4NQWB

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
FELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECF RNA polymerase sigma factor SigK
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/protein binding
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nqwB00
2Z2SB 3HUGB 4NQWB 2Q1ZB
chains in the Genus database with same CATH superfamily
2Y69H 3OSFA 4G7HF 4KNYA 2L7KA 1ETWA 1YG2A 3FM3A 1RUOA 1WRJA 2DA4A 2V9PA 5E8IA 4HG2A 4Y33A 1WJ5A 2EJRA 2L0KA 3OS2A 4BXXJ 4Q5SF 3KYLA 3IRRA 1XSVA 5LRSA 1IN4A 4BAYA 3I55I 2E5ZA 3SZTA 4XRSA 1D8KA 1T0FC 2VKVA 3TP0A 5EF6A 4I09A 4XRFA 4XNFA 5ICFA 3WTUC 2DPDA 3E6MA 2VKHA 2KIQA 4ZZDA 5BPDA 3QU3A 1D8JA 3IAS2 2ME0A 4U88A 1JKRC 1B8IB 1ZARA 1Q1VA 1XDSA 3J81K 5HDNA 2FMYA 4LLLA 2CU7A 5AIQA 1JXSA 4R8HA 3H9GA 1GV5A 3CC2I 3C3WA 1H8AC 1ZRFA 1I1SA 1XCBA 5AONA 1BJZA 5JFRA 5HDKA 2PLYA 3HEFA 4CH7A 3CCEI 4IEJA 2GA2A 1OKRA 5CQGA 4BE2A 2JQ7A 2K3FA 3KEOA 1JJ6C 4IRHA 1FBSA 1MKMA 3IC7A 2CH0A 1B9MA 5F6FA 3WTSC 3FHZA 2R5ZB 4D7NA 2LYCA 3R4KA 2KLOA 2LF8A 2Q8KA 3ZR8X 5BNGA 1ZK8A 1FBQA 2AHQA 5K7HA 4AIJA 1S8NA 3HGGA 1ZR4A 4BU2A 1HKQA 3REOA 1KU7A 1Z9CA 1X58A 2RREA 3KYDB 2QBYB 5FKOA 1FMWA 5K5OA 5HNHA 1VQ7I 2DYRH 4MQ9F 1FBUA 1YTYA 5M5YJ 2WAQN 2QZ8A 4Y7NJ 1AU7A 3LSGA 4OIOF 1IXRC 3G1OA 1RETA 3ERED 3VYRB 2DYSH 3S1MJ 3DBRB 1R9TJ 4PUSA 1IXCA 1X1AA 1JUPA 2MH9A 4AU7A 4B43A 4CCJA 2W7NA 4XLFA 2EINH 3ZMTA 5BS6A 5FLVA 3HRTA 2V1UA 2IPQX 3HRMA 2IT0A 2ZC2A 3QRFF 4BQNA 2W25A 2YU3A 2NVTJ 4AWXB 3FWEA 3RYRA 5BMZA 4M9ZA 3VOEA 1VQPI 4IHXA 2QM3A 3HSEA 1SAXA 3C18A 4D9JA 2F6CA 5JHFA 3K4KA 5EG0A 2NVUB 5EYRA 3DF8A 3ZXSA 4R1HA 3PO3J 4AD9A 1PJRA 5FLMJ 4XOPA 3WODF 3H9QA 3F8MA 4YIRX 2DFFA 3K4BA 3CZ6A 4RB1A 4B4CA 1YJWI 3CUOA 1GXPA 3LQRA 5DDGA 2PJRB 2ZKZA 3OS1A 3GMEA 4UNOA 4HBLA 3SDGA 2ZXWH 3BY6A 1R5GA 2X0LA 5TJJA 5FB2A 2MH2A 2BY1A 2KZGA 2IS4A 3NAUA 5BQTA 2DA1A 3WTWC 3TL4X 1G8XA 2LNBA 2JWTA 4WF2A 5E3MA 1YX3A 3D1NI 5J1RA 3K4LA 1BR4A 3CMMA 5M5XJ 1Y6IA 5J3LA 1QBJA 5LD2C 5KHDA 2LRDA 2VL8A 1R7JA 2HKOA 1FX7A 5E20A 2ZB9A 3DLAA 4LD5A 4IRIA 1SVOA 1FOYA 2F4MB 3IKVA 3ZMDA 2WBMA 3DKYA 4DBRA 1BW6A 2DA7A 5M3MJ 2KIUA 3B73A 4JOMA 4ITVA 1GV2A 2D45A 3C2BA 2K7LA 2CUJA 1AKHB 1T6SA 1ZREA 2FF4A 3GFJA 2LSOA 3QYBA 2IJLA 3E0JB 1DDNA 1BR2A 4UV9A 4BDZA 2W1OA 1TNTA 1ZN2A 2CV1A 3AG4H 5ICEA 1JKQC 5D5VB 4GRIA 1W7PB 4X0GA 2EQRA 1H9GA 3GFIA 1MH4A 1P4WA 4IOCF 3BG7A 5JVTA 2OF7A 2FRHA 4XKVA 3K6GA 1XGMA 3VDXA 2W82A 4M6XA 1LE8A 2RNGA 2EIJH 4FISA 1S7OA 5FRNA 1U2WA 2O3FA 2FEZA 1VQ5I 1KU3A 2VQGA 3U1DA 2H94A 5CVUA 2W24A 4QTRA 3S2DJ 2YU9J 1RI7A 5ILUA 1UHSA 5E18F 3OS0A 3DKXA 2FNAA 4UVBA 5BPIA 1UG2A 5CYVA 1Q1HA 3ZQCA 2PJRA 2BV6A 2NVXJ 2Q1ZB 4ZC3A 5C3EJ 5E17F 3D5RC 3VYSB 5HVQC 4S04A 2JA8J 2Y0SA 3MZ8A 4RM3A 4KMUX 4CCLA 3GTPJ 4MEYF 3NQOA 1J9IA 1A36A 2A61A 2KHMA 2W48A 1BOAA 1MMNA 5JLXA 3ELKA 1LFBA 2XASA 1S3JA 1ZELA 5LHIA 2E1NA 1IO2A 3IH4A 2DJNA 4E7HA 4L5JA 5KVRA 1Z6RA 2OV7A 2A68F 4U0VA 4EV0A 4U7DA 4BQAA 2BHZA 5E3LA 1ETQA 4A3GJ 2NNNA 2HTSA 2DBBA 3V7CA 1HXDA 2ZXJA 1W36D 2A6TA 3HUGA 5E3OA 4LITA 4FHTA 2FX0A 5HS9A 1AKHA 1U3EM 1FTZA 2DK5A 5HS7A 4I01A 2E1OA 3EUHC 4RA2A 1FC3A 2MD5A 3COAC 1LFPA 2A6HF 2V9KA 5FJ8J 1MIJA 2X6OA 2TDXA 4OINF 3SXYA 2L9NA 1BI0A 1U5TC 2G0EA 3RTRA 5GPCA 1W36C 1STZA 1FNNA 1TBXA 1R1VA 5TGTA 2QEXI 3AL0B 4C2TA 4O6JA 2OQRA 3TGNA 2DA2A 1OPCA 3TP3A 1I3QJ 1O7LA 3FMSA 3IH3A 3ABMH 4Y52J 2NOJB 1AOYA 2Y9ZA 1IGNA 1IF1A 3A01A 1ETVA 3HRSA 2GM4A 1VI0A 2NS8A 3CJQB 5EZGA 1JJ8C 3HOVJ 2LOOA 1FLIA 2HOAA 3BZ6A 2Z99A 4HW0A 2I5UA 3C2HA 4G12A 1Z7UA 3GXOA 2JPCA 4HV5A 4MQVA 5CKTA 1W0UA 4C3JJ 1K61A 1K78B 1E17A 4D0PA 2O61A 2JRMA 1OCRH 2CFXA 3GFMA 3HYIA 2JZYA 1OISA 1LEBA 2JSPA 1BR1A 2CYYA 2EFOA 4M6VA 5J8CA 2D1HA 1BC8C 4PFOA 1ITYA 3B6AA 4A2UA 2E2IJ 1V4RA 3JRDA 1HW1A 2IVMA 3MQ0A 5IP9J 2XAFA 4GO1A 4L9TA 3D5LA 3JRBA 2BZTA 5H6RA 1Z6TA 3FXKA 1FSEA 1YHQI 2L9VA 2X48A 2H8WA 1K7AA 4ZYAA 1ZTRA 1LKXA 5CPRB 3QP6A 5J4VA 3SDBA 2P6SA 4E7SA 4ASNA 1IUFA 1YI2I 2DW4A 2CRGA 1DPRA 5CVVA 1TQMA 1JTXA 1Z05A 3BROA 3BG5A 3OIOA 1D1BA 3V7RA 2IA1A 5D8LB 3OOPA 3AG2H 3H1CA 4UB6C 1ZG1A 1VFCA 2R7ZJ 3CDIA 5H6QA 5LHHA 1K6YA 5C44J 1TNSA 2BYVE 3BJ6A 2CG4A 1VF9A 1Y0NA 5J8FA 1FJLA 3MZHA 3CUQC 2K02A 2P6TA 1IRZA 4B44A 3H3ZA 2RN7A 2CQQA 3HOUJ 1PP7U 1WJBA 1SD4A 2NAZA 3L7WA 2LKPA 4A3JJ 1VQLI 5D5XB 5GP9A 2P8TA 3OYIA 2H8RA 2A69F 1YIOA 2F4OB 3ZMUA 2ZMEC 5LLQA 1B72B 4ZYDA 3LSRA 4JX4A 4Y15A 3DBLB 4M72A 1S7EA 2DOAA 2VBZA 5LGTA 2Y0SN 2DA3A 3L9FA 2LDUA 3ZOBA 1BN5A 1YS6A 4PJNA 3A02A 1GVJA 2ICWG 3T8TA 3MKYB 2HDWA 5KK1A 2H1LA 2YS9A 3W2VA 1HDDC 2BW3A 3G1MA 1OJLA 1F9NA 4B8XA 3FK6A 3V42A 3QWLA 1SMTA 1KQ0A 4LMYA 3GTKJ 4YIFA 1HW5A 1MBGA 4G6QA 2FUG2 4GYIA 4MTDA 4D7MA 3HJEA 4EJTA 2FSWA 3TDZC 4IJAA 4ZYEA 3K4MA 1PDNC 4NC6A 1APLC 3LQQA 4CCOA 4M3GA 3D0SA 1SFEA 5IYDJ 2L01A 3S3NA 1A5JA 1DPUA 1J59A 4DNCA 4BEHB 2HNHA 5FD6A 1DGRM 3O6BB 4ABZA 3BTLA 3P9IA 4ESBA 1R36A 2DI3A 1KU2A 1EF4A 3FXLA 4LK0F 3DTEA 3T5XA 3WHBA 2VPLA 3LMMA 2M0CA 1U8BA 2YX7A 2DTRA 4XONA 1MJBA 3Q3SA 4IXAA 2LD5A 2HU9A 2M7AA 3DLLF 1RNLA 5L3CA 2L7ZA 1X4OA 1U78A 3Q0UA 3G1LA 1I1GA 2X1DA 3CCSI 3S2HJ 1BC7C 3ZCOA 4RAZA 4XLNF 1VQNI 3I4MJ 1OCTC 2IP2A 3MN2A 2L5QA 3KZZA 2TRTA 2HOEA 1SC7A 3K0LA 2OZUA 3DBHB 4EGZA 1T56A 1POGA 2GBYA 3LA2A 1DP7P 2OQGA 1WSUA 4A3DJ 2DFEA 1KQ8A 1I6XA 1MMGA 1LEAA 2DFHA 4WXHA 4ON0A 2UWMA 2X1EA 3G6EI 3UNGC 4RGXA 1G3SA 1EH7A 4GYGA 3W2WA 4CUGA 3J7YJ 3BR6A 1A31A 3RKYA 1ZHFA 4J00A 1T08B 1DUXC 3FX3A 4KIBA 2VBWA 3CCYA 2DOFA 2H6CA 2PBIA 2UZKA 3FXJA 2Z3YA 3L2RA 4JX6A 1XB4A 4U0YA 1PUFA 3BR2A 2IXSA 3L1PA 2M0MA 3ERMA 1U9NA 2LH9A 4L9VA 4MNUA 5B3SH 2OUMA 2KIFA 2E1MC 2RQPA 2OPTA 1QZEA 3OYHA 3JTGA 1WPKA 4OAZA 3B02A 3G3ZA 4YRVA 1XC5A 1H89C 3HSRA 2CW0F 1BI1A 1F43A 5ED4A 2B9SA 3KLOA 4AVZA 3RJPA 2VKDA 3H35A 5JVGF 1TWHJ 2NOGA 4HEA2 3CCRI 1A04A 3GW2A 4ENKA 3NWSA 3N97A 1T98A 1FYMA 2HOTA 2ZJQF 4C30A 3CP2A 4QPOA 5LRRA 3RYPA 1HCRA 1JGSA 1XMXA 4C2MJ 1F1ZA 4Y3OA 3R61A 4L18B 4QWQA 5JI6A 1GXQA 2OTLI 3E1SA 3E7LA 3LAJA 5B1AH 1UELB 3GWZA 1NG6A 1DGWY 2CV0A 1IXSB 4AYBN 3J7AO 3CCUI 4UXNA 2VBYA 5F1RA 3OV8A 2E1CA 1E3PA 4G8XA 2VOOA 3HC7A 3EDPA 1X1PA 2K9SA 3GTMJ 4II3A 2CWEA 5EEHA 3LSJA 1HF0A 2FQ3A 3HOYJ 3K2ZA 3U9GA 4YFNF 3FISA 1OYYA 2Q2EA 1K79A 3LNQA 2EV6A 5HLGA 4PJMA 1HOMA 1YLFA 1YRNB 1ERDA 2M45A 3JRHA 4FASD 4BXUA 4O3MA 4KN4X 1SFUA 3WHCA 2ZCWA 3MAJA 3W2AA 3RI4A 3JRFA 2IGMA 2GZWA 1IW7F 3TW7A 4I76A 3IKTA 3FF5A 4A3FJ 4ZTFA 4PGHA 4RB0A 1SANA 5LFAA 4GDFA 4DYQA 4BE0A 3BCBA 4CYCB 4MFDA 2NXNB 4HOBA 3KP7A 2HVRA 4H4KC 3EQLF 3GZ6A 1G3YA 1IRFA 5DYMA 2QSHX 3ZPLA 1D0YA 3WE2A 4CZCA 2DK8A 2QQBA 1ZKGA 5DS9A 4NNJA 4RAGA 4FX4A 5FO5A 2F5DA 3J81Z 4BBSJ 1TC3C 1QHHD 3AFHA 1LDJA 1QHGA 1BIAA 3BG9A 2NVYJ 1SD6A 2X6WA 2M2EA 3GZNB 4I02A 2FNPA 1VTNC 4UHTA 5J4YA 4QSHA 2V6EA 3KP3A 2MC4A 4B3AA 2A07F 1Z0XA 2F5VA 3BR3A 2FD5A 1MDMA 2R7WA 1N78A 4ZYHA 1BL0A 1T95A 5L3FA 1BM9A 2G7UA 5DD4A 5FRMA 1HW2A 1HSTA 1KYZA 1D3YA 3HTSB 2OU2A 1TWAJ 4NC8A 4HNVA 1N77A 4XL9A 3I58A 1F5TA 1MBEA 1W5CC 4AIDA 4A3IJ 5M5WJ 3G2BA 2ME6A 4A3EJ 1YITI 4OIRF 3OYGA 3RCOA 1P4XA 3V8JA 4HQEA 2WY8Q 1VQ9I 1OFCX 1MMDA 3GFLA 4AC0A 3RKQA 1O3TA 3L00A 2VN2A 3RZDJ 3HGYA 2E19A 2XAJA 1VQ4I 3P9KA 2LKSA 1JI8A 3S3OA 2K86A 3WTXC 3HRUA 4G9YA 3P5JA 1TLHB 3CCQI 1QQIA 2XPWA 5GAEJ 4E7KA 2DAOA 4HSRA 3QPHA 2CUZA 3FKIJ 1HQCA 2XPVA 3J7AY 1W1WE 5E1ZB 2DODA 1V5FA 2K9LA 4M71A 4BHPA 5IPAA 1NH3A 2D1VA 2EFNA 1SEUA 2CUFA 5IT3A 4LIVA 4G94A 2CO5A 3PFIA 2IGOA 4C3HJ 4XSZF 3GYHX 