2AS5F

Structure of the dna binding domains of nfat and foxp2 bound specifically to dna.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(TP*TP*AP*GP*GP*AP*AP*AP*AP*TP*TP*TP*GP*TP*TP*TP*CP*AP*T
publication title FOXP3 Controls Regulatory T Cell Function through Cooperation with NFAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 24
structure length 83
sequence length 83
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2as5F00
1H9GA 2EA4A 5LHGA 2HQNA 1GXPA 3HSEA 3GWZA 1AWCA 1IF1A 1K78B 2O03A 2RQPA 2DO7A 4HLYA 3I4PA 1FBSA 2L54A 1MJBA 2OQRA 2GA1A 4KIGA 3ZPLA 2CFXA 4GGGA 2VBYA 4UV8A 2G9WA 5FB2A 1QBJA 1R00A 3QPHA 4YFNF 1P2FA 5D8LB 4XLNF 1ZGJA 1HKTA 2VE8A 1IZ1A 1T0FA 5D5WB 1WQ2A 1MJ9A 4R79A 2HWVA 3V4GA 3I59A 4UVCA 1IW7F 2CO5A 4CICA 4G6QA 3MQ0A 1R22A 2PI0A 1S7OA 1LB2A 2FBKA 4WXHA 1GHCA 1XGOA 5HLGA 5CYVA 2PBIA 3RTRA 3KEQA 4OMYA 3F21A 2D1VA 1FP1D 3KEOA 2DPDA 4M9SA 5F6FA 4FX0A 4XLPF 3GFMA 1HQCA 3QOPA 2IP2A 5LGTA 2HKXA 1SFEA 2WWYA 3L9FA 4HLXA 2VN2A 2R3SA 2Z99A 2FBHA 3E6MA 5E1WA 3QU3A 1TNSA 1FYKA 4M6YA 4A0YA 2OZUA 1R5HA 1ZGAA 3GFJA 1HSJA 1V4RA 2EFOA 2NYXA 2PFBA 1C0WA 4EJVA 1ONVA 5HLHA 1XCBA 5DCMB 3KE2A 1UFMA 3HHGA 3BOQA 1UHWA 4IXAA 2V9VA 4YIIA 1HW5A 4LGWA 3R0JA 1WWXA 3R60A 1FNNA 1XD7A 1RIOH 1BI2A 1TQPA 3TDZC 3FHZA 3L2CA 1FZPB 3TKYA 3W6KB 1O3TA 3HTSB 1TW2A 2DQLA 4S05A 4CGZA 2CYYA 4FHTA 5DYMA 1R1VA 1XMKA 2ZKZA 2RDPA 1T98A 4L9VA 2Y75A 3H3UA 1SD5A 4QWQA 4HF1A 1BIAA 4UHTA 3OOPA 1EH8A 4BYYA 2OZ6A 3J80Z 4I0BA 1CF7B 2FSWA 1SFXA 2PG4A 3AAFA 4I09A 3ROUA 1FYLA 4IHSA 4LG0B 2DTRA 3K9TA 2P5LC 2MA3A 4LK0F 3M8FA 1LEAA 1IN4A 5ED4A 3GUDA 2JRTA 1J75A 5D4RA 2ADUA 4P96A 4RB2C 3SHFA 3TOBA 4OIRF 1USTA 1JE8A 1ZRFA 4U88A 1K79A 1CGPA 1O3QA 3SXYA 1D3YA 2VBWA 4PGGA 5HDKA 2EV6A 2XUBA 2A5YB 3ELKA 5F1RA 3KP5A 2K86A 1PP8F 1DUXC 4LK1F 2RN7A 