4QTRA

Computational design of co-assembling protein-dna nanowires
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
RTAFSEEQKKALDLAFYFDRYLTPEWRRYLSQRLGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dualENH
publication title Computational design of co-assembling protein-DNA nanowires.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags De novo design/dna
total genus 14
structure length 55
sequence length 55
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4qtrA00
2XPWA 1UG2A 3S15J 1Y1WJ 4A3LJ 5K7HA 2XPUA 4L5EA 5M5XJ 4IHXA 2Y30A 3HGGA 1HLVA 1MBFA 1QVTA 4A3BJ 1WPKA 3SFIA 2MW8A 2LK2A 1ZQ3P 1UHSA 3BR0A 2COBA 3JRFA 1TWAJ 1CQTA 1VFCA 3HDDA 5M5YJ 2YUSA 2NOGA 5JLXA 5F27A 4A3JJ 2MSYA 2CRGA 3SDGA 1AKHB 1I50J 2JA7J 1ENHA 3FIWA 1ZR2A 1D5YA 3B6AA 5E3NA 4BXXJ 3RZDJ 1ETXA 5EG0A 5C3EJ 3TW7A 3HOYJ 2R5ZA 1ETVA 3OOUA 1MNMC 1F36A 4XIDA 3ZQLA 2DA2A 3JRCA 1O4XA 2EZLA 3NAUA 5F1JA 5J1RA 2X6OA 1BA5A 1U78A 2GBYA 1UMQA 2HXOA 3OSGA 3HM5A 1WI3A 9ANTA 1FTZA 1QRYA 4XICA 2L9RA 2N8GA 1JKRC 1GV5A 4Y7NJ 5FLMJ 2R5YB 5J3LA 2G0EA 3G1MA 3JREA 3M3YJ 4A3DJ 2TRTA 2LR8A 4FCYA 3H0GJ 5JLWA 2CJJA 2XGDA 1TWFJ 5IP6A 1K83J 5EF6A 3ZQIA 2YU9J 3A02A 3GTPJ 1JTYA 1IV6A 4DYRA 3A01A 3ZQFA 2R5YA 4MLOA 1RETA 3JR9A 3S17J 1TWGJ 3TW6A 2OF7A 1TC3C 4XRMA 4QIWN 2R93J 3I4MJ 3GTKJ 3JRGA 2EQRA 2PMZN 1HF0A 3TP3A 4W97A 3HOXJ 1PUFA 1MSFC 2JN6A 2ECBA 2O9LA 1HDDC 4A3GJ 1S7EA 2Y2ZA 1BW5A 1T33A 1WH5A 2AHQA 3FISA 3I4NJ 4HNVA 2EZIA 2K40A 2MGQA 1H8AC 3BTCA 2ECCA 3HB9A 5E3OA 2ELKA 1RKTA 2VKEA 2DA6A 1XC5A 2E2JJ 1QVUA 4MO7A 2EZHA 4D7MA 4ABZA 2DA7A 5IYCJ 3LNQA 1JJ6C 4A3IJ 3Q3SA 4A3FJ 3MKLA 1R9TJ 4M3GA 3HKZN 1JTXA 5GP9A 1H88C 2E2IJ 2ZB9A 3BG9A 1ZGWA 1Z77A 4C3IJ 1DU0A 1BL0A 2VI6A 2NVYJ 1JT6A 1RESA 2L7FP 3VPRA 3L1PA 2L7ZA 4I6ZA 2VPRA 3S16J 5EGOB 3C2BA 1IC8A 1LFBA 1MBGA 3LSJA 3K7AJ 1GDTA 4XK4A 1A6IA 1RPWA 5IOZA 2E19A 2FQ4A 1JT0A 4A93J 2JWTA 2ME0A 3CQZJ 4X1EA 3OSFA 1ZK8A 3Q0UA 2Y9ZA 4IEJA 3QPSA 2QCOA 5FKLA 5EGOA 5EYRA 1JUMA 3A03A 2L7MP 1P7JA 5FKOA 2FD5A 3WHCA 2I10A 2FX0A 2LLKA 1ETKA 3S1MJ 3OIOA 2LP0A 4UUTA 5K7ZA 3PO2J 1JKQC 4M3FA 3K2AA 1VF9A 3MVPA 1IDZA 2M8GX 4A3MJ 2XPVA 3PM1A 1XG1A 2X48A 1WH7A 1MBEA 1ETWA 1VI0A 3S14J 2M34A 1B8IB 2CQXA 3GTOJ 2O7OA 3O8GA 4A3EJ 4B4CA 3S1QJ 3LOCA 1AKHA 1OJLA 2NVQJ 2GM4A 4XRSG 3QQAA 5J1UA 1IUFA 4FE7A 5E3MA 1H89C 1LE8B 5FKNA 4DW6A 1B8IA 5BNGA 5EDNA 2EH3A 2DA4A 5J1YA 5GPCA 1MH3A 2L0KA 1GT0C 3WHBA 1W0UA 2FJ1A 2Y31A 1X2NA 3HGYA 3BG3A 4M3BA 1LE8A 3E7LA 1OCPA 3CMYA 2HOTA 1SFOJ 3S1NJ 2WB1N 3BR5A 1MSEC 2XB0X 1YRNB 2CQQA 2LFBA 2E1OA 3ZOBA 3D1NI 4MFDA 3SJMA 2B63J 4B1RA 3TEDA 5M3FJ 3CCYA 3GTLJ 1HCRA 5F0CA 4GFBA 1A5JA 2HOSA 4V2FA 1YRNA 3JRDA 4JX6A 4MFEA 2K9QA 2CU7A 5EZHA 1RKWA 4XRSA 5C4XJ 1F43A 4BY7J 2VUMJ 1X58A 3G1LA 3BR3A 3S2HJ 1NK3P 5EEAA 3H3VK 1MBHA 2IBDA 3F0CA 1WGXA 3IH4A 2P81A 4UUSB 1VNDA 3GTGJ 4BKXA 2DMUA 4QTRA 4IHVA 2WV1A 2Y9YA 2X9DA 4C3JJ 2NVTJ 2YS9A 1IDYA 3CDLA 3BTIA 4D5CA 1APLC 4J19A 4AC0A 1LFUP 2HXIA 3FKIJ 3JRAA 3UKGA 4C3HJ 1AHDP 2O8KA 3IH3A 3W6VA 1POGA 1JUPA 5GPAA 3JRBA 4IHWA 2LY9A 1FIAA 3B6CA 1NK2P 2LVSA 2HQ5A 2ID6A 3ZQGA 3Q0VA 3BTLA 2W48A 4JX5A 2M9HA 2QF7A 2M2EA 1JKOC 3IH2A 3BQYA 3S2DJ 1W0TA 1I3QJ 2JJ7A 1MBKA 5F0HA 1B72B 5FKKA 3BR6A 2DN0A 2EBIA 1ITYA 1JGGA 2KT0A 3NARA 4D5FA 1RR7A 3IV5A 1P7IA 4CYCB 1OCTC 1I6HJ 1ORKA 2DMTA 5IP9J 2R0QC 2R92J 3HOWJ 1FIPA 2JK3A 2DA5A 4DZJA 2DTZA 1B72A 2JA5J 2E2HJ 4Y52J 4G12A 1ETYA 2HOAA 1T56A 3HBLA 2XRLA 2TCTA 4JP0A 4CYCA 3FK7A 5EG0B 3BTJA 4BBSJ 4W1UA 1E3OC 1BJZA 5EZGA 2KDZA 1ZTRA 3M4OJ 1GV2A 2R5ZB 1XS9A 3HOVJ 2NVXJ 4V2GA 5IYDJ 1WCMJ 3HOUJ 1QPIA 2XB5A 3MN2A 2JA8J 4JX4A 1U9OA 1NTCA 3S1RJ 1U8BA 3ZQCA 4I76A 4MIMA 4A69C 4C2MJ 2ME6A 5C44J 5M5WJ 4RBOA 1IG7A 1GVDA 4AUXA 4A3CJ 4NDLA 4DYQA 4BBRJ 4DYCA 2AO9A 1IRZA 2XGCA 3BT9A 4EEFG 5F04A 2D5VA 2GLOA 5FJ8J 4QSHA 1ZKGA 2H1KA 1GUUA 3G1OA 5DTDA 2CUFA 2JMWA 5IYBJ 3BR1A 1JJ8C 3RQIA 2JA6J 3A01B 4AYBN 4M3EA 3LSPA 2HDDA 3TP0A 3RZOJ 4FISA 4FE4A 2MG4A 2WAQN 3GBGA 1Z0XA 2ID3A 4B3AA 4FTHA 1MH4A 3ZQHA 1K61A 1IGNA 1JKPC 2XSDC 5F08A 1Y1VJ 2DA1A 1PUFB 3BR2A 3GTQJ 3BQZA 5HODA 1FJLA 1HDPA 1MBJA 2NS8A 2XGEA 3GTJJ 4LOCA 2LD5A 2NS7A 5F0FA 3QPLA 2VKVA 5FLVA 2EZKA 2Y0SN 3HEFA 2RAEA 1DU6A 1FTTA 1G2HA 1BW6A 1U9NA 3JRHA 1ETQA 4JYKA 2HYJA 3O8HA 1OFCX 2DA3A 4UUSA 3DEWA 1JUSA 3GTMJ 2CUEA 1IJWC 4DZPA 4X6AJ 5C4JJ 1FEXA 5IPAA 4IHYA 4BY1J 2DMQA 1TWCJ 2LTPA 5M3MJ 2DMPA 5E3LA 2DJNA 2IAIA 1Q1VA 1X2MA 2R7ZJ 2DMNA 2M0CA 2LKXA 3RKQA 2IEKA 1TWHJ 5IOYA 5IP7J 5FKMA 1HOMA 3HOZJ 4M6VA 1EF4A 1ETOA 3BG5A 4RDUA 1SANA 3LSRA 2K9NA 2K9SA 5DS9A 3PO3J 2H8RA 4M3DA 1AU7A 2HI3A 4A3KJ 3DCFA 4S0HB 4D7NA 3FK6A 3Q0WA 5K7FA 1ZR4A 3LSGA 2OPTA 3JRIA
chains in the Genus database with same CATH superfamily
1FP2A 2XPWA 4NQWB 2KIMA 3HHGA 3IAS2 4XBFA 3NEUA 2QSGX 5M5XJ 1V3FA 2Y30A 2X51A 1OISA 3EUKL 3SFIA 1A36A 3GUDA 1PP7U 2MA3A 3D5LA 1F4KA 1NG7A 2COBA 1MMDA 4WX9A 2UXNA 3DEUA 3DV8A 4XRFA 1YS7A 4NQWA 3HDDA 2DCEA 4N9HA 4HX8A 3IUOA 5HVQC 2LBFA 2YUSA 2RV8A 4RM2A 3Q9SA 2JA7J 4ENNA 1ZR2A 1S7OA 4U7DA 2FRHA 1DQUA 3LL7A 4DJAA 5AIPA 3ERED 4ZTFA 2WWYA 1H9TA 5K1YA 2BVMA 5C3EJ 1PDNC 4RMNA 2FQ3A 4ZDLA 5E1WA 1E0EA 1FOXA 2R5ZA 1VZ0A 3OOUA 5AONA 1MNMC 1U5TC 4RLQA 2VJ4A 5E20A 3NAUA 3U21A 3K4NA 4WCGA 5J1RA 3P7NA 3GX4X 3OYLA 4E7KA 3CCSI 1ZLKA 2W25A 1YW7A 5D8KB 4IOCF 3HM5A 4FHTA 4WXCA 3OY9A 4PSXA 1QRYA 1AOYA 3ZR8X 4L5JA 1GV5A 5B3SH 4XNFA 1D0YA 5J3LA 2Z1DA 5FO5A 3CP8A 2G0EA 4D9JA 4DOZA 3JREA 3M3YJ 3LSIA 2F4IA 3OWTA 3H0GJ 3H5RA 2CJJA 3FBNB 3J7ZI 5HLGA 1K83J 1TT0A 3UNGC 2YU9J 2IS6A 2NNYA 1JTYA 1S6LA 4XLEA 4CCLA 3ABMH 3DBHB 2VXZA 1RETA 1MMNA 4CSWA 3JR9A 3FWEA 1TWGJ 5DYMA 3TW6A 5LGTA 3L7WA 1IW7F 2OF7A 1O7LA 3G2BA 1HW2A 1TC3C 2COMA 1K7AA 2JRMA 3OYGA 3I4MJ 2KDOA 3SZGA 3GZ5A 3LFUA 1V5EA 3TP3A 4BS9A 5GTHC 1ZARA 2FMLA 4W97A 3WTZA 3HOXJ 4CZCA 3CUQB 4EJUA 2O9LA 1WQ2A 2OAZA 1HDDC 1R22A 5K5OA 1LQ1A 1T33A 3RPQA 3VYRB 5A2QZ 4PJMA 1R49A 2R7DA 3WG9A 2MLGA 3FDYA 4OWRB 5LEJA 2DXIA 2Y48A 2QQAA 1W36D 4PCQA 2LRDA 3OYMA 2DQLA 1RUOA 1TLHB 3ASNH 3HB9A 5E3OA 1Z3XA 3CUQA 2K9LA 1XC5A 1S7AA 4M9ZA 2EZHA 5CKTA 2JSPA 1SD4A 2CWEA 4ABZA 1R71A 1QO0D 4YIFA 1A04A 5IYCJ 3IHUA 1VQ8I 1XGSA 3Q3SA 2DT5A 2W85A 3MKLA 1H88C 1OR7C 3C7JA 1WI9A 2ZBKA 4A0YA 2MH2A 3BG9A 4M71A 1BL0A 2NVYJ 4IJAA 2OA4A 1JT6A 2L7FP 4I99C 3L1PA 4I6ZA 2L7ZA 1MZBA 5CJ9A 2V6EA 3G6EI 5LHGA 1EKEA 1MBGA 3LSJA 1R7JA 1XGMA 1RPWA 1Z1DA 5B5EC 2FQ4A 1K78B 3DP7A 2WV0A 2JWTA 1R4MB 3VSLA 2RKHA 3CO7C 3K1NA 3GXOA 4X1EA 4NHJA 1ZK8A 3Q0UA 1T8IA 4HG2A 4IEJA 4ENKA 3QPSA 1NHAA 3FMRA 3QYEA 5EYRA 3A03A 2FD5A 2ISYA 3WHCA 2FX0A 2LLKA 1ETKA 3S1MJ 4MQVA 4Y3OA 4P55A 4II3A 1K78A 5K7ZA 3WU0A 1VQ7I 2OQRA 4M3FA 4A3MJ 5E1XA 4MTDA 1XG1A 4XKBA 3GYHX 1R5ID 3DPTA 2X85A 3OL3A 3VOEA 2AXTC 3CZ6A 2XV4S 4OOIA 2O7OA 3V8LA 4HV6A 4L0YB 2VPLA 4B4CA 3S1QJ 2V9KA 1AKHA 1OJLA 1Z7LA 5GADJ 5J40A 3QQAA 5KAIC 2ZC2A 1LDKB 2DDBA 4AYBA 4ZYAA 4CGZA 1IN5A 2NXNB 5FKNA 1LE8B 3HTSB 5EDNA 2WAQA 3K4KA 3J80Z 3KP3A 1K4SA 3OIPA 4CA0A 4KIGA 3G3ZA 4KN4X 3FKJA 1CGPA 3LMMA 4OU0A 5JHUA 3PSIA 3HGYA 4IRIA 1LE8A 2RQQA 3S1NJ 1FX7A 2IGKA 1BR4A 2CQQA 3HG9A 3ZOBA 2B63J 4PGGA 1ZREA 3K69A 4IQJA 2XAQA 4KISA 2A5YB 2V79A 1R00A 3FX3A 4JBAA 3DU5A 4XMYA 2CQKA 3ECOA 1G59A 1HCRA 3T1BA 3CCJI 4GFBA 5JI6A 2CW7A 1FBQA 1OMIA 4G7HF 2EFNA 1Z91A 2BW3B 5EZHA 4EM2A 2JQ7A 4KNYA 1BI2A 3FZVA 2ZFUA 4BE2A 2H6BA 3JAMZ 5C4XJ 1F43A 1FMVA 4BY7J 4HW0A 2IW5A 2X6YA 1CF7B 5FB2A 1MD0A 3RPUA 2CV1A 3S2HJ 1I6XA 1YE9A 3H3VK 1MBHA 3GLLA 3PFYA 3WGGA 3M7GA 3ZMSA 1EJ9A 2BV6A 2X1EA 4QTRA 2EFWA 2NRAC 1XDSA 3OYHA 3GZ6A 2CUZA 2L3DA 4J19A 3I59B 1CF7A 3FKIJ 2WTEA 4AIDA 2KKOA 2RQPA 3W6KB 4BACA 1N78A 3OV8A 1LVKA 3BY6A 2O8KA 4JK1X 1TTYA 2FNPA 3BCAA 4DNCA 3QU3A 5GPAA 3JRBA 4EMSA 4GGGA 2VN2A 2ADUA 1J7KA 2DFEA 1TW3A 4F52A 3I59A 1XB4A 2FA5A 1T08B 4L0ZB 1JKOC 3AG2H 1BBYA 4BAYA 2YU3A 3S2DJ 3BOQA 1W0TA 3U1DA 5F0HA 2UWMA 2G7HA 3VYSB 1U2WA 3V42A 3BG6A 5B1AH 3A0HC 4FT8A 3PL8A 1Z9CA 1B72B 3SZTA 4L9NA 3BR6A 1ITYA 2D2WA 1VQLI 2KT0A 2MD0A 3R4KA 3T8TA 1RC9A 4LD5A 4CYCB 1OCTC 3BJ6A 5AIQA 1I6HJ 4LLGF 4Q5SF 1ERDA 5ICFA 1ORKA 3MEXA 1FIPA 2K86A 2JK3A 1YG2A 2CS3A 2DTZA 1B72A 3CCQI 3A1YA 2E2HJ 2PJRA 5CQEA 4BXFA 1HW1A 4LK1F 4BNCA 4C9YA 2FXAA 2KIUA 2BYVE 2XRLA 2KL4A 4O3MA 2FEZA 3IC7A 4CYCA 3N4MA 2O0YA 3FK7A 4M74A 4DQ2A 1O3SA 3WTYC 2MFZA 3L2WA 5EZGA 3S3OA 2HTJA 2OJED 1GV2A 3V8KA 2IRFG 1REPC 4V2GA 4BQAA 4U7BA 3QYFA 1QU3A 3DQVC 2DFIA 2XB5A 2FSWA 2JA8J 1FNNA 3I0TA 5E79C 4JX4A 2UXXA 3BC8A 1DGRM 4UY8I 2V26A 1ULYA 3QAHA 3S1RJ 1V55H 3ZQCA 1XMKA 1SVLA 4ZDOA 1GVJA 2L02A 4I76A 3MZYA 3ZMVA 3JSOA 2ME6A 3GFMA 1BC7C 2KZGA 2RREA 1SFKA 2AQFA 3M9AA 1ZRFA 4KA4A 4FX4A 4DYCA 4LJZF 2XKOA 3F23A 4EATA 5FJ8J 3ASOH 4QSHA 2H1KA 2M45A 1ONVA 