5IYBJ

Human core-pic in the open state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iybJ00
1GVDA 3DCFA 2CUFA 1FIPA 3OOUA 1R9TJ 1IC8A 4DZJA 3I4NJ 1POGA 1Y1VJ 3K7AJ 1XG1A 2EZHA 3Q0UA 5GP9A 5FJ8J 4JX4A 4RDUA 3H0GJ 5IP9J 1MBFA 2LP0A 1T33A 5J1RA 3BR3A 1W0UA 3RZOJ 3BQZA 5EGOA 1FTZA 1X2MA 3ZQFA 4D5FA 4D7NA 1OCPA 4M3DA 2EZIA 2WB1N 1RKWA 2HXIA 3DEWA 4DYCA 5FLVA 3S1RJ 1D5YA 4BY1J 1JUPA 2XSDC 4XICA 1HDPA 3M4OJ 3JRCA 2HOSA 4IHXA 2DMNA 1DU6A 3GTQJ 5IP7J 3JRHA 2R5ZB 1E3OC 1VNDA 3WHBA 1IRZA 1JKQC 1AHDP 3S1NJ 1FTTA 2DA3A 2R5YB 2X9DA 5IYCJ 3OIOA 3CMYA 3RQIA 4MO7A 4A3DJ 3G1MA 5J3LA 3JRIA 4BBSJ 2L7FP 3HOXJ 1EF4A 1F36A 4A3IJ 3LSRA 3FKIJ 1WGXA 1JUSA 1IG7A 3S16J 2Y0SN 3BTJA 4I76A 5FKKA 1ZQ3P 3B6CA 4M3FA 2LK2A 1JKRC 2AO9A 2K9NA 3E7LA 3JR9A 2XGDA 4B3AA 3SJMA 3OSGA 4AUXA 1Z0XA 2I10A 3D1NI 2Y9YA 4IHWA 1P7IA 2R7ZJ 3LSPA 5E3MA 3NAUA 2IBDA 2DA1A 4C2MJ 1JJ6C 2JN6A 2M9HA 1B8IA 1YRNB 1VF9A 3QPSA 1NK3P 1W0TA 2DMPA 2XPUA 2E2IJ 3HDDA 3BTLA 3HM5A 4W97A 2LVSA 4M6VA 4UUSA 5C3EJ 2HOAA 5EYRA 2ECBA 1A6IA 1A5JA 3JREA 4HNVA 5C4JJ 2MGQA 4W1UA 2M34A 4FE4A 3GTGJ 5F0HA 2W48A 4C3HJ 1MSFC 1FEXA 1TWGJ 2LD5A 1NTCA 4IEJA 2G0EA 3NARA 1ETKA 4ABZA 4EEFG 1U9NA 1MNMC 2O9LA 3BG3A 5F1JA 2M0CA 1B72A 2ID6A 3VPRA 1ZTRA 2ME6A 5M5WJ 4X1EA 3RZDJ 1QPIA 2Y30A 4CYCA 3HOYJ 1K61A 4LOCA 1TWHJ 2YS9A 4NDLA 1OJLA 2LFBA 3FK7A 1XC5A 2QF7A 3ZOBA 2VKEA 3MVPA 4A3KJ 4XK4A 4JX6A 4MIMA 5K7FA 1VFCA 3LNQA 5FKMA 3CCYA 2GM4A 2LTPA 3G1OA 4JX5A 1BW5A 5FKNA 2DN0A 1HLVA 4D7MA 3HB9A 2OPTA 3CDLA 3CQZJ 3TP3A 2JWTA 1I6HJ 1Z77A 2E2JJ 3ZQHA 5J1YA 4XRMA 1MBKA 2COBA 2EQRA 1IJWC 1BA5A 1ETOA 3MKLA 1BW6A 1K83J 1FJLA 2PMZN 3JRFA 5K7HA 1JT6A 3O8GA 2L9RA 4MFEA 1WI3A 2EZLA 2QCOA 1ORKA 1I3QJ 4BXXJ 5C44J 1WCMJ 4QSHA 3I4MJ 2CJJA 2XRLA 4V2FA 5IYBJ 1MH4A 4A3BJ 3BR6A 1WPKA 5FKLA 1JTYA 3BR0A 2JA6J 2DJNA 3HGGA 1B8IB 2VKVA 1IGNA 1PUFB 3C2BA 3BTIA 2YU9J 1HF0A 3M3YJ 4FCYA 4JYKA 2VPRA 2L7MP 3A01A 1X2NA 1RETA 2K9SA 1NK2P 1LE8A 3JRAA 2NVYJ 3A03A 3HOVJ 5F0FA 4I6ZA 3K2AA 1RKTA 2VUMJ 1JKPC 5IYDJ 2DA7A 1FIAA 4AC0A 4XIDA 1UHSA 1U9OA 2M8GX 5FKOA 3JRBA 2LKXA 4UUTA 3FIWA 3BTCA 2DA2A 5F27A 3Q0VA 5EG0B 3BG9A 1AKHB 3IH4A 3WHCA 3TP0A 1UMQA 4G12A 2XB0X 4A3GJ 1JJ8C 3F0CA 1QRYA 4M3EA 1MSEC 5FLMJ 1OFCX 5IOZA 2NS8A 4A3LJ 3Q3SA 2YUSA 3RKQA 3O8HA 1ZR4A 1GUUA 4AYBN 4A93J 5K7ZA 3B6AA 4BKXA 4FISA 2L0KA 2KDZA 5M3FJ 3IV5A 3BR2A 2TCTA 2CU7A 3S1QJ 1DU0A 3GTPJ 1Y1WJ 3ZQLA 3SDGA 1O4XA 3GBGA 1RR7A 3TW7A 2CQQA 3BR5A 2JA7J 1JGGA 2R5ZA 1JTXA 4S0HB 1XS9A 1RPWA 3QQAA 1ETVA 2R5YA 2LY9A 1BL0A 2HQ5A 1JKOC 5EGOB 2FJ1A 3W6VA 1QVTA 2NVQJ 2LLKA 4BBRJ 2FD5A 5C4XJ 2DMQA 1LFUP 3GTKJ 4J19A 2EZKA 2R92J 1RESA 3PM1A 3PO2J 5BNGA 2NVXJ 4Y7NJ 3BG5A 4QTRA 4X6AJ 5JLWA 2ME0A 5DTDA 1X58A 2CRGA 3A02A 2NVTJ 1SFOJ 2DMTA 3OSFA 1ZKGA 5EEAA 1ETWA 4DYQA 2DMUA 5M5YJ 1GT0C 5E3NA 1TWAJ 2WAQN 5IP6A 1YRNA 3HOWJ 2CUEA 3JRGA 2ECCA 3BQYA 1IV6A 3SFIA 5EDNA 3ZQGA 4A3EJ 5DS9A 4GFBA 3ZQCA 5F0CA 1OCTC 4BY7J 2JJ7A 2DA5A 3TEDA 4B1RA 1WH5A 2MSYA 2B63J 1MBGA 4IHVA 3S14J 1ZK8A 1F43A 1GV5A 1LFBA 2LR8A 4Y52J 1IUFA 2JA8J 2DA4A 3S17J 4C3IJ 1APLC 4IHYA 4B4CA 1VI0A 2XGEA 2EBIA 2XGCA 3GTJJ 3HOUJ 3Q0WA 2IAIA 1T56A 2R0QC 3GTOJ 1GDTA 1I50J 4A3FJ 1HCRA 1H89C 3JRDA 5IOYA 1IDZA 5F08A 1TC3C 4UUSB 4JP0A 2EH3A 3LOCA 2JA5J 4XRSG 5JLXA 2GBYA 3MN2A 1CQTA 2KT0A 2XPWA 3IH2A 4A69C 1GV2A 5M3MJ 2IEKA 3HGYA 1HDDC 1ENHA 2DA6A 5E3LA 2RAEA 2DTZA 3BR1A 2O7OA 4XRSA 4DZPA 4MFDA 5IPAA 2HDDA 2R93J 5EZHA 3L1PA 3FISA 2Y2ZA 4M3GA 4QIWN 2AHQA 2Y9ZA 1B72B 4CYCB 4M3BA 2HI3A 3UKGA 1ZGWA 4V2GA 2JK3A 3S15J 3TW6A 1TWCJ 1JT0A 4L5EA 2Y31A 4C3JJ 3GTLJ 2X48A 2X6OA 3H3VK 4FTHA 2E1OA 1ETYA 2OF7A 3HEFA 1MBHA 2HOTA 2TRTA 3FK6A 2FQ4A 3BT9A 5EZGA 2L7ZA 4DW6A 1ZR2A 1H8AC 1UG2A 2VI6A 4A3JJ 1IDYA 5HODA 2XB5A 1MH3A 3IH3A 2ZB9A 4FE7A 2JMWA 3S2DJ 1U8BA 5J1UA 2P81A 1ETQA 1P7JA 2WV1A 1PUFA 1ITYA 1TWFJ 2XPVA 2H8RA 2CQXA 2K9QA 1H88C 1U78A 1HOMA 4MLOA 3S1MJ 4A3MJ 2NS7A 1S7EA 5GPAA 1G2HA 5GPCA 5M5XJ 2MG4A 2E2HJ 2NOGA 3HBLA 3QPLA 5EG0A 3LSJA 1AKHA 1AU7A 3S2HJ 3GTMJ 2ELKA 2GLOA 2MW8A 3ZQIA 4A3CJ 1Q1VA 1MBJA 3A01B 1JUMA 1WH7A 2FX0A 3HKZN 4DYRA 1LE8B 2D5VA 2HYJA 1BJZA 2M2EA 2H1KA 5F04A 2K40A 3PO3J 3LSGA 3HOZJ 2E19A 3G1LA 1QVUA 2HXOA 4D5CA 2O8KA 9ANTA 4RBOA 5EF6A 1SANA 1ETXA 1MBEA 5E3OA 2N8GA 2ID3A
chains in the Genus database with same CATH superfamily
4OWRB 3FWEA 2F5EA 3DCFA 4RLFA 2D2WA 1ZG5A 2UWMA 2VODA 2FBHA 5LBQA 4PJNA 2PLYA 3ABUA 2ELHA 3BJ6A 3FXRA 2F5CA 3P9IA 2DDAA 2IA0A 3K7AJ 3VYSB 4C2UA 2IS1A 1R1TA 4RDUA 3H0GJ 5IP9J 1JE8A 2VJ5A 4PJMA 1MBFA 3KLNA 4DNCA 1NHAA 1T33A 3BR3A 4HV5A 1MZBA 2MC3A 1FOYA 4GGGA 5DYMA 1X2MA 1FTZA 4B44A 2R7XA 3DPUA 3ELKA 4XBFA 3EYIA 2DYRH 4HDVA 3WE2A 3QYEA 2O5RA 2HTJA 3ERED 4S04A 2UXNA 2P4WA 4FETA 4BY1J 4I7HA 1JUPA 2M0MA 2JVHA 2EPFA 3CCRI 3K1PA 4YRVA 3ABMH 5DUKA 4E7SA 2DMNA 3W2AA 1DU6A 1EJ9A 5ERIA 5IP7J 1IRZA 1VNDA 3WHBA 2GIZA 3L2VA 3BROA 3BJAA 3S3MA 1D8KA 1D3YA 1JHHA 3FM3A 1YS7A 1YJNI 1EF4A 1F36A 3K1MA 3FXOA 2WAFA 4YFXF 3EQLF 4BDYA 1YJ9I 3FM5A 1JUSA 3DTIA 3WGHA 1GHCA 4N9IA 3S16J 1ZG1A 3F8FA 4UVCA 2W1OA 2LK2A 2A6HF 2AO9A 3E7LA 3M07A 3OYHA 1ULYA 3MEXA 1LDDA 1Z0XA 4AVPA 5BMZA 1FBQA 2VBZA 1P7IA 3V42A 1F1ZA 3NAUA 2PJRB 2DA1A 5H20A 3OYEA 1TP4A 3GLXA 1YRNB 4ZTFA 3O6BB 2OUMA 3EYYA 2HQNA 1W0TA 2IS6A 1XGSA 3IWZA 4RB0A 1R4NB 2BY0A 4W97A 2NNNA 2ZJ2A 3PNTA 5TJJA 4UUSA 3LQQA 4JQFA 3MZ8A 1MKMA 2OTJI 1CF7A 1KQ0A 5EEGA 1A5JA 1IRFA 5JVTA 1XPXA 3PNYA 4G7ZF 5ICEA 2CS3A 2DJIA 3I3LA 2W48A 5HOOA 2V1NA 2V1DA 5L3DA 3E6CC 2LD5A 1NTCA 3VEPA 4NC8A 2M87A 2O6GE 3NARA 2IRFG 1VQPI 5GAEJ 1U9NA 4Y15A 5IY5H 3I59B 2CQNA 2M4KA 3AG2H 5F1JA 3JTHA 4ENNA 2ME6A 3RZDJ 3G2BA 2Y30A 3ROUA 3HOYJ 1S8NA 3C2GA 4NDLA 3SQNA 4ZH4F 1XC5A 4PCQA 4XK4A 1ACIA 2BY3A 4MIMA 2Y75A 3FXKA 4H4KC 5F6FA 1VFCA 2HVSA 2L02A 3CP2A 4XONA 4EQQA 3CC2I 3ZQ7A 3G1OA 2HKOA 4NC7A 3GFLA 3LFUA 5CVJA 4EV0A 3S8PA 1IRXA 3HB9A 3NWTA 1J09A 3T5XA 3CDLA 1FPQA 5GTIC 5KNLA 2H94A 4U0VA 3HTUA 1HQCA 1Z77A 2Q2EB 3BP8A 2PI0A 1MBKA 2A6EF 2EQRA 2F5FA 3HYIA 4CSWA 1X1AA 3OYKA 3ZP5A 3WG7H 2ZXIA 1OKRA 3FXJA 3ZMZA 3O8GA 4MFEA 3ULQB 2RNJA 3W2VA 5D8LB 3BDDA 1WI3A 2KJBA 4KT6A 3SFZA 4M9SA 2L3DA 2V6EA 2BVLA 3S32A 3PFIA 2GXBA 2CJJA 3EUKL 2QYOA 2HPMA 2GXAA 3CLQA 3LA3A 2ZJRF 3CZ6A 2E71A 2DO7A 4FASD 2CSOA 2ISZA 2VKVA 4RM3A 3MD2A 1ZN2A 1KQ8A 4MTDA 4Z2YA 4L5JA 1HF0A 2UXXA 4FCYA 4JYKA 5EEHA 3VYTB 1RETA 2XAFA 1KU7A 1A35A 1V55H 3DKWA 1IN6A 5F0FA 4E7KA 2PMUA 3HJEA 5LEKA 3K6GA 4N4OB 3BOQA 4I6ZA 4FX4A 4AM3A 4Y3OA 2M7BA 4KN7X 2QENA 4ENMA 3Q5FA 4JBAA 2M3AA 1U9OA 3ECOA 3JRBA 1X4PA 2LKXA 3BTCA 5HNHA 2H27A 2DA2A 1V5EA 2MD0A 4IOCF 1IXCA 1U5TB 3KZYA 4BU2A 2RKHA 1B4AA 1USTA 1USSA 3WHCA 2XRNA 3RKWA 2W7NA 1FBUA 1JJ8C 1QRYA 4II2A 3OS2A 3KIOA 5JVGF 1QHGA 4YIRX 3CO7C 3KEOA 1D0YA 2KDOA 2VJIA 4YIFA 1WJEA 2ISYA 4ZYAA 2NS8A 4A3LJ 2W57A 3RKQA 3O8HA 4L9JA 3SZGA 3DV8A 5K7ZA 3B6AA 5M3FJ 2CW7A 2HYGD 3IV5A 4BQAA 2TCTA 1O3TA 2OQRA 2D45A 1Y56A 5L3FA 1MW7A 2PG4A 3LFKA 3CCVI 3HOSA 3GTPJ 1R7JA 2ETHA 2Q1ZB 5A2QK 3V7RA 1VQ8I 3ZQLA 4UB6C 2X6XA 3SDGA 4WWCA 3DTKA 4F92B 4IHSA 3GBGA 1SVMA 3DQVC 3BCBA 2MD5A 2DOAA 2OU2A 5B66C 1PP8F 3FHNA 4AVZA 3GXOA 2HQ5A 1YI2I 1TTYA 1OQYA 3AL0C 5FLXZ 2LLKA 2LSOA 1LFUP 2CGPA 3GTKJ 4BHPA 3CO6C 1G3SA 2JUCA 3PO2J 2A05A 2GA1A 2KZGA 3BZ6A 3IUOA 4XLAA 5H6QA 1I27A 5ED4A 3DLAA 4EJOA 4QTRA 2EV6A 3K70D 1JGSA 2OA4A 5JLWA 2VQHA 5DTDA 2XV4S 2NVTJ 2RQPA 2DMTA 4BJ5C 3OYAA 3CF2A 4Q5SF 2PJRA 1XD7A 4CCJA 2DMUA 1GT0C 2Y48A 4I0BA 4LIUA 4EM1A 5IP6A 1YRNA 5FFXA 2EINH 3DKXA 2J5OA 3JRGA 2PEXA 2ECCA 3BQYA 3E6MA 3WU2C 3H0DA 3UR3C 1FNNA 4A5MA 3IAM2 5EDNA 2GOXB 4CCNA 1DP3A 1FC3A 3OL3A 3SZPA 4A3EJ 2NS0A 5CYVA 4Y13A 1EH8A 2F6CA 1PDNC 2MSYA 3ZN0A 2VKDA 4Y52J 3S17J 4AIDA 4C3IJ 1APLC 4I09A 4IHYA 3ZRGA 4BH9A 4B4CA 1VI0A 2XGEA 1O7LA 3FMSA 3HUGB 1ODDA 1SVOA 2EBIA 2XF7A 3F6VA 3HOUJ 2QEXI 2ZJQF 2IAIA 3I59A 4LB6B 3GTOJ 3X2QH 1GDTA 2CYYA 1HCRA 1H89C 1WQ2A 2VT3A 2EWNA 5IOYA 2R7SA 1VQ5I 5F08A 5JI6A 2EIMH 4P96A 5J40A 1IXSB 3BWGA 2JA5J 2VL8A 2GBYA 4OIOF 1O3RA 4HQMA 3AAFA 2XPWA 2DI3A 3IH2A 2IP2A 2OJED 1GV2A 4RAFA 2JTVA 4PJJA 2E35A 3HGYA 2DA6A 1HKTA 3ERMA 3S2WA 1T98A 2O7OA 4MFDA 5IPAA 4HW0A 2HDDA 2R93J 3DPLC 3L1PA 1YTYA 3I54A 3KE2A 1B72B 3AG1H 2Q2EA 3ZMDA 4M3BA 1LQ1A 2AQEA 3TW6A 1TWCJ 1CGPA 1QZZA 2A61A 3KFWX 4PSXA 4XL9A 2ZNYA 2IT0A 3R0JA 2E1OA 2EV0A 1WJBA 1ETYA 3K10A 3N4MA 1MMDA 4GXOA 5DCFA 2H6CA 3BT9A 3OR2C 5HVQC 1ZR2A 2QKMB 2KQRA 1RR8C 2E7WA 1K78B 4QWQA 2MABA 2E7XA 3C3WA 3IH3A 2ZB9A 3H3ZA 4KMUX 1U8BA 5J1UA 1ETQA 1YYVA 2DODA 1P7JA 2M30A 2BY1A 1PYVA 3KCCA 1XSDA 1Z7UA 3E5QA 1OYWA 4B3XA 4E4HA 2E1NA 2WWYA 1TW2A 3HSRA 3E6DA 4M74A 3E0JB 1H88C 1HOMA 3D0SA 3WTTC 3ML6A 1XMAA 4ETSA 1S7EA 