4NQWB

Structure of mycobacterium tuberculosis extracytoplasmic function sigma factor sigk in complex with the cytosolic domain of its cognate anti-sigma factor rska
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
FELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/protein binding
molecule keywords ECF RNA polymerase sigma factor SigK
publication title Structural basis for the redox sensitivity of the Mycobacterium tuberculosis SigK-RskA sigma-anti-sigma complex
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 25
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nqwB00
2Q1ZB 2Z2SB 4NQWB 3HUGB
chains in the Genus database with same CATH superfamily
2ZXWH 1BW5A 1VF9A 3HKZA 5AONA 4RGRA 3I0TA 1DQUA 2KMUA 1WI9A 1R36A 2PQ8A 2NYXA 2VBXA 3LSRA 1DP3A 2L02A 3MN2A 2R7ZJ 4I99C 4A3MJ 4ZZDA 2AO9A 3EUHA 5FO5A 1E3OC 2EA2A 2EH3A 4PUSA 2E7WA 5LFAA 2V1XA 3DKWA 3FM3A 2IXSA 4JQFA 3RDIA 1IRZA 3RKYA 2DDBA 2LOOA 1L0OC 2ZB9A 4FASD 2QBYA 3BOQA 2JZYA 4MTEA 4BE2A 4JBAA 2AQEA 4BXUA 1D5VA 2NVXJ 2P0WA 3I56I 1ZR2A 1F4KA 4JX6A 3QAHA 2E1OA 1YS6A 3DPTA 4A6EA 2LF8A 1TW2A 2IGMA 1DPUA 1JGSA 2K9LA 1I39A 4GRIA 5FKNA 1U5TC 3CMMA 2E1MB 3JRAA 3JSPA 1D1CA 2HOEA 2GWRA 2CFOA 3JW4A 3TEDA 1Z3YA 1X3ZB 4XBFA 3OSFA 1HA8A 1LPQA 2ID6A 2BY0A 2VJIA 2QVOA 2DODA 3I58A 2ZJQF 2IA0A 3C3WA 2VPLA 2XAHA 5J8CA 1MSFC 3W3CA 2F5EA 3NRVA 3JRDA 2WV0A 1LVKA 1X3WB 3WG9A 4ENMA 2KJBA 2L2OA 4S0HB 2L7MP 4RAZA 3S2WA 2QUFA 3CC4I 2R5YB 1BI0A 2GOXB 2R3SA 1TWHJ 1HKSA 1MJ9A 3F8CA 4CYCB 1ZLJA 2VE9A 2HEOA 1MBFA 3GTPJ 1IRXA 4KICA 1WH7A 1Z7UA 2MABA 3BG6A 3R0AA 2RDPA 2A5YB 4LMYA 4BKXA 4OIOF 3BTLA 4ABZA 1XGOA 2QYOA 5FD6A 5J8FA 5FROA 4JX4A 3L00A 1H89C 2D45A 3JRIA 3DKYA 4UXNA 1K78A 1W5CC 2HWVA 3E0JB 4IHWA 1R1VA 3MKLA 1TBXA 1OCRH 5HS9A 2Q1ZB 3WTXC 5FLMJ 5K7ZA 4X0GA 3DFGA 3C7JA 2V9KA 5E1ZB 4XLNF 5IYDJ 2W4SA 4BE1A 3JRHA 3LSIA 4ZC3A 5B1BH 4NHJA 2OQRA 2K9QA 4B44A 3GTLJ 3Q0UA 4P5OA 1J5YA 2FOKA 1HKQA 3K4KA 2EPFA 3WHBA 1KU9A 2M4GA 3S8PA 3OYFA 3EUHC 1V5FA 2FQ3A 2KT0A 1U6GA 1ZHFA 3CF5F 2V9VA 3S1MJ 1X4PA 2GLOA 2VBWA 1LFBA 5L3DA 5EEGA 4P9UA 2B7EA 1FIAA 2M45A 3SZPA 1K83J 3PQJA 3CCLI 3NEUA 1P7IA 4XLHA 5CVJA 3ONQA 4RS8A 4XMYA 3I4NJ 3LAPA 1C0WA 4MQ9F 4A3FJ 4V19K 1ZGJA 2FEZA 2R7QA 3ABUA 2E5NA 3I71A 1MJBA 3H5RA 4U0WA 1CGPA 2ID3A 5J4VA 2YX7A 2XVCA 2DA6A 3ZQHA 2WADA 3FDYA 2R7RA 1OCOH 5FRMA 2HDCA 4G6TB 4LK1F 3M3YJ 1EKEA 4ESJA 3PL8A 2FNAA 5KNLA 2DA7A 3B73A 3BG7A 5JFRA 2XGEA 2XF5A 3V42A 4BJ6C 3HHHA 4G7HF 1NG6A 5ICFA 3PNYA 1U5TB 3IKVA 1WRJA 3S1RJ 2PMUA 1ACIA 2EZIA 1YO5C 4EATA 1IC8A 3HZJA 4G9YA 4D0PA 2MD5A 4A3GJ 4BL0B 5LHGA 4Y4RA 2NAZA 3QPSA 1R71A 2EFWA 4AYBA 2CV2A 4QPOA 3LSPA 3GLLA 1ETOA 1NTCA 2L0KA 1PUFA 3RQIA 3F22A 1ZRDA 3A01A 1FLIA 1SFEA 2K40A 5HVQC 2XV4S 3MMYB 2VN2A 2Z2SB 1RETA 1WJ5A 4BE0A 3DXJF 5DCFA 3A0BC 3FXKA 5JR3A 3HGGA 3WGHA 2M34A 4NBQA 3WTUC 3PFYA 1VQ8I 2VI6A 2CW7A 4RM3A 3LA3A 2V6EA 3OYDA 1D0YA 4PK4A 1YX3A 2COBA 1WFXA 2KIMA 3FZVA 5HODA 3OYJA 2HOSA 1LB2A 1IZ1A 3G71I 3W6VA 1BBYA 5J1RA 2GXBA 4D7NA 3CD6I 4I7HA 1IUFA 5D4RA 3U21A 3FF5A 3QYFA 4FETA 1SVLA 1USTA 4RAYA 5F1RA 5BPIA 3OS0A 1ON2A 2JPBA 4A3KJ 1SFXA 1W1WE 5HS7A 1VQKI 2MSYA 3GTQJ 2FX0A 2KIUA 1Z21A 1ZGAA 2CUZA 2EFNA 4IO9F 3HG9A 4WWCA 3KE2A 4MFEA 1J75A 3K1NA 1I50J 3N97A 1DPRA 1ULYA 2EIJH 3E3VA 3F6VA 1U8BA 4XRMA 4BYYA 4MQVA 4LITA 2X4HA 5IT3A 3GCMA 4I2OA 3W2WA 4DW6A 4FCYA 2DYSH 3D5LA 1GXPA 1K6OA 3TP0A 1XMXA 2ZFWA 4JK1X 3HDDA 4G7ZF 2HPMA 2JRMA 1XMKA 3G4SI 4RA2A 2NOGA 4XN3A 1R58A 3ZN1A 5EEAA 2CFXA 3DEEA 3N4MA 2HXIA 2KRFA 1FNNA 4U88A 2R7SA 1WJFA 2Q8KA 2H6CA 3DPUA 5E3LA 1K7AA 3QODA 1GV5A 2HTSA 1VTNC 4JOMA 1IN7A 3K4LA 1VQPI 2RAEA 1N75A 4M3GA 1RR8C 1H8AC 5D5VB 5LLQA 2JVGA 4II2A 3A03A 1QGPA 1DU0A 1RR7A 4W1UA 3FHZA 4IHSA 4XOPA 4QLCU 5IOYA 2VODA 1P6RA 2X6WA 1B8IA 1ETWA 2PMZN 3QOPA 2PBIA 2XPVA 3OYLA 3M07A 3S1QJ 1FTTA 4CSWA 4BXXJ 1ZREA 1LVAA 1FP2A 4ASNA 3S14J 2WB1N 2BV6A 4M6VA 3VYRB 1EF4A 4L18B 3I5UA 5BOXA 2P5VA 4R1HA 1MH3A 4E70A 1QZYA 1WJBA 5L3EA 3F3XA 1E17A 1X1PA 1D0ZA 3BR3A 3MKZA 3DBLB 3S32A 3E6BA 2BEOA 4A5MA 2XSJC 4DJAA 1WGXA 3VDXA 1K78B 1JTYA 1YHQI 3HTUA 1VNDA 3DU5A 1DDNA 2CQXA 3FK7A 1UHSA 5TISC 2IA1A 3KLOA 2H6BA 2B0LA 2G7UA 2DTRA 3O2PE 3D5SC 3T5XA 4UUSA 5JI6A 1WWXA 1AA7A 2XPUA 3A4CA 5C44J 3OYGA 2JA8J 1BR1A 3CC7I 4IZZA 3R61A 5J47A 2CW0F 1FC3A 5DCMA 5E3MA 4ETSA 2KQRA 2EBIA 4L0ZB 2VC1A 1MMNA 1U78A 3LQQA 4BU2A 3I9V2 2DMUA 2YX4A 1YG2A 2GZWA 3VB2A 4ZYHA 5GAHJ 3GF2A 3CTAA 5C4XJ 4FISA 1X4OA 3RYRA 3RYPA 2QSHX 2VXDA 4Q48A 2Y2ZA 1PYVA 3G1LA 2X85A 4JP0A 4DYRA 4CO8A 1EH8A 1X19A 3H35A 1OLTA 3OYEA 3ZQCA 1FIPA 2GXAA 1SD7A 2R7TA 1BOAA 2VPRA 3B6AA 1B1BA 1KU3A 4ENJA 3H3VK 4A3DJ 2X1DA 3MQ0A 2IS4A 2UXXA 3AFHA 4GDFA 1SD5A 3FX3A 4GGGA 3WU2C 3FHNA 2VJ5A 4XSXF 3OIOA 2LVSA 4MGRA 1FMVA 3MZHA 2ISYA 2OTJI 1KQ0A 1RKTA 2COMA 3HKZN 1FWZA 1R23A 3VSLA 2RREA 3D0SA 4N9IA 2CU7A 4EJUA 2JK3A 2JVHA 4ZDOA 1JKQC 1FBQA 3TKYA 3GBGA 2L9RA 5HLGA 3I64A 3ZMDA 5JVGF 4IQJA 5DV5A 2HYFA 1XPXA 3EQLF 1TTYA 3FXQA 3WTWC 1UB9A 1Y6IA 4EJOA 4BNCA 3RTRA 4ZJZA 2A68F 1JXSA 1FOYA 1UCRA 2DT6A 4RAFA 5E1WA 1ZARA 1UJ8A 1HOMA 3L2UA 2K7LA 2K9NA 3HRTA 3WTVC 1JKRC 1XGSA 1KU2A 3MD2A 2YS9A 1BI2A 1VQ7I 4FHTA 1QPIA 3CZ6A 2DQLA 3A01B 2EZHA 3HPGA 3QU6A 4S04A 4ESFA 1BM9A 1WSUA 3NAUA 4E7HA 1W7PA 5E1XA 3PJRA 4G94A 2MLGA 3AG2H 3CP8A 1HW5A 1E0EA 2KJCA 4E7KA 1YITI 2MYSA 3KP3A 3QYBA 4CUGA 2D1HA 4F52A 1GLNA 4A0ZA 2MLKA 5DS9A 2MC3A 1S6LA 4Y15A 1YJ9I 4ZYDA 2VOPA 1LEAA 5K7FA 1JT6A 3OYNA 1Z67A 4ON0A 1Y0NA 4U0VA 3BLYA 1MBJA 2XASA 5FD5A 3TO9A 3RKQA 1YTYA 2A69F 3E5XA 3H36A 3CDLA 4EQQA 2CUEA 4MIMA 1P2FA 2GAUA 2LP0A 2EFQA 1K4SA 3I3LA 5HOOA 3FXJA 2HXOA 1ZLKA 1MKMA 3T0YA 4PDKA 1KU7A 2KISA 4Y3OA 4ZZLA 3JR9A 1FYKA 3EYYA 2NVUB 3JRFA 3COAC 5KCMA 1QZZA 4XLAA 2DA2A 2RNGA 2M3AA 3ABKH 3CP2A 1W5TA 3QPHA 4B3AA 2JPCA 1RESA 4A93J 4RGSA 2Z33A 4R79A 1X2NA 2PJPA 3HHGA 1O7FA 1XSDA 1U9OA 3ABMH 2E19A 3PFIA 2I8DA 2M9HA 4KDPA 5HDNA 1BC8C 2OBPA 3S3OA 1YW8A 3BJOA 4HPQA 3DEWA 4J19A 3OY9A 3LFUA 3BG9A 1IDYA 2F6CA 3G3ZA 4ITVA 4RLFA 2PX9A 3E97A 4HF0A 2X1CA 4N0BA 4LJZF 4M3EA 4M6XA 4A0XA 1JGGA 5DM7F 2W84A 4OIPF 2O6GE 2DT5A 4RMNA 5IYBJ 4L5JA 5D5WB 4V2GA 4KIBA 4I6ZA 4PJ0C 1S29A 3CDIA 3KP6A 3ZPLA 1FOXA 2W00A 2OV7A 4O3MA 3J81Z 3QRFF 2P6TA 5L3GA 3AAFA 3KEYA 4BQQA 3SFIA 1IGNA 1G59A 1DGRM 5EZHA 5E18F 4ZDLA 2ECCA 1FOWA 3BQYA 2XKPA 1OCCH 1R1UA 4KISA 5DDGA 1B8IB 5IT9K 2VQLA 4F92B 1T8IA 1ZK8A 2JMWA 4GCVA 1AWCA 3DTEA 2HDDA 3RZOJ 4ZYEA 2OCEA 3GTKJ 1ERDA 1MGTA 2PJRB 2HKOA 2NVYJ 3WE2A 5LGNA 1J09A 2XIGA 4HSRA 4IHTA 1U5TA 1H0MA 2LNBA 2ZXJA 3FMSA 2L7FP 1RIOH 3DTIA 2VQCA 4IL6C 4A3EJ 5F0CA 4GXOA 1KQ8A 5ICGA 1X1AA 1JKPC 3E6MA 3Q0VA 5ED4A 3BP8A 3W6JB 5K1YA 3BCAA 3IWZA 4YIFA 3H9QA 3CJRB 3LA2A 5AIPA 1QO0D 5BPDA 1LE8B 1MSEC 4BBRJ 3BDDA 3K4BA 2VJ4A 3G2BA 4PJJA 5ERIA 2O8KA 4ZTFA 1NH3A 2ELHA 4HSTA 4UUSB 4Q4ZF 2BOLA 3BJAA 3ROUA 2XGDA 1VQ6I 5F04A 4AIJA 1P4AA 2F5VA 1N25A 5DCMB 4ZYAA 1MDMA 4EMSA 3BZ6A 4BXFA 4C2TA 1FX7A 4W97A 2A6HF 3Q9VA 1PP7U 2QENA 5D6FA 3HOVJ 5A2QZ 2QCOA 2HQNA 4UVCA 1EH6A 4ZYGA 4LIUA 4XSZF 2FBIA 1ITYA 1B59A 2DPDA 1TP4A 2ME0A 3BR1A 5FLXZ 2ELKA 3HUGA 2ZNZA 1XGMA 5DUKA 3F72A 5B66C 1S7OA 2YU9J 3DF8A 4A69C 5B3SH 2XRNA 1HKTA 2OQGA 1JUPA 2XB0X 3TO6A 2M2EA 2K4BA 2F48A 2BE5F 5CPRB 4AIDA 3WTSC 4LOCA 2Y48A 4WX9A 4G12A 4D5FA 1R5HA 5D6EA 4U0YA 4HOBA 4TV7A 2W48A 1TNTA 4NC6A 5AIQA 3KEOA 2MGQA 2L9SA 2VKDA 2ESNA 3X2QH 4CZZA 2IBDA 2JSCA 1TQIA 3A02A 3LSTA 3OIPA 1IRFA 1CQTA 3KZIC 3O3KA 1J9IA 5KAFC 2MG4A 