2WY8Q

Staphylococcus aureus complement subversion protein sbi-iv in complex with complement fragment c3d
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
66
structure length
66
Chain Sequence
VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C3D FRAGMENT
publication title A Structural Basis for Staphylococcal Complement Subversion: X-Ray Structure of the Complement- Binding Domain of Staphylococcus Aureus Protein Sbi in Complex with Ligand C3D.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wy8Q00
2JVGA 2WY8Q 2WY7Q 2JVHA 2NOJB 2GOMA 2GOXB 3D5RC 3D5SC
chains in the Genus database with same CATH superfamily
3FXLA 4EVIA 1Z67A 2COMA 2Q8KA 4RLQA 1XN7A 2R7WA 4G6TB 4L0YB 4ENNA 5K7HA 3K0LA 4G6DA 4PFOA 5EGOA 5ERIA 5IOYA 1QHGA 2ETHA 2M8EA 5J4YA 1UFMA 1YG2A 4V2FA 2R7RA 2EFWA 1GV5A 1R5GA 3KP4A 3IL2A 3MKZA 4IXAA 1U9NA 3OYFA 2YU3A 1YW7A 2Y0SN 1XTAA 1OFCX 2A3SA 2KIUA 3LL7A 1T33A 4RDUA 3P7NA 2ZC2A 4P5OA 1FYMA 2OD5A 1ETYA 3O3KA 4CCLA 5J1UA 2XAFA 1OJLA 3C2BA 5DV5A 1B9NA 3QPHA 3LA2A 4UUSA 3CP8A 2ZXHA 3OR1C 5J1RA 2P7CB 2ZXWH 3O6BB 3B6CA 2XSDC 2K86A 3WTSC 4XORA 4N4OB 1JT6A 1O57A 2XV4S 3VYRB 3QYFA 4HF0A 1R58A 1S29A 4PJMA 4WCGA 1YE9A 2MYSA 1ZYRF 2MW8A 3CCQI 4IL6C 3DV8A 3RIRA 2V1NA 1TLHB 1P7IA 1T56A 2VJIA 4M74A 3V8JA 2XAJA 4QWQA 4BU2A 4DGWB 1J2XA 2R3SA 1G59A 4A0ZA 4OINF 3E6BA 4CCMA 3WTXC 1IRGA 4A3MJ 4XSXF 5FRNA 1TWFJ 5LHHA 3ERED 2PFBA 2WV0A 3DEEA 1I6HJ 2F5CA 4HZFA 1J75A 4IQJA 1Z0XA 4WK8F 4XIDA 4MQVA 4BUPA 1O3QA 4A3IJ 3E6MA 4MQ9F 4OIQF 2KIMA 4E7SA 3F8MA 4Y7NJ 3LSTA 1BJZA 2DFEA 3GMEA 2NS7A 3OOUA 4Q4ZF 1JTYA 3Q5FA 2DFFA 3J7ZI 4EEFG 3DTIA 2DN0A 3QP6A 1X1CA 1ERDA 3DFGA 4RA2A 3AAFA 2JQ7A 1D1BA 1DUXC 1IXSB 3FKJA 3I55I 4Q5SF 1F1ZA 3DKYA 2YUSA 1T0FC 4MEXF 2HZTA 1HOMA 4PUSA 4HX4A 2F5FA 2K5CA 1UB9A 3K10A 4OAYA 2XGCA 1WVRA 3FXQA 2GXBA 1W5TA 2LSOA 3CLQA 2BHYA 4FT8A 3ZQLA 1XSXA 3QYEA 2P7VB 3FK7A 2ZCWA 3HTSB 2K4BA 2A5WA 2PMUA 3J81Z 3M4OJ 1Y8RB 1BBYA 2AO9A 4AIDA 4PCQA 3RCOA 4IPAA 5HS7A 3BY6A 3C7JA 1NTCA 2BEOA 2UWMA 2E19A 3HOXJ 3PO2J 1BM9A 4CZZA 2ELJA 4HBLA 1JE8A 3P9IA 2CFOA 1RRJA 3IH2A 1XGNA 5LBQA 3NWSA 1YRNB 3FXJA 1WCMJ 2ID6A 3JRHA 4IO9F 1TWCJ 2C6YA 2LP0A 2ELKA 3O8GA 2R92J 5M3MJ 5FJ8J 4CSWA 3L2VA 3WU0A 3L2WA 3HB9A 1HDDC 2PMZA 2JA2A 1W36C 2QA4I 4Y4RA 3CUOA 3RKXA 3OSGA 3TDZC 1MJBA 3W6VA 1JKRC 2E7WA 3UNGC 1K4TA 3IKVA 1D5YA 2KJBA 1S8NA 1IRFA 2IRFG 1O3TA 2XGXA 2AXTC 2HYGD 1T39A 4KDPA 4P9UA 4RAYA 3HM5A 3U21A 2A6EF 1RKTA 2E2JJ 3W6JB 3KP5A 2ISYA 1WJEA 2CS3A 2VI6A 3P9CA 2R5YB 4M72A 2R5ZA 3S3MA 2PJRB 2Y9YA 1QGPA 2V7FA 4DYCA 1OKRA 2IP2A 4HQEA 4R79A 3J7AY 2ZXJA 1FP1D 3ZQGA 1AKHB 4EQQA 1SFEA 2JT1A 1WRJA 2GQQA 3G4SI 4IKFA 3GLLA 5BQTA 3D0SA 3VEPA 3FMSA 2QEXI 2WBMA 3PIPF 3IC7A 4RMNA 4U7DA 3QOEA 2L7ZA 3MZ8A 1JUSA 1PJRA 4RGSA 1D3YA 3BROA 3GFJA 2UXNA 4EATA 1OR7C 2CWEA 1S5LC 1B6AA 1WH7A 3OYBA 1FOYA 2GOMA 1ETOA 5D8LB 5E8IA 2ZFWA 5BPIA 1YTYA 3VYUB 4L9JA 3W2WA 4OAZA 4XMYA 1HQCA 1RI7A 3CMAI 2VC1A 2X4HA 3DXJF 2O61A 2WWYA 4A3DJ 2QKMB 5LGTA 2XKPA 1WJFA 2CSOA 2KMUA 4FE7A 3CCYA 3G3ZA 2NRAC 1TC3C 2BGCA 1X1AA 4M3DA 3QRFF 1LFBA 4M3FA 2JRTA 3GTMJ 3X2QH 4XLNF 2DI3A 3DCFA 2PBIA 5LLQA 1KONA 1ZRFA 3GTPJ 3CCRI 2HVRA 1IV6A 2HEOA 3A02A 2P8TA 2CMPA 3ZMTA 3CCJI 1NG6A 2CYYA 2P0WA 3Q0UA 2DA2A 1Y39A 1ULYA 1ETXA 2EA2A 2WAEA 1TQIA 5TISC 3IV5A 3VSKA 5B1BH 4QIWN 3GTGJ 2DMNA 3KP3A 4HV6A 2HOSA 4F7ZA 2QVOA 2ZBKA 3ZR8X 3SEQA 3ZMUA 1RZ4A 3H0GJ 3OS2A 2X9DA 1I3AA 4QTRA 3E5QA 3HUGA 2H6BA 3U9GA 2BZTA 3H1CA 4CYCA 2V79A 1MSFC 4EJOA 3ZMSA 2M8GX 4OWRB 3EUAA 4D5FA 2B9SA 1B72A 4FASD 1LNWA 3L9FA 1ETKA 2FA5A 3RYPA 2D1VA 3ECHA 2ZJQF 1UG0A 3JRIA 1FOKA 2HZDA 2ZMEB 3JTHA 4DZPA 4LIUA 4BQNA 2K3FA 2V9PA 3K7AJ 4BE0A 2F5EA 3AL0B 4M9XA 5A2QZ 1XB4A 2Z2SB 4XNFA 2LH9A 5M5YJ 3HOWJ 1B59A 1V54H 4MNUA 3WE3A 5FKNA 2ESNA 2V26A 1N78A 4NDLA 3ASNH 5EDNA 1OYYA 3S1NJ 1C0WA 3RPUD 3L2QA 2ZKZA 3RTRA 2EILH 4KUMA 2VN2A 1JI8A 3PJRA 2M3AA 3D5SC 2OU2A 4G9YA 1FEXA 2FNPA 4DYQA 2DOFA 4ZH4F 2H27A 1RC9A 1BI0A 5IYCJ 4S04A 2PMHA 1BOBA 2R93J 4B3AA 5KHDA 4LD5A 2K9QA 3SZGA 5J8FA 3EUHA 3LAJA 4KA4A 2HOTA 3ZOBA 2QCOA 5ED4A 5C3EJ 1FTZA 1S6LA 2MFZA 2QF7A 4D9JA 4XLEA 2P81A 5E3LA 3IRRA 1UHMA 2O8XA 3LA7A 1T08B 4IHSA 2DA7A 3GX4X 1AU7A 5EZHA 2RQPA 3PSFA 1PUEE 1JJ6C 2FNAA 4DW6A 2DODA 2LY9A 2WADA 5LHGA 2VKHA 5CYVA 1WPKA 3H9GA 2QSGX 4Y52J 5ILSA 1UHSA 1FPQA 3QAHA 4X1EA 4PK4A 3G1OA 2VXDA 4KICA 3SFZA 4IHYA 4MHGA 2KDZA 2ZNZA 4DBRA 4P55A 2Y0SA 1P9QC 1RETA 1VQ8I 3S14J 1X3WB 2L2OA 3QU3A 2VUMJ 3Q0VA 3WE2A 1ZLKA 3RPQA 4BJ6C 3IAS2 3KCCA 1RUNA 2R7TA 4DNCA 1BN5A 4HOBA 1MJAA 4XKCA 4CCOA 1LEAA 3WU1B 5FLMJ 2RV8A 2DAOA 2CUEA 2GAUA 3ECOA 4PJLA 2YS9A 3OYAA 2CRGA 3TO7A 4KN4X 3KP2A 1KQ0A 1HSTA 5IY5H 1K78B 4RB1A 2AHQA 4EM0B 4WXHA 3E0JB 1X4OA 2X51A 1I1SA 5FGMA 3HDDA 3BWGA 2MBFA 1G4DA 2EIMH 3UR3C 2EZLA 4BQOA 2WAFA 1S72I 4RLFA 1T2KA 3JW4A 5FKLA 4I0AA 2BY3A 2LNBA 4MGRA 3LSPA 1MNMC 4PJJA 1TT5B 2LC2A 5E3OA 2XAQA 1KYZA 4GCVA 1QZEA 2DOEA 3FKIJ 2J5PA 3G6EI 1S7EA 3H35A 4DBQA 2R7UA 4OIOF 5TRDA 3P9KA 4OIPF 3TO6A 1FMVA 4E7LA 4BL0B 2X48A 2LF8A 1LQ1A 4IF4A 4ZTFA 1JKOC 3S2WA 2EJRA 2VPRA 4UVBA 3CD6I 4L18B 2HYJA 3PL8A 4B47A 4I98B 1XS9A 2LY1A 3ZMVA 4J19A 4ENKA 3L7WA 3H92A 4L0ZB 1X1DA 1WJAA 1ZG5A 2RDPA 5BS6A 3AKZA 1JKPC 5K5OA 5GTHC 3TOAA 2FBIA 2VB6A 3A0BC 1SC7A 3ONQA 3CUQA 5E18F 3HOVJ 3J81K 3M8JA 3Q9SA 5F04A 3CCSI 1JGGA 3V8LA 2ESHA 4BHBA 4BBSJ 4D7MA 1NK3P 3GEZA 3MAJA 4K2EA 2HXOA 4I2OA 1WFXA 3H5NA 3R0JA 2X0LA 4BAYA 3HIFA 3KFWX 4XQFA 3DWLE 1GLNA 2EBIA 2YX4A 4IRIA 2X1EA 5M3FJ 4B4CA 3RZOJ 2IS2A 3BC8A 3WTZA 2QQ8A 2DQLA 5GTIC 1ZR2A 1Z91A 4PSXA 2O3FA 3WTWC 3BJ6A 1NHAA 2GLOA 2DDAA 4CCJA 1IDZA 4U0YA 3L00A 1FOWA 3JRAA 3ZQFA 3WGIA 1K83J 1SMYF 5IYBJ 3BG5A 4HX7A 1Z3YA 2L9SA 2HDDA 3K4BA 3BG6A 4IRGA 1Q1VA 3CC7I 1OCZH 3ZQHA 2R7OA 2LKSA 4P96A 5E1ZB 1ZRCA 1MMGA 1N25A 2HPIA 2PN6A 4UY8I 1WJ5A 2CQKA 3B73A 2FBKA 1IXCA 2XGDA 1Y8QB 2NVXJ 1P92A 3OIOA 4Y3OA 3LNQA 4JX6A 1J7KA 1IXRC 2H1LA 4CO8A 3T1BA 5HS8A 4BQAA 3TDUC 2AS5F 2QQAA 4U0VA 1KU9A 1SMTA 4YG2F 3GFIA 1RUOA 3F22A 4XRSA 2JN6A 1ZGWA 1TTYA 2FBHA 5D6EA 3OL3A 3TGNA 4I09A 4G6QA 2MSYA 1LDJA 4UVAA 4IOCF 2Y31A 3I0TA 5F0HA 4ZDLA 3SDBA 1ZG1A 1U5TA 3OS1A 1YRNA 2DA3A 2H1KA 4AIKA 1OCRH 2LKPA 3GTKJ 2IS6A 1VQMI 6PAXA 2E71A 2ELHA 4E70A 4ESBA 3C2GA 2Z16A 3BJOA 3OYDA 4HW0A 1X2NA 3FM5A 2P5KA 4ZYEA 3WU2C 4EJVA 3A03A 1TL8A 1ZELA 2L9VA 2K7LA 3KYCB 5E8GA 5JFRA 2P6TA 4XRSG 3G2BA 1Y1WJ 1YJWI 1E3OC 1X3ZB 4FISA 5KAFC 3K4CA 4ENJA 2Y48A 1X19A 4LB6B 3JR9A 1DP7P 4BJTA 2CU7A 5F6FA 5E79C 3OYJA 1IUYA 2XSJC 4CA0A 2VIXA 4XLPF 2BV6A 4S0HB 1ZQ3P 1BR2A 1UELB 2DW4A 2OPTA 4EV0A 3JSOA 3ZXSA 2R5YA 3F8NA 4XK4A 4AYBN 3V42A 1JUPA 3R0AA 4GO1A 3BQZA 1AKHA 2OC6A 1GXPA 5EJCA 3SZPA 3OYMA 3RSNA 1RIOH 2M30A 1R22A 1U2WA 3PSIA 2EZHA 4FCYA 2M4KA 1IW7F 4M3BA 4D7NA 1RR7A 3HRTA 4I76A 2VE8A 2Y9ZA 3WTYC 3L2UA 4IQ4A 1PP8F 4WX9A 4E7ZA 4M3GA 2Y0MA 1E0EA 4WWCA 2LY2A 2IGMA 1O7FA 5KAIC 2W82A 2ICWG 2VOOA 1Z05A 1ZK8A 2DDBA 1MMAA 5DUIA 2IS4A 1R1UA 2E1MC 5J47A 3BJAA 2CFXA 5E20A 3GFMA 1MDMB 4ZYGA 1JTXA 4ESJA 3JRFA 3HOSA 3SEZA 3E6DA 3S1MJ 2CW8A 2BW3A 3A1YA 2F5VA 3E1SA 5A2QK 1R6RA 3OIQA 3KLNA 1V5GA 4X6AJ 2X6XA 4KMUX 1LE8A 1WQ2A 3DTEA 4M3EA 2D5VA 3EYYA 2O5RA 3KYDB 1ITYA 1QZZA 4QPQA 4AD9A 1TQPA 4U7BA 1K4SA 3IUOA 3BP8A 1IJWC 1TBXA 3FHNA 4BQQA 3CMYA 4A3GJ 3DU5A 1QPIA 1XD7A 3S2HJ 1BIAA 1DDNA 2NS0A 1YJ9I 3ABLH 5C4JJ 3D5LA 2Q0OA 1H9GA 3DKWA 2IA2A 5K7FA 1SFXA 1AA7A 2ACJA 3EDPA 3TBIA 3GBGA 1MH4A 4M9SA 4CICA 3HYIA 2HQRA 2ZB9A 2Z5UA 1SAUA 