6 F;  3GCM A;  5LGU A;  1WJF A;  1YW8 A;  2Z16 A;  3FMQ A;  4ON0 A;  4YFK F;  3E6M A;  1LVK A;  1LUJ B;  2XV4 S;  1FBS A;  1NHA A;  2HU9 A;  1G8X A;  1TL8 A;  4N9I A;  2HPM A;  2BXY A;  2W25 A;  1KU9 A;  4A0Z A;  4BBR J;  3RI4 A;  3MZH A;  2UXN A;  5F27 A;  4EQQ A;  1Y1V J;  1JKR C;  4E7Z A;  4HV6 A;  2Z33 A;  2EFQ A;  2K9L A;  5BNG A;  1MMG A;  2RGV A;  2R7S A;  4UVC A;  4HST A;  4XOR A;  3CO6 C;  2DXI A;  3WU2 C;  3CCR I;  2XGE A;  3ABL H;  3LWF A;  2CWE A;  1R00 A;  5L3F A;  4JBA A;  2CO5 A;  5E8G A;  5LGN A;  1IJW C;  3S2H J;  1K4S A;  2K3F A;  2DK5 A;  3B6A A;  3M1C A;  3RYR A;  4IHW A;  5LRS A;  1IDZ A;  3EUH A;  4JX4 A;  3LFK A;  2RQP A;  3CDL A;  2HVQ A;  4UXN A;  2UUZ A;  1UST A;  4ZH4 F;  4C2U A;  5B5E C;  4A6D A;  3FM5 A;  1T33 A;  1V5E A;  2CUZ A;  1XCB A;  5EGO B;  3CCS I;  1JJ8 C;  4XLP F;  2Z5U A;  2GBY A;  3TP3 A;  3HOT A;  1FT9 A;  3BZC A;  3GX4 X;  2O7O A;  2EFP A;  1RKT A;  3F8B A;  3TDZ C;  4J01 A;  2CUF A;  2EIM H;  4M74 A;  4DGW B;  4WXC A;  4NC7 A;  4XM3 A;  1SD7 A;  1XB4 A;  5J3L A;  5ILS A;  2YX4 A;  3IAS 2;  3PNY A;  4R8H A;  2YUS A;  4BE0 A;  4BYY A;  1ZKG A;  4L0Z B;  2OZ6 A;  4D9J A;  4BHC A;  3L2W A;  5ICC A;  2NVY J;  1FOK A;  2GM4 A;  2I5U A;  1I1G A;  2Q8K A;  1ETW A;  4Y17 A;  2ZME B;  4BQO A;  2R7R A;  5TJJ A;  2W7N A;  1DPU A;  2NVQ J;  1JTX A;  2H6C A;  3OYC A;  4BQQ A;  2EIJ H;  3M07 A;  3J80 K;  3K69 A;  3V7S A;  1R1T A;  4OU0 A;  1O3T A;  1U3E M;  3R61 A;  1P4X A;  2KIF A;  4HF0 A;  2QA4 I;  3O2P E;  1SMT A;  2EH3 A;  4Q48 A;  5FFX A;  2VIX A;  1FLI A;  2EFW A;  4CDG A;  2F5D A;  1BW6 A;  2FX0 A;  3K0L A;  3GTP J;  2R93 J;  1VQ8 I;  3LSG A;  5A2Q K;  4IL6 C;  2H8R A;  2ZJ2 A;  3EYY A;  2DDB A;  2FQ4 A;  2HNH A;  2P0W A;  4CXF A;  1RI7 A;  2NNY A;  1HC8 A;  3WHB A;  3GME A;  2LRE A;  4PUS A;  1NK2 P;  2IS4 A;  3QRF F;  2HZT A;  2PI0 A;  2XAU A;  3DKX A;  2B7E A;  4F92 B;  1ZQ3 P;  4IO9 F;  2KFD A;  4Z6Y A;  3QPT A;  3BZK A;  5AIP A;  2J5O A;  2NRA C;  1WJA A;  2NOG A;  5E1Z B;  1IV8 A;  1XSD A;  2NVU B;  2HKX A;  3T8R A;  5IT3 A;  2NS0 A;  2DJN A;  2V26 A;  3OIQ A;  4DZJ A;  3E0J B;  4WK8 F;  2F5E A;  4AIH A;  2LKP A;  2JT1 A;  2R3S A;  3QU3 A;  1J7K A;  2NS8 A;  3M8F A;  2PJR A;  3BLY A;  5DUK A;  1FSH A;  2VKV A;  1P2F A;  2ZJR F;  3FM3 A;  3J7Y J;  5EG0 B;  2O9L A;  3CCV I;  4I99 C;  1WCM J;  5GP9 A;  1FTZ A;  2WAF A;  3BWG A;  4RLQ A;  1P4A A;  2K9M A;  4XID A;  1ZGW A;  3F0C A;  2GA1 A;  3FDY A;  1X3W B;  4A93 J;  2XF7 A;  2PMH A;  2QGU A;  2FF4 A;  3FMR A;  1EH7 A;  4OIO F;  3ASO H;  2XAS A;  2YX7 A;  3CJT B;  4BUP A;  1APL C;  3PJR A;  4II3 A;  4XL9 A;  5CVJ A;  2EBI A;  4AM3 A;  1WFX A;  1D8K A;  2OUM A;  5AIQ A;  2Y0S A;  4KN4 X;  3KP5 A;  3HG9 A;  1L0O C;  4QIW N;  3CCU I;  2LP0 A;  3IWF A;  2HZD A;  5FD5 A;  5HDK A;  1V5G A;  1PDN C;  2DOA A;  3QAH A;  5F0C A;  3QOD A;  4OIR F;  3HM5 A;  1H9G A;  3JTG A;  2DA2 A;  2ZSH B;  3FXJ A;  2FEZ A;  3C2B A;  4RGX A;  5IOZ A;  1YJ9 I;  4NDL A;  4BY1 J;  1RZ4 A;  4LLL A;  3IH2 A;  4GCV A;  1Y0N A;  2XUB A;  2QUF A;  4A0Y A;  4XN3 A;  2GIV A;  2DYS H;  2QQB A;  3ABT A;  3WE2 A;  4HX8 A;  1VQ5 I;  1LQ1 A;  1IN5 A;  2LNB A;  3FZV A;  4RAG A;  2VJ5 A;  4I2O A;  3D5S C;  4HG2 A;  2BYV E;  5KAI C;  3WTU C;  4LOC A;  4FHT A;  4G94 A;  2G7H A;  1U9O A;  2CS3 A;  3A0B C;  4F93 B;  4QTR A;  3BR3 A;  1BOA A;  3CCM I;  1SC7 A;  4BXX J;  1CF7 B;  2PN6 A;  2HWV A;  5FRM A;  1LB2 A;  4AVZ A;  3ASN H;  2L9N A;  1UZC A;  3DKY A;  3S93 A;  1H9T A;  3OYG A;  2QWW A;  1B8I B;  2AHQ A;  1SVL A;  2E35 A;  4A3M J;  2PMZ A;  2QSG X;  2KLO A;  2QF7 A;  5FLV A;  2H6B A;  1FJL A;  1WQ2 A;  1Q1H A;  3CF2 A;  4CO8 A;  3SXY A;  4CGZ A;  3TO6 A;  1BR2 A;  2BBY A;  3VDX A;  3HL2 A;  3COA C;  3GFJ A;  2ADU A;  1Z7L A;  2MGQ A;  2IGK A;  2HTS A;  5K7F A;  1HW1 A;  2GZW A;  3ZMU A;  3VWB A;  1LE8 B;  3K4L A;  1XGO A;  1WH5 A;  3IHU A;  2OCC H;  1W7P A;  4PJJ A;  1TWA J;  2W1O A;  3CLO A;  4X6A J;  4ZZD A;  3JCU C;  4C3H J;  