1J0RA 1OQYA 2ADUA 2DOEA 3SQNA 4A69C 2HVSA 2CSOA 1MJ9A 3QOPA 5E1XA 3C7JA 1YW7A 1X3ZB 1SAUA 4F52A 4U87A 2IAIA 4UUSB 4EQQA 2X4HA 1PYVA 3I0TA 3ROUA 2IEKA 3GLXA 2K4BA 5IYBJ 3E6DA 4A0XA 4A0ZA 2E7XA 2K9MA 2XUBA 5B5EC 5JHUA 5H20A 3H0DA 2R5YB 5FKKA 1F4KA 4ZDPA 4HX8A 1TWGJ 4A6EA 5IOYA 1BOBA 3Q0WA 2M30A 1O3QA 1B8IA 3QYFA 2DTZA 5J40A 2E2HJ 2LBFB 2DU9A 3LWFA 3S15J 4KT6A 4WWCA 2E34A 2L4MA 3RQ4A 2LG4A 1AA7A 2VE8A 4BKXA 2F5EA 1ZGAA 5HLIA 1BIBA 4IZZA 1JHFA 1PVEA 3QPTA 1XMAA 2R7FA 3O3KA 3JRCA 1RPWA 4JK1X 2HOSA 2ESHA 1B9NA 3EUAA 5FKNA 1SFKA 1G3WA 2P4WA 3DTKA 5LGNA 2EH3A 4N4NB 3JSPA 2V9VA 2VC0A 3ZQ7A 4HQMA 4XRSG 1TTYA 2P5KA 1MBKA 2IBDA 2BEOA 2R5ZA 2EIMH 4PJJA 2R3SA 2WC2A 2NS7A 1R5HA 3ZQGA 4A3KJ 4A3LJ 2J5PA 6PAXA 2EK5A 1D0XA 1OR7A 4K2EA 1GDTA 5CVJA 3ECHA 2BVMA 2HYFA 4NQWB 4AM3A 2EILH 2FOKA 1M1EB 3PUFA 4LG0B 1TWCJ 2QBYA 3F23A 2DMNA 2KKOA 5ERIA 3F72A 3Q9VA 3FIWA 2VT3A 4BQOA 1S29A 5CVRA 4QPQA 1Z67A 3QQAA 4BJ6C 1IRXA 4RAYA 4YEJA 3SEZA 1UAAA 5H2FC 3WTZA 2R7XA 1JUMA 1WQ2A 3RSNA 3JSOA 3KZIC 2YUSA 1ZRDA 4II2A 3WGGA 2AS5F 2JVGA 4XKWA 1J75A 1CQTA 2HPIA 2CQ7A 3HBLA 1XGNA 4J19A 4BE1A 1U5TB 1T39A 3TDUC 2M5WA 2W57A 3ULQB 5GPAA 3I54A 4XKBA 1LQ1A 2EWNA 1SD7A 1ZGJA 5BOXA 1NK3P 1MNEA 2XRNA 3FK7A 2R92J 1OCCH 3QPSA 2A6EF 2G9WA 3FXQA 4XMYA 1R49A 2X1CA 4M3BA 2IW5A 2Y31A 1W5TA 3PL8A 2F5FA 2HI3A 3UR3C 5IY5H 1JUSA 2RKHA 2M7BA 3HXLA 3OWTA 2HTJA 5DV5A 4MGRA 4XLCA 2E36A 2N8GA 3GZ5A 2QLZA 1JT6A 1IG7A 1ORKA 2IGKA 1HDPA 4M6YA 1O57A 3AAFA 2CGPA 4HNUA 1IN7A 3B6CA 2GAUA 3MFKA 3BC8A 4HLXA 2Z1DA 1JTYA 2PEXA 2E35A 1D1CA 2R7TA 2AXLA 4V2GA 4KMFA 3LSMA 2VJ4A 3OSGA 1GT0C 3GUDA 2PX9A 2E60A 5FFXA 2NRAC 2DA6A 4EM1A 3RQIA 1BI3A 4EMSA 1EKEA 1Y8RB 4A5NA 1CGPA 5F04A 1EH8A 2MYSA 2D2WA 1VNDA 2DMQA 3KP5A 4BHCA 1LDDA 2HDDA 2UUZA 2K5CA 1XS9A 2JUGA 2RV8A 1LDKB 2V1XA 4C2UA 2CJJA 2IA2A 1ZG3A 2VXZA 4NQWA 2OTJI 2FA5A 1J5YA 3QYEA 5FKMA 2MBFA 4UY8I 4I0BA 1LVAA 4JQFA 4JBAA 3KP6A 9ANTA 5D6EA 2B0LA 1NK2P 3SZGA 3O8GA 4BY1J 3F0CA 1RR8C 4KISA 2XSDC 1Z3XA 2L9RA 4EJUA 1HSJA 2VT2A 3TOBA 3PNYA 5F0CA 2VPRA 3CESA 3GTGJ 4ZJZA 1X2NA 2EIKH 2DXIA 4DW6A 3CUQB 1ETYA 3GEZA 3M7GA 1WI9A 4ZH4F 3ABUA 2DT5A 5DCMB 1I6HJ 3WGHA 1EV7A 4GXOA 3CO6C 4KITB 1XSDA 4DYCA 1OCOH 3P7NA 3IH2A 4NHJA 1ULYA 1YQAA 2QA4I 4L0ZB 1IZ1A 1W7PA 2XAHA 4F7ZA 5DCFA 4HDVA 4OIPF 4CXFA 2EV5A 2ZMEB 4PZJA 5LBQA 1HKSA 4EEFG 2EFWA 5HNFA 2P5VA 2KIMA 3PO2J 2GXGA 3FHNA 4UVCA 1RIOH 1FSHA 4PSXA 3JW4A 2K40A 3KEQA 2ETHA 1SVLA 4ZDLA 2J5OA 3BR5A 2R93J 1I39A 2WAEA 2G7HA 3BG3A 2LREA 2M34A 1K83J 1R1TA 2O5RA 1KQ9A 4DJAA 2YPRA 3QAHA 3IAM2 3V8LA 1L0OC 1QU3A 2F2EA 2OCEA 2HWVA 3JCUC 2ECCA 3DPTA 3ISPA 4MFEA 2WA0A 3PFYA 2KP6A 2YSRA 2KRFA 2JK3A 3M8EA 4IF4A 4BHBA 4E4HA 3H5AA 1J09A 2XF5A 1YJNI 1FIPA 4R79A 1YYVA 5HLHA 2V7FA 1IV8A 2XGXA 4RBOA 3NWTA 4X1EA 2GXAA 4E7ZA 1KZHA 2M4GA 4IQ4A 2X6XA 1Y8QB 1LNWA 3CC7I 3LFUA 3BPVA 1P4AA 5IYCJ 2HQ5A 1IRGA 1I50J 3CDLA 3HB9A 3R6SA 1HC8A 2HQAA 4LFUA 4IQJA 3VPRA 1B1BA 2XB0X 2DA5A 5ICGA 5FFZA 4BGDA 5LEJA 3CO7C 3LA3A 2QQ8A 2VB6A 5J1YA 2ISZA 2E7WA 3I64A 2HXIA 1BJAA 2AQFA 2R7OA 2IRFG 4BS9A 3JAMK 2QSFX 1XCVA 5M3FJ 5K7ZA 2RNJA 5DTDA 1RRJA 4RS8A 5KAFC 4XBFA 2BXYA 3SYTA 3PQKA 3QOEA 1MNMC 3K7AJ 1ETXA 2CW8A 2IA0A 5DCMA 1MMAA 1WZ2A 3WU2C 3I5UA 4YIIA 3ZGKA 4AUXA 3I59B 2VBXA 3CJNA 4OMZA 2VONA 3WTVC 3F21A 2DDBA 2ZMEA 5KNLA 5ICCA 2VODA 4BYYA 4IVNA 4D5CA 3CLOA 2EPFA 2QGUA 2XRLA 1N25A 4N9IA 5D4SA 2NNYA 4LOCA 1GUUA 4AIKA 4WX9A 2HZDA 1ONVA 5IP6A 1QGPA 3QU6A 1T33A 2W85A 2BE5F 2OZ6A 3BG6A 5L3DA 2PMZA 4L5EA 4HNTA 2K85A 3BQZA 4UB8C 3OMYA 2KQRA 3PIOF 2E1MB 1K78A 4XSXF 2LLKA 4Z6YA 5ILVA 2WV1A 3HOTA 3CLQA 4TV7A 1LPQA 4ZTJA 3TOAA 4MHGA 2E71A 1IC8A 2O9LA 4YFXF 2EZHA 2PN6A 3BOQA 4AIHA 4XLPF 2JRTA 3GTOJ 3RPUA 4LB6B 2HS5A 1X1DA 3I4NJ 2GWRA 4JX5A 3WTTC 2VI6A 4PJ0C 4LLNA 4OAYA 2FBKA 1USSA 1ZGWA 3A2KA 4I6ZA 1UJ8A 1XD7A 3HG9A 1HKTA 4D1QA 4XN0A 3OL4A 3S1QJ 2MC3A 3T8RA 4JYKA 4LGWA 3BCAA 3OYNA 2IS2A 1K4TA 1XDUA 2H09A 1R00A 4MTEA 1W4MA 4CSWA 5IOZA 4UVAA 5KAIC 3AKZA 1FEXA 5K5RA 2X9DA 4NUBA 3K70D 3EYIA 4XR6A 3EYYA 4P1WA 2CQKA 2I8DA 3CF5F 3K10A 1XTAA 1XG1A 2LVSA 3K1MA 3HZJA 4CZZA 4JP0A 4S05A 5J1UA 3E97A 1OYWA 3FZVA 1O4XA 1B6AA 2V1DA 1KU9A 3K70C 4M3FA 1USTA 3FXOA 4Q47A 3HM5A 4V19K 3U1KA 1LFUP 5A2QZ 2QUFA 3RDIA 3TO7A 3WG7H 4NDLA 2O8XA 1B72A 3F8NA 2LK2A 3FM5A 1MJAA 4Y13A 2DMPA 5CVIA 4CICA 3GF2A 3H92A 3OIQA 4I0AA 4BY7J 1E3HA 3CDHA 3CCLI 4CDGA 3IHUA 1R4MB 5A2QK 1TL8A 3ABKH 3R60A 4G6DA 2LFBA 2I10A 2Z16A 2DCEA 1G3TA 3DXJF 2ECBA 2DMTA 1WHUA 3DEEA 4CO8A 4PGGA 2HXOA 3EUKL 4I2OA 4M9XA 2DPUA 1FT9A 1H88C 3ZQHA 4B48A 4A12A 3E5XA 3ZQLA 2K3PA 1R5ID 1MGTA 4EM2A 5EEAA 2W4SA 4DBQA 2VE9A 5CQEA 4FT8A 1H0MA 3OYBA 2EZLA 2JT1A 4L9NA 4BEHA 1S5LC 1OMIA 3QODA 3TO9A 3KFWX 4KJZA 3E6CC 3U21A 3M1EA 5LGUA 3DKWA 3HKZA 2L3DA 4RGRA 4DIQA 3W6VA 4MEXF 5L3GA 3DQVC 4PJLA 2VJJA 3V7SA 3PNVA 3J80K 4HAMA 4KT5C 2ACJA 2EFQA 1J2XA 3N4MA 1GLNA 3KPHA 2MFZA 1OCPA 3G73A 3BDDA 2BOLA 3G71I 1MBFA 2UXNA 4FE7A 3IUOA 3ESWB 3GTQJ 2PMZN 2DJIA 2OC6A 4BUPA 2HGCA 3H3UA 3OIPA 2YX4A 2QCOA 5DM6F 3KIOA 4GGGA 1HBXG 4BACA 5FLXZ 4E7IA 3E5QA 1U6GA 3HOSA 1FWZA 2K9QA 2M1BA 2QWWA 2KT0A 1IN8A 3CMEI 4KYWA 1ZH5A 1DQUA 3BQYA 1Z3YA 4KIGA 3L2CA 1X3WB 5FLXK 1ACIA 2QQ9A 2L54A 4E7LA 4RLFA 2EBIA 1U0JA 4KUMA 3BZCA 2EA4A 2VXDA 4OMYA 2MW8A 1MZBA 3PQJA 4RM2A 4CGZA 2WY7Q 2M9HA 2O7OA 1ZAOA 3HOZJ 2XAQA 3KP2A 5DEQA 5CJ9A 4S0HB 3I4PA 2ZO4A 1ZG5A 5C4JJ 3E5UA 4MO7A 3PSFA 1FTTA 2R7VA 2R7QA 2OCCH 1QVUA 2XAGA 2JA6J 2VASA 2DQRA 4FX0A 3CD6I 4I99C 4LLGF 2ZNYA 3ZMVA 1Y39A 3C1DA 1WFXA 4Z2YA 1T0FA 2K4JA 4A5MA 3OYDA 3HIFA 1LVKA 3FBNB 1CF7B 2B7EA 1X2MA 4E6KG 3DCFA 4FE4A 3DPLC 1QPIA 1WVRA 1R4NB 1TZLA 2HYGD 1W0TA 1ZR2A 2FBHA 2MLKA 4BJTA 4XQFA 3LSIA 1T2KA 2ZJ2A 1FOKA 3SHFA 4ENNA 2KMUA 1UHMA 1WH7A 1XX5A 1ZYRF 5DD8A 4V2FA 4Q4ZF 2KRHA 3TQNA 4DQ2A 3ABTA 2QSGX 1ODDA 1IUYA 2LY9A 3RKXA 4P55A 3KX2A 4RDUA 4ESFA 1Y0UA 3RZOJ 4L5IA 2XSJC 3IWFA 5EG0B 1V54H 2RC4A 2K27A 4QIWN 1ETKA 4CCMA 2MLGA 1S7AA 1RR7A 1KONA 1S9HA 1HLVA 5L3EA 2WB1A 3JRIA 2O6GE 2L9SA 4P96A 5FD5A 1MSFC 2QKMB 2ZNZA 1R23A 4D5FA 3LSPA 1IDZA 4M3EA 3M1CA 1C0WA 4RB2C 4OOIA 1Z21A 4H0EA 2GQQA 3SFZA 1YRNA 4LJZF 3VYTB 2BY3A 3OYAA 2V1NA 2AQEA 5E79C 2LY1A 4YELA 4ENJA 1UMQA 4I7HA 4OU0A 2L7FP 3V8KA 2Z33A 3K1NA 2EZKA 1IV6A 4KFCA 1REPC 3OR2C 3HKZN 4CYCA 1OYIA 4DZJA 1U8RA 2STTA 2ZJRF 2P7CB 1O7FA 2PI0A 2IGNA 1RZ4A 2R7DA 2HQNA 4XLHA 5GADJ 2WWYA 3HTUA 1QO0D 1WJFA 2EA2A 1TW2A 3CTAA 2RAEA 1VQKI 3MWMA 3GX4X 1CF7A 3PSIA 2GIZA 4KA4A 1MMSA 3AG1H 4FQGA 4UV8A 1G4DA 1YOVB 2XF7A 3CC4I 3BT9A 4KICA 2XC7A 3T0YA 1IDYA 4XKCA 4HSTA 2JUCA 4IRGA 2QF7A 2P0WA 1H9TA 3KLNA 5GAGJ 5J6XA 4FTHA 3T1BA 1RKWA 4C3IJ 1ZLJA 4A6DA 2VJIA 2ID6A 1XGOA 4HYEA 2DMUA 1X4PA 2R4GA 2F4IA 4RGUA 1BI2A 2Y9YA 4XORA 3KP4A 4ETSA 2XKPA 2GOXB 3CQZJ 3OL3A 3RKWA 1XMKA 4J01A 3DEWA 4Y4RA 5F1JA 4IHTA 2RQQA 1FPQA 3BJOA 4QLCU 1LE8B 2V79A 1FP2A 2UXXA 1FYLA 2XGCA 2F5CA 2KZVA 3OY9A 3S1NJ 1FYKA 2WAFA 2B63J 5D5WB 4OWRB 2CS3A 2EFPA 1MH3A 2L7MP 3TMOA 2NVQJ 4A3CJ 4F93B 2XKOA 1TT5B 4IO9F 2HEOA 2CMPA 4KDPA 3SZPA 5B66C 1X19A 2GXBA 2NS0A 2XIGA 1YO5C 2A5WA 3LL7A 1ON2A 3ZMZA 1I5ZA 3BTJA 3JTHA 4L9JA 3V4GA 4P9UA 1U9OA 3TKYA 3CP8A 2KISA 3VWBA 1BBYA 1MW7A 2LP0A 3MD2A 2XAUA 1GHCA 1MBHA 3F22A 3MEXA 3QPLA 3M9AA 5E3NA 3E3VA 2ZXIA 4CCNA 5JLWA 2CUEA 4UUVA 2CQNA 2CQXA 2RDPA 5F08A 5B1BH 3SEQA 3TO6A 5L3BA 4W1UA 3F8BA 2WTEA 1A6IA 2OBPA 4BBRJ 3QP5A 4M74A 1TW3A 4G7OF 1OR7C 1P2FA 3OYMA 2GLOA 3BPXA 