2WY8Q

Staphylococcus aureus complement subversion protein sbi-iv in complex with complement fragment c3d
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
66
structure length
66
Chain Sequence
VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Basis for Staphylococcal Complement Subversion: X-Ray Structure of the Complement- Binding Domain of Staphylococcus Aureus Protein Sbi in Complex with Ligand C3D.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT C3D FRAGMENT
total genus 31
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wy8Q00
2WY7Q 2GOXB 2NOJB 3D5SC 2GOMA 2WY8Q 2JVGA 3D5RC 2JVHA
chains in the Genus database with same CATH superfamily
3BCAA 4Y4RA 4ZJZA 1MBGA 3WTWC 2P5VA 5TRDA 1FT9A 1DDNA 4N4OB 1O7LA 2VT3A 1X1CA 3U1DA 1ETQA 3I0TA 3FHZA 2HYJA 3O8GA 4JP0A 1Z21A 1F4KA 3BQYA 2TDXA 4EGZA 1ODDA 2DTZA 2Y69H 4CICA 1XX5A 4UUSA 5F04A 3AAFA 2D45A 1BR2A 1FYLA 3FMSA 3CESA 1G3SA 3Q5FA 2X6YA 2ZFWA 3CCQI 2HQAA 2LY1A 1ZAOA 2RN7A 4AYBN 3BR0A 1ZQ3P 1I50J 2MD5A 4NBQA 4UB8C 3H35A 2DPDA 1G3YA 2F4MB 3T5XA 1IRGA 4KIFA 4ASNA 3PQKA 2FEZA 5LEKA 4I6ZA 3CMEI 2QKMB 4S05A 1VQPI 4RM3A 2P4WA 1IF1A 3GWZA 3ELKA 4OOIA 4KIGA 5IOZA 3QODA 3S3NA 3H0GJ 1TWFJ 5IOYA 3KIOA 3BJAA 2P81A 4JX4A 1P2FA 2ZKZA 3IH4A 4D9JA 4BQOA 3CTAA 2VBZA 4XN3A 3WGHA 3OOUA 1Y39A 1OYYA 3OYKA 2K40A 1AKHB 2MLKA 2R7UA 4QSHA 1Z77A 2AQFA 4X6AJ 5IP6A 1BI3A 1YJWI 1SD6A 1ZHFA 2HXIA 4U7BA 1MD0A 1MDMB 3HM5A 3RZOJ 1EF4A 1NG6A 4WXDA 2X9DA 4L5EA 2CUFA 1QZYA 3G71I 2MBFA 3JAMK 1BBYA 3ZN0A 3KE2A 2DA6A 3IWZA 5IT3A 3K1PA 1IXSB 3C1DA 5CQEA 2YPRA 1I6XA 2AQEA 2E2IJ 1AOYA 3PQJA 1E3HA 3I56I 1TW2A 1OYIA 3HUGA 4IVNA 3C2HA 1Z7LA 1V3FA 3EUKL 3KYDB 2LC2A 2QQ9A 2VQGA 1DPRA 2BBYA 1ZYRF 3MWMA 4E7ZA 4HOBA 4U0VA 1Z7UA 3CQZJ 5C44J 4E7JA 2QBYA 2X6XA 5IT9K 2A61A 1LE8B 3JTHA 2IS4A 5E1ZB 1BJAA 1YW9A 2ELJA 3D1NI 3BR5A 2LFBA 3H1CA 1QHGA 2IS1A 1KU9A 3VWBA 2JT1A 2JRTA 2F5EA 5KAFC 5B1BH 2BVMA 4BE1A 2VONA 4ZYGA 1K61A 2BW3A 4LIVA 4OWRB 2O0YA 3Q0UA 2KLOA 1U5TB 2KP6A 2CQNA 2IXSA 2R7XA 1OFCX 3Q9SA 3V7SA 2VJJA 3W2VA 2HR3A 4B43A 3H0DA 2XF7A 2VLAA 4BQQA 2GA1A 1KA8A 4A3BJ 1FBSA 5D8KB 2X1CA 4D5FA 1SFUA 1JKRC 1KU2A 2L4AA 3HRTA 1ZGJA 2OZ6A 2W4SA 2A6EF 2Y30A 3GW2A 3TDZC 3QPLA 1MSFC 3DBHB 1V4RA 5B1AH 5L3DA 2G7UA 5CVUA 2DLLA 3FWEA 3QU3A 1OKRA 2ZSHB 1T08B 2H1LA 3FKIJ 3K1MA 4RAZA 3O2PE 4AD9A 2BW3B 1OR7C 2Q1ZB 5FD6A 4EJWA 1BI1A 5M5YJ 3LSMA 2YS9A 4AVZA 1Z6TA 2QEXI 2ACJA 2KRFA 1JUPA 4PGGA 1YLFA 2RNJA 4M71A 3U2RA 1SFOJ 1SFXA 4YELA 4FTHA 2A68F 3BR3A 5K5QA 2OV7A 4B8XA 3FM5A 5K7ZA 4JOMA 4OMYA 1WVRA 1T39A 1UFMA 2VQLA 3JRDA 2EIJH 3IRQA 3I53A 2DMNA 1ZARA 2KRHA 1NTCA 2W82A 3OYNA 1MNEA 9ANTA 2WAFA 1FWZA 3IRRA 4D0PA 4IRHA 3B6AA 4I2OA 3K2AA 3I59B 2CS3A 2GWRA 3A2KA 3ZGKA 3ZQGA 2NVYJ 1D5YA 4ZDLA 1UJ8A 2F5DA 4ZYDA 4JX5A 3I55I 4P9UA 1ETYA 3OR1C 2LD5A 4N4NB 2WAQN 2RQQA 2VB6A 3K2ZA 1T98A 3V7RA 5ILSA 4EGYA 2FNAA 2GIVA 2AO9A 3BG5A 2VN2A 2ADUA 1I27A 1G3TA 3P9IA 4LG3A 1U0JA 5J8FA 3CUQB 1IC8A 4IHTA 4DQ2A 2WWYA 3S14J 2CFXA 4EV0A 2FNPA 2NRAC 4FT8A 2P5KA 1XCBA 3DPLC 3RZDJ 4KN4X 1P9QC 1GVJA 3A02A 4A3FJ 3PNTA 4MFEA 1CF7B 3DPTA 1L3LA 4ENJA 2F48A 2GA2A 4F3QA 1R5HA 2QSFX 5LGTA 1O57A 4M6YA 1J5YA 3I59A 3E5UA 2PQ8A 4JX6A 5FFXA 1D8JA 4ABZA 3QP5A 4BEHA 5CPRB 3HOSA 2DO7A 5J47A 3WTYC 1WKMA 1FNNA 1MW7A 3RJPA 1JHHA 1Z05A 2LKPA 4KIBA 3CUQA 1TC3C 3LWFA 4BHPA 4HQEA 4M74A 4BAYA 1WJCA 1VQ7I 4LMYA 2H6CA 3SJMA 2BOLA 2M4KA 1QHHD 2VC1A 4KITB 5JR3A 3L2VA 1YX5A 2ZXIA 2HXOA 2MH9A 5B66C 3JRHA 1SD7A 3I4PA 4ITVA 1RIOH 3ASOH 3Q9VA 3WHCA 1P4XA 3K4KA 2XF6A 4CYCA 1XS9A 4BJ6C 2O9LA 1DU6A 3E5XA 3CD6I 4YG2F 2FOKA 2Y75A 5LHIA 3BG3A 4ESFA 1BOBA 2NOGA 3OIOA 2EK5A 5FKKA 3I54A 4OMZA 2L5QA 4DZPA 1Y56A 2NNNA 2BE5F 4WXCA 4XQFA 2JA6J 4KYWA 4XORA 2LY2A 1BI2A 1JGGA 3M4OJ 3BTIA 1ZREA 3RTRA 2DCEA 1Y8RB 3NQOA 2ZXJA 3K4LA 3C7JA 3TP3A 2D1VA 2XSJC 5IYDJ 1U8BA 2Z2SB 1RR8C 4MFDA 4CUGA 3A03A 3R0AA 5KHDA 1KYWA 4E7LA 1BR4A 4QTRA 3A0HC 2O7OA 4Y13A 4DYQA 3Q0VA 4DJAA 1FIAA 1U5TA 3RSNA 5F1RA 3WODF 3WTUC 2QSGX 4CGZA 3S1QJ 1HW2A 3EDPA 3ONQA 4XRSA 1D0YA 4QIWN 2QUFA 1OPCA 2COBA 3OSFA 3GTMJ 3T8TA 2C6YA 5D5WB 4FE4A 5KAIC 2I10A 1AU7A 4Q5SF 3R61A 4IPAA 3BTLA 3KP2A 3G3ZA 4PCQA 3MN2A 5D6FA 2K7LA 2VPRA 1ORKA 3GUDA 4A0XA 2QQBA 3V42A 2R7FA 4OAYA 2PI0A 5KNLA 2E2JJ 1TQIA 2BV6A 3JR9A 1LVKA 2LDUA 3SZPA 3OYEA 2A6TA 1HDPA 1AWCA 3EYIA 2H09A 4MLOA 4AM3A 3F6OA 5C4JJ 2OCEA 3BJOA 3CC4I 4OIRF 3CCVI 4IHWA 2IS6A 3VODA 1ETXA 4WK8F 3DTKA 4LFUA 2KIUA 2K5CA 2QVOA 1X1DA 2J5PA 2HKXA 4ENNA 3S8PA 4RBOA 2L9VA 3PIPF 2LH9A 1T33A 5LFAA 3M3YJ 1YW8A 4IOCF 4V19K 4A2UA 1SVOA 3OOPA 3WE2A 3F22A 2HWVA 4E7SA 3V4GA 3L1PA 4HPQA 5ERIA 3SEQA 2TCTA 2LSOA 1GLNA 1HW1A 3ZMUA 4Y17A 2QCOA 4QPQA 5LHHA 3C3WA 1H0MA 1ZRDA 2KISA 4XONA 1XGNA 2WV1A 3UR3C 3GFLA 3JTGA 4WX9A 3IP4B 2HDDA 4DZJA 4P96A 1CF7A 2K86A 2XV4S 1WH5A 1ZGWA 1UHMA 4ETSA 5BMZA 1XGSA 2KFDA 1FPQA 1VQNI 4CH7A 1IW7F 1OJLA 1LEBA 4IL6C 3TGNA 3DEEA 3TQNA 2OU2A 1WFXA 1EH7A 3H36A 1MMNA 4IRGA 4L0YB 4ZYEA 2DMTA 1F1ZA 4XK4A 2NVQJ 3B73A 2XAGA 2R7SA 1TP4A 1OR7A 3ASNH 1N77A 2F2EA 4UUSB 2KDOA 5GPCA 2JQ7A 1X4PA 1TQPA 2BY1A 5H6RA 1VQOI 4G8XA 2LK2A 1IN6A 3MKYB 1ZRCA 3PM1A 1GT0C 2GXAA 1YYVA 2FBIA 5DCMB 4A69C 5H20A 2BXYA 1ZGAA 2V4JC 3RPQA 2HVRA 3HZJA 3KYCB 4F55A 2V1XA 1ULYA 1EKEA 3HEFA 4U0YA 2HQ5A 4Y3OA 1DGRM 4EM2A 3OYHA 3TW7A 1HW5A 5EG0B 4HV5A 3PO3J 1LVAA 2YU3A 2QWWA 1G6NA 4XIDA 1Y8QB 3G1OA 1OQYA 3G4SI 4RAGA 2X1EA 3J80Z 2XASA 3FM3A 1P92A 1P7JA 1WWXA 2KIMA 2XAQA 1HOMA 5F0FA 3ZMDA 1V5FA 2HDCA 2P0WA 3KPHA 3KZZA 4A3JJ 2H8WA 2JTVA 2ISYA 1IV6A 1FX7A 1E0EA 1MNDA 3IKVA 1YG2A 1MJBA 3VB2A 1VQ8I 3PFYA 4KJZA 1TNTA 1DQUA 1MZBA 3NAUA 2VOOA 3B6CA 4FCYA 4HF0A 2JUGA 1TWCJ 3GLXA 4MO7A 3K10A 4YRVA 1JTYA 3AKZA 3QQAA 4C9YA 3M07A 2XPVA 3HUGB 2JK3A 4CCOA 1YIJI 2X1DA 1W36D 3FXRA 1H9TA 4HG2A 1YRNA 3FXMA 4Q4ZF 1WPKA 3S16J 1MH3A 2WAQA 2YUSA 2E5ZA 3OYGA 2ZMEA 1GUUA 3ZCOA 1OCRH 1SD4A 2LR8A 3OS1A 2OUMA 4QPOA 1SEUA 2R7OA 2YX4A 5LRSA 4IX7A 1XGOA 1YW7A 2M30A 2ZJ2A 2IT0A 2KHMA 1XC5A 5F27A 4II2A 4BHBA 4XLFA 3ZXSA 5BPDA 1BC7C 4RM2A 1ZN2A 3W3CA 4BXFA 1VZ0A 2GOMA 5HNHA 1K6OA 2F5CA 2K9MA 5HNFA 4UHTA 2R7RA 2VKEA 2ZXHA 5FRMA 5CJ9A 1LQ1A 1APLC 4I0AA 4M6VA 2Z99A 1N25A 2XROA 3CO7C 4LOCA 3CMMA 4HW0A 1USSA 1YRNB 2IGNA 4PJMA 3D5SC 2Q8KA 2ZJPF 1PDNC 5J1YA 1K7AA 1QZZA 2O3FA 4IHYA 4N9IA 3OV8A 1RRJA 2KPMA 1J75A 1TZLA 3CJTB 3ZQFA 3SEZA 2Q2EB 2D1HA 4BXUA 3LA2A 2FSWA 2Y9YA 5GTHC 4KNYA 3DU5A 5M5XJ 3NRVA 4UXNA 2AXTC 1I3QJ 1B6AA 3UKGA 1R1TA 5FKLA 1RESA 1LFPA 2QENA 4KA4A 1D0ZA 3CCLI 2EJRA 2XGCA 2R0QC 1A6QA 3IH2A 4E7IA 1R1UA 1U78A 2X6WA 3HPHA 3LA7A 2HTJA 3CUOA 5ICFA 2IJLA 4G9YA 1OCPA 5EEGA 1FMVA 2DQLA 4XLNF 1V54H 5E20A 3FZVA 3KZIC 3HB9A 2EFNA 4W1UA 2VJIA 3ESWB 3K7AJ 1S6LA 2A5YB 1D1BA 2XHKA 1MMGA 4G7HF 3BG9A 4OU0A 5JLXA 1ZG1A 1CQTA 2I8DA 2R7DA 1R23A 2DMUA 2RQPA 4A0YA 2RNGA 3QU6A 1USTA 3BDDA 4GRIA 2ZNZA 4ON0A 2DBBA 5DUKA 4XLPF 1XDUA 2FXAA 4G12A 1DU0A 2DYRH 2GZWA 1UELB 2EQRA 3VSKA 2WC2A 3S3MA 2R7TA 3K0LA 4EATA 2P6SA 3DTIA 3F21A 4M9SA 2DMQA 2WBMA 1YFHA 3SZTA 3IC7A 5E3NA 4G6DA 2E19A 1T56A 2FE3A 1O3RA 1F5TA 1O3SA 1I5ZA 3LSPA 2CRGA 3CDLA 4C3IJ 1IN7A 4XNFA 3OS2A 4JYKA 3PNVA 4J19A 3HRUA 1MJAA 1MGTA 5CYVA 3ZMSA 2Y0SA 3P5JA 2E1MB 4KT6A 3ZQIA 1ZG3A 2W00A 1OCTC 1QVUA 4XLEA 2R5ZB 1T0FC 4CYDA 2STWA 1IRZA 1WRJA 3L2RA 2K4BA 4RDUA 5E18F 1WCMJ 2FQ4A 3F6VA 2M5WA 1YITI 3TBIA 4I09A 3DLLF 3AFHA 3OSGA 4XOTA 1H8AC 2QKLB 5ICGA 3F8NA 3OL3A 1HF0A 3S3OA 1PJRA 3HOWJ 2W1OA 3HBLA 1Z1DA 3BC8A 2DFEA 3M1EA 4M3FA 