5IYBJ

Human core-pic in the open state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iybJ00
3G1LA 4M3FA 3IH2A 2CQXA 2DMPA 1JKOC 2JA5J 4QIWN 2P81A 1CQTA 3M4OJ 2W48A 3ZOBA 2EQRA 2CUFA 1Z77A 3BR6A 4MO7A 3BT9A 2KDZA 5EZGA 1QVUA 3JRBA 3B6AA 2TRTA 5IOZA 3CMYA 3MVPA 4A3LJ 3Q0WA 4IHYA 3JRAA 1QPIA 2HOTA 3BTLA 3JRFA 1ORKA 2GLOA 2M0CA 1FIAA 4JX6A 3K7AJ 3CCYA 3HBLA 5FJ8J 4BBSJ 3MN2A 2XRLA 3LSPA 1MBGA 1ZQ3P 2QF7A 5F0HA 1OCTC 3PO2J 1VI0A 3SFIA 3S14J 3S2DJ 1POGA 4A3BJ 1ZGWA 1AU7A 4A3DJ 2R93J 3TW7A 2JA8J 1TWHJ 3JRHA 3S1QJ 2IEKA 1AHDP 3A03A 5IP9J 1ENHA 1W0UA 2Y0SN 1K83J 4A3KJ 1GDTA 3DCFA 5FKNA 1XS9A 2WV1A 1TC3C 4ABZA 4A3FJ 1ZKGA 1ETXA 9ANTA 4XRSA 4JYKA 1JKPC 1FIPA 1WI3A 1JUSA 3A01A 2Y9ZA 5IPAA 2XSDC 3TW6A 4AUXA 2LVSA 3WHBA 4DYCA 1YRNB 2O9LA 1FTTA 2YUSA 4XK4A 1JTXA 4I76A 1JT0A 1P7JA 3O8HA 1P7IA 3IH3A 1BJZA 3F0CA 3HOZJ 3GTKJ 3GTLJ 4MLOA 1RPWA 4M6VA 2DA6A 2MG4A 2ME6A 4D5FA 1JJ8C 1T56A 4MIMA 4A3JJ 1ETOA 1MH3A 2LLKA 2HDDA 5K7HA 2JK3A 3BG5A 4A3MJ 5JLWA 2LKXA 5EG0A 1MBFA 4FCYA 2MGQA 1APLC 3BR5A 3LOCA 1TWGJ 2NVYJ 2ECCA 2H1KA 1PUFA 3D1NI 1MBKA 1ZTRA 2JA7J 3FISA 2E2IJ 3QPSA 4BBRJ 2VI6A 2ID3A 4IEJA 5C4JJ 2XGEA 2DJNA 2Y2ZA 4A69C 1IC8A 3BQYA 2R7ZJ 3MKLA 2B63J 1H89C 1TWCJ 1B72B 3LNQA 1RR7A 2FJ1A 4DZJA 3I4MJ 4IHXA 5M5XJ 5M5WJ 3WHCA 4C3IJ 2M2EA 1T33A 4J19A 5BNGA 3BR0A 3NARA 3RZDJ 1JT6A 2GBYA 2I10A 5IYBJ 2R5YA 2FQ4A 1Y1VJ 2HOAA 3S2HJ 1RKWA 3JRCA 2O8KA 2OF7A 3FIWA 3NAUA 1IRZA 1TWFJ 3HKZN 1OJLA 2CQQA 3G1OA 4XRSG 2NVXJ 2ZB9A 4W1UA 2Y30A 4BKXA 4A3EJ 2LD5A 5IOYA 5C3EJ 5M3FJ 1IGNA 4A3IJ 2DA2A 2LR8A 2VUMJ 3HOYJ 3JR9A 1LFUP 4D7NA 5HODA 1MSEC 2IAIA 1WGXA 1H8AC 5F08A 1U78A 1XG1A 2R0QC 3Q0UA 2VPRA 2L7ZA 2MW8A 3HEFA 3IH4A 5E3LA 1GV2A 4MFEA 4B4CA 3JRDA 3BG9A 3BQZA 3HGYA 4FTHA 1MSFC 3K2AA 3A01B 2DA4A 2R5ZA 2FD5A 3L1PA 5J3LA 1I3QJ 5FKKA 2ME0A 2FX0A 4M3GA 4L5EA 4X6AJ 1Q1VA 2TCTA 3A02A 5EGOB 2CRGA 3IV5A 5FKOA 2YU9J 2XPUA 4FISA 5EYRA 3LSGA 2DN0A 1ETVA 4UUSA 3FK6A 5FKMA 1Z0XA 5EEAA 3CQZJ 4FE7A 2MSYA 3SDGA 2JJ7A 4RDUA 1F36A 1B8IA 3CDLA 4C3JJ 1JKRC 2DTZA 5GPAA 3VPRA 5GP9A 2L0KA 4W97A 1WH7A 1B72A 1FEXA 1JKQC 4D5CA 5GPCA 3ZQFA 4JX5A 3I4NJ 5F1JA 1HDDC 2JA6J 1ETWA 3BTIA 3H3VK 1MBHA 1X2MA 2CUEA 3ZQCA 3C2BA 1GT0C 2EZHA 2YS9A 3GTMJ 2XB5A 3HM5A 5FLMJ 3DEWA 1U8BA 2K40A 3B6CA 4A3CJ 4M3EA 4RBOA 3SJMA 1EF4A 1UG2A 2DMQA 5F04A 2WAQN 3BR2A 2EZKA 2HXOA 4AC0A 2IBDA 2DMTA 1X58A 3LSJA 2HOSA 1BW5A 2K9NA 3ZQLA 4XIDA 1JGGA 5DTDA 1HF0A 3RKQA 4DYRA 1OFCX 4XRMA 2EBIA 2N8GA 4HNVA 2LP0A 2LTPA 4AYBN 1JUPA 1AKHA 2X6OA 4BY1J 1X2NA 2D5VA 1IV6A 1YRNA 3JRGA 1RKTA 2VKEA 5J1UA 4FE4A 3HOWJ 4M3DA 2NS8A 4Y52J 4LOCA 1UHSA 1LE8B 3M3YJ 1Y1WJ 1IDYA 3LSRA 2CU7A 1MH4A 1UMQA 2ECBA 4BY7J 4B1RA 5K7FA 4V2GA 3FKIJ 5C4XJ 5IP7J 1WPKA 4QTRA 1E3OC 4V2FA 2JWTA 5EF6A 2L7MP 3PM1A 3O8GA 5EZHA 2JMWA 3TP0A 1A5JA 1H88C 5E3OA 4BXXJ 5J1RA 2M8GX 4I6ZA 2OPTA 1GUUA 3FK7A 5F0FA 1B8IB 2DA5A 4NDLA 1BL0A 1IUFA 1FTZA 4UUSB 4A3GJ 3H0GJ 1WH5A 3BG3A 3S1RJ 2K9QA 1VFCA 3S1MJ 2COBA 1SANA 4JP0A 4B3AA 3BTJA 1HOMA 2LFBA 2CJJA 1JJ6C 5M3MJ 1XC5A 5IYCJ 1O4XA 4MFDA 1NK2P 1JUMA 1U9NA 1MBEA 3GTJJ 4G12A 3ZQGA 4DZPA 4DYQA 4XICA 3OSFA 1A6IA 1R9TJ 1I6HJ 4S0HB 2E2JJ 1VNDA 3W6VA 2EZLA 2EZIA 2L9RA 3S17J 2M9HA 2Y31A 1ZR4A 1D5YA 1RESA 1QVTA 3JRIA 1LE8A 5E3NA 2GM4A 4X1EA 2Y9YA 3UKGA 2HXIA 3QPLA 1NK3P 2XGDA 2DA3A 1WCMJ 3QQAA 4DW6A 3OSGA 2DA7A 4D7MA 3HOXJ 3G1MA 1K61A 2VKVA 3RQIA 3TEDA 1VF9A 1TWAJ 3JREA 2HYJA 2X48A 3HGGA 2NS7A 2RAEA 2NVTJ 2QCOA 5IYDJ 2NOGA 4CYCA 3S1NJ 5JLXA 5EDNA 2G0EA 2AO9A 3BR1A 1HCRA 5F0CA 4UUTA 1ETYA 2R5ZB 1MBJA 3Q0VA 2X9DA 3OOUA 2R5YB 2DMUA 3Q3SA 2K9SA 2LK2A 5C44J 3GTPJ 2R92J 3ZQIA 1U9OA 2XB0X 2NVQJ 1BA5A 3PO3J 5J1YA 2HI3A 3OIOA 2E1OA 4C3HJ 5K7ZA 2LY9A 2AHQA 2O7OA 4JX4A 2WB1N 2JN6A 3GBGA 2XGCA 2XPWA 1PUFB 3GTQJ 2DA1A 5FKLA 1HDPA 3ZQHA 2E2HJ 3GTOJ 3BTCA 4GFBA 2L7FP 4QSHA 2KT0A 2XPVA 3HB9A 1DU0A 1JTYA 3HDDA 2E19A 5EG0B 2ELKA 1SFOJ 5M5YJ 4IHVA 1ZR2A 3HOUJ 1IJWC 2H8RA 5E3MA 1ITYA 1I50J 2DMNA 1IG7A 4A93J 3BR3A 1ETKA 5IP6A 5EGOA 2HQ5A 1FJLA 4CYCB 1ETQA 1ZK8A 4EEFG 3RZOJ 2M34A 4Y7NJ 3S16J 3GTGJ 1HLVA 1OCPA 3HOVJ 3TP3A 4M3BA 1BW6A 2ID6A 1S7EA 5F27A 1G2HA 1LFBA 1F43A 2PMZN 1DU6A 3S15J 1GV5A 1GVDA 5DS9A 1MNMC 1W0TA 1NTCA 1AKHB 1RETA 1IDZA 2EH3A 5FLVA 4IHWA 3E7LA 4C2MJ 1QRYA
chains in the Genus database with same CATH superfamily
4M3FA 1R1TA 3SXYA 2EB7A 1JE8A 3M4OJ 1FOXA 3WTYC 2W48A 1ZRFA 4KMFA 2L02A 3N4MA 2MLGA 4MO7A 5EEGA 1ACIA 2KDZA 1R71A 3CUQA 4HQEA 2Y48A 1QVUA 2IS6A 3B6AA 4XLEA 4WF2A 4LK0F 1JXSA 4A3LJ 4IZZA 2HPIA 4U88A 3WG9A 5K5QA 2LBFA 4AIHA 5ERIA 2V7FA 3F22A 1ORKA 2H27A 1YJ9I 2KL4A 1Y39A 1U3EM 1FIAA 5GAHJ 1VQPI 2VASA 2R7XA 5B1BH 4LFUA 2XRLA 2ELJA 2NS0A 3PJRA 5GAGJ 2BOLA 3ULQB 2HQAA 3CC7I 4RGSA 3FWEA 2QLZA 3S14J 3S2DJ 1POGA 5CJ9A 1AU7A 2RKHA 1UAAA 3WTZA 2PQ8A 1XDUA 3PSFA 1OQYA 2JA8J 4CH7A 3JRHA 1EH6A 2AS5F 1BI0A 1MMAA 5IP9J 2EFPA 1ENHA 1W0UA 2Y0SN 2ZNZA 5E1WA 1D3YA 2XC7A 1V3FA 1BOAA 3DCFA 1IRGA 4LB5A 4A3FJ 1ZKGA 1ETXA 9ANTA 3OYNA 1FOWA 4LIUA 3N97A 3WG7H 2M8EA 2CWEA 3A01A 1JUSA 1MKMA 4BEHA 3OL4A 2VT3A 2OU2A 4M6XA 3CJQB 3KP7A 4BYYA 3ZMSA 2XSDC 4AUXA 4DYCA 1YRNB 2PJRB 1LJ9A 2OAZA 2YUSA 4BJTA 1AOYA 3PNTA 3HC7A 5CVVA 4N9IA 1SMTA 1OCZH 2M87A 4OIPF 3I54A 5KAFC 2K9LA 1A31A 3KYDB 1XD7A 3A2KA 3DBLB 3F6VA 2DO7A 3I59A 4M6VA 1OCCH 2V9VA 4KT5C 1TL8A 2ME6A 1ZG3A 3ASNH 1ZGJA 1SAUA 1T56A 3KP3A 3RTRA 4A3JJ 1MH3A 3NRVA 4ZYGA 2IGNA 1U5TC 4RLQA 3BG5A 3F23A 4AYBA 4ZZDA 3LMMA 2RN7A 1FY7A 4HEA2 1PVEA 4Y33A 4L0YB 1QU3A 2R7FA 1APLC 2L9SA 4LMYA 3DBRB 1SD4A 3ZQQA 5K5RA 3D1NI 3FXRA 3I0TA 1YW9A 1ZARA 1RC9A 3QPSA 4BBRJ 3F21A 1T0FA 1O7LA 2VI6A 2CMPA 4IEJA 4IRHA 2VBXA 2GOXB 3KP5A 2ZFWA 2K4JA 1XSXA 2DJNA 2XGEA 3GLXA 5AIPA 4A69C 1WVRA 2R7ZJ 2KJCA 1Z91A 2R4GA 4Y15A 4KMUX 4ZH4F 2K7LA 3EYYA 3PIPF 2C6YA 4UNOA 3H3ZA 2VIXA 3W2WA 2X51A 3HHGA 4RLFA 5LGUA 1HC8A 3DKXA 2Z99A 2R7TA 1SVLA 5FRMA 5D5XB 3CF2A 1WJBA 4J19A 2E7WA 1NG6A 2Q8KA 2DFIA 2HQRA 3EUKL 3TQNA 1W36C 2DI3A 4AIDA 3GYHX 2LY1A 2P7VB 1WJ5A 2XAUA 3HHHA 4FT8A 3T5XA 2IGKA 4Q48A 5HLGA 1MJAA 3CO7C 1P2FA 3DTEA 2DDAA 3CCUI 4MEXF 1E2XA 1VQ4I 2CQQA 3ZN0A 3L9FA 2D1VA 1H9GA 2NVXJ 2ZB9A 4OAZA 5IOYA 2LR8A 2VUMJ 2OC6A 4D7NA 3WTSC 4G6QA 5A2QZ 2X1CA 1H8AC 5DM6F 3M8FA 2VPRA 4PFOA 3JRDA 1FBUA 5L3FA 2A07F 3S32A 1BC8C 4KIGA 5GTIC 1ZG5A 2QUFA 3J7ZI 2BXYA 4PSWA 2DJIA 2FQ3A 3HGYA 1MSFC 3A01B 3L2QA 1FNNA 4EJUA 4Y17A 4M3GA 3OYIA 2PLYA 2WV0A 4I0AA 3W6KB 2EFQA 3A4CA 2VBYA 5HS7A 3LSGA 5F64A 3CCEI 3K4MA 1USSA 1ETVA 2O3FA 4OU0A 4UUSA 2XROA 2QBYA 1Z0XA 3WODF 1MW7A 2E1CA 1P92A 2MSYA 3TKYA 4RDUA 2MH9A 1OLTA 2DT6A 4C3JJ 4BDYA 2DTZA 1B72A 2ZKZA 1Y0NA 2ZXHA 3L7WA 4JX5A 3IL2A 4XLPF 3I4NJ 2K3PA 4BACA 2V26A 2IS2A 4BXUA 5E1ZB 1HDDC 3GFLA 3FF5A 2EILH 3CCMI 1ETWA 3H3VK 1X2MA 3OS1A 2CUEA 5H6QA 3P9IA 4YEJA 3DF8A 1NHAA 2HZTA 5FLMJ 1U8BA 2MC4A 2PMHA 3OYLA 3P5JA 3OYCA 2WAQN 3OYJA 3ZPLA 1UHWA 2HXOA 2CW0F 4IVNA 5ILUA 3J81Z 5D4SA 5J8FA 2HOSA 1MMDA 2K9NA 3IAS2 5L3BA 4PFPA 4PGGA 1HF0A 1USTA 2HS5A 4DYRA 3G3ZA 3H9JA 3H0DA 4I2OA 3AFHA 4AYBN 1BR4A 2KP6A 1UJ8A 3ESWB 2X6OA 3VYUB 1V5FA 1WJCA 4ITVA 4CCJA 1YRNA 2D5VA 3VWBA 1LKXA 4HW0A 1DGRM 4XLAA 3FMQA 4KNYA 3IHUA 2M4GA 4LOCA 1J7KA 4IF4A 4LJZF 2MD0A 4EJOA 1Y1WJ 4G9YA 3DWLE 3U9GA 3RPUD 4I99C 5A2QK 3LAPA 4B1RA 5K7FA 2DTRA 3FKIJ 1AA7A 2VOOA 2HYFA 4HNTA 1WPKA 4V2FA 3HOSA 1LQ1A 1RZ4A 3I71A 3LQQA 5IY5H 3VYRB 4FQGA 1H88C 5L3DA 2P5VA 3CTAA 5E3OA 4BXXJ 5J1RA 2M8GX 2J5OA 4L5IA 3GF2A 4RB1A 3GLLA 1ZG1A 1V55H 3F8BA 4UUVA 3REOA 4KDPA 3CDIA 1B1BA 2BVMA 1VFCA 3S1MJ 2HNHA 3GWZA 1IN8A 3HL2A 2HDWA 2UZKA 1IRZA 2D45A 1ZHFA 2B7EA 4BS9A 4JP0A 2EIMH 2K27A 4HV5A 1R23A 2F48A 1RUNA 2VJ4A 4BL0B 1HOMA 4N4OB 1HW5A 2E7XA 5JI6A 5FFZA 4HLYA 2YPRA 1JUMA 1J9IA 4B48A 1MBEA 3AG1H 3WGIA 3GTJJ 4DYQA 3CJTB 5ICFA 3E6MA 3WU1B 2DFEA 3LA7A 1R9TJ 4EATA 2YX7A 4BHPA 3U1DA 1S6LA 2XAGA 4HLXA 4DBRA 4GDFA 3NEUA 3GFIA 4MGRA 2L9RA 4XKCA 2M9HA 1OCOH 2CO5A 3G71I 2EV0A 1RESA 2WA0A 3SHFA 5E3NA 2ZJQF 2VONA 1TZLA 3UKGA 1I1SA 2HXIA 2WY7Q 5CLSA 3WE2A 3DEUA 1F5TA 2DA3A 5CVJA 4KFCA 2F5DA 1JHFA 1I39A 2DA7A 4LD5A 3ABTA 3HOXJ 5LD2C 3M7GA 2W4SA 1R5ID 3OS2A 2MYSA 3G73A 1O3TA 5TRDA 3U2RA 2HQNA 1VF9A 1T8IA 3E6DA 2RAEA 3PNVA 2QCOA 3BCAA 2YX4A 2K86A 1UELB 3J7YJ 3BZ6A 5CVIA 4AIKA 5DYMA 1HCRA 3GFJA 3PUBA 3V8JA 3CLQA 1MBJA 2VKHA 6PAXA 3KX2A 1S72I 2GA2A 2DMUA 3FMRA 2LK2A 5C44J 4WXDA 1Y8QB 1U9OA 2QQAA 2NVQJ 3IAM2 3S3OA 1G3SA 3UNGC 1NG7A 3QRFF 3BJ6A 2KMUA 3MZHA 1ZYRF 3GMEA 1WI9A 2MC3A 2LREA 3KYLA 2GAUA 2XGCA 1KONA 5JVTA 1VQ9I 4GXOA 4BHBA 3HRMA 3BOQA 1HDPA 3EPZA 3ZQHA 4GFBA 1BI2A 2WBMA 5CVRA 1YO5C 2Y75A 4CGZA 4OAYA 3LSIA 1BR1A 3HB9A 2QQ8A 1KU7A 5HS8A 1VZ0A 4I01A 3DU5A 4D0PA 4HSTA 4GYIA 