4QTRA

Computational design of co-assembling protein-dna nanowires
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
RTAFSEEQKKALDLAFYFDRYLTPEWRRYLSQRLGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo design/dna
molecule keywords dualENH
publication title Computational design of co-assembling protein-DNA nanowires.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 14
structure length 55
sequence length 55
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4qtrA00
1X2NA 1GUUA 2L7FP 1HDDC 4S0HB 4MO7A 1TC3C 4FTHA 3M3YJ 1BW6A 2EZKA 1RKTA 4DYQA 2HOSA 2GLOA 1FEXA 3HM5A 1LE8B 2O7OA 2GM4A 1OJLA 2JA8J 5JLXA 4EEFG 5EZGA 2Y9YA 2R5YB 1BL0A 2P81A 5K7FA 5K7HA 3O8GA 3Q3SA 2O8KA 2L7MP 1X58A 3OSFA 3O8HA 5F0CA 2LLKA 2YU9J 3PM1A 1B72A 2KT0A 1HDPA 2CUFA 3MKLA 3JRDA 4XRMA 3S16J 2MGQA 2JA6J 2DA6A 4A3DJ 4M3GA 1LFUP 2NS8A 1MH4A 2FD5A 1ZTRA 2CU7A 1QVTA 2K40A 1JUMA 3TW6A 2ELKA 4C3JJ 2XB5A 3HDDA 2ECBA 4M3DA 1DU6A 1PUFB 1YRNB 3K7AJ 2LK2A 4M3EA 2FQ4A 1P7JA 2GBYA 1GDTA 5IYBJ 5IP9J 5J1YA 4ABZA 2NOGA 2Y30A 5C4JJ 2XPVA 2DA7A 3G1MA 2JN6A 2DA3A 3HOXJ 5EZHA 1LFBA 4B4CA 1OCTC 3JRHA 5IPAA 1IGNA 3K2AA 1MBJA 1MSEC 2JJ7A 1Q1VA 2X48A 3BT9A 4UUSB 4BY1J 3HOUJ 5IOYA 1U9NA 4A3FJ 1HF0A 4IHWA 1ENHA 2Y9ZA 2E2IJ 4BKXA 5BNGA 5EG0B 2Y31A 3ZQGA 3L1PA 1BA5A 3H3VK 2K9NA 3UKGA 3GTGJ 4D7MA 3VPRA 3FKIJ 3HB9A 5EGOA 3BQYA 2NVTJ 1MBEA 1I6HJ 2M9HA 3Q0VA 5E3MA 2W48A 1WGXA 3JRBA 3ZQFA 1DU0A 1XG1A 2WAQN 2DJNA 2CUEA 5C3EJ 3BG3A 2ECCA 5FKMA 5M5YJ 1ZGWA 3ZQIA 2E1OA 4IHYA 3BR2A 3GBGA 4CYCA 5M5WJ 5E3OA 5FJ8J 1NTCA 2XGCA 2VKVA 1RR7A 3B6CA 5IP7J 1ZK8A 1W0UA 1BJZA 2DA1A 1ETKA 1B72B 1T33A 1Z77A 2XGDA 3GTMJ 4A3IJ 1BW5A 3IH4A 3LNQA 3HKZN 2LTPA 2L7ZA 1IC8A 2MG4A 1A5JA 1U9OA 3JRGA 4DW6A 2M2EA 3NARA 1SFOJ 2HQ5A 3GTJJ 4BY7J 1F43A 3H0GJ 3MVPA 3S2DJ 5F08A 1H89C 4J19A 5J1UA 1AU7A 4MIMA 4RDUA 1GT0C 1WH5A 1Y1VJ 3BR0A 1CQTA 2M0CA 1JKRC 3S17J 3F0CA 2R5ZA 3HGGA 4FE7A 2LKXA 3ZQCA 1MBGA 3BTJA 4BBSJ 2VPRA 4M3BA 4QSHA 3HOVJ 2ZB9A 2QCOA 2EQRA 2R0QC 4X6AJ 3S1NJ 4BBRJ 1JT6A 2XRLA 2AO9A 1MBKA 1K83J 2FX0A 3HOZJ 2LFBA 1TWGJ 2DMUA 3Q0UA 3M4OJ 2HXIA 4GFBA 3QQAA 1MSFC 5FLVA 3BTLA 1FJLA 1NK3P 1VI0A 1T56A 5EF6A 3NAUA 1IJWC 1B8IB 5EGOB 4D5CA 3LSGA 4B3AA 3A01A 1OCPA 2L9RA 3FISA 4M6VA 4NDLA 1QVUA 5E3NA 2IEKA 1ZQ3P 2DA4A 2E2HJ 3DEWA 1ZR2A 5J3LA 1W0TA 1HLVA 2H1KA 3B6AA 1VF9A 3TP3A 1Y1WJ 2LD5A 1X2MA 3Q0WA 1IRZA 1UG2A 3BR5A 2VUMJ 2XGEA 2CQQA 1AHDP 2LR8A 5F0HA 2HI3A 4CYCB 2FJ1A 4I6ZA 1VFCA 1ETYA 2D5VA 2HOAA 1MBFA 1GV2A 2IAIA 5IP6A 1U78A 1TWCJ 4MFEA 3BR1A 4A3KJ 2G0EA 4D7NA 3OOUA 1OFCX 2XB0X 2M34A 5F27A 4RBOA 2M8GX 3LOCA 1S7EA 1TWAJ 2YS9A 2CQXA 3HOYJ 4QTRA 3S1QJ 1ZKGA 2CRGA 1RESA 4BXXJ 1AKHB 3WHBA 3TP0A 1IG7A 1FTZA 3JRIA 3JRAA 3LSRA 3G1OA 4MFDA 2K9SA 5J1RA 1ETOA 2CJJA 3CCYA 2JA5J 3SJMA 1ITYA 4D5FA 4QIWN 4A3MJ 1A6IA 4UUTA 1YRNA 4FISA 2ID3A 2DMTA 4JX4A 2R5ZB 1UMQA 3SFIA 5DS9A 2DMQA 2L0KA 5F1JA 4JX5A 1FIAA 3HEFA 4A3EJ 1RPWA 1APLC 3RZOJ 1D5YA 4DYCA 2TRTA 4IHVA 1TWHJ 2NVYJ 3FIWA 4A3CJ 2YUSA 2DTZA 2ME0A 1E3OC 1WCMJ 1WI3A 4G12A 4XRSG 4A3JJ 5GP9A 2X9DA 2R92J 3HGYA 1VNDA 5M3MJ 1H88C 4FCYA 2NS7A 5DTDA 2VKEA 4UUSA 4JP0A 5FKOA 4A93J 3FK7A 3GTQJ 2OF7A 2H8RA 5HODA 5EG0A 3TW7A 2EBIA 2EH3A 3QPLA 1JUPA 1JJ8C 2TCTA 5FKKA 2E2JJ 1IDZA 2HYJA 4IHXA 1NK2P 3BQZA 4X1EA 4AYBN 5GPAA 3ZQHA 3RKQA 2HXOA 2MW8A 5EYRA 5M5XJ 4LOCA 3IV5A 1XS9A 2MSYA 1IDYA 5EEAA 2NVXJ 2LP0A 4AUXA 1RETA 4C3IJ 3BR6A 3SDGA 3S1RJ 2WV1A 1ETQA 4C2MJ 3DCFA 3BG9A 2DMPA 4DZPA 2HOTA 2KDZA 4XK4A 2ME6A 5JLWA 5M3FJ 2E19A 4MLOA 3GTPJ 1IV6A 1QRYA 3PO2J 2DA5A 1ETVA 3ZQLA 3MN2A 1I3QJ 4W97A 4L5EA 1JJ6C 5C4XJ 3BR3A 3RZDJ 2PMZN 1JT0A 2OPTA 3C2BA 3TEDA 4B1RA 3JREA 2HDDA 3I4NJ 3BG5A 4JYKA 1HCRA 4Y7NJ 4JX6A 3ZOBA 2R93J 2AHQA 1GVDA 4A3GJ 2N8GA 5K7ZA 2EZHA 1F36A 3A03A 3BTIA 3CQZJ 4A3BJ 1HOMA 5IYDJ 3IH3A 2R7ZJ 3QPSA 1ETWA 1O4XA 1JKQC 3S14J 3D1NI 1K61A 1LE8A 5FLMJ 2Y0SN 2COBA 2R5YA 2IBDA 2VI6A 2LVSA 3JR9A 4I76A 2RAEA 1JKPC 4XRSA 4A69C 2I10A 1U8BA 3JRFA 1UHSA 1JKOC 3JRCA 3HOWJ 2NVQJ 4IEJA 3A02A 5GPCA 1R9TJ 1WH7A 5FKNA 2X6OA 3LSJA 5C44J 1P7IA 3GTLJ 1IUFA 2JK3A 4FE4A 4HNVA 1PUFA 3S1MJ 3G1LA 1FTTA 1B8IA 1RKWA 4W1UA 3WHCA 2K9QA 1ORKA 1POGA 3E7LA 3RQIA 2XSDC 4XICA 5F0FA 1EF4A 3HBLA 4A3LJ 4AC0A 3W6VA 4M3FA 1I50J 5F04A 3LSPA 1G2HA 1WPKA 5EDNA 1Z0XA 3PO3J 3S2HJ 4C3HJ 1GV5A 5IYCJ 1JGGA 3CDLA 4DZJA 5FKLA 2DMNA 2O9LA 3I4MJ 1JTYA 4DYRA 3GTOJ 1TWFJ 1XC5A 2ID6A 2LY9A 2XPUA 2Y2ZA 2EZIA 2EZLA 1ZR4A 3GTKJ 4V2FA 5E3LA 3CMYA 1MH3A 2B63J 1JTXA 2QF7A 4V2GA 4XIDA 3A01B 3BTCA 3FK6A 3OIOA 1ETXA 5IOZA 3IH2A 2WB1N 1MNMC 2DN0A 2JWTA 1MBHA 4Y52J 3OSGA 3S15J 1H8AC 1JUSA 9ANTA 1AKHA 2XPWA 1QPIA 1SANA 2JA7J 1FIPA 2DA2A 2JMWA
chains in the Genus database with same CATH superfamily
2XGXA 4XLPF 4GGGA 1D8JA 1GUUA 2TDXA 3T0YA 3ZCOA 2LC2A 2UWMA 2QYOA 3MMYB 2HR3A 4ETSA 4BNCA 3OOPA 1BW6A 5HS7A 2XV4S 4HDUA 1D3YA 1RKTA 2P7VB 1LEBA 1IUYA 5B3SH 5E8IA 3PQJA 4DIQA 3FHZA 5EJCA 5BPIA 1ZN2A 2GM4A 1OJLA 1FY7A 3EYYA 4CYDA 1N25A 2P81A 4F7ZA 5K7HA 3C2HA 2O8KA 2L7MP 1X58A 4EMSA 3CCLI 3O8HA 3ERED 2LG4A 1BI0A 3PM1A 2H6CA 2DPUA 1LFPA 2E1MB 2ELHA 4F93B 2JA6J 2DA6A 1LFUP 3ABMH 2EINH 1ZTRA 2K40A 1S3JA 1K4SA 4HRIA 5ERIA 3TW6A 2ELKA 3HDDA 4BEHB 2KZVA 1U8RA 1YRNB 2L7KA 3K7AJ 4EM2A 4M3EA 3P9IA 1RRJA 2FQ4A 2GBYA 3QU3A 4M71A 1TTYA 3C18A 4ABZA 2BY3A 2OU2A 5LEJA 3MFKA 1KU3A 1MIJA 2NOGA 2CMPA 3GTLJ 2XPVA 3E0JB 1R7JA 2ZJRF 3G1MA 3C2GA 2OZUA 1IN6A 2RQPA 2CQ7A 2ZXIA 3I3LA 5EZHA 3HRUA 5HNHA 4B4CA 4PJNA 3JRHA 4ENNA 3ERMA 3VSLA 3J81K 4TV7A 4EJWA 1FBQA 1MBJA 4CCOA 2IP2A 2HEOA 1Q1VA 2X48A 3BT9A 4N4OB 4YEJA 4M6XA 4BHCA 5JHUA 2F5DA 4RGSA 3U1KA 2RKHA 2W85A 3HOUJ 1BIBA 4A3FJ 4UNOA 5LRRA 2KPMA 1O57A 2E2IJ 4KT6A 3QU6A 1XD7A 3WE3A 2K9NA 4F3QA 4D7MA 1VQKI 3A0HC 3FKIJ 1K79A 5J8CA 3AL0C 1KU9A 3HB9A 5EGOA 3OYGA 4UVBA 4B47A 1BR4A 2M9HA 3GXOA 3Q0VA 5JVGF 1R4MB 1WGXA 3JRBA 3ZQFA 2Y0MA 3A1YA 4YIFA 5FFZA 2DJIA 2ZFUA 4CICA 2EWNA 2EIJH 3LFKA 3PFIA 3M8FA 2ECCA 4GCVA 4FX0A 4NQWA 2GZWA 1HSJA 5CJ9A 1Z9CA 5ICCA 4HAMA 1BR2A 4WXDA 1VQ9I 1T38A 2XAHA 2QQAA 1H9GA 5HDKA 2HKOA 2NYXA 5IP7J 4HPQA 2FRHA 1W0UA 4MEXF 1YYVA 1MW7A 2DA1A 4LG3A 1E0EA 2IVMA 4IRHA 3TDZC 3WTYC 1FPQA 1T33A 5LHIA 4A3IJ 1BW5A 3IH4A 3HKZN 1DPRA 3W6JB 5AIQA 2A6TA 3AG4H 4KN7X 3FBIB 4BQNA 1BOAA 1U9OA 3JRGA 1A5JA 3DKYA 1VQOI 3QYEA 3NARA 1STZA 3ULQB 2R7RA 3OIQA 3J80K 2DW4A 3I55I 4BY7J 2P5KA 1F43A 3OYEA 3H0GJ 3WU1B 2GXGA 3MQ0A 1PYVA 3OYFA 3LA3A 2IGNA 4MQ9F 5J1UA 3J7AO 4HF2A 2ZMEA 1IN7A 1GT0C 1Y1VJ 1CQTA 4HDVA 2M0CA 3E6DA 3N05A 4HW0A 2IGMA 2EJRA 4BL0B 3I64A 2R5ZA 4FE7A 2LKXA 1SFXA 1FC3A 3ZQCA 3FWEA 1PVEA 3H1CA 4M3BA 4QSHA 1JHFA 1T95A 2EQRA 2F5VA 2QCOA 2R0QC 4BBRJ 3EUAA 2Z33A 1TW2A 1JXSA 3GW2A 1K83J 2XAUA 3HOZJ 1TWGJ 2DMUA 3Q0UA 3M4OJ 3K4LA 4DGWB 1H0MA 2WTEA 2HXIA 4XRFA 4GFBA 3IAM2 1MSFC 1ZG3A 2HVQA 1FJLA 4OU0A 3I0TA 1S6LA 3LAPA 5EGOB 3KX2A 1OCPA 3MCZA 4KDPA 4Q5SF 1UB9A 2L9RA 5L3EA 4M6VA 4PFOA 5BQTA 2NNNA 1ZG5A 2DODA 2W1OA 5E3NA 1M1EB 2IEKA 3I58A 3K6GA 2L3DA 2X1EA 4YRVA 3DEWA 1I39A 3S93A 1ZR2A 1HLVA 2KZGA 2DFHA 4NQWB 1VF9A 1Y1WJ 2LD5A 1ULYA 1X2MA 4BJ5C 2PG4A 2Z2SB 1P2FA 2HU9A 1ETYA 3RCOA 4DOZA 2E1CA 5DV5A 4AIHA 2ZO4A 1U78A 3PSIA 4HQMA 4MFEA 2CW8A 5J4YA 3F72A 2ZJQF 1AWCA 1IN8A 1X1AA 4D7NA 3BPVA 4YIRX 2XIGA 4GXOA 4XOTA 2M34A 5F27A 4RBOA 1S7EA 5J47A 4XN0A 4KIFA 3DP7A 3M8EA 1WJDA 1AKHB 5D8KB 3TP0A 2M30A 3JRIA 2A6HF 3HSEA 4DQ2A 4OAZA 2K9SA 3R61A 3CF5F 3FMQA 5CVUA 2BY1A 1Z91A 4RGUA 1ZREA 3FF5A 2DAOA 2NOJB 3OL3A 4A3MJ 1SFUA 4UHTA 2EV5A 4HV5A 4LIVA 3ZRGA 2L9NA 4JX4A 2R5ZB 1FX7A 3CF2A 1UMQA 3KP4A 4Y13A 5EEHA 4FASD 2ZC2A 3SFIA 1BI1A 3WTUC 2DMQA 3CLQA 4HV6A 4G7ZF 2MLGA 3U9GA 4A0XA 2UV1A 5E79C 1ZG1A 2W82A 1Z3XA 1FIAA 1J0RA 2BEOA 4LJZF 2STWA 4A3EJ 2QSHX 1JI8A 1RPWA 3RZOJ 4DYCA 1NH3A 3ZXSA 3CCQI 1TWHJ 2NVYJ 3DQVC 2DTZA 1L0OC 3KLOA 2E1NA 4GO1A 4YFNF 3I59A 5GP9A 1LDJA 3E1SA 4AIKA 3CC2I 3HGYA 1VNDA 1H88C 4FCYA 1YHQI 1WFXA 1WZ2A 2DOEA 1J2XA 1TW3A 3EUHA 2NNYA 2L4MA 3S3MA 4A93J 4NC7A 3REOA 2OF7A 3D5LA 2H8RA 4LMYA 2KHMA 3CCSI 3KP3A 1Y8RB 5D4RA 2EBIA 1QZZA 2EH3A 3QPLA 3G4SI 4CGZA 4BAYA 2HDWA 1RC9A 1GVJA 3DPLC 3R0JA 1A31A 2GA2A 5H6RA 4LB5A 2XAGA 5DUIA 4LD5A 3WGIA 1RNLA 1BI2A 5KK1A 1J5YA 2IW5A 2OTJI 4AVPA 2OAZA 4AYBN 4XL9A 5GPAA 2RC4A 3ZQHA 2MW8A 4BUPA 3IV5A 2VQLA 3ZN0A 4AUXA 4ASNA 4R79A 4OMYA 2WV1A 1W5SA 1YS7A 4OIPF 2WY7Q 2CUZA 4LFUA 2KDZA 4IX7A 2ME6A 3I9V2 1E17A 4MLOA 1IXRC 3ECHA 1FLIA 5LGTA 2DA5A 2MYSA 1B9MA 3I4PA 3MN2A 3ZQLA 4BS9A 2K4BA 2LKSA 4W97A 4A2UA 2O6GE 4L5EA 1JJ6C 1ZLJA 3MZHA 2X6YA 3WG7H 1LJ9A 2YX7A 3LAJA 2OTLI 3C2BA 3HUGA 3K4KA 4M6YA 3JREA 4PGGA 2IS4A 1R36A 3I54A 2VB6A 3U21A 1Z6RA 3L2VA 3I4NJ 4JYKA 1HCRA 1UG0A 5ICGA 1VQ5I 2R93J 1OISA 3K4MA 3ZGKA 3PJRA 4A3GJ 2N8GA 