3JW4A

The structure of a putative marr family transcriptional regulator from clostridium acetobutylicum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
123
Chain Sequence
DTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYENQESGIIQKDLAQFSITSMLQGLEKKGYIERRKNIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQKQLMSILIKVNRSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a putative MarR family transcriptional regulator from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR/EmrR family
total genus 42
structure length 123
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jw4A00
2MBFA 5DEQA 1W7PB 2XAJA 3E6MA 1RIOH 4CXFA 1KYZA 3F8MA 4EV0A 3IWZA 1PP8F 4WX9A 1LJ9A 2RC4A 1LDJA 1R7JA 4A0ZA 4EM1A 5D5WB 4IPAA 1SAXA 1ONVA 3T0YA 2RN7A 1QPMA 3L9FA 2EK5A 4A5NA 4EVIA 4BNCA 2TDXA 3K9TA 3JAMZ 1DP7P 1FY7A 5LRRA 2L54A 1BM9A 1KYWA 4ESJA 3WTTC 4YFXF 1T39A 1MJAA 2EA2A 2VT2A 5TJJA 4A12A 1OPCA 4PCQA 2Z5UA 2Q8KA 2WWYA 4R8HA 1QQIA 1FBSA 2QLZA 1E2XA 3WTSC 4N9HA 3W6JB 3QAHA 2BGCA 4MTDA 4A2UA 1HKTA 5J8FA 1XN7A 2FNAA 3BDDA 3K1NA 2RNJA 4GO1A 4WXDA 4AWXB 3GW2A 5CVIA 2JZYA 1OYYA 1XMKA 1B6AA 3RPQA 3BPVA 1BI2A 5CYVA 3TKYA 3GFJA 4UVCA 1ZLKA 3WTZA 1JHHA 5HOOA 3LSTA 4N0BA 3DKWA 1ZRFA 1QNTA 1ZRDA 5DUIA 5FFXA 1FYKA 1FNNA 3QU6A 2JSCA 2BEOA 3HOSA 4RGUA 4KICA 2QENA 2XIGA 5D6EA 3WTWC 2J5OA 2LKPA 5HVQC 1KQ8A 1T38A 1YW7A 2A61A 1Z7UA 2CSOA 4G7ZF 2W85A 1ZREA 1W7PA 4ESFA 3SXYA 3KZZA 2P6TA 3F6VA 3V4GA 1OYIA 1WI9A 2L02A 3ULQB 5F1RA 5L3EA 3GZ6A 1TW3A 2ZBKA 5KK1A 3HRUA 4HYEA 4XLNF 2ELHA 2GZWA 3JTGA 2PG4A 3QPTA 3TOAA 4CO8A 2V1DA 2RVCA 2IJLA 4WK8F 3V8LA 3SZPA 2X0LA 3I54A 1G4DA 4IRGA 1Q1HA 2VBYA 3F23A 2ZKZA 2KIUA 2DTRA 4EJUA 2IA1A 5ICEA 3KLOA 1YTYA 2V1UA 2QBYB 3PFIA 5IT3A 3SQNA 3OV8A 1IN8A 4KMFA 4WCGA 3GFLA 2HGCA 1YIOA 2NNNA 4OINF 4U0WA 1J75A 4M72A 3U9GA 1SMTA 3MEXA 5D5UB 2HDCA 4PGGA 3CUQA 3VB2A 4D0PA 1QGPA 2M87A 2PFBA 4PZJA 5LRSA 5CVJA 5DDGA 1G3WA 3V8JA 2XAQA 5FB2A 5JFRA 2EFOA 2PQ8A 4DNCA 5ED4A 1HSJA 2A68F 3K1PA 4RB1A 3KZYA 2DPUA 5DYMA 1KU2A 4TV7A 5FLXK 3V7RA 2XAGA 1U3EM 3KP6A 5H20A 2EV0A 2ZO4A 1D3YA 1I1SA 4LG0A 2STTA 2Y48A 4AIHA 1XGSA 3P7NA 1W4MA 2FU4A 2VN2A 1YO5C 2IA0A 3R0AA 3WGGA 3R4KA 2XRNA 3DQVC 3RYPA 1K6OA 3FXUA 1P4XA 1U5TA 3HSRA 5DCFA 5L3GA 4G6DA 4I2OA 2M30A 4FX4A 4KN4X 3F22A 1REPC 1P4WA 4LLGF 3CJNA 2YX7A 4ZH4F 3MAJA 5BS6A 1ZGAA 5HS9A 1O57A 1P92A 5E8GA 3KP7A 4NB5A 1ON1A 2ESHA 4IRHA 3FHZA 4I01A 2P4WA 1BJAA 2IVMA 4HW0A 2OQRA 4S05A 4U0VA 1GXPA 4U0YA 4AIJA 1DPUA 1KA8A 1FYLA 3E6BA 5D4RA 2GQQA 1JGSA 3R60A 1S8NA 3J81K 2DAOA 2KJBA 3GO5A 5LHIA 1FPQA 4M6YA 3ABTA 3RYRA 3F21A 2O0YA 3J7AO 3WTVC 4I0BA 5EEGA 2XHKA 2P7VB 2RDPA 4RB0A 4KDPA 1O3RA 4YFKF 3VODA 1U78A 1MZBA 2ZNYA 4U7BA 5H6RA 1IAWA 3IL2A 4ENKA 2XKPA 4LMYA 2RV8A 4RS8A 1R5GA 3J81Z 3V7SA 3HUGA 3KP3A 1OYWA 3M8EA 1UHMA 2F5FA 2LF7A 4WXHA 1V3FA 3B73A 4KT5C 3PQJA 2OA4A 5ILSA 4IHTA 4O6JA 1R23A 2K4BA 2YX4A 3ZN0A 2WV0A 4HQMA 3WODF 1O7FA 2H94A 1YW8A 4S04A 2PMHA 3TOBA 3GLXA 3ZMTA 1IN7A 2FBKA 4G8XA 2VC1A 2PMUA 4EJOA 5FD6A 5HLHA 4L0YB 5HLGA 4BYYA 2D1VA 3KP5A 3V7CA 4LB6B 1K79A 1EH6A 2BYVE 2C6YA 2D1HA 4M73A 4IF4A 1KU7A 3TDUC 2FE3A 1LQ1A 1B9MA 4RB2C 1ZG1A 5IT9K 3R61A 1O3QA 3NRVA 2HEOA 1WSUA 2VBZA 2EFWA 2VBWA 2BBYA 3D5LA 3RI4A 5LGUA 1ZRCA 4GYGA 5ICFA 4ENNA 3OOPA 4KNYA 2FRHA 4UV8A 4LK1F 1T2KA 4ZYDA 2OZUA 3HIFA 3G73A 2CG4A 4HQEA 1BI3A 2DW4A 4HA8A 2QVOA 2ZJ2A 2Z3YA 2GWRA 2OAZA 2YU3A 4G7HF 2WC2A 2DK8A 1ZG5A 2VE8A 2IPQX 1XD7A 4YFNF 1Z1DA 5CJ9A 4O3MA 4MTEA 2JT1A 2JPCA 1FBQA 3J80Z 4L9VA 1IXRC 2MA3A 1IF1A 2DBBA 4EJVA 1Z6TA 2JTVA 1TQPA 3DFGA 4Y15A 3HRTA 3KCCA 2VXZA 5IT9Z 5E1ZB 1PDNC 4KMUX 2XAFA 3GWZA 4L5JA 3GFMA 2FBHA 3HSEA 3I59A 4YIFA 2X4HA 3CUQB 3BP8A 3D0SA 5K5RA 5AIPA 2DQRA 5LGNA 2GIVA 4OIQF 1UB9A 2FMYA 4HX4A 1GHCA 3REOA 1R1UA 2MH9A 3RTRA 4WXCA 5HDKA 2R7DA 3BJ6A 3L2CA 2V1XA 4CICA 4Y13A 3P9IA 3Q9SA 1P2FA 2M8EA 4MNUA 4GCVA 3ZMZA 2ISYA 4KIGA 3E5XA 4EGYA 2L4MA 5D4SA 4BXUA 2LDUA 1YW9A 2H6BA 1IXCA 2VE9A 2DFIA 2Q0OA 3E5UA 2PN6A 2HWVA 2D2WA 2ZFWA 4M71A 1W5SA 2ESNA 3N4MA 4IVNA 1U5TC 2QQ9A 1P6RA 4XLPF 2FNPA 1HKQA 3MWMA 1R58A 3BJAA 2LSOA 2XASA 2A07F 3MZYA 1TNTA 2MLKA 3COAC 2GA1A 4XSXF 1I27A 5F64A 4HF1A 1O7LA 1U5TB 4WWCA 1R36A 2ADUA 1LDKB 2P5KA 3IWFA 2HQNA 2MD5A 4FT8A 3B02A 1B9NA 1IW7F 1TBXA 1J0RA 2J5PA 4HLXA 1SFUA 5LHHA 2CFXA 3WGIA 3E97A 1OKRA 1SD7A 3P9CA 3WG9A 5CVRA 3QP5A 3I4PA 4Q5SF 2YR2A 4BAYA 1TQMA 1TTYA 1UHWA 3HRMA 2ZCWA 3I71A 5D6FA 1FYMA 1XDUA 2FXAA 1QZYA 1KU3A 4MQ9F 4ON0A 2QUFA 2HQRA 5AONA 1SMYF 3GFIA 1UCRA 3CO6C 1B1BA 3QU3A 2HKXA 4GXOA 2NNYA 1QO0D 5LEJA 4MEYF 2O03A 2ZMEB 2VONA 2A6EF 1T6SA 2VT3A 3MZHA 1U6GA 5JHUA 2MC3A 1R22A 1GVJA 4UUVA 4KIBA 4EMSA 2LNBA 2EV5A 4HZFA 3ZMVA 2CGPA 3GYHX 4Q47A 1T0FA 3RKWA 4NHJA 3FWEA 3C3WA 5F6FA 5ILVA 1HSTA 2E1NA 4EM2A 1J5YA 2F5DA 3M7GA 4R79A 1YYVA 3LQRA 4LLLA 1AWCA 2A3SA 1MD0A 2GAUA 4OOIA 3ELKA 3HHGA 4UVAA 4WF2A 1L3LA 5LEKA 5LLQA 3RJPA 3IKTA 4LD5A 3EQLF 2V6CA 2R3SA 1D5VA 3ZQ7A 3R6SA 3VFZA 3KEOA 4BHBA 1IUYA 4M9SA 3LAPA 2H09A 3QOPA 2KIFA 4H0EA 4QWQA 1J59A 3O3KA 5J6XA 1LEBA 2QYOA 1YS7A 3SFZA 1TW2A 2HOEA 3I53A 5E18F 3TO6A 2W25A 3F8NA 2UWMA 2YPRA 5D5XB 3L00A 4P5OA 2ETHA 1J9IA 4G9YA 4E70A 4JQFA 1P4AA 4ENMA 1Z9CA 2DPDA 2A5YB 4LLNA 2IRFG 4O5VA 2CW0F 3ERED 3K0LA 4ZZLA 3WU0A 1XSDA 5FD5A 2FF4A 5D8LB 3FMRA 2QQBA 3JAMK 4UVBA 5L3BA 4LJZF 1LDDA 2HTSA 1WKMA 2E7XA 2UZKA 3AAFA 4IJAA 4LB5A 3RKXA 3C18A 4LGWA 5FLXZ 1GXQA 1B59A 2L3DA 2HTJA 2B0LA 4EGZA 4HV5A 2D45A 1I5ZA 5HS8A 2H6CA 2DI3A 2ACJA 2A69F 1F4KA 4KYWA 1S7OA 1IN6A 3FM3A 4A6EA 2P8TA 1LNWA 2GXBA 1WQ2A 2XVCA 5JI6A 2A6HF 5DD8A 2P6SA 4ZYHA 3ZMUA 3L09A 1OMIA 1D8JA 5TRDA 4ETSA 4KFCA 1IRFA 2XAHA 3IC7A 3DPTA 1QZZA 1Z6RA 4L5IA 4YG2F 3PQKA 1UFMA 2EB7A 5L3FA 3LWFA 1EH7A 3GF2A 2IT0A 5ICCA 1XGNA 3DF8A 3LQQA 2KKOA 3F8BA 1SD6A 4UXNA 4U7DA 1S7AA 2KIMA 4A5MA 1BI0A 1F1ZA 3E5QA 2O3FA 1QBJA 2XROA 4ESBA 4HLYA 5E17F 4ENJA 1MDMB 2PI0A 5HLIA 3LA2A 1K78B 1FOKA 2FSWA 3T8RA 2W24A 4AIKA 1O3TA 1BC8C 1J2XA 4B8XA 1ZAOA 1PUEE 3KEQA 2UXXA 2Y75A 4ZYEA 2NS0A 2K7LA 2OZ6A 1FLIA 1S3JA 3HTSB 4R1HA 1F9NA 4UHTA 1XGOA 1G3SA 2M1BA 3QPHA 3EUHA 1YLFA 4HV6A 3ROUA 1OR7A 3WTYC 1A04A 4AD9A 2PBIA 4RB3C 4Q48A 1D8KA 3Q5FA 1XSVA 1PP7U 2FQ3A 1IXSB 3FZVA 3QP6A 3T5XA 2VOPA 1U2WA 1Z91A 3CDHA 3H3UA 2CO5A 3R0JA 1XMAA 3BZ6A 4CGZA 2M45A 3QRFF 4GGGA 2P5LC 1S29A 3O6BB 3VOEA 4G94A 2PLYA 3G3ZA 1HBXG 1XCVA 3GVAA 4EQQA 3BOQA 4RGSA 3C7JA 1SFEA 3W6KB 2CYYA 4A6DA 5AIQA 4OIOF 4OMYA 3IRRA 5BQTA 3FXRA 3GZ5A 3BY6A 3RDIA 1FWZA 1DDNA 4MHGA 1FSHA 2ZNZA 3P9KA 4HAMA 2LF8A 2ZMEA 4BHCA 5K5OA 3L7WA 3RKYA 3KE2A 1BOAA 4K2EA 2CQKA 1KGSA 4ASNA 1R5HA 2F5EA 2E7WA 2EFQA 1STZA 5JVTA 2V79A 3K2ZA 5ICGA 3RPUA 2VOOA 4XBFA 2NAZA 2P5VA 3LAJA 1MDMA 4I0AA 1BN5A 1ULYA 2EWNA 4HF0A 5FO5A 4ZYGA 4M9ZA 1TQIA 3V8KA 1MJ9A 3GEZA 3ISPA 4LG0B 5E8IA 5DUKA 3WE2A 2Y0MA 1XCBA 3E6DA 2H27A 1RZ4A 4CZZA 4KN7X 4I02A 4Y17A 2DT5A 3M8FA 2Z9OA 2QWWA 2VC0A 4UV9A 4OU0A 1WWXA 2K27A 2FBIA 4HX7A 4ZZDA 3LA7A 2EA4A 5CVUA 5FFZA 1SFXA 1I1GA 4M9XA 1CF7A 4N9IA 2RQPA 1R1TA 2FMLA 3ZPLA 2EV6A 1EV7A 3H3ZA 3CO7C 5DV5A 3MCZA 4RAZA 4HX8A 3TGNA 1DPRA 4FX0A 3NEUA 4EM0B 4M6XA 3VEPA 3I58A 4QLCU 3TQNA 1FSEA 1HW5A 4OMZA 1H9TA 6PAXA 3GUDA 3CUOA 2CWEA 3FXQA 3BJOA 3K1MA 2FA5A 3ZMSA 1G3YA 5ERIA 3TO9A 2Z99A 1R1VA 4KIFA 1J7KA 1H0MA 3H92A 3FMSA 2NRAC 2O61A 3HRSA 3SZTA 4CDGA 3WTXC 3I59B 5FGMA 3U2RA 4I98B 4KUMA 1TNSA 2EFNA 5HS7A 4P55A 2JRTA 1FZPB 3EYYA 3JSOA 3CUQC 2EFPA 5LGTA 4CYDA 2AXLA 1YG2A 2O8XA 5K5QA 1FT9A 3I64A 4UNOA 3ZN1A 2VODA 1MGTA 3M1EA 2XV4S 1O3SA 2P7CB 3EETA 3ABUA 4F7ZA 4IHSA 4RGXA 1YQAA 5LHGA 5BOXA 4P96A 1BIAA 1HQCA 2QM3A 1F5TA 2F5CA 3WTUC 2STWA 1R00A 2G7HA 2HS5A 1T98A 3I0TA 4PDKA 2IW5A 1FBUA 3F8FA 2OQGA 4HBLA 3BROA 2WTEA 5E1WA 3F6OA 5JR3A 5L3DA 4RAYA 1JXSA 3F3XA 3KFWX 4HF2A 1XSXA 3T1BA 2ZXJA 4U88A 1XDSA 2K86A 5E20A 1JE8A 2HZTA 2F2EA 4BHPA 5HDGA 2O6GE 3ML6A 2L4AA 1HXDA 4MQVA 3DXJF 4MGRA 2M5WA 2HR3A 3TO7A 3T8TA 1CGPA 1ZLJA 3GX4X 1U8RA 4M74A 1G6NA 2E1CA 1HW2A 1Y0UA 5ILUA 4YIIA 3ZP5A 2ISZA 2Z33A 4EJTA 3NQOA 2R7FA 1VTNC 2DO7A 2KJCA 2K02A 4P9FA 1IRGA 3ECHA 2Q2EA 2MH2A 4GYIA 3HYIA 2QZ8A 3SHFA 2PJPA 3J80K 1JHFA 1XGMA 4EJWA 1E17A 3E3VA 4XRFA 1X3UA 1ON2A 2QQAA 1MJBA 4IXAA 3N97A 5LBQA 2AS5F 2RGVA 4CHUA 2NYXA 2DU9A 3IKVA 3HSFA 3RIRA 4JK1X 3U1DA 5BPIA 1C0WA 3S2WA 2QBYA 2DLLA 3CTAA 3M9AA 1IN5A 1CF7B 3LFKA 1Z05A 1TLHB 5DCMA 4LFUA 4DQ2A 4LK0F 3JW4A 3KP4A 1HW1A 4L9TA 1SD5A 4HDVA 3E6CC 3O2PE 4Q4ZF 3BWGA 3IHUA 4KA4A 4OIRF 4MEXF 1RUOA 3C1DA 4L18B 3TDZC 3MQ0A 1BI1A 2MLGA 2PEXA 5EEHA 3LA3A 5BMZA 1USSA 2BE5F 4G7OF 5D8KB 3Q9VA 3KLNA 3JTHA 1FP1D 2HYGD 2G9WA 2IA2A 1W7PD 3DPLC 3HTUA 4AVPA 5L3CA 4JBAA 2COMA 1KU9A 2L01A 5DCMB 1K7AA 2HFHA 3ZMDA 1K78A 3FM5A 1ZN2A 4L9NA 2FEZA 5J8CA 2XUBA 1BIBA 1WRJA 4NQWA 5KVRA 3IRQA 1KQ9A 1FX7A 2GA2A 2HKOA 1B4AA 5CLSA 3ECOA 4FHTA 1ZH5A 4I7HA 3MFKA 3BPXA 1LB2A 1ZYRF 4P9UA 1L0OC 2W57A 1XB4A 4HOBA 3HOTA 1I6XA 1V4RA 5HDNA 4I09A 4L9JA 1ODDA 2OU2A 1W5TA 3DP7A 1FP2A 1FC3A 1ZGJA 5H6QA 1ZG3A 4HDUA 3KP2A 1SD4A 1KQ0A 2W84A 1AOYA 1IN4A 1RNLA 5E1XA 3EDPA 3GXOA 3WU1B 4G6QA 3FX3A 5BPDA 4IRIA 3I5UA 5A2QK 1EH8A 1NHAA 1RUNA 1H9GA 5CVVA 2OBPA 1MKMA 3WE3A 2V9VA 4OIPF 1S6LA 2GXGA 2BV6A 5A2QZ 2VBXA 1IZ1A 1DUXC 3JSPA 1BBYA 2G7UA 3KETA 3CLOA 3WGHA 1ZHFA 2KRFA 4RGRA 2XGXA 2EJRA 1G3TA 3K69A 2DQLA 3HHHA 3F72A 4PGHA 2K4JA 2FOKA 2JPBA 3FMQA 1YFHA 4BQAA 5D5VB 2HYFA 4BH9A 2IP2A 3DV8A 1ZARA 5K1YA 4A0YA 3F8CA 5DD4A 1RI7A 1LEAA 4XSZF 1HKSA 2YSRA 3EYIA 2XKOA 2UXNA 1LVAA 1USTA 2OD5A 3FF5A 4A0XA 3DEUA 4Z2YA 1BC7C 2DK5A 2RKHA 4L0ZB 1YS6A 4B09A
chains in the Genus database with same CATH superfamily
2MBFA 2VQHA 3IV5A 3CC2I 5DEQA 1W7PB 2XAJA 1S7EA 3E6MA 1RIOH 1R49A 5DS9A 3BR2A 4CXFA 4C3IJ 1VQ4I 5EYRA 1KYZA 3F8MA 4E7LA 3CDLA 2B7EA 3E0JB 4EV0A 3IWZA 1PP8F 4WX9A 2CUJA 2M34A 1QU3A 5FKMA 1LJ9A 2RC4A 3LSRA 1LDJA 2CMPA 1R7JA 4A0ZA 4BE2A 4EM1A 5D5WB 4IPAA 1SAXA 1ONVA 3MN2A 3T0YA 3LL7A 2RN7A 1QPMA 3L9FA 4YEJA 4D7MA 5J40A 2Y69H 4XORA 3MKZA 5CQEA 2EK5A 1TWCJ 2I10A 5LD2C 2E5ZA 4M3FA 1I3AA 4RAGA 4M3BA 4A5NA 4EVIA 4BNCA 2TDXA 3K9TA 3JAMZ 2KLOA 1FY7A 1YE9A 1DP7P 5LRRA 2M4GA 1BL0A 2E2HJ 2O7OA 2L54A 1BM9A 1KYWA 4ESJA 1IRXA 4C30A 4YFXF 3WTTC 1T39A 3DBHB 5FJ8J 2COBA 2HPIA 1MJAA 2EA2A 2VT2A 5TJJA 4A12A 1PUFB 3H3VK 4OWRB 5GP9A 1OPCA 4PCQA 3L2UA 2AQFA 2Z5UA 2Q8KA 1DGRM 2WWYA 1D1BA 4R8HA 2VIXA 1SFKA 1QQIA 2JVGA 2R7QA 2X6OA 1FBSA 3SFIA 2QLZA 3FIWA 2IAIA 1E2XA 3WTSC 3DTIA 3VYUB 4CUGA 4N9HA 3W6JB 1B8IB 3QAHA 3DTEA 2IS1A 5TISC 3JRBA 2BGCA 2KRCA 4MTDA 1T95A 2XPUA 1TT0A 4A2UA 1LFPA 1JKPC 4PUSA 3PNVA 1HKTA 5J8FA 1XN7A 2FNAA 3BDDA 3K1NA 1ETYA 2RNJA 4GO1A 4WXDA 2V9KA 4AWXB 1X58A 3GW2A 4D5CA 1HC8A 2IXSA 5CVIA 1HF0A 2JZYA 3X2QH 1OYYA 1XMKA 3PO3J 1B6AA 1WJDA 3RPQA 3BPVA 3HBLA 1X19A 2VUMJ 1YRNA 1BI2A 5CYVA 3TKYA 3GFJA 4UVCA 4J00A 1ZLKA 3WTZA 5KCMA 5K7HA 1JHHA 5HOOA 5GTHC 3M3YJ 3DEEA 1HOMA 2L5QA 5E3OA 3DLLF 3LSTA 4N0BA 3L2QA 3BLYA 3DKWA 1ZRFA 4XOTA 1FOXA 1QNTA 2IGKA 1ZRDA 4D9JA 5DUIA 1ERDA 3CZ6A 5FFXA 1FYKA 5C4XJ 4XRSG 1FNNA 3QU6A 2JSCA 4JX4A 2BEOA 3IH3A 3HOSA 4RGUA 3GTKJ 1I6HJ 4KICA 5F0HA 3GTLJ 3OYAA 3ZQFA 1JJ6C 2QENA 2XIGA 5D6EA 3WTWC 2J5OA 2LKPA 5HVQC 1KQ8A 4X6AJ 3BG7A 1T38A 1A6QA 1QA6A 1YW7A 2A61A 1Z7UA 2CSOA 1ZTRA 4G7ZF 2W85A 3CLQA 1Y8RB 1NH3A 1ZREA 1W7PA 4ESFA 4UY8I 2DCEA 3C2BA 4AM3A 3SXYA 3DU5A 1TT5B 2WB1A 3KZZA 4BBSJ 1VQLI 2P6TA 3OL4A 2EQRA 3F6VA 3V4GA 3CMYA 4I6ZA 1OYIA 1GDTA 1WI9A 2L02A 3ULQB 5F1RA 4ZC3A 5L3EA 3GZ6A 1TW3A 4B3AA 2ZBKA 5KK1A 2DFFA 3HRUA 4HYEA 4XLNF 3TEDA 1P7JA 1T56A 2ELHA 2GZWA 3JTGA 3ZQLA 2PG4A 4NC8A 1LE8A 4M3EA 3QPTA 4AU7A 3TOAA 5B5EC 2X1CA 2MSYA 2DYRH 2Y2ZA 4CO8A 1WJ5A 2V1DA 3K4BA 2HOSA 2RVCA 2R7TA 2IJLA 3DLAA 4WK8F 2IS6A 