1E17A

Solution structure of the dna binding domain of the human forkhead transcription factor afx (foxo4)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding domain
molecule keywords AFX
publication title 1H, 13C and 15N Resonance Assignments of the DNA Binding Domain of the Human Forkhead Transcription Factor Afx
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2000-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1e17A00
3BJOA 3QRFF 4P9FA 3CUQC 4KIGA 2PI0A 4GYGA 1Q1HA 3J81Z 3HTSB 2ISYA 2L3DA 3HSEA 3FX3A 1XSVA 1MDMA 3C3WA 4OU0A 5E20A 2W85A 3DP7A 2L4AA 4IJAA 2CW0F 1T0FA 1LEAA 4CHUA 3E6CC 1A04A 1XGOA 1ZRFA 4MEYF 3H3ZA 4PCQA 1BI1A 1QBJA 4HZFA 4Y17A 4U7BA 4PGHA 1E2XA 2W24A 4ENMA 1KU3A 4IF4A 1ON2A 4N9HA 2IW5A 1V4RA 3GX4X 1R7JA 2PBIA 3KEQA 4LLLA 1Z7UA 2DQRA 2G7UA 1ZHFA 5D6EA 2P8TA 2XUBA 4KICA 4ETSA 1IXRC 1FNNA 3ABUA 4RGXA 3EDPA 1IN4A 1TQPA 4KT5C 3GZ5A 4M9XA 2CGPA 1G3SA 4JK1X 2XROA 3ULQB 3K2ZA 5TRDA 3K69A 1G3TA 3FXQA 4LLNA 2DQLA 1ONVA 4CZZA 4LGWA 4P96A 3SQNA 5CVIA 1XSDA 2UWMA 2XGXA 3CO7C 5CLSA 1W7PB 3MCZA 4IPAA 1ZGJA 1T38A 5JHUA 3IWZA 2FSWA 5J8FA 1RNLA 1USTA 4RS8A 2D1VA 3K1NA 4EGZA 1NHAA 3KZYA 4U0YA 1EV7A 4KN4X 5HDKA 1REPC 3KP5A 3COAC 4U0WA 3BJAA 3LAJA 5FFZA 1O3TA 2B0LA 1R5GA 1T6SA 4A5MA 3R6SA 4EJWA 2EFQA 4EM1A 3KETA 1ZREA 1B6AA 5L3DA 2O61A 2FNPA 3G3ZA 3MZHA 2EWNA 3RPUA 2PEXA 2IP2A 1I5ZA 5DV5A 3I59B 2DPDA 2FBKA 2J5OA 1ZG1A 5ICCA 1XDSA 1O3QA 1W7PD 1XMKA 3HRSA 5AONA 3F8FA 5ILVA 4WF2A 1OPCA 4BXUA 4M71A 3LSTA 3HRMA 2GA1A 1TLHB 2A07F 4I2OA 3ZQ7A 2P7CB 2KRFA 1QQIA 2XASA 3FM5A 3RYRA 2BE5F 4ENNA 4HF2A 4ZH4F 1TNTA 2ZCWA 2V6CA 4LFUA 1PP8F 2H6CA 2ZKZA 3IC7A 2HWVA 1F1ZA 4BYYA 3CLOA 2GWRA 4LB5A 1BI0A 4KIFA 2QBYB 5AIPA 3TO9A 1LDKB 2ZNZA 3ABTA 4I0BA 1SD5A 3ZMUA 5FGMA 2BEOA 3R60A 2EFPA 3WTSC 2FNAA 2KIMA 4B09A 1FBUA 1K6OA 1WI9A 2HQRA 3GFIA 1QPMA 2CFXA 2FMYA 5FO5A 4HF1A 1XDUA 1DDNA 3O6BB 1O7FA 2IVMA 2D1HA 3L9FA 4M6YA 3S2WA 4HF0A 1R22A 2W57A 3M1EA 3CUQB 2PMUA 1T98A 2QVOA 4MQVA 3WU0A 4Y15A 4CDGA 4A12A 2M45A 2Q2EA 3ZMTA 1J0RA 3CDHA 2M8EA 3EUHA 2QQAA 2IA0A 1R1UA 1BC8C 3K1PA 3QU3A 1ULYA 2V79A 3QPTA 4XSXF 2XRNA 2IRFG 4IHSA 4NQWA 1IRGA 5HS8A 2FXAA 5LEJA 1B4AA 2JT1A 3IWFA 3F8BA 4HBLA 2X0LA 1OKRA 2ISZA 3HRTA 5LHHA 2RGVA 3KEOA 3FMQA 2YU3A 5F1RA 2EFWA 1I27A 3E5UA 1HBXG 4IHTA 4XLNF 4HA8A 5K5QA 3IL2A 5DDGA 3FF5A 1FPQA 4JQFA 1J59A 2FEZA 3KZZA 4LJZF 3IRQA 2XIGA 5JI6A 1QZYA 1H9TA 2LKPA 3TOAA 3RI4A 2F2EA 5BMZA 4LK0F 3GYHX 4UVBA 3D5LA 4G6QA 5L3EA 1PP7U 3L7WA 2HTJA 3WTWC 2D2WA 5KVRA 2A6HF 2DT5A 4M9SA 2XAQA 2EA4A 4OIOF 1XMAA 3GFMA 3SZTA 2GAUA 4RAZA 4N9IA 2XV4S 1U6GA 1DUXC 1QZZA 5F64A 4Z2YA 3Q5FA 3HOTA 1Z6TA 2XAGA 2PN6A 3RJPA 3VFZA 2VOOA 1TQMA 4HYEA 2HKOA 3EYIA 1MJBA 4DNCA 1OYWA 3F8CA 5K1YA 5LBQA 4MTDA 1YYVA 4E70A 1J75A 4KIBA 4EM0B 3LQQA 2KJCA 2PMHA 2FBHA 4OINF 3HTUA 3RIRA 2E1NA 5ED4A 3Q9VA 3J80K 3OOPA 1ZG3A 2EFNA 3HSRA 4EVIA 2MLGA 5D8LB 4Q47A 5H20A 3WTVC 2L54A 1X3UA 2M1BA 4YG2F 2CYYA 3DFGA 1F9NA 1YLFA 1R58A 5BQTA 4GXOA 1SFEA 2ETHA 3GW2A 3PFIA 5ILUA 3ISPA 2Z5UA 2RC4A 3MAJA 4AIKA 2AXLA 4GCVA 3RKYA 1EH8A 4WK8F 3KCCA 4UUVA 4L0ZB 1R1TA 4R1HA 1ZRCA 5E8IA 2H27A 5DCFA 4HQMA 3E6MA 4L5JA 5E1XA 2VC1A 5FD5A 3J80Z 1DPRA 3CJNA 4YIFA 4XLPF 4KDPA 5FLXK 3C18A 4MEXF 2H09A 4U88A 1LNWA 4M9ZA 4GYIA 3D0SA 1FSHA 3U1DA 2HS5A 1G6NA 1XD7A 1P4XA 1FBQA 3QU6A 2DI3A 3WTXC 4RB0A 2V9VA 4UNOA 2RNJA 2YR2A 2HGCA 4HLYA 4P9UA 1F5TA 1BN5A 2UXNA 1O7LA 3ML6A 1YO5C 5H6QA 3WGIA 3EQLF 3F8MA 5FLXZ 2L02A 2EA2A 3JSPA 3WTTC 2DK5A 1S29A 4HX8A 3I54A 2XAJA 4ESFA 4FX0A 1XGSA 3FZVA 2ZJ2A 2IJLA 5J6XA 2RN7A 2Y48A 4PZJA 2CQKA 3R61A 1YW8A 2GIVA 4GO1A 3DV8A 1RZ4A 2JRTA 1B9NA 4KA4A 4LG0A 4I01A 1D8KA 3R4KA 5LGTA 3ZMDA 3TOBA 2HYFA 3N97A 3ROUA 4UVAA 1FX7A 2VBYA 1IN5A 3DQVC 2IA2A 2EJRA 5ERIA 2MA3A 2QQBA 5DD8A 1D8JA 1O57A 5IT3A 5LHIA 2G7HA 2PG4A 3JTHA 2OZUA 1W5TA 1FP1D 1RUNA 3DEUA 3BPXA 4GGGA 2GQQA 3RKXA 3SHFA 2P5KA 4BQAA 3C7JA 3PQJA 1YG2A 3ECHA 5AIQA 1DP7P 3K0LA 3FMRA 3R0AA 5CVUA 2X4HA 3ZP5A 2H6BA 1UHWA 4M73A 1Y0UA 2A6EF 1P92A 4RAYA 4WWCA 2E1CA 3K9TA 4HX7A 4RGSA 5D5XB 4KN7X 1XGNA 1LB2A 1KQ0A 1LVAA 3QOPA 1D5VA 1B1BA 2GXGA 1FY7A 3ELKA 3DF8A 3F72A 2G9WA 3WG9A 2VBWA 5JVTA 3RTRA 5LGNA 1SFXA 3BJ6A 1KU2A 3TO6A 3LFKA 2HKXA 2O8XA 1ZAOA 1HW1A 1YW7A 4EQQA 4M74A 1LQ1A 1Z9CA 3O3KA 1S3JA 1IUYA 3V8LA 1P6RA 2VE8A 4G8XA 2PFBA 3HIFA 4UXNA 2O03A 5JFRA 1JHHA 3JW4A 2BYVE 2KIUA 1U8RA 1AWCA 3P7NA 2CO5A 3WTUC 4ENKA 4EV0A 4YIIA 3GO5A 3E5QA 1HW2A 1T2KA 2HYGD 5TJJA 3V7CA 2ZMEA 1FT9A 1YFHA 2NAZA 5K5OA 2P4WA 4ZZDA 1CF7A 1MKMA 3Q9SA 1XGMA 1K7AA 4IRGA 3O2PE 1AOYA 4L9JA 4L9TA 5EEGA 2RDPA 4S05A 1P4WA 2PQ8A 1BI2A 3KLNA 1WQ2A 4H0EA 2NNNA 1O3RA 4EJOA 2FBIA 2XAHA 4BHPA 1BIBA 3TGNA 4ASNA 3K1MA 2O0YA 1SD6A 2BGCA 2RQPA 4NHJA 3QP5A 3QPHA 2MC3A 3FMSA 4HV5A 1IXCA 2EV5A 3TKYA 3F6OA 3WTYC 2MH9A 1EH7A 4I7HA 5LRRA 1MD0A 4JBAA 4F7ZA 1YW9A 4DQ2A 1K78A 3ZN1A 3HRUA 2K4JA 2M5WA 1S8NA 2P6TA 1MDMB 3CTAA 3ZN0A 1Z1DA 3BP8A 4HLXA 1ZH5A 1HKTA 4P55A 1KU7A 4FT8A 2DFIA 2TDXA 2ZFWA 2WV0A 4L9VA 1J7KA 2LNBA 2MD5A 2ZXJA 4Q4ZF 2DTRA 1T39A 1IZ1A 4HDUA 4CO8A 4LG0B 2HFHA 1QNTA 3V8JA 2M30A 5HOOA 3OV8A 2FE3A 4OOIA 1IN8A 2WC2A 2H94A 3NRVA 4O6JA 2E7WA 4UV8A 3ERED 2ZNYA 3FXUA 4ZYHA 4U0VA 4I0AA 5IT9K 2YPRA 1GHCA 4LD5A 2RKHA 3KP6A 1R5HA 3MWMA 5ICFA 4XSZF 1LJ9A 2OBPA 2QLZA 2VONA 5L3FA 3GWZA 4ON0A 3LA3A 4G7OF 4YFXF 2Q8KA 4AVPA 2J5PA 5HLGA 2LDUA 3B02A 2EFOA 3GVAA 2VOPA 3HYIA 2K4BA 2W84A 2RVCA 2LF8A 3WTZA 5DUKA 2BBYA 3HSFA 3M8FA 4AIJA 1P2FA 1U2WA 3GEZA 3REOA 1BOAA 1B59A 5IT9Z 4KYWA 2O3FA 4G7ZF 1J2XA 2MLKA 1IN7A 2KKOA 1U3EM 3H3UA 4WXDA 4CICA 4NB5A 1L0OC 5LRSA 1GXQA 2JZYA 1USSA 1H9GA 2Q0OA 3HHHA 3E6BA 2D45A 3WE2A 2QZ8A 5A2QK 3G73A 5E1ZB 4IRIA 3N4MA 1QO0D 2VT3A 1HXDA 3CO6C 2UZKA 3DXJF 4MGRA 2DPUA 4P5OA 1ON1A 4BHCA 2HR3A 3F23A 3J7AO 1UHMA 2DU9A 2AS5F 2OA4A 1G3YA 3P9IA 2QM3A 4WXCA 2P5VA 3ZMZA 3U9GA 4G6DA 1KQ9A 5BS6A 2ZBKA 1XB4A 3NQOA 1JHFA 4UHTA 4HX4A 3I4PA 1HSJA 2ZMEB 4K2EA 1IW7F 4RB3C 1RI7A 6PAXA 1WKMA 1CF7B 2IT0A 2OQRA 5A2QZ 5CYVA 5D5UB 3RPQA 2F5CA 5HLIA 1EH6A 5KK1A 1MGTA 4A6DA 4A2UA 5E8GA 4QLCU 3C1DA 2JPBA 4OMYA 1TNSA 1L3LA 1ZN2A 4CGZA 1OYIA 2F5DA 4FHTA 2IPQX 1W4MA 1ODDA 4KUMA 2C6YA 2VODA 3T8RA 2YX4A 2HZTA 2FRHA 1O3SA 5D6FA 3ECOA 2XVCA 3R0JA 4RGUA 3GUDA 4EMSA 3F6VA 1FLIA 2QWWA 3I71A 1S6LA 5L3CA 4R8HA 1TBXA 2RV8A 3V7RA 1K78B 2LSOA 3PQKA 4O3MA 3ZMSA 1BJAA 4AD9A 3P9CA 4HV6A 4L5IA 3E97A 2FMLA 2VN2A 3JAMK 2E7XA 2DK8A 4CYDA 4M6XA 2Z33A 2Z99A 3FM3A 4A0XA 2L01A 3VODA 2COMA 1U5TA 2O6GE 2FOKA 3FHZA 4G94A 1ZRDA 2EK5A 3JSOA 3DPLC 1U5TC 1WWXA 2FU4A 1WRJA 2DO7A 1TW3A 3M7GA 4I09A 2NRAC 1R1VA 1B9MA 1BM9A 3HUGA 3TQNA 3ZMVA 2QUFA 3T0YA 2STTA 3IHUA 4KFCA 4O5VA 2A5YB 4UV9A 3JAMZ 3IKVA 4S04A 3I5UA 3LAPA 2CG4A 5LLQA 1FC3A 2R7FA 1KU9A 4ZZLA 1G3WA 3LA2A 1FYMA 2OU2A 2FF4A 1KYWA 5LHGA 1G4DA 1XCVA 1YIOA 4OIQF 4I02A 2XKOA 4CXFA 2DLLA 4PDKA 3BOQA 2NYXA 4ESBA 1UFMA 5ICEA 3MEXA 2K7LA 1XN7A 3I58A 3BROA 3W6KB 3WE3A 4ZYGA 4MTEA 3TDUC 4OIRF 1SFUA 5EEHA 1YTYA 5D8KB 4TV7A 2YSRA 2ESHA 3M9AA 2JSCA 4HDVA 3KE2A 2YX7A 1E17A 2VC0A 2LF7A 1MJAA 1WSUA 1J5YA 2PJPA 5HLHA 4BHBA 3I53A 1BI3A 2ADUA 2MH2A 4MNUA 2A69F 1ZG5A 1OR7A 3AAFA 3LQRA 3BWGA 3H92A 1UB9A 4HAMA 1TW2A 1PDNC 4KMFA 3SZPA 1FYKA 5D5VB 1XCBA 3KLOA 4A5NA 3L00A 1GVJA 2P7VB 2EB7A 1LDDA 3HOSA 4R79A 5DUIA 4EM2A 3IKTA 2NNYA 2CWEA 2ACJA 4QWQA 5CVJA 3E5XA 1H0MA 1OMIA 2XHKA 3QAHA 2VBZA 4YFNF 1FBSA 3P9KA 4HQEA 5BPDA 1JE8A 2HEOA 4ENJA 2DW4A 5HDNA 3E3VA 3JTGA 2F5EA 3TO7A 2HOEA 2FQ3A 2A61A 3I64A 1SD7A 2A68F 5FB2A 3LWFA 1YS6A 1Z05A 2VBXA 5FFXA 1BIAA 2L4MA 1IN6A 4I98B 2V1UA 5DCMA 1Z91A 3GLXA 1IF1A 3F21A 2K27A 3VEPA 4G7HF 3WGGA 2Z9OA 2QQ9A 3I0TA 4L0YB 4RB1A 1JXSA 4BAYA 4ZYDA 3MZYA 3RDIA 4KNYA 1TTYA 4IRHA 2Y75A 5CVRA 2R3SA 1J9IA 3T5XA 2F5FA 2GA2A 4ESJA 1UCRA 2V1DA 1FWZA 5DYMA 5HDGA 4L18B 5FD6A 1V3FA 1SMTA 2ESNA 3QP6A 5LGUA 2KIFA 1K79A 3VB2A 2PLYA 4EGYA 4N0BA 2CSOA 2OD5A 2MBFA 2OZ6A 3BZ6A 2EV0A 4AIHA 3SFZA 4PGGA 1F4KA 3HHGA 1RUOA 1U5TB 1Z6RA 2OAZA 5CVVA 2XAFA 3WGHA 2STWA 1HSTA 3F3XA 4OMZA 4EJVA 2GXBA 5DEQA 3E6DA 3RKWA 2HQNA 3M8EA 3TDZC 4Q48A 3VOEA 3BDDA 5HS9A 2WWYA 3BPVA 1LEBA 3EYYA 4WX9A 5L3BA 4YFKF 4U7DA 3NEUA 4HOBA 2EV6A 4AWXB 1D3YA 1W5SA 4A0YA 1QGPA 3T1BA 3ZPLA 1FOKA 1IAWA 4A0ZA 3KP7A 3F8NA 3IRRA 1XSXA 5BOXA 1SMYF 4XBFA 4HW0A 1YQAA 4D0PA 4G9YA 4EJUA 3W6JB 3SXYA 4FX4A 1SAXA 5F6FA 1W7PA 2W25A 3B73A 3EETA 4Y13A 5J8CA 1R36A 1I6XA 3FWEA 5ILSA 4RB2C 1ZGAA 4RGRA 1IXSB 1BBYA 1I1GA 2JTVA 5BPIA 3F22A 4MQ9F 2IA1A 3KP4A 5CJ9A 3WODF 4L9NA 5LEKA 4A6EA 5L3GA 1IRFA 2Z3YA 5E17F 1FSEA 2KJBA 5E18F 1KYZA 3GXOA 3KFWX 4UVCA 5D4RA 1FZPB 2HTSA 2VXZA 2Y0MA 2VT2A 2GZWA 4EJTA 3GF2A 3DKWA 3U2RA 1MJ9A 1KQ8A 2K02A 3LA7A 4Q5SF 2A3SA 3I59A 3T8TA 2WTEA 1HW5A 4ZYEA 4M72A 5JR3A 1HQCA 3V7SA 5ICGA 3L09A 2QENA 3KP2A 2HDCA 5DD4A 5HS7A 2UXXA 3FXRA 1LDJA 1YS7A 4BH9A 2DBBA 1I1SA 4MHGA 1HKSA 1STZA 4LMYA 1OYYA 2R7DA 1ZARA 1TQIA 2DAOA 2M87A 3WU1B 1GXPA 2P5LC 3V4GA 3BY6A 1SD4A 5D4SA 5HVQC 1BC7C 1FP2A 2NS0A 5E1WA 4LLGF 3RYPA 5K5RA 2ZO4A 4IVNA 3GZ6A 1U78A 3KP3A 2V1XA 3CUOA 1ZLKA 4WCGA 2QBYA 2JPCA 1MZBA 1S7OA 4LB6B 1KGSA 1R23A 3DPTA 3J81K 2BV6A 1JGSA 4WXHA 1S7AA 4B8XA 1RIOH 2FA5A 1R00A 2P6SA 3V8KA 5D5WB 4LK1F 4IXAA 2ELHA 1C0WA 1HKQA 2QYOA 4BNCA 3MFKA 5DCMB 2OQGA 2XKPA 4KMUX 1ZLJA 1ZYRF 1P4AA 1PUEE 1DPUA 1FYLA 4OIPF 1KA8A 1CGPA 3CUQA 4XRFA 3L2CA 3MQ0A 1VTNC 2VE9A 3GFLA 5H6RA 2K86A 3GFJA
chains in the Genus database with same CATH superfamily
3BJOA 2WB1A 2CJJA 3G1OA 3QRFF 4RMNA 3L2VA 1YX5A 1MNDA 4FETA 4P9FA 1VQ9I 2F4OB 3CUQC 1JJ8C 4KIGA 3IAS2 2PI0A 3H35A 3QPLA 1XX5A 4GYGA 2EBIA 3MZ8A 1SAUA 1Q1HA 4QPQA 1K4TA 2EH3A 2MABA 3J81Z 3HTSB 2ISYA 4IZZA 2L3DA 4IKFA 1R5ID 3HSEA 3FX3A 1XSVA 1MDMA 3C3WA 2ID6A 3F0CA 4G12A 5EZHA 1JKQC 4OU0A 5E20A 2W85A 1IV6A 3SDGA 5GP9A 1Z77A 3CMMA 4ZJZA 5EF6A 4M3FA 1ETVA 3DP7A 4IHWA 2L4AA 2P81A 4IJAA 2CW0F 3Q3SA 1T0FA 1LEAA 1WGXA 4CHUA 2M0CA 1VQPI 3E6CC 2CV0A 1VFCA 1A04A 3J7AY 3TEDA 1ZR2A 1XGOA 3H5NA 4A3GJ 1ZRFA 2XGDA 3HZJA 1T0FC 4PJJA 4MEYF 3A2KA 1ZKGA 3BCBA 1FMWA 3H3ZA 4PCQA 1BI1A 3E7LA 4BEHB 5DM6F 5J47A 2R7VA 3I3LA 1QBJA 4HZFA 4Y17A 3IAM2 3CCJI 4U7BA 2JWTA 3HXLA 4PGHA 1E2XA 1X4OA 2VLAA 4BS9A 4XRSA 2V9PA 2K9SA 2W24A 2Y31A 3DLLF 2L0KA 4ENMA 1KU3A 4IF4A 1ON2A 1X2MA 2JUCA 4N9HA 2IW5A 1V4RA 2MD0A 3GX4X 1R7JA 1X2NA 4UUSA 2PBIA 1K4SA 3LMMA 4XKBA 3KEQA 2BOLA 2JA5J 4LLLA 5E3MA 1Z7UA 1NTCA 2JVGA 3IH3A 2DQRA 2G7UA 1ZHFA 3M07A 2P8TA 5D6EA 2LLKA 2XUBA 2NOJB 1M1EB 3GTKJ 4KICA 1ETYA 3EUAA 2KQRA 1IXRC 3K4JA 4M3EA 4ETSA 5KNLA 3A0HC 3CJRB 1FNNA 1P7IA 3ABUA 5FRMA 4RGXA 4GRIA 3EDPA 1IN4A 1TQPA 4KT5C 3GZ5A 4M9XA 2CGPA 1X58A 1G3SA 3NWSA 4JK1X 2XROA 3ULQB 3K2ZA 5TRDA 2IGKA 3K69A 1G3TA 3FXQA 4NDLA 4LLNA 2DQLA 1ONVA 4CZZA 4LGWA 1U8BA 4P96A 3SQNA 5CVIA 1XSDA 5F27A 2UWMA 2XGXA 3CO7C 3HOUJ 5CLSA 3F9KA 1W7PB 3MCZA 2R7RA 4IPAA 1ZGJA 3RZOJ 1T38A 5JHUA 1VQ7I 3IWZA 2FSWA 2XRLA 5J8FA 1RNLA 1USTA 3H5AA 2E60A 4Z6YA 4RS8A 1IG7A 2D1VA 3S17J 5FLVA 5IP7J 1I39A 3K1NA 2R7SA 3HJEA 3QWLA 1YJNI 2LTPA 3K4KA 3H0DA 4EGZA 3OYGA 1NHAA 3KZYA 3MVPA 4E7LA 2QSFX 4U0YA 1OCOH 1EV7A 4KN4X 5B3SH 5HDKA 1REPC 2WV1A 3KP5A 3COAC 1FEXA 4U0WA 1AKHB 3BJAA 3LAJA 5FFZA 2ZJQF 1VQOI 1O3TA 2B0LA 2L9SA 2LP0A 1R5GA 5GPAA 2QCOA 1T6SA 4A5MA 3R6SA 4EJWA 2EFQA 4LOCA 4EM1A 5FLMJ 3KETA 1B6AA 2LKSA 3BZKA 4HPQA 3OYAA 1LPQA 3L2QA 1FOWA 5L3DA 2RREA 4ITVA 2O61A 2FNPA 3G3ZA 3MZHA 2EWNA 3RPUA 4S0HB 2PEXA 2IP2A 2MC4A 1HC8A 1I5ZA 5DV5A 3I59B 2DPDA 3OS1A 2FBKA 4BE2A 5EGOA 3LSHA 2J5OA 3BCAA 1ZG1A 3A01A 3KX2A 1W0TA 5ICCA 1ETKA 2LK2A 1XDSA 2DMQA 1O3QA 1RKTA 2PJRB 4C2TA 1W7PD 3VPRA 2E2JJ 1GLNA 1XMKA 3BR3A 3HRSA 1LE8A 1SVMA 5AONA 5J1YA 4G6TB 4JX4A 4D5FA 1A36A 3F8FA 