3FZVA 5K1YA 1QHHD 4ANJA 4A3JJ 3ZPLA 5L3DA 1XG1A 2QENA 5FKKA 4B48A 3KPHA 4XKVA 1J9IA 2ZMEA 1Z6TA 5GAHJ 1VQPI 1K7AA 1ZGJA 1CF7A 2BY0A 1HKTA 2LLKA 3VOEA 2JSPA 3SHFA 4WXDA 1JKQC 1H0MA 5E17F 1MNEA 2OJED 4ON0A 4E4HA 2VQHA 1YITI 4AIHA 5J4VA 3HOTA 1ZLJA 1H9TA 2RN7A 1M1EB 4M6VA 1U8RA 3LQQA 4HSTA 3PQKA 4A3FJ 1EJ9A 2H6CA 1IN4A 2HQAA 5LRSA 1RKWA 1SVLA 1HW5A 3FXRA 1D5VA 2NNNA 3ZQIA 3V7SA 5BPDA 2KL4A 1IC8A 2V6EA 3CESA 2HQNA 2EV0A 4YFKF 4ZDPA 3RPUA 3N4MA 1BW6A 2FUG2 1W1WE 5JI6A 2FJ1A 3FF5A 2DPUA 3LSIA 1B1BA 3MFKA 1BI3A 1V55H 1VF9A 3CO7C 2CV1A 2Z3YA 5FD5A 2F48A 2BXYA 1OLTA 3HHGA 1LJ9A 3OR2C 2LD5A 2VBXA 2XUBA 4DIQA 1HA8A 4CH7A 1V5FA 2W57A 1DQUA 1TT0A 2ADUA 5HS9A 2BBYA 4JX5A 5HDNA 2OF7A 4ETSA 2BE5F 2EIJH 5H2FC 1RR8C 2EFQA 3LWFA 3CJQB 3BTJA 1VQLI 2OQGA 1JXSA 4BXUA 2JA5J 4TV7A 1P4WA 2GWRA 1FYLA 1XMAA 3VYSB 3BR6A 2L9NA 2KFDA 1YS6A 1TZLA 2QZ8A 1YQAA 3PUFA 5LGUA 3FHZA 3VWBA 1DPUA 3WTTC 2RNJA 3K1MA 4XN0A 3B6AA 4RGXA 3EQLF 4M6XA 3WGGA 4C9YA 2XAUA 4M71A 3M1CA 4HLXA 3ML6A 2HPMA 2JUCA 4KJZA 3MMYB 1JUMA 3TKYA 4NC7A 2LBFB 1Y1VJ 2UXXA 5B66C 3KETA 1HKQA 3V7RA 2STTA 1I39A 1WJDA 1K78A 4I0BA 3M9AA 2R7QA 1H88C 5DCFA 5EG0B 2I8DA 4BNCA 3H5AA 3IH3A 5J1YA 4GRIA 3IKTA 2K27A 3HBLA 1R9TJ 1FNNA 3QU6A 3H9QA 3OYLA 2OV7A 3DTKA 5D4RA 2F5DA 2HVQA 2GOXB 2L7FP 3KE2A 1X58A 2KRFA 3H3UA 2QQ9A 3EUHC 1HW2A 2R7VA 3GWZA 1SFOJ 2OCCH 4ZZLA 2KP6A 2GZWA 1X1BA 2KDOA 1IZ1A 1NK2P 1IV8A 2DQRA 1VQKI 3OS0A 2QUFA 4MLOA 4BYYA 2RVCA 1FOXA 2FXAA 3M07A 4IJAA 1P4XA 2XB0X 1E3HA 4XR6A 1GVJA 3CP2A 2E5ZA 4J00A 5HVQC 2E2IJ 3HOUJ 1QA6A 2R7FA 4R1HA 2QWWA 1H8AC 3DQVC 1FY7A 1V3FA 3BOQA 1IGNA 1BW5A 4KMFA 2OQRA 4LG3A 2GXAA 1VQ9I 5E3NA 3SFIA 3A4CA 3J80Z 1Z9CA 2UZKA 4IOAF 2JPCA 1ACIA 4HF1A 4HRIA 4B09A 2D45A 1TWHJ 1QVUA 2W48A 2IAIA 2MG4A 4RB3C 1BI1A 3W6KB 1FMWA 5ILUA 3PNYA 4LLGF 4BHCA 1Z7LA 2OTJI 3RJPA 3CDHA 4I01A 3BTCA 3IWFA 5HDKA 3MKYB 1ZKGA 3DLLF 4M73A 1TW2A 3HTUA 5F1RA 5D5VB 3OOPA 2CQQA 5E3MA 2X85A 3HGYA 2ZSHB 2HXIA 3OV8A 1Z3XA 3COAC 5FKMA 2W7NA 3OY9A 3ZQCA 1QRYA 2PG4A 1UG2A 4I02A 4KIGA 5HLHA 1G3TA 5D5WB 5DM7F 4ZYDA 3JRCA 4UV9A 2HDCA 1TWGJ 3KLOA 2WB1N 2DK8A 3KZIC 3R61A 4UV8A 4AU7A 3DPUA 2E2HJ 5DD8A 1V4RA 3HG9A 1KQ9A 1ODDA 1PUFB 3NWTA 2CW7A 3KEOA 2COBA 2HNHA 1MIJA 2KZGA 4D5CA 3J7AO 1BC8C 3GTLJ 1VFCA 2DA1A 2KRCA 5JVGF 2DMUA 4DJAA 2E60A 1FIPA 1MBGA 4JQFA 1OCOH 1T0FA 2EINH 4MTEA 4D0PA 1LB2A 2AXLA 1SD4A 2CO5A 2LRDA 4RGUA 4A2UA 3JTGA 3F6VA 4Z2YA 4D1QA 2PEXA 3MQ0A 4XLAA 5C4XJ 5GPCA 2A69F 2FEZA 3RKYA 1Y0NA 2CUFA 4Y17A 3SDGA 5D6FA 2HOAA 3GZNB 4IHVA 4ENMA 3RKQA 3CUQC 4AIJA 2QSHX 3FXOA 2RC4A 5CQGA 3S3OA 1R5ID 4AYBA 5B5EC 1SVOA 1R7JA 2WA0A 3GUDA 3PFYA 3FBNB 1GT0C 2MABA 3FMQA 1UCRA 1FSHA 1BA5A 1IO2A 3B02A 5HDGA 4HNTA 2QLZA 2LFBA 1W7PA 3OYHA 1T8IA 3WTVC 3ABKH 4BDYA 2EFPA 4L9TA 1KU2A 3SXYA 4ITVA 5CQEA 1B8IB 1IDYA 4HDVA 4YEJA 1W0UA 2VJJA 4Q47A 1LEBA 2NVUB 2N8GA 4RBOA 5K7ZA 4HLYA 1YJNI 3ZGKA 2IVMA 3JRBA 2NAZA 3CDIA 2VQCA 4QLCU 4NQWB 3BTLA 2JJ7A 2W25A 3KZYA 3T8TA 2IGNA 1BOAA 1S7OA 2I10A 2H8RA 5HNHA 1ZTRA 2NXNB 3NEUA 5ICGA 3WHCA 5JVTA 3F21A 2YPRA 2L4MA 2VE9A 3CF2A 4HF2A 2EA4A 1GDTA 4O5VA 5FKOA 4O6JA 1HDPA 4BACA 5DD4A 4LLLA 3RQIA 1XMXA 1SAXA 2XVCA 5F64A 2IA1A 1POGA 2JA6J 1XGOA 2W1OA 4E7HA 2WAQN 3KYLA 2ID3A 4ZYHA 3AG2H 2CQNA 1FIAA 2HU9A 2ZJ2A 1KU3A 4N9IA 3M1EA 1MDMA 2FQ3A 1YI2I 4DZJA 3M8EA 1U5TC 3OIPA 2IGOA 4B44A 1USSA 1X4PA 3ZRGA 3GO5A 1Z6RA 1MW7A 4XN3A 4II3A 5IOZA 5F1JA 4BEHB 2CUJA 1R49A 1Z1DA 4GDFA 3MKLA 4GXOA 5CJ9A 5JLXA 4AUXA 1OCTC 2EQRA 3VYTB 1GHCA 5IP6A 3S3NA 2OZUA 1OR7A 4BDZA 2F6CA 2DK5A 4PJ0C 5EEAA 1Y0UA 4KYWA 4GGGA 2E34A 4CCKA 1HCRA 1E3PA 5LHIA 3A0HC 2CH0A 3ZQ7A 3C1DA 2WY7Q 1TNTA 2E1MB 1OCPA 3F9KA 3LFKA 2BYVE 2LKXA 5D4SA 3CF5F 5EEHA 4I6ZA 1IF1A 2EPFA 2DYRH 5DUKA 4JYKA 2ZSIB 1FBQA 2KQRA 3FK6A 4E6KG 2GIVA 5HNFA 1G6NA 2GBYA 1GV2A 2JPBA 1B4AA 2HYFA 2MLKA 2O03A 2B63J 3DEUA 5DS9A 1ZN2A 2XF6A 3CZ6A 2OA4A 2GA2A 5HLIA 2KJCA 4OMYA 3DLAA 4YIIA 4DQ2A 4LIVA 2VODA 4RS8A 2JK3A 3GTOJ 1BJAA 3AG1H 1XDUA 3IAM2 1B9MA 2IGKA 1IAWA 1IUFA 2A5YB 3PM1A 1YHQI 4XOPA 3S8PA 4C3IJ 4CXFA 1AHDP 4WF2A 3EPZA 4Z6YA 2DT6A 2XF7A 2ECBA 1L3LA 3EYIA 1ON2A 5DM6F 3CCVI 2MD0A 2Z33A 3LFUA 1XGSA 1QVTA 1DGWY 4GYIA 5KVRA 1T98A 2MC3A 1EH6A 1X2MA 4QPOA 4F3QA 4Y13A 3CLOA 1VQ4I 1D8JA 3CJNA 1IN8A 3I3LA 3HRMA 1LFPA 2M7AA 3RI4A 1SANA 4C3JJ 1USTA 2CG4A 2XAGA 2M2EA 3FISA 2A61A 1W4MA 3BPVA 3C2HA 2JTVA 4CYDA 2BHZA 5FROA 2VL8A 3OSFA 1GUUA 1HLVA 1XCBA 5GADJ 1U3EM 2DO7A 1R00A 1FBSA 1N77A 2G7UA 2KIQA 3F0CA 2JVGA 2HS5A 3ZCOA 1V5EA 2JZYA 1D0ZA 3I64A 3LSKA 5BNGA 1Z7UA 1RPWA 2FF4A 2XASA 3TOBA 1KA8A 3PFIA 4FE4A 2QBYB 2LG4A 1H89C 3GVAA 2LK2A 4HEA2 2E1CA 5DTDA 2VQLA 1IRZA 5L3EA 1CGPA 1MD0A 2E36A 1IN6A 5LEKA 3CCEI 3H9JA 4L5JA 1ZR4A 4ASNA 3GW2A 4LK1F 4YRVA 1A35A 5J40A 1LVKA 1Y6IA 1ENHA 1QZYA 3DF8A 3CCLI 2ZNYA 3LQRA 4IZZA 3ULQB 3HOZJ 2V6CA 2RGVA 1TQMA 4AVPA 5CLSA 1FSEA 2JRMA 2FSWA 1R1VA 4IHXA 5HODA 2LBFA 1G8XA 5J8CA 3K69A 2FD5A 3F8CA 1DU6A 2VT2A 1VQNI 4JBAA 1S3JA 4BY1J 2Q1ZB 2WTEA 1SEUA 1U0JA 3GZ5A 3IHUA 5TGTA 3KP7A 3VB2A 3HUGB 2XPUA 4C2UA 5FLXZ 1HC8A 2DA6A 2JSCA 3H36A 1R36A 4BY7J 2J5OA 2RQQA 1R1TA 4ZDOA 3J80K 3QQAA 1B72B 2IJLA 2BY1A 1Z77A 1VTNC 1HW1A 2DT5A 2IA0A 1OYIA 2KZVA 2NVYJ 4F52A 4ZC3A 1TW3A 5H6RA 1D0XA 1YX3A 3ASOH 5L3GA 5LGNA 1A36A 1F43A 3DPLC 3HZJA 4JOMA 4BGDA 1STZA 2YU9J 3I56I 1LVAA 1ORKA 2PJRA 4E7IA 1R5HA 5FFZA 3T5XA 5IT9Z 4FQGA 1WKMA 3BQYA 3G73A 2K85A 3LA3A 1S9HA 2Z1DA 2DMTA 4RAFA 3K1PA 3RQ4A 1QU3A 4XRFA 3ZQQA 2A05A 2Z9OA 2HI3A 4Y33A 3R60A 4ZJZA 2F4IA 2CV0A 4BHPA 1FX7A 4YIRX 3JCUC 2JMWA 5GAGJ 3QOPA 4L5IA 4M6YA 2VBZA 4W97A 5FB2A 1T95A 5J6XA 2PI0A 1MJ9A 2DU9A 1XSDA 2EZIA 2I5UA 3CO6C 3M8FA 2RKHA 3BR2A 1X1PA 1FT9A 1OCCH 2VOPA 2A68F 2FOKA 2VASA 2WB1A 1FZPB 3TMOA 3N97A 1IG7A 3RYRA 3OYIA 4G94A 1ZRDA 2D1HA 2K40A 2ZJPF 4LG0B 5DEQA 1UHWA 1WJCA 4OIRF 3GYHX 4YFNF 2OUMA 3G71I 3I4MJ 5B3SH 3VDXA 5JR3A 1R23A 2BVLA 1JHFA 2G0EA 2M9HA 2HDWA 2O9LA 5IYDJ 3K6GA 1P7JA 3LSHA 4CUGA 3A01B 2GXGA 3AG4H 3G1MA 2QSFX 1HSJA 1MH3A 3PO3J 1XCVA 3ZN1A 2LREA 2MD5A 3HKZN 5IT3A 5L3FA 4G8XA 3TO9A 4JX4A 3JAMZ 3HRSA 1TNSA 5BMZA 4C2MJ 1S7AA 2HTJA 1PUFA 1GXQA 2Q2EB 2XF5A 4X0GA 4LFUA 3BCBA 4UB6C 3BR3A 2EFNA 3H0DA 2NNYA 4YFXF 3DEWA 4Y15A 1XDSA 3MN2A 4C3HJ 3HSFA 4RM3A 2LTPA 3E7LA 1MBKA 1A5JA 1EF4A 3IRQA 5ILVA 2L9RA 4EGYA 5L3BA 1WZ2A 1DPRA 3FIWA 1JT0A 2DFHA 1QBJA 4IRHA 1D1AA 4BH9A 2DXIA 3K9TA 1PVEA 3Q0WA 1G3YA 2CUZA 3M3YJ 4II2A 1VI0A 3F72A 3QP5A 1KZHA 3LMMA 1FC3A 2HKOA 3HC7A 1LDKB 3WG7H 4OMZA 4LOCA 3F23A 2NS8A 4F93B 3K4KA 4N0BA 2A07F 2K9MA 4G12A 2NOGA 4B43A 2DJIA 2D2WA 2X1CA 4F92B 2V1XA 2V1DA 2OAZA 2M4GA 3DBRB 1UJ8A 1YS7A 3HRUA 3TP3A 1B8IA 3D5RC 4AVZA 1MBEA 4PJNA 5ICFA 4O3MA 4R8HA 1IN5A 5LRRA 2VBYA 2WAQA 1EA3A 3CUQB 5FD6A 1EV7A 2P5VA 4HPQA 5D5UB 5AIPA 1G2HA 4NQWA 5CVIA 2EIKH 2V1UA 2BOLA 5DCMB 2M1BA 5H20A 3ISPA 4C30A 1VQ7I 5CVVA 1W0TA 1SD7A 1I27A 3I59B 1PYVA 1O4XA 3GXOA 2ISZA 4NNJA 1PDNC 3KEQA 1EKEA 3BG3A 4F55A 3S2DJ 3CJRB 4KIFA 2PLYA 4A93J 3OYNA 1XC5A 3F3XA 1REPC 2FX0A 4RB2C 4V19K 2E35A 2M0MA 1XSVA 5IP9J 1WHUA 4KT6A 2NOJB 1OMIA 3FXKA 1MKMA 1MMSA 2XPVA 4PSWA 3P5JA 3BR1A 3OYEA 2UV1A 3AFHA 1J5YA 2OCEA 3PNTA 3I4PA 1FTTA 4FHTA 1K79A 1A6QA 3MEXA 2MH9A 2VT3A 4IX7A 2L0KA 5HOOA 1WSUA 2P4WA 4ZYAA 2RREA 5H6QA 1WI3A 3O2PE 1LFUP 4BEHA 3I9V2 2L4AA 4JP0A 3PIOF 2JWTA 3F8BA 2CQXA 3K4NA 3K70D 5HLTA 1ZREA 3I4NJ 2K9LA 2R4GA 1J09A 1FBUA 1JHHA 5K5QA 2HQ5A 2VKDA 2W00A 3HGGA 3TEDA 5AIQA 1F36A 3S16J 2DFIA 1ZGAA 2H8WA 2X6YA 4HV5A 