2OD5A 3TL4X 3QWLA 2JMWA 5IYBJ 2EIJH 3WTWC 1OLTA 3ABUA 3TDUC 3OYBA 1D3YA 5JR3A 3TP0A 3RZOJ 3S8PA 3ERMA 1U6GA 2XAUA 4BEHB 3RJPA 2M7AA 2HGCA 2MG4A 2OU2A 2KFDA 3CJTB 3CC4I 3ZQHA 1Y1VJ 4I98B 3H3UA 3JSPA 1DP7P 4WF2A 4BEHA 4C2UA 3QP6A 4IL6C 1MBJA 2NS8A 1TT5B 2JUGA 4I7HA 1JGSA 4Y17A 3ZQ7A 3I4PA 5DM6F 3CMAI 4LOCA 2LD5A 2MC4A 4MQ9F 3K70D 1F1ZA 1MMGA 3K4BA 2RAEA 1R1UA 3HTUA 1IN4A 1P2FA 2VIXA 1YYVA 1USSA 3DTKA 3AG4H 4OAZA 3WGIA 4G6TB 2JVHA 3E6DA 3BPVA 2IA2A 1OFCX 3BZCA 3CMMA 2Z2SB 4ZYGA 1MDMA 4XLFA 2OTLI 2W4SA 3E3VA 4DZPA 3GVAA 3QPTA 4RB0A 3PUBA 2XAHA 5C4JJ 4X6AJ 1BJAA 3S2WA 3S3MA 1XD7A 1TQIA 2DMQA 2HKOA 1TWCJ 4PJLA 5BQTA 5M3MJ 4XOTA 3BJAA 3CO6C 4KMFA 2DJNA 1Q1VA 3CCMI 2R7ZJ 3GFJA 4HYEA 3H5NA 4XKVA 2KZVA 4BE0A 3RKQA 2LKXA 5K5QA 4YIRX 3O6BB 5JVTA 2PI0A 1TWHJ 3SQNA 5D4RA 2WAEA 1HC8A 2D45A 4ZYDA 4RDUA 1YI2I 5EEGA 2K9NA 2EILH 4ZYHA 4D1QA 2V6CA 2WY8Q 3T0YA 1PVEA 3HRSA 2XDVA 3FK6A 2M8EA 3Q0WA 2OPTA 1OYYA 3M1CA 1UG2A 3SFZA 3EUHC 2JVGA 1O57A 4I09A 4L5EA 2BY2A 2QSFX 4IHXA 2IVMA 2K3PA 2ZJRF 4WXHA 1MBFA 1LNWA 3DPUA 3KIOA 1WJDA 2CYYA 2LK2A 2I8DA 4JQFA 2A6EF 1WSUA 3M8EA 1TWAJ 3LSHA 2YPRA 1GHCA 3P9CA 3MD2A 1VFCA 4IVNA 1WJEA 2OTJI 1FYMA 4ESJA 1YOVB 3AKZA 2CSOA 5JLXA 5F27A 4LLNA 1DDNA 3FIWA 1D5YA 1WJAA 4FX0A 4LB5A 3ZN0A 3RZDJ 5EG0A 1S3JA 1BI3A 4G6DA 2HFHA 5GAGJ 2W1OA 3LA3A 3HOYJ 2FU4A 5F64A 1XCBA 1ETVA 1I39A 3DTIA 4E4HA 3MKYB 4XIDA 2NAZA 4U87A 4ETSA 5J4VA 1X1CA 1VQ9I 5FD6A 1VTNC 4GO1A 3BZKA 3GO5A 3CCEI 1UMQA 2HTSA 3QP5A 3MKZA 1FTZA 4Q48A 2L9RA 3AAFA 1NH3A 1IUYA 1ZN2A 2RVCA 3HZJA 5HDKA 2D1VA 1UG0A 3V8JA 2DAOA 2KIQA 3TBIA 4F92B 2OCCH 1T2KA 4Y33A 4FCYA 1T95A 2XGDA 3GMEA 4LG3A 3I64A 4GCVA 3X2QH 3ZQFA 3BJOA 3RIRA 2R3SA 3QODA 4ZJZA 2OV7A 2CH0A 3EPZA 1W4MA 1XMAA 2BZTA 3OYAA 2DBBA 4XRMA 4QIWN 4XM3A 2MH9A 3JRGA 1WZ2A 2EQRA 2PMZN 3KETA 1HF0A 3HRTA 3HKZA 2BY1A 5FRMA 1MNDA 3L9FA 1PUFA 2ECBA 1YIOA 4EV0A 4A5MA 2P7VB 3MFKA 4LLLA 2OZ6A 1S7EA 2Y2ZA 3IKVA 1BW5A 4I0AA 1QBJA 4RB3C 4BXUA 2HYFA 2K27A 1RRJA 3H9JA 5JVGF 2QKMB 2MGQA 2VL8A 3HRMA 3MZHA 2Z99A 2ECCA 1MW7A 2ELKA 2R7WA 1AA7A 2VKEA 1P6RA 3GW2A 4BQQA 2V1DA 2E2JJ 1QVUA 4MO7A 4LG0B 3FXLA 2Y0MA 1JE8A 2K7LA 2DA7A 3LNQA 1JJ6C 4A3IJ 4A3FJ 3K4JA 1R9TJ 2OQGA 3OS2A 3ZN1A 2ZB9A 1ZGWA 3HRUA 3ZXSA 1DU0A 2VI6A 3AL0B 1RIOH 1RESA 2F4MB 4LG0A 5EGOB 1WJCA 3DBRB 1U3EM 3K7AJ 4XK4A 2VONA 1HKQA 3IP4B 1VQPI 3TOAA 1JT0A 1UHWA 1KGSA 2ZXWH 1ZGJA 1UB9A 3CQZJ 5BPIA 2F5VA 1S72I 2PN6A 4U88A 3FHNA 4S04A 5EGOA 1JUMA 1P7JA 3ABKH 1VQ6I 4EVIA 3F8NA 1IN7A 2ELHA 2I10A 5CLSA 2GXGA 1DGWY 1UELB 3GZNB 3SEQA 3KYCB 3PO2J 1ZLJA 3H9GA 1V4RA 1VF9A 4ZZLA 4KFCA 2M87A 2M8GX 1XGOA 3ECHA 3M1EA 4CUGA 1EA3A 3PM1A 1LJ9A 4PSWA 1XSXA 1QPMA 4OIOF 3CC2I 1MBEA 1VI0A 1Y8QB 2F5DA 3EDPA 4IX7A 3OR2C 1OQYA 2DI3A 1SEUA 3BZ6A 2CQXA 1W7PB 3LAPA 3G71I 2CO5A 2HVRA 2EFQA 2E1CA 2A6TA 2PG4A 1ZRDA 5D8LB 1U8RA 4XRSG 2FBIA 1QA6A 3NQOA 3IRQA 2FMYA 2IGOA 4FE7A 3T8RA 5LEKA 2WC2A 3KEOA 2R7FA 3SEZA 1T6SA 2HDWA 3FMQA 3RYRA 3K4CA 2DFFA 1WRJA 2XAFA 4E7JA 1W7PA 4RB1A 5ICEA 5GPCA 4HNTA 3KYLA 1GT0C 2ZKZA 3WHBA 1W0UA 1O3TA 1GXPA 1HKTA 2Y31A 4LIUA 2DT6A 4EJWA 2F5CA 3OOPA 3F8CA 3HSEA 3SZPA 2XRNA 3BG3A 4M3BA 4A2UA 3L2QA 3CMYA 5JFRA 1SFOJ 2HOTA 2WB1N 2ZCWA 4YELA 2ZFWA 2JZYA 5J8CA 1YRNB 1IRGA 5CVRA 3CCLI 3J7AY 1JHHA 2E1OA 1D1BA 1VQOI 4B1RA 4PFOA 3F8MA 4HSRA 4RB2C 2A69F 5F0CA 4XN3A 4CXFA 2QZ8A 4CYDA 2HOSA 1ACIA 1YRNA 2DDAA 5HDGA 2HVSA 2KPMA 2NYXA 2OUMA 3IWFA 2HPMA 4XLCA 1RZ4A 5FGMA 1RKWA 2LNBA 3LWFA 4R79A 2HS5A 3ELKA 5ED4A 2GQQA 3G1LA 3BR3A 2QWWA 3CJRB 1SAUA 5EEAA 1OCCH 2IP2A 2QBYB 2IBDA 1WGXA 4Y13A 2Z5UA 1MMSA 2VJ5A 4BKXA 2Y9YA 3NRVA 2BY0A 3KZYA 1J2XA 4PGHA 2NVTJ 4HF2A 3SXYA 3BTIA 4YFKF 3J81Z 5BPDA 5LRRA 1FZPB 2C6YA 2BBYA 2PX9A 4C3HJ 2YR2A 1SFEA 2B9SA 2Z33A 3Q5FA 1BI1A 1POGA 4QWQA 1JUPA 4U0WA 3DTEA 3K4LA 1NK2P 1FOYA 2ID6A 4CCJA 3ZQGA 3GF2A 2GOMA 3BTLA 4JX5A 3VYTB 1E3PA 5LHIA 2ZO4A 3FM5A 3PUFA 2WA0A 3FF5A 3BQYA 2V7FA 1UJ8A 3EYIA 1EH6A 3L2RA 4XKCA 1WVRA 3DEEA 1JGGA 2HZDA 3NARA 4E7SA 5ERIA 4UVAA 3VWBA 5DDGA 2L9VA 4YFNF 1LB2A 4OAYA 4XSXF 4J00A 1OYIA 2LYCA 2P8TA 1B1BA 3HPHA 2R92J 3HOWJ 3SHFA 1Z21A 3PIOF 2VT3A 3PSFA 5L3DA 1ETYA 2HOAA 4H4KC 3E0JB 5LD2C 1ZG1A 2H94A 4WWCA 4K2EA 5LHHA 3ZPLA 4D0PA 4J01A 4OINF 2FBKA 4P9FA 5DCMB 2E34A 1GXQA 4W1UA 3LSKA 2KDZA 2W7NA 1XS9A 1Y6IA 4OIPF 2DT7B 2DYRH 3F3XA 5IYDJ 1WCMJ 1U5TB 1STZA 3HXLA 1YIJI 3HOUJ 4HDVA 1EH8A 4BQNA 1ZRCA 3MN2A 2M7BA 1KQ0A 4PJNA 2G9WA 4G94A 3RSNA 3AFHA 2HQNA 2K4JA 3D0SA 5DCMA 3GFLA 3BP8A 5KK1A 2QENA 5ILUA 3ZGKA 4RGUA 3CD6I 3IL2A 2IA0A 2X0LA 1U5TA 2O03A 1TZLA 2D1HA 3GCMA 2MD5A 3AG3H 5D5WB 4XLNF 1GVDA 2VBZA 4NDLA 4DYQA 2AO9A 2XGCA 1OKRA 3WTVC 3BT9A 4EEFG 2YX4A 1MNEA 1GUUA 5B1BH 4ON0A 5BS6A 5ICCA 5E8GA 2CUFA 1SVOA 1JJ8C 3A01B 5EEHA 1X1BA 4LFUA 2PBIA 3K4MA 3WG7H 3CUOA 3KEQA 2ZXHA 3FXUA 1FC3A 2I5UA 3CC7I 1G3SA 1I5ZA 1OPCA 4IHTA 1ON2A 1IGNA 1JKPC 5D4SA 5LFAA 2VKHA 2VKDA 2F48A 3REOA 2DA1A 2XF6A 3KYDB 4AU7A 3CDIA 5FROA 3GTQJ 3NWTA 4YG2F 2Y69H 1N75A 3I3LA 4H0EA 3GTJJ 2MYSA 2Q2EB 1I1GA 2FF4A 2NS7A 3SDBA 1X3WB 4OIQF 1B9MA 1ZGAA 5J47A 2BW3A 3QPLA 4ZH4F 4E7HA 2VKVA 5FLVA 3JTHA 2Y0SN 1DU6A 4LMYA 5H6QA 3WTUC 4IKFA 1BW6A 3F9KA 2L01A 4HAMA 2E60A 1FBSA 3J7YJ 3JRHA 2EIMH 1ETQA 2L4AA 1UHMA 2HYJA 3O8HA 4BJ6C 2OZUA 3HC7A 1JUSA 1W36C 4RA2A 2XROA 5DEQA 1J5YA 2CW8A 1XDUA 1XGNA 2WY7Q 3TO7A 2LREA 4FQGA 1YX3A 2HZTA 2LKSA 3K9TA 1X2MA 4A6DA 2KJCA 2CFXA 2M0CA 2IEKA 4CCKA 1G3TA 1FP1D 3CF5F 3VSKA 3HIFA 1HOMA 3VDXA 3JTGA 1OR7A 4YEJA 3BG5A 2LH9A 1X1DA 1I1SA 2EV0A 2K9SA 5DS9A 4M3DA 1KYWA 2HI3A 1ODDA 4S0HB 3ZP5A 1K6YA 3LSGA 4AM3A 3DWLE 3KP7A 1Y1WJ 3S15J 5D5VB 4KICA 4BDZA 4A3LJ 1KZHA 1FPQA 4R8HA 1IF1A 3HGGA 1HLVA 2V1XA 3ZQQA 1QVTA 3OYDA 1WPKA 1B9NA 1IV8A 2K5CA 2MW8A 4WXDA 2P6SA 2Z3YA 3JRFA 3P9KA 4U0YA 1CQTA 2RNJA 3H3ZA 2MC3A 1V5GA 4UB8C 1N77A 2M1BA 2NOGA 3HOSA 2MSYA 2CRGA 3SDGA 1J0RA 4HX4A 1D8JA 1FBUA 1LDJA 2EFOA 2BVLA 4ZZDA 5E3NA 4BXXJ 2QQ9A 5ICGA 3KE2A 2QQ8A 3TW7A 2GAUA 2QEXI 3V7CA 1S8NA 1F36A 3ZQLA 3ESWB 2V9VA 5F1JA 2X6OA 1BA5A 5GAHJ 2ZMEC 1T98A 2BY3A 2X6WA 3KEYA 2HXOA 4RS8A 2E7XA 5KHDA 9ANTA 2VQCA 3CDHA 4RAZA 2BE5F 3S93A 5L3CA 1PYVA 4CCNA 4DBQA 3DLLF 1ZAOA 4F91B 4Y7NJ 2A05A 2R5YB 1PUEE 4GYGA 4L5IA 1YJWI 1PP8F 2R7SA 1HKSA 2LR8A 3TDZC 5JLWA 5HNFA 2VBXA 1LEBA 3A02A 3GTPJ 4DYRA 4A5NA 1MGTA 1D5VA 2R5YA 2L7KA 1RUNA 4HLYA 3K1MA 3S17J 3GFIA 1FMWA 3DXJF 1QGPA 2RC4A 2BOLA 3EQLF 3FM3A 2R93J 4G7OF 3FMSA 5HLTA 3IAM2 1XCVA 2PEXA 5ILSA 4ZDPA 4HOBA 2JSCA 2F5FA 2HU9A 2XAGA 1O7FA 2JN6A 1D8KA 5DD4A 5D5UB 2MLKA 4UHTA 2O61A 2P7CB 2AHQA 2OBPA 3I4NJ 4HNVA 2K40A 3QOPA 1HA8A 1S9HA 2FOWA 2DU9A 2RNGA 2M0MA 3BTCA 2HVQA 1WHUA 1WJFA 3J7AO 2DA6A 1WWXA 2EA2A 2ZJQF 4EM0B 4D7MA 3RKWA 3OYNA 4TV7A 2DTRA 2G7UA 3HUGB 4M3GA 1BOBA 2R7VA 2NNNA 4OMYA 4ANJA 1Z77A 3WU1B 4XSZF 4RGRA 4L9JA 2CQNA 3HPGA 2VPRA 4IQ4A 5A2QK 3C2BA 2EJRA 3N97A 3KZZA 2VQLA 3HUGA 2E1NA 1A6IA 4LGWA 1FLIA 3QU6A 2E19A 2HQAA 1X3UA 2XGXA 3TKYA 4A12A 2CV0A 1E17A 4IHSA 3BG7A 3I55I 3OSFA 2Y9ZA 1TP4A 2QCOA 3E6CC 4OIRF 5FKLA 4L18B 5TRDA 2JPCA 5FKOA 3ISPA 1O3QA 2KLOA 5E18F 4I2OA 2LP0A 4UUTA 4BQOA 3MKWB 1WJ5A 2VC1A 3CLQA 1SD6A 3KP4A 5FLXZ 4RGSA 2XPVA 1SD7A 3L09A 4XLAA 3OR1C 2X48A 1DP3A 3F22A 1LFPA 1WH7A 3DKXA 2W82A 1ETWA 2ACJA 2KQRA 2A68F 5KAFC 2FOKA 4EJTA 2M34A 1B8IB 3H92A 3ZMDA 3PQJA 2LG4A 2QKLB 1KU3A 4A3EJ 3H0DA 3LOCA 2HEOA 2NVQJ 5LRSA 3COAC 4CICA 2E7WA 4XQFA 5J1UA 1IUFA 4N0BA 1YITI 3KP2A 4B8XA 1G6NA 4HQMA 1H89C 2EINH 1MIJA 4DW6A 4E6KG 4UUVA 2ZMEB 3B73A 4BUPA 1YO5C 1B8IA 1FOKA 3LQQA 5BNGA 5KNLA 4KUMA 2EH3A 1R23A 2DA4A 3I71A 5J1YA 2PLYA 5E1ZB 3L2UA 1IN8A 4MHGA 4V19K 2H09A 3ONQA 2P5KA 4EGZA 2O3FA 2AQEA 1UAAA 1YHQI 2JPBA 1R6RA 3GLXA 3PJRA 3SYTA 4MEXF 1OCPA 2O5RA 4YFXF 1TQPA 3BR5A 4ITVA 4YRVA 2XB0X 5BOXA 1TQMA 2ESHA 3D1NI 1D0ZA 4MFDA 2GIVA 4B44A 3SJMA 4BHCA 1KQ8A 3RPUD 1G8XA 2NOJB 2DOEA 4MGRA 5HLIA 3OIQA 4I0BA 3ROUA 5KCMA 4F55A 4HA8A 4KIFA 4IOAF 2ELJA 5EJCA 2R7RA 1A5JA 2ZJPF 2GOXB 2ZNYA 1BN5A 3J80K 4G7ZF 2VQGA 2LY2A 3JRDA 3PQKA 3M07A 3CCUI 4MFEA 2MABA 3F8BA 1MKMA 3OYKA 2DLLA 2HR3A 4LB6B 2OC6A 4PFPA 4BYYA 4CZZA 4BGDA 3RCOA 1S29A 2H8WA 1KU7A 4UNOA 3RQ4A 4KIBA 1Y39A 3ZMUA 2VUMJ 3U1KA 1YW8A 1NK3P 4U0VA 3RYPA 2GA2A 1G3YA 2K4BA 4EGYA 3CESA 3O2PE 3CF2A 5LGNA 1K79A 2E5ZA 3K70C 2CFOA 2P81A 1LKXA 1VNDA 3CUQC 4UUSB 1R36A 3K10A 2KRHA 3GTGJ 3LFKA 2WV1A 4C3JJ 3EETA 4IRGA 5BMZA 2B7EA 3CDLA 5J4YA 2M5WA 3KX2A 1U0JA 1APLC 1LFUP 3TGNA 2O6GE 4II2A 5CVJA 3I5UA 3ABLH 3JRAA 1T39A 4NNJA 1E2XA 2STTA 1J59A 2BXZA 1J75A 2EA4A 2L54A 1XMXA 3MMYB 1T38A 1SMTA 2DO7A 4IHWA 4AWXB 2LY9A 5H2FC 3BCBA 1BIAA 1YW9A 2AXLA 3JAMK 1X1PA 2XVCA 5HDNA 4NUBA 1BR1A 2UZKA 1Z6TA 3IWZA 2M9HA 1RNLA 4IPAA 3L2VA 2M2EA 4A0XA 4AVPA 4HV5A 3IH2A 