2UXXA 5FD5A 4RGXA 1Z3YA 1MBJA 2YR2A 5DYMA 2PBIA 1WJBA 3O6BB 3OYIA 2V1DA 2ZXWH 4CCNA 3MKZA 3P9CA 1TBXA 3ECOA 4B47A 4IHSA 4F52A 2YX7A 4PJLA 5D5XB 4J01A 1SAXA 3F3XA 1HDDC 2RC4A 2WA0A 1EV7A 3DKWA 5E8IA 2A05A 1MSEC 2XGEA 5J8CA 2KZGA 3LAJA 2EZLA 1WJAA 3BJ6A 3DLAA 3FK7A 4FASD 2K9LA 4YEJA 1QPMA 3E6CC 1MMAA 2DA7A 3BPXA 3DFGA 4DOZA 3VPRA 2JPCA 2Y9ZA 3QAHA 2MC3A 2LYCA 1REPC 1IN8A 4XL9A 3UNGC 2JVHA 4GYGA 4RB1A 3TOBA 4BS9A 4IO9F 4JQFA 2LY9A 5CVRA 4BNCA 1R00A 3NWTA 2FBKA 3W6VA 4BY7J 2A07F 3WG7H 3S1MJ 4DGWB 3ZQQA 3P7NA 3M9AA 4Q48A 5F6FA 3KZYA 4M6XA 1RC9A 1QU3A 2NVUB 3QYFA 2K85A 2CJJA 2W25A 3FXOA 1MNMC 1LNWA 2IGOA 2VKVA 2HU9A 1B8IB 5CVVA 3H9JA 4EM0B 3M7GA 4MTDA 1SFKA 2L7KA 2MH2A 1B4AA 1G59A 4CO8A 5B5EC 3LSRA 5DCFA 2E34A 2ZNYA 3JRGA 3T0YA 2K27A 2E1OA 3OYFA 3LA3A 2LRDA 3FDYA 4LIUA 1HSJA 3WE3A 2XSDC 2DOFA 2HYGD 4RLFA 4ZTJA 4HF1A 1IXRC 2OAZA 4XM3A 2CO5A 4E70A 3SFZA 2QA4I 5F08A 1XPXA 1W36C 3GXOA 5M3MJ 2V7FA 2DXIA 5K7FA 5FKNA 1F9NA 2GM4A 2HQNA 2QQAA 2PLYA 4HLYA 4ENKA 4IHXA 1O3TA 2AXLA 4FHTA 2NS8A 4E6KG 3OL4A 3FBNB 2CV0A 3HSRA 1SD5A 2ZJRF 4OIQF 5EF6A 2Z1DA 1F36A 2IP2A 4XMYA 4A3EJ 4I02A 3Q0WA 2DAOA 4ZDOA 4O6JA 1P7IA 1HKQA 2F4OB 3JREA 4L9VA 1JJ6C 2DK8A 2GQQA 2CW7A 4PZJA 5LEJA 5IY5H 3NWSA 3TOAA 1R4MB 1IXCA 3G73A 4RGUA 4BGDA 3CCEI 3GTKJ 1O4XA 5J3LA 4RGSA 2XB0X 4CZCA 5C4XJ 3F8CA 4EMSA 5BNGA 1G4DA 2DJNA 3HYIA 4PFPA 2Z33A 1ZR2A 3CLOA 1KQ8A 2CUJA 4I76A 5LGUA 1NK3P 3RQIA 1QO0D 2JPBA 3HC7A 3H3ZA 2DA1A 2DFFA 1LDDA 2P6TA 2DTRA 2L3DA 2O61A 1Q1VA 3ABMH 3AL0C 3CDHA 2EV5A 3RKWA 3E5QA 1AKHA 1KQ9A 4PK4A 2P7CB 4XLCA 3S2HJ 2DMPA 3I71A 1IRXA 2CFOA 4G7OF 3IUOA 1PUEE 2BY3A 1B59A 2ETHA 4ZYAA 1J7KA 2VE9A 1WHUA 2QYOA 4PJJA 2MD0A 3HDDA 3HOZJ 2O8XA 2KJBA 4BJ5C 1D3YA 1UCRA 3BZ6A 2R7ZJ 1A5JA 3G1MA 3WU2C 3U21A 4EEFG 1DUXC 4PDKA 4L5IA 5IYBJ 1XCVA 1OLTA 3HIFA 3IKTA 1VFCA 2X48A 1X2MA 2W85A 4OIPF 2FUG2 4BEHB 5B3SH 3QP6A 5L3CA 1HA8A 5AONA 3QRFF 3FX3A 1SANA 3DBRB 3GZ6A 2Z16A 2KT0A 2CWEA 5D4SA 1UG0A 2HPMA 4RB3C 1SC7A 1GXQA 2M4GA 4AIHA 2CQKA 5LD2C 1E17A 3H92A 3QYEA 2QM3A 1VQ4I 3CC7I 1POGA 1AA7A 1QPIA 4GXOA 4M3BA 2O8KA 4XLHA 1YS6A 1KYZA 2WY7Q 5DM6F 2M8GX 4WF2A 2ELKA 5A2QZ 1X1BA 2HZTA 3LSIA 4ZDPA 4S04A 4DYCA 3L00A 1XDSA 4P55A 2R7WA 2VJ5A 2M8EA 3NEUA 3DQVC 2LKSA 4B3XA 5CVIA 4MNUA 1IAWA 4XR6A 2R5YB 1YO5C 3DEWA 1R4NB 5F64A 2V9PA 4S0HB 2K9QA 2OTLI 3I3LA 3K69A 1GHCA 3K70D 3L7WA 2EZKA 1HXDA 4UVCA 4XSZF 1XSVA 1HLVA 2HTSA 2PJRB 1A31A 4BBSJ 4LLLA 2ZMEB 1RETA 3DF8A 1NG7A 1J2XA 2P7VB 4M3DA 4P1WA 4L9JA 2EFPA 2IGKA 4PFOA 2IAIA 3EYYA 2VBXA 3HL2A 3V8LA 1UG2A 3KLNA 3LMMA 3SQNA 4G7ZF 2MW8A 4J00A 1WQ2A 3HPGA 2NNYA 3OYCA 1GV5A 5FLVA 1T6SA 1KU7A 4EVIA 3D0SA 3HOVJ 2RKHA 3LFKA 3SYTA 4HNUA 3PIOF 2N8GA 4A3DJ 2EINH 1E2XA 4V2GA 3U9GA 1G3WA 2EIKH 3GYHX 3ZQLA 5GTIC 2VASA 3ERED 2VUMJ 3J7AY 3HSFA 2G0EA 3PNYA 2G9WA 3KEOA 1NH3A 2DT5A 2OQGA 2M0MA 2E7XA 2CV2A 1W0TA 3GTOJ 4HX7A 1LB2A 3R0JA 2GOXB 4C3HJ 2M87A 3OR2C 5FFZA 4A5MA 1DPUA 3OIQA 2LBFA 4GFBA 4U0WA 2MC4A 2ESNA 2DOEA 2EH3A 2M34A 1HSTA 2KRCA 4ZC3A 2RV8A 3GLLA 2EWNA 2CW0F 1MBFA 4IEJA 1TWAJ 2H6BA 1S72I 4O5VA 3F0CA 1S8NA 4D7NA 1I6HJ 3HSEA 2XDVA 1IG7A 4LK1F 2PX9A 5DUIA 3OMYA 2ISZA 2B63J 4AIKA 4LJZF 3TDUC 1K78A 5JHUA 6PAXA 3E6BA 2X4HA 4ZZLA 4WCGA 4IQ4A 3ML6A 5EYRA 1ITYA 1TT0A 2Z9OA 1NHAA 2V9VA 5A2QK 4YFNF 4L0ZB 3AG4H 1P4AA 3PJRA 2HNHA 1X1AA 4IJAA 4MQVA 1TLHB 4DYRA 3M1CA 1FP2A 1B72B 1YQAA 2IGMA 2FMYA 2XVCA 1KGSA 3JAMZ 5HS7A 3GF2A 3R6SA 1RPWA 2KIQA 4UUVA 5IYCJ 4IZZA 3A01A 4F93B 1OCCH 1D8KA 1O7FA 2WB1A 3LAPA 1PUFB 2DPUA 2HEOA 4XKWA 3BR1A 5FRNA 2LREA 1XB4A 2E5NA 2W57A 2LKXA 3HHGA 2G7HA 1BIBA 3F72A 2MGQA 1R58A 1LFBA 5BQTA 4BDYA 2RREA 4CSWA 1JUMA 2JSCA 4XOPA 4NHJA 3S1NJ 1IO2A 2NOJB 4C2TA 3KP7A 4UUTA 1YS7A 1FOKA 3SHFA 2UV1A 1U8RA 2HOAA 3MD2A 4NDLA 4CXFA 2FMLA 3ZQCA 3FK6A 2EFOA 4V2FA 2NXNB 2FD5A 2ZFUA 1XMXA 3KEQA 2PMZN 3L2QA 3J81Z 3GFJA 2ZCWA 2L0KA 5GAEJ 1YHQI 1X4OA 5HLGA 1B8IA 3BLYA 1J0RA 5H6QA 1FOYA 1U6GA 2ZBKA 1ZH5A 3QWLA 5J1UA 2JA7J 1XMKA 2EA2A 2CGPA 2UUZA 5E79C 1YOVB 4P9FA 2CV1A 3QPSA 2A6HF 2KJCA 5DDGA 2AHQA 2BGCA 3U1KA 4U87A 1A04A 1NK2P 2RDPA 4BE0A 2VC0A 3AG3H 4RAFA 2R3SA 3FXKA 3QOEA 5LBQA 1K4TA 4IHVA 3IL2A 1PYVA 1U9OA 4PJNA 3VFZA 4PUSA 1S7EA 2ID6A 2QF7A 1V5GA 2W24A 3ABUA 3H3UA 5M5WJ 3OS0A 4UV8A 4JBAA 1E3PA 2M45A 2PMHA 1FYKA 4KUMA 4UVAA 1JI8A 4KMUX 3TKYA 4BL0B 2HOSA 2CQXA 2LTPA 4KISA 1OYWA 1STZA 4NC7A 3IAS2 2MABA 3HHHA 1QRYA 3DBLB 5DTDA 2R7QA 5K5RA 3J80K 3K1NA 4LG0A 4XBFA 4GGGA 1TT5B 3MEXA 5H2FC 3BR6A 1BW6A 3WTVC 3HRMA 5D5VB 5E17F 2XPWA 3WTXC 2CUZA 2OQRA 3FIWA 3E1SA 5HODA 2LOOA 4CCJA 1L0OC 4AIDA 4X0GA 3COAC 3I9V2 3BTJA 2MSYA 2VKDA 4RGRA 4ZTFA 3PUBA 3FKJA 4D5CA 2RGVA 4DBQA 3ZN1A 2WV0A 1KU3A 5F0HA 2OJED 1S7AA 5FLXZ 1JT6A 1FMWA 1ZTRA 2OTJI 1A35A 3J7AO 2HVQA 5HDGA 3JRBA 1IN4A 3ZMZA 2XAFA 2VIXA 1D0XA 1YX3A 2GIZA 3PSFA 2OPTA 3BOQA 3HRSA 5KVRA 2IS2A 4GYIA 2VQHA 5E3LA 2E1MC 2V1UA 4HV6A 2FRHA 3RKXA 5IT9Z 1OCZH 1J09A 3H5AA 2IEKA 2WY8Q 4UVBA 1I39A 1G2HA 1W5TA 4OIOF 3EUAA 3BQZA 2E7WA 4BACA 2PMUA 3ZQ7A 4OAZA 3KETA 4IRIA 4F91B 1U3EM 1FEXA 1UMQA 2XUBA 2HFHA 3CCJI 3GTLJ 2DW4A 5J1RA 3HOUJ 3F9KA 1RUOA 3C2BA 5HDNA 2HOEA 5D5UB 2OZUA 2EILH 2DA2A 1ETVA 3O8HA 1TWHJ 5JI6A 5ILVA 4N0BA 4Z2YA 1JJ8C 1D5VA 1WI9A 1R71A 4LD5A 4A3MJ 1WSUA 1XSXA 3ZRGA 3CLQA 4O3MA 2V6EA 1SAUA 2LLKA 4LB5A 3ZMVA 3RCOA 1Y0NA 3RYPA 1W5CC 4ENMA 3LSJA 5FGMA 4I98B 2KDZA 4BBRJ 2EFQA 1Y6IA 5D4RA 3WGIA 2M1BA 4KICA 4LLGF 4IKFA 3BPVA 3N4MA 3K9TA 4A3CJ 1FZPB 2ICWG 3M8FA 1ZLKA 3HGGA 4C3JJ 3CMYA 1FJLA 3WTSC 4Y52J 2DU9A 2DT6A 2D2WA 2L2OA 2HYFA 2XRNA 2X6OA 4PSXA 4HA8A 1FSHA 4U88A 3VDXA 1JXSA 1W7PB 1X3ZB 2BY0A 2M7AA 2HPIA 2MFZA 3PL8A 3RPUD 4YIIA 1LDJA 5DD4A 1X3WB 2Y2ZA 1IDYA 2MA3A 4LK0F 3ZQHA 1BM9A 3BZCA 3HTSB 3CCMI 2QZ8A 4E7KA 5F1JA 5GPAA 3BR2A 1UZCA 4M9XA 4CCLA 4F92B 1BA5A 5CLSA 3ROUA 4A3IJ 2IBDA 2L7FP 1X2NA 3F8FA 4II3A 4UB6C 2YSRA 4B48A 3JRCA 4A3GJ 3RKYA 3LL7A 2OF7A 3LSGA 3DTEA 4X1EA 3GTGJ 5FB2A 1RI7A 1X19A 4CCKA 4R79A 2CQQA 1GV2A 4XRMA 1PP7U 1G8XA 2KIFA 3PUFA 3GX4X 3CZ6A 1WH7A 4AYBA 1ERDA 1IGNA 3L9FA 3W6JB 2NVTJ 4CDGA 4Y33A 3GFIA 5J40A 1XMAA 3CCSI 1YI2I 1GDTA 4IF4A 3MQ0A 1A6IA 2M9HA 1MBHA 4DBRA 1Z67A 2EZIA 2QQ8A 1XD7A 5EJCA 5FLMJ 5TISC 5LHGA 5E1XA 3FHNA 4CCMA 3W2WA 5JVTA 4CZZA 4DIQA 2VKHA 1RKWA 1JHFA 4HX4A 4LGWA 1ZLJA 2A69F 3QPTA 4ESBA 3H3VK 1JE8A 1WGXA 1WJDA 2P5LC 4CHUA 3LSTA 4A12A 3W2AA 3AG1H 2GAUA 3OYDA 1AHDP 3JRFA 2EIMH 5LRRA 2PEXA 2JA2A 2KZVA 1TL8A 5CQGA 2E1CA 4BH9A 4KN7X 2M0CA 1IV8A 4M3EA 3A0BC 3EPZA 4AWXB 2EZHA 2DOAA 3RDIA 4GO1A 3G1LA 1Z91A 4BKXA 2DA5A 3OWTA 4XKBA 2DQRA 4M73A 2P8TA 3CDIA 4NQWA 4RS8A 4XLAA 4YIRX 3K70C 3A1YA 3KFWX 3LFUA 1YE9A 2X51A 3HXLA 2BEOA 4HYEA 2BHZA 5KK1A 2TRTA 3IH3A 3RI4A 4MQ9F 3HKZA 4YIFA 3Q3SA 4ANJA 3AL0B 1HC8A 1WZ2A 2EB7A 2FF4A 3JRAA 3I5UA 3FXLA 4FE7A 4A5NA 2BZTA 1MDMA 2ECCA 1S3JA 1MBEA 3WG9A 1BI0A 1FIPA 1BC8C 3K4MA 3MMYB 5E8GA 3J7YJ 2F4IA 2LBFB 2L9SA 4G6QA 1PUFA 3KP4A 1FP1D 3K4NA 1S29A 3GTJJ 3F8BA 4LB6B 5J6XA 1GXPA 1IUYA 1QQIA 2E60A 3RKQA 2OCCH 3L2CA 2HS5A 2XRLA 5L3EA 2F6CA 2L7ZA 1SMTA 2XF5A 2E2HJ 4ZH4F 3H9QA 3LQRA 1MBKA 2ZC2A 4AIJA 1S5LC 2HGCA 3VYRB 1YTYA 2CU7A 2MG4A 2D5VA 5ILUA 1B9NA 2HZDA 4BUPA 3KP6A 2FBHA 3O3KA 4BHCA 2LG4A 1K78B 4BY1J 3WTZA 1B9MA 2Q0OA 3V8JA 1VQ5I 4CA0A 4HX8A 2CSOA 4XICA 3G2BA 1V5EA 2HKOA 3ABTA 4NC6A 5TJJA 1W1WE 1QNTA 1W4MA 4OINF 4RMNA 2Y0SN 1ZK8A 4DNCA 2DI3A 3CP8A 3KCCA 4M72A 4FISA 3C18A 5DCMA 4I01A 1DP7P 3JCUC 2FJ1A 5CVJA 5L3FA 2R5ZA 2FQ3A 2EA4A 4M9ZA 2PJPA 2UXNA 2DA4A 