1F4KA

Crystal structure of the replication terminator protein/b-site dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*AP*TP*GP*AP*AP*CP*AP*TP*AP*AP*TP*GP*TP*TP*CP*AP*
publication title Structure of the RTP-DNA complex and the mechanism of polar replication fork arrest
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication/dna
total genus 43
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f4kA00
4XSXF 4LD5A 3MZYA 2IA0A 4ZYGA 3ULQB 2WV0A 3HOSA 2DTRA 4WXCA 2D45A 4EM0B 4R79A 1SMYF 2UXNA 4LLNA 3P9IA 1R5GA 1R58A 3BROA 1YYVA 3B02A 3DF8A 2FU4A 2FNAA 2GA1A 4ZZDA 2CO5A 3LFKA 1XSDA 2ADUA 3DKWA 3PFIA 5FFZA 2X0LA 1QQIA 3TKYA 1HSTA 2YX7A 2VC0A 4HX8A 1JHFA 2XV4S 4O5VA 4OMYA 5LLQA 2IP2A 1A04A 2K02A 4ZZLA 2DPUA 2COMA 3I59B 3BPVA 5HDGA 3EYIA 1NHAA 1YTYA 4HW0A 3K1NA 1UCRA 1J0RA 3VODA 1FSEA 4IRIA 2P4WA 1W5TA 3K2ZA 3V7RA 5K1YA 4RGSA 3BWGA 3L09A 4U88A 1SD6A 1BC8C 1IXRC 3SQNA 1P6RA 2CGPA 3ZMVA 5CVJA 1ZG3A 3DPLC 2VOOA 4UVAA 5AIQA 4BQAA 4M71A 2HDCA 2Z9OA 4CDGA 5LBQA 3WTUC 2XAQA 1QZYA 3WTTC 2FE3A 2YX4A 2R7FA 1H9TA 3NRVA 2STWA 1ODDA 2EV6A 5EEGA 3ZMSA 2KIMA 2MH9A 1MJAA 3VB2A 1ZN2A 3CO7C 1HW1A 2HKOA 1ZRCA 4MGRA 3IWFA 4HBLA 3M9AA 4BYYA 2H6CA 2L4MA 1Z05A 2K4BA 5F1RA 1J2XA 2YPRA 3R0AA 4OIRF 1WKMA 2OU2A 2L4AA 2QLZA 2Q0OA 1IXCA 2PQ8A 4QWQA 1J7KA 1BI3A 2HQNA 3HTSB 3H3ZA 4S04A 1OMIA 4Q48A 2KJCA 3U2RA 4K2EA 3R4KA 2W25A 3ISPA 5CVUA 4UVBA 2IPQX 2FBIA 5HS8A 2GXBA 3RPQA 3R0JA 5H20A 5L3FA 1G3YA 5BQTA 2UXXA 4GO1A 5CVIA 1REPC 3EETA 1JHHA 1MJBA 4EJVA 3ZMTA 2PBIA 3E6BA 5E20A 1RUOA 5ILVA 4UNOA 1S6LA 4HQMA 4LK1F 1J9IA 3ELKA 3M8EA 3BP8A 5LRSA 4HF1A 4EV0A 5D5UB 1XSXA 1B6AA 2DBBA 1ONVA 2GQQA 1U8RA 2R7DA 4HZFA 3FMSA 4O6JA 1MZBA 4ON0A 2TDXA 2PMUA 4I02A 5JFRA 3R60A 2MBFA 2Z3YA 1P92A 4N9IA 1GXPA 5EEHA 3FXRA 4ENNA 2IW5A 3IKVA 1R1UA 3DPTA 5D8LB 1FYLA 3LAJA 3I58A 1R7JA 1IF1A 2WC2A 1BM9A 1D5VA 3I54A 1XGNA 2IJLA 1FY7A 1KU3A 5D6FA 4LG0B 1ZG1A 4HF0A 2BGCA 2VC1A 3CDHA 3WTWC 5E1XA 3KZYA 4BHBA 1DPRA 3T1BA 2CFXA 2M5WA 3F72A 5JR3A 3WGHA 4ZYHA 5FO5A 5ED4A 4CICA 2DLLA 1GHCA 4HLXA 1BI0A 5ICGA 3N4MA 2HTJA 4N0BA 2O03A 2M8EA 2NNNA 3K9TA 3J80K 5D5XB 1FP1D 5D4RA 2XGXA 3KLNA 3BZ6A 4G7ZF 4RS8A 1QNTA 4HDVA 4ENJA 2CWEA 3C7JA 2ZJ2A 2HZTA 1HSJA 2DU9A 3QU3A 1U5TB 3EDPA 4LK0F 2Z99A 1XCBA 3QP6A 1EH8A 4GYIA 2IT0A 3LAPA 1K78B 3MCZA 4HDUA 1HKQA 2P7CB 5LHIA 3GFMA 1DUXC 5BMZA 1F9NA 4AIKA 3ERED 3DP7A 3HHHA 1T0FA 1G4DA 3NQOA 3J81Z 3FX3A 1QBJA 1K7AA 5L3CA 2DW4A 5ERIA 3H92A 2O0YA 3FWEA 2AXLA 1D8JA 1CF7B 2DK5A 4HX4A 4KN4X 4MEYF 4M6YA 2F5EA 2IRFG 2YR2A 2FSWA 2OBPA 1JGSA 4I7HA 3SFZA 2GZWA 3ML6A 3E5QA 4L9TA 1KYZA 4B09A 4KIFA 4R1HA 2E7WA 2OZUA 2XROA 3RJPA 1B4AA 2V9VA 2BEOA 2FNPA 1RNLA 2HYFA 2QBYB 3JTHA 1E2XA 4HV6A 5DCMA 1L3LA 2E1NA 4DNCA 1I5ZA 4ESFA 5ICCA 2XKPA 3N97A 1KQ0A 1V3FA 5JI6A 3QU6A 2FMLA 5IT9K 1PP8F 2PLYA 1KGSA 3SZTA 3GUDA 3F6OA 5L3GA 1ZGAA 3BJAA 4U0YA 1LEAA 5LRRA 5DV5A 2VN2A 3E3VA 4RGXA 1W7PB 3HOTA 2A61A 4OIPF 3HSEA 3E5XA 3RKWA 1LQ1A 1XB4A 4LJZF 1Z7UA 2HOEA 2PG4A 3KFWX 5HVQC 3MWMA 2RC4A 2PN6A 2A69F 5E17F 4CZZA 1HW2A 1ZYRF 3U9GA 3TO9A 3KZZA 3BY6A 1ZARA 2FF4A 3F8NA 4P55A 1JE8A 5HDNA 4EVIA 2HFHA 3IWZA 4I2OA 2F5CA 3J80Z 4G7HF 3J7AO 3P9CA 1IAWA 5BPDA 1S8NA 1RZ4A 3IL2A 4LFUA 1CGPA 3COAC 3U1DA 2V1XA 3W6JB 2CQKA 3KP5A 1YW9A 1I1GA 1FOKA 1FSHA 2MA3A 4UVCA 2X4HA 2EV5A 2P7VB 3I71A 2G9WA 2XAHA 3F8FA 3GEZA 1LB2A 5HLGA 3FXQA 3ZN1A 2FBKA 5L3EA 2JSCA 3KP6A 2EA2A 1FX7A 2H94A 3WU0A 4XSZF 4EGYA 3GXOA 3DFGA 3KP2A 3HRUA 3CUOA 1OKRA 1IN8A 3ZMDA 3W6KB 1BIBA 3V8JA 2YU3A 2A6HF 2ZMEA 5AIPA 2EA4A 4ESJA 1IW7F 2F5DA 4KIGA 3VFZA 2J5OA 3LSTA 3K1PA 1X3UA 5H6RA 4OINF 3GFIA 4RGUA 4HAMA 1ON2A 2D2WA 2XKOA 4Y17A 1O3RA 2KIUA 4NHJA 2STTA 3E97A 4L9JA 2MLKA 3VEPA 1LVAA 1RIOH 3QPHA 4G6DA 1HW5A 3ABUA 4S05A 1D8KA 2M45A 4MQVA 3RPUA 2LDUA 1R1TA 2QQAA 4AIJA 4BAYA 1ZRDA 3WE3A 3Q9VA 2HR3A 4H0EA 5CVRA 5LHHA 4WXHA 2ETHA 2FBHA 1Z6RA 1BC7C 2PMHA 1USSA 4CXFA 2PJPA 1GVJA 2LF8A 3K0LA 4WXDA 1DP7P 4KA4A 1SAXA 3AAFA 1G3TA 2EFPA 3JSOA 2FQ3A 1S7AA 2RNJA 4PCQA 1JXSA 2EB7A 4KT5C 2UWMA 1TNSA 3Q5FA 1SFEA 5LGNA 3WE2A 2ZCWA 3IKTA 4CHUA 3FM3A 1SD7A 1BIAA 2CYYA 2VBWA 3D0SA 4EM2A 1KU9A 1EH6A 2HTSA 2LKPA 3L7WA 2Y0MA 4E70A 1LDDA 1Z6TA 4YG2F 4EJWA 2BE5F 1MDMA 1O57A 4U0VA 4YIFA 1O7LA 2Z5UA 4JQFA 3F3XA 2YSRA 2HS5A 3CUQA 1RUNA 4Q5SF 1YW7A 1FPQA 4MNUA 2NYXA 5LHGA 2VODA 2VT2A 1L0OC 2VXZA 5LGTA 4PZJA 5K5QA 3B73A 1U5TC 4IHTA 4LLGF 1TQIA 2O3FA 4L18B 4HYEA 2IVMA 2CG4A 5CVVA 4RAZA 2MD5A 1S29A 4RGRA 3F6VA 1BOAA 1EH7A 5DCMB 5DYMA 3TGNA 2W85A 2HGCA 2P6SA 3GO5A 1TW3A 3VOEA 5J8FA 2VE9A 1WSUA 4M9ZA 3WTZA 5FD6A 1P4AA 1QPMA 1IZ1A 2K7LA 3K69A 2ZBKA 4R8HA 3TO6A 3GFLA 5E8IA 4RAYA 4ZYEA 3HRMA 2MLGA 4HA8A 2IA2A 2ZNZA 2LSOA 3HIFA 1ZGJA 3PQJA 1WRJA 1LJ9A 1S7OA 2J5PA 3I59A 1PUEE 1ULYA 2F5FA 4OMZA 3FMRA 2GA2A 2CW0F 3D5LA 2HWVA 1QZZA 2EFWA 1F1ZA 4XBFA 4GGGA 1H0MA 1YIOA 2A07F 4O3MA 2GAUA 1U2WA 2ISYA 2LF7A 4CYDA 4UV8A 1OR7A 1SMTA 1ZH5A 5JHUA 1OPCA 4UHTA 2E1CA 3RKYA 2GWRA 1YQAA 1S3JA 1T39A 4GYGA 1G6NA 2OQGA 4HX7A 4LMYA 1PP7U 1J59A 3WTXC 5E1WA 2M30A 3TDZC 3V8LA 1KQ9A 4AWXB 1YO5C 1SFUA 4QLCU 3RDIA 3M7GA 1T38A 1IUYA 1D3YA 1T2KA 5F64A 4A5MA 4I01A 1RI7A 2KKOA 4XLNF 1Z1DA 2P5LC 1IRFA 4FHTA 3FMQA 3ZQ7A 3KP4A 2DQRA 3Q9SA 4IXAA 4MEXF 1YFHA 5ILSA 4JBAA 4WK8F 4AVPA 5DD4A 4LLLA 3QPTA 3RIRA 2H6BA 2NAZA 2FMYA 2ZNYA 3QRFF 4CO8A 3MAJA 5FLXK 4BH9A 5DCFA 3CUQC 2PEXA 4LB6B 1ON1A 3LA2A 2V6CA 2DK8A 3T5XA 2K27A 2P6TA 4HOBA 3HTUA 2RN7A 3LA3A 1W4MA 4TV7A 1TQPA 3P7NA 1O7FA 5HLIA 1MKMA 3RI4A 1WQ2A 1IRGA 2JZYA 6PAXA 1I1SA 2EJRA 2XUBA 4EGZA 3F8CA 3JW4A 2RKHA 2XAJA 1SFXA 3HSFA 1B59A 3WU1B 1FNNA 3S2WA 2W57A 1I27A 4P96A 4I0BA 3ZN0A 4FX4A 2QM3A 3KETA 2QUFA 1ZRFA 1MGTA 3M8FA 1LEBA 4DQ2A 1T6SA 5D5WB 2C6YA 3L9FA 5CYVA 5D5VB 5E8GA 1R22A 3F23A 3I0TA 2XRNA 3WTSC 2RDPA 1UFMA 1OYWA 4MTEA 1MJ9A 1FBQA 1TTYA 1FP2A 3RKXA 1FZPB 3T0YA 1SD5A 1P2FA 2KJBA 4KMFA 4YIIA 5HDKA 1KYWA 1ZAOA 4P5OA 1TLHB 4Y13A 1FC3A 1UB9A 2VT3A 4WF2A 2Y48A 2A3SA 2P5VA 3ECOA 2ELHA 2A5YB 3C1DA 4ENKA 3F21A 1K6OA 2HKXA 2V79A 3P9KA 1BBYA 4LG0A 3JAMK 2DT5A 4L9NA 3FF5A 4MHGA 1IN7A 4A6EA 3E5UA 2BV6A 3FXUA 1KU2A 5A2QK 3F8MA 4P9UA 2ZFWA 1XMAA 3IRQA 2CSOA 2DQLA 4NQWA 4WCGA 5D6EA 3I64A 2FOKA 3TOAA 1PDNC 3LWFA 3TDUC 1QGPA 1U6GA 2XHKA 4P9FA 1P4WA 2KRFA 2RVCA 4ENMA 5K5RA 3G3ZA 5CLSA 2O8XA 1YS7A 2RQPA 2XAFA 3T8TA 1AWCA 1KA8A 5JVTA 2HEOA 2V1UA 4FT8A 1U5TA 4D0PA 1FLIA 1FBSA 2H09A 2MH2A 4AIHA 4YFNF 4UUVA 2JTVA 2VE8A 3MZHA 1XDUA 3GWZA 2OA4A 3C18A 3M1EA 1K78A 2XVCA 1V4RA 4ASNA 3ZP5A 1VTNC 4G94A 3HYIA 5ICFA 3BOQA 3HUGA 2XASA 2ISZA 4IHSA 5ILUA 4KN7X 4N9HA 4PGHA 5LGUA 1FWZA 2A6EF 3E6DA 2ZKZA 1W5SA 4EQQA 4KFCA 3R6SA 4XRFA 5FLXZ 3FM5A 4KIBA 1Q1HA 4ETSA 4M9XA 3HRTA 2FXAA 1XGSA 4A6DA 1CF7A 4UV9A 3SHFA 4BXUA 4I98B 1B1BA 1O3SA 2QQBA 2G7UA 3IC7A 1K79A 5FB2A 4LGWA 1LDKB 4KUMA 5DEQA 5H6QA 4MTDA 5E18F 4A2UA 4G8XA 2QVOA 5DD8A 4RB3C 5L3DA 2NS0A 3EQLF 4OOIA 3ROUA 1Z91A 3RYPA 2E7XA 3L2CA 3WG9A 3OOPA 2QBYA 3V7CA 2EFOA 1HBXG 3ZMUA 2PI0A 4Z2YA 1XGOA 1B9MA 2O6GE 1FBUA 5IT9Z 1BI1A 1U78A 2EK5A 3QP5A 5IT3A 1FYMA 5J8CA 3LQQA 4M73A 4F7ZA 4BHCA 4L9VA 3JTGA 2DI3A 3L00A 2B0LA 3QAHA 5AONA 2K4JA 2F2EA 5DUIA 3LA7A 4M74A 4EJUA 2RGVA 1W7PA 4IVNA 4XLPF 2QWWA 1R36A 3DXJF 4I0AA 2W84A 2DFIA 2QQ9A 4EMSA 4IF4A 2XAGA 1BN5A 1J5YA 3GF2A 4EM1A 3TOBA 4AD9A 4A12A 3JAMZ 1AOYA 4KYWA 4G7OF 4PGGA 3CTAA 4ESBA 3GZ5A 3J81K 4FX0A 2JPCA 3GZ6A 1XD7A 4B8XA 2QENA 1Y0UA 4RB0A 3RYRA 3GYHX 3I4PA 2HQRA 5A2QZ 4Q47A 2H27A 1R5HA 5LEJA 3DEUA 4ZH4F 1IN5A 1FYKA 2QZ8A 2R3SA 2VBXA 4L0ZB 3HHGA 5J6XA 2OAZA 3TO7A 4HQEA 3EUHA 1Z9CA 1ZLJA 3F22A 1F5TA 4KICA 2K86A 3WGGA 4MQ9F 2A68F 4PDKA 3CJNA 3KEOA 3MEXA 1USTA 1J75A 4L5JA 2HYGD 3HRSA 2VBZA 3CO6C 2ZO4A 3F8BA 4CGZA 2VBYA 3V7SA 3CLOA 1GXQA 4M72A 2ZXJA 1QO0D 3E6CC 5KK1A 2PFBA 3T8RA 3GFJA 1U3EM 1XSVA 3V8KA 2FRHA 2W24A 2AS5F 1H9GA 5BOXA 1HKTA 1F4KA 5DUKA 4G9YA 2BBYA 3QOPA 1UHWA 1O3QA 2DPDA 3E6MA 3I53A 1FT9A 1HQCA 4GCVA 1TNTA 4ZYDA 4IRHA 4A0XA 4LB5A 2D1VA 2EFQA 3KLOA 2QYOA 5KVRA 1ZREA 3O6BB 3KE2A 1W7PD 1G3WA 3H3UA 3REOA 2Q2EA 3ABTA 4OU0A 3V4GA 2Q8KA 2NRAC 1SD4A 2LNBA 2NNYA 2FA5A 3MQ0A 3DV8A 2IA1A 2OQRA 3JSPA 2Y75A 2L02A 2VOPA 1YG2A 5E1ZB 1IN4A 4KNYA 3WTVC 2DO7A 2JPBA 3WTYC 3RTRA 4YFKF 3NEUA 2VONA 1KU7A 4A5NA 4HF2A 1MD0A 1YLFA 4M9SA 1C0WA 4OIQF 1LDJA 3IHUA 4IRGA 3BDDA 1KQ8A 3O2PE 4BHPA 1T98A 5FGMA 3SXYA 2M87A 3DQVC 1STZA 4EJTA 5CJ9A 1EV7A 1TQMA 1DDNA 4JK1X 2WWYA 5FFXA 5K5OA 3O3KA 2WTEA 3KCCA 2D1HA 2M1BA 3G73A 3BJOA 1XMKA 4U7DA 1WWXA 2DAOA 3I5UA 3HSRA 1TW2A 3R61A 5L3BA 1R00A 3FZVA 4HV5A 4A0YA 1DPUA 3FHZA 2ESNA 5HS9A 2ESHA 2ZMEB 1UHMA 2XIGA 1XGMA 3EYYA 3WODF 3WGIA 4RB1A 1XN7A 1YS6A 4BNCA 4KDPA 4L5IA 4GXOA 1R23A 2G7HA 1ZG5A 2GIVA 3IRRA 2ACJA 1HKSA 1G3SA 1TBXA 1ZLKA 5DDGA 4L0YB 1R1VA 3KP7A 2Z33A 2L54A 1HXDA 1P4XA 2EWNA 4KMUX 1IXSB 4HLYA 1WI9A 2OD5A 4NB5A 3KEQA 3TQNA 2KIFA 3KP3A 5TJJA 5BPIA 4G6QA 4U0WA 2UZKA 5ICEA 1XDSA 1I6XA 3GLXA 3ECHA 4EJOA 1B9NA 5FD5A 2P8TA 4Y15A 1XCVA 2L3DA 5HS7A 4U7BA 1YW8A 3BJ6A 4YFXF 2BYVE 2EV0A 1IN6A 2JRTA 4WX9A 3SZPA 5BS6A 2MC3A 2O61A 3MFKA 5F6FA 4IJAA 2P5KA 5TRDA 5D8KB 2EFNA 4OIOF 4I09A 1BI2A 3OV8A 1LNWA 2OZ6A 2V1DA 2FEZA 4Q4ZF 2JT1A 3BPXA 3GVAA 1OYIA 5D4SA 3ZMZA 5HLHA 4RB2C 1E17A 2GXGA 3LQRA 5HOOA 4IPAA 1MDMB 3ZPLA 3GX4X 3C3WA 4WWCA 1OYYA 1BJAA 5LEKA 3PQKA 4UXNA 3K1MA 4A0ZA 3CUQB 1O3TA 4M6XA 3GW2A 1ZHFA 2RV8A 2L01A
chains in the Genus database with same CATH superfamily
4BQQA 4XSXF 2G0EA 4LD5A 3MZYA 2IA0A 4ZYGA 4XLFA 3ULQB 5B1AH 1TP4A 4CH7A 2W48A 2BW3B 2H1KA 1DU6A 4PSXA 2WV0A 2JJ7A 3HOSA 4XNFA 2DTRA 2OCCH 3OSFA 4WXCA 2NVQJ 3W2AA 2JA5J 2Z16A 1FIAA 1WJEA 2D45A 3DCFA 3QOEA 5EYRA 4EM0B 4R79A 1SMYF 2UXNA 2V4JC 2QCOA 3P9IA 3ZCOA 4LLNA 1R5GA 1R58A 3BROA 2KPMA 1YYVA 1VQNI 3B02A 3DBLB 4G6TB 3DF8A 2FU4A 3H1CA 2FNAA 2GA1A 3BR3A 2CO5A 4ZZDA 4XORA 3ERMA 3OYGA 1LKXA 3BQYA 3LFKA 1OCPA 1Z21A 1XSDA 2ADUA 3DKWA 3PFIA 2MGQA 1RETA 1T56A 4RM2A 5FFZA 2CFOA 2X0LA 1QQIA 3TKYA 2XC7A 1HSTA 3RQ4A 2OCEA 3N05A 2YX7A 2VC0A 2GOMA 3FXKA 4HX8A 3OR2C 1JHFA 2VL8A 2XV4S 4O5VA 1R4MB 2HPIA 4OMYA 4HNVA 5E3OA 5LLQA 3CCMI 2IP2A 1A04A 2K02A 4ZZLA 1A6QA 3DTIA 2DPUA 2COMA 2PMZA 3ZRGA 3I59B 3BPVA 5HDGA 3EYIA 5HNHA 3EUKL 2M7BA 1NHAA 2BVMA 2ZJPF 3S3MA 2IS2A 2L9SA 1YTYA 4HW0A 3K1NA 1UCRA 1Y1WJ 1J0RA 1DP3A 2PJRB 3VODA 1FSEA 1V54H 4IRIA 2R5ZA 2P4WA 2IGOA 1W5TA 3K2ZA 3V7RA 1W36D 2Y69H 1S5LC 1D0ZA 4E7HA 5K1YA 4FE4A 4RGSA 3BWGA 3OYIA 3L09A 1GV2A 5C3EJ 4U88A 1OCOH 2MC4A 1SD6A 1LPQA 1BC8C 4F91B 3HJEA 1IXRC 2NVUB 2EPFA 3SQNA 2X9DA 1P6RA 1SFOJ 2CGPA 1OISA 3ZMVA 5CVJA 1ZG3A 5FRMA 3DPLC 2VOOA 4UVAA 5AIQA 4BQAA 1D1CA 3A02A 4M71A 2HDCA 2Z9OA 4CDGA 5LBQA 2E1OA 3WTUC 2XAQA 2KFDA 1QZYA 3WTTC 5JHFA 2BY1A 2MD0A 2JWTA 2FE3A 2YX4A 5GADJ 3QODA 4NUBA 2R7FA 1H9TA 3NRVA 2STWA 4IL6C 1ODDA 1U8BA 2EV6A 2ID6A 4RBOA 5EEGA 3ZMSA 1WJAA 1GUUA 4XLHA 3I56I 2KIMA 2VKHA 1APLC 3HG9A 2MH9A 1MJAA 4XRMA 2YS9A 3VB2A 3AG3H 1ZN2A 2CW8A 5FROA 3ZQGA 4C2UA 3CO7C 2XGCA 1HW1A 2HKOA 4A3JJ 1ZRCA 2XGEA 3G1LA 3GTMJ 2BY0A 5K7HA 4W1UA 2CU7A 4MGRA 1YI2I 3CMEI 1N75A 3IWFA 4HBLA 3M9AA 4BYYA 2H6CA 5EGOB 2L4MA 1Z05A 2K4BA 5F1RA 1HC8A 4XLCA 2QGUA 1J2XA 2YPRA 3R0AA 2OPTA 1Z77A 4OIRF 1WKMA 3ZOBA 2OU2A 2L4AA 1ETXA 2E19A 4Y3OA 4E7SA 1A5JA 1H8AC 2IBDA 3HPGA 1TT0A 4CUGA 2QLZA 2DYSH 1Q1VA 2Q0OA 1IXCA 3BG7A 2PQ8A 3CCSI 4QWQA 1J7KA 1BI3A 2HQNA 3HTSB 3H3ZA 4S04A 1OMIA 4Q48A 1TT5B 2CV1A 2KJCA 1ENHA 3U2RA 4K2EA 3R4KA 1YJWI 4I6ZA 2W25A 3ISPA 1CQTA 5CVUA 4UVBA 2IPQX 1X2MA 2FBIA 5HS8A 1JJ6C 1AKHB 2GXBA 3RPQA 3H5NA 3B6AA 1QU3A 1VQ6I 3R0JA 5H20A 5L3FA 3HOYJ 1G3YA 5BQTA 4A3LJ 3VYSB 2UXXA 3QYFA 4GO1A 4J19A 1GV5A 2V9PA 3HBLA 4P1WA 2YUSA 5CVIA 1ETVA 1REPC 2OF7A 3EETA 