2WY8Q

Staphylococcus aureus complement subversion protein sbi-iv in complex with complement fragment c3d
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
66
structure length
66
Chain Sequence
b'VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C3D FRAGMENT
publication title A Structural Basis for Staphylococcal Complement Subversion: X-Ray Structure of the Complement- Binding Domain of Staphylococcus Aureus Protein Sbi in Complex with Ligand C3D.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wy8Q00
2JVHA 2GOXB 3D5SC 2JVGA 2NOJB 2WY8Q 2WY7Q 2GOMA 3D5RC
chains in the Genus database with same CATH superfamily
3OY9A 2K9QA 3GUDA 2XF7A 2ETHA 1XGSA 1QPMA 3FWEA 2DK5A 2JA8J 2CRGA 3ABKH 4HF1A 1ZTRA 1JGSA 1FTZA 1YHQI 4F93B 1G3WA 2STWA 1MJ9A 3J81K 3E5XA 2YX7A 1K6YA 3TO6A 3PIOF 2LOOA 3E1SA 4I01A 1J2XA 1SD5A 3K9TA 3CCVI 2A05A 2XPVA 4ZDPA 3LSMA 5DDGA 1BW6A 5B1BH 5LGUA 3J7ZI 5DD4A 4XKVA 5L3EA 2FU4A 2W25A 2EB7A 1HKSA 4LJZF 1F43A 4LG0A 5DD8A 4B44A 4E7KA 1QHHD 3H9QA 1OYYA 2R7XA 3RPUD 2LMDA 1EKEA 4YEJA 1SD6A 2FA5A 3MN2A 3VYTB 1FBSA 2R7WA 3PFYA 4NHJA 1X4PA 3D1NI 5L3CA 2I5UA 4EQQA 2DMQA 1X1CA 2K9LA 4IRHA 2L02A 3QWLA 4NQWB 2QBYA 1Y8RB 2V9VA 1MGTA 2RDPA 1XCVA 2Y69H 3RIRA 4A5MA 3RI4A 2RAEA 1OCOH 1YX3A 5E3LA 2ELKA 3C18A 2LKPA 3H9JA 4AM3A 4K2EA 1YJNI 1JHHA 5ILSA 1IDZA 4A0ZA 1YJWI 3P9KA 4IHVA 2A3SA 5TRDA 1JUMA 2JRTA 5FLVA 3P9CA 3TDZC 2VKEA 4ENKA 2L7KA 2ZJ2A 5BS6A 4BGDA 1QQIA 1WJAA 5E1XA 1XN7A 4YFNF 4J01A 3WGGA 4FT8A 2W57A 4CICA 2KIFA 3X2QH 3I53A 5AIQA 2P6SA 4GFBA 2VJIA 2K85A 1FT9A 3I5UA 2X6YA 3GLXA 4UUSB 2PMUA 4M3GA 4BEHB 2P7VB 5E79C 1RC9A 2VBWA 1Y1WJ 4ZYGA 4XRFA 1LJ9A 3F6OA 3EUHC 2A5WA 3LSKA 2V9KA 2VT2A 2Y0SA 1ENHA 4BJ5C 5HOOA 3CCRI 4CCOA 2QSHX 2FOWA 2DXIA 1REPC 2L2OA 3EPZA 4U0WA 3C2GA 3PQJA 2BEOA 2L3DA 6PAXA 5DV5A 1QPIA 2LKXA 3U1KA 4C9YA 1D5YA 1QZEA 4ENMA 2ZMEA 3I59A 3KP6A 2HKXA 5DUKA 5FB2A 3KZZA 2KZGA 5LHIA 2WV0A 4J19A 3RZDJ 1ZGWA 2KDZA 4XSZF 4HX4A 3BTIA 1SD7A 1FNNA 4ZC3A 1XSVA 2RQQA 3GTGJ 2LDUA 1Z0XA 2OC6A 2NS8A 3JRHA 4HRIA 4KYWA 4X1EA 4S0HB 4XRSA 1Z7LA 3HKZA 1DUXC 1YW8A 2FMYA 2DN0A 1W7PD 4EEFG 4XIDA 4XICA 4DJAA 2LF7A 1FLIA 2O5RA 5K7ZA 4R79A 2CQXA 1STZA 1Z6TA 2Y9YA 4A6DA 2DMNA 4H0EA 1Z21A 3LA2A 1RI7A 2JSCA 5HLGA 3J7AY 3QAHA 5FKKA 5LRSA 3CCJI 4YIIA 3GYHX 1T0FA 5KK1A 2VN2A 1ZRFA 4G6DA 3CCEI 1RPWA 3BR3A 1BL0A 2UWMA 2K4JA 1YS7A 1QVTA 3AKZA 5CVUA 3OYIA 5F04A 2E1MC 3E97A 1UFMA 5E3MA 2A6TA 2CV0A 1X2MA 2R3SA 5JFRA 1M1EB 1SMTA 4PGHA 4L9NA 3LQQA 2EFOA 1R23A 1Y56A 2KRHA 1KGSA 1D0ZA 2KIMA 2DFIA 4A93J 3PJRA 3KZIC 2BW3A 1R5ID 5J4YA 2XIGA 2MH9A 2P81A 2W4SA 2EIMH 3ERMA 2VQCA 3TP3A 1LEBA 1IDYA 2VUMJ 5IT3A 1LFBA 1FMWA 4KT5C 3LSIA 3CZ6A 3ZXSA 1LVKA 1R1TA 1QRYA 3ZGKA 2L7MP 4GGGA 3HOYJ 1U5TC 1FMVA 3DKWA 2AXTC 3DPLC 2ID6A 5EZHA 4BNCA 1T8IA 5E17F 3CC4I 4ESBA 4HG2A 2BHYA 1EF4A 3I55I 4P96A 4I02A 2KISA 2NVYJ 4FHTA 3PO3J 1IV6A 5HDKA 1WSUA 3EDPA 2M7BA 3ZOBA 1A6QA 4B43A 1LKXA 3K1NA 5C4JJ 2Z5UA 2OU2A 4F7ZA 2W85A 1OCCH 2NVUB 4L18B 3E0JB 3RPQA 3AG4H 3ABMH 1ITYA 4XK4A 1B59A 3ZQGA 2DO7A 3JAMK 2IVMA 2V4JC 1I3QJ 4OU0A 3DV8A 1XDSA 2IW5A 2G7UA 2HS5A 1BOBA 3OIOA 2JUCA 4BQAA 2DOFA 2FNPA 1VFCA 2R7OA 2DLLA 4Z6YA 4DYQA 4I7HA 1H0MA 4QWQA 5DYMA 5FLXK 4EJVA 2VB6A 2AO9A 4AIDA 2DOAA 3ZR8X 5M3MJ 2ESHA 2XGDA 1V4RA 3RKYA 1XGNA 3OS1A 2VPLA 3SEQA 4FQGA 2EFNA 2GWRA 5BPDA 1IRGA 5J8CA 2QQ8A 5FD5A 2X6WA 3ABUA 2D1HA 1TL8A 1FBUA 4M6VA 1ZLKA 3BC8A 1QGPA 3FMQA 4G94A 2LY2A 3G4SI 2R5YA 2R92J 1KU3A 3DQVC 3HRUA 4E6KG 2DJNA 5F1RA 1BM9A 3H1CA 5LRRA 4EV0A 1POGA 1ZKGA 1L0OC 3TOAA 2KJCA 3F8BA 3MKWB 4AIJA 1ON1A 4C2TA 3T1BA 3ZQCA 2PMHA 3DTKA 3JRDA 2OAZA 3BPVA 4YFKF 4U0VA 3DEEA 1IN8A 3W6JB 2VE9A 1YE9A 2FQ4A 3EYYA 4LITA 2M3AA 3CF5F 2YR2A 1EJ9A 2FQ3A 2E71A 2MD0A 4OAZA 4WF2A 5HLHA 3PUFA 4G7HF 2Y48A 4PDKA 3OR2C 3IC7A 3LMMA 2XVCA 4L9JA 4DYCA 4KN7X 4XOTA 1U9NA 3GTKJ 1JHFA 3OYCA 1PYVA 3TQNA 2Q2EB 4IKFA 2H1LA 2QQ9A 3TO9A 3S3NA 5LLQA 3L2CA 2R7FA 1DGRM 3BTCA 1FC3A 1P9QC 1T08B 4UB6C 2DT5A 4WX9A 4XONA 1A36A 3CLQA 1ZGJA 4FASD 3Q5FA 1FOYA 2RV8A 1HDDC 3J80Z 2E1OA 4KNYA 2HOEA 5J1RA 5HNFA 1PDNC 4LLGF 1UJ8A 2PLYA 2FXAA 2UXNA 2VXDA 1XX5A 5H2FC 3HOWJ 2LC2A 1S7OA 2PG4A 3L2VA 2FE3A 2K02A 1RUOA 3TW6A 1QZYA 1X1DA 1YIJI 2HOTA 2NRAC 1X1PA 3JRFA 3HRSA 2NS7A 3E6CC 3KP3A 4CO8A 3K0LA 1WVRA 1R58A 2R7QA 2YU3A 1MW7A 4BAYA 3QOEA 2XHKA 3KYDB 1YX5A 1ZK8A 2IGMA 2H8RA 4UHTA 4HDUA 3I9V2 2NNNA 3NEUA 3WHBA 1O3TA 1VQ9I 4FX0A 1MBFA 5CVIA 2QQAA 3ML6A 5EYRA 3V8KA 4EM1A 4HNVA 3U1DA 3FBIB 3L09A 2X6XA 2NVTJ 1IO2A 2GIZA 1TWCJ 3AG3H 4LB5A 2IS6A 4PCQA 3M8EA 2VQGA 2K3FA 3DPUA 3K1MA 2X1DA 5FFZA 5ICGA 2ZJPF 2E1CA 1I50J 4A3JJ 2M4GA 4M9XA 3TKYA 3QYBA 4D9JA 3V7SA 1CF7A 4WK8F 1VI0A 3LFUA 3HL2A 3LA3A 2JQ7A 4V2GA 3HM5A 1SD4A 3S2HJ 4M6YA 4KMUX 3E6DA 4UVBA 5F6FA 1AHDP 3ESWB 3A0BC 2QBYB 3F8FA 3VDXA 1N78A 3C2BA 3K4JA 5E3NA 4NC8A 3ZPLA 4BXFA 1LFPA 2GA1A 1FWZA 1GLNA 2A07F 3L9FA 4HYEA 3GTMJ 5GTHC 2VJJA 1MDMB 3G1MA 1E3PA 2UV1A 1P6RA 3JSPA 3I58A 2AQEA 2W00A 3GZ5A 2LVSA 3KEQA 4XORA 4X0GA 1Y0UA 1U6GA 1MMSA 2KIUA 3IUOA 2WADA 1BC8C 3BG3A 3MD2A 3PIPF 4IQJA 2CW7A 1TQMA 4DIQA 4QTRA 4UV9A 4HLXA 4A12A 1EV7A 2KDOA 4HSTA 4JX4A 3SZPA 1OCPA 5FJ8J 5LBQA 4ZDOA 4OIPF 3ECHA 1U5TA 3OMYA 3JSOA 3DFGA 4PJNA 3RDIA 1VQNI 1QHGA 3N4MA 4JYKA 2B0LA 1VQMI 3RJPA 4XQFA 2OZUA 3FDYA 2CFXA 1B8IB 3OL3A 4MFEA 1MMAA 2QSFX 5DEQA 5HDGA 4RLQA 2X4HA 1D0XA 3M7GA 1TW3A 3FMRA 1GV2A 3WODF 1FOWA 3NWTA 2AHQA 3R61A 5CVVA 1T56A 2A6EF 1SVMA 1YTYA 5KHDA 5E8GA 2Q0OA 1DDNA 1LVAA 2MBFA 5L3GA 4UVAA 3CD6I 1FOXA 2TDXA 3QPHA 1LPQA 2NNYA 5K7HA 2HQNA 4PSWA 4KIBA 3FBNB 3MKZA 1B72B 3GVAA 3KIOA 3LAJA 4OIRF 3HOVJ 3CUQB 4CYCA 2WWYA 1GXPA 2IEKA 2DA5A 1ETVA 1PUFA 3FF5A 3WE3A 4BBSJ 4M3FA 5EZGA 2Z16A 4Y17A 4GRIA 3DKYA 2K3PA 2LBFB 5DUIA 2RGVA 3GO5A 1HKTA 1OMIA 3G71I 1ERDA 3ROUA 2W82A 4KISA 2Z1DA 4A5NA 2OJED 4CCLA 5D6EA 4CZZA 2EV6A 3ZMUA 5JHFA 5EJCA 4YIFA 1K79A 2X48A 1I6HJ 3L2RA 4BQOA 1VQ4I 1UELB 4MHGA 1AKHB 3ZRGA 2BBYA 5EGOB 4M72A 3BR2A 2BE5F 2XRNA 3L00A 2F6CA 3ZQFA 1CGPA 3SZTA 2E7XA 3MCZA 3LSPA 3LNQA 1USSA 1JT0A 5K5OA 3W6VA 1UZCA 3F3XA 4I98B 1TP4A 2L4AA 4Y3OA 1T0FC 1ETXA 2EA4A 4LD5A 4LLNA 4FE7A 2XRLA 5DS9A 2PI0A 1UCRA 2BY3A 4ZYEA 5IPAA 2O3FA 3RPUA 4EM0B 2BW3B 3L1PA 3ELKA 4ENNA 2QLZA 4XLAA 4ON0A 2IS1A 1LNWA 2HOSA 1TWHJ 3A1YA 4BQQA 4QPOA 2R7ZJ 3HJEA 5GAGJ 2KL4A 3G2BA 1VQ7I 2DDBA 2ELHA 3UR3C 2HXIA 2K7LA 4S04A 2XV4S 2Z9OA 2JRMA 2NXNB 5L3BA 2GXAA 1PUEE 4ESFA 3FXRA 3GX4X 4E7IA 4G6QA 2M8GX 4RB3C 4LIUA 4ABZA 1GHCA 1X3ZB 2B7EA 3U9GA 4WWCA 4CA0A 3DBRB 2GM4A 1F4KA 1X3UA 4M9ZA 2CQ7A 2JUGA 4B48A 3K4MA 1ZRDA 4L0YB 1VNDA 3IRQA 3HHGA 5D5VB 4ZH4F 2JWTA 4AUXA 2NOGA 3D0SA 1YQAA 2EFQA 4G7ZF 3NWSA 4LLLA 3BG7A 3QU6A 1K4SA 4XLFA 1EA3A 2XGCA 2OTLI 4CCNA 5FKNA 4EJTA 3HBLA 4XR6A 5TISC 2XDVA 4FETA 5FGMA 3QYEA 1IRZA 1KONA 3RQ4A 2X51A 1BIBA 2KMUA 3CJNA 4BKXA 1P4WA 1TT5B 1I1GA 2V6CA 2DI3A 5FKOA 3U2RA 2QWWA 5HLTA 3S2DJ 1QBJA 1D1CA 3FXLA 4HBLA 4F55A 3MWMA 3ZMZA 1JE8A 3BCAA 1MBJA 1MNMC 3K4LA 3CMAI 3CP2A 4Q4ZF 4LK0F 3KYCB 2L54A 1LE8B 4ITVA 1R00A 3HSFA 3GTLJ 2PJRA 2LYCA 3WTZA 2VC0A 4IVNA 3ISPA 2KZVA 3CF2A 2ID3A 5GP9A 1HLVA 2N8GA 1O3QA 1NG7A 2NS0A 4V19K 2JJ7A 1UHWA 3JREA 2M0CA 2Y9ZA 2DODA 4RS8A 3FISA 5C3EJ 4P5OA 1ZARA 2PFBA 1O57A 3LSHA 4E7LA 4IHTA 2IS2A 3CDLA 3Q3SA 3A01B 1A31A 4HF2A 4IHSA 3AFHA 1RR8C 3CC7I 1OCRH 3H3ZA 3SDBA 3HZJA 3K70D 3KZYA 3DU5A 1TC3C 3S1QJ 2JVGA 1Z3YA 1R5HA 2ZFUA 4IO9F 1G6NA 5F0CA 4NC6A 2BY0A 3IWFA 4C3HJ 2O6GE 1W7PA 2NVXJ 2CYYA 2QF7A 