3CUQB 2CO5A 1TNTA 2CQKA 5HS8A 1O7FA 3L2CA 3F9KA 1SC7A 2LBFB 5DD4A 1U5TA 2PMHA 1R6RA 1FP2A 2YPRA 1L3LA 3D5SC 1IUYA 2GLOA 3P9KA 1ZHFA 2UUZA 2MW8A 3TOAA 4F7ZA 4A3CJ 1LNWA 2XAJA 1MBJA 2JVGA 1JUMA 3T1BA 3WTUC 3HKZN 1FLIA 2X0LA 5E1WA 1X3WB 4LGWA 2HYJA 1BJZA 4ZDLA 3F8CA 3P5JA 5FD6A 2HS5A 3OV8A 2H1KA 2V9KA 3SZTA 5IT3A 3G4SI 3PO3J 3LSGA 2HOEA 4IQJA 2K86A 2V6CA 4D5CA 2O8KA 2DU9A 1MNDA 4XN0A 1SANA 5HLIA 1J2XA 4IJAA 3R4KA 1GXPA 4G9YA 4OMZA 2OD5A 2QWWA 2GXGA 1GVDA 1XB4A 4GDFA 4P9FA 3GCMA 2P6TA 1PP7U 2FF4A 4DZJA 2XSJC 1YX5A 1YX3A 3G73A 2PX9A 3VODA 5CVVA 1QHHD 4A2UA 3C7JA 3F23A 4CCOA 5GP9A 5D6EA 4JX4A 4XLHA 4KDPA 1BM9A 4YFNF 3CC4I 2IW5A 3KEYA 5HLHA 2NOJB 3WTXC 4OIQF 2COMA 3CESA 3RZOJ 1FP1D 3RYPA 3LAJA 4U88A 3H5RA 3L9FA 4XQFA 1WJCA 2CUJA 1JHFA 1MMGA 3VDXA 1Z7LA 4G6TB 2PFBA 2ZXJA 4CCMA 4XLCA 2WB1N 1RKWA 2HXIA 2DDBA 3ECHA 3V7CA 2RN7A 3JRCA 3S3OA 2YU3A 2HOSA 2A3SA 2BOLA 4Y17A 1C0WA 2A6TA 3WTVC 2FBKA 1E3OC 1GXQA 2PJPA 2W00A 1FTTA 2KRFA 3FXLA 1BOAA 5ILVA 5K5QA 2VBYA 3OIOA 5CLSA 3CMYA 3RQIA 3U9GA 3HOTA 4MO7A 3G1MA 3GYHX 5J3LA 5LGNA 1BI2A 4PDKA 5FGMA 2L54A 1LDJA 5CQGA 1IG7A 2WAQA 3LSKA 3OS0A 1P9QC 3BTJA 4CICA 1VQ4I 3B6CA 4LLGF 2XGDA 3OSGA 2L7KA 2AXLA 1LDKB 2Z33A 4BNCA 2HNHA 1J5YA 1KGSA 2XC7A 2I10A 1R1VA 4KICA 1Y0NA 5E3MA 4C2MJ 1JJ6C 3FKJA 3HUGA 2Y0MA 3QPSA 4DBRA 1S72I 4NB5A 2VXZA 4WXCA 2E2IJ 2MH9A 3PJRA 3HDDA 4IPAA 2VJ4A 3HM5A 2KPMA 1MJBA 4EGZA 4E7LA 3ESWB 1K6OA 1EH7A 5JFRA 1HKSA 2Z16A 4MGRA 5C3EJ 2HOAA 2M1BA 3A0BC 5EYRA 5BOXA 4KN4X 4M6XA 4PJLA 4ITVA 3H5AA 3BG6A 3OY9A 1W36D 5LHIA 2QZ8A 1ON2A 5F0HA 1E0EA 5E79C 3RIRA 1T8IA 4UHTA 4C3HJ 5DUIA 1TWGJ 3OYNA 4IO9F 3KP3A 4ABZA 4EEFG 5B1BH 5LRRA 4EJVA 5CVUA 3HHGA 3KLOA 1MNMC 2WC2A 3BG3A 1FYMA 4Q47A 5B1AH 4IQ4A 2D1HA 3OMYA 2WAEA 2B0LA 1B72A 2EFQA 3VPRA 4LOCA 2LFBA 2K7LA 3ZOBA 1KU2A 2P5KA 2NNYA 4XLEA 5K7FA 1R36A 1GLNA 3CCYA 2NXNB 3TL4X 2XKPA 1I39A 3T8TA 2LTPA 5DEQA 4CUGA 3SDBA 2VQGA 5D4SA 2LC2A 1V54H 1SFXA 1AOYA 2ICWG 1HLVA 4PJ0C 4PFOA 1Z05A 3I55I 2FNAA 1K78A 1Y8QB 4AIJA 3TP3A 4QLCU 2JWTA 2X6WA 5BPDA 2F2EA 4BGDA 4U0YA 2UV1A 3OIPA 3ZQHA 1B9NA 2G7UA 2RV8A 2COBA 3HPHA 5J1YA 4XRMA 3CF5F 4KT5C 1M1EB 2CMPA 1FJLA 1J0RA 2PMZN 3GWZA 4KIFA 4CCLA 5DDGA 1JXSA 1V5FA 5HLGA 2JZYA 2JUGA 2EZLA 2QCOA 2QBYB 1WCMJ 4AWXB 4DGWB 1YW9A 5DD8A 4XSXF 3CUQA 1QQIA 1VQ9I 4A3BJ 2LBFA 1LPQA 2R7VA 1BIBA 4OIRF 1ZLKA 5FKLA 4GYIA 1YLFA 5E20A 4I98B 4RGUA 5E18F 2CFXA 1O57A 2RDPA 3HGGA 1B8IB 1OCRH 1IGNA 2PBIA 3HL2A 3ASNH 2KP6A 1X2NA 2K9SA 3IKVA 2DK8A 1B6AA 1RI7A 2GOMA 3JRAA 3WE3A 3HOVJ 1Q1HA 3FXUA 3MCZA 5DCMB 1HW5A 2FQ3A 2O61A 1RKTA 4M9XA 1DP7P 2FEZA 1FIAA 4KIBA 2M8GX 1X1CA 5LRSA 4PFPA 5F27A 1XX5A 2KIQA 5EG0B 4ZDOA 3OS1A 2BHZA 1AKHB 3IH4A 3KETA 1X1DA 5HNFA 4XLFA 3TP0A 5E17F 4A0ZA 4GCVA 1X3UA 2XB0X 5JR3A 3OYGA 2F4IA 3D5RC 1FMVA 5J8CA 4HPQA 5IOZA 2E1MB 4ANJA 1SMYF 2K3PA 5LEJA 4KFCA 3Q3SA 2ESHA 4KIGA 2LOOA 2VASA 4FT8A 4AU7A 1ZR4A 2CV2A 3DU6A 3QU3A 3HG9A 4BKXA 2L2OA 2L0KA 4RGXA 5AIQA 2J5PA 3F8NA 3GF2A 3RDIA 4U87A 1KU3A 1TNSA 1Z1DA 2XVCA 1K79A 3JAMZ 2KZVA 4U7DA 2OQGA 3EETA 5F64A 1ONVA 4RMNA 1X19A 2QGUA 3MQ0A 1BC8C 1O4XA 1XDUA 1DGRM 3TW7A 2L4MA 5CKTA 2JA7J 1JTXA 4UVAA 3HRSA 1OCOH 1HW2A 5FRNA 4BQNA 2LY9A 3ZXSA 3J81Z 1BL0A 3BLYA 1JKOC 1K4SA 3W6VA 4B8XA 4IHTA 4BBRJ 1GVJA 1OMIA 2DMQA 3KYCB 4XKCA 1LB2A 4D9JA 5D5UB 3GO5A 3HIFA 4L0YB 3F8BA 4BHCA 1WSUA 3TMOA 3DU5A 4Y7NJ 2VB6A 3HTSB 3J80Z 4HF2A 1P92A 1HSTA 1XDSA 3WODF 2QQ8A 4X6AJ 4NUBA 1X58A 2R7TA 3A02A 2Y0SA 3CDIA 1SFOJ 1TLHB 2IGMA 4LG3A 2AXTC 2OZ6A 1ETWA 4UXNA 1FSHA 3HOWJ 2QSFX 1Z21A 1X3ZB 4E7HA 1IV6A 3SFIA 2MLGA 5TGTA 4LK0F 4K2EA 5D6FA 2M5WA 1FY7A 2DA5A 3PNVA 5E1ZB 5L3CA 4LLNA 4B1RA 2B63J 4GYGA 3R60A 2A68F 3O3KA 3S14J 2DT5A 4BQOA 1IW7F 1A6QA 1J7KA 1IUFA 3H1CA 2ZXHA 5GADJ 4IZZA 3DTEA 2JQ7A 3V7SA 1BI0A 4CCKA 1E17A 4HNTA 3ZMTA 2DT6A 3V8KA 5KHDA 2OZUA 1P4AA 4ZYHA 2B7EA 4LFUA 1T56A 2KRHA 3BJOA 1QO0D 3DBLB 1H9TA 3JRDA 4XNFA 1IDZA 2FBIA 1F4KA 2FSWA 3F3XA 3SEZA 5H6RA 2EH3A 2HU9A 4WK8F 2ZCWA 4XRSG 5D4RA 6PAXA 3LMMA 3E5XA 1CQTA 2KT0A 1KZHA 5HLTA 2A07F 4A69C 2F4MB 2TDXA 1HC8A 5M3MJ 1LVKA 2IEKA 3H36A 1W1WE 4FHTA 2R4GA 3I58A 2KRCA 4PUSA 2RAEA 3HRUA 2H1LA 4XOPA 5EJCA 3V4GA 3E97A 2DQRA 2STTA 4XRSA 2EA2A 4DZPA 3VB2A 3QWLA 4RM2A 5EZHA 4E7IA 2Y2ZA 1PUEE 3JSOA 4L9NA 2AHQA 3LL7A 1L0OC 1W5CC 3TDZC 4CYCB 4DIQA 5FFZA 4Y33A 2HI3A 4DBQA 1MMSA 1ZGWA 2ZKZA 3PUBA 2JK3A 4V2GA 2LKSA 4B48A 4L5EA 4IRIA 1BR4A 4GRIA 4ZYEA 5LGTA 2QBYA 2ZMEB 4ESBA 2X4HA 5J4VA 1UELB 3I64A 5H2FC 2FQ4A 2VLAA 1SD7A 3MFKA 1H8AC 1BI3A 1UG2A 2V9VA 1IDYA 5HODA 1G4DA 1MH3A 4KNYA 4MNUA 2K3FA 4FE7A 5L3GA 1TQIA 1OPCA 2V79A 2WV1A 2VQLA 1ZELA 1UG0A 3C1DA 2BGCA 1ZG3A 4HV6A 4EVIA 2DFHA 3GZNB 2DPDA 5D5WB 4XLPF 3Q9VA 3OYFA 2XPVA 2LYCA 4C2TA 1T0FA 5DCMA 5JHUA 1VZ0A 2K9QA 4MHGA 1U78A 1QPMA 4MLOA 3QPTA 4A5NA 2ADUA 2EIKH 3CJNA 5GPAA 1G2HA 1G3YA 2A69F 5FO5A 5FD5A 2V9PA 3RSNA 3HBLA 1V5GA 4HF0A 3QPLA 3L2QA 5EG0A 5ILSA 3ZCOA 1AKHA 1AU7A 1MIJA 2DBBA 2ELKA 3JW4A 4YEJA 1R23A 1TL8A 3REOA 2BVMA 4XKBA 3ZPLA 3JTGA 3K70C 2LY2A 4R1HA 1LE8B 2D5VA 1U5TC 3LSMA 1DQUA 3MZHA 4IKFA 1W4MA 4IX7A 2DOFA 2VN2A 5F04A 1LFPA 2GQQA 4XKWA 3KP6A 1ZYRF 1AA7A 4C9YA 3A1YA 2IA2A 5E3OA 4RB2C 5D5VB 2ID3A 2FOKA 4MEXF 4BAYA 4HOBA 2XDVA 1YIOA 2C6YA 1IC8A 2VOOA 1IO2A 2VBXA 1V3FA 3I4NJ 1YHQI 3L2RA 1POGA 2EV5A 4PGHA 1I5ZA 1IN4A 4ZYDA 2ZMEC 3FDYA 1Y1VJ 2VPLA 1XGOA 4CGZA 3OL4A 1ON1A 2O0YA 3J7AY 2QLZA 3RQ4A 2F4OB 2QQAA 2HVQA 3DBRB 4PGGA 4ON0A 5FLXK 4D5FA 1OCPA 2XUBA 3IL2A 1G3WA 2MH2A 3J7ZI 3PUFA 5CPRB 4HEA2 2JA2A 2Z1DA 3KP5A 3LSTA 4LB5A 1IF1A 2E5ZA 3PIPF 4DYCA 4EM0B 5FLVA 1SEUA 3LSIA 1D5YA 4B09A 1X4OA 3T8RA 2XSDC 4XICA 3ABKH 3M4OJ 4CA0A 1LJ9A 3R6SA 1A36A 4HSRA 1YIJI 1IN5A 2NYXA 3GTQJ 3JRHA 4A6DA 1JKQC 3U1KA 4LJZF 3CP8A 4ENKA 1AHDP 3S1NJ 2IGKA 2ESNA 2X9DA 5IYCJ 2FNPA 4ZZLA 3LA2A 3CUOA 3A2KA 2DAOA 2XAUA 3HOXJ 4A3IJ 1N77A 1WGXA 1Z6TA 2OCEA 2KJCA 2VONA 4OAYA 3GW2A 2A5YB 1BR2A 4UV9A 3K0LA 5F1RA 5FKKA 3RTRA 4M3FA 1JKRC 1YW8A 3SJMA 2VC0A 3E5UA 3PFYA 4IVNA 4AUXA 3V8LA 3D1NI 1TQPA 2Y9YA 4IHWA 3MKZA 5HS7A 2R7ZJ 2EB7A 1MJ9A 2R7OA 1V4RA 4WXHA 2IBDA 1SFUA 1RC9A 3HRMA 2JN6A 1WFXA 1VF9A 5LHHA 5LGUA 3IKTA 1HA8A 2DMPA 2XPUA 1LEBA 4KA4A 3BTLA 1K7AA 1LKXA 4M6VA 3RI4A 4BXFA 3PQKA 4NC6A 1WHUA 3H3UA 2NVUB 2FUG2 3JREA 2RQQA 4HNVA 4BS9A 2IPQX 2MGQA 4W1UA 2ZC2A 4FE4A 3GTGJ 3GFIA 1UCRA 1MSFC 1YITI 2CV1A 4F52A 1ETKA 2L01A 1ZLJA 2O9LA 4M6YA 1ZREA 2M0CA 2GWRA 1PVEA 1ZTRA 5M5WJ 2HKXA 4X1EA 4CYCA 3CCMI 1K61A 2CQ7A 2LRDA 2ZSIB 3QU6A 4JOMA 5IT9Z 3FK7A 3BCAA 2VKEA 2XASA 3MVPA 4A3KJ 2KISA 4JX6A 2RNGA 3KP7A 2LKPA 1QZYA 4U0WA 3ZMVA 3H9QA 2GM4A 2ZMEA 4OINF 3TO9A 3QOEA 5TISC 4JX5A 3H35A 1BW5A 1XMXA 4WX9A 3K4NA 4HYEA 2Z5UA 1P4XA 1R5HA 1TBXA 2OPTA 1BBYA 3H9JA 2P8TA 4GO1A 4TV7A 4OU0A 2BY2A 2DPUA 3HXLA 4B47A 1WJDA 1Y6IA 1ETOA 4BUPA 2R7FA 4LLLA 3CCSI 1WKMA 1ZH5A 1OCZH 4BYYA 4BHBA 4V19K 5K7HA 1RZ4A 4ASNA 2UZKA 1JT6A 2X1CA 3CJRB 2V4JC 4M73A 5KAFC 4BXXJ 1STZA 4OIPF 5BPIA 1Z67A 3AG4H 4QSHA 3H92A 3I4MJ 2K4BA 2BEOA 2WBMA 2YR2A 2PQ8A 1WWXA 2HVRA 4A0XA 4ESJA 2R7WA 2H6BA 2QVOA 4V2FA 1MH4A 3BR6A 1IZ1A 5J6XA 4B43A 3F8MA 1WVRA 3FXQA 2JRTA 3KP2A 3J7YJ 3CUQC 1PUFB 3C2BA 4I99C 2KMUA 3MKYB 3PQJA 1QBJA 2YU9J 3M3YJ 1IRGA 3Q9SA 2JT1A 2VPRA 2L7MP 3ISPA 2ELJA 1S7AA 1D1CA 5J8FA 4R79A 1LE8A 1G59A 1HBXG 1OR7A 3A03A 4OOIA 1IV8A 4BACA 3A4CA 4II3A 3C18A 5B5EC 1S3JA 3RKXA 5K1YA 3ZQQA 2JPBA 2Z99A 4YG2F 1J75A 5IYDJ 3HZJA 2F5DA 1G8XA 2L9VA 3B73A 2DA7A 1FWZA 4AC0A 4XIDA 1UHSA 1VQMI 2IS4A 3ASOH 4WCGA 3VWBA 2K9MA 2I8DA 2JRMA 1LEAA 2M8EA 3F6OA 3S93A 2LREA 4ZYGA 4PSWA 3DXJF 3ZR8X 2IA1A 3IP4B 1UMQA 1VQ7I 4G12A 3L2UA 3RYRA 3F0CA 4F55A 4M3EA 2VC1A 2K9LA 1N25A 1YJWI 3OWTA 1I3AA 2QA4I 2WY7Q 3TKYA 1OFCX 2JSCA 1I6XA 3KYDB 1WJFA 2RGVA 1HW1A 2OV7A 2STWA 3CDHA 3SYTA 3AKZA 2ZXWH 5CJ9A 4LIVA 2P0WA 1GUUA 4AYBN 3G6EI 4FISA 2KDZA 3G3ZA 2LH9A 3BR2A 4FQGA 1VQLI 2O8XA 2G7HA 3NWSA 2DYSH 1Y39A 5KCMA 5B3SH 2EFPA 3BY6A 2W82A 4LD5A 2MA3A 1Y1WJ 3FMRA 4I02A 1TQMA 1RR7A 1YQAA 2CQQA 3BR5A 5HS9A 2W85A 1U6GA 2ZSHB 3P7NA 1W36C 5KVRA 4S0HB 2V26A 1RPWA 3QQAA 4P9UA 1G6NA 4L18B 2LNBA 2XAQA 3G71I 4XLNF 5FRMA 1MD0A 5EGOB 1IN7A 5C4XJ 2FD5A 1FSEA 1ERDA 5E8IA 3BZCA 4J19A 2X85A 3JCUC 4MQVA 2R92J 1RESA 3PM1A 2LMDA 2XIGA 2DK5A 5GTHC 3E6BA 1BC7C 5LD2C 2HDCA 5AONA 3EUHA 5BNGA 1ZRDA 4Y4RA 3WGIA 2NVXJ 4A0YA 1WJ5A 1U0JA 2P5VA 4UNOA 1BJAA 3M9AA 1ZARA 1DPUA 3HC7A 2ME0A 2VXDA 3TGNA 2W24A 2CRGA 2L5QA 2L9SA 2HEOA 2MBFA 2KIFA 4HLYA 4G94A 1IXRC 2VJJA 2RREA 2VE8A 3OSFA 1P6RA 2QKLB 2Z3YA 3R61A 2MC4A 5EEAA 3IRQA 4DYQA 5M5YJ 3GFJA 1R49A 4DOZA 2CWEA 2ZBKA 3K4MA 1QU3A 1TWAJ 2WAQN 2BZTA 1T2KA 1KYZA 4EGYA 2HFHA 4I0AA 1MGTA 1SD5A 