5IYBJ

Human core-pic in the open state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iybJ00
5IPAA 1AKHB 2E1OA 1VF9A 5K7ZA 4FTHA 3HOVJ 5IYCJ 3JR9A 2IEKA 2CUFA 2LTPA 2HOTA 3NARA 3RZOJ 4C3IJ 2M9HA 3C2BA 2OPTA 3ZQLA 2D5VA 4XRSA 5J1RA 1P7JA 3JRGA 2VI6A 3M4OJ 2X48A 1OCTC 4BY7J 3TP3A 5GP9A 2XGDA 3CDLA 2Y9YA 1IRZA 2K9SA 1HDDC 4CYCB 5GPAA 2ZB9A 3GBGA 2XPWA 3BQZA 1IDYA 3ZOBA 1RKTA 3HDDA 3BT9A 3GTJJ 5F27A 2LR8A 5C4JJ 1RKWA 1JKOC 3UKGA 1JTYA 2DJNA 2DMNA 1ETXA 2DTZA 2WB1N 2CU7A 2DA3A 3LSGA 4MO7A 1SFOJ 2DN0A 4UUSA 5EG0A 2LD5A 1WH5A 3FKIJ 1ZK8A 3S17J 1I6HJ 2JMWA 1TWAJ 2LVSA 2EBIA 3ZQIA 1HCRA 2MW8A 3BG9A 5M5YJ 5FKOA 5K7FA 1MBJA 5IP6A 4DYRA 1IGNA 3JRFA 1RPWA 3GTQJ 2DA4A 3F0CA 1ETKA 4BKXA 2VKVA 4QSHA 1IUFA 5K7HA 3O8HA 1GV2A 2GM4A 3QQAA 1I3QJ 4DZJA 2COBA 4A3CJ 2K40A 2XGCA 1UG2A 2QF7A 3HOXJ 2XPVA 1BJZA 1JKRC 1JT6A 3A02A 1ETOA 1X58A 3OIOA 1AHDP 3BR5A 4UUSB 2NS8A 5FKLA 5DS9A 4Y52J 4AYBN 4A3LJ 2R0QC 1W0TA 2G0EA 2HYJA 2HOSA 5IYBJ 1F36A 5IP9J 3JRBA 2P81A 1TWHJ 1APLC 2R5ZA 2CJJA 2MG4A 1VFCA 5EZGA 2TRTA 2LY9A 2DMQA 4XIDA 2I10A 4LOCA 5C4XJ 3BR0A 3GTOJ 4BXXJ 3IH2A 2EZHA 4G12A 5M3FJ 1MH4A 1JJ6C 1Q1VA 3S16J 5EGOB 3HEFA 2YS9A 1ORKA 2HI3A 3RQIA 3IV5A 3WHBA 2FD5A 3G1LA 2B63J 1HOMA 3JREA 1NTCA 2NVXJ 2JWTA 2R7ZJ 2EZKA 3TP0A 3BG3A 1FTTA 1JJ8C 2LKXA 1O4XA 1Z77A 2FQ4A 3OOUA 2X6OA 4C3HJ 2AHQA 1MBHA 4IHVA 1ETQA 2FJ1A 3A03A 4QTRA 3RZDJ 2NVQJ 2EH3A 3SJMA 3MN2A 1Y1VJ 2FX0A 4L5EA 3RKQA 4D5CA 4D7NA 1B8IB 3S1NJ 2M8GX 1F43A 4J19A 3S1RJ 3OSGA 2K9NA 2Y2ZA 3B6AA 5F08A 1VI0A 3HBLA 4A93J 3HGYA 4A3MJ 5EYRA 3H3VK 2ELKA 3BTCA 1BL0A 4FCYA 2ME0A 2O8KA 2EQRA 4A3BJ 1TWCJ 4A3GJ 2E19A 5FKKA 5C44J 2HDDA 3E7LA 4A3JJ 1JKQC 1BW6A 2O9LA 3O8GA 4MIMA 5EEAA 3G1MA 1ZGWA 3LSRA 1QVTA 5J3LA 1IG7A 2ID3A 2NVTJ 1IJWC 3S1MJ 4M3FA 1RESA 2CQQA 3PM1A 1H88C 2XRLA 1JT0A 5IP7J 1JUSA 3GTLJ 1ETYA 2L7ZA 3K7AJ 1MBGA 4MFDA 2Y30A 3MKLA 2ID6A 3VPRA 2R5YA 2R5YB 5M5XJ 4AUXA 3Q3SA 1MBKA 4IHXA 1WGXA 2YUSA 1QRYA 4DYCA 1LE8A 1WI3A 1B72A 1LFBA 2HXIA 1T33A 4UUTA 3BTIA 3GTKJ 4A3EJ 1ETWA 3FK6A 1XS9A 2E2IJ 3GTPJ 2JN6A 1MH3A 3BQYA 5JLWA 3BR1A 3S2DJ 3OSFA 1OFCX 4X1EA 3JRHA 1MSFC 2HOAA 2DMUA 1TWFJ 1Y1WJ 3S15J 2XB5A 2R5ZB 1D5YA 4M3EA 2XSDC 1POGA 2M2EA 3CQZJ 4I6ZA 2DA6A 2Y0SN 1QPIA 4BBRJ 3Q0UA 2H1KA 2VUMJ 1FEXA 1FTZA 1ZR2A 5E3OA 3GTMJ 1JKPC 5J1UA 3MVPA 3PO3J 3CCYA 2YU9J 3Q0VA 1JTXA 1BW5A 3BTLA 3HOZJ 1U78A 1GVDA 1WH7A 4ABZA 1YRNA 1RETA 2EZLA 5EF6A 1K61A 1B72B 5IOZA 3JRCA 1A5JA 2RAEA 3HM5A 1H89C 1JUPA 3JRDA 1VNDA 2MGQA 4RDUA 3TW7A 1LFUP 2Y9ZA 1UMQA 2O7OA 2LP0A 3BTJA 2L9RA 2XGEA 1ZR4A 1T56A 3CMYA 2EZIA 1R9TJ 4DZPA 1LE8B 3TW6A 1SANA 1OCPA 2DMTA 5FKMA 4D7MA 4M3DA 5F0CA 5F0HA 3QPSA 3BR3A 1ZKGA 2L7MP 5EDNA 1MNMC 4RBOA 3TEDA 5M5WJ 3LNQA 4QIWN 3SFIA 4C3JJ 4B3AA 1RR7A 5GPCA 5E3NA 3K2AA 5BNGA 1Z0XA 4GFBA 3HOUJ 1HDPA 4MLOA 1WCMJ 1QVUA 1ITYA 4BY1J 2R92J 1U9NA 2VPRA 2LK2A 2CQXA 4B4CA 1MBFA 2AO9A 2DA7A 1S7EA 4S0HB 1EF4A 2CRGA 1B8IA 4V2GA 3IH4A 3M3YJ 2ECCA 2VKEA 1GV5A 2WAQN 2DA2A 3B6CA 4HNVA 4XRSG 3GTGJ 4I76A 3HB9A 2IAIA 1G2HA 1JUMA 2E2HJ 3DEWA 1P7IA 4JX5A 3S14J 3G1OA 1BA5A 4NDLA 5F04A 1OJLA 1ZQ3P 5DTDA 2Y31A 4DW6A 3H0GJ 4A69C 5J1YA 3BG5A 2M0CA 4Y7NJ 4CYCA 5EZHA 1X2MA 5E3MA 1TC3C 2JA7J 9ANTA 2WV1A 1X2NA 3NAUA 4A3KJ 3LOCA 3HOWJ 1IC8A 2N8GA 3FIWA 4V2FA 2E2JJ 2R93J 5EGOA 3IH3A 4XICA 2W48A 1DU0A 5IYDJ 4M3BA 2M34A 1A6IA 1HLVA 4M3GA 1TWGJ 2JA5J 4XRMA 4A3IJ 2H8RA 5FLMJ 2X9DA 4EEFG 2JA6J 2JK3A 1NK2P 4A3FJ 1K83J 3HGGA 2JA8J 1GUUA 4IHYA 4M6VA 3ZQHA 1PUFA 4JYKA 5FJ8J 3DCFA 3LSPA 1YRNB 1E3OC 1GDTA 2HXOA 5FKNA 1ENHA 3W6VA 4MFEA 2DA1A 1HF0A 2NVYJ 3WHCA 4FISA 5C3EJ 2KT0A 3HKZN 3Q0WA 3S2HJ 1W0UA 1IV6A 2GLOA 2XB0X 5HODA 2LFBA 3FISA 1XC5A 5JLXA 4FE7A 1MSEC 4DYQA 4IEJA 4B1RA 2LLKA 4W1UA 2KDZA 1ETVA 2CUEA 4JP0A 4D5FA 2NS7A 2JJ7A 1WPKA 5F0FA 1H8AC 1UHSA 1AKHA 5IOYA 1AU7A 1U9OA 3A01A 3ZQCA 3HOYJ 3PO2J 4AC0A 3BR6A 3L1PA 3BR2A 1NK3P 2OF7A 1I50J 2GBYA 3ZQGA 3LSJA 2NOGA 1U8BA 4JX6A 1IDZA 2ECBA 3QPLA 3A01B 1CQTA 1FIAA 3ZQFA 4FE4A 2TCTA 4BBSJ 3JRIA 4JX4A 4XK4A 2HQ5A 3I4MJ 3JRAA 3SDGA 2QCOA 2L7FP 1GT0C 1FJLA 5F1JA 4A3DJ 2MSYA 5FLVA 2DA5A 2PMZN 1MBEA 3S1QJ 2DMPA 3I4NJ 3D1NI 5E3LA 2IBDA 4X6AJ 1DU6A 3FK7A 1FIPA 1JGGA 5M3MJ 1XG1A 4IHWA 4C2MJ 5EG0B 2XPUA 2K9QA 2ME6A 1ZTRA 1PUFB 4W97A 2L0KA
chains in the Genus database with same CATH superfamily
1SEUA 2E1OA 1VF9A 4Y33A 3F3XA 3OR2C 1TP4A 5K7ZA 4AU7A 4FTHA 2HPIA 3JR9A 2GXGA 2IEKA 1E0EA 3WTYC 4N0BA 1XGNA 3C2BA 3BJOA 2OPTA 4KMFA 1P6RA 4C9YA 3U9GA 3IL2A 2RKHA 3JRGA 3AL0B 3OYAA 1J59A 4BY7J 4TV7A 3TP3A 3VOEA 3GYHX 2G9WA 2XGDA 4MTEA 3S93A 2X1EA 3WE3A 2ZB9A 2ZMEB 3GBGA 3BQZA 4A5NA 1IDYA 1RKTA 1XB4A 2VBZA 5L3CA 2DU9A 2LR8A 5E1XA 4D9JA 1EKEA 2BYVE 2DFEA 3QYFA 3OYDA 2YU3A 2J5OA 5D5XB 1JTYA 2DJNA 5GAEJ 2JPBA 1TQPA 1VQLI 2KLOA 3W2AA 1G8XA 3QOEA 1SFOJ 1MIJA 1D3YA 3ABUA 3OOPA 5E79C 2DDBA 1HCRA 2DT7B 2MW8A 1MNDA 3MWMA 5M5YJ 3L2WA 3E0JB 2IP2A 3JSOA 1MBJA 2QWWA 2M45A 1ZARA 3JRFA 1IGNA 1HSJA 2QBYB 1I1GA 2EFNA 1LJ9A 4F92B 4M9XA 2L5QA 2FE3A 1KONA 1HW2A 2DA4A 2VONA 3TDUC 2VKVA 4QSHA 4CCMA 5K7HA 4RLFA 5HLTA 2QBYA 3I55I 3MKYB 1W7PB 2XGCA 3OL4A 4AWXB 4XSXF 1YW7A 5F1RA 2RVCA 4RGRA 1B9NA 1BJZA 1G6NA 1JT6A 2OJED 2JT1A 4B09A 5HLGA 2X0LA 1AHDP 5BMZA 2JUGA 5CVUA 3FBIB 5E1ZB 1WJDA 4A3LJ 3T0YA 5CLSA 1G3WA 1E17A 1VQ4I 3K4BA 2RDPA 1X1PA 4CCLA 4IO9F 3T5XA 3JRBA 2QQ9A 2KIFA 4M74A 1CF7A 3JTHA 1TWHJ 1APLC 3BJ6A 2R5ZA 3J7AY 4YIIA 5EZGA 5F64A 3JTGA 1ZH5A 5DUIA 2P5VA 4LOCA 3QYBA 4XMYA 5C4XJ 4ESJA 3BR0A 1XDUA 1ZGJA 3IH2A 5E20A 4XBFA 4DBQA 2PJPA 2X1DA 4KIBA 5LBQA 1ZG1A 1YLFA 3OYMA 4G12A 4UY8I 5DCMB 2LDUA 2X6XA 3GX4X 3HKZA 3KEYA 3A2KA 4I01A 3MQ0A 2YS9A 4CZCA 2HI3A 3GFIA 4NC7A 5LHIA 3VODA 2KMUA 2NVXJ 2JWTA 5DD4A 2R7ZJ 2A07F 1O4XA 4RAFA 2FQ4A 2ELHA 3OOUA 1J5YA 5EJCA 2X6WA 2FOKA 1Y8RB 5FROA 3KZYA 4QTRA 2P0WA 3FZVA 4HYEA 3NRVA 3PSFA 4AIJA 1Y1VJ 1LB2A 3DQVC 2JVHA 4RGXA 1MMSA 2M8GX 1F43A 4J19A 1U5TB 4KT5C 4RAYA 3VEPA 4U7DA 3HGYA 2FUG2 5EYRA 3H3ZA 1XSDA 4IPAA 2L4MA 2PI0A 1ONVA 1RUOA 3H5NA 3H0DA 2ME0A 3T1BA 2D45A 4LLLA 1KA8A 2IGNA 4HDUA 1ZRFA 3PNYA 2DYSH 4WCGA 3ZPLA 1RRJA 1JKQC 1BW6A 2O9LA 1S3JA 2ZSIB 5EEAA 5LGUA 4B44A 2OCEA 2IPQX 4F3QA 2FBIA 3LSRA 5LRRA 1OMIA 1T39A 1ZRCA 3S1MJ 2DT6A 3KYCB 2G7UA 2K4JA 2CQQA 4ASNA 1IF1A 1H88C 3HUGB 2EFOA 3VB2A 2XRLA 4ENKA 1A35A 1ETYA 3F8BA 3K7AJ 2R7TA 2Y30A 3VPRA 2R5YB 2HZDA 5FO5A 4KDPA 3HRTA 4B47A 4GGGA 5KHDA 4K2EA 1WQ2A 3E6DA 2W7NA 1QRYA 1LE8A 5IT3A 1U5TA 1U6GA 3I59B 4LK1F 1LFBA 1A04A 2HKXA 3BTIA 3M7GA 4YFNF 3GTPJ 3L7WA 3BQYA 3KEOA 2STTA 4UHTA 3M1EA 3TO6A 4UVCA 1E3HA 2F5VA 2VQHA 1MSFC 5LEJA 2DMUA 4XRFA 4IVNA 5HNHA 1K6OA 4A2UA 3N4MA 4XR6A 2O0YA 1R4NB 2LRDA 3CQZJ 3LFKA 2XRNA 3VYSB 2RQPA 1BN5A 3IKVA 2WAQA 3SYTA 3S3NA 2XF5A 4OAZA 3CMAI 1DDNA 1YRNA 1RETA 4Q5SF 1W5CC 1SVLA 2NYXA 1V5FA 5IOZA 1T95A 4EJVA 3HL2A 4NHJA 1J0RA 3JRDA 1YS7A 3F8CA 3KE2A 4HX8A 2QENA 3K4NA 2QUFA 4EVIA 1K78B 3GEZA 2BW3B 3R60A 1OR7C 5J4VA 3HJEA 2FF4A 1EH8A 1XMAA 2FSWA 2LP0A 2W82A 4G8XA 1T56A 3LL7A 1FX7A 4RLQA 2F5CA 4OIPF 4N4NB 5L3DA 5FKMA 5H20A 4D7MA 3DXJF 1HKSA 5F0CA 1N75A 5CVVA 5DCMA 5F0HA 3TGNA 1F5TA 4XKWA 2L7MP 1MNMC 4RBOA 5HOOA 3LNQA 1WFXA 4B3AA 1LVKA 4E6KG 1RR7A 1UG0A 1BBYA 5GPCA 3G6EI 1IAWA 1RIOH 3K2AA 4EGYA 1HDPA 4EM1A 3CJQB 1ON1A 1D0ZA 4BACA 4BY1J 3OYGA 1H9TA 3HPGA 1Y8QB 2CYYA 4G9YA 1RUNA 3LSHA 4P9FA 5KK1A 2AO9A 3K10A 2DA7A 4S0HB 1GXQA 3FKJA 4LLNA 4V2GA 3IHUA 2L4AA 2GA2A 1XGSA 3K4KA 1UZCA 2XAHA 2WAQN 4G6TB 4IF4A 3DTIA 3WGGA 3WU2C 1T38A 2Q1ZB 2DA2A 5J8FA 4HNVA 2EIKH 1A6QA 2IAIA 1U3EM 1TQIA 3D5SC 1F4KA 2O03A 1D1CA 2XAQA 1BA5A 1OJLA 3JAMZ 3GCMA 2W24A 2X6YA 1V5EA 1KYWA 1ZQ3P 1R1UA 3CLOA 4HV6A 4G7ZF 4CYCA 2L9SA 2IS1A 2PJRB 1TC3C 2KHMA 9ANTA 1O7LA 5ICEA 1BM9A 3OYNA 2WV1A 1KQ9A 2M30A 3SZPA 2W84A 3J80K 1TQMA 4A3KJ 2ZCWA 3NWSA 4O6JA 4O5VA 4AVPA 1XX5A 4OIRF 4BE2A 2K3FA 2W48A 1DU0A 3AKZA 3OIPA 1F1ZA 1HLVA 3C1DA 2VPLA 3RDIA 4LG0B 2QSGX 4A3IJ 2H8RA 2RN7A 3BJAA 5K5QA 4OMYA 2LG4A 2P6TA 1SD6A 2X9DA 4Q47A 2JA6J 1NK2P 3HGGA 3AFHA 1Y0NA 1G59A 4FQGA 3DTKA 5FJ8J 2NXNB 1YRNB 3DPUA 1XN7A 3W6VA 2GOMA 2NVYJ 2KT0A 3HKZN 3ULQB 3DPTA 1W0UA 4M72A 1IN8A 5HS8A 1JHHA 2DQRA 4I98B 1BC8C 3GZ6A 3FISA 1GHCA 1XC5A 1QHHD 4XKBA 2OD5A 2W4SA 3LAJA 4IEJA 3ABLH 1USSA 2CUEA 5ED4A 3R4KA 5CQEA 2JJ7A 2VKDA 3KZZA 1VQ6I 2W1OA 4QLCU 2FNPA 4RB1A 2XHKA 4I99C 4NC8A 2MBFA 5BPDA 2PMZA 2LBFA 2OF7A 4L5JA 3ZXSA 1YQAA 4AIHA 1HQCA 2M7AA 5IT9Z 4JX6A 5EEGA 5JI6A 3WTXC 1IDZA 2ECBA 3A01B 1W5SA 1V5GA 4ON0A 1XD7A 4IXAA 4FE4A 1YW9A 4FETA 3WTUC 2J5PA 1SFKA 5LRSA 2MC4A 3JRAA 4BE1A 3SDGA 2HQRA 2M7BA 2L7FP 5L3EA 1GT0C 2OCCH 3LQQA 5DM7F 3C2GA 3DKYA 4N4OB 2XASA 1FJLA 1HKTA 2DPDA 2R7UA 3KP2A 2AQEA 2EINH 