5K7ZA 4M72A 3A03A 1A36A 3BTIA 4A3BJ 3B02A 3F6OA 5IYDJ 3IH3A 1LKXA 4DNCA 3VWBA 2VJ4A 3HHGA 4I0BA 1K61A 2O0YA 3QP5A 4DBQA 2VONA 2IPQX 2Q8KA 5FLMJ 2EILH 2R5YA 2G7UA 3K69A 3JR9A 5CYVA 3WTSC 1BC7C 3SHFA 2RAEA 4K2EA 3WU2C 3HG9A 3FHNA 3QPHA 3S32A 1UHSA 2G9WA 5B66C 4CCNA 1QBJA 4GYIA 5D5VB 3HOWJ 2OCCH 3DEEA 5HLTA 1T6SA 4QWQA 2QQBA 5ED4A 2BHZA 2MC3A 2X6OA 1FOWA 5JVTA 5C44J 1OYWA 1S5LC 4FE4A 4M74A 4MQVA 4HNVA 4MTDA 1PUFA 1KYWA 1BJAA 2E71A 4XSXF 5FLXZ 1WI9A 1XGSA 1ORKA 1POGA 2ISYA 3E7LA 4B8XA 2RNJA 4A3LJ 5H6QA 1VZ0A 2X6WA 5GTIC 1ON2A 4IXAA 4ZTJA 5CPRB 1EH7A 1LQ1A 5A2QK 5EEGA 2W24A 4AU7A 3ZMDA 3PO3J 1OQYA 4HG2A 2AQFA 2QSFX 3AAFA 4DZJA 5FKLA 3H0DA 4WWCA 2O9LA 3ZMSA 2V6CA 3HRSA 2KDOA 2HQRA 2PJPA 4XLFA 2DYSH 1TWFJ 2LY9A 2Y2ZA 1Y6IA 2EZLA 4XQFA 5KHDA 1QNTA 4P5OA 4V2FA 1MH3A 4XONA 3RPUA 2HGCA 1JTXA 2E1MC 1NHAA 1U6GA 1KQ8A 4EATA 1LVKA 2K7LA 1UZCA 2WB1N 3M1CA 4L9JA 2DN0A 1X1PA 2C6YA 2JWTA 5D6FA 2FMLA 1MBHA 4Y52J 4RB1A 4YIIA 1EH8A 3S15J 2ZFWA 3F8CA 2F4IA 2PMUA 2BYVE 3HUGB 1TT0A 4E7LA 3CP2A 4S04A 3BJ6A 1WJEA 1X2NA 1TP4A 3VYSB 2CG4A 4CH7A 2L7FP 4E7ZA 2GWRA 2Z1DA 1HDDC 1FOKA 5JHFA 2H27A 1TC3C 2LBFA 5B1AH 3V7RA 1SC7A 4X0GA 3DLAA 5HLGA 3BP8A 3M1EA 4PJMA 1YW7A 3F8FA 3I53A 1FEXA 3F8MA 5DM6F 2CSOA 3KZZA 5CVRA 2R7XA 3SEZA 5JLXA 4EEFG 3IRRA 2A5YB 2Y9YA 2R5YB 3E3VA 3J7YJ 3KETA 1MD0A 2BBYA 3Q3SA 1OCOH 2VIXA 2LLKA 2YU9J 1I6XA 2CUFA 3PNVA 3BJAA 5FROA 1R6RA 5DCMB 3NWTA 3SXYA 1MNEA 1G3WA 4XRMA 3TOBA 1FT9A 1OYIA 1R5HA 4P9UA 1S7OA 3S16J 4M3GA 2XAQA 1VQPI 2RV8A 3JTHA 2JSCA 2ECBA 1R1TA 4F55A 1PUFB 1I1SA 1TZLA 2FXAA 2Q0OA 3JTGA 1F1ZA 3GFJA 3T1BA 3WTWC 5J1YA 2GXBA 3P9KA 3GZ6A 1Z1DA 1HKTA 2LSOA 2VPLA 3SDBA 1YIOA 3DWLE 3FX3A 3KP6A 2OA4A 2KIMA 2Q2EA 3C7JA 2DA7A 4JBAA 1XGOA 3JSPA 3GFLA 2FBKA 3R6SA 3TBIA 2L54A 3BWGA 3FZVA 2JN6A 2LH9A 3W3CA 3H92A 2QSGX 2ZSIB 3EDPA 2WA0A 5IPAA 2UZKA 4KUMA 4RB0A 1W5TA 2L02A 3BZKA 4UUSB 2JUCA 4UVCA 3T8RA 4BY1J 2X51A 3J81Z 5IT9K 2PEXA 2V1XA 3E5XA 1ENHA 2WC2A 4BKXA 5LGUA 2VLAA 1ZARA 2J5PA 2M4GA 1YX5A 2F48A 1OCCH 2F4MB 4N9IA 3FDYA 4AM3A 2F4OB 2EPFA 2NVTJ 4B3XA 3QWLA 1MBEA 1IN5A 1W7PA 2IRFG 2P7CB 4IRIA 1I6HJ 3CJNA 5E1XA 2W48A 3BROA 4C2TA 4DBRA 4BQQA 3F23A 2WAQN 2DJNA 2CUEA 2DLLA 2RN7A 1P9QC 3ABUA 5FRMA 1U5TA 3F8BA 2W4SA 5HVQC 3MKWB 5LLQA 3S3NA 1XGMA 3K70D 2GA1A 4IHYA 1T98A 4CYCA 5HLIA 4ZYAA 1RR8C 1VQ7I 1K6YA 3BG7A 2H1LA 4P1WA 4P96A 5H2FC 2P6SA 1ZK8A 2EFOA 1BJZA 4XKWA 4CZCA 4Y33A 2PN6A 2IXSA 5AIPA 3L2WA 3LNQA 3V7SA 3QODA 2L7ZA 3OYLA 2L2OA 4XN3A 1FP1D 2MG4A 3RPUD 4N4NB 1HW5A 3KEQA 4DW6A 1SD7A 3OYKA 3G73A 5AONA 2HQ5A 1SVMA 3GTJJ 2UUZA 1MZBA 3H5NA 1QA6A 3S2DJ 1ZHFA 3J80Z 4J19A 4XLHA 2CQNA 1G8XA 3O6BB 3V8JA 3OYHA 4RDUA 4G7HF 2GXAA 3QYBA 1B4AA 2PBIA 1JKRC 1SVLA 1FSEA 3GEZA 1MBGA 2VPRA 3EETA 1BR1A 3NQOA 1Z6TA 2P5VA 2KQRA 4XBFA 2KRHA 2H6BA 3BZ6A 1JT6A 4EVIA 5GAGJ 1MBKA 3QRFF 1YS6A 4LLGF 1XX5A 2QLZA 3GZNB 4BDZA 4IF4A 4L9VA 4WCGA 2M8EA 4XKBA 4R1HA 3BTLA 3EPZA 1O3RA 1HW1A 2OZ6A 5F6FA 1YW9A 1NK3P 1WQ2A 1T56A 2KP6A 3CJRB 3O3KA 4I98B 2J5OA 3NAUA 1IJWC 1B8IB 1Y56A 2VC0A 1PUEE 4B3AA 1O7FA 1W7PB 4EV0A 3LSMA 3DKWA 4NDLA 1QGPA 3N4MA 1QVUA 2BVLA 2GIVA 1U5TB 1I1GA 4IOAF 3EUKL 3B6AA 2Y0SA 3TQNA 3BR5A 1DP7P 5F0HA 4CYCB 1R5GA 2FJ1A 4PGHA 4PJJA 2ZNYA 2HOAA 1GV2A 4EJVA 1MDMA 4CO8A 2RQQA 2ICWG 3DTIA 1TWCJ 4YG2F 3IKVA 3W2VA 2OJED 3QPTA 4FHTA 4WK8F 5FGMA 2G0EA 5HNFA 2V1UA 4BE0A 1TQMA 1WJ5A 4RS8A 2HZTA 1CF7A 1N75A 2M8GX 2EK5A 1TWAJ 3HOYJ 3CCJI 3QYFA 4RLFA 2CRGA 1RESA 1E3PA 2F2EA 4HX8A 2XF6A 2WWYA 4EGYA 3H3UA 5J6XA 2VQHA 4P9FA 4MFDA 5TISC 4G8XA 4EGZA 5J1RA 1U0JA 1XCBA 3CP8A 3CCYA 4N9HA 2KJCA 2MH9A 2A61A 1VQ6I 2JA5J 3VOEA 3SJMA 5LHGA 1QPMA 2HYFA 1R4NB 1W7PD 4D5FA 3ASNH 5CKTA 1EKEA 2LMDA 2DMTA 1XGNA 5D5WB 2HQAA 1KU7A 5DS9A 3FXOA 5TJJA 3V8LA 4HLXA 3CCUI 2W7NA 2QZ8A 4LITA 1Y39A 1FWZA 3GUDA 2VT2A 4RB3C 1SAXA 1APLC 1UAAA 4MHGA 4E7IA 3HYIA 4A3CJ 3Q9SA 2ME0A 1YTYA 1E3OC 1EV7A 3IP4B 3RQ4A 4A3JJ 2EIMH 4ZJZA 3BJOA 3LSIA 2K85A 5DTDA 3CMEI 3CDHA 3MEXA 2M7AA 4L5IA 1IRFA 1K4TA 2P4WA 2VQGA 3GTQJ 5L3GA 5HODA 3OR2C 5E18F 3K10A 2DBBA 5EG0A 2PFBA 2K5CA 1WRJA 4A5NA 2E2JJ 3GZ5A 1YLFA 2X85A 3ELKA 1R71A 4XR6A 3T5XA 1NK2P 3Q5FA 2NRAC 3C3WA 3IL2A 5H20A 4X1EA 3LL7A 3KLNA 3H36A 3PQKA 5BS6A 1IRXA 3OMYA 3B73A 2VBWA 1XS9A 3CJQB 1MDMB 1IDYA 2VBXA 1XTAA 4HYEA 4WX9A 2P6TA 2QBYA 2NVXJ 2LP0A 2D1VA 4CDGA 5K5OA 4XKVA 3HJEA 3QOPA 4RAYA 3SDGA 4MTEA 2ZJPF 2OD5A 4QPOA 1PP8F 3BG9A 3ABTA 2CO5A 1CF7B 5K5RA 3ABKH 5J4VA 5M3FJ 1T39A 2E19A 4G6TB 2BZTA 3KYLA 2PJRA 3EUHC 1B6AA 3KPHA 3E5QA 1U2WA 1ETVA 5HDNA 2VJJA 1RI7A 4ESBA 4IQ4A 3G2BA 5C4XJ 2RGVA 2XAFA 3BR3A 4AIDA 3DBRB 5GADJ 1X1DA 1JT0A 4I02A 3TO6A 4MGRA 5GTHC 3TEDA 1WJBA 3OWTA 3ZR8X 3ZP5A 3OYIA 3F6VA 1R1UA 5KCMA 3DU5A 1YITI 4G7OF 3ZMUA 2IA0A 2IGOA 3KZIC 2R7FA 4PCQA 3K2ZA 3FXJA 1MMSA 1HOMA 2MD0A 4PK4A 3FM5A 4UVAA 3S14J 1LE8A 2IJLA 3L9FA 2COBA 1T0FC 4EM1A 2VI6A 3DKXA 4KJZA 2EV0A 3AG2H 2WV0A 1A6QA 1MMNA 3MD2A 3F21A 3N97A 2CV1A 3PNYA 4NNJA 3JRFA 1O3QA 5TGTA 1JKOC 4PJ0C 4L18B 4Y3OA 5J8FA 2M45A 4IL6C 2BGCA 4D9JA 4E7HA 5CVJA 1WSUA 5B5EC 4I7HA 5ICFA 5GPCA 4KN4X 2MBFA 2R7TA 4H0EA 4EJTA 5FKNA 2ZMEB 2CW7A 4HNUA 2Z5UA 1IUFA 2JK3A 3G1LA 1KU2A 4L9TA 3HPGA 2E5ZA 4N0BA 4OINF 3Q9VA 1ZGJA 1FYLA 3KP2A 3RQIA 1ON1A 3SQNA 4F52A 4XICA 1DDNA 5HDGA 2JPCA 4F92B 4BE1A 4CHUA 3KP7A 3CC7I 1I50J 3LSPA 1TQIA 1P4WA 1WPKA 5HLHA 2STTA 1VQNI 3QOEA 3S2HJ 2QBYB 4C3HJ 3HKZA 5L3CA 3CDLA 1JGGA 2XRNA 1I27A 1KQ0A 2R3SA 2A68F 3L09A 2CFOA 4R8HA 5A2QZ 4DYRA 3GTOJ 3DFGA 1XC5A 2ID6A 1ZR4A 3GTKJ 1MMGA 2XHKA 3RDIA 4UY8I 5L3DA 2QF7A 3BTCA 5DDGA 1T8IA 2PJRB 1HXDA 5K5QA 4U7DA 2PLYA 1XMXA 2QWWA 2HZDA 1J59A 1XMAA 3RKXA 1W1WE 2QKMB 3BG6A 2M4KA 3OSGA 2HPIA 2XKOA 1EA3A 1R23A 3A4CA 4IZZA 2XPWA 4U88A 2NXNB 1SANA 2L9VA 2DA2A 2ZJ2A 3PUFA 1G3SA 3K70C 1MKMA 2OV7A 1YW8A 4ZZLA 3G3ZA 4FTHA 3TO7A 3M3YJ 2EZKA 3M8JA 2QQ8A 1YQAA 4M73A 4DYQA 4ESJA 4NHJA 2V79A 1LE8B 3PNTA 3OV8A 1LB2A 1RUOA 5E20A 4L0YB 4RLQA 1BL0A 4ZH4F 3O8GA 1OR7A 3ABLH 3OSFA 2DXIA 5F0CA 2O5RA 3K4BA 3KYCB 1HW2A 1B72A 1HDPA 3P9CA 4BGDA 5IT3A 3JW4A 4YFXF 3JRDA 4AIJA 2MGQA 3LA2A 1FNNA 2HTSA 2HPMA 2NS8A 2A6EF 1MH4A 4PJLA 1AA7A 4LG0A 2CU7A 3K1MA 1JUMA 2E7XA 3OR1C 4C3JJ 2MC4A 4M3DA 2P8TA 1V54H 5DD8A 1LDKB 4O3MA 3L2CA 2VBYA 2R7WA 1ERDA 3DF8A 3PSFA 1LVAA 2ADUA 4I99C 1YFHA 3R0AA 4EM0B 1H9TA 2BY2A 2Y30A 2KJBA 3ISPA 4BH9A 3JAMZ 3FXMA 3H9QA 4BU2A 2HKXA 5DEQA 2ZXWH 2M1BA 3E5UA 4G9YA 2DA3A 3K1NA 3HOXJ 1N78A 1S9HA 1LFBA 1XMKA 3RI4A 1OCTC 4LLLA 3I59B 4BYYA 2OBPA 1KYZA 1BOBA 3OYBA 1BBYA 1C0WA 4XLNF 2JJ7A 1IAWA 4PSWA 4ZYHA 2V7FA 1FYMA 1G6NA 4HA8A 4II2A 1FYKA 1U9NA 1HF0A 3L7WA 3ZQQA 4IHWA 5BNGA 1QHHD 1FP2A 3ZQ7A 3L1PA 1WVRA 2VT3A 3H3VK 1BA5A 4CCJA 5IT9Z 3TMOA 5E1WA 2ZSHB 1J75A 4GYGA 3R4KA 5E3MA 1OLTA 2V1NA 2CUJA 2X0LA 3ESWB 1WJFA 1TT5B 1DU0A 2R7SA 1XG1A 1S7AA 2AXLA 2A07F 3GVAA 1HBXG 5C3EJ 3FKJA 1TNSA 4HOBA 5CQGA 3AFHA 1F4KA 5FKMA 5M5YJ 2W25A 2A69F 1VTNC 2BW3A 3ZQIA 1ZGWA 3CCMI 3RYPA 1BC8C 2DU9A 5F64A 4WF2A 4ESFA 3BR2A 2K9LA 4XKCA 5FJ8J 4G94A 2E7WA 4IRGA 2XGCA 3VDXA 2VKVA 1RR7A 2HS5A 1XPXA 4F91B 2DCEA 4OMZA 1BM9A 1ETKA 1B72B 2EV6A 3HC7A 2VE9A 1Z77A 2KFDA 1HC8A 4U0YA 1XDUA 2H94A 1D1CA 1VQLI 4LG0B 3GYHX 2MH2A 1OMIA 4XSZF 4RAZA 4L9NA 4NC8A 2M2EA 4FQGA 1SFOJ 1NG6A 3HIFA 4AYBA 3MVPA 4BACA 2JSPA 1R49A 2V26A 1U5TC 1SAUA 1AU7A 3UNGC 1ZAOA 1WH5A 3BR0A 2DYRH 4XORA 1AOYA 1W36D 2AS5F 1MJ9A 5IY5H 2LF7A 4BBSJ 3HOVJ 2ZB9A 4CZZA 1X1CA 1IV8A 4HLYA 1YIJI 1DP3A 1TLHB 1R22A 2XRLA 3ZMTA 3HRMA 3CZ6A 2LFBA 2YPRA 4O6JA 4E70A 2PX9A 3K4CA 3ECOA 1OCRH 3IUOA 1QO0D 1D5VA 1J7KA 3OL4A 4AWXB 4UUVA 2KLOA 4BJ6C 1WJCA 4L0ZB 3CUQA 1REPC 3JAMK 2BVMA 2GAUA 3BC8A 4CCMA 4D5CA 3KIOA 1DGWY 3A01A 3E6BA 1SD6A 3FISA 2OQRA 1QZEA 1XSVA 4J00A 1ZELA 1Y0NA 4KICA 5TRDA 1FBUA 3VB2A 3PL8A 1Z3YA 1W0TA 5KNLA 1SD4A 2GIZA 3K0LA 1X1BA 2H1KA 4HZFA 3CO7C 4HX4A 3Q0WA 1IRZA 1IXCA 2E35A 2M5WA 2KIQA 1HQCA 2XGEA 2CQQA 1AHDP 2LR8A 3VYUB 2HI3A 4A6DA 4AD9A 4HF1A 2KIUA 4I6ZA 1XB4A 2D5VA 1USTA 2DOFA 4ZDOA 1MBFA 2JRMA 3SYTA 3VYRB 3BR1A 2NAZA 1K7AA 4A3KJ 4BHPA 1LNWA 4RM2A 3BY6A 3CMAI 1HKSA 5HS9A 1DPUA 3OOUA 2OCEA 3LOCA 3RJPA 2CQXA 3NRVA 3S1QJ 4PSXA 2R7QA 4G6DA 1IG7A 3CESA 1UHMA 1FTZA 5D4SA 4ENKA 2XC7A 3JRAA 2M0MA 1IW7F 3G1OA 1GXPA 2A5WA 5ILSA 1RZ4A 1L3LA 3OYNA 3A0BC 1ETOA 2DDBA 2LBFB 1U3EM 2DT5A 1UELB 3HXLA 4CXFA 1V3FA 4IQJA 3CD6I 1ITYA 4QIWN 2F5CA 1A6IA 1E3HA 4UUTA 4FISA 1YRNA 3VEPA 5BPDA 3E6MA 3DPUA 1WJAA 1F9NA 4B44A 2FNPA 3V42A 2VODA 2BE5F 3A2KA 2X1DA 3LFUA 2HFHA 1IXSB 2MFZA 1XSDA 3D0SA 5F1JA 2FUG2 2M3AA 2DT6A 2CQKA 3HEFA 5KAIC 2D1HA 2WB1A 3GWZA 2TRTA 4IHVA 1J9IA 1CGPA 4LLNA 1E2XA 2K02A 3D5RC 4ZYEA 1WI3A 4XRSG 1OPCA 4C30A 5FB2A 1P6RA 3PUBA 2X9DA 2EIKH 2R92J 1ZH5A 5K1YA 5M3MJ 