3JW4A

The structure of a putative marr family transcriptional regulator from clostridium acetobutylicum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
123
Chain Sequence
DTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYENQESGIIQKDLAQFSITSMLQGLEKKGYIERRKNIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQKQLMSILIKVNRSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR/EmrR family
publication title The structure of a putative MarR family transcriptional regulator from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
total genus 42
structure length 123
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jw4A00
4EV0A 4BHPA 2ELHA 2YPRA 3F22A 2QM3A 1G3WA 5LEKA 4G6DA 5HDNA 3CO7C 3BY6A 1ZGJA 1TQIA 3RKYA 4I09A 3BZ6A 2ZXJA 4HLXA 3P9KA 2ACJA 4MQ9F 4WX9A 3LAPA 1QZYA 4EMSA 1Q1HA 5DEQA 5KVRA 1R23A 4Q4ZF 2DQRA 3C1DA 4EGZA 3JAMZ 3F8NA 3FMRA 4UHTA 2P5VA 3GWZA 5CVVA 4HDVA 3IC7A 4MTDA 1EH7A 3R4KA 2ISZA 1AWCA 2XVCA 1O7FA 3HRTA 1IW7F 3JAMK 2ZBKA 3RKWA 1FY7A 4HQEA 3P9IA 1R00A 3PQJA 2PQ8A 3OV8A 2F5DA 4E70A 1IN6A 1TW3A 2LF8A 2HTJA 2AS5F 1HXDA 1WQ2A 3U9GA 3KCCA 5D8KB 1XSVA 2HQNA 4P9UA 1AOYA 2FXAA 3HIFA 4G8XA 2QQBA 4B09A 3CLOA 4EM0B 2HKOA 3SZTA 5LHHA 1GVJA 2P4WA 2L01A 3KP6A 4G7HF 2P5LC 3L2CA 2W85A 2ZNZA 3F8FA 3GX4X 1K7AA 2IT0A 3F72A 2JRTA 5KK1A 4OU0A 3E6CC 1S7OA 2BGCA 4N0BA 2QBYB 3FWEA 2DBBA 3EETA 3GXOA 3QP6A 4RAZA 5ILUA 1XDUA 1ZG5A 4G94A 3EUHA 3CDHA 2FMYA 5BPIA 1R5HA 3LWFA 1GHCA 2ZMEB 2K27A 2XAJA 5BOXA 4HW0A 1D8KA 3RTRA 2XUBA 2CO5A 1R58A 5L3BA 1BC8C 1QZZA 4D0PA 1O3QA 3GUDA 4HA8A 2P8TA 3VFZA 3S2WA 2UWMA 3WU0A 3AAFA 1V4RA 2M87A 2FBKA 2GXBA 4A0XA 1RZ4A 1DPUA 4L9JA 4LLGF 4AIHA 5D4RA 4IRHA 1MKMA 2A6HF 2YR2A 2IA0A 3FZVA 3BPVA 2DI3A 1SAXA 1X3UA 2P7VB 3WTXC 4OMZA 2K4BA 3PFIA 4EJUA 1FNNA 1J2XA 1CGPA 2D2WA 4FX0A 3D0SA 1R5GA 3T8TA 1G3TA 1IUYA 4OIQF 4K2EA 4HX4A 4U0YA 3JTGA 3WTTC 1T98A 1FBSA 5TRDA 2PEXA 3SXYA 4G6QA 4Z2YA 1DPRA 4WWCA 3E97A 2EK5A 4QWQA 1MJ9A 4EJTA 2HR3A 3M8EA 4Q48A 3M9AA 2JPCA 2RN7A 1P6RA 2RVCA 3VODA 1RIOH 1B59A 5BPDA 5IT9K 3F21A 2XRNA 1QO0D 4GYIA 2VE8A 4CYDA 2H09A 3WTSC 4HDUA 2F5FA 5K5QA 3WGIA 1PDNC 5DDGA 5H20A 2EV5A 1H9TA 3LA2A 2COMA 2EA2A 3LQQA 2EFPA 5L3FA 2WWYA 1USSA 5F64A 1Z6TA 2IA2A 2V79A 3I4PA 2AXLA 5D5VB 1FP1D 3TDUC 3F6VA 2G7HA 2M5WA 3WE3A 1J9IA 4LLLA 5HOOA 5JVTA 3CUQA 1HKTA 4WXCA 1LNWA 3LAJA 1P4XA 2DAOA 1R1VA 3I0TA 3QAHA 1GXPA 5JFRA 1T6SA 4A0ZA 1BIBA 4ENMA 3DP7A 1TTYA 2XGXA 4KN4X 5D5UB 4O6JA 1LDJA 4YFKF 3J81Z 4XLNF 4IRGA 4M72A 3ML6A 4OINF 3KP2A 2E7WA 4KIGA 1L3LA 4IHTA 2DT5A 5E8GA 1E17A 1TNTA 1KU3A 3DFGA 4KFCA 1EV7A 3KFWX 4KIBA 3TDZC 3MCZA 2D1VA 3F8MA 5DV5A 1S29A 3QU3A 3F6OA 3QRFF 2PG4A 2QQ9A 3HSEA 2E1NA 2L4AA 2JTVA 5ILVA 2F2EA 1H9GA 3GFIA 2BV6A 2QLZA 1ON1A 2Y48A 4AD9A 2A68F 4L9NA 2FQ3A 4U0VA 1T39A 1ZRFA 4GYGA 4CO8A 1EH8A 1YW8A 5IT3A 1Z91A 3MEXA 2K86A 3IKTA 1YTYA 2ZO4A 5CVUA 4M6XA 1YO5C 2HDCA 3E5XA 3WTWC 4YFNF 4LG0A 2M1BA 2CW0F 4ESJA 1G3SA 2XIGA 1UHWA 2ESNA 3RI4A 1HKSA 2O6GE 2NNYA 2A6EF 3ZMZA 1TNSA 5DUKA 1RUNA 2EJRA 4WK8F 1I1GA 4A0YA 4QLCU 4AWXB 1MGTA 4IHSA 3V8KA 2FE3A 1K79A 2VC1A 3V8JA 2X4HA 2EFNA 5K5RA 1HKQA 3WODF 4KIFA 2QYOA 3DEUA 3P9CA 5E1ZB 5H6QA 5F6FA 4L9TA 2P7CB 2CFXA 2M8EA 1DP7P 1QQIA 3JTHA 2M30A 4CZZA 4JBAA 4ZZLA 4HX7A 2OQRA 3JSOA 4P9FA 2PFBA 4MTEA 4P96A 1C0WA 5HS7A 4ZH4F 2LDUA 5LGUA 2EV0A 5D5XB 4M74A 1LJ9A 2OBPA 1WWXA 2P6TA 2HYGD 2X0LA 4CICA 3V7RA 1W7PA 4DNCA 4P55A 2NAZA 2L54A 2UZKA 2KRFA 5CVJA 1B1BA 3CJNA 1SMYF 2O0YA 1FWZA 2GXGA 1SD7A 3U2RA 1FYMA 2K4JA 3SZPA 1WKMA 4EJOA 2IP2A 4HYEA 3O2PE 2VOOA 4I98B 3M7GA 3IRRA 2RKHA 4RAYA 2GIVA 3MQ0A 1FC3A 3K2ZA 1USTA 2MLGA 5J8FA 2OA4A 1U8RA 2VC0A 1STZA 1TBXA 1P92A 3I5UA 4YIFA 5DYMA 3MAJA 2H6CA 3K69A 4S05A 2FOKA 2RC4A 2STWA 4GGGA 3FX3A 3FF5A 1ZH5A 2Y75A 2A61A 3WE2A 3IWZA 3WGGA 3KP7A 4G7ZF 2PMHA 2MD5A 5E20A 3T1BA 4ON0A 3TO6A 4WXHA 4WF2A 2A69F 1QBJA 1JHFA 3COAC 1R1UA 5HLHA 4BHBA 2B0LA 5FD5A 3GYHX 5DD8A 6PAXA 2F5EA 1NHAA 3W6JB 3J80Z 3V7CA 3V8LA 2VN2A 4RGXA 2GZWA 1L0OC 2W25A 3H3ZA 1S3JA 2DW4A 3ZMVA 1J75A 4RS8A 3HOSA 1EH6A 1IN5A 1SFUA 4EGYA 3K1MA 3V4GA 3O6BB 3E6BA 3L7WA 5FD6A 3LSTA 2P5KA 3DQVC 2OQGA 4OIRF 4O5VA 4HF2A 1PUEE 2DU9A 5LHGA 1IXCA 2YX4A 5ILSA 4MQVA 3P7NA 5LBQA 3EYIA 4EJWA 4Q5SF 1XGNA 2FA5A 1R1TA 3IHUA 1K6OA 4U0WA 3WGHA 1YQAA 1FBUA 2QBYA 2VE9A 3I64A 5DCMB 2D45A 4R8HA 2RV8A 2EV6A 2J5OA 1P4WA 5L3EA 1FZPB 1HSJA 1ZREA 4KICA 4KMFA 4A2UA 2ZMEA 2ADUA 3IWFA 1I1SA 2WV0A 3ECOA 2Z99A 1IRFA 1K78B 5LGTA 2Y0MA 3J7AO 4R79A 4DQ2A 1U5TB 4I01A 1ZG3A 4U88A 2CG4A 2OZUA 5BMZA 5FGMA 1HW2A 2HZTA 3FMQA 1R22A 2C6YA 2HOEA 2TDXA 3DF8A 3QPTA 3C7JA 1MDMB 2ESHA 1U6GA 1KQ9A 2ZNYA 1YG2A 5AIPA 2HS5A 4UVAA 5D6FA 1K78A 1IN7A 1ZGAA 1U3EM 3DPTA 5JR3A 5EEHA 4OOIA 2GA2A 3I53A 3GVAA 4RGUA 4ENKA 2EFWA 2HEOA 3ULQB 4GXOA 1FYLA 3I71A 1GXQA 2WTEA 3HHGA 1JHHA 3KLNA 2DPDA 3FM5A 4PGGA 4N9HA 4KYWA 4IRIA 5D8LB 1ODDA 3GEZA 3RDIA 4L5IA 1H0MA 1YYVA 1MJAA 4MEXF 3K1NA 4A5MA 3FXUA 4KT5C 4R1HA 4ASNA 5A2QZ 2DO7A 2KJBA 1T38A 1ZHFA 2ZJ2A 3ABTA 4I02A 3E5QA 3ZPLA 3HOTA 4HOBA 5CLSA 1YLFA 3KEQA 3Q9SA 2EWNA 4UVCA 2LKPA 3ISPA 3ABUA 1IRGA 1LQ1A 4OMYA 3LFKA 2HTSA 2R7DA 3ECHA 4Q47A 3KE2A 3JW4A 4I0BA 3QU6A 1KYZA 5LRRA 1BIAA 1XGMA 4UUVA 3KETA 3C18A 1QNTA 4GCVA 5J8CA 3SQNA 4A5NA 5DCFA 3TOAA 4EVIA 1XB4A 2BE5F 1ZLKA 1FSEA 1KGSA 3N4MA 1OYWA 3ZMDA 4A12A 2XKOA 1B9MA 1P2FA 3RYRA 3KP3A 3ZN0A 3M1EA 2HQRA 4XBFA 5ICCA 4BNCA 1KU2A 2KKOA 1Z05A 1FLIA 3WTUC 1RI7A 4BH9A 1KU9A 3RYPA 4M9ZA 3J81K 2GQQA 2HYFA 2ZCWA 1XMKA 1MJBA 1MZBA 1V3FA 1ZYRF 1CF7B 5K1YA 5TJJA 3ROUA 1REPC 2PJPA 4KMUX 5FFXA 2QVOA 1R7JA 3Q9VA 2W24A 4G7OF 3L09A 2D1HA 4O3MA 1HSTA 5CVRA 1F1ZA 1ONVA 3CO6C 2P6SA 1LEBA 1ON2A 2Z3YA 4EM2A 4L5JA 2O3FA 3DKWA 5K5OA 1KQ8A 5L3CA 2XV4S 3FM3A 3KLOA 5ED4A 2IA1A 4CDGA 4HF0A 1J7KA 2XASA 4GO1A 2XHKA 1HW1A 1O7LA 3TO7A 1F5TA 5HS8A 3CTAA 1OYIA 1JE8A 1KQ0A 4IJAA 4MHGA 1G4DA 4F7ZA 2DQLA 3WG9A 3K1PA 4P5OA 2YU3A 1IXRC 2FNAA 1R36A 1F9NA 1KA8A 5FB2A 1LEAA 2MBFA 2QUFA 4MNUA 4NQWA 3L9FA 1SD6A 4UV8A 2CQKA 4A6DA 4ESBA 3TGNA 3D5LA 2A07F 3WTZA 1OPCA 1G6NA 1W7PD 4ZYGA 5FO5A 4I0AA 4UNOA 4H0EA 3I59B 3MFKA 2OU2A 5ICGA 1JXSA 2JPBA 2W84A 2FMLA 1O3RA 4UV9A 1Y0UA 2XAHA 1IN8A 2BEOA 3I58A 5CJ9A 3OOPA 2Q0OA 3GFJA 2GAUA 1XDSA 2A3SA 2NS0A 3LA3A 4HBLA 1D8JA 4M6YA 4LB6B 4FX4A 2DK8A 4U7BA 3F8CA 4UVBA 1Z7UA 1UFMA 1YW7A 5FFZA 3B73A 5D4SA 3BJOA 3I59A 3HTUA 4LGWA 3TKYA 5D5WB 3QP5A 2PLYA 2NNNA 1JGSA 2R7FA 1F4KA 2VBWA 2FBIA 5J6XA 4ENJA 5BQTA 4CGZA 2HFHA 1OR7A 3R61A 5LRSA 5JI6A 2G7UA 1XGSA 1BI2A 3EQLF 4Y15A 2KIMA 4HQMA 1D5VA 2IJLA 2CGPA 2E1CA 3HUGA 2ZFWA 3ZQ7A 3HRMA 4ZYEA 1XSDA 1W4MA 2VONA 2HKXA 2VBYA 4JQFA 4UXNA 1W5TA 2L3DA 5LEJA 1OYYA 3IRQA 3H3UA 4LLNA 3VEPA 5CVIA 4MEYF 3VB2A 4L9VA 3JSPA 2V6CA 5H6RA 3WTVC 2RQPA 3BOQA 4KDPA 3BDDA 5LGNA 3KZYA 3TO9A 1BI1A 2VBZA 3MZHA 3I54A 1ZAOA 2VOPA 3GZ6A 5LLQA 5AIQA 1BBYA 4LFUA 4ZYHA 1O57A 5HLIA 4JK1X 1BJAA 2IRFG 1XMAA 2H27A 1U2WA 2V1DA 1WRJA 4AVPA 1ZARA 5F1RA 2K02A 1I5ZA 4YFXF 2DPUA 1IAWA 1FOKA 1TQMA 3EYYA 3HSFA 3HHHA 2VODA 3BJ6A 2MH9A 1FSHA 2JT1A 1PP8F 2OAZA 3IKVA 2IW5A 4XRFA 2MC3A 1Z6RA 3J80K 5L3GA 2O03A 1B6AA 4ZZDA 5HVQC 4HAMA 4G9YA 3G3ZA 3Q5FA 3HRSA 5HS9A 2HGCA 2R3SA 3NRVA 3GLXA 1DUXC 3K9TA 2CSOA 1BM9A 5JHUA 4CXFA 2QQAA 2Q8KA 1ZRDA 4FT8A 2VBXA 2Z9OA 4RB2C 3M8FA 1YW9A 5BS6A 2JZYA 4HV5A 3TQNA 4RB0A 1QPMA 2M45A 3RPUA 5FLXZ 2VT3A 2JSCA 1ZRCA 4MGRA 3KP5A 1J0RA 5HLGA 1RNLA 4YG2F 2IVMA 3ZMTA 1IN4A 2KIFA 5ERIA 2G9WA 4LMYA 1LB2A 5DCMA 5HDGA 2YX7A 5FLXK 3R0AA 3MZYA 2NYXA 4TV7A 1VTNC 1G3YA 3RPQA 1D3YA 1U5TC 2ETHA 4BHCA 2CWEA 2UXXA 1HBXG 4PDKA 1HQCA 3GO5A 1TLHB 1U5TA 1XN7A 3B02A 1J5YA 1S7AA 5DUIA 3RIRA 2V1UA 1IZ1A 5E18F 1BN5A 3WTYC 4A6EA 1MDMA 2FEZA 2Q2EA 4PZJA 1KYWA 3ZP5A 3T0YA 4OIPF 3F23A 5IT9Z 2KJCA 4XSXF 2FNPA 2RGVA 4NHJA 4L0YB 1SFEA 3GFMA 3ZMSA 4IPAA 1S8NA 3GFLA 2LNBA 1PP7U 3ZN1A 4HV6A 4CHUA 2H94A 3GW2A 2MH2A 2XKPA 1ZLJA 1A04A 1XCVA 2PN6A 1UB9A 4LK0F 3R0JA 1RUOA 2XAGA 2KIUA 2HWVA 2BYVE 5A2QK 5D6EA 2J5PA 2YSRA 5E1WA 3CUQB 3RKXA 3SFZA 3ZMUA 2O61A 5L3DA 2FU4A 4M9SA 4LK1F 3H92A 3LQRA 5HDKA 1P4AA 1S6LA 2QZ8A 3CUQC 1KU7A 3IL2A 1LDKB 2O8XA 4EM1A 4PCQA 4RGSA 1ZN2A 3T5XA 3V7SA 3HSRA 2FRHA 3DXJF 4BXUA 1OKRA 1UCRA 4FHTA 3KEOA 3MWMA 4EJVA 1XD7A 1YIOA 4HLYA 2F5CA 4OIOF 1XSXA 2CYYA 5DD4A 1BOAA 3QOPA 2V1XA 1UHMA 5E1XA 1LVAA 3TOBA 4LD5A 1DDNA 2Z5UA 3LA7A 1BI3A 1YS7A 3G73A 3K0LA 3R6SA 1T2KA 2RDPA 3BPXA 4IF4A 1IXSB 1ZG1A 3E6DA 2A5YB 3SHFA 2EA4A 2VT2A 5ICFA 4KUMA 1U78A 3BP8A 4ENNA 1B9NA 5E8IA 1TW2A 2BBYA 4PGHA 2LSOA 1WSUA 2L02A 1T0FA 3HYIA 1W5SA 3BWGA 3VOEA 3EDPA 3NEUA 1TQPA 2EFQA 2VXZA 4M73A 1HW5A 1O3SA 4N9IA 2QENA 3E3VA 2GWRA 2XROA 2DLLA 3GZ5A 3FXRA 4EQQA 2PMUA 2V9VA 2XAQA 2Z33A 2PI0A 2FF4A 2EB7A 4XLPF 4IXAA 1CF7A 2MA3A 4I7HA 1E2XA 1I27A 2ZKZA 3HRUA 3T8RA 5E17F 2E7XA 4Y13A 4B8XA 1FT9A 1SMTA 5LHIA 4LG0B 3REOA 3E5UA 2WC2A 4L18B 3BJAA 2PBIA 3QPHA 1OMIA 2FSWA 4WXDA 3ELKA 4AIJA 2XAFA 2ISYA 3FMSA 1ULYA 4AIKA 4WCGA 3DV8A 3F3XA 4BYYA 1LDDA 4KA4A 2OZ6A 3E6MA 1BC7C 3WU1B 3W6KB 3N97A 1XGOA 4BAYA 2IPQX 4S04A 4M9XA 1BI0A 4Y17A 2DFIA 1YFHA 1IF1A 1FPQA 2K7LA 4RB3C 3ERED 1SD5A 2DTRA 3R60A 2NRAC 5ICEA 1YS6A 2EFOA 5EEGA 2L4MA 3GF2A 2DK5A 1FYKA 2RNJA 4XSZF 1FP2A 1SFXA 2MLKA 3C3WA 4ZYDA 4ESFA 4BQAA 5AONA 4NB5A 3L00A 2GA1A 3F8BA 2FBHA 3RJPA 2QWWA 3NQOA 2STTA 4U7DA 4HX8A 4RGRA 1B4AA 1O3TA 4HF1A 1FBQA 4ETSA 3CUOA 1FX7A 4RB1A 1J59A 4KNYA 2UXNA 4YIIA 3FHZA 1MD0A 3DPLC 1W7PB 1QGPA 4KN7X 4M71A 3FXQA 1WI9A 1Z9CA 3BROA 4HZFA 2LF7A 1SD4A 1XCBA 3KP4A 3KZZA 2H6BA 2W57A 4L0ZB 3PQKA 4LB5A 4IVNA 5CYVA 1Z1DA 4I2OA 3U1DA 3HTSB 1I6XA 2OD5A 4LJZF 3O3KA
chains in the Genus database with same CATH superfamily
1T95A 1WHUA 1ENHA 2QGUA 4I6ZA 4EV0A 2OCCH 4BHPA 2DMPA 2ELHA 2YPRA 3F22A 2QM3A 2R5YA 3AL0B 1G3WA 1D0ZA 5FKMA 5LEKA 4G6DA 5HDNA 3CO7C 3BY6A 4HSTA 1ZGJA 4UUTA 1TQIA 3RKYA 2L5QA 3BQYA 4I09A 3BZ6A 2ZXJA 4HLXA 3P9KA 2ACJA 4MQ9F 4WX9A 3LAPA 4MLOA 2BY3A 3VPRA 2OUMA 3LSGA 5K7ZA 1QZYA 4EMSA 1Q1HA 5DEQA 5B5EC 2D5VA 2H1LA 5KVRA 4XRSG 1R23A 4Q4ZF 4PFOA 2OCEA 2DQRA 1MNMC 3C1DA 2B63J 4EGZA 1R4NB 3SFIA 1UHSA 4GFBA 3JAMZ 2WY8Q 3S16J 5J47A 3F8NA 3FMRA 4UHTA 2P5VA 2VL8A 3GWZA 2XDVA 1IRXA 5CVVA 1WJDA 3AFHA 1I6HJ 4HDVA 3IC7A 3CCLI 4MTDA 1EH7A 4E7ZA 1A6IA 3R4KA 4HEA2 3PNVA 1CQTA 2ISZA 1AWCA 2HOSA 4E7HA 3EPZA 2CUZA 2KZVA 2M4GA 3K4MA 2XVCA 3UR3C 1MMSA 1O7FA 3HRTA 4J00A 1LE8B 3BG7A 1IW7F 3BR0A 1K4TA 4NC7A 3JAMK 3BQZA 1OCZH 2ZBKA 3DCFA 3RKWA 1FY7A 4HQEA 4FISA 2O5RA 3P9IA 1R00A 3PQJA 5DS9A 2PQ8A 3H3VK 3OV8A 2F5DA 4E70A 1IN6A 1TW3A 4B3AA 2LF8A 2HTJA 2AS5F 2WAFA 3S1MJ 1SANA 2ZXHA 2EZHA 4JX6A 2W48A 1HXDA 1WQ2A 2QSFX 3M07A 2DA1A 3U9GA 4Y7NJ 2A05A 3KCCA 4PJMA 5D8KB 1XSVA 3IAM2 2HQNA 4P9UA 1V54H 1OFCX 1AOYA 1RPWA 2HVSA 2CRGA 1P7JA 4A93J 2FXAA 3HIFA 2LD5A 1DP3A 1I39A 4G8XA 2QQBA 2VJ4A 2NVYJ 1POGA 2K9QA 4B09A 3CLOA 5J1UA 2XAUA 4A3IJ 1X19A 1ERDA 2EH3A 4EM0B 3RCOA 4YRVA 1W0TA 2JA2A 2HKOA 3SZTA 1X1AA 4BQQA 2E60A 5LHHA 1GVJA 1TWHJ 2P4WA 4ZC3A 2L01A 3KP6A 3RPUD 4G7HF 2QA4I 2P5LC 3L2CA 1YX3A 3GTKJ 1W36C 2W85A 3I4NJ 2ZNZA 3F8FA 3GX4X 1K7AA 4ZJZA 4CYCA 3G1OA 2HDDA 3ABLH 3S2HJ 3RZOJ 2FJ1A 4N4NB 4CCJA 3ZQFA 4HNUA 3EUHC 2IT0A 3F72A 2JRTA 3LNQA 2TRTA 1SVLA 5J40A 5KK1A 2LBFB 2P0WA 4OU0A 2YUSA 2VI6A 3E6CC 2LY2A 3CF5F 2JA5J 2HXOA 1S7OA 2BGCA 4N0BA 2QBYB 3FWEA 2DBBA 3EETA 3GXOA 1YHQI 3QP6A 4RAZA 2EZIA 4PSXA 3LSPA 5ILUA 1T8IA 2EQRA 1XDUA 3KX2A 1RKTA 1ZG5A 4G94A 3EUHA 3CDHA 4KISA 1V55H 2M3AA 2FMYA 1QRYA 1WI3A 5BPIA 2B9SA 1R5HA 2JN6A 3LWFA 1GHCA 2ZMEB 2MGQA 1XC5A 2K27A 2QQ8A 2XAJA 3S17J 1TL8A 5BOXA 1X1PA 4HW0A 1D8KA 3RTRA 2XUBA 2CO5A 1R58A 5L3BA 2NVXJ 1BC8C 1QZZA 1EA3A 1N25A 1WH7A 4IQ4A 1NG6A 2KLOA 4D0PA 3PO2J 1O3QA 5BNGA 3MN2A 3GUDA 