1F4KA

Crystal structure of the replication terminator protein/b-site dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the RTP-DNA complex and the mechanism of polar replication fork arrest
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication/dna
molecule keywords 5'-D(*CP*TP*AP*TP*GP*AP*AP*CP*AP*TP*AP*AP*TP*GP*TP*TP*CP*AP*
total genus 43
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1f4kA00
5DV5A 5L3DA 5HOOA 3HRMA 4HV6A 4UV8A 1EH8A 1MZBA 3J7AO 2CFXA 4G7HF 2A5YB 5DD4A 5HDKA 2KRFA 2O3FA 2PBIA 3FMSA 4HYEA 2QQBA 2ESNA 2QWWA 3ZMVA 3OV8A 3I0TA 2P7CB 3SZPA 2GIVA 1Y0UA 2VBWA 5JHUA 1S8NA 1FZPB 2RDPA 3FZVA 1MDMA 1XCVA 4GXOA 1U5TB 5LEKA 3KCCA 4EM1A 2O61A 4M9SA 2CQKA 3QRFF 5HVQC 3ABUA 1USTA 1KGSA 3LWFA 4AIKA 1XMKA 1R1VA 2Y75A 3ZMSA 3E5QA 4WXCA 3E97A 2CSOA 4BNCA 2M8EA 3SFZA 1USSA 2Q2EA 2KKOA 1ZGJA 1SD5A 1XMAA 3CDHA 5BPIA 2V9VA 3ECOA 4ESBA 4LLGF 4PGHA 3GEZA 3D0SA 4IPAA 1U5TC 4GYGA 2HGCA 4A0ZA 3CUQB 3K9TA 4IRGA 4Y15A 3SZTA 3RTRA 3DPLC 4R8HA 2EFPA 1K7AA 3T0YA 1FWZA 4LD5A 3QPHA 3P9CA 1IN5A 3I64A 5D4RA 5A2QZ 4UVBA 3DF8A 5AONA 4ESJA 2D1VA 1WI9A 2M5WA 1B59A 3WTUC 1HKTA 1RZ4A 1BJAA 2PN6A 3HHGA 3DKWA 4BHCA 3TO7A 1ZN2A 4YIFA 2DPDA 2XRNA 1ZRCA 3DFGA 3FMQA 3BPVA 3QP6A 2R7DA 2ACJA 1SFUA 1Z6RA 1S3JA 5LGUA 4KFCA 1Z05A 1Q1HA 1ODDA 2EB7A 1IN6A 4DQ2A 4HAMA 3HYIA 1RUOA 3BY6A 2O8XA 1FYMA 2PFBA 3M9AA 3CTAA 2QYOA 4AIHA 5BS6A 2W85A 1P6RA 4HF1A 3WG9A 1QO0D 5FFXA 4YIIA 2MC3A 2XVCA 3GW2A 2NYXA 2CWEA 3FM5A 4L9NA 4A5MA 2MH9A 2G9WA 3JAMZ 3E5UA 1O3RA 2HYFA 3EUHA 5E20A 1IF1A 5ICGA 1JHHA 1IXRC 1SD7A 1XGMA 4MTEA 2XAJA 1ULYA 1QQIA 1OR7A 5LLQA 1YS7A 3MCZA 3V4GA 5D5WB 4A6DA 2GA2A 4CXFA 2OU2A 3BZ6A 3LQQA 2P5VA 1E2XA 5LHHA 2HKOA 1JHFA 4IVNA 5ICFA 4A0XA 4I0AA 3CUOA 5L3BA 4AIJA 1XSDA 2PI0A 3JSOA 1B4AA 1HSJA 1U5TA 2A6EF 3I54A 3LA7A 4HX8A 3FX3A 4P55A 4ZYEA 1FT9A 3GFMA 5F1RA 1XD7A 3WGIA 1I1GA 4MHGA 1LEAA 4HX4A 1FBSA 1IXSB 2PJPA 4LGWA 2L3DA 3KLOA 1BM9A 3BJAA 2Y0MA 4KYWA 3SXYA 3GXOA 2ZJ2A 1P2FA 1DUXC 1ZLJA 5KK1A 3K1MA 4G6DA 4M72A 1K6OA 2D45A 2Q8KA 1HBXG 2FU4A 3TQNA 1T6SA 1MDMB 4LLLA 2K4JA 2R3SA 3RIRA 1IZ1A 3MFKA 4CO8A 3BPXA 5TRDA 2ZBKA 3V8LA 1Z6TA 2HEOA 2VODA 2MBFA 4G7ZF 4MGRA 3J80Z 1HKQA 1XGSA 2IA1A 4HZFA 1I6XA 1ON2A 5JI6A 5DCMA 4Y13A 4HV5A 3TO9A 2B0LA 1B1BA 4I2OA 2A61A 4IXAA 2E7WA 2PG4A 5AIQA 2RN7A 1P4AA 3K1PA 4UHTA 1FP2A 1W5TA 1T2KA 1YQAA 4XLPF 1J0RA 4XRFA 3H92A 3I4PA 4LLNA 3T8RA 1K78A 3B02A 1B9MA 1S29A 5DCFA 1U3EM 1YLFA 2VN2A 4P96A 1YO5C 1S7AA 1PDNC 5CVIA 1KQ9A 2GAUA 3WODF 3IL2A 3DEUA 3HUGA 4ENMA 3MEXA 1SAXA 3U1DA 2IVMA 4XBFA 2YX4A 1F5TA 1OPCA 4L0ZB 2PMHA 4G6QA 5J8FA 3KP5A 1V3FA 3PQJA 2JZYA 2BV6A 2STTA 2OQGA 4LFUA 5KVRA 2EFNA 1SFEA 5CVUA 2G7HA 5DEQA 1TW2A 2VT2A 5H6QA 1ONVA 2FNPA 2P6TA 4HLXA 1G3YA 5K1YA 3BROA 3E6MA 2XAFA 1O57A 4HBLA 1GXQA 4A2UA 4CYDA 3J81K 2HTJA 2QQ9A 3KLNA 1UB9A 2RKHA 2QENA 3R0AA 1B6AA 2GWRA 1S7OA 1SMYF 1P4WA 3PQKA 2LF7A 1XCBA 4ESFA 4LJZF 3F8BA 4BHBA 1BI3A 1R00A 3LQRA 4LB6B 1PP7U 1Z9CA 4E70A 1HW2A 2XAHA 3ZMDA 3BJ6A 4RGSA 3OOPA 2QQAA 3EYYA 1FX7A 4S05A 2F5DA 3FWEA 1HW5A 1F9NA 1ZG1A 1ON1A 2NNNA 2KJBA 5HS7A 3RKWA 5LHGA 5CVRA 3I5UA 3WTWC 5HS8A 1F1ZA 1P92A 2HWVA 4AWXB 3F3XA 3ZMUA 3AAFA 3REOA 4I01A 4M6XA 4NHJA 2GXGA 4DNCA 2BGCA 5D5VB 4RB1A 1J59A 2CYYA 5L3CA 3HSFA 5FB2A 2OZUA 3ZN0A 2EWNA 1ZGAA 1BOAA 2FNAA 2FQ3A 1ZREA 2C6YA 4OMYA 2VOPA 4GGGA 1QZYA 3P7NA 1UFMA 2UWMA 3GO5A 4M74A 2HYGD 5FFZA 1ZARA 4JBAA 1RNLA 4OIRF 2DW4A 4OINF 2H27A 3KFWX 3N97A 2DAOA 1T98A 4TV7A 3F22A 1GVJA 1KYZA 2DFIA 2KIUA 3RYPA 3GZ5A 1O3QA 2HOEA 1TQIA 2F5CA 1YW9A 4RGRA 3KP3A 2LKPA 4A0YA 5ICEA 4Q48A 2Q0OA 2CO5A 4AD9A 2FA5A 4KDPA 1T39A 1FPQA 4JQFA 2ISYA 4KMFA 4RGUA 3HRUA 2XASA 1BC7C 2CW0F 5K5RA 3O2PE 1YW8A 3W6KB 4ZYHA 1IAWA 4CDGA 4I09A 3F8MA 2QZ8A 3VOEA 3G73A 1XSVA 2OA4A 2NNYA 4IHTA 1IN7A 3FXQA 4BXUA 2BBYA 4M6YA 2EV0A 2M30A 2ZKZA 4XSXF 3I71A 3I59B 2A6HF 3VFZA 2Z99A 2JRTA 1B9NA 1KU9A 1LNWA 1Z91A 4L9TA 1FSEA 4UVCA 1QZZA 1R5GA 3KP2A 5E17F 4FHTA 1YG2A 4CGZA 4Q5SF 5DD8A 4R1HA 3HSRA 3Q9SA 4RB3C 2IA2A 1KU3A 1W5SA 5HDGA 4B09A 1FYKA 3V7SA 2YPRA 2V1DA 3B73A 4OIQF 1DPUA 1J75A 3E5XA 3QU6A 2BE5F 3SHFA 1MKMA 1T38A 5BPDA 3WTVC 2W25A 4UVAA 3MQ0A 1LDKB 1O3SA 1BBYA 1WKMA 2LNBA 5CVVA 2AXLA 2MLGA 3L09A 1H0MA 2QVOA 2VT3A 5EEGA 3BJOA 3KZZA 2P5LC 4MEXF 4XLNF 2IT0A 5F64A 1IN4A 4EM2A 5CVJA 3ZN1A 4I02A 3R4KA 3COAC 5HLHA 3KETA 2V1UA 4KICA 2FBKA 3GWZA 3HOTA 2ZO4A 3U9GA 2ZMEA 4OMZA 1R23A 1G3SA 4ENKA 2ESHA 5DUIA 3NRVA 3G3ZA 1C0WA 4LK1F 1QBJA 3M7GA 5ILSA 2QLZA 5BQTA 1IW7F 1XSXA 5L3FA 5DCMB 2IRFG 1J2XA 5JR3A 4WCGA 2WWYA 5HS9A 2OQRA 3T8TA 1HW1A 3RKXA 1LJ9A 4U0VA 4HF2A 1H9GA 3DXJF 3ROUA 4FX4A 4KIFA 4GCVA 4G7OF 3DPTA 2M45A 4WF2A 2VONA 4HF0A 3WGGA 1OMIA 3KP4A 2PLYA 5ILUA 3ZMTA 3ZMZA 4HQMA 2UZKA 2RC4A 1U6GA 4P9UA 5L3GA 5LHIA 2VOOA 1LDJA 1X3UA 2K86A 1YYVA 3WTXC 1D5VA 3CO7C 3SQNA 2DTRA 2YX7A 5E18F 1R36A 5LRRA 1TQMA 1WRJA 1HQCA 1R5HA 2ZXJA 3RPQA 4HLYA 4CICA 3O3KA 5CLSA 4G9YA 1CGPA 1XDSA 2FMLA 3PFIA 4CZZA 2O03A 4WXHA 2VE8A 4BH9A 2ZNYA 2K02A 3GUDA 4NQWA 4N9HA 3M1EA 5DDGA 1FP1D 3KEQA 1UHWA 2RQPA 2DLLA 1L0OC 5D6FA 5LRSA 5E1WA 4S04A 3R60A 4MEYF 4KIBA 1ZAOA 1KQ8A 4BYYA 4RS8A 2J5PA 2D1HA 4M9XA 1JE8A 2NAZA 4L5IA 4PGGA 2XUBA 1XGOA 1WWXA 1FC3A 4KN7X 4FT8A 2NS0A 1TW3A 1XGNA 3R6SA 5LGNA 5HLGA 2HTSA 2EV6A 2D2WA 3F21A 4KMUX 5E8GA 3Q5FA 1G3WA 4YFKF 2M87A 4U88A 5D6EA 5AIPA 1BI0A 5FD5A 1K79A 3QOPA 1SD4A 2F2EA 3E3VA 4LMYA 1AWCA 1BN5A 1U2WA 2QM3A 4EM0B 4ENNA 5TJJA 2PEXA 3CJNA 4H0EA 1QGPA 1J9IA 3L9FA 3WU1B 2ISZA 1YIOA 4QLCU 3E6BA 2HDCA 2AS5F 2RNJA 2Z9OA 2YSRA 4F7ZA 3IRRA 4YG2F 2WTEA 1TNTA 2WV0A 1A04A 2QBYB 3FHZA 1KU7A 5JFRA 3V7RA 1MD0A 1U8RA 2E7XA 2HQRA 3NQOA 2IPQX 1PP8F 3MWMA 4UV9A 3EDPA 2IW5A 2CG4A 2IA0A 2DT5A 1I5ZA 2OAZA 3P9IA 2K27A 4OU0A 1ZH5A 1W7PD 2ZFWA 1G6NA 3MZYA 1DDNA 2R7FA 2YU3A 3WTYC 3TOAA 3W6JB 4M9ZA 2FMYA 3DP7A 1K78B 3WE3A 1DPRA 4EJUA 3F72A 2OBPA 3C1DA 5D8LB 2ELHA 3IWFA 2VE9A 1VTNC 4AVPA 3HRTA 3L2CA 2ETHA 2ZMEB 1RUNA 1FBQA 4L9VA 5FLXZ 2XHKA 2LF8A 2DPUA 1R1UA 3CLOA 2F5EA 2XKPA 3EYIA 3K69A 4ENJA 2Y48A 5ED4A 4EVIA 5J6XA 4O5VA 4HW0A 2P7VB 2BYVE 5IT9Z 3VB2A 2W24A 2W84A 4QWQA 2V79A 4KUMA 1P4XA 4HDUA 1UHMA 4NB5A 1J5YA 3C18A 3KP6A 1IXCA 2VXZA 4M71A 1G4DA 3K2ZA 3K0LA 2LDUA 3ULQB 4RB2C 2P6SA 2MH2A 3BP8A 1D8JA 3GZ6A 1H9TA 3KP7A 3RDIA 5D8KB 3V8KA 3GX4X 3HOSA 1MJ9A 3HTSB 4L18B 2Z33A 5CYVA 3ZP5A 3BOQA 2FSWA 2O0YA 3BDDA 3P9KA 2DO7A 3L7WA 4PDKA 3WU0A 1OYIA 1ZG3A 4HA8A 1IRFA 2JPBA 1CF7A 5F6FA 1QNTA 5K5OA 4U0YA 2FOKA 3LFKA 5DYMA 3R61A 3I58A 3EQLF 1U78A 4N0BA 4GYIA 4MTDA 4EJOA 2VBXA 2V6CA 1L3LA 3ZPLA 3L00A 2HFHA 1XDUA 3HHHA 5H20A 5IT9K 2EV5A 3R0JA 1Z7UA 2F5FA 2O6GE 2XKOA 3WTSC 2A3SA 3QP5A 5E1XA 1OKRA 2HZTA 3IWZA 5E1ZB 3LAJA 1SD6A 3ISPA 4KN4X 4JK1X 2EA2A 3IRQA 3M8EA 1BIBA 3BWGA 1NHAA 3GF2A 1IUYA 3ABTA 3I59A 4BAYA 1J7KA 4EV0A 3ECHA 4IHSA 1R58A 2VBZA 1XN7A 1KA8A 5HDNA 1OYWA 4I0BA 1I27A 3H3UA 1AOYA 1V4RA 2RVCA 3ELKA 1E17A 2DBBA 4IRHA 4LG0B 4U7BA 5IT3A 2Z3YA 4L5JA 4IRIA 2JT1A 4HOBA 4A6EA 3HSEA 6PAXA 3J81Z 2WC2A 2EFOA 4MNUA 1MGTA 2DI3A 1TBXA 5FO5A 1HKSA 4PZJA 2HKXA 1YTYA 1GXPA 2ADUA 2MD5A 1WSUA 2W57A 2P8TA 3RJPA 4YFNF 3QU3A 4PCQA 4A12A 4IJAA 3WTTC 3F8FA 2KJCA 1FY7A 2COMA 2G7UA 4L9JA 1FLIA 3T1BA 3FXRA 3LA2A 3RI4A 2VBYA 3ML6A 3T5XA 2NRAC 4EGZA 3FXUA 1HSTA 1ZRFA 4O3MA 5D5XB 1YFHA 2XROA 2FF4A 1ZLKA 2JPCA 1W7PB 3MAJA 2UXXA 2DK8A 1O7LA 5HLIA 1I1SA 4P5OA 3TKYA 3JW4A 2PMUA 1FOKA 3QAHA 3M8FA 2RGVA 2EA4A 4OOIA 1TTYA 4BQAA 4WWCA 1IN8A 4BHPA 2TDXA 1LB2A 3DQVC 2MLKA 2GZWA 4G94A 5LEJA 1LVAA 4A5NA 2PQ8A 4U0WA 1RI7A 3F8NA 2K4BA 3J80K 5FGMA 3F8CA 4ZYGA 2H6CA 2CGPA 1FBUA 4ETSA 2JTVA 3D5LA 1BIAA 1STZA 4ZH4F 1KQ0A 4EJVA 2EJRA 2X4HA 4FX0A 4B8XA 4M73A 5DUKA 4Z2YA 4KT5C 1FSHA 1TNSA 3U2RA 5D5UB 2BEOA 1TQPA 5FD6A 2MA3A 2L4AA 1D8KA 1EV7A 4WXDA 1Z1DA 1LEBA 3LA3A 3RYRA 2GXBA 3WTZA 3TGNA 4U7DA 3QPTA 4KNYA 4HQEA 3FM3A 2P4WA 2IJLA 2VC1A 1JGSA 5ICCA 1BI2A 2XV4S 2KIMA 1ZG5A 4D0PA 3JSPA 4ASNA 3IHUA 4XSZF 2EFWA 5D4SA 1R7JA 1W4MA 1YW7A 4LB5A 1SFXA 2HQNA 2FEZA 3TOBA 2GQQA 2ZCWA 1D3YA 1ZHFA 2EK5A 4YFXF 3F6VA 1GHCA 4Q47A 3IKTA 2DQLA 2A69F 2FRHA 3WE2A 1BI1A 1REPC 2FXAA 3F6OA 1WQ2A 2V1XA 3V7CA 3GLXA 3TDUC 2IP2A 3VODA 2K7LA 4EGYA 3S2WA 1O7FA 3FMRA 1FNNA 3LAPA 4UXNA 3TDZC 3CUQC 4ON0A 4EJWA 4CHUA 1PUEE 1MJBA 1IRGA 2J5OA 2H6BA 4RGXA 5E8IA 1LDDA 1O3TA 1EH7A 1G3TA 3IC7A 4KIGA 3LSTA 4EJTA 1YS6A 4WX9A 1CF7B 5LBQA 4EMSA 4I7HA 2GA1A 5ILVA 3JAMK 3CO6C 3GFJA 2P5KA 2H09A 4IF4A 2XGXA 3Q9VA 1MJAA 3RPUA 3F23A 3RKYA 2YR2A 3KZYA 2DK5A 1W7PA 3IKVA 1FYLA 5H6RA 2OD5A 3GVAA 1BC8C 2LSOA 3JTHA 5L3EA 2L01A 4G8XA 3JTGA 4HX7A 2XAGA 2E1CA 4UNOA 4GO1A 4O6JA 2FBHA 2ZNZA 3HTUA 1JXSA 4LG0A 2UXNA 4MQ9F 1UCRA 5EEHA 2RV8A 4L0YB 2H94A 3CUQA 3KEOA 5JVTA 4HDVA 3K1NA 3GYHX 4K2EA 1F4KA 4ZZLA 2L4MA 4RAYA 2Z5UA 2KIFA 2X0LA 4RB0A 5LGTA 2FE3A 3C7JA 5BMZA 2QBYA 3ZQ7A 3MZHA 1R22A 5A2QK 2VC0A 4R79A 4OIOF 1EH6A 5FLXK 4EQQA 2M1BA 4Y17A 2XIGA 3GFLA 1ZRDA 3TO6A 1LQ1A 4RAZA 2JSCA 4ZZDA 2FBIA 1KYWA 4OIPF 2OZ6A 5BOXA 4MQVA 4N9IA 4ZYDA 4WK8F 3E6CC 2XAQA 3ERED 3I53A 1R1TA 4LK0F 3FF5A 5ERIA 3KE2A 1T0FA 3C3WA 3N4MA 1S6LA 2QUFA 5CJ9A 3HRSA 1SMTA 2E1NA 3WGHA 1XB4A 2L02A 2HR3A 4I98B 4UUVA 2A68F 2EFQA 3HIFA 1TLHB 3O6BB 3VEPA 1HXDA 3DV8A 3V8JA 3E6DA 2HS5A 2STWA 3EETA 1KU2A 5K5QA 1ZYRF 2L54A 4Q4ZF 2A07F 1RIOH 4P9FA 3H3ZA 3NEUA 1OYYA 1QPMA 1DP7P 5J8CA 2DU9A 3GFIA 4KA4A 2DQRA
chains in the Genus database with same CATH superfamily
5DV5A 2DMUA 5L3DA 3KZIC 5HOOA 3HRMA 1MH3A 1D1CA 5JLWA 1RESA 4HV6A 2AHQA 4UV8A 2VLAA 1EH8A 4XKBA 1MZBA 2EQRA 3J7AO 3EUHC 2CFXA 3PSFA 2LP0A 4G7HF 4E7ZA 2A5YB 5DD4A 5HDKA 2KRFA 2O3FA 3K4LA 2PBIA 3FMSA 4HYEA 2QQBA 2ESNA 3OL3A 2QWWA 3ZMVA 2NOGA 3K4BA 1Y8RB 2M3AA 3I0TA 3OV8A 1R4MB 3TEDA 1RR8C 2P7CB 1VQ8I 3FXOA 3SZPA 3VYUB 1QVTA 4LIVA 1X58A 2GIVA 1Y0UA 2VBWA 5JHUA 4Y52J 1S8NA 1FZPB 2RDPA 3FZVA 1MDMA 1XCVA 2Y9YA 4GXOA 2LKXA 3OR2C 1U5TB 4PJ0C 5LEKA 1G59A 3KCCA 4EM1A 2O61A 4M9SA 5CPRB 1LFPA 3FKJA 2CQKA 3QRFF 5HVQC 3ABUA 2X1DA 1USTA 1KGSA 3LWFA 2K85A 3JRGA 4AIKA 2GXAA 1I6HJ 1XMKA 1R1VA 2Y75A 3ZMSA 2V6EA 3LL7A 3E5QA 4WXCA 3E97A 2CSOA 3I55I 4BNCA 2M8EA 3SFZA 5CQGA 5IYDJ 5M5YJ 1VQ4I 1USSA 2Q2EA 3F9KA 4CUGA 3CDIA 4AYBA 2KKOA 1ZGJA 2DA7A 1SD5A 4KITB 2ZJPF 1JKPC 1XMAA 1ORKA 4CCOA 3CDHA 4QSHA 2HVRA 3BLYA 5BPIA 1ZK8A 1MMNA 2HNHA 2V9VA 2MABA 2BXYA 5EG0A 4N4OB 5EYRA 3ECOA 3UR3C 4LLGF 4PGHA 4ESBA 4E7JA 3GEZA 1VQLI 1YRNB 2B9SA 3D0SA 4IPAA 3QYEA 1U5TC 5FKMA 3G1LA 1I3QJ 4KJZA 5F0FA 2L7MP 4GYGA 4GDFA 2FQ4A 2HGCA 4A0ZA 4XNFA 1SFKA 3CUQB 3K9TA 3HUGB 3A01B 4IRGA 4Y15A 2BY2A 3SZTA 3RTRA 3DPLC 4R8HA 2EFPA 3CMAI 1K7AA 2CH0A 3T0YA 1JT6A 1FWZA 2LREA 4XM3A 1PVEA 4LD5A 2JK3A 3QPHA 1H88C 3P9CA 3PUFA 1WJFA 1IN5A 2RQQA 2BY3A 1Z3XA 2XF5A 3I64A 3DBRB 3DTKA 1ERDA 5D4RA 2LY2A 5A2QZ 2R7ZJ 4UVBA 1HA8A 3DF8A 3QOEA 3HGYA 5AONA 4ESJA 2D1VA 1WI9A 3Q3SA 3JRIA 2V7FA 2M5WA 3BT9A 1B59A 3WTUC 1HKTA 4GFBA 1RZ4A 4BKXA 1BJAA 2PN6A 3HHGA 4BBRJ 3DKWA 4BHCA 5M3MJ 3TO7A 5FKKA 1ZN2A 2EIMH 4PSWA 1B72A 1Z7LA 1Z77A 1GVDA 4YIFA 4BE1A 4QIWN 4BL0B 2O9LA 1VQOI 2DPDA 2XRNA 1ZRCA 3DFGA 4RAFA 3FMQA 2VJ5A 3BPVA 3QP6A 4J19A 2I10A 3EUAA 3ZQIA 4XL9A 2DCEA 5IOZA 2R7DA 3QPSA 2ACJA 1SFUA 3DBHB 1A6IA 1Z6RA 1S3JA 5LGUA 1X19A 3PO2J 4KFCA 1TL8A 1Z05A 1Q1HA 3HDDA 2XB5A 1A36A 2DT6A 1ODDA 2EB7A 1IN6A 2IGNA 4DQ2A 4AIDA 2EIJH 4HAMA 5DM7F 2KPMA 1TWHJ 3HYIA 2YU9J 2LRDA 4XKWA 3FK6A 1RUOA 4IEJA 2Y9ZA 3BY6A 2O8XA 1FYMA 2VKVA 1FEXA 2PFBA 2HPMA 4Y33A 2Y0SN 3M9AA 2LYCA 3CTAA 2FD5A 2VKEA 4PUSA 2QSFX 3TBIA 2A6TA 4D5FA 2QYOA 4AIHA 1R71A 5BS6A 2W85A 3BZCA 4LITA 5B66C 3JRCA 2F4MB 1P6RA 4HF1A 1JTXA 2PX9A 3D5RC 2R4GA 3WG9A 2BVMA 4RBOA 1QO0D 3IP4B 5GTIC 5FFXA 4YIIA 5IOYA 3OYIA 