3OOUA 3MKZA 2XPUA 3F6OA 5F0FA 4UUSA 2OJED 2EB7A 2O0YA 4XLAA 3LSKA 2HKXA 4ZZLA 3O2PE 4XIDA 3HUGB 4DOZA 2HVQA 4IKFA 1PP8F 2ELHA 2BHYA 2R5YA 5EJCA 3OYKA 1IJWC 3BTIA 4RB3C 2KFDA 4HX7A 4HF2A 3I53A 2DDAA 2A05A 5D8KB 3OYFA 5GTHC 1S6LA 3FMQA 3K4CA 3CJTB 1WKMA 3GLLA 1VQ8I 4A0YA 2WB1N 2NYXA 3VFZA 1D0ZA 2LBFA 2VLAA 1QNTA 1W5SA 1Z91A 3GTJJ 5F64A 1OCZH 1WJEA 2GOMA 4XICA 2XDVA 4CHUA 4IHVA 2AXTC 4IPAA 3LAPA 2WV0A 4XN3A 2KJCA 1LB2A 3A01B 3TEDA 2ZBKA 2COMA 3MMYB 3BTCA 4AVPA 1YS7A 1P6RA 1XPXA 3CCJI 4YFKF 1IN5A 5FKLA 3MKLA 1IN6A 2MG4A 1YJ9I 2DO7A 1MBJA 1AWCA 1QA6A 4O5VA 3A0HC 3P9CA 4PFPA 1SMYF 3BWGA 2LY2A 2LTPA 3VODA 4HV6A 3BZKA 3S16J 1XN7A 3IP4B 2ID3A 4BDYA 3F3XA 1TQPA 2OD5A 4LK1F 1TP4A 2CFOA 2PMHA 4LG0A 3IV5A 2JA5J 2ZSIB 2CV2A 1LUJB 3HPGA 1FZPB 2TCTA 3ZQIA 2HYJA 2KRCA 1XGSA 4N0BA 1P9QC 1WCMJ 2BXZA 4M3DA 2Z5UA 1X1CA 4PDKA 3MZYA 3EUHA 3CCMI 1RC9A 3BP8A 5IP7J 2QQAA 3L2UA 4EJVA 4BNCA 2ELKA 2M4KA 4FETA 3K69A 2MA3A 1SVMA 2YR2A 3K9TA 4LIUA 3S2WA 2Y0MA 3I56I 1R71A 2JJ7A 4OIQF 1U5TA 1MNDA 3ASOH 1G2HA 2F48A 3PNTA 3R0AA 1KYWA 1UCRA 2EV0A 4ESJA 2VIXA 2MGQA 1KA8A 4RAFA 3CF2A 3F8FA 3PJRA 1W7PD 2PQ8A 1WJDA 2DLLA 3HHGA 3S32A 2E2JJ 3SJMA 4M9SA 3I3LA 2Z2SB 3JRGA 1FP1D 3JR9A 5DUKA 4XLEA 4E7JA 4IL6C 2ZJPF 5K1YA 3ABLH 1QVTA 3WU0A 2XGEA 3WE3A 5EZHA 1UFMA 2JMWA 3FBIB 3K4JA 1B4AA 3C2GA 2RGVA 4DGWB 3VB2A 3LFKA 3M8JA 5AIPA 1I3AA 4UUTA 2H6BA 1UG0A 2MABA 4B1RA 3TW6A 1TWFJ 2LF7A 3NEUA 3WGIA 3OYLA 2WADA 2ESNA 3DTIA 4RGSA 5CLSA 3FDYA 2L4AA 2DFIA 2VUMJ 3AG3H 4XRMA 2PG4A 3CMAI 1O3SA 2BBYA 3KETA 2STWA 1Y1WJ 1OLTA 3Q9SA 1AHDP 1A35A 2BY2A 3L2QA 5LHGA 2W84A 4NB5A 3MVPA 4EJWA 4YG2F 4G7ZF 1SD5A 3X2QH 2BVLA 3SFIA 4N4OB 2ELJA 4GCVA 1YE9A 2BW3B 1T38A 3OYEA 4LB5A 3L09A 4XM3A 4IHWA 3WU1B 2VQCA 3H9JA 3CMYA 2HZTA 3KE2A 3CJRB 2V4JC 2LMDA 3JAMZ 2JN6A 3J7ZI 1X1BA 3GBGA 4L0YB 5E8GA 1E2XA 2XHKA 1LJ9A 2Y75A 5IT9Z 4U0WA 1I27A 3S17J 2KDZA 3KEYA 3DP7A 3ZMSA 2BGCA 3O8HA 4Y17A 2C6YA 4N9HA 3ECOA 3Q5FA 1WGXA 2JVHA 3D5SC 3LA7A 3HHHA 3L2VA 2X51A 1BW5A 4HA8A 1XSXA 1Y1VJ 3A03A 1E0EA 3S3MA 2FQ4A 4BL0B 4XOTA 1JT0A 5IT9K 3CUQA 3NARA 4C9YA 3G4SI 2JTVA 4I98B 1JE8A 3FXMA 2MSYA 1VQMI 3HSFA 2XB5A 3JRAA 2O03A 3JREA 2GA1A 1RESA 4CCKA 2HFHA 2KDOA 3U2RA 4HDUA 4F55A 5D6FA 2EZIA 1G59A 2KJBA 1D1AA 3DEUA 3S93A 4ZDOA 3RIRA 1FOXA 5HLTA 3IL2A 5LEKA 4M73A 1ZLKA 3K1PA 1HA8A 3VEPA 2DT6A 2XV4S 3WTYC 2AO9A 2FE3A 2VQHA 2LC2A 3FXRA 2XROA 2V26A 2Y2ZA 3VSKA 3Q0VA 5D5UB 3MKWB 4PSWA 1V5EA 5TRDA 2R7SA 4EJOA 1FOWA 2M3AA 4P5OA 5C4XJ 2LKXA 4U7BA 1SFXA 3BR0A 4KIFA 1X3UA 2LR8A 1ZRCA 3AL0C 3GO5A 2FBIA 4IX7A 3H5RA 4AYBA 4A3BJ 4HPQA 1WH5A 5EGOB 2FU4A 4GFBA 5J47A 5GAHJ 3ZQQA 3DV8A 4B09A 1Z77A 4MLOA 4IHSA 3M3YJ 2QENA 2PFBA 2XGDA 2DQLA 4A3MJ 4KN7X 1PUFB 1V55H 1P7JA 3ZP5A 3HDDA 1QPMA 3RPUD 2ISYA 3DPUA 1UB9A 4XK4A 1N75A 4PCQA 1ETOA 1WI3A 5JR3A 2H27A 2Y30A 3I71A 3CCVI 1QZYA 1DU6A 2E5NA 5F0HA 2X85A 3EETA 5ILSA 4HF0A 3W6KB 4A93J 4IOAF 2FXAA 3S1RJ 3ONQA 1R6RA 1F36A 3OYCA 1S72I 2M8EA 1FIAA 2A5YB 2Z9OA 3F9KA 1EH6A 2JA2A 1DP3A 3ZQFA 2L2OA 4Q48A 4RMNA 1VQ6I 5KCMA 5F27A 1MD0A 2ZFWA 3K4NA 3EPZA 3N05A 3PIPF 1A6QA 1YIJI 5E1WA 4DYRA 1UZCA 1YW8A 4E70A 2CW7A 2IS6A 2V6CA 1NG7A 5FGMA 2P7VB 4LG3A 5DM7F 2R7RA 3I59A 2QYOA 4BJ5C 2QVOA 1R1UA 4HX4A 2HDCA 1D5YA 2VC1A 4P9FA 4HRIA 3L2WA 3H3VK 3LSHA 3OYJA 1K6OA 1MSEC 1V5GA 5FROA 2GIVA 1GVDA 2M8GX 2VKEA 1FMVA 1VZ0A 2UV1A 2ZFUA 3ZRGA 1P92A 3H5NA 3ASNH 4NBQA 3S14J 2VQLA 3ML6A 2OAZA 4B3XA 2H1KA 2Q2EB 1ON1A 1Z1DA 2PJPA 3LOCA 3RPQA 3M07A 1Z7LA 3ZN1A 3FKJA 4F3QA 4HLYA 1IAWA 3GTLJ 1R22A 5K5QA 2R0QC 4DZPA 2IS1A 3HOXJ 3OR1C 4WXDA 2KL4A 3DFGA 1SFOJ 3A1YA 3ZN0A 4FCYA 3UKGA 2D5VA 1T8IA 3HPHA 2FMLA 4ANJA 5EGOA 1VQOI 4F92B 2KPMA 5HS8A 1NHAA 2QKLB 3I9V2 3F6VA 4IHYA 2K9NA 3KZYA 3J80Z 1ZQ3P 5HOOA 2R7UA 1YW9A 4PK4A 1P7IA 1G6NA 3W6JB 4W97A 4X6AJ 1YX5A 2ZSHB 3KCCA 3IRQA 3TBIA 3FMRA 2VJ5A 1NTCA 3MCZA 1JKOC 4EATA 5EEGA 2JPBA 1L3LA 1DU0A 1JHHA 2HQRA 1UHWA 2M87A 2Q0OA 4BQQA 2HR3A 1J7KA 2DT7B 2XVCA 1D5VA 1Y56A 2A3SA 3K2AA 3FXUA 4EVIA 2PMUA 2BY0A 3VSLA 1RUNA 2XF6A 2WAQA 1QZZA 1MDMB 1FY7A 1ENHA 4NC7A 1R58A 1YFHA 3A0BC 2FOWA 1BA5A 1B59A 3M8FA 3KYCB 3A4CA 3GVAA 5HODA 3BJAA 3M4OJ 1WWXA 3F8CA 4MIMA 2JA7J 2X6YA 1O3RA 3NRVA 3H0GJ 4WK8F 3VYUB 1QRYA 3DU6A 3E6BA 2W00A 3HOWJ 2VOPA 4ENMA 2FJ1A 1KGSA 5GTIC 1WJAA 5K7FA 5EDNA 1RKTA 1V3FA 4HF1A 4BXFA 2COBA 5DUIA 2MD0A 3LSTA 1K4SA 3HL2A 3WG9A 3PM1A 3DWLE 1WJCA 4RLQA 3W3CA 4F91B 1E3OC 4CA0A 4EM0B 1EJ9A 3BR1A 4EGYA 3H36A 1EA3A 2HPMA 2ZXHA 4CYDA 3S8PA 3DU5A 2Y48A 3R0JA 4HZFA 4BH9A 1PUEE 2P5LC 1JKPC 2O8KA 4WCGA 2P81A 1TQIA 4ZYGA 2OA4A 1JGGA 2RVCA 3BLYA 1TT0A 4B47A 2JSCA 5TISC 3PUBA 3GCMA 4WXCA 3IWZA 5HDGA 5D4RA 2DN0A 2L02A 4G6TB
chains in the Genus database with same CATH topology
2VPLA 3LMMA 4ZDLA 2L7KA 4XONA 2WAEA 3CP8A 3VWBA 1MW7A 3MD2A 2LREA 2XAUA 2O5RA 2HU9A 4DJAA 2M7AA 4HG2A 4Y33A 1WJ5A 3IAM2 2ZXIA 4CCNA 3OS2A 1X4OA 1QU3A 3KYLA 3SEQA 3DPTA 2E5ZA 2WA0A 2X1DA 2KP6A 3PFYA 1T0FC 3ZCOA 4XNFA 2L5QA 3H5AA 4E4HA 2VKHA 1OR7C 1J09A 2XF5A 3OYMA 3OOUA 3MKZA 3IAS2 4R79A 2V7FA 3NWTA 4XLAA 1MMGA 3LSKA 4E7ZA 2UWMA 2M4GA 2X1EA 3HUGB 3UNGC 4CUGA 3W2WA 3H9GA 4IQ4A 4DOZA 2HVQA 2X6XA 4IKFA 4J00A 3LFUA 3OYKA 2HQAA 4IQJA 4CH7A 3OYFA 5CQGA 4BE2A 3K4CA 4BGDA 3L2RA 2VB6A 1D0ZA 2IXSA 2LBFA 2M0MA 2R7OA 2AQFA 2VLAA 2LH9A 4BS9A 2OUMA 2E1MC 2CH0A 1WJEA 2GOMA 3OYHA 2XDVA 2LYCA 4OAZA 3SYTA 2KLOA 4YRVA 3ZR8X 3QOEA 2CW8A 1MMAA 4XN3A 4AVZA 3MMYB 2VKDA 3H35A 4BU2A 3ZGKA 2RREA 4HEA2 3NWSA 5KNLA 1FMWA 4C30A 3CP2A 4QPOA 5HNHA 4PFPA 4Y3OA 2LY2A 3E1SA 2HZDA 3IP4B 3LSGA 4BDYA 1UELB 3VYRB 1NG6A 1DGWY 2CFOA 3BG6A 2CV0A 4HNTA 2PMZA 2ZSIB 2CV2A 4PUSA 1X1AA 3HPGA 4AU7A 4B43A 4CCJA 2W7NA 4XLFA 3OMYA 2KQRA 2KRCA 2E1MB 3HC7A 1P9QC 4II3A 3HOTA 1X1CA 4BQNA 4ZTJA 3L2UA 2M4KA 4FETA 4LIUA 1X1DA 4D9JA 1MNDA 2F6CA 5JHFA 3K4KA 3PNTA 4PJMA 4OAYA 2VIXA 1ERDA 3ZXSA 4FASD 3A2KA 3PJRA 3CF2A 3HG9A 3S32A 1WJDA 4D1QA 4XN0A 3W2AA 1PJRA 3I3LA 2Z2SB 3OL4A 4XOPA 2IGMA 3H9QA 2IS2A 3BCAA 4XLEA 3OYNA 4E7JA 3K4BA 4CSWA 3CZ6A 4ZTFA 3AKZA 5LFAA 2PJRB 3FBIB 4NUBA 4BE0A 3BCBA 3K4JA 3OS1A 3K70D 3C2GA 4XR6A 2HVRA 4DGWB 4H4KC 3M8JA 4P1WA 2IS4A 2I8DA 3K10A 1UG0A 2MABA 1D0YA 3TL4X 4CZCA 1G8XA 3OYLA 4NNJA 1YX3A 2WADA 3DTIA 1QHHD 3AFHA 3FDYA 3K4LA 1QHGA 1BR4A 3CMMA 1Y6IA 1OLTA 2X6WA 3K70C 5KHDA 5LD2C 2LRDA 3L2QA 2VL8A 2V6EA 2MC4A 3DLAA 2BVLA 2F5VA 4N4OB 2ELJA 2WBMA 3DKYA 1YE9A 4DBRA 2BW3B 2R7WA 1N78A 3OYEA 4JOMA 4ITVA 4XM3A 1T95A 2VQCA 3H9JA 3CJRB 2V4JC 5FRMA 2CUJA 3OIQA 1X1BA 3GBGA 3QYBA 4NC8A 1N77A 4XL9A 3E0JB 1BR2A 4BDZA 3KEYA 2W1OA 3G2BA 3OYGA 2CV1A 2Z16A 2DCEA 4GRIA 2JVHA 3D5SC 3RCOA 4X0GA 3L2VA 2WY8Q 2X51A 1MMDA 3DEEA 1E0EA 3S3MA 4BL0B 3BG7A 4XOTA 3EUKL 4XKVA 3K6GA 4C9YA 3VDXA 1JI8A 2W82A 3S3OA 2RNGA 4B48A 2K3PA 5FRNA 2W4SA 4DBQA 5CQEA 4CCKA 3OYBA 4E7KA 4HSRA 2KDOA 4BEHA 3QODA 2VQGA 4F55A 2CUZA 1G59A 4KJZA 3U21A 3J7AY 1D1AA 3S93A 4ZDOA 2K9LA 1V5FA 5HLTA 3HKZA 4DIQA 1HA8A 2DT6A 3DQVC 4LIVA 4PJLA 3OS0A 2VJJA 2IGOA 3DKXA 3PNVA 2VQHA 2LC2A 2HVSA 2V26A 3VSKA 3MKWB 2PJRA 4PSWA 1V5EA 2Q1ZB 1GLNA 4ZC3A 2R7SA 2MFZA 1SAUA 4F52A 2BOLA 3D5RC 4U87A 3VYSB 2M3AA 4P5OA 5HVQC 4U7BA 2Y0SA 3IUOA 4RM3A 4CCLA 1PYVA 3AL0C 2DJIA 2OC6A 4BUPA 4IX7A 2KHMA 3H5RA 3OIPA 4AYBA 1MMNA 4HPQA 2K9MA 3H0DA 4BACA 4E7IA 1ZELA 3ZQQA 4MLOA 3HOSA 4ZDPA 4E7HA 2OV7A 1BOBA 3QYFA 3RPUD 2LBFB 3DPUA 1DQUA 1N75A 1Z3YA 4KT6A 1W36D 3RQ4A 2A6TA 2LG4A 1AA7A 4LITA 4IZZA 4E7LA 4RLFA 