4E7LA 2JTVA 4MHGA 3HSRA 1MNEA 2DOFA 2HGCA 3IAS2 3TMOA 5FB2A 3RJPA 1MW7A 4IRGA 4HV5A 5EG0A 1Z7LA 1E2XA 1YW9A 2DAOA 1MMGA 3M1EA 4IEJA 3GTJJ 5FFZA 3BZCA 1XD7A 2XAUA 1RNLA 3H3UA 2QZ8A 3N05A 1A5JA 3RPUD 2JWTA 2LKPA 3LNQA 1OCTC 1H9TA 1FBUA 3CCRI 1ZH5A 2Z1DA 4RB0A 2ECBA 3SFZA 1DU6A 3ASOH 4E7ZA 2CO5A 1X1BA 2QLZA 3MVPA 5GTIC 1W7PB 2OUMA 2KFDA 2MBFA 4IOCF 1VQNI 4IXAA 4CCMA 2JA7J 4ZH4F 3C2HA 2ZMEC 1K6YA 2M1BA 3K6GA 3TW7A 3CO6C 2XAJA 1WQ2A 2RQPA 1TC3C 2X6OA 5DD8A 1PVEA 2QWWA 4BY7J 3S1NJ 1IDZA 4DYCA 3GFJA 2R7WA 4AU7A 2XAFA 3KYDB 4MEXF 4CA0A 1G8XA 5M5XJ 2XF6A 3E5UA 3GMEA 3VYTB 2KKOA 1U2WA 4NB5A 1OISA 3ABTA 2QQ8A 1BOBA 2VT3A 2DA4A 1YQAA 3FBNB 3FISA 1TZLA 1P4XA 4L5IA 1F43A 1V5GA 4PFPA 5E79C 2HFHA 3P9IA 3W2VA 1R4MB 4L0YB 3IV5A 2KRHA 3K4CA 1TQPA 2KL4A 2FD5A 3W2AA 2EINH 2VKVA 3HOUJ 3RKXA 1WJDA 1BI3A 2L54A 3LOCA 4HX7A 2R7OA 1Y1WJ 3HOSA 4CCOA 2CQ7A 2WBMA 4HG2A 2K86A 3OYCA 2UZKA 5CJ9A 1NK2P 2MH9A 4XLFA 3GYHX 2UV1A 4C2UA 2NVTJ 3VPRA 1W7PD 2Z99A 1IV6A 5E8IA 3HB9A 2DK5A 3I54A 1WCMJ 3JCUC 9ANTA 2CYYA 3KLNA 3UNGC 1D1BA 2NXNB 4G8XA 3NWSA 2DA3A 2CV1A 1LKXA 4XORA 1GHCA 3P9CA 4LLNA 4Y33A 1IRGA 2CSOA 4D7MA 5C4JJ 3LSMA 1ZGWA 2F4MB 4CCJA 3GZNB 1FSHA 2ZO4A 3M8EA 4I0BA 4KUMA 1EV7A 2HNHA 1S9HA 3HOXJ 1RC9A 1HXDA 2XF7A 1UHWA 3OYMA 3ECHA 3S16J 3VFZA 4ENKA 1VQOI 5IY5H 4OMYA 3KP5A 1WKMA 3CJTB 2ESHA 1SAXA 2W24A 5E20A 2WA0A 4LLGF 3OYBA 2E2IJ 4CCKA 3BZKA 3OIQA 4AUXA 4FTHA 2Y69H 2HOTA 2M0CA 2O5RA 2KDOA 1XDUA 2DXIA 2X0LA 3OOPA 2L7KA 2IT0A 3EUKL 1EA3A 5L3CA 2XC7A 2EIKH 3AL0C 3ZN0A 5JLWA 5K5RA 1MMDA 4ZDPA 2ZKZA 4FX0A 2NNYA 2PMHA 3TO7A 2HR3A 1XSVA 5IYCJ 1MNDA 4C3IJ 2QSFX 3JTHA 5KAIC 1G3TA 1U8RA 1O7LA 4KYWA 3BJ6A 1WHUA 3V7SA 1FYLA 4WXHA 1J2XA 4AWXB 2KZGA 3KYCB 1IAWA 2V26A 1HSTA 2F5DA 2IJLA 3ZQLA 2Y30A 2JQ7A 4CXFA 1JHFA 1W0UA 3BCBA 1E3HA 4Y7NJ 1XSXA 4IX7A 3J7AY 2H1KA 1MDMB 1I1SA 3OL3A 2HQ5A 2VBZA 5J1UA 2E71A 1M1EB 1Z0XA 4QPQA 3CUOA 4YEJA 1V5EA 4ZTJA 4XM3A 4BACA 5BMZA 4S05A 3CC2I 1WZ2A 1TL8A 3CCVI 4LD5A 2IA2A 2DTZA 1IUYA 1O57A 4I02A 5HNHA 3HUGB 4MTDA 3E7LA 2AXLA 2L4AA 1GT0C 3ZQIA 1NG7A 2FJ1A 3BR6A 3K9TA 4O5VA 1LJ9A 2FQ4A 4IOAF 2GOMA 3PNVA 3H1CA 3MKWB 3A0HC 4CYDA 1W36C 1BIBA 2VKEA 2BXZA 3GW2A 3ZQFA 2ZJRF 1S3JA 1QHHD 2K27A 4UVAA 1WH5A 3CF2A 3PUBA 3K2ZA 3BPXA 3ZMVA 4H4KC 3RCOA 3KETA 4C3HJ 2PFBA 2BY3A 1FOKA 3LSKA 1QVTA 2EA4A 3BTJA 2LY9A 3C18A 3F6OA 2AS5F 2NNNA 3KFWX 1Y8RB 2JN6A 3KX2A 5C3EJ 4BHBA 5D8KB 1MH4A 3B6CA 1BL0A 3BY6A 3GXOA 1OCZH 2EB7A 2HTJA 3F0CA 5EG0B 3S15J 1XX5A 1YIJI 1MBKA 2VQHA 1YYVA 4R8HA 3FXLA 1YOVB 2DDAA 5ILVA 1TW3A 2V1UA 2DLLA 3K7AJ 2E60A 1MBHA 2LY2A 2EIMH 3EETA 4UVBA 1HW2A 3KP7A 1FTZA 3D1NI 2E7XA 1S5LC 2GXGA 3VYSB 4A3LJ 2JA5J 1BJAA 2O0YA 5L3FA 3QU3A 2LRDA 2ZJPF 2X9DA 3J81K 2YUSA 2OCCH 1DGWY 2PJRA 4HZFA 2RVCA 2PN6A 2BHZA 4HBLA 2IS2A 4LG3A 3SHFA 2R93J 4F3QA 3CCMI 2JUCA 3L09A 3QPLA 2WWYA 1FYMA 2ZFUA 4MNUA 4QWQA 3CCSI 4N9HA 3AL0B 2A3SA 3CLQA 5HLTA 3J80Z 1FT9A 2NS8A 3DV8A 2H09A 1RRJA 4C3JJ 1LE8A 3QOEA 2M7BA 4B4CA 3VWBA 1G2HA 1K61A 2C6YA 3I4MJ 2DMPA 4A2UA 4XLEA 3ABLH 3DLAA 1G3SA 4BJ5C 4BAYA 1AOYA 1ETQA 1RI7A 3ZXSA 4P55A 4P9FA 4DBQA 2CQNA 2HKXA 2WV1A 4QIWN 1SFKA 3PIOF 3WTTC 2FBKA 3GWZA 4HX4A 4M9ZA 4F55A 3RPUA 3IRRA 2GM4A 5LBQA 4NUBA 2Y31A 4XKCA 2VKHA 1RUOA 1HW1A 1TNSA 4WK8F 1YS7A 5DD4A 1LQ1A 3K70C 1P4WA 3OS2A 2E2JJ 4BY1J 2A6TA 1MIJA 1GUUA 1GV2A 4KN7X 2KIFA 5FRNA 1YFHA 2XAQA 1IXSB 3F8MA 4RBOA 4C2MJ 2BGCA 5DUIA 3FKIJ 2V1DA 4BHPA 5A2QK 2P7CB 5EGOA 4UNOA 2GA2A 2G9WA 3SYTA 1VZ0A 3CMAI 2B9SA 3MKYB 4B09A 5FLVA 1ZG5A 3SZTA 3G1MA 3KIOA 2DA1A 3M9AA 5IP9J 2RV8A 3RQ4A 3CLOA 4D9JA 2R7UA 2QM3A 1YIOA 2HYJA 2VIXA 3M8FA 4Y13A 1T0FC 4UB6C 4B43A 4ESBA 4E7JA 5BS6A 4XK4A 4Y52J 2XUBA 1XGNA 3V8LA 3RI4A 4C9YA 2Q0OA 4M73A 2HQAA 4DZPA 3U9GA 4K2EA 1FSEA 5BQTA 3M8JA 1YLFA 2E35A 2P6SA 3B02A 4PCQA 3ZP5A 2QKLB 2W85A 3IUOA 4IJAA 4M9SA 1Z6RA 5F1JA 4L9VA 3F8FA 2EK5A 2O8XA 2XAGA 2DBBA 2MD0A 4PJMA 4QTRA 2RQQA 3RPQA 1D8KA 5F0FA 1SD4A 3VEPA 4XKVA 3PO2J 1Q1VA 3P9KA 1A6QA 2HVQA 2RN7A 5GPAA 4RB2C 3CCUI 1HLVA 3TQNA 2IEKA 2QQAA 1T95A 4WCGA 5KK1A 2OZ6A 1HQCA 3CCJI 2QQBA 4OIQF 5J3LA 2LG4A 1UG2A 2VL8A 5ICCA 4RM2A 3R6SA 2X51A 4BQAA 4B47A 4IKFA 2Q2EA 4FE7A 2TCTA 5D5XB 1H88C 3I53A 3WU0A 4HX8A 1X1DA 1LUJB 2M87A 2VLAA 4LGWA 1I27A 1TQMA 2KHMA 4M3FA 2DI3A 5KVRA 4O6JA 5DYMA 1OKRA 1YRNA 3C2BA 2K3FA 3G6EI 4BDYA 4GFBA 3DPLC 2R92J 3BC8A 3P7NA 5IP6A 1HCRA 4Z6YA 1USSA 4EM2A 1OR7C 5FKLA 1HBXG 1F1ZA 3O8HA 2LREA 2K9SA 3M4OJ 3OR1C 4EGYA 2V4JC 2XDVA 2F5CA 3GTOJ 2Z3YA 3AG4H 2PLYA 4LB5A 4D1QA 2WAQA 4HQMA 4AD9A 3HRUA 1WJAA 2KRCA 2IGNA 2X1EA 4WXCA 5CVVA 3V8KA 4LIVA 2DU9A 4OIRF 1ZN2A 3OMYA 4FT8A 5IOZA 3SQNA 5FJ8J 2LBFB 1R1TA 2QA4I 4EGZA 3KPHA 5FKMA 3BR2A 4NC7A 1ETXA 1F9NA 3A1YA 3HJEA 1IW7F 1D0XA 4LG0A 3OWTA 2VUMJ 4F91B 3HRSA 3F21A 4HRIA 4AIHA 1I3AA 5F08A 2UUZA 1YI2I 1MZBA 1SANA 1W4MA 1IJWC 2N8GA 1J0RA 2WTEA 2JJ7A 3S2DJ 1OQYA 4BGDA 2MC4A 5B5EC 1RKWA 3BT9A 3WU1B 1OCPA 1IXCA 2Y0MA 2V9PA 2Y9ZA 3L2CA 4Z2YA 2WY7Q 1KONA 1T39A 1SMYF 2LSOA 4HLYA 5D8LB 4KIGA 2X6XA 3FWEA 1S8NA 1WVRA 5J1YA 2Y0SA 4A3BJ 3E5QA 4A6DA 4IVNA 3TGNA 4ANJA 2LH9A 1XC5A 2M7AA 3C1DA 2BW3A 3GLXA 1UFMA 5JHFA 1ON1A 4HNVA 1T38A 5M5WJ 2G7HA 2X6YA 2VT2A 3IH3A 1P9QC 4BS9A 4HAMA 4A5NA 1YE9A 1LEBA 4RB1A 4OAZA 4DBRA 1T56A 1XB4A 1A6IA 1H9GA 2E36A 2H1LA 3ECOA 4I76A 4IF4A 4A0YA 2NS7A 3WHCA 2R4GA 1XS9A 2CQKA 1POGA 4PSWA 3HXLA 5LHHA 2R7FA 3AKZA 2AHQA 1LDJA 2Y75A 5IP7J 1T6SA 2LD5A 2H8RA 1JI8A 3K70D 1QU3A 1PJRA 3H0DA 3ZMZA 1OJLA 3ZQ7A 2JA6J 1B72A 3ML6A 3PM1A 1ZTRA 3LL7A 3PQKA 2ZMEA 2BY1A 2R7DA 2NVQJ 4CCNA 2W7NA 3IP4B 5FGMA 2HVRA 4RDUA 3AG1H 2VB6A 2EILH 4BJTA 4BUPA 1ORKA 2R0QC 2EV0A 1VQ4I 2FUG2 3JRGA 3OR2C 3BR5A 5HNFA 4YELA 2F5FA 3JTGA 3LSGA 5J40A 3R4KA 3GFIA 1R7JA 2K5CA 4U87A 4A3CJ 1HSJA 2LYCA 4XOTA 3ZMUA 2KLOA 1Z1DA 2W57A 5LGTA 4XRSA 4XL9A 3CCEI 2DA5A 1MJAA 3K4MA 4KA4A 2A07F 1I3QJ 2IP2A 3H0GJ 1JE8A 4DOZA 1G3WA 1VFCA 2KDZA 4OINF 3HEFA 4OOIA 3HOWJ 1A35A 3K69A 1KA8A 2LR8A 2IGOA 5EGOB 2P4WA 2LY1A 2M5WA 3BTIA 3DCFA 3SJMA 1FP1D 2FXAA 5JVTA 2EJRA 2DK8A 2W25A 2EV5A 3TBIA 4IHVA 5GAEJ 3QP6A 1BW6A 2FA5A 1FBSA 3F9KA 5GPCA 3ZMTA 1ETYA 3DEUA 4L9JA 1AU7A 1TWFJ 3K4JA 4CH7A 1GVDA 2QF7A 3WGGA 2QSGX 3H9JA 1T98A 2R5ZA 3IAM2 3IHUA 5EYRA 5M5YJ 3OYIA 2DN0A 4YIRX 3LA7A 3WTYC 4LLLA 2ME6A 3M7GA 1L3LA 3IC7A 5H6RA 3DU6A 2XRLA 5GADJ 3HOTA 3PNTA 1JKOC 1EH7A 2IS1A 5M3MJ 1V55H 3KZYA 4KJZA 2BYVE 3E6CC 1T2KA 1ZRCA 3PUFA 1G4DA 1SVMA 2NOJB 1CF7A 3HIFA 5E3NA 4NNJA 2HDWA 4EJWA 1FY7A 1LDKB 5K7HA 3PIPF 2ICWG 3U1DA 1V3FA 2H94A 2HZDA 4HNTA 2IRFG 3OYKA 3R60A 4G6DA 4L9TA 5F64A 3TOAA 2E1NA 1S72I 2WAFA 4LFUA 2Q2EB 5TRDA 1PDNC 3ZMSA 1MNMC 3GUDA 1I1GA 1XTAA 2CH0A 1BR4A 4RLQA 4EJVA 1HC8A 1ZQ3P 2YSRA 4G6QA 2CRGA 3S17J 3BROA 2M8GX 3GFLA 4HQEA 1YRNB 1QVUA 1D5YA 1V54H 4A3IJ 3H92A 3E1SA 3K4NA 4HNUA 2W82A 1P7JA 3J7AO 2XKOA 4NDLA 4B8XA 3CESA 3P5JA 5GP9A 3HPHA 4L5EA 2IGKA 4A12A 2XGCA 3JAMZ 1Y8QB 1U3EM 5ILUA 2HQRA 3LSHA 4M74A 3ZRGA 3VYUB 2ZSIB 3J80K 2EFOA 1LFUP 5JLXA 4BEHB 5H2FC 4I98B 1XG1A 1QBJA 5DTDA 3Q5FA 1R22A 4ENNA 2JT1A 4KIFA 4DYQA 3TP3A 1STZA 3V7CA 1A04A 2O7OA 1Y0UA 2QKMB 4LG0B 3ZQQA 2DCEA 4A3JJ 2HVSA 6PAXA 1B9MA 5EJCA 3IKTA 1OYYA 2DJIA 3BWGA 1NK3P 1O4XA 2PG4A 2OC6A 4EM0B 4XQFA 3DKXA 2IW5A 2OA4A 2Y9YA 2CMPA 4YFXF 2VBYA 3ZQGA 3LAJA 4F93B 2L9NA 4XNFA 2A05A 4YFNF 2LKXA 4I0AA 2LF7A 2GQQA 1Z77A 2IVMA 3FK6A 1IXRC 2MFZA 3CQZJ 4AIKA 2H8WA 1VQMI 3V8JA 5CKTA 2PEXA 3TL4X 4XN0A 4XR6A 3GFMA 3MCZA 4XIDA 1Z91A 1IN8A 1VQ5I 3HM5A 3L2VA 1JJ8C 