2LK2A 2X51A 1TWHJ 3HJEA 4RM2A 1ZR4A 3HKZA 1WGXA 1QZEA 1H89C 1MBHA 2R0QC 3AL0C 3QYBA 5FROA 2CS3A 1K4SA 3V8LA 1E3OC 3SZPA 2X0LA 3I54A 1G4DA 1OCPA 3SYTA 3BG3A 1Q1HA 4IRGA 2VBYA 3TP3A 2LBFB 3F23A 2ZKZA 2KIUA 4FISA 3GZNB 2CV0A 4YIRX 2M3AA 2JUCA 2DTRA 3H35A 4EJUA 3OS2A 3VYSB 2IA1A 4CYCB 4A3MJ 2VPRA 3KLOA 5ICEA 1YTYA 2ELJA 3AKZA 2V1UA 4H4KC 3HB9A 2QBYB 3PFIA 5IT3A 3SQNA 4C2MJ 2R7WA 2FUG2 1WHUA 3GBGA 3OV8A 2N8GA 3ABMH 1HDDC 1IN8A 4KMFA 4WCGA 2HDWA 2HGCA 1RKTA 3GFLA 1YIOA 2NNNA 2DMNA 2VKEA 4DYQA 3LOCA 1J09A 1RESA 4OINF 4U0WA 4IQJA 1J75A 4M72A 2QGUA 2VQCA 2V26A 3U9GA 3CQZJ 1SMTA 1WH7A 3MEXA 4BKXA 5D5UB 4PGGA 2HDCA 3CUQA 3VB2A 2XF6A 2GIZA 5FLMJ 5FKKA 4D0PA 1QGPA 1Z21A 2M87A 2PFBA 1IRZA 4PZJA 5LRSA 5CVJA 4PSXA 5DM7F 2LR8A 5EG0A 4XM3A 5DDGA 1G3WA 1IDZA 3NWTA 3U1KA 2OUMA 3V8JA 2XAQA 5FB2A 3HKZN 4IHXA 5JFRA 2EFOA 2VI6A 2BOLA 1GVDA 2PQ8A 4DNCA 5ED4A 2JUGA 1HSJA 2A68F 3K1PA 4RB1A 2HOAA 3KZYA 1MNDA 2WAFA 5DTDA 2NXNB 1KU2A 4TV7A 5DYMA 3VPRA 4E7SA 2DPUA 5FLXK 1N75A 2V9PA 3CJQB 4LOCA 3V7RA 3MKWB 3BG6A 2IS2A 2LLKA 5M3FJ 3B6CA 2XAGA 2EZHA 4B3XA 2DDAA 4BACA 2CV2A 1U3EM 3KP6A 5H20A 2EV0A 2ZO4A 1D3YA 3JCUC 5J1UA 3G4SI 1IV6A 2LY9A 1JTYA 3RZDJ 3C2GA 3MZ8A 1I1SA 4LG0A 2XGDA 4XKCA 2STTA 3MD2A 2Y48A 3U21A 1ETXA 4AIHA 1XGSA 1LKXA 3J7ZI 3P7NA 1W4MA 2FU4A 5GPCA 2VN2A 2JA7J 1VZ0A 3DBRB 2L0KA 1FIPA 1OQYA 1YO5C 2IA0A 4NNJA 3R0AA 3WGGA 3R4KA 4CCJA 2XRNA 3DQVC 3Q3SA 3RYPA 4A3DJ 2XPWA 1W0TA 1K6OA 3FXUA 1Z67A 2ID6A 1W36C 1P4XA 4JX6A 4KITB 2DA3A 2K9SA 2P0WA 4I76A 1U5TA 3HSRA 5DCFA 5L3GA 4G6DA 4I2OA 2M30A 1MNEA 3M4OJ 5EGOB 3CCMI 3KZIC 5J4VA 4FX4A 1BA5A 4KN4X 3F22A 2NVXJ 1WVRA 1REPC 3GCMA 4ZTJA 4U87A 4ANJA 1P4WA 4LLGF 3CJNA 4A69C 2BY3A 4XMYA 2YX7A 3ASNH 5IP7J 1VQ6I 1MSEC 2H8WA 1YRNB 4ZH4F 3MAJA 5BS6A 4GDFA 1ZGAA 5HS9A 3JRGA 1O57A 1P92A 5E8GA 3B6AA 1QRYA 3KP7A 4NB5A 1ON1A 3OR1C 2ESHA 4IRHA 3FHZA 3HGGA 4I01A 2P4WA 1BJAA 2AQEA 1W0UA 1TZLA 2IVMA 2M9HA 4HW0A 3H0GJ 2OQRA 4S05A 4U0VA 3G71I 3EUHC 4U0YA 2E5NA 1GXPA 4AIJA 4BJTA 1DPUA 3CP8A 1SANA 1KA8A 1W36D 1FYLA 3E6BA 5D4RA 1K61A 2GQQA 2LG4A 2JA5J 1JGSA 2JQ7A 3R60A 1S8NA 3J81K 2DAOA 2KJBA 3GO5A 5LHIA 1FPQA 3BR3A 1NTCA 4M6YA 3ABTA 3CMAI 3RYRA 3F21A 2O0YA 3S3MA 3J7AO 3BTCA 3W2AA 1X3ZB 3BTIA 3WTVC 4I0BA 3V42A 1MBEA 3DPUA 4ZJZA 5EEGA 2XHKA 4GFBA 2P7VB 2RDPA 5IOYA 1R9TJ 4RB0A 4KDPA 1O3RA 3K4NA 2D5VA 4YFKF 3VODA 1U78A 1POGA 4CYCA 2XB0X 1MZBA 2ZNYA 4U7BA 5H6RA 2NVTJ 2XC7A 3CCYA 2JA8J 2Q2EB 4G6TB 5IYDJ 1IAWA 3IL2A 4ENKA 2XKPA 2VQGA 2WV1A 4XNFA 4DZPA 4B4CA 4RAFA 3LSKA 2RV8A 3E7LA 1R5GA 4LMYA 4RS8A 1AHDP 3J81Z 3S1NJ 3V7SA 2RNGA 4B1RA 4UB8C 3HUGA 3KP3A 3CCUI 2R7ZJ 1OYWA 3M8EA 5E3NA 4XLFA 1UHMA 2R7SA 2F5FA 2DFHA 4EEFG 2LF7A 3ZOBA 4WXHA 2Y0SN 2VPLA 1V3FA 4IL6C 3B73A 4KT5C 3PQJA 1X1CA 2OA4A 3TL4X 5ILSA 1FMVA 4XLAA 4O6JA 4IHTA 1R23A 2K4BA 2NOGA 2YX4A 2L7FP 3ZN0A 2WV0A 3RZOJ 3VYRB 4HQMA 1FTTA 3WODF 2DA1A 3PFYA 2DMQA 1O7FA 2H94A 2KHMA 1YW8A 3CJRB 4S04A 2PMHA 2IGNA 2ECBA 3TOBA 3GLXA 3ZMTA 1IN7A 2FBKA 3BR0A 2R5ZA 4BXXJ 2DYSH 4G8XA 4JYKA 2VC1A 2PMUA 4EJOA 2VJJA 5FD6A 1QHHD 5HLHA 4RLQA 4L0YB 2L9VA 2EIKH 5HLGA 3OR2C 3A0HC 4BYYA 2D1VA 3KP5A 3V7CA 3HM5A 3K2AA 3WHCA 1WI3A 4LB6B 1K79A 1EH6A 2BYVE 2C6YA 2D1HA 3PO2J 4M73A 1MNMC 4IF4A 1KU7A 3TDUC 2FE3A 2DDBA 2W48A 1LQ1A 1B9MA 2MW8A 1UAAA 4RB2C 1ZG1A 5IT9K 2WAEA 3R61A 1O3QA 3NRVA 4N4NB 3S2DJ 4DZJA 2HEOA 2MD0A 1WSUA 1Y39A 2R5ZB 2VBZA 2FD5A 3HOXJ 2EFWA 2VBWA 2BBYA 1OJLA 3D5LA 1T0FC 1V5FA 4C9YA 3RI4A 2R7UA 5LGUA 5J1RA 1LUJB 3CC7I 4DOZA 1ZRCA 4GYGA 5ICFA 4ENNA 1JKOC 3OOPA 3W2VA 4KNYA 1R5ID 2FRHA 2ID3A 4UV8A 4LK1F 4L5EA 5B66C 2Z1DA 1T2KA 4ZYDA 4BS9A 2H1LA 1MBGA 2OZUA 2TCTA 3HIFA 1MMAA 3G73A 4FTHA 2HZDA 1HA8A 5HLTA 4XIDA 2CG4A 3M07A 3K10A 4HQEA 3LNQA 1BI3A 2E36A 2DW4A 4HA8A 2DODA 2VJ4A 2QVOA 3HOWJ 2ZJ2A 1W1WE 2W82A 4MO7A 2Z3YA 3EPZA 4PJMA 2GWRA 2YU3A 2OAZA 4G7HF 2WC2A 2DK8A 1ZG5A 4QTRA 2VE8A 4RBOA 2IPQX 1XD7A 4LIVA 2X6YA 2R5YB 2KMUA 1ETOA 4YFNF 1Z1DA 5CJ9A 4O3MA 3BTLA 4MTEA 2DOFA 2JT1A 2JPCA 2WADA 3WHBA 2QSHX 1FBQA 2BVMA 4UUSA 1G8XA 4QPQA 3J80Z 1DU0A 1E3PA 1Q1VA 5GPAA 2JWTA 3GLLA 1RETA 4L9VA 2KRHA 1IXRC 2MA3A 1IF1A 4IEJA 2DBBA 3DU6A 3BCAA 2LVSA 4EJVA 1ETVA 2XF5A 2NVQJ 3HGYA 1Z6TA 4E7IA 2VL8A 3G1MA 2JTVA 1TQPA 3DFGA 1QVUA 4Y15A 3HRTA 3KCCA 2VXZA 5IT9Z 5E1ZB 1PDNC 4OAYA 4KMUX 2XAFA 3GWZA 3ZCOA 4L5JA 3GFMA 2FBHA 3HSEA 2IEKA 3NWSA 3I59A 4YIFA 2X4HA 5J47A 3CUQB 5KHDA 3A01A 3OIPA 3QODA 5EEAA 3MVPA 3BP8A 3Q0UA 2ME0A 2R7XA 3D0SA 1BOBA 1O4XA 5K5RA 5AIPA 2DQRA 3BZCA 4D7NA 5LGNA 4IZZA 2GIVA 5HODA 2BHYA 4IHVA 4OIQF 1UB9A 2FMYA 4HX4A 4BJ6C 1GHCA 3REOA 1R1UA 2ZXIA 1IC8A 1E3HA 2MH9A 1AU7A 3RTRA 4WXCA 5J3LA 1PYVA 5HDKA 2R7DA 2IS4A 2MFZA 3PSFA 4KT6A 3BJ6A 4RA2A 1D1CA 3L2CA 1V55H 2V1XA 4CICA 4ZDOA 2L7KA 2TRTA 3CC4I 1B72B 1WFXA 4IOCF 1U9NA 3HL2A 4Y13A 4V19K 3OYHA 4A93J 4M3GA 3P9IA 2EILH 3Q9SA 2W7NA 1P2FA 3MMYB 2M8EA 1FMWA 2R4GA 4HNUA 1T33A 4MNUA 3OYIA 1VQ5I 3GTPJ 3CCJI 4GCVA 3ZMZA 1IG7A 2ZSHB 2ISYA 4AUXA 4C2UA 4KIGA 3HOZJ 2MGQA 1LVKA 3E5XA 4EGYA 2L4MA 4AVZA 3P5JA 3LFUA 2P81A 4Y33A 4QIWN 4XKWA 5D4SA 3AG4H 3NARA 4BXUA 2LDUA 1YW9A 1VFCA 2H6BA 1IXCA 2VE9A 1I50J 2DFIA 1GV5A 5IP9J 2Q0OA 3E5UA 4W97A 2PN6A 1XPXA 1SVOA 2HWVA 2KQRA 2D2WA 2EZIA 2ZFWA 4M71A 3W3CA 2RQQA 2OC6A 1W5SA 2ESNA 3N4MA 2O8KA 1JI8A 4IVNA 2XF7A 3S15J 5HNHA 4HNVA 1U5TC 2QQ9A 1K83J 1P6RA 4XLPF 2FNPA 1HKQA 3MWMA 1R58A 3BG5A 3BJAA 2LSOA 2XASA 1VQ9I 4LG3A 3KPHA 1ETQA 2A07F 3MZYA 5CKTA 4BE0A 1TNTA 1JJ8C 2HDDA 2MLKA 3COAC 4NBQA 2GA1A 4XSXF 1I27A 5F64A 3JRDA 1OLTA 1O7LA 4HF1A 1U5TB 4WWCA 1R36A 3SEZA 4BQQA 2JK3A 3I4NJ 2ADUA 1LDKB 2P5KA 3IWFA 2HQNA 4I99C 3LSGA 2MD5A 5F0FA 4FT8A 3B02A 1B9NA 1IW7F 1TBXA 2KZVA 1J0RA 4F55A 4ITVA 2J5PA 3C2HA 4HLXA 1SFUA 5LHHA 3FXKA 2CH0A 2CFXA 4PJLA 3WGIA 5JLWA 3E97A 1OKRA 1SD7A 3P9CA 5GADJ 1YJNI 2V7FA 5IY5H 3WG9A 5CVRA 1CQTA 3QP5A 1S9HA 3I4PA 4Q5SF 2ECCA 3CJTB 1UJ8A 2YR2A 4BAYA 1TQMA 1UHWA 1TTYA 2VKVA 3S3NA 3HRMA 2DN0A 2ZCWA 3I71A 1EKEA 1U9OA 5D6FA 1FYMA 1XDUA 2FXAA 5JLXA 1QZYA 1KU3A 2LP0A 4MQ9F 4ON0A 1MMGA 2QUFA 2HQRA 3HG9A 1SMYF 5AONA 3GFIA 1UCRA 4F91B 1B1BA 3CO6C 5FKLA 3QU3A 1JUSA 2HKXA 4X1EA 4GXOA 2NNYA 1QO0D 5LEJA 4XN0A 4MEYF 4MLOA 2O03A 2E19A 1T08B 1BR4A 2ZMEB 2E71A 2A6EF 1T6SA 2VONA 1QPIA 5IOZA 2VT3A 4FE7A 1U6GA 5JHUA 3MZHA 2MC3A 1R22A 3S8PA 2DMTA 5K7ZA 1GVJA 4UUVA 2ZMEC 1AKHA 4KIBA 4EMSA 2LNBA 4V2FA 2EV5A 4HZFA 3ZMVA 4BE1A 2DA6A 2CGPA 3H1CA 3GYHX 4Q47A 1T0FA 2PJRB 3RKWA 4NHJA 3FWEA 3C3WA 1XMXA 5F6FA 5ILVA 1WJAA 1HSTA 2E1NA 4J19A 4EM2A 1J5YA 2E1MC 2F5DA 3M7GA 5CPRB 3MKYB 4R79A 4IHYA 1YYVA 4ZTFA 4XRMA 3LQRA 4LLLA 1AWCA 2A3SA 1MD0A 2OCCH 2GAUA 3CMMA 3JRIA 1A35A 4NQWB 4OOIA 3ELKA 3HHGA 4GRIA 4E7JA 4UVAA 4WF2A 1L3LA 5LEKA 1NG6A 4AC0A 5LLQA 4PJNA 3GMEA 3HOYJ 2R7OA 2VASA 3RJPA 3IUOA 4DGWB 4J01A 3QQAA 3IKTA 3CF2A 3I56I 1FEXA 2FX0A 3BZKA 4LD5A 3EQLF 2V6CA 1HLVA 3Q0WA 2R3SA 1ACIA 4RDUA 3HXLA 1D5VA 3ZQ7A 3R6SA 4HEA2 4JX5A 3S1RJ 3RPUD 3VFZA 3KEOA 4BHBA 1IUYA 2X6XA 2X1DA 4M9SA 3LAPA 2H09A 3QOPA 3VYTB 5HNFA 2KIFA 4Z6YA 2WY7Q 4H0EA 1YX3A 4QWQA 3FBNB 1HCRA 2YS9A 4IHWA 1A5JA 1JKQC 3ASOH 1J59A 3I55I 4IQ4A 1X2NA 5EJCA 3ZQIA 3O3KA 1VQPI 5J6XA 3OOUA 1LEBA 5EF6A 2LY1A 2QYOA 2A6TA 5B3SH 1YS7A 1OISA 1TW2A 2HOEA 3SFZA 3I53A 1Z3XA 2VKHA 5E18F 3TO6A 1IV8A 1ZK8A 2W25A 3F8NA 1OCCH 2V1NA 2UWMA 2FOWA 3AG2H 2YPRA 4S0HB 2R93J 5D5XB 3LSMA 3OYEA 3L00A 4P5OA 1ZQ3P 2LTPA 2ETHA 3S1QJ 3A2KA 1WH5A 1J9IA 4XRSA 4G9YA 2K9QA 4E70A 4JQFA 1XG1A 1P4AA 4ENMA 1Z9CA 5BNGA 2DPDA 1WPKA 2XRLA 2A5YB 4RM3A 3SDGA 1VQKI 4LLNA 4E7KA 2B9SA 2IRFG 4O5VA 2CW0F 3ERED 1B8IA 1UG0A 3K6GA 3PJRA 3K0LA 2RAEA 2E60A 3SEQA 4BU2A 5KAFC 4ZZLA 2KP6A 1Y6IA 3WU0A 2HPMA 2PMZA 1XSDA 3ZRGA 1UG2A 5FD5A 2FF4A 5D8LB 4A3FJ 2DT7B 3G6EI 3FMRA 3TW7A 4IX7A 2QQBA 1JTXA 3JAMK 4UVBA 5L3BA 5IYCJ 3S3OA 3HUGB 3ZQCA 1LFUP 4LJZF 1V5EA 2XGEA 2XGCA 3HEFA 3QYFA 1LDDA 2DT6A 2HTSA 4NC6A 1WKMA 2UUZA 2UV1A 4IKFA 4C2TA 4DJAA 4BQOA 2E7XA 1X3WB 5E3MA 2UZKA 3AAFA 2CQXA 4IOAF 4IJAA 3GTQJ 1XTAA 4LB5A 3RKXA 2KISA 3C18A 3FDYA 3ONQA 1MBFA 4LGWA 5FLXZ 1GXQA 4IO9F 3TMOA 1B59A 2L3DA 2HTJA 4Y4RA 2B0LA 1X1BA 4EGZA 2CW7A 3OL3A 4HV5A 2ICWG 3KX2A 3BT9A 1I5ZA 2D45A 4XL9A 2EBIA 1YJ9I 4Y3OA 5HS8A 2H6CA 2DI3A 2ACJA 4PJJA 1LPQA 4HRIA 2WBMA 1MH4A 2R7VA 2A69F 4XLCA 2F4IA 4UUSB 4HPQA 1F4KA 1DGWY 4KYWA 1S7OA 1X4PA 2DTZA 3K70C 3SJMA 1IN6A 3QYEA 3FM3A 4A6EA 2F48A 2P8TA 3S2HJ 3OYNA 1LNWA 2GXBA 4AIDA 1WQ2A 2XVCA 1EF4A 5JI6A 1RR7A 2VXDA 3OYCA 1U0JA 2A6HF 2VB6A 3D5RC 5DD8A 5CQGA 2P6SA 3KEYA 4ZYHA 2GBYA 4XR6A 3ZMUA 3L09A 3TW6A 1OMIA 1TC3C 1D8JA 1IDYA 2ELKA 5TRDA 1Z0XA 1HDPA 3A02A 4ETSA 4KFCA 5FKOA 1IRFA 2XAHA 3IC7A 4DBRA 2VQLA 3DPTA 1QZZA 1Z6RA 2HQ5A 4L5IA 4YG2F 3PQKA 3F9KA 1UFMA 2EB7A 2K40A 5L3FA 3PIOF 3LWFA 1EH7A 3GF2A 3H9GA 2DJNA 2W1OA 4F93B 2IT0A 1RRJA 3K4LA 2CW8A 5FKNA 5ICCA 1XGNA 3NAUA 3H5NA 4B48A 3DF8A 3LQQA 2KKOA 4Y7NJ 1RPWA 3F8BA 1BW5A 1SD6A 4UXNA 4U7DA 5FRNA 1X1PA 1S7AA 2X48A 2KIMA 1NK2P 4A5MA 1VQ8I 3I9V2 1BI0A 1F1ZA 2E1MB 2HOTA 2K3FA 3E5QA 2O3FA 1FOWA 2DA5A 3BCBA 2JN6A 1QBJA 4JP0A 2XROA 2M2EA 3FXJA 4BY1J 4ESBA 2KT0A 3M8JA 2F5VA 4HLYA 5E17F 2NVUB 4M3DA 4ENJA 1MDMB 1G2HA 2PI0A 5HLIA 1PVEA 4P1WA 1R71A 2QCOA 3LA2A 3TBIA 4XN3A 1K78B 1D0YA 5F0CA 2LRDA 2JJ7A 1FOKA 2FSWA 1K6YA 2AO9A 3T8RA 2W24A 4RMNA 1V5GA 4AIKA 1O3TA 1JKRC 1BC8C 1J2XA 1RKWA 4B8XA 1ZAOA 2OJED 1MMNA 2KZGA 1PUEE 3KEQA 5J4YA 2UXXA 2Y75A 3HC7A 4ZYEA 5IPAA 3AFHA 1EA3A 2ME6A 4E6KG 2NS0A 2K7LA 1G59A 2OZ6A 1DQUA 1FLIA 1S3JA 1Z7LA 3HTSB 2QQ8A 4R1HA 1FJLA 1F9NA 2PJRA 1FTZA 4A3GJ 1MMSA 2M7AA 4UHTA 5EGOA 1D1AA 1XGOA 3DTKA 1G3SA 2M1BA 1JT6A 3QPHA 2OTJI 3EUHA 4C3HJ 1YLFA 4HV6A 3DKXA 3ZQHA 3ROUA 1OR7A 3WTYC 2XB5A 1S72I 1A04A 2EIJH 1M1EB 1P7IA 2LREA 3UNGC 4AD9A 2PBIA 4RB3C 2L7ZA 4Q48A 2JVHA 1D8KA 5C44J 2CU7A 3Q5FA 1XSVA 3ZR8X 4DW6A 1PP7U 2FQ3A 4FETA 1IXSB 1YITI 2CFOA 3FZVA 3QP6A 3T5XA 1ZGWA 4DIQA 1APLC 2VOPA 3ZGKA 1U2WA 2NOJB 1BW6A 1Z91A 2LKSA 3CDHA 1IUFA 3H3UA 3Q0VA 2CO5A 4BEHB 3R0JA 1MW7A 1XMAA 2F4OB 3BZ6A 4CGZA 2M45A 3QRFF 2BY0A 2NVYJ 4GGGA 3VSLA 2HVSA 2CRGA 1V54H 2I8DA 1OCRH 2P5LC 1SEUA 2GOXB 1D0ZA 1S29A 3O6BB 4G94A 3VOEA 2PLYA 3G3ZA 1Y1WJ 1HBXG 1MSFC 2LC2A 3JREA 1XCVA 3GVAA 1JUPA 1ETWA 4EQQA 1MIJA 3BOQA 4RGSA 3CF5F 3C7JA 2DA4A 1SFEA 3TP0A 3W6KB 2CYYA 5TGTA 4QPOA 2E34A 4A6DA 2Z2SB 1P9QC 2VJIA 2KDZA 1AA7A 2Y0SA 3A01B 1WZ2A 3QOEA 5AIQA 2ZJQF 3S17J 2E1OA 2DMUA 4OIOF 1UELB 3GTMJ 1AKHB 4OMYA 3IRRA 5BQTA 3FXRA 3GZ5A 3BY6A 3RDIA 4A3BJ 1FWZA 1OCZH 1DDNA 4MHGA 4RLFA 3D5SC 1FSHA 3FK7A 3H5RA 1MBJA 2ZNZA 3P9KA 4HAMA 1T8IA 2LF8A 2ZMEA 5M5WJ 1N25A 4BHCA 5K5OA 2E35A 3L7WA 3OYBA 3RKYA 3KE2A 1BOAA 4K2EA 2CQKA 2CJJA 1KGSA 3PM1A 4ASNA 1R5HA 2F5EA 2E7WA 2EFQA 1STZA 5JVTA 3RQ4A 2V79A 3K2ZA 2G0EA 5ICGA 2HQAA 3RPUA 3L2RA 3OSFA 2VOOA 1IJWC 3I4MJ 1BR2A 4XBFA 3FKIJ 5M5YJ 2NAZA 2P5VA 1VNDA 3LAJA 2V6EA 2PX9A 1Y8QB 3EUKL 1MDMA 3OMYA 4I0AA 1BN5A 1ULYA 4CA0A 2EWNA 4HF0A 5FO5A 1XX5A 3IH4A 4BDZA 3AG1H 4ZYGA 4HNTA 1Y0NA 4M9ZA 5J1YA 2OF7A 3LSHA 3K70D 3OYLA 1TQIA 3V8KA 1MJ9A 4V2GA 3FK6A 3GEZA 4PK4A 3ISPA 1SC7A 3BR1A 3AL0B 1ZKGA 4LG0B 5E8IA 2JA6J 1NG7A 5DUKA 4A3KJ 1DP3A 2WAQA 3WE2A 2GOMA 2Y0MA 4II2A 1XCBA 2HI3A 3E6DA 2H27A 2XSJC 1RZ4A 2WA0A 3J7YJ 3UR3C 3PL8A 4CZZA 4PFOA 4KN7X 4I02A 4Y17A 3OYGA 2ZXHA 1IO2A 5C4JJ 1LE8B 2DT5A 3W6VA 2YU9J 3M8FA 1ZELA 2Z9OA 2QWWA 2VC0A 4B44A 1X4OA 4UV9A 2W00A 4OU0A 1WWXA 2K27A 2FBIA 4HX7A 4ZZDA 3LA7A 3G2BA 2HU9A 2LMDA 5EG0B 2X85A 2HXOA 2K85A 4CSWA 2EA4A 3DCFA 5CVUA 2CQ7A 4XK4A 5FFZA 1SFXA 2LD5A 3QPLA 4UUTA 3D1NI 1I1GA 4M9XA 3RCOA 9ANTA 1CF7A 4N9IA 2RQPA 2WY8Q 1R1TA 3E1SA 4FCYA 2FMLA 2PMZN 3ZPLA 2EV6A 2VKDA 3ERMA 1EV7A 3H3ZA 5KNLA 2ZJPF 4E7ZA 3CO7C 4XQFA 5DV5A 1TWAJ 2ZSIB 3MCZA 4RAZA 4HX8A 2K5CA 