3EUHC 1U0JA 2VXDA 2E5NA 1LFPA 2X85A 4RM2A 2V9KA 3EUAA 2WY7Q 1SFKA 2L9NA 3RTRA 1W36C 3DTKA 3PSFA 4N4NB 2R7VA 3ONQA 1R6RA 3OYCA 2R7QA 5TGTA 2VASA 3AL0B 4C2TA 3F9KA 2JA2A 1DP3A 2L2OA 4RMNA 1WFXA 4PJJA 5KCMA 3K4NA 3N05A 3EPZA 2NOJB 3OYDA 1LVKA 3FBNB 1D0XA 2CW7A 2IS6A 4E6KG 1NG7A 3DPLC 2BVMA 4NQWB 3CJQB 2LOOA 4LG3A 2R7RA 1TZLA 4BJ5C 4BJTA 4XQFA 3C2HA 3LSIA 4HRIA 3L2WA 4BQOA 3LSHA 3OYJA 5CKTA 1V5GA 4QPQA 5FROA 4BJ6C 2KMUA 1IRXA 4YEJA 3SEZA 1UAAA 2JSPA 1FMVA 1VZ0A 2UV1A 1BR1A 2KRHA 2ZFUA 3ZRGA 2R7XA 3H5NA 4PFOA 2VQLA 3RSNA 4B3XA 4II2A 2Q2EB 2JVGA 4XKWA 3D5LA 3KX2A 2HPIA 4BE1A 1Z7LA 4F3QA 3FKJA 2XSJC 4XKBA 2IS1A 3OR1C 4CCMA 4ZYAA 2KL4A 1LKXA 1MNEA 5CPRB 3SDBA 4E7SA 1KONA 3A1YA 1S9HA 4XMYA 2X1CA 2WB1A 3HPHA 4ANJA 2L9SA 4F92B 3PL8A 2QKMB 2KPMA 3UR3C 2QKLB 3I9V2 3M1CA 1D1BA 2M7BA 3HXLA 3OWTA 1Z21A 4XLCA 5HOOA 2R7UA 3VYTB 3OYAA 2IGKA 4PK4A 2V1NA 1K6YA 2AQEA 1YX5A 2ZSHB 2LY1A 4YELA 3TBIA 4HNUA 2VJ5A 3BC8A 2Z1DA 4EATA 1D1CA 2R7TA 3LSMA 4B44A 2VJ4A 4BQQA 3OR2C 2DT7B 2E60A 1Y56A 1WJBA 3VSLA 2XF6A 2WAQA 3OYIA 2IGNA 2MYSA 4XLHA 4NC7A 1WJFA 2UUZA 2K5CA 2DOAA 2JUGA 1LDKB 3PSIA 4C2UA 2VXZA 3A4CA 2XF7A 3QYEA 4PJNA 2X6YA 2XC7A 4XKCA 3MKYB 4JQFA 4HSTA 2HDWA 3VYUB 2P0WA 3DU6A 3W2VA 3SZGA 2W00A 2BW3A 4KISA 1Z3XA 1WJAA 2VJIA 3V42A 1X4PA 2R4GA 2F4IA 3PNYA 4BXFA 2MD0A 3HL2A 3CESA 4XORA 2FUG2 3DWLE 4ZJZA 2DXIA 1WJCA 4RLQA 3W3CA 2GOXB 3OL3A 4F91B 4CA0A 4J01A 3K4MA 2HPMA 1EA3A 4Y4RA 2ZXHA 2RQQA 3S8PA 3DU5A 4KITB 4CCOA 2KZVA 3OY9A 3S3NA 2WAFA 4BEHB 2HNHA 4OWRB 3BLYA 2CS3A 1TT0A 1DGRM 3TMOA 4B47A 4F93B 5HNFA 3PUBA 3FHNA 2CMPA 1X19A 4PSXA 2A5WA 3LL7A 3DTEA 4G6TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z2S B;  3HUG B;  4NQW B;  2Q1Z B; 
#chains in the Genus database with same CATH topology
 2Y69 H;  3OSF A;  4G7H F;  4KNY A;  2L7K A;  1ETW A;  1YG2 A;  3FM3 A;  1RUO A;  1WRJ A;  2DA4 A;  2V9P A;  5E8I A;  4HG2 A;  4Y33 A;  1WJ5 A;  2EJR A;  2L0K A;  3OS2 A;  4BXX J;  4Q5S F;  3KYL A;  3IRR A;  1XSV A;  5LRS A;  1IN4 A;  4BAY A;  3I55 I;  2E5Z A;  3SZT A;  4XRS A;  1D8K A;  1T0F C;  2VKV A;  3TP0 A;  5EF6 A;  4I09 A;  4XRF A;  4XNF A;  5ICF A;  3WTU C;  2DPD A;  3E6M A;  2VKH A;  2KIQ A;  4ZZD A;  5BPD A;  3QU3 A;  1D8J A;  3IAS 2;  2ME0 A;  4U88 A;  1JKR C;  1B8I B;  1ZAR A;  1Q1V A;  1XDS A;  3J81 K;  5HDN A;  2FMY A;  4LLL A;  2CU7 A;  5AIQ A;  1JXS A;  4R8H A;  3H9G A;  1GV5 A;  3CC2 I;  3C3W A;  1H8A C;  1ZRF A;  1I1S A;  1XCB A;  5AON A;  1BJZ A;  5JFR A;  5HDK A;  2PLY A;  3HEF A;  4CH7 A;  3CCE I;  4IEJ A;  2GA2 A;  1OKR A;  5CQG A;  4BE2 A;  2JQ7 A;  2K3F A;  3KEO A;  1JJ6 C;  4IRH A;  1FBS A;  1MKM A;  3IC7 A;  2CH0 A;  1B9M A;  5F6F A;  3WTS C;  3FHZ A;  2R5Z B;  4D7N A;  2LYC A;  3R4K A;  2KLO A;  2LF8 A;  2Q8K A;  3ZR8 X;  5BNG A;  1ZK8 A;  1FBQ A;  2AHQ A;  5K7H A;  4AIJ A;  1S8N A;  3HGG A;  1ZR4 A;  4BU2 A;  1HKQ A;  3REO A;  1KU7 A;  1Z9C A;  1X58 A;  2RRE A;  3KYD B;  2QBY B;  5FKO A;  1FMW A;  5K5O A;  5HNH A;  1VQ7 I;  2DYR H;  4MQ9 F;  1FBU A;  1YTY A;  5M5Y J;  2WAQ N;  2QZ8 A;  4Y7N J;  1AU7 A;  3LSG A;  4OIO F;  1IXR C;  3G1O A;  1RET A;  3ERE D;  3VYR B;  2DYS H;  3S1M J;  3DBR B;  1R9T J;  4PUS A;  1IXC A;  1X1A A;  1JUP A;  2MH9 A;  4AU7 A;  4B43 A;  4CCJ A;  2W7N A;  4XLF A;  2EIN H;  3ZMT A;  5BS6 A;  5FLV A;  3HRT A;  2V1U A;  2IPQ X;  3HRM A;  2IT0 A;  2ZC2 A;  3QRF F;  4BQN A;  2W25 A;  2YU3 A;  2NVT J;  4AWX B;  3FWE A;  3RYR A;  5BMZ A;  4M9Z A;  3VOE A;  1VQP I;  4IHX A;  2QM3 A;  3HSE A;  1SAX A;  3C18 A;  4D9J A;  2F6C A;  5JHF A;  3K4K A;  5EG0 A;  2NVU B;  5EYR A;  3DF8 A;  3ZXS A;  4R1H A;  3PO3 J;  4AD9 A;  1PJR A;  5FLM J;  4XOP A;  3WOD F;  3H9Q A;  3F8M A;  4YIR X;  2DFF A;  3K4B A;  3CZ6 A;  4RB1 A;  4B4C A;  1YJW I;  3CUO A;  1GXP A;  3LQR A;  5DDG A;  2PJR B;  2ZKZ A;  3OS1 A;  3GME A;  4UNO A;  4HBL A;  3SDG A;  2ZXW H;  3BY6 A;  1R5G A;  2X0L A;  5TJJ A;  5FB2 A;  2MH2 A;  2BY1 A;  2KZG A;  2IS4 A;  3NAU A;  5BQT A;  2DA1 A;  3WTW C;  3TL4 X;  1G8X A;  2LNB A;  2JWT A;  4WF2 A;  5E3M A;  1YX3 A;  3D1N I;  5J1R A;  3K4L A;  1BR4 A;  3CMM A;  5M5X J;  1Y6I A;  5J3L A;  1QBJ A;  5LD2 C;  5KHD A;  2LRD A;  2VL8 A;  1R7J A;  2HKO A;  1FX7 A;  5E20 A;  2ZB9 A;  3DLA A;  4LD5 A;  4IRI A;  1SVO A;  1FOY A;  2F4M B;  3IKV A;  3ZMD A;  2WBM A;  3DKY A;  4DBR A;  1BW6 A;  2DA7 A;  5M3M J;  2KIU A;  3B73 A;  4JOM A;  4ITV A;  1GV2 A;  2D45 A;  3C2B A;  2K7L A;  2CUJ A;  1AKH B;  1T6S A;  1ZRE A;  2FF4 A;  3GFJ A;  2LSO A;  3QYB A;  2IJL A;  3E0J B;  1DDN A;  1BR2 A;  4UV9 A;  4BDZ A;  2W1O A;  1TNT A;  1ZN2 A;  2CV1 A;  3AG4 H;  5ICE A;  1JKQ C;  5D5V B;  4GRI A;  1W7P B;  4X0G A;  2EQR A;  1H9G A;  3GFI A;  1MH4 A;  1P4W A;  4IOC F;  3BG7 A;  5JVT A;  2OF7 A;  2FRH A;  4XKV A;  3K6G A;  1XGM A;  3VDX A;  2W82 A;  4M6X A;  1LE8 A;  2RNG A;  2EIJ H;  4FIS A;  1S7O A;  5FRN A;  1U2W A;  2O3F A;  2FEZ A;  1VQ5 I;  1KU3 A;  2VQG A;  3U1D A;  2H94 A;  5CVU A;  2W24 A;  4QTR A;  3S2D J;  2YU9 J;  1RI7 A;  5ILU A;  1UHS A;  5E18 F;  3OS0 A;  3DKX A;  2FNA A;  4UVB A;  5BPI A;  1UG2 A;  5CYV A;  1Q1H A;  3ZQC A;  2PJR A;  2BV6 A;  2NVX J;  2Q1Z B;  4ZC3 A;  5C3E J;  5E17 F;  3D5R C;  3VYS B;  5HVQ C;  4S04 A;  2JA8 J;  2Y0S A;  3MZ8 A;  4RM3 A;  4KMU X;  4CCL A;  3GTP J;  4MEY F;  3NQO A;  1J9I A;  1A36 A;  2A61 A;  2KHM A;  2W48 A;  1BOA A;  1MMN A;  5JLX A;  3ELK A;  1LFB A;  2XAS A;  1S3J A;  1ZEL A;  5LHI A;  2E1N A;  1IO2 A;  3IH4 A;  2DJN A;  4E7H A;  4L5J A;  5KVR A;  1Z6R A;  2OV7 A;  2A68 F;  4U0V A;  4EV0 A;  4U7D A;  4BQA A;  2BHZ A;  5E3L A;  1ETQ A;  4A3G J;  2NNN A;  2HTS A;  2DBB A;  3V7C A;  1HXD A;  2ZXJ A;  1W36 D;  2A6T A;  3HUG A;  5E3O A;  4LIT A;  4FHT A;  2FX0 A;  5HS9 A;  1AKH A;  1U3E M;  1FTZ A;  2DK5 A;  5HS7 A;  4I01 A;  2E1O A;  3EUH C;  4RA2 A;  1FC3 A;  2MD5 A;  3COA C;  1LFP A;  2A6H F;  2V9K A;  5FJ8 J;  1MIJ A;  2X6O A;  2TDX A;  4OIN F;  3SXY A;  2L9N A;  1BI0 A;  1U5T C;  2G0E A;  3RTR A;  5GPC A;  1W36 C;  1STZ A;  1FNN A;  1TBX A;  1R1V A;  5TGT A;  2QEX I;  3AL0 B;  4C2T A;  4O6J A;  2OQR A;  3TGN A;  2DA2 A;  1OPC A;  3TP3 A;  1I3Q J;  1O7L A;  3FMS A;  3IH3 A;  3ABM H;  4Y52 J;  2NOJ B;  1AOY A;  2Y9Z A;  1IGN A;  1IF1 A;  3A01 A;  1ETV A;  3HRS A;  2GM4 A;  1VI0 A;  2NS8 A;  3CJQ B;  5EZG A;  1JJ8 C;  3HOV J;  2LOO A;  1FLI A;  2HOA A;  3BZ6 A;  2Z99 A;  4HW0 A;  2I5U A;  3C2H A;  4G12 A;  1Z7U A;  3GXO A;  2JPC A;  4HV5 A;  4MQV A;  5CKT A;  1W0U A;  4C3J J;  1K61 A;  1K78 B;  1E17 A;  4D0P A;  2O61 A;  2JRM A;  1OCR H;  2CFX A;  3GFM A;  3HYI A;  2JZY A;  1OIS A;  1LEB A;  2JSP A;  1BR1 A;  2CYY A;  2EFO A;  4M6V A;  5J8C A;  2D1H A;  1BC8 C;  4PFO A;  1ITY A;  3B6A A;  4A2U A;  2E2I J;  1V4R A;  3JRD A;  1HW1 A;  2IVM A;  3MQ0 A;  5IP9 J;  2XAF A;  4GO1 A;  4L9T A;  3D5L A;  3JRB A;  2BZT A;  5H6R A;  1Z6T A;  3FXK A;  1FSE A;  1YHQ I;  2L9V A;  2X48 A;  2H8W A;  1K7A A;  4ZYA A;  1ZTR A;  1LKX A;  5CPR B;  3QP6 A;  5J4V A;  3SDB A;  2P6S A;  4E7S A;  4ASN A;  1IUF A;  1YI2 I;  2DW4 A;  2CRG A;  1DPR A;  5CVV A;  1TQM A;  1JTX A;  1Z05 A;  3BRO A;  3BG5 A;  3OIO A;  1D1B A;  3V7R A;  2IA1 A;  5D8L B;  3OOP A;  3AG2 H;  3H1C A;  4UB6 C;  1ZG1 A;  1VFC A;  2R7Z J;  3CDI A;  5H6Q A;  5LHH A;  1K6Y A;  5C44 J;  1TNS A;  2BYV