2ELKA 3I5UA 3KFWX 5M5YJ 4MQ9F 4IHVA 3T8TA 5DDGA 3HOUJ 4BQAA 1IJWC 5E3MA 1I50J 2DMNA 3GO5A 1LUJB 1IG7A 4A93J 4XSZF 4M9ZA 1FJLA 1XPXA 4CYCB 5JFRA 3RZOJ 2M34A 1L3LA 4AWXB 2IA1A 3MMYB 2JA2A 1Z05A 4S05A 2PN6A 1OCPA 1N75A 4E7IA 3K0LA 2YU3A 1S7EA 2RQPA 1G2HA 3CCSI 3N05A 1GHCA 1X4OA 2ZFUA 3F8MA 5FLXZ 2ZC2A 3ZMUA 3RKWA 5DS9A 1MNMC 1MJBA 4BE1A 2KRHA 3K1NA 1MDMA 5FLVA 3OIPA 3E7LA 1R4MB 4E7HA 2CQ7A 2OCEA 2Y9ZA 2CQXA 1CQTA 2P81A 1QZZA 1SAXA 4N0BA 1YG2A 4E7JA 1J0RA 2W7NA 2P6SA 2JTVA 2IA0A 5EZGA 3T8RA 3ZXSA 4BE0A 3JRBA 1HKTA 5HVQC 4U0YA 2DPUA 2TRTA 5FB2A 5IOZA 1FBSA 3HZJA 5HLTA 3Q0WA 2FEZA 3QP6A 5CYVA 3CUQB 4ZTFA 3EETA 2HOTA 3MD2A 2HFHA 5D4RA 1D8KA 2HR3A 2GWRA 1ODDA 3I59B 1ZH5A 2DFHA 2PX9A 2DFFA 5BQTA 1EA3A 3OYDA 1HBXG 5FJ8J 3I4PA 1TNSA 2XRNA 1MBGA 3BZCA 1YJWI 1T95A 3SEQA 4P96A 1H0MA 5F0HA 1VI0A 2E34A 1BI3A 1DDNA 3JW4A 4BXFA 4DIQA 5H20A 4IOAF 3S8PA 2GOMA 1D1AA 4A3DJ 4ASNA 2ZXWH 2R93J 4GYGA 3TW7A 1R58A 3FHZA 1F9NA 2QA4I 3ABMH 1AHDP 4M73A 3MWMA 2ZO4A 2RNJA 1Z1DA 1K83J 4FETA 4AVPA 4A3KJ 2Z9OA 2NOJB 1VQ5I 1GDTA 5FKNA 1XS9A 2WV1A 3U21A 4NUBA 3RSNA 1KYWA 2CH0A 5HLHA 1FIPA 3CJNA 5FD6A 1WI3A 4ZYAA 4B8XA 1G6NA 3OYKA 1FTTA 2O9LA 3GVAA 2LVSA 3WHBA 1QO0D 4XK4A 3CC4I 2EV5A 3QODA 1P7JA 3ZMDA 2KISA 3O8HA 3HRTA 4XRFA 3VOEA 1BJZA 2M7BA 4XN0A 3C2GA 1ZLKA 3QU6A 3OYAA 3GTLJ 1DPRA 4MLOA 3RKYA 2PJPA 3WGHA 1G8XA 4PCQA 1KU3A 4ENKA 1JJ8C 4PJLA 2KHMA 4MIMA 2STWA 2D2WA 3HRUA 4HG2A 5K7HA 1OCRH 2JK3A 4LLNA 1SD5A 4A3MJ 5JLWA 1TP4A 2QSHX 2CV2A 2EA4A 3RYRA 1QGPA 3OYHA 2V6CA 2A5WA 2WADA 1RRJA 4UY8I 1E17A 1ON2A 2MGQA 2FSWA 2TDXA 2KRCA 3K4BA 3E0JB 5ILSA 3W2VA 1LDKB 2H1KA 1T39A 4R1HA 3O3KA 2HTSA 1T6SA 3IRRA 2JA7J 2DPDA 2M1BA 4ZYHA 1X1AA 3BJOA 2KIFA 2E2IJ 3CCVI 5CVUA 5C4JJ 1EKEA 1HA8A 1OYYA 3FHNA 1IC8A 3ERED 4G6TB 3DPUA 4IXAA 3MKLA 3FX3A 2IGMA 1IUYA 1H89C 1TWCJ 1LB2A 3HUGB 5TJJA 2KKOA 4OIQF 1IN5A 1RR7A 5ILVA 4KISA 5K5OA 3JCUC 3RPUA 5BPDA 4PJ0C 1D5VA 3K4CA 5DUIA 4IHXA 1D0ZA 3G6EI 5M5XJ 1OR7A 1O3SA 1ERDA 3AG4H 1Z9CA 1J5YA 1MZBA 3CDHA 3CP8A 4K2EA 3L2CA 2L5QA 1X4PA 2IPQX 2MBFA 3TO6A 1JT6A 2I10A 1FYMA 2R5YA 2NVUB 3GZ5A 1Y1VJ 2HOAA 3J7AO 2CQKA 3S2HJ 5D5WB 4NQWA 2LKSA 3HRSA 2O8KA 2OF7A 3FIWA 2HTJA 3NAUA 4GCVA 2ISYA 2DXIA 3OOPA 1OJLA 2KIUA 1P6RA 3P9KA 1EH7A 4YFNF 3ZMVA 2OQGA 2BHZA 4H0EA 4PK4A 2VC0A 4FX4A 2Y30A 4BKXA 4I7HA 4A3EJ 1YYVA 5C3EJ 5M3FJ 2CYYA 1IGNA 4A3IJ 1IXRC 2DA2A 2HU9A 3T1BA 2V79A 3FXJA 3FDYA 4IJAA 3JR9A 2HDCA 1LFUP 1KU9A 5HODA 2FNPA 2IAIA 3MFKA 2QYOA 4D1QA 1WGXA 3S3NA 1OKRA 2VKDA 3HEFA 3IH4A 1U8RA 1F1ZA 1Z3YA 1XTAA 3BG9A 1WQ2A 4RGUA 5JR3A 3QYFA 3M8JA 4A2UA 3K2AA 1KQ9A 2FD5A 2G9WA 3L1PA 2FX0A 1EV7A 2MA3A 3SEZA 4X6AJ 5KK1A 1HW1A 4KT6A 1ZGAA 2CRGA 3IV5A 4HAMA 4PZJA 3IRQA 2ETHA 4BH9A 4B43A 3FK6A 3A0BC 5FKMA 3UR3C 1Y6IA 3CQZJ 4FE7A 3CUOA 1DUXC 3LWFA 1IN4A 5JHUA 1B8IA 2FMLA 2PMUA 4W97A 4E70A 1FEXA 3D5SC 1ZLJA 3H9QA 3S2WA 3CCJI 4C9YA 1X1DA 2DOAA 2WC2A 2JA6J 3BTIA 5E1XA 3M07A 2V1UA 3C2BA 2QKLB 2MH2A 3IWZA 4HX7A 3GTMJ 2FE3A 3VSKA 2XB5A 3HM5A 1BC7C 4PJNA 3DEWA 4BJ6C 4IQJA 2BHYA 2Z1DA 2PI0A 3QYBA 3F8CA 4A3CJ 5ICEA 4RBOA 3SJMA 5TGTA 1GXPA 1EF4A 2DMQA 3ZN1A 4AC0A 2IBDA 4ZYDA 2W00A 4YFXF 2EV6A 3C3WA 1HW2A 4EQQA 3E1SA 3OWTA 4IO9F 2ISZA 5DTDA 3HPGA 4IX7A 2A6TA 3E5UA 3MZ8A 4XRMA 2P6TA 2N8GA 3GCMA 2LNBA 1U0JA 3EUHA 1SC7A 4A0YA 1RIOH 4OIOF 1LVAA 2LF8A 3WU2C 2F4MB 5DV5A 4C2TA 1JUPA 3SZGA 4Y13A 5LEJA 2FRHA 1YW8A 5DD8A 2VKEA 3KP6A 4IOCF 5L3GA 3HOWJ 4GGGA 1SEUA 3GEZA 2IT0A 1LE8B 3M3YJ 3LQRA 3LSRA 1SFKA 1MH4A 1QHHD 4CCOA 2EFWA 2XAJA 3PFYA 5ED4A 1YJNI 2ECBA 1S8NA 3RQ4A 2STTA 5C4XJ 3FXOA 4KUMA 2EIKH 2HKOA 4QTRA 2P5LC 1E3OC 2BXZA 2VB6A 2L7MP 1W5TA 3PNYA 5EF6A 3PM1A 3O8GA 5LGTA 4JQFA 3PIOF 1MJ9A 1YX3A 3LAJA 4ZDOA 2RV8A 1WJDA 1BR2A 4ZZLA 3LSTA 4M9SA 4NBQA 3K4LA 4I6ZA 3KZIC 2OPTA 3FK7A 4QWQA 4DBQA 1B8IB 2LOOA 4XLCA 1Z3XA 1BL0A 2R7RA 1IUFA 2D1HA 2RC4A 3H0GJ 3S1RJ 2K9QA 4UB6C 2FXAA 4OIRF 3U1KA 3CD6I 2X6XA 1SANA 1OMIA 3BTJA 1IRFA 1GVJA 3K1MA 2AXTC 2Y0SA 2LFBA 3ZQ7A 2EA2A 3WTTC 2LBFB 4LGWA 3FXUA 4BE2A 1RI7A 1XC5A 4CDGA 3NWTA 5LGNA 2J5PA 4MFDA 1I5ZA 1NK2P 1U9NA 5CQEA 4XOPA 3ZQGA 2W85A 2L2OA 2CQNA 4IPAA 4E7SA 2BEOA 2O5RA 2E2JJ 2QKMB 4YG2F 2IS4A 2F5CA 3VYSB 4U0WA 3W6VA 4LLGF 3R0JA 3S17J 1GLNA 1HQCA 3C7JA 3EYIA 2H94A 1G59A 1LE8A 2HZDA 1SVOA 2FNAA 4XNFA 2H6CA 4X1EA 5B1AH 2KDOA 1KYZA 3OYBA 3GX4X 1UFMA 4LITA 1GXQA 3QPLA 1WCMJ 5ICCA 3D0SA 4DW6A 4AVZA 1ZREA 4UHTA 1LDDA 3QYEA 1R22A 5J4YA 4Z6YA 3FZVA 5LRRA 4CA0A 3OYGA 3LSHA 3ASOH 3RQIA 1KA8A 1KZHA 3HGGA 5D5VB 5BOXA 2NS7A 1VQKI 3E97A 1MMGA 2CSOA 2X6WA 5J4VA 2H09A 5IYDJ 2R7OA 1YE9A 2YR2A 3K4JA 4CXFA 1G4DA 1YLFA 5LLQA 5JLXA 4F3QA 5EDNA 3DTKA 1IN6A 2AO9A 2ZNYA 3BR1A 4II2A 1ETYA 2E60A 2R5ZB 1T2KA 2W57A 3OOUA 4IRGA 3KLOA 3W6JB 1IO2A 5DUKA 2BW3A 1VQ7I 1KQ0A 3LA3A 4NC8A 2Q1ZB 1J09A 3PO3J 2HI3A 1LEAA 2E1OA 1YS7A 3DP7A 3BWGA 4C3HJ 2DDBA 2AHQA 2L54A 4XOTA 3QPHA 2WB1N 2JN6A 4CYDA 4UB8C 2XAFA 3AKZA 1WWXA 3BCBA 1PUFB 1QNTA 3GTQJ 1YIJI 1SFUA 3KZYA 4O3MA 4N4NB 4QSHA 2KT0A 2LH9A 2E19A 3I58A 2KQRA 4M74A 2Y69H 3KPHA 1FT9A 2WB1A 3FBNB 1FP2A 2H8RA 1YX5A 4ESFA 1U2WA 2L9VA 3DPLC 4AIJA 2VT2A 5EGOA 2HQ5A 3BG6A 3PQJA 4Y7NJ 4Y4RA 2VJIA 3PQKA 3GTGJ 1LEBA 3EUAA 5L3CA 3TP3A 2XGXA 3L2WA 2CG4A 3BPVA 4RM2A 1TT0A 1TBXA 1QPMA 3SDBA 4IHTA 2GQQA 1TTYA 2EPFA 1F43A 2DYSH 3BROA 2O0YA 3HUGA 4BGDA 2XAHA 5FROA 1DU6A 1GV5A 1GVDA 4GO1A 2CW8A 2PMZA 2V1DA 1BN5A 2CFOA 4FHTA 1NTCA 1AKHB 1IDZA 4XQFA 2XDVA 2GXAA 3IH2A 2DMPA 4QIWN 2DU9A 2O8XA 2MD5A 3DQVC 4FX0A 2IGOA 1IAWA 1BOBA 3BR6A 3BT9A 3QPTA 2ZJ2A 4HOBA 1YFHA 1W7PB 2VE8A 1Z7LA 3MQ0A 1J75A 2QZ8A 1X19A 1R7JA 3WE3A 3JRAA 5GAEJ 4PSXA 3BTLA 2LRDA 3JRFA 1V5GA 5KVRA 3KE2A 5DM7F 1VQ8I 2VBWA 2FBKA 1MDMB 3MN2A 4KA4A 4AD9A 4IKFA 1XN7A 4RGRA 2WWYA 3P9CA 4Q47A 1FX7A 3L2VA 1OCTC 4I02A 4X0GA 4O5VA 3PO2J 3I53A 1N25A 2UUZA 3ZCOA 2ELHA 1ZGWA 4CCKA 1TW2A 2Z16A 3DPTA 1TWHJ 1MGTA 1S9HA 3S1QJ 2R7UA 2CUJA 2DQRA 4ENJA 4EV0A 3A03A 2Z5UA 2ESHA 1XCVA 3I3LA 3L00A 2F5VA 3FM3A 4E7KA 2QWWA 3K4KA 4UV8A 3HOTA 1TC3C 4ABZA 5D8LB 4XRSA 3LSKA 1TNTA 3MCZA 1JKPC 4ANJA 2DQLA 5FO5A 3V7RA 5LHIA 4HF1A 1A35A 1FLIA 5IPAA 3ELKA 4B47A 1O7FA 2QM3A 3DV8A 4XKBA 3M1CA 1JTXA 4I76A 1K78A 1JT0A 4EJTA 1P7IA 2EFOA 4U0VA 2ZMEB 3IH3A 3PUFA 4H4KC 3F0CA 3HOZJ 2EINH 2GXGA 3BZKA 1PYVA 1RPWA 4DQ2A 2KFDA 4TV7A 2MFZA 4XL9A 3DLAA 4HNUA 5LBQA 3C18A 1K78B 4E6KG 2K4BA 2LLKA 2LKPA 4BQNA 2KIMA 3E6CC 4WCGA 4EGYA 2LKXA 2QBYB 3OR1C 1FMWA 3DKWA 2L4AA 5EG0A 1MBFA 2X6YA 4ZC3A 4FCYA 2IVMA 3H9GA 3ERMA 2P0WA 1W7PA 2VXZA 2JZYA 3MAJA 1YI2I 2XV4S 2WAFA 1N77A 1J2XA 2NVYJ 1PUFA 1ZTRA 2UWMA 2IP2A 1TT5B 2LF7A 1IXSB 2A6HF 2QQ9A 4ENNA 5E18F 1PUEE 2XHKA 1K7AA 4P55A 2K3FA 2GIVA 2UV1A 2YSRA 3LNQA 4B44A 5DCMA 4OWRB 1ONVA 1WSUA 1KGSA 3ISPA 4U7BA 1PP7U 2W24A 5M5WJ 1V5EA 3WHCA 1U6GA 2NNNA 2M2EA 2V1NA 1HSJA 1T33A 1UZCA 2E1MB 5BNGA 3CF5F 1FZPB 2GBYA 5IYBJ 4CSWA 3K6GA 2FQ4A 1HKQA 3J80K 1RKWA 3JRCA 2E35A 2L9NA 2LYCA 1X3WB 1YW7A 1TQIA 4A0ZA 4CCNA 4F55A 3F8NA 2XF5A 3G1OA 3HG9A 1JI8A 4XRSG 5E8GA 1CF7A 2JVHA 4A0XA 4BHCA 4RS8A 2LD5A 5HS9A 4J01A 1WJEA 4RB2C 3H3UA 3J81K 4ENMA 3HOYJ 1CGPA 3AAFA 1MSEC 2EK5A 2PEXA 4BNCA 3JTGA 2WY8Q 3CP2A 4DGWB 5F08A 3Q0UA 2L7ZA 2FOWA 1GV2A 2OV7A 4MFEA 4RB0A 1Y56A 3SFZA 1X1BA 4ZYEA 1MNEA 2LMDA 2HWVA 4L5EA 2P4WA 4BAYA 4LLLA 2TCTA 1VQLI 2KIQA 1YS6A 5FKOA 2Z33A 2XPUA 1IF1A 5FLXK 3BY6A 4R8HA 5J40A 2ZSHB 2L01A 4P5OA 1VTNC 2JJ7A 2QVOA 1F36A 5FD5A 1T98A 1JKRC 3VPRA 1STZA 1WH7A 2BBYA 1JKQC 4ESJA 2E1MC 5GPCA 2K02A 1V54H 2L7KA 2VODA 2F5EA 2A6EF 4LIVA 1MBHA 3KEQA 3GZNB 2L4MA 3H5AA 3TGNA 4YRVA 4UVBA 2EZHA 2YS9A 2VLAA 4D9JA 2H6BA 3KYCB 2O03A 2K40A 4HBLA 4M3EA 3TDUC 1B9MA 4G94A 2VQGA 3L2UA 2BW3B 1UG2A 2V1XA 1I27A 5F04A 3BR2A 1UB9A 2EZKA 4ZDPA 1L0OC 4Q4ZF 2DMTA 1X58A 3LSJA 1BW5A 1G3WA 2HPMA 4YIIA 1FWZA 2OZ6A 3FXMA 1WHUA 2M30A 1JGGA 1NH3A 3RKQA 4N9HA 1OFCX 3AL0C 3H5NA 2OBPA 5E20A 1D8JA 5DD4A 3AL0B 1Q1HA 2QSGX 2XKOA 2JUGA 4EVIA 3KP4A 3J80Z 1Z67A 5DCMB 1X3ZB 3MKWB 4UV9A 2OD5A 3WTWC 1W36D 1AKHA 4BY1J 5D6EA 2JT1A 3ABKH 1IV6A 1RKTA 2PFBA 3M8EA 3Q5FA 4HX8A 3M1EA 4FE4A 4C2UA 3T0YA 3F3XA 2EWNA 1X1CA 2BYVE 4Y52J 1Z6RA 3K2ZA 1D0YA 2HVQA 1BIAA 5J6XA 1IDYA 3L09A 2E71A 2DT5A 1UG0A 3OYEA 4HF2A 3OY9A 4BY7J 3F6OA 1JHHA 5EJCA 2DOEA 5BS6A 4V2GA 1S5LC 3RI4A 2W82A 5IP7J 4NB5A 1MMSA 3Q9VA 5EZHA 1TQMA 3DKYA 1B59A 2OUMA 1R49A 3TP0A 4Q5SF 2LDUA 1A5JA 4RB3C 2LG4A 4MTDA 2HVSA 1B4AA 4XM3A 2NNYA 3I56I 3V8LA 4P9UA 1GUUA 4U7DA 4WWCA 5KNLA 3MKYB 2EFNA 4ESBA 2FMYA 2ZSIB 4OMZA 4UUSB 1ZN2A 1WH5A 1QZEA 2VOPA 4F91B 1T08B 4L0ZB 4ON0A 1EJ9A 4B3AA 3C2HA 3E5XA 3ZR8X 3QOPA 3TDZC 1MMNA 3TL4X 1G3YA 5IYCJ 2R3SA 4XSXF 1A6QA 3DEEA 4G12A 3OSFA 3LFUA 1LFPA 1A6IA 