3JW4A

The structure of a putative marr family transcriptional regulator from clostridium acetobutylicum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
123
Chain Sequence
b'DTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYENQESGIIQKDLAQFSITSMLQGLEKKGYIERRKNIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQKQLMSILIKVNRSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR/EmrR family
publication title The structure of a putative MarR family transcriptional regulator from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Transcription regulator
total genus 42
structure length 123
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jw4A00
4HYEA 5K1YA 2OU2A 3IRQA 2Q8KA 4U0VA 1ONVA 5FO5A 3MAJA 4OMYA 3M1EA 1R36A 1I6XA 1ZAOA 2VC0A 5E1WA 3T1BA 2RQPA 4LG0B 3CO6C 5K5QA 4KFCA 2XIGA 1TTYA 5BQTA 4G7HF 3BY6A 3R0AA 3ML6A 2A5YB 3Q5FA 4R79A 3DPLC 4YFKF 3I58A 2M45A 3HRUA 2A68F 4OIPF 2HYGD 4BNCA 2HKOA 3DFGA 3IHUA 3I4PA 3RKWA 4HOBA 2RKHA 2PQ8A 3MWMA 3FZVA 3V8KA 2CWEA 1OYWA 3RTRA 2K02A 2ZO4A 2EK5A 2XGXA 1HQCA 1AWCA 2VBWA 3WE3A 4ESFA 2XV4S 1KYWA 1KU7A 5ICFA 3QP5A 4L0YB 5CVIA 4ZYHA 3FXRA 4L5IA 2FSWA 3WTSC 4GCVA 3E6CC 3CUQC 2E7WA 4ASNA 1XGMA 5ILSA 5K5OA 1I1SA 1HSJA 2KJBA 4OU0A 3TOAA 3LQQA 2EWNA 2HFHA 1MD0A 5EEGA 2IA1A 5BPDA 4LLNA 2O61A 5ICEA 2Z5UA 2JSCA 5HVQC 1MGTA 3V8LA 2JPBA 2DBBA 5H6RA 5D4SA 1FYKA 3WE2A 1UHWA 5ICGA 4ZZLA 5JFRA 1H0MA 2OAZA 1WSUA 3ZQ7A 3WTZA 2ACJA 2P6SA 4ETSA 3QU6A 1FYLA 4UXNA 4JBAA 2COMA 1ZHFA 3ERED 2J5PA 2XAFA 2L4MA 1FSEA 4KN4X 4MEYF 4Y13A 1ON2A 5HS8A 4EGZA 1HKSA 1EH6A 3JTGA 3NEUA 1LJ9A 1WWXA 3EETA 5AIQA 3TKYA 1FP2A 2HDCA 4UVAA 5D4RA 4AVPA 4ZH4F 2ISYA 1S7AA 3CUQA 4XLNF 1RZ4A 2IRFG 1O7LA 2R3SA 4DNCA 2M8EA 2W85A 3F8BA 3QP6A 2LDUA 1P4AA 1T38A 2CW0F 2E1NA 4QLCU 1R1UA 1R5HA 1J75A 2HGCA 3I5UA 1TNTA 3C7JA 5L3CA 3GXOA 3U2RA 3DV8A 3I53A 1S6LA 2VONA 5D5XB 2ADUA 3FXQA 5JI6A 2FRHA 5J6XA 4U88A 2L4AA 2CSOA 4EJVA 4M6YA 2H94A 1SD4A 3T8TA 1V3FA 3LSTA 3BJ6A 3V7CA 3E97A 3LAJA 4RAYA 4CICA 1XB4A 2Y75A 2BEOA 4S04A 2E1CA 2L01A 4Q5SF 2PJPA 1D5VA 1QBJA 5D5WB 4M73A 2RC4A 2QBYB 2CO5A 3ZN1A 1B59A 3WU1B 4HV5A 3U9GA 4EJTA 5HDNA 3SZTA 3SZPA 2HQNA 2L3DA 4A6EA 5JHUA 3J80K 1USSA 2HTJA 3EYYA 3MFKA 4HQEA 1H9GA 3C1DA 3KEQA 2F5CA 3MZYA 3GEZA 2L02A 1EH7A 1FY7A 2CG4A 3HOTA 2RDPA 3IKVA 2EB7A 4O6JA 2BBYA 5ILVA 1J2XA 1FWZA 1ULYA 2FU4A 1XN7A 2DT5A 5FLXZ 4ZYDA 1YG2A 3FXUA 4ENKA 1W7PB 1TLHB 1FP1D 1KU2A 1I27A 2Z9OA 2XAJA 3HRSA 2H6BA 4XLPF 2RV8A 4IHTA 4A5MA 3GO5A 1YYVA 1YS7A 1RIOH 3FWEA 4BHPA 4OINF 1BM9A 2OZ6A 4RGSA 4G9YA 4HBLA 4L9NA 5LHHA 1REPC 5HLHA 5D6FA 4MTDA 4WK8F 2FEZA 3V8JA 2X0LA 2DO7A 1HBXG 4M9XA 4WXHA 3KEOA 2M30A 2WTEA 3FMRA 5E8IA 4N9IA 2Z99A 3R4KA 1Z9CA 2HOEA 3DPTA 4EM0B 1YS6A 1ZARA 3GF2A 2DFIA 3FHZA 2E7XA 2IW5A 4L5JA 3ZMDA 4KDPA 1J9IA 5KVRA 2WWYA 1R00A 4LK1F 1QZZA 3E6BA 3MCZA 2DQLA 1BI2A 1FBQA 5AIPA 3B02A 1DDNA 3IC7A 1Y0UA 4KA4A 3WTYC 3ECOA 4ZYEA 1HW1A 3BROA 4F7ZA 4PDKA 2ZCWA 3REOA 4Q47A 4PGGA 4GYGA 4HF2A 4L18B 1OPCA 4M6XA 2FMYA 2ZJ2A 4MEXF 2EV5A 2VN2A 3BJAA 3WG9A 2GXBA 1FSHA 2UXXA 5LGTA 3BOQA 1Z91A 1G3TA 2DAOA 3K69A 1W5SA 1W7PD 4HDUA 2ZNZA 2VT3A 4AD9A 4Q4ZF 3MEXA 4A0XA 4IXAA 1BOAA 2ELHA 2K7LA 1G6NA 1XD7A 2ETHA 3K2ZA 4U0WA 2EFOA 2DTRA 1ODDA 3M7GA 4E70A 2EA2A 5LGUA 3QRFF 2L54A 2EFNA 4GYIA 4ENMA 1DUXC 3RKYA 4ENNA 2V79A 2UWMA 3P9KA 3LA7A 1OYIA 4FHTA 1X3UA 1TQMA 4HW0A 3VODA 1U5TB 5TRDA 1PP7U 2BYVE 4WXCA 3VFZA 3KETA 1L3LA 5DCFA 2WV0A 2LKPA 4ZZDA 3CJNA 2PI0A 1R7JA 1RI7A 2EV6A 3ROUA 3OV8A 1Z05A 1STZA 4RGUA 1SAXA 3O2PE 1IRGA 1L0OC 2ZBKA 2H27A 1UCRA 4OIQF 4M71A 3ABUA 2DPDA 3C3WA 3ZPLA 5IT9K 4LFUA 4O5VA 2QM3A 3BWGA 1YLFA 4I7HA 3KP5A 3CO7C 1CGPA 1ZN2A 3QAHA 4UV9A 2PMUA 2ZXJA 4P9FA 3F22A 1G4DA 1JHFA 1FNNA 2Y48A 1OR7A 2K27A 4AIHA 5FLXK 1QQIA 4FX4A 1WKMA 2WC2A 5BMZA 3F3XA 3B73A 2W57A 1MZBA 1FZPB 4YFNF 2FNPA 1XDSA 2RVCA 1QPMA 2QWWA 3F8FA 3TOBA 3NRVA 2RNJA 1ZH5A 4GXOA 2W24A 2ESNA 3HIFA 4P5OA 1TQIA 2FE3A 5J8CA 2P4WA 5FB2A 1U8RA 1B1BA 4WXDA 2O03A 4Y17A 4RB3C 3F6VA 3FF5A 1RUOA 1XGNA 3HSFA 2CGPA 3G3ZA 1R23A 4IRGA 4I01A 2MD5A 3WTWC 1IAWA 3G73A 4A5NA 1BJAA 5DD8A 3ZP5A 5CYVA 3TQNA 1T98A 4EJWA 1YW9A 3LAPA 3FMQA 3GFJA 2V1XA 2MBFA 2TDXA 1SMYF 3HSRA 3I59B 1SD6A 4IHSA 3AAFA 2R7DA 4KMUX 2QUFA 1SFEA 1A04A 1XGOA 4JQFA 1FT9A 4U0YA 4B8XA 2C6YA 3CLOA 3L2CA 4G6QA 4HDVA 2D45A 5FFZA 2KKOA 2JZYA 3BJOA 3T0YA 2DI3A 3RPUA 2HZTA 1GHCA 2CYYA 3LA3A 1RNLA 3LWFA 3OOPA 4HX7A 2YPRA 2YX7A 1RUNA 2O6GE 4A0YA 1ZG3A 4ESJA 5JVTA 4LG0A 5LGNA 5HDGA 1YW7A 1YW8A 1BC8C 2EV0A 4UNOA 2STTA 3V4GA 4CZZA 3JAMK 5H20A 3IWFA 3DP7A 4IRHA 2V9VA 1O7FA 2HKXA 1KQ8A 1U6GA 1XSXA 3RI4A 1USTA 3JSOA 3GW2A 2QYOA 1ZLJA 4JK1X 4UHTA 1ZG1A 1R1VA 4IPAA 3BP8A 1OYYA 5K5RA 3N4MA 1FOKA 2XAGA 5E17F 4AIKA 4HA8A 4ZYGA 3ELKA 3BPVA 1IN7A 3TO6A 3E3VA 4A6DA 2W25A 1BN5A 4EGYA 3CTAA 1S3JA 1JGSA 3DKWA 1B4AA 1K78B 5L3BA 5BPIA 4NB5A 4R1HA 3R61A 3K1MA 1R1TA 2IVMA 1MDMB 4HX8A 1QGPA 2H09A 2V1UA 2EFPA 5E1XA 3IRRA 1BIAA 3ZMUA 1R58A 1E2XA 2VE8A 2XKPA 2M87A 4A0ZA 1G3YA 4GO1A 3VEPA 3KE2A 5LBQA 5BOXA 2A6EF 5ED4A 3TDUC 1IXSB 1Z7UA 4UVBA 1U3EM 3KP7A 3FMSA 5DEQA 2PBIA 2IJLA 2K4BA 5LRSA 1WRJA 2O8XA 1PUEE 4CYDA 4Z2YA 2G9WA 5DCMB 2XHKA 4HZFA 3FX3A 1IUYA 4LMYA 3BZ6A 3L7WA 1KQ9A 2VBYA 2JTVA 4I2OA 4BHBA 6PAXA 1IXRC 5DV5A 1BC7C 5ERIA 4L9JA 4LLGF 2DW4A 1NHAA 3FM5A 3KZYA 4KYWA 2EFQA 2BV6A 1HW2A 2PLYA 1YQAA 2F2EA 1ZGAA 2Y0MA 2XASA 4XBFA 4EM1A 4Q48A 4EM2A 2FBIA 4LJZF 3SXYA 5A2QZ 2FMLA 1U2WA 2HR3A 5L3FA 1IZ1A 1BI0A 5LRRA 1F1ZA 3DEUA 3C18A 2MLGA 3RKXA 2GIVA 2GXGA 4L9TA 2A69F 5FGMA 2QQAA 5CVUA 2F5EA 1E17A 1Z1DA 1ZGJA 3CUOA 3GVAA 1J59A 1H9TA 1P2FA 4M74A 3NQOA 2UXNA 4N0BA 4WWCA 5F1RA 4M72A 1PDNC 4EJUA 3KZZA 3HTSB 5DUKA 3T5XA 3IKTA 2PFBA 3KFWX 2FOKA 2LF7A 2GQQA 2EA4A 1BI1A 3PQJA 3HTUA 2XRNA 2V6CA 2QQ9A 5DYMA 3QOPA 4FX0A 1LDKB 2JT1A 4UUVA 2QBYA 3WTUC 4G8XA 2STWA 4CHUA 2JPCA 4DQ2A 1IN8A 1GVJA 1C0WA 3ABTA 2XAQA 3F8NA 2PEXA 5HS7A 3D0SA 2ZFWA 3WTVC 2LSOA 2VODA 4OIOF 3KP2A 1QO0D 1XSDA 5D5UB 1ZREA 2MH9A 2GA2A 4RAZA 4KIGA 5L3GA 4I09A 4HF0A 3E5UA 2ESHA 3F21A 4M9SA 1F4KA 4L0ZB 5L3DA 3LQRA 1GXPA 1LDJA 3WODF 3WGIA 5TJJA 2A07F 2HTSA 1T0FA 1W7PA 4PCQA 3PQKA 1EV7A 2OQRA 3MQ0A 2GWRA 3JW4A 3GYHX 1SMTA 1TW2A 1OMIA 3ZMSA 3DXJF 4KUMA 4MQ9F 2K4JA 2D1VA 2IPQX 3RIRA 3HRMA 4HX4A 5E20A 1HW5A 4KT5C 4NHJA 3ZMZA 4XRFA 4RS8A 1JE8A 1IW7F 5LHGA 1O3TA 5ILUA 2RGVA 2Q2EA 4BH9A 4LB5A 1W5TA 2P7CB 4EMSA 2OD5A 1JXSA 4YFXF 2B0LA 5HDKA 3QPHA 1G3SA 4BAYA 5DUIA 4U7DA 2A6HF 1SFXA 3KLNA 4EJOA 2P5LC 1S7OA 2UZKA 1K7AA 4OIRF 4CXFA 3KP6A 3JTHA 3QU3A 4MGRA 3I71A 1U5TC 3BDDA 1LNWA 1B9MA 2XROA 1QNTA 3MZHA 4HV6A 3HHGA 3EUHA 4IRIA 2BE5F 5D5VB 3PFIA 4KN7X 1YO5C 4P9UA 3KP4A 4LK0F 5A2QK 4WF2A 2KIUA 4IJAA 3WU0A 3J80Z 3L00A 4I0BA 3I64A 4K2EA 3CUQB 3R0JA 4N9HA 2FBKA 3P9IA 1LB2A 2VOOA 1FLIA 2FNAA 1TNSA 5D8KB 3R6SA 4Y15A 5J8FA 5BS6A 4A12A 3GFIA 2XVCA 1WQ2A 3V7SA 4IF4A 3L09A 5CJ9A 5FFXA 1O3QA 3P9CA 2RN7A 4QWQA 4D0PA 3LFKA 3KCCA 2IA0A 2CQKA 1BBYA 3IL2A 3TO9A 4ENJA 3SQNA 2W84A 4HLYA 4R8HA 5LLQA 3ISPA 1KGSA 1LVAA 1U5TA 1HKQA 2ZMEB 4AWXB 4EQQA 2DPUA 2H6CA 4MNUA 1KA8A 1D3YA 1YFHA 2DK8A 3E6DA 1O57A 3RDIA 3RPQA 3H3UA 1P92A 2LNBA 4WCGA 2Z3YA 5F6FA 1MJAA 3QPTA 1S29A 4RGXA 1ZG5A 2KJCA 3GWZA 3FM3A 2VC1A 1LEBA 1LDDA 1VTNC 3D5LA 1TBXA 2HEOA 2F5DA 1Z6TA 1CF7B 4HLXA 1ZRFA 4M9ZA 5KK1A 4PGHA 5HS9A 5E8GA 2BGCA 4LLLA 1SD5A 3RJPA 1B6AA 2GA1A 3RYRA 1IXCA 1XMAA 4OOIA 2ISZA 3KLOA 2OA4A 1FBUA 2ZNYA 3J81Z 4EVIA 4UVCA 1DPRA 2KIFA 5L3EA 2VXZA 3W6KB 2NS0A 2M5WA 3EDPA 3TDZC 2QVOA 4KMFA 4S05A 1SD7A 4XSXF 2GZWA 2FA5A 2NYXA 2DLLA 4MHGA 1YTYA 1ZRCA 5DDGA 1XCVA 4KIFA 1HKTA 2PG4A 3HYIA 1I1GA 4ON0A 1AOYA 2QQBA 4HF1A 1P6RA 4LB6B 4P96A 3F23A 2V1DA 4MQVA 1XMKA 4KIBA 3SFZA 2EFWA 4KICA 1FBSA 2OBPA 3J7AO 2HYFA 4CGZA 4I02A 3GFLA 2J5OA 3ZMTA 3T8RA 2DQRA 1ON1A 2FXAA 2ZMEA 3HHHA 1IN5A 4RB0A 2MA3A 3I59A 3DF8A 3ULQB 1T6SA 3O6BB 5FD5A 4U7BA 1T39A 1Z6RA 2QZ8A 4MTEA 2XAHA 2MH2A 5CLSA 4H0EA 1YIOA 1T2KA 2PMHA 1PP8F 2NRAC 1DPUA 3DQVC 1ZYRF 1ZLKA 2A3SA 5D8LB 2KIMA 5JR3A 1BI3A 2GAUA 1HXDA 1J5YA 5DD4A 4I98B 2A61A 4LD5A 2HS5A 4PZJA 3WGGA 1CF7A 2VE9A 2YR2A 3I0TA 5HLGA 1Q1HA 4YG2F 1V4RA 5ICCA 4NQWA 1IRFA 3O3KA 3RYPA 5IT9Z 4LGWA 2G7HA 5LEJA 3JSPA 1KQ0A 4YIIA 2M1BA 3Q9SA 3M9AA 1UB9A 2O3FA 3E5QA 3TO7A 2D1HA 5LHIA 1EH8A 4XSZF 3GZ5A 4CDGA 3F72A 4RB2C 1FX7A 3EYIA 2VT2A 2QENA 1MKMA 1O3RA 2PN6A 4P55A 2CFXA 5CVVA 1R22A 5AONA 2EJRA 2HWVA 4O3MA 4ESBA 4AIJA 3F8MA 2DK5A 2Q0OA 5E18F 1DP7P 2YX4A 1XSVA 2ZKZA 1J7KA 1FPQA 4L9VA 3HRTA 1IN4A 2IT0A 1K78A 3GUDA 2FQ3A 3IWZA 3SHFA 3HSEA 5E1ZB 2XKOA 4IVNA 2AXLA 4OMZA 1MDMA 1F9NA 3GFMA 4A2UA 2AS5F 1KYZA 3V7RA 4B09A 2MC3A 3H3ZA 5CVRA 2X4HA 5HLIA 3TGNA 3F8CA 1U78A 1QZYA 1UFMA 2MLKA 2VOPA 2F5FA 2P8TA 4HQMA 1WI9A 5IT3A 1UHMA 3COAC 1HSTA 4G7OF 3S2WA 1J0RA 2DU9A 3P7NA 4BYYA 2K86A 3HUGA 1B9NA 2P5KA 3ECHA 2Z33A 3ZN0A 3J81K 4BQAA 3VOEA 3HOSA 2R7FA 3GLXA 5DCMA 2IA2A 3GX4X 3K1PA 1K79A 3CDHA 3K9TA 2P7VB 3ZMVA 1G3WA 5D6EA 2FBHA 1MJBA 2P6TA 1R5GA 3K0LA 1IN6A 3WTTC 4HAMA 1P4XA 1TW3A 5CVJA 2NNYA 3LA2A 2NAZA 1FC3A 4BHCA 3K1NA 5H6QA 2G7UA 3EQLF 3N97A 3L9FA 4KNYA 2YU3A 4WX9A 2HQRA 4EV0A 4RGRA 4UV8A 2QLZA 3JAMZ 1ZRDA 3E6MA 4G6DA 5EEHA 5F64A 2OQGA 2LF8A 1I5ZA 3E5XA 2XUBA 3I54A 1OKRA 1P4WA 3WGHA 1O3SA 1TQPA 4FT8A 3M8FA 4G7ZF 2P5VA 2NNNA 1BIBA 1D8KA 2VBXA 1LQ1A 4CO8A 2D2WA 4RB1A 4I0AA 4G94A 3U1DA 1KU3A 2KRFA 4BXUA 1MJ9A 3KP3A 1F5TA 1K6OA 5LEKA 1XGSA 3WTXC 1SFUA 3GZ6A 4TV7A 3H92A 3R60A 1GXQA 3W6JB 3VB2A 2O0YA 3M8EA 4YIFA 1S8NA 1W4MA 2VBZA 1JHHA 2FF4A 3F6OA 2OZUA 2JRTA 1XCBA 5HOOA 1D8JA 3Q9VA 3BPXA 1LEAA 1XDUA 5FD6A 4GGGA 2YSRA 1FYMA 1KU9A 2IP2A 1IF1A
chains in the Genus database with same CATH superfamily
4HYEA 5K1YA 3AG4H 2DODA 2OU2A 3IRQA 5FRMA 2QQ8A 4JOMA 1D0YA 4XORA 4YELA 2Q8KA 4U0VA 1ONVA 3S1NJ 2WAQA 2VIXA 2YS9A 5FO5A 3S14J 1SFOJ 3MAJA 2V9KA 4OMYA 2R7ZJ 1RESA 3M1EA 5HNHA 1R36A 1I6XA 1ZAOA 3JRGA 1JKPC 2VC0A 4BJ5C 3HDDA 5E1WA 2HQ5A 3T1BA 2RQPA 4LG0B 3CO6C 3GMEA 5K5QA 4KFCA 2XIGA 2XF6A 1TTYA 3AL0B 1X1PA 3AG1H 5BQTA 2KZVA 5JLXA 4EEFG 4G7HF 2LY1A 2K9NA 1EKEA 2KDOA 3BY6A 3S3OA 3GLLA 3R0AA 2LP0A 3ML6A 2A5YB 2E5ZA 3MMYB 3Q5FA 4R79A 3SDGA 3DPLC 4YFKF 3I58A 5M3MJ 2M45A 3HRUA 3VSLA 2A68F 2BY1A 1BR4A 4OIPF 1T95A 2HYGD 4BNCA 2AO9A 1VQ4I 1N78A 2HKOA 3BT9A 5E3NA 3DFGA 3IHUA 3HC7A 3I4PA 2NVYJ 3RKWA 4BJTA 4HOBA 1GV2A 2RKHA 3OS0A 2PQ8A 2M7BA 2WB1N 4E6KG 3A2KA 3MWMA 3FZVA 2VI6A 3V8KA 2CWEA 3ASOH 2HXIA 1OYWA 4BGDA 2ZSHB 2KT0A 3RTRA 3LSMA 2K02A 3PFYA 2ZO4A 4BY1J 3CCUI 2EK5A 2XGXA 1HQCA 2OJED 1AWCA 2DA5A 1JUMA 1ZK8A 2JMWA 2VBWA 2B63J 3WE3A 4ESFA 2XV4S 1TWAJ 5FJ8J 1KYWA 1KU7A 3H0GJ 1JKQC 2Z16A 2HPMA 5ICFA 3OYMA 3QP5A 4L0YB 5CVIA 4ZYHA 3FXRA 4L5IA 3VSKA 3PNTA 2FSWA 3WTSC 4GCVA 1X4PA 2H8RA 2PMZA 3E6CC 1LPQA 3FXMA 3A02A 3CUQC 2E7WA 2E2IJ 4ASNA 1XGMA 1WI3A 2KL4A 5ILSA 1SVMA 5K5OA 1I1SA 1HSJA 2KJBA 4OU0A 3AG3H 3TOAA 3M3YJ 3LQQA 2EWNA 2HFHA 1IJWC 1MD0A 1G8XA 5E3LA 3QYEA 1WGXA 5EEGA 2IA1A 2IXSA 5BPDA 4M6VA 1Z21A 4LLNA 2O61A 2X6YA 2JA5J 5ICEA 2Z5UA 1Y0NA 2JSCA 5HVQC 1LFPA 1MGTA 3V8LA 2JPBA 2DBBA 2X48A 5H6RA 4BEHB 5D4SA 1X2MA 3L2WA 1FYKA 1I3AA 3WE2A 1T08B 1UHWA 1X2NA 5ICGA 4ZZLA 3CCSI 5JFRA 3I4MJ 1H0MA 2HDWA 2OAZA 2MGQA 1WSUA 3ZQ7A 5B5EC 3WTZA 2ACJA 1WZ2A 2E34A 4PSXA 3RPUD 2FQ4A 3JREA 3CP8A 2CW8A 2P6SA 1LE8B 4ETSA 1ITYA 3GTOJ 2X9DA 5F27A 2VPRA 3QU6A 3OYIA 1FYLA 1A31A 2JA6J 4UXNA 4JBAA 2COMA 3BQZA 1ZHFA 2J5PA 2XAFA 3ERED 3DBRB 1MBEA 2L4MA 4I99C 1FSEA 4KN4X 4M3EA 2MSYA 4MEYF 5JHFA 3U21A 2R5ZA 4Y13A 3A0BC 1ON2A 4N4NB 4PFPA 5HS8A 4EGZA 1HKSA 1YX3A 1EH6A 3JTGA 1JJ6C 4ZC3A 3NEUA 2RQQA 1LJ9A 4NNJA 1WWXA 3EETA 5AIQA 3TKYA 2LC2A 4C2TA 3OR2C 1AKHB 1FP2A 1XTAA 4Y3OA 4XRSG 2HOSA 2HDCA 4DBQA 1Z67A 4UVAA 