1JHHA 1MJBA 4EJVA 3BR0A 4BE0A 3ZMTA 1RR7A 2PBIA 3E6BA 4AU7A 3HOUJ 5E20A 1WJBA 1RUOA 5ILVA 4UNOA 1S6LA 3JRGA 4HQMA 4LK1F 1J9IA 3ELKA 3M8EA 5M3FJ 3BP8A 5LRSA 4HF1A 4EV0A 5D5UB 2KMUA 1XSXA 4M3GA 3QYBA 1B6AA 2DBBA 1IGNA 1E3OC 1ONVA 1X1BA 2GQQA 3CMAI 2KT0A 2R7DA 1U8RA 1D1AA 1VQ7I 4HZFA 3H3VK 3FMSA 4O6JA 4CA0A 1MZBA 1RC9A 2MYSA 4ON0A 2HOSA 2TDXA 1IDZA 2PMUA 2DFHA 2VUMJ 2LK2A 4I02A 5JFRA 3R60A 2MBFA 2Z3YA 1X58A 2FJ1A 3LSPA 1P92A 2QA4I 4N9IA 3HGYA 2QQ8A 3OYKA 1GXPA 2F6CA 1SANA 3S15J 5EEHA 2KLOA 3FXRA 4IQJA 4YELA 4ENNA 2IW5A 3HC7A 4PFOA 3IKVA 9ANTA 4B3XA 1R1UA 3MKWB 5FKMA 1NG6A 4A93J 3A03A 4A3GJ 3GTGJ 3DPTA 3O8HA 5D8LB 3G2BA 3BT9A 2V6EA 1FYLA 3LAJA 3QWLA 3LL7A 2LG4A 3BTLA 3CC7I 4IKFA 2KRHA 3I58A 2EIMH 3Q0WA 3SYTA 2H8WA 2GM4A 1R7JA 1VQ9I 1IF1A 3BZCA 2WC2A 1G2HA 4G12A 2E71A 1BM9A 3K4MA 1D5VA 3I54A 2DMPA 1XGNA 1UG0A 3BC8A 2IJLA 1FY7A 1KU3A 1K61A 3SEZA 5D6FA 3IP4B 3MZ8A 4LG0B 2ZFUA 2LY9A 1ZG1A 3U21A 2LBFB 4HF0A 2AQFA 2BGCA 2CQ7A 2VC1A 3CDHA 3WTWC 3SFIA 5E1XA 3KZYA 4NC7A 3J7YJ 4BHBA 1DPRA 3BQZA 3T1BA 5JLXA 2L7FP 2CFXA 3RZOJ 2M5WA 2EBIA 2IXSA 3F72A 5JR3A 3WGHA 4ZYHA 2LMDA 3PIPF 1X2NA 2O5RA 5J1UA 5FO5A 4HG2A 5ED4A 1IJWC 4NQWB 3GLLA 1U9OA 3Q0VA 4XKCA 1B72A 1IDYA 1WI3A 4J00A 2XSJC 1LUJB 4BJ5C 4CICA 1OCTC 2DLLA 1GHCA 4HLXA 3SDBA 3JR9A 1BI0A 5ICGA 3N4MA 2HTJA 1OQYA 4N0BA 2O03A 2L2OA 2DA4A 2M8EA 2NNNA 3K9TA 4MO7A 5CKTA 3J80K 3E1SA 3OS2A 1UJ8A 2GXAA 5D5XB 1FP1D 2OC6A 4F93B 4AUXA 3IH3A 2XGXA 2ID3A 5D4RA 3KLNA 1YJ9I 1RR8C 3BZ6A 1I50J 3ABMH 2ELKA 3DKXA 2QEXI 1V5EA 4G7ZF 4RS8A 1QNTA 4HDVA 4ENJA 1BR2A 2CWEA 1SEUA 4FCYA 1JGGA 1OCCH 2ELJA 3C7JA 2ZJ2A 3CMMA 1VQMI 2HZTA 1HSJA 5EJCA 5BNGA 2DU9A 1Y6IA 1MBEA 3H9GA 3QU3A 1ETKA 1U5TB 3ZR8X 1IV6A 3EDPA 4LK0F 5GAHJ 5GAGJ 2Z99A 3FKIJ 3K70D 1XCBA 3CESA 3QP6A 1EH8A 2VI6A 4GYIA 1KZHA 2IT0A 1VI0A 3LAPA 1K78B 2ZXHA 3MCZA 1BR1A 3PFYA 4HDUA 1HKQA 1M1EB 3GBGA 1GLNA 2P7CB 1N77A 3Q0UA 2E1MB 3OYBA 2EQRA 5LHIA 3HUGB 2VXDA 3GFMA 1DUXC 5BMZA 1F9NA 2CH0A 4AIKA 3OIOA 4A3IJ 1VQKI 3ERED 4BY7J 3JRCA 1IRXA 3DP7A 3HHHA 1T0FA 1G4DA 5IYDJ 3NQOA 2H1LA 3FX3A 5TGTA 3J81Z 1PUFA 1QBJA 1XX5A 1K7AA 4RA2A 1SFKA 1T08B 4BUPA 1YRNA 2A05A 5L3CA 2DW4A 3E7LA 2VJJA 5KAIC 3W3CA 5ERIA 3H92A 4HNUA 2VPRA 2O0YA 3FWEA 4CCJA 4RLFA 4BL0B 2AXLA 3DTKA 3KEYA 5HNFA 1D8JA 4ZJZA 1CF7B 2DK5A 2P0WA 4HX4A 4KN4X 4MEYF 3AG1H 4M6YA 3AL0C 2F5EA 4QPOA 2IRFG 4OAYA 2Y9YA 2YR2A 3CJTB 1Z3XA 4XKWA 2FSWA 2OBPA 1JGSA 4I7HA 2DDAA 3GZNB 3S2DJ 2Q1ZB 3SFZA 2GZWA 3ML6A 3E5QA 1B8IB 4L9TA 2V1NA 1KYZA 1WHUA 4B09A 4KIFA 4DZPA 4R1HA 3CF2A 2E7WA 1P9QC 2OZUA 3M8JA 1ZTRA 3E0JB 2XROA 3D1NI 3RJPA 2HDWA 1B4AA 2V9VA 4NC6A 2BEOA 1UG2A 1WCMJ 1S72I 5M5WJ 1IUFA 2FNPA 3H0DA 2ECBA 1RNLA 4AM3A 2HYFA 1JKQC 3B6CA 2X1CA 2QBYB 3LMMA 1Z3YA 3JTHA 1E2XA 4A3KJ 2JUGA 4HV6A 5DCMA 1L3LA 2E1NA 5J4YA 3ZQCA 2XB0X 4DNCA 1I5ZA 4DZJA 4ESFA 5ICCA 1MMDA 2XKPA 3BR2A 1JT0A 3N97A 2M3AA 1KQ0A 1TL8A 1V3FA 1H89C 4EATA 2X1EA 2BXYA 5JI6A 4ZDOA 3QU6A 2R7ZJ 2FMLA 3SJMA 5IT9K 2Y9ZA 1SVLA 1PP8F 1X1AA 2HZDA 2PLYA 3RKQA 3HOVJ 3JREA 5LFAA 2FUG2 1KGSA 3SZTA 2K9NA 3LSHA 3GUDA 4F3QA 5FLVA 3FISA 1VQLI 1W0UA 4S0HB 2KQRA 3Q3SA 3F6OA 1R9TJ 2XSDC 3LSGA 5L3GA 4M3BA 1W0TA 1ZGAA 3BJAA 2XRLA 4U0YA 1LEAA 2VKDA 5LRRA 5DV5A 5EG0A 2VN2A 4ZTJA 4OWRB 3E3VA 4RGXA 1W7PB 3HOTA 1K4SA 1J09A 2VQLA 2A61A 4OIPF 3HSEA 3E5XA 1Z0XA 3RKWA 1AU7A 3A2KA 1FOWA 3TBIA 1XB4A 1LQ1A 4LJZF 1Z7UA 1LE8A 2HOEA 2HQ5A 2PG4A 3KFWX 1EKEA 3MWMA 5HVQC 1ERDA 3PL8A 3CLQA 1FTTA 2RC4A 2BHZA 2PN6A 4B44A 2DA3A 2A69F 2EZIA 2L9RA 5E17F 4IOCF 4CZZA 1HW2A 3K7AJ 1ZYRF 4JX6A 3JRHA 2HVQA 3U9GA 5DM6F 3TO9A 3KZZA 4M3FA 5HLTA 4UUSA 2HXIA 3BY6A 1ZARA 2DT7B 4XMYA 4JX5A 2WAQA 2FF4A 2KZVA 3TW6A 3F8NA 4P55A 1JE8A 2DODA 4FE7A 5HDNA 3SEQA 3PUFA 1WFXA 4EVIA 4IX7A 2HFHA 1MBKA 2HI3A 2JVHA 2CQXA 3IWZA 4I2OA 4BGDA 3WU2C 2F5CA 3J80Z 4G7HF 2EZKA 1NG7A 4XN3A 1HDDC 3J7AO 3P9CA 1BW6A 4RMNA 1IAWA 5BPDA 1S8NA 1RZ4A 3IL2A 4LFUA 1CGPA 3COAC 3U1DA 2K9QA 2V1XA 3W6JB 1TWCJ 1DGRM 2CQKA 3KP5A 1YW9A 1I1GA 1FOKA 1FSHA 2MA3A 2DN0A 2M8GX 1UHSA 3DWLE 4IQ4A 5KCMA 2E5ZA 2DMQA 2XPVA 1TWHJ 2X4HA 2EV5A 2P7VB 2F4MB 2F48A 3I71A 2G9WA 4H4KC 4UVCA 2XAHA 2HNHA 1T0FC 3F8FA 3GEZA 1YE9A 1LB2A 1F36A 5HLGA 2B63J 3FXQA 2DYRH 4IHXA 3C2BA 5IY5H 1LVKA 1W1WE 3ZN1A 1WZ2A 4N4OB 3S16J 2FBKA 2IGNA 3GCMA 1OJLA 4C30A 3RSNA 2JSCA 3EUAA 5L3EA 2WY8Q 1Y56A 1SVOA 3KP6A 2EA2A 2HDDA 1FX7A 2H94A 3WU0A 4XSZF 4Z6YA 4EGYA 1FOYA 3GXOA 5IP6A 3DFGA 2JRMA 1MNEA 3KP2A 3PNYA 1X1PA 3HRUA 2DTZA 3CUOA 1EJ9A 1OKRA 1HLVA 1IN8A 1Y8QB 3ZMDA 1OCRH 3W6KB 1BIBA 3V8JA 2YU3A 2A6HF 4PJLA 2VQHA 2ZMEA 5AIPA 2EA4A 2K5CA 4ESJA 1IW7F 2F5DA 4KIGA 3VFZA 4FTHA 3FK6A 4DYQA 1FJLA 1FEXA 2J5OA 4V2GA 3ABKH 1ORKA 3LSTA 3K1PA 1X3UA 5H6RA 3GTPJ 4B3AA 2CV0A 4DOZA 4PJNA 3DLLF 5KAFC 3VWBA 4OINF 3GFIA 4RGUA 2JUCA 4HAMA 1FTZA 2LOOA 2Q2EB 1ON2A 5FKNA 5IYBJ 2IEKA 2D2WA 2AO9A 2NXNB 1D0YA 3IV5A 4NC8A 3CCLI 5IPAA 2XKOA 3OYHA 4FASD 4Y17A 1O3RA 2KIUA 2V9KA 2HVRA 2STTA 4NHJA 3E97A 3WHCA 4L9JA 2MLKA 3VEPA 2F4IA 1LVAA 3BCBA 1RIOH 2K9MA 3QPHA 4G6DA 1HW5A 3ABUA 5IOZA 4S05A 1D8KA 2JMWA 1GVDA 3CZ6A 5E3LA 2M45A 2NVXJ 4MQVA 3RPUA 2H8RA 5J40A 3HOZJ 3K2AA 2LDUA 3H9QA 3OYLA 1ZR4A 3VDXA 4C3JJ 1R1TA 1WJDA 2QQAA 4AIJA 4BAYA 1ZRDA 1XC5A 3WE3A 3Q9VA 2HR3A 1R6RA 4BEHA 3L2UA 4H0EA 2E2IJ 5CVRA 5LHHA 4WXHA 1TWFJ 2ETHA 2FBHA 2O7OA 3QPSA 3BLYA 1Z6RA 1BC7C 1VF9A 2PMHA 1USSA 4GDFA 4CXFA 2PJPA 2JA6J 1T33A 1GVJA 2LF8A 2X6OA 3K0LA 4WXDA 3FIWA 3BG5A 3BTJA 1DP7P 2LR8A 4KA4A 1SAXA 5C4JJ 3G6EI 3AAFA 2R5YB 1G3TA 2EFPA 3PSFA 3JSOA 2FQ3A 1S7AA 1QVTA 2RNJA 2WAEA 4RM3A 4PCQA 1IG7A 1JXSA 4Y7NJ 3JRDA 2EB7A 2LY2A 1MNMC 4XOTA 1E3HA 3HOWJ 3OMYA 4KT5C 2L7KA 2UWMA 2WY7Q 2E2HJ 2R7TA 1TNSA 4JOMA 3Q5FA 1SFEA 2DT6A 5LGNA 1LFUP 3WE2A 3A01B 3OYNA 2ZCWA 3IKTA 4CHUA 3FM3A 3OYFA 1SD7A 1BIAA 3DEWA 3CCJI 4XK4A 2CS3A 2CYYA 2VBWA 3D0SA 4EM2A 4B47A 2ME0A 1KU9A 1VQOI 1EH6A 2HTSA 2LKPA 4FQGA 2F4OB 3L7WA 2Y0MA 4E70A 1LDDA 3L2VA 1Z6TA 4YG2F 2HXOA 4X1EA 5IOYA 2IAIA 4EJWA 2BE5F 4X0GA 4BDZA 2B9SA 1MDMA 1O57A 4U0VA 4YIFA 1O7LA 2Z5UA 2PX9A 4JQFA 4CCKA 2DOEA 2W82A 3F3XA 2YSRA 2HS5A 3CUQA 2XAUA 3ABLH 1RUNA 4Q5SF 1R71A 4NNJA 5M5XJ 1YW7A 2X51A 2V7FA 1FPQA 2JA7J 4MNUA 2NYXA 5LHGA 2FX0A 2VODA 2EZLA 2VT2A 1L0OC 2VXZA 3H36A 4OAZA 5LGTA 4PZJA 5K5QA 1MMSA 1QHHD 3MMYB 4CYCB 3B73A 1PYVA 2OUMA 5CQGA 3I55I 1U5TC 2CRGA 4IHTA 4LLGF 1RKTA 1TQIA 2O3FA 4L18B 4HYEA 1Y8RB 2IVMA 2HU9A 2CG4A 5CVVA 1MMAA 4RAZA 2BW3A 4A3DJ 4M3DA 1MBFA 2MD5A 1S29A 3HB9A 1U9NA 4RGRA 5GP9A 3F6VA 3W2WA 3A0HC 3D5SC 1BOAA 1EH7A 5DCMB 5DYMA 2QSHX 3L1PA 3CCEI 1I6HJ 3TGNA 2W85A 4IHYA 2HGCA 2RQQA 2P6SA 2WAQN 2WADA 3OWTA 2HOAA 1HA8A 3GO5A 1YX3A 4I99C 1TW3A 2CUZA 3OYEA 2JSPA 2ZMEC 3KZIC 4PJMA 3VOEA 5J8FA 3LOCA 4AC0A 2VE9A 1WSUA 4M9ZA 3WTZA 2HQAA 5FD6A 1P4AA 2CV2A 1QPMA 1IZ1A 4HPQA 2K7LA 5FKOA 3K4KA 3K69A 2ZBKA 4R8HA 4II2A 3TO6A 1MH4A 3GFLA 4XKVA 5E8IA 1F43A 4RAYA 3TW7A 5J1RA 4ZYEA 3HRMA 1JJ8C 2MLGA 4HA8A 2D5VA 2IA2A 3G1OA 2ZNZA 2E2JJ 2LSOA 1E0EA 3G4SI 3PJRA 3HIFA 1ZGJA 3PQJA 1ZGWA 1WRJA 1LJ9A 1S7OA 2IGKA 2J5PA 3I59A 1PUEE 1ULYA 4XICA 2F5FA 4OMZA 3FMRA 2GA2A 3UR3C 2CW0F 4XL9A 3D5LA 2HWVA 1QZZA 4CZCA 2EFWA 1F1ZA 4XBFA 4BKXA 3CCVI 4GGGA 4F52A 2PJRA 1LFPA 1HOMA 1H0MA 1YIOA 2A07F 2M34A 4O3MA 2GAUA 1U2WA 2TRTA 2XPUA 2ISYA 3FKJA 1R4NB 4PFPA 2LF7A 1ZELA 4UV8A 4CYDA 2CUJA 3RQIA 1OR7A 1EF4A 1D5YA 1SMTA 2LYCA 1UAAA 1ZH5A 1Y1VJ 5JHUA 1OPCA 3CCYA 4YRVA 3C2HA 4GRIA 4UHTA 3VPRA 2E1CA 3J7AY 4QSHA 3RKYA 4ABZA 1WH5A 1JT6A 1JUSA 2GWRA 1NK3P 3DTEA 1YQAA 4BBRJ 3GTOJ 4UB6C 2NS7A 1S3JA 1T39A 4MFEA 4CCMA 3IUOA 2DA5A 4GYGA 1G6NA 1S9HA 2OQGA 2COBA 4HX7A 3HXLA 1FMWA 3OYAA 4LMYA 1PP7U 4IZZA 1OFCX 2ZXIA 1J59A 4A3MJ 3WTXC 2WV1A 2MFZA 5E1WA 2M30A 3TDZC 3V8LA 2XGDA 1KQ9A 5K7FA 1V5GA 3ZXSA 4AWXB 3M1CA 1WJCA 1YO5C 1SFUA 1U0JA 2QKMB 4QLCU 3RDIA 4LOCA 3CP2A 3K4BA 3M7GA 1T38A 1IUYA 1YJNI 2M7AA 4DYCA 2ZC2A 3OYCA 5DS9A 1D3YA 1T2KA 5F64A 2L9VA 2MW8A 4A5MA 2KISA 4I01A 1RI7A 4LIUA 2E5NA 2L0KA 2NOJB 5CPRB 2KKOA 4XLNF 2I5UA 4E7IA 3OIQA 3S1MJ 1Z1DA 2R0QC 2P5LC 4JX4A 1I3AA 4XKBA 1IRFA 3S1NJ 4FHTA 1X1CA 3FMQA 5FKKA 2VPLA 2M0MA 3VSLA 3ZQ7A 3KP4A 1I39A 2DQRA 3Q9SA 4IXAA 4AVZA 2GLOA 2O8KA 3TP0A 3S93A 4MEXF 2AQEA 3ESWB 1SAUA 5EGOA 3ASOH 3C2GA 1YFHA 1RRJA 2UV1A 3CP8A 3P5JA 5ILSA 4JBAA 5B1BH 2DXIA 4WK8F 4AVPA 5FJ8J 5DD4A 4LLLA 1ACIA 3QPTA 3RIRA 2KDOA 4N4NB 2CUEA 2H6BA 2NAZA 2FMYA 2ZNYA 3QRFF 4CO8A 1Y0NA 5GTHC 3MAJA 5FLXK 4BH9A 4BXFA 5DCFA 3CUQC 2PEXA 4LB6B 1HCRA 1MMNA 1ON1A 3LA2A 2V6CA 4ZTFA 2DK8A 3T5XA 2MSYA 2K27A 3CCUI 2P6TA 4HOBA 3HTUA 2RN7A 3LA3A 3CCQI 1W4MA 4TV7A 1TQPA 3P7NA 1O7FA 5HLIA 4QTRA 2ZJRF 1MKMA 2WA0A 3RI4A 1WQ2A 1I3QJ 3OL4A 1IRGA 2JZYA 6PAXA 1RKWA 1TZLA 1I1SA 5EF6A 2EJRA 2R5ZB 2XUBA 4KT6A 1AKHA 3KYDB 4EGZA 4U87A 1Y39A 3F8CA 5B3SH 4DBQA 3JW4A 3CF5F 2RKHA 2XAJA 5F08A 1SFXA 3CDIA 1DQUA 5KHDA 3HSFA 1B59A 4Y33A 2N8GA 1FNNA 3WU1B 3GTLJ 1QVUA 3S2WA 2W57A 1I27A 2IS6A 3S8PA 4CCLA 1S7EA 1A6IA 2CJJA 4I0BA 4P96A 3ZN0A 4BY1J 1JUPA 4FX4A 4ZYAA 2QM3A 3KETA 5F0HA 2QUFA 3VYTB 1ZRFA 2BXZA 1MGTA 2OJED 3M8FA 1LEBA 4RDUA 4MFDA 4DQ2A 1T6SA 5D5WB 2C6YA 3JCUC 1UZCA 4IO9F 4YEJA 3L9FA 5CYVA 1HDPA 5D5VB 5E8GA 2M0CA 2HVSA 1R22A 3F23A 4L5EA 5J3LA 2W1OA 3I0TA 2XRNA 3DEEA 1SVMA 3WTSC 1HF0A 3CD6I 2RDPA 3VYUB 1UFMA 1OYWA 4MTEA 1MJ9A 1MBHA 3HPHA 3H35A 3OSGA 3HOXJ 1FBQA 5FLMJ 3LSRA 2VQCA 1TTYA 1V5FA 2JK3A 1VQPI 3ZQQA 2K3PA 2KRCA 1FP2A 4A3CJ 3RKXA 1FZPB 4GFBA 1MSEC 3T0YA 1SD5A 1P2FA 2KJBA 4M6VA 4KMFA 2JA8J 4BE1A 4YIIA 5HDKA 2P81A 1YHQI 1X4PA 1KYWA 1V55H 5B66C 2O9LA 1ZAOA 4P5OA 3SDGA 1TLHB 1ZQ3P 4Y13A 2BY3A 1PVEA 1FC3A 4ZC3A 1UB9A 1W5CC 2OV7A 2VT3A 5EZGA 1VQ4I 2L5QA 4WF2A 4A3EJ 2XF7A 2Y48A 2A3SA 2JA2A 2P5VA 3ECOA 2ELHA 2NOGA 1FIPA 2A5YB 3C1DA 4ENKA 2LD5A 1BR4A 5M5YJ 4PSWA 5GPAA 1JUMA 1OR7C 2EIJH 3F21A 5E3NA 1K6OA 3MVPA 3NARA 5LD2C 2K3FA 2HKXA 3BTCA 2V79A 4AYBA 3BTIA 3P9KA 1BBYA 3VSKA 5EZHA 4LG0A 3M3YJ 3JAMK 2JVGA 2DT5A 2LBFA 3I4MJ 3WHBA 4L9NA 2R7WA 1AHDP 3FF5A 3S32A 3GTJJ 4MHGA 2E34A 1IN7A 3QPLA 5HODA 1MW7A 1BJZA 1EA3A 2ICWG 1K83J 1TC3C 5FKLA 4A6EA 3E5UA 3PO3J 5F27A 2BV6A 2FD5A 4HSTA 4BACA 3FXUA 1KU2A 5A2QK 3F8MA 2NVYJ 1T95A 4P9UA 2ZFWA 4ANJA 1XMAA 2LP0A 2AXTC 4MIMA 3IRQA 1MIJA 3CJQB 2CSOA 1XMXA 2DQLA 4NQWA 4WCGA 2M2EA 2DJIA 5D6EA 3I64A 4PK4A 2FOKA 3TOAA 1PDNC 3LWFA 3TDUC 4IEJA 1PJRA 1QGPA 1U6GA 2XHKA 2F5VA 4P9FA 2TCTA 1P4WA 2KRFA 3LSIA 4ZDLA 2RVCA 4PJ0C 3VYRB 5F04A 5JLWA 1YITI 2OTJI 5EEAA 4ENMA 3AL0B 3RCOA 3ZGKA 2VKVA 3FXOA 2DA6A 4XRSG 5K5RA 2JQ7A 3A1YA 3G3ZA 2B7EA 3DBRB 5CLSA 2VB6A 2O8XA 1YS7A 2RQPA 2X6XA 3G71I 3H0GJ 4YIRX 2XAFA 1NK2P 3T8TA 1RPWA 1AWCA 3OS0A 1KA8A 5JVTA 2HEOA 2V1UA 3DKYA 4FT8A 1U5TA 4D0PA 1FLIA 1FBSA 4C9YA 2H09A 3LSKA 2MH2A 4AIHA 4YFNF 5EDNA 4UUVA 2JTVA 2VE8A 3MZHA 1XDUA 3K4LA 3GWZA 2OA4A 4ITVA 3C18A 3M1EA 1K78A 2XVCA 2DMNA 1V4RA 4ASNA 3ZP5A 1VTNC 2HYJA 1IRZA 3ZQHA 4G94A 5GPCA 1MNDA 3PNTA 2DOAA 3HYIA 3K4JA 2DA2A 5ICFA 3BOQA 3AFHA 2VJ4A 3HUGA 2XASA 3S1RJ 4V19K 3I9V2 2ISZA 4IHSA 3K4NA 5ILUA 4KN7X 3S14J 4N9HA 4PGHA 5LGUA 2VLAA 1FWZA 3CJRB 2A6EF 3E6DA 5B5EC 2ZKZA 1W5SA 3UKGA 3LNQA 2K85A 1ZK8A 4EQQA 4KFCA 3R6SA 3OIPA 4XRFA 5FLXZ 1FMVA 4BU2A 3J7ZI 3FM5A 4KIBA 1Q1HA 4HSRA 2R7RA 4ETSA 2FOWA 4XONA 4C2MJ 2DFFA 4M9XA 1VZ0A 3AG2H 2X6YA 1BL0A 3HRTA 1O4XA 3HKZA 3D5RC 3WG7H 1NH3A 2FXAA 1ETWA 1XGSA 5TISC 4A6DA 2YU9J 1CF7A 4UV9A 3UNGC 3SHFA 4BXUA 4I98B 1B1BA 5DTDA 1T8IA 3DU6A 3MKYB 1O3SA 4KITB 2QQBA 2R92J 2G7UA 3IC7A 3GMEA 4BQNA 1K79A 3KYLA 5FB2A 4LGWA 1LDKB 4KUMA 4BQOA 2ZSIB 5DEQA 2DA1A 1ETYA 2ECCA 1B8IA 4DYRA 5H6QA 1X3ZB 4MTDA 3PO2J 2DCEA 4J01A 5E18F 2GOXB 4A2UA 3KYCB 4G8XA 2QVOA 3IAS2 3L2WA 5DD8A 3CMYA 4PJJA 4RB3C 5L3DA 2NS0A 1MH3A 3EQLF 4OOIA 