5IYBJ

Human core-pic in the open state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iybJ00
4B4CA 4GFBA 1GT0C 3H3VK 3S1MJ 1MNMC 1A6IA 1QRYA 1FIPA 3PO2J 2XPWA 2D5VA 2NS8A 4RBOA 3Q0UA 2CRGA 2FJ1A 5E3MA 4I76A 5IYBJ 4XRSA 2EZKA 4M3DA 1LE8A 2NS7A 3CQZJ 2O7OA 1WH5A 2R7ZJ 2KDZA 2MW8A 3D1NI 2JA5J 4BBSJ 4XIDA 4JX5A 1IJWC 2EH3A 3K2AA 4QSHA 2XB0X 5E3OA 5JLXA 2ID6A 4CYCB 3JREA 2HDDA 3HEFA 4W1UA 5GPCA 1JTYA 2P81A 1JJ8C 4XK4A 1B8IA 2M0CA 4G12A 5F0HA 2E2JJ 3S14J 1FTZA 2M34A 2MG4A 1SFOJ 3Q0WA 1JUPA 5GP9A 3TP0A 2VKVA 5J1YA 4QTRA 2VUMJ 3GTLJ 2MGQA 3DEWA 1HCRA 2ECCA 2ECBA 3JRGA 2HXOA 1G2HA 1VF9A 2VKEA 3RZDJ 2DA1A 4A3LJ 2MSYA 3S16J 1IGNA 3BQYA 3E7LA 4BY7J 1GDTA 5JLWA 5C4XJ 4D7NA 2L9RA 4IEJA 1FJLA 2E2HJ 1BJZA 4M3FA 4EEFG 1K61A 1B8IB 5IP6A 5F0CA 2WAQN 4MFDA 1AHDP 3BG5A 2RAEA 5FKMA 2M9HA 1POGA 2G0EA 2DA3A 2XGEA 3TEDA 1ZQ3P 3HOZJ 1U9OA 4W97A 1Z0XA 4RDUA 3GTGJ 4JX4A 1JTXA 2I10A 3JRCA 1OJLA 2OF7A 5IPAA 4BY1J 2CQQA 4DZJA 4C2MJ 1UMQA 1Z77A 3ZQLA 3JRAA 3QPLA 4AUXA 3H0GJ 5FKNA 3G1LA 3LNQA 1HF0A 3MN2A 2Y0SN 2IBDA 5F04A 4A3GJ 3O8GA 1XC5A 3GTOJ 2XB5A 5EGOA 2WV1A 1MBJA 3FKIJ 4CYCA 1MH4A 2EZHA 1DU0A 2ZB9A 2DA7A 5M3FJ 1TC3C 3DCFA 2JA7J 2COBA 1Q1VA 1U9NA 2DTZA 3Q3SA 2DJNA 5E3LA 4FE4A 2Y30A 1R9TJ 3GBGA 3TP3A 1RETA 3BTCA 3MVPA 1MBFA 5M3MJ 3G1OA 1WGXA 3K7AJ 3QPSA 5J1UA 1JKRC 2LY9A 4JP0A 1IDZA 2XRLA 2DMQA 2LFBA 1HOMA 3HOXJ 3HOWJ 2CJJA 2ID3A 4FISA 2XSDC 5EGOB 1T33A 2XGCA 4MLOA 4M6VA 3BR2A 3JR9A 2ELKA 1JUMA 3I4NJ 3OSGA 1D5YA 3FK6A 1X2MA 1JKQC 3GTJJ 3JRFA 1IG7A 1E3OC 3HOYJ 2NVYJ 5FKLA 1ETXA 3S2HJ 2FQ4A 1ETQA 3M4OJ 3O8HA 2O9LA 4M3BA 4X6AJ 1JT0A 4A93J 4S0HB 1MBKA 4M3GA 1ETYA 4A3IJ 3HB9A 4FE7A 3B6CA 1IUFA 4A3BJ 3BTLA 4UUTA 1WCMJ 3A02A 3UKGA 3RZOJ 2LK2A 3FISA 1ZR2A 3S1QJ 2ME0A 1RR7A 1P7IA 1TWFJ 1DU6A 4C3IJ 5FLMJ 1IC8A 2DA4A 3SJMA 1PUFA 4V2GA 2CU7A 2L7FP 3ZQIA 5M5XJ 2NVXJ 1I6HJ 4FCYA 2GBYA 2JK3A 3PO3J 3ZOBA 1LE8B 1UHSA 3HGYA 2TRTA 3PM1A 4MFEA 2OPTA 5J1RA 2R5ZA 1U78A 1ETWA 2CUFA 1F43A 3ZQGA 2E2IJ 3CDLA 3S1RJ 5EYRA 4X1EA 5K7HA 2R0QC 3M3YJ 5EZHA 3F0CA 4J19A 2JN6A 2LVSA 3ZQHA 1GUUA 9ANTA 5F08A 4ABZA 5J3LA 5M5WJ 1JJ6C 1AU7A 2TCTA 1QPIA 2EZIA 1MBEA 1BW6A 3S1NJ 1H8AC 3SDGA 3NARA 2HYJA 3RKQA 1BA5A 2YS9A 2LD5A 1YRNA 5IYDJ 4XRSG 1O4XA 2ME6A 1ETVA 1SANA 1ITYA 3OIOA 2R5ZB 4M3EA 2GM4A 4XICA 4QIWN 2HOTA 2XGDA 5F1JA 4I6ZA 1MH3A 1ZKGA 5F27A 4DYCA 1APLC 3TW6A 1RKWA 1OFCX 5IP9J 5K7ZA 3BR0A 1MSEC 2Y9YA 4MIMA 2AHQA 1RESA 5F0FA 3S17J 1VFCA 3IH3A 2Y2ZA 4Y52J 4DYRA 1YRNB 1MSFC 1RKTA 2XPVA 4Y7NJ 3CMYA 2DMTA 4L5EA 3BR3A 2FD5A 1ETOA 4MO7A 5EEAA 1WI3A 5DS9A 5EZGA 3VPRA 1NTCA 3BR6A 2O8KA 3BG3A 3Q0VA 1OCPA 3GTPJ 2M2EA 5IOZA 2EBIA 2R92J 4A3CJ 1FTTA 1JUSA 4BBRJ 1LFBA 3JRIA 3BT9A 3IH4A 3LSPA 1WPKA 1F36A 1JKOC 2LR8A 2X6OA 3BTIA 2JA8J 2DA2A 2DA5A 3LSGA 2EQRA 1MBHA 3C2BA 2VI6A 2DMNA 1BL0A 2DN0A 3HKZN 1CQTA 2GLOA 4JX6A 3GTMJ 1GV5A 1VNDA 2EZLA 1XS9A 3I4MJ 5IOYA 3GTQJ 1FIAA 2IEKA 1ENHA 2L0KA 1T56A 2L7ZA 1H88C 2YUSA 2R93J 1ZR4A 2AO9A 5FKKA 4DZPA 3NAUA 4IHWA 4D5CA 3FIWA 3G1MA 5C4JJ 2X9DA 2LKXA 2H8RA 1W0TA 1AKHA 1QVTA 3HOUJ 1BW5A 4A3JJ 2L7MP 3CCYA 2Y31A 3GTKJ 3SFIA 1ORKA 5HODA 5C3EJ 2NOGA 1X2NA 4FTHA 4UUSA 2IAIA 4XRMA 1IV6A 2KT0A 3HGGA 1NK2P 1P7JA 2JWTA 2M8GX 2PMZN 4A69C 5EF6A 3TW7A 4A3EJ 1GV2A 3WHCA 3W6VA 4DW6A 3BR5A 4IHVA 3MKLA 5FLVA 1VI0A 2WB1N 1I50J 5C44J 2X48A 2NVQJ 4IHXA 1I3QJ 5DTDA 1AKHB 1HDDC 5IP7J 1JGGA 1K83J 1S7EA 1ZTRA 3ZQCA 2HOAA 3HBLA 4A3DJ 4A3MJ 5E3NA 1W0UA 2LLKA 4UUSB 4BKXA 1FEXA 2K9QA 1IDYA 5EDNA 5M5YJ 2JMWA 2LP0A 1TWAJ 2W48A 4C3JJ 3LSJA 1PUFB 1OCTC 3OSFA 2H1KA 3HM5A 3LOCA 1XG1A 2HI3A 2R5YA 2K9SA 2YU9J 2E1OA 1Y1WJ 3S2DJ 1Y1VJ 3IH2A 3BTJA 3OOUA 1IRZA 4AC0A 5K7FA 2DA6A 1WH7A 2JA6J 4D7MA 2K9NA 5EG0A 3QQAA 2QCOA 4DYQA 3A01A 1A5JA 2HOSA 3JRBA 2NVTJ 2FX0A 1QVUA 4A3FJ 3ZQFA 1TWGJ 5FKOA 2B63J 3A03A 3LSRA 1HDPA 1MBGA 1H89C 1EF4A 2CQXA 4JYKA 2R5YB 5BNGA 4C3HJ 2DMUA 2LTPA 3IV5A 1ZGWA 1JT6A 3BG9A 2HXIA 2K40A 5GPAA 1B72A 2CUEA 5EG0B 1LFUP 4D5FA 2QF7A 3JRDA 3JRHA 3A01B 3BR1A 2XPUA 1X58A 3RQIA 2N8GA 2E19A 1GVDA 4A3KJ 2Y9ZA 1HLVA 4HNVA 1ETKA 3HDDA 4AYBN 1JKPC 4LOCA 4BXXJ 1UG2A 2HQ5A 2JJ7A 1TWHJ 4NDLA 2VPRA 2DMPA 5FJ8J 3L1PA 4IHYA 1RPWA 1B72B 1ZK8A 1U8BA 4V2FA 1TWCJ 4B3AA 4B1RA 3B6AA 5IYCJ 3WHBA 3BQZA 3HOVJ 3S15J 1NK3P 3FK7A
chains in the Genus database with same CATH superfamily
2DO7A 4XLNF 1GT0C 3H3VK 1BM9A 3S1MJ 3WTWC 5H6RA 3IWFA 3S8PA 1A6IA 1XSXA 3CMEI 2VOPA 5LGNA 1K6YA 1QRYA 5BPIA 3SYTA 2IJLA 4HG2A 4CCMA 2NS8A 2CRGA 3VYUB 1TT5B 5IYBJ 5K5QA 2DDBA 3BY6A 2WAQA 5HDKA 4OINF 3CQZJ 2JQ7A 3M8EA 4V19K 2KDZA 2R7ZJ 2JA5J 4IKFA 3S32A 4XLPF 4QSHA 2QSHX 3DU5A 2Q8KA 2ESNA 5D5WB 1T0FA 3QWLA 3EUKL 5ICEA 2M4KA 3DTKA 1XDSA 2OCEA 3SFZA 4M72A 4J01A 2E1CA 1B8IA 1B9MA 2M0CA 2M4GA 4G12A 4G6DA 2QA4I 2ZFUA 2M34A 3KX2A 2Z2SB 2K5CA 2MYSA 3OS0A 5B1BH 4HPQA 3F8MA 1LB2A 2VUMJ 5J1YA 4A6DA 4B3XA 1XCVA 2MGQA 3P9IA 3CDHA 3JAMK 3DPUA 1MMSA 2IS6A 4ESBA 1Z91A 2QQBA 3H0DA 4HOBA 5E1XA 3D5RC 4HA8A 3S16J 4D0PA 2VJIA 3BQYA 1BI0A 4D7NA 3V4GA 2P8TA 4XSZF 2L9RA 1ZRDA 3CD6I 2VN2A 4IEJA 1GLNA 3ZCOA 4U88A 2E2HJ 3HHHA 1MMDA 3OWTA 2X51A 4CA0A 1V5GA 2VC0A 3HRUA 3R0JA 1KYZA 4ZYHA 4KT6A 3TGNA 2M9HA 1POGA 2NS0A 3TO7A 3K4JA 3ZN0A 5LRSA 3OYCA 5FRMA 2ZCWA 4UY8I 4YRVA 3E5XA 1YYVA 3N05A 4RDUA 3GTGJ 1KQ9A 3GCMA 2DPDA 3HSRA 3QPTA 5GAGJ 1E0EA 3QOEA 3ZQ7A 4A12A 2R7QA 4FQGA 3UR3C 5AIPA 2LY2A 3DBHB 3LA3A 3DQVC 4IL6C 1UELB 2ELJA 3KETA 3EETA 3OR1C 1Y0UA 1WJBA 2Y0SN 3ZXSA 4N4NB 4L9TA 5F04A 3O8GA 5F64A 5LEJA 3FM5A 4AIHA 2XB5A 3TOBA 2HGCA 4CYCA 5L3GA 2EK5A 5FLXK 3DFGA 1MH4A 1DU0A 1KYWA 4EJOA 2DA7A 2A5YB 3DCFA 3ML6A 4UHTA 2JVGA 2QBYB 1UFMA 1Q1VA 4Y15A 1EH7A 3Q3SA 3M9AA 5E3LA 2Q2EA 5IT3A 4ZZDA 3TP3A 3PSFA 4EJVA 2QYOA 3ABUA 3J7AY 4PUSA 1MBFA 2OZ6A 3QPSA 1IXCA 5J1UA 1JKRC 3OIQA 2DMQA 2HZTA 2OQRA 4MNUA 4G7OF 4BACA 3RKWA 2LFBA 1YOVB 2MD0A 1O3TA 4BQNA 3MZHA 2ID3A 1SD6A 2P5LC 2V9PA 2WB1A 2XGCA 3KFWX 4IJAA 3L2WA 1USTA 3BR2A 1B4AA 3JR9A 2GXAA 2ELKA 5TISC 3L2VA 1MNEA 4KIGA 1X2MA 3U21A 2V9VA 3HUGA 4KJZA 2HTJA 2P5KA 1MDMA 5FD6A 4BS9A 2FQ4A 4HV6A 5FD5A 4BQAA 1DP3A 1Y0NA 2F2EA 1BI1A 2KIMA 4A2UA 1JT0A 1YI2I 3K6GA 1P4WA 4M3GA 1F1ZA 2FE3A 2XKOA 4MTEA 4A3IJ 3HB9A 1QZZA 1TQIA 2L7KA 4EQQA 4Y33A 2HNHA 1OR7C 2LC2A 1IUFA 3V42A 3FXJA 1QNTA 4NUBA 2LK2A 4IF4A 3S1QJ 3BG7A 2ME0A 2PN6A 3FF5A 1RR7A 2E5NA 4OAZA 3CCQI 4HF1A 1TWFJ 1Z05A 1IC8A 2OA4A 4OWRB 2E1MC 3SJMA 2NVXJ 3ZQIA 1QA6A 4C2TA 1W36D 2XAQA 4FCYA 4F55A 2GBYA 2JK3A 1LE8B 4D1QA 3PM1A 2OPTA 4O6JA 5J1RA 1TLHB 1MIJA 2DYSH 4BHCA 3ZQGA 3CDLA 4NBQA 5JFRA 2R0QC 3M3YJ 5EZHA 1U0JA 4HBLA 3LAJA 4YFKF 4EM1A 2QQ9A 2LOOA 3H3UA 3UNGC 1KQ0A 4ABZA 1LPQA 2PI0A 1GXPA 1JJ6C 2KRCA 1W7PB 2TCTA 2BVLA 1PP8F 4MEXF 3RKQA 1X3UA 3L2UA 1OMIA 5IYDJ 4LK0F 2ME6A 4NC6A 4HZFA 2GIZA 5ILSA 1RC9A 2JVHA 2BE5F 3DKXA 1X1CA 5CQGA 3QU6A 3MQ0A 3AG1H 3HOSA 4I02A 2KZVA 1FC3A 3WTVC 4ENMA 4KYWA 4ITVA 1QHHD 2DLLA 1UB9A 1JI8A 3MMYB 1C0WA 3TW6A 5BMZA 3D0SA 4HLYA 4KMFA 2OBPA 3K4MA 3QP5A 2KZGA 1MSEC 1N78A 1U6GA 2VT2A 2IVMA 3CLOA 2AHQA 4AVPA 5DCFA 1ZREA 3W3CA 2K86A 2KRHA 1IRFA 2Y2ZA 1J09A 3E6BA 4LIVA 1UCRA 4Y4RA 1D0YA 1RKTA 3P5JA 1YRNB 3PNTA 2FD5A 5LHIA 1ETOA 2BHYA 3AAFA 2DFIA 2F5DA 2VBWA 5EEAA 3ABTA 3K1NA 2M3AA 4EGYA 3BR6A 1HBXG 2XF7A 3Q0VA 2OU2A 2GA1A 2GQQA 2QQ8A 5CPRB 2ACJA 4A0XA 3BPXA 4E7LA 2EBIA 2R92J 1LFBA 4OOIA 3JRIA 3KP6A 3IH4A 2L9SA 4XKCA 4U7BA 3LWFA 1ULYA 1X1DA 1F36A 1QQIA 2ADUA 2KFDA 2LR8A 3E3VA 5ILUA 2JA8J 2DA5A 4WF2A 2EQRA 3TQNA 4R8HA 2KHMA 4KISA 3GLXA 2VLAA 1CQTA 4RB0A 3IC7A 1USSA 1XS9A 4GYIA 4O5VA 1FIAA 2DFHA 4G8XA 2IEKA 2ZC2A 2RNJA 5A2QZ 1TZLA 4XBFA 4BEHA 1T56A 2VQHA 2R93J 1FP2A 4HNUA 2CQ7A 2OD5A 1W5SA 5ICCA 5LFAA 4RM2A 1BR2A 1I3AA 2IRFG 4DZPA 3KPHA 2W1OA 5HLHA 1I1GA 5L3EA 3P9KA 2WC2A 2K27A 2IP2A 3DLAA 1JXSA 4I0BA 2M45A 2Y31A 3ZMTA 2FUG2 3C7JA 1ORKA 2EIMH 5D4RA 1D5VA 4BJTA 4QPQA 3C2HA 1X3ZB 4CZZA 2JPCA 3SDBA 4EM0B 4BE1A 4PFPA 5DD8A 1KZHA 2PJPA 2FXAA 3HSEA 5FLVA 1GXQA 1G4DA 1Z6RA 2BW3A 2FF4A 2K85A 2DFFA 3DWLE 4GGGA 1STZA 4LB6B 2O03A 5DTDA 1J9IA 2V79A 3H35A 4ZYGA 1XN7A 3MEXA 3ZQCA 1NG6A 2VJ5A 2DAOA 4E70A 5E3NA 2NYXA 2WWYA 2VE8A 2I8DA 2M8EA 4BKXA 3CDIA 5D6EA 2K9QA 2DT6A 1PJRA 4MQVA 2LREA 4YEJA 4C3JJ 1PUFB 4RM3A 1YJ9I 1O3QA 1NG7A 1U5TA 1OCTC 3U9GA 3OSFA 1MKMA 2H1KA 4XOPA 3LOCA 4A5NA 2HI3A 2R5YA 3RKYA 1FYMA 4RS8A 3P9CA 3NEUA 1X4OA 3DBRB 1IRZA 4S05A 4KICA 5K7FA 1M1EB 3OYLA 2R7WA 4D7MA 3TL4X 2K9NA 3BROA 5EG0A 3QQAA 2QCOA 4DYQA 2FNAA 3G6EI 1A5JA 4F91B 2QZ8A 1XSVA 3H5RA 2B0LA 3H9QA 2NNYA 3EQLF 2KIFA 4M9ZA 4FX0A 4C9YA 2FX0A 2MLKA 1DPRA 3RIRA 2B63J 2LY1A 3A03A 1XSDA 1HDPA 3M7GA 4XR6A 2LDUA 2KJBA 3CUQA 4XKWA 3R4KA 1V5EA 4UV8A 1JT6A 3SXYA 2CV1A 3IAM2 3BG9A 