3F9KA 2QA4I 5A2QZ 5ICFA 4HW0A 4XKCA 4P9FA 1SMYF 1K4TA 2KQRA 4L0ZB 1YYVA 2JPCA 4MIMA 3WU1B 2D5VA 4J00A 1ZREA 4Y15A 4RLFA 2JA2A 2GLOA 3CP8A 1SFEA 3ZCOA 4NNJA 3BZCA 2M4KA 3ABLH 2P5VA 3DXJF 2P5KA 3QYFA 2MLKA 4BH9A 3KLNA 2HVSA 4M3DA 2DA4A 3PSIA 2FF4A 3ULQB 2VQLA 3PNVA 5KNLA 4XKBA 4AD9A 3KX2A 2ZXWH 2MFZA 2FSWA 3CJQB 3KE2A 4RAYA 1QO0D 3S15J 2QKMB 1IN4A 2XAGA 2MLGA 3ECOA 1RZ4A 2XAQA 1JJ8C 4ZJZA 1MBHA 3DLAA 3HTUA 2HOAA 3C3WA 2VOOA 2XGXA 3F8CA 1VF9A 2UUZA 1EH7A 3CC2I 4C2MJ 3QPLA 5F0HA 1S5LC 1DP3A 1D0YA 4M74A 2R7DA 1G4DA 3V7RA 3CCUI 5ED4A 3VYUB 5KAFC 3RKQA 3GTPJ 2YUSA 1YRNB 3C2HA 2WV1A 2MGQA 3P9IA 3K7AJ 3M1CA 1XS9A 4DQ2A 2XSDC 1WI3A 3TMOA 2VI6A 1YW9A 1NHAA 1U0JA 3WTYC 2HWVA 2IT0A 2H09A 2G7HA 3BR0A 1HW1A 2BVLA 2IBDA 2X1CA 2OTJI 2XB5A 3B6CA 1YW7A 4HV5A 3HRTA 3HSRA 4YRVA 3DP7A 1W5TA 5D4SA 3BJAA 2DQRA 5AIPA 3CCLI 5F1JA 2DCEA 4G12A 3HPGA 2NYXA 1RKTA 1O3SA 4Y33A 4IJAA 1R4NB 1IF1A 1K78B 3DKXA 4JK1X 3EQLF 2LFBA 4I76A 4UB8C 3OS2A 2FNAA 1BI2A 3J7YJ 3GMEA 3K1PA 3R0JA 1GVDA 2XKPA 2D1VA 3LL7A 1LQ1A 1JTXA 1ZH5A 1PVEA 1U2WA 2YSRA 2Y31A 4YG2F 1S8NA 1JUSA 1WJFA 2XF5A 2YU9J 1WWXA 1TWFJ 2LREA 3MQ0A 2PJPA 3VFZA 2EV0A 2EPFA 2KRCA 1K61A 3BZ6A 4F92B 4I6ZA 2IP2A 2QGUA 4CCMA 2W84A 3OYJA 3HOTA 1R9TJ 1APLC 1IUFA 2IAIA 3GBGA 5DCMA 2E2HJ 3F72A 2LNBA 1DU0A 4OIQF 2E5NA 3QP5A 5FRMA 1Z1DA 2BZTA 2M30A 4UUVA 2JVHA 3VSKA 3FIWA 1PP8F 4HA8A 4IHYA 5JHUA 4OAYA 3JRAA 2ZNZA 3G1OA 4BE0A 1OR7A 2L7ZA 1LEAA 4XN0A 3I64A 4P1WA 4RM2A 1B9MA 1TW2A 1SFOJ 2LH9A 2GZWA 3VOEA 1F1ZA 4PFOA 3WU0A 3N97A 3D5SC 4MQ9F 1JGGA 1O3RA 4RB2C 3QOPA 1G59A 1DP7P 3IAM2 4B3AA 3HTSB 2EFPA 2ADUA 5J1YA 3TDUC 4LMYA 4A3IJ 5M5WJ 1B6AA 4WXDA 1QA6A 2HQRA 2CU7A 5EEHA 3BROA 1OKRA 3OIQA 3HB9A 5FKMA 3SZGA 4DZPA 2HVRA 1Y8QB 1G8XA 1LDKB 1VQKI 1J75A 3GWZA 4CH7A 1VZ0A 1RETA 4L5JA 4E7SA 1IGNA 3RYPA 3HOSA 3E6BA 1RESA 2RQPA 1HC8A 2ZKZA 4O3MA 3I4NJ 3HUGB 2HI3A 3J80K 4DGWB 2M0MA 2GXGA 2H8WA 1A6IA 3S93A 3WU2C 3N05A 5TGTA 2L9RA 1LUJB 3DEUA 4YIRX 4ZYDA 3H3VK 2WY8Q 4M3BA 2ZCWA 3HOZJ 3NARA 4HZFA 1Z67A 2DMUA 1UG0A 2Q1ZB 2V7FA 5E1ZB 1ZAOA 5L3DA 1HSJA 2IA2A 2ZBKA 4HOBA 2EZKA 5EDNA 2Y0MA 1ZR4A 5FKLA 3R6SA 2WC2A 2E2IJ 1BI1A 4OINF 1U9OA 2EZIA 1KQ8A 4BDZA 2STTA 4DOZA 5D4RA 1Y39A 2E36A 5J47A 2VC1A 5ICEA 3B73A 4MLOA 3ZQ7A 5FRNA 4FTHA 5GPCA 5GAEJ 3FXKA 3W2VA 1UMQA 3WHCA 3WTWC 5E20A 4O6JA 2HKOA 4L9VA 4M71A 4KT6A 1SVOA 1AA7A 1MBEA 2PEXA 4DYRA 3F22A 3O3KA 1BJAA 4L5EA 3OYGA 3AAFA 4JOMA 2ZB9A 1JKPC 4GYGA 1MJAA 3RKXA 4CUGA 5LHGA 2BY2A 2GAUA 4OIOF 1YG2A 2G9WA 3KEYA 3JTHA 2JK3A 4ZYAA 1HXDA 1KQ9A 4UUTA 2HGCA 2L01A 3PNTA 1D5VA 2VL8A 1IN7A 3QU3A 4JBAA 4XLCA 5DTDA 2HTSA 3DEWA 3BR1A 4BACA 5BOXA 1KU9A 1KQ0A 1W0TA 1Z91A 3M8FA 1KYWA 2CUZA 2FOKA 4D7NA 5D5UB 1B4AA 2QEXI 3MFKA 3K70C 1V5EA 5B1AH 4BJ6C 1OYIA 3I54A 1V54H 1X4OA 3DBLB 3IKVA 4HSRA 3SEZA 4IL6C 2XAJA 5EEGA 1G3TA 4WXHA 1HSTA 3HGGA 2RKHA 2VQHA 4CYDA 2ZSIB 4NQWA 3TW7A 2JTVA 1E0EA 2DK8A 4RB0A 1YO5C 1RR7A 2F5DA 2CO5A 1S6LA 3O6BB 1X1BA 1OCTC 2KHMA 1KU7A 2VJ5A 2XKOA 1E3OC 4NUBA 1IXRC 3F23A 1ACIA 5B3SH 1YS6A 2MW8A 3HYIA 2L9SA 2IS4A 1HOMA 3W2WA 3CQZJ 1RUNA 1Z7UA 4XMYA 3FM3A 4ZZDA 2PN6A 5EG0B 1Z9CA 3S17J 1SVLA 2IGOA 2B63J 5IY5H 3MZYA 3FK7A 2R5ZB 3BLYA 2DA6A 4BQNA 1XSDA 3OIPA 5HLIA 1FSHA 3GTJJ 1OYWA 4LB6B 2WAQN 5J40A 4UUSA 4UXNA 4PJ0C 2W48A 4BL0B 3B02A 4GXOA 1SAXA 3HHHA 2OF7A 1MBKA 3NAUA 1Y6IA 3B6AA 1ZG1A 2QCOA 4ANJA 4R1HA 1B1BA 2HXOA 2WA0A 3TBIA 2EINH 2DA7A 3R4KA 4UV8A 4HNTA 1U3EM 3E7LA 1JJ6C 1D1AA 2JPBA 3GFIA 5IYDJ 1IXSB 1E3HA 2I8DA 4RGRA 1E17A 4LG0B 3LSGA 4Z2YA 5FLXZ 4M9SA 1VQ5I 3GZNB 2GQQA 1EH8A 3IP4B 2L4MA 2V9PA 3MZ8A 3K10A 2VIXA 2KIQA 3CDIA 3W3CA 1BR2A 2PMZN 1W1WE 3FXMA 4DBQA 4MTDA 1F5TA 1D3YA 1W5CC 2X0LA 3TEDA 3V8LA 2HYJA 2K27A 4LG3A 1IRXA 3E6MA 3F0CA 3REOA 3HGYA 1YI2I 3CDHA 5C4XJ 2PX9A 5BPIA 3HXLA 4TV7A 3JRBA 3IWZA 4Y7NJ 2CW8A 2DAOA 4KN4X 2E2JJ 3S8PA 4BJTA 3PL8A 3H5NA 5JVTA 1W5SA 1TT0A 2XAFA 3S1MJ 4ZTJA 1NG6A 3Q9VA 1Z05A 1TQIA 2Z99A 2BOLA 1X2NA 3OYLA 3PNYA 3P5JA 3WTSC 1AOYA 2LSOA 4CSWA 1Z6RA 1RRJA 5CYVA 3T5XA 1XC5A 2COBA 2F5CA 2Y30A 3BPXA 4XNFA 1S7AA 1ZLJA 3FKJA 3HPHA 1NH3A 3L7WA 5M3FJ 4HNUA 2F5EA 1P92A 4M73A 1JTYA 2ZXHA 2PQ8A 1Z77A 2EILH 4BUPA 2F48A 4HDVA 1T95A 3OYMA 5H20A 1H8AC 1BR4A 5FO5A 3FHZA 4CZCA 1PJRA 3AL0B 4QPQA 2FRHA 3S2WA 2V1DA 3CO7C 4C30A 2O7OA 1XMXA 1O4XA 2HQAA 1MKMA 5IT9Z 2V1XA 1D1BA 1SC7A 3QODA 4XSXF 1SANA 3GTQJ 5F64A 1ZELA 2ZMEB 3I59B 4PGGA 3E5QA 1YFHA 1FP1D 2OUMA 4EJUA 2EIJH 2MH2A 3SYTA 2F2EA 1U8RA 2K9SA 3QP6A 1GXQA 1HW5A 4G6TB 1JKOC 2M34A 3OYHA 2H6BA 2VXZA 4HF0A 1R71A 4IOCF 2ECCA 2MYSA 3WGHA 4RM3A 1I5ZA 3OYFA 2VKDA 3LA7A 1I3AA 1ZQ3P 2E7WA 1BA5A 4EM2A 4EVIA 4NBQA 1WJBA 5LD2C 3IH3A 2F4MB 1VTNC 4XKWA 3A02A 2M5WA 2X85A 3QPTA 4I09A 3LSRA 2NOJB 3LQRA 4KMFA 3CMEI 2NAZA 1BC7C 5ERIA 2V1UA 2FBIA 1H9TA 2CSOA 3WTVC 1OQYA 2H27A 4ENJA 4OMYA 4IOAF 1FIPA 2P5LC 2DFFA 1JI8A 4A2UA 3TO7A 3HC7A 3RCOA 3OS0A 2H94A 4I0AA 1XGMA 2DMPA 1MSEC 2QSGX 4UVCA 1VQ6I 3ABTA 2VBYA 4QIWN 1S9HA 5M5XJ 1SFKA 2FX0A 1ETQA 3MKLA 4U7BA 2CUJA 2QM3A 2EA2A 3F8NA 5D6FA 2K4BA 3FXJA 4XLNF 1ODDA 1BI3A 4X6AJ 2J5PA 2RC4A 4XOPA 2ZJQF 3SHFA 5TJJA 1F9NA 2VASA 4F3QA 3G3ZA 3DTEA 2WAQA 2FD5A 5D5WB 2HYFA 3LAPA 5A2QK 1A04A 2R4GA 3OYBA 3A2KA 2DA2A 2M7AA 3UNGC 3PM1A 4PK4A 2MA3A 1R4MB 1OR7C 2AS5F 3DTIA 5L3FA 2WAEA 4XLEA 2GA2A 1N25A 2QQBA 1KA8A 2XUBA 1K6OA 5CLSA 1NK3P 1FEXA 1IV8A 4KJZA 2VOPA 3ZQHA 2BXYA 2GIVA 2HZTA 1P4XA 4D1QA 2CG4A 4AYBN 2JA7J 2H6CA 5F0FA 1VQLI 3IKTA 5E3OA 5GAHJ 2DU9A 1IN5A 1OISA 2RREA 3ZQLA 2IGNA 3W6KB 5E18F 4Y13A 3O8GA 3ZQIA 3MVPA 1MH3A 5CQEA 5CPRB 3BQZA 2L0KA 2ZJRF 3MMYB 5K7FA 4PJMA 2MC3A 2PMZA 2Q2EA 3FK6A 1OJLA 1PP7U 4GYIA 2QZ8A 4U7DA 4D0PA 3S1NJ 2FBKA 4XN3A 5HS9A 2Q8KA 3OSFA 4PJJA 3R0AA 3KYLA 3DWLE 4CHUA 1T39A 4CGZA 3AG2H 5ILUA 3VWBA 2O0YA 2EBIA 1KZHA 2ICWG 1B9NA 1XMAA 4LOCA 3T0YA 2CGPA 4FISA 3RYRA 3CCSI 1ETWA 2H1KA 5LHHA 4ESJA 3FZVA 3KEOA 4RBOA 2JN6A 1GV5A 4EGYA 4A3MJ 1TBXA 2R7SA 4AVZA 4I0BA 3ZP5A 1FZPB 3BT9A 3ASNH 5J1UA 3CJRB 4AIKA 1W36D 2IA1A 2BGCA 1K7AA 5BNGA 2DA1A 2K5CA 3V4GA 3P7NA 1XGOA 2R0QC 2LY1A 4IX7A 2Y2ZA 1SFXA 2DOEA 2WAFA 2DA3A 3BQYA 1T38A 2QUFA 4DW6A 4EJWA 4HV6A 1QNTA 2ME0A 2IXSA 3BG5A 3G1LA 3KFWX 3HIFA 4A0YA 2DT7B 3LSJA 2FJ1A 2OD5A 3WTXC 2R5YB 1SFUA 1T33A 3FX3A 4BE1A 2E1NA 2KKOA 1F36A 2DT6A 1IAWA 2ZSHB 3IV5A 4KA4A 1KU2A 4W97A 5IOYA 5JLWA 1G3YA 1XCBA 3Q0VA 2A6HF 2BXZA 2CH0A 4IZZA 4CXFA 2XAUA 3L2WA 2RVCA 4II2A 3IH2A 3ZN0A 3A4CA 5IOZA 4N0BA 1I27A 4G7OF 2J5OA 3K4CA 4MEYF 2FMLA 3M9AA 2EIKH 4IXAA 1LDDA 2JA6J 3PO2J 3HRMA 4C3IJ 1NK2P 3KP7A 2CUEA 4II3A 3EUAA 3FXUA 2XGEA 4MQVA 2ISZA 4RDUA 5K5QA 3CESA 2C6YA 5J3LA 3VYRB 5IP7J 1MIJA 1FTTA 1NTCA 1TNTA 2IA0A 5DM7F 2P8TA 1ZGAA 2HU9A 2BY1A 2QVOA 3BOQA 4RMNA 3WG9A 5D8KB 4Q48A 2DFHA 1VQ8I 4EGZA 1MDMA 1P7IA 3LOCA 1FBQA 4IRIA 3WE2A 1TWGJ 2F4OB 5F27A 3R60A 4IQ4A 3ERED 2HPIA 4AVPA 3NQOA 3CO6C 2Y75A 5KCMA 4EJOA 4F91B 1U8BA 2AQFA 2HYGD 1FX7A 2L9VA 2TCTA 4BY7J 4RB1A 1BOAA 4KIGA 2HR3A 4BYYA 4A3CJ 4LK1F 1UAAA 4AC0A 4BHCA 4RA2A 2LP0A 3EUKL 1HCRA 2Z2SB 2ZNYA 1JKRC 5C44J 2CFOA 4IF4A 1WJEA 3CCQI 1P2FA 3HDDA 1B8IA 2OV7A 3E3VA 4ZZLA 3D5LA 3T8RA 4PJLA 4S05A 3GXOA 2P7CB 2R7VA 1R36A 4C3JJ 2E35A 1FIAA 2EZHA 2DBBA 4EMSA 1L3LA 2CQNA 4GO1A 3MEXA 4IHXA 4EATA 1ZG3A 1X19A 1ETYA 1GVJA 3K4KA 2A69F 2QENA 2DJIA 3I56I 3J81Z 4B47A 4DBRA 1CF7B 1IXCA 1MZBA 2W1OA 2D45A 1WPKA 3H9GA 2TRTA 1DGWY 1WCMJ 1B72A 2IPQX 4Y52J 4WXCA 2F4IA 3CUQA 3CMYA 1ON2A 2JSPA 4I2OA 2LR8A 2JA5J 2CQQA 4AYBA 3ZQQA 3WTUC 3GFMA 