3H1CA 1I3QJ 5D5XB 1MBKA 4RGXA 3DBLB 4BU2A 4Y4RA 5FKKA 2VT2A 2J5OA 4BH9A 3F21A 1VQNI 1RR7A 3IV5A 4BE1A 1K4TA 3TO9A 5E8IA 1LPQA 3OYCA 4MEYF 1K6OA 2PJPA 3TO6A 2VC0A 2DMTA 2KRCA 2R0QC 2E71A 4BL0B 3K6GA 1D1CA 4M9XA 3EUHA 4DZJA 2JA5J 2LBFB 3CMEI 2IS1A 2ZJ2A 3A4CA 2LY1A 2X4HA 2NS0A 4Q47A 3PNVA 1T56A 5HS7A 1W5SA 1R1TA 4PZJA 3HBLA 2E5NA 2HQRA 1UCRA 2QQBA 2TCTA 2V1NA 1SAXA 2E36A 2XIGA 4JP0A 4XN0A 2L9NA 2IT0A 5CVIA 1WKMA 1BJZA 5FRNA 1I3AA 2R5ZB 1YTYA 4M73A 1QZEA 4ENMA 1HXDA 2BHYA 1USTA 3CJQB 4AVZA 2IS4A 3F72A 2LDUA 4F93B 3W2AA 1IN6A 5IT9Z 1U9OA 2VJJA 2P0WA 3OYIA 1EH7A 3KFWX 3LQRA 4P5OA 4MTEA 4ESBA 4Z2YA 2QA4I 3I53A 2ZSIB 1TNSA 4C2MJ 4E7IA 4X0GA 5C44J 2VODA 4KT6A 2M4GA 2K85A 4Y15A 1IG7A 4AUXA 1LVAA 1I27A 3MCZA 4L9VA 3W2WA 5F04A 5L3EA 2GLOA 3WTXC 1ZKGA 3VB2A 2P5VA 3G1OA 4UV9A 5DTDA 3QPHA 3DF8A 3BR1A 3OMYA 4PDKA 2Z9OA 2JA6J 3EYYA 1P4XA 2CV2A 2HDDA 3LSPA 3E97A 1BI0A 1LUJB 2F2EA 4FE4A 3TMOA 1F9NA 1N25A 2JT1A 1MH4A 3WU2C 5TGTA 1FWZA 2LKPA 5CQGA 3M8JA 2W57A 4P9UA 1K61A 5F08A 5CVUA 2VOPA 3E5UA 1V54H 3VFZA 2K02A 2IGNA 3L2CA 4IRHA 3H35A 3KZIC 3CLOA 4XORA 1HDPA 2QLZA 4HPQA 2XGEA 3FBIB 2V9PA 1LEAA 3D5RC 2X1DA 2O8XA 2DJIA 2PQ8A 1OCOH 1P92A 2CGPA 3JCUC 1TBXA 1FTTA 2XHKA 1U9NA 4CDGA 2DQRA 4M9SA 1X19A 2E35A 4JYKA 2H27A 2QBYA 1W5TA 3V7SA 3DEWA 1VQMI 4RM3A 2IPQX 5DUIA 2CUEA 1PJRA 1A35A 2K9MA 1FEXA 1J09A 5IPAA 5L3FA 4BY1J 3A2KA 2PFBA 1R5HA 3CTAA 1XSVA 4UVCA 5E3LA 3W6JB 3G73A 5DV5A 3U9GA 2IAIA 3WODF 3DU6A 3CP2A 1KU2A 5DCFA 4IXAA 1R4NB 5HLHA 2EFPA 4C30A 2V1UA 1ZG3A 5FKMA 3HOZJ 3L00A 1MJAA 1ETOA 4PK4A 2J5PA 3LSRA 3PO3J 3C1DA 2X1CA 3MZ8A 1KA8A 1T0FA 3BPXA 3ZRGA 2UV1A 4A3KJ 1AU7A 2GXBA 2KJBA 2STWA 4EM1A 5K7FA 1ZR4A 1XTAA 3U2RA 1DPUA 4KT5C 5K7HA 1QNTA 2XPUA 3W3CA 1GLNA 4UB6C 3HYIA 2WADA 2VLAA 4A3BJ 4KN7X 1ZQ3P 1UHSA 2M3AA 3BR0A 3F8FA 1UFMA 3TQNA 3FXQA 3PFIA 3H9QA 3G4SI 3M8FA 1IXRC 2P4WA 1R5GA 2VJIA 2R7OA 2VE8A 1HSTA 2V4JC 2IGMA 5M5YJ 1V5FA 1IXSB 5DUKA 4ENJA 4XR6A 1X3ZB 4WK8F 4AIHA 4A3JJ 1AKHB 5CVVA 1I50J 3O3KA 4ZC3A 1ENHA 1H0MA 2NVUB 3B6AA 3E6BA 2Z16A 3RKXA 1ETXA 2LOOA 3D5SC 5TJJA 3I9V2 2HNHA 1JI8A 4CO8A 4L9TA 3FXOA 5FFZA 4Q4ZF 3R6SA 2DA2A 4OMZA 3JRCA 2EZLA 2A61A 3Q9VA 1O4XA 1HW5A 1QZZA 4GXOA 3AG1H 2WBMA 1U78A 5L3GA 3DKYA 2GBYA 3OSGA 2L5QA 1B59A 1WI3A 4EQQA 2JA2A 3OYFA 2EK5A 2XC7A 3TOBA 1VQ4I 4XICA 2PMZA 5H6RA 2A6HF 2N8GA 4E7LA 1JKRC 4HF0A 1ZELA 3LA2A 3S3NA 5FLXK 5FLMJ 5HOOA 2IA1A 3A0BC 2HYGD 3QOEA 3G1MA 4HF1A 4F3QA 4A3DJ 2JUCA 1ZYRF 2TRTA 4XOPA 3C2HA 3VODA 3ML6A 1ZHFA 5HS9A 1TWFJ 5IP6A 5EF6A 4E70A 3ZQIA 5HNHA 2VXDA 1IV6A 3A01A 1KYZA 2CG4A 3V4GA 4MLOA 1FSEA 3NWSA 1SFUA 3DFGA 3W2VA 3UR3C 1XSDA 4S05A 2M4KA 1YLFA 4KITB 1QQIA 2BHZA 5ILVA 3FXKA 3GTKJ 4G6QA 3KLNA 4KDPA 2KISA 2DPDA 1BM9A 2A3SA 3P9IA 3HHHA 2DK8A 2RN7A 4BDYA 2ETHA 2VASA 2B0LA 2ISZA 1MSFC 1AWCA 5J6XA 3DPLC 4A3GJ 3WE3A 4ZTJA 1WH5A 4M6YA 4C2TA 2Q2EA 1P4AA 1RI7A 1W1WE 3FISA 1BOAA 2BEOA 4PJJA 2EZIA 4BHPA 4ASNA 3KLOA 3E5XA 1ON1A 4MNUA 1H8AC 4HLXA 1O3RA 2Y75A 5GTIC 1TW2A 1RKTA 1G4DA 5JHFA 3FXJA 1QZYA 4XKWA 2ICWG 2W84A 3T5XA 4IZZA 3I56I 1MJBA 1JTXA 3HKZN 5GP9A 4AIKA 2CQ7A 2E2IJ 4LITA 1R1VA 2VB6A 4C3IJ 1ZG5A 3VPRA 1JHFA 3S16J 1IC8A 1LFBA 3RKYA 4KMUX 4GDFA 3QYBA 1GDTA 2VBYA 1HQCA 1Z67A 4XL9A 5IOZA 2KP6A 4A93J 2UUZA 2ME0A 2FNAA 3OS0A 4YIIA 3R0AA 1X4OA 5IT3A 2DYSH 1H9GA 4CCMA 2KRFA 5CYVA 1SC7A 2PJRB 2L7MP 3KPHA 1IRFA 2DFHA 3OIOA 3OS1A 1BR2A 3WGHA 1JKQC 3K2AA 2XUBA 3N05A 3MVPA 1EV7A 2GIZA 3DKWA 1IDZA 1YJ9I 2VBWA 4UVBA 4GYIA 5HS8A 3ABTA 1RR8C 2DODA 1W7PD 2HPIA 4B3XA 3MWMA 1P4WA 3H5AA 4FASD 5L3BA 3IRRA 3S14J 2HWVA 1Z6RA 2AS5F 2WB1A 3GTOJ 3O8GA 3BLYA 2HKXA 1FY7A 4E7ZA 2JRTA 3K1PA 1Q1HA 1IZ1A 4GRIA 1XN7A 2GM4A 3R60A 4RLFA 1E3HA 2JTVA 4ZYEA 2QVOA 3MQ0A 5E3MA 3MAJA 1W5CC 4LK0F 1YJNI 1M1EB 6PAXA 1SD5A 2CW0F 2ZSHB 2TDXA 4HNUA 4CHUA 2L9SA 2ZNZA 4B43A 4EJOA 1MH3A 3GEZA 2L0KA 4BJ5C 3H36A 2FBHA 1FSHA 2LF7A 5F1RA 2FJ1A 1L3LA 4KYWA 5K5RA 1X2NA 2W00A 2Q0OA 4I01A 2L2OA 1C0WA 5E17F 3E7LA 1Y56A 4NC6A 3PIPF 1Z7UA 1MSEC 2EB7A 2K3FA 3DLAA 2LFBA 2RGVA 2HDCA 5D6FA 1IRXA 5D6EA 3TEDA 5M3FJ 3CCYA 1VQ5I 3GTLJ 1IO2A 2XF7A 5TISC 4DBRA 4P96A 1YX5A 3HSRA 5IT9K 5B66C 2H1LA 3ZMTA 3KP5A 4V2FA 1P9QC 4XLHA 3HOTA 4JX6A 4NBQA 2K9QA 1YS6A 2QUFA 2XAJA 2CU7A 2PMUA 2WAFA 4F7ZA 4XRSA 3BROA 4CCOA 1TL8A 2R7UA 1X58A 1Z3YA 3R0JA 3JW4A 2EIKH 3PNYA 1UZCA 1SFXA 2HOEA 3F0CA 3IH4A 3RDIA 2DK5A 2XASA 2A5WA 1MDMB 2DMUA 4QPOA 3RI4A 2E1MC 4IHVA 1Y8RB 2X9DA 4M6XA 3ULQB 2YS9A 1IDYA 4M72A 2Q8KA 1JXSA 3FXMA 5DD8A 4D5CA 5DM7F 2QYOA 4AC0A 2HXIA 4RAGA 3HL2A 1B4AA 3ZCOA 3UKGA 1AHDP 1IXCA 3C18A 4CH7A 1DPRA 3IH3A 4HQEA 3W6VA 3C2GA 1SVMA 1TNTA 3KP6A 1FIAA 3B6CA 2LVSA 1D1AA 2HQ5A 4XONA 3WTTC 4QPQA 4RAFA 3Q0VA 2W48A 3OYEA 2QF7A 3S32A 2VOOA 4IO9F 2MBFA 4G9YA 4DIQA 1B6AA 1Z05A 1MMAA 5LGUA 3AL0C 2JJ7A 2F5EA 3LSMA 2EPFA 4BJTA 1OCRH 3OYJA 2DN0A 2EBIA 3J81K 1OCZH 4B47A 4O6JA 1VQKI 4D5FA 2X6XA 4NC7A 5CPRB 5FD5A 1KQ9A 1P7IA 2YSRA 2KHMA 3PNTA 3CCRI 5IP9J 1D0XA 1QHHD 1WFXA 2CMPA 2KIFA 2DA5A 4A0ZA 3HJEA 4LIVA 5FFXA 4N9IA 3FHZA 2VQHA 4Y52J 4G12A 1HSJA 4RAYA 3F6OA 1L0OC 3ZMZA 1XX5A 4DGWB 5EG0B 1FYLA 4XLPF 2GWRA 3BTJA 4BBSJ 1F5TA 2XKPA 1E3OC 4HDUA 1X1AA 1ZTRA 3M4OJ 2KMUA 2DW4A 4AD9A 4N4OB 3HOVJ 3CCVI 2NVXJ 2BGCA 4PUSA 1QPIA 4EJVA 4B48A 2EV5A 2FUG2 2M30A 1BIBA 4KJZA 1NTCA 2P5LC 2LSOA 2EV6A 1U8BA 2R4GA 2IXSA 1Y0UA 3BDDA 4HX7A 3WTSC 4MIMA 2F4OB 3E6MA 4A69C 3I58A 5M5WJ 3F6VA 4B09A 4RBOA 1R58A 2LMDA 1BC8C 3CJNA 4UXNA 3K2ZA 2ZMEA 5KVRA 4A3CJ 1IRZA 4BBRJ 2GXAA 3B02A 2R7QA 4HSTA 4FETA 2DOAA 1Y0NA 3P5JA 1XPXA 3I54A 1SMYF 2D5VA 3QRFF 1KONA 2DOFA 1YQAA 5F6FA 2OCEA 2YX7A 3RQIA 4HBLA 2Y0SA 1J9IA 4AYBN 4M3EA 4O5VA 2CUJA 4FISA 2F6CA 3E1SA 2WAQN 3LAJA 1HBXG 3EUAA 1Z0XA 3C3WA 2ID3A 3GBGA 4B3AA 4FTHA 3VEPA 2L4MA 4UV8A 5H20A 2XSDC 3KCCA 1MJ9A 2ZXIA 2GZWA 2PMHA 3BWGA 2A07F 1PUFB 1IAWA 3K0LA 3BR2A 3IKTA 3BQZA 5HODA 1FJLA 4Z6YA 4IF4A 4PJ0C 1WJBA 3GWZA 2IJLA 1ZH5A 4G8XA 4R1HA 4NB5A 1A31A 4AIJA 1OYWA 2QGUA 2QM3A 4NC8A 5F0FA 2EWNA 4BHBA 5LLQA 5IY5H 3FXRA 2EZKA 3HEFA 1G2HA 1A6QA 3OL4A 4HEA2 4JOMA 1YFHA 1DUXC 2R7XA 1FT9A 2E1MB 5GAEJ 3R61A 3VYUB 4A6EA 4ESFA 2VE9A 2R7TA 2ESNA 1X4PA 2DA3A 2FE3A 4UUSA 4QLCU 1LDDA 3GTMJ 2RDPA 4P1WA 1IJWC 3E5QA 4N4NB 2LC2A 1NG6A 4IHYA 2GA1A 4HZFA 3WE2A 4I02A 4HRIA 2LTPA 2QSHX 5J8FA 3RTRA 2DMPA 5LBQA 2DPUA 2P6TA 2DMNA 3HSFA 3LA7A 2XSJC 1S5LC 1KU9A 1FYKA 3LSTA 1G3WA 5IOYA 5IP7J 4M6VA 2BXYA 1EF4A 2IS2A 2XF5A 1SANA 2H6CA 1QHGA 1T0FC 2Q1ZB 2W24A 2H8RA 1FOWA 3DCFA 2ZXJA 2LF8A 4D7NA 3V7RA 3JRIA
chains in the Genus database with same CATH topology
2XPWA 1UG2A 3S15J 1Y1WJ 4A3LJ 5K7HA 2XPUA 4L5EA 5M5XJ 4IHXA 2Y30A 3HGGA 1HLVA 1MBFA 1QVTA 4A3BJ 1WPKA 3SFIA 2MW8A 2LK2A 1ZQ3P 1UHSA 3BR0A 2COBA 3JRFA 1TWAJ 1CQTA 1VFCA 3HDDA 5M5YJ 2YUSA 2NOGA 5JLXA 5F27A 4A3JJ 2MSYA 2CRGA 3SDGA 1AKHB 1I50J 2JA7J 1ENHA 3FIWA 1ZR2A 1D5YA 3B6AA 5E3NA 4BXXJ 3RZDJ 1ETXA 5EG0A 5C3EJ 3TW7A 3HOYJ 2R5ZA 1ETVA 3OOUA 1MNMC 1F36A 4XIDA 3ZQLA 2DA2A 3JRCA 1O4XA 2EZLA 3NAUA 5F1JA 5J1RA 2X6OA 1BA5A 1U78A 2GBYA 1UMQA 2HXOA 3OSGA 3HM5A 1WI3A 9ANTA 1FTZA 1QRYA 4XICA 2L9RA 2N8GA 1JKRC 1GV5A 4Y7NJ 5FLMJ 2R5YB 5J3LA 2G0EA 3G1MA 3JREA 3M3YJ 4A3DJ 2TRTA 2LR8A 4FCYA 3H0GJ 5JLWA 2CJJA 2XGDA 1TWFJ 5IP6A 1K83J 5EF6A 3ZQIA 2YU9J 3A02A 3GTPJ 1JTYA 1IV6A 4DYRA 3A01A 3ZQFA 2R5YA 4MLOA 1RETA 3JR9A 3S17J 1TWGJ 3TW6A 2OF7A 1TC3C 4XRMA 4QIWN 2R93J 3I4MJ 3GTKJ 3JRGA 2EQRA 2PMZN 1HF0A 3TP3A 4W97A 3HOXJ 1PUFA 1MSFC 2JN6A 2ECBA 2O9LA 1HDDC 4A3GJ 1S7EA 2Y2ZA 1BW5A 1T33A 1WH5A 2AHQA 3FISA 3I4NJ 4HNVA 2EZIA 2K40A 2MGQA 1H8AC 3BTCA 2ECCA 3HB9A 5E3OA 2ELKA 1RKTA 2VKEA 2DA6A 1XC5A 2E2JJ 1QVUA 4MO7A 2EZHA 4D7MA 4ABZA 2DA7A 5IYCJ 3LNQA 1JJ6C 4A3IJ 3Q3SA 4A3FJ 3MKLA 1R9TJ 4M3GA 3HKZN 1JTXA 5GP9A 1H88C 2E2IJ 2ZB9A 3BG9A 1ZGWA 1Z77A 4C3IJ 1DU0A 1BL0A 2VI6A 2NVYJ 1JT6A 1RESA 2L7FP 3VPRA 3L1PA 2L7ZA 4I6ZA 2VPRA 3S16J 5EGOB 3C2BA 1IC8A 1LFBA 1MBGA 3LSJA 3K7AJ 1GDTA 4XK4A 1A6IA 1RPWA 5IOZA 2E19A 2FQ4A 1JT0A 4A93J 2JWTA 2ME0A 3CQZJ 4X1EA 3OSFA 1ZK8A 3Q0UA 2Y9ZA 4IEJA 3QPSA 2QCOA 5FKLA 5EGOA 5EYRA 1JUMA 3A03A 2L7MP 1P7JA 5FKOA 2FD5A 3WHCA 2I10A 2FX0A 2LLKA 1ETKA 3S1MJ 3OIOA 2LP0A 4UUTA 5K7ZA 3PO2J 1JKQC 4M3FA 3K2AA 1VF9A 3MVPA 1IDZA 2M8GX 4A3MJ 2XPVA 3PM1A 1XG1A 2X48A 1WH7A 1MBEA 1ETWA 1VI0A 3S14J 2M34A 1B8IB 2CQXA 3GTOJ 2O7OA 3O8GA 4A3EJ 4B4CA 3S1QJ 3LOCA 1AKHA 1OJLA 2NVQJ 2GM4A 4XRSG 3QQAA 5J1UA 1IUFA 4FE7A 5E3MA 1H89C 1LE8B 5FKNA 4DW6A 1B8IA 5BNGA 5EDNA 2EH3A 2DA4A 5J1YA 5GPCA 1MH3A 2L0KA 1GT0C 3WHBA 1W0UA 2FJ1A 2Y31A 1X2NA 3HGYA 3BG3A 4M3BA 1LE8A 3E7LA 1OCPA 3CMYA 2HOTA 1SFOJ 3S1NJ 2WB1N 3BR5A 1MSEC 2XB0X 1YRNB 2CQQA 2LFBA 2E1OA 3ZOBA 3D1NI 4MFDA 3SJMA 2B63J 4B1RA 3TEDA 5M3FJ 3CCYA 3GTLJ 