4L9VA 1SD6A 4C2TA 2CGPA 2ZFUA 2L3DA 3OYGA 3TL4X 2ZJRF 5LD2C 4I99C 5HLGA 5TJJA 5EF6A 1MNDA 2M7BA 1U5TB 2R7ZJ 4KT5C 1FWZA 2DPDA 5FFXA 2NVQJ 3EETA 1JGSA 2EK5A 2ZXIA 3KP6A 2XKOA 2PJPA 3HHHA 4IVNA 1U6GA 2QKLB 2JVHA 3S15J 2LR8A 3SYTA 3IP4B 3TP0A 3MKWB 2LYCA 1QQIA 1NG7A 3HL2A 1IN7A 3BT9A 2H09A 3K2ZA 4HA8A 5KCMA 1PP7U 4AC0A 2XHKA 1WGXA 3A2KA 3HOYJ 5EEGA 2EZKA 5K5RA 1KU7A 4MO7A 3QODA 4KISA 2E7XA 3LSMA 4YIFA 4F91B 2XC7A 4NC8A 3BPXA 3L2RA 3MZHA 3DKXA 1RESA 3D1NI 2CQ7A 2O7OA 2VJ4A 3O8HA 4XLHA 1HBXG 3CC4I 2EFOA 3TW7A 5EYRA 3QPTA 4BS9A 4FETA 1YFHA 2E1OA 2Y69H 2MA3A 4EJUA 2JA7J 2XAHA 3OMYA 3ABTA 3V4GA 2O0YA 3R4KA 3C3WA 1YLFA 2VC0A 4XKBA 2F4OB 2OTLI 4FTHA 2IBDA 3V8KA 2GA1A 3HXLA 1KGSA 1TP4A 4NUBA 3BZKA 1MBFA 1P6RA 4I7HA 4UB8C 3LSGA 4A5MA 2W4SA 2STWA 4N9HA 4CZCA 2PQ8A 1A04A 2YR2A 2XROA 3CTAA 5DYMA 2E1NA 3HSRA 2UUZA 2XGEA 5D5XB 1OYWA 5FLXK 5IPAA 4J01A 5L3CA 1UMQA 3K4LA 1LUJB 3BLYA 1FJLA 1F4KA 3NQOA 4MIMA 2QBYA 5E1WA 5M5XJ 4KNYA 5IP7J 3J7YJ 4A3KJ 3F8FA 2A6TA 2M5WA 2GM4A 2WY8Q 4XLFA 1XGMA 2FU4A 3LAPA 1CQTA 3LOCA 3GFLA 2KLOA 4B1RA 3SZTA 2QQBA 1LKXA 4Q48A 4P1WA 2EV5A 4BXFA 2BW3B 4XL9A 3U2RA 5EGOB 2NYXA 3L2CA 2M34A 4DYRA 4UVCA 3LSRA 4GFBA 5D8KB 2ECCA 2XRNA 4RGRA 3RZDJ 1LE8B 1N75A 1ZARA 3BR5A 3FXMA 2KHMA 1YYVA 2JA8J 2HTSA 2EH3A 3JREA 2V4JC 2HR3A 2B0LA 2TDXA 1VQ6I 1ZHFA 2DT7B 5IT9K 3FDYA 2XPWA 1MMNA 2LF7A 3KZZA 3CCMI 4CDGA 2G9WA 4XKWA 2FMLA 2CW0F 3QPSA 3BR0A 3MCZA 4RM2A 3WODF 3V7CA 1ETWA 1O3RA 1HXDA 4A12A 1I1GA 1VZ0A 5E1XA 3BCAA 3K4MA 4UUSB 3E3VA 4BBRJ 1UZCA 2W85A 2VXZA 3CDLA 3E5XA 2YX7A 3WHBA 2P6SA 2KT0A 3CQZJ 5CPRB 2HFHA 3S17J 3T8RA 1T6SA 2FE3A 4RAZA 1BC7C 3NRVA 5B1AH 4XM3A 2FMYA 1CF7B 4MFDA 4YELA 1X3UA 2IW5A 4PDKA 2DLLA 3W2VA 3E97A 1SD5A 3QYBA 3GZ6A 1BI2A 1R4MB 5ICEA 9ANTA 1T38A 2ME0A 4UHTA 5JLWA 1BL0A 1ZH5A 5JHUA 2VKEA 4UNOA 3H5RA 2L7MP 2LVSA 3BZ6A 3ZMDA 1MGTA 3FXUA 5KK1A 4KFCA 5F27A 2ZO4A 1W5SA 4V2GA 3S32A 1HKSA 4IHTA 2DMPA 2IT0A 4XRMA 3CC2I 1TWAJ 2DTRA 4FX0A 4KN7X 3WG9A 3JAMK 2HVSA 4EMSA 3IWZA 4EJWA 4LK0F 1Q1HA 1AOYA 2L54A 5J3LA 2W84A 3BG9A 3I5UA 3QPLA 4AWXB 3VFZA 1IRXA 4HYEA 3K4JA 1MMDA 3HKZA 4PGGA 2IS1A 1EH8A 4JK1X 3K70C 2DA4A 2X6OA 1ETVA 2K9NA 4MEYF 4NB5A 2QGUA 1U9OA 4XLCA 2RAEA 3HPGA 1K6OA 1L0OC 3DBHB 4KIBA 4LG0A 3RKWA 3ZMZA 3OYKA 1W5CC 2OZ6A 2VONA 2R7SA 3VPRA 4L5EA 4LLNA 1P2FA 4MTDA 1I3QJ 1F9NA 2KISA 5LEJA 3MVPA 1MZBA 4N4NB 3ZP5A 2LOOA 2AQEA 2MH2A 3W3CA 3A01A 2VLAA 3TW6A 1R71A 2QM3A 4BJ5C 1D0YA 2YSRA 3F6OA 3ABMH 5FO5A 4QSHA 1DU0A 1A31A 4ABZA 2XIGA 1QNTA 2IEKA 1YIOA 2XRLA 4PGHA 4CHUA 2X6WA 2Q2EA 2TCTA 2FRHA 2L01A 4HG2A 5DDGA 2O6GE 4EGZA 3ROUA 3FWEA 1NH3A 4XICA 1G3WA 3MWMA 4ZZDA 3PUBA 1FP2A 2IXSA 3WGHA 2KIFA 2ME6A 4LGWA 3N05A 2Y75A 3R6SA 2HKXA 2L02A 3GCMA 1LPQA 1O3SA 5FLVA 2GIZA 2OBPA 1U8BA 1MSEC 5F0FA 2LDUA 4PZJA 1U78A 2LMDA 3ABUA 1DP3A 3ELKA 4E7JA 1SFKA 1QPMA 2P5LC 2B7EA 2TRTA 3GLXA 3DU6A 3MD2A 4KITB 3C18A 2EB7A 2EWNA 4BE1A 3DP7A 4CGZA 5GP9A 2BVMA 4ZTJA 3L09A 4A6EA 2R7XA 3U1KA 2IPQX 2Y30A 3CCUI 3PNVA 3SQNA 3RDIA 4OU0A 4HDUA 1YO5C 1WWXA 3BZCA 2R5ZB 3UKGA 5LFAA 3OL4A 1Z21A 3SJMA 1VNDA 2PMZN 2BY2A 1WI9A 2K9SA 3CMEI 3HEFA 2VQGA 2F4MB 1ZG3A 4PFPA 1KYWA 1UAAA 3JRGA 5BOXA 4DOZA 5M5WJ 1XPXA 5DCMA 2V9KA 2L7KA 2W24A 3ERMA 3K1NA 1O7LA 2K3PA 4CCNA 3S93A 2JUGA 3FBIB 3I59A 2CJJA 2M0CA 5F0CA 1EH7A 1VQ5I 3W2AA 2RNGA 1E2XA 3BTIA 4UXNA 4LITA 2V9VA 1YW9A 2MGQA 2QYOA 3KX2A 3WTUC 3IH4A 2VPLA 1J59A 2E5NA 1G3SA 3HJEA 4EM1A 1KQ8A 4IEJA 3QWLA 1F5TA 4NBQA 5JHFA 2DMQA 2DTZA 4P9FA 4HNUA 5GPAA 1HF0A 4BKXA 4HAMA 1I50J 5CVUA 4HNVA 4A6DA 4HSRA 1MBHA 5AONA 1I6XA 2MLGA 4UUVA 2EV6A 5F08A 1D8KA 4NHJA 1LDDA 4LJZF 3E6CC 2ZMEC 1K61A 4E7KA 2DBBA 2K4JA 4WXCA 4G7HF 4B3XA 1YW8A 3GTQJ 2DJNA 2KRHA 1XX5A 2K02A 1WJBA 4XOTA 4H4KC 1YX5A 3AL0C 4EM2A 4M9ZA 2FQ4A 2MC4A 3G1LA 3I54A 3I53A 3OYCA 4NC6A 2HWVA 2L5QA 4W1UA 3L1PA 4EJTA 4XONA 3REOA 4ESFA 1BR4A 1ONVA 3K2AA 2NVTJ 2H94A 3KEYA 2HGCA 3CJTB 2XB5A 5EG0A 3M7GA 1RNLA 3CMMA 2VKVA 4HX8A 5CVJA 3I71A 4A3BJ 4CYCB 4BXXJ 4A3EJ 4A69C 1QO0D 4U88A 3NAUA 5ICCA 4IHWA 1JJ8C 4S05A 2VBWA 1ETQA 3ZN0A 1AWCA 1ZAOA 3BG7A 1MBJA 3FM3A 2R0QC 1OISA 1A6IA 2KPMA 5FRMA 3S1RJ 1YOVB 4HQMA 1APLC 1W7PD 1P4AA 2FOWA 5CKTA 4G7OF 3E5UA 1BIBA 3VSLA 4B8XA 3GF2A 1R4NB 4A5NA 4RAGA 1SVMA 4RB0A 3HPHA 5GAEJ 4OOIA 1DGRM 3DPTA 2VJ5A 4G7ZF 3EUKL 3KIOA 3PQJA 1W7PB 1YIJI 1SFUA 2O8KA 2BXZA 4LB5A 4U0WA 1K6YA 3AG3H 2A6HF 4BE2A 3TQNA 3FMRA 1ON1A 2X1DA 3JRDA 1J0RA 1VQOI 2M87A 2M45A 1I5ZA 3MZYA 2KKOA 4FX4A 1BR1A 1W36D 3BDDA 4UUTA 3GTJJ 1WH5A 3H3VK 4A0YA 4GYGA 5C44J 3VODA 4XBFA 1FYKA 4AM3A 2DA5A 2WV1A 4A3LJ 1Y56A 3T0YA 2XDVA 4A3CJ 2DOAA 3Q9VA 5CVRA 2R7DA 2AQFA 4XSZF 1GVDA 2Y2ZA 3U1DA 3I58A 3DBLB 1E17A 5EZGA 3H3ZA 3FX3A 3OWTA 4A0XA 1OQYA 2F2EA 4U87A 2HOEA 4H0EA 5KNLA 2PX9A 3HSEA 1D1CA 1FLIA 2DCEA 3NARA 3S1QJ 2WC2A 2DYSH 2Z99A 3JSPA 1XMKA 4L9NA 4LMYA 2G7HA 4MFEA 2CV2A 3ESWB 3Q3SA 3LSJA 1OPCA
chains in the Genus database with same CATH topology
3TL4X 3DWLE 1GLNA 4RLQA 5LD2C 2X1EA 2R7WA 4BDYA 4G6TB 1MNDA 2M7BA 2IS2A 3BC8A 4ITVA 5CQEA 4PFOA 2ZXIA 4YEJA 4PSXA 1QHGA 2VJJA 4CCJA 2R7RA 2QKLB 3ZGKA 3MKZA 2JVHA 3OYFA 2VQCA 3SYTA 1Z3YA 2L9SA 3IP4B 4NQWB 2LYCA 3MKWB 3K4BA 3BG6A 3LL7A 1NG7A 3HL2A 2IGNA 5KCMA 5HNHA 4P5OA 2R7OA 3A2KA 1MMGA 4CCLA 2HPIA 3CF2A 3QODA 4KISA 4F91B 3LSMA 2XC7A 4NC8A 1WJ5A 4BACA 3L2RA 3DKXA 4Y3OA 3CP8A 2ZXHA 3OR1C 2VJ4A 4XLHA 4BS9A 4FETA 2W1OA 4XORA 4E7HA 4N4OB 3KYLA 3OMYA 3VYRB 3QYFA 3OL3A 2HU9A 4PJMA 4XKBA 1YE9A 2MYSA 4ZDLA 3SDBA 3OIPA 2IGOA 4B44A 3OS1A 1X4PA 2V1NA 3HXLA 3ZRGA 4NUBA 2IS6A 2VJIA 1MW7A 4XN3A 4DGWB 3LSGA 4II3A 4BU2A 2W4SA 1G59A 4CZCA 3C2GA 2Z16A 4BEHB 3OYDA 4CCMA 2CUJA 2UUZA 5FRNA 3VYTB 4J01A 1ZELA 3DEEA 3K4LA 3BLYA 4BDZA 3S3NA 3G2BA 2F6CA 4IQJA 3K4CA 4CCKA 4BUPA 1X19A 2CH0A 2A6TA 4E7SA 2WY8Q 2WY7Q 2E1MB 4XLFA 4BJTA 3F9KA 3OOUA 3OYJA 2KLOA 1LKXA 2XSJC 4P1WA 4CA0A 2VIXA 4BXFA 2BW3B 4XL9A 2ZSIB 2KQRA 3DTIA 4E6KG 1BR2A 1UELB 5HNFA 1X1CA 1ERDA 3ZXSA 1N75A 2KHMA 3V42A 2V4JC 2XF6A 3CZ6A 1D1BA 2DT7B 3FDYA 3DLAA 2OC6A 1MMNA 3FKJA 3DKYA 1T0FC 4XKWA 4LIVA 3OYMA 4PUSA 3RSNA 2K5CA 3PSIA 4RM2A 3K10A 4OAYA 2M4KA 3IAM2 2IGKA 1VZ0A 4XOPA 3S8PA 3BCAA 3EPZA 3K4MA 3QYEA 2DT6A 2XF7A 4IQ4A 3L2UA 4E7ZA 2A5WA 2VXZA 2MD0A 1E0EA 3LFUA 2LY2A 1DGWY 2IGMA 2W82A 5CPRB 3RCOA 1MMAA 4QPOA 4F3QA 2UWMA 2IS4A 2E1MC 3I3LA 1LFPA 2M7AA 2ELJA 4XM3A 4YELA 2CFOA 3HOSA 3W2VA 3SEZA 3NWSA 2CW8A 2BW3A 3A1YA 2F5VA 3E1SA 3QYBA 3C2HA 1R6RA 3OIQA 5FROA 2VL8A 1V5GA 2X6XA 3DTEA 3H5RA 1N77A 4CSWA 2O5RA 2JVGA 4QPQA 3ZCOA 4U7BA 3L2VA 1V5EA 3S32A 3L2WA 1D0ZA 3IUOA 2PMZA 3LSKA 2JA2A 1W36C 3FHNA 4BQQA 3DU5A 2LG4A 4Y4RA 4HEA2 2VQLA 2HVSA 3D5LA 3UNGC 3H9JA 1AA7A 3TBIA 3GBGA 3U21A 4YRVA 1SAUA 1LVKA 1WJEA 1QHHD 1Y6IA 2CS3A 4ANJA 3S3MA 2PJRB 2V7FA 4IZZA 4B48A 4XKVA 4R79A 3J7AY 1IRXA 3K4JA 1MMDA 3HKZA 2IS1A 3K70C 2JSPA 2LBFA 1G8XA 1MNEA 4XLCA 4IKFA 4E4HA 3HPGA 2VQHA 2Q1ZB 3OYKA 2WBMA 1U0JA 3HOTA 2R7SA 4RMNA 5TGTA 3QOEA 3HUGB 1PJRA 4N4NB 4HSTA 4C2UA 2LOOA 4EATA 2AQEA 2HQAA 1OR7C 3W3CA 2VLAA 4BJ5C 2RQQA 3OYBA 4ZDOA 2GOMA 1D0YA 3VYUB 3W2WA 4OAZA 4XMYA 2KL4A 2V6EA 3CESA 2KZVA 2X6WA 2QKMB 4ZDPA 4F52A 1WJFA 2KMUA 4ZC3A 2FUG2 4HG2A 1X1AA 1D0XA 1YX3A 3LSIA 3DPLC 4JOMA 4BGDA 1KONA 2CV1A 3PUBA 2IXSA 2HVRA 2PJRA 1OLTA 4E7IA 3N05A 3OR2C 1HA8A 4DIQA 2CMPA 4CH7A 1NG6A 1V5FA 1DQUA 2P0WA 1TT0A 1S9HA 2Z1DA 2WAEA 3RQ4A 1DP3A 1QU3A 4E7JA 1SFKA 3VSKA 3ZQQA 3DU6A 3MD2A 4KITB 4BE1A 3CJQB 4Y33A 3ZR8X 4ZJZA 2F4IA 3SEQA 2CV0A 2BVMA 3OS2A 