1TW3A 3W3CA 4L9VA 2DLLA 3ZQGA 1P2FA 5DS9A 4GFBA 3ZQCA 5F0CA 1OCTC 2HPIA 3L2WA 4BY7J 2JJ7A 3MMYB 3TEDA 1BIAA 1YOVB 4BJ6C 1D5VA 4EJUA 5TRDA 1MBGA 1Z3XA 4IHVA 1F43A 1WJAA 1GV5A 1LFBA 2W4SA 3VYRB 1K4TA 2JA8J 4PZJA 2VE9A 4EJWA 5L3BA 4RGSA 1REPC 1EKEA 3OYDA 1T95A 3OYIA 4NQWB 4CZZA 2AS5F 3U2RA 2CH0A 2DT7B 3GTJJ 2K27A 1UB9A 3E3VA 1MDMB 2R0QC 1HSJA 5BQTA 4A3FJ 2ZO4A 2EFWA 1WRJA 4HLXA 1TC3C 3F72A 4Z6YA 2L9NA 1TT0A 4HNUA 3GUDA 3LOCA 3WGGA 2B9SA 3LSHA 5JLXA 2BW3B 3MN2A 2JSPA 1DGWY 3RPQA 4EM2A 1ZGAA 1ENHA 1XGMA 3B02A 1R5GA 2KFDA 1UFMA 3M1EA 2YX4A 3FISA 4QIWN 4P1WA 4Q4ZF 2Y9ZA 3A0HC 4F91B 5GAHJ 3UKGA 3TQNA 1JT0A 1XTAA 3N97A 2Y31A 1D0XA 2CW8A 4C3JJ 2X6OA 4G7OF 4FTHA 2KHMA 2OF7A 3HEFA 1FOXA 3FK6A 4HX7A 3S3NA 3SHFA 2L7ZA 4DW6A 1SVLA 3WTZA 1YS6A 4RLQA 2XB5A 3U21A 3DKYA 1SAXA 1Z91A 2JMWA 3H5NA 3K69A 1PUFA 1DUXC 1W5TA 4HZFA 3V8JA 2E34A 4BXUA 1ITYA 2CG4A 2VOPA 1AWCA 2O03A 2AQFA 4BEHB 1NG7A 5CVRA 4YELA 4BQQA 4RAGA 3VFZA 4OAZA 3CLOA 2CFOA 1QZEA 3BPXA 3D5LA 4E7ZA 2FE3A 2MG4A 2XGXA 5M5XJ 2NOGA 2O3FA 1T0FC 4C30A 1SFKA 4P55A 2WTEA 3GTMJ 2HR3A 5GAGJ 2H09A 2YX7A 1MMAA 2D1VA 1A04A 3CCUI 3GVAA 3MWMA 2FXAA 1Q1VA 5DM7F 3A01B 3KEQA 4XSZF 4DYRA 2FX0A 2NAZA 2VBWA 2EFNA 2Z2SB 1T6SA 2M2EA 3NEUA 2K40A 3HPGA 3HOZJ 2IGNA 4O5VA 2FOWA 1QVUA 1U8RA 1S7OA 4RBOA 4IL6C 1O3SA 1ETXA 1YO5C 4EATA 1OCCH 3I56I 3ZMSA 2CUFA 2Q8KA 1FIPA 3OOUA 2E1MC 4M72A 1R9TJ 4J01A 3JAMK 3E1SA 1KA8A 2DQLA 3K4JA 2HWVA 1IN8A 2R7RA 3K1NA 4CHUA 4HX4A 1XG1A 2EZHA 2XAGA 3Q0UA 2PN6A 5FJ8J 2GAUA 3F22A 4OMYA 3DPTA 4UY8I 1E3PA 3KX2A 2LP0A 4G6DA 5E1XA 2IGOA 3M7GA 3J81K 2VIXA 5J1RA 1DPRA 2K4JA 3QP6A 3BQZA 5EGOA 1W0UA 3ZQFA 4D7NA 2X1EA 3CC7I 3KZIC 1VQNI 1TZLA 2VKHA 3ABTA 4M3DA 2G9WA 2GIVA 3VOEA 2EZIA 3DF8A 1MNEA 1FX7A 2F48A 3DEWA 2DXIA 3S1RJ 4HA8A 5A2QZ 3J80K 1HDPA 4D0PA 3AL0B 2QSHX 1S6LA 2WA0A 4XMYA 3QPHA 2OC6A 4UVBA 4IHXA 3ZN1A 3WTWC 2R5ZB 4EJTA 4UV8A 1FT9A 1WI9A 2DA3A 1D0ZA 2R5YB 2ACJA 3CD6I 2LY1A 2CW0F 1J59A 3DEEA 2F5VA 2IJLA 3GZ5A 3WTYC 4A3DJ 3JRIA 4BBSJ 2L7FP 4MQ9F 3LSRA 3FKIJ 2QQBA 4HG2A 2QSGX 4RS8A 5D5XB 1FMWA 4BE2A 4IOAF 1RNLA 3OR1C 2P7CB 4D1QA 2Y0SN 3ONQA 4I76A 4RAZA 3TOBA 1ZQ3P 2I5UA 2K9NA 4IF4A 3ZMUA 4B3AA 3LQRA 3JR9A 1XGNA 2DFEA 3QP5A 1KONA 1XCVA 1O3QA 3CMEI 3LSPA 4NNJA 4XR6A 3OYJA 3JSPA 3P9CA 3OIQA 4KITB 1G3TA 1BI1A 4NQWA 3FF5A 2M9HA 3I4PA 1B8IA 2NRAC 1NK3P 2QUFA 3DFGA 3HSFA 1MDMA 1WZ2A 4KJZA 1R1UA 1UZCA 1QA6A 4E7JA 3MKWB 1N75A 2LVSA 3K4KA 4J00A 2X51A 4ZDPA 2BW3A 2ECBA 1A6IA 3QRFF 1UAAA 1DDNA 3N05A 5C4JJ 3FXMA 2M34A 2YSRA 4X0GA 1H9GA 3DBHB 3AFHA 4ENJA 1EH6A 4G8XA 2VT2A 2GA2A 3H9GA 1R00A 4BL0B 1FEXA 4IEJA 3CCEI 3J7AO 3CMAI 2G0EA 3KZZA 4FX0A 1R5ID 4YFKF 3GZ6A 3DLLF 4CZCA 4ZTJA 4M71A 2XAHA 2ID6A 5LLQA 3IAS2 1QPIA 1RIOH 5CVIA 4YIIA 1TWHJ 2YS9A 1OJLA 4O3MA 2DW4A 2QF7A 5JHFA 3M8JA 1FZPB 2KKOA 3LNQA 5FKMA 4AD9A 4N4NB 2HQAA 3RPUD 1KU9A 3CCQI 4RA2A 1OYYA 2VQCA 1S29A 1YW7A 1NH3A 1A31A 5FKNA 3I0TA 4ZZDA 5LHGA 2BYVE 2DN0A 4I2OA 4D7MA 3DEUA 4R8HA 5FB2A 1KQ9A 5ICFA 3CQZJ 3CJTB 2Q0OA 4MTEA 2HQRA 1I6HJ 2KIUA 2E2JJ 3PIOF 1IJWC 1BA5A 5AIPA 4HF1A 3BG7A 2RVCA 3MKLA 1BR1A 1UJ8A 3L09A 4RB1A 1MJAA 1BW6A 1K83J 4HQEA 2OBPA 3PSFA 3T0YA 3JRFA 4XOTA 4M9ZA 5ICGA 4BDZA 4EMSA 2L9RA 4L0ZB 3KP4A 2E36A 3CMMA 1I3QJ 1ORKA 1R4MB 1Z3YA 3FBIB 4BEHA 5C44J 3F21A 3EPZA 5KAIC 3LWFA 1E3HA 4NBQA 2BE5F 2CUZA 3QYFA 1H0MA 2XRLA 5IYBJ 2DOEA 4AIHA 1N78A 3BPVA 3CTAA 1U3EM 1WPKA 3W6KB 1FOWA 3GFMA 2BXYA 1S5LC 1D1BA 3BR0A 1JTYA 2DJNA 2JA6J 2FMYA 4O6JA 3QOPA 2GZWA 3BTIA 1TT5B 2XKOA 1I1SA 1W7PB 4HX8A 3CJQB 1F9NA 3A01A 1HKQA 2LF8A 1XN7A 2LF7A 4CDGA 1NK2P 3FMQA 2NVYJ 2HZTA 4G6QA 3K2AA 2DTRA 2E5NA 2H8WA 3WTSC 2VUMJ 1JKPC 1Z9CA 3HKZA 3HSEA 4P5OA 3CCLI 2EILH 4LMYA 5FKOA 4UUTA 3FIWA 1OR7C 1PJRA 3IHUA 4L9TA 1OLTA 4CH7A 3Q0VA 2V7FA 3SEQA 2KL4A 4F93B 3L00A 3BG9A 2EFOA 2XROA 4RGRA 2QM3A 4A3GJ 2X1DA 1MSEC 1EV7A 4LG0B 1YFHA 3TDUC 5ILUA 5FLMJ 3IWFA 3K4CA 3FX3A 2HGCA 3W2WA 3GX4X 2M7AA 2V1UA 4IRHA 4L5IA 2YUSA 1SAUA 3GMEA 4A93J 1RUOA 2OAZA 2WV0A 2CU7A 3EDPA 5DV5A 3S1QJ 1QNTA 2V1XA 1DU0A 1HXDA 2L4AA 1SFEA 2WB1A 3HRTA 1EA3A 2DFFA 4DJAA 4XM3A 5KK1A 1JGGA 2OTLI 3DP7A 2R5ZA 1XS9A 4U7BA 2WADA 1ETVA 1XSVA 1R58A 4BE0A 2R5YA 1U2WA 1W7PD 1XCBA 3BC8A 5CQEA 2FJ1A 2X6YA 1QVTA 2NVQJ 4XKVA 4S05A 3I5UA 1B1BA 4QPOA 1UHWA 2QQ9A 5J4YA 2EZKA 3RPUA 1P4WA 3PL8A 3WU1B 4KISA 3M8FA 2K02A 3HHHA 3L7WA 3VYUB 3K4LA 2RC4A 1X1BA 3BG5A 1BN5A 4E70A 3FBNB 4WF2A 2E1CA 4KMFA 1OYIA 3QODA 2HTSA 1W5SA 1E2XA 2IXSA 2MLKA 4AIKA 5D8KB 3EUHC 1SD6A 1ZKGA 2EJRA 2OCCH 4A12A 4QPQA 3SXYA 2A5WA 2R3SA 4ESFA 4F3QA 3DWLE 5E3NA 3UNGC 2BXZA 2HYFA 2CUEA 3I9V2 4HDUA 3R0AA 3IC7A 1FYLA 2BBYA 5FROA 3GEZA 2HZDA 4HSTA 4KYWA 5L3EA 2LG4A 4CXFA 1I1GA 4IXAA 2BV6A 3VSLA 1ZAOA 3LA7A 1RUNA 2XHKA 4AYBA 1D1AA 3KPHA 1NG6A 1WH5A 1ZK8A 2LR8A 4RB3C 2XF6A 2M4GA 2DA4A 2ZNZA 2FRHA 3QYBA 2Z9OA 3OYBA 3CCJI 1R22A 4RAYA 3VSKA 4HAMA 4N9HA 1T08B 2ZFUA 3K4BA 3NQOA 2XGCA 4DQ2A 2M45A 3C2HA 3Q0WA 1Y0UA 2IVMA 5E8GA 1I50J 5ICCA 1D8JA 3RCOA 1R71A 4A6EA 3TBIA 1VQOI 2Y69H 4UUSB 4JP0A 2EIJH 5IT9K 1SD4A 1CF7B 4IRGA 3M1CA 1B9MA 1LUJB 3WU0A 2W84A 2R7UA 4LK1F 2DCEA 1ZGJA 2W25A 4I01A 1HDDC 3COAC 5E3LA 1XSXA 2KLOA 3O2PE 2DTZA 1YG2A 3BR1A 4KUMA 1Z6RA 1J9IA 2BHYA 2ZFWA 3ABLH 1Y8RB 1LVAA 4M3GA 1VTNC 1VQKI 3OYMA 3RJPA 2CV0A 4ZC3A 5J47A 3AG3H 1XMKA 5DM6F 3LAPA 4XN3A 3S15J 1X1PA 3FZVA 2ZJPF 4BE1A 3GTLJ 2X48A 2MFZA 3TO6A 4BJTA 3H3VK 5HDNA 2P5LC 2EA4A 1MBHA 1QGPA 4H0EA 2HOTA 4G7HF 2E60A 2PMZA 2TRTA 2JPCA 3OYLA 1ZRFA 5EZGA 5HDKA 4MEYF 2KIMA 4HRIA 2VI6A 4A3JJ 1YE9A 3MZYA 4LITA 3U1DA 3S2DJ 2P81A 2FMLA 5K5RA 4NHJA 1T39A 3K9TA 2IS2A 3BZKA 3I53A 1IAWA 3I71A 2FA5A 3EUAA 1W7PA 3TO7A 2P7VB 1T38A 1TWFJ 1FYKA 4UUVA 4Q48A 2R7DA 2H8RA 2K85A 3WG9A 2EK5A 1RRJA 2CQXA 4CYDA 4ZJZA 1UHMA 3S1MJ 4A3MJ 2MYSA 4UB8C 2NS7A 2P6SA 1S9HA 3M8EA 2LDUA 5GPCA 2E2HJ 3W6JB 4XORA 2HDWA 1ZRCA 2R7QA 2XF5A 3LSJA 3S2HJ 2DFIA 4N0BA 1OISA 3RKYA 3ZQIA 3KYLA 5K5OA 5BS6A 4LG0A 1FOKA 1WH7A 1SMTA 3MAJA 4E6KG 3GLLA 3OOPA 5HDGA 3ZGKA 1MMNA 2K5CA 1JI8A 1F5TA 1KYWA 3IRRA 1FBSA 3NRVA 3OYCA 2WY8Q 1VQ6I 3PSIA 3FHZA 2E19A 3G1LA 2HXOA 9ANTA 4PK4A 4CO8A 3QAHA 1B59A 4WXDA 1BOBA 5LFAA 4XRFA 5EF6A 4JK1X 1K6YA 2FU4A 1MBEA 4HBLA 2N8GA 3K2ZA
chains in the Genus database with same CATH topology
1GVDA 3DCFA 2CUFA 1FIPA 3OOUA 1R9TJ 1IC8A 4DZJA 3I4NJ 1POGA 1Y1VJ 3K7AJ 1XG1A 2EZHA 3Q0UA 5GP9A 5FJ8J 4JX4A 4RDUA 3H0GJ 5IP9J 1MBFA 2LP0A 1T33A 5J1RA 3BR3A 1W0UA 3RZOJ 3BQZA 5EGOA 1FTZA 1X2MA 3ZQFA 4D5FA 4D7NA 1OCPA 4M3DA 2EZIA 2WB1N 1RKWA 2HXIA 3DEWA 4DYCA 5FLVA 3S1RJ 1D5YA 4BY1J 1JUPA 2XSDC 4XICA 1HDPA 3M4OJ 3JRCA 2HOSA 4IHXA 2DMNA 1DU6A 3GTQJ 5IP7J 3JRHA 2R5ZB 1E3OC 1VNDA 3WHBA 1IRZA 1JKQC 1AHDP 3S1NJ 1FTTA 2DA3A 2R5YB 2X9DA 5IYCJ 3OIOA 3CMYA 3RQIA 4MO7A 4A3DJ 3G1MA 5J3LA 3JRIA 4BBSJ 2L7FP 3HOXJ 1EF4A 1F36A 4A3IJ 3LSRA 3FKIJ 1WGXA 1JUSA 1IG7A 3S16J 2Y0SN 3BTJA 4I76A 5FKKA 1ZQ3P 3B6CA 4M3FA 2LK2A 1JKRC 2AO9A 2K9NA 3E7LA 3JR9A 2XGDA 4B3AA 3SJMA 3OSGA 4AUXA 1Z0XA 2I10A 3D1NI 2Y9YA 4IHWA 1P7IA 2R7ZJ 3LSPA 5E3MA 3NAUA 2IBDA 2DA1A 4C2MJ 1JJ6C 2JN6A 2M9HA 1B8IA 1YRNB 1VF9A 3QPSA 1NK3P 1W0TA 2DMPA 2XPUA 2E2IJ 3HDDA 3BTLA 3HM5A 4W97A 2LVSA 4M6VA 4UUSA 5C3EJ 2HOAA 5EYRA 2ECBA 1A6IA 1A5JA 3JREA 4HNVA 5C4JJ 2MGQA 4W1UA 2M34A 4FE4A 3GTGJ 5F0HA 2W48A 4C3HJ 1MSFC 1FEXA 1TWGJ 2LD5A 1NTCA 4IEJA 2G0EA 3NARA 1ETKA 4ABZA 4EEFG 1U9NA 1MNMC 2O9LA 3BG3A 5F1JA 2M0CA 1B72A 2ID6A 3VPRA 1ZTRA 2ME6A 5M5WJ 4X1EA 3RZDJ 1QPIA 2Y30A 4CYCA 3HOYJ 1K61A 4LOCA 1TWHJ 2YS9A 4NDLA 1OJLA 2LFBA 3FK7A 1XC5A 2QF7A 3ZOBA 2VKEA 3MVPA 4A3KJ 4XK4A 4JX6A 4MIMA 5K7FA 1VFCA 3LNQA 5FKMA 3CCYA 2GM4A 2LTPA 3G1OA 4JX5A 1BW5A 5FKNA 2DN0A 1HLVA 4D7MA 3HB9A 2OPTA 3CDLA 3CQZJ 3TP3A 2JWTA 1I6HJ 1Z77A 2E2JJ 3ZQHA 5J1YA 4XRMA 1MBKA 2COBA 2EQRA 1IJWC 1BA5A 1ETOA 3MKLA 1BW6A 1K83J 1FJLA 2PMZN 3JRFA 5K7HA 1JT6A 3O8GA 2L9RA 4MFEA 1WI3A 2EZLA 2QCOA 1ORKA 1I3QJ 4BXXJ 5C44J 1WCMJ 4QSHA 3I4MJ 2CJJA 2XRLA 4V2FA 5IYBJ 1MH4A 4A3BJ 3BR6A 1WPKA 5FKLA 1JTYA 3BR0A 2JA6J 2DJNA 3HGGA 1B8IB 2VKVA 1IGNA 1PUFB 3C2BA 3BTIA 2YU9J 1HF0A 3M3YJ 4FCYA 4JYKA 2VPRA 2L7MP 3A01A 1X2NA 1RETA 2K9SA 1NK2P 1LE8A 3JRAA 2NVYJ 3A03A 3HOVJ 5F0FA 4I6ZA 3K2AA 1RKTA 2VUMJ 1JKPC 5IYDJ 2DA7A 1FIAA 4AC0A 4XIDA 1UHSA 1U9OA 2M8GX 5FKOA 3JRBA 2LKXA 4UUTA 3FIWA 3BTCA 2DA2A 5F27A 3Q0VA 5EG0B 3BG9A 1AKHB 3IH4A 3WHCA 3TP0A 1UMQA 4G12A 2XB0X 4A3GJ 1JJ8C 3F0CA 1QRYA 4M3EA 1MSEC 5FLMJ 1OFCX 5IOZA 2NS8A 4A3LJ 3Q3SA 2YUSA 3RKQA 3O8HA 1ZR4A 1GUUA 4AYBN 4A93J 5K7ZA 3B6AA 4BKXA 4FISA 2L0KA 2KDZA 5M3FJ 3IV5A 3BR2A 2TCTA 2CU7A 3S1QJ 1DU0A 3GTPJ 1Y1WJ 3ZQLA 3SDGA 1O4XA 3GBGA 1RR7A 3TW7A 2CQQA 3BR5A 2JA7J 1JGGA 2R5ZA 1JTXA 4S0HB 