3CC4I 4UUVA 3S1QJ 1OQYA 1YG2A 5DCFA 4HW0A 3D1NI 1FC3A 3MAJA 4H4KC 2NRAC 4ZYDA 3CO6C 4HQEA 3O6BB 3FK7A 1FIPA 1XG1A 3DBHB 3GF2A 1ZTRA 1LFPA 2L54A 1PUFB 1Y56A 2M1BA 2L0KA 1RC9A 4E7LA 4HNUA 1ZYRF 3MKZA 1I5ZA 3CO7C 1S8NA 3PQJA 4BNCA 2VXDA 1LPQA 5B5EC 1AWCA 2M87A 5GTIC 3ZMVA 2LTPA 2HGCA 2HOTA 3CCRI 4F93B 3H5AA 2V1UA 6PAXA 4XLNF 3SZTA 1MNEA 2VKHA 3TQNA 2B9SA 3E97A 2ISZA 5J1RA 1MZBA 1P7JA 2DODA 2VI6A 4DBRA 2A6EF 4YG2F 2BEOA 4JOMA 1R22A 5GP9A 3CDLA 2M5WA 3OYHA 3S2WA 1R00A 4YELA 1YO5C 1HDDC 1DGWY 5GPAA 4E7KA 3H92A 1OISA 3ZP5A 2ZMEA 4V19K 2VE8A 2ZKZA 3BT9A 3D5RC 3GTJJ 5F27A 5C4JJ 4RAZA 1JKOC 1KU9A 4BQOA 2VJIA 3ECOA 3HHGA 2DTZA 1PUEE 4XSZF 2HYGD 2DA3A 2UZKA 5IT9K 4MO7A 5A2QK 2VOPA 2ISYA 1BIAA 5JHUA 5H6QA 2WB1A 3CDIA 2QM3A 3H9GA 1O7FA 1ZLJA 2QSFX 2H94A 1IN5A 4L0YB 4A12A 1QHGA 3EUAA 1BIBA 2HR3A 1SMYF 1SVOA 3BG9A 5K7FA 3LSMA 2KP6A 3KLOA 5IP6A 4DYRA 1V54H 2PJRA 2WA0A 2HKOA 2F5DA 4HA8A 2EJRA 2FMYA 3BCAA 3N97A 1IUFA 2O8XA 3O8HA 3KYLA 2P4WA 4DZJA 1I3QJ 2COBA 1QBJA 2KPMA 3BC8A 1UG2A 2KFDA 2MLKA 2P7VB 2QF7A 1Z67A 4NC6A 4E70A 2DI3A 4LB5A 2NOJB 5K5OA 1QZEA 5E8IA 5FD6A 3BZCA 4UUSB 3K4CA 4MQVA 1ACIA 2NS8A 2R4GA 5DS9A 3EYIA 4Y52J 1P4XA 3SEZA 5FB2A 3DKWA 2R0QC 1P9QC 4HF2A 1Z7UA 2PX9A 4KIGA 5IYBJ 1WJEA 1F36A 1VQ7I 2VJJA 2HVQA 2V6CA 2CSOA 4AYBA 4LD5A 3GO5A 2MG4A 1BR1A 4ENNA 5LD2C 1SFXA 5KCMA 3H1CA 4QPQA 4BAYA 4OWRB 4EGZA 3BG7A 1UB9A 3DU5A 4LLGF 2ETHA 2OBPA 1QQIA 4I02A 5KVRA 3G4SI 3PIOF 3I4PA 2WBMA 3LSKA 1FMWA 1ORKA 2VC0A 3IUOA 3PQKA 3RQIA 2FD5A 2B63J 1ODDA 4IKFA 1E2XA 4OAYA 4AIKA 1R6RA 2V79A 3ISPA 2DOAA 2M4GA 3HRMA 1PJRA 1Z77A 3A4CA 3NWTA 1UELB 3BP8A 3CZ6A 2LKSA 2OUMA 1J75A 2QQ8A 2ELJA 2ZJPF 3EUHA 1EV7A 5JVTA 2WAEA 2ESNA 1WWXA 5TRDA 4ZYAA 4ITVA 2LC2A 2EH3A 1NH3A 2WY7Q 2VC1A 3SJMA 2L9NA 3GLLA 2FX0A 4HDVA 2FBKA 5J47A 2B7EA 1HBXG 5FLXZ 3B6AA 4C2UA 4ZZLA 5D4RA 3C2HA 2HFHA 1WRJA 1WZ2A 2AS5F 1WHUA 1EH6A 1IXCA 3H3VK 4GDFA 2ZXJA 3KIOA 5DEQA 4IZZA 4FCYA 1U5TC 1TWCJ 4U88A 2E19A 5FKKA 5IY5H 1O3TA 4DIQA 3M8JA 4LIUA 4Y3OA 2DAOA 4GO1A 4A3JJ 5HDGA 2Z33A 4XKVA 3C18A 1YX3A 2VQLA 3BZ6A 4UB6C 4EATA 3BLYA 4KIFA 4IQ4A 1L3LA 1X1CA 1X1DA 1IG7A 2VQCA 3QPTA 3Q5FA 1S5LC 2BY1A 2UXXA 1I39A 1T8IA 2DK8A 3L2QA 2YX4A 3M1CA 1GLNA 3V7SA 2A6TA 3SZGA 4E7JA 3DKXA 4PCQA 4NQWB 3TO9A 1O3QA 2XF7A 3ESWB 2DW4A 2ID6A 1SC7A 4M6YA 1YFHA 2I5UA 4IHXA 3ASOH 1FWZA 2LNBA 1UFMA 2ZFWA 4J01A 2GIVA 2HXIA 2Q2EA 2ZSHB 1TBXA 3LSIA 4ZDLA 1ETWA 1XS9A 3JAMK 2JN6A 1MH3A 2A5YB 1I27A 3BR1A 4QPOA 2E36A 4NB5A 4BHBA 2MH9A 4UV9A 2R7VA 1OFCX 4AM3A 4ZYHA 3JRHA 2BGCA 2NAZA 2HOAA 4B8XA 2CV1A 3KLNA 3S15J 2XKPA 2XB5A 2R5ZB 2IA2A 4BXUA 4D0PA 1YIJI 5FLXK 4ZC3A 3JSPA 3BPXA 4I6ZA 1OLTA 3HYIA 3I5UA 2DA6A 1D5VA 3FXKA 1QPIA 3Q0UA 5ICCA 1JHFA 4KA4A 1OR7A 4N9HA 4NNJA 3D0SA 1JKPC 3B02A 4HX7A 3MVPA 3PO3J 1MMGA 1IW7F 2V9KA 3CCYA 2YU9J 3Q0VA 3GXOA 1JTXA 4OIOF 2RV8A 4XOPA 3BTLA 3HOZJ 5HS9A 1B9MA 1GVDA 2M8EA 2ZXIA 4X0GA 1KYZA 4CO8A 1YI2I 2EZLA 2CH0A 5EF6A 2MD0A 1K61A 5AONA 1A5JA 2RAEA 4RMNA 1JUPA 1VNDA 3I58A 1ZHFA 3IAS2 1FSHA 2MGQA 1W36C 2RNJA 1SMTA 1ZELA 4KUMA 2Y9ZA 2IGKA 4UNOA 3GFLA 4C30A 1WJBA 4U0YA 1O3RA 2DK5A 5GAGJ 4KNYA 2L9RA 1IN6A 2DOEA 2XGEA 2EV0A 3FHZA 2A61A 1ZR4A 3CMYA 2EZIA 4AD9A 3QYEA 1LE8B 1FP2A 2IJLA 1YE9A 1OCPA 2Z1DA 5DYMA 5ERIA 2KIUA 3LA7A 5HDNA 1LNWA 2CGPA 1EH7A 1ZLKA 5M5WJ 3SFIA 1OCCH 4OU0A 2VQGA 3KPHA 4C3JJ 1LDKB 2Q0OA 2FMLA 2WADA 3OMYA 4G6QA 2D2WA 1JGSA 4JK1X 1Z0XA 4GFBA 3HOUJ 3BPVA 2FRHA 5HLIA 4ESFA 1VQNI 1SD5A 1WCMJ 1QVUA 5HVQC 2IS4A 4CYDA 1ITYA 3J80Z 2IRFG 1ULYA 4CCNA 1H0MA 2LK2A 1V3FA 1Z21A 1FOYA 3FHNA 1MDMB 2QYOA 1AOYA 1EF4A 1S7EA 5DD8A 2CRGA 4IQJA 3I54A 1PYVA 3HXLA 1FT9A 3FXQA 3BWGA 2ECCA 2LBFB 2FA5A 2DQLA 3G71I 1W1WE 5LHGA 1Z1DA 3B6CA 2ZJ2A 3MZYA 4XN3A 3DFGA 2E60A 2W25A 1FOWA 4I76A 4MQ9F 4PFOA 5FGMA 1VQMI 1HKQA 3K70C 2EFPA 3RCOA 2V9VA 3MZ8A 1P7IA 4RS8A 3RPQA 4PSXA 2IW5A 3FXJA 3G1OA 5F04A 2QKMB 1H9GA 4HOBA 1CF7B 3M9AA 5DTDA 1DQUA 5J1YA 2Z9OA 2LY2A 1W36D 5EZHA 1X2MA 5E3MA 2JA7J 3LOCA 1FNNA 2N8GA 4P5OA 4V2FA 3DU6A 3FBNB 2BVLA 3KZIC 4YRVA 1S6LA 3ZMDA 1DGRM 3BOQA 4QWQA 3OY9A 5LEKA 4M3BA 3N05A 1R58A 4M71A 1QPMA 1HSTA 4BE0A 1MMDA 3DTEA 5JVGF 2IA0A 1FMVA 4OMZA 1TZLA 4R79A 2JK3A 4A3FJ 3LA3A 4KICA 3FF5A 4Y15A 3W3CA 5LHHA 2PEXA 3DCFA 3SFZA 1E3OC 1ENHA 2DA1A 2ZXHA 3WHCA 3W2WA 2K86A 3K0LA 3Q0WA 2OA4A 4KN7X 2EB7A 2DOFA 4IRHA 4CCKA 4UB8C 3K4LA 5HLHA 3WTVC 4BQAA 3I3LA 2QSHX 3JCUC 1C0WA 3E5XA 4EJTA 2LF7A 3ZMUA 2BY0A 2A69F 1TNSA 1Y39A 2LLKA 3I0TA 2KDZA 2R7RA 4JP0A 1X19A 3P9KA 3CUQA 4ZZDA 4HF0A 5AIPA 1R36A 4EV0A 3S3MA 5F0FA 5TISC 1QNTA 1UHSA 1AKHA 1RNLA 3R6SA 2BE5F 1YJ9I 1AU7A 3CC7I 3ZQCA 4A6DA 4AC0A 3F21A 3OYKA 1G3TA 2YSRA 3WODF 4ZTFA 2K27A 5BS6A 3F6OA 2XAFA 3C7JA 3EDPA 1SFUA 2NOGA 2A3SA 1U8BA 2K5CA 2O5RA 2VBYA 4BHCA 2Y48A 5FRMA 3PSIA 4LJZF 3VSKA 4L9NA 1QU3A 3ZQFA 2TCTA 2CFXA 3OS2A 3JRIA 4PJ0C 3M07A 4XK4A 1DPRA 1REPC 1XSVA 4M9SA 1TT0A 2WC2A 3ZRGA 3TO7A 3L09A 2FBHA 2MSYA 4ZJZA 5FLVA 3WG7H 3HUGA 1J9IA 1MBEA 4P1WA 2EILH 3I4NJ 2XSJC 5J6XA 2DDAA 4YEJA 3W6JB 4X6AJ 4L0ZB 2WAFA 3EYYA 1FOKA 2IS2A 2UXNA 4L9TA 4EM0B 1HA8A 2STWA 4IHWA 4C2MJ 4Z2YA 3BG6A 2ME6A 2ZC2A 1Y0UA 4G7OF 3DPLC 3CMEI 1YHQI 4L9JA 2CFOA 2AXLA 4PK4A 3RKWA 4L9VA 3DWLE 4YIRX 1AKHB 3BZKA 4RGSA 3HIFA 3NEUA 1P4WA 5IYCJ 4IHTA 3RIRA 2CUFA 4HRIA 2F4OB 3NARA 1P92A 4IJAA 5DUKA 4C3IJ 2M9HA 2CQKA 1UAAA 1IN4A 2Z99A 2CW8A 2GOXB 4CDGA 1ZRDA 3M4OJ 1BI3A 2CWEA 2A6HF 2X48A 3DF8A 3PJRA 4KITB 1IRZA 2Y9YA 4NBQA 2K9SA 4CYCB 3H9JA 1VQKI 3CC2I 2XPWA 2M4KA 3ZOBA 4WXCA 1IRFA 4LG3A 4F55A 2HVRA 1GVJA 2X85A 1FZPB 3GFMA 3QRFF 1UHMA 3HOTA 4BJ6C 1ETXA 1BR2A 4GYGA 2CU7A 3GMEA 3PL8A 3LSGA 4OINF 2R7WA 3L2UA 1QGPA 1PDNC 2DN0A 3MD2A 5EG0A 4UUSA 2KRFA 1WH5A 2CS3A 3FKIJ 1ZK8A 2EA4A 3S17J 4BL0B 1TWAJ 2LVSA 3ABKH 2HDCA 3V8JA 3ZQIA 2PN6A 5ICFA 3DBRB 1KU2A 1XSXA 2I8DA 1VQPI 1LUJB 2VJ4A 4E7IA 4Y13A 3AAFA 3NQOA 5D4SA 3TL4X 1W5TA 3FM3A 3OYLA 4BJTA 3T8TA 1LDDA 2KIQA 3WGIA 4KT6A 2DFIA 4BKXA 4A0YA 1NG7A 5CKTA 1GV2A 4MTDA 1NG6A 3QQAA 4G7HF 1XPXA 2K40A 5BPIA 2HVSA 3CCLI 1JKRC 4BHPA 3A02A 1L0OC 4CUGA 1X58A 2XKOA 3JW4A 3OIOA 1R23A 1D1BA 2DBBA 3ZN1A 4BJ5C 5ILUA 1QA6A 4WWCA 5CPRB 2L01A 1IV8A 3C3WA 5FKLA 1Z3XA 4RM2A 4AYBN 5EEHA 5F6FA 2UUZA 1W0TA 1VZ0A 2HYJA 3IWFA 1W7PD 3FWEA 3CDHA 5CYVA 1CGPA 2KZVA 1YS6A 4XLCA 2CQ7A 4XM3A 1VFCA 2CQNA 1TL8A 4I0AA 4XIDA 1UHWA 2I10A 2HNHA 3QU3A 3TOAA 3ZR8X 1FYLA 2E7XA 3LSTA 4F7ZA 2COMA 4CCJA 3V8LA 1W4MA 1XGOA 3E5UA 5M3FJ 1MH4A 1JJ6C 1X4PA 1Q1VA 2F48A 4A0ZA 4BS9A 4IOAF 2R7QA 1I1SA 2PQ8A 4U7BA 2P6SA 3GUDA 1HW1A 3HEFA 4E7ZA 3CUOA 3GZ5A 4ZDOA 1X4OA 3IV5A 1YJNI 1MMNA 3WHBA 3G1LA 1HOMA 3JREA 2E5ZA 1NTCA 3PFIA 1V55H 2EZKA 3TP0A 4XONA 1OYWA 3Q9SA 3ZMZA 3ROUA 4HZFA 2ZMEC 3HTUA 2QGUA 1WJCA 2X6OA 2BBYA 4C3HJ 1U2WA 2AHQA 2JUCA 5D5UB 2JZYA 1EA3A 2W00A 3ASNH 1I3AA 3OS0A 4IHVA 1ETQA 3A03A 1YX5A 2E35A 4CSWA 2CO5A 3RZDJ 4XOTA 1P4AA 4L5EA 4D7NA 1R49A 3S1RJ 2K9NA 3TMOA 2Y2ZA 2K3PA 4A93J 1LKXA 3ZN0A 3HOSA 3LFUA 4A3MJ 2HTJA 4XLFA 4Y4RA 4MEXF 4MNUA 1Z7LA 2L9VA 1OCOH 2X51A 2HWVA 2O8KA 2EQRA 4A3BJ 3HRSA 3TBIA 2HDDA 3E7LA 4ZTJA 2GXBA 2X1CA 2E1NA 1WJ5A 4KJZA 1Z91A 3O8GA 2MA3A 5HNFA 1T0FA 4BDZA 3G1MA 1ZGWA 1VQ5I 4DOZA 1QVTA 1B1BA 4FASD 2NVTJ 3BY6A 4M3FA 3BROA 1TLHB 1N77A 2PBIA 3WGHA 2PMHA 3F8FA 3DP7A 2XV4S 3FXLA 2D1HA 2H27A 2CW0F 3GVAA 1SFEA 1JUSA 1W7PA 4HG2A 3GTLJ 4D1QA 2L7ZA 3VDXA 3HC7A 3P9CA 4HNTA 3SEQA 1JXSA 3Q3SA 1MBKA 1T0FC 1WGXA 2HTSA 4N9IA 3U21A 1YITI 5KAIC 1WI3A 4CICA 5LGNA 1O3SA 1U8RA 1E3PA 4LG0A 5GTHC 2OTJI 2EIMH 4A3EJ 2GXAA 3FK6A 3QAHA 4II3A 5KAFC 2E2IJ 2OC6A 4P9UA 2P5KA 2IGMA 2VBWA 3S2DJ 5CVIA 2CV0A 2E1MB 3SXYA 3OSFA 1KQ0A 3P9IA 3OV8A 4HF1A 1J2XA 2DTRA 5D6FA 1SAXA 2RNGA 3RPUD 4FT8A 2E7WA 1SD7A 1Y1WJ 4OIQF 2PFBA 2E71A 4M3EA 5DDGA 2M2EA 4M6XA 4XORA 3CMMA 5ICGA 1K78A 2VODA 2Y0SN 2EFQA 2VUMJ 1FTZA 3ML6A 1S9HA 2K7LA 2RC4A 1J09A 3QP5A 3CCMI 3GTMJ 5E8GA 3KEQA 5J1UA 1OPCA 3FDYA 2KQRA 1BW5A 2K02A 1U78A 1K6YA 2Y0SA 3WE2A 4HV5A 1WH7A 2MC3A 3QODA 4FHTA 1B72B 2ZFUA 2CV2A 3CCEI 1H89C 2LSOA 1XTAA 3QOPA 3TDZC 1MKMA 3IKTA 3QWLA 5H2FC 2Y0MA 3TW7A 1LFUP 3IAM2 4OOIA 4CA0A 3M8FA 1UMQA 3PFYA 3BTJA 2AQFA 3O2PE 3KX2A 1SD4A 1V4RA 4DZPA 3PUFA 1LDJA 1SANA 2B0LA 2GWRA 3CJRB 2EA2A 2QLZA 2ADUA 1R1TA 1VQOI 4G6DA 3G3ZA 2UWMA 2QVOA 2ZJRF 2XROA 3BR3A 3AL0C 3IC7A 1MD0A 2UV1A 5B66C 2VN2A 3E1SA 2VLAA 1M1EB 2OU2A 1EJ9A 1IZ1A 3ELKA 4YFKF 2OQGA 2VIXA 3MZHA 5E3NA 3GFJA 3RKXA 3OYBA 2ZNYA 2PG4A 3RI4A 2BXYA 3RJPA 1MMAA 2LF8A 1YIOA 4F91B 4MLOA 2JRMA 1G3SA 1TW2A 2GIZA 2Z2SB 1WSUA 2R92J 4KYWA 4PUSA 3F8MA 1MJ9A 3E6BA 4B4CA 4Z6YA 2NNYA 2DXIA 1ERDA 5HS7A 1DP7P 1B8IA 3EUHC 3IH4A 3H5RA 3M3YJ 1GV5A 2BZTA 2Y75A 2JTVA 5D6EA 4AVZA 