5ILVA 4WF2A 3HPHA 1OPCA 4BXUA 1MH4A 1QHGA 2LH9A 3LSTA 3HRMA 4M71A 2GA1A 1TLHB 2A07F 4I2OA 3ZQ7A 4ABZA 2P7CB 1F43A 5IP9J 2KRFA 1QQIA 2XASA 3FM5A 5IYCJ 4FE7A 4XLHA 3RYRA 3TBIA 4A3LJ 2DCEA 1RKWA 3OYJA 3ZQLA 1VQNI 2B63J 2BE5F 5EG0B 1Z21A 4ENNA 1XS9A 2I8DA 4HF2A 3WHBA 4ZH4F 2DMUA 1TNTA 2CQNA 4J01A 5B1BH 2ZCWA 2V6CA 2HDDA 4MFEA 4LFUA 1GVDA 2VI6A 4PFPA 1PP8F 3GTOJ 5FKLA 2H6CA 4FCYA 2ZKZA 3IC7A 1D1CA 2R7ZJ 2HWVA 1Y1VJ 1F1ZA 4BYYA 1S9HA 3CLOA 2GWRA 3OSGA 4W1UA 1IUFA 4LB5A 2DT7B 1BI0A 2KRCA 4KIFA 1X1PA 4XM3A 2QBYB 5AIPA 3TO9A 2R4GA 1JT6A 1LDKB 2ZNZA 2VQGA 3ABTA 4I0BA 1SD5A 2R7QA 3ZMUA 5FGMA 2BEOA 2FUG2 2M7BA 3R60A 5B5EC 1XC5A 2EFPA 4GFBA 3GZNB 3WTSC 3ZXSA 1NK3P 2FNAA 2KIMA 3BQZA 4JX5A 4B09A 1FBUA 1K6OA 4HEA2 1MBKA 2X9DA 2HYJA 1DU6A 1TT5B 1WI9A 4E7IA 2HQRA 4A3EJ 3GFIA 1QPMA 2CFXA 2FMYA 2DOFA 3K4MA 3OYHA 1X1CA 5FO5A 1UELB 1EJ9A 5M3FJ 3HB9A 4M6VA 1DU0A 3OOUA 4HF1A 1XDUA 3ESWB 1DDNA 4RBOA 3O6BB 1O7FA 2IVMA 2EZLA 1UG2A 2D1HA 3L9FA 4M6YA 3S2WA 2HOSA 3CP8A 4HF0A 1R22A 1Z7LA 4Y4RA 2VIXA 2W57A 1W5CC 2JRMA 3D5RC 3M1EA 3CUQB 2PMUA 1T98A 2QVOA 4MQVA 3WU0A 4Y15A 4CDGA 4BXFA 2M45A 4A12A 2HVQA 3TP0A 4UY8I 2Q2EA 2TRTA 3ZMTA 4CH7A 1J0RA 5KAIC 3CDHA 2M8EA 1QHHD 4RM3A 3EUHA 2L9VA 3RKQA 2X1EA 4A3CJ 3GTJJ 2ME0A 1OCCH 2ECCA 2IA0A 1R1UA 2QQAA 3I56I 3K1PA 1BC8C 2E2HJ 2NVTJ 2DMTA 3QU3A 1ULYA 2V79A 3QPTA 1IDYA 1VQ4I 4DZJA 3EUHC 4XSXF 2IRFG 2GOXB 4IHSA 4NQWA 1IRGA 2BXYA 2LMDA 1MMSA 5HS8A 2FXAA 5LEJA 1B4AA 2JT1A 3IWFA 3SDBA 3F8BA 4IHVA 2DJNA 1IRXA 4HBLA 2X0LA 2HPIA 1F36A 1OKRA 2ISZA 3DLAA 5E3LA 3HRTA 1OCRH 1R4MB 3LSMA 5K7FA 5LHHA 2RGVA 2X1CA 1LFPA 3KEOA 2M0MA 2YU3A 3FMQA 5F1RA 1S7EA 2EFWA 2E5ZA 1I27A 2DYSH 2FQ4A 3E5UA 4CCKA 1HBXG 2CW7A 2L7ZA 1RETA 4IHTA 4XRMA 3HKZN 4XLNF 4B48A 4HA8A 4V2FA 3QPSA 2VKVA 2Y30A 2W48A 3K70C 5K5QA 3JRDA 1G59A 3KEYA 3JRFA 3IL2A 1MW7A 4ZTFA 5DDGA 3FF5A 1FPQA 4JQFA 5FKKA 1J59A 2FEZA 3KZZA 4LJZF 3IRQA 2QA4I 4BDYA 2HOTA 4UUSB 5F1JA 2XIGA 5JI6A 4E6KG 2Y0SN 3SYTA 1QZYA 1H9TA 2LKPA 4ZC3A 3TOAA 3RI4A 1VQKI 1UJ8A 3GTMJ 2KZGA 2DT6A 2F2EA 4EATA 2IEKA 1PVEA 2AQFA 4PFOA 3MKYB 3I4MJ 5BMZA 4HNUA 4LK0F 2XF6A 3HC7A 3GYHX 2VJJA 1I3AA 4UVBA 3D5LA 4G6QA 3HL2A 5L3EA 1PP7U 3Q0WA 1ETWA 3L7WA 2HTJA 3WTWC 2K9MA 2D2WA 1CQTA 5KVRA 2KDZA 2A6HF 2DT5A 4M9SA 2XAQA 2EA4A 1DGWY 2R7TA 2XGCA 4OIOF 1XMAA 3GFMA 3SZTA 2GAUA 4RAZA 4N9IA 2XV4S 2IS1A 1U6GA 2BY2A 3K10A 1DUXC 5FJ8J 1QZZA 3RCOA 1MMAA 4C2MJ 2M7AA 5F64A 4Z2YA 3HOTA 3Q5FA 3IH2A 1T95A 1Z6TA 1RESA 1UZCA 3BTLA 2XAGA 2PN6A 3RJPA 3VFZA 2R7OA 2VB6A 4DBQA 2VOOA 3QOEA 3S1NJ 1TQMA 4HYEA 2HKOA 5EZGA 3EYIA 3GFLA 2DA3A 1MJBA 4DNCA 1PUFA 3CC2I 2VQHA 3DU6A 1OYWA 3F8CA 3TL4X 2CV1A 4IX7A 5K1YA 5E3OA 1Q1VA 3OYLA 2KMUA 5LBQA 4MTDA 4A3KJ 1YYVA 3FDYA 3MKZA 2B7EA 4E70A 3NWTA 1J75A 4KIBA 4EM0B 2DMNA 4OWRB 1G8XA 3LQQA 4UB8C 2NS7A 4E7HA 2KJCA 2PMHA 2FBHA 4OAZA 4OINF 1IV8A 3OYEA 3BG7A 3HTUA 2CMPA 2W00A 3RIRA 1VQ8I 4RLFA 5JHFA 2E1NA 1TWHJ 4HG2A 5ED4A 3Q9VA 3J80K 3OOPA 1ZG3A 2EFNA 3HSRA 3ABMH 4EVIA 2MLGA 5D8LB 2E5NA 4Q47A 5H20A 5GADJ 3WTVC 2L54A 1X3UA 2M1BA 4YG2F 2CYYA 1EA3A 3HEFA 4KISA 3DFGA 5EGOB 1F9NA 2F4IA 4DZPA 3A01B 4IQ4A 1YLFA 1R58A 3SEQA 4BJTA 5BQTA 3GTQJ 1N25A 2V7FA 4GXOA 1SFEA 2ETHA 1BR1A 3GW2A 3K4CA 3PFIA 3U21A 2FJ1A 5IY5H 3L2UA 3H9QA 5ILUA 3ISPA 4DYCA 5JVGF 2Z5UA 4UB6C 2RAEA 2DTZA 4DOZA 2RC4A 3MAJA 4BKXA 4AIKA 2AXLA 1Z67A 2XPWA 4GCVA 3RKYA 1EH8A 4MFDA 3PNTA 4WK8F 2JUGA 1EF4A 3CCYA 3KCCA 3I55I 4UUVA 1TWGJ 4L0ZB 1R1TA 5C4XJ 2BHZA 3AG3H 4R1HA 1ZRCA 2V4JC 5E8IA 2H27A 5DCFA 4HQMA 3E6MA 4L5JA 5E1XA 1V55H 2VC1A 2JQ7A 3I4NJ 2OJED 5FD5A 3E0JB 2YUSA 2CQ7A 3J80Z 1DPRA 3CJNA 3DKXA 4C3JJ 2OPTA 4YIFA 3PUBA 3W2VA 4XLPF 4HSTA 4B4CA 4KDPA 5JLXA 5FKOA 5FLXK 3C18A 4MEXF 4CCJA 4RM2A 2HNHA 3W2AA 2H09A 3RPUD 4U88A 1ERDA 5DTDA 1LNWA 2CRGA 1IDZA 3ZCOA 4M9ZA 4GYIA 4AVZA 3D0SA 1FSHA 2EPFA 3U1DA 1NG6A 3S2HJ 4CZCA 1TWFJ 2HS5A 1G6NA 3VYSB 2OTJI 1MBGA 1XD7A 3OYBA 2F6CA 1ZREA 1P4XA 1FBQA 3QU6A 2DI3A 3WTXC 2DA6A 4HSRA 1YIJI 3ZGKA 4RB0A 2V9VA 4UNOA 1MBEA 2RNJA 5KHDA 3VWBA 1JT0A 4LIVA 3CQZJ 4IHYA 3S14J 2IS2A 2YR2A 2HGCA 4HLYA 4P9UA 3BR0A 1F5TA 1BN5A 2UXNA 4XR6A 1O7LA 5M3MJ 3ML6A 2CFOA 3CMEI 3D5SC 5H6QA 1YO5C 1MBFA 3JCUC 4XIDA 3WGIA 3CJTB 3EQLF 1FTTA 3CMYA 3F8MA 5FLXZ 3UR3C 2Z1DA 2M2EA 2WY8Q 3BR6A 4C2UA 2L02A 2EA2A 2IGOA 2WAFA 2DDAA 3JSPA 1MMDA 4D7NA 2X6YA 1ACIA 5F04A 1GUUA 4B3AA 2Q2EB 2X6WA 3WTTC 1R49A 4P1WA 4Y33A 2OUMA 3LSIA 4BE0A 3DBHB 1WJCA 2DK5A 2LBFB 1HOMA 2RNGA 4PJNA 3OYKA 1S29A 5F08A 4HX8A 2E34A 3I54A 2XAJA 1IRZA 4ESFA 3QYFA 4FX0A 1XGSA 3FZVA 3KYCB 2ZJ2A 4BQNA 2IJLA 5J6XA 3FXOA 2RN7A 2HVSA 2Y48A 4PZJA 2CQKA 3GTLJ 2LRDA 2IBDA 2IGNA 3R61A 3NAUA 3OYMA 2GBYA 2X51A 1R71A 4NQWB 5J1RA 4RDUA 1V5EA 1ORKA 1YW8A 2DA4A 2GIVA 4GO1A 4E4HA 5CPRB 3DV8A 1RZ4A 2JRTA 1B9NA 1O4XA 4KA4A 4LG0A 1NK2P 4I01A 2K3FA 1D8KA 3R4KA 5LGTA 3P5JA 3ZMDA 1A6IA 2OC6A 2CUEA 3TOBA 2HYFA 3N97A 3ROUA 4UVAA 2GLOA 1FX7A 3VYTB 2VBYA 1IN5A 3B6AA 1RR7A 3DQVC 5E79C 2IA2A 4I99C 1JJ6C 4BQOA 1BR4A 1V54H 2EJRA 4V19K 5ERIA 2MA3A 2QQBA 5DD8A 4BDZA 1D8JA 1O57A 5IT3A 2NS8A 3TMOA 4X0GA 5LHIA 2G7HA 2PG4A 3JTHA 3FK7A 3DU5A 2OZUA 3RSNA 1VQ5I 1W5TA 1FP1D 1RUNA 3DEUA 3BPXA 4GGGA 3OYIA 2GQQA 3BTJA 3BG5A 3RKXA 3SHFA 2P5KA 4BQAA 2XF5A 3C7JA 1KZHA 1B8IA 3VYUB 3DBRB 5M5YJ 3QODA 1XTAA 3PQJA 2WA0A 4F52A 2NVYJ 1YG2A 3ECHA 3PUFA 2M4KA 2EZHA 5AIQA 3S3NA 3O8GA 3W3CA 4F92B 3UKGA 1DP7P 3K0LA 4JX6A 1W1WE 9ANTA 3BTIA 5K7ZA 2CUZA 3FMRA 2P0WA 3PSFA 3R0AA 3OL3A 1K6YA 5CVUA 4PK4A 3DEWA 2X4HA 3ZP5A 2H6BA 2LREA 1UHWA 4A93J 4M73A 1Y0UA 2A6EF 2EZKA 1P92A 4RAYA 5EDNA 4WWCA 1Y1WJ 2E1CA 2GIZA 4YELA 3K9TA 1D0ZA 1MBJA 3X2QH 2BVLA 5E3NA 4HX7A 4RGSA 5D5XB 4KN7X 1BOBA 1U0JA 5J4YA 1XGNA 3K70D 2YS9A 3LSJA 1LB2A 1KQ0A 1YHQI 2L9RA 1LVAA 3QOPA 1D5VA 2OCCH 4ZDLA 1W36C 3FISA 4HNVA 1XG1A 3W6VA 1B1BA 1PUFB 4BJ5C 2E71A 3BC8A 4BL0B 2GXGA 2DA5A 3ERMA 1BW5A 4JYKA 1FY7A 4BXXJ 2Y9YA 3ELKA 3DF8A 2A5WA 3F72A 2G9WA 2NXNB 3WG9A 2VBWA 1WHUA 3CCLI 2HQ5A 5JVTA 3RTRA 5LGNA 1SFXA 1YI2I 3BJ6A 3K7AJ 5K7HA 1IO2A 4XLAA 1KU2A 3TO6A 3LFKA 2HKXA 2E2IJ 2O8XA 1ZAOA 3FKIJ 1HW1A 2VL8A 2ZXHA 1YW7A 2ID3A 4PJ0C 1EKEA 3GMEA 4EQQA 2BVMA 4M74A 1LQ1A 2VKDA 1Z9CA 2DFFA 3O3KA 2CU7A 2COBA 1SEUA 1ZTRA 1S3JA 2K9NA 3S32A 1IUYA 4CYCA 2ME6A 3V8LA 4MO7A 1P6RA 3FXLA 2VE8A 2VPRA 2O7OA 2PFBA 3HIFA 4G8XA 4UXNA 2O03A 5JFRA 3H1CA 1JHHA 3JW4A 5J3LA 5IYBJ 2ZC2A 2BYVE 2KIUA 3S3OA 1X19A 3BZCA 1U8RA 3CCQI 3OS2A 2Z16A 1AWCA 3P7NA 1MMNA 2LFBA 2XPVA 1FOXA 3H0GJ 2CO5A 3WTUC 4ENKA 2K5CA 5F0HA 4EV0A 4DIQA 5H2FC 5GTIC 2M34A 4YIIA 3GO5A 3E5QA 1HW2A 3PL8A 1T2KA 5BNGA 3OIPA 4RLQA 2HYGD 5TJJA 3V7CA 2ZMEA 3KZIC 3G4SI 2EQRA 1FT9A 1YFHA 1D0XA 2KRHA 2NAZA 5K5OA 2P4WA 3BTCA 4ZZDA 1MKMA 1CF7A 2OV7A 4ZTJA 2KHMA 3Q9SA 2QKMB 1XGMA 4D7MA 3FHNA 3DWLE 2IAIA 1X1BA 4IRGA 1K7AA 2ZMEC 2R7UA 1R6RA 5CKTA 3O2PE 1AOYA 2WY7Q 4L9JA 4L9TA 5EEGA 2RDPA 2H8RA 2KL4A 4S05A 4BBRJ 1P4WA 3CCSI 2PQ8A 1OFCX 4XICA 1BI2A 3G2BA 3KLNA 2HQAA 1WQ2A 4H0EA 4IO9F 5B66C 2NNNA 2MG4A 4EJOA 1O3RA 3Q0UA 2FBIA 2XAHA 1HLVA 3MKWB 4D9JA 4BHPA 1YRNA 1BIBA 3MD2A 3TGNA 5IYDJ 5EJCA 4ASNA 3K1MA 3ZRGA 2O0YA 4XN0A 4PJMA 5FROA 1TC3C 1SD6A 3W2WA 2BGCA 2RQPA 1ZQ3P 5J1UA 4NHJA 2E35A 3H36A 3QP5A 3QPHA 2MC3A 3FMSA 4HV5A 1IXCA 3DTEA 2EV5A 3LOCA 3TKYA 3F6OA 3WTYC 2MH9A 1EH7A 4I7HA 2PX9A 2CQXA 4H4KC 5LRRA 4BU2A 1MD0A 4JBAA 1UG0A 4F7ZA 1YW9A 2NVXJ 4DQ2A 2A6TA 1K78A 3ZN1A 5F0FA 1OLTA 3HRUA 2K4JA 2IS6A 1XPXA 2M5WA 4NC7A 3FK6A 1S8NA 2P6TA 2W7NA 1MDMB 3CTAA 2LC2A 3QYBA 3ZN0A 2DN0A 2F48A 1Z1DA 3BP8A 3CC4I 4HLXA 1ZH5A 1HKTA 4P55A 1KU7A 1WFXA 1SC7A 3J7YJ 4FT8A 2DFIA 5J40A 2TDXA 3ZQGA 2ZFWA 2EZIA 1RPWA 1WH5A 4NUBA 4IQJA 3UNGC 2WV0A 4L9VA 1J7KA 2WAQN 2LNBA 2MD5A 2ZXJA 3A02A 4A3IJ 2I10A 2X6OA 4V2GA 4PJLA 3OSFA 2HZDA 4Q4ZF 2DTRA 1T39A 4XL9A 1IZ1A 2JA8J 4HDUA 3LFUA 4CO8A 4XLFA 4LG0B 4BBSJ 4DW6A 2HFHA 1QNTA 3V8JA 2M30A 3PFYA 5HOOA 5GPCA 1VQLI 3OV8A 1I50J 4YIRX 2FE3A 4OOIA 1IN8A 1SANA 2ELKA 2WC2A 2H94A 2L2OA 3HGYA 3NRVA 4O6JA 1P9QC 2E7WA 4UV8A 3KYLA 3ERED 1WH7A 2ZNYA 3AG2H 1YX3A 1FMVA 2OF7A 3CCRI 3FXUA 4Y52J 4ZYHA 2X6XA 2LY2A 4U0VA 4I0AA 5IT9K 2YPRA 3O8HA 5KCMA 1YE9A 2XB5A 4BQQA 2KPMA 1GHCA 4XKVA 1WJFA 4PSXA 1MNMC 4KJZA 4LD5A 1UAAA 2RKHA 2EILH 3KP6A 1R5HA 3MWMA 5FKMA 5ICFA 3K4BA 4IOCF 2O8KA 2R92J 2JN6A 3QYEA 4DJAA 4XSZF 1S5LC 1JKRC 1LJ9A 2OBPA 4BGDA 4A3MJ 3OR1C 3BG9A 3ZQIA 2QLZA 4AUXA 1PJRA 2VONA 1LUJB 5L3FA 3GWZA 5HLTA 3HDDA 4ON0A 4C9YA 3LA3A 4G7OF 4YFXF 2Q8KA 4AVPA 1A31A 2J5PA 5HLGA 2LDUA 1SFKA 3CCEI 1ZELA 2ELJA 3B02A 2EFOA 3GVAA 2VOPA 5GTHC 3HYIA 2K4BA 2ECBA 1POGA 2W84A 2RVCA 3U1KA 2VUMJ 2LF8A 3WTZA 5DUKA 2BBYA 3K4LA 3HSFA 3M8FA 4AIJA 2AQEA 4A3FJ 1H89C 1P2FA 1U2WA 1RR8C 3GEZA 3REOA 1BA5A 1BOAA 4A3BJ 1B59A 1ETQA 1MBHA 4XNFA 5IT9Z 3WHCA 3CDLA 4KYWA 2O3FA 4G7ZF 3PO3J 1NG7A 1J2XA 5FRNA 2GM4A 2MLKA 3H5RA 2JVHA 1IN7A 2KKOA 3JRHA 5GAHJ 3JRBA 1U3EM 3H3UA 4WXDA 3DBLB 1WJ5A 4X1EA 4CICA 4NB5A 5M5XJ 1NH3A 1L0OC 5LRSA 4BY7J 3GBGA 1BL0A 3ZQHA 1GXQA 2JZYA 3IV5A 1USSA 2CW8A 2LOOA 3OS0A 1H9GA 3HOWJ 2Q0OA 3HHHA 2AO9A 1X3WB 3E6BA 3WE2A 2D45A 2K40A 2QZ8A 3FIWA 3HKZA 1R4NB 5A2QK 3G73A 5E1ZB 4IRIA 2QSHX 3N4MA 1QO0D 1JUSA 2ICWG 2VT3A 1HXDA 3CO6C 2DOAA 1PYVA 4CA0A 3OL4A 1Y56A 2UZKA 4XLEA 1LE8B 3DXJF 1RRJA 2O9LA 4X6AJ 4CYCB 4MGRA 2DPUA 4P5OA 1ON1A 2QGUA 2DA2A 4BHCA 2HR3A 3F23A 3Q0VA 3A4CA 4XKWA 3J7AO 2QQ8A 2UV1A 1UHMA 2DU9A 1YOVB 2AS5F 2OA4A 1HDPA 4UUTA 2Y0SA 1G3YA 2KP6A 3LSPA 3P9IA 2QM3A 2XSJC 4WXCA 2HXIA 2P5VA 3ABLH 4XORA 3ZMZA 3N05A 1OJLA 3U9GA 4G6DA 1VZ0A 1KQ9A 4AU7A 4BY1J 2MGQA 1AA7A 5BS6A 2ZBKA 3C2BA 5EG0A 1XB4A 1FIAA 2BY0A 1HA8A 1UHSA 2XPUA 1MSFC 3NQOA 1JHFA 4LG3A 2KDOA 4UHTA 4HX4A 5HNFA 3I4PA 1HSJA 2ZMEB 4K2EA 1IW7F 4B1RA 4RB3C 1RI7A 6PAXA 1WKMA 1V5FA 1CF7B 2IT0A 2OQRA 5A2QZ 5CYVA 5D5UB 3RPQA 4XOTA 4E7ZA 3LSGA 3JREA 2IGMA 2F5CA 5HLIA 1QVTA 1EH6A 3WU2C 5KK1A 1MGTA 1WPKA 4A6DA 4F3QA 2GOMA 4A2UA 2H1KA 4ZDOA 2WADA 5E8GA 4QLCU 3C1DA 2JPBA 2AXTC 4OMYA 2VQCA 3PIPF 3PM1A 1TNSA 3G1MA 3FXMA 1L3LA 1ZN2A 4MIMA 1OCPA 4CGZA 2F5VA 1OYIA 3OYFA 2Q1ZB 2F5DA 1JTYA 4FHTA 2IPQX 4QSHA 1W4MA 1ODDA 1VI0A 5C44J 4KUMA 3FXKA 2LY9A 3JRAA 2F4MB 1IJWC 2C6YA 2VODA 2R5ZA 2M8GX 1WJEA 3T8RA 2VJ5A 2HZTA 2YX4A 1N77A 1YRNB 2FRHA 3ASNH 1O3SA 5D6FA 2NVUB 3ECOA 2XVCA 3R0JA 4RGUA 4F55A 3GUDA 1MMGA 4EMSA 1Y0NA 3S3MA 4B43A 3F6VA 2W4SA 3OIOA 1YITI 1N78A 2EIKH 1FLIA 3LNQA 2QWWA 3I71A 1S6LA 4BACA 4FQGA 1J09A 1TWCJ 3CF5F 5L3CA 4XQFA 3HOXJ 3CC7I 3AL0C 4R8HA 1TBXA 2RV8A 1TT0A 3FXJA 3DEEA 2ZFUA 1Y8RB 3V7RA 1U9NA 4U87A 3OWTA 1K78B 4FASD 2LSOA 3PQKA 4ZDPA 3ZMSA 4O3MA 5HODA 1BJAA 2H1LA 4AD9A 3P9CA 4HV6A 4L5IA 3PO2J 5DS9A 3E97A 4XLCA 2FMLA 3DPUA 1P7JA 2VN2A 3MKLA 3JAMK 2E7XA 4IL6C 2DK8A 1WJBA 2ZB9A 4CYDA 2CV2A 3GTPJ 1MIJA 4M6XA 2Z33A 2Z99A 3FM3A 2L5QA 3VSKA 4A0XA 2L01A 3VODA 2DODA 1A6QA 2COMA 1U5TA 5HNHA 2O6GE 2FOKA 1JUMA 3FHZA 1HF0A 4G94A 1Z3XA 3S1MJ 3JR9A 1ZRDA 2EK5A 2D5VA 2HDWA 3JSOA 3DPLC 1GDTA 4B3XA 1U5TC 1WWXA 5EEAA 2FU4A 3CLQA 2IXSA 1WRJA 4E7KA 1D0YA 4A3DJ 2DO7A 2V9KA 2K9LA 1TW3A 3CD6I 2K9QA 2NOGA 3S1RJ 3BR5A 3M7GA 2BHYA 2BY3A 4I09A 2NRAC 1R1VA 2QSGX 2IS4A 1B9MA 3CDIA 4CUGA 3QQAA 4F91B 4E7SA 3FBNB 2Z2SB 1BM9A 3HUGA 3TQNA 1LKXA 3ZMVA 3K6GA 3C2HA 3HOZJ 2QUFA 3T0YA 2EIMH 3JRGA 2STTA 2R5YA 1WCMJ 3IHUA 4O5VA 4KFCA 1FIPA 2A5YB 1E0EA 3SFIA 3CP2A 4UV9A 4NC8A 3CZ6A 1I6HJ 3JAMZ 1ZK8A 3IKVA 1ETXA 4AC0A 4KITB 4S04A 4AM3A 3I5UA 3LAPA 2CG4A 2G0EA 5KAFC 5LLQA 3PJRA 1FC3A 2CH0A 2R7FA 4M3BA 1E3HA 1WI3A 1KU9A 4ZZLA 2BW3A 1G3WA 1OCTC 2L9NA 3LA2A 4CCNA 2OU2A 1FYMA 2K3PA 2ZSIB 2Y69H 1JI8A 2FF4A 1KYWA 2JA2A 3DKYA 5LHGA 1G4DA 2DOEA 1XCVA 2KT0A 1YIOA 5CQGA 3M3YJ 2DXIA 3RQIA 4OIQF 4I02A 3H9JA 1X3ZB 2DFHA 2XKOA 2VKHA 4CXFA 2DLLA 