2WY8Q

Staphylococcus aureus complement subversion protein sbi-iv in complex with complement fragment c3d
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
66
structure length
66
Chain Sequence
VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT C3D FRAGMENT
publication title A Structural Basis for Staphylococcal Complement Subversion: X-Ray Structure of the Complement- Binding Domain of Staphylococcus Aureus Protein Sbi in Complex with Ligand C3D.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wy8Q00
2WY7Q 2JVHA 2WY8Q 3D5RC 2JVGA 2GOMA 2NOJB 3D5SC 2GOXB
chains in the Genus database with same CATH superfamily
2K9MA 2L4AA 1HSJA 3DXJF 4F55A 3ZMZA 2EZIA 4RB0A 4MTDA 1IN5A 2CFXA 4U88A 1JTXA 4MNUA 5HLGA 1BJAA 5FD6A 1BOAA 4NQWB 5JFRA 4I02A 3ZCOA 2VT2A 4BJTA 1BM9A 3FXMA 1HKTA 5HS8A 3A4CA 2NS8A 3GTGJ 5LGTA 1YX3A 2CQ7A 3M9AA 1VQ8I 2OZUA 3T5XA 3RIRA 1IV8A 4A3BJ 4GXOA 5CLSA 1IRXA 3ZOBA 2E5NA 1MBKA 2G7UA 3H5AA 4E7KA 3FZVA 1MH4A 5GTHC 1CF7B 1IDYA 3A02A 3OYFA 1D0YA 1TQPA 5HNFA 1MDMA 2NYXA 4I6ZA 5E1ZB 3BTJA 2BVMA 5K5RA 4D5FA 2M4KA 3H9GA 1REPC 4XLAA 2X1DA 4XLFA 3I0TA 4M9ZA 2UXNA 3I56I 1C0WA 2NRAC 2DFFA 2ZCWA 2RKHA 4S04A 5DDGA 3CDHA 4XKCA 1D1AA 2KDZA 3SXYA 2CW8A 4MEYF 2M0MA 3S2HJ 4XKVA 2HVSA 3EYIA 2E7WA 1VQNI 1X19A 4ZTFA 5EEHA 1N77A 4AVPA 5C4XJ 1JKOC 2CW7A 4BUPA 1XMXA 2WY8Q 4Q5SF 2KIFA 2XKPA 3SDBA 1P92A 3WTZA 1MBEA 2ZSIB 4L9TA 4XNFA 1QU3A 9ANTA 5TJJA 2IBDA 2ZSHB 1ZH5A 1POGA 2FJ1A 2P6TA 4MGRA 1HSTA 3RDIA 2WY7Q 2AS5F 3B02A 3OWTA 4RS8A 4PCQA 2K9SA 2V9PA 2ZJPF 3DTIA 4JK1X 1XS9A 3VODA 1BBYA 2CQXA 4IRGA 2PLYA 3K9TA 2EIMH 4BE2A 3SFZA 4UHTA 4LJZF 2XB0X 4A3MJ 2MH2A 4IHTA 5LD2C 5HLHA 3HOYJ 4CXFA 3VYUB 4P5OA 4JX5A 4XKWA 1R71A 1IUFA 2HQNA 1KA8A 1WI3A 2R7SA 4R79A 1BN5A 3NWSA 2X9DA 2NVTJ 1D0ZA 4O3MA 5H6RA 4BH9A 2XC7A 3TMOA 4NC6A 3TO6A 2ID3A 2DDAA 3B73A 2Q1ZB 3WTUC 1WWXA 4E7HA 3PNTA 2R5ZA 1E3PA 3FF5A 1KYWA 3OS2A 3MKLA 1YI2I 1WJ5A 3DFGA 2HWVA 2Q0OA 4E7SA 2JQ7A 3OYIA 2FRHA 4XR6A 2BGCA 4IO9F 3JRHA 3COAC 2CQNA 2VT3A 3CQZJ 1Z0XA 1IN7A 3CDLA 3BCAA 4DOZA 3CCQI 4M6YA 3TP3A 1ENHA 5B3SH 3LQQA 3U1KA 3P9IA 3PIOF 3EUKL 4IOAF 3TDZC 1OCCH 5IP9J 1QRYA 4L9VA 1W36C 1BR1A 1WHUA 3VFZA 3CCUI 4LK1F 3ECHA 2GBYA 4BU2A 4ENNA 4BXFA 4X0GA 3LQRA 5CVRA 3DP7A 1MW7A 3I5UA 3HUGA 2X1CA 5D4SA 4BHPA 4S05A 2QBYB 4O5VA 4XKBA 3CP2A 3F8BA 2DA5A 3JRAA 5FJ8J 1Z91A 1Y8RB 1Z1DA 3O3KA 1WH5A 4A0XA 1BW5A 4ZZDA 4A3IJ 3PO2J 4OMZA 2CUEA 2GWRA 4DYQA 2OTJI 4EM1A 1LDJA 1QPMA 2H6CA 4FE7A 4WXDA 4A3KJ 1AOYA 2GLOA 3I9V2 4FHTA 3ZQLA 4GCVA 4EEFG 4ENMA 1OCPA 2X6WA 5FLXK 1X3ZB 5M5WJ 4PJLA 3DBLB 3OYAA 3IRQA 4XRSG 1ZTRA 5ILSA 4GGGA 1N78A 1HKQA 1ZARA 4XLHA 2VUMJ 3E6MA 1SEUA 3RI4A 4M3EA 1R1TA 2DPDA 4J00A 2VQGA 3IH4A 1IN4A 1YFHA 1VI0A 1XDUA 3VYSB 3J80K 2OUMA 5JVTA 3UKGA 3MQ0A 4EV0A 1KZHA 3WTTC 2DYSH 1QHHD 3KLNA 1YW8A 5F1JA 3I58A 2XGXA 4I0BA 4N0BA 2KZGA 5HLTA 3TBIA 1NTCA 4MQ9F 1MDMB 2JA5J 1MIJA 3OIOA 2K9QA 2HYJA 4AVZA 2W25A 3BQZA 3JTHA 1WPKA 1XGMA 3CC2I 1IXCA 1QZYA 3BG3A 1MJAA 2UUZA 5ERIA 1MBGA 4RB3C 2Y9ZA 2LKSA 2HDDA 2VKHA 4YIIA 5J1UA 2W00A 1QHGA 4A12A 1S7OA 1K6YA 3J81Z 4BGDA 2HGCA 5D8LB 3JAMZ 3E6CC 4L5EA 2EPFA 2VIXA 1MMAA 3S1RJ 2P81A 4B44A 4ENKA 1G3YA 4DBQA 5HS7A 3G71I 1ITYA 1XD7A 4NDLA 3K10A 2F5CA 3S1MJ 1X1BA 2M9HA 2B7EA 4HOBA 3OYBA 1VZ0A 2DA2A 1DGWY 2LP0A 3ECOA 3KLOA 2Y2ZA 1ZLKA 2UXXA 5F27A 1WGXA 5D5VB 3J7YJ 2B0LA 3ZQHA 2CQKA 1GV5A 3ULQB 4FX0A 2K40A 4MIMA 4A3EJ 3M8EA 4LITA 5IYCJ 1UCRA 4I98B 4PJNA 5F04A 1J5YA 5F0FA 4NNJA 3U9GA 2DK5A 4Y3OA 2NS0A 1XCBA 1QGPA 2D1HA 2R5ZB 2MD5A 1YG2A 3FHZA 4LGWA 2EQRA 2K3FA 3KP3A 4LLNA 2BOLA 4UB8C 2STWA 2VE9A 3P5JA 3F8NA 3OR1C 1G3TA 4KITB 3HGYA 3VSKA 1SAUA 1VQPI 2VOOA 2K4JA 2KLOA 2E5ZA 1HDPA 3BZCA 3D0SA 2IT0A 4BEHA 1JI8A 4XL9A 1R4NB 3OIQA 1IJWC 2XVCA 4CICA 1G6NA 4IJAA 4OAZA 5CQGA 2WAFA 4CYCA 4Z2YA 1FP2A 2EK5A 3OYMA 2VJJA 4KMUX 2EJRA 3IH3A 5D6EA 3ASOH 3HUGB 4ZYGA 4CCKA 1QVTA 3HOSA 5FD5A 4IHVA 5B1AH 3C7JA 5C4JJ 2ECBA 1Y0NA 2XAGA 3TO9A 2BW3B 1B72A 1K78A 3ZMDA 4EGZA 1AHDP 3ONQA 3HRTA 2WV0A 2O8XA 1TT5B 2EZKA 2P6SA 4WX9A 1O3QA 2E2JJ 2E71A 4XORA 1ZRFA 4WK8F 2TRTA 4ITVA 5E3NA 2EINH 1YS7A 3GBGA 2F5FA 3BZKA 2XROA 3HSEA 3RZDJ 6PAXA 1ZG3A 4OIPF 1T08B 5KAFC 4BJ5C 4CUGA 2LD5A 2M87A 2XPVA 4DQ2A 5D4RA 2JJ7A 5H2FC 1E2XA 1MMDA 1G8XA 2G9WA 2DW4A 4DJAA 4V19K 2DLLA 4AWXB 3DLAA 4M3FA 5EEAA 1H0MA 3ZQGA 1A36A 2IGNA 4QPOA 1U2WA 1PP8F 1XSVA 2LLKA 4B3XA 2UWMA 2DMUA 2PJPA 3G2BA 3CD6I 3VDXA 1PDNC 4XN3A 1ZG5A 3MN2A 3QP6A 1TP4A 2XASA 3K1NA 4UV9A 2VPLA 5HOOA 3HG9A 2M7BA 1H9TA 1MH3A 5C44J 2O9LA 1EKEA 2XSJC 4DZPA 5K7FA 2R7VA 5KCMA 1DP7P 2LREA 2AXLA 4CDGA 2F5VA 2LH9A 5DV5A 5BMZA 1P6RA 2X6YA 4XSZF 4Y13A 1VQLI 4BL0B 3WTSC 1JKRC 1H89C 3S3NA 2JVHA 4NHJA 1RZ4A 3MAJA 1LQ1A 4HRIA 4ZDLA 1FYMA 3QYEA 5ICEA 1A04A 3HHGA 5L3GA 3BR3A 3DF8A 3JRIA 3UR3C 2V79A 4UY8I 5FRMA 4HPQA 4ZDPA 2KJCA 4G6DA 1PUEE 3FKIJ 1S5LC 4C9YA 1OYYA 2A6TA 1R00A 4AIJA 3HB9A 2OQGA 1VQKI 5FFZA 2OD5A 3W2AA 1TWHJ 1VQ6I 5ICCA 3ERMA 3K1PA 4M74A 4RLFA 5B1BH 4AIHA 2QCOA 4HF0A 4HX8A 5H20A 3JCUC 3SQNA 4UXNA 5HDKA 2R7OA 4ZYEA 4DBRA 1TBXA 4KN7X 1YIOA 1Z9CA 3LFUA 2FMLA 4MO7A 2DBBA 2E35A 2Z33A 1RKWA 3KYDB 2LRDA 1ON2A 4I01A 1J9IA 3BG6A 2IA2A 2Y9YA 3O6BB 4WCGA 4M6VA 2K85A 2DFEA 5F64A 3W6VA 3RPQA 4G7ZF 2CO5A 2DT5A 1S72I 4RLQA 4YFKF 3E0JB 4Y17A 4PZJA 2NNNA 3PUFA 2RDPA 1GXQA 1GVJA 2IGMA 1FYLA 1KGSA 2GA1A 5FROA 2AQEA 1GVDA 1ERDA 4MTEA 2V7FA 3Q0WA 3F6VA 3OYCA 4A2UA 1TNTA 4C3IJ 5ICGA 1XGSA 4C2TA 3FBNB 1FSHA 2X51A 4IRIA 1JHFA 4BEHB 5BPDA 2Q2EA 1AU7A 5E3LA 4RA2A 4FETA 1RUNA 1QA6A 4PGGA 1ZGAA 3SHFA 3QP5A 5KHDA 2QSFX 4KIFA 1K4TA 1Z77A 4XRFA 2NS7A 3GW2A 4UV8A 4DIQA 3TDUC 4CYCB 1UG0A 3SJMA 2JPCA 2VJIA 5FFXA 1ETYA 2W7NA 2STTA 1XSDA 1HBXG 3QRFF 2CS3A 3CF2A 1KONA 4LB5A 4XOPA 5FKNA 4RDUA 1K78B 1JGGA 1B72B 2EZHA 1IUYA 5DUKA 5J8CA 2MSYA 1VTNC 1KU9A 2K9LA 5TRDA 5F6FA 4II3A 2E1MB 2Z99A 1B6AA 4HSTA 2PFBA 4A0YA 3V7SA 3F21A 5BQTA 3E7LA 3D5LA 3D1NI 1ZRDA 2FBHA 5L3CA 5LHIA 2YPRA 1J75A 3N97A 2JA6J 1SFKA 2L01A 2ZXHA 4S0HB 2E1CA 2DOFA 2WA0A 1SVMA 2LFBA 2CYYA 2V26A 3CCRI 4FX4A 3K1MA 2Z9OA 1SAXA 3LWFA 4GYIA 1EH6A 1KQ0A 4XLEA 3WGHA 3H1CA 3PQJA 3BTCA 1T2KA 2RNGA 3IWFA 3IP4B 3I4PA 2R7XA 2M1BA 3RPUD 4LMYA 1SMYF 3MZYA 2KZVA 1SD7A 3H5NA 2DDBA 3E1SA 3RJPA 3OIPA 3F72A 5E3OA 2NVQJ 2DK8A 2L54A 1ZGJA 4BY1J 5EZGA 1FOYA 5E8IA 1TQMA 2KFDA 5DCFA 1HOMA 2WBMA 4A3JJ 2OTLI 2EB7A 3QODA 2ELKA 1BIBA 2EFWA 4KISA 1FEXA 3DPTA 2P7CB 4ZYHA 1EF4A 1I6HJ 1WSUA 5TISC 4BNCA 2M8GX 2VL8A 2LSOA 4QPQA 5GADJ 2KP6A 4HNTA 3HSRA 3LL7A 4EGYA 1RNLA 1VNDA 2FE3A 2KRFA 3LSJA 3WTVC 3KZIC 3OYLA 1U9NA 1Z21A 4LIUA 3TOBA 4IPAA 4DGWB 2O6GE 1X1PA 2NOGA 3CJTB 1JXSA 2V6CA 3B6AA 3F9KA 4MEXF 1GT0C 4CCLA 2PMHA 1APLC 2XGDA 2DXIA 1K83J 2DT6A 2ZNYA 3WTWC 3SEQA 4Y4RA 4AU7A 1TW2A 4KN4X 2HDCA 2QZ8A 2XGEA 2DO7A 1YIJI 2L3DA 2JN6A 1N75A 2L9RA 4E4HA 3ZQQA 2V1UA 2IS2A 3FK7A 3QPSA 4A0ZA 1AWCA 4C3JJ 2KDOA 4A5NA 1OCRH 1I1GA 4P55A 4ENJA 5HODA 1IRFA 2OA4A 3OL4A 5E3MA 1T0FA 3Q9SA 3JTGA 4LG3A 3DEWA 2Q8KA 3CCJI 4OWRB 3P7NA 2R7QA 4QLCU 3H9JA 1XCVA 1GDTA 1FNNA 4AC0A 2EFPA 4C30A 2RGVA 3AL0B 2E1MC 4GRIA 4IHYA 1BI0A 3FMQA 1TZLA 4AM3A 2EFOA 3ZMTA 1QPIA 2E2IJ 2KIMA 1QZZA 2HS5A 4IEJA 1MNMC 3LSTA 1WJEA 2L0KA 3C3WA 4XM3A 4IVNA 3NARA 2OU2A 1W1WE 3TW6A 1G4DA 1HQCA 2AHQA 2Y30A 3MZ8A 1ON1A 4E70A 1OQYA 4G7OF 2AXTC 5M3MJ 5CVJA 1N25A 1T33A 1VQ9I 2CUFA 3FDYA 4QIWN 1R6RA 2P0WA 4KYWA 2Q2EB 2MA3A 3Q0VA 4CZCA 1S29A 4XRSA 3BPXA 2ZO4A 5EZHA 5DS9A 2E19A 5FKMA 1F9NA 4M9SA 3M8JA 