3RCO A;  4CCJ A;  1TWC J;  3ZN0 A;  2IAI A;  3ZN1 A;  2IW5 A;  2IT0 A;  4L9J A;  3H5R A;  1KQ9 A;  2HPI A;  2XAQ A;  2W24 A;  3FF5 A;  2LOO A;  1KZH A;  3TOB A;  2OTJ I;  1TT5 B;  4P55 A;  3I55 I;  4F52 A;  1MJ9 A;  4HAM A;  1R23 A;  4HV5 A;  2R7D A;  4NQW B;  3CDI A;  3DCF A;  2JVG A;  3EYI A;  4O6J A;  1J5Y A;  1B8I A;  2HQ5 A;  3LST A;  2HDD A;  1LFP A;  1R6R A;  3K9T A;  1JE8 A;  3DTE A;  3X2Q H;  2R7Z J;  3JRI A;  4AIK A;  2DQR A;  4KFC A;  3VYR B;  4HF1 A;  2YSR A;  5HNH A;  1W0T A;  2VE9 A;  5K5R A;  5DS9 A;  2ZFU A;  3TW6 A;  4Q4Z F;  1VQL I;  4MIM A;  2XPV A;  3ZMV A;  1DDN A;  4DYQ A;  3CCQ I;  2FMY A;  1TW2 A;  2V9V A;  2XVC A;  1WPK A;  3BR1 A;  3FBN B;  2FU4 A;  4DIQ A;  3KET A;  1LE8 A;  2LSO A;  2VKH A;  3F21 A;  1FBU A;  2FRH A;  3OOP A;  4PSW A;  2NYX A;  2FNP A;  3BPV A;  3RPU D;  4EJT A;  4HBL A;  4PGG A;  1UHW A;  2NAZ A;  2QM3 A;  2EFN A;  2R92 J;  1U5T C;  1BM9 A;  2CW0 F;  4UY8 I;  1I6H J;  2Z1D A;  1SFX A;  3LSI A;  3GTM J;  2E7X A;  1A31 A;  2QQA A;  1KGS A;  4CCO A;  4DNC A;  1W36 D;  5GAG J;  2IGN A;  4I98 B;  4N4O B;  3V8L A;  1JI8 A;  1MND A;  5CVI A;  3H36 A;  4CCN A;  5BS6 A;  4PJL A;  1MNM C;  2XRL A;  4NQW A;  1HKS A;  1MD0 A;  3ZRG A;  1LDK B;  2L54 A;  1W36 C;  1A04 A;  2LD5 A;  2ID3 A;  3CCY A;  1RR8 C;  4E70 A;  1VQ9 I;  4NUB A;  1LKX A;  2ZNZ A;  3MN2 A;  2K4B A;  5F08 A;  2C6Y A;  2IRF G;  4RGS A;  5FLM J;  1Z3Y A;  3FIW A;  4RA2 A;  1YS6 A;  1YJW I;  3U1D A;  3FXU A;  3I53 A;  3HPH A;  3CP8 A;  1VQ7 I;  2EB7 A;  1X4O A;  4WXD A;  1Z1D A;  2R7W A;  3KYC B;  4M3B A;  4Y15 A;  4GFB A;  1IRZ A;  2M8E A;  3LA2 A;  3ZP5 A;  5IYC J;  2DFF A;  4A0X A;  1JXS A;  4A5M A;  4EGY A;  4G6T B;  3WE3 A;  4FTH A;  4IOC F;  2XAJ A;  2EZH A;  1TQP A;  3E5Q A;  4FT8 A;  2LKX A;  3K1P A;  4E6K G;  3AG3 H;  4XON A;  3DQV C;  2CQQ A;  1B4A A;  3GO5 A;  5M5W J;  3CCE I;  3JSP A;  3RSN A;  3QPL A;  4DYR A;  2VPL A;  3F3X A;  4PCQ A;  2MYS A;  3V7R A;  3HYI A;  2IGO A;  4OIN F;  4BHP A;  5BMZ A;  2P7C B;  2YU3 A;  3E1S A;  3F22 A;  4P96 A;  1JHF A;  3KX2 A;  5CJ9 A;  3DU5 A;  4B4C A;  2RRE A;  2L9V A;  2ZCW A;  3OV8 A;  1SD4 A;  4IKF A;  4MTE A;  2STT A;  3CJR B;  2JVH A;  1ZAR A;  5CKT A;  3HUG A;  3H5N A;  2X1E A;  2W48 A;  2CGP A;  2WY7 Q;  1MBF A;  2LY9 A;  2HEO A;  4V2G A;  1VQM I;  3F23 A;  1STZ A;  2A69 F;  4X0G A;  1SFU A;  2HFH A;  4RDU A;  4OWR B;  2LLK A;  1B9M A;  3I54 A;  1SD5 A;  3E7L A;  4M3E A;  1AKH A;  1VQ4 I;  1R49 A;  3J80 Z;  5LLQ A;  2E2J J;  1BA5 A;  4L5E A;  1I3A A;  2CUJ A;  2ACJ A;  4IHS A;  2E71 A;  3I4P A;  4M6V A;  1Z77 A;  5EZH A;  2M4G A;  4WCG A;  3BY6 A;  4EM0 B;  2DLL A;  4PK4 A;  1Z21 A;  1Y8Q B;  3OYM A;  2BV6 A;  2XGX A;  2KQR A;  2H1K A;  3HRS A;  5F64 A;  1FP2 A;  2XPW A;  5BQT A;  1JKP C;  1MBG A;  4UVA A;  3HXL A;  1PYV A;  3SJM A;  5DD8 A;  1Y39 A;  2JK3 A;  1EH8 A;  4KDP A;  2M3A A;  3D1N I;  1MMS A;  4FX4 A;  2DT6 A;  1IO2 A;  1RR7 A;  2X6W A;  3I59 A;  4S0H B;  1MBE A;  1GT0 C;  3EUK L;  2VQC A;  4ITV A;  2DMQ A;  1GDT A;  3WTX C;  3C1D A;  3A2K A;  2DOD A;  2OAZ A;  3HOX J;  1GV5 A;  1SAX A;  3DKW A;  1P92 A;  4XMY A;  4DOZ A;  4O5V A;  3ZXS A;  2VXZ A;  3VPR A;  1YW9 A;  1D0Z A;  3LSM A;  4EJW A;  1FTT A;  2L9S A;  1R4N B;  1FEX A;  2ZSI B;  2VQH A;  3B6C A;  3ZMT A;  4XQF A;  3GTK J;  3IP4 B;  2JRM A;  3L00 A;  3OYK A;  2IA1 A;  1D5Y A;  2RKH A;  4G7H F;  3FXO A;  1QGP A;  5FLX K;  4NC6 A;  2VBY A;  1OLT A;  1XMX A;  4HDV A;  1DGW Y;  3BTI A;  3O8G A;  4MQV A;  5KK1 A;  2J5P A;  2P81 A;  3DTI A;  1K7A A;  3GFL A;  2ELK A;  1SD6 A;  2LMD A;  2M34 A;  5ICE A;  2HKO A;  4EM2 A;  4MO7 A;  2KZV A;  2VPR A;  3FIS A;  3HKZ A;  4E7S A;  2FD5 A;  5K5Q A;  2RAE A;  4M9X A;  2D1V A;  4OMZ A;  2IA2 A;  3KEO A;  2W57 A;  4FE7 A;  4OIQ F;  2WY8 Q;  2XIG A;  1K78 B;  4I7H A;  3QP6 A;  3S2D J;  1MBJ A;  1BJA A;  4CHU A;  2X1C A;  4KIF A;  3BG9 A;  3CUQ B;  5M3F J;  2FNA A;  1I6X A;  2CG4 A;  1U8R A;  3BJO A;  2Y0S N;  2K3P A;  3TDU