2MC3A 3PNTA 3CMEI 1O4XA 2XVCA 3GW2A 2NYXA 2CQXA 4FE7A 2ME0A 2CWEA 3FM5A 2XPWA 4L9NA 4A5MA 2MH9A 2G9WA 5J40A 5EZHA 2L7KA 3E5UA 4DBRA 3JAMZ 2RREA 2HYFA 3EUHA 1O3RA 2QCOA 5E20A 5DS9A 5KHDA 1MSFC 1IF1A 5ICGA 1JHHA 1A31A 1IXRC 1SD7A 1XGMA 4MTEA 1IDYA 1WCMJ 2XAJA 1ULYA 1QQIA 1OR7A 4A3CJ 5LLQA 1YS7A 2CRGA 2R92J 3MCZA 1V55H 3BTLA 2WBMA 3V4GA 5B3SH 5D5WB 1Y1VJ 4A6DA 3J7YJ 2GA2A 2R7XA 4CXFA 2OU2A 3BZ6A 3LQQA 3TP3A 3H3VK 2P5VA 3BR3A 1F43A 5IP7J 5F04A 4AC0A 4F3QA 1E2XA 5LHHA 2HKOA 1UELB 3MMYB 1K6YA 2DOFA 1JHFA 3A02A 4IVNA 5ICFA 1R6RA 4A0XA 4I0AA 3CUOA 3CQZJ 5L3BA 2CW7A 1NTCA 4AIJA 2ECBA 1XSDA 3O8HA 1YOVB 2ZB9A 5FJ8J 3CF5F 2PI0A 1S7EA 3JSOA 1B4AA 1ZGWA 1HSJA 1U5TA 2A6EF 3I54A 3LA7A 4HX8A 1JJ8C 3FX3A 2KLOA 4P55A 3CD6I 4B48A 1FT9A 4ZYEA 3GFMA 5F1RA 3ZQLA 1XD7A 1FMVA 1I1GA 3WGIA 2JA5J 2CQQA 4MHGA 4X6AJ 1LEAA 4HX4A 3QQAA 5GAHJ 1FBSA 2ZFUA 1ETWA 1IXSB 4NNJA 1HDPA 2PJPA 4LGWA 2E1MB 4I6ZA 2L3DA 3KLOA 1BM9A 3IH2A 2W7NA 3BJAA 2Y0MA 4KYWA 3DPUA 3SXYA 3GXOA 1FOWA 2ZJ2A 2F48A 1WH7A 2M9HA 1GDTA 4BDYA 1P2FA 1DUXC 1YX3A 2DFFA 2VXDA 3OYMA 1LUJB 3GCMA 3GBGA 1ZLJA 5KK1A 3BG7A 2LD5A 4AM3A 3K1MA 1FIAA 1E3HA 4G6DA 4M72A 3S1NJ 1K6OA 2NVQJ 1HOMA 2WADA 2D45A 3W2WA 2Q8KA 4XKVA 1WVRA 2HXOA 3LSPA 2M4GA 1HBXG 2FU4A 4LG3A 3TQNA 1T6SA 1MDMB 4HSTA 2JVGA 4LLLA 3S15J 4A3GJ 2K4JA 2R3SA 4DIQA 1BA5A 3RIRA 2IS2A 1XS9A 1JKOC 3S8PA 2QA4I 3L1PA 1IZ1A 3MFKA 4CO8A 2VKDA 2YUSA 3BPXA 5J4VA 5TRDA 1T33A 2GIZA 4FE4A 2ZBKA 3CMMA 3V8LA 4Z6YA 2MD0A 4Y7NJ 3GTKJ 1DP3A 1Z6TA 4UUTA 2HEOA 2VODA 2JA7J 4V2FA 4DZJA 1MMSA 2L2OA 3MN2A 2MBFA 4G7ZF 4PSXA 4BXXJ 4MGRA 4G12A 1T8IA 3NWSA 3J80Z 1HKQA 1XGSA 3OYGA 3H9GA 2IA1A 1A6QA 1MH4A 4HZFA 1I6XA 1ON2A 3CCYA 5JI6A 5DCMA 1BR4A 3ZQFA 4Y13A 4HV5A 3TO9A 2WAFA 2DXIA 2B0LA 3OL4A 1N78A 1B1BA 4I2OA 2A61A 1DU0A 4IXAA 2M0MA 2E7WA 2PG4A 5AIQA 2RN7A 2CUJA 2CU7A 1P4AA 1NG7A 3CJRB 4C2UA 3K1PA 4UHTA 1FP2A 3ZCOA 1W5TA 1T2KA 5GAGJ 1YQAA 4XLPF 3K4MA 3ZQHA 2VJ4A 2E1MC 2LOOA 2CUFA 3HG9A 3U21A 1J0RA 4QTRA 2VUMJ 4XRFA 3H92A 3I4PA 4LLNA 2HQ5A 3T8RA 1GLNA 3B02A 1K78A 4FISA 1B9MA 1S29A 4JX4A 5DCFA 1U3EM 3W6VA 1T0FC 1YLFA 2VN2A 4P96A 4F92B 3BC8A 2K40A 2QQ8A 1YO5C 1S7AA 4UUSB 1PDNC 5CVIA 2V9KA 1KQ9A 2GAUA 3WODF 3M07A 5LD2C 3IL2A 3DEUA 2ZC2A 4BQQA 1ETKA 3HUGA 4ENMA 3MEXA 2HXIA 1SAXA 2M7AA 2IVMA 3U1DA 4XBFA 2IXSA 2YX4A 1J09A 4DYQA 3W2VA 1F5TA 1OPCA 1X4OA 1RKWA 4L0ZB 2PMHA 4G6QA 2QF7A 4ZDLA 5J8FA 3KP5A 3G1OA 1UHSA 2OCEA 2X6YA 1V3FA 3PQJA 3OYHA 2JZYA 1T08B 2KRHA 2Y31A 2BV6A 3ZGKA 5EEAA 2STTA 1E3OC 2OQGA 4LFUA 5KVRA 1TT0A 1WH5A 3A03A 4M3EA 2R7RA 2EFNA 3S3MA 1SFEA 5CVUA 2G7HA 2IEKA 5DEQA 2R7WA 2GOXB 1TW2A 2HU9A 2VT2A 5H6QA 5JHFA 1ONVA 2FNPA 2P6TA 2ZXWH 4HLXA 4LOCA 2DODA 2LH9A 3HOUJ 1X2NA 2VJJA 1G3YA 5K1YA 3BROA 3E6MA 2R5ZA 2XAFA 1O57A 4HBLA 1YJNI 1GXQA 4A2UA 4CYDA 3J81K 2HTJA 2QQ9A 2I5UA 2XF6A 4OAZA 3LSMA 3KLNA 3HPGA 1UB9A 2RKHA 2QENA 4CYCB 2MW8A 3R0AA 1B6AA 2GWRA 4ZYAA 5FLVA 2IS1A 1S7OA 2HOTA 1QPIA 1SMYF 3CC7I 1P4WA 3PQKA 1OCCH 2LF7A 1XCBA 3N05A 2XC7A 2K3FA 4ZC3A 4LJZF 4ESFA 3F8BA 3PIPF 2KDZA 1K61A 2RNGA 3S1QJ 3M8JA 4BHBA 3S17J 1BI3A 4FCYA 1R00A 3LQRA 3K70C 4LB6B 5EF6A 4YRVA 1PP7U 1Z9CA 1BL0A 4E70A 1HW2A 1WZ2A 2XAHA 4A3EJ 2EIKH 3AFHA 3DLAA 3A01A 3BR5A 3ZMDA 4NDLA 3BJ6A 4RGSA 3OOPA 2JUCA 2LK2A 1MNDA 1NH3A 3HOYJ 2CUZA 2QQAA 3EYYA 4C3HJ 2R5ZB 1FX7A 2ZXHA 3PUBA 4S05A 2F5DA 3FWEA 2KL4A 1HW5A 1F9NA 1ZG1A 1ON1A 2NNNA 1QVUA 2KJBA 4XLEA 5HS7A 3JRBA 1X1PA 3RKWA 5LHGA 2K9SA 2KP6A 3OWTA 3RZOJ 5CVRA 3I5UA 3OYFA 4XICA 3WTWC 1IO2A 5HS8A 1F1ZA 1P92A 2HWVA 4AWXB 3F3XA 3ZMUA 3AAFA 3GTLJ 4UUSA 3H35A 5EDNA 3ABMH 1HF0A 2ECCA 2ZXIA 3DEEA 3REOA 4I01A 4AVZA 4M6XA 4HG2A 2OTJI 2HVSA 4NHJA 2GXGA 4DNCA 3A1YA 2BGCA 1QA6A 2FJ1A 5D5VB 2CFOA 4KT6A 2JJ7A 4RB1A 3GTGJ 1J59A 2CYYA 5L3CA 1BR1A 2E1OA 3HSFA 5FB2A 2OZUA 4XRSG 3ZN0A 2EWNA 1ZGAA 3TW6A 4RDUA 1BOAA 2FNAA 2FQ3A 1GV2A 3HOXJ 1ZREA 2C6YA 4OMYA 1S72I 2VOPA 3FIWA 3CCUI 4XN0A 2XF7A 4GGGA 1QZYA 4XONA 3P7NA 1UFMA 1P7JA 2XPUA 1MBEA 2UWMA 2JUGA 3BG5A 3GO5A 4M74A 2HYGD 5FFZA 1ZARA 1TWAJ 4JBAA 3G1MA 4BJ5C 1RNLA 3SYTA 1VQKI 1D5YA 4OIRF 2DW4A 4OINF 2H27A 2KFDA 3BG3A 3KFWX 3OMYA 3H9JA 3N97A 2DAOA 4MLOA 1T98A 4TV7A 3F22A 5FKOA 2DDAA 1GVJA 1OCRH 2CUEA 1KYZA 2DFIA 5KAFC 4XK4A 1LPQA 2KIUA 5JVGF 2VIXA 4B3XA 3RYPA 2E2HJ 3GZ5A 3CCVI 3BTJA 1O3QA 2HOEA 1CQTA 1TQIA 1U9NA 1RR7A 2HYJA 3MZ8A 2RAEA 5TISC 3I9V2 2F5CA 1SVMA 1X1CA 1YW9A 1IG7A 4RGRA 3KP3A 5BNGA 1WFXA 2LKPA 3OYAA 2E36A 4A0YA 5ICEA 3PL8A 1D0ZA 4BY1J 4Q48A 1FTZA 5E3MA 2Y69H 4XORA 2Q0OA 2BHYA 2CO5A 1V5GA 3NWTA 2FA5A 4AD9A 4KDPA 1T39A 1FPQA 4HPQA 4JQFA 3Q0UA 1MMGA 2ISYA 4KMFA 4RGUA 3HRUA 3QYBA 2EZLA 4DYCA 1YX5A 2XASA 1Y1WJ 1BC7C 2CW0F 2E19A 5K5RA 2PMZA 2DA3A 3O2PE 4PK4A 1YW8A 3W6KB 4MFEA 4BJTA 3F0CA 1OFCX 2OCCH 4ZYHA 3MKLA 2Z16A 2ICWG 4I09A 4CDGA 3F8MA 3E7LA 1IAWA 2QZ8A 3VOEA 3G73A 2MG4A 1XSVA 2OA4A 2EZIA 2Q2EB 2NNYA 1WI3A 4IHTA 1IN7A 1IJWC 3CCEI 4D9JA 3FXQA 4BXUA 4XLAA 3DTEA 3SZGA 2BBYA 4M6YA 3HOWJ 2A05A 2EV0A 5FKNA 2M30A 1VQ5I 2ZKZA 4XSXF 3L2VA 2MGQA 3I71A 3MD2A 3I59B 2JQ7A 2A6HF 1MBKA 5HNHA 3VFZA 2Z99A 4D1QA 2JRTA 4H4KC 3J7AY 1B9NA 1KU9A 1LNWA 1Z91A 4L9TA 5C44J 1FSEA 4UVCA 1QZZA 1R5GA 2PMZN 3KP2A 5E17F 2F4IA 3MVPA 2K3PA 4FHTA 3ZXSA 3HL2A 1YG2A 4CGZA 4Q5SF 1MW7A 5DD8A 4R1HA 3HSRA 1UJ8A 4DGWB 5F27A 4ZJZA 4JYKA 3Q9SA 4HNVA 4RB3C 4IHVA 4JOMA 2XSJC 2IA2A 2BVLA 4DJAA 1KU3A 2QSGX 2XGEA 3HKZN 3K10A 2F5VA 1W5SA 5HDGA 3MKZA 4B09A 1FYKA 3DTIA 3V7SA 4XLCA 3CC2I 2YPRA 3CCQI 2V1DA 3B73A 4OIQF 5EG0B 3PJRA 1DPUA 2HPIA 3E5XA 3Q0WA 1J75A 3QU6A 2BE5F 2KZVA 3SHFA 1AKHA 1MKMA 3QPLA 3ABLH 1T38A 1P9QC 5BPDA 3KPHA 1JKRC 2LTPA 3KEYA 2W25A 3WTVC 4UVAA 3MQ0A 1LDKB 1O3SA 2NS7A 1PUFB 5JLXA 3GLLA 1BBYA 1WKMA 2LNBA 5CVVA 3ZQCA 4IHYA 3BG6A 1XMXA 5M5XJ 2L9RA 2AXLA 4S0HB 4B4CA 2MLGA 3L09A 1TZLA 4L5EA 2QVOA 1H0MA 3C2GA 1MBGA 1OQYA 2VT3A 3CC4I 5EEGA 3BJOA 3OR1C 3BQYA 3KZZA 3AKZA 2P5LC 4RM2A 4XLNF 4MEXF 4MO7A 2IT0A 5F64A 1IN4A 2COBA 2KMUA 4EM2A 2B63J 2IGOA 5CVJA 3GZNB 2KT0A 3ZN1A 4I02A 2NVYJ 3OYNA 4BDZA 3R4KA 3S1RJ 3COAC 4ZDOA 5HLHA 3VSLA 4E7HA 3JRDA 3VSKA 1QZEA 1JT0A 3KETA 2WAQN 4B47A 4E6KG 1JUSA 2MFZA 3RSNA 2V1UA 2JA8J 2AQFA 2FBKA 4KICA 3GWZA 3HOTA 2ZO4A 3AG4H 3UKGA 3U9GA 2ZMEA 3JCUC 1PUFA 2TCTA 4OMZA 1R23A 1G3SA 4ENKA 1W36D 2ESHA 5DUIA 3NRVA 3G3ZA 4C30A 1C0WA 2BHZA 4LK1F 1QBJA 3M7GA 4PFPA 2QGUA 2DFHA 1V5EA 3HJEA 3HBLA 5ILSA 2QLZA 5BQTA 1IW7F 2QKLB 2E71A 1XSXA 5CKTA 2FUG2 2DMPA 5L3FA 5DCMB 2IRFG 2DTZA 1J2XA 5JR3A 4WCGA 4NUBA 2WWYA 5HS9A 1Y8QB 2OQRA 1NK3P 3I4MJ 3T8TA 1HW1A 3RKXA 1LJ9A 4XRMA 3IUOA 1JUPA 1FOYA 4U0VA 4HF2A 1AA7A 2ID3A 5K7HA 1H9GA 3DXJF 1I39A 3E1SA 2E34A 3ROUA 5CQEA 2LKSA 1GT0C 4FX4A 2CJJA 4KIFA 4GCVA 1MIJA 4G7OF 5J3LA 3DPTA 2M45A 4WF2A 1K4SA 3GTOJ 2VONA 1MNMC 4HF0A 1OISA 3WGGA 3FISA 4BY7J 3BCBA 1OMIA 4A3MJ 1R49A 3KP4A 2PLYA 2Y0SA 5ILUA 3ZMTA 3G6EI 3ZMZA 4HQMA 2UZKA 5C3EJ 2RC4A 1U6GA 2PJRB 4P9UA 2X6WA 3ASOH 1PJRA 5L3GA 5LHIA 4CA0A 2VOOA 1LDJA 1BJZA 1X3UA 2VJIA 2K86A 2A5WA 1YYVA 3WTXC 1D5VA 3SEQA 4LIUA 3SFIA 5EGOB 3BG9A 3CO7C 3SQNA 2DTRA 4E7LA 2YX7A 5E18F 1R36A 5FLMJ 3S16J 5LRRA 5IP6A 1RPWA 1TQMA 1WRJA 1HQCA 1R5HA 2ZXJA 2O5RA 2X1EA 3ASNH 3RPQA 4B3AA 2IGMA 1YIJI 4HLYA 4CICA 4BEHA 1Y56A 3O3KA 1MMAA 2X85A 1W0UA 3HKZA 5CLSA 5GPAA 4CCLA 3OOUA 1XX5A 4G9YA 5FROA 1UG0A 3DKXA 3SEZA 2KRCA 3H5AA 1CGPA 1I3AA 1XDSA 2FMLA 2R7TA 1H89C 2ELJA 3PFIA 4CZZA 5GTHC 2O03A 1VFCA 4WXHA 1MBFA 2VE8A 4BH9A 2ZNYA 1QHGA 2K02A 2LMDA 3RQIA 3GUDA 4NQWA 4N9HA 3K6GA 3M1EA 5DDGA 4CZCA 3UNGC 1JGGA 3BCAA 3CP2A 1FP1D 3KEQA 4IOCF 1UHWA 2RQPA 2DLLA 2L9NA 3BTIA 1L0OC 5D6FA 5LRSA 5E1WA 4S04A 3R60A 4MEYF 1LVKA 4KIBA 2K9MA 1WGXA 1Y39A 1ZAOA 2WAEA 1KQ8A 1ETXA 4BYYA 4RS8A 3SJMA 5FRNA 3RPUD 2XGDA 2J5PA 2D1HA 4M9XA 1JE8A 4MIMA 2NAZA 4L5IA 4PGGA 1X3WB 2EZKA 1TT5B 2XUBA 4YELA 1HCRA 4F55A 1XGOA 1WWXA 2W4SA 4RLQA 2ZSIB 1FC3A 4D7MA 4KN7X 2QSHX 4FT8A 2BY1A 2NS0A 3BZKA 1TW3A 4IOAF 1V54H 2D5VA 3ERMA 1XGNA 3R6SA 1D1BA 5LGNA 2IS4A 3A0BC 5HLGA 2HTSA 3KX2A 3AL0C 2EV6A 3CJQB 2D2WA 3F21A 3CCJI 4KMUX 5E8GA 3Q5FA 3S1MJ 1G3WA 4YFKF 2M87A 4U88A 5E79C 4QPOA 5D6EA 5AIPA 1BI0A 2NXNB 5FD5A 1K79A 3QOPA 1SD4A 3FXMA 3VYRB 2L9VA 1NG6A 2F2EA 2EPFA 3E3VA 4LMYA 1AWCA 4E7IA 5TGTA 2WY7Q 5HODA 3C2BA 3E0JB 5KNLA 1BN5A 1U2WA 2QM3A 4EM0B 4ENNA 5TJJA 2PEXA 3CJNA 4H0EA 1QGPA 3OYDA 5FRMA 1J9IA 3L9FA 2X6XA 3WU1B 1ZR4A 5KCMA 1VNDA 4BQNA 2ISZA 2OPTA 3ZR8X 1YIOA 4QLCU 3E6BA 2HDCA 2IGKA 1LKXA 2X1CA 1PYVA 2X9DA 1P7IA 2AS5F 4BACA 2RNJA 2Z9OA 2YSRA 4F7ZA 3IRRA 4YG2F 2WTEA 1TNTA 3GMEA 4F91B 2WV0A 1A04A 2QBYB 3FHZA 1VZ0A 1KU7A 5JFRA 3V7RA 1UAAA 1MD0A 1DQUA 1U8RA 2CW8A 4NBQA 2E7XA 2HQRA 3LSIA 1MBHA 5K7ZA 4EEFG 3NQOA 1M1EB 2IPQX 3CP8A 3S14J 2X48A 1HDDC 1TC3C 1YRNA 2EILH 1PP8F 1ZKGA 2WB1N 3MWMA 4UV9A 3EDPA 3WU2C 3VYSB 2IW5A 2CG4A 2IA0A 2CQ7A 2DT5A 3OS2A 3VWBA 2I8DA 1BW6A 1I5ZA 2OAZA 3K4JA 3P9IA 3L2QA 4BXFA 3PO3J 2K27A 4OU0A 1ZH5A 1W7PD 4P1WA 2ZFWA 4BUPA 2EINH 1G6NA 1QHHD 2LFBA 3WHCA 3AG3H 3MZYA 1DDNA 5E3LA 4IZZA 2JMWA 2R7FA 2YU3A 4DBQA 1NK2P 1UMQA 3WTYC 1FOXA 4KISA 3TOAA 3L2UA 1X4PA 3W6JB 2LBFA 4M9ZA 2FMYA 1X1AA 2R7QA 3DP7A 3GTJJ 2TRTA 1K78B 5M5WJ 3D5SC 1R9TJ 1VQPI 3JRFA 3EPZA 3WE3A 1DPRA 1Q1VA 2WAQA 3RZDJ 1YJ9I 3CDLA 2BY0A 4MFDA 3CCMI 5LFAA 2E5NA 4JX6A 4EJUA 1ETQA 3F72A 2OBPA 3C1DA 5D8LB 2ELHA 3V42A 4DYRA 1T95A 2XPVA 3IWFA 3HGGA 5B1AH 2VE9A 1VTNC 4AVPA 3HRTA 3L2CA 1HLVA 2ETHA 2K9NA 4XIDA 2ZMEB 1RUNA 3HXLA 3H5RA 1FBQA 4L9VA 5FLXZ 2XHKA 3TW7A 2LF8A 2DPUA 1XC5A 4RMNA 1R1UA 1AHDP 3CLOA 3ONQA 3AL0B 2F5EA 2XKPA 3HEFA 3EYIA 3K69A 4ENJA 1BOBA 2Y48A 5ED4A 4V19K 3A0HC 4EVIA 2LC2A 5J6XA 4O5VA 5IPAA 4HW0A 2BW3B 2KZGA 2P7VB 3IAM2 2BYVE 1ZTRA 5IT9Z 3VB2A 2W24A 2W84A 4QWQA 4U87A 2CMPA 2V79A 3FXKA 4KUMA 4IQ4A 1P4XA 4Y3OA 3LSHA 2VQGA 5DTDA 2VQCA 4HDUA 4IKFA 3QWLA 1UHMA 3VYTB 1EA3A 1OCOH 1OR7C 2CV1A 4PFOA 4B1RA 4NB5A 4NC7A 1Y6IA 1J5YA 3C18A 3KP6A 1IXCA 2VXZA 9ANTA 3L2RA 4M71A 4XRSA 1G4DA 2W1OA 3K2ZA 3JREA 3K0LA 4AU7A 3OIQA 2LDUA 3ULQB 3EUKL 2G0EA 4RB2C 3FHNA 3CCSI 2P6SA 2CS3A 3BTCA 4C9YA 2MH2A 3BP8A 1D8JA 3LSRA 3GZ6A 2DJIA 1H9TA 3KP7A 1DGRM 4E4HA 3RDIA 2DA6A 5D8KB 5J4YA 3RKQA 2ZJRF 3O8GA 2DT7B 2ID6A 1SEUA 3V8KA 4CSWA 1YHQI 3GX4X 5IYBJ 3HOSA 1MJ9A 3HTSB 4L18B 2HZDA 4FTHA 2Z33A 3PNVA 5J1YA 1W36C 1D0XA 2H1LA 4DW6A 4F93B 2Q1ZB 5CYVA 3ZP5A 1SANA 1W1WE 3K7AJ 4I99C 3BOQA 5C4XJ 1IUFA 2FSWA 2L7FP 2O0YA 3SDGA 2Y2ZA 3BDDA 3P9KA 2DO7A 3FDYA 3L7WA 4E7KA 3ZQQA 3DBLB 4PDKA 3WU0A 4NC6A 2KQRA 4EATA 2L5QA 4BQOA 3H1CA 1OYIA 1ZG3A 3LFUA 4HA8A 1IRFA 2JPBA 1CF7A 2HDDA 5F6FA 4A3KJ 1QNTA 2VL8A 5K5OA 4U0YA 5IY5H 2FOKA 4UB6C 3LFKA 5DYMA 2R5YA 2DYRH 2HQAA 3R61A 2WA0A 2FOWA 1EKEA 1WJ5A 3I58A 4UY8I 3EQLF 1U78A 4N0BA 4GYIA 4N4NB 1Y0NA 3DLLF 1B8IA 1BW5A 4MTDA 3S93A 2M2EA 4EJOA 2VBXA 2V6CA 1L3LA 3ZPLA 3L00A 3TL4X 1D0YA 3ZQGA 2HFHA 1XDUA 2CQNA 5IYCJ 2M4KA 3U1KA 2F4OB 3OYBA 3CZ6A 3HHHA 5H20A 5IT9K 4AUXA 1A5JA 2EV5A 2JWTA 3LSJA 2GLOA 4A3LJ 2CV2A 3R0JA 5H2FC 3OYKA 3M3YJ 5M3FJ 1Z7UA 3K4KA 3LSKA 2F5FA 2HOAA 4G6TB 2O6GE 3HM5A 2XKOA 3WTSC 2E2IJ 2A3SA 3QP5A 5E1XA 3BR0A 1JKQC 3M4OJ 1OKRA 2DN0A 2HZTA 4XR6A 2R7VA 4OWRB 2AO9A 3IWZA 1WJEA 4J01A 5E1ZB 3LAJA 3HOVJ 1SD6A 2K9QA 4YEJA 3ISPA 5F0HA 5DM6F 3JRHA 4IHXA 1RRJA 3OIOA 4KN4X 1K83J 1R5ID 4HEA2 4JK1X 4UB8C 3RCOA 2Z2SB 2KDOA 3P5JA 2EA2A 2MSYA 1SC7A 2ZMEC 4BEHB 3IRQA 4ANJA 3OYCA 3M8EA 1BIBA 3W3CA 3VDXA 3BWGA 1NHAA 3GF2A 1H8AC 3KYDB 5KAIC 1IUYA 3OSFA 3ABTA 5F0CA 2E35A 3I59A 1ACIA 4D5CA 4BAYA 1IV8A 1J7KA 4C2MJ 4EV0A 2LVSA 4II2A 3ECHA 4IHSA 1R58A 4BJ6C 2XRLA 2VBZA 1XN7A 1KA8A 2E60A 1SVLA 1X1DA 5HDNA 1OYWA 4I0BA 1AKHB 2DA5A 1I27A 3H3UA 1AOYA 1V4RA 2RVCA 4PJMA 1JI8A 2H8RA 2R5YB 3ELKA 1E17A 1LE8B 2DBBA 4IRHA 2DMNA 