1HCRA 5F0CA 4GFBA 1A5JA 2HOSA 4V2FA 1YRNA 3JRDA 4JX6A 4MFEA 2K9QA 2CU7A 5EZHA 1RKWA 4XRSA 5C4XJ 1F43A 4BY7J 2VUMJ 1X58A 3G1LA 3BR3A 3S2HJ 1NK3P 5EEAA 3H3VK 1MBHA 2IBDA 3F0CA 1WGXA 3IH4A 2P81A 4UUSB 1VNDA 3GTGJ 4BKXA 2DMUA 4QTRA 4IHVA 2WV1A 2Y9YA 2X9DA 4C3JJ 2NVTJ 2YS9A 1IDYA 3CDLA 3BTIA 4D5CA 1APLC 4J19A 4AC0A 1LFUP 2HXIA 3FKIJ 3JRAA 3UKGA 4C3HJ 1AHDP 2O8KA 3IH3A 3W6VA 1POGA 1JUPA 5GPAA 3JRBA 4IHWA 2LY9A 1FIAA 3B6CA 1NK2P 2LVSA 2HQ5A 2ID6A 3ZQGA 3Q0VA 3BTLA 2W48A 4JX5A 2M9HA 2QF7A 2M2EA 1JKOC 3IH2A 3BQYA 3S2DJ 1W0TA 1I3QJ 2JJ7A 1MBKA 5F0HA 1B72B 5FKKA 3BR6A 2DN0A 2EBIA 1ITYA 1JGGA 2KT0A 3NARA 4D5FA 1RR7A 3IV5A 1P7IA 4CYCB 1OCTC 1I6HJ 1ORKA 2DMTA 5IP9J 2R0QC 2R92J 3HOWJ 1FIPA 2JK3A 2DA5A 4DZJA 2DTZA 1B72A 2JA5J 2E2HJ 4Y52J 4G12A 1ETYA 2HOAA 1T56A 3HBLA 2XRLA 2TCTA 4JP0A 4CYCA 3FK7A 5EG0B 3BTJA 4BBSJ 4W1UA 1E3OC 1BJZA 5EZGA 2KDZA 1ZTRA 3M4OJ 1GV2A 2R5ZB 1XS9A 3HOVJ 2NVXJ 4V2GA 5IYDJ 1WCMJ 3HOUJ 1QPIA 2XB5A 3MN2A 2JA8J 4JX4A 1U9OA 1NTCA 3S1RJ 1U8BA 3ZQCA 4I76A 4MIMA 4A69C 4C2MJ 2ME6A 5C44J 5M5WJ 4RBOA 1IG7A 1GVDA 4AUXA 4A3CJ 4NDLA 4DYQA 4BBRJ 4DYCA 2AO9A 1IRZA 2XGCA 3BT9A 4EEFG 5F04A 2D5VA 2GLOA 5FJ8J 4QSHA 1ZKGA 2H1KA 1GUUA 3G1OA 5DTDA 2CUFA 2JMWA 5IYBJ 3BR1A 1JJ8C 3RQIA 2JA6J 3A01B 4AYBN 4M3EA 3LSPA 2HDDA 3TP0A 3RZOJ 4FISA 4FE4A 2MG4A 2WAQN 3GBGA 1Z0XA 2ID3A 4B3AA 4FTHA 1MH4A 3ZQHA 1K61A 1IGNA 1JKPC 2XSDC 5F08A 1Y1VJ 2DA1A 1PUFB 3BR2A 3GTQJ 3BQZA 5HODA 1FJLA 1HDPA 1MBJA 2NS8A 2XGEA 3GTJJ 4LOCA 2LD5A 2NS7A 5F0FA 3QPLA 2VKVA 5FLVA 2EZKA 2Y0SN 3HEFA 2RAEA 1DU6A 1FTTA 1G2HA 1BW6A 1U9NA 3JRHA 1ETQA 4JYKA 2HYJA 3O8HA 1OFCX 2DA3A 4UUSA 3DEWA 1JUSA 3GTMJ 2CUEA 1IJWC 4DZPA 4X6AJ 5C4JJ 1FEXA 5IPAA 4IHYA 4BY1J 2DMQA 1TWCJ 2LTPA 5M3MJ 2DMPA 5E3LA 2DJNA 2IAIA 1Q1VA 1X2MA 2R7ZJ 2DMNA 2M0CA 2LKXA 3RKQA 2IEKA 1TWHJ 5IOYA 5IP7J 5FKMA 1HOMA 3HOZJ 4M6VA 1EF4A 1ETOA 3BG5A 4RDUA 1SANA 3LSRA 2K9NA 2K9SA 5DS9A 3PO3J 2H8RA 4M3DA 1AU7A 2HI3A 4A3KJ 3DCFA 4S0HB 4D7NA 3FK6A 3Q0WA 5K7FA 1ZR4A 3LSGA 2OPTA 3JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPW A;  1UG2 A;  3S15 J;  1Y1W J;  4A3L J;  5K7H A;  2XPU A;  4L5E A;  5M5X J;  4IHX A;  2Y30 A;  3HGG A;  1HLV A;  1MBF A;  1QVT A;  4A3B J;  1WPK A;  3SFI A;  2MW8 A;  2LK2 A;  1ZQ3 P;  1UHS A;  3BR0 A;  2COB A;  3JRF A;  1TWA J;  1CQT A;  1VFC A;  3HDD A;  5M5Y J;  2YUS A;  2NOG A;  5JLX A;  5F27 A;  4A3J J;  2MSY A;  2CRG A;  3SDG A;  1AKH B;  1I50 J;  2JA7 J;  1ENH A;  3FIW A;  1ZR2 A;  1D5Y A;  3B6A A;  5E3N A;  4BXX J;  3RZD J;  1ETX A;  5EG0 A;  5C3E J;  3TW7 A;  3HOY J;  2R5Z A;  1ETV A;  3OOU A;  1MNM C;  1F36 A;  4XID A;  3ZQL A;  2DA2 A;  3JRC A;  1O4X A;  2EZL A;  3NAU A;  5F1J A;  5J1R A;  2X6O A;  1BA5 A;  1U78 A;  2GBY A;  1UMQ A;  2HXO A;  3OSG A;  3HM5 A;  1WI3 A;  9ANT A;  1FTZ A;  1QRY A;  4XIC A;  2L9R A;  2N8G A;  1JKR C;  1GV5 A;  4Y7N J;  5FLM J;  2R5Y B;  5J3L A;  2G0E A;  3G1M A;  3JRE A;  3M3Y J;  4A3D J;  2TRT A;  2LR8 A;  4FCY A;  3H0G J;  5JLW A;  2CJJ A;  2XGD A;  1TWF J;  5IP6 A;  1K83 J;  5EF6 A;  3ZQI A;  2YU9 J;  3A02 A;  3GTP J;  1JTY A;  1IV6 A;  4DYR A;  3A01 A;  3ZQF A;  2R5Y A;  4MLO A;  1RET A;  3JR9 A;  3S17 J;  1TWG J;  3TW6 A;  2OF7 A;  1TC3 C;  4XRM A;  4QIW N;  2R93 J;  3I4M J;  3GTK J;  3JRG A;  2EQR A;  2PMZ N;  1HF0 A;  3TP3 A;  4W97 A;  3HOX J;  1PUF A;  1MSF C;  2JN6 A;  2ECB A;  2O9L A;  1HDD C;  4A3G J;  1S7E A;  2Y2Z A;  1BW5 A;  1T33 A;  1WH5 A;  2AHQ A;  3FIS A;  3I4N J;  4HNV A;  2EZI A;  2K40 A;  2MGQ A;  1H8A C;  3BTC A;  2ECC A;  3HB9 A;  5E3O A;  2ELK A;  1RKT A;  2VKE A;  2DA6 A;  1XC5 A;  2E2J J;  1QVU A;  4MO7 A;  2EZH A;  4D7M A;  4ABZ A;  2DA7 A;  5IYC J;  3LNQ A;  1JJ6 C;  4A3I J;  3Q3S A;  4A3F J;  3MKL A;  1R9T J;  4M3G A;  3HKZ N;  1JTX A;  5GP9 A;  1H88 C;  2E2I J;  2ZB9 A;  3BG9 A;  1ZGW A;  1Z77 A;  4C3I J;  1DU0 A;  1BL0 A;  2VI6 A;  2NVY J;  1JT6 A;  1RES A;  2L7F P;  3VPR A;  3L1P A;  2L7Z A;  4I6Z A;  2VPR A;  3S16 J;  5EGO B;  3C2B A;  1IC8 A;  1LFB A;  1MBG A;  3LSJ A;  3K7A J;  1GDT A;  4XK4 A;  1A6I A;  1RPW A;  5IOZ A;  2E19 A;  2FQ4 A;  1JT0 A;  4A93 J;  2JWT A;  2ME0 A;  3CQZ J;  4X1E A;  3OSF A;  1ZK8 A;  3Q0U A;  2Y9Z A;  4IEJ A;  3QPS A;  2QCO A;  5FKL A;  5EGO A;  5EYR A;  1JUM A;  3A03 A;  2L7M P;  1P7J A;  5FKO A;  2FD5 A;  3WHC A;  2I10 A;  2FX0 A;  2LLK A;  1ETK A;  3S1M J;  3OIO A;  2LP0 A;  4UUT A;  5K7Z A;  3PO2 J;  1JKQ C;  4M3F A;  3K2A A;  1VF9 A;  3MVP A;  1IDZ A;  2M8G X;  4A3M J;  2XPV A;  3PM1 A;  1XG1 A;  2X48 A;  1WH7 A;  1MBE A;  1ETW A;  1VI0 A;  3S14 J;  2M34 A;  1B8I B;  2CQX A;  3GTO J;  2O7O A;  3O8G A;  4A3E J;  4B4C A;  3S1Q J;  3LOC A;  1AKH A;  1OJL A;  2NVQ J;  2GM4 A;  4XRS G;  3QQA A;  5J1U A;  1IUF A;  4FE7 A;  5E3M A;  1H89 C;  1LE8 B;  5FKN A;  4DW6 A;  1B8I A;  5BNG A;  5EDN A;  2EH3 A;  2DA4 A;  5J1Y A;  5GPC A;  1MH3 A;  2L0K A;  1GT0 C;  3WHB A;  1W0U A;  2FJ1 A;  2Y31 A;  1X2N A;  3HGY A;  3BG3 A;  4M3B A;  1LE8 A;  3E7L A;  1OCP A;  3CMY A;  2HOT A;  1SFO J;  3S1N J;  2WB1 N;  3BR5 A;  1MSE C;  2XB0 X;  1YRN B;  2CQQ A;  2LFB A;  2E1O A;  3ZOB A;  3D1N I;  4MFD A;  3SJM A;  2B63 J;  4B1R A;  3TED A;  5M3F J;  3CCY A;  3GTL J;  1HCR A;  5F0C A;  4GFB A;  1A5J A;  2HOS A;  4V2F A;  1YRN A;  3JRD A;  4JX6 A;  4MFE A;  2K9Q A;  2CU7 A;  5EZH A;  1RKW A;  4XRS A;  5C4X J;  1F43 A;  4BY7 J;  2VUM J;  1X58 A;  3G1L A;  3BR3 A;  3S2H J;  1NK3 P;  5EEA A;  3H3V K;  1MBH A;  2IBD A;  3F0C A;  1WGX A;  3IH4 A;  2P81 A;  4UUS B;  1VND A;  3GTG J;  4BKX A;  2DMU A;  4QTR A;  4IHV A;  2WV1 A;  2Y9Y A;  2X9D A;  4C3J J;  2NVT J;  2YS9 A;  1IDY A;  3CDL A;  3BTI A;  4D5C A;  1APL C;  4J19 A;  4AC0 A;  1LFU P;  2HXI A;  3FKI J;  3JRA A;  3UKG A;  4C3H J;  1AHD P;  2O8K A;  3IH3 A;  3W6V A;  1POG A;  1JUP A;  5GPA A;  3JRB A;  4IHW A;  2LY9 A;  1FIA A;  3B6C A;  1NK2 P;  2LVS A;  2HQ5 A;  2ID6 A;  3ZQG A;  3Q0V A;  3BTL A;  2W48 A;  4JX5 A;  2M9H A;  2QF7 A;  2M2E A;  1JKO C;  3IH2 A;  3BQY A;  3S2D J;  1W0T A;  1I3Q J;  2JJ7 A;  1MBK A;  5F0H A;  1B72 B;  5FKK A;  3BR6 A;  2DN0 A;  2EBI A;  1ITY A;  1JGG A;  2KT0 A;  3NAR A;  4D5F A;  1RR7 A;  3IV5 A;  1P7I A;  4CYC B;  1OCT C;  1I6H J;  1ORK A;  2DMT A;  5IP9 J;  2R0Q C;  2R92 J;  3HOW J;  1FIP A;  2JK3 A;  2DA5 A;  4DZJ A;  2DTZ A;  1B72 A;  2JA5 J;  2E2H J;  4Y52 J;  4G12 A;  1ETY A;  2HOA A;  1T56 A;  3HBL A;  2XRL A;  2TCT A;  4JP0 A;  4CYC A;  3FK7 A;  5EG0 B;  3BTJ A;  4BBS J;  4W1U A;  1E3O C;  1BJZ A;  5EZG A;  2KDZ A;  1ZTR A;  3M4O J;  1GV2 A;  2R5Z B;  1XS9 A;  3HOV J;  2NVX J;  4V2G A;  5IYD J;  1WCM J;  3HOU J;  1QPI A;  2XB5 A;  3MN2 A;  2JA8 J;  4JX4 A;  1U9O A;  1NTC A;  3S1R J;  1U8B A;  3ZQC A;  4I76 A;  4MIM A;  4A69 C;  4C2M J;  2ME6 A;  5C44 J;  5M5W J;  4RBO A;  1IG7 A;  1GVD A;  4AUX A;  4A3C J;  4NDL A;  4DYQ A;  4BBR J;  4DYC A;  2AO9 A;  1IRZ A;  2XGC A;  3BT9 A;  4EEF G;  5F04 A;  2D5V A;  2GLO A;  5FJ8 J;  4QSH A;  1ZKG A;  2H1K A;  1GUU A;  3G1O A;  5DTD A;  2CUF A;  2JMW A;  5IYB J;  3BR1 A;  1JJ8 C;  3RQI A;  2JA6 J;  3A01 B;  4AYB N;  4M3E A;  3LSP A;  2HDD A;  3TP0 A;  3RZO J;  4FIS A;  4FE4 A;  2MG4 A;  2WAQ N;  3GBG A;  1Z0X A;  2ID3 A;  4B3A A;  4FTH A;  1MH4 A;  3ZQH A;  1K61 A;  1IGN A;  1JKP C;  2XSD C;  5F08 A;  1Y1V J;  2DA1 A;  1PUF B;  3BR2 A;  3GTQ J;  3BQZ A;  5HOD A;  1FJL A;  1HDP A;  1MBJ A;  2NS8 A;  2XGE A;  3GTJ J;  4LOC A;  2LD5 A;  2NS7 A;  5F0F A;  3QPL A;  2VKV A;  5FLV A;  2EZK A;  2Y0S N;  3HEF A;  2RAE A;  1DU6 A;  1FTT A;  1G2H A;  1BW6 A;  1U9N A;  3JRH A;  1ETQ A;  4JYK A;  2HYJ A;  3O8H A;  1OFC X;  2DA3 A;  4UUS A;  3DEW A;  1JUS A;  3GTM J;  2CUE A;  1IJW C;  4DZP A;  4X6A J;  5C4J J;  1FEX A;  5IPA A;  4IHY A;  4BY1 J;  2DMQ A;  1TWC J;  2LTP A;  5M3M J;  2DMP A;  5E3L A;  2DJN A;  2IAI A;  1Q1V A;  1X2M A;  2R7Z J;  2DMN A;  2M0C A;  2LKX A;  3RKQ A;  2IEK A;  1TWH J;  5IOY A;  5IP7 J;  5FKM A;  1HOM A;  3HOZ J;  4M6V A;  1EF4 A;  1ETO A;  3BG5 A;  4RDU A;  1SAN A;  3LSR A;  2K9N A;  2K9S A;  5DS9 A;  3PO3 J;  2H8R A;  4M3D A;  1AU7 A;  2HI3 A;  4A3K J;  3DCF A;  4S0H B;  4D7N A;  3FK6 A;  3Q0W A;  5K7F A;  1ZR4 A;  3LSG A;  2OPT A;  3JRI A; 
#chains in the Genus database with same CATH topology
