4NQWB

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
FELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECF RNA polymerase sigma factor SigK
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/protein binding
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nqwB00
4NQWB 2Q1ZB 2Z2SB 3HUGB
chains in the Genus database with same CATH superfamily
1QNTA 4MHGA 2KT0A 1NG7A 4XLAA 2R7ZJ 5EGOB 1IRGA 1I27A 1U8RA 2XSDC 1W5SA 2R7VA 2X51A 3VPRA 2IS4A 3M8JA 2CWEA 5JHUA 1WFXA 2L9SA 3U2RA 1DP7P 2O61A 2L4AA 2F48A 4LK0F 4UNOA 4XICA 1QA6A 3R61A 2PG4A 1ETKA 1YITI 2HU9A 4KN4X 4NQWA 3PNTA 3A02A 1MGTA 2AQFA 5F04A 1R49A 3ZQCA 4GYGA 1Z6TA 1TL8A 4V2GA 4D5CA 2HFHA 3OYEA 2FA5A 4IKFA 2PJRB 4I0AA 2JVHA 4XOPA 4HBLA 3FBNB 1MZBA 1X2MA 3TMOA 2GWRA 2OF7A 1UHSA 2MW8A 2M7AA 2OD5A 2X9DA 3H5NA 3MMYB 4LLNA 2YU9J 5L3BA 3OS1A 3M9AA 1W7PD 2XROA 1MMAA 1T08B 4UB8C 5HNFA 1BL0A 4F52A 2P5LC 3IRRA 3C18A 5KAFC 4EMSA 3WODF 4DNCA 2Y69H 1UAAA 2L02A 1DPRA 4Z6YA 5E20A 1ETOA 2RV8A 2QM3A 4O6JA 1ZR2A 2HVQA 4G8XA 3VWBA 2MC4A 1IV8A 5ICFA 2FSWA 2D1VA 2L9NA 5BNGA 1YO5C 2JVGA 2OQGA 3FXMA 3PSFA 1SD4A 2ZXHA 4B44A 4G9YA 3V8JA 5F64A 2W57A 2QF7A 4P5OA 3UR3C 2QENA 1ZQ3P 3CC2I 1I1SA 3LA3A 2P0WA 3H3ZA 4CUGA 4KITB 2EZHA 5LHIA 3MZYA 4AM3A 1G3YA 1VNDA 1F4KA 2ID3A 4XSZF 3HRUA 1R5HA 2LREA 5EEAA 1B8IB 1R5GA 3H92A 3ZQQA 3F21A 5BPIA 3TO7A 3DLLF 2K4JA 3WGHA 5AIPA 1IG7A 3PO3J 3E97A 4IO9F 4HEA2 4PJ0C 2F5EA 1LUJB 3JRBA 3DXJF 2LKPA 3ELKA 1HW5A 1S6LA 1S9HA 2CW0F 4CYCB 2COMA 2DMQA 4LK1F 2I10A 1FT9A 3K1NA 1SFUA 2EV5A 3KZIC 5FKLA 2VN2A 3BDDA 3J7AY 1GXPA 2FE3A 2QKMB 2HVRA 4DIQA 2QEXI 4I76A 3DEUA 2WB1N 2KZGA 3PJRA 1VQPI 3VB2A 2E35A 3ZXSA 3BR0A 1SVOA 3QODA 1WJCA 4EM1A 1FSHA 3PIPF 2NVTJ 4RAZA 2E1MC 1EA3A 3AG2H 3CP2A 2BBYA 2M0CA 2ZMEC 1ETXA 2IGNA 4EEFG 4PDKA 1YRNA 4AVZA 2ISZA 3S2WA 2Z99A 1YJ9I 3A01B 3GFIA 2L5QA 1MH3A 4U0YA 3DEWA 3FXKA 1K78B 4G7ZF 3ZP5A 1XG1A 5E17F 3V8KA 1WQ2A 4HA8A 3SEQA 4ZYHA 3EPZA 3NRVA 3OYGA 3L7WA 4D0PA 5BQTA 5C44J 2IEKA 2IA2A 4RDUA 3WU1B 2XPVA 3S2DJ 1A6QA 5DDGA 3R0AA 5DYMA 5J47A 1FIPA 5LHGA 3R4KA 1H89C 4FASD 1OMIA 4CCOA 1XGNA 3CF5F 2JQ7A 2NVXJ 1KGSA 3MKLA 3WG9A 4HYEA 5HLIA 3FISA 2OA4A 3T1BA 2IBDA 4RGUA 5KCMA 3OYIA 1GT0C 3JAMK 1R23A 3P9KA 2QBYB 3GTPJ 4DGWB 2XC7A 3ML6A 4XLHA 2PI0A 4D9JA 1JKOC 3KEQA 4YELA 2XPUA 2LK2A 3OYLA 2R7XA 1JT0A 4IRIA 3S1NJ 1NHAA 4BGDA 2H1LA 2V4JC 1D5VA 1MMSA 3QRFF 2W25A 3CDHA 1F1ZA 1Z7LA 4XKVA 4HNTA 1REPC 2KISA 5HVQC 2NVUB 2MYSA 3E5QA 3K6GA 2EPFA 3EYYA 1D1AA 1VQ8I 3E0JB 5K7ZA 3L2UA 4L18B 1ETQA 2VBXA 5CPRB 3F0CA 5DUKA 1RESA 4MGRA 1GHCA 3AG3H 5FFXA 3DBLB 5K5RA 1Z91A 2WY7Q 2K02A 3R60A 1B1BA 1R36A 2DT6A 5L3DA 4MFDA 2ZNYA 2E2IJ 3KIOA 2DT5A 3RPQA 4A3JJ 2EFNA 5ILVA 3MKWB 2O3FA 2MG4A 5TRDA 1EJ9A 3N97A 3CQZJ 1XSXA 2F4MB 3S93A 2FX0A 3EUKL 1USTA 3H9QA 4N4NB 3GTKJ 2M5WA 2K9LA 2DT7B 3CJNA 1KQ9A 2L9RA 1JTYA 2HZDA 1B72A 1X19A 3CLOA 3TKYA 4W1UA 5CVUA 1V3FA 1LKXA 3ZMZA 4MNUA 1YI2I 4A12A 5D6FA 2RGVA 3C2GA 1Y1VJ 2XB0X 1HDDC 6PAXA 3G3ZA 1VF9A 3HRSA 1TT0A 5KNLA 3ZCOA 1W5CC 1X1CA 5E3MA 2KQRA 1LFBA 1LDJA 3QOEA 1A35A 1A04A 2QWWA 1OYYA 1MNEA 1I5ZA 4MLOA 3BG5A 2DMUA 3O2PE 3TP0A 2M34A 4Y15A 2XAUA 2E71A 3JSOA 1MH4A 3KP5A 3HJEA 5HDGA 1KZHA 2F5VA 2R7UA 4I02A 4M6XA 4M3BA 4HQMA 2HKXA 2BW3B 3A1YA 3HGYA 1XDUA 4CGZA 2AO9A 3MEXA 4M3DA 1O7FA 4GO1A 3CF2A 1IDYA 4L5EA 4PJNA 2EFPA 3M07A 3HTUA 3I56I 4G7OF 2RNGA 4ZH4F 5ILUA 2MH9A 3LA2A 4PCQA 2WWYA 2R4GA 3S1RJ 1XPXA 2GXBA 1SAUA 1ZARA 4Y7NJ 3BC8A 2DW4A 2PQ8A 3KP3A 4BJ5C 3BT9A 2YUSA 3C7JA 3ROUA 2BY2A 1VQ6I 1ZH5A 2FNAA 2KRFA 3H9GA 3O3KA 4MFEA 1B6AA 5LGTA 5KVRA 1WI9A 3QPHA 1G4DA 2M8EA 2K7LA 5LGNA 2YPRA 1V5FA 3ECOA 5FO5A 3D5LA 3RCOA 4V2FA 2D45A 2HDDA 3SQNA 2W1OA 3M1CA 1BIBA 2V1DA 1RKTA 5LFAA 1ONVA 3OR2C 3J81Z 3LSRA 1PYVA 1S7EA 4RM2A 1NK2P 1KONA 1QHHD 4ZTFA 1FSEA 4A2UA 5HLGA 2R92J 5K7HA 2XGEA 3CP8A 5J8FA 3PL8A 2IT0A 3S32A 2OC6A 5M3FJ 3CUQA 1ON2A 3TDZC 2LD5A 4ESJA 1MDMA 2FUG2 3OIQA 4BJ6C 1SANA 2LSOA 2VBYA 4AIKA 3MWMA 3HL2A 2VBWA 2XGDA 1W36D 1UJ8A 4HF1A 1WJDA 1MMGA 1U0JA 2V9KA 2LVSA 4PSWA 5E1WA 5TJJA 2TRTA 2LP0A 2Y0MA 1FTTA 3Q0WA 3SEZA 2AXLA 3FXOA 1YS6A 5JVGF 2W00A 1X1BA 2K3PA 1VQKI 4I0BA 4FQGA 5FGMA 3TO9A 4HX7A 4Y13A 3DFGA 1D1BA 2ZKZA 2ZXJA 4BQQA 3K0LA 3WE2A 2NYXA 1IO2A 4M74A 4NC8A 2ME6A 2JJ7A 3LSHA 2J5PA 2R7OA 3LL7A 1ZGJA 2HEOA 5IPAA 1IN5A 3C3WA 5EGOA 2QQBA 3P7NA 4ESBA 3E1SA 2CW7A 2DA3A 2LOOA 2OZ6A 3BR2A 1X2NA 2HKOA 3LQRA 4D7NA 3CUQC 2OCCH 1UHMA 1P4XA 1HF0A 3HOSA 3HBLA 3RIRA 3FM3A 3IUOA 4LLGF 4E70A 3L2VA 3A03A 2XDVA 2E2JJ 3WTSC 2Z1DA 4ASNA 1MBEA 4GYIA 2UWMA 2LKXA 2G9WA 2H1KA 4IVNA 4F7ZA 1IN6A 3KCCA 3W6JB 4WWCA 4QIWN 3QP6A 1OISA 4PGGA 2P4WA 2VKDA 3MD2A 4RLQA 2JTVA 3GZNB 4BE0A 2JMWA 4I6ZA 5B1BH 1YJNI 1MBHA 1FYMA 2XB5A 1I3AA 1JUMA 2I8DA 3LSGA 1I39A 4KT5C 3K4KA 3F8FA 2GBYA 1BC8C 2Z2SB 4FTHA 1VI0A 4ZDPA 4RB3C 1BI2A 2OQRA 4JYKA 2STTA 4UV9A 2K9SA 3FX3A 3BJ6A 1PJRA 2K9NA 3KYLA 3ZMTA 3CDIA 2R7QA 2X1EA 2YSRA 3FXRA 4OMYA 5IOYA 1R1TA 4D7MA 2KIUA 3CCUI 1BA5A 2CUJA 4LG0B 1YX3A 1W7PA 1I50J 3K70D 2V6EA 2K9QA 3I64A 4LIUA 2CRGA 2H6BA 2O8XA 5LRRA 3V7SA 5BPDA 3SZGA 2XAGA 2FQ4A 4DOZA 1SVLA 1EH7A 2Q2EB 4LGWA 1RPWA 3TOBA 4F55A 3GTLJ 1YFHA 1IAWA 2JA6J 1WRJA 1YTYA 2VXZA 4BDZA 4PJLA 4F92B 2PMZN 3A0BC 2QSHX 2HPIA 3J7AO 5EZHA 4UVAA 1A6IA 1R58A 3L9FA 3H0GJ 4IOCF 4BXXJ 2WV1A 4A6DA 3FBIB 4G94A 2P6SA 3KP7A 3PSIA 1Q1HA 4YFXF 1V5EA 3WTWC 1B8IA 4BS9A 2IS2A 2CV0A 3HUGB 1IRZA 3JTGA 1JUPA 4IHSA 4I09A 3DTKA 4BKXA 4FETA 3QYFA 3OS0A 2VLAA 1ZKGA 3GF2A 5M3MJ 1ZRCA 1USSA 4ZJZA 1STZA 4ZTJA 1J7KA 5DD8A 5E1ZB 4GFBA 3PO2J 1Y1WJ 4ABZA 2VKHA 1ERDA 3D5RC 4E7ZA 4Y17A 3GTMJ 2P5KA 1WKMA 2OPTA 1Y0NA 1GDTA 2EZKA 2RC4A 2FQ3A 1FZPB 4QPOA 3ZQLA 1XGOA 2P81A 4KMUX 1DGWY 3MZ8A 4B48A 4BNCA 1S7AA 2EA4A 4Y3OA 1G8XA 2WAFA 4DYCA 5FLXK 3PNYA 1D0ZA 2HOTA 4ENJA 1T33A 3JRIA 2GAUA 4ZYAA 4AUXA 3A01A 3HXLA 1J75A 2MFZA 1ZAOA 4IHVA 1BN5A 5D5UB 4IRGA 4IX7A 4HAMA 2F5FA 3LSJA 4UHTA 5C3EJ 1P4AA 3E5UA 4XBFA 4BAYA 1S3JA 2IP2A 4DQ2A 4BU2A 1YIOA 1XTAA 2DQLA 1XSDA 3H1CA 2Z33A 3RYRA 4RMNA 2XV4S 2IPQX 2KMUA 2KP6A 2JA2A 1ON1A 1VQ4I 3RQ4A 1OCOH 3ABMH 2E1OA 4XRSA 3OYJA 2BVLA 4BEHB 3HOZJ 2ETHA 5CQEA 1WVRA 3GYHX 3A4CA 1I1GA 2MD5A 3J7YJ 2LR8A 4PK4A 3VEPA 2X6YA 3B73A 4Q5SF 3E6CC 3JCUC 1MKMA 4BDYA 1JGGA 1SMYF 1QPIA 2CQNA 2H6CA 3M7GA 2MBFA 4MEYF 2EIKH 3WHCA 4XK4A 4IOAF 1A36A 3I59A 1R7JA 1XX5A 1YYVA 2PMZA 3SDGA 2B9SA 4B43A 3HZJA 4PFPA 3GZ6A 2VQGA 1SEUA 1RI7A 1AOYA 3S1MJ 4KJZA 3IAS2 2K5CA 1TP4A 3V7CA 4ZDOA 3DTEA 1Q1VA 2JSCA 3GX4X 2K4BA 3S15J 4UXNA 2WBMA 2VKEA 2E19A 3KZYA 3QWLA 1HLVA 2KFDA 3QPSA 2CFOA 1TZLA 2P7CB 4YFNF 1ORKA 1VZ0A 2XGCA 3G73A 4G6TB 1QBJA 2VUMJ 5GAGJ 4Y4RA 2M7BA 5J1YA 2A6HF 3ZN1A 2D1HA 4ETSA 3M8FA 3FZVA 2DCEA 1G3WA 1TQPA 3FIWA 3CC4I 3D0SA 3ZGKA 1NK3P 3Q0VA 3ESWB 3NQOA 3GWZA 1GVDA 1IXSB 4CSWA 5GTHC 3SJMA 1XD7A 2ZNZA 2ESHA 2D2WA 3GZ5A 5EJCA 1XB4A 2V6CA 2FJ1A 1T2KA 4CH7A 1HC8A 4KIFA 3EUAA 3BR1A 4ON0A 4U88A 3C1DA 1PUFB 1JHFA 4L9NA 4ENKA 4AC0A 1WGXA 2QLZA 4C3IJ 4X0GA 3ABKH 4QWQA 2HTSA 4B09A 1W4MA 5DEQA 3HKZN 2X0LA 4RGSA 3LSKA 2RN7A 5IT9K 3IP4B 3E5XA 1CF7B 2A6TA 1HSJA 4CICA 3DPUA 3MQ0A 2KLOA 3BG7A 3KP4A 4A0YA 3F6VA 4A69C 5J4VA 1V5GA 2M30A 2GM4A 4ANJA 5BS6A 1G3SA 1IN7A 3IAM2 1LEAA 3HB9A 4KMFA 3SZTA 1MBKA 2R7SA 3DP7A 2R93J 1U2WA 3GCMA 4ITVA 1ZG1A 1ZK8A 3PNVA 1WZ2A 3ZQGA 2ZC2A 2HPMA 2A05A 2CUZA 1Y56A 2GIZA 2LYCA 5ILSA 5J1UA 4RA2A 1TNSA 1N75A 5GTIC 4CXFA 3FXJA 1BM9A 3OL3A 2KIFA 4PUSA 3I4PA 