3TGNA 2Y30A 2K9NA 1WJCA 3UKGA 5E3LA 2BY1A 1DPRA 4FX0A 2E2IJ 2OCEA 2HVRA 3NEUA 4EM0B 1R4NB 1Z3YA 4BY7J 4M6XA 3VEPA 4A3CJ 3I58A 3BQYA 4QLCU 3TQNA 1FSEA 2L9NA 3LSIA 1HW5A 4OMZA 3KYDB 1H9TA 6PAXA 3GUDA 3S93A 4XKBA 3CUOA 2CWEA 3FXQA 2XSDC 2IGMA 1DU6A 3BJOA 3K1MA 3WG7H 2FA5A 2DA2A 1OR7C 2LYCA 3RSNA 3ZMSA 4BL0B 1G3YA 2O9LA 2F4MB 4LITA 2DA7A 4N4OB 5ERIA 3CCSI 3TO9A 1YX5A 2Z99A 3KYCB 3CCRI 2AHQA 5EZGA 1R1VA 2LOOA 4KIFA 2K3PA 1J7KA 1TWFJ 1PUFA 2A5WA 4F3QA 1E0EA 3CD6I 1H0MA 3H92A 3GTGJ 3FMSA 3K4JA 2LFBA 2NRAC 1WCMJ 2O61A 2IGOA 3EUAA 3HRSA 4PSWA 3SZTA 4AYBA 3HPHA 4CDGA 3WTXC 1KONA 3I59B 2R92J 5FGMA 3U2RA 2DOEA 2ZFUA 4I98B 2KPMA 1KZHA 4KUMA 3BC8A 1TNSA 2EFNA 2OPTA 5HS7A 3BTJA 3W2WA 2JRTA 4P55A 1FZPB 3EYYA 3JSOA 1XC5A 5F1JA 2BY2A 3CUQC 2EFPA 5LGTA 4CYDA 4UB6C 2AXLA 1YG2A 2O8XA 5K5QA 3H36A 1FT9A 3I64A 1Y56A 4UNOA 2HVQA 2DMPA 2QKLB 2MYSA 3ZN1A 5KAIC 2X1EA 5JHFA 2WAQN 2VODA 1EJ9A 1MGTA 3M1EA 4LIUA 4XLHA 4E7HA 2XV4S 2ZC2A 1O3SA 4C3JJ 3CCVI 2CQNA 2P7CB 1N77A 3JRHA 1MBKA 3ABLH 3FXOA 3EETA 3K7AJ 3ABUA 4F7ZA 4FQGA 4IHSA 3K4KA 4BXFA 4RGXA 1YQAA 2Q1ZB 5LHGA 5DM6F 5BOXA 4A3IJ 4P96A 2NS8A 1BIAA 2RREA 1HQCA 2QM3A 1F5TA 2F5CA 1RR8C 5IYBJ 1A36A 3G1OA 4ZDLA 2M0CA 3WTUC 2STWA 4Y52J 3CDIA 1R00A 2G7HA 2HS5A 1T98A 3I0TA 4MIMA 4PDKA 2IW5A 1FBUA 3F8FA 2CQQA 2OQGA 4HBLA 3BROA 1OCTC 2WTEA 5E1WA 3F6OA 3CMEI 3IH2A 3HOUJ 3QWLA 4XLEA 5JR3A 1D0XA 2KDOA 5L3DA 1NK3P 4G12A 4RAYA 1JXSA 2H1KA 3ZQQA 3F3XA 3KFWX 4HF2A 3S14J 1XSXA 3DKYA 3T1BA 2ZXJA 3MKLA 4U88A 1XDSA 2L2OA 4B47A 5FLVA 1ITYA 1OCOH 2M7BA 2K86A 4NDLA 2BXYA 4EATA 1Y1VJ 2XPVA 5E20A 1UHSA 2VLAA 1JE8A 3N05A 1VF9A 4DYCA 4BJ5C 2HZTA 1K4TA 2F2EA 4BHPA 1BJZA 5EZHA 5E79C 2X6WA 2K9MA 2X9DA 3VSKA 3L2WA 2EPFA 5HDGA 1YOVB 2O6GE 2M8GX 3ML6A 2L4AA 1HXDA 2MG4A 3DWLE 3DXJF 4MQVA 4MGRA 2WB1N 5M3MJ 1A6IA 2M5WA 2HR3A 3TO7A 3T8TA 1CGPA 1TWGJ 5H2FC 2K9LA 4ZYAA 2CUZA 1ZLJA 3GX4X 3VWBA 3CCQI 2KFDA 4MFDA 2BW3B 1U8RA 4A3LJ 2BXZA 3J7AY 1F36A 1G6NA 4M74A 2E1CA 3DEWA 2OV7A 2A05A 1HW2A 1Y0UA 5ILUA 3FXMA 4M6VA 3LMMA 2M0MA 5C3EJ 2LKXA 4YIIA 3ZP5A 2ISZA 2Z33A 1VQ7I 2KIQA 3AG3H 3NQOA 3BQZA 4EJTA 2R7FA 1VTNC 3K4CA 3GTJJ 2W4SA 3CCEI 2DO7A 2KJCA 3BR5A 3OYDA 3K4MA 4QSHA 3O8GA 2K02A 1WJBA 4P9FA 1IRGA 3JR9A 3ECHA 1FOYA 2Y31A 2Q2EA 2MH2A 2KL4A 4GYIA 3HYIA 4HSRA 2QZ8A 3PNTA 3SHFA 2DXIA 3J80K 1JHFA 1XGMA 2PJPA 4EJWA 4BUPA 1E17A 5GAGJ 3E3VA 2EH3A 2QQAA 1ON2A 1X3UA 4XRFA 2VJ5A 1Z77A 1I39A 3I3LA 1MJBA 4CCKA 4IXAA 4NC7A 1X2MA 5B1BH 1UMQA 4JOMA 1H88C 3FKJA 3N97A 5LBQA 2AS5F 2CV1A 1SFOJ 2RGVA 4CHUA 2JRMA 3GTOJ 3OYMA 2NYXA 2DU9A 3IKVA 3HSFA 3OIQA 1JUMA 2QEXI 2DJIA 2FJ1A 1WJEA 4JK1X 3RIRA 3U1DA 3OYKA 5BPIA 3JRFA 1C0WA 2HNHA 3S2WA 2BZTA 2QBYA 2DLLA 2QF7A 3CTAA 5GAEJ 3M9AA 2JSPA 3S32A 3FXLA 1IN5A 1CF7B 3O8HA 4NUBA 3LFKA 1Z05A 1TLHB 2LBFA 5DCMA 1XS9A 4LFUA 4DQ2A 2QA4I 2L7MP 2OTLI 4LK0F 1VQOI 3JW4A 1ENHA 4FE4A 3CP2A 3KP4A 1HW1A 4KJZA 4L9TA 3KYLA 1SD5A 4HDVA 3E6CC 4ABZA 3O2PE 3H0DA 4Q4ZF 2NS7A 3BWGA 2LY2A 3IHUA 4KA4A 4OIRF 3ZXSA 4AYBN 2EZLA 4MEXF 2HYJA 1RUOA 3C1DA 4L18B 3TDZC 3MQ0A 1BI1A 5M5XJ 1F43A 2MLGA 2PEXA 3BR6A 5EEHA 3WU2C 3LA3A 4F92B 1H8AC 3HZJA 5BMZA 1USSA 3HDDA 1A31A 2BE5F 4BGDA 4G7OF 5D8KB 3Q9VA 3KLNA 4W1UA 2HXIA 2LH9A 3JTHA 1GUUA 1MMDA 1FP1D 2HYGD 2G9WA 3A0BC 4F52A 2IA2A 1W7PD 3DPLC 3HTUA 2IBDA 2CUEA 4AVPA 2E2JJ 3FISA 5L3CA 4JBAA 2GLOA 4KISA 3M1CA 3HPGA 3CESA 2Y9ZA 1JT0A 3SDBA 2COMA 1KU9A 2L01A 5DCMB 1K7AA 2HFHA 3ZMDA 2ZJRF 1K78A 2O5RA 3FM5A 5EDNA 1N78A 1UZCA 1X1AA 2QSGX 2BVLA 1ZN2A 3F0CA 3OIOA 2GM4A 4L9NA 3RQIA 4A3JJ 5GTIC 2FEZA 5J8CA 5K7FA 3ESWB 2XUBA 1BIBA 1WRJA 1D5YA 4NQWA 3SZGA 1S5LC 5KVRA 1IGNA 3OWTA 3IRQA 1KQ9A 1FX7A 5F08A 1U8BA 3S1MJ 2GA2A 2HKOA 1B4AA 4X0GA 5CLSA 3ECOA 4FHTA 4CZCA 1ZH5A 3PUFA 4YELA 3ZQGA 4I7HA 3MFKA 3BPXA 1LB2A 4PJ0C 1YHQI 2L9RA 4BQNA 2EIMH 2AXTC 1ZYRF 1QHGA 4P9UA 3L2VA 1L0OC 2W57A 1XB4A 4BEHA 4HOBA 4CCLA 4A3EJ 3A4CA 3HOTA 1I3QJ 2XDVA 1I6XA 3OYJA 1SVMA 1W5CC 1V4RA 1X1DA 2ZB9A 5HDNA 4I09A 4E4HA 3A1YA 3HOVJ 4L9JA 3H5AA 1ODDA 4CH7A 2OU2A 3OY9A 4D1QA 2Z16A 1R4MB 1W5TA 3DP7A 1TL8A 1ORKA 4XICA 1FP2A 3JRAA 2MABA 4BDYA 1FC3A 1ZGJA 5H6QA 1ZG3A 2B63J 3JRCA 2EZKA 4DBQA 2FQ4A 4HDUA 3FHNA 1SVLA 3KP2A 1SD4A 1KQ0A 2W84A 5LFAA 1AOYA 1IN4A 1RNLA 2H8RA 5E1XA 1B72A 4MFEA 3EDPA 5F04A 3GXOA 5IP6A 1VQNI 3WU1B 3LSPA 2GXAA 2R7RA 2M4KA 4G6QA 3FX3A 3LSJA 5BPDA 4IRIA 1RC9A 1TP4A 3I5UA 5A2QK 3PIPF 2Y9YA 1OFCX 1EH8A 2DOAA 1NHAA 2ZXWH 1RUNA 1H9GA 1GT0C 3L1PA 5CVVA 3DBLB 3H9QA 2OBPA 3ABKH 3IP4B 4D5FA 3G1LA 3KIOA 4CCMA 3FBIB 1MKMA 3WE3A 2F6CA 2V9VA 3OYFA 1YI2I 4OIPF 1S6LA 2BHZA 2QKMB 2JMWA 2GXGA 4XOPA 3VDXA 2BV6A 1QVTA 1PJRA 4PFPA 5A2QZ 2V4JC 2VBXA 1IZ1A 3H9JA 4BBRJ 4II3A 1DUXC 3JSPA 2R5YA 1BBYA 2G7UA 3KETA 3OS0A 3RKQA 1LFBA 5FRMA 4CCNA 3CLOA 3WGHA 1ZHFA 2XAUA 2KRFA 4RGRA 2XGXA 1R6RA 2EJRA 1G3TA 3PUBA 4YRVA 3K69A 5JVGF 2JA2A 2DQLA 2MC4A 3IAS2 2EINH 3HHHA 3F72A 1VQMI 3OSGA 2I5UA 2L9SA 4PGHA 2K4JA 2FOKA 2JPBA 3S16J 1FIAA 3FMQA 5GAHJ 1YFHA 4BQAA 3A03A 4DYRA 5D5VB 2HYFA 2BW3A 2DFEA 3BG9A 5F27A 4ZDPA 3IAM2 4BH9A 2IP2A 3DV8A 3OS1A 1ZARA 5K1YA 5B1AH 4A0YA 1GV2A 1WJFA 3F8CA 3QPSA 4XKVA 5DD4A 1MH3A 3PSIA 2QSFX 1RI7A 4HSTA 1LEAA 4B43A 4XSZF 1HKSA 4CCOA 1GLNA 1YJWI 1JGGA 4OAZA 1VI0A 2YSRA 1YIJI 2XKOA 3EYIA 2UXNA 1LVAA 1USTA 3CCLI 2OD5A 3FF5A 3PNYA 4XONA 4A0XA 1ZR2A 1ETKA 4FASD 3DEUA 2YUSA 4Z2YA 1BC7C 1BR1A 2DK5A 2RKHA 1SAUA 2CUFA 4L0ZB 4HG2A 1YS6A 4B09A
chains in the Genus database with same CATH topology
2MBFA 5DEQA 1W7PB 2XAJA 3E6MA 1RIOH 4CXFA 1KYZA 3F8MA 4EV0A 3IWZA 1PP8F 4WX9A 1LJ9A 2RC4A 1LDJA 1R7JA 4A0ZA 4EM1A 5D5WB 4IPAA 1SAXA 1ONVA 3T0YA 2RN7A 1QPMA 3L9FA 2EK5A 4A5NA 4EVIA 4BNCA 2TDXA 3K9TA 3JAMZ 1DP7P 1FY7A 5LRRA 2L54A 1BM9A 1KYWA 4ESJA 3WTTC 4YFXF 1T39A 1MJAA 2EA2A 2VT2A 5TJJA 4A12A 1OPCA 4PCQA 2Z5UA 2Q8KA 2WWYA 4R8HA 1QQIA 1FBSA 2QLZA 1E2XA 3WTSC 4N9HA 3W6JB 3QAHA 2BGCA 4MTDA 4A2UA 1HKTA 5J8FA 1XN7A 2FNAA 3BDDA 3K1NA 2RNJA 4GO1A 4WXDA 4AWXB 3GW2A 5CVIA 2JZYA 1OYYA 1XMKA 1B6AA 3RPQA 3BPVA 1BI2A 5CYVA 3TKYA 3GFJA 4UVCA 1ZLKA 3WTZA 1JHHA 5HOOA 3LSTA 4N0BA 3DKWA 1ZRFA 1QNTA 1ZRDA 5DUIA 5FFXA 1FYKA 1FNNA 3QU6A 2JSCA 2BEOA 3HOSA 4RGUA 4KICA 2QENA 2XIGA 5D6EA 3WTWC 2J5OA 2LKPA 5HVQC 1KQ8A 1T38A 1YW7A 2A61A 1Z7UA 2CSOA 4G7ZF 2W85A 1ZREA 1W7PA 4ESFA 3SXYA 3KZZA 2P6TA 3F6VA 3V4GA 1OYIA 1WI9A 2L02A 3ULQB 5F1RA 5L3EA 3GZ6A 1TW3A 2ZBKA 5KK1A 3HRUA 4HYEA 4XLNF 2ELHA 2GZWA 3JTGA 2PG4A 3QPTA 3TOAA 4CO8A 2V1DA 2RVCA 2IJLA 4WK8F 3V8LA 3SZPA 2X0LA 3I54A 1G4DA 4IRGA 1Q1HA 2VBYA 3F23A 2ZKZA 2KIUA 2DTRA 4EJUA 2IA1A 5ICEA 3KLOA 1YTYA 2V1UA 2QBYB 3PFIA 5IT3A 3SQNA 3OV8A 1IN8A 4KMFA 4WCGA 3GFLA 2HGCA 1YIOA 2NNNA 4OINF 4U0WA 1J75A 4M72A 3U9GA 1SMTA 3MEXA 5D5UB 2HDCA 4PGGA 3CUQA 3VB2A 4D0PA 1QGPA 2M87A 2PFBA 4PZJA 5LRSA 5CVJA 5DDGA 1G3WA 3V8JA 2XAQA 5FB2A 5JFRA 2EFOA 2PQ8A 4DNCA 5ED4A 1HSJA 2A68F 3K1PA 4RB1A 3KZYA 2DPUA 5DYMA 1KU2A 4TV7A 5FLXK 3V7RA 2XAGA 1U3EM 3KP6A 5H20A 2EV0A 2ZO4A 1D3YA 1I1SA 4LG0A 2STTA 2Y48A 4AIHA 1XGSA 3P7NA 1W4MA 2FU4A 2VN2A 1YO5C 2IA0A 3R0AA 3WGGA 3R4KA 2XRNA 3DQVC 3RYPA 1K6OA 3FXUA 1P4XA 1U5TA 3HSRA 5DCFA 5L3GA 4G6DA 4I2OA 2M30A 4FX4A 4KN4X 3F22A 1REPC 1P4WA 4LLGF 3CJNA 2YX7A 4ZH4F 3MAJA 5BS6A 1ZGAA 5HS9A 1O57A 1P92A 5E8GA 3KP7A 4NB5A 1ON1A 2ESHA 4IRHA 3FHZA 4I01A 2P4WA 1BJAA 2IVMA 4HW0A 2OQRA 4S05A 4U0VA 1GXPA 4U0YA 4AIJA 1DPUA 1KA8A 1FYLA 3E6BA 5D4RA 2GQQA 1JGSA 3R60A 1S8NA 3J81K 2DAOA 2KJBA 3GO5A 5LHIA 1FPQA 4M6YA 3ABTA 3RYRA 3F21A 2O0YA 3J7AO 3WTVC 4I0BA 5EEGA 2XHKA 2P7VB 2RDPA 4RB0A 4KDPA 1O3RA 4YFKF 3VODA 1U78A 1MZBA 2ZNYA 4U7BA 5H6RA 1IAWA 3IL2A 4ENKA 2XKPA 4LMYA 2RV8A 4RS8A 1R5GA 3J81Z 3V7SA 3HUGA 3KP3A 1OYWA 3M8EA 1UHMA 2F5FA 2LF7A 4WXHA 1V3FA 3B73A 4KT5C 3PQJA 2OA4A 5ILSA 4IHTA 4O6JA 1R23A 2K4BA 2YX4A 3ZN0A 2WV0A 4HQMA 3WODF 1O7FA 2H94A 1YW8A 4S04A 2PMHA 3TOBA 3GLXA 3ZMTA 1IN7A 2FBKA 4G8XA 2VC1A 2PMUA 4EJOA 5FD6A 5HLHA 4L0YB 5HLGA 4BYYA 2D1VA 3KP5A 3V7CA 4LB6B 1K79A 1EH6A 2BYVE 2C6YA 2D1HA 4M73A 4IF4A 1KU7A 3TDUC 2FE3A 1LQ1A 1B9MA 4RB2C 1ZG1A 5IT9K 3R61A 1O3QA 3NRVA 2HEOA 1WSUA 2VBZA 2EFWA 2VBWA 2BBYA 3D5LA 3RI4A 5LGUA 1ZRCA 4GYGA 5ICFA 4ENNA 3OOPA 4KNYA 2FRHA 4UV8A 4LK1F 1T2KA 4ZYDA 2OZUA 3HIFA 3G73A 2CG4A 4HQEA 1BI3A 2DW4A 4HA8A 2QVOA 2ZJ2A 2Z3YA 2GWRA 2OAZA 2YU3A 4G7HF 2WC2A 2DK8A 1ZG5A 2VE8A 2IPQX 1XD7A 4YFNF 1Z1DA 5CJ9A 4O3MA 4MTEA 2JT1A 2JPCA 1FBQA 3J80Z 4L9VA 1IXRC 2MA3A 1IF1A 2DBBA 4EJVA 1Z6TA 2JTVA 1TQPA 3DFGA 4Y15A 3HRTA 3KCCA 2VXZA 5IT9Z 5E1ZB 1PDNC 4KMUX 2XAFA 3GWZA 4L5JA 3GFMA 2FBHA 3HSEA 3I59A 4YIFA 2X4HA 3CUQB 3BP8A 3D0SA 5K5RA 5AIPA 2DQRA 5LGNA 2GIVA 4OIQF 1UB9A 2FMYA 4HX4A 1GHCA 3REOA 1R1UA 2MH9A 3RTRA 4WXCA 5HDKA 2R7DA 3BJ6A 3L2CA 2V1XA 4CICA 4Y13A 3P9IA 3Q9SA 1P2FA 2M8EA 4MNUA 4GCVA 3ZMZA 2ISYA 4KIGA 3E5XA 4EGYA 2L4MA 5D4SA 4BXUA 2LDUA 1YW9A 2H6BA 1IXCA 2VE9A 2DFIA 2Q0OA 3E5UA 2PN6A 2HWVA 2D2WA 2ZFWA 4M71A 1W5SA 2ESNA 3N4MA 4IVNA 1U5TC 2QQ9A 1P6RA 4XLPF 2FNPA 1HKQA 3MWMA 1R58A 3BJAA 2LSOA 2XASA 2A07F 3MZYA 1TNTA 2MLKA 3COAC 2GA1A 4XSXF 1I27A 5F64A 4HF1A 1O7LA 1U5TB 4WWCA 1R36A 2ADUA 1LDKB 2P5KA 3IWFA 2HQNA 2MD5A 4FT8A 3B02A 1B9NA 1IW7F 1TBXA 1J0RA 2J5PA 4HLXA 1SFUA 5LHHA 2CFXA 3WGIA 3E97A 1OKRA 1SD7A 3P9CA 3WG9A 5CVRA 3QP5A 3I4PA 4Q5SF 2YR2A 4BAYA 1TQMA 1TTYA 1UHWA 3HRMA 2ZCWA 3I71A 5D6FA 1FYMA 1XDUA 2FXAA 1QZYA 1KU3A 4MQ9F 4ON0A 2QUFA 2HQRA 5AONA 1SMYF 3GFIA 1UCRA 3CO6C 1B1BA 3QU3A 2HKXA 4GXOA 2NNYA 1QO0D 5LEJA 4MEYF 2O03A 2ZMEB 2VONA 2A6EF 1T6SA 2VT3A 3MZHA 1U6GA 5JHUA 2MC3A 1R22A 1GVJA 4UUVA 4KIBA 4EMSA 2LNBA 2EV5A 4HZFA 3ZMVA 2CGPA 3GYHX 4Q47A 1T0FA 3RKWA 4NHJA 3FWEA 3C3WA 5F6FA 5ILVA 1HSTA 2E1NA 4EM2A 1J5YA 2F5DA 3M7GA 4R79A 1YYVA 3LQRA 4LLLA 1AWCA 2A3SA 1MD0A 2GAUA 4OOIA 3ELKA 3HHGA 4UVAA 4WF2A 1L3LA 5LEKA 5LLQA 3RJPA 3IKTA 4LD5A 3EQLF 2V6CA 2R3SA 1D5VA 3ZQ7A 3R6SA 3VFZA 3KEOA 4BHBA 1IUYA 4M9SA 3LAPA 2H09A 3QOPA 2KIFA 4H0EA 4QWQA 1J59A 3O3KA 5J6XA 1LEBA 2QYOA 1YS7A 3SFZA 1TW2A 2HOEA 3I53A 5E18F 3TO6A 2W25A 3F8NA 2UWMA 2YPRA 5D5XB 3L00A 4P5OA 2ETHA 1J9IA 4G9YA 4E70A 4JQFA 1P4AA 4ENMA 1Z9CA 2DPDA 2A5YB 4LLNA 2IRFG 4O5VA 2CW0F 3ERED 3K0LA 4ZZLA 3WU0A 1XSDA 5FD5A 2FF4A 5D8LB 3FMRA 2QQBA 3JAMK 4UVBA 5L3BA 4LJZF 1LDDA 2HTSA 1WKMA 2E7XA 2UZKA 3AAFA 4IJAA 4LB5A 3RKXA 3C18A 4LGWA 5FLXZ 1GXQA 1B59A 2L3DA 2HTJA 2B0LA 4EGZA 4HV5A 2D45A 1I5ZA 5HS8A 2H6CA 2DI3A 2ACJA 2A69F 1F4KA 4KYWA 1S7OA 1IN6A 3FM3A 4A6EA 2P8TA 1LNWA 2GXBA 1WQ2A 2XVCA 5JI6A 2A6HF 5DD8A 2P6SA 4ZYHA 3ZMUA 3L09A 1OMIA 1D8JA 5TRDA 4ETSA 4KFCA 1IRFA 2XAHA 3IC7A 3DPTA 1QZZA 1Z6RA 4L5IA 4YG2F 3PQKA 1UFMA 2EB7A 5L3FA 3LWFA 1EH7A 3GF2A 2IT0A 5ICCA 1XGNA 3DF8A 3LQQA 2KKOA 3F8BA 1SD6A 4UXNA 4U7DA 1S7AA 2KIMA 4A5MA 1BI0A 1F1ZA 3E5QA 2O3FA 1QBJA 2XROA 4ESBA 4HLYA 5E17F 4ENJA 1MDMB 2PI0A 5HLIA 3LA2A 1K78B 1FOKA 2FSWA 3T8RA 2W24A 4AIKA 1O3TA 1BC8C 1J2XA 4B8XA 1ZAOA 1PUEE 3KEQA 2UXXA 2Y75A 4ZYEA 2NS0A 2K7LA 2OZ6A 1FLIA 1S3JA 3HTSB 4R1HA 1F9NA 4UHTA 1XGOA 1G3SA 2M1BA 3QPHA 3EUHA 1YLFA 4HV6A 3ROUA 1OR7A 3WTYC 1A04A 4AD9A 2PBIA 4RB3C 4Q48A 1D8KA 3Q5FA 1XSVA 1PP7U 2FQ3A 1IXSB 3FZVA 3QP6A 3T5XA 2VOPA 1U2WA 1Z91A 3CDHA 3H3UA 2CO5A 3R0JA 1XMAA 3BZ6A 4CGZA 2M45A 3QRFF 4GGGA 2P5LC 1S29A 3O6BB 3VOEA 4G94A 2PLYA 3G3ZA 1HBXG 1XCVA 3GVAA 4EQQA 3BOQA 4RGSA 3C7JA 1SFEA 3W6KB 2CYYA 4A6DA 5AIQA 4OIOF 4OMYA 3IRRA 5BQTA 3FXRA 3GZ5A 3BY6A 3RDIA 1FWZA 1DDNA 4MHGA 1FSHA 2ZNZA 3P9KA 4HAMA 2LF8A 2ZMEA 4BHCA 5K5OA 3L7WA 3RKYA 3KE2A 1BOAA 4K2EA 2CQKA 1KGSA 4ASNA 1R5HA 2F5EA 2E7WA 2EFQA 1STZA 5JVTA 2V79A 3K2ZA 5ICGA 3RPUA 2VOOA 4XBFA 2NAZA 2P5VA 3LAJA 1MDMA 4I0AA 1BN5A 1ULYA 2EWNA 4HF0A 5FO5A 4ZYGA 4M9ZA 1TQIA 3V8KA 1MJ9A 3GEZA 3ISPA 4LG0B 5E8IA 5DUKA 3WE2A 2Y0MA 1XCBA 3E6DA 2H27A 