1XS9A 1RPWA 3QQAA 1ETVA 2R5YA 2LY9A 1BL0A 2HQ5A 1JKOC 5EGOB 2FJ1A 3W6VA 1QVTA 2NVQJ 2LLKA 4BBRJ 2FD5A 5C4XJ 2DMQA 1LFUP 3GTKJ 4J19A 2EZKA 2R92J 1RESA 3PM1A 3PO2J 5BNGA 2NVXJ 4Y7NJ 3BG5A 4QTRA 4X6AJ 5JLWA 2ME0A 5DTDA 1X58A 2CRGA 3A02A 2NVTJ 1SFOJ 2DMTA 3OSFA 1ZKGA 5EEAA 1ETWA 4DYQA 2DMUA 5M5YJ 1GT0C 5E3NA 1TWAJ 2WAQN 5IP6A 1YRNA 3HOWJ 2CUEA 3JRGA 2ECCA 3BQYA 1IV6A 3SFIA 5EDNA 3ZQGA 4A3EJ 5DS9A 4GFBA 3ZQCA 5F0CA 1OCTC 4BY7J 2JJ7A 2DA5A 3TEDA 4B1RA 1WH5A 2MSYA 2B63J 1MBGA 4IHVA 3S14J 1ZK8A 1F43A 1GV5A 1LFBA 2LR8A 4Y52J 1IUFA 2JA8J 2DA4A 3S17J 4C3IJ 1APLC 4IHYA 4B4CA 1VI0A 2XGEA 2EBIA 2XGCA 3GTJJ 3HOUJ 3Q0WA 2IAIA 1T56A 2R0QC 3GTOJ 1GDTA 1I50J 4A3FJ 1HCRA 1H89C 3JRDA 5IOYA 1IDZA 5F08A 1TC3C 4UUSB 4JP0A 2EH3A 3LOCA 2JA5J 4XRSG 5JLXA 2GBYA 3MN2A 1CQTA 2KT0A 2XPWA 3IH2A 4A69C 1GV2A 5M3MJ 2IEKA 3HGYA 1HDDC 1ENHA 2DA6A 5E3LA 2RAEA 2DTZA 3BR1A 2O7OA 4XRSA 4DZPA 4MFDA 5IPAA 2HDDA 2R93J 5EZHA 3L1PA 3FISA 2Y2ZA 4M3GA 4QIWN 2AHQA 2Y9ZA 1B72B 4CYCB 4M3BA 2HI3A 3UKGA 1ZGWA 4V2GA 2JK3A 3S15J 3TW6A 1TWCJ 1JT0A 4L5EA 2Y31A 4C3JJ 3GTLJ 2X48A 2X6OA 3H3VK 4FTHA 2E1OA 1ETYA 2OF7A 3HEFA 1MBHA 2HOTA 2TRTA 3FK6A 2FQ4A 3BT9A 5EZGA 2L7ZA 4DW6A 1ZR2A 1H8AC 1UG2A 2VI6A 4A3JJ 1IDYA 5HODA 2XB5A 1MH3A 3IH3A 2ZB9A 4FE7A 2JMWA 3S2DJ 1U8BA 5J1UA 2P81A 1ETQA 1P7JA 2WV1A 1PUFA 1ITYA 1TWFJ 2XPVA 2H8RA 2CQXA 2K9QA 1H88C 1U78A 1HOMA 4MLOA 3S1MJ 4A3MJ 2NS7A 1S7EA 5GPAA 1G2HA 5GPCA 5M5XJ 2MG4A 2E2HJ 2NOGA 3HBLA 3QPLA 5EG0A 3LSJA 1AKHA 1AU7A 3S2HJ 3GTMJ 2ELKA 2GLOA 2MW8A 3ZQIA 4A3CJ 1Q1VA 1MBJA 3A01B 1JUMA 1WH7A 2FX0A 3HKZN 4DYRA 1LE8B 2D5VA 2HYJA 1BJZA 2M2EA 2H1KA 5F04A 2K40A 3PO3J 3LSGA 3HOZJ 2E19A 3G1LA 1QVUA 2HXOA 4D5CA 2O8KA 9ANTA 4RBOA 5EF6A 1SANA 1ETXA 1MBEA 5E3OA 2N8GA 2ID3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVD A;  3DCF A;  2CUF A;  1FIP A;  3OOU A;  1R9T J;  1IC8 A;  4DZJ A;  3I4N J;  1POG A;  1Y1V J;  3K7A J;  1XG1 A;  2EZH A;  3Q0U A;  5GP9 A;  5FJ8 J;  4JX4 A;  4RDU A;  3H0G J;  5IP9 J;  1MBF A;  2LP0 A;  1T33 A;  5J1R A;  3BR3 A;  1W0U A;  3RZO J;  3BQZ A;  5EGO A;  1FTZ A;  1X2M A;  3ZQF A;  4D5F A;  4D7N A;  1OCP A;  4M3D A;  2EZI A;  2WB1 N;  1RKW A;  2HXI A;  3DEW A;  4DYC A;  5FLV A;  3S1R J;  1D5Y A;  4BY1 J;  1JUP A;  2XSD C;  4XIC A;  1HDP A;  3M4O J;  3JRC A;  2HOS A;  4IHX A;  2DMN A;  1DU6 A;  3GTQ J;  5IP7 J;  3JRH A;  2R5Z B;  1E3O C;  1VND A;  3WHB A;  1IRZ A;  1JKQ C;  1AHD P;  3S1N J;  1FTT A;  2DA3 A;  2R5Y B;  2X9D A;  5IYC J;  3OIO A;  3CMY A;  3RQI A;  4MO7 A;  4A3D J;  3G1M A;  5J3L A;  3JRI A;  4BBS J;  2L7F P;  3HOX J;  1EF4 A;  1F36 A;  4A3I J;  3LSR A;  3FKI J;  1WGX A;  1JUS A;  1IG7 A;  3S16 J;  2Y0S N;  3BTJ A;  4I76 A;  5FKK A;  1ZQ3 P;  3B6C A;  4M3F A;  2LK2 A;  1JKR C;  2AO9 A;  2K9N A;  3E7L A;  3JR9 A;  2XGD A;  4B3A A;  3SJM A;  3OSG A;  4AUX A;  1Z0X A;  2I10 A;  3D1N I;  2Y9Y A;  4IHW A;  1P7I A;  2R7Z J;  3LSP A;  5E3M A;  3NAU A;  2IBD A;  2DA1 A;  4C2M J;  1JJ6 C;  2JN6 A;  2M9H A;  1B8I A;  1YRN B;  1VF9 A;  3QPS A;  1NK3 P;  1W0T A;  2DMP A;  2XPU A;  2E2I J;  3HDD A;  3BTL A;  3HM5 A;  4W97 A;  2LVS A;  4M6V A;  4UUS A;  5C3E J;  2HOA A;  5EYR A;  2ECB A;  1A6I A;  1A5J A;  3JRE A;  4HNV A;  5C4J J;  2MGQ A;  4W1U A;  2M34 A;  4FE4 A;  3GTG J;  5F0H A;  2W48 A;  4C3H J;  1MSF C;  1FEX A;  1TWG J;  2LD5 A;  1NTC A;  4IEJ A;  2G0E A;  3NAR A;  1ETK A;  4ABZ A;  4EEF G;  1U9N A;  1MNM C;  2O9L A;  3BG3 A;  5F1J A;  2M0C A;  1B72 A;  2ID6 A;  3VPR A;  1ZTR A;  2ME6 A;  5M5W J;  4X1E A;  3RZD J;  1QPI A;  2Y30 A;  4CYC A;  3HOY J;  1K61 A;  4LOC A;  1TWH J;  2YS9 A;  4NDL A;  1OJL A;  2LFB A;  3FK7 A;  1XC5 A;  2QF7 A;  3ZOB A;  2VKE A;  3MVP A;  4A3K J;  4XK4 A;  4JX6 A;  4MIM A;  5K7F A;  1VFC A;  3LNQ A;  5FKM A;  3CCY A;  2GM4 A;  2LTP A;  3G1O A;  4JX5 A;  1BW5 A;  5FKN A;  2DN0 A;  1HLV A;  4D7M A;  3HB9 A;  2OPT A;  3CDL A;  3CQZ J;  3TP3 A;  2JWT A;  1I6H J;  1Z77 A;  2E2J J;  3ZQH A;  5J1Y A;  4XRM A;  1MBK A;  2COB A;  2EQR A;  1IJW C;  1BA5 A;  1ETO A;  3MKL A;  1BW6 A;  1K83 J;  1FJL A;  2PMZ N;  3JRF A;  5K7H A;  1JT6 A;  3O8G A;  2L9R A;  4MFE A;  1WI3 A;  2EZL A;  2QCO A;  1ORK A;  1I3Q J;  4BXX J;  5C44 J;  1WCM J;  4QSH A;  3I4M J;  2CJJ A;  2XRL A;  4V2F A;  5IYB J;  1MH4 A;  4A3B J;  3BR6 A;  1WPK A;  5FKL A;  1JTY A;  3BR0 A;  2JA6 J;  2DJN A;  3HGG A;  1B8I B;  2VKV A;  1IGN A;  1PUF B;  3C2B A;  3BTI A;  2YU9 J;  1HF0 A;  3M3Y J;  4FCY A;  4JYK A;  2VPR A;  2L7M P;  3A01 A;  1X2N A;  1RET A;  2K9S A;  1NK2 P;  1LE8 A;  3JRA A;  2NVY J;  3A03 A;  3HOV J;  5F0F A;  4I6Z A;  3K2A A;  1RKT A;  2VUM J;  1JKP C;  5IYD J;  2DA7 A;  1FIA A;  4AC0 A;  4XID A;  1UHS A;  1U9O A;  2M8G X;  5FKO A;  3JRB A;  2LKX A;  4UUT A;  3FIW A;  3BTC A;  2DA2 A;  5F27 A;  3Q0V A;  5EG0 B;  3BG9 A;  1AKH B;  3IH4 A;  3WHC A;  3TP0 A;  1UMQ A;  4G12 A;  2XB0 X;  4A3G J;  1JJ8 C;  3F0C A;  1QRY A;  4M3E A;  1MSE C;  5FLM J;  1OFC X;  5IOZ A;  2NS8 A;  4A3L J;  3Q3S A;  2YUS A;  3RKQ A;  3O8H A;  1ZR4 A;  1GUU A;  4AYB N;  4A93 J;  5K7Z A;  3B6A A;  4BKX A;  4FIS A;  2L0K A;  2KDZ A;  5M3F J;  3IV5 A;  3BR2 A;  2TCT A;  2CU7 A;  3S1Q J;  1DU0 A;  3GTP J;  1Y1W J;  3ZQL A;  3SDG A;  1O4X A;  3GBG A;  1RR7 A;  3TW7 A;  2CQQ A;  3BR5 A;  2JA7 J;  1JGG A;  2R5Z A;  1JTX A;  4S0H B;  1XS9 A;  1RPW A;  3QQA A;  1ETV A;  2R5Y A;  2LY9 A;  1BL0 A;  2HQ5 A;  1JKO C;  5EGO B;  2FJ1 A;  3W6V A;  1QVT A;  2NVQ J;  2LLK A;  4BBR J;  2FD5 A;  5C4X J;  2DMQ A;  1LFU P;  3GTK J;  4J19 A;  2EZK A;  2R92 J;  1RES A;  3PM1 A;  3PO2 J;  5BNG A;  2NVX J;  4Y7N J;  3BG5 A;  4QTR A;  4X6A J;  5JLW A;  2ME0 A;  5DTD A;  1X58 A;  2CRG A;  3A02 A;  2NVT J;  1SFO J;  2DMT A;  3OSF A;  1ZKG A;  5EEA A;  1ETW A;  4DYQ A;  2DMU A;  5M5Y J;  1GT0 C;  5E3N A;  1TWA J;  2WAQ N;  5IP6 A;  1YRN A;  3HOW J;  2CUE A;  3JRG A;  2ECC A;  3BQY A;  1IV6 A;  3SFI A;  5EDN A;  3ZQG A;  4A3E J;  5DS9 A;  4GFB A;  3ZQC A;  5F0C A;  1OCT C;  4BY7 J;  2JJ7 A;  2DA5 A;  3TED A;  4B1R A;  1WH5 A;  2MSY A;  2B63 J;  1MBG A;  4IHV A;  3S14 J;  1ZK8 A;  1F43 A;  1GV5 A;  1LFB A;  2LR8 A;  4Y52 J;  1IUF A;  2JA8 J;  2DA4 A;  3S17 J;  4C3I J;  1APL C;  4IHY A;  4B4C A;  1VI0 A;  2XGE A;  2EBI A;  2XGC A;  3GTJ J;  3HOU J;  3Q0W A;  2IAI A;  1T56 A;  2R0Q C;  3GTO J;  1GDT A;  1I50 J;  4A3F J;  1HCR A;  1H89 C;  3JRD A;  5IOY A;  1IDZ A;  5F08 A;  1TC3 C;  4UUS B;  4JP0 A;  2EH3 A;  3LOC A;  2JA5 J;  4XRS G;  5JLX A;  2GBY A;  3MN2 A;  1CQT A;  2KT0 A;  2XPW A;  3IH2 A;  4A69 C;  1GV2 A;  5M3M J;  2IEK A;  3HGY A;  1HDD C;  1ENH A;  2DA6 A;  5E3L A;  2RAE A;  2DTZ A;  3BR1 A;  2O7O A;  4XRS A;  4DZP A;  4MFD A;  5IPA A;  2HDD A;  2R93 J;  5EZH A;  3L1P A;  3FIS A;  2Y2Z A;  4M3G A;  4QIW N;  2AHQ A;  2Y9Z A;  1B72 B;  4CYC B;  4M3B A;  2HI3 A;  3UKG A;  1ZGW A;  4V2G A;  2JK3 A;  3S15 J;  3TW6 A;  1TWC J;  1JT0 A;  4L5E A;  2Y31 A;  4C3J J;  3GTL J;  2X48 A;  2X6O A;  3H3V K;  4FTH A;  2E1O A;  1ETY A;  2OF7 A;  3HEF A;  1MBH A;  2HOT A;  2TRT A;  3FK6 A;  2FQ4 A;  3BT9 A;  5EZG A;  2L7Z A;  4DW6 A;  1ZR2 A;  1H8A C;  1UG2 A;  2VI6 A;  4A3J J;  1IDY A;  5HOD A;  2XB5 A;  1MH3 A;  3IH3 A;  2ZB9 A;  4FE7 A;  2JMW A;  3S2D J;  1U8B A;  5J1U A;  2P81 A;  1ETQ A;  1P7J A;  2WV1 A;  1PUF A;  1ITY A;  1TWF J;  2XPV A;  2H8R A;  2CQX A;  2K9Q A;  1H88 C;  1U78 A;  1HOM A;  4MLO A;  3S1M J;  4A3M J;  2NS7 A;  1S7E A;  5GPA A;  1G2H A;  5GPC A;  5M5X J;  2MG4 A;  2E2H J;  2NOG A;  3HBL A;  3QPL A;  5EG0 A;  3LSJ A;  1AKH A;  1AU7 A;  3S2H J;  3GTM J;  2ELK A;  2GLO A;  2MW8 A;  3ZQI A;  4A3C J;  1Q1V A;  1MBJ A;  3A01 B;  1JUM A;  1WH7 A;  2FX0 A;  3HKZ N;  4DYR A;  1LE8 B;  2D5V A;  2HYJ A;  1BJZ A;  2M2E A;  2H1K A;  5F04 A;  2K40 A;  3PO3 J;  3LSG A;  3HOZ J;  2E19 A;  3G1L A;  1QVU A;  2HXO A;  4D5C A;  2O8K A;  9ANT A;  4RBO A;  5EF6 A;  1SAN A;  1ETX A;  1MBE A;  5E3O A;  2N8G A;  2ID3 A; 
#chains in the Genus database with same CATH topology