3ZN0A 2VIXA 5M5YJ 1RKWA 2LBFB 1L3LA 3A2KA 1W1WE 2EIJH 4HPQA 4YFKF 3CMMA 1IXRC 2VOOA 4G12A 2KDOA 4FT8A 4YRVA 3NAUA 2Y31A 3FHNA 3B6AA 1YQAA 4WXDA 3VSLA 1OJLA 2M4KA 4YIIA 3ERMA 2FNPA 1XS9A 2DI3A 3QU3A 1BBYA 1ZLKA 4LOCA 1B9NA 3P5JA 5HS8A 1FOWA 4RB1A 4CO8A 1T39A 3KYCB 3GFJA 3F72A 2KIQA 3WHBA 1TTYA 5IYBJ 2WA0A 4KNYA 1KU7A 3LAJA 1Z9CA 2XUBA 4HW0A 4NC6A 4EJTA 4JX4A 4KN7X 3C2BA 4XRMA 4HOBA 1TNTA 1P6RA 2BXZA 2O0YA 2A68F 2PX9A 3M3YJ 1G2HA 4F93B 5B66C 1LE8B 1MJBA 3IH3A 1GXQA 2EA2A 4U7DA 2X85A 3K4NA 4EJWA 5B1AH 4KYWA 2QSGX 3G1LA 3F9KA 3AL0C 3J80K 1RUOA 3HIFA 1OKRA 1MJAA 5ICCA 3WG7H 1TWGJ 5HDKA 5FKOA 2XRNA 5M5WJ 3Q5FA 2DLLA 2FBHA 4HSRA 4M3EA 3TL4X 2VT2A 2Q0OA 3F8BA 4FX0A 3RTRA 2FMLA 2E2HJ 3SZPA 4C9YA 3FKIJ 1P4WA 4A3GJ 1U5TB 2K40A 3FM5A 4R79A 4B3XA 3OOUA 4BH9A 2CUEA 3ZQIA 2ELKA 5K1YA 3OYAA 3KX2A 3FXUA 3RYPA 2EBIA 4MIMA 2FF4A 1WH7A 3UNGC 1BC7C 4IJAA 2CQ7A 4S0HB 4XN0A 1LEBA 4Q47A 5IYCJ 3CD6I 1ODDA 4L5IA 4CCNA 5F6FA 4H4KC 1OFCX 1DU6A 4QPQA 1P92A 1R1VA 1WJBA 2CV1A 1FWZA 2Y30A 2NVYJ 2V1NA 3GO5A 1SD5A 3HM5A 2JUGA 3JAMZ 4WF2A 1K61A 5K5QA 2L2OA 1B4AA 1KYWA 3ULQB 4A6EA 1BW6A 1RETA 2ECBA 2BE5F 2ACJA 1RR7A 1Z3XA 1YW7A 2HNHA 3OV8A 2X6XA 3FK7A 2Q1ZB 3BP8A 4RAFA 1W36C 1IV6A 1UB9A 3SXYA 1HQCA 3U21A 3DKWA 5BMZA 2E7XA 3H35A 2B0LA 2LLKA 5H6QA 4HX8A 1IJWC 2C6YA 1YW8A 1PP7U 1TW3A 4OIOF 2G0EA 2NRAC 4QLCU 2DOAA 3G4SI 4G7HF 1UG0A 2HDCA 3GXOA 2L4MA 3VYTB 1MBJA 2QQ9A 4AIJA 2A69F 1VQNI 3PUBA 2GOXB 5FD5A 5F27A 4EGYA 3WTTC 1SAXA 3FMQA 4ZZDA 3CCLI 4EJVA 3DBHB 2ELHA 4AWXB 5IP7J 1Z6RA 5KAIC 1QRYA 3L2RA 2R7DA 3QYBA 1VTNC 3L1PA 1Z3YA 3K2ZA 5F0HA 2WB1A 2FRHA 3FMSA 2H8RA 3F3XA 4KDPA 4ZZLA 3OYKA 3BJOA 2EILH 1D8JA 2ZSIB 1AKHB 5E79C 1G59A 1WPKA 3K1MA 1XGMA 3GVAA 3VYSB 3CLQA 3ECHA 4GXOA 1IC8A 3BR3A 1D8KA 1MJ9A 2FBIA 4HV5A 1VQ7I 3EUHA 3K7AJ 1XN7A 1T95A 4ZYGA 2OTJI 3QU6A 2GA1A 3ZRGA 1RIOH 1ZRDA 1N78A 1YJWI 4E7KA 4XQFA 2IW5A 5FLMJ 4A3MJ 1S29A 1JXSA 2MSYA 3H3VK 1L0OC 1U8BA 1DGRM 2JPCA 1KQ0A 3ZOBA 2JA5J 2W24A 4F3QA 3K70C 5E8IA 1OPCA 3U9GA 2KHMA 3CUOA 2O5RA 5LRSA 2GA2A 1T56A 2E5ZA 5E18F 5EDNA 3S1QJ 1O3QA 2JA8J 4UUSA 2LFBA 1HW1A 3DBRB 3FF5A 1YLFA 3NWSA 3OR1C 4JBAA 1R22A 1VFCA 3HGGA 5D5WB 1ENHA 3ABLH 1GLNA 3EUHC 5EF6A 2Q8KA 3HPGA 1OQYA 2HXIA 4BY7J 2EFQA 2NXNB 1BI0A 2FU4A 4M71A 4BHBA 2CQXA 4S05A 1FOYA 2R5ZA 3BR5A 3CDLA 2XKOA 2IGOA 4IRHA 1KQ8A 2TDXA 4EV0A 2Y9YA 1MNDA 2NS0A 2VBZA 2NOGA 2E34A 3OYFA 3MCZA 3KLNA 1XDSA 4KISA 4I98B 2M8GX 2ZFWA 2JT1A 5DUIA 2GZWA 2DA5A 3DLAA 4MTDA 2B63J 4FHTA 2EH3A 3Q9SA 2RKHA 2ZCWA 4I7HA 3K1PA 1TWAJ 4M72A 3DU6A 4NBQA 3V7RA 3JRAA 2F6CA 2W7NA 1VQOI 5EZGA 2IRFG 2ZFUA 3W2AA 5ED4A 4Q4ZF 4H0EA 3JSPA 3H5AA 5B3SH 1DUXC 4GDFA 2XKPA 2JRTA 3X2QH 3JRFA 3WTXC 2WC2A 2XSJC 1Z0XA 4N4OB 4HV6A 4IEJA 3KZZA 4RB0A 5CQGA 3HC7A 4OIQF 1V4RA 3VDXA 4YIRX 3LWFA 2VPRA 1T8IA 2QQAA 2ZMEB 4AYBN 3CC7I 4B4CA 1HKSA 5D5XB 2R5YA 5DV5A 3SFZA 3DPLC 1RR8C 3A0HC 1TQIA 3K4BA 1S72I 3QPLA 4LIVA 2K3FA 2AHQA 3Q9VA 1E0EA 3ZQ7A 4Y33A 3KP6A 2F2EA 4U87A 3RI4A 1BI1A 4P1WA 3F22A 4EATA 2DFFA 1QZZA 2EB7A 1QZEA 4IHWA 2BZTA 5EG0B 1PVEA 1U9OA 1Z77A 3V8LA 5FKNA 3CZ6A 3PFIA 5A2QK 2O6GE 2E7WA 4WXCA 1P7JA 1RRJA 2KZVA 1MD0A 4YG2F 1MIJA 3J7ZI 2DODA 2YU3A 2ME0A 2VT3A 2FXAA 2VL8A 2R7WA 1VQLI 2ISYA 1UZCA 1PUFA 3GW2A 2Y75A 3BY6A 2DFEA 3ZMDA 2LTPA 1UELB 1K6OA 5HLHA 2IA0A 2DPDA 5ICGA 1H9GA 2EWNA 3HYIA 1SFOJ 2DJIA 2HYGD 2DFHA 1FJLA 1W0UA 1D0XA 2O7OA 3DKYA 2MH2A 3GFMA 5FKMA 4OIRF 1O3SA 5LGUA 2PJRA 3JTHA 1BR2A 3SYTA 4LJZF 1SD7A 3HTSB 5D4RA 5CLSA 1ZHFA 2M1BA 2OTLI 1O4XA 2QYOA 4IXAA 2NNNA 3TW6A 4UB6C 2QQ8A 3FWEA 5ICEA 2F5CA 3HSRA 4XNFA 2CMPA 3MFKA 4LLLA 1JUSA 1X3UA 2DBBA 4EM2A 2BYVE 2A3SA 2VJIA 3B6CA 4CCKA 1Y6IA 1U3EM 1G3TA 2VJJA 3BG3A 1XMAA 3KFWX 1EH8A 1FX7A 1Y8RB 1CGPA 2FBKA 1JGSA 1FIAA 4B3AA 2FOWA 2H8WA 4U0WA 4UY8I 2CJJA 4G6QA 2OU2A 3HG9A 1PP8F 4CCLA 1C0WA 5LHHA 2QVOA 2GXGA 3GLXA 2NVQJ 3OYMA 3IV5A 3U1DA 2HR3A 4E7SA 4A93J 2DA6A 2KL4A 2HI3A 1S7OA 2A61A 4S04A 1NH3A 4XLPF 4M9SA 2AXTC 1LPQA 2DQRA 5JHFA 3H9JA 4M6VA 5D8LB 2NS8A 2CSOA 2LKSA 4DZJA 3KETA 2NOJB 5J4YA 3BWGA 2VQCA 2M0MA 3F8MA 4A5MA 3JRDA 3H0DA 2HZTA 4HZFA 1JE8A 3QOPA 4II3A 4XKBA 3REOA 5JLXA 3V4GA 4M6YA 1FOXA 5J40A 3FKJA 4ENMA 4AIHA 1S8NA 3R0JA 4CYCA 3CCSI 2DOEA 2M3AA 1UCRA 1OCCH 1AA7A 2MLGA 2YR2A 5D5VB 2XF5A 5H6RA 1B72B 1IUYA 2Z9OA 3SDBA 2DA2A 1SMTA 4I01A 2Y0SN 4RM3A 1BR4A 2DO7A 1HCRA 3HSEA 1J0RA 4O3MA 1GV2A 2HQ5A 3DWLE 4CA0A 2VOPA 4DBRA 1FMWA 3LA7A 1R9TJ 2Y48A 1ITYA 1FYLA 2PMUA 2LNBA 2L7FP 4I99C 3FK6A 5CYVA 2OV7A 5HS7A 1CQTA 3JRGA 3IKVA 4XL9A 5DM7F 3LAPA 2HWVA 1K78A 2R7RA 4M9ZA 2PLYA 3E3VA 2DYSH 3ASNH 4P96A 3L2CA 4D1QA 2V26A 2X48A 3TEDA 2X1DA 3HDDA 1FMVA 2EINH 5J6XA 3CCQI 2DMPA 3G1OA 1QGPA 5FFZA 3TW7A 4NDLA 4X1EA 4LG3A 1ZLJA 4EJOA 3NEUA 4CZZA 3QPTA 1MBFA 2XHKA 4E7LA 2HOSA 2LF7A 2DXIA 1HOMA 1XSVA 3RPUA 1D3YA 2QBYA 3FHZA 2A07F 1I6HJ 3BTJA 2WTEA 3TOAA 2E5NA 1YS7A 2CGPA 2V9VA 2ICWG 3DU5A 2AS5F 3OYNA 4BXUA 2L54A 2YX7A 2VONA 4PJMA 5FROA 2CUFA 3BG6A 2CQKA 1I6XA 4N9IA 4E7HA 4IPAA 5C4XJ 2YX4A 3LNQA 2RQQA 3S2HJ 1EKEA 3GMEA 4HRIA 3BZCA 4AU7A 1ULYA 2BOLA 3G71I 1WJEA 2WY8Q 1XMKA 1WHUA 3BQZA 4FISA 4JQFA 5B5EC 2VC0A 4RS8A 3DF8A 5HOOA 1ZG5A 1XCBA 2BHYA 3B02A 3E6BA 3ABUA 1MMNA 1IW7F 3LMMA 3W3CA 3GTGJ 2ZJ2A 3BTLA 4G6DA 2HQAA 2ELJA 3K10A 4L5JA 4A0ZA 2GIVA 4E7JA 4A3KJ 2X4HA 3RDIA 1LNWA 3CUQB 2XIGA 3T8TA 2G7HA 3IH2A 1MDMB 4BQAA 1M1EB 3WGGA 4HX4A 2OUMA 4DYQA 9ANTA 2K86A 2CV2A 2WAEA 2VPLA 5L3EA 4J01A 5HLTA 2HDWA 2CG4A 2X6OA 3ISPA 4ZDLA 2NS7A 5M5XJ 4L9JA 1FEXA 3S16J 4E7IA 4XRFA 5AONA 1E3HA 1BOBA 3H36A 2EQRA 4A3LJ 4XLFA 5IT9Z 3E6DA 2F4IA 1PDNC 4CDGA 3I55I 3HHGA 2JK3A 3FXQA 2UXNA 4HLXA 1OR7A 3HPHA 2BW3A 4IZZA 1DDNA 3F8NA 4ESFA 4BBRJ 3I4NJ 2BY3A 2KIMA 2STWA 3F23A 3TQNA 1KU3A 2JPBA 1B9MA 4EM0B 2MC3A 1SFKA 4GRIA 2UXXA 2XF6A 1LFUP 3IWFA 1IN8A 4X6AJ 2ID6A 1SC7A 3OIPA 4B8XA 1ZELA 2J5OA 2L7ZA 1QPMA 2DAOA 3I54A 4HLYA 5FD6A 4BBSJ 4A3CJ 2E1NA 2K85A 5DM6F 1N77A 3Q3SA 3NWTA 3GLLA 3CJTB 2PMHA 1R5ID 5GPCA 2HGCA 4RGRA 2VB6A 2XVCA 3BPVA 3BZ6A 1KU2A 2RREA 4HDUA 4C3JJ 3OYCA 1OR7C 2CH0A 4N9HA 4DJAA 1AHDP 1QQIA 1U6GA 3BQYA 4Y52J 4C2MJ 3ONQA 1JKPC 3K69A 1ZREA 2A5WA 4OIPF 4A0XA 2KKOA 1RNLA 5DCMB 4BXFA 1W0TA 1W7PB 1MW7A 4L9TA 1DP3A 5FRNA 1Z67A 1X1PA 4E4HA 2QCOA 4EJUA 4OINF 2R0QC 3ASOH 2V79A 1OLTA 1FNNA 2L01A 2ZB9A 3TO6A 5F1JA 1QVTA 3MZHA 4KUMA 3D5SC 3VSKA 1NG6A 1FP2A 1N25A 2I5UA 1LB2A 3BLYA 1WH5A 3RJPA 1HXDA 1WJAA 3BOQA 2Z16A 1IZ1A 4PZJA 2Y9ZA 2Z3YA 1FTZA 3ABTA 4IF4A 1IXCA 2ZMEA 4XN3A 4KICA 2KRCA 3L2QA 3J80Z 4HG2A 3O8HA 4LD5A 3W6VA 3BTCA 4KIGA 4M9XA 3BJAA 4B47A 5E3NA 2PN6A 2ZJRF 2ADUA 2HOAA 1SD6A 3HKZA 2ECCA 3OOPA 3VYUB 2GQQA 1TQMA 1NTCA 4CCMA 3OY9A 5CVRA 1HKQA 3H5RA 2E60A 1TT5B 3ZQFA 4LB5A 3QP5A 1FC3A 5IY5H 3GTJJ 2NNYA 1K4TA 2MD0A 2HYJA 3RKYA 3DEEA 1K7AA 1YG2A 3L09A 2RDPA 5EG0A 3QQAA 1VQMI 1ETWA 3E6MA 1FY7A 3BR6A 3NARA 4XMYA 1F36A 1PUEE 2IS1A 4IQ4A 5CJ9A 2HYFA 2EZIA 2IAIA 3WU2C 3OYBA 1Z7UA 2FEZA 2KRHA 2ZXWH 3HOTA 1ZYRF 3ZR8X 1H0MA 2QUFA 3CJRB 5HS9A 3OSFA 2PFBA 3W2WA 3W6KB 3RPUD 1A31A 4Q48A 1T38A 1MSFC 3KYDB 3DTIA 2QSFX 2DFIA 3WGIA 3IC7A 1HBXG 1P7IA 4WK8F 3N4MA 2VC1A 1R71A 1MMDA 1WCMJ 2OAZA 3HOVJ 1POGA 3CMYA 3GFLA 1A5JA 4L0ZB 2DA4A 2LDUA 2GXAA 1H8AC 1X1AA 3K2AA 2DK5A 1LE8A 3G1MA 4RLFA 2BY0A 4A5NA 1ZN2A 4KA4A 1IRFA 5F0CA 4U7BA 2LY9A 4BHPA 5FB2A 1TC3C 4CYDA 4ENNA 4I2OA 3MKYB 2KJCA 3CESA 3RKWA 2OCEA 3DQVC 4HSTA 5DS9A 4BE2A 2YS9A 4P9UA 1IGNA 4UVBA 3L2WA 2VASA 1JT6A 