1F4KA

Crystal structure of the replication terminator protein/b-site dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication/dna
molecule keywords 5'-D(*CP*TP*AP*TP*GP*AP*AP*CP*AP*TP*AP*AP*TP*GP*TP*TP*CP*AP*
publication title Structure of the RTP-DNA complex and the mechanism of polar replication fork arrest
pubmed doi rcsb
source organism Bacillus subtilis
total genus 43
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f4kA00
4L9JA 2W85A 3KFWX 3M1EA 2IA0A 3VOEA 1Z91A 1GXPA 1TTYA 4N9HA 1BBYA 2EB7A 3ISPA 2X0LA 4FT8A 3N97A 3WTTC 2P7CB 1YG2A 3I64A 4KIGA 1HW5A 4P5OA 4K2EA 2A61A 5J8FA 2E1NA 4IPAA 1G3TA 4NHJA 1DDNA 5HS7A 4FX4A 3MZYA 2Y48A 4G94A 1XCBA 3EDPA 3COAC 1ZYRF 1LNWA 3QPHA 2IA2A 3R61A 1J75A 3LFKA 3IKVA 2MH2A 2ZJ2A 3BPXA 2M5WA 1R1UA 2OZ6A 4NQWA 1SFXA 5BQTA 3G3ZA 4ZYGA 1F9NA 5DV5A 4YFXF 3E5UA 4DQ2A 1V4RA 3C3WA 2GXBA 3F6OA 1KYWA 3K1MA 5DDGA 4IRGA 3T5XA 2BV6A 1V3FA 4CICA 3I54A 1Z6TA 3KP5A 3RDIA 1TNSA 3M8FA 5CVJA 4Q5SF 5HDNA 4F7ZA 1FY7A 3FXQA 1H9GA 1KU7A 3DKWA 4HX7A 2OU2A 1IXSB 1R00A 2O3FA 2R7DA 3F8CA 4UNOA 5D5VB 5ERIA 5DYMA 3BP8A 2P6TA 1D5VA 1BJAA 3K2ZA 3LA7A 3PQJA 3QU3A 1T0FA 4EGZA 2IW5A 4A5NA 2Y0MA 2QQ9A 3F21A 3KP3A 2FEZA 3VB2A 1I6XA 3ZMDA 1QZYA 3W6KB 1MKMA 3HSRA 2EFQA 3V8LA 3PFIA 3GXOA 4LLLA 2IRFG 4G8XA 5K5OA 1KQ8A 2COMA 1IXCA 3HIFA 1XSVA 1QNTA 2A5YB 2HKXA 3DPTA 2ZKZA 2P8TA 3CUQA 4E70A 3K1PA 5FLXZ 4TV7A 3E6DA 3R0JA 2F5FA 2OBPA 2P6SA 4A6DA 2XROA 2JTVA 2ADUA 3HSFA 2QVOA 3L00A 1HQCA 1Z9CA 4JK1X 1XDSA 3HUGA 3WE2A 3WTVC 2HQRA 5HDKA 2EV6A 2GWRA 3V8JA 3HHGA 1LB2A 1XMKA 4LLGF 1RZ4A 1D8KA 2EFOA 2MA3A 1KQ9A 2XKPA 1IN8A 3K69A 4YFKF 1UFMA 3TOBA 2P4WA 4OMZA 5LGUA 2A3SA 3IC7A 2PJPA 5D4RA 1R22A 1CGPA 5K5RA 3T1BA 1UHWA 5CVRA 2CQKA 4LG0B 3ZN1A 2HEOA 1C0WA 1R1TA 1U3EM 4P9UA 4HF0A 4O3MA 1H9TA 1K79A 5J8CA 2QWWA 3GF2A 3I71A 3GX4X 5CVIA 3OOPA 1UB9A 2V1DA 3GFJA 1TW3A 2ZCWA 3W6JB 3R4KA 1EH8A 2GQQA 5LHHA 4M72A 3BOQA 4MGRA 3IHUA 4U0YA 4P9FA 3I59A 5TJJA 2YU3A 5HLIA 2M87A 3VFZA 3EQLF 3CUOA 2VOPA 2EFNA 1W7PB 4HQEA 1K6OA 2WTEA 1T98A 2JRTA 2M1BA 3H92A 1U2WA 1TW2A 5J6XA 2M8EA 1HKSA 4Y13A 1IRGA 3T8TA 1U8RA 1FT9A 1SFEA 4GCVA 3TKYA 1YQAA 2FBKA 3LAPA 3WTSC 1KA8A 1D3YA 3VEPA 5CYVA 2OD5A 3HRTA 4EJOA 1O3QA 2STTA 1U6GA 3GUDA 1STZA 4KYWA 5DD8A 4ON0A 4BYYA 2MC3A 1LDJA 2XAJA 1PDNC 5LRRA 3J81Z 4LG0A 1T6SA 4RAZA 1KGSA 5LBQA 1P92A 4B8XA 4OOIA 5KVRA 3E6CC 3OV8A 1IXRC 3L2CA 3FHZA 3WODF 2L54A 2V1XA 4G7ZF 2HWVA 1W5TA 4KN7X 4L5JA 4O5VA 2CO5A 4EM0B 5F64A 4EJTA 4KIFA 1FYMA 4Q47A 3GFIA 1ZLKA 5JI6A 3KLNA 3IWFA 4EV0A 4RB3C 1NHAA 4A0XA 1Z05A 1F5TA 1O57A 2FMLA 3FXUA 2EA4A 2BGCA 4MHGA 4ZZDA 4RGUA 2CFXA 3HRUA 5FLXK 3GW2A 5AONA 2VBZA 5L3DA 5BMZA 1XGOA 1ODDA 3V7CA 3QU6A 1KQ0A 2XIGA 4BHBA 1S29A 5IT9K 4WXDA 3QAHA 4I02A 2KIUA 5ICCA 2D2WA 2DI3A 4M9XA 3TGNA 1XGNA 4HX8A 3C18A 2QYOA 2D1HA 4LGWA 3JTGA 4KN4X 4GYGA 4NB5A 2VOOA 2JPCA 5DUIA 3EYIA 3S2WA 1IAWA 4YIFA 4XRFA 2VBYA 2Q8KA 4BAYA 1YW8A 2QBYA 2NNYA 3TO6A 4N0BA 2RDPA 2X4HA 2XRNA 4PGHA 1YS6A 2XHKA 1QZZA 1O3RA 2MLGA 2Z5UA 3ZMZA 1R58A 2E7XA 2V1UA 1MJAA 1HSJA 5LHIA 1XDUA 1KU2A 5CLSA 2ZNYA 1LVAA 4ENMA 1J59A 3TO9A 1AWCA 5E8GA 3KZZA 1TQMA 2QQBA 3R6SA 2Z33A 4L0YB 5LGNA 1XMAA 2M45A 4MTDA 1SD5A 2JPBA 2FRHA 1P4WA 1YS7A 2XASA 1KYZA 5D8LB 4KMFA 3MFKA 5K5QA 4L9NA 1ZARA 3MAJA 5AIPA 3WU0A 2KJBA 5BOXA 2FF4A 3BY6A 1XB4A 1JHHA 2DO7A 1IN7A 1W7PD 1O7FA 1D8JA 3KP4A 2KIFA 1G4DA 4M73A 5FB2A 4RB0A 1ZG5A 1S8NA 4MTEA 1J5YA 2RC4A 4MNUA 3B73A 5LLQA 2VC1A 2J5PA 2M30A 1FBSA 3K1NA 3M7GA 2YX7A 3Q9SA 4LMYA 3J81K 4L9VA 1ZG1A 3PQKA 3FMSA 3ML6A 3Q9VA 1RIOH 4EJVA 4YG2F 3HRMA 3P7NA 3JAMZ 1T2KA 3M8EA 5LHGA 5LEKA 3F22A 2F5EA 4KFCA 2ESHA 4CXFA 3ABTA 3CUQB 1GHCA 4GYIA 3FWEA 2AS5F 3E5QA 1EH7A 3Q5FA 2OQRA 3DF8A 4HZFA 5L3BA 3GFLA 2JSCA 1J7KA 4LFUA 2V79A 4CYDA 2EFWA 1RI7A 3SXYA 4M9SA 2RNJA 2OZUA 3F8MA 1KU9A 4M6YA 3D0SA 1RNLA 4R1HA 3IKTA 3BDDA 1P6RA 2ZXJA 5ED4A 2AXLA 2G7UA 4UVAA 4G7OF 3I5UA 2E1CA 2NS0A 3DEUA 2O0YA 1WI9A 3ULQB 2NRAC 1Z7UA 3H3ZA 4WCGA 3SZPA 2HOEA 3KETA 3F72A 2MBFA 2ZFWA 1O7LA 1B6AA 3IRRA 2NYXA 1Q1HA 2ELHA 4KDPA 2UWMA 2KRFA 5JR3A 3MEXA 1J9IA 2DPDA 4EM1A 1ZRDA 5TRDA 2RV8A 3ECOA 5LGTA 1FYLA 1J0RA 1YYVA 1MJ9A 3FZVA 3JSOA 2ETHA 2PBIA 3ERED 4OMYA 3I59B 4EMSA 1IN6A 3MWMA 4I0AA 1DPRA 4M6XA 3JSPA 2DK8A 1IF1A 3K9TA 1CF7B 3KEOA 4BHPA 1SAXA 3LQRA 2OQGA 1FX7A 1F4KA 4IXAA 2DTRA 2DW4A 3J80K 2XAGA 2G9WA 1LJ9A 3NRVA 4FHTA 4A12A 3AAFA 2HS5A 3P9CA 3N4MA 1HXDA 2GAUA 4OIOF 4XLPF 2BBYA 1ZGJA 3KP7A 2G7HA 4U7BA 1JE8A 2O8XA 4HLXA 1HSTA 1WRJA 3RYRA 2YR2A 2VC0A 5DEQA 3TO7A 2VBXA 2DBBA 1FC3A 1OYYA 3RKWA 3LQQA 3ZMVA 4A5MA 1S7AA 4PCQA 4ENNA 2PEXA 4IHTA 1U78A 1BM9A 1IN4A 4WX9A 1B1BA 4AIKA 3FX3A 4WXHA 3QP6A 1TNTA 2TDXA 1U5TA 4U0WA 3TDUC 4I2OA 5DCFA 5FFXA 3WG9A 2EV0A 3HYIA 1YLFA 3GVAA 3L09A 3E6BA 1USSA 3WU1B 1L3LA 1S7OA 4RAYA 4MEYF 5E1ZB 2Z3YA 3I4PA 1O3SA 1H0MA 4I7HA 4IHSA 5D8KB 5HLHA 4BQAA 3BROA 4ENJA 3CJNA 1CF7A 2FSWA 4G9YA 3I53A 2XKOA 3JAMK 1IN5A 3ZPLA 4HAMA 2QM3A 3SQNA 1ON1A 4WF2A 1ULYA 5E20A 2IP2A 3ZQ7A 1J2XA 4LB5A 3JW4A 3P9IA 2ESNA 4GXOA 2PG4A 2FBHA 1QO0D 2J5OA 4ZYEA 3R60A 4XBFA 4CDGA 4QLCU 2UXXA 4LLNA 1FNNA 1YTYA 2K27A 2IPQX 4HV5A 1YFHA 3I58A 1SMYF 1DP7P 2XV4S 2DQRA 2KJCA 2DLLA 2ZNZA 1R23A 3WGGA 2FBIA 1OYIA 1SFUA 3RI4A 3LSTA 2P7VB 3I0TA 3C7JA 3LA3A 4IRHA 2XAQA 2W84A 2QBYB 1Z1DA 4UUVA 2XGXA 5JFRA 1OPCA 1SD4A 3WTUC 1G3YA 5D5UB 2GIVA 3K0LA 3H3UA 3BJOA 3C1DA 1XN7A 4EVIA 5ILUA 2EWNA 3DQVC 2QZ8A 2BEOA 4ESBA 5A2QZ 1MD0A 3BJ6A 2R3SA 5KK1A 3QOPA 1FSHA 5HDGA 5L3EA 2LF7A 4UXNA 2XVCA 2ZBKA 1XGSA 4Z2YA 4ZZLA 3EUHA 3HOTA 2GA1A 1S6LA 4MEXF 4AD9A 4KMUX 5E1XA 2V9VA 2A6HF 1SD6A 1MDMA 4EM2A 2CYYA 4BNCA 4N9IA 5DD4A 3CLOA 2VE9A 2O03A 2HKOA 4KNYA 2JT1A 5ICFA 4ENKA 4Y15A 5CJ9A 2DPUA 2A68F 1EH6A 2EV5A 4ETSA 2CG4A 1MZBA 5CVVA 3WTYC 2L01A 1ZN2A 3QPTA 2GXGA 3O6BB 4BH9A 2EK5A 2ISZA 1YO5C 4UV8A 1Y0UA 3RPQA 1JHFA 1BI2A 2RN7A 5DUKA 1WKMA 2W25A 3F8BA 1B9NA 4Q48A 1I5ZA 1I1GA 1P4XA 4XLNF 2QQAA 5AIQA 2QLZA 3KCCA 2PMUA 4LD5A 4OINF 2P5VA 1MGTA 1TLHB 3KEQA 2WWYA 4GGGA 3GO5A 1T39A 5H6RA 3ZMTA 4R8HA 1IZ1A 5D5WB 1TQIA 3RYPA 1QPMA 2OA4A 4L5IA 1R1VA 3ROUA 3TQNA 4S04A 2YX4A 3BJAA 1FP1D 3HRSA 3B02A 2ZO4A 4UHTA 4ESFA 4I0BA 2RGVA 4JQFA 2O61A 2ZMEB 1BI1A 3QP5A 3IL2A 4CO8A 2XUBA 2QUFA 5ICEA 1FBQA 1XCVA 3MCZA 2GA2A 2H27A 2V6CA 3IWZA 4ZYHA 1HW1A 1REPC 2H09A 3RKYA 4HDUA 1GXQA 2FA5A 1BI3A 4UV9A 2VT2A 3SHFA 1FSEA 4B09A 5IT3A 1ZAOA 4HX4A 3WE3A 2PQ8A 4RGRA 4WXCA 5LEJA 3RIRA 2HDCA 1ZH5A 3GZ6A 3FF5A 4LK1F 2H6CA 3GLXA 3FM5A 3E6MA 1FZPB 1I1SA 3V8KA 4RB1A 3DPLC 5HS8A 4AIJA 2F5DA 2P5KA 2XAHA 2HFHA 1XSDA 1ONVA 2VXZA 1K78B 3ZMUA 1LDDA 2VN2A 1YW7A 3WTZA 5EEHA 1FWZA 2LF8A 2E7WA 1G6NA 2PLYA 1OYWA 2HGCA 5E1WA 3DFGA 2YSRA 4MQVA 3WTXC 2LKPA 4HOBA 3U9GA 3HOSA 2K4JA 3G73A 3KZYA 3D5LA 3NEUA 3R0AA 4I01A 2EJRA 5F1RA 1UHMA 2JZYA 5A2QK 2DT5A 6PAXA 3IRQA 2Z99A 1HW2A 2FXAA 4EGYA 2ZMEA 4JBAA 1B4AA 1FLIA 2L4MA 5ILSA 1HBXG 1UCRA 4ASNA 5E8IA 1EV7A 1ZG3A 1ZLJA 4KICA 1B59A 4L0ZB 3CO6C 2IVMA 4EQQA 5K1YA 4HA8A 3RTRA 3FM3A 1X3UA 4UVBA 3JTHA 1KU3A 2HR3A 2KIMA 2XAFA 4M71A 3U1DA 1O3TA 2IJLA 4QWQA 2WC2A 2A07F 5D4SA 2R7FA 1K7AA 3E5XA 4U7DA 4A0ZA 1U5TB 2MH9A 5H20A 5JHUA 2LSOA 1E2XA 4L9TA 4BHCA 4CGZA 1K78A 1QGPA 2L02A 1LDKB 4KA4A 4ZYDA 1RUOA 3ELKA 3BZ6A 4XSZF 2PFBA 3U2RA 4HDVA 1MJBA 3ECHA 3KLOA 5E18F 3HTSB 4PZJA 5FO5A 4G6QA 5F6FA 3WTWC 3FXRA 1DPUA 2DAOA 2RVCA 3T8RA 4RGSA 2QENA 4KUMA 4HF1A 1HKTA 2A69F 3FMQA 3KP6A 3F6VA 3VODA 4HLYA 2NAZA 4HV6A 2BYVE 1IW7F 1HKQA 4HQMA 4U0VA 4YFNF 1A04A 1OR7A 3J7AO 1PP7U 1TQPA 1FYKA 2HTSA 4G6DA 3MZHA 1WWXA 1PUEE 4M74A 5IT9Z 2K86A 3V4GA 3REOA 3LAJA 2VONA 1R7JA 4KIBA 4CZZA 4EJUA 5BS6A 3TDZC 2WV0A 1W5SA 4A0YA 5HVQC 4I09A 1F1ZA 3HSEA 5FD6A 5FD5A 1IUYA 1LQ1A 2H6BA 3M9AA 3GFMA 3T0YA 3V7RA 2MD5A 4LJZF 3CO7C 4OU0A 1Z6RA 3RJPA 1S3JA 4HYEA 2W24A 3DXJF 1PP8F 2RQPA 2CW0F 1SMTA 2FNPA 2FQ3A 2VODA 3LWFA 2EFPA 2KKOA 1B9MA 1G3SA 4OIRF 1MDMB 2FMYA 3GEZA 2FU4A 4AWXB 5LRSA 5D6FA 4DNCA 2Q2EA 3O2PE 4O6JA 2FNAA 4WK8F 2HYFA 1LEBA 2D1VA 4MQ9F 5BPIA 1BIBA 1ZRCA 3SFZA 2O6GE 3CUQC 1ZHFA 2HQNA 3KE2A 1ON2A 4YIIA 3GWZA 1AOYA 3F8NA 2IA1A 2PI0A 2FOKA 3EYYA 3ZMSA 2H94A 2F5CA 2ISYA 1L0OC 2L4AA 2DQLA 1BIAA 4KT5C 5FGMA 3DP7A 1XGMA 3LA2A 3HHHA 4HW0A 4RS8A 1WQ2A 1VTNC 5L3FA 5E17F 2GZWA 4S05A 1XSXA 3BPVA 4U88A 4GO1A 1GVJA 2VT3A 1OKRA 4P96A 3F23A 3DV8A 3QRFF 4RGXA 4Q4ZF 2DFIA 4IRIA 2LNBA 5FFZA 4I98B 5ICGA 3L9FA 2W57A 4A6EA 2A6EF 2CGPA 4AVPA 3GYHX 3CTAA 4AIHA 4IJAA 1USTA 4HBLA 4G7HF 1U5TC 2BE5F 2VBWA 5EEGA 1W4MA 2UXNA 3V7SA 2NNNA 3WGHA 4LK0F 2F2EA 5HS9A 2HTJA 2LDUA 2YPRA 2Y75A 3CDHA 1FPQA 2P5LC 1G3WA 1R5GA 4EJWA 2B0LA 5DCMB 1OMIA 1BI0A 2K7LA 1WSUA 1W7PA 2OAZA 3P9KA 1I27A 1BN5A 2MLKA 2PMHA 5CVUA 2K02A 3HTUA 2C6YA 4FX0A 1YIOA 2EA2A 5BPDA 3O3KA 4PGGA 4PDKA 4ZH4F 4H0EA 1FBUA 2CWEA 1SD7A 5JVTA 1P2FA 1ZGAA 3WGIA 3BWGA 4IF4A 2L3DA 1JXSA 2IT0A 5HOOA 5HLGA 4IVNA 4ESJA 3RKXA 4WWCA 1T38A 4OIQF 3NQOA 3L7WA 1BC8C 3TOAA 1P4AA 1ZREA 4RB2C 3ZP5A 2STWA 2ACJA 4A2UA 4P55A 3E3VA 1QBJA 3MQ0A 4L18B 1JGSA 1TBXA 2K4BA 5D5XB 4BXUA 3SZTA 2RKHA 1FOKA 2CSOA 3ZN0A 4OIPF 2HZTA 4XSXF 1R36A 2HYGD 5L3GA 1BOAA 3KP2A 2Q0OA 4Y17A 5D6EA 1E17A 4M9ZA 4LB6B 4R79A 3J80Z 5H6QA 2Z9OA 3ABUA 1RUNA 3E97A 2PN6A 4HF2A 1ZRFA 5DCMA 1FP2A 1LEAA 2DK5A 3F3XA 3FMRA 1DUXC 5ILVA 1IRFA 4D0PA 1XD7A 3RPUA 2D45A 1R5HA 3F8FA 2DU9A 2FE3A 5L3CA 4UVCA 3GZ5A 1QQIA 1YW9A 4CHUA 2UZKA 3EETA 1BC7C 2VE8A
chains in the Genus database with same CATH superfamily
3L2WA 2CUFA 4L9JA 5HODA 1EA3A 1X2MA 2F4IA 1D1AA 2W85A 3KFWX 1WH7A 3M1EA 4FCYA 2IA0A 2DT7B 2H8WA 3VOEA 1YHQI 1Z91A 3OIPA 1GXPA 1J09A 2X85A 2IGOA 5B1BH 3S16J 1WJ5A 1TTYA 4BJTA 4N9HA 1BBYA 2JMWA 4FE7A 2EB7A 3ISPA 1HA8A 2X0LA 2IGKA 2QF7A 4FT8A 3N97A 3WTTC 2KHMA 2LOOA 2P7CB 1YG2A 3I64A 2LKXA 2ZC2A 4KIGA 1HW5A 4P5OA 4K2EA 2A61A 5J8FA 2E1NA 4Y52J 4IPAA 1P9QC 1G3TA 2R7QA 4NHJA 1DDNA 3OS1A 1YE9A 1IRZA 5HS7A 4FX4A 3MZYA 2Y48A 4G94A 1XCBA 3EDPA 3COAC 4XIDA 1WJAA 3EPZA 4DBQA 1ZYRF 4PFPA 1LNWA 3QPHA 2IA2A 3R61A 2KT0A 2VLAA 1S5LC 3GTJJ 1J75A 3LFKA 1WJFA 4A3DJ 3H0GJ 3IKVA 2MH2A 2ZJ2A 3BPXA 2M5WA 3BTLA 1R1UA 2OZ6A 3TMOA 4NQWA 1SFXA 1TP4A 4ZC3A 2EZIA 2NVYJ 5BQTA 3BZKA 3G3ZA 4ZYGA 4PSXA 4XLEA 1F9NA 3S93A 3J7AY 5DV5A 4YFXF 2B9SA 3E5UA 4DQ2A 1V4RA 1TZLA 3OWTA 2ZSHB 3BR5A 3C3WA 2GXBA 2F4MB 3F6OA 1KYWA 5FLMJ 2DA5A 2IBDA 5HNFA 1V5EA 3K1MA 2R7UA 2LY9A 3LOCA 3TBIA 4AYBA 3HUGB 2M3AA 2DDBA 1HLVA 2R0QC 5DDGA 2VUMJ 3DKYA 1TWFJ 1Z77A 4XLCA 4IRGA 1LPQA 3FBNB 3M07A 3T5XA 5M3MJ 2BV6A 2Y30A 1V3FA 4CICA 3FXMA 3I54A 4XKCA 3OS0A 1Z6TA 3KP5A 3RDIA 1TNSA 3M8FA 5CVJA 4Q5SF 3K4MA 5HDNA 3HDDA 4F7ZA 1FY7A 5EG0A 1SFOJ 5BNGA 1OCOH 2Y31A 3FXQA 4PJLA 3OR2C 2X1CA 2KISA 3HOYJ 3K10A 2DFHA 4N4NB 2XGEA 4BBSJ 1Y8RB 3CQZJ 1YRNB 3JRIA 3OS2A 2DA2A 1H9GA 1KU7A 3DKWA 5IY5H 3S17J 4HX7A 3SJMA 1X1CA 2OU2A 3RPUD 1IXSB 3MZ8A 1R00A 2O3FA 4QPOA 3JRBA 2R7DA 3F8CA 4UNOA 3LMMA 5D5VB 5ERIA 4A3EJ 5DYMA 1WJEA 3BP8A 2LR8A 2P6TA 3I4NJ 1D5VA 1H89C 1BJAA 3K2ZA 2CQ7A 3LA7A 3PQJA 3QU3A 1T0FA 3UKGA 3OYLA 4EGZA 2IW5A 4A5NA 1G2HA 3CCMI 2Y0MA 2QQ9A 2XPUA 3F21A 3KP3A 3L2RA 2FEZA 1A35A 4FE4A 1FEXA 3VB2A 1I6XA 4XKVA 3ZMDA 4IKFA 1QZYA 1BL0A 1IC8A 3W6KB 1MKMA 3HSRA 3OYJA 4Z6YA 2EFQA 3V8LA 4HRIA 1FMVA 1T08B 3PFIA 3HOXJ 1IV6A 3GXOA 4LLLA 2IRFG 2JA8J 4DOZA 4G8XA 2K3FA 5K5OA 5EGOB 1KQ8A 2COMA 2NS7A 4XOPA 1B8IA 1IXCA 1MSEC 3HIFA 4DYRA 3GTQJ 1XSVA 2MD0A 1QNTA 2A5YB 2HKXA 4P1WA 3DPTA 4D9JA 1W5CC 2ZKZA 2GM4A 2P8TA 4BQNA 1JUMA 1X1BA 3CUQA 2QSHX 2M0CA 4XK4A 4E70A 3K1PA 5FLXZ 3PUFA 4TV7A 2V26A 3OL4A 3E6DA 1RPWA 3R0JA 2F5FA 2OBPA 2ZMEC 2P6SA 4A6DA 3HBLA 2HPMA 2XROA 2JTVA 2ADUA 1MNEA 1DU0A 3HSFA 2QVOA 3L00A 1HQCA 1Z9CA 4L5EA 1GV5A 3LSMA 4JK1X 1XDSA 