4RM3A 1DGWY 4A69C 4U7BA 4LG0B 4PJNA 2ELKA 5IT3A 2Z3YA 2XB0X 4L5JA 4D7NA 4IRIA 4FASD 2JT1A 4HOBA 4A6EA 4F52A 2W00A 3HSEA 1YITI 3IH3A 1VQ9I 2M7BA 1U8BA 1TP4A 3OS0A 2W48A 4A3BJ 6PAXA 2OC6A 4BU2A 2F6CA 3J81Z 2WC2A 2EFOA 2R7OA 4MNUA 4C3IJ 1MGTA 5IP9J 2DI3A 1SVOA 1MMDA 1TBXA 5EZGA 3S3NA 5FO5A 2IS6A 1HKSA 1F36A 4NQWB 4PZJA 2HKXA 1YTYA 1GXPA 2ADUA 3PNYA 1Z67A 2MD5A 1WSUA 3CJTB 1XPXA 4M3GA 2W57A 2P8TA 4XN3A 3LMMA 3RJPA 2BOLA 4YFNF 3B6CA 2DJNA 3QU3A 4PCQA 4A12A 2DFEA 3H9QA 3QODA 4IJAA 3F8FA 3WTTC 2R0QC 2W82A 2KJCA 4JP0A 1FY7A 2COMA 2G7UA 2K5CA 2L9SA 3K2AA 4L9JA 3AG2H 2YS9A 1FLIA 3HC7A 3T1BA 5F1JA 3QYFA 3FXRA 3LA2A 3PSIA 3RI4A 1X2MA 2VBYA 2JN6A 3ML6A 3T5XA 2NRAC 1OLTA 4EGZA 4RLFA 2H1KA 2KIQA 1YI2I 3FXUA 2DA4A 1HSTA 1ZRFA 1JJ6C 4O3MA 3IH4A 5D5XB 4BGDA 1YFHA 4M3FA 2XROA 3RQ4A 1JTYA 3CCRI 2FF4A 1X3ZB 1ZLKA 1RETA 4FQGA 2JPCA 1OCPA 4ITVA 1W7PB 2VQHA 3MAJA 1G2HA 2UXXA 2DK8A 1O7LA 1I50J 5HLIA 2WY8Q 3M1CA 1GV5A 4J00A 1I1SA 3KYCB 4P5OA 3S3OA 4A3JJ 3D1NI 3TKYA 3JW4A 2PMUA 1FOKA 3QAHA 2VASA 3M8FA 3ABKH 2RGVA 2EA4A 4OOIA 1TTYA 3HPHA 4M3BA 4BQAA 4WWCA 1UG2A 1IN8A 1S9HA 4M3DA 4BHPA 1ETYA 3FK7A 4CCMA 2TDXA 1Z3YA 2LY9A 2ZJQF 2DMQA 1LB2A 3DQVC 1ETVA 2MLKA 4V2GA 2IBDA 1RKTA 2GZWA 3OYJA 4G94A 3CLQA 5LEJA 5GAEJ 1SFOJ 3B6AA 1ETOA 3NAUA 1LE8A 1LVAA 3VPRA 1WJBA 4X0GA 4A5NA 5C4JJ 1OCTC 3I4NJ 5B1BH 2PQ8A 4U0WA 2NVUB 3LNQA 3OYEA 1T56A 4DOZA 1RI7A 3BQZA 2VPRA 3F8NA 3S32A 4BS9A 3KIOA 1VQMI 3LSGA 2K4BA 2NVXJ 3J80K 2L7ZA 1N75A 3FXJA 5FGMA 1WJCA 1ZELA 1FJLA 3BR2A 4I76A 3F8CA 2BW3A 4ZYGA 2H6CA 3MKYB 2CGPA 1FBUA 1SAUA 3DU5A 3FBNB 5EJCA 4ETSA 2JTVA 4XLHA 3OYLA 3D5LA 1BIAA 2O7OA 3CMYA 3AG1H 4HSRA 2EH3A 2N8GA 1STZA 5GPCA 3GTQJ 4ZH4F 3G2BA 2V26A 4XLFA 1KQ0A 1XTAA 1Z21A 2EJRA 2X4HA 3CESA 3WG7H 4EJVA 1ZQ3P 4ABZA 4FX0A 3NARA 4B8XA 4M73A 5DUKA 1HC8A 4Z2YA 4KT5C 3WHBA 1FSHA 1TNSA 3U2RA 5D5UB 4AYBN 1IGNA 2BEOA 2ME6A 1TQPA 5FD6A 2MA3A 1ENHA 2L4AA 1D8KA 1EV7A 3X2QH 4WXDA 3DEWA 5J1RA 1Z1DA 2HVQA 1LEBA 3BR1A 3LA3A 4W1UA 3RYRA 4OAYA 2GXBA 3WTZA 3TGNA 4U7DA 2DOAA 2NS8A 3QPTA 2BZTA 2XSDC 4KNYA 4HQEA 3FM3A 2IAIA 2P4WA 2IJLA 1QU3A 2DMTA 2L0KA 1IRXA 2LR8A 4A3FJ 3A4CA 2VC1A 3S2HJ 1JGSA 5ICCA 1V5FA 1BI2A 2XV4S 5EGOA 2FX0A 2KIMA 3G4SI 1ZG5A 2JVHA 1EF4A 4D0PA 3JSPA 4ASNA 3IHUA 1W5CC 4XSZF 2EFWA 4RAGA 3FBIB 5D4SA 1R7JA 1W4MA 1YW7A 4JX5A 1VQ7I 2DDBA 4LB5A 1SFXA 3G71I 3OIPA 4B43A 1BR2A 2HQNA 2FEZA 3Q0VA 1VQNI 1E0EA 1MNEA 3TOBA 5GP9A 2GQQA 2ZCWA 1D3YA 2P0WA 1ZHFA 1R4NB 1TWGJ 2EK5A 4YFXF 3F6VA 1GHCA 4Q47A 3IKTA 2DQLA 2WB1A 2A69F 2FRHA 1POGA 3WE2A 3I3LA 1BI1A 2M34A 1REPC 1RC9A 2FXAA 3F6OA 1WQ2A 2V1XA 3V7CA 4B44A 1IDZA 3GLXA 3TDUC 1LFUP 2IP2A 1B72B 3VODA 2K7LA 4EGYA 3OSGA 2OUMA 2VB6A 1O7FA 2DYSH 3S2WA 3TMOA 3FMRA 3FKIJ 1FNNA 3LAPA 3DKYA 2M0CA 4UXNA 4CH7A 3TDZC 3H5NA 3CUQC 4ON0A 4XMYA 2LLKA 3SDBA 5E3OA 2V9PA 4EJWA 4CHUA 1PUEE 1MJBA 1IRGA 2J5OA 2P81A 2H6BA 4RA2A 4RGXA 5E8IA 1LDDA 1O3TA 4IHWA 4XKCA 2DA1A 1EH7A 3OS1A 3S2DJ 1G3TA 2VQLA 3IC7A 4KIGA 3GTPJ 2XGCA 3JR9A 3TP0A 3LSTA 3PIOF 4EJTA 1YS6A 4WX9A 3ZOBA 3KYLA 1CF7B 4A3DJ 2M8GX 5LBQA 4EMSA 4I7HA 1VQ6I 2GA1A 5ILVA 2E2JJ 3JAMK 1YE9A 3CO6C 1VI0A 1DU6A 3H0GJ 3GFJA 2X51A 2P5KA 2H09A 2LG4A 5FKLA 1IV6A 2OTLI 4IF4A 1KZHA 1XG1A 1S5LC 1LFBA 2XGXA 1WJAA 3Q9VA 1MJAA 4FETA 3RPUA 3JRAA 3F23A 2VKHA 3RKYA 2YR2A 3KZYA 2XDVA 2CV0A 1ITYA 2DK5A 1W7PA 3ESWB 3IKVA 3K4NA 2AXTC 5HLTA 4IO9F 4XQFA 1FYLA 4DZPA 5H6RA 2OD5A 3GVAA 4CYCA 1BC8C 2LSOA 3JTHA 4QPQA 1MBJA 4HRIA 4YIRX 2E5ZA 2H8WA 2LY1A 3DCFA 5L3EA 2L01A 3FXLA 4G8XA 3JTGA 2LBFB 4HX7A 1AU7A 2UV1A 2XAUA 3ZRGA 2EZHA 2XAGA 2E1CA 4UNOA 3BR6A 4GO1A 2QKMB 2ZSHB 1WHUA 4O6JA 2FBHA 2ZNZA 3K70D 2WV1A 3HTUA 1JXSA 1TWCJ 1EJ9A 1FTTA 2JA6J 5HNFA 4LG0A 1B8IB 1IRZA 3MKWB 4M6VA 4II3A 2UXNA 4MQ9F 1UCRA 4IL6C 5EEHA 2RV8A 4L0YB 2H94A 3CUQA 1N25A 2JRMA 3H36A 2JSPA 3KEOA 3L2WA 3HB9A 4HNUA 5JVTA 4HDVA 3K1NA 3GYHX 4K2EA 4E7SA 1F4KA 4ZZLA 2L4MA 4RAYA 2Z5UA 2GM4A 5GADJ 3DU6A 2GOMA 2X6OA 2KIFA 1U0JA 2X0LA 4RB0A 1IC8A 5E3NA 4C2TA 2HI3A 2O8KA 4Y4RA 5LGTA 2FE3A 3LOCA 2V4JC 3HOZJ 2V1NA 2R7UA 3C7JA 4A3IJ 5BMZA 3IV5A 2QBYA 2K9LA 3ZQ7A 3MZHA 1R22A 2KHMA 2QEXI 1GUUA 2R93J 3H0DA 5A2QK 2VC0A 1FIPA 5B5EC 1N77A 1U9OA 3GTMJ 4A93J 4R79A 1KONA 4OIOF 4NC8A 1W0TA 4CCJA 1EH6A 5FLXK 1OJLA 1X1BA 2M1BA 1Z0XA 2Y30A 2XIGA 4Y17A 4EQQA 3W2AA 3GFLA 4ZTFA 1ZRDA 2EBIA 3TO6A 1A35A 2BXZA 3DWLE 1WPKA 2AQEA 1LQ1A 4RAZA 2JSCA 4ZZDA 1TWFJ 2FBIA 4IX7A 1KYWA 1MSEC 4OIPF 2OZ6A 5BOXA 1E3PA 3CF2A 4MQVA 3J7ZI 2UUZA 1UZCA 4N9IA 4ZYDA 4WK8F 3E6CC 2MC4A 2VI6A 2XAQA 1WJDA 4BE2A 3I56I 5J1UA 3ERED 3I53A 1R1TA 4LK0F 3FF5A 1VF9A 4PJLA 4CCNA 2OJED 5ERIA 4CCKA 3OY9A 1OCZH 2OV7A 3KE2A 3PM1A 4HNTA 1T0FA 2KISA 3C3WA 4X1EA 3N4MA 1S6LA 2QUFA 2B7EA 3K4CA 2DOEA 5CJ9A 3HRSA 2MYSA 1SMTA 3C2HA 3PFYA 2NVTJ 2E1NA 3WGHA 2OF7A 4PJJA 1YJWI 2HDWA 1XB4A 2L02A 4GRIA 2HR3A 4ZDPA 4I98B 4IQJA 2Z1DA 4UUVA 4BBSJ 2A68F 2PJRA 2NOJB 3IAS2 4XOTA 2VPLA 2EFQA 4W97A 1APLC 3HIFA 1D1AA 1TLHB 3O6BB 2JA2A 3VEPA 4C3JJ 1HXDA 3DV8A 3V8JA 2DA2A 5K7FA 3HZJA 2GBYA 1G8XA 3E6DA 2HS5A 3CCLI 2STWA 1JUMA 3EETA 1KU2A 1QRYA 1FMWA 5K5QA 1ZYRF 2L54A 5F08A 5J47A 4Q4ZF 2HOSA 2A07F 1RIOH 4P9FA 3H3ZA 4XOPA 3A2KA 1ZR2A 4BE0A 3NEUA 1OYYA 4ZTJA 1K4TA 2R7SA 1QPMA 1DP7P 5J8CA 2DU9A 3GFIA 4KA4A 2DQRA
chains in the Genus database with same CATH topology
5DV5A 5L3DA 5HOOA 3HRMA 4HV6A 4UV8A 1EH8A 1MZBA 3J7AO 2CFXA 4G7HF 2A5YB 5DD4A 5HDKA 2KRFA 2O3FA 2PBIA 3FMSA 4HYEA 2QQBA 2ESNA 2QWWA 3ZMVA 3OV8A 3I0TA 2P7CB 3SZPA 2GIVA 1Y0UA 2VBWA 5JHUA 1S8NA 1FZPB 2RDPA 3FZVA 1MDMA 1XCVA 4GXOA 1U5TB 5LEKA 3KCCA 4EM1A 2O61A 4M9SA 2CQKA 3QRFF 5HVQC 3ABUA 1USTA 1KGSA 3LWFA 4AIKA 1XMKA 1R1VA 2Y75A 3ZMSA 3E5QA 4WXCA 3E97A 2CSOA 4BNCA 2M8EA 3SFZA 1USSA 2Q2EA 2KKOA 1ZGJA 1SD5A 1XMAA 3CDHA 5BPIA 2V9VA 3ECOA 4ESBA 4LLGF 4PGHA 3GEZA 3D0SA 4IPAA 1U5TC 4GYGA 2HGCA 4A0ZA 3CUQB 3K9TA 4IRGA 4Y15A 3SZTA 3RTRA 3DPLC 4R8HA 2EFPA 1K7AA 3T0YA 1FWZA 4LD5A 3QPHA 3P9CA 1IN5A 3I64A 5D4RA 5A2QZ 4UVBA 3DF8A 5AONA 4ESJA 2D1VA 1WI9A 2M5WA 1B59A 3WTUC 1HKTA 1RZ4A 1BJAA 2PN6A 3HHGA 3DKWA 4BHCA 3TO7A 1ZN2A 4YIFA 2DPDA 2XRNA 1ZRCA 3DFGA 3FMQA 3BPVA 3QP6A 2R7DA 2ACJA 1SFUA 1Z6RA 1S3JA 5LGUA 4KFCA 1Z05A 1Q1HA 1ODDA 2EB7A 1IN6A 4DQ2A 4HAMA 3HYIA 1RUOA 3BY6A 2O8XA 1FYMA 2PFBA 3M9AA 3CTAA 2QYOA 4AIHA 5BS6A 2W85A 1P6RA 4HF1A 3WG9A 1QO0D 5FFXA 4YIIA 2MC3A 2XVCA 3GW2A 2NYXA 2CWEA 3FM5A 4L9NA 4A5MA 2MH9A 2G9WA 3JAMZ 3E5UA 1O3RA 2HYFA 3EUHA 5E20A 1IF1A 5ICGA 1JHHA 1IXRC 1SD7A 1XGMA 4MTEA 2XAJA 1ULYA 1QQIA 1OR7A 5LLQA 1YS7A 3MCZA 3V4GA 5D5WB 4A6DA 2GA2A 4CXFA 2OU2A 3BZ6A 3LQQA 2P5VA 1E2XA 5LHHA 2HKOA 1JHFA 4IVNA 5ICFA 4A0XA 4I0AA 3CUOA 5L3BA 4AIJA 1XSDA 2PI0A 3JSOA 1B4AA 1HSJA 1U5TA 2A6EF 3I54A 3LA7A 4HX8A 3FX3A 4P55A 4ZYEA 1FT9A 3GFMA 5F1RA 1XD7A 3WGIA 1I1GA 4MHGA 1LEAA 4HX4A 1FBSA 1IXSB 2PJPA 4LGWA 2L3DA 3KLOA 1BM9A 3BJAA 2Y0MA 4KYWA 3SXYA 3GXOA 2ZJ2A 1P2FA 1DUXC 1ZLJA 5KK1A 3K1MA 4G6DA 4M72A 1K6OA 2D45A 2Q8KA 1HBXG 2FU4A 3TQNA 1T6SA 1MDMB 4LLLA 2K4JA 2R3SA 3RIRA 1IZ1A 3MFKA 4CO8A 3BPXA 5TRDA 2ZBKA 3V8LA 1Z6TA 2HEOA 2VODA 2MBFA 4G7ZF 4MGRA 3J80Z 1HKQA 1XGSA 2IA1A 4HZFA 1I6XA 1ON2A 5JI6A 5DCMA 4Y13A 4HV5A 3TO9A 2B0LA 1B1BA 4I2OA 2A61A 4IXAA 2E7WA 2PG4A 5AIQA 2RN7A 1P4AA 3K1PA 4UHTA 1FP2A 1W5TA 1T2KA 1YQAA 4XLPF 1J0RA 4XRFA 3H92A 3I4PA 4LLNA 3T8RA 1K78A 3B02A 1B9MA 1S29A 5DCFA 1U3EM 1YLFA 2VN2A 4P96A 1YO5C 1S7AA 1PDNC 5CVIA 1KQ9A 2GAUA 3WODF 3IL2A 3DEUA 3HUGA 4ENMA 3MEXA 1SAXA 3U1DA 2IVMA 4XBFA 2YX4A 1F5TA 1OPCA 4L0ZB 2PMHA 4G6QA 5J8FA 3KP5A 1V3FA 3PQJA 2JZYA 2BV6A 2STTA 2OQGA 4LFUA 5KVRA 2EFNA 1SFEA 5CVUA 2G7HA 5DEQA 1TW2A 2VT2A 5H6QA 1ONVA 2FNPA 2P6TA 4HLXA 1G3YA 5K1YA 3BROA 3E6MA 2XAFA 1O57A 4HBLA 1GXQA 4A2UA 4CYDA 3J81K 2HTJA 2QQ9A 3KLNA 1UB9A 2RKHA 2QENA 3R0AA 1B6AA 2GWRA 1S7OA 1SMYF 1P4WA 3PQKA 2LF7A 1XCBA 4ESFA 4LJZF 3F8BA 4BHBA 1BI3A 1R00A 3LQRA 4LB6B 1PP7U 1Z9CA 4E70A 1HW2A 2XAHA 3ZMDA 3BJ6A 4RGSA 3OOPA 2QQAA 3EYYA 1FX7A 4S05A 2F5DA 3FWEA 1HW5A 1F9NA 1ZG1A 1ON1A 2NNNA 2KJBA 5HS7A 3RKWA 5LHGA 5CVRA 3I5UA 3WTWC 5HS8A 1F1ZA 1P92A 2HWVA 4AWXB 3F3XA 3ZMUA 3AAFA 3REOA 4I01A 4M6XA 4NHJA 2GXGA 4DNCA 2BGCA 5D5VB 4RB1A 1J59A 2CYYA 5L3CA 3HSFA 5FB2A 2OZUA 3ZN0A 2EWNA 1ZGAA 1BOAA 2FNAA 2FQ3A 1ZREA 2C6YA 4OMYA 2VOPA 4GGGA 1QZYA 3P7NA 1UFMA 2UWMA 3GO5A 4M74A 2HYGD 5FFZA 1ZARA 4JBAA 1RNLA 4OIRF 2DW4A 4OINF 2H27A 3KFWX 3N97A 2DAOA 1T98A 4TV7A 3F22A 1GVJA 1KYZA 2DFIA 2KIUA 3RYPA 3GZ5A 1O3QA 2HOEA 1TQIA 2F5CA 1YW9A 4RGRA 3KP3A 2LKPA 4A0YA 5ICEA 4Q48A 2Q0OA 2CO5A 4AD9A 2FA5A 4KDPA 1T39A 1FPQA 4JQFA 2ISYA 4KMFA 4RGUA 3HRUA 2XASA 1BC7C 2CW0F 5K5RA 3O2PE 1YW8A 3W6KB 4ZYHA 1IAWA 4CDGA 4I09A 3F8MA 2QZ8A 3VOEA 3G73A 1XSVA 2OA4A 2NNYA 4IHTA 1IN7A 3FXQA 4BXUA 2BBYA 4M6YA 2EV0A 2M30A 2ZKZA 4XSXF 3I71A 3I59B 2A6HF 3VFZA 2Z99A 2JRTA 1B9NA 1KU9A 1LNWA 1Z91A 4L9TA 1FSEA 4UVCA 1QZZA 1R5GA 3KP2A 5E17F 4FHTA 1YG2A 4CGZA 4Q5SF 5DD8A 4R1HA 3HSRA 3Q9SA 4RB3C 2IA2A 1KU3A 1W5SA 5HDGA 4B09A 1FYKA 3V7SA 2YPRA 2V1DA 3B73A 4OIQF 1DPUA 1J75A 3E5XA 3QU6A 2BE5F 3SHFA 1MKMA 1T38A 5BPDA 3WTVC 2W25A 4UVAA 3MQ0A 1LDKB 1O3SA 1BBYA 1WKMA 2LNBA 5CVVA 2AXLA 2MLGA 3L09A 1H0MA 2QVOA 2VT3A 5EEGA 3BJOA 3KZZA 2P5LC 4MEXF 4XLNF 2IT0A 5F64A 1IN4A 4EM2A 5CVJA 3ZN1A 4I02A 3R4KA 3COAC 5HLHA 3KETA 2V1UA 4KICA 2FBKA 3GWZA 3HOTA 2ZO4A 3U9GA 2ZMEA 4OMZA 1R23A 1G3SA 4ENKA 2ESHA 5DUIA 3NRVA 3G3ZA 1C0WA 4LK1F 1QBJA 3M7GA 5ILSA 2QLZA 5BQTA 1IW7F 1XSXA 5L3FA 5DCMB 2IRFG 1J2XA 5JR3A 4WCGA 2WWYA 5HS9A 2OQRA 3T8TA 1HW1A 3RKXA 1LJ9A 4U0VA 4HF2A 1H9GA 3DXJF 3ROUA 4FX4A 4KIFA 4GCVA 4G7OF 3DPTA 2M45A 4WF2A 2VONA 4HF0A 3WGGA 1OMIA 3KP4A 2PLYA 5ILUA 3ZMTA 3ZMZA 4HQMA 2UZKA 2RC4A 1U6GA 4P9UA 5L3GA 5LHIA 2VOOA 1LDJA 1X3UA 2K86A 1YYVA 3WTXC 1D5VA 3CO7C 3SQNA 2DTRA 2YX7A 5E18F 1R36A 5LRRA 1TQMA 1WRJA 1HQCA 1R5HA 2ZXJA 3RPQA 4HLYA 4CICA 3O3KA 5CLSA 4G9YA 1CGPA 1XDSA 2FMLA 3PFIA 4CZZA 2O03A 4WXHA 2VE8A 4BH9A 2ZNYA 2K02A 3GUDA 4NQWA 4N9HA 3M1EA 5DDGA 1FP1D 3KEQA 1UHWA 2RQPA 2DLLA 1L0OC 5D6FA 5LRSA 5E1WA 4S04A 3R60A 4MEYF 4KIBA 1ZAOA 1KQ8A 4BYYA 4RS8A 2J5PA 2D1HA 4M9XA 1JE8A 2NAZA 4L5IA 4PGGA 2XUBA 1XGOA 1WWXA 1FC3A 4KN7X 4FT8A 2NS0A 1TW3A 1XGNA 3R6SA 5LGNA 5HLGA 2HTSA 2EV6A 2D2WA 3F21A 4KMUX 5E8GA 3Q5FA 1G3WA 4YFKF 2M87A 4U88A 5D6EA 5AIPA 1BI0A 5FD5A 1K79A 3QOPA 1SD4A 2F2EA 3E3VA 4LMYA 1AWCA 1BN5A 1U2WA 2QM3A 4EM0B 4ENNA 5TJJA 2PEXA 3CJNA 4H0EA 1QGPA 1J9IA 3L9FA 3WU1B 2ISZA 1YIOA 4QLCU 3E6BA 2HDCA 2AS5F 2RNJA 2Z9OA 2YSRA 4F7ZA 3IRRA 4YG2F 2WTEA 1TNTA 2WV0A 1A04A 2QBYB 3FHZA 1KU7A 5JFRA 3V7RA 1MD0A 1U8RA 2E7XA 2HQRA 3NQOA 2IPQX 1PP8F 3MWMA 4UV9A 3EDPA 2IW5A 2CG4A 2IA0A 2DT5A 1I5ZA 2OAZA 3P9IA 2K27A 4OU0A 1ZH5A 1W7PD 2ZFWA 1G6NA 3MZYA 1DDNA 2R7FA 2YU3A 3WTYC 3TOAA 3W6JB 4M9ZA 2FMYA 3DP7A 1K78B 3WE3A 1DPRA 4EJUA 3F72A 2OBPA 3C1DA 5D8LB 2ELHA 3IWFA 2VE9A 1VTNC 4AVPA 3HRTA 3L2CA 2ETHA 2ZMEB 1RUNA 1FBQA 4L9VA 5FLXZ 2XHKA 2LF8A 2DPUA 1R1UA 3CLOA 2F5EA 2XKPA 3EYIA 3K69A 4ENJA 2Y48A 5ED4A 4EVIA 5J6XA 4O5VA 4HW0A 2P7VB 2BYVE 5IT9Z 3VB2A 2W24A 2W84A 4QWQA 2V79A 4KUMA 1P4XA 4HDUA 1UHMA 4NB5A 1J5YA 3C18A 3KP6A 1IXCA 2VXZA 4M71A 1G4DA 3K2ZA 3K0LA 2LDUA 3ULQB 4RB2C 2P6SA 2MH2A 3BP8A 1D8JA 3GZ6A 1H9TA 3KP7A 3RDIA 5D8KB 3V8KA 3GX4X 3HOSA 1MJ9A 3HTSB 4L18B 2Z33A 5CYVA 3ZP5A 3BOQA 2FSWA 2O0YA 3BDDA 3P9KA 2DO7A 3L7WA 4PDKA 3WU0A 1OYIA 1ZG3A 4HA8A 1IRFA 2JPBA 1CF7A 5F6FA 1QNTA 5K5OA 4U0YA 2FOKA 3LFKA 5DYMA 3R61A 3I58A 3EQLF 1U78A 4N0BA 4GYIA 4MTDA 4EJOA 2VBXA 2V6CA 1L3LA 3ZPLA 3L00A 2HFHA 1XDUA 3HHHA 5H20A 5IT9K 2EV5A 3R0JA 1Z7UA 2F5FA 2O6GE 2XKOA 3WTSC 2A3SA 3QP5A 5E1XA 1OKRA 2HZTA 3IWZA 5E1ZB 3LAJA 1SD6A 3ISPA 4KN4X 4JK1X 2EA2A 3IRQA 3M8EA 1BIBA 3BWGA 1NHAA 3GF2A 