3QYFA 1GUUA 4HA8A 4Y33A 2P8TA 2X1CA 3S2WA 3VFZA 1ETQA 2UWMA 1BR2A 3WU0A 4Z6YA 3JRAA 3AAFA 1V4RA 2M87A 1R9TJ 1JKOC 1A35A 4QPOA 2FBKA 3OS2A 2GXBA 4A0XA 2LVSA 2KRCA 1RZ4A 1DPUA 4L9JA 4LLGF 4AIHA 5D4RA 4IRHA 1MKMA 2A6HF 1IG7A 2YR2A 1OLTA 2EIJH 2IA0A 2XSJC 1RR8C 2M34A 3FZVA 3BPVA 2DI3A 1SAXA 3FIWA 1X3UA 1ITYA 3DKXA 2P7VB 3WTXC 4OMZA 2K4BA 3PFIA 4EJUA 2EZLA 2VKDA 4NC8A 4HRIA 2IS1A 1FNNA 2LP0A 3BG3A 1J2XA 3C2BA 2ICWG 3OYHA 1CGPA 2D2WA 4FX0A 3D0SA 1R5GA 2PMZN 3FISA 3T8TA 2R7SA 1G3TA 1IUYA 4OIQF 4K2EA 4QSHA 1HCRA 3KYLA 4HX4A 4U0YA 1SVOA 3JTGA 3WTTC 2BY0A 1T98A 1FBSA 4PUSA 1OISA 1IC8A 5TRDA 2PEXA 2DOFA 1YX5A 4G6QA 3SXYA 1BR1A 2K9LA 4Z2YA 3C2HA 4XKWA 3FBIB 1DPRA 3HGGA 1T33A 1JTXA 4OAZA 4XLFA 1IJWC 3UNGC 2L9NA 4WWCA 3OL3A 1MBKA 3E97A 2EK5A 4QWQA 1MJ9A 3G2BA 4EJTA 2HR3A 2JUCA 3M8EA 4Q48A 1YJ9I 2QKLB 5C44J 3M9AA 2JPCA 2RN7A 2KDZA 1P6RA 1X3ZB 2RVCA 3VODA 1FOYA 4AIDA 3ZQCA 1RIOH 2MSYA 1B59A 3VSKA 5BPDA 5IT9K 3F21A 4M3EA 2XRNA 2DMNA 3S3MA 4D7MA 2VJIA 1VQ7I 2HOAA 4PJNA 2DA2A 5DTDA 1QO0D 4GYIA 4U87A 2Y2ZA 3LSHA 2VE8A 2VJJA 4CYDA 2Y30A 4B3XA 2H09A 2H8WA 4XLCA 3WTSC 4HDUA 1VQOI 2F5FA 5K5QA 3WGIA 1PDNC 5J1YA 1EF4A 2HNHA 5DDGA 5H20A 2EV5A 2L7KA 2XF7A 1H9TA 3MKWB 3BG6A 2WAQN 3LA2A 1R6RA 3ESWB 2COMA 2EA2A 1QVTA 3SDBA 1RRJA 3LQQA 2NOJB 3D1NI 4V19K 1Z67A 2EFPA 5L3FA 3CDLA 2WWYA 2Q1ZB 1USSA 1OCRH 2LMDA 5F64A 2LTPA 2DJNA 1Z6TA 5C3EJ 4XR6A 4BY1J 2IA2A 2V79A 1Y6IA 3I4PA 1YJNI 2AXLA 4RM2A 2DXIA 5IYDJ 5D5VB 1FP1D 3TDUC 3F6VA 5EG0A 2WAEA 2M2EA 3BCBA 2G7HA 2IGNA 1Z77A 2W1OA 2M5WA 3WE3A 1J9IA 4XONA 3J7YJ 4LLLA 2CV2A 2DJIA 5HOOA 5JVTA 3CUQA 1HKTA 1MBEA 4WXCA 2A5WA 1LNWA 1TWFJ 2E2HJ 3QYEA 3FXOA 2M7AA 3LAJA 1TP4A 2HZDA 3S1RJ 4D9JA 1P4XA 1MNDA 2DAOA 2V26A 3RZDJ 4X6AJ 3OIPA 2M0MA 1R1VA 3I0TA 3QAHA 1GXPA 1W5CC 5JFRA 1T6SA 2KDOA 2KMUA 4A0ZA 2H8RA 1BIBA 2BOLA 4ENMA 2L7MP 4ITVA 4IKFA 2AQFA 3K4BA 3K7AJ 2IEKA 3DP7A 1TTYA 2XGXA 4KN4X 5D5UB 2EILH 3I55I 2X6WA 4PJJA 4O6JA 1ETYA 3A01B 1LDJA 4C30A 4B47A 4UUSA 4YFKF 2XSDC 3J81Z 4BKXA 2EPFA 3HG9A 4XLNF 2X9DA 4IRGA 2CW8A 2JWTA 4XOPA 2ID3A 4M72A 3GZNB 4F55A 3ML6A 3KP2A 2AHQA 2E7WA 4KIGA 4OINF 1L3LA 2DT5A 4IHTA 5E8GA 2MYSA 2KFDA 1E17A 1TNTA 1KU3A 3DFGA 4KFCA 3SYTA 5JLWA 3DU6A 1EV7A 5GADJ 3KFWX 4KIBA 4JP0A 2B7EA 3TDZC 3DPUA 4BJ6C 3MCZA 5FJ8J 2D1VA 2NOGA 3ZOBA 3F8MA 5F04A 2LRDA 5DV5A 2LC2A 1S29A 1V5EA 3HBLA 3QU3A 3F6OA 1MBJA 3BG9A 3QRFF 3JRGA 2PG4A 2QQ9A 2R7OA 1TWAJ 1E3HA 5IOZA 1HC8A 4IHWA 3HSEA 1X3WB 2E1NA 1OCOH 2QEXI 2L4AA 1LFPA 3BR1A 2JTVA 1T56A 5ILVA 5GAEJ 2F2EA 4NDLA 1ETOA 1H9GA 4DZJA 1AA7A 2E36A 3LSIA 3GFIA 4CCNA 4M6VA 4E7SA 3HOVJ 2BV6A 2QLZA 3VWBA 1ON1A 3HKZN 1OCCH 2O7OA 2Y48A 3O8GA 4AD9A 2A68F 4D1QA 3D5SC 4L9NA 2FQ3A 1A5JA 4U0VA 2M9HA 3BR3A 5F0FA 2FUG2 3CJTB 1T39A 1ZRFA 1LPQA 2OTJI 4GYGA 4A3FJ 4QIWN 4BDZA 1HDDC 2ZJPF 3OYEA 4CO8A 1DQUA 2VKVA 2LY1A 1EH8A 1YW8A 1VQ8I 1MSEC 5IT3A 2N8GA 1V5FA 4JX4A 4BUPA 2VKHA 4F93B 1Z91A 3MEXA 1LFUP 2K86A 3IKTA 1YTYA 4DBQA 2ZO4A 5CVUA 4M6XA 1YO5C 3L2QA 2HDCA 3AG4H 2OV7A 1JKQC 3E5XA 4IZZA 3WTWC 4YFNF 4D7NA 4AYBN 1JKPC 4LG0A 2M1BA 2YU9J 2CW0F 4ESJA 1G3SA 2XIGA 3MMYB 1UHWA 2ESNA 3RI4A 3CC7I 1HKSA 2ZC2A 3I3LA 1P9QC 2XPVA 4C3IJ 2O6GE 2NNYA 1UELB 2A6EF 2IXSA 3WHBA 3ZMZA 1TNSA 5DM6F 5DUKA 3BCAA 1RUNA 2EJRA 4WK8F 1LVKA 2BVLA 1I1GA 4A0YA 2P81A 1HA8A 4QLCU 4AWXB 3S14J 1MGTA 4IHSA 3V8KA 3GTMJ 2FE3A 1K79A 2VC1A 3V8JA 1GVDA 2ZSIB 3PO3J 2DA3A 3DLLF 1ZR2A 3BR6A 2MABA 1BA5A 2X6XA 3AG3H 2X4HA 2EFNA 5J3LA 2E1MC 5K5RA 1HKQA 3WODF 4KIFA 3OYIA 4KT6A 4G6TB 3OYGA 3TW6A 2QYOA 3DEUA 1FJLA 3P9CA 5E1ZB 5H6QA 3LSJA 5F6FA 3VYSB 4L9TA 4LIUA 5TISC 2P7CB 2DN0A 2CFXA 2M8EA 1S7EA 1XMXA 1DP7P 3PUBA 1QQIA 3JTHA 4ZTJA 1TC3C 2M30A 3BR5A 4CZZA 4JBAA 4ZZLA 1F36A 1NG7A 2HVRA 3HXLA 4HX7A 5EDNA 2H1KA 1Z0XA 2OQRA 1ZGWA 3E1SA 1NK2P 3S8PA 3JSOA 4P9FA 1BL0A 1QU3A 2PFBA 4MTEA 3CCMI 1VQ6I 3DBRB 4P96A 3V42A 1C0WA 5HS7A 4OAYA 4LITA 4ZH4F 2LDUA 1FTTA 2O8KA 4D5FA 5LGUA 2EV0A 3GTPJ 1JTYA 3IV5A 1LFBA 1FIPA 5D5XB 3PUFA 3BTLA 4MO7A 4A3GJ 4M74A 1LJ9A 2OBPA 4CCMA 1R5ID 4ANJA 1WWXA 2P6TA 2HYGD 2X0LA 3HUGB 4BE0A 4CICA 3V7RA 3TL4X 1W7PA 5IP7J 3BG5A 4DNCA 4P55A 2GBYA 2NAZA 4XOTA 4XQFA 2L54A 3ZQQA 4I99C 2UZKA 3JREA 4ZYAA 2KRFA 5CVJA 1B1BA 1MH3A 1Y56A 3E7LA 4RLFA 2BW3B 1N75A 2KHMA 3A1YA 1SMYF 2O0YA 3CJNA 5F08A 5B1AH 1FWZA 2NVQJ 2GXGA 3DTIA 5IOYA 1SD7A 2Z2SB 3U2RA 1FYMA 3AL0C 1EKEA 3OWTA 4YIRX 2RREA 1W0UA 1NK3P 2K4JA 2PMZA 3SZPA 1VNDA 5EF6A 2COBA 3HOZJ 1WKMA 3K4KA 2ELJA 3S32A 3DWLE 4EJOA 2IP2A 4HYEA 3O2PE 1SVMA 2VOOA 4I98B 3M7GA 3IRRA 3M4OJ 2RKHA 4RAYA 2GIVA 3MQ0A 1FC3A 3K2ZA 4BBRJ 4Y4RA 1USTA 2MLGA 5J8FA 2X85A 2OA4A 1U8RA 3I9V2 2VC0A 5CQGA 1STZA 1TBXA 1P92A 2NS8A 3I5UA 1I50J 2BW3A 5HNHA 1AKHB 2CW7A 1GV2A 4ZDOA 1UG2A 5DYMA 4YIFA 1U9NA 3MAJA 1G8XA 2BHYA 2F6CA 2H6CA 2WA0A 2LKXA 3GTOJ 5FKNA 4IX7A 3K69A 1R71A 3HL2A 1NH3A 1VZ0A 3BZKA 4S05A 1E3OC 4A3LJ 2FOKA 2RC4A 2VXDA 2STWA 1I3AA 3SDGA 2RAEA 3FX3A 4GGGA 3FF5A 3RKQA 3MZ8A 1ZH5A 2Y75A 4BS9A 2A61A 3WE2A 3IWZA 2X6YA 3WGGA 3C2GA 1PVEA 1DU6A 2L7ZA 1IV8A 3KP7A 2ME6A 4G7ZF 2PMHA 4BY7J 2KT0A 2MD5A 5E20A 3T1BA 4ON0A 1Z7LA 3TO6A 4WXHA 3A4CA 4WF2A 2A69F 3A2KA 1LE8A 4DYQA 1N78A 1QBJA 2HXIA 2K40A 2LG4A 5C4JJ 1JHFA 1WH5A 3BTJA 3I4MJ 5E3OA 1OCPA 3COAC 2JA6J 1R1UA 5HLHA 1K6YA 1ETXA 2XRLA 4ABZA 4BHBA 1UAAA 2B0LA 4BE1A 2BHZA 4IHYA 5FD5A 4HNTA 3GYHX 5DD8A 6PAXA 2F5EA 1NHAA 4V2FA 3W6JB 3CC4I 3J80Z 3V7CA 4BL0B 4AC0A 4RAGA 1B8IB 3V8LA 2DA4A 2VN2A 4RGXA 2GZWA 4BJ5C 1L0OC 1SEUA 4LG3A 4JX5A 2KL4A 3DEWA 3J7ZI 2W25A 2KZGA 3H3ZA 1S3JA 2NS7A 4KJZA 2DW4A 3ZMVA 1J09A 1J75A 3QOEA 4RS8A 3HOSA 1EH6A 9ANTA 1H88C 1IN5A 3IUOA 1SFUA 4EGYA 1NTCA 4D5CA 3K1MA 3MKZA 3V4GA 3O6BB 3E6BA 4CCLA 3L7WA 5FD6A 3LSTA 2P5KA 3OR2C 1HOMA 5EJCA 3DQVC 2VQLA 4FASD 2OQGA 4OIRF 4O5VA 5IYBJ 4X1EA 1DU0A 4HF2A 3HOWJ 1PUEE 2MFZA 2DU9A 5LHGA 1IXCA 2YX4A 2VIXA 3GBGA 5ILSA 4MQVA 3P7NA 5LBQA 3EYIA 4EJWA 4BE2A 4Q5SF 3W6VA 1XGNA 1VQKI 2FA5A 2LOOA 1R1TA 3F9KA 3IHUA 1K6OA 2LBFA 4U0WA 3WGHA 1YQAA 1FBUA 3ZQLA 2F4MB 2QBYA 2VE9A 3I64A 5DCMB 1XPXA 2ZMEC 2XGEA 2D45A 4R8HA 2RV8A 2GXAA 2EV6A 2J5OA 3NAUA 2IS2A 1P4WA 5L3EA 1FZPB 5LFAA 3GCMA 1GV5A 1X1CA 2DFHA 1HSJA 1ZREA 4KICA 1BJZA 1ETVA 1QA6A 4A2UA 4KMFA 4C2UA 4XORA 3ZCOA 4DYRA 2ZMEA 2ADUA 3IWFA 1I1SA 2NVUB 3JRFA 2KISA 2V7FA 2WV0A 1X2MA 3ECOA 2R5ZB 2Z99A 1IRFA 4AUXA 1K78B 2JVGA 5J1RA 3TMOA 2ECCA 3ONQA 2XPUA 5LGTA 3JRDA 2Y0MA 3J7AO 2QKMB 4CCKA 4R79A 4DQ2A 1U5TB 1YOVB 4I01A 1ZG3A 4U88A 3F0CA 2A6TA 2CG4A 2OZUA 3AG1H 5JLXA 4XRSA 5BMZA 5FGMA 2EIMH 1HW2A 2HZTA 2OJED 3FMQA 1R22A 2WB1N 3OYAA 2C6YA 4HSRA 2HOEA 4DZPA 4Y52J 2TDXA 3DF8A 3HKZA 3QPTA 3C7JA 1MDMB 2ESHA 1U6GA 1KQ9A 2Q2EB 2ZNYA 4UB8C 1YG2A 1F43A 5AIPA 5GP9A 3BZCA 3OYFA 4N4OB 2R5ZA 2HS5A 4UVAA 5D6FA 1K78A 2IBDA 1IN7A 1ZGAA 1U3EM 3DPTA 1IGNA 5EEHA 5JR3A 4OOIA 2GA2A 3I53A 3GVAA 4RGUA 4ENKA 2K85A 3BC8A 2EFWA 2HEOA 3JRHA 3DTEA 3ULQB 4GXOA 3S93A 3FK6A 3SZGA 2EINH 3OSGA 1FYLA 1LUJB 4XN3A 3I71A 3K70C 2JA8J 4A3EJ 1GXQA 1ZQ3P 1MH4A 1X2NA 2WTEA 3HHGA 4IO9F 1JHHA 3KLNA 2DPDA 3S15J 1KONA 3FM5A 4PGGA 4N9HA 4KYWA 4IRIA 1VQ5I 3OSFA 4AYBA 4FCYA 5D8LB 4IL6C 3BTIA 1ODDA 3GEZA 1D1BA 3RDIA 3LFUA 2DMUA 4DOZA 3IH3A 4L5IA 3H9GA 1YYVA 1H0MA 3M3YJ 1MJAA 4MEXF 3K1NA 2IS6A 3JR9A 4A5MA 2YS9A 2XF6A 3FXUA 2OF7A 4H4KC 4KT5C 4R1HA 4UB6C 4ASNA 5A2QZ 3PM1A 3KPHA 3H0DA 2DO7A 1ZELA 2KJBA 5HNFA 2BY1A 1WJFA 3WU2C 4XN0A 1T38A 1ZHFA 5HLTA 3QODA 3GTGJ 2ZJ2A 2DMTA 3S1QJ 2K9MA 3ABTA 4I02A 3E5QA 3ZPLA 3HOTA 1XG1A 2LREA 1PUFB 1DGWY 1ZR4A 4HOBA 5CLSA 1YLFA 4QTRA 3OIQA 3H5RA 3HB9A 3KEQA 3Q9SA 2PJRB 3HEFA 2CV0A 3AG2H 2EWNA 4UVCA 3K6GA 3TBIA 1G2HA 2LKPA 3ISPA 4NNJA 3ABUA 1IRGA 1LQ1A 3M8JA 3CC2I 3QYBA 2ZXWH 4FE7A 4OMYA 4FTHA 1UZCA 2ME0A 3LFKA 2HTSA 3AKZA 5FKOA 2ZJQF 2R7DA 3ECHA 4Q47A 2R7UA 3KE2A 3JW4A 1IDYA 1XX5A 5M5XJ 4IHXA 4I0BA 3CJQB 3QU6A 1KYZA 5LRRA 1BIAA 3ERMA 1XGMA 1FOWA 1X4OA 2GOXB 4AU7A 4UUVA 2R7QA 3KETA 3C18A 1QNTA 1Y1VJ 4GCVA 5KAIC 5J8CA 3SQNA 4A5NA 3CCUI 5DCFA 2BXZA 4ZDLA 2M8GX 2DCEA 3TOAA 3MKLA 4EVIA 1XB4A 3TW7A 2BE5F 4KITB 3SJMA 1ZLKA 1FSEA 4F92B 1KGSA 2I8DA 3N4MA 1OYWA 1B72B 3ZMDA 1RC9A 2R93J 3ZR8X 2L9VA 4A12A 2XKOA 1B9MA 1P2FA 3RYRA 1VFCA 2JA7J 2AXTC 3KP3A 2Y0SA 3ZN0A 3M1EA 1FEXA 1JUSA 3A0HC 2K9NA 4GRIA 2HQRA 4BEHB 4XBFA 3G71I 3BTCA 5ICCA 4M3GA 1KU2A 3MD2A 4BNCA 4M3DA 3CP8A 1MMDA 2KKOA 1Z05A 2R7RA 1FLIA 3WTUC 1ZKGA 1RI7A 3UKGA 5KCMA 4BH9A 1WGXA 1KU9A 5EGOB 3RYPA 3ZQGA 4UY8I 3DLAA 2ZB9A 2HOTA 5FRNA 3G6EI 4M9ZA 1X1BA 2HQ5A 3J81K 2GQQA 2HYFA 2ZCWA 1XMKA 3NWSA 4II2A 3A01A 2LK2A 1MJBA 1MZBA 1V3FA 3QQAA 1ZYRF 1CF7B 5K1YA 5TJJA 3FK7A 3ROUA 3ZRGA 1REPC 2PJPA 1A31A 2TCTA 3FKJA 4BXXJ 3O8HA 5B1BH 4KMUX 2GM4A 5FFXA 2QVOA 1R7JA 3Q9VA 2W24A 4G7OF 3L09A 1D1CA 3ASOH 2D1HA 4XM3A 1JGGA 2CS3A 4O3MA 1HSTA 5CVRA 1YRNB 4XRMA 1F1ZA 1ONVA 5F1JA 5FROA 3CO6C 3DBHB 2P6SA 2R7XA 4BJTA 1LEBA 1VQ9I 2GLOA 3A0BC 2QF7A 1ON2A 2Z3YA 4EM2A 1XTAA 4L5JA 3OYCA 2O3FA 4B43A 3DKWA 5K5OA 1MBHA 4BU2A 3CLQA 1KQ8A 5L3CA 1JUMA 2XV4S 3FM3A 1MBFA 3KLOA 3IAS2 5ED4A 2R7WA 2IA1A 4CDGA 1S5LC 4HF0A 2CV1A 1J7KA 1D0YA 2ELKA 2XASA 1ZK8A 3HM5A 3BLYA 2XHKA 4GO1A 4NQWB 1HW1A 1O7LA 3FXMA 3TO7A 1XS9A 1F5TA 3CQZJ 3Q0WA 3CTAA 1OYIA 5HS8A 1JE8A 3K4LA 3RQIA 1KQ0A 3CMYA 1SFOJ 2F5VA 4IJAA 2DFFA 3FDYA 3OYJA 4MHGA 3L2RA 1G4DA 2DQLA 4F7ZA 2LY9A 2XC7A 2LH9A 3WG9A 3K1PA 4P5OA 2YU3A 1IXRC 2FNAA 4W97A 1R36A 1F9NA 1KA8A 5FB2A 2MG4A 1VI0A 4C2MJ 2G0EA 2K5CA 3GTLJ 1LEAA 1IDZA 2JUGA 2MC4A 1U0JA 2MBFA 4NBQA 2QUFA 4MNUA 4NQWA 3L9FA 1SD6A 2DOEA 2DFEA 4UV8A 3KYCB 2Y69H 2CQKA 3OIOA 4A6DA 3FXLA 4C3JJ 1U9OA 3B6AA 2L7FP 4ESBA 1VQ4I 2EBIA 3CJRB 3B6CA 3TGNA 3D5LA 2A07F 3WTZA 4RM3A 1OPCA 1R4MB 1G6NA 3G1MA 1W7PD 1TWGJ 4ZYGA 3G4SI 5FO5A 1E0EA 4I0AA 4UNOA 4H0EA 5K7HA 4CUGA 1QHHD 3I59B 1TZLA 3MFKA 2OU2A 5ICGA 1Y8QB 5E79C 2ZJRF 1JXSA 2JPBA 2W84A 2FMLA 1O3RA 3OOUA 4UV9A 1RR7A 1Y0UA 3GTJJ 2XAHA 1IN8A 2BEOA 1OCTC 3I58A 5CJ9A 3OOPA 5FKLA 2DTZA 2Q0OA 4L5EA 2AQEA 3GFJA 5IY5H 2GAUA 1XDSA 2A3SA 2MW8A 4M3BA 5B66C 2NS0A 3LA3A 4HBLA 1D8JA 3DU5A 4M6YA 4LB6B 1HF0A 2DK8A 4QPQA 4U7BA 3PNTA 4FX4A 3F8CA 4UVBA 3OYBA 2WADA 1Z7UA 1UFMA 2ZFUA 1E3PA 5F0CA 1YW7A 2HPIA 1IV6A 2KPMA 2VQHA 5FFZA 3B73A 3W2AA 5D4SA 4PFPA 3BJOA 2K9SA 2R5YB 3I59A 3HTUA 4LGWA 3TKYA 5D5WB 2I10A 1Y0NA 1OR7C 2CQ7A 3QP5A 2PLYA 5EZGA 4LOCA 2HI3A 2NNNA 4NUBA 1JGSA 2R7FA 1F4KA 2VBWA 3ABKH 4XL9A 1ETWA 2FBIA 5J6XA 2GIZA 3WHCA 4ENJA 5BQTA 3PIOF 4IEJA 4CGZA 2HFHA 1OR7A 2VQCA 3R61A 5LRSA 2Y9ZA 5JI6A 2G7UA 1XGSA 2M0CA 1SC7A 1MSFC 1BI2A 2WB1A 4E7KA 3EQLF 1QZEA 4Y15A 2KIMA 4BDYA 2E2JJ 3D5RC 4HQMA 1RKWA 3HPHA 3CCVI 1WVRA 1D5VA 4C9YA 4MIMA 1M1EB 2VJ5A 2IJLA 1VF9A 3VYTB 2QSHX 3CCRI 2CGPA 5EYRA 2E1CA 3HUGA 3OS0A 4BBSJ 2ZFWA 3Q0UA 3OYLA 3ZQ7A 3HRMA 4ZYEA 2V4JC 3S3OA 2X48A 2R7VA 2BZTA 2PX9A 2X1DA 1XSDA 1U8BA 1D5YA 2QSGX 2DA5A 3LOCA 3N05A 3HDDA 2F48A 1W4MA 1BOBA 1VQPI 2VONA 2HKXA 4OWRB 2VBYA 3PNYA 4JQFA 2FX0A 4UXNA 4BQOA 1W5TA 2L3DA 1APLC 3KIOA 4A3BJ 5LEJA 1FIAA 1OYYA 1OJLA 3IRQA 3H3UA 1AHDP 4LLNA 3VEPA 2R4GA 5CVIA 2LLKA 4MEYF 3VB2A 4L9VA 3JSPA 2V6CA 5CPRB 5H6RA 3WTVC 2RQPA 1WJEA 2R0QC 3BOQA 4KDPA 3NWTA 4V2GA 2LYCA 1Z3YA 4E7IA 2L2OA 2LR8A 3BDDA 5LGNA 3KZYA 4RBOA 4C3HJ 3TO9A 1BI1A 3HGYA 4JYKA 2VBZA 5KAFC 3MZHA 3I54A 1WFXA 1X58A 2JQ7A 1ZAOA 1W36D 3CF2A 3GZ6A 1AKHA 2VOPA 2V9PA 2HU9A 4II3A 5AIQA 5LLQA 1BBYA 4LFUA 2UV1A 4ZYHA 2WAQA 5CKTA 3CCSI 1O57A 3S1NJ 3CCYA 5HLIA 2JJ7A 4JK1X 1BJAA 2IRFG 1XMAA 4F52A 4PK4A 1K4SA 2ID6A 2H27A 1TT0A 5CQEA 1U2WA 2V1DA 1WRJA 4AVPA 1ZARA 2V1NA 3KZIC 2EZKA 2K02A 5F1RA 1I5ZA 4YFXF 3DEEA 2W4SA 2DPUA 1IAWA 1FOKA 1TQMA 4CYCB 3EYYA 4XLEA 3HSFA 2VASA 2R7ZJ 1P7IA 4IOCF 5FLVA 1BR4A 3LMMA 4AVZA 3HHHA 2VODA 3BJ6A 4DW6A 2MH9A 1UJ8A 5M5WJ 1FSHA 1BW6A 3OR1C 