1O7FA 2XB5A 3HOVJ 3S32A 4F91B 1F4KA 1LEAA 1ZAOA 2VJ4A 4BDYA 3FXUA 1U3EM 2KHMA 2JSPA 2QSGX 1K61A 2OC6A 3OYKA 4HBLA 3LSGA 4YIFA 2VBXA 2FXAA 3E5XA 3NRVA 1W5CC 5CQEA 3L2RA 4IX7A 5ED4A 4LLLA 4B47A 3CCVI 5DTDA 3W2WA 2GM4A 1MBJA 2O5RA 3WHBA 1LUJB 3OYHA 2PQ8A 1VQ7I 2ID6A 2DA3A 3BDDA 3DTEA 3KP4A 1UHWA 2CQQA 3E5QA 4EJOA 4U0YA 3PM1A 3R4KA 4HEA2 1RIOH 4A69C 1NH3A 1RESA 2WV1A 1Z3XA 1E0EA 1P7JA 2RC4A 5J4VA 2RN7A 3CMAI 5IP7J 2LC2A 5GTIC 1FZPB 3TO7A 4BHBA 1SC7A 3KE2A 1ZREA 2ADUA 2MYSA 2VASA 4KA4A 1GXPA 3WU0A 3G1MA 1IDZA 3S3MA 3KZYA 3V8LA 2K27A 4C3HJ 1HW1A 3GFIA 1ONVA 5D6FA 1ULYA 3AG4H 3C18A 4FT8A 2OBPA 3KETA 1F36A 2M45A 3V8JA 2CGPA 4B3AA 1JUSA 2HOEA 2HNHA 3K0LA 3L09A 5L3FA 4L9NA 1JHHA 3F22A 1DUXC 3PL8A 2DQRA 3LMMA 5E20A 3LSRA 2ZC2A 3G6EI 4EM2A 5EG0A 2JA8J 4F92B 3QPLA 1M1EB 1QO0D 3PSFA 2IPQX 5B5EC 3GZNB 3X2QH 4CA0A 3PFYA 4HLXA 3U21A 5IP6A 1XX5A 1BL0A 2M8EA 5IPAA 2Y69H 1ODDA 1T39A 2F4IA 3AL0C 3H92A 1YX5A 2JRMA 4PGHA 1B9MA 5IT9K 3GZ6A 3CC4I 3DQVC 1UHMA 3W6JB 2M7AA 2MD0A 2BW3A 4PSXA 1ETKA 2R7RA 3G4SI 3LAPA 3KEQA 4PK4A 1IZ1A 5CVVA 1RKTA 3Q3SA 2GIVA 2L9NA 3QOEA 4IQ4A 2LKXA 3IHUA 2D5VA 3KCCA 1V5FA 2A61A 3JRBA 4RGUA 3IRRA 4I76A 4U7BA 2E36A 2L02A 1PJRA 4JX6A 1TNSA 1VQOI 3HRMA 2HOSA 2VKEA 3KP7A 2OF7A 3AG2H 3ZMVA 1S9HA 1XMKA 3OOPA 1FMVA 1LDDA 1F1ZA 1TWAJ 5BOXA 3S15J 1YYVA 1ZN2A 1R22A 2A6HF 1HW2A 1XTAA 3GXOA 3EPZA 5FLVA 4G12A 3VSLA 1X2NA 4EJVA 1LVAA 2EFNA 2ZJRF 4XONA 3BG5A 2IVMA 2DI3A 2XF7A 3MKZA 2ZXWH 1I3AA 1MMGA 4BXUA 1WKMA 3K6GA 3N05A 2ZKZA 2FUG2 2QLZA 2QGUA 1U5TA 4XMYA 5J8FA 1LFPA 3S3OA 3GTMJ 2Y75A 2W84A 1JGSA 3BG9A 4PDKA 5AIPA 3DV8A 1FC3A 1A5JA 1T8IA 2H1KA 2DA1A 4OOIA 2ZMEB 3ZQFA 4ZYDA 2MW8A 3CESA 1A6IA 1L0OC 2M0CA 1KU3A 1TQIA 4OIOF 3ZGKA 1FPQA 2FD5A 4HLYA 3BWGA 2FOKA 1D5YA 2W4SA 1MJBA 2IS4A 5L3BA 1E3OC 4RM3A 2YU3A 4MQVA 2KQRA 1YRNA 1ZKGA 1ETXA 4BBSJ 2R7FA 3OYJA 4QWQA 5JVGF 2R93J 2VI6A 4UUTA 1Y56A 1PYVA 2KIQA 1BW6A 4LFUA 3BROA 4W97A 1LPQA 4V2FA 1ZHFA 3WODF 2IS6A 4RAZA 3OYGA 4I2OA 1R7JA 2QQBA 1ACIA 2HEOA 3PO3J 2PJRA 2FX0A 5J1YA 5EF6A 3I4NJ 2CMPA 4F93B 1O3RA 4G6TB 2DT7B 3RCOA 2DN0A 5ILVA 1MJ9A 4HG2A 2V4JC 5EDNA 3MFKA 1O3SA 1FTTA 2FU4A 4RGRA 1MZBA 3F8FA 1DP3A 1GUUA 1T95A 2J5PA 2ME6A 4JYKA 2DCEA 1ZYRF 1MBHA 5E8GA 4M6XA 1WRJA 3KPHA 3JRDA 1TWFJ 2A6EF 1Z6TA 2QEXI 2PX9A 3KP2A 5EG0B 4E7ZA 4IHXA 1OKRA 2L9SA 1T0FC 1SFOJ 1LEBA 1USSA 2DOAA 3C2HA 5F1RA 5E1WA 2ETHA 3BR1A 1Z7LA 3F0CA 4G7HF 2BYVE 4RAFA 1T56A 2NVXJ 3OL3A 2I10A 3RYPA 3FXRA 2IA1A 3T0YA 2K5CA 2O7OA 3RQ4A 4BACA 4V2GA 2L7FP 1WJDA 4KNYA 3ABTA 1BIAA 3HTUA 1XB4A 4L5IA 4M71A 2O61A 3F23A 1I50J 3F8CA 4ASNA 3CF5F 4PJ0C 2KJBA 1LDKB 1IW7F 2HXIA 2C6YA 4HW0A 1P4XA 2QQ8A 4JX4A 5D5WB 4DNCA 2XHKA 3ZP5A 2B9SA 2E1OA 2AQFA 1J09A 3K4BA 3HOTA 4CCJA 2JA7J 5CKTA 4BQNA 4XICA 3WE2A 5GAHJ 2KKOA 2TCTA 1OR7A 3M3YJ 1B8IA 1DU0A 1P4WA 2IXSA 1ZLJA 3HPHA 2XAQA 3IC7A 5FO5A 1XDSA 3R0AA 2TDXA 3L2WA 2PG4A 4BE0A 2DOEA 4CCOA 3M1CA 2W85A 3R6SA 4UUSA 3KYCB 4UUVA 2HQAA 4FASD 2HVRA 3MKWB 3GCMA 2QENA 2DMPA 3GX4X 3DKWA 2VJ5A 4EJTA 3HRSA 5BNGA 2L7ZA 2WAEA 5CVUA 4Y15A 2VLAA 4YIRX 1RR8C 1R9TJ 3H3VK 1Z3YA 3K2AA 3QOPA 3VEPA 3CCEI 4ANJA 3IKTA 4ZTJA 5GAGJ 4E7JA 3H0GJ 2L7MP 1U0JA 5GPCA 5D5XB 2QM3A 2EIJH 4B8XA 3J81K 1U5TB 5D5UB 2WB1A 2WTEA 3TKYA 2GXAA 1SFUA 4G94A 1LNWA 2DU9A 2A5YB 3QPHA 4HDUA 1MMSA 1FY7A 2DA7A 1I6XA 2QVOA 1Y8QB 3EETA 5KAIC 3ZQ7A 1WCMJ 5M3FJ 4YFNF 3J7ZI 1Q1HA 3MKYB 4HX7A 4RAGA 4D7MA 1LVKA 4KT5C 2XPUA 3WG9A 2FQ3A 2LY2A 2BXZA 2XF5A 1B59A 1HA8A 4ZJZA 1TC3C 2DTRA 4UB6C 1HKSA 2NNYA 2DQLA 4TV7A 3K4MA 2LG4A 3H35A 3M1EA 5IY5H 2EV6A 3R0JA 4M3GA 1AKHA 3M8FA 1YRNB 3T8RA 1IXSB 2L7KA 3WU1B 1X1DA 1OCOH 2XAJA 1R5ID 3GWZA 2FNPA 3GFMA 4HNUA 3KZZA 1FOXA 3CMEI 1V3FA 1TW3A 3I53A 2RAEA 2V6EA 2MBFA 4BHCA 2K7LA 3IAM2 3RQIA 1RETA 3ZMUA 1G3SA 2ZXIA 3FMSA 1HXDA 4YELA 4ABZA 4N4NB 3ZQCA 2DMNA 2H27A 4BDZA 3SYTA 1YOVB 3ZQIA 2PJRB 2HFHA 1J2XA 2L9VA 3LSKA 5LRRA 4F52A 3ASNH 1EJ9A 3LSIA 2VE8A 2FBKA 1SD5A 2F48A 2FF4A 1V5EA 3I3LA 2QKMB 4EQQA 1V4RA 3WHCA 1EV7A 2I5UA 2B63J 1U6GA 4Q47A 4EVIA 1T98A 3H9QA 3LNQA 3CJNA 4IF4A 2Y0MA 3E6DA 2QA4I 3S1QJ 2R3SA 5A2QZ 3L2VA 3RPUA 1JTYA 5B66C 4KDPA 3K7AJ 2FA5A 2Z3YA 3BR6A 1RPWA 2HR3A 2HOTA 2CUJA 3LFKA 4NB5A 3GO5A 1YO5C 3BJ6A 5DEQA 2DFHA 2GQQA 2O0YA 3FISA 3KYLA 1USTA 1BA5A 3FKJA 1KQ9A 3A0HC 3R60A 3MZHA 3UNGC 1XC5A 1YLFA 4NBQA 2WB1N 5ICFA 2A07F 2CFOA 2JMWA 1L3LA 4A3CJ 2DTZA 3BPVA 1W0UA 1ZQ3P 1D1BA 1JJ6C 2ME0A 3QWLA 1X1AA 2XF6A 2D45A 1ZG1A 3CUQB 2EA4A 3FXQA 2KT0A 3DBRB 1U78A 2DJNA 1BOBA 1Y1WJ 1WJCA 4PFPA 5EJCA 4BE1A 3K4JA 4XN0A 2X1EA 2M5WA 2XRNA 1ORKA 1U5TC 4IQJA 2R7TA 2DODA 2V9VA 2XGCA 3S2DJ 4P96A 2JT1A 5LGNA 3OY9A 3AFHA 1YE9A 3L2QA 3Q5FA 5J6XA 4GYGA 1D8JA 3RTRA 4RBOA 3R61A 4ZYAA 4LLGF 2IS1A 1PP7U 2XKOA 4L18B 1FBQA 4AIDA 1R4MB 1B8IB 3BTLA 4KFCA 5LHGA 4GO1A 4ZC3A 1SFXA 2IGOA 1S8NA 2EZLA 2HQRA 4HF1A 3GUDA 4RGXA 1IV6A 4BXXJ 3T1BA 1R36A 1ZELA 3PIPF 3ABLH 4UUSB 3RZOJ 3HPGA 5IT3A 4M3DA 1ETWA 4OINF 3TGNA 3J7AY 1WVRA 2MH9A 1QNTA 3IWZA 1FMWA 4YRVA 4OIQF 1FBUA 2I8DA 1IN6A 2YR2A 3A03A 2JUCA 2XAHA 4LK0F 1O4XA 1X1CA 2CG4A 2JWTA 1W36D 2H8RA 4D1QA 5JHUA 3L7WA 2JTVA 4XOTA 2VBWA 5CYVA 4ZH4F 4A93J 2OCCH 2PBIA 2W57A 4G6QA 5CPRB 2HKXA 2RQPA 2CUZA 4MLOA 4WWCA 5H6QA 3BOQA 5F0HA 2COMA 3HOZJ 1NG7A 1UFMA 4W1UA 2MABA 3ABKH 3VB2A 2QSHX 3PUBA 2R7DA 2X0LA 4CYDA 4EATA 3DPLC 2JVGA 3IKVA 3OSFA 3MD2A 2M4GA 3BC8A 4XSXF 1KYZA 2BZTA 2KPMA 3DU6A 1X3UA 3JSPA 1S3JA 1WH7A 3K4CA 4XQFA 4I99C 1S6LA 2LBFA 4XIDA 4ESFA 1D3YA 2HXOA 4BS9A 4U87A 3GTLJ 3LA2A 4C2UA 4RM2A 4XK4A 4PJMA 5GP9A 2ZNZA 3FBIB 3LSHA 2P5LC 2GOMA 1AKHB 3G3ZA 4I0AA 4J01A 1JUMA 1U8BA 2RV8A 2FQ4A 4A6DA 1PUFA 3DBHB 3GEZA 1F5TA 1YW9A 1FOKA 5L3DA 3WG7H 1R5HA 1H8AC 2HI3A 3P9CA 4BYYA 3DU5A 2RNJA 1AA7A 3SFIA 5IOZA 4Y52J 1FBSA 1IRGA 4P1WA 3SZPA 4A3FJ 1U9OA 1V5GA 2KRCA 3MMYB 2ECCA 2LOOA 3KP5A 3Q0UA 4AIKA 3BTIA 2EH3A 4PJJA 3CLOA 2HZTA 3KP6A 2GZWA 4RGSA 5HVQC 2CH0A 3CO6C 2IW5A 3QYFA 2M30A 4N9HA 3QYBA 1WFXA 2K4BA 3PNVA 5E17F 2BY3A 2ZFWA 4M72A 2ZFUA 3BR2A 1EH7A 3H36A 5IOYA 1V55H 2VXZA 2OAZA 1WZ2A 2ICWG 2CJJA 3HDDA 2XAFA 4BBRJ 1MGTA 2Z1DA 3REOA 4E7LA 5K5QA 3K70D 3TOAA 5E79C 2L5QA 3LAJA 1IN8A 2M2EA 1OCZH 4F3QA 3QPTA 2VC1A 4KIGA 1LE8A 1JJ8C 3I59A 4L0ZB 4BJ6C 1BI2A 3OOUA 1OR7C 1MBFA 3T8TA 4IHSA 5FLXZ 5EEGA 2ESHA 2QQ9A 2IGKA 3CLQA 1X3WB 2F4OB 1Z67A 4OMYA 3GZ5A 1FP1D 4HQMA 4XLCA 3IV5A 3GLLA 2Z16A 3F6OA 1ETOA 3HHHA 1FX7A 4NUBA 2FSWA 3ML6A 2ZMEA 5LEKA 2F5DA 5L3EA 1UELB 3LA7A 5FLMJ 3S14J 3LA3A 4AD9A 3IUOA 1A35A 2BEOA 3I55I 3SEZA 3J80Z 2VC0A 1GV2A 2CW0F 2LMDA 2OPTA 4EJUA 3ZRGA 4BKXA 3FIWA 2CWEA 4WXHA 4KMFA 1I1SA 1EA3A 2Z5UA 2X6XA 3LSMA 2LK2A 3F8MA 3DEUA 1XN7A 1O3TA 4HNVA 4U7DA 4GFBA 2MC3A 2JUGA 3F3XA 4LIVA 1H88C 4HV5A 2LDUA 3U1DA 3CO7C 3HRUA 1XPXA 4DZJA 1HLVA 1S7AA 2XPWA 5LEJA 3EUHA 2LR8A 5HDNA 3EDPA 4E6KG 3HXLA 3G73A 3OV8A 4UVCA 1DGRM 2H1LA 3BJAA 5DM6F 2H6BA 4HZFA 2EIKH 3GTJJ 4Z6YA 2W24A 4D7NA 1UMQA 3GVAA 1X58A 2BHZA 5LFAA 1HW5A 1YS6A 5E18F 3VWBA 4Y7NJ 3I71A 2FBIA 3VYRB 4HA8A 1I5ZA 4IL6C 1IC8A 1W0TA 1UAAA 2M34A 3C1DA 3GMEA 3N4MA 3AG1H 4HV6A 3WGGA 1GHCA 1STZA 1J59A 2DPUA 3HJEA 5DD4A 3OS1A 2CU7A 3PFIA 2HKOA 4BQQA 2XAUA 5KK1A 4MFDA 4UNOA 4L9JA 4YFXF 3P9KA 3WTYC 3E6BA 5AIQA 1OYIA 1SVOA 3OR2C 4ZZLA 3KFWX 3K69A 3W6KB 5D8KB 2WWYA 4KICA 2NXNB 2VPRA 1UB9A 3JRFA 4ETSA 1KU7A 1E17A 1WJFA 2V1NA 2DA6A 3IAS2 2A69F 1Y1VJ 4LOCA 1QVUA 3HL2A 1P4AA 2LBFB 3W3CA 2HYFA 2R5YB 2ZJ2A 5J4YA 1UJ8A 2BE5F 1P7IA 3PJRA 1IO2A 3HZJA 3HM5A 1MSEC 4EJWA 1Q1VA 