1IUYA 3ABTA 3I59A 4BAYA 1J7KA 4EV0A 3ECHA 4IHSA 1R58A 2VBZA 1XN7A 1KA8A 5HDNA 1OYWA 4I0BA 1I27A 3H3UA 1AOYA 1V4RA 2RVCA 3ELKA 1E17A 2DBBA 4IRHA 4LG0B 4U7BA 5IT3A 2Z3YA 4L5JA 4IRIA 2JT1A 4HOBA 4A6EA 3HSEA 6PAXA 3J81Z 2WC2A 2EFOA 4MNUA 1MGTA 2DI3A 1TBXA 5FO5A 1HKSA 4PZJA 2HKXA 1YTYA 1GXPA 2ADUA 2MD5A 1WSUA 2W57A 2P8TA 3RJPA 4YFNF 3QU3A 4PCQA 4A12A 4IJAA 3WTTC 3F8FA 2KJCA 1FY7A 2COMA 2G7UA 4L9JA 1FLIA 3T1BA 3FXRA 3LA2A 3RI4A 2VBYA 3ML6A 3T5XA 2NRAC 4EGZA 3FXUA 1HSTA 1ZRFA 4O3MA 5D5XB 1YFHA 2XROA 2FF4A 1ZLKA 2JPCA 1W7PB 3MAJA 2UXXA 2DK8A 1O7LA 5HLIA 1I1SA 4P5OA 3TKYA 3JW4A 2PMUA 1FOKA 3QAHA 3M8FA 2RGVA 2EA4A 4OOIA 1TTYA 4BQAA 4WWCA 1IN8A 4BHPA 2TDXA 1LB2A 3DQVC 2MLKA 2GZWA 4G94A 5LEJA 1LVAA 4A5NA 2PQ8A 4U0WA 1RI7A 3F8NA 2K4BA 3J80K 5FGMA 3F8CA 4ZYGA 2H6CA 2CGPA 1FBUA 4ETSA 2JTVA 3D5LA 1BIAA 1STZA 4ZH4F 1KQ0A 4EJVA 2EJRA 2X4HA 4FX0A 4B8XA 4M73A 5DUKA 4Z2YA 4KT5C 1FSHA 1TNSA 3U2RA 5D5UB 2BEOA 1TQPA 5FD6A 2MA3A 2L4AA 1D8KA 1EV7A 4WXDA 1Z1DA 1LEBA 3LA3A 3RYRA 2GXBA 3WTZA 3TGNA 4U7DA 3QPTA 4KNYA 4HQEA 3FM3A 2P4WA 2IJLA 2VC1A 1JGSA 5ICCA 1BI2A 2XV4S 2KIMA 1ZG5A 4D0PA 3JSPA 4ASNA 3IHUA 4XSZF 2EFWA 5D4SA 1R7JA 1W4MA 1YW7A 4LB5A 1SFXA 2HQNA 2FEZA 3TOBA 2GQQA 2ZCWA 1D3YA 1ZHFA 2EK5A 4YFXF 3F6VA 1GHCA 4Q47A 3IKTA 2DQLA 2A69F 2FRHA 3WE2A 1BI1A 1REPC 2FXAA 3F6OA 1WQ2A 2V1XA 3V7CA 3GLXA 3TDUC 2IP2A 3VODA 2K7LA 4EGYA 3S2WA 1O7FA 3FMRA 1FNNA 3LAPA 4UXNA 3TDZC 3CUQC 4ON0A 4EJWA 4CHUA 1PUEE 1MJBA 1IRGA 2J5OA 2H6BA 4RGXA 5E8IA 1LDDA 1O3TA 1EH7A 1G3TA 3IC7A 4KIGA 3LSTA 4EJTA 1YS6A 4WX9A 1CF7B 5LBQA 4EMSA 4I7HA 2GA1A 5ILVA 3JAMK 3CO6C 3GFJA 2P5KA 2H09A 4IF4A 2XGXA 3Q9VA 1MJAA 3RPUA 3F23A 3RKYA 2YR2A 3KZYA 2DK5A 1W7PA 3IKVA 1FYLA 5H6RA 2OD5A 3GVAA 1BC8C 2LSOA 3JTHA 5L3EA 2L01A 4G8XA 3JTGA 4HX7A 2XAGA 2E1CA 4UNOA 4GO1A 4O6JA 2FBHA 2ZNZA 3HTUA 1JXSA 4LG0A 2UXNA 4MQ9F 1UCRA 5EEHA 2RV8A 4L0YB 2H94A 3CUQA 3KEOA 5JVTA 4HDVA 3K1NA 3GYHX 4K2EA 1F4KA 4ZZLA 2L4MA 4RAYA 2Z5UA 2KIFA 2X0LA 4RB0A 5LGTA 2FE3A 3C7JA 5BMZA 2QBYA 3ZQ7A 3MZHA 1R22A 5A2QK 2VC0A 4R79A 4OIOF 1EH6A 5FLXK 4EQQA 2M1BA 4Y17A 2XIGA 3GFLA 1ZRDA 3TO6A 1LQ1A 4RAZA 2JSCA 4ZZDA 2FBIA 1KYWA 4OIPF 2OZ6A 5BOXA 4MQVA 4N9IA 4ZYDA 4WK8F 3E6CC 2XAQA 3ERED 3I53A 1R1TA 4LK0F 3FF5A 5ERIA 3KE2A 1T0FA 3C3WA 3N4MA 1S6LA 2QUFA 5CJ9A 3HRSA 1SMTA 2E1NA 3WGHA 1XB4A 2L02A 2HR3A 4I98B 4UUVA 2A68F 2EFQA 3HIFA 1TLHB 3O6BB 3VEPA 1HXDA 3DV8A 3V8JA 3E6DA 2HS5A 2STWA 3EETA 1KU2A 5K5QA 1ZYRF 2L54A 4Q4ZF 2A07F 1RIOH 4P9FA 3H3ZA 3NEUA 1OYYA 1QPMA 1DP7P 5J8CA 2DU9A 3GFIA 4KA4A 2DQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DV5 A;  5L3D A;  5HOO A;  3HRM A;  4HV6 A;  4UV8 A;  1EH8 A;  1MZB A;  3J7A O;  2CFX A;  4G7H F;  2A5Y B;  5DD4 A;  5HDK A;  2KRF A;  2O3F A;  2PBI A;  3FMS A;  4HYE A;  2QQB A;  2ESN A;  2QWW A;  3ZMV A;  3OV8 A;  3I0T A;  2P7C B;  3SZP A;  2GIV A;  1Y0U A;  2VBW A;  5JHU A;  1S8N A;  1FZP B;  2RDP A;  3FZV A;  1MDM A;  1XCV A;  4GXO A;  1U5T B;  5LEK A;  3KCC A;  4EM1 A;  2O61 A;  4M9S A;  2CQK A;  3QRF F;  5HVQ C;  3ABU A;  1UST A;  1KGS A;  3LWF A;  4AIK A;  1XMK A;  1R1V A;  2Y75 A;  3ZMS A;  3E5Q A;  4WXC A;  3E97 A;  2CSO A;  4BNC A;  2M8E A;  3SFZ A;  1USS A;  2Q2E A;  2KKO A;  1ZGJ A;  1SD5 A;  1XMA A;  3CDH A;  5BPI A;  2V9V A;  3ECO A;  4ESB A;  4LLG F;  4PGH A;  3GEZ A;  3D0S A;  4IPA A;  1U5T C;  4GYG A;  2HGC A;  4A0Z A;  3CUQ B;  3K9T A;  4IRG A;  4Y15 A;  3SZT A;  3RTR A;  3DPL C;  4R8H A;  2EFP A;  1K7A A;  3T0Y A;  1FWZ A;  4LD5 A;  3QPH A;  3P9C A;  1IN5 A;  3I64 A;  5D4R A;  5A2Q Z;  4UVB A;  3DF8 A;  5AON A;  4ESJ A;  2D1V A;  1WI9 A;  2M5W A;  1B59 A;  3WTU C;  1HKT A;  1RZ4 A;  1BJA A;  2PN6 A;  3HHG A;  3DKW A;  4BHC A;  3TO7 A;  1ZN2 A;  4YIF A;  2DPD A;  2XRN A;  1ZRC A;  3DFG A;  3FMQ A;  3BPV A;  3QP6 A;  2R7D A;  2ACJ A;  1SFU A;  1Z6R A;  1S3J A;  5LGU A;  4KFC A;  1Z05 A;  1Q1H A;  1ODD A;  2EB7 A;  1IN6 A;  4DQ2 A;  4HAM A;  3HYI A;  1RUO A;  3BY6 A;  2O8X A;  1FYM A;  2PFB A;  3M9A A;  3CTA A;  2QYO A;  4AIH A;  5BS6 A;  2W85 A;  1P6R A;  4HF1 A;  3WG9 A;  1QO0 D;  5FFX A;  4YII A;  2MC3 A;  2XVC A;  3GW2 A;  2NYX A;  2CWE A;  3FM5 A;  4L9N A;  4A5M A;  2MH9 A;  2G9W A;  3JAM Z;  3E5U A;  1O3R A;  2HYF A;  3EUH A;  5E20 A;  1IF1 A;  5ICG A;  1JHH A;  1IXR C;  1SD7 A;  1XGM A;  4MTE A;  2XAJ A;  1ULY A;  1QQI A;  1OR7 A;  5LLQ A;  1YS7 A;  3MCZ A;  3V4G A;  5D5W B;  4A6D A;  2GA2 A;  4CXF A;  2OU2 A;  3BZ6 A;  3LQQ A;  2P5V A;  1E2X A;  5LHH A;  2HKO A;  1JHF A;  4IVN A;  5ICF A;  4A0X A;  4I0A A;  3CUO A;  5L3B A;  4AIJ A;  1XSD A;  2PI0 A;  3JSO A;  1B4A A;  1HSJ A;  1U5T A;  2A6E F;  3I54 A;  3LA7 A;  4HX8 A;  3FX3 A;  4P55 A;  4ZYE A;  1FT9 A;  3GFM A;  5F1R A;  1XD7 A;  3WGI A;  1I1G A;  4MHG A;  1LEA A;  4HX4 A;  1FBS A;  1IXS B;  2PJP A;  4LGW A;  2L3D A;  3KLO A;  1BM9 A;  3BJA A;  2Y0M A;  4KYW A;  3SXY A;  3GXO A;  2ZJ2 A;  1P2F A;  1DUX C;  1ZLJ A;  5KK1 A;  3K1M A;  4G6D A;  4M72 A;  1K6O A;  2D45 A;  2Q8K A;  1HBX G;  2FU4 A;  3TQN A;  1T6S A;  1MDM B;  4LLL A;  2K4J A;  2R3S A;  3RIR A;  1IZ1 A;  3MFK A;  4CO8 A;  3BPX A;  5TRD A;  2ZBK A;  3V8L A;  1Z6T A;  2HEO A;  2VOD A;  2MBF A;  4G7Z F;  4MGR A;  3J80 Z;  1HKQ A;  1XGS A;  2IA1 A;  4HZF A;  1I6X A;  1ON2 A;  5JI6 A;  5DCM A;  4Y13 A;  4HV5 A;  3TO9 A;  2B0L A;  1B1B A;  4I2O A;  2A61 A;  4IXA A;  2E7W A;  2PG4 A;  5AIQ A;  2RN7 A;  1P4A A;  3K1P A;  4UHT A;  1FP2 A;  1W5T A;  1T2K A;  1YQA A;  4XLP F;  1J0R A;  4XRF A;  3H92 A;  3I4P A;  4LLN A;  3T8R A;  1K78 A;  3B02 A;  1B9M A;  1S29 A;  5DCF A;  1U3E M;  1YLF A;  2VN2 A;  4P96 A;  1YO5 C;  1S7A A;  1PDN C;  5CVI A;  1KQ9 A;  2GAU A;  3WOD F;  3IL2 A;  3DEU A;  3HUG A;  4ENM A;  3MEX A;  1SAX A;  3U1D A;  2IVM A;  4XBF A;  2YX4 A;  1F5T A;  1OPC A;  4L0Z B;  2PMH A;  4G6Q A;  5J8F A;  3KP5 A;  1V3F A;  3PQJ A;  2JZY A;  2BV6 A;  2STT A;  2OQG A;  4LFU A;  5KVR A;  2EFN A;  1SFE A;  5CVU A;  2G7H A;  5DEQ A;  1TW2 A;  2VT2 A;  5H6Q A;  1ONV A;  2FNP A;  2P6T A;  4HLX A;  1G3Y A;  5K1Y A;  3BRO A;  3E6M A;  2XAF A;  1O57 A;  4HBL A;  1GXQ A;  4A2U A;  4CYD A;  3J81 K;  2HTJ A;  2QQ9 A;  3KLN A;  1UB9 A;  2RKH A;  2QEN A;  3R0A A;  1B6A A;  2GWR A;  1S7O A;  1SMY F;  1P4W A;  3PQK A;  2LF7 A;  1XCB A;  4ESF A;  4LJZ F;  3F8B A;  4BHB A;  1BI3 A;  1R00 A;  3LQR A;  4LB6 B;  1PP7 U;  1Z9C A;  4E70 A;  1HW2 A;  2XAH A;  3ZMD A;  3BJ6 A;  4RGS A;  3OOP A;  2QQA A;  3EYY A;  1FX7 A;  4S05 A;  2F5D A;  3FWE A;  1HW5 A;  1F9N A;  1ZG1 A;  1ON1 A;  2NNN A;  2KJB A;  5HS7 A;  3RKW A;  5LHG A;  5CVR A;  3I5U A;  3WTW C;  5HS8 A;  1F1Z A;  1P92 A;  2HWV A;  4AWX B;  3F3X A;  3ZMU A;  3AAF A;  3REO A;  4I01 A;  4M6X A;  4NHJ A;  2GXG A;  4DNC A;  2BGC A;  5D5V B;  4RB1 A;  1J59 A;  2CYY A;  5L3C A;  3HSF A;  5FB2 A;  2OZU A;  3ZN0 A;  2EWN A;  1ZGA A;  1BOA A;  2FNA A;  2FQ3 A;  1ZRE A;  2C6Y A;  4OMY A;  2VOP A;  4GGG A;  1QZY A;  3P7N A;  1UFM A;  2UWM A;  3GO5 A;  4M74 A;  2HYG D;  5FFZ A;  1ZAR A;  4JBA A;  1RNL A;  4OIR F;  2DW4 A;  4OIN F;  2H27 A;  3KFW X;  3N97 A;  2DAO A;  1T98 A;  4TV7 A;  3F22 A;  1GVJ A;  1KYZ A;  2DFI A;  2KIU A;  3RYP A;  3GZ5 A;  1O3Q A;  2HOE A;  1TQI A;  2F5C A;  1YW9 A;  4RGR A;  3KP3 A;  2LKP A;  4A0Y A;  5ICE A;  4Q48 A;  2Q0O A;  2CO5 A;  4AD9 A;  2FA5 A;  4KDP A;  1T39 A;  1FPQ A;  4JQF A;  2ISY A;  4KMF A;  4RGU A;  3HRU A;  2XAS A;  1BC7 C;  2CW0 F;  5K5R A;  3O2P E;  1YW8 A;  3W6K B;  4ZYH A;  1IAW A;  4CDG A;  4I09 A;  3F8M A;  2QZ8 A;  3VOE A;  3G73 A;  1XSV A;  2OA4 A;  2NNY A;  4IHT A;  1IN7 A;  3FXQ A;  4BXU A;  2BBY A;  4M6Y A;  2EV0 A;  2M30 A;  2ZKZ A;  4XSX F;  3I71 A;  3I59 B;  2A6H F;  3VFZ A;  2Z99 A;  2JRT A;  1B9N A;  1KU9 A;  1LNW A;  1Z91 A;  4L9T A;  1FSE A;  4UVC A;  1QZZ A;  1R5G A;  3KP2 A;  5E17 F;  4FHT A;  1YG2 A;  4CGZ A;  4Q5S F;  5DD8 A;  4R1H A;  3HSR A;  3Q9S A;  4RB3 C;  2IA2 A;  1KU3 A;  1W5S A;  5HDG A;  4B09 A;  1FYK A;  3V7S A;  2YPR A;  2V1D A;  3B73 A;  4OIQ F;  1DPU A;  1J75 A;  3E5X A;  3QU6 A;  2BE5 F;  3SHF A;  1MKM A;  1T38 A;  5BPD A;  3WTV C;  2W25 A;  4UVA A;  3MQ0 A;  1LDK B;  1O3S A;  1BBY A;  1WKM A;  2LNB A;  5CVV A;  2AXL A;  2MLG A;  3L09 A;  1H0M A;  2QVO A;  2VT3 A;  5EEG A;  3BJO A;  3KZZ A;  2P5L C;  4MEX F;  4XLN F;  2IT0 A;  5F64 A;  1IN4 A;  4EM2 A;  5CVJ A;  3ZN1 A;  4I02 A;  3R4K A;  3COA C;  5HLH A;  3KET A;  2V1U A;  4KIC A;  2FBK A;  3GWZ A;  3HOT A;  2ZO4 A;  3U9G A;  2ZME A;  4OMZ A;  1R23 A;  1G3S A;  4ENK A;  2ESH A;  5DUI A;  3NRV A;  3G3Z A;  1C0W A;  4LK1 F;  1QBJ A;  3M7G A;  5ILS A;  2QLZ A;  5BQT A;  1IW7 F;  1XSX A;  5L3F A;  5DCM B;  2IRF G;  1J2X A;  5JR3 A;  4WCG A;  2WWY A;  5HS9 A;  2OQR A;  3T8T A;  1HW1 A;  3RKX A;  1LJ9 A;  4U0V A;  4HF2 A;  1H9G A;  3DXJ F;  3ROU A;  4FX4 A;  4KIF A;  4GCV A;  4G7O F;  3DPT A;  2M45 A;  4WF2 A;  2VON A;  4HF0 A;  3WGG A;  1OMI A;  3KP4 A;  2PLY A;  5ILU A;  3ZMT A;  3ZMZ A;  4HQM A;  2UZK A;  2RC4 A;  1U6G A;  4P9U A;  5L3G A;  5LHI A;  2VOO A;  1LDJ A;  1X3U A;  2K86 A;  1YYV A;  3WTX C;  1D5V A;  3CO7 C;  3SQN A;  2DTR A;  2YX7 A;  5E18 F;  1R36 A;  5LRR A;  1TQM A;  1WRJ A;  1HQC A;  1R5H A;  2ZXJ A;  3RPQ A;  4HLY A;  4CIC A;  3O3K A;  5CLS A;  4G9Y A;  1CGP A;  1XDS A;  2FML A;  3PFI A;  4CZZ A;  2O03 A;  4WXH A;  2VE8 A;  4BH9 A;  2ZNY A;  2K02 A;  3GUD A;  4NQW A;  4N9H A;  3M1E A;  5DDG A;  1FP1 D;  3KEQ A;  1UHW A;  2RQP A;  2DLL A;  1L0O C;  5D6F A;  5LRS A;  5E1W A;  4S04 A;  3R60 A;  4MEY F;  4KIB A;  1ZAO A;  1KQ8 A;  4BYY A;  4RS8 A;  2J5P A;  2D1H A;  4M9X A;  1JE8 A;  2NAZ A;  4L5I A;  4PGG A;  2XUB A;  1XGO A;  1WWX A;  1FC3 A;  4KN7 X;  4FT8 A;  2NS0 A;  1TW3 A;  1XGN A;  3R6S A;  5LGN A;  5HLG A;  2HTS A;  2EV6 A;  2D2W A;  3F21 A;  4KMU X;  5E8G A;  3Q5F A;  1G3W A;  4YFK F;  2M87 A;  4U88 A;  5D6E A;  5AIP A;  1BI0 A;  5FD5 A;  1K79 A;  3QOP A;  1SD4 A;  2F2E A;  3E3V A;  4LMY A;  1AWC A;  1BN5 A;  1U2W A;  2QM3 A;  4EM0 B;  4ENN A;  5TJJ A;  2PEX A;  3CJN A;  4H0E A;  1QGP A;  1J9I A;  3L9F A;  3WU1 B;  2ISZ A;  1YIO A;  4QLC U;  3E6B A;  2HDC A;  2AS5 F;  2RNJ A;  2Z9O A;  2YSR A;  4F7Z A;  3IRR A;  4YG2 F;  2WTE A;  1TNT A;  2WV0 A;  1A04 A;  2QBY B;  3FHZ A;  1KU7 A;  5JFR A;  3V7R A;  1MD0 A;  1U8R A;  2E7X A;  2HQR A;  3NQO A;  2IPQ X;  1PP8 F;  3MWM A;  4UV9 A;  3EDP A;  2IW5 A;  2CG4 A;  2IA0 A;  2DT5 A;  1I5Z A;  2OAZ A;  3P9I A;  2K27 A;  4OU0 A;  1ZH5 A;  1W7P D;  2ZFW A;  1G6N A;  3MZY A;  1DDN A;  2R7F A;  2YU3 A;  3WTY C;  3TOA A;  3W6J B;  4M9Z A;  2FMY A;  3DP7 A;  1K78 B;  3WE3 A;  1DPR A;  4EJU A;  3F72 A;  2OBP A;  3C1D A;  5D8L B;  2ELH A;  3IWF A;  2VE9 A;  1VTN C;  4AVP A;  3HRT A;  3L2C A;  2ETH A;  2ZME B;  1RUN A;  1FBQ A;  4L9V A;  5FLX Z;  2XHK A;  2LF8 A;  2DPU A;  1R1U A;  3CLO A;  2F5E A;  2XKP A;  3EYI A;  3K69 A;  4ENJ A;  2Y48 A;  5ED4 A;  4EVI A;  5J6X A;  4O5V A;  4HW0 A;  2P7V B;  2BYV E;  5IT9 Z;  3VB2 A;  2W24 A;  2W84 A;  4QWQ A;  2V79 A;  4KUM A;  1P4X A;  4HDU A;  1UHM A;  4NB5 A;  1J5Y A;  3C18 A;  3KP6 A;  1IXC A;  2VXZ A;  4M71 A;  1G4D A;  3K2Z A;  3K0L A;  2LDU A;  3ULQ B;  4RB2 C;  2P6S A;  2MH2 A;  3BP8 A;  1D8J A;  3GZ6 A;  1H9T A;  3KP7 A;  3RDI A;  5D8K B;  3V8K A;  3GX4 X;  3HOS A;  1MJ9 A;  3HTS B;  4L18 B;  2Z33 A;  5CYV A;  3ZP5 A;  3BOQ A;  2FSW A;  2O0Y A;  3BDD A;  3P9K A;  2DO7 A;  3L7W A;  4PDK A;  3WU0 A;  1OYI A;  1ZG3 A;  4HA8 A;  1IRF A;  2JPB A;  1CF7 A;  5F6F A;  