2HQRA 4NC7A 5J8CA 2BVMA 3CCVI 3I59B 2XAQA 4LG0A 2DPUA 4DYRA 4CHUA 4A3IJ 2EFOA 3VOEA 3M4OJ 2VQHA 3LSIA 4M3GA 4P55A 3KE2A 1E3OC 1R4MB 1X58A 2Q2EA 2XRLA 2ZXIA 3FXLA 4PSXA 1ZGWA 1U9NA 3PQJA 3HOXJ 3RSNA 1VQ5I 2O8KA 1XCVA 3DPTA 1EH6A 4FCYA 5IT3A 5FLVA 4XIDA 2GOMA 4RB2C 4HDVA 1WJFA 5IOZA 1TBXA 3CTAA 1X3WB 3HOYJ 4B1RA 4YIFA 4LITA 4KIBA 1MSEC 2VJ5A 3WE3A 2DTRA 5HNHA 1UFMA 2R3SA 2IS6A 2W84A 1WJ5A 5LD2C 1BJZA 2AQEA 4RGXA 3HUGA 4DW6A 3D1NI 3BG9A 3F8CA 2H27A 4XRSG 5L3GA 1OCZH 3KEYA 3UKGA 1FOKA 3HEFA 3QYEA 4XONA 3I58A 5CVJA 5HDNA 3GEZA 4JOMA 2IGKA 3K4CA 2L9VA 2MLKA 1V55H 1IN4A 3HSFA 4C2UA 3IRQA 4MQ9F 2DDAA 2W4SA 2P7VB 4WXHA 2BXYA 4EQQA 4IHTA 4A3FJ 5F08A 2F5DA 3I71A 4GCVA 2M9HA 3I5UA 1QO0D 2LY1A 1TWCJ 5GP9A 5EEGA 2H94A 3OYHA 1JI8A 5EEHA 2BHZA 4OMZA 4Z2YA 3P9IA 3VFZA 4M3FA 5KHDA 4A3BJ 1F43A 4J00A 1X1DA 3OSGA 1XMXA 2F4OB 1FP1D 2WV0A 1Z05A 3IWZA 2XAFA 2WAQN 1OYWA 4NQWB 3Q0UA 1K4SA 2KJBA 1KU9A 4BJTA 1R1UA 2DTZA 3AG4H 4QSHA 4L9VA 3LQQA 3ZPLA 4W97A 2BY1A 2HS5A 2KDZA 5LLQA 3IH4A 3JW4A 2TCTA 3S17J 1DU0A 1AU7A 4OOIA 3T5XA 4ZYEA 4P9FA 2JSPA 1OYIA 5KK1A 4BE1A 4BEHA 3BZKA 2DMTA 4O5VA 4BACA 1HW2A 1ETVA 4ZC3A 2G7UA 1BW5A 1I3QJ 3H3UA 3WTUC 1TLHB 4JP0A 2O03A 2RQPA 3KEOA 2H09A 4CCJA 4HF2A 1DPUA 2ZSHB 3PQKA 1GV5A 3KP2A 3CMAI 2RNJA 1X4PA 4OAYA 2V1XA 2CYYA 4JX5A 4FX4A 4WCGA 2VE8A 2NAZA 3CCRI 5E3LA 5BOXA 2IA1A 3AL0B 4IQJA 2RAEA 1UG2A 4FE4A 3R6SA 1XGSA 2FD5A 3WTYC 5K5OA 1HSTA 1LDKB 1X3ZB 2M2EA 2ZBKA 2QZ8A 3EETA 3O8GA 3RZOJ 1Y0UA 1LFPA 2Z5UA 4FE7A 2JRMA 3KLOA 3L00A 2E1MB 3FDYA 3K4JA 2LRDA 2DK8A 4KT6A 5GAHJ 2VI6A 2HVSA 4MO7A 4A3DJ 2FMYA 1ZG3A 4RAYA 4XLEA 2OZUA 1SVMA 1BOAA 2BV6A 1XC5A 5E1XA 2PJPA 3OWTA 4IL6C 2CO5A 2ESNA 4AD9A 4NB5A 3J81K 4EVIA 1JKQC 3DV8A 2V7FA 2VKVA 3IL2A 2VQLA 4HF0A 5IP9J 1O3TA 1EV7A 1RC9A 5CVIA 1H9TA 3IHUA 4XKCA 3ZMUA 3BCBA 1JKRC 3WTVC 2L0KA 3DCFA 2OBPA 4AIDA 4R8HA 4XOTA 3U1KA 4BQOA 3PM1A 4WX9A 2CFXA 5A2QZ 2IXSA 3LSPA 2K27A 3JR9A 4EGZA 1QHGA 2HQNA 3GUDA 2WAQA 5D8KB 1APLC 1Y39A 2JA7J 5L3FA 1YRNB 2EV0A 2MA3A 4IHXA 1MNMC 1P9QC 1FBUA 3SHFA 2P6TA 1BI3A 2W48A 3PFYA 4C3HJ 3MAJA 2XAHA 5AIQA 3IKTA 5EYRA 3JREA 4K2EA 5LBQA 1O7LA 2CQQA 2COBA 5DCFA 4OAZA 3LSTA 1J59A 1CF7A 1KA8A 1KYZA 1JJ6C 2FOKA 4PJJA 3V42A 1K83J 3K4MA 2XPWA 3WTZA 1B59A 1JJ8C 3I4MJ 3I9V2 4HNUA 3RZDJ 3KPHA 3JRHA 2EIMH 1FYKA 3K4LA 1Z21A 3COAC 3HOUJ 1SFXA 3ERED 2MGQA 5IP6A 3T0YA 1R00A 3K9TA 1VQ9I 3MKZA 3S14J 2EV6A 1DQUA 4U0VA 4NHJA 2GLOA 3CCMI 4R1HA 4LB6B 3LFUA 3CCJI 3LFKA 1LVAA 3RKQA 1TW2A 5JR3A 2QGUA 5JVTA 4MTEA 1LQ1A 5CKTA 3AKZA 1D5YA 2XF7A 1BIAA 4UV8A 4AYBA 3AAFA 1GUUA 1J9IA 1YHQI 3GBGA 4AVPA 2LBFA 3M8EA 3W2VA 1FLIA 2B7EA 3PIOF 1G6NA 3CO6C 2A6EF 2HXOA 4QTRA 3G2BA 1U78A 4RBOA 3BROA 1YW9A 5D4SA 2E36A 4N0BA 5E3OA 1GVJA 4UVCA 5DCMA 3BCAA 2IJLA 1Y8QB 5GADJ 4UUVA 5FKKA 3S8PA 2CW8A 4XR6A 1ACIA 1H88C 1R4NB 3OIOA 4CZCA 1HDPA 3M1EA 3EQLF 1YE9A 1IF1A 2WADA 1LJ9A 4IHYA 2LH9A 4V19K 2L3DA 5K7FA 3WU0A 3I53A 4YEJA 3RKXA 5TISC 3HHHA 1J09A 1F9NA 1IUFA 1Z1DA 3TGNA 3GTOJ 4DBQA 5FJ8J 3LOCA 3QAHA 2LF8A 2IVMA 2BGCA 3T8RA 4BL0B 1WI3A 3P9CA 4PGHA 3TP3A 3OYDA 1O3RA 4UUTA 1HKTA 1YIJI 2JN6A 1ZGAA 3G6EI 1FBQA 3SFIA 4KFCA 5J3LA 1AWCA 2R7TA 5IYDJ 1EF4A 2JUCA 5FLXZ 5CVVA 1U5TA 2IGMA 2L7KA 2N8GA 3S3OA 1T98A 1FPQA 4DZPA 2RVCA 4MQVA 5C4JJ 2E1CA 2LC2A 1R6RA 1UMQA 3CO7C 4XLNF 1JHHA 4OU0A 5GPAA 2A5YB 4BYYA 2DN0A 2PBIA 5F0FA 3VODA 2P8TA 4LMYA 4NNJA 3C2HA 2HTJA 1V54H 4UUSB 2M45A 1K6YA 3OL4A 4GGGA 3ZMVA 3BPXA 4PFOA 2EZLA 2LY2A 4C30A 5FRMA 2MABA 2UV1A 4HQEA 2UZKA 4XLCA 1IDZA 1O57A 4MEXF 1BR1A 3OS2A 3CMEI 2ZJPF 1T0FA 3HRMA 2K9MA 4A3EJ 3BTIA 2UUZA 2LG4A 5DTDA 2R5ZB 3DKXA 2O9LA 4L0YB 2L7MP 2JWTA 5LEJA 4JK1X 2DDBA 1U5TC 2DYRH 2V1UA 2P5VA 5JFRA 1FBSA 2DU9A 5TGTA 3MVPA 3E7LA 3I0TA 3S3MA 2OJED 3N05A 1J2XA 4XSXF 2HOEA 3AG1H 2V9PA 3MN2A 1LDDA 1ZRFA 2VODA 1OCTC 2DMNA 2M87A 1MBGA 1WWXA 1W5TA 1LVKA 2DA1A 1X4OA 3EDPA 3ZQHA 4E6KG 2R7FA 2W85A 3TBIA 2KPMA 1UHWA 3ZMSA 1YX5A 4XKWA 2CU7A 4D5FA 2DOFA 3HOWJ 3O6BB 5H2FC 1J5YA 2ZJQF 4BUPA 2X6WA 1QVUA 1E17A 4JX6A 5ERIA 2XAJA 1IRXA 4OWRB 3EYIA 1D1CA 1T0FC 4II2A 1OCRH 4LFUA 3S3NA 4BHCA 5J1RA 1BJAA 1T6SA 2DJNA 4XM3A 2Y0SA 2PEXA 3VYRB 2XGXA 1QZYA 1RZ4A 4XORA 4NUBA 1D0YA 3JRCA 1WSUA 1JTXA 1SFEA 4HNVA 2R5YB 2QKLB 3CCEI 3AFHA 3PUFA 5H20A 2XASA 3TDUC 1AKHA 1RUNA 4C2TA 1ZTRA 3GTQJ 2D5VA 2VXDA 4BY1J 5D6EA 4J19A 5E8GA 2QA4I 5F1RA 3RQIA 5HODA 2DA7A 3CJQB 3OMYA 1QU3A 2VJ4A 1P2FA 3CCYA 1YOVB 5JLWA 2X1CA 1ZR4A 2JZYA 1HA8A 2LMDA 3I3LA 2VE9A 2CS3A 5GAEJ 5JI6A 5DD4A 1TWFJ 2EJRA 2EK5A 1TWHJ 3F6OA 5LEKA 2EFWA 1K79A 1OCPA 2M4GA 4TV7A 1F5TA 1S5LC 3LSMA 5L3CA 3HRTA 1E2XA 2ZO4A 4ZYDA 2BEOA 4F91B 1E3PA 3FMRA 4M73A 4BQNA 2W82A 2Y2ZA 1ETYA 4RAGA
chains in the Genus database with same CATH topology
2W7NA 1X1AA 1NG7A 1V5EA 4XLAA 2ZFUA 4BS9A 2IS2A 3W2AA 2CV0A 3HUGB 3H5AA 4RLFA 2R7VA 2X51A 3DTKA 4FETA 3QYFA 3OS0A 2VLAA 2IS4A 2XSJC 4N4OB 3M8JA 4U7BA 1WFXA 5CQGA 3HC7A 2L9SA 4ZJZA 4ZTJA 3VDXA 3MKYB 3CESA 4HSTA 3DQVC 4BE2A 2VKHA 1ERDA 3D5RC 4E7ZA 2HU9A 3PNTA 2AQFA 3DPLC 3L2WA 2VASA 3K4BA 4NC7A 2BVMA 4QPOA 3OYEA 4IKFA 2PJRB 1DGWY 4B48A 2JVHA 4XOPA 4LIVA 4Y3OA 3FBNB 3TMOA 2VQHA 3LSIA 1G8XA 2WAFA 1E0EA 2M7AA 3H5NA 3MMYB 3PNYA 4Y33A 1D0ZA 4U87A 3OS1A 2ZXIA 4P1WA 4PSXA 1MMAA 4ZYAA 3HXLA 4EATA 3RSNA 5HNFA 2MFZA 3DPTA 4F52A 4IX7A 2GOMA 1WJFA 1UAAA 3CZ6A 4LITA 2HVQA 4BU2A 2VJ5A 3VWBA 2MC4A 2KZVA 5HNHA 2L9NA 2IS6A 1WJ5A 4RMNA 5LD2C 2JVGA 2KMUA 2AQEA 2KP6A 2JA2A 3PSFA 2VL8A 2ZXHA 3RQ4A 4B44A 2R7WA 3KEYA 3OYJA 3QYEA 4XONA 2BVLA 4BEHB 5CQEA 4P5OA 3UR3C 4JOMA 3A4CA 1UELB 2IGKA 3K4CA 2P0WA 4C2UA 4CUGA 4PK4A 4KITB 2X6YA 2W4SA 2DJIA 4BDYA 2LREA 1D0XA 3DKYA 3ZQQA 2LY1A 2PMZA 2PJRA 1BR2A 3SYTA 3OYHA 4HEA2 1JI8A 4B43A 5KHDA 4J00A 1X1DA 4PFPA 2VQGA 1S9HA 4KJZA 2CMPA 3IAS2 2K5CA 4XNFA 4ZDOA 3DTEA 2VJIA 3J7AY 4CCKA 1Y6IA 2QKMB 4NQWB 2HVRA 4DIQA 2WBMA 2VJJA 4BJTA 2CFOA 3PJRA 1TZLA 3ZXSA 3QODA 1VZ0A 1WJCA 4G6TB 2E1MC 1EA3A 3CP2A 4Y4RA 2M7BA 2IGNA 3HG9A 4CCLA 4AVZA 2JSPA 2DCEA 4BE1A 2L5QA 3ZGKA 3OYMA 4BEHA 4BACA 3SEQA 4E7SA 4ZC3A 3EPZA 3OYGA 2KL4A 4CCJA 4CSWA 2ZSHB 4FASD 1X4PA 4OAYA 5JHFA 3H9JA 4CCOA 4CH7A 3AL0B 4IQJA 2NOJB 3EUAA 2VQCA 2M0MA 3H0DA 4II3A 4XKBA 1LDKB 3OYIA 5KCMA 3FKJA 4X0GA 1LFPA 2M3AA 2E1MB 3FDYA 1AA7A 4DGWB 2XC7A 4XLHA 3LSKA 2XF5A 3IP4B 3K4JA 2LRDA 4D9JA 4KT6A 2A6TA 4YELA 2HVSA 3SDBA 3OYLA 2R7XA 4RM3A 3DPUA 2KLOA 3BG7A 4BGDA 1BR4A 4XLEA 2V4JC 4HNTA 1Z7LA 4XKVA 1V5GA 3OWTA 3DWLE 4CA0A 5HVQC 4DBRA 1FMWA 4ANJA 2MYSA 2V7FA 3IAM2 3K6GA 1D1AA 2OV7A 2VQLA 3E0JB 3L2UA 2R7SA 4XL9A 4ITVA 5CPRB 2R7RA 3PNVA 4XKCA 3BCBA 2HPMA 4D1QA 2CUZA 1Y56A 4XOTA 2V26A 2X1DA 2WY7Q 4BQOA 2LYCA 1FMVA 2DT6A 1N75A 2IXSA 3OL3A 1QHGA 4PUSA 3MKWB 2VIXA 2WAQA 2LBFB 3A2KA 4LG3A 4HPQA 3S93A 3CMMA 1P9QC 2KDOA 4YRVA 3EUKL 3FHNA 4E7LA 3H9QA 4N4NB 3PFYA 3VSLA 2M4KA 2DXIA 2K9LA 2DT7B 4OAZA 2HZDA 1X19A 1LKXA 2WA0A 4PJJA 3V42A 2E5NA 3K4MA 3C2GA 3DU5A 3I9V2 4HNUA 3OYNA 1TT0A 5KNLA 3ZCOA 4PJMA 1X1CA 5FROA 3BG6A 2KQRA 3K4LA 1Z21A 4E7HA 3QOEA 4F93B 2RQQA 1MNEA 4MLOA 2X85A 3K4NA 4HRIA 3MKZA 4AU7A 3F9KA 3AL0C 1DQUA 2XAUA 2BOLA 3LFUA 2F5VA 2R7UA 1WJEA 2WY8Q 4HSRA 3TL4X 2BW3B 4JQFA 3A1YA 5CKTA 3AKZA 3RTRA 2XF7A 4AYBA 4C9YA 5HOOA 3GBGA 2LBFA 3W2VA 1MMNA 3LMMA 3W3CA 3CF2A 4B3XA 4R79A 4PJNA 3G2BA 3OOUA 3OYAA 2HQAA 2ELJA 3K10A 2RNGA 3KX2A 4E7JA 2R4GA 3UNGC 1SAUA 3BCAA 2OUMA 4XN0A 3BC8A 3S8PA 2CW8A 4XR6A 2WAEA 2CV2A 4BJ5C 2VPLA 4J01A 5HLTA 4CCNA 