4HF2A 4JP0A 4HSRA 4A5MA 2NVUB 4IOCF 2UV1A 2O03A 5AONA 3JR9A 1W5SA 2BY0A 1IXRC 2K3PA 4IXAA 1PUFB 3JREA 5TGTA 3OS0A 2JA2A 1J7KA 2VQLA 1XG1A 2HU9A 2LF7A 2LNBA 2ZBKA 5LHHA 4R1HA 1XMAA 3O8HA 1B9NA 1WI9A 2GAUA 3E3VA 1WJBA 2Y48A 1GLNA 2HDWA 4JBAA 1YJ9I 3NWTA 2XRLA 3CJQB 3QQAA 1A31A 2P8TA 2OV7A 2F6CA 1FIAA 3MWMA 5HLIA 2DJIA 2NAZA 1QZEA 1XGOA 2YU9J 2ISYA 1O57A 2VKVA 1LKXA 2E34A 2NOJB 4B1RA 1CGPA 5E1XA 1YW7A 3K4LA 3FM3A 2QWWA 1BI1A 2WC2A 3JSOA 2QF7A 3AKZA 2LY1A 4H4KC 2VXDA 1LE8B 3I59B 3AAFA 1Z6RA 1MNDA 4PSWA 3GTOJ 1MD0A 2H94A 3L9FA 4FTHA 2ACJA 3MVPA 3L2CA 3GTQJ 3J7AO 4IHWA 1S7EA 2X48A 3E97A 3HOUJ 1NG6A 3S93A 1W7PA 3ABUA 3OYEA 5CJ9A 2LY9A 2EV0A 5K5OA 1IG7A 4JQFA 2BXYA 2YSRA 5FKOA 2OCEA 3SDGA 4QSHA 3PQKA 4OAYA 1K79A 1DDNA 1R5GA 3ROUA 5DM7F 3GFJA 1OPCA 3ESWB 4BAYA 2LTPA 3O2PE 1SD6A 3K70C 1RR7A 5J47A 4ESJA 4NC8A 3BG7A 1YHQI 5C3EJ 4UVAA 2R4GA 4Q4ZF 2GIZA 2D2WA 3NEUA 3CJRB 5BS6A 2MLKA 2PN6A 3OYDA 2HQ5A 3GLXA 3OYNA 3KX2A 1B4AA 1HCRA 2O3FA 2BBYA 2EV5A 5M5YJ 3ISPA 3V7CA 1F43A 2YS9A 1EH8A 3HC7A 2WAQA 2FNAA 2QUFA 1TT0A 3DKXA 5EYRA 4L5JA 2G7HA 4HAMA 1OMIA 1P2FA 4U0WA 3RKWA 1J0RA 4P9FA 5LBQA 4KT6A 2P4WA 2A68F 2IA0A 4HQEA 3V7RA 2BHYA 4CHUA 4PUSA 4K2EA 2IJLA 3TP0A 3V42A 1SVLA 3IL2A 1W4MA 3NAUA 4P9UA 4CSWA 2VN2A 4PFOA 1I39A 1IAWA 3SZTA 2NVYJ 3CP8A 4C2MJ 2R7UA 3HGGA 1K7AA 1SFEA 2CV2A 2KMUA 3FX3A 4M3BA 1W7PD 4UVBA 3ERED 4RB2C 1VQ5I 3CUOA 3CCYA 4I7HA 3V4GA 3IH2A 2W82A 5DD8A 2KISA 3GFLA 2R0QC 3WE3A 1MNEA 3KEOA 2IRFG 2LYCA 1FWZA 5LLQA 3CTAA 1Y39A 1LFUP 3DLLF 2DAOA 5FGMA 4EM0B 2VBYA 3WTXC 3W2VA 1B1BA 4YEJA 4QTRA 4KUMA 3RKXA 4B09A 1OCTC 3ELKA 3ZMSA 4DW6A 3CUQA 3KEYA 2K02A 1T6SA 3H5RA 2HOAA 5LGUA 2XV4S 1MMNA 4A3GJ 3L00A 1IF1A 3MEXA 4DYCA 1KQ8A 2VB6A 5IYDJ 2RREA 1FT9A 3OSGA 5DYMA 2Y0SA 2DFIA 2F5EA 1BR4A 2OQRA 3CDIA 4WF2A 2UZKA 4B43A 2QQAA 2N8GA 1G59A 1BI3A 2YX7A 3RYRA 1YTYA 3A01A 2ZMEC 3BJOA 4U0VA 2OZ6A 2ZXJA 4BQOA 2Y31A 1D8KA 3LOCA 2BVLA 3GTKJ 5F0CA 3FWEA 3OMYA 1K6OA 4A6EA 1RUOA 3HOWJ 2IP2A 3BR0A 1O7LA 5BPIA 3Q9VA 4XRMA 4LB6B 3HOXJ 5F08A 2VKDA 2JK3A 4CCMA 4ESBA 2WAQN 4OIRF 2EBIA 2ZB9A 2FEZA 2KL4A 2EA2A 4NC7A 4HYEA 3VYTB 1YJNI 3I4MJ 2MG4A 2VONA 1KU2A 4N4OB 1R1VA 4CO8A 2K86A 3BR5A 3JRCA 4IZZA 1FYKA 2A5WA 3CMMA 1VFCA 2COBA 1I3QJ 3CC7I 3EUHC 3A2KA 2V9KA 3K4NA 3I64A 2X6OA 2P5VA 1ZK8A 1ZRCA 1P9QC 3QU6A 2GXBA 2KRHA 1BC8C 1NHAA 1TTYA 3A0BC 1G2HA 3C2BA 3FXJA 3DWLE 4XLNF 3RSNA 4I09A 3ZN0A 4FE4A 4A3DJ 1V54H 2H8WA 3JAMK 3V8KA 1W7PB 1LJ9A 4CZZA 3A1YA 3FXLA 2CRGA 5JLWA 1RRJA 1LFBA 4BY7J 4AYBA 3WGIA 1OISA 5DCMA 3VPRA 3M4OJ 2Z2SB 2GXGA 4RAYA 3CMYA 1OJLA 1R58A 3TEDA 1D5VA 2ELJA 4M73A 3EQLF 2MFZA 1FSEA 2OJED 2R92J 4HDVA 2GA2A 1JE8A 1TWCJ 1VQMI 3MCZA 4XBFA 2MC4A 1W5TA 1X4PA 4OU0A 2IEKA 3M07A 1ZR2A 3S17J 3S1NJ 1Y0UA 4M9XA 3K4KA 3JW4A 3L1PA 2HYGD 2P5KA 2Y0SN 1E3HA 4L0YB 2PI0A 2ESNA 1MKMA 4E7IA 2HVQA 2O8KA 1D1CA 1RC9A 1FJLA 4R8HA 5HDGA 2VQCA 5J1RA 1ETVA 1YQAA 2HTJA 4F7ZA 1X2MA 4D9JA 5LRSA 2JRTA 2VQHA 2JSCA 1PVEA 4G9YA 4LG0A 5EGOA 2LKPA 2J5OA 3ZN1A 3DTKA 2HPMA 2X4HA 3HSFA 5M5XJ 4KIBA 1WQ2A 5K1YA 1R49A 3ZR8X 3PNYA 1TL8A 1LB2A 5JHFA 2E7XA 2JPBA 2HPIA 2R7ZJ 1SMTA 3G1OA 1TWGJ 3G1LA 5FKKA 4ON0A 2W48A 3KIOA 2DMQA 3H0DA 3TL4X 4RB1A 3AG3H 4FISA 3BT9A 4NQWA 5GPAA 2X85A 1JT0A 4GDFA 4EMSA 1DQUA 4CH7A 2LF8A 3HIFA 2W1OA 2XIGA 2QYOA 2WADA 1TLHB 1SD4A 1I27A 2G0EA 4KJZA 4LD5A 4AUXA 1R23A 5FB2A 2FMYA 2CSOA 3DCFA 2V1XA 3O8GA 1CF7A 2VOPA 2YX4A 2L2OA 2K9NA 3U2RA 2E2HJ 4J19A 3BZ6A 1Y6IA 1FIPA 1IRZA 2XSDC 2ISZA 3DPUA 3HKZA 2VBZA 4AYBN 1DPUA 2F4MB 1G3WA 3BCBA 1BJZA 4MFEA 4CGZA 4Q48A 3FXOA 2GOXB 5JLXA 4CCNA 3DKYA 1DPRA 1R1UA 2QKLB 3JRGA 2MGQA 3BP8A 1CQTA 4JOMA 1JKPC 1QBJA 5FKLA 2HTSA 3A01B 3ABMH 1UZCA 2R7WA 3CCSI 1DU6A 5HNHA 2PEXA 3S8PA 2PMZA 1A6QA 3HTSB 3K2ZA 5JI6A 1FTZA 2E60A 2RVCA 3GTPJ 2M3AA 1RI7A 3QU3A 4BQAA 4FQGA 1FOWA 1NK2P 2EWNA 4WXCA 5JR3A 2CV0A 1U8RA 5IYBJ 4B48A 4G8XA 1QQIA 2LVSA 5K7ZA 4B4CA 1ZGWA 2BY1A 2A05A 1SANA 2EFQA 1IGNA 2V1DA 2ELHA 2BV6A 4D0PA 2BY2A 3L2UA 4A3LJ 2AO9A 1XGNA 2VODA 3E5UA 3RKQA 3PSIA 1JKQC 3H3ZA 2HZDA 3D5RC 4Y33A 5ILUA 3CCMI 4H0EA 2L4MA 5KVRA 1OLTA 5J3LA 1UHSA 3BLYA 3DEEA 4RMNA 1Z05A 5K7HA 3B6CA 5CVIA 1ZR4A 2D1VA 1OYWA 3BQYA 5HS9A 3GYHX 5DCMB 2XUBA 3WU2C 4IKFA 2F2EA 2R5YA 3NQOA 3D5SC 5FRNA 3RKYA 1HF0A 1BR2A 5GAEJ 2E1NA 4MHGA 1JUPA 2KIUA 5KNLA 5DUIA 2MLGA 3FM5A 2CV1A 4X6AJ 1VQ4I 4X1EA 3ZXSA 3FHNA 1XSXA 3BY6A 4FCYA 1Z7UA 3H3UA 3CCLI 3HKZN 3TQNA 3HYIA 1X4OA 2DMTA 2FOWA 2XDVA 1YITI 3HEFA 3LSPA 2ZJQF 2PMUA 2H09A 1FLIA 1MSFC 1ETQA 3FK6A 3I54A 2DYRH 1NK3P 4XLPF 1JT6A 3M7GA 2QBYA 1H9GA 1HC8A 2IAIA 3QAHA 4II2A 3EYYA 1WJAA 1D0XA 4HX4A 1BC7C 3FMRA 2EILH 3S16J 4N9IA 4ZDOA 4D5CA 3EUAA 4DYRA 2A3SA 3VOEA 2DA4A 3CUQC 3TW7A 1HDDC 3HBLA 2RQQA 2P7VB 2PMZN 5IT9Z 2YUSA 3FXKA 3GF2A 4YG2F 1UG2A 4IRHA 3S2WA 1OFCX 5EGOB 3C2GA 1YJWI 3CZ6A 5A2QK 1T38A 4LG0B 2JZYA 5J40A 3SZGA 3ZPLA 4O6JA 1K4SA 1VF9A
chains in the Genus database with same CATH topology
2IGMA 2K9MA 3RQ4A 4BACA 4F55A 5FROA 2AQEA 1ERDA 1WJBA 1WJDA 1GLNA 2HDWA 2V7FA 3NWTA 3OYCA 3CJQB 4C2TA 2OV7A 3FBNB 2F6CA 2X51A 4NQWB 4BEHB 3ZCOA 2DJIA 1LDKB 4BJTA 4FETA 3A4CA 1LKXA 5KHDA 1YX3A 2NOJB 2AQFA 1J09A 3K4BA 4DIQA 3HOTA 1IRXA 1UG0A 2E5NA 3H5AA 3K4LA 4CCJA 4E7KA 2VJIA 5CKTA 4BQNA 3OYFA 1D0YA 3AKZA 2W7NA 2LY1A 4H4KC 5HNFA 2VXDA 4PSWA 1MNDA 2BVMA 2CS3A 3CF2A 1KONA 2M4KA 3H9GA 2IXSA 4XOPA 4XLAA 3HPHA 2X1DA 4XLFA 3L2WA 4BE0A 4CCOA 3M1CA 2K9LA 4II3A 4XKCA 2HQAA 1D1AA 1NG6A 2CW8A 3S93A 2M0MA 4FASD 2E1MB 4XKVA 3OYEA 4HSTA 3MKWB 2HVRA 2HVSA 1X19A 4ZTFA 2VJ5A 1N77A 4JQFA 2WAEA 2CW7A 2VLAA 3D5LA 4BUPA 4OAYA 2WY8Q 1Z3YA 3SDBA 1SFKA 4ANJA 3K70C 2ZXHA 2ZSIB 4ZTJA 4E7JA 2WA0A 1U0JA 4XNFA 1QU3A 2V26A 2ZSHB 4NC8A 2WB1A 4XLEA 3BG7A 2WY7Q 2R4GA 3OWTA 2RNGA 3IP4B 2R7XA 3CJRB 3RPUD 3DTIA 3OYDA 3OYNA 3MKYB 2KZVA 3KX2A 4BE2A 3H5NA 1LVKA 3E1SA 2LY2A 3OIPA 2XF5A 5LD2C 1HA8A 4ZJZA 3HC7A 3VYUB 4P5OA 4XKWA 2WAQA 3K4MA 2LG4A 3H35A 1TT0A 2WBMA 2R7SA 3DKXA 3QODA 4R79A 3NWSA 4KISA 1D0ZA 3DPTA 2XC7A 2L7KA 4KT6A 1X1DA 3TMOA 2VL8A 2Q1ZB 4QPQA 4PUSA 2KP6A 4HNTA 4E7HA 3PNTA 3LL7A 4HNUA 3V42A 3OS2A 1WJ5A 3OYLA 4E7SA 3OYIA 1Z21A 4LIUA 2V6EA 4DGWB 4XR6A 4CSWA 3IAM2 4PFOA 3CP8A 2R7UA 3F9KA 3BCAA 2ZXIA 4DOZA 4YELA 2CV2A 2KMUA 4N4NB 4BDZA 3SYTA 2PJRB 3EUKL 4CCLA 3LSKA 2DXIA 2DT6A 3SEQA 1W36C 4F52A 3LSIA 1BR1A 2W82A 4Y4RA 4AU7A 1V5EA 3I3LA 4BU2A 1MNEA 2QKMB 4BXFA 4X0GA 2LYCA 1MW7A 1N75A 4E4HA 3ZQQA 2IS2A 3H9QA 2X1CA 2KDOA 3W2VA 4YEJA 3L2VA 4XKBA 3CP2A 3OL4A 3KEYA 2CUJA 3H5RA 4LG3A 4OWRB 1MMNA 2R7QA 3KYLA 3H9JA 2VB6A 3FKJA 2RREA 2Y0SA 3UNGC 4C30A 3AL0B 3I9V2 1BR4A 2E1MC 4GRIA 4B43A 2CFOA 1TZLA 1G59A 2X6WA 1WJEA 1D1BA 4XM3A 4PJLA 4BQOA 1X1AA 3OYAA 2BVLA 2XF6A 3OMYA 1N78A 1BOBA 4XLHA 1WJCA 4PFPA 4BE1A 3FDYA 3K4JA 1R6RA 2P0WA 2X1EA 2Q2EB 4XN0A 2VKDA 4J00A 4IQJA 2R7TA 2VQGA 4CCMA 4CZCA 2KL4A 3OY9A 3AFHA 3VYSB 2OUMA 4NC7A 1YE9A 3M8JA 3VYTB 3L2QA 3S32A 4F91B 2VJ4A 1QHHD 3RTRA 4BDYA 4N4OB 4ZYAA 2IS1A 2KHMA 2JSPA 4IZZA 5HLTA 2A5WA 3TBIA 2OC6A 3CMMA 3OYKA 3LSGA 3A2KA 3EUHC 4ZC3A 2V9KA 4AVZA 2IGOA 3K4NA 1P9QC 2KRHA 5CQEA 3L2RA 4IX7A 4B47A 1ZELA 3W2WA 3DWLE 3RSNA 2O5RA 2UUZA 3HPGA 3OYHA 3J7AY 2VKHA 4YRVA 1FMWA 2W00A 1QHGA 1K6YA 3DTEA 2I8DA 3A1YA 4BGDA 4HEA2 4AYBA 1X1CA 1W36D 1Z3XA 4D1QA 1E0EA 4XOTA 2VIXA 2Z2SB 2LC2A 1MMAA 2ELJA 5CPRB 4B44A 2MFZA 2CUZA 4MLOA 4DBQA 3K10A 1NG7A 2MYSA 2VASA 2MABA 3S3MA 1X1BA 2MC4A 1X4PA 3PUBA 3OYBA 4EATA 1VZ0A 1DGWY 3DPLC 2JVGA 3K4KA 3MD2A 2M4GA 3BC8A 