2HXIA 3TMOA 2K40A 3I71A 2QF7A 1XGSA 1LDJA 2QKMB 2QQAA 3BCAA 3BR1A 3KCCA 4XMYA 2Z99A 1X58A 4LGWA 4RGSA 2ZNZA 4XN0A 3ABMH 4EV0A 3K4BA 4HQMA 2E19A 4HAMA 5HVQC 3KYLA 3H9GA 4HNVA 3OS2A 2V6EA 2A69F 3HDDA 2EILH 4AVZA 4CYDA 2Z1DA 1J75A 3H3ZA 1A35A 3WGIA 4HX4A 5FO5A 4WXHA 2DMPA 4IPAA 2JA2A 1YITI 2TDXA 1BOAA 3OYHA 4IHYA 5IT9Z 2IGOA 2YSRA 4EVIA 1U8BA 3K2ZA 5LBQA 1WHUA 1Z7LA 4B1RA 2F5VA 5IYCJ 4OMYA 3J7ZI 1TTYA 3HOVJ 4QWQA 2WAEA 1U2WA 1MNDA 2ZXWH 3KP4A 3WTTC 4B4CA 4GFBA 3WODF 3I9V2 3L09A 1Y56A 2X1CA 3E6DA 2A3SA 2EIJH 1Z1DA 3CLQA 3DV8A 1YW9A 2RNGA 4M73A 3PSIA 3FXOA 2F4IA 4XRSA 1VQ4I 3VWBA 4M3DA 3D1NI 1IUYA 4Q48A 1IJWC 2EH3A 3HTUA 3NWTA 4RAFA 5DCMA 3KIOA 3P7NA 2ID6A 3A0BC 4CYCB 2DT5A 2VT3A 4W1UA 5GPCA 3S3OA 4P96A 1FBSA 1WKMA 3QAHA 1SVOA 5AONA 5F0HA 3GX4X 3FX3A 2QSGX 2HEOA 3S14J 1FTZA 3F9KA 2XAFA 4YELA 4BJ6C 3TP0A 3DEWA 1T95A 1HCRA 3JRGA 2ECBA 4M71A 2KMUA 2CGPA 2VKEA 1W36C 3RZDJ 2DA1A 3DPLC 4N9IA 3NRVA 2MSYA 4J00A 1VZ0A 2BEOA 3FHNA 1G3WA 1GDTA 3FWEA 3LQRA 2MABA 2AS5F 4U0YA 2QM3A 4C30A 1YIJI 1QHGA 4UB6C 1FYLA 2ZFWA 4LITA 4L0YB 3V7CA 1HC8A 1F5TA 2WAFA 4HX7A 1B8IB 5DM6F 5IP6A 2QWWA 5E18F 1YO5C 2WAQN 4B48A 4BXFA 3BG5A 2RAEA 3LQQA 3J81Z 2ZJQF 4LB5A 1U8RA 1IN8A 4ETSA 1VQ8I 4JQFA 1U9OA 5CQEA 1ERDA 2P7CB 2P5VA 1OISA 2BZTA 3WG9A 3AL0C 5IPAA 3KP2A 4F92B 2DQRA 3A0HC 3M1EA 4C2MJ 5D5VB 1R00A 3JRAA 2DK8A 3H0GJ 5D4SA 5FKNA 3G1LA 3LNQA 2PFBA 1Y6IA 3J7YJ 3MN2A 4A3GJ 5L3BA 1SVLA 2R7FA 3CESA 3F8CA 3JTGA 2H94A 3TKYA 3ZMSA 5EGOA 1ZRCA 1YX3A 4RGUA 1MBJA 2FQ3A 4M6XA 3MZYA 5K5OA 3IRRA 5J8FA 3GEZA 3DEUA 4BQQA 1BR4A 4ZC3A 2DTZA 1SMTA 1IRXA 2DFEA 2IS1A 3CCLI 3GBGA 1RETA 1XX5A 1K79A 4BDYA 2X1DA 3LA2A 3AKZA 2XHKA 2HWVA 5H6QA 3O6BB 2CUZA 5HS9A 3G4SI 4RA2A 4BUPA 2WTEA 4ZYEA 4AWXB 3N97A 2V1XA 4LLNA 3DP7A 2OQGA 2CH0A 2P0WA 5FRNA 1SVMA 4BAYA 4IRHA 1FMVA 1BOBA 3I4NJ 3OSGA 3ZPLA 3FK6A 3JRFA 2LBFA 1IG7A 2COMA 2CYYA 4CXFA 2XV4S 1AA7A 2IGMA 2Q2EB 1ETQA 3M4OJ 3O8HA 1ZHFA 2JUCA 4I0AA 4YFNF 1IAWA 4X6AJ 2HQNA 4S0HB 1LNWA 1YQAA 2KL4A 2WY8Q 2EJRA 2LKSA 2R7OA 4KN7X 4IQJA 2EA2A 1WWXA 1MMAA 2R3SA 2XF5A 1D8KA 1R6RA 1W5TA 3BTLA 5GTHC 1WCMJ 2M7AA 5GADJ 3RZOJ 1ZR2A 1ON2A 4DJAA 4HRIA 2Z9OA 3DTIA 1V55H 1P7IA 4Z2YA 2G7UA 1RRJA 1DU6A 5E8GA 2FBKA 1OKRA 3HUGB 3HZJA 3T0YA 2CU7A 1MDMB 3G3ZA 6PAXA 2DQLA 4FHTA 2FSWA 4BU2A 5J47A 3WTXC 4CCJA 1IO2A 3GFJA 3LAPA 3PO3J 3FBIB 1WJCA 4HNTA 4EJUA 3VSKA 2W00A 4OMZA 1OPCA 4I99C 3ZMVA 1ETWA 2ISYA 2CUFA 1U78A 1R1UA 4E7HA 4CCOA 4QLCU 4X1EA 5K7HA 1TNSA 3CMMA 3L2CA 1GUUA 1E3HA 2YX4A 5F08A 9ANTA 1YS6A 2GA2A 3K4KA 4KA4A 4XL9A 2DT7B 3RCOA 2Y69H 3R60A 3ROUA 2PG4A 3RPQA 2ZNYA 3WTZA 1ZG5A 1S29A 2Y75A 3S1NJ 2OTJI 3NARA 3L2QA 1R22A 4IOAF 1BA5A 4F52A 5ICGA 2YS9A 2LD5A 2HR3A 1AWCA 1L3LA 3K0LA 1U3EM 1HSTA 2W84A 2OUMA 4M3EA 4UVCA 1LFPA 5GTIC 1G3YA 4L9JA 5K1YA 5ICFA 2HOTA 2XGDA 3DBLB 1I6XA 2ZSHB 4DYCA 1APLC 3CJQB 4B09A 5J4YA 2X6WA 3PUFA 3MFKA 4PSWA 3S3MA 2XVCA 3ASNH 1YJWI 4NHJA 3OIPA 2VQLA 2MLGA 3TO6A 3U2RA 1D0ZA 1RESA 5F0FA 2EA4A 3S17J 1VFCA 2KIUA 2E5ZA 4DYRA 2LKPA 1VQOI 4Y7NJ 5CVRA 3GVAA 2EINH 2HFHA 3GLLA 4UUVA 3S2WA 3MKWB 3I64A 2EFNA 1QGPA 2WBMA 1W1WE 2E1MB 2G9WA 2RDPA 3BG3A 1WQ2A 2DYRH 3WE2A 3I59B 2M2EA 3W2WA 2XRNA 5IOZA 5E17F 1FTTA 2KJCA 3EUAA 4BBRJ 1TNTA 1MD0A 4HSTA 1KU2A 1JKOC 4E7JA 2VQGA 4IO9F 2DA2A 1XGOA 3COAC 3WE3A 5ED4A 5CLSA 3LSGA 3MWMA 1MBHA 3C2BA 2FMYA 5HLTA 3ZR8X 3ELKA 3HKZN 1X4PA 3CC4I 3HXLA 1VNDA 2E7XA 3I4MJ 2DOEA 2QKLB 4LLGF 3V8JA 5L3DA 2F6CA 4B8XA 1SD7A 2PJRA 2L7ZA 1J5YA 2R7SA 1ZR4A 1PVEA 5LRRA 2Z16A 3CJNA 3JAMZ 4KITB 5KHDA 2AO9A 3I0TA 5E20A 1RR8C 4EM2A 5FKKA 3NAUA 4OU0A 3E97A 1IN7A 3OYBA 3OYJA 3HOUJ 1W0TA 1R5ID 1QVTA 2PQ8A 3E5QA 2WA0A 1F4KA 3PIPF 1FMWA 1DDNA 2LH9A 1YLFA 5HODA 2PLYA 3IL2A 2CO5A 2O0YA 4FTHA 4UUSA 3T8RA 2K9LA 1NK2P 1P7JA 2JWTA 1TP4A 5KAFC 2M8GX 4LMYA 2PMZN 4A69C 3TW7A 2QEXI 4H4KC 4HF0A 1W4MA 3K70D 4BEHB 4DW6A 1R5GA 3QP6A 4EJTA 4LFUA 2L4MA 3BR5A 2J5OA 1Z3YA 2PBIA 3CCRI 5C44J 1I50J 2JSPA 1XD7A 4LG3A 3CP8A 1I3QJ 3I5UA 4IHXA 5FROA 3OYKA 2K4JA 1PUEE 5IP7J 1S3JA 1K83J 3OYGA 1ZTRA 1JGGA 1A6QA 2HOAA 4B43A 1MJ9A 3KEYA 2F4OB 2BGCA 1IDYA 1UJ8A 2Y0SA 2JMWA 2LP0A 3LSHA 2L54A 2DI3A 2W48A 2I5UA 3FBNB 1J59A 3SZTA 2ZXJA 5FLXZ 5LLQA 3G71I 2JTVA 2E1OA 1Y1WJ 4WXDA 3S2DJ 3OV8A 1Y1VJ 3IH2A 2BW3B 3BTJA 3NWSA 4AIDA 4AC0A 2DA6A 1WH7A 1D8JA 3DF8A 5B3SH 3WTYC 3BZKA 2MD5A 3QRFF 1O7FA 5TGTA 4LIUA 3JRBA 1NHAA 3BJAA 3ZQFA 3IKVA 3CO7C 3PFYA 1MBGA 2X1EA 5JVGF 1H89C 3OMYA 2CQXA 1U5TB 1ZYRF 2ZJRF 2R5YB 2YX7A 5BNGA 4C3HJ 3LMMA 1O57A 2DMUA 4Q4ZF 2R4GA 4ZTFA 4B44A 4GXOA 1ZGWA 4NC7A 3MKYB 1IZ1A 1R58A 4PJ0C 5TRDA 3M07A 4JOMA 1B72A 4Q5SF 2CUEA 2EPFA 3OS1A 3KP7A 5EG0B 3BLYA 3F23A 1VQ7I 3JRDA 2ICWG 3HPHA 2H6CA 2IW5A 4N4OB 1MJBA 4MTDA 2FRHA 3FXMA 2BHZA 1ZRFA 4NQWA 1GVDA 4A3KJ 4E7ZA 4HF2A 4ZDPA 3CCUI 4AYBN 1JKPC 2A6TA 2JRTA 2VODA 1SMYF 3LFUA 1UG2A 1K78B 3OYNA 3LFKA 4ENNA 3CCSI 2HZDA 1EV7A 2H8WA 4CCKA 1SFKA 5JHFA 1DGRM 1BC8C 2OJED 2V9KA 4E4HA 2VPLA 4I01A 4LLLA 4XOTA 3B6AA 2ESHA 2DU9A 3F3XA 4LJZF 3ULQB 2XC7A 3S15J 1X1AA 1O3RA 2XSJC 1NK3P 2K4BA 2CV0A 2IXSA 1U5TC 1MNMC 3OL3A 2HS5A 2W25A 1B1BA 3F6VA 5B1AH 2UXXA 1FIPA 2CQKA 2XPWA 5GAEJ 5K5RA 2HVSA 2L02A 4HW0A 2D5VA 3BP8A 2LRDA 1LEBA 3Q0UA 2FJ1A 3FXKA 4I76A 1I27A 3PQKA 2EZKA 3C3WA 1LE8A 3ZMZA 1BIAA 1EH6A 2NS7A 2O7OA 1WH5A 4BXUA 3PJRA 4BBSJ 3PUBA 4JX5A 2OC6A 1ZH5A 3K2AA 2XB0X 1YJNI 1A04A 5E3OA 4I98B 1GVJA 2CQNA 5JLXA 3ZMUA 3JREA 1R71A 2HDDA 5E79C 2MBFA 3CUQC 1ON1A 2JT1A 5EJCA 1FP1D 4RAGA 2Y48A 1VTNC 4I09A 4CDGA 3CTAA 1SFOJ 1XDUA 3Q0WA 1JUPA 5GP9A 1UG0A 2VKVA 2ZXIA 2W4SA 3GTLJ 4XKBA 2OZUA 2VQCA 4ZH4F 2ECCA 2HXOA 1ODDA 3KP3A 1WJAA 2ZMEA 3GUDA 1OLTA 3BWGA 4GDFA 4F7ZA 2ZXHA 1IGNA 4BY7J 5JLWA 3ASOH 3VYSB 1ZLJA 5F1RA 4DOZA 5DCMB 1HSJA 3H9JA 1R36A 2VJJA 5B66C 4M3FA 4FX4A 4L5IA 4EEFG 3ECOA 4CGZA 1I1SA 3HG9A 3LSIA 4XORA 4Y17A 2V1UA 2ZKZA 2XAJA 3CF2A 5FKMA 4ZDOA 2Q1ZB 3PL8A 4UVBA 2XGEA 3QYEA 4YG2F 3TEDA 1J7KA 3LSMA 2VKDA 2XAUA 3BDDA 3ZP5A 2NAZA 1REPC 5D8KB 1Z0XA 2KPMA 2L3DA 1JTXA 1TW2A 2I10A 1OJLA 2OF7A 3JRCA 4BY1J 5E1ZB 5FGMA 1LJ9A 3ZQLA 2HQRA 1WI9A 4LK1F 4M9XA 3ZGKA 4D9JA 1RZ4A 1FZPB 4AM3A 1ZARA 1RNLA 1WRJA 4BHPA 2GOXB 4RGXA 1O7LA 3EYIA 3HPGA 3IUOA 2DXIA 4OIOF 2Y0MA 1XC5A 3QOPA 1LKXA 1R4NB 1T6SA 5LHGA 1FSEA 2QUFA 2VBYA 4BL0B 2ZB9A 1IW7F 1TC3C 1VQLI 1H9GA 2X0LA 4P9UA 3J80K 2Y30A 1R9TJ 4LG0B 3TOAA 3BTCA 1JGSA 3MVPA 1BN5A 1WGXA 2M30A 3OOPA 2A5WA 1SEUA 2LY9A 4JP0A 2XRLA 2KP6A 4RB3C 1WSUA 1YIOA 1VQ6I 2WADA 3HJEA 3IP4B 4CO8A 1HOMA 2VC1A 2PX9A 3E1SA 3GXOA 2DW4A 3HOWJ 2XSDC 5EGOB 2M0MA 3AG4H 4M6VA 1GHCA 5DYMA 1KGSA 4A0YA 1JUMA 1SD4A 1JKQC 1N25A 3GTJJ 3EPZA 3FXUA 1ETXA 4ENKA 3S2HJ 2QSFX 2V7FA 1HKQA 2O3FA 3BZ6A 1FT9A 2O9LA 4M3BA 3B73A 1V3FA 3AG2H 2RGVA 4PCQA 2Q0OA 4R1HA 5JR3A 2CW8A 1MBKA 3KLNA 4DQ2A 1ETYA 4RLQA 1MMNA 2RN7A 1HKSA 5CVIA 4PDKA 4PSXA 1XMXA 2RC4A 2XKPA 4YIRX 1E2XA 2X6YA 1IV8A 3AL0B 1UHWA 3UKGA 4UUTA 2E34A 2LG4A 3MKZA 3FISA 1WJ5A 2V4JC 1Y39A 3DXJF 1WFXA 5BPDA 4C3IJ 5HNHA 4RB1A 1EJ9A 2UWMA 1YW8A 3LL7A 3JSOA 2DA4A 3KYCB 4DIQA 2LBFB 1PUFA 2HVQA 3WU1B 4V2GA 1D0XA 2L7FP 1YW7A 5M5XJ 1I6HJ 4HSRA 2M87A 1LVKA 1Z21A 3DTEA 5JHUA 2EV6A 3ZOBA 3K70C 3X2QH 4UNOA 2O8XA 4RMNA 2PEXA 2R5ZA 3WGHA 2EFQA 2D1HA 4XONA 4ZJZA 3HHGA 3K9TA 3S1RJ 1J0RA 1MJAA 4U7DA 4F93B 3F0CA 4J19A 2JN6A 2E35A 3R0AA 4XNFA 4ZYDA 1A36A 3KEQA 4XLCA 3H5NA 3ZQHA 2HVRA 2NRAC 5J3LA 2P4WA 3CUOA 2RKHA 1FBQA 3C2GA 4II3A 3TDUC 4Y13A 4IQ4A 1MBEA 1BW6A 5J8CA 3MD2A 2P7VB 4Y3OA 5L3CA 5DDGA 1FOXA 5KCMA 4L5JA 4OIRF 2F5FA 1O4XA 2HTSA 1SANA 3BC8A 3I3LA 2B7EA 2VE9A 1FOKA 1OCRH 3CC2I 1P2FA 1IXRC 2GM4A 2ZSIB 3ABKH 4XICA 3A1YA 5F1JA 3CP2A 3DU6A 2EFOA 3IAS2 4I6ZA 5BS6A 4IOCF 1BI3A 3BJOA 5K7ZA 3BR0A 5GAHJ 2RREA 4HX8A 4XLFA 4E7IA 4A5MA 4II2A 3IH3A 4RGRA 3RSNA 2DCEA 5FFXA 3REOA 2IGNA 1MSFC 1PYVA 2XPVA 3CMYA 4U0WA 3CF5F 2DMTA 4L5EA 4E6KG 1G3SA 2KQRA 4WX9A 3G73A 5DS9A 1XGMA 1NTCA 1T2KA 2DDAA 2E60A 3EUHA 1R23A 4Z6YA 1YTYA 5EEHA 1OCPA 5ERIA 2KDOA 3CCMI 4A3CJ 1OYIA 4G94A 2AQEA 3KEOA 4IHSA 3F6OA 4HQEA 1BC7C 1WPKA 2X6OA 3BTIA 3FMSA 1T8IA 5CVJA 5IY5H 2GXBA 3GW2A 2P6SA 4L18B 2VI6A 2DMNA 3OR2C 1TW3A 3U1KA 2DN0A 3PFIA 3GTMJ 1GV5A 2EZLA 2IA1A 2V6CA 1ENHA 2XASA 2ZBKA 5H20A 3FXQA 4GRIA 1RUOA 4Q47A 4WXCA 1H88C 2YUSA 5KVRA 3LSKA 1SD5A 3FIWA 3G1MA 5C4JJ 2W57A 2LKXA 4L9VA 1AKHA 1P92A 1BW5A 4PZJA 4A3JJ 2NVUB 3KZIC 3ECHA 3GTKJ 3WGGA 3SFIA 4DBQA 1HW2A 5C3EJ 2NOGA 1S7OA 3HTSB 1DPUA 1X2NA 1IV6A 2KT0A 3HGGA 2FOWA 3FHZA 4CICA 3DPTA 4A3EJ 2R7XA 3WHCA 2O61A 2BY0A 4UV9A 2PJRB 2M7BA 4H0EA 5CKTA 3BJ6A 4IHVA 2IS4A 2DBBA 3VOEA 5KK1A 1YFHA 2WB1N 1X19A 2MC4A 3F8FA 2HPMA 5EEGA 4C2UA 1KA8A 1QBJA 1EA3A 3F8BA 1OYYA 2PMUA 2DPUA 