2HDWA 4H4KC 4CZCA 4QPQA 1YE9A 4ZDLA 1WJBA 2WADA 2CV1A 2V1NA 2LH9A 3H9GA 2JUGA 4YEJA 4E7IA 2L2OA 1J09A 1BOBA 4DBQA 4XLFA 1Z3XA 2F4IA 2HNHA 1V5FA 2X6XA 4BL0B 3D5LA 3RCOA 2Q1ZB 2W1OA 3M1CA 3OYDA 1W36C 3HPHA 5LFAA 2BW3A 4IZZA 3U21A 3OR2C 1PYVA 3H35A 4RM2A 2R7TA 1KONA 1QHHD 4ZTFA 2IGMA 2L7KA 3S3OA 1SFKA 4GRIA 2XF6A 2DOAA 2LC2A 1UG0A 3CP8A 1R6RA 3PL8A 3OIPA 3VYTB 3S32A 2OC6A 1ZELA 2FUG2 3OIQA 3C2HA 3PUBA 2GOXB 4NNJA 4BJ6C 1N77A 3NWTA 3HL2A 1K6YA 3OL4A 1W36D 4PFOA 2LY2A 4C30A 3L2RA 3QYBA 1WJDA 1MMGA 1U0JA 5FRMA 2V9KA 4PSWA 2MABA 1Z3YA 2UV1A 2WB1A 4XLCA 2VB6A 3SEZA 2RREA 3OYCA 2W00A 1X1BA 1OR7C 2K3PA 2CH0A 1BR1A 4DJAA 3OS2A 3OYKA 2K9MA 3ONQA 1D1BA 2UUZA 2LG4A 2ZSIB 4BQQA 2A5WA 1G59A 3DKXA 4BXFA 3VYSB 1MW7A 4NC8A 1DP3A 5FRNA 3LSHA 2R7OA 4E4HA 3LL7A 1OLTA 5TGTA 1T95A 3S3MA 3D5SC 3E1SA 3N05A 2CW7A 2LOOA 3VSKA 1NG6A 3ZRGA 3BLYA 1WJAA 1N78A 2Z16A 3HOSA 4E7KA 1LVKA 4XQFA 1X4OA 3IUOA 4E6KG 3TBIA 2KPMA 1YX5A 4XKWA 2XDVA 1DGRM 3L2VA 4XN3A 2Z1DA 2KRCA 3L2QA 2UWMA 4HG2A 4BUPA 2X6WA 4F3QA 3K70C 1IRXA 4OWRB 2KHMA 1D1CA 2O5RA 2VKDA 3MD2A 4RLQA 1T0FC 2E5ZA 4II2A 4B47A 4BE0A 3S3NA 3HKZA 3VYUB 4CCMA 3NWSA 2I8DA 3LSGA 3OY9A 3OR1C 3H5RA 2E60A 4XM3A 3K4KA 2Y0SA 2Z2SB 1GLNA 3EUHC 3VYRB 3HPGA 4ZDPA 2MD0A 4XORA 3DEEA 4NUBA 1D0YA 2QKLB 1PJRA 3AFHA 3KYLA 2R7QA 2X1EA 4C2TA 4XMYA 2IS1A 2VXDA 4IQ4A 2CUJA 1YX3A 3K70D 2V6EA 3HOTA 3OYBA 2KRHA 2IGOA 3ZR8X 4LIUA 3CJRB 3CJQB 3OMYA 1QU3A 3SZGA 1MNDA 2VJ4A 3W2WA 4DOZA 3RPUD 3OYFA 2Q2EB 4KISA 2X1CA 4F55A 1HA8A 3DTIA 3I3LA 2CS3A 3DLAA 2VXZA 2M4GA 4PJLA 4BDZA 4F92B 3LSMA 3DU6A 2HPIA 1MMDA 2F6CA 4F91B 3FBIB 4BQNA 2W82A 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQW B;  2Q1Z B;  2Z2S B;  3HUG B; 
#chains in the Genus database with same CATH topology
 1QNT A;  4MHG A;  2KT0 A;  1NG7 A;  4XLA A;  2R7Z J;  5EGO B;  1IRG A;  1I27 A;  1U8R A;  2XSD C;  1W5S A;  2R7V A;  2X51 A;  3VPR A;  2IS4 A;  3M8J A;  2CWE A;  5JHU A;  1WFX A;  2L9S A;  3U2R A;  1DP7 P;  2O61 A;  2L4A A;  2F48 A;  4LK0 F;  4UNO A;  4XIC A;  1QA6 A;  3R61 A;  2PG4 A;  1ETK A;  1YIT I;  2HU9 A;  4KN4 X;  4NQW A;  3PNT A;  3A02 A;  1MGT A;  2AQF A;  5F04 A;  1R49 A;  3ZQC A;  4GYG A;  1Z6T A;  1TL8 A;  4V2G A;  4D5C A;  2HFH A;  3OYE A;  2FA5 A;  4IKF A;  2PJR B;  4I0A A;  2JVH A;  4XOP A;  4HBL A;  3FBN B;  1MZB A;  1X2M A;  3TMO A;  2GWR A;  2OF7 A;  1UHS A;  2MW8 A;  2M7A A;  2OD5 A;  2X9D A;  3H5N A;  3MMY B;  4LLN A;  2YU9 J;  5L3B A;  3OS1 A;  3M9A A;  1W7P D;  2XRO A;  1MMA A;  1T08 B;  4UB8 C;  5HNF A;  1BL0 A;  4F52 A;  2P5L C;  3IRR A;  3C18 A;  5KAF C;  4EMS A;  3WOD F;  4DNC A;  2Y69 H;  1UAA A;  2L02 A;  1DPR A;  4Z6Y A;  5E20 A;  1ETO A;  2RV8 A;  2QM3 A;  4O6J A;  1ZR2 A;  2HVQ A;  4G8X A;  3VWB A;  2MC4 A;  1IV8 A;  5ICF A;  2FSW A;  2D1V A;  2L9N A;  5BNG A;  1YO5 C;  2JVG A;  2OQG A;  3FXM A;  3PSF A;  1SD4 A;  2ZXH A;  4B44 A;  4G9Y A;  3V8J A;  5F64 A;  2W57 A;  2QF7 A;  4P5O A;  3UR3 C;  2QEN A;  1ZQ3 P;  3CC2 I;  1I1S A;  3LA3 A;  2P0W A;  3H3Z A;  4CUG A;  4KIT B;  2EZH A;  5LHI A;  3MZY A;  4AM3 A;  1G3Y A;  1VND A;  1F4K A;  2ID3 A;  4XSZ F;  3HRU A;  1R5H A;  2LRE A;  5EEA A;  1B8I B;  1R5G A;  3H92 A;  3ZQQ A;  3F21 A;  5BPI A;  3TO7 A;  3DLL F;  2K4J A;  3WGH A;  5AIP A;  1IG7 A;  3PO3 J;  3E97 A;  4IO9 F;  4HEA 2;  4PJ0 C;  2F5E A;  1LUJ B;  3JRB A;  3DXJ F;  2LKP A;  3ELK A;  1HW5 A;  1S6L A;  1S9H A;  2CW0 F;  4CYC B;  2COM A;  2DMQ A;  4LK1 F;  2I10 A;  1FT9 A;  3K1N A;  1SFU A;  2EV5 A;  3KZI C;  5FKL A;  2VN2 A;  3BDD A;  3J7A Y;  1GXP A;  2FE3 A;  2QKM B;  2HVR A;  4DIQ A;  2QEX I;  4I76 A;  3DEU A;  2WB1 N;  2KZG A;  3PJR A;  1VQP I;  3VB2 A;  2E35 A;  3ZXS A;  3BR0 A;  1SVO A;  3QOD A;  1WJC A;  4EM1 A;  1FSH A;  3PIP F;  2NVT J;  4RAZ A;  2E1M C;  1EA3 A;  3AG2 H;  3CP2 A;  2BBY A;  2M0C A;  2ZME C;  1ETX A;  2IGN A;  4EEF G;  4PDK A;  1YRN A;  4AVZ A;  2ISZ A;  3S2W A;  2Z99 A;  1YJ9 I;  3A01 B;  3GFI A;  2L5Q A;  1MH3 A;  4U0Y A;  3DEW A;  3FXK A;  1K78 B;  4G7Z F;  3ZP5 A;  1XG1 A;  5E17 F;  3V8K A;  1WQ2 A;  4HA8 A;  3SEQ A;  4ZYH A;  3EPZ A;  3NRV A;  3OYG A;  3L7W A;  4D0P A;  5BQT A;  5C44 J;  2IEK A;  2IA2 A;  4RDU A;  3WU1 B;  2XPV A;  3S2D J;  1A6Q A;  5DDG A;  3R0A A;  5DYM A;  5J47 A;  1FIP A;  5LHG A;  3R4K A;  1H89 C;  4FAS D;  1OMI A;  4CCO A;  1XGN A;  3CF5 F;  2JQ7 A;  2NVX J;  1KGS A;  3MKL A;  3WG9 A;  4HYE A;  5HLI A;  3FIS A;  2OA4 A;  3T1B A;  2IBD A;  4RGU A;  5KCM A;  3OYI A;  1GT0 C;  3JAM K;  1R23 A;  3P9K A;  2QBY B;  3GTP J;  4DGW B;  2XC7 A;  3ML6 A;  4XLH A;  2PI0 A;  4D9J A;  1JKO C;  3KEQ A;  4YEL A;  2XPU A;  2LK2 A;  3OYL A;  2R7X A;  1JT0 A;  4IRI A;  3S1N J;  1NHA A;  4BGD A;  2H1L A;  2V4J C;  1D5V A;  1MMS A;  3QRF F;  2W25 A;  3CDH A;  1F1Z A;  1Z7L A;  4XKV A;  4HNT A;  1REP C;  2KIS A;  5HVQ C;  2NVU B;  2MYS A;  3E5Q A;  3K6G A;  2EPF A;  3EYY A;  1D1A A;  1VQ8 I;  3E0J B;  5K7Z A;  3L2U A;  4L18 B;  1ETQ A;  2VBX A;  5CPR B;  3F0C A;  5DUK A;  1RES A;  4MGR A;  1GHC A;  3AG3 H;  5FFX A;  3DBL B;  5K5R A;  1Z91 A;  2WY7 Q;  2K02 A;  3R60 A;  1B1B A;  1R36 A;  2DT6 A;  5L3D A;  4MFD A;  2ZNY A;  2E2I J;  3KIO A;  2DT5 A;  3RPQ A;  4A3J J;  2EFN A;  5ILV A;  3MKW B;  2O3F A;  2MG4 A;  5TRD A;  1EJ9 A;  3N97 A;  3CQZ J;  1XSX A;  2F4M B;  3S93 A;  2FX0 A;  3EUK L;  1UST A;  3H9Q A;  4N4N B;  3GTK J;  2M5W A;  2K9L A;  2DT7 B;  3CJN A;  1KQ9 A;  2L9R A;  1JTY A;  2HZD A;  1B72 A;  1X19 A;  3CLO A;  3TKY A;  4W1U A;  5CVU A;  1V3F A;  1LKX A;  3ZMZ A;  4MNU A;  1YI2 I;  4A12 A;  5D6F A;  2RGV A;  3C2G A;  1Y1V J;  2XB0 X;  1HDD C;  6PAX A;  3G3Z A;  1VF9 A;  3HRS A;  1TT0 A;  5KNL A;  3ZCO A;  1W5C C;  1X1C A;  5E3M A;  2KQR A;  1LFB A;  1LDJ A;  3QOE A;  1A35 A;  1A04 A;  2QWW A;  1OYY A;  1MNE A;  1I5Z A;  4MLO A;  3BG5 A;  2DMU A;  3O2P E;  3TP0 A;  2M34 A;  4Y15 A;  2XAU A;  2E71 A;  3JSO A;  1MH4 A;  3KP5 A;  3HJE A;  5HDG A;  1KZH A;  2F5V A;  2R7U A;  4I02 A;  4M6X A;  4M3B A;  4HQM A;  2HKX A;  2BW3 B;  3A1Y A;  3HGY A;  1XDU A;  4CGZ A;  2AO9 A;  3MEX A;  4M3D A;  1O7F A;  4GO1 A;  3CF2 A;  1IDY A;  4L5E A;  4PJN A;  2EFP A;  3M07 A;  3HTU A;  3I56 I;  4G7O F;  2RNG A;  4ZH4 F;  5ILU A;  2MH9 A;  3LA2 A;  4PCQ A;  2WWY A;  2R4G A;  3S1R J;  1XPX A;  2GXB A;  1SAU A;  1ZAR A;  4Y7N J;  3BC8 A;  2DW4 A;  2PQ8 A;  3KP3 A;  4BJ5 C;  3BT9 A;  2YUS A;  3C7J A;  3ROU A;  2BY2 A;  1VQ6 I;  1ZH5 A;  2FNA A;  2KRF A;  3H9G A;  3O3K A;  4MFE A;  1B6A A;  5LGT A;  5KVR A;  1WI9 A;  3QPH A;  1G4D A;  2M8E A;  2K7L A;  5LGN A;  2YPR A;  1V5F A;  3ECO A;  5FO5 A;  3D5L A;  3RCO A;  4V2F A;  2D45 A;  2HDD A;  3SQN A;  2W1O A;  3M1C A;  1BIB A;  2V1D A;  1RKT A;  5LFA A;  1ONV A;  3OR2 C;  3J81 Z;  3LSR A;  1PYV A;  1S7E A;  4RM2 A;  1NK2 P;  1KON A;  1QHH D;  4ZTF A;  1FSE A;  4A2U A;  5HLG A;  2R92 J;  5K7H A;  2XGE A;  3CP8 A;  5J8F A;  3PL8 A;  2IT0 A;  3S32 A;  2OC6 A;  5M3F J;  3CUQ A;  1ON2 A;  3TDZ C;  2LD5 A;  4ESJ A;  1MDM A;  2FUG 2;  3OIQ A;  4BJ6 C;  1SAN A;  2LSO A;  2VBY A;  4AIK A;  3MWM A;  3HL2 A;  2VBW A;  2XGD A;  1W36 D;  1UJ8 A;  4HF1 A;  1WJD A;  1MMG A;  1U0J A;  2V9K A;  2LVS A;  4PSW A;  5E1W A;  5TJJ A;  2TRT A;  2LP0 A;  2Y0M A;  1FTT A;  3Q0W A;  3SEZ A;  2AXL A;  3FXO A;  1YS6 A;  5JVG F;  2W00 