5D4RA 4AVPA 4ZH4F 4FTHA 2ISYA 1S7AA 2E1MB 3CUQA 4XLNF 1RZ4A 2ECBA 2CUEA 1ETWA 1FTTA 2IRFG 2R4GA 1O7LA 2R3SA 4DNCA 2M8EA 2ELKA 2W85A 3F8BA 3ZR8X 3QP6A 2LDUA 1A36A 2VKHA 3S2HJ 4DIQA 4FASD 1R4NB 1Q1VA 1P4AA 1T38A 4J00A 2CW0F 3Q0WA 2E1NA 4QLCU 1R1UA 4BU2A 2E19A 3W2AA 4QIWN 4PSWA 1R5HA 1J75A 2HGCA 3I5UA 1TNTA 2GLOA 3K4BA 3DEEA 1X3ZB 1BOBA 3C7JA 5L3CA 3GXOA 3UNGC 3NWSA 3U2RA 3DTKA 3IP4B 3DV8A 3I53A 1P9QC 1S6LA 2JSPA 1OJLA 1ETQA 3CMYA 1IGNA 3IV5A 4J19A 3CP2A 2NVQJ 3E0JB 3CCEI 2VONA 2M3AA 4BDZA 5D5XB 2V26A 2ADUA 3FXQA 1RRJA 5JI6A 3OYLA 1WJDA 2FRHA 2ZB9A 5J6XA 2AQEA 4U88A 3K4JA 1TL8A 2L4AA 2CSOA 4EJVA 4M6YA 4XONA 2H94A 4XLAA 2KRCA 1BL0A 3C2BA 1SD4A 2CUFA 4DYQA 3T8TA 1V3FA 4ANJA 3HB9A 3LSTA 3BJ6A 3V7CA 3BR1A 3HOUJ 3E97A 3LAJA 2KQRA 1DU0A 4XICA 2YU9J 4RAYA 3K4MA 5C3EJ 2VUMJ 5IP6A 1JUSA 1XC5A 2EINH 2Y69H 2F6CA 4CICA 2FOWA 4BJ6C 1XB4A 2Y75A 2BEOA 2VPLA 4BBSJ 4S04A 2IS4A 4Y33A 2E1CA 4B3XA 5DS9A 3E7LA 2L01A 4Q5SF 4A3EJ 2PJPA 1D5VA 2XB5A 4XLFA 1QBJA 5D5WB 4X6AJ 2JUCA 4M73A 1V5EA 2RC4A 2F4OB 4RDUA 1W0UA 1R71A 2IBDA 2L9RA 2QBYB 2QSGX 3HOXJ 2CO5A 3ZN1A 2OCEA 1B59A 3TEDA 3WU1B 4HV5A 3U9GA 1T8IA 4MFDA 4EJTA 2DCEA 3A03A 5B3SH 2VKDA 3DCFA 3FK6A 5HDNA 3PSFA 4Y7NJ 1DGRM 3SZTA 3SZPA 2AQFA 2HQNA 2L3DA 4A6EA 2HI3A 5B1AH 5JHUA 1LE8A 1MMAA 3J80K 1USSA 2HTJA 3EYYA 2KHMA 3MFKA 4HQEA 1Y8QB 1H9GA 3S15J 3C1DA 4D7MA 2DTZA 2H1LA 2TRTA 3KEQA 1ZKGA 3Q0UA 4F3QA 2F5CA 1VZ0A 3MZYA 4A93J 3GEZA 4DGWB 1HDPA 2L02A 1EH7A 1FY7A 1SVOA 2CG4A 3HOTA 2RDPA 4MFEA 1X3WB 3IKVA 3FKJA 2EB7A 4XKWA 4O6JA 2BBYA 5ILVA 1J2XA 1FWZA 1AKHA 1ULYA 2DMPA 2G0EA 2FU4A 4NUBA 5M5YJ 1XN7A 2DT5A 2LY9A 5GADJ 5FLXZ 4ZYDA 3ZQGA 4KT6A 1YG2A 3FXUA 3QQAA 4ENKA 1W7PB 1TLHB 1FP1D 1KU2A 1MMNA 1I27A 2Z9OA 2XAJA 5CPRB 4IOCF 4H4KC 1UHSA 3HRSA 2H6BA 3CDIA 2VJ5A 4XLPF 3OYGA 4KJZA 4P1WA 1GDTA 2RV8A 1OCOH 4IHTA 4A5MA 3GO5A 1YYVA 4KITB 3ZQLA 1YS7A 1MBHA 1W1WE 3FWEA 1RIOH 4BHPA 4OINF 1Y1WJ 1BM9A 2OZ6A 5B66C 2W7NA 4DOZA 4RGSA 4G9YA 4HBLA 4L9NA 3BG5A 2KLOA 5LHHA 1REPC 1MIJA 2EBIA 5HLHA 5D6FA 2Y31A 2M34A 4MTDA 1X19A 2M7AA 2ZXHA 4WK8F 3KEYA 3F0CA 2FEZA 2KISA 3V8JA 5J47A 1GV5A 2X0LA 3BZCA 3CC2I 1WJEA 4OAZA 2DO7A 1HBXG 4M9XA 4WXHA 3KEOA 3BR2A 5HNFA 2M30A 4E7KA 1FOWA 2WTEA 3HM5A 3FMRA 1A35A 5E8IA 3FXLA 1QZEA 2DA2A 3BR3A 1YJWI 4N9IA 2Z99A 3S93A 4CCOA 5M5XJ 2DMQA 2N8GA 3ASNH 3R4KA 1Z9CA 3H36A 3LFUA 4IZZA 1MBGA 2HOEA 4QTRA 3DPTA 2Q2EB 4EM0B 2MW8A 1YS6A 3OYNA 3OR1C 1ZARA 2BXZA 1UMQA 2DFIA 2DJIA 2LTPA 3GF2A 3FHZA 1HF0A 2DOEA 2NVTJ 3S1QJ 3QOEA 2E7XA 2IW5A 4L5JA 5J40A 1TZLA 2K3PA 4XR6A 3ZMDA 1Y6IA 2IS2A 5IP7J 4IEJA 2BY2A 1NK3P 4KDPA 1J9IA 5F0CA 5KVRA 1ERDA 3G6EI 2WWYA 4JP0A 5TGTA 3LSRA 1R00A 4LK1F 2I10A 2VJJA 2DMUA 2PJRA 1QZZA 4B44A 3DBLB 3E6BA 3MCZA 2DQLA 1BI2A 2M4KA 3MN2A 4FQGA 2NS7A 1B8IA 4CCLA 3CC7I 1FBQA 5AIPA 3B02A 2DA7A 1MNEA 3IC7A 1DDNA 3DEWA 1Y0UA 4KA4A 3WTYC 1HC8A 1P7JA 3ECOA 4ZYEA 1BW5A 1MMDA 4ZDOA 1HW1A 3IH3A 4B47A 5IPAA 2Y9ZA 3S3MA 1GT0C 2Y2ZA 3JRIA 1SANA 3BROA 4F7ZA 4PDKA 2ZCWA 5J4YA 2F48A 3GTJJ 3REOA 4Q47A 4PGGA 2VL8A 2GIZA 4GYGA 1ZR4A 4HF2A 4L18B 1OPCA 4M6XA 3QYBA 2FMYA 2LK2A 1WPKA 2ZJ2A 4MEXF 1ETVA 2EV5A 2VN2A 3BJAA 3OOUA 3WG9A 2GXBA 3MKWB 1FSHA 2UXXA 5LGTA 4UUTA 3BOQA 3GZNB 1F36A 3K70D 1ACIA 1Z91A 3TP0A 1G3TA 1WFXA 2DAOA 4RLQA 3K69A 5J4VA 1W5SA 1W7PD 4HDUA 3BC8A 1T33A 2ZNZA 2VT3A 4AD9A 4Q4ZF 1Z0XA 3MEXA 5EGOA 4A0XA 3IAS2 1UELB 4IXAA 2HXOA 1BOAA 2BHZA 2HVRA 1OQYA 2ELHA 2K7LA 1G6NA 3HOWJ 1XD7A 2ETHA 3K2ZA 4U0WA 1Z77A 2EFOA 2DTRA 2VQLA 4BL0B 5GTHC 2LFBA 1ODDA 4XKBA 3M7GA 4E70A 2CRGA 2EA2A 5LGUA 3OYJA 2XGDA 3QRFF 2L54A 4ABZA 3PUFA 1ENHA 2EFNA 4FISA 4GYIA 4V2GA 1OR7C 4ENMA 1DUXC 2XC7A 3RKYA 4ENNA 2V79A 2UWMA 4U87A 1YJ9I 3P9KA 3LA7A 1OYIA 4FHTA 5KAIC 1X3UA 2GM4A 1TQMA 1FTZA 2P0WA 3ONQA 3O8HA 4HW0A 5F0FA 3VODA 2CQ7A 5IOYA 1U5TB 5TRDA 1PP7U 4IOAF 2BYVE 4WXCA 2Y30A 3VFZA 3KETA 4IHVA 1L3LA 5GAEJ 5DCFA 2WV0A 2LKPA 4ZZDA 3CJNA 4AC0A 1EA3A 1QU3A 1PYVA 2PI0A 1KONA 1R7JA 1RI7A 2EV6A 3OS1A 4HNTA 2NOJB 1HCRA 3ROUA 3OV8A 1Z05A 5K7ZA 2V6EA 1STZA 4RGUA 1U8BA 1SAXA 3O2PE 4CCKA 2E2HJ 1IRGA 1L0OC 2ZBKA 4UUSA 2H27A 2NS8A 3EUAA 2LVSA 1UCRA 4OIQF 4M71A 2HVSA 3ABUA 4DBRA 1YJNI 4CA0A 4L5EA 1FOYA 4QSHA 3OL3A 4B43A 1S72I 2DPDA 4F52A 3C3WA 4PJLA 2EZLA 2Y9YA 4AIDA 3ZPLA 5IT9K 4LFUA 3CQZJ 4O5VA 2QM3A 1UZCA 3QPLA 1YRNB 3BWGA 4ZDPA 3OYDA 1WHUA 1YLFA 3MZ8A 3ZRGA 1OCTC 4I7HA 3KP5A 3W3CA 3CO7C 1V5GA 1CGPA 4C30A 2M4GA 1ZN2A 3QAHA 4E7ZA 4UV9A 2M9HA 2PMUA 3PO2J 2VQHA 2ZXJA 4P9FA 3F22A 1G4DA 1JHFA 1FNNA 3BG3A 4II2A 4YEJA 5H2FC 4XLCA 2LLKA 2Y48A 4BY7J 1OR7A 2K27A 4ZDLA 4AIHA 5FLXK 1JTYA 1QQIA 1K4TA 2WAQN 4FX4A 2K40A 1WKMA 2WC2A 5BMZA 3F3XA 3B73A 3AFHA 4BXFA 2W57A 1MZBA 3H9QA 3MKYB 4XNFA 1FZPB 1TWHJ 1IC8A 4YFNF 4NC8A 1JKRC 2FNPA 4IQJA 1XDSA 2BY3A 2RVCA 1QPMA 1WJ5A 3QWLA 2EZIA 3OYBA 1VQ5I 2QWWA 3F8FA 3HEFA 4B48A 2R7UA 5TISC 3TOBA 4X1EA 3DLAA 3NRVA 4PJNA 1MMGA 2DFHA 2RNJA 1ZH5A 4GXOA 1XX5A 3A01A 3B6CA 4DZPA 1IV8A 4F93B 3GBGA 4E7HA 1JUPA 2FJ1A 2W24A 4XKCA 1A6IA 1N75A 4HNUA 2ESNA 3HIFA 3CJTB 4P5OA 1H8AC 1TQIA 2IS6A 3WHBA 4AU7A 1OFCX 2FE3A 5J8CA 2P4WA 2DA1A 5FB2A 1U8RA 1AHDP 1B1BA 2DXIA 4WXDA 3SYTA 2O03A 3CCYA 4Y17A 3ZQCA 4RB3C 3F6VA 2IGNA 3FF5A 1RUOA 4JX5A 4RBOA 1XGNA 3HSFA 2CGPA 3G3ZA 4XIDA 3JRCA 1R23A 4IRGA 1JKOC 4I01A 2MD5A 3WTWC 4C3HJ 1IAWA 3G73A 3AL0C 4A5NA 1BJAA 3BG6A 1IV6A 2A5WA 5DD8A 3ZP5A 5CYVA 3VDXA 3ABMH 3TQNA 1T98A 3K2AA 4EJWA 1YW9A 3TW6A 2JVGA 3LAPA 2JJ7A 1H88C 3DU5A 3FMQA 1Y56A 1HA8A 1JT6A 3GFJA 2V1XA 2MBFA 2BOLA 1MH3A 1B72B 2TDXA 1EJ9A 1SMYF 4IKFA 3B6AA 4PUSA 4ZTJA 4E7JA 3RCOA 3HSRA 3I59B 1SD6A 1D1CA 4IHSA 4W97A 3ZCOA 3BTIA 3AAFA 2R7DA 2EIKH 4KMUX 2PMZN 1MBFA 2QUFA 1VQMI 1VFCA 1SFEA 1A04A 1XGOA 4JQFA 1FT9A 2CJJA 3FBNB 3BTLA 4I76A 5EYRA 1ZR2A 4U0YA 4B8XA 2C6YA 3CLOA 1IRZA 3L2CA 4G6QA 3ZXSA 4BBRJ 1MNDA 4HDVA 3CMEI 2D45A 1OCPA 5FFZA 2KKOA 4UY8I 1YITI 5DM6F 1OCZH 2JZYA 3LMMA 3OWTA 3BJOA 1QHHD 2ZJQF 3T0YA 1V55H 4E7IA 2DI3A 3RPUA 1LFUP 2A6TA 3PM1A 4B3AA 3HOZJ 2HZTA 1GHCA 2QKLB 5IYCJ 1YRNA 2CYYA 1J09A 3TL4X 2MG4A 3LA3A 1RNLA 2DA3A 3BCBA 3RQIA 1GUUA 3LWFA 5M3FJ 3OOPA 3OSFA 2KZGA 3J7AY 4HX7A 2YPRA 2YX7A 4EATA 3IH4A 1RUNA 3MKZA 2O6GE 2VQGA 4LIVA 4A0YA 1EF4A 2DN0A 1X58A 1ZG3A 4ESJA 5JVTA 1IO2A 3MKLA 4LG0A 1MBKA 5LGNA 4XLEA 3H9JA 4V2FA 2ZFUA 1K4SA 1BJZA 5HDGA 3A1YA 1YW7A 1PJRA 1YW8A 4NQWB 1BC8C 2EV0A 4UNOA 2STTA 3V4GA 3GCMA 4CZZA 3JAMK 2V4JC 5H20A 2W82A 3IWFA 2CQXA 3DP7A 5EJCA 4IRHA 2E60A 2V9VA 2DA4A 2KDZA 3OYHA 1O7FA 2BHYA 2HKXA 4BXXJ 2F4IA 1KQ8A 2QGUA 2LBFB 1U6GA 1XSXA 3RI4A 2A05A 2P81A 1USTA 2ZJRF 4HNVA 3JSOA 4DJAA 3HGYA 4AUXA 4IL6C 4NC6A 5JVGF 3GW2A 2VXDA 2CV1A 2DJNA 2QYOA 5FLVA 1ZLJA 4JK1X 3SZGA 4Z6YA 4UHTA 2XF5A 4C2MJ 3CJRB 1ZG1A 1R1VA 1S9HA 1R6RA 4IPAA 3WG7H 2XSJC 3BP8A 1OYYA 3X2QH 5KHDA 5K5RA 2K9LA 3N4MA 1FOKA 1HOMA 2BVMA 2XAGA 5E17F 2QKMB 4AIKA 2LMDA 4HA8A 2H8WA 1MBJA 4DZJA 4ZYGA 3ELKA 3FXOA 2LOOA 1TT5B 2EIJH 1IN7A 2MABA 3BPVA 3TO6A 2R5YB 2HNHA 3HZJA 3U1KA 2JQ7A 3E3VA 4A6DA 2W25A 2I5UA 1BN5A 4EGYA 3L2VA 1I50J 3CTAA 2EILH 1S3JA 3KYLA 2ID3A 3C2GA 1JGSA 2GOXB 3DKWA 1B4AA 2V1NA 1K78B 4UB6C 1DGWY 5L3BA 4CUGA 4BDYA 5BPIA 1N77A 2ELJA 4NB5A 4R1HA 4A3BJ 4D9JA 3R61A 3NAUA 2XRLA 2Z2SB 3K1MA 2E1MC 5EZHA 2DYRH 4RMNA 1B72A 3GTLJ 2XF7A 1R1TA 2IVMA 4JYKA 4A3FJ 4HX8A 2GOMA 1MDMB 1JGGA 1QGPA 1NK2P 2H09A 2V1UA 2E36A 2EFPA 3JRDA 5E1XA 3IRRA 1BIAA 3BZKA 2IGOA 3ZMUA 3JRAA 2HQAA 1R9TJ 3GTGJ 1R58A 1E2XA 2VE8A 2HU9A 1MW7A 1SEUA 3ZQFA 2L2OA 2XKPA 2M87A 5LFAA 4A0ZA 1G3YA 1QPIA 4GO1A 3VEPA 3K4KA 4BEHA 3KE2A 2OUMA 1XMXA 5LBQA 5BOXA 3CZ6A 2A6EF 3HKZA 1JT0A 1W36D 4AM3A 2CFOA 5ED4A 3DPUA 3TDUC 2ZJPF 1IXSB 1Z7UA 4UVBA 1U3EM 2I8DA 4D7NA 3KP7A 5F04A 3FMSA 5DEQA 2PBIA 2DMNA 1WH5A 2IJLA 2K4BA 5LRSA 1LUJB 3S16J 1WRJA 2O8XA 1YOVB 1X1DA 1PUEE 4CYDA 4C3JJ 3DKXA 4Z2YA 2G9WA 3FHNA 1OCRH 4V19K 1YX5A 5DCMB 4XQFA 2LR8A 4MLOA 4BE2A 2XHKA 2KPMA 4HZFA 2DFEA 4XKVA 3FX3A 1IUYA 4LMYA 5KAFC 3BZ6A 3CCMI 2M0CA 4BS9A 3L7WA 3HOYJ 3ERMA 1KQ9A 2VBYA 2JTVA 1ZQ3P 4BHBA 4I2OA 1IXRC 5DV5A 1BC7C 6PAXA 4LITA 3IAM2 3BR5A 4IQ4A 3K6GA 5ERIA 2CQQA 2BZTA 4L9JA 3I9V2 3LOCA 3LNQA 2GBYA 3HOVJ 4LLGF 2DW4A 1NHAA 2VJIA 1K61A 3FM5A 3KZYA 3HGGA 4KYWA 2EFQA 2BV6A 1HW2A 2PLYA 1YQAA 1QVTA 1ZGAA 2F2EA 2Y0MA 2XASA 4XBFA 2MYSA 4CCJA 4Q48A 4EM2A 4EM1A 2FBIA 4LJZF 3SXYA 2WY7Q 5GTIC 5A2QZ 1HDDC 1IRXA 5GAGJ 2FMLA 1U2WA 2DT6A 2HR3A 1OLTA 5L3FA 1IZ1A 1BI0A 3S32A 2COBA 2L7FP 3SFIA 3BR6A 3DTEA 3FK7A 1F1ZA 2AXTC 3DEUA 4G6TB 5CQGA 5LRRA 1MSFC 3JRHA 2XGEA 2LY2A 2MLGA 3C18A 3RKXA 1I39A 3CLQA 4RM3A 3PO3J 1BA5A 2GIVA 2AHQA 2GXGA 4L9TA 4II3A 2A69F 4AVZA 5FGMA 4I6ZA 2QQAA 3FISA 4D1QA 4Y52J 5CVUA 1NTCA 2F5EA 3H0DA 1E17A 4BE1A 2NXNB 3S1MJ 1Z1DA 1ZGJA 3SJMA 3CUOA 3GVAA 3CC4I 1LVKA 4B1RA 1RPWA 1J59A 3I56I 2ME6A 1H9TA 1P2FA 3D1NI 4M74A 1E3OC 1Z7LA 2X85A 4A3GJ 2Q1ZB 3NQOA 2UXNA 4N0BA 3W6VA 4WWCA 2K85A 3H5NA 5F1RA 2CU7A 4M72A 1PDNC 2KRHA 3L1PA 2H1KA 4EJUA 1T0FC 3KZZA 5C4XJ 4LIUA 5GPAA 3HTSB 1WVRA 3C2HA 5DUKA 2W00A 2WAFA 3T5XA 1QRYA 1G2HA 1ETKA 2LYCA 3IKTA 2PFBA 3KFWX 2FOKA 2LF7A 3E1SA 2GQQA 3OIPA 2EA4A 1BI1A 2EIMH 3BQYA 3PQJA 3HTUA 2XRNA 2V6CA 3VYSB 1DQUA 2E35A 4XK4A 2QQ9A 5DYMA 3S17J 3QOPA 4FX0A 1LDKB 2JT1A 4UUVA 2K9QA 4XM3A 3WTUC 2QBYA 2L9VA 4G8XA 2R7VA 2L0KA 2STWA 1VQOI 3HPHA 4CHUA 1DU6A 1E0EA 2JPCA 4DQ2A 1IN8A 1GVJA 4A3IJ 4W1UA 3BR0A 1UG0A 1C0WA 3ABTA 4M3DA 2XAQA 2RAEA 9ANTA 3F8NA 3UKGA 1XG1A 2PEXA 5HS7A 3HXLA 3D0SA 2ZFWA 3NWTA 3WTVC 2LSOA 3K7AJ 2VODA 4OIOF 3KP2A 1QO0D 1FIAA 2OTJI 3V42A 2FD5A 1XSDA 3PNYA 5D5UB 1ZREA 3OYFA 4F55A 1O4XA 4IHWA 2DDAA 2MH9A 5FKOA 2GA2A 4RAZA 4KIGA 5L3GA 3CMAI 4I09A 4HF0A 3E5UA 3IH2A 3LSJA 2ESHA 4XN0A 3F21A 4M9SA 2OC6A 1F4KA 4L0ZB 1TT0A 3L2RA 2XPUA 5L3DA 3LQRA 2L9SA 1GXPA 1LDJA 3WODF 3ESWB 2JA2A 3H3VK 1UAAA 3WGIA 5TJJA 2A07F 4CZCA 2Z1DA 2HTSA 1T0FA 5HLTA 1W7PA 4PCQA 3PQKA 1EV7A 2OQRA 3MQ0A 2GWRA 3G1LA 3JW4A 4RAFA 4FE4A 2V9PA 1WCMJ 4HG2A 2WAEA 3GYHX 1SMTA 4DYRA 3PJRA 1ZELA 5FKKA 1IG7A 1TW2A 1OMIA 3ZMSA 1MNMC 2XPVA 3DXJF 1BR2A 3UR3C 4KUMA 4MQ9F 2K4JA 2CH0A 4QPOA 2X1CA 2D1VA 1U9OA 1SVLA 2IPQX 3RIRA 1BW6A 3G1OA 4A69C 3HRMA 2E1OA 4ZTFA 4HSTA 1R49A 4XOTA 3N05A 2E2JJ 4HX4A 4UB8C 2KIQA 3DTIA 5K7HA 5E20A 1HW5A 4M3BA 4KT5C 2O7OA 2WA0A 4NHJA 1WH7A 3TW7A 2CQNA 1A5JA 3ZMZA 3RQ4A 3KPHA 4XRFA 3DWLE 3H35A 2ICWG 1CQTA 1RETA 2X6WA 3OYKA 3CCQI 1VQ8I 4RS8A 1W0TA 1JE8A 5IY5H 1Z3YA 1IW7F 5LHGA 4MO7A 1O3TA 3K4NA 5ILUA 2QEXI 4FCYA 2RGVA 5LD2C 1D1AA 3G1MA 3A0HC 1Y1VJ 1ETXA 2JA8J 2EQRA 2Q2EA 4GFBA 2MFZA 3G2BA 4BH9A 4LB5A 5GAHJ 5J1RA 2KMUA 1W5TA 3JRFA 3I3LA 2P7CB 2DMTA 2IAIA 2CW7A 5E3MA 1JTXA 2V7FA 2R7XA 4EMSA 3OIOA 2OD5A 1JXSA 4YFXF 1M1EB 2HOAA 2B0LA 1MMSA 5HDKA 4ZYAA 3QPHA 1D5YA 1G3SA 4BAYA 1LKXA 1JJ8C 4CH7A 5DUIA 4U7DA 2A6HF 1SFXA 3KLNA 4EJOA 5FKNA 1VQKI 2P5LC 3I4NJ 2LKSA 1Y39A 3GTMJ 2R7TA 1S7OA 2UZKA 3RKQA 1K7AA 3M1CA 4OIRF 3LSHA 4CXFA 1X1AA 2NOGA 3KP6A 2LD5A 3JTHA 3QU3A 4MGRA 1MSEC 3EUKL 3I71A 1U5TC 3BDDA 3WHCA 3VWBA 2JRMA 2K9MA 1LNWA 1B9MA 2XROA 3CCVI 3BG7A 1QNTA 3MZHA 4E4HA 4KISA 4HV6A 3GTQJ 4BQQA 3HHGA 3VPRA 2LREA 3EUHA 3HPGA 3S8PA 1JI8A 1TP4A 2BE5F 4XMYA 4IRIA 2ME0A 3VYRB 2R5ZB 5D5VB 2X6XA 3PFIA 4KN7X 1YO5C 4P9UA 2X51A 3KP4A 4LK0F 3DKYA 1FMWA 5A2QK 4WF2A 2KIUA 4IJAA 3WU0A 3J80Z 3L00A 4I0BA 1U0JA 2CUZA 4F91B 4HRIA 3I64A 4K2EA 3CUQB 2WB1A 5EEAA 3R0JA 4N9HA 2FBKA 3P9IA 1LB2A 2VOOA 1FLIA 2L9NA 2FNAA 1TNSA 1VQ7I 1IUFA 5D8KB 3R6SA 2WBMA 3NARA 4Y15A 5J8FA 5BS6A 3FBIB 4A12A 2R7QA 3GFIA 4HEA2 2XVCA 2VASA 1WQ2A 3CDLA 3V7SA 2JN6A 4IF4A 3L2UA 5J3LA 3L09A 5CJ9A 1T56A 3AG2H 4GDFA 4J01A 5FFXA 4IO9F 1D1BA 1O3QA 3P9CA 2RN7A 2UV1A 4X0GA 1VI0A 4QWQA 5C4JJ 4D0PA 3LFKA 5EZGA 3KCCA 3KX2A 2IA0A 2CQKA 1BBYA 3BLYA 1YE9A 2OCCH 3IL2A 3TO9A 