3FMQA 3HBLA 4A3DJ 2VL8A 4A3MJ 1HA8A 3GMEA 3FZVA 2LLKA 2XAGA 4HLXA 4UUSB 4NNJA 3VEPA 1IN6A 2MA3A 4PJLA 4M74A 2EB7A 2BY2A 1TWAJ 4RAZA 1BI2A 5L3FA 5DM7F 3LSJA 1FPQA 4O3MA 4G6TB 5FB2A 1VQMI 4ASNA 3HM5A 1TQPA 2GWRA 2XIGA 4IHTA 1FNNA 2X4HA 1V54H 2ISZA 2PMHA 4ZDLA 2JRMA 1W5CC 2MC3A 3HIFA 4YIIA 3RJPA 1CF7A 3GYHX 1KQ8A 1QU3A 1XCBA 3K69A 2KISA 3T8TA 3A01A 4I7HA 3PNYA 3Q9SA 2HOSA 2HKXA 3WG7H 5LGTA 1E17A 3G2BA 3RTRA 4GYGA 2NVTJ 2YU3A 1QVUA 4CH7A 2CV2A 2XGXA 3OYEA 3LSRA 3BZCA 3SEZA 3M8JA 1MGTA 4JYKA 1T98A 1YHQI 1WZ2A 2LMDA 5DUIA 3VSLA 3F22A 4EMSA 3HOTA 2W85A 4CHUA 1B6AA 3C18A 3HRTA 2JZYA 1IN4A 1A31A 2L4AA 3JRHA 3FM3A 1K4TA 4JBAA 3GFLA 1OYWA 1S8NA 3VYTB 1S9HA 2ETHA 3KYDB 2VJ4A 5DUKA 2Y9ZA 1HLVA 3L2RA 4XRFA 1O3SA 2HQAA 2BXZA 4BXXJ 1IRGA 1ZAOA 3I53A 2HQ5A 4EATA 5JVTA 4ESFA 3ONQA 5CYVA 1TWHJ 4NDLA 3F72A 3SZGA 1B9NA 2H6BA 1RPWA 4GO1A 2F48A 4IZZA 1FY7A 1ONVA 1D3YA 2RVCA 3KE2A 1B72B 4PFOA 3GZ6A 1TWCJ 4I2OA 4B3AA 1SC7A 2QLZA 4OIQF 4ESJA 5BOXA 2CFOA 3BQZA 1Z67A 4E7KA 3MAJA 3VDXA 1XMAA 1VQNI 1BR1A 2IGKA 5E1WA 3IRQA 4NQWB 5HDGA 1E3PA 2J5PA 3E6CC 1S6LA 4IRIA 4KNYA 1FOYA 5BQTA 3WTSC 2IS2A 1Y8QB 4HEA2 1R5HA 2XUBA 4XKVA 4XSXF 1K6OA 2VIXA 1DUXC 3PO2J 2UUZA 2IA0A 3GWZA 3GFIA 3HRMA 3FKJA 4RBOA 4KT5C 5E3MA 3GO5A 2F5CA 1YX5A 4G7ZF 1CGPA 1LDDA 5HLGA 2HPIA 3S3NA 3FXRA 2MW8A 4XIDA 3DEEA 3BPVA 1Z9CA 3F8NA 2CW0F 2NNNA 3ZRGA 5JI6A 2ELHA 2Z33A 2KLOA 4BNCA 3JTHA 1WJEA 3L7WA 3HEFA 4EJWA 1QZYA 4HV5A 1ZGJA 2V1DA 3E0JB 1JTYA 1S5LC 2P81A 1JJ8C 4XK4A 2UZKA 1IN5A 4UXNA 2OCCH 4G9YA 3D5SC 3O2PE 2E2JJ 2IT0A 1ZGAA 1S7AA 1ZG1A 1NH3A 2MG4A 4A6EA 5A2QK 1IF1A 4QTRA 3BOQA 2EWNA 1JHHA 4PGHA 3ZQQA 2R7RA 1X3WB 3V8KA 2D45A 2DTRA 1QPMA 3LA7A 1OCZH 1G2HA 1FWZA 1VF9A 4BE2A 3K4NA 3B02A 2LSOA 4A3LJ 3K4CA 1H9TA 2IA2A 4HYEA 3VYRB 2QVOA 1B59A 3E7LA 4QPOA 5C4XJ 1I5ZA 2E71A 2EV0A 5LGUA 4KIFA 4UVAA 1FJLA 1ZELA 1FX7A 4YFXF 4A0ZA 3R61A 4B47A 1BJZA 2F5EA 2Z5UA 3K1PA 2VXZA 2L01A 2NOJB 2ZJPF 4BH9A 1K61A 3Q5FA 2LF7A 5F0CA 4EGZA 4MFDA 1AHDP 2FBHA 2FMLA 3RDIA 2KRFA 2YPRA 4IVNA 2G0EA 2DA3A 3L9FA 3RI4A 3AFHA 1LQ1A 1ZQ3P 2G7HA 2HDWA 1OR7A 3OL4A 4YIFA 3HOZJ 3CJRB 4XLEA 4W97A 2ZMEB 2QBYA 2W24A 3H1CA 4MHGA 4JX4A 1T38A 4AD9A 2UV1A 2CQQA 3C1DA 4DZJA 2XAHA 1UMQA 1Z77A 1TT0A 3ERMA 3HKZA 1VQ9I 3A2KA 2BYVE 3QPLA 2F4MB 3T1BA 4AUXA 4JK1X 3MCZA 3I59A 3H36A 4PGGA 1HF0A 1OCCH 3ABLH 3ZMDA 3K10A 3QPHA 2IBDA 2OV7A 1FOWA 2DOAA 2L9VA 1VQPI 2HU9A 2VBZA 1UZCA 2VKHA 4XLHA 5CJ9A 4S04A 3GTOJ 1TL8A 2WV1A 4KMUX 1DQUA 3I54A 4RB2C 1HKTA 3FKIJ 5CVVA 5DEQA 3M1CA 2B9SA 3AG3H 2EZHA 2CW7A 4U87A 3JSPA 5CVUA 2GOMA 5M3FJ 4NB5A 4ZTJA 1LEAA 2COBA 2JA7J 4IXAA 4K2EA 3OYDA 1U9NA 4HDVA 5HLIA 5D5XB 3CUQB 2HYFA 3HRSA 2DJNA 4FE4A 3OYIA 1K7AA 3RPUA 3U1DA 2VXDA 2GZWA 2O6GE 1MW7A 2EIKH 3IWZA 1YE9A 4OAYA 1WVRA 2PMZA 5M3MJ 2E36A 3G1OA 3K7AJ 2JPBA 2BY1A 3SHFA 2DOFA 2L9NA 1IDZA 3OYAA 2GXGA 3CJTB 3V7SA 2EFPA 1XTAA 4IRGA 3LSTA 2BOLA 1R7JA 2EV5A 3HOXJ 2CJJA 4FISA 1T33A 1QO0D 4MLOA 2ZMEC 2E1NA 4ANJA 1F43A 1Z7UA 3W2VA 3K4LA 2E7WA 3RYRA 2MFZA 1D5YA 1EH8A 2W7NA 4KIBA 3HOYJ 4DNCA 1E3OC 2NVYJ 5FKLA 3WTUC 3R6SA 1LVAA 2K7LA 2RV8A 3RQ4A 1VQKI 4A93J 3WU0A 2P6TA 2AXTC 1ZG3A 3CCJI 3O3KA 4FE7A 1EKEA 3VFZA 2KKOA 3B6CA 4N9HA 2FU4A 2R7TA 1K4SA 4A3BJ 3A02A 4ENJA 2A07F 1OCOH 4MQ9F 2HDCA 3BCBA 2CUJA 5AIQA 5FLMJ 2CG4A 1W7PA 4M9SA 1IXSB 3TBIA 4ON0A 2GAUA 4FASD 1V5FA 1LUJB 2MH9A 5IT9K 5H2FC 5DD4A 3CO6C 2IPQX 5FFZA 3T5XA 1PDNC 1UHSA 3HGYA 4R79A 3KP5A 2TRTA 3H5AA 1KU3A 4MFEA 2OTLI 5HS7A 3HL2A 3QYFA 3RKXA 2HOEA 4AU7A 1R1VA 4NC8A 4CSWA 3JW4A 4HDUA 2E2IJ 1X1BA 5EYRA 1YS7A 4KFCA 2LNBA 4FETA 3W2AA 3OY9A 2LVSA 2M5WA 1KONA 3MZ8A 4RLFA 1I39A 3OYFA 2WV0A 2R7UA 2GIVA 4U0VA 3RYPA 2VB6A 1Z6TA 3L00A 2A6HF 3GF2A 4AIKA 5M5WJ 1AU7A 1OQYA 1G3TA 2ZJ2A 4PJJA 1QPIA 2EZIA 1P4AA 4XLAA 4F3QA 3QU3A 3SDGA 1H8AC 2HYJA 4WCGA 3SEQA 1VQ5I 2D1VA 1YRNA 2QGUA 4XRSG 4P5OA 1ETVA 2K9MA 1JHFA 3OIOA 3S93A 2H27A 1ITYA 4AYBA 3FXLA 2L5QA 2LF8A 2R5ZB 3F21A 4XN3A 4BJ5C 3E6MA 5F6FA 5DV5A 4QIWN 1AOYA 3A4CA 1MH3A 1ZKGA 5F27A 1G59A 1RKWA 3ISPA 4KN4X 1OFCX 5TJJA 1D1AA 5IP9J 4P1WA 2FA5A 2X6XA 2Y9YA 4MIMA 5HNFA 4KUMA 3I55I 3CZ6A 1K78A 3KZYA 2CWEA 4Y52J 3HSFA 1R1TA 2HYGD 2H1LA 3BR3A 4MO7A 3CMAI 4L9NA 1WJFA 1G8XA 5HOOA 1ACIA 1WI3A 3GFMA 4WK8F 2O5RA 5EZGA 3VPRA 3GZ5A 5HS8A 4OIPF 3BG6A 2O8KA 1V4RA 1DP7P 1HW5A 1PP7U 4XQFA 2D2WA 3IKTA 1L0OC 2R7DA 3DKYA 2A68F 1J2XA 5KAIC 3W6JB 3J81K 3GTPJ 1JUSA 4G6QA 2ZO4A 4P55A 3BT9A 2BVMA 1FLIA 3D5LA 3LSPA 3Q9VA 5D5UB 4BYYA 3M8FA 3PQJA 1S72I 2JUGA 2BBYA 3FDYA 2R7VA 2KIQA 4N0BA 1BL0A 1Z3XA 2GLOA 2CMPA 4JX6A 4PJMA 2XROA 4MEYF 5IOYA 3GTQJ 2FBIA 2C6YA 5J40A 1T08B 2L0KA 3CC7I 4BGDA 1Q1HA 1R4MB 4CCNA 1WJDA 2FEZA 2V26A 3I56I 4WWCA 4BE0A 1SFXA 1JE8A 1KU9A 3JCUC 3W6KB 5LEKA 4IHWA 2WY7Q 4D5CA 3I58A 2STTA 1XB4A 2OAZA 2X9DA 4P9FA 1ZN2A 2H8RA 1N77A 2CFXA 1D1CA 3HC7A 1RIOH 2L7MP 3CCYA 4FT8A 4CUGA 1SFEA 2UXNA 3V7RA 1UHMA 1HXDA 1SFUA 2IAIA 4XRMA 1BBYA 1FSHA 2XF6A 4KDPA 5EF6A 3DLLF 2K3PA 3HYIA 1GV2A 4IX7A 1Y8RB 3W6VA 4PJNA 2Z3YA 1BIBA 5KNLA 1DGWY 3FMRA 1XMKA 2EFWA 4L0ZB 3MKLA 1VI0A 3PNVA 3J7AO 3TO9A 1F9NA 2X48A 1G6NA 2NVQJ 1BJAA 1AKHB 4UB8C 1HDDC 1XPXA 1MMGA 4DGWB 2YR2A 1S7EA 4X0GA 3I4PA 4AIJA 4TV7A 3RPUD 2H09A 4BDZA 1W0UA 1FEXA 1P9QC 5D6FA 2V1NA 2DK5A 1P6RA 5EDNA 2A05A 5M5YJ 4PK4A 2AQFA 2VONA 3EUHC 1ZLKA 3VB2A 5J6XA 4BHBA 4ZZLA 3H92A 1XG1A 3PIOF 2K9SA 2YU9J 1RUNA 3OOUA 5D8LB 4LD5A 3K1MA 1XGNA 1R49A 2BY3A 5ILVA 2JSCA 3J80Z 1P4XA 2JA6J 1SAUA 4RAYA 3V8LA 5LD2C 2A6EF 2STWA 3ESWB 4BQOA 2BV6A 4ZYAA 2W82A 2LYCA 4A3FJ 2HKOA 2VOOA 1N75A 5E8IA 3EDPA 1TWGJ 2M1BA 2L2OA 1HQCA 5FKOA 3QODA 1EF4A 2RQPA 2AXLA 2X85A 3TDZC 4DBRA 4M6YA 3CCEI 3WU2C 5HDNA 2FOKA 1YG2A 3SQNA 1KU7A 4LG0A 3CCVI 2LTPA 3IV5A 4MGRA 1UAAA 3IHUA 4E7SA 3KZZA 1SAXA 2NXNB 3SZPA 5GPAA 1CF7B 3KLOA 1HW1A 5J4VA 3NQOA 1W7PD 3ERED 1D1BA 1LFUP 2DJIA 3ZN1A 4D5FA 2VBXA 3A01B 4G7HF 1LDKB 2XPUA 3EYYA 3N4MA 2MH2A 1T39A 3RQIA 3VODA 2N8GA 2FNPA 3QYBA 4CZCA 3E5UA 1MZBA 2K3FA 2RQQA 2CSOA 1ETKA 2K02A 4LOCA 3GZNB 1T0FC 2JJ7A 2BXYA 1RI7A 1FBUA 2VPRA 4CCLA 3OYMA 5FJ8J 1QZEA 2CS3A 2XDVA 2DODA 2VASA 4XM3A 3L1PA 1FYKA 5LHHA 4GCVA 1TBXA 1ZK8A 2A61A 3DKWA 4V2FA 3WHBA 1H0MA 1X1PA 5B5EC 2QENA 1TQMA 3FK7A
chains in the Genus database with same CATH topology
4B4CA 4GFBA 1GT0C 3H3VK 3S1MJ 1MNMC 1A6IA 1QRYA 1FIPA 3PO2J 2XPWA 2D5VA 2NS8A 4RBOA 3Q0UA 2CRGA 2FJ1A 5E3MA 4I76A 5IYBJ 4XRSA 2EZKA 4M3DA 1LE8A 2NS7A 3CQZJ 2O7OA 1WH5A 2R7ZJ 2KDZA 2MW8A 3D1NI 2JA5J 4BBSJ 4XIDA 4JX5A 1IJWC 2EH3A 3K2AA 4QSHA 2XB0X 5E3OA 5JLXA 2ID6A 4CYCB 3JREA 2HDDA 3HEFA 4W1UA 5GPCA 1JTYA 2P81A 1JJ8C 4XK4A 1B8IA 2M0CA 4G12A 5F0HA 2E2JJ 3S14J 1FTZA 2M34A 2MG4A 1SFOJ 3Q0WA 1JUPA 5GP9A 3TP0A 2VKVA 5J1YA 4QTRA 2VUMJ 3GTLJ 2MGQA 3DEWA 1HCRA 2ECCA 2ECBA 3JRGA 2HXOA 1G2HA 1VF9A 2VKEA 3RZDJ 2DA1A 4A3LJ 2MSYA 3S16J 1IGNA 3BQYA 3E7LA 4BY7J 1GDTA 5JLWA 5C4XJ 4D7NA 2L9RA 4IEJA 1FJLA 2E2HJ 1BJZA 4M3FA 4EEFG 1K61A 1B8IB 5IP6A 5F0CA 2WAQN 4MFDA 1AHDP 3BG5A 2RAEA 5FKMA 2M9HA 1POGA 2G0EA 2DA3A 2XGEA 3TEDA 1ZQ3P 3HOZJ 1U9OA 4W97A 1Z0XA 4RDUA 3GTGJ 4JX4A 1JTXA 2I10A 3JRCA 1OJLA 2OF7A 5IPAA 4BY1J 2CQQA 4DZJA 4C2MJ 1UMQA 1Z77A 3ZQLA 3JRAA 3QPLA 4AUXA 3H0GJ 5FKNA 3G1LA 3LNQA 1HF0A 3MN2A 2Y0SN 2IBDA 5F04A 4A3GJ 3O8GA 1XC5A 3GTOJ 2XB5A 5EGOA 2WV1A 1MBJA 3FKIJ 4CYCA 1MH4A 2EZHA 1DU0A 2ZB9A 2DA7A 5M3FJ 1TC3C 3DCFA 2JA7J 2COBA 1Q1VA 1U9NA 2DTZA 3Q3SA 2DJNA 5E3LA 4FE4A 2Y30A 1R9TJ 3GBGA 3TP3A 1RETA 3BTCA 3MVPA 1MBFA 5M3MJ 3G1OA 1WGXA 3K7AJ 3QPSA 5J1UA 1JKRC 2LY9A 4JP0A 1IDZA 2XRLA 2DMQA 2LFBA 1HOMA 3HOXJ 3HOWJ 2CJJA 2ID3A 4FISA 2XSDC 5EGOB 1T33A 2XGCA 4MLOA 4M6VA 3BR2A 3JR9A 2ELKA 1JUMA 3I4NJ 3OSGA 1D5YA 3FK6A 1X2MA 1JKQC 3GTJJ 3JRFA 1IG7A 1E3OC 3HOYJ 2NVYJ 5FKLA 1ETXA 3S2HJ 2FQ4A 1ETQA 3M4OJ 3O8HA 2O9LA 4M3BA 4X6AJ 1JT0A 4A93J 4S0HB 1MBKA 4M3GA 1ETYA 4A3IJ 3HB9A 4FE7A 3B6CA 1IUFA 4A3BJ 3BTLA 4UUTA 1WCMJ 3A02A 3UKGA 3RZOJ 2LK2A 3FISA 1ZR2A 3S1QJ 2ME0A 1RR7A 1P7IA 1TWFJ 1DU6A 4C3IJ 5FLMJ 1IC8A 2DA4A 3SJMA 1PUFA 4V2GA 2CU7A 2L7FP 3ZQIA 5M5XJ 2NVXJ 1I6HJ 4FCYA 2GBYA 2JK3A 3PO3J 3ZOBA 1LE8B 1UHSA 3HGYA 2TRTA 3PM1A 4MFEA 2OPTA 5J1RA 2R5ZA 1U78A 1ETWA 2CUFA 1F43A 3ZQGA 2E2IJ 3CDLA 3S1RJ 5EYRA 4X1EA 5K7HA 2R0QC 3M3YJ 5EZHA 3F0CA 4J19A 2JN6A 2LVSA 3ZQHA 1GUUA 9ANTA 5F08A 4ABZA 5J3LA 5M5WJ 1JJ6C 1AU7A 2TCTA 1QPIA 2EZIA 1MBEA 1BW6A 3S1NJ 1H8AC 3SDGA 3NARA 2HYJA 3RKQA 1BA5A 2YS9A 2LD5A 1YRNA 5IYDJ 4XRSG 1O4XA 2ME6A 1ETVA 1SANA 1ITYA 3OIOA 2R5ZB 4M3EA 2GM4A 4XICA 4QIWN 2HOTA 2XGDA 5F1JA 4I6ZA 1MH3A 1ZKGA 5F27A 4DYCA 1APLC 3TW6A 1RKWA 1OFCX 5IP9J 5K7ZA 3BR0A 1MSEC 2Y9YA 4MIMA 2AHQA 1RESA 5F0FA 3S17J 1VFCA 3IH3A 2Y2ZA 4Y52J 4DYRA 1YRNB 