4QTRA

Computational design of co-assembling protein-dna nanowires
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
b'RTAFSEEQKKALDLAFYFDRYLTPEWRRYLSQRLGLNEAQIKIWFQNKRAKIKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dualENH
publication title Computational design of co-assembling protein-DNA nanowires.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags De novo design/dna
total genus 14
structure length 55
sequence length 55
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4qtrA00
3MVPA 3CMYA 2WV1A 4M3GA 2O8KA 2DA4A 4MLOA 1PUFB 3S17J 1LFBA 1Y1WJ 4FTHA 3NARA 2CU7A 1HF0A 1IC8A 3I4NJ 4DYQA 4UUSB 3L1PA 1TC3C 4A69C 4S0HB 3E7LA 4D5CA 4MIMA 1FIAA 1K61A 1MBEA 1GV2A 1ZGWA 3GTMJ 2R7ZJ 5J1UA 3GTPJ 4XICA 3ZQCA 2YUSA 4MFDA 1LE8A 1U8BA 1Z0XA 1RPWA 2E2JJ 1X58A 1JT0A 4A3KJ 1QRYA 3GTQJ 2M0CA 4W97A 2DA1A 1ETYA 2IBDA 2FD5A 3LSPA 3JRDA 2LTPA 3LNQA 2EH3A 4AYBN 3TW7A 2AHQA 3RKQA 2G0EA 2DJNA 5M5WJ 3GTGJ 3HKZN 5FKLA 1T56A 2HOAA 1B72B 4FE4A 2D5VA 1RKWA 5JLWA 1JUSA 3BR1A 1TWAJ 3S1NJ 3BG3A 5EDNA 4CYCA 5EG0A 1GVDA 3BTJA 1JKQC 5DS9A 2Y31A 2LKXA 2JA5J 2ID3A 2LP0A 1MSFC 2H8RA 2PMZN 3I4MJ 3CQZJ 3QPSA 4L5EA 1FJLA 2HXIA 2KT0A 2VPRA 4AUXA 5J1RA 1YRNB 3ZQGA 2XGCA 3HB9A 3K2AA 3NAUA 2B63J 1AKHA 3OSFA 2ECBA 3BT9A 1RR7A 2E19A 5M5XJ 4BY1J 3O8GA 1BW6A 3D1NI 3HDDA 2COBA 4A3BJ 3A01B 3IV5A 5EGOA 2TRTA 2LFBA 1QPIA 3GTLJ 1GV5A 3H0GJ 5FJ8J 1NK2P 5E3MA 1TWFJ 5IYBJ 2HOTA 1ETVA 3ZQFA 2MSYA 5GPCA 1IGNA 2HDDA 4A3CJ 2N8GA 5K7HA 1P7JA 1ENHA 2Y9YA 4C2MJ 4M3FA 1TWCJ 1FIPA 2L9RA 3Q0VA 3PO2J 2MW8A 4JX6A 4XRSA 1UMQA 5F27A 2CUEA 2AO9A 4J19A 2P81A 1GT0C 1NK3P 2LY9A 5C44J 3HOVJ 2HQ5A 5C4XJ 3FKIJ 1IDZA 4BY7J 2R5ZA 4DW6A 2NVQJ 1FTZA 3BTLA 3M3YJ 5K7ZA 2R5YB 3BG9A 2YU9J 4IHVA 2M9HA 1T33A 2K9NA 5FKNA 1TWGJ 1Q1VA 5E3OA 5IYDJ 2M8GX 1R9TJ 2R93J 1P7IA 3GTJJ 2EZHA 1JKOC 2NS7A 3HGGA 2R92J 2DA7A 4X6AJ 1UHSA 3FIWA 1PUFA 2CQQA 2JJ7A 3Q3SA 2XSDC 4A3LJ 2DA6A 3M4OJ 1U78A 1H88C 2NVYJ 2HOSA 3JRFA 3PM1A 4BKXA 1D5YA 1ZK8A 5FKMA 1MBKA 1SANA 4B1RA 1H89C 2XB5A 2K9SA 3W6VA 4DZPA 1XS9A 2GLOA 2JA6J 1IUFA 2EZKA 1BW5A 1WPKA 3F0CA 5M5YJ 3OIOA 2XPVA 1NTCA 3JRCA 2HYJA 2LD5A 2WB1N 1JUPA 1FTTA 3HBLA 5IP7J 2L7ZA 1LE8B 4FCYA 5F08A 1JKRC 1ORKA 3WHCA 3BR2A 2Y30A 4MFEA 1ETWA 4M3BA 2I10A 1ITYA 1JKPC 4A3JJ 1OCTC 1ETQA 5BNGA 3SJMA 4A3DJ 1E3OC 3SDGA 1SFOJ 2WAQN 1HCRA 4BBRJ 2KDZA 1WGXA 5E3NA 3ZQLA 1IRZA 5GPAA 1ETXA 4NDLA 1B8IA 1I3QJ 1HOMA 2L0KA 3TP0A 4CYCB 4RDUA 3LSGA 3A02A 4RBOA 4QTRA 2ID6A 2W48A 5C4JJ 5C3EJ 3S1RJ 1VI0A 3C2BA 1BJZA 2Y0SN 3S2HJ 1BA5A 4M3DA 1VF9A 1JGGA 2DA3A 4A3MJ 2O7OA 3G1LA 4FISA 5EZHA 1ZTRA 4V2GA 3GBGA 1YRNA 1JTYA 1XG1A 2NVXJ 5J3LA 2NVTJ 5IP9J 3BTIA 1HDDC 2JA7J 1GDTA 2DTZA 5HODA 1MNMC 2FJ1A 2DMNA 4A3FJ 1AKHB 1A5JA 1A6IA 2DN0A 5JLXA 2ECCA 2GM4A 1X2NA 3HOYJ 5F0HA 1FEXA 2OF7A 4QIWN 3LSJA 1UG2A 3ZOBA 1RESA 2XGEA 4C3IJ 2VKVA 3Q0UA 3QPLA 1H8AC 3HM5A 3PO3J 1CQTA 3H3VK 1GUUA 1LFUP 5EGOB 1HLVA 2DMTA 2ME0A 1OJLA 1ETKA 1F43A 1ZR2A 2CJJA 3S1MJ 1JUMA 4MO7A 4XRMA 1ZKGA 1ZQ3P 3IH3A 4A3EJ 4I76A 2LK2A 3OSGA 1WH5A 5J1YA 1JT6A 2YS9A 2K40A 4HNVA 2E1OA 1S7EA 2L7MP 3BR6A 3HEFA 3VPRA 5EZGA 3GTKJ 1G2HA 4A3IJ 2FX0A 2JWTA 3FK7A 2E2IJ 3WHBA 2Y9ZA 1ETOA 5IOZA 2GBYA 1RKTA 2XPWA 1OFCX 5E3LA 1MSEC 1Y1VJ 3JRBA 3A03A 4C3HJ 4D7MA 2X48A 5FLMJ 3IH4A 3S14J 3LOCA 4UUSA 1MBGA 3JREA 4IHXA 2EQRA 3QQAA 3UKGA 3SFIA 2E2HJ 1VFCA 5F0CA 5F0FA 2DA2A 3RZDJ 4V2FA 2CRGA 1ZR4A 4M6VA 3ZQIA 4DZJA 3FISA 4XRSG 1JTXA 2LR8A 3BG5A 2IEKA 4D7NA 2XPUA 5IYCJ 3JRAA 4FE7A 3Q0WA 1F36A 2QF7A 4JP0A 3BTCA 1POGA 3BR5A 2NOGA 4X1EA 1B72A 4QSHA 2HI3A 2DA5A 5K7FA 3FK6A 1QVTA 2EZIA 1DU0A 4JX4A 2CQXA 1WI3A 3DCFA 4JYKA 1MBFA 4GFBA 2MG4A 3G1MA 4AC0A 1O4XA 1X2MA 2JMWA 4Y7NJ 5M3MJ 5EG0B 1IJWC 2EZLA 2IAIA 1W0TA 5FKOA 1IG7A 1VNDA 3K7AJ 2QCOA 4JX5A 2XRLA 1TWHJ 4ABZA 1I50J 2JA8J 5F04A 4G12A 3TW6A 3JRHA 1IV6A 1B8IB 2DMQA 4BBSJ 3RZOJ 2MGQA 1W0UA 4IEJA 2K9QA 3CCYA 4C3JJ 2JN6A 1U9NA 2M34A 2X9DA 4XIDA 1RETA 2LVSA 1APLC 3B6CA 4A3GJ 3S16J 1OCPA 3BR0A 2R0QC 5M3FJ 3G1OA 5EYRA 2JK3A 3LSRA 5F1JA 1WCMJ 2HXOA 1MBHA 3OOUA 4LOCA 3A01A 3BQZA 1JJ8C 4B4CA 2O9LA 2ME6A 3HOUJ 2ELKA 2VI6A 3HOXJ 4I6ZA 1JJ6C 9ANTA 2OPTA 3MN2A 3TP3A 3O8HA 5IP6A 2M2EA 3MKLA 1MH4A 1Z77A 4D5FA 3HGYA 4UUTA 3JR9A 2VUMJ 2NS8A 3CDLA 1I6HJ 3BR3A 2DMPA 3DEWA 3S2DJ 2LLKA 5FLVA 5EF6A 1HDPA 3S1QJ 5DTDA 2XGDA 3ZQHA 3HOZJ 1MH3A 1WH7A 2ZB9A 4B3AA 4BXXJ 2VKEA 3RQIA 5GP9A 2RAEA 5IOYA 2X6OA 2H1KA 1DU6A 4XK4A 4EEFG 1BL0A 1MBJA 5IPAA 3JRGA 1U9OA 4M3EA 3GTOJ 5EEAA 1K83J 4A93J 3S15J 2R5ZB 3JRIA 2FQ4A 3B6AA 2R5YA 3HOWJ 5FKKA 1AU7A 4DYCA 2EBIA 4W1UA 4DYRA 2XB0X 2TCTA 1XC5A 4Y52J 1AHDP 1IDYA 2DMUA 3TEDA 3BQYA 1EF4A 2CUFA 2Y2ZA 3IH2A 4IHWA 1QVUA 4IHYA 2L7FP
chains in the Genus database with same CATH superfamily
1BI2A 2XASA 1YQAA 4HSRA 1I1GA 4NBQA 4XLEA 2O8KA 3IWFA 2DA4A 2LREA 2XAHA 1IRGA 2PEXA 3N05A 3AKZA 4NQWA 1UJ8A 2MLGA 3L7WA 3PUFA 3FHZA 3L1PA 5J4YA 2CW0F 4P9UA 1HW2A 2VQCA 4MIMA 3ABTA 3KP6A 1TBXA 3HIFA 2XDVA 2ZSHB 2R7ZJ 4ETSA 5TRDA 2P6TA 1IXRC 3TOAA 3K4NA 2HVSA 3ZQCA 1G6NA 2ISZA 1LE8A 1U8BA 3F8CA 1IRFA 3FXUA 2L54A 3CF2A 1QBJA 4LLLA 4A3KJ 1QRYA 3RSNA 3KP3A 2HU9A 5GAHJ 4W97A 1TW2A 2DA1A 2EFOA 2IBDA 3LSPA 3JRDA 2LTPA 2VLAA 3RKWA 2AHQA 3E6BA 3COAC 5M5WJ 2P6SA 1T56A 1B72B 2ZMEC 4G6QA 3CCEI 3LMMA 3OYGA 4OMYA 1FZPB 1BIBA 3MAJA 2I8DA 1JUSA 3DQVC 1Y39A 1XGSA 2DQLA 1TWAJ 3BR1A 1MZBA 2LYCA 4UVBA 1Q1HA 4CCJA 1HKSA 2K9LA 3BG3A 2DDAA 4P5OA 3MFKA 2UZKA 2RQPA 2QVOA 3BTJA 3DEUA 3K70D 1X4PA 2BYVE 1FNNA 1WJCA 2CFOA 3HSFA 3ABMH 2BY0A 3EDPA 3VOEA 1W5CC 1AOYA 2H8RA 2PMZN 2BW3B 4GYIA 1YIOA 3CQZJ 2RVCA 4IRIA 4IF4A 2P4WA 2OUMA 1WZ2A 1F9NA 3WGIA 4F55A 2VJ4A 1RNLA 3M7GA 1MMNA 4UVAA 1U5TB 2ISYA 2IPQX 3K2AA 2K86A 3NAUA 1KU9A 5HDGA 1TZLA 2A6EF 2DI3A 1W36C 4EVIA 1R7JA 2F5VA 2LSOA 1FY7A 2K27A 4OAZA 5BPDA 4BY1J 5LGNA 3AG4H 3OV8A 5EEHA 3HDDA 4HQMA 1J2XA 4Z6YA 3ASNH 4LD5A 4ESBA 1YS7A 3PNYA 2DOAA 1MJAA 3GTLJ 2OA4A 2GA2A 2L02A 5D5XB 5E3MA 4BE2A 1IF1A 2W57A 3PIPF 3HC7A 3MZHA 2FXAA 5GPCA 4CYDA 4A3CJ 2N8GA 2IW5A 2K9MA 4RB3C 2K02A 4ZTJA 2Y9YA 1TWCJ 4IRGA 1TT5B 3OWTA 2MW8A 1YX3A 3F22A 1FOWA 1UMQA 4J19A 2CUEA 4AIKA 5CJ9A 2P81A 2LY9A 3HOVJ 2CG4A 1IDZA 2RNGA 1QZYA 1ZRCA 3H0DA 2NVQJ 4IVNA 2OTLI 4RAZA 3VYTB 2R5YB 2YU9J 2P5LC 2M9HA 1T95A 1SMYF 4PFOA 1PUEE 1TWGJ 3LAJA 3OS0A 3EETA 2M7BA 1R9TJ 2C6YA 1DPUA 3QP5A 3QOPA 3FMRA 4XSZF 2F6CA 2IXSA 3GTJJ 1J5YA 2EZHA 5L3EA 1U8RA 3HGGA 1FSEA 3GLXA 1HSTA 3CJQB 2CQQA 3Q3SA 3L2RA 1R58A 4U0YA 2H1LA 2DA6A 3IP4B 2W00A 1T39A 1W7PB 2PN6A 4BKXA 4DGWB 5GTHC 5FKMA 3T5XA 3S3NA 1H89C 3GMEA 2NNYA 1MMSA 2O03A 1XS9A 1Y0UA 2QBYB 3M8FA 1D1AA 2JA6J 1BW5A 3OIOA 3HOSA 3DPLC 2WB1N 2HR3A 3HBLA 1TLHB 2CV2A 1KQ0A 5F08A 1XB4A 2IGKA 2X6WA 2ZNZA 4M3BA 3U1KA 2P5VA 4BQQA 5LEKA 3OYJA 1ITYA 3DBHB 4WXDA 4ZYDA 3SJMA 1JGSA 4QPQA 2QSHX 2NNNA 1OYYA 1BR4A 4DBRA 1HCRA 4Y4RA 1WGXA 4N4NB 2OZUA 1WKMA 1HOMA 3J80K 1RI7A 4RAGA 4CYCB 2H8WA 4RDUA 3RKXA 3D0SA 2W82A 1WJFA 1YITI 3A02A 3B73A 3V7SA 4QTRA 3KP5A 1I6XA 3P9CA 3FHNA 5CVRA 2F5FA 1VI0A 4UB6C 4UXNA 1R22A 3C2BA 1BJZA 4XQFA 4A5NA 4HA8A 3U21A 3FXOA 3TO9A 5D8LB 3R60A 4OMZA 3OMYA 5DM6F 3CCQI 3LQRA 4D1QA 4U88A 1YFHA 3F72A 3BZ6A 1XG1A 1HDDC 4HDUA 4KISA 1QGPA 1IUYA 3KZYA 5HNFA 2X6XA 2M5WA 3BY6A 4O5VA 3FM5A 5F0HA 4ESJA 1FEXA 2JPCA 2QKLB 3V8LA 3LSJA 1UG2A 2WY8Q 1RESA 1N77A 3BG6A 3GX4X 3HM5A 4UHTA 5FLXZ 2FA5A 3RCOA 1CQTA 3PO3J 3BDDA 1LFUP 4NB5A 5BQTA 2HKOA 4BEHB 3HRSA 2VB6A 2OQRA 2DMTA 4XOTA 1ZELA 2RDPA 1T0FA 3WTWC 5D5UB 3J7YJ 2H6CA 2W4SA 2JQ7A 1SFUA 3IH3A 1HQCA 3DU6A 1V5FA 1WJEA 4I76A 3OSGA 5J1YA 2YS9A 4JQFA 1ZLJA 3F6OA 1VQPI 3L2VA 1X1AA 1SD7A 1LDDA 1UHMA 2L7MP 1S7EA 1D1BA 1Z05A 2NAZA 5L3FA 1YTYA 3A0BC 3EUKL 4MNUA 2HYGD 4IJAA 4C2UA 1TT0A 4E7LA 2E2IJ 3WHBA 5KCMA 4KUMA 2Y9ZA 2FU4A 4BE0A 2HEOA 3RDIA 4AU7A 3AG1H 3VEPA 3JSOA 2E1MC 4XLPF 2XPWA 3SHFA 1OFCX 2IS6A 3CUOA 1S7OA 4ESFA 5EEGA 4C3HJ 3I64A 4D7MA 1IO2A 3CD6I 3S14J 1DP7P 3LOCA 1B59A 4UUSA 3W2WA 2DYRH 4BYYA 1G3TA 3BG7A 5D6FA 1G8XA 2E7WA 4XLAA 2E2HJ 1DP3A 3LFUA 1KU3A 2TDXA 1T08B 2DA2A 2R7OA 2P7VB 5F0FA 5ILSA 2F4MB 2XUBA 3RZDJ 1QZEA 2V1NA 1ZR4A 2WV0A 3D5SC 4IXAA 2DDBA 4M6VA 3ZQIA 5DUIA 3L2QA 1IV8A 4XRSG 4G94A 5DDGA 1U6GA 3BG5A 4D7NA 3LAPA 3BTCA 3E6MA 4ANJA 2IGOA 4IX7A 4HRIA 4KICA 2J5OA 3E3VA 1FSHA 3SYTA 4HNUA 5D8KB 4RAYA 2CQXA 3VB2A 3DCFA 2UV1A 1Y8RB 2AS5F 4RAFA 2AQFA 2MG4A 1GXQA 5K5RA 1O4XA 4ZYGA 2KDOA 1N25A 2ZMEB 5M3MJ 2IAIA 5FKOA 5B66C 1VNDA 4JX5A 3RYRA 4A0XA 2JA8J 3KFWX 3KEYA 3JRHA 4G6DA 3REOA 1OCCH 3LA2A 1VZ0A 4IPAA 4BBSJ 4B48A 1U5TC 2ETHA 3HZJA 1W0UA 4Y33A 5B1AH 1PP8F 1UZCA 4XMYA 2M34A 2X85A 3L00A 4Q47A 2QUFA 2VC0A 3KLNA 2HZTA 5E20A 1FBSA 3CMAI 1NH3A 4CHUA 2P0WA 2JK3A 2L3DA 1D0ZA 4XORA 1ZN2A 3SQNA 2L01A 2GXGA 