3LSGA 3L2QA 4ENJA 3M07A 1RR7A 3SQNA 1IDZA 2W84A 4HLYA 4XOPA 5BNGA 1QVUA 4R8HA 4NBQA 5LLQA 2L7ZA 2JUGA 3ISPA 1KGSA 1LVAA 1U5TA 1HKQA 2O8KA 2ZMEB 4AWXB 4BE0A 2CMPA 3CESA 3WU2C 4EQQA 2DPUA 2ZSIB 3KIOA 2H6CA 3M8JA 4MNUA 3LSPA 1KA8A 1D3YA 1YFHA 2DK8A 3E6DA 3CCRI 1RC9A 5IP9J 4FE7A 1ZTRA 1O57A 4BKXA 4NDLA 5JLWA 3RDIA 1W5CC 1QHGA 3RPQA 3H3UA 4C2UA 1P92A 2LNBA 4WCGA 2Z3YA 2R92J 1QA6A 5F6FA 1MJAA 3QPTA 2CV0A 3CMMA 1S29A 2M2EA 4RGXA 1ZG5A 2KJCA 1RKTA 3GWZA 3FM3A 4PJMA 5KNLA 5FROA 3SEZA 2VC1A 4DW6A 1LEBA 1LDDA 1VTNC 3D5LA 4JX6A 4XN3A 3ABLH 3S3NA 1RKWA 2X1DA 1TBXA 3BCAA 2HEOA 1YI2I 2F5DA 3F9KA 1Z6TA 2DFFA 1CF7B 4HLXA 1ZRFA 2M0MA 4M9ZA 2GXAA 5B1BH 2K5CA 3LL7A 4F92B 1ETYA 4PGHA 5KK1A 4CYCB 3OMYA 5HS9A 5E8GA 2BGCA 4IHXA 1WJFA 2L7MP 1SD5A 4LLLA 2ZXIA 3RJPA 1B6AA 4YRVA 4A3MJ 4NC7A 2GA1A 2ZMEC 1IXCA 3RYRA 1XMAA 3KYDB 4OOIA 2L5QA 2F4MB 2NVUB 2ISZA 3GTPJ 1LFBA 2YUSA 3KLOA 2OA4A 1FBUA 2ZNYA 4ZJZA 3J81Z 4EVIA 1X1BA 4UVCA 1DPRA 2KIFA 5L3EA 2VXZA 3W6KB 2NS0A 2F5VA 2M5WA 3EDPA 3TDZC 3ZQHA 5M5WJ 2QVOA 1FEXA 4KMFA 4BQNA 2HDDA 2UUZA 1SD7A 4S05A 1W36C 4XSXF 2JA7J 2GZWA 2FA5A 2PX9A 2NYXA 2DLLA 2D5VA 4MHGA 4LG3A 1E3HA 3HBLA 1YTYA 2E71A 1ZRCA 2R93J 2IGMA 5DDGA 2EH3A 2VKVA 3H9GA 3O8GA 1XCVA 3SDBA 5J1UA 4KIFA 4RLFA 3TMOA 1X1CA 4N4OB 2DOAA 1HKTA 2PG4A 3HYIA 1I1GA 2O9LA 4ON0A 2OTLI 4LOCA 1AOYA 2QQBA 4GRIA 4HF1A 3OYCA 5K7FA 1P6RA 2VLAA 4LB6B 4P96A 3F23A 3K4CA 4FETA 2V1DA 4MQVA 4PJJA 2OPTA 1XMKA 4KIBA 1NG7A 5J1YA 3SFZA 2EFWA 2DDBA 4KICA 1FBSA 2OBPA 3J7AO 2HYFA 4CGZA 1Y8RB 2OV7A 4I02A 3GFLA 2J5OA 3ZMTA 3GTKJ 3T8RA 2DQRA 1ON1A 4OAYA 2FXAA 2ZMEA 3A4CA 3H5AA 3HHHA 1IN5A 5DTDA 4RB0A 2MA3A 2KFDA 3I59A 3Q0VA 1OCCH 2L7KA 1N25A 3HL2A 3DF8A 2IGKA 3ULQB 2BXYA 2ECCA 3KYCB 1T6SA 3O6BB 5FD5A 2Y0SA 1TWCJ 1GVDA 4U7BA 5CQEA 1FIPA 3G71I 2IEKA 3BTJA 1NG6A 2FX0A 4CSWA 1T39A 1KZHA 3OYAA 3JCUC 1Z6RA 2QZ8A 4MTEA 5HODA 2XAHA 2MH2A 5CLSA 4H0EA 1YIOA 1T2KA 2PMHA 4A3KJ 1PP8F 3H5RA 3HG9A 4XL9A 2NRAC 1RR8C 1X4OA 3PUBA 3FXJA 2CS3A 3CCJI 1DPUA 2RNGA 2Y0SN 3DQVC 1ZYRF 3PNVA 2A3SA 3ABKH 3FIWA 5D8LB 4DYCA 2KIMA 3HUGB 5JR3A 1ZLKA 5GP9A 3J7YJ 1BI3A 2GAUA 1HXDA 1I3QJ 1J5YA 1VQ9I 5DD4A 2QSFX 4I98B 3W2WA 3ZQIA 2PJRB 2A61A 2LH9A 3HKZN 1MH4A 4RM2A 4LD5A 2HS5A 2K9SA 4PZJA 2EZHA 3CF5F 3WGGA 1CF7A 5F08A 2VQCA 1WJAA 2VE9A 5IOZA 1B8IB 1R4MB 2YR2A 3TP3A 1VQLI 3I0TA 4CYCA 5HLGA 3OYEA 1Q1HA 1WJBA 4YG2F 1AU7A 3OIQA 1V4RA 5ICCA 4NQWA 1TC3C 1IRFA 1VNDA 1K6YA 3O3KA 3OS2A 3CD6I 2JVHA 3RYPA 5IT9Z 4LGWA 2G7HA 5LEJA 3DLLF 3RSNA 4A3DJ 3JSPA 1KQ0A 4YIIA 2TCTA 3FXKA 2M1BA 3TBIA 4IHYA 2W4SA 3Q9SA 3M9AA 2EZKA 2MD0A 4Y4RA 3RZDJ 3D5RC 1UB9A 2O3FA 2QF7A 1UG2A 3E5QA 2LBFA 1F43A 3TO7A 2D1HA 5LHIA 1SC7A 1EH8A 4XSZF 1OISA 3GZ5A 4CDGA 3F72A 1FJLA 1VQNI 2E5NA 4RB2C 1FX7A 1PUFB 3EYIA 5GPCA 2VT2A 3W2VA 2QENA 1TWFJ 5F0HA 1MKMA 2HPIA 3KZIC 1O3RA 2PN6A 3OSGA 4P55A 5DM7F 2CFXA 5CVVA 1R22A 2FUG2 2LRDA 5AONA 5FRNA 3QYFA 3QODA 4D5CA 2EJRA 2HWVA 4O3MA 4ESBA 4AIJA 2ZC2A 3F8MA 5EGOB 5EF6A 3JRBA 2DT7B 3JR9A 2R5YA 2DK5A 2Q0OA 5E18F 4XRSA 1DP7P 2YX4A 1XSVA 3Q3SA 3D5SC 2ZKZA 5C44J 2NVXJ 1J7KA 1FPQA 4RA2A 2HOTA 4L9VA 3HRTA 1IN4A 5EG0B 3S2DJ 2IT0A 1K78A 3RZOJ 4QPQA 2OF7A 4XLHA 2QCOA 3GUDA 4G12A 4M3GA 3ZOBA 2K3FA 2QA4I 2FQ3A 3IWZA 1G59A 3SHFA 3HSEA 3CCLI 3K70C 3FKIJ 2VB6A 5E1ZB 2XKOA 3CJQB 4IVNA 3OY9A 2AXLA 2LKXA 4OMZA 4S0HB 5E3OA 1SAUA 1AA7A 3CF2A 2BVLA 1H89C 1MDMA 2O5RA 2EPFA 4PFOA 4C3IJ 4OWRB 1APLC 1BR1A 1F9NA 3EPZA 2BW3B 3FDYA 3GFMA 4A2UA 5IYDJ 2AS5F 1KYZA 2DOFA 1NH3A 2KP6A 3V7RA 4B09A 3PIOF 2R7SA 1FOXA 2CUJA 1GLNA 2MC3A 2QSHX 3H3ZA 5CVRA 3SEQA 2X4HA 2CV2A 5HLIA 3TGNA 3F8CA 2LG4A 4UUSB 3BTCA 1U78A 1QZYA 1UFMA 2MLKA 2HYJA 2VOPA 2F5FA 2P8TA 4HQMA 1S7EA 1WI9A 3MD2A 1I6HJ 2WV1A 4A3LJ 5FKMA 5IT3A 1UHMA 3H1CA 1WJCA 3K10A 5FLMJ 3COAC 1HSTA 3PSIA 2B7EA 4G7OF 3S2WA 1J0RA 2DU9A 3P7NA 4BYYA 4PJ0C 2K86A 3HUGA 1B9NA 1VF9A 5E79C 2P5KA 1ZGWA 3ECHA 3P5JA 3MVPA 4D5FA 4HPQA 1P7IA 3HJEA 1UJ8A 3ZN0A 2Z33A 3J81K 2W1OA 4BQAA 3VOEA 5FKLA 1Z3XA 3HOSA 1IDYA 3VYTB 2R7FA 3G4SI 3GLXA 5DCMA 2IA2A 1U9NA 3M4OJ 1A6QA 4E7SA 3GX4X 2ID6A 3K1PA 1K79A 3CDHA 2WY8Q 3K9TA 2P7VB 3K4LA 4A3JJ 3ZMVA 2X1EA 1G3WA 5D6EA 2FBHA 1R5ID 2WADA 4E7LA 1MJBA 2P6TA 1R5GA 1SFKA 5F1JA 3J7ZI 2VKEA 3K0LA 3ZGKA 1IN6A 1ORKA 3WTTC 3S1RJ 2X6OA 2HZDA 4HAMA 3IUOA 4JX4A 1P4XA 1TW3A 5CVJA 2NNYA 3LA2A 2NAZA 1FC3A 2JK3A 4BHCA 3I55I 3PL8A 1D0XA 3K1NA 5H6QA 4IX7A 2G7UA 2RREA 3EQLF 1V5FA 3N97A 3L9FA 4KNYA 2YU3A 2XSDC 2IS1A 2XDVA 4WX9A 2HQRA 3PIPF 4EV0A 1E3PA 4C9YA 1FMVA 4RGRA 1POGA 4CCNA 1PUFA 2XGCA 4UV8A 1TWGJ 3A01B 2QLZA 3DU6A 3JAMZ 4RAGA 4M3FA 1ZRDA 3E6MA 1XPXA 1PVEA 4G6DA 1D0ZA 5EEHA 5F64A 2OQGA 2LF8A 2ZXWH 4MIMA 1I5ZA 2BY0A 3E5XA 2XUBA 3I54A 1OKRA 1P4WA 2XB0X 3WGHA 1O3SA 4CCMA 4AYBA 1TQPA 4FT8A 4BACA 3M8FA 2DA6A 4G7ZF 2P5VA 2NNNA 5EG0A 3AKZA 1BIBA 3EUHC 1ETOA 1D8KA 2VBXA 1XS9A 2VJ4A 4HSRA 1LQ1A 2M8GX 4CO8A 2HVQA 2D2WA 4RB1A 4I0AA 2R7OA 4G94A 3U1DA 1KU3A 3VYUB 2KRFA 3DBHB 1VQPI 5CKTA 3BG9A 4BXUA 1MJ9A 2R7WA 4BUPA 4B4CA 2XPWA 5EDNA 4AYBN 3KP3A 1HLVA 1F5TA 3OL4A 1K6OA 4PK4A 4ITVA 5LEKA 1YIJI 2DYSH 1XGSA 3WTXC 1SFUA 4YIRX 2BW3A 4TV7A 3GZ6A 3H92A 2W48A 4XRMA 4BQOA 2B9SA 3R60A 1V54H 4A3CJ 3QPSA 1GXQA 3W6JB 3VB2A 2O0YA 3M8EA 5KCMA 3LSIA 2JWTA 1VQ6I 4YIFA 1S8NA 1W4MA 2VBZA 1JHHA 2FF4A 3F6OA 2OZUA 3LSKA 2JRTA 1XCBA 5HOOA 1D8JA 3Q9VA 3BPXA 1K83J 1S5LC 1LEAA 3ZQQA 1XDUA 5FD6A 4GGGA 2XAUA 2YSRA 1DP3A 1FYMA 1KU9A 2IP2A 1IF1A 2MC4A 2R7RA 1YHQI 2R0QC 5IYBJ
chains in the Genus database with same CATH topology
4HYEA 5K1YA 2OU2A 3IRQA 2Q8KA 4U0VA 1ONVA 5FO5A 3MAJA 4OMYA 3M1EA 1R36A 1I6XA 1ZAOA 2VC0A 5E1WA 3T1BA 2RQPA 4LG0B 3CO6C 5K5QA 4KFCA 2XIGA 1TTYA 5BQTA 4G7HF 3BY6A 3R0AA 3ML6A 2A5YB 3Q5FA 4R79A 3DPLC 4YFKF 3I58A 2M45A 3HRUA 2A68F 4OIPF 2HYGD 4BNCA 2HKOA 3DFGA 3IHUA 3I4PA 3RKWA 4HOBA 2RKHA 2PQ8A 3MWMA 3FZVA 3V8KA 2CWEA 1OYWA 3RTRA 2K02A 2ZO4A 2EK5A 2XGXA 1HQCA 1AWCA 2VBWA 3WE3A 4ESFA 2XV4S 1KYWA 1KU7A 5ICFA 3QP5A 4L0YB 5CVIA 4ZYHA 3FXRA 4L5IA 2FSWA 3WTSC 4GCVA 3E6CC 3CUQC 2E7WA 4ASNA 1XGMA 5ILSA 5K5OA 1I1SA 1HSJA 2KJBA 4OU0A 3TOAA 3LQQA 2EWNA 2HFHA 1MD0A 5EEGA 2IA1A 5BPDA 4LLNA 2O61A 5ICEA 2Z5UA 2JSCA 5HVQC 1MGTA 3V8LA 2JPBA 2DBBA 5H6RA 5D4SA 1FYKA 3WE2A 1UHWA 5ICGA 4ZZLA 5JFRA 1H0MA 2OAZA 1WSUA 3ZQ7A 3WTZA 2ACJA 2P6SA 4ETSA 3QU6A 1FYLA 4UXNA 4JBAA 2COMA 1ZHFA 3ERED 2J5PA 2XAFA 2L4MA 1FSEA 4KN4X 4MEYF 4Y13A 1ON2A 5HS8A 4EGZA 1HKSA 1EH6A 3JTGA 3NEUA 1LJ9A 1WWXA 3EETA 5AIQA 3TKYA 1FP2A 2HDCA 4UVAA 5D4RA 4AVPA 4ZH4F 2ISYA 1S7AA 3CUQA 4XLNF 1RZ4A 2IRFG 1O7LA 2R3SA 4DNCA 2M8EA 2W85A 3F8BA 3QP6A 2LDUA 1P4AA 1T38A 2CW0F 2E1NA 4QLCU 1R1UA 1R5HA 1J75A 2HGCA 3I5UA 1TNTA 3C7JA 5L3CA 3GXOA 3U2RA 3DV8A 3I53A 1S6LA 2VONA 5D5XB 2ADUA 3FXQA 5JI6A 2FRHA 5J6XA 4U88A 2L4AA 2CSOA 4EJVA 4M6YA 2H94A 1SD4A 3T8TA 1V3FA 3LSTA 3BJ6A 3V7CA 3E97A 3LAJA 4RAYA 4CICA 1XB4A 2Y75A 2BEOA 4S04A 2E1CA 2L01A 4Q5SF 2PJPA 1D5VA 1QBJA 5D5WB 4M73A 2RC4A 2QBYB 2CO5A 3ZN1A 1B59A 3WU1B 4HV5A 3U9GA 4EJTA 5HDNA 3SZTA 3SZPA 2HQNA 2L3DA 4A6EA 5JHUA 3J80K 1USSA 2HTJA 3EYYA 3MFKA 4HQEA 1H9GA 3C1DA 3KEQA 2F5CA 3MZYA 3GEZA 2L02A 1EH7A 1FY7A 2CG4A 3HOTA 2RDPA 3IKVA 2EB7A 4O6JA 2BBYA 5ILVA 1J2XA 1FWZA 1ULYA 2FU4A 1XN7A 2DT5A 5FLXZ 4ZYDA 1YG2A 3FXUA 4ENKA 1W7PB 1TLHB 1FP1D 1KU2A 1I27A 2Z9OA 2XAJA 3HRSA 2H6BA 4XLPF 2RV8A 4IHTA 4A5MA 3GO5A 1YYVA 1YS7A 1RIOH 3FWEA 4BHPA 4OINF 1BM9A 2OZ6A 4RGSA 4G9YA 4HBLA 4L9NA 5LHHA 1REPC 5HLHA 5D6FA 4MTDA 4WK8F 2FEZA 3V8JA 2X0LA 2DO7A 1HBXG 4M9XA 4WXHA 3KEOA 2M30A 2WTEA 3FMRA 5E8IA 4N9IA 2Z99A 3R4KA 1Z9CA 2HOEA 3DPTA 4EM0B 1YS6A 1ZARA 3GF2A 2DFIA 3FHZA 2E7XA 2IW5A 4L5JA 3ZMDA 4KDPA 1J9IA 5KVRA 2WWYA 1R00A 4LK1F 1QZZA 3E6BA 3MCZA 2DQLA 1BI2A 1FBQA 5AIPA 3B02A 1DDNA 3IC7A 1Y0UA 4KA4A 3WTYC 3ECOA 4ZYEA 1HW1A 3BROA 4F7ZA 4PDKA 2ZCWA 3REOA 4Q47A 4PGGA 4GYGA 4HF2A 4L18B 1OPCA 4M6XA 2FMYA 2ZJ2A 4MEXF 2EV5A 2VN2A 3BJAA 3WG9A 2GXBA 1FSHA 2UXXA 5LGTA 3BOQA 1Z91A 1G3TA 2DAOA 3K69A 1W5SA 1W7PD 4HDUA 2ZNZA 2VT3A 4AD9A 4Q4ZF 3MEXA 4A0XA 4IXAA 1BOAA 2ELHA 2K7LA 1G6NA 1XD7A 2ETHA 3K2ZA 4U0WA 2EFOA 2DTRA 1ODDA 3M7GA 4E70A 2EA2A 5LGUA 3QRFF 2L54A 2EFNA 4GYIA 4ENMA 1DUXC 3RKYA 4ENNA 2V79A 2UWMA 3P9KA 3LA7A 1OYIA 4FHTA 1X3UA 1TQMA 4HW0A 3VODA 1U5TB 5TRDA 1PP7U 2BYVE 4WXCA 3VFZA 3KETA 1L3LA 5DCFA 2WV0A 2LKPA 4ZZDA 3CJNA 2PI0A 1R7JA 1RI7A 2EV6A 3ROUA 3OV8A 1Z05A 1STZA 4RGUA 1SAXA 3O2PE 1IRGA 1L0OC 2ZBKA 2H27A 1UCRA 4OIQF 4M71A 3ABUA 2DPDA 3C3WA 3ZPLA 5IT9K 4LFUA 4O5VA 2QM3A 3BWGA 1YLFA 4I7HA 3KP5A 3CO7C 1CGPA 1ZN2A 3QAHA 4UV9A 2PMUA 2ZXJA 4P9FA 3F22A 1G4DA 1JHFA 1FNNA 2Y48A 1OR7A 2K27A 4AIHA 5FLXK 1QQIA 4FX4A 1WKMA 2WC2A 5BMZA 3F3XA 3B73A 2W57A 1MZBA 1FZPB 4YFNF 2FNPA 1XDSA 2RVCA 1QPMA 2QWWA 3F8FA 3TOBA 3NRVA 2RNJA 1ZH5A 4GXOA 2W24A 2ESNA 3HIFA 4P5OA 1TQIA 2FE3A 5J8CA 2P4WA 5FB2A 1U8RA 1B1BA 4WXDA 2O03A 4Y17A 4RB3C 3F6VA 3FF5A 1RUOA 1XGNA 3HSFA 2CGPA 3G3ZA 1R23A 4IRGA 4I01A 2MD5A 3WTWC 1IAWA 3G73A 4A5NA 1BJAA 5DD8A 3ZP5A 5CYVA 3TQNA 1T98A 4EJWA 1YW9A 3LAPA 3FMQA 3GFJA 2V1XA 2MBFA 2TDXA 1SMYF 3HSRA 3I59B 1SD6A 4IHSA 3AAFA 2R7DA 4KMUX 2QUFA 1SFEA 1A04A 1XGOA 4JQFA 1FT9A 4U0YA 4B8XA 2C6YA 3CLOA 3L2CA 4G6QA 4HDVA 2D45A 5FFZA 2KKOA 2JZYA 3BJOA 3T0YA 2DI3A 3RPUA 2HZTA 1GHCA 2CYYA 3LA3A 1RNLA 3LWFA 3OOPA 4HX7A 2YPRA 2YX7A 1RUNA 2O6GE 4A0YA 1ZG3A 4ESJA 5JVTA 4LG0A 5LGNA 5HDGA 1YW7A 1YW8A 1BC8C 2EV0A 4UNOA 2STTA 3V4GA 4CZZA 3JAMK 5H20A 3IWFA 3DP7A 4IRHA 2V9VA 1O7FA 2HKXA 1KQ8A 1U6GA 1XSXA 3RI4A 1USTA 3JSOA 3GW2A 2QYOA 1ZLJA 4JK1X 4UHTA 1ZG1A 1R1VA 4IPAA 3BP8A 1OYYA 5K5RA 3N4MA 1FOKA 2XAGA 5E17F 4AIKA 4HA8A 4ZYGA 3ELKA 3BPVA 1IN7A 3TO6A 3E3VA 4A6DA 2W25A 1BN5A 4EGYA 3CTAA 1S3JA 1JGSA 3DKWA 1B4AA 1K78B 5L3BA 5BPIA 4NB5A 4R1HA 3R61A 3K1MA 1R1TA 2IVMA 1MDMB 4HX8A 1QGPA 2H09A 2V1UA 2EFPA 5E1XA 3IRRA 1BIAA 3ZMUA 1R58A 1E2XA 2VE8A 2XKPA 2M87A 4A0ZA 1G3YA 4GO1A 3VEPA 3KE2A 5LBQA 5BOXA 2A6EF 5ED4A 3TDUC 1IXSB 1Z7UA 4UVBA 1U3EM 3KP7A 3FMSA 5DEQA 2PBIA 2IJLA 2K4BA 5LRSA 1WRJA 2O8XA 1PUEE 4CYDA 4Z2YA 2G9WA 5DCMB 2XHKA 4HZFA 3FX3A 1IUYA 4LMYA 3BZ6A 3L7WA 1KQ9A 2VBYA 2JTVA 4I2OA 4BHBA 6PAXA 1IXRC 5DV5A 1BC7C 5ERIA 4L9JA 4LLGF 2DW4A 1NHAA 3FM5A 3KZYA 4KYWA 2EFQA 2BV6A 1HW2A 2PLYA 1YQAA 2F2EA 1ZGAA 2Y0MA 2XASA 4XBFA 4EM1A 4Q48A 4EM2A 2FBIA 4LJZF 3SXYA 5A2QZ 2FMLA 1U2WA 2HR3A 5L3FA 1IZ1A 1BI0A 5LRRA 1F1ZA 3DEUA 3C18A 2MLGA 3RKXA 2GIVA 2GXGA 4L9TA 2A69F 5FGMA 2QQAA 5CVUA 2F5EA 1E17A 1Z1DA 1ZGJA 3CUOA 3GVAA 1J59A 1H9TA 1P2FA 4M74A 3NQOA 2UXNA 4N0BA 4WWCA 5F1RA 4M72A 1PDNC 4EJUA 3KZZA 3HTSB 5DUKA 3T5XA 3IKTA 2PFBA 3KFWX 2FOKA 2LF7A 2GQQA 2EA4A 1BI1A 3PQJA 3HTUA 2XRNA 2V6CA 2QQ9A 5DYMA 3QOPA 4FX0A 1LDKB 2JT1A 4UUVA 2QBYA 3WTUC 4G8XA 2STWA 4CHUA 2JPCA 4DQ2A 1IN8A 1GVJA 1C0WA 3ABTA 2XAQA 3F8NA 2PEXA 5HS7A 3D0SA 2ZFWA 3WTVC 2LSOA 2VODA 4OIOF 3KP2A 1QO0D 1XSDA 5D5UB 1ZREA 2MH9A 2GA2A 4RAZA 4KIGA 5L3GA 4I09A 4HF0A 3E5UA 2ESHA 3F21A 4M9SA 1F4KA 4L0ZB 5L3DA 3LQRA 1GXPA 1LDJA 3WODF 3WGIA 5TJJA 2A07F 2HTSA 1T0FA 1W7PA 4PCQA 3PQKA 1EV7A 2OQRA 3MQ0A 2GWRA 3JW4A 3GYHX 1SMTA 1TW2A 1OMIA 3ZMSA 3DXJF 4KUMA 4MQ9F 2K4JA 2D1VA 2IPQX 3RIRA 3HRMA 4HX4A 5E20A 1HW5A 4KT5C 4NHJA 3ZMZA 4XRFA 4RS8A 1JE8A 1IW7F 5LHGA 1O3TA 5ILUA 2RGVA 2Q2EA 4BH9A 4LB5A 1W5TA 2P7CB 4EMSA 2OD5A 1JXSA 4YFXF 2B0LA 5HDKA 3QPHA 1G3SA 4BAYA 5DUIA 4U7DA 2A6HF 1SFXA 3KLNA 4EJOA 2P5LC 1S7OA 2UZKA 1K7AA 4OIRF 4CXFA 3KP6A 3JTHA 3QU3A 4MGRA 3I71A 1U5TC 3BDDA 1LNWA 1B9MA 2XROA 1QNTA 3MZHA 4HV6A 3HHGA 3EUHA 4IRIA 2BE5F 5D5VB 3PFIA 4KN7X 1YO5C 4P9UA 3KP4A 4LK0F 5A2QK 4WF2A 2KIUA 4IJAA 3WU0A 3J80Z 3L00A 4I0BA 3I64A 4K2EA 3CUQB 3R0JA 4N9HA 2FBKA 3P9IA 1LB2A 2VOOA 1FLIA 2FNAA 1TNSA 5D8KB 3R6SA 4Y15A 5J8FA 5BS6A 4A12A 3GFIA 2XVCA 1WQ2A 