4ZTJA 2R7XA 3VYSB 2L9NA 1TZLA 1T95A 3PNVA 3VWBA 4OWRB 3EUAA 4FASD 5LFAA 3OL4A 1Z21A 4XN0A 4C9YA 1UG0A 2HZDA 2XAUA 3M1CA 2VASA 2WB1A 2HPMA 4LIUA 4BQNA 2VQGA 3TMOA 4KJZA 3MMYB 4PFPA 4NC7A 2LBFB 3OYIA 1UAAA 4BE0A 4DOZA 3AL0B 1WJDA 1WJCA 2Z2SB 4XNFA 2OUMA 2LH9A 3VDXA 2R7QA 2BVLA 2V9KA 2L7KA 2HDWA 2I8DA 1N78A 2V26A 2K3PA 4CCNA 3K6GA 3S93A 3RPUD 3L2QA 2JUGA 3FBIB 3H5AA 3LSHA 3RTRA 3OYHA 1JI8A 4CUGA 3PJRA 4GRIA 2M3AA 3D5SC 3W2AA 2RNGA 3H9QA 4LITA 2OV7A 3DTKA 2LREA 3OYLA 2HVQA 2GOXB 3KX2A 2VPLA 2E5NA 1BOBA 5JHFA 2Q2EB 2XF5A 5KHDA 3EUHC 4X0GA 3SZGA 4HNUA 2R7VA 3BCBA 3H0DA 4HSRA 2MFZA 2KP6A 4D9JA 4XLEA 1X1BA 2KDOA 4RM3A 3OS0A 4MLOA 4E7KA 3PSFA 4B3XA 4XR6A 2KRHA 2E5ZA 2WADA 3CP2A 4J00A 5HVQC 2VKHA 3H9GA 1D1AA 1WJBA 4XOTA 2DXIA 4H4KC 1YX5A 3AL0C 2MC4A 3OYCA 2CUZA 2L5QA 4II2A 4PK4A 4XONA 1BR4A 2VXDA 3LMMA 3DQVC 3HC7A 3KEYA 4DBRA 1LDKB 2Y0SA 1P9QC 3CMMA 4F93B 2L2OA 3K4KA 2K9MA 4B43A 4LG3A 2DJIA 4BJ6C 3IAS2 2X1CA 4F92B 3A4CA 2R7TA 2M4GA 4XKCA 4HRIA 3BG7A 4CCOA 3D5RC 4AVZA 4PJNA 2KPMA 1FMWA 5FRMA 3PNYA 4PJLA 5CKTA 3OYAA 1Z7LA 3VSLA 2WAQA 1EA3A 4HPQA 3MKYB 3E0JB 1X4OA 2X51A 3HPHA 2BOLA 4C30A 1DGRM 2X85A 3DPTA 2VJ5A 2ZSHB 3UR3C 4BQOA 3EUKL 2WAFA 1Z3XA 1PYVA 4RLFA 2W7NA 3OY9A 4NNJA 1K6YA 4BE2A 4F55A 4PJJA 3CJRB 2X1DA 2LC2A 4AU7A 3DPUA 3OYNA 3HG9A 1BR1A 4DBQA 3H35A 1W36D 2R7UA 2M0MA 3NWTA 2CW7A 2HNHA 4KT6A 1FMVA 2NOJB 4E7LA 4BL0B 2KRCA 1Y56A 2XDVA 4DJAA 4ZTFA 4PSWA 2DOAA 2E60A 2AQFA 4JQFA 3PL8A 3OYEA 2UV1A 3AFHA 4B47A 3OWTA 2LRDA 3PNTA 2LY1A 4D1QA 4XLAA 4IX7A 5HOOA 4U87A 1X1DA 4ZYAA 1WJAA 2RREA 3AKZA 5KNLA 4BEHA 3I9V2 1D1CA 2VB6A 2DCEA 3ONQA 3K4NA 5CQGA 5HLTA 3K70D 3S3OA 2K9LA 2R4GA 1J09A 3M8JA 4AYBA 2WA0A 3PFYA 3FBNB 2VKDA 2W00A 2MABA 2CV2A 1WFXA 3H5NA 4HNTA 2X6YA 4C2TA 2ZFUA 4XQFA 3OYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVG A;  2WY8 Q;  2WY7 Q;  2JVH A;  2NOJ B;  2GOM A;  2GOX B;  3D5R C;  3D5S C; 
#chains in the Genus database with same CATH topology
 3FXL A;  4EVI A;  1Z67 A;  2COM A;  2Q8K A;  4RLQ A;  1XN7 A;  2R7W A;  4G6T B;  4L0Y B;  4ENN A;  5K7H A;  3K0L A;  4G6D A;  4PFO A;  5EGO A;  5ERI A;  5IOY A;  1QHG A;  2ETH A;  2M8E A;  5J4Y A;  1UFM A;  1YG2 A;  4V2F A;  2R7R A;  2EFW A;  1GV5 A;  1R5G A;  3KP4 A;  3IL2 A;  3MKZ A;  4IXA A;  1U9N A;  3OYF A;  2YU3 A;  1YW7 A;  2Y0S N;  1XTA A;  1OFC X;  2A3S A;  2KIU A;  3LL7 A;  1T33 A;  4RDU A;  3P7N A;  2ZC2 A;  4P5O A;  1FYM A;  2OD5 A;  1ETY A;  3O3K A;  4CCL A;  5J1U A;  2XAF A;  1OJL A;  3C2B A;  5DV5 A;  1B9N A;  3QPH A;  3LA2 A;  4UUS A;  3CP8 A;  2ZXH A;  3OR1 C;  5J1R A;  2P7C B;  2ZXW H;  3O6B B;  3B6C A;  2XSD C;  2K86 A;  3WTS C;  4XOR A;  4N4O B;  1JT6 A;  1O57 A;  2XV4 S;  3VYR B;  3QYF A;  4HF0 A;  1R58 A;  1S29 A;  4PJM A;  4WCG A;  1YE9 A;  2MYS A;  1ZYR F;  2MW8 A;  3CCQ I;  4IL6 C;  3DV8 A;  3RIR A;  2V1N A;  1TLH B;  1P7I A;  1T56 A;  2VJI A;  4M74 A;  3V8J A;  2XAJ A;  4QWQ A;  4BU2 A;  4DGW B;  1J2X A;  2R3S A;  1G59 A;  4A0Z A;  4OIN F;  3E6B A;  4CCM A;  3WTX C;  1IRG A;  4A3M J;  4XSX F;  5FRN A;  1TWF J;  5LHH A;  3ERE D;  2PFB A;  2WV0 A;  3DEE A;  1I6H J;  2F5C A;  4HZF A;  1J75 A;  4IQJ A;  1Z0X A;  4WK8 F;  4XID A;  4MQV A;  4BUP A;  1O3Q A;  4A3I J;  3E6M A;  4MQ9 F;  4OIQ F;  2KIM A;  4E7S A;  3F8M A;  4Y7N J;  3LST A;  1BJZ A;  2DFE A;  3GME A;  2NS7 A;  3OOU A;  4Q4Z F;  1JTY A;  3Q5F A;  2DFF A;  3J7Z I;  4EEF G;  3DTI A;  2DN0 A;  3QP6 A;  1X1C A;  1ERD A;  3DFG A;  4RA2 A;  3AAF A;  2JQ7 A;  1D1B A;  1DUX C;  1IXS B;  3FKJ A;  3I55 I;  4Q5S F;  1F1Z A;  3DKY A;  2YUS A;  1T0F C;  4MEX F;  2HZT A;  1HOM A;  4PUS A;  4HX4 A;  2F5F A;  2K5C A;  1UB9 A;  3K10 A;  4OAY A;  2XGC A;  1WVR A;  3FXQ A;  2GXB A;  1W5T A;  2LSO A;  3CLQ A;  2BHY A;  4FT8 A;  3ZQL A;  1XSX A;  3QYE A;  2P7V B;  3FK7 A;  2ZCW A;  3HTS B;  2K4B A;  2A5W A;  2PMU A;  3J81 Z;  3M4O J;  1Y8R B;  1BBY A;  2AO9 A;  4AID A;  4PCQ A;  3RCO A;  4IPA A;  5HS7 A;  3BY6 A;  3C7J A;  1NTC A;  2BEO A;  2UWM A;  2E19 A;  3HOX J;  3PO2 J;  1BM9 A;  4CZZ A;  2ELJ A;  4HBL A;  1JE8 A;  3P9I A;  2CFO A;  1RRJ A;  3IH2 A;  1XGN A;  5LBQ A;  3NWS A;  1YRN B;  3FXJ A;  1WCM J;  2ID6 A;  3JRH A;  4IO9 F;  1TWC J;  2C6Y A;  2LP0 A;  2ELK A;  3O8G A;  2R92 J;  5M3M J;  5FJ8 J;  4CSW A;  3L2V A;  3WU0 A;  3L2W A;  3HB9 A;  1HDD C;  2PMZ A;  2JA2 A;  1W36 C;  2QA4 I;  4Y4R A;  3CUO A;  3RKX A;  3OSG A;  3TDZ C;  1MJB A;  3W6V A;  1JKR C;  2E7W A;  3UNG C;  1K4T A;  3IKV A;  1D5Y A;  2KJB A;  1S8N A;  1IRF A;  2IRF G;  1O3T A;  2XGX A;  2AXT C;  2HYG D;  1T39 A;  4KDP A;  4P9U A;  4RAY A;  3HM5 A;  3U21 A;  2A6E F;  1RKT A;  2E2J J;  3W6J B;  3KP5 A;  2ISY A;  1WJE A;  2CS3 A;  2VI6 A;  3P9C A;  2R5Y B;  4M72 A;  2R5Z A;  3S3M A;  2PJR B;  2Y9Y A;  1QGP A;  2V7F A;  4DYC A;  1OKR A;  2IP2 A;  4HQE A;  4R79 A;  3J7A Y;  2ZXJ A;  1FP1 D;  3ZQG A;  1AKH B;  4EQQ A;  1SFE A;  2JT1 A;  1WRJ A;  2GQQ A;  3G4S I;  4IKF A;  3GLL A;  5BQT A;  3D0S A;  3VEP A;  3FMS A;  2QEX I;  2WBM A;  3PIP F;  3IC7 A;  4RMN A;  4U7D A;  3QOE A;  2L7Z A;  3MZ8 A;  1JUS A;  1PJR A;  4RGS A;  1D3Y A;  3BRO A;  3GFJ A;  2UXN A;  4EAT A;  1OR7 C;  2CWE A;  1S5L C;  1B6A A;  1WH7 A;  3OYB A;  1FOY A;  2GOM A;  1ETO A;  5D8L B;  5E8I A;  2ZFW A;  5BPI A;  1YTY A;  3VYU B;  4L9J A;  3W2W A;  4OAZ A;  4XMY A;  1HQC A;  1RI7 A;  3CMA I;  2VC1 A;  2X4H A;  3DXJ F;  2O61 A;  2WWY A;  4A3D J;  2QKM B;  5LGT A;  2XKP A;  1WJF A;  2CSO A;  2KMU A;  4FE7 A;  3CCY A;  3G3Z A;  2NRA C;  1TC3 C;  2BGC A;  1X1A A;  4M3D A;  3QRF F;  1LFB A;  4M3F A;  2JRT A;  3GTM J;  3X2Q H;  4XLN F;  2DI3 A;  3DCF A;  2PBI A;  5LLQ A;  1KON A;  1ZRF A;  3GTP J;  3CCR I;  2HVR A;  1IV6 A;  2HEO A;  3A02 A;  2P8T A;  2CMP A;  3ZMT A;  3CCJ I;  1NG6 A;  2CYY A;  2P0W A;  3Q0U A;  2DA2 A;  1Y39 A;  1ULY A;  1ETX A;  2EA2 A;  2WAE A;  1TQI A;  5TIS C;  3IV5 A;  3VSK A;  5B1B H;  4QIW N;  3GTG J;  2DMN A;  3KP3 A;  4HV6 A;  2HOS A;  4F7Z A;  2QVO A;  2ZBK A;  3ZR8 X;  3SEQ A;  3ZMU A;  1RZ4 A;  3H0G J;  3OS2 A;  2X9D A;  1I3A A;  4QTR A;  3E5Q A;  3HUG A;  2H6B A;  3U9G A;  2BZT A;  3H1C A;  4CYC A;  2V79 A;  1MSF C;  4EJO A;  3ZMS A;  2M8G X;  4OWR B;  3EUA A;  4D5F A;  2B9S A;  1B72 A;  4FAS D;  1LNW A;  3L9F A;  1ETK A;  2FA5 A;  3RYP A;  2D1V A;  3ECH A;  2ZJQ F;  1UG0 A;  3JRI A;  1FOK A;  2HZD A;  2ZME B;  3JTH A;  4DZP A;  4LIU A;  4BQN A;  2K3F A;  2V9P A;  3K7A J;  4BE0 A;  2F5E A;  3AL0 B;  4M9X A;  5A2Q Z;  1XB4 A;  2Z2S B;  4XNF A;  2LH9 A;  5M5Y J;  3HOW J;  1B59 A;  1V54 H;  4MNU A;  3WE3 A;  5FKN A;  2ESN A;  2V26 A;  1N78 A;  4NDL A;  3ASN H;  5EDN A;  1OYY A;  3S1N J;  1C0W A;  3RPU D;  3L2Q A;  2ZKZ A;  3RTR A;  2EIL H;  4KUM A;  2VN2 A;  1JI8 A;  3PJR A;  2M3A A;  3D5S C;  2OU2 A;  4G9Y A;  1FEX A;  2FNP A;  4DYQ A;  2DOF A;  4ZH4 F;  2H27 A;  1RC9 A;  1BI0 A;  5IYC J;  4S04 A;  2PMH A;  1BOB A;  2R93 J;  4B3A A;  5KHD A;  4LD5 A;  2K9Q A;  3SZG A;  5J8F A;  3EUH A;  3LAJ A;  4KA4 A;  2HOT A;  3ZOB A;  2QCO A;  5ED4 A;  5C3E J;  1FTZ A;  1S6L A;  2MFZ A;  2QF7 A;  4D9J A;  4XLE A;  2P81 A;  5E3L A;  3IRR A;  1UHM A;  2O8X A;  3LA7 A;  1T08 B;  4IHS A;  2DA7 A;  3GX4 X;  1AU7 A;  5EZH A;  2RQP A;  3PSF A;  1PUE E;  1JJ6 C;  2FNA A;  4DW6 A;  2DOD A;  2LY9 A;  2WAD A;  5LHG A;  2VKH A;  5CYV A;  1WPK A;  3H9G A;  2QSG