2YPRA 3MEXA 2V9PA 2V6EA 4H0EA 3HB9A 2R7DA 2L2OA 4U0VA 2P8TA 1WJFA 1G2HA 1JUMA 2Q8KA 1USTA 3BCBA 1UJ8A 3DEWA 4JX5A 5GADJ 2F2EA 2DO7A 2JSCA 4II2A 5D8LB 1BOBA 4DW6A 3H0GJ 4MHGA 2KL4A 1IXSB 2ZXWH 1X3WB 2DCEA 2VT2A 4ENJA 5TGTA 1R5GA 4HBLA 4WXHA 2XAJA 3NAUA 4EQQA 2VJ5A 1IN7A 2TDXA 1IC8A 3HOWJ 1Z3YA 2K9MA 3FIWA 2QA4I 1S7OA 1T6SA 1R4MB 1X3ZB 4M73A 2GZWA 4PDKA 2W85A 3CP2A 4R8HA 2FU4A 3G73A 2M34A 3SQNA 2BW3A 1WKMA 2JA5J 3MMYB 5FLMJ 3PNVA 2H1LA 1Z05A 1ZGAA 4EEFG 2VE9A 3LA2A 3OYIA 1K83J 4HSRA 1GUUA 4IHYA 1B6AA 3RTRA 2XDVA 4JYKA 3L2RA 1PUFA 3LSPA 5L3BA 3DV8A 2HXOA 3U2RA 1HF0A 1FPQA 4FISA 5GAHJ 5C3EJ 4I09A 2E34A 1D1AA 1T08B 1FBUA 2RGVA 3LQRA 4P96A 5HODA 3EQLF 3IWZA 2LFBA 2VBXA 4BH9A 4FE7A 5FFZA 2ZJQF 4DYQA 3KP6A 4B1RA 4W1UA 2OAZA 4S04A 4I7HA 1ETVA 1B4AA 2F4MB 1WVRA 2NS7A 3EETA 4D5FA 4BQNA 4PJNA 3ZMTA 3HTSB 3HSEA 5L3GA 3WTWC 3VFZA 2HOEA 1U9OA 3PO2J 4JQFA 1X1AA 1BI1A 3BR6A 4XNFA 4PJJA 2OTLI 3F22A 1S7AA 2H6CA 1NK3P 4IRIA 2FQ3A 3K1MA 2QKLB 1RZ4A 3ECHA 3FMRA 3LSJA 3ZQGA 2R7FA 3GW2A 2K4BA 2A05A 4PGHA 4PJMA 1J7KA 4XLAA 1MJAA 4BEHA 4J00A 1CQTA 1D0YA 3FMSA 3ZQQA 1VQ8I 2JPCA 5FRNA 4GYIA 1BJAA 2YX7A 1QO0D 4BDYA 3I4MJ 4EMSA 1YOVB 2QCOA 3RKYA 4U87A 1STZA 3HG9A 4RB2C 3MKWB 2V4JC 3K1PA 4KFCA 3B73A 2NNNA 3RPUA 5F1JA 4A3DJ 2RREA 2DA5A 2PMZN 3F23A 2DMPA 3F8NA 2KJCA 4YFXF 4IL6C 1ZREA 5E3LA 2IBDA 1T2KA 1FBSA 1I6XA 1XGMA 1JGGA 1BI0A 2LY1A 2A68F 1YTYA 3A1YA 3GWZA 5EG0B 1TTYA 2K9QA 3H36A 4W97A 2F4IA 3RYPA 3PUBA 3MCZA 1ZN2A 2V1XA 5IPAA 3AG4H 3PIPF 3J7ZI 1LQ1A 2HDWA 2Z16A 4XLPF 3HOVJ 2KDOA 2H8WA 1R5HA 2Y69H 5KNLA 2VT3A 2LYCA 4A0XA 3RZOJ 3H3UA 1R7JA 3QU6A 2W57A 2MYSA 5DV5A 4UVAA 2XVCA 2GQQA 4DQ2A 3P5JA 5B1AH 3ZQLA 3HRUA 4XRSA 2D5VA 3F6VA 2R7SA 3KP3A 1KZHA 2DLLA 2LMDA 3K4JA 1P2FA 4UV8A 1WI9A 3OYJA 1OCTC 3OR1C 2QQAA 4UVBA 4L5IA 5FD5A 4XQFA 4IX7A 4LK0F 2MH2A 3HDDA 4HSTA 2EIJH 1K4TA 1RKWA 4CHUA 5A2QZ 4WXDA 4E7SA 3UKGA 2DMNA 2R3SA 2ICWG 2NVUB 2WB1N 2BY2A 3QP6A 3KFWX 4ZYEA 2LH9A 3VWBA 3OYCA 2KJBA 4U0WA 3K2ZA 2LD5A 1TT5B 2HZTA 1I6HJ 1MGTA 2JMWA 5D8KB 3HSRA 2EBIA 1FYKA 2Q2EB 4B43A 3CJNA 5BQTA 3CCJI 2P5LC 3CLQA 5FKOA 4G94A 4B3XA 4F52A 4UXNA 1PP7U 2KRCA 3UNGC 1R1VA 2XGXA 3CP8A 2EFWA 2KZGA 1RPWA 4HAMA 3GTQJ 3H35A 1LVAA 3F0CA 1ETKA 1SAUA 4MGRA 1OYIA 3FXOA 3ZCOA 2GM4A 4A3CJ 1F9NA 4Q4ZF 5H6RA 2OZUA 3HOXJ 2XPVA 4PGGA 4LB6B 3OS1A 1ETOA 1Q1HA 3E6CC 1BI2A 2MD5A 3KP4A 2F5FA 3CUQB 4MEYF 3VYTB 3OL3A 3I71A 3BR5A 3ABTA 3WTZA 2JSPA 4RAGA 3WG9A 2DFFA 1A36A 3DEEA 2OZ6A 2G0EA 3RQ4A 1S29A 1B59A 3RSNA 2QEXI 3FXMA 3S32A 2HOSA 1IRGA 3WU1B 3AG2H 3CCVI 3T8RA 4I0BA 5IP9J 1YJWI 2BV6A 2P81A 2VXZA 1D0XA 4EJOA 3EUKL 5K5RA 4DGWB 2CJJA 2XIGA 3OIQA 5L3FA 2TRTA 2LY9A 2DMQA 3KCCA 2E1MC 5LGTA 1IRXA 2IVMA 3GTOJ 4BXXJ 2L02A 4A6EA 3FX3A 3RYRA 4BGDA 2EZHA 3DLAA 3R0JA 3SHFA 3K69A 1FBQA 5JHFA 1ZG5A 3S8PA 2XAGA 4LGWA 1R5ID 3M8EA 3S16J 3MFKA 4CZZA 5EGOB 3W6KB 1YW8A 1N25A 1LEAA 5HDKA 4WK8F 1ZAOA 4RB0A 2GA1A 5D5WB 1LEBA 2M0MA 4XN0A 4C2TA 2V1DA 3P7NA 3HSFA 2JA2A 5CVRA 3BG3A 2VL8A 1FTTA 1JJ8C 2LKXA 3F9KA 3GZNB 3DBLB 3PNTA 1K79A 3KP7A 1MBHA 4RGUA 2ZO4A 3IP4B 1SVMA 2HU9A 1K4SA 4S05A 2FJ1A 1N78A 3BDDA 1O57A 2NVQJ 3MN2A 3RKQA 4D5CA 1B8IB 1IXRC 3OYFA 3S1NJ 1OYYA 2P7CB 4P55A 5CVJA 3OSGA 5F08A 3ERMA 1VI0A 3HBLA 3COAC 2V26A 1VQ9I 4L18B 3OWTA 1BOAA 1D8JA 4R1HA 4PJLA 2BXZA 2HS5A 3R0AA 2BHZA 2ELKA 3BTCA 3LWFA 3REOA 1BL0A 4HLXA 1OCZH 4A3GJ 4NUBA 1ON2A 5C44J 4CGZA 2V1NA 2K9LA 3L2VA 2CW7A 1FP1D 5E18F 4MIMA 1JI8A 2CUZA 4KN4X 5ILVA 3V7RA 1OCRH 4BYYA 5J3LA 1IUYA 2ID3A 1IJWC 1IO2A 3DEUA 3TOBA 3L9FA 1R71A 1RESA 1TNTA 3PM1A 3W2VA 2JQ7A 1FY7A 3HHHA 1JT0A 3E6MA 5IP7J 4BUPA 4GRIA 2R7XA 4M9ZA 3DLLF 1MBGA 3FM5A 5K1YA 4MFDA 2R5YA 2E5NA 3MKLA 1VTNC 1MW7A 5M5XJ 1D8KA 1XCVA 2HEOA 1HXDA 5J4YA 4AUXA 3S3OA 4HLYA 3VYRB 2YUSA 3V42A 3KP5A 4DYCA 4ENMA 1B72A 2FOWA 1T33A 4PSWA 3A0BC 4UUTA 4A5MA 2ACJA 2E1CA 2JRTA 3GTKJ 2DYRH 3CCUI 3U1DA 3CCQI 5JLWA 1ZG3A 4XLHA 5FFXA 3VSLA 4X1EA 1TW3A 1MJBA 1Z9CA 4RA2A 2DT5A 2IGOA 1TWFJ 3CUQC 2DFHA 4EJWA 1D5YA 2XSDC 1POGA 2FXAA 2BHYA 3K70D 4PZJA 2MLGA 3I64A 4O3MA 3AG1H 4BBRJ 2H1KA 3FMQA 1FEXA 4XL9A 1ZR2A 5E3OA 2WY8Q 1G4DA 1WJAA 5AIQA 3CCSI 3G2BA 3LAPA 2BY3A 2PLYA 1HW5A 1G3YA 3L2CA 2QZ8A 2FEZA 3GLXA 2XC7A 4ABZA 2L7KA 2LKPA 2KIMA 3K1NA 4LIVA 1QZYA 3Q9VA 3I59A 4XKCA 2KRHA 3JRCA 2M3AA 4GCVA 2KKOA 3HM5A 4GXOA 4ZYGA 4ESBA 5J40A 1X1BA 1YYVA 4CH7A 4RDUA 3V8KA 1X3UA 1U0JA 5LLQA 1XDSA 2WV0A 3FXUA 2O7OA 2O3FA 4PFPA 4DJAA 1MDMA 2K85A 1R9TJ 2OQRA 3TKYA 3TW6A 3V4GA 2ZNZA 3VYUB 5CQGA 2DMTA 2IT0A 3I53A 4BQQA 4IHSA 2V7FA 4M3DA 3QPSA 2F6CA 1ZKGA 2ESHA 4RM3A 5EDNA 3TEDA 3K9TA 4QIWN 3F72A 2XAUA 3ZQ7A 3UR3C 5JFRA 3WU0A 2EV6A 2X4HA 1XMXA 3HZJA 2LOOA 3CF2A 2XF6A 3E5QA 2CMPA 3X2QH 5BNGA 3ZMSA 4YIFA 2H09A 2VB6A 3SDBA 4EJUA 3V7CA 3EPZA 1Y6IA 2Z5UA 3KYDB 4BXFA 2O61A 4IOCF 1U9NA 2NS0A 2VPRA 3I9V2 2CQXA 1MBFA 3HPHA 1KGSA 3J81K 1RR8C 1KU7A 2MABA 2MFZA 2VKEA 2L3DA 1Z6RA 1K7AA 3J81Z 3D5LA 5BOXA 4XRSG 2RQQA 3GTGJ 2HQAA 1UCRA 4AIDA 3IRQA 4ANJA 1RI7A 2E2HJ 3L00A 3S14J 4NDLA 3CF5F 2H6BA 1KU3A 2G7HA 4B48A 3J7YJ 1Z6TA 2Y31A 2BOLA 4A69C 3BG5A 2M0CA 3H9QA 4Y7NJ 2EPFA 5TJJA 4EM2A 5D5VB 3J7AO 3CESA 3WTSC 4WF2A 1X2NA 5ILSA 2A5WA 2O6GE 2Z3YA 2E2JJ 4DNCA 2R93J 5EGOA 1T98A 2DPUA 3IH3A 1JE8A 4XICA 1KQ8A 3A0HC 4JBAA 3K4MA 5IYDJ 1A6IA 2LREA 4M3GA 3KETA 4NQWA 1TWGJ 2EK5A 2WWYA 1DP3A 4XRMA 4KISA 5JR3A 3QPHA 2KISA 5CJ9A 4BEHB 2JA8J 4IRGA 4M6VA 3ZQHA 1XCBA 3LMMA 4HX4A 4BU2A 3K6GA 3I56I 1GDTA 5FKNA 4MFEA 3ABMH 2EV5A 3S2HJ 1PP8F 1IV6A 2HYFA 3FXRA 4HPQA 2GLOA 2HQNA 2XB0X 2JVGA 4LITA 1XMKA 4ZDPA 5JLXA 1MSEC 2AXTC 1NHAA 2ZBKA 3IRRA 2D1VA 1FLIA 2VASA 3ERED 2F5EA 5E1WA 4WX9A 4KMUX 1WPKA 3ZGKA 4CCOA 3CTAA 1BC7C 2WTEA 1H8AC 5B3SH 5IOYA 3A01A 3HOYJ 5LFAA 2IA1A 2HPMA 1PVEA 4E4HA 1S72I 2EWNA 4HEA2 2CUJA 4ETSA 3L1PA 2R7OA 3BR2A 1FYMA 1I50J 4FX0A 2GBYA 4RB3C 4I2OA 2BVMA 2QQBA 1FSEA 3QPLA 4HQMA 4LFUA 4LMYA 1DPUA 1FIAA 3WTTC 1FOXA 4BBSJ 4JX4A 2XUBA 2HQ5A 3O3KA 3AG3H 1BR4A 4CXFA 2C6YA 3CJTB 1QZZA 1DUXC 1A31A 1HC8A 4Y17A 4ZH4F 3CD6I 2PMUA 1OKRA 5DM6F 3U1KA 2FNAA 2GAUA 4FX4A 3OYEA 2YR2A 3E3VA 2IS6A 5B1BH 1DU6A 2DJIA 4XLEA 4E7HA 2CG4A 5M3MJ 1GXPA 5E17F 2OV7A 3ONQA 2XPUA 4Q48A 5J8CA 1AA7A 2IXSA 3R61A 2VOOA
chains in the Genus database with same CATH topology
5IPAA 1AKHB 2E1OA 1VF9A 5K7ZA 4FTHA 3HOVJ 5IYCJ 3JR9A 2IEKA 2CUFA 2LTPA 2HOTA 3NARA 3RZOJ 4C3IJ 2M9HA 3C2BA 2OPTA 3ZQLA 2D5VA 4XRSA 5J1RA 1P7JA 3JRGA 2VI6A 3M4OJ 2X48A 1OCTC 4BY7J 3TP3A 5GP9A 2XGDA 3CDLA 2Y9YA 1IRZA 2K9SA 1HDDC 4CYCB 5GPAA 2ZB9A 3GBGA 2XPWA 3BQZA 1IDYA 3ZOBA 1RKTA 3HDDA 3BT9A 3GTJJ 5F27A 2LR8A 5C4JJ 1RKWA 1JKOC 3UKGA 1JTYA 2DJNA 2DMNA 1ETXA 2DTZA 2WB1N 2CU7A 2DA3A 3LSGA 4MO7A 1SFOJ 2DN0A 4UUSA 5EG0A 2LD5A 1WH5A 3FKIJ 1ZK8A 3S17J 1I6HJ 2JMWA 1TWAJ 2LVSA 2EBIA 3ZQIA 1HCRA 2MW8A 3BG9A 5M5YJ 5FKOA 5K7FA 1MBJA 5IP6A 4DYRA 1IGNA 3JRFA 1RPWA 3GTQJ 2DA4A 3F0CA 1ETKA 4BKXA 2VKVA 4QSHA 1IUFA 5K7HA 3O8HA 1GV2A 2GM4A 3QQAA 1I3QJ 4DZJA 2COBA 4A3CJ 2K40A 2XGCA 1UG2A 2QF7A 3HOXJ 2XPVA 1BJZA 1JKRC 1JT6A 3A02A 1ETOA 1X58A 3OIOA 1AHDP 3BR5A 4UUSB 2NS8A 5FKLA 5DS9A 4Y52J 4AYBN 4A3LJ 2R0QC 1W0TA 2G0EA 2HYJA 2HOSA 5IYBJ 1F36A 5IP9J 3JRBA 2P81A 1TWHJ 1APLC 2R5ZA 2CJJA 2MG4A 1VFCA 5EZGA 2TRTA 2LY9A 2DMQA 4XIDA 2I10A 4LOCA 5C4XJ 3BR0A 3GTOJ 4BXXJ 3IH2A 2EZHA 4G12A 5M3FJ 1MH4A 1JJ6C 1Q1VA 3S16J 5EGOB 3HEFA 2YS9A 1ORKA 2HI3A 3RQIA 3IV5A 3WHBA 2FD5A 3G1LA 2B63J 1HOMA 3JREA 1NTCA 2NVXJ 2JWTA 2R7ZJ 2EZKA 3TP0A 3BG3A 1FTTA 1JJ8C 2LKXA 1O4XA 1Z77A 2FQ4A 3OOUA 2X6OA 4C3HJ 2AHQA 1MBHA 4IHVA 1ETQA 2FJ1A 3A03A 4QTRA 3RZDJ 2NVQJ 2EH3A 3SJMA 3MN2A 1Y1VJ 2FX0A 4L5EA 3RKQA 4D5CA 4D7NA 1B8IB 3S1NJ 2M8GX 1F43A 4J19A 3S1RJ 3OSGA 2K9NA 2Y2ZA 3B6AA 5F08A 1VI0A 3HBLA 4A93J 3HGYA 4A3MJ 5EYRA 3H3VK 2ELKA 3BTCA 1BL0A 4FCYA 2ME0A 2O8KA 2EQRA 4A3BJ 1TWCJ 4A3GJ 2E19A 5FKKA 5C44J 2HDDA 3E7LA 4A3JJ 1JKQC 1BW6A 2O9LA 3O8GA 4MIMA 5EEAA 3G1MA 1ZGWA 3LSRA 1QVTA 5J3LA 1IG7A 2ID3A 2NVTJ 1IJWC 3S1MJ 4M3FA 1RESA 2CQQA 3PM1A 1H88C 2XRLA 1JT0A 5IP7J 1JUSA 3GTLJ 1ETYA 2L7ZA 3K7AJ 1MBGA 4MFDA 2Y30A 3MKLA 2ID6A 3VPRA 2R5YA 2R5YB 5M5XJ 4AUXA 3Q3SA 1MBKA 4IHXA 1WGXA 2YUSA 1QRYA 4DYCA 1LE8A 1WI3A 1B72A 1LFBA 2HXIA 1T33A 4UUTA 3BTIA 3GTKJ 4A3EJ 1ETWA 3FK6A 1XS9A 2E2IJ 3GTPJ 2JN6A 1MH3A 3BQYA 5JLWA 3BR1A 3S2DJ 3OSFA 1OFCX 4X1EA 3JRHA 1MSFC 2HOAA 2DMUA 1TWFJ 1Y1WJ 3S15J 2XB5A 2R5ZB 1D5YA 4M3EA 2XSDC 1POGA 2M2EA 3CQZJ 4I6ZA 2DA6A 2Y0SN 1QPIA 4BBRJ 3Q0UA 2H1KA 2VUMJ 1FEXA 1FTZA 1ZR2A 5E3OA 3GTMJ 1JKPC 5J1UA 3MVPA 3PO3J 3CCYA 2YU9J 3Q0VA 1JTXA 1BW5A 3BTLA 3HOZJ 1U78A 1GVDA 1WH7A 4ABZA 1YRNA 1RETA 2EZLA 5EF6A 1K61A 1B72B 5IOZA 3JRCA 1A5JA 2RAEA 3HM5A 1H89C 1JUPA 3JRDA 