1QNT A;  5K5O A;  4U0Y A;  2FOK A;  3LFK A;  5DYM A;  3R61 A;  3I58 A;  3EQL F;  1U78 A;  4N0B A;  4GYI A;  4MTD A;  4EJO A;  2VBX A;  2V6C A;  1L3L A;  3ZPL A;  3L00 A;  2HFH A;  1XDU A;  3HHH A;  5H20 A;  5IT9 K;  2EV5 A;  3R0J A;  1Z7U A;  2F5F A;  2O6G E;  2XKO A;  3WTS C;  2A3S A;  3QP5 A;  5E1X A;  1OKR A;  2HZT A;  3IWZ A;  5E1Z B;  3LAJ A;  1SD6 A;  3ISP A;  4KN4 X;  4JK1 X;  2EA2 A;  3IRQ A;  3M8E A;  1BIB A;  3BWG A;  1NHA A;  3GF2 A;  1IUY A;  3ABT A;  3I59 A;  4BAY A;  1J7K A;  4EV0 A;  3ECH A;  4IHS A;  1R58 A;  2VBZ A;  1XN7 A;  1KA8 A;  5HDN A;  1OYW A;  4I0B A;  1I27 A;  3H3U A;  1AOY A;  1V4R A;  2RVC A;  3ELK A;  1E17 A;  2DBB A;  4IRH A;  4LG0 B;  4U7B A;  5IT3 A;  2Z3Y A;  4L5J A;  4IRI A;  2JT1 A;  4HOB A;  4A6E A;  3HSE A;  6PAX A;  3J81 Z;  2WC2 A;  2EFO A;  4MNU A;  1MGT A;  2DI3 A;  1TBX A;  5FO5 A;  1HKS A;  4PZJ A;  2HKX A;  1YTY A;  1GXP A;  2ADU A;  2MD5 A;  1WSU A;  2W57 A;  2P8T A;  3RJP A;  4YFN F;  3QU3 A;  4PCQ A;  4A12 A;  4IJA A;  3WTT C;  3F8F A;  2KJC A;  1FY7 A;  2COM A;  2G7U A;  4L9J A;  1FLI A;  3T1B A;  3FXR A;  3LA2 A;  3RI4 A;  2VBY A;  3ML6 A;  3T5X A;  2NRA C;  4EGZ A;  3FXU A;  1HST A;  1ZRF A;  4O3M A;  5D5X B;  1YFH A;  2XRO A;  2FF4 A;  1ZLK A;  2JPC A;  1W7P B;  3MAJ A;  2UXX A;  2DK8 A;  1O7L A;  5HLI A;  1I1S A;  4P5O A;  3TKY A;  3JW4 A;  2PMU A;  1FOK A;  3QAH A;  3M8F A;  2RGV A;  2EA4 A;  4OOI A;  1TTY A;  4BQA A;  4WWC A;  1IN8 A;  4BHP A;  2TDX A;  1LB2 A;  3DQV C;  2MLK A;  2GZW A;  4G94 A;  5LEJ A;  1LVA A;  4A5N A;  2PQ8 A;  4U0W A;  1RI7 A;  3F8N A;  2K4B A;  3J80 K;  5FGM A;  3F8C A;  4ZYG A;  2H6C A;  2CGP A;  1FBU A;  4ETS A;  2JTV A;  3D5L A;  1BIA A;  1STZ A;  4ZH4 F;  1KQ0 A;  4EJV A;  2EJR A;  2X4H A;  4FX0 A;  4B8X A;  4M73 A;  5DUK A;  4Z2Y A;  4KT5 C;  1FSH A;  1TNS A;  3U2R A;  5D5U B;  2BEO A;  1TQP A;  5FD6 A;  2MA3 A;  2L4A A;  1D8K A;  1EV7 A;  4WXD A;  1Z1D A;  1LEB A;  3LA3 A;  3RYR A;  2GXB A;  3WTZ A;  3TGN A;  4U7D A;  3QPT A;  4KNY A;  4HQE A;  3FM3 A;  2P4W A;  2IJL A;  2VC1 A;  1JGS A;  5ICC A;  1BI2 A;  2XV4 S;  2KIM A;  1ZG5 A;  4D0P A;  3JSP A;  4ASN A;  3IHU A;  4XSZ F;  2EFW A;  5D4S A;  1R7J A;  1W4M A;  1YW7 A;  4LB5 A;  1SFX A;  2HQN A;  2FEZ A;  3TOB A;  2GQQ A;  2ZCW A;  1D3Y A;  1ZHF A;  2EK5 A;  4YFX F;  3F6V A;  1GHC A;  4Q47 A;  3IKT A;  2DQL A;  2A69 F;  2FRH A;  3WE2 A;  1BI1 A;  1REP C;  2FXA A;  3F6O A;  1WQ2 A;  2V1X A;  3V7C A;  3GLX A;  3TDU C;  2IP2 A;  3VOD A;  2K7L A;  4EGY A;  3S2W A;  1O7F A;  3FMR A;  1FNN A;  3LAP A;  4UXN A;  3TDZ C;  3CUQ C;  4ON0 A;  4EJW A;  4CHU A;  1PUE E;  1MJB A;  1IRG A;  2J5O A;  2H6B A;  4RGX A;  5E8I A;  1LDD A;  1O3T A;  1EH7 A;  1G3T A;  3IC7 A;  4KIG A;  3LST A;  4EJT A;  1YS6 A;  4WX9 A;  1CF7 B;  5LBQ A;  4EMS A;  4I7H A;  2GA1 A;  5ILV A;  3JAM K;  3CO6 C;  3GFJ A;  2P5K A;  2H09 A;  4IF4 A;  2XGX A;  3Q9V A;  1MJA A;  3RPU A;  3F23 A;  3RKY A;  2YR2 A;  3KZY A;  2DK5 A;  1W7P A;  3IKV A;  1FYL A;  5H6R A;  2OD5 A;  3GVA A;  1BC8 C;  2LSO A;  3JTH A;  5L3E A;  2L01 A;  4G8X A;  3JTG A;  4HX7 A;  2XAG A;  2E1C A;  4UNO A;  4GO1 A;  4O6J A;  2FBH A;  2ZNZ A;  3HTU A;  1JXS A;  4LG0 A;  2UXN A;  4MQ9 F;  1UCR A;  5EEH A;  2RV8 A;  4L0Y B;  2H94 A;  3CUQ A;  3KEO A;  5JVT A;  4HDV A;  3K1N A;  3GYH X;  4K2E A;  1F4K A;  4ZZL A;  2L4M A;  4RAY A;  2Z5U A;  2KIF A;  2X0L A;  4RB0 A;  5LGT A;  2FE3 A;  3C7J A;  5BMZ A;  2QBY A;  3ZQ7 A;  3MZH A;  1R22 A;  5A2Q K;  2VC0 A;  4R79 A;  4OIO F;  1EH6 A;  5FLX K;  4EQQ A;  2M1B A;  4Y17 A;  2XIG A;  3GFL A;  1ZRD A;  3TO6 A;  1LQ1 A;  4RAZ A;  2JSC A;  4ZZD A;  2FBI A;  1KYW A;  4OIP F;  2OZ6 A;  5BOX A;  4MQV A;  4N9I A;  4ZYD A;  4WK8 F;  3E6C C;  2XAQ A;  3ERE D;  3I53 A;  1R1T A;  4LK0 F;  3FF5 A;  5ERI A;  3KE2 A;  1T0F A;  3C3W A;  3N4M A;  1S6L A;  2QUF A;  5CJ9 A;  3HRS A;  1SMT A;  2E1N A;  3WGH A;  1XB4 A;  2L02 A;  2HR3 A;  4I98 B;  4UUV A;  2A68 F;  2EFQ A;  3HIF A;  1TLH B;  3O6B B;  3VEP A;  1HXD A;  3DV8 A;  3V8J A;  3E6D A;  2HS5 A;  2STW A;  3EET A;  1KU2 A;  5K5Q A;  1ZYR F;  2L54 A;  4Q4Z F;  2A07 F;  1RIO H;  4P9F A;  3H3Z A;  3NEU A;  1OYY A;  1QPM A;  1DP7 P;  5J8C A;  2DU9 A;  3GFI A;  4KA4 A;  2DQR A; 
#chains in the Genus database with same CATH topology
 5DV5 A;  2DMU A;  5L3D A;  3KZI C;  5HOO A;  3HRM A;  1MH3 A;  1D1C A;  5JLW A;  1RES A;  4HV6 A;  2AHQ A;  4UV8 A;  2VLA A;  1EH8 A;  4XKB A;  1MZB A;  2EQR A;  3J7A O;  3EUH C;  2CFX A;  3PSF A;  2LP0 A;  4G7H F;  4E7Z A;  2A5Y B;  5DD4 A;  5HDK A;  2KRF A;  2O3F A;  3K4L A;  2PBI A;  3FMS A;  4HYE A;  2QQB A;  2ESN A;  3OL3 A;  2QWW A;  3ZMV A;  2NOG A;  3K4B A;  1Y8R B;  2M3A A;  3I0T A;  3OV8 A;  1R4M B;  3TED A;  1RR8 C;  2P7C B;  1VQ8 I;  3FXO A;  3SZP A;  3VYU B;  1QVT A;  4LIV A;  1X58 A;  2GIV A;  1Y0U A;  2VBW A;  5JHU A;  4Y52 J;  1S8N A;  1FZP B;  2RDP A;  3FZV A;  1MDM A;  1XCV A;  2Y9Y A;  4GXO A;  2LKX A;  3OR2 C;  1U5T B;  4PJ0 C;  5LEK A;  1G59 A;  3KCC A;  4EM1 A;  2O61 A;  4M9S A;  5CPR B;  1LFP A;  3FKJ A;  2CQK A;  3QRF F;  5HVQ C;  3ABU A;  2X1D A;  1UST A;  1KGS A;  3LWF A;  2K85 A;  3JRG A;  4AIK A;  2GXA A;  1I6H J;  1XMK A;  1R1V A;  2Y75 A;  3ZMS A;  2V6E A;  3LL7 A;  3E5Q A;  4WXC A;  3E97 A;  2CSO A;  3I55 I;  4BNC A;  2M8E A;  3SFZ A;  5CQG A;  5IYD J;  5M5Y J;  1VQ4 I;  1USS A;  2Q2E A;  3F9K A;  4CUG A;  3CDI A;  4AYB A;  2KKO A;  1ZGJ A;  2DA7 A;  1SD5 A;  4KIT B;  2ZJP F;  1JKP C;  1XMA A;  1ORK A;  4CCO A;  3CDH A;  4QSH A;  2HVR A;  3BLY A;  5BPI A;  1ZK8 A;  1MMN A;  2HNH A;  2V9V A;  2MAB A;  2BXY A;  5EG0 A;  4N4O B;  5EYR A;  3ECO A;  3UR3 C;  4LLG F;  4PGH A;  4ESB A;  4E7J A;  3GEZ A;  1VQL I;  1YRN B;  2B9S A;  3D0S A;  4IPA A;  3QYE A;  1U5T C;  5FKM A;  3G1L A;  1I3Q J;  4KJZ A;  5F0F A;  2L7M P;  4GYG A;  4GDF A;  2FQ4 A;  2HGC A;  4A0Z A;  4XNF A;  1SFK A;  3CUQ B;  3K9T A;  3HUG B;  3A01 B;  4IRG A;  4Y15 A;  2BY2 A;  3SZT A;  3RTR A;  3DPL C;  4R8H A;  2EFP A;  3CMA I;  1K7A A;  2CH0 A;  3T0Y A;  1JT6 A;  1FWZ A;  2LRE A;  4XM3 A;  1PVE A;  4LD5 A;  2JK3 A;  3QPH A;  1H88 C;  3P9C A;  3PUF A;  1WJF A;  1IN5 A;  2RQQ A;  2BY3 A;  1Z3X A;  2XF5 A;  3I64 A;  3DBR B;  3DTK A;  1ERD A;  5D4R A;  2LY2 A;  5A2Q Z;  2R7Z J;  4UVB A;  1HA8 A;  3DF8 A;  3QOE A;  3HGY A;  5AON A;  4ESJ A;  2D1V A;  1WI9 A;  3Q3S A;  3JRI A;  2V7F A;  2M5W A;  3BT9 A;  1B59 A;  3WTU C;  1HKT A;  4GFB A;  1RZ4 A;  4BKX A;  1BJA A;  2PN6 A;  3HHG A;  4BBR J;  3DKW A;  4BHC A;  5M3M J;  3TO7 A;  5FKK A;  1ZN2 A;  2EIM H;  4PSW A;  1B72 A;  1Z7L A;  1Z77 A;  1GVD A;  4YIF A;  4BE1 A;  4QIW N;  4BL0 B;  2O9L A;  1VQO I;  2DPD A;  2XRN A;  1ZRC A;  3DFG A;  4RAF A;  3FMQ A;  2VJ5 A;  3BPV A;  3QP6 A;  4J19 A;  2I10 A;  3EUA A;  3ZQI A;  4XL9 A;  2DCE A;  5IOZ A;  2R7D A;  3QPS A;  2ACJ A;  1SFU A;  3DBH B;  1A6I A;  1Z6R A;  1S3J A;  5LGU A;  1X19 A;  3PO2 J;  4KFC A;  1TL8 A;  1Z05 A;  1Q1H A;  3HDD A;  2XB5 A;  1A36 A;  2DT6 A;  1ODD A;  2EB7 A;  1IN6 A;  2IGN A;  4DQ2 A;  4AID A;  2EIJ H;  4HAM A;  5DM7 F;  2KPM A;  1TWH J;  3HYI A;  2YU9 J;  2LRD A;  4XKW A;  3FK6 A;  1RUO A;  4IEJ A;  2Y9Z A;  3BY6 A;  2O8X A;  1FYM A;  2VKV A;  1FEX A;  2PFB A;  2HPM A;  4Y33 A;  2Y0S N;  3M9A A;  2LYC A;  3CTA A;  2FD5 A;  2VKE A;  4PUS A;  2QSF X;  3TBI A;  2A6T A;  4D5F A;  2QYO A;  4AIH A;  1R71 A;  5BS6 A;  2W85 A;  3BZC A;  4LIT A;  5B66 C;  3JRC A;  2F4M B;  1P6R A;  4HF1 A;  1JTX A;  2PX9 A;  3D5R C;  2R4G A;  3WG9 A;  2BVM A;  4RBO A;  1QO0 D;  3IP4 B;  5GTI C;  5FFX A;  4YII A;  5IOY A;  3OYI A;  2MC3 A;  3PNT A;  3CME I;  1O4X A;  2XVC A;  3GW2 A;  2NYX A;  2CQX A;  4FE7 A;  2ME0 A;  2CWE A;  3FM5 A;  2XPW A;  4L9N A;  4A5M A;  2MH9 A;  2G9W A;  5J40 A;  5EZH A;  2L7K A;  3E5U A;  4DBR A;  3JAM Z;  2RRE A;  2HYF A;  3EUH A;  1O3R A;  2QCO A;  5E20 A;  5DS9 A;  5KHD A;  1MSF C;  1IF1 A;  5ICG A;  1JHH A;  1A31 A;  1IXR C;  1SD7 A;  1XGM A;  4MTE A;  1IDY A;  1WCM J;  2XAJ A;  1ULY A;  1QQI A;  1OR7 A;  4A3C J;  5LLQ A;  1YS7 A;  2CRG A;  2R92 J;  3MCZ A;  1V55 H;  3BTL A;  2WBM A;  3V4G A;  5B3S H;  5D5W B;  1Y1V J;  4A6D A;  3J7Y J;  2GA2 A;  2R7X A;  4CXF A;  2OU2 A;  3BZ6 A;  3LQQ A;  3TP3 A;  3H3V K;  2P5V A;  3BR3 A;  1F43 A;  5IP7 J;  5F04 A;  4AC0 A;  4F3Q A;  1E2X A;  5LHH A;  2HKO A;  1UEL B;  3MMY B;  1K6Y A;  2DOF A;  1JHF A;  3A02 A;  4IVN A;  5ICF A;  1R6R A;  4A0X A;  4I0A A;  3CUO A;  3CQZ J;  5L3B A;  2CW7 A;  1NTC A;  4AIJ A;  2ECB A;  1XSD A;  3O8H A;  1YOV B;  2ZB9 A;  5FJ8 J;  3CF5 F;  2PI0 A;  1S7E A;  3JSO A;  1B4A A;  1ZGW A;  1HSJ A;  1U5T A;  2A6E F;  3I54 A;  3LA7 A;  4HX8 A;  1JJ8 C;  3FX3 A;  2KLO A;  4P55 A;  3CD6 I;  4B48 A;  1FT9 A;  4ZYE A;  3GFM A;  5F1R A;  3ZQL A;  1XD7 A;  1FMV A;  1I1G A;  3WGI A;  2JA5 J;  2CQQ A;  4MHG A;  4X6A J;  1LEA A;  4HX4 A;  3QQA A;  5GAH J;  1FBS A;  2ZFU A;  1ETW A;  1IXS B;  4NNJ A;  1HDP A;  2PJP A;  4LGW A;  2E1M B;  4I6Z A;  2L3D A;  3KLO A;  1BM9 A;  3IH2 A;  2W7N A;  3BJA A;  2Y0M A;  4KYW A;  3DPU A;  3SXY A;  3GXO A;  1FOW A;  2ZJ2 A;  2F48 A;  1WH7 A;  2M9H A;  1GDT A;  4BDY A;  1P2F A;  1DUX C;  1YX3 A;  2DFF A;  2VXD A;  3OYM A;  1LUJ B;  3GCM A;  3GBG A;  1ZLJ A;  5KK1 A;  3BG7 A;  2LD5 A;  4AM3 A;  3K1M A;  1FIA A;  1E3H A;  4G6D A;  4M72 A;  3S1N J;  1K6O A;  2NVQ J;  1HOM A;  2WAD A;  2D45 A;  3W2W A;  2Q8K A;  4XKV A;  1WVR A;  2HXO A;  3LSP A;  2M4G A;  1HBX G;  2FU4 A;  4LG3 A;  3TQN A;  1T6S A;  1MDM B;  4HST A;  2JVG A;  4LLL A;  3S15 J;  4A3G J;  2K4J A;  2R3S A;  4DIQ A;  1BA5 A;  3RIR A;  2IS2 A;  1XS9 A;  1JKO C;  3S8P A;  2QA4 I;  3L1P A;  1IZ1 A;  3MFK A;  4CO8 A;  2VKD A;  2YUS A;  3BPX A;  5J4V A;  5TRD A;  1T33 A;  2GIZ A;  4FE4 A;  2ZBK A;  3CMM A;  3V8L A;  4Z6Y A;  2MD0 A;  4Y7N J;  3GTK J;  1DP3 A;  1Z6T A;  4UUT A;  2HEO A;  2VOD A;  2JA7 J;  4V2F A;  4DZJ A;  1MMS A;  2L2O A;  3MN2 A;  2MBF A;  4G7Z F;  4PSX A;  4BXX J;  4MGR A;  4G12 A;  1T8I A;  3NWS A;  3J80 Z;  1HKQ A;  1XGS A;  3OYG A;  3H9G A;  2IA1 A;  1A6Q A;  1MH4 A;  4HZF A;  1I6X A;  1ON2 A;  3CCY A;  5JI6 A;  5DCM A;  1BR4 A;  3ZQF A;  4Y13 A;  4HV5 A;  3TO9 A;  2WAF A;  2DXI A;  2B0L A;  3OL4 A;  1N78 A;  1B1B A;  4I2O A;  2A61 A;  1DU0 A;  4IXA A;  2M0M A;  2E7W A;  2PG4 A;  5AIQ A;  2RN7 A;  2CUJ A;  2CU7 A;  1P4A A;  1NG7 A;  3CJR B;  4C2U A;  3K1P A;  4UHT A;  1FP2 A;  3ZCO A;  1W5T A;  1T2K A;  5GAG J;  1YQA A;  4XLP F;  3K4M A;  3ZQH A;  2VJ4 A;  2E1M C;  2LOO A;  2CUF A;  3HG9 A;  3U21 A;  1J0R A;  4QTR A;  2VUM J;  4XRF A;  3H92 A;  3I4P A;  4LLN A;  2HQ5 A;  3T8R A;  1GLN A;  3B02 A;  1K78 A;  4FIS A;  1B9M A;  1S29 A;  4JX4 A;  5DCF A;  1U3E M;  3W6V A;  1T0F C;  1YLF A;  2VN2 A;  4P96 A;  4F92 B;  3BC8 A;  2K40 A;  2QQ8 A;  1YO5 C;  1S7A A;  4UUS B;  1PDN C;  5CVI A;  2V9K A;  1KQ9 A;  2GAU A;  3WOD F;  3M07 A;  5LD2 C;  3IL2 A;  3DEU A;  2ZC2 A;  4BQQ A;  1ETK A;  3HUG A;  4ENM A;  3MEX A;  2HXI A;  1SAX A;  2M7A A;  2IVM A;  3U1D A;  4XBF A;  2IXS A;  2YX4 A;  1J09 A;  4DYQ A;  3W2V A;  1F5T A;  1OPC A;  1X4O A;  1RKW A;  4L0Z B;  2PMH A;  4G6Q A;  2QF7 A;  4ZDL A;  5J8F A;  3KP5 A;  3G1O A;  1UHS A;  2OCE A;  2X6Y A;  1V3F A;  3PQJ A;  3OYH A;  2JZY A;  1T08 B;  2KRH A;  2Y31 A;  2BV6 A;  3ZGK A;  5EEA A;  2STT A;  1E3O C;  2OQG A;  4LFU A;  5KVR A;  1TT0 A;  1WH5 A;  3A03 A;  4M3E A;  2R7R A;  2EFN A;  3S3M A;  1SFE