2RVCA 2X85A 4NHJA 4S0HB 2KRFA 3C1DA 1R6RA 1VNDA 2QENA 2ACJA 2DBBA 4DOZA 3H36A 4KJZA 1RUOA 1DP7P 4IRIA 2Y31A 2W1OA 2P5KA 3HSEA 1QVTA 2W25A 1OISA 1R5GA 2JUCA 5BPIA 4HF0A 2GM4A 5KCMA 2Y9YA 4MTEA 3AG2H 1NK3P 3H1CA 4RA2A 2FF4A 1B9NA 1FC3A 3ZGKA 3TBIA 3QQAA 2BVLA 2RQQA 5HDGA 2AQEA 3OSGA 3G2BA 3G1MA 4HYEA 4E4HA 1K61A 5FRNA 1XMKA 2RDPA 3KIOA 2JSCA 1OYWA 3V42A 3TEDA 3VFZA 5IT9Z 1E0EA 2X48A 1KU2A 4LG0A 3V4GA 2K9MA 2NOGA 5J47A 2DW4A 1ZAOA 2M7AA 3S1NJ 1FBQA 1P9QC 2FOKA 1LVKA 3HSRA 3NWSA 4L9TA 2GXBA 1LDJA 4F52A 5F0CA 4HDVA 4UUTA 3Q0VA 4KICA 2X9DA 2ADUA 1HXDA 2R5YB 3Q3SA 2K9SA 2QSFX 2ZXIA 1J59A 4RGXA 2V6EA 3PL8A 1O57A 4EM1A 3ZQIA 2XB0X 2E5NA 1BA5A 2AQFA 4Z2YA 1TW3A 2VQHA 1FP1D 4YIFA 1M1EB 3J7AY 3NQOA 3K4NA 2A68F 5JHFA 3DBHB 2O7OA 2CUZA 4LB6B 1W1WE 2Q2EB 1W5SA 1H9TA 2DA1A 3GXOA 3BTCA 2L7FP 2PBIA 4KN4X 3IC7A 3V7CA 3E6BA 3HDDA 1A36A 5EG0B 4HSRA 3K10A 1SFOJ 3F72A 5F6FA 2KZGA 1ZR2A 3OR2C 2XUBA 1ITYA 2JVGA 4OOIA 2VJJA 2VL8A 3I64A 4UXNA 2BE5F 1ETKA 3TO7A 1DGWY 3OYMA 2XKPA 4UVCA 2WAEA 3EQLF 3TO9A 4EEFG 2G7UA 2KPMA 3G4SI 3KEOA 4LG3A 1K4SA 1R1UA 2OZUA 2ZMEC 3VEPA 1HLVA 2R7DA 4M3BA 1IN7A 2ID6A 4G7OF 2R7WA 3ECOA 2A05A 4I0BA 4KIBA 3HJEA 2PMZN 3X2QH 4CHUA 2XAQA 1TLHB 2F4IA 2XASA 4EMSA 3IKVA 1XCBA 1RETA 4CCMA 4IHWA 1E3HA 4C2MJ 1QRYA 3G1LA 2JA5J 2X1DA 1JKOC 4CUGA 3ECHA 1AWCA 1K79A 2LC2A 1XX5A 3ZOBA 2EQRA 2CUFA 1Z77A 2F6CA 3CO6C 5HOOA 2VN2A 4XLNF 4BQQA 5LFAA 3OS0A 2I8DA 1PDNC 3W2AA 2RGVA 1A04A 3CMYA 2VPLA 4HX4A 1XDSA 3MVPA 4WX9A 4BEHB 3HXLA 1DPUA 4IHYA 3K69A 2E5ZA 1QPIA 2F5FA 1VQNI 4G8XA 3OMYA 2PG4A 2HGCA 4C30A 1O3RA 3JTHA 5LHHA 2GLOA 2M0CA 4L5JA 3QOEA 4JX6A 3K7AJ 3CCYA 3RYPA 2Y0MA 3HBLA 4CICA 1N78A 4BBSJ 2MABA 4GRIA 3LSPA 1D1BA 3FBIB 4V19K 4ZDLA 1ZQ3P 2V4JC 2QF7A 3CC2I 3SFIA 3B73A 4A3BJ 4M72A 1YQAA 2JSPA 5L3EA 4BQOA 5GTHC 4CZCA 1QQIA 3F9KA 5CKTA 2IEKA 1RR8C 4XLFA 2ZJRF 4CZZA 3WTXC 3WGGA 4DJAA 2IRFG 3BG7A 3V8KA 2CV0A 2BY2A 1IXCA 2GZWA 4G6DA 4Y3OA 3TMOA 3A1YA 1FYKA 4M6YA 2R7VA 4JYKA 2DLLA 2MLKA 3CCQI 2CS3A 4EM0B 4NNJA 2P8TA 5B3SH 3BC8A 1REPC 3TW6A 2IW5A 4A5NA 1OR7C 2HVRA 2FU4A 4UVAA 4OMYA 1R00A 2ZJPF 3K1PA 4E7ZA 1FSHA 3DXJF 2VJ5A 1XGSA 1YIOA 2Q0OA 1Z7UA 3CJRB 4KITB 2IS1A 1WZ2A 5ICGA 3A0HC 3GTKJ 2ESNA 2DA6A 2MG4A 3CZ6A 2ZMEA 1MD0A 2GA1A 3CMAI 1UCRA 4D5FA 3KETA 2OJED 3GW2A 1RNLA 4QPQA 4XONA 3SZTA 1ETOA 2M0MA 2VQCA 1IZ1A 2EIJH 2HDDA 4XORA 3SYTA 4G7ZF 5E17F 3KP2A 3FXLA 2H8WA 4JOMA 2E36A 3ZRGA 4BUPA 3M9AA 1FOYA 1XSDA 3BR5A 3LOCA 1TWGJ 4JK1X 3O2PE 4MNUA 5AONA 2OTJI 4NC6A 2ECCA 4WXCA 4HRIA 3E3VA 1WJFA 2H1LA 2KLOA 2ICWG 1MBKA 4HV6A 3FISA 1OYIA 5H6RA 3FKJA 3TOBA 3EDPA 2ID3A 4PJJA 2WAQA 2Y2ZA 3ROUA 3R0AA 3BQYA 1W5CC 2CFXA 2NAZA 2B63J 3R6SA 3IWFA 2O6GE 1B72B 4YIRX 4E7LA 3CESA 3HTUA 2FJ1A 1VQMI 3Q9SA 3LL7A 4B09A 3B02A 1Y0UA 2JPBA 4U87A 1K6YA 5KHDA 1BBYA 4DZJA 3I4MJ 3L2RA 4RAYA 1IRXA 1Z21A 2CW7A 3ZMTA 1B6AA 5D5UB 3CMMA 4C3IJ 5EEHA 1IW7F 4F7ZA 3BR0A 4EM2A 3NARA 3R61A 3RZDJ 1P4WA 3JAMK 3MEXA 3E5QA 1XMAA 3S3MA 1IV8A 3PSIA 1JGSA 2XF6A 2BZTA 4A12A 1YHQI 1K6OA 1DP3A 3K9TA 5HDNA 4RMNA 1TWFJ 3HKZN 3PFIA 2F2EA 5FGMA 2A5YB 4LG0B 2E1NA 1S3JA 2QQBA 3RDIA 4ZJZA 3IKTA 1I1GA 1WJAA 4W1UA 1S29A 1EH8A 2RNGA 2RREA 4HA8A 4A6DA 2JQ7A 1CF7B 1WFXA 4CCLA 1R4NB 4RAGA 3RJPA 3P7NA 1U78A 1XG1A 2R0QC 2MW8A 5E3LA 1QBJA 1F4KA 4B4CA 1ZRDA 2LY2A 4G7HF 3VODA 3BQZA 1XGNA 5LRSA 5H2FC 3R60A 1DQUA 4FTHA 3DFGA 3GFMA 2NRAC 2DA4A 2V9KA 2R5ZA 3MZYA 1I3QJ 5J3LA 5FKKA 2ME0A 2VE9A 1X3UA 4KYWA 2KZVA 3K70C 3QP5A 1Q1VA 3BDDA 3A02A 1TQPA 5EGOB 1P4AA 3HIFA 4HZFA 4ETSA 1PP8F 2YU9J 2HYGD 4M71A 3HKZA 4FISA 5EYRA 1MNDA 3KZZA 3OV8A 2DN0A 3HPHA 4WK8F 2M3AA 5EEAA 2DOFA 5DEQA 2L3DA 3SDGA 2HEOA 3OIQA 4FASD 1R36A 1C0WA 3CDLA 1HSTA 5GPAA 1SD6A 2DYRH 5GP9A 2L0KA 2V9PA 2PJRA 3QAHA 4D5CA 4XR6A 3ZQFA 4BDZA 2NYXA 1ULYA 3K70D 5F1JA 4P9FA 3D5RC 3CCLI 5D6FA 4HPQA 3HYIA 3ZQCA 1FOKA 5HNFA 4EJWA 1GT0C 2JRTA 3ABLH 1S7OA 4BJ5C 3EUHC 2BY3A 2K85A 2JPCA 3SQNA 1T0FC 3B6CA 5B66C 1V4RA 1WKMA 4NQWB 3R4KA 1SFXA 2OA4A 4HQMA 4L9JA 2OCCH 3D5LA 2NXNB 3ZQLA 4XIDA 3HTSB 2K5CA 5J8CA 2ZBKA 5CPRB 4EGZA 2LSOA 1YOVB 2EBIA 3JAMZ 1U5TA 4HNVA 2LP0A 2LTPA 3V7SA 2COMA 3OL3A 5HLIA 3VSLA 3BPXA 1E3PA 3H35A 3DLLF 2EJRA 5DCFA 1X2NA 4M9XA 2HKXA 5CQGA 4F92B 1UHMA 3JRGA 1P4XA 5J1UA 3IUOA 4A5MA 2B9SA 5AIQA 4M3DA 3BLYA 2NS8A 2CV1A 1FSEA 3ABUA 1LNWA 4EJVA 1UHSA 1BI1A 2CU7A 1UMQA 3I9V2 1HKSA 4PDKA 3GZ6A 3MKZA 5BMZA 3WTVC 3F8FA 4XLHA 2A61A 1XMXA 1BJAA 2JWTA 2ZCWA 2R7SA 2JMWA 1Z6TA 2IXSA 3JSOA 2Z3YA 3VB2A 1Y8RB 3VDXA 3JSPA 5HNHA 4I98B 1FPQA 3ZP5A 5F0FA 4J00A 2R7QA 1R5HA 2OTLI 2DA5A 4NDLA 1X1PA 2GIZA 3COAC 1WRJA 2XIGA 1VQOI 1ZRCA 1U5TB 1FTZA 4A3GJ 3BG3A 3IP4B 1W7PD 2COBA 1SVMA 1R1VA 2BY1A 2A69F 1XSVA 3W3CA 2CJJA 1JJ6C 3KCCA 5M3MJ 2IA2A 4IQ4A 1O4XA 5E8IA 1MIJA 1SMYF 3RCOA 4R79A 4AM3A 4L9VA 3ONQA 4DZPA 2Z2SB 3QU3A 3CCRI 4MEYF 3RIRA 1SD7A 4XICA 3KLNA 4L18B 3LFKA 2M4KA 1I6HJ 3WU0A 1FMVA 2I5UA 4RM3A 3OYFA 5E79C 1G3TA 1BM9A 5JVGF 4L9NA 2XF7A 2EZLA 2EZIA 2Q2EA 4XKWA 2B0LA 4MHGA 1XGMA 1ZR4A 1D5YA 3I55I 3JRIA 2DK5A 1QZYA 3FM5A 4QPOA 4IHSA 3CUQC 4IL6C 2XSJC 5TISC 3VYTB 2F4OB 2FBIA 4S04A 2HOEA 4PJMA 2XGDA 2BV6A 3FXKA 2XVCA 4OINF 1D0XA 3CMEI 3SZPA 4XKVA 4XMYA 4D7MA 2X0LA 4ZTJA 1QHGA 1XGOA 3GUDA 2A3SA 2VKVA 3LA2A 5KAIC 1OPCA 2X4HA 2DK8A 5IT9K 3O6BB 1TWAJ 2AXLA 2HYJA 2DAOA 3HSFA 4NC7A 3JREA 1YTYA 3QWLA 1LPQA 2NVTJ 2QGUA 3H5RA 2CGPA 4CYCA 2G0EA 5D8KB 2VQLA 1ZELA 2DT7B 2FBHA 4II3A 3DU6A 3DTIA 4KN7X 1I3AA 2M5WA 4P1WA 2JRMA 1K4TA 3GTPJ 4O6JA 4CO8A 1SFEA 2R92J 2ZXJA 3RPQA 2UXXA 1VQ6I 5J1YA 2WTEA 1D1CA 3OIOA 2QEXI 5HDKA 2BGCA 2DCEA 2W84A 5K7ZA 2LY9A 5K1YA 1I6XA 4JX4A 3RKXA 4QLCU 3GBGA 2XPWA 2O61A 5LHGA 3AG3H 1BIBA 5FKLA 4KIFA 2VXDA 3FMSA 2E2HJ 4PUSA 3GTOJ 4RAFA 4XBFA 4RAZA 2DODA 3LSMA 1DU0A 1W4MA 2XPVA 1JTYA 5B5EC 2VC1A 1QA6A 4JBAA 2M45A 3WTUC 3BP8A 4XN3A 3KEYA 1ON1A 2IJLA 1KQ8A 2VBZA 5GADJ 3ZMZA 3BJAA 3BR3A 1PJRA 5IP6A 1YITI 1FYLA 4B3XA 3S93A 2KJBA 2P7CB 1ETQA 1ZK8A 4LK1F 2UXNA 4WXHA 3S16J 3ML6A 4I09A 5IT3A 5F1RA 2G7HA 3HOVJ 4PGHA 2X1EA 1BW6A 1S7AA 1T38A 4BU2A 1XB4A 4F93B 2FA5A 4AU7A 5F27A 4DNCA 4MQVA 3TOAA 1LFBA 5FFXA 3H92A 5LEKA 4YFKF 3S15J 3CLOA 2FUG2 4HDUA 1W0TA 2OQRA 3FXQA 4YELA 4A6EA 1O3QA 2BY0A 2EH3A
chains in the Genus database with same CATH topology
3G1LA 4M3FA 3IH2A 2CQXA 2DMPA 1JKOC 2JA5J 4QIWN 2P81A 1CQTA 3M4OJ 2W48A 3ZOBA 2EQRA 2CUFA 1Z77A 3BR6A 4MO7A 3BT9A 2KDZA 5EZGA 1QVUA 3JRBA 3B6AA 2TRTA 5IOZA 3CMYA 3MVPA 4A3LJ 3Q0WA 4IHYA 3JRAA 1QPIA 2HOTA 3BTLA 3JRFA 1ORKA 2GLOA 2M0CA 1FIAA 4JX6A 3K7AJ 3CCYA 3HBLA 5FJ8J 4BBSJ 3MN2A 2XRLA 3LSPA 1MBGA 1ZQ3P 2QF7A 5F0HA 1OCTC 3PO2J 1VI0A 3SFIA 3S14J 3S2DJ 1POGA 4A3BJ 1ZGWA 1AU7A 4A3DJ 2R93J 3TW7A 2JA8J 1TWHJ 3JRHA 3S1QJ 2IEKA 1AHDP 3A03A 5IP9J 1ENHA 1W0UA 2Y0SN 1K83J 4A3KJ 1GDTA 3DCFA 5FKNA 1XS9A 2WV1A 1TC3C 4ABZA 4A3FJ 1ZKGA 1ETXA 9ANTA 4XRSA 4JYKA 1JKPC 1FIPA 1WI3A 1JUSA 3A01A 2Y9ZA 5IPAA 2XSDC 3TW6A 4AUXA 2LVSA 3WHBA 4DYCA 1YRNB 2O9LA 1FTTA 2YUSA 4XK4A 1JTXA 4I76A 1JT0A 1P7JA 3O8HA 1P7IA 3IH3A 1BJZA 3F0CA 3HOZJ 3GTKJ 3GTLJ 4MLOA 1RPWA 4M6VA 2DA6A 2MG4A 2ME6A 4D5FA 1JJ8C 1T56A 4MIMA 4A3JJ 1ETOA 1MH3A 2LLKA 2HDDA 5K7HA 2JK3A 3BG5A 4A3MJ 5JLWA 2LKXA 5EG0A 1MBFA 4FCYA 2MGQA 1APLC 3BR5A 3LOCA 1TWGJ 2NVYJ 2ECCA 2H1KA 1PUFA 3D1NI 1MBKA 1ZTRA 2JA7J 3FISA 2E2IJ 3QPSA 4BBRJ 2VI6A 2ID3A 4IEJA 5C4JJ 2XGEA 2DJNA 2Y2ZA 4A69C 1IC8A 3BQYA 2R7ZJ 3MKLA 2B63J 1H89C 1TWCJ 1B72B 3LNQA 1RR7A 2FJ1A 4DZJA 3I4MJ 4IHXA 5M5XJ 5M5WJ 3WHCA 4C3IJ 2M2EA 1T33A 4J19A 5BNGA 3BR0A 3NARA 3RZDJ 1JT6A 2GBYA 2I10A 5IYBJ 2R5YA 2FQ4A 1Y1VJ 2HOAA 3S2HJ 1RKWA 3JRCA 2O8KA 2OF7A 3FIWA 3NAUA 1IRZA 1TWFJ 3HKZN 1OJLA 2CQQA 3G1OA 4XRSG 2NVXJ 2ZB9A 4W1UA 2Y30A 4BKXA 4A3EJ 2LD5A 5IOYA 5C3EJ 5M3FJ 1IGNA 4A3IJ 2DA2A 2LR8A 2VUMJ 3HOYJ 3JR9A 1LFUP 4D7NA 5HODA 1MSEC 2IAIA 1WGXA 1H8AC 5F08A 1U78A 1XG1A 2R0QC 3Q0UA 2VPRA 2L7ZA 2MW8A 3HEFA 3IH4A 5E3LA 1GV2A 4MFEA 4B4CA 3JRDA 3BG9A 3BQZA 3HGYA 4FTHA 1MSFC 3K2AA 3A01B 2DA4A 2R5ZA 2FD5A 3L1PA 5J3LA 1I3QJ 5FKKA 2ME0A 2FX0A 4M3GA 4L5EA 4X6AJ 1Q1VA 2TCTA 3A02A 5EGOB 2CRGA 3IV5A 5FKOA 2YU9J 2XPUA 4FISA 5EYRA 3LSGA 2DN0A 1ETVA 4UUSA 3FK6A 5FKMA 1Z0XA 5EEAA 3CQZJ 4FE7A 2MSYA 3SDGA 2JJ7A 4RDUA 1F36A 1B8IA 3CDLA 4C3JJ 1JKRC 2DTZA 5GPAA 3VPRA 5GP9A 2L0KA 4W97A 1WH7A 1B72A 1FEXA 1JKQC 4D5CA 5GPCA 3ZQFA 4JX5A 3I4NJ 5F1JA 1HDDC 2JA6J 1ETWA 3BTIA 3H3VK 1MBHA 1X2MA 2CUEA 3ZQCA 3C2BA 1GT0C 2EZHA 2YS9A 3GTMJ 2XB5A 3HM5A 5FLMJ 3DEWA 1U8BA 2K40A 3B6CA 4A3CJ 4M3EA 4RBOA 3SJMA 1EF4A 1UG2A 2DMQA 5F04A 2WAQN 3BR2A 2EZKA 2HXOA 4AC0A 2IBDA 2DMTA 1X58A 3LSJA 2HOSA 1BW5A 2K9NA 3ZQLA 4XIDA 1JGGA 5DTDA 1HF0A 3RKQA 4DYRA 1OFCX 4XRMA 2EBIA 2N8GA 4HNVA 