1VNDA 2MGQA 4RDUA 3TW7A 1LFUP 2Y9ZA 1UMQA 2O7OA 2LP0A 3BTJA 2L9RA 2XGEA 1ZR4A 1T56A 3CMYA 2EZIA 1R9TJ 4DZPA 1LE8B 3TW6A 1SANA 1OCPA 2DMTA 5FKMA 4D7MA 4M3DA 5F0CA 5F0HA 3QPSA 3BR3A 1ZKGA 2L7MP 5EDNA 1MNMC 4RBOA 3TEDA 5M5WJ 3LNQA 4QIWN 3SFIA 4C3JJ 4B3AA 1RR7A 5GPCA 5E3NA 3K2AA 5BNGA 1Z0XA 4GFBA 3HOUJ 1HDPA 4MLOA 1WCMJ 1QVUA 1ITYA 4BY1J 2R92J 1U9NA 2VPRA 2LK2A 2CQXA 4B4CA 1MBFA 2AO9A 2DA7A 1S7EA 4S0HB 1EF4A 2CRGA 1B8IA 4V2GA 3IH4A 3M3YJ 2ECCA 2VKEA 1GV5A 2WAQN 2DA2A 3B6CA 4HNVA 4XRSG 3GTGJ 4I76A 3HB9A 2IAIA 1G2HA 1JUMA 2E2HJ 3DEWA 1P7IA 4JX5A 3S14J 3G1OA 1BA5A 4NDLA 5F04A 1OJLA 1ZQ3P 5DTDA 2Y31A 4DW6A 3H0GJ 4A69C 5J1YA 3BG5A 2M0CA 4Y7NJ 4CYCA 5EZHA 1X2MA 5E3MA 1TC3C 2JA7J 9ANTA 2WV1A 1X2NA 3NAUA 4A3KJ 3LOCA 3HOWJ 1IC8A 2N8GA 3FIWA 4V2FA 2E2JJ 2R93J 5EGOA 3IH3A 4XICA 2W48A 1DU0A 5IYDJ 4M3BA 2M34A 1A6IA 1HLVA 4M3GA 1TWGJ 2JA5J 4XRMA 4A3IJ 2H8RA 5FLMJ 2X9DA 4EEFG 2JA6J 2JK3A 1NK2P 4A3FJ 1K83J 3HGGA 2JA8J 1GUUA 4IHYA 4M6VA 3ZQHA 1PUFA 4JYKA 5FJ8J 3DCFA 3LSPA 1YRNB 1E3OC 1GDTA 2HXOA 5FKNA 1ENHA 3W6VA 4MFEA 2DA1A 1HF0A 2NVYJ 3WHCA 4FISA 5C3EJ 2KT0A 3HKZN 3Q0WA 3S2HJ 1W0UA 1IV6A 2GLOA 2XB0X 5HODA 2LFBA 3FISA 1XC5A 5JLXA 4FE7A 1MSEC 4DYQA 4IEJA 4B1RA 2LLKA 4W1UA 2KDZA 1ETVA 2CUEA 4JP0A 4D5FA 2NS7A 2JJ7A 1WPKA 5F0FA 1H8AC 1UHSA 1AKHA 5IOYA 1AU7A 1U9OA 3A01A 3ZQCA 3HOYJ 3PO2J 4AC0A 3BR6A 3L1PA 3BR2A 1NK3P 2OF7A 1I50J 2GBYA 3ZQGA 3LSJA 2NOGA 1U8BA 4JX6A 1IDZA 2ECBA 3QPLA 3A01B 1CQTA 1FIAA 3ZQFA 4FE4A 2TCTA 4BBSJ 3JRIA 4JX4A 4XK4A 2HQ5A 3I4MJ 3JRAA 3SDGA 2QCOA 2L7FP 1GT0C 1FJLA 5F1JA 4A3DJ 2MSYA 5FLVA 2DA5A 2PMZN 1MBEA 3S1QJ 2DMPA 3I4NJ 3D1NI 5E3LA 2IBDA 4X6AJ 1DU6A 3FK7A 1FIPA 1JGGA 5M3MJ 1XG1A 4IHWA 4C2MJ 5EG0B 2XPUA 2K9QA 2ME6A 1ZTRA 1PUFB 4W97A 2L0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IPA A;  1AKH B;  2E1O A;  1VF9 A;  5K7Z A;  4FTH A;  3HOV J;  5IYC J;  3JR9 A;  2IEK A;  2CUF A;  2LTP A;  2HOT A;  3NAR A;  3RZO J;  4C3I J;  2M9H A;  3C2B A;  2OPT A;  3ZQL A;  2D5V A;  4XRS A;  5J1R A;  1P7J A;  3JRG A;  2VI6 A;  3M4O J;  2X48 A;  1OCT C;  4BY7 J;  3TP3 A;  5GP9 A;  2XGD A;  3CDL A;  2Y9Y A;  1IRZ A;  2K9S A;  1HDD C;  4CYC B;  5GPA A;  2ZB9 A;  3GBG A;  2XPW A;  3BQZ A;  1IDY A;  3ZOB A;  1RKT A;  3HDD A;  3BT9 A;  3GTJ J;  5F27 A;  2LR8 A;  5C4J J;  1RKW A;  1JKO C;  3UKG A;  1JTY A;  2DJN A;  2DMN A;  1ETX A;  2DTZ A;  2WB1 N;  2CU7 A;  2DA3 A;  3LSG A;  4MO7 A;  1SFO J;  2DN0 A;  4UUS A;  5EG0 A;  2LD5 A;  1WH5 A;  3FKI J;  1ZK8 A;  3S17 J;  1I6H J;  2JMW A;  1TWA J;  2LVS A;  2EBI A;  3ZQI A;  1HCR A;  2MW8 A;  3BG9 A;  5M5Y J;  5FKO A;  5K7F A;  1MBJ A;  5IP6 A;  4DYR A;  1IGN A;  3JRF A;  1RPW A;  3GTQ J;  2DA4 A;  3F0C A;  1ETK A;  4BKX A;  2VKV A;  4QSH A;  1IUF A;  5K7H A;  3O8H A;  1GV2 A;  2GM4 A;  3QQA A;  1I3Q J;  4DZJ A;  2COB A;  4A3C J;  2K40 A;  2XGC A;  1UG2 A;  2QF7 A;  3HOX J;  2XPV A;  1BJZ A;  1JKR C;  1JT6 A;  3A02 A;  1ETO A;  1X58 A;  3OIO A;  1AHD P;  3BR5 A;  4UUS B;  2NS8 A;  5FKL A;  5DS9 A;  4Y52 J;  4AYB N;  4A3L J;  2R0Q C;  1W0T A;  2G0E A;  2HYJ A;  2HOS A;  5IYB J;  1F36 A;  5IP9 J;  3JRB A;  2P81 A;  1TWH J;  1APL C;  2R5Z A;  2CJJ A;  2MG4 A;  1VFC A;  5EZG A;  2TRT A;  2LY9 A;  2DMQ A;  4XID A;  2I10 A;  4LOC A;  5C4X J;  3BR0 A;  3GTO J;  4BXX J;  3IH2 A;  2EZH A;  4G12 A;  5M3F J;  1MH4 A;  1JJ6 C;  1Q1V A;  3S16 J;  5EGO B;  3HEF A;  2YS9 A;  1ORK A;  2HI3 A;  3RQI A;  3IV5 A;  3WHB A;  2FD5 A;  3G1L A;  2B63 J;  1HOM A;  3JRE A;  1NTC A;  2NVX J;  2JWT A;  2R7Z J;  2EZK A;  3TP0 A;  3BG3 A;  1FTT A;  1JJ8 C;  2LKX A;  1O4X A;  1Z77 A;  2FQ4 A;  3OOU A;  2X6O A;  4C3H J;  2AHQ A;  1MBH A;  4IHV A;  1ETQ A;  2FJ1 A;  3A03 A;  4QTR A;  3RZD J;  2NVQ J;  2EH3 A;  3SJM A;  3MN2 A;  1Y1V J;  2FX0 A;  4L5E A;  3RKQ A;  4D5C A;  4D7N A;  1B8I B;  3S1N J;  2M8G X;  1F43 A;  4J19 A;  3S1R J;  3OSG A;  2K9N A;  2Y2Z A;  3B6A A;  5F08 A;  1VI0 A;  3HBL A;  4A93 J;  3HGY A;  4A3M J;  5EYR A;  3H3V K;  2ELK A;  3BTC A;  1BL0 A;  4FCY A;  2ME0 A;  2O8K A;  2EQR A;  4A3B J;  1TWC J;  4A3G J;  2E19 A;  5FKK A;  5C44 J;  2HDD A;  3E7L A;  4A3J J;  1JKQ C;  1BW6 A;  2O9L A;  3O8G A;  4MIM A;  5EEA A;  3G1M A;  1ZGW A;  3LSR A;  1QVT A;  5J3L A;  1IG7 A;  2ID3 A;  2NVT J;  1IJW C;  3S1M J;  4M3F A;  1RES A;  2CQQ A;  3PM1 A;  1H88 C;  2XRL A;  1JT0 A;  5IP7 J;  1JUS A;  3GTL J;  1ETY A;  2L7Z A;  3K7A J;  1MBG A;  4MFD A;  2Y30 A;  3MKL A;  2ID6 A;  3VPR A;  2R5Y A;  2R5Y B;  5M5X J;  4AUX A;  3Q3S A;  1MBK A;  4IHX A;  1WGX A;  2YUS A;  1QRY A;  4DYC A;  1LE8 A;  1WI3 A;  1B72 A;  1LFB A;  2HXI A;  1T33 A;  4UUT A;  3BTI A;  3GTK J;  4A3E J;  1ETW A;  3FK6 A;  1XS9 A;  2E2I J;  3GTP J;  2JN6 A;  1MH3 A;  3BQY A;  5JLW A;  3BR1 A;  3S2D J;  3OSF A;  1OFC X;  4X1E A;  3JRH A;  1MSF C;  2HOA A;  2DMU A;  1TWF J;  1Y1W J;  3S15 J;  2XB5 A;  2R5Z B;  1D5Y A;  4M3E A;  2XSD C;  1POG A;  2M2E A;  3CQZ J;  4I6Z A;  2DA6 A;  2Y0S N;  1QPI A;  4BBR J;  3Q0U A;  2H1K A;  2VUM J;  1FEX A;  1FTZ A;  1ZR2 A;  5E3O A;  3GTM J;  1JKP C;  5J1U A;  3MVP A;  3PO3 J;  3CCY A;  2YU9 J;  3Q0V A;  1JTX A;  1BW5 A;  3BTL A;  3HOZ J;  1U78 A;  1GVD A;  1WH7 A;  4ABZ A;  1YRN A;  1RET A;  2EZL A;  5EF6 A;  1K61 A;  1B72 B;  5IOZ A;  3JRC A;  1A5J A;  2RAE A;  3HM5 A;  1H89 C;  1JUP A;  3JRD A;  1VND A;  2MGQ A;  4RDU A;  3TW7 A;  1LFU P;  2Y9Z A;  1UMQ A;  2O7O A;  2LP0 A;  3BTJ A;  2L9R A;  2XGE A;  1ZR4 A;  1T56 A;  3CMY A;  2EZI A;  1R9T J;  4DZP A;  1LE8 B;  3TW6 A;  1SAN A;  1OCP A;  2DMT A;  5FKM A;  4D7M A;  4M3D A;  5F0C A;  5F0H A;  3QPS A;  3BR3 A;  1ZKG A;  2L7M P;  5EDN A;  1MNM C;  4RBO A;  3TED A;  5M5W J;  3LNQ A;  4QIW N;  3SFI A;  4C3J J;  4B3A A;  1RR7 A;  5GPC A;  5E3N A;  3K2A A;  5BNG A;  1Z0X A;  4GFB A;  3HOU J;  1HDP A;  4MLO A;  1WCM J;  1QVU A;  1ITY A;  4BY1 J;  2R92 J;  1U9N A;  2VPR A;  2LK2 A;  2CQX A;  4B4C A;  1MBF A;  2AO9 A;  2DA7 A;  1S7E A;  4S0H B;  1EF4 A;  2CRG A;  1B8I A;  4V2G A;  3IH4 A;  3M3Y J;  2ECC A;  2VKE A;  1GV5 A;  2WAQ N;  2DA2 A;  3B6C A;  4HNV A;  4XRS G;  3GTG J;  4I76 A;  3HB9 A;  2IAI A;  1G2H A;  1JUM A;  2E2H J;  3DEW A;  1P7I A;  4JX5 A;  3S14 J;  3G1O A;  1BA5 A;  4NDL A;  5F04 A;  1OJL A;  1ZQ3 P;  5DTD A;  2Y31 A;  4DW6 A;  3H0G J;  4A69 C;  5J1Y A;  3BG5 A;  2M0C A;  4Y7N J;  4CYC A;  5EZH A;  1X2M A;  5E3M A;  1TC3 C;  2JA7 J;  9ANT A;  2WV1 A;  1X2N A;  3NAU A;  4A3K J;  3LOC A;  3HOW J;  1IC8 A;  2N8G A;  3FIW A;  4V2F A;  2E2J J;  2R93 J;  5EGO A;  3IH3 A;  4XIC A;  2W48 A;  1DU0 A;  5IYD J;  4M3B A;  2M34 A;  1A6I A;  1HLV A;  4M3G A;  1TWG J;  2JA5 J;  4XRM A;  4A3I J;  2H8R A;  5FLM J;  2X9D A;  4EEF G;  2JA6 J;  2JK3 A;  1NK2 P;  4A3F J;  1K83 J;  3HGG A;  2JA8 J;  1GUU A;  4IHY A;  4M6V A;  3ZQH A;  1PUF A;  4JYK A;  5FJ8 J;  3DCF A;  3LSP A;  1YRN B;  1E3O C;  1GDT A;  2HXO A;  5FKN A;  1ENH A;  3W6V A;  4MFE A;  2DA1 A;  1HF0 A;  2NVY J;  3WHC A;  4FIS A;  5C3E J;  2KT0 A;  3HKZ N;  3Q0W A;  3S2H J;  1W0U A;  1IV6 A;  2GLO A;  2XB0 X;  5HOD A;  2LFB A;  3FIS A;  1XC5 A;  5JLX A;  4FE7 A;  1MSE C;  4DYQ A;  4IEJ A;  4B1R A;  2LLK A;  4W1U A;  2KDZ A;  1ETV A;  2CUE A;  4JP0 A;  4D5F A;  2NS7 A;  2JJ7 A;  1WPK A;  5F0F A;  1H8A C;  1UHS A;  1AKH A;  5IOY A;  1AU7 A;  1U9O A;  3A01 A;  3ZQC A;  3HOY J;  3PO2 J;  4AC0 A;  3BR6 A;  3L1P A;  3BR2 A;  1NK3 P;  2OF7 A;  1I50 J;  2GBY A;  3ZQG A;  3LSJ A;  2NOG A;  1U8B A;  4JX6 A;  1IDZ A;  2ECB A;  3QPL A;  3A01 B;  1CQT A;  1FIA A;  3ZQF A;  4FE4 A;  2TCT A;  4BBS J;  3JRI A;  4JX4 A;  4XK4 A;  2HQ5 A;  3I4M J;  3JRA A;  3SDG A;  2QCO A;  2L7F P;  1GT0 C;  1FJL A;  5F1J A;  4A3D J;  2MSY A;  5FLV A;  2DA5 A;  2PMZ N;  1MBE A;  3S1Q J;  2DMP A;  3I4N J;  3D1N I;  5E3L A;  2IBD A;  4X6A J;  1DU6 A;  3FK7 A;  1FIP A;  1JGG A;  5M3M J;  1XG1 A;  4IHW A;  4C2M J;  5EG0 B;  2XPU A;  2K9Q A;  2ME6 A;  1ZTR A;  1PUF B;  4W97 A;  2L0K A; 
#chains in the Genus database with same CATH topology