1MSFC 1RKTA 2XPVA 4Y7NJ 3CMYA 2DMTA 4L5EA 3BR3A 2FD5A 1ETOA 4MO7A 5EEAA 1WI3A 5DS9A 5EZGA 3VPRA 1NTCA 3BR6A 2O8KA 3BG3A 3Q0VA 1OCPA 3GTPJ 2M2EA 5IOZA 2EBIA 2R92J 4A3CJ 1FTTA 1JUSA 4BBRJ 1LFBA 3JRIA 3BT9A 3IH4A 3LSPA 1WPKA 1F36A 1JKOC 2LR8A 2X6OA 3BTIA 2JA8J 2DA2A 2DA5A 3LSGA 2EQRA 1MBHA 3C2BA 2VI6A 2DMNA 1BL0A 2DN0A 3HKZN 1CQTA 2GLOA 4JX6A 3GTMJ 1GV5A 1VNDA 2EZLA 1XS9A 3I4MJ 5IOYA 3GTQJ 1FIAA 2IEKA 1ENHA 2L0KA 1T56A 2L7ZA 1H88C 2YUSA 2R93J 1ZR4A 2AO9A 5FKKA 4DZPA 3NAUA 4IHWA 4D5CA 3FIWA 3G1MA 5C4JJ 2X9DA 2LKXA 2H8RA 1W0TA 1AKHA 1QVTA 3HOUJ 1BW5A 4A3JJ 2L7MP 3CCYA 2Y31A 3GTKJ 3SFIA 1ORKA 5HODA 5C3EJ 2NOGA 1X2NA 4FTHA 4UUSA 2IAIA 4XRMA 1IV6A 2KT0A 3HGGA 1NK2P 1P7JA 2JWTA 2M8GX 2PMZN 4A69C 5EF6A 3TW7A 4A3EJ 1GV2A 3WHCA 3W6VA 4DW6A 3BR5A 4IHVA 3MKLA 5FLVA 1VI0A 2WB1N 1I50J 5C44J 2X48A 2NVQJ 4IHXA 1I3QJ 5DTDA 1AKHB 1HDDC 5IP7J 1JGGA 1K83J 1S7EA 1ZTRA 3ZQCA 2HOAA 3HBLA 4A3DJ 4A3MJ 5E3NA 1W0UA 2LLKA 4UUSB 4BKXA 1FEXA 2K9QA 1IDYA 5EDNA 5M5YJ 2JMWA 2LP0A 1TWAJ 2W48A 4C3JJ 3LSJA 1PUFB 1OCTC 3OSFA 2H1KA 3HM5A 3LOCA 1XG1A 2HI3A 2R5YA 2K9SA 2YU9J 2E1OA 1Y1WJ 3S2DJ 1Y1VJ 3IH2A 3BTJA 3OOUA 1IRZA 4AC0A 5K7FA 2DA6A 1WH7A 2JA6J 4D7MA 2K9NA 5EG0A 3QQAA 2QCOA 4DYQA 3A01A 1A5JA 2HOSA 3JRBA 2NVTJ 2FX0A 1QVUA 4A3FJ 3ZQFA 1TWGJ 5FKOA 2B63J 3A03A 3LSRA 1HDPA 1MBGA 1H89C 1EF4A 2CQXA 4JYKA 2R5YB 5BNGA 4C3HJ 2DMUA 2LTPA 3IV5A 1ZGWA 1JT6A 3BG9A 2HXIA 2K40A 5GPAA 1B72A 2CUEA 5EG0B 1LFUP 4D5FA 2QF7A 3JRDA 3JRHA 3A01B 3BR1A 2XPUA 1X58A 3RQIA 2N8GA 2E19A 1GVDA 4A3KJ 2Y9ZA 1HLVA 4HNVA 1ETKA 3HDDA 4AYBN 1JKPC 4LOCA 4BXXJ 1UG2A 2HQ5A 2JJ7A 1TWHJ 4NDLA 2VPRA 2DMPA 5FJ8J 3L1PA 4IHYA 1RPWA 1B72B 1ZK8A 1U8BA 4V2FA 1TWCJ 4B3AA 4B1RA 3B6AA 5IYCJ 3WHBA 3BQZA 3HOVJ 3S15J 1NK3P 3FK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B4C A;  4GFB A;  1GT0 C;  3H3V K;  3S1M J;  1MNM C;  1A6I A;  1QRY A;  1FIP A;  3PO2 J;  2XPW A;  2D5V A;  2NS8 A;  4RBO A;  3Q0U A;  2CRG A;  2FJ1 A;  5E3M A;  4I76 A;  5IYB J;  4XRS A;  2EZK A;  4M3D A;  1LE8 A;  2NS7 A;  3CQZ J;  2O7O A;  1WH5 A;  2R7Z J;  2KDZ A;  2MW8 A;  3D1N I;  2JA5 J;  4BBS J;  4XID A;  4JX5 A;  1IJW C;  2EH3 A;  3K2A A;  4QSH A;  2XB0 X;  5E3O A;  5JLX A;  2ID6 A;  4CYC B;  3JRE A;  2HDD A;  3HEF A;  4W1U A;  5GPC A;  1JTY A;  2P81 A;  1JJ8 C;  4XK4 A;  1B8I A;  2M0C A;  4G12 A;  5F0H A;  2E2J J;  3S14 J;  1FTZ A;  2M34 A;  2MG4 A;  1SFO J;  3Q0W A;  1JUP A;  5GP9 A;  3TP0 A;  2VKV A;  5J1Y A;  4QTR A;  2VUM J;  3GTL J;  2MGQ A;  3DEW A;  1HCR A;  2ECC A;  2ECB A;  3JRG A;  2HXO A;  1G2H A;  1VF9 A;  2VKE A;  3RZD J;  2DA1 A;  4A3L J;  2MSY A;  3S16 J;  1IGN A;  3BQY A;  3E7L A;  4BY7 J;  1GDT A;  5JLW A;  5C4X J;  4D7N A;  2L9R A;  4IEJ A;  1FJL A;  2E2H J;  1BJZ A;  4M3F A;  4EEF G;  1K61 A;  1B8I B;  5IP6 A;  5F0C A;  2WAQ N;  4MFD A;  1AHD P;  3BG5 A;  2RAE A;  5FKM A;  2M9H A;  1POG A;  2G0E A;  2DA3 A;  2XGE A;  3TED A;  1ZQ3 P;  3HOZ J;  1U9O A;  4W97 A;  1Z0X A;  4RDU A;  3GTG J;  4JX4 A;  1JTX A;  2I10 A;  3JRC A;  1OJL A;  2OF7 A;  5IPA A;  4BY1 J;  2CQQ A;  4DZJ A;  4C2M J;  1UMQ A;  1Z77 A;  3ZQL A;  3JRA A;  3QPL A;  4AUX A;  3H0G J;  5FKN A;  3G1L A;  3LNQ A;  1HF0 A;  3MN2 A;  2Y0S N;  2IBD A;  5F04 A;  4A3G J;  3O8G A;  1XC5 A;  3GTO J;  2XB5 A;  5EGO A;  2WV1 A;  1MBJ A;  3FKI J;  4CYC A;  1MH4 A;  2EZH A;  1DU0 A;  2ZB9 A;  2DA7 A;  5M3F J;  1TC3 C;  3DCF A;  2JA7 J;  2COB A;  1Q1V A;  1U9N A;  2DTZ A;  3Q3S A;  2DJN A;  5E3L A;  4FE4 A;  2Y30 A;  1R9T J;  3GBG A;  3TP3 A;  1RET A;  3BTC A;  3MVP A;  1MBF A;  5M3M J;  3G1O A;  1WGX A;  3K7A J;  3QPS A;  5J1U A;  1JKR C;  2LY9 A;  4JP0 A;  1IDZ A;  2XRL A;  2DMQ A;  2LFB A;  1HOM A;  3HOX J;  3HOW J;  2CJJ A;  2ID3 A;  4FIS A;  2XSD C;  5EGO B;  1T33 A;  2XGC A;  4MLO A;  4M6V A;  3BR2 A;  3JR9 A;  2ELK A;  1JUM A;  3I4N J;  3OSG A;  1D5Y A;  3FK6 A;  1X2M A;  1JKQ C;  3GTJ J;  3JRF A;  1IG7 A;  1E3O C;  3HOY J;  2NVY J;  5FKL A;  1ETX A;  3S2H J;  2FQ4 A;  1ETQ A;  3M4O J;  3O8H A;  2O9L A;  4M3B A;  4X6A J;  1JT0 A;  4A93 J;  4S0H B;  1MBK A;  4M3G A;  1ETY A;  4A3I J;  3HB9 A;  4FE7 A;  3B6C A;  1IUF A;  4A3B J;  3BTL A;  4UUT A;  1WCM J;  3A02 A;  3UKG A;  3RZO J;  2LK2 A;  3FIS A;  1ZR2 A;  3S1Q J;  2ME0 A;  1RR7 A;  1P7I A;  1TWF J;  1DU6 A;  4C3I J;  5FLM J;  1IC8 A;  2DA4 A;  3SJM A;  1PUF A;  4V2G A;  2CU7 A;  2L7F P;  3ZQI A;  5M5X J;  2NVX J;  1I6H J;  4FCY A;  2GBY A;  2JK3 A;  3PO3 J;  3ZOB A;  1LE8 B;  1UHS A;  3HGY A;  2TRT A;  3PM1 A;  4MFE A;  2OPT A;  5J1R A;  2R5Z A;  1U78 A;  1ETW A;  2CUF A;  1F43 A;  3ZQG A;  2E2I J;  3CDL A;  3S1R J;  5EYR A;  4X1E A;  5K7H A;  2R0Q C;  3M3Y J;  5EZH A;  3F0C A;  4J19 A;  2JN6 A;  2LVS A;  3ZQH A;  1GUU A;  9ANT A;  5F08 A;  4ABZ A;  5J3L A;  5M5W J;  1JJ6 C;  1AU7 A;  2TCT A;  1QPI A;  2EZI A;  1MBE A;  1BW6 A;  3S1N J;  1H8A C;  3SDG A;  3NAR A;  2HYJ A;  3RKQ A;  1BA5 A;  2YS9 A;  2LD5 A;  1YRN A;  5IYD J;  4XRS G;  1O4X A;  2ME6 A;  1ETV A;  1SAN A;  1ITY A;  3OIO A;  2R5Z B;  4M3E A;  2GM4 A;  4XIC A;  4QIW N;  2HOT A;  2XGD A;  5F1J A;  4I6Z A;  1MH3 A;  1ZKG A;  5F27 A;  4DYC A;  1APL C;  3TW6 A;  1RKW A;  1OFC X;  5IP9 J;  5K7Z A;  3BR0 A;  1MSE C;  2Y9Y A;  4MIM A;  2AHQ A;  1RES A;  5F0F A;  3S17 J;  1VFC A;  3IH3 A;  2Y2Z A;  4Y52 J;  4DYR A;  1YRN B;  1MSF C;  1RKT A;  2XPV A;  4Y7N J;  3CMY A;  2DMT A;  4L5E A;  3BR3 A;  2FD5 A;  1ETO A;  4MO7 A;  5EEA A;  1WI3 A;  5DS9 A;  5EZG A;  3VPR A;  1NTC A;  3BR6 A;  2O8K A;  3BG3 A;  3Q0V A;  1OCP A;  3GTP J;  2M2E A;  5IOZ A;  2EBI A;  2R92 J;  4A3C J;  1FTT A;  1JUS A;  4BBR J;  1LFB A;  3JRI A;  3BT9 A;  3IH4 A;  3LSP A;  1WPK A;  1F36 A;  1JKO C;  2LR8 A;  2X6O A;  3BTI A;  2JA8 J;  2DA2 A;  2DA5 A;  3LSG A;  2EQR A;  1MBH A;  3C2B A;  2VI6 A;  2DMN A;  1BL0 A;  2DN0 A;  3HKZ N;  1CQT A;  2GLO A;  4JX6 A;  3GTM J;  1GV5 A;  1VND A;  2EZL A;  1XS9 A;  3I4M J;  5IOY A;  3GTQ J;  1FIA A;  2IEK A;  1ENH A;  2L0K A;  1T56 A;  2L7Z A;  1H88 C;  2YUS A;  2R93 J;  1ZR4 A;  2AO9 A;  5FKK A;  4DZP A;  3NAU A;  4IHW A;  4D5C A;  3FIW A;  3G1M A;  5C4J J;  2X9D A;  2LKX A;  2H8R A;  1W0T A;  1AKH A;  1QVT A;  3HOU J;  1BW5 A;  4A3J J;  2L7M P;  3CCY A;  2Y31 A;  3GTK J;  3SFI A;  1ORK A;  5HOD A;  5C3E J;  2NOG A;  1X2N A;  4FTH A;  4UUS A;  2IAI A;  4XRM A;  1IV6 A;  2KT0 A;  3HGG A;  1NK2 P;  1P7J A;  2JWT A;  2M8G X;  2PMZ N;  4A69 C;  5EF6 A;  3TW7 A;  4A3E J;  1GV2 A;  3WHC A;  3W6V A;  4DW6 A;  3BR5 A;  4IHV A;  3MKL A;  5FLV A;  1VI0 A;  2WB1 N;  1I50 J;  5C44 J;  2X48 A;  2NVQ J;  4IHX A;  1I3Q J;  5DTD A;  1AKH B;  1HDD C;  5IP7 J;  1JGG A;  1K83 J;  1S7E A;  1ZTR A;  3ZQC A;  2HOA A;  3HBL A;  4A3D J;  4A3M J;  5E3N A;  1W0U A;  2LLK A;  4UUS B;  4BKX A;  1FEX A;  2K9Q A;  1IDY A;  5EDN A;  5M5Y J;  2JMW A;  2LP0 A;  1TWA J;  2W48 A;  4C3J J;  3LSJ A;  1PUF B;  1OCT C;  3OSF A;  2H1K A;  3HM5 A;  3LOC A;  1XG1 A;  2HI3 A;  2R5Y A;  2K9S A;  2YU9 J;  2E1O A;  1Y1W J;  3S2D J;  1Y1V J;  3IH2 A;  3BTJ A;  3OOU A;  1IRZ A;  4AC0 A;  5K7F A;  2DA6 A;  1WH7 A;  2JA6 J;  4D7M A;  2K9N A;  5EG0 A;  3QQA A;  2QCO A;  4DYQ A;  3A01 A;  1A5J A;  2HOS A;  3JRB A;  2NVT J;  2FX0 A;  1QVU A;  4A3F J;  3ZQF A;  1TWG J;  5FKO A;  2B63 J;  3A03 A;  3LSR A;  1HDP A;  1MBG A;  1H89 C;  1EF4 A;  2CQX A;  4JYK A;  2R5Y B;  5BNG A;  4C3H J;  2DMU A;  2LTP A;  3IV5 A;  1ZGW A;  1JT6 A;  3BG9 A;  2HXI A;  2K40 A;  5GPA A;  1B72 A;  2CUE A;  5EG0 B;  1LFU P;  4D5F A;  2QF7 A;  3JRD A;  3JRH A;  3A01 B;  3BR1 A;  2XPU A;  1X58 A;  3RQI A;  2N8G A;  2E19 A;  1GVD A;  4A3K J;  2Y9Z A;  1HLV A;  4HNV A;  1ETK A;  3HDD A;  4AYB N;  1JKP C;  4LOC A;  4BXX J;  1UG2 A;  2HQ5 A;  2JJ7 A;  1TWH J;  4NDL A;  2VPR A;  2DMP A;  5FJ8 J;  3L1P A;  4IHY A;  1RPW A;  1B72 B;  1ZK8 A;  1U8B A;  4V2F A;  1TWC J;  4B3A A;  4B1R A;  3B6A A;  5IYC J;  3WHB A;  3BQZ A;  3HOV J;  3S15 J;  1NK3 P;  3FK7 A; 
#chains in the Genus database with same CATH topology