4AIHA 2D1HA 4CZZA 1AOYA 2YX7A 2HQRA 2J5PA 4G7HF 1RNLA 1SAXA 3DV8A 4BH9A 1FPQA 3FXRA 5DD4A 2EFQA 2XRNA 2ZNZA 5LHHA 4EV0A 4XSZF 2UXXA 3SQNA 5BPDA 3B02A 4N9IA 2VBZA 2FNPA 3DP7A 4K2EA 3IWFA 2Q8KA 5HVQC 2K27A 3CUQA 5ERIA 3RI4A 4XBFA 4EJWA 5D5XB 2L3DA 5K5RA 4KA4A 1O3SA 2X0LA 3RPUA 3JTGA 2QQ9A 2RV8A 2DAOA 4Y15A 2LF7A 5CVIA 1D8JA 1U8RA 3KCCA 4EJUA 2L4MA 4IJAA 2M30A 1H0MA 1SD7A 5CVVA 3RDIA 1BI0A 2VT2A 4HF2A 2IA2A 2JPCA 4KMUX 3LQRA 3WTWC 4KN4X 3CO7C 3MZYA 1HW1A 1K7AA 3P9KA 3ML6A 2A6HF 3PQKA 1T6SA 4KUMA 3GW2A 5TRDA 1DDNA 4NQWA 5D5UB 4E70A 2A61A 1XSXA 1YFHA 4ESJA 3WTZA 2ISYA 2RKHA 2XAFA 5IT3A 3TOAA 4LFUA 2FBIA 1UHMA 1RUOA 2YU3A 5HS9A 4HW0A 1F1ZA 2O6GE 3MZHA 2P7VB 2IA1A 3KLOA 1ODDA 1W7PB 2FA5A 3GLXA 3C18A 3FX3A 4ESBA 3N97A 2BYVE 3F8FA 3KP3A 3T0YA 4ZYGA 1B9NA 1RUNA 3ECOA 2ETHA 2P5VA 2C6YA 2JZYA 3V8LA 2O8XA 3T1BA 4ASNA 1I6XA 5JI6A 5CVUA 1PP7U 2LNBA 4KYWA 3WTSC 1VTNC 3DF8A 3I58A 4HV5A 1Z05A 5FFZA 2R7DA 3EUHA 2W24A 4EGYA 1KA8A 3WTUC 3D5LA 5BQTA 2LF8A 1YW9A 2A69F 2ESHA 2KIFA 2ZCWA 1IXSB 3KP6A 2QM3A 2ZNYA 4LB6B 4CHUA 1LDDA 3ZMTA 1D8KA 4EQQA 1BN5A 1Z1DA 3ZN0A 3QP5A 4A5NA 1FX7A 2QQAA 3MFKA 1ZRDA 2VE9A 4A0XA 3GYHX 5D4SA 4ZZDA 5E1ZB 3BZ6A 3BWGA 1J5YA 3F23A 2OQGA 1B9MA 2ZBKA 1GXQA 2RC4A 1BI3A 2XVCA 2OU2A 5L3GA 3KFWX 2HR3A 1IXRC 3I53A 1O7FA 1U5TA 4IRGA 2IPQX 3KP4A 5FFXA 1R23A 2O0YA 1MJAA 3CUOA 3OV8A 1WI9A 4P9UA 2VONA 3FXQA 2F5EA 5AIQA 3WE3A 3ZMZA 1MD0A 2L01A 3T8RA 3QU6A 3LQQA 1JHFA 2IW5A 3GZ5A 2K02A 1B6AA 4RS8A 3WU0A 3NQOA 1L0OC 1BBYA 1W5SA 4HZFA 3G3ZA 1J2XA 2VOOA 3RIRA 4WWCA 2UZKA 1XDSA 3PQJA 3K1NA 3RYRA 2QZ8A 1P6RA 2M45A 4U0YA 2RNJA 1O57A 1IUYA 3FM5A 2IJLA 4JBAA 5BS6A 4HAMA 4YFXF 2ZXJA 2R7FA 1P92A 3F6OA 3K1MA 3ERED 4A0ZA 2KRFA 4CXFA 3E5UA 5EEHA 4G8XA 1BJAA 4HDUA 2D2WA 3NEUA 5K5OA 2H27A 5DEQA 1XB4A 1MDMB 3EYIA 3E3VA 4ESFA 4GYIA 1XGMA 1KU3A 