1HCRA 1FTZA 3IHUA 5K7HA 2O6GE 5HS8A 5EGOB 2NS0A 3CF5F 4WXHA 2RAEA 1U2WA 3C2GA 2EBIA 4XKVA 1S9HA 1J9IA 4UV9A 2VXZA 3VEPA 2ZMEC 3H9GA 3N97A 4H0EA 2VODA 3BROA 4FETA 2HOTA 3I58A 1IUFA 3MCZA 2ZB9A 5J4YA 1H89C 1U9NA 3GZNB 3JW4A 2XKPA 1S7OA 3GVAA 5DS9A 2OA4A 1T38A 1E3OC 1R7JA 4I99C 1RR7A 3S32A 3H5NA 3S17J 4LLNA 4IXAA 3ZOBA 4NC8A 5GAGJ 2W7NA 4BXXJ 4RLQA 3SDBA 4RB2C 3RIRA 1FOWA 4KMFA 3E6DA 3OIPA 3EUHC 5GAHJ 3E7LA 3DWLE 2I5UA 1T95A 1JTXA 2K9SA 1JUSA 3TEDA 1X58A 1VTNC 4AUXA 1XSDA 3GTPJ 2H8RA 3IV5A 1T8IA 3E97A 5FO5A 1K4SA 4ZZDA 3MKWB 3BTCA 3TO7A 5JLWA 4GCVA 3S2WA 3MZHA 2ZO4A 2IA0A 1T0FA 1BR1A 5M3FJ 3LOCA 3FF5A 1QGPA 4PSWA 2CQ7A 2H94A 2UZKA 5DEQA 3MFKA 5DM7F 2DJIA 3V7CA 4LITA 4UNOA 1H9GA 3DP7A 4B3AA 4EJVA 4D1QA 5KCMA 1SFEA 2V1NA 3KEYA 4L9NA 3HTUA 3F23A 4XRFA 1TNSA 1MKMA 1M1EB 1K6YA 4WWCA 3KP3A 4YFXF 3OYMA 5EEHA 4BDZA 3CC2I 1IDZA 2Z3YA 1R5GA 1U5TC 1W7PD 2BHYA 1HKTA 3SZGA 5EZGA 1UHWA 4DW6A 2IRFG 1HKSA 4G94A 4AVPA 1EA3A 5LLQA 1F43A 1VQMI 2KKOA 1BJZA 4A93J 4I0BA 3T8RA 4Z6YA 2OBPA 4NUBA 1MIJA 3W6KB 3CP2A 1X3UA 3GFMA 1N78A 3VOEA 2BY2A 3DEUA 4HNVA 1T2KA 3BY6A 1DP3A 3ERMA 2NS7A 5LGNA 5L3GA 1JKPC 3D5LA 1ETOA 1JT0A 2W48A 3ABKH 2JA5J 2QSHX 1PVEA 2Q2EA 1MMSA 1J59A 3FXQA 4UY8I 5CKTA 1TW3A 1Z0XA 2DFIA 1FLIA 2ELHA 2K02A 3G6EI 1ZELA 4HBLA 2M3AA 1OCOH 5ED4A 2LVSA 3GMEA 2O03A 1IN5A 3HOXJ 3B02A 2VOPA 5FROA 1DGWY 3WU1B 5D6EA 3EUHA 4EJOA 1B72A 4EQQA 4EM1A 2Z5UA 2W84A 4HSTA 4KFCA 3HKZN 3HGYA 2VT2A 2M7BA 2VI6A 1MMDA 4QLCU 3KYLA 1X1PA 3F8MA 2VPLA 1H88C 4C30A 3TP0A 4B44A 2JN6A 4RB0A 1I3AA 2DN0A 3BZKA 5EG0A 1BN5A 4RA2A 2L02A 2QGUA 3MAJA 5HLHA 2V9KA 3MVPA 5K5OA 4GDFA 2GXBA 3OYJA 2ME0A 2L4MA 3WTTC 2MYSA 3FMQA 2E71A 3CUQC 3I4MJ 5JVGF 3VYUB 2XGDA 1VQKI 4HDVA 2LF7A 4A6EA 3BCBA 1IZ1A 5FKOA 3CMAI 4PJ0C 3CCYA 3M8JA 2FOWA 2OC6A 3A4CA 3WGGA 1ZG5A 1Y0UA 1K79A 3FXUA 5J4VA 2FU4A 3SFIA 1WJFA 1LUJB 2BYVE 2NYXA 3EETA 3SXYA 3WU0A 5EGOA 2HDWA 1VI0A 3MZYA 2COMA 2XAUA 2R93J 1K83J 2A5WA 2JSPA 1ETKA 3DKYA 3DCFA 4K2EA 3DXJF 2O5RA 2L9RA 4HQMA 4BQNA 4Y7NJ 1Z3XA 2L9NA 2PN6A 3J81K 2VE8A 2CMPA 2VXDA 3CJQB 1ETWA 1LJ9A 5DD8A 4YFKF 3OYAA 2K9NA 1HQCA 2DDAA 2M2EA 1RUNA 4EJUA 2NVXJ 1KQ0A 2BXZA 2GBYA 2HVSA 1ONVA 3CCUI 3KP5A 5JFRA 2LF8A 3ISPA 1Y1WJ 5HS9A 4A3KJ 3GO5A 5HDKA 3GEZA 2XAJA 4M3GA 2LMDA 2STTA 4MIMA 2K4JA 2XB5A 2KL4A 3GTQJ 4NQWB 4HF2A 1BOAA 3GCMA 3PO2J 1LE8A 2E35A 2KMUA 4BQAA 2IA1A 3NARA 2VBYA 3DKXA 2QLZA 5K1YA 1RKTA 1ZKGA 4HZFA 1B1BA 4BYYA 3FMRA 2ESHA 2XAHA 1JGSA 2R4GA 2XKOA 4P5OA 2DODA 4R1HA 5L3BA 5E1WA 5EDNA 1R5ID 5EEAA 3CJNA 1IJWC 3V8KA 2XPUA 3JRIA 3LSKA 2GXGA 2JRMA 2JA8J 2DT7B 1LKXA 2Y31A 3L09A 3LNQA 1RZ4A 2AS5F 2VJ4A 3RPUA 3K4CA 2PG4A 2L54A 2YU9J 1BW5A 3BWGA 2UWMA 2H27A 2FA5A 1TTYA 2R7VA 1KZHA 3VYSB 5HLTA 4B4CA 5JHFA 4XKCA 1VNDA 5E3MA 1O3QA 2BVLA 3HOYJ 1FTTA 1KONA 3L2UA 1MJ9A 2DFHA 4MGRA 4R8HA 5BS6A 1P6RA 3E0JB 2R92J 1FYMA 3D5RC 4MEYF 1RNLA 4KDPA 2LP0A 3T1BA 3S93A 1FC3A 1UB9A 2GLOA 2OD5A 3TO9A 1LDKB 3ZP5A 4IQJA 1Z9CA 2WAEA 2V79A 3ECHA 3GZ5A 4NB5A 1BL0A 1FY7A 1V55H 1JKQC 2B7EA 5HVQC 1TQMA 3BG6A 4BJTA 4L18B 4AC0A 5DV5A 1YJ9I 2RVCA 3CF2A 3OYBA 3MZ8A 2ZJQF 2L7MP 3KLOA 2DYSH 4N9HA 4ESJA 3P9KA 3LSHA 3LQQA 3TW6A 1W0UA 1FSEA 4A3LJ 2IPQX 2V26A 4IOAF 4U7DA 4AU7A 2J5OA 1UAAA 2QBYB 2CH0A 1HBXG 4B1RA 2K3PA 3IWFA 5FKMA 5IP7J 3X2QH 2PJRA 5EZHA 4C2UA 3PFIA 1EH8A 2XIGA 3QOPA 1R6RA 4QWQA 3M8EA 2IA2A 4CYCB 2A3SA 5GP9A 1ACIA 5ICEA 1VQ6I 3ABLH 3JSOA 1XN7A 2CW8A 1C0WA 1ZRFA 5C3EJ 1ZR4A 3DV8A 3J7ZI 1R22A 4KT5C 1QA6A 2DA3A 3I64A 3KX2A 1R49A 4HEA2 1LEAA 2DK5A 1FOXA 4HRIA 1XTAA 2VL8A 1D1CA 4E4HA 5AIQA 4G6TB 5FJ8J 2K3FA 2IVMA 4A6DA 2JZYA 3S2DJ 3FXJA 1Y1VJ 5HOOA 4L5JA 5BPIA 3MKLA 3E3VA 3TMOA 4PGHA 1LPQA 5D8LB 1FBUA 4JK1X 3VYTB 1R9TJ 3R60A 3HG9A 4XN0A 4FX4A 2JUCA 3A01B 5TGTA 3TO6A 4I7HA 1VQLI 1W7PA 1Q1HA 1EJ9A 2CYYA 4HNTA 1OISA 5E3OA 1I1GA 2HQRA 2E1NA 3RYRA 3ZMTA 2X85A 4HDUA 3S15J 3CCRI 1QZEA 3K6GA 1TWGJ 4Q47A 3HOTA 3RQ4A 1EH6A 2IW5A 3K4JA 4L9TA 3E6MA 1JKOC 2ZSIB 2VBWA 1Z6RA 2EV0A 2WB1N 2WTEA 2ID3A 1YIOA 2HI3A 3I4NJ 1GVDA 4MTEA 3VSLA 2CUEA 4TV7A 2EFWA 2KQRA 4E7HA 2VQCA 1SMYF 2CG4A 1W5SA 3DPUA 1VQ9I 1FBQA 3ZPLA 3GBGA 1CGPA 2JJ7A 1WJ5A 3DU6A 1XGMA 2JWTA 1SVMA 4LG0B 3BG7A 1R36A 1A36A 1WI3A 4XSXF 2NAZA 2JVGA 4MHGA 1PP8F 1ENHA 3QYBA 2XC7A 3JSPA 1IRFA 4HAMA 2WADA 1N75A 2PMZA 4FX0A 5F0CA 1I1SA 2X0LA 3FISA 1YJNI 5BOXA 2F5FA 4RAYA 2V6CA 1SVLA 2ECBA 5GADJ 2B9SA 2H1KA 1XG1A 4FQGA 1ON1A 2E36A 2ME6A 3FBIB 4XRSG 3QPHA 3SDGA 2L01A 3ULQB 1R1VA 2EV6A 3N05A 3CO6C 2Y0MA 5FLXK 1ON2A 3H5RA 4BE2A 4C2MJ 1BIAA 2MLGA 4BU2A 2JMWA 5IPAA 2LNBA 3ZR8X 3S1RJ 3AG2H 3HJEA 1UHSA 1QVTA 1P4WA 3BP8A 3TL4X 4B09A 3OY9A 3EQLF 3REOA 4H4KC 1QBJA 4A0ZA 1OMIA 1LFUP 4NNJA 4ZYHA 3PSIA 3K4BA 1MH4A 4F7ZA 5IP9J 3CJRB 1WJEA 1VF9A 4EJTA 2PFBA 4D7MA 3IAM2 3R4KA 3L2WA 2EPFA 1D1AA 4Y15A 2Y48A 5AIPA 4MEXF 3BT9A 4W97A 5HLIA 2XGXA 4HLXA 2DDBA 4HSRA 2R5YA 2B0LA 3WHBA 2FX0A 5ICCA 3OYLA 2F5VA
chains in the Genus database with same CATH topology
3BCAA 4Y4RA 4ZJZA 1E0EA 1MNDA 4N4OB 2VASA 1X1CA 3C2GA 3PFYA 3J7AY 3PNYA 1S9HA 4KJZA 4XKVA 1DQUA 2M0MA 2VXZA 1Z21A 2JUGA 2CV2A 3H9GA 4FETA 3K10A 1BR2A 4YRVA 3AKZA 3CESA 2X6YA 2GOXB 4C9YA 2HQAA 3HUGB 2LY1A 3OR2C 4CCOA 3OIQA 2LBFA 2X1DA 1W36D 4HG2A 3S32A 2MC4A 3H5NA 2KRCA 4ZC3A 3H35A 2WAQA 4NC8A 2E5ZA 2W7NA 3OYGA 4RLQA 3SDBA 3ZCOA 2QKMB 4RM3A 3OS1A 2OUMA 3OIPA 3EUHC 4QPOA 2R7OA 4IX7A 3DWLE 2XDVA 1T95A 3QODA 3S3NA 2KHMA 3OMYA 4II2A 4XLFA 3ZXSA 4RM2A 3W3CA 3MKWB 4BXFA 1VZ0A 4D9JA 2GOMA 5HNHA 4BQOA 4IQ4A 1TT0A 4XN3A 1BR1A 2K9MA 5HNFA 3OOUA 3OYKA 2R7RA 2ZXHA 4PSWA 3PJRA 5FRMA 2HNHA 1X1AA 2DJIA 2R7UA 3M1CA 4LITA 3CMMA 2AQFA 2IGNA 4PJMA 2IGMA 3D5SC 4D1QA 5KCMA 2V1NA 3KEYA 4U7BA 1K6YA 4IZZA 4F93B 3OYMA 4BDZA 1NG6A 2KPMA 2WB1A 1TZLA 4XKWA 3SEZA 3SZGA 2LREA 5FRNA 2Q2EB 2E5NA 5CQEA 2AQEA 1EA3A 3DU5A 4BDYA 2RREA 4CSWA 3C2HA 4XOPA 1Z7LA 3EUKL 2LC2A 1LFPA 4NUBA 2NOJB 4C2TA 2VQGA 1D0ZA 3CP2A 1N78A 4E7ZA 2UV1A 3MD2A 4E7JA 4E7IA 2X6XA 2X6WA 1DP3A 3HPHA 3D5LA 2ELJA 1FMVA 1QHGA 2IS1A 3VWBA 2VJIA 2ZFUA 2BVMA 4BE1A 5CKTA 1D1BA 3L2QA 1MMGA 1ZELA 2BW3A 4LIVA 4OWRB 1X4OA 2M3AA 3BLYA 2KLOA 2KP6A 2IXSA 2R7XA 2I8DA 2VJJA 5FROA 3W2VA 4B43A 3H0DA 1DGWY 2XF7A 4BQQA 2VLAA 2RNGA 2UUZA 2X1CA 4HSTA 4GRIA 2CV1A 2W4SA 2M7BA 1MMDA 4U87A 4BE0A 3KYLA 1UELB 2VPLA 3VSKA 3QOEA 4C30A 3S3MA 4B44A 1PYVA 4PJNA 2R7TA 4PUSA 4EATA 3DTIA 1V5GA 3OS0A 2WBMA 2ZSHB 2BW3B 1OR7C 2Q1ZB 1JI8A 4BL0B 3LSMA 2V9KA 4KISA 4AVZA 4NC7A 3OYJA 3IAS2 2MABA 4XNFA 3OS2A 3PNVA 2MYSA 2R7QA 4YELA 3VYUB 2Y0SA 2E1MB 2OV7A 4KT6A 3BCBA 4JOMA 2W00A 4XLEA 1T0FC 2VQLA 3M8JA 2OC6A 3A4CA 3L2RA 2CUZA 3E1SA 2KRHA 1WJFA 2LOOA 2W82A 3TBIA 3AFHA 4CCJA 3OYNA 4XOTA 1MNEA 2HDWA 2QKLB 3I9V2 3OL3A 4X0GA 2WAFA 1PJRA 2XAUA 2VKDA 2W1OA 3S3OA 4ZTFA 3BC8A 3PUBA 3FKJA 2CS3A 2A5WA 2JSPA 4DBQA 1Z3YA 3DKYA 3A2KA 3ZGKA 2O5RA 4ZDLA 4BQNA 1WJBA 1FMWA 1Z3XA 4CCNA 3OYIA 3MKZA 2HVQA 3OR1C 2L9NA 4N4NB 4B47A 2RQQA 2VB6A 4F52A 2CMPA 2VIXA 1D0XA 1YX3A 3PSFA 4PJLA 2VXDA 3CJQB 4J01A 4LG3A 3OYAA 2IS2A 1U0JA 2WA0A 2VQHA 2E1MC 2HVSA 3DPLC 1P9QC 1WJAA 4FASD 3DLAA 3PNTA 2K9LA 1J09A 4YEJA 3DPTA 3H5AA 1MMAA 2WY8Q 4DOZA 4F3QA 2LYCA 3EUAA 4XL9A 3UNGC 2JVHA 4BACA 4OAZA 2KL4A 4NQWB 4BEHA 5CPRB 4BS9A 4F91B 3HOSA 4JQFA 1MW7A 3NWTA 2KMUA 3F9KA 4DGWB 3DKXA 3ZQQA 1WJCA 2BOLA 2M4KA 1QHHD 1QU3A 4P5OA 2R4GA 3QYFA 4KITB 3L2VA 1YX5A 2ZXIA 3ZRGA 2V6EA 1SAUA 2IGOA 2HU9A 4ITVA 3H9JA 3LSKA 2DT7B 1LKXA 3RCOA 1SFKA 2L7KA 1G59A 3K4KA 2XF6A 2VJ4A 4BJ6C 3K4CA 