 2DO7 A;  4XLN F;  1GT0 C;  3H3V K;  1BM9 A;  3S1M J;  3WTW C;  5H6R A;  3IWF A;  3S8P A;  1A6I A;  1XSX A;  3CME I;  2VOP A;  5LGN A;  1K6Y A;  1QRY A;  5BPI A;  3SYT A;  2IJL A;  4HG2 A;  4CCM A;  2NS8 A;  2CRG A;  3VYU B;  1TT5 B;  5IYB J;  5K5Q A;  2DDB A;  3BY6 A;  2WAQ A;  5HDK A;  4OIN F;  3CQZ J;  2JQ7 A;  3M8E A;  4V19 K;  2KDZ A;  2R7Z J;  2JA5 J;  4IKF A;  3S32 A;  4XLP F;  4QSH A;  2QSH X;  3DU5 A;  2Q8K A;  2ESN A;  5D5W B;  1T0F A;  3QWL A;  3EUK L;  5ICE A;  2M4K A;  3DTK A;  1XDS A;  2OCE A;  3SFZ A;  4M72 A;  4J01 A;  2E1C A;  1B8I A;  1B9M A;  2M0C A;  2M4G A;  4G12 A;  4G6D A;  2QA4 I;  2ZFU A;  2M34 A;  3KX2 A;  2Z2S B;  2K5C A;  2MYS A;  3OS0 A;  5B1B H;  4HPQ A;  3F8M A;  1LB2 A;  2VUM J;  5J1Y A;  4A6D A;  4B3X A;  1XCV A;  2MGQ A;  3P9I A;  3CDH A;  3JAM K;  3DPU A;  1MMS A;  2IS6 A;  4ESB A;  1Z91 A;  2QQB A;  3H0D A;  4HOB A;  5E1X A;  3D5R C;  4HA8 A;  3S16 J;  4D0P A;  2VJI A;  3BQY A;  1BI0 A;  4D7N A;  3V4G A;  2P8T A;  4XSZ F;  2L9R A;  1ZRD A;  3CD6 I;  2VN2 A;  4IEJ A;  1GLN A;  3ZCO A;  4U88 A;  2E2H J;  3HHH A;  1MMD A;  3OWT A;  2X51 A;  4CA0 A;  1V5G A;  2VC0 A;  3HRU A;  3R0J A;  1KYZ A;  4ZYH A;  4KT6 A;  3TGN A;  2M9H A;  1POG A;  2NS0 A;  3TO7 A;  3K4J A;  3ZN0 A;  5LRS A;  3OYC A;  5FRM A;  2ZCW A;  4UY8 I;  4YRV A;  3E5X A;  1YYV A;  3N05 A;  4RDU A;  3GTG J;  1KQ9 A;  3GCM A;  2DPD A;  3HSR A;  3QPT A;  5GAG J;  1E0E A;  3QOE A;  3ZQ7 A;  4A12 A;  2R7Q A;  4FQG A;  3UR3 C;  5AIP A;  2LY2 A;  3DBH B;  3LA3 A;  3DQV C;  4IL6 C;  1UEL B;  2ELJ A;  3KET A;  3EET A;  3OR1 C;  1Y0U A;  1WJB A;  2Y0S N;  3ZXS A;  4N4N B;  4L9T A;  5F04 A;  3O8G A;  5F64 A;  5LEJ A;  3FM5 A;  4AIH A;  2XB5 A;  3TOB A;  2HGC A;  4CYC A;  5L3G A;  2EK5 A;  5FLX K;  3DFG A;  1MH4 A;  1DU0 A;  1KYW A;  4EJO A;  2DA7 A;  2A5Y B;  3DCF A;  3ML6 A;  4UHT A;  2JVG A;  2QBY B;  1UFM A;  1Q1V A;  4Y15 A;  1EH7 A;  3Q3S A;  3M9A A;  5E3L A;  2Q2E A;  5IT3 A;  4ZZD A;  3TP3 A;  3PSF A;  4EJV A;  2QYO A;  3ABU A;  3J7A Y;  4PUS A;  1MBF A;  2OZ6 A;  3QPS A;  1IXC A;  5J1U A;  1JKR C;  3OIQ A;  2DMQ A;  2HZT A;  2OQR A;  4MNU A;  4G7O F;  4BAC A;  3RKW A;  2LFB A;  1YOV B;  2MD0 A;  1O3T A;  4BQN A;  3MZH A;  2ID3 A;  1SD6 A;  2P5L C;  2V9P A;  2WB1 A;  2XGC A;  3KFW X;  4IJA A;  3L2W A;  1UST A;  3BR2 A;  1B4A A;  3JR9 A;  2GXA A;  2ELK A;  5TIS C;  3L2V A;  1MNE A;  4KIG A;  1X2M A;  3U21 A;  2V9V A;  3HUG A;  4KJZ A;  2HTJ A;  2P5K A;  1MDM A;  5FD6 A;  4BS9 A;  2FQ4 A;  4HV6 A;  5FD5 A;  4BQA A;  1DP3 A;  1Y0N A;  2F2E A;  1BI1 A;  2KIM A;  4A2U A;  1JT0 A;  1YI2 I;  3K6G A;  1P4W A;  4M3G A;  1F1Z A;  2FE3 A;  2XKO A;  4MTE A;  4A3I J;  3HB9 A;  1QZZ A;  1TQI A;  2L7K A;  4EQQ A;  4Y33 A;  2HNH A;  1OR7 C;  2LC2 A;  1IUF A;  3V42 A;  3FXJ A;  1QNT A;  4NUB A;  2LK2 A;  4IF4 A;  3S1Q J;  3BG7 A;  2ME0 A;  2PN6 A;  3FF5 A;  1RR7 A;  2E5N A;  4OAZ A;  3CCQ I;  4HF1 A;  1TWF J;  1Z05 A;  1IC8 A;  2OA4 A;  4OWR B;  2E1M C;  3SJM A;  2NVX J;  3ZQI A;  1QA6 A;  4C2T A;  1W36 D;  2XAQ A;  4FCY A;  4F55 A;  2GBY A;  2JK3 A;  1LE8 B;  4D1Q A;  3PM1 A;  2OPT A;  4O6J A;  5J1R A;  1TLH B;  1MIJ A;  2DYS H;  4BHC A;  3ZQG A;  3CDL A;  4NBQ A;  5JFR A;  2R0Q C;  3M3Y J;  5EZH A;  1U0J A;  4HBL A;  3LAJ A;  4YFK F;  4EM1 A;  2QQ9 A;  2LOO A;  3H3U A;  3UNG C;  1KQ0 A;  4ABZ A;  1LPQ A;  2PI0 A;  1GXP A;  1JJ6 C;  2KRC A;  1W7P B;  2TCT A;  2BVL A;  1PP8 F;  4MEX F;  3RKQ A;  1X3U A;  3L2U A;  1OMI A;  5IYD J;  4LK0 F;  2ME6 A;  4NC6 A;  4HZF A;  2GIZ A;  5ILS A;  1RC9 A;  2JVH A;  2BE5 F;  3DKX A;  1X1C A;  5CQG A;  3QU6 A;  3MQ0 A;  3AG1 H;  3HOS A;  4I02 A;  2KZV A;  1FC3 A;  3WTV C;  4ENM A;  4KYW A;  4ITV A;  1QHH D;  2DLL A;  1UB9 A;  1JI8 A;  3MMY B;  1C0W A;  3TW6 A;  5BMZ A;  3D0S A;  4HLY A;  4KMF A;  2OBP A;  3K4M A;  3QP5 A;  2KZG A;  1MSE C;  1N78 A;  1U6G A;  2VT2 A;  2IVM A;  3CLO A;  2AHQ A;  4AVP A;  5DCF A;  1ZRE A;  3W3C A;  2K86 A;  2KRH A;  1IRF A;  2Y2Z A;  1J09 A;  3E6B A;  4LIV A;  1UCR A;  4Y4R A;  1D0Y A;  1RKT A;  3P5J A;  1YRN B;  3PNT A;  2FD5 A;  5LHI A;  1ETO A;  2BHY A;  3AAF A;  2DFI A;  2F5D A;  2VBW A;  5EEA A;  3ABT A;  3K1N A;  2M3A A;  4EGY A;  3BR6 A;  1HBX G;  2XF7 A;  3Q0V A;  2OU2 A;  2GA1 A;  2GQQ A;  2QQ8 A;  5CPR B;  2ACJ A;  4A0X A;  3BPX A;  4E7L A;  2EBI A;  2R92 J;  1LFB A;  4OOI A;  3JRI A;  3KP6 A;  3IH4 A;  2L9S A;  4XKC A;  4U7B A;  3LWF A;  1ULY A;  1X1D A;  1F36 A;  1QQI A;  2ADU A;  2KFD A;  2LR8 A;  3E3V A;  5ILU A;  2JA8 J;  2DA5 A;  4WF2 A;  2EQR A;  3TQN A;  4R8H A;  2KHM A;  4KIS A;  3GLX A;  2VLA A;  1CQT A;  4RB0 A;  3IC7 A;  1USS A;  1XS9 A;  4GYI A;  4O5V A;  1FIA A;  2DFH A;  4G8X A;  2IEK A;  2ZC2 A;  2RNJ A;  5A2Q Z;  1TZL A;  4XBF A;  4BEH A;  1T56 A;  2VQH A;  2R93 J;  1FP2 A;  4HNU A;  2CQ7 A;  2OD5 A;  1W5S A;  5ICC A;  5LFA A;  4RM2 A;  1BR2 A;  1I3A A;  2IRF G;  4DZP A;  3KPH A;  2W1O A;  5HLH A;  1I1G A;  5L3E A;  3P9K A;  2WC2 A;  2K27 A;  2IP2 A;  3DLA A;  1JXS A;  4I0B A;  2M45 A;  2Y31 A;  3ZMT A;  2FUG 2;  3C7J A;  1ORK A;  2EIM H;  5D4R A;  1D5V A;  4BJT A;  4QPQ A;  3C2H A;  1X3Z B;  4CZZ A;  2JPC A;  3SDB A;  4EM0 B;  4BE1 A;  4PFP A;  5DD8 A;  1KZH A;  2PJP A;  2FXA A;  3HSE A;  5FLV A;  1GXQ A;  1G4D A;  1Z6R A;  2BW3 A;  2FF4 A;  2K85 A;  2DFF A;  3DWL E;  4GGG A;  1STZ A;  4LB6 B;  2O03 A;  5DTD A;  1J9I A;  2V79 A;  3H35 A;  4ZYG A;  1XN7 A;  3MEX A;  3ZQC A;  1NG6 A;  2VJ5 A;  2DAO A;  4E70 A;  5E3N A;  2NYX A;  2WWY A;  2VE8 A;  2I8D A;  2M8E A;  4BKX A;  3CDI A;  5D6E A;  2K9Q A;  2DT6 A;  1PJR A;  4MQV A;  2LRE A;  4YEJ A;  4C3J J;  1PUF B;  4RM3 A;  1YJ9 I;  1O3Q A;  1NG7 A;  1U5T A;  1OCT C;  3U9G A;  3OSF A;  1MKM A;  2H1K A;  4XOP A;  3LOC A;  4A5N A;  2HI3 A;  2R5Y A;  3RKY A;  1FYM A;  4RS8 A;  3P9C A;  3NEU A;  1X4O A;  3DBR B;  1IRZ A;  4S05 A;  4KIC A;  5K7F A;  1M1E B;  3OYL A;  2R7W A;  4D7M A;  3TL4 X;  2K9N A;  3BRO A;  5EG0 A;  3QQA A;  2QCO A;  4DYQ A;  2FNA A;  3G6E I;  1A5J A;  4F91 B;  2QZ8 A;  1XSV A;  3H5R A;  2B0L A;  3H9Q A;  2NNY A;  3EQL F;  2KIF A;  4M9Z A;  4FX0 A;  4C9Y A;  2FX0 A;  2MLK A;  1DPR A;  3RIR A;  2B63 J;  2LY1 A;  3A03 A;  1XSD A;  1HDP A;  3M7G A;  4XR6 A;  2LDU A;  2KJB A;  3CUQ A;  4XKW A;  3R4K A;  1V5E A;  4UV8 A;  1JT6 A;  3SXY A;  2CV1 A;  3IAM 2;  3BG9 A;  2HXI A;  3TMO A;  2K40 A;  3I71 A;  2QF7 A;  1XGS A;  1LDJ A;  2QKM B;  2QQA A;  3BCA A;  3BR1 A;  3KCC A;  4XMY A;  2Z99 A;  1X58 A;  4LGW A;  4RGS A;  2ZNZ A;  4XN0 A;  3ABM H;  4EV0 A;  3K4B A;  4HQM A;  2E19 A;  4HAM A;  5HVQ C;  3KYL A;  3H9G A;  4HNV A;  3OS2 A;  2V6E A;  2A69 F;  3HDD A;  2EIL H;  4AVZ A;  4CYD A;  2Z1D A;  1J75 A;  3H3Z A;  1A35 A;  3WGI A;  4HX4 A;  5FO5 A;  4WXH A;  2DMP A;  4IPA A;  2JA2 A;  1YIT I;  2TDX A;  1BOA A;  3OYH A;  4IHY A;  5IT9 Z;  2IGO A;  2YSR A;  4EVI A;  1U8B A;  3K2Z A;  5LBQ A;  1WHU A;  1Z7L A;  4B1R A;  2F5V A;  5IYC J;  4OMY A;  3J7Z I;  1TTY A;  3HOV J;  4QWQ A;  2WAE A;  1U2W A;  1MND A;  2ZXW H;  3KP4 A;  3WTT C;  4B4C A;  4GFB A;  3WOD F;  3I9V 2;  3L09 A;  1Y56 A;  2X1C A;  3E6D A;  2A3S A;  2EIJ H;  1Z1D A;  3CLQ A;  3DV8 A;  1YW9 A;  2RNG A;  4M73 A;  3PSI A;  3FXO A;  2F4I A;  4XRS A;  1VQ4 I;  3VWB A;  4M3D A;  3D1N I;  1IUY A;  4Q48 A;  1IJW C;  2EH3 A;  3HTU A;  3NWT A;  4RAF A;  5DCM A;  3KIO A;  3P7N A;  2ID6 A;  3A0B C;  4CYC B;  2DT5 A;  2VT3 A;  4W1U A;  5GPC A;  3S3O A;  4P96 A;  1FBS A;  1WKM A;  3QAH A;  1SVO A;  5AON A;  5F0H A;  3GX4 X;  3FX3 A;  2QSG X;  2HEO A;  3S14 J;  1FTZ A;  3F9K A;  2XAF A;  4YEL A;  4BJ6 C;  3TP0 A;  3DEW A;  1T95 A;  1HCR A;  3JRG A;  2ECB A;  4M71 A;  2KMU A;  2CGP A;  2VKE A;  1W36 C;  3RZD J;  2DA1 A;  3DPL C;  4N9I A;  3NRV A;  2MSY A;  4J00 A;  1VZ0 A;  2BEO A;  3FHN A;  1G3W A;  1GDT A;  3FWE A;  3LQR A;  2MAB A;  2AS5 F;  4U0Y A;  2QM3 A;  4C30 A;  1YIJ I;  1QHG A;  4UB6 C;  1FYL A;  2ZFW A;  4LIT A;  4L0Y B;  3V7C A;  1HC8 A;  1F5T A;  2WAF A;  4HX7 A;  1B8I B;  5DM6 F;  5IP6 A;  2QWW A;  5E18 F;  1YO5 C;  2WAQ N;  4B48 A;  4BXF A;  3BG5 A;  2RAE A;  3LQQ A;  3J81 Z;  2ZJQ F;  4LB5 A;  1U8R A;  1IN8 A;  4ETS A;  1VQ8 I;  4JQF A;  1U9O A;  5CQE A;  1ERD A;  2P7C B;  2P5V A;  1OIS A;  2BZT A;  3WG9 A;  3AL0 C;  5IPA A;  3KP2 A;  4F92 B;  2DQR A;  3A0H C;  3M1E A;  4C2M J;  5D5V B;  1R00 A;  3JRA A;  2DK8 A;  3H0G J;  5D4S A;  5FKN A;  3G1L A;  3LNQ A;  2PFB A;  1Y6I A;  3J7Y J;  3MN2 A;  4A3G J;  5L3B A;  1SVL A;  2R7F A;  3CES A;  3F8C A;  3JTG A;  2H94 A;  3TKY A;  3ZMS A;  5EGO A;  1ZRC A;  1YX3 A;  4RGU A;  1MBJ A;  2FQ3 A;  4M6X A;  3MZY A;  5K5O A;  3IRR A;  5J8F A;  3GEZ A;  3DEU A;  4BQQ A;  1BR4 A;  4ZC3 A;  2DTZ A;  1SMT A;  1IRX A;  2DFE A;  2IS1 A;  3CCL I;  3GBG A;  1RET A;  1XX5 A;  1K79 A;  4BDY A;  2X1D A;  3LA2 A;  3AKZ A;  2XHK A;  2HWV A;  5H6Q A;  3O6B B;  2CUZ A;  5HS9 A;  3G4S I;  4RA2 A;  4BUP A;  2WTE A;  4ZYE A;  4AWX B;  3N97 A;  2V1X A;  4LLN A;  3DP7 A;  2OQG