4XKWA 2BW3B 3KEQA 4HLXA 3Q0WA 2JUGA 5IT9Z 2OAZA 4J01A 1IG7A 3L9FA 2QGUA 3JRBA 1IF1A 2BXYA 3MWMA 4FQGA 2D2WA 4DZJA 2HYGD 3IRQA 2L4MA 3MZYA 1SEUA 1W5SA 3H3ZA 2NRAC 4DGWB 5TJJA 3S2HJ 4AM3A 4U7DA 4HEA2 4KNYA 4H0EA 3NWTA 3ULQB 2LMDA 4PJLA 3DTKA 4KFCA 1R5GA 2CS3A 2BVMA 2CGPA 2K9MA 3H5AA 2HU9A 2P5KA 3G1OA 1N77A 1A36A 1IN6A 3MAJA 2VASA 1B72B 1Y56A 1WPKA 4V2FA 5CVRA 3T1BA 2QEXI 4BDZA 3A2KA 3HRMA 2ZMEB 5LEJA 3HOYJ 1R00A 2XROA 2GA1A 2OZUA 2Z16A 5E8GA 2UWMA 1YJNI 2O03A 3GO5A 4LK0F 5K5OA 5LD2C 2HI3A 2DOAA 1ZAOA 5DEQA 4BHCA 2E1CA 3LWFA 2VOOA 1FJLA 2TRTA 2IPQX 3FXRA 3LSJA 4EVIA 2O3FA 2OF7A 3HSFA 2R7VA 3BR0A 4GO1A 1QRYA 3S3NA 3OS1A 2D5VA 4PGHA 2L7ZA 3V4GA 2E34A 2I5UA 4EJTA 3HGYA 3IWFA 1JUSA 1R6RA 1ZG3A 2W1OA 5IPAA 1KYWA 2OPTA 2DMNA 3L2QA 1Y39A 1JUMA 1AKHB 2LC2A 2RC4A 2GIZA 4XKBA 3NQOA 1T08B 3ESWB 2TDXA 4GYGA 2P7VB 5LGUA 3DBRB 2CW8A 3I55I 1NHAA 2CJJA 2DOEA 1TWCJ 2LBFA 2NS0A 4PJNA 1ZKGA 2LLKA 1VQLI 2FU4A 1R4NB 3I59B 3KP2A 4XLPF 4BH9A 2DFHA 3F23A 4DQ2A 1N78A 2WAQN 4PFOA 1HDPA 3SDBA 1GVJA 2ZCWA 2CV0A 1BIAA 1TLHB 2FOWA 2R5ZB 2V7FA 4CCLA 1DP7P 2Z5UA 2CUFA 1YX5A 5E3OA 1FPQA 3DQVC 4UY8I 5LRRA 2EZKA 3ZGKA 4XICA 4RGXA 3T8TA 1TWAJ 3Q9SA 4QSHA 3VSKA 3PO3J 4PSXA 1TWGJ 1T0FA 2LKSA 3TDZC 4P96A 1SVOA 5CQGA 4HF1A 2D1VA 2QBYB 1WJCA 3HC7A 1R5ID 1ODDA 4J00A 1J7KA 1J59A 4M3BA 3SEQA 2VC0A 2JSPA 1CF7B 4WXDA 1KYZA 3HBLA 1K79A 3OV8A 3TDUC 1RUNA 1WJEA 3I4PA 3FXUA 2IAIA 2K02A 2YPRA 2V1NA 4CZCA 2DO7A 4UHTA 2V79A 4HDVA 4IHXA 5BNGA 3FIWA 2ZXHA 4FE4A 2Y0SN 4HDUA 2M8EA 3J7ZI 2Z9OA 3AG3H 2KP6A 4X1EA 5LHIA 2AQFA 2WAEA 2CQQA 5CQEA 1OYWA 3FMRA 4XLCA 3SDGA 3JREA 1EJ9A 2RNJA 3JRCA 1B9NA 3EUAA 3EDPA 4G7OF 2ZXIA 2DFFA 3KYLA 2L5QA 4AC0A 5CYVA 3RZDJ 3FBIB 5DM6F 1X3UA 2DYRH 3NARA 4RAGA 3T8RA 2FNPA 4IRHA 5EDNA 2P5LC 1YW7A 2XSDC 2A61A 2BVLA 5J4YA 4HW0A 3CUQA 2KIQA 3VODA 3Q3SA 3FKJA 3U1KA 4AVPA 2VJJA 4JYKA 2E5ZA 1ETKA 1WI3A 2OU2A 1F5TA 4I01A 3UR3C 3ZOBA 5D4SA 5EF6A 3L2WA 1MMSA 1SD6A 4FX4A 1U9NA 2ETHA 2ZBKA 5FKOA 2OJED 2UXNA 4KN4X 3K0LA 3JSOA 1X58A 3F8NA 3L7WA 2WC2A 5ICEA 3MZ8A 1OR7A 1KGSA 2LTPA 2P8TA 3MFKA 3OOUA 1TT5B 4YG2F 1BA5A 3SZGA 2VQGA 1B4AA 4XRFA 1GXQA 2AXTC 4XONA 5M3FJ 2VONA 3GX4X 2VE8A 4NQWA 2XHKA 3R0JA 3HTSB 1KQ9A 2M4KA 2F4IA 1VQ9I 2L9VA 4UV8A 5HLHA 4IRIA 2V6CA 3ISPA 2LK2A 3OSGA 1XCBA 4PZJA 5HDGA 3WG7H 1LDDA 4KT6A 1R49A 4BBSJ 5FLXK 1D1AA 3WTZA 2ZNYA 2STTA 2RKHA 2BZTA 3BTCA 1FEXA 1I6HJ 1ETVA 1Z3XA 3LMMA 3CMYA 3G73A 4M72A 3OYAA 2XB5A 1T33A 2PI0A 4OMZA 1FMWA 3GZ5A 1GDTA 3LQRA 1QNTA 1QZEA 4HYEA 2WY8Q 1OPCA 2ZSHB 1V4RA 2DMQA 4E7IA 3QQAA 3CCYA 3IL2A 3KP4A 2OD5A 1JTXA 1BR2A 4L9NA 3RSNA 2L01A 3S93A 2DJNA 1P92A 2DMTA 5LRSA 1BN5A 1I5ZA 4M9XA 5CLSA 2DQRA 3IH4A 5CVUA 1FZPB 1RPWA 2J5OA 1BC7C 5FKKA 4PGGA 1SC7A 2ACJA 5E17F 1BI1A 3RKWA 2LDUA 4KITB 3VOEA 5GTHC 4F7ZA 5CVIA 1PP8F 5EEHA 3GTMJ 1ZYRF 1IV8A 3CUQC 3OL4A 2HOAA 4RB3C 1W36D 2G0EA 1MBGA 3FXOA 2DFEA 3ZR8X 4YFKF 1HF0A 2A5WA 1F36A 1IN4A 1UG0A 3UKGA 3GZ6A 4Q5SF 4XRSG 1X2MA 3SXYA 3TOBA 1PUFB 4MFDA 1ZRFA 2HPIA 1UELB 2DW4A 4B3XA 1O3SA 2BY2A 4Q47A 3MEXA 4EM1A 5H6QA 2R5YA 4UUVA 4IQ4A 3SEZA 1JHHA 2P81A 4B48A 4U7BA 3HL2A 3K10A 4DIQA 4E7SA 4CYCA 1QHGA 3L2RA 1OYIA 3J7YJ 1BJZA 3O6BB 4C30A 1TT0A 1D8JA 2CG4A 3WODF 4HV6A 3E6DA 5HS8A 4YRVA 2FBHA 2GBYA 4N4OB 4X6AJ 4BEHA 3EPZA 1IN5A 2STWA 2F4OB 2FE3A 5K5QA 4N4NB 2BHYA 3M1CA 4AVZA 4M6YA 3ZCOA 3OYHA 1Z9CA 4HA8A 5ILSA 1UAAA 2YU3A 1Q1HA 4NC8A 2ISZA 3PSIA 1G6NA 2I10A 3HYIA 2EFPA 2HS5A 3QYEA 3JAMK 3PSFA 2E2HJ 1QA6A 1ONVA 1S7EA 2MH2A 3DLLF 4E4HA 2LFBA 3CJQB 3CJNA 2EWNA 4OU0A 4M71A 3K1MA 1XMAA 1K4TA 1IO2A 2RGVA 4BQOA 1A31A 4WF2A 5H20A 2FMLA 1XDSA 2XGXA 3ASNH 4JX5A 1PUEE 1I6XA 4E6KG 5LEKA 3CMEI 2JA2A 3EYIA 5F27A 3FM5A 4D5CA 5FFXA 3V7RA 3FXMA 2EQRA 1G3YA 4BQNA 3GTGJ 1VI0A 2A6EF 2KZVA 4UV9A 4GYIA 1UZCA 1QQIA 1R9TJ 2DPUA 4IHYA 3C2GA 3DP7A 3L1PA 1SFUA 1ZR4A 2K4JA 2O9LA 2FRHA 3CCQI 1O3RA 1APLC 1SAUA 4OAYA 3O8GA 2FMYA 2XPWA 1AHDP 2M0MA 2MA3A 3GEZA 2CUJA 3K2AA 4EV0A 5HLIA 2PMZA 3BG3A 5F6FA 3WGIA 4CHUA 2HZTA 3KCCA 3LFKA 3QPTA 3HOZJ 2WB1A 2K3PA 1UHMA 2E1MC 2EV6A 4II3A 2K85A 4RGUA 3DBHB 4MLOA 1O3TA 2R7XA 3U2RA 3GVAA 4B1RA 5L3BA 2EZLA 2MW8A 2YR2A 2FF4A 1REPC 1YJWI 5D5UB 2L3DA 2B63J 2KPMA 1SMTA 5HDKA 1KZHA 4OWRB 1D3YA 3ERED 1MD0A 2ELJA 4LB6B 2GIVA 5EZGA 2DFIA 3H5NA 1U0JA 2ZJ2A 3QWLA 3CUQB 1XCVA 1W0TA 4KMUX 2F2EA 1Z6TA 3IH2A 3CDHA 1O3QA 4CICA 1JJ6C 3K1PA 3CO7C 4IPAA 2DT7B 1ZG1A 4P1WA 2X48A 3S3MA 4CDGA 4CGZA 2FSWA 4UUTA 1Y1VJ 1UMQA 5J6XA 1S7AA 5KHDA 3H9GA 4M3DA 3RIRA 2H27A 3BPVA 3WE3A 1MMAA 5F0HA 3ELKA 2IS6A 1ZELA 5B1AH 4AYBN 4NQWB 2QQ9A 1XN7A 1DUXC 1LFPA 2M30A 4Y17A 1OMIA 3KZZA 1AKHA 1OFCX 2J5PA 1JT0A 3QP5A 1RZ4A 1B6AA 4HF2A 1LNWA 2JRTA 3BG5A 1MBEA 1HDDC 5GAGJ 3FMQA 2VXZA 3ERMA 3HSEA 1X1CA 2ZC2A 1QPMA 1Z05A 3BQZA 2BBYA 3W6KB 5JHUA 1SFOJ 2OTLI 4EEFG 4MO7A 3D5RC 3F8BA 2ADUA 3REOA 1ENHA 3DWLE 3I59A 4KT5C 4MEYF 3TW6A 1E3PA 2CWEA 2O61A 4YIIA 4KMFA 5TGTA 4DNCA 4UB8C 4I09A
chains in the Genus database with same CATH topology
3AL0B 3BLYA 5HLTA 3HKZA 1DQUA 2KMUA 4DGWB 3I3LA 5HOOA 1DP3A 4Y3OA 3QOEA 4HEA2 2M7BA 3NWTA 3VWBA 4PUSA 4XLAA 4PJLA 3DTKA 5KCMA 5LFAA 2RNGA 2M3AA 4XLEA 2CS3A 2BVMA 3CP2A 3DLAA 2K9MA 3H5AA 2HU9A 2IXSA 4BJ5C 4JQFA 1N77A 3ZXSA 4R79A 2LOOA 2VASA 4FASD 1Y56A 4DBQA 4BDZA 1SFKA 3A2KA 4BE2A 2AQEA 2I8DA 2P0WA 2Z16A 4F55A 2UWMA 3S3OA 4NUBA 3DPTA 4HPQA 4XKCA 3OY9A 2VKHA 3LFUA 5LD2C 2DOAA 2F6CA 4ITVA 4RLFA 2IGMA 2X1CA 2K9LA 4GRIA 3K70C 3CMMA 2E1MB 3OS2A 2A6TA 1D1CA 4RMNA 5FRNA 2CFOA 1Z3YA 2R7VA 1HA8A 3S3NA 3OS1A 2W00A 2OV7A 2VJIA 3KEYA 4BQQA 2VPLA 3W3CA 1R6RA 3SYTA 1G59A 1DGRM 2W1OA 1VZ0A 1LVKA 3MKYB 4ZDLA 2L2OA 3L2QA 2LC2A 4KISA 4XKBA 2GOXB 3RQ4A 4D9JA 2R7UA 2VQLA 2VIXA 4F92B 1T0FC 3DTEA 4B43A 4E7JA 1IRXA 2CW8A 2MABA 3BG6A 1ERDA 2PJRB 2LBFA 4C9YA 4PJNA 1J09A 4HSRA 2HQAA 5FROA 1N78A 3DKYA 4PFOA 3SDBA 3DTIA 3M8JA 3E0JB 2VQCA 2QKLB 3IUOA 2CV0A 2Q1ZB 1X1AA 4X0GA 2V7FA 4CCLA 3BCAA 2MD0A 2V9KA 3H9QA 3CJRB 4PJMA 1YX5A 2RQQA 3DQVC 2W4SA 4BE1A 3K4BA 4PJJA 2VJ4A 3G2BA 3LSIA 4ZC3A 3ZGKA 4ZTFA 4XKVA 3VSKA 4PSXA 4HSTA 2HVQA 4B44A 2BOLA 4P5OA 1T95A 3K4KA 2F5VA 5CQGA 1WJCA 2M4GA 3HC7A 3S8PA 4ZYAA 2LG4A 3OYFA 4J00A 3EUHC 4BXFA 2VL8A 1V5FA 3SEQA 4C2TA 2JSPA 4RM2A 1X4PA 2X51A 4B47A 4IKFA 1WJEA 4LIUA 2V1NA 4CZCA 4XLHA 3ONQA 1X1DA 2ZXHA 4XMYA 2VLAA 2KHMA 2KP6A 4BDYA 2AQFA 2WAEA 5CQEA 2R7QA 3DPLC 3BC8A 4XLCA 2E5NA 3H5RA 1OR7C 3EUAA 2ZXIA 5CPRB 3KYLA 2L5QA 2LREA 3FBIB 3OR1C 2V4JC 2WADA 3FDYA 2R7RA 2XDVA 5FRMA 4G6TB 4D1QA 2WAQA 2BVLA 2L9SA 1WJAA 2VKDA 2KRCA 3PL8A 2IGNA 2X1EA 5KNLA 3BG7A 3OIPA 3FKJA 4LIVA 3OMYA 2VJJA 2XF5A 3V42A 4E7LA 2LBFB 4BJ6C 2E5ZA 1NG6A 1MNEA 4NC7A 3PNYA 3IAS2 3A1YA 3TMOA 1D0XA 3UR3C 1MW7A 3OWTA 3L2WA 1Z7LA 4F91B 4HRIA 1MMGA 2UUZA 4EATA 4BL0B 4Y4RA 2XAUA 4AYBA 2CV2A 4QPOA 3OOUA 3N05A 3SZGA 4BGDA 2MC4A 2VQGA 4XONA 3RPUD 5HVQC 3MMYB 2Z2SB 1WJ5A 2M4KA 2F4IA 2WY7Q 4BE0A 2Z1DA 1KONA 2X6XA 4E7ZA 1X1BA 3PFYA 2Y0SA 4KT6A 2CW7A 4RM3A 2OUMA 2V6EA 4ANJA 1D1AA 3OYDA 4CCMA 1D0YA 2LH9A 4PK4A 1YX3A 2M7AA 1WFXA 2BW3A 3OYJA 3C2HA 1K6YA 3K6GA 5JHFA 1Z3XA 3LMMA 2X6YA 3U21A 3QYFA 4FETA 3OYAA 1P9QC 4BS9A 3OS0A 1YE9A 4OAZA 4DBRA 1Z21A 2CUZA 1FMWA 3HG9A 2R7WA 4AU7A 2R4GA 2WY8Q 2ZSHB 4PSWA 4CA0A 3HXLA 1G8XA 4E7IA 2XF6A 3AKZA 3RSNA 1BR2A 3VYTB 4LITA 3S93A 1JI8A 3K70D 1BOBA 1QU3A 3W2WA 1PJRA 3FBNB 1TZLA 3D5LA 3H0DA 1V5GA 4PFPA 3LL7A 3W2VA 2HPMA 4CCNA 2KRHA 3K4CA 4XN3A 2W7NA 2KL4A 3IP4B 4KITB 2HVRA 3W2AA 2VB6A 1WJDA 3DEEA 4BJTA 4BUPA 