4PDKA 3BOQA 2LD5A 2OTLI 2NYXA 3RQ4A 5J4VA 1T08B 4ESBA 1UFMA 4M3GA 5ICEA 2CUFA 2HOAA 3MEXA 3S16J 2K7LA 1XN7A 3I58A 1K61A 3BROA 2BXZA 3W6KB 3WE3A 4ZYGA 4MTEA 1BJZA 2DA7A 4CCOA 3TDUC 4OIRF 4IHXA 1SFUA 1JKPC 2VQLA 1LVKA 5EEHA 1MNEA 2DJIA 5C4JJ 5D8KB 1YTYA 4TV7A 3CMAI 3CCVI 2DA1A 2YSRA 1LFBA 1VQ6I 2ESHA 3M9AA 1TP4A 2KLOA 3S15J 1JTXA 2JSCA 2R0QC 4I76A 4NBQA 3L2WA 2R7XA 4RAGA 3FKJA 4HDVA 5GAEJ 3KE2A 5IOZA 3HOVJ 4CCMA 1B72A 2JJ7A 2YX7A 1E17A 1ZR4A 2MW8A 2HXOA 2VC0A 5CQEA 2LF7A 2E1MC 1MJAA 1WSUA 1J5YA 2PJPA 3OR2C 3DTKA 5LD2C 2UUZA 5HLHA 4BHBA 4A3JJ 3I53A 1BI3A 2ADUA 2MH2A 4MNUA 1H88C 1RC9A 2DYRH 3GLLA 3SJMA 2A69F 1ZG5A 2JA6J 1OR7A 2WAEA 3SZGA 4Y7NJ 3AAFA 3LQRA 4DBRA 1XMXA 3ZOBA 3K2AA 3ABKH 2B9SA 3BWGA 3H92A 1UB9A 3G6EI 2ZJRF 1TZLA 1WZ2A 4B47A 4HAMA 3JRIA 2L7MP 1I3QJ 1OR7C 1TW2A 2QEXI 1PDNC 1X1DA 4KMFA 4OAYA 2K85A 3SZPA 3BG3A 5D5VB 1FYKA 3S2DJ 2RQQA 1XCBA 1YJWI 2MYSA 3KLOA 4LITA 4A5NA 3L00A 4BE1A 1GVJA 2P7VB 2EB7A 1LDDA 2Y2ZA 1HCRA 1MH3A 3GTGJ 5C3EJ 3HOSA 3TW6A 1AHDP 1T56A 2H8WA 3DTIA 4R79A 3S93A 1ENHA 5DUIA 2HI3A 4EM2A 1A35A 2YU9J 4KT6A 5F0CA 3IKTA 1DP3A 4D1QA 2NNYA 1DGRM 2V26A 1SFOJ 1GV5A 2DMPA 2CWEA 3J7ZI 2ACJA 2LVSA 4QWQA 5CVJA 3E5XA 2VJ4A 2GXAA 2XSDC 1H0MA 1OMIA 2HPMA 2XHKA 2ZSHB 3QAHA 1T8IA 2VBZA 3TW7A 4YFNF 3PSIA 1FBSA 4FE4A 4NC6A 3P9KA 4HQEA 5GAGJ 1E3PA 5BPDA 3IH4A 1JE8A 1Y8QB 2HEOA 2ZXIA 2LG4A 3L1PA 3G71I 4ENJA 2DW4A 3A1YA 4D5CA 5HDNA 3E3VA 2R93J 1AU7A 3JTGA 1GT0C 2F5EA 3TO7A 2HOEA 2FQ3A 2A61A 2XGEA 3I64A 4NNJA 1DQUA 2I5UA 5IPAA 1SD7A 1KONA 1E3OC 1U9OA 2A68F 5FB2A 4CCLA 4GDFA 3HGGA 3MMYB 3LWFA 2CQQA 1SVLA 1YS6A 4CSWA 1Z05A 2VBXA 5FFXA 4FTHA 5IOYA 1BIAA 2L4MA 3IP4B 1IN6A 4I98B 2V1UA 3ASOH 5DCMA 2R7WA 2M4GA 1Z91A 3GLXA 1IF1A 4XONA 3F21A 2K27A 4XN3A 3VYRB 3VEPA 4B44A 4G7HF 3ZQCA 3WGGA 1OISA 4RAFA 2LY1A 2Z9OA 2R5ZB 2QQ9A 3I0TA 2V1NA 4L0YB 4RB1A 1JXSA 4BAYA 2ZJPF 4ZYDA 1UMQA 3MZYA 1JGGA 2XDVA 3RDIA 1HDDC 3OMYA 2QF7A 3HM5A 2LR8A 4KNYA 1TTYA 4IRHA 1Y39A 2Y75A 5CVRA 3AL0B 2R3SA 4J19A 1J9IA 3VDXA 3AFHA 3T5XA 2LKXA 2VASA 2F5FA 3PIOF 2GA2A 4ESJA 1UCRA 2V1DA 3OYDA 1FTZA 3KIOA 1H8AC 1FWZA 3PNVA 5DYMA 5HDGA 4L18B 5FD6A 1V3FA 2JSPA 4QIWN 1FOYA 1BW6A 1SMTA 2W82A 2ESNA 3QP6A 4XKCA 5LGUA 3RZDJ 5FKNA 2KIFA 2LBFA 3HPGA 1K79A 3VB2A 4QTRA 2PLYA 4EGYA 1Y6IA 3OIQA 4N0BA 3OYNA 2CSOA 2OD5A 2MBFA 2DFEA 2OZ6A 2HVRA 4YRVA 2PMZN 3BZ6A 2EV0A 3C2GA 2A05A 4AIHA 3SFZA 4E7JA 4PGGA 2E36A 1ZGWA 1F4KA 3HHGA 1RUOA 1U5TB 1QU3A 1Z6RA 2OAZA 4N4OB 2BZTA 2XAFA 5CVVA 3WGHA 4HNTA 1HSTA 2STWA 3F3XA 3M1CA 4OMZA 4EJVA 4BUPA 2GXBA 5DEQA 2N8GA 3E6DA 1OQYA 3RKWA 4C3HJ 2HQNA 4BEHA 3M8EA 4RA2A 4ZYAA 3TDZC 3MN2A 1D5YA 3LSKA 4Q48A 2VXDA 3VOEA 3EUKL 2DDBA 2QKLB 3BDDA 1QRYA 5HS9A 3A03A 3BPVA 2WWYA 3CCMI 1BR2A 3B6CA 3EYYA 1LEBA 4WX9A 2KFDA 3PNYA 3AG1H 1W0UA 5L3BA 4YFKF 4U7DA 2WBMA 3HUGB 4JP0A 3NEUA 2FD5A 4HOBA 2R5YB 2EV6A 1K83J 4AWXB 1TL8A 4AIDA 1D3YA 1W5SA 4A0YA 4L5EA 1QGPA 1B8IB 3T1BA 3ZPLA 3BR1A 2X48A 1FOKA 3A0BC 1IAWA 1VNDA 2JMWA 4A0ZA 1GV2A 1G2HA 4J00A 3KP7A 3F8NA 3OY9A 3IRRA 3BLYA 2MFZA 3V42A 1XSXA 5BOXA 1SMYF 2BW3B 4XBFA 4HW0A 1YQAA 4D0PA 3KPHA 3KYDB 4G9YA 4I6ZA 2E1OA 4EJUA 3W6JB 4DYRA 3SXYA 4FX4A 2JK3A 1TWAJ 1SAXA 5F6FA 1W7PA 3HOYJ 2W25A 3B73A 3CJQB 1D1AA 3EETA 3BT9A 4Y13A 5J8CA 4XK4A 4M3DA 2E19A 1R36A 2XC7A 1R9TJ 1QZEA 1I6XA 3BQYA 3FWEA 3G1LA 5ILSA 1A5JA 4RB2C 1ZGAA 2XAUA 3BR2A 3IUOA 4EEFG 4XOPA 3WG7H 4RGRA 1IXSB 1BBYA 1Z0XA 4XRSG 1I1GA 2JTVA 5BPIA 1YJ9I 3F22A 2KISA 4AYBN 5M5WJ 3M4OJ 4A69C 4PSWA 1S72I 2CS3A 4MQ9F 2IA1A 3KP4A 5CJ9A 3WODF 3L2RA 2O5RA 2JA7J 4W97A 1JUPA 5IP6A 4L9NA 5LEKA 2W1OA 4A6EA 4IOAF 4LIUA 2KZVA 2BY1A 5L3GA 1ITYA 3DCFA 1IRFA 1AKHA 2XB0X 2Z3YA 5EYRA 5E17F 1FSEA 2KJBA 2ZXWH 3ZR8X 5E18F 1KYZA 2MSYA 3GXOA 3KFWX 4UVCA 5D4RA 2FOWA 1FZPB 2HTSA 3M8JA 2VXZA 2Y0MA 2VT2A 2PMZA 2WAQA 4PUSA 2M3AA 2E1MB 2GZWA 1IC8A 4EJTA 3GF2A 3DKWA 4C3IJ 3U2RA 1MJ9A 2NVQJ 1KQ8A 3EPZA 2K02A 3LA7A 1B72B 4Q5SF 4N4NB 2A3SA 3I59A 3T8TA 2V6EA 2WTEA 1HW5A 3JRCA 3VSLA 5JLWA 2WB1N 2EIJH 5B1AH 4XMYA 4QPOA 4ZYEA 4M72A 2OCEA 2PJRA 1SVOA 5JR3A 1HQCA 3OYCA 3TP3A 3V7SA 2LYCA 5ICGA 3L09A 4II3A 3H3VK 2QENA 3KP2A 3ONQA 1T33A 2VKEA 2HDCA 5DD4A 3NARA 5HS7A 1WVRA 2UXXA 3FXRA 1VQMI 1LDJA 1W36D 4ANJA 1YS7A 4BH9A 2DBBA 1I1SA 4MHGA 1HKSA 4MLOA 1STZA 3S1QJ 5LFAA 4LMYA 1OYYA 1V5GA 4DGWB 2R7DA 1ZARA 1OCZH 1QA6A 2AHQA 1TQIA 1X1AA 1QVUA 4II2A 2FX0A 2DAOA 2M87A 2X1DA 4F93B 2L7KA 3WU1B 1GXPA 2P5LC 3V4GA 4IEJA 3BY6A 1SD4A 5D4SA 2EINH 1Z3YA 5HVQC 1BC7C 2TCTA 1FP2A 2NS0A 5E1WA 3LL7A 4LLGF 3RYPA 5DM7F 3GCMA 3AKZA 5K5RA 2ZO4A 1N75A 4IVNA 3GZ6A 1LFUP 2M9HA 3CESA 1U78A 3KP3A 2CUJA 3CCUI 2V1XA 3FBIB 1FJLA 1ETOA 3E1SA 3SEZA 3CUOA 1ZLKA 4FISA 4WCGA 2QBYA 3AG4H 1MSEC 1QPIA 4HRIA 3S8PA 3ZQQA 2JPCA 4C30A 4Y3OA 1MZBA 2VJIA 2KIQA 2HU9A 1S7OA 4LB6B 1KGSA 1R23A 3DPTA 3J81K 2BV6A 1JKOC 1JGSA 3CF2A 4AYBA 4WXHA 4YEJA 3H9GA 2XF7A 1S7AA 4B8XA 3HBLA 5TISC 1RIOH 5TGTA 2FA5A 1R00A 2P6SA 3V8KA 3HG9A 1WJAA 5D5WB 3K4NA 4IXAA 4LK1F 1X4PA 2ELHA 1C0WA 1HKQA 2QYOA 4BNCA 3MFKA 3I9V2 5DCMB 2OQGA 2XKPA 4KMUX 2Y9ZA 3D1NI 1ZLJA 1D1BA 1ZYRF 1P4AA 4DYQA 3LSRA 1PUEE 1DPUA 4JOMA 1FYLA 2X85A 4OIPF 4BJ6C 1KA8A 3BG6A 1CGPA 1VF9A 1WJDA 3CUQA 4XRFA 1APLC 3ZQFA 1IGNA 3L2CA 3MQ0A 1VTNC 2VE9A 2L7FP 2VPLA 2XRNA 5H6RA 2K86A 3GFJA
chains in the Genus database with same CATH topology
3BJOA 3QRFF 4P9FA 3CUQC 4KIGA 2PI0A 4GYGA 1Q1HA 3J81Z 3HTSB 2ISYA 2L3DA 3HSEA 3FX3A 1XSVA 1MDMA 3C3WA 4OU0A 5E20A 2W85A 3DP7A 2L4AA 4IJAA 2CW0F 1T0FA 1LEAA 4CHUA 3E6CC 1A04A 1XGOA 1ZRFA 4MEYF 3H3ZA 4PCQA 1BI1A 1QBJA 4HZFA 4Y17A 4U7BA 4PGHA 1E2XA 2W24A 4ENMA 1KU3A 4IF4A 1ON2A 4N9HA 2IW5A 1V4RA 3GX4X 1R7JA 2PBIA 3KEQA 4LLLA 1Z7UA 2DQRA 2G7UA 1ZHFA 5D6EA 2P8TA 2XUBA 4KICA 4ETSA 1IXRC 1FNNA 3ABUA 4RGXA 3EDPA 1IN4A 1TQPA 4KT5C 3GZ5A 4M9XA 2CGPA 1G3SA 4JK1X 2XROA 3ULQB 3K2ZA 5TRDA 3K69A 1G3TA 3FXQA 4LLNA 2DQLA 1ONVA 4CZZA 4LGWA 4P96A 3SQNA 5CVIA 1XSDA 2UWMA 2XGXA 3CO7C 5CLSA 1W7PB 3MCZA 4IPAA 1ZGJA 1T38A 5JHUA 3IWZA 2FSWA 5J8FA 1RNLA 1USTA 4RS8A 2D1VA 3K1NA 4EGZA 1NHAA 3KZYA 4U0YA 1EV7A 4KN4X 5HDKA 1REPC 3KP5A 3COAC 4U0WA 3BJAA 3LAJA 5FFZA 1O3TA 2B0LA 1R5GA 1T6SA 4A5MA 3R6SA 4EJWA 2EFQA 4EM1A 3KETA 1ZREA 1B6AA 5L3DA 2O61A 2FNPA 3G3ZA 3MZHA 2EWNA 3RPUA 2PEXA 2IP2A 1I5ZA 5DV5A 3I59B 2DPDA 2FBKA 2J5OA 1ZG1A 5ICCA 1XDSA 1O3QA 1W7PD 1XMKA 3HRSA 5AONA 3F8FA 5ILVA 4WF2A 1OPCA 4BXUA 4M71A 3LSTA 3HRMA 2GA1A 1TLHB 2A07F 4I2OA 3ZQ7A 2P7CB 2KRFA 1QQIA 2XASA 3FM5A 3RYRA 2BE5F 4ENNA 4HF2A 4ZH4F 1TNTA 2ZCWA 2V6CA 4LFUA 1PP8F 2H6CA 2ZKZA 3IC7A 2HWVA 1F1ZA 4BYYA 3CLOA 2GWRA 4LB5A 1BI0A 4KIFA 2QBYB 5AIPA 3TO9A 1LDKB 2ZNZA 3ABTA 4I0BA 1SD5A 3ZMUA 5FGMA 2BEOA 3R60A 2EFPA 3WTSC 2FNAA 2KIMA 4B09A 1FBUA 1K6OA 1WI9A 2HQRA 3GFIA 1QPMA 2CFXA 2FMYA 5FO5A 4HF1A 1XDUA 1DDNA 3O6BB 1O7FA 2IVMA 2D1HA 3L9FA 4M6YA 3S2WA 4HF0A 1R22A 2W57A 3M1EA 3CUQB 2PMUA 1T98A 2QVOA 4MQVA 3WU0A 4Y15A 4CDGA 4A12A 2M45A 2Q2EA 3ZMTA 1J0RA 3CDHA 2M8EA 3EUHA 2QQAA 2IA0A 1R1UA 1BC8C 3K1PA 3QU3A 1ULYA 2V79A 3QPTA 4XSXF 2XRNA 2IRFG 4IHSA 4NQWA 1IRGA 5HS8A 2FXAA 5LEJA 1B4AA 2JT1A 3IWFA 3F8BA 4HBLA 2X0LA 1OKRA 2ISZA 3HRTA 5LHHA 2RGVA 3KEOA 3FMQA 2YU3A 5F1RA 2EFWA 1I27A 3E5UA 1HBXG 4IHTA 4XLNF 4HA8A 5K5QA 3IL2A 5DDGA 3FF5A 1FPQA 4JQFA 1J59A 2FEZA 3KZZA 4LJZF 3IRQA 2XIGA 5JI6A 1QZYA 1H9TA 2LKPA 3TOAA 3RI4A 2F2EA 5BMZA 4LK0F 3GYHX 4UVBA 3D5LA 4G6QA 5L3EA 1PP7U 3L7WA 2HTJA 3WTWC 2D2WA 5KVRA 2A6HF 2DT5A 4M9SA 2XAQA 2EA4A 4OIOF 1XMAA 3GFMA 3SZTA 2GAUA 4RAZA 4N9IA 2XV4S 1U6GA 1DUXC 1QZZA 5F64A 4Z2YA 3Q5FA 3HOTA 1Z6TA 2XAGA 2PN6A 3RJPA 3VFZA 2VOOA 1TQMA 4HYEA 2HKOA 3EYIA 1MJBA 4DNCA 1OYWA 3F8CA 5K1YA 5LBQA 4MTDA 1YYVA 4E70A 1J75A 4KIBA 4EM0B 3LQQA 2KJCA 2PMHA 2FBHA 4OINF 3HTUA 3RIRA 2E1NA 5ED4A 3Q9VA 3J80K 3OOPA 1ZG3A 2EFNA 3HSRA 4EVIA 2MLGA 5D8LB 4Q47A 5H20A 3WTVC 2L54A 1X3UA 2M1BA 4YG2F 2CYYA 3DFGA 1F9NA 1YLFA 1R58A 5BQTA 4GXOA 1SFEA 2ETHA 3GW2A 3PFIA 5ILUA 3ISPA 2Z5UA 2RC4A 3MAJA 4AIKA 2AXLA 4GCVA 3RKYA 1EH8A 4WK8F 3KCCA 4UUVA 4L0ZB 1R1TA 4R1HA 1ZRCA 5E8IA 2H27A 5DCFA 4HQMA 3E6MA 4L5JA 5E1XA 2VC1A 5FD5A 3J80Z 1DPRA 3CJNA 4YIFA 4XLPF 4KDPA 5FLXK 3C18A 4MEXF 2H09A 4U88A 1LNWA 4M9ZA 4GYIA 3D0SA 1FSHA 3U1DA 2HS5A 1G6NA 1XD7A 1P4XA 1FBQA 3QU6A 2DI3A 3WTXC 4RB0A 2V9VA 4UNOA 2RNJA 2YR2A 2HGCA 4HLYA 4P9UA 1F5TA 1BN5A 2UXNA 1O7LA 3ML6A 1YO5C 5H6QA 3WGIA 3EQLF 3F8MA 5FLXZ 2L02A 2EA2A 3JSPA 3WTTC 2DK5A 1S29A 4HX8A 3I54A 2XAJA 4ESFA 4FX0A 1XGSA 3FZVA 2ZJ2A 2IJLA 5J6XA 2RN7A 2Y48A 4PZJA 2CQKA 3R61A 1YW8A 2GIVA 4GO1A 3DV8A 1RZ4A 2JRTA 1B9NA 4KA4A 4LG0A 4I01A 1D8KA 3R4KA 5LGTA 3ZMDA 3TOBA 2HYFA 3N97A 3ROUA 4UVAA 1FX7A 2VBYA 1IN5A 3DQVC 2IA2A 2EJRA 5ERIA 2MA3A 2QQBA 5DD8A 1D8JA 1O57A 5IT3A 5LHIA 2G7HA 2PG4A 3JTHA 2OZUA 1W5TA 1FP1D 1RUNA 3DEUA 3BPXA 4GGGA 2GQQA 3RKXA 3SHFA 2P5KA 4BQAA 3C7JA 3PQJA 1YG2A 3ECHA 5AIQA 1DP7P 3K0LA 3FMRA 3R0AA 5CVUA 2X4HA 3ZP5A 2H6BA 1UHWA 4M73A 1Y0UA 2A6EF 1P92A 4RAYA 4WWCA 2E1CA 3K9TA 4HX7A 4RGSA 5D5XB 4KN7X 1XGNA 1LB2A 1KQ0A 1LVAA 3QOPA 1D5VA 1B1BA 2GXGA 1FY7A 3ELKA 3DF8A 3F72A 2G9WA 3WG9A 2VBWA 5JVTA 3RTRA 5LGNA 1SFXA 3BJ6A 1KU2A 3TO6A 3LFKA 2HKXA 2O8XA 1ZAOA 1HW1A 1YW7A 4EQQA 4M74A 1LQ1A 1Z9CA 3O3KA 1S3JA 1IUYA 3V8LA 1P6RA 2VE8A 4G8XA 2PFBA 3HIFA 4UXNA 2O03A 5JFRA 1JHHA 3JW4A 2BYVE 2KIUA 1U8RA 1AWCA 3P7NA 2CO5A 3WTUC 4ENKA 4EV0A 4YIIA 3GO5A 3E5QA 1HW2A 1T2KA 2HYGD 5TJJA 3V7CA 2ZMEA 1FT9A 1YFHA 2NAZA 5K5OA 2P4WA 4ZZDA 1CF7A 1MKMA 3Q9SA 1XGMA 1K7AA 4IRGA 3O2PE 1AOYA 4L9JA 4L9TA 5EEGA 2RDPA 4S05A 1P4WA 2PQ8A 1BI2A 3KLNA 1WQ2A 4H0EA 2NNNA 1O3RA 4EJOA 2FBIA 2XAHA 4BHPA 1BIBA 3TGNA 4ASNA 3K1MA 2O0YA 1SD6A 2BGCA 2RQPA 4NHJA 3QP5A 3QPHA 2MC3A 3FMSA 4HV5A 1IXCA 2EV5A 3TKYA 3F6OA 3WTYC 2MH9A 1EH7A 4I7HA 5LRRA 1MD0A 4JBAA 4F7ZA 1YW9A 4DQ2A 1K78A 3ZN1A 3HRUA 2K4JA 2M5WA 1S8NA 2P6TA 1MDMB 3CTAA 3ZN0A 1Z1DA 3BP8A 4HLXA 1ZH5A 1HKTA 4P55A 1KU7A 4FT8A 2DFIA 2TDXA 2ZFWA 2WV0A 4L9VA 1J7KA 2LNBA 2MD5A 2ZXJA 4Q4ZF 2DTRA 1T39A 1IZ1A 4HDUA 4CO8A 4LG0B 2HFHA 1QNTA 3V8JA 2M30A 5HOOA 3OV8A 2FE3A 4OOIA 1IN8A 2WC2A 2H94A 3NRVA 4O6JA 2E7WA 4UV8A 3ERED 2ZNYA 3FXUA 4ZYHA 4U0VA 4I0AA 5IT9K 2YPRA 1GHCA 4LD5A 2RKHA 3KP6A 1R5HA 3MWMA 5ICFA 4XSZF 1LJ9A 2OBPA 2QLZA 2VONA 5L3FA 3GWZA 4ON0A 3LA3A 4G7OF 4YFXF 2Q8KA 4AVPA 2J5PA 5HLGA 2LDUA 3B02A 2EFOA 3GVAA 2VOPA 3HYIA 2K4BA 2W84A 2RVCA 2LF8A 3WTZA 5DUKA 2BBYA 3HSFA 3M8FA 4AIJA 1P2FA 1U2WA 3GEZA 3REOA 1BOAA 1B59A 5IT9Z 4KYWA 2O3FA 4G7ZF 1J2XA 2MLKA 1IN7A 2KKOA 1U3EM 3H3UA 4WXDA 4CICA 4NB5A 1L0OC 5LRSA 1GXQA 2JZYA 1USSA 1H9GA 2Q0OA 3HHHA 3E6BA 2D45A 3WE2A 2QZ8A 5A2QK 3G73A 5E1ZB 4IRIA 3N4MA 1QO0D 2VT3A 1HXDA 3CO6C 2UZKA 3DXJF 4MGRA 2DPUA 4P5OA 1ON1A 4BHCA 2HR3A 3F23A 3J7AO 1UHMA 2DU9A 2AS5F 2OA4A 1G3YA 3P9IA 2QM3A 4WXCA 2P5VA 3ZMZA 3U9GA 4G6DA 1KQ9A 5BS6A 2ZBKA 1XB4A 3NQOA 1JHFA 4UHTA 4HX4A 3I4PA 1HSJA 2ZMEB 4K2EA 1IW7F 4RB3C 1RI7A 6PAXA 1WKMA 1CF7B 2IT0A 2OQRA 5A2QZ 5CYVA 5D5UB 3RPQA 2F5CA 5HLIA 1EH6A 5KK1A 1MGTA 4A6DA 4A2UA 5E8GA 4QLCU 3C1DA 2JPBA 4OMYA 1TNSA 1L3LA 1ZN2A 4CGZA 1OYIA 2F5DA 4FHTA 2IPQX 1W4MA 1ODDA 4KUMA 2C6YA 2VODA 3T8RA 2YX4A 2HZTA 2FRHA 1O3SA 5D6FA 3ECOA 2XVCA 3R0JA 4RGUA 3GUDA 4EMSA 3F6VA 1FLIA 2QWWA 3I71A 1S6LA 5L3CA 4R8HA 1TBXA 2RV8A 3V7RA 1K78B 2LSOA 3PQKA 4O3MA 3ZMSA 1BJAA 4AD9A 3P9CA 4HV6A 4L5IA 3E97A 2FMLA 2VN2A 3JAMK 2E7XA 2DK8A 4CYDA 4M6XA 2Z33A 2Z99A 3FM3A 4A0XA 2L01A 3VODA 2COMA 1U5TA 2O6GE 2FOKA 3FHZA 4G94A 1ZRDA 2EK5A 3JSOA 3DPLC 1U5TC 1WWXA 2FU4A 1WRJA 2DO7A 1TW3A 3M7GA 4I09A 2NRAC 1R1VA 1B9MA 1BM9A 3HUGA 3TQNA 3ZMVA 2QUFA 3T0YA 2STTA 3IHUA 4KFCA 4O5VA 2A5YB 4UV9A 3JAMZ 3IKVA 4S04A 3I5UA 3LAPA 2CG4A 5LLQA 1FC3A 2R7FA 1KU9A 4ZZLA 1G3WA 3LA2A 1FYMA 2OU2A 