C;  2VOO A;  4XRF A;  2JPB A;  1P4W A;  1ETX A;  1YO5 C;  4LG0 B;  3BTL A;  4A69 C;  2A6T A;  5GAE J;  3L7W A;  1TQI A;  4HOB A;  1H0M A;  3BJ6 A;  4BS9 A;  1XGS A;  2VJI A;  3JRD A;  1REP C;  3VFZ A;  3HSE A;  1QZE A;  2QLZ A;  4A5N A;  3LSK A;  2EIN H;  1FIP A;  3IRR A;  3S2W A;  1U9N A;  5D5X B;  2IJL A;  3IH3 A;  2EZK A;  2HYG D;  4HQE A;  2X6O A;  2KL4 A;  1SFE A;  2HQN A;  3BCB A;  2GWR A;  1KQ8 A;  2E2H J;  2E1N A;  1FOX A;  3IL2 A;  1WHU A;  4Y3O A;  5DUI A;  2M4K A;  3IRQ A;  3L2Q A;  4KYW A;  1S5L C;  3KZZ A;  4J19 A;  1PUF B;  1JGG A;  2WC2 A;  2X85 A;  3IAM 2;  2F5V A;  1ZYR F;  2IXS A;  1HST A;  5J1Y A;  1AHD P;  3BZ6 A;  3H5A A;  5L3C A;  1UHM A;  1BL0 A;  1JUP A;  3DP7 A;  1MJB A;  1X1D A;  2H09 A;  3U1K A;  3G73 A;  2ZC2 A;  4ZDP A;  3A01 A;  2K5C A;  1IZ1 A;  4JQF A;  3TED A;  1WH7 A;  4LG0 A;  2KPM A;  1ODD A;  3KIO A;  4D1Q A;  1QPI A;  4XLN F;  1IRF A;  3EQL F;  5C3E J;  1IV6 A;  3BR5 A;  3IUO A;  4KJZ A;  1DUX C;  3M7G A;  2YPR A;  2JRT A;  4UUS B;  1XS9 A;  3OL4 A;  3TGN A;  4G9Y A;  1KQ0 A;  2O8K A;  2PMZ N;  1VND A;  1XDU A;  4IHV A;  2JZY A;  2R0Q C;  2PEX A;  4V2F A;  4A6E A;  5TIS C;  1GUU A;  3QU6 A;  1DP3 A;  2G7U A;  1A6Q A;  2V4J C;  4XNF A;  3OYL A;  3TO7 A;  3V8K A;  1H88 C;  3K2A A;  1PUF A;  3WTW C;  4MLO A;  4FCY A;  4CH7 A;  1RKW A;  1WKM A;  3CMM A;  3RZO J;  4U87 A;  3ULQ B;  1X2M A;  3QYF A;  3K4M A;  4ESB A;  3G71 I;  4A3E J;  1ACI A;  2PLY A;  4FE4 A;  4A12 A;  1BW5 A;  2CSO A;  4BL0 B;  2K4J A;  5JVT A;  2BE5 F;  1G4D A;  2JUG A;  4ZC3 A;  4BH9 A;  5FKN A;  1HDD C;  1MNE A;  1QA6 A;  4UUS A;  3HTU A;  5KAF C;  3QQA A;  1H8A C;  3S16 J;  2E36 A;  4IQJ A;  3K4C A;  1G2H A;  3WG7 H;  4FX0 A;  3KLN A;  4PZJ A;  1ZLJ A;  2HQA A;  3KZI C;  3ZOB A;  3AG4 H;  2JA6 J;  1MH4 A;  3QP5 A;  3D5L A;  1R1V A;  5E1X A;  1SEU A;  4ENM A;  1YX5 A;  2ISY A;  4PFO A;  4DJA A;  4XLH A;  3E97 A;  3HIF A;  2MW8 A;  2BHZ A;  1I1S A;  2MA3 A;  5C4J J;  3ERM A;  4S04 A;  4HX4 A;  1EH6 A;  3BC8 A;  3KP7 A;  3AFH A;  3LOC A;  3CZ6 A;  4G7O F;  2UXX A;  2CV2 A;  2RC4 A;  1ZTR A;  3O8H A;  4D5F A;  3FXK A;  5LEJ A;  4I6Z A;  4BJT A;  1XG1 A;  2I10 A;  3P9C A;  2VKD A;  4MTD A;  4O3M A;  2BY2 A;  5LRR A;  2MSY A;  4UUT A;  3HGY A;  3HJE A;  2ZNY A;  4ABZ A;  2GQQ A;  2W4S A;  1G6N A;  3I71 A;  2FUG 2;  5IT9 K;  2Y69 H;  1W5C C;  5HLG A;  4L5J A;  2AS5 F;  3SQN A;  2JPC A;  5HVQ C;  2QZ8 A;  4XKV A;  4CUG A;  4CZC A;  1BC7 C;  3RKY A;  3WTY C;  2IS2 A;  4ZDO A;  2HQR A;  1S7A A;  2P7V B;  5FKL A;  1QRY A;  1TT0 A;  2X48 A;  1VF9 A;  2CMP A;  4RBO A;  1J9I A;  3G4S I;  2A61 A;  3MD2 A;  3AL0 C;  2LYC A;  3QWL A;  1YS7 A;  3VYS B;  3F8M A;  2JA7 J;  5F1J A;  3RPQ A;  2EIK H;  2KIS A;  2PX9 A;  2K9N A;  1VQP I;  2ZXI A;  2A07 F;  2VQG A;  2IPQ X;  2JWT A;  3WTT C;  1R5G A;  2EQR A;  4U0W A;  3TKY A;  3FMS A;  4EAT A;  1YIO A;  3S1Q J;  1Y8R B;  3C7J A;  2AXT C;  2KIM A;  2F2E A;  3HB9 A;  3NQO A;  2PQ8 A;  2V79 A;  4HLX A;  4EM1 A;  3CF5 F;  3W6K B;  4ZTF A;  4E7J A;  2MLK A;  2W84 A;  4WX9 A;  3EDP A;  3S14 J;  1JJ6 C;  3PIP F;  2E60 A;  3K4K A;  2K7L A;  3CCL I;  3PQJ A;  2PJR B;  3FKJ A;  4F91 B;  4HYE A;  5DV5 A;  3E5X A;  3LA3 A;  4LD5 A;  4UUV A;  1U5T A;  4G7Z F;  3ABU A;  4GGG A;  2ZXJ A;  4HZF A;  2Y9Y A;  5EEH A;  2ICW G;  1MDM B;  2XRN A;  3T8T A;  2VT3 A;  4ZTJ A;  3GW2 A;  4QLC U;  2WAE A;  2E1C A;  4RGU A;  2L7K A;  4M6X A;  2HOE A;  4E7K A;  4PJ0 C;  1PP8 F;  3B02 A;  4BDZ A;  1MSE C;  2R7T A;  2WV0 A;  3A02 A;  1HLV A;  3JRB A;  2EPF A;  1XCV A;  4CYD A;  5IY5 H;  5M3M J;  2IA0 A;  1QNT A;  1ETY A;  2DT7 B;  2WTE A;  4LMY A;  3GLX A;  3ZQ7 A;  2LKS A;  5BPD A;  4EEF G;  2LF8 A;  2OPT A;  2XSJ C;  2NVX J;  5ICF A;  2ZFW A;  2E1O A;  3J81 K;  5DDG A;  4CA0 A;  3DPT A;  3C2H A;  3GUD A;  2LDU A;  3HC7 A;  1F43 A;  2DI3 A;  1LJ9 A;  2CFX A;  3W2V A;  2KDZ A;  2VAS A;  1D0X A;  2LC2 A;  3BP8 A;  2GLO A;  2P6S A;  2ZKZ A;  4FET A;  4IQ4 A;  3DF8 A;  1SMY F;  3ZGK