2E1MB 4JQFA 1IJWC 4H4KC 2K86A 5BQTA 1XB4A 2LBFA 1ORKA 3JW4A 3RKWA 2VODA 3H3UA 3K4BA 3GTOJ 3DLLF 3OSGA 1DPUA 5IYBJ 3AG1H 2ISYA 1OLTA 1U78A 3VEPA 2X9DA 4OMZA 1HF0A 1Y0NA 2UZKA 4IEJA 4MTEA 5LEJA 1R7JA 5FLMJ 4N4NB 2XB0X 4ZTFA 4E7ZA 3ZMVA 1AKHA 1JKQC 1S3JA 3UKGA 1YOVB 5EGOA 3DU6A 3H92A 1WFXA 3I0TA 3KP2A 4FX4A 1TTYA 1U5TB 1WRJA 1V3FA 2ZXIA 2HNHA 4HPQA 2HDDA 4YFXF 3BWGA 3GFJA 4N4OB 3VODA 1QZZA 4MFDA 4A0XA 1BN5A 1MSFC 3S16J 2KLOA 2OCCH 2P4WA 1XDUA 3BG9A 5D5XB 2CS3A 1IZ1A 2VJ4A 4N9HA 1ZHFA 3PSFA 5FD6A 1ZYRF 1R5GA 2BV6A 4QSHA 2GXBA 3HOUJ 2V26A 3COAC 1I1SA 2OA4A 1WGXA 4KITB 2IJLA 3A03A 2KRFA 4HQMA 5CVRA 4A3DJ 2DYSH 4MGRA 4B1RA 3ONQA 1MNEA 1Q1VA 1GT0C 1IG7A 2O8KA 4G8XA 1V55H 2EK5A 1S7EA 4FCYA 4CYCB 4A6EA 2LY9A 3OV8A 2VBZA 1O7FA 1PUFB 2F5VA 2W7NA 1MJBA 2MG4A 2OCEA 3K69A 4I99C 4BS9A 4A69C 4O5VA 1X1AA 2RNGA 3OYAA 2K40A 3F8MA 3KPHA 2LG4A 1LB2A 3SQNA 4BXXJ 3ZMDA 5FROA 2IGKA 1JT6A 3I71A 3GF2A 1LDJA 1R6RA 4IPAA 2HFHA 1XD7A 1G2HA 3LFKA 3IHUA 1IC8A 4A3GJ 1BIAA 4HX8A 3I4MJ 2YX4A 1J0RA 1LFUP 2WY7Q 1Y1VJ 4PUSA 1IRFA 3OOPA 2DTZA 2V1NA 1R49A 1DQUA 3VB2A 3L2QA 2VBXA 2QKLB 4BBRJ 1FYKA 2KT0A 4CCJA 3WGIA 3OR1C 5D8LB 3HOXJ 1WH7A 1T6SA 2M2EA 5GTIC 1JUPA 2NVQJ 2DQLA 1E2XA 1VQPI 4JX6A 2LF8A 4Q47A 1DPRA 1JXSA 1ZN2A 5JI6A 5LFAA 3H5RA 2WBMA 1LE8A 4LIVA 3BJ6A 3Q9SA 2MABA 3RZOJ 4HLYA 3MZHA 3DBHB 2KFDA 3TOBA 5M5YJ 1W36C 1IN6A 1W0UA 4RGUA 4IHWA 2XC7A 2EV5A 1BJZA 3K4NA 4JX5A 2CQKA 4E70A 3OYKA 4XLHA 1A35A 2R7UA 1HA8A 3DF8A 4HQEA 2HPMA 5IYCJ 2W24A 3A01A 1HBXG 1D8JA 2E34A 2HEOA 3HSEA 3BTLA 2DYRH 5FFXA 4XRSG 5IP6A 5J6XA 2VONA 2VPRA 2ELJA 4N9IA 2AXLA 2GOXB 2HQ5A 4UNOA 4NDLA 2MD5A 2WB1N 1XPXA 3M4OJ 4OWRB 4D5FA 4GCVA 2ESNA 4G9YA 3VSLA 4CDGA 4A3EJ 1RKWA 2DPDA 2XPUA 1FP2A 4NC7A 1ZR2A 5F08A 4A3LJ 2IRFG 3H0GJ 3CCYA 5CQGA 4A3KJ 2DW4A 4OOIA 3ZN1A 1A5JA 4HX7A 3GLLA 3K2AA 3GZ6A 1C0WA 2ZC2A 3D5RC 4Y4RA 2L7FP 4RAZA 2EWNA 3TL4X 2BYVE 4E7HA 1HDPA 3FMSA 5LGTA 3QQAA 4P9UA 4A3BJ 1FYLA 2LLKA 3EUHA 2CJJA 4PFPA 4B09A 3CLOA 1ETKA 1SAUA 4PZJA 1XMKA 1D8KA 2DTRA 2VKHA 1EH6A 1N75A 2Z3YA 2M9HA 4CCKA 1DU6A 4BEHA 1H89C 2PJRB 5IT9K 2DFEA 2ZO4A 3IRRA 3RQIA 1SEUA 4BY1J 5KVRA 3JAMZ 3S3OA 3GFLA 4D7MA 3WTTC 5EF6A 1Q1HA 2ME6A 2RNJA 3DPTA 5BMZA 2VE8A 4LGWA 3OYDA 2GBYA 3OL4A 5IP9J 3JTGA 2OQGA 2EZLA 4L9TA 3M1EA 1J5YA 1KYZA 1YRNA 1G3SA 2I10A 1YJ9I 4NB5A 1UHSA 1FY7A 2L5QA 1ZRCA 3KCCA 5JR3A 4BE2A 4E4HA 5GPAA 3OYNA 5J8FA 2EFWA 5KAIC 3NRVA 4RAGA 1IW7F 3CTAA 2HDCA 4YELA 1W7PB 4W1UA 4U0YA 2EJRA 3KP5A 2LTPA 3V8JA 1QU3A 1TLHB 1S29A 1T98A 3WG7H 2M87A 3ZMSA 2XASA 4XM3A 3Q0UA 3O8HA 1O7LA 2VKVA 2O03A 2ACJA 2CV1A 2FUG2 5B66C 1K78A 1TNSA 2YS9A 2CV2A 3BR5A 1WKMA 1RNLA 1XTAA 2G0EA 2KJBA 4UY8I 3H35A 3BY6A 1UB9A 3I4PA 2CUFA 2M45A 4R8HA 1R22A 2E19A 3BTJA 3VYSB 1H9GA 1WI9A 1MMDA 2B9SA 3IH4A 3KETA 2V79A 4AIHA 2P0WA 1RIOH 2EH3A 4M3EA 3RSNA 3ASOH 4KUMA 1R1VA 3I3LA 3CJTB 4BHBA 2MSYA 3H0DA 1MNDA 2A61A 4BDYA 2YPRA 4RAFA 3L2UA 1R1UA 1K83J 1HKQA 3RTRA 2V6EA 2HDWA 4JP0A 1CQTA 2R7RA 3K6GA 5AONA 4RGXA 4B8XA 4MEXF 3JRGA 5J4VA 1TQPA 4ZDLA 3FXQA 5GADJ 2LD5A 2M1BA 4Q5SF 4E7JA 5DM6F 2CW0F 1X3WB 2E5ZA 3JRIA 1S72I 3H5AA 5LGNA 3U21A 1J09A 1N77A 5CVJA 3FM5A 4V2FA 4L5IA 4XL9A 2PBIA 3E5UA 2Z33A 2UXXA 1ZG5A 4GDFA 1OFCX 3BCBA 3F21A 4ASNA 3GW2A 1GDTA 2MC4A 4BHPA 2XF6A 3BP8A 1WQ2A 1WJCA 1MD0A 1ETOA 2HTJA 3FHNA 1BI0A 2OZ6A 1AU7A 2DMTA 2OBPA 1P7JA 1MMNA 4MO7A 1VQOI 1GUUA 5LEKA 3CUOA 3AL0C 1WHUA 1TZLA 2CWEA 3MKYB 1WH5A 4U88A 3OWTA 2D2WA 5JLXA 5HS7A 2WB1A 3IL2A 3HUGA 3QRFF 3TGNA 4AWXB 5HDNA 1OPCA 2EQRA 2JZYA 2ECBA 5ICCA 1FJLA 2K9NA 2FBHA 1UG2A 4AU7A 4A3FJ 3IAS2 2O8XA 4ZYHA 2XPWA 4B4CA 1WJ5A 4WCGA 1MBGA 1I39A 1H88C 1FOKA 4M6XA 2LRDA 1X58A 2R93J 3M07A 1MMGA 2ZMEC 4KIFA 1IUYA 5EEAA 1T2KA 1I6XA 4DZJA 3S14J 1FSEA 3SJMA 2ZFWA 3PUBA 2M8EA 3CUQC 2A5YB 5HVQC 4FE4A 3JCUC 4ETSA 3SDGA 5DCMB 2CMPA 3J7AO 3H36A 3PFIA 1P4AA 4XBFA 2OPTA 5H6RA 5CJ9A 1BW5A 4LFUA 3BDDA 3BR6A 2GOMA 4HEA2 1UHMA 1Z3XA 2HZDA 1ULYA 4U87A 3SFIA 5JVGF 2Y0SN 2X1EA 3K2ZA 2O9LA 4QLCU 3FXOA 1HQCA 2O61A 2XAHA 5CKTA 4XLPF 4DNCA 3MAJA 1AWCA 3GEZA 1FPQA 2P6TA 3A0HC 2VT3A 3OOUA 3T8TA 4MNUA 3S3MA 2RN7A 3BZKA 4KDPA 3S32A 2JT1A 3GCMA 3V42A 4D5CA 3BG6A 1WJDA 3KLOA 3LSTA 2LKSA 3C7JA 3M8JA 5E8IA 4BU2A 1ONVA 2E60A 3FKIJ 4BXUA 2KP6A 3HEFA 4XRMA 2L9NA 1BBYA 4P55A 1YLFA 4PSXA 2XSJC 3QPSA 3Q0WA 3HG9A 4HAMA 4RGSA 5DCFA 3HKZN 4F52A 5HS8A 5K5RA 3OYEA 3G6EI 1W4MA 1YIOA 2XROA 2VLAA 2COMA 1J7KA 5HODA 3EYIA 3EETA 2FEZA 5HNHA 1WZ2A 2ZXJA 2JMWA 4KICA 9ANTA 1XG1A 3SFZA 3VPRA 1MH4A 3O2PE 1BR1A 3LWFA 2K9MA 4KFCA 3S1RJ 1QVUA 3KP4A 3JR9A 1J59A 2F5FA 1V5FA 2DDAA 5H6QA 5B5EC 3F6VA 2X6OA 3JRCA 2OQRA 2BVMA 2BHZA 4C2UA 4B3XA 3ZMTA 2R7TA 5E1WA 3V7CA 1OCZH 2QYOA 2A68F 3DCFA 1XSXA 3C1DA 1FYMA 3PQKA 1HW2A 5ILVA 3BJOA 1TWAJ 3CCMI 3W2AA 2DPUA 2WTEA 1USTA 3G73A 1V5GA 3SXYA 5EG0A 2HVQA 1J9IA 3M3YJ 2KPMA 5K1YA 1YITI 2R5ZA 2LK2A 4IRGA 3TP0A 3CMMA
chains in the Genus database with same CATH topology
3OY9A 5KHDA 2XF7A 2VQHA 2ZSIB 4N4NB 4ZTFA 1E0EA 4F93B 4E7ZA 4PSWA 1X1BA 1K6YA 2KHMA 3FBNB 3MKZA 2LOOA 3E1SA 3DU6A 2VJ5A 1WFXA 4NUBA 4ZDPA 3LSMA 2ZXIA 2HNHA 4HPQA 4XKVA 2L9SA 2IS4A 3W2WA 4N4OB 2Z16A 4GRIA 3DKYA 2K3PA 2LBFB 4B44A 1QHHD 4E7KA 2KLOA 3H9QA 4XMYA 2R7XA 3RPUD 2IGOA 4YEJA 2CS3A 2VJ4A 1ERDA 3BLYA 2W82A 3PSFA 4BQNA 3OIPA 3VYTB 2R7WA 4KISA 2Z1DA 3PFYA 1X4PA 4CCLA 2V26A 1X1CA 2K9LA 4NQWB 4BL0B 5JHFA 4KITB 4BQOA 3L2RA 1UELB 3ONQA 1MNEA 3ZRGA 1Y6IA 1YX3A 4ANJA 2WA0A 2F6CA 3H9JA 3TBIA 4HNTA 1D1AA 2F5VA 2W7NA 2I8DA 4BS9A 4Y3OA 2L7KA 1T0FC 4BGDA 1WJAA 1X1AA 2RNGA 3LSGA 3OYAA 4J01A 2LG4A 5FROA 3IP4B 2IGKA 3K10A 2VIXA 2VJIA 1R6RA 2BW3B 3W3CA 1BR2A 2X6YA 4XLAA 2IS1A 4DBQA 3A1YA 4BEHB 4BQQA 4QPOA 2KL4A 3G2BA 2WY7Q 4PUSA 3UR3C 4LG3A 2V1NA 1IRXA 1DQUA 3L2QA 3EUHC 2A5WA 3LSKA 2QKLB 2V9KA 4E7IA 4CCJA 2Y0SA 3HXLA 4BJ5C 3OR1C 5HOOA 4CCOA 2DXIA 4LIUA 2CW8A 2L2OA 3EPZA 3S8PA 4BJTA 3PL8A 3C2GA 3H5NA 4CA0A 1TT0A 5LFAA 4ZTJA 1NG6A 2JUGA 4B48A 3H5RA 2WBMA 4LIVA 3K4MA 2BOLA 2MABA 4C9YA 3OYLA 3PNYA 1W36C 4CSWA 3NWSA 4XNFA 2XC7A 3BG7A 3FKJA 3K4NA 4XLFA 1EA3A 3HPHA 3OYKA 4CCNA 4XLHA 2R7UA 4HNUA 1HA8A 4XR6A 2HPMA 2XDVA 2ZXHA 4ZC3A 4BUPA 4FETA 2RQQA 3QYEA 1KONA 3RQ4A 2OC6A 2X51A 2KMUA 1T95A 3OYMA 4HRIA 1BR4A 2ELJA 2GOXB 1Z7LA 4CZCA 3HKZA 1PJRA 3AL0B 4QPQA 5HLTA 4DJAA 4C30A 2O5RA 1D1CA 4R79A 4OWRB 4F55A 3BCAA 1Z21A 2HQAA 3K4LA 3CP2A 3J7AY 3VSLA 4ITVA 1D1BA 4NC7A 2PJRA 2LYCA 3QODA 2KZVA 3CF2A 1ZELA 5CQGA 1NG7A 2OUMA 3SYTA 4G6TB 2UWMA 4P5OA 2VXZA 3OYHA 2IS2A 3LSHA 3AKZA 4E7LA 3D5RC 3OYIA 4Y4RA 2E1MC 2MYSA 3TL4X 3AFHA 4RM3A 3OYFA 4E7HA 2A6TA 2CV0A 2VKDA 3SDBA 3K70D 3DU5A 2JVGA 1Z3YA 1Y56A 2KRHA 1WJBA 2ZFUA 5LD2C 1D0ZA 4PFPA 1SAUA 4XKWA 3PJRA 2X85A 2BW3A 2NOJB 2VKHA 1N75A 4CCKA 2W4SA 3F9KA 2VQCA 4BEHA 2PJRB 4XKCA 2KQRA 1FMWA 3S3OA 3LSIA 3CZ6A 3ZXSA 1JI8A 1LVKA 4J00A 4RLFA 2JA2A 3CP8A 3DPTA 3HC7A 3ZCOA 3ZGKA 4NNJA 1FMVA 3OYDA 3DPLC 3OL4A 3RCOA 3OS0A 2M4KA 3QYFA 4HG2A 1S9HA 1SFKA 2HVSA 4U7BA 2L5QA 2CUJA 3PSIA 4BE2A 2VQLA 3PNVA 4E4HA 4XKBA 5KNLA 3OYNA 3KX2A 2MFZA 2M7BA 3CJQB 4XOPA 4B43A 1LKXA 2QKMB 4YELA 2VASA 4F3QA 4ZJZA 1QU3A 3DTEA 2WAQA 3DLAA 3E0JB 4XM3A 2R4GA 3OYBA 3A2KA 2M7AA 3UNGC 2UUZA 4PK4A 2CV1A 1OR7C 2FUG2 3DTIA 2CV2A 1DP3A 1D0YA 2V4JC 2WAEA 4XLEA 3H35A 1BOBA 3VYUB 4KJZA 3VYSB 4D1QA 3C2HA 1MMDA 2R7OA 3M1CA 2RREA 2P0WA 2IGNA 3TMOA 3RSNA 2VB6A 3I3LA 1U0JA 2DOAA 3ZR8X 3H0DA 1MNDA 4BDYA 2BVLA 2X1CA 3L2UA 5CQEA 5CPRB 3OS1A 2VPLA 3SEQA 3RTRA 2V6EA 2HDWA 3MMYB 