2FF4A 1KYWA 5LHGA 1G4DA 1XCVA 1YIOA 4OIQF 4I02A 2XKOA 4CXFA 2DLLA 4PDKA 3BOQA 2NYXA 4ESBA 1UFMA 5ICEA 3MEXA 2K7LA 1XN7A 3I58A 3BROA 3W6KB 3WE3A 4ZYGA 4MTEA 3TDUC 4OIRF 1SFUA 5EEHA 1YTYA 5D8KB 4TV7A 2YSRA 2ESHA 3M9AA 2JSCA 4HDVA 3KE2A 2YX7A 1E17A 2VC0A 2LF7A 1MJAA 1WSUA 1J5YA 2PJPA 5HLHA 4BHBA 3I53A 1BI3A 2ADUA 2MH2A 4MNUA 2A69F 1ZG5A 1OR7A 3AAFA 3LQRA 3BWGA 3H92A 1UB9A 4HAMA 1TW2A 1PDNC 4KMFA 3SZPA 1FYKA 5D5VB 1XCBA 3KLOA 4A5NA 3L00A 1GVJA 2P7VB 2EB7A 1LDDA 3HOSA 4R79A 5DUIA 4EM2A 3IKTA 2NNYA 2CWEA 2ACJA 4QWQA 5CVJA 3E5XA 1H0MA 1OMIA 2XHKA 3QAHA 2VBZA 4YFNF 1FBSA 3P9KA 4HQEA 5BPDA 1JE8A 2HEOA 4ENJA 2DW4A 5HDNA 3E3VA 3JTGA 2F5EA 3TO7A 2HOEA 2FQ3A 2A61A 3I64A 1SD7A 2A68F 5FB2A 3LWFA 1YS6A 1Z05A 2VBXA 5FFXA 1BIAA 2L4MA 1IN6A 4I98B 2V1UA 5DCMA 1Z91A 3GLXA 1IF1A 3F21A 2K27A 3VEPA 4G7HF 3WGGA 2Z9OA 2QQ9A 3I0TA 4L0YB 4RB1A 1JXSA 4BAYA 4ZYDA 3MZYA 3RDIA 4KNYA 1TTYA 4IRHA 2Y75A 5CVRA 2R3SA 1J9IA 3T5XA 2F5FA 2GA2A 4ESJA 1UCRA 2V1DA 1FWZA 5DYMA 5HDGA 4L18B 5FD6A 1V3FA 1SMTA 2ESNA 3QP6A 5LGUA 2KIFA 1K79A 3VB2A 2PLYA 4EGYA 4N0BA 2CSOA 2OD5A 2MBFA 2OZ6A 3BZ6A 2EV0A 4AIHA 3SFZA 4PGGA 1F4KA 3HHGA 1RUOA 1U5TB 1Z6RA 2OAZA 5CVVA 2XAFA 3WGHA 2STWA 1HSTA 3F3XA 4OMZA 4EJVA 2GXBA 5DEQA 3E6DA 3RKWA 2HQNA 3M8EA 3TDZC 4Q48A 3VOEA 3BDDA 5HS9A 2WWYA 3BPVA 1LEBA 3EYYA 4WX9A 5L3BA 4YFKF 4U7DA 3NEUA 4HOBA 2EV6A 4AWXB 1D3YA 1W5SA 4A0YA 1QGPA 3T1BA 3ZPLA 1FOKA 1IAWA 4A0ZA 3KP7A 3F8NA 3IRRA 1XSXA 5BOXA 1SMYF 4XBFA 4HW0A 1YQAA 4D0PA 4G9YA 4EJUA 3W6JB 3SXYA 4FX4A 1SAXA 5F6FA 1W7PA 2W25A 3B73A 3EETA 4Y13A 5J8CA 1R36A 1I6XA 3FWEA 5ILSA 4RB2C 1ZGAA 4RGRA 1IXSB 1BBYA 1I1GA 2JTVA 5BPIA 3F22A 4MQ9F 2IA1A 3KP4A 5CJ9A 3WODF 4L9NA 5LEKA 4A6EA 5L3GA 1IRFA 2Z3YA 5E17F 1FSEA 2KJBA 5E18F 1KYZA 3GXOA 3KFWX 4UVCA 5D4RA 1FZPB 2HTSA 2VXZA 2Y0MA 2VT2A 2GZWA 4EJTA 3GF2A 3DKWA 3U2RA 1MJ9A 1KQ8A 2K02A 3LA7A 4Q5SF 2A3SA 3I59A 3T8TA 2WTEA 1HW5A 4ZYEA 4M72A 5JR3A 1HQCA 3V7SA 5ICGA 3L09A 2QENA 3KP2A 2HDCA 5DD4A 5HS7A 2UXXA 3FXRA 1LDJA 1YS7A 4BH9A 2DBBA 1I1SA 4MHGA 1HKSA 1STZA 4LMYA 1OYYA 2R7DA 1ZARA 1TQIA 2DAOA 2M87A 3WU1B 1GXPA 2P5LC 3V4GA 3BY6A 1SD4A 5D4SA 5HVQC 1BC7C 1FP2A 2NS0A 5E1WA 4LLGF 3RYPA 5K5RA 2ZO4A 4IVNA 3GZ6A 1U78A 3KP3A 2V1XA 3CUOA 1ZLKA 4WCGA 2QBYA 2JPCA 1MZBA 1S7OA 4LB6B 1KGSA 1R23A 3DPTA 3J81K 2BV6A 1JGSA 4WXHA 1S7AA 4B8XA 1RIOH 2FA5A 1R00A 2P6SA 3V8KA 5D5WB 4LK1F 4IXAA 2ELHA 1C0WA 1HKQA 2QYOA 4BNCA 3MFKA 5DCMB 2OQGA 2XKPA 4KMUX 1ZLJA 1ZYRF 1P4AA 1PUEE 1DPUA 1FYLA 4OIPF 1KA8A 1CGPA 3CUQA 4XRFA 3L2CA 3MQ0A 1VTNC 2VE9A 3GFLA 5H6RA 2K86A 3GFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJO A;  3QRF F;  4P9F A;  3CUQ C;  4KIG A;  2PI0 A;  4GYG A;  1Q1H A;  3J81 Z;  3HTS B;  2ISY A;  2L3D A;  3HSE A;  3FX3 A;  1XSV A;  1MDM A;  3C3W A;  4OU0 A;  5E20 A;  2W85 A;  3DP7 A;  2L4A A;  4IJA A;  2CW0 F;  1T0F A;  1LEA A;  4CHU A;  3E6C C;  1A04 A;  1XGO A;  1ZRF A;  4MEY F;  3H3Z A;  4PCQ A;  1BI1 A;  1QBJ A;  4HZF A;  4Y17 A;  4U7B A;  4PGH A;  1E2X A;  2W24 A;  4ENM A;  1KU3 A;  4IF4 A;  1ON2 A;  4N9H A;  2IW5 A;  1V4R A;  3GX4 X;  1R7J A;  2PBI A;  3KEQ A;  4LLL A;  1Z7U A;  2DQR A;  2G7U A;  1ZHF A;  5D6E A;  2P8T A;  2XUB A;  4KIC A;  4ETS A;  1IXR C;  1FNN A;  3ABU A;  4RGX A;  3EDP A;  1IN4 A;  1TQP A;  4KT5 C;  3GZ5 A;  4M9X A;  2CGP A;  1G3S A;  4JK1 X;  2XRO A;  3ULQ B;  3K2Z A;  5TRD A;  3K69 A;  1G3T A;  3FXQ A;  4LLN A;  2DQL A;  1ONV A;  4CZZ A;  4LGW A;  4P96 A;  3SQN A;  5CVI A;  1XSD A;  2UWM A;  2XGX A;  3CO7 C;  5CLS A;  1W7P B;  3MCZ A;  4IPA A;  1ZGJ A;  1T38 A;  5JHU A;  3IWZ A;  2FSW A;  5J8F A;  1RNL A;  1UST A;  4RS8 A;  2D1V A;  3K1N A;  4EGZ A;  1NHA A;  3KZY A;  4U0Y A;  1EV7 A;  4KN4 X;  5HDK A;  1REP C;  3KP5 A;  3COA C;  4U0W A;  3BJA A;  3LAJ A;  5FFZ A;  1O3T A;  2B0L A;  1R5G A;  1T6S A;  4A5M A;  3R6S A;  4EJW A;  2EFQ A;  4EM1 A;  3KET A;  1ZRE A;  1B6A A;  5L3D A;  2O61 A;  2FNP A;  3G3Z A;  3MZH A;  2EWN A;  3RPU A;  2PEX A;  2IP2 A;  1I5Z A;  5DV5 A;  3I59 B;  2DPD A;  2FBK A;  2J5O A;  1ZG1 A;  5ICC A;  1XDS A;  1O3Q A;  1W7P D;  1XMK A;  3HRS A;  5AON A;  3F8F A;  5ILV A;  4WF2 A;  1OPC A;  4BXU A;  4M71 A;  3LST A;  3HRM A;  2GA1 A;  1TLH B;  2A07 F;  4I2O A;  3ZQ7 A;  2P7C B;  2KRF A;  1QQI A;  2XAS A;  3FM5 A;  3RYR A;  2BE5 F;  4ENN A;  4HF2 A;  4ZH4 F;  1TNT A;  2ZCW A;  2V6C A;  4LFU A;  1PP8 F;  2H6C A;  2ZKZ A;  3IC7 A;  2HWV A;  1F1Z A;  4BYY A;  3CLO A;  2GWR A;  4LB5 A;  1BI0 A;  4KIF A;  2QBY B;  5AIP A;  3TO9 A;  1LDK B;  2ZNZ A;  3ABT A;  4I0B A;  1SD5 A;  3ZMU A;  5FGM A;  2BEO A;  3R60 A;  2EFP A;  3WTS C;  2FNA A;  2KIM A;  4B09 A;  1FBU A;  1K6O A;  1WI9 A;  2HQR A;  3GFI A;  1QPM A;  2CFX A;  2FMY A;  5FO5 A;  4HF1 A;  1XDU A;  1DDN A;  3O6B B;  1O7F A;  2IVM A;  2D1H A;  3L9F A;  4M6Y A;  3S2W A;  4HF0 A;  1R22 A;  2W57 A;  3M1E A;  3CUQ B;  2PMU A;  1T98 A;  2QVO A;  4MQV A;  3WU0 A;  4Y15 A;  4CDG A;  4A12 A;  2M45 A;  2Q2E A;  3ZMT A;  1J0R A;  3CDH A;  2M8E A;  3EUH A;  2QQA A;  2IA0 A;  1R1U A;  1BC8 C;  3K1P A;  3QU3 A;  1ULY A;  2V79 A;  3QPT A;  4XSX F;  2XRN A;  2IRF G;  4IHS A;  4NQW A;  1IRG A;  5HS8 A;  2FXA A;  5LEJ A;  1B4A A;  2JT1 A;  3IWF A;  3F8B A;  4HBL A;  2X0L A;  1OKR A;  2ISZ A;  3HRT A;  5LHH A;  2RGV A;  3KEO A;  3FMQ A;  2YU3 A;  5F1R A;  2EFW A;  1I27 A;  3E5U A;  1HBX G;  4IHT A;  4XLN F;  4HA8 A;  5K5Q A;  3IL2 A;  5DDG A;  3FF5 A;  1FPQ A;  4JQF A;  1J59 A;  2FEZ A;  3KZZ A;  4LJZ F;  3IRQ A;  2XIG A;  5JI6 A;  1QZY A;  1H9T A;  2LKP A;  3TOA A;  3RI4 A;  2F2E A;  5BMZ A;  4LK0 F;  3GYH X;  4UVB A;  3D5L A;  4G6Q A;  5L3E A;  1PP7 U;  3L7W A;  2HTJ A;  3WTW C;  2D2W A;  5KVR A;  2A6H F;  2DT5 A;  4M9S A;  2XAQ A;  2EA4 A;  4OIO F;  1XMA A;  3GFM A;  3SZT A;  2GAU A;  4RAZ A;  4N9I A;  2XV4 S;  1U6G A;  1DUX C;  1QZZ A;  5F64 A;  4Z2Y A;  3Q5F A;  3HOT A;  1Z6T A;  2XAG A;  2PN6 A;  3RJP A;  3VFZ A;  2VOO A;  1TQM A;  4HYE A;  2HKO A;  3EYI A;  1MJB A;  4DNC A;  1OYW A;  3F8C A;  5K1Y A;  5LBQ A;  4MTD A;  1YYV A;  4E70 A;  1J75 A;  4KIB A;  4EM0 B;  3LQQ A;  2KJC A;  2PMH A;  2FBH A;  4OIN F;  3HTU A;  3RIR A;  2E1N A;  5ED4 A;  3Q9V A;  3J80 K;  3OOP A;  1ZG3 A;  2EFN A;  3HSR A;  4EVI A;  2MLG A;  5D8L B;  4Q47 A;  5H20 A;  3WTV C;  2L54 A;  1X3U A;  2M1B A;  4YG2 F;  2CYY A;  3DFG A;  1F9N A;  1YLF A;  1R58 A;  5BQT A;  4GXO A;  1SFE A;  2ETH A;  3GW2 A;  3PFI A;  5ILU A;  3ISP A;  2Z5U A;  2RC4 A;  3MAJ A;  4AIK A;  2AXL A;  4GCV A;  3RKY A;  1EH8 A;  4WK8 F;  3KCC A;  4UUV A;  4L0Z B;  1R1T A;  4R1H A;  1ZRC A;  5E8I A;  2H27 A;  5DCF A;  4HQM A;  3E6M A;  4L5J A;  5E1X A;  2VC1 A;  5FD5 A;  3J80 Z;  1DPR A;  3CJN A;  4YIF A;  4XLP F;  4KDP A;  5FLX K;  3C18 A;  4MEX F;  2H09 A;  4U88 A;  1LNW A;  4M9Z A;  4GYI A;  3D0S A;  1FSH A;  3U1D A;  2HS5 A;  1G6N A;  1XD7 A;  1P4X A;  1FBQ A;  3QU6 A;  2DI3 A;  3WTX C;  4RB0 A;  2V9V A;  4UNO A;  2RNJ A;  2YR2 A;  2HGC A;  4HLY A;  4P9U A;  1F5T A;  1BN5 A;  2UXN A;  1O7L A;  3ML6 A;  1YO5 C;  5H6Q A;  3WGI A;  3EQL F;  3F8M A;  5FLX Z;  2L02 A;  2EA2 A;  3JSP A;  3WTT C;  2DK5 A;  1S29 A;  4HX8 A;  3I54 A;  2XAJ A;  4ESF A;  4FX0 A;  1XGS A;  3FZV A;  2ZJ2 A;  2IJL A;  5J6X A;  2RN7 A;  2Y48 A;  4PZJ A;  2CQK A;  3R61 A;  1YW8 A;  2GIV A;  4GO1 A;  3DV8 A;  1RZ4 A;  2JRT A;  1B9N A;  4KA4 A;  4LG0 A;  4I01 A;  1D8K A;  3R4K A;  5LGT A;  3ZMD A;  3TOB A;  2HYF A;  3N97 A;  3ROU A;  4UVA A;  1FX7 A;  2VBY A;  1IN5 A;  3DQV C;  2IA2 A;  2EJR A;  5ERI A;  2MA3 A;  2QQB A;  5DD8 A;  1D8J A;  1O57 A;  5IT3 A;  5LHI A;  2G7H A;  2PG4 A;  3JTH A;  2OZU A;  1W5T A;  1FP1 D;  1RUN A;  3DEU A;  3BPX A;  4GGG A;  2GQQ A;  3RKX A;  3SHF A;  2P5K A;  4BQA A;  3C7J A;  3PQJ A;  1YG2 A;  3ECH A;  5AIQ A;  1DP7 P;  3K0L A;  3FMR A;  3R0A A;  5CVU A;  2X4H A;  3ZP5 A;  2H6B A;  1UHW A;  4M73 A;  1Y0U A;  2A6E F;  1P92 A;  4RAY A;  4WWC A;  2E1C A;  3K9T A;  4HX7 A;  4RGS A;  5D5X B;  4KN7 X;  1XGN A;  1LB2 A;  1KQ0 A;  1LVA A;  3QOP A;  1D5V A;  1B1B A;  2GXG A;  1FY7 A;  3ELK A;  3DF8 A;  3F72 A;  2G9W A;  3WG9 A;  2VBW A;  5JVT A;  3RTR A;  5LGN A;  1SFX A;  3BJ6 A;  1KU2 A;  3TO6 A;  3LFK A;  2HKX A;  2O8X A;  1ZAO A;  1HW1 A;  1YW7 A;  4EQQ A;  4M74 A;  1LQ1 A;  1Z9C A;  3O3K A;  1S3J A;  1IUY A;  3V8L A;  1P6R A;  2VE8 A;  4G8X A;  2PFB A;  3HIF A;  4UXN A;  2O03 A;  5JFR A;  1JHH A;  3JW4 A;  2BYV E;  2KIU A;  1U8R A;  1AWC A;  3P7N A;  2CO5 A;  3WTU C;  4ENK A;  4EV0 A;  4YII A;  3GO5 A;  3E5Q A;  1HW2 A;  1T2K A;  2HYG D;  5TJJ A;  3V7C A;  2ZME A;  1FT9 A;  1YFH A;  2NAZ A;  5K5O A;  2P4W A;  4ZZD A;  1CF7 A;  1MKM A;  3Q9S A;  1XGM A;  1K7A A;  4IRG A;  3O2P E;  1AOY A;  4L9J A;  4L9T A;  5EEG A;  2RDP A;  4S05 A;  1P4W A;  2PQ8 A;  1BI2 A;  3KLN A;  1WQ2 A;  4H0E A;  2NNN A;  1O3R A;  4EJO A;  2FBI A;  2XAH A;  4BHP A;  1BIB A;  3TGN A;  4ASN A;  3K1M A;  2O0Y A;  1SD6 A;  2BGC A;  2RQP A;  4NHJ A;  3QP5 A;  3QPH A;  2MC3 A;  3FMS A;  4HV5 A;  1IXC A;  2EV5 A;  3TKY A;  3F6O A;  3WTY C;  2MH9 A;  1EH7 A;  4I7H A;  5LRR A;  1MD0 A;  4JBA A;  4F7Z A;  1YW9 A;  4DQ2 A;  1K78 A;  3ZN1 A;  3HRU A;  2K4J A;  2M5W A;  1S8N A;  2P6T A;  1MDM B;  3CTA A;  3ZN0 A;  1Z1D A;  3BP8 A;  4HLX A;  1ZH5 A;  1HKT A;  4P55 A;  1KU7 A;  4FT8 A;  2DFI A;  2TDX A;  2ZFW A;  2WV0 A;  4L9V A;  1J7K A;  2LNB A;  2MD5 A;  2ZXJ A;  4Q4Z F;  2DTR A;  1T39 A;  1IZ1 A;  4HDU A;  4CO8 A;  4LG0 B;  2HFH A;  1QNT A;  3V8J A;  2M30 A;  5HOO A;  3OV8 A;  2FE3 A;  4OOI A;  1IN8 A;  2WC2 A;  2H94 A;  3NRV A;  4O6J A;  2E7W A;  4UV8 A;  3ERE D;  2ZNY A;  3FXU A;  4ZYH A;  4U0V A;  4I0A A;  5IT9 K;  2YPR A;  1GHC A;  4LD5 A;  2RKH A;  3KP6 A;  1R5H A;  3MWM A;  5ICF A;  4XSZ F;  1LJ9 A;  2OBP A;  2QLZ A;  2VON A;  5L3F A;  3GWZ A;  4ON0 A;  3LA3 A;  4G7O F;  4YFX F;  2Q8K A;  4AVP A;  2J5P A;  5HLG A;  2LDU A;  3B02 A;  2EFO A;  3GVA A;  2VOP A;  3HYI A;  2K4B A;  2W84 A;  2RVC A;  2LF8 A;  3WTZ A;  5DUK A;  2BBY A;  3HSF A;  3M8F A;  4AIJ A;  1P2F A;  1U2W A;  3GEZ A;  3REO A;  1BOA A;  1B59 A;  5IT9 Z;  4KYW A;  2O3F A;  4G7Z F;  1J2X A;  2MLK A;  1IN7 A;  2KKO A;  1U3E M;  3H3U A;  4WXD A;  4CIC A;  4NB5 A;  1L0O C;  5LRS A;  1GXQ A;  2JZY A;  1USS A;  1H9G A;  2Q0O A;  3HHH A;  3E6B A;  2D45 A;  3WE2 A;  2QZ8 A;  5A2Q K;  3G73 A;  5E1Z B;  4IRI A;  3N4M A;  1QO0 D;  2VT3 A;  1HXD A;  3CO6 C;  2UZK A;  3DXJ F;  4MGR A;  2DPU A;  4P5O A;  1ON1 A;  4BHC A;  2HR3 A;  3F23 A;  3J7A O;  1UHM A;  2DU9 A;  2AS5 F;  2OA4 A;  1G3Y A;  3P9I A;  2QM3 A;  4WXC A;  2P5V A;  3ZMZ A;  3U9G A;  4G6D A;  1KQ9 A;  5BS6 A;  2ZBK A;  1XB4 A;  3NQO A;  1JHF A;  4UHT A;  4HX4 A;  3I4P A;  1HSJ A;  2ZME B;  4K2E A;  1IW7 F;  4RB3 C;  1RI7 A;  6PAX A;  1WKM A;  1CF7 B;  2IT0 A;  2OQR A;  5A2Q Z;  5CYV A;  5D5U B;  3RPQ A;  2F5C A;  5HLI A;  1EH6 A;  5KK1 A;  1MGT A;  4A6D A;  4A2U A;  5E8G A;  4QLC U;  3C1D A;  2JPB A;  4OMY A;  1TNS A;  1L3L A;  1ZN2 A;  4CGZ A;  1OYI A;  2F5D A;  4FHT A;  2IPQ X;  1W4M A;  1ODD A;  4KUM A;  2C6Y A;  2VOD A;  3T8R A;  2YX4 A;  2HZT A;  2FRH A;  1O3S A;  5D6F A;  3ECO A;  2XVC A;  3R0J A;  4RGU A;  3GUD A;  4EMS A;  3F6V A;  1FLI A;  2QWW A;  3I71 A;  1S6L A;  5L3C A;  4R8H A;  1TBX A;  2RV8 A;  3V7R A;  1K78 B;  2LSO A;  3PQK A;  4O3M A;  3ZMS A;  1BJA A;  4AD9 A;  3P9C A;  4HV6 A;  4L5I A;  3E97 A;  2FML A;  2VN2 A;  3JAM K;  2E7X A;  2DK8 A;  4CYD A;  4M6X A;  2Z33 A;  2Z99 A;  3FM3 A;  4A0X A;  2L01 A;  3VOD