1Y6IA 3OYFA 2LRDA 2UWMA 3FDYA 4LIUA 4IKFA 2R7VA 3VYSB 4RLFA 5HLTA 5JHFA 4ZTJA 1BOBA 4XM3A 4XKCA 2L5QA 2BVLA 1Y56A 4XQFA 1W36C 1KONA 3L2UA 2DT6A 4XORA 2LY2A 2V7FA 2L2OA 4PSXA 3E0JB 2DXIA 3RTRA 3VDXA 2DCEA 3D5RC 2HPIA 2M7AA 2MFZA 3K4LA 3PL8A 3RPUD 3S93A 2XSJC 1LDKB 2Z2SB 4IQJA 2WAEA 4CUGA 4E6KG 3OL4A 3FBNB 5KHDA 4E7KA 2CV0A 5HVQC 4E7LA 3BG6A 1BR4A 4BJTA 2Z1DA 4CCLA 3CF2A 4F92B 3OYBA 4XMYA 4DJAA 4B48A 4II3A 4ZDOA 3LSHA 3RSNA 3LL7A 2V26A 4AU7A 1UAAA 2CH0A 3ONQA 3LSGA 3DTEA 1D0YA 1X19A 4CCKA 4R79A 2K3PA 2CW7A 2PJRA 4C2UA 3NWSA 1G8XA 1R6RA 3CZ6A 4AYBA 4BGDA 1ERDA 4Y33A 2CW8A 4CZCA 4PFPA 4DBRA 3V42A 2CUJA 3KX2A 4OAYA 3HC7A 4HEA2 5KNLA 3FHNA 4CCMA 1LVKA 3W2WA 4HRIA 2VL8A 4DIQA 2VKHA 1D1CA 4E4HA 3OYEA 4G6TB 2A6TA 3AL0C 1WJDA 4MLOA 4PK4A 5HOOA 4XLCA 3W2AA 3TMOA 1IRXA 2CFOA 3IUOA 3OYDA 2IS6A 3VYTB 4XN0A 3HG9A 4ZYAA 5TGTA 2JA2A 2KZVA 3DTKA 2MD0A 4PJJA 5CQGA 2K5CA 4HNTA 1X1DA 4BJ5C 3S8PA 2X85A 3EPZA 2LH9A 3K6GA 3U21A 5LFAA 3RQ4A 3HOTA 3K4JA 2DOAA 1OLTA 2ZSIB 3OWTA 4XKBA 3K70C 2FUG2 4BEHB 4E7SA 4XLAA 4HPQA 3SEQA 3A1YA 1HA8A 1GLNA 3LFUA 3VSLA 1YE9A 2KQRA 4E7HA 2X51A 2VQCA 2Z16A 3HXLA 4QPQA 1UG0A 2HPMA 4XONA 3DPUA 3UR3C 2M4GA 3IP4B 5LD2C 3GBGA 3HKZA 1WJ5A 3DU6A 3QYEA 4ANJA 3AL0B 3BG7A 1AA7A 2JVGA 4CH7A 4XLHA 2XC7A 3QYBA 2WY7Q 3DEEA 2WADA 1N75A 2PMZA 3K4MA 1WFXA 1MMNA 1X1BA 3LSIA 3MMYB 4ZDPA 2F4IA 2LBFB 2L9SA 2R7SA 2R7WA 3K4NA 2VJ5A 3DQVC 3FBIB 2E60A 1N77A 2KDOA 4B3XA 1X4PA 4XR6A 2F6CA 2XF5A 3N05A 3H9QA 3I3LA 3MKYB 3H5RA 3K70D 4BE2A 3VYRB 4BU2A 2HZDA 2V4JC 4BUPA 2HVRA 2PJRB 3ZR8X 4F55A 2LG4A 1NG7A 3TL4X 3OY9A 4H4KC 4P1WA 4CA0A 4PFOA 2IGKA 1DGRM 4Y3OA 3OYHA 4NNJA 3PSIA 3G2BA 3K4BA 1V5EA 3CJRB 1WJEA 3IAM2 3HL2A 3LMMA 3L2WA 1D1AA 4RMNA 4J00A 2X1EA 3HPGA 3OYCA 3CP8A 4HSRA 3SYTA 4HNUA 1V5FA 3OYLA 2P0WA 2IS4A 2F5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WY7 Q;  2GOX B;  2NOJ B;  3D5S C;  2GOM A;  2WY8 Q;  2JVG A;  3D5R C;  2JVH A; 
#chains in the Genus database with same CATH topology
 3BCA A;  4Y4R A;  4ZJZ A;  1MBG A;  3WTW C;  2P5V A;  5TRD A;  1FT9 A;  1DDN A;  4N4O B;  1O7L A;  2VT3 A;  1X1C A;  3U1D A;  1ETQ A;  3I0T A;  3FHZ A;  2HYJ A;  3O8G A;  4JP0 A;  1Z21 A;  1F4K A;  3BQY A;  2TDX A;  4EGZ A;  1ODD A;  2DTZ A;  2Y69 H;  4CIC A;  1XX5 A;  4UUS A;  5F04 A;  3AAF A;  2D45 A;  1BR2 A;  1FYL A;  3FMS A;  3CES A;  1G3S A;  3Q5F A;  2X6Y A;  2ZFW A;  3CCQ I;  2HQA A;  2LY1 A;  1ZAO A;  2RN7 A;  4AYB N;  3BR0 A;  1ZQ3 P;  1I50 J;  2MD5 A;  4NBQ A;  4UB8 C;  3H35 A;  2DPD A;  1G3Y A;  2F4M B;  3T5X A;  1IRG A;  4KIF A;  4ASN A;  3PQK A;  2FEZ A;  5LEK A;  4I6Z A;  3CME I;  2QKM B;  4S05 A;  1VQP I;  4RM3 A;  2P4W A;  1IF1 A;  3GWZ A;  3ELK A;  4OOI A;  4KIG A;  5IOZ A;  3QOD A;  3S3N A;  3H0G J;  1TWF J;  5IOY A;  3KIO A;  3BJA A;  2P81 A;  4JX4 A;  1P2F A;  2ZKZ A;  3IH4 A;  4D9J A;  4BQO A;  3CTA A;  2VBZ A;  4XN3 A;  3WGH A;  3OOU A;  1Y39 A;  1OYY A;  3OYK A;  2K40 A;  1AKH B;  2MLK A;  2R7U A;  4QSH A;  1Z77 A;  2AQF A;  4X6A J;  5IP6 A;  1BI3 A;  1YJW I;  1SD6 A;  1ZHF A;  2HXI A;  4U7B A;  1MD0 A;  1MDM B;  3HM5 A;  3RZO J;  1EF4 A;  1NG6 A;  4WXD A;  2X9D A;  4L5E A;  2CUF A;  1QZY A;  3G71 I;  2MBF A;  3JAM K;  1BBY A;  3ZN0 A;  3KE2 A;  2DA6 A;  3IWZ A;  5IT3 A;  3K1P A;  1IXS B;  3C1D A;  5CQE A;  2YPR A;  1I6X A;  2AQE A;  2E2I J;  1AOY A;  3PQJ A;  1E3H A;  3I56 I;  1TW2 A;  1OYI A;  3HUG A;  4IVN A;  3C2H A;  1Z7L A;  1V3F A;  3EUK L;  3KYD B;  2LC2 A;  2QQ9 A;  2VQG A;  1DPR A;  2BBY A;  1ZYR F;  3MWM A;  4E7Z A;  4HOB A;  4U0V A;  1Z7U A;  3CQZ J;  5C44 J;  4E7J A;  2QBY A;  2X6X A;  5IT9 K;  2A61 A;  1LE8 B;  3JTH A;  2IS4 A;  5E1Z B;  1BJA A;  1YW9 A;  2ELJ A;  3D1N I;  3BR5 A;  2LFB A;  3H1C A;  1QHG A;  2IS1 A;  1KU9 A;  3VWB A;  2JT1 A;  2JRT A;  2F5E A;  5KAF C;  5B1B H;  2BVM A;  4BE1 A;  2VON A;  4ZYG A;  1K61 A;  2BW3 A;  4LIV A;  4OWR B;  2O0Y A;  3Q0U A;  2KLO A;  1U5T B;  2KP6 A;  2CQN A;  2IXS A;  2R7X A;  1OFC X;  3Q9S A;  3V7S A;  2VJJ A;  3W2V A;  2HR3 A;  4B43 A;  3H0D A;  2XF7 A;  2VLA A;  4BQQ A;  2GA1 A;  1KA8 A;  4A3B J;  1FBS A;  5D8K B;  2X1C A;  4D5F A;  1SFU A;  1JKR C;  1KU2 A;  2L4A A;  3HRT A;  1ZGJ A;  2OZ6 A;  2W4S A;  2A6E F;  2Y30 A;  3GW2 A;  3TDZ C;  3QPL A;  1MSF C;  3DBH B;  1V4R A;  5B1A H;  5L3D A;  2G7U A;  5CVU A;  2DLL A;  3FWE A;  3QU3 A;  1OKR A;  2ZSH B;  1T08 B;  2H1L A;  3FKI J;  3K1M A;  4RAZ A;  3O2P E;  4AD9 A;  2BW3 B;  1OR7 C;  2Q1Z B;  5FD6 A;  4EJW A;  1BI1 A;  5M5Y J;  3LSM A;  2YS9 A;  4AVZ A;  1Z6T A;  2QEX I;  2ACJ A;  2KRF A;  1JUP A;  4PGG A;  1YLF A;  2RNJ A;  4M71 A;  3U2R A;  1SFO J;  1SFX A;  4YEL A;  4FTH A;  2A68 F;  3BR3 A;  5K5Q A;  2OV7 A;  4B8X A;  3FM5 A;  5K7Z A;  4JOM A;  4OMY A;  1WVR A;  1T39 A;  1UFM A;  2VQL A;  3JRD A;  2EIJ H;  3IRQ A;  3I53 A;  2DMN A;  1ZAR A;  2KRH A;  1NTC A;  2W82 A;  3OYN A;  1MNE A;  9ANT A;  2WAF A;  1FWZ A;  3IRR A;  4D0P A;  4IRH A;  3B6A A;  4I2O A;  3K2A A;  3I59 B;  2CS3 A;  2GWR A;  3A2K A;  3ZGK A;  3ZQG A;  2NVY J;  1D5Y A;  4ZDL A;  1UJ8 A;  2F5D A;  4ZYD A;  4JX5 A;  3I55 I;  4P9U A;  1ETY A;  3OR1 C;  2LD5 A;  4N4N B;  2WAQ N;  2RQQ A;  2VB6 A;  3K2Z A;  1T98 A;  3V7R A;  5ILS A;  4EGY A;  2FNA A;  2GIV A;  2AO9 A;  3BG5 A;  2VN2 A;  2ADU A;  1I27 A;  1G3T A;  3P9I A;  4LG3 A;  1U0J A;  5J8F A;  3CUQ B;  1IC8 A;  4IHT A;  4DQ2 A;  2WWY A;  3S14 J;  2CFX A;  4EV0 A;  2FNP A;  2NRA C;  4FT8 A;  2P5K A;  1XCB A;  3DPL C;  3RZD J;  4KN4 X;  1P9Q C;  1GVJ A;  3A02 A;  4A3F J;  3PNT A;  4MFE A;  1CF7 B;  3DPT A;  1L3L A;  4ENJ A;  2F48 A;  2GA2 A;  4F3Q A;  1R5H A;  2QSF X;  5LGT A;  1O57 A;  4M6Y A;  1J5Y A;  3I59 A;  3E5U A;  2PQ8 A;  4JX6 A;  5FFX A;  1D8J A;  4ABZ A;  3QP5 A;  4BEH A;  5CPR B;  3HOS A;  2DO7 A;  5J47 A;  3WTY C;  1WKM A;  1FNN A;  1MW7 A;  3RJP A;  1JHH A;  1Z05 A;  2LKP A;  4KIB A;  3CUQ A;  1TC3 C;  3LWF A;  4BHP A;  4HQE A;  4M74 A;  4BAY A;  1WJC A;  1VQ7 I;  4LMY A;  2H6C A;  3SJM A;  2BOL A;  2M4K A;  1QHH D;  2VC1 A;  4KIT B;  5JR3 A;  3L2V A;  1YX5 A;  2ZXI A;  2HXO A;  2MH9 A;  5B66 C;  3JRH A;  1SD7 A;  3I4P A;  4ITV A;  1RIO H;  3ASO H;  3Q9V A;  3WHC A;  1P4X A;  3K4K A;  2XF6 A;  4CYC A;  1XS9 A;  4BJ6 C;  2O9L A;  1DU6 A;  3E5X A;  3CD6 I;  4YG2 F;  2FOK A;  2Y75 A;  5LHI A;  3BG3 A;  4ESF A;  1BOB A;  2NOG A;  3OIO A;  2EK5 A;  5FKK A;  3I54 A;  4OMZ A;  2L5Q A;  4DZP A;  1Y56 A;  2NNN A;  2BE5 F;  4WXC A;  4XQF A;  2JA6 J;  4KYW A;  4XOR A;  2LY2 A;  1BI2 A;  1JGG A;  3M4O J;  3BTI A;  1ZRE A;  3RTR A;  2DCE A;  1Y8R B;  3NQO A;  2ZXJ A;  3K4L A;  3C7J A;  3TP3 A;  2D1V A;  2XSJ C;  5IYD J;  1U8B A;  2Z2S B;  1RR8 C;  4MFD A;  4CUG A;  3A03 A;  3R0A A;  5KHD A;  1KYW A;  4E7L A;  1BR4 A;  4QTR A;  3A0H C;  2O7O A;  4Y13 A;  4DYQ A;  3Q0V A;  4DJA A;  1FIA A;  1U5T A;  3RSN A;  5F1R A;  3WOD F;  3WTU C;  2QSG X;  4CGZ A;  3S1Q J;  1HW2 A;  3EDP A;  3ONQ A;  4XRS A;  1D0Y A;  4QIW N;  2QUF A;  1OPC A;  2COB A;  3OSF A;  3GTM J;  3T8T A;  2C6Y A;  5D5W B;  4FE4 A;  5KAI C;  2I10 A;  1AU7 A;  4Q5S F;  3R61 A;  4IPA A;  3BTL A;  3KP2 A;  3G3Z A;  4PCQ A;  3MN2 A;  5D6F A;  2K7L A;  2VPR A;  1ORK A;  3GUD A;  4A0X A;  2QQB A;  3V42 A;  2R7F A;  4OAY A;  2PI0 A;  5KNL A;  2E2J J;  1TQI A;  2BV6 A;  3JR9 A;  1LVK A;  2LDU A;  3SZP A;  3OYE A;  2A6T A;  1HDP A;  1AWC