4XLCA 3OOUA 2CH0A 4II3A 3BQZA 3CDHA 2YPRA 1W1WE 5E1ZB 1XDUA 3HOUJ 3L09A 4M9ZA 3SDBA 2ELKA 1QO0D 4HV6A 2YR2A 4RA2A 1J09A 2V1DA 3E97A 2KQRA 5LGTA 3L2UA 3HOXJ 3OYDA 4I6ZA 1KU7A 3MN2A 4KNYA 1H9GA 1RIOH 1O3QA 3O8HA 5IP6A 2FQ3A 1B6AA 3JR9A 3DTIA 2V6CA 3S2DJ 1D5VA 2P7CB 2H94A 2LLKA 2RKHA 2X1DA 2ELHA 1KGSA 3GF2A 1LVAA 3KIOA 1MH3A 3FXLA 2HTJA 1WH7A 5F1RA 3K4CA 5J6XA 2ZB9A 4KYWA 2F5CA 3MMYB 4B3AA 3T1BA 4BXXJ 3RQIA 1B1BA 1TNTA 2W85A 3HRMA 4LG3A 2GOXB 5BPIA 2H1KA 4XK4A 3VSKA 2MFZA 4EEFG 3HXLA 5DCFA 1UAAA 4LMYA 4PGGA 3ZRGA 4RB2C 4CCNA 3GTOJ 3QPHA 1R36A 1MNEA 3JRIA 3TGNA 2UXNA 2XKOA 2KIUA 4LJZF 5FKKA 2BVMA 3IL2A 3GXOA 2TCTA 1XC5A 1ZRFA 4Y52J 2DMUA 4KN7X 1EF4A 3SZTA 1ON2A 5JHUA 3ESWB 4AYBA 3ZMUA 4M3GA 4N9HA 4N9IA 4OIQF 4PJ0C 3HUGB 3W6KB 5CVVA 4PSXA 4XLFA 3S17J 2NYXA 2E36A 3NARA 1HF0A 1ON1A 1SEUA 2GXAA 1VQ6I 3DKWA 1TC3C 3M1CA 1J9IA 2HQAA 1R5HA 2FBHA 1MBEA 1GV2A 2HS5A 1SMTA 4XNFA 3GTMJ 2P8TA 4IKFA 1FBUA 1ZG5A 2R7WA 1F4KA 2ZSIB 1IRXA 4BDYA 1XMAA 2Y48A 3K6GA 4MFDA 4ENJA 4G8XA 5TJJA 4L9JA 3A0HC 1HKTA 3GTQJ 3I4PA 4ZYAA 1Z6RA 2FOKA 4ENMA 1DDNA 4XBFA 3N4MA 1O7FA 3CZ6A 3LNQA 1VQNI 1LEBA 3G6EI 3I3LA 1VTNC 2DJNA 1YJNI 2EA2A 2CW7A 5HDNA 4OOIA 4FE4A 1Y56A 2NRAC 4CA0A 2BY2A 2MBFA 2HVQA 2HNHA 2VPLA 2JUGA 1YJWI 2L9SA 3FWEA 5EDNA 5EG0A 5A2QK 3J7AY 1GVDA 2QLZA 1YIJI 3H1CA 1HSJA 2OQGA 1RZ4A 3MZ8A 2GXBA 2E35A 1X1PA 4XKWA 2EV5A 5GADJ 4PJLA 4QLCU 1MSFC 3IAM2 2LH9A 2HVRA 3IKTA 1NG7A 2NVUB 4C2TA 1EKEA 3I4MJ 4UNOA 1FJLA 2D1VA 3IAS2 1FOKA 4HQEA 4PK4A 1E17A 1BJAA 2KT0A 2FOWA 4MTDA 3ZQGA 1IAWA 3M1EA 1KA8A 1WSUA 4WF2A 1I1SA 2IRFG 4HAMA 3BT9A 1R5GA 4WXHA 4BJ6C 2CYYA 2E19A 2Z33A 4QWQA 1KU2A 1Z67A 4AVPA 4RGXA 1VQMI 3TQNA 4K2EA 3DLAA 4CDGA 4HSTA 3IV5A 3W2VA 1VQLI 2ZNYA 5EGOA 5KHDA 2X4HA 4UV8A 1XGNA 1GV5A 3BWGA 3AG3H 6PAXA 4DQ2A 1TWFJ 3LSIA 3R0JA 3I53A 3W2AA 3TDZC 3N97A 2FNAA 3J80Z 1QHHD 3OYFA 5K7HA 2XAFA 1ENHA 2QQAA 4ZDLA 5HOOA 3FKJA 2DPDA 2KJCA 1FP2A 3PO2J 1LKXA 2PBIA 3H5NA 2LG4A 4JX6A 2AO9A 3UNGC 5C4XJ 3HTSB 1BR2A 2R5ZA 2KL4A 4EMSA 4L9VA 4F93B 5D4RA 3LWFA 3RPUA 1ZREA 1L0OC 1T33A 2K9NA 2HYFA 5AIPA 4AVZA 5E3OA 2EK5A 2O8XA 1VQ4I 1V5EA 3IHUA 1OLTA 3CJTB 1XTAA 2MABA 2VQLA 3CESA 1JKOC 3RI4A 2JT1A 2R92J 4RGUA 3M8JA 2E1MB 2DA7A 3SEQA 2WAQA 2AXTC 4X6AJ 1Z3XA 3K4LA 1A6QA 2JJ7A 1T38A 5KK1A 2O6GE 1U78A 4NQWB 4PSWA 4GO1A 5BMZA 3HTUA 1FLIA 2NVYJ 2ZXWH 1YO5C 1D5YA 1P9QC 2M8EA 2BY1A 1ZGAA 2DK5A 2I5UA 4QPOA 3TO6A 5GAEJ 2QQBA 3I58A 4N0BA 1A04A 2GQQA 2GLOA 4L0ZB 4LITA 3TOBA 1IUFA 2OD5A 1WPKA 2Y0SA 1D8KA 3JRCA 2HYJA 2LC2A 2LNBA 1I39A 3QP6A 1K6YA 3OS2A 3DFGA 1I5ZA 2L7ZA 5IP7J 1LE8B 4FCYA 4MTEA 1JKRC 1RUOA 3WHCA 3FZVA 3BR2A 1PP7U 4MFEA 4RS8A 2XRNA 2I10A 3X2QH 1JKPC 1BBYA 1ETQA 1E3OC 2CO5A 1J0RA 4HG2A 1R4MB 3NWTA 1H9TA 4RGSA 1U0JA 2W1OA 3ZMSA 5GPAA 3DBRB 1OMIA 4NDLA 1B8IA 2LF7A 2Y0MA 3I59A 3JAMK 1X4OA 3P9KA 4HF1A 1X1BA 4Q4ZF 1ERDA 1SD4A 4ZC3A 2W84A 3FXQA 3M07A 1R71A 5HLTA 3J7AO 2ID6A 2W48A 3KYCB 3HPHA 4XR6A 2DXIA 2WADA 1OYWA 3VYRB 4NC7A 4AIDA 3CO6C 3ISPA 1BA5A 1VF9A 2Z3YA 1X3UA 4B47A 2ZXIA 2O7OA 3G1LA 2RNJA 1ZTRA 3HYIA 2Y75A 4V2GA 4EJUA 3DPTA 3F21A 5DV5A 2NVXJ 4Y15A 5J3LA 2QZ8A 2NOJB 3H9GA 4EJOA 2KIMA 5KAFC 3V8KA 5LBQA 1YW8A 1K4SA 1MIJA 1GDTA 2DTZA 1WFXA 3SZGA 5HODA 3DV8A 2R7UA 4A3FJ 1A36A 1V55H 3K70C 3WU2C 2ECCA 2HPIA 3HOYJ 1IXCA 4YIRX 3GFIA 2OF7A 1TQPA 4QIWN 2LBFA 2X1EA 5IT9K 5BOXA 1S9HA 2QWWA 4C3IJ 4YRVA 3QPLA 1H8AC 5L3GA 2Y69H 2QQ9A 3KP2A 1GUUA 2O5RA 1FYMA 1HLVA 3K9TA 1OJLA 4XN3A 2KIQA 3WU0A 1F43A 1ZR2A 1QA6A 1YLFA 2CJJA 1JUMA 4XRMA 2JPBA 1UELB 2XF5A 2XHKA 1AWCA 1D8JA 3K0LA 4U87A 2HZDA 2DFIA 2IT0A 3GFJA 3SZPA 4NNJA 1TL8A 2V26A 1ZAOA 2A5YB 2DFEA 2DOEA 2QENA 3BCBA 5DD4A 5L3DA 2V9PA 3ZCOA 4HNVA 3W6JB 3KEQA 4EQQA 2XROA 4HX4A 3V7CA 1XPXA 3VPRA 4I7HA 4BACA 3OYNA 4I99C 4UY8I 2BGCA 3WU1B 1OR7C 2JWTA 1A31A 1KQ9A 1OKRA 5DCMA 2P5KA 3WTSC 5CYVA 3QYBA 3PIOF 3VYSB 5E3LA 4KMFA 3I71A 3ZR8X 3DKYA 3K69A 3WE2A 5FLMJ 4FQGA 2E71A 1K78A 3I56I 1K79A 1MBGA 3CJNA 4XKBA 1XSVA 3KEOA 3UKGA 2V7FA 3RYPA 3VWBA 1W7PA 5LLQA 3FBNB 1HC8A 3CTAA 3MKYB 2MD5A 4FT8A 4NC6A 4CXFA 2STWA 2VBXA 1Y0NA 4RLQA 5E8IA 4AD9A 4XKVA 2V9VA 1FPQA 1K4TA 2LR8A 1P4XA 2H09A 2FF4A 3T8RA 4B44A 3OIQA 5E8GA 4XONA 2QF7A 1YG2A 3PSFA 1JHHA 1POGA 2NOGA 4X1EA 3BROA 4QSHA 3D5LA 5FFZA 1X19A 2EINH 3DXJF 4GDFA 2EZIA 2OTJI 4YEJA 3CCSI 1GXPA 2L2OA 2WC2A 1WI3A 1MBFA 2J5PA 4EV0A 2VJ5A 4GFBA 1R5ID 2XAGA 3HPGA 3G1MA 3GUDA 3E6CC 2PJPA 1GLNA 2HDWA 1X2MA 2JMWA 1U3EM 1IJWC 2CV0A 3H92A 2ZJQF 1W0TA 5AONA 4D9JA 3DEEA 3RQ4A 1IG7A 2EV0A 2M45A 3TKYA 4OIRF 3KYLA 1MDMB 5F04A 2E60A 3OR1C 4G12A 3TW6A 3KETA 4IHSA 3V42A 1UCRA 2X51A 4FETA 1XGMA 1ONVA 3RZOJ 4BU2A 1HW5A 2K3FA 1HBXG 2CWEA 3OR2C 3RIRA 3PJRA 2K9QA 3CCYA 4C3JJ 3OL3A 2QA4I 3RTRA 3CCJI 2VIXA 2GWRA 1RETA 2LVSA 1APLC 3B6CA 5BS6A 3ULQB 3H9JA 4PUSA 3WODF 3S16J 3BR0A 5K5OA 3U2RA 3ZXSA 5M3FJ 4CCMA 2BV6A 3J7ZI 3BJAA 5J4VA 5EJCA 2VBZA 1R1VA 2G7HA 3HOTA 2MA3A 1KYWA 4PFPA 4LOCA 2V1UA 3ZP5A 3A01A 3EPZA 1JJ8C 3RPUD 2EFWA 2O9LA 1PDNC 1LDJA 1D0XA 1IN4A 2E1NA 2VI6A 4TV7A 5LGUA 1JJ6C 2HKXA 2HQRA 2EV6A 2CUZA 2X6YA 4EM0B 2M2EA 3NRVA 3MKLA 1MH4A 1Z77A 3ZMDA 2DQRA 4D5FA 4YG2F 1HA8A 1UB9A 4UUTA 1XMKA 4FHTA 4BQNA 3CDLA 3FX3A 4E7KA 2VUMJ 2DMPA 3DEWA 5DUKA 3Q5FA 2OZ6A 5FLVA 1QPMA 5H2FC 2F2EA 3LSMA 1HDPA 3FMQA 1O3RA 1K6OA 3ZQHA 3GO5A 2VN2A 2KISA 2RV8A 2A68F 5H6RA 5A2QZ 1OCZH 2CQNA 4WCGA 3OYLA 2PJRA 1IN7A 1FYLA 3VDXA 3GZ5A 3CUQA 1TQIA 1BL0A 5IPAA 3JRGA 4NC8A 3KZIC 4HDVA 1U9OA 1Z3YA 3KP7A 3PSIA 4M3EA 1X3WB 2FEZA 2OBPA 4KT5C 1K83J 4LFUA 4B43A 5J8CA 5EEAA 2FQ4A 1CF7A 2D2WA 2QQ8A 3B6AA 5HDKA 1AU7A 3I54A 2MH9A 2JUCA 1FX7A 2EIKH 2MD0A 2VXDA 1XMXA 2BHZA 2WY7Q 3AFHA 1KONA 2CUFA 3NWSA 4FX0A 1IXSB 3TBIA 4GGGA 2M30A 2XGDA 3VSLA 2O0YA 2VE8A 1WJDA 1BI0A 2EA4A 2KP6A 3HKZA 4HPQA 2V79A 1D0YA 2JSCA 1PUFB 1FYKA 1ZYRF 1Y1WJ 2Z99A 4FTHA 2DJIA 3I4NJ 2Q8KA 2G7UA 4DYQA 2F4IA 4UUSB 3H5AA 3F9KA 4A69C 2XV4S 5FRMA 2RQQA 3E7LA 4LGWA 4D5CA 1FIAA 5LHHA 2IA0A 4M6YA 2DT6A 2JSPA 3HG9A 1EH8A 3OYIA 5J1UA 2ZC2A 2Z2SB 4L9TA 5TGTA 3GTPJ 1SVOA 2BVLA 1X1CA 5J40A 4LB6B 4KITB 2ESHA 2M3AA 4KIGA 5FD5A 4B8XA 4E6KG 1R00A 5FD6A 4RLFA 3NEUA 2E2JJ 1HKQA 1JT0A 4F7ZA 1VQOI 2KZGA 4LLNA 2FD5A 2VKDA 3CDIA 2EH3A 3QYEA 4AYBN 4BE1A 3TW7A 3RKQA 4EATA 1ZG3A 1SD5A 2YX7A 1B9NA 4II2A 5FKLA 3EYIA 2HOAA 3EYYA 1S7AA 1RKWA 5JLWA 4ZDOA 1ZHFA 4G6TB 4HBLA 4NUBA 4WK8F 3J81K 1G3YA 2ZMEA 3E5XA 1EJ9A 2Z5UA 2QKMB 3ASOH 1FBQA 1JKQC 5DS9A 2ZJPF 4C30A 5J47A 4HX8A 1ZLKA 2LKXA 1P6RA 2JA5J 4YIFA 2ID3A 5DD8A 5DEQA 1LVKA 4E7JA 2Z16A 5DM7F 1G3WA 3IC7A 2KKOA 1IW7F 3MD2A 2CQKA 4L5EA 4IRHA 1T2KA 2LKPA 4BH9A 4MQ9F 2VPRA 2KIFA 1YRNB 4P1WA 5J1RA 1RRJA 4EM1A 4OWRB 4HNTA 5IY5H 2PMUA 2A3SA 3ERED 4BQOA 2JA2A 4XRFA 4P96A 1AKHA 1P92A 2LDUA 3MWMA 3OSFA 4M74A 2KRHA 2ECBA 3AL0B 3ZN1A 1RR7A 5HLGA 3HRTA 1U2WA 2ZJ2A 2COBA 2E5ZA 2H6BA 2EFQA 1TP4A 1S3JA 2IGNA 1SVMA 3GWZA 4CICA 2L9NA 2STTA 1QPIA 4V19K 2EFNA 1YJ9I 1I27A 1NK2P 1E0EA 5CQGA 1OQYA 4CH7A 2H27A 4A6EA 5IYBJ 3BC8A 3ZQFA 2MSYA 2BHYA 1IGNA 3JAMZ 3BJOA 2HDDA 2Q2EB 5JFRA 1S8NA 1SVLA 1W7PD 4KA4A 1P7JA 3E5UA 5DYMA 4G7HF 1FIPA 3K4BA 3Q0VA 5H20A 3FXJA 1IZ1A 2IS2A 3HJEA 4EJVA 5F27A 4XRSA 5AIQA 3E5QA 5C44J 3FKIJ 3HSRA 4BY7J 1IN5A 3BTLA 2ESNA 1O3TA 5K7ZA 2K3PA 3M3YJ 2Z1DA 4IHVA 3LSHA 5B1BH 1BOBA 3KLOA 2E34A 3GEZA 1B4AA 2OV7A 1VQ7I 5ERIA 3WTXC 4KIFA 1STZA 4RM2A 4J01A 2GIZA 3DU5A 1UHSA 1P2FA 4UV9A 1KZHA 2XSDC 3CJRB 4IOCF 4A3LJ 3M4OJ 5IT9Z 4UVCA 1MMDA 2ELJA 1H88C 3F8BA 1RC9A 2HWVA 1ZGJA 3ROUA 1ZK8A 4I98B 4MEXF 1MBKA 3GFLA 4LG0A 4B1RA 4CZZA 1S29A 4DJAA 2K9SA 4Z2YA 4DZPA 2XF7A 3ZMZA 1SD6A 3PL8A 2CQ7A 3QOEA 2EILH 2EZKA 2K4JA 2A05A 2VKHA 5M5YJ 3ZMTA 1ZARA 2LY1A 2XPVA 4M9SA 2LKSA 3PUBA 2LD5A 1OCRH 4I0AA 1JUPA 1EH6A 5FRNA 1DGWY 3KE2A 4IHTA 4DIQA 3OIPA 4WWCA 4I01A 2DT7B 2Y30A 4IQJA 2FMYA 1ETWA 4ZH4F 4Q5SF 3TL4X 4ZZLA 4S05A 5ICFA 3F3XA 2VC1A 2OU2A 2MYSA 2PMHA 4A3DJ 5CVJA 3SDGA 2WAQN 3SEZA 1GHCA 4BBRJ 2EB7A 4YFNF 3CF5F 3ABUA 2L4AA 3K1MA 3ZQLA 1QU3A 2E7XA 2ZKZA 2IGMA 1I3QJ 3PQKA 3JSPA 1EH7A 2GA1A 1FWZA 5ICCA 3KCCA 4RMNA 3GYHX 2M0MA 1T6SA 5KVRA 2VODA 4ZYEA 4KMUX 2QSGX 3F8NA 5C3EJ 4CCLA 2IS4A 4PZJA 2Y0SN 2KLOA 3S2HJ 1E3HA 3ELKA 4HZFA 3FMSA 2DA3A 2XKPA 4A2UA 4BDZA 2OC6A 1LNWA 4FISA 2VOPA 5EZHA 3FM3A 3CP8A 3GBGA 3CCUI 2PG4A 4ON0A 3ABLH 2R3SA 5IP9J 3BTIA 1B9MA 2D1HA 2F4OB 3E6DA 3P5JA 4LK0F 1G59A 1XCVA 2HGCA 2JA7J 3F23A 3EUHA 3GZ6A 2FJ1A 4LIUA 3G73A 1A5JA 4LLGF 4A0YA 2DN0A 5JLXA 2QM3A 4G7OF 1S5LC 1X2NA 2R4GA 4GRIA 1R23A 1T0FC 1V4RA 3ZOBA 2ZCWA 2DW4A 2RC4A 2VKVA 3Q0UA 1MJ9A 2EWNA 4LB5A 3AAFA 4ZZDA 2JRMA 3H3VK 2DT5A 3C2GA 5EGOB 3KP4A 1RR8C 4BHPA 3LFKA 3I9V2 3BPXA 1ZKGA 1ZQ3P 1UG0A 2A6TA 2LK2A 2CSOA 1JT6A 4HV5A 2PQ8A 4F91B 3ZPLA 3ECHA 1FOYA 