1RZ4A 4CZZA 4KN7X 4I02A 4Y17A 2DT5A 3M8FA 2Z9OA 2QWWA 2VC0A 4UV9A 4OU0A 1WWXA 2K27A 2FBIA 4HX7A 4ZZDA 3LA7A 2EA4A 5CVUA 5FFZA 1SFXA 1I1GA 4M9XA 1CF7A 4N9IA 2RQPA 1R1TA 2FMLA 3ZPLA 2EV6A 1EV7A 3H3ZA 3CO7C 5DV5A 3MCZA 4RAZA 4HX8A 3TGNA 1DPRA 4FX0A 3NEUA 4EM0B 4M6XA 3VEPA 3I58A 4QLCU 3TQNA 1FSEA 1HW5A 4OMZA 1H9TA 6PAXA 3GUDA 3CUOA 2CWEA 3FXQA 3BJOA 3K1MA 2FA5A 3ZMSA 1G3YA 5ERIA 3TO9A 2Z99A 1R1VA 4KIFA 1J7KA 1H0MA 3H92A 3FMSA 2NRAC 2O61A 3HRSA 3SZTA 4CDGA 3WTXC 3I59B 5FGMA 3U2RA 4I98B 4KUMA 1TNSA 2EFNA 5HS7A 4P55A 2JRTA 1FZPB 3EYYA 3JSOA 3CUQC 2EFPA 5LGTA 4CYDA 2AXLA 1YG2A 2O8XA 5K5QA 1FT9A 3I64A 4UNOA 3ZN1A 2VODA 1MGTA 3M1EA 2XV4S 1O3SA 2P7CB 3EETA 3ABUA 4F7ZA 4IHSA 4RGXA 1YQAA 5LHGA 5BOXA 4P96A 1BIAA 1HQCA 2QM3A 1F5TA 2F5CA 3WTUC 2STWA 1R00A 2G7HA 2HS5A 1T98A 3I0TA 4PDKA 2IW5A 1FBUA 3F8FA 2OQGA 4HBLA 3BROA 2WTEA 5E1WA 3F6OA 5JR3A 5L3DA 4RAYA 1JXSA 3F3XA 3KFWX 4HF2A 1XSXA 3T1BA 2ZXJA 4U88A 1XDSA 2K86A 5E20A 1JE8A 2HZTA 2F2EA 4BHPA 5HDGA 2O6GE 3ML6A 2L4AA 1HXDA 4MQVA 3DXJF 4MGRA 2M5WA 2HR3A 3TO7A 3T8TA 1CGPA 1ZLJA 3GX4X 1U8RA 4M74A 1G6NA 2E1CA 1HW2A 1Y0UA 5ILUA 4YIIA 3ZP5A 2ISZA 2Z33A 4EJTA 3NQOA 2R7FA 1VTNC 2DO7A 2KJCA 2K02A 4P9FA 1IRGA 3ECHA 2Q2EA 2MH2A 4GYIA 3HYIA 2QZ8A 3SHFA 2PJPA 3J80K 1JHFA 1XGMA 4EJWA 1E17A 3E3VA 4XRFA 1X3UA 1ON2A 2QQAA 1MJBA 4IXAA 3N97A 5LBQA 2AS5F 2RGVA 4CHUA 2NYXA 2DU9A 3IKVA 3HSFA 3RIRA 4JK1X 3U1DA 5BPIA 1C0WA 3S2WA 2QBYA 2DLLA 3CTAA 3M9AA 1IN5A 1CF7B 3LFKA 1Z05A 1TLHB 5DCMA 4LFUA 4DQ2A 4LK0F 3JW4A 3KP4A 1HW1A 4L9TA 1SD5A 4HDVA 3E6CC 3O2PE 4Q4ZF 3BWGA 3IHUA 4KA4A 4OIRF 4MEXF 1RUOA 3C1DA 4L18B 3TDZC 3MQ0A 1BI1A 2MLGA 2PEXA 5EEHA 3LA3A 5BMZA 1USSA 2BE5F 4G7OF 5D8KB 3Q9VA 3KLNA 3JTHA 1FP1D 2HYGD 2G9WA 2IA2A 1W7PD 3DPLC 3HTUA 4AVPA 5L3CA 4JBAA 2COMA 1KU9A 2L01A 5DCMB 1K7AA 2HFHA 3ZMDA 1K78A 3FM5A 1ZN2A 4L9NA 2FEZA 5J8CA 2XUBA 1BIBA 1WRJA 4NQWA 5KVRA 3IRQA 1KQ9A 1FX7A 2GA2A 2HKOA 1B4AA 5CLSA 3ECOA 4FHTA 1ZH5A 4I7HA 3MFKA 3BPXA 1LB2A 1ZYRF 4P9UA 1L0OC 2W57A 1XB4A 4HOBA 3HOTA 1I6XA 1V4RA 5HDNA 4I09A 4L9JA 1ODDA 2OU2A 1W5TA 3DP7A 1FP2A 1FC3A 1ZGJA 5H6QA 1ZG3A 4HDUA 3KP2A 1SD4A 1KQ0A 2W84A 1AOYA 1IN4A 1RNLA 5E1XA 3EDPA 3GXOA 3WU1B 4G6QA 3FX3A 5BPDA 4IRIA 3I5UA 5A2QK 1EH8A 1NHAA 1RUNA 1H9GA 5CVVA 2OBPA 1MKMA 3WE3A 2V9VA 4OIPF 1S6LA 2GXGA 2BV6A 5A2QZ 2VBXA 1IZ1A 1DUXC 3JSPA 1BBYA 2G7UA 3KETA 3CLOA 3WGHA 1ZHFA 2KRFA 4RGRA 2XGXA 2EJRA 1G3TA 3K69A 2DQLA 3HHHA 3F72A 4PGHA 2K4JA 2FOKA 2JPBA 3FMQA 1YFHA 4BQAA 5D5VB 2HYFA 4BH9A 2IP2A 3DV8A 1ZARA 5K1YA 4A0YA 3F8CA 5DD4A 1RI7A 1LEAA 4XSZF 1HKSA 2YSRA 3EYIA 2XKOA 2UXNA 1LVAA 1USTA 2OD5A 3FF5A 4A0XA 3DEUA 4Z2YA 1BC7C 2DK5A 2RKHA 4L0ZB 1YS6A 4B09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBF A;  5DEQ A;  1W7P B;  2XAJ A;  3E6M A;  1RIO H;  4CXF A;  1KYZ A;  3F8M A;  4EV0 A;  3IWZ A;  1PP8 F;  4WX9 A;  1LJ9 A;  2RC4 A;  1LDJ A;  1R7J A;  4A0Z A;  4EM1 A;  5D5W B;  4IPA A;  1SAX A;  1ONV A;  3T0Y A;  2RN7 A;  1QPM A;  3L9F A;  2EK5 A;  4A5N A;  4EVI A;  4BNC A;  2TDX A;  3K9T A;  3JAM Z;  1DP7 P;  1FY7 A;  5LRR A;  2L54 A;  1BM9 A;  1KYW A;  4ESJ A;  3WTT C;  4YFX F;  1T39 A;  1MJA A;  2EA2 A;  2VT2 A;  5TJJ A;  4A12 A;  1OPC A;  4PCQ A;  2Z5U A;  2Q8K A;  2WWY A;  4R8H A;  1QQI A;  1FBS A;  2QLZ A;  1E2X A;  3WTS C;  4N9H A;  3W6J B;  3QAH A;  2BGC A;  4MTD A;  4A2U A;  1HKT A;  5J8F A;  1XN7 A;  2FNA A;  3BDD A;  3K1N A;  2RNJ A;  4GO1 A;  4WXD A;  4AWX B;  3GW2 A;  5CVI A;  2JZY A;  1OYY A;  1XMK A;  1B6A A;  3RPQ A;  3BPV A;  1BI2 A;  5CYV A;  3TKY A;  3GFJ A;  4UVC A;  1ZLK A;  3WTZ A;  1JHH A;  5HOO A;  3LST A;  4N0B A;  3DKW A;  1ZRF A;  1QNT A;  1ZRD A;  5DUI A;  5FFX A;  1FYK A;  1FNN A;  3QU6 A;  2JSC A;  2BEO A;  3HOS A;  4RGU A;  4KIC A;  2QEN A;  2XIG A;  5D6E A;  3WTW C;  2J5O A;  2LKP A;  5HVQ C;  1KQ8 A;  1T38 A;  1YW7 A;  2A61 A;  1Z7U A;  2CSO A;  4G7Z F;  2W85 A;  1ZRE A;  1W7P A;  4ESF A;  3SXY A;  3KZZ A;  2P6T A;  3F6V A;  3V4G A;  1OYI A;  1WI9 A;  2L02 A;  3ULQ B;  5F1R A;  5L3E A;  3GZ6 A;  1TW3 A;  2ZBK A;  5KK1 A;  3HRU A;  4HYE A;  4XLN F;  2ELH A;  2GZW A;  3JTG A;  2PG4 A;  3QPT A;  3TOA A;  4CO8 A;  2V1D A;  2RVC A;  2IJL A;  4WK8 F;  3V8L A;  3SZP A;  2X0L A;  3I54 A;  1G4D A;  4IRG A;  1Q1H A;  2VBY A;  3F23 A;  2ZKZ A;  2KIU A;  2DTR A;  4EJU A;  2IA1 A;  5ICE A;  3KLO A;  1YTY A;  2V1U A;  2QBY B;  3PFI A;  5IT3 A;  3SQN A;  3OV8 A;  1IN8 A;  4KMF A;  4WCG A;  3GFL A;  2HGC A;  1YIO A;  2NNN A;  4OIN F;  4U0W A;  1J75 A;  4M72 A;  3U9G A;  1SMT A;  3MEX A;  5D5U B;  2HDC A;  4PGG A;  3CUQ A;  3VB2 A;  4D0P A;  1QGP A;  2M87 A;  2PFB A;  4PZJ A;  5LRS A;  5CVJ A;  5DDG A;  1G3W A;  3V8J A;  2XAQ A;  5FB2 A;  5JFR A;  2EFO A;  2PQ8 A;  4DNC A;  5ED4 A;  1HSJ A;  2A68 F;  3K1P A;  4RB1 A;  3KZY A;  2DPU A;  5DYM A;  1KU2 A;  4TV7 A;  5FLX K;  3V7R A;  2XAG A;  1U3E M;  3KP6 A;  5H20 A;  2EV0 A;  2ZO4 A;  1D3Y A;  1I1S A;  4LG0 A;  2STT A;  2Y48 A;  4AIH A;  1XGS A;  3P7N A;  1W4M A;  2FU4 A;  2VN2 A;  1YO5 C;  2IA0 A;  3R0A A;  3WGG A;  3R4K A;  2XRN A;  3DQV C;  3RYP A;  1K6O A;  3FXU A;  1P4X A;  1U5T A;  3HSR A;  5DCF A;  5L3G A;  4G6D A;  4I2O A;  2M30 A;  4FX4 A;  4KN4 X;  3F22 A;  1REP C;  1P4W A;  4LLG F;  3CJN A;  2YX7 A;  4ZH4 F;  3MAJ A;  5BS6 A;  1ZGA A;  5HS9 A;  1O57 A;  1P92 A;  5E8G A;  3KP7 A;  4NB5 A;  1ON1 A;  2ESH A;  4IRH A;  3FHZ A;  4I01 A;  2P4W A;  1BJA A;  2IVM A;  4HW0 A;  2OQR A;  4S05 A;  4U0V A;  1GXP A;  4U0Y A;  4AIJ A;  1DPU A;  1KA8 A;  1FYL A;  3E6B A;  5D4R A;  2GQQ A;  1JGS A;  3R60 A;  1S8N A;  3J81 K;  2DAO A;  2KJB A;  3GO5 A;  5LHI A;  1FPQ A;  4M6Y A;  3ABT A;  3RYR A;  3F21 A;  2O0Y A;  3J7A O;  3WTV C;  4I0B A;  5EEG A;  2XHK A;  2P7V B;  2RDP A;  4RB0 A;  4KDP A;  1O3R A;  4YFK F;  3VOD A;  1U78 A;  1MZB A;  2ZNY A;  4U7B A;  5H6R A;  1IAW A;  3IL2 A;  4ENK A;  2XKP A;  4LMY A;  2RV8 A;  4RS8 A;  1R5G A;  3J81 Z;  3V7S A;  3HUG A;  3KP3 A;  1OYW A;  3M8E A;  1UHM A;  2F5F A;  2LF7 A;  4WXH A;  1V3F A;  3B73 A;  4KT5 C;  3PQJ A;  2OA4 A;  5ILS A;  4IHT A;  4O6J A;  1R23 A;  2K4B A;  2YX4 A;  3ZN0 A;  2WV0 A;  4HQM A;  3WOD F;  1O7F A;  2H94 A;  1YW8 A;  4S04 A;  2PMH A;  3TOB A;  3GLX A;  3ZMT A;  1IN7 A;  2FBK A;  4G8X A;  2VC1 A;  2PMU A;  4EJO A;  5FD6 A;  5HLH A;  4L0Y B;  5HLG A;  4BYY A;  2D1V A;  3KP5 A;  3V7C A;  4LB6 B;  1K79 A;  1EH6 A;  2BYV E;  2C6Y A;  2D1H A;  4M73 A;  4IF4 A;  1KU7 A;  3TDU C;  2FE3 A;  1LQ1 A;  1B9M A;  4RB2 C;  1ZG1 A;  5IT9 K;  3R61 A;  1O3Q A;  3NRV A;  2HEO A;  1WSU A;  2VBZ A;  2EFW A;  2VBW A;  2BBY A;  3D5L A;  3RI4 A;  5LGU A;  1ZRC A;  4GYG A;  5ICF A;  4ENN A;  3OOP A;  4KNY A;  2FRH A;  4UV8 A;  4LK1 F;  1T2K A;  4ZYD A;  2OZU A;  3HIF A;  3G73 A;  2CG4 A;  4HQE A;  1BI3 A;  2DW4 A;  4HA8 A;  2QVO A;  2ZJ2 A;  2Z3Y A;  2GWR A;  2OAZ A;  2YU3 A;  4G7H F;  2WC2 A;  2DK8 A;  1ZG5 A;  2VE8 A;  2IPQ X;  1XD7 A;  4YFN F;  1Z1D A;  5CJ9 A;  4O3M A;  4MTE A;  2JT1 A;  2JPC A;  1FBQ A;  3J80 Z;  4L9V A;  1IXR C;  2MA3 A;  1IF1 A;  2DBB A;  4EJV A;  1Z6T A;  2JTV A;  1TQP A;  3DFG A;  4Y15 A;  3HRT A;  3KCC A;  2VXZ A;  5IT9 Z;  5E1Z B;  1PDN C;  4KMU X;  2XAF A;  3GWZ A;  4L5J A;  3GFM A;  2FBH A;  3HSE A;  3I59 A;  4YIF A;  2X4H A;  3CUQ B;  3BP8 A;  3D0S A;  5K5R A;  5AIP A;  2DQR A;  5LGN A;  2GIV A;  4OIQ F;  1UB9 A;  2FMY A;  4HX4 A;  1GHC A;  3REO A;  1R1U A;  2MH9 A;  3RTR A;  4WXC A;  5HDK A;  2R7D A;  3BJ6 A;  3L2C A;  2V1X A;  4CIC A;  4Y13 A;  3P9I A;  3Q9S A;  1P2F A;  2M8E A;  4MNU A;  4GCV A;  3ZMZ A;  2ISY A;  4KIG A;  3E5X A;  4EGY A;  2L4M A;  5D4S A;  4BXU A;  2LDU A;  1YW9 A;  2H6B A;  1IXC A;  2VE9 A;  2DFI A;  2Q0O A;  3E5U A;  2PN6 A;  2HWV A;  2D2W A;  2ZFW A;  4M71 A;  1W5S A;  2ESN A;  3N4M A;  4IVN A;  1U5T C;  2QQ9 A;  1P6R A;  4XLP F;  2FNP A;  1HKQ A;  3MWM A;  1R58 A;  3BJA A;  2LSO A;  2XAS A;  2A07 F;  3MZY A;  1TNT A;  2MLK A;  3COA C;  2GA1 A;  4XSX F;  1I27 A;  5F64 A;  4HF1 A;  1O7L A;  1U5T B;  4WWC A;  1R36 A;  2ADU A;  1LDK B;  2P5K A;  3IWF A;  2HQN A;  2MD5 A;  4FT8 A;  3B02 A;  1B9N A;  1IW7 F;  1TBX A;  1J0R A;  2J5P A;  4HLX A;  1SFU A;  5LHH A;  2CFX A;  3WGI A;  3E97 A;  1OKR A;  1SD7 A;  3P9C A;  3WG9 A;  5CVR A;  3QP5 A;  3I4P A;  4Q5S F;  2YR2 A;  4BAY A;  1TQM A;  1TTY A;  1UHW A;  3HRM A;  2ZCW A;  3I71 A;  5D6F A;  1FYM A;  1XDU A;  2FXA A;  1QZY A;  1KU3 A;  4MQ9 F;  4ON0 A;  2QUF A;  2HQR A;  5AON A;  1SMY F;  3GFI A;  1UCR A;  3CO6 C;  1B1B A;  3QU3 A;  2HKX A;  4GXO A;  2NNY A;  1QO0 D;  5LEJ A;  4MEY F;  2O03 A;  2ZME B;  2VON A;  2A6E F;  1T6S A;  2VT3 A;  3MZH A;  1U6G A;  5JHU A;  2MC3 A;  1R22 A;  1GVJ A;  4UUV A;  4KIB A;  4EMS A;  2LNB A;  2EV5 A;  4HZF A;  3ZMV A;  2CGP A;  3GYH X;  4Q47 A;  1T0F A;  3RKW A;  4NHJ A;  3FWE A;  3C3W A;  5F6F A;  5ILV A;  1HST A;  2E1N A;  4EM2 A;  1J5Y A;  2F5D A;  3M7G A;  4R79 A;  1YYV A;  3LQR A;  4LLL A;  1AWC A;  2A3S A;  1MD0 A;  2GAU A;  4OOI A;  3ELK A;  3HHG A;  4UVA A;  4WF2 A;  1L3L A;  5LEK A;  5LLQ A;  3RJP A;  3IKT A;  4LD5 A;  3EQL F;  2V6C A;  2R3S A;  1D5V A;  3ZQ7 A;  3R6S A;  3VFZ A;  3KEO A;  4BHB A;  1IUY A;  4M9S A;  3LAP A;  2H09 A;  3QOP A;  2KIF A;  4H0E A;  4QWQ A;  1J59 A;  3O3K A;  5J6X A;  1LEB A;  2QYO A;  1YS7 A;  3SFZ A;  1TW2 A;  2HOE A;  3I53 A;  5E18 F;  3TO6 A;  2W25 A;  3F8N A;  2UWM A;  2YPR A;  5D5X B;  3L00 A;  4P5O A;  2ETH A;  1J9I A;  4G9Y A;  4E70 A;  4JQF A;  1P4A A;  4ENM A;  1Z9C A;  2DPD A;  2A5Y B;  4LLN A;  2IRF G;  4O5V A;  2CW0 F;  3ERE D;  3K0L A;  4ZZL A;  3WU0 A;  1XSD A;  5FD5 A;  2FF4 A;  5D8L B;  3FMR A;  2QQB A;  3JAM K;  4UVB A;  5L3B A;  4LJZ F;  1LDD A;  2HTS A;  1WKM A;  2E7X A;  2UZK A;  3AAF A;  4IJA A;  4LB5 A;  3RKX A;  3C18 A;  4LGW A;  5FLX Z;  1GXQ A;  1B59 A;  2L3D A;  2HTJ A;  2B0L A;  4EGZ A;  4HV5 A;  2D45 A;  1I5Z A;  5HS8 A;  2H6C A;  2DI3 A;  2ACJ A;  2A69 F;  1F4K A;  4KYW A;  1S7O A;  1IN6 A;  3FM3 A;  4A6E A;  2P8T A;  1LNW A;  2GXB A;  1WQ2 A;  2XVC A;  5JI6 A;  2A6H F;  5DD8 A;  2P6S A;  4ZYH A;  3ZMU A;  3L09 A;  1OMI A;  1D8J A;  5TRD A;  4ETS A;  4KFC A;  1IRF A;  2XAH A;  3IC7 A;  3DPT A;  1QZZ A;  1Z6R A;  4L5I A;  4YG2 F;  3PQK A;  1UFM A;  2EB7 A;  5L3F A;  3LWF A;  1EH7 A;  3GF2 A;  2IT0 A;  5ICC A;  1XGN A;  3DF8 A;  3LQQ A;  2KKO A;  3F8B A;  1SD6 A;  4UXN A;  4U7D A;  1S7A A;  2KIM A;  4A5M A;  1BI0 A;  1F1Z A;  3E5Q A;  2O3F A;  1QBJ A;  2XRO A;  4ESB A;  4HLY A;  5E17 F;  4ENJ A;  1MDM B;  2PI0 A;  5HLI A;  3LA2 A;  1K78 B;  1FOK A;  2FSW A;  3T8R A;  2W24 A;  4AIK A;  1O3T A;  1BC8 C;  1J2X A;  4B8X A;  1ZAO A;  1PUE E;  3KEQ A;  2UXX A;  2Y75 A;  4ZYE A;  2NS0 A;  2K7L A;  2OZ6 A;  1FLI A;  1S3J A;  3HTS B;  4R1H A;  1F9N A;  4UHT A;  1XGO A;  1G3S A;  2M1B A;  3QPH A;  3EUH A;  1YLF A;  4HV6 A;  3ROU A;  1OR7 A;  3WTY C;  1A04 A;  4AD9 A;  2PBI A;  4RB3 C;  4Q48 A;  1D8K A;  3Q5F A;  1XSV A;  1PP7 U;  2FQ3 A;  1IXS B;  3FZV A;  3QP6 A;  3T5X A;  2VOP A;  1U2W A;  1Z91 A;  3CDH A;  3H3U A;  2CO5 A;  3R0J A;  1XMA A;  3BZ6 A;  4CGZ A;  2M45 A;  3QRF F;  4GGG A;  2P5L C;  1S29 A;  3O6B B;  3VOE A;  4G94 A;  2PLY A;  3G3Z A;  1HBX G;  1XCV A;  3GVA A;  4EQQ A;  3BOQ A;  4RGS A;  3C7J A;  1SFE A;  3W6K B;  2CYY A;  4A6D A;  5AIQ A;  4OIO F;  4OMY A;  3IRR A;  5BQT A;  3FXR A;  3GZ5 A;  3BY6 A;  3RDI A;  1FWZ A;  1DDN A;  4MHG A;  1FSH A;  2ZNZ A;  3P9K A;  4HAM A;  2LF8 A;  2ZME A;  4BHC A;  5K5O A;  3L7W A;  3RKY A;  3KE2 A;  1BOA A;  4K2E