3V7SA 4IF4A 3L09A 5CJ9A 5FFXA 1O3QA 3P9CA 2RN7A 4QWQA 4D0PA 3LFKA 3KCCA 2IA0A 2CQKA 1BBYA 3IL2A 3TO9A 4ENJA 3SQNA 2W84A 4HLYA 4R8HA 5LLQA 3ISPA 1KGSA 1LVAA 1U5TA 1HKQA 2ZMEB 4AWXB 4EQQA 2DPUA 2H6CA 4MNUA 1KA8A 1D3YA 1YFHA 2DK8A 3E6DA 1O57A 3RDIA 3RPQA 3H3UA 1P92A 2LNBA 4WCGA 2Z3YA 5F6FA 1MJAA 3QPTA 1S29A 4RGXA 1ZG5A 2KJCA 3GWZA 3FM3A 2VC1A 1LEBA 1LDDA 1VTNC 3D5LA 1TBXA 2HEOA 2F5DA 1Z6TA 1CF7B 4HLXA 1ZRFA 4M9ZA 5KK1A 4PGHA 5HS9A 5E8GA 2BGCA 4LLLA 1SD5A 3RJPA 1B6AA 2GA1A 3RYRA 1IXCA 1XMAA 4OOIA 2ISZA 3KLOA 2OA4A 1FBUA 2ZNYA 3J81Z 4EVIA 4UVCA 1DPRA 2KIFA 5L3EA 2VXZA 3W6KB 2NS0A 2M5WA 3EDPA 3TDZC 2QVOA 4KMFA 4S05A 1SD7A 4XSXF 2GZWA 2FA5A 2NYXA 2DLLA 4MHGA 1YTYA 1ZRCA 5DDGA 1XCVA 4KIFA 1HKTA 2PG4A 3HYIA 1I1GA 4ON0A 1AOYA 2QQBA 4HF1A 1P6RA 4LB6B 4P96A 3F23A 2V1DA 4MQVA 1XMKA 4KIBA 3SFZA 2EFWA 4KICA 1FBSA 2OBPA 3J7AO 2HYFA 4CGZA 4I02A 3GFLA 2J5OA 3ZMTA 3T8RA 2DQRA 1ON1A 2FXAA 2ZMEA 3HHHA 1IN5A 4RB0A 2MA3A 3I59A 3DF8A 3ULQB 1T6SA 3O6BB 5FD5A 4U7BA 1T39A 1Z6RA 2QZ8A 4MTEA 2XAHA 2MH2A 5CLSA 4H0EA 1YIOA 1T2KA 2PMHA 1PP8F 2NRAC 1DPUA 3DQVC 1ZYRF 1ZLKA 2A3SA 5D8LB 2KIMA 5JR3A 1BI3A 2GAUA 1HXDA 1J5YA 5DD4A 4I98B 2A61A 4LD5A 2HS5A 4PZJA 3WGGA 1CF7A 2VE9A 2YR2A 3I0TA 5HLGA 1Q1HA 4YG2F 1V4RA 5ICCA 4NQWA 1IRFA 3O3KA 3RYPA 5IT9Z 4LGWA 2G7HA 5LEJA 3JSPA 1KQ0A 4YIIA 2M1BA 3Q9SA 3M9AA 1UB9A 2O3FA 3E5QA 3TO7A 2D1HA 5LHIA 1EH8A 4XSZF 3GZ5A 4CDGA 3F72A 4RB2C 1FX7A 3EYIA 2VT2A 2QENA 1MKMA 1O3RA 2PN6A 4P55A 2CFXA 5CVVA 1R22A 5AONA 2EJRA 2HWVA 4O3MA 4ESBA 4AIJA 3F8MA 2DK5A 2Q0OA 5E18F 1DP7P 2YX4A 1XSVA 2ZKZA 1J7KA 1FPQA 4L9VA 3HRTA 1IN4A 2IT0A 1K78A 3GUDA 2FQ3A 3IWZA 3SHFA 3HSEA 5E1ZB 2XKOA 4IVNA 2AXLA 4OMZA 1MDMA 1F9NA 3GFMA 4A2UA 2AS5F 1KYZA 3V7RA 4B09A 2MC3A 3H3ZA 5CVRA 2X4HA 5HLIA 3TGNA 3F8CA 1U78A 1QZYA 1UFMA 2MLKA 2VOPA 2F5FA 2P8TA 4HQMA 1WI9A 5IT3A 1UHMA 3COAC 1HSTA 4G7OF 3S2WA 1J0RA 2DU9A 3P7NA 4BYYA 2K86A 3HUGA 1B9NA 2P5KA 3ECHA 2Z33A 3ZN0A 3J81K 4BQAA 3VOEA 3HOSA 2R7FA 3GLXA 5DCMA 2IA2A 3GX4X 3K1PA 1K79A 3CDHA 3K9TA 2P7VB 3ZMVA 1G3WA 5D6EA 2FBHA 1MJBA 2P6TA 1R5GA 3K0LA 1IN6A 3WTTC 4HAMA 1P4XA 1TW3A 5CVJA 2NNYA 3LA2A 2NAZA 1FC3A 4BHCA 3K1NA 5H6QA 2G7UA 3EQLF 3N97A 3L9FA 4KNYA 2YU3A 4WX9A 2HQRA 4EV0A 4RGRA 4UV8A 2QLZA 3JAMZ 1ZRDA 3E6MA 4G6DA 5EEHA 5F64A 2OQGA 2LF8A 1I5ZA 3E5XA 2XUBA 3I54A 1OKRA 1P4WA 3WGHA 1O3SA 1TQPA 4FT8A 3M8FA 4G7ZF 2P5VA 2NNNA 1BIBA 1D8KA 2VBXA 1LQ1A 4CO8A 2D2WA 4RB1A 4I0AA 4G94A 3U1DA 1KU3A 2KRFA 4BXUA 1MJ9A 3KP3A 1F5TA 1K6OA 5LEKA 1XGSA 3WTXC 1SFUA 3GZ6A 4TV7A 3H92A 3R60A 1GXQA 3W6JB 3VB2A 2O0YA 3M8EA 4YIFA 1S8NA 1W4MA 2VBZA 1JHHA 2FF4A 3F6OA 2OZUA 2JRTA 1XCBA 5HOOA 1D8JA 3Q9VA 3BPXA 1LEAA 1XDUA 5FD6A 4GGGA 2YSRA 1FYMA 1KU9A 2IP2A 1IF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYE A;  5K1Y A;  2OU2 A;  3IRQ A;  2Q8K A;  4U0V A;  1ONV A;  5FO5 A;  3MAJ A;  4OMY A;  3M1E A;  1R36 A;  1I6X A;  1ZAO A;  2VC0 A;  5E1W A;  3T1B A;  2RQP A;  4LG0 B;  3CO6 C;  5K5Q A;  4KFC A;  2XIG A;  1TTY A;  5BQT A;  4G7H F;  3BY6 A;  3R0A A;  3ML6 A;  2A5Y B;  3Q5F A;  4R79 A;  3DPL C;  4YFK F;  3I58 A;  2M45 A;  3HRU A;  2A68 F;  4OIP F;  2HYG D;  4BNC A;  2HKO A;  3DFG A;  3IHU A;  3I4P A;  3RKW A;  4HOB A;  2RKH A;  2PQ8 A;  3MWM A;  3FZV A;  3V8K A;  2CWE A;  1OYW A;  3RTR A;  2K02 A;  2ZO4 A;  2EK5 A;  2XGX A;  1HQC A;  1AWC A;  2VBW A;  3WE3 A;  4ESF A;  2XV4 S;  1KYW A;  1KU7 A;  5ICF A;  3QP5 A;  4L0Y B;  5CVI A;  4ZYH A;  3FXR A;  4L5I A;  2FSW A;  3WTS C;  4GCV A;  3E6C C;  3CUQ C;  2E7W A;  4ASN A;  1XGM A;  5ILS A;  5K5O A;  1I1S A;  1HSJ A;  2KJB A;  4OU0 A;  3TOA A;  3LQQ A;  2EWN A;  2HFH A;  1MD0 A;  5EEG A;  2IA1 A;  5BPD A;  4LLN A;  2O61 A;  5ICE A;  2Z5U A;  2JSC A;  5HVQ C;  1MGT A;  3V8L A;  2JPB A;  2DBB A;  5H6R A;  5D4S A;  1FYK A;  3WE2 A;  1UHW A;  5ICG A;  4ZZL A;  5JFR A;  1H0M A;  2OAZ A;  1WSU A;  3ZQ7 A;  3WTZ A;  2ACJ A;  2P6S A;  4ETS A;  3QU6 A;  1FYL A;  4UXN A;  4JBA A;  2COM A;  1ZHF A;  3ERE D;  2J5P A;  2XAF A;  2L4M A;  1FSE A;  4KN4 X;  4MEY F;  4Y13 A;  1ON2 A;  5HS8 A;  4EGZ A;  1HKS A;  1EH6 A;  3JTG A;  3NEU A;  1LJ9 A;  1WWX A;  3EET A;  5AIQ A;  3TKY A;  1FP2 A;  2HDC A;  4UVA A;  5D4R A;  4AVP A;  4ZH4 F;  2ISY A;  1S7A A;  3CUQ A;  4XLN F;  1RZ4 A;  2IRF G;  1O7L A;  2R3S A;  4DNC A;  2M8E A;  2W85 A;  3F8B A;  3QP6 A;  2LDU A;  1P4A A;  1T38 A;  2CW0 F;  2E1N A;  4QLC U;  1R1U A;  1R5H A;  1J75 A;  2HGC A;  3I5U A;  1TNT A;  3C7J A;  5L3C A;  3GXO A;  3U2R A;  3DV8 A;  3I53 A;  1S6L A;  2VON A;  5D5X B;  2ADU A;  3FXQ A;  5JI6 A;  2FRH A;  5J6X A;  4U88 A;  2L4A A;  2CSO A;  4EJV A;  4M6Y A;  2H94 A;  1SD4 A;  3T8T A;  1V3F A;  3LST A;  3BJ6 A;  3V7C A;  3E97 A;  3LAJ A;  4RAY A;  4CIC A;  1XB4 A;  2Y75 A;  2BEO A;  4S04 A;  2E1C A;  2L01 A;  4Q5S F;  2PJP A;  1D5V A;  1QBJ A;  5D5W B;  4M73 A;  2RC4 A;  2QBY B;  2CO5 A;  3ZN1 A;  1B59 A;  3WU1 B;  4HV5 A;  3U9G A;  4EJT A;  5HDN A;  3SZT A;  3SZP A;  2HQN A;  2L3D A;  4A6E A;  5JHU A;  3J80 K;  1USS A;  2HTJ A;  3EYY A;  3MFK A;  4HQE A;  1H9G A;  3C1D A;  3KEQ A;  2F5C A;  3MZY A;  3GEZ A;  2L02 A;  1EH7 A;  1FY7 A;  2CG4 A;  3HOT A;  2RDP A;  3IKV A;  2EB7 A;  4O6J A;  2BBY A;  5ILV A;  1J2X A;  1FWZ A;  1ULY A;  2FU4 A;  1XN7 A;  2DT5 A;  5FLX Z;  4ZYD A;  1YG2 A;  3FXU A;  4ENK A;  1W7P B;  1TLH B;  1FP1 D;  1KU2 A;  1I27 A;  2Z9O A;  2XAJ A;  3HRS A;  2H6B A;  4XLP F;  2RV8 A;  4IHT A;  4A5M A;  3GO5 A;  1YYV A;  1YS7 A;  1RIO H;  3FWE A;  4BHP A;  4OIN F;  1BM9 A;  2OZ6 A;  4RGS A;  4G9Y A;  4HBL A;  4L9N A;  5LHH A;  1REP C;  5HLH A;  5D6F A;  4MTD A;  4WK8 F;  2FEZ A;  3V8J A;  2X0L A;  2DO7 A;  1HBX G;  4M9X A;  4WXH A;  3KEO A;  2M30 A;  2WTE A;  3FMR A;  5E8I A;  4N9I A;  2Z99 A;  3R4K A;  1Z9C A;  2HOE A;  3DPT A;  4EM0 B;  1YS6 A;  1ZAR A;  3GF2 A;  2DFI A;  3FHZ A;  2E7X A;  2IW5 A;  4L5J A;  3ZMD A;  4KDP A;  1J9I A;  5KVR A;  2WWY A;  1R00 A;  4LK1 F;  1QZZ A;  3E6B A;  3MCZ A;  2DQL A;  1BI2 A;  1FBQ A;  5AIP A;  3B02 A;  1DDN A;  3IC7 A;  1Y0U A;  4KA4 A;  3WTY C;  3ECO A;  4ZYE A;  1HW1 A;  3BRO A;  4F7Z A;  4PDK A;  2ZCW A;  3REO A;  4Q47 A;  4PGG A;  4GYG A;  4HF2 A;  4L18 B;  1OPC A;  4M6X A;  2FMY A;  2ZJ2 A;  4MEX F;  2EV5 A;  2VN2 A;  3BJA A;  3WG9 A;  2GXB A;  1FSH A;  2UXX A;  5LGT A;  3BOQ A;  1Z91 A;  1G3T A;  2DAO A;  3K69 A;  1W5S A;  1W7P D;  4HDU A;  2ZNZ A;  2VT3 A;  4AD9 A;  4Q4Z F;  3MEX A;  4A0X A;  4IXA A;  1BOA A;  2ELH A;  2K7L A;  1G6N A;  1XD7 A;  2ETH A;  3K2Z A;  4U0W A;  2EFO A;  2DTR A;  1ODD A;  3M7G A;  4E70 A;  2EA2 A;  5LGU A;  3QRF F;  2L54 A;  2EFN A;  4GYI A;  4ENM A;  1DUX C;  3RKY A;  4ENN A;  2V79 A;  2UWM A;  3P9K A;  3LA7 A;  1OYI A;  4FHT A;  1X3U A;  1TQM A;  4HW0 A;  3VOD A;  1U5T B;  5TRD A;  1PP7 U;  2BYV E;  4WXC A;  3VFZ A;  3KET A;  1L3L A;  5DCF A;  2WV0 A;  2LKP A;  4ZZD A;  3CJN A;  2PI0 A;  1R7J A;  1RI7 A;  2EV6 A;  3ROU A;  3OV8 A;  1Z05 A;  1STZ A;  4RGU A;  1SAX A;  3O2P E;  1IRG A;  1L0O C;  2ZBK A;  2H27 A;  1UCR A;  4OIQ F;  4M71 A;  3ABU A;  2DPD A;  3C3W A;  3ZPL A;  5IT9 K;  4LFU A;  4O5V A;  2QM3 A;  3BWG A;  1YLF A;  4I7H A;  3KP5 A;  3CO7 C;  1CGP A;  1ZN2 A;  3QAH A;  4UV9 A;  2PMU A;  2ZXJ A;  4P9F A;  3F22 A;  1G4D A;  1JHF A;  1FNN A;  2Y48 A;  1OR7 A;  2K27 A;  4AIH A;  5FLX K;  1QQI A;  4FX4 A;  1WKM A;  2WC2 A;  5BMZ A;  3F3X A;  3B73 A;  2W57 A;  1MZB A;  1FZP B;  4YFN F;  2FNP A;  1XDS A;  2RVC A;  1QPM A;  2QWW A;  3F8F A;  3TOB A;  3NRV A;  2RNJ A;  1ZH5 A;  4GXO A;  2W24 A;  2ESN A;  3HIF A;  4P5O A;  1TQI A;  2FE3 A;  5J8C A;  2P4W A;  5FB2 A;  1U8R A;  1B1B A;  4WXD A;  2O03 A;  4Y17 A;  4RB3 C;  3F6V A;  3FF5 A;  1RUO A;  1XGN A;  3HSF A;  2CGP A;  3G3Z A;  1R23 A;  4IRG A;  4I01 A;  2MD5 A;  3WTW C;  1IAW A;  3G73 A;  4A5N A;  1BJA A;  5DD8 A;  3ZP5 A;  5CYV A;  3TQN A;  1T98 A;  4EJW A;  1YW9 A;  3LAP A;  3FMQ A;  3GFJ A;  2V1X A;  2MBF A;  2TDX A;  1SMY F;  3HSR A;  3I59 B;  1SD6 A;  4IHS A;  3AAF A;  2R7D A;  4KMU X;  2QUF A;  1SFE A;  1A04 A;  1XGO A;  4JQF A;  1FT9 A;  4U0Y A;  4B8X A;  2C6Y A;  3CLO A;  3L2C A;  4G6Q A;  4HDV A;  2D45 A;  5FFZ A;  2KKO A;  2JZY A;  3BJO A;  3T0Y A;  2DI3 A;  3RPU A;  2HZT A;  1GHC A;  2CYY A;  3LA3 A;  1RNL A;  3LWF A;  3OOP A;  4HX7 A;  2YPR A;  2YX7 A;  1RUN A;  2O6G E;  4A0Y A;  1ZG3 A;  4ESJ A;  5JVT A;  4LG0 A;  5LGN A;  5HDG A;  1YW7 A;  1YW8 A;  1BC8 C;  2EV0 A;  4UNO A;  2STT A;  3V4G A;  4CZZ A;  3JAM K;  5H20 A;  3IWF A;  3DP7 A;  4IRH A;  2V9V A;  1O7F A;  2HKX A;  1KQ8 A;  1U6G A;  1XSX A;  3RI4 A;  1UST A;  3JSO A;  3GW2 A;  2QYO A;  1ZLJ A;  4JK1 X;  4UHT A;  1ZG1 A;  1R1V A;  4IPA A;  3BP8 A;  1OYY A;  5K5R A;  3N4M A;  1FOK A;  2XAG A;  5E17 F;  4AIK A;  4HA8 A;  4ZYG A;  3ELK A;  3BPV A;  1IN7 A;  3TO6 A;  3E3V A;  4A6D A;  2W25 A;  1BN5 A;  4EGY A;  3CTA A;  1S3J A;  1JGS A;  3DKW A;  1B4A A;  1K78 B;  5L3B A;  5BPI A;  4NB5 A;  4R1H A;  3R61 A;  3K1M A;  1R1T A;  2IVM A;  1MDM B;  4HX8 A;  1QGP A;  2H09 A;  2V1U A;  2EFP A;  5E1X A;  3IRR A;  1BIA A;  3ZMU A;  1R58 A;  1E2X A;  2VE8 A;  2XKP A;  2M87 A;  4A0Z A;  1G3Y A;  4GO1 A;  3VEP A;  3KE2 A;  5LBQ A;  5BOX A;  2A6E F;  5ED4 A;  3TDU C;  1IXS B;  1Z7U A;  4UVB A;  1U3E M;  3KP7 A;  3FMS A;  5DEQ A;  2PBI A;  2IJL A;  2K4B A;  5LRS A;  1WRJ A;  2O8X A;  1PUE E;  4CYD A;  4Z2Y A;  2G9W A;  5DCM B;  2XHK A;  4HZF A;  3FX3 A;  1IUY A;  4LMY A;  3BZ6 A;  3L7W A;  1KQ9 A;  2VBY A;  2JTV A;  4I2O A;  4BHB A;  6PAX A;  1IXR C;  5DV5 A;  1BC7 C;  5ERI A;  4L9J A;  4LLG F;  2DW4 A;  1NHA A;  3FM5 A;  3KZY A;  4KYW A;  2EFQ A;  2BV6 A;  1HW2 A;  2PLY A;  1YQA A;  2F2E A;  1ZGA A;  2Y0M A;  2XAS A;  4XBF A;  4EM1 A;  4Q48 A;  4EM2 A;  2FBI A;  4LJZ F;  3SXY A;  5A2Q Z;  2FML A;  1U2W A;  2HR3 A;  5L3F A;  1IZ1 A;  1BI0 A;  5LRR A;  1F1Z A;  3DEU A;  3C18 A;  2MLG A;  3RKX A;  2GIV A;  2GXG A;  4L9T A;  2A69 F;  5FGM A;  2QQA A;  5CVU A;  2F5E A;  1E17 A;  1Z1D A;  1ZGJ A;  3CUO A;  3GVA A;  1J59 A;  1H9T A;  1P2F A;  4M74 A;  3NQO A;  2UXN A;  4N0B A;  4WWC A;  5F1R A;  4M72 A;  1PDN C;  4EJU A;  3KZZ A;  3HTS B;  5DUK A;  3T5X A;  3IKT A;  2PFB A;  3KFW X;  2FOK A;  2LF7 A;  2GQQ A;  2EA4 A;  1BI1 A;  3PQJ A;  3HTU A;  2XRN A;  2V6C A;  2QQ9 A;  5DYM A;  3QOP A;  4FX0 A;  1LDK B;  2JT1 A;  4UUV A;  2QBY A;  3WTU C;  4G8X A;  2STW A;  4CHU A;  2JPC A;  4DQ2 A;  1IN8 A;  1GVJ A;  1C0W A;  3ABT A;  2XAQ A;  3F8N A;  2PEX A;  5HS7 A;  3D0S A;  2ZFW A;  3WTV C;  2LSO A;  2VOD A;  4OIO F;  3KP2 A;  1QO0 D;  1XSD A;  5D5U B;  1ZRE A;  2MH9 A;  2GA2 A;  4RAZ A;  4KIG A;  5L3G A;  4I09 A;  4HF0 A;  3E5U A;  2ESH A;  3F21 A;  4M9S A;  1F4K A;  4L0Z B;  5L3D A;  3LQR A;  1GXP A;  1LDJ A;  3WOD F;  3WGI A;  5TJJ A;  2A07 F;  2HTS A;  1T0F A;  1W7P A;  4PCQ A;  3PQK A;  1EV7 A;  2OQR A;  3MQ0 A;  2GWR A;  3JW4 A;  3GYH X;  1SMT A;  1TW2 A;  1OMI A;  3ZMS A;  3DXJ F;  4KUM A;  4MQ9 F;  2K4J A;  2D1V A;  2IPQ X;  3RIR A;  3HRM A;  4HX4 A;  5E20 A;  1HW5 A;  4KT5 C;  4NHJ A;  3ZMZ A;  4XRF A;  4RS8 A;  1JE8 A;  1IW7 F;  5LHG A;  1O3T A;  5ILU A;  2RGV A;  2Q2E A;  4BH9 A;  4LB5 A;  1W5T A;  2P7C B;  4EMS A;  2OD5 A;  1JXS A;  4YFX F;  2B0L A;  5HDK A;  3QPH A;  1G3S A;  4BAY A;  5DUI A;  4U7D A;  2A6H F;  1SFX A;  3KLN A;  4EJO A;  2P5L C;  1S7O A;  2UZK A;  1K7A A;  4OIR F;  4CXF A;  3KP6 A;  3JTH A;  3QU3 A;  4MGR A;  3I71 A;  1U5T C;  3BDD A;  1LNW A;  1B9M A;  2XRO A;  1QNT A;  3MZH A;  4HV6 A;  3HHG A;  3EUH A;  4IRI A;  2BE5 F;  5D5V B;  3PFI A;  4KN7 X;  1YO5 C;  4P9U A;  3KP4 A;  4LK0 F;  5A2Q K;  4WF2 A;  2KIU A;  4IJA A;  3WU0 A;  3J80 Z;  3L00 A;  4I0B A;  3I64 A;  4K2E A;  3CUQ B;  3R0J A;  4N9H A;  2FBK A;  3P9I A;  1LB2 A;  2VOO A;  1FLI A;  2FNA A;  1TNS A;  5D8K B;  3R6S A;  4Y15 A;  5J8F A;  5BS6 A;  4A12 A;  3GFI A;  2XVC A;  1WQ2 A;  3V7S A;  4IF4 A;  3L09 A;  5CJ9 A;  5FFX A;  1O3Q A;  3P9C A;  2RN7 A;  4QWQ A;  4D0P A;  3LFK A;  3KCC A;  2IA0 A;  2CQK A;  1BBY A;  3IL2 A;  3TO9 A;  4ENJ A;  3SQN A;  2W84 A;  4HLY A;  4R8H A;  5LLQ A;  3ISP A;  1KGS A;  1LVA A;  1U5T A;  1HKQ A;  2ZME B;  4AWX B;  4EQQ A;  2DPU A;  2H6C A;  4MNU A;  1KA8 A;  1D3Y A;  1YFH A;  2DK8 A;  3E6D A;  1O57 A;  3RDI A;  3RPQ A;  3H3U A;  1P92 A;  2LNB A;  4WCG A;  2Z3Y A;  5F6F A;  1MJA A;  3QPT A;  1S29 A;  4RGX A;  1ZG5 A;  2KJC A;  3GWZ A;  3FM3 A;  2VC1 A;  1LEB A;  1LDD A;  1VTN C;  3D5L A;  1TBX A;  2HEO A;  2F5D A;  1Z6T A;  1CF7 B;  4HLX A;  1ZRF A;  4M9Z A;  5KK1 A;  4PGH A;  5HS9 A;  5E8G A;  2BGC A;  4LLL A;  1SD5 A;  3RJP A;  1B6A A;  2GA1 A;  3RYR A;  1IXC A;  1XMA A;  4OOI A;  2ISZ A;  3KLO A;  2OA4 A;  1FBU A;  2ZNY A;  3J81 Z;  4EVI A;  4UVC A;  1DPR A;  2KIF A;  5L3E A;  2VXZ A;  3W6K B;  2NS0 A;  2M5W A;  3EDP A;  3TDZ C;  2QVO A;  4KMF A;  4S05 A;  1SD7 A;  4XSX F;  2GZW A;  2FA5 A;  2NYX A;  2DLL A;  4MHG A;  1YTY A;  1ZRC A;  5DDG A;  1XCV A;  4KIF A;  1HKT A;  2PG4 A;  3HYI A;  1I1G A;  4ON0 A;  1AOY A;  2QQB A;  4HF1 A;  1P6R A;  4LB6 B;  4P96 A;  3F23 A;  2V1D A;  4MQV A;  1XMK A;  4KIB A;  3SFZ A;  2EFW A;  4KIC A;  1FBS A;  2OBP A;  3J7A O;  2HYF A;  4CGZ A;  4I02 A;  3GFL A;  2J5O A;  3ZMT A;  3T8R A;  2DQR A;  1ON1 A;  2FXA A;  2ZME A;  3HHH A;  1IN5 A;  4RB0 A;  2MA3 A;  3I59 A;  3DF8 A;  3ULQ B;  1T6S A;  3O6B B;  5FD5 A;  4U7B A;  1T39 A;  1Z6R A;  2QZ8 A;  4MTE A;  2XAH A;  2MH2 A;  5CLS A;  4H0E A;  1YIO A;  1T2K A;  2PMH A;  1PP8 F;  2NRA C;  1DPU A;  3DQV C;  1ZYR F;  1ZLK A;  2A3S A;  5D8L B;  2KIM A;  5JR3 A;  1BI3 A;  2GAU A;  1HXD A;  1J5Y A;  5DD4 A;  4I98 B;  2A61 A;  4LD5 A;  2HS5 A;  4PZJ A;  3WGG A;  1CF7 A;  2VE9 A;  2YR2 A;  3I0T A;  5HLG A;  1Q1H A;  4YG2 F;  1V4R A;  5ICC A;  4NQW A;  1IRF A;  3O3K A;  3RYP A;  5IT9 Z;  4LGW A;  2G7H A;  5LEJ A;  3JSP A;  1KQ0 A;  4YII A;  2M1B A;  3Q9S A;  3M9A A;  1UB9 A;  2O3F A;  3E5Q A;  3TO7 A;  2D1H A;  5LHI A;  1EH8 A;  4XSZ F;  3GZ5 A;  4CDG A;  3F72 A;  4RB2 C;  1FX7 A;  3EYI A;  2VT2 A;  2QEN A;  1MKM A;  1O3R A;  2PN6 A;  4P55 A;  2CFX A;  5CVV A;  1R22 A;  5AON A;  2EJR A;  2HWV A;  4O3M A;  4ESB A;  4AIJ A;  3F8M A;  2DK5 A;  2Q0O A;  5E18 F;  1DP7 P;  2YX4 A;  1XSV A;  2ZKZ A;  1J7K A;  1FPQ A;  4L9V A;  3HRT A;  1IN4 A;  2IT0 A;  1K78 A;  3GUD A;  2FQ3 A;  3IWZ A;  3SHF A;  3HSE A;  5E1Z B;  2XKO A;  4IVN A;  2AXL A;  4OMZ A;  1MDM A;  1F9N A;  3GFM A;  4A2U A;  2AS5 F;  1KYZ A;  3V7R A;  4B09 A;  2MC3 A;  3H3Z A;  5CVR A;  2X4H A;  5HLI A;  3TGN A;  3F8C A;  1U78 A;  1QZY A;  1UFM A;  2MLK A;  2VOP A;  2F5F A;  2P8T A;  4HQM A;  1WI9 A;  5IT3 A;  1UHM A;  3COA C;  1HST A;  4G7O F;  3S2W A;  1J0R A;  2DU9 A;  3P7N A;  4BYY A;  2K86 A;  3HUG A;  1B9N A;  2P5K A;  3ECH A;  2Z33 A;  3ZN0 A;  3J81 K;  4BQA A;  3VOE A;  3HOS A;  2R7F A;  3GLX A;  5DCM A;  2IA2 A;  3GX4 X;  3K1P A;  1K79 A;  3CDH A;  3K9T A;  2P7V B;  3ZMV A;  1G3W A;  5D6E A;  2FBH A;  1MJB A;  2P6T A;  1R5G A;  3K0L A;  1IN6 A;  3WTT C;  4HAM A;  1P4X A;  1TW3 A;  5CVJ A;  2NNY A;  3LA2 A;  2NAZ A;  1FC3 A;  4BHC A;  3K1N A;  5H6Q A;  2G7U A;  3EQL F;  3N97 A;  3L9F A;  4KNY A;  2YU3 A;  4WX9 A;  2HQR A;  4EV0 A;  4RGR A;  4UV8 A;  2QLZ A;  3JAM Z;  1ZRD A;  3E6M A;  4G6D A;  5EEH A;  5F64 A;  2OQG A;  2LF8 A;  1I5Z A;  3E5X A;  2XUB A;  3I54 A;  1OKR A;  1P4W A;  3WGH A;  1O3S A;  1TQP A;  4FT8 A;  3M8F A;  4G7Z F;  2P5V A;  2NNN A;  1BIB A;  1D8K A;  2VBX A;  1LQ1 A;  4CO8 A;  2D2W A;  4RB1 A;  4I0A A;  4G94 A;  3U1D A;  1KU3 A;  2KRF A;  4BXU A;  1MJ9 A;  3KP3 A;  1F5T A;  1K6O A;  5LEK A;  1XGS A;  3WTX C;  1SFU A;  3GZ6 A;  4TV7 A;  3H92 A;  3R60 A;  1GXQ A;  3W6J B;  3VB2 A;  2O0Y A;  3M8E A;  4YIF A;  1S8N A;  1W4M A;  2VBZ A;  1JHH A;  2FF4 A;  3F6O A;  2OZU A;  2JRT A;  1XCB A;  5HOO A;  1D8J A;  3Q9V A;  3BPX A;  1LEA A;  1XDU A;  5FD6 A;  4GGG A;  2YSR A;  1FYM A;  1KU9 A;  2IP2 A;  1IF1 A; 
#chains in the Genus database with same CATH topology
 4HYE A;  5K1Y A;  3AG4 H;  2DOD A;  2OU2 A;  3IRQ A;  5FRM A;  2QQ8 A;  4JOM A;  1D0Y A;  4XOR A;  4YEL A;  2Q8K A;  4U0V A;  1ONV A;  3S1N J;  2WAQ A;  2VIX A;  2YS9 A;  5FO5 A;  3S14 J;  1SFO J;  3MAJ A;  2V9K A;  4OMY A;  2R7Z J;  1RES A;  3M1E A;  5HNH A;  1R36 A;  1I6X A;  1ZAO A;  3JRG A;  1JKP C;  2VC0 A;  4BJ5 C;  3HDD A;  5E1W A;  2HQ5 A;  3T1B A;  2RQP A;  4LG0 B;  3CO6 C;  3GME A;  5K5Q A;  4KFC A;  2XIG A;  2XF6 A;  1TTY A;  3AL0 B;  1X1P A;  3AG1 H;  5BQT A;  2KZV A;  5JLX A;  4EEF G;  4G7H F;  2LY1 A;  2K9N A;  1EKE A;  2KDO A;  3BY6 A;  3S3O A;  3GLL A;  3R0A A;  2LP0 A;  3ML6 A;  2A5Y B;  2E5Z A;  3MMY B;  3Q5F A;  4R79 A;  3SDG A;  3DPL C;  4YFK F;  3I58 A;  5M3M J;  2M45 A;  3HRU A;  3VSL A;  2A68 F;  2BY1 A;  1BR4 A;  4OIP F;  1T95 A;  2HYG D;  4BNC A;  2AO9 A;  1VQ4 I;  1N78 A;  2HKO A;  3BT9 A;  5E3N A;  3DFG A;  3IHU A;  3HC7 A;  3I4P A;  2NVY J;  3RKW A;  4BJT A;  4HOB A;  1GV2 A;  2RKH A;  3OS0 A;  2PQ8 A;  2M7B A;  2WB1 N;  4E6K G;  3A2K A;  3MWM A;  3FZV A;  2VI6 A;  3V8K A;  2CWE A;  3ASO H;  2HXI A;  1OYW A;  4BGD A;  2ZSH B;  2KT0 A;  3RTR A;  3LSM A;  2K02 A;  3PFY A;  2ZO4 A;  4BY1 J;  3CCU I;  2EK5 A;  2XGX A;  1HQC A;  2OJE D;  1AWC A;  2DA5 A;  1JUM A;  1ZK8 A;  2JMW A;  2VBW A;  2B63 J;  3WE3 A;  4ESF A;  2XV4 S;  1TWA J;  5FJ8 J;  1KYW A;  1KU7 A;  3H0G J;  1JKQ C;  2Z16 A;  2HPM A;  5ICF A;  3OYM A;  3QP5 A;  4L0Y B;  5CVI A;  4ZYH A;  3FXR A;  4L5I A;  3VSK A;  3PNT A;  2FSW A;  3WTS C;  4GCV A;  1X4P A;  2H8R A;  2PMZ A;  3E6C C;  1LPQ A;  3FXM A;  3A02 A;  3CUQ C;  2E7W A;  2E2I J;  4ASN A;  1XGM A;  1WI3 A;  2KL4 A;  5ILS A;  1SVM A;  5K5O A;  1I1S A;  1HSJ A;  2KJB A;  4OU0 A;  3AG3 H;  3TOA A;  3M3Y J;  3LQQ A;  2EWN A;  2HFH A;  1IJW C;  1MD0 A;  1G8X A;  5E3L A;  3QYE A;  1WGX A;  5EEG A;  2IA1 A;  2IXS A;  5BPD A;  4M6V A;  1Z21 A;  4LLN A;  2O61 A;  2X6Y A;  2JA5 J;  5ICE A;  2Z5U A;  1Y0N A;  2JSC A;  5HVQ C;  1LFP A;  1MGT A;  3V8L A;  2JPB A;  2DBB A;  2X48 A;  5H6R A;  4BEH B;  5D4S A;  1X2M A;  3L2W A;  1FYK A;  1I3A A;  3WE2 A;  1T08 B;  1UHW A;  1X2N A;  5ICG A;  4ZZL A;  3CCS I;  5JFR A;  3I4M J;  1H0M A;  2HDW A;  2OAZ A;  2MGQ A;  1WSU A;  3ZQ7 A;  5B5E C;  3WTZ A;  2ACJ A;  1WZ2 A;  2E34 A;  4PSX A;  3RPU D;  2FQ4 A;  3JRE A;  3CP8 A;  2CW8 A;  2P6S A;  1LE8 B;  4ETS A;  1ITY A;  3GTO J;  2X9D A;  5F27 A;  2VPR A;  3QU6 A;  3OYI A;  1FYL A;  1A31 A;  2JA6 J;  4UXN A;  4JBA A;  2COM A;  3BQZ A;  1ZHF A;  2J5P A;  2XAF A;  3ERE D;  3DBR B;  1MBE A;  2L4M A;  4I99 C;  1FSE A;  4KN4 X;  4M3E A;  2MSY A;  4MEY F;  5JHF A;  3U21 A;  2R5Z A;  4Y13 A;  3A0B C;  1ON2 A;  4N4N B;  4PFP A;  5HS8 A;  4EGZ A;  1HKS A;  1YX3 A;  1EH6 A;  3JTG A;  1JJ6 C;  4ZC3 A;  3NEU A;  2RQQ A;  1LJ9 A;  4NNJ A;  1WWX A;  3EET A;  5AIQ A;  3TKY A;  2LC2 A;  4C2T A;  3OR2 C;  1AKH B;  1FP2 A;  1XTA A;  4Y3O A;  4XRS G;  2HOS A;  2HDC A;  4DBQ A;  1Z67 A;  4UVA A;  5D4R A;  4AVP A;  4ZH4 F;  4FTH A;  2ISY A;  1S7A A;  2E1M B;  3CUQ A;  4XLN F;  1RZ4 A;  2ECB A;  2CUE A;  1ETW A;  1FTT A;  2IRF G;  2R4G A;  1O7L A;  2R3S A;  4DNC A;  2M8E A;  2ELK A;  2W85 A;  3F8B A;  3ZR8 X;  3QP6 A;  2LDU A;  1A36 A;  2VKH A;  3S2H J;  4DIQ A;  4FAS D;  1R4N B;  1Q1V A;  1P4A A;  1T38 A;  4J00 A;  2CW0 F;  3Q0W A;  2E1N A;  4QLC U;  1R1U A;  4BU2 A;  2E19 A;  3W2A A;  4QIW N;  4PSW A;  1R5H A;  1J75 A;  2HGC A;  3I5U A;  1TNT A;  2GLO A;  3K4B A;  3DEE A;  1X3Z B;  1BOB A;  3C7J A;  5L3C A;  3GXO A;  3UNG C;  3NWS A;  3U2R A;  3DTK A;  3IP4 B;  3DV8 A;  3I53 A;  1P9Q C;  1S6L A;  2JSP A;  1OJL A;  1ETQ A;  3CMY A;  1IGN A;  3IV5 A;  4J19 A;  3CP2 A;  2NVQ J;  3E0J B;  3CCE I;  2VON A;  2M3A A;  4BDZ A;  5D5X B;  2V26 A;  2ADU A;  3FXQ A;  1RRJ A;  5JI6 A;  3OYL A;  1WJD A;  2FRH A;  2ZB9 A;  5J6X A;  2AQE A;  4U88 A;  3K4J A;  1TL8 A;  2L4A A;  2CSO A;  4EJV A;  4M6Y A;  4XON A;  2H94 A;  4XLA A;  2KRC A;  1BL0 A;  3C2B A;  1SD4 A;  2CUF A;  4DYQ A;  3T8T A;  1V3F A;  4ANJ A;  3HB9 A;  3LST A;  3BJ6 A;  3V7C A;  3BR1 A;  3HOU J;  3E97 A;  3LAJ A;  2KQR A;  1DU0 A;  4XIC A;  2YU9 J;  4RAY A;  3K4M A;  5C3E J;  2VUM J;  5IP6 A;  1JUS A;  1XC5 A;  2EIN H;  2Y69 H;  2F6C A;  4CIC A;  2FOW A;  4BJ6 C;  1XB4 A;  2Y75 A;  2BEO A;  2VPL A;  4BBS J;  4S04 A;  2IS4 A;  4Y33 A;  2E1C A;  4B3X A;  5DS9 A;  3E7L A;  2L01 A;  4Q5S F;  4A3E J;  2PJP A;  1D5V A;  2XB5 A;  4XLF A;  1QBJ A;  5D5W B;  4X6A J;  2JUC A;  4M73 A;  1V5E A;  2RC4 A;  2F4O B;  4RDU A;  1W0U A;  1R71 A;  2IBD A;  2L9R A;  2QBY B;  2QSG X;  3HOX J;  2CO5 A;  3ZN1 A;  2OCE A;  1B59 A;  3TED A;  3WU1 B;  4HV5 A;  3U9G A;  1T8I A;  4MFD A;  4EJT A;  2DCE A;  3A03 A;  5B3S H;  2VKD A;  3DCF A;  3FK6 A;  5HDN A;  3PSF A;  4Y7N J;  1DGR M;  3SZT A;  3SZP A;  2AQF A;  2HQN A;  2L3D A;  4A6E A;  2HI3 A;  5B1A H;  5JHU A;  1LE8 A;  1MMA A;  3J80 K;  1USS A;  2HTJ A;  3EYY A;  2KHM A;  3MFK A;  4HQE A;  1Y8Q B;  1H9G A;  3S15 J;  3C1D A;  4D7M A;  2DTZ A;  2H1L A;  2TRT A;  3KEQ A;  1ZKG A;  3Q0U A;  4F3Q A;  2F5C A;  1VZ0 A;  3MZY A;  4A93 J;  3GEZ A;  4DGW B;  1HDP A;  2L02 A;  1EH7 A;  1FY7 A;  1SVO A;  2CG4 A;  3HOT A;  2RDP A;  4MFE A;  1X3W B;  3IKV A;  3FKJ A;  2EB7 A;  4XKW A;  4O6J A;  2BBY A;  5ILV A;  1J2X A;  1FWZ A;  1AKH A;  1ULY A;  2DMP A;  2G0E A;  2FU4 A;  4NUB A;  5M5Y J;  1XN7 A;  2DT5 A;  2LY9 A;  5GAD J;  5FLX Z;  4ZYD A;  3ZQG A;  4KT6 A;  1YG2 A;  3FXU A;  3QQA A;  4ENK A;  1W7P B;  1TLH B;  1FP1 D;  1KU2 A;  1MMN A;  1I27 A;  2Z9O A;  2XAJ A;  5CPR B;  4IOC F;  4H4K C;  1UHS A;  3HRS A;  2H6B A;  3CDI A;  2VJ5 A;  4XLP F;  3OYG A;  4KJZ A;  4P1W A;  1GDT A;  2RV8 A;  1OCO H;  4IHT A;  4A5M A;  3GO5 A;  1YYV A;  4KIT B;  3ZQL A;  1YS7 A;  1MBH A;  1W1W E;  3FWE A;  1RIO H;  4BHP A;  4OIN F;  1Y1W J;  1BM9 A;  2OZ6 A;  5B66 C;  2W7N A;  4DOZ A;  4RGS A;  4G9Y A;  4HBL A;  4L9N A;  3BG5 A;  2KLO A;  5LHH A;  1REP C;  1MIJ A;  2EBI A;  5HLH A;  5D6F A;  2Y31 A;  2M34 A;  4MTD A;  1X19 A;  2M7A A;  2ZXH A;  4WK8 F;  3KEY A;  3F0C A;  2FEZ A;  2KIS A;  3V8J A;  5J47 A;  1GV5 A;  2X0L A;  3BZC A;  3CC2 I;  1WJE A;  4OAZ A;  2DO7 A;  1HBX G;  4M9X A;  4WXH A;  3KEO A;  3BR2 A;  5HNF A;  2M30 A;  4E7K A;  1FOW A;  2WTE A;  3HM5 A;  3FMR A;  1A35 A;  5E8I A;  3FXL A;  1QZE A;  2DA2 A;  3BR3 A;  1YJW I;  4N9I A;  2Z99 A;  3S93 A;  4CCO A;  5M5X J;  2DMQ A;  2N8G A;  3ASN H;  3R4K A;  1Z9C A;  3H36 A;  3LFU A;  4IZZ A;  1MBG A;  2HOE A;  4QTR A;  3DPT A;  2Q2E B;  4EM0 B;  2MW8 A;  1YS6 A;  3OYN A;  3OR1 C;  1ZAR A;  2BXZ A;  1UMQ A;  2DFI A;  2DJI A;  2LTP A;  3GF2 A;  3FHZ A;  1HF0 A;  2DOE A;  2NVT J;  3S1Q J;  3QOE A;  2E7X A;  2IW5 A;  4L5J A;  5J40 A;  1TZL A;  2K3P A;  4XR6 A;  3ZMD A;  1Y6I A;  2IS2 A;  5IP7 J;  4IEJ A;  2BY2 A;  1NK3 P;  4KDP A;  1J9I A;  5F0C A;  5KVR A;  1ERD A;  3G6E I;  2WWY A;  4JP0 A;  5TGT A;  3LSR A;  1R00 A;  4LK1 F;  2I10 A;  2VJJ A;  2DMU A;  2PJR A;  1QZZ A;  4B44 A;  3DBL B;  3E6B A;  3MCZ A;  2DQL A;  1BI2 