5LHGA 3LL7A 1R49A 2AQEA 3AG2H 3ZGKA 1YI2I 3GTKJ 2WBMA 1BC8C 1LFPA 1LPQA 1JI8A 4BUPA 4FASD 2DK8A 4A3IJ 2R7DA 2DBBA 2FX0A 3HSEA 1ETOA 3OY9A 2GBYA 1RKTA 1IN8A 4XL9A 2HOEA 1Z9CA 1Y1VJ 5GTIC 3A03A 3ZMVA 2WWYA 4JOMA 2IS1A 2VBYA 3C3WA 3RPQA 4AWXB 4KN4X 2PLYA 1OCOH 4MGRA 2M1BA 4IHXA 2LMDA 1XX5A 1VQ8I 4H0EA 2L5QA 2XAUA 5F0CA 1MW7A 3QRFF 1TQMA 1Z1DA 2HDCA 4V2FA 5LFAA 3L2WA 5D4SA 5LRSA 1PJRA 2E5NA 2KZVA 4DZJA 3FISA 4M73A 4WX9A 1JTXA 4CUGA 2EIMH 2IEKA 4HW0A 4J00A 5IYCJ 2BXZA 4BXFA 3JRAA 4HX7A 3MZYA 3Q0WA 3RJPA 4YFKF 4UUVA 1YE9A 1J7KA 4JP0A 2UWMA 4XN0A 3HHHA 3B02A 4I02A 3K4MA 2NXNB 4BJ5C 3DP7A 3KYDB 4G9YA 1B72A 2DA5A 5K7FA 3MCZA 3P9IA 3FK6A 1XD7A 3L9FA 3MEXA 3WG7H 4JX4A 4JYKA 1USSA 5F64A 3MKWB 4AC0A 2OCEA 5ILUA 3I0TA 1JHFA 1QNTA 1BR1A 2GOMA 4OINF 3IRRA 1R4NB 1W36D 1C0WA 5FFXA 2MH2A 3KX2A 3CCVI 2QCOA 1T98A 2XRLA 4RGRA 4ABZA 4F52A 1FC3A 1SFXA 4IO9F 4Y3OA 4Q48A 1B8IB 1IV6A 2IA1A 3I59B 3BZKA 5FROA 4E4HA 2A69F 4M6XA 2CV1A 2BW3A 1SFKA 1W5SA 2MGQA 2DAOA 3CCLI 4AM3A 5CPRB 1FMVA 3G2BA 2GZWA 3CMMA 2JN6A 3T0YA 3AL0C 2MC3A 2FE3A 5JR3A 2QEXI 2X9DA 4XIDA 1WHUA 4KDPA 4IQ4A 1U5TA 4A3GJ 4RB0A 1OCPA 3BLYA 3GVAA 1X3ZB 2K5CA 2W7NA 3G1OA 2LY2A 5CVUA 3V4GA 2XC7A 3L2CA 5EYRA 2CFXA 3CC7I 2DOFA 1WCMJ 4KJZA 4MEYF 3OYAA 3LA7A 2HXOA 1MBHA 1REPC 2F5DA 2DFFA 3QODA 2LOOA 4B4CA 2ME6A 4JBAA 3V7RA 3IUOA 5ILVA 2CW8A 2W24A 2R7XA 1K7AA 1LQ1A 2LBFB 1D3YA 3BP8A 3S93A 2NS8A 2BBYA 1I3AA 3BR3A 4OU0A 4BQAA 2ZFWA 5H6QA 3G4SI 2VONA 1PVEA 4L5IA 3S1QJ 5DTDA 2EJRA 3J81Z 3IKVA 4EM2A 4XOPA 3VFZA 2IVMA 4U7DA 4U7BA 4MQVA 4CCOA 4LIVA 4A6DA 1JXSA 2VKEA 5IOYA 2JVGA 5GP9A 2WAEA 3GW2A 4M71A 2BOLA 1TW3A 2VT2A 2E1CA 3ERMA 2R7VA 2RN7A 1H0MA 2DLLA 3S15J 2V4JC 2R5YA 3W3CA 1G3SA 1LJ9A 3JTHA 1R6RA 1T8IA 1Z21A 2EBIA 1UHWA 3FXMA 4DYRA 1HW1A 3HRUA 4RB1A 1ZH5A 1AHDP 1IDYA 3BQYA 2CGPA 2Y2ZA 3G3ZA 3OS1A 1QVUA 4IHWA 3LSKA 2L7FP 3QPTA 5DCMB 2XAJA 3ECOA 4ZJZA 1BOAA 1XCBA 2X1CA 3MVPA 4U0VA 1SAUA 2WV1A 4HEA2 3OL4A 3CMYA 1W4MA 2YU3A 2M87A 4MLOA 4PJJA 3CMEI 1ODDA 1LFBA 3DTKA 5CLSA 1K78B 2HPMA 2V1XA 2CU7A 4AIHA 1IC8A 1ACIA 1XSXA 3SXYA 5E17F 2BY3A 4S0HB 3A2KA 3F8MA 1K61A 1MKMA 3R0AA 1YS6A 4C9YA 2DPUA 2R7TA 1VQ5I 1ZGWA 2O3FA 2QBYA 1D1CA 1EA3A 1BI1A 3WTYC 2BE5F 4XICA 4BHCA 2YUSA 4A0ZA 2PMZA 1Z0XA 4CGZA 1RPWA 1XN7A 5HS8A 1X58A 2VQGA 2ICWG 2M0CA 1SC7A 1HXDA 2CUJA 1ETYA 3S2WA 3C7JA 5ED4A 4S04A 3MQ0A 2G0EA 2VJJA 2WA0A 4A12A 3GTGJ 3HKZN 2KFDA 2L9VA 2D5VA 1LUJB 4XLNF 2DO7A 2AXLA 2XF6A 2FUG2 3PNVA 2MC4A 2PI0A 3CCMI 3S1NJ 2CMPA 1ULYA 3WE3A 4CYCA 2VOOA 5HNHA 2RGVA 5JVTA 1JE8A 3ZN0A 1LEAA 2Y31A 4R8HA 1MDMA 3DF8A 3LSTA 4KIBA 1YW9A 3QU3A 2LP0A 3U9GA 4PCQA 1ZRDA 1P4AA 1M1EB 3QPSA 2KHMA 4L9NA 4RM3A 5B5EC 4X0GA 3OYKA 2HXIA 3IWZA 4AUXA 1N78A 3Q9VA 1WJ5A 2XGCA 3H36A 3H3ZA 4UB8C 2K85A 3HB9A 3EUHC 5JI6A 2B63J 3O3KA 1LDKB 2A61A 2O61A 3DTEA 5M5XJ 4ENNA 5CKTA 3O8GA 5HS9A 1BW6A 1FP1D 3DPUA 3D1NI 4ZTFA 3U1DA 3FF5A 3FXRA 4A3BJ 3A01B 1L3LA 3D5RC 1V3FA 3F8FA 1BM9A 4F92B 2TRTA 4BEHA 2LFBA 3JW4A 4E7IA 3H0GJ 5FJ8J 5L3CA 4FX4A 1E3PA 2OCCH 2FSWA 2YX4A 4CCKA 2IJLA 1OYIA 3OYBA 2V6EA 5K1YA 1WVRA 2HOTA 3EUAA 4IOAF 1ETVA 2Q1ZB 4DNCA 2BEOA 2KMUA 2BXYA 2KJBA 3S3OA 4XLHA 1XGOA 2JVHA 2HTSA 5CQEA 4C2MJ 5LEJA 4NHJA 4M3FA 1RUNA 3GZNB 2PJRB 3WTTC 2L9RA 1ZG1A 3H35A 1Y6IA 3A4CA 3CUQB 4CSWA 1GT0C 4ZYHA 1NK3P 3K4KA 2HQ5A 4HLYA 2VQHA 2JZYA 1KQ8A 4DW6A 1FTZA 1DQUA 3S3MA 5K5QA 3WTUC 1CF7B 3DWLE 2WB1A 3BG9A 5HLHA 4OIOF 5FKNA 3C2HA 2OAZA 1Q1VA 1P4WA 5IYDJ 3QAHA 4P9FA 2M8GX 3I5UA 4ITVA 4CZCA 2R93J 1P7IA 2ADUA 5E1WA 2Q0OA 2NS7A 3DLLF 5FB2A 2A07F 1FMWA 1IN6A 2OJED 3FIWA 1MJBA 1PUFA 1FOXA 2A5WA 1XSDA 5ICGA 5LD2C 3VYUB 2BZTA 3K2ZA 2IA2A 2JRTA 2HOSA 3VODA 3JRFA 3CO7C 3PM1A 4L18B 4H4KC 1MD0A 2ZXHA 2ZO4A 2KRCA 2FRHA 1SANA 2F5EA 2RREA 3NQOA 2XAQA 1TNSA 2XB5A 3W6VA 3R4KA 4BJTA 3F0CA 2D45A 1PYVA 1NTCA 4MHGA 1FTTA 4E70A 4L0YB 2IP2A 3UR3C 4LK1F 1ORKA 3KPHA 5JHFA 1Y8QB 2VJIA 5B3SH 3K1PA 4ZDPA 3WGHA 2CS3A 5JVGF 4A3JJ 5FO5A 2DU9A 3GCMA 4M9XA 1OCTC 1G4DA 3SFZA 5BNGA 2EPFA 1DGRM 1SFOJ 4YFXF 4I0BA 2ZXJA 3ABKH 2KDZA 1S6LA 3ZQ7A 1W5TA 5E3NA 1IRZA 4R1HA 3CCRI 3LQQA 3R6SA 1ETXA 2L0KA 3TP0A 1E2XA 3C1DA 2M7AA 3LSGA 2F48A 4RBOA 2LRDA 5TISC 5C4JJ 4KT6A 3S1RJ 1S72I 1CGPA 2FBKA 4O6JA 1BN5A 4U0WA 3V8JA 3ZQQA 1Z7UA 4M3DA 3H3UA 1JGGA 4OAYA 4A3MJ 5GAGJ 1EV7A 2WAFA 4HF0A 1YRNA 1JTYA 1QQIA 4KFCA 2VE9A 2NVTJ 2EIJH 1YOVB 2DCEA 3GLLA 4EGYA 5D5VB 3ML6A 4BL0B 2QGUA 1MNMC 2DMNA 4E7SA 1AKHB 2JTVA 1A6IA 3RKYA 2FBIA 2DFHA 2GM4A 4HLXA 4XSXF 4DOZA 1V54H 2QSFX 2XGEA 3K1NA 5J8FA 1FT9A 3QYFA 2V9KA 3IRQA 3A1YA 4N4OB 1NG6A 4ASNA 3WTVC 4IZZA 2ME0A 4GCVA 2R7SA 1ETKA 3Q9SA 3JTGA 3S1MJ 4MO7A 5KAIC 1YHQI 2R7FA 4HF2A 4GYGA 3K10A 4A3EJ 4A5MA 1VQKI 1WH5A 2A6HF 2Q2EA 1QHGA 4B09A 3E1SA 2K40A 2XVCA 2QYOA 2Z9OA 1Z7LA 2M4KA 2PX9A 2E1OA 3WTZA 3BR6A 3FBIB 3HEFA 4E7HA 4ENKA 1OPCA 5EZGA 5ICEA 3M8EA 1G2HA 5L3BA 4HOBA 5LHIA 3G71I 5E18F 2M4GA 3PNTA 3FK7A 3TDUC 4PDKA 5IOZA 2UUZA 3CLOA 1V5GA 2B9SA 3PFIA 3OYCA 4EGZA 4D0PA 1MSEC 2VT3A 3HUGA 2HFHA 3JRBA 4JK1X 1OR7A 2FNPA 2X48A 4BAYA 2KPMA 1SAXA 1J75A 3IH4A 4DBQA 2LF8A 3JREA 2EQRA 1GVJA 1MMAA 3O2PE 3QQAA 2GIVA 3QU6A 4YELA 3SFIA 3F6VA 1NHAA 2XSJC 4OIPF 1VFCA 4BXUA 3H9QA 3OYHA 1O57A 2CRGA 5HVQC 3LA3A 2R7QA 2VXZA 2GAUA 3QWLA 3FDYA 4YIIA 1WWXA 3DBLB 1MNDA 1DUXC 4LG0B 1UFMA 2XPUA 2COMA 4PJNA 4FE7A 2MLKA 2XGXA 1F36A 2DYSH 3MKZA 3CLQA 3BR5A 4E7ZA 2HI3A 2B7EA 3T8TA 1QVTA 5FLXK 1DU0A 3KZZA 1YW7A 4Y13A 4R79A 3E0JB 1OISA 2XIGA 1MGTA 3R61A 3S32A 2ACJA 3BJ6A 3WGGA 1VQ9I 1Z6TA 4EJWA 4Y7NJ 5EG0B 2DTRA 2EZLA 3BCAA 2ZJRF 4BHBA 3PQJA 3K7AJ 4BS9A 1TWHJ 3P7NA 5E79C 1I50J 1WRJA 3JCUC 4WXCA 3EQLF 3O6BB 4XKCA 1Z91A 3BPVA 3FXKA 3ONQA 1MMGA 2DMQA 3HHGA 2L7KA 1SFEA 1O7LA 3HL2A 1O3SA 5CVIA 1A35A 1WI9A 3S8PA 5FGMA 3CC4I 1YX5A 3M9AA 4IEJA 5D6EA 2L4MA 2HQNA 1U9NA 1WJBA 2K4BA 4F3QA 3OYMA 3WG9A 1X1DA 2DODA 3K4JA 1BC7C 1DPRA 2ZFUA 2R0QC 4GXOA 4PJMA 3TMOA 1QZZA 2X0LA 2R7RA 3I55I 3LSRA 5F1JA 2W25A 1WQ2A 4L5JA 1LB2A 4B3XA 4CO8A 4XM3A 4EJTA 4M72A 2PFBA 4O3MA 2VL8A 3BOQA 4I09A 9ANTA 2OPTA 2WTEA 4HYEA 5E1XA 3TP3A 1R1UA 5HLIA 1F1ZA 1F5TA 3HGYA 1BIAA 1I6HJ 5D5WB 3TO7A 1R1TA 4PGHA 2YSRA 2ZBKA 3CUQC 3CP2A 1WJAA 3H5RA 1N75A 5EF6A 4BNCA 3CC2I 3HOZJ 2B0LA 2G9WA 2UXXA 5HS7A 1KYZA 4P55A 2NS0A 2VBWA 4AIJA 1TTYA 2RAEA 2X6OA 1DU6A 2EFPA 1J59A 4Y17A 2K7LA 1MBJA 3OOPA 3PFYA 5IT3A 2FMLA 4A93J 2R5ZB 4I2OA 5KNLA 3HOWJ 1YYVA 1AA7A 5F6FA 4IL6C 4DYCA 3C18A 1USTA 4W1UA 2XB0X 5LRRA 1XDSA 2VASA 3TEDA 2KRFA 4G7ZF 3DKXA 3OYEA 3IH2A 3GFMA 1BI3A 4IHYA 3BZCA 4BGDA
chains in the Genus database with same CATH topology
3MVPA 3CMYA 2WV1A 4M3GA 2O8KA 2DA4A 4MLOA 1PUFB 3S17J 1LFBA 1Y1WJ 4FTHA 3NARA 2CU7A 1HF0A 1IC8A 3I4NJ 4DYQA 4UUSB 3L1PA 1TC3C 4A69C 4S0HB 3E7LA 4D5CA 4MIMA 1FIAA 1K61A 1MBEA 1GV2A 1ZGWA 3GTMJ 2R7ZJ 5J1UA 3GTPJ 4XICA 3ZQCA 2YUSA 4MFDA 1LE8A 1U8BA 1Z0XA 1RPWA 2E2JJ 1X58A 1JT0A 4A3KJ 1QRYA 3GTQJ 2M0CA 4W97A 2DA1A 1ETYA 2IBDA 2FD5A 3LSPA 3JRDA 2LTPA 3LNQA 2EH3A 4AYBN 3TW7A 2AHQA 3RKQA 2G0EA 2DJNA 5M5WJ 3GTGJ 3HKZN 5FKLA 1T56A 2HOAA 1B72B 4FE4A 2D5VA 1RKWA 5JLWA 1JUSA 3BR1A 1TWAJ 3S1NJ 3BG3A 5EDNA 4CYCA 5EG0A 1GVDA 3BTJA 1JKQC 5DS9A 2Y31A 2LKXA 2JA5J 2ID3A 2LP0A 1MSFC 2H8RA 2PMZN 3I4MJ 3CQZJ 3QPSA 4L5EA 1FJLA 2HXIA 2KT0A 2VPRA 4AUXA 5J1RA 1YRNB 3ZQGA 2XGCA 3HB9A 3K2AA 3NAUA 2B63J 1AKHA 3OSFA 2ECBA 3BT9A 1RR7A 2E19A 5M5XJ 4BY1J 3O8GA 1BW6A 3D1NI 3HDDA 2COBA 4A3BJ 3A01B 3IV5A 5EGOA 2TRTA 2LFBA 1QPIA 3GTLJ 1GV5A 3H0GJ 5FJ8J 1NK2P 5E3MA 1TWFJ 5IYBJ 2HOTA 1ETVA 3ZQFA 2MSYA 5GPCA 1IGNA 2HDDA 4A3CJ 2N8GA 5K7HA 1P7JA 1ENHA 2Y9YA 4C2MJ 4M3FA 1TWCJ 1FIPA 2L9RA 3Q0VA 3PO2J 2MW8A 4JX6A 4XRSA 1UMQA 5F27A 2CUEA 2AO9A 4J19A 2P81A 1GT0C 1NK3P 2LY9A 5C44J 3HOVJ 2HQ5A 5C4XJ 3FKIJ 1IDZA 4BY7J 2R5ZA 4DW6A 2NVQJ 1FTZA 3BTLA 3M3YJ 5K7ZA 2R5YB 3BG9A 2YU9J 4IHVA 2M9HA 1T33A 2K9NA 5FKNA 1TWGJ 1Q1VA 5E3OA 5IYDJ 2M8GX 1R9TJ 2R93J 1P7IA 3GTJJ 2EZHA 1JKOC 2NS7A 3HGGA 2R92J 2DA7A 4X6AJ 1UHSA 3FIWA 1PUFA 2CQQA 2JJ7A 3Q3SA 2XSDC 4A3LJ 2DA6A 3M4OJ 1U78A 1H88C 2NVYJ 2HOSA 3JRFA 3PM1A 4BKXA 1D5YA 1ZK8A 5FKMA 1MBKA 1SANA 4B1RA 1H89C 2XB5A 2K9SA 3W6VA 4DZPA 1XS9A 2GLOA 2JA6J 1IUFA 2EZKA 1BW5A 1WPKA 3F0CA 5M5YJ 3OIOA 2XPVA 1NTCA 3JRCA 2HYJA 2LD5A 2WB1N 1JUPA 1FTTA 3HBLA 5IP7J 2L7ZA 1LE8B 4FCYA 5F08A 1JKRC 1ORKA 3WHCA 3BR2A 2Y30A 4MFEA 1ETWA 4M3BA 2I10A 1ITYA 1JKPC 4A3JJ 1OCTC 1ETQA 5BNGA 3SJMA 4A3DJ 1E3OC 3SDGA 1SFOJ 2WAQN 1HCRA 4BBRJ 2KDZA 1WGXA 5E3NA 3ZQLA 1IRZA 5GPAA 1ETXA 4NDLA 1B8IA 1I3QJ 1HOMA 2L0KA 3TP0A 4CYCB 4RDUA 3LSGA 3A02A 4RBOA 4QTRA 2ID6A 2W48A 5C4JJ 5C3EJ 3S1RJ 1VI0A 3C2BA 1BJZA 2Y0SN 3S2HJ 1BA5A 4M3DA 1VF9A 1JGGA 2DA3A 4A3MJ 2O7OA 3G1LA 4FISA 5EZHA 1ZTRA 4V2GA 3GBGA 1YRNA 1JTYA 1XG1A 2NVXJ 5J3LA 2NVTJ 5IP9J 3BTIA 1HDDC 2JA7J 1GDTA 2DTZA 5HODA 1MNMC 2FJ1A 2DMNA 4A3FJ 1AKHB 1A5JA 1A6IA 2DN0A 5JLXA 2ECCA 2GM4A 1X2NA 3HOYJ 5F0HA 1FEXA 2OF7A 4QIWN 3LSJA 1UG2A 3ZOBA 1RESA 2XGEA 4C3IJ 2VKVA 3Q0UA 3QPLA 1H8AC 3HM5A 3PO3J 1CQTA 3H3VK 1GUUA 1LFUP 5EGOB 1HLVA 2DMTA 2ME0A 1OJLA 1ETKA 1F43A 1ZR2A 2CJJA 3S1MJ 1JUMA 4MO7A 4XRMA 1ZKGA 1ZQ3P 3IH3A 4A3EJ 4I76A 2LK2A 3OSGA 1WH5A 5J1YA 1JT6A 2YS9A 2K40A 4HNVA 2E1OA 1S7EA 2L7MP 3BR6A 3HEFA 3VPRA 5EZGA 3GTKJ 1G2HA 4A3IJ 2FX0A 2JWTA 3FK7A 2E2IJ 3WHBA 2Y9ZA 1ETOA 5IOZA 2GBYA 1RKTA 2XPWA 1OFCX 5E3LA 1MSEC 1Y1VJ 3JRBA 3A03A 4C3HJ 4D7MA 2X48A 5FLMJ 3IH4A 3S14J 3LOCA 4UUSA 1MBGA 3JREA 4IHXA 2EQRA 3QQAA 3UKGA 3SFIA 2E2HJ 1VFCA 5F0CA 5F0FA 2DA2A 3RZDJ 4V2FA 2CRGA 1ZR4A 4M6VA 3ZQIA 4DZJA 3FISA 4XRSG 1JTXA 2LR8A 3BG5A 2IEKA 4D7NA 2XPUA 5IYCJ 3JRAA 4FE7A 3Q0WA 1F36A 2QF7A 4JP0A 3BTCA 1POGA 3BR5A 2NOGA 4X1EA 1B72A 4QSHA 2HI3A 2DA5A 5K7FA 3FK6A 1QVTA 2EZIA 1DU0A 4JX4A 2CQXA 1WI3A 3DCFA 4JYKA 1MBFA 4GFBA 2MG4A 3G1MA 4AC0A 1O4XA 1X2MA 2JMWA 4Y7NJ 5M3MJ 5EG0B 1IJWC 2EZLA 2IAIA 1W0TA 5FKOA 1IG7A 1VNDA 3K7AJ 2QCOA 4JX5A 2XRLA 1TWHJ 4ABZA 1I50J 2JA8J 5F04A 4G12A 3TW6A 3JRHA 1IV6A 1B8IB 2DMQA 4BBSJ 3RZOJ 2MGQA 1W0UA 4IEJA 2K9QA 3CCYA 4C3JJ 2JN6A 1U9NA 2M34A 2X9DA 4XIDA 1RETA 2LVSA 1APLC 3B6CA 4A3GJ 3S16J 1OCPA 3BR0A 2R0QC 5M3FJ 3G1OA 5EYRA 2JK3A 3LSRA 5F1JA 1WCMJ 2HXOA 1MBHA 3OOUA 4LOCA 3A01A 3BQZA 1JJ8C 4B4CA 2O9LA 2ME6A 3HOUJ 2ELKA 2VI6A 3HOXJ 4I6ZA 1JJ6C 9ANTA 2OPTA 3MN2A 3TP3A 3O8HA 5IP6A 2M2EA 3MKLA 1MH4A 1Z77A 4D5FA 3HGYA 4UUTA 3JR9A 2VUMJ 2NS8A 3CDLA 1I6HJ 3BR3A 2DMPA 3DEWA 3S2DJ 2LLKA 5FLVA 5EF6A 1HDPA 3S1QJ 5DTDA 2XGDA 3ZQHA 3HOZJ 1MH3A 1WH7A 2ZB9A 4B3AA 4BXXJ 2VKEA 3RQIA 5GP9A 2RAEA 5IOYA 2X6OA 2H1KA 1DU6A 4XK4A 4EEFG 1BL0A 1MBJA 5IPAA 3JRGA 1U9OA 4M3EA 3GTOJ 5EEAA 1K83J 4A93J 3S15J 2R5ZB 3JRIA 2FQ4A 3B6AA 2R5YA 3HOWJ 5FKKA 1AU7A 4DYCA 2EBIA 4W1UA 4DYRA 2XB0X 2TCTA 1XC5A 4Y52J 1AHDP 1IDYA 2DMUA 3TEDA 3BQYA 1EF4A 2CUFA 2Y2ZA 3IH2A 4IHWA 1QVUA 4IHYA 2L7FP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVP A;  3CMY A;  2WV1 A;  4M3G A;  2O8K A;  2DA4 A;  4MLO A;  1PUF B;  3S17 J;  1LFB A;  1Y1W J;  4FTH A;  3NAR A;  2CU7 A;  1HF0 A;  1IC8 A;  3I4N J;  4DYQ A;  4UUS B;  3L1P A;  1TC3 C;  4A69 C;  4S0H B;  3E7L A;  4D5C A;  4MIM A;  1FIA A;  1K61 A;  1MBE A;  1GV2 A;  1ZGW A;  3GTM J;  2R7Z J;  5J1U A;  3GTP J;  4XIC A;  3ZQC A;  2YUS A;  4MFD A;  1LE8 A;  1U8B A;  1Z0X A;  1RPW A;  2E2J J;  1X58 A;  1JT0 A;  4A3K J;  1QRY A;  3GTQ J;  2M0C A;  4W97 A;  2DA1 A;  1ETY A;  2IBD A;  2FD5 A;  3LSP A;  3JRD A;  2LTP A;  3LNQ A;  2EH3 A;  4AYB N;  3TW7 A;  2AHQ A;  3RKQ A;  2G0E A;  2DJN A;  5M5W J;  3GTG J;  3HKZ N;  5FKL A;  1T56 A;  2HOA A;  1B72 B;  4FE4 A;  2D5V A;  1RKW A;  5JLW A;  1JUS A;  3BR1 A;  1TWA J;  3S1N J;  3BG3 A;  5EDN A;  4CYC A;  5EG0 A;  1GVD A;  3BTJ A;  1JKQ C;  5DS9 A;  2Y31 A;  2LKX A;  2JA5 J;  2ID3 A;  2LP0 A;  1MSF C;  2H8R A;  2PMZ N;  3I4M J;  3CQZ J;  3QPS A;  4L5E A;  1FJL A;  2HXI A;  2KT0 A;  2VPR A;  4AUX A;  5J1R A;  1YRN B;  3ZQG A;  2XGC A;  3HB9 A;  3K2A A;  3NAU A;  2B63 J;  1AKH A;  3OSF A;  2ECB A;  3BT9 A;  1RR7 A;  2E19 A;  5M5X J;  4BY1 J;  3O8G A;  1BW6 A;  3D1N I;  3HDD A;  2COB A;  4A3B J;  3A01 B;  3IV5 A;  5EGO A;  2TRT A;  2LFB A;  1QPI A;  3GTL J;  1GV5 A;  3H0G J;  5FJ8 J;  1NK2 P;  5E3M A;  1TWF J;  5IYB J;  2HOT A;  1ETV A;  3ZQF A;  2MSY A;  5GPC A;  1IGN A;  2HDD A;  4A3C J;  2N8G A;  5K7H A;  1P7J A;  1ENH A;  2Y9Y A;  4C2M J;  4M3F A;  1TWC J;  1FIP A;  2L9R A;  3Q0V A;  3PO2 J;  2MW8 A;  4JX6 A;  4XRS A;  1UMQ A;  5F27 A;  2CUE A;  2AO9 A;  4J19 A;  2P81 A;  1GT0 C;  1NK3 P;  2LY9 A;  5C44 J;  3HOV J;  2HQ5 A;  5C4X J;  3FKI J;  1IDZ A;  4BY7 J;  2R5Z A;  4DW6 A;  2NVQ J;  1FTZ A;  3BTL A;  3M3Y J;  5K7Z A;  2R5Y B;  3BG9 A;  2YU9 J;  4IHV A;  2M9H A;  1T33 A;  2K9N A;  5FKN A;  1TWG J;  1Q1V A;  5E3O A;  5IYD J;  2M8G X;  1R9T J;  2R93 J;  1P7I A;  3GTJ J;  2EZH A;  1JKO C;  2NS7 A;  3HGG A;  2R92 J;  2DA7 A;  4X6A J;  1UHS A;  3FIW A;  1PUF A;  2CQQ A;  2JJ7 A;  3Q3S A;  2XSD C;  4A3L J;  2DA6 A;  3M4O J;  1U78 A;  1H88 C;  2NVY J;  2HOS A;  3JRF A;  3PM1 A;  4BKX A;  1D5Y A;  1ZK8 A;  5FKM A;  1MBK A;  1SAN A;  4B1R A;  1H89 C;  2XB5 A;  2K9S A;  3W6V A;  4DZP A;  1XS9 A;  2GLO A;  2JA6 J;  1IUF A;  2EZK A;  1BW5 A;  1WPK A;  3F0C A;  5M5Y J;  3OIO A;  2XPV A;  1NTC A;  3JRC A;  2HYJ A;  2LD5 A;  2WB1 N;  1JUP A;  1FTT A;  3HBL A;  5IP7 J;  2L7Z A;  1LE8 B;  4FCY A;  5F08 A;  1JKR C;  1ORK A;  3WHC A;  3BR2 A;  2Y30 A;  4MFE A;  1ETW A;  4M3B A;  2I10 A;  1ITY A;  1JKP C;  4A3J J;  1OCT C;  1ETQ A;  5BNG A;  3SJM A;  4A3D J;  1E3O C;  3SDG A;  1SFO J;  2WAQ N;  1HCR A;  4BBR J;  2KDZ A;  1WGX A;  5E3N A;  3ZQL A;  1IRZ A;  5GPA A;  1ETX A;  4NDL A;  1B8I A;  1I3Q J;  1HOM A;  2L0K A;  3TP0 A;  4CYC B;  4RDU A;  3LSG A;  3A02 A;  4RBO A;  4QTR A;  2ID6 A;  2W48 A;  5C4J J;  5C3E J;  3S1R J;  1VI0 A;  3C2B A;  1BJZ A;  2Y0S N;  3S2H J;  1BA5 A;  4M3D A;  1VF9 A;  1JGG A;  2DA3 A;  4A3M J;  2O7O A;  3G1L A;  4FIS A;  5EZH A;  1ZTR A;  4V2G A;  3GBG A;  1YRN A;  1JTY A;  1XG1 A;  2NVX J;  5J3L A;  2NVT J;  5IP9 J;  3BTI A;  1HDD C;  2JA7 J;  1GDT A;  2DTZ A;  5HOD A;  1MNM C;  2FJ1 A;  2DMN A;  4A3F J;  1AKH B;  1A5J A;  1A6I A;  2DN0 A;  5JLX A;  2ECC A;  2GM4 A;  1X2N A;  3HOY J;  5F0H A;  1FEX A;  2OF7 A;  4QIW N;  3LSJ A;  1UG2 A;  3ZOB A;  1RES A;  2XGE A;  4C3I J;  2VKV A;  3Q0U A;  3QPL A;  1H8A C;  3HM5 A;  3PO3 J;  1CQT A;  3H3V K;  1GUU A;  1LFU P;  5EGO B;  1HLV A;  2DMT A;  2ME0 A;  1OJL A;  1ETK A;  1F43 A;  1ZR2 A;  2CJJ A;  3S1M J;  1JUM A;  4MO7 A;  4XRM A;  1ZKG A;  1ZQ3 P;  3IH3 A;  4A3E J;  4I76 A;  2LK2 A;  3OSG A;  1WH5 A;  5J1Y A;  1JT6 A;  2YS9 A;  2K40 A;  4HNV A;  2E1O A;  1S7E A;  2L7M P;  3BR6 A;  3HEF A;  3VPR A;  5EZG A;  3GTK J;  1G2H A;  4A3I J;  2FX0 A;  2JWT A;  3FK7 A;  2E2I J;  3WHB A;  2Y9Z A;  1ETO A;  5IOZ A;  2GBY A;  1RKT A;  2XPW A;  1OFC X;  5E3L A;  1MSE C;  1Y1V J;  3JRB A;  3A03 A;  4C3H J;  4D7M A;  2X48 A;  5FLM J;  3IH4 A;  3S14 J;  3LOC A;  4UUS A;  1MBG A;  3JRE A;  4IHX A;  2EQR A;  3QQA A;  3UKG A;  3SFI A;  2E2H J;  1VFC A;  5F0C A;  5F0F A;  2DA2 A;  3RZD J;  4V2F A;  2CRG A;  1ZR4 A;  4M6V A;  3ZQI A;  4DZJ A;  3FIS A;  4XRS G;  1JTX A;  2LR8 A;  3BG5 A;  2IEK A;  4D7N A;  2XPU A;  5IYC J;  3JRA A;  4FE7 A;  3Q0W A;  1F36 A;  2QF7 A;  4JP0 A;  3BTC A;  1POG A;  3BR5 A;  2NOG A;  4X1E A;  1B72 A;  4QSH A;  2HI3 A;  2DA5 A;  5K7F A;  3FK6 A;  1QVT A;  2EZI A;  1DU0 A;  4JX4 A;  2CQX A;  1WI3 A;  3DCF A;  4JYK A;  1MBF A;  4GFB A;  2MG4 A;  3G1M A;  4AC0 A;  1O4X A;  1X2M A;  2JMW A;  4Y7N J;  5M3M J;  5EG0 B;  1IJW C;  2EZL A;  2IAI A;  1W0T A;  5FKO A;  1IG7 A;  1VND A;  3K7A J;  2QCO A;  4JX5 A;  2XRL A;  1TWH J;  4ABZ A;  1I50 J;  2JA8 J;  5F04 A;  4G12 A;  3TW6 A;  3JRH A;  1IV6 A;  1B8I B;  2DMQ A;  4BBS J;  3RZO J;  2MGQ A;  1W0U A;  4IEJ A;  2K9Q A;  3CCY A;  4C3J J;  2JN6 A;  1U9N A;  2M34 A;  2X9D A;  4XID A;  1RET A;  2LVS A;  1APL C;  3B6C A;  4A3G J;  3S16 J;  1OCP A;  3BR0 A;  2R0Q C;  5M3F J;  3G1O A;  5EYR A;  2JK3 A;  3LSR A;  5F1J A;  1WCM J;  2HXO A;  1MBH A;  3OOU A;  4LOC A;  3A01 A;  3BQZ A;  1JJ8 C;  4B4C A;  2O9L A;  2ME6 A;  3HOU J;  2ELK A;  2VI6 A;  3HOX J;  4I6Z A;  1JJ6 C;  9ANT A;  2OPT A;  3MN2 A;  3TP3 A;  3O8H A;  5IP6 A;  2M2E A;  3MKL A;  1MH4 A;  1Z77 A;  4D5F A;  3HGY A;  4UUT A;  3JR9 A;  2VUM J;  2NS8 A;  3CDL A;  1I6H J;  3BR3 A;  2DMP A;  3DEW A;  3S2D J;  2LLK A;  5FLV A;  5EF6 A;  1HDP A;  3S1Q J;  5DTD A;  2XGD A;  3ZQH A;  3HOZ J;  1MH3 A;  1WH7 A;  2ZB9 A;  4B3A A;  4BXX J;  2VKE A;  3RQI A;  5GP9 A;  2RAE A;  5IOY A;  2X6O A;  2H1K A;  1DU6 A;  4XK4 A;  4EEF G;  1BL0 A;  1MBJ A;  5IPA A;  3JRG A;  1U9O A;  4M3E A;  3GTO J;  5EEA A;  1K83 J;  4A93 J;  3S15 J;  2R5Z B;  3JRI A;  2FQ4 A;  3B6A A;  2R5Y A;  3HOW J;  5FKK A;  1AU7 A;  4DYC A;  2EBI A;  4W1U A;  4DYR A;  2XB0 X;  2TCT A;  1XC5 A;  4Y52 J;  1AHD P;  1IDY A;  2DMU A;  3TED A;  3BQY A;  1EF4 A;  2CUF A;  2Y2Z A;  3IH2 A;  4IHW A;  1QVU A;  4IHY A;  2L7F P; 
#chains in the Genus database with same CATH topology