3ROUA 1B72B 1Z91A 1QPIA 3RYPA 1FOXA 2E7XA 4EEFG 4A3BJ 2LREA 4XN0A 4UB8C 1X3WB 3L2CA 1IC8A 3WG9A 3JRAA 2NVTJ 3BR1A 2Y31A 3OOPA 1R5ID 1Z67A 4KJZA 4MLOA 3HDDA 2QBYA 3H9JA 3ONQA 2WAFA 1WH7A 5M3MJ 4AIDA 3OR1C 3V7CA 5E79C 3HM5A 2EFOA 1HBXG 4DBRA 1XPXA 3ZMUA 3FXJA 2PI0A 5KNLA 1WVRA 5H2FC 4Y4RA 4Z2YA 2DFEA 1XGOA 1B9MA 2O6GE 1FBUA 5IT9Z 1BA5A 4FETA 1JKOC 2XDVA 4XR6A 2ME6A 1BI1A 1U78A 1TWGJ 2EK5A 1JTXA 3QP5A 5F0CA 5IT3A 1FYMA 5J8CA 3LQQA 4M73A 4F7ZA 5JVGF 1W36C 4BHCA 4HNTA 4L9VA 4DIQA 3JTGA 2DI3A 3HZJA 3AKZA 2M4KA 3L00A 2B0LA 3QAHA 4HEA2 5AONA 2K4JA 2F2EA 5DUIA 3LA7A 3K4CA 4M74A 4EJUA 2KIQA 4IHWA 2RGVA 3A0BC 2R7VA 1W7PA 4IVNA 4XLPF 2HOTA 1JKPC 2QWWA 1R36A 3DXJF 4I0AA 2W84A 2DFIA 2QQ9A 4EMSA 4D1QA 3AG4H 2MG4A 4IF4A 2XAGA 1BN5A 1J5YA 1G8XA 3G1MA 3GF2A 4EM1A 3TOBA 4AD9A 3I3LA 4A12A 4D7NA 4LIVA 3FXLA 4LITA 3LSMA 3JAMZ 1AOYA 4UY8I 3DBHB 1PUFB 1MSFC 4PGGA 4KYWA 4G7OF 5C4XJ 3CTAA 1XS9A 4ESBA 1YRNB 3GZ5A 3J81K 4FX0A 2JPCA 2DJNA 1A31A 1N78A 5GTIC 1XD7A 3GZ6A 1OLTA 4B8XA 2QENA 2XF5A 1Y0UA 3HGGA 4RB0A 3RYRA 3IH4A 2DMUA 3GYHX 3I4PA 1WJ5A 2HQRA 3BR6A 4A69C 5A2QZ 4II3A 2VQGA 4Q47A 1R5HA 2H27A 4XLAA 3MKLA 1YIJI 1VQ8I 5LEJA 3DEUA 4BXXJ 2JN6A 4ZH4F 1IN5A 1UELB 1FYKA 2I8DA 3L2QA 2QZ8A 2R3SA 2XPWA 2Z2SB 2VBXA 4L0ZB 1GT0C 2NS8A 3O8GA 3HHGA 5J6XA 2OAZA 3TO7A 4ZDPA 4HQEA 1JKRC 3EUHA 2I10A 2LKXA 2Y0SN 4AYBN 1Z9CA 1ZLJA 2LFBA 2WB1A 3OYMA 3L2RA 3BG3A 3F22A 1ETQA 1F5TA 4KICA 1ITYA 2K86A 2IGMA 3TL4X 3WGGA 1GDTA 2ZXWH 2CQNA 4MQ9F 2GIZA 3LFUA 2E1MC 2VJIA 2A68F 1H88C 4PDKA 3CJNA 3KEOA 3BZKA 2DDBA 3MEXA 3EPZA 1USTA 1J75A 4L5JA 3KIOA 4E4HA 2HYGD 3HRSA 2VBZA 3CO6C 2ZO4A 3F8BA 5F0FA 4CGZA 3RPUD 4DGWB 2VBYA 3V7SA 3CLOA 1GXQA 4M72A 2R4GA 2ZXJA 2M9HA 1QO0D 3OOUA 3E6CC 4C3IJ 3MD2A 4KISA 5KK1A 2PFBA 5J1YA 2M4GA 3T8RA 3GFJA 1U3EM 1XSVA 3V8KA 2FRHA 2KP6A 4BJTA 2W24A 5J47A 1H9GA 2AS5F 1BW5A 4D7MA 5BOXA 2EIKH 2CUFA 2K9LA 4W97A 4XLEA 1F4KA 5F1JA 1HKTA 5DUKA 4G9YA 1QZEA 4RAFA 1OCZH 4B4CA 2CMPA 1DGWY 5GAEJ 2BBYA 3QOPA 3S17J 4E7LA 3A4CA 4XM3A 1UHWA 4XOPA 2DOFA 1O3QA 2DPDA 3TEDA 5EG0B 3E6MA 2W7NA 3I53A 3OYDA 1FT9A 1HQCA 3W6VA 2RNGA 1POGA 4GCVA 4BJ6C 4DJAA 1QRYA 1TNTA 3K10A 5IP7J 4ZYDA 2KDZA 2K9SA 1JI8A 4IRHA 4PUSA 4A0XA 4LB5A 1LE8B 2D1VA 3ZQFA 4E7KA 2EFQA 2ZB9A 3KLOA 3MN2A 2X6WA 3MKZA 2VKEA 1MBJA 2QYOA 1N25A 3OL3A 3O6BB 5KVRA 1ZREA 3PUBA 3GTKJ 4Y52J 3KE2A 1W7PD 1G3WA 3H3UA 3REOA 2Q2EA 3ABTA 4OU0A 3V4GA 1QHGA 3JRBA 2Q8KA 3FXMA 3PM1A 1SD4A 2NRAC 4XIDA 2LNBA 5CQEA 2NNYA 2FA5A 3MQ0A 3DV8A 1WJFA 4UUSB 1A36A 2IA1A 2FQ4A 3BCAA 3S1QJ 2VASA 2Y30A 2LKSA 2OQRA 3JSPA 2KHMA 2R93J 1K6YA 2Y75A 3H5RA 3HL2A 4LG3A 2L02A 2VOPA 1YG2A 4CCNA 3HEFA 1D0XA 4BS9A 4UUTA 3CDLA 5E1ZB 1IN4A 2ZSHB 1IO2A 4KNYA 3WTVC 5FRNA 2E60A 2DO7A 4D5CA 2QSGX 2AHQA 1E3PA 1UMQA 1YOVB 3IAM2 2JPBA 2MABA 5IYCJ 2CQQA 1YX5A 2K40A 3HKZN 3WTYC 3RTRA 4YFKF 3NEUA 1A35A 2HPMA 4B1RA 2VONA 2PMZN 1KU7A 4A5NA 4HRIA 4HF2A 3CC2I 1MD0A 1RESA 1YLFA 4M9SA 1C0WA 1LDJA 4OIQF 1P7JA 3IHUA 4RAGA 1NTCA 4IRGA 3BDDA 1KQ8A 3O2PE 5J4VA 2LLKA 2X1DA 4BHPA 2LY1A 1T98A 4E7JA 5C44J 5FGMA 3SXYA 2M87A 3X2QH 2A5WA 3DQVC 3CCRI 1STZA 3NWSA 4EJTA 5CJ9A 2R5YA 1EV7A 1TQMA 4XQFA 4I76A 2RREA 3TP3A 1DDNA 4JK1X 4BDYA 3BG6A 2WWYA 5FFXA 5K5OA 1MBGA 2L9NA 2R7UA 3S2HJ 2VJ5A 1D1BA 3O3KA 4QIWN 2WTEA 2R7QA 3U1KA 3LSJA 3KCCA 2D1HA 2M1BA 3G73A 2RAEA 3BJOA 1XMKA 1P7IA 1DU0A 4U7DA 2XF6A 1IV8A 4IHVA 1WWXA 3NAUA 3OYJA 3A01A 2DAOA 3I5UA 3HSRA 1TW2A 3R61A 5L3BA 1R00A 2LH9A 3FZVA 4C2TA 3DLAA 2EZHA 3H5AA 4HV5A 4A0YA 1DPUA 3FHZA 1ETOA 2BZTA 2Y2ZA 2ESNA 5HS9A 2ESHA 2ZMEB 1ZR2A 1UHMA 3CQZJ 2XIGA 1XGMA 3TMOA 4BE2A 3EUHC 3EYYA 3WODF 2DMTA 1TWAJ 3WGIA 3M4OJ 2L7MP 5K7ZA 4RB1A 4B48A 3F9KA 4F55A 1XN7A 1YS6A 4BNCA 4CSWA 3DU5A 4JP0A 4KDPA 2W4SA 4L5IA 4GXOA 1R23A 3K70C 2BY2A 3FBNB 2G7HA 1ZG5A 3M07A 2GIVA 3IRRA 5E3MA 2ACJA 3QYEA 1R49A 1HKSA 3FDYA 1G3SA 1VQ5I 1TBXA 2CW7A 1ZLKA 5DDGA 4L0YB 4CYCA 1R1VA 3KP7A 2Z33A 2L54A 1HXDA 1P4XA 2EWNA 3OS1A 3S3NA 4KMUX 1IXSB 3PNVA 2R7OA 4HLYA 1WI9A 2OD5A 4NB5A 3KEQA 3TQNA 2X48A 2LRDA 3RZDJ 2BVLA 1BOBA 1X4OA 1MMGA 2QF7A 2KIFA 2W00A 3KP3A 5TJJA 5BPIA 3QQAA 4E6KG 4D5FA 4G6QA 3KPHA 4U0WA 4M3EA 2GBYA 2UZKA 1LFBA 4BEHB 5ICEA 1XDSA 1I6XA 2Z1DA 2DA7A 2EH3A 3GLXA 1VNDA 3ECHA 4C3HJ 4EJOA 1G59A 1B9NA 5FD5A 3F0CA 2P8TA 3I4NJ 2R7SA 1ZKGA 3CC4I 1Z7LA 2LTPA 4Y15A 1SC7A 2IS4A 1XCVA 2L3DA 5HS7A 3W2VA 4E7ZA 4U7BA 1YW8A 2KL4A 3BJ6A 2LVSA 3PIOF 2OTLI 4YFXF 2BYVE 4CCOA 3OY9A 2EV0A 1IN6A 1QA6A 1KONA 2JRTA 2WBMA 4WX9A 3SZPA 5BS6A 4BBSJ 1XG1A 5IP9J 2MC3A 4D9JA 3MFKA 2O61A 5F6FA 4RLQA 2A6TA 2QSFX 3JRFA 1X1DA 2WB1N 4IJAA 2P5KA 3ASNH 2BHYA 2Y0SA 5TRDA 5D8KB 3V42A 2EFNA 4OIOF 4I09A 1BI2A 2XB5A 3PSIA 3OV8A 1LNWA 2OZ6A 2QKLB 1VFCA 1JTYA 2R7XA 2V1DA 3NWTA 4F92B 1K4TA 4V2FA 4QPQA 2FEZA 2X85A 3FHNA 2JT1A 4Q4ZF 4XRSA 3BPXA 4DW6A 3GVAA 3JRIA 1OYIA 4FISA 2EILH 5D4SA 3ZMZA 5HLHA 4RB2C 1E17A 3KX2A 1WPKA 3GTQJ 4B43A 2EINH 3K6GA 1XTAA 3ZQIA 2GXGA 3LQRA 5HOOA 2KZGA 2VIXA 3FBIB 4A3FJ 4IPAA 1MDMB 2E36A 3ZPLA 1AA7A 3GX4X 4IOAF 4NBQA 3C3WA 4WWCA 3FK7A 1OYYA 1BJAA 3ZQLA 4X6AJ 1WGXA 2BOLA 5LEKA 4NDLA 3PQKA 3BG9A 4UXNA 3K1MA 4A0ZA 3CUQB 3SZGA 4JYKA 3S3OA 1O3TA 2LC2A 4M6XA 2IS1A 3GW2A 2V26A 3BR5A 2L7ZA 1ZHFA 1X19A 2RV8A 2ZJQF 3IH2A 2UUZA 5DM7F 2E35A 2L01A 3DPUA
chains in the Genus database with same CATH topology
4XSXF 4LD5A 3MZYA 2IA0A 4ZYGA 3ULQB 2WV0A 3HOSA 2DTRA 4WXCA 2D45A 4EM0B 4R79A 1SMYF 2UXNA 4LLNA 3P9IA 1R5GA 1R58A 3BROA 1YYVA 3B02A 3DF8A 2FU4A 2FNAA 2GA1A 4ZZDA 2CO5A 3LFKA 1XSDA 2ADUA 3DKWA 3PFIA 5FFZA 2X0LA 1QQIA 3TKYA 1HSTA 2YX7A 2VC0A 4HX8A 1JHFA 2XV4S 4O5VA 4OMYA 5LLQA 2IP2A 1A04A 2K02A 4ZZLA 2DPUA 2COMA 3I59B 3BPVA 5HDGA 3EYIA 1NHAA 1YTYA 4HW0A 3K1NA 1UCRA 1J0RA 3VODA 1FSEA 4IRIA 2P4WA 1W5TA 3K2ZA 3V7RA 5K1YA 4RGSA 3BWGA 3L09A 4U88A 1SD6A 1BC8C 1IXRC 3SQNA 1P6RA 2CGPA 3ZMVA 5CVJA 1ZG3A 3DPLC 2VOOA 4UVAA 5AIQA 4BQAA 4M71A 2HDCA 2Z9OA 4CDGA 5LBQA 3WTUC 2XAQA 1QZYA 3WTTC 2FE3A 2YX4A 2R7FA 1H9TA 3NRVA 2STWA 1ODDA 2EV6A 5EEGA 3ZMSA 2KIMA 2MH9A 1MJAA 3VB2A 1ZN2A 3CO7C 1HW1A 2HKOA 1ZRCA 4MGRA 3IWFA 4HBLA 3M9AA 4BYYA 2H6CA 2L4MA 1Z05A 2K4BA 5F1RA 1J2XA 2YPRA 3R0AA 4OIRF 1WKMA 2OU2A 2L4AA 2QLZA 2Q0OA 1IXCA 2PQ8A 4QWQA 1J7KA 1BI3A 2HQNA 3HTSB 3H3ZA 4S04A 1OMIA 4Q48A 2KJCA 3U2RA 4K2EA 3R4KA 2W25A 3ISPA 5CVUA 4UVBA 2IPQX 2FBIA 5HS8A 2GXBA 3RPQA 3R0JA 5H20A 5L3FA 1G3YA 5BQTA 2UXXA 4GO1A 5CVIA 1REPC 3EETA 1JHHA 1MJBA 4EJVA 3ZMTA 2PBIA 3E6BA 5E20A 1RUOA 5ILVA 4UNOA 1S6LA 4HQMA 4LK1F 1J9IA 3ELKA 3M8EA 3BP8A 5LRSA 4HF1A 4EV0A 5D5UB 1XSXA 1B6AA 2DBBA 1ONVA 2GQQA 1U8RA 2R7DA 4HZFA 3FMSA 4O6JA 1MZBA 4ON0A 2TDXA 2PMUA 4I02A 5JFRA 3R60A 2MBFA 2Z3YA 1P92A 4N9IA 1GXPA 5EEHA 3FXRA 4ENNA 2IW5A 3IKVA 1R1UA 3DPTA 5D8LB 1FYLA 3LAJA 3I58A 1R7JA 1IF1A 2WC2A 1BM9A 1D5VA 3I54A 1XGNA 2IJLA 1FY7A 1KU3A 5D6FA 4LG0B 1ZG1A 4HF0A 2BGCA 2VC1A 3CDHA 3WTWC 5E1XA 3KZYA 4BHBA 1DPRA 3T1BA 2CFXA 2M5WA 3F72A 5JR3A 3WGHA 4ZYHA 5FO5A 5ED4A 4CICA 2DLLA 1GHCA 4HLXA 1BI0A 5ICGA 3N4MA 2HTJA 4N0BA 2O03A 2M8EA 2NNNA 3K9TA 3J80K 5D5XB 1FP1D 5D4RA 2XGXA 3KLNA 3BZ6A 4G7ZF 4RS8A 1QNTA 4HDVA 4ENJA 2CWEA 3C7JA 2ZJ2A 2HZTA 1HSJA 2DU9A 3QU3A 1U5TB 3EDPA 4LK0F 2Z99A 1XCBA 3QP6A 1EH8A 4GYIA 2IT0A 3LAPA 1K78B 3MCZA 4HDUA 1HKQA 2P7CB 5LHIA 3GFMA 1DUXC 5BMZA 1F9NA 4AIKA 3ERED 3DP7A 3HHHA 1T0FA 1G4DA 3NQOA 3J81Z 3FX3A 1QBJA 1K7AA 5L3CA 2DW4A 5ERIA 3H92A 2O0YA 3FWEA 2AXLA 1D8JA 1CF7B 2DK5A 4HX4A 4KN4X 4MEYF 4M6YA 2F5EA 2IRFG 2YR2A 2FSWA 2OBPA 1JGSA 4I7HA 3SFZA 2GZWA 3ML6A 3E5QA 4L9TA 1KYZA 4B09A 4KIFA 4R1HA 2E7WA 2OZUA 2XROA 3RJPA 1B4AA 2V9VA 2BEOA 2FNPA 1RNLA 2HYFA 2QBYB 3JTHA 1E2XA 4HV6A 5DCMA 1L3LA 2E1NA 4DNCA 1I5ZA 4ESFA 5ICCA 2XKPA 3N97A 1KQ0A 1V3FA 5JI6A 3QU6A 2FMLA 5IT9K 1PP8F 2PLYA 1KGSA 3SZTA 3GUDA 3F6OA 5L3GA 1ZGAA 3BJAA 4U0YA 1LEAA 5LRRA 5DV5A 2VN2A 3E3VA 4RGXA 1W7PB 3HOTA 2A61A 4OIPF 3HSEA 3E5XA 3RKWA 1LQ1A 1XB4A 4LJZF 1Z7UA 2HOEA 2PG4A 3KFWX 5HVQC 3MWMA 2RC4A 2PN6A 2A69F 5E17F 4CZZA 1HW2A 1ZYRF 3U9GA 3TO9A 3KZZA 3BY6A 1ZARA 2FF4A 3F8NA 4P55A 1JE8A 5HDNA 4EVIA 2HFHA 3IWZA 4I2OA 2F5CA 3J80Z 4G7HF 3J7AO 3P9CA 1IAWA 5BPDA 1S8NA 1RZ4A 3IL2A 4LFUA 1CGPA 3COAC 3U1DA 2V1XA 3W6JB 2CQKA 3KP5A 1YW9A 1I1GA 1FOKA 1FSHA 2MA3A 4UVCA 2X4HA 2EV5A 2P7VB 3I71A 2G9WA 2XAHA 3F8FA 3GEZA 1LB2A 5HLGA 3FXQA 3ZN1A 2FBKA 5L3EA 2JSCA 3KP6A 2EA2A 1FX7A 2H94A 3WU0A 4XSZF 4EGYA 3GXOA 3DFGA 3KP2A 3HRUA 3CUOA 1OKRA 1IN8A 3ZMDA 3W6KB 1BIBA 3V8JA 2YU3A 2A6HF 2ZMEA 5AIPA 2EA4A 4ESJA 1IW7F 2F5DA 4KIGA 3VFZA 2J5OA 3LSTA 3K1PA 1X3UA 5H6RA 4OINF 3GFIA 4RGUA 4HAMA 1ON2A 2D2WA 2XKOA 4Y17A 1O3RA 2KIUA 4NHJA 2STTA 3E97A 4L9JA 2MLKA 3VEPA 1LVAA 1RIOH 3QPHA 4G6DA 1HW5A 3ABUA 4S05A 1D8KA 2M45A 4MQVA 3RPUA 2LDUA 1R1TA 2QQAA 4AIJA 4BAYA 1ZRDA 3WE3A 3Q9VA 2HR3A 4H0EA 5CVRA 5LHHA 4WXHA 2ETHA 2FBHA 1Z6RA 1BC7C 2PMHA 1USSA 4CXFA 2PJPA 1GVJA 2LF8A 3K0LA 4WXDA 1DP7P 4KA4A 1SAXA 3AAFA 1G3TA 2EFPA 3JSOA 2FQ3A 1S7AA 2RNJA 4PCQA 1JXSA 2EB7A 4KT5C 2UWMA 1TNSA 3Q5FA 1SFEA 5LGNA 3WE2A 2ZCWA 3IKTA 4CHUA 3FM3A 1SD7A 1BIAA 2CYYA 2VBWA 3D0SA 4EM2A 1KU9A 1EH6A 2HTSA 2LKPA 3L7WA 2Y0MA 4E70A 1LDDA 1Z6TA 4YG2F 4EJWA 2BE5F 1MDMA 1O57A 4U0VA 4YIFA 1O7LA 2Z5UA 4JQFA 3F3XA 2YSRA 2HS5A 3CUQA 1RUNA 4Q5SF 1YW7A 1FPQA 4MNUA 2NYXA 5LHGA 2VODA 2VT2A 1L0OC 2VXZA 5LGTA 4PZJA 5K5QA 3B73A 1U5TC 4IHTA 4LLGF 1TQIA 2O3FA 4L18B 4HYEA 2IVMA 2CG4A 5CVVA 4RAZA 2MD5A 1S29A 4RGRA 3F6VA 1BOAA 1EH7A 5DCMB 5DYMA 3TGNA 2W85A 2HGCA 2P6SA 3GO5A 1TW3A 3VOEA 5J8FA 2VE9A 1WSUA 4M9ZA 3WTZA 5FD6A 1P4AA 1QPMA 1IZ1A 2K7LA 3K69A 2ZBKA 4R8HA 3TO6A 3GFLA 5E8IA 4RAYA 4ZYEA 3HRMA 2MLGA 4HA8A 2IA2A 2ZNZA 2LSOA 3HIFA 1ZGJA 3PQJA 1WRJA 1LJ9A 1S7OA 2J5PA 3I59A 1PUEE 1ULYA 2F5FA 4OMZA 3FMRA 2GA2A 2CW0F 3D5LA 2HWVA 1QZZA 2EFWA 1F1ZA 4XBFA 4GGGA 1H0MA 1YIOA 2A07F 4O3MA 2GAUA 1U2WA 2ISYA 2LF7A 4CYDA 4UV8A 1OR7A 1SMTA 1ZH5A 5JHUA 1OPCA 4UHTA 2E1CA 3RKYA 2GWRA 1YQAA 1S3JA 1T39A 4GYGA 1G6NA 2OQGA 4HX7A 4LMYA 1PP7U 1J59A 3WTXC 5E1WA 2M30A 3TDZC 3V8LA 1KQ9A 4AWXB 1YO5C 1SFUA 4QLCU 3RDIA 3M7GA 1T38A 1IUYA 1D3YA 1T2KA 5F64A 4A5MA 4I01A 1RI7A 2KKOA 4XLNF 1Z1DA 2P5LC 1IRFA 4FHTA 3FMQA 3ZQ7A 3KP4A 2DQRA 3Q9SA 4IXAA 4MEXF 1YFHA 5ILSA 4JBAA 4WK8F 4AVPA 5DD4A 4LLLA 3QPTA 3RIRA 2H6BA 2NAZA 2FMYA 2ZNYA 3QRFF 4CO8A 3MAJA 5FLXK 4BH9A 5DCFA 3CUQC 2PEXA 4LB6B 1ON1A 3LA2A 2V6CA 2DK8A 3T5XA 2K27A 2P6TA 4HOBA 3HTUA 2RN7A 3LA3A 1W4MA 4TV7A 1TQPA 3P7NA 1O7FA 5HLIA 1MKMA 3RI4A 1WQ2A 1IRGA 2JZYA 6PAXA 1I1SA 2EJRA 2XUBA 4EGZA 3F8CA 3JW4A 2RKHA 2XAJA 1SFXA 3HSFA 1B59A 3WU1B 1FNNA 3S2WA 2W57A 1I27A 4P96A 4I0BA 3ZN0A 4FX4A 2QM3A 3KETA 2QUFA 1ZRFA 1MGTA 3M8FA 1LEBA 4DQ2A 1T6SA 5D5WB 2C6YA 3L9FA 5CYVA 5D5VB 5E8GA 1R22A 3F23A 3I0TA 2XRNA 3WTSC 2RDPA 1UFMA 1OYWA 4MTEA 1MJ9A 1FBQA 1TTYA 1FP2A 3RKXA 1FZPB 3T0YA 1SD5A 1P2FA 2KJBA 4KMFA 4YIIA 5HDKA 1KYWA 1ZAOA 4P5OA 1TLHB 4Y13A 1FC3A 1UB9A 2VT3A 4WF2A 2Y48A 2A3SA 2P5VA 3ECOA 2ELHA 2A5YB 3C1DA 4ENKA 3F21A 1K6OA 2HKXA 2V79A 3P9KA 1BBYA 4LG0A 3JAMK 2DT5A 4L9NA 3FF5A 4MHGA 1IN7A 4A6EA 3E5UA 2BV6A 3FXUA 1KU2A 5A2QK 3F8MA 4P9UA 2ZFWA 1XMAA 3IRQA 2CSOA 2DQLA 4NQWA 4WCGA 5D6EA 3I64A 2FOKA 3TOAA 1PDNC 3LWFA 3TDUC 1QGPA 1U6GA 2XHKA 4P9FA 1P4WA 2KRFA 2RVCA 4ENMA 5K5RA 3G3ZA 5CLSA 2O8XA 1YS7A 2RQPA 2XAFA 3T8TA 1AWCA 1KA8A 5JVTA 2HEOA 2V1UA 4FT8A 1U5TA 4D0PA 1FLIA 1FBSA 2H09A 2MH2A 4AIHA 4YFNF 4UUVA 2JTVA 2VE8A 3MZHA 1XDUA 3GWZA 2OA4A 3C18A 3M1EA 1K78A 2XVCA 1V4RA 4ASNA 3ZP5A 1VTNC 4G94A 3HYIA 5ICFA 3BOQA 3HUGA 2XASA 2ISZA 4IHSA 5ILUA 4KN7X 4N9HA 4PGHA 5LGUA 1FWZA 2A6EF 3E6DA 2ZKZA 1W5SA 4EQQA 4KFCA 3R6SA 4XRFA 5FLXZ 3FM5A 4KIBA 1Q1HA 4ETSA 4M9XA 3HRTA 2FXAA 1XGSA 4A6DA 1CF7A 4UV9A 3SHFA 4BXUA 4I98B 1B1BA 1O3SA 2QQBA 