3HUGA 5JHFA 3WE2A 3CCJI 3WTVC 1QVUA 2ELJA 1JI8A 1GLNA 1MW7A 2HQRA 5HDKA 5LFAA 2JA6J 1VQ4I 2EV6A 4AUXA 2GWRA 4UUSB 5C3EJ 4F52A 3V8JA 3HHGA 1LB2A 4RAFA 2XAUA 1XMKA 4LLGF 1RZ4A 3D5SC 1Y1WJ 2EBIA 4DBRA 1D8KA 2L9SA 3HG9A 3U1KA 4BEHA 2EFOA 2GOXB 2MA3A 1KQ9A 2XKPA 2XRLA 2AXTC 1IN8A 3K69A 4YFKF 4XNFA 3BQZA 1UFMA 1YITI 3TOBA 2OTLI 2P4WA 2HZDA 4OMZA 1YRNA 1ZELA 5LGUA 2A3SA 3IC7A 3QODA 2PJPA 1UJ8A 3MKLA 4CUGA 1R22A 5D4RA 3VYUB 1CGPA 5K5RA 3T1BA 1UHWA 5CVRA 1NK3P 2CQKA 1JTXA 2KL4A 4LG0B 3ZN1A 1ETXA 2HEOA 2F48A 1PYVA 1C0WA 1HDDC 1R1TA 1GVDA 5IP7J 1U3EM 4P9UA 4HF0A 2V9PA 2UUZA 4O3MA 1V5FA 1H9TA 1K79A 2R93J 3ERMA 1RKWA 5J8CA 2QWWA 2VKDA 2EPFA 3GF2A 4FETA 2JA2A 3I71A 4PJNA 3CZ6A 4PJ0C 3GX4X 4M3BA 5CVIA 3OOPA 2IGMA 3BG9A 4I76A 1UB9A 2V1DA 3GFJA 1AU7A 3AG3H 1TW3A 2ZCWA 3A2KA 3W6JB 3R4KA 3J7ZI 4A69C 2EQRA 4AC0A 1EH8A 2GQQA 2DOEA 2VI6A 5LHHA 1Y6IA 2MGQA 1H8AC 3CDIA 5GTIC 3K70D 4M72A 3BR1A 3BOQA 4MGRA 3IHUA 3KYCB 3N05A 3F9KA 4U0YA 1Y39A 4P9FA 2YU9J 2V7FA 3I59A 5TJJA 2YU3A 1HCRA 5EJCA 1D1CA 5HLIA 3A03A 2M87A 3VFZA 3EQLF 3OYHA 3CUOA 3RCOA 1TT0A 2VOPA 2R5YB 2EFNA 3K4NA 1W7PB 4HQEA 2BXZA 1K6OA 2Y0SN 5GPCA 2WTEA 1T98A 2IAIA 2JRTA 2M1BA 3H92A 1R6RA 4NUBA 1VQ7I 4D5FA 3B6AA 3ZRGA 1U2WA 1TW2A 1WCMJ 5J6XA 1I39A 2QSFX 3FBIB 2M8EA 1IG7A 1HKSA 1HDPA 4B3AA 4Y13A 1QU3A 2RAEA 1IRGA 2VQHA 3T8TA 4NC6A 1Z3YA 1R71A 2R5ZA 1U8RA 1FT9A 1SFEA 3PSIA 1SEUA 4GCVA 4XOTA 3HC7A 3VDXA 3TKYA 1YQAA 2FBKA 1WZ2A 1YOVB 3LAPA 3WTSC 5EYRA 1A5JA 1KA8A 1IJWC 1D3YA 3H5RA 3VEPA 5CYVA 2EIJH 2OD5A 4II2A 5CKTA 3K2AA 1R9TJ 3VYRB 3HRTA 4EJOA 2JQ7A 1O3QA 3S1RJ 2STTA 5B3SH 1U6GA 3GUDA 1STZA 4KYWA 2DMUA 1SVLA 2E5NA 2WV1A 5DD8A 3E0JB 4ON0A 4BYYA 2HDDA 3SFIA 2MC3A 1LDJA 2XAJA 2CW8A 2Z16A 4FISA 1PDNC 5LRRA 3J81Z 3I55I 4LG0A 1T6SA 4RAZA 1KGSA 3SDBA 5LBQA 1P92A 4B8XA 4XLAA 4OOIA 5KVRA 3E6CC 3OV8A 4B47A 3BG3A 1IXRC 1Y0NA 3C2HA 3TW7A 3L2CA 4IO9F 1LVKA 2LY1A 1XC5A 3FHZA 4LIUA 3WODF 2BZTA 1VQOI 1VQ8I 2L54A 2ZB9A 2ZJPF 2V1XA 5J40A 2H1KA 4G7ZF 2HWVA 1W5TA 2DJIA 3M3YJ 4KN7X 3QPLA 4L5JA 4O5VA 2CO5A 4EM0B 1UELB 5F64A 3ZQLA 4YEJA 4EJTA 4KIFA 1FYMA 2VPLA 3FK7A 1Z21A 4Q47A 1VQ6I 3GTLJ 2E34A 1ETKA 3GFIA 3DTEA 2EZHA 1ZLKA 2W82A 1V5GA 2ZXIA 3KLNA 5JI6A 3IWFA 4LIVA 2BY0A 4EV0A 4RB3C 2FD5A 1NHAA 5LD2C 2LLKA 2A5WA 2DA6A 4A0XA 3ESWB 1Z05A 2OTJI 3A02A 1F5TA 1O57A 2FMLA 3FXUA 3DBHB 2EA4A 2BGCA 4A3CJ 4MHGA 2WADA 4ZZDA 4JOMA 4RGUA 3VSLA 4YELA 2CFXA 4Y33A 3S15J 3HRUA 5FLXK 2OV7A 3GW2A 1UG0A 5AONA 2VBZA 3K4JA 3OSFA 3LSKA 5L3DA 5BMZA 4XQFA 5FRMA 3HOWJ 1XGOA 3IUOA 1ODDA 3V7CA 3QU6A 3OIOA 1KQ0A 1VF9A 2XIGA 4BHBA 1S29A 4CA0A 1MMNA 5IT9K 2FX0A 4WXDA 1T8IA 2O9LA 3QAHA 2QSGX 4I02A 3CCRI 2KIUA 5ICCA 3BR3A 2D2WA 4NDLA 2DI3A 1ETOA 4M9XA 3TGNA 1XGNA 2JVHA 4HX8A 3C18A 5CQEA 1ETQA 2QYOA 3PUBA 2D1HA 4LGWA 1E3HA 1N77A 3S1QJ 1UHSA 1WH5A 3JTGA 4KN4X 4GYGA 4NB5A 1WGXA 4BUPA 2OUMA 1MBKA 2ZXHA 5JLXA 4ZDPA 2JPCA 4GDFA 2VOOA 5DUIA 1I6HJ 2TRTA 5H2FC 3EYIA 5J4VA 3S2WA 2MYSA 3S1NJ 2I10A 1IAWA 2BHZA 2KPMA 1MBJA 3RQIA 4XRFA 4YIFA 2ID3A 2VBYA 2DCEA 2YUSA 3H9JA 2Q8KA 4S0HB 4BAYA 1MSFC 1YW8A 2QBYA 1Q1VA 2NNYA 1Z7LA 3TO6A 4N0BA 2RDPA 1YX5A 1T33A 1Y1VJ 2IXSA 2OCCH 2W48A 4BGDA 2X4HA 1POGA 4JX6A 1YJNI 2XRNA 4PGHA 1YS6A 2XHKA 1QZZA 1O3RA 4JX5A 2MLGA 2Z5UA 2E1OA 2OCEA 3ZMZA 1R58A 4AU7A 3HZJA 2E7XA 3JRCA 2DJNA 4BDZA 3HKZN 2V1UA 1MJAA 1HSJA 5LHIA 1XDUA 2M0MA 4BXFA 5EZGA 1KU2A 4C2UA 4X1EA 5CLSA 3AL0B 2ZNYA 2B7EA 1LVAA 1U9OA 1X4PA 4ENMA 1J59A 3TO9A 3O8HA 1AWCA 1ORKA 4PJJA 5E8GA 3KZZA 2R7XA 1TQMA 2QQBA 4A3LJ 3R6SA 2Z33A 4L0YB 4CCJA 5LGNA 1XMAA 1VQPI 2FOWA 5KAFC 2M45A 4MTDA 3GLLA 4GFBA 1LFPA 1SD5A 3TP0A 2JPBA 4BBRJ 2FRHA 3G6EI 3H3VK 2O5RA 4RMNA 1FOYA 1P4WA 1YS7A 2XASA 1KYZA 5F08A 5D8LB 4KMFA 3MFKA 2R7VA 5K5QA 1O4XA 4L9NA 4YRVA 2DMNA 1ZARA 3MAJA 5AIPA 3PFYA 3WU0A 2KJBA 5BOXA 2FF4A 3BY6A 4CH7A 1XB4A 1JHHA 1ZQ3P 1JUSA 2DO7A 5EZHA 1EF4A 3HPHA 1IN7A 1LKXA 4DW6A 1W7PD 5GTHC 1O7FA 4MO7A 2DTZA 5IOYA 1D8JA 3KP4A 2KIFA 2WAFA 1G4DA 2ECBA 2ME0A 4CCKA 2VJIA 2PJRB 3FXOA 4M73A 5FB2A 4IHVA 3ZQCA 2DXIA 2D5VA 4RB0A 1ZG5A 3QYFA 2LYCA 3VWBA 4BKXA 2LRDA 1S8NA 4BY7J 1N25A 1OCPA 4MTEA 1RRJA 2W1OA 4IEJA 1J5YA 2RC4A 1RC9A 3KZIC 3B73A 4MNUA 5EDNA 2UV1A 5LLQA 3OY9A 2VC1A 3LSJA 2J5PA 2EZKA 2M30A 3C2BA 2B63J 3BTJA 2Y9YA 1FBSA 3CJRB 4UB6C 3K1NA 3M7GA 2YX7A 3Q9SA 1YX3A 2K9MA 3CMAI 4LMYA 3KYLA 4DYQA 3J81K 4L9VA 1ZG1A 3PQKA 2XPVA 3FMSA 3ML6A 3Q9VA 4KT6A 1RIOH 5IOZA 4EJVA 4YG2F 2L9RA 3HRMA 1G8XA 3P7NA 3JAMZ 3D5RC 1T2KA 4E7IA 1B8IB 3M8EA 1QPIA 5LHGA 1Z0XA 5LEKA 3F22A 1X58A 1BR1A 2F5EA 4KFCA 2ESHA 4CXFA 3ABTA 2IEKA 3CUQB 1GHCA 4GYIA 3FWEA 4DZPA 2AS5F 1E3OC 2Q1ZB 2DOAA 2XF6A 3E5QA 4DGWB 1EH7A 3KEYA 3Q5FA 2OQRA 1BR2A 3DF8A 4HZFA 5L3BA 3GFLA 2JSCA 1J7KA 4LFUA 2V79A 4HG2A 4CYDA 2EFWA 1FJLA 1RI7A 3CD6I 3SXYA 4M9SA 4H4KC 2RNJA 2DFEA 5DM6F 2OZUA 1OCTC 2CFOA 3ZXSA 3W6VA 1X2NA 3F8MA 1KU9A 4M6YA 5FKOA 5K7FA 3D0SA 1RNLA 4R1HA 3IKTA 3BDDA 4CZCA 4XRSA 1P6RA 3H9GA 3OOUA 2ZXJA 5ED4A 3H1CA 1EJ9A 2E2JJ 2AXLA 4BEHB 2G7UA 2M4KA 4UVAA 4IX7A 4A93J 4G7OF 3I5UA 2E1CA 3UR3C 2NS0A 1GDTA 3CCQI 3DEUA 2O0YA 3O8GA 1WI9A 5F1JA 3ULQB 2NRAC 1Z7UA 3H3ZA 4WCGA 3SZPA 4BU2A 2HOEA 3KETA 1W1WE 3F72A 2MBFA 2ZFWA 2PJRA 1UMQA 1JKQC 1O7LA 3SEQA 1B6AA 1NK2P 3IRRA 2VB6A 1RKTA 2NYXA 3ZQFA 1SFKA 2EIMH 1Q1HA 2JUCA 3JRAA 1VQ5I 4A3IJ 2BY3A 2ELHA 2VKVA 1HF0A 4PSWA 4KDPA 4Y7NJ 2KRFA 5JR3A 2UWMA 4HEA2 3MEXA 2WY8Q 1J9IA 1TWHJ 1DQUA 2DPDA 4EM1A 4QIWN 2F6CA 3LNQA 1ZRDA 5TRDA 1D0YA 2RV8A 3ECOA 5LGTA 2R7SA 1FYLA 9ANTA 1J0RA 1KONA 5FRNA 1YYVA 2X51A 1MJ9A 3FZVA 3JSOA 3OSGA 4CCNA 3OYIA 3S14J 2R7WA 2ETHA 2PBIA 3ERED 4OMYA 2E1MB 3DBLB 3I59B 5K7HA 4EMSA 1BJZA 1PUFB 1LE8A 1IN6A 2I8DA 3CF5F 4FTHA 3G1OA 3MWMA 4I0AA 1DPRA 5CPRB 4M6XA 3JSPA 2DK8A 3KX2A 1IF1A 3K9TA 1CF7B 3KEOA 4BHPA 1SAXA 4BE2A 2AO9A 4ZDOA 3LQRA 1XMXA 1ZGWA 3DLAA 3JR9A 2OQGA 1FX7A 3RKQA 2L7FP 3K6GA 1F4KA 4IXAA 5E3LA 2DTRA 2DW4A 4UB8C 2IS4A 3PIPF 1RESA 2CMPA 3J80K 2XAGA 2G9WA 1LJ9A 3NRVA 4FHTA 4A12A 3AAFA 1OCRH 2KDOA 4BY1J 1MMGA 2HS5A 2R5ZB 1SANA 2JK3A 3TW6A 3P9CA 3N4MA 1W0TA 1HXDA 3CCVI 2X1DA 2GAUA 1I50J 4OIOF 4XLPF 2BBYA 1ZGJA 3KP7A 2V4JC 5F0FA 2G7HA 4U7BA 1JE8A 2GLOA 2O8XA 2KP6A 4HLXA 1HSTA 1WRJA 3IAS2 2CUZA 3K4CA 3RYRA 3OYGA 3E7LA 2CUJA 2YR2A 3Q0WA 2VC0A 5DEQA 3TO7A 2VBXA 2DBBA 1FC3A 1OYYA 3RKWA 3LQQA 5HLTA 2HDWA 3ZMVA 1F43A 2DDAA 3CCUI 4A5MA 2ZXWH 1S7AA 2M2EA 5FKLA 3DBRB 4PCQA 4IQ4A 4ENNA 3W2VA 4ANJA 1Y56A 1W36D 3HM5A 2WB1A 1P7JA 2PEXA 4IHTA 4J19A 1U78A 4B43A 2DN0A 4AM3A 1BM9A 2N8GA 3CESA 1IN4A 4WX9A 2CV1A 3CP8A 2OC6A 1B1BA 1D1BA 2L7KA 3SYTA 4AIKA 3FX3A 2EINH 1ETWA 4WXHA 4II3A 3QP6A 3LL7A 3HOVJ 1TNTA 1HOMA 4E7KA 1OCZH 4AIDA 2E36A 2TDXA 1NG7A 3UNGC 1U5TA 4DJAA 3I3LA 2KDZA 1WI3A 4U0WA 5K7ZA 4RA2A 4C3IJ 3TDUC 4I2OA 3C2GA 5DCFA 5FFXA 3K70C 3WG9A 2R92J 2Y0SA 2HXIA 1XX5A 2EV0A 3HYIA 1YLFA 3GVAA 3L09A 3E6BA 3Q0UA 3DU6A 2E60A 1USSA 2NOJB 5J1YA 3WU1B 3L2UA 1L3LA 1FTZA 1S7OA 4RAYA 3D1NI 4MEYF 1AHDP 3DCFA 1T0FC 5E1ZB 2Z3YA 3H35A 3I4PA 1O3SA 1H0MA 4I7HA 3PNYA 1TWAJ 4BE0A 2L2OA 1PUFA 4RAGA 5DTDA 4IHSA 5D8KB 4BQQA 5HLHA 4BQAA 3BROA 1DGRM 4ENJA 3CJNA 3I56I 1CF7A 2FSWA 4G9YA 3I53A 3PIOF 1OJLA 2XKOA 1IN5A 3JAMK 4M3EA 3GTPJ 3CMYA 3ZPLA 4HAMA 2QM3A 4XN0A 3S32A 5B1AH 3SQNA 3PNTA 4XLFA 1ON1A 3K4KA 4NBQA 5C4XJ 1A6IA 1SVMA 3PM1A 4WF2A 1ULYA 5E20A 4A3MJ 3JREA 2IP2A 3ZQ7A 1J2XA 4LB5A 3JW4A 2BXYA 2CS3A 2I5UA 3P9IA 3MMYB 2ESNA 3DWLE 1OR7C 2M34A 3AG1H 4GXOA 2PG4A 2FBHA 1QO0D 2J5OA 2X6WA 2A6TA 2Z1DA 4ZYEA 4W1UA 2XSDC 4V19K 2ECCA 3BT9A 3R60A 4XBFA 4CDGA 4QLCU 2UXXA 2WAEA 4IHXA 1LFBA 2L9VA 2E2IJ 2K85A 4LLNA 1FNNA 4PJMA 1OLTA 1YTYA 2K27A 4RBOA 4A3JJ 3CC2I 2IPQX 2ICWG 4HV5A 1YFHA 4C30A 3I58A 1MBGA 1X19A 1SMYF 1WFXA 1S9HA 4RLQA 2BY1A 1JT6A 2CJJA 1DP7P 4OAZA 2XV4S 2DQRA 2KJCA 2LH9A 3QYEA 2L5QA 2DLLA 1VFCA 2R7RA 2ZNZA 1OFCX 1R23A 3G2BA 2JA7J 3WGGA 2X48A 2FBIA 1OYIA 1SFUA 3RI4A 1HC8A 3LSTA 2P7VB 3I0TA 3HB9A 4E6KG 3C7JA 4HSRA 3W2AA 1WJBA 3LA3A 3V42A 3BG5A 1FTTA 4IRHA 2XAQA 2W84A 2QBYB 1Z1DA 4UUVA 2X9DA 4C2TA 2XGXA 3M4OJ 2BW3A 5FKNA 2ZFUA 4N4OB 5JFRA 3I4MJ 2VKHA 4ZDLA 3S2HJ 1OPCA 1SD4A 5D5UB 1G3YA 3WTUC 4HPQA 2GIVA 3JRGA 3K0LA 4LITA 3H3UA 3BJOA 3C1DA 3G1MA 1XN7A 4EVIA 2LC2A 3PNVA 5ILUA 3CCLI 2EWNA 2F5VA 2QZ8A 3DQVC 4XORA 2BEOA 2VJJA 4ESBA 4RM2A 2NVTJ 3B6CA 1YJWI 5A2QZ 4CCMA 1MD0A 3BJ6A 5FROA 2QA4I 1K61A 2IS6A 2R3SA 4BACA 5KK1A 4B48A 4XN3A 4IOAF 3QOPA 1FSHA 2E2HJ 2CU7A 1JGGA 1UAAA 1VQMI 5HDGA 1RR8C 5L3EA 2OPTA 4PUSA 2LF7A 4UXNA 2XVCA 2ZBKA 1XGSA 4XKBA 1MNDA 2NVXJ 4Z2YA 4ZZLA 1QZEA 3EUHA 3LSRA 5F0CA 3HOTA 2GA1A 2P0WA 1S6LA 3FIWA 4MEXF 2DA4A 1MMDA 4AD9A 3VPRA 4KMUX 5E1XA 2V9VA 2TCTA 3LSGA 2A6HF 1SD6A 1MDMA 4EM2A 2CYYA 2XF7A 4BNCA 4N9IA 4IHWA 2KRHA 2ID6A 1B72A 4LG3A 3HOUJ 5DD4A 3CLOA 2VE9A 2O03A 1MMAA 2HKOA 4KNYA 1F36A 5J1RA 1V55H 2JT1A 5ICFA 3HGYA 3A1YA 2BY2A 2K5CA 4ENKA 1P7IA 4Y15A 5CJ9A 1H88C 2DPUA 2A68F 1EH6A 2EV5A 4IOCF 4ETSA 2X6OA 2JJ7A 2CG4A 1MZBA 5CVVA 2RQQA 1MBHA 1ENHA 3WTYC 2L01A 1ZN2A 3L2QA 3QPTA 2GXGA 4V2FA 3O6BB 2DMPA 2V6EA 3RSNA 3CMEI 4QTRA 1K83J 4BH9A 2EK5A 2ISZA 4AVZA 1YO5C 4UV8A 1Y0UA 3RPQA 1JHFA 2VJ5A 1BI2A 2RN7A 2XSJC 1JKPC 5DUKA 1WKMA 2KFDA 2W25A 3F8BA 1B9NA 4F55A 4Q48A 1I5ZA 1SVOA 5GAHJ 1I1GA 1P4XA 2K9QA 4XLNF 2KZGA 2QQAA 5AIQA 3H9QA 1T95A 2M4GA 2QLZA 3KCCA 3HKZA 4V2GA 2G0EA 2PMUA 2GIZA 1UG2A 1PVEA 4LD5A 4OINF 4ITVA 2P5VA 1MGTA 1TLHB 4NNJA 1Z3XA 3KEQA 2DA1A 2WWYA 4GGGA 2EZLA 3A4CA 3GO5A 1T39A 3S3OA 5H6RA 3TP3A 4XKWA 4GRIA 4R8HA 3ZMTA 4DZJA 1IZ1A 2PMZA 5D5WB 1TQIA 3CJTB 2COBA 3Q3SA 3RYPA 1QPMA 2OA4A 3FHNA 2WAQA 3GZNB 5F27A 1A6QA 5GAEJ 5EF6A 2NS8A 4L5IA 1R1VA 3ROUA 1X1AA 4RLFA 3TQNA 2XGCA 4S04A 2JRMA 2YX4A 3OYKA 3BJAA 5J47A 3MVPA 3WU2C 2MFZA 1FP1D 2IS2A 3HRSA 3B02A 2ZO4A 3FK6A 2KIQA 4UHTA 2O8KA 1G59A 4ESFA 4J01A 4I0BA 2RGVA 4JQFA 2O61A 4XMYA 2ZMEB 1UZCA 1BI1A 2GOMA 1IO2A 3QP5A 3F0CA 5IP9J 3CC7I 3IL2A 2CH0A 2K40A 4CO8A 1EKEA 5M3FJ 3BC8A 2XUBA 2QUFA 2JSPA 5E79C 1FBQA 5ICEA 1XCVA 3MCZA 2V9KA 4PK4A 5J4YA 2HU9A 3W3CA 2GA2A 3HXLA 3S3MA 2H27A 4EATA 2V6CA 3IWZA 4OAYA 4ZYHA 1HW1A 4FASD 1REPC 3K4LA 3A01A 2Y9ZA 2H09A 3RKYA 4HDUA 1TC3C 1GXQA 1IDYA 2FA5A 4XONA 2R7OA 2OJED 1OISA 2HYJA 1BI3A 1FOXA 4UV9A 4XM3A 2VT2A 3HOZJ 4I6ZA 3SHFA 4MFEA 1FSEA 3BLYA 1X1DA 2XPWA 4B09A 2CQNA 5IT3A 1MNMC 1ZAOA 1Z67A 2M7AA 2KRCA 4HX4A 3WE3A 2PQ8A 4RGRA 3DTIA 1GV2A 4WXCA 5LEJA 1LUJB 3RIRA 3NWSA 2HDCA 4Y4RA 1ZH5A 1QVTA 3RZOJ 2GBYA 4IL6C 3GZ6A 3FF5A 2M8GX 4LK1F 2H6CA 3A0HC 4B44A 3GLXA 4BE1A 3FM5A 5C44J 2LBFA 3W2WA 3BR0A 3E6MA 1FZPB 3CCYA 1GT0C 1I1SA 3V8KA 4RB1A 3DPLC 3IP4B 5HS8A 4AIJA 1S7EA 5GAGJ 2F5DA 2P5KA 2XAHA 2HFHA 1XSDA 1ONVA 2VXZA 1K78B 3ABKH 3ZMUA 1BR4A 3P5JA 1LDDA 2VN2A 1YW7A 3WTZA 5EEHA 4YIRX 1FWZA 2DMQA 2W00A 1ETYA 2LF8A 2LD5A 2E7WA 1G6NA 2LREA 2PLYA 1VNDA 1OYWA 2HGCA 5E1WA 3DFGA 4XLHA 1WHUA 2YSRA 3OYCA 1E3PA 1WJDA 4MQVA 3RQ4A 3X2QH 3ZQQA 3WTXC 2LKPA 2NOGA 3PL8A 4HOBA 2NVQJ 1R49A 3U9GA 3HOSA 2K4JA 1LE8B 3G73A 1R5ID 3KZYA 3D5LA 5FJ8J 3NEUA 3R0AA 2ZJQF 3U21A 3QQAA 1IRXA 4I01A 3OYAA 2EJRA 2KQRA 3EUKL 4M3DA 5F1RA 1UHMA 2JZYA 5A2QK 1NTCA 2DT5A 2LG4A 2E5ZA 5DS9A 3FXKA 1FIPA 1V54H 6PAXA 2MSYA 3BTIA 3OYEA 3IRQA 2PX9A 2Z99A 1HW2A 3WHBA 4MFDA 2FXAA 2DOFA 2HVRA 4EGYA 1QA6A 3CP2A 1OQYA 1NG6A 3JRFA 2ZMEA 4BDYA 3OYNA 5JVGF 3LSPA 1ZR4A 3GMEA 4JBAA 3GTMJ 1B4AA 1FLIA 3LSIA 3VYSB 3GTKJ 2L4MA 3DPUA 5ILSA 4F93B 4CYCA 1HBXG 2ZJRF 2VASA 1UCRA 1MH3A 4NC7A 4ASNA 2AHQA 5E8IA 1SC7A 1EV7A 1ZG3A 1ZLJA 4HSTA 4KICA 4C9YA 4HNUA 1W0UA 2K3PA 3MD2A 1B59A 4L0ZB 3CO6C 2IVMA 3ZQIA 4EQQA 5K1YA 2X1EA 4HA8A 1U9NA 2L9NA 2E71A 4X0GA 3RTRA 3FM3A 5TISC 1X3UA 3GTOJ 4Y3OA 4UVBA 3LSHA 3JTHA 3IH3A 1FMWA 1KU3A 2HR3A 3BR2A 2KIMA 1BOBA 2XAFA 4M71A 