 4OWR B;  3FWE A;  2F5E A;  3DCF A;  4RLF A;  2D2W A;  1ZG5 A;  2UWM A;  2VOD A;  2FBH A;  5LBQ A;  4PJN A;  2PLY A;  3ABU A;  2ELH A;  3BJ6 A;  3FXR A;  2F5C A;  3P9I A;  2DDA A;  2IA0 A;  3K7A J;  3VYS B;  4C2U A;  2IS1 A;  1R1T A;  4RDU A;  3H0G J;  5IP9 J;  1JE8 A;  2VJ5 A;  4PJM A;  1MBF A;  3KLN A;  4DNC A;  1NHA A;  1T33 A;  3BR3 A;  4HV5 A;  1MZB A;  2MC3 A;  1FOY A;  4GGG A;  5DYM A;  1X2M A;  1FTZ A;  4B44 A;  2R7X A;  3DPU A;  3ELK A;  4XBF A;  3EYI A;  2DYR H;  4HDV A;  3WE2 A;  3QYE A;  2O5R A;  2HTJ A;  3ERE D;  4S04 A;  2UXN A;  2P4W A;  4FET A;  4BY1 J;  4I7H A;  1JUP A;  2M0M A;  2JVH A;  2EPF A;  3CCR I;  3K1P A;  4YRV A;  3ABM H;  5DUK A;  4E7S A;  2DMN A;  3W2A A;  1DU6 A;  1EJ9 A;  5ERI A;  5IP7 J;  1IRZ A;  1VND A;  3WHB A;  2GIZ A;  3L2V A;  3BRO A;  3BJA A;  3S3M A;  1D8K A;  1D3Y A;  1JHH A;  3FM3 A;  1YS7 A;  1YJN I;  1EF4 A;  1F36 A;  3K1M A;  3FXO A;  2WAF A;  4YFX F;  3EQL F;  4BDY A;  1YJ9 I;  3FM5 A;  1JUS A;  3DTI A;  3WGH A;  1GHC A;  4N9I A;  3S16 J;  1ZG1 A;  3F8F A;  4UVC A;  2W1O A;  2LK2 A;  2A6H F;  2AO9 A;  3E7L A;  3M07 A;  3OYH A;  1ULY A;  3MEX A;  1LDD A;  1Z0X A;  4AVP A;  5BMZ A;  1FBQ A;  2VBZ A;  1P7I A;  3V42 A;  1F1Z A;  3NAU A;  2PJR B;  2DA1 A;  5H20 A;  3OYE A;  1TP4 A;  3GLX A;  1YRN B;  4ZTF A;  3O6B B;  2OUM A;  3EYY A;  2HQN A;  1W0T A;  2IS6 A;  1XGS A;  3IWZ A;  4RB0 A;  1R4N B;  2BY0 A;  4W97 A;  2NNN A;  2ZJ2 A;  3PNT A;  5TJJ A;  4UUS A;  3LQQ A;  4JQF A;  3MZ8 A;  1MKM A;  2OTJ I;  1CF7 A;  1KQ0 A;  5EEG A;  1A5J A;  1IRF A;  5JVT A;  1XPX A;  3PNY A;  4G7Z F;  5ICE A;  2CS3 A;  2DJI A;  3I3L A;  2W48 A;  5HOO A;  2V1N A;  2V1D A;  5L3D A;  3E6C C;  2LD5 A;  1NTC A;  3VEP A;  4NC8 A;  2M87 A;  2O6G E;  3NAR A;  2IRF G;  1VQP I;  5GAE J;  1U9N A;  4Y15 A;  5IY5 H;  3I59 B;  2CQN A;  2M4K A;  3AG2 H;  5F1J A;  3JTH A;  4ENN A;  2ME6 A;  3RZD J;  3G2B A;  2Y30 A;  3ROU A;  3HOY J;  1S8N A;  3C2G A;  4NDL A;  3SQN A;  4ZH4 F;  1XC5 A;  4PCQ A;  4XK4 A;  1ACI A;  2BY3 A;  4MIM A;  2Y75 A;  3FXK A;  4H4K C;  5F6F A;  1VFC A;  2HVS A;  2L02 A;  3CP2 A;  4XON A;  4EQQ A;  3CC2 I;  3ZQ7 A;  3G1O A;  2HKO A;  4NC7 A;  3GFL A;  3LFU A;  5CVJ A;  4EV0 A;  3S8P A;  1IRX A;  3HB9 A;  3NWT A;  1J09 A;  3T5X A;  3CDL A;  1FPQ A;  5GTI C;  5KNL A;  2H94 A;  4U0V A;  3HTU A;  1HQC A;  1Z77 A;  2Q2E B;  3BP8 A;  2PI0 A;  1MBK A;  2A6E F;  2EQR A;  2F5F A;  3HYI A;  4CSW A;  1X1A A;  3OYK A;  3ZP5 A;  3WG7 H;  2ZXI A;  1OKR A;  3FXJ A;  3ZMZ A;  3O8G A;  4MFE A;  3ULQ B;  2RNJ A;  3W2V A;  5D8L B;  3BDD A;  1WI3 A;  2KJB A;  4KT6 A;  3SFZ A;  4M9S A;  2L3D A;  2V6E A;  2BVL A;  3S32 A;  3PFI A;  2GXB A;  2CJJ A;  3EUK L;  2QYO A;  2HPM A;  2GXA A;  3CLQ A;  3LA3 A;  2ZJR F;  3CZ6 A;  2E71 A;  2DO7 A;  4FAS D;  2CSO A;  2ISZ A;  2VKV A;  4RM3 A;  3MD2 A;  1ZN2 A;  1KQ8 A;  4MTD A;  4Z2Y A;  4L5J A;  1HF0 A;  2UXX A;  4FCY A;  4JYK A;  5EEH A;  3VYT B;  1RET A;  2XAF A;  1KU7 A;  1A35 A;  1V55 H;  3DKW A;  1IN6 A;  5F0F A;  4E7K A;  2PMU A;  3HJE A;  5LEK A;  3K6G A;  4N4O B;  3BOQ A;  4I6Z A;  4FX4 A;  4AM3 A;  4Y3O A;  2M7B A;  4KN7 X;  2QEN A;  4ENM A;  3Q5F A;  4JBA A;  2M3A A;  1U9O A;  3ECO A;  3JRB A;  1X4P A;  2LKX A;  3BTC A;  5HNH A;  2H27 A;  2DA2 A;  1V5E A;  2MD0 A;  4IOC F;  1IXC A;  1U5T B;  3KZY A;  4BU2 A;  2RKH A;  1B4A A;  1UST A;  1USS A;  3WHC A;  2XRN A;  3RKW A;  2W7N A;  1FBU A;  1JJ8 C;  1QRY A;  4II2 A;  3OS2 A;  3KIO A;  5JVG F;  1QHG A;  4YIR X;  3CO7 C;  3KEO A;  1D0Y A;  2KDO A;  2VJI A;  4YIF A;  1WJE A;  2ISY A;  4ZYA A;  2NS8 A;  4A3L J;  2W57 A;  3RKQ A;  3O8H A;  4L9J A;  3SZG A;  3DV8 A;  5K7Z A;  3B6A A;  5M3F J;  2CW7 A;  2HYG D;  3IV5 A;  4BQA A;  2TCT A;  1O3T A;  2OQR A;  2D45 A;  1Y56 A;  5L3F A;  1MW7 A;  2PG4 A;  3LFK A;  3CCV I;  3HOS A;  3GTP J;  1R7J A;  2ETH A;  2Q1Z B;  5A2Q K;  3V7R A;  1VQ8 I;  3ZQL A;  4UB6 C;  2X6X A;  3SDG A;  4WWC A;  3DTK A;  4F92 B;  4IHS A;  3GBG A;  1SVM A;  3DQV C;  3BCB A;  2MD5 A;  2DOA A;  2OU2 A;  5B66 C;  1PP8 F;  3FHN A;  4AVZ A;  3GXO A;  2HQ5 A;  1YI2 I;  1TTY A;  1OQY A;  3AL0 C;  5FLX Z;  2LLK A;  2LSO A;  1LFU P;  2CGP A;  3GTK J;  4BHP A;  3CO6 C;  1G3S A;  2JUC A;  3PO2 J;  2A05 A;  2GA1 A;  2KZG A;  3BZ6 A;  3IUO A;  4XLA A;  5H6Q A;  1I27 A;  5ED4 A;  3DLA A;  4EJO A;  4QTR A;  2EV6 A;  3K70 D;  1JGS A;  2OA4 A;  5JLW A;  2VQH A;  5DTD A;  2XV4 S;  2NVT J;  2RQP A;  2DMT A;  4BJ5 C;  3OYA A;  3CF2 A;  4Q5S F;  2PJR A;  1XD7 A;  4CCJ A;  2DMU A;  1GT0 C;  2Y48 A;  4I0B A;  4LIU A;  4EM1 A;  5IP6 A;  1YRN A;  5FFX A;  2EIN H;  3DKX A;  2J5O A;  3JRG A;  2PEX A;  2ECC A;  3BQY A;  3E6M A;  3WU2 C;  3H0D A;  3UR3 C;  1FNN A;  4A5M A;  3IAM 2;  5EDN A;  2GOX B;  4CCN A;  1DP3 A;  1FC3 A;  3OL3 A;  3SZP A;  4A3E J;  2NS0 A;  5CYV A;  4Y13 A;  1EH8 A;  2F6C A;  1PDN C;  2MSY A;  3ZN0 A;  2VKD A;  4Y52 J;  3S17 J;  4AID A;  4C3I J;  1APL C;  4I09 A;  4IHY A;  3ZRG A;  4BH9 A;  4B4C A;  1VI0 A;  2XGE A;  1O7L A;  3FMS A;  3HUG B;  1ODD A;  1SVO A;  2EBI A;  2XF7 A;  3F6V A;  3HOU J;  2QEX I;  2ZJQ F;  2IAI A;  3I59 A;  4LB6 B;  3GTO J;  3X2Q H;  1GDT A;  2CYY A;  1HCR A;  1H89 C;  1WQ2 A;  2VT3 A;  2EWN A;  5IOY A;  2R7S A;  1VQ5 I;  5F08 A;  5JI6 A;  2EIM H;  4P96 A;  5J40 A;  1IXS B;  3BWG A;  2JA5 J;  2VL8 A;  2GBY A;  4OIO F;  1O3R A;  4HQM A;  3AAF A;  2XPW A;  2DI3 A;  3IH2 A;  2IP2 A;  2OJE D;  1GV2 A;  4RAF A;  2JTV A;  4PJJ A;  2E35 A;  3HGY A;  2DA6 A;  1HKT A;  3ERM A;  3S2W A;  1T98 A;  2O7O A;  4MFD A;  5IPA A;  4HW0 A;  2HDD A;  2R93 J;  3DPL C;  3L1P A;  1YTY A;  3I54 A;  3KE2 A;  1B72 B;  3AG1 H;  2Q2E A;  3ZMD A;  4M3B A;  1LQ1 A;  2AQE A;  3TW6 A;  1TWC J;  1CGP A;  1QZZ A;  2A61 A;  3KFW X;  4PSX A;  4XL9 A;  2ZNY A;  2IT0 A;  3R0J A;  2E1O A;  2EV0 A;  1WJB A;  1ETY A;  3K10 A;  3N4M A;  1MMD A;  4GXO A;  5DCF A;  2H6C A;  3BT9 A;  3OR2 C;  5HVQ C;  1ZR2 A;  2QKM B;  2KQR A;  1RR8 C;  2E7W A;  1K78 B;  4QWQ A;  2MAB A;  2E7X A;  3C3W A;  3IH3 A;  2ZB9 A;  3H3Z A;  4KMU X;  1U8B A;  5J1U A;  1ETQ A;  1YYV A;  2DOD A;  1P7J A;  2M30 A;  2BY1 A;  1PYV A;  3KCC A;  1XSD A;  1Z7U A;  3E5Q A;  1OYW A;  4B3X A;  4E4H A;  2E1N A;  2WWY A;  1TW2 A;  3HSR A;  3E6D A;  4M74 A;  3E0J B;  1H88 C;  1HOM A;  3D0S A;  3WTT C;  3ML6 A;  1XMA A;  4ETS A;  1S7E A;  3CUQ B;  2CO5 A;  1TNT A;  2CQK A;  5HS8 A;  1O7F A;  3L2C A;  3F9K A;  1SC7 A;  2LBF B;  5DD4 A;  1U5T A;  2PMH A;  1R6R A;  1FP2 A;  2YPR A;  1L3L A;  3D5S C;  1IUY A;  2GLO A;  3P9K A;  1ZHF A;  2UUZ A;  2MW8 A;  3TOA A;  4F7Z A;  4A3C J;  1LNW A;  2XAJ A;  1MBJ A;  2JVG A;  1JUM A;  3T1B A;  3WTU C;  3HKZ N;  1FLI A;  2X0L A;  5E1W A;  1X3W B;  4LGW A;  2HYJ A;  1BJZ A;  4ZDL A;  3F8C A;  3P5J A;  5FD6 A;  2HS5 A;  3OV8 A;  2H1K A;  2V9K A;  3SZT A;  5IT3 A;  3G4S I;  3PO3 J;  3LSG A;  2HOE A;  4IQJ A;  2K86 A;  2V6C A;  4D5C A;  2O8K A;  2DU9 A;  1MND A;  4XN0 A;  1SAN A;  5HLI A;  1J2X A;  4IJA A;  3R4K A;  1GXP A;  4G9Y A;  4OMZ A;  2OD5 A;  2QWW A;  2GXG A;  1GVD A;  1XB4 A;  4GDF A;  4P9F A;  3GCM A;  2P6T A;  1PP7 U;  2FF4 A;  4DZJ A;  2XSJ C;  1YX5 A;  1YX3 A;  3G73 A;  2PX9 A;  3VOD A;  5CVV A;  1QHH D;  4A2U A;  3C7J A;  3F23 A;  4CCO A;  5GP9 A;  5D6E A;  4JX4 A;  4XLH A;  4KDP A;  1BM9 A;  4YFN F;  3CC4 I;  2IW5 A;  3KEY A;  5HLH A;  2NOJ B;  3WTX C;  4OIQ F;  2COM A;  3CES A;  3RZO J;  1FP1 D;  3RYP A;  3LAJ A;  4U88 A;  3H5R A;  3L9F A;  4XQF A;  1WJC A;  2CUJ A;  1JHF A;  1MMG A;  3VDX A;  1Z7L A;  4G6T B;  2PFB A;  2ZXJ A;  4CCM A;  4XLC A;  2WB1 N;  1RKW A;  2HXI A;  2DDB A;  3ECH A;  3V7C A;  2RN7 A;  3JRC A;  3S3O A;  2YU3 A;  2HOS A;  2A3S A;  2BOL A;  4Y17 A;  1C0W A;  2A6T A;  3WTV C;  2FBK A;  1E3O C;  1GXQ A;  2PJP A;  2W00 A;  1FTT A;  2KRF A;  3FXL A;  1BOA A;  5ILV A;  5K5Q A;  2VBY A;  3OIO A;  5CLS A;  3CMY A;  3RQI A;  3U9G A;  3HOT A;  4MO7 A;  3G1M A;  3GYH X;  5J3L A;  5LGN A;  1BI2 A;  4PDK A;  5FGM A;  2L54 A;  1LDJ A;  5CQG A;  1IG7 A;  2WAQ A;  3LSK A;  3OS0 A;  1P9Q C;  3BTJ A;  4CIC A;  1VQ4 I;  3B6C A;  4LLG F;  2XGD A;  3OSG A;  2L7K A;  2AXL A;  1LDK B;  2Z33 A;  4BNC A;  2HNH A;  1J5Y A;  1KGS A;  2XC7 A;  2I10 A;  1R1V A;  4KIC A;  1Y0N A;  5E3M A;  4C2M J;  1JJ6 C;  3FKJ A;  3HUG A;  2Y0M A;  3QPS A;  4DBR A;  1S72 I;  4NB5 A;  2VXZ A;  4WXC A;  2E2I J;  2MH9 A;  3PJR A;  3HDD A;  4IPA A;  2VJ4 A;  3HM5 A;  2KPM A;  1MJB A;  4EGZ A;  4E7L A;  3ESW B;  1K6O A;  1EH7 A;  5JFR A;  1HKS A;  2Z16 A;  4MGR A;  5C3E J;  2HOA A;  2M1B A;  3A0B C;  5EYR A;  5BOX A;  4KN4 X;  4M6X A;  4PJL A;  4ITV A;  3H5A A;  3BG6 A;  3OY9 A;  1W36 D;  5LHI A;  2QZ8 A;  1ON2 A;  5F0H A;  1E0E A;  5E79 C;  3RIR A;  1T8I A;  4UHT A;  4C3H J;  5DUI A;  1TWG J;  3OYN A;  4IO9 F;  3KP3 A;  4ABZ A;  4EEF G;  5B1B H;  5LRR A;  4EJV A;  5CVU A;  3HHG A;  3KLO A;  1MNM C;  2WC2 A;  3BG3 A;  1FYM A;  4Q47 A;  5B1A H;  4IQ4 A;  2D1H A;  3OMY A;  2WAE A;  2B0L A;  1B72 A;  2EFQ A;  3VPR A;  4LOC A;  2LFB A;  2K7L A;  3ZOB A;  1KU2 A;  2P5K A;  2NNY A;  4XLE A;  5K7F A;  1R36 A;  1GLN A;  3CCY A;  2NXN B;  3TL4 X;  2XKP A;  1I39 A;  3T8T A;  2LTP A;  5DEQ A;  4CUG A;  3SDB A;  2VQG A;  5D4S A;  2LC2 A;  1V54 H;  1SFX A;  1AOY A;  2ICW G;  1HLV A;  4PJ0 C;  4PFO A;  1Z05 A;  3I55 I;  2FNA A;  1K78 A;  1Y8Q B;  4AIJ A;  3TP3 A;  4QLC U;  2JWT A;  2X6W A;  5BPD A;  2F2E A;  4BGD A;  4U0Y A;  2UV1 A;  3OIP A;  3ZQH A;  1B9N A;  2G7U A;  2RV8 A;  2COB A;  3HPH A;  5J1Y A;  4XRM A;  3CF5 F;  4KT5 C;  1M1E B;  2CMP A;  1FJL A;  1J0R A;  2PMZ N;  3GWZ A;  4KIF A;  4CCL A;  5DDG A;  1JXS A;  1V5F A;  5HLG A;  2JZY A;  2JUG A;  2EZL A;  2QCO A;  2QBY B;  1WCM J;  4AWX B;  4DGW B;  1YW9 A;  5DD8 A;  4XSX F;  3CUQ A;  1QQI A;  1VQ9 I;  4A3B J;  2LBF A;  1LPQ A;  2R7V A;  1BIB A;  4OIR F;  1ZLK A;  5FKL A;  4GYI A;  1YLF A;  5E20 A;  4I98 B;  4RGU A;  5E18 F;  2CFX A;  1O57 A;  2RDP A;  3HGG A;  1B8I B;  1OCR H;  1IGN A;  2PBI A;  3HL2 A;  3ASN H;  2KP6 A;  1X2N A;  2K9S A;  3IKV A;  2DK8 A;  1B6A A;  1RI7 A;  2GOM A;  3JRA A;  3WE3 A;  3HOV J;  1Q1H A;  3FXU A;  3MCZ A;  5DCM B;  1HW5 A;  2FQ3 A;  2O61 A;  1RKT A;  4M9X A;  1DP7 P;  2FEZ A;  1FIA A;  4KIB A;  2M8G X;  1X1C A;  5LRS A;  4PFP A;  5F27 A;  1XX5 A;  2KIQ A;  5EG0 B;  4ZDO A;  3OS1 A;  2BHZ A;  1AKH B;  3IH4 A;  3KET A;  1X1D A;  5HNF A;  4XLF A;  3TP0 A;  5E17 F;  4A0Z A;  4GCV A;  1X3U A;  2XB0 X;  5JR3 A;  3OYG A;  2F4I A;  3D5R C;  1FMV A;  5J8C A;  4HPQ A;  5IOZ A;  2E1M B;  4ANJ A;  1SMY F;  2K3P A;  5LEJ A;  4KFC A;  3Q3S A;  2ESH A;  4KIG A;  2LOO A;  2VAS A;  4FT8 A;  4AU7 A;  1ZR4 A;  2CV2 A;  3DU6 A;  3QU3 A;  3HG9 A;  4BKX A;  2L2O A;  2L0K A;  4RGX A;  5AIQ A;  2J5P A;  3F8N A;  3GF2 A;  3RDI A;  4U87 A;  1KU3 A;  1TNS A;  1Z1D A;  2XVC A;  1K79 A;  3JAM Z;  2KZV A;  4U7D A;  2OQG A;  3EET A;  5F64 A;  1ONV A;  4RMN A;  1X19 A;  2QGU A;  3MQ0 A;  1BC8 C;  1O4X A;  1XDU A;  1DGR M;  3TW7 A;  2L4M A;  5CKT A;  2JA7 J;  1JTX A;  4UVA A;  3HRS A;  1OCO H;  1HW2 A;  5FRN A;  4BQN A;  2LY9 A;  3ZXS A;  3J81 Z;  1BL0 A;  3BLY A;  1JKO C;  1K4S A;  3W6V A;  4B8X A;  4IHT A;  4BBR J;  1GVJ A;  1OMI A;  2DMQ A;  3KYC B;  4XKC A;  1LB2 A;  4D9J A;  5D5U B;  3GO5 A;  3HIF A;  4L0Y B;  3F8B A;  4BHC A;  1WSU A;  3TMO A;  3DU5 A;  4Y7N J;  2VB6 A;  3HTS B;  3J80 Z;  4HF2 A;  1P92 A;  1HST A;  1XDS A;  3WOD F;  2QQ8 A;  4X6A J;  4NUB A;  1X58 A;  2R7T A;  3A02 A;  2Y0S A;  3CDI A;  1SFO J;  1TLH B;  2IGM A;  4LG3 A;  2AXT C;  2OZ6 A;  1ETW A;  4UXN A;  1FSH A;  3HOW J;  2QSF X;  1Z21 A;  1X3Z B;  4E7H A;  1IV6 A;  3SFI A;  2MLG A;  5TGT A;  4LK0 F;  4K2E A;  5D6F A;  2M5W A;  1FY7 A;  2DA5 A;  3PNV A;  5E1Z B;  5L3C A;  4LLN A;  4B1R A;  2B63 J;  4GYG A;  3R60 A;  2A68 F;  3O3K A;  3S14 J;  2DT5 A;  4BQO A;  1IW7 F;  1A6Q A;  1J7K A;  1IUF A;  3H1C A;  2ZXH A;  5GAD J;  4IZZ A;  3DTE A;  2JQ7 A;  3V7S A;  1BI0 A;  4CCK A;  1E17 A;  4HNT A;  3ZMT A;  2DT6 A;  3V8K A;  5KHD A;  2OZU A;  1P4A A;  4ZYH A;  2B7E A;  4LFU A;  1T56 A;  2KRH A;  3BJO A;  1QO0 D;  3DBL B;  1H9T A;  3JRD A;  4XNF A;  1IDZ A;  2FBI A;  1F4K A;  2FSW A;  3F3X A;  3SEZ A;  5H6R A;  2EH3 A;  2HU9 A;  4WK8 F;  2ZCW A;  4XRS G;  5D4R A;  6PAX A;  3LMM A;  3E5X A;  1CQT A;  2KT0 A;  1KZH A;  5HLT A;  2A07 F;  4A69 C;  2F4M B;  2TDX A;  1HC8 A;  5M3M J;  1LVK A;  2IEK A;  3H36 A;  1W1W E;  4FHT A;  2R4G A;  3I58 A;  2KRC A;  4PUS A;  2RAE A;  3HRU A;  2H1L A;  4XOP A;  5EJC A;  3V4G A;  3E97 A;  2DQR A;  2STT A;  4XRS A;  2EA2 A;  4DZP A;  3VB2 A;  3QWL A;  4RM2 A;  5EZH A;  4E7I A;  2Y2Z A;  1PUE E;  3JSO A;  4L9N A;  2AHQ A;  3LL7 A;  1L0O C;  1W5C C;  3TDZ C;  4CYC B;  4DIQ A;  5FFZ A;  4Y33 A;  2HI3 A;  4DBQ A;  1MMS A;  1ZGW A;  2ZKZ A;  3PUB A;  2JK3 A;  4V2G A;  2LKS A;  4B48 A;  4L5E A;  4IRI A;  1BR4 A;  4GRI A;  4ZYE A;  5LGT A;  2QBY A;  2ZME B;  4ESB A;  2X4H A;  5J4V A;  1UEL B;  3I64 A;  5H2F C;  2FQ4 A;  2VLA A;  1SD7 A;  3MFK A;  1H8A C;  1BI3 A;  1UG2 A;  2V9V A;  1IDY A;  5HOD A;  1G4D A;  1MH3 A;  4KNY A;  4MNU A;  2K3F A;  4FE7 A;  5L3G A;  1TQI A;  1OPC A;  2V79 A;  2WV1 A;  2VQL A;  1ZEL A;  1UG0 A;  3C1D A;  2BGC A;  1ZG3 A;  4HV6 A;  4EVI A;  2DFH A;  3GZN B;  2DPD A;  5D5W B;  4XLP F;  3Q9V A;  3OYF A;  2XPV A;  2LYC A;  4C2T A;  1T0F A;  5DCM A;  5JHU A;  1VZ0 A;  2K9Q A;  4MHG A;  1U78 A;  1QPM A;  4MLO A;  3QPT A;  4A5N A;  2ADU A;  2EIK H;  3CJN A;  5GPA A;  1G2H A;  1G3Y A;  2A69 F;  5FO5 A;  5FD5 A;  2V9P A;  3RSN A;  3HBL A;  1V5G A;  4HF0 A;  3QPL A;  3L2Q A;  5EG0 A;  5ILS A;  3ZCO A;  1AKH A;  1AU7 A;  1MIJ A;  2DBB A;  2ELK A;  3JW4 A;  4YEJ A;  1R23 A;  1TL8 A;  3REO A;  2BVM A;  4XKB A;  3ZPL A;  3JTG A;  3K70 C;  2LY2 A;  4R1H A;  1LE8 B;  2D5V A;  1U5T C;  3LSM A;  1DQU A;  3MZH A;  4IKF A;  1W4M A;  4IX7 A;  2DOF A;  2VN2 A;  5F04 A;  1LFP A;  2GQQ A;  4XKW A;  3KP6 A;  1ZYR F;  1AA7 A;  4C9Y A;  3A1Y A;  2IA2 A;  5E3O A;  4RB2 C;  5D5V B;  2ID3 A;  2FOK A;  4MEX F;  4BAY A;  4HOB A;  2XDV A;  1YIO A;  2C6Y A;  1IC8 A;  2VOO A;  1IO2 A;  2VBX A;  1V3F A;  3I4N J;  1YHQ I;  3L2R A;  1POG A;  2EV5 A;  4PGH A;  1I5Z A;  1IN4 A;  4ZYD A;  2ZME C;  3FDY A;  1Y1V J;  2VPL A;  1XGO A;  4CGZ A;  3OL4 A;  1ON1 A;  2O0Y A;  3J7A Y;  2QLZ A;  3RQ4 A;  2F4O B;  2QQA A;  2HVQ A;  3DBR B;  4PGG A;  4ON0 A;  5FLX K;  4D5F A;  1OCP A;  2XUB A;  3IL2 A;  1G3W A;  2MH2 A;  3J7Z I;  3PUF A;  5CPR B;  4HEA 2;  2JA2 A;  2Z1D A;  3KP5 A;  3LST A;  4LB5 A;  1IF1 A;  2E5Z A;  3PIP F;  4DYC A;  4EM0 B;  5FLV A;  1SEU A;  3LSI A;  1D5Y A;  4B09 A;  1X4O A;  3T8R A;  2XSD C;  4XIC A;  3ABK H;  3M4O J;  4CA0 A;  1LJ9 A;  3R6S A;  1A36 A;  4HSR A;  1YIJ I;  1IN5 A;  2NYX A;  3GTQ J;  3JRH A;  4A6D A;  1JKQ C;  3U1K A;  4LJZ F;  3CP8 A;  4ENK A;  1AHD P;  3S1N J;  2IGK A;  2ESN A;  2X9D A;  5IYC J;  2FNP A;  4ZZL A;  3LA2 A;  3CUO A;  3A2K A;  2DAO A;  2XAU A;  3HOX J;  4A3I J;  1N77 A;  1WGX A;  1Z6T A;  2OCE A;  2KJC A;  2VON A;  4OAY A;  3GW2 A;  2A5Y B;  1BR2 A;  4UV9 A;  3K0L A;  5F1R A;  5FKK A;  3RTR A;  4M3F A;  1JKR C;  1YW8 A;  3SJM A;  2VC0 A;  3E5U A;  3PFY A;  4IVN A;  4AUX A;  3V8L A;  3D1N I;  1TQP A;  2Y9Y A;  4IHW A;  3MKZ A;  5HS7 A;  2R7Z J;  2EB7 A;  1MJ9 A;  2R7O A;  1V4R A;  4WXH A;  2IBD A;  1SFU A;  1RC9 A;  3HRM A;  2JN6 A;  1WFX A;  1VF9 A;  5LHH A;  5LGU A;  3IKT A;  1HA8 A;  2DMP A;  2XPU A;  1LEB A;  4KA4 A;  3BTL A;  1K7A A;  1LKX A;  4M6V A;  3RI4 A;  4BXF A;  3PQK A;  4NC6 A;  1WHU A;  3H3U A;  2NVU B;  2FUG 2;  3JRE A;  2RQQ A;  4HNV A;  4BS9 A;  2IPQ X;  2MGQ A;  4W1U A;  2ZC2 A;  4FE4 A;  3GTG J;  3GFI A;  1UCR A;  1MSF C;  1YIT I;  2CV1 A;  4F52 A;  1ETK A;  2L01 A;  1ZLJ A;  2O9L A;  4M6Y A;  1ZRE A;  2M0C A;  2GWR A;  1PVE A;  1ZTR A;  5M5W J;  2HKX A;  4X1E A;  4CYC A;  3CCM I;  1K61 A;  2CQ7 A;  2LRD A;  2ZSI B;  3QU6 A;  4JOM A;  5IT9 Z;  3FK7 A;  3BCA A;  2VKE A;  2XAS A;  3MVP A;  4A3K J;  2KIS A;  4JX6 A;  2RNG A;  3KP7 A;  2LKP A;  1QZY A;  4U0W A;  3ZMV A;  3H9Q A;  2GM4 A;  2ZME A;  4OIN F;  3TO9 A;  3QOE A;  5TIS C;  4JX5 A;  3H35 A;  1BW5 A;  1XMX A;  4WX9 A;  3K4N A;  4HYE A;  2Z5U A;  1P4X A;  1R5H A;  1TBX A;  2OPT A;  1BBY A;  3H9J A;  2P8T A;  4GO1 A;  4TV7 A;  4OU0 A;  2BY2 A;  2DPU A;  3HXL A;  4B47 A;  1WJD A;  1Y6I A;  1ETO A;  4BUP A;  2R7F A;  4LLL A;  3CCS I;  1WKM A;  1ZH5 A;  1OCZ H;  4BYY A;  4BHB A;  4V19 K;  5K7H A;  1RZ4 A;  4ASN A;  2UZK A;  1JT6 A;  2X1C A;  3CJR B;  2V4J C;  4M73 A;  5KAF C;  4BXX J;  1STZ A;  4OIP F;  5BPI A;  1Z67 A;  3AG4 H;  4QSH A;  3H92 A;  3I4M J;  2K4B A;  2BEO A;  2WBM A;  2YR2 A;  2PQ8 A;  1WWX A;  2HVR A;  4A0X A;  4ESJ A;  2R7W A;  2H6B A;  2QVO A;  4V2F A;  1MH4 A;  3BR6 A;  1IZ1 A;  5J6X A;  4B43 A;  3F8M A;  1WVR A;  3FXQ A;  2JRT A;  3KP2 A;  3J7Y J;  3CUQ C;  1PUF B;  3C2B A;  4I99 C;  2KMU A;  3MKY B;  3PQJ A;  1QBJ A;  2YU9 J;  3M3Y J;  1IRG A;  3Q9S A;  2JT1 A;  2VPR A;  2L7M P;  3ISP A;  2ELJ A;  1S7A A;  1D1C A;  5J8F A;  4R79 A;  1LE8 A;  1G59 A;  1HBX G;  1OR7 A;  3A03 A;  4OOI A;  1IV8 A;  4BAC A;  3A4C A;  4II3 A;  3C18 A;  5B5E C;  1S3J A;  3RKX A;  5K1Y A;  3ZQQ A;  2JPB A;  2Z99 A;  4YG2 F;  1J75 A;  5IYD J;  3HZJ A;  2F5D A;  1G8X A;  2L9V A;  3B73 A;  2DA7 A;  1FWZ A;  4AC0 A;  4XID A;  1UHS A;  1VQM I;  2IS4 A;  3ASO H;  4WCG A;  3VWB A;  2K9M A;  2I8D A;  2JRM A;  1LEA A;  2M8E A;  3F6O A;  3S93 A;  2LRE A;  4ZYG A;  