4PJMA 4YRVA 2PMZA 2X6WA 2R7RA 3K6GA 3BC8A 2DCEA 2LY2A 3DQVC 3HPGA 4XN3A 4PJJA 4E6KG 4Y33A 3DWLE 3KYLA 4ZDLA 3VWBA 3MKWB 3DKXA 3OS2A 4E7JA 4C2TA 2E5ZA 3H5AA 3U21A 1J09A 1N77A 3DTKA 3LL7A 3DEEA 2R7SA 1YE9A 4LITA 4XL9A 4AVZA 1WJFA 2XF5A 3BCBA 2M3AA 3CJRB 1W36D 2MD0A 4OAZA 2K5CA 2LREA 3OR2C 2MC4A 3LMMA 2LY1A 2XF6A 2KRCA 4XOTA 4IX7A 1WJCA 4F92B 3OYCA 1PYVA 4CCMA 3OYJA 3HOTA 2WAFA 2Q2EB 3GBGA 4IKFA 3FHNA 2IXSA 2DT7B 2E5NA 4BE1A 1MMNA 3S3NA 5FRMA 1DGRM 2JVHA 3VSKA 2DT6A 1P9QC 3AL0C 4OAYA 2ZSHB 1TZLA 4XONA 4FASD 3MKYB 4BE0A 3OWTA 4XN0A 4P1WA 4RM2A 2WB1A 2LH9A 5HNFA 2CH0A 4PFOA 4IZZA 2VXDA 3D5SC 2XAUA 4AU7A 3L2WA 3IAS2 2LC2A 4II2A 1WJ5A 3L2VA 1G59A 3A4CA 3IAM2 2LRDA 1X1DA 1MMGA 3K4CA 3PUBA 2R7QA 5HVQC 3OIQA 2HVRA 3SZGA 1MW7A 1G8XA 1LDKB 2CMPA 3QOEA 4II3A 3EUAA 1YX5A 1VZ0A 2IGMA 4CH7A 4E7SA 3I9V2 3CESA 3VYRB 2GOMA 3HOSA 4HEA2 1Z3XA 2HZDA 4U87A 3FBIB 4RMNA 2HU9A 3SEZA 2X6XA 2X1EA 3HUGB 2IS6A 4DGWB 2M0MA 5CKTA 3S93A 2VQGA 3DPUA 2X1DA 3N05A 4IQ4A 5TGTA 2HPIA 2WY8Q 3OOUA 3S3MA 2M4GA 3QYBA 1UG0A 5KCMA 3S32A 4F91B 2Q1ZB 2V7FA 4D9JA 2AQFA 3LFUA 3V42A 3HL2A 3BG6A 1WJDA 3M8JA 4BU2A 2E60A 2KP6A 1UAAA 2L9NA 4BDZA 3EUKL 4PSXA 2Z2SB 3VDXA 4DOZA 1N78A 2XSJC 3K4JA 3HG9A 2CFOA 4NC8A 1WJEA 4MLOA 4F52A 4BXFA 3OYEA 5FRNA 2OV7A 3D5LA 1LFPA 1GLNA 3W2VA 2VLAA 4PJLA 2R7VA 2VJJA 5HNHA 4KT6A 2UV1A 1AA7A 2AQEA 2W00A 4XORA 3OYGA 4JOMA 4EATA 1X19A 4X0GA 1BR1A 3K4KA 2K9MA 4CUGA 2DJIA 3IUOA 2WADA 3MD2A 1V5FA 4IQJA 2CW7A 4B47A 4DBRA 3KEYA 4DIQA 2W1OA 2KDOA 4HSTA 4ZYAA 3H9GA 2BVMA 1DGWY 4C2UA 3PNTA 4B3XA 2VL8A 4ZDOA 2R7TA 2F4IA 4XLCA 3OMYA 2JSPA 4PJNA 4AYBA 3ZQQA 4BACA 1QHGA 2E1MB 4JQFA 2CUZA 3W2AA 4H4KC 4XQFA 3FDYA 2LBFA 3OL3A 1MMAA 1V5GA 2HVQA 4RLQA 3K70C 1D0XA 1V5EA 2KPMA 3K4BA 4BJ6C 1X4OA 3NWTA 4HSRA 1OLTA 3CMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVH A;  2GOX B;  3D5S C;  2JVG A;  2NOJ B;  2WY8 Q;  2WY7 Q;  2GOM A;  3D5R C; 
#chains in the Genus database with same CATH topology
 3OY9 A;  2K9Q A;  3GUD A;  2XF7 A;  2ETH A;  1XGS A;  1QPM A;  3FWE A;  2DK5 A;  2JA8 J;  2CRG A;  3ABK H;  4HF1 A;  1ZTR A;  1JGS A;  1FTZ A;  1YHQ I;  4F93 B;  1G3W A;  2STW A;  1MJ9 A;  3J81 K;  3E5X A;  2YX7 A;  1K6Y A;  3TO6 A;  3PIO F;  2LOO A;  3E1S A;  4I01 A;  1J2X A;  1SD5 A;  3K9T A;  3CCV I;  2A05 A;  2XPV A;  4ZDP A;  3LSM A;  5DDG A;  1BW6 A;  5B1B H;  5LGU A;  3J7Z I;  5DD4 A;  4XKV A;  5L3E A;  2FU4 A;  2W25 A;  2EB7 A;  1HKS A;  4LJZ F;  1F43 A;  4LG0 A;  5DD8 A;  4B44 A;  4E7K A;  1QHH D;  3H9Q A;  1OYY A;  2R7X A;  3RPU D;  2LMD A;  1EKE A;  4YEJ A;  1SD6 A;  2FA5 A;  3MN2 A;  3VYT B;  1FBS A;  2R7W A;  3PFY A;  4NHJ A;  1X4P A;  3D1N I;  5L3C A;  2I5U A;  4EQQ A;  2DMQ A;  1X1C A;  2K9L A;  4IRH A;  2L02 A;  3QWL A;  4NQW B;  2QBY A;  1Y8R B;  2V9V A;  1MGT A;  2RDP A;  1XCV A;  2Y69 H;  3RIR A;  4A5M A;  3RI4 A;  2RAE A;  1OCO H;  1YX3 A;  5E3L A;  2ELK A;  3C18 A;  2LKP A;  3H9J A;  4AM3 A;  4K2E A;  1YJN I;  1JHH A;  5ILS A;  1IDZ A;  4A0Z A;  1YJW I;  3P9K A;  4IHV A;  2A3S A;  5TRD A;  1JUM A;  2JRT A;  5FLV A;  3P9C A;  3TDZ C;  2VKE A;  4ENK A;  2L7K A;  2ZJ2 A;  5BS6 A;  4BGD A;  1QQI A;  1WJA A;  5E1X A;  1XN7 A;  4YFN F;  4J01 A;  3WGG A;  4FT8 A;  2W57 A;  4CIC A;  2KIF A;  3X2Q H;  3I53 A;  5AIQ A;  2P6S A;  4GFB A;  2VJI A;  2K85 A;  1FT9 A;  3I5U A;  2X6Y A;  3GLX A;  4UUS B;  2PMU A;  4M3G A;  4BEH B;  2P7V B;  5E79 C;  1RC9 A;  2VBW A;  1Y1W J;  4ZYG A;  4XRF A;  1LJ9 A;  3F6O A;  3EUH C;  2A5W A;  3LSK A;  2V9K A;  2VT2 A;  2Y0S A;  1ENH A;  4BJ5 C;  5HOO A;  3CCR I;  4CCO A;  2QSH X;  2FOW A;  2DXI A;  1REP C;  2L2O A;  3EPZ A;  4U0W A;  3C2G A;  3PQJ A;  2BEO A;  2L3D A;  6PAX A;  5DV5 A;  1QPI A;  2LKX A;  3U1K A;  4C9Y A;  1D5Y A;  1QZE A;  4ENM A;  2ZME A;  3I59 A;  3KP6 A;  2HKX A;  5DUK A;  5FB2 A;  3KZZ A;  2KZG A;  5LHI A;  2WV0 A;  4J19 A;  3RZD J;  1ZGW A;  2KDZ A;  4XSZ F;  4HX4 A;  3BTI A;  1SD7 A;  1FNN A;  4ZC3 A;  1XSV A;  2RQQ A;  3GTG J;  2LDU A;  1Z0X A;  2OC6 A;  2NS8 A;  3JRH A;  4HRI A;  4KYW A;  4X1E A;  4S0H B;  4XRS A;  1Z7L A;  3HKZ A;  1DUX C;  1YW8 A;  2FMY A;  2DN0 A;  1W7P D;  4EEF G;  4XID A;  4XIC A;  4DJA A;  2LF7 A;  1FLI A;  2O5R A;  5K7Z A;  4R79 A;  2CQX A;  1STZ A;  1Z6T A;  2Y9Y A;  4A6D A;  2DMN A;  4H0E A;  1Z21 A;  3LA2 A;  1RI7 A;  2JSC A;  5HLG A;  3J7A Y;  3QAH A;  5FKK A;  5LRS A;  3CCJ I;  4YII A;  3GYH X;  1T0F A;  5KK1 A;  2VN2 A;  1ZRF A;  4G6D A;  3CCE I;  1RPW A;  3BR3 A;  1BL0 A;  2UWM A;  2K4J A;  1YS7 A;  1QVT A;  3AKZ A;  5CVU A;  3OYI A;  5F04 A;  2E1M C;  3E97 A;  1UFM A;  5E3M A;  2A6T A;  2CV0 A;  1X2M A;  2R3S A;  5JFR A;  1M1E B;  1SMT A;  4PGH A;  4L9N A;  3LQQ A;  2EFO A;  1R23 A;  1Y56 A;  2KRH A;  1KGS A;  1D0Z A;  2KIM A;  2DFI A;  4A93 J;  3PJR A;  3KZI C;  2BW3 A;  1R5I D;  5J4Y A;  2XIG A;  2MH9 A;  2P81 A;  2W4S A;  2EIM H;  3ERM A;  2VQC A;  3TP3 A;  1LEB A;  1IDY A;  2VUM J;  5IT3 A;  1LFB A;  1FMW A;  4KT5 C;  3LSI A;  3CZ6 A;  3ZXS A;  1LVK A;  1R1T A;  1QRY A;  3ZGK A;  2L7M P;  4GGG A;  3HOY J;  1U5T C;  1FMV A;  3DKW A;  2AXT C;  3DPL C;  2ID6 A;  5EZH A;  4BNC A;  1T8I A;  5E17 F;  3CC4 I;  4ESB A;  4HG2 A;  2BHY A;  1EF4 A;  3I55 I;  4P96 A;  4I02 A;  2KIS A;  2NVY J;  4FHT A;  3PO3 J;  1IV6 A;  5HDK A;  1WSU A;  3EDP A;  2M7B A;  3ZOB A;  1A6Q A;  4B43 A;  1LKX A;  3K1N A;  5C4J J;  2Z5U A;  2OU2 A;  4F7Z A;  2W85 A;  1OCC H;  2NVU B;  4L18 B;  3E0J B;  3RPQ A;  3AG4 H;  3ABM H;  1ITY A;  4XK4 A;  1B59 A;  3ZQG A;  2DO7 A;  3JAM K;  2IVM A;  2V4J C;  1I3Q J;  4OU0 A;  3DV8 A;  1XDS A;  2IW5 A;  2G7U A;  2HS5 A;  1BOB A;  3OIO A;  2JUC A;  4BQA A;  2DOF A;  2FNP A;  1VFC A;  2R7O A;  2DLL A;  4Z6Y A;  4DYQ A;  4I7H A;  1H0M A;  4QWQ A;  5DYM A;  5FLX K;  4EJV A;  2VB6 A;  2AO9 A;  4AID A;  2DOA A;  3ZR8 X;  5M3M J;  2ESH A;  2XGD A;  1V4R A;  3RKY A;  1XGN A;  3OS1 A;  2VPL A;  3SEQ A;  4FQG A;  2EFN A;  2GWR A;  5BPD A;  1IRG A;  5J8C A;  2QQ8 A;  5FD5 A;  2X6W A;  3ABU A;  2D1H A;  1TL8 A;  1FBU A;  4M6V A;  1ZLK A;  3BC8 A;  1QGP A;  3FMQ A;  4G94 A;  2LY2 A;  3G4S I;  2R5Y A;  2R92 J;  1KU3 A;  3DQV C;  3HRU A;  4E6K G;  2DJN A;  5F1R A;  1BM9 A;  3H1C A;  5LRR A;  4EV0 A;  1POG A;  1ZKG A;  1L0O C;  3TOA A;  2KJC A;  3F8B A;  3MKW B;  4AIJ A;  1ON1 A;  4C2T A;  3T1B A;  3ZQC A;  2PMH A;  3DTK A;  3JRD A;  2OAZ A;  3BPV A;  4YFK F;  4U0V A;  3DEE A;  1IN8 A;  3W6J B;  2VE9 A;  1YE9 A;  2FQ4 A;  3EYY A;  4LIT A;  2M3A A;  3CF5 F;  2YR2 A;  1EJ9 A;  2FQ3 A;  2E71 A;  2MD0 A;  4OAZ A;  4WF2 A;  5HLH A;  3PUF A;  4G7H F;  2Y48 A;  4PDK A;  3OR2 C;  3IC7 A;  3LMM A;  2XVC A;  4L9J A;  4DYC A;  4KN7 X;  4XOT A;  1U9N A;  3GTK J;  1JHF A;  3OYC A;  1PYV A;  3TQN A;  2Q2E B;  4IKF A;  2H1L A;  2QQ9 A;  3TO9 A;  3S3N A;  5LLQ A;  3L2C A;  2R7F A;  1DGR M;  3BTC A;  1FC3 A;  1P9Q C;  1T08 B;  4UB6 C;  2DT5 A;  4WX9 A;  4XON A;  1A36 A;  3CLQ A;  1ZGJ A;  4FAS D;  3Q5F A;  1FOY A;  2RV8 A;  1HDD C;  3J80 Z;  2E1O A;  4KNY A;  2HOE A;  5J1R A;  5HNF A;  1PDN C;  4LLG F;  1UJ8 A;  2PLY A;  2FXA A;  2UXN A;  2VXD A;  1XX5 A;  5H2F C;  3HOW J;  2LC2 A;  1S7O A;  2PG4 A;  3L2V A;  2FE3 A;  2K02 A;  1RUO A;  3TW6 A;  1QZY A;  1X1D A;  1YIJ I;  2HOT A;  2NRA C;  1X1P A;  3JRF A;  3HRS A;  2NS7 A;  3E6C C;  3KP3 A;  4CO8 A;  3K0L A;  1WVR A;  1R58 A;  2R7Q