A;  1X1B A;  2K3P A;  1VQK I;  4I0B A;  4FQG A;  5FGM A;  3TO9 A;  4HX7 A;  4Y13 A;  3DFG A;  1D1B A;  2ZKZ A;  2ZXJ A;  4BQQ A;  3K0L A;  3WE2 A;  2NYX A;  1IO2 A;  4M74 A;  4NC8 A;  2ME6 A;  2JJ7 A;  3LSH A;  2J5P A;  2R7O A;  3LL7 A;  1ZGJ A;  2HEO A;  5IPA A;  1IN5 A;  3C3W A;  5EGO A;  2QQB A;  3P7N A;  4ESB A;  3E1S A;  2CW7 A;  2DA3 A;  2LOO A;  2OZ6 A;  3BR2 A;  1X2N A;  2HKO A;  3LQR A;  4D7N A;  3CUQ C;  2OCC H;  1UHM A;  1P4X A;  1HF0 A;  3HOS A;  3HBL A;  3RIR A;  3FM3 A;  3IUO A;  4LLG F;  4E70 A;  3L2V A;  3A03 A;  2XDV A;  2E2J J;  3WTS C;  2Z1D A;  4ASN A;  1MBE A;  4GYI A;  2UWM A;  2LKX A;  2G9W A;  2H1K A;  4IVN A;  4F7Z A;  1IN6 A;  3KCC A;  3W6J B;  4WWC A;  4QIW N;  3QP6 A;  1OIS A;  4PGG A;  2P4W A;  2VKD A;  3MD2 A;  4RLQ A;  2JTV A;  3GZN B;  4BE0 A;  2JMW A;  4I6Z A;  5B1B H;  1YJN I;  1MBH A;  1FYM A;  2XB5 A;  1I3A A;  1JUM A;  2I8D A;  3LSG A;  1I39 A;  4KT5 C;  3K4K A;  3F8F A;  2GBY A;  1BC8 C;  2Z2S B;  4FTH A;  1VI0 A;  4ZDP A;  4RB3 C;  1BI2 A;  2OQR A;  4JYK A;  2STT A;  4UV9 A;  2K9S A;  3FX3 A;  3BJ6 A;  1PJR A;  2K9N A;  3KYL A;  3ZMT A;  3CDI A;  2R7Q A;  2X1E A;  2YSR A;  3FXR A;  4OMY A;  5IOY A;  1R1T A;  4D7M A;  2KIU A;  3CCU I;  1BA5 A;  2CUJ A;  4LG0 B;  1YX3 A;  1W7P A;  1I50 J;  3K70 D;  2V6E A;  2K9Q A;  3I64 A;  4LIU A;  2CRG A;  2H6B A;  2O8X A;  5LRR A;  3V7S A;  5BPD A;  3SZG A;  2XAG A;  2FQ4 A;  4DOZ A;  1SVL A;  1EH7 A;  2Q2E B;  4LGW A;  1RPW A;  3TOB A;  4F55 A;  3GTL J;  1YFH A;  1IAW A;  2JA6 J;  1WRJ A;  1YTY A;  2VXZ A;  4BDZ A;  4PJL A;  4F92 B;  2PMZ N;  3A0B C;  2QSH X;  2HPI A;  3J7A O;  5EZH A;  4UVA A;  1A6I A;  1R58 A;  3L9F A;  3H0G J;  4IOC F;  4BXX J;  2WV1 A;  4A6D A;  3FBI B;  4G94 A;  2P6S A;  3KP7 A;  3PSI A;  1Q1H A;  4YFX F;  1V5E A;  3WTW C;  1B8I A;  4BS9 A;  2IS2 A;  2CV0 A;  3HUG B;  1IRZ A;  3JTG A;  1JUP A;  4IHS A;  4I09 A;  3DTK A;  4BKX A;  4FET A;  3QYF A;  3OS0 A;  2VLA A;  1ZKG A;  3GF2 A;  5M3M J;  1ZRC A;  1USS A;  4ZJZ A;  1STZ A;  4ZTJ A;  1J7K A;  5DD8 A;  5E1Z B;  4GFB A;  3PO2 J;  1Y1W J;  4ABZ A;  2VKH A;  1ERD A;  3D5R C;  4E7Z A;  4Y17 A;  3GTM J;  2P5K A;  1WKM A;  2OPT A;  1Y0N A;  1GDT A;  2EZK A;  2RC4 A;  2FQ3 A;  1FZP B;  4QPO A;  3ZQL A;  1XGO A;  2P81 A;  4KMU X;  1DGW Y;  3MZ8 A;  4B48 A;  4BNC A;  1S7A A;  2EA4 A;  4Y3O A;  1G8X A;  2WAF A;  4DYC A;  5FLX K;  3PNY A;  1D0Z A;  2HOT A;  4ENJ A;  1T33 A;  3JRI A;  2GAU A;  4ZYA A;  4AUX A;  3A01 A;  3HXL A;  1J75 A;  2MFZ A;  1ZAO A;  4IHV A;  1BN5 A;  5D5U B;  4IRG A;  4IX7 A;  4HAM A;  2F5F A;  3LSJ A;  4UHT A;  5C3E J;  1P4A A;  3E5U A;  4XBF A;  4BAY A;  1S3J A;  2IP2 A;  4DQ2 A;  4BU2 A;  1YIO A;  1XTA A;  2DQL A;  1XSD A;  3H1C A;  2Z33 A;  3RYR A;  4RMN A;  2XV4 S;  2IPQ X;  2KMU A;  2KP6 A;  2JA2 A;  1ON1 A;  1VQ4 I;  3RQ4 A;  1OCO H;  3ABM H;  2E1O A;  4XRS A;  3OYJ A;  2BVL A;  4BEH B;  3HOZ J;  2ETH A;  5CQE A;  1WVR A;  3GYH X;  3A4C A;  1I1G A;  2MD5 A;  3J7Y J;  2LR8 A;  4PK4 A;  3VEP A;  2X6Y A;  3B73 A;  4Q5S F;  3E6C C;  3JCU C;  1MKM A;  4BDY A;  1JGG A;  1SMY F;  1QPI A;  2CQN A;  2H6C A;  3M7G A;  2MBF A;  4MEY F;  2EIK H;  3WHC A;  4XK4 A;  4IOA F;  1A36 A;  3I59 A;  1R7J A;  1XX5 A;  1YYV A;  2PMZ A;  3SDG A;  2B9S A;  4B43 A;  3HZJ A;  4PFP A;  3GZ6 A;  2VQG A;  1SEU A;  1RI7 A;  1AOY A;  3S1M J;  4KJZ A;  3IAS 2;  2K5C A;  1TP4 A;  3V7C A;  4ZDO A;  3DTE A;  1Q1V A;  2JSC A;  3GX4 X;  2K4B A;  3S15 J;  4UXN A;  2WBM A;  2VKE A;  2E19 A;  3KZY A;  3QWL A;  1HLV A;  2KFD A;  3QPS A;  2CFO A;  1TZL A;  2P7C B;  4YFN F;  1ORK A;  1VZ0 A;  2XGC A;  3G73 A;  4G6T B;  1QBJ A;  2VUM J;  5GAG J;  4Y4R A;  2M7B A;  5J1Y A;  2A6H F;  3ZN1 A;  2D1H A;  4ETS A;  3M8F A;  3FZV A;  2DCE A;  1G3W A;  1TQP A;  3FIW A;  3CC4 I;  3D0S A;  3ZGK A;  1NK3 P;  3Q0V A;  3ESW B;  3NQO A;  3GWZ A;  1GVD A;  1IXS B;  4CSW A;  5GTH C;  3SJM A;  1XD7 A;  2ZNZ A;  2ESH A;  2D2W A;  3GZ5 A;  5EJC A;  1XB4 A;  2V6C A;  2FJ1 A;  1T2K A;  4CH7 A;  1HC8 A;  4KIF A;  3EUA A;  3BR1 A;  4ON0 A;  4U88 A;  3C1D A;  1PUF B;  1JHF A;  4L9N A;  4ENK A;  4AC0 A;  1WGX A;  2QLZ A;  4C3I J;  4X0G A;  3ABK H;  4QWQ A;  2HTS A;  4B09 A;  1W4M A;  5DEQ A;  3HKZ N;  2X0L A;  4RGS A;  3LSK A;  2RN7 A;  5IT9 K;  3IP4 B;  3E5X A;  1CF7 B;  2A6T A;  1HSJ A;  4CIC A;  3DPU A;  3MQ0 A;  2KLO A;  3BG7 A;  3KP4 A;  4A0Y A;  3F6V A;  4A69 C;  5J4V A;  1V5G A;  2M30 A;  2GM4 A;  4ANJ A;  5BS6 A;  1G3S A;  1IN7 A;  3IAM 2;  1LEA A;  3HB9 A;  4KMF A;  3SZT A;  1MBK A;  2R7S A;  3DP7 A;  2R93 J;  1U2W A;  3GCM A;  4ITV A;  1ZG1 A;  1ZK8 A;  3PNV A;  1WZ2 A;  3ZQG A;  2ZC2 A;  2HPM A;  2A05 A;  2CUZ A;  1Y56 A;  2GIZ A;  2LYC A;  5ILS A;  5J1U A;  4RA2 A;  1TNS A;  1N75 A;  5GTI C;  4CXF A;  3FXJ A;  1BM9 A;  3OL3 A;  2KIF A;  4PUS A;  3I4P A;  3ZN0 A;  2VIX A;  5M5Y J;  1RKW A;  2LBF B;  1L3L A;  3A2K A;  1W1W E;  2EIJ H;  4HPQ A;  4YFK F;  3CMM A;  1IXR C;  2VOO A;  4G12 A;  2KDO A;  4FT8 A;  4YRV A;  3NAU A;  2Y31 A;  3FHN A;  3B6A A;  1YQA A;  4WXD A;  3VSL A;  1OJL A;  2M4K A;  4YII A;  3ERM A;  2FNP A;  1XS9 A;  2DI3 A;  3QU3 A;  1BBY A;  1ZLK A;  4LOC A;  1B9N A;  3P5J A;  5HS8 A;  1FOW A;  4RB1 A;  4CO8 A;  1T39 A;  3KYC B;  3GFJ A;  3F72 A;  2KIQ A;  3WHB A;  1TTY A;  5IYB J;  2WA0 A;  4KNY A;  1KU7 A;  3LAJ A;  1Z9C A;  2XUB A;  4HW0 A;  4NC6 A;  4EJT A;  4JX4 A;  4KN7 X;  3C2B A;  4XRM A;  4HOB A;  1TNT A;  1P6R A;  2BXZ A;  2O0Y A;  2A68 F;  2PX9 A;  3M3Y J;  1G2H A;  4F93 B;  5B66 C;  1LE8 B;  1MJB A;  3IH3 A;  1GXQ A;  2EA2 A;  4U7D A;  2X85 A;  3K4N A;  4EJW A;  5B1A H;  4KYW A;  2QSG X;  3G1L A;  3F9K A;  3AL0 C;  3J80 K;  1RUO A;  3HIF A;  1OKR A;  1MJA A;  5ICC A;  3WG7 H;  1TWG J;  5HDK A;  5FKO A;  2XRN A;  5M5W J;  3Q5F A;  2DLL A;  2FBH A;  4HSR A;  4M3E A;  3TL4 X;  2VT2 A;  2Q0O A;  3F8B A;  4FX0 A;  3RTR A;  2FML A;  2E2H J;  3SZP A;  4C9Y A;  3FKI J;  1P4W A;  4A3G J;  1U5T B;  2K40 A;  3FM5 A;  4R79 A;  4B3X A;  3OOU A;  4BH9 A;  2CUE A;  3ZQI A;  2ELK A;  5K1Y A;  3OYA A;  3KX2 A;  3FXU A;  3RYP A;  2EBI A;  4MIM A;  2FF4 A;  1WH7 A;  3UNG C;  1BC7 C;  4IJA A;  2CQ7 A;  4S0H B;  4XN0 A;  1LEB A;  4Q47 A;  5IYC J;  3CD6 I;  1ODD A;  4L5I A;  4CCN A;  5F6F A;  4H4K C;  1OFC X;  1DU6 A;  4QPQ A;  1P92 A;  1R1V A;  1WJB A;  2CV1 A;  1FWZ A;  2Y30 A;  2NVY J;  2V1N A;  3GO5 A;  1SD5 A;  3HM5 A;  2JUG A;  3JAM Z;  4WF2 A;  1K61 A;  5K5Q A;  2L2O A;  1B4A A;  1KYW A;  3ULQ B;  4A6E A;  1BW6 A;  1RET A;  2ECB A;  2BE5 F;  2ACJ A;  1RR7 A;  1Z3X A;  1YW7 A;  2HNH A;  3OV8 A;  2X6X A;  3FK7 A;  2Q1Z B;  3BP8 A;  4RAF A;  1W36 C;  1IV6 A;  1UB9 A;  3SXY A;  1HQC A;  3U21 A;  3DKW A;  5BMZ A;  2E7X A;  3H35 A;  2B0L A;  2LLK A;  5H6Q A;  4HX8 A;  1IJW C;  2C6Y A;  1YW8 A;  1PP7 U;  1TW3 A;  4OIO F;  2G0E A;  2NRA C;  4QLC U;  2DOA A;  3G4S I;  4G7H F;  1UG0 A;  2HDC A;  3GXO A;  2L4M A;  3VYT B;  1MBJ A;  2QQ9 A;  4AIJ A;  2A69 F;  1VQN I;  3PUB A;  2GOX B;  5FD5 A;  5F27 A;  4EGY A;  3WTT C;  1SAX A;  3FMQ A;  4ZZD A;  3CCL I;  4EJV A;  3DBH B;  2ELH A;  4AWX B;  5IP7 J;  1Z6R A;  5KAI C;  1QRY A;  3L2R A;  2R7D A;  3QYB A;  1VTN C;  3L1P A;  1Z3Y A;  3K2Z A;  5F0H A;  2WB1 A;  2FRH A;  3FMS A;  2H8R A;  3F3X A;  4KDP A;  4ZZL A;  