 1FP2 A;  2XPW A;  4NQW B;  2KIM A;  3HHG A;  3IAS 2;  4XBF A;  3NEU A;  2QSG X;  5M5X J;  1V3F A;  2Y30 A;  2X51 A;  1OIS A;  3EUK L;  3SFI A;  1A36 A;  3GUD A;  1PP7 U;  2MA3 A;  3D5L A;  1F4K A;  1NG7 A;  2COB A;  1MMD A;  4WX9 A;  2UXN A;  3DEU A;  3DV8 A;  4XRF A;  1YS7 A;  4NQW A;  3HDD A;  2DCE A;  4N9H A;  4HX8 A;  3IUO A;  5HVQ C;  2LBF A;  2YUS A;  2RV8 A;  4RM2 A;  3Q9S A;  2JA7 J;  4ENN A;  1ZR2 A;  1S7O A;  4U7D A;  2FRH A;  1DQU A;  3LL7 A;  4DJA A;  5AIP A;  3ERE D;  4ZTF A;  2WWY A;  1H9T A;  5K1Y A;  2BVM A;  5C3E J;  1PDN C;  4RMN A;  2FQ3 A;  4ZDL A;  5E1W A;  1E0E A;  1FOX A;  2R5Z A;  1VZ0 A;  3OOU A;  5AON A;  1MNM C;  1U5T C;  4RLQ A;  2VJ4 A;  5E20 A;  3NAU A;  3U21 A;  3K4N A;  4WCG A;  5J1R A;  3P7N A;  3GX4 X;  3OYL A;  4E7K A;  3CCS I;  1ZLK A;  2W25 A;  1YW7 A;  5D8K B;  4IOC F;  3HM5 A;  4FHT A;  4WXC A;  3OY9 A;  4PSX A;  1QRY A;  1AOY A;  3ZR8 X;  4L5J A;  1GV5 A;  5B3S H;  4XNF A;  1D0Y A;  5J3L A;  2Z1D A;  5FO5 A;  3CP8 A;  2G0E A;  4D9J A;  4DOZ A;  3JRE A;  3M3Y J;  3LSI A;  2F4I A;  3OWT A;  3H0G J;  3H5R A;  2CJJ A;  3FBN B;  3J7Z I;  5HLG A;  1K83 J;  1TT0 A;  3UNG C;  2YU9 J;  2IS6 A;  2NNY A;  1JTY A;  1S6L A;  4XLE A;  4CCL A;  3ABM H;  3DBH B;  2VXZ A;  1RET A;  1MMN A;  4CSW A;  3JR9 A;  3FWE A;  1TWG J;  5DYM A;  3TW6 A;  5LGT A;  3L7W A;  1IW7 F;  2OF7 A;  1O7L A;  3G2B A;  1HW2 A;  1TC3 C;  2COM A;  1K7A A;  2JRM A;  3OYG A;  3I4M J;  2KDO A;  3SZG A;  3GZ5 A;  3LFU A;  1V5E A;  3TP3 A;  4BS9 A;  5GTH C;  1ZAR A;  2FML A;  4W97 A;  3WTZ A;  3HOX J;  4CZC A;  3CUQ B;  4EJU A;  2O9L A;  1WQ2 A;  2OAZ A;  1HDD C;  1R22 A;  5K5O A;  1LQ1 A;  1T33 A;  3RPQ A;  3VYR B;  5A2Q Z;  4PJM A;  1R49 A;  2R7D A;  3WG9 A;  2MLG A;  3FDY A;  4OWR B;  5LEJ A;  2DXI A;  2Y48 A;  2QQA A;  1W36 D;  4PCQ A;  2LRD A;  3OYM A;  2DQL A;  1RUO A;  1TLH B;  3ASN H;  3HB9 A;  5E3O A;  1Z3X A;  3CUQ A;  2K9L A;  1XC5 A;  1S7A A;  4M9Z A;  2EZH A;  5CKT A;  2JSP A;  1SD4 A;  2CWE A;  4ABZ A;  1R71 A;  1QO0 D;  4YIF A;  1A04 A;  5IYC J;  3IHU A;  1VQ8 I;  1XGS A;  3Q3S A;  2DT5 A;  2W85 A;  3MKL A;  1H88 C;  1OR7 C;  3C7J A;  1WI9 A;  2ZBK A;  4A0Y A;  2MH2 A;  3BG9 A;  4M71 A;  1BL0 A;  2NVY J;  4IJA A;  2OA4 A;  1JT6 A;  2L7F P;  4I99 C;  3L1P A;  4I6Z A;  2L7Z A;  1MZB A;  5CJ9 A;  2V6E A;  3G6E I;  5LHG A;  1EKE A;  1MBG A;  3LSJ A;  1R7J A;  1XGM A;  1RPW A;  1Z1D A;  5B5E C;  2FQ4 A;  1K78 B;  3DP7 A;  2WV0 A;  2JWT A;  1R4M B;  3VSL A;  2RKH A;  3CO7 C;  3K1N A;  3GXO A;  4X1E A;  4NHJ A;  1ZK8 A;  3Q0U A;  1T8I A;  4HG2 A;  4IEJ A;  4ENK A;  3QPS A;  1NHA A;  3FMR A;  3QYE A;  5EYR A;  3A03 A;  2FD5 A;  2ISY A;  3WHC A;  2FX0 A;  2LLK A;  1ETK A;  3S1M J;  4MQV A;  4Y3O A;  4P55 A;  4II3 A;  1K78 A;  5K7Z A;  3WU0 A;  1VQ7 I;  2OQR A;  4M3F A;  4A3M J;  5E1X A;  4MTD A;  1XG1 A;  4XKB A;  3GYH X;  1R5I D;  3DPT A;  2X85 A;  3OL3 A;  3VOE A;  2AXT C;  3CZ6 A;  2XV4 S;  4OOI A;  2O7O A;  3V8L A;  4HV6 A;  4L0Y B;  2VPL A;  4B4C A;  3S1Q J;  2V9K A;  1AKH A;  1OJL A;  1Z7L A;  5GAD J;  5J40 A;  3QQA A;  5KAI C;  2ZC2 A;  1LDK B;  2DDB A;  4AYB A;  4ZYA A;  4CGZ A;  1IN5 A;  2NXN B;  5FKN A;  1LE8 B;  3HTS B;  5EDN A;  2WAQ A;  3K4K A;  3J80 Z;  3KP3 A;  1K4S A;  3OIP A;  4CA0 A;  4KIG A;  3G3Z A;  4KN4 X;  3FKJ A;  1CGP A;  3LMM A;  4OU0 A;  5JHU A;  3PSI A;  3HGY A;  4IRI A;  1LE8 A;  2RQQ A;  3S1N J;  1FX7 A;  2IGK A;  1BR4 A;  2CQQ A;  3HG9 A;  3ZOB A;  2B63 J;  4PGG A;  1ZRE A;  3K69 A;  4IQJ A;  2XAQ A;  4KIS A;  2A5Y B;  2V79 A;  1R00 A;  3FX3 A;  4JBA A;  3DU5 A;  4XMY A;  2CQK A;  3ECO A;  1G59 A;  1HCR A;  3T1B A;  3CCJ I;  4GFB A;  5JI6 A;  2CW7 A;  1FBQ A;  1OMI A;  4G7H F;  2EFN A;  1Z91 A;  2BW3 B;  5EZH A;  4EM2 A;  2JQ7 A;  4KNY A;  1BI2 A;  3FZV A;  2ZFU A;  4BE2 A;  2H6B A;  3JAM Z;  5C4X J;  1F43 A;  1FMV A;  4BY7 J;  4HW0 A;  2IW5 A;  2X6Y A;  1CF7 B;  5FB2 A;  1MD0 A;  3RPU A;  2CV1 A;  3S2H J;  1I6X A;  1YE9 A;  3H3V K;  1MBH A;  3GLL A;  3PFY A;  3WGG A;  3M7G A;  3ZMS A;  1EJ9 A;  2BV6 A;  2X1E A;  4QTR A;  2EFW A;  2NRA C;  1XDS A;  3OYH A;  3GZ6 A;  2CUZ A;  2L3D A;  4J19 A;  3I59 B;  1CF7 A;  3FKI J;  2WTE A;  4AID A;  2KKO A;  2RQP A;  3W6K B;  4BAC A;  1N78 A;  3OV8 A;  1LVK A;  3BY6 A;  2O8K A;  4JK1 X;  1TTY A;  2FNP A;  3BCA A;  4DNC A;  3QU3 A;  5GPA A;  3JRB A;  4EMS A;  4GGG A;  2VN2 A;  2ADU A;  1J7K A;  2DFE A;  1TW3 A;  4F52 A;  3I59 A;  1XB4 A;  2FA5 A;  1T08 B;  4L0Z B;  1JKO C;  3AG2 H;  1BBY A;  4BAY A;  2YU3 A;  3S2D J;  3BOQ A;  1W0T A;  3U1D A;  5F0H A;  2UWM A;  2G7H A;  3VYS B;  1U2W A;  3V42 A;  3BG6 A;  5B1A H;  3A0H C;  4FT8 A;  3PL8 A;  1Z9C A;  1B72 B;  3SZT A;  4L9N A;  3BR6 A;  1ITY A;  2D2W A;  1VQL I;  2KT0 A;  2MD0 A;  3R4K A;  3T8T A;  1RC9 A;  4LD5 A;  4CYC B;  1OCT C;  3BJ6 A;  5AIQ A;  1I6H J;  4LLG F;  4Q5S F;  1ERD A;  5ICF A;  1ORK A;  3MEX A;  1FIP A;  2K86 A;  2JK3 A;  1YG2 A;  2CS3 A;  2DTZ A;  1B72 A;  3CCQ I;  3A1Y A;  2E2H J;  2PJR A;  5CQE A;  4BXF A;  1HW1 A;  4LK1 F;  4BNC A;  4C9Y A;  2FXA A;  2KIU A;  2BYV E;  2XRL A;  2KL4 A;  4O3M A;  2FEZ A;  3IC7 A;  4CYC A;  3N4M A;  2O0Y A;  3FK7 A;  4M74 A;  4DQ2 A;  1O3S A;  3WTY C;  2MFZ A;  3L2W A;  5EZG A;  3S3O A;  2HTJ A;  2OJE D;  1GV2 A;  3V8K A;  2IRF G;  1REP C;  4V2G A;  4BQA A;  4U7B A;  3QYF A;  1QU3 A;  3DQV C;  2DFI A;  2XB5 A;  2FSW A;  2JA8 J;  1FNN A;  3I0T A;  5E79 C;  4JX4 A;  2UXX A;  3BC8 A;  1DGR M;  4UY8 I;  2V26 A;  1ULY A;  3QAH A;  3S1R J;  1V55 H;  3ZQC A;  1XMK A;  1SVL A;  4ZDO A;  1GVJ A;  2L02 A;  4I76 A;  3MZY A;  3ZMV A;  3JSO A;  2ME6 A;  3GFM A;  1BC7 C;  2KZG A;  2RRE A;  1SFK A;  2AQF A;  3M9A A;  1ZRF A;  4KA4 A;  4FX4 A;  4DYC A;  4LJZ F;  2XKO A;  3F23 A;  4EAT A;  5FJ8 J;  3ASO H;  4QSH A;  2H1K A;  2M45 A;  1ONV A;  2OD5 A;  3TL4 X;  3QWL A;  2JMW A;  5IYB J;  2EIJ H;  3WTW C;  1OLT A;  3ABU A;  3TDU C;  3OYB A;  1D3Y A;  5JR3 A;  3TP0 A;  3RZO J;  3S8P A;  3ERM A;  1U6G A;  2XAU A;  4BEH B;  3RJP A;  2M7A A;  2HGC A;  2MG4 A;  2OU2 A;  2KFD A;  3CJT B;  3CC4 I;  3ZQH A;  1Y1V J;  4I98 B;  3H3U A;  3JSP A;  1DP7 P;  4WF2 A;  4BEH A;  4C2U A;  3QP6 A;  4IL6 C;  1MBJ A;  2NS8 A;  1TT5 B;  2JUG A;  4I7H A;  1JGS A;  4Y17 A;  3ZQ7 A;  3I4P A;  5DM6 F;  3CMA I;  4LOC A;  2LD5 A;  2MC4 A;  4MQ9 F;  3K70 D;  1F1Z A;  1MMG A;  3K4B A;  2RAE A;  1R1U A;  3HTU A;  1IN4 A;  1P2F A;  2VIX A;  1YYV A;  1USS A;  3DTK A;  3AG4 H;  4OAZ A;  3WGI A;  4G6T B;  2JVH A;  3E6D A;  3BPV A;  2IA2 A;  1OFC X;  3BZC A;  3CMM A;  2Z2S B;  4ZYG A;  1MDM A;  4XLF A;  2OTL I;  2W4S A;  3E3V A;  4DZP A;  3GVA A;  3QPT A;  4RB0 A;  3PUB A;  2XAH A;  5C4J J;  4X6A J;  1BJA A;  3S2W A;  3S3M A;  1XD7 A;  1TQI A;  2DMQ A;  2HKO A;  1TWC J;  4PJL A;  5BQT A;  5M3M J;  4XOT A;  3BJA A;  3CO6 C;  4KMF A;  2DJN A;  1Q1V A;  3CCM I;  2R7Z J;  3GFJ A;  4HYE A;  3H5N A;  4XKV A;  2KZV A;  4BE0 A;  3RKQ A;  2LKX A;  5K5Q A;  4YIR X;  3O6B B;  5JVT A;  2PI0 A;  1TWH J;  3SQN A;  5D4R A;  2WAE A;  1HC8 A;  2D45 A;  4ZYD A;  4RDU A;  1YI2 I;  5EEG A;  2K9N A;  2EIL H;  4ZYH A;  4D1Q A;  2V6C A;  2WY8 Q;  3T0Y A;  1PVE A;  3HRS A;  2XDV A;  3FK6 A;  2M8E A;  3Q0W A;  2OPT A;  1OYY A;  3M1C A;  1UG2 A;  3SFZ A;  3EUH C;  2JVG A;  1O57 A;  4I09 A;  4L5E A;  2BY2 A;  2QSF X;  4IHX A;  2IVM A;  2K3P A;  2ZJR F;  4WXH A;  1MBF A;  1LNW A;  3DPU A;  3KIO A;  1WJD A;  2CYY A;  2LK2 A;  2I8D A;  4JQF A;  2A6E F;  1WSU A;  3M8E A;  1TWA J;  3LSH A;  2YPR A;  1GHC A;  3P9C A;  3MD2 A;  1VFC A;  4IVN A;  1WJE A;  2OTJ I;  1FYM A;  4ESJ A;  1YOV B;  3AKZ A;  2CSO A;  5JLX A;  5F27 A;  4LLN A;  1DDN A;  3FIW A;  1D5Y A;  1WJA A;  4FX0 A;  4LB5 A;  3ZN0 A;  3RZD J;  5EG0 A;  1S3J A;  1BI3 A;  4G6D A;  2HFH A;  5GAG J;  2W1O A;  3LA3 A;  3HOY J;  2FU4 A;  5F64 A;  1XCB A;  1ETV A;  1I39 A;  3DTI A;  4E4H A;  3MKY B;  4XID A;  2NAZ A;  4U87 A;  4ETS A;  5J4V A;  1X1C A;  1VQ9 I;  5FD6 A;  1VTN C;  4GO1 A;  3BZK A;  3GO5 A;  3CCE I;  1UMQ A;  2HTS A;  3QP5 A;  3MKZ A;  1FTZ A;  4Q48 A;  2L9R A;  3AAF A;  1NH3 A;  1IUY A;  1ZN2 A;  2RVC A;  3HZJ A;  5HDK A;  2D1V A;  1UG0 A;  3V8J A;  2DAO A;  2KIQ A;  3TBI A;  4F92 B;  2OCC H;  1T2K A;  4Y33 A;  4FCY A;  1T95 A;  2XGD A;  3GME A;  4LG3 A;  3I64 A;  4GCV A;  3X2Q H;  3ZQF A;  3BJO A;  3RIR A;  2R3S A;  3QOD A;  4ZJZ A;  2OV7 A;  2CH0 A;  3EPZ A;  1W4M A;  1XMA A;  2BZT A;  3OYA A;  2DBB A;  4XRM A;  4QIW N;  4XM3 A;  2MH9 A;  3JRG A;  1WZ2 A;  2EQR A;  2PMZ N;  3KET A;  1HF0 A;  3HRT A;  3HKZ A;  2BY1 A;  5FRM A;  1MND A;  3L9F A;  1PUF A;  2ECB A;  1YIO A;  4EV0 A;  4A5M A;  2P7V B;  3MFK A;  4LLL A;  2OZ6 A;  1S7E A;  2Y2Z A;  3IKV A;  1BW5 A;  4I0A A;  1QBJ A;  4RB3 C;  4BXU A;  2HYF A;  2K27 A;  1RRJ A;  3H9J A;  5JVG F;  2QKM B;  2MGQ A;  2VL8 A;  3HRM A;  3MZH