2G7UA 3IC7A 1K79A 5FB2A 4LGWA 1LDKB 4KUMA 5DEQA 5H6QA 4MTDA 5E18F 4A2UA 4G8XA 2QVOA 5DD8A 4RB3C 5L3DA 2NS0A 3EQLF 4OOIA 3ROUA 1Z91A 3RYPA 2E7XA 3L2CA 3WG9A 3OOPA 2QBYA 3V7CA 2EFOA 1HBXG 3ZMUA 2PI0A 4Z2YA 1XGOA 1B9MA 2O6GE 1FBUA 5IT9Z 1BI1A 1U78A 2EK5A 3QP5A 5IT3A 1FYMA 5J8CA 3LQQA 4M73A 4F7ZA 4BHCA 4L9VA 3JTGA 2DI3A 3L00A 2B0LA 3QAHA 5AONA 2K4JA 2F2EA 5DUIA 3LA7A 4M74A 4EJUA 2RGVA 1W7PA 4IVNA 4XLPF 2QWWA 1R36A 3DXJF 4I0AA 2W84A 2DFIA 2QQ9A 4EMSA 4IF4A 2XAGA 1BN5A 1J5YA 3GF2A 4EM1A 3TOBA 4AD9A 4A12A 3JAMZ 1AOYA 4KYWA 4G7OF 4PGGA 3CTAA 4ESBA 3GZ5A 3J81K 4FX0A 2JPCA 3GZ6A 1XD7A 4B8XA 2QENA 1Y0UA 4RB0A 3RYRA 3GYHX 3I4PA 2HQRA 5A2QZ 4Q47A 2H27A 1R5HA 5LEJA 3DEUA 4ZH4F 1IN5A 1FYKA 2QZ8A 2R3SA 2VBXA 4L0ZB 3HHGA 5J6XA 2OAZA 3TO7A 4HQEA 3EUHA 1Z9CA 1ZLJA 3F22A 1F5TA 4KICA 2K86A 3WGGA 4MQ9F 2A68F 4PDKA 3CJNA 3KEOA 3MEXA 1USTA 1J75A 4L5JA 2HYGD 3HRSA 2VBZA 3CO6C 2ZO4A 3F8BA 4CGZA 2VBYA 3V7SA 3CLOA 1GXQA 4M72A 2ZXJA 1QO0D 3E6CC 5KK1A 2PFBA 3T8RA 3GFJA 1U3EM 1XSVA 3V8KA 2FRHA 2W24A 2AS5F 1H9GA 5BOXA 1HKTA 1F4KA 5DUKA 4G9YA 2BBYA 3QOPA 1UHWA 1O3QA 2DPDA 3E6MA 3I53A 1FT9A 1HQCA 4GCVA 1TNTA 4ZYDA 4IRHA 4A0XA 4LB5A 2D1VA 2EFQA 3KLOA 2QYOA 5KVRA 1ZREA 3O6BB 3KE2A 1W7PD 1G3WA 3H3UA 3REOA 2Q2EA 3ABTA 4OU0A 3V4GA 2Q8KA 2NRAC 1SD4A 2LNBA 2NNYA 2FA5A 3MQ0A 3DV8A 2IA1A 2OQRA 3JSPA 2Y75A 2L02A 2VOPA 1YG2A 5E1ZB 1IN4A 4KNYA 3WTVC 2DO7A 2JPBA 3WTYC 3RTRA 4YFKF 3NEUA 2VONA 1KU7A 4A5NA 4HF2A 1MD0A 1YLFA 4M9SA 1C0WA 4OIQF 1LDJA 3IHUA 4IRGA 3BDDA 1KQ8A 3O2PE 4BHPA 1T98A 5FGMA 3SXYA 2M87A 3DQVC 1STZA 4EJTA 5CJ9A 1EV7A 1TQMA 1DDNA 4JK1X 2WWYA 5FFXA 5K5OA 3O3KA 2WTEA 3KCCA 2D1HA 2M1BA 3G73A 3BJOA 1XMKA 4U7DA 1WWXA 2DAOA 3I5UA 3HSRA 1TW2A 3R61A 5L3BA 1R00A 3FZVA 4HV5A 4A0YA 1DPUA 3FHZA 2ESNA 5HS9A 2ESHA 2ZMEB 1UHMA 2XIGA 1XGMA 3EYYA 3WODF 3WGIA 4RB1A 1XN7A 1YS6A 4BNCA 4KDPA 4L5IA 4GXOA 1R23A 2G7HA 1ZG5A 2GIVA 3IRRA 2ACJA 1HKSA 1G3SA 1TBXA 1ZLKA 5DDGA 4L0YB 1R1VA 3KP7A 2Z33A 2L54A 1HXDA 1P4XA 2EWNA 4KMUX 1IXSB 4HLYA 1WI9A 2OD5A 4NB5A 3KEQA 3TQNA 2KIFA 3KP3A 5TJJA 5BPIA 4G6QA 4U0WA 2UZKA 5ICEA 1XDSA 1I6XA 3GLXA 3ECHA 4EJOA 1B9NA 5FD5A 2P8TA 4Y15A 1XCVA 2L3DA 5HS7A 4U7BA 1YW8A 3BJ6A 4YFXF 2BYVE 2EV0A 1IN6A 2JRTA 4WX9A 3SZPA 5BS6A 2MC3A 2O61A 3MFKA 5F6FA 4IJAA 2P5KA 5TRDA 5D8KB 2EFNA 4OIOF 4I09A 1BI2A 3OV8A 1LNWA 2OZ6A 2V1DA 2FEZA 4Q4ZF 2JT1A 3BPXA 3GVAA 1OYIA 5D4SA 3ZMZA 5HLHA 4RB2C 1E17A 2GXGA 3LQRA 5HOOA 4IPAA 1MDMB 3ZPLA 3GX4X 3C3WA 4WWCA 1OYYA 1BJAA 5LEKA 3PQKA 4UXNA 3K1MA 4A0ZA 3CUQB 1O3TA 4M6XA 3GW2A 1ZHFA 2RV8A 2L01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSX F;  4LD5 A;  3MZY A;  2IA0 A;  4ZYG A;  3ULQ B;  2WV0 A;  3HOS A;  2DTR A;  4WXC A;  2D45 A;  4EM0 B;  4R79 A;  1SMY F;  2UXN A;  4LLN A;  3P9I A;  1R5G A;  1R58 A;  3BRO A;  1YYV A;  3B02 A;  3DF8 A;  2FU4 A;  2FNA A;  2GA1 A;  4ZZD A;  2CO5 A;  3LFK A;  1XSD A;  2ADU A;  3DKW A;  3PFI A;  5FFZ A;  2X0L A;  1QQI A;  3TKY A;  1HST A;  2YX7 A;  2VC0 A;  4HX8 A;  1JHF A;  2XV4 S;  4O5V A;  4OMY A;  5LLQ A;  2IP2 A;  1A04 A;  2K02 A;  4ZZL A;  2DPU A;  2COM A;  3I59 B;  3BPV A;  5HDG A;  3EYI A;  1NHA A;  1YTY A;  4HW0 A;  3K1N A;  1UCR A;  1J0R A;  3VOD A;  1FSE A;  4IRI A;  2P4W A;  1W5T A;  3K2Z A;  3V7R A;  5K1Y A;  4RGS A;  3BWG A;  3L09 A;  4U88 A;  1SD6 A;  1BC8 C;  1IXR C;  3SQN A;  1P6R A;  2CGP A;  3ZMV A;  5CVJ A;  1ZG3 A;  3DPL C;  2VOO A;  4UVA A;  5AIQ A;  4BQA A;  4M71 A;  2HDC A;  2Z9O A;  4CDG A;  5LBQ A;  3WTU C;  2XAQ A;  1QZY A;  3WTT C;  2FE3 A;  2YX4 A;  2R7F A;  1H9T A;  3NRV A;  2STW A;  1ODD A;  2EV6 A;  5EEG A;  3ZMS A;  2KIM A;  2MH9 A;  1MJA A;  3VB2 A;  1ZN2 A;  3CO7 C;  1HW1 A;  2HKO A;  1ZRC A;  4MGR A;  3IWF A;  4HBL A;  3M9A A;  4BYY A;  2H6C A;  2L4M A;  1Z05 A;  2K4B A;  5F1R A;  1J2X A;  2YPR A;  3R0A A;  4OIR F;  1WKM A;  2OU2 A;  2L4A A;  2QLZ A;  2Q0O A;  1IXC A;  2PQ8 A;  4QWQ A;  1J7K A;  1BI3 A;  2HQN A;  3HTS B;  3H3Z A;  4S04 A;  1OMI A;  4Q48 A;  2KJC A;  3U2R A;  4K2E A;  3R4K A;  2W25 A;  3ISP A;  5CVU A;  4UVB A;  2IPQ X;  2FBI A;  5HS8 A;  2GXB A;  3RPQ A;  3R0J A;  5H20 A;  5L3F A;  1G3Y A;  5BQT A;  2UXX A;  4GO1 A;  5CVI A;  1REP C;  3EET A;  1JHH A;  1MJB A;  4EJV A;  3ZMT A;  2PBI A;  3E6B A;  5E20 A;  1RUO A;  5ILV A;  4UNO A;  1S6L A;  4HQM A;  4LK1 F;  1J9I A;  3ELK A;  3M8E A;  3BP8 A;  5LRS A;  4HF1 A;  4EV0 A;  5D5U B;  1XSX A;  1B6A A;  2DBB A;  1ONV A;  2GQQ A;  1U8R A;  2R7D A;  4HZF A;  3FMS A;  4O6J A;  1MZB A;  4ON0 A;  2TDX A;  2PMU A;  4I02 A;  5JFR A;  3R60 A;  2MBF A;  2Z3Y A;  1P92 A;  4N9I A;  1GXP A;  5EEH A;  3FXR A;  4ENN A;  2IW5 A;  3IKV A;  1R1U A;  3DPT A;  5D8L B;  1FYL A;  3LAJ A;  3I58 A;  1R7J A;  1IF1 A;  2WC2 A;  1BM9 A;  1D5V A;  3I54 A;  1XGN A;  2IJL A;  1FY7 A;  1KU3 A;  5D6F A;  4LG0 B;  1ZG1 A;  4HF0 A;  2BGC A;  2VC1 A;  3CDH A;  3WTW C;  5E1X A;  3KZY A;  4BHB A;  1DPR A;  3T1B A;  2CFX A;  2M5W A;  3F72 A;  5JR3 A;  3WGH A;  4ZYH A;  5FO5 A;  5ED4 A;  4CIC A;  2DLL A;  1GHC A;  4HLX A;  1BI0 A;  5ICG A;  3N4M A;  2HTJ A;  4N0B A;  2O03 A;  2M8E A;  2NNN A;  3K9T A;  3J80 K;  5D5X B;  1FP1 D;  5D4R A;  2XGX A;  3KLN A;  3BZ6 A;  4G7Z F;  4RS8 A;  1QNT A;  4HDV A;  4ENJ A;  2CWE A;  3C7J A;  2ZJ2 A;  2HZT A;  1HSJ A;  2DU9 A;  3QU3 A;  1U5T B;  3EDP A;  4LK0 F;  2Z99 A;  1XCB A;  3QP6 A;  1EH8 A;  4GYI A;  2IT0 A;  3LAP A;  1K78 B;  3MCZ A;  4HDU A;  1HKQ A;  2P7C B;  5LHI A;  3GFM A;  1DUX C;  5BMZ A;  1F9N A;  4AIK A;  3ERE D;  3DP7 A;  3HHH A;  1T0F A;  1G4D A;  3NQO A;  3J81 Z;  3FX3 A;  1QBJ A;  1K7A A;  5L3C A;  2DW4 A;  5ERI A;  3H92 A;  2O0Y A;  3FWE A;  2AXL A;  1D8J A;  1CF7 B;  2DK5 A;  4HX4 A;  4KN4 X;  4MEY F;  4M6Y A;  2F5E A;  2IRF G;  2YR2 A;  2FSW A;  2OBP A;  1JGS A;  4I7H A;  3SFZ A;  2GZW A;  3ML6 A;  3E5Q A;  4L9T A;  1KYZ A;  4B09 A;  4KIF A;  4R1H A;  2E7W A;  2OZU A;  2XRO A;  3RJP A;  1B4A A;  2V9V A;  2BEO A;  2FNP A;  1RNL A;  2HYF A;  2QBY B;  3JTH A;  1E2X A;  4HV6 A;  5DCM A;  1L3L A;  2E1N A;  4DNC A;  1I5Z A;  4ESF A;  5ICC A;  2XKP A;  3N97 A;  1KQ0 A;  1V3F A;  5JI6 A;  3QU6 A;  2FML A;  5IT9 K;  1PP8 F;  2PLY A;  1KGS A;  3SZT A;  3GUD A;  3F6O A;  5L3G A;  1ZGA A;  3BJA A;  4U0Y A;  1LEA A;  5LRR A;  5DV5 A;  2VN2 A;  3E3V A;  4RGX A;  1W7P B;  3HOT A;  2A61 A;  4OIP F;  3HSE A;  3E5X A;  3RKW A;  1LQ1 A;  1XB4 A;  4LJZ F;  1Z7U A;  2HOE A;  2PG4 A;  3KFW X;  5HVQ C;  3MWM A;  2RC4 A;  2PN6 A;  2A69 F;  5E17 F;  4CZZ A;  1HW2 A;  1ZYR F;  3U9G A;  3TO9 A;  3KZZ A;  3BY6 A;  1ZAR A;  2FF4 A;  3F8N A;  4P55 A;  1JE8 A;  5HDN A;  4EVI A;  2HFH A;  3IWZ A;  4I2O A;  2F5C A;  3J80 Z;  4G7H F;  3J7A O;  3P9C A;  1IAW A;  5BPD A;  1S8N A;  1RZ4 A;  3IL2 A;  4LFU A;  1CGP A;  3COA C;  3U1D A;  2V1X A;  3W6J B;  2CQK A;  3KP5 A;  1YW9 A;  1I1G A;  1FOK A;  1FSH A;  2MA3 A;  4UVC A;  2X4H A;  2EV5 A;  2P7V B;  3I71 A;  2G9W A;  2XAH A;  3F8F A;  3GEZ A;  1LB2 A;  5HLG A;  3FXQ A;  3ZN1 A;  2FBK A;  5L3E A;  2JSC A;  3KP6 A;  2EA2 A;  1FX7 A;  2H94 A;  3WU0 A;  4XSZ F;  4EGY A;  3GXO A;  3DFG A;  3KP2 A;  3HRU A;  3CUO A;  1OKR A;  1IN8 A;  3ZMD A;  3W6K B;  1BIB A;  3V8J A;  2YU3 A;  2A6H F;  2ZME A;  5AIP A;  2EA4 A;  4ESJ A;  1IW7 F;  2F5D A;  4KIG A;  3VFZ A;  2J5O A;  3LST A;  3K1P A;  1X3U A;  5H6R A;  4OIN F;  3GFI A;  4RGU A;  4HAM A;  1ON2 A;  2D2W A;  2XKO A;  4Y17 A;  1O3R A;  2KIU A;  4NHJ A;  2STT A;  3E97 A;  4L9J A;  2MLK A;  3VEP A;  1LVA A;  1RIO H;  3QPH A;  4G6D A;  1HW5 A;  3ABU A;  4S05 A;  1D8K A;  2M45 A;  4MQV A;  3RPU A;  2LDU A;  1R1T A;  2QQA A;  4AIJ A;  4BAY A;  1ZRD A;  3WE3 A;  3Q9V A;  2HR3 A;  4H0E A;  5CVR A;  5LHH A;  4WXH A;  2ETH A;  2FBH A;  1Z6R A;  1BC7 C;  2PMH A;  1USS A;  4CXF A;  2PJP A;  1GVJ A;  2LF8 A;  3K0L A;  4WXD A;  1DP7 P;  4KA4 A;  1SAX A;  3AAF A;  1G3T A;  2EFP A;  3JSO A;  2FQ3 A;  1S7A A;  2RNJ A;  4PCQ A;  1JXS A;  2EB7 A;  4KT5 C;  2UWM A;  1TNS A;  3Q5F A;  1SFE A;  5LGN A;  3WE2 A;  2ZCW A;  3IKT A;  4CHU A;  3FM3 A;  1SD7 A;  1BIA A;  2CYY A;  2VBW A;  3D0S A;  4EM2 A;  1KU9 A;  1EH6 A;  2HTS A;  2LKP A;  3L7W A;  2Y0M A;  4E70 A;  1LDD A;  1Z6T A;  4YG2 F;  4EJW A;  2BE5 F;  1MDM A;  1O57 A;  4U0V A;  4YIF A;  1O7L A;  2Z5U A;  4JQF A;  3F3X A;  2YSR A;  2HS5 A;  3CUQ A;  1RUN A;  4Q5S F;  1YW7 A;  1FPQ A;  4MNU A;  2NYX A;  5LHG A;  2VOD A;  2VT2 A;  1L0O C;  2VXZ A;  5LGT A;  4PZJ A;  5K5Q A;  3B73 A;  1U5T C;  4IHT A;  4LLG F;  1TQI A;  2O3F A;  4L18 B;  4HYE A;  2IVM A;  2CG4 A;  5CVV A;  4RAZ A;  2MD5 A;  1S29 A;  4RGR A;  3F6V A;  1BOA A;  1EH7 A;  5DCM B;  5DYM A;  3TGN A;  2W85 A;  2HGC A;  2P6S A;  3GO5 A;  1TW3 A;  3VOE A;  5J8F A;  2VE9 A;  1WSU A;  4M9Z A;  3WTZ A;  5FD6 A;  1P4A A;  1QPM A;  1IZ1 A;  2K7L A;  3K69 A;  2ZBK A;  4R8H A;  3TO6 A;  3GFL A;  5E8I A;  4RAY A;  4ZYE A;  3HRM A;  2MLG A;  4HA8 A;  2IA2 A;  2ZNZ A;  2LSO A;  3HIF A;  1ZGJ A;  3PQJ A;  1WRJ A;  1LJ9 A;  1S7O A;  2J5P A;  3I59 A;  1PUE E;  1ULY A;  2F5F A;  4OMZ A;  3FMR A;  2GA2 A;  2CW0 F;  3D5L A;  2HWV A;  1QZZ A;  2EFW A;  1F1Z A;  4XBF A;  4GGG A;  1H0M A;  1YIO A;  2A07 F;  4O3M A;  2GAU A;  1U2W A;  2ISY A;  2LF7 A;  4CYD A;  4UV8 A;  1OR7 A;  1SMT A;  1ZH5 A;  5JHU A;  1OPC A;  4UHT A;  2E1C A;  3RKY A;  2GWR A;  1YQA A;  1S3J A;  1T39 A;  4GYG A;  1G6N A;  2OQG A;  4HX7 A;  4LMY A;  1PP7 U;  1J59 A;  3WTX C;  5E1W A;  2M30 A;  3TDZ C;  3V8L A;  1KQ9 A;  4AWX B;  1YO5 C;  1SFU A;  4QLC U;  3RDI A;  3M7G A;  1T38 A;  1IUY A;  1D3Y A;  1T2K A;  5F64 A;  4A5M A;  4I01 A;  1RI7 A;  2KKO A;  4XLN F;  1Z1D A;  2P5L C;  1IRF A;  4FHT A;  3FMQ A;  3ZQ7 A;  3KP4 A;  2DQR A;  3Q9S A;  4IXA A;  4MEX F;  1YFH A;  5ILS A;  4JBA A;  4WK8 F;  4AVP A;  5DD4 A;  4LLL A;  3QPT A;  3RIR A;  2H6B A;  2NAZ A;  2FMY A;  2ZNY A;  3QRF F;  4CO8 A;  3MAJ A;  5FLX K;  4BH9 A;  5DCF A;  3CUQ C;  2PEX A;  4LB6 B;  1ON1 A;  3LA2 A;  2V6C A;  2DK8 A;  3T5X A;  2K27 A;  2P6T A;  4HOB A;  3HTU A;  2RN7 A;  3LA3 A;  1W4M A;  4TV7 A;  1TQP A;  3P7N A;  1O7F A;  5HLI A;  1MKM A;  3RI4 A;  1WQ2 A;  1IRG A;  2JZY A;  6PAX A;  1I1S A;  2EJR A;  2XUB A;  4EGZ A;  3F8C A;  3JW4 A;  2RKH A;  2XAJ A;  1SFX A;  3HSF A;  1B59 A;  3WU1 B;  1FNN A;  3S2W A;  2W57 A;  1I27 A;  4P96 A;  4I0B A;  3ZN0 A;  4FX4 A;  2QM3 A;  3KET A;  2QUF A;  1ZRF A;  1MGT A;  3M8F A;  1LEB A;  4DQ2 A;  1T6S A;  5D5W B;  2C6Y A;  3L9F A;  5CYV A;  5D5V B;  5E8G A;  1R22 A;  3F23 A;  3I0T A;  2XRN A;  3WTS C;  2RDP A;  1UFM A;  1OYW A;  4MTE A;  1MJ9 A;  1FBQ A;  1TTY A;  1FP2 A;  3RKX A;  1FZP B;  3T0Y A;  1SD5 A;  1P2F A;  2KJB A;  4KMF A;  4YII A;  5HDK A;  1KYW A;  1ZAO A;  4P5O A;  1TLH B;  4Y13 A;  1FC3 A;  1UB9 A;  2VT3 A;  4WF2 A;  2Y48 A;  2A3S A;  2P5V A;  3ECO A;  2ELH A;  2A5Y B;  3C1D A;  4ENK A;  3F21 A;  1K6O A;  2HKX A;  2V79 A;  3P9K A;  1BBY A;  4LG0 A;  3JAM K;  2DT5 A;  4L9N A;  3FF5 A;  4MHG A;  1IN7 A;  4A6E A;  3E5U A;  2BV6 A;  3FXU A;  1KU2 A;  5A2Q K;  3F8M A;  4P9U A;  2ZFW A;  1XMA A;  3IRQ A;  2CSO A;  2DQL A;  4NQW A;  4WCG A;  5D6E A;  3I64 A;  2FOK A;  3TOA A;  1PDN C;  3LWF A;  3TDU C;  1QGP A;  1U6G A;  2XHK A;  4P9F A;  1P4W A;  2KRF A;  2RVC A;  4ENM A;  5K5R A;  3G3Z A;  5CLS A;  2O8X A;  1YS7 A;  2RQP A;  2XAF A;  3T8T A;  1AWC A;  1KA8 A;  5JVT A;  2HEO A;  2V1U A;  4FT8 A;  1U5T A;  4D0P A;  1FLI A;  1FBS A;  2H09 A;  2MH2 A;  4AIH A;  4YFN F;  4UUV A;  2JTV A;  2VE8 A;  3MZH A;  1XDU A;  3GWZ A;  