3OYK A;  3BJO A;  2EIL H;  1D8J A;  2ZSI B;  1AKH B;  5E79 C;  1G59 A;  1WPK A;  3K1M A;  1XGM A;  3GVA A;  3VYS B;  3CLQ A;  3ECH A;  4GXO A;  1IC8 A;  3BR3 A;  1D8K A;  1MJ9 A;  2FBI A;  4HV5 A;  1VQ7 I;  3EUH A;  3K7A J;  1XN7 A;  1T95 A;  4ZYG A;  2OTJ I;  3QU6 A;  2GA1 A;  3ZRG A;  1RIO H;  1ZRD A;  1N78 A;  1YJW I;  4E7K A;  4XQF A;  2IW5 A;  5FLM J;  4A3M J;  1S29 A;  1JXS A;  2MSY A;  3H3V K;  1L0O C;  1U8B A;  1DGR M;  2JPC A;  1KQ0 A;  3ZOB A;  2JA5 J;  2W24 A;  4F3Q A;  3K70 C;  5E8I A;  1OPC A;  3U9G A;  2KHM A;  3CUO A;  2O5R A;  5LRS A;  2GA2 A;  1T56 A;  2E5Z A;  5E18 F;  5EDN A;  3S1Q J;  1O3Q A;  2JA8 J;  4UUS A;  2LFB A;  1HW1 A;  3DBR B;  3FF5 A;  1YLF A;  3NWS A;  3OR1 C;  4JBA A;  1R22 A;  1VFC A;  3HGG A;  5D5W B;  1ENH A;  3ABL H;  1GLN A;  3EUH C;  5EF6 A;  2Q8K A;  3HPG A;  1OQY A;  2HXI A;  4BY7 J;  2EFQ A;  2NXN B;  1BI0 A;  2FU4 A;  4M71 A;  4BHB A;  2CQX A;  4S05 A;  1FOY A;  2R5Z A;  3BR5 A;  3CDL A;  2XKO A;  2IGO A;  4IRH A;  1KQ8 A;  2TDX A;  4EV0 A;  2Y9Y A;  1MND A;  2NS0 A;  2VBZ A;  2NOG A;  2E34 A;  3OYF A;  3MCZ A;  3KLN A;  1XDS A;  4KIS A;  4I98 B;  2M8G X;  2ZFW A;  2JT1 A;  5DUI A;  2GZW A;  2DA5 A;  3DLA A;  4MTD A;  2B63 J;  4FHT A;  2EH3 A;  3Q9S A;  2RKH A;  2ZCW A;  4I7H A;  3K1P A;  1TWA J;  4M72 A;  3DU6 A;  4NBQ A;  3V7R A;  3JRA A;  2F6C A;  2W7N A;  1VQO I;  5EZG A;  2IRF G;  2ZFU A;  3W2A A;  5ED4 A;  4Q4Z F;  4H0E A;  3JSP A;  3H5A A;  5B3S H;  1DUX C;  4GDF A;  2XKP A;  2JRT A;  3X2Q H;  3JRF A;  3WTX C;  2WC2 A;  2XSJ C;  1Z0X A;  4N4O B;  4HV6 A;  4IEJ A;  3KZZ A;  4RB0 A;  5CQG A;  3HC7 A;  4OIQ F;  1V4R A;  3VDX A;  4YIR X;  3LWF A;  2VPR A;  1T8I A;  2QQA A;  2ZME B;  4AYB N;  3CC7 I;  4B4C A;  1HKS A;  5D5X B;  2R5Y A;  5DV5 A;  3SFZ A;  3DPL C;  1RR8 C;  3A0H C;  1TQI A;  3K4B A;  1S72 I;  3QPL A;  4LIV A;  2K3F A;  2AHQ A;  3Q9V A;  1E0E A;  3ZQ7 A;  4Y33 A;  3KP6 A;  2F2E A;  4U87 A;  3RI4 A;  1BI1 A;  4P1W A;  3F22 A;  4EAT A;  2DFF A;  1QZZ A;  2EB7 A;  1QZE A;  4IHW A;  2BZT A;  5EG0 B;  1PVE A;  1U9O A;  1Z77 A;  3V8L A;  5FKN A;  3CZ6 A;  3PFI A;  5A2Q K;  2O6G E;  2E7W A;  4WXC A;  1P7J A;  1RRJ A;  2KZV A;  1MD0 A;  4YG2 F;  1MIJ A;  3J7Z I;  2DOD A;  2YU3 A;  2ME0 A;  2VT3 A;  2FXA A;  2VL8 A;  2R7W A;  1VQL I;  2ISY A;  1UZC A;  1PUF A;  3GW2 A;  2Y75 A;  3BY6 A;  2DFE A;  3ZMD A;  2LTP A;  1UEL B;  1K6O A;  5HLH A;  2IA0 A;  2DPD A;  5ICG A;  1H9G A;  2EWN A;  3HYI A;  1SFO J;  2DJI A;  2HYG D;  2DFH A;  1FJL A;  1W0U A;  1D0X A;  2O7O A;  3DKY A;  2MH2 A;  3GFM A;  5FKM A;  4OIR F;  1O3S A;  5LGU A;  2PJR A;  3JTH A;  1BR2 A;  3SYT A;  4LJZ F;  1SD7 A;  3HTS B;  5D4R A;  5CLS A;  1ZHF A;  2M1B A;  2OTL I;  1O4X A;  2QYO A;  4IXA A;  2NNN A;  3TW6 A;  4UB6 C;  2QQ8 A;  3FWE A;  5ICE A;  2F5C A;  3HSR A;  4XNF A;  2CMP A;  3MFK A;  4LLL A;  1JUS A;  1X3U A;  2DBB A;  4EM2 A;  2BYV E;  2A3S A;  2VJI A;  3B6C A;  4CCK A;  1Y6I A;  1U3E M;  1G3T A;  2VJJ A;  3BG3 A;  1XMA A;  3KFW X;  1EH8 A;  1FX7 A;  1Y8R B;  1CGP A;  2FBK A;  1JGS A;  1FIA A;  4B3A A;  2FOW A;  2H8W A;  4U0W A;  4UY8 I;  2CJJ A;  4G6Q A;  2OU2 A;  3HG9 A;  1PP8 F;  4CCL A;  1C0W A;  5LHH A;  2QVO A;  2GXG A;  3GLX A;  2NVQ J;  3OYM A;  3IV5 A;  3U1D A;  2HR3 A;  4E7S A;  4A93 J;  2DA6 A;  2KL4 A;  2HI3 A;  1S7O A;  2A61 A;  4S04 A;  1NH3 A;  4XLP F;  4M9S A;  2AXT C;  1LPQ A;  2DQR A;  5JHF A;  3H9J A;  4M6V A;  5D8L B;  2NS8 A;  2CSO A;  2LKS A;  4DZJ A;  3KET A;  2NOJ B;  5J4Y A;  3BWG A;  2VQC A;  2M0M A;  3F8M A;  4A5M A;  3JRD A;  3H0D A;  2HZT A;  4HZF A;  1JE8 A;  3QOP A;  4II3 A;  4XKB A;  3REO A;  5JLX A;  3V4G A;  4M6Y A;  1FOX A;  5J40 A;  3FKJ A;  4ENM A;  4AIH A;  1S8N A;  3R0J A;  4CYC A;  3CCS I;  2DOE A;  2M3A A;  1UCR A;  1OCC H;  1AA7 A;  2MLG A;  2YR2 A;  5D5V B;  2XF5 A;  5H6R A;  1B72 B;  1IUY A;  2Z9O A;  3SDB A;  2DA2 A;  1SMT A;  4I01 A;  2Y0S N;  4RM3 A;  1BR4 A;  2DO7 A;  1HCR A;  3HSE A;  1J0R A;  4O3M A;  1GV2 A;  2HQ5 A;  3DWL E;  4CA0 A;  2VOP A;  4DBR A;  1FMW A;  3LA7 A;  1R9T J;  2Y48 A;  1ITY A;  1FYL A;  2PMU A;  2LNB A;  2L7F P;  4I99 C;  3FK6 A;  5CYV A;  2OV7 A;  5HS7 A;  1CQT A;  3JRG A;  3IKV A;  4XL9 A;  5DM7 F;  3LAP A;  2HWV A;  1K78 A;  2R7R A;  4M9Z A;  2PLY A;  3E3V A;  2DYS H;  3ASN H;  4P96 A;  3L2C A;  4D1Q A;  2V26 A;  2X48 A;  3TED A;  2X1D A;  3HDD A;  1FMV A;  2EIN H;  5J6X A;  3CCQ I;  2DMP A;  3G1O A;  1QGP A;  5FFZ A;  3TW7 A;  4NDL A;  4X1E A;  4LG3 A;  1ZLJ A;  4EJO A;  3NEU A;  4CZZ A;  3QPT A;  1MBF A;  2XHK A;  4E7L A;  2HOS A;  2LF7 A;  2DXI A;  1HOM A;  1XSV A;  3RPU A;  1D3Y A;  2QBY A;  3FHZ A;  2A07 F;  1I6H J;  3BTJ A;  2WTE A;  3TOA A;  2E5N A;  1YS7 A;  2CGP A;  2V9V A;  2ICW G;  3DU5 A;  2AS5 F;  3OYN A;  4BXU A;  2L54 A;  2YX7 A;  2VON A;  4PJM A;  5FRO A;  2CUF A;  3BG6 A;  2CQK A;  1I6X A;  4N9I A;  4E7H A;  4IPA A;  5C4X J;  2YX4 A;  3LNQ A;  2RQQ A;  3S2H J;  1EKE A;  3GME A;  4HRI A;  3BZC A;  4AU7 A;  1ULY A;  2BOL A;  3G71 I;  1WJE A;  2WY8 Q;  1XMK A;  1WHU A;  3BQZ A;  4FIS A;  4JQF A;  5B5E C;  2VC0 A;  4RS8 A;  3DF8 A;  5HOO A;  1ZG5 A;  1XCB A;  2BHY A;  3B02 A;  3E6B A;  3ABU A;  1MMN A;  1IW7 F;  3LMM A;  3W3C A;  3GTG J;  2ZJ2 A;  3BTL A;  4G6D A;  2HQA A;  2ELJ A;  3K10 A;  4L5J A;  4A0Z A;  2GIV A;  4E7J A;  4A3K J;  2X4H A;  3RDI A;  1LNW A;  3CUQ B;  2XIG A;  3T8T A;  2G7H A;  3IH2 A;  1MDM B;  4BQA A;  1M1E B;  3WGG A;  4HX4 A;  2OUM A;  4DYQ A;  9ANT A;  2K86 A;  2CV2 A;  2WAE A;  2VPL A;  5L3E A;  4J01 A;  5HLT A;  2HDW A;  2CG4 A;  2X6O A;  3ISP A;  4ZDL A;  2NS7 A;  5M5X J;  4L9J A;  1FEX A;  3S16 J;  4E7I A;  4XRF A;  5AON A;  1E3H A;  1BOB A;  3H36 A;  2EQR A;  4A3L J;  4XLF A;  5IT9 Z;  3E6D A;  2F4I A;  1PDN C;  4CDG A;  3I55 I;  3HHG A;  2JK3 A;  3FXQ A;  2UXN A;  4HLX A;  1OR7 A;  3HPH A;  2BW3 A;  4IZZ A;  1DDN A;  3F8N A;  4ESF A;  4BBR J;  3I4N J;  2BY3 A;  2KIM A;  2STW A;  3F23 A;  3TQN A;  1KU3 A;  2JPB A;  1B9M A;  4EM0 B;  2MC3 A;  1SFK A;  4GRI A;  2UXX A;  2XF6 A;  1LFU P;  3IWF A;  1IN8 A;  4X6A J;  2ID6 A;  1SC7 A;  3OIP A;  4B8X A;  1ZEL A;  2J5O A;  2L7Z A;  1QPM A;  2DAO A;  3I54 A;  4HLY A;  5FD6 A;  4BBS J;  4A3C J;  2E1N A;  2K85 A;  5DM6 F;  1N77 A;  3Q3S A;  3NWT A;  3GLL A;  3CJT B;  2PMH A;  1R5I D;  5GPC A;  2HGC A;  4RGR A;  2VB6 A;  2XVC A;  3BPV A;  3BZ6 A;  1KU2 A;  2RRE A;  4HDU A;  4C3J J;  3OYC A;  1OR7 C;  2CH0 A;  4N9H A;  4DJA A;  1AHD P;  1QQI A;  1U6G A;  3BQY A;  4Y52 J;  4C2M J;  3ONQ A;  1JKP C;  3K69 A;  1ZRE A;  2A5W A;  4OIP F;  4A0X A;  2KKO A;  1RNL A;  5DCM B;  4BXF A;  1W0T A;  1W7P B;  1MW7 A;  4L9T A;  1DP3 A;  5FRN A;  1Z67 A;  1X1P A;  4E4H A;  2QCO A;  4EJU A;  4OIN F;  2R0Q C;  3ASO H;  2V79 A;  1OLT A;  1FNN A;  2L01 A;  2ZB9 A;  3TO6 A;  5F1J A;  1QVT A;  3MZH A;  4KUM A;  3D5S C;  3VSK A;  1NG6 A;  1FP2 A;  1N25 A;  2I5U A;  1LB2 A;  3BLY A;  1WH5 A;  3RJP A;  1HXD A;  1WJA A;  3BOQ A;  2Z16 A;  1IZ1 A;  4PZJ A;  2Y9Z A;  2Z3Y A;  1FTZ A;  3ABT A;  4IF4 A;  1IXC A;  2ZME A;  4XN3 A;  4KIC A;  2KRC A;  3L2Q A;  3J80 Z;  4HG2 A;  3O8H A;  4LD5 A;  3W6V A;  3BTC A;  4KIG A;  4M9X A;  3BJA A;  4B47 A;  5E3N A;  2PN6 A;  2ZJR F;  2ADU A;  2HOA A;  1SD6 A;  3HKZ A;  2ECC A;  3OOP A;  