A;  2YU3 A;  1MW7 A;  4BAY A;  3QOE A;  2XHK A;  3KYD B;  1YX5 A;  1ZK8 A;  2IGM A;  2H8R A;  4UHT A;  4HDU A;  3I9V 2;  2NNN A;  3NEU A;  3WHB A;  1O3T A;  1VQ9 I;  4FX0 A;  1MBF A;  5CVI A;  2QQA A;  3ML6 A;  5EYR A;  3V8K A;  4EM1 A;  4HNV A;  3U1D A;  3FBI B;  3L09 A;  2X6X A;  2NVT J;  1IO2 A;  2GIZ A;  1TWC J;  3AG3 H;  4LB5 A;  2IS6 A;  4PCQ A;  3M8E A;  2VQG A;  2K3F A;  3DPU A;  3K1M A;  2X1D A;  5FFZ A;  5ICG A;  2ZJP F;  2E1C A;  1I50 J;  4A3J J;  2M4G A;  4M9X A;  3TKY A;  3QYB A;  4D9J A;  3V7S A;  1CF7 A;  4WK8 F;  1VI0 A;  3LFU A;  3HL2 A;  3LA3 A;  2JQ7 A;  4V2G A;  3HM5 A;  1SD4 A;  3S2H J;  4M6Y A;  4KMU X;  3E6D A;  4UVB A;  5F6F A;  1AHD P;  3ESW B;  3A0B C;  2QBY B;  3F8F A;  3VDX A;  1N78 A;  3C2B A;  3K4J A;  5E3N A;  4NC8 A;  3ZPL A;  4BXF A;  1LFP A;  2GA1 A;  1FWZ A;  1GLN A;  2A07 F;  3L9F A;  4HYE A;  3GTM J;  5GTH C;  2VJJ A;  1MDM B;  3G1M A;  1E3P A;  2UV1 A;  1P6R A;  3JSP A;  3I58 A;  2AQE A;  2W00 A;  3GZ5 A;  2LVS A;  3KEQ A;  4XOR A;  4X0G A;  1Y0U A;  1U6G A;  1MMS A;  2KIU A;  3IUO A;  2WAD A;  1BC8 C;  3BG3 A;  3MD2 A;  3PIP F;  4IQJ A;  2CW7 A;  1TQM A;  4DIQ A;  4QTR A;  4UV9 A;  4HLX A;  4A12 A;  1EV7 A;  2KDO A;  4HST A;  4JX4 A;  3SZP A;  1OCP A;  5FJ8 J;  5LBQ A;  4ZDO A;  4OIP F;  3ECH A;  1U5T A;  3OMY A;  3JSO A;  3DFG A;  4PJN A;  3RDI A;  1VQN I;  1QHG A;  3N4M A;  4JYK A;  2B0L A;  1VQM I;  3RJP A;  4XQF A;  2OZU A;  3FDY A;  2CFX A;  1B8I B;  3OL3 A;  4MFE A;  1MMA A;  2QSF X;  5DEQ A;  5HDG A;  4RLQ A;  2X4H A;  1D0X A;  3M7G A;  1TW3 A;  3FMR A;  1GV2 A;  3WOD F;  1FOW A;  3NWT A;  2AHQ A;  3R61 A;  5CVV A;  1T56 A;  2A6E F;  1SVM A;  1YTY A;  5KHD A;  5E8G A;  2Q0O A;  1DDN A;  1LVA A;  2MBF A;  5L3G A;  4UVA A;  3CD6 I;  1FOX A;  2TDX A;  3QPH A;  1LPQ A;  2NNY A;  5K7H A;  2HQN A;  4PSW A;  4KIB A;  3FBN B;  3MKZ A;  1B72 B;  3GVA A;  3KIO A;  3LAJ A;  4OIR F;  3HOV J;  3CUQ B;  4CYC A;  2WWY A;  1GXP A;  2IEK A;  2DA5 A;  1ETV A;  1PUF A;  3FF5 A;  3WE3 A;  4BBS J;  4M3F A;  5EZG A;  2Z16 A;  4Y17 A;  4GRI A;  3DKY A;  2K3P A;  2LBF B;  5DUI A;  2RGV A;  3GO5 A;  1HKT A;  1OMI A;  3G71 I;  1ERD A;  3ROU A;  2W82 A;  4KIS A;  2Z1D A;  4A5N A;  2OJE D;  4CCL A;  5D6E A;  4CZZ A;  2EV6 A;  3ZMU A;  5JHF A;  5EJC A;  4YIF A;  1K79 A;  2X48 A;  1I6H J;  3L2R A;  4BQO A;  1VQ4 I;  1UEL B;  4MHG A;  1AKH B;  3ZRG A;  2BBY A;  5EGO B;  4M72 A;  3BR2 A;  2BE5 F;  2XRN A;  3L00 A;  2F6C A;  3ZQF A;  1CGP A;  3SZT A;  2E7X A;  3MCZ A;  3LSP A;  3LNQ A;  1USS A;  1JT0 A;  5K5O A;  3W6V A;  1UZC A;  3F3X A;  4I98 B;  1TP4 A;  2L4A A;  4Y3O A;  1T0F C;  1ETX A;  2EA4 A;  4LD5 A;  4LLN A;  4FE7 A;  2XRL A;  5DS9 A;  2PI0 A;  1UCR A;  2BY3 A;  4ZYE A;  5IPA A;  2O3F A;  3RPU A;  4EM0 B;  2BW3 B;  3L1P A;  3ELK A;  4ENN A;  2QLZ A;  4XLA A;  4ON0 A;  2IS1 A;  1LNW A;  2HOS A;  1TWH J;  3A1Y A;  4BQQ A;  4QPO A;  2R7Z J;  3HJE A;  5GAG J;  2KL4 A;  3G2B A;  1VQ7 I;  2DDB A;  2ELH A;  3UR3 C;  2HXI A;  2K7L A;  4S04 A;  2XV4 S;  2Z9O A;  2JRM A;  2NXN B;  5L3B A;  2GXA A;  1PUE E;  4ESF A;  3FXR A;  3GX4 X;  4E7I A;  4G6Q A;  2M8G X;  4RB3 C;  4LIU A;  4ABZ A;  1GHC A;  1X3Z B;  2B7E A;  3U9G A;  4WWC A;  4CA0 A;  3DBR B;  2GM4 A;  1F4K A;  1X3U A;  4M9Z A;  2CQ7 A;  2JUG A;  4B48 A;  3K4M A;  1ZRD A;  4L0Y B;  1VND A;  3IRQ A;  3HHG A;  5D5V B;  4ZH4 F;  2JWT A;  4AUX A;  2NOG A;  3D0S A;  1YQA A;  2EFQ A;  4G7Z F;  3NWS A;  4LLL A;  3BG7 A;  3QU6 A;  1K4S A;  4XLF A;  1EA3 A;  2XGC A;  2OTL I;  4CCN A;  5FKN A;  4EJT A;  3HBL A;  4XR6 A;  5TIS C;  2XDV A;  4FET A;  5FGM A;  3QYE A;  1IRZ A;  1KON A;  3RQ4 A;  2X51 A;  1BIB A;  2KMU A;  3CJN A;  4BKX A;  1P4W A;  1TT5 B;  1I1G A;  2V6C A;  2DI3 A;  5FKO A;  3U2R A;  2QWW A;  5HLT A;  3S2D J;  1QBJ A;  1D1C A;  3FXL A;  4HBL A;  4F55 A;  3MWM A;  3ZMZ A;  1JE8 A;  3BCA A;  1MBJ A;  1MNM C;  3K4L A;  3CMA I;  3CP2 A;  4Q4Z F;  4LK0 F;  3KYC B;  2L54 A;  1LE8 B;  4ITV A;  1R00 A;  3HSF A;  3GTL J;  2PJR A;  2LYC A;  3WTZ A;  2VC0 A;  4IVN A;  3ISP A;  2KZV A;  3CF2 A;  2ID3 A;  5GP9 A;  1HLV A;  2N8G A;  1O3Q A;  1NG7 A;  2NS0 A;  4V19 K;  2JJ7 A;  1UHW A;  3JRE A;  2M0C A;  2Y9Z A;  2DOD A;  4RS8 A;  3FIS A;  5C3E J;  4P5O A;  1ZAR A;  2PFB A;  1O57 A;  3LSH A;  4E7L A;  4IHT A;  2IS2 A;  3CDL A;  3Q3S A;  3A01 B;  1A31 A;  4HF2 A;  4IHS A;  3AFH A;  1RR8 C;  3CC7 I;  1OCR H;  3H3Z A;  3SDB A;  3HZJ A;  3K70 D;  3KZY A;  3DU5 A;  1TC3 C;  3S1Q J;  2JVG A;  1Z3Y A;  1R5H A;  2ZFU A;  4IO9 F;  1G6N A;  5F0C A;  4NC6 A;  2BY0 A;  3IWF A;  4C3H J;  2O6G E;  1W7P A;  2NVX J;  2CYY A;  2QF7 A;  3F9K A;  2QA4 I;  5A2Q Z;  5ICF A;  4HW0 A;  4XKC A;  4P9F A;  1SMY F;  1K4T A;  2KQR A;  4L0Z B;  1YYV A;  2JPC A;  4MIM A;  3WU1 B;  2D5V A;  4J00 A;  1ZRE A;  4Y15 A;  4RLF A;  2JA2 A;  2GLO A;  3CP8 A;  1SFE A;  3ZCO A;  4NNJ A;  3BZC A;  2M4K A;  3ABL H;  2P5V A;  3DXJ F;  2P5K A;  3QYF A;  2MLK A;  4BH9 A;  3KLN A;  2HVS A;  4M3D A;  2DA4 A;  3PSI A;  2FF4 A;  3ULQ B;  2VQL A;  3PNV A;  5KNL A;  4XKB A;  4AD9 A;  3KX2 A;  2ZXW H;  2MFZ A;  2FSW A;  3CJQ B;  3KE2 A;  4RAY A;  1QO0 D;  3S15 J;  2QKM B;  1IN4 A;  2XAG A;  2MLG A;  3ECO A;  1RZ4 A;  2XAQ A;  1JJ8 C;  4ZJZ A;  1MBH A;  3DLA A;  3HTU A;  2HOA A;  3C3W A;  2VOO A;  2XGX A;  3F8C A;  1VF9 A;  2UUZ A;  1EH7 A;  3CC2 I;  4C2M J;  3QPL A;  5F0H A;  1S5L C;  1DP3 A;  1D0Y A;  4M74 A;  2R7D A;  1G4D A;  3V7R A;  3CCU I;  5ED4 A;  3VYU B;  5KAF C;  3RKQ A;  3GTP J;  2YUS A;  1YRN B;  3C2H A;  2WV1 A;  2MGQ A;  3P9I A;  3K7A J;  3M1C A;  1XS9 A;  4DQ2 A;  2XSD C;  1WI3 A;  3TMO A;  2VI6 A;  1YW9 A;  1NHA A;  1U0J A;  3WTY C;  2HWV A;  2IT0 A;  2H09 A;  2G7H A;  3BR0 A;  1HW1 A;  2BVL A;  2IBD A;  2X1C A;  2OTJ I;  2XB5 A;  3B6C A;  1YW7 A;  4HV5 A;  3HRT A;  3HSR A;  4YRV A;  3DP7 A;  1W5T A;  5D4S A;  3BJA A;  2DQR A;  5AIP A;  3CCL I;  5F1J A;  2DCE A;  4G12 A;  3HPG A;  2NYX A;  1RKT A;  1O3S A;  4Y33 A;  4IJA A;  1R4N B;  1IF1 A;  1K78 B;  3DKX A;  4JK1 X;  3EQL F;  2LFB A;  4I76 A;  4UB8 C;  3OS2 A;  2FNA A;  1BI2 A;  3J7Y J;  3GME A;  3K1P A;  3R0J A;  1GVD A;  2XKP A;  2D1V A;  3LL7 A;  1LQ1 A;  1JTX A;  1ZH5 A;  1PVE A;  1U2W A;  2YSR A;  2Y31 A;  4YG2 F;  1S8N A;  1JUS A;  1WJF A;  2XF5 A;  2YU9 J;  1WWX A;  1TWF J;  2LRE A;  3MQ0 A;  2PJP A;  3VFZ A;  2EV0 A;  2EPF A;  2KRC A;  1K61 A;  3BZ6 A;  4F92 B;  4I6Z A;  2IP2 A;  2QGU A;  4CCM A;  2W84 A;  3OYJ A;  3HOT A;  1R9T J;  1APL C;  1IUF A;  2IAI A;  3GBG A;  5DCM A;  2E2H J;  3F72 A;  2LNB A;  1DU0 A;  4OIQ F;  2E5N A;  3QP5 A;  5FRM A;  1Z1D A;  2BZT A;  2M30 A;  4UUV A;  2JVH A;  3VSK A;  3FIW A;  1PP8 F;  4HA8 A;  4IHY A;  5JHU A;  4OAY A;  3JRA A;  2ZNZ A;  3G1O A;  4BE0 A;  1OR7 A;  2L7Z A;  1LEA A;  4XN0 A;  3I64 A;  4P1W A;  4RM2 A;  1B9M A;  1TW2 A;  1SFO J;  2LH9 A;  2GZW A;  3VOE A;  1F1Z A;  4PFO A;  3WU0 A;  3N97 A;  3D5S C;  4MQ9 F;  1JGG A;  1O3R A;  4RB2 C;  3QOP A;  1G59 A;  1DP7 P;  3IAM 2;  4B3A A;  3HTS B;  2EFP A;  2ADU A;  5J1Y A;  3TDU C;  4LMY A;  4A3I J;  5M5W J;  1B6A A;  4WXD A;  1QA6 A;  2HQR A;  2CU7 A;  5EEH A;  3BRO A;  1OKR A;  3OIQ A;  3HB9 A;  5FKM A;  3SZG A;  4DZP A;  2HVR A;  1Y8Q B;  1G8X A;  1LDK B;  1VQK I;  1J75 A;  3GWZ A;  4CH7 A;  1VZ0 A;  1RET A;  4L5J A;  4E7S A;  1IGN