2KPMA 3DU6A 2HNHA 3K4CA 4XQFA 2LBFA 3PL8A 3LMMA 4E7IA 4BS9A 2HVQA 4U87A 1D1CA 4LITA 4C2UA 4RM2A 4PJMA 4F92B 4PJNA 3PSFA 4NNJA 3FBIB 3LSHA 2VQCA 2GOMA 4CA0A 3PFYA 4D9JA 3U21A 2VQHA 4J01A 4Y3OA 3DTKA 2HPMA 2F4IA 3DU5A 1AA7A 3AL0C 3ZR8X 3PNYA 4P1WA 5JHFA 2HPIA 1YX5A 1V5GA 2KRCA 3MMYB 2BOLA 2LOOA 4PJJA 3OR1C 3DQVC 4KITB 5HVQC 2CH0A 1SAUA 2M7AA 3VSKA 2MD0A 3QYFA 2KLOA 2BW3A 4PSXA 3TL4X 2E5ZA 1WFXA 3QYBA 3H0DA 2R7RA 3PNVA 2X85A 4PK4A 4BEHA 1DQUA 2ZFUA 4XL9A 4CH7A 1JI8A 2L9NA 2VXZA 2W1OA 3OIQA 3QOEA 4IQ4A 2WADA 1V5FA 2Z1DA 4E7LA 3K70D 4OAZA 4KJZA 5CQGA 2WAFA 4U7BA 2L5QA 3OYMA 4F3QA 1PJRA 2VJJA 3HUGB 4CCKA 2L2OA 3HOSA 1Y6IA 4BJ6C 3OOUA 1OR7C 1S9HA 1FMVA 2BW3B 3DPUA 3HKZA 3ONQA 3BCBA 2IGKA 4XORA 3EPZA 4XLCA 4ITVA 3VSLA 2Z16A 2GOXB 3GBGA 4CCNA 3DKYA 4NUBA 4XONA 2QKLB 1UELB 2XF7A 4JOMA 4BJ5C 4CUGA 3MKZA 3IUOA 2R7WA 1MMGA 5HNHA 3SEZA 3S8PA 2PMZA 1MMDA 1G8XA 3ZRGA 3K6GA 3N05A 2FUG2 1EA3A 4DJAA 2E60A 2X6XA 3LSMA 2M3AA 4XMYA 1LFPA 3S3OA 3DLAA 2CV0A 2JUGA 2IGNA 4B48A 4LIVA 4QPOA 4B3XA 2UWMA 3G2BA 3VDXA 3CESA 4XN3A 3ZGKA 4E6KG 2VPLA 5HOOA 3HXLA 3L2UA 3HG9A 2M7BA 2W4SA 1DGRM 2IS4A 2XSJC 4RM3A 2R7VA 2KQRA 5KCMA 2LREA 3PSIA 2F5VA 2HZDA 2LH9A 2X6YA 3D5RC 4Y33A 5LFAA 3OYJA 3VWBA 4BL0B 3S3NA 1OLTA 2JVHA 1Y56A 1PYVA 3BLYA 3DEEA 4RMNA 4ZDLA 3VYRB 4HRIA 3QYEA 2IS6A 3UR3C 1UAAA 3OYGA 4IKFA 5FRMA 4HPQA 4ZDPA 4C9YA 3D5SC 5FRNA 2A6TA 2PJRA 1BR2A 3OS1A 5KNLA 4BQQA 3W2AA 2CMPA 2CV1A 2XAUA 4F93B 4RLFA 3ZXSA 3FHNA 4G6TB 2DT7B 3RCOA 3OR2C 4HG2A 1X4OA 2XDVA 2V4JC 2R7OA 1WJFA 2V1NA 1DP3A 3IAS2 1T95A 4DBRA 3HL2A 3LFUA 2DCEA 3W3CA 2LBFB 4II2A 1WJAA 1D0XA 3PJRA 4ZDOA 2LRDA 3EUAA 4E7ZA 3BG6A 2L9SA 1T0FC 4HSRA 2RQQA 2DOAA 3C2HA 2UV1A 2K3PA 3C2GA 3CZ6A 1Z7LA 5TGTA 3OS0A 4RLQA 2JA2A 3OL3A 3SZGA 2VQLA 3E0JB 2HU9A 2K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WY7 Q;  2JVH A;  2WY8 Q;  3D5R C;  2JVG A;  2GOM A;  2NOJ B;  3D5S C;  2GOX B; 
#chains in the Genus database with same CATH topology
 2K9M A;  2L4A A;  1HSJ A;  3DXJ F;  4F55 A;  3ZMZ A;  2EZI A;  4RB0 A;  4MTD A;  1IN5 A;  2CFX A;  4U88 A;  1JTX A;  4MNU A;  5HLG A;  1BJA A;  5FD6 A;  1BOA A;  4NQW B;  5JFR A;  4I02 A;  3ZCO A;  2VT2 A;  4BJT A;  1BM9 A;  3FXM A;  1HKT A;  5HS8 A;  3A4C A;  2NS8 A;  3GTG J;  5LGT A;  1YX3 A;  2CQ7 A;  3M9A A;  1VQ8 I;  2OZU A;  3T5X A;  3RIR A;  1IV8 A;  4A3B J;  4GXO A;  5CLS A;  1IRX A;  3ZOB A;  2E5N A;  1MBK A;  2G7U A;  3H5A A;  4E7K A;  3FZV A;  1MH4 A;  5GTH C;  1CF7 B;  1IDY A;  3A02 A;  3OYF A;  1D0Y A;  1TQP A;  5HNF A;  1MDM A;  2NYX A;  4I6Z A;  5E1Z B;  3BTJ A;  2BVM A;  5K5R A;  4D5F A;  2M4K A;  3H9G A;  1REP C;  4XLA A;  2X1D A;  4XLF A;  3I0T A;  4M9Z A;  2UXN A;  3I56 I;  1C0W A;  2NRA C;  2DFF A;  2ZCW A;  2RKH A;  4S04 A;  5DDG A;  3CDH A;  4XKC A;  1D1A A;  2KDZ A;  3SXY A;  2CW8 A;  4MEY F;  2M0M A;  3S2H J;  4XKV A;  2HVS A;  3EYI A;  2E7W A;  1VQN I;  1X19 A;  4ZTF A;  5EEH A;  1N77 A;  4AVP A;  5C4X J;  1JKO C;  2CW7 A;  4BUP A;  1XMX A;  2WY8 Q;  4Q5S F;  2KIF A;  2XKP A;  3SDB A;  1P92 A;  3WTZ A;  1MBE A;  2ZSI B;  4L9T A;  4XNF A;  1QU3 A;  9ANT A;  5TJJ A;  2IBD A;  2ZSH B;  1ZH5 A;  1POG A;  2FJ1 A;  2P6T A;  4MGR A;  1HST A;  3RDI A;  2WY7 Q;  2AS5 F;  3B02 A;  3OWT A;  4RS8 A;  4PCQ A;  2K9S A;  2V9P A;  2ZJP F;  3DTI A;  4JK1 X;  1XS9 A;  3VOD A;  1BBY A;  2CQX A;  4IRG A;  2PLY A;  3K9T A;  2EIM H;  4BE2 A;  3SFZ A;  4UHT A;  4LJZ F;  2XB0 X;  4A3M J;  2MH2 A;  4IHT A;  5LD2 C;  5HLH A;  3HOY J;  4CXF A;  3VYU B;  4P5O A;  4JX5 A;  4XKW A;  1R71 A;  1IUF A;  2HQN A;  1KA8 A;  1WI3 A;  2R7S A;  4R79 A;  1BN5 A;  3NWS A;  2X9D A;  2NVT J;  1D0Z A;  4O3M A;  5H6R A;  4BH9 A;  2XC7 A;  3TMO A;  4NC6 A;  3TO6 A;  2ID3 A;  2DDA A;  3B73 A;  2Q1Z B;  3WTU C;  1WWX A;  4E7H A;  3PNT A;  2R5Z A;  1E3P A;  3FF5 A;  1KYW A;  3OS2 A;  3MKL A;  1YI2 I;  1WJ5 A;  3DFG A;  2HWV A;  2Q0O A;  4E7S A;  2JQ7 A;  3OYI A;  2FRH A;  4XR6 A;  2BGC A;  4IO9 F;  3JRH A;  3COA C;  2CQN A;  2VT3 A;  3CQZ J;  1Z0X A;  1IN7 A;  3CDL A;  3BCA A;  4DOZ A;  3CCQ I;  4M6Y A;  3TP3 A;  1ENH A;  5B3S H;  3LQQ A;  3U1K A;  3P9I A;  3PIO F;  3EUK L;  4IOA F;  3TDZ C;  1OCC H;  5IP9 J;  1QRY A;  4L9V A;  1W36 C;  1BR1 A;  1WHU A;  3VFZ A;  3CCU I;  4LK1 F;  3ECH A;  2GBY A;  4BU2 A;  4ENN A;  4BXF A;  4X0G A;  3LQR A;  5CVR A;  3DP7 A;  1MW7 A;  3I5U A;  3HUG A;  2X1C A;  5D4S A;  4BHP A;  4S05 A;  2QBY B;  4O5V A;  4XKB A;  3CP2 A;  3F8B A;  2DA5 A;  3JRA A;  5FJ8 J;  1Z91 A;  1Y8R B;  1Z1D A;  3O3K A;  1WH5 A;  4A0X A;  1BW5 A;  4ZZD A;  4A3I J;  3PO2 J;  4OMZ A;  2CUE A;  2GWR A;  4DYQ A;  2OTJ I;  4EM1 A;  1LDJ A;  1QPM A;  2H6C A;  4FE7 A;  4WXD A;  4A3K J;  1AOY A;  2GLO A;  3I9V 2;  4FHT A;  3ZQL A;  4GCV A;  4EEF G;  4ENM A;  1OCP A;  2X6W A;  5FLX K;  1X3Z B;  5M5W J;  4PJL A;  3DBL B;  3OYA A;  3IRQ A;  4XRS G;  1ZTR A;  5ILS A;  4GGG A;  1N78 A;  1HKQ A;  1ZAR A;  4XLH A;  2VUM J;  3E6M A;  1SEU A;  3RI4 A;  4M3E A;  1R1T A;  2DPD A;  4J00 A;  2VQG A;  3IH4 A;  1IN4 A;  1YFH A;  1VI0 A;  1XDU A;  3VYS B;  3J80 K;  2OUM A;  5JVT A;  3UKG A;  3MQ0 A;  4EV0 A;  1KZH A;  3WTT C;  2DYS H;  1QHH D;  3KLN A;  1YW8 A;  5F1J A;  3I58 A;  2XGX A;  4I0B A;  4N0B A;  2KZG A;  5HLT A;  3TBI A;  1NTC A;  4MQ9 F;  1MDM B;  2JA5 J;  1MIJ A;  3OIO A;  2K9Q A;  2HYJ A;  4AVZ A;  2W25 A;  3BQZ A;  3JTH A;  1WPK A;  1XGM A;  3CC2 I;  1IXC A;  1QZY A;  3BG3 A;  1MJA A;  2UUZ A;  5ERI A;  1MBG A;  4RB3 C;  2Y9Z A;  2LKS A;  2HDD A;  2VKH A;  4YII A;  5J1U A;  2W00 A;  1QHG A;  4A12 A;  1S7O A;  1K6Y A;  3J81 Z;  4BGD A;  2HGC A;  5D8L B;  3JAM Z;  3E6C C;  4L5E A;  2EPF A;  2VIX A;  1MMA A;  3S1R J;  2P81 A;  4B44 A;  4ENK A;  1G3Y A;  4DBQ A;  5HS7 A;  3G71 I;  1ITY A;  1XD7 A;  4NDL A;  3K10 A;  2F5C A;  3S1M J;  1X1B A;  2M9H A;  2B7E A;  4HOB A;  3OYB A;  1VZ0 A;  2DA2 A;  1DGW Y;  2LP0 A;  3ECO A;  3KLO A;  2Y2Z A;  1ZLK A;  2UXX A;  5F27 A;  1WGX A;  5D5V B;  3J7Y J;  2B0L A;  3ZQH A;  2CQK A;  1GV5 A;  3ULQ B;  4FX0 A;  2K40 A;  4MIM A;  4A3E J;  3M8E A;  4LIT A;  5IYC J;  1UCR A;  4I98 B;  4PJN A;  5F04 A;  1J5Y A;  5F0F A;  4NNJ A;  3U9G A;  2DK5 A;  4Y3O A;  2NS0 A;  1XCB A;  1QGP A;  2D1H A;  2R5Z B;  2MD5 A;  1YG2 A;  3FHZ A;  4LGW A;  2EQR A;  2K3F A;  3KP3 A;  4LLN A;  2BOL A;  4UB8 C;  2STW A;  2VE9 A;  3P5J A;  3F8N A;  3OR1 C;  1G3T A;  4KIT B;  3HGY A;  3VSK A;  1SAU A;  1VQP I;  2VOO A;  2K4J A;  2KLO A;  2E5Z A;  1HDP A;  3BZC A;  3D0S A;  2IT0 A;  4BEH A;  1JI8 A;  4XL9 A;  1R4N B;  3OIQ A;  1IJW C;  2XVC A;  4CIC A;  1G6N A;  4IJA A;  4OAZ A;  5CQG A;  2WAF A;  4CYC A;  4Z2Y A;  1FP2 A;  2EK5 A;  3OYM A;  2VJJ A;  4KMU X;  2EJR A;  3IH3 A;  5D6E A;  3ASO H;  3HUG B;  4ZYG A;  4CCK A;  1QVT A;  3HOS A;  5FD5 A;  4IHV A;  5B1A H;  3C7J A;  5C4J J;  2ECB A;  1Y0N A;  2XAG A;  3TO9 A;  2BW3 B;  1B72 A;  1K78 A;  3ZMD A;  4EGZ A;  1AHD P;  3ONQ A;  3HRT A;  2WV0 A;  2O8X A;  1TT5 B;  2EZK A;  2P6S A;  4WX9 A;  1O3Q A;  2E2J J;  2E71 A;  4XOR A;  1ZRF A;  4WK8 F;  2TRT A;  4ITV A;  5E3N A;  2EIN H;  1YS7 A;  3GBG A;  2F5F A;  3BZK A;  2XRO A;  3HSE A;  3RZD J;  6PAX A;  1ZG3 A;  4OIP F;  1T08 B;  5KAF C;  4BJ5 C;  4CUG A;  2LD5 A;  2M87 A;  2XPV A;  4DQ2 A;  5D4R A;  2JJ7 A;  5H2F C;  1E2X A;  1MMD A;  1G8X A;  2G9W A;  2DW4 A;  4DJA A;  4V19 K;  2DLL