A;  2M4K A;  3MN2 A;  4FQG A;  2NS7 A;  1B8I A;  4CCL A;  3CC7 I;  1FBQ A;  5AIP A;  3B02 A;  2DA7 A;  1MNE A;  3IC7 A;  1DDN A;  3DEW A;  1Y0U A;  4KA4 A;  3WTY C;  1HC8 A;  1P7J A;  3ECO A;  4ZYE A;  1BW5 A;  1MMD A;  4ZDO A;  1HW1 A;  3IH3 A;  4B47 A;  5IPA A;  2Y9Z A;  3S3M A;  1GT0 C;  2Y2Z A;  3JRI A;  1SAN A;  3BRO A;  4F7Z A;  4PDK A;  2ZCW A;  5J4Y A;  2F48 A;  3GTJ J;  3REO A;  4Q47 A;  4PGG A;  2VL8 A;  2GIZ A;  4GYG A;  1ZR4 A;  4HF2 A;  4L18 B;  1OPC A;  4M6X A;  3QYB A;  2FMY A;  2LK2 A;  1WPK A;  2ZJ2 A;  4MEX F;  1ETV A;  2EV5 A;  2VN2 A;  3BJA A;  3OOU A;  3WG9 A;  2GXB A;  3MKW B;  1FSH A;  2UXX A;  5LGT A;  4UUT A;  3BOQ A;  3GZN B;  1F36 A;  3K70 D;  1ACI A;  1Z91 A;  3TP0 A;  1G3T A;  1WFX A;  2DAO A;  4RLQ A;  3K69 A;  5J4V A;  1W5S A;  1W7P D;  4HDU A;  3BC8 A;  1T33 A;  2ZNZ A;  2VT3 A;  4AD9 A;  4Q4Z F;  1Z0X A;  3MEX A;  5EGO A;  4A0X A;  3IAS 2;  1UEL B;  4IXA A;  2HXO A;  1BOA A;  2BHZ A;  2HVR A;  1OQY A;  2ELH A;  2K7L A;  1G6N A;  3HOW J;  1XD7 A;  2ETH A;  3K2Z A;  4U0W A;  1Z77 A;  2EFO A;  2DTR A;  2VQL A;  4BL0 B;  5GTH C;  2LFB A;  1ODD A;  4XKB A;  3M7G A;  4E70 A;  2CRG A;  2EA2 A;  5LGU A;  3OYJ A;  2XGD A;  3QRF F;  2L54 A;  4ABZ A;  3PUF A;  1ENH A;  2EFN A;  4FIS A;  4GYI A;  4V2G A;  1OR7 C;  4ENM A;  1DUX C;  2XC7 A;  3RKY A;  4ENN A;  2V79 A;  2UWM A;  4U87 A;  1YJ9 I;  3P9K A;  3LA7 A;  1OYI A;  4FHT A;  5KAI C;  1X3U A;  2GM4 A;  1TQM A;  1FTZ A;  2P0W A;  3ONQ A;  3O8H A;  4HW0 A;  5F0F A;  3VOD A;  2CQ7 A;  5IOY A;  1U5T B;  5TRD A;  1PP7 U;  4IOA F;  2BYV E;  4WXC A;  2Y30 A;  3VFZ A;  3KET A;  4IHV A;  1L3L A;  5GAE J;  5DCF A;  2WV0 A;  2LKP A;  4ZZD A;  3CJN A;  4AC0 A;  1EA3 A;  1QU3 A;  1PYV A;  2PI0 A;  1KON A;  1R7J A;  1RI7 A;  2EV6 A;  3OS1 A;  4HNT A;  2NOJ B;  1HCR A;  3ROU A;  3OV8 A;  1Z05 A;  5K7Z A;  2V6E A;  1STZ A;  4RGU A;  1U8B A;  1SAX A;  3O2P E;  4CCK A;  2E2H J;  1IRG A;  1L0O C;  2ZBK A;  4UUS A;  2H27 A;  2NS8 A;  3EUA A;  2LVS A;  1UCR A;  4OIQ F;  4M71 A;  2HVS A;  3ABU A;  4DBR A;  1YJN I;  4CA0 A;  4L5E A;  1FOY A;  4QSH A;  3OL3 A;  4B43 A;  1S72 I;  2DPD A;  4F52 A;  3C3W A;  4PJL A;  2EZL A;  2Y9Y A;  4AID A;  3ZPL A;  5IT9 K;  4LFU A;  3CQZ J;  4O5V A;  2QM3 A;  1UZC A;  3QPL A;  1YRN B;  3BWG A;  4ZDP A;  3OYD A;  1WHU A;  1YLF A;  3MZ8 A;  3ZRG A;  1OCT C;  4I7H A;  3KP5 A;  3W3C A;  3CO7 C;  1V5G A;  1CGP A;  4C30 A;  2M4G A;  1ZN2 A;  3QAH A;  4E7Z A;  4UV9 A;  2M9H A;  2PMU A;  3PO2 J;  2VQH A;  2ZXJ A;  4P9F A;  3F22 A;  1G4D A;  1JHF A;  1FNN A;  3BG3 A;  4II2 A;  4YEJ A;  5H2F C;  4XLC A;  2LLK A;  2Y48 A;  4BY7 J;  1OR7 A;  2K27 A;  4ZDL A;  4AIH A;  5FLX K;  1JTY A;  1QQI A;  1K4T A;  2WAQ N;  4FX4 A;  2K40 A;  1WKM A;  2WC2 A;  5BMZ A;  3F3X A;  3B73 A;  3AFH A;  4BXF A;  2W57 A;  1MZB A;  3H9Q A;  3MKY B;  4XNF A;  1FZP B;  1TWH J;  1IC8 A;  4YFN F;  4NC8 A;  1JKR C;  2FNP A;  4IQJ A;  1XDS A;  2BY3 A;  2RVC A;  1QPM A;  1WJ5 A;  3QWL A;  2EZI A;  3OYB A;  1VQ5 I;  2QWW A;  3F8F A;  3HEF A;  4B48 A;  2R7U A;  5TIS C;  3TOB A;  4X1E A;  3DLA A;  3NRV A;  4PJN A;  1MMG A;  2DFH A;  2RNJ A;  1ZH5 A;  4GXO A;  1XX5 A;  3A01 A;  3B6C A;  4DZP A;  1IV8 A;  4F93 B;  3GBG A;  4E7H A;  1JUP A;  2FJ1 A;  2W24 A;  4XKC A;  1A6I A;  1N75 A;  4HNU A;  2ESN A;  3HIF A;  3CJT B;  4P5O A;  1H8A C;  1TQI A;  2IS6 A;  3WHB A;  4AU7 A;  1OFC X;  2FE3 A;  5J8C A;  2P4W A;  2DA1 A;  5FB2 A;  1U8R A;  1AHD P;  1B1B A;  2DXI A;  4WXD A;  3SYT A;  2O03 A;  3CCY A;  4Y17 A;  3ZQC A;  4RB3 C;  3F6V A;  2IGN A;  3FF5 A;  1RUO A;  4JX5 A;  4RBO A;  1XGN A;  3HSF A;  2CGP A;  3G3Z A;  4XID A;  3JRC A;  1R23 A;  4IRG A;  1JKO C;  4I01 A;  2MD5 A;  3WTW C;  4C3H J;  1IAW A;  3G73 A;  3AL0 C;  4A5N A;  1BJA A;  3BG6 A;  1IV6 A;  2A5W A;  5DD8 A;  3ZP5 A;  5CYV A;  3VDX A;  3ABM H;  3TQN A;  1T98 A;  3K2A A;  4EJW A;  1YW9 A;  3TW6 A;  2JVG A;  3LAP A;  2JJ7 A;  1H88 C;  3DU5 A;  3FMQ A;  1Y56 A;  1HA8 A;  1JT6 A;  3GFJ A;  2V1X A;  2MBF A;  2BOL A;  1MH3 A;  1B72 B;  2TDX A;  1EJ9 A;  1SMY F;  4IKF A;  3B6A A;  4PUS A;  4ZTJ A;  4E7J A;  3RCO A;  3HSR A;  3I59 B;  1SD6 A;  1D1C A;  4IHS A;  4W97 A;  3ZCO A;  3BTI A;  3AAF A;  2R7D A;  2EIK H;  4KMU X;  2PMZ N;  1MBF A;  2QUF A;  1VQM I;  1VFC A;  1SFE A;  1A04 A;  1XGO A;  4JQF A;  1FT9 A;  2CJJ A;  3FBN B;  3BTL A;  4I76 A;  5EYR A;  1ZR2 A;  4U0Y A;  4B8X A;  2C6Y A;  3CLO A;  1IRZ A;  3L2C A;  4G6Q A;  3ZXS A;  4BBR J;  1MND A;  4HDV A;  3CME I;  2D45 A;  1OCP A;  5FFZ A;  2KKO A;  4UY8 I;  1YIT I;  5DM6 F;  1OCZ H;  2JZY A;  3LMM A;  3OWT A;  3BJO A;  1QHH D;  2ZJQ F;  3T0Y A;  1V55 H;  4E7I A;  2DI3 A;  3RPU A;  1LFU P;  2A6T A;  3PM1 A;  4B3A A;  3HOZ J;  2HZT A;  1GHC A;  2QKL B;  5IYC J;  1YRN A;  2CYY A;  1J09 A;  3TL4 X;  2MG4 A;  3LA3 A;  1RNL A;  2DA3 A;  3BCB A;  3RQI A;  1GUU A;  3LWF A;  5M3F J;  3OOP A;  3OSF A;  2KZG A;  3J7A Y;  4HX7 A;  2YPR A;  2YX7 A;  4EAT A;  3IH4 A;  1RUN A;  3MKZ A;  2O6G E;  2VQG A;  4LIV A;  4A0Y A;  1EF4 A;  2DN0 A;  1X58 A;  1ZG3 A;  4ESJ A;  5JVT A;  1IO2 A;  3MKL A;  4LG0 A;  1MBK A;  5LGN A;  4XLE A;  3H9J A;  4V2F A;  2ZFU A;  1K4S A;  1BJZ A;  5HDG A;  3A1Y A;  1YW7 A;  1PJR A;  1YW8 A;  4NQW B;  1BC8 C;  2EV0 A;  4UNO A;  2STT A;  3V4G A;  3GCM A;  4CZZ A;  3JAM K;  2V4J C;  5H20 A;  2W82 A;  3IWF A;  2CQX A;  3DP7 A;  5EJC A;  4IRH A;  2E60 A;  2V9V A;  2DA4 A;  2KDZ A;  3OYH A;  1O7F A;  2BHY A;  2HKX A;  4BXX J;  2F4I A;  1KQ8 A;  2QGU A;  2LBF B;  1U6G A;  1XSX A;  3RI4 A;  2A05 A;  2P81 A;  1UST A;  2ZJR F;  4HNV A;  3JSO A;  4DJA A;  3HGY A;  4AUX A;  4IL6 C;  4NC6 A;  5JVG F;  3GW2 A;  2VXD A;  2CV1 A;  2DJN A;  2QYO A;  5FLV A;  1ZLJ A;  4JK1 X;  3SZG A;  4Z6Y A;  4UHT A;  2XF5 A;  4C2M J;  3CJR B;  1ZG1 A;  1R1V A;  1S9H A;  1R6R A;  4IPA A;  3WG7 H;  2XSJ C;  3BP8 A;  1OYY A;  3X2Q H;  5KHD A;  5K5R A;  2K9L A;  3N4M A;  1FOK A;  1HOM A;  2BVM A;  2XAG A;  5E17 F;  2QKM B;  4AIK A;  2LMD A;  4HA8 A;  2H8W A;  1MBJ A;  4DZJ A;  4ZYG A;  3ELK A;  3FXO A;  2LOO A;  1TT5 B;  2EIJ H;  1IN7 A;  2MAB A;  3BPV A;  3TO6 A;  2R5Y B;  2HNH A;  3HZJ A;  3U1K A;  2JQ7 A;  3E3V A;  4A6D A;  2W25 A;  2I5U A;  1BN5 A;  4EGY A;  3L2V A;  1I50 J;  3CTA A;  2EIL H;  1S3J A;  3KYL A;  2ID3 A;  3C2G A;  1JGS A;  2GOX B;  3DKW A;  1B4A A;  2V1N A;  1K78 B;  4UB6 C;  1DGW Y;  5L3B A;  4CUG A;  4BDY A;  5BPI A;  1N77 A;  2ELJ A;  4NB5 A;  4R1H A;  4A3B J;  4D9J A;  3R61 A;  3NAU A;  2XRL A;  2Z2S B;  3K1M A;  2E1M C;  5EZH A;  2DYR H;  4RMN A;  1B72 A;  3GTL J;  2XF7 A;  1R1T A;  2IVM A;  4JYK A;  4A3F J;  4HX8 A;  2GOM A;  1MDM B;  1JGG A;  1QGP A;  1NK2 P;  2H09 A;  2V1U A;  2E36 A;  2EFP A;  3JRD A;  5E1X A;  3IRR A;  1BIA A;  3BZK A;  2IGO A;  3ZMU A;  3JRA A;  2HQA A;  1R9T J;  3GTG J;  1R58 A;  1E2X A;  2VE8 A;  2HU9 A;  1MW7 A;  1SEU A;  3ZQF A;  2L2O A;  2XKP A;  2M87 A;  5LFA A;  4A0Z A;  1G3Y A;  1QPI A;  4GO1 A;  3VEP A;  3K4K A;  4BEH A;  3KE2 A;  2OUM A;  1XMX A;  5LBQ A;  5BOX A;  3CZ6 A;  2A6E F;  3HKZ A;  1JT0 A;  1W36 D;  4AM3 A;  2CFO A;  5ED4 A;  3DPU A;  3TDU C;  2ZJP F;  1IXS B;  1Z7U A;  4UVB A;  1U3E M;  2I8D A;  4D7N A;  3KP7 A;  5F04 A;  3FMS A;  5DEQ A;  2PBI A;  2DMN A;  1WH5 A;  2IJL A;  2K4B A;  5LRS A;  1LUJ B;  3S16 J;  1WRJ A;  2O8X A;  1YOV B;  1X1D A;  1PUE E;  4CYD A;  4C3J J;  3DKX A;  4Z2Y A;  2G9W A;  3FHN A;  1OCR H;  4V19 K;  1YX5 A;  5DCM B;  4XQF A;  2LR8 A;  4MLO A;  4BE2 A;  2XHK A;  2KPM A;  4HZF A;  2DFE A;  4XKV A;  3FX3 A;  1IUY A;  4LMY A;  5KAF C;  3BZ6 A;  3CCM I;  2M0C A;  4BS9 A;  3L7W A;  3HOY J;  3ERM A;  1KQ9 A;  2VBY A;  2JTV A;  1ZQ3 P;  4BHB A;  4I2O A;  1IXR C;  5DV5 A;  1BC7 C;  6PAX A;  4LIT A;  3IAM 2;  3BR5 A;  4IQ4 A;  3K6G A;  5ERI A;  2CQQ A;  2BZT A;  4L9J A;  3I9V 2;  3LOC A;  3LNQ A;  2GBY A;  3HOV J;  4LLG F;  2DW4 A;  1NHA A;  2VJI A;  1K61 A;  3FM5 A;  3KZY A;  3HGG A;  4KYW A;  2EFQ A;  2BV6 A;  1HW2 A;  2PLY A;  1YQA A;  1QVT A;  1ZGA A;  2F2E A;  2Y0M A;  2XAS A;  4XBF A;  2MYS A;  4CCJ A;  4Q48 A;  4EM2 A;  4EM1 A;  2FBI A;  4LJZ F;  3SXY A;  2WY7 Q;  5GTI C;  5A2Q Z;  1HDD C;  1IRX A;  5GAG J;  2FML A;  1U2W A;  2DT6 A;  2HR3 A;  1OLT A;  5L3F A;  1IZ1 A;  1BI0 A;  3S32 A;  2COB A;  2L7F P;  3SFI A;  3BR6 A;  3DTE A;  3FK7 A;  1F1Z A;  2AXT C;  3DEU A;  4G6T B;  5CQG A;  5LRR A;  1MSF C;  3JRH A;  2XGE A;  2LY2 A;  2MLG A;  3C18 A;  3RKX A;  1I39 A;  3CLQ A;  4RM3 A;  3PO3 J;  1BA5 A;  2GIV A;  2AHQ A;  2GXG A;  4L9T A;  4II3 A;  2A69 F;  4AVZ A;  5FGM A;  4I6Z A;  2QQA A;  3FIS A;  4D1Q A;  4Y52 J;  5CVU A;  1NTC A;  2F5E A;  3H0D A;  1E17 A;  4BE1 A;  2NXN B;  3S1M J;  1Z1D A;  1ZGJ A;  3SJM A;  3CUO A;  3GVA A;  3CC4 I;  1LVK A;  4B1R A;  1RPW A;  1J59 A;  3I56 I;  2ME6 A;  1H9T A;  1P2F A;  3D1N I;  4M74 A;  1E3O C;  1Z7L A;  2X85 A;  4A3G J;  2Q1Z B;  3NQO A;  2UXN A;  4N0B A;  3W6V A;  4WWC A;  2K85 A;  3H5N A;  5F1R A;  2CU7 A;  4M72 A;  1PDN C;  2KRH A;  3L1P A;  2H1K A;  4EJU A;  1T0F C;  3KZZ A;  5C4X J;  4LIU A;  5GPA A;  3HTS B;  1WVR A;  3C2H A;  5DUK A;  2W00 A;  2WAF A;  3T5X A;  1QRY A;  1G2H A;  1ETK A;  2LYC A;  3IKT A;  2PFB A;  3KFW X;  2FOK A;  2LF7 A;  3E1S A;  2GQQ A;  3OIP A;  2EA4 A;  1BI1 A;  2EIM H;  3BQY A;  3PQJ A;  3HTU A;  2XRN A;  2V6C A;  3VYS B;  1DQU A;  2E35 A;  4XK4 A;  2QQ9 A;  5DYM A;  3S17 J;  3QOP A;  4FX0 A;  1LDK B;  2JT1 A;  4UUV A;  2K9Q A;  4XM3 A;  3WTU C;  2QBY A;  2L9V A;  4G8X A;  2R7V A;  2L0K A;  2STW A;  1VQO I;  3HPH A;  4CHU A;  1DU6 A;  1E0E A;  2JPC A;  4DQ2 A;  1IN8 A;  1GVJ A;  4A3I J;  4W1U A;  3BR0 A;  1UG0 A;  1C0W A;  3ABT A;  4M3D A;  2XAQ A;  2RAE A;  9ANT A;  3F8N A;  3UKG A;  1XG1 A;  2PEX A;  5HS7 A;  3HXL A;  3D0S A;  2ZFW A;  3NWT A;  3WTV C;  2LSO A;  3K7A J;  2VOD A;  4OIO F;  3KP2 A;  1QO0 D;  1FIA A;  2OTJ I;  3V42 A;  2FD5 A;  1XSD A;  3PNY A;  5D5U B;  1ZRE A;  3OYF A;  4F55 A;  1O4X A;  4IHW A;  2DDA A;  2MH9 A;  5FKO A;  2GA2 A;  4RAZ A;  4KIG A;  5L3G A;  3CMA I;  4I09 A;  4HF0 A;  3E5U A;  3IH2 A;  3LSJ A;  2ESH A;  4XN0 A;  3F21 A;  4M9S A;  2OC6 A;  1F4K A;  4L0Z B;  1TT0 A;  3L2R A;  2XPU A;  5L3D A;  3LQR A;  2L9S A;  1GXP A;  1LDJ A;  3WOD F;  3ESW B;  2JA2 A;  3H3V K;  1UAA A;  3WGI A;  5TJJ A;  2A07 F;  4CZC A;  2Z1D A;  2HTS A;  1T0F A;  5HLT A;  1W7P A;  4PCQ A;  3PQK A;  1EV7 A;  2OQR A;  3MQ0 A;  2GWR A;  3G1L A;  3JW4 A;  4RAF A;  4FE4 A;  2V9P A;  1WCM J;  4HG2 A;  2WAE A;  3GYH X;  1SMT A;  4DYR A;  3PJR A;  1ZEL A;  5FKK A;  1IG7 A;  1TW2 A;  1OMI A;  3ZMS A;  1MNM C;  2XPV A;  3DXJ F;  1BR2 A;  3UR3 C;  4KUM A;  4MQ9 F;  2K4J A;  2CH0 A;  4QPO A;  2X1C A;  2D1V A;  1U9O A;  1SVL A;  2IPQ X;  3RIR A;  1BW6 A;  3G1O A;  4A69 C;  3HRM A;  2E1O A;  4ZTF A;  4HST A;  1R49 A;  4XOT A;  3N05 A;  2E2J J;  4HX4 A;  4UB8 C;  2KIQ A;  3DTI A;  5K7H A;  5E20 A;  1HW5 A;  4M3B A;  4KT5 C;  2O7O A;  2WA0 A;  4NHJ A;  1WH7 A;  3TW7 A;  2CQN A;  1A5J A;  3ZMZ A;  3RQ4 A;  3KPH A;  4XRF A;  3DWL E;  3H35 A;  2ICW G;  1CQT A;  1RET A;  2X6W A;  3OYK A;  3CCQ I;  1VQ8 I;  4RS8 A;  1W0T A;  1JE8 A;  5IY5 H;  1Z3Y A;  1IW7 F;  5LHG A;  4MO7 A;  1O3T A;  3K4N A;  5ILU A;  2QEX I;  4FCY A;  2RGV A;  5LD2 C;  1D1A A;  3G1M A;  3A0H C;  1Y1V J;  1ETX A;  2JA8 J;  2EQR A;  2Q2E A;  4GFB A;  2MFZ A;  3G2B A;  4BH9 A;  4LB5 A;  5GAH J;  5J1R A;  2KMU A;  1W5T A;  3JRF A;  3I3L A;  2P7C B;  2DMT A;  2IAI