4AVZA 3CUQB 2NS7A 3OS0A 1VQMI 1S72I 4KIBA 5FKOA 1T08B 1MJBA 2ZCWA 2L5QA 2ACJA 3GFMA 3QAHA 3FK7A 3H3ZA 2XDVA 1A04A 1Z7UA 1S8NA 1G4DA 4ON0A 1ACIA 1LEAA 1JUPA 3DEUA 5LHHA 1K78A 2Q2EB 2JZYA 3H35A 1IDZA 2HYJA 2LY2A 1G3YA 1NG7A 1YO5C 1Z7LA 3CCEI 1QHGA 2XASA 3IRQA 3BQZA 2E36A 4ENJA 3LSKA 4Y15A 2VBZA 5EYRA 4BJTA 1YE9A 1MMAA 2MSYA 2HVRA 4NC6A 2V1DA 3AKZA 2ELJA 2HYGD 1ZYRF 1IRGA 1T2KA 2V9VA 2IS6A 3HSRA 1V55H 5ILUA 2PMZA 3OS1A 4Y4RA 2DMPA 4NB5A 4P55A 2BV6A 5J40A 3BOQA 1XSXA 4RGXA 3GTPJ 2ISZA 5E1ZB 2HNHA 1R1VA 3ZN1A 1LPQA 4IPAA 4JOMA 1X4PA 4UXNA 5F1RA 1OKRA 4C9YA 1B9NA 1HA8A 2ZMEC 4KITB 2XSJC 3RZDJ 4I01A 3FXRA 3CO6C 2YX4A 4B1RA 3LSTA 3RSNA 3DPTA 4JK1X 5FFXA 3CJTB 4LK0F 1IO2A 4U7BA 5BOXA 4UV9A 1GHCA 1F5TA 1ONVA 1GVDA 3IHUA 4KISA 2L4AA 4JQFA 3CQZJ 4KA4A 3UR3C 2R7ZJ 1ETWA 3FM3A 2XF5A 2BY0A 3D1NI 2ESNA 3CTAA 1MMDA 3BDDA 3WG9A 2K9MA 1TBXA 2VJ5A 1V4RA 2LY1A 1ZRCA 2EA4A 4H4KC 4I76A 5LD2C 4A69C 2I10A 1U8BA 2YSRA 2GOXB 3HSFA 2MLKA 2WAQA 2NVQJ 1O3TA 4IEJA 3A02A 2VOPA 1R9TJ 2A3SA 5L3BA 3LSJA 3DU6A 1K78B 5B1BH 4GDFA 2KRCA 5FO5A 1UCRA 3FXKA 1UJ8A 4W1UA 3VODA 3OYCA 3WHCA 2K9QA 3MKZA 1IN4A 1EH6A 5F0FA 1EF4A 2QGUA 3HBLA 1PJRA 4AC0A 2WBMA 3L00A 1N77A 3W6VA 1P4AA 1HKQA 4HEA2 4E4HA 1G2HA 5EDNA 1Z0XA 5HOOA 2DPDA 3F8NA 3FXQA 1V5FA 4BDYA 3TKYA 3WODF 2CH0A 3DLLF 3W2AA 3MAJA 2DOAA 2KISA 5ILVA 4IO9F 4WXHA 1JTYA 4FETA 2XPUA 3TL4X 2EZIA 2F5FA 4BXFA 1PP7U 2JA2A 4MNUA 3JCUC 3CMYA 2B9SA 4LGWA 2B63J 4Q48A 3HZJA 4XIDA 5FD6A 4UV8A 3AG3H 3CMMA 3OIOA 2F5EA 3ML6A 1WHUA 3D5SC 2E34A 1X3UA 2RREA 3T8TA 3C1DA 3L2QA 1UHWA 3LQRA 3VYTB 4KT5C 3V4GA 5LEKA 2HTJA 1H8AC 4XMYA 1AKHA 1SFKA 3PIOF 5CVVA 4KFCA 1FIPA 3BCBA 2MA3A 2JMWA 5DM7F 3HHHA 1SFEA 3H5RA 3KEYA 3FXLA 4IHTA 5HS8A 2DI3A 4D0PA 4S0HB 4MO7A 2QUFA 2VC1A 2XKPA 3AG1H 3CC4I 5LRSA 2HOSA 2GLOA 2DT7B 3HM5A 2O7OA 3RYRA 2JA8J 1DGRM 3MZYA 5JFRA 1ZRDA 1GLNA 5EZGA 3WTXC 5K7FA 2JTVA 5D6EA 3K4JA 4C2UA 2ZKZA 2IGKA 2KT0A 3MKLA 1PDNC 1Z05A 2EFQA 5LGNA 1BIAA 1QU3A 2DK5A 2ZNZA 2FEZA 4HBLA 4A3DJ 2FD5A 4NUBA 4BXUA 4CA0A 1QVTA 3GCMA 3MWMA 3PIPF 3OYAA 4ENMA 3WTTC 3IWZA 4E7KA 1W4MA 2XB5A 3H5AA 3J7ZI 1DU6A 2ZXJA 2LK2A 5D5UB 1Q1HA 1GDTA 1P7JA 3KP5A 1XDSA 2ZXHA 3U2RA 4OIOF 5IYBJ 4BE2A 1W36C 5IP9J 2QENA 1X4OA 4DJAA 1VQ4I 4I2OA 1R58A 3K4NA 2KMUA 4ZDPA 5C4JJ 3OIPA 3W6KB 4HSTA 2EA2A 3OYJA 2JT1A 2PQ8A 5CLSA 2DDAA 2V9KA 2R7OA 2L01A 3WTVC 1I5ZA 2BOLA 1OCZH 3M07A 2CWEA 4KMFA 4MEYF 1IGNA 3IC7A 2LYCA 2PMHA 1J09A 1OR7C 2MABA 3K2AA 1MSEC 1V5GA 1YX3A 5D8LB 5CVIA 4FT8A 5BMZA 3RPQA 2IT0A 4OOIA 5IOYA 3TGNA 2FQ3A 2NVUB 1G3TA 2Y9ZA 4S05A 5EG0B 1BN5A 4J01A 3X2QH 4BQAA 2Y31A 3GMEA 3ZQGA 2Y75A 3UKGA 3GTGJ 1JHHA 3VPRA 3DV8A 4FX4A 3CCVI 1EJ9A 2HQNA 3BQYA 1FOYA 3V8KA 2EFWA 3IAS2 1KQ9A 1FOXA 2VASA 2JPBA 4BQOA 1X3WB 4ZZDA 2FOWA 2Z16A 3V7CA 4M9SA 1OYYA 3BG3A 3TOAA 3S3OA 5GAHJ 3IKTA 3RKWA 2E1OA 2FU4A 2W00A 3HOTA 3GBGA 3GO5A 1YJNI 2QA4I 5M5WJ 1O7LA 4E6KG 5E3OA 2KL4A 4CCKA 1NTCA 3B6CA 2CGPA 2IS1A 1G59A 3GLLA 4U87A 2I5UA 3W2WA 1S29A 2XGDA 1D8KA 3GTMJ 2FBHA 1D0YA 2LTPA 4M9ZA 1P4XA 2XROA 5DUKA 2OQGA 4XLAA 1IC8A 1ODDA 2HDCA 1R00A 3DBHB 1GXQA 1RIOH 1I3AA 3AL0B 3HL2A 2F6CA 2IA2A 5KVRA 1JGSA 2FE3A 2Y48A 2EFNA 1WWXA 2JQ7A 2O03A 3LMMA 4IKFA 3TO9A 2DTRA 2X6XA 3E97A 5F08A 1H89C 2O8XA 4A6EA 2BHYA 1Z67A 2V9PA 1DQUA 2M87A 2K86A 4MIMA 4RGRA 3IWFA 2R7UA 3S17J 3F0CA 3HGGA 3HPHA 3COAC 2UXNA 2X1CA 3BTJA 5GAEJ 3NEUA 4A0ZA 2JUGA 2LDUA 4X6AJ 3R60A 3S1NJ 3HTUA 4WXCA 2AO9A 2FX0A 5LFAA 2P0WA 3M9AA 4HF0A 2FNAA 4UB6C 1KZHA 4ZC3A 4IJAA 4IOCF 3QQAA 4CCLA 5FLVA 1T0FA 3HTSB 3H9JA 4RA2A 2L9SA 1VI0A 2HOEA 1FMWA 1B1BA 1FMVA 1QZYA 1K6OA 5EF6A 3RKYA 2VE8A 3LSGA 3GF2A 5D5XB 1IF1A 1D1BA 1MGTA 1SVOA 3I5UA 3U1DA 4U0WA 2Q1ZB 2OC6A 1YG2A 4RAFA 1ZRFA 3KCCA 3ROUA 4A12A 3KE2A 1ZQ3P 2DA4A 2FBIA 2E2HJ 1W5CC 2RVCA 5J3LA 4D1QA 2E5NA 3O2PE 3CDIA 3I71A 3BLYA 3TP3A 2O61A 2W57A 2A05A 4IVNA 5LBQA 3VSKA 1UG2A 2UXXA 2VUMJ 1KGSA 2K3FA 2R7DA 3H9GA 1VFCA 5DYMA 5IP6A 2IAIA 4KMUX 3WE2A 3P7NA 4A0YA 2DQLA 4OIRF 3LA7A 2WADA 2P5LC 1X19A 2HWVA 1V5EA 4XM3A 1OFCX 2XB0X 3FXUA 2YS9A 3L2UA 4QTRA 1ZKGA 4I09A 2M7BA 4BXXJ 3CUQC 3WHBA 3WGHA 4LIUA 4Q4ZF 1TQPA 2EFPA 5DCMA 3LSRA 2QEXI 2DK8A 3PFYA 5FRNA 2QKLB 3MZ8A 2CJJA 2XF7A 2WAEA 2AXTC 4CUGA 1ZLKA 1B59A 5CQEA 4XLCA 2R4GA 4E7SA 2RDPA 4LK1F 2I8DA 3P5JA 2ID3A 3F9KA 4QPQA 2VXZA 2V6EA 3HRTA 2X4HA 4Y17A 4UB8C 1FSHA 2OUMA 3LQQA 2L0KA 1TNTA 2FA5A 5KAFC 2GQQA 4JX5A 4RMNA 4B43A 5DD4A 3HOSA 2CS3A 4Z6YA 1D5YA 4ZYGA 3FIWA 3WTZA 2JRTA 2YUSA 2GOMA 1WCMJ 2DQRA 3CUOA 2XUBA 3NWSA 4G12A 1FBSA 2K3PA 2LKPA 5L3FA 4HQEA 3K1PA 2YU3A 4RAGA 2VKEA 4UUSA 4JP0A 4ZDLA 1SEUA 3SZGA 1DUXC 4HSRA 4RM3A 1FZPB 2LREA 2WY8Q 3ZMVA 3TDUC 4QLCU 6PAXA 1D0ZA 3WU0A 2Z3YA 3TW7A 3G71I 3WGGA 1YJ9I 1JJ8C 2TCTA 4YFKF 4E7JA 2G7HA 2AQEA 3BZCA 3CCRI 2COMA 5FKKA 5E17F 1LUJB 2DFFA 4IHXA 3QP6A 1WKMA 2ETHA 3RKQA 2HXOA 3MKYB 4I0AA 5FD5A 2NS0A 4LOCA 1X3ZB 5M5XJ 1ZGAA 3G6EI 5JR3A 5EEAA 3DTEA 1P92A 3LSHA 1RETA 1KA8A 1YOVB 4II3A 4C3IJ 3I56I 1Z21A 3BR6A 4EQQA 3S1RJ 2HVSA 1ETQA 4BHBA 4EJUA 2XVCA 3FMSA 4ZYDA 2K4JA 4C2MJ 3DCFA 2Y69H 2CV2A 4DZPA 2HOTA 1XN7A 4XK4A 2QM3A 4ITVA 5JLWA 2CV0A 3ZPLA 2D2WA 2RNGA 1IV6A 2VKHA 1QRYA 3PO2J 2JVHA 4KIGA 2XAJA 4V19K 2V4JC 1I3QJ 3GLXA 2Z99A 1SD5A 3FBNB 1LDDA 2DFEA 4G6QA 1D0XA 3OY9A 3F3XA 2PMZN 2MD5A 3ONQA 1D1AA 2BW3B 2H8WA 2OPTA 1MNDA 4NBQA 3S8PA 2DFIA 4B48A 3DBLB 1KONA 2QVOA 4OAYA 2HDDA 1QQIA 3K9TA 3BG5A 3SZPA 4Y7NJ 3GX4X 4JX6A 3ZOBA 1SMYF 4KYWA 2R7VA 4HX7A 2AHQA 4LB6B 3BPXA 2EZHA 1F36A 3CLOA 3JSOA 2PI0A 2H09A 4ZTFA 4PZJA 3QPSA 4Z2YA 3KEOA 1O4XA 1JKQC 4EJOA 3FMRA 2Y0SN 2CYYA 2IBDA 4IHSA 2LVSA 3EQLF 1BI3A 2BXZA 1JKPC 2D45A 2VKDA 4XRSA 1HSTA 3M7GA 3EYIA 4RB2C 1A35A 3SZTA 3JRCA 2LOOA 2JVGA 4B09A 2VL8A 2B7EA 2KKOA 1UFMA 3DXJF 3S2WA 4U0VA 3RTRA 1WH7A 2K27A 4CSWA 2FOKA 1RUNA 5FLXK 2EB7A 4OWRB 2FMYA 5JI6A 2O3FA 1P7IA 4M9XA 4BEHA 3OYDA 1XCVA 2VXDA 3L2RA 3BCAA 3VFZA 5ICEA 3OYMA 3F22A 1TL8A 1O3SA 2VJIA 2LF8A 3S1MJ 1FTTA 4XNFA 1B8IA 1RKWA 1YI2I 2CFXA 2KRFA 4Q47A 2LRDA 1USSA 3KFWX 5DCFA 4A5MA 2XSDC 2ZBKA 2FSWA 2W84A 2Z9OA 4PUSA 4O5VA 4M3FA 4YELA 3E6CC 2FF4A 2B0LA 1Y8QB 1R5ID 4OIQF 5F04A 1VQ8I 3ASOH 3LWFA 2VN2A 3ZMZA 4PDKA 1GV5A 3KYDB 5IYCJ 1JE8A 2DMNA 3GFIA 1YJWI 3I4MJ 1Y0UA 2E60A 2VQCA 4XLEA 4PFPA 4XOPA 3RIRA 2WAFA 3J7AY 2CW0F 5E3LA 4ANJA 2QQ9A 4GRIA 1MJAA 4V2GA 3A01B 3FK6A 4L5JA 1ETXA 5IOZA 2DO7A 2LNBA 1IZ1A 3DTKA 2ESHA 3IH2A 3KZYA 2KIFA 2IA1A 1MNMC 2VOOA 2BXYA 4KNYA 1JUSA 9ANTA 3OS2A 2YR2A 5E8GA 3SFZA 1QPIA 1SMTA 3SEQA 2JA7J 2IS2A 4HNTA
chains in the Genus database with same CATH topology
1X2NA 1GUUA 2L7FP 1HDDC 4S0HB 4MO7A 1TC3C 4FTHA 3M3YJ 1BW6A 2EZKA 1RKTA 4DYQA 2HOSA 2GLOA 1FEXA 3HM5A 1LE8B 2O7OA 2GM4A 1OJLA 2JA8J 5JLXA 4EEFG 5EZGA 2Y9YA 2R5YB 1BL0A 2P81A 5K7FA 5K7HA 3O8GA 3Q3SA 2O8KA 2L7MP 1X58A 3OSFA 3O8HA 5F0CA 2LLKA 2YU9J 3PM1A 1B72A 2KT0A 1HDPA 2CUFA 3MKLA 3JRDA 4XRMA 3S16J 2MGQA 2JA6J 2DA6A 4A3DJ 4M3GA 1LFUP 2NS8A 1MH4A 2FD5A 1ZTRA 2CU7A 1QVTA 2K40A 1JUMA 3TW6A 2ELKA 4C3JJ 2XB5A 3HDDA 2ECBA 4M3DA 1DU6A 1PUFB 1YRNB 3K7AJ 2LK2A 4M3EA 2FQ4A 1P7JA 2GBYA 1GDTA 5IYBJ 5IP9J 5J1YA 4ABZA 2NOGA 2Y30A 5C4JJ 2XPVA 2DA7A 3G1MA 2JN6A 2DA3A 3HOXJ 5EZHA 1LFBA 4B4CA 1OCTC 3JRHA 5IPAA 1IGNA 3K2AA 1MBJA 1MSEC 2JJ7A 1Q1VA 2X48A 3BT9A 4UUSB 4BY1J 3HOUJ 5IOYA 1U9NA 4A3FJ 1HF0A 4IHWA 1ENHA 2Y9ZA 2E2IJ 4BKXA 5BNGA 5EG0B 2Y31A 3ZQGA 3L1PA 1BA5A 3H3VK 2K9NA 3UKGA 3GTGJ 4D7MA 3VPRA 3FKIJ 3HB9A 5EGOA 3BQYA 2NVTJ 1MBEA 1I6HJ 2M9HA 3Q0VA 5E3MA 2W48A 1WGXA 3JRBA 3ZQFA 1DU0A 1XG1A 2WAQN 2DJNA 2CUEA 5C3EJ 3BG3A 2ECCA 5FKMA 5M5YJ 1ZGWA 3ZQIA 2E1OA 4IHYA 3BR2A 3GBGA 4CYCA 5M5WJ 5E3OA 5FJ8J 1NTCA 2XGCA 2VKVA 1RR7A 3B6CA 5IP7J 1ZK8A 1W0UA 1BJZA 2DA1A 1ETKA 1B72B 1T33A 1Z77A 2XGDA 3GTMJ 4A3IJ 1BW5A 3IH4A 3LNQA 3HKZN 2LTPA 2L7ZA 1IC8A 2MG4A 1A5JA 1U9OA 3JRGA 4DW6A 2M2EA 3NARA 1SFOJ 2HQ5A 3GTJJ 4BY7J 1F43A 3H0GJ 3MVPA 3S2DJ 5F08A 1H89C 4J19A 5J1UA 1AU7A 4MIMA 4RDUA 1GT0C 1WH5A 1Y1VJ 3BR0A 1CQTA 2M0CA 1JKRC 3S17J 3F0CA 2R5ZA 3HGGA 4FE7A 2LKXA 3ZQCA 1MBGA 3BTJA 4BBSJ 2VPRA 4M3BA 4QSHA 3HOVJ 2ZB9A 2QCOA 2EQRA 2R0QC 4X6AJ 3S1NJ 4BBRJ 1JT6A 2XRLA 2AO9A 1MBKA 1K83J 2FX0A 3HOZJ 2LFBA 1TWGJ 2DMUA 3Q0UA 3M4OJ 2HXIA 4GFBA 3QQAA 1MSFC 5FLVA 3BTLA 1FJLA 1NK3P 1VI0A 1T56A 5EF6A 3NAUA 1IJWC 1B8IB 5EGOB 4D5CA 3LSGA 4B3AA 3A01A 1OCPA 2L9RA 3FISA 4M6VA 4NDLA 1QVUA 5E3NA 2IEKA 1ZQ3P 2DA4A 2E2HJ 3DEWA 1ZR2A 5J3LA 1W0TA 1HLVA 2H1KA 3B6AA 1VF9A 3TP3A 1Y1WJ 2LD5A 1X2MA 3Q0WA 1IRZA 1UG2A 3BR5A 2VUMJ 2XGEA 2CQQA 1AHDP 2LR8A 5F0HA 2HI3A 4CYCB 2FJ1A 4I6ZA 1VFCA 1ETYA 2D5VA 2HOAA 1MBFA 1GV2A 2IAIA 5IP6A 1U78A 1TWCJ 4MFEA 3BR1A 4A3KJ 2G0EA 4D7NA 3OOUA 1OFCX 2XB0X 2M34A 5F27A 4RBOA 2M8GX 3LOCA 1S7EA 1TWAJ 2YS9A 2CQXA 