2JT1A 1PP8F 2OAZA 1VQMI 1UMQA 3IKVA 1JT0A 2IW5A 1MNEA 2BXYA 4XRFA 2MC3A 2KIQA 2GOMA 2ZSHB 1Z6RA 2HQAA 3J80K 2ZXIA 5L3GA 2O03A 1B6AA 4ZZDA 3EUAA 3FKIJ 5HVQC 4HAMA 3A02A 1MMAA 2L0KA 3G3ZA 4G9YA 4XMYA 2IAIA 3Q5FA 3QPLA 3HRSA 5HS9A 1B8IA 2HGCA 2R3SA 3NRVA 3PL8A 2DT7B 3GLXA 1DUXC 4I76A 3K9TA 1IO2A 3U21A 5IYCJ 2CU7A 1Y39A 2CSOA 1BM9A 1GDTA 2KP6A 5JHUA 3ZGKA 4CXFA 1HLVA 4NC6A 2QQAA 2Q8KA 1QPIA 4S0HB 1ZRDA 4HG2A 1QHGA 4FT8A 2VBXA 2Z9OA 4RB2C 1Z3XA 3M8FA 1YW9A 1JUPA 1BW5A 1UG0A 3WG7H 5BS6A 5M3MJ 1JJ8C 5J4VA 1H8AC 5F27A 2MD0A 1X1DA 1FMWA 5IP6A 2JZYA 3OMYA 3CD6I 2OC6A 4HV5A 2XGDA 3TQNA 3OYNA 4RB0A 5TGTA 4B1RA 4CA0A 1YI2I 1WZ2A 3NARA 5KNLA 1QPMA 2M45A 3RPUA 4F3QA 5FLXZ 2VT3A 2JSCA 1ZRCA 4MGRA 1ORKA 3KP5A 1J0RA 3H5AA 1S72I 5HLGA 1RNLA 4YG2F 2IVMA 3H36A 3ZMTA 1IN4A 1X4PA 2JRMA 2KIFA 5ERIA 2OPTA 2X6OA 2G9WA 1Y8RB 3TEDA 4LMYA 4XKVA 3ZQIA 1LB2A 2ECBA 5DCMA 1EJ9A 2HVQA 3CMAI 4RA2A 5HDGA 5FLMJ 2YX7A 5FLXK 3R0AA 4RDUA 3MZYA 3OL4A 4J01A 3K70D 4RLQA 2NYXA 4TV7A 4CH7A 5DM7F 1VTNC 5C4XJ 1G3YA 3RPQA 3GTQJ 1D3YA 1U5TC 3PJRA 5FRMA 3H1CA 4A3DJ 4EEFG 2E19A 2ETHA 1VQNI 3CCEI 4BHCA 2IGKA 5EEAA 1WJ5A 2CWEA 1WJCA 2UXXA 4A3MJ 1HBXG 4BACA 2KRHA 4PDKA 1HQCA 2HPMA 3GO5A 3CMEI 1TLHB 1WPKA 1U5TA 4BXFA 1XN7A 4XIDA 2CJJA 3B02A 3OYDA 1J5YA 1Q1VA 3FHNA 1S7AA 3VDXA 1H89C 2O9LA 1MBGA 5DUIA 3RIRA 2V1UA 1YE9A 4B44A 4G12A 1IZ1A 2DODA 5E18F 1BN5A 4ZTFA 4HNVA 2E34A 4A6EA 3WTYC 2KQRA 1MDMA 2FEZA 3W2WA 3E0JB 4DJAA 2Q2EA 2FD5A 2XGCA 4MFEA 1KYWA 4PZJA 3ZP5A 5H2FC 3T0YA 4OIPF 3F23A 2Y31A 5IT9Z 2KJCA 1JT6A 4XSXF 2JVHA 2FNPA 2RGVA 4PJ0C 4YELA 5JVGF 4NHJA 4L0YB 2AO9A 3Q3SA 1SFEA 4PSWA 1YIJI 5JHFA 1WCMJ 3GFMA 1YJWI 3ZMSA 4IHVA 3M1CA 2Y9YA 4IPAA 4F91B 5LD2C 1S8NA 3GFLA 3L2UA 1IRZA 2LNBA 5GAGJ 1PP7U 3ZN1A 2F4OB 4HV6A 3HJEA 4CHUA 2H94A 3GW2A 1ZTRA 2LFBA 1MMNA 2MH2A 2XKPA 1ZLJA 1A04A 1XCVA 2W7NA 3FXKA 2CQXA 5E3LA 2W82A 2PN6A 1UB9A 4LK0F 3ABMH 3R0JA 1RUOA 2XAGA 2KIUA 4E7LA 4J19A 5EG0B 2HWVA 1QVUA 3H35A 4XKBA 2V9KA 2BYVE 3BR2A 5A2QK 3CZ6A 2IS4A 2FQ4A 4E7JA 2M4KA 5D6EA 2J5PA 2YSRA 5E1WA 1WJBA 1MMGA 3CUQB 2DDAA 3RKXA 3SFZA 3ZMUA 2E35A 2O61A 5B3SH 5L3DA 2FU4A 2CUJA 3K4NA 3TP0A 2IGOA 3H0GJ 4M9SA 2Z1DA 3JCUC 4LK1F 1JJ6C 3H92A 2VLAA 3LQRA 2L9SA 5HDKA 1P4AA 1S6LA 3OS1A 2QZ8A 1PUFA 2X1EA 2R92J 3CUQC 1KU7A 3IL2A 4A3CJ 1LDKB 2O8XA 3HOYJ 4DYCA 4EM1A 4PCQA 2DYRH 2PJRA 4RGSA 1ZN2A 3T5XA 3V7SA 3HSRA 5EZHA 3VYRB 3DKYA 4XLHA 2HYJA 4YEJA 3BT9A 2FRHA 3DXJF 4BXUA 1OKRA 1UCRA 2JMWA 4FHTA 3KEOA 3JRCA 3MWMA 4EJVA 4UUSB 1XD7A 2W00A 1YIOA 4HLYA 2E2IJ 2F5CA 3CCQI 2VUMJ 4OIOF 1XSXA 2BY2A 2CYYA 2DYSH 1IUFA 3Q0VA 5DD4A 3KYDB 1BOAA 3QOPA 3W3CA 2V1XA 3J7AY 1UHMA 2VB6A 5E1XA 1LVAA 3TOBA 4LD5A 4FQGA 2E5ZA 1DDNA 2Z5UA 3I56I 3LA7A 1BI3A 4CZCA 4XNFA 5M5YJ 4BQNA 2XB5A 1YS7A 3G73A 3K0LA 3R6SA 1T2KA 2RDPA 1B72A 1T0FC 3BPXA 2VKEA 4IF4A 1IXSB 2WBMA 1ZG1A 4A3JJ 2E71A 3E6DA 2A5YB 1S9HA 3SHFA 2EA4A 1W1WE 3FBNB 2VT2A 5ICFA 4KUMA 5GAHJ 1U78A 1O4XA 3BP8A 4ENNA 4Y3OA 3H9QA 1B9NA 5E8IA 4XLAA 3TP3A 4BEHA 1TW2A 3GMEA 2BBYA 4PGHA 2LSOA 1V5GA 3W2VA 1WSUA 2L02A 1T0FA 1YITI 3HYIA 1W5SA 3BWGA 4CSWA 3VOEA 3GLLA 3PSFA 3EDPA 3NEUA 1TQPA 2EFQA 2VXZA 4IOAF 1GLNA 4M73A 1HW5A 1O3SA 4N9IA 2QENA 3E3VA 3PIPF 2GWRA 4FETA 2XROA 4XICA 2R7TA 5E3NA 2DLLA 3GZ5A 5EGOA 3FXRA 3QWLA 5K7FA 4W1UA 4EQQA 2PMUA 2V9VA 2XAQA 1D1AA 2Z33A 3IH4A 3OYMA 2PI0A 3JRBA 2FF4A 2HDWA 3MKYB 2EB7A 4XLPF 4RMNA 3SEQA 4IXAA 1RESA 2OTLI 1K83J 1Y1WJ 2UUZA 1CF7A 2K3FA 2MA3A 3EUKL 1D0XA 4I7HA 1LKXA 1FOXA 1E2XA 1I27A 2ZKZA 3HRUA 3T8RA 5GTIC 2LKSA 5IP9J 4XKCA 5E17F 2E7XA 3ZQHA 3P5JA 1PJRA 4Y13A 4A69C 4B8XA 1FT9A 1SMTA 3RQ4A 1R49A 4JOMA 5LHIA 4LG0B 3X2QH 3REOA 3E5UA 2WC2A 4L18B 3LL7A 4FE4A 3BJAA 2PBIA 1VQLI 5E3MA 2CQNA 3QPHA 1OMIA 2FSWA 4WXDA 3L2VA 3ELKA 4AIJA 3QPSA 1AU7A 2WY7Q 1YRNA 2XAFA 3HC7A 3K2AA 1N77A 2ISYA 2CH0A 3FMSA 1SFKA 1ULYA 3CESA 3CP2A 4AIKA 4IQJA 2DDBA 2L9RA 3HOUJ 3VYUB 3IH2A 4WCGA 5F0HA 5M3FJ 3DV8A 3F3XA 4PJLA 2NVTJ 2VPLA 1MW7A 3K4CA 4BYYA 2DOAA 2V6EA 2VQGA 5KHDA 1LDDA 3FXJA 2JSPA 1JI8A 2CUFA 4KA4A 3KEYA 2OZ6A 3E6MA 1BC7C 3WU1B 4B4CA 2VPRA 4E6KG 2I5UA 3H9JA 3W6KB 3N97A 1XGOA 1T08B 2XF5A 3IP4B 5FKKA 4X0GA 4BAYA 2IPQX 4S04A 2CUEA 4M9XA 4B48A 1BI0A 4Y17A 2E5NA 2WV1A 2DFIA 3PSIA 1YFHA 1IF1A 2RNGA 3H5NA 1FPQA 2K7LA 4RB3C 5HODA 3OY9A 2E1OA 1DGRM 3ERED 1SD5A 2DTRA 2X51A 5J4YA 4BGDA 1GT0C 2E1MB 1PYVA 3DBLB 3R60A 2NRAC 5ICEA 1TT5B 3U1KA 4DIQA 1YS6A 2EFOA 3OYKA 2K3PA 2L4MA 3GF2A 5EEGA 1SAUA 2DK5A 2CQQA 1FYKA 2RNJA 4XSZF 3S2DJ 1FP2A 3LSMA 3HOXJ 2CMPA 1HDPA 3VSLA 4P1WA 1K61A 1SFXA 2MLKA 3C3WA 5GPAA 4MFDA 4ZYDA 2M7BA 4ESFA 4BQAA 4LIVA 5AONA 4NB5A 3L00A 5GTHC 2GA1A 1ACIA 3HPGA 3K10A 2EIKH 3F8BA 2FBHA 3RJPA 2QWWA 3NQOA 2STTA 4U7DA 4HX8A 4RGRA 2DA7A 2DA6A 1B4AA 1WJAA 4RAFA 2NXNB 2Z16A 1O3TA 4HF1A 1ETKA 3LSRA 3CCJI 1FBQA 1OQYA 3JRIA 2DT6A 4ETSA 1KZHA 2FOWA 3MVPA 4GDFA 4DBRA 3CUOA 1FX7A 4RB1A 1J59A 4KNYA 3L1PA 1I3QJ 3A03A 2UXNA 4YIIA 2XPWA 3ZXSA 3L2WA 2CFOA 3FHZA 3K4JA 1MD0A 5IPAA 2JK3A 1Z21A 3RSNA 2IGMA 3DPLC 1W7PB 1QGPA 4KN7X 2F4IA 4M71A 4E4HA 2RQQA 1A36A 3PFYA 3FXQA 3CMMA 4M3FA 1G59A 1WI9A 2BVMA 2XB0X 1Z9CA 3BROA 4HZFA 4XK4A 3ASNH 4C2TA 2LF7A 1SD4A 1FMVA 3SEZA 1MIJA 1XCBA 3LSKA 3KP4A 3HZJA 3KZZA 2H6BA 4DGWB 2W57A 2Y0SN 4L0ZB 3DTKA 3PQKA 4A3KJ 4HPQA 3G1LA 2DMQA 5GPCA 4LB5A 4IVNA 5CYVA 1FTZA 1A6QA 1Z1DA 4ZDPA 4I2OA 3U1DA 3S3NA 4AM3A 4CCOA 3CDIA 4EATA 1RETA 1I6XA 2QCOA 3HTSB 2OD5A 1JKRC 1TWCJ 4LJZF 3O3KA
chains in the Genus database with same CATH topology
4EV0A 4BHPA 2ELHA 2YPRA 3F22A 2QM3A 1G3WA 5LEKA 4G6DA 5HDNA 3CO7C 3BY6A 1ZGJA 1TQIA 3RKYA 4I09A 3BZ6A 2ZXJA 4HLXA 3P9KA 2ACJA 4MQ9F 4WX9A 3LAPA 1QZYA 4EMSA 1Q1HA 5DEQA 5KVRA 1R23A 4Q4ZF 2DQRA 3C1DA 4EGZA 3JAMZ 3F8NA 3FMRA 4UHTA 2P5VA 3GWZA 5CVVA 4HDVA 3IC7A 4MTDA 1EH7A 3R4KA 2ISZA 1AWCA 2XVCA 1O7FA 3HRTA 1IW7F 3JAMK 2ZBKA 3RKWA 1FY7A 4HQEA 3P9IA 1R00A 3PQJA 2PQ8A 3OV8A 2F5DA 4E70A 1IN6A 1TW3A 2LF8A 2HTJA 2AS5F 1HXDA 1WQ2A 3U9GA 3KCCA 5D8KB 1XSVA 2HQNA 4P9UA 1AOYA 2FXAA 3HIFA 4G8XA 2QQBA 4B09A 3CLOA 4EM0B 2HKOA 3SZTA 5LHHA 1GVJA 2P4WA 2L01A 3KP6A 4G7HF 2P5LC 3L2CA 2W85A 2ZNZA 3F8FA 3GX4X 1K7AA 2IT0A 3F72A 2JRTA 5KK1A 4OU0A 3E6CC 1S7OA 2BGCA 4N0BA 2QBYB 3FWEA 2DBBA 3EETA 3GXOA 3QP6A 4RAZA 5ILUA 1XDUA 1ZG5A 4G94A 3EUHA 3CDHA 2FMYA 5BPIA 1R5HA 3LWFA 1GHCA 2ZMEB 2K27A 2XAJA 5BOXA 4HW0A 1D8KA 3RTRA 2XUBA 2CO5A 1R58A 5L3BA 1BC8C 1QZZA 4D0PA 1O3QA 3GUDA 4HA8A 2P8TA 3VFZA 3S2WA 2UWMA 3WU0A 3AAFA 1V4RA 2M87A 2FBKA 2GXBA 4A0XA 1RZ4A 1DPUA 4L9JA 4LLGF 4AIHA 5D4RA 4IRHA 1MKMA 2A6HF 2YR2A 2IA0A 3FZVA 3BPVA 2DI3A 1SAXA 1X3UA 2P7VB 3WTXC 4OMZA 2K4BA 3PFIA 4EJUA 1FNNA 1J2XA 1CGPA 2D2WA 4FX0A 3D0SA 1R5GA 3T8TA 1G3TA 1IUYA 4OIQF 4K2EA 4HX4A 4U0YA 3JTGA 3WTTC 1T98A 1FBSA 5TRDA 2PEXA 3SXYA 4G6QA 4Z2YA 1DPRA 4WWCA 3E97A 2EK5A 4QWQA 1MJ9A 4EJTA 2HR3A 3M8EA 4Q48A 3M9AA 2JPCA 2RN7A 1P6RA 2RVCA 3VODA 1RIOH 1B59A 5BPDA 5IT9K 3F21A 2XRNA 1QO0D 4GYIA 2VE8A 4CYDA 2H09A 3WTSC 4HDUA 2F5FA 5K5QA 3WGIA 1PDNC 5DDGA 5H20A 2EV5A 1H9TA 3LA2A 2COMA 2EA2A 3LQQA 2EFPA 5L3FA 2WWYA 1USSA 5F64A 1Z6TA 2IA2A 2V79A 3I4PA 2AXLA 5D5VB 1FP1D 3TDUC 3F6VA 2G7HA 2M5WA 3WE3A 1J9IA 4LLLA 5HOOA 5JVTA 3CUQA 1HKTA 4WXCA 1LNWA 3LAJA 1P4XA 2DAOA 1R1VA 3I0TA 3QAHA 1GXPA 5JFRA 1T6SA 4A0ZA 1BIBA 4ENMA 3DP7A 1TTYA 2XGXA 4KN4X 5D5UB 4O6JA 1LDJA 4YFKF 3J81Z 4XLNF 4IRGA 4M72A 3ML6A 4OINF 3KP2A 2E7WA 4KIGA 1L3LA 4IHTA 2DT5A 5E8GA 1E17A 1TNTA 1KU3A 3DFGA 4KFCA 1EV7A 3KFWX 4KIBA 3TDZC 3MCZA 2D1VA 3F8MA 5DV5A 1S29A 3QU3A 3F6OA 3QRFF 2PG4A 2QQ9A 3HSEA 2E1NA 2L4AA 2JTVA 5ILVA 2F2EA 1H9GA 3GFIA 2BV6A 2QLZA 1ON1A 2Y48A 4AD9A 2A68F 4L9NA 2FQ3A 4U0VA 1T39A 1ZRFA 4GYGA 4CO8A 1EH8A 1YW8A 5IT3A 1Z91A 3MEXA 2K86A 3IKTA 1YTYA 2ZO4A 5CVUA 4M6XA 1YO5C 2HDCA 3E5XA 3WTWC 4YFNF 4LG0A 2M1BA 2CW0F 4ESJA 1G3SA 2XIGA 1UHWA 2ESNA 3RI4A 1HKSA 2O6GE 2NNYA 2A6EF 3ZMZA 1TNSA 5DUKA 1RUNA 2EJRA 4WK8F 1I1GA 4A0YA 4QLCU 4AWXB 1MGTA 4IHSA 3V8KA 2FE3A 1K79A 2VC1A 3V8JA 2X4HA 2EFNA 5K5RA 1HKQA 3WODF 4KIFA 2QYOA 3DEUA 3P9CA 5E1ZB 5H6QA 5F6FA 4L9TA 2P7CB 2CFXA 2M8EA 1DP7P 1QQIA 3JTHA 2M30A 4CZZA 4JBAA 4ZZLA 4HX7A 2OQRA 3JSOA 4P9FA 2PFBA 4MTEA 4P96A 1C0WA 5HS7A 4ZH4F 2LDUA 5LGUA 2EV0A 5D5XB 4M74A 1LJ9A 2OBPA 1WWXA 2P6TA 2HYGD 2X0LA 4CICA 3V7RA 1W7PA 4DNCA 4P55A 2NAZA 2L54A 2UZKA 2KRFA 5CVJA 1B1BA 3CJNA 1SMYF 2O0YA 1FWZA 2GXGA 1SD7A 3U2RA 1FYMA 2K4JA 3SZPA 1WKMA 4EJOA 2IP2A 4HYEA 3O2PE 2VOOA 4I98B 3M7GA 3IRRA 2RKHA 4RAYA 2GIVA 3MQ0A 1FC3A 3K2ZA 1USTA 2MLGA 5J8FA 2OA4A 1U8RA 2VC0A 1STZA 1TBXA 1P92A 3I5UA 4YIFA 5DYMA 3MAJA 2H6CA 3K69A 4S05A 2FOKA 2RC4A 2STWA 4GGGA 3FX3A 3FF5A 1ZH5A 2Y75A 2A61A 3WE2A 3IWZA 3WGGA 3KP7A 4G7ZF 2PMHA 2MD5A 5E20A 3T1BA 4ON0A 3TO6A 4WXHA 4WF2A 2A69F 1QBJA 1JHFA 3COAC 1R1UA 5HLHA 4BHBA 2B0LA 5FD5A 3GYHX 5DD8A 6PAXA 2F5EA 1NHAA 3W6JB 3J80Z 3V7CA 3V8LA 2VN2A 4RGXA 2GZWA 1L0OC 2W25A 3H3ZA 1S3JA 2DW4A 3ZMVA 1J75A 4RS8A 3HOSA 1EH6A 1IN5A 1SFUA 4EGYA 3K1MA 3V4GA 3O6BB 3E6BA 3L7WA 5FD6A 3LSTA 2P5KA 3DQVC 2OQGA 4OIRF 4O5VA 4HF2A 1PUEE 2DU9A 5LHGA 1IXCA 2YX4A 5ILSA 4MQVA 3P7NA 5LBQA 3EYIA 4EJWA 4Q5SF 1XGNA 2FA5A 1R1TA 3IHUA 1K6OA 4U0WA 3WGHA 1YQAA 1FBUA 2QBYA 2VE9A 3I64A 5DCMB 2D45A 4R8HA 2RV8A 2EV6A 2J5OA 1P4WA 5L3EA 1FZPB 1HSJA 1ZREA 4KICA 4KMFA 4A2UA 2ZMEA 2ADUA 3IWFA 1I1SA 2WV0A 3ECOA 2Z99A 1IRFA 1K78B 5LGTA 2Y0MA 3J7AO 4R79A 4DQ2A 1U5TB 4I01A 1ZG3A 4U88A 2CG4A 2OZUA 5BMZA 5FGMA 1HW2A 2HZTA 3FMQA 1R22A 2C6YA 2HOEA 2TDXA 3DF8A 3QPTA 3C7JA 1MDMB 2ESHA 1U6GA 1KQ9A 2ZNYA 1YG2A 5AIPA 2HS5A 4UVAA 5D6FA 1K78A 1IN7A 1ZGAA 1U3EM 3DPTA 5JR3A 5EEHA 4OOIA 2GA2A 3I53A 3GVAA 4RGUA 4ENKA 2EFWA 2HEOA 3ULQB 4GXOA 1FYLA 3I71A 1GXQA 2WTEA 3HHGA 1JHHA 3KLNA 2DPDA 3FM5A 4PGGA 4N9HA 4KYWA 4IRIA 5D8LB 1ODDA 3GEZA 3RDIA 4L5IA 1H0MA 1YYVA 1MJAA 4MEXF 3K1NA 4A5MA 3FXUA 4KT5C 4R1HA 4ASNA 5A2QZ 2DO7A 2KJBA 1T38A 1ZHFA 2ZJ2A 3ABTA 4I02A 3E5QA 3ZPLA 3HOTA 4HOBA 5CLSA 1YLFA 3KEQA 3Q9SA 2EWNA 4UVCA 2LKPA 3ISPA 3ABUA 1IRGA 1LQ1A 4OMYA 3LFKA 2HTSA 2R7DA 3ECHA 4Q47A 3KE2A 3JW4A 4I0BA 3QU6A 1KYZA 5LRRA 1BIAA 1XGMA 4UUVA 3KETA 3C18A 1QNTA 4GCVA 5J8CA 3SQNA 4A5NA 5DCFA 3TOAA 4EVIA 1XB4A 2BE5F 1ZLKA 1FSEA 1KGSA 3N4MA 1OYWA 3ZMDA 4A12A 2XKOA 1B9MA 1P2FA 3RYRA 3KP3A 3ZN0A 3M1EA 2HQRA 4XBFA 5ICCA 4BNCA 1KU2A 2KKOA 1Z05A 1FLIA 3WTUC 1RI7A 4BH9A 1KU9A 3RYPA 4M9ZA 3J81K 2GQQA 2HYFA 2ZCWA 1XMKA 1MJBA 1MZBA 1V3FA 1ZYRF 1CF7B 5K1YA 5TJJA 3ROUA 1REPC 2PJPA 4KMUX 5FFXA 2QVOA 1R7JA 3Q9VA 2W24A 4G7OF 3L09A 2D1HA 4O3MA 1HSTA 5CVRA 1F1ZA 1ONVA 3CO6C 2P6SA 1LEBA 1ON2A 2Z3YA 4EM2A 4L5JA 2O3FA 3DKWA 5K5OA 1KQ8A 5L3CA 2XV4S 3FM3A 3KLOA 5ED4A 2IA1A 4CDGA 4HF0A 1J7KA 2XASA 4GO1A 2XHKA 1HW1A 1O7LA 3TO7A 1F5TA 5HS8A 3CTAA 1OYIA 1JE8A 1KQ0A 4IJAA 4MHGA 1G4DA 4F7ZA 2DQLA 3WG9A 3K1PA 4P5OA 2YU3A 1IXRC 2FNAA 1R36A 1F9NA 1KA8A 5FB2A 1LEAA 2MBFA 2QUFA 4MNUA 4NQWA 3L9FA 1SD6A 4UV8A 2CQKA 4A6DA 4ESBA 3TGNA 3D5LA 2A07F 3WTZA 1OPCA 1G6NA 1W7PD 4ZYGA 5FO5A 4I0AA 4UNOA 4H0EA 3I59B 3MFKA 2OU2A 5ICGA 1JXSA 2JPBA 2W84A 2FMLA 1O3RA 4UV9A 1Y0UA 2XAHA 1IN8A 2BEOA 3I58A 5CJ9A 3OOPA 2Q0OA 3GFJA 2GAUA 1XDSA 2A3SA 2NS0A 3LA3A 4HBLA 1D8JA 4M6YA 4LB6B 4FX4A 2DK8A 4U7BA 3F8CA 4UVBA 1Z7UA 1UFMA 1YW7A 5FFZA 3B73A 5D4SA 3BJOA 3I59A 3HTUA 4LGWA 3TKYA 5D5WB 3QP5A 2PLYA 2NNNA 1JGSA 2R7FA 1F4KA 2VBWA 2FBIA 5J6XA 4ENJA 5BQTA 4CGZA 2HFHA 1OR7A 3R61A 5LRSA 5JI6A 2G7UA 1XGSA 1BI2A 3EQLF 4Y15A 2KIMA 4HQMA 1D5VA 2IJLA 2CGPA 2E1CA 3HUGA 2ZFWA 3ZQ7A 3HRMA 4ZYEA 1XSDA 1W4MA 2VONA 2HKXA 2VBYA 4JQFA 4UXNA 1W5TA 2L3DA 5LEJA 1OYYA 3IRQA 3H3UA 4LLNA 3VEPA 5CVIA 4MEYF 3VB2A 4L9VA 3JSPA 2V6CA 5H6RA 3WTVC 2RQPA 3BOQA 4KDPA 3BDDA 5LGNA 3KZYA 3TO9A 1BI1A 2VBZA 3MZHA 3I54A 1ZAOA 2VOPA 3GZ6A 5LLQA 5AIQA 1BBYA 4LFUA 