X;  4Y52 J;  5ILS A;  1UHS A;  1FPQ A;  3QAH A;  4X1E A;  4PK4 A;  3G1O A;  2VXD A;  4KIC A;  3SFZ A;  4IHY A;  4MHG A;  2KDZ A;  2ZNZ A;  4DBR A;  4P55 A;  2Y0S A;  1P9Q C;  1RET A;  1VQ8 I;  3S14 J;  1X3W B;  2L2O A;  3QU3 A;  2VUM J;  3Q0V A;  3WE2 A;  1ZLK A;  3RPQ A;  4BJ6 C;  3IAS 2;  3KCC A;  1RUN A;  2R7T A;  4DNC A;  1BN5 A;  4HOB A;  1MJA A;  4XKC A;  4CCO A;  1LEA A;  3WU1 B;  5FLM J;  2RV8 A;  2DAO A;  2CUE A;  2GAU A;  3ECO A;  4PJL A;  2YS9 A;  3OYA A;  2CRG A;  3TO7 A;  4KN4 X;  3KP2 A;  1KQ0 A;  1HST A;  5IY5 H;  1K78 B;  4RB1 A;  2AHQ A;  4EM0 B;  4WXH A;  3E0J B;  1X4O A;  2X51 A;  1I1S A;  5FGM A;  3HDD A;  3BWG A;  2MBF A;  1G4D A;  2EIM H;  3UR3 C;  2EZL A;  4BQO A;  2WAF A;  1S72 I;  4RLF A;  1T2K A;  3JW4 A;  5FKL A;  4I0A A;  2BY3 A;  2LNB A;  4MGR A;  3LSP A;  1MNM C;  4PJJ A;  1TT5 B;  2LC2 A;  5E3O A;  2XAQ A;  1KYZ A;  4GCV A;  1QZE A;  2DOE A;  3FKI J;  2J5P A;  3G6E I;  1S7E A;  3H35 A;  4DBQ A;  2R7U A;  4OIO F;  5TRD A;  3P9K A;  4OIP F;  3TO6 A;  1FMV A;  4E7L A;  4BL0 B;  2X48 A;  2LF8 A;  1LQ1 A;  4IF4 A;  4ZTF A;  1JKO C;  3S2W A;  2EJR A;  2VPR A;  4UVB A;  3CD6 I;  4L18 B;  2HYJ A;  3PL8 A;  4B47 A;  4I98 B;  1XS9 A;  2LY1 A;  3ZMV A;  4J19 A;  4ENK A;  3L7W A;  3H92 A;  4L0Z B;  1X1D A;  1WJA A;  1ZG5 A;  2RDP A;  5BS6 A;  3AKZ A;  1JKP C;  5K5O A;  5GTH C;  3TOA A;  2FBI A;  2VB6 A;  3A0B C;  1SC7 A;  3ONQ A;  3CUQ A;  5E18 F;  3HOV J;  3J81 K;  3M8J A;  3Q9S A;  5F04 A;  3CCS I;  1JGG A;  3V8L A;  2ESH A;  4BHB A;  4BBS J;  4D7M A;  1NK3 P;  3GEZ A;  3MAJ A;  4K2E A;  2HXO A;  4I2O A;  1WFX A;  3H5N A;  3R0J A;  2X0L A;  4BAY A;  3HIF A;  3KFW X;  4XQF A;  3DWL E;  1GLN A;  2EBI A;  2YX4 A;  4IRI A;  2X1E A;  5M3F J;  4B4C A;  3RZO J;  2IS2 A;  3BC8 A;  3WTZ A;  2QQ8 A;  2DQL A;  5GTI C;  1ZR2 A;  1Z91 A;  4PSX A;  2O3F A;  3WTW C;  3BJ6 A;  1NHA A;  2GLO A;  2DDA A;  4CCJ A;  1IDZ A;  4U0Y A;  3L00 A;  1FOW A;  3JRA A;  3ZQF A;  3WGI A;  1K83 J;  1SMY F;  5IYB J;  3BG5 A;  4HX7 A;  1Z3Y A;  2L9S A;  2HDD A;  3K4B A;  3BG6 A;  4IRG A;  1Q1V A;  3CC7 I;  1OCZ H;  3ZQH A;  2R7O A;  2LKS A;  4P96 A;  5E1Z B;  1ZRC A;  1MMG A;  1N25 A;  2HPI A;  2PN6 A;  4UY8 I;  1WJ5 A;  2CQK A;  3B73 A;  2FBK A;  1IXC A;  2XGD A;  1Y8Q B;  2NVX J;  1P92 A;  3OIO A;  4Y3O A;  3LNQ A;  4JX6 A;  1J7K A;  1IXR C;  2H1L A;  4CO8 A;  3T1B A;  5HS8 A;  4BQA A;  3TDU C;  2AS5 F;  2QQA A;  4U0V A;  1KU9 A;  1SMT A;  4YG2 F;  3GFI A;  1RUO A;  3F22 A;  4XRS A;  2JN6 A;  1ZGW A;  1TTY A;  2FBH A;  5D6E A;  3OL3 A;  3TGN A;  4I09 A;  4G6Q A;  2MSY A;  1LDJ A;  4UVA A;  4IOC F;  2Y31 A;  3I0T A;  5F0H A;  4ZDL A;  3SDB A;  1ZG1 A;  1U5T A;  3OS1 A;  1YRN A;  2DA3 A;  2H1K A;  4AIK A;  1OCR H;  2LKP A;  3GTK J;  2IS6 A;  1VQM I;  6PAX A;  2E71 A;  2ELH A;  4E70 A;  4ESB A;  3C2G A;  2Z16 A;  3BJO A;  3OYD A;  4HW0 A;  1X2N A;  3FM5 A;  2P5K A;  4ZYE A;  3WU2 C;  4EJV A;  3A03 A;  1TL8 A;  1ZEL A;  2L9V A;  2K7L A;  3KYC B;  5E8G A;  5JFR A;  2P6T A;  4XRS G;  3G2B A;  1Y1W J;  1YJW I;  1E3O C;  1X3Z B;  4FIS A;  5KAF C;  3K4C A;  4ENJ A;  2Y48 A;  1X19 A;  4LB6 B;  3JR9 A;  1DP7 P;  4BJT A;  2CU7 A;  5F6F A;  5E79 C;  3OYJ A;  1IUY A;  2XSJ C;  4CA0 A;  2VIX A;  4XLP F;  2BV6 A;  4S0H B;  1ZQ3 P;  1BR2 A;  1UEL B;  2DW4 A;  2OPT A;  4EV0 A;  3JSO A;  3ZXS A;  2R5Y A;  3F8N A;  4XK4 A;  4AYB N;  3V42 A;  1JUP A;  3R0A A;  4GO1 A;  3BQZ A;  1AKH A;  2OC6 A;  1GXP A;  5EJC A;  3SZP A;  3OYM A;  3RSN A;  1RIO H;  2M30 A;  1R22 A;  1U2W A;  3PSI A;  2EZH A;  4FCY A;  2M4K A;  1IW7 F;  4M3B A;  4D7N A;  1RR7 A;  3HRT A;  4I76 A;  2VE8 A;  2Y9Z A;  3WTY C;  3L2U A;  4IQ4 A;  1PP8 F;  4WX9 A;  4E7Z A;  4M3G A;  2Y0M A;  1E0E A;  4WWC A;  2LY2 A;  2IGM A;  1O7F A;  5KAI C;  2W82 A;  2ICW G;  2VOO A;  1Z05 A;  1ZK8 A;  2DDB A;  1MMA A;  5DUI A;  2IS4 A;  1R1U A;  2E1M C;  5J47 A;  3BJA A;  2CFX A;  5E20 A;  3GFM A;  1MDM B;  4ZYG A;  1JTX A;  4ESJ A;  3JRF A;  3HOS A;  3SEZ A;  3E6D A;  3S1M J;  2CW8 A;  2BW3 A;  3A1Y A;  2F5V A;  3E1S A;  5A2Q K;  1R6R A;  3OIQ A;  3KLN A;  1V5G A;  4X6A J;  2X6X A;  4KMU X;  1LE8 A;  1WQ2 A;  3DTE A;  4M3E A;  2D5V A;  3EYY A;  2O5R A;  3KYD B;  1ITY A;  1QZZ A;  4QPQ A;  4AD9 A;  1TQP A;  4U7B A;  1K4S A;  3IUO A;  3BP8 A;  1IJW C;  1TBX A;  3FHN A;  4BQQ A;  3CMY A;  4A3G J;  3DU5 A;  1QPI A;  1XD7 A;  3S2H J;  1BIA A;  1DDN A;  2NS0 A;  1YJ9 I;  3ABL H;  5C4J J;  3D5L A;  2Q0O A;  1H9G A;  3DKW A;  2IA2 A;  5K7F A;  1SFX A;  1AA7 A;  2ACJ A;  3EDP A;  3TBI A;  3GBG A;  1MH4 A;  4M9S A;  4CIC A;  3HYI A;  2HQR A;  2ZB9 A;  2Z5U A;  1SAU A;  3FZV A;  5K1Y A;  1QHH D;  4ANJ A;  4A3J J;  3ZPL A;  5L3D A;  1XG1 A;  2QEN A;  5FKK A;  4B48 A;  3KPH A;  4XKV A;  1J9I A;  2ZME A;  1Z6T A;  5GAH J;  1VQP I;  1K7A A;  1ZGJ A;  1CF7 A;  2BY0 A;  1HKT A;  2LLK A;  3VOE A;  2JSP A;  3SHF A;  4WXD A;  1JKQ C;  1H0M A;  5E17 F;  1MNE A;  2OJE D;  4ON0 A;  4E4H A;  2VQH A;  1YIT I;  4AIH A;  5J4V A;  3HOT A;  1ZLJ A;  1H9T A;  2RN7 A;  1M1E B;  4M6V A;  1U8R A;  3LQQ A;  4HST A;  3PQK A;  4A3F J;  1EJ9 A;  2H6C A;  1IN4 A;  2HQA A;  5LRS A;  1RKW A;  1SVL A;  1HW5 A;  3FXR A;  1D5V A;  2NNN A;  3ZQI A;  3V7S A;  5BPD A;  2KL4 A;  1IC8 A;  2V6E A;  3CES A;  2HQN A;  2EV0 A;  4YFK F;  4ZDP A;  3RPU A;  3N4M A;  1BW6 A;  2FUG 2;  1W1W E;  5JI6 A;  2FJ1 A;  3FF5 A;  2DPU A;  3LSI A;  1B1B A;  3MFK A;  1BI3 A;  1V55 H;  1VF9 A;  3CO7 C;  2CV1 A;  2Z3Y A;  5FD5 A;  2F48 A;  2BXY A;  1OLT A;  3HHG A;  1LJ9 A;  3OR2 C;  2LD5 A;  2VBX A;  2XUB A;  4DIQ A;  1HA8 A;  4CH7 A;  1V5F A;  2W57 A;  1DQU A;  1TT0 A;  2ADU A;  5HS9 A;  2BBY A;  4JX5 A;  5HDN A;  2OF7 A;  4ETS A;  2BE5 F;  2EIJ H;  5H2F C;  1RR8 C;  2EFQ A;  3LWF A;  3CJQ B;  3BTJ A;  1VQL I;  2OQG A;  1JXS A;  4BXU A;  2JA5 J;  4TV7 A;  1P4W A;  2GWR A;  1FYL A;  1XMA A;  3VYS B;  3BR6 A;  2L9N A;  2KFD A;  1YS6 A;  1TZL A;  2QZ8 A;  1YQA A;  3PUF A;  5LGU A;  3FHZ A;  3VWB A;  1DPU A;  3WTT C;  2RNJ A;  3K1M A;  4XN0 A;  3B6A A;  4RGX A;  3EQL F;  4M6X A;  3WGG A;  4C9Y A;  2XAU A;  4M71 A;  3M1C A;  4HLX A;  3ML6 A;  2HPM A;  2JUC A;  4KJZ A;  3MMY B;  1JUM A;  3TKY A;  4NC7 A;  2LBF B;  1Y1V J;  2UXX A;  5B66 C;  3KET A;  1HKQ A;  3V7R A;  2STT A;  1I39 A;  1WJD A;  1K78 A;  4I0B A;  3M9A A;  2R7Q A;  1H88 C;  5DCF A;  5EG0 B;  2I8D A;  4BNC A;  3H5A A;  3IH3 A;  5J1Y A;  4GRI A;  3IKT A;  2K27 A;  3HBL A;  1R9T J;  1FNN A;  3QU6 A;  3H9Q A;  3OYL A;  2OV7 A;  3DTK A;  5D4R A;  2F5D A;  2HVQ A;  2GOX B;  2L7F P;  3KE2 A;  1X58 A;  2KRF A;  3H3U A;  2QQ9 A;  3EUH C;  1HW2 A;  2R7V A;  3GWZ A;  1SFO J;  2OCC H;  4ZZL A;  2KP6 A;  2GZW A;  1X1B A;  2KDO A;  1IZ1 A;  1NK2 P;  1IV8 A;  2DQR A;  1VQK I;  3OS0 A;  2QUF A;  4MLO A;  4BYY A;  2RVC A;  1FOX A;  2FXA A;  3M07 A;  4IJA A;  1P4X A;  2XB0 X;  1E3H A;  4XR6 A;  1GVJ A;  3CP2 A;  2E5Z A;  4J00 A;  5HVQ C;  2E2I J;  3HOU J;  1QA6 A;  2R7F A;  4R1H A;  2QWW A;  1H8A C;  3DQV C;  1FY7 A;  1V3F A;  3BOQ A;  1IGN A;  1BW5 A;  4KMF A;  2OQR A;  4LG3 A;  2GXA A;  1VQ9 I;  5E3N A;  3SFI A;  3A4C A;  3J80 Z;  1Z9C A;  2UZK A;  4IOA F;  2JPC A;  1ACI A;  4HF1 A;  4HRI A;  4B09 A;  2D45 A;  1TWH J;  1QVU A;  2W48 A;  2IAI A;  2MG4 A;  4RB3 C;  1BI1 A;  3W6K B;  1FMW A;  5ILU A;  3PNY A;  4LLG