3U1DA 1MBEA 1O3TA 2IJLA 4QWQA 2KMUA 2WC2A 1IUFA 2V1NA 2A07F 5D4SA 2R7FA 1K7AA 3NAUA 3E5XA 1X4OA 1DP3A 4U7DA 4C3JJ 2CW7A 4A3GJ 2RNGA 1MBFA 4A0ZA 1U5TB 3OYMA 2MH9A 3CF2A 1K4SA 3IH2A 2Z2SB 3WG7H 2Y2ZA 3I9V2 5H20A 5JHUA 3S1MJ 2LK2A 2LSOA 1AKHB 2HXOA 1SAUA 1E2XA 4XR6A 5J1UA 4L9TA 4AYBN 4BHCA 4CGZA 1K78A 2RREA 1QGPA 1D5YA 1XTAA 2L02A 3GBGA 2R7TA 1JKRC 3S8PA 1LDKB 3ZQGA 4ZYDA 4KA4A 1RUOA 3ELKA 3BZ6A 4XSZF 5GADJ 1JJ8C 4A3BJ 2LP0A 1KZHA 2Y69H 2PFBA 5F04A 3IAM2 3FKIJ 3U2RA 5B5EC 5KHDA 2VQGA 5HNHA 1MJBA 3ECHA 4B4CA 4HDVA 2W4SA 3KLOA 5E18F 1MH4A 3HTSB 4PZJA 1ACIA 5E3NA 5FO5A 3PO2J 3SZGA 4G6QA 3BTCA 1TT5B 3H36A 1JUPA 3QPSA 4JP0A 2HPIA 3IV5A 4D5CA 5F6FA 1QRYA 2YS9A 1YI2I 3BZCA 5M5XJ 3KPHA 1BA5A 3WTWC 1BW5A 3FXRA 1AA7A 1DPUA 2DAOA 1XS9A 2RVCA 3GTGJ 1IV8A 3T8RA 2MG4A 4BJ6C 2Q2EB 4RGSA 3BCAA 4D1QA 2QENA 4KUMA 4PFOA 5KCMA 1VQ9I 4HF1A 2A69F 3FMQA 3KP6A 3F6VA 1HKTA 3VODA 1ZKGA 2HOTA 2K9NA 5FLVA 4HLYA 3FKJA 2JUGA 2NAZA 1A36A 2P81A 3AL0C 3ASNH 2BYVE 4HV6A 3OYFA 1IW7F 1HKQA 4HQMA 4U0VA 4YFNF 1A04A 1OR7A 5C4JJ 3J7AO 1D0ZA 1DGWY 1RR7A 3ABMH 2LY2A 1PP7U 3PJRA 1TQPA 1FYKA 3OIQA 4M3GA 2HTSA 4G6DA 4JYKA 3JRHA 1WWXA 3MZHA 2DT6A 1PUEE 4CCLA 1W36C 2BVMA 2HQ5A 4M74A 3OYDA 3HPGA 5IT9Z 2K86A 1ZTRA 4ZYAA 1K6YA 3CLQA 4E4HA 2HI3A 3V4GA 3BR6A 1VQKI 3JRDA 2FQ4A 1ERDA 4XL9A 2WA0A 3HEFA 3ZCOA 3REOA 3LAJA 2VONA 1R7JA 4KIBA 4CZZA 2H8RA 4EJUA 1U0JA 2M9HA 5BS6A 1PJRA 3TDZC 1WPKA 2AQFA 2WV0A 2X6YA 1W5SA 4A0YA 4KJZA 5HVQC 2H1LA 4BXXJ 4I09A 1F1ZA 2QKMB 4BS9A 2HVQA 3HSEA 5FD6A 5FD5A 4M3FA 2DYSH 3ASOH 1IUYA 4ZTJA 1LQ1A 2BW3B 2H6BA 3AKZA 3M9AA 3GFMA 5FKMA 3HJEA 4CSWA 2DA3A 2NVUB 3T0YA 3V7RA 1AKHA 1VQNI 2MD5A 4LJZF 3CO7C 3K4BA 4BL0B 4OU0A 1Z6RA 3FXLA 3CC4I 3RJPA 3FXJA 1S3JA 2HQAA 4HYEA 2W24A 3DXJF 1T56A 1JTYA 2MC4A 1PP8F 2RQPA 2CW0F 4XRMA 1TWCJ 1SMTA 2FNPA 2FQ3A 2VQCA 2VODA 3LWFA 3K7AJ 3MKWB 2EFPA 1LFUP 2GXAA 2VPRA 3CCEI 3BG6A 3QWLA 2KKOA 2LTPA 1R4MB 2WB1N 4X6AJ 1B9MA 1G3SA 2HOSA 4OIRF 2F4OB 1MDMB 1OCCH 5GPAA 2EH3A 2FMYA 3GEZA 3MKYB 2FU4A 3E1SA 4AWXB 5LRSA 1B72B 5D6FA 1XPXA 4DNCA 1JT0A 2XB0X 3CJQB 2DA7A 2Q2EA 3O2PE 3Q0VA 3MKZA 5EGOA 4O6JA 2FNAA 4WK8F 2E19A 3G4SI 2JN6A 2HYFA 1LEBA 2D1VA 4MQ9F 2LFBA 5BPIA 1BIBA 1ZRCA 4HNTA 2KLOA 3SFZA 2O6GE 2HOAA 3H5NA 3CUQC 1APLC 1ZHFA 2HQNA 1IDZA 1R4NB 3NWTA 1QHGA 1U8BA 2FUG2 5KAIC 2AQEA 3KE2A 4C2MJ 2R7ZJ 1ON2A 4YIIA 4QSHA 3GWZA 3VSKA 5IYCJ 3J7YJ 1FIAA 1AOYA 3F8NA 2BHYA 2IA1A 3OR1C 1N78A 5CQGA 2PI0A 4KISA 2FOKA 2IGNA 2L7MP 3EYYA 4W97A 4BJ5C 4A3KJ 4IQJA 3ZMSA 3SEZA 1VI0A 3WHCA 2H94A 2F5CA 4LOCA 4XICA 2VKEA 2ISYA 1L0OC 2L4AA 4F91B 3ABLH 2DQLA 1BIAA 4KT5C 5FGMA 3JCUC 3DP7A 3PO3J 2IS1A 3L1PA 1XGMA 3LA2A 2XF5A 3HHHA 4HW0A 4RS8A 3ZGKA 1WQ2A 4E7HA 1JJ6C 4FQGA 1VTNC 5J3LA 5L3FA 1A31A 5TGTA 3DKXA 3QOEA 2XGDA 5E17F 3L2VA 4EEFG 2WBMA 1JKOC 2GZWA 3ZQHA 4UUSA 4U87A 4S05A 3OYBA 3H5AA 4E7JA 1XSXA 3BPVA 4U88A 4ABZA 2BOLA 4GO1A 1M1EB 1GVJA 2CQXA 2VT3A 4XRSG 2XC7A 1OKRA 1WJCA 2VXDA 5KNLA 3TEDA 4JX4A 4D7MA 3DEEA 3KYDB 1X1PA 3CCSI 4P96A 4M6VA 3F23A 3DV8A 5M5WJ 3QRFF 4RGXA 4Q4ZF 4MIMA 1MMSA 2DFIA 2ME6A 4E7ZA 4IRIA 2JWTA 2LNBA 4I98B 5FFZA 4B3XA 5ICGA 2HVSA 3L9FA 2W57A 4A6EA 3IH4A 4DYCA 5M5YJ 3M1CA 2A6EF 2CGPA 4AVPA 3GYHX 3CTAA 1D0XA 4AIHA 5IPAA 2EILH 4IJAA 3CDLA 2QGUA 3G1LA 1USTA 4HBLA 4G7HF 1VQLI 1NH3A 1U5TC 4UUTA 4NC8A 2BE5F 2VBWA 1E0EA 2DFFA 2LVSA 5EEGA 1W4MA 4C3HJ 2UXNA 4F3QA 3FISA 3NARA 3TL4X 2R4GA 2NXNB 3V7SA 5F0HA 2NNNA 2QEXI 3WGHA 1ITYA 4LK0F 2F2EA 1Y8QB 5HS9A 2HTJA 3KIOA 2VQLA 2CUEA 2LDUA 2YPRA 2CRGA 3CMMA 3EUAA 2Y75A 3CDHA 1WVRA 2K9SA 2E1MC 3DU5A 1XG1A 2JVGA 1IGNA 3MN2A 1FPQA 2P5LC 1G3WA 2O7OA 1GUUA 1TWGJ 2VJ4A 2XB5A 1BW6A 1R5GA 1YJ9I 4EJWA 2B0LA 4IHYA 4B1RA 5DCMB 1OMIA 2DODA 3A01B 1YIJI 1BI0A 2K7LA 2R5YA 1ZR2A 1WSUA 5FKKA 1W7PA 2MABA 1ZK8A 1TL8A 2OAZA 3DLLF 2DMTA 3P9KA 1I27A 1BN5A 2ZSIB 2MLKA 2X6XA 1MIJA 2PMHA 3BG7A 5CVUA 2KZVA 2K02A 2WY7Q 3ONQA 5IYBJ 4IZZA 1DU6A 3HTUA 2C6YA 4FX0A 3AG4H 1FOWA 1YIOA 2EA2A 5BPDA 3O3KA 4PGGA 4PDKA 2VIXA 4UY8I 4ZH4F 4H0EA 1FBUA 2CWEA 3ZOBA 2ELKA 1SD7A 4D7NA 4OWRB 5JVTA 2L7ZA 5EEAA 1P2FA 1ZGAA 1K4TA 2LBFB 5DM7F 3OL3A 3WGIA 5E3OA 3BWGA 2LKSA 5E3MA 4IF4A 2L3DA 1JXSA 4G12A 4ZJZA 2IT0A 5HOOA 5HLGA 4IVNA 2HNHA 5GP9A 4ESJA 1S72I 3RKXA 2QCOA 3GCMA 4E7LA 4WWCA 1T38A 4OIQF 4I99C 3NQOA 1I3QJ 3A0BC 5IP6A 3L7WA 2VL8A 3PSFA 1BC8C 3AG2H 3TOAA 1P4AA 2CV0A 1ZREA 3OMYA 4RB2C 1I3AA 4BQOA 3ZP5A 3S3NA 1QHHD 3S2DJ 2STWA 4HNVA 4RM3A 5JLWA 1CQTA 2ACJA 4A2UA 4P55A 3E3VA 1QBJA 3MQ0A 3ZR8X 4L18B 2W7NA 1JGSA 1ETVA 1TBXA 3G71I 2K4BA 5D5XB 4BXUA 3SZTA 3AFHA 2RKHA 3H0DA 1FOKA 4RDUA 2CSOA 3ZN0A 4OIPF 2HZTA 4XSXF 1R36A 2DYRH 2HYGD 5L3GA 5IYDJ 3HL2A 1BOAA 2EIKH 2LMDA 3KP2A 4E7SA 2JA5J 2Q0OA 2FJ1A 4Y17A 5D6EA 1E17A 4M9ZA 4LB6B 3DEWA 1VZ0A 4R79A 3J80Z 5H6QA 2Z9OA 3ABUA 3EUHC 4NQWB 2BVLA 4CCOA 4CYCB 1RUNA 3E97A 2XDVA 4ZTFA 3VYTB 2PN6A 4HF2A 3LFUA 2PMZN 1ZRFA 5DCMA 1X3WB 2QQ8A 4QPQA 3M8JA 1FP2A 1LEAA 2DK5A 3HGGA 3F3XA 3FMRA 4KITB 2L0KA 3QYBA 2WAQN 1DUXC 2M7BA 5ILVA 3RZDJ 1IRFA 4D0PA 1XD7A 3RPUA 4G6TB 2D45A 1R5HA 2OF7A 3F8FA 1X3ZB 3FDYA 1RETA 5B66C 2DU9A 3BQYA 2CV2A 4F92B 2E35A 2FE3A 2QKLB 4A3FJ 4MLOA 1N75A 4DIQA 5L3CA 2A05A 4UVCA 3BCBA 3GZ5A 1QQIA 2K9LA 3SDGA 2MW8A 5EG0B 1YW9A 3DTKA 4CHUA 2UZKA 4J00A 3EETA 1BC7C 2VE8A 2CQQA
chains in the Genus database with same CATH topology
4L9JA 2W85A 3KFWX 3M1EA 2IA0A 3VOEA 1Z91A 1GXPA 1TTYA 4N9HA 1BBYA 2EB7A 3ISPA 2X0LA 4FT8A 3N97A 3WTTC 2P7CB 1YG2A 3I64A 4KIGA 1HW5A 4P5OA 4K2EA 2A61A 5J8FA 2E1NA 4IPAA 1G3TA 4NHJA 1DDNA 5HS7A 4FX4A 3MZYA 2Y48A 4G94A 1XCBA 3EDPA 3COAC 1ZYRF 1LNWA 3QPHA 2IA2A 3R61A 1J75A 3LFKA 3IKVA 2MH2A 2ZJ2A 3BPXA 2M5WA 1R1UA 2OZ6A 4NQWA 1SFXA 5BQTA 3G3ZA 4ZYGA 1F9NA 5DV5A 4YFXF 3E5UA 4DQ2A 1V4RA 3C3WA 2GXBA 3F6OA 1KYWA 3K1MA 5DDGA 4IRGA 3T5XA 2BV6A 1V3FA 4CICA 3I54A 1Z6TA 3KP5A 3RDIA 1TNSA 3M8FA 5CVJA 4Q5SF 5HDNA 4F7ZA 1FY7A 3FXQA 1H9GA 1KU7A 3DKWA 4HX7A 2OU2A 1IXSB 1R00A 2O3FA 2R7DA 3F8CA 4UNOA 5D5VB 5ERIA 5DYMA 3BP8A 2P6TA 1D5VA 1BJAA 3K2ZA 3LA7A 3PQJA 3QU3A 1T0FA 4EGZA 2IW5A 4A5NA 2Y0MA 2QQ9A 3F21A 3KP3A 2FEZA 3VB2A 1I6XA 3ZMDA 1QZYA 3W6KB 1MKMA 3HSRA 2EFQA 3V8LA 3PFIA 3GXOA 4LLLA 2IRFG 4G8XA 5K5OA 1KQ8A 2COMA 1IXCA 3HIFA 1XSVA 1QNTA 2A5YB 2HKXA 3DPTA 2ZKZA 2P8TA 3CUQA 4E70A 3K1PA 5FLXZ 4TV7A 3E6DA 3R0JA 2F5FA 2OBPA 2P6SA 4A6DA 2XROA 2JTVA 2ADUA 3HSFA 2QVOA 3L00A 1HQCA 1Z9CA 4JK1X 1XDSA 3HUGA 3WE2A 3WTVC 2HQRA 5HDKA 2EV6A 2GWRA 3V8JA 3HHGA 1LB2A 1XMKA 4LLGF 1RZ4A 1D8KA 2EFOA 2MA3A 1KQ9A 2XKPA 1IN8A 3K69A 4YFKF 1UFMA 3TOBA 2P4WA 4OMZA 5LGUA 2A3SA 3IC7A 2PJPA 5D4RA 1R22A 1CGPA 5K5RA 3T1BA 1UHWA 5CVRA 2CQKA 4LG0B 3ZN1A 2HEOA 1C0WA 1R1TA 1U3EM 4P9UA 4HF0A 4O3MA 1H9TA 1K79A 5J8CA 2QWWA 3GF2A 3I71A 3GX4X 5CVIA 3OOPA 1UB9A 2V1DA 3GFJA 1TW3A 2ZCWA 3W6JB 3R4KA 1EH8A 2GQQA 5LHHA 4M72A 3BOQA 4MGRA 3IHUA 4U0YA 4P9FA 3I59A 5TJJA 2YU3A 5HLIA 2M87A 3VFZA 3EQLF 3CUOA 2VOPA 2EFNA 1W7PB 4HQEA 1K6OA 2WTEA 1T98A 2JRTA 2M1BA 3H92A 1U2WA 1TW2A 5J6XA 2M8EA 1HKSA 4Y13A 1IRGA 3T8TA 1U8RA 1FT9A 1SFEA 4GCVA 3TKYA 1YQAA 2FBKA 3LAPA 3WTSC 1KA8A 1D3YA 3VEPA 5CYVA 2OD5A 3HRTA 4EJOA 1O3QA 2STTA 1U6GA 3GUDA 1STZA 4KYWA 5DD8A 4ON0A 4BYYA 2MC3A 1LDJA 2XAJA 1PDNC 5LRRA 3J81Z 4LG0A 1T6SA 4RAZA 1KGSA 5LBQA 1P92A 4B8XA 4OOIA 5KVRA 3E6CC 3OV8A 1IXRC 3L2CA 3FHZA 3WODF 2L54A 2V1XA 4G7ZF 2HWVA 1W5TA 4KN7X 4L5JA 4O5VA 2CO5A 4EM0B 5F64A 4EJTA 4KIFA 1FYMA 4Q47A 3GFIA 1ZLKA 5JI6A 3KLNA 3IWFA 4EV0A 4RB3C 1NHAA 4A0XA 1Z05A 1F5TA 1O57A 2FMLA 3FXUA 2EA4A 2BGCA 4MHGA 4ZZDA 4RGUA 2CFXA 3HRUA 5FLXK 3GW2A 5AONA 2VBZA 5L3DA 5BMZA 1XGOA 1ODDA 3V7CA 3QU6A 1KQ0A 2XIGA 4BHBA 1S29A 5IT9K 4WXDA 3QAHA 4I02A 2KIUA 5ICCA 2D2WA 2DI3A 4M9XA 3TGNA 1XGNA 4HX8A 3C18A 2QYOA 2D1HA 4LGWA 3JTGA 4KN4X 4GYGA 4NB5A 2VOOA 2JPCA 5DUIA 3EYIA 3S2WA 1IAWA 4YIFA 4XRFA 2VBYA 2Q8KA 4BAYA 1YW8A 2QBYA 2NNYA 3TO6A 4N0BA 2RDPA 2X4HA 2XRNA 4PGHA 1YS6A 2XHKA 1QZZA 1O3RA 2MLGA 2Z5UA 3ZMZA 1R58A 2E7XA 2V1UA 1MJAA 1HSJA 5LHIA 1XDUA 1KU2A 5CLSA 2ZNYA 1LVAA 4ENMA 1J59A 3TO9A 1AWCA 5E8GA 3KZZA 1TQMA 2QQBA 3R6SA 2Z33A 4L0YB 5LGNA 1XMAA 2M45A 4MTDA 1SD5A 2JPBA 2FRHA 1P4WA 1YS7A 2XASA 1KYZA 5D8LB 4KMFA 3MFKA 5K5QA 4L9NA 1ZARA 3MAJA 5AIPA 3WU0A 2KJBA 5BOXA 2FF4A 3BY6A 1XB4A 1JHHA 2DO7A 1IN7A 1W7PD 1O7FA 1D8JA 3KP4A 2KIFA 1G4DA 4M73A 5FB2A 4RB0A 1ZG5A 1S8NA 4MTEA 1J5YA 2RC4A 4MNUA 3B73A 5LLQA 2VC1A 2J5PA 2M30A 1FBSA 3K1NA 3M7GA 2YX7A 3Q9SA 4LMYA 3J81K 4L9VA 1ZG1A 3PQKA 3FMSA 3ML6A 3Q9VA 1RIOH 4EJVA 4YG2F 3HRMA 3P7NA 3JAMZ 1T2KA 3M8EA 5LHGA 5LEKA 3F22A 2F5EA 4KFCA 2ESHA 4CXFA 3ABTA 3CUQB 1GHCA 4GYIA 3FWEA 2AS5F 3E5QA 1EH7A 3Q5FA 2OQRA 3DF8A 4HZFA 5L3BA 3GFLA 2JSCA 1J7KA 4LFUA 2V79A 4CYDA 2EFWA 1RI7A 3SXYA 4M9SA 2RNJA 2OZUA 3F8MA 1KU9A 4M6YA 3D0SA 1RNLA 4R1HA 3IKTA 3BDDA 1P6RA 2ZXJA 5ED4A 2AXLA 2G7UA 4UVAA 4G7OF 3I5UA 2E1CA 2NS0A 3DEUA 2O0YA 1WI9A 3ULQB 2NRAC 1Z7UA 3H3ZA 4WCGA 3SZPA 2HOEA 3KETA 3F72A 2MBFA 2ZFWA 1O7LA 1B6AA 3IRRA 2NYXA 1Q1HA 2ELHA 4KDPA 2UWMA 2KRFA 5JR3A 3MEXA 1J9IA 2DPDA 4EM1A 1ZRDA 5TRDA 2RV8A 3ECOA 5LGTA 1FYLA 1J0RA 1YYVA 1MJ9A 3FZVA 3JSOA 2ETHA 2PBIA 3ERED 4OMYA 3I59B 4EMSA 1IN6A 3MWMA 4I0AA 1DPRA 4M6XA 3JSPA 2DK8A 1IF1A 3K9TA 1CF7B 3KEOA 4BHPA 1SAXA 3LQRA 2OQGA 1FX7A 1F4KA 4IXAA 2DTRA 2DW4A 3J80K 2XAGA 2G9WA 1LJ9A 3NRVA 4FHTA 4A12A 3AAFA 2HS5A 3P9CA 3N4MA 1HXDA 2GAUA 4OIOF 4XLPF 2BBYA 1ZGJA 3KP7A 2G7HA 4U7BA 1JE8A 2O8XA 4HLXA 1HSTA 1WRJA 3RYRA 2YR2A 2VC0A 5DEQA 3TO7A 2VBXA 2DBBA 1FC3A 1OYYA 3RKWA 3LQQA 3ZMVA 4A5MA 1S7AA 4PCQA 4ENNA 2PEXA 4IHTA 1U78A 1BM9A 1IN4A 4WX9A 1B1BA 4AIKA 3FX3A 4WXHA 3QP6A 1TNTA 2TDXA 1U5TA 4U0WA 3TDUC 4I2OA 5DCFA 5FFXA 3WG9A 2EV0A 3HYIA 1YLFA 3GVAA 3L09A 3E6BA 1USSA 3WU1B 1L3LA 1S7OA 4RAYA 4MEYF 5E1ZB 2Z3YA 3I4PA 1O3SA 1H0MA 4I7HA 4IHSA 5D8KB 5HLHA 4BQAA 3BROA 4ENJA 3CJNA 1CF7A 2FSWA 4G9YA 3I53A 2XKOA 3JAMK 1IN5A 3ZPLA 4HAMA 2QM3A 3SQNA 1ON1A 4WF2A 1ULYA 5E20A 2IP2A 3ZQ7A 1J2XA 4LB5A 3JW4A 3P9IA 2ESNA 4GXOA 2PG4A 2FBHA 1QO0D 2J5OA 4ZYEA 3R60A 4XBFA 4CDGA 4QLCU 2UXXA 4LLNA 1FNNA 1YTYA 2K27A 2IPQX 4HV5A 1YFHA 3I58A 1SMYF 1DP7P 2XV4S 2DQRA 2KJCA 2DLLA 2ZNZA 1R23A 3WGGA 2FBIA 1OYIA 1SFUA 3RI4A 3LSTA 2P7VB 3I0TA 3C7JA 3LA3A 4IRHA 2XAQA 2W84A 2QBYB 1Z1DA 4UUVA 2XGXA 5JFRA 1OPCA 1SD4A 3WTUC 1G3YA 5D5UB 2GIVA 3K0LA 3H3UA 3BJOA 3C1DA 1XN7A 4EVIA 5ILUA 2EWNA 3DQVC 2QZ8A 2BEOA 4ESBA 5A2QZ 1MD0A 3BJ6A 2R3SA 5KK1A 3QOPA 1FSHA 5HDGA 5L3EA 2LF7A 4UXNA 2XVCA 2ZBKA 1XGSA 4Z2YA 4ZZLA 3EUHA 3HOTA 2GA1A 1S6LA 4MEXF 4AD9A 4KMUX 5E1XA 2V9VA 2A6HF 1SD6A 1MDMA 4EM2A 2CYYA 4BNCA 4N9IA 5DD4A 3CLOA 2VE9A 2O03A 2HKOA 4KNYA 2JT1A 5ICFA 4ENKA 4Y15A 5CJ9A 2DPUA 2A68F 1EH6A 2EV5A 4ETSA 2CG4A 1MZBA 5CVVA 3WTYC 2L01A 1ZN2A 3QPTA 2GXGA 3O6BB 4BH9A 2EK5A 2ISZA 1YO5C 4UV8A 1Y0UA 3RPQA 1JHFA 1BI2A 2RN7A 5DUKA 1WKMA 2W25A 3F8BA 1B9NA 4Q48A 1I5ZA 1I1GA 1P4XA 4XLNF 2QQAA 5AIQA 2QLZA 3KCCA 2PMUA 4LD5A 4OINF 2P5VA 1MGTA 1TLHB 3KEQA 2WWYA 4GGGA 3GO5A 1T39A 5H6RA 3ZMTA 4R8HA 1IZ1A 5D5WB 1TQIA 3RYPA 1QPMA 2OA4A 4L5IA 1R1VA 3ROUA 3TQNA 4S04A 2YX4A 3BJAA 1FP1D 3HRSA 3B02A 2ZO4A 4UHTA 4ESFA 4I0BA 2RGVA 4JQFA 2O61A 2ZMEB 1BI1A 3QP5A 3IL2A 4CO8A 2XUBA 2QUFA 5ICEA 1FBQA 1XCVA 3MCZA 2GA2A 2H27A 2V6CA 3IWZA 4ZYHA 1HW1A 1REPC 2H09A 3RKYA 4HDUA 1GXQA 2FA5A 1BI3A 4UV9A 2VT2A 3SHFA 1FSEA 4B09A 5IT3A 1ZAOA 4HX4A 3WE3A 2PQ8A 4RGRA 4WXCA 5LEJA 3RIRA 2HDCA 1ZH5A 3GZ6A 3FF5A 4LK1F 2H6CA 3GLXA 3FM5A 3E6MA 1FZPB 1I1SA 3V8KA 4RB1A 3DPLC 5HS8A 4AIJA 2F5DA 2P5KA 2XAHA 2HFHA 1XSDA 1ONVA 2VXZA 1K78B 3ZMUA 1LDDA 2VN2A 1YW7A 3WTZA 5EEHA 1FWZA 2LF8A 2E7WA 1G6NA 2PLYA 1OYWA 2HGCA 5E1WA 3DFGA 2YSRA 4MQVA 3WTXC 2LKPA 4HOBA 3U9GA 3HOSA 2K4JA 3G73A 3KZYA 3D5LA 3NEUA 3R0AA 4I01A 2EJRA 