4ZYHA 1O57A 5HLIA 4JK1X 1BJAA 2IRFG 1XMAA 2H27A 1U2WA 2V1DA 1WRJA 4AVPA 1ZARA 5F1RA 2K02A 1I5ZA 4YFXF 2DPUA 1IAWA 1FOKA 1TQMA 3EYYA 3HSFA 3HHHA 2VODA 3BJ6A 2MH9A 1FSHA 2JT1A 1PP8F 2OAZA 3IKVA 2IW5A 4XRFA 2MC3A 1Z6RA 3J80K 5L3GA 2O03A 1B6AA 4ZZDA 5HVQC 4HAMA 4G9YA 3G3ZA 3Q5FA 3HRSA 5HS9A 2HGCA 2R3SA 3NRVA 3GLXA 1DUXC 3K9TA 2CSOA 1BM9A 5JHUA 4CXFA 2QQAA 2Q8KA 1ZRDA 4FT8A 2VBXA 2Z9OA 4RB2C 3M8FA 1YW9A 5BS6A 2JZYA 4HV5A 3TQNA 4RB0A 1QPMA 2M45A 3RPUA 5FLXZ 2VT3A 2JSCA 1ZRCA 4MGRA 3KP5A 1J0RA 5HLGA 1RNLA 4YG2F 2IVMA 3ZMTA 1IN4A 2KIFA 5ERIA 2G9WA 4LMYA 1LB2A 5DCMA 5HDGA 2YX7A 5FLXK 3R0AA 3MZYA 2NYXA 4TV7A 1VTNC 1G3YA 3RPQA 1D3YA 1U5TC 2ETHA 4BHCA 2CWEA 2UXXA 1HBXG 4PDKA 1HQCA 3GO5A 1TLHB 1U5TA 1XN7A 3B02A 1J5YA 1S7AA 5DUIA 3RIRA 2V1UA 1IZ1A 5E18F 1BN5A 3WTYC 4A6EA 1MDMA 2FEZA 2Q2EA 4PZJA 1KYWA 3ZP5A 3T0YA 4OIPF 3F23A 5IT9Z 2KJCA 4XSXF 2FNPA 2RGVA 4NHJA 4L0YB 1SFEA 3GFMA 3ZMSA 4IPAA 1S8NA 3GFLA 2LNBA 1PP7U 3ZN1A 4HV6A 4CHUA 2H94A 3GW2A 2MH2A 2XKPA 1ZLJA 1A04A 1XCVA 2PN6A 1UB9A 4LK0F 3R0JA 1RUOA 2XAGA 2KIUA 2HWVA 2BYVE 5A2QK 5D6EA 2J5PA 2YSRA 5E1WA 3CUQB 3RKXA 3SFZA 3ZMUA 2O61A 5L3DA 2FU4A 4M9SA 4LK1F 3H92A 3LQRA 5HDKA 1P4AA 1S6LA 2QZ8A 3CUQC 1KU7A 3IL2A 1LDKB 2O8XA 4EM1A 4PCQA 4RGSA 1ZN2A 3T5XA 3V7SA 3HSRA 2FRHA 3DXJF 4BXUA 1OKRA 1UCRA 4FHTA 3KEOA 3MWMA 4EJVA 1XD7A 1YIOA 4HLYA 2F5CA 4OIOF 1XSXA 2CYYA 5DD4A 1BOAA 3QOPA 2V1XA 1UHMA 5E1XA 1LVAA 3TOBA 4LD5A 1DDNA 2Z5UA 3LA7A 1BI3A 1YS7A 3G73A 3K0LA 3R6SA 1T2KA 2RDPA 3BPXA 4IF4A 1IXSB 1ZG1A 3E6DA 2A5YB 3SHFA 2EA4A 2VT2A 5ICFA 4KUMA 1U78A 3BP8A 4ENNA 1B9NA 5E8IA 1TW2A 2BBYA 4PGHA 2LSOA 1WSUA 2L02A 1T0FA 3HYIA 1W5SA 3BWGA 3VOEA 3EDPA 3NEUA 1TQPA 2EFQA 2VXZA 4M73A 1HW5A 1O3SA 4N9IA 2QENA 3E3VA 2GWRA 2XROA 2DLLA 3GZ5A 3FXRA 4EQQA 2PMUA 2V9VA 2XAQA 2Z33A 2PI0A 2FF4A 2EB7A 4XLPF 4IXAA 1CF7A 2MA3A 4I7HA 1E2XA 1I27A 2ZKZA 3HRUA 3T8RA 5E17F 2E7XA 4Y13A 4B8XA 1FT9A 1SMTA 5LHIA 4LG0B 3REOA 3E5UA 2WC2A 4L18B 3BJAA 2PBIA 3QPHA 1OMIA 2FSWA 4WXDA 3ELKA 4AIJA 2XAFA 2ISYA 3FMSA 1ULYA 4AIKA 4WCGA 3DV8A 3F3XA 4BYYA 1LDDA 4KA4A 2OZ6A 3E6MA 1BC7C 3WU1B 3W6KB 3N97A 1XGOA 4BAYA 2IPQX 4S04A 4M9XA 1BI0A 4Y17A 2DFIA 1YFHA 1IF1A 1FPQA 2K7LA 4RB3C 3ERED 1SD5A 2DTRA 3R60A 2NRAC 5ICEA 1YS6A 2EFOA 5EEGA 2L4MA 3GF2A 2DK5A 1FYKA 2RNJA 4XSZF 1FP2A 1SFXA 2MLKA 3C3WA 4ZYDA 4ESFA 4BQAA 5AONA 4NB5A 3L00A 2GA1A 3F8BA 2FBHA 3RJPA 2QWWA 3NQOA 2STTA 4U7DA 4HX8A 4RGRA 1B4AA 1O3TA 4HF1A 1FBQA 4ETSA 3CUOA 1FX7A 4RB1A 1J59A 4KNYA 2UXNA 4YIIA 3FHZA 1MD0A 3DPLC 1W7PB 1QGPA 4KN7X 4M71A 3FXQA 1WI9A 1Z9CA 3BROA 4HZFA 2LF7A 1SD4A 1XCBA 3KP4A 3KZZA 2H6BA 2W57A 4L0ZB 3PQKA 4LB5A 4IVNA 5CYVA 1Z1DA 4I2OA 3U1DA 3HTSB 1I6XA 2OD5A 4LJZF 3O3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EV0 A;  4BHP A;  2ELH A;  2YPR A;  3F22 A;  2QM3 A;  1G3W A;  5LEK A;  4G6D A;  5HDN A;  3CO7 C;  3BY6 A;  1ZGJ A;  1TQI A;  3RKY A;  4I09 A;  3BZ6 A;  2ZXJ A;  4HLX A;  3P9K A;  2ACJ A;  4MQ9 F;  4WX9 A;  3LAP A;  1QZY A;  4EMS A;  1Q1H A;  5DEQ A;  5KVR A;  1R23 A;  4Q4Z F;  2DQR A;  3C1D A;  4EGZ A;  3JAM Z;  3F8N A;  3FMR A;  4UHT A;  2P5V A;  3GWZ A;  5CVV A;  4HDV A;  3IC7 A;  4MTD A;  1EH7 A;  3R4K A;  2ISZ A;  1AWC A;  2XVC A;  1O7F A;  3HRT A;  1IW7 F;  3JAM K;  2ZBK A;  3RKW A;  1FY7 A;  4HQE A;  3P9I A;  1R00 A;  3PQJ A;  2PQ8 A;  3OV8 A;  2F5D A;  4E70 A;  1IN6 A;  1TW3 A;  2LF8 A;  2HTJ A;  2AS5 F;  1HXD A;  1WQ2 A;  3U9G A;  3KCC A;  5D8K B;  1XSV A;  2HQN A;  4P9U A;  1AOY A;  2FXA A;  3HIF A;  4G8X A;  2QQB A;  4B09 A;  3CLO A;  4EM0 B;  2HKO A;  3SZT A;  5LHH A;  1GVJ A;  2P4W A;  2L01 A;  3KP6 A;  4G7H F;  2P5L C;  3L2C A;  2W85 A;  2ZNZ A;  3F8F A;  3GX4 X;  1K7A A;  2IT0 A;  3F72 A;  2JRT A;  5KK1 A;  4OU0 A;  3E6C C;  1S7O A;  2BGC A;  4N0B A;  2QBY B;  3FWE A;  2DBB A;  3EET A;  3GXO A;  3QP6 A;  4RAZ A;  5ILU A;  1XDU A;  1ZG5 A;  4G94 A;  3EUH A;  3CDH A;  2FMY A;  5BPI A;  1R5H A;  3LWF A;  1GHC A;  2ZME B;  2K27 A;  2XAJ A;  5BOX A;  4HW0 A;  1D8K A;  3RTR A;  2XUB A;  2CO5 A;  1R58 A;  5L3B A;  1BC8 C;  1QZZ A;  4D0P A;  1O3Q A;  3GUD A;  4HA8 A;  2P8T A;  3VFZ A;  3S2W A;  2UWM A;  3WU0 A;  3AAF A;  1V4R A;  2M87 A;  2FBK A;  2GXB A;  4A0X A;  1RZ4 A;  1DPU A;  4L9J A;  4LLG F;  4AIH A;  5D4R A;  4IRH A;  1MKM A;  2A6H F;  2YR2 A;  2IA0 A;  3FZV A;  3BPV A;  2DI3 A;  1SAX A;  1X3U A;  2P7V B;  3WTX C;  4OMZ A;  2K4B A;  3PFI A;  4EJU A;  1FNN A;  1J2X A;  1CGP A;  2D2W A;  4FX0 A;  3D0S A;  1R5G A;  3T8T A;  1G3T A;  1IUY A;  4OIQ F;  4K2E A;  4HX4 A;  4U0Y A;  3JTG A;  3WTT C;  1T98 A;  1FBS A;  5TRD A;  2PEX A;  3SXY A;  4G6Q A;  4Z2Y A;  1DPR A;  4WWC A;  3E97 A;  2EK5 A;  4QWQ A;  1MJ9 A;  4EJT A;  2HR3 A;  3M8E A;  4Q48 A;  3M9A A;  2JPC A;  2RN7 A;  1P6R A;  2RVC A;  3VOD A;  1RIO H;  1B59 A;  5BPD A;  5IT9 K;  3F21 A;  2XRN A;  1QO0 D;  4GYI A;  2VE8 A;  4CYD A;  2H09 A;  3WTS C;  4HDU A;  2F5F A;  5K5Q A;  3WGI A;  1PDN C;  5DDG A;  5H20 A;  2EV5 A;  1H9T A;  3LA2 A;  2COM A;  2EA2 A;  3LQQ A;  2EFP A;  5L3F A;  2WWY A;  1USS A;  5F64 A;  1Z6T A;  2IA2 A;  2V79 A;  3I4P A;  2AXL A;  5D5V B;  1FP1 D;  3TDU C;  3F6V A;  2G7H A;  2M5W A;  3WE3 A;  1J9I A;  4LLL A;  5HOO A;  5JVT A;  3CUQ A;  1HKT A;  4WXC A;  1LNW A;  3LAJ A;  1P4X A;  2DAO A;  1R1V A;  3I0T A;  3QAH A;  1GXP A;  5JFR A;  1T6S A;  4A0Z A;  1BIB A;  4ENM A;  3DP7 A;  1TTY A;  2XGX A;  4KN4 X;  5D5U B;  4O6J A;  1LDJ A;  4YFK F;  3J81 Z;  4XLN F;  4IRG A;  4M72 A;  3ML6 A;  4OIN F;  3KP2 A;  2E7W A;  4KIG A;  1L3L A;  4IHT A;  2DT5 A;  5E8G A;  1E17 A;  1TNT A;  1KU3 A;  3DFG A;  4KFC A;  1EV7 A;  3KFW X;  4KIB A;  3TDZ C;  3MCZ A;  2D1V A;  3F8M A;  5DV5 A;  1S29 A;  3QU3 A;  3F6O A;  3QRF F;  2PG4 A;  2QQ9 A;  3HSE A;  2E1N A;  2L4A A;  2JTV A;  5ILV A;  2F2E A;  1H9G A;  3GFI A;  2BV6 A;  2QLZ A;  1ON1 A;  2Y48 A;  4AD9 A;  2A68 F;  4L9N A;  2FQ3 A;  4U0V A;  1T39 A;  1ZRF A;  4GYG A;  4CO8 A;  1EH8 A;  1YW8 A;  5IT3 A;  1Z91 A;  3MEX A;  2K86 A;  3IKT A;  1YTY A;  2ZO4 A;  5CVU A;  4M6X A;  1YO5 C;  2HDC A;  3E5X A;  3WTW C;  4YFN F;  4LG0 A;  2M1B A;  2CW0 F;  4ESJ A;  1G3S A;  2XIG A;  1UHW A;  2ESN A;  3RI4 A;  1HKS A;  2O6G E;  2NNY A;  2A6E F;  3ZMZ A;  1TNS A;  5DUK A;  1RUN A;  2EJR A;  4WK8 F;  1I1G A;  4A0Y A;  4QLC U;  4AWX B;  1MGT A;  4IHS A;  3V8K A;  2FE3 A;  1K79 A;  2VC1 A;  3V8J A;  2X4H A;  2EFN A;  5K5R A;  1HKQ A;  3WOD F;  4KIF A;  2QYO A;  3DEU A;  3P9C A;  5E1Z B;  5H6Q A;  5F6F A;  4L9T A;  2P7C B;  2CFX A;  2M8E A;  1DP7 P;  1QQI A;  3JTH A;  2M30 A;  4CZZ A;  4JBA A;  4ZZL A;  4HX7 A;  2OQR A;  3JSO A;  4P9F A;  2PFB A;  4MTE A;  4P96 A;  1C0W A;  5HS7 A;  4ZH4 F;  2LDU A;  5LGU A;  2EV0 A;  5D5X B;  4M74 A;  1LJ9 A;  2OBP A;  1WWX A;  2P6T A;  2HYG D;  2X0L A;  4CIC A;  3V7R A;  1W7P A;  4DNC A;  4P55 A;  2NAZ A;  2L54 A;  2UZK A;  2KRF A;  5CVJ A;  1B1B A;  3CJN A;  1SMY F;  2O0Y A;  1FWZ A;  2GXG A;  1SD7 A;  3U2R A;  1FYM A;  2K4J A;  3SZP A;  1WKM A;  4EJO A;  2IP2 A;  4HYE A;  3O2P E;  2VOO A;  4I98 B;  3M7G A;  3IRR A;  2RKH A;  4RAY A;  2GIV A;  3MQ0 A;  1FC3 A;  3K2Z A;  1UST A;  2MLG A;  5J8F A;  2OA4 A;  1U8R A;  2VC0 A;  1STZ A;  1TBX A;  1P92 A;  3I5U A;  4YIF A;  5DYM A;  3MAJ A;  2H6C A;  3K69 A;  4S05 A;  2FOK A;  2RC4 A;  2STW A;  4GGG A;  3FX3 A;  3FF5 A;  1ZH5 A;  2Y75 A;  2A61 A;  3WE2 A;  3IWZ A;  3WGG A;  3KP7 A;  4G7Z F;  2PMH A;  2MD5 A;  5E20 A;  3T1B A;  4ON0 A;  3TO6 A;  4WXH A;  4WF2 A;  2A69 F;  1QBJ A;  1JHF A;  3COA C;  1R1U A;  5HLH A;  4BHB A;  2B0L A;  5FD5 A;  3GYH X;  5DD8 A;  6PAX A;  2F5E A;  1NHA A;  3W6J B;  3J80 Z;  3V7C A;  3V8L A;  2VN2 A;  4RGX A;  2GZW A;  1L0O C;  2W25 A;  3H3Z A;  1S3J A;  2DW4 A;  3ZMV A;  1J75 A;  4RS8 A;  3HOS A;  1EH6 A;  1IN5 A;  1SFU A;  4EGY A;  3K1M A;  3V4G A;  3O6B B;  3E6B A;  3L7W A;  5FD6 A;  3LST A;  2P5K A;  3DQV C;  2OQG A;  4OIR F;  4O5V A;  4HF2 A;  1PUE E;  2DU9 A;  5LHG A;  1IXC A;  2YX4 A;  5ILS A;  4MQV A;  3P7N A;  5LBQ A;  3EYI A;  4EJW A;  4Q5S F;  1XGN A;  2FA5 A;  1R1T A;  3IHU A;  1K6O A;  4U0W A;  3WGH A;  1YQA A;  1FBU A;  2QBY A;  2VE9 A;  3I64 A;  5DCM B;  2D45 A;  4R8H A;  2RV8 A;  2EV6 A;  2J5O A;  1P4W A;  5L3E A;  1FZP B;  1HSJ A;  1ZRE A;  4KIC A;  4KMF A;  4A2U A;  2ZME A;  2ADU A;  3IWF A;  1I1S A;  2WV0 A;  3ECO A;  2Z99 A;  1IRF A;  1K78 B;  5LGT A;  2Y0M A;  3J7A O;  4R79 A;  4DQ2 A;  1U5T B;  4I01 A;  1ZG3 A;  4U88 A;  2CG4 A;  2OZU A;  5BMZ A;  5FGM A;  1HW2 A;  2HZT A;  3FMQ A;  1R22 A;  2C6Y A;  2HOE A;  2TDX A;  3DF8 A;  3QPT A;  3C7J A;  1MDM B;  2ESH A;  1U6G A;  1KQ9 A;  2ZNY A;  1YG2 A;  5AIP A;  2HS5 A;  4UVA A;  5D6F A;  1K78 A;  1IN7 A;  1ZGA A;  1U3E M;  3DPT A;  5JR3 A;  5EEH A;  4OOI A;  2GA2 A;  3I53 A;  3GVA A;  4RGU A;  4ENK A;  2EFW A;  2HEO A;  3ULQ B;  4GXO A;  1FYL A;  3I71 A;  1GXQ A;  2WTE A;  3HHG A;  1JHH A;  3KLN A;  2DPD A;  3FM5 A;  4PGG A;  4N9H A;  4KYW A;  4IRI A;  5D8L B;  1ODD A;  3GEZ A;  3RDI A;  4L5I A;  1H0M A;  1YYV A;  1MJA A;  4MEX F;  3K1N A;  4A5M A;  3FXU A;  4KT5 C;  4R1H A;  4ASN A;  5A2Q Z;  2DO7 A;  2KJB A;  1T38 A;  1ZHF A;  2ZJ2 A;  3ABT A;  4I02 A;  3E5Q A;  3ZPL A;  3HOT A;  4HOB A;  5CLS A;  1YLF A;  3KEQ A;  3Q9S A;  2EWN A;  4UVC A;  2LKP A;  3ISP A;  3ABU A;  1IRG A;  1LQ1 A;  4OMY A;  3LFK A;  2HTS A;  2R7D A;  3ECH A;  4Q47 A;  3KE2 A;  3JW4 A;  4I0B A;  3QU6 A;  1KYZ A;  5LRR A;  1BIA A;  1XGM A;  4UUV A;  3KET A;  3C18 A;  1QNT A;  4GCV A;  5J8C A;  3SQN A;  4A5N A;  5DCF A;  3TOA A;  4EVI A;  1XB4 A;  2BE5 F;  1ZLK A;  1FSE A;  1KGS A;  3N4M A;  1OYW A;  3ZMD A;  4A12 A;  2XKO A;  1B9M A;  1P2F A;  3RYR A;  3KP3 A;  3ZN0 A;  3M1E A;  2HQR A;  4XBF A;  5ICC A;  4BNC A;  1KU2 A;  2KKO A;  1Z05 A;  1FLI A;  3WTU C;  1RI7 A;  4BH9 A;  1KU9 A;  3RYP A;  4M9Z A;  3J81 K;  2GQQ A;  2HYF A;  2ZCW A;  1XMK A;  1MJB A;  1MZB A;  1V3F A;  1ZYR F;  1CF7 B;  5K1Y A;  5TJJ A;  3ROU A;  1REP C;  2PJP A;  4KMU X;  5FFX A;  2QVO A;  1R7J A;  3Q9V A;  2W24 A;  4G7O F;  3L09 A;  2D1H A;  4O3M A;  1HST A;  5CVR A;  1F1Z A;  1ONV A;  3CO6 C;  2P6S A;  1LEB A;  1ON2 A;  2Z3Y A;  4EM2 A;  4L5J A;  2O3F A;  3DKW A;  5K5O A;  1KQ8 A;  5L3C A;  2XV4 S;  3FM3 A;  3KLO A;  5ED4 A;  2IA1 A;  4CDG A;  4HF0 A;  1J7K A;  2XAS A;  4GO1 A;  2XHK A;  1HW1 A;  1O7L A;  3TO7 A;  1F5T A;  5HS8 A;  3CTA A;  1OYI A;  1JE8 A;  1KQ0 A;  4IJA A;  4MHG A;  1G4D A;  4F7Z A;  2DQL A;  3WG9 A;  3K1P A;  4P5O A;  2YU3 A;  1IXR C;  2FNA A;  1R36 A;  1F9N A;  1KA8 A;  5FB2 A;  1LEA A;  2MBF A;  2QUF A;  4MNU A;  4NQW A;  3L9F A;  1SD6 A;  4UV8 A;  2CQK A;  4A6D A;  4ESB A;  3TGN A;  3D5L A;  2A07 F;  3WTZ A;  1OPC A;  1G6N A;  1W7P D;  4ZYG A;  5FO5 A;  4I0A A;  4UNO A;  4H0E A;  3I59 B;  3MFK A;  2OU2 A;  5ICG A;  1JXS A;  2JPB A;  2W84 A;  2FML A;  1O3R A;  4UV9 A;  1Y0U A;  2XAH A;  1IN8 A;  2BEO A;  3I58 A;  5CJ9 A;  3OOP A;  2Q0O A;  3GFJ A;  2GAU A;  1XDS A;  2A3S A;  2NS0 A;  3LA3 A;  4HBL A;  1D8J A;  4M6Y A;  4LB6 B;  4FX4 A;  2DK8 A;  4U7B A;  3F8C A;  4UVB A;  1Z7U A;  1UFM A;  1YW7 A;  5FFZ A;  3B73 A;  5D4S A;  3BJO A;  3I59 A;  3HTU A;  4LGW A;  3TKY A;  5D5W B;  3QP5 A;  2PLY A;  2NNN A;  1JGS A;  2R7F A;  1F4K A;  2VBW A;  2FBI A;  5J6X A;  4ENJ A;  5BQT A;  4CGZ A;  2HFH A;  1OR7 A;  3R61 A;  5LRS A;  5JI6 A;  2G7U A;  1XGS A;  1BI2 A;  3EQL F;  4Y15 A;  2KIM A;  4HQM A;  1D5V A;  2IJL A;  2CGP A;  2E1C A;  3HUG A;  2ZFW A;  3ZQ7 A;  3HRM A;  4ZYE A;  1XSD A;  1W4M A;  2VON