2NNNA 4CYDA 2GXGA 1B1BA 4OIOF 1LJ9A 2ESNA 2L02A 1IN6A 3C3WA 3E6CC 2XAQA 5E17F 1QQIA 1MGTA 3SFZA 3WTXC 2IT0A 1KGSA 3K2ZA 1TQMA 4KT5C 4RB1A 3BJ6A 4RB0A 3R61A 4U0WA 1MZBA 3V8KA 1IAWA 1T2KA 3M7GA 2VODA 5E18F 5DCFA 5ICGA 5F64A 2J5OA 5HOOA 5LGNA 1QNTA 3V8JA 4M72A 5D5VB 2PJPA 4MTEA 1J7KA 1K78A 2BGCA 1FP2A 3HYIA 4RAZA 4AVPA 2GWRA 3CUQC 1FSEA 1YW7A 2EFNA 1R1TA 2XASA 2GQQA 3P9CA 1OYIA 2G7UA 2XKPA 4KNYA 4HQEA 2V1XA 2Y48A 1W4MA 2E1CA 3JSOA 4M9XA 1IN5A 3BPXA 4WXDA 1ZREA 2E1NA 4G7OF 1KU9A 5LEKA 1PUEE 2EB7A 3Q5FA 3TO9A 2QUFA 1G3WA 2EV0A 1BIBA 2CW0F 1D5VA 3FMRA 2UWMA 3DQVC 3RJPA 1J0RA 1EV7A 4EGZA 4HV6A 2KIUA 1HKSA 4L9NA 4RAYA 2NRAC 4BXUA 2OD5A 5D6FA 3WGGA 5DD8A 1FWZA 4ZZLA 3WE2A 2NNYA 4RGRA 2F5DA 3TGNA 1WKMA 2EFPA 2MH9A 2Z33A 2STTA 5H6RA 2VT3A 1K6OA 3V7CA 3P7NA 1LVAA 2GA2A 4ZYEA 1OKRA 1F9NA 2FU4A 1SMTA 1G4DA 5HDNA 1V3FA 2HOEA 2P6TA 1P4AA 1ZLKA 3JSPA 1P4WA 3HUGA 1IRFA 1HSTA 2RGVA 3KZZA 2ZFWA 1YS7A 1YLFA 2A3SA 5DCMA 4UNOA 1KYZA 2WC2A 4WCGA 2G7HA 5CLSA 1FLIA 3ISPA 4HX4A 1OMIA 4B8XA 1B4AA 1ULYA 3R6SA 5H20A 2Z5UA 2W25A 4U7BA 1Q1HA 2QENA 3K0LA 1TQIA 2QWWA 4Q4ZF 4TV7A 1BC7C 1QZYA 4UVBA 3LA7A 4WX9A 2Y0MA 1XSDA 2CWEA 4HX8A 3FWEA 4P9FA 2MLGA 3DKWA 5CVJA 3LA3A 4OU0A 4O3MA 1CF7A 4O5VA 6PAXA 1XGNA 2WTEA 4M71A 3COAC 2V1UA 1R36A 4FT8A 4LG0A 4AIJA 4MTDA 2EJRA 2JPBA 2LKPA 4Y17A 4PCQA 3GF2A 4R1HA 1USSA 3HHHA 5JFRA 1F5TA 2ELHA 1U5TC 2GXBA 2YR2A 3SZTA 3MCZA 3WG9A 3W6JB 4S04A 1Z6TA 2KJCA 3FXUA 4LMYA 3GEZA 3TDUC 1DP7P 2ZMEB 2NS0A 3V7RA 3HOSA 2X4HA 3O2PE 3RKYA 3M9AA 3BY6A 3E5QA 3ZMSA 4XSXF 4CO8A 2UXNA 4IRHA 1I1GA 3ZP5A 5K5QA 2QBYB 2RVCA 2BEOA 2KKOA 3K1PA 2M87A 1R7JA 2P6SA 4HQMA 4I02A 5J8CA 2HYFA 3IKTA 4BHBA 4QLCU 3ZMUA 5E8IA 1ON1A 1ZHFA 1W7PD 3ZQ7A 4U0VA 3VFZA 3JW4A 1S29A 1ON2A 2H6CA 3ABUA 4RB3C 3L09A 1LQ1A 3T5XA 1U78A 4WXCA 4ENKA 5FO5A 3HSFA 2XAGA 