A;  4AWX B;  3DLA A;  4M3F A;  5EEA A;  1H0M A;  3ZQG A;  1A36 A;  2IGN A;  4QPO A;  1U2W A;  1PP8 F;  1XSV A;  2LLK A;  4B3X A;  2UWM A;  2DMU A;  2PJP A;  3G2B A;  3CD6 I;  3VDX A;  1PDN C;  4XN3 A;  1ZG5 A;  3MN2 A;  3QP6 A;  1TP4 A;  2XAS A;  3K1N A;  4UV9 A;  2VPL A;  5HOO A;  3HG9 A;  2M7B A;  1H9T A;  1MH3 A;  5C44 J;  2O9L A;  1EKE A;  2XSJ C;  4DZP A;  5K7F A;  2R7V A;  5KCM A;  1DP7 P;  2LRE A;  2AXL A;  4CDG A;  2F5V A;  2LH9 A;  5DV5 A;  5BMZ A;  1P6R A;  2X6Y A;  4XSZ F;  4Y13 A;  1VQL I;  4BL0 B;  3WTS C;  1JKR C;  1H89 C;  3S3N A;  2JVH A;  4NHJ A;  1RZ4 A;  3MAJ A;  1LQ1 A;  4HRI A;  4ZDL A;  1FYM A;  3QYE A;  5ICE A;  1A04 A;  3HHG A;  5L3G A;  3BR3 A;  3DF8 A;  3JRI A;  3UR3 C;  2V79 A;  4UY8 I;  5FRM A;  4HPQ A;  4ZDP A;  2KJC A;  4G6D A;  1PUE E;  3FKI J;  1S5L C;  4C9Y A;  1OYY A;  2A6T A;  1R00 A;  4AIJ A;  3HB9 A;  2OQG A;  1VQK I;  5FFZ A;  2OD5 A;  3W2A A;  1TWH J;  1VQ6 I;  5ICC A;  3ERM A;  3K1P A;  4M74 A;  4RLF A;  5B1B H;  4AIH A;  2QCO A;  4HF0 A;  4HX8 A;  5H20 A;  3JCU C;  3SQN A;  4UXN A;  5HDK A;  2R7O A;  4ZYE A;  4DBR A;  1TBX A;  4KN7 X;  1YIO A;  1Z9C A;  3LFU A;  2FML A;  4MO7 A;  2DBB A;  2E35 A;  2Z33 A;  1RKW A;  3KYD B;  2LRD A;  1ON2 A;  4I01 A;  1J9I A;  3BG6 A;  2IA2 A;  2Y9Y A;  3O6B B;  4WCG A;  4M6V A;  2K85 A;  2DFE A;  5F64 A;  3W6V A;  3RPQ A;  4G7Z F;  2CO5 A;  2DT5 A;  1S72 I;  4RLQ A;  4YFK F;  3E0J B;  4Y17 A;  4PZJ A;  2NNN A;  3PUF A;  2RDP A;  1GXQ A;  1GVJ A;  2IGM A;  1FYL A;  1KGS A;  2GA1 A;  5FRO A;  2AQE A;  1GVD A;  1ERD A;  4MTE A;  2V7F A;  3Q0W A;  3F6V A;  3OYC A;  4A2U A;  1TNT A;  4C3I J;  5ICG A;  1XGS A;  4C2T A;  3FBN B;  1FSH A;  2X51 A;  4IRI A;  1JHF A;  4BEH B;  5BPD A;  2Q2E A;  1AU7 A;  5E3L A;  4RA2 A;  4FET A;  1RUN A;  1QA6 A;  4PGG A;  1ZGA A;  3SHF A;  3QP5 A;  5KHD A;  2QSF X;  4KIF A;  1K4T A;  1Z77 A;  4XRF A;  2NS7 A;  3GW2 A;  4UV8 A;  4DIQ A;  3TDU C;  4CYC B;  1UG0 A;  3SJM A;  2JPC A;  2VJI A;  5FFX A;  1ETY A;  2W7N A;  2STT A;  1XSD A;  1HBX G;  3QRF F;  2CS3 A;  3CF2 A;  1KON A;  4LB5 A;  4XOP A;  5FKN A;  4RDU A;  1K78 B;  1JGG A;  1B72 B;  2EZH A;  1IUY A;  5DUK A;  5J8C A;  2MSY A;  1VTN C;  1KU9 A;  2K9L A;  5TRD A;  5F6F A;  4II3 A;  2E1M B;  2Z99 A;  1B6A A;  4HST A;  2PFB A;  4A0Y A;  3V7S A;  3F21 A;  5BQT A;  3E7L A;  3D5L A;  3D1N I;  1ZRD A;  2FBH A;  5L3C A;  5LHI A;  2YPR A;  1J75 A;  3N97 A;  2JA6 J;  1SFK A;  2L01 A;  2ZXH A;  4S0H B;  2E1C A;  2DOF A;  2WA0 A;  1SVM A;  2LFB A;  2CYY A;  2V26 A;  3CCR I;  4FX4 A;  3K1M A;  2Z9O A;  1SAX A;  3LWF A;  4GYI A;  1EH6 A;  1KQ0 A;  4XLE A;  3WGH A;  3H1C A;  3PQJ A;  3BTC A;  1T2K A;  2RNG A;  3IWF A;  3IP4 B;  3I4P A;  2R7X A;  2M1B A;  3RPU D;  4LMY A;  1SMY F;  3MZY A;  2KZV A;  1SD7 A;  3H5N A;  2DDB A;  3E1S A;  3RJP A;  3OIP A;  3F72 A;  5E3O A;  2NVQ J;  2DK8 A;  2L54 A;  1ZGJ A;  4BY1 J;  5EZG A;  1FOY A;  5E8I A;  1TQM A;  2KFD A;  5DCF A;  1HOM A;  2WBM A;  4A3J J;  2OTL I;  2EB7 A;  3QOD A;  2ELK A;  1BIB A;  2EFW A;  4KIS A;  1FEX A;  3DPT A;  2P7C B;  4ZYH A;  1EF4 A;  1I6H J;  1WSU A;  5TIS C;  4BNC A;  2M8G X;  2VL8 A;  2LSO A;  4QPQ A;  5GAD J;  2KP6 A;  4HNT A;  3HSR A;  3LL7 A;  4EGY A;  1RNL A;  1VND A;  2FE3 A;  2KRF A;  3LSJ A;  3WTV C;  3KZI C;  3OYL A;  1U9N A;  1Z21 A;  4LIU A;  3TOB A;  4IPA A;  4DGW B;  2O6G E;  1X1P A;  2NOG A;  3CJT B;  1JXS A;  2V6C A;  3B6A A;  3F9K A;  4MEX F;  1GT0 C;  4CCL A;  2PMH A;  1APL C;  2XGD A;  2DXI A;  1K83 J;  2DT6 A;  2ZNY A;  3WTW C;  3SEQ A;  4Y4R A;  4AU7 A;  1TW2 A;  4KN4 X;  2HDC A;  2QZ8 A;  2XGE A;  2DO7 A;  1YIJ I;  2L3D A;  2JN6 A;  1N75 A;  2L9R A;  4E4H A;  3ZQQ A;  2V1U A;  2IS2 A;  3FK7 A;  3QPS A;  4A0Z A;  1AWC A;  4C3J J;  2KDO A;  4A5N A;  1OCR H;  1I1G A;  4P55 A;  4ENJ A;  5HOD A;  1IRF A;  2OA4 A;  3OL4 A;  5E3M A;  1T0F A;  3Q9S A;  3JTG A;  4LG3 A;  3DEW A;  2Q8K A;  3CCJ I;  4OWR B;  3P7N A;  2R7Q A;  4QLC U;  3H9J A;  1XCV A;  1GDT A;  1FNN A;  4AC0 A;  2EFP A;  4C30 A;  2RGV A;  3AL0 B;  2E1M C;  4GRI A;  4IHY A;  1BI0 A;  3FMQ A;  1TZL A;  4AM3 A;  2EFO A;  3ZMT A;  1QPI A;  2E2I J;  2KIM A;  1QZZ A;  2HS5 A;  4IEJ A;  1MNM C;  3LST A;  1WJE A;  2L0K A;  3C3W A;  4XM3 A;  4IVN A;  3NAR A;  2OU2 A;  1W1W E;  3TW6 A;  1G4D A;  1HQC A;  2AHQ A;  2Y30 A;  3MZ8 A;  1ON1 A;  4E70 A;  1OQY A;  4G7O F;  2AXT C;  5M3M J;  5CVJ A;  1N25 A;  1T33 A;  1VQ9 I;  2CUF A;  3FDY A;  4QIW N;  1R6R A;  2P0W A;  4KYW A;  2Q2E B;  2MA3 A;  3Q0V A;  4CZC A;  1S29 A;  4XRS A;  3BPX A;  2ZO4 A;  5EZH A;  5DS9 A;  2E19 A;  5FKM A;  1F9N A;  4M9S A;  3M8J A;  1O7F A;  2XB5 A;  3HOV J;  3S32 A;  4F91 B;  1F4K A;  1LEA A;  1ZAO A;  2VJ4 A;  4BDY A;  3FXU A;  1U3E M;  2KHM A;  2JSP A;  2QSG X;  1K61 A;  2OC6 A;  3OYK A;  4HBL A;  3LSG A;  4YIF A;  2VBX A;  2FXA A;  3E5X A;  3NRV A;  1W5C C;  5CQE A;  3L2R A;  4IX7 A;  5ED4 A;  4LLL A;  4B47 A;  3CCV I;  5DTD A;  3W2W A;  2GM4 A;  1MBJ A;  2O5R A;  3WHB A;  1LUJ B;  3OYH A;  2PQ8 A;  1VQ7 I;  2ID6 A;  2DA3 A;  3BDD A;  3DTE A;  3KP4 A;  1UHW A;  2CQQ A;  3E5Q A;  4EJO A;  4U0Y A;  3PM1 A;  3R4K A;  4HEA 2;  1RIO H;  4A69 C;  1NH3 A;  1RES A;  2WV1 A;  1Z3X A;  1E0E A;  1P7J A;  2RC4 A;  5J4V A;  2RN7 A;  3CMA I;  5IP7 J;  2LC2 A;  5GTI C;  1FZP B;  3TO7 A;  4BHB A;  1SC7 A;  3KE2 A;  1ZRE A;  2ADU A;  2MYS A;  2VAS A;  4KA4 A;  1GXP A;  3WU0 A;  3G1M A;  1IDZ A;  3S3M A;  3KZY A;  3V8L A;  2K27 A;  4C3H J;  1HW1 A;  3GFI A;  1ONV A;  5D6F A;  1ULY A;  3AG4 H;  3C18 A;  4FT8 A;  2OBP A;  3KET A;  1F36 A;  2M45 A;  3V8J A;  2CGP A;  4B3A A;  1JUS A;  2HOE A;  2HNH A;  3K0L A;  3L09 A;  5L3F A;  4L9N A;  1JHH A;  3F22 A;  1DUX C;  3PL8 A;  2DQR A;  3LMM A;  5E20 A;  3LSR A;  2ZC2 A;  3G6E I;  4EM2 A;  5EG0 A;  2JA8 J;  4F92 B;  3QPL A;  1M1E B;  1QO0 D;  3PSF A;  2IPQ X;  5B5E C;  3GZN B;  3X2Q H;  4CA0 A;  3PFY A;  4HLX A;  3U21 A;  5IP6 A;  1XX5 A;  1BL0 A;  2M8E A;  5IPA A;  2Y69 H;  1ODD A;  1T39 A;  2F4I A;  3AL0 C;  3H92 A;  1YX5 A;  2JRM A;  4PGH A;  1B9M A;  5IT9 K;  3GZ6 A;  3CC4 I;  3DQV C;  1UHM A;  3W6J B;  2M7A A;  2MD0 A;  2BW3 A;  4PSX A;  1ETK A;  2R7R A;  3G4S I;  3LAP A;  3KEQ A;  4PK4 A;  1IZ1 A;  5CVV A;  1RKT A;  3Q3S A;  2GIV A;  2L9N A;  3QOE A;  4IQ4 A;  2LKX A;  3IHU A;  2D5V A;  3KCC A;  1V5F A;  2A61 A;  3JRB A;  4RGU A;  3IRR A;  4I76 A;  4U7B A;  2E36 A;  2L02 A;  1PJR A;  4JX6 A;  1TNS A;  1VQO I;  3HRM A;  2HOS A;  2VKE A;  3KP7 A;  2OF7 A;  3AG2 H;  3ZMV A;  1S9H A;  1XMK A;  3OOP A;  1FMV A;  1LDD A;  1F1Z A;  1TWA J;  5BOX A;  3S15 J;  1YYV A;  1ZN2 A;  1R22 A;  2A6H F;  1HW2 A;  1XTA A;  3GXO A;  3EPZ A;  5FLV A;  4G12 A;  3VSL A;  1X2N A;  4EJV A;  1LVA A;  2EFN A;  2ZJR F;  4XON A;  3BG5 A;  2IVM A;  2DI3 A;  2XF7 A;  3MKZ A;  2ZXW H;  1I3A A;  1MMG A;  4BXU A;  1WKM A;  3K6G A;  3N05 A;  2ZKZ A;  2FUG 2;  2QLZ A;  2QGU A;  1U5T A;  4XMY A;  5J8F A;  1LFP A;  3S3O A;  3GTM J;  2Y75 A;  2W84 A;  1JGS A;  3BG9 A;  4PDK A;  5AIP A;  3DV8 A;  1FC3 A;  1A5J A;  1T8I A;  2H1K A;  2DA1 A;  4OOI A;  2ZME B;  3ZQF A;  4ZYD A;  2MW8 A;  3CES A;  1A6I A;  1L0O C;  2M0C A;  1KU3 A;  1TQI A;  4OIO F;  3ZGK A;  1FPQ A;  2FD5 A;  4HLY A;  3BWG A;  2FOK A;  1D5Y A;  2W4S A;  1MJB A;  2IS4 A;  5L3B A;  1E3O C;  4RM3 A;  2YU3 