A;  2COM A;  1U5T A;  2O6G E;  2FOK A;  3FHZ A;  4G94 A;  1ZRD A;  2EK5 A;  3JSO A;  3DPL C;  1U5T C;  1WWX A;  2FU4 A;  1WRJ A;  2DO7 A;  1TW3 A;  3M7G A;  4I09 A;  2NRA C;  1R1V A;  1B9M A;  1BM9 A;  3HUG A;  3TQN A;  3ZMV A;  2QUF A;  3T0Y A;  2STT A;  3IHU A;  4KFC A;  4O5V A;  2A5Y B;  4UV9 A;  3JAM Z;  3IKV A;  4S04 A;  3I5U A;  3LAP A;  2CG4 A;  5LLQ A;  1FC3 A;  2R7F A;  1KU9 A;  4ZZL A;  1G3W A;  3LA2 A;  1FYM A;  2OU2 A;  2FF4 A;  1KYW A;  5LHG A;  1G4D A;  1XCV A;  1YIO A;  4OIQ F;  4I02 A;  2XKO A;  4CXF A;  2DLL A;  4PDK A;  3BOQ A;  2NYX A;  4ESB A;  1UFM A;  5ICE A;  3MEX A;  2K7L A;  1XN7 A;  3I58 A;  3BRO A;  3W6K B;  3WE3 A;  4ZYG A;  4MTE A;  3TDU C;  4OIR F;  1SFU A;  5EEH A;  1YTY A;  5D8K B;  4TV7 A;  2YSR A;  2ESH A;  3M9A A;  2JSC A;  4HDV A;  3KE2 A;  2YX7 A;  1E17 A;  2VC0 A;  2LF7 A;  1MJA A;  1WSU A;  1J5Y A;  2PJP A;  5HLH A;  4BHB A;  3I53 A;  1BI3 A;  2ADU A;  2MH2 A;  4MNU A;  2A69 F;  1ZG5 A;  1OR7 A;  3AAF A;  3LQR A;  3BWG A;  3H92 A;  1UB9 A;  4HAM A;  1TW2 A;  1PDN C;  4KMF A;  3SZP A;  1FYK A;  5D5V B;  1XCB A;  3KLO A;  4A5N A;  3L00 A;  1GVJ A;  2P7V B;  2EB7 A;  1LDD A;  3HOS A;  4R79 A;  5DUI A;  4EM2 A;  3IKT A;  2NNY A;  2CWE A;  2ACJ A;  4QWQ A;  5CVJ A;  3E5X A;  1H0M A;  1OMI A;  2XHK A;  3QAH A;  2VBZ A;  4YFN F;  1FBS A;  3P9K A;  4HQE A;  5BPD A;  1JE8 A;  2HEO A;  4ENJ A;  2DW4 A;  5HDN A;  3E3V A;  3JTG A;  2F5E A;  3TO7 A;  2HOE A;  2FQ3 A;  2A61 A;  3I64 A;  1SD7 A;  2A68 F;  5FB2 A;  3LWF A;  1YS6 A;  1Z05 A;  2VBX A;  5FFX A;  1BIA A;  2L4M A;  1IN6 A;  4I98 B;  2V1U A;  5DCM A;  1Z91 A;  3GLX A;  1IF1 A;  3F21 A;  2K27 A;  3VEP A;  4G7H F;  3WGG A;  2Z9O A;  2QQ9 A;  3I0T A;  4L0Y B;  4RB1 A;  1JXS A;  4BAY A;  4ZYD A;  3MZY A;  3RDI A;  4KNY A;  1TTY A;  4IRH A;  2Y75 A;  5CVR A;  2R3S A;  1J9I A;  3T5X A;  2F5F A;  2GA2 A;  4ESJ A;  1UCR A;  2V1D A;  1FWZ A;  5DYM A;  5HDG A;  4L18 B;  5FD6 A;  1V3F A;  1SMT A;  2ESN A;  3QP6 A;  5LGU A;  2KIF A;  1K79 A;  3VB2 A;  2PLY A;  4EGY A;  4N0B A;  2CSO A;  2OD5 A;  2MBF A;  2OZ6 A;  3BZ6 A;  2EV0 A;  4AIH A;  3SFZ A;  4PGG A;  1F4K A;  3HHG A;  1RUO A;  1U5T B;  1Z6R A;  2OAZ A;  5CVV A;  2XAF A;  3WGH A;  2STW A;  1HST A;  3F3X A;  4OMZ A;  4EJV A;  2GXB A;  5DEQ A;  3E6D A;  3RKW A;  2HQN A;  3M8E A;  3TDZ C;  4Q48 A;  3VOE A;  3BDD A;  5HS9 A;  2WWY A;  3BPV A;  1LEB A;  3EYY A;  4WX9 A;  5L3B A;  4YFK F;  4U7D A;  3NEU A;  4HOB A;  2EV6 A;  4AWX B;  1D3Y A;  1W5S A;  4A0Y A;  1QGP A;  3T1B A;  3ZPL A;  1FOK A;  1IAW A;  4A0Z A;  3KP7 A;  3F8N A;  3IRR A;  1XSX A;  5BOX A;  1SMY F;  4XBF A;  4HW0 A;  1YQA A;  4D0P A;  4G9Y A;  4EJU A;  3W6J B;  3SXY A;  4FX4 A;  1SAX A;  5F6F A;  1W7P A;  2W25 A;  3B73 A;  3EET A;  4Y13 A;  5J8C A;  1R36 A;  1I6X A;  3FWE A;  5ILS A;  4RB2 C;  1ZGA A;  4RGR A;  1IXS B;  1BBY A;  1I1G A;  2JTV A;  5BPI A;  3F22 A;  4MQ9 F;  2IA1 A;  3KP4 A;  5CJ9 A;  3WOD F;  4L9N A;  5LEK A;  4A6E A;  5L3G A;  1IRF A;  2Z3Y A;  5E17 F;  1FSE A;  2KJB A;  5E18 F;  1KYZ A;  3GXO A;  3KFW X;  4UVC A;  5D4R A;  1FZP B;  2HTS A;  2VXZ A;  2Y0M A;  2VT2 A;  2GZW A;  4EJT A;  3GF2 A;  3DKW A;  3U2R A;  1MJ9 A;  1KQ8 A;  2K02 A;  3LA7 A;  4Q5S F;  2A3S A;  3I59 A;  3T8T A;  2WTE A;  1HW5 A;  4ZYE A;  4M72 A;  5JR3 A;  1HQC A;  3V7S A;  5ICG A;  3L09 A;  2QEN A;  3KP2 A;  2HDC A;  5DD4 A;  5HS7 A;  2UXX A;  3FXR A;  1LDJ A;  1YS7 A;  4BH9 A;  2DBB A;  1I1S A;  4MHG A;  1HKS A;  1STZ A;  4LMY A;  1OYY A;  2R7D A;  1ZAR A;  1TQI A;  2DAO A;  2M87 A;  3WU1 B;  1GXP A;  2P5L C;  3V4G A;  3BY6 A;  1SD4 A;  5D4S A;  5HVQ C;  1BC7 C;  1FP2 A;  2NS0 A;  5E1W A;  4LLG F;  3RYP A;  5K5R A;  2ZO4 A;  4IVN A;  3GZ6 A;  1U78 A;  3KP3 A;  2V1X A;  3CUO A;  1ZLK A;  4WCG A;  2QBY A;  2JPC A;  1MZB A;  1S7O A;  4LB6 B;  1KGS A;  1R23 A;  3DPT A;  3J81 K;  2BV6 A;  1JGS A;  4WXH A;  1S7A A;  4B8X A;  1RIO H;  2FA5 A;  1R00 A;  2P6S A;  3V8K A;  5D5W B;  4LK1 F;  4IXA A;  2ELH A;  1C0W A;  1HKQ A;  2QYO A;  4BNC A;  3MFK A;  5DCM B;  2OQG A;  2XKP A;  4KMU X;  1ZLJ A;  1ZYR F;  1P4A A;  1PUE E;  1DPU A;  1FYL A;  4OIP F;  1KA8 A;  1CGP A;  3CUQ A;  4XRF A;  3L2C A;  3MQ0 A;  1VTN C;  2VE9 A;  3GFL A;  5H6R A;  2K86 A;  3GFJ A; 
#chains in the Genus database with same CATH topology
 3BJO A;  2WB1 A;  2CJJ A;  3G1O A;  3QRF F;  4RMN A;  3L2V A;  1YX5 A;  1MND A;  4FET A;  4P9F A;  1VQ9 I;  2F4O B;  3CUQ C;  1JJ8 C;  4KIG A;  3IAS 2;  2PI0 A;  3H35 A;  3QPL A;  1XX5 A;  4GYG A;  2EBI A;  3MZ8 A;  1SAU A;  1Q1H A;  4QPQ A;  1K4T A;  2EH3 A;  2MAB A;  3J81 Z;  3HTS B;  2ISY A;  4IZZ A;  2L3D A;  4IKF A;  1R5I D;  3HSE A;  3FX3 A;  1XSV A;  1MDM A;  3C3W A;  2ID6 A;  3F0C A;  4G12 A;  5EZH A;  1JKQ C;  4OU0 A;  5E20 A;  2W85 A;  1IV6 A;  3SDG A;  5GP9 A;  1Z77 A;  3CMM A;  4ZJZ A;  5EF6 A;  4M3F A;  1ETV A;  3DP7 A;  4IHW A;  2L4A A;  2P81 A;  4IJA A;  2CW0 F;  3Q3S A;  1T0F A;  1LEA A;  1WGX A;  4CHU A;  2M0C A;  1VQP I;  3E6C C;  2CV0 A;  1VFC A;  1A04 A;  3J7A Y;  3TED A;  1ZR2 A;  1XGO A;  3H5N A;  4A3G J;  1ZRF A;  2XGD A;  3HZJ A;  1T0F C;  4PJJ A;  4MEY F;  3A2K A;  1ZKG A;  3BCB A;  1FMW A;  3H3Z A;  4PCQ A;  1BI1 A;  3E7L A;  4BEH B;  5DM6 F;  5J47 A;  2R7V A;  3I3L A;  1QBJ A;  4HZF A;  4Y17 A;  3IAM 2;  3CCJ I;  4U7B A;  2JWT A;  3HXL A;  4PGH A;  1E2X A;  1X4O A;  2VLA A;  4BS9 A;  4XRS A;  2V9P A;  2K9S A;  2W24 A;  2Y31 A;  3DLL F;  2L0K A;  4ENM A;  1KU3 A;  4IF4 A;  1ON2 A;  1X2M A;  2JUC A;  4N9H A;  2IW5 A;  1V4R A;  2MD0 A;  3GX4 X;  1R7J A;  1X2N A;  4UUS A;  2PBI A;  1K4S A;  3LMM A;  4XKB A;  3KEQ A;  2BOL A;  2JA5 J;  4LLL A;  5E3M A;  1Z7U A;  1NTC A;  2JVG A;  3IH3 A;  2DQR A;  2G7U A;  1ZHF A;  3M07 A;  2P8T A;  5D6E A;  2LLK A;  2XUB A;  2NOJ B;  1M1E B;  3GTK J;  4KIC A;  1ETY A;  3EUA A;  2KQR A;  1IXR C;  3K4J A;  4M3E A;  4ETS A;  5KNL A;  3A0H C;  3CJR B;  1FNN A;  1P7I A;  3ABU A;  5FRM A;  4RGX A;  4GRI A;  3EDP A;  1IN4 A;  1TQP A;  4KT5 C;  3GZ5 A;  4M9X A;  2CGP A;  1X58 A;  1G3S A;  3NWS A;  4JK1 X;  2XRO A;  3ULQ B;  3K2Z A;  5TRD A;  2IGK A;  3K69 A;  1G3T A;  3FXQ A;  4NDL A;  4LLN A;  2DQL A;  1ONV A;  4CZZ A;  4LGW A;  1U8B A;  4P96 A;  3SQN A;  5CVI A;  1XSD A;  5F27 A;  2UWM A;  2XGX A;  3CO7 C;  3HOU J;  5CLS A;  3F9K A;  1W7P B;  3MCZ A;  2R7R A;  4IPA A;  1ZGJ A;  3RZO J;  1T38 A;  5JHU A;  1VQ7 I;  3IWZ A;  2FSW A;  2XRL A;  5J8F A;  1RNL A;  1UST A;  3H5A A;  2E60 A;  4Z6Y A;  4RS8 A;  1IG7 A;  2D1V A;  3S17 J;  5FLV A;  5IP7 J;  1I39 A;  3K1N A;  2R7S A;  3HJE A;  3QWL A;  1YJN I;  2LTP A;  3K4K A;  3H0D A;  4EGZ A;  3OYG A;  1NHA A;  3KZY A;  3MVP A;  4E7L A;  2QSF X;  4U0Y A;  1OCO H;  1EV7 A;  4KN4 X;  5B3S H;  5HDK A;  1REP C;  2WV1 A;  3KP5 A;  3COA C;  1FEX A;  4U0W A;  1AKH B;  3BJA A;  3LAJ A;  5FFZ A;  2ZJQ F;  1VQO I;  1O3T A;  2B0L A;  2L9S A;  2LP0 A;  1R5G A;  5GPA A;  2QCO A;  1T6S A;  4A5M A;  3R6S A;  4EJW A;  2EFQ A;  4LOC A;  4EM1 A;  5FLM J;  3KET A;  1B6A A;  2LKS A;  3BZK A;  4HPQ A;  3OYA A;  1LPQ A;  3L2Q A;  1FOW A;  5L3D A;  2RRE A;  4ITV A;  2O61 A;  2FNP A;  3G3Z A;  3MZH A;  2EWN A;  3RPU A;  4S0H B;  2PEX A;  2IP2 A;  2MC4 A;  1HC8 A;  1I5Z A;  5DV5 A;  3I59 B;  2DPD A;  3OS1 A;  2FBK A;  4BE2 A;  5EGO A;  3LSH A;  2J5O A;  3BCA A;  1ZG1 A;  3A01 A;  3KX2 A;  1W0T A;  5ICC A;  1ETK A;  2LK2 A;  1XDS A;  2DMQ A;  1O3Q A;  1RKT A;  2PJR B;  4C2T A;  1W7P D;  3VPR A;  2E2J J;  1GLN A;  1XMK A;  3BR3 A;  3HRS A;  1LE8 A;  1SVM A;  5AON A;  5J1Y A;  4G6T B;  4JX4 A;  4D5F A;  1A36 A;  3F8F A;  5ILV A;  4WF2 A;  3HPH A;  1OPC A;  4BXU A;  1MH4 A;  1QHG A;  2LH9 A;  3LST A;  3HRM A;  4M71 A;  2GA1 A;  1TLH B;  2A07 F;  4I2O A;  3ZQ7 A;  4ABZ A;  2P7C B;  1F43 A;  5IP9 J;  2KRF A;  1QQI A;  2XAS A;  3FM5 A;  5IYC J;  4FE7 A;  4XLH A;  3RYR A;  3TBI A;  4A3L J;  2DCE A;  1RKW A;  3OYJ A;  3ZQL A;  1VQN I;  2B63 J;  2BE5 F;  5EG0 B;  1Z21 A;  4ENN A;  1XS9 A;  2I8D A;  4HF2 A;  3WHB A;  4ZH4 F;  2DMU A;  1TNT A;  2CQN A;  4J01 A;  5B1B H;  2ZCW A;  2V6C A;  2HDD A;  4MFE A;  4LFU A;  1GVD A;  2VI6 A;  4PFP A;  1PP8 F;  3GTO J;  5FKL A;  2H6C A;  4FCY A;  2ZKZ A;  3IC7 A;  1D1C A;  2R7Z J;  2HWV A;  1Y1V J;  1F1Z A;  4BYY A;  1S9H A;  3CLO A;  2GWR A;  3OSG A;  4W1U A;  1IUF A;  4LB5 A;  2DT7 B;  1BI0 A;  2KRC A;  4KIF A;  1X1P A;  4XM3 A;  2QBY B;  5AIP A;  3TO9 A;  2R4G A;  1JT6 A;  1LDK B;  2ZNZ A;  2VQG A;  3ABT A;  4I0B A;  1SD5 A;  2R7Q A;  3ZMU A;  5FGM A;  2BEO A;  2FUG 2;  2M7B A;  3R60 A;  5B5E C;  1XC5 A;  2EFP A;  4GFB A;  3GZN B;  3WTS C;  3ZXS A;  1NK3 P;  2FNA A;  2KIM A;  3BQZ A;  4JX5 A;  4B09 A;  1FBU A;  1K6O A;  4HEA 2;  1MBK A;  2X9D A;  2HYJ A;  1DU6 A;  1TT5 B;  1WI9 A;  4E7I A;  2HQR A;  4A3E J;  3GFI A;  1QPM A;  2CFX A;  2FMY A;  2DOF A;  3K4M A;  3OYH A;  1X1C A;  5FO5 A;  1UEL B;  1EJ9 A;  5M3F J;  3HB9 A;  4M6V A;  1DU0 A;  3OOU A;  4HF1 A;  1XDU A;  3ESW B;  1DDN A;  4RBO A;  3O6B B;  1O7F A;  2IVM A;  2EZL A;  1UG2 A;  2D1H A;  3L9F A;  4M6Y A;  3S2W A;  2HOS A;  3CP8 A;  4HF0 A;  1R22 A;  1Z7L A;  4Y4R A;  2VIX A;  2W57 A;  1W5C C;  2JRM A;  3D5R C;  3M1E A;  3CUQ B;  2PMU A;  1T98 A;  2QVO A;  4MQV A;  3WU0 A;  4Y15 A;  4CDG A;  4BXF A;  2M45 A;  4A12 A;  2HVQ A;  3TP0 A;  4UY8 I;  2Q2E A;  2TRT A;  3ZMT A;  4CH7 A;  1J0R A;  5KAI C;  3CDH A;  2M8E A;  1QHH D;  4RM3 A;  3EUH A;  2L9V A;  3RKQ A;  2X1E A;  4A3C J;  3GTJ J;  2ME0 A;  1OCC H;  2ECC A;  2IA0 A;  1R1U A;  2QQA A;  3I56 I;  3K1P A;  1BC8 C;  2E2H J;  2NVT J;  2DMT A;  3QU3 A;  1ULY A;  2V79 A;  3QPT A;  1IDY A;  1VQ4 I;  4DZJ A;  3EUH C;  4XSX F;  2IRF G;  2GOX B;  4IHS A;  4NQW A;  1IRG A;  2BXY A;  2LMD A;  1MMS A;  5HS8 A;  2FXA A;  5LEJ A;  1B4A A;  2JT1 A;  3IWF A;  3SDB A;  3F8B A;  4IHV A;  2DJN A;  1IRX A;  4HBL A;  2X0L A;  2HPI A;  1F36 A;  1OKR A;  2ISZ A;  3DLA A;  5E3L A;  3HRT A;  1OCR H;  1R4M B;  3LSM A;  5K7F A;  5LHH A;  2RGV A;  2X1C A;  1LFP A;  3KEO A;  2M0M A;  2YU3 A;  3FMQ A;  5F1R A;  1S7E A;  2EFW A;  2E5Z A;  1I27 A;  2DYS H;  2FQ4 A;  3E5U A;  4CCK A;  1HBX G;  2CW7 A;  2L7Z A;  1RET A;  4IHT A;  4XRM A;  3HKZ N;  4XLN F;  4B48 A;  4HA8 A;  4V2F A;  3QPS A;  2VKV A;  2Y30 A;  2W48 A;  3K70 C;  5K5Q A;  3JRD A;  1G59 A;  3KEY A;  3JRF A;  3IL2 A;  1MW7 A;  4ZTF A;  5DDG A;  3FF5 A;  1FPQ A;  4JQF A;  5FKK A;  1J59 A;  2FEZ A;  3KZZ A;  4LJZ F;  3IRQ A;  2QA4 I;  4BDY A;  2HOT A;  4UUS B;  5F1J A;  2XIG A;  5JI6 A;  4E6K G;  2Y0S N;  3SYT A;  1QZY A;  1H9T A;  2LKP A;  4ZC3 A;  3TOA A;  3RI4 A;  1VQK I;  1UJ8 A;  3GTM J;  2KZG A;  2DT6 A;  2F2E A;  4EAT A;  2IEK A;  1PVE A;  2AQF A;  4PFO A;  3MKY B;  3I4M J;  5BMZ A;  4HNU A;  4LK0 F;  2XF6 A;  3HC7 A;  3GYH X;  2VJJ A;  1I3A A;  4UVB A;  3D5L A;  4G6Q A;  3HL2 A;  5L3E A;  1PP7 U;  3Q0W A;  1ETW A;  3L7W A;  2HTJ A;  3WTW C;  2K9M A;  2D2W A;  1CQT A;  5KVR A;  2KDZ A;  2A6H F;  2DT5 A;  4M9S A;  2XAQ A;  2EA4 A;  1DGW Y;  2R7T A;  2XGC A;  4OIO F;  1XMA A;  3GFM A;  3SZT A;  2GAU A;  4RAZ A;  4N9I A;  2XV4 S;  2IS1 A;  1U6G A;  2BY2 A;  3K10 A;  1DUX C;  5FJ8 J;  1QZZ A;  3RCO A;  1MMA A;  4C2M J;  2M7A A;  5F64 A;  4Z2Y A;  3HOT A;  3Q5F A;  3IH2 A;  1T95 A;  1Z6T A;  1RES A;  1UZC A;  3BTL A;  2XAG A;  2PN6 A;  3RJP A;  3VFZ A;  2R7O A;  2VB6 A;  4DBQ A;  2VOO A;  3QOE A;  3S1N J;  1TQM A;  4HYE A;  2HKO A;  5EZG A;  3EYI A;  3GFL A;  2DA3 