A;  5CVU A;  2G7H A;  2IEK A;  5DEQ A;  2R7W A;  2GOX B;  1TW2 A;  2HU9 A;  2VT2 A;  5H6Q A;  5JHF A;  1ONV A;  2FNP A;  2P6T A;  2ZXW H;  4HLX A;  4LOC A;  2DOD A;  2LH9 A;  3HOU J;  1X2N A;  2VJJ A;  1G3Y A;  5K1Y A;  3BRO A;  3E6M A;  2R5Z A;  2XAF A;  1O57 A;  4HBL A;  1YJN I;  1GXQ A;  4A2U A;  4CYD A;  3J81 K;  2HTJ A;  2QQ9 A;  2I5U A;  2XF6 A;  4OAZ A;  3LSM A;  3KLN A;  3HPG A;  1UB9 A;  2RKH A;  2QEN A;  4CYC B;  2MW8 A;  3R0A A;  1B6A A;  2GWR A;  4ZYA A;  5FLV A;  2IS1 A;  1S7O A;  2HOT A;  1QPI A;  1SMY F;  3CC7 I;  1P4W A;  3PQK A;  1OCC H;  2LF7 A;  1XCB A;  3N05 A;  2XC7 A;  2K3F A;  4ZC3 A;  4LJZ F;  4ESF A;  3F8B A;  3PIP F;  2KDZ A;  1K61 A;  2RNG A;  3S1Q J;  3M8J A;  4BHB A;  3S17 J;  1BI3 A;  4FCY A;  1R00 A;  3LQR A;  3K70 C;  4LB6 B;  5EF6 A;  4YRV A;  1PP7 U;  1Z9C A;  1BL0 A;  4E70 A;  1HW2 A;  1WZ2 A;  2XAH A;  4A3E J;  2EIK H;  3AFH A;  3DLA A;  3A01 A;  3BR5 A;  3ZMD A;  4NDL A;  3BJ6 A;  4RGS A;  3OOP A;  2JUC A;  2LK2 A;  1MND A;  1NH3 A;  3HOY J;  2CUZ A;  2QQA A;  3EYY A;  4C3H J;  2R5Z B;  1FX7 A;  2ZXH A;  3PUB A;  4S05 A;  2F5D A;  3FWE A;  2KL4 A;  1HW5 A;  1F9N A;  1ZG1 A;  1ON1 A;  2NNN A;  1QVU A;  2KJB A;  4XLE A;  5HS7 A;  3JRB A;  1X1P A;  3RKW A;  5LHG A;  2K9S A;  2KP6 A;  3OWT A;  3RZO J;  5CVR A;  3I5U A;  3OYF A;  4XIC A;  3WTW C;  1IO2 A;  5HS8 A;  1F1Z A;  1P92 A;  2HWV A;  4AWX B;  3F3X A;  3ZMU A;  3AAF A;  3GTL J;  4UUS A;  3H35 A;  5EDN A;  3ABM H;  1HF0 A;  2ECC A;  2ZXI A;  3DEE A;  3REO A;  4I01 A;  4AVZ A;  4M6X A;  4HG2 A;  2OTJ I;  2HVS A;  4NHJ A;  2GXG A;  4DNC A;  3A1Y A;  2BGC A;  1QA6 A;  2FJ1 A;  5D5V B;  2CFO A;  4KT6 A;  2JJ7 A;  4RB1 A;  3GTG J;  1J59 A;  2CYY A;  5L3C A;  1BR1 A;  2E1O A;  3HSF A;  5FB2 A;  2OZU A;  4XRS G;  3ZN0 A;  2EWN A;  1ZGA A;  3TW6 A;  4RDU A;  1BOA A;  2FNA A;  2FQ3 A;  1GV2 A;  3HOX J;  1ZRE A;  2C6Y A;  4OMY A;  1S72 I;  2VOP A;  3FIW A;  3CCU I;  4XN0 A;  2XF7 A;  4GGG A;  1QZY A;  4XON A;  3P7N A;  1UFM A;  1P7J A;  2XPU A;  1MBE A;  2UWM A;  2JUG A;  3BG5 A;  3GO5 A;  4M74 A;  2HYG D;  5FFZ A;  1ZAR A;  1TWA J;  4JBA A;  3G1M A;  4BJ5 C;  1RNL A;  3SYT A;  1VQK I;  1D5Y A;  4OIR F;  2DW4 A;  4OIN F;  2H27 A;  2KFD A;  3BG3 A;  3KFW X;  3OMY A;  3H9J A;  3N97 A;  2DAO A;  4MLO A;  1T98 A;  4TV7 A;  3F22 A;  5FKO A;  2DDA A;  1GVJ A;  1OCR H;  2CUE A;  1KYZ A;  2DFI A;  5KAF C;  4XK4 A;  1LPQ A;  2KIU A;  5JVG F;  2VIX A;  4B3X A;  3RYP A;  2E2H J;  3GZ5 A;  3CCV I;  3BTJ A;  1O3Q A;  2HOE A;  1CQT A;  1TQI A;  1U9N A;  1RR7 A;  2HYJ A;  3MZ8 A;  2RAE A;  5TIS C;  3I9V 2;  2F5C A;  1SVM A;  1X1C A;  1YW9 A;  1IG7 A;  4RGR A;  3KP3 A;  5BNG A;  1WFX A;  2LKP A;  3OYA A;  2E36 A;  4A0Y A;  5ICE A;  3PL8 A;  1D0Z A;  4BY1 J;  4Q48 A;  1FTZ A;  5E3M A;  2Y69 H;  4XOR A;  2Q0O A;  2BHY A;  2CO5 A;  1V5G A;  3NWT A;  2FA5 A;  4AD9 A;  4KDP A;  1T39 A;  1FPQ A;  4HPQ A;  4JQF A;  3Q0U A;  1MMG A;  2ISY A;  4KMF A;  4RGU A;  3HRU A;  3QYB A;  2EZL A;  4DYC A;  1YX5 A;  2XAS A;  1Y1W J;  1BC7 C;  2CW0 F;  2E19 A;  5K5R A;  2PMZ A;  2DA3 A;  3O2P E;  4PK4 A;  1YW8 A;  3W6K B;  4MFE A;  4BJT A;  3F0C A;  1OFC X;  2OCC H;  4ZYH A;  3MKL A;  2Z16 A;  2ICW G;  4I09 A;  4CDG A;  3F8M A;  3E7L A;  1IAW A;  2QZ8 A;  3VOE A;  3G73 A;  2MG4 A;  1XSV A;  2OA4 A;  2EZI A;  2Q2E B;  2NNY A;  1WI3 A;  4IHT A;  1IN7 A;  1IJW C;  3CCE I;  4D9J A;  3FXQ A;  4BXU A;  4XLA A;  3DTE A;  3SZG A;  2BBY A;  4M6Y A;  3HOW J;  2A05 A;  2EV0 A;  5FKN A;  2M30 A;  1VQ5 I;  2ZKZ A;  4XSX F;  3L2V A;  2MGQ A;  3I71 A;  3MD2 A;  3I59 B;  2JQ7 A;  2A6H F;  1MBK A;  5HNH A;  3VFZ A;  2Z99 A;  4D1Q A;  2JRT A;  4H4K C;  3J7A Y;  1B9N A;  1KU9 A;  1LNW A;  1Z91 A;  4L9T A;  5C44 J;  1FSE A;  4UVC A;  1QZZ A;  1R5G A;  2PMZ N;  3KP2 A;  5E17 F;  2F4I A;  3MVP A;  2K3P A;  4FHT A;  3ZXS A;  3HL2 A;  1YG2 A;  4CGZ A;  4Q5S F;  1MW7 A;  5DD8 A;  4R1H A;  3HSR A;  1UJ8 A;  4DGW B;  5F27 A;  4ZJZ A;  4JYK A;  3Q9S A;  4HNV A;  4RB3 C;  4IHV A;  4JOM A;  2XSJ C;  2IA2 A;  2BVL A;  4DJA A;  1KU3 A;  2QSG X;  2XGE A;  3HKZ N;  3K10 A;  2F5V A;  1W5S A;  5HDG A;  3MKZ A;  4B09 A;  1FYK A;  3DTI A;  3V7S A;  4XLC A;  3CC2 I;  2YPR A;  3CCQ I;  2V1D A;  3B73 A;  4OIQ F;  5EG0 B;  3PJR A;  1DPU A;  2HPI A;  3E5X A;  3Q0W A;  1J75 A;  3QU6 A;  2BE5 F;  2KZV A;  3SHF A;  1AKH A;  1MKM A;  3QPL A;  3ABL H;  1T38 A;  1P9Q C;  5BPD A;  3KPH A;  1JKR C;  2LTP A;  3KEY A;  2W25 A;  3WTV C;  4UVA A;  3MQ0 A;  1LDK B;  1O3S A;  2NS7 A;  1PUF B;  5JLX A;  3GLL A;  1BBY A;  1WKM A;  2LNB A;  5CVV A;  3ZQC A;  4IHY A;  3BG6 A;  1XMX A;  5M5X J;  2L9R A;  2AXL A;  4S0H B;  4B4C A;  2MLG A;  3L09 A;  1TZL A;  4L5E A;  2QVO A;  1H0M A;  3C2G A;  1MBG A;  1OQY A;  2VT3 A;  3CC4 I;  5EEG A;  3BJO A;  3OR1 C;  3BQY A;  3KZZ A;  3AKZ A;  2P5L C;  4RM2 A;  4XLN F;  4MEX F;  4MO7 A;  2IT0 A;  5F64 A;  1IN4 A;  2COB A;  2KMU A;  4EM2 A;  2B63 J;  2IGO A;  5CVJ A;  3GZN B;  2KT0 A;  3ZN1 A;  4I02 A;  2NVY J;  3OYN A;  4BDZ A;  3R4K A;  3S1R J;  3COA C;  4ZDO A;  5HLH A;  3VSL A;  4E7H A;  3JRD A;  3VSK A;  1QZE A;  1JT0 A;  3KET A;  2WAQ N;  4B47 A;  4E6K G;  1JUS A;  2MFZ A;  3RSN A;  2V1U A;  2JA8 J;  2AQF A;  2FBK A;  4KIC A;  3GWZ A;  3HOT A;  2ZO4 A;  3AG4 H;  3UKG A;  3U9G A;  2ZME A;  3JCU C;  1PUF A;  2TCT A;  4OMZ A;  1R23 A;  1G3S A;  4ENK A;  1W36 D;  2ESH A;  5DUI A;  3NRV A;  3G3Z A;  4C30 A;  1C0W A;  2BHZ A;  4LK1 F;  1QBJ A;  3M7G A;  4PFP A;  2QGU A;  2DFH A;  1V5E A;  3HJE A;  3HBL A;  5ILS A;  2QLZ A;  5BQT A;  1IW7 F;  2QKL B;  2E71 A;  1XSX A;  5CKT A;  2FUG 2;  2DMP A;  5L3F A;  5DCM B;  2IRF G;  2DTZ A;  1J2X A;  5JR3 A;  4WCG A;  4NUB A;  2WWY A;  5HS9 A;  1Y8Q B;  2OQR A;  1NK3 P;  3I4M J;  3T8T A;  1HW1 A;  3RKX A;  1LJ9 A;  4XRM A;  3IUO A;  1JUP A;  1FOY A;  4U0V A;  4HF2 A;  1AA7 A;  2ID3 A;  5K7H A;  1H9G A;  3DXJ F;  1I39 A;  3E1S A;  2E34 A;  3ROU A;  5CQE A;  2LKS A;  1GT0 C;  4FX4 A;  2CJJ A;  4KIF A;  4GCV A;  1MIJ A;  4G7O F;  5J3L A;  3DPT A;  2M45 A;  4WF2 A;  1K4S A;  3GTO J;  2VON A;  1MNM C;  4HF0 A;  1OIS A;  3WGG A;  3FIS A;  4BY7 J;  3BCB A;  1OMI A;  4A3M J;  1R49 A;  3KP4 A;  2PLY A;  2Y0S A;  5ILU A;  3ZMT A;  3G6E I;  3ZMZ A;  4HQM A;  2UZK A;  5C3E J;  2RC4 A;  1U6G A;  2PJR B;  4P9U A;  2X6W A;  3ASO H;  1PJR A;  5L3G A;  5LHI A;  4CA0 A;  2VOO A;  1LDJ A;  1BJZ A;  1X3U A;  2VJI A;  2K86 A;  2A5W A;  1YYV A;  3WTX C;  1D5V A;  3SEQ A;  4LIU A;  3SFI A;  5EGO B;  3BG9 A;  3CO7 C;  3SQN A;  2DTR A;  4E7L A;  2YX7 A;  5E18 F;  1R36 A;  5FLM J;  3S16 J;  5LRR A;  5IP6 A;  1RPW A;  1TQM A;  1WRJ A;  1HQC A;  1R5H A;  2ZXJ A;  2O5R A;  2X1E A;  3ASN H;  3RPQ A;  4B3A A;  2IGM A;  1YIJ I;  4HLY A;  4CIC A;  4BEH A;  1Y56 A;  3O3K A;  1MMA A;  2X85 A;  1W0U A;  3HKZ A;  5CLS A;  5GPA A;  4CCL A;  3OOU A;  1XX5 A;  4G9Y A;  5FRO A;  1UG0 A;  3DKX A;  3SEZ A;  2KRC A;  3H5A A;  1CGP A;  1I3A A;  1XDS A;  2FML A;  2R7T A;  1H89 C;  2ELJ A;  3PFI A;  4CZZ A;  5GTH C;  2O03 A;  1VFC A;  4WXH A;  1MBF A;  2VE8 A;  4BH9 A;  2ZNY A;  1QHG A;  2K02 A;  2LMD A;  3RQI A;  3GUD A;  4NQW A;  4N9H A;  3K6G A;  3M1E A;  5DDG A;  4CZC A;  3UNG C;  1JGG A;  3BCA A;  3CP2 A;  1FP1 D;  3KEQ A;  4IOC F;  1UHW A;  2RQP A;  2DLL A;  2L9N A;  3BTI A;  1L0O C;  5D6F A;  5LRS A;  5E1W A;  4S04 A;  3R60 A;  4MEY F;  1LVK A;  4KIB A;  2K9M A;  1WGX A;  1Y39 A;  1ZAO A;  2WAE A;  1KQ8 A;  1ETX A;  4BYY A;  4RS8 A;  3SJM A;  5FRN A;  3RPU D;  2XGD A;  2J5P A;  2D1H A;  4M9X A;  1JE8 A;  4MIM A;  2NAZ A;  4L5I A;  4PGG A;  1X3W B;  2EZK A;  1TT5 B;  2XUB A;  4YEL A;  1HCR A;  4F55 A;  1XGO A;  1WWX A;  2W4S A;  4RLQ A;  2ZSI B;  1FC3 A;  4D7M A;  4KN7 X;  2QSH X;  4FT8 A;  2BY1 A;  2NS0 A;  3BZK A;  1TW3 A;  4IOA F;  1V54 H;  2D5V A;  3ERM A;  1XGN A;  3R6S A;  1D1B A;  5LGN A;  2IS4 A;  3A0B C;  5HLG A;  2HTS A;  3KX2 A;  3AL0 C;  2EV6 A;  3CJQ B;  2D2W A;  3F21 A;  3CCJ I;  4KMU X;  5E8G A;  3Q5F A;  3S1M J;  1G3W A;  4YFK F;  2M87 A;  4U88 A;  5E79 C;  4QPO A;  5D6E A;  5AIP A;  1BI0 A;  2NXN B;  5FD5 A;  1K79 A;  3QOP A;  1SD4 A;  3FXM A;  3VYR B;  2L9V A;  1NG6 A;  2F2E A;  2EPF A;  3E3V A;  4LMY A;  1AWC A;  4E7I A;  5TGT A;  2WY7 Q;  5HOD A;  3C2B A;  3E0J B;  5KNL A;  1BN5 A;  1U2W A;  2QM3 A;  4EM0 B;  4ENN A;  5TJJ A;  2PEX A;  3CJN A;  4H0E A;  1QGP A;  3OYD A;  5FRM A;  1J9I A;  3L9F A;  2X6X A;  3WU1 B;  1ZR4 A;  5KCM A;  1VND A;  4BQN A;  2ISZ A;  2OPT A;  3ZR8 X;  1YIO A;  4QLC U;  3E6B A;  2HDC A;  2IGK A;  1LKX A;  2X1C A;  1PYV A;  2X9D A;  1P7I A;  2AS5 F;  4BAC A;  2RNJ A;  2Z9O A;  2YSR A;  4F7Z A;  3IRR A;  4YG2 F;  2WTE A;  1TNT A;  3GME A;  4F91 B;  2WV0 A;  1A04 A;  2QBY B;  3FHZ A;  1VZ0 A;  1KU7 A;  5JFR A;  3V7R A;  1UAA A;  1MD0 A;  1DQU A;  1U8R A;  2CW8 A;  4NBQ A;  2E7X A;  2HQR A;  3LSI A;  1MBH A;  5K7Z A;  4EEF G;  3NQO A;  1M1E B;  2IPQ X;  3CP8 A;  3S14 J;  2X48 A;  1HDD C;  1TC3 C;  1YRN A;  2EIL H;  1PP8 F;  1ZKG A;  2WB1 N;  3MWM A;  4UV9 A;  3EDP A;  3WU2 C;  3VYS B;  2IW5 A;  2CG4 A;  2IA0 A;  2CQ7 A;  2DT5 A;  3OS2 A;  3VWB A;  2I8D A;  1BW6 A;  1I5Z A;  2OAZ A;  3K4J A;  3P9I A;  3L2Q A;  4BXF A;  3PO3 J;  2K27 A;  4OU0 A;  1ZH5 A;  1W7P D;  4P1W A;  2ZFW A;  4BUP A;  2EIN H;  1G6N A;  1QHH D;  2LFB A;  3WHC A;  3AG3 H;  3MZY A;  1DDN A;  5E3L A;  4IZZ A;  2JMW A;  2R7F A;  2YU3 A;  4DBQ A;  1NK2 P;  1UMQ A;  3WTY C;  1FOX A;  4KIS A;  3TOA A;  3L2U A;  1X4P A;  3W6J B;  2LBF A;  4M9Z A;  2FMY A;  1X1A A;  2R7Q A;  3DP7 A;  3GTJ J;  2TRT A;  1K78 B;  5M5W J;  3D5S C;  1R9T J;  1VQP I;  3JRF A;  3EPZ A;  3WE3 A;  1DPR A;  1Q1V A;  2WAQ A;  3RZD J;  1YJ9 I;  3CDL A;  2BY0 A;  4MFD A;  3CCM I;  5LFA A;  2E5N A;  4JX6 A;  4EJU A;  1ETQ A;  3F72 A;  2OBP A;  3C1D A;  5D8L B;  2ELH A;  3V42 A;  4DYR A;  1T95 A;  2XPV A;  3IWF A;  3HGG A;  5B1A H;  2VE9 A;  1VTN C;  4AVP A;  3HRT A;  3L2C A;  1HLV A;  2ETH A;  2K9N A;  4XID A;  2ZME B;  1RUN A;  3HXL A;  3H5R A;  1FBQ A;  4L9V A;  5FLX Z;  2XHK A;  3TW7 A;  2LF8 A;  2DPU A;  1XC5 A;  4RMN A;  1R1U A;  1AHD P;  3CLO A;  3ONQ A;  3AL0 B;  2F5E A;  2XKP A;  3HEF A;  3EYI A;  3K69 A;  4ENJ A;  1BOB A;  2Y48 A;  5ED4 A;  4V19 K;  3A0H C;  4EVI A;  2LC2 A;  5J6X A;  4O5V A;  5IPA A;  4HW0 A;  2BW3 B;  2KZG A;  2P7V B;  3IAM 2;  2BYV E;  1ZTR A;  5IT9 Z;  3VB2 A;  2W24 A;  2W84 A;  4QWQ A;  4U87 A;  2CMP A;  2V79 A;  3FXK A;  4KUM A;  4IQ4 A;  1P4X A;  4Y3O A;  3LSH A;  2VQG A;  5DTD A;  2VQC A;  4HDU A;  4IKF A;  3QWL A;  1UHM A;  3VYT B;  1EA3 A;  1OCO H;  1OR7 C;  2CV1 A;  4PFO A;  4B1R A;  4NB5 A;  4NC7 A;  1Y6I A;  1J5Y A;  3C18 A;  3KP6 A;  1IXC A;  2VXZ A;  9ANT A;  3L2R A;  4M71 A;  4XRS A;  1G4D A;  2W1O A;  3K2Z A;  3JRE A;  3K0L A;  4AU7 A;  3OIQ A;  2LDU A;  3ULQ B;  3EUK L;  2G0E A;  4RB2 C;  3FHN A;  3CCS I;  2P6S A;  2CS3 A;  3BTC A;  4C9Y A;  2MH2 A;  3BP8 A;  1D8J A;  3LSR A;  3GZ6 A;  2DJI A;  1H9T A;  3KP7 A;  1DGR M;  4E4H A;  3RDI A;  2DA6 A;  5D8K B;  5J4Y A;  3RKQ A;  2ZJR F;  3O8G A;  2DT7 B;  2ID6 A;  1SEU A;  3V8K A;  4CSW A;  1YHQ I;  3GX4 X;  5IYB J;  3HOS A;  1MJ9 A;  3HTS B;  4L18 B;  2HZD A;  4FTH A;  2Z33 A;  3PNV A;  5J1Y A;  1W36 C;  1D0X A;  2H1L A;  4DW6 A;  4F93 B;  2Q1Z B;  5CYV A;  3ZP5 A;  1SAN A;  1W1W E;  3K7A J;  4I99 C;  3BOQ A;  5C4X J;  1IUF A;  2FSW A;  2L7F P;  2O0Y A;  3SDG A;  2Y2Z A;  3BDD A;  3P9K A;  2DO7 