A;  3EYI A;  2H09 A;  4MLO A;  4AM3 A;  3F6O A;  5C4J J;  2OCE A;  3BJO A;  3CC4 I;  4OIR F;  3CCV I;  4IHW A;  2IS6 A;  3VOD A;  1ETX A;  4WK8 F;  3DTK A;  4LFU A;  2KIU A;  2K5C A;  2QVO A;  1X1D A;  2J5P A;  2HKX A;  4ENN A;  3S8P A;  4RBO A;  2L9V A;  3PIP F;  2LH9 A;  1T33 A;  5LFA A;  3M3Y J;  1YW8 A;  4IOC F;  4V19 K;  4A2U A;  1SVO A;  3OOP A;  3WE2 A;  3F22 A;  2HWV A;  4E7S A;  3V4G A;  3L1P A;  4HPQ A;  5ERI A;  3SEQ A;  2TCT A;  2LSO A;  1GLN A;  1HW1 A;  3ZMU A;  4Y17 A;  2QCO A;  4QPQ A;  5LHH A;  3C3W A;  1H0M A;  1ZRD A;  2KIS A;  4XON A;  1XGN A;  2WV1 A;  3UR3 C;  3GFL A;  3JTG A;  4WX9 A;  3IP4 B;  2HDD A;  4DZJ A;  4P96 A;  1CF7 A;  2K86 A;  2XV4 S;  1WH5 A;  1ZGW A;  1UHM A;  4ETS A;  5BMZ A;  1XGS A;  2KFD A;  1FPQ A;  1VQN I;  4CH7 A;  1IW7 F;  1OJL A;  1LEB A;  4IL6 C;  3TGN A;  3DEE A;  3TQN A;  2OU2 A;  1WFX A;  1EH7 A;  3H36 A;  1MMN A;  4IRG A;  4L0Y B;  4ZYE A;  2DMT A;  1F1Z A;  4XK4 A;  2NVQ J;  3B73 A;  2XAG A;  2R7S A;  1TP4 A;  1OR7 A;  3ASN H;  1N77 A;  2F2E A;  4UUS B;  2KDO A;  5GPC A;  2JQ7 A;  1X4P A;  1TQP A;  2BY1 A;  5H6R A;  1VQO I;  4G8X A;  2LK2 A;  1IN6 A;  3MKY B;  1ZRC A;  3PM1 A;  1GT0 C;  2GXA A;  1YYV A;  2FBI A;  5DCM B;  4A69 C;  5H20 A;  2BXY A;  1ZGA A;  2V4J C;  3RPQ A;  2HVR A;  3HZJ A;  3KYC B;  4F55 A;  2V1X A;  1ULY A;  1EKE A;  3HEF A;  4U0Y A;  2HQ5 A;  4Y3O A;  1DGR M;  4EM2 A;  3OYH A;  3TW7 A;  1HW5 A;  5EG0 B;  4HV5 A;  3PO3 J;  1LVA A;  2YU3 A;  2QWW A;  1G6N A;  4XID A;  1Y8Q B;  3G1O A;  1OQY A;  3G4S I;  4RAG A;  2X1E A;  3J80 Z;  2XAS A;  3FM3 A;  1P92 A;  1P7J A;  1WWX A;  2KIM A;  2XAQ A;  1HOM A;  5F0F A;  3ZMD A;  1V5F A;  2HDC A;  2P0W A;  3KPH A;  3KZZ A;  4A3J J;  2H8W A;  2JTV A;  2ISY A;  1IV6 A;  1FX7 A;  1E0E A;  1MND A;  3IKV A;  1YG2 A;  1MJB A;  3VB2 A;  1VQ8 I;  3PFY A;  4KJZ A;  1TNT A;  1DQU A;  1MZB A;  3NAU A;  2VOO A;  3B6C A;  4FCY A;  4HF0 A;  2JUG A;  1TWC J;  3GLX A;  4MO7 A;  3K10 A;  4YRV A;  1JTY A;  3AKZ A;  3QQA A;  4C9Y A;  3M07 A;  2XPV A;  3HUG B;  2JK3 A;  4CCO A;  1YIJ I;  2X1D A;  1W36 D;  3FXR A;  1H9T A;  4HG2 A;  1YRN A;  3FXM A;  4Q4Z F;  1WPK A;  3S16 J;  1MH3 A;  2WAQ A;  2YUS A;  2E5Z A;  3OYG A;  2ZME A;  1GUU A;  3ZCO A;  1OCR H;  1SD4 A;  2LR8 A;  3OS1 A;  2OUM A;  4QPO A;  1SEU A;  2R7O A;  2YX4 A;  5LRS A;  4IX7 A;  1XGO A;  1YW7 A;  2M30 A;  2ZJ2 A;  2IT0 A;  2KHM A;  1XC5 A;  5F27 A;  4II2 A;  4BHB A;  4XLF A;  3ZXS A;  5BPD A;  1BC7 C;  4RM2 A;  1ZN2 A;  3W3C A;  4BXF A;  1VZ0 A;  2GOM A;  5HNH A;  1K6O A;  2F5C A;  2K9M A;  5HNF A;  4UHT A;  2R7R A;  2VKE A;  2ZXH A;  5FRM A;  5CJ9 A;  1LQ1 A;  1APL C;  4I0A A;  4M6V A;  2Z99 A;  1N25 A;  2XRO A;  3CO7 C;  4LOC A;  3CMM A;  4HW0 A;  1USS A;  1YRN B;  2IGN A;  4PJM A;  3D5S C;  2Q8K A;  2ZJP F;  1PDN C;  5J1Y A;  1K7A A;  1QZZ A;  2O3F A;  4IHY A;  4N9I A;  3OV8 A;  1RRJ A;  2KPM A;  1J75 A;  1TZL A;  3CJT B;  3ZQF A;  3SEZ A;  2Q2E B;  2D1H A;  4BXU A;  3LA2 A;  2FSW A;  2Y9Y A;  5GTH C;  4KNY A;  3DU5 A;  5M5X J;  3NRV A;  4UXN A;  2AXT C;  1I3Q J;  1B6A A;  3UKG A;  1R1T A;  5FKL A;  1RES A;  1LFP A;  2QEN A;  4KA4 A;  1D0Z A;  3CCL I;  2EJR A;  2XGC A;  2R0Q C;  1A6Q A;  3IH2 A;  4E7I A;  1R1U A;  1U78 A;  2X6W A;  3HPH A;  3LA7 A;  2HTJ A;  3CUO A;  5ICF A;  2IJL A;  4G9Y A;  1OCP A;  5EEG A;  1FMV A;  2DQL A;  4XLN F;  1V54 H;  5E20 A;  3FZV A;  3KZI C;  3HB9 A;  2EFN A;  4W1U A;  2VJI A;  3ESW B;  3K7A J;  1S6L A;  2A5Y B;  1D1B A;  2XHK A;  1MMG A;  4G7H F;  3BG9 A;  4OU0 A;  5JLX A;  1ZG1 A;  1CQT A;  2I8D A;  2R7D A;  1R23 A;  2DMU A;  2RQP A;  4A0Y A;  2RNG A;  3QU6 A;  1UST A;  3BDD A;  4GRI A;  2ZNZ A;  4ON0 A;  2DBB A;  5DUK A;  4XLP F;  1XDU A;  2FXA A;  4G12 A;  1DU0 A;  2DYR H;  2GZW A;  1UEL B;  2EQR A;  3VSK A;  2WC2 A;  3S3M A;  2R7T A;  3K0L A;  4EAT A;  2P6S A;  3DTI A;  3F21 A;  4M9S A;  2DMQ A;  2WBM A;  1YFH A;  3SZT A;  3IC7 A;  5E3N A;  4G6D A;  2E19 A;  1T56 A;  2FE3 A;  1O3R A;  1F5T A;  1O3S A;  1I5Z A;  3LSP A;  2CRG A;  3CDL A;  4C3I J;  1IN7 A;  4XNF A;  3OS2 A;  4JYK A;  3PNV A;  4J19 A;  3HRU A;  1MJA A;  1MGT A;  5CYV A;  3ZMS A;  2Y0S A;  3P5J A;  2E1M B;  4KT6 A;  3ZQI A;  1ZG3 A;  2W00 A;  1OCT C;  1QVU A;  4XLE A;  2R5Z B;  1T0F C;  4CYD A;  2STW A;  1IRZ A;  1WRJ A;  3L2R A;  2K4B A;  4RDU A;  5E18 F;  1WCM J;  2FQ4 A;  3F6V A;  2M5W A;  1YIT I;  3TBI A;  4I09 A;  3DLL F;  3AFH A;  3OSG A;  4XOT A;  1H8A C;  2QKL B;  5ICG A;  3F8N A;  3OL3 A;  1HF0 A;  3S3O A;  1PJR A;  3HOW J;  2W1O A;  3HBL A;  1Z1D A;  3BC8 A;  2DFE A;  3M1E A;  4M3F A;  2UXX A;  5FD5 A;  4RGX A;  1Z3Y A;  1MBJ A;  2YR2 A;  5DYM A;  2PBI A;  1WJB A;  3O6B B;  3OYI A;  2V1D A;  2ZXW H;  4CCN A;  3MKZ A;  3P9C A;  1TBX A;  3ECO A;  4B47 A;  4IHS A;  4F52 A;  2YX7 A;  4PJL A;  5D5X B;  4J01 A;  1SAX A;  3F3X A;  1HDD C;  2RC4 A;  2WA0 A;  1EV7 A;  3DKW A;  5E8I A;  2A05 A;  1MSE C;  2XGE A;  5J8C A;  2KZG A;  3LAJ A;  2EZL A;  1WJA A;  3BJ6 A;  3DLA A;  3FK7 A;  4FAS D;  2K9L A;  4YEJ A;  1QPM A;  3E6C C;  1MMA A;  2DA7 A;  3BPX A;  3DFG A;  4DOZ A;  3VPR A;  2JPC A;  2Y9Z A;  3QAH A;  2MC3 A;  2LYC A;  1REP C;  1IN8 A;  4XL9 A;  3UNG C;  2JVH A;  4GYG A;  4RB1 A;  3TOB A;  4BS9 A;  4IO9 F;  4JQF A;  2LY9 A;  5CVR A;  4BNC A;  1R00 A;  3NWT A;  2FBK A;  3W6V A;  4BY7 J;  2A07 F;  3WG7 H;  3S1M J;  4DGW B;  3ZQQ A;  3P7N A;  3M9A A;  4Q48 A;  5F6F A;  3KZY A;  4M6X A;  1RC9 A;  1QU3 A;  2NVU B;  3QYF A;  2K85 A;  2CJJ A;  2W25 A;  3FXO A;  1MNM C;  1LNW A;  2IGO A;  2VKV A;  2HU9 A;  1B8I B;  5CVV A;  3H9J A;  4EM0 B;  3M7G A;  4MTD A;  1SFK A;  2L7K A;  2MH2 A;  1B4A A;  1G59 A;  4CO8 A;  5B5E C;  3LSR A;  5DCF A;  2E34 A;  2ZNY A;  3JRG A;  3T0Y A;  2K27 A;  2E1O A;  3OYF A;  3LA3 A;  2LRD A;  3FDY A;  4LIU A;  1HSJ A;  3WE3 A;  2XSD C;  2DOF A;  2HYG D;  4RLF A;  4ZTJ A;  4HF1 A;  1IXR C;  2OAZ A;  4XM3 A;  2CO5 A;  4E70 A;  3SFZ A;  2QA4 I;  5F08 A;  1XPX A;  1W36 C;  3GXO A;  5M3M J;  2V7F A;  2DXI A;  5K7F A;  5FKN A;  1F9N A;  2GM4 A;  2HQN A;  2QQA A;  2PLY A;  4HLY A;  4ENK A;  4IHX A;  1O3T A;  2AXL A;  4FHT A;  2NS8 A;  4E6K G;  3OL4 A;  3FBN B;  2CV0 A;  3HSR A;  1SD5 A;  2ZJR F;  4OIQ F;  5EF6 A;  2Z1D A;  1F36 A;  2IP2 A;  4XMY A;  4A3E J;  4I02 A;  3Q0W A;  2DAO A;  4ZDO A;  4O6J A;  1P7I A;  1HKQ A;  2F4O B;  3JRE A;  4L9V A;  1JJ6 C;  2DK8 A;  2GQQ A;  2CW7 A;  4PZJ A;  5LEJ A;  5IY5 H;  3NWS A;  3TOA A;  1R4M B;  1IXC A;  3G73 A;  4RGU A;  4BGD A;  3CCE I;  3GTK J;  1O4X A;  5J3L A;  4RGS A;  2XB0 X;  4CZC A;  5C4X J;  3F8C A;  4EMS A;  5BNG A;  1G4D A;  2DJN A;  3HYI A;  4PFP A;  2Z33 A;  1ZR2 A;  3CLO A;  1KQ8 A;  2CUJ A;  4I76 A;  5LGU A;  1NK3 P;  3RQI A;  1QO0 D;  2JPB A;  3HC7 A;  3H3Z A;  2DA1 A;  2DFF A;  1LDD A;  2P6T A;  2DTR A;  2L3D A;  2O61 A;  1Q1V A;  3ABM H;  3AL0 C;  3CDH A;  2EV5 A;  3RKW A;  3E5Q A;  1AKH A;  1KQ9 A;  4PK4 A;  2P7C B;  4XLC A;  3S2H J;  2DMP A;  3I71 A;  1IRX A;  2CFO A;  4G7O F;  3IUO A;  1PUE E;  2BY3 A;  1B59 A;  2ETH A;  4ZYA A;  1J7K A;  2VE9 A;  1WHU A;  2QYO A;  4PJJ A;  2MD0 A;  3HDD A;  3HOZ J;  2O8X A;  2KJB A;  4BJ5 C;  1D3Y A;  1UCR A;  3BZ6 A;  2R7Z J;  1A5J A;  3G1M A;  3WU2 C;  3U21 A;  4EEF G;  1DUX C;  4PDK A;  4L5I A;  5IYB J;  1XCV A;  1OLT A;  3HIF A;  3IKT A;  