2OA4 A;  3C18 A;  3M1E A;  1K78 A;  2XVC A;  1V4R A;  4ASN A;  3ZP5 A;  1VTN C;  4G94 A;  3HYI A;  5ICF A;  3BOQ A;  3HUG A;  2XAS A;  2ISZ A;  4IHS A;  5ILU A;  4KN7 X;  4N9H A;  4PGH A;  5LGU A;  1FWZ A;  2A6E F;  3E6D A;  2ZKZ A;  1W5S A;  4EQQ A;  4KFC A;  3R6S A;  4XRF A;  5FLX Z;  3FM5 A;  4KIB A;  1Q1H A;  4ETS A;  4M9X A;  3HRT A;  2FXA A;  1XGS A;  4A6D A;  1CF7 A;  4UV9 A;  3SHF A;  4BXU A;  4I98 B;  1B1B A;  1O3S A;  2QQB A;  2G7U A;  3IC7 A;  1K79 A;  5FB2 A;  4LGW A;  1LDK B;  4KUM A;  5DEQ A;  5H6Q A;  4MTD A;  5E18 F;  4A2U A;  4G8X A;  2QVO A;  5DD8 A;  4RB3 C;  5L3D A;  2NS0 A;  3EQL F;  4OOI A;  3ROU A;  1Z91 A;  3RYP A;  2E7X A;  3L2C A;  3WG9 A;  3OOP A;  2QBY A;  3V7C A;  2EFO A;  1HBX G;  3ZMU A;  2PI0 A;  4Z2Y A;  1XGO A;  1B9M A;  2O6G E;  1FBU A;  5IT9 Z;  1BI1 A;  1U78 A;  2EK5 A;  3QP5 A;  5IT3 A;  1FYM A;  5J8C A;  3LQQ A;  4M73 A;  4F7Z A;  4BHC A;  4L9V A;  3JTG A;  2DI3 A;  3L00 A;  2B0L A;  3QAH A;  5AON A;  2K4J A;  2F2E A;  5DUI A;  3LA7 A;  4M74 A;  4EJU A;  2RGV A;  1W7P A;  4IVN A;  4XLP F;  2QWW A;  1R36 A;  3DXJ F;  4I0A A;  2W84 A;  2DFI A;  2QQ9 A;  4EMS A;  4IF4 A;  2XAG A;  1BN5 A;  1J5Y A;  3GF2 A;  4EM1 A;  3TOB A;  4AD9 A;  4A12 A;  3JAM Z;  1AOY A;  4KYW A;  4G7O F;  4PGG A;  3CTA A;  4ESB A;  3GZ5 A;  3J81 K;  4FX0 A;  2JPC A;  3GZ6 A;  1XD7 A;  4B8X A;  2QEN A;  1Y0U A;  4RB0 A;  3RYR A;  3GYH X;  3I4P A;  2HQR A;  5A2Q Z;  4Q47 A;  2H27 A;  1R5H A;  5LEJ A;  3DEU A;  4ZH4 F;  1IN5 A;  1FYK A;  2QZ8 A;  2R3S A;  2VBX A;  4L0Z B;  3HHG A;  5J6X A;  2OAZ A;  3TO7 A;  4HQE A;  3EUH A;  1Z9C A;  1ZLJ A;  3F22 A;  1F5T A;  4KIC A;  2K86 A;  3WGG A;  4MQ9 F;  2A68 F;  4PDK A;  3CJN A;  3KEO A;  3MEX A;  1UST A;  1J75 A;  4L5J A;  2HYG D;  3HRS A;  2VBZ A;  3CO6 C;  2ZO4 A;  3F8B A;  4CGZ A;  2VBY A;  3V7S A;  3CLO A;  1GXQ A;  4M72 A;  2ZXJ A;  1QO0 D;  3E6C C;  5KK1 A;  2PFB A;  3T8R A;  3GFJ A;  1U3E M;  1XSV A;  3V8K A;  2FRH A;  2W24 A;  2AS5 F;  1H9G A;  5BOX A;  1HKT A;  1F4K A;  5DUK A;  4G9Y A;  2BBY A;  3QOP A;  1UHW A;  1O3Q A;  2DPD A;  3E6M A;  3I53 A;  1FT9 A;  1HQC A;  4GCV A;  1TNT A;  4ZYD A;  4IRH A;  4A0X A;  4LB5 A;  2D1V A;  2EFQ A;  3KLO A;  2QYO A;  5KVR A;  1ZRE A;  3O6B B;  3KE2 A;  1W7P D;  1G3W A;  3H3U A;  3REO A;  2Q2E A;  3ABT A;  4OU0 A;  3V4G A;  2Q8K A;  2NRA C;  1SD4 A;  2LNB A;  2NNY A;  2FA5 A;  3MQ0 A;  3DV8 A;  2IA1 A;  2OQR A;  3JSP A;  2Y75 A;  2L02 A;  2VOP A;  1YG2 A;  5E1Z B;  1IN4 A;  4KNY A;  3WTV C;  2DO7 A;  2JPB A;  3WTY C;  3RTR A;  4YFK F;  3NEU A;  2VON A;  1KU7 A;  4A5N A;  4HF2 A;  1MD0 A;  1YLF A;  4M9S A;  1C0W A;  4OIQ F;  1LDJ A;  3IHU A;  4IRG A;  3BDD A;  1KQ8 A;  3O2P E;  4BHP A;  1T98 A;  5FGM A;  3SXY A;  2M87 A;  3DQV C;  1STZ A;  4EJT A;  5CJ9 A;  1EV7 A;  1TQM A;  1DDN A;  4JK1 X;  2WWY A;  5FFX A;  5K5O A;  3O3K A;  2WTE A;  3KCC A;  2D1H A;  2M1B A;  3G73 A;  3BJO A;  1XMK A;  4U7D A;  1WWX A;  2DAO A;  3I5U A;  3HSR A;  1TW2 A;  3R61 A;  5L3B A;  1R00 A;  3FZV A;  4HV5 A;  4A0Y A;  1DPU A;  3FHZ A;  2ESN A;  5HS9 A;  2ESH A;  2ZME B;  1UHM A;  2XIG A;  1XGM A;  3EYY A;  3WOD F;  3WGI A;  4RB1 A;  1XN7 A;  1YS6 A;  4BNC A;  4KDP A;  4L5I A;  4GXO A;  1R23 A;  2G7H A;  1ZG5 A;  2GIV A;  3IRR A;  2ACJ A;  1HKS A;  1G3S A;  1TBX A;  1ZLK A;  5DDG A;  4L0Y B;  1R1V A;  3KP7 A;  2Z33 A;  2L54 A;  1HXD A;  1P4X A;  2EWN A;  4KMU X;  1IXS B;  4HLY A;  1WI9 A;  2OD5 A;  4NB5 A;  3KEQ A;  3TQN A;  2KIF A;  3KP3 A;  5TJJ A;  5BPI A;  4G6Q A;  4U0W A;  2UZK A;  5ICE A;  1XDS A;  1I6X A;  3GLX A;  3ECH A;  4EJO A;  1B9N A;  5FD5 A;  2P8T A;  4Y15 A;  1XCV A;  2L3D A;  5HS7 A;  4U7B A;  1YW8 A;  3BJ6 A;  4YFX F;  2BYV E;  2EV0 A;  1IN6 A;  2JRT A;  4WX9 A;  3SZP A;  5BS6 A;  2MC3 A;  2O61 A;  3MFK A;  5F6F A;  4IJA A;  2P5K A;  5TRD A;  5D8K B;  2EFN A;  4OIO F;  4I09 A;  1BI2 A;  3OV8 A;  1LNW A;  2OZ6 A;  2V1D A;  2FEZ A;  4Q4Z F;  2JT1 A;  3BPX A;  3GVA A;  1OYI A;  5D4S A;  3ZMZ A;  5HLH A;  4RB2 C;  1E17 A;  2GXG A;  3LQR A;  5HOO A;  4IPA A;  1MDM B;  3ZPL A;  3GX4 X;  3C3W A;  4WWC A;  1OYY A;  1BJA A;  5LEK A;  3PQK A;  4UXN A;  3K1M A;  4A0Z A;  3CUQ B;  1O3T A;  4M6X A;  3GW2 A;  1ZHF A;  2RV8 A;  2L01 A; 
#chains in the Genus database with same CATH topology
 4BQQ A;  4XSX F;  2G0E A;  4LD5 A;  3MZY A;  2IA0 A;  4ZYG A;  4XLF A;  3ULQ B;  5B1A H;  1TP4 A;  4CH7 A;  2W48 A;  2BW3 B;  2H1K A;  1DU6 A;  4PSX A;  2WV0 A;  2JJ7 A;  3HOS A;  4XNF A;  2DTR A;  2OCC H;  3OSF A;  4WXC A;  2NVQ J;  3W2A A;  2JA5 J;  2Z16 A;  1FIA A;  1WJE A;  2D45 A;  3DCF A;  3QOE A;  5EYR A;  4EM0 B;  4R79 A;  1SMY F;  2UXN A;  2V4J C;  2QCO A;  3P9I A;  3ZCO A;  4LLN A;  1R5G A;  1R58 A;  3BRO A;  2KPM A;  1YYV A;  1VQN I;  3B02 A;  3DBL B;  4G6T B;  3DF8 A;  2FU4 A;  3H1C A;  2FNA A;  2GA1 A;  3BR3 A;  2CO5 A;  4ZZD A;  4XOR A;  3ERM A;  3OYG A;  1LKX A;  3BQY A;  3LFK A;  1OCP A;  1Z21 A;  1XSD A;  2ADU A;  3DKW A;  3PFI A;  2MGQ A;  1RET A;  1T56 A;  4RM2 A;  5FFZ A;  2CFO A;  2X0L A;  1QQI A;  3TKY A;  2XC7 A;  1HST A;  3RQ4 A;  2OCE A;  3N05 A;  2YX7 A;  2VC0 A;  2GOM A;  3FXK A;  4HX8 A;  3OR2 C;  1JHF A;  2VL8 A;  2XV4 S;  4O5V A;  1R4M B;  2HPI A;  4OMY A;  4HNV A;  5E3O A;  5LLQ A;  3CCM I;  2IP2 A;  1A04 A;  2K02 A;  4ZZL A;  1A6Q A;  3DTI A;  2DPU A;  2COM A;  2PMZ A;  3ZRG A;  3I59 B;  3BPV A;  5HDG A;  3EYI A;  5HNH A;  3EUK L;  2M7B A;  1NHA A;  2BVM A;  2ZJP F;  3S3M A;  2IS2 A;  2L9S A;  1YTY A;  4HW0 A;  3K1N A;  1UCR A;  1Y1W J;  1J0R A;  1DP3 A;  2PJR B;  3VOD A;  1FSE A;  1V54 H;  4IRI A;  2R5Z A;  2P4W A;  2IGO A;  1W5T A;  3K2Z A;  3V7R A;  1W36 D;  2Y69 H;  1S5L C;  1D0Z A;  4E7H A;  5K1Y A;  4FE4 A;  4RGS A;  3BWG A;  3OYI A;  3L09 A;  1GV2 A;  5C3E J;  4U88 A;  1OCO H;  2MC4 A;  1SD6 A;  1LPQ A;  1BC8 C;  4F91 B;  3HJE A;  1IXR C;  2NVU B;  2EPF A;  3SQN A;  2X9D A;  1P6R A;  1SFO J;  2CGP A;  1OIS A;  3ZMV A;  5CVJ A;  1ZG3 A;  5FRM A;  3DPL C;  2VOO A;  4UVA A;  5AIQ A;  4BQA A;  1D1C A;  3A02 A;  4M71 A;  2HDC A;  2Z9O A;  4CDG A;  5LBQ A;  2E1O A;  3WTU C;  2XAQ A;  2KFD A;  1QZY A;  3WTT C;  5JHF A;  2BY1 A;  2MD0 A;  2JWT A;  2FE3 A;  2YX4 A;  5GAD J;  3QOD A;  4NUB A;  2R7F A;  1H9T A;  3NRV A;  2STW A;  4IL6 C;  1ODD A;  1U8B A;  2EV6 A;  2ID6 A;  4RBO A;  5EEG A;  3ZMS A;  1WJA A;  1GUU A;  4XLH A;  3I56 I;  2KIM A;  2VKH A;  1APL C;  3HG9 A;  2MH9 A;  1MJA A;  4XRM A;  2YS9 A;  3VB2 A;  3AG3 H;  1ZN2 A;  2CW8 A;  5FRO A;  3ZQG A;  4C2U A;  3CO7 C;  2XGC A;  1HW1 A;  2HKO A;  4A3J J;  1ZRC A;  2XGE A;  3G1L A;  3GTM J;  2BY0 A;  5K7H A;  4W1U A;  2CU7 A;  4MGR A;  1YI2 I;  3CME I;  1N75 A;  3IWF A;  4HBL A;  3M9A A;  4BYY A;  2H6C A;  5EGO B;  2L4M A;  1Z05 A;  2K4B A;  5F1R A;  1HC8 A;  4XLC A;  2QGU A;  1J2X A;  2YPR A;  3R0A A;  2OPT A;  1Z77 A;  4OIR F;  1WKM A;  3ZOB A;  2OU2 A;  2L4A A;  1ETX A;  2E19 A;  4Y3O A;  4E7S A;  1A5J A;  1H8A C;  2IBD A;  3HPG A;  1TT0 A;  4CUG A;  2QLZ A;  2DYS H;  1Q1V A;  2Q0O A;  1IXC A;  3BG7 A;  2PQ8 A;  3CCS I;  4QWQ A;  1J7K A;  1BI3 A;  2HQN A;  3HTS B;  3H3Z A;  4S04 A;  1OMI A;  4Q48 A;  1TT5 B;  2CV1 A;  2KJC A;  1ENH A;  3U2R A;  4K2E A;  3R4K A;  1YJW I;  4I6Z A;  2W25 A;  3ISP A;  1CQT A;  5CVU A;  4UVB A;  2IPQ X;  1X2M A;  2FBI A;  5HS8 A;  1JJ6 C;  1AKH B;  2GXB A;  3RPQ A;  3H5N A;  3B6A A;  1QU3 A;  1VQ6 I;  3R0J A;  5H20 A;  5L3F A;  3HOY J;  1G3Y A;  5BQT A;  4A3L J;  3VYS B;  2UXX A;  3QYF A;  4GO1 A;  4J19 A;  1GV5 A;  2V9P A;  3HBL A;  4P1W A;  2YUS A;  5CVI A;  1ETV A;  1REP C;  2OF7 A;  3EET A;  1JHH A;  1MJB A;  4EJV A;  3BR0 A;  4BE0 A;  3ZMT A;  1RR7 A;  2PBI A;  3E6B A;  4AU7 A;  3HOU J;  5E20 A;  1WJB A;  1RUO A;  5ILV A;  4UNO A;  1S6L A;  3JRG A;  4HQM A;  4LK1 F;  1J9I A;  3ELK A;  3M8E A;  5M3F J;  3BP8 A;  5LRS A;  4HF1 A;  4EV0 A;  5D5U B;  2KMU A;  1XSX A;  4M3G A;  3QYB A;  1B6A A;  2DBB A;  1IGN A;  1E3O C;  1ONV A;  1X1B A;  2GQQ A;  3CMA I;  2KT0 A;  2R7D A;  1U8R A;  1D1A A;  1VQ7 I;  4HZF A;  3H3V K;  3FMS A;  4O6J A;  4CA0 A;  1MZB A;  1RC9 A;  2MYS A;  4ON0 A;  2HOS A;  2TDX A;  1IDZ A;  2PMU A;  2DFH A;  2VUM J;  2LK2 A;  4I02 A;  5JFR A;  3R60 A;  2MBF A;  2Z3Y A;  1X58 A;  2FJ1 A;  3LSP A;  1P92 A;  2QA4 I;  4N9I A;  3HGY A;  2QQ8 A;  3OYK A;  1GXP A;  2F6C A;  1SAN A;  3S15 J;  5EEH A;  2KLO A;  3FXR A;  4IQJ A;  4YEL A;  4ENN A;  2IW5 A;  3HC7 A;  4PFO A;  3IKV A;  9ANT A;  4B3X A;  1R1U A;  3MKW B;  5FKM A;  1NG6 A;  4A93 J;  3A03 A;  4A3G J;  3GTG J;  3DPT A;  3O8H A;  5D8L B;  3G2B A;  3BT9 A;  2V6E A;  1FYL A;  3LAJ A;  3QWL A;  3LL7 A;  2LG4 A;  3BTL A;  3CC7 I;  4IKF A;  2KRH A;  3I58 A;  2EIM H;  3Q0W A;  3SYT A;  2H8W A;  2GM4 A;  1R7J A;  1VQ9 I;  1IF1 A;  3BZC A;  2WC2 A;  1G2H A;  4G12 A;  2E71 A;  1BM9 A;  3K4M A;  1D5V A;  3I54 A;  2DMP A;  1XGN A;  1UG0 A;  3BC8 A;  2IJL A;  1FY7 A;  1KU3 A;  1K61 A;  3SEZ A;  5D6F A;  3IP4 B;  3MZ8 A;  4LG0 B;  2ZFU A;  2LY9 A;  1ZG1 A;  3U21 A;  2LBF B;  4HF0 A;  2AQF A;  2BGC A;  2CQ7 A;  2VC1 A;  3CDH A;  3WTW C;  3SFI A;  5E1X A;  3KZY A;  4NC7 A;  3J7Y J;  4BHB A;  1DPR A;  3BQZ A;  3T1B A;  5JLX A;  2L7F P;  2CFX A;  3RZO J;  2M5W A;  2EBI A;  2IXS A;  3F72 A;  5JR3 A;  3WGH A;  4ZYH A;  2LMD A;  3PIP F;  1X2N A;  2O5R A;  5J1U A;  5FO5 A;  4HG2 A;  5ED4 A;  1IJW C;  4NQW B;  3GLL A;  1U9O A;  3Q0V A;  4XKC A;  1B72 A;  1IDY A;  1WI3 A;  4J00 A;  2XSJ C;  1LUJ B;  4BJ5 C;  4CIC A;  1OCT C;  2DLL A;  1GHC A;  4HLX A;  3SDB A;  3JR9 A;  1BI0 A;  5ICG A;  3N4M A;  2HTJ A;  1OQY A;  4N0B A;  2O03 A;  2L2O A;  2DA4 A;  2M8E A;  2NNN A;  3K9T A;  4MO7 A;  5CKT A;  3J80 K;  3E1S A;  3OS2 A;  1UJ8 A;  2GXA A;  5D5X B;  1FP1 D;  2OC6 A;  4F93 B;  4AUX A;  3IH3 A;  2XGX A;  2ID3 A;  5D4R A;  3KLN A;  1YJ9 I;  1RR8 C;  3BZ6 A;  1I50 J;  3ABM H;  2ELK A;  3DKX A;  2QEX I;  1V5E A;  4G7Z F;  4RS8 A;  1QNT A;  4HDV A;  4ENJ A;  1BR2 A;  2CWE A;  1SEU A;  4FCY A;  1JGG A;  1OCC H;  2ELJ A;  3C7J A;  2ZJ2 A;  3CMM A;  1VQM I;  2HZT A;  1HSJ A;  5EJC A;  5BNG A;  2DU9 A;  1Y6I A;  1MBE A;  3H9G A;  3QU3 A;  1ETK A;  1U5T B;  3ZR8 X;  1IV6 A;  3EDP A;  4LK0 F;  5GAH J;  5GAG J;  2Z99 A;  3FKI J;  3K70 D;  1XCB A;  3CES A;  3QP6 A;  1EH8 A;  2VI6 A;  4GYI A;  1KZH A;  2IT0 A;  1VI0 A;  3LAP A;  1K78 B;  2ZXH A;  3MCZ A;  1BR1 A;  3PFY A;  4HDU A;  1HKQ A;  1M1E B;  3GBG A;  1GLN A;  2P7C B;  1N77 A;  3Q0U A;  2E1M B;  3OYB A;  2EQR A;  5LHI A;  3HUG B;  2VXD A;  3GFM A;  1DUX C;  5BMZ A;  1F9N A;  2CH0 A;  4AIK A;  3OIO A;  4A3I J;  1VQK I;  3ERE D;  4BY7 J;  3JRC A;  1IRX A;  3DP7 A;  3HHH A;  1T0F A;  1G4D A;  5IYD J;  3NQO A;  2H1L A;  3FX3 A;  5TGT A;  3J81 Z;  1PUF A;  1QBJ A;  1XX5 A;  1K7A A;  4RA2 A;  1SFK A;  1T08 B;  4BUP A;  1YRN A;  2A05 A;  5L3C A;  2DW4 A;  3E7L A;  2VJJ A;  5KAI C;  3W3C A;  5ERI A;  3H92 A;  4HNU A;  2VPR A;  2O0Y A;  3FWE A;  4CCJ A;  4RLF A;  4BL0 B;  2AXL A;  3DTK A;  3KEY A;  5HNF A;  1D8J A;  4ZJZ A;  1CF7 B;  2DK5 A;  2P0W A;  4HX4 A;  4KN4 X;  4MEY F;  3AG1 H;  4M6Y A;  3AL0 C;  2F5E A;  4QPO A;  2IRF G;  4OAY A;  2Y9Y A;  2YR2 A;  3CJT B;  1Z3X A;  4XKW A;  2FSW A;  2OBP A;  1JGS A;  4I7H A;  2DDA A;  3GZN B;  3S2D J;  2Q1Z B;  3SFZ A;  2GZW A;  3ML6 A;  3E5Q A;  1B8I B;  4L9T A;  2V1N A;  1KYZ A;  1WHU A;  4B09 A;  4KIF A;  4DZP A;  4R1H A;  3CF2 A;  2E7W A;  1P9Q C;  2OZU A;  3M8J A;  1ZTR