 1SEU A;  2E1O A;  1VF9 A;  4Y33 A;  3F3X A;  3OR2 C;  1TP4 A;  5K7Z A;  4AU7 A;  4FTH A;  2HPI A;  3JR9 A;  2GXG A;  2IEK A;  1E0E A;  3WTY C;  4N0B A;  1XGN A;  3C2B A;  3BJO A;  2OPT A;  4KMF A;  1P6R A;  4C9Y A;  3U9G A;  3IL2 A;  2RKH A;  3JRG A;  3AL0 B;  3OYA A;  1J59 A;  4BY7 J;  4TV7 A;  3TP3 A;  3VOE A;  3GYH X;  2G9W A;  2XGD A;  4MTE A;  3S93 A;  2X1E A;  3WE3 A;  2ZB9 A;  2ZME B;  3GBG A;  3BQZ A;  4A5N A;  1IDY A;  1RKT A;  1XB4 A;  2VBZ A;  5L3C A;  2DU9 A;  2LR8 A;  5E1X A;  4D9J A;  1EKE A;  2BYV E;  2DFE A;  3QYF A;  3OYD A;  2YU3 A;  2J5O A;  5D5X B;  1JTY A;  2DJN A;  5GAE J;  2JPB A;  1TQP A;  1VQL I;  2KLO A;  3W2A A;  1G8X A;  3QOE A;  1SFO J;  1MIJ A;  1D3Y A;  3ABU A;  3OOP A;  5E79 C;  2DDB A;  1HCR A;  2DT7 B;  2MW8 A;  1MND A;  3MWM A;  5M5Y J;  3L2W A;  3E0J B;  2IP2 A;  3JSO A;  1MBJ A;  2QWW A;  2M45 A;  1ZAR A;  3JRF A;  1IGN A;  1HSJ A;  2QBY B;  1I1G A;  2EFN A;  1LJ9 A;  4F92 B;  4M9X A;  2L5Q A;  2FE3 A;  1KON A;  1HW2 A;  2DA4 A;  2VON A;  3TDU C;  2VKV A;  4QSH A;  4CCM A;  5K7H A;  4RLF A;  5HLT A;  2QBY A;  3I55 I;  3MKY B;  1W7P B;  2XGC A;  3OL4 A;  4AWX B;  4XSX F;  1YW7 A;  5F1R A;  2RVC A;  4RGR A;  1B9N A;  1BJZ A;  1G6N A;  1JT6 A;  2OJE D;  2JT1 A;  4B09 A;  5HLG A;  2X0L A;  1AHD P;  5BMZ A;  2JUG A;  5CVU A;  3FBI B;  5E1Z B;  1WJD A;  4A3L J;  3T0Y A;  5CLS A;  1G3W A;  1E17 A;  1VQ4 I;  3K4B A;  2RDP A;  1X1P A;  4CCL A;  4IO9 F;  3T5X A;  3JRB A;  2QQ9 A;  2KIF A;  4M74 A;  1CF7 A;  3JTH A;  1TWH J;  1APL C;  3BJ6 A;  2R5Z A;  3J7A Y;  4YII A;  5EZG A;  5F64 A;  3JTG A;  1ZH5 A;  5DUI A;  2P5V A;  4LOC A;  3QYB A;  4XMY A;  5C4X J;  4ESJ A;  3BR0 A;  1XDU A;  1ZGJ A;  3IH2 A;  5E20 A;  4XBF A;  4DBQ A;  2PJP A;  2X1D A;  4KIB A;  5LBQ A;  1ZG1 A;  1YLF A;  3OYM A;  4G12 A;  4UY8 I;  5DCM B;  2LDU A;  2X6X A;  3GX4 X;  3HKZ A;  3KEY A;  3A2K A;  4I01 A;  3MQ0 A;  2YS9 A;  4CZC A;  2HI3 A;  3GFI A;  4NC7 A;  5LHI A;  3VOD A;  2KMU A;  2NVX J;  2JWT A;  5DD4 A;  2R7Z J;  2A07 F;  1O4X A;  4RAF A;  2FQ4 A;  2ELH A;  3OOU A;  1J5Y A;  5EJC A;  2X6W A;  2FOK A;  1Y8R B;  5FRO A;  3KZY A;  4QTR A;  2P0W A;  3FZV A;  4HYE A;  3NRV A;  3PSF A;  4AIJ A;  1Y1V J;  1LB2 A;  3DQV C;  2JVH A;  4RGX A;  1MMS A;  2M8G X;  1F43 A;  4J19 A;  1U5T B;  4KT5 C;  4RAY A;  3VEP A;  4U7D A;  3HGY A;  2FUG 2;  5EYR A;  3H3Z A;  1XSD A;  4IPA A;  2L4M A;  2PI0 A;  1ONV A;  1RUO A;  3H5N A;  3H0D A;  2ME0 A;  3T1B A;  2D45 A;  4LLL A;  1KA8 A;  2IGN A;  4HDU A;  1ZRF A;  3PNY A;  2DYS H;  4WCG A;  3ZPL A;  1RRJ A;  1JKQ C;  1BW6 A;  2O9L A;  1S3J A;  2ZSI B;  5EEA A;  5LGU A;  4B44 A;  2OCE A;  2IPQ X;  4F3Q A;  2FBI A;  3LSR A;  5LRR A;  1OMI A;  1T39 A;  1ZRC A;  3S1M J;  2DT6 A;  3KYC B;  2G7U A;  2K4J A;  2CQQ A;  4ASN A;  1IF1 A;  1H88 C;  3HUG B;  2EFO A;  3VB2 A;  2XRL A;  4ENK A;  1A35 A;  1ETY A;  3F8B A;  3K7A J;  2R7T A;  2Y30 A;  3VPR A;  2R5Y B;  2HZD A;  5FO5 A;  4KDP A;  3HRT A;  4B47 A;  4GGG A;  5KHD A;  4K2E A;  1WQ2 A;  3E6D A;  2W7N A;  1QRY A;  1LE8 A;  5IT3 A;  1U5T A;  1U6G A;  3I59 B;  4LK1 F;  1LFB A;  1A04 A;  2HKX A;  3BTI A;  3M7G A;  4YFN F;  3GTP J;  3L7W A;  3BQY A;  3KEO A;  2STT A;  4UHT A;  3M1E A;  3TO6 A;  4UVC A;  1E3H A;  2F5V A;  2VQH A;  1MSF C;  5LEJ A;  2DMU A;  4XRF A;  4IVN A;  5HNH A;  1K6O A;  4A2U A;  3N4M A;  4XR6 A;  2O0Y A;  1R4N B;  2LRD A;  3CQZ J;  3LFK A;  2XRN A;  3VYS B;  2RQP A;  1BN5 A;  3IKV A;  2WAQ A;  3SYT A;  3S3N A;  2XF5 A;  4OAZ A;  3CMA I;  1DDN A;  1YRN A;  1RET A;  4Q5S F;  1W5C C;  1SVL A;  2NYX A;  1V5F A;  5IOZ A;  1T95 A;  4EJV A;  3HL2 A;  4NHJ A;  1J0R A;  3JRD A;  1YS7 A;  3F8C A;  3KE2 A;  4HX8 A;  2QEN A;  3K4N A;  2QUF A;  4EVI A;  1K78 B;  3GEZ A;  2BW3 B;  3R60 A;  1OR7 C;  5J4V A;  3HJE A;  2FF4 A;  1EH8 A;  1XMA A;  2FSW A;  2LP0 A;  2W82 A;  4G8X A;  1T56 A;  3LL7 A;  1FX7 A;  4RLQ A;  2F5C A;  4OIP F;  4N4N B;  5L3D A;  5FKM A;  5H20 A;  4D7M A;  3DXJ F;  1HKS A;  5F0C A;  1N75 A;  5CVV A;  5DCM A;  5F0H A;  3TGN A;  1F5T A;  4XKW A;  2L7M P;  1MNM C;  4RBO A;  5HOO A;  3LNQ A;  1WFX A;  4B3A A;  1LVK A;  4E6K G;  1RR7 A;  1UG0 A;  1BBY A;  5GPC A;  3G6E I;  1IAW A;  1RIO H;  3K2A A;  4EGY A;  1HDP A;  4EM1 A;  3CJQ B;  1ON1 A;  1D0Z A;  4BAC A;  4BY1 J;  3OYG A;  1H9T A;  3HPG A;  1Y8Q B;  2CYY A;  4G9Y A;  1RUN A;  3LSH A;  4P9F A;  5KK1 A;  2AO9 A;  3K10 A;  2DA7 A;  4S0H B;  1GXQ A;  3FKJ A;  4LLN A;  4V2G A;  3IHU A;  2L4A A;  2GA2 A;  1XGS A;  3K4K A;  1UZC A;  2XAH A;  2WAQ N;  4G6T B;  4IF4 A;  3DTI A;  3WGG A;  3WU2 C;  1T38 A;  2Q1Z B;  2DA2 A;  5J8F A;  4HNV A;  2EIK H;  1A6Q A;  2IAI A;  1U3E M;  1TQI A;  3D5S C;  1F4K A;  2O03 A;  1D1C A;  2XAQ A;  1BA5 A;  1OJL A;  3JAM Z;  3GCM A;  2W24 A;  2X6Y A;  1V5E A;  1KYW A;  1ZQ3 P;  1R1U A;  3CLO A;  4HV6 A;  4G7Z F;  4CYC A;  2L9S A;  2IS1 A;  2PJR B;  1TC3 C;  2KHM A;  9ANT A;  1O7L A;  5ICE A;  1BM9 A;  3OYN A;  2WV1 A;  1KQ9 A;  2M30 A;  3SZP A;  2W84 A;  3J80 K;  1TQM A;  4A3K J;  2ZCW A;  3NWS A;  4O6J A;  4O5V A;  4AVP A;  1XX5 A;  4OIR F;  4BE2 A;  2K3F A;  2W48 A;  1DU0 A;  3AKZ A;  3OIP A;  1F1Z A;  1HLV A;  3C1D A;  2VPL A;  3RDI A;  4LG0 B;  2QSG X;  4A3I J;  2H8R A;  2RN7 A;  3BJA A;  5K5Q A;  4OMY A;  2LG4 A;  2P6T A;  1SD6 A;  2X9D A;  4Q47 A;  2JA6 J;  1NK2 P;  3HGG A;  3AFH A;  1Y0N A;  1G59 A;  4FQG A;  3DTK A;  5FJ8 J;  2NXN B;  1YRN B;  3DPU A;  1XN7 A;  3W6V A;  2GOM A;  2NVY J;  2KT0 A;  3HKZ N;  3ULQ B;  3DPT A;  1W0U A;  4M72 A;  1IN8 A;  5HS8 A;  1JHH A;  2DQR A;  4I98 B;  1BC8 C;  3GZ6 A;  3FIS A;  1GHC A;  1XC5 A;  1QHH D;  4XKB A;  2OD5 A;  2W4S A;  3LAJ A;  4IEJ A;  3ABL H;  1USS A;  2CUE A;  5ED4 A;  3R4K A;  5CQE A;  2JJ7 A;  2VKD A;  3KZZ A;  1VQ6 I;  2W1O A;  4QLC U;  2FNP A;  4RB1 A;  2XHK A;  4I99 C;  4NC8 A;  2MBF A;  5BPD A;  2PMZ A;  2LBF A;  2OF7 A;  4L5J A;  3ZXS A;  1YQA A;  4AIH A;  1HQC A;  2M7A A;  5IT9 Z;  4JX6 A;  5EEG A;  5JI6 A;  3WTX C;  1IDZ A;  2ECB A;  3A01 B;  1W5S A;  1V5G A;  4ON0 A;  1XD7 A;  4IXA A;  4FE4 A;  1YW9 A;  4FET A;  3WTU C;  2J5P A;  1SFK A;  5LRS A;  2MC4 A;  3JRA A;  4BE1 A;  3SDG A;  2HQR A;  2M7B A;  2L7F P;  5L3E A;  1GT0 C;  2OCC H;  3LQQ A;  5DM7 F;  3C2G A;  3DKY A;  4N4O B;  2XAS A;  1FJL A;  1HKT A;  2DPD A;  2R7U A;  3KP2 A;  2AQE A;  2EIN H;  3CC4 I;  4UUV A;  3S1Q J;  1OQY A;  1YG2 A;  5DCF A;  4HW0 A;  3D1N I;  1FC3 A;  3MAJ A;  4H4K C;  2NRA C;  4ZYD A;  3CO6 C;  4HQE A;  3O6B B;  3FK7 A;  1FIP A;  1XG1 A;  3DBH B;  3GF2 A;  1ZTR A;  1LFP A;  2L54 A;  1PUF B;  1Y56 A;  2M1B A;  2L0K A;  1RC9 A;  4E7L A;  4HNU A;  1ZYR F;  3MKZ A;  1I5Z A;  3CO7 C;  1S8N A;  3PQJ A;  4BNC A;  2VXD A;  1LPQ A;  5B5E C;  1AWC A;  2M87 A;  5GTI C;  3ZMV A;  2LTP A;  2HGC A;  2HOT A;  3CCR I;  4F93 B;  3H5A A;  2V1U A;  6PAX A;  4XLN F;  3SZT A;  1MNE A;  2VKH A;  3TQN A;  2B9S A;  3E97 A;  2ISZ A;  5J1R A;  1MZB A;  1P7J A;  2DOD A;  2VI6 A;  4DBR A;  2A6E F;  4YG2 F;  2BEO A;  4JOM A;  1R22 A;  5GP9 A;  3CDL A;  2M5W A;  3OYH A;  3S2W A;  1R00 A;  4YEL A;  1YO5 C;  1HDD C;  1DGW Y;  5GPA A;  4E7K A;  3H92 A;  1OIS A;  3ZP5 A;  2ZME A;  4V19 K;  2VE8 A;  2ZKZ A;  3BT9 A;  3D5R C;  3GTJ J;  5F27 A;  5C4J J;  4RAZ A;  1JKO C;  1KU9 A;  4BQO A;  2VJI A;  3ECO A;  3HHG A;  2DTZ A;  1PUE E;  4XSZ F;  2HYG D;  2DA3 A;  2UZK A;  5IT9 K;  4MO7 A;  5A2Q K;  2VOP A;  2ISY A;  1BIA A;  5JHU A;  5H6Q A;  2WB1 A;  3CDI A;  2QM3 A;  3H9G A;  1O7F A;  1ZLJ A;  2QSF X;  2H94 A;  1IN5 A;  4L0Y B;  4A12 A;  1QHG A;  3EUA A;  1BIB A;  2HR3 A;  1SMY F;  1SVO A;  3BG9 A;  5K7F A;  3LSM A;  2KP6 A;  3KLO A;  5IP6 A;  4DYR A;  1V54 H;  2PJR A;  2WA0 A;  2HKO A;  2F5D A;  4HA8 A;  2EJR A;  2FMY A;  3BCA A;  3N97 A;  1IUF A;  2O8X A;  3O8H A;  3KYL A;  2P4W A;  4DZJ A;  1I3Q J;  2COB A;  1QBJ A;  2KPM A;  3BC8 A;  1UG2 A;  2KFD A;  2MLK A;  2P7V B;  2QF7 A;  1Z67 A;  4NC6 A;  4E70 A;  2DI3 A;  4LB5 A;  2NOJ B;  5K5O A;  1QZE A;  5E8I A;  5FD6 A;  3BZC A;  4UUS B;  3K4C A;  4MQV A;  1ACI A;  2NS8 A;  2R4G A;  5DS9 A;  3EYI A;  4Y52 J;  1P4X A;  3SEZ A;  5FB2 A;  3DKW A;  2R0Q C;  1P9Q C;  4HF2 A;  1Z7U A;  2PX9 A;  4KIG A;  5IYB J;  1WJE A;  1F36 A;  1VQ7 I;  2VJJ A;  2HVQ A;  2V6C A;  2CSO A;  4AYB A;  4LD5 A;  3GO5 A;  2MG4 A;  1BR1 A;  4ENN A;  5LD2 C;  1SFX A;  5KCM A;  3H1C A;  4QPQ A;  4BAY A;  4OWR B;  4EGZ A;  3BG7 A;  1UB9 A;  3DU5 A;  4LLG F;  2ETH A;  2OBP A;  1QQI A;  4I02 A;  5KVR A;  3G4S I;  3PIO F;  3I4P A;  2WBM A;  3LSK A;  1FMW A;  1ORK A;  2VC0 A;  3IUO A;  3PQK A;  3RQI A;  2FD5 A;  2B63 J;  1ODD A;  4IKF A;  1E2X A;  4OAY A;  4AIK A;  1R6R A;  2V79 A;  3ISP A;  2DOA A;  2M4G A;  3HRM A;  1PJR A;  1Z77 A;  3A4C A;  3NWT A;  1UEL B;  3BP8 A;  3CZ6 A;  2LKS A;  2OUM A;  1J75 A;  2QQ8 A;  2ELJ A;  2ZJP F;  3EUH A;  1EV7 A;  5JVT A;  2WAE A;  2ESN A;  1WWX A;  5TRD A;  4ZYA A;  4ITV A;  2LC2 A;  2EH3 A;  1NH3 A;  2WY7 Q;  2VC1 A;  3SJM A;  2L9N A;  3GLL