4PSW A;  3DXJ F;  3ZR8 X;  2IA1 A;  3IP4 B;  1UMQ A;  1VQ7 I;  4G12 A;  3L2U A;  3RYR A;  3F0C A;  4F55 A;  4M3E A;  2VC1 A;  2K9L A;  1N25 A;  1YJW I;  3OWT A;  1I3A A;  2QA4 I;  2WY7 Q;  3TKY A;  1OFC X;  2JSC A;  1I6X A;  3KYD B;  1WJF A;  2RGV A;  1HW1 A;  2OV7 A;  2STW A;  3CDH A;  3SYT A;  3AKZ A;  2ZXW H;  5CJ9 A;  4LIV A;  2P0W A;  1GUU A;  4AYB N;  3G6E I;  4FIS A;  2KDZ A;  3G3Z A;  2LH9 A;  3BR2 A;  4FQG A;  1VQL I;  2O8X A;  2G7H A;  3NWS A;  2DYS H;  1Y39 A;  5KCM A;  5B3S H;  2EFP A;  3BY6 A;  2W82 A;  4LD5 A;  2MA3 A;  1Y1W J;  3FMR A;  4I02 A;  1TQM A;  1RR7 A;  1YQA A;  2CQQ A;  3BR5 A;  5HS9 A;  2W85 A;  1U6G A;  2ZSH B;  3P7N A;  1W36 C;  5KVR A;  4S0H B;  2V26 A;  1RPW A;  3QQA A;  4P9U A;  1G6N A;  4L18 B;  2LNB A;  2XAQ A;  3G71 I;  4XLN F;  5FRM A;  1MD0 A;  5EGO B;  1IN7 A;  5C4X J;  2FD5 A;  1FSE A;  1ERD A;  5E8I A;  3BZC A;  4J19 A;  2X85 A;  3JCU C;  4MQV A;  2R92 J;  1RES A;  3PM1 A;  2LMD A;  2XIG A;  2DK5 A;  5GTH C;  3E6B A;  1BC7 C;  5LD2 C;  2HDC A;  5AON A;  3EUH A;  5BNG A;  1ZRD A;  4Y4R A;  3WGI A;  2NVX J;  4A0Y A;  1WJ5 A;  1U0J A;  2P5V A;  4UNO A;  1BJA A;  3M9A A;  1ZAR A;  1DPU A;  3HC7 A;  2ME0 A;  2VXD A;  3TGN A;  2W24 A;  2CRG A;  2L5Q A;  2L9S A;  2HEO A;  2MBF A;  2KIF A;  4HLY A;  4G94 A;  1IXR C;  2VJJ A;  2RRE A;  2VE8 A;  3OSF A;  1P6R A;  2QKL B;  2Z3Y A;  3R61 A;  2MC4 A;  5EEA A;  3IRQ A;  4DYQ A;  5M5Y J;  3GFJ A;  1R49 A;  4DOZ A;  2CWE A;  2ZBK A;  3K4M A;  1QU3 A;  1TWA J;  2WAQ N;  2BZT A;  1T2K A;  1KYZ A;  4EGY A;  2HFH A;  4I0A A;  1MGT A;  1SD5 A;  1TW3 A;  3W3C A;  4L9V A;  2DLL A;  3ZQG A;  1P2F A;  5DS9 A;  4GFB A;  3ZQC A;  5F0C A;  1OCT C;  2HPI A;  3L2W A;  4BY7 J;  2JJ7 A;  3MMY B;  3TED A;  1BIA A;  1YOV B;  4BJ6 C;  1D5V A;  4EJU A;  5TRD A;  1MBG A;  1Z3X A;  4IHV A;  1F43 A;  1WJA A;  1GV5 A;  1LFB A;  2W4S A;  3VYR B;  1K4T A;  2JA8 J;  4PZJ A;  2VE9 A;  4EJW A;  5L3B A;  4RGS A;  1REP C;  1EKE A;  3OYD A;  1T95 A;  3OYI A;  4NQW B;  4CZZ A;  2AS5 F;  3U2R A;  2CH0 A;  2DT7 B;  3GTJ J;  2K27 A;  1UB9 A;  3E3V A;  1MDM B;  2R0Q C;  1HSJ A;  5BQT A;  4A3F J;  2ZO4 A;  2EFW A;  1WRJ A;  4HLX A;  1TC3 C;  3F72 A;  4Z6Y A;  2L9N A;  1TT0 A;  4HNU A;  3GUD A;  3LOC A;  3WGG A;  2B9S A;  3LSH A;  5JLX A;  2BW3 B;  3MN2 A;  2JSP A;  1DGW Y;  3RPQ A;  4EM2 A;  1ZGA A;  1ENH A;  1XGM A;  3B02 A;  1R5G A;  2KFD A;  1UFM A;  3M1E A;  2YX4 A;  3FIS A;  4QIW N;  4P1W A;  4Q4Z F;  2Y9Z A;  3A0H C;  4F91 B;  5GAH J;  3UKG A;  3TQN A;  1JT0 A;  1XTA A;  3N97 A;  2Y31 A;  1D0X A;  2CW8 A;  4C3J J;  2X6O A;  4G7O F;  4FTH A;  2KHM A;  2OF7 A;  3HEF A;  1FOX A;  3FK6 A;  4HX7 A;  3S3N A;  3SHF A;  2L7Z A;  4DW6 A;  1SVL A;  3WTZ A;  1YS6 A;  4RLQ A;  2XB5 A;  3U21 A;  3DKY A;  1SAX A;  1Z91 A;  2JMW A;  3H5N A;  3K69 A;  1PUF A;  1DUX C;  1W5T A;  4HZF A;  3V8J A;  2E34 A;  4BXU A;  1ITY A;  2CG4 A;  2VOP A;  1AWC A;  2O03 A;  2AQF A;  4BEH B;  1NG7 A;  5CVR A;  4YEL A;  4BQQ A;  4RAG A;  3VFZ A;  4OAZ A;  3CLO A;  2CFO A;  1QZE A;  3BPX A;  3D5L A;  4E7Z A;  2FE3 A;  2MG4 A;  2XGX A;  5M5X J;  2NOG A;  2O3F A;  1T0F C;  4C30 A;  1SFK A;  4P55 A;  2WTE A;  3GTM J;  2HR3 A;  5GAG J;  2H09 A;  2YX7 A;  1MMA A;  2D1V A;  1A04 A;  3CCU I;  3GVA A;  3MWM A;  2FXA A;  1Q1V A;  5DM7 F;  3A01 B;  3KEQ A;  4XSZ F;  4DYR A;  2FX0 A;  2NAZ A;  2VBW A;  2EFN A;  2Z2S B;  1T6S A;  2M2E A;  3NEU A;  2K40 A;  3HPG A;  3HOZ J;  2IGN A;  4O5V A;  2FOW A;  1QVU A;  1U8R A;  1S7O A;  4RBO A;  4IL6 C;  1O3S A;  1ETX A;  1YO5 C;  4EAT A;  1OCC H;  3I56 I;  3ZMS A;  2CUF A;  2Q8K A;  1FIP A;  3OOU A;  2E1M C;  4M72 A;  1R9T J;  4J01 A;  3JAM K;  3E1S A;  1KA8 A;  2DQL A;  3K4J A;  2HWV A;  1IN8 A;  2R7R A;  3K1N A;  4CHU A;  4HX4 A;  1XG1 A;  2EZH A;  2XAG A;  3Q0U A;  2PN6 A;  5FJ8 J;  2GAU A;  3F22 A;  4OMY A;  3DPT A;  4UY8 I;  1E3P A;  3KX2 A;  2LP0 A;  4G6D A;  5E1X A;  2IGO A;  3M7G A;  3J81 K;  2VIX A;  5J1R A;  1DPR A;  2K4J A;  3QP6 A;  3BQZ A;  5EGO A;  1W0U A;  3ZQF A;  4D7N A;  2X1E A;  3CC7 I;  3KZI C;  1VQN I;  1TZL A;  2VKH A;  3ABT A;  4M3D A;  2G9W A;  2GIV A;  3VOE A;  2EZI A;  3DF8 A;  1MNE A;  1FX7 A;  2F48 A;  3DEW A;  2DXI A;  3S1R J;  4HA8 A;  5A2Q Z;  3J80 K;  1HDP A;  4D0P A;  3AL0 B;  2QSH X;  1S6L A;  2WA0 A;  4XMY A;  3QPH A;  2OC6 A;  4UVB A;  4IHX A;  3ZN1 A;  3WTW C;  2R5Z B;  4EJT A;  4UV8 A;  1FT9 A;  1WI9 A;  2DA3 A;  1D0Z A;  2R5Y B;  2ACJ A;  3CD6 I;  2LY1 A;  2CW0 F;  1J59 A;  3DEE A;  2F5V A;  2IJL A;  3GZ5 A;  3WTY C;  4A3D J;  3JRI A;  4BBS J;  2L7F P;  4MQ9 F;  3LSR A;  3FKI J;  2QQB A;  4HG2 A;  2QSG X;  4RS8 A;  5D5X B;  1FMW A;  4BE2 A;  4IOA F;  1RNL A;  3OR1 C;  2P7C B;  4D1Q A;  2Y0S N;  3ONQ A;  4I76 A;  4RAZ A;  3TOB A;  1ZQ3 P;  2I5U A;  2K9N A;  4IF4 A;  3ZMU A;  4B3A A;  3LQR A;  3JR9 A;  1XGN A;  2DFE A;  3QP5 A;  1KON A;  1XCV A;  1O3Q A;  3CME I;  3LSP A;  4NNJ A;  4XR6 A;  3OYJ A;  3JSP A;  3P9C A;  3OIQ A;  4KIT B;  1G3T A;  1BI1 A;  4NQW A;  3FF5 A;  2M9H A;  3I4P A;  1B8I A;  2NRA C;  1NK3 P;  2QUF A;  3DFG A;  3HSF A;  1MDM A;  1WZ2 A;  4KJZ A;  1R1U A;  1UZC A;  1QA6 A;  4E7J A;  3MKW B;  1N75 A;  2LVS A;  3K4K A;  4J00 A;  2X51 A;  4ZDP A;  2BW3 A;  2ECB A;  1A6I A;  3QRF F;  1UAA A;  1DDN A;  3N05 A;  5C4J J;  3FXM A;  2M34 A;  2YSR A;  4X0G A;  1H9G A;  3DBH B;  3AFH A;  4ENJ A;  1EH6 A;  4G8X A;  2VT2 A;  2GA2 A;  3H9G A;  1R00 A;  4BL0 B;  1FEX A;  4IEJ A;  3CCE I;  3J7A O;  3CMA I;  2G0E A;  3KZZ A;  4FX0 A;  1R5I D;  4YFK F;  3GZ6 A;  3DLL F;  4CZC A;  4ZTJ A;  4M71 A;  2XAH A;  2ID6 A;  5LLQ A;  3IAS 2;  1QPI A;  1RIO H;  5CVI A;  4YII A;  1TWH J;  2YS9 A;  1OJL A;  4O3M A;  2DW4 A;  2QF7 A;  5JHF A;  3M8J A;  1FZP B;  2KKO A;  3LNQ A;  5FKM A;  4AD9 A;  4N4N B;  2HQA A;  3RPU D;  1KU9 A;  3CCQ I;  4RA2 A;  1OYY A;  2VQC A;  1S29 A;  1YW7 A;  1NH3 A;  1A31 A;  5FKN A;  3I0T A;  4ZZD A;  5LHG A;  2BYV E;  2DN0 A;  4I2O A;  4D7M A;  3DEU A;  4R8H A;  5FB2 A;  1KQ9 A;  5ICF A;  3CQZ J;  3CJT B;  2Q0O A;  4MTE A;  2HQR A;  1I6H J;  2KIU A;  2E2J J;  3PIO F;  1IJW C;  1BA5 A;  5AIP A;  4HF1 A;  3BG7 A;  2RVC A;  3MKL A;  1BR1 A;  1UJ8 A;  3L09 A;  4RB1 A;  1MJA A;  1BW6 A;  1K83 J;  4HQE A;  2OBP A;  3PSF A;  3T0Y A;  3JRF A;  4XOT A;  4M9Z A;  5ICG A;  4BDZ A;  4EMS A;  2L9R A;  4L0Z B;  3KP4 A;  2E36 A;  3CMM A;  1I3Q J;  1ORK A;  1R4M B;  1Z3Y A;  3FBI B;  4BEH A;  5C44 J;  3F21 A;  3EPZ A;  5KAI C;  3LWF A;  1E3H A;  4NBQ A;  2BE5 F;  2CUZ A;  3QYF A;  1H0M A;  2XRL A;  5IYB J;  2DOE A;  4AIH A;  1N78 A;  3BPV A;  3CTA A;  1U3E M;  1WPK A;  3W6K B;  1FOW A;  3GFM A;  2BXY A;  1S5L C;  1D1B A;  3BR0 A;  1JTY A;  2DJN A;  2JA6 J;  2FMY A;  4O6J A;  3QOP A;  2GZW A;  3BTI A;  1TT5 B;  2XKO A;  1I1S A;  1W7P B;  4HX8 A;  3CJQ B;  1F9N A;  3A01 A;  1HKQ A;  2LF8 A;  1XN7 A;  2LF7 A;  4CDG A;  1NK2 P;  3FMQ A;  2NVY J;  2HZT A;  4G6Q A;  3K2A A;  2DTR A;  2E5N A;  2H8W A;  3WTS C;  2VUM J;  1JKP C;  1Z9C A;  3HKZ A;  3HSE A;  4P5O A;  3CCL I;  2EIL H;  4LMY A;  5FKO A;  4UUT A;  3FIW A;  1OR7 C;  1PJR A;  3IHU A;  4L9T A;  1OLT A;  4CH7 A;  3Q0V A;  2V7F A;  3SEQ A;  2KL4 A;  4F93 B;  3L00 A;  3BG9 A;  2EFO A;  2XRO A;  4RGR A;  2QM3 A;  4A3G J;  2X1D A;  1MSE C;  1EV7 A;  4LG0 B;  1YFH A;  3TDU C;  5ILU A;  5FLM J;  3IWF A;  3K4C A;  3FX3 A;  2HGC A;  3W2W A;  3GX4 X;  2M7A A;  2V1U A;  4IRH A;  4L5I A;  2YUS A;  1SAU A;  3GME A;  4A93 J;  1RUO A;  2OAZ A;  2WV0 A;  2CU7 A;  3EDP A;  5DV5 A;  3S1Q J;  1QNT A;  2V1X A;  1DU0 A;  1HXD A;  2L4A A;  1SFE A;  2WB1 A;  3HRT A;  1EA3 A;  2DFF A;  4DJA A;  4XM3 A;  5KK1 A;  1JGG A;  2OTL I;  3DP7 A;  2R5Z A;  1XS9 A;  4U7B A;  2WAD A;  1ETV A;  1XSV A;  1R58 A;  4BE0 A;  2R5Y A;  1U2W A;  1W7P D;  1XCB A;  3BC8 A;  5CQE A;  2FJ1 A;  2X6Y A;  1QVT A;  2NVQ J;  4XKV A;  4S05 A;  3I5U A;  1B1B A;  4QPO A;  1UHW A;  2QQ9 A;  5J4Y A;  2EZK A;  3RPU A;  1P4W A;  3PL8 A;  3WU1 B;  4KIS A;  3M8F A;  2K02 A;  3HHH A;  3L7W A;  3VYU B;  3K4L A;  2RC4 A;  1X1B A;  3BG5 A;  1BN5 A;  4E70 A;  3FBN B;  4WF2 A;  2E1C A;  4KMF A;  1OYI A;  3QOD A;  2HTS A;  1W5S A;  1E2X A;  2IXS A;  2MLK A;  4AIK A;  5D8K B;  3EUH C;  1SD6 A;  1ZKG A;  2EJR A;  2OCC H;  4A12 A;  4QPQ A;  3SXY A;  2A5W A;  2R3S A;  4ESF A;  4F3Q A;  3DWL E;  5E3N A;  3UNG C;  2BXZ A;  2HYF A;  2CUE A;  3I9V 2;  4HDU A;  3R0A A;  3IC7 A;  1FYL A;  2BBY A;  5FRO A;  3GEZ A;  2HZD A;  4HST A;  4KYW A;  