A;  4MQV A;  2KQR A;  1YRN A;  1ZKG A;  1ETX A;  4BBS J;  2R7F A;  3OYJ A;  4QWQ A;  5JVG F;  2R93 J;  2VI6 A;  4UUT A;  1Y56 A;  1PYV A;  2KIQ A;  1BW6 A;  4LFU A;  3BRO A;  4W97 A;  1LPQ A;  4V2F A;  1ZHF A;  3WOD F;  2IS6 A;  4RAZ A;  3OYG A;  4I2O A;  1R7J A;  2QQB A;  1ACI A;  2HEO A;  3PO3 J;  2PJR A;  2FX0 A;  5J1Y A;  5EF6 A;  3I4N J;  2CMP A;  4F93 B;  1O3R A;  4G6T B;  2DT7 B;  3RCO A;  2DN0 A;  5ILV A;  1MJ9 A;  4HG2 A;  2V4J C;  5EDN A;  3MFK A;  1O3S A;  1FTT A;  2FU4 A;  4RGR A;  1MZB A;  3F8F A;  1DP3 A;  1GUU A;  1T95 A;  2J5P A;  2ME6 A;  4JYK A;  2DCE A;  1ZYR F;  1MBH A;  5E8G A;  4M6X A;  1WRJ A;  3KPH A;  3JRD A;  1TWF J;  2A6E F;  1Z6T A;  2QEX I;  2PX9 A;  3KP2 A;  5EG0 B;  4E7Z A;  4IHX A;  1OKR A;  2L9S A;  1T0F C;  1SFO J;  1LEB A;  1USS A;  2DOA A;  3C2H A;  5F1R A;  5E1W A;  2ETH A;  3BR1 A;  1Z7L A;  3F0C A;  4G7H F;  2BYV E;  4RAF A;  1T56 A;  2NVX J;  3OL3 A;  2I10 A;  3RYP A;  3FXR A;  2IA1 A;  3T0Y A;  2K5C A;  2O7O A;  3RQ4 A;  4BAC A;  4V2G A;  2L7F P;  1WJD A;  4KNY A;  3ABT A;  1BIA A;  3HTU A;  1XB4 A;  4L5I A;  4M71 A;  2O61 A;  3F23 A;  1I50 J;  3F8C A;  4ASN A;  3CF5 F;  4PJ0 C;  2KJB A;  1LDK B;  1IW7 F;  2HXI A;  2C6Y A;  4HW0 A;  1P4X A;  2QQ8 A;  4JX4 A;  5D5W B;  4DNC A;  2XHK A;  3ZP5 A;  2B9S A;  2E1O A;  2AQF A;  1J09 A;  3K4B A;  3HOT A;  4CCJ A;  2JA7 J;  5CKT A;  4BQN A;  4XIC A;  3WE2 A;  5GAH J;  2KKO A;  2TCT A;  1OR7 A;  3M3Y J;  1B8I A;  1DU0 A;  1P4W A;  2IXS A;  1ZLJ A;  3HPH A;  2XAQ A;  3IC7 A;  5FO5 A;  1XDS A;  3R0A A;  2TDX A;  3L2W A;  2PG4 A;  4BE0 A;  2DOE A;  4CCO A;  3M1C A;  2W85 A;  3R6S A;  4UUS A;  3KYC B;  4UUV A;  2HQA A;  4FAS D;  2HVR A;  3MKW B;  3GCM A;  2QEN A;  2DMP A;  3GX4 X;  3DKW A;  2VJ5 A;  4EJT A;  3HRS A;  5BNG A;  2L7Z A;  2WAE A;  5CVU A;  4Y15 A;  2VLA A;  4YIR X;  1RR8 C;  1R9T J;  3H3V K;  1Z3Y A;  3K2A A;  3QOP A;  3VEP A;  3CCE I;  4ANJ A;  3IKT A;  4ZTJ A;  5GAG J;  4E7J A;  3H0G J;  2L7M P;  1U0J A;  5GPC A;  5D5X B;  2QM3 A;  2EIJ H;  4B8X A;  3J81 K;  1U5T B;  5D5U B;  2WB1 A;  2WTE A;  3TKY A;  2GXA A;  1SFU A;  4G94 A;  1LNW A;  2DU9 A;  2A5Y B;  3QPH A;  4HDU A;  1MMS A;  1FY7 A;  2DA7 A;  1I6X A;  2QVO A;  1Y8Q B;  3EET A;  5KAI C;  3ZQ7 A;  1WCM J;  5M3F J;  4YFN F;  3J7Z I;  1Q1H A;  3MKY B;  4HX7 A;  4RAG A;  4D7M A;  1LVK A;  4KT5 C;  2XPU A;  3WG9 A;  2FQ3 A;  2LY2 A;  2BXZ A;  2XF5 A;  1B59 A;  1HA8 A;  4ZJZ A;  1TC3 C;  2DTR A;  4UB6 C;  1HKS A;  2NNY A;  2DQL A;  4TV7 A;  3K4M A;  2LG4 A;  3H35 A;  3M1E A;  5IY5 H;  2EV6 A;  3R0J A;  4M3G A;  1AKH A;  3M8F A;  1YRN B;  3T8R A;  1IXS B;  2L7K A;  3WU1 B;  1X1D A;  1OCO H;  2XAJ A;  1R5I D;  3GWZ A;  2FNP A;  3GFM A;  4HNU A;  3KZZ A;  1FOX A;  3CME I;  1V3F A;  1TW3 A;  3I53 A;  2RAE A;  2V6E A;  2MBF A;  4BHC A;  2K7L A;  3IAM 2;  3RQI A;  1RET A;  3ZMU A;  1G3S A;  2ZXI A;  3FMS A;  1HXD A;  4YEL A;  4ABZ A;  4N4N B;  3ZQC A;  2DMN A;  2H27 A;  4BDZ A;  3SYT A;  1YOV B;  3ZQI A;  2PJR B;  2HFH A;  1J2X A;  2L9V A;  3LSK A;  5LRR A;  4F52 A;  3ASN H;  1EJ9 A;  3LSI A;  2VE8 A;  2FBK A;  1SD5 A;  2F48 A;  2FF4 A;  1V5E A;  3I3L A;  2QKM B;  4EQQ A;  1V4R A;  3WHC A;  1EV7 A;  2I5U A;  2B63 J;  1U6G A;  4Q47 A;  4EVI A;  1T98 A;  3H9Q A;  3LNQ A;  3CJN A;  4IF4 A;  2Y0M A;  3E6D A;  2QA4 I;  3S1Q J;  2R3S A;  5A2Q Z;  3L2V A;  3RPU A;  1JTY A;  5B66 C;  4KDP A;  3K7A J;  2FA5 A;  2Z3Y A;  3BR6 A;  1RPW A;  2HR3 A;  2HOT A;  2CUJ A;  3LFK A;  4NB5 A;  3GO5 A;  1YO5 C;  3BJ6 A;  5DEQ A;  2DFH A;  2GQQ A;  2O0Y A;  3FIS A;  3KYL A;  1UST A;  1BA5 A;  3FKJ A;  1KQ9 A;  3A0H C;  3R60 A;  3MZH A;  3UNG C;  1XC5 A;  1YLF A;  4NBQ A;  2WB1 N;  5ICF A;  2A07 F;  2CFO A;  2JMW A;  1L3L A;  4A3C J;  2DTZ A;  3BPV A;  1W0U A;  1ZQ3 P;  1D1B A;  1JJ6 C;  2ME0 A;  3QWL A;  1X1A A;  2XF6 A;  2D45 A;  1ZG1 A;  3CUQ B;  2EA4 A;  3FXQ A;  2KT0 A;  3DBR B;  1U78 A;  2DJN A;  1BOB A;  1Y1W J;  1WJC A;  4PFP A;  5EJC A;  4BE1 A;  3K4J A;  4XN0 A;  2X1E A;  2M5W A;  2XRN A;  1ORK A;  1U5T C;  4IQJ A;  2R7T A;  2DOD A;  2V9V A;  2XGC A;  3S2D J;  4P96 A;  2JT1 A;  5LGN A;  3OY9 A;  3AFH A;  1YE9 A;  3L2Q A;  3Q5F A;  5J6X A;  4GYG A;  1D8J A;  3RTR A;  4RBO A;  3R61 A;  4ZYA A;  4LLG F;  2IS1 A;  1PP7 U;  2XKO A;  4L18 B;  1FBQ A;  4AID A;  1R4M B;  1B8I B;  3BTL A;  4KFC A;  5LHG A;  4GO1 A;  4ZC3 A;  1SFX A;  2IGO A;  1S8N A;  2EZL A;  2HQR A;  4HF1 A;  3GUD A;  4RGX A;  1IV6 A;  4BXX J;  3T1B A;  1R36 A;  1ZEL A;  3PIP F;  3ABL H;  4UUS B;  3RZO J;  3HPG A;  5IT3 A;  4M3D A;  1ETW A;  4OIN F;  3TGN A;  3J7A Y;  1WVR A;  2MH9 A;  1QNT A;  3IWZ A;  1FMW A;  4YRV A;  4OIQ F;  1FBU A;  2I8D A;  1IN6 A;  2YR2 A;  3A03 A;  2JUC A;  2XAH A;  4LK0 F;  1O4X A;  1X1C A;  2CG4 A;  2JWT A;  1W36 D;  2H8R A;  4D1Q A;  5JHU A;  3L7W A;  2JTV A;  4XOT A;  2VBW A;  5CYV A;  4ZH4 F;  4A93 J;  2OCC H;  2PBI A;  2W57 A;  4G6Q A;  5CPR B;  2HKX A;  2RQP A;  2CUZ A;  4MLO A;  4WWC A;  5H6Q A;  3BOQ A;  5F0H A;  2COM A;  3HOZ J;  1NG7 A;  1UFM A;  4W1U A;  2MAB A;  3ABK H;  3VB2 A;  2QSH X;  3PUB A;  2R7D A;  2X0L A;  4CYD A;  4EAT A;  3DPL C;  2JVG A;  3IKV A;  3OSF A;  3MD2 A;  2M4G A;  3BC8 A;  4XSX F;  1KYZ A;  2BZT A;  2KPM A;  3DU6 A;  1X3U A;  3JSP A;  1S3J A;  1WH7 A;  3K4C A;  4XQF A;  4I99 C;  1S6L A;  2LBF A;  4XID A;  4ESF A;  1D3Y A;  2HXO A;  4BS9 A;  4U87 A;  3GTL J;  3LA2 A;  4C2U A;  4RM2 A;  4XK4 A;  4PJM A;  5GP9 A;  2ZNZ A;  3FBI B;  3LSH A;  2P5L C;  2GOM A;  1AKH B;  3G3Z A;  4I0A A;  4J01 A;  1JUM A;  1U8B A;  2RV8 A;  2FQ4 A;  4A6D A;  1PUF A;  3DBH B;  3GEZ A;  1F5T A;  1YW9 A;  1FOK A;  5L3D A;  3WG7 H;  1R5H A;  1H8A C;  2HI3 A;  3P9C A;  4BYY A;  3DU5 A;  2RNJ A;  1AA7 A;  3SFI A;  5IOZ A;  4Y52 J;  1FBS A;  1IRG A;  4P1W A;  3SZP A;  4A3F J;  1U9O A;  1V5G A;  2KRC A;  3MMY B;  2ECC A;  2LOO A;  3KP5 A;  3Q0U A;  4AIK A;  3BTI A;  2EH3 A;  4PJJ A;  3CLO A;  2HZT A;  3KP6 A;  2GZW A;  4RGS A;  5HVQ C;  2CH0 A;  3CO6 C;  2IW5 A;  3QYF A;  2M30 A;  4N9H A;  3QYB A;  1WFX A;  2K4B A;  3PNV A;  5E17 F;  2BY3 A;  2ZFW A;  4M72 A;  2ZFU A;  3BR2 A;  1EH7 A;  3H36 A;  5IOY A;  1V55 H;  2VXZ A;  2OAZ A;  1WZ2 A;  2ICW G;  2CJJ A;  3HDD A;  2XAF A;  4BBR J;  1MGT A;  2Z1D A;  3REO A;  4E7L A;  5K5Q A;  3K70 D;  3TOA A;  5E79 C;  2L5Q A;  3LAJ A;  1IN8 A;  2M2E A;  1OCZ H;  4F3Q A;  3QPT A;  2VC1 A;  4KIG A;  1LE8 A;  1JJ8 C;  3I59 A;  4L0Z B;  4BJ6 C;  1BI2 A;  3OOU A;  1OR7 C;  1MBF A;  3T8T A;  4IHS A;  5FLX Z;  5EEG A;  2ESH A;  2QQ9 A;  2IGK A;  3CLQ A;  1X3W B;  2F4O B;  1Z67 A;  4OMY A;  3GZ5 A;  1FP1 D;  4HQM A;  4XLC A;  3IV5 A;  3GLL A;  2Z16 A;  3F6O A;  1ETO A;  3HHH A;  1FX7 A;  4NUB A;  2FSW A;  3ML6 A;  2ZME A;  5LEK A;  2F5D A;  5L3E A;  1UEL B;  3LA7 A;  5FLM J;  3S14 J;  3LA3 A;  4AD9 A;  3IUO A;  1A35 A;  2BEO A;  3I55 I;  3SEZ A;  3J80 Z;  2VC0 A;  1GV2 A;  2CW0 F;  2LMD A;  2OPT A;  4EJU A;  3ZRG A;  4BKX A;  3FIW A;  2CWE A;  4WXH A;  4KMF A;  1I1S A;  1EA3 A;  2Z5U A;  2X6X A;  3LSM A;  2LK2 A;  3F8M A;  3DEU A;  1XN7 A;  1O3T A;  4HNV A;  4U7D A;  4GFB A;  2MC3 A;  2JUG A;  3F3X A;  4LIV A;  1H88 C;  4HV5 A;  2LDU A;  3U1D A;  3CO7 C;  3HRU A;  1XPX A;  4DZJ A;  1HLV A;  1S7A A;  2XPW A;  5LEJ A;  3EUH A;  2LR8 A;  5HDN A;  3EDP A;  4E6K G;  3HXL