1VFC A;  2X48 A;  1X2M A;  2W85 A;  4OIP F;  2FUG 2;  4BEH B;  5B3S H;  3QP6 A;  5L3C A;  1HA8 A;  5AON A;  3QRF F;  3FX3 A;  1SAN A;  3DBR B;  3GZ6 A;  2Z16 A;  2KT0 A;  2CWE A;  5D4S A;  1UG0 A;  2HPM A;  4RB3 C;  1SC7 A;  1GXQ A;  2M4G A;  4AIH A;  2CQK A;  5LD2 C;  1E17 A;  3H92 A;  3QYE A;  2QM3 A;  1VQ4 I;  3CC7 I;  1POG A;  1AA7 A;  1QPI A;  4GXO A;  4M3B A;  2O8K A;  4XLH A;  1YS6 A;  1KYZ A;  2WY7 Q;  5DM6 F;  2M8G X;  4WF2 A;  2ELK A;  5A2Q Z;  1X1B A;  2HZT A;  3LSI A;  4ZDP A;  4S04 A;  4DYC A;  3L00 A;  1XDS A;  4P55 A;  2R7W A;  2VJ5 A;  2M8E A;  3NEU A;  3DQV C;  2LKS A;  4B3X A;  5CVI A;  4MNU A;  1IAW A;  4XR6 A;  2R5Y B;  1YO5 C;  3DEW A;  1R4N B;  5F64 A;  2V9P A;  4S0H B;  2K9Q A;  2OTL I;  3I3L A;  3K69 A;  1GHC A;  3K70 D;  3L7W A;  2EZK A;  1HXD A;  4UVC A;  4XSZ F;  1XSV A;  1HLV A;  2HTS A;  2PJR B;  1A31 A;  4BBS J;  4LLL A;  2ZME B;  1RET A;  3DF8 A;  1NG7 A;  1J2X A;  2P7V B;  4M3D A;  4P1W A;  4L9J A;  2EFP A;  2IGK A;  4PFO A;  2IAI A;  3EYY A;  2VBX A;  3HL2 A;  3V8L A;  1UG2 A;  3KLN A;  3LMM A;  3SQN A;  4G7Z F;  2MW8 A;  4J00 A;  1WQ2 A;  3HPG A;  2NNY A;  3OYC A;  1GV5 A;  5FLV A;  1T6S A;  1KU7 A;  4EVI A;  3D0S A;  3HOV J;  2RKH A;  3LFK A;  3SYT A;  4HNU A;  3PIO F;  2N8G A;  4A3D J;  2EIN H;  1E2X A;  4V2G A;  3U9G A;  1G3W A;  2EIK H;  3GYH X;  3ZQL A;  5GTI C;  2VAS A;  3ERE D;  2VUM J;  3J7A Y;  3HSF A;  2G0E A;  3PNY A;  2G9W A;  3KEO A;  1NH3 A;  2DT5 A;  2OQG A;  2M0M A;  2E7X A;  2CV2 A;  1W0T A;  3GTO J;  4HX7 A;  1LB2 A;  3R0J A;  2GOX B;  4C3H J;  2M87 A;  3OR2 C;  5FFZ A;  4A5M A;  1DPU A;  3OIQ A;  2LBF A;  4GFB A;  4U0W A;  2MC4 A;  2ESN A;  2DOE A;  2EH3 A;  2M34 A;  1HST A;  2KRC A;  4ZC3 A;  2RV8 A;  3GLL A;  2EWN A;  2CW0 F;  1MBF A;  4IEJ A;  1TWA J;  2H6B A;  1S72 I;  4O5V A;  3F0C A;  1S8N A;  4D7N A;  1I6H J;  3HSE A;  2XDV A;  1IG7 A;  4LK1 F;  2PX9 A;  5DUI A;  3OMY A;  2ISZ A;  2B63 J;  4AIK A;  4LJZ F;  3TDU C;  1K78 A;  5JHU A;  6PAX A;  3E6B A;  2X4H A;  4ZZL A;  4WCG A;  4IQ4 A;  3ML6 A;  5EYR A;  1ITY A;  1TT0 A;  2Z9O A;  1NHA A;  2V9V A;  5A2Q K;  4YFN F;  4L0Z B;  3AG4 H;  1P4A A;  3PJR A;  2HNH A;  1X1A A;  4IJA A;  4MQV A;  1TLH B;  4DYR A;  3M1C A;  1FP2 A;  1B72 B;  1YQA A;  2IGM A;  2FMY A;  2XVC A;  1KGS A;  3JAM Z;  5HS7 A;  3GF2 A;  3R6S A;  1RPW A;  2KIQ A;  4UUV A;  5IYC J;  4IZZ A;  3A01 A;  4F93 B;  1OCC H;  1D8K A;  1O7F A;  2WB1 A;  3LAP A;  1PUF B;  2DPU A;  2HEO A;  4XKW A;  3BR1 A;  5FRN A;  2LRE A;  1XB4 A;  2E5N A;  2W57 A;  2LKX A;  3HHG A;  2G7H A;  1BIB A;  3F72 A;  2MGQ A;  1R58 A;  1LFB A;  5BQT A;  4BDY A;  2RRE A;  4CSW A;  1JUM A;  2JSC A;  4XOP A;  4NHJ A;  3S1N J;  1IO2 A;  2NOJ B;  4C2T A;  3KP7 A;  4UUT A;  1YS7 A;  1FOK A;  3SHF A;  2UV1 A;  1U8R A;  2HOA A;  3MD2 A;  4NDL A;  4CXF A;  2FML A;  3ZQC A;  3FK6 A;  2EFO A;  4V2F A;  2NXN B;  2FD5 A;  2ZFU A;  1XMX A;  3KEQ A;  2PMZ N;  3L2Q A;  3J81 Z;  3GFJ A;  2ZCW A;  2L0K A;  5GAE J;  1YHQ I;  1X4O A;  5HLG A;  1B8I A;  3BLY A;  1J0R A;  5H6Q A;  1FOY A;  1U6G A;  2ZBK A;  1ZH5 A;  3QWL A;  5J1U A;  2JA7 J;  1XMK A;  2EA2 A;  2CGP A;  2UUZ A;  5E79 C;  1YOV B;  4P9F A;  2CV1 A;  3QPS A;  2A6H F;  2KJC A;  5DDG A;  2AHQ A;  2BGC A;  3U1K A;  4U87 A;  1A04 A;  1NK2 P;  2RDP A;  4BE0 A;  2VC0 A;  3AG3 H;  4RAF A;  2R3S A;  3FXK A;  3QOE A;  5LBQ A;  1K4T A;  4IHV A;  3IL2 A;  1PYV A;  1U9O A;  4PJN A;  3VFZ A;  4PUS A;  1S7E A;  2ID6 A;  2QF7 A;  1V5G A;  2W24 A;  3ABU A;  3H3U A;  5M5W J;  3OS0 A;  4UV8 A;  4JBA A;  1E3P A;  2M45 A;  2PMH A;  1FYK A;  4KUM A;  4UVA A;  1JI8 A;  4KMU X;  3TKY A;  4BL0 B;  2HOS A;  2CQX A;  2LTP A;  4KIS A;  1OYW A;  1STZ A;  4NC7 A;  3IAS 2;  2MAB A;  3HHH A;  1QRY A;  3DBL B;  5DTD A;  2R7Q A;  5K5R A;  3J80 K;  3K1N A;  4LG0 A;  4XBF A;  4GGG A;  1TT5 B;  3MEX A;  5H2F C;  3BR6 A;  1BW6 A;  3WTV C;  3HRM A;  5D5V B;  5E17 F;  2XPW A;  3WTX C;  2CUZ A;  2OQR A;  3FIW A;  3E1S A;  5HOD A;  2LOO A;  4CCJ A;  1L0O C;  4AID A;  4X0G A;  3COA C;  3I9V 2;  3BTJ A;  2MSY A;  2VKD A;  4RGR A;  4ZTF A;  3PUB A;  3FKJ A;  4D5C A;  2RGV A;  4DBQ A;  3ZN1 A;  2WV0 A;  1KU3 A;  5F0H A;  2OJE D;  1S7A A;  5FLX Z;  1JT6 A;  1FMW A;  1ZTR A;  2OTJ I;  1A35 A;  3J7A O;  2HVQ A;  5HDG A;  3JRB A;  1IN4 A;  3ZMZ A;  2XAF A;  2VIX A;  1D0X A;  1YX3 A;  2GIZ A;  3PSF A;  2OPT A;  3BOQ A;  3HRS A;  5KVR A;  2IS2 A;  4GYI A;  2VQH A;  5E3L A;  2E1M C;  2V1U A;  4HV6 A;  2FRH A;  3RKX A;  5IT9 Z;  1OCZ H;  1J09 A;  3H5A A;  2IEK A;  2WY8 Q;  4UVB A;  1I39 A;  1G2H A;  1W5T A;  4OIO F;  3EUA A;  3BQZ A;  2E7W A;  4BAC A;  2PMU A;  3ZQ7 A;  4OAZ A;  3KET A;  4IRI A;  4F91 B;  1U3E M;  1FEX A;  1UMQ A;  2XUB A;  2HFH A;  3CCJ I;  3GTL J;  2DW4 A;  5J1R A;  3HOU J;  3F9K A;  1RUO A;  3C2B A;  5HDN A;  2HOE A;  5D5U B;  2OZU A;  2EIL H;  2DA2 A;  1ETV A;  3O8H A;  1TWH J;  5JI6 A;  5ILV A;  4N0B A;  4Z2Y A;  1JJ8 C;  1D5V A;  1WI9 A;  1R71 A;  4LD5 A;  4A3M J;  1WSU A;  1XSX A;  3ZRG A;  3CLQ A;  4O3M A;  2V6E A;  1SAU A;  2LLK A;  4LB5 A;  3ZMV A;  3RCO A;  1Y0N A;  3RYP A;  1W5C C;  4ENM A;  3LSJ A;  5FGM A;  4I98 B;  2KDZ A;  4BBR J;  2EFQ A;  1Y6I A;  5D4R A;  3WGI A;  2M1B A;  4KIC A;  4LLG F;  4IKF A;  3BPV A;  3N4M A;  3K9T A;  4A3C J;  1FZP B;  2ICW G;  3M8F A;  1ZLK A;  3HGG A;  4C3J J;  3CMY A;  1FJL A;  3WTS C;  4Y52 J;  2DU9 A;  2DT6 A;  2D2W A;  2L2O A;  2HYF A;  2XRN A;  2X6O A;  4PSX A;  4HA8 A;  1FSH A;  4U88 A;  3VDX A;  1JXS A;  1W7P B;  1X3Z B;  2BY0 A;  2M7A A;  2HPI A;  2MFZ A;  3PL8 A;  3RPU D;  4YII A;  1LDJ A;  5DD4 A;  1X3W B;  2Y2Z A;  1IDY A;  2MA3 A;  4LK0 F;  3ZQH A;  1BM9 A;  3BZC A;  3HTS B;  3CCM I;  2QZ8 A;  4E7K A;  5F1J A;  5GPA A;  3BR2 A;  1UZC A;  4M9X A;  4CCL A;  4F92 B;  1BA5 A;  5CLS A;  3ROU A;  4A3I J;  2IBD A;  2L7F P;  1X2N A;  3F8F A;  4II3 A;  4UB6 C;  2YSR A;  4B48 A;  3JRC A;  4A3G J;  3RKY A;  3LL7 A;  2OF7 A;  3LSG A;  3DTE A;  4X1E A;  3GTG J;  5FB2 A;  1RI7 A;  1X19 A;  4CCK A;  4R79 A;  2CQQ A;  1GV2 A;  4XRM A;  1PP7 U;  1G8X A;  2KIF A;  3PUF A;  3GX4 X;  3CZ6 A;  1WH7 A;  4AYB A;  1ERD A;  1IGN A;  3L9F A;  3W6J B;  2NVT J;  4CDG A;  4Y33 A;  3GFI A;  5J40 A;  1XMA A;  3CCS I;  1YI2 I;  1GDT A;  4IF4 A;  3MQ0 A;  1A6I A;  2M9H A;  1MBH A;  4DBR A;  1Z67 A;  2EZI A;  2QQ8 A;  1XD7 A;  5EJC A;  5FLM J;  5TIS C;  5LHG A;  5E1X A;  3FHN A;  4CCM A;  3W2W A;  5JVT A;  4CZZ A;  4DIQ A;  2VKH A;  1RKW A;  1JHF A;  4HX4 A;  4LGW A;  1ZLJ A;  2A69 F;  3QPT A;  4ESB A;  3H3V K;  1JE8 A;  1WGX A;  1WJD A;  2P5L C;  4CHU A;  3LST A;  4A12 A;  3W2A A;  3AG1 H;  2GAU A;  3OYD A;  1AHD P;  3JRF A;  2EIM H;  5LRR A;  2PEX A;  2JA2 A;  2KZV A;  1TL8 A;  5CQG A;  2E1C A;  4BH9 A;  4KN7 X;  2M0C A;  1IV8 A;  4M3E A;  3A0B C;  3EPZ A;  4AWX B;  2EZH A;  2DOA A;  3RDI A;  4GO1 A;  3G1L A;  1Z91 A;  4BKX A;  2DA5 A;  3OWT A;  4XKB A;  2DQR A;  4M73 A;  2P8T A;  3CDI A;  4NQW A;  4RS8 A;  4XLA A;  4YIR X;  3K70 C;  3A1Y A;  3KFW X;  3LFU A;  1YE9 A;  2X51 A;  3HXL A;  2BEO A;  4HYE A;  2BHZ A;  5KK1 A;  2TRT A;  3IH3 A;  3RI4 A;  4MQ9 F;  3HKZ A;  4YIF A;  3Q3S A;  4ANJ A;  3AL0 B;  1HC8 A;  1WZ2 A;  2EB7 A;  2FF4 A;  3JRA A;  3I5U A;  3FXL A;  4FE7 A;  4A5N A;  2BZT A;  1MDM A;  2ECC A;  1S3J A;  1MBE A;  3WG9 A;  1BI0 