5L3E A;  2LG4 A;  4CXF A;  1I1G A;  4IXA A;  2BV6 A;  3VSL A;  1ZAO A;  3LA7 A;  1RUN A;  2XHK A;  4AYB A;  1D1A A;  3KPH A;  1NG6 A;  1WH5 A;  1ZK8 A;  2LR8 A;  4RB3 C;  2XF6 A;  2M4G A;  2DA4 A;  2ZNZ A;  2FRH A;  3QYB A;  2Z9O A;  3OYB A;  3CCJ I;  1R22 A;  4RAY A;  3VSK A;  4HAM A;  4N9H A;  1T08 B;  2ZFU A;  3K4B A;  3NQO A;  2XGC A;  4DQ2 A;  2M45 A;  3C2H A;  3Q0W A;  1Y0U A;  2IVM A;  5E8G A;  1I50 J;  5ICC A;  1D8J A;  3RCO A;  1R71 A;  4A6E A;  3TBI A;  1VQO I;  2Y69 H;  4UUS B;  4JP0 A;  2EIJ H;  5IT9 K;  1SD4 A;  1CF7 B;  4IRG A;  3M1C A;  1B9M A;  1LUJ B;  3WU0 A;  2W84 A;  2R7U A;  4LK1 F;  2DCE A;  1ZGJ A;  2W25 A;  4I01 A;  1HDD C;  3COA C;  5E3L A;  1XSX A;  2KLO A;  3O2P E;  2DTZ A;  1YG2 A;  3BR1 A;  4KUM A;  1Z6R A;  1J9I A;  2BHY A;  2ZFW A;  3ABL H;  1Y8R B;  1LVA A;  4M3G A;  1VTN C;  1VQK I;  3OYM A;  3RJP A;  2CV0 A;  4ZC3 A;  5J47 A;  3AG3 H;  1XMK A;  5DM6 F;  3LAP A;  4XN3 A;  3S15 J;  1X1P A;  3FZV A;  2ZJP F;  4BE1 A;  3GTL J;  2X48 A;  2MFZ A;  3TO6 A;  4BJT A;  3H3V K;  5HDN A;  2P5L C;  2EA4 A;  1MBH A;  1QGP A;  4H0E A;  2HOT A;  4G7H F;  2E60 A;  2PMZ A;  2TRT A;  2JPC A;  3OYL A;  1ZRF A;  5EZG A;  5HDK A;  4MEY F;  2KIM A;  4HRI A;  2VI6 A;  4A3J J;  1YE9 A;  3MZY A;  4LIT A;  3U1D A;  3S2D J;  2P81 A;  2FML A;  5K5R A;  4NHJ A;  1T39 A;  3K9T A;  2IS2 A;  3BZK A;  3I53 A;  1IAW A;  3I71 A;  2FA5 A;  3EUA A;  1W7P A;  3TO7 A;  2P7V B;  1T38 A;  1TWF J;  1FYK A;  4UUV A;  4Q48 A;  2R7D A;  2H8R A;  2K85 A;  3WG9 A;  2EK5 A;  1RRJ A;  2CQX A;  4CYD A;  4ZJZ A;  1UHM A;  3S1M J;  4A3M J;  2MYS A;  4UB8 C;  2NS7 A;  2P6S A;  1S9H A;  3M8E A;  2LDU A;  5GPC A;  2E2H J;  3W6J B;  4XOR A;  2HDW A;  1ZRC A;  2R7Q A;  2XF5 A;  3LSJ A;  3S2H J;  2DFI A;  4N0B A;  1OIS A;  3RKY A;  3ZQI A;  3KYL A;  5K5O A;  5BS6 A;  4LG0 A;  1FOK A;  1WH7 A;  1SMT A;  3MAJ A;  4E6K G;  3GLL A;  3OOP A;  5HDG A;  3ZGK A;  1MMN A;  2K5C A;  1JI8 A;  1F5T A;  1KYW A;  3IRR A;  1FBS A;  3NRV A;  3OYC A;  2WY8 Q;  1VQ6 I;  3PSI A;  3FHZ A;  2E19 A;  3G1L A;  2HXO A;  9ANT A;  4PK4 A;  4CO8 A;  3QAH A;  1B59 A;  4WXD A;  1BOB A;  5LFA A;  4XRF A;  5EF6 A;  4JK1 X;  1K6Y A;  2FU4 A;  1MBE A;  4HBL A;  2N8G A;  3K2Z A; 
#chains in the Genus database with same CATH homology
 1GVD A;  3DCF A;  2CUF A;  1FIP A;  3OOU A;  1R9T J;  1IC8 A;  4DZJ A;  3I4N J;  1POG A;  1Y1V J;  3K7A J;  1XG1 A;  2EZH A;  3Q0U A;  5GP9 A;  5FJ8 J;  4JX4 A;  4RDU A;  3H0G J;  5IP9 J;  1MBF A;  2LP0 A;  1T33 A;  5J1R A;  3BR3 A;  1W0U A;  3RZO J;  3BQZ A;  5EGO A;  1FTZ A;  1X2M A;  3ZQF A;  4D5F A;  4D7N A;  1OCP A;  4M3D A;  2EZI A;  2WB1 N;  1RKW A;  2HXI A;  3DEW A;  4DYC A;  5FLV A;  3S1R J;  1D5Y A;  4BY1 J;  1JUP A;  2XSD C;  4XIC A;  1HDP A;  3M4O J;  3JRC A;  2HOS A;  4IHX A;  2DMN A;  1DU6 A;  3GTQ J;  5IP7 J;  3JRH A;  2R5Z B;  1E3O C;  1VND A;  3WHB A;  1IRZ A;  1JKQ C;  1AHD P;  3S1N J;  1FTT A;  2DA3 A;  2R5Y B;  2X9D A;  5IYC J;  3OIO A;  3CMY A;  3RQI A;  4MO7 A;  4A3D J;  3G1M A;  5J3L A;  3JRI A;  4BBS J;  2L7F P;  3HOX J;  1EF4 A;  1F36 A;  4A3I J;  3LSR A;  3FKI J;  1WGX A;  1JUS A;  1IG7 A;  3S16 J;  2Y0S N;  3BTJ A;  4I76 A;  5FKK A;  1ZQ3 P;  3B6C A;  4M3F A;  2LK2 A;  1JKR C;  2AO9 A;  2K9N A;  3E7L A;  3JR9 A;  2XGD A;  4B3A A;  3SJM A;  3OSG A;  4AUX A;  1Z0X A;  2I10 A;  3D1N I;  2Y9Y A;  4IHW A;  1P7I A;  2R7Z J;  3LSP A;  5E3M A;  3NAU A;  2IBD A;  2DA1 A;  4C2M J;  1JJ6 C;  2JN6 A;  2M9H A;  1B8I A;  1YRN B;  1VF9 A;  3QPS A;  1NK3 P;  1W0T A;  2DMP A;  2XPU A;  2E2I J;  3HDD A;  3BTL A;  3HM5 A;  4W97 A;  2LVS A;  4M6V A;  4UUS A;  5C3E J;  2HOA A;  5EYR A;  2ECB A;  1A6I A;  1A5J A;  3JRE A;  4HNV A;  5C4J J;  2MGQ A;  4W1U A;  2M34 A;  4FE4 A;  3GTG J;  5F0H A;  2W48 A;  4C3H J;  1MSF C;  1FEX A;  1TWG J;  2LD5 A;  1NTC A;  4IEJ A;  2G0E A;  3NAR A;  1ETK A;  4ABZ A;  4EEF G;  1U9N A;  1MNM C;  2O9L A;  3BG3 A;  5F1J A;  2M0C A;  1B72 A;  2ID6 A;  3VPR A;  1ZTR A;  2ME6 A;  5M5W J;  4X1E A;  3RZD J;  1QPI A;  2Y30 A;  4CYC A;  3HOY J;  1K61 A;  4LOC A;  1TWH J;  2YS9 A;  4NDL A;  1OJL A;  2LFB A;  3FK7 A;  1XC5 A;  2QF7 A;  3ZOB A;  2VKE A;  3MVP A;  4A3K J;  4XK4 A;  4JX6 A;  4MIM A;  5K7F A;  1VFC A;  3LNQ A;  5FKM A;  3CCY A;  2GM4 A;  2LTP A;  3G1O A;  4JX5 A;  1BW5 A;  5FKN A;  2DN0 A;  1HLV A;  4D7M A;  3HB9 A;  2OPT A;  3CDL A;  3CQZ J;  3TP3 A;  2JWT A;  1I6H J;  1Z77 A;  2E2J J;  3ZQH A;  5J1Y A;  4XRM A;  1MBK A;  2COB A;  2EQR A;  1IJW C;  1BA5 A;  1ETO A;  3MKL A;  1BW6 A;  1K83 J;  1FJL A;  2PMZ N;  3JRF A;  5K7H A;  1JT6 A;  3O8G A;  2L9R A;  4MFE A;  1WI3 A;  2EZL A;  2QCO A;  1ORK A;  1I3Q J;  4BXX J;  5C44 J;  1WCM J;  4QSH A;  3I4M J;  2CJJ A;  2XRL A;  4V2F A;  5IYB J;  1MH4 A;  4A3B J;  3BR6 A;  1WPK A;  5FKL A;  1JTY A;  3BR0 A;  2JA6 J;  2DJN A;  3HGG A;  1B8I B;  2VKV A;  1IGN A;  1PUF B;  3C2B A;  3BTI A;  2YU9 J;  1HF0 A;  3M3Y J;  4FCY A;  4JYK A;  2VPR A;  2L7M P;  3A01 A;  1X2N A;  1RET A;  2K9S A;  1NK2 P;  1LE8 A;  3JRA A;  2NVY J;  3A03 A;  3HOV J;  5F0F A;  4I6Z A;  3K2A A;  1RKT A;  2VUM J;  1JKP C;  5IYD J;  2DA7 A;  1FIA A;  4AC0 A;  4XID A;  1UHS A;  1U9O A;  2M8G X;  5FKO A;  3JRB A;  2LKX A;  4UUT A;  3FIW A;  3BTC A;  2DA2 A;  5F27 A;  3Q0V A;  5EG0 B;  3BG9 A;  1AKH B;  3IH4 A;  3WHC A;  3TP0 A;  1UMQ A;  4G12 A;  2XB0 X;  4A3G J;  1JJ8 C;  3F0C A;  1QRY A;  4M3E A;  1MSE C;  5FLM J;  1OFC X;  5IOZ A;  2NS8 A;  4A3L J;  3Q3S A;  2YUS A;  3RKQ A;  3O8H A;  1ZR4 A;  1GUU A;  4AYB N;  4A93 J;  5K7Z A;  3B6A A;  4BKX A;  4FIS A;  2L0K A;  2KDZ A;  5M3F J;  3IV5 A;  3BR2 A;  2TCT A;  2CU7 A;  3S1Q J;  1DU0 A;  3GTP J;  1Y1W J;  3ZQL A;  3SDG A;  1O4X A;  3GBG A;  1RR7 A;  3TW7 A;  2CQQ A;  3BR5 A;  2JA7 J;  1JGG A;  2R5Z A;  1JTX A;  4S0H B;  1XS9 A;  1RPW A;  3QQA A;  1ETV A;  2R5Y A;  2LY9 A;  1BL0 A;  2HQ5 A;  1JKO C;  5EGO B;  2FJ1 A;  3W6V A;  1QVT A;  2NVQ J;  2LLK A;  4BBR J;  2FD5 A;  5C4X J;  2DMQ A;  1LFU P;  3GTK J;  4J19 A;  2EZK A;  2R92 J;  1RES A;  3PM1 A;  3PO2 J;  5BNG A;  2NVX J;  4Y7N J;  3BG5 A;  4QTR A;  4X6A J;  5JLW A;  2ME0 A;  5DTD A;  1X58 A;  2CRG A;  3A02 A;  2NVT J;  1SFO J;  2DMT A;  3OSF A;  1ZKG A;  5EEA A;  1ETW A;  4DYQ A;  2DMU A;  5M5Y J;  1GT0 C;  5E3N A;  1TWA J;  2WAQ N;  5IP6 A;  1YRN A;  3HOW J;  2CUE A;  3JRG A;  2ECC A;  3BQY A;  1IV6 A;  3SFI A;  5EDN A;  3ZQG A;  4A3E J;  5DS9 A;  4GFB A;  3ZQC A;  5F0C A;  1OCT C;  4BY7 J;  2JJ7 A;  2DA5 A;  3TED A;  4B1R A;  1WH5 A;  2MSY A;  2B63 J;  1MBG A;  4IHV A;  3S14 J;  1ZK8 A;  1F43 A;  1GV5 A;  1LFB A;  2LR8 A;  4Y52 J;  1IUF A;  2JA8 J;  2DA4 A;  3S17 J;  4C3I J;  1APL C;  4IHY A;  4B4C A;  1VI0 A;  2XGE A;  2EBI A;  2XGC A;  3GTJ J;  3HOU J;  3Q0W A;  2IAI A;  1T56 A;  2R0Q C;  3GTO J;  1GDT A;  1I50 J;  4A3F J;  1HCR A;  1H89 C;  3JRD A;  5IOY A;  1IDZ A;  5F08 A;  1TC3 C;  4UUS B;  4JP0 A;  2EH3 A;  3LOC A;  2JA5 J;  4XRS G;  5JLX A;  2GBY A;  3MN2 A;  1CQT A;  2KT0 A;  2XPW A;  3IH2 A;  4A69 C;  1GV2 A;  5M3M J;  2IEK A;  3HGY A;  1HDD C;  1ENH A;  2DA6 A;  5E3L A;  2RAE A;  2DTZ A;  3BR1 A;  2O7O A;  4XRS A;  4DZP A;  4MFD A;  5IPA A;  2HDD A;  2R93 J;  5EZH A;  3L1P A;  3FIS A;  2Y2Z A;  4M3G A;  4QIW N;  2AHQ A;  2Y9Z A;  1B72 B;  4CYC B;  4M3B A;  2HI3 A;  3UKG A;  1ZGW A;  4V2G A;  2JK3 A;  3S15 J;  3TW6 A;  1TWC J;  1JT0 A;  4L5E A;  2Y31 A;  4C3J J;  3GTL J;  2X48 A;  2X6O A;  3H3V K;  4FTH A;  2E1O A;  1ETY A;  2OF7 A;  3HEF A;  1MBH A;  2HOT A;  2TRT A;  3FK6 A;  2FQ4 A;  3BT9 A;  5EZG A;  2L7Z A;  4DW6 A;  1ZR2 A;  1H8A C;  1UG2 A;  2VI6 A;  4A3J J;  1IDY A;  5HOD A;  2XB5 A;  1MH3 A;  3IH3 A;  2ZB9 A;  4FE7 A;  2JMW A;  3S2D J;  1U8B A;  5J1U A;  2P81 A;  1ETQ A;  1P7J A;  2WV1 A;  1PUF A;  1ITY A;  1TWF J;  2XPV A;  2H8R A;  2CQX A;  2K9Q A;  1H88 C;  1U78 A;  1HOM A;  4MLO A;  3S1M J;  4A3M J;  2NS7 A;  1S7E A;  5GPA A;  1G2H A;  5GPC A;  5M5X J;  2MG4 A;  2E2H J;  2NOG A;  3HBL A;  3QPL A;  5EG0 A;  3LSJ A;  1AKH A;  1AU7 A;  3S2H J;  3GTM J;  2ELK A;  2GLO A;  2MW8 A;  3ZQI A;  4A3C J;  1Q1V A;  1MBJ A;  3A01 B;  1JUM A;  1WH7 A;  2FX0 A;  3HKZ N;  4DYR A;  1LE8 B;  2D5V A;  2HYJ A;  1BJZ A;  2M2E A;  2H1K A;  5F04 A;  2K40 A;  3PO3 J;  3LSG A;  3HOZ J;  2E19 A;  3G1L A;  1QVU A;  2HXO A;  4D5C A;  2O8K A;  9ANT A;  4RBO A;  5EF6 A;  1SAN A;  1ETX A;  1MBE A;  5E3O A;  2N8G A;  2ID3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...