A;  2CQK A;  1KGS A;  4ASN A;  1R5H A;  2F5E A;  2E7W A;  2EFQ A;  1STZ A;  5JVT A;  2V79 A;  3K2Z A;  5ICG A;  3RPU A;  2VOO A;  4XBF A;  2NAZ A;  2P5V A;  3LAJ A;  1MDM A;  4I0A A;  1BN5 A;  1ULY A;  2EWN A;  4HF0 A;  5FO5 A;  4ZYG A;  4M9Z A;  1TQI A;  3V8K A;  1MJ9 A;  3GEZ A;  3ISP A;  4LG0 B;  5E8I A;  5DUK A;  3WE2 A;  2Y0M A;  1XCB A;  3E6D A;  2H27 A;  1RZ4 A;  4CZZ A;  4KN7 X;  4I02 A;  4Y17 A;  2DT5 A;  3M8F A;  2Z9O A;  2QWW A;  2VC0 A;  4UV9 A;  4OU0 A;  1WWX A;  2K27 A;  2FBI A;  4HX7 A;  4ZZD A;  3LA7 A;  2EA4 A;  5CVU A;  5FFZ A;  1SFX A;  1I1G A;  4M9X A;  1CF7 A;  4N9I A;  2RQP A;  1R1T A;  2FML A;  3ZPL A;  2EV6 A;  1EV7 A;  3H3Z A;  3CO7 C;  5DV5 A;  3MCZ A;  4RAZ A;  4HX8 A;  3TGN A;  1DPR A;  4FX0 A;  3NEU A;  4EM0 B;  4M6X A;  3VEP A;  3I58 A;  4QLC U;  3TQN A;  1FSE A;  1HW5 A;  4OMZ A;  1H9T A;  6PAX A;  3GUD A;  3CUO A;  2CWE A;  3FXQ A;  3BJO A;  3K1M A;  2FA5 A;  3ZMS A;  1G3Y A;  5ERI A;  3TO9 A;  2Z99 A;  1R1V A;  4KIF A;  1J7K A;  1H0M A;  3H92 A;  3FMS A;  2NRA C;  2O61 A;  3HRS A;  3SZT A;  4CDG A;  3WTX C;  3I59 B;  5FGM A;  3U2R A;  4I98 B;  4KUM A;  1TNS A;  2EFN A;  5HS7 A;  4P55 A;  2JRT A;  1FZP B;  3EYY A;  3JSO A;  3CUQ C;  2EFP A;  5LGT A;  4CYD A;  2AXL A;  1YG2 A;  2O8X A;  5K5Q A;  1FT9 A;  3I64 A;  4UNO A;  3ZN1 A;  2VOD A;  1MGT A;  3M1E A;  2XV4 S;  1O3S A;  2P7C B;  3EET A;  3ABU A;  4F7Z A;  4IHS A;  4RGX A;  1YQA A;  5LHG A;  5BOX A;  4P96 A;  1BIA A;  1HQC A;  2QM3 A;  1F5T A;  2F5C A;  3WTU C;  2STW A;  1R00 A;  2G7H A;  2HS5 A;  1T98 A;  3I0T A;  4PDK A;  2IW5 A;  1FBU A;  3F8F A;  2OQG A;  4HBL A;  3BRO A;  2WTE A;  5E1W A;  3F6O A;  5JR3 A;  5L3D A;  4RAY A;  1JXS A;  3F3X A;  3KFW X;  4HF2 A;  1XSX A;  3T1B A;  2ZXJ A;  4U88 A;  1XDS A;  2K86 A;  5E20 A;  1JE8 A;  2HZT A;  2F2E A;  4BHP A;  5HDG A;  2O6G E;  3ML6 A;  2L4A A;  1HXD A;  4MQV A;  3DXJ F;  4MGR A;  2M5W A;  2HR3 A;  3TO7 A;  3T8T A;  1CGP A;  1ZLJ A;  3GX4 X;  1U8R A;  4M74 A;  1G6N A;  2E1C A;  1HW2 A;  1Y0U A;  5ILU A;  4YII A;  3ZP5 A;  2ISZ A;  2Z33 A;  4EJT A;  3NQO A;  2R7F A;  1VTN C;  2DO7 A;  2KJC A;  2K02 A;  4P9F A;  1IRG A;  3ECH A;  2Q2E A;  2MH2 A;  4GYI A;  3HYI A;  2QZ8 A;  3SHF A;  2PJP A;  3J80 K;  1JHF A;  1XGM A;  4EJW A;  1E17 A;  3E3V A;  4XRF A;  1X3U A;  1ON2 A;  2QQA A;  1MJB A;  4IXA A;  3N97 A;  5LBQ A;  2AS5 F;  2RGV A;  4CHU A;  2NYX A;  2DU9 A;  3IKV A;  3HSF A;  3RIR A;  4JK1 X;  3U1D A;  5BPI A;  1C0W A;  3S2W A;  2QBY A;  2DLL A;  3CTA A;  3M9A A;  1IN5 A;  1CF7 B;  3LFK A;  1Z05 A;  1TLH B;  5DCM A;  4LFU A;  4DQ2 A;  4LK0 F;  3JW4 A;  3KP4 A;  1HW1 A;  4L9T A;  1SD5 A;  4HDV A;  3E6C C;  3O2P E;  4Q4Z F;  3BWG A;  3IHU A;  4KA4 A;  4OIR F;  4MEX F;  1RUO A;  3C1D A;  4L18 B;  3TDZ C;  3MQ0 A;  1BI1 A;  2MLG A;  2PEX A;  5EEH A;  3LA3 A;  5BMZ A;  1USS A;  2BE5 F;  4G7O F;  5D8K B;  3Q9V A;  3KLN A;  3JTH A;  1FP1 D;  2HYG D;  2G9W A;  2IA2 A;  1W7P D;  3DPL C;  3HTU A;  4AVP A;  5L3C A;  4JBA A;  2COM A;  1KU9 A;  2L01 A;  5DCM B;  1K7A A;  2HFH A;  3ZMD A;  1K78 A;  3FM5 A;  1ZN2 A;  4L9N A;  2FEZ A;  5J8C A;  2XUB A;  1BIB A;  1WRJ A;  4NQW A;  5KVR A;  3IRQ A;  1KQ9 A;  1FX7 A;  2GA2 A;  2HKO A;  1B4A A;  5CLS A;  3ECO A;  4FHT A;  1ZH5 A;  4I7H A;  3MFK A;  3BPX A;  1LB2 A;  1ZYR F;  4P9U A;  1L0O C;  2W57 A;  1XB4 A;  4HOB A;  3HOT A;  1I6X A;  1V4R A;  5HDN A;  4I09 A;  4L9J A;  1ODD A;  2OU2 A;  1W5T A;  3DP7 A;  1FP2 A;  1FC3 A;  1ZGJ A;  5H6Q A;  1ZG3 A;  4HDU A;  3KP2 A;  1SD4 A;  1KQ0 A;  2W84 A;  1AOY A;  1IN4 A;  1RNL A;  5E1X A;  3EDP A;  3GXO A;  3WU1 B;  4G6Q A;  3FX3 A;  5BPD A;  4IRI A;  3I5U A;  5A2Q K;  1EH8 A;  1NHA A;  1RUN A;  1H9G A;  5CVV A;  2OBP A;  1MKM A;  3WE3 A;  2V9V A;  4OIP F;  1S6L A;  2GXG A;  2BV6 A;  5A2Q Z;  2VBX A;  1IZ1 A;  1DUX C;  3JSP A;  1BBY A;  2G7U A;  3KET A;  3CLO A;  3WGH A;  1ZHF A;  2KRF A;  4RGR A;  2XGX A;  2EJR A;  1G3T A;  3K69 A;  2DQL A;  3HHH A;  3F72 A;  4PGH A;  2K4J A;  2FOK A;  2JPB A;  3FMQ A;  1YFH A;  4BQA A;  5D5V B;  2HYF A;  4BH9 A;  2IP2 A;  3DV8 A;  1ZAR A;  5K1Y A;  4A0Y A;  3F8C A;  5DD4 A;  1RI7 A;  1LEA A;  4XSZ F;  1HKS A;  2YSR A;  3EYI A;  2XKO A;  2UXN A;  1LVA A;  1UST A;  2OD5 A;  3FF5 A;  4A0X A;  3DEU A;  4Z2Y A;  1BC7 C;  2DK5 A;  2RKH A;  4L0Z B;  1YS6 A;  4B09 A; 
#chains in the Genus database with same CATH topology
 2MBF A;  2VQH A;  3IV5 A;  3CC2 I;  5DEQ A;  1W7P B;  2XAJ A;  1S7E A;  3E6M A;  1RIO H;  1R49 A;  5DS9 A;  3BR2 A;  4CXF A;  4C3I J;  1VQ4 I;  5EYR A;  1KYZ A;  3F8M A;  4E7L A;  3CDL A;  2B7E A;  3E0J B;  4EV0 A;  3IWZ A;  1PP8 F;  4WX9 A;  2CUJ A;  2M34 A;  1QU3 A;  5FKM A;  1LJ9 A;  2RC4 A;  3LSR A;  1LDJ A;  2CMP A;  1R7J A;  4A0Z A;  4BE2 A;  4EM1 A;  5D5W B;  4IPA A;  1SAX A;  1ONV A;  3MN2 A;  3T0Y A;  3LL7 A;  2RN7 A;  1QPM A;  3L9F A;  4YEJ A;  4D7M A;  5J40 A;  2Y69 H;  4XOR A;  3MKZ A;  5CQE A;  2EK5 A;  1TWC J;  2I10 A;  5LD2 C;  2E5Z A;  4M3F A;  1I3A A;  4RAG A;  4M3B A;  4A5N A;  4EVI A;  4BNC A;  2TDX A;  3K9T A;  3JAM Z;  2KLO A;  1FY7 A;  1YE9 A;  1DP7 P;  5LRR A;  2M4G A;  1BL0 A;  2E2H J;  2O7O A;  2L54 A;  1BM9 A;  1KYW A;  4ESJ A;  1IRX A;  4C30 A;  4YFX F;  3WTT C;  1T39 A;  3DBH B;  5FJ8 J;  2COB A;  2HPI A;  1MJA A;  2EA2 A;  2VT2 A;  5TJJ A;  4A12 A;  1PUF B;  3H3V K;  4OWR B;  5GP9 A;  1OPC A;  4PCQ A;  3L2U A;  2AQF A;  2Z5U A;  2Q8K A;  1DGR M;  2WWY A;  1D1B A;  4R8H A;  2VIX A;  1SFK A;  1QQI A;  2JVG A;  2R7Q A;  2X6O A;  1FBS A;  3SFI A;  2QLZ A;  3FIW A;  2IAI A;  1E2X A;  3WTS C;  3DTI A;  3VYU B;  4CUG A;  4N9H A;  3W6J B;  1B8I B;  3QAH A;  3DTE A;  2IS1 A;  5TIS C;  3JRB A;  2BGC A;  2KRC A;  4MTD A;  1T95 A;  2XPU A;  1TT0 A;  4A2U A;  1LFP A;  1JKP C;  4PUS A;  3PNV A;  1HKT A;  5J8F A;  1XN7 A;  2FNA A;  3BDD A;  3K1N A;  1ETY A;  2RNJ A;  4GO1 A;  4WXD A;  2V9K A;  4AWX B;  1X58 A;  3GW2 A;  4D5C A;  1HC8 A;  2IXS A;  5CVI A;  1HF0 A;  2JZY A;  3X2Q H;  1OYY A;  1XMK A;  3PO3 J;  1B6A A;  1WJD A;  3RPQ A;  3BPV A;  3HBL A;  1X19 A;  2VUM J;  1YRN A;  1BI2 A;  5CYV A;  3TKY A;  3GFJ A;  4UVC A;  4J00 A;  1ZLK A;  3WTZ A;  5KCM A;  5K7H A;  1JHH A;  5HOO A;  5GTH C;  3M3Y J;  3DEE A;  1HOM A;  2L5Q A;  5E3O A;  3DLL F;  3LST A;  4N0B A;  3L2Q A;  3BLY A;  3DKW A;  1ZRF A;  4XOT A;  1FOX A;  1QNT A;  2IGK A;  1ZRD A;  4D9J A;  5DUI A;  1ERD A;  3CZ6 A;  5FFX A;  1FYK A;  5C4X J;  4XRS G;  1FNN A;  3QU6 A;  2JSC A;  4JX4 A;  2BEO A;  3IH3 A;  3HOS A;  4RGU A;  3GTK J;  1I6H J;  4KIC A;  5F0H A;  3GTL J;  3OYA A;  3ZQF A;  1JJ6 C;  2QEN A;  2XIG A;  5D6E A;  3WTW C;  2J5O A;  2LKP A;  5HVQ C;  1KQ8 A;  4X6A J;  3BG7 A;  1T38 A;  1A6Q A;  1QA6 A;  1YW7 A;  2A61 A;  1Z7U A;  2CSO A;  1ZTR A;  4G7Z F;  2W85 A;  3CLQ A;  1Y8R B;  1NH3 A;  1ZRE A;  1W7P A;  4ESF A;  4UY8 I;  2DCE A;  3C2B A;  4AM3 A;  3SXY A;  3DU5 A;  1TT5 B;  2WB1 A;  3KZZ A;  4BBS J;  1VQL I;  2P6T A;  3OL4 A;  2EQR A;  3F6V A;  3V4G A;  3CMY A;  4I6Z A;  1OYI A;  1GDT A;  1WI9 A;  2L02 A;  3ULQ B;  5F1R A;  4ZC3 A;  5L3E A;  3GZ6 A;  1TW3 A;  4B3A A;  2ZBK A;  5KK1 A;  2DFF A;  3HRU A;  4HYE A;  4XLN F;  3TED A;  1P7J A;  1T56 A;  2ELH A;  2GZW A;  3JTG A;  3ZQL A;  2PG4 A;  4NC8 A;  1LE8 A;  4M3E A;  3QPT A;  4AU7 A;  3TOA A;  5B5E C;  2X1C A;  2MSY A;  2DYR H;  2Y2Z A;  4CO8 A;  1WJ5 A;  2V1D A;  3K4B A;  2HOS A;  2RVC A;  2R7T A;  2IJL A;  3DLA A;  4WK8 F;  2IS6 A;  2LK2 A;  2X51 A;  1TWH J;  3HJE A;  4RM2 A;  1ZR4 A;  3HKZ A;  1WGX A;  1QZE A;  1H89 C;  1MBH A;  2R0Q C;  3AL0 C;  3QYB A;  5FRO A;  2CS3 A;  1K4S A;  3V8L A;  1E3O C;  3SZP A;  2X0L A;  3I54 A;  1G4D A;  1OCP A;  3SYT A;  3BG3 A;  1Q1H A;  4IRG A;  2VBY A;  3TP3 A;  2LBF B;  3F23 A;  2ZKZ A;  2KIU A;  4FIS A;  3GZN B;  2CV0 A;  4YIR X;  2M3A A;  2JUC A;  2DTR A;  3H35 A;  4EJU A;  3OS2 A;  3VYS B;  2IA1 A;  4CYC B;  4A3M J;  2VPR A;  3KLO A;  5ICE A;  1YTY A;  2ELJ A;  3AKZ A;  2V1U A;  4H4K C;  3HB9 A;  2QBY B;  3PFI A;  5IT3 A;  3SQN A;  4C2M J;  2R7W A;  2FUG 2;  1WHU A;  3GBG A;  3OV8 A;  2N8G A;  3ABM H;  1HDD C;  1IN8 A;  4KMF A;  4WCG A;  2HDW A;  2HGC A;  1RKT A;  3GFL A;  1YIO A;  2NNN A;  2DMN A;  2VKE A;  4DYQ A;  3LOC A;  1J09 A;  1RES A;  4OIN F;  4U0W A;  4IQJ A;  1J75 A;  4M72 A;  2QGU A;  2VQC A;  2V26 A;  3U9G A;  3CQZ J;  1SMT A;  1WH7 A;  3MEX A;  4BKX A;  5D5U B;  4PGG A;  2HDC A;  3CUQ A;  3VB2 A;  2XF6 A;  2GIZ A;  5FLM J;  5FKK A;  4D0P A;  1QGP A;  1Z21 A;  2M87 A;  2PFB A;  1IRZ A;  4PZJ A;  5LRS A;  5CVJ A;  4PSX A;  5DM7 F;  2LR8 A;  5EG0 A;  4XM3 A;  5DDG A;  1G3W A;  1IDZ A;  3NWT A;  3U1K A;  2OUM A;  3V8J A;  2XAQ A;  5FB2 A;  3HKZ N;  4IHX A;  5JFR A;  2EFO A;  2VI6 A;  2BOL A;  1GVD A;  2PQ8 A;  4DNC A;  5ED4 A;  2JUG A;  1HSJ A;  2A68 F;  3K1P A;  4RB1 A;  2HOA A;  3KZY A;  1MND A;  2WAF A;  5DTD A;  2NXN B;  1KU2 A;  4TV7 A;  5DYM A;  3VPR A;  4E7S A;  2DPU A;  5FLX K;  1N75 A;  2V9P A;  3CJQ B;  4LOC A;  3V7R A;  3MKW B;  3BG6 A;  2IS2 A;  2LLK A;  5M3F J;  3B6C A;  2XAG A;  2EZH A;  4B3X A;  2DDA A;  4BAC A;  2CV2 A;  1U3E M;  3KP6 A;  5H20 A;  2EV0 A;  2ZO4 A;  1D3Y A;  3JCU C;  5J1U A;  3G4S I;  1IV6 A;  2LY9 A;  1JTY A;  3RZD J;  3C2G A;  3MZ8 A;  1I1S A;  4LG0 A;  2XGD A;  4XKC A;  2STT A;  3MD2 A;  2Y48 A;  3U21 A;  1ETX A;  4AIH A;  1XGS A;  1LKX A;  3J7Z I;  3P7N A;  1W4M A;  2FU4 A;  5GPC A;  2VN2 A;  2JA7 J;  1VZ0 A;  3DBR B;  2L0K A;  1FIP A;  1OQY A;  1YO5 C;  2IA0 A;  4NNJ A;  3R0A A;  3WGG A;  3R4K A;  4CCJ A;  2XRN A;  3DQV C;  3Q3S A;  3RYP A;  4A3D J;  2XPW A;  1W0T A;  1K6O A;  3FXU A;  1Z67 A;  2ID6 A;  1W36 C;  1P4X A;  4JX6 A;  4KIT B;  2DA3 A;  2K9S A;  2P0W A;  4I76 A;  1U5T A;  3HSR A;  5DCF A;  5L3G A;  4G6D A;  4I2O A;  2M30 A;  1MNE A;  3M4O J;  5EGO B;  3CCM I;  3KZI C;  5J4V A;  4FX4 A;  1BA5 A;  4KN4 X;  3F22 A;  2NVX J;  1WVR A;  1REP C;  3GCM A;  4ZTJ A;  4U87 A;  4ANJ A;  1P4W A;  4LLG F;  3CJN A;  4A69 C;  2BY3 A;  4XMY A;  2YX7 A;  3ASN H;  5IP7 J;  1VQ6 I;  1MSE C;  2H8W A;  1YRN B;  4ZH4 F;  3MAJ A;  5BS6 A;  4GDF A;  1ZGA A;  5HS9 A;  3JRG A;  1O57 A;  1P92 A;  5E8G A;  3B6A A;  1QRY A;  3KP7 A;  4NB5 A;  1ON1 A;  3OR1 C;  2ESH A;  4IRH A;  3FHZ A;  3HGG A;  4I01 A;  2P4W A;  1BJA A;  2AQE A;  1W0U A;  1TZL A;  2IVM A;  2M9H A;  4HW0 A;  3H0G J;  2OQR A;  4S05 A;  4U0V A;  3G71 I;  3EUH C;  4U0Y A;  2E5N A;  1GXP A;  4AIJ A;  4BJT A;  1DPU A;  3CP8 A;  1SAN A;  1KA8 A;  1W36 D;  1FYL A;  3E6B A;  5D4R A;  1K61 A;  2GQQ A;  2LG4 A;  2JA5 J;  1JGS A;  2JQ7 A;  3R60 A;  1S8N A;  3J81 K;  2DAO A;  2KJB A;  3GO5 A;  5LHI A;  1FPQ A;  3BR3 A;  1NTC A;  4M6Y A;  3ABT A;  3CMA I;  3RYR A;  3F21 A;  2O0Y A;  3S3M A;  3J7A O;  3BTC A;  3W2A A;  1X3Z B;  3BTI A;  3WTV C;  4I0B A;  3V42 A;  1MBE A;  3DPU A;  4ZJZ A;  5EEG A;  2XHK A;  4GFB A;  2P7V B;  2RDP A;  5IOY A;  1R9T J;  4RB0 A;  4KDP A;  1O3R A;  3K4N A;  2D5V A;  4YFK F;  3VOD A;  1U78 A;  1POG A;  4CYC A;  2XB0 X;  1MZB A;  2ZNY A;  4U7B A;  5H6R A;  2NVT J;  2XC7 A;  3CCY A;  2JA8 J;  2Q2E B;  4G6T B;  5IYD J;  1IAW A;  3IL2 A;  4ENK A;  2XKP A;  2VQG A;  2WV1 A;  4XNF A;  4DZP A;  4B4C A;  4RAF A;  3LSK A;  2RV8 A;  3E7L A;  1R5G A;  4LMY A;  4RS8 A;  1AHD P;  3J81 Z;  3S1N J;  3V7S A;  2RNG A;  4B1R A;  4UB8 C;  3HUG A;  3KP3 A;  3CCU I;  2R7Z J;  1OYW A;  3M8E A;  5E3N A;  4XLF A;  1UHM A;  2R7S A;  2F5F A;  2DFH A;  4EEF G;  2LF7 A;  3ZOB A;  