F;  4BHC A;  1Z7L A;  2OTJ I;  3RJP A;  3CDH A;  4I01 A;  3BTC A;  3IWF A;  5HDK A;  3MKY B;  1ZKG A;  3DLL F;  4M73 A;  1TW2 A;  3HTU A;  5F1R A;  5D5V B;  3OOP A;  2CQQ A;  5E3M A;  2X85 A;  3HGY A;  2ZSH B;  2HXI A;  3OV8 A;  1Z3X A;  3COA C;  5FKM A;  2W7N A;  3OY9 A;  3ZQC A;  1QRY A;  2PG4 A;  1UG2 A;  4I02 A;  4KIG A;  5HLH A;  1G3T A;  5D5W B;  5DM7 F;  4ZYD A;  3JRC A;  4UV9 A;  2HDC A;  1TWG J;  3KLO A;  2WB1 N;  2DK8 A;  3KZI C;  3R61 A;  4UV8 A;  4AU7 A;  3DPU A;  2E2H J;  5DD8 A;  1V4R A;  3HG9 A;  1KQ9 A;  1ODD A;  1PUF B;  3NWT A;  2CW7 A;  3KEO A;  2COB A;  2HNH A;  1MIJ A;  2KZG A;  4D5C A;  3J7A O;  1BC8 C;  3GTL J;  1VFC A;  2DA1 A;  2KRC A;  5JVG F;  2DMU A;  4DJA A;  2E60 A;  1FIP A;  1MBG A;  4JQF A;  1OCO H;  1T0F A;  2EIN H;  4MTE A;  4D0P A;  1LB2 A;  2AXL A;  1SD4 A;  2CO5 A;  2LRD A;  4RGU A;  4A2U A;  3JTG A;  3F6V A;  4Z2Y A;  4D1Q A;  2PEX A;  3MQ0 A;  4XLA A;  5C4X J;  5GPC A;  2A69 F;  2FEZ A;  3RKY A;  1Y0N A;  2CUF A;  4Y17 A;  3SDG A;  5D6F A;  2HOA A;  3GZN B;  4IHV A;  4ENM A;  3RKQ A;  3CUQ C;  4AIJ A;  2QSH X;  3FXO A;  2RC4 A;  5CQG A;  3S3O A;  1R5I D;  4AYB A;  5B5E C;  1SVO A;  1R7J A;  2WA0 A;  3GUD A;  3PFY A;  3FBN B;  1GT0 C;  2MAB A;  3FMQ A;  1UCR A;  1FSH A;  1BA5 A;  1IO2 A;  3B02 A;  5HDG A;  4HNT A;  2QLZ A;  2LFB A;  1W7P A;  3OYH A;  1T8I A;  3WTV C;  3ABK H;  4BDY A;  2EFP A;  4L9T A;  1KU2 A;  3SXY A;  4ITV A;  5CQE A;  1B8I B;  1IDY A;  4HDV A;  4YEJ A;  1W0U A;  2VJJ A;  4Q47 A;  1LEB A;  2NVU B;  2N8G A;  4RBO A;  5K7Z A;  4HLY A;  1YJN I;  3ZGK A;  2IVM A;  3JRB A;  2NAZ A;  3CDI A;  2VQC A;  4QLC U;  4NQW B;  3BTL A;  2JJ7 A;  2W25 A;  3KZY A;  3T8T A;  2IGN A;  1BOA A;  1S7O A;  2I10 A;  2H8R A;  5HNH A;  1ZTR A;  2NXN B;  3NEU A;  5ICG A;  3WHC A;  5JVT A;  3F21 A;  2YPR A;  2L4M A;  2VE9 A;  3CF2 A;  4HF2 A;  2EA4 A;  1GDT A;  4O5V A;  5FKO A;  4O6J A;  1HDP A;  4BAC A;  5DD4 A;  4LLL A;  3RQI A;  1XMX A;  1SAX A;  2XVC A;  5F64 A;  2IA1 A;  1POG A;  2JA6 J;  1XGO A;  2W1O A;  4E7H A;  2WAQ N;  3KYL A;  2ID3 A;  4ZYH A;  3AG2 H;  2CQN A;  1FIA A;  2HU9 A;  2ZJ2 A;  1KU3 A;  4N9I A;  3M1E A;  1MDM A;  2FQ3 A;  1YI2 I;  4DZJ A;  3M8E A;  1U5T C;  3OIP A;  2IGO A;  4B44 A;  1USS A;  1X4P A;  3ZRG A;  3GO5 A;  1Z6R A;  1MW7 A;  4XN3 A;  4II3 A;  5IOZ A;  5F1J A;  4BEH B;  2CUJ A;  1R49 A;  1Z1D A;  4GDF A;  3MKL A;  4GXO A;  5CJ9 A;  5JLX A;  4AUX A;  1OCT C;  2EQR A;  3VYT B;  1GHC A;  5IP6 A;  3S3N A;  2OZU A;  1OR7 A;  4BDZ A;  2F6C A;  2DK5 A;  4PJ0 C;  5EEA A;  1Y0U A;  4KYW A;  4GGG A;  2E34 A;  4CCK A;  1HCR A;  1E3P A;  5LHI A;  3A0H C;  2CH0 A;  3ZQ7 A;  3C1D A;  2WY7 Q;  1TNT A;  2E1M B;  1OCP A;  3F9K A;  3LFK A;  2BYV E;  2LKX A;  5D4S A;  3CF5 F;  5EEH A;  4I6Z A;  1IF1 A;  2EPF A;  2DYR H;  5DUK A;  4JYK A;  2ZSI B;  1FBQ A;  2KQR A;  3FK6 A;  4E6K G;  2GIV A;  5HNF A;  1G6N A;  2GBY A;  1GV2 A;  2JPB A;  1B4A A;  2HYF A;  2MLK A;  2O03 A;  2B63 J;  3DEU A;  5DS9 A;  1ZN2 A;  2XF6 A;  3CZ6 A;  2OA4 A;  2GA2 A;  5HLI A;  2KJC A;  4OMY A;  3DLA A;  4YII A;  4DQ2 A;  4LIV A;  2VOD A;  4RS8 A;  2JK3 A;  3GTO J;  1BJA A;  3AG1 H;  1XDU A;  3IAM 2;  1B9M A;  2IGK A;  1IAW A;  1IUF A;  2A5Y B;  3PM1 A;  1YHQ I;  4XOP A;  3S8P A;  4C3I J;  4CXF A;  1AHD P;  4WF2 A;  3EPZ A;  4Z6Y A;  2DT6 A;  2XF7 A;  2ECB A;  1L3L A;  3EYI A;  1ON2 A;  5DM6 F;  3CCV I;  2MD0 A;  2Z33 A;  3LFU A;  1XGS A;  1QVT A;  1DGW Y;  4GYI A;  5KVR A;  1T98 A;  2MC3 A;  1EH6 A;  1X2M A;  4QPO A;  4F3Q A;  4Y13 A;  3CLO A;  1VQ4 I;  1D8J A;  3CJN A;  1IN8 A;  3I3L A;  3HRM A;  1LFP A;  2M7A A;  3RI4 A;  1SAN A;  4C3J J;  1UST A;  2CG4 A;  2XAG A;  2M2E A;  3FIS A;  2A61 A;  1W4M A;  3BPV A;  3C2H A;  2JTV A;  4CYD A;  2BHZ A;  5FRO A;  2VL8 A;  3OSF A;  1GUU A;  1HLV A;  1XCB A;  5GAD J;  1U3E M;  2DO7 A;  1R00 A;  1FBS A;  1N77 A;  2G7U A;  2KIQ A;  3F0C A;  2JVG A;  2HS5 A;  3ZCO A;  1V5E A;  2JZY A;  1D0Z A;  3I64 A;  3LSK A;  5BNG A;  1Z7U A;  1RPW A;  2FF4 A;  2XAS A;  3TOB A;  1KA8 A;  3PFI A;  4FE4 A;  2QBY B;  2LG4 A;  1H89 C;  3GVA A;  2LK2 A;  4HEA 2;  2E1C A;  5DTD A;  2VQL A;  1IRZ A;  5L3E A;  1CGP A;  1MD0 A;  2E36 A;  1IN6 A;  5LEK A;  3CCE I;  3H9J A;  4L5J A;  1ZR4 A;  4ASN A;  3GW2 A;  4LK1 F;  4YRV A;  1A35 A;  5J40 A;  1LVK A;  1Y6I A;  1ENH A;  1QZY A;  3DF8 A;  3CCL I;  2ZNY A;  3LQR A;  4IZZ A;  3ULQ B;  3HOZ J;  2V6C A;  2RGV A;  1TQM A;  4AVP A;  5CLS A;  1FSE A;  2JRM A;  2FSW A;  1R1V A;  4IHX A;  5HOD A;  2LBF A;  1G8X A;  5J8C A;  3K69 A;  2FD5 A;  3F8C A;  1DU6 A;  2VT2 A;  1VQN I;  4JBA A;  1S3J A;  4BY1 J;  2Q1Z B;  2WTE A;  1SEU A;  1U0J A;  3GZ5 A;  3IHU A;  5TGT A;  3KP7 A;  3VB2 A;  3HUG B;  2XPU A;  4C2U A;  5FLX Z;  1HC8 A;  2DA6 A;  2JSC A;  3H36 A;  1R36 A;  4BY7 J;  2J5O A;  2RQQ A;  1R1T A;  4ZDO A;  3J80 K;  3QQA A;  1B72 B;  2IJL A;  2BY1 A;  1Z77 A;  1VTN C;  1HW1 A;  2DT5 A;  2IA0 A;  1OYI A;  2KZV A;  2NVY J;  4F52 A;  4ZC3 A;  1TW3 A;  5H6R A;  1D0X A;  1YX3 A;  3ASO H;  5L3G A;  5LGN A;  1A36 A;  1F43 A;  3DPL C;  3HZJ A;  4JOM A;  4BGD A;  1STZ A;  2YU9 J;  3I56 I;  1LVA A;  1ORK A;  2PJR A;  4E7I A;  1R5H A;  5FFZ A;  3T5X A;  5IT9 Z;  4FQG A;  1WKM A;  3BQY A;  3G73 A;  2K85 A;  3LA3 A;  1S9H A;  2Z1D A;  2DMT A;  4RAF A;  3K1P A;  3RQ4 A;  1QU3 A;  4XRF A;  3ZQQ A;  2A05 A;  2Z9O A;  2HI3 A;  4Y33 A;  3R60 A;  4ZJZ A;  2F4I A;  2CV0 A;  4BHP A;  1FX7 A;  4YIR X;  3JCU C;  2JMW A;  5GAG J;  3QOP A;  4L5I A;  4M6Y A;  2VBZ A;  4W97 A;  5FB2 A;  1T95 A;  5J6X A;  2PI0 A;  1MJ9 A;  2DU9 A;  1XSD A;  2EZI A;  2I5U A;  3CO6 C;  3M8F A;  2RKH A;  3BR2 A;  1X1P A;  1FT9 A;  1OCC H;  2VOP A;  2A68 F;  2FOK A;  2VAS A;  2WB1 A;  1FZP B;  3TMO A;  3N97 A;  1IG7 A;  3RYR A;  3OYI A;  4G94 A;  1ZRD A;  2D1H A;  2K40 A;  2ZJP F;  4LG0 B;  5DEQ A;  1UHW A;  1WJC A;  4OIR F;  3GYH X;  4YFN F;  2OUM A;  3G71 I;  3I4M J;  5B3S H;  3VDX A;  5JR3 A;  1R23 A;  2BVL A;  1JHF A;  2G0E A;  2M9H A;  2HDW A;  2O9L A;  5IYD J;  3K6G A;  1P7J A;  3LSH A;  4CUG A;  3A01 B;  2GXG A;  3AG4 H;  3G1M A;  2QSF X;  1HSJ A;  1MH3 A;  3PO3 J;  1XCV A;  3ZN1 A;  2LRE A;  2MD5 A;  3HKZ N;  5IT3 A;  5L3F A;  4G8X A;  3TO9 A;  4JX4 A;  3JAM Z;  3HRS A;  1TNS A;  5BMZ A;  4C2M J;  1S7A A;  2HTJ A;  1PUF A;  1GXQ A;  2Q2E B;  2XF5 A;  4X0G A;  4LFU A;  3BCB A;  4UB6 C;  3BR3 A;  2EFN A;  3H0D A;  2NNY A;  4YFX F;  3DEW A;  4Y15 A;  1XDS A;  3MN2 A;  4C3H J;  3HSF A;  4RM3 A;  2LTP A;  3E7L A;  1MBK A;  1A5J A;  1EF4 A;  3IRQ A;  5ILV A;  2L9R A;  4EGY A;  5L3B A;  1WZ2 A;  1DPR A;  3FIW A;  1JT0 A;  2DFH A;  1QBJ A;  4IRH A;  1D1A A;  4BH9 A;  2DXI A;  3K9T A;  1PVE A;  3Q0W A;  1G3Y A;  2CUZ A;  3M3Y J;  4II2 A;  1VI0 A;  3F72 A;  3QP5 A;  1KZH A;  3LMM A;  1FC3 A;  2HKO A;  3HC7 A;  1LDK B;  3WG7 H;  4OMZ A;  4LOC A;  3F23 A;  2NS8 A;  4F93 B;  3K4K A;  4N0B A;  2A07 F;  2K9M A;  4G12 A;  2NOG A;  4B43 A;  2DJI A;  2D2W A;  2X1C A;  4F92 B;  2V1X A;  2V1D A;  2OAZ A;  2M4G A;  3DBR B;  1UJ8 A;  1YS7 A;  3HRU A;  3TP3 A;  1B8I A;  3D5R C;  4AVZ A;  1MBE A;  4PJN A;  5ICF A;  4O3M A;  4R8H A;  1IN5 A;  5LRR A;  2VBY A;  2WAQ A;  1EA3 A;  3CUQ B;  5FD6 A;  1EV7 A;  2P5V A;  4HPQ A;  5D5U B;  5AIP A;  1G2H A;  4NQW A;  5CVI A;  2EIK H;  2V1U A;  2BOL A;  5DCM