A;  3E0J B;  2XRO A;  3D1N I;  3RJP A;  2HDW A;  1B4A A;  2V9V A;  4NC6 A;  2BEO A;  1UG2 A;  1WCM J;  1S72 I;  5M5W J;  1IUF A;  2FNP A;  3H0D A;  2ECB A;  1RNL A;  4AM3 A;  2HYF A;  1JKQ C;  3B6C A;  2X1C A;  2QBY B;  3LMM A;  1Z3Y A;  3JTH A;  1E2X A;  4A3K J;  2JUG A;  4HV6 A;  5DCM A;  1L3L A;  2E1N A;  5J4Y A;  3ZQC A;  2XB0 X;  4DNC A;  1I5Z A;  4DZJ A;  4ESF A;  5ICC A;  1MMD A;  2XKP A;  3BR2 A;  1JT0 A;  3N97 A;  2M3A A;  1KQ0 A;  1TL8 A;  1V3F A;  1H89 C;  4EAT A;  2X1E A;  2BXY A;  5JI6 A;  4ZDO A;  3QU6 A;  2R7Z J;  2FML A;  3SJM A;  5IT9 K;  2Y9Z A;  1SVL A;  1PP8 F;  1X1A A;  2HZD A;  2PLY A;  3RKQ A;  3HOV J;  3JRE A;  5LFA A;  2FUG 2;  1KGS A;  3SZT A;  2K9N A;  3LSH A;  3GUD A;  4F3Q A;  5FLV A;  3FIS A;  1VQL I;  1W0U A;  4S0H B;  2KQR A;  3Q3S A;  3F6O A;  1R9T J;  2XSD C;  3LSG A;  5L3G A;  4M3B A;  1W0T A;  1ZGA A;  3BJA A;  2XRL A;  4U0Y A;  1LEA A;  2VKD A;  5LRR A;  5DV5 A;  5EG0 A;  2VN2 A;  4ZTJ A;  4OWR B;  3E3V A;  4RGX A;  1W7P B;  3HOT A;  1K4S A;  1J09 A;  2VQL A;  2A61 A;  4OIP F;  3HSE A;  3E5X A;  1Z0X A;  3RKW A;  1AU7 A;  3A2K A;  1FOW A;  3TBI A;  1XB4 A;  1LQ1 A;  4LJZ F;  1Z7U A;  1LE8 A;  2HOE A;  2HQ5 A;  2PG4 A;  3KFW X;  1EKE A;  3MWM A;  5HVQ C;  1ERD A;  3PL8 A;  3CLQ A;  1FTT A;  2RC4 A;  2BHZ A;  2PN6 A;  4B44 A;  2DA3 A;  2A69 F;  2EZI A;  2L9R A;  5E17 F;  4IOC F;  4CZZ A;  1HW2 A;  3K7A J;  1ZYR F;  4JX6 A;  3JRH A;  2HVQ A;  3U9G A;  5DM6 F;  3TO9 A;  3KZZ A;  4M3F A;  5HLT A;  4UUS A;  2HXI A;  3BY6 A;  1ZAR A;  2DT7 B;  4XMY A;  4JX5 A;  2WAQ A;  2FF4 A;  2KZV A;  3TW6 A;  3F8N A;  4P55 A;  1JE8 A;  2DOD A;  4FE7 A;  5HDN A;  3SEQ A;  3PUF A;  1WFX A;  4EVI A;  4IX7 A;  2HFH A;  1MBK A;  2HI3 A;  2JVH A;  2CQX A;  3IWZ A;  4I2O A;  4BGD A;  3WU2 C;  2F5C A;  3J80 Z;  4G7H F;  2EZK A;  1NG7 A;  4XN3 A;  1HDD C;  3J7A O;  3P9C A;  1BW6 A;  4RMN A;  1IAW A;  5BPD A;  1S8N A;  1RZ4 A;  3IL2 A;  4LFU A;  1CGP A;  3COA C;  3U1D A;  2K9Q A;  2V1X A;  3W6J B;  1TWC J;  1DGR M;  2CQK A;  3KP5 A;  1YW9 A;  1I1G A;  1FOK A;  1FSH A;  2MA3 A;  2DN0 A;  2M8G X;  1UHS A;  3DWL E;  4IQ4 A;  5KCM A;  2E5Z A;  2DMQ A;  2XPV A;  1TWH J;  2X4H A;  2EV5 A;  2P7V B;  2F4M B;  2F48 A;  3I71 A;  2G9W A;  4H4K C;  4UVC A;  2XAH A;  2HNH A;  1T0F C;  3F8F A;  3GEZ A;  1YE9 A;  1LB2 A;  1F36 A;  5HLG A;  2B63 J;  3FXQ A;  2DYR H;  4IHX A;  3C2B A;  5IY5 H;  1LVK A;  1W1W E;  3ZN1 A;  1WZ2 A;  4N4O B;  3S16 J;  2FBK A;  2IGN A;  3GCM A;  1OJL A;  4C30 A;  3RSN A;  2JSC A;  3EUA A;  5L3E A;  2WY8 Q;  1Y56 A;  1SVO A;  3KP6 A;  2EA2 A;  2HDD A;  1FX7 A;  2H94 A;  3WU0 A;  4XSZ F;  4Z6Y A;  4EGY A;  1FOY A;  3GXO A;  5IP6 A;  3DFG A;  2JRM A;  1MNE A;  3KP2 A;  3PNY A;  1X1P A;  3HRU A;  2DTZ A;  3CUO A;  1EJ9 A;  1OKR A;  1HLV A;  1IN8 A;  1Y8Q B;  3ZMD A;  1OCR H;  3W6K B;  1BIB A;  3V8J A;  2YU3 A;  2A6H F;  4PJL A;  2VQH A;  2ZME A;  5AIP A;  2EA4 A;  2K5C A;  4ESJ A;  1IW7 F;  2F5D A;  4KIG A;  3VFZ A;  4FTH A;  3FK6 A;  4DYQ A;  1FJL A;  1FEX A;  2J5O A;  4V2G A;  3ABK H;  1ORK A;  3LST A;  3K1P A;  1X3U A;  5H6R A;  3GTP J;  4B3A A;  2CV0 A;  4DOZ A;  4PJN A;  3DLL F;  5KAF C;  3VWB A;  4OIN F;  3GFI A;  4RGU A;  2JUC A;  4HAM A;  1FTZ A;  2LOO A;  2Q2E B;  1ON2 A;  5FKN A;  5IYB J;  2IEK A;  2D2W A;  2AO9 A;  2NXN B;  1D0Y A;  3IV5 A;  4NC8 A;  3CCL I;  5IPA A;  2XKO A;  3OYH A;  4FAS D;  4Y17 A;  1O3R A;  2KIU A;  2V9K A;  2HVR A;  2STT A;  4NHJ A;  3E97 A;  3WHC A;  4L9J A;  2MLK A;  3VEP A;  2F4I A;  1LVA A;  3BCB A;  1RIO H;  2K9M A;  3QPH A;  4G6D A;  1HW5 A;  3ABU A;  5IOZ A;  4S05 A;  1D8K A;  2JMW A;  1GVD A;  3CZ6 A;  5E3L A;  2M45 A;  2NVX J;  4MQV A;  3RPU A;  2H8R A;  5J40 A;  3HOZ J;  3K2A A;  2LDU A;  3H9Q A;  3OYL A;  1ZR4 A;  3VDX A;  4C3J J;  1R1T A;  1WJD A;  2QQA A;  4AIJ A;  4BAY A;  1ZRD A;  1XC5 A;  3WE3 A;  3Q9V A;  2HR3 A;  1R6R A;  4BEH A;  3L2U A;  4H0E A;  2E2I J;  5CVR A;  5LHH A;  4WXH A;  1TWF J;  2ETH A;  2FBH A;  2O7O A;  3QPS A;  3BLY A;  1Z6R A;  1BC7 C;  1VF9 A;  2PMH A;  1USS A;  4GDF A;  4CXF A;  2PJP A;  2JA6 J;  1T33 A;  1GVJ A;  2LF8 A;  2X6O A;  3K0L A;  4WXD A;  3FIW A;  3BG5 A;  3BTJ A;  1DP7 P;  2LR8 A;  4KA4 A;  1SAX A;  5C4J J;  3G6E I;  3AAF A;  2R5Y B;  1G3T A;  2EFP A;  3PSF A;  3JSO A;  2FQ3 A;  1S7A A;  1QVT A;  2RNJ A;  2WAE A;  4RM3 A;  4PCQ A;  1IG7 A;  1JXS A;  4Y7N J;  3JRD A;  2EB7 A;  2LY2 A;  1MNM C;  4XOT A;  1E3H A;  3HOW J;  3OMY A;  4KT5 C;  2L7K A;  2UWM A;  2WY7 Q;  2E2H J;  2R7T A;  1TNS A;  4JOM A;  3Q5F A;  1SFE A;  2DT6 A;  5LGN A;  1LFU P;  3WE2 A;  3A01 B;  3OYN A;  2ZCW A;  3IKT A;  4CHU A;  3FM3 A;  3OYF A;  1SD7 A;  1BIA A;  3DEW A;  3CCJ I;  4XK4 A;  2CS3 A;  2CYY A;  2VBW A;  3D0S A;  4EM2 A;  4B47 A;  2ME0 A;  1KU9 A;  1VQO I;  1EH6 A;  2HTS A;  2LKP A;  4FQG A;  2F4O B;  3L7W A;  2Y0M A;  4E70 A;  1LDD A;  3L2V A;  1Z6T A;  4YG2 F;  2HXO A;  4X1E A;  5IOY A;  2IAI A;  4EJW A;  2BE5 F;  4X0G A;  4BDZ A;  2B9S A;  1MDM A;  1O57 A;  4U0V A;  4YIF A;  1O7L A;  2Z5U A;  2PX9 A;  4JQF A;  4CCK A;  2DOE A;  2W82 A;  3F3X A;  2YSR A;  2HS5 A;  3CUQ A;  2XAU A;  3ABL H;  1RUN A;  4Q5S F;  1R71 A;  4NNJ A;  5M5X J;  1YW7 A;  2X51 A;  2V7F A;  1FPQ A;  2JA7 J;  4MNU A;  2NYX A;  5LHG A;  2FX0 A;  2VOD A;  2EZL A;  2VT2 A;  1L0O C;  2VXZ A;  3H36 A;  4OAZ A;  5LGT A;  4PZJ A;  5K5Q A;  1MMS A;  1QHH D;  3MMY B;  4CYC B;  3B73 A;  1PYV A;  2OUM A;  5CQG A;  3I55 I;  1U5T C;  2CRG A;  4IHT A;  4LLG F;  1RKT A;  1TQI A;  2O3F A;  4L18 B;  4HYE A;  1Y8R B;  2IVM A;  2HU9 A;  2CG4 A;  5CVV A;  1MMA A;  4RAZ A;  2BW3 A;  4A3D J;  4M3D A;  1MBF A;  2MD5 A;  1S29 A;  3HB9 A;  1U9N A;  4RGR A;  5GP9 A;  3F6V A;  3W2W A;  3A0H C;  3D5S C;  1BOA A;  1EH7 A;  5DCM B;  5DYM A;  2QSH X;  3L1P A;  3CCE I;  1I6H J;  3TGN A;  2W85 A;  4IHY A;  2HGC A;  2RQQ A;  2P6S A;  2WAQ N;  2WAD A;  3OWT A;  2HOA A;  1HA8 A;  3GO5 A;  1YX3 A;  4I99 C;  1TW3 A;  2CUZ A;  3OYE A;  2JSP A;  2ZME C;  3KZI C;  4PJM A;  3VOE A;  5J8F A;  3LOC A;  4AC0 A;  2VE9 A;  1WSU A;  4M9Z A;  3WTZ A;  2HQA A;  5FD6 A;  1P4A A;  2CV2 A;  1QPM A;  1IZ1 A;  4HPQ A;  2K7L A;  5FKO A;  3K4K A;  3K69 A;  2ZBK A;  4R8H A;  4II2 A;  3TO6 A;  1MH4 A;  3GFL A;  4XKV A;  5E8I A;  1F43 A;  4RAY A;  3TW7 A;  5J1R A;  4ZYE A;  3HRM A;  1JJ8 C;  2MLG A;  4HA8 A;  2D5V A;  2IA2 A;  3G1O A;  2ZNZ A;  2E2J J;  2LSO A;  1E0E A;  3G4S I;  3PJR A;  3HIF A;  1ZGJ A;  3PQJ A;  1ZGW A;  1WRJ A;  1LJ9 A;  1S7O A;  2IGK A;  2J5P A;  3I59 A;  1PUE E;  1ULY A;  4XIC A;  2F5F A;  4OMZ A;  3FMR A;  2GA2 A;  3UR3 C;  2CW0 F;  4XL9 A;  3D5L A;  2HWV A;  1QZZ A;  4CZC A;  2EFW A;  1F1Z A;  4XBF A;  4BKX A;  3CCV I;  4GGG A;  4F52 A;  2PJR A;  1LFP A;  1HOM A;  1H0M A;  1YIO A;  2A07 F;  2M34 A;  4O3M A;  2GAU A;  1U2W A;  2TRT A;  2XPU A;  2ISY A;  3FKJ A;  1R4N B;  4PFP A;  2LF7 A;  1ZEL A;  4UV8 A;  4CYD A;  2CUJ A;  3RQI A;  1OR7 A;  1EF4 A;  1D5Y A;  1SMT A;  2LYC A;  1UAA A;  1ZH5 A;  1Y1V J;  5JHU A;  1OPC A;  3CCY A;  4YRV A;  3C2H A;  4GRI A;  4UHT A;  3VPR A;  2E1C A;  3J7A Y;  4QSH A;  3RKY A;  4ABZ A;  1WH5 A;  1JT6 A;  1JUS A;  2GWR A;  1NK3 P;  3DTE A;  1YQA A;  4BBR J;  3GTO J;  4UB6 C;  2NS7 A;  1S3J A;  1T39 A;  4MFE A;  4CCM A;  3IUO A;  2DA5 A;  4GYG A;  1G6N A;  1S9H A;  2OQG A;  2COB A;  4HX7 A;  3HXL A;  1FMW A;  3OYA A;  4LMY A;  1PP7 U;  4IZZ A;  1OFC X;  2ZXI A;  1J59 A;  4A3M J;  3WTX C;  2WV1 A;  2MFZ A;  5E1W A;  2M30 A;  3TDZ C;  3V8L A;  2XGD A;  1KQ9 A;  5K7F A;  1V5G A;  3ZXS A;  4AWX B;  3M1C A;  1WJC A;  1YO5 C;  1SFU A;  1U0J A;  2QKM B;  4QLC U;  3RDI A;  4LOC A;  3CP2 A;  3K4B A;  3M7G A;  1T38 A;  1IUY A;  1YJN I;  2M7A A;  4DYC A;  2ZC2 A;  3OYC A;  5DS9 A;  1D3Y A;  1T2K A;  5F64 A;  2L9V A;  2MW8 A;  4A5M A;  2KIS A;  4I01 A;  1RI7 A;  4LIU A;  2E5N A;  2L0K A;  2NOJ B;  5CPR B;  2KKO A;  4XLN F;  2I5U A;  4E7I A;  3OIQ A;  3S1M J;  1Z1D A;  2R0Q C;  2P5L C;  4JX4 A;  1I3A A;  4XKB A;  1IRF A;  3S1N J;  4FHT A;  1X1C A;  3FMQ A;  5FKK A;  2VPL A;  2M0M A;  3VSL A;  3ZQ7 A;  3KP4 A;  1I39 A;  2DQR A;  3Q9S A;  4IXA A;  4AVZ A;  2GLO A;  2O8K A;  3TP0 A;  3S93 A;  4MEX F;  2AQE A;  3ESW B;  1SAU A;  5EGO A;  3ASO H;  3C2G A;  1YFH A;  1RRJ A;  2UV1 A;  3CP8 A;  3P5J A;  5ILS A;  4JBA A;  5B1B H;  2DXI A;  4WK8 F;  4AVP A;  5FJ8 J;  5DD4 A;  4LLL A;  1ACI A;  3QPT A;  3RIR A;  2KDO A;  4N4N B;  2CUE A;  2H6B A;  2NAZ A;  2FMY A;  2ZNY A;  3QRF F;  4CO8 A;  1Y0N A;  5GTH C;  3MAJ A;  5FLX K;  4BH9 A;  4BXF A;  5DCF A;  3CUQ C;  2PEX A;  4LB6 B;  1HCR A;  1MMN A;  1ON1 A;  3LA2 A;  2V6C A;  4ZTF A;  2DK8 A;  3T5X A;  2MSY A;  2K27 A;  3CCU I;  2P6T A;  4HOB A;  3HTU A;  2RN7 A;  3LA3 A;  3CCQ I;  1W4M A;  4TV7 A;  1TQP A;  3P7N A;  1O7F A;  5HLI A;  4QTR A;  2ZJR F;  1MKM A;  2WA0 A;  3RI4 A;  1WQ2 A;  1I3Q J;  3OL4 A;  1IRG A;  2JZY A;  6PAX A;  1RKW A;  1TZL A;  1I1S A;  5EF6 A;  2EJR A;  2R5Z B;  2XUB A;  4KT6 A;  1AKH A;  3KYD B;  4EGZ A;  4U87 A;  1Y39 A;  3F8C A;  5B3S H;  4DBQ A;  3JW4 A;  3CF5 F;  2RKH A;  2XAJ A;  5F08 A;  1SFX A;  3CDI A;  1DQU A;  5KHD A;  3HSF A;  1B59 A;  4Y33 A;  2N8G A;  1FNN A;  3WU1 B;  3GTL J;  1QVU A;  3S2W A;  2W57 A;  1I27 A;  2IS6 A;  3S8P A;  4CCL A;  1S7E A;  1A6I A;  2CJJ A;  4I0B A;  4P96 A;  3ZN0 A;  4BY1 J;  1JUP A;  4FX4 A;  4ZYA A;  2QM3 A;  3KET A;  5F0H A;  2QUF A;  3VYT B;  1ZRF A;  2BXZ A;  1MGT A;  2OJE D;  3M8F A;  1LEB A;  4RDU A;  4MFD A;  4DQ2 A;  1T6S A;  5D5W B;  2C6Y A;  3JCU C;  1UZC A;  4IO9 F;  4YEJ A;  3L9F A;  5CYV A;  1HDP A;  5D5V B;  5E8G A;  2M0C A;  2HVS A;  1R22 A;  3F23 A;  4L5E A;  5J3L A;  2W1O A;  3I0T A;  2XRN A;  3DEE A;  1SVM A;  3WTS C;  1HF0 A;  3CD6 I;  2RDP A;  3VYU B;  1UFM A;  1OYW A;  4MTE A;  1MJ9 A;  1MBH A;  3HPH A;  3H35 A;  3OSG A;  3HOX J;  1FBQ A;  5FLM J;  3LSR A;  2VQC A;  1TTY A;  1V5F A;  2JK3 A;  1VQP I;  3ZQQ A;  2K3P A;  2KRC A;  1FP2 A;  4A3C J;  3RKX A;  1FZP B;  4GFB A;  1MSE C;  3T0Y A;  1SD5 A;  1P2F A;  2KJB A;  4M6V A;  4KMF A;  2JA8 J;  4BE1 A;  4YII A;  5HDK A;  2P81 A;  1YHQ I;  1X4P A;  1KYW A;  1V55 H;  5B66 C;  2O9L A;  1ZAO A;  4P5O A;  3SDG A;  1TLH B;  1ZQ3 P;  4Y13 A;  2BY3 A;  1PVE A;  1FC3 A;  4ZC3 A;  1UB9 A;  1W5C C;  2OV7 A;  2VT3 A;  5EZG A;  1VQ4 I;  2L5Q A;  4WF2 A;  4A3E J;  2XF7 A;  2Y48 A;  2A3S A;  2JA2 A;  2P5V A;  3ECO A;  2ELH A;  2NOG A;  1FIP A;  2A5Y B;  3C1D A;  4ENK A;  2LD5 A;  1BR4 A;  5M5Y J;  4PSW A;  5GPA A;  1JUM A;  1OR7 C;  2EIJ H;  3F21 A;  5E3N A;  1K6O A;  3MVP A;  3NAR A;  5LD2 C;  2K3F A;  2HKX A;  3BTC A;  2V79 A;  4AYB A;  3BTI A;  3P9K A;  1BBY A;  3VSK A;  5EZH A;  4LG0 A;  3M3Y J;  3JAM K;  2JVG A;  2DT5 A;  2LBF A;  3I4M J;  3WHB A;  4L9N A;  2R7W A;  1AHD P;  3FF5 A;  3S32 A;  3GTJ J;  4MHG A;  2E34 A;  1IN7 A;  3QPL A;  5HOD A;  1MW7 A;  1BJZ A;  1EA3 A;  2ICW G;  1K83 J;  1TC3 C;  5FKL A;  4A6E A;  3E5U A;  3PO3 J;  5F27 A;  2BV6 A;  2FD5 A;  4HST A;  4BAC A;  3FXU A;  1KU2 A;  5A2Q K;  3F8M A;  2NVY J;  1T95 A;  4P9U A;  2ZFW A;  4ANJ A;  1XMA A;  2LP0 A;  2AXT C;  4MIM A;  3IRQ A;  1MIJ A;  3CJQ B;  2CSO A;  1XMX A;  2DQL A;  4NQW A;  4WCG A;  2M2E A;  2DJI A;  5D6E A;  3I64 A;  4PK4 A;  2FOK A;  3TOA A;  1PDN C;  3LWF A;  3TDU C;  4IEJ A;  1PJR A;  1QGP A;  1U6G A;  2XHK A;  2F5V A;  4P9F A;  2TCT A;  1P4W A;  2KRF A;  3LSI A;  4ZDL A;  2RVC A;  4PJ0 C;  3VYR