2LP0A 2LTPA 4AYBN 1JUPA 1AKHA 2X6OA 4BY1J 1X2NA 2D5VA 1IV6A 1YRNA 3JRGA 1RKTA 2VKEA 5J1UA 4FE4A 3HOWJ 4M3DA 2NS8A 4Y52J 4LOCA 1UHSA 1LE8B 3M3YJ 1Y1WJ 1IDYA 3LSRA 2CU7A 1MH4A 1UMQA 2ECBA 4BY7J 4B1RA 5K7FA 4V2GA 3FKIJ 5C4XJ 5IP7J 1WPKA 4QTRA 1E3OC 4V2FA 2JWTA 5EF6A 2L7MP 3PM1A 3O8GA 5EZHA 2JMWA 3TP0A 1A5JA 1H88C 5E3OA 4BXXJ 5J1RA 2M8GX 4I6ZA 2OPTA 1GUUA 3FK7A 5F0FA 1B8IB 2DA5A 4NDLA 1BL0A 1IUFA 1FTZA 4UUSB 4A3GJ 3H0GJ 1WH5A 3BG3A 3S1RJ 2K9QA 1VFCA 3S1MJ 2COBA 1SANA 4JP0A 4B3AA 3BTJA 1HOMA 2LFBA 2CJJA 1JJ6C 5M3MJ 1XC5A 5IYCJ 1O4XA 4MFDA 1NK2P 1JUMA 1U9NA 1MBEA 3GTJJ 4G12A 3ZQGA 4DZPA 4DYQA 4XICA 3OSFA 1A6IA 1R9TJ 1I6HJ 4S0HB 2E2JJ 1VNDA 3W6VA 2EZLA 2EZIA 2L9RA 3S17J 2M9HA 2Y31A 1ZR4A 1D5YA 1RESA 1QVTA 3JRIA 1LE8A 5E3NA 2GM4A 4X1EA 2Y9YA 3UKGA 2HXIA 3QPLA 1NK3P 2XGDA 2DA3A 1WCMJ 3QQAA 4DW6A 3OSGA 2DA7A 4D7MA 3HOXJ 3G1MA 1K61A 2VKVA 3RQIA 3TEDA 1VF9A 1TWAJ 3JREA 2HYJA 2X48A 3HGGA 2NS7A 2RAEA 2NVTJ 2QCOA 5IYDJ 2NOGA 4CYCA 3S1NJ 5JLXA 5EDNA 2G0EA 2AO9A 3BR1A 1HCRA 5F0CA 4UUTA 1ETYA 2R5ZB 1MBJA 3Q0VA 2X9DA 3OOUA 2R5YB 2DMUA 3Q3SA 2K9SA 2LK2A 5C44J 3GTPJ 2R92J 3ZQIA 1U9OA 2XB0X 2NVQJ 1BA5A 3PO3J 5J1YA 2HI3A 3OIOA 2E1OA 4C3HJ 5K7ZA 2LY9A 2AHQA 2O7OA 4JX4A 2WB1N 2JN6A 3GBGA 2XGCA 2XPWA 1PUFB 3GTQJ 2DA1A 5FKLA 1HDPA 3ZQHA 2E2HJ 3GTOJ 3BTCA 4GFBA 2L7FP 4QSHA 2KT0A 2XPVA 3HB9A 1DU0A 1JTYA 3HDDA 2E19A 5EG0B 2ELKA 1SFOJ 5M5YJ 4IHVA 1ZR2A 3HOUJ 1IJWC 2H8RA 5E3MA 1ITYA 1I50J 2DMNA 1IG7A 4A93J 3BR3A 1ETKA 5IP6A 5EGOA 2HQ5A 1FJLA 4CYCB 1ETQA 1ZK8A 4EEFG 3RZOJ 2M34A 4Y7NJ 3S16J 3GTGJ 1HLVA 1OCPA 3HOVJ 3TP3A 4M3BA 1BW6A 2ID6A 1S7EA 5F27A 1G2HA 1LFBA 1F43A 2PMZN 1DU6A 3S15J 1GV5A 1GVDA 5DS9A 1MNMC 1W0TA 1NTCA 1AKHB 1RETA 1IDZA 2EH3A 5FLVA 4IHWA 3E7LA 4C2MJ 1QRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1L A;  4M3F A;  3IH2 A;  2CQX A;  2DMP A;  1JKO C;  2JA5 J;  4QIW N;  2P81 A;  1CQT A;  3M4O J;  2W48 A;  3ZOB A;  2EQR A;  2CUF A;  1Z77 A;  3BR6 A;  4MO7 A;  3BT9 A;  2KDZ A;  5EZG A;  1QVU A;  3JRB A;  3B6A A;  2TRT A;  5IOZ A;  3CMY A;  3MVP A;  4A3L J;  3Q0W A;  4IHY A;  3JRA A;  1QPI A;  2HOT A;  3BTL A;  3JRF A;  1ORK A;  2GLO A;  2M0C A;  1FIA A;  4JX6 A;  3K7A J;  3CCY A;  3HBL A;  5FJ8 J;  4BBS J;  3MN2 A;  2XRL A;  3LSP A;  1MBG A;  1ZQ3 P;  2QF7 A;  5F0H A;  1OCT C;  3PO2 J;  1VI0 A;  3SFI A;  3S14 J;  3S2D J;  1POG A;  4A3B J;  1ZGW A;  1AU7 A;  4A3D J;  2R93 J;  3TW7 A;  2JA8 J;  1TWH J;  3JRH A;  3S1Q J;  2IEK A;  1AHD P;  3A03 A;  5IP9 J;  1ENH A;  1W0U A;  2Y0S N;  1K83 J;  4A3K J;  1GDT A;  3DCF A;  5FKN A;  1XS9 A;  2WV1 A;  1TC3 C;  4ABZ A;  4A3F J;  1ZKG A;  1ETX A;  9ANT A;  4XRS A;  4JYK A;  1JKP C;  1FIP A;  1WI3 A;  1JUS A;  3A01 A;  2Y9Z A;  5IPA A;  2XSD C;  3TW6 A;  4AUX A;  2LVS A;  3WHB A;  4DYC A;  1YRN B;  2O9L A;  1FTT A;  2YUS A;  4XK4 A;  1JTX A;  4I76 A;  1JT0 A;  1P7J A;  3O8H A;  1P7I A;  3IH3 A;  1BJZ A;  3F0C A;  3HOZ J;  3GTK J;  3GTL J;  4MLO A;  1RPW A;  4M6V A;  2DA6 A;  2MG4 A;  2ME6 A;  4D5F A;  1JJ8 C;  1T56 A;  4MIM A;  4A3J J;  1ETO A;  1MH3 A;  2LLK A;  2HDD A;  5K7H A;  2JK3 A;  3BG5 A;  4A3M J;  5JLW A;  2LKX A;  5EG0 A;  1MBF A;  4FCY A;  2MGQ A;  1APL C;  3BR5 A;  3LOC A;  1TWG J;  2NVY J;  2ECC A;  2H1K A;  1PUF A;  3D1N I;  1MBK A;  1ZTR A;  2JA7 J;  3FIS A;  2E2I J;  3QPS A;  4BBR J;  2VI6 A;  2ID3 A;  4IEJ A;  5C4J J;  2XGE A;  2DJN A;  2Y2Z A;  4A69 C;  1IC8 A;  3BQY A;  2R7Z J;  3MKL A;  2B63 J;  1H89 C;  1TWC J;  1B72 B;  3LNQ A;  1RR7 A;  2FJ1 A;  4DZJ A;  3I4M J;  4IHX A;  5M5X J;  5M5W J;  3WHC A;  4C3I J;  2M2E A;  1T33 A;  4J19 A;  5BNG A;  3BR0 A;  3NAR A;  3RZD J;  1JT6 A;  2GBY A;  2I10 A;  5IYB J;  2R5Y A;  2FQ4 A;  1Y1V J;  2HOA A;  3S2H J;  1RKW A;  3JRC A;  2O8K A;  2OF7 A;  3FIW A;  3NAU A;  1IRZ A;  1TWF J;  3HKZ N;  1OJL A;  2CQQ A;  3G1O A;  4XRS G;  2NVX J;  2ZB9 A;  4W1U A;  2Y30 A;  4BKX A;  4A3E J;  2LD5 A;  5IOY A;  5C3E J;  5M3F J;  1IGN A;  4A3I J;  2DA2 A;  2LR8 A;  2VUM J;  3HOY J;  3JR9 A;  1LFU P;  4D7N A;  5HOD A;  1MSE C;  2IAI A;  1WGX A;  1H8A C;  5F08 A;  1U78 A;  1XG1 A;  2R0Q C;  3Q0U A;  2VPR A;  2L7Z A;  2MW8 A;  3HEF A;  3IH4 A;  5E3L A;  1GV2 A;  4MFE A;  4B4C A;  3JRD A;  3BG9 A;  3BQZ A;  3HGY A;  4FTH A;  1MSF C;  3K2A A;  3A01 B;  2DA4 A;  2R5Z A;  2FD5 A;  3L1P A;  5J3L A;  1I3Q J;  5FKK A;  2ME0 A;  2FX0 A;  4M3G A;  4L5E A;  4X6A J;  1Q1V A;  2TCT A;  3A02 A;  5EGO B;  2CRG A;  3IV5 A;  5FKO A;  2YU9 J;  2XPU A;  4FIS A;  5EYR A;  3LSG A;  2DN0 A;  1ETV A;  4UUS A;  3FK6 A;  5FKM A;  1Z0X A;  5EEA A;  3CQZ J;  4FE7 A;  2MSY A;  3SDG A;  2JJ7 A;  4RDU A;  1F36 A;  1B8I A;  3CDL A;  4C3J J;  1JKR C;  2DTZ A;  5GPA A;  3VPR A;  5GP9 A;  2L0K A;  4W97 A;  1WH7 A;  1B72 A;  1FEX A;  1JKQ C;  4D5C A;  5GPC A;  3ZQF A;  4JX5 A;  3I4N J;  5F1J A;  1HDD C;  2JA6 J;  1ETW A;  3BTI A;  3H3V K;  1MBH A;  1X2M A;  2CUE A;  3ZQC A;  3C2B A;  1GT0 C;  2EZH A;  2YS9 A;  3GTM J;  2XB5 A;  3HM5 A;  5FLM J;  3DEW A;  1U8B A;  2K40 A;  3B6C A;  4A3C J;  4M3E A;  4RBO A;  3SJM A;  1EF4 A;  1UG2 A;  2DMQ A;  5F04 A;  2WAQ N;  3BR2 A;  2EZK A;  2HXO A;  4AC0 A;  2IBD A;  2DMT A;  1X58 A;  3LSJ A;  2HOS A;  1BW5 A;  2K9N A;  3ZQL A;  4XID A;  1JGG A;  5DTD A;  1HF0 A;  3RKQ A;  4DYR A;  1OFC X;  4XRM A;  2EBI A;  2N8G A;  4HNV A;  2LP0 A;  2LTP A;  4AYB N;  1JUP A;  1AKH A;  2X6O A;  4BY1 J;  1X2N A;  2D5V A;  1IV6 A;  1YRN A;  3JRG A;  1RKT A;  2VKE A;  5J1U A;  4FE4 A;  3HOW J;  4M3D A;  2NS8 A;  4Y52 J;  4LOC A;  1UHS A;  1LE8 B;  3M3Y J;  1Y1W J;  1IDY A;  3LSR A;  2CU7 A;  1MH4 A;  1UMQ A;  2ECB A;  4BY7 J;  4B1R A;  5K7F A;  4V2G A;  3FKI J;  5C4X J;  5IP7 J;  1WPK A;  4QTR A;  1E3O C;  4V2F A;  2JWT A;  5EF6 A;  2L7M P;  3PM1 A;  3O8G A;  5EZH A;  2JMW A;  3TP0 A;  1A5J A;  1H88 C;  5E3O A;  4BXX J;  5J1R A;  2M8G X;  4I6Z A;  2OPT A;  1GUU A;  3FK7 A;  5F0F A;  1B8I B;  2DA5 A;  4NDL A;  1BL0 A;  1IUF A;  1FTZ A;  4UUS B;  4A3G J;  3H0G J;  1WH5 A;  3BG3 A;  3S1R J;  2K9Q A;  1VFC A;  3S1M J;  2COB A;  1SAN A;  4JP0 A;  4B3A A;  3BTJ A;  1HOM A;  2LFB A;  2CJJ A;  1JJ6 C;  5M3M J;  1XC5 A;  5IYC J;  1O4X A;  4MFD A;  1NK2 P;  1JUM A;  1U9N A;  1MBE A;  3GTJ J;  4G12 A;  3ZQG A;  4DZP A;  4DYQ A;  4XIC A;  3OSF A;  1A6I A;  1R9T J;  1I6H J;  4S0H B;  2E2J J;  1VND A;  3W6V A;  2EZL A;  2EZI A;  2L9R A;  3S17 J;  2M9H A;  2Y31 A;  1ZR4 A;  1D5Y A;  1RES A;  1QVT A;  3JRI A;  1LE8 A;  5E3N A;  2GM4 A;  4X1E A;  2Y9Y A;  3UKG A;  2HXI A;  3QPL A;  1NK3 P;  2XGD A;  2DA3 A;  1WCM J;  3QQA A;  4DW6 A;  3OSG A;  2DA7 A;  4D7M A;  3HOX J;  3G1M A;  1K61 A;  2VKV A;  3RQI A;  3TED A;  1VF9 A;  1TWA J;  3JRE A;  2HYJ A;  2X48 A;  3HGG A;  2NS7 A;  2RAE A;  2NVT J;  2QCO A;  5IYD J;  2NOG A;  4CYC A;  3S1N J;  5JLX A;  5EDN A;  2G0E A;  2AO9 A;  3BR1 A;  1HCR A;  5F0C A;  4UUT A;  1ETY A;  2R5Z B;  1MBJ A;  3Q0V A;  2X9D A;  3OOU A;  2R5Y B;  2DMU A;  3Q3S A;  2K9S A;  2LK2 A;  5C44 J;  3GTP J;  2R92 J;  3ZQI A;  1U9O A;  2XB0 X;  2NVQ J;  1BA5 A;  3PO3 J;  5J1Y A;  2HI3 A;  3OIO A;  2E1O A;  4C3H J;  5K7Z A;  2LY9 A;  2AHQ A;  2O7O A;  4JX4 A;  2WB1 N;  2JN6 A;  3GBG A;  2XGC A;  2XPW A;  1PUF B;  3GTQ J;  2DA1 A;  5FKL A;  1HDP A;  3ZQH A;  2E2H J;  3GTO J;  3BTC A;  4GFB A;  2L7F P;  4QSH A;  2KT0 A;  2XPV A;  3HB9 A;  1DU0 A;  1JTY A;  3HDD A;  2E19 A;  5EG0 B;  2ELK A;  1SFO J;  5M5Y J;  4IHV A;  1ZR2 A;  3HOU J;  1IJW C;  2H8R A;  5E3M A;  1ITY A;  1I50 J;  2DMN A;  1IG7 A;  4A93 J;  3BR3 A;  1ETK A;  5IP6 A;  5EGO A;  2HQ5 A;  1FJL A;  4CYC B;  1ETQ A;  1ZK8 A;  4EEF G;  3RZO J;  2M34 A;  4Y7N J;  3S16 J;  3GTG J;  1HLV A;  1OCP A;  3HOV J;  3TP3 A;  4M3B A;  1BW6 A;  2ID6 A;  1S7E A;  5F27 A;  1G2H A;  1LFB A;  1F43 A;  2PMZ N;  1DU6 A;  3S15 J;  1GV5 A;  1GVD A;  5DS9 A;  1MNM C;  1W0T A;  1NTC A;  1AKH B;  1RET A;  1IDZ A;  2EH3 A;  5FLV A;  4IHW A;  3E7L A;  4C2M J;  1QRY A; 
#chains in the Genus database with same CATH topology