E;  3BJ6 A;  2CG4 A;  1VF9 A;  1Y0N A;  5J8F A;  1FJL A;  3MZH A;  3CUQ C;  2K02 A;  2P6T A;  1IRZ A;  4B44 A;  3H3Z A;  2RN7 A;  2CQQ A;  3HOU J;  1PP7 U;  1WJB A;  1SD4 A;  2NAZ A;  3L7W A;  2LKP A;  4A3J J;  1VQL I;  5D5X B;  5GP9 A;  2P8T A;  3OYI A;  2H8R A;  2A69 F;  1YIO A;  2F4O B;  3ZMU A;  2ZME C;  5LLQ A;  1B72 B;  4ZYD A;  3LSR A;  4JX4 A;  4Y15 A;  3DBL B;  4M72 A;  1S7E A;  2DOA A;  2VBZ A;  5LGT A;  2Y0S N;  2DA3 A;  3L9F A;  2LDU A;  3ZOB A;  1BN5 A;  1YS6 A;  4PJN A;  3A02 A;  1GVJ A;  2ICW G;  3T8T A;  3MKY B;  2HDW A;  5KK1 A;  2H1L A;  2YS9 A;  3W2V A;  1HDD C;  2BW3 A;  3G1M A;  1OJL A;  1F9N A;  4B8X A;  3FK6 A;  3V42 A;  3QWL A;  1SMT A;  1KQ0 A;  4LMY A;  3GTK J;  4YIF A;  1HW5 A;  1MBG A;  4G6Q A;  2FUG 2;  4GYI A;  4MTD A;  4D7M A;  3HJE A;  4EJT A;  2FSW A;  3TDZ C;  4IJA A;  4ZYE A;  3K4M A;  1PDN C;  4NC6 A;  1APL C;  3LQQ A;  4CCO A;  4M3G A;  3D0S A;  1SFE A;  5IYD J;  2L01 A;  3S3N A;  1A5J A;  1DPU A;  1J59 A;  4DNC A;  4BEH B;  2HNH A;  5FD6 A;  1DGR M;  3O6B B;  4ABZ A;  3BTL A;  3P9I A;  4ESB A;  1R36 A;  2DI3 A;  1KU2 A;  1EF4 A;  3FXL A;  4LK0 F;  3DTE A;  3T5X A;  3WHB A;  2VPL A;  3LMM A;  2M0C A;  1U8B A;  2YX7 A;  2DTR A;  4XON A;  1MJB A;  3Q3S A;  4IXA A;  2LD5 A;  2HU9 A;  2M7A A;  3DLL F;  1RNL A;  5L3C A;  2L7Z A;  1X4O A;  1U78 A;  3Q0U A;  3G1L A;  1I1G A;  2X1D A;  3CCS I;  3S2H J;  1BC7 C;  3ZCO A;  4RAZ A;  4XLN F;  1VQN I;  3I4M J;  1OCT C;  2IP2 A;  3MN2 A;  2L5Q A;  3KZZ A;  2TRT A;  2HOE A;  1SC7 A;  3K0L A;  2OZU A;  3DBH B;  4EGZ A;  1T56 A;  1POG A;  2GBY A;  3LA2 A;  1DP7 P;  2OQG A;  1WSU A;  4A3D J;  2DFE A;  1KQ8 A;  1I6X A;  1MMG A;  1LEA A;  2DFH A;  4WXH A;  4ON0 A;  2UWM A;  2X1E A;  3G6E I;  3UNG C;  4RGX A;  1G3S A;  1EH7 A;  4GYG A;  3W2W A;  4CUG A;  3J7Y J;  3BR6 A;  1A31 A;  3RKY A;  1ZHF A;  4J00 A;  1T08 B;  1DUX C;  3FX3 A;  4KIB A;  2VBW A;  3CCY A;  2DOF A;  2H6C A;  2PBI A;  2UZK A;  3FXJ A;  2Z3Y A;  3L2R A;  4JX6 A;  1XB4 A;  4U0Y A;  1PUF A;  3BR2 A;  2IXS A;  3L1P A;  2M0M A;  3ERM A;  1U9N A;  2LH9 A;  4L9V A;  4MNU A;  5B3S H;  2OUM A;  2KIF A;  2E1M C;  2RQP A;  2OPT A;  1QZE A;  3OYH A;  3JTG A;  1WPK A;  4OAZ A;  3B02 A;  3G3Z A;  4YRV A;  1XC5 A;  1H89 C;  3HSR A;  2CW0 F;  1BI1 A;  1F43 A;  5ED4 A;  2B9S A;  3KLO A;  4AVZ A;  3RJP A;  2VKD A;  3H35 A;  5JVG F;  1TWH J;  2NOG A;  4HEA 2;  3CCR I;  1A04 A;  3GW2 A;  4ENK A;  3NWS A;  3N97 A;  1T98 A;  1FYM A;  2HOT A;  2ZJQ F;  4C30 A;  3CP2 A;  4QPO A;  5LRR A;  3RYP A;  1HCR A;  1JGS A;  1XMX A;  4C2M J;  1F1Z A;  4Y3O A;  3R61 A;  4L18 B;  4QWQ A;  5JI6 A;  1GXQ A;  2OTL I;  3E1S A;  3E7L A;  3LAJ A;  5B1A H;  1UEL B;  3GWZ A;  1NG6 A;  1DGW Y;  2CV0 A;  1IXS B;  4AYB N;  3J7A O;  3CCU I;  4UXN A;  2VBY A;  5F1R A;  3OV8 A;  2E1C A;  1E3P A;  4G8X A;  2VOO A;  3HC7 A;  3EDP A;  1X1P A;  2K9S A;  3GTM J;  4II3 A;  2CWE A;  5EEH A;  3LSJ A;  1HF0 A;  2FQ3 A;  3HOY J;  3K2Z A;  3U9G A;  4YFN F;  3FIS A;  1OYY A;  2Q2E A;  1K79 A;  3LNQ A;  2EV6 A;  5HLG A;  4PJM A;  1HOM A;  1YLF A;  1YRN B;  1ERD A;  2M45 A;  3JRH A;  4FAS D;  4BXU A;  4O3M A;  4KN4 X;  1SFU A;  3WHC A;  2ZCW A;  3MAJ A;  3W2A A;  3RI4 A;  3JRF A;  2IGM A;  2GZW A;  1IW7 F;  3TW7 A;  4I76 A;  3IKT A;  3FF5 A;  4A3F J;  4ZTF A;  4PGH A;  4RB0 A;  1SAN A;  5LFA A;  4GDF A;  4DYQ A;  4BE0 A;  3BCB A;  4CYC B;  4MFD A;  2NXN B;  4HOB A;  3KP7 A;  2HVR A;  4H4K C;  3EQL F;  3GZ6 A;  1G3Y A;  1IRF A;  5DYM A;  2QSH X;  3ZPL A;  1D0Y A;  3WE2 A;  4CZC A;  2DK8 A;  2QQB A;  1ZKG A;  5DS9 A;  4NNJ A;  4RAG A;  4FX4 A;  5FO5 A;  2F5D A;  3J81 Z;  4BBS J;  1TC3 C;  1QHH D;  3AFH A;  1LDJ A;  1QHG A;  1BIA A;  3BG9 A;  2NVY J;  1SD6 A;  2X6W A;  2M2E A;  3GZN B;  4I02 A;  2FNP A;  1VTN C;  4UHT A;  5J4Y A;  4QSH A;  2V6E A;  3KP3 A;  2MC4 A;  4B3A A;  2A07 F;  1Z0X A;  2F5V A;  3BR3 A;  2FD5 A;  1MDM A;  2R7W A;  1N78 A;  4ZYH A;  1BL0 A;  1T95 A;  5L3F A;  1BM9 A;  2G7U A;  5DD4 A;  5FRM A;  1HW2 A;  1HST A;  1KYZ A;  1D3Y A;  3HTS B;  2OU2 A;  1TWA J;  4NC8 A;  4HNV A;  1N77 A;  4XL9 A;  3I58 A;  1F5T A;  1MBE A;  1W5C C;  4AID A;  4A3I J;  5M5W J;  3G2B A;  2ME6 A;  4A3E J;  1YIT I;  4OIR F;  3OYG A;  3RCO A;  1P4X A;  3V8J A;  4HQE A;  2WY8 Q;  1VQ9 I;  1OFC X;  1MMD A;  3GFL A;  4AC0 A;  3RKQ A;  1O3T A;  3L00 A;  2VN2 A;  3RZD J;  3HGY A;  2E19 A;  2XAJ A;  1VQ4 I;  3P9K A;  2LKS A;  1JI8 A;  3S3O A;  2K86 A;  3WTX C;  3HRU A;  4G9Y A;  3P5J A;  1TLH B;  3CCQ I;  1QQI A;  2XPW A;  5GAE J;  4E7K A;  2DAO A;  4HSR A;  3QPH A;  2CUZ A;  3FKI J;  1HQC A;  2XPV A;  3J7A Y;  1W1W E;  5E1Z B;  2DOD A;  1V5F A;  2K9L A;  4M71 A;  4BHP A;  5IPA A;  1NH3 A;  2D1V A;  2EFN A;  1SEU A;  2CUF A;  5IT3 A;  4LIV A;  4G94 A;  2CO5 A;  3PFI A;  2IGO A;  4C3H J;  4XSZ F;  3GYH X;  1J0R A;  1OQY A;  2ADU A;  2DOE A;  3SQN A;  4A69 C;  2HVS A;  2CSO A;  1MJ9 A;  3QOP A;  5E1X A;  3C7J A;  1YW7 A;  1X3Z B;  1SAU A;  4F52 A;  4U87 A;  2IAI A;  4UUS B;  4EQQ A;  2X4H A;  1PYV A;  3I0T A;  3ROU A;  2IEK A;  3GLX A;  2K4B A;  5IYB J;  3E6D A;  4A0X A;  4A0Z A;  2E7X A;  2K9M A;  2XUB A;  5B5E C;  5JHU A;  5H20 A;  3H0D A;  2R5Y B;  5FKK A;  1F4K A;  4ZDP A;  4HX8 A;  1TWG J;  4A6E A;  5IOY A;  1BOB A;  3Q0W A;  2M30 A;  1O3Q A;  1B8I A;  3QYF A;  2DTZ A;  5J40 A;  2E2H J;  2LBF B;  2DU9 A;  3LWF A;  3S15 J;  4KT6 A;  4WWC A;  2E34 A;  2L4M A;  3RQ4 A;  2LG4 A;  1AA7 A;  2VE8 A;  4BKX A;  2F5E A;  1ZGA A;  5HLI A;  1BIB A;  4IZZ A;  1JHF A;  1PVE A;  3QPT A;  1XMA A;  2R7F A;  3O3K A;  3JRC A;  1RPW A;  4JK1 X;  2HOS A;  2ESH A;  1B9N A;  3EUA A;  5FKN A;  1SFK A;  1G3W A;  2P4W A;  3DTK A;  5LGN A;  2EH3 A;  4N4N B;  3JSP A;  2V9V A;  2VC0 A;  3ZQ7 A;  4HQM A;  4XRS G;  1TTY A;  2P5K A;  1MBK A;  2IBD A;  2BEO A;  2R5Z A;  2EIM H;  4PJJ A;  2R3S A;  2WC2 A;  2NS7 A;  1R5H A;  3ZQG A;  4A3K J;  4A3L J;  2J5P A;  6PAX A;  2EK5 A;  1D0X A;  1OR7 A;  4K2E A;  1GDT A;  5CVJ A;  3ECH A;  2BVM A;  2HYF A;  4NQW B;  4AM3 A;  2EIL H;  2FOK A;  1M1E B;  3PUF A;  4LG0 B;  1TWC J;  2QBY A;  3F23 A;  2DMN A;  2KKO A;  5ERI A;  3F72 A;  3Q9V A;  3FIW A;  2VT3 A;  4BQO A;  1S29 A;  5CVR A;  4QPQ A;  1Z67 A;  3QQA A;  4BJ6 C;  1IRX A;  4RAY A;  4YEJ A;  3SEZ A;  1UAA A;  5H2F C;  3WTZ A;  2R7X A;  1JUM A;  1WQ2 A;  3RSN A;  3JSO A;  3KZI C;  2YUS A;  1ZRD A;  4II2 A;  3WGG A;  2AS5 F;  2JVG A;  4XKW A;  1J75 A;  1CQT A;  2HPI A;  2CQ7 A;  3HBL A;  1XGN A;  4J19 A;  4BE1 A;  1U5T B;  1T39 A;  3TDU C;  2M5W A;  2W57 A;  3ULQ B;  5GPA A;  3I54 A;  4XKB A;  1LQ1 A;  2EWN A;  1SD7 A;  1ZGJ A;  5BOX A;  1NK3 P;  1MNE A;  2XRN A;  3FK7 A;  2R92 J;  1OCC H;  3QPS A;  2A6E F;  2G9W A;  3FXQ A;  4XMY A;  1R49 A;  2X1C A;  4M3B A;  2IW5 A;  2Y31 A;  1W5T A;  3PL8 A;  2F5F A;  2HI3 A;  3UR3 C;  5IY5 H;  1JUS A;  2RKH A;  2M7B A;  3HXL A;  3OWT A;  2HTJ A;  5DV5 A;  4MGR A;  4XLC A;  2E36 A;  2N8G A;  3GZ5 A;  2QLZ A;  1JT6 A;  1IG7 A;  1ORK A;  2IGK A;  1HDP A;  4M6Y A;  1O57 A;  3AAF A;  2CGP A;  4HNU A;  1IN7 A;  3B6C A;  2GAU A;  3MFK A;  3BC8 A;  4HLX A;  2Z1D A;  1JTY A;  2PEX A;  2E35 A;  1D1C A;  2R7T A;  2AXL A;  4V2G A;  4KMF A;  3LSM A;  2VJ4 A;  3OSG A;  1GT0 C;  3GUD A;  2PX9 A;  2E60 A;  5FFX A;  2NRA C;  2DA6 