5F1RA 1UHMA 2JZYA 5A2QK 2DT5A 6PAXA 3IRQA 2Z99A 1HW2A 2FXAA 4EGYA 2ZMEA 4JBAA 1B4AA 1FLIA 2L4MA 5ILSA 1HBXG 1UCRA 4ASNA 5E8IA 1EV7A 1ZG3A 1ZLJA 4KICA 1B59A 4L0ZB 3CO6C 2IVMA 4EQQA 5K1YA 4HA8A 3RTRA 3FM3A 1X3UA 4UVBA 3JTHA 1KU3A 2HR3A 2KIMA 2XAFA 4M71A 3U1DA 1O3TA 2IJLA 4QWQA 2WC2A 2A07F 5D4SA 2R7FA 1K7AA 3E5XA 4U7DA 4A0ZA 1U5TB 2MH9A 5H20A 5JHUA 2LSOA 1E2XA 4L9TA 4BHCA 4CGZA 1K78A 1QGPA 2L02A 1LDKB 4KA4A 4ZYDA 1RUOA 3ELKA 3BZ6A 4XSZF 2PFBA 3U2RA 4HDVA 1MJBA 3ECHA 3KLOA 5E18F 3HTSB 4PZJA 5FO5A 4G6QA 5F6FA 3WTWC 3FXRA 1DPUA 2DAOA 2RVCA 3T8RA 4RGSA 2QENA 4KUMA 4HF1A 1HKTA 2A69F 3FMQA 3KP6A 3F6VA 3VODA 4HLYA 2NAZA 4HV6A 2BYVE 1IW7F 1HKQA 4HQMA 4U0VA 4YFNF 1A04A 1OR7A 3J7AO 1PP7U 1TQPA 1FYKA 2HTSA 4G6DA 3MZHA 1WWXA 1PUEE 4M74A 5IT9Z 2K86A 3V4GA 3REOA 3LAJA 2VONA 1R7JA 4KIBA 4CZZA 4EJUA 5BS6A 3TDZC 2WV0A 1W5SA 4A0YA 5HVQC 4I09A 1F1ZA 3HSEA 5FD6A 5FD5A 1IUYA 1LQ1A 2H6BA 3M9AA 3GFMA 3T0YA 3V7RA 2MD5A 4LJZF 3CO7C 4OU0A 1Z6RA 3RJPA 1S3JA 4HYEA 2W24A 3DXJF 1PP8F 2RQPA 2CW0F 1SMTA 2FNPA 2FQ3A 2VODA 3LWFA 2EFPA 2KKOA 1B9MA 1G3SA 4OIRF 1MDMB 2FMYA 3GEZA 2FU4A 4AWXB 5LRSA 5D6FA 4DNCA 2Q2EA 3O2PE 4O6JA 2FNAA 4WK8F 2HYFA 1LEBA 2D1VA 4MQ9F 5BPIA 1BIBA 1ZRCA 3SFZA 2O6GE 3CUQC 1ZHFA 2HQNA 3KE2A 1ON2A 4YIIA 3GWZA 1AOYA 3F8NA 2IA1A 2PI0A 2FOKA 3EYYA 3ZMSA 2H94A 2F5CA 2ISYA 1L0OC 2L4AA 2DQLA 1BIAA 4KT5C 5FGMA 3DP7A 1XGMA 3LA2A 3HHHA 4HW0A 4RS8A 1WQ2A 1VTNC 5L3FA 5E17F 2GZWA 4S05A 1XSXA 3BPVA 4U88A 4GO1A 1GVJA 2VT3A 1OKRA 4P96A 3F23A 3DV8A 3QRFF 4RGXA 4Q4ZF 2DFIA 4IRIA 2LNBA 5FFZA 4I98B 5ICGA 3L9FA 2W57A 4A6EA 2A6EF 2CGPA 4AVPA 3GYHX 3CTAA 4AIHA 4IJAA 1USTA 4HBLA 4G7HF 1U5TC 2BE5F 2VBWA 5EEGA 1W4MA 2UXNA 3V7SA 2NNNA 3WGHA 4LK0F 2F2EA 5HS9A 2HTJA 2LDUA 2YPRA 2Y75A 3CDHA 1FPQA 2P5LC 1G3WA 1R5GA 4EJWA 2B0LA 5DCMB 1OMIA 1BI0A 2K7LA 1WSUA 1W7PA 2OAZA 3P9KA 1I27A 1BN5A 2MLKA 2PMHA 5CVUA 2K02A 3HTUA 2C6YA 4FX0A 1YIOA 2EA2A 5BPDA 3O3KA 4PGGA 4PDKA 4ZH4F 4H0EA 1FBUA 2CWEA 1SD7A 5JVTA 1P2FA 1ZGAA 3WGIA 3BWGA 4IF4A 2L3DA 1JXSA 2IT0A 5HOOA 5HLGA 4IVNA 4ESJA 3RKXA 4WWCA 1T38A 4OIQF 3NQOA 3L7WA 1BC8C 3TOAA 1P4AA 1ZREA 4RB2C 3ZP5A 2STWA 2ACJA 4A2UA 4P55A 3E3VA 1QBJA 3MQ0A 4L18B 1JGSA 1TBXA 2K4BA 5D5XB 4BXUA 3SZTA 2RKHA 1FOKA 2CSOA 3ZN0A 4OIPF 2HZTA 4XSXF 1R36A 2HYGD 5L3GA 1BOAA 3KP2A 2Q0OA 4Y17A 5D6EA 1E17A 4M9ZA 4LB6B 4R79A 3J80Z 5H6QA 2Z9OA 3ABUA 1RUNA 3E97A 2PN6A 4HF2A 1ZRFA 5DCMA 1FP2A 1LEAA 2DK5A 3F3XA 3FMRA 1DUXC 5ILVA 1IRFA 4D0PA 1XD7A 3RPUA 2D45A 1R5HA 3F8FA 2DU9A 2FE3A 5L3CA 4UVCA 3GZ5A 1QQIA 1YW9A 4CHUA 2UZKA 3EETA 1BC7C 2VE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9J A;  2W85 A;  3KFW X;  3M1E A;  2IA0 A;  3VOE A;  1Z91 A;  1GXP A;  1TTY A;  4N9H A;  1BBY A;  2EB7 A;  3ISP A;  2X0L A;  4FT8 A;  3N97 A;  3WTT C;  2P7C B;  1YG2 A;  3I64 A;  4KIG A;  1HW5 A;  4P5O A;  4K2E A;  2A61 A;  5J8F A;  2E1N A;  4IPA A;  1G3T A;  4NHJ A;  1DDN A;  5HS7 A;  4FX4 A;  3MZY A;  2Y48 A;  4G94 A;  1XCB A;  3EDP A;  3COA C;  1ZYR F;  1LNW A;  3QPH A;  2IA2 A;  3R61 A;  1J75 A;  3LFK A;  3IKV A;  2MH2 A;  2ZJ2 A;  3BPX A;  2M5W A;  1R1U A;  2OZ6 A;  4NQW A;  1SFX A;  5BQT A;  3G3Z A;  4ZYG A;  1F9N A;  5DV5 A;  4YFX F;  3E5U A;  4DQ2 A;  1V4R A;  3C3W A;  2GXB A;  3F6O A;  1KYW A;  3K1M A;  5DDG A;  4IRG A;  3T5X A;  2BV6 A;  1V3F A;  4CIC A;  3I54 A;  1Z6T A;  3KP5 A;  3RDI A;  1TNS A;  3M8F A;  5CVJ A;  4Q5S F;  5HDN A;  4F7Z A;  1FY7 A;  3FXQ A;  1H9G A;  1KU7 A;  3DKW A;  4HX7 A;  2OU2 A;  1IXS B;  1R00 A;  2O3F A;  2R7D A;  3F8C A;  4UNO A;  5D5V B;  5ERI A;  5DYM A;  3BP8 A;  2P6T A;  1D5V A;  1BJA A;  3K2Z A;  3LA7 A;  3PQJ A;  3QU3 A;  1T0F A;  4EGZ A;  2IW5 A;  4A5N A;  2Y0M A;  2QQ9 A;  3F21 A;  3KP3 A;  2FEZ A;  3VB2 A;  1I6X A;  3ZMD A;  1QZY A;  3W6K B;  1MKM A;  3HSR A;  2EFQ A;  3V8L A;  3PFI A;  3GXO A;  4LLL A;  2IRF G;  4G8X A;  5K5O A;  1KQ8 A;  2COM A;  1IXC A;  3HIF A;  1XSV A;  1QNT A;  2A5Y B;  2HKX A;  3DPT A;  2ZKZ A;  2P8T A;  3CUQ A;  4E70 A;  3K1P A;  5FLX Z;  4TV7 A;  3E6D A;  3R0J A;  2F5F A;  2OBP A;  2P6S A;  4A6D A;  2XRO A;  2JTV A;  2ADU A;  3HSF A;  2QVO A;  3L00 A;  1HQC A;  1Z9C A;  4JK1 X;  1XDS A;  3HUG A;  3WE2 A;  3WTV C;  2HQR A;  5HDK A;  2EV6 A;  2GWR A;  3V8J A;  3HHG A;  1LB2 A;  1XMK A;  4LLG F;  1RZ4 A;  1D8K A;  2EFO A;  2MA3 A;  1KQ9 A;  2XKP A;  1IN8 A;  3K69 A;  4YFK F;  1UFM A;  3TOB A;  2P4W A;  4OMZ A;  5LGU A;  2A3S A;  3IC7 A;  2PJP A;  5D4R A;  1R22 A;  1CGP A;  5K5R A;  3T1B A;  1UHW A;  5CVR A;  2CQK A;  4LG0 B;  3ZN1 A;  2HEO A;  1C0W A;  1R1T A;  1U3E M;  4P9U A;  4HF0 A;  4O3M A;  1H9T A;  1K79 A;  5J8C A;  2QWW A;  3GF2 A;  3I71 A;  3GX4 X;  5CVI A;  3OOP A;  1UB9 A;  2V1D A;  3GFJ A;  1TW3 A;  2ZCW A;  3W6J B;  3R4K A;  1EH8 A;  2GQQ A;  5LHH A;  4M72 A;  3BOQ A;  4MGR A;  3IHU A;  4U0Y A;  4P9F A;  3I59 A;  5TJJ A;  2YU3 A;  5HLI A;  2M87 A;  3VFZ A;  3EQL F;  3CUO A;  2VOP A;  2EFN A;  1W7P B;  4HQE A;  1K6O A;  2WTE A;  1T98 A;  2JRT A;  2M1B A;  3H92 A;  1U2W A;  1TW2 A;  5J6X A;  2M8E A;  1HKS A;  4Y13 A;  1IRG A;  3T8T A;  1U8R A;  1FT9 A;  1SFE A;  4GCV A;  3TKY A;  1YQA A;  2FBK A;  3LAP A;  3WTS C;  1KA8 A;  1D3Y A;  3VEP A;  5CYV A;  2OD5 A;  3HRT A;  4EJO A;  1O3Q A;  2STT A;  1U6G A;  3GUD A;  1STZ A;  4KYW A;  5DD8 A;  4ON0 A;  4BYY A;  2MC3 A;  1LDJ A;  2XAJ A;  1PDN C;  5LRR A;  3J81 Z;  4LG0 A;  1T6S A;  4RAZ A;  1KGS A;  5LBQ A;  1P92 A;  4B8X A;  4OOI A;  5KVR A;  3E6C C;  3OV8 A;  1IXR C;  3L2C A;  3FHZ A;  3WOD F;  2L54 A;  2V1X A;  4G7Z F;  2HWV A;  1W5T A;  4KN7 X;  4L5J A;  4O5V A;  2CO5 A;  4EM0 B;  5F64 A;  4EJT A;  4KIF A;  1FYM A;  4Q47 A;  3GFI A;  1ZLK A;  5JI6 A;  3KLN A;  3IWF A;  4EV0 A;  4RB3 C;  1NHA A;  4A0X A;  1Z05 A;  1F5T A;  1O57 A;  2FML A;  3FXU A;  2EA4 A;  2BGC A;  4MHG A;  4ZZD A;  4RGU A;  2CFX A;  3HRU A;  5FLX K;  3GW2 A;  5AON A;  2VBZ A;  5L3D A;  5BMZ A;  1XGO A;  1ODD A;  3V7C A;  3QU6 A;  1KQ0 A;  2XIG A;  4BHB A;  1S29 A;  5IT9 K;  4WXD A;  3QAH A;  4I02 A;  2KIU A;  5ICC A;  2D2W A;  2DI3 A;  4M9X A;  3TGN A;  1XGN A;  4HX8 A;  3C18 A;  2QYO A;  2D1H A;  4LGW A;  3JTG A;  4KN4 X;  4GYG A;  4NB5 A;  2VOO A;  2JPC A;  5DUI A;  3EYI A;  3S2W A;  1IAW A;  4YIF A;  4XRF A;  2VBY A;  2Q8K A;  4BAY A;  1YW8 A;  2QBY A;  2NNY A;  3TO6 A;  4N0B A;  2RDP A;  2X4H A;  2XRN A;  4PGH A;  1YS6 A;  2XHK A;  1QZZ A;  1O3R A;  2MLG A;  2Z5U A;  3ZMZ A;  1R58 A;  2E7X A;  2V1U A;  1MJA A;  1HSJ A;  5LHI A;  1XDU A;  1KU2 A;  5CLS A;  2ZNY A;  1LVA A;  4ENM A;  1J59 A;  3TO9 A;  1AWC A;  5E8G A;  3KZZ A;  1TQM A;  2QQB A;  3R6S A;  2Z33 A;  4L0Y B;  5LGN A;  1XMA A;  2M45 A;  4MTD A;  1SD5 A;  2JPB A;  2FRH A;  1P4W A;  1YS7 A;  2XAS A;  1KYZ A;  5D8L B;  4KMF A;  3MFK A;  5K5Q A;  4L9N A;  1ZAR A;  3MAJ A;  5AIP A;  3WU0 A;  2KJB A;  5BOX A;  2FF4 A;  3BY6 A;  1XB4 A;  1JHH A;  2DO7 A;  1IN7 A;  1W7P D;  1O7F A;  1D8J A;  3KP4 A;  2KIF A;  1G4D A;  4M73 A;  5FB2 A;  4RB0 A;  1ZG5 A;  1S8N A;  4MTE A;  1J5Y A;  2RC4 A;  4MNU A;  3B73 A;  5LLQ A;  2VC1 A;  2J5P A;  2M30 A;  1FBS A;  3K1N A;  3M7G A;  2YX7 A;  3Q9S A;  4LMY A;  3J81 K;  4L9V A;  1ZG1 A;  3PQK A;  3FMS A;  3ML6 A;  3Q9V A;  1RIO H;  4EJV A;  4YG2 F;  3HRM A;  3P7N A;  3JAM Z;  1T2K A;  3M8E A;  5LHG A;  5LEK A;  3F22 A;  2F5E A;  4KFC A;  2ESH A;  4CXF A;  3ABT A;  3CUQ B;  1GHC A;  4GYI A;  3FWE A;  2AS5 F;  3E5Q A;  1EH7 A;  3Q5F A;  2OQR A;  3DF8 A;  4HZF A;  5L3B A;  3GFL A;  2JSC A;  1J7K A;  4LFU A;  2V79 A;  4CYD A;  2EFW A;  1RI7 A;  3SXY A;  4M9S A;  2RNJ A;  2OZU A;  3F8M A;  1KU9 A;  4M6Y A;  3D0S A;  1RNL A;  4R1H A;  3IKT A;  3BDD A;  1P6R A;  2ZXJ A;  5ED4 A;  2AXL A;  2G7U A;  4UVA A;  4G7O F;  3I5U A;  2E1C A;  2NS0 A;  3DEU A;  2O0Y A;  1WI9 A;  3ULQ B;  2NRA C;  1Z7U A;  3H3Z A;  4WCG A;  3SZP A;  2HOE A;  3KET A;  3F72 A;  2MBF A;  2ZFW A;  1O7L A;  1B6A A;  3IRR A;  2NYX A;  1Q1H A;  2ELH A;  4KDP A;  2UWM A;  2KRF A;  5JR3 A;  3MEX A;  1J9I A;  2DPD A;  4EM1 A;  1ZRD A;  5TRD A;  2RV8 A;  3ECO A;  5LGT A;  1FYL A;  1J0R A;  1YYV A;  1MJ9 A;  3FZV A;  3JSO A;  2ETH A;  2PBI A;  3ERE D;  4OMY A;  3I59 B;  4EMS A;  1IN6 A;  3MWM A;  4I0A A;  1DPR A;  4M6X A;  3JSP A;  2DK8 A;  1IF1 A;  3K9T A;  1CF7 B;  3KEO A;  4BHP A;  1SAX A;  3LQR A;  2OQG A;  1FX7 A;  1F4K A;  4IXA A;  2DTR A;  2DW4 A;  3J80 K;  2XAG A;  2G9W A;  1LJ9 A;  3NRV A;  4FHT A;  4A12 A;  3AAF A;  2HS5 A;  3P9C A;  3N4M A;  1HXD A;  2GAU A;  4OIO F;  4XLP F;  2BBY A;  1ZGJ A;  3KP7 A;  2G7H A;  4U7B A;  1JE8 A;  2O8X A;  4HLX A;  1HST A;  1WRJ A;  3RYR A;  2YR2 A;  2VC0 A;  5DEQ A;  3TO7 A;  2VBX A;  2DBB A;  1FC3 A;  1OYY A;  3RKW A;  3LQQ A;  3ZMV A;  4A5M A;  1S7A A;  4PCQ A;  4ENN A;  2PEX A;  4IHT A;  1U78 A;  1BM9 A;  1IN4 A;  4WX9 A;  1B1B A;  4AIK A;  3FX3 A;  4WXH A;  3QP6 A;  1TNT A;  2TDX A;  1U5T A;  4U0W A;  3TDU C;  4I2O A;  5DCF A;  5FFX A;  3WG9 A;  2EV0 A;  3HYI A;  1YLF A;  3GVA A;  3L09 A;  3E6B A;  1USS A;  3WU1 B;  1L3L A;  1S7O A;  4RAY A;  4MEY F;  5E1Z B;  2Z3Y A;  3I4P A;  1O3S A;  1H0M A;  4I7H A;  4IHS A;  5D8K B;  5HLH A;  4BQA A;  3BRO A;  4ENJ A;  3CJN A;  1CF7 A;  2FSW A;  4G9Y A;  3I53 A;  2XKO A;  3JAM K;  1IN5 A;  3ZPL A;  4HAM A;  2QM3 A;  3SQN A;  1ON1 A;  4WF2 A;  1ULY A;  5E20 A;  2IP2 A;  3ZQ7 A;  1J2X A;  4LB5 A;  3JW4 A;  3P9I A;  2ESN A;  4GXO A;  2PG4 A;  2FBH A;  1QO0 D;  2J5O A;  4ZYE A;  3R60 A;  4XBF A;  4CDG A;  4QLC U;  2UXX A;  4LLN A;  1FNN A;  1YTY A;  2K27 A;  2IPQ X;  4HV5 A;  1YFH A;  3I58 A;  1SMY F;  1DP7 P;  2XV4 S;  2DQR A;  2KJC A;  2DLL A;  2ZNZ A;  1R23 A;  3WGG A;  2FBI A;  1OYI A;  1SFU A;  3RI4 A;  3LST A;  2P7V B;  3I0T A;  3C7J A;  3LA3 A;  4IRH A;  2XAQ A;  2W84 A;  2QBY B;  1Z1D A;  4UUV A;  2XGX A;  5JFR A;  1OPC A;  1SD4 A;  3WTU C;  1G3Y A;  5D5U B;  2GIV A;  3K0L A;  3H3U A;  3BJO A;  3C1D A;  1XN7 A;  4EVI A;  5ILU A;  2EWN A;  3DQV C;  2QZ8 A;  2BEO A;  4ESB A;  5A2Q Z;  1MD0 A;  3BJ6 A;  2R3S A;  5KK1 A;  3QOP A;  1FSH A;  5HDG A;  5L3E A;  2LF7 A;  4UXN A;  2XVC A;  2ZBK A;  1XGS A;  4Z2Y A;  4ZZL A;  3EUH A;  3HOT A;  2GA1 A;  1S6L A;  4MEX F;  4AD9 A;  4KMU X;  5E1X A;  2V9V A;  2A6H F;  1SD6 A;  1MDM A;  4EM2 A;  2CYY A;  4BNC A;  4N9I A;  5DD4 A;  3CLO A;  2VE9 A;  2O03 A;  2HKO A;  4KNY A;  2JT1 A;  5ICF A;  4ENK A;  4Y15 A;  5CJ9 A;  2DPU A;  2A68 F;  1EH6 A;  2EV5 A;  4ETS A;  2CG4 A;  1MZB A;  5CVV A;  3WTY C;  2L01 A;  1ZN2 A;  3QPT A;  2GXG A;  3O6B B;  4BH9 A;  2EK5 A;  2ISZ A;  1YO5 C;  4UV8 A;  1Y0U A;  3RPQ A;  1JHF A;  1BI2 A;  2RN7 A;  5DUK A;  1WKM A;  2W25 A;  3F8B A;  1B9N A;  4Q48 A;  1I5Z A;  1I1G A;  1P4X A;  4XLN F;  2QQA A;  5AIQ A;  2QLZ A;  3KCC A;  2PMU A;  4LD5 A;  4OIN F;  2P5V A;  1MGT A;  1TLH B;  3KEQ A;  2WWY A;  4GGG A;  3GO5 A;  1T39 A;  5H6R A;  3ZMT A;  4R8H A;  1IZ1 A;  5D5W B;  1TQI A;  3RYP A;  1QPM A;  2OA4 A;  4L5I A;  1R1V A;  3ROU A;  3TQN A;  4S04 A;  2YX4 A;  3BJA A;  1FP1 D;  3HRS A;  3B02 A;  2ZO4 A;  4UHT A;  4ESF A;  4I0B A;  2RGV A;  4JQF A;  2O61 A;  2ZME B;  1BI1 A;  3QP5 A;  3IL2 A;  4CO8 A;  2XUB A;  2QUF A;  5ICE A;  1FBQ A;  1XCV A;  3MCZ A;  2GA2 A;  2H27 A;  2V6C A;  3IWZ A;  4ZYH A;  1HW1 A;  1REP C;  2H09 A;  3RKY A;  4HDU A;  1GXQ A;  2FA5 A;  1BI3 A;  4UV9 A;  2VT2 A;  3SHF A;  1FSE A;  4B09 A;  5IT3 A;  1ZAO A;  4HX4 A;  3WE3 A;  2PQ8 A;  4RGR A;  4WXC A;  5LEJ A;  3RIR A;  2HDC A;  1ZH5 A;  3GZ6 A;  3FF5 A;  4LK1 F;  2H6C