A;  2CW7 A;  5E3M A;  1JTX A;  2V7F A;  2R7X A;  4EMS A;  3OIO A;  2OD5 A;  1JXS A;  4YFX F;  1M1E B;  2HOA A;  2B0L A;  1MMS A;  5HDK A;  4ZYA A;  3QPH A;  1D5Y A;  1G3S A;  4BAY A;  1LKX A;  1JJ8 C;  4CH7 A;  5DUI A;  4U7D A;  2A6H F;  1SFX A;  3KLN A;  4EJO A;  5FKN A;  1VQK I;  2P5L C;  3I4N J;  2LKS A;  1Y39 A;  3GTM J;  2R7T A;  1S7O A;  2UZK A;  3RKQ A;  1K7A A;  3M1C A;  4OIR F;  3LSH A;  4CXF A;  1X1A A;  2NOG A;  3KP6 A;  2LD5 A;  3JTH A;  3QU3 A;  4MGR A;  1MSE C;  3EUK L;  3I71 A;  1U5T C;  3BDD A;  3WHC A;  3VWB A;  2JRM A;  2K9M A;  1LNW A;  1B9M A;  2XRO A;  3CCV I;  3BG7 A;  1QNT A;  3MZH A;  4E4H A;  4KIS A;  4HV6 A;  3GTQ J;  4BQQ A;  3HHG A;  3VPR A;  2LRE A;  3EUH A;  3HPG A;  3S8P A;  1JI8 A;  1TP4 A;  2BE5 F;  4XMY A;  4IRI A;  2ME0 A;  3VYR B;  2R5Z B;  5D5V B;  2X6X A;  3PFI A;  4KN7 X;  1YO5 C;  4P9U A;  2X51 A;  3KP4 A;  4LK0 F;  3DKY A;  1FMW A;  5A2Q K;  4WF2 A;  2KIU A;  4IJA A;  3WU0 A;  3J80 Z;  3L00 A;  4I0B A;  1U0J A;  2CUZ A;  4F91 B;  4HRI A;  3I64 A;  4K2E A;  3CUQ B;  2WB1 A;  5EEA A;  3R0J A;  4N9H A;  2FBK A;  3P9I A;  1LB2 A;  2VOO A;  1FLI A;  2L9N A;  2FNA A;  1TNS A;  1VQ7 I;  1IUF A;  5D8K B;  3R6S A;  2WBM A;  3NAR A;  4Y15 A;  5J8F A;  5BS6 A;  3FBI B;  4A12 A;  2R7Q A;  3GFI A;  4HEA 2;  2XVC A;  2VAS A;  1WQ2 A;  3CDL A;  3V7S A;  2JN6 A;  4IF4 A;  3L2U A;  5J3L A;  3L09 A;  5CJ9 A;  1T56 A;  3AG2 H;  4GDF A;  4J01 A;  5FFX A;  4IO9 F;  1D1B A;  1O3Q A;  3P9C A;  2RN7 A;  2UV1 A;  4X0G A;  1VI0 A;  4QWQ A;  5C4J J;  4D0P A;  3LFK A;  5EZG A;  3KCC A;  3KX2 A;  2IA0 A;  2CQK A;  1BBY A;  3BLY A;  1YE9 A;  2OCC H;  3IL2 A;  3TO9 A;  3LSG A;  3L2Q A;  4ENJ A;  3M07 A;  1RR7 A;  3SQN A;  1IDZ A;  2W84 A;  4HLY A;  4XOP A;  5BNG A;  1QVU A;  4R8H A;  4NBQ A;  5LLQ A;  2L7Z A;  2JUG A;  3ISP A;  1KGS A;  1LVA A;  1U5T A;  1HKQ A;  2O8K A;  2ZME B;  4AWX B;  4BE0 A;  2CMP A;  3CES A;  3WU2 C;  4EQQ A;  2DPU A;  2ZSI B;  3KIO A;  2H6C A;  3M8J A;  4MNU A;  3LSP A;  1KA8 A;  1D3Y A;  1YFH A;  2DK8 A;  3E6D A;  3CCR I;  1RC9 A;  5IP9 J;  4FE7 A;  1ZTR A;  1O57 A;  4BKX A;  4NDL A;  5JLW A;  3RDI A;  1W5C C;  1QHG A;  3RPQ A;  3H3U A;  4C2U A;  1P92 A;  2LNB A;  4WCG A;  2Z3Y A;  2R92 J;  1QA6 A;  5F6F A;  1MJA A;  3QPT A;  2CV0 A;  3CMM A;  1S29 A;  2M2E A;  4RGX A;  1ZG5 A;  2KJC A;  1RKT A;  3GWZ A;  3FM3 A;  4PJM A;  5KNL A;  5FRO A;  3SEZ A;  2VC1 A;  4DW6 A;  1LEB A;  1LDD A;  1VTN C;  3D5L A;  4JX6 A;  4XN3 A;  3ABL H;  3S3N A;  1RKW A;  2X1D A;  1TBX A;  3BCA A;  2HEO A;  1YI2 I;  2F5D A;  3F9K A;  1Z6T A;  2DFF A;  1CF7 B;  4HLX A;  1ZRF A;  2M0M A;  4M9Z A;  2GXA A;  5B1B H;  2K5C A;  3LL7 A;  4F92 B;  1ETY A;  4PGH A;  5KK1 A;  4CYC B;  3OMY A;  5HS9 A;  5E8G A;  2BGC A;  4IHX A;  1WJF A;  2L7M P;  1SD5 A;  4LLL A;  2ZXI A;  3RJP A;  1B6A A;  4YRV A;  4A3M J;  4NC7 A;  2GA1 A;  2ZME C;  1IXC A;  3RYR A;  1XMA A;  3KYD B;  4OOI A;  2L5Q A;  2F4M B;  2NVU B;  2ISZ A;  3GTP J;  1LFB A;  2YUS A;  3KLO A;  2OA4 A;  1FBU A;  2ZNY A;  4ZJZ A;  3J81 Z;  4EVI A;  1X1B A;  4UVC A;  1DPR A;  2KIF A;  5L3E A;  2VXZ A;  3W6K B;  2NS0 A;  2F5V A;  2M5W A;  3EDP A;  3TDZ C;  3ZQH A;  5M5W J;  2QVO A;  1FEX A;  4KMF A;  4BQN A;  2HDD A;  2UUZ A;  1SD7 A;  4S05 A;  1W36 C;  4XSX F;  2JA7 J;  2GZW A;  2FA5 A;  2PX9 A;  2NYX A;  2DLL A;  2D5V A;  4MHG A;  4LG3 A;  1E3H A;  3HBL A;  1YTY A;  2E71 A;  1ZRC A;  2R93 J;  2IGM A;  5DDG A;  2EH3 A;  2VKV A;  3H9G A;  3O8G A;  1XCV A;  3SDB A;  5J1U A;  4KIF A;  4RLF A;  3TMO A;  1X1C A;  4N4O B;  2DOA A;  1HKT A;  2PG4 A;  3HYI A;  1I1G A;  2O9L A;  4ON0 A;  2OTL I;  4LOC A;  1AOY A;  2QQB A;  4GRI A;  4HF1 A;  3OYC A;  5K7F A;  1P6R A;  2VLA A;  4LB6 B;  4P96 A;  3F23 A;  3K4C A;  4FET A;  2V1D A;  4MQV A;  4PJJ A;  2OPT A;  1XMK A;  4KIB A;  1NG7 A;  5J1Y A;  3SFZ A;  2EFW A;  2DDB A;  4KIC A;  1FBS A;  2OBP A;  3J7A O;  2HYF A;  4CGZ A;  1Y8R B;  2OV7 A;  4I02 A;  3GFL A;  2J5O A;  3ZMT A;  3GTK J;  3T8R A;  2DQR A;  1ON1 A;  4OAY A;  2FXA A;  2ZME A;  3A4C A;  3H5A A;  3HHH A;  1IN5 A;  5DTD A;  4RB0 A;  2MA3 A;  2KFD A;  3I59 A;  3Q0V A;  1OCC H;  2L7K A;  1N25 A;  3HL2 A;  3DF8 A;  2IGK A;  3ULQ B;  2BXY A;  2ECC A;  3KYC B;  1T6S A;  3O6B B;  5FD5 A;  2Y0S A;  1TWC J;  1GVD A;  4U7B A;  5CQE A;  1FIP A;  3G71 I;  2IEK A;  3BTJ A;  1NG6 A;  2FX0 A;  4CSW A;  1T39 A;  1KZH A;  3OYA A;  3JCU C;  1Z6R A;  2QZ8 A;  4MTE A;  5HOD A;  2XAH A;  2MH2 A;  5CLS A;  4H0E A;  1YIO A;  1T2K A;  2PMH A;  4A3K J;  1PP8 F;  3H5R A;  3HG9 A;  4XL9 A;  2NRA C;  1RR8 C;  1X4O A;  3PUB A;  3FXJ A;  2CS3 A;  3CCJ I;  1DPU A;  2RNG A;  2Y0S N;  3DQV C;  1ZYR F;  3PNV A;  2A3S A;  3ABK H;  3FIW A;  5D8L B;  4DYC A;  2KIM A;  3HUG B;  5JR3 A;  1ZLK A;  5GP9 A;  3J7Y J;  1BI3 A;  2GAU A;  1HXD A;  1I3Q J;  1J5Y A;  1VQ9 I;  5DD4 A;  2QSF X;  4I98 B;  3W2W A;  3ZQI A;  2PJR B;  2A61 A;  2LH9 A;  3HKZ N;  1MH4 A;  4RM2 A;  4LD5 A;  2HS5 A;  2K9S A;  4PZJ A;  2EZH A;  3CF5 F;  3WGG A;  1CF7 A;  5F08 A;  2VQC A;  1WJA A;  2VE9 A;  5IOZ A;  1B8I B;  1R4M B;  2YR2 A;  3TP3 A;  1VQL I;  3I0T A;  4CYC A;  5HLG A;  3OYE A;  1Q1H A;  1WJB A;  4YG2 F;  1AU7 A;  3OIQ A;  1V4R A;  5ICC A;  4NQW A;  1TC3 C;  1IRF A;  1VND A;  1K6Y A;  3O3K A;  3OS2 A;  3CD6 I;  2JVH A;  3RYP A;  5IT9 Z;  4LGW A;  2G7H A;  5LEJ A;  3DLL F;  3RSN A;  4A3D J;  3JSP A;  1KQ0 A;  4YII A;  2TCT A;  3FXK A;  2M1B A;  3TBI A;  4IHY A;  2W4S A;  3Q9S A;  3M9A A;  2EZK A;  2MD0 A;  4Y4R A;  3RZD J;  3D5R C;  1UB9 A;  2O3F A;  2QF7 A;  1UG2 A;  3E5Q A;  2LBF A;  1F43 A;  3TO7 A;  2D1H A;  5LHI A;  1SC7 A;  1EH8 A;  4XSZ F;  1OIS A;  3GZ5 A;  4CDG A;  3F72 A;  1FJL A;  1VQN I;  2E5N A;  4RB2 C;  1FX7 A;  1PUF B;  3EYI A;  5GPC A;  2VT2 A;  3W2V A;  2QEN A;  1TWF J;  5F0H A;  1MKM A;  2HPI A;  3KZI C;  1O3R A;  2PN6 A;  3OSG A;  4P55 A;  5DM7 F;  2CFX A;  5CVV A;  1R22 A;  2FUG 2;  2LRD A;  5AON A;  5FRN A;  3QYF A;  3QOD A;  4D5C A;  2EJR A;  2HWV A;  4O3M A;  4ESB A;  4AIJ A;  2ZC2 A;  3F8M A;  5EGO B;  5EF6 A;  3JRB A;  2DT7 B;  3JR9 A;  2R5Y A;  2DK5 A;  2Q0O A;  5E18 F;  4XRS A;  1DP7 P;  2YX4 A;  1XSV A;  3Q3S A;  3D5S C;  2ZKZ A;  5C44 J;  2NVX J;  1J7K A;  1FPQ A;  4RA2 A;  2HOT A;  4L9V A;  3HRT A;  1IN4 A;  5EG0 B;  3S2D J;  2IT0 A;  1K78 A;  3RZO J;  4QPQ A;  2OF7 A;  4XLH A;  2QCO A;  3GUD A;  4G12 A;  4M3G A;  3ZOB A;  2K3F A;  2QA4 I;  2FQ3 A;  3IWZ A;  1G59 A;  3SHF A;  3HSE A;  3CCL I;  3K70 C;  3FKI J;  2VB6 A;  5E1Z B;  2XKO A;  3CJQ B;  4IVN A;  3OY9 A;  2AXL A;  2LKX A;  4OMZ A;  4S0H B;  5E3O A;  1SAU A;  1AA7 A;  3CF2 A;  2BVL A;  1H89 C;  1MDM A;  2O5R A;  2EPF A;  4PFO A;  4C3I J;  4OWR B;  1APL C;  1BR1 A;  1F9N A;  3EPZ A;  2BW3 B;  3FDY A;  3GFM A;  4A2U A;  5IYD J;  2AS5 F;  1KYZ A;  2DOF A;  1NH3 A;  2KP6 A;  3V7R A;  4B09 A;  3PIO F;  2R7S A;  1FOX A;  2CUJ A;  1GLN A;  2MC3 A;  2QSH X;  3H3Z A;  5CVR A;  3SEQ A;  2X4H A;  2CV2 A;  5HLI A;  3TGN A;  3F8C A;  2LG4 A;  4UUS B;  3BTC A;  1U78 A;  1QZY A;  1UFM A;  2MLK A;  2HYJ A;  2VOP A;  2F5F A;  2P8T A;  4HQM A;  1S7E A;  1WI9 A;  3MD2 A;  1I6H J;  2WV1 A;  4A3L J;  5FKM A;  5IT3 A;  1UHM A;  3H1C A;  1WJC A;  3K10 A;  5FLM J;  3COA C;  1HST A;  3PSI A;  2B7E A;  4G7O F;  3S2W A;  1J0R A;  2DU9 A;  3P7N A;  4BYY A;  4PJ0 C;  2K86 A;  3HUG A;  1B9N A;  1VF9 A;  5E79 C;  2P5K A;  1ZGW A;  3ECH A;  3P5J A;  3MVP A;  4D5F A;  4HPQ A;  1P7I A;  3HJE A;  1UJ8 A;  3ZN0 A;  2Z33 A;  3J81 K;  2W1O A;  4BQA A;  3VOE A;  5FKL A;  1Z3X A;  3HOS A;  1IDY A;  3VYT B;  2R7F A;  3G4S I;  3GLX A;  5DCM A;  2IA2 A;  1U9N A;  3M4O J;  1A6Q A;  4E7S A;  3GX4 X;  2ID6 A;  3K1P A;  1K79 A;  3CDH A;  2WY8 Q;  3K9T A;  2P7V B;  3K4L A;  4A3J J;  3ZMV A;  2X1E A;  1G3W A;  5D6E A;  2FBH A;  1R5I D;  2WAD A;  4E7L A;  1MJB A;  2P6T A;  1R5G A;  1SFK A;  5F1J A;  3J7Z I;  2VKE A;  3K0L A;  3ZGK A;  1IN6 A;  1ORK A;  3WTT C;  3S1R J;  2X6O A;  2HZD A;  4HAM A;  3IUO A;  4JX4 A;  1P4X A;  1TW3 A;  5CVJ A;  2NNY A;  3LA2 A;  2NAZ A;  1FC3 A;  2JK3 A;  4BHC A;  3I55 I;  3PL8 A;  1D0X A;  3K1N A;  5H6Q A;  4IX7 A;  2G7U A;  2RRE A;  3EQL F;  1V5F A;  3N97 A;  3L9F A;  4KNY A;  2YU3 A;  2XSD C;  2IS1 A;  2XDV A;  4WX9 A;  2HQR A;  3PIP F;  4EV0 A;  1E3P A;  4C9Y A;  1FMV A;  4RGR A;  1POG A;  4CCN A;  1PUF A;  2XGC A;  4UV8 A;  1TWG J;  3A01 B;  2QLZ A;  3DU6 A;  3JAM Z;  4RAG A;  4M3F A;  1ZRD A;  3E6M A;  1XPX A;  1PVE A;  4G6D A;  1D0Z A;  5EEH A;  5F64 A;  2OQG A;  2LF8 A;  2ZXW H;  4MIM A;  1I5Z A;  2BY0 A;  3E5X A;  2XUB A;  3I54 A;  1OKR A;  1P4W A;  2XB0 X;  3WGH A;  1O3S A;  4CCM A;  4AYB A;  1TQP A;  4FT8 A;  4BAC A;  3M8F A;  2DA6 A;  4G7Z F;  2P5V A;  2NNN A;  5EG0 A;  3AKZ A;  1BIB A;  3EUH C;  1ETO A;  1D8K A;  2VBX A;  1XS9 A;  2VJ4 A;  4HSR A;  1LQ1 A;  2M8G X;  4CO8 A;  2HVQ A;  2D2W A;  4RB1 A;  4I0A A;  2R7O A;  4G94 A;  3U1D A;  1KU3 A;  3VYU B;  2KRF A;  3DBH B;  1VQP I;  5CKT A;  3BG9 A;  4BXU A;  1MJ9 A;  2R7W A;  4BUP A;  4B4C A;  2XPW A;  5EDN A;  4AYB N;  3KP3 A;  1HLV A;  1F5T A;  3OL4 A;  1K6O A;  4PK4 A;  4ITV A;  5LEK A;  1YIJ I;  2DYS H;  1XGS A;  3WTX C;  1SFU A;  4YIR X;  2BW3 A;  4TV7 A;  3GZ6 A;  3H92 A;  2W48 A;  4XRM A;  4BQO A;  2B9S A;  3R60 A;  1V54 H;  4A3C J;  3QPS A;  1GXQ A;  3W6J B;  3VB2 A;  2O0Y A;  3M8E A;  5KCM A;  3LSI A;  2JWT A;  1VQ6 I;  4YIF A;  1S8N A;  1W4M A;  2VBZ A;  1JHH A;  2FF4 A;  3F6O A;  2OZU A;  3LSK A;  2JRT A;  1XCB A;  5HOO A;  1D8J A;  3Q9V A;  3BPX A;  1K83 J;  1S5L C;  1LEA A;  3ZQQ A;  1XDU A;  5FD6 A;  4GGG A;  2XAU A;  2YSR A;  1DP3 A;  1FYM A;  1KU9 A;  2IP2 A;  1IF1 A;  2MC4 A;  2R7R A;  1YHQ I;  2R0Q C;  5IYB J; 
#chains in the Genus database with same CATH homology