A;  4EM1 A;  3RQI A;  1BI3 A;  4EMS A;  1EKE A;  1Y8R B;  4A5N A;  1CGP A;  5F04 A;  1EH8 A;  2MYS A;  2D2W A;  1VND A;  2DMQ A;  3KP5 A;  4BHC A;  1LDD A;  2HDD A;  2UUZ A;  2K5C A;  1XS9 A;  2JUG A;  2RV8 A;  1LDK B;  2V1X A;  4C2U A;  2CJJ A;  2IA2 A;  1ZG3 A;  2VXZ A;  4NQW A;  2OTJ I;  2FA5 A;  1J5Y A;  3QYE A;  5FKM A;  2MBF A;  4UY8 I;  4I0B A;  1LVA A;  4JQF A;  4JBA A;  3KP6 A;  9ANT A;  5D6E A;  2B0L A;  1NK2 P;  3SZG A;  3O8G A;  4BY1 J;  3F0C A;  1RR8 C;  4KIS A;  2XSD C;  1Z3X A;  2L9R A;  4EJU A;  1HSJ A;  2VT2 A;  3TOB A;  3PNY A;  5F0C A;  2VPR A;  3CES A;  3GTG J;  4ZJZ A;  1X2N A;  2EIK H;  2DXI A;  4DW6 A;  3CUQ B;  1ETY A;  3GEZ A;  3M7G A;  1WI9 A;  4ZH4 F;  3ABU A;  2DT5 A;  5DCM B;  1I6H J;  3WGH A;  1EV7 A;  4GXO A;  3CO6 C;  4KIT B;  1XSD A;  4DYC A;  1OCO H;  3P7N A;  3IH2 A;  4NHJ A;  1ULY A;  1YQA A;  2QA4 I;  4L0Z B;  1IZ1 A;  1W7P A;  2XAH A;  4F7Z A;  5DCF A;  4HDV A;  4OIP F;  4CXF A;  2EV5 A;  2ZME B;  4PZJ A;  5LBQ A;  1HKS A;  4EEF G;  2EFW A;  5HNF A;  2P5V A;  2KIM A;  3PO2 J;  2GXG A;  3FHN A;  4UVC A;  1RIO H;  1FSH A;  4PSX A;  3JW4 A;  2K40 A;  3KEQ A;  2ETH A;  1SVL A;  4ZDL A;  2J5O A;  3BR5 A;  2R93 J;  1I39 A;  2WAE A;  2G7H A;  3BG3 A;  2LRE A;  2M34 A;  1K83 J;  1R1T A;  2O5R A;  1KQ9 A;  4DJA A;  2YPR A;  3QAH A;  3IAM 2;  3V8L A;  1L0O C;  1QU3 A;  2F2E A;  2OCE A;  2HWV A;  3JCU C;  2ECC A;  3DPT A;  3ISP A;  4MFE A;  2WA0 A;  3PFY A;  2KP6 A;  2YSR A;  2KRF A;  2JK3 A;  3M8E A;  4IF4 A;  4BHB A;  4E4H A;  3H5A A;  1J09 A;  2XF5 A;  1YJN I;  1FIP A;  4R79 A;  1YYV A;  5HLH A;  2V7F A;  1IV8 A;  2XGX A;  4RBO A;  3NWT A;  4X1E A;  2GXA A;  4E7Z A;  1KZH A;  2M4G A;  4IQ4 A;  2X6X A;  1Y8Q B;  1LNW A;  3CC7 I;  3LFU A;  3BPV A;  1P4A A;  5IYC J;  2HQ5 A;  1IRG A;  1I50 J;  3CDL A;  3HB9 A;  3R6S A;  1HC8 A;  2HQA A;  4LFU A;  4IQJ A;  3VPR A;  1B1B A;  2XB0 X;  2DA5 A;  5ICG A;  5FFZ A;  4BGD A;  5LEJ A;  3CO7 C;  3LA3 A;  2QQ8 A;  2VB6 A;  5J1Y A;  2ISZ A;  2E7W A;  3I64 A;  2HXI A;  1BJA A;  2AQF A;  2R7O A;  2IRF G;  4BS9 A;  3JAM K;  2QSF X;  1XCV A;  5M3F J;  5K7Z A;  2RNJ A;  5DTD A;  1RRJ A;  4RS8 A;  5KAF C;  4XBF A;  2BXY A;  3SYT A;  3PQK A;  3QOE A;  1MNM C;  3K7A J;  1ETX A;  2CW8 A;  2IA0 A;  5DCM A;  1MMA A;  1WZ2 A;  3WU2 C;  3I5U A;  4YII A;  3ZGK A;  4AUX A;  3I59 B;  2VBX A;  3CJN A;  4OMZ A;  2VON A;  3WTV C;  3F21 A;  2DDB A;  2ZME A;  5KNL A;  5ICC A;  2VOD A;  4BYY A;  4IVN A;  4D5C A;  3CLO A;  2EPF A;  2QGU A;  2XRL A;  1N25 A;  4N9I A;  5D4S A;  2NNY A;  4LOC A;  1GUU A;  4AIK A;  4WX9 A;  2HZD A;  1ONV A;  5IP6 A;  1QGP A;  3QU6 A;  1T33 A;  2W85 A;  2BE5 F;  2OZ6 A;  3BG6 A;  5L3D A;  2PMZ A;  4L5E A;  4HNT A;  2K85 A;  3BQZ A;  4UB8 C;  3OMY A;  2KQR A;  3PIO F;  2E1M B;  1K78 A;  4XSX F;  2LLK A;  4Z6Y A;  5ILV A;  2WV1 A;  3HOT A;  3CLQ A;  4TV7 A;  1LPQ A;  4ZTJ A;  3TOA A;  4MHG A;  2E71 A;  1IC8 A;  2O9L A;  4YFX F;  2EZH A;  2PN6 A;  3BOQ A;  4AIH A;  4XLP F;  2JRT A;  3GTO J;  3RPU A;  4LB6 B;  2HS5 A;  1X1D A;  3I4N J;  2GWR A;  4JX5 A;  3WTT C;  2VI6 A;  4PJ0 C;  4LLN A;  4OAY A;  2FBK A;  1USS A;  1ZGW A;  3A2K A;  4I6Z A;  1UJ8 A;  1XD7 A;  3HG9 A;  1HKT A;  4D1Q A;  4XN0 A;  3OL4 A;  3S1Q J;  2MC3 A;  3T8R A;  4JYK A;  4LGW A;  3BCA A;  3OYN A;  2IS2 A;  1K4T A;  1XDU A;  2H09 A;  1R00 A;  4MTE A;  1W4M A;  4CSW A;  5IOZ A;  4UVA A;  5KAI C;  3AKZ A;  1FEX A;  5K5R A;  2X9D A;  4NUB A;  3K70 D;  3EYI A;  4XR6 A;  3EYY A;  4P1W A;  2CQK A;  2I8D A;  3CF5 F;  3K10 A;  1XTA A;  1XG1 A;  2LVS A;  3K1M A;  3HZJ A;  4CZZ A;  4JP0 A;  4S05 A;  5J1U A;  3E97 A;  1OYW A;  3FZV A;  1O4X A;  1B6A A;  2V1D A;  1KU9 A;  3K70 C;  4M3F A;  1UST A;  3FXO A;  4Q47 A;  3HM5 A;  4V19 K;  3U1K A;  1LFU P;  5A2Q Z;  2QUF A;  3RDI A;  3TO7 A;  3WG7 H;  4NDL A;  2O8X A;  1B72 A;  3F8N A;  2LK2 A;  3FM5 A;  1MJA A;  4Y13 A;  2DMP A;  5CVI A;  4CIC A;  3GF2 A;  3H92 A;  3OIQ A;  4I0A A;  4BY7 J;  1E3H A;  3CDH A;  3CCL I;  4CDG A;  3IHU A;  1R4M B;  5A2Q K;  1TL8 A;  3ABK H;  3R60 A;  4G6D A;  2LFB A;  2I10 A;  2Z16 A;  2DCE A;  1G3T A;  3DXJ F;  2ECB A;  2DMT A;  1WHU A;  3DEE A;  4CO8 A;  4PGG A;  2HXO A;  3EUK L;  4I2O A;  4M9X A;  2DPU A;  1FT9 A;  1H88 C;  3ZQH A;  4B48 A;  4A12 A;  3E5X A;  3ZQL A;  2K3P A;  1R5I D;  1MGT A;  4EM2 A;  5EEA A;  2W4S A;  4DBQ A;  2VE9 A;  5CQE A;  4FT8 A;  1H0M A;  3OYB A;  2EZL A;  2JT1 A;  4L9N A;  4BEH A;  1S5L C;  1OMI A;  3QOD A;  3TO9 A;  3KFW X;  4KJZ A;  3E6C C;  3U21 A;  3M1E A;  5LGU A;  3DKW A;  3HKZ A;  2L3D A;  4RGR A;  4DIQ A;  3W6V A;  4MEX F;  5L3G A;  3DQV C;  4PJL A;  2VJJ A;  3V7S A;  3PNV A;  3J80 K;  4HAM A;  4KT5 C;  2ACJ A;  2EFQ A;  1J2X A;  3N4M A;  1GLN A;  3KPH A;  2MFZ A;  1OCP A;  3G73 A;  3BDD A;  2BOL A;  3G71 I;  1MBF A;  2UXN A;  4FE7 A;  3IUO A;  3ESW B;  3GTQ J;  2PMZ N;  2DJI A;  2OC6 A;  4BUP A;  2HGC A;  3H3U A;  3OIP A;  2YX4 A;  2QCO A;  5DM6 F;  3KIO A;  4GGG A;  1HBX G;  4BAC A;  5FLX Z;  4E7I A;  3E5Q A;  1U6G A;  3HOS A;  1FWZ A;  2K9Q A;  2M1B A;  2QWW A;  2KT0 A;  1IN8 A;  3CME I;  4KYW A;  1ZH5 A;  1DQU A;  3BQY A;  1Z3Y A;  4KIG A;  3L2C A;  1X3W B;  5FLX K;  1ACI A;  2QQ9 A;  2L54 A;  4E7L A;  4RLF A;  2EBI A;  1U0J A;  4KUM A;  3BZC A;  2EA4 A;  2VXD A;  4OMY A;  2MW8 A;  1MZB A;  3PQJ A;  4RM2 A;  4CGZ A;  2WY7 Q;  2M9H A;  2O7O A;  1ZAO A;  3HOZ J;  2XAQ A;  3KP2 A;  5DEQ A;  5CJ9 A;  4S0H B;  3I4P A;  2ZO4 A;  1ZG5 A;  5C4J J;  3E5U A;  4MO7 A;  3PSF A;  1FTT A;  2R7V A;  2R7Q A;  2OCC H;  1QVU A;  2XAG A;  2JA6 J;  2VAS A;  2DQR A;  4FX0 A;  3CD6 I;  4I99 C;  4LLG F;  2ZNY A;  3ZMV A;  1Y39 A;  3C1D A;  1WFX A;  4Z2Y A;  1T0F A;  2K4J A;  4A5M A;  3OYD A;  3HIF A;  1LVK A;  3FBN B;  1CF7 B;  2B7E A;  1X2M A;  4E6K G;  3DCF A;  4FE4 A;  3DPL C;  1QPI A;  1WVR A;  1R4N B;  1TZL A;  2HYG D;  1W0T A;  1ZR2 A;  2FBH A;  2MLK A;  4BJT A;  4XQF A;  3LSI A;  1T2K A;  2ZJ2 A;  1FOK A;  3SHF A;  4ENN A;  2KMU A;  1UHM A;  1WH7 A;  1XX5 A;  1ZYR F;  5DD8 A;  4V2F A;  4Q4Z F;  2KRH A;  3TQN A;  4DQ2 A;  3ABT A;  2QSG X;  1ODD A;  1IUY A;  2LY9 A;  3RKX A;  4P55 A;  3KX2 A;  4RDU A;  4ESF A;  1Y0U A;  3RZO J;  4L5I A;  2XSJ C;  3IWF A;  5EG0 B;  1V54 H;  2RC4 A;  2K27 A;  4QIW N;  1ETK A;  4CCM A;  2MLG A;  1S7A A;  1RR7 A;  1KON A;  1S9H A;  1HLV A;  5L3E A;  2WB1 A;  3JRI A;  2O6G E;  2L9S A;  4P96 A;  5FD5 A;  1MSF C;  2QKM B;  2ZNZ A;  1R23 A;  4D5F A;  3LSP A;  1IDZ A;  4M3E A;  3M1C A;  1C0W A;  4RB2 C;  4OOI A;  1Z21 A;  4H0E A;  2GQQ A;  3SFZ A;  1YRN A;  4LJZ F;  3VYT B;  2BY3 A;  3OYA A;  2V1N A;  2AQE A;  5E79 C;  2LY1 A;  4YEL A;  4ENJ A;  1UMQ A;  4I7H A;  4OU0 A;  2L7F P;  3V8K A;  2Z33 A;  3K1N A;  2EZK A;  1IV6 A;  4KFC A;  1REP C;  3OR2 C;  3HKZ N;  4CYC A;  1OYI A;  4DZJ A;  1U8R A;  2STT A;  2ZJR F;  2P7C B;  1O7F A;  2PI0 A;  2IGN A;  1RZ4 A;  2R7D A;  2HQN A;  4XLH A;  5GAD J;  2WWY A;  3HTU A;  1QO0 D;  1WJF A;  2EA2 A;  1TW2 A;  3CTA A;  2RAE A;  1VQK I;  3MWM A;  3GX4 X;  1CF7 A;  3PSI A;  2GIZ A;  4KA4 A;  1MMS A;  3AG1 H;  4FQG A;  4UV8 A;  1G4D A;  1YOV B;  2XF7 A;  3CC4 I;  3BT9 A;  4KIC A;  2XC7 A;  3T0Y A;  1IDY A;  4XKC A;  4HST A;  2JUC A;  4IRG A;  2QF7 A;  2P0W A;  1H9T A;  3KLN A;  5GAG J;  