A;  3FDY A;  3L7W A;  4E7K A;  3ZQQ A;  3DBL B;  4PDK A;  3WU0 A;  4NC6 A;  2KQR A;  4EAT A;  2L5Q A;  4BQO A;  3H1C A;  1OYI A;  1ZG3 A;  3LFU A;  4HA8 A;  1IRF A;  2JPB A;  1CF7 A;  2HDD A;  5F6F A;  4A3K J;  1QNT A;  2VL8 A;  5K5O A;  4U0Y A;  5IY5 H;  2FOK A;  4UB6 C;  3LFK A;  5DYM A;  2R5Y A;  2DYR H;  2HQA A;  3R61 A;  2WA0 A;  2FOW A;  1EKE A;  1WJ5 A;  3I58 A;  4UY8 I;  3EQL F;  1U78 A;  4N0B A;  4GYI A;  4N4N B;  1Y0N A;  3DLL F;  1B8I A;  1BW5 A;  4MTD A;  3S93 A;  2M2E A;  4EJO A;  2VBX A;  2V6C A;  1L3L A;  3ZPL A;  3L00 A;  3TL4 X;  1D0Y A;  3ZQG A;  2HFH A;  1XDU A;  2CQN A;  5IYC J;  2M4K A;  3U1K A;  2F4O B;  3OYB A;  3CZ6 A;  3HHH A;  5H20 A;  5IT9 K;  4AUX A;  1A5J A;  2EV5 A;  2JWT A;  3LSJ A;  2GLO A;  4A3L J;  2CV2 A;  3R0J A;  5H2F C;  3OYK A;  3M3Y J;  5M3F J;  1Z7U A;  3K4K A;  3LSK A;  2F5F A;  2HOA A;  4G6T B;  2O6G E;  3HM5 A;  2XKO A;  3WTS C;  2E2I J;  2A3S A;  3QP5 A;  5E1X A;  3BR0 A;  1JKQ C;  3M4O J;  1OKR A;  2DN0 A;  2HZT A;  4XR6 A;  2R7V A;  4OWR B;  2AO9 A;  3IWZ A;  1WJE A;  4J01 A;  5E1Z B;  3LAJ A;  3HOV J;  1SD6 A;  2K9Q A;  4YEJ A;  3ISP A;  5F0H A;  5DM6 F;  3JRH A;  4IHX A;  1RRJ A;  3OIO A;  4KN4 X;  1K83 J;  1R5I D;  4HEA 2;  4JK1 X;  4UB8 C;  3RCO A;  2Z2S B;  2KDO A;  3P5J A;  2EA2 A;  2MSY A;  1SC7 A;  2ZME C;  4BEH B;  3IRQ A;  4ANJ A;  3OYC A;  3M8E A;  1BIB A;  3W3C A;  3VDX A;  3BWG A;  1NHA A;  3GF2 A;  1H8A C;  3KYD B;  5KAI C;  1IUY A;  3OSF A;  3ABT A;  5F0C A;  2E35 A;  3I59 A;  1ACI A;  4D5C A;  4BAY A;  1IV8 A;  1J7K A;  4C2M J;  4EV0 A;  2LVS A;  4II2 A;  3ECH A;  4IHS A;  1R58 A;  4BJ6 C;  2XRL A;  2VBZ A;  1XN7 A;  1KA8 A;  2E60 A;  1SVL A;  1X1D A;  5HDN A;  1OYW A;  4I0B A;  1AKH B;  2DA5 A;  1I27 A;  3H3U A;  1AOY A;  1V4R A;  2RVC A;  4PJM A;  1JI8 A;  2H8R A;  2R5Y B;  3ELK A;  1E17 A;  1LE8 B;  2DBB A;  4IRH A;  2DMN A;  4RM3 A;  1DGW Y;  4A69 C;  4U7B A;  4LG0 B;  4PJN A;  2ELK A;  5IT3 A;  2Z3Y A;  2XB0 X;  4L5J A;  4D7N A;  4IRI A;  4FAS D;  2JT1 A;  4HOB A;  4A6E A;  4F52 A;  2W00 A;  3HSE A;  1YIT I;  3IH3 A;  1VQ9 I;  2M7B A;  1U8B A;  1TP4 A;  3OS0 A;  2W48 A;  4A3B J;  6PAX A;  2OC6 A;  4BU2 A;  2F6C A;  3J81 Z;  2WC2 A;  2EFO A;  2R7O A;  4MNU A;  4C3I J;  1MGT A;  5IP9 J;  2DI3 A;  1SVO A;  1MMD A;  1TBX A;  5EZG A;  3S3N A;  5FO5 A;  2IS6 A;  1HKS A;  1F36 A;  4NQW B;  4PZJ A;  2HKX A;  1YTY A;  1GXP A;  2ADU A;  3PNY A;  1Z67 A;  2MD5 A;  1WSU A;  3CJT B;  1XPX A;  4M3G A;  2W57 A;  2P8T A;  4XN3 A;  3LMM A;  3RJP A;  2BOL A;  4YFN F;  3B6C A;  2DJN A;  3QU3 A;  4PCQ A;  4A12 A;  2DFE A;  3H9Q A;  3QOD A;  4IJA A;  3F8F A;  3WTT C;  2R0Q C;  2W82 A;  2KJC A;  4JP0 A;  1FY7 A;  2COM A;  2G7U A;  2K5C A;  2L9S A;  3K2A A;  4L9J A;  3AG2 H;  2YS9 A;  1FLI A;  3HC7 A;  3T1B A;  5F1J A;  3QYF A;  3FXR A;  3LA2 A;  3PSI A;  3RI4 A;  1X2M A;  2VBY A;  2JN6 A;  3ML6 A;  3T5X A;  2NRA C;  1OLT A;  4EGZ A;  4RLF A;  2H1K A;  2KIQ A;  1YI2 I;  3FXU A;  2DA4 A;  1HST A;  1ZRF A;  1JJ6 C;  4O3M A;  3IH4 A;  5D5X B;  4BGD A;  1YFH A;  4M3F A;  2XRO A;  3RQ4 A;  1JTY A;  3CCR I;  2FF4 A;  1X3Z B;  1ZLK A;  1RET A;  4FQG A;  2JPC A;  1OCP A;  4ITV A;  1W7P B;  2VQH A;  3MAJ A;  1G2H A;  2UXX A;  2DK8 A;  1O7L A;  1I50 J;  5HLI A;  2WY8 Q;  3M1C A;  1GV5 A;  4J00 A;  1I1S A;  3KYC B;  4P5O A;  3S3O A;  4A3J J;  3D1N I;  3TKY A;  3JW4 A;  2PMU A;  1FOK A;  3QAH A;  2VAS A;  3M8F A;  3ABK H;  2RGV A;  2EA4 A;  4OOI A;  1TTY A;  3HPH A;  4M3B A;  4BQA A;  4WWC A;  1UG2 A;  1IN8 A;  1S9H A;  4M3D A;  4BHP A;  1ETY A;  3FK7 A;  4CCM A;  2TDX A;  1Z3Y A;  2LY9 A;  2ZJQ F;  2DMQ A;  1LB2 A;  3DQV C;  1ETV A;  2MLK A;  4V2G A;  2IBD A;  1RKT A;  2GZW A;  3OYJ A;  4G94 A;  3CLQ A;  5LEJ A;  5GAE J;  1SFO J;  3B6A A;  1ETO A;  3NAU A;  1LE8 A;  1LVA A;  3VPR A;  1WJB A;  4X0G A;  4A5N A;  5C4J J;  1OCT C;  3I4N J;  5B1B H;  2PQ8 A;  4U0W A;  2NVU B;  3LNQ A;  3OYE A;  1T56 A;  4DOZ A;  1RI7 A;  3BQZ A;  2VPR A;  3F8N A;  3S32 A;  4BS9 A;  3KIO A;  1VQM I;  3LSG A;  2K4B A;  2NVX J;  3J80 K;  2L7Z A;  1N75 A;  3FXJ A;  5FGM A;  1WJC A;  1ZEL A;  1FJL A;  3BR2 A;  4I76 A;  3F8C A;  2BW3 A;  4ZYG A;  2H6C A;  3MKY B;  2CGP A;  1FBU A;  1SAU A;  3DU5 A;  3FBN B;  5EJC A;  4ETS A;  2JTV A;  4XLH A;  3OYL A;  3D5L A;  1BIA A;  2O7O A;  3CMY A;  3AG1 H;  4HSR A;  2EH3 A;  2N8G A;  1STZ A;  5GPC A;  3GTQ J;  4ZH4 F;  3G2B A;  2V26 A;  4XLF A;  1KQ0 A;  1XTA A;  1Z21 A;  2EJR A;  2X4H A;  3CES A;  3WG7 H;  4EJV A;  1ZQ3 P;  4ABZ A;  4FX0 A;  3NAR A;  4B8X A;  4M73 A;  5DUK A;  1HC8 A;  4Z2Y A;  4KT5 C;  3WHB A;  1FSH A;  1TNS A;  3U2R A;  5D5U B;  4AYB N;  1IGN A;  2BEO A;  2ME6 A;  1TQP A;  5FD6 A;  2MA3 A;  1ENH A;  2L4A A;  1D8K A;  1EV7 A;  3X2Q H;  4WXD A;  3DEW A;  5J1R A;  1Z1D A;  2HVQ A;  1LEB A;  3BR1 A;  3LA3 A;  4W1U A;  3RYR A;  4OAY A;  2GXB A;  3WTZ A;  3TGN A;  4U7D A;  2DOA A;  2NS8 A;  3QPT A;  2BZT A;  2XSD C;  4KNY A;  4HQE A;  3FM3 A;  2IAI A;  2P4W A;  2IJL A;  1QU3 A;  2DMT A;  2L0K A;  1IRX A;  2LR8 A;  4A3F J;  3A4C A;  2VC1 A;  3S2H J;  1JGS A;  5ICC A;  1V5F A;  1BI2 A;  2XV4 S;  5EGO A;  2FX0 A;  2KIM A;  3G4S I;  1ZG5 A;  2JVH A;  1EF4 A;  4D0P A;  3JSP A;  4ASN A;  3IHU A;  1W5C C;  4XSZ F;  2EFW A;  4RAG A;  3FBI B;  5D4S A;  1R7J A;  1W4M A;  1YW7 A;  4JX5 A;  1VQ7 I;  2DDB A;  4LB5 A;  1SFX A;  3G71 I;  3OIP A;  4B43 A;  1BR2 A;  2HQN A;  2FEZ A;  3Q0V A;  1VQN I;  1E0E A;  1MNE A;  3TOB A;  5GP9 A;  2GQQ A;  2ZCW A;  1D3Y A;  2P0W A;  1ZHF A;  1R4N B;  1TWG J;  2EK5 A;  4YFX F;  3F6V A;  1GHC A;  4Q47 A;  3IKT A;  2DQL A;  2WB1 A;  2A69 F;  2FRH A;  1POG A;  3WE2 A;  3I3L A;  1BI1 A;  2M34 A;  1REP C;  1RC9 A;  2FXA A;  3F6O A;  1WQ2 A;  2V1X A;  3V7C A;  4B44 A;  1IDZ A;  3GLX A;  3TDU C;  1LFU P;  2IP2 A;  1B72 B;  3VOD A;  2K7L A;  4EGY A;  3OSG A;  2OUM A;  2VB6 A;  1O7F A;  2DYS H;  3S2W A;  3TMO A;  3FMR A;  3FKI J;  1FNN A;  3LAP A;  3DKY A;  2M0C A;  4UXN A;  4CH7 A;  3TDZ C;  3H5N A;  3CUQ C;  4ON0 A;  4XMY A;  2LLK A;  3SDB A;  5E3O A;  2V9P A;  4EJW A;  4CHU A;  1PUE E;  1MJB A;  1IRG A;  2J5O A;  2P81 A;  2H6B A;  4RA2 A;  4RGX A;  5E8I A;  1LDD A;  1O3T A;  4IHW A;  4XKC A;  2DA1 A;  1EH7 A;  3OS1 A;  3S2D J;  1G3T A;  2VQL A;  3IC7 A;  4KIG A;  3GTP J;  2XGC A;  3JR9 A;  3TP0 A;  3LST A;  3PIO F;  4EJT A;  1YS6 A;  4WX9 A;  3ZOB A;  3KYL A;  1CF7 B;  4A3D J;  2M8G X;  5LBQ A;  4EMS A;  4I7H A;  1VQ6 I;  2GA1 A;  5ILV A;  2E2J J;  3JAM K;  1YE9 A;  3CO6 C;  1VI0 A;  1DU6 A;  3H0G J;  3GFJ A;  2X51 A;  2P5K A;  2H09 A;  2LG4 A;  5FKL A;  1IV6 A;  2OTL I;  4IF4 A;  1KZH A;  1XG1 A;  1S5L C;  1LFB A;  2XGX A;  1WJA A;  3Q9V A;  1MJA A;  4FET A;  3RPU A;  3JRA A;  3F23 A;  2VKH A;  3RKY A;  2YR2 A;  3KZY A;  2XDV A;  2CV0 A;  1ITY A;  2DK5 A;  1W7P A;  3ESW B;  3IKV A;  3K4N A;  2AXT C;  5HLT A;  4IO9 F;  4XQF A;  1FYL A;  4DZP A;  5H6R A;  2OD5 A;  3GVA A;  4CYC A;  1BC8 C;  2LSO A;  3JTH A;  4QPQ A;  1MBJ A;  4HRI A;  4YIR X;  2E5Z A;  2H8W A;  2LY1 A;  3DCF A;  5L3E A;  2L01 A;  3FXL A;  4G8X A;  3JTG A;  2LBF B;  4HX7 A;  1AU7 A;  2UV1 A;  2XAU A;  3ZRG A;  2EZH A;  2XAG A;  2E1C A;  4UNO A;  3BR6 A;  4GO1 A;  2QKM B;  2ZSH B;  1WHU A;  4O6J A;  2FBH A;  2ZNZ A;  3K70 D;  2WV1 A;  3HTU A;  1JXS A;  1TWC J;  1EJ9 A;  1FTT A;  2JA6 J;  5HNF A;  4LG0 A;  1B8I B;  1IRZ A;  3MKW B;  4M6V A;  4II3 A;  2UXN A;  4MQ9 F;  1UCR A;  4IL6 C;  5EEH A;  2RV8 A;  4L0Y B;  2H94 A;  3CUQ A;  1N25 A;  2JRM A;  3H36 A;  2JSP A;  3KEO A;  3L2W A;  3HB9 A;  4HNU A;  5JVT A;  4HDV A;  3K1N A;  3GYH X;  4K2E A;  4E7S A;  1F4K A;  4ZZL A;  2L4M A;  4RAY A;  2Z5U A;  2GM4 A;  5GAD J;  3DU6 A;  2GOM A;  2X6O A;  2KIF A;  1U0J A;  2X0L A;  4RB0 A;  1IC8 A;  5E3N A;  4C2T A;  2HI3 A;  2O8K A;  4Y4R A;  5LGT A;  2FE3 A;  3LOC A;  2V4J C;  3HOZ J;  2V1N A;  2R7U A;  3C7J A;  4A3I J;  5BMZ A;  3IV5 A;  2QBY A;  2K9L A;  3ZQ7 A;  3MZH A;  1R22 A;  2KHM A;  2QEX I;  1GUU A;  2R93 J;  3H0D A;  5A2Q K;  2VC0 A;  1FIP A;  5B5E C;  1N77 A;  1U9O A;  3GTM J;  4A93 J;  4R79 A;  1KON A;  4OIO F;  4NC8 A;  1W0T A;  4CCJ A;  1EH6 A;  5FLX K;  1OJL A;  1X1B A;  2M1B A;  1Z0X A;  2Y30 A;  2XIG A;  4Y17 A;  4EQQ A;  3W2A A;  3GFL A;  4ZTF A;  1ZRD A;  2EBI A;  3TO6 A;  1A35 A;  2BXZ A;  3DWL E;  1WPK A;  2AQE A;  1LQ1 A;  4RAZ A;  2JSC A;  4ZZD A;  1TWF J;  2FBI A;  4IX7 A;  1KYW A;  1MSE C;  4OIP F;  2OZ6 A;  5BOX A;  1E3P A;  3CF2 A;  4MQV A;  3J7Z I;  2UUZ A;  1UZC A;  4N9I A;  4ZYD A;  4WK8 F;  3E6C C;  2MC4 A;  2VI6 A;  2XAQ A;  1WJD A;  4BE2 A;  3I56 I;  5J1U A;  3ERE D;  3I53 A;  1R1T A;  4LK0 F;  3FF5 A;  1VF9 A;  4PJL A;  4CCN A;  2OJE D;  5ERI A;  4CCK A;  3OY9 A;  1OCZ H;  2OV7 A;  3KE2 A;  3PM1 A;  4HNT A;  1T0F A;  2KIS A;  3C3W A;  4X1E A;  3N4M A;  1S6L A;  2QUF A;  2B7E A;  3K4C A;  2DOE A;  5CJ9 A;  3HRS A;  2MYS A;  1SMT A;  3C2H A;  3PFY A;  2NVT J;  2E1N A;  3WGH A;  2OF7 A;  4PJJ A;  1YJW I;  2HDW A;  1XB4 A;  2L02 A;  4GRI A;  2HR3 A;  4ZDP A;  4I98 B;  4IQJ A;  2Z1D A;  4UUV A;  4BBS J;  2A68 F;  2PJR A;  2NOJ B;  3IAS 2;  4XOT A;  2VPL A;  2EFQ A;  4W97 A;  1APL C;  3HIF A;  1D1A A;  1TLH B;  3O6B B;  2JA2 A;  3VEP A;  4C3J J;  1HXD A;  3DV8 A;  3V8J A;  2DA2 A;  5K7F A;  3HZJ A;  2GBY A;  1G8X A;  3E6D A;  2HS5 A;  3CCL I;  2STW A;  1JUM A;  3EET A;  1KU2 A;  1QRY A;  1FMW A;  5K5Q A;  1ZYR F;  2L54 A;  5F08 A;  5J47 A;  4Q4Z F;  2HOS A;  2A07 F;  1RIO H;  4P9F A;  3H3Z A;  4XOP A;  3A2K A;  1ZR2 A;  4BE0 A;  3NEU A;  1OYY A;  4ZTJ A;  1K4T A;  2R7S A;  1QPM A;  1DP7 P;  5J8C A;  2DU9 A;  3GFI A;  4KA4 A;  2DQR A; 
#chains in the Genus database with same CATH homology
 5DV5 A;  5L3D A;  5HOO A;  3HRM A;  4HV6 A;  4UV8 A;  1EH8 A;  1MZB A;  3J7A O;  2CFX A;  4G7H F;  2A5Y B;  5DD4 A;  5HDK A;  2KRF A;  2O3F A;  2PBI A;  3FMS A;  4HYE A;  2QQB A;  2ESN A;  2QWW A;  3ZMV A;  3OV8 A;  3I0T A;  2P7C B;  3SZP A;  2GIV A;  1Y0U A;  2VBW A;  5JHU A;  1S8N A;  1FZP B;  2RDP A;  3FZV A;  1MDM A;  1XCV A;  4GXO A;  1U5T B;  5LEK A;  3KCC A;  4EM1 A;  2O61 A;  4M9S A;  2CQK A;  3QRF F;  5HVQ C;  3ABU A;  1UST A;  1KGS A;  3LWF A;  4AIK A;  1XMK A;  1R1V A;  2Y75 A;  3ZMS A;  3E5Q A;  4WXC A;  3E97 A;  2CSO A;  4BNC A;  2M8E A;  3SFZ A;  1USS A;  2Q2E A;  2KKO A;  1ZGJ A;  1SD5 A;  1XMA A;  3CDH A;  5BPI A;  2V9V A;  3ECO A;  4ESB A;  4LLG F;  4PGH A;  3GEZ A;  3D0S A;  4IPA A;  1U5T C;  4GYG A;  2HGC A;  4A0Z A;  3CUQ B;  3K9T A;  4IRG A;  4Y15 A;  3SZT A;  3RTR A;  3DPL C;  4R8H A;  2EFP A;  1K7A A;  3T0Y A;  1FWZ A;  4LD5 A;  3QPH A;  3P9C A;  1IN5 A;  3I64 A;  5D4R A;  5A2Q Z;  4UVB A;  3DF8 A;  5AON A;  4ESJ A;  2D1V A;  1WI9 A;  2M5W A;  1B59 A;  3WTU C;  1HKT A;  1RZ4 A;  1BJA A;  2PN6 A;  3HHG A;  3DKW A;  4BHC A;  3TO7 A;  1ZN2 A;  4YIF A;  2DPD A;  2XRN A;  1ZRC A;  3DFG A;  3FMQ A;  3BPV A;  3QP6 A;  2R7D A;  2ACJ A;  1SFU A;  1Z6R A;  1S3J A;  5LGU A;  4KFC A;  1Z05 A;  1Q1H A;  1ODD A;  2EB7 A;  1IN6 A;  4DQ2 A;  4HAM A;  3HYI A;  1RUO A;  3BY6 A;  2O8X A;  1FYM A;  2PFB A;  3M9A A;  3CTA A;  2QYO A;  4AIH A;  5BS6 A;  2W85 A;  1P6R A;  4HF1 A;  3WG9 A;  1QO0 D;  5FFX A;  4YII A;  2MC3 A;  2XVC A;  3GW2 A;  2NYX A;  2CWE A;  3FM5 A;  4L9N A;  4A5M A;  2MH9 A;  2G9W A;  3JAM Z;  3E5U A;  1O3R A;  2HYF A;  3EUH A;  5E20 A;  1IF1 A;  5ICG A;  1JHH A;  1IXR C;  1SD7 A;  1XGM A;  4MTE A;  2XAJ A;  1ULY