 4HYE A;  5K1Y A;  2OU2 A;  3IRQ A;  2Q8K A;  4U0V A;  1ONV A;  5FO5 A;  3MAJ A;  4OMY A;  3M1E A;  1R36 A;  1I6X A;  1ZAO A;  2VC0 A;  5E1W A;  3T1B A;  2RQP A;  4LG0 B;  3CO6 C;  5K5Q A;  4KFC A;  2XIG A;  1TTY A;  5BQT A;  4G7H F;  3BY6 A;  3R0A A;  3ML6 A;  2A5Y B;  3Q5F A;  4R79 A;  3DPL C;  4YFK F;  3I58 A;  2M45 A;  3HRU A;  2A68 F;  4OIP F;  2HYG D;  4BNC A;  2HKO A;  3DFG A;  3IHU A;  3I4P A;  3RKW A;  4HOB A;  2RKH A;  2PQ8 A;  3MWM A;  3FZV A;  3V8K A;  2CWE A;  1OYW A;  3RTR A;  2K02 A;  2ZO4 A;  2EK5 A;  2XGX A;  1HQC A;  1AWC A;  2VBW A;  3WE3 A;  4ESF A;  2XV4 S;  1KYW A;  1KU7 A;  5ICF A;  3QP5 A;  4L0Y B;  5CVI A;  4ZYH A;  3FXR A;  4L5I A;  2FSW A;  3WTS C;  4GCV A;  3E6C C;  3CUQ C;  2E7W A;  4ASN A;  1XGM A;  5ILS A;  5K5O A;  1I1S A;  1HSJ A;  2KJB A;  4OU0 A;  3TOA A;  3LQQ A;  2EWN A;  2HFH A;  1MD0 A;  5EEG A;  2IA1 A;  5BPD A;  4LLN A;  2O61 A;  5ICE A;  2Z5U A;  2JSC A;  5HVQ C;  1MGT A;  3V8L A;  2JPB A;  2DBB A;  5H6R A;  5D4S A;  1FYK A;  3WE2 A;  1UHW A;  5ICG A;  4ZZL A;  5JFR A;  1H0M A;  2OAZ A;  1WSU A;  3ZQ7 A;  3WTZ A;  2ACJ A;  2P6S A;  4ETS A;  3QU6 A;  1FYL A;  4UXN A;  4JBA A;  2COM A;  1ZHF A;  3ERE D;  2J5P A;  2XAF A;  2L4M A;  1FSE A;  4KN4 X;  4MEY F;  4Y13 A;  1ON2 A;  5HS8 A;  4EGZ A;  1HKS A;  1EH6 A;  3JTG A;  3NEU A;  1LJ9 A;  1WWX A;  3EET A;  5AIQ A;  3TKY A;  1FP2 A;  2HDC A;  4UVA A;  5D4R A;  4AVP A;  4ZH4 F;  2ISY A;  1S7A A;  3CUQ A;  4XLN F;  1RZ4 A;  2IRF G;  1O7L A;  2R3S A;  4DNC A;  2M8E A;  2W85 A;  3F8B A;  3QP6 A;  2LDU A;  1P4A A;  1T38 A;  2CW0 F;  2E1N A;  4QLC U;  1R1U A;  1R5H A;  1J75 A;  2HGC A;  3I5U A;  1TNT A;  3C7J A;  5L3C A;  3GXO A;  3U2R A;  3DV8 A;  3I53 A;  1S6L A;  2VON A;  5D5X B;  2ADU A;  3FXQ A;  5JI6 A;  2FRH A;  5J6X A;  4U88 A;  2L4A A;  2CSO A;  4EJV A;  4M6Y A;  2H94 A;  1SD4 A;  3T8T A;  1V3F A;  3LST A;  3BJ6 A;  3V7C A;  3E97 A;  3LAJ A;  4RAY A;  4CIC A;  1XB4 A;  2Y75 A;  2BEO A;  4S04 A;  2E1C A;  2L01 A;  4Q5S F;  2PJP A;  1D5V A;  1QBJ A;  5D5W B;  4M73 A;  2RC4 A;  2QBY B;  2CO5 A;  3ZN1 A;  1B59 A;  3WU1 B;  4HV5 A;  3U9G A;  4EJT A;  5HDN A;  3SZT A;  3SZP A;  2HQN A;  2L3D A;  4A6E A;  5JHU A;  3J80 K;  1USS A;  2HTJ A;  3EYY A;  3MFK A;  4HQE A;  1H9G A;  3C1D A;  3KEQ A;  2F5C A;  3MZY A;  3GEZ A;  2L02 A;  1EH7 A;  1FY7 A;  2CG4 A;  3HOT A;  2RDP A;  3IKV A;  2EB7 A;  4O6J A;  2BBY A;  5ILV A;  1J2X A;  1FWZ A;  1ULY A;  2FU4 A;  1XN7 A;  2DT5 A;  5FLX Z;  4ZYD A;  1YG2 A;  3FXU A;  4ENK A;  1W7P B;  1TLH B;  1FP1 D;  1KU2 A;  1I27 A;  2Z9O A;  2XAJ A;  3HRS A;  2H6B A;  4XLP F;  2RV8 A;  4IHT A;  4A5M A;  3GO5 A;  1YYV A;  1YS7 A;  1RIO H;  3FWE A;  4BHP A;  4OIN F;  1BM9 A;  2OZ6 A;  4RGS A;  4G9Y A;  4HBL A;  4L9N A;  5LHH A;  1REP C;  5HLH A;  5D6F A;  4MTD A;  4WK8 F;  2FEZ A;  3V8J A;  2X0L A;  2DO7 A;  1HBX G;  4M9X A;  4WXH A;  3KEO A;  2M30 A;  2WTE A;  3FMR A;  5E8I A;  4N9I A;  2Z99 A;  3R4K A;  1Z9C A;  2HOE A;  3DPT A;  4EM0 B;  1YS6 A;  1ZAR A;  3GF2 A;  2DFI A;  3FHZ A;  2E7X A;  2IW5 A;  4L5J A;  3ZMD A;  4KDP A;  1J9I A;  5KVR A;  2WWY A;  1R00 A;  4LK1 F;  1QZZ A;  3E6B A;  3MCZ A;  2DQL A;  1BI2 A;  1FBQ A;  5AIP A;  3B02 A;  1DDN A;  3IC7 A;  1Y0U A;  4KA4 A;  3WTY C;  3ECO A;  4ZYE A;  1HW1 A;  3BRO A;  4F7Z A;  4PDK A;  2ZCW A;  3REO A;  4Q47 A;  4PGG A;  4GYG A;  4HF2 A;  4L18 B;  1OPC A;  4M6X A;  2FMY A;  2ZJ2 A;  4MEX F;  2EV5 A;  2VN2 A;  3BJA A;  3WG9 A;  2GXB A;  1FSH A;  2UXX A;  5LGT A;  3BOQ A;  1Z91 A;  1G3T A;  2DAO A;  3K69 A;  1W5S A;  1W7P D;  4HDU A;  2ZNZ A;  2VT3 A;  4AD9 A;  4Q4Z F;  3MEX A;  4A0X A;  4IXA A;  1BOA A;  2ELH A;  2K7L A;  1G6N A;  1XD7 A;  2ETH A;  3K2Z A;  4U0W A;  2EFO A;  2DTR A;  1ODD A;  3M7G A;  4E70 A;  2EA2 A;  5LGU A;  3QRF F;  2L54 A;  2EFN A;  4GYI A;  4ENM A;  1DUX C;  3RKY A;  4ENN A;  2V79 A;  2UWM A;  3P9K A;  3LA7 A;  1OYI A;  4FHT A;  1X3U A;  1TQM A;  4HW0 A;  3VOD A;  1U5T B;  5TRD A;  1PP7 U;  2BYV E;  4WXC A;  3VFZ A;  3KET A;  1L3L A;  5DCF A;  2WV0 A;  2LKP A;  4ZZD A;  3CJN A;  2PI0 A;  1R7J A;  1RI7 A;  2EV6 A;  3ROU A;  3OV8 A;  1Z05 A;  1STZ A;  4RGU A;  1SAX A;  3O2P E;  1IRG A;  1L0O C;  2ZBK A;  2H27 A;  1UCR A;  4OIQ F;  4M71 A;  3ABU A;  2DPD A;  3C3W A;  3ZPL A;  5IT9 K;  4LFU A;  4O5V A;  2QM3 A;  3BWG A;  1YLF A;  4I7H A;  3KP5 A;  3CO7 C;  1CGP A;  1ZN2 A;  3QAH A;  4UV9 A;  2PMU A;  2ZXJ A;  4P9F A;  3F22 A;  1G4D A;  1JHF A;  1FNN A;  2Y48 A;  1OR7 A;  2K27 A;  4AIH A;  5FLX K;  1QQI A;  4FX4 A;  1WKM A;  2WC2 A;  5BMZ A;  3F3X A;  3B73 A;  2W57 A;  1MZB A;  1FZP B;  4YFN F;  2FNP A;  1XDS A;  2RVC A;  1QPM A;  2QWW A;  3F8F A;  3TOB A;  3NRV A;  2RNJ A;  1ZH5 A;  4GXO A;  2W24 A;  2ESN A;  3HIF A;  4P5O A;  1TQI A;  2FE3 A;  5J8C A;  2P4W A;  5FB2 A;  1U8R A;  1B1B A;  4WXD A;  2O03 A;  4Y17 A;  4RB3 C;  3F6V A;  3FF5 A;  1RUO A;  1XGN A;  3HSF A;  2CGP A;  3G3Z A;  1R23 A;  4IRG A;  4I01 A;  2MD5 A;  3WTW C;  1IAW A;  3G73 A;  4A5N A;  1BJA A;  5DD8 A;  3ZP5 A;  5CYV A;  3TQN A;  1T98 A;  4EJW A;  1YW9 A;  3LAP A;  3FMQ A;  3GFJ A;  2V1X A;  2MBF A;  2TDX A;  1SMY F;  3HSR A;  3I59 B;  1SD6 A;  4IHS A;  3AAF A;  2R7D A;  4KMU X;  2QUF A;  1SFE A;  1A04 A;  1XGO A;  4JQF A;  1FT9 A;  4U0Y A;  4B8X A;  2C6Y A;  3CLO A;  3L2C A;  4G6Q A;  4HDV A;  2D45 A;  5FFZ A;  2KKO A;  2JZY A;  3BJO A;  3T0Y A;  2DI3 A;  3RPU A;  2HZT A;  1GHC A;  2CYY A;  3LA3 A;  1RNL A;  3LWF A;  3OOP A;  4HX7 A;  2YPR A;  2YX7 A;  1RUN A;  2O6G E;  4A0Y A;  1ZG3 A;  4ESJ A;  5JVT A;  4LG0 A;  5LGN A;  5HDG A;  1YW7 A;  1YW8 A;  1BC8 C;  2EV0 A;  4UNO A;  2STT A;  3V4G A;  4CZZ A;  3JAM K;  5H20 A;  3IWF A;  3DP7 A;  4IRH A;  2V9V A;  1O7F A;  2HKX A;  1KQ8 A;  1U6G A;  1XSX A;  3RI4 A;  1UST A;  3JSO A;  3GW2 A;  2QYO A;  1ZLJ A;  4JK1 X;  4UHT A;  1ZG1 A;  1R1V A;  4IPA A;  3BP8 A;  1OYY A;  5K5R A;  3N4M A;  1FOK A;  2XAG A;  5E17 F;  4AIK A;  4HA8 A;  4ZYG A;  3ELK A;  3BPV A;  1IN7 A;  3TO6 A;  3E3V A;  4A6D A;  2W25 A;  1BN5 A;  4EGY A;  3CTA A;  1S3J A;  1JGS A;  3DKW A;  1B4A A;  1K78 B;  5L3B A;  5BPI A;  4NB5 A;  4R1H A;  3R61 A;  3K1M A;  1R1T A;  2IVM A;  1MDM B;  4HX8 A;  1QGP A;  2H09 A;  2V1U A;  2EFP A;  5E1X A;  3IRR A;  1BIA A;  3ZMU A;  1R58 A;  1E2X A;  2VE8 A;  2XKP A;  2M87 A;  4A0Z A;  1G3Y A;  4GO1 A;  3VEP A;  3KE2 A;  5LBQ A;  5BOX A;  2A6E F;  5ED4 A;  3TDU C;  1IXS B;  1Z7U A;  4UVB A;  1U3E M;  3KP7 A;  3FMS A;  5DEQ A;  2PBI A;  2IJL A;  2K4B A;  5LRS A;  1WRJ A;  2O8X A;  1PUE E;  4CYD A;  4Z2Y A;  2G9W A;  5DCM B;  2XHK A;  4HZF A;  3FX3 A;  1IUY A;  4LMY A;  3BZ6 A;  3L7W A;  1KQ9 A;  2VBY A;  2JTV A;  4I2O A;  4BHB A;  6PAX A;  1IXR C;  5DV5 A;  1BC7 C;  5ERI A;  4L9J A;  4LLG F;  2DW4 A;  1NHA A;  3FM5 A;  3KZY A;  4KYW A;  2EFQ A;  2BV6 A;  1HW2 A;  2PLY A;  1YQA A;  2F2E A;  1ZGA A;  2Y0M A;  2XAS A;  4XBF A;  4EM1 A;  4Q48 A;  4EM2 A;  2FBI A;  4LJZ F;  3SXY A;  5A2Q Z;  2FML A;  1U2W A;  2HR3 A;  5L3F A;  1IZ1 A;  1BI0 A;  5LRR A;  1F1Z A;  3DEU A;  3C18 A;  2MLG A;  3RKX A;  2GIV A;  2GXG A;  4L9T A;  2A69 F;  5FGM A;  2QQA A;  5CVU A;  2F5E A;  1E17 A;  1Z1D A;  1ZGJ A;  3CUO A;  3GVA A;  1J59 A;  1H9T A;  1P2F A;  4M74 A;  3NQO A;  2UXN A;  4N0B A;  4WWC A;  5F1R A;  4M72 A;  1PDN C;  4EJU A;  3KZZ A;  3HTS B;  5DUK A;  3T5X A;  3IKT A;  2PFB A;  3KFW X;  2FOK A;  2LF7 A;  2GQQ A;  2EA4 A;  1BI1 A;  3PQJ A;  3HTU A;  2XRN A;  2V6C A;  2QQ9 A;  5DYM A;  3QOP A;  4FX0 A;  1LDK B;  2JT1 A;  4UUV A;  2QBY A;  3WTU C;  4G8X A;  2STW A;  4CHU A;  2JPC A;  4DQ2 A;  1IN8 A;  1GVJ A;  1C0W A;  3ABT A;  2XAQ A;  3F8N A;  2PEX A;  5HS7 A;  3D0S A;  2ZFW A;  3WTV C;  2LSO A;  2VOD A;  4OIO F;  3KP2 A;  1QO0 D;  1XSD A;  5D5U B;  1ZRE A;  2MH9 A;  2GA2 A;  4RAZ A;  4KIG A;  5L3G A;  4I09 A;  4HF0 A;  3E5U A;  2ESH A;  3F21 A;  4M9S A;  1F4K A;  4L0Z B;  5L3D A;  3LQR A;  1GXP A;  1LDJ A;  3WOD F;  3WGI A;  5TJJ A;  2A07 F;  2HTS A;  1T0F A;  1W7P A;  4PCQ A;  3PQK A;  1EV7 A;  2OQR A;  3MQ0 A;  2GWR A;  3JW4 A;  3GYH X;  1SMT A;  1TW2 A;  1OMI A;  3ZMS A;  3DXJ F;  4KUM A;  4MQ9 F;  2K4J A;  2D1V A;  2IPQ X;  3RIR A;  3HRM A;  4HX4 A;  5E20 A;  1HW5 A;  4KT5 C;  4NHJ A;  3ZMZ A;  4XRF A;  4RS8 A;  1JE8 A;  1IW7 F;  5LHG A;  1O3T A;  5ILU A;  2RGV A;  2Q2E A;  4BH9 A;  4LB5 A;  1W5T A;  2P7C B;  4EMS A;  2OD5 A;  1JXS A;  4YFX F;  2B0L A;  5HDK A;  3QPH A;  1G3S A;  4BAY A;  5DUI A;  4U7D A;  2A6H F;  1SFX A;  3KLN A;  4EJO A;  2P5L C;  1S7O A;  2UZK A;  1K7A A;  4OIR F;  4CXF A;  3KP6 A;  3JTH A;  3QU3 A;  4MGR A;  3I71 A;  1U5T C;  3BDD A;  1LNW A;  1B9M A;  2XRO A;  1QNT A;  3MZH A;  4HV6 A;  3HHG A;  3EUH A;  4IRI A;  2BE5 F;  5D5V B;  3PFI A;  4KN7 X;  1YO5 C;  4P9U A;  3KP4 A;  4LK0 F;  5A2Q K;  4WF2 A;  2KIU A;  4IJA A;  3WU0 A;  3J80 Z;  3L00 A;  4I0B A;  3I64 A;  4K2E A;  3CUQ B;  3R0J A;  4N9H A;  2FBK A;  3P9I A;  1LB2 A;  2VOO A;  1FLI A;  2FNA A;  1TNS A;  5D8K B;  3R6S A;  4Y15 A;  5J8F A;  5BS6 A;  4A12 A;  3GFI A;  2XVC A;  1WQ2 A;  3V7S A;  4IF4 A;  3L09 A;  5CJ9 A;  5FFX A;  1O3Q A;  3P9C A;  2RN7 A;  4QWQ A;  4D0P A;  3LFK A;  3KCC A;  2IA0 A;  2CQK A;  1BBY A;  3IL2 A;  3TO9 A;  4ENJ A;  3SQN A;  2W84 A;  4HLY A;  4R8H A;  5LLQ A;  3ISP A;  1KGS A;  1LVA A;  1U5T A;  1HKQ A;  2ZME B;  4AWX B;  4EQQ A;  2DPU A;  2H6C A;  4MNU A;  1KA8 A;  1D3Y A;  1YFH A;  2DK8 A;  3E6D A;  1O57 A;  3RDI A;  3RPQ A;  3H3U A;  1P92 A;  2LNB A;  4WCG A;  2Z3Y A;  5F6F A;  1MJA A;  3QPT A;  1S29 A;  4RGX A;  1ZG5 A;  2KJC A;  3GWZ A;  3FM3 A;  2VC1 A;  1LEB A;  1LDD A;  1VTN C;  3D5L A;  1TBX A;  2HEO A;  2F5D A;  1Z6T A;  1CF7 B;  4HLX A;  1ZRF A;  4M9Z A;  5KK1 A;  4PGH A;  5HS9 A;  5E8G A;  2BGC A;  4LLL A;  1SD5 A;  3RJP A;  1B6A A;  2GA1 A;  3RYR A;  1IXC A;  1XMA A;  4OOI A;  2ISZ A;  3KLO A;  2OA4 A;  1FBU A;  2ZNY A;  3J81 Z;  4EVI A;  4UVC A;  1DPR A;  2KIF A;  5L3E A;  2VXZ A;  3W6K B;  2NS0 A;  2M5W A;  3EDP A;  3TDZ C;  2QVO A;  4KMF A;  4S05 A;  1SD7 A;  4XSX F;  2GZW A;  2FA5 A;  2NYX A;  2DLL A;  4MHG A;  1YTY A;  1ZRC A;  5DDG A;  1XCV A;  4KIF A;  1HKT A;  2PG4 A;  3HYI A;  1I1G A;  4ON0 A;  1AOY A;  2QQB A;  4HF1 A;  1P6R A;  4LB6 B;  4P96 A;  3F23 A;  2V1D A;  4MQV A;  1XMK A;  4KIB A;  3SFZ A;  2EFW A;  4KIC A;  1FBS A;  2OBP A;  3J7A O;  2HYF A;  4CGZ A;  4I02 A;  3GFL A;  2J5O A;  3ZMT A;  3T8R A;  2DQR A;  1ON1 A;  2FXA A;  2ZME A;  3HHH A;  1IN5 A;  4RB0 A;  2MA3 A;  3I59 A;  3DF8 A;  3ULQ B;  1T6S A;  3O6B B;  5FD5 A;  4U7B A;  1T39 A;  1Z6R A;  2QZ8 A;  4MTE A;  2XAH A;  2MH2 A;  5CLS A;  4H0E A;  1YIO A;  1T2K A;  2PMH A;  1PP8 F;  2NRA C;  1DPU A;  3DQV C;  1ZYR F;  1ZLK A;  2A3S A;  5D8L B;  2KIM A;  5JR3 A;  1BI3 A;  2GAU A;  1HXD A;  1J5Y A;  5DD4 A;  4I98 B;  2A61 A;  4LD5 A;  2HS5 A;  4PZJ A;  3WGG A;  1CF7 A;  2VE9 A;  2YR2 A;  3I0T A;  5HLG A;  1Q1H A;  4YG2 F;  1V4R A;  5ICC A;  4NQW A;  1IRF A;  3O3K A;  3RYP A;  5IT9 Z;  4LGW A;  2G7H A;  5LEJ A;  3JSP A;  1KQ0 A;  4YII A;  2M1B A;  3Q9S A;  3M9A A;  1UB9 A;  2O3F A;  3E5Q A;  3TO7 A;  2D1H A;  5LHI A;  1EH8 A;  4XSZ F;  3GZ5 A;  4CDG A;  3F72 A;  4RB2 C;  1FX7 A;  3EYI A;  2VT2 A;  2QEN A;  1MKM A;  1O3R A;  2PN6 A;  4P55 A;  2CFX A;  5CVV A;  1R22 A;  5AON A;  2EJR A;  2HWV A;  4O3M A;  4ESB A;  4AIJ A;  3F8M A;  2DK5 A;  2Q0O A;  5E18 F;  1DP7 P;  2YX4 A;  1XSV A;  2ZKZ A;  1J7K A;  1FPQ A;  4L9V A;  3HRT A;  1IN4 A;  2IT0 A;  1K78 A;  3GUD A;  2FQ3 A;  3IWZ A;  3SHF A;  3HSE A;  5E1Z B;  2XKO A;  4IVN A;  2AXL A;  4OMZ A;  1MDM A;  1F9N A;  3GFM A;  4A2U A;  2AS5 F;  1KYZ A;  3V7R A;  4B09 A;  2MC3 A;  3H3Z A;  5CVR A;  2X4H A;  5HLI A;  3TGN A;  3F8C A;  1U78 A;  1QZY A;  1UFM A;  2MLK A;  2VOP A;  2F5F A;  2P8T A;  4HQM A;  1WI9 A;  5IT3 A;  1UHM A;  3COA C;  1HST A;  4G7O F;  3S2W A;  1J0R A;  2DU9 A;  3P7N A;  4BYY A;  2K86 A;  3HUG A;  1B9N A;  2P5K A;  3ECH A;  2Z33 A;  3ZN0 A;  3J81 K;  4BQA A;  3VOE A;  3HOS A;  2R7F A;  3GLX A;  5DCM A;  2IA2 A;  3GX4 X;  3K1P A;  1K79 A;  3CDH A;  3K9T A;  2P7V B;  3ZMV A;  1G3W A;  5D6E A;  2FBH A;  1MJB A;  2P6T A;  1R5G A;  3K0L A;  1IN6 A;  3WTT C;  4HAM A;  1P4X A;  1TW3 A;  5CVJ A;  2NNY A;  3LA2 A;  2NAZ A;  1FC3 A;  4BHC A;  3K1N A;  5H6Q A;  2G7U A;  3EQL F;  3N97 A;  3L9F A;  4KNY A;  2YU3 A;  4WX9 A;  2HQR A;  4EV0 A;  4RGR A;  4UV8 A;  2QLZ A;  3JAM Z;  1ZRD A;  3E6M A;  4G6D A;  5EEH A;  5F64 A;  2OQG A;  2LF8 A;  1I5Z A;  3E5X A;  2XUB A;  3I54 A;  1OKR A;  1P4W A;  3WGH A;  1O3S A;  1TQP A;  4FT8 A;  3M8F A;  4G7Z F;  2P5V A;  2NNN A;  1BIB A;  1D8K A;  2VBX A;  1LQ1 A;  4CO8 A;  2D2W A;  4RB1 A;  4I0A A;  4G94 A;  3U1D A;  1KU3 A;  2KRF A;  4BXU A;  1MJ9 A;  3KP3 A;  1F5T A;  1K6O A;  5LEK A;  1XGS A;  3WTX C;  1SFU A;  3GZ6 A;  4TV7 A;  3H92 A;  3R60 A;  1GXQ A;  3W6J B;  3VB2 A;  2O0Y A;  3M8E A;  4YIF A;  1S8N A;  1W4M A;  2VBZ A;  1JHH A;  2FF4 A;  3F6O A;  2OZU A;  2JRT A;  1XCB A;  5HOO A;  1D8J A;  3Q9V A;  3BPX A;  1LEA A;  1XDU A;  5FD6 A;  4GGG A;  2YSR A;  1FYM A;  1KU9 A;  2IP2 A;  1IF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...