A;  1MJB A;  4DNC A;  1PUF A;  3CC2 I;  2VQH A;  3DU6 A;  1OYW A;  3F8C A;  3TL4 X;  2CV1 A;  4IX7 A;  5K1Y A;  5E3O A;  1Q1V A;  3OYL A;  2KMU A;  5LBQ A;  4MTD A;  4A3K J;  1YYV A;  3FDY A;  3MKZ A;  2B7E A;  4E70 A;  3NWT A;  1J75 A;  4KIB A;  4EM0 B;  2DMN A;  4OWR B;  1G8X A;  3LQQ A;  4UB8 C;  2NS7 A;  4E7H A;  2KJC A;  2PMH A;  2FBH A;  4OAZ A;  4OIN F;  1IV8 A;  3OYE A;  3BG7 A;  3HTU A;  2CMP A;  2W00 A;  3RIR A;  1VQ8 I;  4RLF A;  5JHF A;  2E1N A;  1TWH J;  4HG2 A;  5ED4 A;  3Q9V A;  3J80 K;  3OOP A;  1ZG3 A;  2EFN A;  3HSR A;  3ABM H;  4EVI A;  2MLG A;  5D8L B;  2E5N A;  4Q47 A;  5H20 A;  5GAD J;  3WTV C;  2L54 A;  1X3U A;  2M1B A;  4YG2 F;  2CYY A;  1EA3 A;  3HEF A;  4KIS A;  3DFG A;  5EGO B;  1F9N A;  2F4I A;  4DZP A;  3A01 B;  4IQ4 A;  1YLF A;  1R58 A;  3SEQ A;  4BJT A;  5BQT A;  3GTQ J;  1N25 A;  2V7F A;  4GXO A;  1SFE A;  2ETH A;  1BR1 A;  3GW2 A;  3K4C A;  3PFI A;  3U21 A;  2FJ1 A;  5IY5 H;  3L2U A;  3H9Q A;  5ILU A;  3ISP A;  4DYC A;  5JVG F;  2Z5U A;  4UB6 C;  2RAE A;  2DTZ A;  4DOZ A;  2RC4 A;  3MAJ A;  4BKX A;  4AIK A;  2AXL A;  1Z67 A;  2XPW A;  4GCV A;  3RKY A;  1EH8 A;  4MFD A;  3PNT A;  4WK8 F;  2JUG A;  1EF4 A;  3CCY A;  3KCC A;  3I55 I;  4UUV A;  1TWG J;  4L0Z B;  1R1T A;  5C4X J;  2BHZ A;  3AG3 H;  4R1H A;  1ZRC A;  2V4J C;  5E8I A;  2H27 A;  5DCF A;  4HQM A;  3E6M A;  4L5J A;  5E1X A;  1V55 H;  2VC1 A;  2JQ7 A;  3I4N J;  2OJE D;  5FD5 A;  3E0J B;  2YUS A;  2CQ7 A;  3J80 Z;  1DPR A;  3CJN A;  3DKX A;  4C3J J;  2OPT A;  4YIF A;  3PUB A;  3W2V A;  4XLP F;  4HST A;  4B4C A;  4KDP A;  5JLX A;  5FKO A;  5FLX K;  3C18 A;  4MEX F;  4CCJ A;  4RM2 A;  2HNH A;  3W2A A;  2H09 A;  3RPU D;  4U88 A;  1ERD A;  5DTD A;  1LNW A;  2CRG A;  1IDZ A;  3ZCO A;  4M9Z A;  4GYI A;  4AVZ A;  3D0S A;  1FSH A;  2EPF A;  3U1D A;  1NG6 A;  3S2H J;  4CZC A;  1TWF J;  2HS5 A;  1G6N A;  3VYS B;  2OTJ I;  1MBG A;  1XD7 A;  3OYB A;  2F6C A;  1ZRE A;  1P4X A;  1FBQ A;  3QU6 A;  2DI3 A;  3WTX C;  2DA6 A;  4HSR A;  1YIJ I;  3ZGK A;  4RB0 A;  2V9V A;  4UNO A;  1MBE A;  2RNJ A;  5KHD A;  3VWB A;  1JT0 A;  4LIV A;  3CQZ J;  4IHY A;  3S14 J;  2IS2 A;  2YR2 A;  2HGC A;  4HLY A;  4P9U A;  3BR0 A;  1F5T A;  1BN5 A;  2UXN A;  4XR6 A;  1O7L A;  5M3M J;  3ML6 A;  2CFO A;  3CME I;  3D5S C;  5H6Q A;  1YO5 C;  1MBF A;  3JCU C;  4XID A;  3WGI A;  3CJT B;  3EQL F;  1FTT A;  3CMY A;  3F8M A;  5FLX Z;  3UR3 C;  2Z1D A;  2M2E A;  2WY8 Q;  3BR6 A;  4C2U A;  2L02 A;  2EA2 A;  2IGO A;  2WAF A;  2DDA A;  3JSP A;  1MMD A;  4D7N A;  2X6Y A;  1ACI A;  5F04 A;  1GUU A;  4B3A A;  2Q2E B;  2X6W A;  3WTT C;  1R49 A;  4P1W A;  4Y33 A;  2OUM A;  3LSI A;  4BE0 A;  3DBH B;  1WJC A;  2DK5 A;  2LBF B;  1HOM A;  2RNG A;  4PJN A;  3OYK A;  1S29 A;  5F08 A;  4HX8 A;  2E34 A;  3I54 A;  2XAJ A;  1IRZ A;  4ESF A;  3QYF A;  4FX0 A;  1XGS A;  3FZV A;  3KYC B;  2ZJ2 A;  4BQN A;  2IJL A;  5J6X A;  3FXO A;  2RN7 A;  2HVS A;  2Y48 A;  4PZJ A;  2CQK A;  3GTL J;  2LRD A;  2IBD A;  2IGN A;  3R61 A;  3NAU A;  3OYM A;  2GBY A;  2X51 A;  1R71 A;  4NQW B;  5J1R A;  4RDU A;  1V5E A;  1ORK A;  1YW8 A;  2DA4 A;  2GIV A;  4GO1 A;  4E4H A;  5CPR B;  3DV8 A;  1RZ4 A;  2JRT A;  1B9N A;  1O4X A;  4KA4 A;  4LG0 A;  1NK2 P;  4I01 A;  2K3F A;  1D8K A;  3R4K A;  5LGT A;  3P5J A;  3ZMD A;  1A6I A;  2OC6 A;  2CUE A;  3TOB A;  2HYF A;  3N97 A;  3ROU A;  4UVA A;  2GLO A;  1FX7 A;  3VYT B;  2VBY A;  1IN5 A;  3B6A A;  1RR7 A;  3DQV C;  5E79 C;  2IA2 A;  4I99 C;  1JJ6 C;  4BQO A;  1BR4 A;  1V54 H;  2EJR A;  4V19 K;  5ERI A;  2MA3 A;  2QQB A;  5DD8 A;  4BDZ A;  1D8J A;  1O57 A;  5IT3 A;  2NS8 A;  3TMO A;  4X0G A;  5LHI A;  2G7H A;  2PG4 A;  3JTH A;  3FK7 A;  3DU5 A;  2OZU A;  3RSN A;  1VQ5 I;  1W5T A;  1FP1 D;  1RUN A;  3DEU A;  3BPX A;  4GGG A;  3OYI A;  2GQQ A;  3BTJ A;  3BG5 A;  3RKX A;  3SHF A;  2P5K A;  4BQA A;  2XF5 A;  3C7J A;  1KZH A;  1B8I A;  3VYU B;  3DBR B;  5M5Y J;  3QOD A;  1XTA A;  3PQJ A;  2WA0 A;  4F52 A;  2NVY J;  1YG2 A;  3ECH A;  3PUF A;  2M4K A;  2EZH A;  5AIQ A;  3S3N A;  3O8G A;  3W3C A;  4F92 B;  3UKG A;  1DP7 P;  3K0L A;  4JX6 A;  1W1W E;  9ANT A;  3BTI A;  5K7Z A;  2CUZ A;  3FMR A;  2P0W A;  3PSF A;  3R0A A;  3OL3 A;  1K6Y A;  5CVU A;  4PK4 A;  3DEW A;  2X4H A;  3ZP5 A;  2H6B A;  2LRE A;  1UHW A;  4A93 J;  4M73 A;  1Y0U A;  2A6E F;  2EZK A;  1P92 A;  4RAY A;  5EDN A;  4WWC A;  1Y1W J;  2E1C A;  2GIZ A;  4YEL A;  3K9T A;  1D0Z A;  1MBJ A;  3X2Q H;  2BVL A;  5E3N A;  4HX7 A;  4RGS A;  5D5X B;  4KN7 X;  1BOB A;  1U0J A;  5J4Y A;  1XGN A;  3K70 D;  2YS9 A;  3LSJ A;  1LB2 A;  1KQ0 A;  1YHQ I;  2L9R A;  1LVA A;  3QOP A;  1D5V A;  2OCC H;  4ZDL A;  1W36 C;  3FIS A;  4HNV A;  1XG1 A;  3W6V A;  1B1B A;  1PUF B;  4BJ5 C;  2E71 A;  3BC8 A;  4BL0 B;  2GXG A;  2DA5 A;  3ERM A;  1BW5 A;  4JYK A;  1FY7 A;  4BXX J;  2Y9Y A;  3ELK A;  3DF8 A;  2A5W A;  3F72 A;  2G9W A;  2NXN B;  3WG9 A;  2VBW A;  1WHU A;  3CCL I;  2HQ5 A;  5JVT A;  3RTR A;  5LGN A;  1SFX A;  1YI2 I;  3BJ6 A;  3K7A J;  5K7H A;  1IO2 A;  4XLA A;  1KU2 A;  3TO6 A;  3LFK A;  2HKX A;  2E2I J;  2O8X A;  1ZAO A;  3FKI J;  1HW1 A;  2VL8 A;  2ZXH A;  1YW7 A;  2ID3 A;  4PJ0 C;  1EKE A;  3GME A;  4EQQ A;  2BVM A;  4M74 A;  1LQ1 A;  2VKD A;  1Z9C A;  2DFF A;  3O3K A;  2CU7 A;  2COB A;  1SEU A;  1ZTR A;  1S3J A;  2K9N A;  3S32 A;  1IUY A;  4CYC A;  2ME6 A;  3V8L A;  4MO7 A;  1P6R A;  3FXL A;  2VE8 A;  2VPR A;  2O7O A;  2PFB A;  3HIF A;  4G8X A;  4UXN A;  2O03 A;  5JFR A;  3H1C A;  1JHH A;  3JW4 A;  5J3L A;  5IYB J;  2ZC2 A;  2BYV E;  2KIU A;  3S3O A;  1X19 A;  3BZC A;  1U8R A;  3CCQ I;  3OS2 A;  2Z16 A;  1AWC A;  3P7N A;  1MMN A;  2LFB A;  2XPV A;  1FOX A;  3H0G J;  2CO5 A;  3WTU C;  4ENK A;  2K5C A;  5F0H A;  4EV0 A;  4DIQ A;  5H2F C;  5GTI C;  2M34 A;  4YII A;  3GO5 A;  3E5Q A;  1HW2 A;  3PL8 A;  1T2K A;  5BNG A;  3OIP A;  4RLQ A;  2HYG D;  5TJJ A;  3V7C A;  2ZME A;  3KZI C;  3G4S I;  2EQR A;  1FT9 A;  1YFH A;  1D0X A;  2KRH A;  2NAZ A;  5K5O A;  2P4W A;  3BTC A;  4ZZD A;  1MKM A;  1CF7 A;  2OV7 A;  4ZTJ A;  2KHM A;  3Q9S A;  2QKM B;  1XGM A;  4D7M A;  3FHN A;  3DWL E;  2IAI A;  1X1B A;  4IRG A;  1K7A A;  2ZME C;  2R7U A;  1R6R A;  5CKT A;  3O2P E;  1AOY A;  2WY7 Q;  4L9J A;  4L9T A;  5EEG A;  2RDP A;  2H8R A;  2KL4 A;  4S05 A;  4BBR J;  1P4W A;  3CCS I;  2PQ8 A;  1OFC X;  4XIC A;  1BI2 A;  3G2B A;  3KLN A;  2HQA A;  1WQ2 A;  4H0E A;  4IO9 F;  5B66 C;  2NNN A;  2MG4 A;  4EJO A;  1O3R A;  3Q0U A;  2FBI A;  2XAH A;  1HLV A;  3MKW B;  4D9J A;  4BHP A;  1YRN A;  1BIB A;  3MD2 A;  3TGN A;  5IYD J;  5EJC A;  4ASN A;  3K1M A;  3ZRG A;  2O0Y A;  4XN0 A;  4PJM A;  5FRO A;  1TC3 C;  1SD6 A;  3W2W A;  2BGC A;  2RQP A;  1ZQ3 P;  5J1U A;  4NHJ A;  2E35 A;  3H36 A;  3QP5 A;  3QPH A;  2MC3 A;  3FMS A;  4HV5 A;  1IXC A;  3DTE A;  2EV5 A;  3LOC A;  3TKY A;  3F6O A;  3WTY C;  2MH9 A;  1EH7 A;  4I7H A;  2PX9 A;  2CQX A;  4H4K C;  5LRR A;  4BU2 A;  1MD0 A;  4JBA A;  1UG0 A;  4F7Z A;  1YW9 A;  2NVX J;  4DQ2 A;  2A6T A;  1K78 A;  3ZN1 A;  5F0F A;  1OLT A;  3HRU A;  2K4J A;  2IS6 A;  1XPX A;  2M5W A;  4NC7 A;  3FK6 A;  1S8N A;  2P6T A;  2W7N A;  1MDM B;  3CTA A;  2LC2 A;  3QYB A;  3ZN0 A;  2DN0 A;  2F48 A;  1Z1D A;  3BP8 A;  3CC4 I;  4HLX A;  1ZH5 A;  1HKT A;  4P55 A;  1KU7 A;  1WFX A;  1SC7 A;  3J7Y J;  4FT8 A;  2DFI A;  5J40 A;  2TDX A;  3ZQG A;  2ZFW A;  2EZI A;  1RPW A;  1WH5 A;  4NUB A;  4IQJ A;  3UNG C;  2WV0 A;  4L9V A;  1J7K A;  2WAQ N;  2LNB A;  2MD5 A;  2ZXJ A;  3A02 A;  4A3I J;  2I10 A;  2X6O A;  4V2G A;  4PJL A;  3OSF A;  2HZD A;  4Q4Z F;  2DTR A;  1T39 A;  4XL9 A;  1IZ1 A;  2JA8 J;  4HDU A;  3LFU A;  4CO8 A;  4XLF A;  4LG0 B;  4BBS J;  4DW6 A;  2HFH A;  1QNT A;  3V8J A;  2M30 A;  3PFY A;  5HOO A;  5GPC A;  1VQL I;  3OV8 A;  1I50 J;  4YIR X;  2FE3 A;  4OOI A;  1IN8 A;  1SAN A;  2ELK A;  2WC2 A;  2H94 A;  2L2O A;  3HGY A;  3NRV A;  4O6J A;  1P9Q C;  2E7W A;  4UV8 A;  3KYL A;  3ERE D;  1WH7 A;  2ZNY A;  3AG2 H;  1YX3 A;  1FMV A;  2OF7 A;  3CCR I;  3FXU A;  4Y52 J;  4ZYH A;  2X6X A;  2LY2 A;  4U0V A;  4I0A A;  5IT9 K;  2YPR A;  3O8H A;  5KCM A;  1YE9 A;  2XB5 A;  4BQQ A;  2KPM A;  1GHC A;  4XKV A;  1WJF A;  4PSX A;  1MNM C;  4KJZ A;  4LD5 A;  1UAA A;  2RKH A;  2EIL H;  3KP6 A;  1R5H A;  3MWM A;  5FKM A;  5ICF A;  3K4B A;  4IOC F;  2O8K A;  2R92 J;  2JN6 A;  3QYE A;  4DJA A;  4XSZ F;  1S5L C;  1JKR C;  1LJ9 A;  2OBP A;  4BGD A;  4A3M J;  3OR1 C;  3BG9 A;  3ZQI A;  2QLZ A;  4AUX A;  1PJR A;  2VON A;  1LUJ B;  5L3F A;  3GWZ A;  5HLT A;  3HDD A;  4ON0 A;  4C9Y A;  3LA3 A;  4G7O F;  4YFX F;  2Q8K A;  4AVP A;  1A31 A;  2J5P A;  5HLG A;  2LDU A;  1SFK A;  3CCE I;  1ZEL A;  2ELJ A;  3B02 A;  2EFO A;  3GVA A;  2VOP A;  5GTH C;  3HYI A;  2K4B A;  2ECB A;  1POG A;  2W84 A;  2RVC A;  3U1K A;  2VUM J;  2LF8 A;  3WTZ A;  5DUK A;  2BBY A;  3K4L A;  3HSF A;  3M8F A;  4AIJ A;  2AQE A;  4A3F J;  1H89 C;  1P2F A;  1U2W A;  1RR8 C;  3GEZ A;  3REO A;  1BA5 A;  1BOA A;  4A3B J;  1B59 A;  1ETQ A;  1MBH A;  4XNF A;  5IT9 Z;  3WHC A;  3CDL A;  4KYW A;  2O3F A;  4G7Z F;  3PO3 J;  1NG7 A;  1J2X A;  5FRN A;  2GM4 A;  2MLK A;  3H5R A;  2JVH A;  1IN7 A;  2KKO A;  3JRH A;  5GAH J;  3JRB A;  1U3E M;  3H3U A;  4WXD A;  3DBL B;  1WJ5 A;  4X1E A;  4CIC A;  4NB5 A;  5M5X J;  1NH3 A;  1L0O C;  5LRS A;  4BY7 J;  3GBG A;  1BL0 A;  3ZQH A;  1GXQ A;  2JZY A;  3IV5 A;  1USS A;  2CW8 A;  2LOO A;  3OS0 A;  1H9G A;  3HOW J;  2Q0O A;  3HHH A;  2AO9 A;  1X3W B;  3E6B A;  3WE2 A;  2D45 A;  2K40 A;  2QZ8 A;  3FIW A;  3HKZ A;  1R4N B;  5A2Q K;  3G73 A;  5E1Z B;  4IRI A;  2QSH X;  3N4M A;  1QO0 D;  1JUS A;  2ICW G;  2VT3 A;  1HXD A;  3CO6 C;  2DOA A;  1PYV A;  4CA0 A;  3OL4 A;  1Y56 A;  2UZK A;  4XLE A;  1LE8 B;  3DXJ F;  1RRJ A;  2O9L A;  4X6A J;  4CYC B;  4MGR A;  2DPU A;  4P5O A;  1ON1 A;  2QGU A;  2DA2 A;  4BHC A;  2HR3 A;  3F23 A;  3Q0V A;  3A4C A;  4XKW A;  3J7A O;  2QQ8 A;  2UV1 A;  1UHM A;  2DU9 A;  1YOV B;  2AS5 F;  2OA4 A;  1HDP A;  4UUT A;  2Y0S A;  1G3Y A;  2KP6 A;  3LSP A;  3P9I A;  2QM3 A;  2XSJ C;  4WXC A;  2HXI A;  2P5V A;  3ABL H;  4XOR A;  3ZMZ A;  3N05 A;  1OJL A;  3U9G A;  4G6D A;  1VZ0 A;  1KQ9 A;  4AU7 A;  4BY1 J;  2MGQ A;  1AA7 A;  5BS6 A;  2ZBK A;  3C2B A;  5EG0 A;  1XB4 A;  1FIA A;  2BY0 A;  1HA8 A;  1UHS A;  2XPU A;  1MSF C;  3NQO A;  1JHF A;  4LG3 A;  2KDO A;  4UHT A;  4HX4 A;  5HNF A;  3I4P A;  1HSJ A;  2ZME B;  4K2E A;  1IW7 F;  4B1R A;  4RB3 C;  1RI7 A;  6PAX A;  1WKM A;  1V5F A;  1CF7 B;  2IT0 A;  2OQR A;  5A2Q Z;  5CYV A;  5D5U B;  3RPQ A;  4XOT A;  4E7Z A;  3LSG A;  3JRE A;  2IGM A;  2F5C A;  5HLI A;  1QVT A;  1EH6 A;  3WU2 C;  5KK1 A;  1MGT A;  1WPK A;  4A6D A;  4F3Q A;  2GOM A;  4A2U A;  2H1K A;  4ZDO A;  2WAD A;  5E8G A;  4QLC U;  3C1D A;  2JPB A;  2AXT C;  4OMY A;  2VQC A;  3PIP F;  3PM1 A;  1TNS A;  3G1M A;  3FXM A;  1L3L A;  1ZN2 A;  4MIM A;  1OCP A;  4CGZ A;  2F5V A;  1OYI A;  3OYF A;  2Q1Z B;  2F5D A;  1JTY A;  4FHT A;  2IPQ X;  4QSH A;  1W4M A;  1ODD A;  1VI0 A;  5C44 J;  4KUM A;  3FXK A;  2LY9 A;  3JRA A;  2F4M B;  1IJW C;  2C6Y A;  2VOD A;  2R5Z A;  2M8G X;  1WJE A;  3T8R A;  2VJ5 A;  2HZT A;  2YX4 A;  1N77 A;  1YRN B;  2FRH A;  3ASN H;  1O3S A;  5D6F A;  2NVU B;  3ECO A;  2XVC A;  3R0J A;  4RGU A;  4F55 A;  3GUD A;  1MMG A;  4EMS A;  1Y0N A;  3S3M A;  4B43 A;  3F6V A;  2W4S A;  3OIO A;  1YIT I;  1N78 A;  2EIK H;  1FLI A;  3LNQ A;  2QWW A;  3I71 A;  1S6L A;  4BAC A;  4FQG A;  1J09 A;  1TWC J;  3CF5 F;  5L3C A;  