A;  2FX0 A;  4HDV A;  2FBK A;  5J47 A;  2B7E A;  1HBX G;  5FLX Z;  3B6A A;  4C2U A;  4ZZL A;  5D4R A;  3C2H A;  2HFH A;  1WRJ A;  1WZ2 A;  2AS5 F;  1WHU A;  1EH6 A;  1IXC A;  3H3V K;  4GDF A;  2ZXJ A;  3KIO A;  5DEQ A;  4IZZ A;  4FCY A;  1U5T C;  1TWC J;  4U88 A;  2E19 A;  5FKK A;  5IY5 H;  1O3T A;  4DIQ A;  3M8J A;  4LIU A;  4Y3O A;  2DAO A;  4GO1 A;  4A3J J;  5HDG A;  2Z33 A;  4XKV A;  3C18 A;  1YX3 A;  2VQL A;  3BZ6 A;  4UB6 C;  4EAT A;  3BLY A;  4KIF A;  4IQ4 A;  1L3L A;  1X1C A;  1X1D A;  1IG7 A;  2VQC A;  3QPT A;  3Q5F A;  1S5L C;  2BY1 A;  2UXX A;  1I39 A;  1T8I A;  2DK8 A;  3L2Q A;  2YX4 A;  3M1C A;  1GLN A;  3V7S A;  2A6T A;  3SZG A;  4E7J A;  3DKX A;  4PCQ A;  4NQW B;  3TO9 A;  1O3Q A;  2XF7 A;  3ESW B;  2DW4 A;  2ID6 A;  1SC7 A;  4M6Y A;  1YFH A;  2I5U A;  4IHX A;  3ASO H;  1FWZ A;  2LNB A;  1UFM A;  2ZFW A;  4J01 A;  2GIV A;  2HXI A;  2Q2E A;  2ZSH B;  1TBX A;  3LSI A;  4ZDL A;  1ETW A;  1XS9 A;  3JAM K;  2JN6 A;  1MH3 A;  2A5Y B;  1I27 A;  3BR1 A;  4QPO A;  2E36 A;  4NB5 A;  4BHB A;  2MH9 A;  4UV9 A;  2R7V A;  1OFC X;  4AM3 A;  4ZYH A;  3JRH A;  2BGC A;  2NAZ A;  2HOA A;  4B8X A;  2CV1 A;  3KLN A;  3S15 J;  2XKP A;  2XB5 A;  2R5Z B;  2IA2 A;  4BXU A;  4D0P A;  1YIJ I;  5FLX K;  4ZC3 A;  3JSP A;  3BPX A;  4I6Z A;  1OLT A;  3HYI A;  3I5U A;  2DA6 A;  1D5V A;  3FXK A;  1QPI A;  3Q0U A;  5ICC A;  1JHF A;  4KA4 A;  1OR7 A;  4N9H A;  4NNJ A;  3D0S A;  1JKP C;  3B02 A;  4HX7 A;  3MVP A;  3PO3 J;  1MMG A;  1IW7 F;  2V9K A;  3CCY A;  2YU9 J;  3Q0V A;  3GXO A;  1JTX A;  4OIO F;  2RV8 A;  4XOP A;  3BTL A;  3HOZ J;  5HS9 A;  1B9M A;  1GVD A;  2M8E A;  2ZXI A;  4X0G A;  1KYZ A;  4CO8 A;  1YI2 I;  2EZL A;  2CH0 A;  5EF6 A;  2MD0 A;  1K61 A;  5AON A;  1A5J A;  2RAE A;  4RMN A;  1JUP A;  1VND A;  3I58 A;  1ZHF A;  3IAS 2;  1FSH A;  2MGQ A;  1W36 C;  2RNJ A;  1SMT A;  1ZEL A;  4KUM A;  2Y9Z A;  2IGK A;  4UNO A;  3GFL A;  4C30 A;  1WJB A;  4U0Y A;  1O3R A;  2DK5 A;  5GAG J;  4KNY A;  2L9R A;  1IN6 A;  2DOE A;  2XGE A;  2EV0 A;  3FHZ A;  2A61 A;  1ZR4 A;  3CMY A;  2EZI A;  4AD9 A;  3QYE A;  1LE8 B;  1FP2 A;  2IJL A;  1YE9 A;  1OCP A;  2Z1D A;  5DYM A;  5ERI A;  2KIU A;  3LA7 A;  5HDN A;  1LNW A;  2CGP A;  1EH7 A;  1ZLK A;  5M5W J;  3SFI A;  1OCC H;  4OU0 A;  2VQG A;  3KPH A;  4C3J J;  1LDK B;  2Q0O A;  2FML A;  2WAD A;  3OMY A;  4G6Q A;  2D2W A;  1JGS A;  4JK1 X;  1Z0X A;  4GFB A;  3HOU J;  3BPV A;  2FRH A;  5HLI A;  4ESF A;  1VQN I;  1SD5 A;  1WCM J;  1QVU A;  5HVQ C;  2IS4 A;  4CYD A;  1ITY A;  3J80 Z;  2IRF G;  1ULY A;  4CCN A;  1H0M A;  2LK2 A;  1V3F A;  1Z21 A;  1FOY A;  3FHN A;  1MDM B;  2QYO A;  1AOY A;  1EF4 A;  1S7E A;  5DD8 A;  2CRG A;  4IQJ A;  3I54 A;  1PYV A;  3HXL A;  1FT9 A;  3FXQ A;  3BWG A;  2ECC A;  2LBF B;  2FA5 A;  2DQL A;  3G71 I;  1W1W E;  5LHG A;  1Z1D A;  3B6C A;  2ZJ2 A;  3MZY A;  4XN3 A;  3DFG A;  2E60 A;  2W25 A;  1FOW A;  4I76 A;  4MQ9 F;  4PFO A;  5FGM A;  1VQM I;  1HKQ A;  3K70 C;  2EFP A;  3RCO A;  2V9V A;  3MZ8 A;  1P7I A;  4RS8 A;  3RPQ A;  4PSX A;  2IW5 A;  3FXJ A;  3G1O A;  5F04 A;  2QKM B;  1H9G A;  4HOB A;  1CF7 B;  3M9A A;  5DTD A;  1DQU A;  5J1Y A;  2Z9O A;  2LY2 A;  1W36 D;  5EZH A;  1X2M A;  5E3M A;  2JA7 J;  3LOC A;  1FNN A;  2N8G A;  4P5O A;  4V2F A;  3DU6 A;  3FBN B;  2BVL A;  3KZI C;  4YRV A;  1S6L A;  3ZMD A;  1DGR M;  3BOQ A;  4QWQ A;  3OY9 A;  5LEK A;  4M3B A;  3N05 A;  1R58 A;  4M71 A;  1QPM A;  1HST A;  4BE0 A;  1MMD A;  3DTE A;  5JVG F;  2IA0 A;  1FMV A;  4OMZ A;  1TZL A;  4R79 A;  2JK3 A;  4A3F J;  3LA3 A;  4KIC A;  3FF5 A;  4Y15 A;  3W3C A;  5LHH A;  2PEX A;  3DCF A;  3SFZ A;  1E3O C;  1ENH A;  2DA1 A;  2ZXH A;  3WHC A;  3W2W A;  2K86 A;  3K0L A;  3Q0W A;  2OA4 A;  4KN7 X;  2EB7 A;  2DOF A;  4IRH A;  4CCK A;  4UB8 C;  3K4L A;  5HLH A;  3WTV C;  4BQA A;  3I3L A;  2QSH X;  3JCU C;  1C0W A;  3E5X A;  4EJT A;  2LF7 A;  3ZMU A;  2BY0 A;  2A69 F;  1TNS A;  1Y39 A;  2LLK A;  3I0T A;  2KDZ A;  2R7R A;  4JP0 A;  1X19 A;  3P9K A;  3CUQ A;  4ZZD A;  4HF0 A;  5AIP A;  1R36 A;  4EV0 A;  3S3M A;  5F0F A;  5TIS C;  1QNT A;  1UHS A;  1AKH A;  1RNL A;  3R6S A;  2BE5 F;  1YJ9 I;  1AU7 A;  3CC7 I;  3ZQC A;  4A6D A;  4AC0 A;  3F21 A;  3OYK A;  1G3T A;  2YSR A;  3WOD F;  4ZTF A;  2K27 A;  5BS6 A;  3F6O A;  2XAF A;  3C7J A;  3EDP A;  1SFU A;  2NOG A;  2A3S A;  1U8B A;  2K5C A;  2O5R A;  2VBY A;  4BHC A;  2Y48 A;  5FRM A;  3PSI A;  4LJZ F;  3VSK A;  4L9N A;  1QU3 A;  3ZQF A;  2TCT A;  2CFX A;  3OS2 A;  3JRI A;  4PJ0 C;  3M07 A;  4XK4 A;  1DPR A;  1REP C;  1XSV A;  4M9S A;  1TT0 A;  2WC2 A;  3ZRG A;  3TO7 A;  3L09 A;  2FBH A;  2MSY A;  4ZJZ A;  5FLV A;  3WG7 H;  3HUG A;  1J9I A;  1MBE A;  4P1W A;  2EIL H;  3I4N J;  2XSJ C;  5J6X A;  2DDA A;  4YEJ A;  3W6J B;  4X6A J;  4L0Z B;  2WAF A;  3EYY A;  1FOK A;  2IS2 A;  2UXN A;  4L9T A;  4EM0 B;  1HA8 A;  2STW A;  4IHW A;  4C2M J;  4Z2Y A;  3BG6 A;  2ME6 A;  2ZC2 A;  1Y0U A;  4G7O F;  3DPL C;  3CME I;  1YHQ I;  4L9J A;  2CFO A;  2AXL A;  4PK4 A;  3RKW A;  4L9V A;  3DWL E;  4YIR X;  1AKH B;  3BZK A;  4RGS A;  3HIF A;  3NEU A;  1P4W A;  5IYC J;  4IHT A;  3RIR A;  2CUF A;  4HRI A;  2F4O B;  3NAR A;  1P92 A;  4IJA A;  5DUK A;  4C3I J;  2M9H A;  2CQK A;  1UAA A;  1IN4 A;  2Z99 A;  2CW8 A;  2GOX B;  4CDG A;  1ZRD A;  3M4O J;  1BI3 A;  2CWE A;  2A6H F;  2X48 A;  3DF8 A;  3PJR A;  4KIT B;  1IRZ A;  2Y9Y A;  4NBQ A;  2K9S A;  4CYC B;  3H9J A;  1VQK I;  3CC2 I;  2XPW A;  2M4K A;  3ZOB A;  4WXC A;  1IRF A;  4LG3 A;  4F55 A;  2HVR A;  1GVJ A;  2X85 A;  1FZP B;  3GFM A;  3QRF F;  1UHM A;  3HOT A;  4BJ6 C;  1ETX A;  1BR2 A;  4GYG A;  2CU7 A;  3GME A;  3PL8 A;  3LSG A;  4OIN F;  2R7W A;  3L2U A;  1QGP A;  1PDN C;  2DN0 A;  3MD2 A;  5EG0 A;  4UUS A;  2KRF A;  1WH5 A;  2CS3 A;  3FKI J;  1ZK8 A;  2EA4 A;  3S17 J;  4BL0 B;  1TWA J;  2LVS A;  3ABK H;  2HDC A;  3V8J A;  3ZQI A;  2PN6 A;  5ICF A;  3DBR B;  1KU2 A;  1XSX A;  2I8D A;  1VQP I;  1LUJ B;  2VJ4 A;  4E7I A;  4Y13 A;  3AAF A;  3NQO A;  5D4S A;  3TL4 X;  1W5T A;  3FM3 A;  3OYL A;  4BJT A;  3T8T A;  1LDD A;  2KIQ A;  3WGI A;  4KT6 A;  2DFI A;  4BKX A;  4A0Y A;  1NG7 A;  5CKT A;  1GV2 A;  4MTD A;  1NG6 A;  3QQA A;  4G7H F;  1XPX A;  2K40 A;  5BPI A;  2HVS A;  3CCL I;  1JKR C;  4BHP A;  3A02 A;  1L0O C;  4CUG A;  1X58 A;  2XKO A;  3JW4 A;  3OIO A;  1R23 A;  1D1B A;  2DBB A;  3ZN1 A;  4BJ5 C;  5ILU A;  1QA6 A;  4WWC A;  5CPR B;  2L01 A;  1IV8 A;  3C3W A;  5FKL A;  1Z3X A;  4RM2 A;  4AYB N;  5EEH A;  5F6F A;  2UUZ A;  1W0T A;  1VZ0 A;  2HYJ A;  3IWF A;  1W7P D;  3FWE A;  3CDH A;  5CYV A;  1CGP A;  2KZV A;  1YS6 A;  4XLC A;  2CQ7 A;  4XM3 A;  1VFC A;  2CQN A;  1TL8 A;  4I0A A;  4XID A;  1UHW A;  2I10 A;  2HNH A;  3QU3 A;  3TOA A;  3ZR8 X;  1FYL A;  2E7X A;  3LST A;  4F7Z A;  2COM A;  4CCJ A;  3V8L A;  1W4M A;  1XGO A;  3E5U A;  5M3F J;  1MH4 A;  1JJ6 C;  1X4P A;  1Q1V A;  2F48 A;  4A0Z A;  4BS9 A;  4IOA F;  2R7Q A;  1I1S A;  2PQ8 A;  4U7B A;  2P6S A;  3GUD A;  1HW1 A;  3HEF A;  4E7Z A;  3CUO A;  3GZ5 A;  4ZDO A;  1X4O A;  3IV5 A;  1YJN I;  1MMN A;  3WHB A;  3G1L A;  1HOM A;  3JRE A;  2E5Z A;  1NTC A;  3PFI A;  1V55 H;  2EZK A;  3TP0 A;  4XON A;  1OYW A;  3Q9S A;  3ZMZ A;  3ROU A;  4HZF A;  2ZME C;  3HTU A;  2QGU A;  1WJC A;  2X6O A;  2BBY A;  4C3H J;  1U2W A;  2AHQ A;  2JUC A;  5D5U B;  2JZY A;  1EA3 A;  2W00 A;  3ASN H;  1I3A A;  3OS0 A;  4IHV A;  1ETQ A;  3A03 A;  1YX5 A;  2E35 A;  4CSW A;  2CO5 A;  3RZD J;  4XOT A;  1P4A A;  4L5E A;  4D7N A;  1R49 A;  3S1R J;  2K9N A;  3TMO A;  2Y2Z A;  2K3P A;  4A93 J;  1LKX A;  3ZN0 A;  3HOS A;  3LFU A;  4A3M J;  2HTJ A;  4XLF A;  4Y4R A;  4MEX F;  4MNU A;  1Z7L A;  2L9V A;  1OCO H;  2X51 A;  2HWV A;  2O8K A;  2EQR A;  4A3B J;  3HRS A;  3TBI A;  2HDD A;  3E7L A;  4ZTJ A;  2GXB A;  2X1C A;  2E1N A;  1WJ5 A;  4KJZ A;  1Z91 A;  3O8G A;  2MA3 A;  5HNF A;  1T0F A;  4BDZ A;  3G1M A;  1ZGW A;  1VQ5 I;  4DOZ A;  1QVT A;  1B1B A;  4FAS D;  2NVT J;  3BY6 A;  4M3F A;  3BRO A;  1TLH B;  1N77 A;  2PBI A;  3WGH A;  2PMH A;  3F8F A;  3DP7 A;  2XV4 S;  3FXL A;  2D1H A;  2H27 A;  2CW0 F;  3GVA A;  1SFE A;  1JUS A;  1W7P A;  4HG2 A;  3GTL J;  4D1Q A;  2L7Z A;  3VDX A;  3HC7 A;  3P9C A;  4HNT A;  3SEQ A;  1JXS A;  3Q3S A;  1MBK A;  1T0F C;  1WGX A;  2HTS A;  4N9I A;  3U21 A;  1YIT I;  5KAI C;  1WI3 A;  4CIC A;  5LGN A;  1O3S A;  1U8R A;  1E3P A;  4LG0 A;  5GTH C;  2OTJ I;  2EIM H;  4A3E J;  2GXA A;  3FK6 A;  3QAH A;  4II3 A;  5KAF C;  2E2I J;  2OC6 A;  4P9U A;  2P5K A;  