A;  2HKX A;  2VBY A;  4JQF A;  4UXN A;  1W5T A;  2L3D A;  5LEJ A;  1OYY A;  3IRQ A;  3H3U A;  4LLN A;  3VEP A;  5CVI A;  4MEY F;  3VB2 A;  4L9V A;  3JSP A;  2V6C A;  5H6R A;  3WTV C;  2RQP A;  3BOQ A;  4KDP A;  3BDD A;  5LGN A;  3KZY A;  3TO9 A;  1BI1 A;  2VBZ A;  3MZH A;  3I54 A;  1ZAO A;  2VOP A;  3GZ6 A;  5LLQ A;  5AIQ A;  1BBY A;  4LFU A;  4ZYH A;  1O57 A;  5HLI A;  4JK1 X;  1BJA A;  2IRF G;  1XMA A;  2H27 A;  1U2W A;  2V1D A;  1WRJ A;  4AVP A;  1ZAR A;  5F1R A;  2K02 A;  1I5Z A;  4YFX F;  2DPU A;  1IAW A;  1FOK A;  1TQM A;  3EYY A;  3HSF A;  3HHH A;  2VOD A;  3BJ6 A;  2MH9 A;  1FSH A;  2JT1 A;  1PP8 F;  2OAZ A;  3IKV A;  2IW5 A;  4XRF A;  2MC3 A;  1Z6R A;  3J80 K;  5L3G A;  2O03 A;  1B6A A;  4ZZD A;  5HVQ C;  4HAM A;  4G9Y A;  3G3Z A;  3Q5F A;  3HRS A;  5HS9 A;  2HGC A;  2R3S A;  3NRV A;  3GLX A;  1DUX C;  3K9T A;  2CSO A;  1BM9 A;  5JHU A;  4CXF A;  2QQA A;  2Q8K A;  1ZRD A;  4FT8 A;  2VBX A;  2Z9O A;  4RB2 C;  3M8F A;  1YW9 A;  5BS6 A;  2JZY A;  4HV5 A;  3TQN A;  4RB0 A;  1QPM A;  2M45 A;  3RPU A;  5FLX Z;  2VT3 A;  2JSC A;  1ZRC A;  4MGR A;  3KP5 A;  1J0R A;  5HLG A;  1RNL A;  4YG2 F;  2IVM A;  3ZMT A;  1IN4 A;  2KIF A;  5ERI A;  2G9W A;  4LMY A;  1LB2 A;  5DCM A;  5HDG A;  2YX7 A;  5FLX K;  3R0A A;  3MZY A;  2NYX A;  4TV7 A;  1VTN C;  1G3Y A;  3RPQ A;  1D3Y A;  1U5T C;  2ETH A;  4BHC A;  2CWE A;  2UXX A;  1HBX G;  4PDK A;  1HQC A;  3GO5 A;  1TLH B;  1U5T A;  1XN7 A;  3B02 A;  1J5Y A;  1S7A A;  5DUI A;  3RIR A;  2V1U A;  1IZ1 A;  5E18 F;  1BN5 A;  3WTY C;  4A6E A;  1MDM A;  2FEZ A;  2Q2E A;  4PZJ A;  1KYW A;  3ZP5 A;  3T0Y A;  4OIP F;  3F23 A;  5IT9 Z;  2KJC A;  4XSX F;  2FNP A;  2RGV A;  4NHJ A;  4L0Y B;  1SFE A;  3GFM A;  3ZMS A;  4IPA A;  1S8N A;  3GFL A;  2LNB A;  1PP7 U;  3ZN1 A;  4HV6 A;  4CHU A;  2H94 A;  3GW2 A;  2MH2 A;  2XKP A;  1ZLJ A;  1A04 A;  1XCV A;  2PN6 A;  1UB9 A;  4LK0 F;  3R0J A;  1RUO A;  2XAG A;  2KIU A;  2HWV A;  2BYV E;  5A2Q K;  5D6E A;  2J5P A;  2YSR A;  5E1W A;  3CUQ B;  3RKX A;  3SFZ A;  3ZMU A;  2O61 A;  5L3D A;  2FU4 A;  4M9S A;  4LK1 F;  3H92 A;  3LQR A;  5HDK A;  1P4A A;  1S6L A;  2QZ8 A;  3CUQ C;  1KU7 A;  3IL2 A;  1LDK B;  2O8X A;  4EM1 A;  4PCQ A;  4RGS A;  1ZN2 A;  3T5X A;  3V7S A;  3HSR A;  2FRH A;  3DXJ F;  4BXU A;  1OKR A;  1UCR A;  4FHT A;  3KEO A;  3MWM A;  4EJV A;  1XD7 A;  1YIO A;  4HLY A;  2F5C A;  4OIO F;  1XSX A;  2CYY A;  5DD4 A;  1BOA A;  3QOP A;  2V1X A;  1UHM A;  5E1X A;  1LVA A;  3TOB A;  4LD5 A;  1DDN A;  2Z5U A;  3LA7 A;  1BI3 A;  1YS7 A;  3G73 A;  3K0L A;  3R6S A;  1T2K A;  2RDP A;  3BPX A;  4IF4 A;  1IXS B;  1ZG1 A;  3E6D A;  2A5Y B;  3SHF A;  2EA4 A;  2VT2 A;  5ICF A;  4KUM A;  1U78 A;  3BP8 A;  4ENN A;  1B9N A;  5E8I A;  1TW2 A;  2BBY A;  4PGH A;  2LSO A;  1WSU A;  2L02 A;  1T0F A;  3HYI A;  1W5S A;  3BWG A;  3VOE A;  3EDP A;  3NEU A;  1TQP A;  2EFQ A;  2VXZ A;  4M73 A;  1HW5 A;  1O3S A;  4N9I A;  2QEN A;  3E3V A;  2GWR A;  2XRO A;  2DLL A;  3GZ5 A;  3FXR A;  4EQQ A;  2PMU A;  2V9V A;  2XAQ A;  2Z33 A;  2PI0 A;  2FF4 A;  2EB7 A;  4XLP F;  4IXA A;  1CF7 A;  2MA3 A;  4I7H A;  1E2X A;  1I27 A;  2ZKZ A;  3HRU A;  3T8R A;  5E17 F;  2E7X A;  4Y13 A;  4B8X A;  1FT9 A;  1SMT A;  5LHI A;  4LG0 B;  3REO A;  3E5U A;  2WC2 A;  4L18 B;  3BJA A;  2PBI A;  3QPH A;  1OMI A;  2FSW A;  4WXD A;  3ELK A;  4AIJ A;  2XAF A;  2ISY A;  3FMS A;  1ULY A;  4AIK A;  4WCG A;  3DV8 A;  3F3X A;  4BYY A;  1LDD A;  4KA4 A;  2OZ6 A;  3E6M A;  1BC7 C;  3WU1 B;  3W6K B;  3N97 A;  1XGO A;  4BAY A;  2IPQ X;  4S04 A;  4M9X A;  1BI0 A;  4Y17 A;  2DFI A;  1YFH A;  1IF1 A;  1FPQ A;  2K7L A;  4RB3 C;  3ERE D;  1SD5 A;  2DTR A;  3R60 A;  2NRA C;  5ICE A;  1YS6 A;  2EFO A;  5EEG A;  2L4M A;  3GF2 A;  2DK5 A;  1FYK A;  2RNJ A;  4XSZ F;  1FP2 A;  1SFX A;  2MLK A;  3C3W A;  4ZYD A;  4ESF A;  4BQA A;  5AON A;  4NB5 A;  3L00 A;  2GA1 A;  3F8B A;  2FBH A;  3RJP A;  2QWW A;  3NQO A;  2STT A;  4U7D A;  4HX8 A;  4RGR A;  1B4A A;  1O3T A;  4HF1 A;  1FBQ A;  4ETS A;  3CUO A;  1FX7 A;  4RB1 A;  1J59 A;  4KNY A;  2UXN A;  4YII A;  3FHZ A;  1MD0 A;  3DPL C;  1W7P B;  1QGP A;  4KN7 X;  4M71 A;  3FXQ A;  1WI9 A;  1Z9C A;  3BRO A;  4HZF A;  2LF7 A;  1SD4 A;  1XCB A;  3KP4 A;  3KZZ A;  2H6B A;  2W57 A;  4L0Z B;  3PQK A;  4LB5 A;  4IVN A;  5CYV A;  1Z1D A;  4I2O A;  3U1D A;  3HTS B;  1I6X A;  2OD5 A;  4LJZ F;  3O3K A; 
#chains in the Genus database with same CATH topology
 1T95 A;  1WHU A;  1ENH A;  2QGU A;  4I6Z A;  4EV0 A;  2OCC H;  4BHP A;  2DMP A;  2ELH A;  2YPR A;  3F22 A;  2QM3 A;  2R5Y A;  3AL0 B;  1G3W A;  1D0Z A;  5FKM A;  5LEK A;  4G6D A;  5HDN A;  3CO7 C;  3BY6 A;  4HST A;  1ZGJ A;  4UUT A;  1TQI A;  3RKY A;  2L5Q A;  3BQY A;  4I09 A;  3BZ6 A;  2ZXJ A;  4HLX A;  3P9K A;  2ACJ A;  4MQ9 F;  4WX9 A;  3LAP A;  4MLO A;  2BY3 A;  3VPR A;  2OUM A;  3LSG A;  5K7Z A;  1QZY A;  4EMS A;  1Q1H A;  5DEQ A;  5B5E C;  2D5V A;  2H1L A;  5KVR A;  4XRS G;  1R23 A;  4Q4Z F;  4PFO A;  2OCE A;  2DQR A;  1MNM C;  3C1D A;  2B63 J;  4EGZ A;  1R4N B;  3SFI A;  1UHS A;  4GFB A;  3JAM Z;  2WY8 Q;  3S16 J;  5J47 A;  3F8N A;  3FMR A;  4UHT A;  2P5V A;  2VL8 A;  3GWZ A;  2XDV A;  1IRX A;  5CVV A;  1WJD A;  3AFH A;  1I6H J;  4HDV A;  3IC7 A;  3CCL I;  4MTD A;  1EH7 A;  4E7Z A;  1A6I A;  3R4K A;  4HEA 2;  3PNV A;  1CQT A;  2ISZ A;  1AWC A;  2HOS A;  4E7H A;  3EPZ A;  2CUZ A;  2KZV A;  2M4G A;  3K4M A;  2XVC A;  3UR3 C;  1MMS A;  1O7F A;  3HRT A;  4J00 A;  1LE8 B;  3BG7 A;  1IW7 F;  3BR0 A;  1K4T A;  4NC7 A;  3JAM K;  3BQZ A;  1OCZ H;  2ZBK A;  3DCF A;  3RKW A;  1FY7 A;  4HQE A;  4FIS A;  2O5R A;  3P9I A;  1R00 A;  3PQJ A;  5DS9 A;  2PQ8 A;  3H3V K;  3OV8 A;  2F5D A;  4E70 A;  1IN6 A;  1TW3 A;  4B3A A;  2LF8 A;  2HTJ A;  2AS5 F;  2WAF A;  3S1M J;  1SAN A;  2ZXH A;  2EZH A;  4JX6 A;  2W48 A;  1HXD A;  1WQ2 A;  2QSF X;  3M07 A;  2DA1 A;  3U9G A;  4Y7N J;  2A05 A;  3KCC A;  4PJM A;  5D8K B;  1XSV A;  3IAM 2;  2HQN A;  4P9U A;  1V54 H;  1OFC X;  1AOY A;  1RPW A;  2HVS A;  2CRG A;  1P7J A;  4A93 J;  2FXA A;  3HIF A;  2LD5 A;  1DP3 A;  1I39 A;  4G8X A;  2QQB A;  2VJ4 A;  2NVY J;  1POG A;  2K9Q A;  4B09 A;  3CLO A;  5J1U A;  2XAU A;  4A3I J;  1X19 A;  1ERD A;  2EH3 A;  4EM0 B;  3RCO A;  4YRV A;  1W0T A;  2JA2 A;  2HKO A;  3SZT A;  1X1A A;  4BQQ A;  2E60 A;  5LHH A;  1GVJ A;  1TWH J;  2P4W A;  4ZC3 A;  2L01 A;  3KP6 A;  3RPU D;  4G7H F;  2QA4 I;  2P5L C;  3L2C A;  1YX3 A;  3GTK J;  1W36 C;  2W85 A;  3I4N J;  2ZNZ A;  3F8F A;  3GX4 X;  1K7A A;  4ZJZ A;  4CYC A;  3G1O A;  2HDD A;  3ABL H;  3S2H J;  3RZO J;  2FJ1 A;  4N4N B;  4CCJ A;  3ZQF A;  4HNU A;  3EUH C;  2IT0 A;  3F72 A;  2JRT A;  3LNQ A;  2TRT A;  1SVL A;  5J40 A;  5KK1 A;  2LBF B;  2P0W A;  4OU0 A;  2YUS A;  2VI6 A;  3E6C C;  2LY2 A;  3CF5 F;  2JA5 J;  2HXO A;  1S7O A;  2BGC A;  4N0B A;  2QBY B;  3FWE A;  2DBB A;  3EET A;  3GXO A;  1YHQ I;  3QP6 A;  4RAZ A;  2EZI A;  4PSX A;  3LSP A;  5ILU A;  1T8I A;  2EQR A;  1XDU A;  3KX2 A;  1RKT A;  1ZG5 A;  4G94 A;  3EUH A;  3CDH A;  4KIS A;  1V55 H;  2M3A A;  2FMY A;  1QRY A;  1WI3 A;  5BPI A;  2B9S A;  1R5H A;  2JN6 A;  3LWF A;  1GHC A;  2ZME B;  2MGQ A;  1XC5 A;  2K27 A;  2QQ8 A;  2XAJ A;  3S17 J;  1TL8 A;  5BOX A;  1X1P A;  4HW0 A;  1D8K A;  3RTR A;  2XUB A;  2CO5 A;  1R58 A;  5L3B A;  2NVX J;  1BC8 C;  1QZZ A;  1EA3 A;  1N25 A;  1WH7 A;  4IQ4 A;  1NG6 A;  2KLO A;  4D0P A;  3PO2 J;  1O3Q A;  5BNG A;  3MN2 A;  3GUD A;  3QYF A;  1GUU A;  4HA8 A;  4Y33 A;  2P8T A;  2X1C A;  3S2W A;  3VFZ A;  1ETQ A;  2UWM A;  1BR2 A;  3WU0 A;  4Z6Y A;  3JRA A;  3AAF A;  1V4R A;  2M87 A;  1R9T J;  1JKO C;  1A35 A;  4QPO A;  2FBK A;  3OS2 A;  2GXB A;  4A0X A;  2LVS A;  2KRC A;  1RZ4 A;  1DPU A;  4L9J A;  4LLG F;  4AIH A;  5D4R A;  4IRH A;  1MKM A;  2A6H F;  1IG7 A;  2YR2 A;  1OLT A;  2EIJ H;  2IA0 A;  2XSJ C;  1RR8 C;  2M34 A;  3FZV A;  3BPV A;  2DI3 A;  1SAX A;  3FIW A;  1X3U A;  1ITY A;  3DKX A;  2P7V B;  3WTX C;  4OMZ A;  2K4B A;  3PFI A;  4EJU A;  2EZL A;  2VKD A;  4NC8 A;  4HRI A;  2IS1 A;  1FNN A;  2LP0 A;  3BG3 A;  1J2X A;  3C2B A;  2ICW G;  3OYH A;  1CGP A;  2D2W A;  4FX0 A;  3D0S A;  1R5G A;  2PMZ N;  3FIS A;  3T8T A;  2R7S A;  1G3T A;  1IUY A;  4OIQ F;  4K2E A;  4QSH A;  1HCR A;  3KYL A;  4HX4 A;  4U0Y A;  1SVO A;  3JTG A;  3WTT C;  2BY0 A;  1T98 A;  1FBS A;  4PUS A;  1OIS A;  1IC8 A;  5TRD A;  2PEX A;  2DOF A;  1YX5 A;  4G6Q A;  3SXY A;  1BR1 A;  2K9L A;  4Z2Y A;  3C2H A;  4XKW A;  3FBI B;  1DPR A;  3HGG A;  1T33 A;  1JTX A;  4OAZ A;  4XLF A;  1IJW C;  3UNG C;  2L9N A;  4WWC A;  3OL3 A;  1MBK A;  3E97 A;  2EK5 A;  4QWQ A;  1MJ9 A;  3G2B A;  4EJT A;  2HR3 A;  2JUC A;  3M8E A;  4Q48 A;  1YJ9 I;  2QKL B;  5C44 J;  3M9A A;  2JPC A;  2RN7 A;  2KDZ A;  1P6R A;  1X3Z B;  2RVC A;  3VOD A;  1FOY A;  4AID A;  3ZQC A;  1RIO H;  2MSY A;  1B59 A;  3VSK A;  5BPD A;  5IT9 K;  3F21 A;  4M3E A;  2XRN A;  2DMN A;  3S3M A;  4D7M A;  2VJI A;  1VQ7 I;  2HOA A;  4PJN A;  2DA2 A;  5DTD A;  1QO0 D;  4GYI A;  4U87 A;  2Y2Z A;  3LSH A;  2VE8 A;  2VJJ A;  4CYD A;  2Y30 A;  4B3X A;  2H09 A;  2H8W A;  4XLC A;  3WTS C;  4HDU A;  1VQO I;  2F5F A;  5K5Q A;  3WGI A;  1PDN C;  5J1Y A;  1EF4 A;  2HNH A;  5DDG A;  5H20 A;  2EV5 A;  2L7K A;  2XF7 A;  1H9T A;  3MKW B;  3BG6 A;  2WAQ N;  3LA2 A;  1R6R A;  3ESW B;  2COM A;  2EA2 A;  1QVT A;  3SDB A;  1RRJ A;  3LQQ A;  2NOJ B;  3D1N I;  4V19 K;  1Z67 A;  2EFP A;  5L3F A;  3CDL A;  2WWY A;  2Q1Z B;  1USS A;  1OCR H;  2LMD A;  5F64 A;  2LTP A;  2DJN A;  1Z6T A;  5C3E J;  4XR6 A;  4BY1 J;  2IA2 A;  2V79 A;  1Y6I A;  3I4P A;  1YJN I;  2AXL A;  4RM2 A;  2DXI A;  5IYD J;  5D5V B;  1FP1 D;  3TDU C;  3F6V A;  5EG0 A;  2WAE A;  2M2E A;  3BCB A;  2G7H A;  2IGN A;  1Z77 A;  2W1O A;  2M5W A;  3WE3 A;  1J9I A;  4XON A;  3J7Y J;  4LLL A;  2CV2 A;  2DJI A;  5HOO A;  5JVT A;  3CUQ A;  1HKT A;  1MBE A;  4WXC A;  2A5W A;  1LNW A;  1TWF J;  2E2H J;  3QYE A;  3FXO A;  2M7A A;  3LAJ A;  1TP4 A;  2HZD A;  3S1R J;  4D9J A;  1P4X A;  1MND A;  2DAO A;  2V26 A;  3RZD J;  4X6A J;  3OIP A;  2M0M A;  1R1V A;  3I0T A;  3QAH A;  1GXP A;  1W5C C;  5JFR A;  1T6S A;  2KDO A;  2KMU A;  4A0Z A;  2H8R A;  1BIB A;  2BOL A;  4ENM A;  2L7M P;  4ITV A;  4IKF A;  2AQF A;  3K4B A;  3K7A J;  2IEK A;  3DP7 A;  1TTY A;  2XGX A;  4KN4 X;  5D5U B;  2EIL H;  3I55 I;  2X6W A;  4PJJ A;  4O6J A;  1ETY A;  3A01 B;  1LDJ A;  4C30 A;  4B47 A;  4UUS A;  4YFK F;  2XSD C;  3J81 Z;  4BKX A;  2EPF A;  3HG9 A;  4XLN F;  2X9D A;  4IRG A;  2CW8 A;  2JWT A;  4XOP A;  2ID3 A;  4M72 A;  3GZN B;  4F55 A;  3ML6 A;  3KP2 A;  2AHQ A;  2E7W A;  4KIG A;  4OIN F;  1L3L A;  2DT5 A;  4IHT A;  5E8G A;  2MYS A;  2KFD A;  1E17 A;  1TNT A;  1KU3 A;  3DFG A;  4KFC A;  3SYT A;  5JLW A;  3DU6 A;  1EV7 A;  5GAD J;  3KFW X;  4KIB A;  4JP0 A;  2B7E A;  3TDZ C;  3DPU A;  4BJ6 C;  3MCZ A;  5FJ8 J;  2D1V A;  2NOG A;  3ZOB A;  3F8M A;  5F04 A;  2LRD A;  5DV5 A;  2LC2 A;  1S29 A;  1V5E A;  3HBL A;  3QU3 A;  3F6O A;  1MBJ A;  3BG9 A;  3QRF F;  3JRG A;  2PG4 A;  2QQ9 A;  2R7O A;  1TWA J;  1E3H A;  5IOZ A;  1HC8 A;  4IHW A;  3HSE A;  1X3W B;  2E1N A;  1OCO H;  2QEX I;  2L4A A;  1LFP A;  3BR1 A;  2JTV A;  1T56 A;  5ILV A;  5GAE J;  2F2E A;  4NDL A;  1ETO A;  1H9G A;  4DZJ A;  1AA7 A;  2E36 A;  3LSI A;  3GFI A;  4CCN A;  4M6V A;  4E7S A;  3HOV J;  2BV6 A;  2QLZ A;  3VWB A;  1ON1 A;  3HKZ N;  1OCC H;  2O7O A;  2Y48 A;  3O8G A;  4AD9 A;  2A68 F;  4D1Q A;  3D5S C;  4L9N A;  2FQ3 A;  1A5J A;  4U0V A;  2M9H A;  3BR3 A;  5F0F