A;  2CH0 A;  2P0W A;  5FRN A;  1SVM A;  4BAY A;  4IRH A;  1FMV A;  1BOB A;  3I4N J;  3OSG A;  3ZPL A;  3FK6 A;  3JRF A;  2LBF A;  1IG7 A;  2COM A;  2CYY A;  4CXF A;  2XV4 S;  1AA7 A;  2IGM A;  2Q2E B;  1ETQ A;  3M4O J;  3O8H A;  1ZHF A;  2JUC A;  4I0A A;  4YFN F;  1IAW A;  4X6A J;  2HQN A;  4S0H B;  1LNW A;  1YQA A;  2KL4 A;  2WY8 Q;  2EJR A;  2LKS A;  2R7O A;  4KN7 X;  4IQJ A;  2EA2 A;  1WWX A;  1MMA A;  2R3S A;  2XF5 A;  1D8K A;  1R6R A;  1W5T A;  3BTL A;  5GTH C;  1WCM J;  2M7A A;  5GAD J;  3RZO J;  1ZR2 A;  1ON2 A;  4DJA A;  4HRI A;  2Z9O A;  3DTI A;  1V55 H;  1P7I A;  4Z2Y A;  2G7U A;  1RRJ A;  1DU6 A;  5E8G A;  2FBK A;  1OKR A;  3HUG B;  3HZJ A;  3T0Y A;  2CU7 A;  1MDM B;  3G3Z A;  6PAX A;  2DQL A;  4FHT A;  2FSW A;  4BU2 A;  5J47 A;  3WTX C;  4CCJ A;  1IO2 A;  3GFJ A;  3LAP A;  3PO3 J;  3FBI B;  1WJC A;  4HNT A;  4EJU A;  3VSK A;  2W00 A;  4OMZ A;  1OPC A;  4I99 C;  3ZMV A;  1ETW A;  2ISY A;  2CUF A;  1U78 A;  1R1U A;  4E7H A;  4CCO A;  4QLC U;  4X1E A;  5K7H A;  1TNS A;  3CMM A;  3L2C A;  1GUU A;  1E3H A;  2YX4 A;  5F08 A;  9ANT A;  1YS6 A;  2GA2 A;  3K4K A;  4KA4 A;  4XL9 A;  2DT7 B;  3RCO A;  2Y69 H;  3R60 A;  3ROU A;  2PG4 A;  3RPQ A;  2ZNY A;  3WTZ A;  1ZG5 A;  1S29 A;  2Y75 A;  3S1N J;  2OTJ I;  3NAR A;  3L2Q A;  1R22 A;  4IOA F;  1BA5 A;  4F52 A;  5ICG A;  2YS9 A;  2LD5 A;  2HR3 A;  1AWC A;  1L3L A;  3K0L A;  1U3E M;  1HST A;  2W84 A;  2OUM A;  4M3E A;  4UVC A;  1LFP A;  5GTI C;  1G3Y A;  4L9J A;  5K1Y A;  5ICF A;  2HOT A;  2XGD A;  3DBL B;  1I6X A;  2ZSH B;  4DYC A;  1APL C;  3CJQ B;  4B09 A;  5J4Y A;  2X6W A;  3PUF A;  3MFK A;  4PSW A;  3S3M A;  2XVC A;  3ASN H;  1YJW I;  4NHJ A;  3OIP A;  2VQL A;  2MLG A;  3TO6 A;  3U2R A;  1D0Z A;  1RES A;  5F0F A;  2EA4 A;  3S17 J;  1VFC A;  2KIU A;  2E5Z A;  4DYR A;  2LKP A;  1VQO I;  4Y7N J;  5CVR A;  3GVA A;  2EIN H;  2HFH A;  3GLL A;  4UUV A;  3S2W A;  3MKW B;  3I64 A;  2EFN A;  1QGP A;  2WBM A;  1W1W E;  2E1M B;  2G9W A;  2RDP A;  3BG3 A;  1WQ2 A;  2DYR H;  3WE2 A;  3I59 B;  2M2E A;  3W2W A;  2XRN A;  5IOZ A;  5E17 F;  1FTT A;  2KJC A;  3EUA A;  4BBR J;  1TNT A;  1MD0 A;  4HST A;  1KU2 A;  1JKO C;  4E7J A;  2VQG A;  4IO9 F;  2DA2 A;  1XGO A;  3COA C;  3WE3 A;  5ED4 A;  5CLS A;  3LSG A;  3MWM A;  1MBH A;  3C2B A;  2FMY A;  5HLT A;  3ZR8 X;  3ELK A;  3HKZ N;  1X4P A;  3CC4 I;  3HXL A;  1VND A;  2E7X A;  3I4M J;  2DOE A;  2QKL B;  4LLG F;  3V8J A;  5L3D A;  2F6C A;  4B8X A;  1SD7 A;  2PJR A;  2L7Z A;  1J5Y A;  2R7S A;  1ZR4 A;  1PVE A;  5LRR A;  2Z16 A;  3CJN A;  3JAM Z;  4KIT B;  5KHD A;  2AO9 A;  3I0T A;  5E20 A;  1RR8 C;  4EM2 A;  5FKK A;  3NAU A;  4OU0 A;  3E97 A;  1IN7 A;  3OYB A;  3OYJ A;  3HOU J;  1W0T A;  1R5I D;  1QVT A;  2PQ8 A;  3E5Q A;  2WA0 A;  1F4K A;  3PIP F;  1FMW A;  1DDN A;  2LH9 A;  1YLF A;  5HOD A;  2PLY A;  3IL2 A;  2CO5 A;  2O0Y A;  4FTH A;  4UUS A;  3T8R A;  2K9L A;  1NK2 P;  1P7J A;  2JWT A;  1TP4 A;  5KAF C;  2M8G X;  4LMY A;  2PMZ N;  4A69 C;  3TW7 A;  2QEX I;  4H4K C;  4HF0 A;  1W4M A;  3K70 D;  4BEH B;  4DW6 A;  1R5G A;  3QP6 A;  4EJT A;  4LFU A;  2L4M A;  3BR5 A;  2J5O A;  1Z3Y A;  2PBI A;  3CCR I;  5C44 J;  1I50 J;  2JSP A;  1XD7 A;  4LG3 A;  3CP8 A;  1I3Q J;  3I5U A;  4IHX A;  5FRO A;  3OYK A;  2K4J A;  1PUE E;  5IP7 J;  1S3J A;  1K83 J;  3OYG A;  1ZTR A;  1JGG A;  1A6Q A;  2HOA A;  4B43 A;  1MJ9 A;  3KEY A;  2F4O B;  2BGC A;  1IDY A;  1UJ8 A;  2Y0S A;  2JMW A;  2LP0 A;  3LSH A;  2L54 A;  2DI3 A;  2W48 A;  2I5U A;  3FBN B;  1J59 A;  3SZT A;  2ZXJ A;  5FLX Z;  5LLQ A;  3G71 I;  2JTV A;  2E1O A;  1Y1W J;  4WXD A;  3S2D J;  3OV8 A;  1Y1V J;  3IH2 A;  2BW3 B;  3BTJ A;  3NWS A;  4AID A;  4AC0 A;  2DA6 A;  1WH7 A;  1D8J A;  3DF8 A;  5B3S H;  3WTY C;  3BZK A;  2MD5 A;  3QRF F;  1O7F A;  5TGT A;  4LIU A;  3JRB A;  1NHA A;  3BJA A;  3ZQF A;  3IKV A;  3CO7 C;  3PFY A;  1MBG A;  2X1E A;  5JVG F;  1H89 C;  3OMY A;  2CQX A;  1U5T B;  1ZYR F;  2ZJR F;  2R5Y B;  2YX7 A;  5BNG A;  4C3H J;  3LMM A;  1O57 A;  2DMU A;  4Q4Z F;  2R4G A;  4ZTF A;  4B44 A;  4GXO A;  1ZGW A;  4NC7 A;  3MKY B;  1IZ1 A;  1R58 A;  4PJ0 C;  5TRD A;  3M07 A;  4JOM A;  1B72 A;  4Q5S F;  2CUE A;  2EPF A;  3OS1 A;  3KP7 A;  5EG0 B;  3BLY A;  3F23 A;  1VQ7 I;  3JRD A;  2ICW G;  3HPH A;  2H6C A;  2IW5 A;  4N4O B;  1MJB A;  4MTD A;  2FRH A;  3FXM A;  2BHZ A;  1ZRF A;  4NQW A;  1GVD A;  4A3K J;  4E7Z A;  4HF2 A;  4ZDP A;  3CCU I;  4AYB N;  1JKP C;  2A6T A;  2JRT A;  2VOD A;  1SMY F;  3LFU A;  1UG2 A;  1K78 B;  3OYN A;  3LFK A;  4ENN A;  3CCS I;  2HZD A;  1EV7 A;  2H8W A;  4CCK A;  1SFK A;  5JHF A;  1DGR M;  1BC8 C;  2OJE D;  2V9K A;  4E4H A;  2VPL A;  4I01 A;  4LLL A;  4XOT A;  3B6A A;  2ESH A;  2DU9 A;  3F3X A;  4LJZ F;  3ULQ B;  2XC7 A;  3S15 J;  1X1A A;  1O3R A;  2XSJ C;  1NK3 P;  2K4B A;  2CV0 A;  2IXS A;  1U5T C;  1MNM C;  3OL3 A;  2HS5 A;  2W25 A;  1B1B A;  3F6V A;  5B1A H;  2UXX A;  1FIP A;  2CQK A;  2XPW A;  5GAE J;  5K5R A;  2HVS A;  2L02 A;  4HW0 A;  2D5V A;  3BP8 A;  2LRD A;  1LEB A;  3Q0U A;  2FJ1 A;  3FXK A;  4I76 A;  1I27 A;  3PQK A;  2EZK A;  3C3W A;  1LE8 A;  3ZMZ A;  1BIA A;  1EH6 A;  2NS7 A;  2O7O A;  1WH5 A;  4BXU A;  3PJR A;  4BBS J;  3PUB A;  4JX5 A;  2OC6 A;  1ZH5 A;  3K2A A;  2XB0 X;  1YJN I;  1A04 A;  5E3O A;  4I98 B;  1GVJ A;  2CQN A;  5JLX A;  3ZMU A;  3JRE A;  1R71 A;  2HDD A;  5E79 C;  2MBF A;  3CUQ C;  1ON1 A;  2JT1 A;  5EJC A;  1FP1 D;  4RAG A;  2Y48 A;  1VTN C;  4I09 A;  4CDG A;  3CTA A;  1SFO J;  1XDU A;  3Q0W A;  1JUP A;  5GP9 A;  1UG0 A;  2VKV A;  2ZXI A;  2W4S A;  3GTL J;  4XKB A;  2OZU A;  2VQC A;  4ZH4 F;  2ECC A;  2HXO A;  1ODD A;  3KP3 A;  1WJA A;  2ZME A;  3GUD A;  1OLT A;  3BWG A;  4GDF A;  4F7Z A;  2ZXH A;  1IGN A;  4BY7 J;  5JLW A;  3ASO H;  3VYS B;  1ZLJ A;  5F1R A;  4DOZ A;  5DCM B;  1HSJ A;  3H9J A;  1R36 A;  2VJJ A;  5B66 C;  4M3F A;  4FX4 A;  4L5I A;  4EEF G;  3ECO A;  4CGZ A;  1I1S A;  3HG9 A;  3LSI A;  4XOR A;  4Y17 A;  2V1U A;  2ZKZ A;  2XAJ A;  3CF2 A;  5FKM A;  4ZDO A;  2Q1Z B;  3PL8 A;  4UVB A;  2XGE A;  3QYE A;  4YG2 F;  3TED A;  1J7K A;  3LSM A;  2VKD A;  2XAU A;  3BDD A;  3ZP5 A;  2NAZ A;  1REP C;  5D8K B;  1Z0X A;  2KPM A;  2L3D A;  1JTX A;  1TW2 A;  2I10 A;  1OJL A;  2OF7 A;  3JRC A;  4BY1 J;  5E1Z B;  5FGM A;  1LJ9 A;  3ZQL A;  2HQR A;  1WI9 A;  4LK1 F;  4M9X A;  3ZGK A;  4D9J A;  1RZ4 A;  1FZP B;  4AM3 A;  1ZAR A;  1RNL A;  1WRJ A;  4BHP A;  2GOX B;  4RGX A;  1O7L A;  3EYI A;  3HPG A;  3IUO A;  2DXI A;  4OIO F;  2Y0M A;  1XC5 A;  3QOP A;  1LKX A;  1R4N B;  1T6S A;  5LHG A;  1FSE A;  2QUF A;  2VBY A;  4BL0 B;  2ZB9 A;  1IW7 F;  1TC3 C;  1VQL I;  1H9G A;  2X0L A;  4P9U A;  3J80 K;  2Y30 A;  1R9T J;  4LG0 B;  3TOA A;  3BTC A;  1JGS A;  3MVP A;  1BN5 A;  1WGX A;  2M30 A;  3OOP A;  2A5W A;  1SEU A;  2LY9 A;  4JP0 A;  2XRL A;  2KP6 A;  4RB3 C;  1WSU A;  1YIO A;  1VQ6 I;  2WAD A;  3HJE A;  3IP4 B;  4CO8 A;  1HOM A;  2VC1 A;  2PX9 A;  3E1S A;  3GXO A;  2DW4 A;  3HOW J;  2XSD C;  5EGO B;  2M0M A;  3AG4 H;  4M6V A;  1GHC A;  5DYM A;  1KGS A;  4A0Y A;  1JUM A;  1SD4 A;  1JKQ C;  1N25 A;  3GTJ J;  3EPZ A;  3FXU A;  1ETX A;  4ENK A;  3S2H J;  2QSF X;  2V7F A;  1HKQ A;  2O3F A;  3BZ6 A;  1FT9 A;  2O9L A;  4M3B A;  3B73 A;  1V3F A;  3AG2 H;  2RGV A;  4PCQ A;  2Q0O A;  4R1H A;  5JR3 A;  2CW8 A;  1MBK A;  3KLN A;  4DQ2 A;  1ETY A;  4RLQ A;  1MMN A;  2RN7 A;  1HKS A;  5CVI A;  4PDK A;  4PSX A;  1XMX A;  2RC4 A;  2XKP A;  4YIR X;  1E2X A;  2X6Y A;  1IV8 A;  3AL0 B;  1UHW A;  3UKG A;  4UUT A;  2E34 A;  2LG4 A;  3MKZ A;  3FIS A;  1WJ5 A;  2V4J C;  1Y39 A;  3DXJ F;  1WFX A;  5BPD A;  4C3I J;  5HNH A;  4RB1 A;  1EJ9 A;  2UWM A;  1YW8 A;  3LL7 A;  3JSO A;  2DA4 A;  3KYC B;  4DIQ A;  2LBF B;  1PUF A;  2HVQ A;  3WU1 B;  4V2G A;  1D0X A;  2L7F P;  1YW7 A;  5M5X J;  1I6H J;  4HSR A;  2M87 A;  1LVK A;  1Z21 A;  3DTE A;  5JHU A;  2EV6 A;  3ZOB A;  3K70 C;  3X2Q H;  4UNO A;  2O8X A;  4RMN A;  2PEX A;  2R5Z A;  3WGH A;  2EFQ A;  2D1H A;  4XON A;  4ZJZ A;  3HHG A;  3K9T A;  3S1R J;  1J0R A;  1MJA A;  4U7D A;  4F93 B;  3F0C A;  4J19 A;  2JN6 A;  2E35 A;  3R0A A;  4XNF A;  4ZYD A;  1A36 A;  3KEQ A;  4XLC A;  3H5N A;  3ZQH A;  2HVR A;  2NRA C;  5J3L A;  2P4W A;  3CUO A;  2RKH A;  1FBQ A;  3C2G A;  4II3 A;  3TDU C;  4Y13 A;  4IQ4 A;  1MBE A;  1BW6 A;  5J8C A;  3MD2 A;  2P7V B;  4Y3O A;  5L3C A;  5DDG A;  1FOX A;  5KCM A;  4L5J A;  4OIR F;  2F5F A;  1O4X A;  2HTS A;  1SAN A;  3BC8 A;  3I3L A;  2B7E A;  2VE9 A;  1FOK A;  1OCR H;  