A;  3G1O A;  1MDM A;  4XN0 A;  3VOD A;  3TP0 A;  1NG6 A;  5LFA A;  5HDG A;  2A5Y B;  5JLW A;  1XD7 A;  3C18 A;  2G9W A;  1TWG J;  2GAU A;  4YEJ A;  1FX7 A;  3FWE A;  1SVO A;  3D0S A;  3DEU A;  1YI2 I;  1VZ0 A;  1TNS A;  3CJN A;  3J7Z I;  2BW3 A;  1J2X A;  4M3G A;  3V42 A;  3AG1 H;  2OJE D;  2NS7 A;  4ZYG A;  3CD6 I;  1BBY A;  2E1M C;  3K1M A;  2CQ7 A;  4DW6 A;  1Y56 A;  3HKZ N;  3LMM A;  4V19 K;  3S1R J;  4XOP A;  1D1C A;  2MC4 A;  5ILV A;  1FSE A;  2DA5 A;  5J8F A;  2WB1 N;  4HW0 A;  2IGM A;  5LEK A;  1GXP A;  1E3O C;  5EYR A;  1I50 J;  3PM1 A;  1RET A;  5FKM A;  2Y75 A;  1SAU A;  4I01 A;  1B1B A;  1IXS B;  5EF6 A;  1TQM A;  2BY3 A;  2FE3 A;  3F6O A;  4H4K C;  2GOX B;  3HRU A;  1ZN2 A;  4RS8 A;  5CQE A;  3JRE A;  2YS9 A;  2VJJ A;  3JAM K;  1F9N A;  5E3L A;  5D5U B;  3EUA A;  3DLL F;  3B73 A;  3VYU B;  2TCT A;  3DTK A;  4XBF A;  4YFX F;  3P5J A;  1W7P B;  3CMA I;  1QO0 D;  2HOS A;  3M8J A;  4G6Q A;  3QPH A;  3SZG A;  2VC1 A;  4BU2 A;  4P9F A;  2QEX I;  3FK7 A;  4IJA A;  3MKL A;  4HSR A;  4DQ2 A;  4RB3 C;  1T6S A;  1XSV A;  3DPL C;  5FRN A;  3BJA A;  3V7C A;  1UAA A;  9ANT A;  3WTZ A;  3OS1 A;  4XK4 A;  2VON A;  1GHC A;  3MAJ A;  2NXN B;  2O61 A;  2M0M A;  2G0E A;  1ZG3 A;  4KIG A;  4S05 A;  1YJN I;  4B47 A;  4RAZ A;  2EA4 A;  3E3V A;  5ILU A;  2RNJ A;  5HS9 A;  3OYH A;  1Y6I A;  1G3Y A;  3HOS A;  4RLF A;  2HDC A;  4CYC A;  4UHT A;  3G1M A;  3RQI A;  1T0F C;  3GFM A;  4GXO A;  3G1L A;  2E5Z A;  2IVM A;  2LR8 A;  2XF5 A;  5J1R A;  2R7O A;  3PL8 A;  1DP7 P;  3MWM A;  5E3N A;  1TW3 A;  5GPA A;  3SZP A;  3I56 I;  4DBQ A;  5L3E A;  3OSF A;  1V4R A;  1IC8 A;  4E4H A;  2IP2 A;  4A3K J;  1KA8 A;  1HKQ A;  3KP2 A;  1HCR A;  1VQ6 I;  1ZRE A;  5D6F A;  4HDU A;  1RES A;  3CO7 C;  3JR9 A;  4A3F J;  1IXC A;  2JJ7 A;  5KHD A;  4LB5 A;  5FJ8 J;  2M1B A;  3DU6 A;  2HOT A;  3DBH B;  2PG4 A;  1K61 A;  2VE8 A;  3ZQF A;  1YYV A;  4UV9 A;  1WJE A;  3S8P A;  3ELK A;  1S8N A;  4B3A A;  1T2K A;  2DFH A;  2MC3 A;  4CCL A;  3OIO A;  4I09 A;  1AWC A;  1IN7 A;  1FBQ A;  1BI3 A;  1Y0U A;  4NC8 A;  2DOE A;  5HDN A;  4OOI A;  2CV0 A;  3PO3 J;  2IS6 A;  5H6Q A;  3HTS B;  5FKK A;  3PUB A;  1KU7 A;  3KP4 A;  5F04 A;  5LHI A;  5HLT A;  5IPA A;  4LB6 B;  1BI2 A;  4GRI A;  5IOY A;  3HHG A;  3I64 A;  1S7E A;  3MEX A;  3SDB A;  4AWX B;  4KNY A;  1R22 A;  2Q2E A;  2Z99 A;  3K70 D;  2FOW A;  1UFM A;  5J4V A;  4XOT A;  3PO2 J;  4ESJ A;  1RUO A;  1LDJ A;  4IHT A;  1OCZ H;  1S29 A;  4B48 A;  1B6A A;  2L01 A;  2L4A A;  4D7N A;  3F8F A;  2DMP A;  1W0U A;  2V6C A;  3H1C A;  1P6R A;  4WXH A;  4RB1 A;  2D2W A;  3K70 C;  4MFE A;  2DCE A;  4WWC A;  3H3V K;  3HGG A;  5J8C A;  3PFY A;  4KIB A;  2M45 A;  4FAS D;  5E17 F;  1X1B A;  1E17 A;  3WU0 A;  3ERE D;  3ZMS A;  3CC2 I;  3HUG B;  1WRJ A;  2DAO A;  2GIZ A;  2WAQ A;  2JN6 A;  1WJ5 A;  5D5V B;  2QYO A;  5L3G A;  3M8E A;  1QPM A;  3G2B A;  1VI0 A;  4LK0 F;  3CTA A;  1JUS A;  1X58 A;  2COB A;  2M5W A;  1AKH B;  3GTO J;  1I39 A;  2OCE A;  4I0A A;  5J1U A;  5FGM A;  4HRI A;  3OL3 A;  4ENN A;  2M0C A;  5C4X J;  1K6Y A;  1B72 A;  5CVR A;  2XB5 A;  2FOK A;  2P4W A;  1X3U A;  2BVL A;  1Z9C A;  4Q5S F;  2IS1 A;  4YIR X;  3K2Z A;  1NK3 P;  2DMT A;  4XSX F;  4MEY F;  2ZME C;  2QQ9 A;  1V54 H;  2MH9 A;  3ZR8 X;  3FBI B;  2CRG A;  3UR3 C;  2XSD C;  1VQN I;  3R6S A;  4M6Y A;  2F5C A;  4AID A;  5IP9 J;  1ERD A;  1GVJ A;  3TOA A;  4UVB A;  4C2T A;  2RV8 A;  3I59 B;  3KFW X;  2VQL A;  4BHB A;  5HOO A;  2RVC A;  3ABK H;  2OV7 A;  4BE2 A;  4BNC A;  3MMY B;  2F4O B;  3OYE A;  4HNU A;  1WJC A;  3RIR A;  1LFB A;  4DBR A;  1PP7 U;  5K7Z A;  1PJR A;  1AOY A;  2VOP A;  2GOM A;  3GZ5 A;  1HW5 A;  2OA4 A;  1ENH A;  1K4T A;  1RUN A;  1X19 A;  3DXJ F;  1HA8 A;  3LA7 A;  1G3S A;  3OYJ A;  2ZJQ F;  3MKY B;  1U6G A;  1YE9 A;  4G6D A;  1R1U A;  2K86 A;  2R5Y B;  3CDH A;  2KIQ A;  1WJD A;  3NRV A;  4BKX A;  3OMY A;  1GVD A;  2LRD A;  1R9T J;  2AQE A;  2CW7 A;  4CCK A;  5A2Q Z;  4MEX F;  1MW7 A;  4A3D J;  1U0J A;  