A;  2FUG 2;  3CJT B;  1T39 A;  1ZRF A;  1LPQ A;  2OTJ I;  4GYG A;  4A3F J;  4QIW N;  4BDZ A;  1HDD C;  2ZJP F;  3OYE A;  4CO8 A;  1DQU A;  2VKV A;  2LY1 A;  1EH8 A;  1YW8 A;  1VQ8 I;  1MSE C;  5IT3 A;  2N8G A;  1V5F A;  4JX4 A;  4BUP A;  2VKH A;  4F93 B;  1Z91 A;  3MEX A;  1LFU P;  2K86 A;  3IKT A;  1YTY A;  4DBQ A;  2ZO4 A;  5CVU A;  4M6X A;  1YO5 C;  3L2Q A;  2HDC A;  3AG4 H;  2OV7 A;  1JKQ C;  3E5X A;  4IZZ A;  3WTW C;  4YFN F;  4D7N A;  4AYB N;  1JKP C;  4LG0 A;  2M1B A;  2YU9 J;  2CW0 F;  4ESJ A;  1G3S A;  2XIG A;  3MMY B;  1UHW A;  2ESN A;  3RI4 A;  3CC7 I;  1HKS A;  2ZC2 A;  3I3L A;  1P9Q C;  2XPV A;  4C3I J;  2O6G E;  2NNY A;  1UEL B;  2A6E F;  2IXS A;  3WHB A;  3ZMZ A;  1TNS A;  5DM6 F;  5DUK A;  3BCA A;  1RUN A;  2EJR A;  4WK8 F;  1LVK A;  2BVL A;  1I1G A;  4A0Y A;  2P81 A;  1HA8 A;  4QLC U;  4AWX B;  3S14 J;  1MGT A;  4IHS A;  3V8K A;  3GTM J;  2FE3 A;  1K79 A;  2VC1 A;  3V8J A;  1GVD A;  2ZSI B;  3PO3 J;  2DA3 A;  3DLL F;  1ZR2 A;  3BR6 A;  2MAB A;  1BA5 A;  2X6X A;  3AG3 H;  2X4H A;  2EFN A;  5J3L A;  2E1M C;  5K5R A;  1HKQ A;  3WOD F;  4KIF A;  3OYI A;  4KT6 A;  4G6T B;  3OYG A;  3TW6 A;  2QYO A;  3DEU A;  1FJL A;  3P9C A;  5E1Z B;  5H6Q A;  3LSJ A;  5F6F A;  3VYS B;  4L9T A;  4LIU A;  5TIS C;  2P7C B;  2DN0 A;  2CFX A;  2M8E A;  1S7E A;  1XMX A;  1DP7 P;  3PUB A;  1QQI A;  3JTH A;  4ZTJ A;  1TC3 C;  2M30 A;  3BR5 A;  4CZZ A;  4JBA A;  4ZZL A;  1F36 A;  1NG7 A;  2HVR A;  3HXL A;  4HX7 A;  5EDN A;  2H1K A;  1Z0X A;  2OQR A;  1ZGW A;  3E1S A;  1NK2 P;  3S8P A;  3JSO A;  4P9F A;  1BL0 A;  1QU3 A;  2PFB A;  4MTE A;  3CCM I;  1VQ6 I;  3DBR B;  4P96 A;  3V42 A;  1C0W A;  5HS7 A;  4OAY A;  4LIT A;  4ZH4 F;  2LDU A;  1FTT A;  2O8K A;  4D5F A;  5LGU A;  2EV0 A;  3GTP J;  1JTY A;  3IV5 A;  1LFB A;  1FIP A;  5D5X B;  3PUF A;  3BTL A;  4MO7 A;  4A3G J;  4M74 A;  1LJ9 A;  2OBP A;  4CCM A;  1R5I D;  4ANJ A;  1WWX A;  2P6T A;  2HYG D;  2X0L A;  3HUG B;  4BE0 A;  4CIC A;  3V7R A;  3TL4 X;  1W7P A;  5IP7 J;  3BG5 A;  4DNC A;  4P55 A;  2GBY A;  2NAZ A;  4XOT A;  4XQF A;  2L54 A;  3ZQQ A;  4I99 C;  2UZK A;  3JRE A;  4ZYA A;  2KRF A;  5CVJ A;  1B1B A;  1MH3 A;  1Y56 A;  3E7L A;  4RLF A;  2BW3 B;  1N75 A;  2KHM A;  3A1Y A;  1SMY F;  2O0Y A;  3CJN A;  5F08 A;  5B1A H;  1FWZ A;  2NVQ J;  2GXG A;  3DTI A;  5IOY A;  1SD7 A;  2Z2S B;  3U2R A;  1FYM A;  3AL0 C;  1EKE A;  3OWT A;  4YIR X;  2RRE A;  1W0U A;  1NK3 P;  2K4J A;  2PMZ A;  3SZP A;  1VND A;  5EF6 A;  2COB A;  3HOZ J;  1WKM A;  3K4K A;  2ELJ A;  3S32 A;  3DWL E;  4EJO A;  2IP2 A;  4HYE A;  3O2P E;  1SVM A;  2VOO A;  4I98 B;  3M7G A;  3IRR A;  3M4O J;  2RKH A;  4RAY A;  2GIV A;  3MQ0 A;  1FC3 A;  3K2Z A;  4BBR J;  4Y4R A;  1UST A;  2MLG A;  5J8F A;  2X85 A;  2OA4 A;  1U8R A;  3I9V 2;  2VC0 A;  5CQG A;  1STZ A;  1TBX A;  1P92 A;  2NS8 A;  3I5U A;  1I50 J;  2BW3 A;  5HNH A;  1AKH B;  2CW7 A;  1GV2 A;  4ZDO A;  1UG2 A;  5DYM A;  4YIF A;  1U9N A;  3MAJ A;  1G8X A;  2BHY A;  2F6C A;  2H6C A;  2WA0 A;  2LKX A;  3GTO J;  5FKN A;  4IX7 A;  3K69 A;  1R71 A;  3HL2 A;  1NH3 A;  1VZ0 A;  3BZK A;  4S05 A;  1E3O C;  4A3L J;  2FOK A;  2RC4 A;  2VXD A;  2STW A;  1I3A A;  3SDG A;  2RAE A;  3FX3 A;  4GGG A;  3FF5 A;  3RKQ A;  3MZ8 A;  1ZH5 A;  2Y75 A;  4BS9 A;  2A61 A;  3WE2 A;  3IWZ A;  2X6Y A;  3WGG A;  3C2G A;  1PVE A;  1DU6 A;  2L7Z A;  1IV8 A;  3KP7 A;  2ME6 A;  4G7Z F;  2PMH A;  4BY7 J;  2KT0 A;  2MD5 A;  5E20 A;  3T1B A;  4ON0 A;  1Z7L A;  3TO6 A;  4WXH A;  3A4C A;  4WF2 A;  2A69 F;  3A2K A;  1LE8 A;  4DYQ A;  1N78 A;  1QBJ A;  2HXI A;  2K40 A;  2LG4 A;  5C4J J;  1JHF A;  1WH5 A;  3BTJ A;  3I4M J;  5E3O A;  1OCP A;  3COA C;  2JA6 J;  1R1U A;  5HLH A;  1K6Y A;  1ETX A;  2XRL A;  4ABZ A;  4BHB A;  1UAA A;  2B0L A;  4BE1 A;  2BHZ A;  4IHY A;  5FD5 A;  4HNT A;  3GYH X;  5DD8 A;  6PAX A;  2F5E A;  1NHA A;  4V2F A;  3W6J B;  3CC4 I;  3J80 Z;  3V7C A;  4BL0 B;  4AC0 A;  4RAG A;  1B8I B;  3V8L A;  2DA4 A;  2VN2 A;  4RGX A;  2GZW A;  4BJ5 C;  1L0O C;  1SEU A;  4LG3 A;  4JX5 A;  2KL4 A;  3DEW A;  3J7Z I;  2W25 A;  2KZG A;  3H3Z A;  1S3J A;  2NS7 A;  4KJZ A;  2DW4 A;  3ZMV A;  1J09 A;  1J75 A;  3QOE A;  4RS8 A;  3HOS A;  1EH6 A;  9ANT A;  1H88 C;  1IN5 A;  3IUO A;  1SFU A;  4EGY A;  1NTC A;  4D5C A;  3K1M A;  3MKZ A;  3V4G A;  3O6B B;  3E6B A;  4CCL A;  3L7W A;  5FD6 A;  3LST A;  2P5K A;  3OR2 C;  1HOM A;  5EJC A;  3DQV C;  2VQL A;  4FAS D;  2OQG A;  4OIR F;  4O5V A;  5IYB J;  4X1E A;  1DU0 A;  4HF2 A;  3HOW J;  1PUE E;  2MFZ A;  2DU9 A;  5LHG A;  1IXC A;  2YX4 A;  2VIX A;  3GBG A;  5ILS A;  4MQV A;  3P7N A;  5LBQ A;  3EYI A;  4EJW A;  4BE2 A;  4Q5S F;  3W6V A;  1XGN A;  1VQK I;  2FA5 A;  2LOO A;  1R1T A;  3F9K A;  3IHU A;  1K6O A;  2LBF A;  4U0W A;  3WGH A;  1YQA A;  1FBU A;  3ZQL A;  2F4M B;  2QBY A;  2VE9 A;  3I64 A;  5DCM B;  1XPX A;  2ZME C;  2XGE A;  2D45 A;  4R8H A;  2RV8 A;  2GXA A;  2EV6 A;  2J5O A;  3NAU A;  2IS2 A;  1P4W A;  5L3E A;  1FZP B;  5LFA A;  3GCM A;  1GV5 A;  1X1C A;  2DFH A;  1HSJ A;  1ZRE A;  4KIC A;  1BJZ A;  1ETV A;  1QA6 A;  4A2U A;  4KMF A;  4C2U A;  4XOR A;  3ZCO A;  4DYR A;  2ZME A;  2ADU A;  3IWF A;  1I1S A;  2NVU B;  3JRF A;  2KIS A;  2V7F A;  2WV0 A;  1X2M A;  3ECO A;  2R5Z B;  2Z99 A;  1IRF A;  4AUX A;  1K78 B;  2JVG A;  5J1R A;  3TMO A;  2ECC A;  3ONQ A;  2XPU A;  5LGT A;  3JRD A;  2Y0M A;  3J7A O;  2QKM B;  4CCK A;  4R79 A;  4DQ2 A;  1U5T B;  1YOV B;  4I01 A;  1ZG3 A;  4U88 A;  3F0C A;  2A6T A;  2CG4 A;  2OZU A;  3AG1 H;  5JLX A;  4XRS A;  5BMZ A;  5FGM A;  2EIM H;  1HW2 A;  2HZT A;  2OJE D;  3FMQ A;  1R22 A;  2WB1 N;  3OYA A;  2C6Y A;  4HSR A;  2HOE A;  4DZP A;  4Y52 J;  2TDX A;  3DF8 A;  3HKZ A;  3QPT A;  3C7J A;  1MDM B;  2ESH A;  1U6G A;  1KQ9 A;  2Q2E B;  2ZNY A;  4UB8 C;  1YG2 A;  1F43 A;  5AIP A;  5GP9 A;  3BZC A;  3OYF A;  4N4O B;  2R5Z A;  2HS5 A;  4UVA A;  5D6F A;  1K78 A;  2IBD A;  1IN7 A;  1ZGA A;  1U3E M;  3DPT A;  1IGN A;  5EEH A;  5JR3 A;  4OOI A;  2GA2 A;  3I53 A;  3GVA A;  4RGU A;  4ENK A;  2K85 A;  3BC8 A;  2EFW A;  2HEO A;  3JRH A;  3DTE A;  3ULQ B;  4GXO A;  3S93 A;  3FK6 A;  3SZG A;  2EIN H;  3OSG A;  1FYL A;  1LUJ B;  4XN3 A;  3I71 A;  3K70 C;  2JA8 J;  4A3E J;  1GXQ A;  1ZQ3 P;  1MH4 A;  1X2N A;  2WTE A;  3HHG A;  4IO9 F;  1JHH A;  3KLN A;  2DPD A;  3S15 J;  1KON A;  3FM5 A;  4PGG A;  4N9H A;  4KYW A;  4IRI A;  1VQ5 I;  3OSF A;  4AYB A;  4FCY A;  5D8L B;  4IL6 C;  3BTI A;  1ODD A;  3GEZ A;  1D1B A;  3RDI A;  3LFU A;  2DMU A;  4DOZ A;  3IH3 A;  4L5I A;  3H9G A;  1YYV A;  1H0M A;  3M3Y J;  1MJA A;  4MEX F;  3K1N A;  2IS6 A;  3JR9 A;  4A5M A;  2YS9 A;  2XF6 A;  3FXU A;  2OF7 A;  4H4K C;  4KT5 C;  4R1H A;  4UB6 C;  4ASN A;  5A2Q Z;  3PM1 A;  3KPH A;  3H0D A;  2DO7 A;  1ZEL A;  2KJB A;  5HNF A;  2BY1 A;  1WJF A;  3WU2 C;  4XN0 A;  1T38 A;  1ZHF A;  5HLT A;  3QOD A;  3GTG J;  2ZJ2 A;  2DMT A;  3S1Q J;  2K9M A;  3ABT A;  4I02 A;  3E5Q A;  3ZPL A;  3HOT A;  1XG1 A;  2LRE A;  1PUF B;  1DGW Y;  1ZR4 A;  4HOB A;  5CLS A;  1YLF A;  4QTR A;  3OIQ A;  3H5R A;  3HB9 A;  3KEQ A;  3Q9S A;  2PJR B;  3HEF A;  2CV0 A;  3AG2 H;  2EWN A;  4UVC A;  3K6G A;  3TBI A;  1G2H A;  2LKP A;  3ISP A;  4NNJ A;  3ABU A;  1IRG A;  1LQ1 A;  3M8J A;  3CC2 I;  3QYB A;  2ZXW H;  4FE7 A;  4OMY A;  4FTH A;  1UZC A;  2ME0 A;  3LFK A;  2HTS A;  3AKZ A;  5FKO A;  2ZJQ F;  2R7D A;  3ECH A;  4Q47 A;  2R7U A;  3KE2 A;  3JW4 A;  1IDY A;  1XX5 A;  5M5X J;  4IHX A;  4I0B A;  3CJQ B;  3QU6 A;  1KYZ A;  5LRR A;  1BIA A;  3ERM A;  1XGM A;  1FOW A;  1X4O A;  2GOX B;  4AU7 A;  4UUV A;  2R7Q A;  3KET A;  3C18 A;  1QNT A;  1Y1V J;  4GCV A;  5KAI C;  5J8C A;  3SQN A;  4A5N A;  3CCU I;  5DCF A;  2BXZ A;  4ZDL A;  2M8G X;  2DCE A;  3TOA A;  3MKL A;  4EVI A;  1XB4 A;  3TW7 A;  2BE5 F;  4KIT B;  3SJM A;  1ZLK A;  1FSE A;  4F92 B;  1KGS A;  2I8D A;  3N4M A;  1OYW A;  1B72 B;  3ZMD A;  1RC9 A;  2R93 J;  3ZR8 X;  2L9V A;  4A12 A;  2XKO A;  1B9M A;  1P2F A;  3RYR A;  1VFC A;  2JA7 J;  2AXT C;  3KP3 A;  2Y0S A;  3ZN0 A;  3M1E A;  1FEX A;  1JUS A;  3A0H C;  2K9N A;  4GRI A;  2HQR A;  4BEH B;  4XBF A;  3G71 I;  3BTC A;  5ICC A;  4M3G A;  1KU2 A;  3MD2 A;  4BNC A;  4M3D A;  3CP8 A;  1MMD A;  2KKO A;  1Z05 A;  2R7R A;  1FLI A;  3WTU C;  1ZKG A;  1RI7 A;  3UKG A;  5KCM A;  4BH9 A;  1WGX A;  1KU9 A;  5EGO B;  3RYP A;  3ZQG A;  4UY8 I;  3DLA A;  2ZB9 A;  2HOT A;  5FRN A;  3G6E I;  4M9Z A;  1X1B A;  2HQ5 A;  3J81 K;  2GQQ A;  2HYF A;  2ZCW A;  1XMK A;  3NWS A;  4II2 A;  3A01 A;  2LK2 A;  1MJB A;  1MZB A;  1V3F A;  3QQA A;  1ZYR F;  1CF7 B;  5K1Y A;  5TJJ A;  3FK7 A;  3ROU A;  3ZRG A;  1REP C;  2PJP A;  1A31 A;  2TCT A;  3FKJ A;  4BXX J;  3O8H A;  5B1B H;  4KMU X;  2GM4 A;  5FFX A;  2QVO A;  1R7J A;  3Q9V A;  2W24 A;  4G7O F;  3L09 A;  1D1C A;  3ASO H;  2D1H A;  4XM3 A;  1JGG A;  2CS3 A;  4O3M A;  1HST A;  5CVR A;  1YRN B;  4XRM A;  1F1Z A;  1ONV A;  5F1J A;  5FRO A;  3CO6 C;  3DBH B;  2P6S A;  2R7X A;  4BJT A;  1LEB A;  1VQ9 I;  2GLO A;  3A0B C;  2QF7 A;  1ON2 A;  2Z3Y A;  4EM2 A;  1XTA A;  4L5J A;  3OYC A;  2O3F A;  4B43 A;  3DKW A;  5K5O A;  1MBH A;  4BU2 A;  3CLQ A;  1KQ8 A;  5L3C A;  1JUM A;  2XV4 S;  3FM3 A;  1MBF A;  3KLO A;  3IAS 2;  5ED4 A;  2R7W A;  2IA1 A;  4CDG A;  1S5L C;  4HF0 A;  2CV1 A;  1J7K A;  1D0Y A;  2ELK A;  2XAS A;  1ZK8 A;  3HM5 A;  3BLY A;  2XHK A;  4GO1 A;  4NQW B;  1HW1 A;  1O7L A;  3FXM A;  3TO7 A;  1XS9 A;  1F5T A;  3CQZ J;  3Q0W A;  3CTA A;  1OYI A;  5HS8 A;  1JE8 A;  3K4L A;  3RQI A;  1KQ0 A;  3CMY A;  1SFO J;  2F5V A;  4IJA A;  2DFF A;  3FDY A;  3OYJ A;  4MHG A;  3L2R A;  1G4D A;  2DQL A;  4F7Z A;  2LY9 A;  2XC7 A;  2LH9 A;  3WG9 A;  3K1P A;  4P5O A;  2YU3 A;  1IXR C;  2FNA A;  4W97 A;  1R36 A;  1F9N A;  1KA8 A;  5FB2 A;  2MG4 A;  1VI0 A;  4C2M J;  2G0E A;  2K5C A;  3GTL J;  1LEA A;  1IDZ A;  2JUG A;  2MC4 A;  1U0J A;  2MBF A;  4NBQ A;  2QUF A;  4MNU A;  4NQW A;  3L9F A;  1SD6 A;  2DOE A;  2DFE A;  4UV8 A;  3KYC B;  2Y69 H;  2CQK A;  3OIO A;  4A6D A;  3FXL A;  4C3J J;  1U9O A;  3B6A A;  2L7F P;  4ESB A;  1VQ4 I;  2EBI A;  3CJR B;  3B6C A;  3TGN A;  3D5L A;  2A07 F;  3WTZ A;  4RM3 A;  1OPC A;  1R4M B;  1G6N A;  3G1M A;  1W7P D;  1TWG J;  4ZYG A;  3G4S I;  5FO5 A;  1E0E A;  4I0A A;  4UNO A;  4H0E A;  5K7H A;  4CUG A;  1QHH D;  3I59 B;  1TZL A;  3MFK A;  2OU2 A;  5ICG A;  1Y8Q B;  5E79 C;  2ZJR F;  1JXS A;  2JPB A;  2W84 A;  2FML A;  1O3R A;  3OOU A;  4UV9 A;  1RR7 A;  1Y0U A;  3GTJ J;  2XAH A;  1IN8 A;  2BEO A;  1OCT C;  3I58 A;  5CJ9 A;  3OOP A;  5FKL A;  2DTZ A;  2Q0O A;  4L5E A;  2AQE A;  3GFJ A;  5IY5 H;  2GAU A;  1XDS A;  2A3S A;  2MW8 A;  4M3B A;  5B66 C;  2NS0 A;  3LA3 A;  4HBL A;  1D8J A;  3DU5 A;  4M6Y A;  4LB6 B;  1HF0 A;  2DK8 A;  4QPQ A;  4U7B A;  3PNT A;  4FX4 A;  3F8C A;  4UVB A;  3OYB A;  2WAD A;  1Z7U A;  1UFM A;  2ZFU A;  1E3P A;  5F0C A;  1YW7 A;  2HPI A;  1IV6 A;  2KPM A;  2VQH A;  5FFZ A;  3B73 A;  3W2A A;  5D4S A;  4PFP A;  3BJO A;  2K9S A;  2R5Y B;  3I59 A;  3HTU A;  4LGW A;  3TKY A;  5D5W B;  2I10 A;  1Y0N A;  1OR7 C;  2CQ7 A;  3QP5 A;  2PLY A;  5EZG A;  4LOC A;  2HI3 A;  2NNN A;  4NUB A;  1JGS A;  2R7F A;  1F4K A;  2VBW A;  3ABK H;  4XL9 A;  1ETW A;  2FBI A;  5J6X A;  2GIZ A;  3WHC A;  4ENJ A;  5BQT A;  3PIO F;  4IEJ A;  4CGZ A;  2HFH A;  1OR7 A;  2VQC A;  3R61 A;  5LRS A;  2Y9Z A;  5JI6 A;  2G7U A;  1XGS A;  2M0C A;  1SC7 A;  1MSF C;  1BI2 A;  2WB1 A;  4E7K A;  3EQL F;  1QZE A;  4Y15 A;  2KIM A;  4BDY A;  2E2J J;  3D5R C;  4HQM A;  1RKW