4XQF A;  3HOX J;  3CC7 I;  3AL0 C;  4R8H A;  1TBX A;  2RV8 A;  1TT0 A;  3FXJ A;  3DEE A;  2ZFU A;  1Y8R B;  3V7R A;  1U9N A;  4U87 A;  3OWT A;  1K78 B;  4FAS D;  2LSO A;  3PQK A;  4ZDP A;  3ZMS A;  4O3M A;  5HOD A;  1BJA A;  2H1L A;  4AD9 A;  3P9C A;  4HV6 A;  4L5I A;  3PO2 J;  5DS9 A;  3E97 A;  4XLC A;  2FML A;  3DPU A;  1P7J A;  2VN2 A;  3MKL A;  3JAM K;  2E7X A;  4IL6 C;  2DK8 A;  1WJB A;  2ZB9 A;  4CYD A;  2CV2 A;  3GTP J;  1MIJ A;  4M6X A;  2Z33 A;  2Z99 A;  3FM3 A;  2L5Q A;  3VSK A;  4A0X A;  2L01 A;  3VOD A;  2DOD A;  1A6Q A;  2COM A;  1U5T A;  5HNH A;  2O6G E;  2FOK A;  1JUM A;  3FHZ A;  1HF0 A;  4G94 A;  1Z3X A;  3S1M J;  3JR9 A;  1ZRD A;  2EK5 A;  2D5V A;  2HDW A;  3JSO A;  3DPL C;  1GDT A;  4B3X A;  1U5T C;  1WWX A;  5EEA A;  2FU4 A;  3CLQ A;  2IXS A;  1WRJ A;  4E7K A;  1D0Y A;  4A3D J;  2DO7 A;  2V9K A;  2K9L A;  1TW3 A;  3CD6 I;  2K9Q A;  2NOG A;  3S1R J;  3BR5 A;  3M7G A;  2BHY A;  2BY3 A;  4I09 A;  2NRA C;  1R1V A;  2QSG X;  2IS4 A;  1B9M A;  3CDI A;  4CUG A;  3QQA A;  4F91 B;  4E7S A;  3FBN B;  2Z2S B;  1BM9 A;  3HUG A;  3TQN A;  1LKX A;  3ZMV A;  3K6G A;  3C2H A;  3HOZ J;  2QUF A;  3T0Y A;  2EIM H;  3JRG A;  2STT A;  2R5Y A;  1WCM J;  3IHU A;  4O5V A;  4KFC A;  1FIP A;  2A5Y B;  1E0E A;  3SFI A;  3CP2 A;  4UV9 A;  4NC8 A;  3CZ6 A;  1I6H J;  3JAM Z;  1ZK8 A;  3IKV A;  1ETX A;  4AC0 A;  4KIT B;  4S04 A;  4AM3 A;  3I5U A;  3LAP A;  2CG4 A;  2G0E A;  5KAF C;  5LLQ A;  3PJR A;  1FC3 A;  2CH0 A;  2R7F A;  4M3B A;  1E3H A;  1WI3 A;  1KU9 A;  4ZZL A;  2BW3 A;  1G3W A;  1OCT C;  2L9N A;  3LA2 A;  4CCN A;  2OU2 A;  1FYM A;  2K3P A;  2ZSI B;  2Y69 H;  1JI8 A;  2FF4 A;  1KYW A;  2JA2 A;  3DKY A;  5LHG A;  1G4D A;  2DOE A;  1XCV A;  2KT0 A;  1YIO A;  5CQG A;  3M3Y J;  2DXI A;  3RQI A;  4OIQ F;  4I02 A;  3H9J A;  1X3Z B;  2DFH A;  2XKO A;  2VKH A;  4CXF A;  2DLL A;  4PDK A;  3BOQ A;  2LD5 A;  2OTL I;  2NYX A;  3RQ4 A;  5J4V A;  1T08 B;  4ESB A;  1UFM A;  4M3G A;  5ICE A;  2CUF A;  2HOA A;  3MEX A;  3S16 J;  2K7L A;  1XN7 A;  3I58 A;  1K61 A;  3BRO A;  2BXZ A;  3W6K B;  3WE3 A;  4ZYG A;  4MTE A;  1BJZ A;  2DA7 A;  4CCO A;  3TDU C;  4OIR F;  4IHX A;  1SFU A;  1JKP C;  2VQL A;  1LVK A;  5EEH A;  1MNE A;  2DJI A;  5C4J J;  5D8K B;  1YTY A;  4TV7 A;  3CMA I;  3CCV I;  2DA1 A;  2YSR A;  1LFB A;  1VQ6 I;  2ESH A;  3M9A A;  1TP4 A;  2KLO A;  3S15 J;  1JTX A;  2JSC A;  2R0Q C;  4I76 A;  4NBQ A;  3L2W A;  2R7X A;  4RAG A;  3FKJ A;  4HDV A;  5GAE J;  3KE2 A;  5IOZ A;  3HOV J;  4CCM A;  1B72 A;  2JJ7 A;  2YX7 A;  1E17 A;  1ZR4 A;  2MW8 A;  2HXO A;  2VC0 A;  5CQE A;  2LF7 A;  2E1M C;  1MJA A;  1WSU A;  1J5Y A;  2PJP A;  3OR2 C;  3DTK A;  5LD2 C;  2UUZ A;  5HLH A;  4BHB A;  4A3J J;  3I53 A;  1BI3 A;  2ADU A;  2MH2 A;  4MNU A;  1H88 C;  1RC9 A;  2DYR H;  3GLL A;  3SJM A;  2A69 F;  1ZG5 A;  2JA6 J;  1OR7 A;  2WAE A;  3SZG A;  4Y7N J;  3AAF A;  3LQR A;  4DBR A;  1XMX A;  3ZOB A;  3K2A A;  3ABK H;  2B9S A;  3BWG A;  3H92 A;  1UB9 A;  3G6E I;  2ZJR F;  1TZL A;  1WZ2 A;  4B47 A;  4HAM A;  3JRI A;  2L7M P;  1I3Q J;  1OR7 C;  1TW2 A;  2QEX I;  1PDN C;  1X1D A;  4KMF A;  4OAY A;  2K85 A;  3SZP A;  3BG3 A;  5D5V B;  1FYK A;  3S2D J;  2RQQ A;  1XCB A;  1YJW I;  2MYS A;  3KLO A;  4LIT A;  4A5N A;  3L00 A;  4BE1 A;  1GVJ A;  2P7V B;  2EB7 A;  1LDD A;  2Y2Z A;  1HCR A;  1MH3 A;  3GTG J;  5C3E J;  3HOS A;  3TW6 A;  1AHD P;  1T56 A;  2H8W A;  3DTI A;  4R79 A;  3S93 A;  1ENH A;  5DUI A;  2HI3 A;  4EM2 A;  1A35 A;  2YU9 J;  4KT6 A;  5F0C A;  3IKT A;  1DP3 A;  4D1Q A;  2NNY A;  1DGR M;  2V26 A;  1SFO J;  1GV5 A;  2DMP A;  2CWE A;  3J7Z I;  2ACJ A;  2LVS A;  4QWQ A;  5CVJ A;  3E5X A;  2VJ4 A;  2GXA A;  2XSD C;  1H0M A;  1OMI A;  2HPM A;  2XHK A;  2ZSH B;  3QAH A;  1T8I A;  2VBZ A;  3TW7 A;  4YFN F;  3PSI A;  1FBS A;  4FE4 A;  4NC6 A;  3P9K A;  4HQE A;  5GAG J;  1E3P A;  5BPD A;  3IH4 A;  1JE8 A;  1Y8Q B;  2HEO A;  2ZXI A;  2LG4 A;  3L1P A;  3G71 I;  4ENJ A;  2DW4 A;  3A1Y A;  4D5C A;  5HDN A;  3E3V A;  2R93 J;  1AU7 A;  3JTG A;  1GT0 C;  2F5E A;  3TO7 A;  2HOE A;  2FQ3 A;  2A61 A;  2XGE A;  3I64 A;  4NNJ A;  1DQU A;  2I5U A;  5IPA A;  1SD7 A;  1KON A;  1E3O C;  1U9O A;  2A68 F;  5FB2 A;  4CCL A;  4GDF A;  3HGG A;  3MMY B;  3LWF A;  2CQQ A;  1SVL A;  1YS6 A;  4CSW A;  1Z05 A;  2VBX A;  5FFX A;  4FTH A;  5IOY A;  1BIA A;  2L4M A;  3IP4 B;  1IN6 A;  4I98 B;  2V1U A;  3ASO H;  5DCM A;  2R7W A;  2M4G A;  1Z91 A;  3GLX A;  1IF1 A;  4XON A;  3F21 A;  2K27 A;  4XN3 A;  3VYR B;  3VEP A;  4B44 A;  4G7H F;  3ZQC A;  3WGG A;  1OIS A;  4RAF A;  2LY1 A;  2Z9O A;  2R5Z B;  2QQ9 A;  3I0T A;  2V1N A;  4L0Y B;  4RB1 A;  1JXS A;  4BAY A;  2ZJP F;  4ZYD A;  1UMQ A;  3MZY A;  1JGG A;  2XDV A;  3RDI A;  1HDD C;  3OMY A;  2QF7 A;  3HM5 A;  2LR8 A;  4KNY A;  1TTY A;  4IRH A;  1Y39 A;  2Y75 A;  5CVR A;  3AL0 B;  2R3S A;  4J19 A;  1J9I A;  3VDX A;  3AFH A;  3T5X A;  2LKX A;  2VAS A;  2F5F A;  3PIO F;  2GA2 A;  4ESJ A;  1UCR A;  2V1D A;  3OYD A;  1FTZ A;  3KIO A;  1H8A C;  1FWZ A;  3PNV A;  5DYM A;  5HDG A;  4L18 B;  5FD6 A;  1V3F A;  2JSP A;  4QIW N;  1FOY A;  1BW6 A;  1SMT A;  2W82 A;  2ESN A;  3QP6 A;  4XKC A;  5LGU A;  3RZD J;  5FKN A;  2KIF A;  2LBF A;  3HPG A;  1K79 A;  3VB2 A;  4QTR A;  2PLY A;  4EGY A;  1Y6I A;  3OIQ A;  4N0B A;  3OYN A;  2CSO A;  2OD5 A;  2MBF A;  2DFE A;  2OZ6 A;  2HVR A;  4YRV A;  2PMZ N;  3BZ6 A;  2EV0 A;  3C2G A;  2A05 A;  4AIH A;  3SFZ A;  4E7J A;  4PGG A;  2E36 A;  1ZGW A;  1F4K A;  3HHG A;  1RUO A;  1U5T B;  1QU3 A;  1Z6R A;  2OAZ A;  4N4O B;  2BZT A;  2XAF A;  5CVV A;  3WGH A;  4HNT A;  1HST A;  2STW A;  3F3X A;  3M1C A;  4OMZ A;  4EJV A;  4BUP A;  2GXB A;  5DEQ A;  2N8G A;  3E6D A;  1OQY A;  3RKW A;  4C3H J;  2HQN A;  4BEH A;  3M8E A;  4RA2 A;  4ZYA A;  3TDZ C;  3MN2 A;  1D5Y A;  3LSK A;  4Q48 A;  2VXD A;  3VOE A;  3EUK L;  2DDB A;  2QKL B;  3BDD A;  1QRY A;  5HS9 A;  3A03 A;  3BPV A;  2WWY A;  3CCM I;  1BR2 A;  3B6C A;  3EYY A;  1LEB A;  4WX9 A;  2KFD A;  3PNY A;  3AG1 H;  1W0U A;  5L3B A;  4YFK F;  4U7D A;  2WBM A;  3HUG B;  4JP0 A;  3NEU A;  2FD5 A;  4HOB A;  2R5Y B;  2EV6 A;  1K83 J;  4AWX B;  1TL8 A;  4AID A;  1D3Y A;  1W5S A;  4A0Y A;  4L5E A;  1QGP A;  1B8I B;  3T1B A;  3ZPL A;  3BR1 A;  2X48 A;  1FOK A;  3A0B C;  1IAW A;  1VND A;  2JMW A;  4A0Z A;  1GV2 A;  1G2H A;  4J00 A;  3KP7 A;  3F8N A;  3OY9 A;  3IRR A;  3BLY A;  2MFZ A;  3V42 A;  1XSX A;  5BOX A;  1SMY F;  2BW3 B;  4XBF A;  4HW0 A;  1YQA A;  4D0P A;  3KPH A;  3KYD B;  4G9Y A;  4I6Z A;  2E1O A;  4EJU A;  3W6J B;  4DYR A;  3SXY A;  4FX4 A;  2JK3 A;  1TWA J;  1SAX A;  5F6F A;  1W7P A;  3HOY J;  2W25 A;  3B73 A;  3CJQ B;  1D1A A;  3EET A;  3BT9 A;  4Y13 A;  5J8C A;  4XK4 A;  4M3D A;  2E19 A;  1R36 A;  2XC7 A;  1R9T J;  1QZE A;  1I6X A;  3BQY A;  3FWE A;  3G1L A;  5ILS A;  1A5J A;  4RB2 C;  1ZGA A;  2XAU A;  3BR2 A;  3IUO A;  4EEF G;  4XOP A;  3WG7 H;  4RGR A;  1IXS B;  1BBY A;  1Z0X A;  4XRS G;  1I1G A;  2JTV A;  5BPI A;  1YJ9 I;  3F22 A;  2KIS A;  4AYB N;  5M5W J;  3M4O J;  4A69 C;  4PSW A;  1S72 I;  2CS3 A;  4MQ9 F;  2IA1 A;  3KP4 A;  5CJ9 A;  3WOD F;  3L2R A;  2O5R A;  2JA7 J;  4W97 A;  1JUP A;  5IP6 A;  4L9N A;  5LEK A;  2W1O A;  4A6E A;  4IOA F;  4LIU A;  2KZV A;  2BY1 A;  5L3G A;  1ITY A;  3DCF A;  1IRF A;  1AKH A;  2XB0 X;  2Z3Y A;  5EYR A;  5E17 F;  1FSE A;  2KJB A;  2ZXW H;  3ZR8 X;  5E18 F;  1KYZ A;  2MSY A;  3GXO A;  3KFW X;  4UVC A;  5D4R A;  2FOW A;  1FZP B;  2HTS A;  3M8J A;  2VXZ A;  2Y0M A;  2VT2 A;  2PMZ A;  2WAQ A;  4PUS A;  2M3A A;  2E1M B;  2GZW A;  1IC8 A;  4EJT A;  3GF2 A;  3DKW A;  4C3I J;  3U2R A;  1MJ9 A;  2NVQ J;  1KQ8 A;  3EPZ A;  2K02 A;  3LA7 A;  1B72 B;  4Q5S F;  4N4N B;  2A3S A;  3I59 A;  3T8T A;  2V6E A;  2WTE A;  1HW5 A;  3JRC A;  3VSL A;  5JLW A;  2WB1 N;  2EIJ H;  5B1A H;  4XMY A;  4QPO A;  4ZYE A;  4M72 A;  2OCE A;  2PJR A;  1SVO A;  5JR3 A;  1HQC A;  3OYC A;  3TP3 A;  3V7S A;  2LYC A;  5ICG A;  3L09 A;  4II3 A;  3H3V K;  2QEN A;  3KP2 A;  3ONQ A;  1T33 A;  2VKE A;  2HDC A;  5DD4 A;  3NAR A;  5HS7 A;  1WVR A;  2UXX A;  3FXR A;  1VQM I;  1LDJ A;  1W36 D;  4ANJ A;  1YS7 A;  4BH9 A;  2DBB A;  1I1S A;  4MHG A;  1HKS A;  4MLO A;  1STZ A;  3S1Q J;  5LFA A;  4LMY A;  1OYY A;  1V5G A;  4DGW B;  2R7D A;  1ZAR A;  1OCZ H;  1QA6 A;  2AHQ A;  1TQI A;  1X1A A;  1QVU A;  4II2 A;  2FX0 A;  2DAO A;  2M87 A;  2X1D A;  4F93 B;  2L7K A;  3WU1 B;  1GXP A;  2P5L C;  3V4G A;  4IEJ A;  3BY6 A;  1SD4 A;  5D4S A;  2EIN H;  1Z3Y A;  5HVQ C;  1BC7 C;  2TCT A;  1FP2 A;  2NS0 A;  5E1W A;  3LL7 A;  4LLG F;  3RYP A;  5DM7 F;  3GCM A;  3AKZ A;  5K5R A;  2ZO4 A;  1N75 A;  4IVN A;  3GZ6 A;  1LFU P;  2M9H A;  3CES A;  1U78 A;  3KP3 A;  2CUJ A;  3CCU I;  2V1X A;  3FBI B;  1FJL A;  1ETO A;  3E1S A;  3SEZ A;  3CUO A;  1ZLK A;  4FIS A;  4WCG A;  2QBY A;  3AG4 H;  1MSE C;  1QPI A;  4HRI A;  3S8P A;  3ZQQ A;  2JPC A;  4C30 A;  4Y3O A;  1MZB A;  2VJI A;  2KIQ A;  2HU9 A;  1S7O A;  4LB6 B;  1KGS A;  1R23 A;  3DPT A;  3J81 K;  2BV6 A;  1JKO C;  1JGS A;  3CF2 A;  4AYB A;  4WXH A;  4YEJ A;  3H9G A;  2XF7 A;  1S7A A;  4B8X A;  3HBL A;  5TIS C;  1RIO H;  5TGT A;  2FA5 A;  1R00 A;  2P6S A;  3V8K A;  3HG9 A;  1WJA A;  5D5W B;  3K4N A;  4IXA A;  4LK1 F;  1X4P A;  2ELH A;  1C0W A;  1HKQ A;  2QYO A;  4BNC A;  3MFK A;  3I9V 2;  5DCM B;  2OQG A;  2XKP A;  4KMU X;  2Y9Z A;  3D1N I;  1ZLJ A;  1D1B A;  1ZYR F;  1P4A A;  4DYQ A;  3LSR A;  1PUE E;  1DPU A;  4JOM A;  1FYL A;  2X85 A;  4OIP F;  4BJ6 C;  1KA8 A;  3BG6 A;  1CGP A;  1VF9 A;  1WJD A;  3CUQ A;  4XRF A;  1APL C;  3ZQF A;  1IGN A;  3L2C A;  3MQ0 A;  1VTN C;  2VE9 A;  2L7F P;  2VPL A;  2XRN A;  5H6R A;  2K86 A;  3GFJ A; 
#chains in the Genus database with same CATH homology
 3BJO A;  3QRF F;  4P9F A;  3CUQ C;  4KIG A;  2PI0 A;  4GYG A;  1Q1H A;  3J81 Z;  3HTS B;  2ISY A;  2L3D A;  3HSE A;  3FX3 A;  1XSV A;  1MDM A;  3C3W A;  4OU0 A;  5E20 A;  2W85 A;  3DP7 A;  2L4A A;  4IJA A;  2CW0 F;  1T0F A;  1LEA A;  4CHU A;  3E6C C;  1A04 A;  1XGO A;  1ZRF A;  4MEY F;  3H3Z A;  4PCQ A;  1BI1 A;  1QBJ A;  4HZF A;  4Y17 A;  4U7B A;  4PGH A;  1E2X A;  2W24 A;  4ENM A;  1KU3 A;  4IF4 A;  1ON2 A;  4N9H A;  2IW5 A;  1V4R A;  3GX4 X;  1R7J A;  2PBI A;  3KEQ A;  4LLL A;  1Z7U A;  2DQR A;  2G7U A;  1ZHF A;  5D6E A;  2P8T A;  2XUB A;  4KIC A;  4ETS A;  1IXR C;  1FNN A;  3ABU A;  4RGX A;  3EDP A;  1IN4 A;  1TQP A;  4KT5 C;  3GZ5 A;  4M9X A;  2CGP A;  1G3S A;  4JK1 X;  2XRO A;  3ULQ B;  3K2Z A;  5TRD A;  3K69 A;  1G3T A;  3FXQ A;  4LLN A;  2DQL A;  1ONV A;  4CZZ A;  4LGW A;  4P96 A;  3SQN A;  5CVI A;  1XSD A;  2UWM A;  2XGX A;  3CO7 C;  5CLS A;  1W7P B;  3MCZ A;  4IPA A;  1ZGJ A;  1T38 A;  5JHU A;  3IWZ A;  2FSW A;  5J8F A;  1RNL A;  1UST A;  4RS8 A;  2D1V A;  3K1N A;  4EGZ A;  1NHA A;  3KZY A;  4U0Y A;  1EV7 A;  4KN4 X;  5HDK A;  1REP C;  3KP5 A;  3COA C;  4U0W A;  3BJA A;  3LAJ A;  5FFZ A;  1O3T A;  2B0L A;  1R5G A;  1T6S A;  4A5M A;  3R6S A;  4EJW A;  2EFQ A;  4EM1 A;  3KET A;  1ZRE A;  1B6A A;  5L3D A;  2O61 A;  2FNP A;  3G3Z A;  3MZH A;  2EWN A;  3RPU A;  2PEX A;  2IP2 A;  1I5Z A;  5DV5 A;  3I59 B;  2DPD A;  2FBK A;  2J5O A;  1ZG1 A;  5ICC A;  1XDS A;  1O3Q A;  1W7P D;  1XMK A;  3HRS A;  5AON A;  3F8F A;  5ILV A;  4WF2 A;  1OPC A;  4BXU A;  4M71 A;  3LST A;  3HRM A;  2GA1 A;  1TLH B;  2A07 F;  4I2O A;  3ZQ7 A;  2P7C B;  2KRF A;  1QQI A;  2XAS A;  3FM5 A;  3RYR A;  2BE5 F;  4ENN A;  4HF2 A;  4ZH4 F;  1TNT A;  2ZCW A;  