3RKQ A;  4DYC A;  5B1A H;  3K6G A;  5F6F A;  3DBR B;  3BG3 A;  2ZBK A;  1UG0 A;  2DO7 A;  2JMW A;  2MH2 A;  1HKT A;  4M3F A;  3GEZ A;  5K1Y A;  5CYV A;  2QQ8 A;  1J0R A;  3GVA A;  1MSF C;  3MKW B;  3GFI A;  3LSR A;  1N75 A;  1T08 B;  1JKQ C;  3Q0U A;  3BRO A;  4OAZ A;  4RMN A;  4A3B J;  4U88 A;  3J81 Z;  1FYL A;  3GXO A;  4M3D A;  2D5V A;  1Z7U A;  1F1Z A;  5GTI C;  4JK1 X;  4XRM A;  1LNW A;  4AYB A;  2AO9 A;  2R5Y A;  3H92 A;  3QPS A;  1FYM A;  2KIU A;  3JTH A;  2WWY A;  5DCM B;  1W1W E;  2DA3 A;  2ETH A;  1QZY A;  3FHN A;  1MIJ A;  5KCM A;  4KT6 A;  4Q47 A;  1ZG5 A;  3ZQG A;  2JQ7 A;  3LFU A;  2X9D A;  3Q5F A;  3PSI A;  3ZCO A;  3TMO A;  2WAD A;  2UWM A;  1OCR H;  5D5W B;  2X4H A;  3BQY A;  5CLS A;  2N8G A;  3I0T A;  3FXL A;  3DLA A;  1I3Q J;  1BR1 A;  2VKE A;  4M73 A;  2E2I J;  1E2X A;  3HOZ J;  3NEU A;  3WTV C;  1W7P D;  3CMY A;  3LNQ A;  1R36 A;  3A01 B;  3S3O A;  1OR7 C;  1T8I A;  1E0E A;  3K7A J;  4BDY A;  1DQU A;  2DDA A;  2Y48 A;  1LEB A;  3NWT A;  4UB8 C;  3DFG A;  2R5Z B;  3M4O J;  3HOV J;  4JYK A;  4ZYH A;  3JRC A;  3R0J A;  3P9I A;  1S3J A;  2HXI A;  1PVE A;  1WVR A;  1RRJ A;  1ZRD A;  1OQY A;  3Q0V A;  2XAF A;  2V9P A;  2E19 A;  3E6D A;  1TTY A;  1TZL A;  2XAH A;  2L5Q A;  3BDD A;  5DCM A;  2VOD A;  1YW7 A;  3RKW A;  3ESW B;  2ELH A;  1OCC H;  2VT2 A;  3KE2 A;  1VQK I;  1AA7 A;  3BR6 A;  4EJO A;  1YOV B;  1NTC A;  4XKC A;  3ZQQ A;  4L18 B;  3FX3 A;  1FPQ A;  1QHG A;  2DA7 A;  1W5S A;  1Z6R A;  2M2E A;  1ZAO A;  4IF4 A;  2V7F A;  3GBG A;  2P5K A;  1O4X A;  2HTJ A;  4EGZ A;  3QYE A;  1BN5 A;  5D8K B;  2LTP A;  3KEY A;  2ESH A;  4L9V A;  4M9Z A;  2LVS A;  1MMN A;  2M7A A;  4LFU A;  1WZ2 A;  1K6O A;  4UV8 A;  2R5Z A;  1UHS A;  3E6B A;  4ZYD A;  3E6C C;  3NWS A;  2DMN A;  1T56 A;  4JX6 A;  4IVN A;  2KT0 A;  2Q0O A;  5IP7 J;  3ZQI A;  4Y4R A;  2TRT A;  5ERI A;  1HW2 A;  2CQN A;  1A5J A;  2EZI A;  5CVV A;  3CUO A;  5EJC A;  1KYW A;  2A5W A;  3KEQ A;  4G8X A;  4XLF A;  4BQN A;  4BXF A;  5L3B A;  1HDP A;  3CME I;  3HOY J;  4C9Y A;  2O8X A;  1WSU A;  3S15 J;  5F1R A;  3OYI A;  2XF6 A;  2BZT A;  2FBH A;  1FNN A;  1POG A;  3F8N A;  4HNV A;  4JOM A;  3U2R A;  2O03 A;  4LLN A;  5IYD J;  2LY1 A;  2R7V A;  1CQT A;  4IRI A;  4P9U A;  2JUC A;  3MZ8 A;  1NG7 A;  1OYW A;  1UG2 A;  3JW4 A;  2DPU A;  4EJU A;  5EZG A;  4XKW A;  1FWZ A;  1HSJ A;  1YQA A;  2MG4 A;  5F0F A;  4B8X A;  3N05 A;  4BJ6 C;  1P7J A;  4IX7 A;  5CVU A;  1TWF J;  1FIA A;  2MD5 A;  2MBF A;  2B9S A;  1ZHF A;  1A36 A;  4CCM A;  4XR6 A;  2XRO A;  1IGN A;  2F4M B;  3DV8 A;  4ENK A;  3DEE A;  1KON A;  4PJM A;  3L9F A;  4YRV A;  4IRH A;  4BGD A;  2FML A;  1ZRC A;  1MMA A;  2ZXH A;  3CLQ A;  2LH9 A;  3JRA A;  3T0Y A;  2NVT J;  4Y52 J;  4E7H A;  4EMS A;  1JGS A;  2L9R A;  4F55 A;  4N0B A;  2DFE A; 
#chains in the Genus database with same CATH homology
 4B09 A;  3U9G A;  2FSW A;  4HQM A;  3IC7 A;  1QZZ A;  1C0W A;  1DPR A;  1IN6 A;  5JFR A;  1W5T A;  2XHK A;  1T0F A;  2HGC A;  1R58 A;  4RB0 A;  4AIJ A;  5DCF A;  3WGG A;  1U5T B;  2KRF A;  1S7O A;  3V8J A;  3ISP A;  2EFO A;  2OQR A;  1LEA A;  1XMA A;  2RDP A;  3HRT A;  5HS7 A;  1HXD A;  3HRM A;  2FBI A;  3KCC A;  3AAF A;  1OMI A;  2FA5 A;  2KJC A;  4PGH A;  2DT5 A;  4YFN F;  3WTS C;  4ETS A;  2P5V A;  2YR2 A;  3LAJ A;  1T98 A;  1O3R A;  1IUY A;  4A2U A;  2OZU A;  1G3T A;  1IN4 A;  3RDI A;  5BPI A;  3ZPL A;  5H20 A;  3RPU A;  3WGI A;  3KP3 A;  4OIP F;  3HHH A;  2NNN A;  1RNL A;  3QOP A;  1KU3 A;  5JHU A;  3VOE A;  4KA4 A;  5FB2 A;  2CQK A;  2BEO A;  5L3D A;  1PUE E;  2EK5 A;  4HLY A;  2XKO A;  3ROU A;  2LF7 A;  1BI0 A;  3IWZ A;  3WOD F;  1QBJ A;  3LQR A;  3M1E A;  3ECH A;  1R7J A;  4QWQ A;  4N9H A;  1IN8 A;  1OKR A;  2L4M A;  5EEG A;  2JSC A;  4RB2 C;  3EET A;  2PMU A;  5LHH A;  2ZME A;  1I27 A;  1XN7 A;  5FLX Z;  1U78 A;  2L02 A;  3Q9S A;  1UB9 A;  3CUQ C;  2FQ3 A;  4IXA A;  3GF2 A;  1ZLK A;  2QEN A;  1ZRF A;  1U2W A;  2COM A;  4WF2 A;  2O3F A;  3KZY A;  5FFZ A;  4L5I A;  5E18 