4WXH A;  2Y0S N;  2VPL A;  1V3F A;  4IL6 C;  3B73 A;  4KT5 C;  3PQJ A;  1X1C A;  2OA4 A;  3TL4 X;  5ILS A;  1FMV A;  4XLA A;  4O6J A;  4IHT A;  1R23 A;  2K4B A;  2NOG A;  2YX4 A;  2L7F P;  3ZN0 A;  2WV0 A;  3RZO J;  3VYR B;  4HQM A;  1FTT A;  3WOD F;  2DA1 A;  3PFY A;  2DMQ A;  1O7F A;  2H94 A;  2KHM A;  1YW8 A;  3CJR B;  4S04 A;  2PMH A;  2IGN A;  2ECB A;  3TOB A;  3GLX A;  3ZMT A;  1IN7 A;  2FBK A;  3BR0 A;  2R5Z A;  4BXX J;  2DYS H;  4G8X A;  4JYK A;  2VC1 A;  2PMU A;  4EJO A;  2VJJ A;  5FD6 A;  1QHH D;  5HLH A;  4RLQ A;  4L0Y B;  2L9V A;  2EIK H;  5HLG A;  3OR2 C;  3A0H C;  4BYY A;  2D1V A;  3KP5 A;  3V7C A;  3HM5 A;  3K2A A;  3WHC A;  1WI3 A;  4LB6 B;  1K79 A;  1EH6 A;  2BYV E;  2C6Y A;  2D1H A;  3PO2 J;  4M73 A;  1MNM C;  4IF4 A;  1KU7 A;  3TDU C;  2FE3 A;  2DDB A;  2W48 A;  1LQ1 A;  1B9M A;  2MW8 A;  1UAA A;  4RB2 C;  1ZG1 A;  5IT9 K;  2WAE A;  3R61 A;  1O3Q A;  3NRV A;  4N4N B;  3S2D J;  4DZJ A;  2HEO A;  2MD0 A;  1WSU A;  1Y39 A;  2R5Z B;  2VBZ A;  2FD5 A;  3HOX J;  2EFW A;  2VBW A;  2BBY A;  1OJL A;  3D5L A;  1T0F C;  1V5F A;  4C9Y A;  3RI4 A;  2R7U A;  5LGU A;  5J1R A;  1LUJ B;  3CC7 I;  4DOZ A;  1ZRC A;  4GYG A;  5ICF A;  4ENN A;  1JKO C;  3OOP A;  3W2V A;  4KNY A;  1R5I D;  2FRH A;  2ID3 A;  4UV8 A;  4LK1 F;  4L5E A;  5B66 C;  2Z1D A;  1T2K A;  4ZYD A;  4BS9 A;  2H1L A;  1MBG A;  2OZU A;  2TCT A;  3HIF A;  1MMA A;  3G73 A;  4FTH A;  2HZD A;  1HA8 A;  5HLT A;  4XID A;  2CG4 A;  3M07 A;  3K10 A;  4HQE A;  3LNQ A;  1BI3 A;  2E36 A;  2DW4 A;  4HA8 A;  2DOD A;  2VJ4 A;  2QVO A;  3HOW J;  2ZJ2 A;  1W1W E;  2W82 A;  4MO7 A;  2Z3Y A;  3EPZ A;  4PJM A;  2GWR A;  2YU3 A;  2OAZ A;  4G7H F;  2WC2 A;  2DK8 A;  1ZG5 A;  4QTR A;  2VE8 A;  4RBO A;  2IPQ X;  1XD7 A;  4LIV A;  2X6Y A;  2R5Y B;  2KMU A;  1ETO A;  4YFN F;  1Z1D A;  5CJ9 A;  4O3M A;  3BTL A;  4MTE A;  2DOF A;  2JT1 A;  2JPC A;  2WAD A;  3WHB A;  2QSH X;  1FBQ A;  2BVM A;  4UUS A;  1G8X A;  4QPQ A;  3J80 Z;  1DU0 A;  1E3P A;  1Q1V A;  5GPA A;  2JWT A;  3GLL A;  1RET A;  4L9V A;  2KRH A;  1IXR C;  2MA3 A;  1IF1 A;  4IEJ A;  2DBB A;  3DU6 A;  3BCA A;  2LVS A;  4EJV A;  1ETV A;  2XF5 A;  2NVQ J;  3HGY A;  1Z6T A;  4E7I A;  2VL8 A;  3G1M A;  2JTV A;  1TQP A;  3DFG A;  1QVU A;  4Y15 A;  3HRT A;  3KCC A;  2VXZ A;  5IT9 Z;  5E1Z B;  1PDN C;  4OAY A;  4KMU X;  2XAF A;  3GWZ A;  3ZCO A;  4L5J A;  3GFM A;  2FBH A;  3HSE A;  2IEK A;  3NWS A;  3I59 A;  4YIF A;  2X4H A;  5J47 A;  3CUQ B;  5KHD A;  3A01 A;  3OIP A;  3QOD A;  5EEA A;  3MVP A;  3BP8 A;  3Q0U A;  2ME0 A;  2R7X A;  3D0S A;  1BOB A;  1O4X A;  5K5R A;  5AIP A;  2DQR A;  3BZC A;  4D7N A;  5LGN A;  4IZZ A;  2GIV A;  5HOD A;  2BHY A;  4IHV A;  4OIQ F;  1UB9 A;  2FMY A;  4HX4 A;  4BJ6 C;  1GHC A;  3REO A;  1R1U A;  2ZXI A;  1IC8 A;  1E3H A;  2MH9 A;  1AU7 A;  3RTR A;  4WXC A;  5J3L A;  1PYV A;  5HDK A;  2R7D A;  2IS4 A;  2MFZ A;  3PSF A;  4KT6 A;  3BJ6 A;  4RA2 A;  1D1C A;  3L2C A;  1V55 H;  2V1X A;  4CIC A;  4ZDO A;  2L7K A;  2TRT A;  3CC4 I;  1B72 B;  1WFX A;  4IOC F;  1U9N A;  3HL2 A;  4Y13 A;  4V19 K;  3OYH A;  4A93 J;  4M3G A;  3P9I A;  2EIL H;  3Q9S A;  2W7N A;  1P2F A;  3MMY B;  2M8E A;  1FMW A;  2R4G A;  4HNU A;  1T33 A;  4MNU A;  3OYI A;  1VQ5 I;  3GTP J;  3CCJ I;  4GCV A;  3ZMZ A;  1IG7 A;  2ZSH B;  2ISY A;  4AUX A;  4C2U A;  4KIG A;  3HOZ J;  2MGQ A;  1LVK A;  3E5X A;  4EGY A;  2L4M A;  4AVZ A;  3P5J A;  3LFU A;  2P81 A;  4Y33 A;  4QIW N;  4XKW A;  5D4S A;  3AG4 H;  3NAR A;  4BXU A;  2LDU A;  1YW9 A;  1VFC A;  2H6B A;  1IXC A;  2VE9 A;  1I50 J;  2DFI A;  1GV5 A;  5IP9 J;  2Q0O A;  3E5U A;  4W97 A;  2PN6 A;  1XPX A;  1SVO A;  2HWV A;  2KQR A;  2D2W A;  2EZI A;  2ZFW A;  4M71 A;  3W3C A;  2RQQ A;  2OC6 A;  1W5S A;  2ESN A;  3N4M A;  2O8K A;  1JI8 A;  4IVN A;  2XF7 A;  3S15 J;  5HNH A;  4HNV A;  1U5T C;  2QQ9 A;  1K83 J;  1P6R A;  4XLP F;  2FNP A;  1HKQ A;  3MWM A;  1R58 A;  3BG5 A;  3BJA A;  2LSO A;  2XAS A;  1VQ9 I;  4LG3 A;  3KPH A;  1ETQ A;  2A07 F;  3MZY A;  5CKT A;  4BE0 A;  1TNT A;  1JJ8 C;  2HDD A;  2MLK A;  3COA C;  4NBQ A;  2GA1 A;  4XSX F;  1I27 A;  5F64 A;  3JRD A;  1OLT A;  1O7L A;  4HF1 A;  1U5T B;  4WWC A;  1R36 A;  3SEZ A;  4BQQ A;  2JK3 A;  3I4N J;  2ADU A;  1LDK B;  2P5K A;  3IWF A;  2HQN A;  4I99 C;  3LSG A;  2MD5 A;  5F0F A;  4FT8 A;  3B02 A;  1B9N A;  1IW7 F;  1TBX A;  2KZV A;  1J0R A;  4F55 A;  4ITV A;  2J5P A;  3C2H A;  4HLX A;  1SFU A;  5LHH A;  3FXK A;  2CH0 A;  2CFX A;  4PJL A;  3WGI A;  5JLW A;  3E97 A;  1OKR A;  1SD7 A;  3P9C A;  5GAD J;  1YJN I;  2V7F A;  5IY5 H;  3WG9 A;  5CVR A;  1CQT A;  3QP5 A;  1S9H A;  3I4P A;  4Q5S F;  2ECC A;  3CJT B;  1UJ8 A;  2YR2 A;  4BAY A;  1TQM A;  1UHW A;  1TTY A;  2VKV A;  3S3N A;  3HRM A;  2DN0 A;  2ZCW A;  3I71 A;  1EKE A;  1U9O A;  5D6F A;  1FYM A;  1XDU A;  2FXA A;  5JLX A;  1QZY A;  1KU3 A;  2LP0 A;  4MQ9 F;  4ON0 A;  1MMG A;  2QUF A;  2HQR A;  3HG9 A;  1SMY F;  5AON A;  3GFI A;  1UCR A;  4F91 B;  1B1B A;  3CO6 C;  5FKL A;  3QU3 A;  1JUS A;  2HKX A;  4X1E A;  4GXO A;  2NNY A;  1QO0 D;  5LEJ A;  4XN0 A;  4MEY F;  4MLO A;  2O03 A;  2E19 A;  1T08 B;  1BR4 A;  2ZME B;  2E71 A;  2A6E F;  1T6S A;  2VON A;  1QPI A;  5IOZ A;  2VT3 A;  4FE7 A;  1U6G A;  5JHU A;  3MZH A;  2MC3 A;  1R22 A;  3S8P A;  2DMT A;  5K7Z A;  1GVJ A;  4UUV A;  2ZME C;  1AKH A;  4KIB A;  4EMS A;  2LNB A;  4V2F A;  2EV5 A;  4HZF A;  3ZMV A;  4BE1 A;  2DA6 A;  2CGP A;  3H1C A;  3GYH X;  4Q47 A;  1T0F A;  2PJR B;  3RKW A;  4NHJ A;  3FWE A;  3C3W A;  1XMX A;  5F6F A;  5ILV A;  1WJA A;  1HST A;  2E1N A;  4J19 A;  4EM2 A;  1J5Y A;  2E1M C;  2F5D A;  3M7G A;  5CPR B;  3MKY B;  4R79 A;  4IHY A;  1YYV A;  4ZTF A;  4XRM A;  3LQR A;  4LLL A;  1AWC A;  2A3S A;  1MD0 A;  2OCC H;  2GAU A;  3CMM A;  3JRI A;  1A35 A;  4NQW B;  4OOI A;  3ELK A;  3HHG A;  4GRI A;  4E7J A;  4UVA A;  4WF2 A;  1L3L A;  5LEK A;  1NG6 A;  4AC0 A;  5LLQ A;  4PJN A;  3GME A;  3HOY J;  2R7O A;  2VAS A;  3RJP A;  3IUO A;  4DGW B;  4J01 A;  3QQA A;  3IKT A;  3CF2 A;  3I56 I;  1FEX A;  2FX0 A;  3BZK A;  4LD5 A;  3EQL F;  2V6C A;  1HLV A;  3Q0W A;  2R3S A;  1ACI A;  4RDU A;  3HXL A;  1D5V A;  3ZQ7 A;  3R6S A;  4HEA 2;  4JX5 A;  3S1R J;  3RPU D;  3VFZ A;  3KEO A;  4BHB A;  1IUY A;  2X6X A;  2X1D A;  4M9S A;  3LAP A;  2H09 A;  3QOP A;  3VYT B;  5HNF A;  2KIF A;  4Z6Y A;  2WY7 Q;  4H0E A;  1YX3 A;  4QWQ A;  3FBN B;  1HCR A;  2YS9 A;  4IHW A;  1A5J A;  1JKQ C;  3ASO H;  1J59 A;  3I55 I;  4IQ4 A;  1X2N A;  5EJC A;  3ZQI A;  3O3K A;  1VQP I;  5J6X A;  3OOU A;  1LEB A;  5EF6 A;  2LY1 A;  2QYO A;  2A6T A;  5B3S H;  1YS7 A;  1OIS A;  1TW2 A;  2HOE A;  3SFZ A;  3I53 A;  1Z3X A;  2VKH A;  5E18 F;  3TO6 A;  1IV8 A;  1ZK8 A;  2W25 A;  3F8N A;  1OCC H;  2V1N A;  2UWM A;  2FOW A;  3AG2 H;  2YPR A;  4S0H B;  2R93 J;  5D5X B;  3LSM A;  3OYE A;  3L00 A;  4P5O A;  1ZQ3 P;  2LTP A;  2ETH A;  3S1Q J;  3A2K A;  1WH5 A;  1J9I A;  4XRS A;  4G9Y A;  2K9Q A;  4E70 A;  4JQF A;  1XG1 A;  1P4A A;  4ENM A;  1Z9C A;  5BNG A;  2DPD A;  1WPK A;  2XRL A;  2A5Y B;  4RM3 A;  3SDG A;  1VQK I;  4LLN A;  4E7K A;  2B9S A;  2IRF G;  4O5V A;  2CW0 F;  3ERE D;  1B8I A;  1UG0 A;  3K6G A;  3PJR A;  3K0L A;  2RAE A;  2E60 A;  3SEQ A;  4BU2 A;  5KAF C;  4ZZL A;  2KP6 A;  1Y6I A;  3WU0 A;  2HPM A;  2PMZ A;  1XSD A;  3ZRG A;  1UG2 A;  5FD5 A;  2FF4 A;  5D8L B;  4A3F J;  2DT7 B;  3G6E I;  3FMR A;  3TW7 A;  4IX7 A;  2QQB A;  1JTX A;  3JAM K;  4UVB A;  5L3B A;  5IYC J;  3S3O A;  3HUG B;  3ZQC A;  1LFU P;  4LJZ F;  1V5E A;  2XGE A;  2XGC A;  3HEF A;  3QYF A;  1LDD A;  2DT6 A;  2HTS A;  4NC6 A;  1WKM A;  2UUZ A;  2UV1 A;  4IKF A;  4C2T A;  4DJA A;  4BQO A;  2E7X A;  1X3W B;  5E3M A;  2UZK A;  3AAF A;  2CQX A;  4IOA F;  4IJA A;  3GTQ J;  1XTA A;  4LB5 A;  3RKX A;  2KIS A;  3C18 A;  3FDY A;  3ONQ A;  1MBF A;  4LGW A;  5FLX Z;  1GXQ A;  4IO9 F;  3TMO A;  1B59 A;  2L3D A;  2HTJ A;  4Y4R A;  2B0L A;  1X1B A;  4EGZ A;  2CW7 A;  3OL3 A;  4HV5 A;  2ICW G;  3KX2 A;  3BT9 A;  1I5Z A;  2D45 A;  4XL9 A;  2EBI A;  1YJ9 I;  4Y3O A;  5HS8 A;  2H6C A;  2DI3 A;  2ACJ A;  4PJJ A;  1LPQ A;  4HRI A;  2WBM A;  1MH4 A;  2R7V A;  2A69 F;  4XLC A;  2F4I A;  4UUS B;  4HPQ A;  1F4K A;  1DGW Y;  4KYW A;  1S7O A;  1X4P A;  2DTZ A;  3K70 C;  3SJM A;  1IN6 A;  3QYE A;  3FM3 A;  4A6E A;  2F48 A;  2P8T A;  3S2H J;  3OYN A;  1LNW A;  2GXB A;  4AID A;  1WQ2 A;  2XVC A;  1EF4 A;  5JI6 A;  1RR7 A;  2VXD A;  3OYC A;  1U0J A;  2A6H F;  2VB6 A;  3D5R C;  5DD8 A;  5CQG A;  2P6S A;  3KEY A;  4ZYH A;  2GBY A;  4XR6 A;  3ZMU A;  3L09 A;  3TW6 A;  1OMI A;  1TC3 C;  1D8J A;  1IDY A;  2ELK A;  5TRD A;  1Z0X A;  1HDP A;  3A02 A;  4ETS A;  4KFC A;  5FKO A;  1IRF A;  2XAH A;  3IC7 A;  4DBR A;  2VQL A;  3DPT A;  1QZZ A;  1Z6R A;  2HQ5 A;  4L5I A;  4YG2 F;  3PQK A;  3F9K A;  1UFM A;  2EB7 A;  2K40 A;  5L3F A;  3PIO F;  3LWF A;  1EH7 A;  3GF2 A;  3H9G A;  2DJN A;  2W1O A;  4F93 B;  2IT0 A;  1RRJ A;  3K4L A;  2CW8 A;  5FKN A;  5ICC A;  1XGN A;  3NAU A;  3H5N A;  4B48 A;  3DF8 A;  3LQQ A;  2KKO A;  4Y7N J;  1RPW A;  3F8B A;  1BW5 A;  1SD6 A;  4UXN A;  4U7D A;  5FRN A;  1X1P A;  1S7A A;  2X48 A;  2KIM A;  1NK2 P;  4A5M A;  1VQ8 I;  3I9V 2;  1BI0 A;  1F1Z A;  2E1M B;  2HOT A;  2K3F A;  3E5Q A;  2O3F A;  1FOW A;  2DA5 A;  3BCB A;  2JN6 A;  1QBJ A;  4JP0 A;  2XRO A;  2M2E A;  3FXJ A;  4BY1 J;  4ESB A;  2KT0 A;  3M8J A;  2F5V A;  4HLY A;  5E17 F;  2NVU B;  4M3D A;  4ENJ A;  1MDM B;  1G2H A;  2PI0 A;  5HLI A;  1PVE A;  4P1W A;  1R71 A;  2QCO A;  3LA2 A;  3TBI A;  4XN3 A;  1K78 B;  1D0Y A;  5F0C A;  2LRD A;  2JJ7 A;  1FOK A;  2FSW A;  1K6Y A;  2AO9 A;  3T8R A;  2W24 A;  4RMN A;  1V5G A;  4AIK A;  1O3T A;  1JKR C;  1BC8 C;  1J2X A;  1RKW A;  4B8X A;  1ZAO A;  2OJE D;  1MMN A;  2KZG A;  1PUE E;  3KEQ A;  5J4Y A;  2UXX A;  2Y75 A;  3HC7 A;  4ZYE A;  5IPA A;  3AFH A;  1EA3 A;  2ME6 A;  4E6K G;  2NS0 A;  2K7L A;  1G59 A;  2OZ6 A;  1DQU A;  1FLI A;  1S3J A;  1Z7L A;  3HTS B;  2QQ8 A;  4R1H A;  1FJL A;  1F9N A;  2PJR A;  1FTZ A;  4A3G J;  1MMS A;  2M7A A;  4UHT A;  5EGO A;  1D1A A;  1XGO A;  3DTK A;  1G3S A;  2M1B A;  1JT6 A;  3QPH A;  2OTJ I;  3EUH A;  4C3H J;  1YLF A;  4HV6 A;  3DKX A;  3ZQH A;  3ROU A;  1OR7 A;  3WTY C;  2XB5 A;  1S72 I;  1A04 A;  2EIJ H;  1M1E B;  1P7I A;  2LRE A;  3UNG C;  4AD9 A;  2PBI A;  4RB3 C;  2L7Z A;  4Q48 A;  2JVH A;  1D8K A;  5C44 J;  2CU7 A;  3Q5F A;  1XSV A;  3ZR8 X;  4DW6 A;  1PP7 U;  2FQ3 A;  4FET A;  1IXS B;  1YIT I;  2CFO A;  3FZV A;  3QP6 A;  3T5X A;  1ZGW A;  4DIQ A;  1APL C;  2VOP A;  3ZGK A;  1U2W A;  2NOJ B;  1BW6 A;  1Z91 A;  2LKS A;  3CDH A;  1IUF A;  3H3U A;  3Q0V A;  2CO5 A;  4BEH B;  3R0J A;  1MW7 A;  1XMA A;  2F4O B;  3BZ6 A;  4CGZ A;  2M45 A;  3QRF F;  2BY0 A;  2NVY J;  4GGG A;  3VSL A;  2HVS A;  2CRG A;  1V54 H;  2I8D A;  1OCR H;  2P5L C;  1SEU A;  2GOX B;  1D0Z A;  1S29 A;  3O6B B;  4G94 A;  3VOE A;  2PLY A;  3G3Z A;  1Y1W J;  1HBX G;  1MSF C;  2LC2 A;  3JRE A;  1XCV A;  3GVA A;  1JUP A;  1ETW A;  4EQQ A;  1MIJ A;  3BOQ A;  4RGS A;  3CF5 F;  3C7J A;  2DA4 A;  1SFE A;  3TP0 A;  3W6K B;  2CYY A;  5TGT A;  4QPO A;  2E34 A;  4A6D A;  2Z2S B;  1P9Q C;  2VJI A;  2KDZ A;  1AA7 A;  2Y0S A;  3A01 B;  1WZ2 A;  3QOE A;  5AIQ A;  2ZJQ F;  3S17 J;  2E1O A;  2DMU A;  4OIO F;  1UEL B;  3GTM J;  1AKH B;  4OMY A;  3IRR A;  5BQT A;  3FXR A;  3GZ5 A;  3BY6 A;  3RDI A;  4A3B J;  1FWZ A;  1OCZ H;  1DDN A;  4MHG A;  4RLF A;  3D5S C;  1FSH A;  3FK7 A;  3H5R A;  1MBJ A;  2ZNZ A;  3P9K A;  4HAM