 4M3F A;  1R1T A;  3SXY A;  2EB7 A;  1JE8 A;  3M4O J;  1FOX A;  3WTY C;  2W48 A;  1ZRF A;  4KMF A;  2L02 A;  3N4M A;  2MLG A;  4MO7 A;  5EEG A;  1ACI A;  2KDZ A;  1R71 A;  3CUQ A;  4HQE A;  2Y48 A;  1QVU A;  2IS6 A;  3B6A A;  4XLE A;  4WF2 A;  4LK0 F;  1JXS A;  4A3L J;  4IZZ A;  2HPI A;  4U88 A;  3WG9 A;  5K5Q A;  2LBF A;  4AIH A;  5ERI A;  2V7F A;  3F22 A;  1ORK A;  2H27 A;  1YJ9 I;  2KL4 A;  1Y39 A;  1U3E M;  1FIA A;  5GAH J;  1VQP I;  2VAS A;  2R7X A;  5B1B H;  4LFU A;  2XRL A;  2ELJ A;  2NS0 A;  3PJR A;  5GAG J;  2BOL A;  3ULQ B;  2HQA A;  3CC7 I;  4RGS A;  3FWE A;  2QLZ A;  3S14 J;  3S2D J;  1POG A;  5CJ9 A;  1AU7 A;  2RKH A;  1UAA A;  3WTZ A;  2PQ8 A;  1XDU A;  3PSF A;  1OQY A;  2JA8 J;  4CH7 A;  3JRH A;  1EH6 A;  2AS5 F;  1BI0 A;  1MMA A;  5IP9 J;  2EFP A;  1ENH A;  1W0U A;  2Y0S N;  2ZNZ A;  5E1W A;  1D3Y A;  2XC7 A;  1V3F A;  1BOA A;  3DCF A;  1IRG A;  4LB5 A;  4A3F J;  1ZKG A;  1ETX A;  9ANT A;  3OYN A;  1FOW A;  4LIU A;  3N97 A;  3WG7 H;  2M8E A;  2CWE A;  3A01 A;  1JUS A;  1MKM A;  4BEH A;  3OL4 A;  2VT3 A;  2OU2 A;  4M6X A;  3CJQ B;  3KP7 A;  4BYY A;  3ZMS A;  2XSD C;  4AUX A;  4DYC A;  1YRN B;  2PJR B;  1LJ9 A;  2OAZ A;  2YUS A;  4BJT A;  1AOY A;  3PNT A;  3HC7 A;  5CVV A;  4N9I A;  1SMT A;  1OCZ H;  2M87 A;  4OIP F;  3I54 A;  5KAF C;  2K9L A;  1A31 A;  3KYD B;  1XD7 A;  3A2K A;  3DBL B;  3F6V A;  2DO7 A;  3I59 A;  4M6V A;  1OCC H;  2V9V A;  4KT5 C;  1TL8 A;  2ME6 A;  1ZG3 A;  3ASN H;  1ZGJ A;  1SAU A;  1T56 A;  3KP3 A;  3RTR A;  4A3J J;  1MH3 A;  3NRV A;  4ZYG A;  2IGN A;  1U5T C;  4RLQ A;  3BG5 A;  3F23 A;  4AYB A;  4ZZD A;  3LMM A;  2RN7 A;  1FY7 A;  4HEA 2;  1PVE A;  4Y33 A;  4L0Y B;  1QU3 A;  2R7F A;  1APL C;  2L9S A;  4LMY A;  3DBR B;  1SD4 A;  3ZQQ A;  5K5R A;  3D1N I;  3FXR A;  3I0T A;  1YW9 A;  1ZAR A;  1RC9 A;  3QPS A;  4BBR J;  3F21 A;  1T0F A;  1O7L A;  2VI6 A;  2CMP A;  4IEJ A;  4IRH A;  2VBX A;  2GOX B;  3KP5 A;  2ZFW A;  2K4J A;  1XSX A;  2DJN A;  2XGE A;  3GLX A;  5AIP A;  4A69 C;  1WVR A;  2R7Z J;  2KJC A;  1Z91 A;  2R4G A;  4Y15 A;  4KMU X;  4ZH4 F;  2K7L A;  3EYY A;  3PIP F;  2C6Y A;  4UNO A;  3H3Z A;  2VIX A;  3W2W A;  2X51 A;  3HHG A;  4RLF A;  5LGU A;  1HC8 A;  3DKX A;  2Z99 A;  2R7T A;  1SVL A;  5FRM A;  5D5X B;  3CF2 A;  1WJB A;  4J19 A;  2E7W A;  1NG6 A;  2Q8K A;  2DFI A;  2HQR A;  3EUK L;  3TQN A;  1W36 C;  2DI3 A;  4AID A;  3GYH X;  2LY1 A;  2P7V B;  1WJ5 A;  2XAU A;  3HHH A;  4FT8 A;  3T5X A;  2IGK A;  4Q48 A;  5HLG A;  1MJA A;  3CO7 C;  1P2F A;  3DTE A;  2DDA A;  3CCU I;  4MEX F;  1E2X A;  1VQ4 I;  2CQQ A;  3ZN0 A;  3L9F A;  2D1V A;  1H9G A;  2NVX J;  2ZB9 A;  4OAZ A;  5IOY A;  2LR8 A;  2VUM J;  2OC6 A;  4D7N A;  3WTS C;  4G6Q A;  5A2Q Z;  2X1C A;  1H8A C;  5DM6 F;  3M8F A;  2VPR A;  4PFO A;  3JRD A;  1FBU A;  5L3F A;  2A07 F;  3S32 A;  1BC8 C;  4KIG A;  5GTI C;  1ZG5 A;  2QUF A;  3J7Z I;  2BXY A;  4PSW A;  2DJI A;  2FQ3 A;  3HGY A;  1MSF C;  3A01 B;  3L2Q A;  1FNN A;  4EJU A;  4Y17 A;  4M3G A;  3OYI A;  2PLY A;  2WV0 A;  4I0A A;  3W6K B;  2EFQ A;  3A4C A;  2VBY A;  5HS7 A;  3LSG A;  5F64 A;  3CCE I;  3K4M A;  1USS A;  1ETV A;  2O3F A;  4OU0 A;  4UUS A;  2XRO A;  2QBY A;  1Z0X A;  3WOD F;  1MW7 A;  2E1C A;  1P92 A;  2MSY A;  3TKY A;  4RDU A;  2MH9 A;  1OLT A;  2DT6 A;  4C3J J;  4BDY A;  2DTZ A;  1B72 A;  2ZKZ A;  1Y0N A;  2ZXH A;  3L7W A;  4JX5 A;  3IL2 A;  4XLP F;  3I4N J;  2K3P A;  4BAC A;  2V26 A;  2IS2 A;  4BXU A;  5E1Z B;  1HDD C;  3GFL A;  3FF5 A;  2EIL H;  3CCM I;  1ETW A;  3H3V K;  1X2M A;  3OS1 A;  2CUE A;  5H6Q A;  3P9I A;  4YEJ A;  3DF8 A;  1NHA A;  2HZT A;  5FLM J;  1U8B A;  2MC4 A;  2PMH A;  3OYL A;  3P5J A;  3OYC A;  2WAQ N;  3OYJ A;  3ZPL A;  1UHW A;  2HXO A;  2CW0 F;  4IVN A;  5ILU A;  3J81 Z;  5D4S A;  5J8F A;  2HOS A;  1MMD A;  2K9N A;  3IAS 2;  5L3B A;  4PFP A;  4PGG A;  1HF0 A;  1UST A;  2HS5 A;  4DYR A;  3G3Z A;  3H9J A;  3H0D A;  4I2O A;  3AFH A;  4AYB N;  1BR4 A;  2KP6 A;  1UJ8 A;  3ESW B;  2X6O A;  3VYU B;  1V5F A;  1WJC A;  4ITV A;  4CCJ A;  1YRN A;  2D5V A;  3VWB A;  1LKX A;  4HW0 A;  1DGR M;  4XLA A;  3FMQ A;  4KNY A;  3IHU A;  2M4G A;  4LOC A;  1J7K A;  4IF4 A;  4LJZ F;  2MD0 A;  4EJO A;  1Y1W J;  4G9Y A;  3DWL E;  3U9G A;  3RPU D;  4I99 C;  5A2Q K;  3LAP A;  4B1R A;  5K7F A;  2DTR A;  3FKI J;  1AA7 A;  2VOO A;  2HYF A;  4HNT A;  1WPK A;  4V2F A;  3HOS A;  1LQ1 A;  1RZ4 A;  3I71 A;  3LQQ A;  5IY5 H;  3VYR B;  4FQG A;  1H88 C;  5L3D A;  2P5V A;  3CTA A;  5E3O A;  4BXX J;  5J1R A;  2M8G X;  2J5O A;  4L5I A;  3GF2 A;  4RB1 A;  3GLL A;  1ZG1 A;  1V55 H;  3F8B A;  4UUV A;  3REO A;  4KDP A;  3CDI A;  1B1B A;  2BVM A;  1VFC A;  3S1M J;  2HNH A;  3GWZ A;  1IN8 A;  3HL2 A;  2HDW A;  2UZK A;  1IRZ A;  2D45 A;  1ZHF A;  2B7E A;  4BS9 A;  4JP0 A;  2EIM H;  2K27 A;  4HV5 A;  1R23 A;  2F48 A;  1RUN A;  2VJ4 A;  4BL0 B;  1HOM A;  4N4O B;  1HW5 A;  2E7X A;  5JI6 A;  5FFZ A;  4HLY A;  2YPR A;  1JUM A;  1J9I A;  4B48 A;  1MBE A;  3AG1 H;  3WGI A;  3GTJ J;  4DYQ A;  3CJT B;  5ICF A;  3E6M A;  3WU1 B;  2DFE A;  3LA7 A;  1R9T J;  4EAT A;  2YX7 A;  4BHP A;  3U1D A;  1S6L A;  2XAG A;  4HLX A;  4DBR A;  4GDF A;  3NEU A;  3GFI A;  4MGR A;  2L9R A;  4XKC A;  2M9H A;  1OCO H;  2CO5 A;  3G71 I;  2EV0 A;  1RES A;  2WA0 A;  3SHF A;  5E3N A;  2ZJQ F;  2VON A;  1TZL A;  3UKG A;  1I1S A;  2HXI A;  2WY7 Q;  5CLS A;  3WE2 A;  3DEU A;  1F5T A;  2DA3 A;  5CVJ A;  4KFC A;  2F5D A;  1JHF A;  1I39 A;  2DA7 A;  4LD5 A;  3ABT A;  3HOX J;  5LD2 C;  3M7G A;  2W4S A;  1R5I D;  3OS2 A;  2MYS A;  3G73 A;  1O3T A;  5TRD A;  3U2R A;  2HQN A;  1VF9 A;  1T8I A;  3E6D A;  2RAE A;  3PNV A;  2QCO A;  3BCA A;  2YX4 A;  2K86 A;  1UEL B;  3J7Y J;  3BZ6 A;  5CVI A;  4AIK A;  5DYM A;  1HCR A;  3GFJ A;  3PUB A;  3V8J A;  3CLQ A;  1MBJ A;  2VKH A;  6PAX A;  3KX2 A;  1S72 I;  2GA2 A;  2DMU A;  3FMR A;  2LK2 A;  5C44 J;  4WXD A;  1Y8Q B;  1U9O A;  2QQA A;  2NVQ J;  3IAM 2;  3S3O A;  1G3S A;  3UNG C;  1NG7 A;  3QRF F;  3BJ6 A;  2KMU A;  3MZH A;  1ZYR F;  3GME A;  1WI9 A;  2MC3 A;  2LRE A;  3KYL A;  2GAU A;  2XGC A;  1KON A;  5JVT A;  1VQ9 I;  4GXO A;  4BHB A;  3HRM A;  3BOQ A;  1HDP A;  3EPZ A;  3ZQH A;  4GFB A;  1BI2 A;  2WBM A;  5CVR A;  1YO5 C;  2Y75 A;  4CGZ A;  4OAY A;  3LSI A;  1BR1 A;  3HB9 A;  2QQ8 A;  1KU7 A;  5HS8 A;  1VZ0 A;  4I01 A;  3DU5 A;  4D0P A;  4HST A;  4GYI A;  2ELK A;  3I5U A;  3KFW X;  5M5Y J;  4MQ9 F;  4IHV A;  3T8T A;  5DDG A;  3HOU J;  4BQA A;  1IJW C;  5E3M A;  1I50 J;  2DMN A;  3GO5 A;  1LUJ B;  1IG7 A;  4A93 J;  4XSZ F;  4M9Z A;  1FJL A;  1XPX A;  4CYC B;  5JFR A;  3RZO J;  2M34 A;  1L3L A;  4AWX B;  2IA1 A;  3MMY B;  2JA2 A;  1Z05 A;  4S05 A;  2PN6 A;  1OCP A;  1N75 A;  4E7I A;  3K0L A;  2YU3 A;  1S7E A;  2RQP A;  1G2H A;  3CCS I;  3N05 A;  1GHC A;  1X4O A;  2ZFU A;  3F8M A;  5FLX Z;  2ZC2 A;  3ZMU A;  3RKW A;  5DS9 A;  1MNM C;  1MJB A;  4BE1 A;  2KRH A;  3K1N A;  1MDM A;  5FLV A;  3OIP A;  3E7L A;  1R4M B;  4E7H A;  2CQ7 A;  2OCE A;  2Y9Z A;  2CQX A;  1CQT A;  2P81 A;  1QZZ A;  1SAX A;  4N0B A;  1YG2 A;  4E7J A;  1J0R A;  2W7N A;  2P6S A;  2JTV A;  2IA0 A;  5EZG A;  3T8R A;  3ZXS A;  4BE0 A;  3JRB A;  1HKT A;  5HVQ C;  4U0Y A;  2DPU A;  2TRT A;  5FB2 A;  5IOZ A;  1FBS A;  3HZJ A;  5HLT A;  3Q0W A;  2FEZ A;  3QP6 A;  5CYV A;  3CUQ B;  4ZTF A;  3EET A;  2HOT A;  3MD2 A;  2HFH A;  5D4R A;  1D8K A;  2HR3 A;  2GWR A;  1ODD A;  3I59 B;  1ZH5 A;  2DFH A;  2PX9 A;  2DFF A;  5BQT A;  1EA3 A;  3OYD A;  1HBX G;  5FJ8 J;  3I4P A;  1TNS A;  2XRN A;  1MBG A;  3BZC A;  1YJW I;  1T95 A;  3SEQ A;  4P96 A;  1H0M A;  5F0H A;  1VI0 A;  2E34 A;  1BI3 A;  1DDN A;  3JW4 A;  4BXF A;  4DIQ A;  5H20 A;  4IOA F;  3S8P A;  2GOM A;  1D1A A;  4A3D J;  4ASN A;  2ZXW H;  2R93 J;  4GYG A;  3TW7 A;  1R58 A;  3FHZ A;  1F9N A;  2QA4 I;  3ABM H;  1AHD P;  4M73 A;  3MWM A;  2ZO4 A;  2RNJ A;  1Z1D A;  1K83 J;  4FET A;  4AVP A;  4A3K J;  2Z9O A;  2NOJ B;  1VQ5 I;  1GDT A;  5FKN A;  1XS9 A;  2WV1 A;  3U21 A;  4NUB A;  3RSN A;  1KYW A;  2CH0 A;  5HLH A;  1FIP A;  3CJN A;  5FD6 A;  1WI3 A;  4ZYA A;  4B8X A;  1G6N A;  3OYK A;  1FTT A;  2O9L A;  3GVA A;  2LVS A;  3WHB A;  1QO0 D;  4XK4 A;  3CC4 I;  2EV5 A;  3QOD A;  1P7J A;  3ZMD A;  2KIS A;  3O8H A;  3HRT A;  4XRF A;  3VOE A;  1BJZ A;  2M7B A;  4XN0 A;  3C2G A;  1ZLK A;  3QU6 A;  3OYA A;  3GTL J;  1DPR A;  4MLO A;  3RKY A;  2PJP A;  3WGH A;  1G8X A;  4PCQ A;  1KU3 A;  4ENK A;  1JJ8 C;  4PJL A;  2KHM A;  4MIM A;  2STW A;  2D2W A;  3HRU A;  4HG2 A;  5K7H A;  1OCR H;  2JK3 A;  4LLN A;  1SD5 A;  4A3M J;  5JLW A;  1TP4 A;  2QSH X;  2CV2 A;  2EA4 A;  3RYR A;  1QGP A;  3OYH A;  2V6C A;  2A5W A;  2WAD A;  1RRJ A;  4UY8 I;  1E17 A;  1ON2 A;  2MGQ A;  2FSW A;  2TDX A;  2KRC A;  3K4B A;  3E0J B;  5ILS A;  3W2V A;  1LDK B;  2H1K A;  1T39 A;  4R1H A;  3O3K A;  2HTS A;  1T6S A;  3IRR A;  2JA7 J;  2DPD A;  2M1B A;  4ZYH A;  1X1A A;  3BJO A;  2KIF A;  2E2I J;  3CCV I;  5CVU A;  5C4J J;  1EKE A;  1HA8 A;  1OYY A;  3FHN A;  1IC8 A;  3ERE D;  4G6T