3CC2 I;  1P2F A;  1IXR C;  2GM4 A;  2ZSI B;  3ABK H;  4XIC A;  3A1Y A;  5F1J A;  3CP2 A;  3DU6 A;  2EFO A;  3IAS 2;  4I6Z A;  5BS6 A;  4IOC F;  1BI3 A;  3BJO A;  5K7Z A;  3BR0 A;  5GAH J;  2RRE A;  4HX8 A;  4XLF A;  4E7I A;  4A5M A;  4II2 A;  3IH3 A;  4RGR A;  3RSN A;  2DCE A;  5FFX A;  3REO A;  2IGN A;  1MSF C;  1PYV A;  2XPV A;  3CMY A;  4U0W A;  3CF5 F;  2DMT A;  4L5E A;  4E6K G;  1G3S A;  2KQR A;  4WX9 A;  3G73 A;  5DS9 A;  1XGM A;  1NTC A;  1T2K A;  2DDA A;  2E60 A;  3EUH A;  1R23 A;  4Z6Y A;  1YTY A;  5EEH A;  1OCP A;  5ERI A;  2KDO A;  3CCM I;  4A3C J;  1OYI A;  4G94 A;  2AQE A;  3KEO A;  4IHS A;  3F6O A;  4HQE A;  1BC7 C;  1WPK A;  2X6O A;  3BTI A;  3FMS A;  1T8I A;  5CVJ A;  5IY5 H;  2GXB A;  3GW2 A;  2P6S A;  4L18 B;  2VI6 A;  2DMN A;  3OR2 C;  1TW3 A;  3U1K A;  2DN0 A;  3PFI A;  3GTM J;  1GV5 A;  2EZL A;  2IA1 A;  2V6C A;  1ENH A;  2XAS A;  2ZBK A;  5H20 A;  3FXQ A;  4GRI A;  1RUO A;  4Q47 A;  4WXC A;  1H88 C;  2YUS A;  5KVR A;  3LSK A;  1SD5 A;  3FIW A;  3G1M A;  5C4J J;  2W57 A;  2LKX A;  4L9V A;  1AKH A;  1P92 A;  1BW5 A;  4PZJ A;  4A3J J;  2NVU B;  3KZI C;  3ECH A;  3GTK J;  3WGG A;  3SFI A;  4DBQ A;  1HW2 A;  5C3E J;  2NOG A;  1S7O A;  3HTS B;  1DPU A;  1X2N A;  1IV6 A;  2KT0 A;  3HGG A;  2FOW A;  3FHZ A;  4CIC A;  3DPT A;  4A3E J;  2R7X A;  3WHC A;  2O61 A;  2BY0 A;  4UV9 A;  2PJR B;  2M7B A;  4H0E A;  5CKT A;  3BJ6 A;  4IHV A;  2IS4 A;  2DBB A;  3VOE A;  5KK1 A;  1YFH A;  2WB1 N;  1X19 A;  2MC4 A;  3F8F A;  2HPM A;  5EEG A;  4C2U A;  1KA8 A;  1QBJ A;  1EA3 A;  3F8B A;  1OYY A;  2PMU A;  2DPU A;  3FMQ A;  3HBL A;  4A3D J;  2VL8 A;  4A3M J;  1HA8 A;  3GME A;  3FZV A;  2LLK A;  2XAG A;  4HLX A;  4UUS B;  4NNJ A;  3VEP A;  1IN6 A;  2MA3 A;  4PJL A;  4M74 A;  2EB7 A;  2BY2 A;  1TWA J;  4RAZ A;  1BI2 A;  5L3F A;  5DM7 F;  3LSJ A;  1FPQ A;  4O3M A;  4G6T B;  5FB2 A;  1VQM I;  4ASN A;  3HM5 A;  1TQP A;  2GWR A;  2XIG A;  4IHT A;  1FNN A;  2X4H A;  1V54 H;  2ISZ A;  2PMH A;  4ZDL A;  2JRM A;  1W5C C;  2MC3 A;  3HIF A;  4YII A;  3RJP A;  1CF7 A;  3GYH X;  1KQ8 A;  1QU3 A;  1XCB A;  3K69 A;  2KIS A;  3T8T A;  3A01 A;  4I7H A;  3PNY A;  3Q9S A;  2HOS A;  2HKX A;  3WG7 H;  5LGT A;  1E17 A;  3G2B A;  3RTR A;  4GYG A;  2NVT J;  2YU3 A;  1QVU A;  4CH7 A;  2CV2 A;  2XGX A;  3OYE A;  3LSR A;  3BZC A;  3SEZ A;  3M8J A;  1MGT A;  4JYK A;  1T98 A;  1YHQ I;  1WZ2 A;  2LMD A;  5DUI A;  3VSL A;  3F22 A;  4EMS A;  3HOT A;  2W85 A;  4CHU A;  1B6A A;  3C18 A;  3HRT A;  2JZY A;  1IN4 A;  1A31 A;  2L4A A;  3JRH A;  3FM3 A;  1K4T A;  4JBA A;  3GFL A;  1OYW A;  1S8N A;  3VYT B;  1S9H A;  2ETH A;  3KYD B;  2VJ4 A;  5DUK A;  2Y9Z A;  1HLV A;  3L2R A;  4XRF A;  1O3S A;  2HQA A;  2BXZ A;  4BXX J;  1IRG A;  1ZAO A;  3I53 A;  2HQ5 A;  4EAT A;  5JVT A;  4ESF A;  3ONQ A;  5CYV A;  1TWH J;  4NDL A;  3F72 A;  3SZG A;  1B9N A;  2H6B A;  1RPW A;  4GO1 A;  2F48 A;  4IZZ A;  1FY7 A;  1ONV A;  1D3Y A;  2RVC A;  3KE2 A;  1B72 B;  4PFO A;  3GZ6 A;  1TWC J;  4I2O A;  4B3A A;  1SC7 A;  2QLZ A;  4OIQ F;  4ESJ A;  5BOX A;  2CFO A;  3BQZ A;  1Z67 A;  4E7K A;  3MAJ A;  3VDX A;  1XMA A;  1VQN I;  1BR1 A;  2IGK A;  5E1W A;  3IRQ A;  4NQW B;  5HDG A;  1E3P A;  2J5P A;  3E6C C;  1S6L A;  4IRI A;  4KNY A;  1FOY A;  5BQT A;  3WTS C;  2IS2 A;  1Y8Q B;  4HEA 2;  1R5H A;  2XUB A;  4XKV A;  4XSX F;  1K6O A;  2VIX A;  1DUX C;  3PO2 J;  2UUZ A;  2IA0 A;  3GWZ A;  3GFI A;  3HRM A;  3FKJ A;  4RBO A;  4KT5 C;  5E3M A;  3GO5 A;  2F5C A;  1YX5 A;  4G7Z F;  1CGP A;  1LDD A;  5HLG A;  2HPI A;  3S3N A;  3FXR A;  2MW8 A;  4XID A;  3DEE A;  3BPV A;  1Z9C A;  3F8N A;  2CW0 F;  2NNN A;  3ZRG A;  5JI6 A;  2ELH A;  2Z33 A;  2KLO A;  4BNC A;  3JTH A;  1WJE A;  3L7W A;  3HEF A;  4EJW A;  1QZY A;  4HV5 A;  1ZGJ A;  2V1D A;  3E0J B;  1JTY A;  1S5L C;  2P81 A;  1JJ8 C;  4XK4 A;  2UZK A;  1IN5 A;  4UXN A;  2OCC H;  4G9Y A;  3D5S C;  3O2P E;  2E2J J;  2IT0 A;  1ZGA A;  1S7A A;  1ZG1 A;  1NH3 A;  2MG4 A;  4A6E A;  5A2Q K;  1IF1 A;  4QTR A;  3BOQ A;  2EWN A;  1JHH A;  4PGH A;  3ZQQ A;  2R7R A;  1X3W B;  3V8K A;  2D45 A;  2DTR A;  1QPM A;  3LA7 A;  1OCZ H;  1G2H A;  1FWZ A;  1VF9 A;  4BE2 A;  3K4N A;  3B02 A;  2LSO A;  4A3L J;  3K4C A;  1H9T A;  2IA2 A;  4HYE A;  3VYR B;  2QVO A;  1B59 A;  3E7L A;  4QPO A;  5C4X J;  1I5Z A;  2E71 A;  2EV0 A;  5LGU A;  4KIF A;  4UVA A;  1FJL A;  1ZEL A;  1FX7 A;  4YFX F;  4A0Z A;  3R61 A;  4B47 A;  1BJZ A;  2F5E A;  2Z5U A;  3K1P A;  2VXZ A;  2L01 A;  2NOJ B;  2ZJP F;  4BH9 A;  1K61 A;  3Q5F A;  2LF7 A;  5F0C A;  4EGZ A;  4MFD A;  1AHD P;  2FBH A;  2FML A;  3RDI A;  2KRF A;  2YPR A;  4IVN A;  2G0E A;  2DA3 A;  3L9F A;  3RI4 A;  3AFH A;  1LQ1 A;  1ZQ3 P;  2G7H A;  2HDW A;  1OR7 A;  3OL4 A;  4YIF A;  3HOZ J;  3CJR B;  4XLE A;  4W97 A;  2ZME B;  2QBY A;  2W24 A;  3H1C A;  4MHG A;  4JX4 A;  1T38 A;  4AD9 A;  2UV1 A;  2CQQ A;  3C1D A;  4DZJ A;  2XAH A;  1UMQ A;  1Z77 A;  1TT0 A;  3ERM A;  3HKZ A;  1VQ9 I;  3A2K A;  2BYV E;  3QPL A;  2F4M B;  3T1B A;  4AUX A;  4JK1 X;  3MCZ A;  3I59 A;  3H36 A;  4PGG A;  1HF0 A;  1OCC H;  3ABL H;  3ZMD A;  3K10 A;  3QPH A;  2IBD A;  2OV7 A;  1FOW A;  2DOA A;  2L9V A;  1VQP I;  2HU9 A;  2VBZ A;  1UZC A;  2VKH A;  4XLH A;  5CJ9 A;  4S04 A;  3GTO J;  1TL8 A;  2WV1 A;  4KMU X;  1DQU A;  3I54 A;  4RB2 C;  1HKT A;  3FKI J;  5CVV A;  5DEQ A;  3M1C A;  2B9S A;  3AG3 H;  2EZH A;  2CW7 A;  4U87 A;  3JSP A;  5CVU A;  2GOM A;  5M3F J;  4NB5 A;  4ZTJ A;  1LEA A;  2COB A;  2JA7 J;  4IXA A;  4K2E A;  3OYD A;  1U9N A;  4HDV A;  5HLI A;  5D5X B;  3CUQ B;  2HYF A;  3HRS A;  2DJN A;  4FE4 A;  3OYI A;  1K7A A;  3RPU A;  3U1D A;  2VXD A;  2GZW A;  2O6G E;  1MW7 A;  2EIK H;  3IWZ A;  1YE9 A;  4OAY A;  1WVR A;  2PMZ A;  5M3M J;  2E36 A;  3G1O A;  3K7A J;  2JPB A;  2BY1 A;  3SHF A;  2DOF A;  2L9N A;  1IDZ A;  3OYA A;  2GXG A;  3CJT B;  3V7S A;  2EFP A;  1XTA A;  4IRG A;  3LST A;  2BOL A;  1R7J A;  2EV5 A;  3HOX J;  2CJJ A;  4FIS A;  1T33 A;  1QO0 D;  4MLO A;  2ZME C;  2E1N A;  4ANJ A;  1F43 A;  1Z7U A;  3W2V A;  3K4L A;  2E7W A;  3RYR A;  2MFZ A;  1D5Y A;  1EH8 A;  2W7N A;  4KIB A;  3HOY J;  4DNC A;  1E3O C;  2NVY J;  5FKL A;  3WTU C;  3R6S A;  1LVA A;  2K7L A;  2RV8 A;  3RQ4 A;  1VQK I;  4A93 J;  3WU0 A;  2P6T A;  2AXT C;  1ZG3 A;  3CCJ I;  3O3K A;  4FE7 A;  1EKE A;  3VFZ A;  2KKO A;  3B6C A;  4N9H A;  2FU4 A;  2R7T A;  1K4S A;  4A3B J;  3A02 A;  4ENJ A;  2A07 F;  1OCO H;  4MQ9 F;  2HDC A;  3BCB A;  2CUJ A;  5AIQ A;  5FLM J;  2CG4 A;  1W7P A;  4M9S A;  1IXS B;  3TBI A;  4ON0 A;  2GAU A;  4FAS D;  1V5F A;  1LUJ B;  2MH9 A;  5IT9 K;  5H2F C;  5DD4 A;  3CO6 C;  2IPQ X;  5FFZ A;  3T5X A;  1PDN C;  1UHS A;  3HGY A;  4R79 A;  3KP5 A;  2TRT A;  3H5A A;  1KU3 A;  4MFE A;  2OTL I;  5HS7 A;  3HL2 A;  3QYF A;  3RKX A;  2HOE A;  4AU7 A;  1R1V A;  4NC8 A;  4CSW A;  3JW4 A;  4HDU A;  2E2I J;  1X1B A;  5EYR A;  1YS7 A;  4KFC A;  2LNB A;  4FET A;  3W2A A;  3OY9 A;  2LVS A;  2M5W A;  1KON A;  3MZ8 A;  4RLF A;  1I39 A;  3OYF A;  2WV0 A;  2R7U A;  2GIV A;  4U0V A;  3RYP A;  2VB6 A;  1Z6T A;  3L00 A;  2A6H F;  3GF2 A;  4AIK A;  5M5W J;  1AU7 A;  1OQY A;  1G3T A;  2ZJ2 A;  4PJJ A;  1QPI A;  2EZI A;  1P4A A;  4XLA A;  4F3Q A;  3QU3 A;  3SDG A;  1H8A C;  2HYJ A;  4WCG A;  3SEQ A;  1VQ5 I;  2D1V A;  1YRN A;  2QGU A;  4XRS G;  4P5O A;  1ETV A;  2K9M A;  1JHF A;  3OIO A;  3S93 A;  2H27 A;  1ITY A;  4AYB A;  3FXL A;  2L5Q A;  2LF8 A;  2R5Z B;  3F21 A;  4XN3 A;  4BJ5 C;  3E6M A;  5F6F A;  5DV5 A;  4QIW N;  1AOY A;  3A4C A;  1MH3 A;  1ZKG A;  5F27 A;  1G59 A;  1RKW A;  3ISP A;  4KN4 X;  1OFC X;  5TJJ A;  1D1A A;  5IP9 J;  4P1W A;  2FA5 A;  2X6X A;  2Y9Y A;  4MIM A;  5HNF A;  4KUM A;  3I55 I;  3CZ6 A;  1K78 A;  3KZY A;  2CWE A;  4Y52 J;  3HSF A;  1R1T A;  2HYG D;  2H1L A;  3BR3 A;  4MO7 A;  3CMA I;  4L9N A;  1WJF A;  1G8X A;  5HOO A;  1ACI A;  1WI3 A;  3GFM A;  4WK8 F;  2O5R A;  5EZG A;  3VPR A;  3GZ5 A;  5HS8 A;  4OIP F;  3BG6 A;  2O8K A;  1V4R A;  1DP7 P;  1HW5 A;  1PP7 U;  4XQF A;  2D2W A;  3IKT A;  1L0O C;  2R7D A;  3DKY A;  2A68 F;  1J2X A;  5KAI C;  3W6J B;  3J81 K;  3GTP J;  1JUS A;  4G6Q A;  2ZO4 A;  4P55 A;  3BT9 A;  2BVM A;  1FLI A;  3D5L A;  3LSP A;  3Q9V A;  5D5U B;  4BYY A;  3M8F A;  3PQJ A;  1S72 I;  2JUG A;  2BBY A;  3FDY A;  2R7V A;  2KIQ A;  4N0B A;  1BL0 A;  1Z3X A;  2GLO A;  2CMP A;  4JX6 A;  4PJM A;  2XRO A;  4MEY F;  5IOY A;  3GTQ J;  2FBI A;  2C6Y A;  5J40 A;  1T08 B;  2L0K A;  3CC7 I;  4BGD A;  1Q1H A;  1R4M B;  4CCN A;  1WJD A;  