3HOYJ 4QTRA 3S1QJ 1ZKGA 2CRGA 1RESA 4BXXJ 1AKHB 3WHBA 3TP0A 1IG7A 1FTZA 3JRIA 3JRAA 3LSRA 3G1OA 4MFDA 2K9SA 5J1RA 1ETOA 2CJJA 3CCYA 2JA5J 3SJMA 1ITYA 4D5FA 4QIWN 4A3MJ 1A6IA 4UUTA 1YRNA 4FISA 2ID3A 2DMTA 4JX4A 2R5ZB 1UMQA 3SFIA 5DS9A 2DMQA 2L0KA 5F1JA 4JX5A 1FIAA 3HEFA 4A3EJ 1RPWA 1APLC 3RZOJ 1D5YA 4DYCA 2TRTA 4IHVA 1TWHJ 2NVYJ 3FIWA 4A3CJ 2YUSA 2DTZA 2ME0A 1E3OC 1WCMJ 1WI3A 4G12A 4XRSG 4A3JJ 5GP9A 2X9DA 2R92J 3HGYA 1VNDA 5M3MJ 1H88C 4FCYA 2NS7A 5DTDA 2VKEA 4UUSA 4JP0A 5FKOA 4A93J 3FK7A 3GTQJ 2OF7A 2H8RA 5HODA 5EG0A 3TW7A 2EBIA 2EH3A 3QPLA 1JUPA 1JJ8C 2TCTA 5FKKA 2E2JJ 1IDZA 2HYJA 4IHXA 1NK2P 3BQZA 4X1EA 4AYBN 5GPAA 3ZQHA 3RKQA 2HXOA 2MW8A 5EYRA 5M5XJ 4LOCA 3IV5A 1XS9A 2MSYA 1IDYA 5EEAA 2NVXJ 2LP0A 4AUXA 1RETA 4C3IJ 3BR6A 3SDGA 3S1RJ 2WV1A 1ETQA 4C2MJ 3DCFA 3BG9A 2DMPA 4DZPA 2HOTA 2KDZA 4XK4A 2ME6A 5JLWA 5M3FJ 2E19A 4MLOA 3GTPJ 1IV6A 1QRYA 3PO2J 2DA5A 1ETVA 3ZQLA 3MN2A 1I3QJ 4W97A 4L5EA 1JJ6C 5C4XJ 3BR3A 3RZDJ 2PMZN 1JT0A 2OPTA 3C2BA 3TEDA 4B1RA 3JREA 2HDDA 3I4NJ 3BG5A 4JYKA 1HCRA 4Y7NJ 4JX6A 3ZOBA 2R93J 2AHQA 1GVDA 4A3GJ 2N8GA 5K7ZA 2EZHA 1F36A 3A03A 3BTIA 3CQZJ 4A3BJ 1HOMA 5IYDJ 3IH3A 2R7ZJ 3QPSA 1ETWA 1O4XA 1JKQC 3S14J 3D1NI 1K61A 1LE8A 5FLMJ 2Y0SN 2COBA 2R5YA 2IBDA 2VI6A 2LVSA 3JR9A 4I76A 2RAEA 1JKPC 4XRSA 4A69C 2I10A 1U8BA 3JRFA 1UHSA 1JKOC 3JRCA 3HOWJ 2NVQJ 4IEJA 3A02A 5GPCA 1R9TJ 1WH7A 5FKNA 2X6OA 3LSJA 5C44J 1P7IA 3GTLJ 1IUFA 2JK3A 4FE4A 4HNVA 1PUFA 3S1MJ 3G1LA 1FTTA 1B8IA 1RKWA 4W1UA 3WHCA 2K9QA 1ORKA 1POGA 3E7LA 3RQIA 2XSDC 4XICA 5F0FA 1EF4A 3HBLA 4A3LJ 4AC0A 3W6VA 4M3FA 1I50J 5F04A 3LSPA 1G2HA 1WPKA 5EDNA 1Z0XA 3PO3J 3S2HJ 4C3HJ 1GV5A 5IYCJ 1JGGA 3CDLA 4DZJA 5FKLA 2DMNA 2O9LA 3I4MJ 1JTYA 4DYRA 3GTOJ 1TWFJ 1XC5A 2ID6A 2LY9A 2XPUA 2Y2ZA 2EZIA 2EZLA 1ZR4A 3GTKJ 4V2FA 5E3LA 3CMYA 1MH3A 2B63J 1JTXA 2QF7A 4V2GA 4XIDA 3A01B 3BTCA 3FK6A 3OIOA 1ETXA 5IOZA 3IH2A 2WB1N 1MNMC 2DN0A 2JWTA 1MBHA 4Y52J 3OSGA 3S15J 1H8AC 1JUSA 9ANTA 1AKHA 2XPWA 1QPIA 1SANA 2JA7J 1FIPA 2DA2A 2JMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2N A;  1GUU A;  2L7F P;  1HDD C;  4S0H B;  4MO7 A;  1TC3 C;  4FTH A;  3M3Y J;  1BW6 A;  2EZK A;  1RKT A;  4DYQ A;  2HOS A;  2GLO A;  1FEX A;  3HM5 A;  1LE8 B;  2O7O A;  2GM4 A;  1OJL A;  2JA8 J;  5JLX A;  4EEF G;  5EZG A;  2Y9Y A;  2R5Y B;  1BL0 A;  2P81 A;  5K7F A;  5K7H A;  3O8G A;  3Q3S A;  2O8K A;  2L7M P;  1X58 A;  3OSF A;  3O8H A;  5F0C A;  2LLK A;  2YU9 J;  3PM1 A;  1B72 A;  2KT0 A;  1HDP A;  2CUF A;  3MKL A;  3JRD A;  4XRM A;  3S16 J;  2MGQ A;  2JA6 J;  2DA6 A;  4A3D J;  4M3G A;  1LFU P;  2NS8 A;  1MH4 A;  2FD5 A;  1ZTR A;  2CU7 A;  1QVT A;  2K40 A;  1JUM A;  3TW6 A;  2ELK A;  4C3J J;  2XB5 A;  3HDD A;  2ECB A;  4M3D A;  1DU6 A;  1PUF B;  1YRN B;  3K7A J;  2LK2 A;  4M3E A;  2FQ4 A;  1P7J A;  2GBY A;  1GDT A;  5IYB J;  5IP9 J;  5J1Y A;  4ABZ A;  2NOG A;  2Y30 A;  5C4J J;  2XPV A;  2DA7 A;  3G1M A;  2JN6 A;  2DA3 A;  3HOX J;  5EZH A;  1LFB A;  4B4C A;  1OCT C;  3JRH A;  5IPA A;  1IGN A;  3K2A A;  1MBJ A;  1MSE C;  2JJ7 A;  1Q1V A;  2X48 A;  3BT9 A;  4UUS B;  4BY1 J;  3HOU J;  5IOY A;  1U9N A;  4A3F J;  1HF0 A;  4IHW A;  1ENH A;  2Y9Z A;  2E2I J;  4BKX A;  5BNG A;  5EG0 B;  2Y31 A;  3ZQG A;  3L1P A;  1BA5 A;  3H3V K;  2K9N A;  3UKG A;  3GTG J;  4D7M A;  3VPR A;  3FKI J;  3HB9 A;  5EGO A;  3BQY A;  2NVT J;  1MBE A;  1I6H J;  2M9H A;  3Q0V A;  5E3M A;  2W48 A;  1WGX A;  3JRB A;  3ZQF A;  1DU0 A;  1XG1 A;  2WAQ N;  2DJN A;  2CUE A;  5C3E J;  3BG3 A;  2ECC A;  5FKM A;  5M5Y J;  1ZGW A;  3ZQI A;  2E1O A;  4IHY A;  3BR2 A;  3GBG A;  4CYC A;  5M5W J;  5E3O A;  5FJ8 J;  1NTC A;  2XGC A;  2VKV A;  1RR7 A;  3B6C A;  5IP7 J;  1ZK8 A;  1W0U A;  1BJZ A;  2DA1 A;  1ETK A;  1B72 B;  1T33 A;  1Z77 A;  2XGD A;  3GTM J;  4A3I J;  1BW5 A;  3IH4 A;  3LNQ A;  3HKZ N;  2LTP A;  2L7Z A;  1IC8 A;  2MG4 A;  1A5J A;  1U9O A;  3JRG A;  4DW6 A;  2M2E A;  3NAR A;  1SFO J;  2HQ5 A;  3GTJ J;  4BY7 J;  1F43 A;  3H0G J;  3MVP A;  3S2D J;  5F08 A;  1H89 C;  4J19 A;  5J1U A;  1AU7 A;  4MIM A;  4RDU A;  1GT0 C;  1WH5 A;  1Y1V J;  3BR0 A;  1CQT A;  2M0C A;  1JKR C;  3S17 J;  3F0C A;  2R5Z A;  3HGG A;  4FE7 A;  2LKX A;  3ZQC A;  1MBG A;  3BTJ A;  4BBS J;  2VPR A;  4M3B A;  4QSH A;  3HOV J;  2ZB9 A;  2QCO A;  2EQR A;  2R0Q C;  4X6A J;  3S1N J;  4BBR J;  1JT6 A;  2XRL A;  2AO9 A;  1MBK A;  1K83 J;  2FX0 A;  3HOZ J;  2LFB A;  1TWG J;  2DMU A;  3Q0U A;  3M4O J;  2HXI A;  4GFB A;  3QQA A;  1MSF C;  5FLV A;  3BTL A;  1FJL A;  1NK3 P;  1VI0 A;  1T56 A;  5EF6 A;  3NAU A;  1IJW C;  1B8I B;  5EGO B;  4D5C A;  3LSG A;  4B3A A;  3A01 A;  1OCP A;  2L9R A;  3FIS A;  4M6V A;  4NDL A;  1QVU A;  5E3N A;  2IEK A;  1ZQ3 P;  2DA4 A;  2E2H J;  3DEW A;  1ZR2 A;  5J3L A;  1W0T A;  1HLV A;  2H1K A;  3B6A A;  1VF9 A;  3TP3 A;  1Y1W J;  2LD5 A;  1X2M A;  3Q0W A;  1IRZ A;  1UG2 A;  3BR5 A;  2VUM J;  2XGE A;  2CQQ A;  1AHD P;  2LR8 A;  5F0H A;  2HI3 A;  4CYC B;  2FJ1 A;  4I6Z A;  1VFC A;  1ETY A;  2D5V A;  2HOA A;  1MBF A;  1GV2 A;  2IAI A;  5IP6 A;  1U78 A;  1TWC J;  4MFE A;  3BR1 A;  4A3K J;  2G0E A;  4D7N A;  3OOU A;  1OFC X;  2XB0 X;  2M34 A;  5F27 A;  4RBO A;  2M8G X;  3LOC A;  1S7E A;  1TWA J;  2YS9 A;  2CQX A;  3HOY J;  4QTR A;  3S1Q J;  1ZKG A;  2CRG A;  1RES A;  4BXX J;  1AKH B;  3WHB A;  3TP0 A;  1IG7 A;  1FTZ A;  3JRI A;  3JRA A;  3LSR A;  3G1O A;  4MFD A;  2K9S A;  5J1R A;  1ETO A;  2CJJ A;  3CCY A;  2JA5 J;  3SJM A;  1ITY A;  4D5F A;  4QIW N;  4A3M J;  1A6I A;  4UUT A;  1YRN A;  4FIS A;  2ID3 A;  2DMT A;  4JX4 A;  2R5Z B;  1UMQ A;  3SFI A;  5DS9 A;  2DMQ A;  2L0K A;  5F1J A;  4JX5 A;  1FIA A;  3HEF A;  4A3E J;  1RPW A;  1APL C;  3RZO J;  1D5Y A;  4DYC A;  2TRT A;  4IHV A;  1TWH J;  2NVY J;  3FIW A;  4A3C J;  2YUS A;  2DTZ A;  2ME0 A;  1E3O C;  1WCM J;  1WI3 A;  4G12 A;  4XRS G;  4A3J J;  5GP9 A;  2X9D A;  2R92 J;  3HGY A;  1VND A;  5M3M J;  1H88 C;  4FCY A;  2NS7 A;  5DTD A;  2VKE A;  4UUS A;  4JP0 A;  5FKO A;  4A93 J;  3FK7 A;  3GTQ J;  2OF7 A;  2H8R A;  5HOD A;  5EG0 A;  3TW7 A;  2EBI A;  2EH3 A;  3QPL A;  1JUP A;  1JJ8 C;  2TCT A;  5FKK A;  2E2J J;  1IDZ A;  2HYJ A;  4IHX A;  1NK2 P;  3BQZ A;  4X1E A;  4AYB N;  5GPA A;  3ZQH A;  3RKQ A;  2HXO A;  2MW8 A;  5EYR A;  5M5X J;  4LOC A;  3IV5 A;  1XS9 A;  2MSY A;  1IDY A;  5EEA A;  2NVX J;  2LP0 A;  4AUX A;  1RET A;  4C3I J;  3BR6 A;  3SDG A;  3S1R J;  2WV1 A;  1ETQ A;  4C2M J;  3DCF A;  3BG9 A;  2DMP A;  4DZP A;  2HOT A;  2KDZ A;  4XK4 A;  2ME6 A;  5JLW A;  5M3F J;  2E19 A;  4MLO A;  3GTP J;  1IV6 A;  1QRY A;  3PO2 J;  2DA5 A;  1ETV A;  3ZQL A;  3MN2 A;  1I3Q J;  4W97 A;  4L5E A;  1JJ6 C;  5C4X J;  3BR3 A;  3RZD J;  2PMZ N;  1JT0 A;  2OPT A;  3C2B A;  3TED A;  4B1R A;  3JRE A;  2HDD A;  3I4N J;  3BG5 A;  4JYK A;  1HCR A;  4Y7N J;  4JX6 A;  3ZOB A;  2R93 J;  2AHQ A;  1GVD A;  4A3G J;  2N8G A;  5K7Z A;  2EZH A;  1F36 A;  3A03 A;  3BTI A;  3CQZ J;  4A3B J;  1HOM A;  5IYD J;  3IH3 A;  2R7Z J;  3QPS A;  1ETW A;  1O4X A;  1JKQ C;  3S14 J;  3D1N I;  1K61 A;  1LE8 A;  5FLM J;  2Y0S N;  2COB A;  2R5Y A;  2IBD A;  2VI6 A;  2LVS A;  3JR9 A;  4I76 A;  2RAE A;  1JKP C;  4XRS A;  4A69 C;  2I10 A;  1U8B A;  3JRF A;  1UHS A;  1JKO C;  3JRC A;  3HOW J;  2NVQ J;  4IEJ A;  3A02 A;  5GPC A;  1R9T J;  1WH7 A;  5FKN A;  2X6O A;  3LSJ A;  5C44 J;  1P7I A;  3GTL J;  1IUF A;  2JK3 A;  4FE4 A;  4HNV A;  1PUF A;  3S1M J;  3G1L A;  1FTT A;  1B8I A;  1RKW A;  4W1U A;  3WHC A;  2K9Q A;  1ORK A;  1POG A;  3E7L A;  3RQI A;  2XSD C;  4XIC A;  5F0F A;  1EF4 A;  3HBL A;  4A3L J;  4AC0 A;  3W6V A;  4M3F A;  1I50 J;  5F04 A;  3LSP A;  1G2H A;  1WPK A;  5EDN A;  1Z0X A;  3PO3 J;  3S2H J;  4C3H J;  1GV5 A;  5IYC J;  1JGG A;  3CDL A;  4DZJ A;  5FKL A;  2DMN A;  2O9L A;  3I4M J;  1JTY A;  4DYR A;  3GTO J;  1TWF J;  1XC5 A;  2ID6 A;  2LY9 A;  2XPU A;  2Y2Z A;  2EZI A;  2EZL A;  1ZR4 A;  3GTK J;  4V2F A;  5E3L A;  3CMY A;  1MH3 A;  2B63 J;  1JTX A;  2QF7 A;  4V2G A;  4XID A;  3A01 B;  3BTC A;  3FK6 A;  3OIO A;  1ETX A;  5IOZ A;  3IH2 A;  2WB1 N;  1MNM C;  2DN0 A;  2JWT A;  1MBH A;  4Y52 J;  3OSG A;  3S15 J;  1H8A C;  1JUS A;  9ANT A;  1AKH A;  2XPW A;  1QPI A;  1SAN A;  2JA7 J;  1FIP A;  2DA2 A;  2JMW A; 
#chains in the Genus database with same CATH topology