A;  1FIP A;  1BC8 C;  3K4M A;  3MMY B;  5E8G A;  3J7Y J;  2F4I A;  2LBF B;  2L9S A;  4G6Q A;  1PUF A;  3KP4 A;  1FP1 D;  3K4N A;  1S29 A;  3GTJ J;  3F8B A;  4LB6 B;  5J6X A;  1GXP A;  1IUY A;  1QQI A;  2E60 A;  3RKQ A;  2OCC H;  3L2C A;  2HS5 A;  2XRL A;  5L3E A;  2F6C A;  2L7Z A;  1SMT A;  2XF5 A;  2E2H J;  4ZH4 F;  3H9Q A;  3LQR A;  1MBK A;  2ZC2 A;  4AIJ A;  1S5L C;  2HGC A;  3VYR B;  1YTY A;  2CU7 A;  2MG4 A;  2D5V A;  5ILU A;  1B9N A;  2HZD A;  4BUP A;  3KP6 A;  2FBH A;  3O3K A;  4BHC A;  2LG4 A;  1K78 B;  4BY1 J;  3WTZ A;  1B9M A;  2Q0O A;  3V8J A;  1VQ5 I;  4CA0 A;  4HX8 A;  2CSO A;  4XIC A;  3G2B A;  1V5E A;  2HKO A;  3ABT A;  4NC6 A;  5TJJ A;  1W1W E;  1QNT A;  1W4M A;  4OIN F;  4RMN A;  2Y0S N;  1ZK8 A;  4DNC A;  2DI3 A;  3CP8 A;  3KCC A;  4M72 A;  4FIS A;  3C18 A;  5DCM A;  4I01 A;  1DP7 P;  3JCU C;  2FJ1 A;  5CVJ A;  5L3F A;  2R5Z A;  2FQ3 A;  2EA4 A;  4M9Z A;  2PJP A;  2UXN A;  2DA4 A;  1HCR A;  1FTZ A;  3IHU A;  5K7H A;  2O6G E;  5HS8 A;  5EGO B;  2NS0 A;  3CF5 F;  4WXH A;  2RAE A;  1U2W A;  3C2G A;  2EBI A;  4XKV A;  1S9H A;  1J9I A;  4UV9 A;  2VXZ A;  3VEP A;  2ZME C;  3H9G A;  3N97 A;  4H0E A;  2VOD A;  3BRO A;  4FET A;  2HOT A;  3I58 A;  1IUF A;  3MCZ A;  2ZB9 A;  5J4Y A;  1H89 C;  1U9N A;  3GZN B;  3JW4 A;  2XKP A;  1S7O A;  3GVA A;  5DS9 A;  2OA4 A;  1T38 A;  1E3O C;  1R7J A;  4I99 C;  1RR7 A;  3S32 A;  3H5N A;  3S17 J;  4LLN A;  4IXA A;  3ZOB A;  4NC8 A;  5GAG J;  2W7N A;  4BXX J;  4RLQ A;  3SDB A;  4RB2 C;  3RIR A;  1FOW A;  4KMF A;  3E6D A;  3OIP A;  3EUH C;  5GAH J;  3E7L A;  3DWL E;  2I5U A;  1T95 A;  1JTX A;  2K9S A;  1JUS A;  3TED A;  1X58 A;  1VTN C;  4AUX A;  1XSD A;  3GTP J;  2H8R A;  3IV5 A;  1T8I A;  3E97 A;  5FO5 A;  1K4S A;  4ZZD A;  3MKW B;  3BTC A;  3TO7 A;  5JLW A;  4GCV A;  3S2W A;  3MZH A;  2ZO4 A;  2IA0 A;  1T0F A;  1BR1 A;  5M3F J;  3LOC A;  3FF5 A;  1QGP A;  4PSW A;  2CQ7 A;  2H94 A;  2UZK A;  5DEQ A;  3MFK A;  5DM7 F;  2DJI A;  3V7C A;  4LIT A;  4UNO A;  1H9G A;  3DP7 A;  4B3A A;  4EJV A;  4D1Q A;  5KCM A;  1SFE A;  2V1N A;  3KEY A;  4L9N A;  3HTU A;  3F23 A;  4XRF A;  1TNS A;  1MKM A;  1M1E B;  1K6Y A;  4WWC A;  3KP3 A;  4YFX F;  3OYM A;  5EEH A;  4BDZ A;  3CC2 I;  1IDZ A;  2Z3Y A;  1R5G A;  1U5T C;  1W7P D;  2BHY A;  1HKT A;  3SZG A;  5EZG A;  1UHW A;  4DW6 A;  2IRF G;  1HKS A;  4G94 A;  4AVP A;  1EA3 A;  5LLQ A;  1F43 A;  1VQM I;  2KKO A;  1BJZ A;  4A93 J;  4I0B A;  3T8R A;  4Z6Y A;  2OBP A;  4NUB A;  1MIJ A;  3W6K B;  3CP2 A;  1X3U A;  3GFM A;  1N78 A;  3VOE A;  2BY2 A;  3DEU A;  4HNV A;  1T2K A;  3BY6 A;  1DP3 A;  3ERM A;  2NS7 A;  5LGN A;  5L3G A;  1JKP C;  3D5L A;  1ETO A;  1JT0 A;  2W48 A;  3ABK H;  2JA5 J;  2QSH X;  1PVE A;  2Q2E A;  1MMS A;  1J59 A;  3FXQ A;  4UY8 I;  5CKT A;  1TW3 A;  1Z0X A;  2DFI A;  1FLI A;  2ELH A;  2K02 A;  3G6E I;  1ZEL A;  4HBL A;  2M3A A;  1OCO H;  5ED4 A;  2LVS A;  3GME A;  2O03 A;  1IN5 A;  3HOX J;  3B02 A;  2VOP A;  5FRO A;  1DGW Y;  3WU1 B;  5D6E A;  3EUH A;  4EJO A;  1B72 A;  4EQQ A;  4EM1 A;  2Z5U A;  2W84 A;  4HST A;  4KFC A;  3HKZ N;  3HGY A;  2VT2 A;  2M7B A;  2VI6 A;  1MMD A;  4QLC U;  3KYL A;  1X1P A;  3F8M A;  2VPL A;  1H88 C;  4C30 A;  3TP0 A;  4B44 A;  2JN6 A;  4RB0 A;  1I3A A;  2DN0 A;  3BZK A;  5EG0 A;  1BN5 A;  4RA2 A;  2L02 A;  2QGU A;  3MAJ A;  5HLH A;  2V9K A;  3MVP A;  5K5O A;  4GDF A;  2GXB A;  3OYJ A;  2ME0 A;  2L4M A;  3WTT C;  2MYS A;  3FMQ A;  2E71 A;  3CUQ C;  3I4M J;  5JVG F;  3VYU B;  2XGD A;  1VQK I;  4HDV A;  2LF7 A;  4A6E A;  3BCB A;  1IZ1 A;  5FKO A;  3CMA I;  4PJ0 C;  3CCY A;  3M8J A;  2FOW A;  2OC6 A;  3A4C A;  3WGG A;  1ZG5 A;  1Y0U A;  1K79 A;  3FXU A;  5J4V A;  2FU4 A;  3SFI A;  1WJF A;  1LUJ B;  2BYV E;  2NYX A;  3EET A;  3SXY A;  3WU0 A;  5EGO A;  2HDW A;  1VI0 A;  3MZY A;  2COM A;  2XAU A;  2R93 J;  1K83 J;  2A5W A;  2JSP A;  1ETK A;  3DKY A;  3DCF A;  4K2E A;  3DXJ F;  2O5R A;  2L9R A;  4HQM A;  4BQN A;  4Y7N J;  1Z3X A;  2L9N A;  2PN6 A;  3J81 K;  2VE8 A;  2CMP A;  2VXD A;  3CJQ B;  1ETW A;  1LJ9 A;  5DD8 A;  4YFK F;  3OYA A;  2K9N A;  1HQC A;  2DDA A;  2M2E A;  1RUN A;  4EJU A;  2NVX J;  1KQ0 A;  2BXZ A;  2GBY A;  2HVS A;  1ONV A;  3CCU I;  3KP5 A;  5JFR A;  2LF8 A;  3ISP A;  1Y1W J;  5HS9 A;  4A3K J;  3GO5 A;  5HDK A;  3GEZ A;  2XAJ A;  4M3G A;  2LMD A;  2STT A;  4MIM A;  2K4J A;  2XB5 A;  2KL4 A;  3GTQ J;  4NQW B;  4HF2 A;  1BOA A;  3GCM A;  3PO2 J;  1LE8 A;  2E35 A;  2KMU A;  4BQA A;  2IA1 A;  3NAR A;  2VBY A;  3DKX A;  2QLZ A;  5K1Y A;  1RKT A;  1ZKG A;  4HZF A;  1B1B A;  4BYY A;  3FMR A;  2ESH A;  2XAH A;  1JGS A;  2R4G A;  2XKO A;  4P5O A;  2DOD A;  4R1H A;  5L3B A;  5E1W A;  5EDN A;  1R5I D;  5EEA A;  3CJN A;  1IJW C;  3V8K A;  2XPU A;  3JRI A;  3LSK A;  2GXG A;  2JRM A;  2JA8 J;  2DT7 B;  1LKX A;  2Y31 A;  3L09 A;  3LNQ A;  1RZ4 A;  2AS5 F;  2VJ4 A;  3RPU A;  3K4C A;  2PG4 A;  2L54 A;  2YU9 J;  1BW5 A;  3BWG A;  2UWM A;  2H27 A;  2FA5 A;  1TTY A;  2R7V A;  1KZH A;  3VYS B;  5HLT A;  4B4C A;  5JHF A;  4XKC A;  1VND A;  5E3M A;  1O3Q A;  2BVL A;  3HOY J;  1FTT A;  1KON A;  3L2U A;  1MJ9 A;  2DFH A;  4MGR A;  4R8H A;  5BS6 A;  1P6R A;  3E0J B;  2R92 J;  1FYM A;  3D5R C;  4MEY F;  1RNL A;  4KDP A;  2LP0 A;  3T1B A;  3S93 A;  1FC3 A;  1UB9 A;  2GLO A;  2OD5 A;  3TO9 A;  1LDK B;  3ZP5 A;  4IQJ A;  1Z9C A;  2WAE A;  2V79 A;  3ECH A;  3GZ5 A;  4NB5 A;  1BL0 A;  1FY7 A;  1V55 H;  1JKQ C;  2B7E A;  5HVQ C;  1TQM A;  3BG6 A;  4BJT A;  4L18 B;  4AC0 A;  5DV5 A;  1YJ9 I;  2RVC A;  3CF2 A;  3OYB A;  3MZ8 A;  2ZJQ F;  2L7M P;  3KLO A;  2DYS H;  4N9H A;  4ESJ A;  3P9K A;  3LSH A;  3LQQ A;  3TW6 A;  1W0U A;  1FSE A;  4A3L J;  2IPQ X;  2V26 A;  4IOA F;  4U7D A;  4AU7 A;  2J5O A;  1UAA A;  2QBY B;  2CH0 A;  1HBX G;  4B1R A;  2K3P A;  3IWF A;  5FKM A;  5IP7 J;  3X2Q H;  2PJR A;  5EZH A;  4C2U A;  3PFI A;  1EH8 A;  2XIG A;  3QOP A;  1R6R A;  4QWQ A;  3M8E A;  2IA2 A;  4CYC B;  2A3S A;  5GP9 A;  1ACI A;  5ICE A;  1VQ6 I;  3ABL H;  3JSO A;  1XN7 A;  2CW8 A;  1C0W A;  1ZRF A;  5C3E J;  1ZR4 A;  3DV8 A;  3J7Z I;  1R22 A;  4KT5 C;  1QA6 A;  2DA3 A;  3I64 A;  3KX2 A;  1R49 A;  4HEA 2;  1LEA A;  2DK5 A;  1FOX A;  4HRI A;  1XTA A;  2VL8 A;  1D1C A;  4E4H A;  5AIQ A;  4G6T B;  5FJ8 J;  2K3F A;  2IVM A;  4A6D A;  2JZY A;  3S2D J;  3FXJ A;  1Y1V J;  5HOO A;  4L5J A;  5BPI A;  3MKL A;  3E3V A;  3TMO A;  4PGH A;  1LPQ A;  5D8L B;  1FBU A;  4JK1 X;  3VYT B;  1R9T J;  3R60 A;  3HG9 A;  4XN0 A;  4FX4 A;  2JUC A;  3A01 B;  5TGT A;  3TO6 A;  4I7H A;  1VQL I;  1W7P A;  1Q1H A;  1EJ9 A;  2CYY A;  4HNT A;  1OIS A;  5E3O A;  1I1G A;  2HQR A;  2E1N A;  3RYR A;  3ZMT A;  2X85 A;  4HDU A;  3S15 J;  3CCR I;  1QZE A;  3K6G A;  1TWG J;  4Q47 A;  3HOT A;  3RQ4 A;  1EH6 A;  2IW5 A;  3K4J A;  4L9T A;  3E6M A;  1JKO C;  2ZSI B;  2VBW A;  1Z6R A;  2EV0 A;  2WB1 N;  2WTE A;  2ID3 A;  1YIO A;  2HI3 A;  3I4N J;  1GVD A;  4MTE A;  3VSL A;  2CUE A;  4TV7 A;  2EFW A;  2KQR A;  4E7H A;  2VQC A;  1SMY F;  2CG4 A;  1W5S A;  3DPU A;  1VQ9 I;  1FBQ A;  3ZPL A;  3GBG A;  1CGP A;  2JJ7 A;  1WJ5 A;  3DU6 A;  1XGM A;  2JWT A;  1SVM A;  4LG0 B;  3BG7 A;  1R36 A;  1A36 A;  1WI3 A;  4XSX F;  2NAZ A;  2JVG A;  4MHG A;  1PP8 F;  1ENH A;  3QYB A;  2XC7 A;  3JSP A;  1IRF A;  4HAM A;  2WAD A;  1N75 A;  2PMZ A;  4FX0 A;  5F0C A;  1I1S A;  2X0L A;  3FIS A;  1YJN I;  5BOX A;  2F5F A;  4RAY A;  2V6C A;  1SVL A;  2ECB A;  5GAD J;  2B9S A;  2H1K A;  1XG1 A;  4FQG A;  1ON1 A;  2E36 A;  2ME6 A;  3FBI B;  4XRS G;  3QPH A;  3SDG A;  2L01 A;  3ULQ B;  1R1V A;  2EV6 A;  3N05 A;  3CO6 C;  2Y0M A;  5FLX K;  1ON2 A;  3H5R A;  4BE2 A;  4C2M J;  1BIA A;  2MLG A;  4BU2 A;  2JMW A;  5IPA A;  2LNB A;  3ZR8 X;  3S1R J;  3AG2 H;  3HJE A;  1UHS A;  1QVT A;  1P4W A;  3BP8 A;  3TL4 X;  4B09 A;  3OY9 A;  3EQL F;  3REO A;  4H4K C;  1QBJ A;  4A0Z A;  1OMI A;  1LFU P;  4NNJ A;  4ZYH A;  3PSI A;  3K4B A;  1MH4 A;  4F7Z A;  5IP9 J;  3CJR B;  1WJE A;  1VF9 A;  4EJT A;  2PFB A;  4D7M A;  3IAM 2;  3R4K A;  3L2W A;  2EPF A;  1D1A A;  4Y15 A;  2Y48 A;  5AIP A;  4MEX F;  3BT9 A;  4W97 A;  5HLI A;  2XGX A;  4HLX A;  2DDB A;  4HSR A;  2R5Y A;  2B0L A;  3WHB A;  2FX0 A;  5ICC A;  3OYL A;  2F5V A; 