F;  1J59 A;  2Y0M A;  4KUM A;  1W4M A;  1Z91 A;  4CIC A;  3H3U A;  4MNU A;  2EV0 A;  4RAY A;  4XSZ F;  4HX7 A;  2H27 A;  2O6G E;  1F5T A;  3ML6 A;  2V1X A;  2X0L A;  1CGP A;  4L9T A;  1YG2 A;  5HS8 A;  1IAW A;  3TQN A;  4LGW A;  4ZYE A;  4YG2 F;  1USS A;  5E1W A;  1O7L A;  1ZGJ A;  1QQI A;  4ASN A;  2V1U A;  2P8T A;  2QVO A;  5D4S A;  3F6V A;  3P9K A;  2TDX A;  4KN7 X;  2A68 F;  1MZB A;  3FXQ A;  4I0B A;  3RKX A;  1XGM A;  2VN2 A;  1OYY A;  1FP1 D;  1BI1 A;  2Z9O A;  2FBK A;  2K27 A;  4R79 A;  3REO A;  3F8C A;  3Q9V A;  2DU9 A;  4GO1 A;  1I5Z A;  4HF2 A;  2ESN A;  2VBZ A;  3T1B A;  3VB2 A;  1KU2 A;  1OR7 A;  4BAY A;  4U7B A;  2VBX A;  5LBQ A;  1D5V A;  2GXB A;  3M9A A;  1XGN A;  1R5H A;  5E20 A;  1OPC A;  1CF7 A;  2XAG A;  1L3L A;  2KJB A;  4H0E A;  5JI6 A;  3R60 A;  5D8L B;  2MLG A;  1XDS A;  2VBW A;  3WGH A;  4P5O A;  2EV6 A;  4IRG A;  3TO9 A;  2RN7 A;  3L09 A;  5AON A;  5J6X A;  1T38 A;  2PJP A;  1T39 A;  2STW A;  1ZH5 A;  6PAX A;  2P5L C;  4MHG A;  5KVR A;  3RJP A;  4I02 A;  4EJV A;  4PDK A;  1G3W A;  4U0V A;  5DD4 A;  3KP6 A;  3HSF A;  1MKM A;  2A6H F;  2M30 A;  3LQQ A;  1TLH B;  4RGR A;  4OMY A;  3BPX A;  3H3Z A;  1O3Q A;  5FD6 A;  1Z05 A;  1OYI A;  2KKO A;  5IT9 Z;  3RTR A;  3SFZ A;  1B59 A;  4EVI A;  1WI9 A;  1D8J A;  3IKV A;  3WG9 A;  3KLO A;  5ICG A;  3O3K A;  1YTY A;  2GXG A;  5K5O A;  5LHG A;  1S6L A;  3MZY A;  1K79 A;  5D4R A;  3WU1 B;  3SZT A;  4NHJ A;  3O6B B;  5ED4 A;  4EV0 A;  1ONV A;  2OBP A;  3IKT A;  1TNT A;  4Z2Y A;  4KT5 C;  4KMF A;  3GZ6 A;  1RIO H;  4LK1 F;  2L3D A;  2GA2 A;  2D1H A;  3F72 A;  4D0P A;  3T5X A;  3ZMD A;  3W6J B;  2H94 A;  1JHH A;  1IXR C;  2M87 A;  2EV5 A;  2PFB A;  3E5U A;  1O3S A;  2F5F A;  1BIB A;  1WWX A;  4TV7 A;  1BIA A;  1IF1 A;  2P6T A;  2O0Y A;  4AVP A;  2AXL A;  4M72 A;  4BXU A;  2DBB A;  4U7D A;  1O7F A;  1HBX G;  4R1H A;  1ON1 A;  2HS5 A;  1V3F A;  5DEQ A;  4ESF A;  4ENJ A;  1ZG1 A;  3SHF A;  2B0L A;  4LJZ F;  2R7F A;  3P7N A;  3FXR A;  1TBX A;  1XSX A;  2DFI A;  3JSO A;  1FY7 A;  2FXA A;  1YLF A;  5TRD A;  1HQC A;  5HLH A;  2W85 A;  1BC8 C;  4KIC A;  1YFH A;  4MQ9 F;  1EV7 A;  4YIF A;  2PBI A;  4LLG F;  4KMU X;  4M71 A;  3J7A O;  1MGT A;  2ZO4 A;  3L2C A;  1ULY A;  4AD9 A;  4IPA A;  4U0Y A;  3R4K A;  3GYH X;  4YII A;  3MQ0 A;  4NB5 A;  2QBY B;  2OD5 A;  1FC3 A;  1IRG A;  3I5U A;  4Y13 A;  2DQL A;  1KYZ A;  3BOQ A;  2ISZ A;  1J75 A;  2EWN A;  1FYK A;  3JAM Z;  5D6E A;  3VEP A;  4MGR A;  4UNO A;  2DK8 A;  3PQK A;  3ECO A;  3MFK A;  1GXQ A;  2BGC A;  3PFI A;  3I58 A;  4L9N A;  3HSR A;  1XMK A;  2K02 A;  4M9S A;  4GYG A;  3R0A A;  2A3S A;  5LGT A;  5BOX A;  3N4M A;  5E8I A;  1F4K A;  1LVA A;  2QBY A;  2HYF A;  1D3Y A;  1ON2 A;  4ZZL A;  1ZGA A;  2OQG A;  1K78 A;  5H6R A;  1UCR A;  2D45 A;  3CUQ A;  4GYI A;  2DTR A;  3LAP A;  2Z3Y A;  3C3W A;  4HA8 A;  1O57 A;  5HLI A;  3N97 A;  2V1D A;  3ZMZ A;  3FHZ A;  2XKP A;  2HR3 A;  5FO5 A;  3GWZ A;  1MJA A;  1B9N A;  1Z6T A;  1LDD A;  3MCZ A;  1FZP B;  2OU2 A;  3K1N A;  4L0Y B;  2DPD A;  2VC0 A;  2UZK A;  5JR3 A;  2JTV A;  2EJR A;  4BQA A;  2CYY A;  3RYP A;  1VTN C;  2E7W A;  3V4G A;  4K2E A;  1IW7 F;  2EA2 A;  3G3Z A;  2DW4 A;  4F7Z A;  4CZZ A;  5DYM A;  2A6E F;  5LGU A;  4YFK F;  1YW8 A;  3FMQ A;  4ON0 A;  3E6M A;  1FBS A;  1NHA A;  2XV4 S;  4N9I A;  2W25 A;  1KU9 A;  4A0Z A;  3RI4 A;  3MZH A;  2UXN A;  4EQQ A;  4HV6 A;  2Z33 A;  2EFQ A;  2RGV A;  4UVC A;  3CO6 C;  3LWF A;  2CWE A;  1R00 A;  5L3F A;  4JBA A;  2CO5 A;  5E8G A;  5LGN A;  2DK5 A;  3RYR A;  5LRS A;  3EUH A;  3LFK A;  2RQP A;  4UXN A;  1UST A;  4ZH4 F;  4A6D A;  3FM5 A;  1XCB A;  4XLP F;  2Z5U A;  3HOT A;  1FT9 A;  3GX4 X;  2EFP A;  3F8B A;  3TDZ C;  4M74 A;  4WXC A;  1SD7 A;  1XB4 A;  5ILS A;  2YX4 A;  4R8H A;  4BYY A;  4L0Z B;  2OZ6 A;  4BHC A;  5ICC A;  1FOK A;  1I1G A;  2Q8K A;  4Y17 A;  2ZME B;  5TJJ A;  1DPU A;  2H6C A;  3J80 K;  3K69 A;  3V7S A;  1R1T A;  4OU0 A;  1O3T A;  1U3E M;  3R61 A;  1P4X A;  2KIF A;  4HF0 A;  