B;  3DPU A;  4IXA A;  3MKL A;  3FX3 A;  2IGM A;  1IUY A;  1H89 C;  1TWC J;  1LB2 A;  3HUG B;  5TJJ A;  2KKO A;  4OIQ F;  1IN5 A;  1RR7 A;  5ILV A;  4KIS A;  5K5O A;  3JCU C;  3RPU A;  5BPD A;  4PJ0 C;  1D5V A;  3K4C A;  5DUI A;  4IHX A;  1D0Z A;  3G6E I;  5M5X J;  1OR7 A;  1O3S A;  1ERD A;  3AG4 H;  1Z9C A;  1J5Y A;  1MZB A;  3CDH A;  3CP8 A;  4K2E A;  3L2C A;  2L5Q A;  1X4P A;  2IPQ X;  2MBF A;  3TO6 A;  1JT6 A;  2I10 A;  1FYM A;  2R5Y A;  2NVU B;  3GZ5 A;  1Y1V J;  2HOA A;  3J7A O;  2CQK A;  3S2H J;  5D5W B;  4NQW A;  2LKS A;  3HRS A;  2O8K A;  2OF7 A;  3FIW A;  2HTJ A;  3NAU A;  4GCV A;  2ISY A;  2DXI A;  3OOP A;  1OJL A;  2KIU A;  1P6R A;  3P9K A;  1EH7 A;  4YFN F;  3ZMV A;  2OQG A;  2BHZ A;  4H0E A;  4PK4 A;  2VC0 A;  4FX4 A;  2Y30 A;  4BKX A;  4I7H A;  4A3E J;  1YYV A;  5C3E J;  5M3F J;  2CYY A;  1IGN A;  4A3I J;  1IXR C;  2DA2 A;  2HU9 A;  3T1B A;  2V79 A;  3FXJ A;  3FDY A;  4IJA A;  3JR9 A;  2HDC A;  1LFU P;  1KU9 A;  5HOD A;  2FNP A;  2IAI A;  3MFK A;  2QYO A;  4D1Q A;  1WGX A;  3S3N A;  1OKR A;  2VKD A;  3HEF A;  3IH4 A;  1U8R A;  1F1Z A;  1Z3Y A;  1XTA A;  3BG9 A;  1WQ2 A;  4RGU A;  5JR3 A;  3QYF A;  3M8J A;  4A2U A;  3K2A A;  1KQ9 A;  2FD5 A;  2G9W A;  3L1P A;  2FX0 A;  1EV7 A;  2MA3 A;  3SEZ A;  4X6A J;  5KK1 A;  1HW1 A;  4KT6 A;  1ZGA A;  2CRG A;  3IV5 A;  4HAM A;  4PZJ A;  3IRQ A;  2ETH A;  4BH9 A;  4B43 A;  3FK6 A;  3A0B C;  5FKM A;  3UR3 C;  1Y6I A;  3CQZ J;  4FE7 A;  3CUO A;  1DUX C;  3LWF A;  1IN4 A;  5JHU A;  1B8I A;  2FML A;  2PMU A;  4W97 A;  4E70 A;  1FEX A;  3D5S C;  1ZLJ A;  3H9Q A;  3S2W A;  3CCJ I;  4C9Y A;  1X1D A;  2DOA A;  2WC2 A;  2JA6 J;  3BTI A;  5E1X A;  3M07 A;  2V1U A;  3C2B A;  2QKL B;  2MH2 A;  3IWZ A;  4HX7 A;  3GTM J;  2FE3 A;  3VSK A;  2XB5 A;  3HM5 A;  1BC7 C;  4PJN A;  3DEW A;  4BJ6 C;  4IQJ A;  2BHY A;  2Z1D A;  2PI0 A;  3QYB A;  3F8C A;  4A3C J;  5ICE A;  4RBO A;  3SJM A;  5TGT A;  1GXP A;  1EF4 A;  2DMQ A;  3ZN1 A;  4AC0 A;  2IBD A;  4ZYD A;  2W00 A;  4YFX F;  2EV6 A;  3C3W A;  1HW2 A;  4EQQ A;  3E1S A;  3OWT A;  4IO9 F;  2ISZ A;  5DTD A;  3HPG A;  4IX7 A;  2A6T A;  3E5U A;  3MZ8 A;  4XRM A;  2P6T A;  2N8G A;  3GCM A;  2LNB A;  1U0J A;  3EUH A;  1SC7 A;  4A0Y A;  1RIO H;  4OIO F;  1LVA A;  2LF8 A;  3WU2 C;  2F4M B;  5DV5 A;  4C2T A;  1JUP A;  3SZG A;  4Y13 A;  5LEJ A;  2FRH A;  1YW8 A;  5DD8 A;  2VKE A;  3KP6 A;  4IOC F;  5L3G A;  3HOW J;  4GGG A;  1SEU A;  3GEZ A;  2IT0 A;  1LE8 B;  3M3Y J;  3LQR A;  3LSR A;  1SFK A;  1MH4 A;  1QHH D;  4CCO A;  2EFW A;  2XAJ A;  3PFY A;  5ED4 A;  1YJN I;  2ECB A;  1S8N A;  3RQ4 A;  2STT A;  5C4X J;  3FXO A;  4KUM A;  2EIK H;  2HKO A;  4QTR A;  2P5L C;  1E3O C;  2BXZ A;  2VB6 A;  2L7M P;  1W5T A;  3PNY A;  5EF6 A;  3PM1 A;  3O8G A;  5LGT A;  4JQF A;  3PIO F;  1MJ9 A;  1YX3 A;  3LAJ A;  4ZDO A;  2RV8 A;  1WJD A;  1BR2 A;  4ZZL A;  3LST A;  4M9S A;  4NBQ A;  3K4L A;  4I6Z A;  3KZI C;  2OPT A;  3FK7 A;  4QWQ A;  4DBQ A;  1B8I B;  2LOO A;  4XLC A;  1Z3X A;  1BL0 A;  2R7R A;  1IUF A;  2D1H A;  2RC4 A;  3H0G J;  3S1R J;  2K9Q A;  4UB6 C;  2FXA A;  4OIR F;  3U1K A;  3CD6 I;  2X6X A;  1SAN A;  1OMI A;  3BTJ A;  1IRF A;  1GVJ A;  3K1M A;  2AXT C;  2Y0S A;  2LFB A;  3ZQ7 A;  2EA2 A;  3WTT C;  2LBF B;  4LGW A;  3FXU A;  4BE2 A;  1RI7 A;  1XC5 A;  4CDG A;  3NWT A;  5LGN A;  2J5P A;  4MFD A;  1I5Z A;  1NK2 P;  1U9N A;  5CQE A;  4XOP A;  3ZQG A;  2W85 A;  2L2O A;  2CQN A;  4IPA A;  4E7S A;  2BEO A;  2O5R A;  2E2J J;  2QKM B;  4YG2 F;  2IS4 A;  2F5C A;  3VYS B;  4U0W A;  3W6V A;  4LLG F;  3R0J A;  3S17 J;  1GLN A;  1HQC A;  3C7J A;  3EYI A;  2H94 A;  1G59 A;  1LE8 A;  2HZD A;  1SVO A;  2FNA A;  4XNF A;  2H6C A;  4X1E A;  5B1A H;  2KDO A;  1KYZ A;  3OYB A;  3GX4 X;  1UFM A;  4LIT A;  1GXQ A;  3QPL A;  1WCM J;  5ICC A;  3D0S A;  4DW6 A;  4AVZ A;  1ZRE A;  4UHT A;  1LDD A;  3QYE A;  1R22 A;  5J4Y A;  4Z6Y A;  3FZV A;  5LRR A;  4CA0 A;  3OYG A;  3LSH A;  3ASO H;  3RQI A;  1KA8 A;  1KZH A;  3HGG A;  5D5V B;  5BOX A;  2NS7 A;  1VQK I;  3E97 A;  1MMG A;  2CSO A;  2X6W A;  5J4V A;  2H09 A;  5IYD J;  2R7O A;  1YE9 A;  2YR2 A;  3K4J A;  4CXF A;  1G4D A;  1YLF A;  5LLQ A;  5JLX A;  4F3Q A;  5EDN A;  3DTK A;  1IN6 A;  2AO9 A;  2ZNY A;  3BR1 A;  4II2 A;  1ETY A;  2E60 A;  2R5Z B;  1T2K A;  2W57 A;  3OOU A;  4IRG A;  3KLO A;  3W6J B;  1IO2 A;  5DUK A;  2BW3 A;  1VQ7 I;  1KQ0 A;  3LA3 A;  4NC8 A;  2Q1Z B;  1J09 A;  3PO3 J;  2HI3 A;  1LEA A;  2E1O A;  1YS7 A;  3DP7 A;  3BWG A;  4C3H J;  2DDB A;  2AHQ A;  2L54 A;  4XOT A;  3QPH A;  2WB1 N;  2JN6 A;  4CYD A;  4UB8 C;  2XAF A;  3AKZ A;  1WWX A;  3BCB A;  1PUF B;  1QNT A;  3GTQ J;  1YIJ I;  1SFU A;  3KZY A;  4O3M A;  4N4N B;  4QSH A;  2KT0 A;  2LH9 A;  2E19 A;  3I58 A;  2KQR A;  4M74 A;  2Y69 H;  3KPH A;  1FT9 A;  2WB1 A;  3FBN B;  1FP2 A;  2H8R A;  1YX5 A;  4ESF A;  1U2W A;  2L9V A;  3DPL C;  4AIJ A;  2VT2 A;  5EGO A;  2HQ5 A;  3BG6 A;  3PQJ A;  4Y7N J;  4Y4R A;  2VJI A;  3PQK A;  3GTG J;  1LEB A;  3EUA A;  5L3C A;  3TP3 A;  2XGX A;  3L2W A;  2CG4 A;  3BPV A;  4RM2 A;  1TT0 A;  1TBX A;  1QPM A;  3SDB A;  4IHT A;  2GQQ A;  1TTY A;  2EPF A;  1F43 A;  2DYS H;  3BRO A;  2O0Y A;  3HUG A;  4BGD A;  2XAH A;  5FRO A;  1DU6 A;  1GV5 A;  1GVD A;  4GO1 A;  2CW8 A;  2PMZ A;  2V1D A;  1BN5 A;  2CFO A;  4FHT A;  1NTC A;  1AKH B;  1IDZ A;  4XQF A;  2XDV A;  2GXA A;  3IH2 A;  2DMP A;  4QIW N;  2DU9 A;  2O8X A;  2MD5 A;  3DQV C;  4FX0 A;  2IGO A;  1IAW A;  1BOB A;  3BR6 A;  3BT9 A;  3QPT A;  2ZJ2 A;  4HOB A;  1YFH A;  1W7P B;  2VE8 A;  1Z7L A;  3MQ0 A;  1J75 A;  2QZ8 A;  1X19 A;  1R7J A;  3WE3 A;  3JRA A;  5GAE J;  4PSX A;  3BTL A;  2LRD A;  3JRF A;  1V5G A;  5KVR A;  3KE2 A;  5DM7 F;  1VQ8 I;  2VBW A;  2FBK A;  1MDM B;  3MN2 A;  4KA4 A;  4AD9 A;  4IKF A;  1XN7 A;  4RGR A;  2WWY A;  3P9C A;  4Q47 A;  1FX7 A;  3L2V A;  1OCT C;  4I02 A;  4X0G A;  4O5V A;  3PO2 J;  3I53 A;  1N25 A;  2UUZ A;  3ZCO A;  2ELH A;  1ZGW A;  4CCK A;  1TW2 A;  2Z16 A;  3DPT A;  1TWH J;  1MGT A;  1S9H A;  3S1Q J;  2R7U A;  2CUJ A;  2DQR A;  4ENJ A;  4EV0 A;  3A03 A;  2Z5U A;  2ESH A;  1XCV A;  3I3L A;  3L00 A;  2F5V A;  3FM3 A;  4E7K A;  2QWW A;  3K4K A;  4UV8 A;  3HOT A;  1TC3 C;  4ABZ A;  5D8L B;  4XRS A;  3LSK A;  1TNT A;  3MCZ A;  1JKP C;  4ANJ A;  2DQL A;  5FO5 A;  3V7R A;  5LHI A;  4HF1 A;  1A35 A;  1FLI A;  5IPA A;  3ELK A;  4B47 A;  1O7F A;  2QM3 A;  3DV8 A;  4XKB A;  3M1C A;  1JTX A;  4I76 A;  1K78 A;  1JT0 A;  4EJT A;  1P7I A;  2EFO A;  4U0V A;  2ZME B;  3IH3 A;  3PUF A;  4H4K C;  3F0C A;  3HOZ J;  2EIN H;  2GXG A;  3BZK A;  1PYV A;  1RPW A;  4DQ2 A;  2KFD A;  4TV7 A;  2MFZ A;  4XL9 A;  3DLA A;  4HNU A;  5LBQ A;  3C18 A;  1K78 B;  4E6K G;  2K4B A;  2LLK A;  2LKP A;  4BQN A;  2KIM A;  3E6C C;  4WCG A;  4EGY A;  2LKX A;  2QBY B;  3OR1 C;  1FMW A;  3DKW A;  2L4A A;  5EG0 A;  1MBF A;  2X6Y A;  4ZC3 A;  4FCY A;  2IVM A;  3H9G A;  3ERM A;  2P0W A;  1W7P A;  2VXZ A;  2JZY A;  3MAJ A;  1YI2 I;  2XV4 S;  2WAF A;  1N77 A;  1J2X A;  2NVY J;  1PUF A;  1ZTR A;  2UWM A;  2IP2 A;  1TT5 B;  2LF7 A;  1IXS B;  2A6H F;  2QQ9 A;  4ENN A;  5E18 F;  1PUE E;  2XHK A;  1K7A A;  4P55 A;  2K3F A;  2GIV A;  2UV1 A;  2YSR A;  3LNQ A;  4B44 A;  5DCM A;  4OWR B;  1ONV A;  1WSU A;  1KGS A;  3ISP A;  4U7B A;  1PP7 U;  2W24 A;  5M5W J;  1V5E A;  3WHC A;  1U6G A;  2NNN A;  2M2E A;  2V1N A;  1HSJ A;  1T33 A;  1UZC A;  2E1M B;  5BNG A;  3CF5 F;  1FZP B;  2GBY A;  5IYB J;  4CSW A;  3K6G A;  2FQ4 A;  1HKQ A;  3J80 K;  1RKW A;  3JRC A;  2E35 A;  2L9N A;  2LYC A;  1X3W B;  1YW7 A;  1TQI A;  4A0Z A;  4CCN A;  4F55 A;  3F8N A;  2XF5 A;  3G1O A;  3HG9 A;  1JI8 A;  4XRS G;  5E8G A;  1CF7 A;  2JVH A;  4A0X A;  4BHC A;  4RS8 A;  2LD5 A;  5HS9 A;  4J01 A;  1WJE A;  4RB2 C;  3H3U A;  3J81 K;  4ENM A;  3HOY J;  1CGP A;  3AAF A;  1MSE C;  2EK5 A;  2PEX A;  4BNC A;  3JTG A;  2WY8 Q;  3CP2 A;  4DGW B;  5F08 A;  3Q0U A;  2L7Z A;  2FOW A;  1GV2 A;  2OV7 A;  4MFE A;  4RB0 A;  1Y56 A;  3SFZ A;  1X1B A;  4ZYE A;  1MNE A;  2LMD A;  2HWV A;  4L5E A;  2P4W A;  4BAY A;  4LLL A;  2TCT A;  1VQL I;  2KIQ A;  1YS6 A;  5FKO A;  2Z33 A;  2XPU A;  1IF1 A;  5FLX K;  3BY6 A;  4R8H A;  5J40 A;  2ZSH B;  2L01 A;  4P5O A;  1VTN C;  2JJ7 A;  2QVO A;  1F36 A;  5FD5 A;  1T98 A;  1JKR C;  3VPR A;  1STZ A;  1WH7 A;  2BBY A;  1JKQ C;  4ESJ A;  2E1M C;  5GPC A;  2K02 A;  1V54 H;  2L7K A;  2VOD A;  2F5E A;  2A6E F;  4LIV A;  1MBH A;  3KEQ A;  3GZN B;  2L4M A;  3H5A A;  3TGN A;  4YRV A;  4UVB A;  2EZH A;  