A;  3HPH A;  3CCV I;  1WVR A;  1D5V A;  4C9Y A;  4MIM A;  1M1E B;  2VJ5 A;  2IJL A;  1VF9 A;  3VYT B;  2QSH X;  3CCR I;  2CGP A;  5EYR A;  2E1C A;  3HUG A;  3OS0 A;  4BBS J;  2ZFW A;  3Q0U A;  3OYL A;  3ZQ7 A;  3HRM A;  4ZYE A;  2V4J C;  3S3O A;  2X48 A;  2R7V A;  2BZT A;  2PX9 A;  2X1D A;  1XSD A;  1U8B A;  1D5Y A;  2QSG X;  2DA5 A;  3LOC A;  3N05 A;  3HDD A;  2F48 A;  1W4M A;  1BOB A;  1VQP I;  2VON A;  2HKX A;  4OWR B;  2VBY A;  3PNY A;  4JQF A;  2FX0 A;  4UXN A;  4BQO A;  1W5T A;  2L3D A;  1APL C;  3KIO A;  4A3B J;  5LEJ A;  1FIA A;  1OYY A;  1OJL A;  3IRQ A;  3H3U A;  1AHD P;  4LLN A;  3VEP A;  2R4G A;  5CVI A;  2LLK A;  4MEY F;  3VB2 A;  4L9V A;  3JSP A;  2V6C A;  5CPR B;  5H6R A;  3WTV C;  2RQP A;  1WJE A;  2R0Q C;  3BOQ A;  4KDP A;  3NWT A;  4V2G A;  2LYC A;  1Z3Y A;  4E7I A;  2L2O A;  2LR8 A;  3BDD A;  5LGN A;  3KZY A;  4RBO A;  4C3H J;  3TO9 A;  1BI1 A;  3HGY A;  4JYK A;  2VBZ A;  5KAF C;  3MZH A;  3I54 A;  1WFX A;  1X58 A;  2JQ7 A;  1ZAO A;  1W36 D;  3CF2 A;  3GZ6 A;  1AKH A;  2VOP A;  2V9P A;  2HU9 A;  4II3 A;  5AIQ A;  5LLQ A;  1BBY A;  4LFU A;  2UV1 A;  4ZYH A;  2WAQ A;  5CKT A;  3CCS I;  1O57 A;  3S1N J;  3CCY A;  5HLI A;  2JJ7 A;  4JK1 X;  1BJA A;  2IRF G;  1XMA A;  4F52 A;  4PK4 A;  1K4S A;  2ID6 A;  2H27 A;  1TT0 A;  5CQE A;  1U2W A;  2V1D A;  1WRJ A;  4AVP A;  1ZAR A;  2V1N A;  3KZI C;  2EZK A;  2K02 A;  5F1R A;  1I5Z A;  4YFX F;  3DEE A;  2W4S A;  2DPU A;  1IAW A;  1FOK A;  1TQM A;  4CYC B;  3EYY A;  4XLE A;  3HSF A;  2VAS A;  2R7Z J;  1P7I A;  4IOC F;  5FLV A;  1BR4 A;  3LMM A;  4AVZ A;  3HHH A;  2VOD A;  3BJ6 A;  4DW6 A;  2MH9 A;  1UJ8 A;  5M5W J;  1FSH A;  1BW6 A;  3OR1 C;  2JT1 A;  1PP8 F;  2OAZ A;  1VQM I;  1UMQ A;  3IKV A;  1JT0 A;  2IW5 A;  1MNE A;  2BXY A;  4XRF A;  2MC3 A;  2KIQ A;  2GOM A;  2ZSH B;  1Z6R A;  2HQA A;  3J80 K;  2ZXI A;  5L3G A;  2O03 A;  1B6A A;  4ZZD A;  3EUA A;  3FKI J;  5HVQ C;  4HAM A;  3A02 A;  1MMA A;  2L0K A;  3G3Z A;  4G9Y A;  4XMY A;  2IAI A;  3Q5F A;  3QPL A;  3HRS A;  5HS9 A;  1B8I A;  2HGC A;  2R3S A;  3NRV A;  3PL8 A;  2DT7 B;  3GLX A;  1DUX C;  4I76 A;  3K9T A;  1IO2 A;  3U21 A;  5IYC J;  2CU7 A;  1Y39 A;  2CSO A;  1BM9 A;  1GDT A;  2KP6 A;  5JHU A;  3ZGK A;  4CXF A;  1HLV A;  4NC6 A;  2QQA A;  2Q8K A;  1QPI A;  4S0H B;  1ZRD A;  4HG2 A;  1QHG A;  4FT8 A;  2VBX A;  2Z9O A;  4RB2 C;  1Z3X A;  3M8F A;  1YW9 A;  1JUP A;  1BW5 A;  1UG0 A;  3WG7 H;  5BS6 A;  5M3M J;  1JJ8 C;  5J4V A;  1H8A C;  5F27 A;  2MD0 A;  1X1D A;  1FMW A;  5IP6 A;  2JZY A;  3OMY A;  3CD6 I;  2OC6 A;  4HV5 A;  2XGD A;  3TQN A;  3OYN A;  4RB0 A;  5TGT A;  4B1R A;  4CA0 A;  1YI2 I;  1WZ2 A;  3NAR A;  5KNL A;  1QPM A;  2M45 A;  3RPU A;  4F3Q A;  5FLX Z;  2VT3 A;  2JSC A;  1ZRC A;  4MGR A;  1ORK A;  3KP5 A;  1J0R A;  3H5A A;  1S72 I;  5HLG A;  1RNL A;  4YG2 F;  2IVM A;  3H36 A;  3ZMT A;  1IN4 A;  1X4P A;  2JRM A;  2KIF A;  5ERI A;  2OPT A;  2X6O A;  2G9W A;  1Y8R B;  3TED A;  4LMY A;  4XKV A;  3ZQI A;  1LB2 A;  2ECB A;  5DCM A;  1EJ9 A;  2HVQ A;  3CMA I;  4RA2 A;  5HDG A;  5FLM J;  2YX7 A;  5FLX K;  3R0A A;  4RDU A;  3MZY A;  3OL4 A;  4J01 A;  3K70 D;  4RLQ A;  2NYX A;  4TV7 A;  4CH7 A;  5DM7 F;  1VTN C;  5C4X J;  1G3Y A;  3RPQ A;  3GTQ J;  1D3Y A;  1U5T C;  3PJR A;  5FRM A;  3H1C A;  4A3D J;  4EEF G;  2E19 A;  2ETH A;  1VQN I;  3CCE I;  4BHC A;  2IGK A;  5EEA A;  1WJ5 A;  2CWE A;  1WJC A;  2UXX A;  4A3M J;  1HBX G;  4BAC A;  2KRH A;  4PDK A;  1HQC A;  2HPM A;  3GO5 A;  3CME I;  1TLH B;  1WPK A;  1U5T A;  4BXF A;  1XN7 A;  4XID A;  2CJJ A;  3B02 A;  3OYD A;  1J5Y A;  1Q1V A;  3FHN A;  1S7A A;  3VDX A;  1H89 C;  2O9L A;  1MBG A;  5DUI A;  3RIR A;  2V1U A;  1YE9 A;  4B44 A;  4G12 A;  1IZ1 A;  2DOD A;  5E18 F;  1BN5 A;  4ZTF A;  4HNV A;  2E34 A;  4A6E A;  3WTY C;  2KQR A;  1MDM A;  2FEZ A;  3W2W A;  3E0J B;  4DJA A;  2Q2E A;  2FD5 A;  2XGC A;  4MFE A;  1KYW A;  4PZJ A;  3ZP5 A;  5H2F C;  3T0Y A;  4OIP F;  3F23 A;  2Y31 A;  5IT9 Z;  2KJC A;  1JT6 A;  4XSX F;  2JVH A;  2FNP A;  2RGV A;  4PJ0 C;  4YEL A;  5JVG F;  4NHJ A;  4L0Y B;  2AO9 A;  3Q3S A;  1SFE A;  4PSW A;  1YIJ I;  5JHF A;  1WCM J;  3GFM A;  1YJW I;  3ZMS A;  4IHV A;  3M1C A;  2Y9Y A;  4IPA A;  4F91 B;  5LD2 C;  1S8N A;  3GFL A;  3L2U A;  1IRZ A;  2LNB A;  5GAG J;  1PP7 U;  3ZN1 A;  2F4O B;  4HV6 A;  3HJE A;  4CHU A;  2H94 A;  3GW2 A;  1ZTR A;  2LFB A;  1MMN A;  2MH2 A;  2XKP A;  1ZLJ A;  1A04 A;  1XCV A;  2W7N A;  3FXK A;  2CQX A;  5E3L A;  2W82 A;  2PN6 A;  1UB9 A;  4LK0 F;  3ABM H;  3R0J A;  1RUO A;  2XAG A;  2KIU A;  4E7L A;  4J19 A;  5EG0 B;  2HWV A;  1QVU A;  3H35 A;  4XKB A;  2V9K A;  2BYV E;  3BR2 A;  5A2Q K;  3CZ6 A;  2IS4 A;  2FQ4 A;  4E7J A;  2M4K A;  5D6E A;  2J5P A;  2YSR A;  5E1W A;  1WJB A;  1MMG A;  3CUQ B;  2DDA A;  3RKX A;  3SFZ A;  3ZMU A;  2E35 A;  2O61 A;  5B3S H;  5L3D A;  2FU4 A;  2CUJ A;  3K4N A;  3TP0 A;  2IGO A;  3H0G J;  4M9S A;  2Z1D A;  3JCU C;  4LK1 F;  1JJ6 C;  3H92 A;  2VLA A;  3LQR A;  2L9S A;  5HDK A;  1P4A A;  1S6L A;  3OS1 A;  2QZ8 A;  1PUF A;  2X1E A;  2R92 J;  3CUQ C;  1KU7 A;  3IL2 A;  4A3C J;  1LDK B;  2O8X A;  3HOY J;  4DYC A;  4EM1 A;  4PCQ A;  2DYR H;  2PJR A;  4RGS A;  1ZN2 A;  3T5X A;  3V7S A;  3HSR A;  5EZH A;  3VYR B;  3DKY A;  4XLH A;  2HYJ A;  4YEJ A;  3BT9 A;  2FRH A;  3DXJ F;  4BXU A;  1OKR A;  1UCR A;  2JMW A;  4FHT A;  3KEO A;  3JRC A;  3MWM A;  4EJV A;  4UUS B;  1XD7 A;  2W00 A;  1YIO A;  4HLY A;  2E2I J;  2F5C A;  3CCQ I;  2VUM J;  4OIO F;  1XSX A;  2BY2 A;  2CYY A;  2DYS H;  1IUF A;  3Q0V A;  5DD4 A;  3KYD B;  1BOA A;  3QOP A;  3W3C A;  2V1X A;  3J7A Y;  1UHM A;  2VB6 A;  5E1X A;  1LVA A;  3TOB A;  4LD5 A;  4FQG A;  2E5Z A;  1DDN A;  2Z5U A;  3I56 I;  3LA7 A;  1BI3 A;  4CZC A;  4XNF A;  5M5Y J;  4BQN A;  2XB5 A;  1YS7 A;  3G73 A;  3K0L A;  3R6S A;  1T2K A;  2RDP A;  1B72 A;  1T0F C;  3BPX A;  2VKE A;  4IF4 A;  1IXS B;  2WBM A;  1ZG1 A;  4A3J J;  2E71 A;  3E6D A;  2A5Y B;  1S9H A;  3SHF A;  2EA4 A;  1W1W E;  3FBN B;  2VT2 A;  5ICF A;  4KUM A;  5GAH J;  1U78 A;  1O4X A;  3BP8 A;  4ENN A;  4Y3O A;  3H9Q A;  1B9N A;  5E8I A;  4XLA A;  3TP3 A;  4BEH A;  1TW2 A;  3GME A;  2BBY A;  4PGH A;  2LSO A;  1V5G A;  3W2V A;  1WSU A;  2L02 A;  1T0F A;  1YIT I;  3HYI A;  1W5S A;  3BWG A;  4CSW A;  3VOE A;  3GLL A;  3PSF A;  3EDP A;  3NEU A;  1TQP A;  2EFQ A;  2VXZ A;  4IOA F;  1GLN A;  4M73 A;  1HW5 A;  1O3S A;  4N9I A;  2QEN A;  3E3V A;  3PIP F;  2GWR A;  4FET A;  2XRO A;  4XIC A;  2R7T A;  5E3N A;  2DLL A;  3GZ5 A;  5EGO A;  3FXR A;  3QWL A;  5K7F A;  4W1U A;  4EQQ A;  2PMU A;  2V9V A;  2XAQ A;  1D1A A;  2Z33 A;  3IH4 A;  3OYM A;  2PI0 A;  3JRB A;  2FF4 A;  2HDW A;  3MKY B;  2EB7 A;  4XLP F;  4RMN A;  3SEQ A;  4IXA A;  1RES A;  2OTL I;  1K83 J;  1Y1W J;  2UUZ A;  1CF7 A;  2K3F A;  2MA3 A;  3EUK L;  1D0X A;  4I7H A;  1LKX A;  1FOX A;  1E2X A;  1I27 A;  2ZKZ A;  3HRU A;  3T8R A;  5GTI C;  2LKS A;  5IP9 J;  4XKC A;  5E17 F;  2E7X A;  3ZQH A;  3P5J A;  1PJR A;  4Y13 A;  4A69 C;  4B8X A;  1FT9 A;  1SMT A;  3RQ4 A;  1R49 A;  4JOM A;  5LHI A;  4LG0 B;  3X2Q H;  3REO A;  3E5U A;  2WC2 A;  4L18 B;  3LL7 A;  4FE4 A;  3BJA A;  2PBI A;  1VQL I;  5E3M A;  2CQN A;  3QPH A;  1OMI A;  2FSW A;  4WXD A;  3L2V A;  3ELK A;  4AIJ A;  3QPS A;  1AU7 A;  2WY7 Q;  1YRN A;  2XAF A;  3HC7 A;  3K2A A;  1N77 A;  2ISY A;  2CH0 A;  3FMS A;  1SFK A;  1ULY A;  3CES A;  3CP2 A;  4AIK A;  4IQJ A;  2DDB A;  2L9R A;  3HOU J;  3VYU B;  3IH2 A;  4WCG A;  5F0H A;  5M3F J;  3DV8 A;  3F3X A;  4PJL A;  2NVT J;  2VPL A;  1MW7 A;  3K4C A;  4BYY A;  2DOA A;  2V6E A;  2VQG A;  5KHD A;  1LDD A;  3FXJ A;  2JSP A;  1JI8 A;  2CUF A;  4KA4 A;  3KEY A;  2OZ6 A;  3E6M A;  1BC7 C;  3WU1 B;  4B4C A;  2VPR A;  4E6K G;  2I5U A;  3H9J A;  3W6K B;  3N97 A;  1XGO A;  1T08 B;  2XF5 A;  3IP4 B;  5FKK A;  4X0G A;  4BAY A;  2IPQ X;  4S04 A;  2CUE A;  4M9X A;  4B48 A;  1BI0 A;  4Y17 A;  2E5N A;  2WV1 A;  2DFI A;  3PSI A;  1YFH A;  1IF1 A;  2RNG A;  3H5N A;  1FPQ A;  2K7L A;  4RB3 C;  5HOD A;  3OY9 A;  2E1O A;  1DGR M;  3ERE D;  1SD5 A;  2DTR A;  2X51 A;  5J4Y A;  4BGD A;  1GT0 C;  2E1M B;  1PYV A;  3DBL B;  3R60 A;  2NRA C;  5ICE A;  1TT5 B;  3U1K A;  4DIQ A;  1YS6 A;  2EFO A;  3OYK A;  2K3P A;  2L4M A;  3GF2 A;  5EEG A;  1SAU A;  2DK5 A;  2CQQ A;  1FYK A;  2RNJ A;  4XSZ F;  3S2D J;  1FP2 A;  3LSM A;  3HOX J;  2CMP A;  1HDP A;  3VSL A;  4P1W A;  1K61 A;  1SFX A;  2MLK A;  3C3W A;  5GPA A;  4MFD A;  4ZYD A;  2M7B A;  4ESF A;  4BQA A;  4LIV A;  5AON A;  4NB5 A;  3L00 A;  5GTH C;  2GA1 A;  1ACI A;  3HPG A;  3K10 A;  2EIK H;  3F8B A;  2FBH A;  3RJP A;  2QWW A;  3NQO A;  2STT A;  4U7D A;  4HX8 A;  4RGR A;  2DA7 A;  2DA6 A;  1B4A A;  1WJA A;  4RAF A;  2NXN B;  2Z16 A;  1O3T A;  4HF1 A;  1ETK A;  3LSR A;  3CCJ I;  1FBQ A;  1OQY A;  3JRI A;  2DT6 A;  4ETS A;  1KZH A;  2FOW A;  3MVP A;  4GDF A;  4DBR A;  3CUO A;  1FX7 A;  4RB1 A;  1J59 A;  4KNY A;  3L1P A;  1I3Q J;  3A03 A;  2UXN A;  4YII A;  2XPW A;  3ZXS A;  3L2W A;  2CFO A;  3FHZ A;  3K4J A;  1MD0 A;  5IPA A;  2JK3 A;  1Z21 A;  3RSN A;  2IGM A;  3DPL C;  1W7P B;  1QGP A;  4KN7 X;  2F4I A;  4M71 A;  4E4H A;  2RQQ A;  1A36 A;  3PFY A;  3FXQ A;  3CMM A;  4M3F A;  1G59 A;  1WI9 A;  2BVM A;  2XB0 X;  1Z9C A;  3BRO A;  4HZF A;  4XK4 A;  3ASN H;  4C2T A;  2LF7 A;  1SD4 A;  1FMV A;  3SEZ A;  1MIJ A;  1XCB A;  3LSK A;  3KP4 A;  3HZJ A;  3KZZ A;  2H6B A;  4DGW B;  2W57 A;  2Y0S N;  4L0Z B;  3DTK A;  3PQK A;  4A3K J;  4HPQ A;  3G1L A;  2DMQ A;  5GPC A;  4LB5 A;  4IVN A;  5CYV A;  1FTZ A;  1A6Q A;  1Z1D A;  4ZDP A;  4I2O A;  3U1D A;  3S3N A;  4AM3 A;  4CCO A;  3CDI A;  4EAT A;  1RET A;  1I6X A;  2QCO A;  3HTS B;  2OD5 A;  1JKR C;  1TWC J;  4LJZ F;  3O3K A; 
#chains in the Genus database with same CATH homology