2FUG2 3OR2C 2R7OA 3OL4A 5HNFA 4YELA 2R7SA 1WJFA 3HOSA 3LSGA 4CCOA 3DPUA 1W36D 3QODA 2K5CA 4U87A 2LYCA 4XOTA 3ZR8X 2WBMA 2A5WA 2KLOA 4HG2A 4JOMA 3OYCA 3K4LA 4XLFA 1UG0A 4XL9A 2UV1A 4C2UA 3K4MA 1N75A 2JVGA 3UNGC 4DOZA 4II2A 1D1BA 2HPIA 3NWSA 1UELB 4B3XA 2CV1A 1LKXA 4XORA 4XOPA 4Y33A 2IGOA 3LSMA 2X6WA 2LY1A 4IQ4A 3SEZA 4CCJA 4B48A 4U7BA 3HL2A 3K10A 4DIQA 4E7SA 1QHGA 3L2RA 3OYLA 4C30A 2HNHA 1TT0A 1S9HA 4CSWA 2XF7A 3TBIA 3OYMA 3VYRB 4YRVA 4N4OB 4BEHA 3EPZA 3F9KA 4N4NB 3M1CA 4AVZA 3ZCOA 3OYHA 3K4JA 4CH7A 1WJBA 1UAAA 1D0ZA 2WA0A 4NC8A 3OYBA 3PSIA 3MKZA 3S32A 3H9JA 4CCKA 3OIQA 2XSJC 3QYEA 4DJAA 3PSFA 3IAM2 3VDXA 3OYIA 2O5RA 2KDOA 3CJQB 3DU5A 4E4HA 2DXIA 2L7KA 3EUKL 1EA3A 2XC7A 4BQOA 3AL0C 1MMDA 4ZDPA 3DU6A 3D5SC 3HOTA 3PNTA 4E6KG 1AA7A 3A4CA 3OYGA 2JA2A 1BR1A 1MNDA 4IZZA 2IS1A 4BQNA 2KQRA 4KJZA 1MMNA 2KZVA 2NOJB 2V26A 3I9V2 4BU2A 4NNJA 2HDWA 3C2GA 1LDKB 3BCBA 4IX7A 3J7AY 2HZDA 4HNTA 3OL3A 3OYKA 4QPQA 1SAUA 4OAYA 1X4OA 4YEJA 1V5EA 2M0MA 2WAFA 2VXDA 4ZTJA 2Q2EB 1PYVA 4XM3A 4BACA 2X85A 1X19A 2CUJA 3H35A 2PMZA 2CH0A 1OLTA 3OYEA 1BR4A 4RLQA 5HNHA 3HUGB 2R7TA 2WB1A 1NG7A 2X1DA 2K3PA 2E1MC 4II3A 2IS4A 3AFHA 4MLOA 2R7XA 3E1SA 2GOMA 3K4NA 3PNVA 2W82A 4HNUA 3MKWB 3FHNA 2VJ5A 1W36C 3CESA 3HPHA 2KPMA 1QHHD 2IGKA 1FMVA 4OWRB 3CF2A 3PUBA 2ELJA 3LSHA 3H5NA 4H4KC 1U0JA 3VYUB 3VSLA 3ZRGA 2ZSIB 3RCOA 2RREA 2JVHA 4BEHB 3LSKA 4ZDOA 3GBGA 4IQJA 3KX2A 1Y6IA 2DT7B 2QKMB 3RTRA 4ZJZA 3ZQQA 2DCEA 4P1WA 2HVSA 2DT6A 3S3MA 2VQHA 2DJIA 3L2UA 2OC6A 4XQFA 5KHDA 2E60A 3DKXA 3H9GA 2LY2A 3MD2A 1MMAA 2CMPA 3CZ6A 4F93B 2L9NA 4XNFA 3HPGA 2IS6A 1ZELA 4NQWB 4E7HA 3PJRA 1LFPA 3VYSB 2MFZA 3CP8A 1E0EA 4E7KA 2MYSA 3QYBA 4CUGA 5CKTA 3TL4X 2LRDA 2VXZA 4XN0A 4F52A 1GLNA 1X1CA 4XR6A 3L2VA 1DGWY 2PJRA 4XKWA 2BW3B 3D5RC 2IS2A 2JUGA 3DWLE 4LG3A 3OYNA 4J01A 4F3QA 5TGTA 2ZFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1Z B;  2Z2S B;  4NQW B;  3HUG B; 
#chains in the Genus database with same CATH topology
 2ZXW H;  1BW5 A;  1VF9 A;  3HKZ A;  5AON A;  4RGR A;  3I0T A;  1DQU A;  2KMU A;  1WI9 A;  1R36 A;  2PQ8 A;  2NYX A;  2VBX A;  3LSR A;  1DP3 A;  2L02 A;  3MN2 A;  2R7Z J;  4I99 C;  4A3M J;  4ZZD A;  2AO9 A;  3EUH A;  5FO5 A;  1E3O C;  2EA2 A;  2EH3 A;  4PUS A;  2E7W A;  5LFA A;  2V1X A;  3DKW A;  3FM3 A;  2IXS A;  4JQF A;  3RDI A;  1IRZ A;  3RKY A;  2DDB A;  2LOO A;  1L0O C;  2ZB9 A;  4FAS D;  2QBY A;  3BOQ A;  2JZY A;  4MTE A;  4BE2 A;  4JBA A;  2AQE A;  4BXU A;  1D5V A;  2NVX J;  2P0W A;  3I56 I;  1ZR2 A;  1F4K A;  4JX6 A;  3QAH A;  2E1O A;  1YS6 A;  3DPT A;  4A6E A;  2LF8 A;  1TW2 A;  2IGM A;  1DPU A;  1JGS A;  2K9L A;  1I39 A;  4GRI A;  5FKN A;  1U5T C;  3CMM A;  2E1M B;  3JRA A;  3JSP A;  1D1C A;  2HOE A;  2GWR A;  2CFO A;  3JW4 A;  3TED A;  1Z3Y A;  1X3Z B;  4XBF A;  3OSF A;  1HA8 A;  1LPQ A;  2ID6 A;  2BY0 A;  2VJI A;  2QVO A;  2DOD A;  3I58 A;  2ZJQ F;  2IA0 A;  3C3W A;  2VPL A;  2XAH A;  5J8C A;  1MSF C;  3W3C A;  2F5E A;  3NRV A;  3JRD A;  2WV0 A;  1LVK A;  1X3W B;  3WG9 A;  4ENM A;  2KJB A;  2L2O A;  4S0H B;  2L7M P;  4RAZ A;  3S2W A;  2QUF A;  3CC4 I;  2R5Y B;  1BI0 A;  2GOX B;  2R3S A;  1TWH J;  1HKS A;  1MJ9 A;  3F8C A;  4CYC B;  1ZLJ A;  2VE9 A;  2HEO A;  1MBF A;  3GTP J;  1IRX A;  4KIC A;  1WH7 A;  1Z7U A;  2MAB A;  3BG6 A;  3R0A A;  2RDP A;  2A5Y B;  4LMY A;  4BKX A;  4OIO F;  3BTL A;  4ABZ A;  1XGO A;  2QYO A;  5FD6 A;  5J8F A;  5FRO A;  4JX4 A;  3L00 A;  1H89 C;  2D45 A;  3JRI A;  3DKY A;  4UXN A;  1K78 A;  1W5C C;  2HWV A;  3E0J B;  4IHW A;  1R1V A;  3MKL A;  1TBX A;  1OCR H;  5HS9 A;  2Q1Z B;  3WTX C;  5FLM J;  5K7Z A;  4X0G A;  3DFG A;  3C7J A;  2V9K A;  5E1Z B;  4XLN F;  5IYD J;  2W4S A;  4BE1 A;  3JRH A;  3LSI A;  4ZC3 A;  5B1B H;  4NHJ A;  2OQR A;  2K9Q A;  4B44 A;  3GTL J;  3Q0U A;  4P5O A;  1J5Y A;  2FOK A;  1HKQ A;  3K4K A;  2EPF A;  3WHB A;  1KU9 A;  2M4G A;  3S8P A;  3OYF A;  3EUH C;  1V5F A;  2FQ3 A;  2KT0 A;  1U6G A;  1ZHF A;  3CF5 F;  2V9V A;  3S1M J;  1X4P A;  2GLO A;  2VBW A;  1LFB A;  5L3D A;  5EEG A;  4P9U A;  2B7E A;  1FIA A;  2M45 A;  3SZP A;  1K83 J;  3PQJ A;  3CCL I;  3NEU A;  1P7I A;  4XLH A;  5CVJ A;  3ONQ A;  4RS8 A;  4XMY A;  3I4N J;  3LAP A;  1C0W A;  4MQ9 F;  4A3F J;  4V19 K;  1ZGJ A;  2FEZ A;  2R7Q A;  3ABU A;  2E5N A;  3I71 A;  1MJB A;  3H5R A;  4U0W A;  1CGP A;  2ID3 A;  5J4V A;  2YX7 A;  2XVC A;  2DA6 A;  3ZQH A;  2WAD A;  3FDY A;  2R7R A;  1OCO H;  5FRM A;  2HDC A;  4G6T B;  4LK1 F;  3M3Y J;  1EKE A;  4ESJ A;  3PL8 A;  2FNA A;  5KNL A;  2DA7 A;  3B73 A;  3BG7 A;  5JFR A;  2XGE A;  2XF5 A;  3V42 A;  4BJ6 C;  3HHH A;  4G7H F;  1NG6 A;  5ICF A;  3PNY A;  1U5T B;  3IKV A;  1WRJ A;  3S1R J;  2PMU A;  1ACI A;  2EZI A;  1YO5 C;  4EAT A;  1IC8 A;  3HZJ A;  4G9Y A;  4D0P A;  2MD5 A;  4A3G J;  4BL0 B;  5LHG A;  4Y4R A;  2NAZ A;  3QPS A;  1R71 A;  2EFW A;  4AYB A;  2CV2 A;  4QPO A;  3LSP A;  3GLL A;  1ETO A;  1NTC A;  2L0K A;  1PUF A;  3RQI A;  3F22 A;  1ZRD A;  3A01 A;  1FLI A;  1SFE A;  2K40 A;  5HVQ C;  2XV4 S;  3MMY B;  2VN2 A;  2Z2S B;  1RET A;  1WJ5 A;  4BE0 A;  3DXJ F;  5DCF A;  3A0B C;  3FXK A;  5JR3 A;  3HGG A;  3WGH A;  2M34 A;  4NBQ A;  3WTU C;  3PFY A;  1VQ8 I;  2VI6 A;  2CW7 A;  4RM3 A;  3LA3 A;  2V6E A;  3OYD A;  1D0Y A;  4PK4 A;  1YX3 A;  2COB A;  1WFX A;  2KIM A;  3FZV A;  5HOD A;  3OYJ A;  2HOS A;  1LB2 A;  1IZ1 A;  3G71 I;  3W6V A;  1BBY A;  5J1R A;  2GXB A;  4D7N A;  3CD6 I;  4I7H A;  1IUF A;  5D4R A;  3U21 A;  3FF5 A;  3QYF A;  4FET A;  1SVL A;  1UST A;  4RAY A;  5F1R A;  5BPI A;  3OS0 A;  1ON2 A;  2JPB A;  4A3K J;  1SFX A;  1W1W E;  5HS7 A;  1VQK I;  2MSY A;  3GTQ J;  2FX0 A;  2KIU A;  1Z21 A;  1ZGA A;  2CUZ A;  2EFN A;  4IO9 F;  3HG9 A;  4WWC A;  3KE2 A;  4MFE A;  1J75 A;  3K1N A;  1I50 J;  3N97 A;  1DPR A;  1ULY A;  2EIJ H;  3E3V A;  3F6V A;  1U8B A;  4XRM A;  4BYY A;  4MQV A;  4LIT A;  2X4H A;  5IT3 A;  3GCM A;  4I2O A;  3W2W A;  4DW6 A;  4FCY A;  2DYS H;  3D5L A;  1GXP A;  1K6O A;  3TP0 A;  1XMX A;  2ZFW A;  4JK1 X;  3HDD A;  4G7Z F;  2HPM A;  2JRM A;  1XMK A;  3G4S I;  4RA2 A;  2NOG A;  4XN3 A;  1R58 A;  3ZN1 A;  5EEA A;  2CFX A;  3DEE A;  3N4M A;  2HXI A;  2KRF A;  1FNN A;  4U88 A;  2R7S A;  1WJF A;  2Q8K A;  2H6C A;  3DPU A;  5E3L A;  1K7A A;  3QOD A;  1GV5 A;  2HTS A;  1VTN C;  4JOM A;  1IN7 A;  3K4L A;  1VQP I;  2RAE A;  1N75 A;  4M3G A;  1RR8 C;  1H8A C;  5D5V B;  5LLQ A;  2JVG A;  4II2 A;  3A03 A;  1QGP A;  1DU0 A;  1RR7 A;  4W1U A;  3FHZ A;  4IHS A;  4XOP A;  4QLC U;  5IOY A;  2VOD A;  1P6R A;  2X6W A;  1B8I A;  1ETW A;  2PMZ N;  3QOP A;  2PBI A;  2XPV A;  3OYL A;  3M07 A;  3S1Q J;  1FTT A;  4CSW A;  4BXX J;  1ZRE A;  1LVA A;  1FP2 A;  4ASN A;  3S14 J;  2WB1 N;  2BV6 A;  4M6V A;  3VYR B;  1EF4 A;  4L18 B;  3I5U A;  5BOX A;  2P5V A;  4R1H A;  1MH3 A;  4E70 A;  1QZY A;  1WJB A;  5L3E A;  3F3X A;  1E17 A;  1X1P A;  1D0Z A;  3BR3 A;  3MKZ A;  3DBL B;  3S32 A;  3E6B A;  2BEO A;  4A5M A;  2XSJ C;  4DJA A;  1WGX A;  3VDX A;  1K78 B;  1JTY A;  1YHQ I;  3HTU A;  1VND A;  3DU5 A;  1DDN A;  2CQX A;  3FK7 A;  1UHS A;  5TIS C;  2IA1 A;  3KLO A;  2H6B A;  2B0L A;  2G7U A;  2DTR A;  3O2P E;  3D5S C;  3T5X A;  4UUS A;  5JI6 A;  1WWX A;  1AA7 A;  2XPU A;  3A4C A;  5C44 J;  3OYG A;  2JA8 J;  1BR1 A;  3CC7 I;  4IZZ A;  3R61 A;  5J47 A;  2CW0 F;  1FC3 A;  5DCM A;  5E3M A;  4ETS A;  2KQR A;  2EBI A;  4L0Z