A;  3G73 A;  3OV8 A;  4UVC A;  1DGR M;  2H1L A;  3BJA A;  5DM6 F;  2H6B A;  4HZF A;  2EIK H;  3GTJ J;  4Z6Y A;  2W24 A;  4D7N A;  1UMQ A;  3GVA A;  1X58 A;  2BHZ A;  5LFA A;  1HW5 A;  1YS6 A;  5E18 F;  3VWB A;  4Y7N J;  3I71 A;  2FBI A;  3VYR B;  4HA8 A;  1I5Z A;  4IL6 C;  1IC8 A;  1W0T A;  1UAA A;  2M34 A;  3C1D A;  3GME A;  3N4M A;  3AG1 H;  4HV6 A;  3WGG A;  1GHC A;  1STZ A;  1J59 A;  2DPU A;  3HJE A;  5DD4 A;  3OS1 A;  2CU7 A;  3PFI A;  2HKO A;  4BQQ A;  2XAU A;  5KK1 A;  4MFD A;  4UNO A;  4L9J A;  4YFX F;  3P9K A;  3WTY C;  3E6B A;  5AIQ A;  1OYI A;  1SVO A;  3OR2 C;  4ZZL A;  3KFW X;  3K69 A;  3W6K B;  5D8K B;  2WWY A;  4KIC A;  2NXN B;  2VPR A;  1UB9 A;  3JRF A;  4ETS A;  1KU7 A;  1E17 A;  1WJF A;  2V1N A;  2DA6 A;  3IAS 2;  2A69 F;  1Y1V J;  4LOC A;  1QVU A;  3HL2 A;  1P4A A;  2LBF B;  3W3C A;  2HYF A;  2R5Y B;  2ZJ2 A;  5J4Y A;  1UJ8 A;  2BE5 F;  1P7I A;  3PJR A;  1IO2 A;  3HZJ A;  3HM5 A;  1MSE C;  4EJW A;  1Q1V A;  4HF2 A;  4JP0 A;  4HSR A;  4A5M A;  2NVU B;  4IOC F;  2UV1 A;  2O03 A;  5AON A;  3JR9 A;  1W5S A;  2BY0 A;  1IXR C;  2K3P A;  4IXA A;  1PUF B;  3JRE A;  5TGT A;  3OS0 A;  2JA2 A;  1J7K A;  2VQL A;  1XG1 A;  2HU9 A;  2LF7 A;  2LNB A;  2ZBK A;  5LHH A;  4R1H A;  1XMA A;  3O8H A;  1B9N A;  1WI9 A;  2GAU A;  3E3V A;  1WJB A;  2Y48 A;  1GLN A;  2HDW A;  4JBA A;  1YJ9 I;  3NWT A;  2XRL A;  3CJQ B;  3QQA A;  1A31 A;  2P8T A;  2OV7 A;  2F6C A;  1FIA A;  3MWM A;  5HLI A;  2DJI A;  2NAZ A;  1QZE A;  1XGO A;  2YU9 J;  2ISY A;  1O57 A;  2VKV A;  1LKX A;  2E34 A;  2NOJ B;  4B1R A;  1CGP A;  5E1X A;  1YW7 A;  3K4L A;  3FM3 A;  2QWW A;  1BI1 A;  2WC2 A;  3JSO A;  2QF7 A;  3AKZ A;  2LY1 A;  4H4K C;  2VXD A;  1LE8 B;  3I59 B;  3AAF A;  1Z6R A;  1MND A;  4PSW A;  3GTO J;  1MD0 A;  2H94 A;  3L9F A;  4FTH A;  2ACJ A;  3MVP A;  3L2C A;  3GTQ J;  3J7A O;  4IHW A;  1S7E A;  2X48 A;  3E97 A;  3HOU J;  1NG6 A;  3S93 A;  1W7P A;  3ABU A;  3OYE A;  5CJ9 A;  2LY9 A;  2EV0 A;  5K5O A;  1IG7 A;  4JQF A;  2BXY A;  2YSR A;  5FKO A;  2OCE A;  3SDG A;  4QSH A;  3PQK A;  4OAY A;  1K79 A;  1DDN A;  1R5G A;  3ROU A;  5DM7 F;  3GFJ A;  1OPC A;  3ESW B;  4BAY A;  2LTP A;  3O2P E;  1SD6 A;  3K70 C;  1RR7 A;  5J47 A;  4ESJ A;  4NC8 A;  3BG7 A;  1YHQ I;  5C3E J;  4UVA A;  2R4G A;  4Q4Z F;  2GIZ A;  2D2W A;  3NEU A;  3CJR B;  5BS6 A;  2MLK A;  2PN6 A;  3OYD A;  2HQ5 A;  3GLX A;  3OYN A;  3KX2 A;  1B4A A;  1HCR A;  2O3F A;  2BBY A;  2EV5 A;  5M5Y J;  3ISP A;  3V7C A;  1F43 A;  2YS9 A;  1EH8 A;  3HC7 A;  2WAQ A;  2FNA A;  2QUF A;  1TT0 A;  3DKX A;  5EYR A;  4L5J A;  2G7H A;  4HAM A;  1OMI A;  1P2F A;  4U0W A;  3RKW A;  1J0R A;  4P9F A;  5LBQ A;  4KT6 A;  2P4W A;  2A68 F;  2IA0 A;  4HQE A;  3V7R A;  2BHY A;  4CHU A;  4PUS A;  4K2E A;  2IJL A;  3TP0 A;  3V42 A;  1SVL A;  3IL2 A;  1W4M A;  3NAU A;  4P9U A;  4CSW A;  2VN2 A;  4PFO A;  1I39 A;  1IAW A;  3SZT A;  2NVY J;  3CP8 A;  4C2M J;  2R7U A;  3HGG A;  1K7A A;  1SFE A;  2CV2 A;  2KMU A;  3FX3 A;  4M3B A;  1W7P D;  4UVB A;  3ERE D;  4RB2 C;  1VQ5 I;  3CUO A;  3CCY A;  4I7H A;  3V4G A;  3IH2 A;  2W82 A;  5DD8 A;  2KIS A;  3GFL A;  2R0Q C;  3WE3 A;  1MNE A;  3KEO A;  2IRF G;  2LYC A;  1FWZ A;  5LLQ A;  3CTA A;  1Y39 A;  1LFU P;  3DLL F;  2DAO A;  5FGM A;  4EM0 B;  2VBY A;  3WTX C;  3W2V A;  1B1B A;  4YEJ A;  4QTR A;  4KUM A;  3RKX A;  4B09 A;  1OCT C;  3ELK A;  3ZMS A;  4DW6 A;  3CUQ A;  3KEY A;  2K02 A;  1T6S A;  3H5R A;  2HOA A;  5LGU A;  2XV4 S;  1MMN A;  4A3G J;  3L00 A;  1IF1 A;  3MEX A;  4DYC A;  1KQ8 A;  2VB6 A;  5IYD J;  2RRE A;  1FT9 A;  3OSG A;  5DYM A;  2Y0S A;  2DFI A;  2F5E A;  1BR4 A;  2OQR A;  3CDI A;  4WF2 A;  2UZK A;  4B43 A;  2QQA A;  2N8G A;  1G59 A;  1BI3 A;  2YX7 A;  3RYR A;  1YTY A;  3A01 A;  2ZME C;  3BJO A;  4U0V A;  2OZ6 A;  2ZXJ A;  4BQO A;  2Y31 A;  1D8K A;  3LOC A;  2BVL A;  3GTK J;  5F0C A;  3FWE A;  3OMY A;  1K6O A;  4A6E A;  1RUO A;  3HOW J;  2IP2 A;  3BR0 A;  1O7L A;  5BPI A;  3Q9V A;  4XRM A;  4LB6 B;  3HOX J;  5F08 A;  2VKD A;  2JK3 A;  4CCM A;  4ESB A;  2WAQ N;  4OIR F;  2EBI A;  2ZB9 A;  2FEZ A;  2KL4 A;  2EA2 A;  4NC7 A;  4HYE A;  3VYT B;  1YJN I;  3I4M J;  2MG4 A;  2VON A;  1KU2 A;  4N4O B;  1R1V A;  4CO8 A;  2K86 A;  3BR5 A;  3JRC A;  4IZZ A;  1FYK A;  2A5W A;  3CMM A;  1VFC A;  2COB A;  1I3Q J;  3CC7 I;  3EUH C;  3A2K A;  2V9K A;  3K4N A;  3I64 A;  2X6O A;  2P5V A;  1ZK8 A;  1ZRC A;  1P9Q C;  3QU6 A;  2GXB A;  2KRH A;  1BC8 C;  1NHA A;  1TTY A;  3A0B C;  1G2H A;  3C2B A;  3FXJ A;  3DWL E;  4XLN F;  3RSN A;  4I09 A;  3ZN0 A;  4FE4 A;  4A3D J;  1V54 H;  2H8W A;  3JAM K;  3V8K A;  1W7P B;  1LJ9 A;  4CZZ A;  3A1Y A;  3FXL A;  2CRG A;  5JLW A;  1RRJ A;  1LFB A;  4BY7 J;  4AYB A;  3WGI A;  1OIS A;  5DCM A;  3VPR A;  3M4O J;  2Z2S B;  2GXG A;  4RAY A;  3CMY A;  1OJL A;  1R58 A;  3TED A;  1D5V A;  2ELJ A;  4M73 A;  3EQL F;  2MFZ A;  1FSE A;  2OJE D;  2R92 J;  4HDV A;  2GA2 A;  1JE8 A;  1TWC J;  1VQM I;  3MCZ A;  4XBF A;  2MC4 A;  1W5T A;  1X4P A;  4OU0 A;  2IEK A;  3M07 A;  1ZR2 A;  3S17 J;  3S1N J;  1Y0U A;  4M9X A;  3K4K A;  3JW4 A;  3L1P A;  2HYG D;  2P5K A;  2Y0S N;  1E3H A;  4L0Y B;  2PI0 A;  2ESN A;  1MKM A;  4E7I A;  2HVQ A;  2O8K A;  1D1C A;  1RC9 A;  1FJL A;  4R8H A;  5HDG A;  2VQC A;  5J1R A;  1ETV A;  1YQA A;  2HTJ A;  4F7Z A;  1X2M A;  4D9J A;  5LRS A;  2JRT A;  2VQH A;  2JSC A;  1PVE A;  4G9Y A;  4LG0 A;  5EGO A;  2LKP A;  2J5O A;  3ZN1 A;  3DTK A;  2HPM A;  2X4H A;  3HSF A;  5M5X J;  4KIB A;  1WQ2 A;  5K1Y A;  1R49 A;  3ZR8 X;  3PNY A;  1TL8 A;  1LB2 A;  5JHF A;  2E7X A;  2JPB A;  2HPI A;  2R7Z J;  1SMT A;  3G1O A;  1TWG J;  3G1L A;  5FKK A;  4ON0 A;  2W48 A;  3KIO A;  2DMQ A;  3H0D A;  3TL4 X;  4RB1 A;  3AG3 H;  4FIS A;  3BT9 A;  4NQW A;  5GPA A;  2X85 A;  1JT0 A;  4GDF A;  4EMS A;  1DQU A;  4CH7 A;  2LF8 A;  3HIF A;  2W1O A;  2XIG A;  2QYO A;  2WAD A;  1TLH B;  1SD4 A;  1I27 A;  2G0E A;  4KJZ A;  4LD5 A;  4AUX A;  1R23 A;  5FB2 A;  2FMY A;  2CSO A;  3DCF A;  2V1X A;  3O8G A;  1CF7 A;  2VOP A;  2YX4 A;  2L2O A;  2K9N A;  3U2R A;  2E2H J;  4J19 A;  3BZ6 A;  1Y6I A;  1FIP A;  1IRZ A;  2XSD C;  2ISZ A;  3DPU A;  3HKZ A;  2VBZ A;  4AYB N;  1DPU A;  2F4M B;  1G3W A;  3BCB A;  1BJZ A;  4MFE A;  4CGZ A;  4Q48 A;  3FXO A;  2GOX B;  5JLX A;  4CCN A;  3DKY A;  1DPR A;  1R1U A;  2QKL B;  3JRG A;  2MGQ A;  3BP8 A;  1CQT A;  4JOM A;  1JKP C;  1QBJ A;  5FKL A;  2HTS A;  3A01 B;  3ABM H;  1UZC A;  2R7W A;  3CCS I;  1DU6 A;  5HNH A;  2PEX A;  3S8P A;  2PMZ A;  1A6Q A;  3HTS B;  3K2Z A;  5JI6 A;  1FTZ A;  2E60 A;  2RVC A;  3GTP J;  2M3A A;  1RI7 A;  3QU3 A;  4BQA A;  4FQG A;  1FOW A;  1NK2 P;  2EWN A;  4WXC A;  5JR3 A;  2CV0 A;  1U8R A;  5IYB J;  4B48 A;  4G8X A;  1QQI A;  2LVS A;  5K7Z A;  4B4C A;  1ZGW A;  2BY1 A;  2A05 A;  1SAN A;  2EFQ A;  1IGN A;  2V1D A;  2ELH A;  2BV6 A;  4D0P A;  2BY2 A;  3L2U A;  4A3L J;  2AO9 A;  1XGN A;  2VOD A;  3E5U A;  3RKQ A;  3PSI A;  1JKQ C;  3H3Z A;  2HZD A;  3D5R C;  4Y33 A;  5ILU A;  3CCM I;  4H0E A;  2L4M A;  5KVR A;  1OLT A;  5J3L A;  1UHS A;  3BLY A;  3DEE A;  4RMN A;  1Z05 A;  5K7H A;  3B6C A;  5CVI A;  1ZR4 A;  2D1V A;  1OYW A;  3BQY A;  5HS9 A;  3GYH X;  5DCM B;  2XUB A;  3WU2 C;  4IKF A;  2F2E A;  2R5Y A;  3NQO A;  3D5S C;  5FRN A;  3RKY A;  1HF0 A;  1BR2 A;  5GAE J;  2E1N A;  4MHG A;  1JUP A;  2KIU A;  5KNL A;  5DUI A;  2MLG A;  3FM5 A;  2CV1 A;  4X6A J;  1VQ4 I;  4X1E A;  3ZXS A;  3FHN A;  1XSX A;  3BY6 A;  4FCY A;  1Z7U A;  3H3U A;  3CCL I;  3HKZ N;  3TQN A;  3HYI A;  1X4O A;  2DMT A;  2FOW A;  2XDV A;  1YIT I;  3HEF A;  3LSP A;  2ZJQ F;  2PMU A;  2H09 A;  1FLI A;  1MSF C;  1ETQ A;  3FK6 A;  3I54 A;  2DYR H;  1NK3 P;  4XLP F;  1JT6 A;  3M7G A;  2QBY A;  1H9G A;  1HC8 A;  2IAI A;  3QAH A;  4II2 A;  3EYY A;  1WJA A;  1D0X A;  4HX4 A;  1BC7 C;  3FMR A;  2EIL H;  3S16 J;  4N9I A;  4ZDO A;  4D5C A;  3EUA A;  4DYR A;  2A3S A;  3VOE A;  2DA4 A;  3CUQ C;  3TW7 A;  1HDD C;  3HBL A;  2RQQ A;  2P7V B;  2PMZ N;  5IT9 Z;  2YUS A;  3FXK A;  3GF2 A;  4YG2 F;  1UG2 A;  4IRH A;  3S2W A;  1OFC X;  5EGO B;  3C2G A;  1YJW I;  3CZ6 A;  5A2Q K;  1T38 A;  4LG0 B;  2JZY A;  5J40 A;  3SZG A;  3ZPL A;  4O6J A;  1K4S A;  1VF9 A; 