A;  3GLX A;  3FM5 A;  3E6M A;  1FZP B;  1I1S A;  3V8K A;  4RB1 A;  3DPL C;  5HS8 A;  4AIJ A;  2F5D A;  2P5K A;  2XAH A;  2HFH A;  1XSD A;  1ONV A;  2VXZ A;  1K78 B;  3ZMU A;  1LDD A;  2VN2 A;  1YW7 A;  3WTZ A;  5EEH A;  1FWZ A;  2LF8 A;  2E7W A;  1G6N A;  2PLY A;  1OYW A;  2HGC A;  5E1W A;  3DFG A;  2YSR A;  4MQV A;  3WTX C;  2LKP A;  4HOB A;  3U9G A;  3HOS A;  2K4J A;  3G73 A;  3KZY A;  3D5L A;  3NEU A;  3R0A A;  4I01 A;  2EJR A;  5F1R A;  1UHM A;  2JZY A;  5A2Q K;  2DT5 A;  6PAX A;  3IRQ A;  2Z99 A;  1HW2 A;  2FXA A;  4EGY A;  2ZME A;  4JBA A;  1B4A A;  1FLI A;  2L4M A;  5ILS A;  1HBX G;  1UCR A;  4ASN A;  5E8I A;  1EV7 A;  1ZG3 A;  1ZLJ A;  4KIC A;  1B59 A;  4L0Z B;  3CO6 C;  2IVM A;  4EQQ A;  5K1Y A;  4HA8 A;  3RTR A;  3FM3 A;  1X3U A;  4UVB A;  3JTH A;  1KU3 A;  2HR3 A;  2KIM A;  2XAF A;  4M71 A;  3U1D A;  1O3T A;  2IJL A;  4QWQ A;  2WC2 A;  2A07 F;  5D4S A;  2R7F A;  1K7A A;  3E5X A;  4U7D A;  4A0Z A;  1U5T B;  2MH9 A;  5H20 A;  5JHU A;  2LSO A;  1E2X A;  4L9T A;  4BHC A;  4CGZ A;  1K78 A;  1QGP A;  2L02 A;  1LDK B;  4KA4 A;  4ZYD A;  1RUO A;  3ELK A;  3BZ6 A;  4XSZ F;  2PFB A;  3U2R A;  4HDV A;  1MJB A;  3ECH A;  3KLO A;  5E18 F;  3HTS B;  4PZJ A;  5FO5 A;  4G6Q A;  5F6F A;  3WTW C;  3FXR A;  1DPU A;  2DAO A;  2RVC A;  3T8R A;  4RGS A;  2QEN A;  4KUM A;  4HF1 A;  1HKT A;  2A69 F;  3FMQ A;  3KP6 A;  3F6V A;  3VOD A;  4HLY A;  2NAZ A;  4HV6 A;  2BYV E;  1IW7 F;  1HKQ A;  4HQM A;  4U0V A;  4YFN F;  1A04 A;  1OR7 A;  3J7A O;  1PP7 U;  1TQP A;  1FYK A;  2HTS A;  4G6D A;  3MZH A;  1WWX A;  1PUE E;  4M74 A;  5IT9 Z;  2K86 A;  3V4G A;  3REO A;  3LAJ A;  2VON A;  1R7J A;  4KIB A;  4CZZ A;  4EJU A;  5BS6 A;  3TDZ C;  2WV0 A;  1W5S A;  4A0Y A;  5HVQ C;  4I09 A;  1F1Z A;  3HSE A;  5FD6 A;  5FD5 A;  1IUY A;  1LQ1 A;  2H6B A;  3M9A A;  3GFM A;  3T0Y A;  3V7R A;  2MD5 A;  4LJZ F;  3CO7 C;  4OU0 A;  1Z6R A;  3RJP A;  1S3J A;  4HYE A;  2W24 A;  3DXJ F;  1PP8 F;  2RQP A;  2CW0 F;  1SMT A;  2FNP A;  2FQ3 A;  2VOD A;  3LWF A;  2EFP A;  2KKO A;  1B9M A;  1G3S A;  4OIR F;  1MDM B;  2FMY A;  3GEZ A;  2FU4 A;  4AWX B;  5LRS A;  5D6F A;  4DNC A;  2Q2E A;  3O2P E;  4O6J A;  2FNA A;  4WK8 F;  2HYF A;  1LEB A;  2D1V A;  4MQ9 F;  5BPI A;  1BIB A;  1ZRC A;  3SFZ A;  2O6G E;  3CUQ C;  1ZHF A;  2HQN A;  3KE2 A;  1ON2 A;  4YII A;  3GWZ A;  1AOY A;  3F8N A;  2IA1 A;  2PI0 A;  2FOK A;  3EYY A;  3ZMS A;  2H94 A;  2F5C A;  2ISY A;  1L0O C;  2L4A A;  2DQL A;  1BIA A;  4KT5 C;  5FGM A;  3DP7 A;  1XGM A;  3LA2 A;  3HHH A;  4HW0 A;  4RS8 A;  1WQ2 A;  1VTN C;  5L3F A;  5E17 F;  2GZW A;  4S05 A;  1XSX A;  3BPV A;  4U88 A;  4GO1 A;  1GVJ A;  2VT3 A;  1OKR A;  4P96 A;  3F23 A;  3DV8 A;  3QRF F;  4RGX A;  4Q4Z F;  2DFI A;  4IRI A;  2LNB A;  5FFZ A;  4I98 B;  5ICG A;  3L9F A;  2W57 A;  4A6E A;  2A6E F;  2CGP A;  4AVP A;  3GYH X;  3CTA A;  4AIH A;  4IJA A;  1UST A;  4HBL A;  4G7H F;  1U5T C;  2BE5 F;  2VBW A;  5EEG A;  1W4M A;  2UXN A;  3V7S A;  2NNN A;  3WGH A;  4LK0 F;  2F2E A;  5HS9 A;  2HTJ A;  2LDU A;  2YPR A;  2Y75 A;  3CDH A;  1FPQ A;  2P5L C;  1G3W A;  1R5G A;  4EJW A;  2B0L A;  5DCM B;  1OMI A;  1BI0 A;  2K7L A;  1WSU A;  1W7P A;  2OAZ A;  3P9K A;  1I27 A;  1BN5 A;  2MLK A;  2PMH A;  5CVU A;  2K02 A;  3HTU A;  2C6Y A;  4FX0 A;  1YIO A;  2EA2 A;  5BPD A;  3O3K A;  4PGG A;  4PDK A;  4ZH4 F;  4H0E A;  1FBU A;  2CWE A;  1SD7 A;  5JVT A;  1P2F A;  1ZGA A;  3WGI A;  3BWG A;  4IF4 A;  2L3D A;  1JXS A;  2IT0 A;  5HOO A;  5HLG A;  4IVN A;  4ESJ A;  3RKX A;  4WWC A;  1T38 A;  4OIQ F;  3NQO A;  3L7W A;  1BC8 C;  3TOA A;  1P4A A;  1ZRE A;  4RB2 C;  3ZP5 A;  2STW A;  2ACJ A;  4A2U A;  4P55 A;  3E3V A;  1QBJ A;  3MQ0 A;  4L18 B;  1JGS A;  1TBX A;  2K4B A;  5D5X B;  4BXU A;  3SZT A;  2RKH A;  1FOK A;  2CSO A;  3ZN0 A;  4OIP F;  2HZT A;  4XSX F;  1R36 A;  2HYG D;  5L3G A;  1BOA A;  3KP2 A;  2Q0O A;  4Y17 A;  5D6E A;  1E17 A;  4M9Z A;  4LB6 B;  4R79 A;  3J80 Z;  5H6Q A;  2Z9O A;  3ABU A;  1RUN A;  3E97 A;  2PN6 A;  4HF2 A;  1ZRF A;  5DCM A;  1FP2 A;  1LEA A;  2DK5 A;  3F3X A;  3FMR A;  1DUX C;  5ILV A;  1IRF A;  4D0P A;  1XD7 A;  3RPU A;  2D45 A;  1R5H A;  3F8F A;  2DU9 A;  2FE3 A;  5L3C A;  4UVC A;  3GZ5 A;  1QQI A;  1YW9 A;  4CHU A;  2UZK A;  3EET A;  1BC7 C;  2VE8 A; 
#chains in the Genus database with same CATH topology
 3L2W A;  2CUF A;  4L9J A;  5HOD A;  1EA3 A;  1X2M A;  2F4I A;  1D1A A;  2W85 A;  3KFW X;  1WH7 A;  3M1E A;  4FCY A;  2IA0 A;  2DT7 B;  2H8W A;  3VOE A;  1YHQ I;  1Z91 A;  3OIP A;  1GXP A;  1J09 A;  2X85 A;  2IGO A;  5B1B H;  3S16 J;  1WJ5 A;  1TTY A;  4BJT A;  4N9H A;  1BBY A;  2JMW A;  4FE7 A;  2EB7 A;  3ISP A;  1HA8 A;  2X0L A;  2IGK A;  2QF7 A;  4FT8 A;  3N97 A;  3WTT C;  2KHM A;  2LOO A;  2P7C B;  1YG2 A;  3I64 A;  2LKX A;  2ZC2 A;  4KIG A;  1HW5 A;  4P5O A;  4K2E A;  2A61 A;  5J8F A;  2E1N A;  4Y52 J;  4IPA A;  1P9Q C;  1G3T A;  2R7Q A;  4NHJ A;  1DDN A;  3OS1 A;  1YE9 A;  1IRZ A;  5HS7 A;  4FX4 A;  3MZY A;  2Y48 A;  4G94 A;  1XCB A;  3EDP A;  3COA C;  4XID A;  1WJA A;  3EPZ A;  4DBQ A;  1ZYR F;  4PFP A;  1LNW A;  3QPH A;  2IA2 A;  3R61 A;  2KT0 A;  2VLA A;  1S5L C;  3GTJ J;  1J75 A;  3LFK A;  1WJF A;  4A3D J;  3H0G J;  3IKV A;  2MH2 A;  2ZJ2 A;  3BPX A;  2M5W A;  3BTL A;  1R1U A;  2OZ6 A;  3TMO A;  4NQW A;  1SFX A;  1TP4 A;  4ZC3 A;  2EZI A;  2NVY J;  5BQT A;  3BZK A;  3G3Z A;  4ZYG A;  4PSX A;  4XLE A;  1F9N A;  3S93 A;  3J7A Y;  5DV5 A;  4YFX F;  2B9S A;  3E5U A;  4DQ2 A;  1V4R A;  1TZL A;  3OWT A;  2ZSH B;  3BR5 A;  3C3W A;  2GXB A;  2F4M B;  3F6O A;  1KYW A;  5FLM J;  2DA5 A;  2IBD A;  5HNF A;  1V5E A;  3K1M A;  2R7U A;  2LY9 A;  3LOC A;  3TBI A;  4AYB A;  3HUG B;  2M3A A;  2DDB A;  1HLV A;  2R0Q C;  5DDG A;  2VUM J;  3DKY A;  1TWF J;  1Z77 A;  4XLC A;  4IRG A;  1LPQ A;  3FBN B;  3M07 A;  3T5X A;  5M3M J;  2BV6 A;  2Y30 A;  1V3F A;  4CIC A;  3FXM A;  3I54 A;  4XKC A;  3OS0 A;  1Z6T A;  3KP5 A;  3RDI A;  1TNS A;  3M8F A;  5CVJ A;  4Q5S F;  3K4M A;  5HDN A;  3HDD A;  4F7Z A;  1FY7 A;  5EG0 A;  1SFO J;  5BNG A;  1OCO H;  2Y31 A;  3FXQ A;  4PJL A;  3OR2 C;  2X1C A;  2KIS A;  3HOY J;  3K10 A;  2DFH A;  4N4N B;  2XGE A;  4BBS J;  1Y8R B;  3CQZ J;  1YRN B;  3JRI A;  3OS2 A;  2DA2 A;  1H9G A;  1KU7 A;  3DKW A;  5IY5 H;  3S17 J;  4HX7 A;  3SJM A;  1X1C A;  2OU2 A;  3RPU D;  1IXS B;  3MZ8 A;  1R00 A;  2O3F A;  4QPO A;  3JRB A;  2R7D A;  3F8C A;  4UNO A;  3LMM A;  5D5V B;  5ERI A;  4A3E J;  5DYM A;  1WJE A;  3BP8 A;  2LR8 A;  2P6T A;  3I4N J;  1D5V A;  1H89 C;  1BJA A;  3K2Z A;  2CQ7 A;  3LA7 A;  3PQJ A;  3QU3 A;  1T0F A;  3UKG A;  3OYL A;  4EGZ A;  2IW5 A;  4A5N A;  1G2H A;  3CCM I;  2Y0M A;  2QQ9 A;  2XPU A;  3F21 A;  3KP3 A;  3L2R A;  2FEZ A;  1A35 A;  4FE4 A;  1FEX A;  3VB2 A;  1I6X A;  4XKV A;  3ZMD A;  4IKF A;  1QZY A;  1BL0 A;  1IC8 A;  3W6K B;  1MKM A;  3HSR A;  3OYJ A;  4Z6Y A;  2EFQ A;  3V8L A;  4HRI A;  1FMV A;  1T08 B;  3PFI A;  3HOX J;  1IV6 A;  3GXO A;  4LLL A;  2IRF G;  2JA8 J;  4DOZ A;  4G8X A;  2K3F A;  5K5O A;  5EGO B;  1KQ8 A;  2COM A;  2NS7 A;  4XOP A;  1B8I A;  1IXC A;  1MSE C;  3HIF A;  4DYR A;  3GTQ J;  1XSV A;  2MD0 A;  1QNT A;  2A5Y B;  2HKX A;  4P1W A;  3DPT A;  4D9J A;  1W5C C;  2ZKZ A;  2GM4 A;  2P8T A;  4BQN A;  1JUM A;  1X1B A;  3CUQ A;  2QSH X;  2M0C A;  4XK4 A;  4E70 A;  3K1P A;  5FLX Z;  3PUF A;  4TV7 A;  2V26 A;  3OL4 A;  3E6D A;  1RPW A;  3R0J A;  2F5F A;  2OBP A;  2ZME C;  2P6S A;  4A6D A;  3HBL A;  2HPM A;  2XRO A;  2JTV A;  2ADU A;  1MNE A;  1DU0 A;  3HSF A;  2QVO A;  3L00 A;  1HQC A;  1Z9C A;  4L5E A;  1GV5 A;  3LSM A;  4JK1 X;  1XDS A;  3HUG A;  5JHF A;  3WE2 A;  3CCJ I;  3WTV C;  1QVU A;  2ELJ A;  1JI8 A;  1GLN A;  1MW7 A;  2HQR A;  5HDK A;  5LFA A;  2JA6 J;  1VQ4 I;  2EV6 A;  4AUX A;  2GWR A;  4UUS B;  5C3E J;  4F52 A;  3V8J A;  3HHG A;  1LB2 A;  4RAF A;  2XAU A;  1XMK A;  4LLG F;  1RZ4 A;  3D5S C;  1Y1W J;  2EBI A;  4DBR A;  1D8K A;  2L9S A;  3HG9 A;  3U1K A;  4BEH A;  2EFO A;  2GOX B;  2MA3 A;  1KQ9 A;  2XKP A;  2XRL A;  2AXT C;  1IN8 A;  3K69 A;  4YFK F;  4XNF A;  3BQZ A;  1UFM A;  1YIT I;  3TOB A;  2OTL I;  2P4W A;  2HZD A;  4OMZ A;  1YRN A;  1ZEL A;  5LGU A;  2A3S A;  3IC7 A;  3QOD A;  2PJP A;  1UJ8 A;  3MKL A;  4CUG A;  1R22 A;  5D4R A;  3VYU B;  1CGP A;  5K5R A;  3T1B A;  1UHW A;  5CVR A;  1NK3 P;  2CQK A;  1JTX A;  2KL4 A;  4LG0 B;  3ZN1 A;  1ETX A;  2HEO A;  2F48 A;  1PYV A;  1C0W A;  1HDD C;  1R1T A;  1GVD A;  5IP7 J;  1U3E M;  4P9U A;  4HF0 A;  2V9P A;  2UUZ A;  4O3M A;  1V5F A;  1H9T A;  1K79 A;  2R93 J;  3ERM A;  1RKW A;  5J8C A;  2QWW A;  2VKD A;  2EPF A;  3GF2 A;  4FET A;  2JA2 A;  3I71 A;  4PJN A;  3CZ6 A;  4PJ0 C;  3GX4 X;  4M3B A;  5CVI A;  3OOP A;  2IGM A;  3BG9 A;  4I76 A;  1UB9 A;  2V1D A;  3GFJ A;  1AU7 A;  3AG3 H;  1TW3 A;  2ZCW A;  3A2K A;  3W6J B;  3R4K A;  3J7Z I;  4A69 C;  2EQR A;  4AC0 A;  1EH8 A;  2GQQ A;  2DOE A;  2VI6 A;  5LHH A;  1Y6I A;  2MGQ A;  1H8A C;  3CDI A;  5GTI C;  3K70 D;  4M72 A;  3BR1 A;  3BOQ A;  4MGR A;  3IHU A;  3KYC B;  3N05 A;  3F9K A;  4U0Y A;  1Y39 A;  4P9F A;  2YU9 J;  2V7F A;  3I59 A;  5TJJ A;  2YU3 A;  1HCR A;  5EJC A;  1D1C A;  5HLI A;  3A03 A;  2M87 A;  3VFZ A;  3EQL F;  3OYH A;  3CUO A;  3RCO A;  1TT0 A;  2VOP A;  2R5Y B;  2EFN A;  3K4N A;  1W7P B;  4HQE A;  2BXZ A;  1K6O A;  2Y0S N;  5GPC A;  2WTE A;  1T98 A;  2IAI A;  2JRT A;  2M1B A;  3H92 A;  1R6R A;  4NUB A;  1VQ7 I;  4D5F A;  3B6A A;  3ZRG A;  1U2W A;  1TW2 A;  1WCM J;  5J6X A;  1I39 A;  2QSF X;  3FBI B;  2M8E A;  1IG7 A;  1HKS A;  1HDP A;  4B3A A;  4Y13 A;  1QU3 A;  2RAE A;  1IRG A;  2VQH A;  3T8T A;  4NC6 A;  1Z3Y A;  1R71 A;  2R5Z A;  1U8R A;  1FT9 A;  1SFE A;  3PSI A;  1SEU A;  4GCV A;  4XOT A;  3HC7 A;  3VDX A;  3TKY A;  1YQA A;  2FBK A;  1WZ2 A;  1YOV B;  3LAP A;  3WTS C;  5EYR A;  1A5J A;  1KA8 A;  1IJW C;  1D3Y A;  3H5R A;  3VEP A;  5CYV A;  2EIJ H;  2OD5 A;  4II2 A;  5CKT A;  3K2A A;  1R9T J;  3VYR B;  3HRT A;  4EJO A;  2JQ7 A;  1O3Q A;  3S1R J;  2STT A;  5B3S H;  1U6G A;  3GUD A;  1STZ A;  4KYW A;  2DMU A;  1SVL A;  2E5N A;  2WV1 A;  5DD8 A;  3E0J B;  4ON0 A;  4BYY A;  2HDD A;  3SFI A;  2MC3 A;  1LDJ A;  2XAJ A;  2CW8 A;  2Z16 A;  4FIS A;  1PDN C;  5LRR A;  3J81 Z;  3I55 I;  4LG0 A;  1T6S A;  4RAZ A;  1KGS A;  3SDB A;  5LBQ A;  1P92 A;  4B8X A;  4XLA A;  4OOI A;  5KVR A;  3E6C C;  3OV8 A;  4B47 A;  3BG3 A;  1IXR C;  1Y0N A;  3C2H A;  3TW7 A;  3L2C A;  4IO9 F;  1LVK A;  2LY1 A;  1XC5 A;  3FHZ A;  4LIU A;  3WOD F;  2BZT A;  1VQO I;  1VQ8 I;  2L54 A;  2ZB9 A;  2ZJP F;  2V1X A;  5J40 A;  2H1K A;  4G7Z F;  2HWV A;  1W5T A;  2DJI A;  3M3Y J;  4KN7 X;  3QPL A;  4L5J A;  4O5V A;  2CO5 A;  4EM0 B;  1UEL B;  5F64 A;  3ZQL A;  4YEJ A;  4EJT A;  4KIF A;  1FYM A;  2VPL A;  3FK7 A;  1Z21 A;  4Q47 A;  1VQ6 I;  3GTL J;  2E34 A;  1ETK A;  3GFI A;  3DTE A;  2EZH A;  1ZLK A;  2W82 A;  1V5G A;  2ZXI A;  3KLN A;  5JI6 A;  3IWF A;  4LIV A;  2BY0 A;  4EV0 A;  4RB3 C;  2FD5 A;  1NHA A;  5LD2 C;  2LLK A;  2A5W A;  2DA6 A;  4A0X A;  3ESW B;  1Z05 A;  2OTJ I;  3A02 A;  1F5T A;  1O57 A;  2FML A;  3FXU A;  3DBH B;  2EA4 A;  2BGC A;  4A3C J;  4MHG A;  2WAD A;  4ZZD A;  4JOM A;  4RGU A;  3VSL A;  4YEL A;  2CFX A;  4Y33 A;  3S15 J;  3HRU A;  5FLX K;  2OV7 A;  3GW2 A;  1UG0 A;  5AON A;  2VBZ A;  3K4J A;  3OSF A;  3LSK A;  5L3D A;  5BMZ A;  4XQF A;  5FRM A;  3HOW J;  1XGO A;  3IUO A;  1ODD A;  3V7C A;  3QU6 A;  3OIO A;  1KQ0 A;  1VF9 A;  2XIG A;  4BHB A;  1S29 A;  4CA0 