B;  2VC1 A;  1MMN A;  1U78 A;  3LQQ A;  4BU2 A;  3I9V 2;  2DMU A;  2YX4 A;  1YG2 A;  2GZW A;  3VB2 A;  4ZYH A;  5GAH J;  3GF2 A;  3CTA A;  5C4X J;  4FIS A;  1X4O A;  3RYR A;  3RYP A;  2QSH X;  2VXD A;  4Q48 A;  2Y2Z A;  1PYV A;  3G1L A;  2X85 A;  4JP0 A;  4DYR A;  4CO8 A;  1EH8 A;  1X19 A;  3H35 A;  1OLT A;  3OYE A;  3ZQC A;  1FIP A;  2GXA A;  1SD7 A;  2R7T A;  1BOA A;  2VPR A;  3B6A A;  1B1B A;  1KU3 A;  4ENJ A;  3H3V K;  4A3D J;  2X1D A;  3MQ0 A;  2IS4 A;  2UXX A;  3AFH A;  4GDF A;  1SD5 A;  3FX3 A;  4GGG A;  3WU2 C;  3FHN A;  2VJ5 A;  4XSX F;  3OIO A;  2LVS A;  4MGR A;  1FMV A;  3MZH A;  2ISY A;  2OTJ I;  1KQ0 A;  1RKT A;  2COM A;  3HKZ N;  1FWZ A;  1R23 A;  3VSL A;  2RRE A;  3D0S A;  4N9I A;  2CU7 A;  4EJU A;  2JK3 A;  2JVH A;  4ZDO A;  1JKQ C;  1FBQ A;  3TKY A;  3GBG A;  2L9R A;  5HLG A;  3I64 A;  3ZMD A;  5JVG F;  4IQJ A;  5DV5 A;  2HYF A;  1XPX A;  3EQL F;  1TTY A;  3FXQ A;  3WTW C;  1UB9 A;  1Y6I A;  4EJO A;  4BNC A;  3RTR A;  4ZJZ A;  2A68 F;  1JXS A;  1FOY A;  1UCR A;  2DT6 A;  4RAF A;  5E1W A;  1ZAR A;  1UJ8 A;  1HOM A;  3L2U A;  2K7L A;  2K9N A;  3HRT A;  3WTV C;  1JKR C;  1XGS A;  1KU2 A;  3MD2 A;  2YS9 A;  1BI2 A;  1VQ7 I;  4FHT A;  1QPI A;  3CZ6 A;  2DQL A;  3A01 B;  2EZH A;  3HPG A;  3QU6 A;  4S04 A;  4ESF A;  1BM9 A;  1WSU A;  3NAU A;  4E7H A;  1W7P A;  5E1X A;  3PJR A;  4G94 A;  2MLG A;  3AG2 H;  3CP8 A;  1HW5 A;  1E0E A;  2KJC A;  4E7K A;  1YIT I;  2MYS A;  3KP3 A;  3QYB A;  4CUG A;  2D1H A;  4F52 A;  1GLN A;  4A0Z A;  2MLK A;  5DS9 A;  2MC3 A;  1S6L A;  4Y15 A;  1YJ9 I;  4ZYD A;  2VOP A;  1LEA A;  5K7F A;  1JT6 A;  3OYN A;  1Z67 A;  4ON0 A;  1Y0N A;  4U0V A;  3BLY A;  1MBJ A;  2XAS A;  5FD5 A;  3TO9 A;  3RKQ A;  1YTY A;  2A69 F;  3E5X A;  3H36 A;  3CDL A;  4EQQ A;  2CUE A;  4MIM A;  1P2F A;  2GAU A;  2LP0 A;  2EFQ A;  1K4S A;  3I3L A;  5HOO A;  3FXJ A;  2HXO A;  1ZLK A;  1MKM A;  3T0Y A;  4PDK A;  1KU7 A;  2KIS A;  4Y3O A;  4ZZL A;  3JR9 A;  1FYK A;  3EYY A;  2NVU B;  3JRF A;  3COA C;  5KCM A;  1QZZ A;  4XLA A;  2DA2 A;  2RNG A;  2M3A A;  3ABK H;  3CP2 A;  1W5T A;  3QPH A;  4B3A A;  2JPC A;  1RES A;  4A93 J;  4RGS A;  2Z33 A;  4R79 A;  1X2N A;  2PJP A;  3HHG A;  1O7F A;  1XSD A;  1U9O A;  3ABM H;  2E19 A;  3PFI A;  2I8D A;  2M9H A;  4KDP A;  5HDN A;  1BC8 C;  2OBP A;  3S3O A;  1YW8 A;  3BJO A;  4HPQ A;  3DEW A;  4J19 A;  3OY9 A;  3LFU A;  3BG9 A;  1IDY A;  2F6C A;  3G3Z A;  4ITV A;  4RLF A;  2PX9 A;  3E97 A;  4HF0 A;  2X1C A;  4N0B A;  4LJZ F;  4M3E A;  4M6X A;  4A0X A;  1JGG A;  5DM7 F;  2W84 A;  4OIP F;  2O6G E;  2DT5 A;  4RMN A;  5IYB J;  4L5J A;  5D5W B;  4V2G A;  4KIB A;  4I6Z A;  4PJ0 C;  1S29 A;  3CDI A;  3KP6 A;  3ZPL A;  1FOX A;  2W00 A;  2OV7 A;  4O3M A;  3J81 Z;  3QRF F;  2P6T A;  5L3G A;  3AAF A;  3KEY A;  4BQQ A;  3SFI A;  1IGN A;  1G59 A;  1DGR M;  5EZH A;  5E18 F;  4ZDL A;  2ECC A;  1FOW A;  3BQY A;  2XKP A;  1OCC H;  1R1U A;  4KIS A;  5DDG A;  1B8I B;  5IT9 K;  2VQL A;  4F92 B;  1T8I A;  1ZK8 A;  2JMW A;  4GCV A;  1AWC A;  3DTE A;  2HDD A;  3RZO J;  4ZYE A;  2OCE A;  3GTK J;  1ERD A;  1MGT A;  2PJR B;  2HKO A;  2NVY J;  3WE2 A;  5LGN A;  1J09 A;  2XIG A;  4HSR A;  4IHT A;  1U5T A;  1H0M A;  2LNB A;  2ZXJ A;  3FMS A;  2L7F P;  1RIO H;  3DTI A;  2VQC A;  4IL6 C;  4A3E J;  5F0C A;  4GXO A;  1KQ8 A;  5ICG A;  1X1A A;  1JKP C;  3E6M A;  3Q0V A;  5ED4 A;  3BP8 A;  3W6J B;  5K1Y A;  3BCA A;  3IWZ A;  4YIF A;  3H9Q A;  3CJR B;  3LA2 A;  5AIP A;  1QO0 D;  5BPD A;  1LE8 B;  1MSE C;  4BBR J;  3BDD A;  3K4B A;  2VJ4 A;  3G2B A;  4PJJ A;  5ERI A;  2O8K A;  4ZTF A;  1NH3 A;  2ELH A;  4HST A;  4UUS B;  4Q4Z F;  2BOL A;  3BJA A;  3ROU A;  2XGD A;  1VQ6 I;  5F04 A;  4AIJ A;  1P4A A;  2F5V A;  1N25 A;  5DCM B;  4ZYA A;  1MDM A;  4EMS A;  3BZ6 A;  4BXF A;  4C2T A;  1FX7 A;  4W97 A;  2A6H F;  3Q9V A;  1PP7 U;  2QEN A;  5D6F A;  3HOV J;  5A2Q Z;  2QCO A;  2HQN A;  4UVC A;  1EH6 A;  4ZYG A;  4LIU A;  4XSZ F;  2FBI A;  1ITY A;  1B59 A;  2DPD A;  1TP4 A;  2ME0 A;  3BR1 A;  5FLX Z;  2ELK A;  3HUG A;  2ZNZ A;  1XGM A;  5DUK A;  3F72 A;  5B66 C;  1S7O A;  2YU9 J;  3DF8 A;  4A69 C;  5B3S H;  2XRN A;  1HKT A;  2OQG A;  1JUP A;  2XB0 X;  3TO6 A;  2M2E A;  2K4B A;  2F48 A;  2BE5 F;  5CPR B;  4AID A;  3WTS C;  4LOC A;  2Y48 A;  4WX9 A;  4G12 A;  4D5F A;  1R5H A;  5D6E A;  4U0Y A;  4HOB A;  4TV7 A;  2W48 A;  1TNT A;  4NC6 A;  5AIQ A;  3KEO A;  2MGQ A;  2L9S A;  2VKD A;  2ESN A;  3X2Q H;  4CZZ A;  2IBD A;  2JSC A;  1TQI A;  3A02 A;  3LST A;  3OIP A;  1IRF A;  1CQT A;  3KZI C;  3O3K A;  1J9I A;  5KAF C;  2MG4 A;  4E7L A;  2JTV A;  4MHG A;  3HSR A;  1MNE A;  2DOF A;  2HGC A;  3IAS 2;  3TMO A;  5FB2 A;  3RJP A;  1MW7 A;  4IRG A;  4HV5 A;  5EG0 A;  1Z7L A;  1E2X A;  1YW9 A;  2DAO A;  1MMG A;  3M1E A;  4IEJ A;  3GTJ J;  5FFZ A;  3BZC A;  1XD7 A;  2XAU A;  1RNL A;  3H3U A;  2QZ8 A;  3N05 A;  1A5J A;  3RPU D;  2JWT A;  2LKP A;  3LNQ A;  1OCT C;  1H9T A;  1FBU A;  3CCR I;  1ZH5 A;  2Z1D A;  4RB0 A;  2ECB A;  3SFZ A;  1DU6 A;  3ASO H;  4E7Z A;  2CO5 A;  1X1B A;  2QLZ A;  3MVP A;  5GTI C;  1W7P B;  2OUM A;  2KFD A;  2MBF A;  4IOC F;  1VQN I;  4IXA A;  4CCM A;  2JA7 J;  4ZH4 F;  3C2H A;  2ZME C;  1K6Y A;  2M1B A;  3K6G A;  3TW7 A;  3CO6 C;  2XAJ A;  1WQ2 A;  2RQP A;  1TC3 C;  2X6O A;  5DD8 A;  1PVE A;  2QWW A;  4BY7 J;  3S1N J;  1IDZ A;  4DYC A;  3GFJ A;  2R7W A;  4AU7 A;  2XAF A;  3KYD B;  4MEX F;  4CA0 A;  1G8X A;  5M5X J;  2XF6 A;  3E5U A;  3GME A;  3VYT B;  2KKO A;  1U2W A;  4NB5 A;  1OIS A;  3ABT A;  2QQ8 A;  1BOB A;  2VT3 A;  2DA4 A;  1YQA A;  3FBN B;  3FIS A;  1TZL A;  1P4X A;  4L5I A;  1F43 A;  1V5G A;  4PFP A;  5E79 C;  2HFH A;  3P9I A;  3W2V A;  1R4M B;  4L0Y B;  3IV5 A;  2KRH A;  3K4C A;  1TQP A;  2KL4 A;  2FD5 A;  3W2A A;  2EIN H;  2VKV A;  3HOU J;  3RKX A;  1WJD A;  1BI3 A;  2L54 A;  3LOC A;  4HX7 A;  2R7O A;  1Y1W J;  3HOS A;  4CCO A;  2CQ7 A;  2WBM A;  4HG2 A;  2K86 A;  3OYC A;  2UZK A;  5CJ9 A;  1NK2 P;  2MH9 A;  4XLF A;  3GYH X;  2UV1 A;  4C2U A;  2NVT J;  3VPR A;  1W7P D;  2Z99 A;  1IV6 A;  5E8I A;  3HB9 A;  2DK5 A;  3I54 A;  1WCM J;  3JCU C;  9ANT A;  2CYY A;  3KLN A;  3UNG C;  1D1B A;  2NXN B;  4G8X A;  3NWS A;  2DA3 A;  2CV1 A;  1LKX A;  4XOR A;  1GHC A;  3P9C A;  4LLN A;  4Y33 A;  1IRG A;  2CSO A;  4D7M A;  5C4J J;  3LSM A;  1ZGW A;  2F4M B;  4CCJ A;  3GZN B;  1FSH A;  2ZO4 A;  3M8E A;  4I0B A;  4KUM A;  1EV7 A;  2HNH A;  1S9H A;  3HOX J;  1RC9 A;  1HXD A;  2XF7 A;  1UHW A;  3OYM A;  3ECH A;  3S16 J;  3VFZ A;  4ENK A;  1VQO I;  5IY5 H;  4OMY A;  3KP5 A;  1WKM A;  3CJT B;  2ESH A;  1SAX A;  2W24 A;  5E20 A;  2WA0 A;  4LLG F;  3OYB A;  2E2I J;  4CCK A;  3BZK A;  3OIQ A;  4AUX A;  4FTH A;  2Y69 H;  2HOT A;  2M0C A;  2O5R A;  2KDO A;  1XDU A;  2DXI A;  2X0L A;  3OOP A;  2L7K A;  2IT0 A;  3EUK L;  1EA3 A;  5L3C A;  2XC7 A;  2EIK H;  3AL0 C;  3ZN0 A;  5JLW A;  5K5R A;  1MMD A;  4ZDP A;  2ZKZ A;  4FX0 A;  2NNY A;  2PMH A;  3TO7 A;  2HR3 A;  1XSV A;  5IYC J;  1MND A;  4C3I J;  2QSF X;  3JTH A;  5KAI C;  1G3T A;  1U8R A;  1O7L A;  4KYW A;  3BJ6 A;  1WHU A;  3V7S A;  1FYL A;  4WXH A;  1J2X A;  4AWX B;  2KZG A;  3KYC B;  1IAW A;  2V26 A;  1HST A;  2F5D A;  2IJL A;  3ZQL A;  2Y30 A;  2JQ7 A;  4CXF A;  1JHF A;  1W0U A;  3BCB A;  1E3H A;  4Y7N J;  1XSX A;  4IX7 A;  3J7A Y;  2H1K A;  1MDM B;  1I1S A;  3OL3 