A;  1T8I A;  2LF8 A;  2ZME A;  5M5W J;  1N25 A;  4BHC A;  5K5O A;  2E35 A;  3L7W A;  3OYB A;  3RKY A;  3KE2 A;  1BOA A;  4K2E A;  2CQK A;  2CJJ A;  1KGS A;  3PM1 A;  4ASN A;  1R5H A;  2F5E A;  2E7W A;  2EFQ A;  1STZ A;  5JVT A;  3RQ4 A;  2V79 A;  3K2Z A;  2G0E A;  5ICG A;  2HQA A;  3RPU A;  3L2R A;  3OSF A;  2VOO A;  1IJW C;  3I4M J;  1BR2 A;  4XBF A;  3FKI J;  5M5Y J;  2NAZ A;  2P5V A;  1VND A;  3LAJ A;  2V6E A;  2PX9 A;  1Y8Q B;  3EUK L;  1MDM A;  3OMY A;  4I0A A;  1BN5 A;  1ULY A;  4CA0 A;  2EWN A;  4HF0 A;  5FO5 A;  1XX5 A;  3IH4 A;  4BDZ A;  3AG1 H;  4ZYG A;  4HNT A;  1Y0N A;  4M9Z A;  5J1Y A;  2OF7 A;  3LSH A;  3K70 D;  3OYL A;  1TQI A;  3V8K A;  1MJ9 A;  4V2G A;  3FK6 A;  3GEZ A;  4PK4 A;  3ISP A;  1SC7 A;  3BR1 A;  3AL0 B;  1ZKG A;  4LG0 B;  5E8I A;  2JA6 J;  1NG7 A;  5DUK A;  4A3K J;  1DP3 A;  2WAQ A;  3WE2 A;  2GOM A;  2Y0M A;  4II2 A;  1XCB A;  2HI3 A;  3E6D A;  2H27 A;  2XSJ C;  1RZ4 A;  2WA0 A;  3J7Y J;  3UR3 C;  3PL8 A;  4CZZ A;  4PFO A;  4KN7 X;  4I02 A;  4Y17 A;  3OYG A;  2ZXH A;  1IO2 A;  5C4J J;  1LE8 B;  2DT5 A;  3W6V A;  2YU9 J;  3M8F A;  1ZEL A;  2Z9O A;  2QWW A;  2VC0 A;  4B44 A;  1X4O A;  4UV9 A;  2W00 A;  4OU0 A;  1WWX A;  2K27 A;  2FBI A;  4HX7 A;  4ZZD A;  3LA7 A;  3G2B A;  2HU9 A;  2LMD A;  5EG0 B;  2X85 A;  2HXO A;  2K85 A;  4CSW A;  2EA4 A;  3DCF A;  5CVU A;  2CQ7 A;  4XK4 A;  5FFZ A;  1SFX A;  2LD5 A;  3QPL A;  4UUT A;  3D1N I;  1I1G A;  4M9X A;  3RCO A;  9ANT A;  1CF7 A;  4N9I A;  2RQP A;  2WY8 Q;  1R1T A;  3E1S A;  4FCY A;  2FML A;  2PMZ N;  3ZPL A;  2EV6 A;  2VKD A;  3ERM A;  1EV7 A;  3H3Z A;  5KNL A;  2ZJP F;  4E7Z A;  3CO7 C;  4XQF A;  5DV5 A;  1TWA J;  2ZSI B;  3MCZ A;  4RAZ A;  4HX8 A;  2K5C A;  3TGN A;  2Y30 A;  2K9N A;  1WJC A;  3UKG A;  5E3L A;  2BY1 A;  1DPR A;  4FX0 A;  2E2I J;  2OCE A;  2HVR A;  3NEU A;  4EM0 B;  1R4N B;  1Z3Y A;  4BY7 J;  4M6X A;  3VEP A;  4A3C J;  3I58 A;  3BQY A;  4QLC U;  3TQN A;  1FSE A;  2L9N A;  3LSI A;  1HW5 A;  4OMZ A;  3KYD B;  1H9T A;  6PAX A;  3GUD A;  3S93 A;  4XKB A;  3CUO A;  2CWE A;  3FXQ A;  2XSD C;  2IGM A;  1DU6 A;  3BJO A;  3K1M A;  3WG7 H;  2FA5 A;  2DA2 A;  1OR7 C;  2LYC A;  3RSN A;  3ZMS A;  4BL0 B;  1G3Y A;  2O9L A;  2F4M B;  4LIT A;  2DA7 A;  4N4O B;  5ERI A;  3CCS I;  3TO9 A;  1YX5 A;  2Z99 A;  3KYC B;  3CCR I;  2AHQ A;  5EZG A;  1R1V A;  2LOO A;  4KIF A;  2K3P A;  1J7K A;  1TWF J;  1PUF A;  2A5W A;  4F3Q A;  1E0E A;  3CD6 I;  1H0M A;  3H92 A;  3GTG J;  3FMS A;  3K4J A;  2LFB A;  2NRA C;  1WCM J;  2O61 A;  2IGO A;  3EUA A;  3HRS A;  4PSW A;  3SZT A;  4AYB A;  3HPH A;  4CDG A;  3WTX C;  1KON A;  3I59 B;  2R92 J;  5FGM A;  3U2R A;  2DOE A;  2ZFU A;  4I98 B;  2KPM A;  1KZH A;  4KUM A;  3BC8 A;  1TNS A;  2EFN A;  2OPT A;  5HS7 A;  3BTJ A;  3W2W A;  2JRT A;  4P55 A;  1FZP B;  3EYY A;  3JSO A;  1XC5 A;  5F1J A;  2BY2 A;  3CUQ C;  2EFP A;  5LGT A;  4CYD A;  4UB6 C;  2AXL A;  1YG2 A;  2O8X A;  5K5Q A;  3H36 A;  1FT9 A;  3I64 A;  1Y56 A;  4UNO A;  2HVQ A;  2DMP A;  2QKL B;  2MYS A;  3ZN1 A;  5KAI C;  2X1E A;  5JHF A;  2WAQ N;  2VOD A;  1EJ9 A;  1MGT A;  3M1E A;  4LIU A;  4XLH A;  4E7H A;  2XV4 S;  2ZC2 A;  1O3S A;  4C3J J;  3CCV I;  2CQN A;  2P7C B;  1N77 A;  3JRH A;  1MBK A;  3ABL H;  3FXO A;  3EET A;  3K7A J;  3ABU A;  4F7Z A;  4FQG A;  4IHS A;  3K4K A;  4BXF A;  4RGX A;  1YQA A;  2Q1Z B;  5LHG A;  5DM6 F;  5BOX A;  4A3I J;  4P96 A;  2NS8 A;  1BIA A;  2RRE A;  1HQC A;  2QM3 A;  1F5T A;  2F5C A;  1RR8 C;  5IYB J;  1A36 A;  3G1O A;  4ZDL A;  2M0C A;  3WTU C;  2STW A;  4Y52 J;  3CDI A;  1R00 A;  2G7H A;  2HS5 A;  1T98 A;  3I0T A;  4MIM A;  4PDK A;  2IW5 A;  1FBU A;  3F8F A;  2CQQ A;  2OQG A;  4HBL A;  3BRO A;  1OCT C;  2WTE A;  5E1W A;  3F6O A;  3CME I;  3IH2 A;  3HOU J;  3QWL A;  4XLE A;  5JR3 A;  1D0X A;  2KDO A;  5L3D A;  1NK3 P;  4G12 A;  4RAY A;  1JXS A;  2H1K A;  3ZQQ A;  3F3X A;  3KFW X;  4HF2 A;  3S14 J;  1XSX A;  3DKY A;  3T1B A;  2ZXJ A;  3MKL A;  4U88 A;  1XDS A;  2L2O A;  4B47 A;  5FLV A;  1ITY A;  1OCO H;  2M7B A;  2K86 A;  4NDL A;  2BXY A;  4EAT A;  1Y1V J;  2XPV A;  5E20 A;  1UHS A;  2VLA A;  1JE8 A;  3N05 A;  1VF9 A;  4DYC A;  4BJ5 C;  2HZT A;  1K4T A;  2F2E A;  4BHP A;  1BJZ A;  5EZH A;  5E79 C;  2X6W A;  2K9M A;  2X9D A;  3VSK A;  3L2W A;  2EPF A;  5HDG A;  1YOV B;  2O6G E;  2M8G X;  3ML6 A;  2L4A A;  1HXD A;  2MG4 A;  3DWL E;  3DXJ F;  4MQV A;  4MGR A;  2WB1 N;  5M3M J;  1A6I A;  2M5W A;  2HR3 A;  3TO7 A;  3T8T A;  1CGP A;  1TWG J;  5H2F C;  2K9L A;  4ZYA A;  2CUZ A;  1ZLJ A;  3GX4 X;  3VWB A;  3CCQ I;  2KFD A;  4MFD A;  2BW3 B;  1U8R A;  4A3L J;  2BXZ A;  3J7A Y;  1F36 A;  1G6N A;  4M74 A;  2E1C A;  3DEW A;  2OV7 A;  2A05 A;  1HW2 A;  1Y0U A;  5ILU A;  3FXM A;  4M6V A;  3LMM A;  2M0M A;  5C3E J;  2LKX A;  4YII A;  3ZP5 A;  2ISZ A;  2Z33 A;  1VQ7 I;  2KIQ A;  3AG3 H;  3NQO A;  3BQZ A;  4EJT A;  2R7F A;  1VTN C;  3K4C A;  3GTJ J;  2W4S A;  3CCE I;  2DO7 A;  2KJC A;  3BR5 A;  3OYD A;  3K4M A;  4QSH A;  3O8G A;  2K02 A;  1WJB A;  4P9F A;  1IRG A;  3JR9 A;  3ECH A;  1FOY A;  2Y31 A;  2Q2E A;  2MH2 A;  2KL4 A;  4GYI A;  3HYI A;  4HSR A;  2QZ8 A;  3PNT A;  3SHF A;  2DXI A;  3J80 K;  1JHF A;  1XGM A;  2PJP A;  4EJW A;  4BUP A;  1E17 A;  5GAG J;  3E3V A;  2EH3 A;  2QQA A;  1ON2 A;  1X3U A;  4XRF A;  2VJ5 A;  1Z77 A;  1I39 A;  3I3L A;  1MJB A;  4CCK A;  4IXA A;  4NC7 A;  1X2M A;  5B1B H;  1UMQ A;  4JOM A;  1H88 C;  3FKJ A;  3N97 A;  5LBQ A;  2AS5 F;  2CV1 A;  1SFO J;  2RGV A;  4CHU A;  2JRM A;  3GTO J;  3OYM A;  2NYX A;  2DU9 A;  3IKV A;  3HSF A;  3OIQ A;  1JUM A;  2QEX I;  2DJI A;  2FJ1 A;  1WJE A;  4JK1 X;  3RIR A;  3U1D A;  3OYK A;  5BPI A;  3JRF A;  1C0W A;  2HNH A;  3S2W A;  2BZT A;  2QBY A;  2DLL A;  2QF7 A;  3CTA A;  5GAE J;  3M9A A;  2JSP A;  3S32 A;  3FXL A;  1IN5 A;  1CF7 B;  3O8H A;  4NUB A;  3LFK A;  1Z05 A;  1TLH B;  2LBF A;  5DCM A;  1XS9 A;  4LFU A;  4DQ2 A;  2QA4 I;  2L7M P;  2OTL I;  4LK0 F;  1VQO I;  3JW4 A;  1ENH A;  4FE4 A;  3CP2 A;  3KP4 A;  1HW1 A;  4KJZ A;  4L9T A;  3KYL A;  1SD5 A;  4HDV A;  3E6C C;  4ABZ A;  3O2P E;  3H0D A;  4Q4Z F;  2NS7 A;  3BWG A;  2LY2 A;  3IHU A;  4KA4 A;  4OIR F;  3ZXS A;  4AYB N;  2EZL A;  4MEX F;  2HYJ A;  1RUO A;  3C1D A;  4L18 B;  3TDZ C;  3MQ0 A;  1BI1 A;  5M5X J;  1F43 A;  2MLG A;  2PEX A;  3BR6 A;  5EEH A;  3WU2 C;  3LA3 A;  4F92 B;  1H8A C;  3HZJ A;  5BMZ A;  1USS A;  3HDD A;  1A31 A;  2BE5 F;  4BGD A;  4G7O F;  5D8K B;  3Q9V A;  3KLN A;  4W1U A;  2HXI A;  2LH9 A;  3JTH A;  1GUU A;  1MMD A;  1FP1 D;  2HYG D;  2G9W A;  3A0B C;  4F52 A;  2IA2 A;  1W7P D;  3DPL C;  3HTU A;  2IBD A;  2CUE A;  4AVP A;  2E2J J;  3FIS A;  5L3C A;  4JBA A;  2GLO A;  4KIS A;  3M1C A;  3HPG A;  3CES A;  2Y9Z A;  1JT0 A;  3SDB A;  2COM A;  1KU9 A;  2L01 A;  5DCM B;  1K7A A;  2HFH A;  3ZMD A;  2ZJR F;  1K78 A;  2O5R A;  3FM5 A;  5EDN A;  1N78 A;  1UZC A;  1X1A A;  2QSG X;  2BVL A;  1ZN2 A;  3F0C A;  3OIO A;  2GM4 A;  4L9N A;  3RQI A;  4A3J J;  5GTI C;  2FEZ A;  5J8C A;  5K7F A;  3ESW B;  2XUB A;  1BIB A;  1WRJ A;  1D5Y A;  4NQW A;  3SZG A;  1S5L C;  5KVR A;  1IGN A;  3OWT A;  3IRQ A;  1KQ9 A;  1FX7 A;  5F08 A;  1U8B A;  3S1M J;  2GA2 A;  2HKO A;  1B4A A;  4X0G A;  5CLS A;  3ECO A;  4FHT A;  4CZC A;  1ZH5 A;  3PUF A;  4YEL A;  3ZQG A;  4I7H A;  3MFK A;  3BPX A;  1LB2 A;  4PJ0 C;  1YHQ I;  2L9R A;  4BQN A;  2EIM H;  2AXT C;  1ZYR F;  1QHG A;  4P9U A;  3L2V A;  1L0O C;  2W57 A;  1XB4 A;  4BEH A;  4HOB A;  4CCL A;  4A3E J;  3A4C A;  3HOT A;  1I3Q J;  2XDV A;  1I6X A;  3OYJ A;  1SVM A;  1W5C C;  1V4R A;  1X1D A;  2ZB9 A;  5HDN A;  4I09 A;  4E4H A;  3A1Y A;  3HOV J;  4L9J A;  3H5A A;  1ODD A;  4CH7 A;  2OU2 A;  3OY9 A;  4D1Q A;  2Z16 A;  1R4M B;  1W5T A;  3DP7 A;  1TL8 A;  1ORK A;  4XIC A;  1FP2 A;  3JRA A;  2MAB A;  4BDY A;  1FC3 A;  1ZGJ A;  5H6Q A;  1ZG3 A;  2B63 J;  3JRC A;  2EZK A;  4DBQ A;  2FQ4 A;  4HDU A;  3FHN A;  1SVL A;  3KP2 A;  1SD4 A;  1KQ0 A;  2W84 A;  5LFA A;  1AOY A;  1IN4 A;  1RNL A;  2H8R A;  5E1X A;  1B72 A;  4MFE A;  3EDP A;  5F04 A;  3GXO A;  5IP6 A;  1VQN I;  3WU1 B;  3LSP A;  2GXA A;  2R7R A;  2M4K A;  4G6Q A;  3FX3 A;  3LSJ A;  5BPD A;  4IRI A;  1RC9 A;  1TP4 A;  3I5U A;  5A2Q K;  3PIP F;  2Y9Y A;  1OFC X;  1EH8 A;  2DOA A;  1NHA A;  2ZXW H;  1RUN A;  1H9G A;  1GT0 C;  3L1P A;  5CVV A;  3DBL B;  3H9Q A;  2OBP A;  3ABK H;  3IP4 B;  4D5F A;  3G1L A;  3KIO A;  4CCM A;  3FBI B;  1MKM A;  3WE3 A;  2F6C A;  2V9V A;  3OYF A;  1YI2 I;  4OIP F;  1S6L A;  2BHZ A;  2QKM B;  2JMW A;  2GXG A;  4XOP A;  3VDX A;  2BV6 A;  1QVT A;  1PJR A;  4PFP A;  5A2Q Z;  2V4J C;  2VBX A;  1IZ1 A;  3H9J A;  4BBR J;  4II3 A;  1DUX C;  3JSP A;  2R5Y A;  1BBY A;  2G7U A;  3KET A;  3OS0 A;  3RKQ A;  1LFB A;  5FRM A;  4CCN A;  3CLO A;  3WGH A;  1ZHF A;  2XAU A;  2KRF A;  4RGR A;  2XGX A;  1R6R A;  2EJR A;  1G3T A;  3PUB A;  4YRV A;  3K69 A;  5JVG F;  2JA2 A;  2DQL A;  2MC4 A;  3IAS 2;  2EIN H;  3HHH A;  3F72 A;  1VQM I;  3OSG A;  2I5U A;  2L9S A;  4PGH A;  2K4J A;  2FOK A;  2JPB A;  3S16 J;  1FIA A;  3FMQ A;  5GAH J;  1YFH A;  4BQA A;  3A03 A;  4DYR A;  5D5V B;  2HYF A;  2BW3 A;  2DFE A;  3BG9 A;  5F27 A;  4ZDP A;  3IAM 2;  4BH9 A;  2IP2 A;  3DV8 A;  3OS1 A;  1ZAR A;  5K1Y A;  5B1A H;  4A0Y A;  1GV2 A;  1WJF A;  3F8C A;  3QPS A;  4XKV A;  5DD4 A;  1MH3 A;  3PSI A;  2QSF X;  1RI7 A;  4HST A;  1LEA A;  4B43 A;  4XSZ F;  1HKS A;  4CCO A;  1GLN A;  1YJW I;  1JGG A;  4OAZ A;  1VI0 A;  2YSR A;  1YIJ I;  2XKO A;  3EYI A;  2UXN A;  1LVA A;  1UST A;  3CCL I;  2OD5 A;  3FF5 A;  3PNY A;  4XON A;  4A0X A;  1ZR2 A;  1ETK A;  4FAS D;  3DEU A;  2YUS A;  4Z2Y A;  1BC7 C;  1BR1 A;  2DK5 A;  2RKH A;  1SAU A;  2CUF A;  4L0Z B;  4HG2 A;  1YS6 A;  4B09 A; 
#chains in the Genus database with same CATH homology