2YS9 A;  2VLA A;  4D9J A;  2H6B A;  3KYC B;  2O03 A;  2K40 A;  4HBL A;  4M3E A;  3TDU C;  1B9M A;  4G94 A;  2VQG A;  3L2U A;  2BW3 B;  1UG2 A;  2V1X A;  1I27 A;  5F04 A;  3BR2 A;  1UB9 A;  2EZK A;  4ZDP A;  1L0O C;  4Q4Z F;  2DMT A;  1X58 A;  3LSJ A;  1BW5 A;  1G3W A;  2HPM A;  4YII A;  1FWZ A;  2OZ6 A;  3FXM A;  1WHU A;  2M30 A;  1JGG A;  1NH3 A;  3RKQ A;  4N9H A;  1OFC X;  3AL0 C;  3H5N A;  2OBP A;  5E20 A;  1D8J A;  5DD4 A;  3AL0 B;  1Q1H A;  2QSG X;  2XKO A;  2JUG A;  4EVI A;  3KP4 A;  3J80 Z;  1Z67 A;  5DCM B;  1X3Z B;  3MKW B;  4UV9 A;  2OD5 A;  3WTW C;  1W36 D;  1AKH A;  4BY1 J;  5D6E A;  2JT1 A;  3ABK H;  1IV6 A;  1RKT A;  2PFB A;  3M8E A;  3Q5F A;  4HX8 A;  3M1E A;  4FE4 A;  4C2U A;  3T0Y A;  3F3X A;  2EWN A;  1X1C A;  2BYV E;  4Y52 J;  1Z6R A;  3K2Z A;  1D0Y A;  2HVQ A;  1BIA A;  5J6X A;  1IDY A;  3L09 A;  2E71 A;  2DT5 A;  1UG0 A;  3OYE A;  4HF2 A;  3OY9 A;  4BY7 J;  3F6O A;  1JHH A;  5EJC A;  2DOE A;  5BS6 A;  4V2G A;  1S5L C;  3RI4 A;  2W82 A;  5IP7 J;  4NB5 A;  1MMS A;  3Q9V A;  5EZH A;  1TQM A;  3DKY A;  1B59 A;  2OUM A;  1R49 A;  3TP0 A;  4Q5S F;  2LDU A;  1A5J A;  4RB3 C;  2LG4 A;  4MTD A;  2HVS A;  1B4A A;  4XM3 A;  2NNY A;  3I56 I;  3V8L A;  4P9U A;  1GUU A;  4U7D A;  4WWC A;  5KNL A;  3MKY B;  2EFN A;  4ESB A;  2FMY A;  2ZSI B;  4OMZ A;  4UUS B;  1ZN2 A;  1WH5 A;  1QZE A;  2VOP A;  4F91 B;  1T08 B;  4L0Z B;  4ON0 A;  1EJ9 A;  4B3A A;  3C2H A;  3E5X A;  3ZR8 X;  3QOP A;  3TDZ C;  1MMN A;  3TL4 X;  1G3Y A;  5IYC J;  2R3S A;  4XSX F;  1A6Q A;  3DEE A;  4G12 A;  3OSF A;  3LFU A;  1LFP A;  1A6I A;  2RVC A;  2X85 A;  4NHJ A;  4S0H B;  2KRF A;  3C1D A;  1R6R A;  1VND A;  2QEN A;  2ACJ A;  2DBB A;  4DOZ A;  3H36 A;  4KJZ A;  1RUO A;  1DP7 P;  4IRI A;  2Y31 A;  2W1O A;  2P5K A;  3HSE A;  1QVT A;  2W25 A;  1OIS A;  1R5G A;  2JUC A;  5BPI A;  4HF0 A;  2GM4 A;  5KCM A;  2Y9Y A;  4MTE A;  3AG2 H;  1NK3 P;  3H1C A;  4RA2 A;  2FF4 A;  1B9N A;  1FC3 A;  3ZGK A;  3TBI A;  3QQA A;  2BVL A;  2RQQ A;  5HDG A;  2AQE A;  3OSG A;  3G2B A;  3G1M A;  4HYE A;  4E4H A;  1K61 A;  5FRN A;  1XMK A;  2RDP A;  3KIO A;  2JSC A;  1OYW A;  3V42 A;  3TED A;  3VFZ A;  5IT9 Z;  1E0E A;  2X48 A;  1KU2 A;  4LG0 A;  3V4G A;  2K9M A;  2NOG A;  5J47 A;  2DW4 A;  1ZAO A;  2M7A A;  3S1N J;  1FBQ A;  1P9Q C;  2FOK A;  1LVK A;  3HSR A;  3NWS A;  4L9T A;  2GXB A;  1LDJ A;  4F52 A;  5F0C A;  4HDV A;  4UUT A;  3Q0V A;  4KIC A;  2X9D A;  2ADU A;  1HXD A;  2R5Y B;  3Q3S A;  2K9S A;  2QSF X;  2ZXI A;  1J59 A;  4RGX A;  2V6E A;  3PL8 A;  1O57 A;  4EM1 A;  3ZQI A;  2XB0 X;  2E5N A;  1BA5 A;  2AQF A;  4Z2Y A;  1TW3 A;  2VQH A;  1FP1 D;  4YIF A;  1M1E B;  3J7A Y;  3NQO A;  3K4N A;  2A68 F;  5JHF A;  3DBH B;  2O7O A;  2CUZ A;  4LB6 B;  1W1W E;  2Q2E B;  1W5S A;  1H9T A;  2DA1 A;  3GXO A;  3BTC A;  2L7F P;  2PBI A;  4KN4 X;  3IC7 A;  3V7C A;  3E6B A;  3HDD A;  1A36 A;  5EG0 B;  4HSR A;  3K10 A;  1SFO J;  3F72 A;  5F6F A;  2KZG A;  1ZR2 A;  3OR2 C;  2XUB A;  1ITY A;  2JVG A;  4OOI A;  2VJJ A;  2VL8 A;  3I64 A;  4UXN A;  2BE5 F;  1ETK A;  3TO7 A;  1DGW Y;  3OYM A;  2XKP A;  4UVC A;  2WAE A;  3EQL F;  3TO9 A;  4EEF G;  2G7U A;  2KPM A;  3G4S I;  3KEO A;  4LG3 A;  1K4S A;  1R1U A;  2OZU A;  2ZME C;  3VEP A;  1HLV A;  2R7D A;  4M3B A;  1IN7 A;  2ID6 A;  4G7O F;  2R7W A;  3ECO A;  2A05 A;  4I0B A;  4KIB A;  3HJE A;  2PMZ N;  3X2Q H;  4CHU A;  2XAQ A;  1TLH B;  2F4I A;  2XAS A;  4EMS A;  3IKV A;  1XCB A;  1RET A;  4CCM A;  4IHW A;  1E3H A;  4C2M J;  1QRY A;  3G1L A;  2JA5 J;  2X1D A;  1JKO C;  4CUG A;  3ECH A;  1AWC A;  1K79 A;  2LC2 A;  1XX5 A;  3ZOB A;  2EQR A;  2CUF A;  1Z77 A;  2F6C A;  3CO6 C;  5HOO A;  2VN2 A;  4XLN F;  4BQQ A;  5LFA A;  3OS0 A;  2I8D A;  1PDN C;  3W2A A;  2RGV A;  1A04 A;  3CMY A;  2VPL A;  4HX4 A;  1XDS A;  3MVP A;  4WX9 A;  4BEH B;  3HXL A;  1DPU A;  4IHY A;  3K69 A;  2E5Z A;  1QPI A;  2F5F A;  1VQN I;  4G8X A;  3OMY A;  2PG4 A;  2HGC A;  4C30 A;  1O3R A;  3JTH A;  5LHH A;  2GLO A;  2M0C A;  4L5J A;  3QOE A;  4JX6 A;  3K7A J;  3CCY A;  3RYP A;  2Y0M A;  3HBL A;  4CIC A;  1N78 A;  4BBS J;  2MAB A;  4GRI A;  3LSP A;  1D1B A;  3FBI B;  4V19 K;  4ZDL A;  1ZQ3 P;  2V4J C;  2QF7 A;  3CC2 I;  3SFI A;  3B73 A;  4A3B J;  4M72 A;  1YQA A;  2JSP A;  5L3E A;  4BQO A;  5GTH C;  4CZC A;  1QQI A;  3F9K A;  5CKT A;  2IEK A;  1RR8 C;  4XLF A;  2ZJR F;  4CZZ A;  3WTX C;  3WGG A;  4DJA A;  2IRF G;  3BG7 A;  3V8K A;  2CV0 A;  2BY2 A;  1IXC A;  2GZW A;  4G6D A;  4Y3O A;  3TMO A;  3A1Y A;  1FYK A;  4M6Y A;  2R7V A;  4JYK A;  2DLL A;  2MLK A;  3CCQ I;  2CS3 A;  4EM0 B;  4NNJ A;  2P8T A;  5B3S H;  3BC8 A;  1REP C;  3TW6 A;  2IW5 A;  4A5N A;  1OR7 C;  2HVR A;  2FU4 A;  4UVA A;  4OMY A;  1R00 A;  2ZJP F;  3K1P A;  4E7Z A;  1FSH A;  3DXJ F;  2VJ5 A;  1XGS A;  1YIO A;  2Q0O A;  1Z7U A;  3CJR B;  4KIT B;  2IS1 A;  1WZ2 A;  5ICG A;  3A0H C;  3GTK J;  2ESN A;  2DA6 A;  2MG4 A;  3CZ6 A;  2ZME A;  1MD0 A;  2GA1 A;  3CMA I;  1UCR A;  4D5F A;  3KET A;  2OJE D;  3GW2 A;  1RNL A;  4QPQ A;  4XON A;  3SZT A;  1ETO A;  2M0M A;  2VQC A;  1IZ1 A;  2EIJ H;  2HDD A;  4XOR A;  3SYT A;  4G7Z F;  5E17 F;  3KP2 A;  3FXL A;  2H8W A;  4JOM A;  2E36 A;  3ZRG A;  4BUP A;  3M9A A;  1FOY A;  1XSD A;  3BR5 A;  3LOC A;  1TWG J;  4JK1 X;  3O2P E;  4MNU A;  5AON A;  2OTJ I;  4NC6 A;  2ECC A;  4WXC A;  4HRI A;  3E3V A;  1WJF A;  2H1L A;  2KLO A;  2ICW G;  1MBK A;  4HV6 A;  3FIS A;  1OYI A;  5H6R A;  3FKJ A;  3TOB A;  3EDP A;  2ID3 A;  4PJJ A;  2WAQ A;  2Y2Z A;  3ROU A;  3R0A A;  3BQY A;  1W5C C;  2CFX A;  2NAZ A;  2B63 J;  3R6S A;  3IWF A;  2O6G E;  1B72 B;  4YIR X;  4E7L A;  3CES A;  3HTU A;  2FJ1 A;  1VQM I;  3Q9S A;  3LL7 A;  4B09 A;  3B02 A;  1Y0U A;  2JPB A;  4U87 A;  1K6Y A;  5KHD A;  1BBY A;  4DZJ A;  3I4M J;  3L2R A;  4RAY A;  1IRX A;  1Z21 A;  2CW7 A;  3ZMT A;  1B6A A;  5D5U B;  3CMM A;  4C3I J;  5EEH A;  1IW7 F;  4F7Z A;  3BR0 A;  4EM2 A;  3NAR A;  3R61 A;  3RZD J;  1P4W A;  3JAM K;  3MEX A;  3E5Q A;  1XMA A;  3S3M A;  1IV8 A;  3PSI A;  1JGS A;  2XF6 A;  2BZT A;  4A12 A;  1YHQ I;  1K6O A;  1DP3 A;  3K9T A;  5HDN A;  4RMN A;  1TWF J;  3HKZ N;  3PFI A;  2F2E A;  5FGM A;  2A5Y B;  4LG0 B;  2E1N A;  1S3J A;  2QQB A;  3RDI A;  4ZJZ A;  3IKT A;  1I1G A;  1WJA A;  4W1U A;  1S29 A;  1EH8 A;  2RNG A;  2RRE A;  4HA8 A;  4A6D A;  2JQ7 A;  1CF7 B;  1WFX A;  4CCL A;  1R4N B;  4RAG A;  3RJP A;  3P7N A;  1U78 A;  1XG1 A;  2R0Q C;  2MW8 A;  5E3L A;  1QBJ A;  1F4K A;  4B4C A;  1ZRD A;  2LY2 A;  4G7H F;  3VOD A;  3BQZ A;  1XGN A;  5LRS A;  5H2F C;  3R60 A;  1DQU A;  4FTH A;  3DFG A;  3GFM A;  2NRA C;  2DA4 A;  2V9K A;  2R5Z A;  3MZY A;  1I3Q J;  5J3L A;  5FKK A;  2ME0 A;  2VE9 A;  1X3U A;  4KYW A;  2KZV A;  3K70 C;  3QP5 A;  1Q1V A;  3BDD A;  3A02 A;  1TQP A;  5EGO B;  1P4A A;  3HIF A;  4HZF A;  4ETS A;  1PP8 F;  2YU9 J;  2HYG D;  4M71 A;  3HKZ A;  4FIS A;  5EYR A;  1MND A;  3KZZ A;  3OV8 A;  2DN0 A;  3HPH A;  4WK8 F;  2M3A A;  5EEA A;  2DOF A;  5DEQ A;  2L3D A;  3SDG A;  2HEO A;  3OIQ A;  4FAS D;  1R36 A;  1C0W A;  3CDL A;  1HST A;  5GPA A;  1SD6 A;  2DYR H;  5GP9 A;  2L0K A;  2V9P A;  2PJR A;  3QAH A;  4D5C A;  4XR6 A;  3ZQF A;  4BDZ A;  2NYX A;  1ULY A;  3K70 D;  5F1J A;  4P9F A;  3D5R C;  3CCL I;  5D6F A;  4HPQ A;  3HYI A;  3ZQC A;  1FOK A;  5HNF A;  4EJW A;  1GT0 C;  2JRT A;  3ABL H;  1S7O A;  4BJ5 C;  3EUH C;  2BY3 A;  2K85 A;  2JPC A;  3SQN A;  1T0F C;  3B6C A;  5B66 C;  1V4R A;  1WKM A;  4NQW B;  3R4K A;  1SFX A;  2OA4 A;  4HQM A;  4L9J A;  2OCC H;  3D5L A;  2NXN B;  3ZQL A;  4XID A;  3HTS B;  2K5C A;  5J8C A;  2ZBK A;  5CPR B;  4EGZ A;  2LSO A;  1YOV B;  2EBI A;  3JAM Z;  1U5T A;  4HNV A;  2LP0 A;  2LTP A;  3V7S A;  2COM A;  3OL3 A;  5HLI A;  3VSL A;  3BPX A;  1E3P A;  3H35 A;  3DLL F;  2EJR A;  5DCF A;  1X2N A;  4M9X A;  2HKX A;  5CQG A;  4F92 B;  1UHM A;  3JRG A;  1P4X A;  5J1U A;  3IUO A;  4A5M A;  2B9S A;  5AIQ A;  4M3D A;  3BLY A;  2NS8 A;  2CV1 A;  1FSE A;  3ABU A;  1LNW A;  4EJV A;  1UHS A;  1BI1 A;  2CU7 A;  1UMQ A;  3I9V 2;  1HKS A;  4PDK A;  3GZ6 A;  3MKZ A;  5BMZ A;  3WTV C;  3F8F A;  4XLH A;  2A61 A;  1XMX A;  1BJA A;  2JWT A;  2ZCW A;  2R7S A;  2JMW A;  1Z6T A;  2IXS A;  3JSO A;  2Z3Y A;  3VB2 A;  1Y8R B;  3VDX A;  3JSP A;  5HNH A;  4I98 B;  1FPQ A;  3ZP5 A;  5F0F A;  4J00 A;  2R7Q A;  1R5H A;  2OTL I;  2DA5 A;  4NDL A;  1X1P A;  2GIZ A;  3COA C;  1WRJ A;  2XIG A;  1VQO I;  1ZRC A;  1U5T B;  1FTZ A;  4A3G J;  3BG3 A;  3IP4 B;  1W7P D;  2COB A;  1SVM A;  