2FEZ A;  2V26 A;  3I56 I;  4WWC A;  4BE0 A;  1SFX A;  1JE8 A;  1KU9 A;  3JCU C;  3W6K B;  5LEK A;  4IHW A;  2WY7 Q;  4D5C A;  3I58 A;  2STT A;  1XB4 A;  2OAZ A;  2X9D A;  4P9F A;  1ZN2 A;  2H8R A;  1N77 A;  2CFX A;  1D1C A;  3HC7 A;  1RIO H;  2L7M P;  3CCY A;  4FT8 A;  4CUG A;  1SFE A;  2UXN A;  3V7R A;  1UHM A;  1HXD A;  1SFU A;  2IAI A;  4XRM A;  1BBY A;  1FSH A;  2XF6 A;  4KDP A;  5EF6 A;  3DLL F;  2K3P A;  3HYI A;  1GV2 A;  4IX7 A;  1Y8R B;  3W6V A;  4PJN A;  2Z3Y A;  1BIB A;  5KNL A;  1DGW Y;  3FMR A;  1XMK A;  2EFW A;  4L0Z B;  3MKL A;  1VI0 A;  3PNV A;  3J7A O;  3TO9 A;  1F9N A;  2X48 A;  1G6N A;  2NVQ J;  1BJA A;  1AKH B;  4UB8 C;  1HDD C;  1XPX A;  1MMG A;  4DGW B;  2YR2 A;  1S7E A;  4X0G A;  3I4P A;  4AIJ A;  4TV7 A;  3RPU D;  2H09 A;  4BDZ A;  1W0U A;  1FEX A;  1P9Q C;  5D6F A;  2V1N A;  2DK5 A;  1P6R A;  5EDN A;  2A05 A;  5M5Y J;  4PK4 A;  2AQF A;  2VON A;  3EUH C;  1ZLK A;  3VB2 A;  5J6X A;  4BHB A;  4ZZL A;  3H92 A;  1XG1 A;  3PIO F;  2K9S A;  2YU9 J;  1RUN A;  3OOU A;  5D8L B;  4LD5 A;  3K1M A;  1XGN A;  1R49 A;  2BY3 A;  5ILV A;  2JSC A;  3J80 Z;  1P4X A;  2JA6 J;  1SAU A;  4RAY A;  3V8L A;  5LD2 C;  2A6E F;  2STW A;  3ESW B;  4BQO A;  2BV6 A;  4ZYA A;  2W82 A;  2LYC A;  4A3F J;  2HKO A;  2VOO A;  1N75 A;  5E8I A;  3EDP A;  1TWG J;  2M1B A;  2L2O A;  1HQC A;  5FKO A;  3QOD A;  1EF4 A;  2RQP A;  2AXL A;  2X85 A;  3TDZ C;  4DBR A;  4M6Y A;  3CCE I;  3WU2 C;  5HDN A;  2FOK A;  1YG2 A;  3SQN A;  1KU7 A;  4LG0 A;  3CCV I;  2LTP A;  3IV5 A;  4MGR A;  1UAA A;  3IHU A;  4E7S A;  3KZZ A;  1SAX A;  2NXN B;  3SZP A;  5GPA A;  1CF7 B;  3KLO A;  1HW1 A;  5J4V A;  3NQO A;  1W7P D;  3ERE D;  1D1B A;  1LFU P;  2DJI A;  3ZN1 A;  4D5F A;  2VBX A;  3A01 B;  4G7H F;  1LDK B;  2XPU A;  3EYY A;  3N4M A;  2MH2 A;  1T39 A;  3RQI A;  3VOD A;  2N8G A;  2FNP A;  3QYB A;  4CZC A;  3E5U A;  1MZB A;  2K3F A;  2RQQ A;  2CSO A;  1ETK A;  2K02 A;  4LOC A;  3GZN B;  1T0F C;  2JJ7 A;  2BXY A;  1RI7 A;  1FBU A;  2VPR A;  4CCL A;  3OYM A;  5FJ8 J;  1QZE A;  2CS3 A;  2XDV A;  2DOD A;  2VAS A;  4XM3 A;  3L1P A;  1FYK A;  5LHH A;  4GCV A;  1TBX A;  1ZK8 A;  2A61 A;  3DKW A;  4V2F A;  3WHB A;  1H0M A;  1X1P A;  5B5E C;  2QEN A;  1TQM A;  3FK7 A; 
#chains in the Genus database with same CATH homology
 4B4C A;  4GFB A;  1GT0 C;  3H3V K;  3S1M J;  1MNM C;  1A6I A;  1QRY A;  1FIP A;  3PO2 J;  2XPW A;  2D5V A;  2NS8 A;  4RBO A;  3Q0U A;  2CRG A;  2FJ1 A;  5E3M A;  4I76 A;  5IYB J;  4XRS A;  2EZK A;  4M3D A;  1LE8 A;  2NS7 A;  3CQZ J;  2O7O A;  1WH5 A;  2R7Z J;  2KDZ A;  2MW8 A;  3D1N I;  2JA5 J;  4BBS J;  4XID A;  4JX5 A;  1IJW C;  2EH3 A;  3K2A A;  4QSH A;  2XB0 X;  5E3O A;  5JLX A;  2ID6 A;  4CYC B;  3JRE A;  2HDD A;  3HEF A;  4W1U A;  5GPC A;  1JTY A;  2P81 A;  1JJ8 C;  4XK4 A;  1B8I A;  2M0C A;  4G12 A;  5F0H A;  2E2J J;  3S14 J;  1FTZ A;  2M34 A;  2MG4 A;  1SFO J;  3Q0W A;  1JUP A;  5GP9 A;  3TP0 A;  2VKV A;  5J1Y A;  4QTR A;  2VUM J;  3GTL J;  2MGQ A;  3DEW A;  1HCR A;  2ECC A;  2ECB A;  3JRG A;  2HXO A;  1G2H A;  1VF9 A;  2VKE A;  3RZD J;  2DA1 A;  4A3L J;  2MSY A;  3S16 J;  1IGN A;  3BQY A;  3E7L A;  4BY7 J;  1GDT A;  5JLW A;  5C4X J;  4D7N A;  2L9R A;  4IEJ A;  1FJL A;  2E2H J;  1BJZ A;  4M3F A;  4EEF G;  1K61 A;  1B8I B;  5IP6 A;  5F0C A;  2WAQ N;  4MFD A;  1AHD P;  3BG5 A;  2RAE A;  5FKM A;  2M9H A;  1POG A;  2G0E A;  2DA3 A;  2XGE A;  3TED A;  1ZQ3 P;  3HOZ J;  1U9O A;  4W97 A;  1Z0X A;  4RDU A;  3GTG J;  4JX4 A;  1JTX A;  2I10 A;  3JRC A;  1OJL A;  2OF7 A;  5IPA A;  4BY1 J;  2CQQ A;  4DZJ A;  4C2M J;  1UMQ A;  1Z77 A;  3ZQL A;  3JRA A;  3QPL A;  4AUX A;  3H0G J;  5FKN A;  3G1L A;  3LNQ A;  1HF0 A;  3MN2 A;  2Y0S N;  2IBD A;  5F04 A;  4A3G J;  3O8G A;  1XC5 A;  3GTO J;  2XB5 A;  5EGO A;  2WV1 A;  1MBJ A;  3FKI J;  4CYC A;  1MH4 A;  2EZH A;  1DU0 A;  2ZB9 A;  2DA7 A;  5M3F J;  1TC3 C;  3DCF A;  2JA7 J;  2COB A;  1Q1V A;  1U9N A;  2DTZ A;  3Q3S A;  2DJN A;  5E3L A;  4FE4 A;  2Y30 A;  1R9T J;  3GBG A;  3TP3 A;  1RET A;  3BTC A;  3MVP A;  1MBF A;  5M3M J;  3G1O A;  1WGX A;  3K7A J;  3QPS A;  5J1U A;  1JKR C;  2LY9 A;  4JP0 A;  1IDZ A;  2XRL A;  2DMQ A;  2LFB A;  1HOM A;  3HOX J;  3HOW J;  2CJJ A;  2ID3 A;  4FIS A;  2XSD C;  5EGO B;  1T33 A;  2XGC A;  4MLO A;  4M6V A;  3BR2 A;  3JR9 A;  2ELK A;  1JUM A;  3I4N J;  3OSG A;  1D5Y A;  3FK6 A;  1X2M A;  1JKQ C;  3GTJ J;  3JRF A;  1IG7 A;  1E3O C;  3HOY J;  2NVY J;  5FKL A;  1ETX A;  3S2H J;  2FQ4 A;  1ETQ A;  3M4O J;  3O8H A;  2O9L A;  4M3B A;  4X6A J;  1JT0 A;  4A93 J;  4S0H B;  1MBK A;  4M3G A;  1ETY A;  4A3I J;  3HB9 A;  4FE7 A;  3B6C A;  1IUF A;  4A3B J;  3BTL A;  4UUT A;  1WCM J;  3A02 A;  3UKG A;  3RZO J;  2LK2 A;  3FIS A;  1ZR2 A;  3S1Q J;  2ME0 A;  1RR7 A;  1P7I A;  1TWF J;  1DU6 A;  4C3I J;  5FLM J;  1IC8 A;  2DA4 A;  3SJM A;  1PUF A;  4V2G A;  2CU7 A;  2L7F P;  3ZQI A;  5M5X J;  2NVX J;  1I6H J;  4FCY A;  2GBY A;  2JK3 A;  3PO3 J;  3ZOB A;  1LE8 B;  1UHS A;  3HGY A;  2TRT A;  3PM1 A;  4MFE A;  2OPT A;  5J1R A;  2R5Z A;  1U78 A;  1ETW A;  2CUF A;  1F43 A;  3ZQG A;  2E2I J;  3CDL A;  3S1R J;  5EYR A;  4X1E A;  5K7H A;  2R0Q C;  3M3Y J;  5EZH A;  3F0C A;  4J19 A;  2JN6 A;  2LVS A;  3ZQH A;  1GUU A;  9ANT A;  5F08 A;  4ABZ A;  5J3L A;  5M5W J;  1JJ6 C;  1AU7 A;  2TCT A;  1QPI A;  2EZI A;  1MBE A;  1BW6 A;  3S1N J;  1H8A C;  3SDG A;  3NAR A;  2HYJ A;  3RKQ A;  1BA5 A;  2YS9 A;  2LD5 A;  1YRN A;  5IYD J;  4XRS G;  1O4X A;  2ME6 A;  1ETV A;  1SAN A;  1ITY A;  3OIO A;  2R5Z B;  4M3E A;  2GM4 A;  4XIC A;  4QIW N;  2HOT A;  2XGD A;  5F1J A;  4I6Z A;  1MH3 A;  1ZKG A;  5F27 A;  4DYC A;  1APL C;  3TW6 A;  1RKW A;  1OFC X;  5IP9 J;  5K7Z A;  3BR0 A;  1MSE C;  2Y9Y A;  4MIM A;  2AHQ A;  1RES A;  5F0F A;  3S17 J;  1VFC A;  3IH3 A;  2Y2Z A;  4Y52 J;  4DYR A;  1YRN B;  1MSF C;  1RKT A;  2XPV A;  4Y7N J;  3CMY A;  2DMT A;  4L5E A;  3BR3 A;  2FD5 A;  1ETO A;  4MO7 A;  5EEA A;  1WI3 A;  5DS9 A;  5EZG A;  3VPR A;  1NTC A;  3BR6 A;  2O8K A;  3BG3 A;  3Q0V A;  1OCP A;  3GTP J;  2M2E A;  5IOZ A;  2EBI A;  2R92 J;  4A3C J;  1FTT A;  1JUS A;  4BBR J;  1LFB A;  3JRI A;  3BT9 A;  3IH4 A;  3LSP A;  1WPK A;  1F36 A;  1JKO C;  2LR8 A;  2X6O A;  3BTI A;  2JA8 J;  2DA2 A;  2DA5 A;  3LSG A;  2EQR A;  1MBH A;  3C2B A;  2VI6 A;  2DMN A;  1BL0 A;  2DN0 A;  3HKZ N;  1CQT A;  2GLO A;  4JX6 A;  3GTM J;  1GV5 A;  1VND A;  2EZL A;  1XS9 A;  3I4M J;  5IOY A;  3GTQ J;  1FIA A;  2IEK A;  1ENH A;  2L0K A;  1T56 A;  2L7Z A;  1H88 C;  2YUS A;  2R93 J;  1ZR4 A;  2AO9 A;  5FKK A;  4DZP A;  3NAU A;  4IHW A;  4D5C A;  3FIW A;  3G1M A;  5C4J J;  2X9D A;  2LKX A;  2H8R A;  1W0T A;  1AKH A;  1QVT A;  3HOU J;  1BW5 A;  4A3J J;  2L7M P;  3CCY A;  2Y31 A;  3GTK J;  3SFI A;  1ORK A;  5HOD A;  5C3E J;  2NOG A;  1X2N A;  4FTH A;  4UUS A;  2IAI A;  4XRM A;  1IV6 A;  2KT0 A;  3HGG A;  1NK2 P;  1P7J A;  2JWT A;  2M8G X;  2PMZ N;  4A69 C;  5EF6 A;  3TW7 A;  4A3E J;  1GV2 A;  3WHC A;  3W6V A;  4DW6 A;  3BR5 A;  4IHV A;  3MKL A;  5FLV A;  1VI0 A;  2WB1 N;  1I50 J;  5C44 J;  2X48 A;  2NVQ J;  4IHX A;  1I3Q J;  5DTD A;  1AKH B;  1HDD C;  5IP7 J;  1JGG A;  1K83 J;  1S7E A;  1ZTR A;  3ZQC A;  2HOA A;  3HBL A;  4A3D J;  4A3M J;  5E3N A;  1W0U A;  2LLK A;  4UUS B;  4BKX A;  1FEX A;  2K9Q A;  1IDY A;  5EDN A;  5M5Y J;  2JMW A;  2LP0 A;  1TWA J;  2W48 A;  4C3J J;  3LSJ A;  1PUF B;  1OCT C;  3OSF A;  2H1K A;  3HM5 A;  3LOC A;  1XG1 A;  2HI3 A;  2R5Y A;  2K9S A;  2YU9 J;  2E1O A;  1Y1W J;  3S2D J;  1Y1V J;  3IH2 A;  3BTJ A;  3OOU A;  1IRZ A;  4AC0 A;  5K7F A;  2DA6 A;  1WH7 A;  2JA6 J;  4D7M A;  2K9N A;  5EG0 A;  3QQA A;  2QCO A;  4DYQ A;  3A01 A;  1A5J A;  2HOS A;  3JRB A;  2NVT J;  2FX0 A;  1QVU A;  4A3F J;  3ZQF A;  1TWG J;  5FKO A;  2B63 J;  3A03 A;  3LSR A;  1HDP A;  1MBG A;  1H89 C;  1EF4 A;  2CQX A;  4JYK A;  2R5Y B;  5BNG A;  4C3H J;  2DMU A;  2LTP A;  3IV5 A;  1ZGW A;  1JT6 A;  3BG9 A;  2HXI A;  2K40 A;  5GPA A;  1B72 A;  2CUE A;  5EG0 B;  1LFU P;  4D5F A;  2QF7 A;  3JRD A;  3JRH A;  3A01 B;  3BR1 A;  2XPU A;  1X58 A;  3RQI A;  2N8G A;  2E19 A;  1GVD A;  4A3K J;  2Y9Z A;  1HLV A;  4HNV A;  1ETK A;  3HDD A;  4AYB N;  1JKP C;  4LOC A;  4BXX J;  1UG2 A;  2HQ5 A;  2JJ7 A;  1TWH J;  4NDL A;  2VPR A;  2DMP A;  5FJ8 J;  3L1P A;  4IHY A;  1RPW A;  1B72 B;  1ZK8 A;  1U8B A;  4V2F A;  1TWC J;  4B3A A;  4B1R A;  3B6A A;  5IYC J;  3WHB A;  3BQZ A;  3HOV J;  3S15 J;  1NK3 P;  3FK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...