A;  2Z99 A;  2ECC A;  1MW7 A;  2ELK A;  2R7W A;  1AA7 A;  2VKE A;  1P6R A;  3GW2 A;  4BQQ A;  2V1D A;  2E2J J;  1QVU A;  4MO7 A;  4LG0 B;  3FXL A;  2Y0M A;  1JE8 A;  2K7L A;  2DA7 A;  3LNQ A;  1JJ6 C;  4A3I J;  4A3F J;  3K4J A;  1R9T J;  2OQG A;  3OS2 A;  3ZN1 A;  2ZB9 A;  1ZGW A;  3HRU A;  3ZXS A;  1DU0 A;  2VI6 A;  3AL0 B;  1RIO H;  1RES A;  2F4M B;  4LG0 A;  5EGO B;  1WJC A;  3DBR B;  1U3E M;  3K7A J;  4XK4 A;  2VON A;  1HKQ A;  3IP4 B;  1VQP I;  3TOA A;  1JT0 A;  1UHW A;  1KGS A;  2ZXW H;  1ZGJ A;  1UB9 A;  3CQZ J;  5BPI A;  2F5V A;  1S72 I;  2PN6 A;  4U88 A;  3FHN A;  4S04 A;  5EGO A;  1JUM A;  1P7J A;  3ABK H;  1VQ6 I;  4EVI A;  3F8N A;  1IN7 A;  2ELH A;  2I10 A;  5CLS A;  2GXG A;  1DGW Y;  1UEL B;  3GZN B;  3SEQ A;  3KYC B;  3PO2 J;  1ZLJ A;  3H9G A;  1V4R A;  1VF9 A;  4ZZL A;  4KFC A;  2M87 A;  2M8G X;  1XGO A;  3ECH A;  3M1E A;  4CUG A;  1EA3 A;  3PM1 A;  1LJ9 A;  4PSW A;  1XSX A;  1QPM A;  4OIO F;  3CC2 I;  1MBE A;  1VI0 A;  1Y8Q B;  2F5D A;  3EDP A;  4IX7 A;  3OR2 C;  1OQY A;  2DI3 A;  1SEU A;  3BZ6 A;  2CQX A;  1W7P B;  3LAP A;  3G71 I;  2CO5 A;  2HVR A;  2EFQ A;  2E1C A;  2A6T A;  2PG4 A;  1ZRD A;  5D8L B;  1U8R A;  4XRS G;  2FBI A;  1QA6 A;  3NQO A;  3IRQ A;  2FMY A;  2IGO A;  4FE7 A;  3T8R A;  5LEK A;  2WC2 A;  3KEO A;  2R7F A;  3SEZ A;  1T6S A;  2HDW A;  3FMQ A;  3RYR A;  3K4C A;  2DFF A;  1WRJ A;  2XAF A;  4E7J A;  1W7P A;  4RB1 A;  5ICE A;  5GPC A;  4HNT A;  3KYL A;  1GT0 C;  2ZKZ A;  3WHB A;  1W0U A;  1O3T A;  1GXP A;  1HKT A;  2Y31 A;  4LIU A;  2DT6 A;  4EJW A;  2F5C A;  3OOP A;  3F8C A;  3HSE A;  3SZP A;  2XRN A;  3BG3 A;  4M3B A;  4A2U A;  3L2Q A;  3CMY A;  5JFR A;  1SFO J;  2HOT A;  2WB1 N;  2ZCW A;  4YEL A;  2ZFW A;  2JZY A;  5J8C A;  1YRN B;  1IRG A;  5CVR A;  3CCL I;  3J7A Y;  1JHH A;  2E1O A;  1D1B A;  1VQO I;  4B1R A;  4PFO A;  3F8M A;  4HSR A;  4RB2 C;  2A69 F;  5F0C A;  4XN3 A;  4CXF A;  2QZ8 A;  4CYD A;  2HOS A;  1ACI A;  1YRN A;  2DDA A;  5HDG A;  2HVS A;  2KPM A;  2NYX A;  2OUM A;  3IWF A;  2HPM A;  4XLC A;  1RZ4 A;  5FGM A;  1RKW A;  2LNB A;  3LWF A;  4R79 A;  2HS5 A;  3ELK A;  5ED4 A;  2GQQ A;  3G1L A;  3BR3 A;  2QWW A;  3CJR B;  1SAU A;  5EEA A;  1OCC H;  2IP2 A;  2QBY B;  2IBD A;  1WGX A;  4Y13 A;  2Z5U A;  1MMS A;  2VJ5 A;  4BKX A;  2Y9Y A;  3NRV A;  2BY0 A;  3KZY A;  1J2X A;  4PGH A;  2NVT J;  4HF2 A;  3SXY A;  3BTI A;  4YFK F;  3J81 Z;  5BPD A;  5LRR A;  1FZP B;  2C6Y A;  2BBY A;  2PX9 A;  4C3H J;  2YR2 A;  1SFE A;  2B9S A;  2Z33 A;  3Q5F A;  1BI1 A;  1POG A;  4QWQ A;  1JUP A;  4U0W A;  3DTE A;  3K4L A;  1NK2 P;  1FOY A;  2ID6 A;  4CCJ A;  3ZQG A;  3GF2 A;  2GOM A;  3BTL A;  4JX5 A;  3VYT B;  1E3P A;  5LHI A;  2ZO4 A;  3FM5 A;  3PUF A;  2WA0 A;  3FF5 A;  3BQY A;  2V7F A;  1UJ8 A;  3EYI A;  1EH6 A;  3L2R A;  4XKC A;  1WVR A;  3DEE A;  1JGG A;  2HZD A;  3NAR A;  4E7S A;  5ERI A;  4UVA A;  3VWB A;  5DDG A;  2L9V A;  4YFN F;  1LB2 A;  4OAY A;  4XSX F;  4J00 A;  1OYI A;  2LYC A;  2P8T A;  1B1B A;  3HPH A;  2R92 J;  3HOW J;  3SHF A;  1Z21 A;  3PIO F;  2VT3 A;  3PSF A;  5L3D A;  1ETY A;  2HOA A;  4H4K C;  3E0J B;  5LD2 C;  1ZG1 A;  2H94 A;  4WWC A;  4K2E A;  5LHH A;  3ZPL A;  4D0P A;  4J01 A;  4OIN F;  2FBK A;  4P9F A;  5DCM B;  2E34 A;  1GXQ A;  4W1U A;  3LSK A;  2KDZ A;  2W7N A;  1XS9 A;  1Y6I A;  4OIP F;  2DT7 B;  2DYR H;  3F3X A;  5IYD J;  1WCM J;  1U5T B;  1STZ A;  3HXL A;  1YIJ I;  3HOU J;  4HDV A;  1EH8 A;  4BQN A;  1ZRC A;  3MN2 A;  2M7B A;  1KQ0 A;  4PJN A;  2G9W A;  4G94 A;  3RSN A;  3AFH A;  2HQN A;  2K4J A;  3D0S A;  5DCM A;  3GFL A;  3BP8 A;  5KK1 A;  2QEN A;  5ILU A;  3ZGK A;  4RGU A;  3CD6 I;  3IL2 A;  2IA0 A;  2X0L A;  1U5T A;  2O03 A;  1TZL A;  2D1H A;  3GCM A;  2MD5 A;  3AG3 H;  5D5W B;  4XLN F;  1GVD A;  2VBZ A;  4NDL A;  4DYQ A;  2AO9 A;  2XGC A;  1OKR A;  3WTV C;  3BT9 A;  4EEF G;  2YX4 A;  1MNE A;  1GUU A;  5B1B H;  4ON0 A;  5BS6 A;  5ICC A;  5E8G A;  2CUF A;  1SVO A;  1JJ8 C;  3A01 B;  5EEH A;  1X1B A;  4LFU A;  2PBI A;  3K4M A;  3WG7 H;  3CUO A;  3KEQ A;  2ZXH A;  3FXU A;  1FC3 A;  2I5U A;  3CC7 I;  1G3S A;  1I5Z A;  1OPC A;  4IHT A;  1ON2 A;  1IGN A;  1JKP C;  5D4S A;  5LFA A;  2VKH A;  2VKD A;  2F48 A;  3REO A;  2DA1 A;  2XF6 A;  3KYD B;  4AU7 A;  3CDI A;  5FRO A;  3GTQ J;  3NWT A;  4YG2 F;  2Y69 H;  1N75 A;  3I3L A;  4H0E A;  3GTJ J;  2MYS A;  2Q2E B;  1I1G A;  2FF4 A;  2NS7 A;  3SDB A;  1X3W B;  4OIQ F;  1B9M A;  1ZGA A;  5J47 A;  2BW3 A;  3QPL A;  4ZH4 F;  4E7H A;  2VKV A;  5FLV A;  3JTH A;  2Y0S N;  1DU6 A;  4LMY A;  5H6Q A;  3WTU C;  4IKF A;  1BW6 A;  3F9K A;  2L01 A;  4HAM A;  2E60 A;  1FBS A;  3J7Y J;  3JRH A;  2EIM H;  1ETQ A;  2L4A A;  1UHM A;  2HYJ A;  3O8H A;  4BJ6 C;  2OZU A;  3HC7 A;  1JUS A;  1W36 C;  4RA2 A;  2XRO A;  5DEQ A;  1J5Y A;  2CW8 A;  1XDU A;  1XGN A;  2WY7 Q;  3TO7 A;  2LRE A;  4FQG A;  1YX3 A;  2HZT A;  2LKS A;  3K9T A;  1X2M A;  4A6D A;  2KJC A;  2CFX A;  2M0C A;  2IEK A;  4CCK A;  1G3T A;  1FP1 D;  3CF5 F;  3VSK A;  3HIF A;  1HOM A;  3VDX A;  3JTG A;  1OR7 A;  4YEJ A;  3BG5 A;  2LH9 A;  1X1D A;  1I1S A;  2EV0 A;  2K9S A;  5DS9 A;  4M3D A;  1KYW A;  2HI3 A;  1ODD A;  4S0H B;  3ZP5 A;  1K6Y A;  3LSG A;  4AM3 A;  3DWL E;  3KP7 A;  1Y1W J;  3S15 J;  5D5V B;  4KIC A;  4BDZ A;  4A3L J;  1KZH A;  1FPQ A;  4R8H A;  1IF1 A;  3HGG A;  1HLV A;  2V1X A;  3ZQQ A;  1QVT A;  3OYD A;  1WPK A;  1B9N A;  1IV8 A;  2K5C A;  2MW8 A;  4WXD A;  2P6S A;  2Z3Y A;  3JRF A;  3P9K A;  4U0Y A;  1CQT A;  2RNJ A;  3H3Z A;  2MC3 A;  1V5G A;  4UB8 C;  1N77 A;  2M1B A;  2NOG A;  3HOS A;  2MSY A;  2CRG A;  3SDG A;  1J0R A;  4HX4 A;  1D8J A;  1FBU A;  1LDJ A;  2EFO A;  2BVL A;  4ZZD A;  5E3N A;  4BXX J;  2QQ9 A;  5ICG A;  3KE2 A;  2QQ8 A;  3TW7 A;  2GAU A;  2QEX I;  3V7C A;  1S8N A;  1F36 A;  3ZQL A;  3ESW B;  2V9V A;  5F1J A;  2X6O A;  1BA5 A;  5GAH J;  2ZME C;  1T98 A;  2BY3 A;  2X6W A;  3KEY A;  2HXO A;  4RS8 A;  2E7X A;  5KHD A;  9ANT A;  2VQC A;  3CDH A;  4RAZ A;  2BE5 F;  3S93 A;  5L3C A;  1PYV A;  4CCN A;  4DBQ A;  3DLL F;  1ZAO A;  4F91 B;  4Y7N J;  2A05 A;  2R5Y B;  1PUE E;  4GYG A;  4L5I A;  1YJW I;  1PP8 F;  2R7S A;  1HKS A;  2LR8 A;  3TDZ C;  5JLW A;  5HNF A;  2VBX A;  1LEB A;  3A02 A;  3GTP J;  4DYR A;  4A5N A;  1MGT A;  1D5V A;  2R5Y A;  2L7K A;  1RUN A;  4HLY A;  3K1M A;  3S17 J;  3GFI A;  1FMW A;  3DXJ F;  1QGP A;  2RC4 A;  2BOL A;  3EQL F;  3FM3 A;  2R93 J;  4G7O F;  3FMS A;  5HLT A;  3IAM 2;  1XCV A;  2PEX A;  5ILS A;  4ZDP A;  4HOB A;  2JSC A;  2F5F A;  2HU9 A;  2XAG A;  1O7F A;  2JN6 A;  1D8K A;  5DD4 A;  5D5U B;  2MLK A;  4UHT A;  2O61 A;  2P7C B;  2AHQ A;  2OBP A;  3I4N J;  4HNV A;  2K40 A;  3QOP A;  1HA8 A;  1S9H A;  2FOW A;  2DU9 A;  2RNG A;  2M0M A;  3BTC A;  2HVQ A;  1WHU A;  1WJF A;  3J7A O;  2DA6 A;  1WWX A;  2EA2 A;  2ZJQ F;  4EM0 B;  4D7M A;  3RKW A;  3OYN A;  4TV7 A;  2DTR A;  2G7U A;  3HUG B;  4M3G A;  1BOB A;  2R7V A;  2NNN A;  4OMY A;  4ANJ A;  1Z77 A;  3WU1 B;  4XSZ F;  4RGR A;  4L9J A;  2CQN A;  3HPG A;  2VPR A;  4IQ4 A;  5A2Q K;  3C2B A;  2EJR A;  3N97 A;  3KZZ A;  2VQL A;  3HUG A;  2E1N A;  1A6I A;  4LGW A;  1FLI A;  3QU6 A;  2E19 A;  2HQA A;  1X3U A;  2XGX A;  3TKY A;  4A12 A;  2CV0 A;  1E17 A;  4IHS A;  3BG7 A;  3I55 I;  3OSF A;  2Y9Z A;  1TP4 A;  2QCO A;  3E6C C;  4OIR F;  5FKL A;  4L18 B;  5TRD A;  2JPC A;  5FKO A;  3ISP A;  1O3Q A;  2KLO A;  5E18 F;  4I2O A;  2LP0 A;  4UUT A;  4BQO A;  3MKW B;  1WJ5 A;  2VC1 A;  3CLQ A;  1SD6 A;  3KP4 A;  5FLX Z;  4RGS A;  2XPV A;  1SD7 A;  3L09 A;  4XLA A;  3OR1 C;  2X48 A;  1DP3 A;  3F22 A;  1LFP A;  1WH7 A;  3DKX A;  2W82 A;  1ETW A;  2ACJ A;  2KQR A;  2A68 F;  5KAF C;  2FOK A;  4EJT A;  2M34 A;  1B8I B;  3H92 A;  3ZMD A;  3PQJ A;  2LG4 A;  2QKL B;  1KU3 A;  4A3E J;  3H0D A;  3LOC A;  2HEO A;  2NVQ J;  5LRS A;  3COA C;  4CIC A;  2E7W A;  4XQF A;  5J1U A;  1IUF A;  4N0B A;  1YIT I;  3KP2 A;  4B8X A;  1G6N A;  4HQM A;  1H89 C;  2EIN H;  1MIJ A;  4DW6 A;  4E6K G;  4UUV A;  2ZME B;  3B73 A;  4BUP A;  1YO5 C;  1B8I A;  1FOK A;  3LQQ A;  5BNG A;  5KNL A;  4KUM A;  2EH3 A;  1R23 A;  2DA4 A;  3I71 A;  5J1Y A;  2PLY A;  5E1Z B;  3L2U A;  1IN8 A;  4MHG A;  4V19 K;  2H09 A;  3ONQ A;  2P5K A;  4EGZ A;  2O3F A;  2AQE A;  1UAA A;  1YHQ I;  2JPB A;  1R6R A;  3GLX A;  3PJR A;  3SYT A;  4MEX F;  1OCP A;  2O5R A;  4YFX F;  1TQP A;  3BR5 A;  4ITV A;  4YRV A;  2XB0 X;  5BOX A;  1TQM A;  2ESH A;  3D1N I;  1D0Z A;  4MFD A;  2GIV A;  4B44 A;  3SJM A;  4BHC A;  1KQ8 A;  3RPU D;  1G8X A;  2NOJ B;  2DOE A;  4MGR A;  5HLI A;  3OIQ A;  4I0B A;  3ROU A;  5KCM A;  4F55 A;  4HA8 A;  4KIF A;  4IOA F;  2ELJ A;  5EJC A;  2R7R A;  1A5J A;  2ZJP F;  2GOX B;  2ZNY A;  1BN5 A;  3J80 K;  4G7Z F;  2VQG A;  2LY2 A;  3JRD A;  3PQK A;  3M07 A;  3CCU I;  4MFE A;  2MAB A;  3F8B A;  1MKM A;  3OYK A;  2DLL A;  2HR3 A;  4LB6 B;  2OC6 A;  4PFP A;  4BYY A;  4CZZ A;  4BGD A;  3RCO A;  1S29 A;  2H8W A;  1KU7 A;  4UNO A;  3RQ4 A;  4KIB A;  1Y39 A;  3ZMU A;  2VUM J;  3U1K A;  1YW8 A;  1NK3 P;  4U0V A;  3RYP A;  2GA2 A;  1G3Y A;  2K4B A;  4EGY A;  3CES A;  3O2P E;  3CF2 A;  5LGN A;  1K79 A;  2E5Z A;  3K70 C;  2CFO A;  2P81 A;  1LKX A;  1VND A;  3CUQ C;  4UUS B;  1R36 A;  3K10 A;  2KRH A;  3GTG J;  3LFK A;  2WV1 A;  4C3J J;  3EET A;  4IRG A;  5BMZ A;  2B7E A;  3CDL A;  5J4Y A;  2M5W A;  3KX2 A;  1U0J A;  1APL C;  1LFU P;  3TGN A;  2O6G E;  4II2 A;  5CVJ A;  3I5U A;  3ABL H;  3JRA A;  1T39 A;  4NNJ A;  1E2X A;  2STT A;  1J59 A;  2BXZ A;  1J75 A;  2EA4 A;  2L54 A;  1XMX A;  3MMY B;  1T38 A;  1SMT A;  2DO7 A;  4IHW A;  4AWX B;  2LY9 A;  5H2F C;  3BCB A;  1BIA A;  1YW9 A;  2AXL A;  3JAM K;  1X1P A;  2XVC A;  5HDN A;  4NUB A;  1BR1 A;  2UZK A;  1Z6T A;  3IWZ A;  2M9H A;  1RNL A;  4IPA A;  3L2V A;  2M2E A;  4A0X A;  4AVP A;  4HV5 A;  3IH2 A;  3H1C A;  1I3Q J;  5D5X B;  1MBK A;  4RGX A;  3DBL B;  4BU2 A;  4Y4R A;  5FKK A;  2VT2 A;  2J5O A;  4BH9 A;  3F21 A;  1VQN I;  1RR7 A;  3IV5 A;  4BE1 A;  1K4T A;  3TO9 A;  5E8I A;  1LPQ A;  3OYC A;  4MEY F;  1K6O A;  2PJP A;  3TO6 A;  2VC0 A;  2DMT A;  2KRC A;  2R0Q C;  2E71 A;  4BL0 B;  3K6G A;  1D1C A;  4M9X A;  3EUH A;  4DZJ A;  2JA5 J;  2LBF B;  3CME I;  2IS1 A;  2ZJ2 A;  3A4C A;  2LY1 A;  2X4H A;  2NS0 A;  4Q47 A;  3PNV A;  1T56 A;  5HS7 A;  1W5S A;  1R1T A;  4PZJ A;  3HBL A;  2E5N A;  2HQR A;  1UCR A;  2QQB A;  2TCT A;  2V1N A;  1SAX A;  2E36 A;  2XIG A;  4JP0 A;  4XN0 A;  2L9N A;  2IT0 A;  5CVI A;  1WKM A;  1BJZ A;  5FRN A;  1I3A A;  2R5Z B;  1YTY A;  4M73 A;  1QZE A;  4ENM A;  1HXD A;  2BHY A;  1UST A;  3CJQ B;  4AVZ A;  2IS4 A;  3F72 A;  2LDU A;  4F93 B;  3W2A A;  1IN6 A;  5IT9 Z;  1U9O A;  2VJJ A;  2P0W A;  3OYI A;  1EH7 A;  3KFW X;  3LQR A;  4P5O A;  4MTE A;  4ESB A;  4Z2Y A;  2QA4 I;  3I53 A;  2ZSI B;  1TNS A;  4C2M J;  4E7I A;  4X0G A;  5C44 J;  2VOD A;  4KT6 A;  2M4G A;  2K85 A;  4Y15 A;  1IG7 A;  4AUX A;  1LVA A;  1I27 A;  3MCZ A;  4L9V A;  3W2W A;  5F04 A;  5L3E A;  2GLO A;  3WTX C;  1ZKG A;  3VB2 A;  2P5V A;  3G1O A;  4UV9 A;  5DTD A;  3QPH A;  3DF8 A;  3BR1 A;  3OMY A;  4PDK A;  2Z9O A;  2JA6 J;  3EYY A;  1P4X A;  2CV2 A;  2HDD A;  3LSP A;  3E97 A;  1BI0 A;  1LUJ B;  2F2E A;  4FE4 A;  3TMO A;  1F9N A;  1N25 A;  2JT1 A;  1MH4 A;  3WU2 C;  5TGT A;  1FWZ A;  2LKP A;  5CQG A;  3M8J A;  2W57 A;  4P9U A;  1K61 A;  5F08 A;  5CVU A;  2VOP A;  3E5U A;  1V54 H;  3VFZ A;  2K02 A;  2IGN A;  3L2C A;  4IRH A;  3H35 A;  3KZI C;  3CLO A;  4XOR A;  1HDP A;  2QLZ A;  4HPQ A;  2XGE A;  3FBI B;  2V9P A;  1LEA A;  3D5R C;  2X1D A;  2O8X A;  2DJI A;  2PQ8 A;  1OCO H;  1P92 A;  2CGP A;  3JCU C;  1TBX A;  1FTT A;  2XHK A;  1U9N A;  4CDG A;  2DQR A;  4M9S A;  1X19 A;  2E35 A;  4JYK A;  2H27 A;  2QBY A;  1W5T A;  3V7S A;  3DEW A;  1VQM I;  4RM3 A;  2IPQ X;  5DUI A;  2CUE A;  1PJR A;  1A35 A;  2K9M A;  1FEX A;  1J09 A;  5IPA A;  5L3F A;  4BY1 J;  3A2K A;  2PFB A;  1R5H A;  3CTA A;  1XSV A;  4UVC A;  5E3L A;  3W6J B;  3G73 A;  5DV5 A;  3U9G A;  2IAI A;  3WOD F;  3DU6 A;  3CP2 A;  1KU2 A;  5DCF A;  4IXA A;  1R4N B;  5HLH A;  2EFP A;  4C30 A;  2V1U A;  1ZG3 A;  5FKM A;  3HOZ J;  3L00 A;  1MJA A;  1ETO A;  4PK4 A;  2J5P A;  3LSR A;  3PO3 J;  3C1D A;  2X1C A;  3MZ8 A;  1KA8 A;  1T0F A;  3BPX A;  3ZRG A;  2UV1 A;  4A3K J;  1AU7 A;  2GXB A;  2KJB A;  2STW A;  4EM1 A;  5K7F A;  1ZR4 A;  1XTA A;  3U2R A;  1DPU A;  4KT5 C;  5K7H A;  1QNT A;  2XPU A;  3W3C A;  1GLN A;  4UB6 C;  3HYI A;  2WAD A;  2VLA A;  4A3B J;  4KN7 X;  1ZQ3 P;  1UHS A;  2M3A A;  3BR0 A;  3F8F A;  1UFM A;  3TQN A;  3FXQ A;  3PFI A;  3H9Q A;  3G4S I;  3M8F A;  1IXR C;  2P4W A;  1R5G A;  2VJI A;  2R7O A;  2VE8 A;  1HST A;  2V4J C;  2IGM A;  5M5Y J;  1V5F A;  1IXS B;  5DUK A;  4ENJ A;  4XR6 A;  1X3Z B;  4WK8 F;  4AIH A;  4A3J J;  1AKH B;  5CVV A;  1I50 J;  3O3K A;  4ZC3 A;  1ENH A;  1H0M A;  2NVU B;  3B6A A;  3E6B A;  2Z16 A;  3RKX A;  1ETX A;  2LOO A;  3D5S C;  5TJJ A;  3I9V 2;  2HNH A;  1JI8 A;  4CO8 A;  4L9T A;  3FXO A;  5FFZ A;  4Q4Z F;  3R6S A;  2DA2 A;  4OMZ A;  3JRC A;  2EZL A;  2A61 A;  3Q9V A;  1O4X A;  1HW5 A;  1QZZ A;  4GXO A;  3AG1 H;  2WBM A;  1U78 A;  5L3G A;  3DKY A;  2GBY A;  3OSG A;  2L5Q A;  1B59 A;  1WI3 A;  4EQQ A;  2JA2 A;  3OYF A;  2EK5 A;  2XC7 A;  3TOB A;  1VQ4 I;  4XIC A;  2PMZ A;  5H6R A;  2A6H F;  2N8G A;  4E7L A;  1JKR C;  4HF0 A;  1ZEL A;  3LA2 A;  3S3N A;  5FLX K;  5FLM J;  5HOO A;  2IA1 A;  3A0B C;  2HYG D;  3QOE A;  3G1M A;  4HF1 A;  4F3Q A;  4A3D J;  2JUC A;  1ZYR F;  2TRT A;  4XOP A;  3C2H A;  3VOD A;  3ML6 A;  1ZHF A;  5HS9 A;  1TWF J;  5IP6 A;  5EF6 A;  4E70 A;  3ZQI A;  5HNH A;  2VXD A;  1IV6 A;  3A01 A;  1KYZ A;  2CG4 A;  3V4G A;  4MLO A;  1FSE A;  3NWS A;  1SFU A;  3DFG A;  3W2V A;  3UR3 C;  1XSD A;  4S05 A;  2M4K A;  1YLF A;  4KIT B;  1QQI A;  2BHZ A;  5ILV A;  3FXK A;  3GTK J;  4G6Q A;  3KLN A;  4KDP A;  2KIS A;  2DPD A;  1BM9 A;  2A3S A;  3P9I A;  3HHH A;  2DK8 A;  2RN7 A;  4BDY A;  2ETH A;  2VAS A;  2B0L A;  2ISZ A;  1MSF C;  1AWC A;  5J6X A;  3DPL C;  4A3G J;  3WE3 A;  4ZTJ A;  1WH5 A;  4M6Y A;  4C2T A;  2Q2E A;  1P4A A;  1RI7 A;  1W1W E;  3FIS A;  1BOA A;  2BEO A;  4PJJ A;  2EZI A;  4BHP A;  4ASN A;  3KLO A;  3E5X A;  1ON1 A;  4MNU A;  1H8A C;  4HLX A;  1O3R A;  2Y75 A;  5GTI C;  1TW2 A;  1RKT A;  1G4D A;  5JHF A;  3FXJ A;  1QZY A;  4XKW A;  2ICW G;  2W84 A;  3T5X A;  4IZZ A;  3I56 I;  1MJB A;  1JTX A;  3HKZ N;  5GP9 A;  4AIK A;  2CQ7 A;  2E2I J;  4LIT A;  1R1V A;  2VB6 A;  4C3I J;  1ZG5 A;  3VPR A;  1JHF A;  3S16 J;  1IC8 A;  1LFB A;  3RKY A;  4KMU X;  4GDF A;  3QYB A;  1GDT A;  2VBY A;  1HQC A;  1Z67 A;  4XL9 A;  5IOZ A;  2KP6 A;  4A93 J;  2UUZ A;  2ME0 A;  2FNA A;  3OS0 A;  4YII A;  3R0A A;  1X4O A;  5IT3 A;  2DYS H;  1H9G A;  4CCM A;  2KRF A;  5CYV A;  1SC7 A;  2PJR B;  2L7M P;  3KPH A;  1IRF A;  2DFH A;  3OIO A;  3OS1 A;  1BR2 A;  3WGH A;  1JKQ C;  3K2A A;  2XUB A;  3N05 A;  3MVP A;  1EV7 A;  2GIZ A;  3DKW A;  1IDZ A;  1YJ9 I;  2VBW A;  4UVB A;  4GYI A;  5HS8 A;  3ABT A;  1RR8 C;  2DOD A;  1W7P D;  2HPI A;  4B3X A;  3MWM A;  1P4W A;  3H5A A;  4FAS D;  5L3B A;  3IRR A;  3S14 J;  2HWV A;  1Z6R A;  2AS5 F;  2WB1 A;  3GTO J;  3O8G A;  3BLY A;  2HKX A;  1FY7 A;  4E7Z A;  2JRT A;  3K1P A;  1Q1H A;  1IZ1 A;  4GRI A;  1XN7 A;  2GM4 A;  3R60 A;  4RLF A;  1E3H A;  2JTV A;  4ZYE A;  2QVO A;  3MQ0 A;  5E3M A;  3MAJ A;  1W5C C;  4LK0 F;  1YJN I;  1M1E B;  6PAX A;  1SD5 A;  2CW0 F;  2ZSH B;  2TDX A;  4HNU A;  4CHU A;  2L9S A;  2ZNZ A;  4B43 A;  4EJO A;  1MH3 A;  3GEZ A;  2L0K A;  4BJ5 C;  3H36 A;  2FBH A;  1FSH A;  2LF7 A;  5F1R A;  2FJ1 A;  1L3L A;  4KYW A;  5K5R A;  1X2N A;  2W00 A;  2Q0O A;  4I01 A;  2L2O A;  1C0W A;  5E17 F;  3E7L A;  1Y56 A;  4NC6 A;  3PIP F;  1Z7U A;  1MSE C;  2EB7 A;  2K3F A;  3DLA A;  2LFB A;  2RGV A;  2HDC A;  5D6F A;  1IRX A;  5D6E A;  3TED A;  5M3F J;  3CCY A;  1VQ5 I;  3GTL J;  1IO2 A;  2XF7 A;  5TIS C;  4DBR A;  4P96 A;  1YX5 A;  3HSR A;  5IT9 K;  5B66 C;  2H1L A;  3ZMT A;  3KP5 A;  4V2F A;  1P9Q C;  4XLH A;  3HOT A;  4JX6 A;  4NBQ A;  2K9Q A;  1YS6 A;  2QUF A;  2XAJ A;  2CU7 A;  2PMU A;  2WAF A;  4F7Z A;  4XRS A;  3BRO A;  4CCO A;  1TL8 A;  2R7U A;  1X58 A;  1Z3Y A;  3R0J A;  3JW4 A;  2EIK H;  3PNY A;  1UZC A;  1SFX A;  2HOE A;  3F0C A;  3IH4 A;  3RDI A;  2DK5 A;  2XAS A;  2A5W A;  1MDM B;  2DMU A;  4QPO A;  3RI4 A;  2E1M C;  4IHV A;  1Y8R B;  2X9D A;  4M6X A;  3ULQ B;  2YS9 A;  1IDY A;  4M72 A;  2Q8K A;  1JXS A;  3FXM A;  5DD8 A;  4D5C A;  5DM7 F;  2QYO A;  4AC0 A;  2HXI A;  4RAG A;  3HL2 A;  1B4A A;  3ZCO A;  3UKG A;  1AHD P;  1IXC A;  3C18 A;  4CH7 A;  1DPR A;  3IH3 A;  4HQE A;  3W6V A;  3C2G A;  1SVM A;  1TNT A;  3KP6 A;  1FIA A;  3B6C A;  2LVS A;  1D1A A;  2HQ5 A;  4XON A;  3WTT C;  4QPQ A;  4RAF A;  3Q0V A;  2W48 A;  3OYE A;  2QF7 A;  3S32 A;  2VOO A;  4IO9 F;  2MBF A;  4G9Y A;  4DIQ A;  1B6A A;  1Z05 A;  1MMA A;  5LGU A;  3AL0 C;  2JJ7 A;  2F5E A;  3LSM A;  2EPF A;  4BJT A;  1OCR H;  3OYJ A;  2DN0 A;  2EBI A;  3J81 K;  1OCZ H;  4B47 A;  4O6J A;  1VQK I;  4D5F A;  2X6X A;  4NC7 A;  5CPR B;  5FD5 A;  1KQ9 A;  1P7I A;  2YSR A;  2KHM A;  3PNT