 2XGX A;  4XLP F;  4GGG A;  1D8J A;  1GUU A;  2TDX A;  3T0Y A;  3ZCO A;  2LC2 A;  2UWM A;  2QYO A;  3MMY B;  2HR3 A;  4ETS A;  4BNC A;  3OOP A;  1BW6 A;  5HS7 A;  2XV4 S;  4HDU A;  1D3Y A;  1RKT A;  2P7V B;  1LEB A;  1IUY A;  5B3S H;  5E8I A;  3PQJ A;  4DIQ A;  3FHZ A;  5EJC A;  5BPI A;  1ZN2 A;  2GM4 A;  1OJL A;  1FY7 A;  3EYY A;  4CYD A;  1N25 A;  2P81 A;  4F7Z A;  5K7H A;  3C2H A;  2O8K A;  2L7M P;  1X58 A;  4EMS A;  3CCL I;  3O8H A;  3ERE D;  2LG4 A;  1BI0 A;  3PM1 A;  2H6C A;  2DPU A;  1LFP A;  2E1M B;  2ELH A;  4F93 B;  2JA6 J;  2DA6 A;  1LFU P;  3ABM H;  2EIN H;  1ZTR A;  2K40 A;  1S3J A;  1K4S A;  4HRI A;  5ERI A;  3TW6 A;  2ELK A;  3HDD A;  4BEH B;  2KZV A;  1U8R A;  1YRN B;  2L7K A;  3K7A J;  4EM2 A;  4M3E A;  3P9I A;  1RRJ A;  2FQ4 A;  2GBY A;  3QU3 A;  4M71 A;  1TTY A;  3C18 A;  4ABZ A;  2BY3 A;  2OU2 A;  5LEJ A;  3MFK A;  1KU3 A;  1MIJ A;  2NOG A;  2CMP A;  3GTL J;  2XPV A;  3E0J B;  1R7J A;  2ZJR F;  3G1M A;  3C2G A;  2OZU A;  1IN6 A;  2RQP A;  2CQ7 A;  2ZXI A;  3I3L A;  5EZH A;  3HRU A;  5HNH A;  4B4C A;  4PJN A;  3JRH A;  4ENN A;  3ERM A;  3VSL A;  3J81 K;  4TV7 A;  4EJW A;  1FBQ A;  1MBJ A;  4CCO A;  2IP2 A;  2HEO A;  1Q1V A;  2X48 A;  3BT9 A;  4N4O B;  4YEJ A;  4M6X A;  4BHC A;  5JHU A;  2F5D A;  4RGS A;  3U1K A;  2RKH A;  2W85 A;  3HOU J;  1BIB A;  4A3F J;  4UNO A;  5LRR A;  2KPM A;  1O57 A;  2E2I J;  4KT6 A;  3QU6 A;  1XD7 A;  3WE3 A;  2K9N A;  4F3Q A;  4D7M A;  1VQK I;  3A0H C;  3FKI J;  1K79 A;  5J8C A;  3AL0 C;  1KU9 A;  3HB9 A;  5EGO A;  3OYG A;  4UVB A;  4B47 A;  1BR4 A;  2M9H A;  3GXO A;  3Q0V A;  5JVG F;  1R4M B;  1WGX A;  3JRB A;  3ZQF A;  2Y0M A;  3A1Y A;  4YIF A;  5FFZ A;  2DJI A;  2ZFU A;  4CIC A;  2EWN A;  2EIJ H;  3LFK A;  3PFI A;  3M8F A;  2ECC A;  4GCV A;  4FX0 A;  4NQW A;  2GZW A;  1HSJ A;  5CJ9 A;  1Z9C A;  5ICC A;  4HAM A;  1BR2 A;  4WXD A;  1VQ9 I;  1T38 A;  2XAH A;  2QQA A;  1H9G A;  5HDK A;  2HKO A;  2NYX A;  5IP7 J;  4HPQ A;  2FRH A;  1W0U A;  4MEX F;  1YYV A;  1MW7 A;  2DA1 A;  4LG3 A;  1E0E A;  2IVM A;  4IRH A;  3TDZ C;  3WTY C;  1FPQ A;  1T33 A;  5LHI A;  4A3I J;  1BW5 A;  3IH4 A;  3HKZ N;  1DPR A;  3W6J B;  5AIQ A;  2A6T A;  3AG4 H;  4KN7 X;  3FBI B;  4BQN A;  1BOA A;  1U9O A;  3JRG A;  1A5J A;  3DKY A;  1VQO I;  3QYE A;  3NAR A;  1STZ A;  3ULQ B;  2R7R A;  3OIQ A;  3J80 K;  2DW4 A;  3I55 I;  4BY7 J;  2P5K A;  1F43 A;  3OYE A;  3H0G J;  3WU1 B;  2GXG A;  3MQ0 A;  1PYV A;  3OYF A;  3LA3 A;  2IGN A;  4MQ9 F;  5J1U A;  3J7A O;  4HF2 A;  2ZME A;  1IN7 A;  1GT0 C;  1Y1V J;  1CQT A;  4HDV A;  2M0C A;  3E6D A;  3N05 A;  4HW0 A;  2IGM A;  2EJR A;  4BL0 B;  3I64 A;  2R5Z A;  4FE7 A;  2LKX A;  1SFX A;  1FC3 A;  3ZQC A;  3FWE A;  1PVE A;  3H1C A;  4M3B A;  4QSH A;  1JHF A;  1T95 A;  2EQR A;  2F5V A;  2QCO A;  2R0Q C;  4BBR J;  3EUA A;  2Z33 A;  1TW2 A;  1JXS A;  3GW2 A;  1K83 J;  2XAU A;  3HOZ J;  1TWG J;  2DMU A;  3Q0U A;  3M4O J;  3K4L A;  4DGW B;  1H0M A;  2WTE A;  2HXI A;  4XRF A;  4GFB A;  3IAM 2;  1MSF C;  1ZG3 A;  2HVQ A;  1FJL A;  4OU0 A;  3I0T A;  1S6L A;  3LAP A;  5EGO B;  3KX2 A;  1OCP A;  3MCZ A;  4KDP A;  4Q5S F;  1UB9 A;  2L9R A;  5L3E A;  4M6V A;  4PFO A;  5BQT A;  2NNN A;  1ZG5 A;  2DOD A;  2W1O A;  5E3N A;  1M1E B;  2IEK A;  3I58 A;  3K6G A;  2L3D A;  2X1E A;  4YRV A;  3DEW A;  1I39 A;  3S93 A;  1ZR2 A;  1HLV A;  2KZG A;  2DFH A;  4NQW B;  1VF9 A;  1Y1W J;  2LD5 A;  1ULY A;  1X2M A;  4BJ5 C;  2PG4 A;  2Z2S B;  1P2F A;  2HU9 A;  1ETY A;  3RCO A;  4DOZ A;  2E1C A;  5DV5 A;  4AIH A;  2ZO4 A;  1U78 A;  3PSI A;  4HQM A;  4MFE A;  2CW8 A;  5J4Y A;  3F72 A;  2ZJQ F;  1AWC A;  1IN8 A;  1X1A A;  4D7N A;  3BPV A;  4YIR X;  2XIG A;  4GXO A;  4XOT A;  2M34 A;  5F27 A;  4RBO A;  1S7E A;  5J47 A;  4XN0 A;  4KIF A;  3DP7 A;  3M8E A;  1WJD A;  1AKH B;  5D8K B;  3TP0 A;  2M30 A;  3JRI A;  2A6H F;  3HSE A;  4DQ2 A;  4OAZ A;  2K9S A;  3R61 A;  3CF5 F;  3FMQ A;  5CVU A;  2BY1 A;  1Z91 A;  4RGU A;  1ZRE A;  3FF5 A;  2DAO A;  2NOJ B;  3OL3 A;  4A3M J;  1SFU A;  4UHT A;  2EV5 A;  4HV5 A;  4LIV A;  3ZRG A;  2L9N A;  4JX4 A;  2R5Z B;  1FX7 A;  3CF2 A;  1UMQ A;  3KP4 A;  4Y13 A;  5EEH A;  4FAS D;  2ZC2 A;  3SFI A;  1BI1 A;  3WTU C;  2DMQ A;  3CLQ A;  4HV6 A;  4G7Z F;  2MLG A;  3U9G A;  4A0X A;  2UV1 A;  5E79 C;  1ZG1 A;  2W82 A;  1Z3X A;  1FIA A;  1J0R A;  2BEO A;  4LJZ F;  2STW A;  4A3E J;  2QSH X;  1JI8 A;  1RPW A;  3RZO J;  4DYC A;  1NH3 A;  3ZXS A;  3CCQ I;  1TWH J;  2NVY J;  3DQV C;  2DTZ A;  1L0O C;  3KLO A;  2E1N A;  4GO1 A;  4YFN F;  3I59 A;  5GP9 A;  1LDJ A;  3E1S A;  4AIK A;  3CC2 I;  3HGY A;  1VND A;  1H88 C;  4FCY A;  1YHQ I;  1WFX A;  1WZ2 A;  2DOE A;  1J2X A;  1TW3 A;  3EUH A;  2NNY A;  2L4M A;  3S3M A;  4A93 J;  4NC7 A;  3REO A;  2OF7 A;  3D5L A;  2H8R A;  4LMY A;  2KHM A;  3CCS I;  3KP3 A;  1Y8R B;  5D4R A;  2EBI A;  1QZZ A;  2EH3 A;  3QPL A;  3G4S I;  4CGZ A;  4BAY A;  2HDW A;  1RC9 A;  1GVJ A;  3DPL C;  3R0J A;  1A31 A;  2GA2 A;  5H6R A;  4LB5 A;  2XAG A;  5DUI A;  4LD5 A;  3WGI A;  1RNL A;  1BI2 A;  5KK1 A;  1J5Y A;  2IW5 A;  2OTJ I;  4AVP A;  2OAZ A;  4AYB N;  4XL9 A;  5GPA A;  2RC4 A;  3ZQH A;  2MW8 A;  4BUP A;  3IV5 A;  2VQL A;  3ZN0 A;  4AUX A;  4ASN A;  4R79 A;  4OMY A;  2WV1 A;  1W5S A;  1YS7 A;  4OIP F;  2WY7 Q;  2CUZ A;  4LFU A;  2KDZ A;  4IX7 A;  2ME6 A;  3I9V 2;  1E17 A;  4MLO A;  1IXR C;  3ECH A;  1FLI A;  5LGT A;  2DA5 A;  2MYS A;  1B9M A;  3I4P A;  3MN2 A;  3ZQL A;  4BS9 A;  2K4B A;  2LKS A;  4W97 A;  4A2U A;  2O6G E;  4L5E A;  1JJ6 C;  1ZLJ A;  3MZH A;  2X6Y A;  3WG7 H;  1LJ9 A;  2YX7 A;  3LAJ A;  2OTL I;  3C2B A;  3HUG A;  3K4K A;  4M6Y A;  3JRE A;  4PGG A;  2IS4 A;  1R36 A;  3I54 A;  2VB6 A;  3U21 A;  1Z6R A;  3L2V A;  3I4N J;  4JYK A;  1HCR A;  1UG0 A;  5ICG A;  1VQ5 I;  2R93 J;  1OIS A;  3K4M A;  3ZGK A;  3PJR A;  4A3G J;  2N8G A;  5K7Z A;  4M72 A;  3A03 A;  1A36 A;  3BTI A;  4A3B J;  3B02 A;  3F6O A;  5IYD J;  3IH3 A;  1LKX A;  4DNC A;  3VWB A;  2VJ4 A;  3HHG A;  4I0B A;  1K61 A;  2O0Y A;  3QP5 A;  4DBQ A;  2VON A;  2IPQ X;  2Q8K A;  5FLM J;  2EIL H;  2R5Y A;  2G7U A;  3K69 A;  3JR9 A;  5CYV A;  3WTS C;  1BC7 C;  3SHF A;  2RAE A;  4K2E A;  3WU2 C;  3HG9 A;  3FHN A;  3QPH A;  3S32 A;  1UHS A;  2G9W A;  5B66 C;  4CCN A;  1QBJ A;  4GYI A;  5D5V B;  3HOW J;  2OCC H;  3DEE A;  5HLT A;  1T6S A;  4QWQ A;  2QQB A;  5ED4 A;  2BHZ A;  2MC3 A;  2X6O A;  1FOW A;  5JVT A;  5C44 J;  1OYW A;  1S5L C;  4FE4 A;  4M74 A;  4MQV A;  4HNV A;  4MTD A;  1PUF A;  1KYW A;  1BJA A;  2E71 A;  4XSX F;  5FLX Z;  1WI9 A;  1XGS A;  1ORK A;  1POG A;  2ISY A;  3E7L A;  4B8X A;  2RNJ A;  4A3L J;  5H6Q A;  1VZ0 A;  2X6W A;  5GTI C;  1ON2 A;  4IXA A;  4ZTJ A;  5CPR B;  1EH7 A;  1LQ1 A;  5A2Q K;  5EEG A;  2W24 A;  4AU7 A;  3ZMD A;  3PO3 J;  1OQY A;  4HG2 A;  2AQF A;  2QSF X;  3AAF A;  4DZJ A;  5FKL A;  3H0D A;  4WWC A;  2O9L A;  3ZMS A;  2V6C A;  3HRS A;  2KDO A;  2HQR A;  2PJP A;  4XLF A;  2DYS H;  1TWF J;  2LY9 A;  2Y2Z A;  1Y6I A;  2EZL A;  4XQF A;  5KHD A;  1QNT A;  4P5O A;  4V2F A;  1MH3 A;  4XON A;  3RPU A;  2HGC A;  1JTX A;  2E1M C;  1NHA A;  1U6G A;  1KQ8 A;  4EAT A;  1LVK A;  2K7L A;  1UZC A;  2WB1 N;  3M1C A;  4L9J A;  2DN0 A;  1X1P A;  2C6Y A;  2JWT A;  5D6F A;  2FML A;  1MBH A;  4Y52 J;  4RB1 A;  4YII A;  1EH8 A;  3S15 J;  2ZFW A;  3F8C A;  2F4I A;  2PMU A;  2BYV E;  3HUG B;  1TT0 A;  4E7L A;  3CP2 A;  4S04 A;  3BJ6 A;  1WJE A;  1X2N A;  1TP4 A;  3VYS B;  2CG4 A;  4CH7 A;  2L7F P;  4E7Z A;  2GWR A;  2Z1D A;  1HDD C;  1FOK A;  5JHF A;  2H27 A;  1TC3 C;  2LBF A;  5B1A H;  3V7R A;  1SC7 A;  4X0G A;  3DLA A;  5HLG A;  3BP8 A;  3M1E A;  4PJM A;  1YW7 A;  3F8F A;  3I53 A;  1FEX A;  3F8M A;  5DM6 F;  2CSO A;  3KZZ A;  5CVR A;  2R7X A;  3SEZ A;  5JLX A;  4EEF G;  3IRR A;  2A5Y B;  2Y9Y A;  2R5Y B;  3E3V A;  3J7Y J;  3KET A;  1MD0 A;  2BBY A;  3Q3S A;  1OCO H;  2VIX A;  2LLK A;  2YU9 J;  1I6X A;  2CUF A;  3PNV A;  3BJA A;  5FRO A;  1R6R A;  5DCM B;  3NWT A;  3SXY A;  1MNE A;  1G3W A;  4XRM A;  3TOB A;  1FT9 A;  1OYI A;  1R5H A;  4P9U A;  1S7O A;  3S16 J;  4M3G A;  2XAQ A;  1VQP I;  2RV8 A;  3JTH A;  2JSC A;  2ECB A;  1R1T A;  4F55 A;  1PUF B;  1I1S A;  1TZL A;  2FXA A;  2Q0O A;  3JTG A;  1F1Z A;  3GFJ A;  3T1B A;  3WTW C;  5J1Y A;  2GXB A;  3P9K A;  3GZ6 A;  1Z1D A;  1HKT A;  2LSO A;  2VPL A;  3SDB A;  1YIO A;  3DWL E;  3FX3 A;  3KP6 A;  2OA4 A;  2KIM A;  2Q2E A;  3C7J A;  2DA7 A;  4JBA A;  1XGO A;  3JSP A;  3GFL A;  2FBK A;  3R6S A;  3TBI A;  2L54 A;  3BWG A;  3FZV A;  2JN6 A;  2LH9 A;  3W3C A;  3H92 A;  2QSG X;  2ZSI B;  3EDP A;  2WA0 A;  5IPA A;  2UZK A;  4KUM A;  4RB0 A;  1W5T A;  2L02 A;  3BZK A;  4UUS B;  2JUC A;  4UVC A;  3T8R A;  4BY1 J;  2X51 A;  3J81 Z;  5IT9 K;  2PEX A;  2V1X A;  3E5X A;  1ENH A;  2WC2 A;  4BKX A;  5LGU A;  2VLA A;  1ZAR A;  2J5P A;  2M4G A;  1YX5 A;  2F48 A;  1OCC H;  2F4M