2IGM A;  2VBW A;  3S2D J;  5CVI A;  2CV0 A;  2E1M B;  3SXY A;  3OSF A;  1KQ0 A;  3P9I A;  3OV8 A;  4HF1 A;  1J2X A;  2DTR A;  5D6F A;  1SAX A;  2RNG A;  3RPU D;  4FT8 A;  2E7W A;  1SD7 A;  1Y1W J;  4OIQ F;  2PFB A;  2E71 A;  4M3E A;  5DDG A;  2M2E A;  4M6X A;  4XOR A;  3CMM A;  5ICG A;  1K78 A;  2VOD A;  2Y0S N;  2EFQ A;  2VUM J;  1FTZ A;  3ML6 A;  1S9H A;  2K7L A;  2RC4 A;  1J09 A;  3QP5 A;  3CCM I;  3GTM J;  5E8G A;  3KEQ A;  5J1U A;  1OPC A;  3FDY A;  2KQR A;  1BW5 A;  2K02 A;  1U78 A;  1K6Y A;  2Y0S A;  3WE2 A;  4HV5 A;  1WH7 A;  2MC3 A;  3QOD A;  4FHT A;  1B72 B;  2ZFU A;  2CV2 A;  3CCE I;  1H89 C;  2LSO A;  1XTA A;  3QOP A;  3TDZ C;  1MKM A;  3IKT A;  3QWL A;  5H2F C;  2Y0M A;  3TW7 A;  1LFU P;  3IAM 2;  4OOI A;  4CA0 A;  3M8F A;  1UMQ A;  3PFY A;  3BTJ A;  2AQF A;  3O2P E;  3KX2 A;  1SD4 A;  1V4R A;  4DZP A;  3PUF A;  1LDJ A;  1SAN A;  2B0L A;  2GWR A;  3CJR B;  2EA2 A;  2QLZ A;  2ADU A;  1R1T A;  1VQO I;  4G6D A;  3G3Z A;  2UWM A;  2QVO A;  2ZJR F;  2XRO A;  3BR3 A;  3AL0 C;  3IC7 A;  1MD0 A;  2UV1 A;  5B66 C;  2VN2 A;  3E1S A;  2VLA A;  1M1E B;  2OU2 A;  1EJ9 A;  1IZ1 A;  3ELK A;  4YFK F;  2OQG A;  2VIX A;  3MZH A;  5E3N A;  3GFJ A;  3RKX A;  3OYB A;  2ZNY A;  2PG4 A;  3RI4 A;  2BXY A;  3RJP A;  1MMA A;  2LF8 A;  1YIO A;  4F91 B;  4MLO A;  2JRM A;  1G3S A;  1TW2 A;  2GIZ A;  2Z2S B;  1WSU A;  2R92 J;  4KYW A;  4PUS A;  3F8M A;  1MJ9 A;  3E6B A;  4B4C A;  4Z6Y A;  2NNY A;  2DXI A;  1ERD A;  5HS7 A;  1DP7 P;  1B8I A;  3EUH C;  3IH4 A;  3H5R A;  3M3Y J;  1GV5 A;  2BZT A;  2Y75 A;  2JTV A;  5D6E A;  4AVZ A;  2YPR A;  3MEX A;  2V9P A;  2V6E A;  4H0E A;  3HB9 A;  2R7D A;  2L2O A;  4U0V A;  2P8T A;  1WJF A;  1G2H A;  1JUM A;  2Q8K A;  1UST A;  3BCB A;  1UJ8 A;  3DEW A;  4JX5 A;  5GAD J;  2F2E A;  2DO7 A;  2JSC A;  4II2 A;  5D8L B;  1BOB A;  4DW6 A;  3H0G J;  4MHG A;  2KL4 A;  1IXS B;  2ZXW H;  1X3W B;  2DCE A;  2VT2 A;  4ENJ A;  5TGT A;  1R5G A;  4HBL A;  4WXH A;  2XAJ A;  3NAU A;  4EQQ A;  2VJ5 A;  1IN7 A;  2TDX A;  1IC8 A;  3HOW J;  1Z3Y A;  2K9M A;  3FIW A;  2QA4 I;  1S7O A;  1T6S A;  1R4M B;  1X3Z B;  4M73 A;  2GZW A;  4PDK A;  2W85 A;  3CP2 A;  4R8H A;  2FU4 A;  3G73 A;  2M34 A;  3SQN A;  2BW3 A;  1WKM A;  2JA5 J;  3MMY B;  5FLM J;  3PNV A;  2H1L A;  1Z05 A;  1ZGA A;  4EEF G;  2VE9 A;  3LA2 A;  3OYI A;  1K83 J;  4HSR A;  1GUU A;  4IHY A;  1B6A A;  3RTR A;  2XDV A;  4JYK A;  3L2R A;  1PUF A;  3LSP A;  5L3B A;  3DV8 A;  2HXO A;  3U2R A;  1HF0 A;  1FPQ A;  4FIS A;  5GAH J;  5C3E J;  4I09 A;  2E34 A;  1D1A A;  1T08 B;  1FBU A;  2RGV A;  3LQR A;  4P96 A;  5HOD A;  3EQL F;  3IWZ A;  2LFB A;  2VBX A;  4BH9 A;  4FE7 A;  5FFZ A;  2ZJQ F;  4DYQ A;  3KP6 A;  4B1R A;  4W1U A;  2OAZ A;  4S04 A;  4I7H A;  1ETV A;  1B4A A;  2F4M B;  1WVR A;  2NS7 A;  3EET A;  4D5F A;  4BQN A;  4PJN A;  3ZMT A;  3HTS B;  3HSE A;  5L3G A;  3WTW C;  3VFZ A;  2HOE A;  1U9O A;  3PO2 J;  4JQF A;  1X1A A;  1BI1 A;  3BR6 A;  4XNF A;  4PJJ A;  2OTL I;  3F22 A;  1S7A A;  2H6C A;  1NK3 P;  4IRI A;  2FQ3 A;  3K1M A;  2QKL B;  1RZ4 A;  3ECH A;  3FMR A;  3LSJ A;  3ZQG A;  2R7F A;  3GW2 A;  2K4B A;  2A05 A;  4PGH A;  4PJM A;  1J7K A;  4XLA A;  1MJA A;  4BEH A;  4J00 A;  1CQT A;  1D0Y A;  3FMS A;  3ZQQ A;  1VQ8 I;  2JPC A;  5FRN A;  4GYI A;  1BJA A;  2YX7 A;  1QO0 D;  4BDY A;  3I4M J;  4EMS A;  1YOV B;  2QCO A;  3RKY A;  4U87 A;  1STZ A;  3HG9 A;  4RB2 C;  3MKW B;  2V4J C;  3K1P A;  4KFC A;  3B73 A;  2NNN A;  3RPU A;  5F1J A;  4A3D J;  2RRE A;  2DA5 A;  2PMZ N;  3F23 A;  2DMP A;  3F8N A;  2KJC A;  4YFX F;  4IL6 C;  1ZRE A;  5E3L A;  2IBD A;  1T2K A;  1FBS A;  1I6X A;  1XGM A;  1JGG A;  1BI0 A;  2LY1 A;  2A68 F;  1YTY A;  3A1Y A;  3GWZ A;  5EG0 B;  1TTY A;  2K9Q A;  3H36 A;  4W97 A;  2F4I A;  3RYP A;  3PUB A;  3MCZ A;  1ZN2 A;  2V1X A;  5IPA A;  3AG4 H;  3PIP F;  3J7Z I;  1LQ1 A;  2HDW A;  2Z16 A;  4XLP F;  3HOV J;  2KDO A;  2H8W A;  1R5H A;  2Y69 H;  5KNL A;  2VT3 A;  2LYC A;  4A0X A;  3RZO J;  3H3U A;  1R7J A;  3QU6 A;  2W57 A;  2MYS A;  5DV5 A;  4UVA A;  2XVC A;  2GQQ A;  4DQ2 A;  3P5J A;  5B1A H;  3ZQL A;  3HRU A;  4XRS A;  2D5V A;  3F6V A;  2R7S A;  3KP3 A;  1KZH A;  2DLL A;  2LMD A;  3K4J A;  1P2F A;  4UV8 A;  1WI9 A;  3OYJ A;  1OCT C;  3OR1 C;  2QQA A;  4UVB A;  4L5I A;  5FD5 A;  4XQF A;  4IX7 A;  4LK0 F;  2MH2 A;  3HDD A;  4HST A;  2EIJ H;  1K4T A;  1RKW A;  4CHU A;  5A2Q Z;  4WXD A;  4E7S A;  3UKG A;  2DMN A;  2R3S A;  2ICW G;  2NVU B;  2WB1 N;  2BY2 A;  3QP6 A;  3KFW X;  4ZYE A;  2LH9 A;  3VWB A;  3OYC A;  2KJB A;  4U0W A;  3K2Z A;  2LD5 A;  1TT5 B;  2HZT A;  1I6H J;  1MGT A;  2JMW A;  5D8K B;  3HSR A;  2EBI A;  1FYK A;  2Q2E B;  4B43 A;  3CJN A;  5BQT A;  3CCJ I;  2P5L C;  3CLQ A;  5FKO A;  4G94 A;  4B3X A;  4F52 A;  4UXN A;  1PP7 U;  2KRC A;  3UNG C;  1R1V A;  2XGX A;  3CP8 A;  2EFW A;  2KZG A;  1RPW A;  4HAM A;  3GTQ J;  3H35 A;  1LVA A;  3F0C A;  1ETK A;  1SAU A;  4MGR A;  1OYI A;  3FXO A;  3ZCO A;  2GM4 A;  4A3C J;  1F9N A;  4Q4Z F;  5H6R A;  2OZU A;  3HOX J;  2XPV A;  4PGG A;  4LB6 B;  3OS1 A;  1ETO A;  1Q1H A;  3E6C C;  1BI2 A;  2MD5 A;  3KP4 A;  2F5F A;  3CUQ B;  4MEY F;  3VYT B;  3OL3 A;  3I71 A;  3BR5 A;  3ABT A;  3WTZ A;  2JSP A;  4RAG A;  3WG9 A;  2DFF A;  1A36 A;  3DEE A;  2OZ6 A;  2G0E A;  3RQ4 A;  1S29 A;  1B59 A;  3RSN A;  2QEX I;  3FXM A;  3S32 A;  2HOS A;  1IRG A;  3WU1 B;  3AG2 H;  3CCV I;  3T8R A;  4I0B A;  5IP9 J;  1YJW I;  2BV6 A;  2P81 A;  2VXZ A;  1D0X A;  4EJO A;  3EUK L;  5K5R A;  4DGW B;  2CJJ A;  2XIG A;  3OIQ A;  5L3F A;  2TRT A;  2LY9 A;  2DMQ A;  3KCC A;  2E1M C;  5LGT A;  1IRX A;  2IVM A;  3GTO J;  4BXX J;  2L02 A;  4A6E A;  3FX3 A;  3RYR A;  4BGD A;  2EZH A;  3DLA A;  3R0J A;  3SHF A;  3K69 A;  1FBQ A;  5JHF A;  1ZG5 A;  3S8P A;  2XAG A;  4LGW A;  1R5I D;  3M8E A;  3S16 J;  3MFK A;  4CZZ A;  5EGO B;  3W6K B;  1YW8 A;  1N25 A;  1LEA A;  5HDK A;  4WK8 F;  1ZAO A;  4RB0 A;  2GA1 A;  5D5W B;  1LEB A;  2M0M A;  4XN0 A;  4C2T A;  2V1D A;  3P7N A;  3HSF A;  2JA2 A;  5CVR A;  3BG3 A;  2VL8 A;  1FTT A;  1JJ8 C;  2LKX A;  3F9K A;  3GZN B;  3DBL B;  3PNT A;  1K79 A;  3KP7 A;  1MBH A;  4RGU A;  2ZO4 A;  3IP4 B;  1SVM A;  2HU9 A;  1K4S A;  4S05 A;  2FJ1 A;  1N78 A;  3BDD A;  1O57 A;  2NVQ J;  3MN2 A;  3RKQ A;  4D5C A;  1B8I B;  1IXR C;  3OYF A;  3S1N J;  1OYY A;  2P7C B;  4P55 A;  5CVJ A;  3OSG A;  5F08 A;  3ERM A;  1VI0 A;  3HBL A;  3COA C;  2V26 A;  1VQ9 I;  4L18 B;  3OWT A;  1BOA A;  1D8J A;  4R1H A;  4PJL A;  2BXZ A;  2HS5 A;  3R0A A;  2BHZ A;  2ELK A;  3BTC A;  3LWF A;  3REO A;  1BL0 A;  4HLX A;  1OCZ H;  4A3G J;  4NUB A;  1ON2 A;  5C44 J;  4CGZ A;  2V1N A;  2K9L A;  3L2V A;  2CW7 A;  1FP1 D;  5E18 F;  4MIM A;  1JI8 A;  2CUZ A;  4KN4 X;  5ILV A;  3V7R A;  1OCR H;  4BYY A;  5J3L A;  1IUY A;  2ID3 A;  1IJW C;  1IO2 A;  3DEU A;  3TOB A;  3L9F A;  1R71 A;  1RES A;  1TNT A;  3PM1 A;  3W2V A;  2JQ7 A;  1FY7 A;  3HHH A;  1JT0 A;  3E6M A;  5IP7 J;  4BUP A;  4GRI A;  2R7X A;  4M9Z A;  3DLL F;  1MBG A;  3FM5 A;  5K1Y A;  4MFD A;  2R5Y A;  2E5N A;  3MKL A;  1VTN C;  1MW7 A;  5M5X J;  1D8K A;  1XCV A;  2HEO A;  1HXD A;  5J4Y A;  4AUX A;  3S3O A;  4HLY A;  3VYR B;  2YUS A;  3V42 A;  3KP5 A;  4DYC A;  4ENM A;  1B72 A;  2FOW A;  1T33 A;  4PSW A;  3A0B C;  4UUT A;  4A5M A;  2ACJ A;  2E1C A;  2JRT A;  3GTK J;  2DYR H;  3CCU I;  3U1D A;  3CCQ I;  5JLW A;  1ZG3 A;  4XLH A;  5FFX A;  3VSL A;  4X1E A;  1TW3 A;  1MJB A;  1Z9C A;  4RA2 A;  2DT5 A;  2IGO A;  1TWF J;  3CUQ C;  2DFH A;  4EJW A;  1D5Y A;  2XSD C;  1POG A;  2FXA A;  2BHY A;  3K70 D;  4PZJ A;  2MLG A;  3I64 A;  4O3M A;  3AG1 H;  4BBR J;  2H1K A;  3FMQ A;  1FEX A;  4XL9 A;  1ZR2 A;  5E3O A;  2WY8 Q;  1G4D A;  1WJA A;  5AIQ A;  3CCS I;  3G2B A;  3LAP A;  2BY3 A;  2PLY A;  1HW5 A;  1G3Y A;  3L2C A;  2QZ8 A;  2FEZ A;  3GLX A;  2XC7 A;  4ABZ A;  2L7K A;  2LKP A;  2KIM A;  3K1N A;  4LIV A;  1QZY A;  3Q9V A;  3I59 A;  4XKC A;  2KRH A;  3JRC A;  2M3A A;  4GCV A;  2KKO A;  3HM5 A;  4GXO A;  4ZYG A;  4ESB A;  5J40 A;  1X1B A;  1YYV A;  4CH7 A;  4RDU A;  3V8K A;  1X3U A;  1U0J A;  5LLQ A;  1XDS A;  2WV0 A;  3FXU A;  2O7O A;  2O3F A;  4PFP A;  4DJA A;  1MDM A;  2K85 A;  1R9T J;  2OQR A;  3TKY A;  3TW6 A;  3V4G A;  2ZNZ A;  3VYU B;  5CQG A;  2DMT A;  2IT0 A;  3I53 A;  4BQQ A;  4IHS A;  2V7F A;  4M3D A;  3QPS A;  2F6C A;  1ZKG A;  2ESH A;  4RM3 A;  5EDN A;  3TED A;  3K9T A;  4QIW N;  3F72 A;  2XAU A;  3ZQ7 A;  3UR3 C;  5JFR A;  3WU0 A;  2EV6 A;  2X4H A;  1XMX A;  3HZJ A;  