A;  1MMN A;  5IT9 K;  2FX0 A;  4WXD A;  1T8I A;  2O9L A;  3QAH A;  2QSG X;  4I02 A;  3CCR I;  2KIU A;  5ICC A;  3BR3 A;  2D2W A;  4NDL A;  2DI3 A;  1ETO A;  4M9X A;  3TGN A;  1XGN A;  2JVH A;  4HX8 A;  3C18 A;  5CQE A;  1ETQ A;  2QYO A;  3PUB A;  2D1H A;  4LGW A;  1E3H A;  1N77 A;  3S1Q J;  1UHS A;  1WH5 A;  3JTG A;  4KN4 X;  4GYG A;  4NB5 A;  1WGX A;  4BUP A;  2OUM A;  1MBK A;  2ZXH A;  5JLX A;  4ZDP A;  2JPC A;  4GDF A;  2VOO A;  5DUI A;  1I6H J;  2TRT A;  5H2F C;  3EYI A;  5J4V A;  3S2W A;  2MYS A;  3S1N J;  2I10 A;  1IAW A;  2BHZ A;  2KPM A;  1MBJ A;  3RQI A;  4XRF A;  4YIF A;  2ID3 A;  2VBY A;  2DCE A;  2YUS A;  3H9J A;  2Q8K A;  4S0H B;  4BAY A;  1MSF C;  1YW8 A;  2QBY A;  1Q1V A;  2NNY A;  1Z7L A;  3TO6 A;  4N0B A;  2RDP A;  1YX5 A;  1T33 A;  1Y1V J;  2IXS A;  2OCC H;  2W48 A;  4BGD A;  2X4H A;  1POG A;  4JX6 A;  1YJN I;  2XRN A;  4PGH A;  1YS6 A;  2XHK A;  1QZZ A;  1O3R A;  4JX5 A;  2MLG A;  2Z5U A;  2E1O A;  2OCE A;  3ZMZ A;  1R58 A;  4AU7 A;  3HZJ A;  2E7X A;  3JRC A;  2DJN A;  4BDZ A;  3HKZ N;  2V1U A;  1MJA A;  1HSJ A;  5LHI A;  1XDU A;  2M0M A;  4BXF A;  5EZG A;  1KU2 A;  4C2U A;  4X1E A;  5CLS A;  3AL0 B;  2ZNY A;  2B7E A;  1LVA A;  1U9O A;  1X4P A;  4ENM A;  1J59 A;  3TO9 A;  3O8H A;  1AWC A;  1ORK A;  4PJJ A;  5E8G A;  3KZZ A;  2R7X A;  1TQM A;  2QQB A;  4A3L J;  3R6S A;  2Z33 A;  4L0Y B;  4CCJ A;  5LGN A;  1XMA A;  1VQP I;  2FOW A;  5KAF C;  2M45 A;  4MTD A;  3GLL A;  4GFB A;  1LFP A;  1SD5 A;  3TP0 A;  2JPB A;  4BBR J;  2FRH A;  3G6E I;  3H3V K;  2O5R A;  4RMN A;  1FOY A;  1P4W A;  1YS7 A;  2XAS A;  1KYZ A;  5F08 A;  5D8L B;  4KMF A;  3MFK A;  2R7V A;  5K5Q A;  1O4X A;  4L9N A;  4YRV A;  2DMN A;  1ZAR A;  3MAJ A;  5AIP A;  3PFY A;  3WU0 A;  2KJB A;  5BOX A;  2FF4 A;  3BY6 A;  4CH7 A;  1XB4 A;  1JHH A;  1ZQ3 P;  1JUS A;  2DO7 A;  5EZH A;  1EF4 A;  3HPH A;  1IN7 A;  1LKX A;  4DW6 A;  1W7P D;  5GTH C;  1O7F A;  4MO7 A;  2DTZ A;  5IOY A;  1D8J A;  3KP4 A;  2KIF A;  2WAF A;  1G4D A;  2ECB A;  2ME0 A;  4CCK A;  2VJI A;  2PJR B;  3FXO A;  4M73 A;  5FB2 A;  4IHV A;  3ZQC A;  2DXI A;  2D5V A;  4RB0 A;  1ZG5 A;  3QYF A;  2LYC A;  3VWB A;  4BKX A;  2LRD A;  1S8N A;  4BY7 J;  1N25 A;  1OCP A;  4MTE A;  1RRJ A;  2W1O A;  4IEJ A;  1J5Y A;  2RC4 A;  1RC9 A;  3KZI C;  3B73 A;  4MNU A;  5EDN A;  2UV1 A;  5LLQ A;  3OY9 A;  2VC1 A;  3LSJ A;  2J5P A;  2EZK A;  2M30 A;  3C2B A;  2B63 J;  3BTJ A;  2Y9Y A;  1FBS A;  3CJR B;  4UB6 C;  3K1N A;  3M7G A;  2YX7 A;  3Q9S A;  1YX3 A;  2K9M A;  3CMA I;  4LMY A;  3KYL A;  4DYQ A;  3J81 K;  4L9V A;  1ZG1 A;  3PQK A;  2XPV A;  3FMS A;  3ML6 A;  3Q9V A;  4KT6 A;  1RIO H;  5IOZ A;  4EJV A;  4YG2 F;  2L9R A;  3HRM A;  1G8X A;  3P7N A;  3JAM Z;  3D5R C;  1T2K A;  4E7I A;  1B8I B;  3M8E A;  1QPI A;  5LHG A;  1Z0X A;  5LEK A;  3F22 A;  1X58 A;  1BR1 A;  2F5E A;  4KFC A;  2ESH A;  4CXF A;  3ABT A;  2IEK A;  3CUQ B;  1GHC A;  4GYI A;  3FWE A;  4DZP A;  2AS5 F;  1E3O C;  2Q1Z B;  2DOA A;  2XF6 A;  3E5Q A;  4DGW B;  1EH7 A;  3KEY A;  3Q5F A;  2OQR A;  1BR2 A;  3DF8 A;  4HZF A;  5L3B A;  3GFL A;  2JSC A;  1J7K A;  4LFU A;  2V79 A;  4HG2 A;  4CYD A;  2EFW A;  1FJL A;  1RI7 A;  3CD6 I;  3SXY A;  4M9S A;  4H4K C;  2RNJ A;  2DFE A;  5DM6 F;  2OZU A;  1OCT C;  2CFO A;  3ZXS A;  3W6V A;  1X2N A;  3F8M A;  1KU9 A;  4M6Y A;  5FKO A;  5K7F A;  3D0S A;  1RNL A;  4R1H A;  3IKT A;  3BDD A;  4CZC A;  4XRS A;  1P6R A;  3H9G A;  3OOU A;  2ZXJ A;  5ED4 A;  3H1C A;  1EJ9 A;  2E2J J;  2AXL A;  4BEH B;  2G7U A;  2M4K A;  4UVA A;  4IX7 A;  4A93 J;  4G7O F;  3I5U A;  2E1C A;  3UR3 C;  2NS0 A;  1GDT A;  3CCQ I;  3DEU A;  2O0Y A;  3O8G A;  1WI9 A;  5F1J A;  3ULQ B;  2NRA C;  1Z7U A;  3H3Z A;  4WCG A;  3SZP A;  4BU2 A;  2HOE A;  3KET A;  1W1W E;  3F72 A;  2MBF A;  2ZFW A;  2PJR A;  1UMQ A;  1JKQ C;  1O7L A;  3SEQ A;  1B6A A;  1NK2 P;  3IRR A;  2VB6 A;  1RKT A;  2NYX A;  3ZQF A;  1SFK A;  2EIM H;  1Q1H A;  2JUC A;  3JRA A;  1VQ5 I;  4A3I J;  2BY3 A;  2ELH A;  2VKV A;  1HF0 A;  4PSW A;  4KDP A;  4Y7N J;  2KRF A;  5JR3 A;  2UWM A;  4HEA 2;  3MEX A;  2WY8 Q;  1J9I A;  1TWH J;  1DQU A;  2DPD A;  4EM1 A;  4QIW N;  2F6C A;  3LNQ A;  1ZRD A;  5TRD A;  1D0Y A;  2RV8 A;  3ECO A;  5LGT A;  2R7S A;  1FYL A;  9ANT A;  1J0R A;  1KON A;  5FRN A;  1YYV A;  2X51 A;  1MJ9 A;  3FZV A;  3JSO A;  3OSG A;  4CCN A;  3OYI A;  3S14 J;  2R7W A;  2ETH A;  2PBI A;  3ERE D;  4OMY A;  2E1M B;  3DBL B;  3I59 B;  5K7H A;  4EMS A;  1BJZ A;  1PUF B;  1LE8 A;  1IN6 A;  2I8D A;  3CF5 F;  4FTH A;  3G1O A;  3MWM A;  4I0A A;  1DPR A;  5CPR B;  4M6X A;  3JSP A;  2DK8 A;  3KX2 A;  1IF1 A;  3K9T A;  1CF7 B;  3KEO A;  4BHP A;  1SAX A;  4BE2 A;  2AO9 A;  4ZDO A;  3LQR A;  1XMX A;  1ZGW A;  3DLA A;  3JR9 A;  2OQG A;  1FX7 A;  3RKQ A;  2L7F P;  3K6G A;  1F4K A;  4IXA A;  5E3L A;  2DTR A;  2DW4 A;  4UB8 C;  2IS4 A;  3PIP F;  1RES A;  2CMP A;  3J80 K;  2XAG A;  2G9W A;  1LJ9 A;  3NRV A;  4FHT A;  4A12 A;  3AAF A;  1OCR H;  2KDO A;  4BY1 J;  1MMG A;  2HS5 A;  2R5Z B;  1SAN A;  2JK3 A;  3TW6 A;  3P9C A;  3N4M A;  1W0T A;  1HXD A;  3CCV I;  2X1D A;  2GAU A;  1I50 J;  4OIO F;  4XLP F;  2BBY A;  1ZGJ A;  3KP7 A;  2V4J C;  5F0F A;  2G7H A;  4U7B A;  1JE8 A;  2GLO A;  2O8X A;  2KP6 A;  4HLX A;  1HST A;  1WRJ A;  3IAS 2;  2CUZ A;  3K4C A;  3RYR A;  3OYG A;  3E7L A;  2CUJ A;  2YR2 A;  3Q0W A;  2VC0 A;  5DEQ A;  3TO7 A;  2VBX A;  2DBB A;  1FC3 A;  1OYY A;  3RKW A;  3LQQ A;  5HLT A;  2HDW A;  3ZMV A;  1F43 A;  2DDA A;  3CCU I;  4A5M A;  2ZXW H;  1S7A A;  2M2E A;  5FKL A;  3DBR B;  4PCQ A;  4IQ4 A;  4ENN A;  3W2V A;  4ANJ A;  1Y56 A;  1W36 D;  3HM5 A;  2WB1 A;  1P7J A;  2PEX A;  4IHT A;  4J19 A;  1U78 A;  4B43 A;  2DN0 A;  4AM3 A;  1BM9 A;  2N8G A;  3CES A;  1IN4 A;  4WX9 A;  2CV1 A;  3CP8 A;  2OC6 A;  1B1B A;  1D1B A;  2L7K A;  3SYT A;  4AIK A;  3FX3 A;  2EIN H;  1ETW A;  4WXH A;  4II3 A;  3QP6 A;  3LL7 A;  3HOV J;  1TNT A;  1HOM A;  4E7K A;  1OCZ H;  4AID A;  2E36 A;  2TDX A;  1NG7 A;  3UNG C;  1U5T A;  4DJA A;  3I3L A;  2KDZ A;  1WI3 A;  4U0W A;  5K7Z A;  4RA2 A;  4C3I J;  3TDU C;  4I2O A;  3C2G A;  5DCF A;  5FFX A;  3K70 C;  3WG9 A;  2R92 J;  2Y0S A;  2HXI A;  1XX5 A;  2EV0 A;  3HYI A;  1YLF A;  3GVA A;  3L09 A;  3E6B A;  3Q0U A;  3DU6 A;  2E60 A;  1USS A;  2NOJ B;  5J1Y A;  3WU1 B;  3L2U A;  1L3L A;  1FTZ A;  1S7O A;  4RAY A;  3D1N I;  4MEY F;  1AHD P;  3DCF A;  1T0F C;  5E1Z B;  2Z3Y A;  3H35 A;  3I4P A;  1O3S A;  1H0M A;  4I7H A;  3PNY A;  1TWA J;  4BE0 A;  2L2O A;  1PUF A;  4RAG A;  5DTD A;  4IHS A;  5D8K B;  4BQQ A;  5HLH A;  4BQA A;  3BRO A;  1DGR M;  4ENJ A;  3CJN A;  3I56 I;  1CF7 A;  2FSW A;  4G9Y A;  3I53 A;  3PIO F;  1OJL A;  2XKO A;  1IN5 A;  3JAM K;  4M3E A;  3GTP J;  3CMY A;  3ZPL A;  4HAM A;  2QM3 A;  4XN0 A;  3S32 A;  5B1A H;  3SQN A;  3PNT A;  4XLF A;  1ON1 A;  3K4K A;  4NBQ A;  5C4X J;  1A6I A;  1SVM A;  3PM1 A;  4WF2 A;  1ULY A;  5E20 A;  4A3M J;  3JRE A;  2IP2 A;  3ZQ7 A;  1J2X A;  4LB5 A;  3JW4 A;  2BXY A;  2CS3 A;  2I5U A;  3P9I A;  3MMY B;  2ESN A;  3DWL E;  1OR7 C;  2M34 A;  3AG1 H;  4GXO A;  2PG4 A;  2FBH A;  1QO0 D;  2J5O A;  2X6W A;  2A6T A;  2Z1D A;  4ZYE A;  4W1U A;  2XSD C;  4V19 K;  2ECC A;  3BT9 A;  3R60 A;  4XBF A;  4CDG A;  4QLC U;  2UXX A;  2WAE A;  4IHX A;  1LFB A;  2L9V A;  2E2I J;  2K85 A;  4LLN A;  1FNN A;  4PJM A;  1OLT A;  1YTY A;  2K27 A;  4RBO A;  4A3J J;  3CC2 I;  2IPQ X;  2ICW G;  4HV5 A;  1YFH A;  4C30 A;  3I58 A;  1MBG A;  1X19 A;  1SMY F;  1WFX A;  1S9H A;  4RLQ A;  2BY1 A;  1JT6 A;  2CJJ A;  1DP7 P;  4OAZ A;  2XV4 S;  2DQR A;  2KJC A;  2LH9 A;  3QYE A;  2L5Q A;  2DLL A;  1VFC A;  2R7R A;  2ZNZ A;  1OFC X;  1R23 A;  3G2B A;  2JA7 J;  3WGG A;  2X48 A;  2FBI A;  1OYI A;  1SFU A;  3RI4 A;  1HC8 A;  3LST A;  2P7V B;  3I0T A;  3HB9 A;  4E6K G;  3C7J A;  4HSR A;  3W2A A;  1WJB A;  3LA3 A;  3V42 A;  3BG5 A;  1FTT A;  4IRH A;  2XAQ A;  2W84 A;  2QBY B;  1Z1D A;  4UUV A;  2X9D A;  4C2T A;  2XGX A;  3M4O J;  2BW3 A;  5FKN A;  2ZFU A;  4N4O B;  5JFR A;  3I4M J;  2VKH A;  4ZDL A;  3S2H J;  1OPC A;  1SD4 A;  5D5U B;  1G3Y A;  3WTU C;  4HPQ A;  2GIV A;  3JRG A;  3K0L A;  4LIT A;  3H3U A;  3BJO A;  3C1D A;  3G1M A;  1XN7 A;  4EVI A;  2LC2 A;  3PNV A;  5ILU A;  3CCL I;  2EWN A;  2F5V A;  2QZ8 A;  3DQV C;  4XOR A;  2BEO A;  2VJJ A;  4ESB A;  4RM2 A;  2NVT J;  3B6C A;  1YJW I;  5A2Q Z;  4CCM A;  1MD0 A;  3BJ6 A;  5FRO A;  2QA4 I;  1K61 A;  2IS6 A;  2R3S A;  4BAC A;  5KK1 A;  4B48 A;  4XN3 A;  4IOA F;  3QOP A;  1FSH A;  2E2H J;  2CU7 A;  1JGG A;  1UAA A;  1VQM I;  5HDG A;  1RR8 C;  5L3E A;  2OPT A;  4PUS A;  2LF7 A;  4UXN A;  2XVC A;  2ZBK A;  1XGS A;  4XKB A;  1MND A;  2NVX J;  4Z2Y A;  4ZZL A;  1QZE A;  3EUH A;  3LSR A;  5F0C A;  3HOT A;  2GA1 A;  2P0W A;  1S6L A;  3FIW A;  4MEX F;  2DA4 A;  1MMD A;  4AD9 A;  3VPR A;  4KMU X;  5E1X A;  2V9V A;  2TCT A;  3LSG A;  2A6H F;  1SD6 A;  1MDM A;  4EM2 A;  2CYY A;  2XF7 A;  4BNC A;  4N9I A;  4IHW A;  2KRH A;  2ID6 A;  1B72 A;  4LG3 A;  3HOU J;  5DD4 A;  3CLO A;  2VE9 A;  2O03 A;  1MMA A;  2HKO A;  4KNY A;  1F36 A;  5J1R A;  1V55 H;  2JT1 A;  5ICF A;  3HGY A;  3A1Y A;  2BY2 A;  2K5C A;  4ENK A;  1P7I A;  4Y15 A;  5CJ9 A;  1H88 C;  2DPU A;  2A68 F;  1EH6 A;  2EV5 A;  4IOC F;  4ETS A;  2X6O A;  2JJ7 A;  2CG4 A;  1MZB A;  5CVV A;  2RQQ A;  1MBH A;  1ENH A;  3WTY C;  2L01 A;  1ZN2 A;  3L2Q A;  3QPT A;  2GXG A;  4V2F A;  3O6B B;  2DMP A;  2V6E A;  3RSN A;  3CME I;  4QTR A;  1K83 J;  4BH9 A;  2EK5 A;  2ISZ A;  4AVZ A;  1YO5 C;  4UV8 A;  1Y0U A;  3RPQ A;  1JHF A;  2VJ5 A;  1BI2 A;  2RN7 A;  2XSJ C;  1JKP C;  5DUK A;  1WKM A;  2KFD A;  2W25 A;  3F8B A;  1B9N A;  4F55 A;  4Q48 A;  1I5Z A;  1SVO A;  5GAH J;  1I1G A;  1P4X A;  2K9Q A;  4XLN F;  2KZG A;  2QQA A;  5AIQ A;  3H9Q A;  1T95 A;  2M4G A;  2QLZ A;  3KCC A;  3HKZ A;  4V2G A;  2G0E A;  2PMU A;  2GIZ A;  1UG2 A;  1PVE A;  4LD5 A;  4OIN F;  4ITV A;  2P5V A;  1MGT A;  1TLH B;  4NNJ A;  1Z3X A;  3KEQ A;  2DA1 A;  2WWY A;  4GGG A;  2EZL A;  3A4C A;  3GO5 A;  1T39 A;  3S3O A;  5H6R A;  3TP3 A;  4XKW A;  4GRI A;  4R8H A;  3ZMT A;  4DZJ A;  1IZ1 A;  2PMZ A;  5D5W B;  1TQI A;  3CJT B;  2COB A;  3Q3S A;  3RYP A;  1QPM A;  2OA4 A;  3FHN A;  2WAQ A;  3GZN B;  5F27 A;  1A6Q A;  5GAE J;  5EF6 A;  2NS8 A;  4L5I A;  1R1V A;  3ROU A;  1X1A A;  4RLF A;  3TQN A;  2XGC A;  4S04 A;  2JRM A;  2YX4 A;  3OYK A;  3BJA A;  5J47 A;  3MVP A;  3WU2 C;  2MFZ A;  1FP1 D;  2IS2 A;  3HRS A;  3B02 A;  2ZO4 A;  3FK6 A;  2KIQ A;  4UHT A;  2O8K A;  1G59 A;  4ESF A;  4J01 A;  4I0B A;  2RGV A;  4JQF A;  2O61 A;  4XMY A;  2ZME B;  1UZC A;  1BI1 A;  2GOM A;  1IO2 A;  3QP5 A;  3F0C A;  5IP9 J;  3CC7 I;  3IL2 A;  2CH0 A;  2K40 A;  4CO8 A;  1EKE A;  5M3F J;  3BC8 A;  2XUB A;  2QUF A;  2JSP A;  5E79 C;  1FBQ A;  5ICE A;  1XCV A;  3MCZ A;  2V9K A;  4PK4 A;  5J4Y A;  2HU9 A;  3W3C A;  2GA2 A;  3HXL A;  3S3M A;  2H27 A;  4EAT A;  2V6C A;  3IWZ A;  4OAY A;  4ZYH A;  1HW1 A;  4FAS D;  1REP C;  3K4L A;  3A01 A;  2Y9Z A;  2H09 A;  3RKY A;  4HDU A;  1TC3 C;  1GXQ A;  1IDY A;  2FA5 A;  4XON A;  2R7O A;  2OJE D;  1OIS A;  2HYJ A;  1BI3 A;  1FOX A;  4UV9 A;  4XM3 A;  2VT2 A;  3HOZ J;  4I6Z A;  3SHF A;  4MFE A;  1FSE A;  3BLY A;  1X1D A;  2XPW A;  4B09 A;  2CQN A;  5IT3 A;  1MNM C;  1ZAO A;  1Z67 A;  2M7A A;  2KRC A;  4HX4 A;  3WE3 A;  2PQ8 A;  4RGR A;  3DTI A;  1GV2 A;  4WXC A;  5LEJ A;  1LUJ B;  3RIR A;  3NWS A;  2HDC A;  4Y4R A;  1ZH5 A;  1QVT A;  3RZO J;  2GBY A;  