A;  2HQ5 A;  2VBZ A;  5J1U A;  2E71 A;  1M1E B;  1Z0X A;  4QPQ A;  3CUO A;  4YEJ A;  1V5E A;  4ZTJ A;  4XM3 A;  4BAC A;  5BMZ A;  4S05 A;  3CC2 I;  1WZ2 A;  1TL8 A;  3CCV I;  4LD5 A;  2IA2 A;  2DTZ A;  1IUY A;  1O57 A;  4I02 A;  5HNH A;  3HUG B;  4MTD A;  3E7L A;  2AXL A;  2L4A A;  1GT0 C;  3ZQI A;  1NG7 A;  2FJ1 A;  3BR6 A;  3K9T A;  4O5V A;  1LJ9 A;  2FQ4 A;  4IOA F;  2GOM A;  3PNV A;  3H1C A;  3MKW B;  3A0H C;  4CYD A;  1W36 C;  1BIB A;  2VKE A;  2BXZ A;  3GW2 A;  3ZQF A;  2ZJR F;  1S3J A;  1QHH D;  2K27 A;  4UVA A;  1WH5 A;  3CF2 A;  3PUB A;  3K2Z A;  3BPX A;  3ZMV A;  4H4K C;  3RCO A;  3KET A;  4C3H J;  2PFB A;  2BY3 A;  1FOK A;  3LSK A;  1QVT A;  2EA4 A;  3BTJ A;  2LY9 A;  3C18 A;  3F6O A;  2AS5 F;  2NNN A;  3KFW X;  1Y8R B;  2JN6 A;  3KX2 A;  5C3E J;  4BHB A;  5D8K B;  1MH4 A;  3B6C A;  1BL0 A;  3BY6 A;  3GXO A;  1OCZ H;  2EB7 A;  2HTJ A;  3F0C A;  5EG0 B;  3S15 J;  1XX5 A;  1YIJ I;  1MBK A;  2VQH A;  1YYV A;  4R8H A;  3FXL A;  1YOV B;  2DDA A;  5ILV A;  1TW3 A;  2V1U A;  2DLL A;  3K7A J;  2E60 A;  1MBH A;  2LY2 A;  2EIM H;  3EET A;  4UVB A;  1HW2 A;  3KP7 A;  1FTZ A;  3D1N I;  2E7X A;  1S5L C;  2GXG A;  3VYS B;  4A3L J;  2JA5 J;  1BJA A;  2O0Y A;  5L3F A;  3QU3 A;  2LRD A;  2ZJP F;  2X9D A;  3J81 K;  2YUS A;  2OCC H;  1DGW Y;  2PJR A;  4HZF A;  2RVC A;  2PN6 A;  2BHZ A;  4HBL A;  2IS2 A;  4LG3 A;  3SHF A;  2R93 J;  4F3Q A;  3CCM I;  2JUC A;  3L09 A;  3QPL A;  2WWY A;  1FYM A;  2ZFU A;  4MNU A;  4QWQ A;  3CCS I;  4N9H A;  3AL0 B;  2A3S A;  3CLQ A;  5HLT A;  3J80 Z;  1FT9 A;  2NS8 A;  3DV8 A;  2H09 A;  1RRJ A;  4C3J J;  1LE8 A;  3QOE A;  2M7B A;  4B4C A;  3VWB A;  1G2H A;  1K61 A;  2C6Y A;  3I4M J;  2DMP A;  4A2U A;  4XLE A;  3ABL H;  3DLA A;  1G3S A;  4BJ5 C;  4BAY A;  1AOY A;  1ETQ A;  1RI7 A;  3ZXS A;  4P55 A;  4P9F A;  4DBQ A;  2CQN A;  2HKX A;  2WV1 A;  4QIW N;  1SFK A;  3PIO F;  3WTT C;  2FBK A;  3GWZ A;  4HX4 A;  4M9Z A;  4F55 A;  3RPU A;  3IRR A;  2GM4 A;  5LBQ A;  4NUB A;  2Y31 A;  4XKC A;  2VKH A;  1RUO A;  1HW1 A;  1TNS A;  4WK8 F;  1YS7 A;  5DD4 A;  1LQ1 A;  3K70 C;  1P4W A;  3OS2 A;  2E2J J;  4BY1 J;  2A6T A;  1MIJ A;  1GUU A;  1GV2 A;  4KN7 X;  2KIF A;  5FRN A;  1YFH A;  2XAQ A;  1IXS B;  3F8M A;  4RBO A;  4C2M J;  2BGC A;  5DUI A;  3FKI J;  2V1D A;  4BHP A;  5A2Q K;  2P7C B;  5EGO A;  4UNO A;  2GA2 A;  2G9W A;  3SYT A;  1VZ0 A;  3CMA I;  2B9S A;  3MKY B;  4B09 A;  5FLV A;  1ZG5 A;  3SZT A;  3G1M A;  3KIO A;  2DA1 A;  3M9A A;  5IP9 J;  2RV8 A;  3RQ4 A;  3CLO A;  4D9J A;  2R7U A;  2QM3 A;  1YIO A;  2HYJ A;  2VIX A;  3M8F A;  4Y13 A;  1T0F C;  4UB6 C;  4B43 A;  4ESB A;  4E7J A;  5BS6 A;  4XK4 A;  4Y52 J;  2XUB A;  1XGN A;  3V8L A;  3RI4 A;  4C9Y A;  2Q0O A;  4M73 A;  2HQA A;  4DZP A;  3U9G A;  4K2E A;  1FSE A;  5BQT A;  3M8J A;  1YLF A;  2E35 A;  2P6S A;  3B02 A;  4PCQ A;  3ZP5 A;  2QKL B;  2W85 A;  3IUO A;  4IJA A;  4M9S A;  1Z6R A;  5F1J A;  4L9V A;  3F8F A;  2EK5 A;  2O8X A;  2XAG A;  2DBB A;  2MD0 A;  4PJM A;  4QTR A;  2RQQ A;  3RPQ A;  1D8K A;  5F0F A;  1SD4 A;  3VEP A;  4XKV A;  3PO2 J;  1Q1V A;  3P9K A;  1A6Q A;  2HVQ A;  2RN7 A;  5GPA A;  4RB2 C;  3CCU I;  1HLV A;  3TQN A;  2IEK A;  2QQA A;  1T95 A;  4WCG A;  5KK1 A;  2OZ6 A;  1HQC A;  3CCJ I;  2QQB A;  4OIQ F;  5J3L A;  2LG4 A;  1UG2 A;  2VL8 A;  5ICC A;  4RM2 A;  3R6S A;  2X51 A;  4BQA A;  4B47 A;  4IKF A;  2Q2E A;  4FE7 A;  2TCT A;  5D5X B;  1H88 C;  3I53 A;  3WU0 A;  4HX8 A;  1X1D A;  1LUJ B;  2M87 A;  2VLA A;  4LGW A;  1I27 A;  1TQM A;  2KHM A;  4M3F A;  2DI3 A;  5KVR A;  4O6J A;  5DYM A;  1OKR A;  1YRN A;  3C2B A;  2K3F A;  3G6E I;  4BDY A;  4GFB A;  3DPL C;  2R92 J;  3BC8 A;  3P7N A;  5IP6 A;  1HCR A;  4Z6Y A;  1USS A;  4EM2 A;  1OR7 C;  5FKL A;  1HBX G;  1F1Z A;  3O8H A;  2LRE A;  2K9S A;  3M4O J;  3OR1 C;  4EGY A;  2V4J C;  2XDV A;  2F5C A;  3GTO J;  2Z3Y A;  3AG4 H;  2PLY A;  4LB5 A;  4D1Q A;  2WAQ A;  4HQM A;  4AD9 A;  3HRU A;  1WJA A;  2KRC A;  2IGN A;  2X1E A;  4WXC A;  5CVV A;  3V8K A;  4LIV A;  2DU9 A;  4OIR F;  1ZN2 A;  3OMY A;  4FT8 A;  5IOZ A;  3SQN A;  5FJ8 J;  2LBF B;  1R1T A;  2QA4 I;  4EGZ A;  3KPH A;  5FKM A;  3BR2 A;  4NC7 A;  1ETX A;  1F9N A;  3A1Y A;  3HJE A;  1IW7 F;  1D0X A;  4LG0 A;  3OWT A;  2VUM J;  4F91 B;  3HRS A;  3F21 A;  4HRI A;  4AIH A;  1I3A A;  5F08 A;  2UUZ A;  1YI2 I;  1MZB A;  1SAN A;  1W4M A;  1IJW C;  2N8G A;  1J0R A;  2WTE A;  2JJ7 A;  3S2D J;  1OQY A;  4BGD A;  2MC4 A;  5B5E C;  1RKW A;  3BT9 A;  3WU1 B;  1OCP A;  1IXC A;  2Y0M A;  2V9P A;  2Y9Z A;  3L2C A;  4Z2Y A;  2WY7 Q;  1KON A;  1T39 A;  1SMY F;  2LSO A;  4HLY A;  5D8L B;  4KIG A;  2X6X A;  3FWE A;  1S8N A;  1WVR A;  5J1Y A;  2Y0S A;  4A3B J;  3E5Q A;  4A6D A;  4IVN A;  3TGN A;  4ANJ A;  2LH9 A;  1XC5 A;  2M7A A;  3C1D A;  2BW3 A;  3GLX A;  1UFM A;  5JHF A;  1ON1 A;  4HNV A;  1T38 A;  5M5W J;  2G7H A;  2X6Y A;  2VT2 A;  3IH3 A;  1P9Q C;  4BS9 A;  4HAM A;  4A5N A;  1YE9 A;  1LEB A;  4RB1 A;  4OAZ A;  4DBR A;  1T56 A;  1XB4 A;  1A6I A;  1H9G A;  2E36 A;  2H1L A;  3ECO A;  4I76 A;  4IF4 A;  4A0Y A;  2NS7 A;  3WHC A;  2R4G A;  1XS9 A;  2CQK A;  1POG A;  4PSW A;  3HXL A;  5LHH A;  2R7F A;  3AKZ A;  2AHQ A;  1LDJ A;  2Y75 A;  5IP7 J;  1T6S A;  2LD5 A;  2H8R A;  1JI8 A;  3K70 D;  1QU3 A;  1PJR A;  3H0D A;  3ZMZ A;  1OJL A;  3ZQ7 A;  2JA6 J;  1B72 A;  3ML6 A;  3PM1 A;  1ZTR A;  3LL7 A;  3PQK A;  2ZME A;  2BY1 A;  2R7D A;  2NVQ J;  4CCN A;  2W7N A;  3IP4 B;  5FGM A;  2HVR A;  4RDU A;  3AG1 H;  2VB6 A;  2EIL H;  4BJT A;  4BUP A;  1ORK A;  2R0Q C;  2EV0 A;  1VQ4 I;  2FUG 2;  3JRG A;  3OR2 C;  3BR5 A;  5HNF A;  4YEL A;  2F5F A;  3JTG A;  3LSG A;  5J40 A;  3R4K A;  3GFI A;  1R7J A;  2K5C A;  4U87 A;  4A3C J;  1HSJ A;  2LYC A;  4XOT A;  3ZMU A;  2KLO A;  1Z1D A;  2W57 A;  5LGT A;  4XRS A;  4XL9 A;  3CCE I;  2DA5 A;  1MJA A;  3K4M A;  4KA4 A;  2A07 F;  1I3Q J;  2IP2 A;  3H0G J;  1JE8 A;  4DOZ A;  1G3W A;  1VFC A;  2KDZ A;  4OIN F;  3HEF A;  4OOI A;  3HOW J;  1A35 A;  3K69 A;  1KA8 A;  2LR8 A;  2IGO A;  5EGO B;  2P4W A;  2LY1 A;  2M5W A;  3BTI A;  3DCF A;  3SJM A;  1FP1 D;  2FXA A;  5JVT A;  2EJR A;  2DK8 A;  2W25 A;  2EV5 A;  3TBI A;  4IHV A;  5GAE J;  3QP6 A;  1BW6 A;  2FA5 A;  1FBS A;  3F9K A;  5GPC A;  3ZMT A;  1ETY A;  3DEU A;  4L9J A;  1AU7 A;  1TWF J;  3K4J A;  4CH7 A;  1GVD A;  2QF7 A;  3WGG A;  2QSG X;  3H9J A;  1T98 A;  2R5Z A;  3IAM 2;  3IHU A;  5EYR A;  5M5Y J;  3OYI A;  2DN0 A;  4YIR X;  3LA7 A;  3WTY C;  4LLL A;  2ME6 A;  3M7G A;  1L3L A;  3IC7 A;  5H6R A;  3DU6 A;  2XRL A;  5GAD J;  3HOT A;  3PNT A;  1JKO C;  1EH7 A;  2IS1 A;  5M3M J;  1V55 H;  3KZY A;  4KJZ A;  2BYV E;  3E6C C;  1T2K A;  1ZRC A;  3PUF A;  1G4D A;  1SVM A;  2NOJ B;  1CF7 A;  3HIF A;  5E3N A;  4NNJ A;  2HDW A;  4EJW A;  1FY7 A;  1LDK B;  5K7H A;  3PIP F;  2ICW G;  3U1D A;  1V3F A;  2H94 A;  2HZD A;  4HNT A;  2IRF G;  3OYK A;  3R60 A;  4G6D A;  4L9T A;  5F64 A;  3TOA A;  2E1N A;  1S72 I;  2WAF A;  4LFU A;  2Q2E B;  5TRD A;  1PDN C;  3ZMS A;  1MNM C;  3GUD A;  1I1G A;  1XTA A;  2CH0 A;  1BR4 A;  4RLQ A;  4EJV A;  1HC8 A;  1ZQ3 P;  2YSR A;  4G6Q A;  2CRG A;  3S17 J;  3BRO A;  2M8G X;  3GFL A;  4HQE A;  1YRN B;  1QVU A;  1D5Y A;  1V54 H;  4A3I J;  3H92 A;  3E1S A;  3K4N A;  4HNU A;  2W82 A;  1P7J A;  3J7A O;  2XKO A;  4NDL A;  4B8X A;  3CES A;  3P5J A;  5GP9 A;  3HPH