3VYU B;  2GQQ A;  1TQM A;  1NTC A;  4CCM A;  3OY9 A;  5CVR A;  1HKQ A;  3H5R A;  2E60 A;  1TT5 B;  3ZQF A;  4LB5 A;  3QP5 A;  1FC3 A;  5IY5 H;  3GTJ J;  2NNY A;  1K4T A;  2MD0 A;  2HYJ A;  3RKY A;  3DEE A;  1K7A A;  1YG2 A;  3L09 A;  2RDP A;  5EG0 A;  3QQA A;  1VQM I;  1ETW A;  3E6M A;  1FY7 A;  3BR6 A;  3NAR A;  4XMY A;  1F36 A;  1PUE E;  2IS1 A;  4IQ4 A;  5CJ9 A;  2HYF A;  2EZI A;  2IAI A;  3WU2 C;  3OYB A;  1Z7U A;  2FEZ A;  2KRH A;  2ZXW H;  3HOT A;  1ZYR F;  3ZR8 X;  1H0M A;  2QUF A;  3CJR B;  5HS9 A;  3OSF A;  2PFB A;  3W2W A;  3W6K B;  3RPU D;  1A31 A;  4Q48 A;  1T38 A;  1MSF C;  3KYD B;  3DTI A;  2QSF X;  2DFI A;  3WGI A;  3IC7 A;  1HBX G;  1P7I A;  4WK8 F;  3N4M A;  2VC1 A;  1R71 A;  1MMD A;  1WCM J;  2OAZ A;  3HOV J;  1POG A;  3CMY A;  3GFL A;  1A5J A;  4L0Z B;  2DA4 A;  2LDU A;  2GXA A;  1H8A C;  1X1A A;  3K2A A;  2DK5 A;  1LE8 A;  3G1M A;  4RLF A;  2BY0 A;  4A5N A;  1ZN2 A;  4KA4 A;  1IRF A;  5F0C A;  4U7B A;  2LY9 A;  4BHP A;  5FB2 A;  1TC3 C;  4CYD A;  4ENN A;  4I2O A;  3MKY B;  2KJC A;  3CES A;  3RKW A;  2OCE A;  3DQV C;  4HST A;  5DS9 A;  4BE2 A;  2YS9 A;  4P9U A;  1IGN A;  4UVB A;  3L2W A;  2VAS A;  1JT6 A;  2HQR A;  4NC7 A;  5J8C A;  2BVM A;  3CCV I;  3I59 B;  2XAQ A;  4LG0 A;  2DPU A;  4DYR A;  4CHU A;  4A3I J;  2EFO A;  3VOE A;  3M4O J;  2VQH A;  3LSI A;  4M3G A;  4P55 A;  3KE2 A;  1E3O C;  1R4M B;  1X58 A;  2Q2E A;  2XRL A;  2ZXI A;  3FXL A;  4PSX A;  1ZGW A;  1U9N A;  3PQJ A;  3HOX J;  3RSN A;  1VQ5 I;  2O8K A;  1XCV A;  3DPT A;  1EH6 A;  4FCY A;  5IT3 A;  5FLV A;  4XID A;  2GOM A;  4RB2 C;  4HDV A;  1WJF A;  5IOZ A;  1TBX A;  3CTA A;  1X3W B;  3HOY J;  4B1R A;  4YIF A;  4LIT A;  4KIB A;  1MSE C;  2VJ5 A;  3WE3 A;  2DTR A;  5HNH A;  1UFM A;  2R3S A;  2IS6 A;  2W84 A;  1WJ5 A;  5LD2 C;  1BJZ A;  2AQE A;  4RGX A;  3HUG A;  4DW6 A;  3D1N I;  3BG9 A;  3F8C A;  2H27 A;  4XRS G;  5L3G A;  1OCZ H;  3KEY A;  3UKG A;  1FOK A;  3HEF A;  3QYE A;  4XON A;  3I58 A;  5CVJ A;  5HDN A;  3GEZ A;  4JOM A;  2IGK A;  3K4C A;  2L9V A;  2MLK A;  1V55 H;  1IN4 A;  3HSF A;  4C2U A;  3IRQ A;  4MQ9 F;  2DDA A;  2W4S A;  2P7V B;  4WXH A;  2BXY A;  4EQQ A;  4IHT A;  4A3F J;  5F08 A;  2F5D A;  3I71 A;  4GCV A;  2M9H A;  3I5U A;  1QO0 D;  2LY1 A;  1TWC J;  5GP9 A;  5EEG A;  2H94 A;  3OYH A;  1JI8 A;  5EEH A;  2BHZ A;  4OMZ A;  4Z2Y A;  3P9I A;  3VFZ A;  4M3F A;  5KHD A;  4A3B J;  1F43 A;  4J00 A;  1X1D A;  3OSG A;  1XMX A;  2F4O B;  1FP1 D;  2WV0 A;  1Z05 A;  3IWZ A;  2XAF A;  2WAQ N;  1OYW A;  4NQW B;  3Q0U A;  1K4S A;  2KJB A;  1KU9 A;  4BJT A;  1R1U A;  2DTZ A;  3AG4 H;  4QSH A;  4L9V A;  3LQQ A;  3ZPL A;  4W97 A;  2BY1 A;  2HS5 A;  2KDZ A;  5LLQ A;  3IH4 A;  3JW4 A;  2TCT A;  3S17 J;  1DU0 A;  1AU7 A;  4OOI A;  3T5X A;  4ZYE A;  4P9F A;  2JSP A;  1OYI A;  5KK1 A;  4BE1 A;  4BEH A;  3BZK A;  2DMT A;  4O5V A;  4BAC A;  1HW2 A;  1ETV A;  4ZC3 A;  2G7U A;  1BW5 A;  1I3Q J;  3H3U A;  3WTU C;  1TLH B;  4JP0 A;  2O03 A;  2RQP A;  3KEO A;  2H09 A;  4CCJ A;  4HF2 A;  1DPU A;  2ZSH B;  3PQK A;  1GV5 A;  3KP2 A;  3CMA I;  2RNJ A;  1X4P A;  4OAY A;  2V1X A;  2CYY A;  4JX5 A;  4FX4 A;  4WCG A;  2VE8 A;  2NAZ A;  3CCR I;  5E3L A;  5BOX A;  2IA1 A;  3AL0 B;  4IQJ A;  2RAE A;  1UG2 A;  4FE4 A;  3R6S A;  1XGS A;  2FD5 A;  3WTY C;  5K5O A;  1HST A;  1LDK B;  1X3Z B;  2M2E A;  2ZBK A;  2QZ8 A;  3EET A;  3O8G A;  3RZO J;  1Y0U A;  1LFP A;  2Z5U A;  4FE7 A;  2JRM A;  3KLO A;  3L00 A;  2E1M B;  3FDY A;  3K4J A;  2LRD A;  2DK8 A;  4KT6 A;  5GAH J;  2VI6 A;  2HVS A;  4MO7 A;  4A3D J;  2FMY A;  1ZG3 A;  4RAY A;  4XLE A;  2OZU A;  1SVM A;  1BOA A;  2BV6 A;  1XC5 A;  5E1X A;  2PJP A;  3OWT A;  4IL6 C;  2CO5 A;  2ESN A;  4AD9 A;  4NB5 A;  3J81 K;  4EVI A;  1JKQ C;  3DV8 A;  2V7F A;  2VKV A;  3IL2 A;  2VQL A;  4HF0 A;  5IP9 J;  1O3T A;  1EV7 A;  1RC9 A;  5CVI A;  1H9T A;  3IHU A;  4XKC A;  3ZMU A;  3BCB A;  1JKR C;  3WTV C;  2L0K A;  3DCF A;  2OBP A;  4AID A;  4R8H A;  4XOT A;  3U1K A;  4BQO A;  3PM1 A;  4WX9 A;  2CFX A;  5A2Q Z;  2IXS A;  3LSP A;  2K27 A;  3JR9 A;  4EGZ A;  1QHG A;  2HQN A;  3GUD A;  2WAQ A;  5D8K B;  1APL C;  1Y39 A;  2JA7 J;  5L3F A;  1YRN B;  2EV0 A;  2MA3 A;  4IHX A;  1MNM C;  1P9Q C;  1FBU A;  3SHF A;  2P6T A;  1BI3 A;  2W48 A;  3PFY A;  4C3H J;  3MAJ A;  2XAH A;  5AIQ A;  3IKT A;  5EYR A;  3JRE A;  4K2E A;  5LBQ A;  1O7L A;  2CQQ A;  2COB A;  5DCF A;  4OAZ A;  3LST A;  1J59 A;  1CF7 A;  1KA8 A;  1KYZ A;  1JJ6 C;  2FOK A;  4PJJ A;  3V42 A;  1K83 J;  3K4M A;  2XPW A;  3WTZ A;  1B59 A;  1JJ8 C;  3I4M J;  3I9V 2;  4HNU A;  3RZD J;  3KPH A;  3JRH A;  2EIM H;  1FYK A;  3K4L A;  1Z21 A;  3COA C;  3HOU J;  1SFX A;  3ERE D;  2MGQ A;  5IP6 A;  3T0Y A;  1R00 A;  3K9T A;  1VQ9 I;  3MKZ A;  3S14 J;  2EV6 A;  1DQU A;  4U0V A;  4NHJ A;  2GLO A;  3CCM I;  4R1H A;  4LB6 B;  3LFU A;  3CCJ I;  3LFK A;  1LVA A;  3RKQ A;  1TW2 A;  5JR3 A;  2QGU A;  5JVT A;  4MTE A;  1LQ1 A;  5CKT A;  3AKZ A;  1D5Y A;  2XF7 A;  1BIA A;  4UV8 A;  4AYB A;  3AAF A;  1GUU A;  1J9I A;  1YHQ I;  3GBG A;  4AVP A;  2LBF A;  3M8E A;  3W2V A;  1FLI A;  2B7E A;  3PIO F;  1G6N A;  3CO6 C;  2A6E F;  2HXO A;  4QTR A;  3G2B A;  1U78 A;  4RBO A;  3BRO A;  1YW9 A;  5D4S A;  2E36 A;  4N0B A;  5E3O A;  1GVJ A;  4UVC A;  5DCM A;  3BCA A;  2IJL A;  1Y8Q B;  5GAD J;  4UUV A;  5FKK A;  3S8P A;  2CW8 A;  4XR6 A;  1ACI A;  1H88 C;  1R4N B;  3OIO A;  4CZC A;  1HDP A;  3M1E A;  3EQL F;  1YE9 A;  1IF1 A;  2WAD A;  1LJ9 A;  4IHY A;  2LH9 A;  4V19 K;  2L3D A;  5K7F A;  3WU0 A;  3I53 A;  4YEJ A;  3RKX A;  5TIS C;  3HHH A;  1J09 A;  1F9N A;  1IUF A;  1Z1D A;  3TGN A;  3GTO J;  4DBQ A;  5FJ8 J;  3LOC A;  3QAH A;  2LF8 A;  2IVM A;  2BGC A;  3T8R A;  4BL0 B;  1WI3 A;  3P9C A;  4PGH A;  3TP3 A;  3OYD A;  1O3R A;  4UUT A;  1HKT A;  1YIJ I;  2JN6 A;  1ZGA A;  3G6E I;  1FBQ A;  3SFI A;  4KFC A;  5J3L A;  1AWC A;  2R7T A;  5IYD J;  1EF4 A;  2JUC A;  5FLX Z;  5CVV A;  1U5T A;  2IGM A;  2L7K A;  2N8G A;  3S3O A;  1T98 A;  1FPQ A;  4DZP A;  2RVC A;  4MQV A;  5C4J J;  2E1C A;  2LC2 A;  1R6R A;  1UMQ A;  3CO7 C;  4XLN F;  1JHH A;  4OU0 A;  5GPA A;  2A5Y B;  4BYY A;  2DN0 A;  2PBI A;  5F0F A;  3VOD A;  2P8T A;  4LMY A;  4NNJ A;  3C2H A;  2HTJ A;  1V54 H;  4UUS B;  2M45 A;  1K6Y A;  3OL4 A;  4GGG A;  3ZMV A;  3BPX A;  4PFO A;  2EZL A;  2LY2 A;  4C30 A;  5FRM A;  2MAB A;  2UV1 A;  4HQE A;  2UZK A;  4XLC A;  1IDZ A;  1O57 A;  4MEX F;  1BR1 A;  3OS2 A;  3CME I;  2ZJP F;  1T0F A;  3HRM A;  2K9M A;  4A3E J;  3BTI A;  2UUZ A;  2LG4 A;  5DTD A;  2R5Z B;  3DKX A;  2O9L A;  4L0Y B;  2L7M P;  2JWT A;  5LEJ A;  4JK1 X;  2DDB A;  1U5T C;  2DYR H;  2V1U A;  2P5V A;  5JFR A;  1FBS A;  2DU9 A;  5TGT A;  3MVP A;  3E7L A;  3I0T A;  3S3M A;  2OJE D;  3N05 A;  1J2X A;  4XSX F;  2HOE A;  3AG1 H;  2V9P A;  3MN2 A;  1LDD A;  1ZRF A;  2VOD A;  1OCT C;  2DMN A;  2M87 A;  1MBG A;  1WWX A;  1W5T A;  1LVK A;  2DA1 A;  1X4O A;  3EDP A;  3ZQH A;  4E6K G;  2R7F A;  2W85 A;  3TBI A;  2KPM A;  1UHW A;  3ZMS A;  1YX5 A;  4XKW A;  2CU7 A;  4D5F A;  2DOF A;  3HOW J;  3O6B B;  5H2F C;  1J5Y A;  2ZJQ F;  4BUP A;  2X6W A;  1QVU A;  1E17 A;  4JX6 A;  5ERI A;  2XAJ A;  1IRX A;  4OWR B;  3EYI A;  1D1C A;  1T0F C;  4II2 A;  1OCR H;  4LFU A;  3S3N A;  4BHC A;  5J1R A;  1BJA A;  1T6S A;  2DJN A;  4XM3 A;  2Y0S A;  2PEX A;  3VYR B;  2XGX A;  1QZY A;  1RZ4 A;  4XOR A;  4NUB A;  1D0Y A;  3JRC A;  1WSU A;  1JTX A;  1SFE A;  4HNV A;  2R5Y B;  2QKL B;  3CCE I;  3AFH A;  3PUF A;  5H20 A;  2XAS A;  3TDU C;  1AKH A;  1RUN A;  4C2T A;  1ZTR A;  3GTQ J;  2D5V A;  2VXD A;  4BY1 J;  5D6E A;  4J19 A;  5E8G A;  2QA4 I;  5F1R A;  3RQI A;  5HOD A;  2DA7 A;  3CJQ B;  3OMY A;  1QU3 A;  2VJ4 A;  1P2F A;  3CCY A;  1YOV B;  5JLW A;  2X1C A;  1ZR4 A;  2JZY A;  1HA8 A;  2LMD A;  3I3L A;  2VE9 A;  2CS3 A;  5GAE J;  5JI6 A;  5DD4 A;  1TWF J;  2EJR A;  2EK5 A;  1TWH J;  3F6O A;  5LEK A;  2EFW A;  1K79 A;  1OCP A;  2M4G A;  4TV7 A;  1F5T A;  1S5L C;  3LSM A;  5L3C A;  3HRT A;  1E2X A;  2ZO4 A;  4ZYD A;  2BEO A;  4F91 B;  1E3P A;  3FMR A;  4M73 A;  4BQN A;  2W82 A;  2Y2Z A;  1ETY A;  4RAG A; 