 1BI2 A;  2XAS A;  1YQA A;  4HSR A;  1I1G A;  4NBQ A;  4XLE A;  2O8K A;  3IWF A;  2DA4 A;  2LRE A;  2XAH A;  1IRG A;  2PEX A;  3N05 A;  3AKZ A;  4NQW A;  1UJ8 A;  2MLG A;  3L7W A;  3PUF A;  3FHZ A;  3L1P A;  5J4Y A;  2CW0 F;  4P9U A;  1HW2 A;  2VQC A;  4MIM A;  3ABT A;  3KP6 A;  1TBX A;  3HIF A;  2XDV A;  2ZSH B;  2R7Z J;  4ETS A;  5TRD A;  2P6T A;  1IXR C;  3TOA A;  3K4N A;  2HVS A;  3ZQC A;  1G6N A;  2ISZ A;  1LE8 A;  1U8B A;  3F8C A;  1IRF A;  3FXU A;  2L54 A;  3CF2 A;  1QBJ A;  4LLL A;  4A3K J;  1QRY A;  3RSN A;  3KP3 A;  2HU9 A;  5GAH J;  4W97 A;  1TW2 A;  2DA1 A;  2EFO A;  2IBD A;  3LSP A;  3JRD A;  2LTP A;  2VLA A;  3RKW A;  2AHQ A;  3E6B A;  3COA C;  5M5W J;  2P6S A;  1T56 A;  1B72 B;  2ZME C;  4G6Q A;  3CCE I;  3LMM A;  3OYG A;  4OMY A;  1FZP B;  1BIB A;  3MAJ A;  2I8D A;  1JUS A;  3DQV C;  1Y39 A;  1XGS A;  2DQL A;  1TWA J;  3BR1 A;  1MZB A;  2LYC A;  4UVB A;  1Q1H A;  4CCJ A;  1HKS A;  2K9L A;  3BG3 A;  2DDA A;  4P5O A;  3MFK A;  2UZK A;  2RQP A;  2QVO A;  3BTJ A;  3DEU A;  3K70 D;  1X4P A;  2BYV E;  1FNN A;  1WJC A;  2CFO A;  3HSF A;  3ABM H;  2BY0 A;  3EDP A;  3VOE A;  1W5C C;  1AOY A;  2H8R A;  2PMZ N;  2BW3 B;  4GYI A;  1YIO A;  3CQZ J;  2RVC A;  4IRI A;  4IF4 A;  2P4W A;  2OUM A;  1WZ2 A;  1F9N A;  3WGI A;  4F55 A;  2VJ4 A;  1RNL A;  3M7G A;  1MMN A;  4UVA A;  1U5T B;  2ISY A;  2IPQ X;  3K2A A;  2K86 A;  3NAU A;  1KU9 A;  5HDG A;  1TZL A;  2A6E F;  2DI3 A;  1W36 C;  4EVI A;  1R7J A;  2F5V A;  2LSO A;  1FY7 A;  2K27 A;  4OAZ A;  5BPD A;  4BY1 J;  5LGN A;  3AG4 H;  3OV8 A;  5EEH A;  3HDD A;  4HQM A;  1J2X A;  4Z6Y A;  3ASN H;  4LD5 A;  4ESB A;  1YS7 A;  3PNY A;  2DOA A;  1MJA A;  3GTL J;  2OA4 A;  2GA2 A;  2L02 A;  5D5X B;  5E3M A;  4BE2 A;  1IF1 A;  2W57 A;  3PIP F;  3HC7 A;  3MZH A;  2FXA A;  5GPC A;  4CYD A;  4A3C J;  2N8G A;  2IW5 A;  2K9M A;  4RB3 C;  2K02 A;  4ZTJ A;  2Y9Y A;  1TWC J;  4IRG A;  1TT5 B;  3OWT A;  2MW8 A;  1YX3 A;  3F22 A;  1FOW A;  1UMQ A;  4J19 A;  2CUE A;  4AIK A;  5CJ9 A;  2P81 A;  2LY9 A;  3HOV J;  2CG4 A;  1IDZ A;  2RNG A;  1QZY A;  1ZRC A;  3H0D A;  2NVQ J;  4IVN A;  2OTL I;  4RAZ A;  3VYT B;  2R5Y B;  2YU9 J;  2P5L C;  2M9H A;  1T95 A;  1SMY F;  4PFO A;  1PUE E;  1TWG J;  3LAJ A;  3OS0 A;  3EET A;  2M7B A;  1R9T J;  2C6Y A;  1DPU A;  3QP5 A;  3QOP A;  3FMR A;  4XSZ F;  2F6C A;  2IXS A;  3GTJ J;  1J5Y A;  2EZH A;  5L3E A;  1U8R A;  3HGG A;  1FSE A;  3GLX A;  1HST A;  3CJQ B;  2CQQ A;  3Q3S A;  3L2R A;  1R58 A;  4U0Y A;  2H1L A;  2DA6 A;  3IP4 B;  2W00 A;  1T39 A;  1W7P B;  2PN6 A;  4BKX A;  4DGW B;  5GTH C;  5FKM A;  3T5X A;  3S3N A;  1H89 C;  3GME A;  2NNY A;  1MMS A;  2O03 A;  1XS9 A;  1Y0U A;  2QBY B;  3M8F A;  1D1A A;  2JA6 J;  1BW5 A;  3OIO A;  3HOS A;  3DPL C;  2WB1 N;  2HR3 A;  3HBL A;  1TLH B;  2CV2 A;  1KQ0 A;  5F08 A;  1XB4 A;  2IGK A;  2X6W A;  2ZNZ A;  4M3B A;  3U1K A;  2P5V A;  4BQQ A;  5LEK A;  3OYJ A;  1ITY A;  3DBH B;  4WXD A;  4ZYD A;  3SJM A;  1JGS A;  4QPQ A;  2QSH X;  2NNN A;  1OYY A;  1BR4 A;  4DBR A;  1HCR A;  4Y4R A;  1WGX A;  4N4N B;  2OZU A;  1WKM A;  1HOM A;  3J80 K;  1RI7 A;  4RAG A;  4CYC B;  2H8W A;  4RDU A;  3RKX A;  3D0S A;  2W82 A;  1WJF A;  1YIT I;  3A02 A;  3B73 A;  3V7S A;  4QTR A;  3KP5 A;  1I6X A;  3P9C A;  3FHN A;  5CVR A;  2F5F A;  1VI0 A;  4UB6 C;  4UXN A;  1R22 A;  3C2B A;  1BJZ A;  4XQF A;  4A5N A;  4HA8 A;  3U21 A;  3FXO A;  3TO9 A;  5D8L B;  3R60 A;  4OMZ A;  3OMY A;  5DM6 F;  3CCQ I;  3LQR A;  4D1Q A;  4U88 A;  1YFH A;  3F72 A;  3BZ6 A;  1XG1 A;  1HDD C;  4HDU A;  4KIS A;  1QGP A;  1IUY A;  3KZY A;  5HNF A;  2X6X A;  2M5W A;  3BY6 A;  4O5V A;  3FM5 A;  5F0H A;  4ESJ A;  1FEX A;  2JPC A;  2QKL B;  3V8L A;  3LSJ A;  1UG2 A;  2WY8 Q;  1RES A;  1N77 A;  3BG6 A;  3GX4 X;  3HM5 A;  4UHT A;  5FLX Z;  2FA5 A;  3RCO A;  1CQT A;  3PO3 J;  3BDD A;  1LFU P;  4NB5 A;  5BQT A;  2HKO A;  4BEH B;  3HRS A;  2VB6 A;  2OQR A;  2DMT A;  4XOT A;  1ZEL A;  2RDP A;  1T0F A;  3WTW C;  5D5U B;  3J7Y J;  2H6C A;  2W4S A;  2JQ7 A;  1SFU A;  3IH3 A;  1HQC A;  3DU6 A;  1V5F A;  1WJE A;  4I76 A;  3OSG A;  5J1Y A;  2YS9 A;  4JQF A;  1ZLJ A;  3F6O A;  1VQP I;  3L2V A;  1X1A A;  1SD7 A;  1LDD A;  1UHM A;  2L7M P;  1S7E A;  1D1B A;  1Z05 A;  2NAZ A;  5L3F A;  1YTY A;  3A0B C;  3EUK L;  4MNU A;  2HYG D;  4IJA A;  4C2U A;  1TT0 A;  4E7L A;  2E2I J;  3WHB A;  5KCM A;  4KUM A;  2Y9Z A;  2FU4 A;  4BE0 A;  2HEO A;  3RDI A;  4AU7 A;  3AG1 H;  3VEP A;  3JSO A;  2E1M C;  4XLP F;  2XPW A;  3SHF A;  1OFC X;  2IS6 A;  3CUO A;  1S7O A;  4ESF A;  5EEG A;  4C3H J;  3I64 A;  4D7M A;  1IO2 A;  3CD6 I;  3S14 J;  1DP7 P;  3LOC A;  1B59 A;  4UUS A;  3W2W A;  2DYR H;  4BYY A;  1G3T A;  3BG7 A;  5D6F A;  1G8X A;  2E7W A;  4XLA A;  2E2H J;  1DP3 A;  3LFU A;  1KU3 A;  2TDX A;  1T08 B;  2DA2 A;  2R7O A;  2P7V B;  5F0F A;  5ILS A;  2F4M B;  2XUB A;  3RZD J;  1QZE A;  2V1N A;  1ZR4 A;  2WV0 A;  3D5S C;  4IXA A;  2DDB A;  4M6V A;  3ZQI A;  5DUI A;  3L2Q A;  1IV8 A;  4XRS G;  4G94 A;  5DDG A;  1U6G A;  3BG5 A;  4D7N A;  3LAP A;  3BTC A;  3E6M A;  4ANJ A;  2IGO A;  4IX7 A;  4HRI A;  4KIC A;  2J5O A;  3E3V A;  1FSH A;  3SYT A;  4HNU A;  5D8K B;  4RAY A;  2CQX A;  3VB2 A;  3DCF A;  2UV1 A;  1Y8R B;  2AS5 F;  4RAF A;  2AQF A;  2MG4 A;  1GXQ A;  5K5R A;  1O4X A;  4ZYG A;  2KDO A;  1N25 A;  2ZME B;  5M3M J;  2IAI A;  5FKO A;  5B66 C;  1VND A;  4JX5 A;  3RYR A;  4A0X A;  2JA8 J;  3KFW X;  3KEY A;  3JRH A;  4G6D A;  3REO A;  1OCC H;  3LA2 A;  1VZ0 A;  4IPA A;  4BBS J;  4B48 A;  1U5T C;  2ETH A;  3HZJ A;  1W0U A;  4Y33 A;  5B1A H;  1PP8 F;  1UZC A;  4XMY A;  2M34 A;  2X85 A;  3L00 A;  4Q47 A;  2QUF A;  2VC0 A;  3KLN A;  2HZT A;  5E20 A;  1FBS A;  3CMA I;  1NH3 A;  4CHU A;  2P0W A;  2JK3 A;  2L3D A;  1D0Z A;  4XOR A;  1ZN2 A;  3SQN A;  2L01 A;  2GXG A;  4XLC A;  3OOU A;  2CH0 A;  4II3 A;  3BQZ A;  3CDH A;  2YPR A;  1W1W E;  5E1Z B;  1XDU A;  3HOU J;  3L09 A;  4M9Z A;  3SDB A;  2ELK A;  1QO0 D;  4HV6 A;  2YR2 A;  4RA2 A;  1J09 A;  2V1D A;  3E97 A;  2KQR A;  5LGT A;  3L2U A;  3HOX J;  3OYD A;  4I6Z A;  1KU7 A;  3MN2 A;  4KNY A;  1H9G A;  1RIO H;  1O3Q A;  3O8H A;  5IP6 A;  2FQ3 A;  1B6A A;  3JR9 A;  3DTI A;  2V6C A;  3S2D J;  1D5V A;  2P7C B;  2H94 A;  2LLK A;  2RKH A;  2X1D A;  2ELH A;  1KGS A;  3GF2 A;  1LVA A;  3KIO A;  1MH3 A;  3FXL A;  2HTJ A;  1WH7 A;  5F1R A;  3K4C A;  5J6X A;  2ZB9 A;  4KYW A;  2F5C A;  3MMY B;  4B3A A;  3T1B A;  4BXX J;  3RQI A;  1B1B A;  1TNT A;  2W85 A;  3HRM A;  4LG3 A;  2GOX B;  5BPI A;  2H1K A;  4XK4 A;  3VSK A;  2MFZ A;  4EEF G;  3HXL A;  5DCF A;  1UAA A;  4LMY A;  4PGG A;  3ZRG A;  4RB2 C;  4CCN A;  3GTO J;  3QPH A;  1R36 A;  1MNE A;  3JRI A;  3TGN A;  2UXN A;  2XKO A;  2KIU A;  4LJZ F;  5FKK A;  2BVM A;  3IL2 A;  3GXO A;  2TCT A;  1XC5 A;  1ZRF A;  4Y52 J;  2DMU A;  4KN7 X;  1EF4 A;  3SZT A;  1ON2 A;  5JHU A;  3ESW B;  4AYB A;  3ZMU A;  4M3G A;  4N9H A;  4N9I A;  4OIQ F;  4PJ0 C;  3HUG B;  3W6K B;  5CVV A;  4PSX A;  4XLF A;  3S17 J;  2NYX A;  2E36 A;  3NAR A;  1HF0 A;  1ON1 A;  1SEU A;  2GXA A;  1VQ6 I;  3DKW A;  1TC3 C;  3M1C A;  1J9I A;  2HQA A;  1R5H A;  2FBH A;  1MBE A;  1GV2 A;  2HS5 A;  1SMT A;  4XNF A;  3GTM J;  2P8T A;  4IKF A;  1FBU A;  1ZG5 A;  2R7W A;  1F4K A;  2ZSI B;  1IRX A;  4BDY A;  1XMA A;  2Y48 A;  3K6G A;  4MFD A;  4ENJ A;  4G8X A;  5TJJ A;  4L9J A;  3A0H C;  1HKT A;  3GTQ J;  3I4P A;  4ZYA A;  1Z6R A;  2FOK A;  4ENM A;  1DDN A;  4XBF A;  3N4M A;  1O7F A;  3CZ6 A;  3LNQ A;  1VQN I;  1LEB A;  3G6E I;  3I3L A;  1VTN C;  2DJN A;  1YJN I;  2EA2 A;  2CW7 A;  5HDN A;  4OOI A;  4FE4 A;  1Y56 A;  2NRA C;  4CA0 A;  2BY2 A;  2MBF A;  2HVQ A;  2HNH A;  2VPL A;  2JUG A;  1YJW I;  2L9S A;  3FWE A;  5EDN A;  5EG0 A;  5A2Q K;  3J7A Y;  1GVD A;  2QLZ A;  1YIJ I;  3H1C A;  1HSJ A;  2OQG A;  1RZ4 A;  3MZ8 A;  2GXB A;  2E35 A;  1X1P A;  4XKW A;  2EV5 A;  5GAD J;  4PJL A;  4QLC U;  1MSF C;  3IAM 2;  2LH9 A;  2HVR A;  3IKT A;  1NG7 A;  2NVU B;  4C2T A;  1EKE A;  3I4M J;  4UNO A;  1FJL A;  2D1V A;  3IAS 2;  1FOK A;  4HQE A;  4PK4 A;  1E17 A;  1BJA A;  2KT0 A;  2FOW A;  4MTD A;  3ZQG A;  1IAW A;  3M1E A;  1KA8 A;  1WSU A;  4WF2 A;  1I1S A;  2IRF G;  4HAM A;  3BT9 A;  1R5G A;  4WXH A;  4BJ6 C;  2CYY A;  2E19 A;  2Z33 A;  4QWQ A;  1KU2 A;  1Z67 A;  4AVP A;  4RGX A;  1VQM I;  3TQN A;  4K2E A;  3DLA A;  4CDG A;  4HST A;  3IV5 A;  3W2V A;  1VQL I;  2ZNY A;  5EGO A;  5KHD A;  2X4H A;  4UV8 A;  1XGN A;  1GV5 A;  3BWG A;  3AG3 H;  6PAX A;  4DQ2 A;  1TWF J;  3LSI A;  3R0J A;  3I53 A;  3W2A A;  3TDZ C;  3N97 A;  2FNA A;  3J80 Z;  1QHH D;  3OYF A;  5K7H A;  2XAF A;  1ENH A;  2QQA A;  4ZDL A;  5HOO A;  3FKJ A;  2DPD A;  2KJC A;  1FP2 A;  3PO2 J;  1LKX A;  2PBI A;  3H5N A;  2LG4 A;  4JX6 A;  2AO9 A;  3UNG C;  5C4X J;  3HTS B;  1BR2 A;  2R5Z A;  2KL4 A;  4EMS A;  4L9V A;  4F93 B;  5D4R A;  3LWF