A;  4L5E A;  2IGK A;  4A12 A;  2XGC A;  3JAM Z;  1Y8Q B;  1U3E M;  5ILU A;  2HQR A;  3LSH A;  4M74 A;  3ZRG A;  3VYU B;  2ZSI B;  3J80 K;  2EFO A;  1LFU P;  5JLX A;  4BEH B;  5H2F C;  4I98 B;  1XG1 A;  1QBJ A;  5DTD A;  3Q5F A;  1R22 A;  4ENN A;  2JT1 A;  4KIF A;  4DYQ A;  3TP3 A;  1STZ A;  3V7C A;  1A04 A;  2O7O A;  1Y0U A;  2QKM B;  4LG0 B;  3ZQQ A;  2DCE A;  4A3J J;  2HVS A;  6PAX A;  1B9M A;  5EJC A;  3IKT A;  1OYY A;  2DJI A;  3BWG A;  1NK3 P;  1O4X A;  2PG4 A;  2OC6 A;  4EM0 B;  4XQF A;  3DKX A;  2IW5 A;  2OA4 A;  2Y9Y A;  2CMP A;  4YFX F;  2VBY A;  3ZQG A;  3LAJ A;  4F93 B;  2L9N A;  4XNF A;  2A05 A;  4YFN F;  2LKX A;  4I0A A;  2LF7 A;  2GQQ A;  1Z77 A;  2IVM A;  3FK6 A;  1IXR C;  2MFZ A;  3CQZ J;  4AIK A;  2H8W A;  1VQM I;  3V8J A;  5CKT A;  2PEX A;  3TL4 X;  4XN0 A;  4XR6 A;  3GFM A;  3MCZ A;  4XID A;  1Z91 A;  1IN8 A;  1VQ5 I;  3HM5 A;  3L2V A;  1JJ8 C;  4XKW A;  2BW3 B;  3KEQ A;  4HLX A;  3Q0W A;  2JUG A;  5IT9 Z;  2OAZ A;  4J01 A;  1IG7 A;  3L9F A;  2QGU A;  3JRB A;  1IF1 A;  2BXY A;  3MWM A;  4FQG A;  2D2W A;  4DZJ A;  2HYG D;  3IRQ A;  2L4M A;  3MZY A;  1SEU A;  1W5S A;  3H3Z A;  2NRA C;  4DGW B;  5TJJ A;  3S2H J;  4AM3 A;  4U7D A;  4HEA 2;  4KNY A;  4H0E A;  3NWT A;  3ULQ B;  2LMD A;  4PJL A;  3DTK A;  4KFC A;  1R5G A;  2CS3 A;  2BVM A;  2CGP A;  2K9M A;  3H5A A;  2HU9 A;  2P5K A;  3G1O A;  1N77 A;  1A36 A;  1IN6 A;  3MAJ A;  2VAS A;  1B72 B;  1Y56 A;  1WPK A;  4V2F A;  5CVR A;  3T1B A;  2QEX I;  4BDZ A;  3A2K A;  3HRM A;  2ZME B;  5LEJ A;  3HOY J;  1R00 A;  2XRO A;  2GA1 A;  2OZU A;  2Z16 A;  5E8G A;  2UWM A;  1YJN I;  2O03 A;  3GO5 A;  4LK0 F;  5K5O A;  5LD2 C;  2HI3 A;  2DOA A;  1ZAO A;  5DEQ A;  4BHC A;  2E1C A;  3LWF A;  2VOO A;  1FJL A;  2TRT A;  2IPQ X;  3FXR A;  3LSJ A;  4EVI A;  2O3F A;  2OF7 A;  3HSF A;  2R7V A;  3BR0 A;  4GO1 A;  1QRY A;  3S3N A;  3OS1 A;  2D5V A;  4PGH A;  2L7Z A;  3V4G A;  2E34 A;  2I5U A;  4EJT A;  3HGY A;  3IWF A;  1JUS A;  1R6R A;  1ZG3 A;  2W1O A;  5IPA A;  1KYW A;  2OPT A;  2DMN A;  3L2Q A;  1Y39 A;  1JUM A;  1AKH B;  2LC2 A;  2RC4 A;  2GIZ A;  4XKB A;  3NQO A;  1T08 B;  3ESW B;  2TDX A;  4GYG A;  2P7V B;  5LGU A;  3DBR B;  2CW8 A;  3I55 I;  1NHA A;  2CJJ A;  2DOE A;  1TWC J;  2LBF A;  2NS0 A;  4PJN A;  1ZKG A;  2LLK A;  1VQL I;  2FU4 A;  1R4N B;  3I59 B;  3KP2 A;  4XLP F;  4BH9 A;  2DFH A;  3F23 A;  4DQ2 A;  1N78 A;  2WAQ N;  4PFO A;  1HDP A;  3SDB A;  1GVJ A;  2ZCW A;  2CV0 A;  1BIA A;  1TLH B;  2FOW A;  2R5Z B;  2V7F A;  4CCL A;  1DP7 P;  2Z5U A;  2CUF A;  1YX5 A;  5E3O A;  1FPQ A;  3DQV C;  4UY8 I;  5LRR A;  2EZK A;  3ZGK A;  4XIC A;  4RGX A;  3T8T A;  1TWA J;  3Q9S A;  4QSH A;  3VSK A;  3PO3 J;  4PSX A;  1TWG J;  1T0F A;  2LKS A;  3TDZ C;  4P96 A;  1SVO A;  5CQG A;  4HF1 A;  2D1V A;  2QBY B;  1WJC A;  3HC7 A;  1R5I D;  1ODD A;  4J00 A;  1J7K A;  1J59 A;  4M3B A;  3SEQ A;  2VC0 A;  2JSP A;  1CF7 B;  4WXD A;  1KYZ A;  3HBL A;  1K79 A;  3OV8 A;  3TDU C;  1RUN A;  1WJE A;  3I4P A;  3FXU A;  2IAI A;  2K02 A;  2YPR A;  2V1N A;  4CZC A;  2DO7 A;  4UHT A;  2V79 A;  4HDV A;  4IHX A;  5BNG A;  3FIW A;  2ZXH A;  4FE4 A;  2Y0S N;  4HDU A;  2M8E A;  3J7Z I;  2Z9O A;  3AG3 H;  2KP6 A;  4X1E A;  5LHI A;  2AQF A;  2WAE A;  2CQQ A;  5CQE A;  1OYW A;  3FMR A;  4XLC A;  3SDG A;  3JRE A;  1EJ9 A;  2RNJ A;  3JRC A;  1B9N A;  3EUA A;  3EDP A;  4G7O F;  2ZXI A;  2DFF A;  3KYL A;  2L5Q A;  4AC0 A;  5CYV A;  3RZD J;  3FBI B;  5DM6 F;  1X3U A;  2DYR H;  3NAR A;  4RAG A;  3T8R A;  2FNP A;  4IRH A;  5EDN A;  2P5L C;  1YW7 A;  2XSD C;  2A61 A;  2BVL A;  5J4Y A;  4HW0 A;  3CUQ A;  2KIQ A;  3VOD A;  3Q3S A;  3FKJ A;  3U1K A;  4AVP A;  2VJJ A;  4JYK A;  2E5Z A;  1ETK A;  1WI3 A;  2OU2 A;  1F5T A;  4I01 A;  3UR3 C;  3ZOB A;  5D4S A;  5EF6 A;  3L2W A;  1MMS A;  1SD6 A;  4FX4 A;  1U9N A;  2ETH A;  2ZBK A;  5FKO A;  2OJE D;  2UXN A;  4KN4 X;  3K0L A;  3JSO A;  1X58 A;  3F8N A;  3L7W A;  2WC2 A;  5ICE A;  3MZ8 A;  1OR7 A;  1KGS A;  2LTP A;  2P8T A;  3MFK A;  3OOU A;  1TT5 B;  4YG2 F;  1BA5 A;  3SZG A;  2VQG A;  1B4A A;  4XRF A;  1GXQ A;  2AXT C;  4XON A;  5M3F J;  2VON A;  3GX4 X;  2VE8 A;  4NQW A;  2XHK A;  3R0J A;  3HTS B;  1KQ9 A;  2M4K A;  2F4I A;  1VQ9 I;  2L9V A;  4UV8 A;  5HLH A;  4IRI A;  2V6C A;  3ISP A;  2LK2 A;  3OSG A;  1XCB A;  4PZJ A;  5HDG A;  3WG7 H;  1LDD A;  4KT6 A;  1R49 A;  4BBS J;  5FLX K;  1D1A A;  3WTZ A;  2ZNY A;  2STT A;  2RKH A;  2BZT A;  3BTC A;  1FEX A;  1I6H J;  1ETV A;  1Z3X A;  3LMM A;  3CMY A;  3G73 A;  4M72 A;  3OYA A;  2XB5 A;  1T33 A;  2PI0 A;  4OMZ A;  1FMW A;  3GZ5 A;  1GDT A;  3LQR A;  1QNT A;  1QZE A;  4HYE A;  2WY8 Q;  1OPC A;  2ZSH B;  1V4R A;  2DMQ A;  4E7I A;  3QQA A;  3CCY A;  3IL2 A;  3KP4 A;  2OD5 A;  1JTX A;  1BR2 A;  4L9N A;  3RSN A;  2L01 A;  3S93 A;  2DJN A;  1P92 A;  2DMT A;  5LRS A;  1BN5 A;  1I5Z A;  4M9X A;  5CLS A;  2DQR A;  3IH4 A;  5CVU A;  1FZP B;  1RPW A;  2J5O A;  1BC7 C;  5FKK A;  4PGG A;  1SC7 A;  2ACJ A;  5E17 F;  1BI1 A;  3RKW A;  2LDU A;  4KIT B;  3VOE A;  5GTH C;  4F7Z A;  5CVI A;  1PP8 F;  5EEH A;  3GTM J;  1ZYR F;  1IV8 A;  3CUQ C;  3OL4 A;  2HOA A;  4RB3 C;  1W36 D;  2G0E A;  1MBG A;  3FXO A;  2DFE A;  3ZR8 X;  4YFK F;  1HF0 A;  2A5W A;  1F36 A;  1IN4 A;  1UG0 A;  3UKG A;  3GZ6 A;  4Q5S F;  4XRS G;  1X2M A;  3SXY A;  3TOB A;  1PUF B;  4MFD A;  1ZRF A;  2HPI A;  1UEL B;  2DW4 A;  4B3X A;  1O3S A;  2BY2 A;  4Q47 A;  3MEX A;  4EM1 A;  5H6Q A;  2R5Y A;  4UUV A;  4IQ4 A;  3SEZ A;  1JHH A;  2P81 A;  4B48 A;  4U7B A;  3HL2 A;  3K10 A;  4DIQ A;  4E7S A;  4CYC A;  1QHG A;  3L2R A;  1OYI A;  3J7Y J;  1BJZ A;  3O6B B;  4C30 A;  1TT0 A;  1D8J A;  2CG4 A;  3WOD F;  4HV6 A;  3E6D A;  5HS8 A;  4YRV A;  2FBH A;  2GBY A;  4N4O B;  4X6A J;  4BEH A;  3EPZ A;  1IN5 A;  2STW A;  2F4O B;  2FE3 A;  5K5Q A;  4N4N B;  2BHY A;  3M1C A;  4AVZ A;  4M6Y A;  3ZCO A;  3OYH A;  1Z9C A;  4HA8 A;  5ILS A;  1UAA A;  2YU3 A;  1Q1H A;  4NC8 A;  2ISZ A;  3PSI A;  1G6N A;  2I10 A;  3HYI A;  2EFP A;  2HS5 A;  3QYE A;  3JAM K;  3PSF A;  2E2H J;  1QA6 A;  1ONV A;  1S7E A;  2MH2 A;  3DLL F;  4E4H A;  2LFB A;  3CJQ B;  3CJN A;  2EWN A;  4OU0 A;  4M71 A;  3K1M A;  1XMA A;  1K4T A;  1IO2 A;  2RGV A;  4BQO A;  1A31 A;  4WF2 A;  5H20 A;  2FML A;  1XDS A;  2XGX A;  3ASN H;  4JX5 A;  1PUE E;  1I6X A;  4E6K G;  5LEK A;  3CME I;  2JA2 A;  3EYI A;  5F27 A;  3FM5 A;  4D5C A;  5FFX A;  3V7R A;  3FXM A;  2EQR A;  1G3Y A;  4BQN A;  3GTG J;  1VI0 A;  2A6E F;  2KZV A;  4UV9 A;  4GYI A;  1UZC A;  1QQI A;  1R9T J;  2DPU A;  4IHY A;  3C2G A;  3DP7 A;  3L1P A;  1SFU A;  1ZR4 A;  2K4J A;  2O9L A;  2FRH A;  3CCQ I;  1O3R A;  1APL C;  1SAU A;  4OAY A;  3O8G A;  2FMY A;  2XPW A;  1AHD P;  2M0M A;  2MA3 A;  3GEZ A;  2CUJ A;  3K2A A;  4EV0 A;  5HLI A;  2PMZ A;  3BG3 A;  5F6F A;  3WGI A;  4CHU A;  2HZT A;  3KCC A;  3LFK A;  3QPT A;  3HOZ J;  2WB1 A;  2K3P A;  1UHM A;  2E1M C;  2EV6 A;  4II3 A;  2K85 A;  4RGU A;  3DBH B;  4MLO A;  1O3T A;  2R7X A;  3U2R A;  3GVA A;  4B1R A;  5L3B A;  2EZL A;  2MW8 A;  2YR2 A;  2FF4 A;  1REP C;  1YJW I;  5D5U B;  2L3D A;  2B63 J;  2KPM A;  1SMT A;  5HDK A;  1KZH A;  4OWR B;  1D3Y A;  3ERE D;  1MD0 A;  2ELJ A;  4LB6 B;  2GIV A;  5EZG A;  2DFI A;  3H5N A;  1U0J A;  2ZJ2 A;  3QWL A;  3CUQ B;  1XCV A;  1W0T A;  4KMU X;  2F2E A;  1Z6T A;  3IH2 A;  3CDH A;  1O3Q A;  4CIC A;  1JJ6 C;  3K1P A;  3CO7 C;  4IPA A;  2DT7 B;  1ZG1 A;  4P1W A;  2X48 A;  3S3M A;  4CDG A;  4CGZ A;  2FSW A;  4UUT A;  1Y1V J;  1UMQ A;  5J6X A;  1S7A A;  5KHD A;  3H9G A;  4M3D A;  3RIR A;  2H27 A;  3BPV A;  3WE3 A;  1MMA A;  5F0H A;  3ELK A;  2IS6 A;  1ZEL A;  5B1A H;  4AYB N;  4NQW B;  2QQ9 A;  1XN7 A;  1DUX C;  1LFP A;  2M30 A;  4Y17 A;  1OMI A;  3KZZ A;  1AKH A;  1OFC X;  2J5P A;  1JT0 A;  3QP5 A;  1RZ4 A;  1B6A A;  4HF2 A;  1LNW A;  2JRT A;  3BG5 A;  1MBE A;  1HDD C;  5GAG J;  3FMQ A;  2VXZ A;  3ERM A;  3HSE A;  1X1C A;  2ZC2 A;  1QPM A;  1Z05 A;  3BQZ A;  2BBY A;  3W6K B;  5JHU A;  1SFO J;  2OTL I;  4EEF G;  4MO7 A;  3D5R C;  3F8B A;  2ADU A;  3REO A;  1ENH A;  3DWL E;  3I59 A;  4KT5 C;  4MEY F;  3TW6 A;  1E3P A;  2CWE A;  2O61 A;  4YII A;  4KMF A;  5TGT A;  4DNC A;  4UB8 C;  4I09 A; 