#chains in the Genus database with same CATH homology
 2W7N A;  1X1A A;  1NG7 A;  1V5E A;  4XLA A;  2ZFU A;  4BS9 A;  2IS2 A;  3W2A A;  2CV0 A;  3HUG B;  3H5A A;  4RLF A;  2R7V A;  2X51 A;  3DTK A;  4FET A;  3QYF A;  3OS0 A;  2VLA A;  2IS4 A;  2XSJ C;  4N4O B;  3M8J A;  4U7B A;  1WFX A;  5CQG A;  3HC7 A;  2L9S A;  4ZJZ A;  4ZTJ A;  3VDX A;  3MKY B;  3CES A;  4HST A;  3DQV C;  4BE2 A;  2VKH A;  1ERD A;  3D5R C;  4E7Z A;  2HU9 A;  3PNT A;  2AQF A;  3DPL C;  3L2W A;  2VAS A;  3K4B A;  4NC7 A;  2BVM A;  4QPO A;  3OYE A;  4IKF A;  2PJR B;  1DGW Y;  4B48 A;  2JVH A;  4XOP A;  4LIV A;  4Y3O A;  3FBN B;  3TMO A;  2VQH A;  3LSI A;  1G8X A;  2WAF A;  1E0E A;  2M7A A;  3H5N A;  3MMY B;  3PNY A;  4Y33 A;  1D0Z A;  4U87 A;  3OS1 A;  2ZXI A;  4P1W A;  4PSX A;  1MMA A;  4ZYA A;  3HXL A;  4EAT A;  3RSN A;  5HNF A;  2MFZ A;  3DPT A;  4F52 A;  4IX7 A;  2GOM A;  1WJF A;  1UAA A;  3CZ6 A;  4LIT A;  2HVQ A;  4BU2 A;  2VJ5 A;  3VWB A;  2MC4 A;  2KZV A;  5HNH A;  2L9N A;  2IS6 A;  1WJ5 A;  4RMN A;  5LD2 C;  2JVG A;  2KMU A;  2AQE A;  2KP6 A;  2JA2 A;  3PSF A;  2VL8 A;  2ZXH A;  3RQ4 A;  4B44 A;  2R7W A;  3KEY A;  3OYJ A;  3QYE A;  4XON A;  2BVL A;  4BEH B;  5CQE A;  4P5O A;  3UR3 C;  4JOM A;  3A4C A;  1UEL B;  2IGK A;  3K4C A;  2P0W A;  4C2U A;  4CUG A;  4PK4 A;  4KIT B;  2X6Y A;  2W4S A;  2DJI A;  4BDY A;  2LRE A;  1D0X A;  3DKY A;  3ZQQ A;  2LY1 A;  2PMZ A;  2PJR A;  1BR2 A;  3SYT A;  3OYH A;  4HEA 2;  1JI8 A;  4B43 A;  5KHD A;  4J00 A;  1X1D A;  4PFP A;  2VQG A;  1S9H A;  4KJZ A;  2CMP A;  3IAS 2;  2K5C A;  4XNF A;  4ZDO A;  3DTE A;  2VJI A;  3J7A Y;  4CCK A;  1Y6I A;  2QKM B;  4NQW B;  2HVR A;  4DIQ A;  2WBM A;  2VJJ A;  4BJT A;  2CFO A;  3PJR A;  1TZL A;  3ZXS A;  3QOD A;  1VZ0 A;  1WJC A;  4G6T B;  2E1M C;  1EA3 A;  3CP2 A;  4Y4R A;  2M7B A;  2IGN A;  3HG9 A;  4CCL A;  4AVZ A;  2JSP A;  2DCE A;  4BE1 A;  2L5Q A;  3ZGK A;  3OYM A;  4BEH A;  4BAC A;  3SEQ A;  4E7S A;  4ZC3 A;  3EPZ A;  3OYG A;  2KL4 A;  4CCJ A;  4CSW A;  2ZSH B;  4FAS D;  1X4P A;  4OAY A;  5JHF A;  3H9J A;  4CCO A;  4CH7 A;  3AL0 B;  4IQJ A;  2NOJ B;  3EUA A;  2VQC A;  2M0M A;  3H0D A;  4II3 A;  4XKB A;  1LDK B;  3OYI A;  5KCM A;  3FKJ A;  4X0G A;  1LFP A;  2M3A A;  2E1M B;  3FDY A;  1AA7 A;  4DGW B;  2XC7 A;  4XLH A;  3LSK A;  2XF5 A;  3IP4 B;  3K4J A;  2LRD A;  4D9J A;  4KT6 A;  2A6T A;  4YEL A;  2HVS A;  3SDB A;  3OYL A;  2R7X A;  4RM3 A;  3DPU A;  2KLO A;  3BG7 A;  4BGD A;  1BR4 A;  4XLE A;  2V4J C;  4HNT A;  1Z7L A;  4XKV A;  1V5G A;  3OWT A;  3DWL E;  4CA0 A;  5HVQ C;  4DBR A;  1FMW A;  4ANJ A;  2MYS A;  2V7F A;  3IAM 2;  3K6G A;  1D1A A;  2OV7 A;  2VQL A;  3E0J B;  3L2U A;  2R7S A;  4XL9 A;  4ITV A;  5CPR B;  2R7R A;  3PNV A;  4XKC A;  3BCB A;  2HPM A;  4D1Q A;  2CUZ A;  1Y56 A;  4XOT A;  2V26 A;  2X1D A;  2WY7 Q;  4BQO A;  2LYC A;  1FMV A;  2DT6 A;  1N75 A;  2IXS A;  3OL3 A;  1QHG A;  4PUS A;  3MKW B;  2VIX A;  2WAQ A;  2LBF B;  3A2K A;  4LG3 A;  4HPQ A;  3S93 A;  3CMM A;  1P9Q C;  2KDO A;  4YRV A;  3EUK L;  3FHN A;  4E7L A;  3H9Q A;  4N4N B;  3PFY A;  3VSL A;  2M4K A;  2DXI A;  2K9L A;  2DT7 B;  4OAZ A;  2HZD A;  1X19 A;  1LKX A;  2WA0 A;  4PJJ A;  3V42 A;  2E5N A;  3K4M A;  3C2G A;  3DU5 A;  3I9V 2;  4HNU A;  3OYN A;  1TT0 A;  5KNL A;  3ZCO A;  4PJM A;  1X1C A;  5FRO A;  3BG6 A;  2KQR A;  3K4L A;  1Z21 A;  4E7H A;  3QOE A;  4F93 B;  2RQQ A;  1MNE A;  4MLO A;  2X85 A;  3K4N A;  4HRI A;  3MKZ A;  4AU7 A;  3F9K A;  3AL0 C;  1DQU A;  2XAU A;  2BOL A;  3LFU A;  2F5V A;  2R7U A;  1WJE A;  2WY8 Q;  4HSR A;  3TL4 X;  2BW3 B;  4JQF A;  3A1Y A;  5CKT A;  3AKZ A;  3RTR A;  2XF7 A;  4AYB A;  4C9Y A;  5HOO A;  3GBG A;  2LBF A;  3W2V A;  1MMN A;  3LMM A;  3W3C A;  3CF2 A;  4B3X A;  4R79 A;  4PJN A;  3G2B A;  3OOU A;  3OYA A;  2HQA A;  2ELJ A;  3K10 A;  2RNG A;  3KX2 A;  4E7J A;  2R4G A;  3UNG C;  1SAU A;  3BCA A;  2OUM A;  4XN0 A;  3BC8 A;  3S8P A;  2CW8 A;  4XR6 A;  2WAE A;  2CV2 A;  4BJ5 C;  2VPL A;  4J01 A;  5HLT A;  4CCN A;  2HDW A;  4H4K C;  4CZC A;  4QPQ A;  1YE9 A;  4ZDL A;  1WJB A;  2WAD A;  2CV1 A;  2V1N A;  2LH9 A;  3H9G A;  2JUG A;  4YEJ A;  4E7I A;  2L2O A;  1J09 A;  1BOB A;  4DBQ A;  4XLF A;  1Z3X A;  2F4I A;  2HNH A;  1V5F A;  2X6X A;  4BL0 B;  3D5L A;  3RCO A;  2Q1Z B;  2W1O A;  3M1C A;  3OYD A;  1W36 C;  3HPH A;  5LFA A;  2BW3 A;  4IZZ A;  3U21 A;  3OR2 C;  1PYV A;  3H35 A;  4RM2 A;  2R7T A;  1KON A;  1QHH D;  4ZTF A;  2IGM A;  2L7K A;  3S3O A;  1SFK A;  4GRI A;  2XF6 A;  2DOA A;  2LC2 A;  1UG0 A;  3CP8 A;  1R6R A;  3PL8 A;  3OIP A;  3VYT B;  3S32 A;  2OC6 A;  1ZEL A;  2FUG 2;  3OIQ A;  3C2H A;  3PUB A;  2GOX B;  4NNJ A;  4BJ6 C;  1N77 A;  3NWT A;  3HL2 A;  1K6Y A;  3OL4 A;  1W36 D;  4PFO A;  2LY2 A;  4C30 A;  3L2R A;  3QYB A;  1WJD A;  1MMG A;  1U0J A;  5FRM A;  2V9K A;  4PSW A;  2MAB A;  1Z3Y A;  2UV1 A;  2WB1 A;  4XLC A;  2VB6 A;  3SEZ A;  2RRE A;  3OYC A;  2W00 A;  1X1B A;  1OR7 C;  2K3P A;  2CH0 A;  1BR1 A;  4DJA A;  3OS2 A;  3OYK A;  2K9M A;  3ONQ A;  1D1B A;  2UUZ A;  2LG4 A;  2ZSI B;  4BQQ A;  2A5W A;  1G59 A;  3DKX A;  4BXF A;  3VYS B;  1MW7 A;  4NC8 A;  1DP3 A;  5FRN A;  3LSH A;  2R7O A;  4E4H A;  3LL7 A;  1OLT A;  5TGT A;  1T95 A;  3S3M A;  3D5S C;  3E1S A;  3N05 A;  2CW7 A;  2LOO A;  3VSK A;  1NG6 A;  3ZRG A;  3BLY A;  1WJA A;  1N78 A;  2Z16 A;  3HOS A;  4E7K A;  1LVK A;  4XQF A;  1X4O A;  3IUO A;  4E6K G;  3TBI A;  2KPM A;  1YX5 A;  4XKW A;  2XDV A;  1DGR M;  3L2V A;  4XN3 A;  2Z1D A;  2KRC A;  3L2Q A;  2UWM A;  4HG2 A;  4BUP A;  2X6W A;  4F3Q A;  3K70 C;  1IRX A;  4OWR B;  2KHM A;  1D1C A;  2O5R A;  2VKD A;  3MD2 A;  4RLQ A;  1T0F C;  2E5Z A;  4II2 A;  4B47 A;  4BE0 A;  3S3N A;  3HKZ A;  3VYU B;  4CCM A;  3NWS A;  2I8D A;  3LSG A;  3OY9 A;  3OR1 C;  3H5R A;  2E60 A;  4XM3 A;  3K4K A;  2Y0S A;  2Z2S B;  1GLN A;  3EUH C;  3VYR B;  3HPG A;  4ZDP A;  2MD0 A;  4XOR A;  3DEE A;  4NUB A;  1D0Y A;  2QKL B;  1PJR A;  3AFH A;  3KYL A;  2R7Q A;  2X1E A;  4C2T A;  4XMY A;  2IS1 A;  2VXD A;  4IQ4 A;  2CUJ A;  1YX3 A;  3K70 D;  2V6E A;  3HOT A;  3OYB A;  2KRH A;  2IGO A;  3ZR8 X;  4LIU A;  3CJR B;  3CJQ B;  3OMY A;  1QU3 A;  3SZG A;  1MND A;  2VJ4 A;  3W2W A;  4DOZ A;  3RPU D;  3OYF A;  2Q2E B;  4KIS A;  2X1C A;  4F55 A;  1HA8 A;  3DTI A;  3I3L A;  2CS3 A;  3DLA A;  2VXZ A;  2M4G A;  4PJL A;  4BDZ A;  4F92 B;  3LSM A;  3DU6 A;  2HPI A;  1MMD A;  2F6C A;  4F91 B;  3FBI B;  4BQN A;  2W82 A;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...