A;  3RYP A;  3HOS A;  3E6B A;  1RES A;  2RQP A;  1HC8 A;  2ZKZ A;  4O3M A;  3I4N J;  3HUG B;  2HI3 A;  3J80 K;  4DGW B;  2M0M A;  2GXG A;  2H8W A;  1A6I A;  3S93 A;  3WU2 C;  3N05 A;  5TGT A;  2L9R A;  1LUJ B;  3DEU A;  4YIR X;  4ZYD A;  3H3V K;  2WY8 Q;  4M3B A;  2ZCW A;  3HOZ J;  3NAR A;  4HZF A;  1Z67 A;  2DMU A;  1UG0 A;  2Q1Z B;  2V7F A;  5E1Z B;  1ZAO A;  5L3D A;  1HSJ A;  2IA2 A;  2ZBK A;  4HOB A;  2EZK A;  5EDN A;  2Y0M A;  1ZR4 A;  5FKL A;  3R6S A;  2WC2 A;  2E2I J;  1BI1 A;  4OIN F;  1U9O A;  2EZI A;  1KQ8 A;  4BDZ A;  2STT A;  4DOZ A;  5D4R A;  1Y39 A;  2E36 A;  5J47 A;  2VC1 A;  5ICE A;  3B73 A;  4MLO A;  3ZQ7 A;  5FRN A;  4FTH A;  5GPC A;  5GAE J;  3FXK A;  3W2V A;  1UMQ A;  3WHC A;  3WTW C;  5E20 A;  4O6J A;  2HKO A;  4L9V A;  4M71 A;  4KT6 A;  1SVO A;  1AA7 A;  1MBE A;  2PEX A;  4DYR A;  3F22 A;  3O3K A;  1BJA A;  4L5E A;  3OYG A;  3AAF A;  4JOM A;  2ZB9 A;  1JKP C;  4GYG A;  1MJA A;  3RKX A;  4CUG A;  5LHG A;  2BY2 A;  2GAU A;  4OIO F;  1YG2 A;  2G9W A;  3KEY A;  3JTH A;  2JK3 A;  4ZYA A;  1HXD A;  1KQ9 A;  4UUT A;  2HGC A;  2L01 A;  3PNT A;  1D5V A;  2VL8 A;  1IN7 A;  3QU3 A;  4JBA A;  4XLC A;  5DTD A;  2HTS A;  3DEW A;  3BR1 A;  4BAC A;  5BOX A;  1KU9 A;  1KQ0 A;  1W0T A;  1Z91 A;  3M8F A;  1KYW A;  2CUZ A;  2FOK A;  4D7N A;  5D5U B;  1B4A A;  2QEX I;  3MFK A;  3K70 C;  1V5E A;  5B1A H;  4BJ6 C;  1OYI A;  3I54 A;  1V54 H;  1X4O A;  3DBL B;  3IKV A;  4HSR A;  3SEZ A;  4IL6 C;  2XAJ A;  5EEG A;  1G3T A;  4WXH A;  1HST A;  3HGG A;  2RKH A;  2VQH A;  4CYD A;  2ZSI B;  4NQW A;  3TW7 A;  2JTV A;  1E0E A;  2DK8 A;  4RB0 A;  1YO5 C;  1RR7 A;  2F5D A;  2CO5 A;  1S6L A;  3O6B B;  1X1B A;  1OCT C;  2KHM A;  1KU7 A;  2VJ5 A;  2XKO A;  1E3O C;  4NUB A;  1IXR C;  3F23 A;  1ACI A;  5B3S H;  1YS6 A;  2MW8 A;  3HYI A;  2L9S A;  2IS4 A;  1HOM A;  3W2W A;  3CQZ J;  1RUN A;  1Z7U A;  4XMY A;  3FM3 A;  4ZZD A;  2PN6 A;  5EG0 B;  1Z9C A;  3S17 J;  1SVL A;  2IGO A;  2B63 J;  5IY5 H;  3MZY A;  3FK7 A;  2R5Z B;  3BLY A;  2DA6 A;  4BQN A;  1XSD A;  3OIP A;  5HLI A;  1FSH A;  3GTJ J;  1OYW A;  4LB6 B;  2WAQ N;  5J40 A;  4UUS A;  4UXN A;  4PJ0 C;  2W48 A;  4BL0 B;  3B02 A;  4GXO A;  1SAX A;  3HHH A;  2OF7 A;  1MBK A;  3NAU A;  1Y6I A;  3B6A A;  1ZG1 A;  2QCO A;  4ANJ A;  4R1H A;  1B1B A;  2HXO A;  2WA0 A;  3TBI A;  2EIN H;  2DA7 A;  3R4K A;  4UV8 A;  4HNT A;  1U3E M;  3E7L A;  1JJ6 C;  1D1A A;  2JPB A;  3GFI A;  5IYD J;  1IXS B;  1E3H A;  2I8D A;  4RGR A;  1E17 A;  4LG0 B;  3LSG A;  4Z2Y A;  5FLX Z;  4M9S A;  1VQ5 I;  3GZN B;  2GQQ A;  1EH8 A;  3IP4 B;  2L4M A;  2V9P A;  3MZ8 A;  3K10 A;  2VIX A;  2KIQ A;  3CDI A;  3W3C A;  1BR2 A;  2PMZ N;  1W1W E;  3FXM A;  4DBQ A;  4MTD A;  1F5T A;  1D3Y A;  1W5C C;  2X0L A;  3TED A;  3V8L A;  2HYJ A;  2K27 A;  4LG3 A;  1IRX A;  3E6M A;  3F0C A;  3REO A;  3HGY A;  1YI2 I;  3CDH A;  5C4X J;  2PX9 A;  5BPI A;  3HXL A;  4TV7 A;  3JRB A;  3IWZ A;  4Y7N J;  2CW8 A;  2DAO A;  4KN4 X;  2E2J J;  3S8P A;  4BJT A;  3PL8 A;  3H5N A;  5JVT A;  1W5S A;  1TT0 A;  2XAF A;  3S1M J;  4ZTJ A;  1NG6 A;  3Q9V A;  1Z05 A;  1TQI A;  2Z99 A;  2BOL A;  1X2N A;  3OYL A;  3PNY A;  3P5J A;  3WTS C;  1AOY A;  2LSO A;  4CSW A;  1Z6R A;  1RRJ A;  5CYV A;  3T5X A;  1XC5 A;  2COB A;  2F5C A;  2Y30 A;  3BPX A;  4XNF A;  1S7A A;  1ZLJ A;  3FKJ A;  3HPH A;  1NH3 A;  3L7W A;  5M3F J;  4HNU A;  2F5E A;  1P92 A;  4M73 A;  1JTY A;  2ZXH A;  2PQ8 A;  1Z77 A;  2EIL H;  4BUP A;  2F48 A;  4HDV A;  1T95 A;  3OYM A;  5H20 A;  1H8A C;  1BR4 A;  5FO5 A;  3FHZ A;  4CZC A;  1PJR A;  3AL0 B;  4QPQ A;  2FRH A;  3S2W A;  2V1D A;  3CO7 C;  4C30 A;  2O7O A;  1XMX A;  1O4X A;  2HQA A;  1MKM A;  5IT9 Z;  2V1X A;  1D1B A;  1SC7 A;  3QOD A;  4XSX F;  1SAN A;  3GTQ J;  5F64 A;  1ZEL A;  2ZME B;  3I59 B;  4PGG A;  3E5Q A;  1YFH A;  1FP1 D;  2OUM A;  4EJU A;  2EIJ H;  2MH2 A;  3SYT A;  2F2E A;  1U8R A;  2K9S A;  3QP6 A;  1GXQ A;  1HW5 A;  4G6T B;  1JKO C;  2M34 A;  3OYH A;  2H6B A;  2VXZ A;  4HF0 A;  1R71 A;  4IOC F;  2ECC A;  2MYS A;  3WGH A;  4RM3 A;  1I5Z A;  3OYF A;  2VKD A;  3LA7 A;  1I3A A;  1ZQ3 P;  2E7W A;  1BA5 A;  4EM2 A;  4EVI A;  4NBQ A;  1WJB A;  5LD2 C;  3IH3 A;  2F4M B;  1VTN C;  4XKW A;  3A02 A;  2M5W A;  2X85 A;  3QPT A;  4I09 A;  3LSR A;  2NOJ B;  3LQR A;  4KMF A;  3CME I;  2NAZ A;  1BC7 C;  5ERI A;  2V1U A;  2FBI A;  1H9T A;  2CSO A;  3WTV C;  1OQY A;  2H27 A;  4ENJ A;  4OMY A;  4IOA F;  1FIP A;  2P5L C;  2DFF A;  1JI8 A;  4A2U A;  3TO7 A;  3HC7 A;  3RCO A;  3OS0 A;  2H94 A;  4I0A A;  1XGM A;  2DMP A;  1MSE C;  2QSG X;  4UVC A;  1VQ6 I;  3ABT A;  2VBY A;  4QIW N;  1S9H A;  5M5X J;  1SFK A;  2FX0 A;  1ETQ A;  3MKL A;  4U7B A;  2CUJ A;  2QM3 A;  2EA2 A;  3F8N A;  5D6F A;  2K4B A;  3FXJ A;  4XLN F;  1ODD A;  1BI3 A;  4X6A J;  2J5P A;  2RC4 A;  4XOP A;  2ZJQ F;  3SHF A;  5TJJ A;  1F9N A;  2VAS A;  4F3Q A;  3G3Z A;  3DTE A;  2WAQ A;  2FD5 A;  5D5W B;  2HYF A;  3LAP A;  5A2Q K;  1A04 A;  2R4G A;  3OYB A;  3A2K A;  2DA2 A;  2M7A A;  3UNG C;  3PM1 A;  4PK4 A;  2MA3 A;  1R4M B;  1OR7 C;  2AS5 F;  3DTI A;  5L3F A;  2WAE A;  4XLE A;  2GA2 A;  1N25 A;  2QQB A;  1KA8 A;  2XUB A;  1K6O A;  5CLS A;  1NK3 P;  1FEX A;  1IV8 A;  4KJZ A;  2VOP A;  3ZQH A;  2BXY A;  2GIV A;  2HZT A;  1P4X A;  4D1Q A;  2CG4 A;  4AYB N;  2JA7 J;  2H6C A;  5F0F A;  1VQL I;  3IKT A;  5E3O A;  5GAH J;  2DU9 A;  1IN5 A;  1OIS A;  2RRE A;  3ZQL A;  2IGN A;  3W6K B;  5E18 F;  4Y13 A;  3O8G A;  3ZQI A;  3MVP A;  1MH3 A;  5CQE A;  5CPR B;  3BQZ A;  2L0K A;  2ZJR F;  3MMY B;  5K7F A;  4PJM A;  2MC3 A;  2PMZ A;  2Q2E A;  3FK6 A;  1OJL A;  1PP7 U;  4GYI A;  2QZ8 A;  4U7D A;  4D0P A;  3S1N J;  2FBK A;  4XN3 A;  5HS9 A;  2Q8K A;  3OSF A;  4PJJ A;  3R0A A;  3KYL A;  3DWL E;  4CHU A;  1T39 A;  4CGZ A;  3AG2 H;  5ILU A;  3VWB A;  2O0Y A;  2EBI A;  1KZH A;  2ICW G;  1B9N A;  1XMA A;  4LOC A;  3T0Y A;  2CGP A;  4FIS A;  3RYR A;  3CCS I;  1ETW A;  2H1K A;  5LHH A;  4ESJ A;  3FZV A;  3KEO A;  4RBO A;  2JN6 A;  1GV5 A;  4EGY A;  4A3M J;  1TBX A;  2R7S A;  4AVZ A;  4I0B A;  3ZP5 A;  1FZP B;  3BT9 A;  3ASN H;  5J1U A;  3CJR B;  4AIK A;  1W36 D;  2IA1 A;  2BGC A;  1K7A A;  5BNG A;  2DA1 A;  2K5C A;  3V4G A;  3P7N A;  1XGO A;  2R0Q C;  2LY1 A;  4IX7 A;  2Y2Z A;  1SFX A;  2DOE A;  2WAF A;  2DA3 A;  3BQY A;  1T38 A;  2QUF A;  4DW6 A;  4EJW A;  4HV6 A;  1QNT A;  2ME0 A;  2IXS A;  3BG5 A;  3G1L A;  3KFW X;  3HIF A;  4A0Y A;  2DT7 B;  3LSJ A;  2FJ1 A;  2OD5 A;  3WTX C;  2R5Y B;  1SFU A;  1T33 A;  3FX3 A;  4BE1 A;  2E1N A;  2KKO A;  1F36 A;  2DT6 A;  1IAW A;  2ZSH B;  3IV5 A;  4KA4 A;  1KU2 A;  4W97 A;  5IOY A;  5JLW A;  1G3Y A;  1XCB A;  3Q0V A;  2A6H F;  2BXZ A;  2CH0 A;  4IZZ A;  4CXF A;  2XAU A;  3L2W A;  2RVC A;  4II2 A;  3IH2 A;  3ZN0 A;  3A4C A;  5IOZ A;  4N0B A;  1I27 A;  4G7O F;  2J5O A;  3K4C A;  4MEY F;  2FML A;  3M9A A;  2EIK H;  4IXA A;  1LDD A;  2JA6 J;  3PO2 J;  3HRM A;  4C3I J;  1NK2 P;  3KP7 A;  2CUE A;  4II3 A;  3EUA A;  3FXU A;  2XGE A;  4MQV A;  2ISZ A;  4RDU A;  5K5Q A;  3CES A;  2C6Y A;  5J3L A;  3VYR B;  5IP7 J;  1MIJ A;  1FTT A;  1NTC A;  1TNT A;  2IA0 A;  5DM7 F;  2P8T A;  1ZGA A;  2HU9 A;  2BY1 A;  2QVO A;  3BOQ A;  4RMN A;  3WG9 A;  5D8K B;  4Q48 A;  2DFH A;  1VQ8 I;  4EGZ A;  1MDM A;  1P7I A;  3LOC A;  1FBQ A;  4IRI A;  3WE2 A;  1TWG J;  2F4O B;  5F27 A;  3R60 