3O2P E;  1SMT A;  4Q48 A;  5FFX A;  1FLI A;  2EFW A;  4CDG A;  2F5D A;  3K0L A;  5A2Q K;  2ZJ2 A;  3EYY A;  2NNY A;  4CXF A;  1RI7 A;  3QRF F;  2HZT A;  2PI0 A;  3QPT A;  5AIP A;  2J5O A;  2NRA C;  5E1Z B;  1XSD A;  2HKX A;  3T8R A;  5IT3 A;  2NS0 A;  4WK8 F;  2F5E A;  4AIH A;  2LKP A;  2JT1 A;  2R3S A;  3QU3 A;  1J7K A;  3M8F A;  5DUK A;  1FSH A;  1P2F A;  3FM3 A;  3BWG A;  1P4A A;  2GA1 A;  3FMR A;  2PMH A;  2FF4 A;  1EH7 A;  4OIO F;  2XAS A;  2YX7 A;  5CVJ A;  1D8K A;  5AIQ A;  4KN4 X;  3KP5 A;  1L0O C;  3IWF A;  5FD5 A;  5HDK A;  1PDN C;  3QAH A;  4OIR F;  1H9G A;  3JTG A;  2FEZ A;  4RGX A;  1RZ4 A;  4LLL A;  4GCV A;  2XUB A;  2QUF A;  4A0Y A;  2GIV A;  3ABT A;  2QQB A;  3WE2 A;  4HX8 A;  1LQ1 A;  1IN5 A;  2LNB A;  3FZV A;  4I2O A;  2BYV E;  3WTU C;  4FHT A;  4G94 A;  2G7H A;  1BOA A;  1CF7 B;  2PN6 A;  2HWV A;  1LB2 A;  1H9T A;  2QWW A;  2H6B A;  1WQ2 A;  1Q1H A;  4CO8 A;  3SXY A;  4CGZ A;  3TO6 A;  2BBY A;  3COA C;  3GFJ A;  2ADU A;  2HTS A;  1HW1 A;  2GZW A;  3ZMU A;  1XGO A;  3IHU A;  1W7P A;  3CLO A;  4ZZD A;  3ZN0 A;  3ZN1 A;  2IW5 A;  2IT0 A;  4L9J A;  1KQ9 A;  2XAQ A;  3FF5 A;  2W24 A;  3TOB A;  4P55 A;  1MJ9 A;  4HAM A;  1R23 A;  4HV5 A;  2R7D A;  3EYI A;  4O6J A;  1J5Y A;  3LST A;  3K9T A;  1JE8 A;  4AIK A;  2DQR A;  4KFC A;  4HF1 A;  2YSR A;  2VE9 A;  5K5R A;  4Q4Z F;  3ZMV A;  1DDN A;  2FMY A;  1TW2 A;  2V9V A;  2XVC A;  2FU4 A;  3KET A;  2LSO A;  3F21 A;  1FBU A;  2FRH A;  3OOP A;  2NYX A;  2FNP A;  3BPV A;  4EJT A;  4HBL A;  4PGG A;  1UHW A;  2NAZ A;  2QM3 A;  2EFN A;  1U5T C;  1BM9 A;  2CW0 F;  1SFX A;  2E7X A;  2QQA A;  1KGS A;  4DNC A;  4I98 B;  3V8L A;  5CVI A;  5BS6 A;  4NQW A;  1HKS A;  1MD0 A;  1LDK B;  2L54 A;  1A04 A;  4E70 A;  2ZNZ A;  2K4B A;  2C6Y A;  2IRF G;  4RGS A;  1YS6 A;  3U1D A;  3FXU A;  3I53 A;  2EB7 A;  4WXD A;  1Z1D A;  4Y15 A;  2M8E A;  3LA2 A;  3ZP5 A;  4A0X A;  1JXS A;  4A5M A;  4EGY A;  3WE3 A;  2XAJ A;  1TQP A;  3E5Q A;  4FT8 A;  3K1P A;  3DQV C;  1B4A A;  3GO5 A;  3JSP A;  3F3X A;  4PCQ A;  3V7R A;  3HYI A;  4BHP A;  4OIN F;  5BMZ A;  2P7C B;  2YU3 A;  3F22 A;  4P96 A;  1JHF A;  5CJ9 A;  2ZCW A;  3OV8 A;  1SD4 A;  4MTE A;  2STT A;  1ZAR A;  3HUG A;  2CGP A;  2HEO A;  3F23 A;  1STZ A;  2A69 F;  1SFU A;  2HFH A;  1B9M A;  3I54 A;  1SD5 A;  3J80 Z;  5LLQ A;  2ACJ A;  4IHS A;  3I4P A;  4WCG A;  3BY6 A;  4EM0 B;  2DLL A;  2BV6 A;  2XGX A;  3HRS A;  5F64 A;  1FP2 A;  5BQT A;  4UVA A;  5DD8 A;  1EH8 A;  4KDP A;  4FX4 A;  3I59 A;  3WTX C;  3C1D A;  2OAZ A;  1SAX A;  3DKW A;  1P92 A;  4O5V A;  2VXZ A;  1YW9 A;  4EJW A;  3ZMT A;  3L00 A;  2IA1 A;  2RKH A;  4G7H F;  1QGP A;  5FLX K;  2VBY A;  4HDV A;  4MQV A;  5KK1 A;  2J5P A;  1K7A A;  3GFL A;  1SD6 A;  5ICE A;  2HKO A;  4EM2 A;  5K5Q A;  4M9X A;  2D1V A;  4OMZ A;  2IA2 A;  3KEO A;  2W57 A;  4OIQ F;  2XIG A;  1K78 B;  4I7H A;  3QP6 A;  1BJA A;  4CHU A;  4KIF A;  3CUQ B;  2FNA A;  1I6X A;  2CG4 A;  1U8R A;  3BJO A;  3TDU C;  2VOO A;  4XRF A;  2JPB A;  1P4W A;  1YO5 C;  4LG0 B;  3L7W A;  1TQI A;  4HOB A;  1H0M A;  3BJ6 A;  1XGS A;  1REP C;  3VFZ A;  3HSE A;  4A5N A;  2QLZ A;  3IRR A;  3S2W A;  5D5X B;  2IJL A;  2HYG D;  4HQE A;  1SFE A;  2HQN A;  1KQ8 A;  2GWR A;  2E1N A;  3IL2 A;  5DUI A;  3IRQ A;  4KYW A;  3KZZ A;  2WC2 A;  1ZYR F;  1HST A;  3BZ6 A;  5L3C A;  1UHM A;  3DP7 A;  1MJB A;  2H09 A;  3G73 A;  4JQF A;  1IZ1 A;  4LG0 A;  1ODD A;  4XLN F;  1IRF A;  3EQL F;  1DUX C;  3M7G A;  2YPR A;  2JRT A;  3TGN A;  4G9Y A;  1KQ0 A;  1XDU A;  2JZY A;  2PEX A;  4A6E A;  3QU6 A;  2G7U A;  3TO7 A;  3V8K A;  3WTW C;  1WKM A;  3ULQ B;  4ESB A;  2PLY A;  4A12 A;  2CSO A;  5JVT A;  2K4J A;  2BE5 F;  1G4D A;  4BH9 A;  3HTU A;  4FX0 A;  3KLN A;  4PZJ A;  1ZLJ A;  3QP5 A;  3D5L A;  1R1V A;  5E1X A;  4ENM A;  2ISY A;  3E97 A;  3HIF A;  1I1S A;  2MA3 A;  4S04 A;  4HX4 A;  1EH6 A;  3KP7 A;  4G7O F;  2UXX A;  2RC4 A;  5LEJ A;  3P9C A;  4MTD A;  4O3M A;  5LRR A;  2ZNY A;  2GQQ A;  1G6N A;  3I71 A;  5IT9 K;  5HLG A;  