5J6X A;  4FTH A;  3T1B A;  1RKW A;  4C3I J;  1ZLJ A;  4A6D A;  2VJI A;  2ID6 A;  1XGO A;  4HYE A;  2DMU A;  1X4P A;  2R4G A;  2F4I A;  4RGU A;  1BI2 A;  2Y9Y A;  4XOR A;  3KP4 A;  4ETS A;  2XKP A;  2GOX B;  3CQZ J;  3OL3 A;  3RKW A;  1XMK A;  4J01 A;  3DEW A;  4Y4R A;  5F1J A;  4IHT A;  2RQQ A;  1FPQ A;  3BJO A;  4QLC U;  1LE8 B;  2V79 A;  1FP2 A;  2UXX A;  1FYL A;  2XGC A;  2F5C A;  2KZV A;  3OY9 A;  3S1N J;  1FYK A;  2WAF A;  2B63 J;  5D5W B;  4OWR B;  2CS3 A;  2EFP A;  1MH3 A;  2L7M P;  3TMO A;  2NVQ J;  4A3C J;  4F93 B;  2XKO A;  1TT5 B;  4IO9 F;  2HEO A;  2CMP A;  4KDP A;  3SZP A;  5B66 C;  1X19 A;  2GXB A;  2NS0 A;  2XIG A;  1YO5 C;  2A5W A;  3LL7 A;  1ON2 A;  3ZMZ A;  1I5Z A;  3BTJ A;  3JTH A;  4L9J A;  3V4G A;  4P9U A;  1U9O A;  3TKY A;  3CP8 A;  2KIS A;  3VWB A;  1BBY A;  1MW7 A;  2LP0 A;  3MD2 A;  2XAU A;  1GHC A;  1MBH A;  3F22 A;  3MEX A;  3QPL A;  3M9A A;  5E3N A;  3E3V A;  2ZXI A;  4CCN A;  5JLW A;  2CUE A;  4UUV A;  2CQN A;  2CQX A;  2RDP A;  5F08 A;  5B1B H;  3SEQ A;  3TO6 A;  5L3B A;  4W1U A;  3F8B A;  2WTE A;  1A6I A;  2OBP A;  4BBR J;  3QP5 A;  4M74 A;  1TW3 A;  4G7O F;  1OR7 C;  1P2F A;  3OYM A;  2GLO A;  3BPX A;  3OOU A;  3MKZ A;  2XPU A;  3F6O A;  5F0F A;  4UUS A;  2OJE D;  2EB7 A;  2O0Y A;  4XLA A;  3LSK A;  2HKX A;  4ZZL A;  3O2P E;  4XID A;  3HUG B;  4DOZ A;  2HVQ A;  4IKF A;  1PP8 F;  2ELH A;  2BHY A;  2R5Y A;  5EJC A;  3OYK A;  1IJW C;  3BTI A;  4RB3 C;  2KFD A;  4HX7 A;  4HF2 A;  3I53 A;  2DDA A;  2A05 A;  5D8K B;  3OYF A;  5GTH C;  1S6L A;  3FMQ A;  3K4C A;  3CJT B;  1WKM A;  3GLL A;  1VQ8 I;  4A0Y A;  2WB1 N;  2NYX A;  3VFZ A;  1D0Z A;  2LBF A;  2VLA A;  1QNT A;  1W5S A;  1Z91 A;  3GTJ J;  5F64 A;  1OCZ H;  1WJE A;  2GOM A;  4XIC A;  2XDV A;  4CHU A;  4IHV A;  2AXT C;  4IPA A;  3LAP A;  2WV0 A;  4XN3 A;  2KJC A;  1LB2 A;  3A01 B;  3TED A;  2ZBK A;  2COM A;  3MMY B;  3BTC A;  4AVP A;  1YS7 A;  1P6R A;  1XPX A;  3CCJ I;  4YFK F;  1IN5 A;  5FKL A;  3MKL A;  1IN6 A;  2MG4 A;  1YJ9 I;  2DO7 A;  1MBJ A;  1AWC A;  1QA6 A;  4O5V A;  3A0H C;  3P9C A;  4PFP A;  1SMY F;  3BWG A;  2LY2 A;  2LTP A;  3VOD A;  4HV6 A;  3BZK A;  3S16 J;  1XN7 A;  3IP4 B;  2ID3 A;  4BDY A;  3F3X A;  1TQP A;  2OD5 A;  4LK1 F;  1TP4 A;  2CFO A;  2PMH A;  4LG0 A;  3IV5 A;  2JA5 J;  2ZSI B;  2CV2 A;  1LUJ B;  3HPG A;  1FZP B;  2TCT A;  3ZQI A;  2HYJ A;  2KRC A;  1XGS A;  4N0B A;  1P9Q C;  1WCM J;  2BXZ A;  4M3D A;  2Z5U A;  1X1C A;  4PDK A;  3MZY A;  3EUH A;  3CCM I;  1RC9 A;  3BP8 A;  5IP7 J;  2QQA A;  3L2U A;  4EJV A;  4BNC A;  2ELK A;  2M4K A;  4FET A;  3K69 A;  2MA3 A;  1SVM A;  2YR2 A;  3K9T A;  4LIU A;  3S2W A;  2Y0M A;  3I56 I;  1R71 A;  2JJ7 A;  4OIQ F;  1U5T A;  1MND A;  3ASO H;  1G2H A;  2F48 A;  3PNT A;  3R0A A;  1KYW A;  1UCR A;  2EV0 A;  4ESJ A;  2VIX A;  2MGQ A;  1KA8 A;  4RAF A;  3CF2 A;  3F8F A;  3PJR A;  1W7P D;  2PQ8 A;  1WJD A;  2DLL A;  3HHG A;  3S32 A;  2E2J J;  3SJM A;  4M9S A;  3I3L A;  2Z2S B;  3JRG A;  1FP1 D;  3JR9 A;  5DUK A;  4XLE A;  4E7J A;  4IL6 C;  2ZJP F;  5K1Y A;  3ABL H;  1QVT A;  3WU0 A;  2XGE A;  3WE3 A;  5EZH A;  1UFM A;  2JMW A;  3FBI B;  3K4J A;  1B4A A;  3C2G A;  2RGV A;  4DGW B;  3VB2 A;  3LFK A;  3M8J A;  5AIP A;  1I3A A;  4UUT A;  2H6B A;  1UG0 A;  2MAB A;  4B1R A;  3TW6 A;  1TWF J;  2LF7 A;  3NEU A;  3WGI A;  3OYL A;  2WAD A;  2ESN A;  3DTI A;  4RGS A;  5CLS A;  3FDY A;  2L4A A;  2DFI A;  2VUM J;  3AG3 H;  4XRM A;  2PG4 A;  3CMA I;  1O3S A;  2BBY A;  3KET A;  2STW A;  1Y1W J;  1OLT A;  3Q9S A;  1AHD P;  1A35 A;  2BY2 A;  3L2Q A;  5LHG A;  2W84 A;  4NB5 A;  3MVP A;  4EJW A;  4YG2 F;  4G7Z F;  1SD5 A;  3X2Q H;  2BVL A;  3SFI A;  4N4O B;  2ELJ A;  4GCV A;  1YE9 A;  2BW3 B;  1T38 A;  3OYE A;  4LB5 A;  3L09 A;  4XM3 A;  4IHW A;  3WU1 B;  2VQC A;  3H9J A;  3CMY A;  2HZT A;  3KE2 A;  3CJR B;  2V4J C;  2LMD A;  3JAM Z;  2JN6 A;  3J7Z I;  1X1B A;  3GBG A;  4L0Y B;  5E8G A;  1E2X A;  2XHK A;  1LJ9 A;  2Y75 A;  5IT9 Z;  4U0W A;  1I27 A;  3S17 J;  2KDZ A;  3KEY A;  3DP7 A;  3ZMS A;  2BGC A;  3O8H A;  4Y17 A;  2C6Y A;  4N9H A;  3ECO A;  3Q5F A;  1WGX A;  2JVH A;  3D5S C;  3LA7 A;  3HHH A;  3L2V A;  2X51 A;  1BW5 A;  4HA8 A;  1XSX A;  1Y1V J;  3A03 A;  1E0E A;  3S3M A;  2FQ4 A;  4BL0 B;  4XOT A;  1JT0 A;  5IT9 K;  3CUQ A;  3NAR A;  4C9Y A;  3G4S I;  2JTV A;  4I98 B;  1JE8 A;  3FXM A;  2MSY A;  1VQM I;  3HSF A;  2XB5 A;  3JRA A;  2O03 A;  3JRE A;  2GA1 A;  1RES A;  4CCK A;  2HFH A;  2KDO A;  3U2R A;  4HDU A;  4F55 A;  5D6F A;  2EZI A;  1G59 A;  2KJB A;  1D1A A;  3DEU A;  3S93 A;  4ZDO A;  3RIR A;  1FOX A;  5HLT A;  3IL2 A;  5LEK A;  4M73 A;  1ZLK A;  3K1P A;  1HA8 A;  3VEP A;  2DT6 A;  2XV4 S;  3WTY C;  2AO9 A;  2FE3 A;  2VQH A;  2LC2 A;  3FXR A;  2XRO A;  2V26 A;  2Y2Z A;  3VSK A;  3Q0V A;  5D5U B;  3MKW B;  4PSW A;  1V5E A;  5TRD A;  2R7S A;  4EJO A;  1FOW A;  2M3A A;  4P5O A;  5C4X J;  2LKX A;  4U7B A;  1SFX A;  3BR0 A;  4KIF A;  1X3U A;  2LR8 A;  1ZRC A;  3AL0 C;  3GO5 A;  2FBI A;  4IX7 A;  3H5R A;  4AYB A;  4A3B J;  4HPQ A;  1WH5 A;  5EGO B;  2FU4 A;  4GFB A;  5J47 A;  5GAH J;  3ZQQ A;  3DV8 A;  4B09 A;  1Z77 A;  4MLO A;  4IHS A;  3M3Y J;  2QEN A;  2PFB A;  2XGD A;  2DQL A;  4A3M J;  4KN7 X;  1PUF B;  1V55 H;  1P7J A;  3ZP5 A;  3HDD A;  1QPM A;  3RPU D;  2ISY A;  3DPU A;  1UB9 A;  4XK4 A;  1N75 A;  4PCQ A;  1ETO A;  1WI3 A;  5JR3 A;  2H27 A;  2Y30 A;  3I71 A;  3CCV I;  1QZY A;  1DU6 A;  2E5N A;  5F0H A;  2X85 A;  3EET A;  5ILS A;  4HF0 A;  3W6K B;  4A93 J;  4IOA F;  2FXA A;  3S1R J;  3ONQ A;  1R6R A;  1F36 A;  3OYC A;  1S72 I;  2M8E A;  1FIA A;  2A5Y B;  2Z9O A;  3F9K A;  1EH6 A;  2JA2 A;  1DP3 A;  3ZQF A;  2L2O A;  4Q48 A;  4RMN A;  1VQ6 I;  5KCM A;  5F27 A;  1MD0 A;  2ZFW A;  3K4N A;  3EPZ A;  3N05 A;  3PIP F;  1A6Q A;  1YIJ I;  5E1W A;  4DYR A;  1UZC A;  1YW8 A;  4E70 A;  2CW7 A;  2IS6 A;  2V6C A;  1NG7 A;  5FGM A;  2P7V B;  4LG3 A;  5DM7 F;  2R7R A;  3I59 A;  2QYO A;  4BJ5 C;  2QVO A;  1R1U A;  4HX4 A;  2HDC A;  1D5Y A;  2VC1 A;  4P9F A;  4HRI A;  3L2W A;  3H3V K;  3LSH A;  3OYJ A;  1K6O A;  1MSE C;  1V5G A;  5FRO A;  2GIV A;  1GVD A;  2M8G X;  2VKE A;  1FMV A;  1VZ0 A;  2UV1 A;  2ZFU A;  3ZRG A;  1P92 A;  3H5N A;  3ASN H;  4NBQ A;  3S14 J;  2VQL A;  3ML6 A;  2OAZ A;  4B3X A;  2H1K A;  2Q2E B;  1ON1 A;  1Z1D A;  2PJP A;  3LOC A;  3RPQ A;  3M07 A;  1Z7L A;  3ZN1 A;  3FKJ A;  4F3Q A;  4HLY A;  1IAW A;  3GTL J;  1R22 A;  5K5Q A;  2R0Q C;  4DZP A;  2IS1 A;  3HOX J;  3OR1 C;  4WXD A;  2KL4 A;  3DFG A;  1SFO J;  3A1Y A;  3ZN0 A;  4FCY A;  3UKG A;  2D5V A;  1T8I A;  3HPH A;  2FML A;  4ANJ A;  5EGO A;  1VQO I;  4F92 B;  2KPM A;  5HS8 A;  1NHA A;  2QKL B;  3I9V 2;  3F6V A;  4IHY A;  2K9N A;  3KZY A;  3J80 Z;  1ZQ3 P;  5HOO A;  2R7U A;  1YW9 A;  4PK4 A;  1P7I A;  1G6N A;  3W6J B;  4W97 A;  4X6A J;  1YX5 A;  2ZSH B;  3KCC A;  3IRQ A;  3TBI A;  3FMR A;  2VJ5 A;  1NTC A;  3MCZ A;  1JKO C;  4EAT A;  5EEG A;  2JPB A;  1L3L A;  1DU0 A;  1JHH A;  2HQR A;  1UHW A;  2M87 A;  2Q0O A;  4BQQ A;  2HR3 A;  1J7K A;  2DT7 B;  2XVC A;  1D5V A;  1Y56 A;  2A3S A;  3K2A A;  3FXU A;  4EVI A;  2PMU A;  2BY0 A;  3VSL A;  1RUN A;  2XF6 A;  2WAQ A;  1QZZ A;  1MDM B;  1FY7 A;  1ENH A;  4NC7 A;  1R58 A;  1YFH A;  3A0B C;  2FOW A;  1BA5 A;  1B59 A;  3M8F A;  3KYC B;  3A4C A;  3GVA A;  5HOD A;  3BJA A;  3M4O J;  1WWX A;  3F8C A;  4MIM A;  2JA7 J;  2X6Y A;  1O3R A;  3NRV A;  3H0G J;  4WK8 F;  3VYU B;  1QRY A;  3DU6 A;  3E6B A;  2W00 A;  3HOW J;  2VOP A;  4ENM A;  2FJ1 A;  1KGS A;  5GTI C;  1WJA A;  5K7F A;  5EDN A;  1RKT A;  1V3F A;  4HF1 A;  4BXF A;  2COB A;  5DUI A;  2MD0 A;  3LST A;  1K4S A;  3HL2 A;  3WG9 A;  3PM1 A;  3DWL E;  1WJC A;  4RLQ A;  3W3C A;  4F91 B;  1E3O C;  4CA0 A;  4EM0 B;  1EJ9 A;  3BR1 A;  4EGY A;  3H36 A;  1EA3 A;  2HPM A;  2ZXH A;  4CYD A;  3S8P A;  3DU5 A;  2Y48 A;  3R0J A;  4HZF A;  4BH9 A;  1PUE E;  2P5L C;  1JKP C;  2O8K A;  4WCG A;  2P81 A;  1TQI A;  4ZYG A;  2OA4 A;  1JGG A;  2RVC A;  3BLY A;  1TT0 A;  4B47 A;  2JSC A;  5TIS C;  3PUB A;  3GCM A;  4WXC A;  3IWZ A;  5HDG A;  5D4R A;  2DN0 A;  2L02 A;  4G6T B; 