4IL6 C;  3GZ6 A;  3FF5 A;  2M8G X;  4LK1 F;  2H6C A;  3A0H C;  4B44 A;  3GLX A;  4BE1 A;  3FM5 A;  5C44 J;  2LBF A;  3W2W A;  3BR0 A;  3E6M A;  1FZP B;  3CCY A;  1GT0 C;  1I1S A;  3V8K A;  4RB1 A;  3DPL C;  3IP4 B;  5HS8 A;  4AIJ A;  1S7E A;  5GAG J;  2F5D A;  2P5K A;  2XAH A;  2HFH A;  1XSD A;  1ONV A;  2VXZ A;  1K78 B;  3ABK H;  3ZMU A;  1BR4 A;  3P5J A;  1LDD A;  2VN2 A;  1YW7 A;  3WTZ A;  5EEH A;  4YIR X;  1FWZ A;  2DMQ A;  2W00 A;  1ETY A;  2LF8 A;  2LD5 A;  2E7W A;  1G6N A;  2LRE A;  2PLY A;  1VND A;  1OYW A;  2HGC A;  5E1W A;  3DFG A;  4XLH A;  1WHU A;  2YSR A;  3OYC A;  1E3P A;  1WJD A;  4MQV A;  3RQ4 A;  3X2Q H;  3ZQQ A;  3WTX C;  2LKP A;  2NOG A;  3PL8 A;  4HOB A;  2NVQ J;  1R49 A;  3U9G A;  3HOS A;  2K4J A;  1LE8 B;  3G73 A;  1R5I D;  3KZY A;  3D5L A;  5FJ8 J;  3NEU A;  3R0A A;  2ZJQ F;  3U21 A;  3QQA A;  1IRX A;  4I01 A;  3OYA A;  2EJR A;  2KQR A;  3EUK L;  4M3D A;  5F1R A;  1UHM A;  2JZY A;  5A2Q K;  1NTC A;  2DT5 A;  2LG4 A;  2E5Z A;  5DS9 A;  3FXK A;  1FIP A;  1V54 H;  6PAX A;  2MSY A;  3BTI A;  3OYE A;  3IRQ A;  2PX9 A;  2Z99 A;  1HW2 A;  3WHB A;  4MFD A;  2FXA A;  2DOF A;  2HVR A;  4EGY A;  1QA6 A;  3CP2 A;  1OQY A;  1NG6 A;  3JRF A;  2ZME A;  4BDY A;  3OYN A;  5JVG F;  3LSP A;  1ZR4 A;  3GME A;  4JBA A;  3GTM J;  1B4A A;  1FLI A;  3LSI A;  3VYS B;  3GTK J;  2L4M A;  3DPU A;  5ILS A;  4F93 B;  4CYC A;  1HBX G;  2ZJR F;  2VAS A;  1UCR A;  1MH3 A;  4NC7 A;  4ASN A;  2AHQ A;  5E8I A;  1SC7 A;  1EV7 A;  1ZG3 A;  1ZLJ A;  4HST A;  4KIC A;  4C9Y A;  4HNU A;  1W0U A;  2K3P A;  3MD2 A;  1B59 A;  4L0Z B;  3CO6 C;  2IVM A;  3ZQI A;  4EQQ A;  5K1Y A;  2X1E A;  4HA8 A;  1U9N A;  2L9N A;  2E71 A;  4X0G A;  3RTR A;  3FM3 A;  5TIS C;  1X3U A;  3GTO J;  4Y3O A;  4UVB A;  3LSH A;  3JTH A;  3IH3 A;  1FMW A;  1KU3 A;  2HR3 A;  3BR2 A;  2KIM A;  1BOB A;  2XAF A;  4M71 A;  3U1D A;  1MBE A;  1O3T A;  2IJL A;  4QWQ A;  2KMU A;  2WC2 A;  1IUF A;  2V1N A;  2A07 F;  5D4S A;  2R7F A;  1K7A A;  3NAU A;  3E5X A;  1X4O A;  1DP3 A;  4U7D A;  4C3J J;  2CW7 A;  4A3G J;  2RNG A;  1MBF A;  4A0Z A;  1U5T B;  3OYM A;  2MH9 A;  3CF2 A;  1K4S A;  3IH2 A;  2Z2S B;  3WG7 H;  2Y2Z A;  3I9V 2;  5H20 A;  5JHU A;  3S1M J;  2LK2 A;  2LSO A;  1AKH B;  2HXO A;  1SAU A;  1E2X A;  4XR6 A;  5J1U A;  4L9T A;  4AYB N;  4BHC A;  4CGZ A;  1K78 A;  2RRE A;  1QGP A;  1D5Y A;  1XTA A;  2L02 A;  3GBG A;  2R7T A;  1JKR C;  3S8P A;  1LDK B;  3ZQG A;  4ZYD A;  4KA4 A;  1RUO A;  3ELK A;  3BZ6 A;  4XSZ F;  5GAD J;  1JJ8 C;  4A3B J;  2LP0 A;  1KZH A;  2Y69 H;  2PFB A;  5F04 A;  3IAM 2;  3FKI J;  3U2R A;  5B5E C;  5KHD A;  2VQG A;  5HNH A;  1MJB A;  3ECH A;  4B4C A;  4HDV A;  2W4S A;  3KLO A;  5E18 F;  1MH4 A;  3HTS B;  4PZJ A;  1ACI A;  5E3N A;  5FO5 A;  3PO2 J;  3SZG A;  4G6Q A;  3BTC A;  1TT5 B;  3H36 A;  1JUP A;  3QPS A;  4JP0 A;  2HPI A;  3IV5 A;  4D5C A;  5F6F A;  1QRY A;  2YS9 A;  1YI2 I;  3BZC A;  5M5X J;  3KPH A;  1BA5 A;  3WTW C;  1BW5 A;  3FXR A;  1AA7 A;  1DPU A;  2DAO A;  1XS9 A;  2RVC A;  3GTG J;  1IV8 A;  3T8R A;  2MG4 A;  4BJ6 C;  2Q2E B;  4RGS A;  3BCA A;  4D1Q A;  2QEN A;  4KUM A;  4PFO A;  5KCM A;  1VQ9 I;  4HF1 A;  2A69 F;  3FMQ A;  3KP6 A;  3F6V A;  1HKT A;  3VOD A;  1ZKG A;  2HOT A;  2K9N A;  5FLV A;  4HLY A;  3FKJ A;  2JUG A;  2NAZ A;  1A36 A;  2P81 A;  3AL0 C;  3ASN H;  2BYV E;  4HV6 A;  3OYF A;  1IW7 F;  1HKQ A;  4HQM A;  4U0V A;  4YFN F;  1A04 A;  1OR7 A;  5C4J J;  3J7A O;  1D0Z A;  1DGW Y;  1RR7 A;  3ABM H;  2LY2 A;  1PP7 U;  3PJR A;  1TQP A;  1FYK A;  3OIQ A;  4M3G A;  2HTS A;  4G6D A;  4JYK A;  3JRH A;  1WWX A;  3MZH A;  2DT6 A;  1PUE E;  4CCL A;  1W36 C;  2BVM A;  2HQ5 A;  4M74 A;  3OYD A;  3HPG A;  5IT9 Z;  2K86 A;  1ZTR A;  4ZYA A;  1K6Y A;  3CLQ A;  4E4H A;  2HI3 A;  3V4G A;  3BR6 A;  1VQK I;  3JRD A;  2FQ4 A;  1ERD A;  4XL9 A;  2WA0 A;  3HEF A;  3ZCO A;  3REO A;  3LAJ A;  2VON A;  1R7J A;  4KIB A;  4CZZ A;  2H8R A;  4EJU A;  1U0J A;  2M9H A;  5BS6 A;  1PJR A;  3TDZ C;  1WPK A;  2AQF A;  2WV0 A;  2X6Y A;  1W5S A;  4A0Y A;  4KJZ A;  5HVQ C;  2H1L A;  4BXX J;  4I09 A;  1F1Z A;  2QKM B;  4BS9 A;  2HVQ A;  3HSE A;  5FD6 A;  5FD5 A;  4M3F A;  2DYS H;  3ASO H;  1IUY A;  4ZTJ A;  1LQ1 A;  2BW3 B;  2H6B A;  3AKZ A;  3M9A A;  3GFM A;  5FKM A;  3HJE A;  4CSW A;  2DA3 A;  2NVU B;  3T0Y A;  3V7R A;  1AKH A;  1VQN I;  2MD5 A;  4LJZ F;  3CO7 C;  3K4B A;  4BL0 B;  4OU0 A;  1Z6R A;  3FXL A;  3CC4 I;  3RJP A;  3FXJ A;  1S3J A;  2HQA A;  4HYE A;  2W24 A;  3DXJ F;  1T56 A;  1JTY A;  2MC4 A;  1PP8 F;  2RQP A;  2CW0 F;  4XRM A;  1TWC J;  1SMT A;  2FNP A;  2FQ3 A;  2VQC A;  2VOD A;  3LWF A;  3K7A J;  3MKW B;  2EFP A;  1LFU P;  2GXA A;  2VPR A;  3CCE I;  3BG6 A;  3QWL A;  2KKO A;  2LTP A;  1R4M B;  2WB1 N;  4X6A J;  1B9M A;  1G3S A;  2HOS A;  4OIR F;  2F4O B;  1MDM B;  1OCC H;  5GPA A;  2EH3 A;  2FMY A;  3GEZ A;  3MKY B;  2FU4 A;  3E1S A;  4AWX B;  5LRS A;  1B72 B;  5D6F A;  1XPX A;  4DNC A;  1JT0 A;  2XB0 X;  3CJQ B;  2DA7 A;  2Q2E A;  3O2P E;  3Q0V A;  3MKZ A;  5EGO A;  4O6J A;  2FNA A;  4WK8 F;  2E19 A;  3G4S I;  2JN6 A;  2HYF A;  1LEB A;  2D1V A;  4MQ9 F;  2LFB A;  5BPI A;  1BIB A;  1ZRC A;  4HNT A;  2KLO A;  3SFZ A;  2O6G E;  2HOA A;  3H5N A;  3CUQ C;  1APL C;  1ZHF A;  2HQN A;  1IDZ A;  1R4N B;  3NWT A;  1QHG A;  1U8B A;  2FUG 2;  5KAI C;  2AQE A;  3KE2 A;  4C2M J;  2R7Z J;  1ON2 A;  4YII A;  4QSH A;  3GWZ A;  3VSK A;  5IYC J;  3J7Y J;  1FIA A;  1AOY A;  3F8N A;  2BHY A;  2IA1 A;  3OR1 C;  1N78 A;  5CQG A;  2PI0 A;  4KIS A;  2FOK A;  2IGN A;  2L7M P;  3EYY A;  4W97 A;  4BJ5 C;  4A3K J;  4IQJ A;  3ZMS A;  3SEZ A;  1VI0 A;  3WHC A;  2H94 A;  2F5C A;  4LOC A;  4XIC A;  2VKE A;  2ISY A;  1L0O C;  2L4A A;  4F91 B;  3ABL H;  2DQL A;  1BIA A;  4KT5 C;  5FGM A;  3JCU C;  3DP7 A;  3PO3 J;  2IS1 A;  3L1P A;  1XGM A;  3LA2 A;  2XF5 A;  3HHH A;  4HW0 A;  4RS8 A;  3ZGK A;  1WQ2 A;  4E7H A;  1JJ6 C;  4FQG A;  1VTN C;  5J3L A;  5L3F A;  1A31 A;  5TGT A;  3DKX A;  3QOE A;  2XGD A;  5E17 F;  3L2V A;  4EEF G;  2WBM A;  1JKO C;  2GZW A;  3ZQH A;  4UUS A;  4U87 A;  4S05 A;  3OYB A;  3H5A A;  4E7J A;  1XSX A;  3BPV A;  4U88 A;  4ABZ A;  2BOL A;  4GO1 A;  1M1E B;  1GVJ A;  2CQX A;  2VT3 A;  4XRS G;  2XC7 A;  1OKR A;  1WJC A;  2VXD A;  5KNL A;  3TED A;  4JX4 A;  4D7M A;  3DEE A;  3KYD B;  1X1P A;  3CCS I;  4P96 A;  4M6V A;  3F23 A;  3DV8 A;  5M5W J;  3QRF F;  4RGX A;  4Q4Z F;  4MIM A;  1MMS A;  2DFI A;  2ME6 A;  4E7Z A;  4IRI A;  2JWT A;  2LNB A;  4I98 B;  5FFZ A;  4B3X A;  5ICG A;  2HVS A;  3L9F A;  2W57 A;  4A6E A;  3IH4 A;  4DYC A;  5M5Y J;  3M1C A;  2A6E F;  2CGP A;  4AVP A;  3GYH X;  3CTA A;  1D0X A;  4AIH A;  5IPA A;  2EIL H;  4IJA A;  3CDL A;  2QGU A;  3G1L A;  1UST A;  4HBL A;  4G7H F;  1VQL I;  1NH3 A;  1U5T C;  4UUT A;  4NC8 A;  2BE5 F;  2VBW A;  1E0E A;  2DFF A;  2LVS A;  5EEG A;  1W4M A;  4C3H J;  2UXN A;  4F3Q A;  3FIS A;  3NAR A;  3TL4 X;  2R4G A;  2NXN B;  3V7S A;  5F0H A;  2NNN A;  2QEX I;  3WGH A;  1ITY A;  4LK0 F;  2F2E A;  1Y8Q B;  5HS9 A;  2HTJ A;  3KIO A;  2VQL A;  2CUE A;  2LDU A;  2YPR A;  2CRG A;  3CMM A;  3EUA A;  2Y75 A;  3CDH A;  1WVR A;  2K9S A;  2E1M C;  3DU5 A;  1XG1 A;  2JVG A;  1IGN A;  3MN2 A;  1FPQ A;  2P5L C;  1G3W A;  2O7O A;  1GUU A;  1TWG J;  2VJ4 A;  2XB5 A;  1BW6 A;  1R5G A;  1YJ9 I;  4EJW A;  2B0L A;  4IHY A;  4B1R A;  5DCM B;  1OMI A;  2DOD A;  3A01 B;  1YIJ I;  1BI0 A;  2K7L A;  2R5Y A;  1ZR2 A;  1WSU A;  5FKK A;  1W7P A;  2MAB A;  1ZK8 A;  1TL8 A;  2OAZ A;  3DLL F;  2DMT A;  3P9K A;  1I27 A;  1BN5 A;  2ZSI B;  2MLK A;  2X6X A;  1MIJ A;  2PMH A;  3BG7 A;  5CVU A;  2KZV A;  2K02 A;  2WY7 Q;  3ONQ A;  5IYB J;  4IZZ A;  1DU6 A;  3HTU A;  2C6Y A;  4FX0 A;  3AG4 H;  1FOW A;  1YIO A;  2EA2 A;  5BPD A;  3O3K A;  4PGG A;  4PDK A;  2VIX A;  4UY8 I;  4ZH4 F;  4H0E A;  1FBU A;  2CWE A;  3ZOB A;  2ELK A;  1SD7 A;  4D7N A;  4OWR B;  5JVT A;  2L7Z A;  5EEA A;  1P2F A;  1ZGA A;  1K4T A;  2LBF B;  5DM7 F;  3OL3 A;  3WGI A;  5E3O A;  3BWG A;  2LKS A;  5E3M A;  4IF4 A;  2L3D A;  1JXS A;  4G12 A;  4ZJZ A;  2IT0 A;  5HOO A;  5HLG A;  4IVN A;  2HNH A;  5GP9 A;  4ESJ A;  1S72 I;  3RKX A;  2QCO A;  3GCM A;  4E7L A;  4WWC A;  1T38 A;  4OIQ F;  4I99 C;  3NQO A;  1I3Q J;  3A0B C;  5IP6 A;  3L7W A;  2VL8 A;  3PSF A;  1BC8 C;  3AG2 H;  3TOA A;  1P4A A;  2CV0 A;  1ZRE A;  3OMY A;  4RB2 C;  1I3A A;  4BQO A;  3ZP5 A;  3S3N A;  1QHH D;  3S2D J;  2STW A;  4HNV A;  4RM3 A;  5JLW A;  1CQT A;  2ACJ A;  4A2U A;  4P55 A;  3E3V A;  1QBJ A;  3MQ0 A;  3ZR8 X;  4L18 B;  2W7N A;  1JGS A;  1ETV A;  1TBX A;  3G71 I;  2K4B A;  5D5X B;  4BXU A;  3SZT A;  3AFH A;  2RKH A;  3H0D A;  1FOK A;  4RDU A;  2CSO A;  3ZN0 A;  4OIP F;  2HZT A;  4XSX F;  1R36 A;  2DYR H;  2HYG D;  5L3G A;  5IYD J;  3HL2 A;  1BOA A;  2EIK H;  2LMD A;  3KP2 A;  4E7S A;  2JA5 J;  2Q0O A;  2FJ1 A;  4Y17 A;  5D6E A;  1E17 A;  4M9Z A;  4LB6 B;  3DEW A;  1VZ0 A;  4R79 A;  3J80 Z;  5H6Q A;  2Z9O A;  3ABU A;  3EUH C;  4NQW B;  2BVL A;  4CCO A;  4CYC B;  1RUN A;  3E97 A;  2XDV A;  4ZTF A;  3VYT B;  2PN6 A;  4HF2 A;  3LFU A;  2PMZ N;  1ZRF A;  5DCM A;  1X3W B;  2QQ8 A;  4QPQ A;  3M8J A;  1FP2 A;  1LEA A;  2DK5 A;  3HGG A;  3F3X A;  3FMR A;  4KIT B;  2L0K A;  3QYB A;  2WAQ N;  1DUX C;  2M7B A;  5ILV A;  3RZD J;  1IRF A;  4D0P A;  1XD7 A;  3RPU A;  4G6T B;  2D45 A;  1R5H A;  2OF7 A;  3F8F A;  1X3Z B;  3FDY A;  1RET A;  5B66 C;  2DU9 A;  3BQY A;  2CV2 A;  4F92 B;  2E35 A;  2FE3 A;  2QKL B;  4A3F J;  4MLO A;  1N75 A;  4DIQ A;  5L3C A;  2A05 A;  4UVC A;  3BCB A;  3GZ5 A;  1QQI A;  2K9L A;  3SDG A;  2MW8 A;  5EG0 B;  1YW9 A;  3DTK A;  4CHU A;  2UZK A;  4J00 A;  3EET A;  1BC7 C;  2VE8 A;  2CQQ A; 
#chains in the Genus database with same CATH homology
 4L9J A;  2W85 A;  3KFW X;  3M1E A;  2IA0 A;  3VOE A;  1Z91 A;  1GXP A;  1TTY A;  4N9H A;  1BBY A;  2EB7 A;  3ISP A;  2X0L A;  4FT8 A;  3N97 A;  3WTT C;  2P7C B;  1YG2 A;  3I64 A;  4KIG A;  1HW5 A;  4P5O A;  4K2E A;  2A61 A;  5J8F A;  2E1N A;  4IPA A;  1G3T A;  4NHJ A;  1DDN A;  5HS7 A;  4FX4 A;  3MZY A;  2Y48 A;  4G94 A;  1XCB A;  3EDP A;  3COA C;  1ZYR F;  1LNW A;  3QPH A;  2IA2 A;  3R61 A;  1J75 A;  3LFK A;  3IKV A;  2MH2 A;  2ZJ2 A;  3BPX A;  2M5W A;  1R1U A;  2OZ6 A;  4NQW A;  1SFX A;  5BQT A;  3G3Z A;  4ZYG A;  1F9N A;  5DV5 A;  4YFX F;  3E5U A;  4DQ2 A;  1V4R A;  3C3W A;  2GXB A;  3F6O A;  1KYW A;  3K1M A;  5DDG A;  4IRG A;  3T5X A;  2BV6 A;  1V3F A;  4CIC A;  3I54 A;  1Z6T A;  3KP5 A;  3RDI A;  1TNS A;  3M8F A;  5CVJ A;  4Q5S F;  5HDN A;  4F7Z A;  1FY7 A;  3FXQ A;  1H9G A;  1KU7 A;  3DKW A;  4HX7 A;  2OU2 A;  1IXS B;  1R00 A;  2O3F A;  2R7D A;  3F8C A;  4UNO A;  5D5V B;  5ERI A;  5DYM A;  3BP8 A;  2P6T A;  1D5V A;  1BJA A;  3K2Z A;  3LA7 A;  3PQJ A;  3QU3 A;  1T0F A;  4EGZ A;  2IW5 A;  4A5N A;  2Y0M A;  2QQ9 A;  3F21 A;  3KP3 A;  2FEZ A;  3VB2 A;  1I6X A;  3ZMD A;  1QZY A;  3W6K B;  1MKM A;  3HSR A;  2EFQ A;  3V8L A;  3PFI A;  3GXO A;  4LLL A;  2IRF G;  4G8X A;  5K5O A;  1KQ8 A;  2COM A;  1IXC A;  3HIF A;  1XSV A;  1QNT A;  2A5Y B;  2HKX A;  3DPT A;  2ZKZ A;  2P8T A;  3CUQ A;  4E70 A;  3K1P A;  5FLX Z;  4TV7 A;  3E6D A;  3R0J A;  2F5F A;  2OBP A;  2P6S A;  4A6D A;  2XRO A;  2JTV A;  2ADU A;  3HSF A;  2QVO A;  3L00 A;  1HQC A;  1Z9C A;  4JK1 X;  1XDS A;  3HUG A;  3WE2 A;  3WTV C;  2HQR A;  5HDK A;  2EV6 A;  2GWR A;  3V8J A;  3HHG A;  1LB2 A;  1XMK A;  4LLG F;  1RZ4 A;  1D8K A;  2EFO A;  2MA3 A;  1KQ9 A;  2XKP A;  1IN8 A;  