B;  4N9I A;  3FDY A;  4AM3 A;  2F4O B;  2EPF A;  2NVT J;  4B3X A;  3QWL A;  1MBE A;  1IN5 A;  1W7P A;  2IRF G;  2P7C B;  4IRI A;  1I6H J;  3CJN A;  5E1X A;  2W48 A;  3BRO A;  4C2T A;  4DBR A;  4BQQ A;  3F23 A;  2WAQ N;  2DJN A;  2CUE A;  2DLL A;  2RN7 A;  1P9Q C;  3ABU A;  5FRM A;  1U5T A;  3F8B A;  2W4S A;  5HVQ C;  3MKW B;  5LLQ A;  3S3N A;  1XGM A;  3K70 D;  2GA1 A;  4IHY A;  1T98 A;  4CYC A;  5HLI A;  4ZYA A;  1RR8 C;  1VQ7 I;  1K6Y A;  3BG7 A;  2H1L A;  4P1W A;  4P96 A;  5H2F C;  2P6S A;  1ZK8 A;  2EFO A;  1BJZ A;  4XKW A;  4CZC A;  4Y33 A;  2PN6 A;  2IXS A;  5AIP A;  3L2W A;  3LNQ A;  3V7S A;  3QOD A;  2L7Z A;  3OYL A;  2L2O A;  4XN3 A;  1FP1 D;  2MG4 A;  3RPU D;  4N4N B;  1HW5 A;  3KEQ A;  4DW6 A;  1SD7 A;  3OYK A;  3G73 A;  5AON A;  2HQ5 A;  1SVM A;  3GTJ J;  2UUZ A;  1MZB A;  3H5N A;  1QA6 A;  3S2D J;  1ZHF A;  3J80 Z;  4J19 A;  4XLH A;  2CQN A;  1G8X A;  3O6B B;  3V8J A;  3OYH A;  4RDU A;  4G7H F;  2GXA A;  3QYB A;  1B4A A;  2PBI A;  1JKR C;  1SVL A;  1FSE A;  3GEZ A;  1MBG A;  2VPR A;  3EET A;  1BR1 A;  3NQO A;  1Z6T A;  2P5V A;  2KQR A;  4XBF A;  2KRH A;  2H6B A;  3BZ6 A;  1JT6 A;  4EVI A;  5GAG J;  1MBK A;  3QRF F;  1YS6 A;  4LLG F;  1XX5 A;  2QLZ A;  3GZN B;  4BDZ A;  4IF4 A;  4L9V A;  4WCG A;  2M8E A;  4XKB A;  4R1H A;  3BTL A;  3EPZ A;  1O3R A;  1HW1 A;  2OZ6 A;  5F6F A;  1YW9 A;  1NK3 P;  1WQ2 A;  1T56 A;  2KP6 A;  3CJR B;  3O3K A;  4I98 B;  2J5O A;  3NAU A;  1IJW C;  1B8I B;  1Y56 A;  2VC0 A;  1PUE E;  4B3A A;  1O7F A;  1W7P B;  4EV0 A;  3LSM A;  3DKW A;  4NDL A;  1QGP A;  3N4M A;  1QVU A;  2BVL A;  2GIV A;  1U5T B;  1I1G A;  4IOA F;  3EUK L;  3B6A A;  2Y0S A;  3TQN A;  3BR5 A;  1DP7 P;  5F0H A;  4CYC B;  1R5G A;  2FJ1 A;  4PGH A;  4PJJ A;  2ZNY A;  2HOA A;  1GV2 A;  4EJV A;  1MDM A;  4CO8 A;  2RQQ A;  2ICW G;  3DTI A;  1TWC J;  4YG2 F;  3IKV A;  3W2V A;  2OJE D;  3QPT A;  4FHT A;  4WK8 F;  5FGM A;  2G0E A;  5HNF A;  2V1U A;  4BE0 A;  1TQM A;  1WJ5 A;  4RS8 A;  2HZT A;  1CF7 A;  1N75 A;  2M8G X;  2EK5 A;  1TWA J;  3HOY J;  3CCJ I;  3QYF A;  4RLF A;  2CRG A;  1RES A;  1E3P A;  2F2E A;  4HX8 A;  2XF6 A;  2WWY A;  4EGY A;  3H3U A;  5J6X A;  2VQH A;  4P9F A;  4MFD A;  5TIS C;  4G8X A;  4EGZ A;  5J1R A;  1U0J A;  1XCB A;  3CP8 A;  3CCY A;  4N9H A;  2KJC A;  2MH9 A;  2A61 A;  1VQ6 I;  2JA5 J;  3VOE A;  3SJM A;  5LHG A;  1QPM A;  2HYF A;  1R4N B;  1W7P D;  4D5F A;  3ASN H;  5CKT A;  1EKE A;  2LMD A;  2DMT A;  1XGN A;  5D5W B;  2HQA A;  1KU7 A;  5DS9 A;  3FXO A;  5TJJ A;  3V8L A;  4HLX A;  3CCU I;  2W7N A;  2QZ8 A;  4LIT A;  1Y39 A;  1FWZ A;  3GUD A;  2VT2 A;  4RB3 C;  1SAX A;  1APL C;  1UAA A;  4MHG A;  4E7I A;  3HYI A;  4A3C J;  3Q9S A;  2ME0 A;  1YTY A;  1E3O C;  1EV7 A;  3IP4 B;  3RQ4 A;  4A3J J;  2EIM H;  4ZJZ A;  3BJO A;  3LSI A;  2K85 A;  5DTD A;  3CME I;  3CDH A;  3MEX A;  2M7A A;  4L5I A;  1IRF A;  1K4T A;  2P4W A;  2VQG A;  3GTQ J;  5L3G A;  5HOD A;  3OR2 C;  5E18 F;  3K10 A;  2DBB A;  5EG0 A;  2PFB A;  2K5C A;  1WRJ A;  4A5N A;  2E2J J;  3GZ5 A;  1YLF A;  2X85 A;  3ELK A;  1R71 A;  4XR6 A;  3T5X A;  1NK2 P;  3Q5F A;  2NRA C;  3C3W A;  3IL2 A;  5H20 A;  4X1E A;  3LL7 A;  3KLN A;  3H36 A;  3PQK A;  5BS6 A;  1IRX A;  3OMY A;  3B73 A;  2VBW A;  1XS9 A;  3CJQ B;  1MDM B;  1IDY A;  2VBX A;  1XTA A;  4HYE A;  4WX9 A;  2P6T A;  2QBY A;  2NVX J;  2LP0 A;  2D1V A;  4CDG A;  5K5O A;  4XKV A;  3HJE A;  3QOP A;  4RAY A;  3SDG A;  4MTE A;  2ZJP F;  2OD5 A;  4QPO A;  1PP8 F;  3BG9 A;  3ABT A;  2CO5 A;  1CF7 B;  5K5R A;  3ABK H;  5J4V A;  5M3F J;  1T39 A;  2E19 A;  4G6T B;  2BZT A;  3KYL A;  2PJR A;  3EUH C;  1B6A A;  3KPH A;  3E5Q A;  1U2W A;  1ETV A;  5HDN A;  2VJJ A;  1RI7 A;  4ESB A;  4IQ4 A;  3G2B A;  5C4X J;  2RGV A;  2XAF A;  3BR3 A;  4AID A;  3DBR B;  5GAD J;  1X1D A;  1JT0 A;  4I02 A;  3TO6 A;  4MGR A;  5GTH C;  3TED A;  1WJB A;  3OWT A;  3ZR8 X;  3ZP5 A;  3OYI A;  3F6V A;  1R1U A;  5KCM A;  3DU5 A;  1YIT I;  4G7O F;  3ZMU A;  2IA0 A;  2IGO A;  3KZI C;  2R7F A;  4PCQ A;  3K2Z A;  3FXJ A;  1MMS A;  1HOM A;  2MD0 A;  4PK4 A;  3FM5 A;  4UVA A;  3S14 J;  1LE8 A;  2IJL A;  3L9F A;  2COB A;  1T0F C;  4EM1 A;  2VI6 A;  3DKX A;  4KJZ A;  2EV0 A;  3AG2 H;  2WV0 A;  1A6Q A;  1MMN A;  3MD2 A;  3F21 A;  3N97 A;  2CV1 A;  3PNY A;  4NNJ A;  3JRF A;  1O3Q A;  5TGT A;  1JKO C;  4PJ0 C;  4L18 B;  4Y3O A;  5J8F A;  2M45 A;  4IL6 C;  2BGC A;  4D9J A;  4E7H A;  5CVJ A;  1WSU A;  5B5E C;  4I7H A;  5ICF A;  5GPC A;  4KN4 X;  2MBF A;  2R7T A;  4H0E A;  4EJT A;  5FKN A;  2ZME B;  2CW7 A;  4HNU A;  2Z5U A;  1IUF A;  2JK3 A;  3G1L A;  1KU2 A;  4L9T A;  3HPG A;  2E5Z A;  4N0B A;  4OIN F;  3Q9V A;  1ZGJ A;  1FYL A;  3KP2 A;  3RQI A;  1ON1 A;  3SQN A;  4F52 A;  4XIC A;  1DDN A;  5HDG A;  2JPC A;  4F92 B;  4BE1 A;  4CHU A;  3KP7 A;  3CC7 I;  1I50 J;  3LSP A;  1TQI A;  1P4W A;  1WPK A;  5HLH A;  2STT A;  1VQN I;  3QOE A;  3S2H J;  2QBY B;  4C3H J;  3HKZ A;  5L3C A;  3CDL A;  1JGG A;  2XRN A;  1I27 A;  1KQ0 A;  2R3S A;  2A68 F;  3L09 A;  2CFO A;  4R8H A;  5A2Q Z;  4DYR A;  3GTO J;  3DFG A;  1XC5 A;  2ID6 A;  1ZR4 A;  3GTK J;  1MMG A;  2XHK A;  3RDI A;  4UY8 I;  5L3D A;  2QF7 A;  3BTC A;  5DDG A;  1T8I A;  2PJR B;  1HXD A;  5K5Q A;  4U7D A;  2PLY A;  1XMX A;  2QWW A;  2HZD A;  1J59 A;  1XMA A;  3RKX A;  1W1W E;  2QKM B;  3BG6 A;  2M4K A;  3OSG A;  2HPI A;  2XKO A;  1EA3 A;  1R23 A;  3A4C A;  4IZZ A;  2XPW A;  4U88 A;  2NXN B;  1SAN A;  2L9V A;  2DA2 A;  2ZJ2 A;  3PUF A;  1G3S A;  3K70 C;  1MKM A;  2OV7 A;  1YW8 A;  4ZZL A;  3G3Z A;  4FTH A;  3TO7 A;  3M3Y J;  2EZK A;  3M8J A;  2QQ8 A;  1YQA A;  4M73 A;  4DYQ A;  4ESJ A;  4NHJ A;  2V79 A;  1LE8 B;  3PNT A;  3OV8 A;  1LB2 A;  1RUO A;  5E20 A;  4L0Y B;  4RLQ A;  1BL0 A;  4ZH4 F;  3O8G A;  1OR7 A;  3ABL H;  3OSF A;  2DXI A;  5F0C A;  2O5R A;  3K4B A;  3KYC B;  1HW2 A;  1B72 A;  1HDP A;  3P9C A;  4BGD A;  5IT3 A;  3JW4 A;  4YFX F;  3JRD A;  4AIJ A;  2MGQ A;  3LA2 A;  1FNN A;  2HTS A;  2HPM A;  2NS8 A;  2A6E F;  1MH4 A;  4PJL A;  1AA7 A;  4LG0 A;  2CU7 A;  3K1M A;  1JUM A;  2E7X A;  3OR1 C;  4C3J J;  2MC4 A;  4M3D A;  2P8T A;  1V54 H;  5DD8 A;  1LDK B;  4O3M A;  3L2C A;  2VBY A;  2R7W A;  1ERD A;  3DF8 A;  3PSF A;  1LVA A;  2ADU A;  4I99 C;  1YFH A;  3R0A A;  4EM0 B;  1H9T A;  2BY2 A;  2Y30 A;  2KJB A;  3ISP A;  4BH9 A;  3JAM Z;  3FXM A;  3H9Q A;  4BU2 A;  2HKX A;  5DEQ A;  2ZXW H;  2M1B A;  3E5U A;  4G9Y A;  2DA3 A;  3K1N A;  3HOX J;  1N78 A;  1S9H A;  1LFB A;  1XMK A;  3RI4 A;  1OCT C;  4LLL A;  3I59 B;  4BYY A;  2OBP A;  1KYZ A;  1BOB A;  3OYB A;  1BBY A;  1C0W A;  4XLN F;  2JJ7 A;  1IAW A;  4PSW A;  4ZYH A;  2V7F A;  1FYM A;  1G6N A;  4HA8 A;  4II2 A;  1FYK A;  1U9N A;  1HF0 A;  3L7W A;  3ZQQ A;  4IHW A;  5BNG A;  1QHH D;  1FP2 A;  3ZQ7 A;  3L1P A;  1WVR A;  2VT3 A;  3H3V K;  1BA5 A;  4CCJ A;  5IT9 Z;  3TMO A;  5E1W A;  2ZSH B;  1J75 A;  4GYG A;  3R4K A;  5E3M A;  1OLT A;  2V1N A;  2CUJ A;  2X0L A;  3ESW B;  1WJF A;  1TT5 B;  1DU0 A;  2R7S A;  1XG1 A;  1S7A A;  2AXL A;  2A07 F;  3GVA A;  1HBX G;  5C3E J;  3FKJ A;  1TNS A;  4HOB A;  5CQG A;  3AFH A;  1F4K A;  5FKM A;  5M5Y J;  2W25 A;  2A69 F;  1VTN C;  2BW3 A;  3ZQI A;  1ZGW A;  3CCM I;  3RYP A;  1BC8 C;  2DU9 A;  5F64 A;  4WF2 A;  4ESF A;  3BR2 A;  2K9L A;  4XKC A;  5FJ8 J;  4G94 A;  2E7W A;  4IRG A;  2XGC A;  3VDX A;  2VKV A;  1RR7 A;  2HS5 A;  1XPX A;  4F91 B;  2DCE A;  4OMZ A;  1BM9 A;  1ETK A;  1B72 B;  2EV6 A;  3HC7 A;  2VE9 A;  1Z77 A;  2KFD A;  1HC8 A;  4U0Y A;  1XDU A;  2H94 A;  1D1C A;  1VQL I;  4LG0 B;  3GYH X;  2MH2 A;  1OMI A;  4XSZ F;  4RAZ A;  4L9N A;  4NC8 A;  2M2E A;  4FQG A;  1SFO J;  1NG6 A;  3HIF A;  4AYB A;  3MVP A;  4BAC A;  2JSP A;  1R49 A;  2V26 A;  1U5T C;  1SAU A;  1AU7 A;  3UNG C;  1ZAO A;  1WH5 A;  3BR0 A;  2DYR H;  4XOR A;  1AOY A;  1W36 D;  2AS5 F;  1MJ9 A;  5IY5 H;  2LF7 A;  4BBS J;  3HOV J;  2ZB9 A;  4CZZ A;  1X1C A;  1IV8 A;  4HLY A;  1YIJ I;  1DP3 A;  1TLH B;  1R22 A;  2XRL A;  3ZMT A;  3HRM A;  3CZ6 A;  2LFB A;  2YPR A;  4O6J A;  4E70 A;  2PX9 A;  3K4C A;  3ECO A;  1OCR H;  3IUO A;  1QO0 D;  1D5V A;  1J7K A;  3OL4 A;  4AWX B;  4UUV A;  2KLO A;  4BJ6 C;  1WJC A;  4L0Z B;  3CUQ A;  1REP C;  3JAM K;  2BVM A;  2GAU A;  3BC8 A;  4CCM A;  4D5C A;  3KIO A;  1DGW Y;  3A01 A;  3E6B A;  1SD6 A;  3FIS A;  2OQR A;  1QZE A;  1XSV A;  4J00 A;  1ZEL A;  1Y0N A;  4KIC A;  5TRD A;  1FBU A;  3VB2 A;  3PL8 A;  1Z3Y A;  1W0T A;  5KNL A;  1SD4 A;  2GIZ A;  3K0L A;  1X1B A;  2H1K A;  4HZF A;  3CO7 C;  4HX4 A;  3Q0W A;  1IRZ A;  1IXC A;  2E35 