A;  4IQ4 A;  3ERE D;  2HPI A;  4AVP A;  3NQO A;  3CO6 C;  2Y75 A;  5KCM A;  4EJO A;  4F91 B;  1U8B A;  2AQF A;  2HYG D;  1FX7 A;  2L9V A;  2TCT A;  4BY7 J;  4RB1 A;  1BOA A;  4KIG A;  2HR3 A;  4BYY A;  4A3C J;  4LK1 F;  1UAA A;  4AC0 A;  4BHC A;  4RA2 A;  2LP0 A;  3EUK L;  1HCR A;  2Z2S B;  2ZNY A;  1JKR C;  5C44 J;  2CFO A;  4IF4 A;  1WJE A;  3CCQ I;  1P2F A;  3HDD A;  1B8I A;  2OV7 A;  3E3V A;  4ZZL A;  3D5L A;  3T8R A;  4PJL A;  4S05 A;  3GXO A;  2P7C B;  2R7V A;  1R36 A;  4C3J J;  2E35 A;  1FIA A;  2EZH A;  2DBB A;  4EMS A;  1L3L A;  2CQN A;  4GO1 A;  3MEX A;  4IHX A;  4EAT A;  1ZG3 A;  1X19 A;  1ETY A;  1GVJ A;  3K4K A;  2A69 F;  2QEN A;  2DJI A;  3I56 I;  3J81 Z;  4B47 A;  4DBR A;  1CF7 B;  1IXC A;  1MZB A;  2W1O A;  2D45 A;  1WPK A;  3H9G A;  2TRT A;  1DGW Y;  1WCM J;  1B72 A;  2IPQ X;  4Y52 J;  4WXC A;  2F4I A;  3CUQ A;  3CMY A;  1ON2 A;  2JSP A;  4I2O A;  2LR8 A;  2JA5 J;  2CQQ A;  4AYB A;  3ZQQ A;  3WTU C;  3GFM A;  2E1M B;  4JQF A;  1IJW C;  4H4K C;  2K86 A;  5BQT A;  1XB4 A;  2LBF A;  1ORK A;  3JW4 A;  3RKW A;  2VOD A;  3H3U A;  3K4B A;  3GTO J;  3DLL F;  3OSG A;  1DPU A;  5IYB J;  3AG1 H;  2ISY A;  1OLT A;  1U78 A;  3VEP A;  2X9D A;  4OMZ A;  1HF0 A;  1Y0N A;  2UZK A;  4IEJ A;  4MTE A;  5LEJ A;  1R7J A;  5FLM J;  4N4N B;  2XB0 X;  4ZTF A;  4E7Z A;  3ZMV A;  1AKH A;  1JKQ C;  1S3J A;  3UKG A;  1YOV B;  5EGO A;  3DU6 A;  3H92 A;  1WFX A;  3I0T A;  3KP2 A;  4FX4 A;  1TTY A;  1U5T B;  1WRJ A;  1V3F A;  2ZXI A;  2HNH A;  4HPQ A;  2HDD A;  4YFX F;  3BWG A;  3GFJ A;  4N4O B;  3VOD A;  1QZZ A;  4MFD A;  4A0X A;  1BN5 A;  1MSF C;  3S16 J;  2KLO A;  2OCC H;  2P4W A;  1XDU A;  3BG9 A;  5D5X B;  2CS3 A;  1IZ1 A;  2VJ4 A;  4N9H A;  1ZHF A;  3PSF A;  5FD6 A;  1ZYR F;  1R5G A;  2BV6 A;  4QSH A;  2GXB A;  3HOU J;  2V26 A;  3COA C;  1I1S A;  2OA4 A;  1WGX A;  4KIT B;  2IJL A;  3A03 A;  2KRF A;  4HQM A;  5CVR A;  4A3D J;  2DYS H;  4MGR A;  4B1R A;  3ONQ A;  1MNE A;  1Q1V A;  1GT0 C;  1IG7 A;  2O8K A;  4G8X A;  1V55 H;  2EK5 A;  1S7E A;  4FCY A;  4CYC B;  4A6E A;  2LY9 A;  3OV8 A;  2VBZ A;  1O7F A;  1PUF B;  2F5V A;  2W7N A;  1MJB A;  2MG4 A;  2OCE A;  3K69 A;  4I99 C;  4BS9 A;  4A69 C;  4O5V A;  1X1A A;  2RNG A;  3OYA A;  2K40 A;  3F8M A;  3KPH A;  2LG4 A;  1LB2 A;  3SQN A;  4BXX J;  3ZMD A;  5FRO A;  2IGK A;  1JT6 A;  3I71 A;  3GF2 A;  1LDJ A;  1R6R A;  4IPA A;  2HFH A;  1XD7 A;  1G2H A;  3LFK A;  3IHU A;  1IC8 A;  4A3G J;  1BIA A;  4HX8 A;  3I4M J;  2YX4 A;  1J0R A;  1LFU P;  2WY7 Q;  1Y1V J;  4PUS A;  1IRF A;  3OOP A;  2DTZ A;  2V1N A;  1R49 A;  1DQU A;  3VB2 A;  3L2Q A;  2VBX A;  2QKL B;  4BBR J;  1FYK A;  2KT0 A;  4CCJ A;  3WGI A;  3OR1 C;  5D8L B;  3HOX J;  1WH7 A;  1T6S A;  2M2E A;  5GTI C;  1JUP A;  2NVQ J;  2DQL A;  1E2X A;  1VQP I;  4JX6 A;  2LF8 A;  4Q47 A;  1DPR A;  1JXS A;  1ZN2 A;  5JI6 A;  5LFA A;  3H5R A;  2WBM A;  1LE8 A;  4LIV A;  3BJ6 A;  3Q9S A;  2MAB A;  3RZO J;  4HLY A;  3MZH A;  3DBH B;  2KFD A;  3TOB A;  5M5Y J;  1W36 C;  1IN6 A;  1W0U A;  4RGU A;  4IHW A;  2XC7 A;  2EV5 A;  1BJZ A;  3K4N A;  4JX5 A;  2CQK A;  4E70 A;  3OYK A;  4XLH A;  1A35 A;  2R7U A;  1HA8 A;  3DF8 A;  4HQE A;  2HPM A;  5IYC J;  2W24 A;  3A01 A;  1HBX G;  1D8J A;  2E34 A;  2HEO A;  3HSE A;  3BTL A;  2DYR H;  5FFX A;  4XRS G;  5IP6 A;  5J6X A;  2VON A;  2VPR A;  2ELJ A;  4N9I A;  2AXL A;  2GOX B;  2HQ5 A;  4UNO A;  4NDL A;  2MD5 A;  2WB1 N;  1XPX A;  3M4O J;  4OWR B;  4D5F A;  4GCV A;  2ESN A;  4G9Y A;  3VSL A;  4CDG A;  4A3E J;  1RKW A;  2DPD A;  2XPU A;  1FP2 A;  4NC7 A;  1ZR2 A;  5F08 A;  4A3L J;  2IRF G;  3H0G J;  3CCY A;  5CQG A;  4A3K J;  2DW4 A;  4OOI A;  3ZN1 A;  1A5J A;  4HX7 A;  3GLL A;  3K2A A;  3GZ6 A;  1C0W A;  2ZC2 A;  3D5R C;  4Y4R A;  2L7F P;  4RAZ A;  2EWN A;  3TL4 X;  2BYV E;  4E7H A;  1HDP A;  3FMS A;  5LGT A;  3QQA A;  4P9U A;  4A3B J;  1FYL A;  2LLK A;  3EUH A;  2CJJ A;  4PFP A;  4B09 A;  3CLO A;  1ETK A;  1SAU A;  4PZJ A;  1XMK A;  1D8K A;  2DTR A;  2VKH A;  1EH6 A;  1N75 A;  2Z3Y A;  2M9H A;  4CCK A;  1DU6 A;  4BEH A;  1H89 C;  2PJR B;  5IT9 K;  2DFE A;  2ZO4 A;  3IRR A;  3RQI A;  1SEU A;  4BY1 J;  5KVR A;  3JAM Z;  3S3O A;  3GFL A;  4D7M A;  3WTT C;  5EF6 A;  1Q1H A;  2ME6 A;  2RNJ A;  3DPT A;  5BMZ A;  2VE8 A;  4LGW A;  3OYD A;  2GBY A;  3OL4 A;  5IP9 J;  3JTG A;  2OQG A;  2EZL A;  4L9T A;  3M1E A;  1J5Y A;  1KYZ A;  1YRN A;  1G3S A;  2I10 A;  1YJ9 I;  4NB5 A;  1UHS A;  1FY7 A;  2L5Q A;  1ZRC A;  3KCC A;  5JR3 A;  4BE2 A;  4E4H A;  5GPA A;  3OYN A;  5J8F A;  2EFW A;  5KAI C;  3NRV A;  4RAG A;  1IW7 F;  3CTA A;  2HDC A;  4YEL A;  1W7P B;  4W1U A;  4U0Y A;  2EJR A;  3KP5 A;  2LTP A;  3V8J A;  1QU3 A;  1TLH B;  1S29 A;  1T98 A;  3WG7 H;  2M87 A;  3ZMS A;  2XAS A;  4XM3 A;  3Q0U A;  3O8H A;  1O7L A;  2VKV A;  2O03 A;  2ACJ A;  2CV1 A;  2FUG 2;  5B66 C;  1K78 A;  1TNS A;  2YS9 A;  2CV2 A;  3BR5 A;  1WKM A;  1RNL A;  1XTA A;  2G0E A;  2KJB A;  4UY8 I;  3H35 A;  3BY6 A;  1UB9 A;  3I4P A;  2CUF A;  2M45 A;  4R8H A;  1R22 A;  2E19 A;  3BTJ A;  3VYS B;  1H9G A;  1WI9 A;  1MMD A;  2B9S A;  3IH4 A;  3KET A;  2V79 A;  4AIH A;  2P0W A;  1RIO H;  2EH3 A;  4M3E A;  3RSN A;  3ASO H;  4KUM A;  1R1V A;  3I3L A;  3CJT B;  4BHB A;  2MSY A;  3H0D A;  1MND A;  2A61 A;  4BDY A;  2YPR A;  4RAF A;  3L2U A;  1R1U A;  1K83 J;  1HKQ A;  3RTR A;  2V6E A;  2HDW A;  4JP0 A;  1CQT A;  2R7R A;  3K6G A;  5AON A;  4RGX A;  4B8X A;  4MEX F;  3JRG A;  5J4V A;  1TQP A;  4ZDL A;  3FXQ A;  5GAD J;  2LD5 A;  2M1B A;  4Q5S F;  4E7J A;  5DM6 F;  2CW0 F;  1X3W B;  2E5Z A;  3JRI A;  1S72 I;  3H5A A;  5LGN A;  3U21 A;  1J09 A;  1N77 A;  5CVJ A;  3FM5 A;  4V2F A;  4L5I A;  4XL9 A;  2PBI A;  3E5U A;  2Z33 A;  2UXX A;  1ZG5 A;  4GDF A;  1OFC X;  3BCB A;  3F21 A;  4ASN A;  3GW2 A;  1GDT A;  2MC4 A;  4BHP A;  2XF6 A;  3BP8 A;  1WQ2 A;  1WJC A;  1MD0 A;  1ETO A;  2HTJ A;  3FHN A;  1BI0 A;  2OZ6 A;  1AU7 A;  2DMT A;  2OBP A;  1P7J A;  1MMN A;  4MO7 A;  1VQO I;  1GUU A;  5LEK A;  3CUO A;  3AL0 C;  1WHU A;  1TZL A;  2CWE A;  3MKY B;  1WH5 A;  4U88 A;  3OWT A;  2D2W A;  5JLX A;  5HS7 A;  2WB1 A;  3IL2 A;  3HUG A;  3QRF F;  3TGN A;  4AWX B;  5HDN A;  1OPC A;  2EQR A;  2JZY A;  2ECB A;  5ICC A;  1FJL A;  2K9N A;  2FBH A;  1UG2 A;  4AU7 A;  4A3F J;  3IAS 2;  2O8X A;  4ZYH A;  2XPW A;  4B4C A;  1WJ5 A;  4WCG A;  1MBG A;  1I39 A;  1H88 C;  1FOK A;  4M6X A;  2LRD A;  1X58 A;  2R93 J;  3M07 A;  1MMG A;  2ZME C;  4KIF A;  1IUY A;  5EEA A;  1T2K A;  1I6X A;  4DZJ A;  3S14 J;  1FSE A;  3SJM A;  2ZFW A;  3PUB A;  2M8E A;  3CUQ C;  2A5Y B;  5HVQ C;  4FE4 A;  3JCU C;  4ETS A;  3SDG A;  5DCM B;  2CMP A;  3J7A O;  3H36 A;  3PFI A;  1P4A A;  4XBF A;  2OPT A;  5H6R A;  5CJ9 A;  1BW5 A;  4LFU A;  3BDD A;  3BR6 A;  2GOM A;  4HEA 2;  1UHM A;  1Z3X A;  2HZD A;  1ULY A;  4U87 A;  3SFI A;  5JVG F;  2Y0S N;  2X1E A;  3K2Z A;  2O9L A;  4QLC U;  3FXO A;  1HQC A;  2O61 A;  2XAH A;  5CKT A;  4XLP F;  4DNC A;  3MAJ A;  1AWC A;  3GEZ A;  1FPQ A;  2P6T A;  3A0H C;  2VT3 A;  3OOU A;  3T8T A;  4MNU A;  3S3M A;  2RN7 A;  3BZK A;  4KDP A;  3S32 A;  2JT1 A;  3GCM A;  3V42 A;  4D5C A;  3BG6 A;  1WJD A;  3KLO A;  3LST A;  2LKS A;  3C7J A;  3M8J A;  5E8I A;  4BU2 A;  1ONV A;  2E60 A;  3FKI J;  4BXU A;  2KP6 A;  3HEF A;  4XRM A;  2L9N A;  1BBY A;  4P55 A;  1YLF A;  4PSX A;  2XSJ C;  3QPS A;  3Q0W A;  3HG9 A;  4HAM A;  4RGS A;  5DCF A;  3HKZ N;  4F52 A;  5HS8 A;  5K5R A;  3OYE A;  3G6E I;  1W4M A;  1YIO A;  2XRO A;  2VLA A;  2COM A;  1J7K A;  5HOD A;  3EYI A;  3EET A;  2FEZ A;  5HNH A;  1WZ2 A;  2ZXJ A;  2JMW A;  4KIC A;  9ANT A;  1XG1 A;  3SFZ A;  3VPR A;  1MH4 A;  3O2P E;  1BR1 A;  3LWF A;  2K9M A;  4KFC A;  3S1R J;  1QVU A;  3KP4 A;  3JR9 A;  1J59 A;  2F5F A;  1V5F A;  2DDA A;  5H6Q A;  5B5E C;  3F6V A;  2X6O A;  3JRC A;  2OQR A;  2BVM A;  2BHZ A;  4C2U A;  4B3X A;  3ZMT A;  2R7T A;  5E1W A;  3V7C A;  1OCZ H;  2QYO A;  2A68 F;  3DCF A;  1XSX A;  3C1D A;  1FYM A;  3PQK A;  1HW2 A;  5ILV A;  3BJO A;  1TWA J;  3CCM I;  3W2A A;  2DPU A;  2WTE A;  1UST A;  3G73 A;  1V5G A;  3SXY A;  5EG0 A;  2HVQ A;  1J9I A;  3M3Y J;  2KPM A;  5K1Y A;  1YIT I;  2R5Z A;  2LK2 A;  4IRG A;  3TP0 A;  3CMM A; 