#chains in the Genus database with same CATH homology
 2IGM A;  2K9M A;  3RQ4 A;  4BAC A;  4F55 A;  5FRO A;  2AQE A;  1ERD A;  1WJB A;  1WJD A;  1GLN A;  2HDW A;  2V7F A;  3NWT A;  3OYC A;  3CJQ B;  4C2T A;  2OV7 A;  3FBN B;  2F6C A;  2X51 A;  4NQW B;  4BEH B;  3ZCO A;  2DJI A;  1LDK B;  4BJT A;  4FET A;  3A4C A;  1LKX A;  5KHD A;  1YX3 A;  2NOJ B;  2AQF A;  1J09 A;  3K4B A;  4DIQ A;  3HOT A;  1IRX A;  1UG0 A;  2E5N A;  3H5A A;  3K4L A;  4CCJ A;  4E7K A;  2VJI A;  5CKT A;  4BQN A;  3OYF A;  1D0Y A;  3AKZ A;  2W7N A;  2LY1 A;  4H4K C;  5HNF A;  2VXD A;  4PSW A;  1MND A;  2BVM A;  2CS3 A;  3CF2 A;  1KON A;  2M4K A;  3H9G A;  2IXS A;  4XOP A;  4XLA A;  3HPH A;  2X1D A;  4XLF A;  3L2W A;  4BE0 A;  4CCO A;  3M1C A;  2K9L A;  4II3 A;  4XKC A;  2HQA A;  1D1A A;  1NG6 A;  2CW8 A;  3S93 A;  2M0M A;  4FAS D;  2E1M B;  4XKV A;  3OYE A;  4HST A;  3MKW B;  2HVR A;  2HVS A;  1X19 A;  4ZTF A;  2VJ5 A;  1N77 A;  4JQF A;  2WAE A;  2CW7 A;  2VLA A;  3D5L A;  4BUP A;  4OAY A;  2WY8 Q;  1Z3Y A;  3SDB A;  1SFK A;  4ANJ A;  3K70 C;  2ZXH A;  2ZSI B;  4ZTJ A;  4E7J A;  2WA0 A;  1U0J A;  4XNF A;  1QU3 A;  2V26 A;  2ZSH B;  4NC8 A;  2WB1 A;  4XLE A;  3BG7 A;  2WY7 Q;  2R4G A;  3OWT A;  2RNG A;  3IP4 B;  2R7X A;  3CJR B;  3RPU D;  3DTI A;  3OYD A;  3OYN A;  3MKY B;  2KZV A;  3KX2 A;  4BE2 A;  3H5N A;  1LVK A;  3E1S A;  2LY2 A;  3OIP A;  2XF5 A;  5LD2 C;  1HA8 A;  4ZJZ A;  3HC7 A;  3VYU B;  4P5O A;  4XKW A;  2WAQ A;  3K4M A;  2LG4 A;  3H35 A;  1TT0 A;  2WBM A;  2R7S A;  3DKX A;  3QOD A;  4R79 A;  3NWS A;  4KIS A;  1D0Z A;  3DPT A;  2XC7 A;  2L7K A;  4KT6 A;  1X1D A;  3TMO A;  2VL8 A;  2Q1Z B;  4QPQ A;  4PUS A;  2KP6 A;  4HNT A;  4E7H A;  3PNT A;  3LL7 A;  4HNU A;  3V42 A;  3OS2 A;  1WJ5 A;  3OYL A;  4E7S A;  3OYI A;  1Z21 A;  4LIU A;  2V6E A;  4DGW B;  4XR6 A;  4CSW A;  3IAM 2;  4PFO A;  3CP8 A;  2R7U A;  3F9K A;  3BCA A;  2ZXI A;  4DOZ A;  4YEL A;  2CV2 A;  2KMU A;  4N4N B;  4BDZ A;  3SYT A;  2PJR B;  3EUK L;  4CCL A;  3LSK A;  2DXI A;  2DT6 A;  3SEQ A;  1W36 C;  4F52 A;  3LSI A;  1BR1 A;  2W82 A;  4Y4R A;  4AU7 A;  1V5E A;  3I3L A;  4BU2 A;  1MNE A;  2QKM B;  4BXF A;  4X0G A;  2LYC A;  1MW7 A;  1N75 A;  4E4H A;  3ZQQ A;  2IS2 A;  3H9Q A;  2X1C A;  2KDO A;  3W2V A;  4YEJ A;  3L2V A;  4XKB A;  3CP2 A;  3OL4 A;  3KEY A;  2CUJ A;  3H5R A;  4LG3 A;  4OWR B;  1MMN A;  2R7Q A;  3KYL A;  3H9J A;  2VB6 A;  3FKJ A;  2RRE A;  2Y0S A;  3UNG C;  4C30 A;  3AL0 B;  3I9V 2;  1BR4 A;  2E1M C;  4GRI A;  4B43 A;  2CFO A;  1TZL A;  1G59 A;  2X6W A;  1WJE A;  1D1B A;  4XM3 A;  4PJL A;  4BQO A;  1X1A A;  3OYA A;  2BVL A;  2XF6 A;  3OMY A;  1N78 A;  1BOB A;  4XLH A;  1WJC A;  4PFP A;  4BE1 A;  3FDY A;  3K4J A;  1R6R A;  2P0W A;  2X1E A;  2Q2E B;  4XN0 A;  2VKD A;  4J00 A;  4IQJ A;  2R7T A;  2VQG A;  4CCM A;  4CZC A;  2KL4 A;  3OY9 A;  3AFH A;  3VYS B;  2OUM A;  4NC7 A;  1YE9 A;  3M8J A;  3VYT B;  3L2Q A;  3S32 A;  4F91 B;  2VJ4 A;  1QHH D;  3RTR A;  4BDY A;  4N4O B;  4ZYA A;  2IS1 A;  2KHM A;  2JSP A;  4IZZ A;  5HLT A;  2A5W A;  3TBI A;  2OC6 A;  3CMM A;  3OYK A;  3LSG A;  3A2K A;  3EUH C;  4ZC3 A;  2V9K A;  4AVZ A;  2IGO A;  3K4N A;  1P9Q C;  2KRH A;  5CQE A;  3L2R A;  4IX7 A;  4B47 A;  1ZEL A;  3W2W A;  3DWL E;  3RSN A;  2O5R A;  2UUZ A;  3HPG A;  3OYH A;  3J7A Y;  2VKH A;  4YRV A;  1FMW A;  2W00 A;  1QHG A;  1K6Y A;  3DTE A;  2I8D A;  3A1Y A;  4BGD A;  4HEA 2;  4AYB A;  1X1C A;  1W36 D;  1Z3X A;  4D1Q A;  1E0E A;  4XOT A;  2VIX A;  2Z2S B;  2LC2 A;  1MMA A;  2ELJ A;  5CPR B;  4B44 A;  2MFZ A;  2CUZ A;  4MLO A;  4DBQ A;  3K10 A;  1NG7 A;  2MYS A;  2VAS A;  2MAB A;  3S3M A;  1X1B A;  2MC4 A;  1X4P A;  3PUB A;  3OYB A;  4EAT A;  1VZ0 A;  1DGW Y;  3DPL C;  2JVG A;  3K4K A;  3MD2 A;  2M4G A;  3BC8 A;  2KPM A;  3DU6 A;  2HNH A;  3K4C A;  4XQF A;  2LBF A;  3PL8 A;  3LMM A;  4E7I A;  4BS9 A;  2HVQ A;  4U87 A;  1D1C A;  4LIT A;  4C2U A;  4RM2 A;  4PJM A;  4F92 B;  4PJN A;  3PSF A;  4NNJ A;  3FBI B;  3LSH A;  2VQC A;  2GOM A;  4CA0 A;  3PFY A;  4D9J A;  3U21 A;  2VQH A;  4J01 A;  4Y3O A;  3DTK A;  2HPM A;  2F4I A;  3DU5 A;  1AA7 A;  3AL0 C;  3ZR8 X;  3PNY A;  4P1W A;  5JHF A;  2HPI A;  1YX5 A;  1V5G A;  2KRC A;  3MMY B;  2BOL A;  2LOO A;  4PJJ A;  3OR1 C;  3DQV C;  4KIT B;  5HVQ C;  2CH0 A;  1SAU A;  2M7A A;  3VSK A;  2MD0 A;  3QYF A;  2KLO A;  2BW3 A;  4PSX A;  3TL4 X;  2E5Z A;  1WFX A;  3QYB A;  3H0D A;  2R7R A;  3PNV A;  2X85 A;  4PK4 A;  4BEH A;  1DQU A;  2ZFU A;  4XL9 A;  4CH7 A;  1JI8 A;  2L9N A;  2VXZ A;  2W1O A;  3OIQ A;  3QOE A;  4IQ4 A;  2WAD A;  1V5F A;  2Z1D A;  4E7L A;  3K70 D;  4OAZ A;  4KJZ A;  5CQG A;  2WAF A;  4U7B A;  2L5Q A;  3OYM A;  4F3Q A;  1PJR A;  2VJJ A;  3HUG B;  4CCK A;  2L2O A;  3HOS A;  1Y6I A;  4BJ6 C;  3OOU A;  1OR7 C;  1S9H A;  1FMV A;  2BW3 B;  3DPU A;  3HKZ A;  3ONQ A;  3BCB A;  2IGK A;  4XOR A;  3EPZ A;  4XLC A;  4ITV A;  3VSL A;  2Z16 A;  2GOX B;  3GBG A;  4CCN A;  3DKY A;  4NUB A;  4XON A;  2QKL B;  1UEL B;  2XF7 A;  4JOM A;  4BJ5 C;  4CUG A;  3MKZ A;  3IUO A;  2R7W A;  1MMG A;  5HNH A;  3SEZ A;  3S8P A;  2PMZ A;  1MMD A;  1G8X A;  3ZRG A;  3K6G A;  3N05 A;  2FUG 2;  1EA3 A;  4DJA A;  2E60 A;  2X6X A;  3LSM A;  2M3A A;  4XMY A;  1LFP A;  3S3O A;  3DLA A;  2CV0 A;  2JUG A;  2IGN A;  4B48 A;  4LIV A;  4QPO A;  4B3X A;  2UWM A;  3G2B A;  3VDX A;  3CES A;  4XN3 A;  3ZGK A;  4E6K G;  2VPL A;  5HOO A;  3HXL A;  3L2U A;  3HG9 A;  2M7B A;  2W4S A;  1DGR M;  2IS4 A;  2XSJ C;  4RM3 A;  2R7V A;  2KQR A;  5KCM A;  2LRE A;  3PSI A;  2F5V A;  2HZD A;  2LH9 A;  2X6Y A;  3D5R C;  4Y33 A;  5LFA A;  3OYJ A;  3VWB A;  4BL0 B;  3S3N A;  1OLT A;  2JVH A;  1Y56 A;  1PYV A;  3BLY A;  3DEE A;  4RMN A;  4ZDL A;  3VYR B;  4HRI A;  3QYE A;  2IS6 A;  3UR3 C;  1UAA A;  3OYG A;  4IKF A;  5FRM A;  4HPQ A;  4ZDP A;  4C9Y A;  3D5S C;  5FRN A;  2A6T A;  2PJR A;  1BR2 A;  3OS1 A;  5KNL A;  4BQQ A;  3W2A A;  2CMP A;  2CV1 A;  2XAU A;  4F93 B;  4RLF A;  3ZXS A;  3FHN A;  4G6T B;  2DT7 B;  3RCO A;  3OR2 C;  4HG2 A;  1X4O A;  2XDV A;  2V4J C;  2R7O A;  1WJF A;  2V1N A;  1DP3 A;  3IAS 2;  1T95 A;  4DBR A;  3HL2 A;  3LFU A;  2DCE A;  3W3C A;  2LBF B;  4II2 A;  1WJA A;  1D0X A;  3PJR A;  4ZDO A;  2LRD A;  3EUA A;  4E7Z A;  3BG6 A;  2L9S A;  1T0F C;  4HSR A;  2RQQ A;  2DOA A;  3C2H A;  2UV1 A;  2K3P A;  3C2G A;  3CZ6 A;  1Z7L A;  5TGT A;  3OS0 A;  4RLQ A;  2JA2 A;  3OL3 A;  3SZG A;  2VQL A;  3E0J B;  2HU9 A;  2K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...