B;  5F04 A;  5JLW A;  1YIT I;  2OTJ I;  5EEA A;  4ENM A;  3AL0 B;  3RCO A;  3ZGK A;  2VKV A;  3FXO A;  2DA6 A;  4XRS G;  5K5R A;  2JQ7 A;  3A1Y A;  3G3Z A;  2B7E A;  3DBR B;  5CLS A;  2VB6 A;  2O8X A;  1YS7 A;  2RQP A;  2X6X A;  3G71 I;  3H0G J;  4YIR X;  2XAF A;  1NK2 P;  3T8T A;  1RPW A;  1AWC A;  3OS0 A;  1KA8 A;  5JVT A;  2HEO A;  2V1U A;  3DKY A;  4FT8 A;  1U5T A;  4D0P A;  1FLI A;  1FBS A;  4C9Y A;  2H09 A;  3LSK A;  2MH2 A;  4AIH A;  4YFN F;  5EDN A;  4UUV A;  2JTV A;  2VE8 A;  3MZH A;  1XDU A;  3K4L A;  3GWZ A;  2OA4 A;  4ITV A;  3C18 A;  3M1E A;  1K78 A;  2XVC A;  2DMN A;  1V4R A;  4ASN A;  3ZP5 A;  1VTN C;  2HYJ A;  1IRZ A;  3ZQH A;  4G94 A;  5GPC A;  1MND A;  3PNT A;  2DOA A;  3HYI A;  3K4J A;  2DA2 A;  5ICF A;  3BOQ A;  3AFH A;  2VJ4 A;  3HUG A;  2XAS A;  3S1R J;  4V19 K;  3I9V 2;  2ISZ A;  4IHS A;  3K4N A;  5ILU A;  4KN7 X;  3S14 J;  4N9H A;  4PGH A;  5LGU A;  2VLA A;  1FWZ A;  3CJR B;  2A6E F;  3E6D A;  5B5E C;  2ZKZ A;  1W5S A;  3UKG A;  3LNQ A;  2K85 A;  1ZK8 A;  4EQQ A;  4KFC A;  3R6S A;  3OIP A;  4XRF A;  5FLX Z;  1FMV A;  4BU2 A;  3J7Z I;  3FM5 A;  4KIB A;  1Q1H A;  4HSR A;  2R7R A;  4ETS A;  2FOW A;  4XON A;  4C2M J;  2DFF A;  4M9X A;  1VZ0 A;  3AG2 H;  2X6Y A;  1BL0 A;  3HRT A;  1O4X A;  3HKZ A;  3D5R C;  3WG7 H;  1NH3 A;  2FXA A;  1ETW A;  1XGS A;  5TIS C;  4A6D A;  2YU9 J;  1CF7 A;  4UV9 A;  3UNG C;  3SHF A;  4BXU A;  4I98 B;  1B1B A;  5DTD A;  1T8I A;  3DU6 A;  3MKY B;  1O3S A;  4KIT B;  2QQB A;  2R92 J;  2G7U A;  3IC7 A;  3GME A;  4BQN A;  1K79 A;  3KYL A;  5FB2 A;  4LGW A;  1LDK B;  4KUM A;  4BQO A;  2ZSI B;  5DEQ A;  2DA1 A;  1ETY A;  2ECC A;  1B8I A;  4DYR A;  5H6Q A;  1X3Z B;  4MTD A;  3PO2 J;  2DCE A;  4J01 A;  5E18 F;  2GOX B;  4A2U A;  3KYC B;  4G8X A;  2QVO A;  3IAS 2;  3L2W A;  5DD8 A;  3CMY A;  4PJJ A;  4RB3 C;  5L3D A;  2NS0 A;  1MH3 A;  3EQL F;  4OOI A;  3ROU A;  1B72 B;  1Z91 A;  1QPI A;  3RYP A;  1FOX A;  2E7X A;  4EEF G;  4A3B J;  2LRE A;  4XN0 A;  4UB8 C;  1X3W B;  3L2C A;  1IC8 A;  3WG9 A;  3JRA A;  2NVT J;  3BR1 A;  2Y31 A;  3OOP A;  1R5I D;  1Z67 A;  4KJZ A;  4MLO A;  3HDD A;  2QBY A;  3H9J A;  3ONQ A;  2WAF A;  1WH7 A;  5M3M J;  4AID A;  3OR1 C;  3V7C A;  5E79 C;  3HM5 A;  2EFO A;  1HBX G;  4DBR A;  1XPX A;  3ZMU A;  3FXJ A;  2PI0 A;  5KNL A;  1WVR A;  5H2F C;  4Y4R A;  4Z2Y A;  2DFE A;  1XGO A;  1B9M A;  2O6G E;  1FBU A;  5IT9 Z;  1BA5 A;  4FET A;  1JKO C;  2XDV A;  4XR6 A;  2ME6 A;  1BI1 A;  1U78 A;  1TWG J;  2EK5 A;  1JTX A;  3QP5 A;  5F0C A;  5IT3 A;  1FYM A;  5J8C A;  3LQQ A;  4M73 A;  4F7Z A;  5JVG F;  1W36 C;  4BHC A;  4HNT A;  4L9V A;  4DIQ A;  3JTG A;  2DI3 A;  3HZJ A;  3AKZ A;  2M4K A;  3L00 A;  2B0L A;  3QAH A;  4HEA 2;  5AON A;  2K4J A;  2F2E A;  5DUI A;  3LA7 A;  3K4C A;  4M74 A;  4EJU A;  2KIQ A;  4IHW A;  2RGV A;  3A0B C;  2R7V A;  1W7P A;  4IVN A;  4XLP F;  2HOT A;  1JKP C;  2QWW A;  1R36 A;  3DXJ F;  4I0A A;  2W84 A;  2DFI A;  2QQ9 A;  4EMS A;  4D1Q A;  3AG4 H;  2MG4 A;  4IF4 A;  2XAG A;  1BN5 A;  1J5Y A;  1G8X A;  3G1M A;  3GF2 A;  4EM1 A;  3TOB A;  4AD9 A;  3I3L A;  4A12 A;  4D7N A;  4LIV A;  3FXL A;  4LIT A;  3LSM A;  3JAM Z;  1AOY A;  4UY8 I;  3DBH B;  1PUF B;  1MSF C;  4PGG A;  4KYW A;  4G7O F;  5C4X J;  3CTA A;  1XS9 A;  4ESB A;  1YRN B;  3GZ5 A;  3J81 K;  4FX0 A;  2JPC A;  2DJN A;  1A31 A;  1N78 A;  5GTI C;  1XD7 A;  3GZ6 A;  1OLT A;  4B8X A;  2QEN A;  2XF5 A;  1Y0U A;  3HGG A;  4RB0 A;  3RYR A;  3IH4 A;  2DMU A;  3GYH X;  3I4P A;  1WJ5 A;  2HQR A;  3BR6 A;  4A69 C;  5A2Q Z;  4II3 A;  2VQG A;  4Q47 A;  1R5H A;  2H27 A;  4XLA A;  3MKL A;  1YIJ I;  1VQ8 I;  5LEJ A;  3DEU A;  4BXX J;  2JN6 A;  4ZH4 F;  1IN5 A;  1UEL B;  1FYK A;  2I8D A;  3L2Q A;  2QZ8 A;  2R3S A;  2XPW A;  2Z2S B;  2VBX A;  4L0Z B;  1GT0 C;  2NS8 A;  3O8G A;  3HHG A;  5J6X A;  2OAZ A;  3TO7 A;  4ZDP A;  4HQE A;  1JKR C;  3EUH A;  2I10 A;  2LKX A;  2Y0S N;  4AYB N;  1Z9C A;  1ZLJ A;  2LFB A;  2WB1 A;  3OYM A;  3L2R A;  3BG3 A;  3F22 A;  1ETQ A;  1F5T A;  4KIC A;  1ITY A;  2K86 A;  2IGM A;  3TL4 X;  3WGG A;  1GDT A;  2ZXW H;  2CQN A;  4MQ9 F;  2GIZ A;  3LFU A;  2E1M C;  2VJI A;  2A68 F;  1H88 C;  4PDK A;  3CJN A;  3KEO A;  3BZK A;  2DDB A;  3MEX A;  3EPZ A;  1UST A;  1J75 A;  4L5J A;  3KIO A;  4E4H A;  2HYG D;  3HRS A;  2VBZ A;  3CO6 C;  2ZO4 A;  3F8B A;  5F0F A;  4CGZ A;  3RPU D;  4DGW B;  2VBY A;  3V7S A;  3CLO A;  1GXQ A;  4M72 A;  2R4G A;  2ZXJ A;  2M9H A;  1QO0 D;  3OOU A;  3E6C C;  4C3I J;  3MD2 A;  4KIS A;  5KK1 A;  2PFB A;  5J1Y A;  2M4G A;  3T8R A;  3GFJ A;  1U3E M;  1XSV A;  3V8K A;  2FRH A;  2KP6 A;  4BJT A;  2W24 A;  5J47 A;  1H9G A;  2AS5 F;  1BW5 A;  4D7M A;  5BOX A;  2EIK H;  2CUF A;  2K9L A;  4W97 A;  4XLE A;  1F4K A;  5F1J A;  1HKT A;  5DUK A;  4G9Y A;  1QZE A;  4RAF A;  1OCZ H;  4B4C A;  2CMP A;  1DGW Y;  5GAE J;  2BBY A;  3QOP A;  3S17 J;  4E7L A;  3A4C A;  4XM3 A;  1UHW A;  4XOP A;  2DOF A;  1O3Q A;  2DPD A;  3TED A;  5EG0 B;  3E6M A;  2W7N A;  3I53 A;  3OYD A;  1FT9 A;  1HQC A;  3W6V A;  2RNG A;  1POG A;  4GCV A;  4BJ6 C;  4DJA A;  1QRY A;  1TNT A;  3K10 A;  5IP7 J;  4ZYD A;  2KDZ A;  2K9S A;  1JI8 A;  4IRH A;  4PUS A;  4A0X A;  4LB5 A;  1LE8 B;  2D1V A;  3ZQF A;  4E7K A;  2EFQ A;  2ZB9 A;  3KLO A;  3MN2 A;  2X6W A;  3MKZ A;  2VKE A;  1MBJ A;  2QYO A;  1N25 A;  3OL3 A;  3O6B B;  5KVR A;  1ZRE A;  3PUB A;  3GTK J;  4Y52 J;  3KE2 A;  1W7P D;  1G3W A;  3H3U A;  3REO A;  2Q2E A;  3ABT A;  4OU0 A;  3V4G A;  1QHG A;  3JRB A;  2Q8K A;  3FXM A;  3PM1 A;  1SD4 A;  2NRA C;  4XID A;  2LNB A;  5CQE A;  2NNY A;  2FA5 A;  3MQ0 A;  3DV8 A;  1WJF A;  4UUS B;  1A36 A;  2IA1 A;  2FQ4 A;  3BCA A;  3S1Q J;  2VAS A;  2Y30 A;  2LKS A;  2OQR A;  3JSP A;  2KHM A;  2R93 J;  1K6Y A;  2Y75 A;  3H5R A;  3HL2 A;  4LG3 A;  2L02 A;  2VOP A;  1YG2 A;  4CCN A;  3HEF A;  1D0X A;  4BS9 A;  4UUT A;  3CDL A;  5E1Z B;  1IN4 A;  2ZSH B;  1IO2 A;  4KNY A;  3WTV C;  5FRN A;  2E60 A;  2DO7 A;  4D5C A;  2QSG X;  2AHQ A;  1E3P A;  1UMQ A;  1YOV B;  3IAM 2;  2JPB A;  2MAB A;  5IYC J;  2CQQ A;  1YX5 A;  2K40 A;  3HKZ N;  3WTY C;  3RTR A;  4YFK F;  3NEU A;  1A35 A;  2HPM A;  4B1R A;  2VON A;  2PMZ N;  1KU7 A;  4A5N A;  4HRI A;  4HF2 A;  3CC2 I;  1MD0 A;  1RES A;  1YLF A;  4M9S A;  1C0W A;  1LDJ A;  4OIQ F;  1P7J A;  3IHU A;  4RAG A;  1NTC A;  4IRG A;  3BDD A;  1KQ8 A;  3O2P E;  5J4V A;  2LLK A;  2X1D A;  4BHP A;  2LY1 A;  1T98 A;  4E7J A;  5C44 J;  5FGM A;  3SXY A;  2M87 A;  3X2Q H;  2A5W A;  3DQV C;  3CCR I;  1STZ A;  3NWS A;  4EJT A;  5CJ9 A;  2R5Y A;  1EV7 A;  1TQM A;  4XQF A;  4I76 A;  2RRE A;  3TP3 A;  1DDN A;  4JK1 X;  4BDY A;  3BG6 A;  2WWY A;  5FFX A;  5K5O A;  1MBG A;  2L9N A;  2R7U A;  3S2H J;  2VJ5 A;  1D1B A;  3O3K A;  4QIW N;  2WTE A;  2R7Q A;  3U1K A;  3LSJ A;  3KCC A;  2D1H A;  2M1B A;  3G73 A;  2RAE A;  3BJO A;  1XMK A;  1P7I A;  1DU0 A;  4U7D A;  2XF6 A;  1IV8 A;  4IHV A;  1WWX A;  3NAU A;  3OYJ A;  3A01 A;  2DAO A;  3I5U A;  3HSR A;  1TW2 A;  3R61 A;  5L3B A;  1R00 A;  2LH9 A;  3FZV A;  4C2T A;  3DLA A;  2EZH A;  3H5A A;  4HV5 A;  4A0Y A;  1DPU A;  3FHZ A;  1ETO A;  2BZT A;  2Y2Z A;  2ESN A;  5HS9 A;  2ESH A;  2ZME B;  1ZR2 A;  1UHM A;  3CQZ J;  2XIG A;  1XGM A;  3TMO A;  4BE2 A;  3EUH C;  3EYY A;  3WOD F;  2DMT A;  1TWA J;  3WGI A;  3M4O J;  2L7M P;  5K7Z A;  4RB1 A;  4B48 A;  3F9K A;  4F55 A;  1XN7 A;  1YS6 A;  4BNC A;  4CSW A;  3DU5 A;  4JP0 A;  4KDP A;  2W4S A;  4L5I A;  4GXO A;  1R23 A;  3K70 C;  2BY2 A;  3FBN B;  2G7H A;  1ZG5 A;  3M07 A;  2GIV A;  3IRR A;  5E3M A;  2ACJ A;  3QYE A;  1R49 A;  1HKS A;  3FDY A;  1G3S A;  1VQ5 I;  1TBX A;  2CW7 A;  1ZLK A;  5DDG A;  4L0Y B;  4CYC A;  1R1V A;  3KP7 A;  2Z33 A;  2L54 A;  1HXD A;  1P4X A;  2EWN A;  3OS1 A;  3S3N A;  4KMU X;  1IXS B;  3PNV A;  2R7O A;  4HLY A;  1WI9 A;  2OD5 A;  4NB5 A;  3KEQ A;  3TQN A;  2X48 A;  2LRD A;  3RZD J;  2BVL A;  1BOB A;  1X4O A;  1MMG A;  2QF7 A;  2KIF A;  2W00 A;  3KP3 A;  5TJJ A;  5BPI A;  3QQA A;  4E6K G;  4D5F A;  4G6Q A;  3KPH A;  4U0W A;  4M3E A;  2GBY A;  2UZK A;  1LFB A;  4BEH B;  5ICE A;  1XDS A;  1I6X A;  2Z1D A;  2DA7 A;  2EH3 A;  3GLX A;  1VND A;  3ECH A;  4C3H J;  4EJO A;  1G59 A;  1B9N A;  5FD5 A;  3F0C A;  2P8T A;  3I4N J;  2R7S A;  1ZKG A;  3CC4 I;  1Z7L A;  2LTP A;  4Y15 A;  1SC7 A;  2IS4 A;  1XCV A;  2L3D A;  5HS7 A;  3W2V A;  4E7Z A;  4U7B A;  1YW8 A;  2KL4 A;  3BJ6 A;  2LVS A;  3PIO F;  2OTL I;  4YFX F;  2BYV E;  4CCO A;  3OY9 A;  2EV0 A;  1IN6 A;  1QA6 A;  1KON A;  2JRT A;  2WBM A;  4WX9 A;  3SZP A;  5BS6 A;  4BBS J;  1XG1 A;  5IP9 J;  2MC3 A;  4D9J A;  3MFK A;  2O61 A;  5F6F A;  4RLQ A;  2A6T A;  2QSF X;  3JRF A;  1X1D A;  2WB1 N;  4IJA A;  2P5K A;  3ASN H;  2BHY A;  2Y0S A;  5TRD A;  5D8K B;  3V42 A;  2EFN A;  4OIO F;  4I09 A;  1BI2 A;  2XB5 A;  3PSI A;  3OV8 A;  1LNW A;  2OZ6 A;  2QKL B;  1VFC A;  1JTY A;  2R7X A;  2V1D A;  3NWT A;  4F92 B;  1K4T A;  4V2F A;  4QPQ A;  2FEZ A;  2X85 A;  3FHN A;  2JT1 A;  4Q4Z F;  4XRS A;  3BPX A;  4DW6 A;  3GVA A;  3JRI A;  1OYI A;  4FIS A;  2EIL H;  5D4S A;  3ZMZ A;  5HLH A;  4RB2 C;  1E17 A;  3KX2 A;  1WPK A;  3GTQ J;  4B43 A;  2EIN H;  3K6G A;  1XTA A;  3ZQI A;  2GXG A;  3LQR A;  5HOO A;  2KZG A;  2VIX A;  3FBI B;  4A3F J;  4IPA A;  1MDM B;  2E36 A;  3ZPL A;  1AA7 A;  3GX4 X;  4IOA F;  4NBQ A;  3C3W A;  4WWC A;  3FK7 A;  1OYY A;  1BJA A;  3ZQL A;  4X6A J;  1WGX A;  2BOL A;  5LEK A;  4NDL A;  3PQK A;  3BG9 A;  4UXN A;  3K1M A;  4A0Z A;  3CUQ B;  3SZG A;  4JYK A;  3S3O A;  1O3T A;  2LC2 A;  4M6X A;  2IS1 A;  3GW2 A;  2V26 A;  3BR5 A;  2L7Z A;  1ZHF A;  1X19 A;  2RV8 A;  2ZJQ F;  3IH2 A;  2UUZ A;  5DM7 F;  2E35 A;  2L01 A;  3DPU A; 
#chains in the Genus database with same CATH homology
 4XSX F;  4LD5 A;  3MZY A;  2IA0 A;  4ZYG A;  3ULQ B;  2WV0 A;  3HOS A;  2DTR A;  4WXC A;  2D45 A;  4EM0 B;  4R79 A;  1SMY F;  2UXN A;  4LLN A;  3P9I A;  1R5G A;  1R58 A;  3BRO A;  1YYV A;  3B02 A;  3DF8 A;  2FU4 A;  2FNA A;  2GA1 A;  4ZZD A;  2CO5 A;  3LFK A;  1XSD A;  2ADU A;  3DKW A;  3PFI A;  5FFZ A;  2X0L A;  1QQI A;  3TKY A;  1HST A;  2YX7 A;  2VC0 A;  4HX8 A;  1JHF A;  2XV4 S;  4O5V A;  4OMY A;  5LLQ A;  2IP2 A;  1A04 A;  2K02 A;  4ZZL A;  2DPU A;  2COM A;  3I59 B;  3BPV A;  5HDG A;  3EYI A;  1NHA A;  1YTY A;  4HW0 A;  3K1N A;  1UCR A;  1J0R A;  3VOD A;  1FSE A;  4IRI A;  2P4W A;  1W5T A;  3K2Z A;  3V7R A;  5K1Y A;  4RGS A;  3BWG A;  3L09 A;  4U88 A;  1SD6 A;  1BC8 C;  1IXR C;  3SQN A;  1P6R A;  2CGP A;  3ZMV A;  5CVJ A;  1ZG3 A;  3DPL C;  2VOO A;  4UVA A;  5AIQ A;  4BQA A;  4M71 A;  2HDC A;  2Z9O A;  4CDG A;  5LBQ A;  3WTU C;  2XAQ A;  1QZY A;  3WTT C;  2FE3 A;  2YX4 A;  2R7F A;  1H9T A;  3NRV A;  2STW A;  1ODD A;  2EV6 A;  5EEG A;  3ZMS A;  2KIM A;  2MH9 A;  1MJA A;  3VB2 A;  1ZN2 A;  3CO7 C;  1HW1 A;  2HKO A;  1ZRC A;  4MGR A;  3IWF A;  4HBL A;  3M9A A;  4BYY A;  2H6C A;  2L4M A;  1Z05 A;  2K4B A;  5F1R A;  1J2X A;  2YPR A;  3R0A A;  4OIR F;  1WKM A;  2OU2 A;  2L4A A;  2QLZ A;  2Q0O A;  1IXC A;  2PQ8 A;  4QWQ A;  1J7K A;  1BI3 A;  2HQN A;  3HTS B;  3H3Z A;  4S04 A;  1OMI A;  4Q48 A;  2KJC A;  3U2R A;  4K2E A;  3R4K A;  2W25 A;  3ISP A;  5CVU A;  4UVB A;  2IPQ X;  2FBI A;  5HS8 A;  2GXB A;  3RPQ A;  3R0J A;  5H20 A;  5L3F A;  1G3Y A;  5BQT A;  2UXX A;  4GO1 A;  5CVI A;  1REP C;  3EET A;  1JHH A;  1MJB A;  4EJV A;  3ZMT A;  2PBI A;  3E6B A;  5E20 A;  1RUO A;  5ILV A;  4UNO A;  1S6L A;  4HQM A;  4LK1 F;  1J9I A;  3ELK A;  3M8E