#chains in the Genus database with same CATH homology
 3AL0 B;  3BLY A;  5HLT A;  3HKZ A;  1DQU A;  2KMU A;  4DGW B;  3I3L A;  5HOO A;  1DP3 A;  4Y3O A;  3QOE A;  4HEA 2;  2M7B A;  3NWT A;  3VWB A;  4PUS A;  4XLA A;  4PJL A;  3DTK A;  5KCM A;  5LFA A;  2RNG A;  2M3A A;  4XLE A;  2CS3 A;  2BVM A;  3CP2 A;  3DLA A;  2K9M A;  3H5A A;  2HU9 A;  2IXS A;  4BJ5 C;  4JQF A;  1N77 A;  3ZXS A;  4R79 A;  2LOO A;  2VAS A;  4FAS D;  1Y56 A;  4DBQ A;  4BDZ A;  1SFK A;  3A2K A;  4BE2 A;  2AQE A;  2I8D A;  2P0W A;  2Z16 A;  4F55 A;  2UWM A;  3S3O A;  4NUB A;  3DPT A;  4HPQ A;  4XKC A;  3OY9 A;  2VKH A;  3LFU A;  5LD2 C;  2DOA A;  2F6C A;  4ITV A;  4RLF A;  2IGM A;  2X1C A;  2K9L A;  4GRI A;  3K70 C;  3CMM A;  2E1M B;  3OS2 A;  2A6T A;  1D1C A;  4RMN A;  5FRN A;  2CFO A;  1Z3Y A;  2R7V A;  1HA8 A;  3S3N A;  3OS1 A;  2W00 A;  2OV7 A;  2VJI A;  3KEY A;  4BQQ A;  2VPL A;  3W3C A;  1R6R A;  3SYT A;  1G59 A;  1DGR M;  2W1O A;  1VZ0 A;  1LVK A;  3MKY B;  4ZDL A;  2L2O A;  3L2Q A;  2LC2 A;  4KIS A;  4XKB A;  2GOX B;  3RQ4 A;  4D9J A;  2R7U A;  2VQL A;  2VIX A;  4F92 B;  1T0F C;  3DTE A;  4B43 A;  4E7J A;  1IRX A;  2CW8 A;  2MAB A;  3BG6 A;  1ERD A;  2PJR B;  2LBF A;  4C9Y A;  4PJN A;  1J09 A;  4HSR A;  2HQA A;  5FRO A;  1N78 A;  3DKY A;  4PFO A;  3SDB A;  3DTI A;  3M8J A;  3E0J B;  2VQC A;  2QKL B;  3IUO A;  2CV0 A;  2Q1Z B;  1X1A A;  4X0G A;  2V7F A;  4CCL A;  3BCA A;  2MD0 A;  2V9K A;  3H9Q A;  3CJR B;  4PJM A;  1YX5 A;  2RQQ A;  3DQV C;  2W4S A;  4BE1 A;  3K4B A;  4PJJ A;  2VJ4 A;  3G2B A;  3LSI A;  4ZC3 A;  3ZGK A;  4ZTF A;  4XKV A;  3VSK A;  4PSX A;  4HST A;  2HVQ A;  4B44 A;  2BOL A;  4P5O A;  1T95 A;  3K4K A;  2F5V A;  5CQG A;  1WJC A;  2M4G A;  3HC7 A;  3S8P A;  4ZYA A;  2LG4 A;  3OYF A;  4J00 A;  3EUH C;  4BXF A;  2VL8 A;  1V5F A;  3SEQ A;  4C2T A;  2JSP A;  4RM2 A;  1X4P A;  2X51 A;  4B47 A;  4IKF A;  1WJE A;  4LIU A;  2V1N A;  4CZC A;  4XLH A;  3ONQ A;  1X1D A;  2ZXH A;  4XMY A;  2VLA A;  2KHM A;  2KP6 A;  4BDY A;  2AQF A;  2WAE A;  5CQE A;  2R7Q A;  3DPL C;  3BC8 A;  4XLC A;  2E5N A;  3H5R A;  1OR7 C;  3EUA A;  2ZXI A;  5CPR B;  3KYL A;  2L5Q A;  2LRE A;  3FBI B;  3OR1 C;  2V4J C;  2WAD A;  3FDY A;  2R7R A;  2XDV A;  5FRM A;  4G6T B;  4D1Q A;  2WAQ A;  2BVL A;  2L9S A;  1WJA A;  2VKD A;  2KRC A;  3PL8 A;  2IGN A;  2X1E A;  5KNL A;  3BG7 A;  3OIP A;  3FKJ A;  4LIV A;  3OMY A;  2VJJ A;  2XF5 A;  3V42 A;  4E7L A;  2LBF B;  4BJ6 C;  2E5Z A;  1NG6 A;  1MNE A;  4NC7 A;  3PNY A;  3IAS 2;  3A1Y A;  3TMO A;  1D0X A;  3UR3 C;  1MW7 A;  3OWT A;  3L2W A;  1Z7L A;  4F91 B;  4HRI A;  1MMG A;  2UUZ A;  4EAT A;  4BL0 B;  4Y4R A;  2XAU A;  4AYB A;  2CV2 A;  4QPO A;  3OOU A;  3N05 A;  3SZG A;  4BGD A;  2MC4 A;  2VQG A;  4XON A;  3RPU D;  5HVQ C;  3MMY B;  2Z2S B;  1WJ5 A;  2M4K A;  2F4I A;  2WY7 Q;  4BE0 A;  2Z1D A;  1KON A;  2X6X A;  4E7Z A;  1X1B A;  3PFY A;  2Y0S A;  4KT6 A;  2CW7 A;  4RM3 A;  2OUM A;  2V6E A;  4ANJ A;  1D1A A;  3OYD A;  4CCM A;  1D0Y A;  2LH9 A;  4PK4 A;  1YX3 A;  2M7A A;  1WFX A;  2BW3 A;  3OYJ A;  3C2H A;  1K6Y A;  3K6G A;  5JHF A;  1Z3X A;  3LMM A;  2X6Y A;  3U21 A;  3QYF A;  4FET A;  3OYA A;  1P9Q C;  4BS9 A;  3OS0 A;  1YE9 A;  4OAZ A;  4DBR A;  1Z21 A;  2CUZ A;  1FMW A;  3HG9 A;  2R7W A;  4AU7 A;  2R4G A;  2WY8 Q;  2ZSH B;  4PSW A;  4CA0 A;  3HXL A;  1G8X A;  4E7I A;  2XF6 A;  3AKZ A;  3RSN A;  1BR2 A;  3VYT B;  4LIT A;  3S93 A;  1JI8 A;  3K70 D;  1BOB A;  1QU3 A;  3W2W A;  1PJR A;  3FBN B;  1TZL A;  3D5L A;  3H0D A;  1V5G A;  4PFP A;  3LL7 A;  3W2V A;  2HPM A;  4CCN A;  2KRH A;  3K4C A;  4XN3 A;  2W7N A;  2KL4 A;  3IP4 B;  4KIT B;  2HVR A;  3W2A A;  2VB6 A;  1WJD A;  3DEE A;  4BJT A;  4BUP A;  2FUG 2;  3OR2 C;  2R7O A;  3OL4 A;  5HNF A;  4YEL A;  2R7S A;  1WJF A;  3HOS A;  3LSG A;  4CCO A;  3DPU A;  1W36 D;  3QOD A;  2K5C A;  4U87 A;  2LYC A;  4XOT A;  3ZR8 X;  2WBM A;  2A5W A;  2KLO A;  4HG2 A;  4JOM A;  3OYC A;  3K4L A;  4XLF A;  1UG0 A;  4XL9 A;  2UV1 A;  4C2U A;  3K4M A;  1N75 A;  2JVG A;  3UNG C;  4DOZ A;  4II2 A;  1D1B A;  2HPI A;  3NWS A;  1UEL B;  4B3X A;  2CV1 A;  1LKX A;  4XOR A;  4XOP A;  4Y33 A;  2IGO A;  3LSM A;  2X6W A;  2LY1 A;  4IQ4 A;  3SEZ A;  4CCJ A;  4B48 A;  4U7B A;  3HL2 A;  3K10 A;  4DIQ A;  4E7S A;  1QHG A;  3L2R A;  3OYL A;  4C30 A;  2HNH A;  1TT0 A;  1S9H A;  4CSW A;  2XF7 A;  3TBI A;  3OYM A;  3VYR B;  4YRV A;  4N4O B;  4BEH A;  3EPZ A;  3F9K A;  4N4N B;  3M1C A;  4AVZ A;  3ZCO A;  3OYH A;  3K4J A;  4CH7 A;  1WJB A;  1UAA A;  1D0Z A;  2WA0 A;  4NC8 A;  3OYB A;  3PSI A;  3MKZ A;  3S32 A;  3H9J A;  4CCK A;  3OIQ A;  2XSJ C;  3QYE A;  4DJA A;  3PSF A;  3IAM 2;  3VDX A;  3OYI A;  2O5R A;  2KDO A;  3CJQ B;  3DU5 A;  4E4H A;  2DXI A;  2L7K A;  3EUK L;  1EA3 A;  2XC7 A;  4BQO A;  3AL0 C;  1MMD A;  4ZDP A;  3DU6 A;  3D5S C;  3HOT A;  3PNT A;  4E6K G;  1AA7 A;  3A4C A;  3OYG A;  2JA2 A;  1BR1 A;  1MND A;  4IZZ A;  2IS1 A;  4BQN A;  2KQR A;  4KJZ A;  1MMN A;  2KZV A;  2NOJ B;  2V26 A;  3I9V 2;  4BU2 A;  4NNJ A;  2HDW A;  3C2G A;  1LDK B;  3BCB A;  4IX7 A;  3J7A Y;  2HZD A;  4HNT A;  3OL3 A;  3OYK A;  4QPQ A;  1SAU A;  4OAY A;  1X4O A;  4YEJ A;  1V5E A;  2M0M A;  2WAF A;  2VXD A;  4ZTJ A;  2Q2E B;  1PYV A;  4XM3 A;  4BAC A;  2X85 A;  1X19 A;  2CUJ A;  3H35 A;  2PMZ A;  2CH0 A;  1OLT A;  3OYE A;  1BR4 A;  4RLQ A;  5HNH A;  3HUG B;  2R7T A;  2WB1 A;  1NG7 A;  2X1D A;  2K3P A;  2E1M C;  4II3 A;  2IS4 A;  3AFH A;  4MLO A;  2R7X A;  3E1S A;  2GOM A;  3K4N A;  3PNV A;  2W82 A;  4HNU A;  3MKW B;  3FHN A;  2VJ5 A;  1W36 C;  3CES A;  3HPH A;  2KPM A;  1QHH D;  2IGK A;  1FMV A;  4OWR B;  3CF2 A;  3PUB A;  2ELJ A;  3LSH A;  3H5N A;  4H4K C;  1U0J A;  3VYU B;  3VSL A;  3ZRG A;  2ZSI B;  3RCO A;  2RRE A;  2JVH A;  4BEH B;  3LSK A;  4ZDO A;  3GBG A;  4IQJ A;  3KX2 A;  1Y6I A;  2DT7 B;  2QKM B;  3RTR A;  4ZJZ A;  3ZQQ A;  2DCE A;  4P1W A;  2HVS A;  2DT6 A;  3S3M A;  2VQH A;  2DJI A;  3L2U A;  2OC6 A;  4XQF A;  5KHD A;  2E60 A;  3DKX A;  3H9G A;  2LY2 A;  3MD2 A;  1MMA A;  2CMP A;  3CZ6 A;  4F93 B;  2L9N A;  4XNF A;  3HPG A;  2IS6 A;  1ZEL A;  4NQW B;  4E7H A;  3PJR A;  1LFP A;  3VYS B;  2MFZ A;  3CP8 A;  1E0E A;  4E7K A;  2MYS A;  3QYB A;  4CUG A;  5CKT A;  3TL4 X;  2LRD A;  2VXZ A;  4XN0 A;  4F52 A;  1GLN A;  1X1C A;  4XR6 A;  3L2V A;  1DGW Y;  2PJR A;  4XKW A;  2BW3 B;  3D5R C;  2IS2 A;  2JUG A;  3DWL E;  4LG3 A;  3OYN A;  4J01 A;  4F3Q A;  5TGT A;  2ZFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...