A;  3RPU A;  1ZRE A;  1L0O C;  1T33 A;  2K9N A;  2HYF A;  5AIP A;  4AVZ A;  5E3O A;  2EK5 A;  2O8X A;  1VQ4 I;  1V5E A;  3IHU A;  1OLT A;  3CJT B;  1XTA A;  2MAB A;  2VQL A;  3CES A;  1JKO C;  3RI4 A;  2JT1 A;  2R92 J;  4RGU A;  3M8J A;  2E1M B;  2DA7 A;  3SEQ A;  2WAQ A;  2AXT C;  4X6A J;  1Z3X A;  3K4L A;  1A6Q A;  2JJ7 A;  1T38 A;  5KK1 A;  2O6G E;  1U78 A;  4NQW B;  4PSW A;  4GO1 A;  5BMZ A;  3HTU A;  1FLI A;  2NVY J;  2ZXW H;  1YO5 C;  1D5Y A;  1P9Q C;  2M8E A;  2BY1 A;  1ZGA A;  2DK5 A;  2I5U A;  4QPO A;  3TO6 A;  5GAE J;  2QQB A;  3I58 A;  4N0B A;  1A04 A;  2GQQ A;  2GLO A;  4L0Z B;  4LIT A;  3TOB A;  1IUF A;  2OD5 A;  1WPK A;  2Y0S A;  1D8K A;  3JRC A;  2HYJ A;  2LC2 A;  2LNB A;  1I39 A;  3QP6 A;  1K6Y A;  3OS2 A;  3DFG A;  1I5Z A;  2L7Z A;  5IP7 J;  1LE8 B;  4FCY A;  4MTE A;  1JKR C;  1RUO A;  3WHC A;  3FZV A;  3BR2 A;  1PP7 U;  4MFE A;  4RS8 A;  2XRN A;  2I10 A;  3X2Q H;  1JKP C;  1BBY A;  1ETQ A;  1E3O C;  2CO5 A;  1J0R A;  4HG2 A;  1R4M B;  3NWT A;  1H9T A;  4RGS A;  1U0J A;  2W1O A;  3ZMS A;  5GPA A;  3DBR B;  1OMI A;  4NDL A;  1B8I A;  2LF7 A;  2Y0M A;  3I59 A;  3JAM K;  1X4O A;  3P9K A;  4HF1 A;  1X1B A;  4Q4Z F;  1ERD A;  1SD4 A;  4ZC3 A;  2W84 A;  3FXQ A;  3M07 A;  1R71 A;  5HLT A;  3J7A O;  2ID6 A;  2W48 A;  3KYC B;  3HPH A;  4XR6 A;  2DXI A;  2WAD A;  1OYW A;  3VYR B;  4NC7 A;  4AID A;  3CO6 C;  3ISP A;  1BA5 A;  1VF9 A;  2Z3Y A;  1X3U A;  4B47 A;  2ZXI A;  2O7O A;  3G1L A;  2RNJ A;  1ZTR A;  3HYI A;  2Y75 A;  4V2G A;  4EJU A;  3DPT A;  3F21 A;  5DV5 A;  2NVX J;  4Y15 A;  5J3L A;  2QZ8 A;  2NOJ B;  3H9G A;  4EJO A;  2KIM A;  5KAF C;  3V8K A;  5LBQ A;  1YW8 A;  1K4S A;  1MIJ A;  1GDT A;  2DTZ A;  1WFX A;  3SZG A;  5HOD A;  3DV8 A;  2R7U A;  4A3F J;  1A36 A;  1V55 H;  3K70 C;  3WU2 C;  2ECC A;  2HPI A;  3HOY J;  1IXC A;  4YIR X;  3GFI A;  2OF7 A;  1TQP A;  4QIW N;  2LBF A;  2X1E A;  5IT9 K;  5BOX A;  1S9H A;  2QWW A;  4C3I J;  4YRV A;  3QPL A;  1H8A C;  5L3G A;  2Y69 H;  2QQ9 A;  3KP2 A;  1GUU A;  2O5R A;  1FYM A;  1HLV A;  3K9T A;  1OJL A;  4XN3 A;  2KIQ A;  3WU0 A;  1F43 A;  1ZR2 A;  1QA6 A;  1YLF A;  2CJJ A;  1JUM A;  4XRM A;  2JPB A;  1UEL B;  2XF5 A;  2XHK A;  1AWC A;  1D8J A;  3K0L A;  4U87 A;  2HZD A;  2DFI A;  2IT0 A;  3GFJ A;  3SZP A;  4NNJ A;  1TL8 A;  2V26 A;  1ZAO A;  2A5Y B;  2DFE A;  2DOE A;  2QEN A;  3BCB A;  5DD4 A;  5L3D A;  2V9P A;  3ZCO A;  4HNV A;  3W6J B;  3KEQ A;  4EQQ A;  2XRO A;  4HX4 A;  3V7C A;  1XPX A;  3VPR A;  4I7H A;  4BAC A;  3OYN A;  4I99 C;  4UY8 I;  2BGC A;  3WU1 B;  1OR7 C;  2JWT A;  1A31 A;  1KQ9 A;  1OKR A;  5DCM A;  2P5K A;  3WTS C;  5CYV A;  3QYB A;  3PIO F;  3VYS B;  5E3L A;  4KMF A;  3I71 A;  3ZR8 X;  3DKY A;  3K69 A;  3WE2 A;  5FLM J;  4FQG A;  2E71 A;  1K78 A;  3I56 I;  1K79 A;  1MBG A;  3CJN A;  4XKB A;  1XSV A;  3KEO A;  3UKG A;  2V7F A;  3RYP A;  3VWB A;  1W7P A;  5LLQ A;  3FBN B;  1HC8 A;  3CTA A;  3MKY B;  2MD5 A;  4FT8 A;  4NC6 A;  4CXF A;  2STW A;  2VBX A;  1Y0N A;  4RLQ A;  5E8I A;  4AD9 A;  4XKV A;  2V9V A;  1FPQ A;  1K4T A;  2LR8 A;  1P4X A;  2H09 A;  2FF4 A;  3T8R A;  4B44 A;  3OIQ A;  5E8G A;  4XON A;  2QF7 A;  1YG2 A;  3PSF A;  1JHH A;  1POG A;  2NOG A;  4X1E A;  3BRO A;  4QSH A;  3D5L A;  5FFZ A;  1X19 A;  2EIN H;  3DXJ F;  4GDF A;  2EZI A;  2OTJ I;  4YEJ A;  3CCS I;  1GXP A;  2L2O A;  2WC2 A;  1WI3 A;  1MBF A;  2J5P A;  4EV0 A;  2VJ5 A;  4GFB A;  1R5I D;  2XAG A;  3HPG A;  3G1M A;  3GUD A;  3E6C C;  2PJP A;  1GLN A;  2HDW A;  1X2M A;  2JMW A;  1U3E M;  1IJW C;  2CV0 A;  3H92 A;  2ZJQ F;  1W0T A;  5AON A;  4D9J A;  3DEE A;  3RQ4 A;  1IG7 A;  2EV0 A;  2M45 A;  3TKY A;  4OIR F;  3KYL A;  1MDM B;  5F04 A;  2E60 A;  3OR1 C;  4G12 A;  3TW6 A;  3KET A;  4IHS A;  3V42 A;  1UCR A;  2X51 A;  4FET A;  1XGM A;  1ONV A;  3RZO J;  4BU2 A;  1HW5 A;  2K3F A;  1HBX G;  2CWE A;  3OR2 C;  3RIR A;  3PJR A;  2K9Q A;  3CCY A;  4C3J J;  3OL3 A;  2QA4 I;  3RTR A;  3CCJ I;  2VIX A;  2GWR A;  1RET A;  2LVS A;  1APL C;  3B6C A;  5BS6 A;  3ULQ B;  3H9J A;  4PUS A;  3WOD F;  3S16 J;  3BR0 A;  5K5O A;  3U2R A;  3ZXS A;  5M3F J;  4CCM A;  2BV6 A;  3J7Z I;  3BJA A;  5J4V A;  5EJC A;  2VBZ A;  1R1V A;  2G7H A;  3HOT A;  2MA3 A;  1KYW A;  4PFP A;  4LOC A;  2V1U A;  3ZP5 A;  3A01 A;  3EPZ A;  1JJ8 C;  3RPU D;  2EFW A;  2O9L A;  1PDN C;  1LDJ A;  1D0X A;  1IN4 A;  2E1N A;  2VI6 A;  4TV7 A;  5LGU A;  1JJ6 C;  2HKX A;  2HQR A;  2EV6 A;  2CUZ A;  2X6Y A;  4EM0 B;  2M2E A;  3NRV A;  3MKL A;  1MH4 A;  1Z77 A;  3ZMD A;  2DQR A;  4D5F A;  4YG2 F;  1HA8 A;  1UB9 A;  4UUT A;  1XMK A;  4FHT A;  4BQN A;  3CDL A;  3FX3 A;  4E7K A;  2VUM J;  2DMP A;  3DEW A;  5DUK A;  3Q5F A;  2OZ6 A;  5FLV A;  1QPM A;  5H2F C;  2F2E A;  3LSM A;  1HDP A;  3FMQ A;  1O3R A;  1K6O A;  3ZQH A;  3GO5 A;  2VN2 A;  2KIS A;  2RV8 A;  2A68 F;  5H6R A;  5A2Q Z;  1OCZ H;  2CQN A;  4WCG A;  3OYL A;  2PJR A;  1IN7 A;  1FYL A;  3VDX A;  3GZ5 A;  3CUQ A;  1TQI A;  1BL0 A;  5IPA A;  3JRG A;  4NC8 A;  3KZI C;  4HDV A;  1U9O A;  1Z3Y A;  3KP7 A;  3PSI A;  4M3E A;  1X3W B;  2FEZ A;  2OBP A;  4KT5 C;  1K83 J;  4LFU A;  4B43 A;  5J8C A;  5EEA A;  2FQ4 A;  1CF7 A;  2D2W A;  2QQ8 A;  3B6A A;  5HDK A;  1AU7 A;  3I54 A;  2MH9 A;  2JUC A;  1FX7 A;  2EIK H;  2MD0 A;  2VXD A;  1XMX A;  2BHZ A;  2WY7 Q;  3AFH A;  1KON A;  2CUF A;  3NWS A;  4FX0 A;  1IXS B;  3TBI A;  4GGG A;  2M30 A;  2XGD A;  3VSL A;  2O0Y A;  2VE8 A;  1WJD A;  1BI0 A;  2EA4 A;  2KP6 A;  3HKZ A;  4HPQ A;  2V79 A;  1D0Y A;  2JSC A;  1PUF B;  1FYK A;  1ZYR F;  1Y1W J;  2Z99 A;  4FTH A;  2DJI A;  3I4N J;  2Q8K A;  2G7U A;  4DYQ A;  2F4I A;  4UUS B;  3H5A A;  3F9K A;  4A69 C;  2XV4 S;  5FRM A;  2RQQ A;  3E7L A;  4LGW A;  4D5C A;  1FIA A;  5LHH A;  2IA0 A;  4M6Y A;  2DT6 A;  2JSP A;  3HG9 A;  1EH8 A;  3OYI A;  5J1U A;  2ZC2 A;  2Z2S B;  4L9T A;  5TGT A;  3GTP J;  1SVO A;  2BVL A;  1X1C A;  5J40 A;  4LB6 B;  4KIT B;  2ESH A;  2M3A A;  4KIG A;  5FD5 A;  4B8X A;  4E6K G;  1R00 A;  5FD6 A;  4RLF A;  3NEU A;  2E2J J;  1HKQ A;  1JT0 A;  4F7Z A;  1VQO I;  2KZG A;  4LLN A;  2FD5 A;  2VKD A;  3CDI A;  2EH3 A;  3QYE A;  4AYB N;  4BE1 A;  3TW7 A;  3RKQ A;  4EAT A;  1ZG3 A;  1SD5 A;  2YX7 A;  1B9N A;  4II2 A;  5FKL A;  3EYI A;  2HOA A;  3EYY A;  1S7A A;  1RKW A;  5JLW A;  4ZDO A;  1ZHF A;  4G6T B;  4HBL A;  4NUB A;  4WK8 F;  3J81 K;  1G3Y A;  2ZME A;  3E5X A;  1EJ9 A;  2Z5U A;  2QKM B;  3ASO H;  1FBQ A;  1JKQ C;  5DS9 A;  2ZJP F;  4C30 A;  5J47 A;  4HX8 A;  1ZLK A;  2LKX A;  1P6R A;  2JA5 J;  4YIF A;  2ID3 A;  5DD8 A;  5DEQ A;  1LVK A;  4E7J A;  2Z16 A;  5DM7 F;  1G3W A;  3IC7 A;  2KKO A;  1IW7 F;  3MD2 A;  2CQK A;  4L5E A;  4IRH A;  1T2K A;  2LKP A;  4BH9 A;  4MQ9 F;  2VPR A;  2KIF A;  1YRN B;  4P1W A;  5J1R A;  1RRJ A;  4EM1 A;  4OWR B;  4HNT A;  5IY5 H;  2PMU A;  2A3S A;  3ERE D;  4BQO A;  2JA2 A;  4XRF A;  4P96 A;  1AKH A;  1P92 A;  2LDU A;  3MWM A;  3OSF A;  4M74 A;  2KRH A;  2ECB A;  3AL0 B;  3ZN1 A;  1RR7 A;  5HLG A;  3HRT A;  1U2W A;  2ZJ2 A;  2COB A;  2E5Z A;  2H6B A;  2EFQ A;  1TP4 A;  1S3J A;  2IGN A;  1SVM A;  3GWZ A;  4CIC A;  2L9N A;  2STT A;  1QPI A;  4V19 K;  2EFN A;  1YJ9 I;  1I27 A;  1NK2 P;  1E0E A;  5CQG A;  1OQY A;  4CH7 A;  2H27 A;  4A6E A;  5IYB J;  3BC8 A;  3ZQF A;  2MSY A;  2BHY A;  1IGN A;  3JAM Z;  3BJO A;  2HDD A;  2Q2E B;  5JFR A;  1S8N A;  1SVL A;  1W7P D;  4KA4 A;  1P7J A;  3E5U A;  5DYM A;  4G7H F;  1FIP A;  3K4B A;  3Q0V A;  5H20 A;  3FXJ A;  1IZ1 A;  2IS2 A;  3HJE A;  4EJV A;  5F27 A;  4XRS A;  5AIQ A;  3E5Q A;  5C44 J;  3FKI J;  3HSR A;  4BY7 J;  1IN5 A;  3BTL A;  2ESN A;  1O3T A;  5K7Z A;  2K3P A;  3M3Y J;  2Z1D A;  4IHV A;  3LSH A;  5B1B H;  1BOB A;  3KLO A;  2E34 A;  3GEZ A;  1B4A A;  2OV7 A;  1VQ7 I;  5ERI A;  3WTX C;  4KIF A;  1STZ A;  4RM2 A;  4J01 A;  2GIZ A;  3DU5 A;  1UHS A;  1P2F A;  4UV9 A;  1KZH A;  2XSD C;  3CJR B;  4IOC F;  4A3L J;  3M4O J;  5IT9 Z;  4UVC A;  1MMD A;  2ELJ A;  1H88 C;  3F8B A;  1RC9 A;  2HWV A;  1ZGJ A;  3ROU A;  1ZK8 A;  4I98 B;  4MEX F;  1MBK A;  3GFL A;  4LG0 A;  4B1R A;  4CZZ A;  1S29 A;  4DJA A;  2K9S A;  4Z2Y A;  4DZP A;  2XF7 A;  3ZMZ A;  1SD6 A;  3PL8 A;  2CQ7 A;  3QOE A;  2EIL H;  2EZK A;  2K4J A;  2A05 A;  2VKH A;  5M5Y J;  3ZMT A;  1ZAR A;  2LY1 A;  2XPV A;  4M9S A;  2LKS A;  3PUB A;  2LD5 A;  1OCR H;  4I0A A;  1JUP A;  1EH6 A;  5FRN A;  1DGW Y;  3KE2 A;  4IHT A;  4DIQ A;  3OIP A;  4WWC A;  4I01 A;  2DT7 B;  2Y30 A;  4IQJ A;  2FMY A;  1ETW A;  4ZH4 F;  4Q5S F;  3TL4 X;  4ZZL A;  4S05 A;  5ICF A;  3F3X A;  2VC1 A;  2OU2 A;  2MYS A;  