2V6C A;  4LFU A;  1PP8 F;  2H6C A;  2ZKZ A;  3IC7 A;  2HWV A;  1F1Z A;  4BYY A;  3CLO A;  2GWR A;  4LB5 A;  1BI0 A;  4KIF A;  2QBY B;  5AIP A;  3TO9 A;  1LDK B;  2ZNZ A;  3ABT A;  4I0B A;  1SD5 A;  3ZMU A;  5FGM A;  2BEO A;  3R60 A;  2EFP A;  3WTS C;  2FNA A;  2KIM A;  4B09 A;  1FBU A;  1K6O A;  1WI9 A;  2HQR A;  3GFI A;  1QPM A;  2CFX A;  2FMY A;  5FO5 A;  4HF1 A;  1XDU A;  1DDN A;  3O6B B;  1O7F A;  2IVM A;  2D1H A;  3L9F A;  4M6Y A;  3S2W A;  4HF0 A;  1R22 A;  2W57 A;  3M1E A;  3CUQ B;  2PMU A;  1T98 A;  2QVO A;  4MQV A;  3WU0 A;  4Y15 A;  4CDG A;  4A12 A;  2M45 A;  2Q2E A;  3ZMT A;  1J0R A;  3CDH A;  2M8E A;  3EUH A;  2QQA A;  2IA0 A;  1R1U A;  1BC8 C;  3K1P A;  3QU3 A;  1ULY A;  2V79 A;  3QPT A;  4XSX F;  2XRN A;  2IRF G;  4IHS A;  4NQW A;  1IRG A;  5HS8 A;  2FXA A;  5LEJ A;  1B4A A;  2JT1 A;  3IWF A;  3F8B A;  4HBL A;  2X0L A;  1OKR A;  2ISZ A;  3HRT A;  5LHH A;  2RGV A;  3KEO A;  3FMQ A;  2YU3 A;  5F1R A;  2EFW A;  1I27 A;  3E5U A;  1HBX G;  4IHT A;  4XLN F;  4HA8 A;  5K5Q A;  3IL2 A;  5DDG A;  3FF5 A;  1FPQ A;  4JQF A;  1J59 A;  2FEZ A;  3KZZ A;  4LJZ F;  3IRQ A;  2XIG A;  5JI6 A;  1QZY A;  1H9T A;  2LKP A;  3TOA A;  3RI4 A;  2F2E A;  5BMZ A;  4LK0 F;  3GYH X;  4UVB A;  3D5L A;  4G6Q A;  5L3E A;  1PP7 U;  3L7W A;  2HTJ A;  3WTW C;  2D2W A;  5KVR A;  2A6H F;  2DT5 A;  4M9S A;  2XAQ A;  2EA4 A;  4OIO F;  1XMA A;  3GFM A;  3SZT A;  2GAU A;  4RAZ A;  4N9I A;  2XV4 S;  1U6G A;  1DUX C;  1QZZ A;  5F64 A;  4Z2Y A;  3Q5F A;  3HOT A;  1Z6T A;  2XAG A;  2PN6 A;  3RJP A;  3VFZ A;  2VOO A;  1TQM A;  4HYE A;  2HKO A;  3EYI A;  1MJB A;  4DNC A;  1OYW A;  3F8C A;  5K1Y A;  5LBQ A;  4MTD A;  1YYV A;  4E70 A;  1J75 A;  4KIB A;  4EM0 B;  3LQQ A;  2KJC A;  2PMH A;  2FBH A;  4OIN F;  3HTU A;  3RIR A;  2E1N A;  5ED4 A;  3Q9V A;  3J80 K;  3OOP A;  1ZG3 A;  2EFN A;  3HSR A;  4EVI A;  2MLG A;  5D8L B;  4Q47 A;  5H20 A;  3WTV C;  2L54 A;  1X3U A;  2M1B A;  4YG2 F;  2CYY A;  3DFG A;  1F9N A;  1YLF A;  1R58 A;  5BQT A;  4GXO A;  1SFE A;  2ETH A;  3GW2 A;  3PFI A;  5ILU A;  3ISP A;  2Z5U A;  2RC4 A;  3MAJ A;  4AIK A;  2AXL A;  4GCV A;  3RKY A;  1EH8 A;  4WK8 F;  3KCC A;  4UUV A;  4L0Z B;  1R1T A;  4R1H A;  1ZRC A;  5E8I A;  2H27 A;  5DCF A;  4HQM A;  3E6M A;  4L5J A;  5E1X A;  2VC1 A;  5FD5 A;  3J80 Z;  1DPR A;  3CJN A;  4YIF A;  4XLP F;  4KDP A;  5FLX K;  3C18 A;  4MEX F;  2H09 A;  4U88 A;  1LNW A;  4M9Z A;  4GYI A;  3D0S A;  1FSH A;  3U1D A;  2HS5 A;  1G6N A;  1XD7 A;  1P4X A;  1FBQ A;  3QU6 A;  2DI3 A;  3WTX C;  4RB0 A;  2V9V A;  4UNO A;  2RNJ A;  2YR2 A;  2HGC A;  4HLY A;  4P9U A;  1F5T A;  1BN5 A;  2UXN A;  1O7L A;  3ML6 A;  1YO5 C;  5H6Q A;  3WGI A;  3EQL F;  3F8M A;  5FLX Z;  2L02 A;  2EA2 A;  3JSP A;  3WTT C;  2DK5 A;  1S29 A;  4HX8 A;  3I54 A;  2XAJ A;  4ESF A;  4FX0 A;  1XGS A;  3FZV A;  2ZJ2 A;  2IJL A;  5J6X A;  2RN7 A;  2Y48 A;  4PZJ A;  2CQK A;  3R61 A;  1YW8 A;  2GIV A;  4GO1 A;  3DV8 A;  1RZ4 A;  2JRT A;  1B9N A;  4KA4 A;  4LG0 A;  4I01 A;  1D8K A;  3R4K A;  5LGT A;  3ZMD A;  3TOB A;  2HYF A;  3N97 A;  3ROU A;  4UVA A;  1FX7 A;  2VBY A;  1IN5 A;  3DQV C;  2IA2 A;  2EJR A;  5ERI A;  2MA3 A;  2QQB A;  5DD8 A;  1D8J A;  1O57 A;  5IT3 A;  5LHI A;  2G7H A;  2PG4 A;  3JTH A;  2OZU A;  1W5T A;  1FP1 D;  1RUN A;  3DEU A;  3BPX A;  4GGG A;  2GQQ A;  3RKX A;  3SHF A;  2P5K A;  4BQA A;  3C7J A;  3PQJ A;  1YG2 A;  3ECH A;  5AIQ A;  1DP7 P;  3K0L A;  3FMR A;  3R0A A;  5CVU A;  2X4H A;  3ZP5 A;  2H6B A;  1UHW A;  4M73 A;  1Y0U A;  2A6E F;  1P92 A;  4RAY A;  4WWC A;  2E1C A;  3K9T A;  4HX7 A;  4RGS A;  5D5X B;  4KN7 X;  1XGN A;  1LB2 A;  1KQ0 A;  1LVA A;  3QOP A;  1D5V A;  1B1B A;  2GXG A;  1FY7 A;  3ELK A;  3DF8 A;  3F72 A;  2G9W A;  3WG9 A;  2VBW A;  5JVT A;  3RTR A;  5LGN A;  1SFX A;  3BJ6 A;  1KU2 A;  3TO6 A;  3LFK A;  2HKX A;  2O8X A;  1ZAO A;  1HW1 A;  1YW7 A;  4EQQ A;  4M74 A;  1LQ1 A;  1Z9C A;  3O3K A;  1S3J A;  1IUY A;  3V8L A;  1P6R A;  2VE8 A;  4G8X A;  2PFB A;  3HIF A;  4UXN A;  2O03 A;  5JFR A;  1JHH A;  3JW4 A;  2BYV E;  2KIU A;  1U8R A;  1AWC A;  3P7N A;  2CO5 A;  3WTU C;  4ENK A;  4EV0 A;  4YII A;  3GO5 A;  3E5Q A;  1HW2 A;  1T2K A;  2HYG D;  5TJJ A;  3V7C A;  2ZME A;  1FT9 A;  1YFH A;  2NAZ A;  5K5O A;  2P4W A;  4ZZD A;  1CF7 A;  1MKM A;  3Q9S A;  1XGM A;  1K7A A;  4IRG A;  3O2P E;  1AOY A;  4L9J A;  4L9T A;  5EEG A;  2RDP A;  4S05 A;  1P4W A;  2PQ8 A;  1BI2 A;  3KLN A;  1WQ2 A;  4H0E A;  2NNN A;  1O3R A;  4EJO A;  2FBI A;  2XAH A;  4BHP A;  1BIB A;  3TGN A;  4ASN A;  3K1M A;  2O0Y A;  1SD6 A;  2BGC A;  2RQP A;  4NHJ A;  3QP5 A;  3QPH A;  2MC3 A;  3FMS A;  4HV5 A;  1IXC A;  2EV5 A;  3TKY A;  3F6O A;  3WTY C;  2MH9 A;  1EH7 A;  4I7H A;  5LRR A;  1MD0 A;  4JBA A;  4F7Z A;  1YW9 A;  4DQ2 A;  1K78 A;  3ZN1 A;  3HRU A;  2K4J A;  2M5W A;  1S8N A;  2P6T A;  1MDM B;  3CTA A;  3ZN0 A;  1Z1D A;  3BP8 A;  4HLX A;  1ZH5 A;  1HKT A;  4P55 A;  1KU7 A;  4FT8 A;  2DFI A;  2TDX A;  2ZFW A;  2WV0 A;  4L9V A;  1J7K A;  2LNB A;  2MD5 A;  2ZXJ A;  4Q4Z F;  2DTR A;  1T39 A;  1IZ1 A;  4HDU A;  4CO8 A;  4LG0 B;  2HFH A;  1QNT A;  3V8J A;  2M30 A;  5HOO A;  3OV8 A;  2FE3 A;  4OOI A;  1IN8 A;  2WC2 A;  2H94 A;  3NRV A;  4O6J A;  2E7W A;  4UV8 A;  3ERE D;  2ZNY A;  3FXU A;  4ZYH A;  4U0V A;  4I0A A;  5IT9 K;  2YPR A;  1GHC A;  4LD5 A;  2RKH A;  3KP6 A;  1R5H A;  3MWM A;  5ICF A;  4XSZ F;  1LJ9 A;  2OBP A;  2QLZ A;  2VON A;  5L3F A;  3GWZ A;  4ON0 A;  3LA3 A;  4G7O F;  4YFX F;  2Q8K A;  4AVP A;  2J5P A;  5HLG A;  2LDU A;  3B02 A;  2EFO A;  3GVA A;  2VOP A;  3HYI A;  2K4B A;  2W84 A;  2RVC A;  2LF8 A;  3WTZ A;  5DUK A;  2BBY A;  3HSF A;  3M8F A;  4AIJ A;  1P2F A;  1U2W A;  3GEZ A;  3REO A;  1BOA A;  1B59 A;  5IT9 Z;  4KYW A;  2O3F A;  4G7Z F;  1J2X A;  2MLK A;  1IN7 A;  2KKO A;  1U3E M;  3H3U A;  4WXD A;  4CIC A;  4NB5 A;  1L0O C;  5LRS A;  1GXQ A;  2JZY A;  1USS A;  1H9G A;  2Q0O A;  3HHH A;  3E6B A;  2D45 A;  3WE2 A;  2QZ8 A;  5A2Q K;  3G73 A;  5E1Z B;  4IRI A;  3N4M A;  1QO0 D;  2VT3 A;  1HXD A;  3CO6 C;  2UZK A;  3DXJ F;  4MGR A;  2DPU A;  4P5O A;  1ON1 A;  4BHC A;  2HR3 A;  3F23 A;  3J7A O;  1UHM A;  2DU9 A;  2AS5 F;  2OA4 A;  1G3Y A;  3P9I A;  2QM3 A;  4WXC A;  2P5V A;  3ZMZ A;  3U9G A;  4G6D A;  1KQ9 A;  5BS6 A;  2ZBK A;  1XB4 A;  3NQO A;  1JHF A;  4UHT A;  4HX4 A;  3I4P A;  1HSJ A;  2ZME B;  4K2E A;  1IW7 F;  4RB3 C;  1RI7 A;  6PAX A;  1WKM A;  1CF7 B;  2IT0 A;  2OQR A;  5A2Q Z;  5CYV A;  5D5U B;  3RPQ A;  2F5C A;  5HLI A;  1EH6 A;  5KK1 A;  1MGT A;  4A6D A;  4A2U A;  5E8G A;  4QLC U;  3C1D A;  2JPB A;  4OMY A;  1TNS A;  1L3L A;  1ZN2 A;  4CGZ A;  1OYI A;  2F5D A;  4FHT A;  2IPQ X;  1W4M A;  1ODD A;  4KUM A;  2C6Y A;  2VOD A;  3T8R A;  2YX4 A;  2HZT A;  2FRH A;  1O3S A;  5D6F A;  3ECO A;  2XVC A;  3R0J A;  4RGU A;  3GUD A;  4EMS A;  3F6V A;  1FLI A;  2QWW A;  3I71 A;  1S6L A;  5L3C A;  4R8H A;  1TBX A;  2RV8 A;  3V7R A;  1K78 B;  2LSO A;  3PQK A;  4O3M A;  3ZMS A;  1BJA A;  4AD9 A;  3P9C A;  4HV6 A;  4L5I A;  3E97 A;  2FML A;  2VN2 A;  3JAM K;  2E7X A;  2DK8 A;  4CYD A;  4M6X A;  2Z33 A;  2Z99 A;  3FM3 A;  4A0X A;  2L01 A;  3VOD A;  2COM A;  1U5T A;  2O6G E;  2FOK A;  3FHZ A;  4G94 A;  1ZRD A;  2EK5 A;  3JSO A;  3DPL C;  1U5T C;  1WWX A;  2FU4 A;  1WRJ A;  2DO7 A;  1TW3 A;  3M7G A;  4I09 A;  2NRA C;  1R1V A;  1B9M A;  1BM9 A;  3HUG A;  3TQN A;  3ZMV A;  2QUF A;  3T0Y A;  2STT A;  3IHU A;  4KFC A;  4O5V A;  2A5Y B;  4UV9 A;  3JAM Z;  3IKV A;  4S04 A;  3I5U A;  3LAP A;  2CG4 A;  5LLQ A;  1FC3 A;  2R7F A;  1KU9 A;  4ZZL A;  1G3W A;  3LA2 A;  1FYM A;  2OU2 A;  2FF4 A;  1KYW A;  5LHG A;  1G4D A;  1XCV A;  1YIO A;  4OIQ F;  4I02 A;  2XKO A;  4CXF A;  2DLL A;  4PDK A;  3BOQ A;  2NYX A;  4ESB A;  1UFM A;  5ICE A;  3MEX A;  2K7L A;  1XN7 A;  3I58 A;  3BRO A;  3W6K B;  3WE3 A;  4ZYG A;  4MTE A;  3TDU C;  4OIR F;  1SFU A;  5EEH A;  1YTY A;  5D8K B;  4TV7 A;  2YSR A;  2ESH A;  3M9A A;  2JSC A;  4HDV A;  3KE2 A;  2YX7 A;  1E17 A;  2VC0 A;  2LF7 A;  1MJA A;  1WSU A;  1J5Y A;  2PJP A;  5HLH A;  4BHB A;  3I53 A;  1BI3 A;  2ADU A;  2MH2 A;  4MNU A;  2A69 F;  1ZG5 A;  1OR7 A;  3AAF A;  3LQR A;  3BWG A;  3H92 A;  1UB9 A;  4HAM A;  1TW2 A;  1PDN C;  4KMF A;  3SZP A;  1FYK A;  5D5V B;  1XCB A;  3KLO A;  4A5N A;  3L00 A;  1GVJ A;  2P7V B;  2EB7 A;  1LDD A;  3HOS A;  4R79 A;  5DUI A;  4EM2 A;  3IKT A;  2NNY A;  2CWE A;  2ACJ A;  4QWQ A;  5CVJ A;  3E5X A;  1H0M A;  1OMI A;  2XHK A;  3QAH A;  2VBZ A;  4YFN F;  1FBS A;  3P9K A;  4HQE A;  5BPD A;  1JE8 A;  2HEO A;  4ENJ A;  2DW4 A;  5HDN A;  3E3V A;  3JTG A;  2F5E A;  3TO7 A;  2HOE A;  2FQ3 A;  2A61 A;  3I64 A;  1SD7 A;  2A68 F;  5FB2 A;  3LWF A;  1YS6 A;  1Z05 A;  2VBX A;  5FFX A;  1BIA A;  2L4M A;  1IN6 A;  4I98 B;  2V1U A;  5DCM A;  1Z91 A;  3GLX A;  1IF1 A;  3F21 A;  2K27 A;  3VEP A;  4G7H F;  3WGG A;  2Z9O A;  2QQ9 A;  3I0T A;  4L0Y B;  4RB1 A;  1JXS A;  4BAY A;  4ZYD A;  3MZY A;  3RDI A;  4KNY A;  1TTY A;  4IRH A;  2Y75 A;  5CVR A;  2R3S A;  1J9I A;  3T5X A;  2F5F A;  2GA2 A;  4ESJ A;  1UCR A;  2V1D A;  1FWZ A;  5DYM A;  5HDG A;  4L18 B;  5FD6 A;  1V3F A;  1SMT A;  2ESN A;  3QP6 A;  5LGU A;  2KIF A;  1K79 A;  3VB2 A;  2PLY A;  4EGY A;  4N0B A;  2CSO A;  2OD5 A;  2MBF A;  2OZ6 A;  3BZ6 A;  2EV0 A;  4AIH A;  3SFZ A;  4PGG A;  1F4K A;  3HHG A;  1RUO A;  1U5T B;  1Z6R A;  2OAZ A;  5CVV A;  2XAF A;  3WGH A;  2STW A;  1HST A;  3F3X A;  4OMZ A;  4EJV A;  2GXB A;  5DEQ A;  3E6D A;  3RKW A;  2HQN A;  3M8E A;  3TDZ C;  4Q48 A;  3VOE A;  3BDD A;  5HS9 A;  2WWY A;  3BPV A;  1LEB A;  3EYY A;  4WX9 A;  5L3B A;  4YFK F;  4U7D A;  3NEU A;  4HOB A;  2EV6 A;  4AWX B;  1D3Y A;  1W5S A;  4A0Y A;  1QGP A;  3T1B A;  3ZPL A;  1FOK A;  1IAW A;  4A0Z A;  3KP7 A;  3F8N A;  3IRR A;  1XSX A;  5BOX A;  1SMY F;  4XBF A;  4HW0 A;  1YQA A;  4D0P A;  4G9Y A;  4EJU A;  3W6J B;  3SXY A;  4FX4 A;  1SAX A;  5F6F A;  1W7P A;  2W25 A;  3B73 A;  3EET A;  4Y13 A;  5J8C A;  1R36 A;  1I6X A;  3FWE A;  5ILS A;  4RB2 C;  1ZGA A;  4RGR A;  1IXS B;  1BBY A;  1I1G A;  2JTV A;  5BPI A;  3F22 A;  4MQ9 F;  2IA1 A;  3KP4 A;  5CJ9 A;  3WOD F;  4L9N A;  5LEK A;  4A6E A;  5L3G A;  1IRF A;  2Z3Y A;  5E17 F;  1FSE A;  2KJB A;  5E18 F;  1KYZ A;  3GXO A;  3KFW X;  4UVC A;  5D4R A;  1FZP B;  2HTS A;  2VXZ A;  2Y0M A;  2VT2 A;  2GZW A;  4EJT A;  3GF2 A;  3DKW A;  3U2R A;  1MJ9 A;  1KQ8 A;  2K02 A;  3LA7 A;  4Q5S F;  2A3S A;  3I59 A;  3T8T A;  2WTE A;  1HW5 A;  4ZYE A;  4M72 A;  5JR3 A;  1HQC A;  3V7S A;  5ICG A;  3L09 A;  2QEN A;  3KP2 A;  2HDC A;  5DD4 A;  5HS7 A;  2UXX A;  3FXR A;  1LDJ A;  1YS7 A;  4BH9 A;  2DBB A;  1I1S A;  4MHG A;  1HKS A;  1STZ A;  4LMY A;  1OYY A;  2R7D A;  1ZAR A;  1TQI A;  2DAO A;  2M87 A;  3WU1 B;  1GXP A;  2P5L C;  3V4G A;  3BY6 A;  1SD4 A;  5D4S A;  5HVQ C;  1BC7 C;  1FP2 A;  2NS0 A;  5E1W A;  4LLG F;  3RYP A;  5K5R A;  2ZO4 A;  4IVN A;  3GZ6 A;  1U78 A;  3KP3 A;  2V1X A;  3CUO A;  1ZLK A;  4WCG A;  2QBY A;  2JPC A;  1MZB A;  1S7O A;  4LB6 B;  1KGS A;  1R23 A;  3DPT A;  3J81 K;  2BV6 A;  1JGS A;  4WXH A;  1S7A A;  4B8X A;  1RIO H;  2FA5 A;  1R00 A;  2P6S A;  3V8K A;  5D5W B;  4LK1 F;  4IXA A;  2ELH A;  1C0W A;  1HKQ A;  2QYO A;  4BNC A;  3MFK A;  5DCM B;  2OQG A;  2XKP A;  4KMU X;  1ZLJ A;  1ZYR F;  1P4A A;  1PUE E;  1DPU A;  1FYL A;  4OIP F;  1KA8 A;  1CGP A;  3CUQ A;  4XRF A;  3L2C A;  3MQ0 A;  1VTN C;  2VE9 A;  3GFL A;  5H6R A;  2K86 A;  3GFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...