A;  2M5W A;  2KIQ A;  1HQC A;  2XGE A;  2CQQ A;  1AHD P;  2LR8 A;  3VYU B;  2HI3 A;  4A6D A;  4AD9 A;  4HF1 A;  2KIU A;  4I6Z A;  1XB4 A;  2D5V A;  1UST A;  2DOF A;  4ZDO A;  1MBF A;  2JRM A;  3SYT A;  3VYR B;  3BR1 A;  2NAZ A;  1K7A A;  4A3K J;  4BHP A;  1LNW A;  4RM2 A;  3BY6 A;  3CMA I;  1HKS A;  5HS9 A;  1DPU A;  3OOU A;  2OCE A;  3LOC A;  3RJP A;  2CQX A;  3NRV A;  3S1Q J;  4PSX A;  2R7Q A;  4G6D A;  1IG7 A;  3CES A;  1UHM A;  1FTZ A;  5D4S A;  4ENK A;  2XC7 A;  3JRA A;  2M0M A;  1IW7 F;  3G1O A;  1GXP A;  2A5W A;  5ILS A;  1RZ4 A;  1L3L A;  3OYN A;  3A0B C;  1ETO A;  2DDB A;  2LBF B;  1U3E M;  2DT5 A;  1UEL B;  3HXL A;  4CXF A;  1V3F A;  4IQJ A;  3CD6 I;  1ITY A;  4QIW N;  2F5C A;  1A6I A;  1E3H A;  4UUT A;  4FIS A;  1YRN A;  3VEP A;  5BPD A;  3E6M A;  3DPU A;  1WJA A;  1F9N A;  4B44 A;  2FNP A;  3V42 A;  2VOD A;  2BE5 F;  3A2K A;  2X1D A;  3LFU A;  2HFH A;  1IXS B;  2MFZ A;  1XSD A;  3D0S A;  5F1J A;  2FUG 2;  2M3A A;  2DT6 A;  2CQK A;  3HEF A;  5KAI C;  2D1H A;  2WB1 A;  3GWZ A;  2TRT A;  4IHV A;  1J9I A;  1CGP A;  4LLN A;  1E2X A;  2K02 A;  3D5R C;  4ZYE A;  1WI3 A;  4XRS G;  1OPC A;  4C30 A;  5FB2 A;  1P6R A;  3PUB A;  2X9D A;  2EIK H;  2R92 J;  1ZH5 A;  5K1Y A;  5M3M J;  4AVZ A;  3CUQ B;  2NS7 A;  3OS0 A;  1VQM I;  1S72 I;  4KIB A;  5FKO A;  1T08 B;  1MJB A;  2ZCW A;  2L5Q A;  2ACJ A;  3GFM A;  3QAH A;  3FK7 A;  3H3Z A;  2XDV A;  1A04 A;  1Z7U A;  1S8N A;  1G4D A;  4ON0 A;  1ACI A;  1LEA A;  1JUP A;  3DEU A;  5LHH A;  1K78 A;  2Q2E B;  2JZY A;  3H35 A;  1IDZ A;  2HYJ A;  2LY2 A;  1G3Y A;  1NG7 A;  1YO5 C;  1Z7L A;  3CCE I;  1QHG A;  2XAS A;  3IRQ A;  3BQZ A;  2E36 A;  4ENJ A;  3LSK A;  4Y15 A;  2VBZ A;  5EYR A;  4BJT A;  1YE9 A;  1MMA A;  2MSY A;  2HVR A;  4NC6 A;  2V1D A;  3AKZ A;  2ELJ A;  2HYG D;  1ZYR F;  1IRG A;  1T2K A;  2V9V A;  2IS6 A;  3HSR A;  1V55 H;  5ILU A;  2PMZ A;  3OS1 A;  4Y4R A;  2DMP A;  4NB5 A;  4P55 A;  2BV6 A;  5J40 A;  3BOQ A;  1XSX A;  4RGX A;  3GTP J;  2ISZ A;  5E1Z B;  2HNH A;  1R1V A;  3ZN1 A;  1LPQ A;  4IPA A;  4JOM A;  1X4P A;  4UXN A;  5F1R A;  1OKR A;  4C9Y A;  1B9N A;  1HA8 A;  2ZME C;  4KIT B;  2XSJ C;  3RZD J;  4I01 A;  3FXR A;  3CO6 C;  2YX4 A;  4B1R A;  3LST A;  3RSN A;  3DPT A;  4JK1 X;  5FFX A;  3CJT B;  4LK0 F;  1IO2 A;  4U7B A;  5BOX A;  4UV9 A;  1GHC A;  1F5T A;  1ONV A;  1GVD A;  3IHU A;  4KIS A;  2L4A A;  4JQF A;  3CQZ J;  4KA4 A;  3UR3 C;  2R7Z J;  1ETW A;  3FM3 A;  2XF5 A;  2BY0 A;  3D1N I;  2ESN A;  3CTA A;  1MMD A;  3BDD A;  3WG9 A;  2K9M A;  1TBX A;  2VJ5 A;  1V4R A;  2LY1 A;  1ZRC A;  2EA4 A;  4H4K C;  4I76 A;  5LD2 C;  4A69 C;  2I10 A;  1U8B A;  2YSR A;  2GOX B;  3HSF A;  2MLK A;  2WAQ A;  2NVQ J;  1O3T A;  4IEJ A;  3A02 A;  2VOP A;  1R9T J;  2A3S A;  5L3B A;  3LSJ A;  3DU6 A;  1K78 B;  5B1B H;  4GDF A;  2KRC A;  5FO5 A;  1UCR A;  3FXK A;  1UJ8 A;  4W1U A;  3VOD A;  3OYC A;  3WHC A;  2K9Q A;  3MKZ A;  1IN4 A;  1EH6 A;  5F0F A;  1EF4 A;  2QGU A;  3HBL A;  1PJR A;  4AC0 A;  2WBM A;  3L00 A;  1N77 A;  3W6V A;  1P4A A;  1HKQ A;  4HEA 2;  4E4H A;  1G2H A;  5EDN A;  1Z0X A;  5HOO A;  2DPD A;  3F8N A;  3FXQ A;  1V5F A;  4BDY A;  3TKY A;  3WOD F;  2CH0 A;  3DLL F;  3W2A A;  3MAJ A;  2DOA A;  2KIS A;  5ILV A;  4IO9 F;  4WXH A;  1JTY A;  4FET A;  2XPU A;  3TL4 X;  2EZI A;  2F5F A;  4BXF A;  1PP7 U;  2JA2 A;  4MNU A;  3JCU C;  3CMY A;  2B9S A;  4LGW A;  2B63 J;  4Q48 A;  3HZJ A;  4XID A;  5FD6 A;  4UV8 A;  3AG3 H;  3CMM A;  3OIO A;  2F5E A;  3ML6 A;  1WHU A;  3D5S C;  2E34 A;  1X3U A;  2RRE A;  3T8T A;  3C1D A;  3L2Q A;  1UHW A;  3LQR A;  3VYT B;  4KT5 C;  3V4G A;  5LEK A;  2HTJ A;  1H8A C;  4XMY A;  1AKH A;  1SFK A;  3PIO F;  5CVV A;  4KFC A;  1FIP A;  3BCB A;  2MA3 A;  2JMW A;  5DM7 F;  3HHH A;  1SFE A;  3H5R A;  3KEY A;  3FXL A;  4IHT A;  5HS8 A;  2DI3 A;  4D0P A;  4S0H B;  4MO7 A;  2QUF A;  2VC1 A;  2XKP A;  3AG1 H;  3CC4 I;  5LRS A;  2HOS A;  2GLO A;  2DT7 B;  3HM5 A;  2O7O A;  3RYR A;  2JA8 J;  1DGR M;  3MZY A;  5JFR A;  1ZRD A;  1GLN A;  5EZG A;  3WTX C;  5K7F A;  2JTV A;  5D6E A;  3K4J A;  4C2U A;  2ZKZ A;  2IGK A;  2KT0 A;  3MKL A;  1PDN C;  1Z05 A;  2EFQ A;  5LGN A;  1BIA A;  1QU3 A;  2DK5 A;  2ZNZ A;  2FEZ A;  4HBL A;  4A3D J;  2FD5 A;  4NUB A;  4BXU A;  4CA0 A;  1QVT A;  3GCM A;  3MWM A;  3PIP F;  3OYA A;  4ENM A;  3WTT C;  3IWZ A;  4E7K A;  1W4M A;  2XB5 A;  3H5A A;  3J7Z I;  1DU6 A;  2ZXJ A;  2LK2 A;  5D5U B;  1Q1H A;  1GDT A;  1P7J A;  3KP5 A;  1XDS A;  2ZXH A;  3U2R A;  4OIO F;  5IYB J;  4BE2 A;  1W36 C;  5IP9 J;  2QEN A;  1X4O A;  4DJA A;  1VQ4 I;  4I2O A;  1R58 A;  3K4N A;  2KMU A;  4ZDP A;  5C4J J;  3OIP A;  3W6K B;  4HST A;  2EA2 A;  3OYJ A;  2JT1 A;  2PQ8 A;  5CLS A;  2DDA A;  2V9K A;  2R7O A;  2L01 A;  3WTV C;  1I5Z A;  2BOL A;  1OCZ H;  3M07 A;  2CWE A;  4KMF A;  4MEY F;  1IGN A;  3IC7 A;  2LYC A;  2PMH A;  1J09 A;  1OR7 C;  2MAB A;  3K2A A;  1MSE C;  1V5G A;  1YX3 A;  5D8L B;  5CVI A;  4FT8 A;  5BMZ A;  3RPQ A;  2IT0 A;  4OOI A;  5IOY A;  3TGN A;  2FQ3 A;  2NVU B;  1G3T A;  2Y9Z A;  4S05 A;  5EG0 B;  1BN5 A;  4J01 A;  3X2Q H;  4BQA A;  2Y31 A;  3GME A;  3ZQG A;  2Y75 A;  3UKG A;  3GTG J;  1JHH A;  3VPR A;  3DV8 A;  4FX4 A;  3CCV I;  1EJ9 A;  2HQN A;  3BQY A;  1FOY A;  3V8K A;  2EFW A;  3IAS 2;  1KQ9 A;  1FOX A;  2VAS A;  2JPB A;  4BQO A;  1X3W B;  4ZZD A;  2FOW A;  2Z16 A;  3V7C A;  4M9S A;  1OYY A;  3BG3 A;  3TOA A;  3S3O A;  5GAH J;  3IKT A;  3RKW A;  2E1O A;  2FU4 A;  2W00 A;  3HOT A;  3GBG A;  3GO5 A;  1YJN I;  2QA4 I;  5M5W J;  1O7L A;  4E6K G;  5E3O A;  2KL4 A;  4CCK A;  1NTC A;  3B6C A;  2CGP A;  2IS1 A;  1G59 A;  3GLL A;  4U87 A;  2I5U A;  3W2W A;  1S29 A;  2XGD A;  1D8K A;  3GTM J;  2FBH A;  1D0Y A;  2LTP A;  4M9Z A;  1P4X A;  2XRO A;  5DUK A;  2OQG A;  4XLA A;  1IC8 A;  1ODD A;  2HDC A;  1R00 A;  3DBH B;  1GXQ A;  1RIO H;  1I3A A;  3AL0 B;  3HL2 A;  2F6C A;  2IA2 A;  5KVR A;  1JGS A;  2FE3 A;  2Y48 A;  2EFN A;  1WWX A;  2JQ7 A;  2O03 A;  3LMM A;  4IKF A;  3TO9 A;  2DTR A;  2X6X A;  3E97 A;  5F08 A;  1H89 C;  2O8X A;  4A6E A;  2BHY A;  1Z67 A;  2V9P A;  1DQU A;  2M87 A;  2K86 A;  4MIM A;  4RGR A;  3IWF A;  2R7U A;  3S17 J;  3F0C A;  3HGG A;  3HPH A;  3COA C;  2UXN A;  2X1C A;  3BTJ A;  5GAE J;  3NEU A;  4A0Z A;  2JUG A;  2LDU A;  4X6A J;  3R60 A;  3S1N J;  3HTU A;  4WXC A;  2AO9 A;  2FX0 A;  5LFA A;  2P0W A;  3M9A A;  4HF0 A;  2FNA A;  4UB6 C;  1KZH A;  4ZC3 A;  4IJA A;  4IOC F;  3QQA A;  4CCL A;  5FLV A;  1T0F A;  3HTS B;  3H9J A;  4RA2 A;  2L9S A;  1VI0 A;  2HOE A;  1FMW A;  1B1B A;  1FMV A;  1QZY A;  1K6O A;  5EF6 A;  3RKY A;  2VE8 A;  3LSG A;  3GF2 A;  5D5X B;  1IF1 A;  1D1B A;  1MGT A;  1SVO A;  3I5U A;  3U1D A;  4U0W A;  2Q1Z B;  2OC6 A;  1YG2 A;  4RAF A;  1ZRF A;  3KCC A;  3ROU A;  4A12 A;  3KE2 A;  1ZQ3 P;  2DA4 A;  2FBI A;  2E2H J;  1W5C C;  2RVC A;  5J3L A;  4D1Q A;  2E5N A;  3O2P E;  3CDI A;  3I71 A;  3BLY A;  3TP3 A;  2O61 A;  2W57 A;  2A05 A;  4IVN A;  5LBQ A;  3VSK A;  1UG2 A;  2UXX A;  2VUM J;  1KGS A;  2K3F A;  2R7D A;  3H9G A;  1VFC A;  5DYM A;  5IP6 A;  2IAI A;  4KMU X;  3WE2 A;  3P7N A;  4A0Y A;  2DQL A;  4OIR F;  3LA7 A;  2WAD A;  2P5L C;  1X19 A;  2HWV A;  1V5E A;  4XM3 A;  1OFC X;  2XB0 X;  3FXU A;  2YS9 A;  3L2U A;  4QTR A;  1ZKG A;  4I09 A;  2M7B A;  4BXX J;  3CUQ C;  3WHB A;  3WGH A;  4LIU A;  4Q4Z F;  1TQP A;  2EFP A;  5DCM A;  3LSR A;  2QEX I;  2DK8 A;  3PFY A;  5FRN A;  2QKL B;  3MZ8 A;  2CJJ A;  2XF7 A;  2WAE A;  2AXT C;  4CUG A;  1ZLK A;  1B59 A;  5CQE A;  4XLC A;  2R4G A;  4E7S A;  2RDP A;  4LK1 F;  2I8D A;  3P5J A;  2ID3 A;  3F9K A;  4QPQ A;  2VXZ A;  2V6E A;  3HRT A;  2X4H A;  4Y17 A;  4UB8 C;  1FSH A;  2OUM A;  3LQQ A;  2L0K A;  1TNT A;  2FA5 A;  5KAF C;  2GQQ A;  4JX5 A;  4RMN A;  4B43 A;  5DD4 A;  3HOS A;  2CS3 A;  4Z6Y A;  1D5Y A;  4ZYG A;  3FIW A;  3WTZ A;  2JRT A;  2YUS A;  2GOM A;  1WCM J;  2DQR A;  3CUO A;  2XUB A;  3NWS A;  4G12 A;  1FBS A;  2K3P A;  2LKP A;  5L3F A;  4HQE A;  3K1P A;  2YU3 A;  4RAG A;  2VKE A;  4UUS A;  4JP0 A;  4ZDL A;  1SEU A;  3SZG A;  1DUX C;  4HSR A;  4RM3 A;  1FZP B;  2LRE A;  2WY8 Q;  3ZMV A;  3TDU C;  4QLC U;  6PAX A;  1D0Z A;  3WU0 A;  2Z3Y A;  3TW7 A;  3G71 I;  3WGG A;  1YJ9 I;  1JJ8 C;  2TCT A;  4YFK F;  4E7J A;  2G7H A;  2AQE A;  3BZC A;  3CCR I;  2COM A;  5FKK A;  5E17 F;  1LUJ B;  2DFF A;  4IHX A;  3QP6 A;  1WKM A;  2ETH A;  3RKQ A;  2HXO A;  3MKY B;  4I0A A;  5FD5 A;  2NS0 A;  4LOC A;  1X3Z B;  5M5X J;  1ZGA A;  3G6E I;  5JR3 A;  5EEA A;  3DTE A;  1P92 A;  3LSH A;  1RET A;  1KA8 