2PMH A;  4A3D J;  5CVJ A;  3SDG A;  2WAQ N;  3SEZ A;  1GHC A;  4BBR J;  2EB7 A;  4YFN F;  3CF5 F;  3ABU A;  2L4A A;  3K1M A;  3ZQL A;  1QU3 A;  2E7X A;  2ZKZ A;  2IGM A;  1I3Q J;  3PQK A;  3JSP A;  1EH7 A;  2GA1 A;  1FWZ A;  5ICC A;  3KCC A;  4RMN A;  3GYH X;  2M0M A;  1T6S A;  5KVR A;  2VOD A;  4ZYE A;  4KMU X;  2QSG X;  3F8N A;  5C3E J;  4CCL A;  2IS4 A;  4PZJ A;  2Y0S N;  2KLO A;  3S2H J;  1E3H A;  3ELK A;  4HZF A;  3FMS A;  2DA3 A;  2XKP A;  4A2U A;  4BDZ A;  2OC6 A;  1LNW A;  4FIS A;  2VOP A;  5EZH A;  3FM3 A;  3CP8 A;  3GBG A;  3CCU I;  2PG4 A;  4ON0 A;  3ABL H;  2R3S A;  5IP9 J;  3BTI A;  1B9M A;  2D1H A;  2F4O B;  3E6D A;  3P5J A;  4LK0 F;  1G59 A;  1XCV A;  2HGC A;  2JA7 J;  3F23 A;  3EUH A;  3GZ6 A;  2FJ1 A;  4LIU A;  3G73 A;  1A5J A;  4LLG F;  4A0Y A;  2DN0 A;  5JLX A;  2QM3 A;  4G7O F;  1S5L C;  1X2N A;  2R4G A;  4GRI A;  1R23 A;  1T0F C;  1V4R A;  3ZOB A;  2ZCW A;  2DW4 A;  2RC4 A;  2VKV A;  3Q0U A;  1MJ9 A;  2EWN A;  4LB5 A;  3AAF A;  4ZZD A;  2JRM A;  3H3V K;  2DT5 A;  3C2G A;  5EGO B;  3KP4 A;  1RR8 C;  4BHP A;  3LFK A;  3I9V 2;  3BPX A;  1ZKG A;  1ZQ3 P;  1UG0 A;  2A6T A;  2LK2 A;  2CSO A;  1JT6 A;  4HV5 A;  2PQ8 A;  4F91 B;  3ZPL A;  3ECH A;  1FOY A;  5LHG A;  3LL7 A;  1R49 A;  2AQE A;  3AG2 H;  3ZGK A;  1YI2 I;  3GTK J;  2WBM A;  1BC8 C;  1LFP A;  1LPQ A;  1JI8 A;  4BUP A;  4FAS D;  2DK8 A;  4A3I J;  2R7D A;  2DBB A;  2FX0 A;  3HSE A;  1ETO A;  3OY9 A;  2GBY A;  1RKT A;  1IN8 A;  4XL9 A;  2HOE A;  1Z9C A;  1Y1V J;  5GTI C;  3A03 A;  3ZMV A;  2WWY A;  4JOM A;  2IS1 A;  2VBY A;  3C3W A;  3RPQ A;  4AWX B;  4KN4 X;  2PLY A;  1OCO H;  4MGR A;  2M1B A;  4IHX A;  2LMD A;  1XX5 A;  1VQ8 I;  4H0E A;  2L5Q A;  2XAU A;  5F0C A;  1MW7 A;  3QRF F;  1TQM A;  1Z1D A;  2HDC A;  4V2F A;  5LFA A;  3L2W A;  5D4S A;  5LRS A;  1PJR A;  2E5N A;  2KZV A;  4DZJ A;  3FIS A;  4M73 A;  4WX9 A;  1JTX A;  4CUG A;  2EIM H;  2IEK A;  4HW0 A;  4J00 A;  5IYC J;  2BXZ A;  4BXF A;  3JRA A;  4HX7 A;  3MZY A;  3Q0W A;  3RJP A;  4YFK F;  4UUV A;  1YE9 A;  1J7K A;  4JP0 A;  2UWM A;  4XN0 A;  3HHH A;  3B02 A;  4I02 A;  3K4M A;  2NXN B;  4BJ5 C;  3DP7 A;  3KYD B;  4G9Y A;  1B72 A;  2DA5 A;  5K7F A;  3MCZ A;  3P9I A;  3FK6 A;  1XD7 A;  3L9F A;  3MEX A;  3WG7 H;  4JX4 A;  4JYK A;  1USS A;  5F64 A;  3MKW B;  4AC0 A;  2OCE A;  5ILU A;  3I0T A;  1JHF A;  1QNT A;  1BR1 A;  2GOM A;  4OIN F;  3IRR A;  1R4N B;  1W36 D;  1C0W A;  5FFX A;  2MH2 A;  3KX2 A;  3CCV I;  2QCO A;  1T98 A;  2XRL A;  4RGR A;  4ABZ A;  4F52 A;  1FC3 A;  1SFX A;  4IO9 F;  4Y3O A;  4Q48 A;  1B8I B;  1IV6 A;  2IA1 A;  3I59 B;  3BZK A;  5FRO A;  4E4H A;  2A69 F;  4M6X A;  2CV1 A;  2BW3 A;  1SFK A;  1W5S A;  2MGQ A;  2DAO A;  3CCL I;  4AM3 A;  5CPR B;  1FMV A;  3G2B A;  2GZW A;  3CMM A;  2JN6 A;  3T0Y A;  3AL0 C;  2MC3 A;  2FE3 A;  5JR3 A;  2QEX I;  2X9D A;  4XID A;  1WHU A;  4KDP A;  4IQ4 A;  1U5T A;  4A3G J;  4RB0 A;  1OCP A;  3BLY A;  3GVA A;  1X3Z B;  2K5C A;  2W7N A;  3G1O A;  2LY2 A;  5CVU A;  3V4G A;  2XC7 A;  3L2C A;  5EYR A;  2CFX A;  3CC7 I;  2DOF A;  1WCM J;  4KJZ A;  4MEY F;  3OYA A;  3LA7 A;  2HXO A;  1MBH A;  1REP C;  2F5D A;  2DFF A;  3QOD A;  2LOO A;  4B4C A;  2ME6 A;  4JBA A;  3V7R A;  3IUO A;  5ILV A;  2CW8 A;  2W24 A;  2R7X A;  1K7A A;  1LQ1 A;  2LBF B;  1D3Y A;  3BP8 A;  3S93 A;  2NS8 A;  2BBY A;  1I3A A;  3BR3 A;  4OU0 A;  4BQA A;  2ZFW A;  5H6Q A;  3G4S I;  2VON A;  1PVE A;  4L5I A;  3S1Q J;  5DTD A;  2EJR A;  3J81 Z;  3IKV A;  4EM2 A;  4XOP A;  3VFZ A;  2IVM A;  4U7D A;  4U7B A;  4MQV A;  4CCO A;  4LIV A;  4A6D A;  1JXS A;  2VKE A;  5IOY A;  2JVG A;  5GP9 A;  2WAE A;  3GW2 A;  4M71 A;  2BOL A;  1TW3 A;  2VT2 A;  2E1C A;  3ERM A;  2R7V A;  2RN7 A;  1H0M A;  2DLL A;  3S15 J;  2V4J C;  2R5Y A;  3W3C A;  1G3S A;  1LJ9 A;  3JTH A;  1R6R A;  1T8I A;  1Z21 A;  2EBI A;  1UHW A;  3FXM A;  4DYR A;  1HW1 A;  3HRU A;  4RB1 A;  1ZH5 A;  1AHD P;  1IDY A;  3BQY A;  2CGP A;  2Y2Z A;  3G3Z A;  3OS1 A;  1QVU A;  4IHW A;  3LSK A;  2L7F P;  3QPT A;  5DCM B;  2XAJ A;  3ECO A;  4ZJZ A;  1BOA A;  1XCB A;  2X1C A;  3MVP A;  4U0V A;  1SAU A;  2WV1 A;  4HEA 2;  3OL4 A;  3CMY A;  1W4M A;  2YU3 A;  2M87 A;  4MLO A;  4PJJ A;  3CME I;  1ODD A;  1LFB A;  3DTK A;  5CLS A;  1K78 B;  2HPM A;  2V1X A;  2CU7 A;  4AIH A;  1IC8 A;  1ACI A;  1XSX A;  3SXY A;  5E17 F;  2BY3 A;  4S0H B;  3A2K A;  3F8M A;  1K61 A;  1MKM A;  3R0A A;  1YS6 A;  4C9Y A;  2DPU A;  2R7T A;  1VQ5 I;  1ZGW A;  2O3F A;  2QBY A;  1D1C A;  1EA3 A;  1BI1 A;  3WTY C;  2BE5 F;  4XIC A;  4BHC A;  2YUS A;  4A0Z A;  2PMZ A;  1Z0X A;  4CGZ A;  1RPW A;  1XN7 A;  5HS8 A;  1X58 A;  2VQG A;  2ICW G;  2M0C A;  1SC7 A;  1HXD A;  2CUJ A;  1ETY A;  3S2W A;  3C7J A;  5ED4 A;  4S04 A;  3MQ0 A;  2G0E A;  2VJJ A;  2WA0 A;  4A12 A;  3GTG J;  3HKZ N;  2KFD A;  2L9V A;  2D5V A;  1LUJ B;  4XLN F;  2DO7 A;  2AXL A;  2XF6 A;  2FUG 2;  3PNV A;  2MC4 A;  2PI0 A;  3CCM I;  3S1N J;  2CMP A;  1ULY A;  3WE3 A;  4CYC A;  2VOO A;  5HNH A;  2RGV A;  5JVT A;  1JE8 A;  3ZN0 A;  1LEA A;  2Y31 A;  4R8H A;  1MDM A;  3DF8 A;  3LST A;  4KIB A;  1YW9 A;  3QU3 A;  2LP0 A;  3U9G A;  4PCQ A;  1ZRD A;  1P4A A;  1M1E B;  3QPS A;  2KHM A;  4L9N A;  4RM3 A;  5B5E C;  4X0G A;  3OYK A;  2HXI A;  3IWZ A;  4AUX A;  1N78 A;  3Q9V A;  1WJ5 A;  2XGC A;  3H36 A;  3H3Z A;  4UB8 C;  2K85 A;  3HB9 A;  3EUH C;  5JI6 A;  2B63 J;  3O3K A;  1LDK B;  2A61 A;  2O61 A;  3DTE A;  5M5X J;  4ENN A;  5CKT A;  3O8G A;  5HS9 A;  1BW6 A;  1FP1 D;  3DPU A;  3D1N I;  4ZTF A;  3U1D A;  3FF5 A;  3FXR A;  4A3B J;  3A01 B;  1L3L A;  3D5R C;  1V3F A;  3F8F A;  1BM9 A;  4F92 B;  2TRT A;  4BEH A;  2LFB A;  3JW4 A;  4E7I A;  3H0G J;  5FJ8 J;  5L3C A;  4FX4 A;  1E3P A;  2OCC H;  2FSW A;  2YX4 A;  4CCK A;  2IJL A;  1OYI A;  3OYB A;  2V6E A;  5K1Y A;  1WVR A;  2HOT A;  3EUA A;  4IOA F;  1ETV A;  2Q1Z B;  4DNC A;  2BEO A;  2KMU A;  2BXY A;  2KJB A;  3S3O A;  4XLH A;  1XGO A;  2JVH A;  2HTS A;  5CQE A;  4C2M J;  5LEJ A;  4NHJ A;  4M3F A;  1RUN A;  3GZN B;  2PJR B;  3WTT C;  2L9R A;  1ZG1 A;  3H35 A;  1Y6I A;  3A4C A;  3CUQ B;  4CSW A;  1GT0 C;  4ZYH A;  1NK3 P;  3K4K A;  2HQ5 A;  4HLY A;  2VQH A;  2JZY A;  1KQ8 A;  4DW6 A;  1FTZ A;  1DQU A;  3S3M A;  5K5Q A;  3WTU C;  1CF7 B;  3DWL E;  2WB1 A;  3BG9 A;  5HLH A;  4OIO F;  5FKN A;  3C2H A;  2OAZ A;  1Q1V A;  1P4W A;  5IYD J;  3QAH A;  4P9F A;  2M8G X;  3I5U A;  4ITV A;  4CZC A;  2R93 J;  1P7I A;  2ADU A;  5E1W A;  2Q0O A;  2NS7 A;  3DLL F;  5FB2 A;  2A07 F;  1FMW A;  1IN6 A;  2OJE D;  3FIW A;  1MJB A;  1PUF A;  1FOX A;  2A5W A;  1XSD A;  5ICG A;  5LD2 C;  3VYU B;  2BZT A;  3K2Z A;  2IA2 A;  2JRT A;  2HOS A;  3VOD A;  3JRF A;  3CO7 C;  3PM1 A;  4L18 B;  4H4K C;  1MD0 A;  2ZXH A;  2ZO4 A;  2KRC A;  2FRH A;  1SAN A;  2F5E A;  2RRE A;  3NQO A;  2XAQ A;  1TNS A;  2XB5 A;  3W6V A;  3R4K A;  4BJT A;  3F0C A;  2D45 A;  1PYV A;  1NTC A;  4MHG A;  1FTT A;  4E70 A;  4L0Y B;  2IP2 A;  3UR3 C;  4LK1 F;  1ORK A;  3KPH A;  5JHF A;  1Y8Q B;  2VJI A;  5B3S H;  3K1P A;  4ZDP A;  3WGH A;  2CS3 A;  5JVG F;  4A3J J;  5FO5 A;  2DU9 A;  3GCM A;  4M9X A;  1OCT C;  1G4D A;  3SFZ A;  5BNG A;  2EPF A;  1DGR M;  1SFO J;  4YFX F;  4I0B A;  2ZXJ A;  3ABK H;  2KDZ A;  1S6L A;  3ZQ7 A;  1W5T A;  5E3N A;  1IRZ A;  4R1H A;  3CCR I;  3LQQ A;  3R6S A;  1ETX A;  2L0K A;  3TP0 A;  1E2X A;  3C1D A;  2M7A A;  3LSG A;  2F48 A;  4RBO A;  2LRD A;  5TIS C;  5C4J J;  4KT6 A;  3S1R J;  1S72 I;  1CGP A;  2FBK A;  4O6J A;  1BN5 A;  4U0W A;  3V8J A;  3ZQQ A;  1Z7U A;  4M3D A;  3H3U A;  1JGG A;  4OAY A;  4A3M J;  5GAG J;  1EV7 A;  2WAF A;  4HF0 A;  1YRN A;  1JTY A;  1QQI A;  4KFC A;  2VE9 A;  2NVT J;  2EIJ H;  1YOV B;  2DCE A;  3GLL A;  4EGY A;  5D5V B;  3ML6 A;  4BL0 B;  2QGU A;  1MNM C;  2DMN A;  4E7S A;  1AKH B;  2JTV A;  1A6I A;  3RKY A;  2FBI A;  2DFH A;  2GM4 A;  4HLX A;  4XSX F;  4DOZ A;  1V54 H;  2QSF X;  2XGE A;  3K1N A;  5J8F A;  1FT9 A;  3QYF A;  2V9K A;  3IRQ A;  3A1Y A;  4N4O B;  1NG6 A;  4ASN A;  3WTV C;  4IZZ A;  2ME0 A;  4GCV A;  2R7S A;  1ETK A;  3Q9S A;  3JTG A;  3S1M J;  4MO7 A;  5KAI C;  1YHQ I;  2R7F A;  4HF2 A;  4GYG A;  3K10 A;  4A3E J;  4A5M A;  1VQK I;  1WH5 A;  2A6H F;  2Q2E A;  1QHG A;  4B09 A;  3E1S A;  2K40 A;  2XVC A;  2QYO A;  2Z9O A;  1Z7L A;  2M4K A;  2PX9 A;  2E1O A;  3WTZ A;  3BR6 A;  3FBI B;  3HEF A;  4E7H A;  4ENK A;  1OPC A;  5EZG A;  5ICE A;  3M8E A;  1G2H A;  5L3B A;  4HOB A;  5LHI A;  3G71 I;  5E18 F;  2M4G A;  3PNT A;  3FK7 A;  3TDU C;  4PDK A;  5IOZ A;  2UUZ A;  3CLO A;  1V5G A;  2B9S A;  3PFI