A;  3CCR I;  5IP9 J;  1D0X A;  1QHH D;  1WFX A;  2CMP A;  2KIF A;  2DA5 A;  4A0Z A;  3HJE A;  4LIV A;  5FFX A;  4N9I A;  3FHZ A;  2VQH A;  4Y52 J;  4G12 A;  1HSJ A;  4RAY A;  3F6O A;  1L0O C;  3ZMZ A;  1XX5 A;  4DGW B;  5EG0 B;  1FYL A;  4XLP F;  2GWR A;  3BTJ A;  4BBS J;  1F5T A;  2XKP A;  1E3O C;  4HDU A;  1X1A A;  1ZTR A;  3M4O J;  2KMU A;  2DW4 A;  4AD9 A;  4N4O B;  3HOV J;  3CCV I;  2NVX J;  2BGC A;  4PUS A;  1QPI A;  4EJV A;  4B48 A;  2EV5 A;  2FUG 2;  2M30 A;  1BIB A;  4KJZ A;  1NTC A;  2P5L C;  2LSO A;  2EV6 A;  1U8B A;  2R4G A;  2IXS A;  1Y0U A;  3BDD A;  4HX7 A;  3WTS C;  4MIM A;  2F4O B;  3E6M A;  4A69 C;  3I58 A;  5M5W J;  3F6V A;  4B09 A;  4RBO A;  1R58 A;  2LMD A;  1BC8 C;  3CJN A;  4UXN A;  3K2Z A;  2ZME A;  5KVR A;  4A3C J;  1IRZ A;  4BBR J;  2GXA A;  3B02 A;  2R7Q A;  4HST A;  4FET A;  2DOA A;  1Y0N A;  3P5J A;  1XPX A;  3I54 A;  1SMY F;  2D5V A;  3QRF F;  1KON A;  2DOF A;  1YQA A;  5F6F A;  2OCE A;  2YX7 A;  3RQI A;  4HBL A;  2Y0S A;  1J9I A;  4AYB N;  4M3E A;  4O5V A;  2CUJ A;  4FIS A;  2F6C A;  3E1S A;  2WAQ N;  3LAJ A;  1HBX G;  3EUA A;  1Z0X A;  3C3W A;  2ID3 A;  3GBG A;  4B3A A;  4FTH A;  3VEP A;  2L4M A;  4UV8 A;  5H20 A;  2XSD C;  3KCC A;  1MJ9 A;  2ZXI A;  2GZW A;  2PMH A;  3BWG A;  2A07 F;  1PUF B;  1IAW A;  3K0L A;  3BR2 A;  3IKT A;  3BQZ A;  5HOD A;  1FJL A;  4Z6Y A;  4IF4 A;  4PJ0 C;  1WJB A;  3GWZ A;  2IJL A;  1ZH5 A;  4G8X A;  4R1H A;  4NB5 A;  1A31 A;  4AIJ A;  1OYW A;  2QGU A;  2QM3 A;  4NC8 A;  5F0F A;  2EWN A;  4BHB A;  5LLQ A;  5IY5 H;  3FXR A;  2EZK A;  3HEF A;  1G2H A;  1A6Q A;  3OL4 A;  4HEA 2;  4JOM A;  1YFH A;  1DUX C;  2R7X A;  1FT9 A;  2E1M B;  5GAE J;  3R61 A;  3VYU B;  4A6E A;  4ESF A;  2VE9 A;  2R7T A;  2ESN A;  1X4P A;  2DA3 A;  2FE3 A;  4UUS A;  4QLC U;  1LDD A;  3GTM J;  2RDP A;  4P1W A;  1IJW C;  3E5Q A;  4N4N B;  2LC2 A;  1NG6 A;  4IHY A;  2GA1 A;  4HZF A;  3WE2 A;  4I02 A;  4HRI A;  2LTP A;  2QSH X;  5J8F A;  3RTR A;  2DMP A;  5LBQ A;  2DPU A;  2P6T A;  2DMN A;  3HSF A;  3LA7 A;  2XSJ C;  1S5L C;  1KU9 A;  1FYK A;  3LST A;  1G3W A;  5IOY A;  5IP7 J;  4M6V A;  2BXY A;  1EF4 A;  2IS2 A;  2XF5 A;  1SAN A;  2H6C A;  1QHG A;  1T0F C;  2Q1Z B;  2W24 A;  2H8R A;  1FOW A;  3DCF A;  2ZXJ A;  2LF8 A;  4D7N A;  3V7R A;  3JRI A; 
#chains in the Genus database with same CATH homology
 2XPW A;  1UG2 A;  3S15 J;  1Y1W J;  4A3L J;  5K7H A;  2XPU A;  4L5E A;  5M5X J;  4IHX A;  2Y30 A;  3HGG A;  1HLV A;  1MBF A;  1QVT A;  4A3B J;  1WPK A;  3SFI A;  2MW8 A;  2LK2 A;  1ZQ3 P;  1UHS A;  3BR0 A;  2COB A;  3JRF A;  1TWA J;  1CQT A;  1VFC A;  3HDD A;  5M5Y J;  2YUS A;  2NOG A;  5JLX A;  5F27 A;  4A3J J;  2MSY A;  2CRG A;  3SDG A;  1AKH B;  1I50 J;  2JA7 J;  1ENH A;  3FIW A;  1ZR2 A;  1D5Y A;  3B6A A;  5E3N A;  4BXX J;  3RZD J;  1ETX A;  5EG0 A;  5C3E J;  3TW7 A;  3HOY J;  2R5Z A;  1ETV A;  3OOU A;  1MNM C;  1F36 A;  4XID A;  3ZQL A;  2DA2 A;  3JRC A;  1O4X A;  2EZL A;  3NAU A;  5F1J A;  5J1R A;  2X6O A;  1BA5 A;  1U78 A;  2GBY A;  1UMQ A;  2HXO A;  3OSG A;  3HM5 A;  1WI3 A;  9ANT A;  1FTZ A;  1QRY A;  4XIC A;  2L9R A;  2N8G A;  1JKR C;  1GV5 A;  4Y7N J;  5FLM J;  2R5Y B;  5J3L A;  2G0E A;  3G1M A;  3JRE A;  3M3Y J;  4A3D J;  2TRT A;  2LR8 A;  4FCY A;  3H0G J;  5JLW A;  2CJJ A;  2XGD A;  1TWF J;  5IP6 A;  1K83 J;  5EF6 A;  3ZQI A;  2YU9 J;  3A02 A;  3GTP J;  1JTY A;  1IV6 A;  4DYR A;  3A01 A;  3ZQF A;  2R5Y A;  4MLO A;  1RET A;  3JR9 A;  3S17 J;  1TWG J;  3TW6 A;  2OF7 A;  1TC3 C;  4XRM A;  4QIW N;  2R93 J;  3I4M J;  3GTK J;  3JRG A;  2EQR A;  2PMZ N;  1HF0 A;  3TP3 A;  4W97 A;  3HOX J;  1PUF A;  1MSF C;  2JN6 A;  2ECB A;  2O9L A;  1HDD C;  4A3G J;  1S7E A;  2Y2Z A;  1BW5 A;  1T33 A;  1WH5 A;  2AHQ A;  3FIS A;  3I4N J;  4HNV A;  2EZI A;  2K40 A;  2MGQ A;  1H8A C;  3BTC A;  2ECC A;  3HB9 A;  5E3O A;  2ELK A;  1RKT A;  2VKE A;  2DA6 A;  1XC5 A;  2E2J J;  1QVU A;  4MO7 A;  2EZH A;  4D7M A;  4ABZ A;  2DA7 A;  5IYC J;  3LNQ A;  1JJ6 C;  4A3I J;  3Q3S A;  4A3F J;  3MKL A;  1R9T J;  4M3G A;  3HKZ N;  1JTX A;  5GP9 A;  1H88 C;  2E2I J;  2ZB9 A;  3BG9 A;  1ZGW A;  1Z77 A;  4C3I J;  1DU0 A;  1BL0 A;  2VI6 A;  2NVY J;  1JT6 A;  1RES A;  2L7F P;  3VPR A;  3L1P A;  2L7Z A;  4I6Z A;  2VPR A;  3S16 J;  5EGO B;  3C2B A;  1IC8 A;  1LFB A;  1MBG A;  3LSJ A;  3K7A J;  1GDT A;  4XK4 A;  1A6I A;  1RPW A;  5IOZ A;  2E19 A;  2FQ4 A;  1JT0 A;  4A93 J;  2JWT A;  2ME0 A;  3CQZ J;  4X1E A;  3OSF A;  1ZK8 A;  3Q0U A;  2Y9Z A;  4IEJ A;  3QPS A;  2QCO A;  5FKL A;  5EGO A;  5EYR A;  1JUM A;  3A03 A;  2L7M P;  1P7J A;  5FKO A;  2FD5 A;  3WHC A;  2I10 A;  2FX0 A;  2LLK A;  1ETK A;  3S1M J;  3OIO A;  2LP0 A;  4UUT A;  5K7Z A;  3PO2 J;  1JKQ C;  4M3F A;  3K2A A;  1VF9 A;  3MVP A;  1IDZ A;  2M8G X;  4A3M J;  2XPV A;  3PM1 A;  1XG1 A;  2X48 A;  1WH7 A;  1MBE A;  1ETW A;  1VI0 A;  3S14 J;  2M34 A;  1B8I B;  2CQX A;  3GTO J;  2O7O A;  3O8G A;  4A3E J;  4B4C A;  3S1Q J;  3LOC A;  1AKH A;  1OJL A;  2NVQ J;  2GM4 A;  4XRS G;  3QQA A;  5J1U A;  1IUF A;  4FE7 A;  5E3M A;  1H89 C;  1LE8 B;  5FKN A;  4DW6 A;  1B8I A;  5BNG A;  5EDN A;  2EH3 A;  2DA4 A;  5J1Y A;  5GPC A;  1MH3 A;  2L0K A;  1GT0 C;  3WHB A;  1W0U A;  2FJ1 A;  2Y31 A;  1X2N A;  3HGY A;  3BG3 A;  4M3B A;  1LE8 A;  3E7L A;  1OCP A;  3CMY A;  2HOT A;  1SFO J;  3S1N J;  2WB1 N;  3BR5 A;  1MSE C;  2XB0 X;  1YRN B;  2CQQ A;  2LFB A;  2E1O A;  3ZOB A;  3D1N I;  4MFD A;  3SJM A;  2B63 J;  4B1R A;  3TED A;  5M3F J;  3CCY A;  3GTL J;  1HCR A;  5F0C A;  4GFB A;  1A5J A;  2HOS A;  4V2F A;  1YRN A;  3JRD A;  4JX6 A;  4MFE A;  2K9Q A;  2CU7 A;  5EZH A;  1RKW A;  4XRS A;  5C4X J;  1F43 A;  4BY7 J;  2VUM J;  1X58 A;  3G1L A;  3BR3 A;  3S2H J;  1NK3 P;  5EEA A;  3H3V K;  1MBH A;  2IBD A;  3F0C A;  1WGX A;  3IH4 A;  2P81 A;  4UUS B;  1VND A;  3GTG J;  4BKX A;  2DMU A;  4QTR A;  4IHV A;  2WV1 A;  2Y9Y A;  2X9D A;  4C3J J;  2NVT J;  2YS9 A;  1IDY A;  3CDL A;  3BTI A;  4D5C A;  1APL C;  4J19 A;  4AC0 A;  1LFU P;  2HXI A;  3FKI J;  3JRA A;  3UKG A;  4C3H J;  1AHD P;  2O8K A;  3IH3 A;  3W6V A;  1POG A;  1JUP A;  5GPA A;  3JRB A;  4IHW A;  2LY9 A;  1FIA A;  3B6C A;  1NK2 P;  2LVS A;  2HQ5 A;  2ID6 A;  3ZQG A;  3Q0V A;  3BTL A;  2W48 A;  4JX5 A;  2M9H A;  2QF7 A;  2M2E A;  1JKO C;  3IH2 A;  3BQY A;  3S2D J;  1W0T A;  1I3Q J;  2JJ7 A;  1MBK A;  5F0H A;  1B72 B;  5FKK A;  3BR6 A;  2DN0 A;  2EBI A;  1ITY A;  1JGG A;  2KT0 A;  3NAR A;  4D5F A;  1RR7 A;  3IV5 A;  1P7I A;  4CYC B;  1OCT C;  1I6H J;  1ORK A;  2DMT A;  5IP9 J;  2R0Q C;  2R92 J;  3HOW J;  1FIP A;  2JK3 A;  2DA5 A;  4DZJ A;  2DTZ A;  1B72 A;  2JA5 J;  2E2H J;  4Y52 J;  4G12 A;  1ETY A;  2HOA A;  1T56 A;  3HBL A;  2XRL A;  2TCT A;  4JP0 A;  4CYC A;  3FK7 A;  5EG0 B;  3BTJ A;  4BBS J;  4W1U A;  1E3O C;  1BJZ A;  5EZG A;  2KDZ A;  1ZTR A;  3M4O J;  1GV2 A;  2R5Z B;  1XS9 A;  3HOV J;  2NVX J;  4V2G A;  5IYD J;  1WCM J;  3HOU J;  1QPI A;  2XB5 A;  3MN2 A;  2JA8 J;  4JX4 A;  1U9O A;  1NTC A;  3S1R J;  1U8B A;  3ZQC A;  4I76 A;  4MIM A;  4A69 C;  4C2M J;  2ME6 A;  5C44 J;  5M5W J;  4RBO A;  1IG7 A;  1GVD A;  4AUX A;  4A3C J;  4NDL A;  4DYQ A;  4BBR J;  4DYC A;  2AO9 A;  1IRZ A;  2XGC A;  3BT9 A;  4EEF G;  5F04 A;  2D5V A;  2GLO A;  5FJ8 J;  4QSH A;  1ZKG A;  2H1K A;  1GUU A;  3G1O A;  5DTD A;  2CUF A;  2JMW A;  5IYB J;  3BR1 A;  1JJ8 C;  3RQI A;  2JA6 J;  3A01 B;  4AYB N;  4M3E A;  3LSP A;  2HDD A;  3TP0 A;  3RZO J;  4FIS A;  4FE4 A;  2MG4 A;  2WAQ N;  3GBG A;  1Z0X A;  2ID3 A;  4B3A A;  4FTH A;  1MH4 A;  3ZQH A;  1K61 A;  1IGN A;  1JKP C;  2XSD C;  5F08 A;  1Y1V J;  2DA1 A;  1PUF B;  3BR2 A;  3GTQ J;  3BQZ A;  5HOD A;  1FJL A;  1HDP A;  1MBJ A;  2NS8 A;  2XGE A;  3GTJ J;  4LOC A;  2LD5 A;  2NS7 A;  5F0F A;  3QPL A;  2VKV A;  5FLV A;  2EZK A;  2Y0S N;  3HEF A;  2RAE A;  1DU6 A;  1FTT A;  1G2H A;  1BW6 A;  1U9N A;  3JRH A;  1ETQ A;  4JYK A;  2HYJ A;  3O8H A;  1OFC X;  2DA3 A;  4UUS A;  3DEW A;  1JUS A;  3GTM J;  2CUE A;  1IJW C;  4DZP A;  4X6A J;  5C4J J;  1FEX A;  5IPA A;  4IHY A;  4BY1 J;  2DMQ A;  1TWC J;  2LTP A;  5M3M J;  2DMP A;  5E3L A;  2DJN A;  2IAI A;  1Q1V A;  1X2M A;  2R7Z J;  2DMN A;  2M0C A;  2LKX A;  3RKQ A;  2IEK A;  1TWH J;  5IOY A;  5IP7 J;  5FKM A;  1HOM A;  3HOZ J;  4M6V A;  1EF4 A;  1ETO A;  3BG5 A;  4RDU A;  1SAN A;  3LSR A;  2K9N A;  2K9S A;  5DS9 A;  3PO3 J;  2H8R A;  4M3D A;  1AU7 A;  2HI3 A;  4A3K J;  3DCF A;  4S0H B;  4D7N A;  3FK6 A;  3Q0W A;  5K7F A;  1ZR4 A;  3LSG A;  2OPT A;  3JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...