#chains in the Genus database with same CATH homology
 3OY9 A;  5KHD A;  2XF7 A;  2VQH A;  2ZSI B;  4N4N B;  4ZTF A;  1E0E A;  4F93 B;  4E7Z A;  4PSW A;  1X1B A;  1K6Y A;  2KHM A;  3FBN B;  3MKZ A;  2LOO A;  3E1S A;  3DU6 A;  2VJ5 A;  1WFX A;  4NUB A;  4ZDP A;  3LSM A;  2ZXI A;  2HNH A;  4HPQ A;  4XKV A;  2L9S A;  2IS4 A;  3W2W A;  4N4O B;  2Z16 A;  4GRI A;  3DKY A;  2K3P A;  2LBF B;  4B44 A;  1QHH D;  4E7K A;  2KLO A;  3H9Q A;  4XMY A;  2R7X A;  3RPU D;  2IGO A;  4YEJ A;  2CS3 A;  2VJ4 A;  1ERD A;  3BLY A;  2W82 A;  3PSF A;  4BQN A;  3OIP A;  3VYT B;  2R7W A;  4KIS A;  2Z1D A;  3PFY A;  1X4P A;  4CCL A;  2V26 A;  1X1C A;  2K9L A;  4NQW B;  4BL0 B;  5JHF A;  4KIT B;  4BQO A;  3L2R A;  1UEL B;  3ONQ A;  1MNE A;  3ZRG A;  1Y6I A;  1YX3 A;  4ANJ A;  2WA0 A;  2F6C A;  3H9J A;  3TBI A;  4HNT A;  1D1A A;  2F5V A;  2W7N A;  2I8D A;  4BS9 A;  4Y3O A;  2L7K A;  1T0F C;  4BGD A;  1WJA A;  1X1A A;  2RNG A;  3LSG A;  3OYA A;  4J01 A;  2LG4 A;  5FRO A;  3IP4 B;  2IGK A;  3K10 A;  2VIX A;  2VJI A;  1R6R A;  2BW3 B;  3W3C A;  1BR2 A;  2X6Y A;  4XLA A;  2IS1 A;  4DBQ A;  3A1Y A;  4BEH B;  4BQQ A;  4QPO A;  2KL4 A;  3G2B A;  2WY7 Q;  4PUS A;  3UR3 C;  4LG3 A;  2V1N A;  1IRX A;  1DQU A;  3L2Q A;  3EUH C;  2A5W A;  3LSK A;  2QKL B;  2V9K A;  4E7I A;  4CCJ A;  2Y0S A;  3HXL A;  4BJ5 C;  3OR1 C;  5HOO A;  4CCO A;  2DXI A;  4LIU A;  2CW8 A;  2L2O A;  3EPZ A;  3S8P A;  4BJT A;  3PL8 A;  3C2G A;  3H5N A;  4CA0 A;  1TT0 A;  5LFA A;  4ZTJ A;  1NG6 A;  2JUG A;  4B48 A;  3H5R A;  2WBM A;  4LIV A;  3K4M A;  2BOL A;  2MAB A;  4C9Y A;  3OYL A;  3PNY A;  1W36 C;  4CSW A;  3NWS A;  4XNF A;  2XC7 A;  3BG7 A;  3FKJ A;  3K4N A;  4XLF A;  1EA3 A;  3HPH A;  3OYK A;  4CCN A;  4XLH A;  2R7U A;  4HNU A;  1HA8 A;  4XR6 A;  2HPM A;  2XDV A;  2ZXH A;  4ZC3 A;  4BUP A;  4FET A;  2RQQ A;  3QYE A;  1KON A;  3RQ4 A;  2OC6 A;  2X51 A;  2KMU A;  1T95 A;  3OYM A;  4HRI A;  1BR4 A;  2ELJ A;  2GOX B;  1Z7L A;  4CZC A;  3HKZ A;  1PJR A;  3AL0 B;  4QPQ A;  5HLT A;  4DJA A;  4C30 A;  2O5R A;  1D1C A;  4R79 A;  4OWR B;  4F55 A;  3BCA A;  1Z21 A;  2HQA A;  3K4L A;  3CP2 A;  3J7A Y;  3VSL A;  4ITV A;  1D1B A;  4NC7 A;  2PJR A;  2LYC A;  3QOD A;  2KZV A;  3CF2 A;  1ZEL A;  5CQG A;  1NG7 A;  2OUM A;  3SYT A;  4G6T B;  2UWM A;  4P5O A;  2VXZ A;  3OYH A;  2IS2 A;  3LSH A;  3AKZ A;  4E7L A;  3D5R C;  3OYI A;  4Y4R A;  2E1M C;  2MYS A;  3TL4 X;  3AFH A;  4RM3 A;  3OYF A;  4E7H A;  2A6T A;  2CV0 A;  2VKD A;  3SDB A;  3K70 D;  3DU5 A;  2JVG A;  1Z3Y A;  1Y56 A;  2KRH A;  1WJB A;  2ZFU A;  5LD2 C;  1D0Z A;  4PFP A;  1SAU A;  4XKW A;  3PJR A;  2X85 A;  2BW3 A;  2NOJ B;  2VKH A;  1N75 A;  4CCK A;  2W4S A;  3F9K A;  2VQC A;  4BEH A;  2PJR B;  4XKC A;  2KQR A;  1FMW A;  3S3O A;  3LSI A;  3CZ6 A;  3ZXS A;  1JI8 A;  1LVK A;  4J00 A;  4RLF A;  2JA2 A;  3CP8 A;  3DPT A;  3HC7 A;  3ZCO A;  3ZGK A;  4NNJ A;  1FMV A;  3OYD A;  3DPL C;  3OL4 A;  3RCO A;  3OS0 A;  2M4K A;  3QYF A;  4HG2 A;  1S9H A;  1SFK A;  2HVS A;  4U7B A;  2L5Q A;  2CUJ A;  3PSI A;  4BE2 A;  2VQL A;  3PNV A;  4E4H A;  4XKB A;  5KNL A;  3OYN A;  3KX2 A;  2MFZ A;  2M7B A;  3CJQ B;  4XOP A;  4B43 A;  1LKX A;  2QKM B;  4YEL A;  2VAS A;  4F3Q A;  4ZJZ A;  1QU3 A;  3DTE A;  2WAQ A;  3DLA A;  3E0J B;  4XM3 A;  2R4G A;  3OYB A;  3A2K A;  2M7A A;  3UNG C;  2UUZ A;  4PK4 A;  2CV1 A;  1OR7 C;  2FUG 2;  3DTI A;  2CV2 A;  1DP3 A;  1D0Y A;  2V4J C;  2WAE A;  4XLE A;  3H35 A;  1BOB A;  3VYU B;  4KJZ A;  3VYS B;  4D1Q A;  3C2H A;  1MMD A;  2R7O A;  3M1C A;  2RRE A;  2P0W A;  2IGN A;  3TMO A;  3RSN A;  2VB6 A;  3I3L A;  1U0J A;  2DOA A;  3ZR8 X;  3H0D A;  1MND A;  4BDY A;  2BVL A;  2X1C A;  3L2U A;  5CQE A;  5CPR B;  3OS1 A;  2VPL A;  3SEQ A;  3RTR A;  2V6E A;  2HDW A;  3MMY B;  4PJM A;  4YRV A;  2PMZ A;  2X6W A;  2R7R A;  3K6G A;  3BC8 A;  2DCE A;  2LY2 A;  3DQV C;  3HPG A;  4XN3 A;  4PJJ A;  4E6K G;  4Y33 A;  3DWL E;  3KYL A;  4ZDL A;  3VWB A;  3MKW B;  3DKX A;  3OS2 A;  4E7J A;  4C2T A;  2E5Z A;  3H5A A;  3U21 A;  1J09 A;  1N77 A;  3DTK A;  3LL7 A;  3DEE A;  2R7S A;  1YE9 A;  4LIT A;  4XL9 A;  4AVZ A;  1WJF A;  2XF5 A;  3BCB A;  2M3A A;  3CJR B;  1W36 D;  2MD0 A;  4OAZ A;  2K5C A;  2LRE A;  3OR2 C;  2MC4 A;  3LMM A;  2LY1 A;  2XF6 A;  2KRC A;  4XOT A;  4IX7 A;  1WJC A;  4F92 B;  3OYC A;  1PYV A;  4CCM A;  3OYJ A;  3HOT A;  2WAF A;  2Q2E B;  3GBG A;  4IKF A;  3FHN A;  2IXS A;  2DT7 B;  2E5N A;  4BE1 A;  1MMN A;  3S3N A;  5FRM A;  1DGR M;  2JVH A;  3VSK A;  2DT6 A;  1P9Q C;  3AL0 C;  4OAY A;  2ZSH B;  1TZL A;  4XON A;  4FAS D;  3MKY B;  4BE0 A;  3OWT A;  4XN0 A;  4P1W A;  4RM2 A;  2WB1 A;  2LH9 A;  5HNF A;  2CH0 A;  4PFO A;  4IZZ A;  2VXD A;  3D5S C;  2XAU A;  4AU7 A;  3L2W A;  3IAS 2;  2LC2 A;  4II2 A;  1WJ5 A;  3L2V A;  1G59 A;  3A4C A;  3IAM 2;  2LRD A;  1X1D A;  1MMG A;  3K4C A;  3PUB A;  2R7Q A;  5HVQ C;  3OIQ A;  2HVR A;  3SZG A;  1MW7 A;  1G8X A;  1LDK B;  2CMP A;  3QOE A;  4II3 A;  3EUA A;  1YX5 A;  1VZ0 A;  2IGM A;  4CH7 A;  4E7S A;  3I9V 2;  3CES A;  3VYR B;  2GOM A;  3HOS A;  4HEA 2;  1Z3X A;  2HZD A;  4U87 A;  3FBI B;  4RMN A;  2HU9 A;  3SEZ A;  2X6X A;  2X1E A;  3HUG B;  2IS6 A;  4DGW B;  2M0M A;  5CKT A;  3S93 A;  2VQG A;  3DPU A;  2X1D A;  3N05 A;  4IQ4 A;  5TGT A;  2HPI A;  2WY8 Q;  3OOU A;  3S3M A;  2M4G A;  3QYB A;  1UG0 A;  5KCM A;  3S32 A;  4F91 B;  2Q1Z B;  2V7F A;  4D9J A;  2AQF A;  3LFU A;  3V42 A;  3HL2 A;  3BG6 A;  1WJD A;  3M8J A;  4BU2 A;  2E60 A;  2KP6 A;  1UAA A;  2L9N A;  4BDZ A;  3EUK L;  4PSX A;  2Z2S B;  3VDX A;  4DOZ A;  1N78 A;  2XSJ C;  3K4J A;  3HG9 A;  2CFO A;  4NC8 A;  1WJE A;  4MLO A;  4F52 A;  4BXF A;  3OYE A;  5FRN A;  2OV7 A;  3D5L A;  1LFP A;  1GLN A;  3W2V A;  2VLA A;  4PJL A;  2R7V A;  2VJJ A;  5HNH A;  4KT6 A;  2UV1 A;  1AA7 A;  2AQE A;  2W00 A;  4XOR A;  3OYG A;  4JOM A;  4EAT A;  1X19 A;  4X0G A;  1BR1 A;  3K4K A;  2K9M A;  4CUG A;  2DJI A;  3IUO A;  2WAD A;  3MD2 A;  1V5F A;  4IQJ A;  2CW7 A;  4B47 A;  4DBR A;  3KEY A;  4DIQ A;  2W1O A;  2KDO A;  4HST A;  4ZYA A;  3H9G A;  2BVM A;  1DGW Y;  4C2U A;  3PNT A;  4B3X A;  2VL8 A;  4ZDO A;  2R7T A;  2F4I A;  4XLC A;  3OMY A;  2JSP A;  4PJN A;  4AYB A;  3ZQQ A;  4BAC A;  1QHG A;  2E1M B;  4JQF A;  2CUZ A;  3W2A A;  4H4K C;  4XQF A;  3FDY A;  2LBF A;  3OL3 A;  1MMA A;  1V5G A;  2HVQ A;  4RLQ A;  3K70 C;  1D0X A;  1V5E A;  2KPM A;  3K4B A;  4BJ6 C;  1X4O A;  3NWT A;  4HSR A;  1OLT A;  3CMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...