A;  3OYC A;  4EGZ A;  4D0P A;  1MSE C;  2VT3 A;  3HUG A;  2HFH A;  3JRB A;  4JK1 X;  1OR7 A;  2FNP A;  2X48 A;  4BAY A;  2KPM A;  1SAX A;  1J75 A;  3IH4 A;  4DBQ A;  2LF8 A;  3JRE A;  2EQR A;  1GVJ A;  1MMA A;  3O2P E;  3QQA A;  2GIV A;  3QU6 A;  4YEL A;  3SFI A;  3F6V A;  1NHA A;  2XSJ C;  4OIP F;  1VFC A;  4BXU A;  3H9Q A;  3OYH A;  1O57 A;  2CRG A;  5HVQ C;  3LA3 A;  2R7Q A;  2VXZ A;  2GAU A;  3QWL A;  3FDY A;  4YII A;  1WWX A;  3DBL B;  1MND A;  1DUX C;  4LG0 B;  1UFM A;  2XPU A;  2COM A;  4PJN A;  4FE7 A;  2MLK A;  2XGX A;  1F36 A;  2DYS H;  3MKZ A;  3CLQ A;  3BR5 A;  4E7Z A;  2HI3 A;  2B7E A;  3T8T A;  1QVT A;  5FLX K;  1DU0 A;  3KZZ A;  1YW7 A;  4Y13 A;  4R79 A;  3E0J B;  1OIS A;  2XIG A;  1MGT A;  3R61 A;  3S32 A;  2ACJ A;  3BJ6 A;  3WGG A;  1VQ9 I;  1Z6T A;  4EJW A;  4Y7N J;  5EG0 B;  2DTR A;  2EZL A;  3BCA A;  2ZJR F;  4BHB A;  3PQJ A;  3K7A J;  4BS9 A;  1TWH J;  3P7N A;  5E79 C;  1I50 J;  1WRJ A;  3JCU C;  4WXC A;  3EQL F;  3O6B B;  4XKC A;  1Z91 A;  3BPV A;  3FXK A;  3ONQ A;  1MMG A;  2DMQ A;  3HHG A;  2L7K A;  1SFE A;  1O7L A;  3HL2 A;  1O3S A;  5CVI A;  1A35 A;  1WI9 A;  3S8P A;  5FGM A;  3CC4 I;  1YX5 A;  3M9A A;  4IEJ A;  5D6E A;  2L4M A;  2HQN A;  1U9N A;  1WJB A;  2K4B A;  4F3Q A;  3OYM A;  3WG9 A;  1X1D A;  2DOD A;  3K4J A;  1BC7 C;  1DPR A;  2ZFU A;  2R0Q C;  4GXO A;  4PJM A;  3TMO A;  1QZZ A;  2X0L A;  2R7R A;  3I55 I;  3LSR A;  5F1J A;  2W25 A;  1WQ2 A;  4L5J A;  1LB2 A;  4B3X A;  4CO8 A;  4XM3 A;  4EJT A;  4M72 A;  2PFB A;  4O3M A;  2VL8 A;  3BOQ A;  4I09 A;  9ANT A;  2OPT A;  2WTE A;  4HYE A;  5E1X A;  3TP3 A;  1R1U A;  5HLI A;  1F1Z A;  1F5T A;  3HGY A;  1BIA A;  1I6H J;  5D5W B;  3TO7 A;  1R1T A;  4PGH A;  2YSR A;  2ZBK A;  3CUQ C;  3CP2 A;  1WJA A;  3H5R A;  1N75 A;  5EF6 A;  4BNC A;  3CC2 I;  3HOZ J;  2B0L A;  2G9W A;  2UXX A;  5HS7 A;  1KYZ A;  4P55 A;  2NS0 A;  2VBW A;  4AIJ A;  1TTY A;  2RAE A;  2X6O A;  1DU6 A;  2EFP A;  1J59 A;  4Y17 A;  2K7L A;  1MBJ A;  3OOP A;  3PFY A;  5IT3 A;  2FML A;  4A93 J;  2R5Z B;  4I2O A;  5KNL A;  3HOW J;  1YYV A;  1AA7 A;  5F6F A;  4IL6 C;  4DYC A;  3C18 A;  1UST A;  4W1U A;  2XB0 X;  5LRR A;  1XDS A;  2VAS A;  3TED A;  2KRF A;  4G7Z F;  3DKX A;  3OYE A;  3IH2 A;  3GFM A;  1BI3 A;  4IHY A;  3BZC A;  4BGD A; 
#chains in the Genus database with same CATH homology
 3MVP A;  3CMY A;  2WV1 A;  4M3G A;  2O8K A;  2DA4 A;  4MLO A;  1PUF B;  3S17 J;  1LFB A;  1Y1W J;  4FTH A;  3NAR A;  2CU7 A;  1HF0 A;  1IC8 A;  3I4N J;  4DYQ A;  4UUS B;  3L1P A;  1TC3 C;  4A69 C;  4S0H B;  3E7L A;  4D5C A;  4MIM A;  1FIA A;  1K61 A;  1MBE A;  1GV2 A;  1ZGW A;  3GTM J;  2R7Z J;  5J1U A;  3GTP J;  4XIC A;  3ZQC A;  2YUS A;  4MFD A;  1LE8 A;  1U8B A;  1Z0X A;  1RPW A;  2E2J J;  1X58 A;  1JT0 A;  4A3K J;  1QRY A;  3GTQ J;  2M0C A;  4W97 A;  2DA1 A;  1ETY A;  2IBD A;  2FD5 A;  3LSP A;  3JRD A;  2LTP A;  3LNQ A;  2EH3 A;  4AYB N;  3TW7 A;  2AHQ A;  3RKQ A;  2G0E A;  2DJN A;  5M5W J;  3GTG J;  3HKZ N;  5FKL A;  1T56 A;  2HOA A;  1B72 B;  4FE4 A;  2D5V A;  1RKW A;  5JLW A;  1JUS A;  3BR1 A;  1TWA J;  3S1N J;  3BG3 A;  5EDN A;  4CYC A;  5EG0 A;  1GVD A;  3BTJ A;  1JKQ C;  5DS9 A;  2Y31 A;  2LKX A;  2JA5 J;  2ID3 A;  2LP0 A;  1MSF C;  2H8R A;  2PMZ N;  3I4M J;  3CQZ J;  3QPS A;  4L5E A;  1FJL A;  2HXI A;  2KT0 A;  2VPR A;  4AUX A;  5J1R A;  1YRN B;  3ZQG A;  2XGC A;  3HB9 A;  3K2A A;  3NAU A;  2B63 J;  1AKH A;  3OSF A;  2ECB A;  3BT9 A;  1RR7 A;  2E19 A;  5M5X J;  4BY1 J;  3O8G A;  1BW6 A;  3D1N I;  3HDD A;  2COB A;  4A3B J;  3A01 B;  3IV5 A;  5EGO A;  2TRT A;  2LFB A;  1QPI A;  3GTL J;  1GV5 A;  3H0G J;  5FJ8 J;  1NK2 P;  5E3M A;  1TWF J;  5IYB J;  2HOT A;  1ETV A;  3ZQF A;  2MSY A;  5GPC A;  1IGN A;  2HDD A;  4A3C J;  2N8G A;  5K7H A;  1P7J A;  1ENH A;  2Y9Y A;  4C2M J;  4M3F A;  1TWC J;  1FIP A;  2L9R A;  3Q0V A;  3PO2 J;  2MW8 A;  4JX6 A;  4XRS A;  1UMQ A;  5F27 A;  2CUE A;  2AO9 A;  4J19 A;  2P81 A;  1GT0 C;  1NK3 P;  2LY9 A;  5C44 J;  3HOV J;  2HQ5 A;  5C4X J;  3FKI J;  1IDZ A;  4BY7 J;  2R5Z A;  4DW6 A;  2NVQ J;  1FTZ A;  3BTL A;  3M3Y J;  5K7Z A;  2R5Y B;  3BG9 A;  2YU9 J;  4IHV A;  2M9H A;  1T33 A;  2K9N A;  5FKN A;  1TWG J;  1Q1V A;  5E3O A;  5IYD J;  2M8G X;  1R9T J;  2R93 J;  1P7I A;  3GTJ J;  2EZH A;  1JKO C;  2NS7 A;  3HGG A;  2R92 J;  2DA7 A;  4X6A J;  1UHS A;  3FIW A;  1PUF A;  2CQQ A;  2JJ7 A;  3Q3S A;  2XSD C;  4A3L J;  2DA6 A;  3M4O J;  1U78 A;  1H88 C;  2NVY J;  2HOS A;  3JRF A;  3PM1 A;  4BKX A;  1D5Y A;  1ZK8 A;  5FKM A;  1MBK A;  1SAN A;  4B1R A;  1H89 C;  2XB5 A;  2K9S A;  3W6V A;  4DZP A;  1XS9 A;  2GLO A;  2JA6 J;  1IUF A;  2EZK A;  1BW5 A;  1WPK A;  3F0C A;  5M5Y J;  3OIO A;  2XPV A;  1NTC A;  3JRC A;  2HYJ A;  2LD5 A;  2WB1 N;  1JUP A;  1FTT A;  3HBL A;  5IP7 J;  2L7Z A;  1LE8 B;  4FCY A;  5F08 A;  1JKR C;  1ORK A;  3WHC A;  3BR2 A;  2Y30 A;  4MFE A;  1ETW A;  4M3B A;  2I10 A;  1ITY A;  1JKP C;  4A3J J;  1OCT C;  1ETQ A;  5BNG A;  3SJM A;  4A3D J;  1E3O C;  3SDG A;  1SFO J;  2WAQ N;  1HCR A;  4BBR J;  2KDZ A;  1WGX A;  5E3N A;  3ZQL A;  1IRZ A;  5GPA A;  1ETX A;  4NDL A;  1B8I A;  1I3Q J;  1HOM A;  2L0K A;  3TP0 A;  4CYC B;  4RDU A;  3LSG A;  3A02 A;  4RBO A;  4QTR A;  2ID6 A;  2W48 A;  5C4J J;  5C3E J;  3S1R J;  1VI0 A;  3C2B A;  1BJZ A;  2Y0S N;  3S2H J;  1BA5 A;  4M3D A;  1VF9 A;  1JGG A;  2DA3 A;  4A3M J;  2O7O A;  3G1L A;  4FIS A;  5EZH A;  1ZTR A;  4V2G A;  3GBG A;  1YRN A;  1JTY A;  1XG1 A;  2NVX J;  5J3L A;  2NVT J;  5IP9 J;  3BTI A;  1HDD C;  2JA7 J;  1GDT A;  2DTZ A;  5HOD A;  1MNM C;  2FJ1 A;  2DMN A;  4A3F J;  1AKH B;  1A5J A;  1A6I A;  2DN0 A;  5JLX A;  2ECC A;  2GM4 A;  1X2N A;  3HOY J;  5F0H A;  1FEX A;  2OF7 A;  4QIW N;  3LSJ A;  1UG2 A;  3ZOB A;  1RES A;  2XGE A;  4C3I J;  2VKV A;  3Q0U A;  3QPL A;  1H8A C;  3HM5 A;  3PO3 J;  1CQT A;  3H3V K;  1GUU A;  1LFU P;  5EGO B;  1HLV A;  2DMT A;  2ME0 A;  1OJL A;  1ETK A;  1F43 A;  1ZR2 A;  2CJJ A;  3S1M J;  1JUM A;  4MO7 A;  4XRM A;  1ZKG A;  1ZQ3 P;  3IH3 A;  4A3E J;  4I76 A;  2LK2 A;  3OSG A;  1WH5 A;  5J1Y A;  1JT6 A;  2YS9 A;  2K40 A;  4HNV A;  2E1O A;  1S7E A;  2L7M P;  3BR6 A;  3HEF A;  3VPR A;  5EZG A;  3GTK J;  1G2H A;  4A3I J;  2FX0 A;  2JWT A;  3FK7 A;  2E2I J;  3WHB A;  2Y9Z A;  1ETO A;  5IOZ A;  2GBY A;  1RKT A;  2XPW A;  1OFC X;  5E3L A;  1MSE C;  1Y1V J;  3JRB A;  3A03 A;  4C3H J;  4D7M A;  2X48 A;  5FLM J;  3IH4 A;  3S14 J;  3LOC A;  4UUS A;  1MBG A;  3JRE A;  4IHX A;  2EQR A;  3QQA A;  3UKG A;  3SFI A;  2E2H J;  1VFC A;  5F0C A;  5F0F A;  2DA2 A;  3RZD J;  4V2F A;  2CRG A;  1ZR4 A;  4M6V A;  3ZQI A;  4DZJ A;  3FIS A;  4XRS G;  1JTX A;  2LR8 A;  3BG5 A;  2IEK A;  4D7N A;  2XPU A;  5IYC J;  3JRA A;  4FE7 A;  3Q0W A;  1F36 A;  2QF7 A;  4JP0 A;  3BTC A;  1POG A;  3BR5 A;  2NOG A;  4X1E A;  1B72 A;  4QSH A;  2HI3 A;  2DA5 A;  5K7F A;  3FK6 A;  1QVT A;  2EZI A;  1DU0 A;  4JX4 A;  2CQX A;  1WI3 A;  3DCF A;  4JYK A;  1MBF A;  4GFB A;  2MG4 A;  3G1M A;  4AC0 A;  1O4X A;  1X2M A;  2JMW A;  4Y7N J;  5M3M J;  5EG0 B;  1IJW C;  2EZL A;  2IAI A;  1W0T A;  5FKO A;  1IG7 A;  1VND A;  3K7A J;  2QCO A;  4JX5 A;  2XRL A;  1TWH J;  4ABZ A;  1I50 J;  2JA8 J;  5F04 A;  4G12 A;  3TW6 A;  3JRH A;  1IV6 A;  1B8I B;  2DMQ A;  4BBS J;  3RZO J;  2MGQ A;  1W0U A;  4IEJ A;  2K9Q A;  3CCY A;  4C3J J;  2JN6 A;  1U9N A;  2M34 A;  2X9D A;  4XID A;  1RET A;  2LVS A;  1APL C;  3B6C A;  4A3G J;  3S16 J;  1OCP A;  3BR0 A;  2R0Q C;  5M3F J;  3G1O A;  5EYR A;  2JK3 A;  3LSR A;  5F1J A;  1WCM J;  2HXO A;  1MBH A;  3OOU A;  4LOC A;  3A01 A;  3BQZ A;  1JJ8 C;  4B4C A;  2O9L A;  2ME6 A;  3HOU J;  2ELK A;  2VI6 A;  3HOX J;  4I6Z A;  1JJ6 C;  9ANT A;  2OPT A;  3MN2 A;  3TP3 A;  3O8H A;  5IP6 A;  2M2E A;  3MKL A;  1MH4 A;  1Z77 A;  4D5F A;  3HGY A;  4UUT A;  3JR9 A;  2VUM J;  2NS8 A;  3CDL A;  1I6H J;  3BR3 A;  2DMP A;  3DEW A;  3S2D J;  2LLK A;  5FLV A;  5EF6 A;  1HDP A;  3S1Q J;  5DTD A;  2XGD A;  3ZQH A;  3HOZ J;  1MH3 A;  1WH7 A;  2ZB9 A;  4B3A A;  4BXX J;  2VKE A;  3RQI A;  5GP9 A;  2RAE A;  5IOY A;  2X6O A;  2H1K A;  1DU6 A;  4XK4 A;  4EEF G;  1BL0 A;  1MBJ A;  5IPA A;  3JRG A;  1U9O A;  4M3E A;  3GTO J;  5EEA A;  1K83 J;  4A93 J;  3S15 J;  2R5Z B;  3JRI A;  2FQ4 A;  3B6A A;  2R5Y A;  3HOW J;  5FKK A;  1AU7 A;  4DYC A;  2EBI A;  4W1U A;  4DYR A;  2XB0 X;  2TCT A;  1XC5 A;  4Y52 J;  1AHD P;  1IDY A;  2DMU A;  3TED A;  3BQY A;  1EF4 A;  2CUF A;  2Y2Z A;  3IH2 A;  4IHW A;  1QVU A;  4IHY A;  2L7F P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...