 2MBF A;  5DEQ A;  1W7P B;  2XAJ A;  3E6M A;  1RIO H;  4CXF A;  1KYZ A;  3F8M A;  4EV0 A;  3IWZ A;  1PP8 F;  4WX9 A;  1LJ9 A;  2RC4 A;  1LDJ A;  1R7J A;  4A0Z A;  4EM1 A;  5D5W B;  4IPA A;  1SAX A;  1ONV A;  3T0Y A;  2RN7 A;  1QPM A;  3L9F A;  2EK5 A;  4A5N A;  4EVI A;  4BNC A;  2TDX A;  3K9T A;  3JAM Z;  1DP7 P;  1FY7 A;  5LRR A;  2L54 A;  1BM9 A;  1KYW A;  4ESJ A;  3WTT C;  4YFX F;  1T39 A;  1MJA A;  2EA2 A;  2VT2 A;  5TJJ A;  4A12 A;  1OPC A;  4PCQ A;  2Z5U A;  2Q8K A;  2WWY A;  4R8H A;  1QQI A;  1FBS A;  2QLZ A;  1E2X A;  3WTS C;  4N9H A;  3W6J B;  3QAH A;  2BGC A;  4MTD A;  4A2U A;  1HKT A;  5J8F A;  1XN7 A;  2FNA A;  3BDD A;  3K1N A;  2RNJ A;  4GO1 A;  4WXD A;  4AWX B;  3GW2 A;  5CVI A;  2JZY A;  1OYY A;  1XMK A;  1B6A A;  3RPQ A;  3BPV A;  1BI2 A;  5CYV A;  3TKY A;  3GFJ A;  4UVC A;  1ZLK A;  3WTZ A;  1JHH A;  5HOO A;  3LST A;  4N0B A;  3DKW A;  1ZRF A;  1QNT A;  1ZRD A;  5DUI A;  5FFX A;  1FYK A;  1FNN A;  3QU6 A;  2JSC A;  2BEO A;  3HOS A;  4RGU A;  4KIC A;  2QEN A;  2XIG A;  5D6E A;  3WTW C;  2J5O A;  2LKP A;  5HVQ C;  1KQ8 A;  1T38 A;  1YW7 A;  2A61 A;  1Z7U A;  2CSO A;  4G7Z F;  2W85 A;  1ZRE A;  1W7P A;  4ESF A;  3SXY A;  3KZZ A;  2P6T A;  3F6V A;  3V4G A;  1OYI A;  1WI9 A;  2L02 A;  3ULQ B;  5F1R A;  5L3E A;  3GZ6 A;  1TW3 A;  2ZBK A;  5KK1 A;  3HRU A;  4HYE A;  4XLN F;  2ELH A;  2GZW A;  3JTG A;  2PG4 A;  3QPT A;  3TOA A;  4CO8 A;  2V1D A;  2RVC A;  2IJL A;  4WK8 F;  3V8L A;  3SZP A;  2X0L A;  3I54 A;  1G4D A;  4IRG A;  1Q1H A;  2VBY A;  3F23 A;  2ZKZ A;  2KIU A;  2DTR A;  4EJU A;  2IA1 A;  5ICE A;  3KLO A;  1YTY A;  2V1U A;  2QBY B;  3PFI A;  5IT3 A;  3SQN A;  3OV8 A;  1IN8 A;  4KMF A;  4WCG A;  3GFL A;  2HGC A;  1YIO A;  2NNN A;  4OIN F;  4U0W A;  1J75 A;  4M72 A;  3U9G A;  1SMT A;  3MEX A;  5D5U B;  2HDC A;  4PGG A;  3CUQ A;  3VB2 A;  4D0P A;  1QGP A;  2M87 A;  2PFB A;  4PZJ A;  5LRS A;  5CVJ A;  5DDG A;  1G3W A;  3V8J A;  2XAQ A;  5FB2 A;  5JFR A;  2EFO A;  2PQ8 A;  4DNC A;  5ED4 A;  1HSJ A;  2A68 F;  3K1P A;  4RB1 A;  3KZY A;  2DPU A;  5DYM A;  1KU2 A;  4TV7 A;  5FLX K;  3V7R A;  2XAG A;  1U3E M;  3KP6 A;  5H20 A;  2EV0 A;  2ZO4 A;  1D3Y A;  1I1S A;  4LG0 A;  2STT A;  2Y48 A;  4AIH A;  1XGS A;  3P7N A;  1W4M A;  2FU4 A;  2VN2 A;  1YO5 C;  2IA0 A;  3R0A A;  3WGG A;  3R4K A;  2XRN A;  3DQV C;  3RYP A;  1K6O A;  3FXU A;  1P4X A;  1U5T A;  3HSR A;  5DCF A;  5L3G A;  4G6D A;  4I2O A;  2M30 A;  4FX4 A;  4KN4 X;  3F22 A;  1REP C;  1P4W A;  4LLG F;  3CJN A;  2YX7 A;  4ZH4 F;  3MAJ A;  5BS6 A;  1ZGA A;  5HS9 A;  1O57 A;  1P92 A;  5E8G A;  3KP7 A;  4NB5 A;  1ON1 A;  2ESH A;  4IRH A;  3FHZ A;  4I01 A;  2P4W A;  1BJA A;  2IVM A;  4HW0 A;  2OQR A;  4S05 A;  4U0V A;  1GXP A;  4U0Y A;  4AIJ A;  1DPU A;  1KA8 A;  1FYL A;  3E6B A;  5D4R A;  2GQQ A;  1JGS A;  3R60 A;  1S8N A;  3J81 K;  2DAO A;  2KJB A;  3GO5 A;  5LHI A;  1FPQ A;  4M6Y A;  3ABT A;  3RYR A;  3F21 A;  2O0Y A;  3J7A O;  3WTV C;  4I0B A;  5EEG A;  2XHK A;  2P7V B;  2RDP A;  4RB0 A;  4KDP A;  1O3R A;  4YFK F;  3VOD A;  1U78 A;  1MZB A;  2ZNY A;  4U7B A;  5H6R A;  1IAW A;  3IL2 A;  4ENK A;  2XKP A;  4LMY A;  2RV8 A;  4RS8 A;  1R5G A;  3J81 Z;  3V7S A;  3HUG A;  3KP3 A;  1OYW A;  3M8E A;  1UHM A;  2F5F A;  2LF7 A;  4WXH A;  1V3F A;  3B73 A;  4KT5 C;  3PQJ A;  2OA4 A;  5ILS A;  4IHT A;  4O6J A;  1R23 A;  2K4B A;  2YX4 A;  3ZN0 A;  2WV0 A;  4HQM A;  3WOD F;  1O7F A;  2H94 A;  1YW8 A;  4S04 A;  2PMH A;  3TOB A;  3GLX A;  3ZMT A;  1IN7 A;  2FBK A;  4G8X A;  2VC1 A;  2PMU A;  4EJO A;  5FD6 A;  5HLH A;  4L0Y B;  5HLG A;  4BYY A;  2D1V A;  3KP5 A;  3V7C A;  4LB6 B;  1K79 A;  1EH6 A;  2BYV E;  2C6Y A;  2D1H A;  4M73 A;  4IF4 A;  1KU7 A;  3TDU C;  2FE3 A;  1LQ1 A;  1B9M A;  4RB2 C;  1ZG1 A;  5IT9 K;  3R61 A;  1O3Q A;  3NRV A;  2HEO A;  1WSU A;  2VBZ A;  2EFW A;  2VBW A;  2BBY A;  3D5L A;  3RI4 A;  5LGU A;  1ZRC A;  4GYG A;  5ICF A;  4ENN A;  3OOP A;  4KNY A;  2FRH A;  4UV8 A;  4LK1 F;  1T2K A;  4ZYD A;  2OZU A;  3HIF A;  3G73 A;  2CG4 A;  4HQE A;  1BI3 A;  2DW4 A;  4HA8 A;  2QVO A;  2ZJ2 A;  2Z3Y A;  2GWR A;  2OAZ A;  2YU3 A;  4G7H F;  2WC2 A;  2DK8 A;  1ZG5 A;  2VE8 A;  2IPQ X;  1XD7 A;  4YFN F;  1Z1D A;  5CJ9 A;  4O3M A;  4MTE A;  2JT1 A;  2JPC A;  1FBQ A;  3J80 Z;  4L9V A;  1IXR C;  2MA3 A;  1IF1 A;  2DBB A;  4EJV A;  1Z6T A;  2JTV A;  1TQP A;  3DFG A;  4Y15 A;  3HRT A;  3KCC A;  2VXZ A;  5IT9 Z;  5E1Z B;  1PDN C;  4KMU X;  2XAF A;  3GWZ A;  4L5J A;  3GFM A;  2FBH A;  3HSE A;  3I59 A;  4YIF A;  2X4H A;  3CUQ B;  3BP8 A;  3D0S A;  5K5R A;  5AIP A;  2DQR A;  5LGN A;  2GIV A;  4OIQ F;  1UB9 A;  2FMY A;  4HX4 A;  1GHC A;  3REO A;  1R1U A;  2MH9 A;  3RTR A;  4WXC A;  5HDK A;  2R7D A;  3BJ6 A;  3L2C A;  2V1X A;  4CIC A;  4Y13 A;  3P9I A;  3Q9S A;  1P2F A;  2M8E A;  4MNU A;  4GCV A;  3ZMZ A;  2ISY A;  4KIG A;  3E5X A;  4EGY A;  2L4M A;  5D4S A;  4BXU A;  2LDU A;  1YW9 A;  2H6B A;  1IXC A;  2VE9 A;  2DFI A;  2Q0O A;  3E5U A;  2PN6 A;  2HWV A;  2D2W A;  2ZFW A;  4M71 A;  1W5S A;  2ESN A;  3N4M A;  4IVN A;  1U5T C;  2QQ9 A;  1P6R A;  4XLP F;  2FNP A;  1HKQ A;  3MWM A;  1R58 A;  3BJA A;  2LSO A;  2XAS A;  2A07 F;  3MZY A;  1TNT A;  2MLK A;  3COA C;  2GA1 A;  4XSX F;  1I27 A;  5F64 A;  4HF1 A;  1O7L A;  1U5T B;  4WWC A;  1R36 A;  2ADU A;  1LDK B;  2P5K A;  3IWF A;  2HQN A;  2MD5 A;  4FT8 A;  3B02 A;  1B9N A;  1IW7 F;  1TBX A;  1J0R A;  2J5P A;  4HLX A;  1SFU A;  5LHH A;  2CFX A;  3WGI A;  3E97 A;  1OKR A;  1SD7 A;  3P9C A;  3WG9 A;  5CVR A;  3QP5 A;  3I4P A;  4Q5S F;  2YR2 A;  4BAY A;  1TQM A;  1TTY A;  1UHW A;  3HRM A;  2ZCW A;  3I71 A;  5D6F A;  1FYM A;  1XDU A;  2FXA A;  1QZY A;  1KU3 A;  4MQ9 F;  4ON0 A;  2QUF A;  2HQR A;  5AON A;  1SMY F;  3GFI A;  1UCR A;  3CO6 C;  1B1B A;  3QU3 A;  2HKX A;  4GXO A;  2NNY A;  1QO0 D;  5LEJ A;  4MEY F;  2O03 A;  2ZME B;  2VON A;  2A6E F;  1T6S A;  2VT3 A;  3MZH A;  1U6G A;  5JHU A;  2MC3 A;  1R22 A;  1GVJ A;  4UUV A;  4KIB A;  4EMS A;  2LNB A;  2EV5 A;  4HZF A;  3ZMV A;  2CGP A;  3GYH X;  4Q47 A;  1T0F A;  3RKW A;  4NHJ A;  3FWE A;  3C3W A;  5F6F A;  5ILV A;  1HST A;  2E1N A;  4EM2 A;  1J5Y A;  2F5D A;  3M7G A;  4R79 A;  1YYV A;  3LQR A;  4LLL A;  1AWC A;  2A3S A;  1MD0 A;  2GAU A;  4OOI A;  3ELK A;  3HHG A;  4UVA A;  4WF2 A;  1L3L A;  5LEK A;  5LLQ A;  3RJP A;  3IKT A;  4LD5 A;  3EQL F;  2V6C A;  2R3S A;  1D5V A;  3ZQ7 A;  3R6S A;  3VFZ A;  3KEO A;  4BHB A;  1IUY A;  4M9S A;  3LAP A;  2H09 A;  3QOP A;  2KIF A;  4H0E A;  4QWQ A;  1J59 A;  3O3K A;  5J6X A;  1LEB A;  2QYO A;  1YS7 A;  3SFZ A;  1TW2 A;  2HOE A;  3I53 A;  5E18 F;  3TO6 A;  2W25 A;  3F8N A;  2UWM A;  2YPR A;  5D5X B;  3L00 A;  4P5O A;  2ETH A;  1J9I A;  4G9Y A;  4E70 A;  4JQF A;  1P4A A;  4ENM A;  1Z9C A;  2DPD A;  2A5Y B;  4LLN A;  2IRF G;  4O5V A;  2CW0 F;  3ERE D;  3K0L A;  4ZZL A;  3WU0 A;  1XSD A;  5FD5 A;  2FF4 A;  5D8L B;  3FMR A;  2QQB A;  3JAM K;  4UVB A;  5L3B A;  4LJZ F;  1LDD A;  2HTS A;  1WKM A;  2E7X A;  2UZK A;  3AAF A;  4IJA A;  4LB5 A;  3RKX A;  3C18 A;  4LGW A;  5FLX Z;  1GXQ A;  1B59 A;  2L3D A;  2HTJ A;  2B0L A;  4EGZ A;  4HV5 A;  2D45 A;  1I5Z A;  5HS8 A;  2H6C A;  2DI3 A;  2ACJ A;  2A69 F;  1F4K A;  4KYW A;  1S7O A;  1IN6 A;  3FM3 A;  4A6E A;  2P8T A;  1LNW A;  2GXB A;  1WQ2 A;  2XVC A;  5JI6 A;  2A6H F;  5DD8 A;  2P6S A;  4ZYH A;  3ZMU A;  3L09 A;  1OMI A;  1D8J A;  5TRD A;  4ETS A;  4KFC A;  1IRF A;  2XAH A;  3IC7 A;  3DPT A;  1QZZ A;  1Z6R A;  4L5I A;  4YG2 F;  3PQK A;  1UFM A;  2EB7 A;  5L3F A;  3LWF A;  1EH7 A;  3GF2 A;  2IT0 A;  5ICC A;  1XGN A;  3DF8 A;  3LQQ A;  2KKO A;  3F8B A;  1SD6 A;  4UXN A;  4U7D A;  1S7A A;  2KIM A;  4A5M A;  1BI0 A;  1F1Z A;  3E5Q A;  2O3F A;  1QBJ A;  2XRO A;  4ESB A;  4HLY A;  5E17 F;  4ENJ A;  1MDM B;  2PI0 A;  5HLI A;  3LA2 A;  1K78 B;  1FOK A;  2FSW A;  3T8R A;  2W24 A;  4AIK A;  1O3T A;  1BC8 C;  1J2X A;  4B8X A;  1ZAO A;  1PUE E;  3KEQ A;  2UXX A;  2Y75 A;  4ZYE A;  2NS0 A;  2K7L A;  2OZ6 A;  1FLI A;  1S3J A;  3HTS B;  4R1H A;  1F9N A;  4UHT A;  1XGO A;  1G3S A;  2M1B A;  3QPH A;  3EUH A;  1YLF A;  4HV6 A;  3ROU A;  1OR7 A;  3WTY C;  1A04 A;  4AD9 A;  2PBI A;  4RB3 C;  4Q48 A;  1D8K A;  3Q5F A;  1XSV A;  1PP7 U;  2FQ3 A;  1IXS B;  3FZV A;  3QP6 A;  3T5X A;  2VOP A;  1U2W A;  1Z91 A;  3CDH A;  3H3U A;  2CO5 A;  3R0J A;  1XMA A;  3BZ6 A;  4CGZ A;  2M45 A;  3QRF F;  4GGG A;  2P5L C;  1S29 A;  3O6B B;  3VOE A;  4G94 A;  2PLY A;  3G3Z A;  1HBX G;  1XCV A;  3GVA A;  4EQQ A;  3BOQ A;  4RGS A;  3C7J A;  1SFE A;  3W6K B;  2CYY A;  4A6D A;  5AIQ A;  4OIO F;  4OMY A;  3IRR A;  5BQT A;  3FXR A;  3GZ5 A;  3BY6 A;  3RDI A;  1FWZ A;  1DDN A;  4MHG A;  1FSH A;  2ZNZ A;  3P9K A;  4HAM A;  2LF8 A;  2ZME A;  4BHC A;  5K5O A;  3L7W A;  3RKY A;  3KE2 A;  1BOA A;  4K2E A;  2CQK A;  1KGS A;  4ASN A;  1R5H A;  2F5E A;  2E7W A;  2EFQ A;  1STZ A;  5JVT A;  2V79 A;  3K2Z A;  5ICG A;  3RPU A;  2VOO A;  4XBF A;  2NAZ A;  2P5V A;  3LAJ A;  1MDM A;  4I0A A;  1BN5 A;  1ULY A;  2EWN A;  4HF0 A;  5FO5 A;  4ZYG A;  4M9Z A;  1TQI A;  3V8K A;  1MJ9 A;  3GEZ A;  3ISP A;  4LG0 B;  5E8I A;  5DUK A;  3WE2 A;  2Y0M A;  1XCB A;  3E6D A;  2H27 A;  1RZ4 A;  4CZZ A;  4KN7 X;  4I02 A;  4Y17 A;  2DT5 A;  3M8F A;  2Z9O A;  2QWW A;  2VC0 A;  4UV9 A;  4OU0 A;  1WWX A;  2K27 A;  2FBI A;  4HX7 A;  4ZZD A;  3LA7 A;  2EA4 A;  5CVU A;  5FFZ A;  1SFX A;  1I1G A;  4M9X A;  1CF7 A;  4N9I A;  2RQP A;  1R1T A;  2FML A;  3ZPL A;  2EV6 A;  1EV7 A;  3H3Z A;  3CO7 C;  5DV5 A;  3MCZ A;  4RAZ A;  4HX8 A;  3TGN A;  1DPR A;  4FX0 A;  3NEU A;  4EM0 B;  4M6X A;  3VEP A;  3I58 A;  4QLC U;  3TQN A;  1FSE A;  1HW5 A;  4OMZ A;  1H9T A;  6PAX A;  3GUD A;  3CUO A;  2CWE A;  3FXQ A;  3BJO A;  3K1M A;  2FA5 A;  3ZMS A;  1G3Y A;  5ERI A;  3TO9 A;  2Z99 A;  1R1V A;  4KIF A;  1J7K A;  1H0M A;  3H92 A;  3FMS A;  2NRA C;  2O61 A;  3HRS A;  3SZT A;  4CDG A;  3WTX C;  3I59 B;  5FGM A;  3U2R A;  4I98 B;  4KUM A;  1TNS A;  2EFN A;  5HS7 A;  4P55 A;  2JRT A;  1FZP B;  3EYY A;  3JSO A;  3CUQ C;  2EFP A;  5LGT A;  4CYD A;  2AXL A;  1YG2 A;  2O8X A;  5K5Q A;  1FT9 A;  3I64 A;  4UNO A;  3ZN1 A;  2VOD A;  1MGT A;  3M1E A;  2XV4 S;  1O3S A;  2P7C B;  3EET A;  3ABU A;  4F7Z A;  4IHS A;  4RGX A;  1YQA A;  5LHG A;  5BOX A;  4P96 A;  1BIA A;  1HQC A;  2QM3 A;  1F5T A;  2F5C A;  3WTU C;  2STW A;  1R00 A;  2G7H A;  2HS5 A;  1T98 A;  3I0T A;  4PDK A;  2IW5 A;  1FBU A;  3F8F A;  2OQG A;  4HBL A;  3BRO A;  2WTE A;  5E1W A;  3F6O A;  5JR3 A;  5L3D A;  4RAY A;  1JXS A;  3F3X A;  3KFW X;  4HF2 A;  1XSX A;  3T1B A;  2ZXJ A;  4U88 A;  1XDS A;  2K86 A;  5E20 A;  1JE8 A;  2HZT A;  2F2E A;  4BHP A;  5HDG A;  2O6G E;  3ML6 A;  2L4A A;  1HXD A;  4MQV A;  3DXJ F;  4MGR A;  2M5W A;  2HR3 A;  3TO7 A;  3T8T A;  1CGP A;  1ZLJ A;  3GX4 X;  1U8R A;  4M74 A;  1G6N A;  2E1C A;  1HW2 A;  1Y0U A;  5ILU A;  4YII A;  3ZP5 A;  2ISZ A;  2Z33 A;  4EJT A;  3NQO A;  2R7F A;  1VTN C;  2DO7 A;  2KJC A;  2K02 A;  4P9F A;  1IRG A;  3ECH A;  2Q2E A;  2MH2 A;  4GYI A;  3HYI A;  2QZ8 A;  3SHF A;  2PJP A;  3J80 K;  1JHF A;  1XGM A;  4EJW A;  1E17 A;  3E3V A;  4XRF A;  1X3U A;  1ON2 A;  2QQA A;  1MJB A;  4IXA A;  3N97 A;  5LBQ A;  2AS5 F;  2RGV A;  4CHU A;  2NYX A;  2DU9 A;  3IKV A;  3HSF A;  3RIR A;  4JK1 X;  3U1D A;  5BPI A;  1C0W A;  3S2W A;  2QBY A;  2DLL A;  3CTA A;  3M9A A;  1IN5 A;  1CF7 B;  3LFK A;  1Z05 A;  1TLH B;  5DCM A;  4LFU A;  4DQ2 A;  4LK0 F;  3JW4 A;  3KP4 A;  1HW1 A;  4L9T A;  1SD5 A;  4HDV A;  3E6C C;  3O2P E;  4Q4Z F;  3BWG A;  3IHU A;  4KA4 A;  4OIR F;  4MEX F;  1RUO A;  3C1D A;  4L18 B;  3TDZ C;  3MQ0 A;  1BI1 A;  2MLG A;  2PEX A;  5EEH A;  3LA3 A;  5BMZ A;  1USS A;  2BE5 F;  4G7O F;  5D8K B;  3Q9V A;  3KLN A;  3JTH A;  1FP1 D;  2HYG D;  2G9W A;  2IA2 A;  1W7P D;  3DPL C;  3HTU A;  4AVP A;  5L3C A;  4JBA A;  2COM A;  1KU9 A;  2L01 A;  5DCM B;  1K7A A;  2HFH A;  3ZMD A;  1K78 A;  3FM5 A;  1ZN2 A;  4L9N A;  2FEZ A;  5J8C A;  2XUB A;  1BIB A;  1WRJ A;  4NQW A;  5KVR A;  3IRQ A;  1KQ9 A;  1FX7 A;  2GA2 A;  2HKO A;  1B4A A;  5CLS A;  3ECO A;  4FHT A;  1ZH5 A;  4I7H A;  3MFK A;  3BPX A;  1LB2 A;  1ZYR F;  4P9U A;  1L0O C;  2W57 A;  1XB4 A;  4HOB A;  3HOT A;  1I6X A;  1V4R A;  5HDN A;  4I09 A;  4L9J A;  1ODD A;  2OU2 A;  1W5T A;  3DP7 A;  1FP2 A;  1FC3 A;  1ZGJ A;  5H6Q A;  1ZG3 A;  4HDU A;  3KP2 A;  1SD4 A;  1KQ0 A;  2W84 A;  1AOY A;  1IN4 A;  1RNL A;  5E1X A;  3EDP A;  3GXO A;  3WU1 B;  4G6Q A;  3FX3 A;  5BPD A;  4IRI A;  3I5U A;  5A2Q K;  1EH8 A;  1NHA A;  1RUN A;  1H9G A;  5CVV A;  2OBP A;  1MKM A;  3WE3 A;  2V9V A;  4OIP F;  1S6L A;  2GXG A;  2BV6 A;  5A2Q Z;  2VBX A;  1IZ1 A;  1DUX C;  3JSP A;  1BBY A;  2G7U A;  3KET A;  3CLO A;  3WGH A;  1ZHF A;  2KRF A;  4RGR A;  2XGX A;  2EJR A;  1G3T A;  3K69 A;  2DQL A;  3HHH A;  3F72 A;  4PGH A;  2K4J A;  2FOK A;  2JPB A;  3FMQ A;  1YFH A;  4BQA A;  5D5V B;  2HYF A;  4BH9 A;  2IP2 A;  3DV8 A;  1ZAR A;  5K1Y A;  4A0Y A;  3F8C A;  5DD4 A;  1RI7 A;  1LEA A;  4XSZ F;  1HKS A;  2YSR A;  3EYI A;  2XKO A;  2UXN A;  1LVA A;  1UST A;  2OD5 A;  3FF5 A;  4A0X A;  3DEU A;  4Z2Y A;  1BC7 C;  2DK5 A;  2RKH A;  4L0Z B;  1YS6 A;  4B09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...