3K69 A;  4YFK F;  1UFM A;  3TOB A;  2P4W A;  4OMZ A;  5LGU A;  2A3S A;  3IC7 A;  2PJP A;  5D4R A;  1R22 A;  1CGP A;  5K5R A;  3T1B A;  1UHW A;  5CVR A;  2CQK A;  4LG0 B;  3ZN1 A;  2HEO A;  1C0W A;  1R1T A;  1U3E M;  4P9U A;  4HF0 A;  4O3M A;  1H9T A;  1K79 A;  5J8C A;  2QWW A;  3GF2 A;  3I71 A;  3GX4 X;  5CVI A;  3OOP A;  1UB9 A;  2V1D A;  3GFJ A;  1TW3 A;  2ZCW A;  3W6J B;  3R4K A;  1EH8 A;  2GQQ A;  5LHH A;  4M72 A;  3BOQ A;  4MGR A;  3IHU A;  4U0Y A;  4P9F A;  3I59 A;  5TJJ A;  2YU3 A;  5HLI A;  2M87 A;  3VFZ A;  3EQL F;  3CUO A;  2VOP A;  2EFN A;  1W7P B;  4HQE A;  1K6O A;  2WTE A;  1T98 A;  2JRT A;  2M1B A;  3H92 A;  1U2W A;  1TW2 A;  5J6X A;  2M8E A;  1HKS A;  4Y13 A;  1IRG A;  3T8T A;  1U8R A;  1FT9 A;  1SFE A;  4GCV A;  3TKY A;  1YQA A;  2FBK A;  3LAP A;  3WTS C;  1KA8 A;  1D3Y A;  3VEP A;  5CYV A;  2OD5 A;  3HRT A;  4EJO A;  1O3Q A;  2STT A;  1U6G A;  3GUD A;  1STZ A;  4KYW A;  5DD8 A;  4ON0 A;  4BYY A;  2MC3 A;  1LDJ A;  2XAJ A;  1PDN C;  5LRR A;  3J81 Z;  4LG0 A;  1T6S A;  4RAZ A;  1KGS A;  5LBQ A;  1P92 A;  4B8X A;  4OOI A;  5KVR A;  3E6C C;  3OV8 A;  1IXR C;  3L2C A;  3FHZ A;  3WOD F;  2L54 A;  2V1X A;  4G7Z F;  2HWV A;  1W5T A;  4KN7 X;  4L5J A;  4O5V A;  2CO5 A;  4EM0 B;  5F64 A;  4EJT A;  4KIF A;  1FYM A;  4Q47 A;  3GFI A;  1ZLK A;  5JI6 A;  3KLN A;  3IWF A;  4EV0 A;  4RB3 C;  1NHA A;  4A0X A;  1Z05 A;  1F5T A;  1O57 A;  2FML A;  3FXU A;  2EA4 A;  2BGC A;  4MHG A;  4ZZD A;  4RGU A;  2CFX A;  3HRU A;  5FLX K;  3GW2 A;  5AON A;  2VBZ A;  5L3D A;  5BMZ A;  1XGO A;  1ODD A;  3V7C A;  3QU6 A;  1KQ0 A;  2XIG A;  4BHB A;  1S29 A;  5IT9 K;  4WXD A;  3QAH A;  4I02 A;  2KIU A;  5ICC A;  2D2W A;  2DI3 A;  4M9X A;  3TGN A;  1XGN A;  4HX8 A;  3C18 A;  2QYO A;  2D1H A;  4LGW A;  3JTG A;  4KN4 X;  4GYG A;  4NB5 A;  2VOO A;  2JPC A;  5DUI A;  3EYI A;  3S2W A;  1IAW A;  4YIF A;  4XRF A;  2VBY A;  2Q8K A;  4BAY A;  1YW8 A;  2QBY A;  2NNY A;  3TO6 A;  4N0B A;  2RDP A;  2X4H A;  2XRN A;  4PGH A;  1YS6 A;  2XHK A;  1QZZ A;  1O3R A;  2MLG A;  2Z5U A;  3ZMZ A;  1R58 A;  2E7X A;  2V1U A;  1MJA A;  1HSJ A;  5LHI A;  1XDU A;  1KU2 A;  5CLS A;  2ZNY A;  1LVA A;  4ENM A;  1J59 A;  3TO9 A;  1AWC A;  5E8G A;  3KZZ A;  1TQM A;  2QQB A;  3R6S A;  2Z33 A;  4L0Y B;  5LGN A;  1XMA A;  2M45 A;  4MTD A;  1SD5 A;  2JPB A;  2FRH A;  1P4W A;  1YS7 A;  2XAS A;  1KYZ A;  5D8L B;  4KMF A;  3MFK A;  5K5Q A;  4L9N A;  1ZAR A;  3MAJ A;  5AIP A;  3WU0 A;  2KJB A;  5BOX A;  2FF4 A;  3BY6 A;  1XB4 A;  1JHH A;  2DO7 A;  1IN7 A;  1W7P D;  1O7F A;  1D8J A;  3KP4 A;  2KIF A;  1G4D A;  4M73 A;  5FB2 A;  4RB0 A;  1ZG5 A;  1S8N A;  4MTE A;  1J5Y A;  2RC4 A;  4MNU A;  3B73 A;  5LLQ A;  2VC1 A;  2J5P A;  2M30 A;  1FBS A;  3K1N A;  3M7G A;  2YX7 A;  3Q9S A;  4LMY A;  3J81 K;  4L9V A;  1ZG1 A;  3PQK A;  3FMS A;  3ML6 A;  3Q9V A;  1RIO H;  4EJV A;  4YG2 F;  3HRM A;  3P7N A;  3JAM Z;  1T2K A;  3M8E A;  5LHG A;  5LEK A;  3F22 A;  2F5E A;  4KFC A;  2ESH A;  4CXF A;  3ABT A;  3CUQ B;  1GHC A;  4GYI A;  3FWE A;  2AS5 F;  3E5Q A;  1EH7 A;  3Q5F A;  2OQR A;  3DF8 A;  4HZF A;  5L3B A;  3GFL A;  2JSC A;  1J7K A;  4LFU A;  2V79 A;  4CYD A;  2EFW A;  1RI7 A;  3SXY A;  4M9S A;  2RNJ A;  2OZU A;  3F8M A;  1KU9 A;  4M6Y A;  3D0S A;  1RNL A;  4R1H A;  3IKT A;  3BDD A;  1P6R A;  2ZXJ A;  5ED4 A;  2AXL A;  2G7U A;  4UVA A;  4G7O F;  3I5U A;  2E1C A;  2NS0 A;  3DEU A;  2O0Y A;  1WI9 A;  3ULQ B;  2NRA C;  1Z7U A;  3H3Z A;  4WCG A;  3SZP A;  2HOE A;  3KET A;  3F72 A;  2MBF A;  2ZFW A;  1O7L A;  1B6A A;  3IRR A;  2NYX A;  1Q1H A;  2ELH A;  4KDP A;  2UWM A;  2KRF A;  5JR3 A;  3MEX A;  1J9I A;  2DPD A;  4EM1 A;  1ZRD A;  5TRD A;  2RV8 A;  3ECO A;  5LGT A;  1FYL A;  1J0R A;  1YYV A;  1MJ9 A;  3FZV A;  3JSO A;  2ETH A;  2PBI A;  3ERE D;  4OMY A;  3I59 B;  4EMS A;  1IN6 A;  3MWM A;  4I0A A;  1DPR A;  4M6X A;  3JSP A;  2DK8 A;  1IF1 A;  3K9T A;  1CF7 B;  3KEO A;  4BHP A;  1SAX A;  3LQR A;  2OQG A;  1FX7 A;  1F4K A;  4IXA A;  2DTR A;  2DW4 A;  3J80 K;  2XAG A;  2G9W A;  1LJ9 A;  3NRV A;  4FHT A;  4A12 A;  3AAF A;  2HS5 A;  3P9C A;  3N4M A;  1HXD A;  2GAU A;  4OIO F;  4XLP F;  2BBY A;  1ZGJ A;  3KP7 A;  2G7H A;  4U7B A;  1JE8 A;  2O8X A;  4HLX A;  1HST A;  1WRJ A;  3RYR A;  2YR2 A;  2VC0 A;  5DEQ A;  3TO7 A;  2VBX A;  2DBB A;  1FC3 A;  1OYY A;  3RKW A;  3LQQ A;  3ZMV A;  4A5M A;  1S7A A;  4PCQ A;  4ENN A;  2PEX A;  4IHT A;  1U78 A;  1BM9 A;  1IN4 A;  4WX9 A;  1B1B A;  4AIK A;  3FX3 A;  4WXH A;  3QP6 A;  1TNT A;  2TDX A;  1U5T A;  4U0W A;  3TDU C;  4I2O A;  5DCF A;  5FFX A;  3WG9 A;  2EV0 A;  3HYI A;  1YLF A;  3GVA A;  3L09 A;  3E6B A;  1USS A;  3WU1 B;  1L3L A;  1S7O A;  4RAY A;  4MEY F;  5E1Z B;  2Z3Y A;  3I4P A;  1O3S A;  1H0M A;  4I7H A;  4IHS A;  5D8K B;  5HLH A;  4BQA A;  3BRO A;  4ENJ A;  3CJN A;  1CF7 A;  2FSW A;  4G9Y A;  3I53 A;  2XKO A;  3JAM K;  1IN5 A;  3ZPL A;  4HAM A;  2QM3 A;  3SQN A;  1ON1 A;  4WF2 A;  1ULY A;  5E20 A;  2IP2 A;  3ZQ7 A;  1J2X A;  4LB5 A;  3JW4 A;  3P9I A;  2ESN A;  4GXO A;  2PG4 A;  2FBH A;  1QO0 D;  2J5O A;  4ZYE A;  3R60 A;  4XBF A;  4CDG A;  4QLC U;  2UXX A;  4LLN A;  1FNN A;  1YTY A;  2K27 A;  2IPQ X;  4HV5 A;  1YFH A;  3I58 A;  1SMY F;  1DP7 P;  2XV4 S;  2DQR A;  2KJC A;  2DLL A;  2ZNZ A;  1R23 A;  3WGG A;  2FBI A;  1OYI A;  1SFU A;  3RI4 A;  3LST A;  2P7V B;  3I0T A;  3C7J A;  3LA3 A;  4IRH A;  2XAQ A;  2W84 A;  2QBY B;  1Z1D A;  4UUV A;  2XGX A;  5JFR A;  1OPC A;  1SD4 A;  3WTU C;  1G3Y A;  5D5U B;  2GIV A;  3K0L A;  3H3U A;  3BJO A;  3C1D A;  1XN7 A;  4EVI A;  5ILU A;  2EWN A;  3DQV C;  2QZ8 A;  2BEO A;  4ESB A;  5A2Q Z;  1MD0 A;  3BJ6 A;  2R3S A;  5KK1 A;  3QOP A;  1FSH A;  5HDG A;  5L3E A;  2LF7 A;  4UXN A;  2XVC A;  2ZBK A;  1XGS A;  4Z2Y A;  4ZZL A;  3EUH A;  3HOT A;  2GA1 A;  1S6L A;  4MEX F;  4AD9 A;  4KMU X;  5E1X A;  2V9V A;  2A6H F;  1SD6 A;  1MDM A;  4EM2 A;  2CYY A;  4BNC A;  4N9I A;  5DD4 A;  3CLO A;  2VE9 A;  2O03 A;  2HKO A;  4KNY A;  2JT1 A;  5ICF A;  4ENK A;  4Y15 A;  5CJ9 A;  2DPU A;  2A68 F;  1EH6 A;  2EV5 A;  4ETS A;  2CG4 A;  1MZB A;  5CVV A;  3WTY C;  2L01 A;  1ZN2 A;  3QPT A;  2GXG A;  3O6B B;  4BH9 A;  2EK5 A;  2ISZ A;  1YO5 C;  4UV8 A;  1Y0U A;  3RPQ A;  1JHF A;  1BI2 A;  2RN7 A;  5DUK A;  1WKM A;  2W25 A;  3F8B A;  1B9N A;  4Q48 A;  1I5Z A;  1I1G A;  1P4X A;  4XLN F;  2QQA A;  5AIQ A;  2QLZ A;  3KCC A;  2PMU A;  4LD5 A;  4OIN F;  2P5V A;  1MGT A;  1TLH B;  3KEQ A;  2WWY A;  4GGG A;  3GO5 A;  1T39 A;  5H6R A;  3ZMT A;  4R8H A;  1IZ1 A;  5D5W B;  1TQI A;  3RYP A;  1QPM A;  2OA4 A;  4L5I A;  1R1V A;  3ROU A;  3TQN A;  4S04 A;  2YX4 A;  3BJA A;  1FP1 D;  3HRS A;  3B02 A;  2ZO4 A;  4UHT A;  4ESF A;  4I0B A;  2RGV A;  4JQF A;  2O61 A;  2ZME B;  1BI1 A;  3QP5 A;  3IL2 A;  4CO8 A;  2XUB A;  2QUF A;  5ICE A;  1FBQ A;  1XCV A;  3MCZ A;  2GA2 A;  2H27 A;  2V6C A;  3IWZ A;  4ZYH A;  1HW1 A;  1REP C;  2H09 A;  3RKY A;  4HDU A;  1GXQ A;  2FA5 A;  1BI3 A;  4UV9 A;  2VT2 A;  3SHF A;  1FSE A;  4B09 A;  5IT3 A;  1ZAO A;  4HX4 A;  3WE3 A;  2PQ8 A;  4RGR A;  4WXC A;  5LEJ A;  3RIR A;  2HDC A;  1ZH5 A;  3GZ6 A;  3FF5 A;  4LK1 F;  2H6C A;  3GLX A;  3FM5 A;  3E6M A;  1FZP B;  1I1S A;  3V8K A;  4RB1 A;  3DPL C;  5HS8 A;  4AIJ A;  2F5D A;  2P5K A;  2XAH A;  2HFH A;  1XSD A;  1ONV A;  2VXZ A;  1K78 B;  3ZMU A;  1LDD A;  2VN2 A;  1YW7 A;  3WTZ A;  5EEH A;  1FWZ A;  2LF8 A;  2E7W A;  1G6N A;  2PLY A;  1OYW A;  2HGC A;  5E1W A;  3DFG A;  2YSR A;  4MQV A;  3WTX C;  2LKP A;  4HOB A;  3U9G A;  3HOS A;  2K4J A;  3G73 A;  3KZY A;  3D5L A;  3NEU A;  3R0A A;  4I01 A;  2EJR A;  5F1R A;  1UHM A;  2JZY A;  5A2Q K;  2DT5 A;  6PAX A;  3IRQ A;  2Z99 A;  1HW2 A;  2FXA A;  4EGY A;  2ZME A;  4JBA A;  1B4A A;  1FLI A;  2L4M A;  5ILS A;  1HBX G;  1UCR A;  4ASN A;  5E8I A;  1EV7 A;  1ZG3 A;  1ZLJ A;  4KIC A;  1B59 A;  4L0Z B;  3CO6 C;  2IVM A;  4EQQ A;  5K1Y A;  4HA8 A;  3RTR A;  3FM3 A;  1X3U A;  4UVB A;  3JTH A;  1KU3 A;  2HR3 A;  2KIM A;  2XAF A;  4M71 A;  3U1D A;  1O3T A;  2IJL A;  4QWQ A;  2WC2 A;  2A07 F;  5D4S A;  2R7F A;  1K7A A;  3E5X A;  4U7D A;  4A0Z A;  1U5T B;  2MH9 A;  5H20 A;  5JHU A;  2LSO A;  1E2X A;  4L9T A;  4BHC A;  4CGZ A;  1K78 A;  1QGP A;  2L02 A;  1LDK B;  4KA4 A;  4ZYD A;  1RUO A;  3ELK A;  3BZ6 A;  4XSZ F;  2PFB A;  3U2R A;  4HDV A;  1MJB A;  3ECH A;  3KLO A;  5E18 F;  3HTS B;  4PZJ A;  5FO5 A;  4G6Q A;  5F6F A;  3WTW C;  3FXR A;  1DPU A;  2DAO A;  2RVC A;  3T8R A;  4RGS A;  2QEN A;  4KUM A;  4HF1 A;  1HKT A;  2A69 F;  3FMQ A;  3KP6 A;  3F6V A;  3VOD A;  4HLY A;  2NAZ A;  4HV6 A;  2BYV E;  1IW7 F;  1HKQ A;  4HQM A;  4U0V A;  4YFN F;  1A04 A;  1OR7 A;  3J7A O;  1PP7 U;  1TQP A;  1FYK A;  2HTS A;  4G6D A;  3MZH A;  1WWX A;  1PUE E;  4M74 A;  5IT9 Z;  2K86 A;  3V4G A;  3REO A;  3LAJ A;  2VON A;  1R7J A;  4KIB A;  4CZZ A;  4EJU A;  5BS6 A;  3TDZ C;  2WV0 A;  1W5S A;  4A0Y A;  5HVQ C;  4I09 A;  1F1Z A;  3HSE A;  5FD6 A;  5FD5 A;  1IUY A;  1LQ1 A;  2H6B A;  3M9A A;  3GFM A;  3T0Y A;  3V7R A;  2MD5 A;  4LJZ F;  3CO7 C;  4OU0 A;  1Z6R A;  3RJP A;  1S3J A;  4HYE A;  2W24 A;  3DXJ F;  1PP8 F;  2RQP A;  2CW0 F;  1SMT A;  2FNP A;  2FQ3 A;  2VOD A;  3LWF A;  2EFP A;  2KKO A;  1B9M A;  1G3S A;  4OIR F;  1MDM B;  2FMY A;  3GEZ A;  2FU4 A;  4AWX B;  5LRS A;  5D6F A;  4DNC A;  2Q2E A;  3O2P E;  4O6J A;  2FNA A;  4WK8 F;  2HYF A;  1LEB A;  2D1V A;  4MQ9 F;  5BPI A;  1BIB A;  1ZRC A;  3SFZ A;  2O6G E;  3CUQ C;  1ZHF A;  2HQN A;  3KE2 A;  1ON2 A;  4YII A;  3GWZ A;  1AOY A;  3F8N A;  2IA1 A;  2PI0 A;  2FOK A;  3EYY A;  3ZMS A;  2H94 A;  2F5C A;  2ISY A;  1L0O C;  2L4A A;  2DQL A;  1BIA A;  4KT5 C;  5FGM A;  3DP7 A;  1XGM A;  3LA2 A;  3HHH A;  4HW0 A;  4RS8 A;  1WQ2 A;  1VTN C;  5L3F A;  5E17 F;  2GZW A;  4S05 A;  1XSX A;  3BPV A;  4U88 A;  4GO1 A;  1GVJ A;  2VT3 A;  1OKR A;  4P96 A;  3F23 A;  3DV8 A;  3QRF F;  4RGX A;  4Q4Z F;  2DFI A;  4IRI A;  2LNB A;  5FFZ A;  4I98 B;  5ICG A;  3L9F A;  2W57 A;  4A6E A;  2A6E F;  2CGP A;  4AVP A;  3GYH X;  3CTA A;  4AIH A;  4IJA A;  1UST A;  4HBL A;  4G7H F;  1U5T C;  2BE5 F;  2VBW A;  5EEG A;  1W4M A;  2UXN A;  3V7S A;  2NNN A;  3WGH A;  4LK0 F;  2F2E A;  5HS9 A;  2HTJ A;  2LDU A;  2YPR A;  2Y75 A;  3CDH A;  1FPQ A;  2P5L C;  1G3W A;  1R5G A;  4EJW A;  2B0L A;  5DCM B;  1OMI A;  1BI0 A;  2K7L A;  1WSU A;  1W7P A;  2OAZ A;  3P9K A;  1I27 A;  1BN5 A;  2MLK A;  2PMH A;  5CVU A;  2K02 A;  3HTU A;  2C6Y A;  4FX0 A;  1YIO A;  2EA2 A;  5BPD A;  3O3K A;  4PGG A;  4PDK A;  4ZH4 F;  4H0E A;  1FBU A;  2CWE A;  1SD7 A;  5JVT A;  1P2F A;  1ZGA A;  3WGI A;  3BWG A;  4IF4 A;  2L3D A;  1JXS A;  2IT0 A;  5HOO A;  5HLG A;  4IVN A;  4ESJ A;  3RKX A;  4WWC A;  1T38 A;  4OIQ F;  3NQO A;  3L7W A;  1BC8 C;  3TOA A;  1P4A A;  1ZRE A;  4RB2 C;  3ZP5 A;  2STW A;  2ACJ A;  4A2U A;  4P55 A;  3E3V A;  1QBJ A;  3MQ0 A;  4L18 B;  1JGS A;  1TBX A;  2K4B A;  5D5X B;  4BXU A;  3SZT A;  2RKH A;  1FOK A;  2CSO A;  3ZN0 A;  4OIP F;  2HZT A;  4XSX F;  1R36 A;  2HYG D;  5L3G A;  1BOA A;  3KP2 A;  2Q0O A;  4Y17 A;  5D6E A;  1E17 A;  4M9Z A;  4LB6 B;  4R79 A;  3J80 Z;  5H6Q A;  2Z9O A;  3ABU A;  1RUN A;  3E97 A;  2PN6 A;  4HF2 A;  1ZRF A;  5DCM A;  1FP2 A;  1LEA A;  2DK5 A;  3F3X A;  3FMR A;  1DUX C;  5ILV A;  1IRF A;  4D0P A;  1XD7 A;  3RPU A;  2D45 A;  1R5H A;  3F8F A;  2DU9 A;  2FE3 A;  5L3C A;  4UVC A;  3GZ5 A;  1QQI A;  1YW9 A;  4CHU A;  2UZK A;  3EET A;  1BC7 C;  2VE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...