1R1V A;  2BY1 A;  2A69 F;  1XSV A;  3W3C A;  2CJJ A;  1JJ6 C;  3KCC A;  5M3M J;  2IA2 A;  4IQ4 A;  1O4X A;  5E8I A;  1MIJ A;  1SMY F;  3RCO A;  4R79 A;  4AM3 A;  4L9V A;  3ONQ A;  4DZP A;  2Z2S B;  3QU3 A;  3CCR I;  4MEY F;  3RIR A;  1SD7 A;  4XIC A;  3KLN A;  4L18 B;  3LFK A;  2M4K A;  1I6H J;  3WU0 A;  1FMV A;  2I5U A;  4RM3 A;  3OYF A;  5E79 C;  1G3T A;  1BM9 A;  5JVG F;  4L9N A;  2XF7 A;  2EZL A;  2EZI A;  2Q2E A;  4XKW A;  2B0L A;  4MHG A;  1XGM A;  1ZR4 A;  1D5Y A;  3I55 I;  3JRI A;  2DK5 A;  1QZY A;  3FM5 A;  4QPO A;  4IHS A;  3CUQ C;  4IL6 C;  2XSJ C;  5TIS C;  3VYT B;  2F4O B;  2FBI A;  4S04 A;  2HOE A;  4PJM A;  2XGD A;  2BV6 A;  3FXK A;  2XVC A;  4OIN F;  1D0X A;  3CME I;  3SZP A;  4XKV A;  4XMY A;  4D7M A;  2X0L A;  4ZTJ A;  1QHG A;  1XGO A;  3GUD A;  2A3S A;  2VKV A;  3LA2 A;  5KAI C;  1OPC A;  2X4H A;  2DK8 A;  5IT9 K;  3O6B B;  1TWA J;  2AXL A;  2HYJ A;  2DAO A;  3HSF A;  4NC7 A;  3JRE A;  1YTY A;  3QWL A;  1LPQ A;  2NVT J;  2QGU A;  3H5R A;  2CGP A;  4CYC A;  2G0E A;  5D8K B;  2VQL A;  1ZEL A;  2DT7 B;  2FBH A;  4II3 A;  3DU6 A;  3DTI A;  4KN7 X;  1I3A A;  2M5W A;  4P1W A;  2JRM A;  1K4T A;  3GTP J;  4O6J A;  4CO8 A;  1SFE A;  2R92 J;  2ZXJ A;  3RPQ A;  2UXX A;  1VQ6 I;  5J1Y A;  2WTE A;  1D1C A;  3OIO A;  2QEX I;  5HDK A;  2BGC A;  2DCE A;  2W84 A;  5K7Z A;  2LY9 A;  5K1Y A;  1I6X A;  4JX4 A;  3RKX A;  4QLC U;  3GBG A;  2XPW A;  2O61 A;  5LHG A;  3AG3 H;  1BIB A;  5FKL A;  4KIF A;  2VXD A;  3FMS A;  2E2H J;  4PUS A;  3GTO J;  4RAF A;  4XBF A;  4RAZ A;  2DOD A;  3LSM A;  1DU0 A;  1W4M A;  2XPV A;  1JTY A;  5B5E C;  2VC1 A;  1QA6 A;  4JBA A;  2M45 A;  3WTU C;  3BP8 A;  4XN3 A;  3KEY A;  1ON1 A;  2IJL A;  1KQ8 A;  2VBZ A;  5GAD J;  3ZMZ A;  3BJA A;  3BR3 A;  1PJR A;  5IP6 A;  1YIT I;  1FYL A;  4B3X A;  3S93 A;  2KJB A;  2P7C B;  1ETQ A;  1ZK8 A;  4LK1 F;  2UXN A;  4WXH A;  3S16 J;  3ML6 A;  4I09 A;  5IT3 A;  5F1R A;  2G7H A;  3HOV J;  4PGH A;  2X1E A;  1BW6 A;  1S7A A;  1T38 A;  4BU2 A;  1XB4 A;  4F93 B;  2FA5 A;  4AU7 A;  5F27 A;  4DNC A;  4MQV A;  3TOA A;  1LFB A;  5FFX A;  3H92 A;  5LEK A;  4YFK F;  3S15 J;  3CLO A;  2FUG 2;  4HDU A;  1W0T A;  2OQR A;  3FXQ A;  4YEL A;  4A6E A;  1O3Q A;  2BY0 A;  2EH3 A; 
#chains in the Genus database with same CATH homology
 3G1L A;  4M3F A;  3IH2 A;  2CQX A;  2DMP A;  1JKO C;  2JA5 J;  4QIW N;  2P81 A;  1CQT A;  3M4O J;  2W48 A;  3ZOB A;  2EQR A;  2CUF A;  1Z77 A;  3BR6 A;  4MO7 A;  3BT9 A;  2KDZ A;  5EZG A;  1QVU A;  3JRB A;  3B6A A;  2TRT A;  5IOZ A;  3CMY A;  3MVP A;  4A3L J;  3Q0W A;  4IHY A;  3JRA A;  1QPI A;  2HOT A;  3BTL A;  3JRF A;  1ORK A;  2GLO A;  2M0C A;  1FIA A;  4JX6 A;  3K7A J;  3CCY A;  3HBL A;  5FJ8 J;  4BBS J;  3MN2 A;  2XRL A;  3LSP A;  1MBG A;  1ZQ3 P;  2QF7 A;  5F0H A;  1OCT C;  3PO2 J;  1VI0 A;  3SFI A;  3S14 J;  3S2D J;  1POG A;  4A3B J;  1ZGW A;  1AU7 A;  4A3D J;  2R93 J;  3TW7 A;  2JA8 J;  1TWH J;  3JRH A;  3S1Q J;  2IEK A;  1AHD P;  3A03 A;  5IP9 J;  1ENH A;  1W0U A;  2Y0S N;  1K83 J;  4A3K J;  1GDT A;  3DCF A;  5FKN A;  1XS9 A;  2WV1 A;  1TC3 C;  4ABZ A;  4A3F J;  1ZKG A;  1ETX A;  9ANT A;  4XRS A;  4JYK A;  1JKP C;  1FIP A;  1WI3 A;  1JUS A;  3A01 A;  2Y9Z A;  5IPA A;  2XSD C;  3TW6 A;  4AUX A;  2LVS A;  3WHB A;  4DYC A;  1YRN B;  2O9L A;  1FTT A;  2YUS A;  4XK4 A;  1JTX A;  4I76 A;  1JT0 A;  1P7J A;  3O8H A;  1P7I A;  3IH3 A;  1BJZ A;  3F0C A;  3HOZ J;  3GTK J;  3GTL J;  4MLO A;  1RPW A;  4M6V A;  2DA6 A;  2MG4 A;  2ME6 A;  4D5F A;  1JJ8 C;  1T56 A;  4MIM A;  4A3J J;  1ETO A;  1MH3 A;  2LLK A;  2HDD A;  5K7H A;  2JK3 A;  3BG5 A;  4A3M J;  5JLW A;  2LKX A;  5EG0 A;  1MBF A;  4FCY A;  2MGQ A;  1APL C;  3BR5 A;  3LOC A;  1TWG J;  2NVY J;  2ECC A;  2H1K A;  1PUF A;  3D1N I;  1MBK A;  1ZTR A;  2JA7 J;  3FIS A;  2E2I J;  3QPS A;  4BBR J;  2VI6 A;  2ID3 A;  4IEJ A;  5C4J J;  2XGE A;  2DJN A;  2Y2Z A;  4A69 C;  1IC8 A;  3BQY A;  2R7Z J;  3MKL A;  2B63 J;  1H89 C;  1TWC J;  1B72 B;  3LNQ A;  1RR7 A;  2FJ1 A;  4DZJ A;  3I4M J;  4IHX A;  5M5X J;  5M5W J;  3WHC A;  4C3I J;  2M2E A;  1T33 A;  4J19 A;  5BNG A;  3BR0 A;  3NAR A;  3RZD J;  1JT6 A;  2GBY A;  2I10 A;  5IYB J;  2R5Y A;  2FQ4 A;  1Y1V J;  2HOA A;  3S2H J;  1RKW A;  3JRC A;  2O8K A;  2OF7 A;  3FIW A;  3NAU A;  1IRZ A;  1TWF J;  3HKZ N;  1OJL A;  2CQQ A;  3G1O A;  4XRS G;  2NVX J;  2ZB9 A;  4W1U A;  2Y30 A;  4BKX A;  4A3E J;  2LD5 A;  5IOY A;  5C3E J;  5M3F J;  1IGN A;  4A3I J;  2DA2 A;  2LR8 A;  2VUM J;  3HOY J;  3JR9 A;  1LFU P;  4D7N A;  5HOD A;  1MSE C;  2IAI A;  1WGX A;  1H8A C;  5F08 A;  1U78 A;  1XG1 A;  2R0Q C;  3Q0U A;  2VPR A;  2L7Z A;  2MW8 A;  3HEF A;  3IH4 A;  5E3L A;  1GV2 A;  4MFE A;  4B4C A;  3JRD A;  3BG9 A;  3BQZ A;  3HGY A;  4FTH A;  1MSF C;  3K2A A;  3A01 B;  2DA4 A;  2R5Z A;  2FD5 A;  3L1P A;  5J3L A;  1I3Q J;  5FKK A;  2ME0 A;  2FX0 A;  4M3G A;  4L5E A;  4X6A J;  1Q1V A;  2TCT A;  3A02 A;  5EGO B;  2CRG A;  3IV5 A;  5FKO A;  2YU9 J;  2XPU A;  4FIS A;  5EYR A;  3LSG A;  2DN0 A;  1ETV A;  4UUS A;  3FK6 A;  5FKM A;  1Z0X A;  5EEA A;  3CQZ J;  4FE7 A;  2MSY A;  3SDG A;  2JJ7 A;  4RDU A;  1F36 A;  1B8I A;  3CDL A;  4C3J J;  1JKR C;  2DTZ A;  5GPA A;  3VPR A;  5GP9 A;  2L0K A;  4W97 A;  1WH7 A;  1B72 A;  1FEX A;  1JKQ C;  4D5C A;  5GPC A;  3ZQF A;  4JX5 A;  3I4N J;  5F1J A;  1HDD C;  2JA6 J;  1ETW A;  3BTI A;  3H3V K;  1MBH A;  1X2M A;  2CUE A;  3ZQC A;  3C2B A;  1GT0 C;  2EZH A;  2YS9 A;  3GTM J;  2XB5 A;  3HM5 A;  5FLM J;  3DEW A;  1U8B A;  2K40 A;  3B6C A;  4A3C J;  4M3E A;  4RBO A;  3SJM A;  1EF4 A;  1UG2 A;  2DMQ A;  5F04 A;  2WAQ N;  3BR2 A;  2EZK A;  2HXO A;  4AC0 A;  2IBD A;  2DMT A;  1X58 A;  3LSJ A;  2HOS A;  1BW5 A;  2K9N A;  3ZQL A;  4XID A;  1JGG A;  5DTD A;  1HF0 A;  3RKQ A;  4DYR A;  1OFC X;  4XRM A;  2EBI A;  2N8G A;  4HNV A;  2LP0 A;  2LTP A;  4AYB N;  1JUP A;  1AKH A;  2X6O A;  4BY1 J;  1X2N A;  2D5V A;  1IV6 A;  1YRN A;  3JRG A;  1RKT A;  2VKE A;  5J1U A;  4FE4 A;  3HOW J;  4M3D A;  2NS8 A;  4Y52 J;  4LOC A;  1UHS A;  1LE8 B;  3M3Y J;  1Y1W J;  1IDY A;  3LSR A;  2CU7 A;  1MH4 A;  1UMQ A;  2ECB A;  4BY7 J;  4B1R A;  5K7F A;  4V2G A;  3FKI J;  5C4X J;  5IP7 J;  1WPK A;  4QTR A;  1E3O C;  4V2F A;  2JWT A;  5EF6 A;  2L7M P;  3PM1 A;  3O8G A;  5EZH A;  2JMW A;  3TP0 A;  1A5J A;  1H88 C;  5E3O A;  4BXX J;  5J1R A;  2M8G X;  4I6Z A;  2OPT A;  1GUU A;  3FK7 A;  5F0F A;  1B8I B;  2DA5 A;  4NDL A;  1BL0 A;  1IUF A;  1FTZ A;  4UUS B;  4A3G J;  3H0G J;  1WH5 A;  3BG3 A;  3S1R J;  2K9Q A;  1VFC A;  3S1M J;  2COB A;  1SAN A;  4JP0 A;  4B3A A;  3BTJ A;  1HOM A;  2LFB A;  2CJJ A;  1JJ6 C;  5M3M J;  1XC5 A;  5IYC J;  1O4X A;  4MFD A;  1NK2 P;  1JUM A;  1U9N A;  1MBE A;  3GTJ J;  4G12 A;  3ZQG A;  4DZP A;  4DYQ A;  4XIC A;  3OSF A;  1A6I A;  1R9T J;  1I6H J;  4S0H B;  2E2J J;  1VND A;  3W6V A;  2EZL A;  2EZI A;  2L9R A;  3S17 J;  2M9H A;  2Y31 A;  1ZR4 A;  1D5Y A;  1RES A;  1QVT A;  3JRI A;  1LE8 A;  5E3N A;  2GM4 A;  4X1E A;  2Y9Y A;  3UKG A;  2HXI A;  3QPL A;  1NK3 P;  2XGD A;  2DA3 A;  1WCM J;  3QQA A;  4DW6 A;  3OSG A;  2DA7 A;  4D7M A;  3HOX J;  3G1M A;  1K61 A;  2VKV A;  3RQI A;  3TED A;  1VF9 A;  1TWA J;  3JRE A;  2HYJ A;  2X48 A;  3HGG A;  2NS7 A;  2RAE A;  2NVT J;  2QCO A;  5IYD J;  2NOG A;  4CYC A;  3S1N J;  5JLX A;  5EDN A;  2G0E A;  2AO9 A;  3BR1 A;  1HCR A;  5F0C A;  4UUT A;  1ETY A;  2R5Z B;  1MBJ A;  3Q0V A;  2X9D A;  3OOU A;  2R5Y B;  2DMU A;  3Q3S A;  2K9S A;  2LK2 A;  5C44 J;  3GTP J;  2R92 J;  3ZQI A;  1U9O A;  2XB0 X;  2NVQ J;  1BA5 A;  3PO3 J;  5J1Y A;  2HI3 A;  3OIO A;  2E1O A;  4C3H J;  5K7Z A;  2LY9 A;  2AHQ A;  2O7O A;  4JX4 A;  2WB1 N;  2JN6 A;  3GBG A;  2XGC A;  2XPW A;  1PUF B;  3GTQ J;  2DA1 A;  5FKL A;  1HDP A;  3ZQH A;  2E2H J;  3GTO J;  3BTC A;  4GFB A;  2L7F P;  4QSH A;  2KT0 A;  2XPV A;  3HB9 A;  1DU0 A;  1JTY A;  3HDD A;  2E19 A;  5EG0 B;  2ELK A;  1SFO J;  5M5Y J;  4IHV A;  1ZR2 A;  3HOU J;  1IJW C;  2H8R A;  5E3M A;  1ITY A;  1I50 J;  2DMN A;  1IG7 A;  4A93 J;  3BR3 A;  1ETK A;  5IP6 A;  5EGO A;  2HQ5 A;  1FJL A;  4CYC B;  1ETQ A;  1ZK8 A;  4EEF G;  3RZO J;  2M34 A;  4Y7N J;  3S16 J;  3GTG J;  1HLV A;  1OCP A;  3HOV J;  3TP3 A;  4M3B A;  1BW6 A;  2ID6 A;  1S7E A;  5F27 A;  1G2H A;  1LFB A;  1F43 A;  2PMZ N;  1DU6 A;  3S15 J;  1GV5 A;  1GVD A;  5DS9 A;  1MNM C;  1W0T A;  1NTC A;  1AKH B;  1RET A;  1IDZ A;  2EH3 A;  5FLV A;  4IHW A;  3E7L A;  4C2M J;  1QRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...