2LOO A;  3CF2 A;  2XF6 A;  3E5Q A;  2CMP A;  3X2Q H;  5BNG A;  3ZMS A;  4YIF A;  2H09 A;  2VB6 A;  3SDB A;  4EJU A;  3V7C A;  3EPZ A;  1Y6I A;  2Z5U A;  3KYD B;  4BXF A;  2O61 A;  4IOC F;  1U9N A;  2NS0 A;  2VPR A;  3I9V 2;  2CQX A;  1MBF A;  3HPH A;  1KGS A;  3J81 K;  1RR8 C;  1KU7 A;  2MAB A;  2MFZ A;  2VKE A;  2L3D A;  1Z6R A;  1K7A A;  3J81 Z;  3D5L A;  5BOX A;  4XRS G;  2RQQ A;  3GTG J;  2HQA A;  1UCR A;  4AID A;  3IRQ A;  4ANJ A;  1RI7 A;  2E2H J;  3L00 A;  3S14 J;  4NDL A;  3CF5 F;  2H6B A;  1KU3 A;  2G7H A;  4B48 A;  3J7Y J;  1Z6T A;  2Y31 A;  2BOL A;  4A69 C;  3BG5 A;  2M0C A;  3H9Q A;  4Y7N J;  2EPF A;  5TJJ A;  4EM2 A;  5D5V B;  3J7A O;  3CES A;  3WTS C;  4WF2 A;  1X2N A;  5ILS A;  2A5W A;  2O6G E;  2Z3Y A;  2E2J J;  4DNC A;  2R93 J;  5EGO A;  1T98 A;  2DPU A;  3IH3 A;  1JE8 A;  4XIC A;  1KQ8 A;  3A0H C;  4JBA A;  3K4M A;  5IYD J;  1A6I A;  2LRE A;  4M3G A;  3KET A;  4NQW A;  1TWG J;  2EK5 A;  2WWY A;  1DP3 A;  4XRM A;  4KIS A;  5JR3 A;  3QPH A;  2KIS A;  5CJ9 A;  4BEH B;  2JA8 J;  4IRG A;  4M6V A;  3ZQH A;  1XCB A;  3LMM A;  4HX4 A;  4BU2 A;  3K6G A;  3I56 I;  1GDT A;  5FKN A;  4MFE A;  3ABM H;  2EV5 A;  3S2H J;  1PP8 F;  1IV6 A;  2HYF A;  3FXR A;  4HPQ A;  2GLO A;  2HQN A;  2XB0 X;  2JVG A;  4LIT A;  1XMK A;  4ZDP A;  5JLX A;  1MSE C;  2AXT C;  1NHA A;  2ZBK A;  3IRR A;  2D1V A;  1FLI A;  2VAS A;  3ERE D;  2F5E A;  5E1W A;  4WX9 A;  4KMU X;  1WPK A;  3ZGK A;  4CCO A;  3CTA A;  1BC7 C;  2WTE A;  1H8A C;  5B3S H;  5IOY A;  3A01 A;  3HOY J;  5LFA A;  2IA1 A;  2HPM A;  1PVE A;  4E4H A;  1S72 I;  2EWN A;  4HEA 2;  2CUJ A;  4ETS A;  3L1P A;  2R7O A;  3BR2 A;  1FYM A;  1I50 J;  4FX0 A;  2GBY A;  4RB3 C;  4I2O A;  2BVM A;  2QQB A;  1FSE A;  3QPL A;  4HQM A;  4LFU A;  4LMY A;  1DPU A;  1FIA A;  3WTT C;  1FOX A;  4BBS J;  4JX4 A;  2XUB A;  2HQ5 A;  3O3K A;  3AG3 H;  1BR4 A;  4CXF A;  2C6Y A;  3CJT B;  1QZZ A;  1DUX C;  1A31 A;  1HC8 A;  4Y17 A;  4ZH4 F;  3CD6 I;  2PMU A;  1OKR A;  5DM6 F;  3U1K A;  2FNA A;  2GAU A;  4FX4 A;  3OYE A;  2YR2 A;  3E3V A;  2IS6 A;  5B1B H;  1DU6 A;  2DJI A;  4XLE A;  4E7H A;  2CG4 A;  5M3M J;  1GXP A;  5E17 F;  2OV7 A;  3ONQ A;  2XPU A;  4Q48 A;  5J8C A;  1AA7 A;  2IXS A;  3R61 A;  2VOO A; 
#chains in the Genus database with same CATH homology
 5IPA A;  1AKH B;  2E1O A;  1VF9 A;  5K7Z A;  4FTH A;  3HOV J;  5IYC J;  3JR9 A;  2IEK A;  2CUF A;  2LTP A;  2HOT A;  3NAR A;  3RZO J;  4C3I J;  2M9H A;  3C2B A;  2OPT A;  3ZQL A;  2D5V A;  4XRS A;  5J1R A;  1P7J A;  3JRG A;  2VI6 A;  3M4O J;  2X48 A;  1OCT C;  4BY7 J;  3TP3 A;  5GP9 A;  2XGD A;  3CDL A;  2Y9Y A;  1IRZ A;  2K9S A;  1HDD C;  4CYC B;  5GPA A;  2ZB9 A;  3GBG A;  2XPW A;  3BQZ A;  1IDY A;  3ZOB A;  1RKT A;  3HDD A;  3BT9 A;  3GTJ J;  5F27 A;  2LR8 A;  5C4J J;  1RKW A;  1JKO C;  3UKG A;  1JTY A;  2DJN A;  2DMN A;  1ETX A;  2DTZ A;  2WB1 N;  2CU7 A;  2DA3 A;  3LSG A;  4MO7 A;  1SFO J;  2DN0 A;  4UUS A;  5EG0 A;  2LD5 A;  1WH5 A;  3FKI J;  1ZK8 A;  3S17 J;  1I6H J;  2JMW A;  1TWA J;  2LVS A;  2EBI A;  3ZQI A;  1HCR A;  2MW8 A;  3BG9 A;  5M5Y J;  5FKO A;  5K7F A;  1MBJ A;  5IP6 A;  4DYR A;  1IGN A;  3JRF A;  1RPW A;  3GTQ J;  2DA4 A;  3F0C A;  1ETK A;  4BKX A;  2VKV A;  4QSH A;  1IUF A;  5K7H A;  3O8H A;  1GV2 A;  2GM4 A;  3QQA A;  1I3Q J;  4DZJ A;  2COB A;  4A3C J;  2K40 A;  2XGC A;  1UG2 A;  2QF7 A;  3HOX J;  2XPV A;  1BJZ A;  1JKR C;  1JT6 A;  3A02 A;  1ETO A;  1X58 A;  3OIO A;  1AHD P;  3BR5 A;  4UUS B;  2NS8 A;  5FKL A;  5DS9 A;  4Y52 J;  4AYB N;  4A3L J;  2R0Q C;  1W0T A;  2G0E A;  2HYJ A;  2HOS A;  5IYB J;  1F36 A;  5IP9 J;  3JRB A;  2P81 A;  1TWH J;  1APL C;  2R5Z A;  2CJJ A;  2MG4 A;  1VFC A;  5EZG A;  2TRT A;  2LY9 A;  2DMQ A;  4XID A;  2I10 A;  4LOC A;  5C4X J;  3BR0 A;  3GTO J;  4BXX J;  3IH2 A;  2EZH A;  4G12 A;  5M3F J;  1MH4 A;  1JJ6 C;  1Q1V A;  3S16 J;  5EGO B;  3HEF A;  2YS9 A;  1ORK A;  2HI3 A;  3RQI A;  3IV5 A;  3WHB A;  2FD5 A;  3G1L A;  2B63 J;  1HOM A;  3JRE A;  1NTC A;  2NVX J;  2JWT A;  2R7Z J;  2EZK A;  3TP0 A;  3BG3 A;  1FTT A;  1JJ8 C;  2LKX A;  1O4X A;  1Z77 A;  2FQ4 A;  3OOU A;  2X6O A;  4C3H J;  2AHQ A;  1MBH A;  4IHV A;  1ETQ A;  2FJ1 A;  3A03 A;  4QTR A;  3RZD J;  2NVQ J;  2EH3 A;  3SJM A;  3MN2 A;  1Y1V J;  2FX0 A;  4L5E A;  3RKQ A;  4D5C A;  4D7N A;  1B8I B;  3S1N J;  2M8G X;  1F43 A;  4J19 A;  3S1R J;  3OSG A;  2K9N A;  2Y2Z A;  3B6A A;  5F08 A;  1VI0 A;  3HBL A;  4A93 J;  3HGY A;  4A3M J;  5EYR A;  3H3V K;  2ELK A;  3BTC A;  1BL0 A;  4FCY A;  2ME0 A;  2O8K A;  2EQR A;  4A3B J;  1TWC J;  4A3G J;  2E19 A;  5FKK A;  5C44 J;  2HDD A;  3E7L A;  4A3J J;  1JKQ C;  1BW6 A;  2O9L A;  3O8G A;  4MIM A;  5EEA A;  3G1M A;  1ZGW A;  3LSR A;  1QVT A;  5J3L A;  1IG7 A;  2ID3 A;  2NVT J;  1IJW C;  3S1M J;  4M3F A;  1RES A;  2CQQ A;  3PM1 A;  1H88 C;  2XRL A;  1JT0 A;  5IP7 J;  1JUS A;  3GTL J;  1ETY A;  2L7Z A;  3K7A J;  1MBG A;  4MFD A;  2Y30 A;  3MKL A;  2ID6 A;  3VPR A;  2R5Y A;  2R5Y B;  5M5X J;  4AUX A;  3Q3S A;  1MBK A;  4IHX A;  1WGX A;  2YUS A;  1QRY A;  4DYC A;  1LE8 A;  1WI3 A;  1B72 A;  1LFB A;  2HXI A;  1T33 A;  4UUT A;  3BTI A;  3GTK J;  4A3E J;  1ETW A;  3FK6 A;  1XS9 A;  2E2I J;  3GTP J;  2JN6 A;  1MH3 A;  3BQY A;  5JLW A;  3BR1 A;  3S2D J;  3OSF A;  1OFC X;  4X1E A;  3JRH A;  1MSF C;  2HOA A;  2DMU A;  1TWF J;  1Y1W J;  3S15 J;  2XB5 A;  2R5Z B;  1D5Y A;  4M3E A;  2XSD C;  1POG A;  2M2E A;  3CQZ J;  4I6Z A;  2DA6 A;  2Y0S N;  1QPI A;  4BBR J;  3Q0U A;  2H1K A;  2VUM J;  1FEX A;  1FTZ A;  1ZR2 A;  5E3O A;  3GTM J;  1JKP C;  5J1U A;  3MVP A;  3PO3 J;  3CCY A;  2YU9 J;  3Q0V A;  1JTX A;  1BW5 A;  3BTL A;  3HOZ J;  1U78 A;  1GVD A;  1WH7 A;  4ABZ A;  1YRN A;  1RET A;  2EZL A;  5EF6 A;  1K61 A;  1B72 B;  5IOZ A;  3JRC A;  1A5J A;  2RAE A;  3HM5 A;  1H89 C;  1JUP A;  3JRD A;  1VND A;  2MGQ A;  4RDU A;  3TW7 A;  1LFU P;  2Y9Z A;  1UMQ A;  2O7O A;  2LP0 A;  3BTJ A;  2L9R A;  2XGE A;  1ZR4 A;  1T56 A;  3CMY A;  2EZI A;  1R9T J;  4DZP A;  1LE8 B;  3TW6 A;  1SAN A;  1OCP A;  2DMT A;  5FKM A;  4D7M A;  4M3D A;  5F0C A;  5F0H A;  3QPS A;  3BR3 A;  1ZKG A;  2L7M P;  5EDN A;  1MNM C;  4RBO A;  3TED A;  5M5W J;  3LNQ A;  4QIW N;  3SFI A;  4C3J J;  4B3A A;  1RR7 A;  5GPC A;  5E3N A;  3K2A A;  5BNG A;  1Z0X A;  4GFB A;  3HOU J;  1HDP A;  4MLO A;  1WCM J;  1QVU A;  1ITY A;  4BY1 J;  2R92 J;  1U9N A;  2VPR A;  2LK2 A;  2CQX A;  4B4C A;  1MBF A;  2AO9 A;  2DA7 A;  1S7E A;  4S0H B;  1EF4 A;  2CRG A;  1B8I A;  4V2G A;  3IH4 A;  3M3Y J;  2ECC A;  2VKE A;  1GV5 A;  2WAQ N;  2DA2 A;  3B6C A;  4HNV A;  4XRS G;  3GTG J;  4I76 A;  3HB9 A;  2IAI A;  1G2H A;  1JUM A;  2E2H J;  3DEW A;  1P7I A;  4JX5 A;  3S14 J;  3G1O A;  1BA5 A;  4NDL A;  5F04 A;  1OJL A;  1ZQ3 P;  5DTD A;  2Y31 A;  4DW6 A;  3H0G J;  4A69 C;  5J1Y A;  3BG5 A;  2M0C A;  4Y7N J;  4CYC A;  5EZH A;  1X2M A;  5E3M A;  1TC3 C;  2JA7 J;  9ANT A;  2WV1 A;  1X2N A;  3NAU A;  4A3K J;  3LOC A;  3HOW J;  1IC8 A;  2N8G A;  3FIW A;  4V2F A;  2E2J J;  2R93 J;  5EGO A;  3IH3 A;  4XIC A;  2W48 A;  1DU0 A;  5IYD J;  4M3B A;  2M34 A;  1A6I A;  1HLV A;  4M3G A;  1TWG J;  2JA5 J;  4XRM A;  4A3I J;  2H8R A;  5FLM J;  2X9D A;  4EEF G;  2JA6 J;  2JK3 A;  1NK2 P;  4A3F J;  1K83 J;  3HGG A;  2JA8 J;  1GUU A;  4IHY A;  4M6V A;  3ZQH A;  1PUF A;  4JYK A;  5FJ8 J;  3DCF A;  3LSP A;  1YRN B;  1E3O C;  1GDT A;  2HXO A;  5FKN A;  1ENH A;  3W6V A;  4MFE A;  2DA1 A;  1HF0 A;  2NVY J;  3WHC A;  4FIS A;  5C3E J;  2KT0 A;  3HKZ N;  3Q0W A;  3S2H J;  1W0U A;  1IV6 A;  2GLO A;  2XB0 X;  5HOD A;  2LFB A;  3FIS A;  1XC5 A;  5JLX A;  4FE7 A;  1MSE C;  4DYQ A;  4IEJ A;  4B1R A;  2LLK A;  4W1U A;  2KDZ A;  1ETV A;  2CUE A;  4JP0 A;  4D5F A;  2NS7 A;  2JJ7 A;  1WPK A;  5F0F A;  1H8A C;  1UHS A;  1AKH A;  5IOY A;  1AU7 A;  1U9O A;  3A01 A;  3ZQC A;  3HOY J;  3PO2 J;  4AC0 A;  3BR6 A;  3L1P A;  3BR2 A;  1NK3 P;  2OF7 A;  1I50 J;  2GBY A;  3ZQG A;  3LSJ A;  2NOG A;  1U8B A;  4JX6 A;  1IDZ A;  2ECB A;  3QPL A;  3A01 B;  1CQT A;  1FIA A;  3ZQF A;  4FE4 A;  2TCT A;  4BBS J;  3JRI A;  4JX4 A;  4XK4 A;  2HQ5 A;  3I4M J;  3JRA A;  3SDG A;  2QCO A;  2L7F P;  1GT0 C;  1FJL A;  5F1J A;  4A3D J;  2MSY A;  5FLV A;  2DA5 A;  2PMZ N;  1MBE A;  3S1Q J;  2DMP A;  3I4N J;  3D1N I;  5E3L A;  2IBD A;  4X6A J;  1DU6 A;  3FK7 A;  1FIP A;  1JGG A;  5M3M J;  1XG1 A;  4IHW A;  4C2M J;  5EG0 B;  2XPU A;  2K9Q A;  2ME6 A;  1ZTR A;  1PUF B;  4W97 A;  2L0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...