A;  3BP8 A;  5LRS A;  4HF1 A;  4EV0 A;  5D5U B;  1XSX A;  1B6A A;  2DBB A;  1ONV A;  2GQQ A;  1U8R A;  2R7D A;  4HZF A;  3FMS A;  4O6J A;  1MZB A;  4ON0 A;  2TDX A;  2PMU A;  4I02 A;  5JFR A;  3R60 A;  2MBF A;  2Z3Y A;  1P92 A;  4N9I A;  1GXP A;  5EEH A;  3FXR A;  4ENN A;  2IW5 A;  3IKV A;  1R1U A;  3DPT A;  5D8L B;  1FYL A;  3LAJ A;  3I58 A;  1R7J A;  1IF1 A;  2WC2 A;  1BM9 A;  1D5V A;  3I54 A;  1XGN A;  2IJL A;  1FY7 A;  1KU3 A;  5D6F A;  4LG0 B;  1ZG1 A;  4HF0 A;  2BGC A;  2VC1 A;  3CDH A;  3WTW C;  5E1X A;  3KZY A;  4BHB A;  1DPR A;  3T1B A;  2CFX A;  2M5W A;  3F72 A;  5JR3 A;  3WGH A;  4ZYH A;  5FO5 A;  5ED4 A;  4CIC A;  2DLL A;  1GHC A;  4HLX A;  1BI0 A;  5ICG A;  3N4M A;  2HTJ A;  4N0B A;  2O03 A;  2M8E A;  2NNN A;  3K9T A;  3J80 K;  5D5X B;  1FP1 D;  5D4R A;  2XGX A;  3KLN A;  3BZ6 A;  4G7Z F;  4RS8 A;  1QNT A;  4HDV A;  4ENJ A;  2CWE A;  3C7J A;  2ZJ2 A;  2HZT A;  1HSJ A;  2DU9 A;  3QU3 A;  1U5T B;  3EDP A;  4LK0 F;  2Z99 A;  1XCB A;  3QP6 A;  1EH8 A;  4GYI A;  2IT0 A;  3LAP A;  1K78 B;  3MCZ A;  4HDU A;  1HKQ A;  2P7C B;  5LHI A;  3GFM A;  1DUX C;  5BMZ A;  1F9N A;  4AIK A;  3ERE D;  3DP7 A;  3HHH A;  1T0F A;  1G4D A;  3NQO A;  3J81 Z;  3FX3 A;  1QBJ A;  1K7A A;  5L3C A;  2DW4 A;  5ERI A;  3H92 A;  2O0Y A;  3FWE A;  2AXL A;  1D8J A;  1CF7 B;  2DK5 A;  4HX4 A;  4KN4 X;  4MEY F;  4M6Y A;  2F5E A;  2IRF G;  2YR2 A;  2FSW A;  2OBP A;  1JGS A;  4I7H A;  3SFZ A;  2GZW A;  3ML6 A;  3E5Q A;  4L9T A;  1KYZ A;  4B09 A;  4KIF A;  4R1H A;  2E7W A;  2OZU A;  2XRO A;  3RJP A;  1B4A A;  2V9V A;  2BEO A;  2FNP A;  1RNL A;  2HYF A;  2QBY B;  3JTH A;  1E2X A;  4HV6 A;  5DCM A;  1L3L A;  2E1N A;  4DNC A;  1I5Z A;  4ESF A;  5ICC A;  2XKP A;  3N97 A;  1KQ0 A;  1V3F A;  5JI6 A;  3QU6 A;  2FML A;  5IT9 K;  1PP8 F;  2PLY A;  1KGS A;  3SZT A;  3GUD A;  3F6O A;  5L3G A;  1ZGA A;  3BJA A;  4U0Y A;  1LEA A;  5LRR A;  5DV5 A;  2VN2 A;  3E3V A;  4RGX A;  1W7P B;  3HOT A;  2A61 A;  4OIP F;  3HSE A;  3E5X A;  3RKW A;  1LQ1 A;  1XB4 A;  4LJZ F;  1Z7U A;  2HOE A;  2PG4 A;  3KFW X;  5HVQ C;  3MWM A;  2RC4 A;  2PN6 A;  2A69 F;  5E17 F;  4CZZ A;  1HW2 A;  1ZYR F;  3U9G A;  3TO9 A;  3KZZ A;  3BY6 A;  1ZAR A;  2FF4 A;  3F8N A;  4P55 A;  1JE8 A;  5HDN A;  4EVI A;  2HFH A;  3IWZ A;  4I2O A;  2F5C A;  3J80 Z;  4G7H F;  3J7A O;  3P9C A;  1IAW A;  5BPD A;  1S8N A;  1RZ4 A;  3IL2 A;  4LFU A;  1CGP A;  3COA C;  3U1D A;  2V1X A;  3W6J B;  2CQK A;  3KP5 A;  1YW9 A;  1I1G A;  1FOK A;  1FSH A;  2MA3 A;  4UVC A;  2X4H A;  2EV5 A;  2P7V B;  3I71 A;  2G9W A;  2XAH A;  3F8F A;  3GEZ A;  1LB2 A;  5HLG A;  3FXQ A;  3ZN1 A;  2FBK A;  5L3E A;  2JSC A;  3KP6 A;  2EA2 A;  1FX7 A;  2H94 A;  3WU0 A;  4XSZ F;  4EGY A;  3GXO A;  3DFG A;  3KP2 A;  3HRU A;  3CUO A;  1OKR A;  1IN8 A;  3ZMD A;  3W6K B;  1BIB A;  3V8J A;  2YU3 A;  2A6H F;  2ZME A;  5AIP A;  2EA4 A;  4ESJ A;  1IW7 F;  2F5D A;  4KIG A;  3VFZ A;  2J5O A;  3LST A;  3K1P A;  1X3U A;  5H6R A;  4OIN F;  3GFI A;  4RGU A;  4HAM A;  1ON2 A;  2D2W A;  2XKO A;  4Y17 A;  1O3R A;  2KIU A;  4NHJ A;  2STT A;  3E97 A;  4L9J A;  2MLK A;  3VEP A;  1LVA A;  1RIO H;  3QPH A;  4G6D A;  1HW5 A;  3ABU A;  4S05 A;  1D8K A;  2M45 A;  4MQV A;  3RPU A;  2LDU A;  1R1T A;  2QQA A;  4AIJ A;  4BAY A;  1ZRD A;  3WE3 A;  3Q9V A;  2HR3 A;  4H0E A;  5CVR A;  5LHH A;  4WXH A;  2ETH A;  2FBH A;  1Z6R A;  1BC7 C;  2PMH A;  1USS A;  4CXF A;  2PJP A;  1GVJ A;  2LF8 A;  3K0L A;  4WXD A;  1DP7 P;  4KA4 A;  1SAX A;  3AAF A;  1G3T A;  2EFP A;  3JSO A;  2FQ3 A;  1S7A A;  2RNJ A;  4PCQ A;  1JXS A;  2EB7 A;  4KT5 C;  2UWM A;  1TNS A;  3Q5F A;  1SFE A;  5LGN A;  3WE2 A;  2ZCW A;  3IKT A;  4CHU A;  3FM3 A;  1SD7 A;  1BIA A;  2CYY A;  2VBW A;  3D0S A;  4EM2 A;  1KU9 A;  1EH6 A;  2HTS A;  2LKP A;  3L7W A;  2Y0M A;  4E70 A;  1LDD A;  1Z6T A;  4YG2 F;  4EJW A;  2BE5 F;  1MDM A;  1O57 A;  4U0V A;  4YIF A;  1O7L A;  2Z5U A;  4JQF A;  3F3X A;  2YSR A;  2HS5 A;  3CUQ A;  1RUN A;  4Q5S F;  1YW7 A;  1FPQ A;  4MNU A;  2NYX A;  5LHG A;  2VOD A;  2VT2 A;  1L0O C;  2VXZ A;  5LGT A;  4PZJ A;  5K5Q A;  3B73 A;  1U5T C;  4IHT A;  4LLG F;  1TQI A;  2O3F A;  4L18 B;  4HYE A;  2IVM A;  2CG4 A;  5CVV A;  4RAZ A;  2MD5 A;  1S29 A;  4RGR A;  3F6V A;  1BOA A;  1EH7 A;  5DCM B;  5DYM A;  3TGN A;  2W85 A;  2HGC A;  2P6S A;  3GO5 A;  1TW3 A;  3VOE A;  5J8F A;  2VE9 A;  1WSU A;  4M9Z A;  3WTZ A;  5FD6 A;  1P4A A;  1QPM A;  1IZ1 A;  2K7L A;  3K69 A;  2ZBK A;  4R8H A;  3TO6 A;  3GFL A;  5E8I A;  4RAY A;  4ZYE A;  3HRM A;  2MLG A;  4HA8 A;  2IA2 A;  2ZNZ A;  2LSO A;  3HIF A;  1ZGJ A;  3PQJ A;  1WRJ A;  1LJ9 A;  1S7O A;  2J5P A;  3I59 A;  1PUE E;  1ULY A;  2F5F A;  4OMZ A;  3FMR A;  2GA2 A;  2CW0 F;  3D5L A;  2HWV A;  1QZZ A;  2EFW A;  1F1Z A;  4XBF A;  4GGG A;  1H0M A;  1YIO A;  2A07 F;  4O3M A;  2GAU A;  1U2W A;  2ISY A;  2LF7 A;  4CYD A;  4UV8 A;  1OR7 A;  1SMT A;  1ZH5 A;  5JHU A;  1OPC A;  4UHT A;  2E1C A;  3RKY A;  2GWR A;  1YQA A;  1S3J A;  1T39 A;  4GYG A;  1G6N A;  2OQG A;  4HX7 A;  4LMY A;  1PP7 U;  1J59 A;  3WTX C;  5E1W A;  2M30 A;  3TDZ C;  3V8L A;  1KQ9 A;  4AWX B;  1YO5 C;  1SFU A;  4QLC U;  3RDI A;  3M7G A;  1T38 A;  1IUY A;  1D3Y A;  1T2K A;  5F64 A;  4A5M A;  4I01 A;  1RI7 A;  2KKO A;  4XLN F;  1Z1D A;  2P5L C;  1IRF A;  4FHT A;  3FMQ A;  3ZQ7 A;  3KP4 A;  2DQR A;  3Q9S A;  4IXA A;  4MEX F;  1YFH A;  5ILS A;  4JBA A;  4WK8 F;  4AVP A;  5DD4 A;  4LLL A;  3QPT A;  3RIR A;  2H6B A;  2NAZ A;  2FMY A;  2ZNY A;  3QRF F;  4CO8 A;  3MAJ A;  5FLX K;  4BH9 A;  5DCF A;  3CUQ C;  2PEX A;  4LB6 B;  1ON1 A;  3LA2 A;  2V6C A;  2DK8 A;  3T5X A;  2K27 A;  2P6T A;  4HOB A;  3HTU A;  2RN7 A;  3LA3 A;  1W4M A;  4TV7 A;  1TQP A;  3P7N A;  1O7F A;  5HLI A;  1MKM A;  3RI4 A;  1WQ2 A;  1IRG A;  2JZY A;  6PAX A;  1I1S A;  2EJR A;  2XUB A;  4EGZ A;  3F8C A;  3JW4 A;  2RKH A;  2XAJ A;  1SFX A;  3HSF A;  1B59 A;  3WU1 B;  1FNN A;  3S2W A;  2W57 A;  1I27 A;  4P96 A;  4I0B A;  3ZN0 A;  4FX4 A;  2QM3 A;  3KET A;  2QUF A;  1ZRF A;  1MGT A;  3M8F A;  1LEB A;  4DQ2 A;  1T6S A;  5D5W B;  2C6Y A;  3L9F A;  5CYV A;  5D5V B;  5E8G A;  1R22 A;  3F23 A;  3I0T A;  2XRN A;  3WTS C;  2RDP A;  1UFM A;  1OYW A;  4MTE A;  1MJ9 A;  1FBQ A;  1TTY A;  1FP2 A;  3RKX A;  1FZP B;  3T0Y A;  1SD5 A;  1P2F A;  2KJB A;  4KMF A;  4YII A;  5HDK A;  1KYW A;  1ZAO A;  4P5O A;  1TLH B;  4Y13 A;  1FC3 A;  1UB9 A;  2VT3 A;  4WF2 A;  2Y48 A;  2A3S A;  2P5V A;  3ECO A;  2ELH A;  2A5Y B;  3C1D A;  4ENK A;  3F21 A;  1K6O A;  2HKX A;  2V79 A;  3P9K A;  1BBY A;  4LG0 A;  3JAM K;  2DT5 A;  4L9N A;  3FF5 A;  4MHG A;  1IN7 A;  4A6E A;  3E5U A;  2BV6 A;  3FXU A;  1KU2 A;  5A2Q K;  3F8M A;  4P9U A;  2ZFW A;  1XMA A;  3IRQ A;  2CSO A;  2DQL A;  4NQW A;  4WCG A;  5D6E A;  3I64 A;  2FOK A;  3TOA A;  1PDN C;  3LWF A;  3TDU C;  1QGP A;  1U6G A;  2XHK A;  4P9F A;  1P4W A;  2KRF A;  2RVC A;  4ENM A;  5K5R A;  3G3Z A;  5CLS A;  2O8X A;  1YS7 A;  2RQP A;  2XAF A;  3T8T A;  1AWC A;  1KA8 A;  5JVT A;  2HEO A;  2V1U A;  4FT8 A;  1U5T A;  4D0P A;  1FLI A;  1FBS A;  2H09 A;  2MH2 A;  4AIH A;  4YFN F;  4UUV A;  2JTV A;  2VE8 A;  3MZH A;  1XDU A;  3GWZ A;  2OA4 A;  3C18 A;  3M1E A;  1K78 A;  2XVC A;  1V4R A;  4ASN A;  3ZP5 A;  1VTN C;  4G94 A;  3HYI A;  5ICF A;  3BOQ A;  3HUG A;  2XAS A;  2ISZ A;  4IHS A;  5ILU A;  4KN7 X;  4N9H A;  4PGH A;  5LGU A;  1FWZ A;  2A6E F;  3E6D A;  2ZKZ A;  1W5S A;  4EQQ A;  4KFC A;  3R6S A;  4XRF A;  5FLX Z;  3FM5 A;  4KIB A;  1Q1H A;  4ETS A;  4M9X A;  3HRT A;  2FXA A;  1XGS A;  4A6D A;  1CF7 A;  4UV9 A;  3SHF A;  4BXU A;  4I98 B;  1B1B A;  1O3S A;  2QQB A;  2G7U A;  3IC7 A;  1K79 A;  5FB2 A;  4LGW A;  1LDK B;  4KUM A;  5DEQ A;  5H6Q A;  4MTD A;  5E18 F;  4A2U A;  4G8X A;  2QVO A;  5DD8 A;  4RB3 C;  5L3D A;  2NS0 A;  3EQL F;  4OOI A;  3ROU A;  1Z91 A;  3RYP A;  2E7X A;  3L2C A;  3WG9 A;  3OOP A;  2QBY A;  3V7C A;  2EFO A;  1HBX G;  3ZMU A;  2PI0 A;  4Z2Y A;  1XGO A;  1B9M A;  2O6G E;  1FBU A;  5IT9 Z;  1BI1 A;  1U78 A;  2EK5 A;  3QP5 A;  5IT3 A;  1FYM A;  5J8C A;  3LQQ A;  4M73 A;  4F7Z A;  4BHC A;  4L9V A;  3JTG A;  2DI3 A;  3L00 A;  2B0L A;  3QAH A;  5AON A;  2K4J A;  2F2E A;  5DUI A;  3LA7 A;  4M74 A;  4EJU A;  2RGV A;  1W7P A;  4IVN A;  4XLP F;  2QWW A;  1R36 A;  3DXJ F;  4I0A A;  2W84 A;  2DFI A;  2QQ9 A;  4EMS A;  4IF4 A;  2XAG A;  1BN5 A;  1J5Y A;  3GF2 A;  4EM1 A;  3TOB A;  4AD9 A;  4A12 A;  3JAM Z;  1AOY A;  4KYW A;  4G7O F;  4PGG A;  3CTA A;  4ESB A;  3GZ5 A;  3J81 K;  4FX0 A;  2JPC A;  3GZ6 A;  1XD7 A;  4B8X A;  2QEN A;  1Y0U A;  4RB0 A;  3RYR A;  3GYH X;  3I4P A;  2HQR A;  5A2Q Z;  4Q47 A;  2H27 A;  1R5H A;  5LEJ A;  3DEU A;  4ZH4 F;  1IN5 A;  1FYK A;  2QZ8 A;  2R3S A;  2VBX A;  4L0Z B;  3HHG A;  5J6X A;  2OAZ A;  3TO7 A;  4HQE A;  3EUH A;  1Z9C A;  1ZLJ A;  3F22 A;  1F5T A;  4KIC A;  2K86 A;  3WGG A;  4MQ9 F;  2A68 F;  4PDK A;  3CJN A;  3KEO A;  3MEX A;  1UST A;  1J75 A;  4L5J A;  2HYG D;  3HRS A;  2VBZ A;  3CO6 C;  2ZO4 A;  3F8B A;  4CGZ A;  2VBY A;  3V7S A;  3CLO A;  1GXQ A;  4M72 A;  2ZXJ A;  1QO0 D;  3E6C C;  5KK1 A;  2PFB A;  3T8R A;  3GFJ A;  1U3E M;  1XSV A;  3V8K A;  2FRH A;  2W24 A;  2AS5 F;  1H9G A;  5BOX A;  1HKT A;  1F4K A;  5DUK A;  4G9Y A;  2BBY A;  3QOP A;  1UHW A;  1O3Q A;  2DPD A;  3E6M A;  3I53 A;  1FT9 A;  1HQC A;  4GCV A;  1TNT A;  4ZYD A;  4IRH A;  4A0X A;  4LB5 A;  2D1V A;  2EFQ A;  3KLO A;  2QYO A;  5KVR A;  1ZRE A;  3O6B B;  3KE2 A;  1W7P D;  1G3W A;  3H3U A;  3REO A;  2Q2E A;  3ABT A;  4OU0 A;  3V4G A;  2Q8K A;  2NRA C;  1SD4 A;  2LNB A;  2NNY A;  2FA5 A;  3MQ0 A;  3DV8 A;  2IA1 A;  2OQR A;  3JSP A;  2Y75 A;  2L02 A;  2VOP A;  1YG2 A;  5E1Z B;  1IN4 A;  4KNY A;  3WTV C;  2DO7 A;  2JPB A;  3WTY C;  3RTR A;  4YFK F;  3NEU A;  2VON A;  1KU7 A;  4A5N A;  4HF2 A;  1MD0 A;  1YLF A;  4M9S A;  1C0W A;  4OIQ F;  1LDJ A;  3IHU A;  4IRG A;  3BDD A;  1KQ8 A;  3O2P E;  4BHP A;  1T98 A;  5FGM A;  3SXY A;  2M87 A;  3DQV C;  1STZ A;  4EJT A;  5CJ9 A;  1EV7 A;  1TQM A;  1DDN A;  4JK1 X;  2WWY A;  5FFX A;  5K5O A;  3O3K A;  2WTE A;  3KCC A;  2D1H A;  2M1B A;  3G73 A;  3BJO A;  1XMK A;  4U7D A;  1WWX A;  2DAO A;  3I5U A;  3HSR A;  1TW2 A;  3R61 A;  5L3B A;  1R00 A;  3FZV A;  4HV5 A;  4A0Y A;  1DPU A;  3FHZ A;  2ESN A;  5HS9 A;  2ESH A;  2ZME B;  1UHM A;  2XIG A;  1XGM A;  3EYY A;  3WOD F;  3WGI A;  4RB1 A;  1XN7 A;  1YS6 A;  4BNC A;  4KDP A;  4L5I A;  4GXO A;  1R23 A;  2G7H A;  1ZG5 A;  2GIV A;  3IRR A;  2ACJ A;  1HKS A;  1G3S A;  1TBX A;  1ZLK A;  5DDG A;  4L0Y B;  1R1V A;  3KP7 A;  2Z33 A;  2L54 A;  1HXD A;  1P4X A;  2EWN A;  4KMU X;  1IXS B;  4HLY A;  1WI9 A;  2OD5 A;  4NB5 A;  3KEQ A;  3TQN A;  2KIF A;  3KP3 A;  5TJJ A;  5BPI A;  4G6Q A;  4U0W A;  2UZK A;  5ICE A;  1XDS A;  1I6X A;  3GLX A;  3ECH A;  4EJO A;  1B9N A;  5FD5 A;  2P8T A;  4Y15 A;  1XCV A;  2L3D A;  5HS7 A;  4U7B A;  1YW8 A;  3BJ6 A;  4YFX F;  2BYV E;  2EV0 A;  1IN6 A;  2JRT A;  4WX9 A;  3SZP A;  5BS6 A;  2MC3 A;  2O61 A;  3MFK A;  5F6F A;  4IJA A;  2P5K A;  5TRD A;  5D8K B;  2EFN A;  4OIO F;  4I09 A;  1BI2 A;  3OV8 A;  1LNW A;  2OZ6 A;  2V1D A;  2FEZ A;  4Q4Z F;  2JT1 A;  3BPX A;  3GVA A;  1OYI A;  5D4S A;  3ZMZ A;  5HLH A;  4RB2 C;  1E17 A;  2GXG A;  3LQR A;  5HOO A;  4IPA A;  1MDM B;  3ZPL A;  3GX4 X;  3C3W A;  4WWC A;  1OYY A;  1BJA A;  5LEK A;  3PQK A;  4UXN A;  3K1M A;  4A0Z A;  3CUQ B;  1O3T A;  4M6X A;  3GW2 A;  1ZHF A;  2RV8 A;  2L01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...