#chains in the Genus database with same CATH homology
 3BCA A;  4Y4R A;  4ZJZ A;  1E0E A;  1MND A;  4N4O B;  2VAS A;  1X1C A;  3C2G A;  3PFY A;  3J7A Y;  3PNY A;  1S9H A;  4KJZ A;  4XKV A;  1DQU A;  2M0M A;  2VXZ A;  1Z21 A;  2JUG A;  2CV2 A;  3H9G A;  4FET A;  3K10 A;  1BR2 A;  4YRV A;  3AKZ A;  3CES A;  2X6Y A;  2GOX B;  4C9Y A;  2HQA A;  3HUG B;  2LY1 A;  3OR2 C;  4CCO A;  3OIQ A;  2LBF A;  2X1D A;  1W36 D;  4HG2 A;  3S32 A;  2MC4 A;  3H5N A;  2KRC A;  4ZC3 A;  3H35 A;  2WAQ A;  4NC8 A;  2E5Z A;  2W7N A;  3OYG A;  4RLQ A;  3SDB A;  3ZCO A;  2QKM B;  4RM3 A;  3OS1 A;  2OUM A;  3OIP A;  3EUH C;  4QPO A;  2R7O A;  4IX7 A;  3DWL E;  2XDV A;  1T95 A;  3QOD A;  3S3N A;  2KHM A;  3OMY A;  4II2 A;  4XLF A;  3ZXS A;  4RM2 A;  3W3C A;  3MKW B;  4BXF A;  1VZ0 A;  4D9J A;  2GOM A;  5HNH A;  4BQO A;  4IQ4 A;  1TT0 A;  4XN3 A;  1BR1 A;  2K9M A;  5HNF A;  3OOU A;  3OYK A;  2R7R A;  2ZXH A;  4PSW A;  3PJR A;  5FRM A;  2HNH A;  1X1A A;  2DJI A;  2R7U A;  3M1C A;  4LIT A;  3CMM A;  2AQF A;  2IGN A;  4PJM A;  2IGM A;  3D5S C;  4D1Q A;  5KCM A;  2V1N A;  3KEY A;  4U7B A;  1K6Y A;  4IZZ A;  4F93 B;  3OYM A;  4BDZ A;  1NG6 A;  2KPM A;  2WB1 A;  1TZL A;  4XKW A;  3SEZ A;  3SZG A;  2LRE A;  5FRN A;  2Q2E B;  2E5N A;  5CQE A;  2AQE A;  1EA3 A;  3DU5 A;  4BDY A;  2RRE A;  4CSW A;  3C2H A;  4XOP A;  1Z7L A;  3EUK L;  2LC2 A;  1LFP A;  4NUB A;  2NOJ B;  4C2T A;  2VQG A;  1D0Z A;  3CP2 A;  1N78 A;  4E7Z A;  2UV1 A;  3MD2 A;  4E7J A;  4E7I A;  2X6X A;  2X6W A;  1DP3 A;  3HPH A;  3D5L A;  2ELJ A;  1FMV A;  1QHG A;  2IS1 A;  3VWB A;  2VJI A;  2ZFU A;  2BVM A;  4BE1 A;  5CKT A;  1D1B A;  3L2Q A;  1MMG A;  1ZEL A;  2BW3 A;  4LIV A;  4OWR B;  1X4O A;  2M3A A;  3BLY A;  2KLO A;  2KP6 A;  2IXS A;  2R7X A;  2I8D A;  2VJJ A;  5FRO A;  3W2V A;  4B43 A;  3H0D A;  1DGW Y;  2XF7 A;  4BQQ A;  2VLA A;  2RNG A;  2UUZ A;  2X1C A;  4HST A;  4GRI A;  2CV1 A;  2W4S A;  2M7B A;  1MMD A;  4U87 A;  4BE0 A;  3KYL A;  1UEL B;  2VPL A;  3VSK A;  3QOE A;  4C30 A;  3S3M A;  4B44 A;  1PYV A;  4PJN A;  2R7T A;  4PUS A;  4EAT A;  3DTI A;  1V5G A;  3OS0 A;  2WBM A;  2ZSH B;  2BW3 B;  1OR7 C;  2Q1Z B;  1JI8 A;  4BL0 B;  3LSM A;  2V9K A;  4KIS A;  4AVZ A;  4NC7 A;  3OYJ A;  3IAS 2;  2MAB A;  4XNF A;  3OS2 A;  3PNV A;  2MYS A;  2R7Q A;  4YEL A;  3VYU B;  2Y0S A;  2E1M B;  2OV7 A;  4KT6 A;  3BCB A;  4JOM A;  2W00 A;  4XLE A;  1T0F C;  2VQL A;  3M8J A;  2OC6 A;  3A4C A;  3L2R A;  2CUZ A;  3E1S A;  2KRH A;  1WJF A;  2LOO A;  2W82 A;  3TBI A;  3AFH A;  4CCJ A;  3OYN A;  4XOT A;  1MNE A;  2HDW A;  2QKL B;  3I9V 2;  3OL3 A;  4X0G A;  2WAF A;  1PJR A;  2XAU A;  2VKD A;  2W1O A;  3S3O A;  4ZTF A;  3BC8 A;  3PUB A;  3FKJ A;  2CS3 A;  2A5W A;  2JSP A;  4DBQ A;  1Z3Y A;  3DKY A;  3A2K A;  3ZGK A;  2O5R A;  4ZDL A;  4BQN A;  1WJB A;  1FMW A;  1Z3X A;  4CCN A;  3OYI A;  3MKZ A;  2HVQ A;  3OR1 C;  2L9N A;  4N4N B;  4B47 A;  2RQQ A;  2VB6 A;  4F52 A;  2CMP A;  2VIX A;  1D0X A;  1YX3 A;  3PSF A;  4PJL A;  2VXD A;  3CJQ B;  4J01 A;  4LG3 A;  3OYA A;  2IS2 A;  1U0J A;  2WA0 A;  2VQH A;  2E1M C;  2HVS A;  3DPL C;  1P9Q C;  1WJA A;  4FAS D;  3DLA A;  3PNT A;  2K9L A;  1J09 A;  4YEJ A;  3DPT A;  3H5A A;  1MMA A;  2WY8 Q;  4DOZ A;  4F3Q A;  2LYC A;  3EUA A;  4XL9 A;  3UNG C;  2JVH A;  4BAC A;  4OAZ A;  2KL4 A;  4NQW B;  4BEH A;  5CPR B;  4BS9 A;  4F91 B;  3HOS A;  4JQF A;  1MW7 A;  3NWT A;  2KMU A;  3F9K A;  4DGW B;  3DKX A;  3ZQQ A;  1WJC A;  2BOL A;  2M4K A;  1QHH D;  1QU3 A;  4P5O A;  2R4G A;  3QYF A;  4KIT B;  3L2V A;  1YX5 A;  2ZXI A;  3ZRG A;  2V6E A;  1SAU A;  2IGO A;  2HU9 A;  4ITV A;  3H9J A;  3LSK A;  2DT7 B;  1LKX A;  3RCO A;  1SFK A;  2L7K A;  1G59 A;  3K4K A;  2XF6 A;  2VJ4 A;  4BJ6 C;  3K4C A;  1Y6I A;  3OYF A;  2LRD A;  2UWM A;  3FDY A;  4LIU A;  4IKF A;  2R7V A;  3VYS B;  4RLF A;  5HLT A;  5JHF A;  4ZTJ A;  1BOB A;  4XM3 A;  4XKC A;  2L5Q A;  2BVL A;  1Y56 A;  4XQF A;  1W36 C;  1KON A;  3L2U A;  2DT6 A;  4XOR A;  2LY2 A;  2V7F A;  2L2O A;  4PSX A;  3E0J B;  2DXI A;  3RTR A;  3VDX A;  2DCE A;  3D5R C;  2HPI A;  2M7A A;  2MFZ A;  3K4L A;  3PL8 A;  3RPU D;  3S93 A;  2XSJ C;  1LDK B;  2Z2S B;  4IQJ A;  2WAE A;  4CUG A;  4E6K G;  3OL4 A;  3FBN B;  5KHD A;  4E7K A;  2CV0 A;  5HVQ C;  4E7L A;  3BG6 A;  1BR4 A;  4BJT A;  2Z1D A;  4CCL A;  3CF2 A;  4F92 B;  3OYB A;  4XMY A;  4DJA A;  4B48 A;  4II3 A;  4ZDO A;  3LSH A;  3RSN A;  3LL7 A;  2V26 A;  4AU7 A;  1UAA A;  2CH0 A;  3ONQ A;  3LSG A;  3DTE A;  1D0Y A;  1X19 A;  4CCK A;  4R79 A;  2K3P A;  2CW7 A;  2PJR A;  4C2U A;  3NWS A;  1G8X A;  1R6R A;  3CZ6 A;  4AYB A;  4BGD A;  1ERD A;  4Y33 A;  2CW8 A;  4CZC A;  4PFP A;  4DBR A;  3V42 A;  2CUJ A;  3KX2 A;  4OAY A;  3HC7 A;  4HEA 2;  5KNL A;  3FHN A;  4CCM A;  1LVK A;  3W2W A;  4HRI A;  2VL8 A;  4DIQ A;  2VKH A;  1D1C A;  4E4H A;  3OYE A;  4G6T B;  2A6T A;  3AL0 C;  1WJD A;  4MLO A;  4PK4 A;  5HOO A;  4XLC A;  3W2A A;  3TMO A;  1IRX A;  2CFO A;  3IUO A;  3OYD A;  2IS6 A;  3VYT B;  4XN0 A;  3HG9 A;  4ZYA A;  5TGT A;  2JA2 A;  2KZV A;  3DTK A;  2MD0 A;  4PJJ A;  5CQG A;  2K5C A;  4HNT A;  1X1D A;  4BJ5 C;  3S8P A;  2X85 A;  3EPZ A;  2LH9 A;  3K6G A;  3U21 A;  5LFA A;  3RQ4 A;  3HOT A;  3K4J A;  2DOA A;  1OLT A;  2ZSI B;  3OWT A;  4XKB A;  3K70 C;  2FUG 2;  4BEH B;  4E7S A;  4XLA A;  4HPQ A;  3SEQ A;  3A1Y A;  1HA8 A;  1GLN A;  3LFU A;  3VSL A;  1YE9 A;  2KQR A;  4E7H A;  2X51 A;  2VQC A;  2Z16 A;  3HXL A;  4QPQ A;  1UG0 A;  2HPM A;  4XON A;  3DPU A;  3UR3 C;  2M4G A;  3IP4 B;  5LD2 C;  3GBG A;  3HKZ A;  1WJ5 A;  3DU6 A;  3QYE A;  4ANJ A;  3AL0 B;  3BG7 A;  1AA7 A;  2JVG A;  4CH7 A;  4XLH A;  2XC7 A;  3QYB A;  2WY7 Q;  3DEE A;  2WAD A;  1N75 A;  2PMZ A;  3K4M A;  1WFX A;  1MMN A;  1X1B A;  3LSI A;  3MMY B;  4ZDP A;  2F4I A;  2LBF B;  2L9S A;  2R7S A;  2R7W A;  3K4N A;  2VJ5 A;  3DQV C;  3FBI B;  2E60 A;  1N77 A;  2KDO A;  4B3X A;  1X4P A;  4XR6 A;  2F6C A;  2XF5 A;  3N05 A;  3H9Q A;  3I3L A;  3MKY B;  3H5R A;  3K70 D;  4BE2 A;  3VYR B;  4BU2 A;  2HZD A;  2V4J C;  4BUP A;  2HVR A;  2PJR B;  3ZR8 X;  4F55 A;  2LG4 A;  1NG7 A;  3TL4 X;  3OY9 A;  4H4K C;  4P1W A;  4CA0 A;  4PFO A;  2IGK A;  1DGR M;  4Y3O A;  3OYH A;  4NNJ A;  3PSI A;  3G2B A;  3K4B A;  1V5E A;  3CJR B;  1WJE A;  3IAM 2;  3HL2 A;  3LMM A;  3L2W A;  1D1A A;  4RMN A;  4J00 A;  2X1E A;  3HPG A;  3OYC A;  3CP8 A;  4HSR A;  3SYT A;  4HNU A;  1V5F A;  3OYL A;  2P0W A;  2IS4 A;  2F5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...