#chains in the Genus database with same CATH homology
 2VPL A;  3LMM A;  4ZDL A;  2L7K A;  4XON A;  2WAE A;  3CP8 A;  3VWB A;  1MW7 A;  3MD2 A;  2LRE A;  2XAU A;  2O5R A;  2HU9 A;  4DJA A;  2M7A A;  4HG2 A;  4Y33 A;  1WJ5 A;  3IAM 2;  2ZXI A;  4CCN A;  3OS2 A;  1X4O A;  1QU3 A;  3KYL A;  3SEQ A;  3DPT A;  2E5Z A;  2WA0 A;  2X1D A;  2KP6 A;  3PFY A;  1T0F C;  3ZCO A;  4XNF A;  2L5Q A;  3H5A A;  4E4H A;  2VKH A;  1OR7 C;  1J09 A;  2XF5 A;  3OYM A;  3OOU A;  3MKZ A;  3IAS 2;  4R79 A;  2V7F A;  3NWT A;  4XLA A;  1MMG A;  3LSK A;  4E7Z A;  2UWM A;  2M4G A;  2X1E A;  3HUG B;  3UNG C;  4CUG A;  3W2W A;  3H9G A;  4IQ4 A;  4DOZ A;  2HVQ A;  2X6X A;  4IKF A;  4J00 A;  3LFU A;  3OYK A;  2HQA A;  4IQJ A;  4CH7 A;  3OYF A;  5CQG A;  4BE2 A;  3K4C A;  4BGD A;  3L2R A;  2VB6 A;  1D0Z A;  2IXS A;  2LBF A;  2M0M A;  2R7O A;  2AQF A;  2VLA A;  2LH9 A;  4BS9 A;  2OUM A;  2E1M C;  2CH0 A;  1WJE A;  2GOM A;  3OYH A;  2XDV A;  2LYC A;  4OAZ A;  3SYT A;  2KLO A;  4YRV A;  3ZR8 X;  3QOE A;  2CW8 A;  1MMA A;  4XN3 A;  4AVZ A;  3MMY B;  2VKD A;  3H35 A;  4BU2 A;  3ZGK A;  2RRE A;  4HEA 2;  3NWS A;  5KNL A;  1FMW A;  4C30 A;  3CP2 A;  4QPO A;  5HNH A;  4PFP A;  4Y3O A;  2LY2 A;  3E1S A;  2HZD A;  3IP4 B;  3LSG A;  4BDY A;  1UEL B;  3VYR B;  1NG6 A;  1DGW Y;  2CFO A;  3BG6 A;  2CV0 A;  4HNT A;  2PMZ A;  2ZSI B;  2CV2 A;  4PUS A;  1X1A A;  3HPG A;  4AU7 A;  4B43 A;  4CCJ A;  2W7N A;  4XLF A;  3OMY A;  2KQR A;  2KRC A;  2E1M B;  3HC7 A;  1P9Q C;  4II3 A;  3HOT A;  1X1C A;  4BQN A;  4ZTJ A;  3L2U A;  2M4K A;  4FET A;  4LIU A;  1X1D A;  4D9J A;  1MND A;  2F6C A;  5JHF A;  3K4K A;  3PNT A;  4PJM A;  4OAY A;  2VIX A;  1ERD A;  3ZXS A;  4FAS D;  3A2K A;  3PJR A;  3CF2 A;  3HG9 A;  3S32 A;  1WJD A;  4D1Q A;  4XN0 A;  3W2A A;  1PJR A;  3I3L A;  2Z2S B;  3OL4 A;  4XOP A;  2IGM A;  3H9Q A;  2IS2 A;  3BCA A;  4XLE A;  3OYN A;  4E7J A;  3K4B A;  4CSW A;  3CZ6 A;  4ZTF A;  3AKZ A;  5LFA A;  2PJR B;  3FBI B;  4NUB A;  4BE0 A;  3BCB A;  3K4J A;  3OS1 A;  3K70 D;  3C2G A;  4XR6 A;  2HVR A;  4DGW B;  4H4K C;  3M8J A;  4P1W A;  2IS4 A;  2I8D A;  3K10 A;  1UG0 A;  2MAB A;  1D0Y A;  3TL4 X;  4CZC A;  1G8X A;  3OYL A;  4NNJ A;  1YX3 A;  2WAD A;  3DTI A;  1QHH D;  3AFH A;  3FDY A;  3K4L A;  1QHG A;  1BR4 A;  3CMM A;  1Y6I A;  1OLT A;  2X6W A;  3K70 C;  5KHD A;  5LD2 C;  2LRD A;  3L2Q A;  2VL8 A;  2V6E A;  2MC4 A;  3DLA A;  2BVL A;  2F5V A;  4N4O B;  2ELJ A;  2WBM A;  3DKY A;  1YE9 A;  4DBR A;  2BW3 B;  2R7W A;  1N78 A;  3OYE A;  4JOM A;  4ITV A;  4XM3 A;  1T95 A;  2VQC A;  3H9J A;  3CJR B;  2V4J C;  5FRM A;  2CUJ A;  3OIQ A;  1X1B A;  3GBG A;  3QYB A;  4NC8 A;  1N77 A;  4XL9 A;  3E0J B;  1BR2 A;  4BDZ A;  3KEY A;  2W1O A;  3G2B A;  3OYG A;  2CV1 A;  2Z16 A;  2DCE A;  4GRI A;  2JVH A;  3D5S C;  3RCO A;  4X0G A;  3L2V A;  2WY8 Q;  2X51 A;  1MMD A;  3DEE A;  1E0E A;  3S3M A;  4BL0 B;  3BG7 A;  4XOT A;  3EUK L;  4XKV A;  3K6G A;  4C9Y A;  3VDX A;  1JI8 A;  2W82 A;  3S3O A;  2RNG A;  4B48 A;  2K3P A;  5FRN A;  2W4S A;  4DBQ A;  5CQE A;  4CCK A;  3OYB A;  4E7K A;  4HSR A;  2KDO A;  4BEH A;  3QOD A;  2VQG A;  4F55 A;  2CUZ A;  1G59 A;  4KJZ A;  3U21 A;  3J7A Y;  1D1A A;  3S93 A;  4ZDO A;  2K9L A;  1V5F A;  5HLT A;  3HKZ A;  4DIQ A;  1HA8 A;  2DT6 A;  3DQV C;  4LIV A;  4PJL A;  3OS0 A;  2VJJ A;  2IGO A;  3DKX A;  3PNV A;  2VQH A;  2LC2 A;  2HVS A;  2V26 A;  3VSK A;  3MKW B;  2PJR A;  4PSW A;  1V5E A;  2Q1Z B;  1GLN A;  4ZC3 A;  2R7S A;  2MFZ A;  1SAU A;  4F52 A;  2BOL A;  3D5R C;  4U87 A;  3VYS B;  2M3A A;  4P5O A;  5HVQ C;  4U7B A;  2Y0S A;  3IUO A;  4RM3 A;  4CCL A;  1PYV A;  3AL0 C;  2DJI A;  2OC6 A;  4BUP A;  4IX7 A;  2KHM A;  3H5R A;  3OIP A;  4AYB A;  1MMN A;  4HPQ A;  2K9M A;  3H0D A;  4BAC A;  4E7I A;  1ZEL A;  3ZQQ A;  4MLO A;  3HOS A;  4ZDP A;  4E7H A;  2OV7 A;  1BOB A;  3QYF A;  3RPU D;  2LBF B;  3DPU A;  1DQU A;  1N75 A;  1Z3Y A;  4KT6 A;  1W36 D;  3RQ4 A;  2A6T A;  2LG4 A;  1AA7 A;  4LIT A;  4IZZ A;  4E7L A;  4RLF A;  3EUH C;  1U0J A;  2VXD A;  2E5N A;  1LFP A;  2X85 A;  4RM2 A;  2V9K A;  3EUA A;  2WY7 Q;  1SFK A;  2L9N A;  3RTR A;  1W36 C;  3DTK A;  3PSF A;  4N4N B;  2R7V A;  3ONQ A;  1R6R A;  3OYC A;  2R7Q A;  5TGT A;  2VAS A;  3AL0 B;  4C2T A;  3F9K A;  2JA2 A;  1DP3 A;  2L2O A;  4RMN A;  1WFX A;  4PJJ A;  5KCM A;  3K4N A;  3N05 A;  3EPZ A;  2NOJ B;  3OYD A;  1LVK A;  3FBN B;  1D0X A;  2CW7 A;  2IS6 A;  4E6K G;  1NG7 A;  3DPL C;  2BVM A;  4NQW B;  3CJQ B;  2LOO A;  4LG3 A;  2R7R A;  1TZL A;  4BJ5 C;  4BJT A;  4XQF A;  3C2H A;  3LSI A;  4HRI A;  3L2W A;  4BQO A;  3LSH A;  3OYJ A;  5CKT A;  1V5G A;  4QPQ A;  5FRO A;  4BJ6 C;  2KMU A;  1IRX A;  4YEJ A;  3SEZ A;  1UAA A;  2JSP A;  1FMV A;  1VZ0 A;  2UV1 A;  1BR1 A;  2KRH A;  2ZFU A;  3ZRG A;  2R7X A;  3H5N A;  4PFO A;  2VQL A;  3RSN A;  4B3X A;  4II2 A;  2Q2E B;  2JVG A;  4XKW A;  3D5L A;  3KX2 A;  2HPI A;  4BE1 A;  1Z7L A;  4F3Q A;  3FKJ A;  2XSJ C;  4XKB A;  2IS1 A;  3OR1 C;  4CCM A;  4ZYA A;  2KL4 A;  1LKX A;  1MNE A;  5CPR B;  3SDB A;  4E7S A;  1KON A;  3A1Y A;  1S9H A;  4XMY A;  2X1C A;  2WB1 A;  3HPH A;  4ANJ A;  2L9S A;  4F92 B;  3PL8 A;  2QKM B;  2KPM A;  3UR3 C;  2QKL B;  3I9V 2;  3M1C A;  1D1B A;  2M7B A;  3HXL A;  3OWT A;  1Z21 A;  4XLC A;  5HOO A;  2R7U A;  3VYT B;  3OYA A;  2IGK A;  4PK4 A;  2V1N A;  1K6Y A;  2AQE A;  1YX5 A;  2ZSH B;  2LY1 A;  4YEL A;  3TBI A;  4HNU A;  2VJ5 A;  3BC8 A;  2Z1D A;  4EAT A;  1D1C A;  2R7T A;  3LSM A;  4B44 A;  2VJ4 A;  4BQQ A;  3OR2 C;  2DT7 B;  2E60 A;  1Y56 A;  1WJB A;  3VSL A;  2XF6 A;  2WAQ A;  3OYI A;  2IGN A;  2MYS A;  4XLH A;  4NC7 A;  1WJF A;  2UUZ A;  2K5C A;  2DOA A;  2JUG A;  1LDK B;  3PSI A;  4C2U A;  2VXZ A;  3A4C A;  2XF7 A;  3QYE A;  4PJN A;  2X6Y A;  2XC7 A;  4XKC A;  3MKY B;  4JQF A;  4HST A;  2HDW A;  3VYU B;  2P0W A;  3DU6 A;  3W2V A;  3SZG A;  2W00 A;  2BW3 A;  4KIS A;  1Z3X A;  1WJA A;  2VJI A;  3V42 A;  1X4P A;  2R4G A;  2F4I A;  3PNY A;  4BXF A;  2MD0 A;  3HL2 A;  3CES A;  4XOR A;  2FUG 2;  3DWL E;  4ZJZ A;  2DXI A;  1WJC A;  4RLQ A;  3W3C A;  2GOX B;  3OL3 A;  4F91 B;  4CA0 A;  4J01 A;  3K4M A;  2HPM A;  1EA3 A;  4Y4R A;  2ZXH A;  2RQQ A;  3S8P A;  3DU5 A;  4KIT B;  4CCO A;  2KZV A;  3OY9 A;  3S3N A;  2WAF A;  4BEH B;  2HNH A;  4OWR B;  3BLY A;  2CS3 A;  1TT0 A;  1DGR M;  3TMO A;  4B47 A;  4F93 B;  5HNF A;  3PUB A;  3FHN A;  2CMP A;  1X19 A;  4PSX A;  2A5W A;  3LL7 A;  3DTE A;  4G6T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...