B;  2M1B A;  5H20 A;  3ISP A;  4C30 A;  1VQ7 I;  5CVV A;  1W0T A;  1SD7 A;  1I27 A;  3I59 B;  1PYV A;  1O4X A;  3GXO A;  2ISZ A;  4NNJ A;  1PDN C;  3KEQ A;  1EKE A;  3BG3 A;  4F55 A;  3S2D J;  3CJR B;  4KIF A;  2PLY A;  4A93 J;  3OYN A;  1XC5 A;  3F3X A;  1REP C;  2FX0 A;  4RB2 C;  4V19 K;  2E35 A;  2M0M A;  1XSV A;  5IP9 J;  1WHU A;  4KT6 A;  2NOJ B;  1OMI A;  3FXK A;  1MKM A;  1MMS A;  2XPV A;  4PSW A;  3P5J A;  3BR1 A;  3OYE A;  2UV1 A;  3AFH A;  1J5Y A;  2OCE A;  3PNT A;  3I4P A;  1FTT A;  4FHT A;  1K79 A;  1A6Q A;  3MEX A;  2MH9 A;  2VT3 A;  4IX7 A;  2L0K A;  5HOO A;  1WSU A;  2P4W A;  4ZYA A;  2RRE A;  5H6Q A;  1WI3 A;  3O2P E;  1LFU P;  4BEH A;  3I9V 2;  2L4A A;  4JP0 A;  3PIO F;  2JWT A;  3F8B A;  2CQX A;  3K4N A;  3K70 D;  5HLT A;  1ZRE A;  3I4N J;  2K9L A;  2R4G A;  1J09 A;  1FBU A;  1JHH A;  5K5Q A;  2HQ5 A;  2VKD A;  2W00 A;  3HGG A;  3TED A;  5AIQ A;  1F36 A;  3S16 J;  2DFI A;  1ZGA A;  2H8W A;  2X6Y A;  4HV5 A;  4L9V A;  1SD6 A;  4C2T A;  2CGP A;  2ZFU A;  2L3D A;  3OYG A;  3TL4 X;  2ZJR F;  5LD2 C;  4I99 C;  5HLG A;  5TJJ A;  5EF6 A;  1MND A;  2M7B A;  1U5T B;  2R7Z J;  4KT5 C;  1FWZ A;  2DPD A;  5FFX A;  2NVQ J;  3EET A;  1JGS A;  2EK5 A;  2ZXI A;  3KP6 A;  2XKO A;  2PJP A;  3HHH A;  4IVN A;  1U6G A;  2QKL B;  2JVH A;  3S15 J;  2LR8 A;  3SYT A;  3IP4 B;  3TP0 A;  3MKW B;  2LYC A;  1QQI A;  1NG7 A;  3HL2 A;  1IN7 A;  3BT9 A;  2H09 A;  3K2Z A;  4HA8 A;  5KCM A;  1PP7 U;  4AC0 A;  2XHK A;  1WGX A;  3A2K A;  3HOY J;  5EEG A;  2EZK A;  5K5R A;  1KU7 A;  4MO7 A;  3QOD A;  4KIS A;  2E7X A;  3LSM A;  4YIF A;  4F91 B;  2XC7 A;  4NC8 A;  3BPX A;  3L2R A;  3MZH A;  3DKX A;  1RES A;  3D1N I;  2CQ7 A;  2O7O A;  2VJ4 A;  3O8H A;  4XLH A;  1HBX G;  3CC4 I;  2EFO A;  3TW7 A;  5EYR A;  3QPT A;  4BS9 A;  4FET A;  1YFH A;  2E1O A;  2Y69 H;  2MA3 A;  4EJU A;  2JA7 J;  2XAH A;  3OMY A;  3ABT A;  3V4G A;  2O0Y A;  3R4K A;  3C3W A;  1YLF A;  2VC0 A;  4XKB A;  2F4O B;  2OTL I;  4FTH A;  2IBD A;  3V8K A;  2GA1 A;  3HXL A;  1KGS A;  1TP4 A;  4NUB A;  3BZK A;  1MBF A;  1P6R A;  4I7H A;  4UB8 C;  3LSG A;  4A5M A;  2W4S A;  2STW A;  4N9H A;  4CZC A;  2PQ8 A;  1A04 A;  2YR2 A;  2XRO A;  3CTA A;  5DYM A;  2E1N A;  3HSR A;  2UUZ A;  2XGE A;  5D5X B;  1OYW A;  5FLX K;  5IPA A;  4J01 A;  5L3C A;  1UMQ A;  3K4L A;  1LUJ B;  3BLY A;  1FJL A;  1F4K A;  3NQO A;  4MIM A;  2QBY A;  5E1W A;  5M5X J;  4KNY A;  5IP7 J;  3J7Y J;  4A3K J;  3F8F A;  2A6T A;  2M5W A;  2GM4 A;  2WY8 Q;  4XLF A;  1XGM A;  2FU4 A;  3LAP A;  1CQT A;  3LOC A;  3GFL A;  2KLO A;  4B1R A;  3SZT A;  2QQB A;  1LKX A;  4Q48 A;  4P1W A;  2EV5 A;  4BXF A;  2BW3 B;  4XL9 A;  3U2R A;  5EGO B;  2NYX A;  3L2C A;  2M34 A;  4DYR A;  4UVC A;  3LSR A;  4GFB A;  5D8K B;  2ECC A;  2XRN A;  4RGR A;  3RZD J;  1LE8 B;  1N75 A;  1ZAR A;  3BR5 A;  3FXM A;  2KHM A;  1YYV A;  2JA8 J;  2HTS A;  2EH3 A;  3JRE A;  2V4J C;  2HR3 A;  2B0L A;  2TDX A;  1VQ6 I;  1ZHF A;  2DT7 B;  5IT9 K;  3FDY A;  2XPW A;  1MMN A;  2LF7 A;  3KZZ A;  3CCM I;  4CDG A;  2G9W A;  4XKW A;  2FML A;  2CW0 F;  3QPS A;  3BR0 A;  3MCZ A;  4RM2 A;  3WOD F;  3V7C A;  1ETW A;  1O3R A;  1HXD A;  4A12 A;  1I1G A;  1VZ0 A;  5E1X A;  3BCA A;  3K4M A;  4UUS B;  3E3V A;  4BBR J;  1UZC A;  2W85 A;  2VXZ A;  3CDL A;  3E5X A;  2YX7 A;  3WHB A;  2P6S A;  2KT0 A;  3CQZ J;  5CPR B;  2HFH A;  3S17 J;  3T8R A;  1T6S A;  2FE3 A;  4RAZ A;  1BC7 C;  3NRV A;  5B1A H;  4XM3 A;  2FMY A;  1CF7 B;  4MFD A;  4YEL A;  1X3U A;  2IW5 A;  4PDK A;  2DLL A;  3W2V A;  3E97 A;  1SD5 A;  3QYB A;  3GZ6 A;  1BI2 A;  1R4M B;  5ICE A;  9ANT A;  1T38 A;  2ME0 A;  4UHT A;  5JLW A;  1BL0 A;  1ZH5 A;  5JHU A;  2VKE A;  4UNO A;  3H5R A;  2L7M P;  2LVS A;  3BZ6 A;  3ZMD A;  1MGT A;  3FXU A;  5KK1 A;  4KFC A;  5F27 A;  2ZO4 A;  1W5S A;  4V2G A;  3S32 A;  1HKS A;  4IHT A;  2DMP A;  2IT0 A;  4XRM A;  3CC2 I;  1TWA J;  2DTR A;  4FX0 A;  4KN7 X;  3WG9 A;  3JAM K;  2HVS A;  4EMS A;  3IWZ A;  4EJW A;  4LK0 F;  1Q1H A;  1AOY A;  2L54 A;  5J3L A;  2W84 A;  3BG9 A;  3I5U A;  3QPL A;  4AWX B;  3VFZ A;  1IRX A;  4HYE A;  3K4J A;  1MMD A;  3HKZ A;  4PGG A;  2IS1 A;  1EH8 A;  4JK1 X;  3K70 C;  2DA4 A;  2X6O A;  1ETV A;  2K9N A;  4MEY F;  4NB5 A;  2QGU A;  1U9O A;  4XLC A;  2RAE A;  3HPG A;  1K6O A;  1L0O C;  3DBH B;  4KIB A;  4LG0 A;  3RKW A;  3ZMZ A;  3OYK A;  1W5C C;  2OZ6 A;  2VON A;  2R7S A;  3VPR A;  4L5E A;  4LLN A;  1P2F A;  4MTD A;  1I3Q J;  1F9N A;  2KIS A;  5LEJ A;  3MVP A;  1MZB A;  4N4N B;  3ZP5 A;  2LOO A;  2AQE A;  2MH2 A;  3W3C A;  3A01 A;  2VLA A;  3TW6 A;  1R71 A;  2QM3 A;  4BJ5 C;  1D0Y A;  2YSR A;  3F6O A;  3ABM H;  5FO5 A;  4QSH A;  1DU0 A;  1A31 A;  4ABZ A;  2XIG A;  1QNT A;  2IEK A;  1YIO A;  2XRL A;  4PGH A;  4CHU A;  2X6W A;  2Q2E A;  2TCT A;  2FRH A;  2L01 A;  4HG2 A;  5DDG A;  2O6G E;  4EGZ A;  3ROU A;  3FWE A;  1NH3 A;  4XIC A;  1G3W A;  3MWM A;  4ZZD A;  3PUB A;  1FP2 A;  2IXS A;  3WGH A;  2KIF A;  2ME6 A;  4LGW A;  3N05 A;  2Y75 A;  3R6S A;  2HKX A;  2L02 A;  3GCM A;  1LPQ A;  1O3S A;  5FLV A;  2GIZ A;  2OBP A;  1U8B A;  1MSE C;  5F0F A;  2LDU A;  4PZJ A;  1U78 A;  2LMD A;  3ABU A;  1DP3 A;  3ELK A;  4E7J A;  1SFK A;  1QPM A;  2P5L C;  2B7E A;  2TRT A;  3GLX A;  3DU6 A;  3MD2 A;  4KIT B;  3C18 A;  2EB7 A;  2EWN A;  4BE1 A;  3DP7 A;  4CGZ A;  5GP9 A;  2BVM A;  4ZTJ A;  3L09 A;  4A6E A;  2R7X A;  3U1K A;  2IPQ X;  2Y30 A;  3CCU I;  3PNV A;  3SQN A;  3RDI A;  4OU0 A;  4HDU A;  1YO5 C;  1WWX A;  3BZC A;  2R5Z B;  3UKG A;  5LFA A;  3OL4 A;  1Z21 A;  3SJM A;  1VND A;  2PMZ N;  2BY2 A;  1WI9 A;  2K9S A;  3CME I;  3HEF A;  2VQG A;  2F4M B;  1ZG3 A;  4PFP A;  1KYW A;  1UAA A;  3JRG A;  5BOX A;  4DOZ A;  5M5W J;  1XPX A;  5DCM A;  2V9K A;  2L7K A;  2W24 A;  3ERM A;  3K1N A;  1O7L A;  2K3P A;  4CCN A;  3S93 A;  2JUG A;  3FBI B;  3I59 A;  2CJJ A;  2M0C A;  5F0C A;  1EH7 A;  1VQ5 I;  3W2A A;  2RNG A;  1E2X A;  3BTI A;  4UXN A;  4LIT A;  2V9V A;  1YW9 A;  2MGQ A;  2QYO A;  3KX2 A;  3WTU C;  3IH4 A;  2VPL A;  1J59 A;  2E5N A;  1G3S A;  3HJE A;  4EM1 A;  1KQ8 A;  4IEJ A;  3QWL A;  1F5T A;  4NBQ A;  5JHF A;  2DMQ A;  2DTZ A;  4P9F A;  4HNU A;  5GPA A;  1HF0 A;  4BKX A;  4HAM A;  1I50 J;  5CVU A;  4HNV A;  4A6D A;  4HSR A;  1MBH A;  5AON A;  1I6X A;  2MLG A;  4UUV A;  2EV6 A;  5F08 A;  1D8K A;  4NHJ A;  1LDD A;  4LJZ F;  3E6C C;  2ZME C;  1K61 A;  4E7K A;  2DBB A;  2K4J A;  4WXC A;  4G7H F;  4B3X A;  1YW8 A;  3GTQ J;  2DJN A;  2KRH A;  1XX5 A;  2K02 A;  1WJB A;  4XOT A;  4H4K C;  1YX5 A;  3AL0 C;  4EM2 A;  4M9Z A;  2FQ4 A;  2MC4 A;  3G1L A;  3I54 A;  3I53 A;  3OYC A;  4NC6 A;  2HWV A;  2L5Q A;  4W1U A;  3L1P A;  4EJT A;  4XON A;  3REO A;  4ESF A;  1BR4 A;  1ONV A;  3K2A A;  2NVT J;  2H94 A;  3KEY A;  2HGC A;  3CJT B;  2XB5 A;  5EG0 A;  3M7G A;  1RNL A;  3CMM A;  2VKV A;  4HX8 A;  5CVJ A;  3I71 A;  4A3B J;  4CYC B;  4BXX J;  4A3E J;  4A69 C;  1QO0 D;  4U88 A;  3NAU A;  5ICC A;  4IHW A;  1JJ8 C;  4S05 A;  2VBW A;  1ETQ A;  3ZN0 A;  1AWC A;  1ZAO A;  3BG7 A;  1MBJ A;  3FM3 A;  2R0Q C;  1OIS A;  1A6I A;  2KPM A;  5FRM A;  3S1R J;  1YOV B;  4HQM A;  1APL C;  1W7P D;  1P4A A;  2FOW A;  5CKT A;  4G7O F;  3E5U A;  1BIB A;  3VSL A;  4B8X A;  3GF2 A;  1R4N B;  4A5N A;  4RAG A;  1SVM A;  4RB0 A;  3HPH A;  5GAE J;  4OOI A;  1DGR M;  3DPT A;  2VJ5 A;  4G7Z F;  3EUK L;  3KIO A;  3PQJ A;  1W7P B;  1YIJ I;  1SFU A;  2O8K A;  2BXZ A;  4LB5 A;  4U0W A;  1K6Y A;  3AG3 H;  2A6H F;  4BE2 A;  3TQN A;  3FMR A;  1ON1 A;  2X1D A;  3JRD A;  1J0R A;  1VQO I;  2M87 A;  2M45 A;  1I5Z A;  3MZY A;  2KKO A;  4FX4 A;  1BR1 A;  1W36 D;  3BDD A;  4UUT A;  3GTJ J;  1WH5 A;  3H3V K;  4A0Y A;  4GYG A;  5C44 J;  3VOD A;  4XBF A;  1FYK A;  4AM3 A;  2DA5 A;  2WV1 A;  4A3L J;  1Y56 A;  3T0Y A;  2XDV A;  4A3C J;  2DOA A;  3Q9V A;  5CVR A;  2R7D A;  2AQF A;  4XSZ F;  1GVD A;  2Y2Z A;  3U1D A;  3I58 A;  3DBL B;  1E17 A;  5EZG A;  3H3Z A;  3FX3 A;  3OWT A;  4A0X A;  1OQY A;  2F2E A;  4U87 A;  2HOE A;  4H0E A;  5KNL A;  2PX9 A;  3HSE A;  1D1C A;  1FLI A;  2DCE A;  3NAR A;  3S1Q J;  2WC2 A;  2DYS H;  2Z99 A;  3JSP A;  1XMK A;  4L9N A;  4LMY A;  2G7H A;  4MFE A;  2CV2 A;  3ESW B;  3Q3S A;  3LSJ A;  1OPC A; 