A;  1QQI A;  1OR7 A;  5LLQ A;  1YS7 A;  3MCZ A;  3V4G A;  5D5W B;  4A6D A;  2GA2 A;  4CXF A;  2OU2 A;  3BZ6 A;  3LQQ A;  2P5V A;  1E2X A;  5LHH A;  2HKO A;  1JHF A;  4IVN A;  5ICF A;  4A0X A;  4I0A A;  3CUO A;  5L3B A;  4AIJ A;  1XSD A;  2PI0 A;  3JSO A;  1B4A A;  1HSJ A;  1U5T A;  2A6E F;  3I54 A;  3LA7 A;  4HX8 A;  3FX3 A;  4P55 A;  4ZYE A;  1FT9 A;  3GFM A;  5F1R A;  1XD7 A;  3WGI A;  1I1G A;  4MHG A;  1LEA A;  4HX4 A;  1FBS A;  1IXS B;  2PJP A;  4LGW A;  2L3D A;  3KLO A;  1BM9 A;  3BJA A;  2Y0M A;  4KYW A;  3SXY A;  3GXO A;  2ZJ2 A;  1P2F A;  1DUX C;  1ZLJ A;  5KK1 A;  3K1M A;  4G6D A;  4M72 A;  1K6O A;  2D45 A;  2Q8K A;  1HBX G;  2FU4 A;  3TQN A;  1T6S A;  1MDM B;  4LLL A;  2K4J A;  2R3S A;  3RIR A;  1IZ1 A;  3MFK A;  4CO8 A;  3BPX A;  5TRD A;  2ZBK A;  3V8L A;  1Z6T A;  2HEO A;  2VOD A;  2MBF A;  4G7Z F;  4MGR A;  3J80 Z;  1HKQ A;  1XGS A;  2IA1 A;  4HZF A;  1I6X A;  1ON2 A;  5JI6 A;  5DCM A;  4Y13 A;  4HV5 A;  3TO9 A;  2B0L A;  1B1B A;  4I2O A;  2A61 A;  4IXA A;  2E7W A;  2PG4 A;  5AIQ A;  2RN7 A;  1P4A A;  3K1P A;  4UHT A;  1FP2 A;  1W5T A;  1T2K A;  1YQA A;  4XLP F;  1J0R A;  4XRF A;  3H92 A;  3I4P A;  4LLN A;  3T8R A;  1K78 A;  3B02 A;  1B9M A;  1S29 A;  5DCF A;  1U3E M;  1YLF A;  2VN2 A;  4P96 A;  1YO5 C;  1S7A A;  1PDN C;  5CVI A;  1KQ9 A;  2GAU A;  3WOD F;  3IL2 A;  3DEU A;  3HUG A;  4ENM A;  3MEX A;  1SAX A;  3U1D A;  2IVM A;  4XBF A;  2YX4 A;  1F5T A;  1OPC A;  4L0Z B;  2PMH A;  4G6Q A;  5J8F A;  3KP5 A;  1V3F A;  3PQJ A;  2JZY A;  2BV6 A;  2STT A;  2OQG A;  4LFU A;  5KVR A;  2EFN A;  1SFE A;  5CVU A;  2G7H A;  5DEQ A;  1TW2 A;  2VT2 A;  5H6Q A;  1ONV A;  2FNP A;  2P6T A;  4HLX A;  1G3Y A;  5K1Y A;  3BRO A;  3E6M A;  2XAF A;  1O57 A;  4HBL A;  1GXQ A;  4A2U A;  4CYD A;  3J81 K;  2HTJ A;  2QQ9 A;  3KLN A;  1UB9 A;  2RKH A;  2QEN A;  3R0A A;  1B6A A;  2GWR A;  1S7O A;  1SMY F;  1P4W A;  3PQK A;  2LF7 A;  1XCB A;  4ESF A;  4LJZ F;  3F8B A;  4BHB A;  1BI3 A;  1R00 A;  3LQR A;  4LB6 B;  1PP7 U;  1Z9C A;  4E70 A;  1HW2 A;  2XAH A;  3ZMD A;  3BJ6 A;  4RGS A;  3OOP A;  2QQA A;  3EYY A;  1FX7 A;  4S05 A;  2F5D A;  3FWE A;  1HW5 A;  1F9N A;  1ZG1 A;  1ON1 A;  2NNN A;  2KJB A;  5HS7 A;  3RKW A;  5LHG A;  5CVR A;  3I5U A;  3WTW C;  5HS8 A;  1F1Z A;  1P92 A;  2HWV A;  4AWX B;  3F3X A;  3ZMU A;  3AAF A;  3REO A;  4I01 A;  4M6X A;  4NHJ A;  2GXG A;  4DNC A;  2BGC A;  5D5V B;  4RB1 A;  1J59 A;  2CYY A;  5L3C A;  3HSF A;  5FB2 A;  2OZU A;  3ZN0 A;  2EWN A;  1ZGA A;  1BOA A;  2FNA A;  2FQ3 A;  1ZRE A;  2C6Y A;  4OMY A;  2VOP A;  4GGG A;  1QZY A;  3P7N A;  1UFM A;  2UWM A;  3GO5 A;  4M74 A;  2HYG D;  5FFZ A;  1ZAR A;  4JBA A;  1RNL A;  4OIR F;  2DW4 A;  4OIN F;  2H27 A;  3KFW X;  3N97 A;  2DAO A;  1T98 A;  4TV7 A;  3F22 A;  1GVJ A;  1KYZ A;  2DFI A;  2KIU A;  3RYP A;  3GZ5 A;  1O3Q A;  2HOE A;  1TQI A;  2F5C A;  1YW9 A;  4RGR A;  3KP3 A;  2LKP A;  4A0Y A;  5ICE A;  4Q48 A;  2Q0O A;  2CO5 A;  4AD9 A;  2FA5 A;  4KDP A;  1T39 A;  1FPQ A;  4JQF A;  2ISY A;  4KMF A;  4RGU A;  3HRU A;  2XAS A;  1BC7 C;  2CW0 F;  5K5R A;  3O2P E;  1YW8 A;  3W6K B;  4ZYH A;  1IAW A;  4CDG A;  4I09 A;  3F8M A;  2QZ8 A;  3VOE A;  3G73 A;  1XSV A;  2OA4 A;  2NNY A;  4IHT A;  1IN7 A;  3FXQ A;  4BXU A;  2BBY A;  4M6Y A;  2EV0 A;  2M30 A;  2ZKZ A;  4XSX F;  3I71 A;  3I59 B;  2A6H F;  3VFZ A;  2Z99 A;  2JRT A;  1B9N A;  1KU9 A;  1LNW A;  1Z91 A;  4L9T A;  1FSE A;  4UVC A;  1QZZ A;  1R5G A;  3KP2 A;  5E17 F;  4FHT A;  1YG2 A;  4CGZ A;  4Q5S F;  5DD8 A;  4R1H A;  3HSR A;  3Q9S A;  4RB3 C;  2IA2 A;  1KU3 A;  1W5S A;  5HDG A;  4B09 A;  1FYK A;  3V7S A;  2YPR A;  2V1D A;  3B73 A;  4OIQ F;  1DPU A;  1J75 A;  3E5X A;  3QU6 A;  2BE5 F;  3SHF A;  1MKM A;  1T38 A;  5BPD A;  3WTV C;  2W25 A;  4UVA A;  3MQ0 A;  1LDK B;  1O3S A;  1BBY A;  1WKM A;  2LNB A;  5CVV A;  2AXL A;  2MLG A;  3L09 A;  1H0M A;  2QVO A;  2VT3 A;  5EEG A;  3BJO A;  3KZZ A;  2P5L C;  4MEX F;  4XLN F;  2IT0 A;  5F64 A;  1IN4 A;  4EM2 A;  5CVJ A;  3ZN1 A;  4I02 A;  3R4K A;  3COA C;  5HLH A;  3KET A;  2V1U A;  4KIC A;  2FBK A;  3GWZ A;  3HOT A;  2ZO4 A;  3U9G A;  2ZME A;  4OMZ A;  1R23 A;  1G3S A;  4ENK A;  2ESH A;  5DUI A;  3NRV A;  3G3Z A;  1C0W A;  4LK1 F;  1QBJ A;  3M7G A;  5ILS A;  2QLZ A;  5BQT A;  1IW7 F;  1XSX A;  5L3F A;  5DCM B;  2IRF G;  1J2X A;  5JR3 A;  4WCG A;  2WWY A;  5HS9 A;  2OQR A;  3T8T A;  1HW1 A;  3RKX A;  1LJ9 A;  4U0V A;  4HF2 A;  1H9G A;  3DXJ F;  3ROU A;  4FX4 A;  4KIF A;  4GCV A;  4G7O F;  3DPT A;  2M45 A;  4WF2 A;  2VON A;  4HF0 A;  3WGG A;  1OMI A;  3KP4 A;  2PLY A;  5ILU A;  3ZMT A;  3ZMZ A;  4HQM A;  2UZK A;  2RC4 A;  1U6G A;  4P9U A;  5L3G A;  5LHI A;  2VOO A;  1LDJ A;  1X3U A;  2K86 A;  1YYV A;  3WTX C;  1D5V A;  3CO7 C;  3SQN A;  2DTR A;  2YX7 A;  5E18 F;  1R36 A;  5LRR A;  1TQM A;  1WRJ A;  1HQC A;  1R5H A;  2ZXJ A;  3RPQ A;  4HLY A;  4CIC A;  3O3K A;  5CLS A;  4G9Y A;  1CGP A;  1XDS A;  2FML A;  3PFI A;  4CZZ A;  2O03 A;  4WXH A;  2VE8 A;  4BH9 A;  2ZNY A;  2K02 A;  3GUD A;  4NQW A;  4N9H A;  3M1E A;  5DDG A;  1FP1 D;  3KEQ A;  1UHW A;  2RQP A;  2DLL A;  1L0O C;  5D6F A;  5LRS A;  5E1W A;  4S04 A;  3R60 A;  4MEY F;  4KIB A;  1ZAO A;  1KQ8 A;  4BYY A;  4RS8 A;  2J5P A;  2D1H A;  4M9X A;  1JE8 A;  2NAZ A;  4L5I A;  4PGG A;  2XUB A;  1XGO A;  1WWX A;  1FC3 A;  4KN7 X;  4FT8 A;  2NS0 A;  1TW3 A;  1XGN A;  3R6S A;  5LGN A;  5HLG A;  2HTS A;  2EV6 A;  2D2W A;  3F21 A;  4KMU X;  5E8G A;  3Q5F A;  1G3W A;  4YFK F;  2M87 A;  4U88 A;  5D6E A;  5AIP A;  1BI0 A;  5FD5 A;  1K79 A;  3QOP A;  1SD4 A;  2F2E A;  3E3V A;  4LMY A;  1AWC A;  1BN5 A;  1U2W A;  2QM3 A;  4EM0 B;  4ENN A;  5TJJ A;  2PEX A;  3CJN A;  4H0E A;  1QGP A;  1J9I A;  3L9F A;  3WU1 B;  2ISZ A;  1YIO A;  4QLC U;  3E6B A;  2HDC A;  2AS5 F;  2RNJ A;  2Z9O A;  2YSR A;  4F7Z A;  3IRR A;  4YG2 F;  2WTE A;  1TNT A;  2WV0 A;  1A04 A;  2QBY B;  3FHZ A;  1KU7 A;  5JFR A;  3V7R A;  1MD0 A;  1U8R A;  2E7X A;  2HQR A;  3NQO A;  2IPQ X;  1PP8 F;  3MWM A;  4UV9 A;  3EDP A;  2IW5 A;  2CG4 A;  2IA0 A;  2DT5 A;  1I5Z A;  2OAZ A;  3P9I A;  2K27 A;  4OU0 A;  1ZH5 A;  1W7P D;  2ZFW A;  1G6N A;  3MZY A;  1DDN A;  2R7F A;  2YU3 A;  3WTY C;  3TOA A;  3W6J B;  4M9Z A;  2FMY A;  3DP7 A;  1K78 B;  3WE3 A;  1DPR A;  4EJU A;  3F72 A;  2OBP A;  3C1D A;  5D8L B;  2ELH A;  3IWF A;  2VE9 A;  1VTN C;  4AVP A;  3HRT A;  3L2C A;  2ETH A;  2ZME B;  1RUN A;  1FBQ A;  4L9V A;  5FLX Z;  2XHK A;  2LF8 A;  2DPU A;  1R1U A;  3CLO A;  2F5E A;  2XKP A;  3EYI A;  3K69 A;  4ENJ A;  2Y48 A;  5ED4 A;  4EVI A;  5J6X A;  4O5V A;  4HW0 A;  2P7V B;  2BYV E;  5IT9 Z;  3VB2 A;  2W24 A;  2W84 A;  4QWQ A;  2V79 A;  4KUM A;  1P4X A;  4HDU A;  1UHM A;  4NB5 A;  1J5Y A;  3C18 A;  3KP6 A;  1IXC A;  2VXZ A;  4M71 A;  1G4D A;  3K2Z A;  3K0L A;  2LDU A;  3ULQ B;  4RB2 C;  2P6S A;  2MH2 A;  3BP8 A;  1D8J A;  3GZ6 A;  1H9T A;  3KP7 A;  3RDI A;  5D8K B;  3V8K A;  3GX4 X;  3HOS A;  1MJ9 A;  3HTS B;  4L18 B;  2Z33 A;  5CYV A;  3ZP5 A;  3BOQ A;  2FSW A;  2O0Y A;  3BDD A;  3P9K A;  2DO7 A;  3L7W A;  4PDK A;  3WU0 A;  1OYI A;  1ZG3 A;  4HA8 A;  1IRF A;  2JPB A;  1CF7 A;  5F6F A;  1QNT A;  5K5O A;  4U0Y A;  2FOK A;  3LFK A;  5DYM A;  3R61 A;  3I58 A;  3EQL F;  1U78 A;  4N0B A;  4GYI A;  4MTD A;  4EJO A;  2VBX A;  2V6C A;  1L3L A;  3ZPL A;  3L00 A;  2HFH A;  1XDU A;  3HHH A;  5H20 A;  5IT9 K;  2EV5 A;  3R0J A;  1Z7U A;  2F5F A;  2O6G E;  2XKO A;  3WTS C;  2A3S A;  3QP5 A;  5E1X A;  1OKR A;  2HZT A;  3IWZ A;  5E1Z B;  3LAJ A;  1SD6 A;  3ISP A;  4KN4 X;  4JK1 X;  2EA2 A;  3IRQ A;  3M8E A;  1BIB A;  3BWG A;  1NHA A;  3GF2 A;  1IUY A;  3ABT A;  3I59 A;  4BAY A;  1J7K A;  4EV0 A;  3ECH A;  4IHS A;  1R58 A;  2VBZ A;  1XN7 A;  1KA8 A;  5HDN A;  1OYW A;  4I0B A;  1I27 A;  3H3U A;  1AOY A;  1V4R A;  2RVC A;  3ELK A;  1E17 A;  2DBB A;  4IRH A;  4LG0 B;  4U7B A;  5IT3 A;  2Z3Y A;  4L5J A;  4IRI A;  2JT1 A;  4HOB A;  4A6E A;  3HSE A;  6PAX A;  3J81 Z;  2WC2 A;  2EFO A;  4MNU A;  1MGT A;  2DI3 A;  1TBX A;  5FO5 A;  1HKS A;  4PZJ A;  2HKX A;  1YTY A;  1GXP A;  2ADU A;  2MD5 A;  1WSU A;  2W57 A;  2P8T A;  3RJP A;  4YFN F;  3QU3 A;  4PCQ A;  4A12 A;  4IJA A;  3WTT C;  3F8F A;  2KJC A;  1FY7 A;  2COM A;  2G7U A;  4L9J A;  1FLI A;  3T1B A;  3FXR A;  3LA2 A;  3RI4 A;  2VBY A;  3ML6 A;  3T5X A;  2NRA C;  4EGZ A;  3FXU A;  1HST A;  1ZRF A;  4O3M A;  5D5X B;  1YFH A;  2XRO A;  2FF4 A;  1ZLK A;  2JPC A;  1W7P B;  3MAJ A;  2UXX A;  2DK8 A;  1O7L A;  5HLI A;  1I1S A;  4P5O A;  3TKY A;  3JW4 A;  2PMU A;  1FOK A;  3QAH A;  3M8F A;  2RGV A;  2EA4 A;  4OOI A;  1TTY A;  4BQA A;  4WWC A;  1IN8 A;  4BHP A;  2TDX A;  1LB2 A;  3DQV C;  2MLK A;  2GZW A;  4G94 A;  5LEJ A;  1LVA A;  4A5N A;  2PQ8 A;  4U0W A;  1RI7 A;  3F8N A;  2K4B A;  3J80 K;  5FGM A;  3F8C A;  4ZYG A;  2H6C A;  2CGP A;  1FBU A;  4ETS A;  2JTV A;  3D5L A;  1BIA A;  1STZ A;  4ZH4 F;  1KQ0 A;  4EJV A;  2EJR A;  2X4H A;  4FX0 A;  4B8X A;  4M73 A;  5DUK A;  4Z2Y A;  4KT5 C;  1FSH A;  1TNS A;  3U2R A;  5D5U B;  2BEO A;  1TQP A;  5FD6 A;  2MA3 A;  2L4A A;  1D8K A;  1EV7 A;  4WXD A;  1Z1D A;  1LEB A;  3LA3 A;  3RYR A;  2GXB A;  3WTZ A;  3TGN A;  4U7D A;  3QPT A;  4KNY A;  4HQE A;  3FM3 A;  2P4W A;  2IJL A;  2VC1 A;  1JGS A;  5ICC A;  1BI2 A;  2XV4 S;  2KIM A;  1ZG5 A;  4D0P A;  3JSP A;  4ASN A;  3IHU A;  4XSZ F;  2EFW A;  5D4S A;  1R7J A;  1W4M A;  1YW7 A;  4LB5 A;  1SFX A;  2HQN A;  2FEZ A;  3TOB A;  2GQQ A;  2ZCW A;  1D3Y A;  1ZHF A;  2EK5 A;  4YFX F;  3F6V A;  1GHC A;  4Q47 A;  3IKT A;  2DQL A;  2A69 F;  2FRH A;  3WE2 A;  1BI1 A;  1REP C;  2FXA A;  3F6O A;  1WQ2 A;  2V1X A;  3V7C A;  3GLX A;  3TDU C;  2IP2 A;  3VOD A;  2K7L A;  4EGY A;  3S2W A;  1O7F A;  3FMR A;  1FNN A;  3LAP A;  4UXN A;  3TDZ C;  3CUQ C;  4ON0 A;  4EJW A;  4CHU A;  1PUE E;  1MJB A;  1IRG A;  2J5O A;  2H6B A;  4RGX A;  5E8I A;  1LDD A;  1O3T A;  1EH7 A;  1G3T A;  3IC7 A;  4KIG A;  3LST A;  4EJT A;  1YS6 A;  4WX9 A;  1CF7 B;  5LBQ A;  4EMS A;  4I7H A;  2GA1 A;  5ILV A;  3JAM K;  3CO6 C;  3GFJ A;  2P5K A;  2H09 A;  4IF4 A;  2XGX A;  3Q9V A;  1MJA A;  3RPU A;  3F23 A;  3RKY A;  2YR2 A;  3KZY A;  2DK5 A;  1W7P A;  3IKV A;  1FYL A;  5H6R A;  2OD5 A;  3GVA A;  1BC8 C;  2LSO A;  3JTH A;  5L3E A;  2L01 A;  4G8X A;  3JTG A;  4HX7 A;  2XAG A;  2E1C A;  4UNO A;  4GO1 A;  4O6J A;  2FBH A;  2ZNZ A;  3HTU A;  1JXS A;  4LG0 A;  2UXN A;  4MQ9 F;  1UCR A;  5EEH A;  2RV8 A;  4L0Y B;  2H94 A;  3CUQ A;  3KEO A;  5JVT A;  4HDV A;  3K1N A;  3GYH X;  4K2E A;  1F4K A;  4ZZL A;  2L4M A;  4RAY A;  2Z5U A;  2KIF A;  2X0L A;  4RB0 A;  5LGT A;  2FE3 A;  3C7J A;  5BMZ A;  2QBY A;  3ZQ7 A;  3MZH A;  1R22 A;  5A2Q K;  2VC0 A;  4R79 A;  4OIO F;  1EH6 A;  5FLX K;  4EQQ A;  2M1B A;  4Y17 A;  2XIG A;  3GFL A;  1ZRD A;  3TO6 A;  1LQ1 A;  4RAZ A;  2JSC A;  4ZZD A;  2FBI A;  1KYW A;  4OIP F;  2OZ6 A;  5BOX A;  4MQV A;  4N9I A;  4ZYD A;  4WK8 F;  3E6C C;  2XAQ A;  3ERE D;  3I53 A;  1R1T A;  4LK0 F;  3FF5 A;  5ERI A;  3KE2 A;  1T0F A;  3C3W A;  3N4M A;  1S6L A;  2QUF A;  5CJ9 A;  3HRS A;  1SMT A;  2E1N A;  3WGH A;  1XB4 A;  2L02 A;  2HR3 A;  4I98 B;  4UUV A;  2A68 F;  2EFQ A;  3HIF A;  1TLH B;  3O6B B;  3VEP A;  1HXD A;  3DV8 A;  3V8J A;  3E6D A;  2HS5 A;  2STW A;  3EET A;  1KU2 A;  5K5Q A;  1ZYR F;  2L54 A;  4Q4Z F;  2A07 F;  1RIO H;  4P9F A;  3H3Z A;  3NEU A;  1OYY A;  1QPM A;  1DP7 P;  5J8C A;  2DU9 A;  3GFI A;  4KA4 A;  2DQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...