 4EV0 A;  4BHP A;  2ELH A;  2YPR A;  3F22 A;  2QM3 A;  1G3W A;  5LEK A;  4G6D A;  5HDN A;  3CO7 C;  3BY6 A;  1ZGJ A;  1TQI A;  3RKY A;  4I09 A;  3BZ6 A;  2ZXJ A;  4HLX A;  3P9K A;  2ACJ A;  4MQ9 F;  4WX9 A;  3LAP A;  1QZY A;  4EMS A;  1Q1H A;  5DEQ A;  5KVR A;  1R23 A;  4Q4Z F;  2DQR A;  3C1D A;  4EGZ A;  3JAM Z;  3F8N A;  3FMR A;  4UHT A;  2P5V A;  3GWZ A;  5CVV A;  4HDV A;  3IC7 A;  4MTD A;  1EH7 A;  3R4K A;  2ISZ A;  1AWC A;  2XVC A;  1O7F A;  3HRT A;  1IW7 F;  3JAM K;  2ZBK A;  3RKW A;  1FY7 A;  4HQE A;  3P9I A;  1R00 A;  3PQJ A;  2PQ8 A;  3OV8 A;  2F5D A;  4E70 A;  1IN6 A;  1TW3 A;  2LF8 A;  2HTJ A;  2AS5 F;  1HXD A;  1WQ2 A;  3U9G A;  3KCC A;  5D8K B;  1XSV A;  2HQN A;  4P9U A;  1AOY A;  2FXA A;  3HIF A;  4G8X A;  2QQB A;  4B09 A;  3CLO A;  4EM0 B;  2HKO A;  3SZT A;  5LHH A;  1GVJ A;  2P4W A;  2L01 A;  3KP6 A;  4G7H F;  2P5L C;  3L2C A;  2W85 A;  2ZNZ A;  3F8F A;  3GX4 X;  1K7A A;  2IT0 A;  3F72 A;  2JRT A;  5KK1 A;  4OU0 A;  3E6C C;  1S7O A;  2BGC A;  4N0B A;  2QBY B;  3FWE A;  2DBB A;  3EET A;  3GXO A;  3QP6 A;  4RAZ A;  5ILU A;  1XDU A;  1ZG5 A;  4G94 A;  3EUH A;  3CDH A;  2FMY A;  5BPI A;  1R5H A;  3LWF A;  1GHC A;  2ZME B;  2K27 A;  2XAJ A;  5BOX A;  4HW0 A;  1D8K A;  3RTR A;  2XUB A;  2CO5 A;  1R58 A;  5L3B A;  1BC8 C;  1QZZ A;  4D0P A;  1O3Q A;  3GUD A;  4HA8 A;  2P8T A;  3VFZ A;  3S2W A;  2UWM A;  3WU0 A;  3AAF A;  1V4R A;  2M87 A;  2FBK A;  2GXB A;  4A0X A;  1RZ4 A;  1DPU A;  4L9J A;  4LLG F;  4AIH A;  5D4R A;  4IRH A;  1MKM A;  2A6H F;  2YR2 A;  2IA0 A;  3FZV A;  3BPV A;  2DI3 A;  1SAX A;  1X3U A;  2P7V B;  3WTX C;  4OMZ A;  2K4B A;  3PFI A;  4EJU A;  1FNN A;  1J2X A;  1CGP A;  2D2W A;  4FX0 A;  3D0S A;  1R5G A;  3T8T A;  1G3T A;  1IUY A;  4OIQ F;  4K2E A;  4HX4 A;  4U0Y A;  3JTG A;  3WTT C;  1T98 A;  1FBS A;  5TRD A;  2PEX A;  3SXY A;  4G6Q A;  4Z2Y A;  1DPR A;  4WWC A;  3E97 A;  2EK5 A;  4QWQ A;  1MJ9 A;  4EJT A;  2HR3 A;  3M8E A;  4Q48 A;  3M9A A;  2JPC A;  2RN7 A;  1P6R A;  2RVC A;  3VOD A;  1RIO H;  1B59 A;  5BPD A;  5IT9 K;  3F21 A;  2XRN A;  1QO0 D;  4GYI A;  2VE8 A;  4CYD A;  2H09 A;  3WTS C;  4HDU A;  2F5F A;  5K5Q A;  3WGI A;  1PDN C;  5DDG A;  5H20 A;  2EV5 A;  1H9T A;  3LA2 A;  2COM A;  2EA2 A;  3LQQ A;  2EFP A;  5L3F A;  2WWY A;  1USS A;  5F64 A;  1Z6T A;  2IA2 A;  2V79 A;  3I4P A;  2AXL A;  5D5V B;  1FP1 D;  3TDU C;  3F6V A;  2G7H A;  2M5W A;  3WE3 A;  1J9I A;  4LLL A;  5HOO A;  5JVT A;  3CUQ A;  1HKT A;  4WXC A;  1LNW A;  3LAJ A;  1P4X A;  2DAO A;  1R1V A;  3I0T A;  3QAH A;  1GXP A;  5JFR A;  1T6S A;  4A0Z A;  1BIB A;  4ENM A;  3DP7 A;  1TTY A;  2XGX A;  4KN4 X;  5D5U B;  4O6J A;  1LDJ A;  4YFK F;  3J81 Z;  4XLN F;  4IRG A;  4M72 A;  3ML6 A;  4OIN F;  3KP2 A;  2E7W A;  4KIG A;  1L3L A;  4IHT A;  2DT5 A;  5E8G A;  1E17 A;  1TNT A;  1KU3 A;  3DFG A;  4KFC A;  1EV7 A;  3KFW X;  4KIB A;  3TDZ C;  3MCZ A;  2D1V A;  3F8M A;  5DV5 A;  1S29 A;  3QU3 A;  3F6O A;  3QRF F;  2PG4 A;  2QQ9 A;  3HSE A;  2E1N A;  2L4A A;  2JTV A;  5ILV A;  2F2E A;  1H9G A;  3GFI A;  2BV6 A;  2QLZ A;  1ON1 A;  2Y48 A;  4AD9 A;  2A68 F;  4L9N A;  2FQ3 A;  4U0V A;  1T39 A;  1ZRF A;  4GYG A;  4CO8 A;  1EH8 A;  1YW8 A;  5IT3 A;  1Z91 A;  3MEX A;  2K86 A;  3IKT A;  1YTY A;  2ZO4 A;  5CVU A;  4M6X A;  1YO5 C;  2HDC A;  3E5X A;  3WTW C;  4YFN F;  4LG0 A;  2M1B A;  2CW0 F;  4ESJ A;  1G3S A;  2XIG A;  1UHW A;  2ESN A;  3RI4 A;  1HKS A;  2O6G E;  2NNY A;  2A6E F;  3ZMZ A;  1TNS A;  5DUK A;  1RUN A;  2EJR A;  4WK8 F;  1I1G A;  4A0Y A;  4QLC U;  4AWX B;  1MGT A;  4IHS A;  3V8K A;  2FE3 A;  1K79 A;  2VC1 A;  3V8J A;  2X4H A;  2EFN A;  5K5R A;  1HKQ A;  3WOD F;  4KIF A;  2QYO A;  3DEU A;  3P9C A;  5E1Z B;  5H6Q A;  5F6F A;  4L9T A;  2P7C B;  2CFX A;  2M8E A;  1DP7 P;  1QQI A;  3JTH A;  2M30 A;  4CZZ A;  4JBA A;  4ZZL A;  4HX7 A;  2OQR A;  3JSO A;  4P9F A;  2PFB A;  4MTE A;  4P96 A;  1C0W A;  5HS7 A;  4ZH4 F;  2LDU A;  5LGU A;  2EV0 A;  5D5X B;  4M74 A;  1LJ9 A;  2OBP A;  1WWX A;  2P6T A;  2HYG D;  2X0L A;  4CIC A;  3V7R A;  1W7P A;  4DNC A;  4P55 A;  2NAZ A;  2L54 A;  2UZK A;  2KRF A;  5CVJ A;  1B1B A;  3CJN A;  1SMY F;  2O0Y A;  1FWZ A;  2GXG A;  1SD7 A;  3U2R A;  1FYM A;  2K4J A;  3SZP A;  1WKM A;  4EJO A;  2IP2 A;  4HYE A;  3O2P E;  2VOO A;  4I98 B;  3M7G A;  3IRR A;  2RKH A;  4RAY A;  2GIV A;  3MQ0 A;  1FC3 A;  3K2Z A;  1UST A;  2MLG A;  5J8F A;  2OA4 A;  1U8R A;  2VC0 A;  1STZ A;  1TBX A;  1P92 A;  3I5U A;  4YIF A;  5DYM A;  3MAJ A;  2H6C A;  3K69 A;  4S05 A;  2FOK A;  2RC4 A;  2STW A;  4GGG A;  3FX3 A;  3FF5 A;  1ZH5 A;  2Y75 A;  2A61 A;  3WE2 A;  3IWZ A;  3WGG A;  3KP7 A;  4G7Z F;  2PMH A;  2MD5 A;  5E20 A;  3T1B A;  4ON0 A;  3TO6 A;  4WXH A;  4WF2 A;  2A69 F;  1QBJ A;  1JHF A;  3COA C;  1R1U A;  5HLH A;  4BHB A;  2B0L A;  5FD5 A;  3GYH X;  5DD8 A;  6PAX A;  2F5E A;  1NHA A;  3W6J B;  3J80 Z;  3V7C A;  3V8L A;  2VN2 A;  4RGX A;  2GZW A;  1L0O C;  2W25 A;  3H3Z A;  1S3J A;  2DW4 A;  3ZMV A;  1J75 A;  4RS8 A;  3HOS A;  1EH6 A;  1IN5 A;  1SFU A;  4EGY A;  3K1M A;  3V4G A;  3O6B B;  3E6B A;  3L7W A;  5FD6 A;  3LST A;  2P5K A;  3DQV C;  2OQG A;  4OIR F;  4O5V A;  4HF2 A;  1PUE E;  2DU9 A;  5LHG A;  1IXC A;  2YX4 A;  5ILS A;  4MQV A;  3P7N A;  5LBQ A;  3EYI A;  4EJW A;  4Q5S F;  1XGN A;  2FA5 A;  1R1T A;  3IHU A;  1K6O A;  4U0W A;  3WGH A;  1YQA A;  1FBU A;  2QBY A;  2VE9 A;  3I64 A;  5DCM B;  2D45 A;  4R8H A;  2RV8 A;  2EV6 A;  2J5O A;  1P4W A;  5L3E A;  1FZP B;  1HSJ A;  1ZRE A;  4KIC A;  4KMF A;  4A2U A;  2ZME A;  2ADU A;  3IWF A;  1I1S A;  2WV0 A;  3ECO A;  2Z99 A;  1IRF A;  1K78 B;  5LGT A;  2Y0M A;  3J7A O;  4R79 A;  4DQ2 A;  1U5T B;  4I01 A;  1ZG3 A;  4U88 A;  2CG4 A;  2OZU A;  5BMZ A;  5FGM A;  1HW2 A;  2HZT A;  3FMQ A;  1R22 A;  2C6Y A;  2HOE A;  2TDX A;  3DF8 A;  3QPT A;  3C7J A;  1MDM B;  2ESH A;  1U6G A;  1KQ9 A;  2ZNY A;  1YG2 A;  5AIP A;  2HS5 A;  4UVA A;  5D6F A;  1K78 A;  1IN7 A;  1ZGA A;  1U3E M;  3DPT A;  5JR3 A;  5EEH A;  4OOI A;  2GA2 A;  3I53 A;  3GVA A;  4RGU A;  4ENK A;  2EFW A;  2HEO A;  3ULQ B;  4GXO A;  1FYL A;  3I71 A;  1GXQ A;  2WTE A;  3HHG A;  1JHH A;  3KLN A;  2DPD A;  3FM5 A;  4PGG A;  4N9H A;  4KYW A;  4IRI A;  5D8L B;  1ODD A;  3GEZ A;  3RDI A;  4L5I A;  1H0M A;  1YYV A;  1MJA A;  4MEX F;  3K1N A;  4A5M A;  3FXU A;  4KT5 C;  4R1H A;  4ASN A;  5A2Q Z;  2DO7 A;  2KJB A;  1T38 A;  1ZHF A;  2ZJ2 A;  3ABT A;  4I02 A;  3E5Q A;  3ZPL A;  3HOT A;  4HOB A;  5CLS A;  1YLF A;  3KEQ A;  3Q9S A;  2EWN A;  4UVC A;  2LKP A;  3ISP A;  3ABU A;  1IRG A;  1LQ1 A;  4OMY A;  3LFK A;  2HTS A;  2R7D A;  3ECH A;  4Q47 A;  3KE2 A;  3JW4 A;  4I0B A;  3QU6 A;  1KYZ A;  5LRR A;  1BIA A;  1XGM A;  4UUV A;  3KET A;  3C18 A;  1QNT A;  4GCV A;  5J8C A;  3SQN A;  4A5N A;  5DCF A;  3TOA A;  4EVI A;  1XB4 A;  2BE5 F;  1ZLK A;  1FSE A;  1KGS A;  3N4M A;  1OYW A;  3ZMD A;  4A12 A;  2XKO A;  1B9M A;  1P2F A;  3RYR A;  3KP3 A;  3ZN0 A;  3M1E A;  2HQR A;  4XBF A;  5ICC A;  4BNC A;  1KU2 A;  2KKO A;  1Z05 A;  1FLI A;  3WTU C;  1RI7 A;  4BH9 A;  1KU9 A;  3RYP A;  4M9Z A;  3J81 K;  2GQQ A;  2HYF A;  2ZCW A;  1XMK A;  1MJB A;  1MZB A;  1V3F A;  1ZYR F;  1CF7 B;  5K1Y A;  5TJJ A;  3ROU A;  1REP C;  2PJP A;  4KMU X;  5FFX A;  2QVO A;  1R7J A;  3Q9V A;  2W24 A;  4G7O F;  3L09 A;  2D1H A;  4O3M A;  1HST A;  5CVR A;  1F1Z A;  1ONV A;  3CO6 C;  2P6S A;  1LEB A;  1ON2 A;  2Z3Y A;  4EM2 A;  4L5J A;  2O3F A;  3DKW A;  5K5O A;  1KQ8 A;  5L3C A;  2XV4 S;  3FM3 A;  3KLO A;  5ED4 A;  2IA1 A;  4CDG A;  4HF0 A;  1J7K A;  2XAS A;  4GO1 A;  2XHK A;  1HW1 A;  1O7L A;  3TO7 A;  1F5T A;  5HS8 A;  3CTA A;  1OYI A;  1JE8 A;  1KQ0 A;  4IJA A;  4MHG A;  1G4D A;  4F7Z A;  2DQL A;  3WG9 A;  3K1P A;  4P5O A;  2YU3 A;  1IXR C;  2FNA A;  1R36 A;  1F9N A;  1KA8 A;  5FB2 A;  1LEA A;  2MBF A;  2QUF A;  4MNU A;  4NQW A;  3L9F A;  1SD6 A;  4UV8 A;  2CQK A;  4A6D A;  4ESB A;  3TGN A;  3D5L A;  2A07 F;  3WTZ A;  1OPC A;  1G6N A;  1W7P D;  4ZYG A;  5FO5 A;  4I0A A;  4UNO A;  4H0E A;  3I59 B;  3MFK A;  2OU2 A;  5ICG A;  1JXS A;  2JPB A;  2W84 A;  2FML A;  1O3R A;  4UV9 A;  1Y0U A;  2XAH A;  1IN8 A;  2BEO A;  3I58 A;  5CJ9 A;  3OOP A;  2Q0O A;  3GFJ A;  2GAU A;  1XDS A;  2A3S A;  2NS0 A;  3LA3 A;  4HBL A;  1D8J A;  4M6Y A;  4LB6 B;  4FX4 A;  2DK8 A;  4U7B A;  3F8C A;  4UVB A;  1Z7U A;  1UFM A;  1YW7 A;  5FFZ A;  3B73 A;  5D4S A;  3BJO A;  3I59 A;  3HTU A;  4LGW A;  3TKY A;  5D5W B;  3QP5 A;  2PLY A;  2NNN A;  1JGS A;  2R7F A;  1F4K A;  2VBW A;  2FBI A;  5J6X A;  4ENJ A;  5BQT A;  4CGZ A;  2HFH A;  1OR7 A;  3R61 A;  5LRS A;  5JI6 A;  2G7U A;  1XGS A;  1BI2 A;  3EQL F;  4Y15 A;  2KIM A;  4HQM A;  1D5V A;  2IJL A;  2CGP A;  2E1C A;  3HUG A;  2ZFW A;  3ZQ7 A;  3HRM A;  4ZYE A;  1XSD A;  1W4M A;  2VON A;  2HKX A;  2VBY A;  4JQF A;  4UXN A;  1W5T A;  2L3D A;  5LEJ A;  1OYY A;  3IRQ A;  3H3U A;  4LLN A;  3VEP A;  5CVI A;  4MEY F;  3VB2 A;  4L9V A;  3JSP A;  2V6C A;  5H6R A;  3WTV C;  2RQP A;  3BOQ A;  4KDP A;  3BDD A;  5LGN A;  3KZY A;  3TO9 A;  1BI1 A;  2VBZ A;  3MZH A;  3I54 A;  1ZAO A;  2VOP A;  3GZ6 A;  5LLQ A;  5AIQ A;  1BBY A;  4LFU A;  4ZYH A;  1O57 A;  5HLI A;  4JK1 X;  1BJA A;  2IRF G;  1XMA A;  2H27 A;  1U2W A;  2V1D A;  1WRJ A;  4AVP A;  1ZAR A;  5F1R A;  2K02 A;  1I5Z A;  4YFX F;  2DPU A;  1IAW A;  1FOK A;  1TQM A;  3EYY A;  3HSF A;  3HHH A;  2VOD A;  3BJ6 A;  2MH9 A;  1FSH A;  2JT1 A;  1PP8 F;  2OAZ A;  3IKV A;  2IW5 A;  4XRF A;  2MC3 A;  1Z6R A;  3J80 K;  5L3G A;  2O03 A;  1B6A A;  4ZZD A;  5HVQ C;  4HAM A;  4G9Y A;  3G3Z A;  3Q5F A;  3HRS A;  5HS9 A;  2HGC A;  2R3S A;  3NRV A;  3GLX A;  1DUX C;  3K9T A;  2CSO A;  1BM9 A;  5JHU A;  4CXF A;  2QQA A;  2Q8K A;  1ZRD A;  4FT8 A;  2VBX A;  2Z9O A;  4RB2 C;  3M8F A;  1YW9 A;  5BS6 A;  2JZY A;  4HV5 A;  3TQN A;  4RB0 A;  1QPM A;  2M45 A;  3RPU A;  5FLX Z;  2VT3 A;  2JSC A;  1ZRC A;  4MGR A;  3KP5 A;  1J0R A;  5HLG A;  1RNL A;  4YG2 F;  2IVM A;  3ZMT A;  1IN4 A;  2KIF A;  5ERI A;  2G9W A;  4LMY A;  1LB2 A;  5DCM A;  5HDG A;  2YX7 A;  5FLX K;  3R0A A;  3MZY A;  2NYX A;  4TV7 A;  1VTN C;  1G3Y A;  3RPQ A;  1D3Y A;  1U5T C;  2ETH A;  4BHC A;  2CWE A;  2UXX A;  1HBX G;  4PDK A;  1HQC A;  3GO5 A;  1TLH B;  1U5T A;  1XN7 A;  3B02 A;  1J5Y A;  1S7A A;  5DUI A;  3RIR A;  2V1U A;  1IZ1 A;  5E18 F;  1BN5 A;  3WTY C;  4A6E A;  1MDM A;  2FEZ A;  2Q2E A;  4PZJ A;  1KYW A;  3ZP5 A;  3T0Y A;  4OIP F;  3F23 A;  5IT9 Z;  2KJC A;  4XSX F;  2FNP A;  2RGV A;  4NHJ A;  4L0Y B;  1SFE A;  3GFM A;  3ZMS A;  4IPA A;  1S8N A;  3GFL A;  2LNB A;  1PP7 U;  3ZN1 A;  4HV6 A;  4CHU A;  2H94 A;  3GW2 A;  2MH2 A;  2XKP A;  1ZLJ A;  1A04 A;  1XCV A;  2PN6 A;  1UB9 A;  4LK0 F;  3R0J A;  1RUO A;  2XAG A;  2KIU A;  2HWV A;  2BYV E;  5A2Q K;  5D6E A;  2J5P A;  2YSR A;  5E1W A;  3CUQ B;  3RKX A;  3SFZ A;  3ZMU A;  2O61 A;  5L3D A;  2FU4 A;  4M9S A;  4LK1 F;  3H92 A;  3LQR A;  5HDK A;  1P4A A;  1S6L A;  2QZ8 A;  3CUQ C;  1KU7 A;  3IL2 A;  1LDK B;  2O8X A;  4EM1 A;  4PCQ A;  4RGS A;  1ZN2 A;  3T5X A;  3V7S A;  3HSR A;  2FRH A;  3DXJ F;  4BXU A;  1OKR A;  1UCR A;  4FHT A;  3KEO A;  3MWM A;  4EJV A;  1XD7 A;  1YIO A;  4HLY A;  2F5C A;  4OIO F;  1XSX A;  2CYY A;  5DD4 A;  1BOA A;  3QOP A;  2V1X A;  1UHM A;  5E1X A;  1LVA A;  3TOB A;  4LD5 A;  1DDN A;  2Z5U A;  3LA7 A;  1BI3 A;  1YS7 A;  3G73 A;  3K0L A;  3R6S A;  1T2K A;  2RDP A;  3BPX A;  4IF4 A;  1IXS B;  1ZG1 A;  3E6D A;  2A5Y B;  3SHF A;  2EA4 A;  2VT2 A;  5ICF A;  4KUM A;  1U78 A;  3BP8 A;  4ENN A;  1B9N A;  5E8I A;  1TW2 A;  2BBY A;  4PGH A;  2LSO A;  1WSU A;  2L02 A;  1T0F A;  3HYI A;  1W5S A;  3BWG A;  3VOE A;  3EDP A;  3NEU A;  1TQP A;  2EFQ A;  2VXZ A;  4M73 A;  1HW5 A;  1O3S A;  4N9I A;  2QEN A;  3E3V A;  2GWR A;  2XRO A;  2DLL A;  3GZ5 A;  3FXR A;  4EQQ A;  2PMU A;  2V9V A;  2XAQ A;  2Z33 A;  2PI0 A;  2FF4 A;  2EB7 A;  4XLP F;  4IXA A;  1CF7 A;  2MA3 A;  4I7H A;  1E2X A;  1I27 A;  2ZKZ A;  3HRU A;  3T8R A;  5E17 F;  2E7X A;  4Y13 A;  4B8X A;  1FT9 A;  1SMT A;  5LHI A;  4LG0 B;  3REO A;  3E5U A;  2WC2 A;  4L18 B;  3BJA A;  2PBI A;  3QPH A;  1OMI A;  2FSW A;  4WXD A;  3ELK A;  4AIJ A;  2XAF A;  2ISY A;  3FMS A;  1ULY A;  4AIK A;  4WCG A;  3DV8 A;  3F3X A;  4BYY A;  1LDD A;  4KA4 A;  2OZ6 A;  3E6M A;  1BC7 C;  3WU1 B;  3W6K B;  3N97 A;  1XGO A;  4BAY A;  2IPQ X;  4S04 A;  4M9X A;  1BI0 A;  4Y17 A;  2DFI A;  1YFH A;  1IF1 A;  1FPQ A;  2K7L A;  4RB3 C;  3ERE D;  1SD5 A;  2DTR A;  3R60 A;  2NRA C;  5ICE A;  1YS6 A;  2EFO A;  5EEG A;  2L4M A;  3GF2 A;  2DK5 A;  1FYK A;  2RNJ A;  4XSZ F;  1FP2 A;  1SFX A;  2MLK A;  3C3W A;  4ZYD A;  4ESF A;  4BQA A;  5AON A;  4NB5 A;  3L00 A;  2GA1 A;  3F8B A;  2FBH A;  3RJP A;  2QWW A;  3NQO A;  2STT A;  4U7D A;  4HX8 A;  4RGR A;  1B4A A;  1O3T A;  4HF1 A;  1FBQ A;  4ETS A;  3CUO A;  1FX7 A;  4RB1 A;  1J59 A;  4KNY A;  2UXN A;  4YII A;  3FHZ A;  1MD0 A;  3DPL C;  1W7P B;  1QGP A;  4KN7 X;  4M71 A;  3FXQ A;  1WI9 A;  1Z9C A;  3BRO A;  4HZF A;  2LF7 A;  1SD4 A;  1XCB A;  3KP4 A;  3KZZ A;  2H6B A;  2W57 A;  4L0Z B;  3PQK A;  4LB5 A;  4IVN A;  5CYV A;  1Z1D A;  4I2O A;  3U1D A;  3HTS B;  1I6X A;  2OD5 A;  4LJZ F;  3O3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...