4L5J A;  2AS5 F;  3SQN A;  2JPC A;  5HVQ C;  2QZ8 A;  1BC7 C;  3RKY A;  3WTY C;  2HQR A;  1S7A A;  2P7V B;  1J9I A;  2A61 A;  1YS7 A;  3F8M A;  3RPQ A;  2A07 F;  2IPQ X;  3WTT C;  1R5G A;  3TKY A;  4U0W A;  3FMS A;  1YIO A;  3C7J A;  2KIM A;  2F2E A;  3NQO A;  4HLX A;  2PQ8 A;  2V79 A;  4EM1 A;  3W6K B;  2MLK A;  2W84 A;  4WX9 A;  3EDP A;  2K7L A;  3PQJ A;  4HYE A;  5DV5 A;  3E5X A;  3LA3 A;  4LD5 A;  4UUV A;  4G7Z F;  1U5T A;  3ABU A;  4GGG A;  2ZXJ A;  4HZF A;  5EEH A;  1MDM B;  2XRN A;  3T8T A;  2VT3 A;  3GW2 A;  4QLC U;  2E1C A;  4RGU A;  4M6X A;  2HOE A;  1PP8 F;  3B02 A;  2WV0 A;  1XCV A;  4CYD A;  2IA0 A;  1QNT A;  2WTE A;  4LMY A;  3GLX A;  3ZQ7 A;  5BPD A;  2LF8 A;  5ICF A;  2ZFW A;  3J81 K;  5DDG A;  3DPT A;  3GUD A;  2LDU A;  2DI3 A;  1LJ9 A;  2CFX A;  3BP8 A;  2P6S A;  2ZKZ A;  3DF8 A;  1SMY F;  1MDM A;  3VOD A;  5HDG A;  2A5Y B;  1XD7 A;  3C18 A;  2G9W A;  2GAU A;  1FX7 A;  3FWE A;  3D0S A;  3DEU A;  1TNS A;  3CJN A;  1J2X A;  4ZYG A;  1BBY A;  3K1M A;  5ILV A;  1FSE A;  5J8F A;  4HW0 A;  5LEK A;  1GXP A;  2Y75 A;  4I01 A;  1B1B A;  1IXS B;  1TQM A;  2FE3 A;  3F6O A;  3HRU A;  1ZN2 A;  4RS8 A;  3JAM K;  1F9N A;  5D5U B;  3B73 A;  4XBF A;  4YFX F;  1W7P B;  1QO0 D;  4G6Q A;  3QPH A;  2VC1 A;  4P9F A;  4IJA A;  4DQ2 A;  4RB3 C;  1T6S A;  1XSV A;  3DPL C;  3BJA A;  3V7C A;  3WTZ A;  2VON A;  1GHC A;  3MAJ A;  2O61 A;  1ZG3 A;  4KIG A;  4S05 A;  4RAZ A;  2EA4 A;  3E3V A;  5ILU A;  2RNJ A;  5HS9 A;  1G3Y A;  3HOS A;  2HDC A;  4UHT A;  3GFM A;  4GXO A;  2IVM A;  1DP7 P;  3MWM A;  1TW3 A;  3SZP A;  5L3E A;  1V4R A;  2IP2 A;  1KA8 A;  1HKQ A;  3KP2 A;  1ZRE A;  5D6F A;  4HDU A;  3CO7 C;  4LB5 A;  1IXC A;  2M1B A;  2PG4 A;  2VE8 A;  1YYV A;  4UV9 A;  3ELK A;  1S8N A;  1T2K A;  2MC3 A;  4I09 A;  1AWC A;  1IN7 A;  1FBQ A;  1BI3 A;  1Y0U A;  5HDN A;  4OOI A;  5H6Q A;  3HTS B;  1KU7 A;  3KP4 A;  5LHI A;  4LB6 B;  1BI2 A;  3HHG A;  3I64 A;  3MEX A;  4AWX B;  4KNY A;  1R22 A;  2Q2E A;  2Z99 A;  1UFM A;  4ESJ A;  1RUO A;  1LDJ A;  4IHT A;  1S29 A;  1B6A A;  2L01 A;  2L4A A;  3F8F A;  2V6C A;  1P6R A;  4WXH A;  4RB1 A;  2D2W A;  4WWC A;  5J8C A;  4KIB A;  2M45 A;  5E17 F;  1E17 A;  3WU0 A;  3ERE D;  3ZMS A;  1WRJ A;  2DAO A;  5D5V B;  2QYO A;  5L3G A;  3M8E A;  1QPM A;  4LK0 F;  3CTA A;  2M5W A;  4I0A A;  5FGM A;  4ENN A;  5CVR A;  4Q5S F;  2FOK A;  2P4W A;  1X3U A;  1Z9C A;  3K2Z A;  4XSX F;  4MEY F;  2QQ9 A;  2MH9 A;  3R6S A;  4M6Y A;  2F5C A;  1GVJ A;  3TOA A;  4UVB A;  2RV8 A;  3I59 B;  3KFW X;  4BHB A;  5HOO A;  2RVC A;  4BNC A;  3RIR A;  1PP7 U;  1AOY A;  2VOP A;  3GZ5 A;  1HW5 A;  2OA4 A;  1RUN A;  3DXJ F;  3LA7 A;  1G3S A;  1U6G A;  4G6D A;  1R1U A;  2K86 A;  3CDH A;  3NRV A;  5A2Q Z;  4MEX F;  5F6F A;  2ZBK A;  2DO7 A;  2MH2 A;  1HKT A;  3GEZ A;  5K1Y A;  5CYV A;  1J0R A;  3GVA A;  3GFI A;  3BRO A;  4U88 A;  3J81 Z;  1FYL A;  3GXO A;  1Z7U A;  1F1Z A;  4JK1 X;  1LNW A;  1FYM A;  3H92 A;  2KIU A;  3JTH A;  2WWY A;  5DCM B;  2ETH A;  1QZY A;  4Q47 A;  1ZG5 A;  3Q5F A;  2UWM A;  5D5W B;  2X4H A;  5CLS A;  3I0T A;  4M73 A;  1E2X A;  3NEU A;  3WTV C;  1W7P D;  1R36 A;  2Y48 A;  1LEB A;  3DFG A;  4ZYH A;  3R0J A;  3P9I A;  1S3J A;  1ZRD A;  2XAF A;  3E6D A;  1TTY A;  2XAH A;  3BDD A;  5DCM A;  2VOD A;  1YW7 A;  3RKW A;  2ELH A;  2VT2 A;  3KE2 A;  4EJO A;  4L18 B;  3FX3 A;  1FPQ A;  1W5S A;  1Z6R A;  1ZAO A;  4IF4 A;  2P5K A;  2HTJ A;  4EGZ A;  1BN5 A;  5D8K B;  2ESH A;  4L9V A;  4M9Z A;  4LFU A;  1K6O A;  4UV8 A;  3E6B A;  4ZYD A;  3E6C C;  4IVN A;  2Q0O A;  5ERI A;  1HW2 A;  5CVV A;  3CUO A;  5L3B A;  1KYW A;  3KEQ A;  4G8X A;  2O8X A;  1WSU A;  5F1R A;  2FBH A;  1FNN A;  3F8N A;  3U2R A;  2O03 A;  4LLN A;  4IRI A;  4P9U A;  1OYW A;  3JW4 A;  2DPU A;  4EJU A;  1FWZ A;  1HSJ A;  1YQA A;  4B8X A;  5CVU A;  2MD5 A;  2MBF A;  1ZHF A;  2XRO A;  3DV8 A;  4ENK A;  3L9F A;  4IRH A;  2FML A;  1ZRC A;  3T0Y A;  4EMS A;  1JGS A;  4N0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...