#chains in the Genus database with same CATH homology
 3TL4 X;  3DWL E;  1GLN A;  4RLQ A;  5LD2 C;  2X1E A;  2R7W A;  4BDY A;  4G6T B;  1MND A;  2M7B A;  2IS2 A;  3BC8 A;  4ITV A;  5CQE A;  4PFO A;  2ZXI A;  4YEJ A;  4PSX A;  1QHG A;  2VJJ A;  4CCJ A;  2R7R A;  2QKL B;  3ZGK A;  3MKZ A;  2JVH A;  3OYF A;  2VQC A;  3SYT A;  1Z3Y A;  2L9S A;  3IP4 B;  4NQW B;  2LYC A;  3MKW B;  3K4B A;  3BG6 A;  3LL7 A;  1NG7 A;  3HL2 A;  2IGN A;  5KCM A;  5HNH A;  4P5O A;  2R7O A;  3A2K A;  1MMG A;  4CCL A;  2HPI A;  3CF2 A;  3QOD A;  4KIS A;  4F91 B;  3LSM A;  2XC7 A;  4NC8 A;  1WJ5 A;  4BAC A;  3L2R A;  3DKX A;  4Y3O A;  3CP8 A;  2ZXH A;  3OR1 C;  2VJ4 A;  4XLH A;  4BS9 A;  4FET A;  2W1O A;  4XOR A;  4E7H A;  4N4O B;  3KYL A;  3OMY A;  3VYR B;  3QYF A;  3OL3 A;  2HU9 A;  4PJM A;  4XKB A;  1YE9 A;  2MYS A;  4ZDL A;  3SDB A;  3OIP A;  2IGO A;  4B44 A;  3OS1 A;  1X4P A;  2V1N A;  3HXL A;  3ZRG A;  4NUB A;  2IS6 A;  2VJI A;  1MW7 A;  4XN3 A;  4DGW B;  3LSG A;  4II3 A;  4BU2 A;  2W4S A;  1G59 A;  4CZC A;  3C2G A;  2Z16 A;  4BEH B;  3OYD A;  4CCM A;  2CUJ A;  2UUZ A;  5FRN A;  3VYT B;  4J01 A;  1ZEL A;  3DEE A;  3K4L A;  3BLY A;  4BDZ A;  3S3N A;  3G2B A;  2F6C A;  4IQJ A;  3K4C A;  4CCK A;  4BUP A;  1X19 A;  2CH0 A;  2A6T A;  4E7S A;  2WY8 Q;  2WY7 Q;  2E1M B;  4XLF A;  4BJT A;  3F9K A;  3OOU A;  3OYJ A;  2KLO A;  1LKX A;  2XSJ C;  4P1W A;  4CA0 A;  2VIX A;  4BXF A;  2BW3 B;  4XL9 A;  2ZSI B;  2KQR A;  3DTI A;  4E6K G;  1BR2 A;  1UEL B;  5HNF A;  1X1C A;  1ERD A;  3ZXS A;  1N75 A;  2KHM A;  3V42 A;  2V4J C;  2XF6 A;  3CZ6 A;  1D1B A;  2DT7 B;  3FDY A;  3DLA A;  2OC6 A;  1MMN A;  3FKJ A;  3DKY A;  1T0F C;  4XKW A;  4LIV A;  3OYM A;  4PUS A;  3RSN A;  2K5C A;  3PSI A;  4RM2 A;  3K10 A;  4OAY A;  2M4K A;  3IAM 2;  2IGK A;  1VZ0 A;  4XOP A;  3S8P A;  3BCA A;  3EPZ A;  3K4M A;  3QYE A;  2DT6 A;  2XF7 A;  4IQ4 A;  3L2U A;  4E7Z A;  2A5W A;  2VXZ A;  2MD0 A;  1E0E A;  3LFU A;  2LY2 A;  1DGW Y;  2IGM A;  2W82 A;  5CPR B;  3RCO A;  1MMA A;  4QPO A;  4F3Q A;  2UWM A;  2IS4 A;  2E1M C;  3I3L A;  1LFP A;  2M7A A;  2ELJ A;  4XM3 A;  4YEL A;  2CFO A;  3HOS A;  3W2V A;  3SEZ A;  3NWS A;  2CW8 A;  2BW3 A;  3A1Y A;  2F5V A;  3E1S A;  3QYB A;  3C2H A;  1R6R A;  3OIQ A;  5FRO A;  2VL8 A;  1V5G A;  2X6X A;  3DTE A;  3H5R A;  1N77 A;  4CSW A;  2O5R A;  2JVG A;  4QPQ A;  3ZCO A;  4U7B A;  3L2V A;  1V5E A;  3S32 A;  3L2W A;  1D0Z A;  3IUO A;  2PMZ A;  3LSK A;  2JA2 A;  1W36 C;  3FHN A;  4BQQ A;  3DU5 A;  2LG4 A;  4Y4R A;  4HEA 2;  2VQL A;  2HVS A;  3D5L A;  3UNG C;  3H9J A;  1AA7 A;  3TBI A;  3GBG A;  3U21 A;  4YRV A;  1SAU A;  1LVK A;  1WJE A;  1QHH D;  1Y6I A;  2CS3 A;  4ANJ A;  3S3M A;  2PJR B;  2V7F A;  4IZZ A;  4B48 A;  4XKV A;  4R79 A;  3J7A Y;  1IRX A;  3K4J A;  1MMD A;  3HKZ A;  2IS1 A;  3K70 C;  2JSP A;  2LBF A;  1G8X A;  1MNE A;  4XLC A;  4IKF A;  4E4H A;  3HPG A;  2VQH A;  2Q1Z B;  3OYK A;  2WBM A;  1U0J A;  3HOT A;  2R7S A;  4RMN A;  5TGT A;  3QOE A;  3HUG B;  1PJR A;  4N4N B;  4HST A;  4C2U A;  2LOO A;  4EAT A;  2AQE A;  2HQA A;  1OR7 C;  3W3C A;  2VLA A;  4BJ5 C;  2RQQ A;  3OYB A;  4ZDO A;  2GOM A;  1D0Y A;  3VYU B;  3W2W A;  4OAZ A;  4XMY A;  2KL4 A;  2V6E A;  3CES A;  2KZV A;  2X6W A;  2QKM B;  4ZDP A;  4F52 A;  1WJF A;  2KMU A;  4ZC3 A;  2FUG 2;  4HG2 A;  1X1A A;  1D0X A;  1YX3 A;  3LSI A;  3DPL C;  4JOM A;  4BGD A;  1KON A;  2CV1 A;  3PUB A;  2IXS A;  2HVR A;  2PJR A;  1OLT A;  4E7I A;  3N05 A;  3OR2 C;  1HA8 A;  4DIQ A;  2CMP A;  4CH7 A;  1NG6 A;  1V5F A;  1DQU A;  2P0W A;  1TT0 A;  1S9H A;  2Z1D A;  2WAE A;  3RQ4 A;  1DP3 A;  1QU3 A;  4E7J A;  1SFK A;  3VSK A;  3ZQQ A;  3DU6 A;  3MD2 A;  4KIT B;  4BE1 A;  3CJQ B;  4Y33 A;  3ZR8 X;  4ZJZ A;  2F4I A;  3SEQ A;  2CV0 A;  2BVM A;  3OS2 A;  4ZTJ A;  2R7X A;  3VYS B;  2L9N A;  1TZL A;  1T95 A;  3PNV A;  3VWB A;  4OWR B;  3EUA A;  4FAS D;  5LFA A;  3OL4 A;  1Z21 A;  4XN0 A;  4C9Y A;  1UG0 A;  2HZD A;  2XAU A;  3M1C A;  2VAS A;  2WB1 A;  2HPM A;  4LIU A;  4BQN A;  2VQG A;  3TMO A;  4KJZ A;  3MMY B;  4PFP A;  4NC7 A;  2LBF B;  3OYI A;  1UAA A;  4BE0 A;  4DOZ A;  3AL0 B;  1WJD A;  1WJC A;  2Z2S B;  4XNF A;  2OUM A;  2LH9 A;  3VDX A;  2R7Q A;  2BVL A;  2V9K A;  2L7K A;  2HDW A;  2I8D A;  1N78 A;  2V26 A;  2K3P A;  4CCN A;  3K6G A;  3S93 A;  3RPU D;  3L2Q A;  2JUG A;  3FBI B;  3H5A A;  3LSH A;  3RTR A;  3OYH A;  1JI8 A;  4CUG A;  3PJR A;  4GRI A;  2M3A A;  3D5S C;  3W2A A;  2RNG A;  3H9Q A;  4LIT A;  2OV7 A;  3DTK A;  2LRE A;  3OYL A;  2HVQ A;  2GOX B;  3KX2 A;  2VPL A;  2E5N A;  1BOB A;  5JHF A;  2Q2E B;  2XF5 A;  5KHD A;  3EUH C;  4X0G A;  3SZG A;  4HNU A;  2R7V A;  3BCB A;  3H0D A;  4HSR A;  2MFZ A;  2KP6 A;  4D9J A;  4XLE A;  1X1B A;  2KDO A;  4RM3 A;  3OS0 A;  4MLO A;  4E7K A;  3PSF A;  4B3X A;  4XR6 A;  2KRH A;  2E5Z A;  2WAD A;  3CP2 A;  4J00 A;  5HVQ C;  2VKH A;  3H9G A;  1D1A A;  1WJB A;  4XOT A;  2DXI A;  4H4K C;  1YX5 A;  3AL0 C;  2MC4 A;  3OYC A;  2CUZ A;  2L5Q A;  4II2 A;  4PK4 A;  4XON A;  1BR4 A;  2VXD A;  3LMM A;  3DQV C;  3HC7 A;  3KEY A;  4DBR A;  1LDK B;  2Y0S A;  1P9Q C;  3CMM A;  4F93 B;  2L2O A;  3K4K A;  2K9M A;  4B43 A;  4LG3 A;  2DJI A;  4BJ6 C;  3IAS 2;  2X1C A;  4F92 B;  3A4C A;  2R7T A;  2M4G A;  4XKC A;  4HRI A;  3BG7 A;  4CCO A;  3D5R C;  4AVZ A;  4PJN A;  2KPM A;  1FMW A;  5FRM A;  3PNY A;  4PJL A;  5CKT A;  3OYA A;  1Z7L A;  3VSL A;  2WAQ A;  1EA3 A;  4HPQ A;  3MKY B;  3E0J B;  1X4O A;  2X51 A;  3HPH A;  2BOL A;  4C30 A;  1DGR M;  2X85 A;  3DPT A;  2VJ5 A;  2ZSH B;  3UR3 C;  4BQO A;  3EUK L;  2WAF A;  1Z3X A;  1PYV A;  4RLF A;  2W7N A;  3OY9 A;  4NNJ A;  1K6Y A;  4BE2 A;  4F55 A;  4PJJ A;  3CJR B;  2X1D A;  2LC2 A;  4AU7 A;  3DPU A;  3OYN A;  3HG9 A;  1BR1 A;  4DBQ A;  3H35 A;  1W36 D;  2R7U A;  2M0M A;  3NWT A;  2CW7 A;  2HNH A;  4KT6 A;  1FMV A;  2NOJ B;  4E7L A;  4BL0 B;  2KRC A;  1Y56 A;  2XDV A;  4DJA A;  4ZTF A;  4PSW A;  2DOA A;  2E60 A;  2AQF A;  4JQF A;  3PL8 A;  3OYE A;  2UV1 A;  3AFH A;  4B47 A;  3OWT A;  2LRD A;  3PNT A;  2LY1 A;  4D1Q A;  4XLA A;  4IX7 A;  5HOO A;  4U87 A;  1X1D A;  4ZYA A;  1WJA A;  2RRE A;  3AKZ A;  5KNL A;  4BEH A;  3I9V 2;  1D1C A;  2VB6 A;  2DCE A;  3ONQ A;  3K4N A;  5CQG A;  5HLT A;  3K70 D;  3S3O A;  2K9L A;  2R4G A;  1J09 A;  3M8J A;  4AYB A;  2WA0 A;  3PFY A;  3FBN B;  2VKD A;  2W00 A;  2MAB A;  2CV2 A;  1WFX A;  3H5N A;  4HNT A;  2X6Y A;  4C2T A;  2ZFU A;  4XQF A;  3OYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...