A;  1YOV B;  4II3 A;  4C3I J;  3I56 I;  1Z21 A;  3BR6 A;  4EQQ A;  3S1R J;  2HVS A;  1ETQ A;  4BHB A;  4EJU A;  2XVC A;  3FMS A;  4ZYD A;  2K4J A;  4C2M J;  3DCF A;  2Y69 H;  2CV2 A;  4DZP A;  2HOT A;  1XN7 A;  4XK4 A;  2QM3 A;  4ITV A;  5JLW A;  2CV0 A;  3ZPL A;  2D2W A;  2RNG A;  1IV6 A;  2VKH A;  1QRY A;  3PO2 J;  2JVH A;  4KIG A;  2XAJ A;  4V19 K;  2V4J C;  1I3Q J;  3GLX A;  2Z99 A;  1SD5 A;  3FBN B;  1LDD A;  2DFE A;  4G6Q A;  1D0X A;  3OY9 A;  3F3X A;  2PMZ N;  2MD5 A;  3ONQ A;  1D1A A;  2BW3 B;  2H8W A;  2OPT A;  1MND A;  4NBQ A;  3S8P A;  2DFI A;  4B48 A;  3DBL B;  1KON A;  2QVO A;  4OAY A;  2HDD A;  1QQI A;  3K9T A;  3BG5 A;  3SZP A;  4Y7N J;  3GX4 X;  4JX6 A;  3ZOB A;  1SMY F;  4KYW A;  2R7V A;  4HX7 A;  2AHQ A;  4LB6 B;  3BPX A;  2EZH A;  1F36 A;  3CLO A;  3JSO A;  2PI0 A;  2H09 A;  4ZTF A;  4PZJ A;  3QPS A;  4Z2Y A;  3KEO A;  1O4X A;  1JKQ C;  4EJO A;  3FMR A;  2Y0S N;  2CYY A;  2IBD A;  4IHS A;  2LVS A;  3EQL F;  1BI3 A;  2BXZ A;  1JKP C;  2D45 A;  2VKD A;  4XRS A;  1HST A;  3M7G A;  3EYI A;  4RB2 C;  1A35 A;  3SZT A;  3JRC A;  2LOO A;  2JVG A;  4B09 A;  2VL8 A;  2B7E A;  2KKO A;  1UFM A;  3DXJ F;  3S2W A;  4U0V A;  3RTR A;  1WH7 A;  2K27 A;  4CSW A;  2FOK A;  1RUN A;  5FLX K;  2EB7 A;  4OWR B;  2FMY A;  5JI6 A;  2O3F A;  1P7I A;  4M9X A;  4BEH A;  3OYD A;  1XCV A;  2VXD A;  3L2R A;  3BCA A;  3VFZ A;  5ICE A;  3OYM A;  3F22 A;  1TL8 A;  1O3S A;  2VJI A;  2LF8 A;  3S1M J;  1FTT A;  4XNF A;  1B8I A;  1RKW A;  1YI2 I;  2CFX A;  2KRF A;  4Q47 A;  2LRD A;  1USS A;  3KFW X;  5DCF A;  4A5M A;  2XSD C;  2ZBK A;  2FSW A;  2W84 A;  2Z9O A;  4PUS A;  4O5V A;  4M3F A;  4YEL A;  3E6C C;  2FF4 A;  2B0L A;  1Y8Q B;  1R5I D;  4OIQ F;  5F04 A;  1VQ8 I;  3ASO H;  3LWF A;  2VN2 A;  3ZMZ A;  4PDK A;  1GV5 A;  3KYD B;  5IYC J;  1JE8 A;  2DMN A;  3GFI A;  1YJW I;  3I4M J;  1Y0U A;  2E60 A;  2VQC A;  4XLE A;  4PFP A;  4XOP A;  3RIR A;  2WAF A;  3J7A Y;  2CW0 F;  5E3L A;  4ANJ A;  2QQ9 A;  4GRI A;  1MJA A;  4V2G A;  3A01 B;  3FK6 A;  4L5J A;  1ETX A;  5IOZ A;  2DO7 A;  2LNB A;  1IZ1 A;  3DTK A;  2ESH A;  3IH2 A;  3KZY A;  2KIF A;  2IA1 A;  1MNM C;  2VOO A;  2BXY A;  4KNY A;  1JUS A;  9ANT A;  3OS2 A;  2YR2 A;  5E8G A;  3SFZ A;  1QPI A;  1SMT A;  3SEQ A;  2JA7 J;  2IS2 A;  4HNT A; 
#chains in the Genus database with same CATH homology
 1X2N A;  1GUU A;  2L7F P;  1HDD C;  4S0H B;  4MO7 A;  1TC3 C;  4FTH A;  3M3Y J;  1BW6 A;  2EZK A;  1RKT A;  4DYQ A;  2HOS A;  2GLO A;  1FEX A;  3HM5 A;  1LE8 B;  2O7O A;  2GM4 A;  1OJL A;  2JA8 J;  5JLX A;  4EEF G;  5EZG A;  2Y9Y A;  2R5Y B;  1BL0 A;  2P81 A;  5K7F A;  5K7H A;  3O8G A;  3Q3S A;  2O8K A;  2L7M P;  1X58 A;  3OSF A;  3O8H A;  5F0C A;  2LLK A;  2YU9 J;  3PM1 A;  1B72 A;  2KT0 A;  1HDP A;  2CUF A;  3MKL A;  3JRD A;  4XRM A;  3S16 J;  2MGQ A;  2JA6 J;  2DA6 A;  4A3D J;  4M3G A;  1LFU P;  2NS8 A;  1MH4 A;  2FD5 A;  1ZTR A;  2CU7 A;  1QVT A;  2K40 A;  1JUM A;  3TW6 A;  2ELK A;  4C3J J;  2XB5 A;  3HDD A;  2ECB A;  4M3D A;  1DU6 A;  1PUF B;  1YRN B;  3K7A J;  2LK2 A;  4M3E A;  2FQ4 A;  1P7J A;  2GBY A;  1GDT A;  5IYB J;  5IP9 J;  5J1Y A;  4ABZ A;  2NOG A;  2Y30 A;  5C4J J;  2XPV A;  2DA7 A;  3G1M A;  2JN6 A;  2DA3 A;  3HOX J;  5EZH A;  1LFB A;  4B4C A;  1OCT C;  3JRH A;  5IPA A;  1IGN A;  3K2A A;  1MBJ A;  1MSE C;  2JJ7 A;  1Q1V A;  2X48 A;  3BT9 A;  4UUS B;  4BY1 J;  3HOU J;  5IOY A;  1U9N A;  4A3F J;  1HF0 A;  4IHW A;  1ENH A;  2Y9Z A;  2E2I J;  4BKX A;  5BNG A;  5EG0 B;  2Y31 A;  3ZQG A;  3L1P A;  1BA5 A;  3H3V K;  2K9N A;  3UKG A;  3GTG J;  4D7M A;  3VPR A;  3FKI J;  3HB9 A;  5EGO A;  3BQY A;  2NVT J;  1MBE A;  1I6H J;  2M9H A;  3Q0V A;  5E3M A;  2W48 A;  1WGX A;  3JRB A;  3ZQF A;  1DU0 A;  1XG1 A;  2WAQ N;  2DJN A;  2CUE A;  5C3E J;  3BG3 A;  2ECC A;  5FKM A;  5M5Y J;  1ZGW A;  3ZQI A;  2E1O A;  4IHY A;  3BR2 A;  3GBG A;  4CYC A;  5M5W J;  5E3O A;  5FJ8 J;  1NTC A;  2XGC A;  2VKV A;  1RR7 A;  3B6C A;  5IP7 J;  1ZK8 A;  1W0U A;  1BJZ A;  2DA1 A;  1ETK A;  1B72 B;  1T33 A;  1Z77 A;  2XGD A;  3GTM J;  4A3I J;  1BW5 A;  3IH4 A;  3LNQ A;  3HKZ N;  2LTP A;  2L7Z A;  1IC8 A;  2MG4 A;  1A5J A;  1U9O A;  3JRG A;  4DW6 A;  2M2E A;  3NAR A;  1SFO J;  2HQ5 A;  3GTJ J;  4BY7 J;  1F43 A;  3H0G J;  3MVP A;  3S2D J;  5F08 A;  1H89 C;  4J19 A;  5J1U A;  1AU7 A;  4MIM A;  4RDU A;  1GT0 C;  1WH5 A;  1Y1V J;  3BR0 A;  1CQT A;  2M0C A;  1JKR C;  3S17 J;  3F0C A;  2R5Z A;  3HGG A;  4FE7 A;  2LKX A;  3ZQC A;  1MBG A;  3BTJ A;  4BBS J;  2VPR A;  4M3B A;  4QSH A;  3HOV J;  2ZB9 A;  2QCO A;  2EQR A;  2R0Q C;  4X6A J;  3S1N J;  4BBR J;  1JT6 A;  2XRL A;  2AO9 A;  1MBK A;  1K83 J;  2FX0 A;  3HOZ J;  2LFB A;  1TWG J;  2DMU A;  3Q0U A;  3M4O J;  2HXI A;  4GFB A;  3QQA A;  1MSF C;  5FLV A;  3BTL A;  1FJL A;  1NK3 P;  1VI0 A;  1T56 A;  5EF6 A;  3NAU A;  1IJW C;  1B8I B;  5EGO B;  4D5C A;  3LSG A;  4B3A A;  3A01 A;  1OCP A;  2L9R A;  3FIS A;  4M6V A;  4NDL A;  1QVU A;  5E3N A;  2IEK A;  1ZQ3 P;  2DA4 A;  2E2H J;  3DEW A;  1ZR2 A;  5J3L A;  1W0T A;  1HLV A;  2H1K A;  3B6A A;  1VF9 A;  3TP3 A;  1Y1W J;  2LD5 A;  1X2M A;  3Q0W A;  1IRZ A;  1UG2 A;  3BR5 A;  2VUM J;  2XGE A;  2CQQ A;  1AHD P;  2LR8 A;  5F0H A;  2HI3 A;  4CYC B;  2FJ1 A;  4I6Z A;  1VFC A;  1ETY A;  2D5V A;  2HOA A;  1MBF A;  1GV2 A;  2IAI A;  5IP6 A;  1U78 A;  1TWC J;  4MFE A;  3BR1 A;  4A3K J;  2G0E A;  4D7N A;  3OOU A;  1OFC X;  2XB0 X;  2M34 A;  5F27 A;  4RBO A;  2M8G X;  3LOC A;  1S7E A;  1TWA J;  2YS9 A;  2CQX A;  3HOY J;  4QTR A;  3S1Q J;  1ZKG A;  2CRG A;  1RES A;  4BXX J;  1AKH B;  3WHB A;  3TP0 A;  1IG7 A;  1FTZ A;  3JRI A;  3JRA A;  3LSR A;  3G1O A;  4MFD A;  2K9S A;  5J1R A;  1ETO A;  2CJJ A;  3CCY A;  2JA5 J;  3SJM A;  1ITY A;  4D5F A;  4QIW N;  4A3M J;  1A6I A;  4UUT A;  1YRN A;  4FIS A;  2ID3 A;  2DMT A;  4JX4 A;  2R5Z B;  1UMQ A;  3SFI A;  5DS9 A;  2DMQ A;  2L0K A;  5F1J A;  4JX5 A;  1FIA A;  3HEF A;  4A3E J;  1RPW A;  1APL C;  3RZO J;  1D5Y A;  4DYC A;  2TRT A;  4IHV A;  1TWH J;  2NVY J;  3FIW A;  4A3C J;  2YUS A;  2DTZ A;  2ME0 A;  1E3O C;  1WCM J;  1WI3 A;  4G12 A;  4XRS G;  4A3J J;  5GP9 A;  2X9D A;  2R92 J;  3HGY A;  1VND A;  5M3M J;  1H88 C;  4FCY A;  2NS7 A;  5DTD A;  2VKE A;  4UUS A;  4JP0 A;  5FKO A;  4A93 J;  3FK7 A;  3GTQ J;  2OF7 A;  2H8R A;  5HOD A;  5EG0 A;  3TW7 A;  2EBI A;  2EH3 A;  3QPL A;  1JUP A;  1JJ8 C;  2TCT A;  5FKK A;  2E2J J;  1IDZ A;  2HYJ A;  4IHX A;  1NK2 P;  3BQZ A;  4X1E A;  4AYB N;  5GPA A;  3ZQH A;  3RKQ A;  2HXO A;  2MW8 A;  5EYR A;  5M5X J;  4LOC A;  3IV5 A;  1XS9 A;  2MSY A;  1IDY A;  5EEA A;  2NVX J;  2LP0 A;  4AUX A;  1RET A;  4C3I J;  3BR6 A;  3SDG A;  3S1R J;  2WV1 A;  1ETQ A;  4C2M J;  3DCF A;  3BG9 A;  2DMP A;  4DZP A;  2HOT A;  2KDZ A;  4XK4 A;  2ME6 A;  5JLW A;  5M3F J;  2E19 A;  4MLO A;  3GTP J;  1IV6 A;  1QRY A;  3PO2 J;  2DA5 A;  1ETV A;  3ZQL A;  3MN2 A;  1I3Q J;  4W97 A;  4L5E A;  1JJ6 C;  5C4X J;  3BR3 A;  3RZD J;  2PMZ N;  1JT0 A;  2OPT A;  3C2B A;  3TED A;  4B1R A;  3JRE A;  2HDD A;  3I4N J;  3BG5 A;  4JYK A;  1HCR A;  4Y7N J;  4JX6 A;  3ZOB A;  2R93 J;  2AHQ A;  1GVD A;  4A3G J;  2N8G A;  5K7Z A;  2EZH A;  1F36 A;  3A03 A;  3BTI A;  3CQZ J;  4A3B J;  1HOM A;  5IYD J;  3IH3 A;  2R7Z J;  3QPS A;  1ETW A;  1O4X A;  1JKQ C;  3S14 J;  3D1N I;  1K61 A;  1LE8 A;  5FLM J;  2Y0S N;  2COB A;  2R5Y A;  2IBD A;  2VI6 A;  2LVS A;  3JR9 A;  4I76 A;  2RAE A;  1JKP C;  4XRS A;  4A69 C;  2I10 A;  1U8B A;  3JRF A;  1UHS A;  1JKO C;  3JRC A;  3HOW J;  2NVQ J;  4IEJ A;  3A02 A;  5GPC A;  1R9T J;  1WH7 A;  5FKN A;  2X6O A;  3LSJ A;  5C44 J;  1P7I A;  3GTL J;  1IUF A;  2JK3 A;  4FE4 A;  4HNV A;  1PUF A;  3S1M J;  3G1L A;  1FTT A;  1B8I A;  1RKW A;  4W1U A;  3WHC A;  2K9Q A;  1ORK A;  1POG A;  3E7L A;  3RQI A;  2XSD C;  4XIC A;  5F0F A;  1EF4 A;  3HBL A;  4A3L J;  4AC0 A;  3W6V A;  4M3F A;  1I50 J;  5F04 A;  3LSP A;  1G2H A;  1WPK A;  5EDN A;  1Z0X A;  3PO3 J;  3S2H J;  4C3H J;  1GV5 A;  5IYC J;  1JGG A;  3CDL A;  4DZJ A;  5FKL A;  2DMN A;  2O9L A;  3I4M J;  1JTY A;  4DYR A;  3GTO J;  1TWF J;  1XC5 A;  2ID6 A;  2LY9 A;  2XPU A;  2Y2Z A;  2EZI A;  2EZL A;  1ZR4 A;  3GTK J;  4V2F A;  5E3L A;  3CMY A;  1MH3 A;  2B63 J;  1JTX A;  2QF7 A;  4V2G A;  4XID A;  3A01 B;  3BTC A;  3FK6 A;  3OIO A;  1ETX A;  5IOZ A;  3IH2 A;  2WB1 N;  1MNM C;  2DN0 A;  2JWT A;  1MBH A;  4Y52 J;  3OSG A;  3S15 J;  1H8A C;  1JUS A;  9ANT A;  1AKH A;  2XPW A;  1QPI A;  1SAN A;  2JA7 J;  1FIP A;  2DA2 A;  2JMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...