3GFLA 4EM2A 4NHJA 3L00A 4DQ2A 3WODF 4WF2A 2XHKA 2P4WA 4IVNA 4BHPA 4B09A 5DV5A 4GXOA 4L9TA 2LDUA 4R8HA 2FRHA 1XN7A 4AD9A 1QO0D 5IT9Z 5E1XA 3HRUA 4OIPF 2W84A 5D8KB 1PDNC 3R0AA 4A12A 2W57A 4I98B 5J8FA 4EJTA 1IRGA 1E17A 2FOKA 3CTAA 5FLXZ 1O7LA 1XCVA 3CDHA 3J80K 2EFWA 1MKMA 3F6VA 1EH6A 3ZMDA 2BV6A 1KQ8A 5D6EA 2A68F 4IRIA 2XROA 1S7AA 5JVTA 2V6CA 3HTUA 3RPQA 4P5OA 1IN7A 4IHTA 5E8GA 2ACJA 1W7PA 1QPMA 4Y13A 2F5CA 1ZG3A 2H94A 4Z2YA 2CGPA 4A6DA 2OAZA 2FMYA 4L18B 2EV5A 3CLOA 3IKVA 1OPCA 5ICCA 1TTYA 2STWA 3FF5A 4Q5SF 3HSRA 1RI7A 1I1SA 4M9ZA 1ZARA 5AONA 1U6GA 1YO5C 2COMA 5A2QZ 4U7DA 3J7AO 1G3SA 2MC3A 2XGXA 2K4JA 4KIBA 3JAMZ 4G7ZF 1SD4A 3IWZA 4EJOA 5DUIA 2QVOA 3ECHA 1SD6A 5L3FA 3MAJA 4P55A 1TLHB 4HA8A 2LSOA 3I59B 2B0LA 2DI3A 2DLLA 1OYWA 2E7XA 5HLIA 4LLLA 5ILVA 4YIFA 3EDPA 3U1DA 3Q9VA 1QGPA 3F3XA 4GCVA 4HDVA 4KDPA 1KU7A 2DBBA 1S8NA 2VXZA 3IC7A 1W5TA 2O3FA 3O3KA 4L5JA 2MBFA 1E2XA 1NHAA 1LDKB 1G3YA 1DPUA 4A6EA 4ZYDA 3LA2A 3G73A 5HS8A 4MQVA 3FZVA 2Q2EA 5LRSA 2BBYA 4HF0A 3H3ZA 3L7WA 4ENNA 2DU9A 1YTYA 3WTVC 2V79A 1U2WA 1OYYA 2IVMA 3LAPA 3RYPA 3QAHA 3TQNA 1HW2A 1TNTA 3KLNA 4YFKF 1LEBA 3F8MA 3BDDA 4M73A 4I0AA 3GO5A 4XRFA 5KVRA 3WTTC 3O6BB 1JXSA 5LBQA 3Q9SA 5ICEA 5E20A 3B73A 2ISZA 4JK1X 5IT9K 1FC3A 2L4AA 4OINF 2KJBA 3D0SA 4MHGA 3SZPA 2QLZA 3VODA 2E7WA 5CVRA 3J81Z 4NB5A 2D45A 5LGUA 3F8BA 5FLXK 3DFGA 5FD6A 2XV4S 1KQ0A 1XDUA 4G94A 1MDMA 5CJ9A 4L9JA 4PDKA 2HEOA 2PQ8A 1I5ZA 3GZ6A 2A6EF 4I2OA 4LLGF 1B59A 4D0PA 2DT5A 3BPVA 1ZG1A 1SMYF 1BOAA 1KU2A 2PMHA 4OMZA 2CQKA 3F22A 3QRFF 3U9GA 1KQ9A 2XAHA 2VC1A 2H09A 2HGCA 2HYGD 5ILSA 1EH7A 2MH2A 1Z9CA 5DUKA 3MEXA 1S6LA 4MEYF 1Z7UA 3WU1B 5LLQA 4UUVA 4O6JA 1Y0UA 1XGSA 2H6BA 3I71A 2GAUA 3K69A 3EETA 2W85A 2EWNA 4I7HA 2M1BA 4IF4A 4A5MA 5ILUA 3LFKA 3BJAA 3GX4X 4AWXB 1YG2A 3ZN1A 2VOPA 4M6XA 4M74A 5A2QK 4RGUA 3IL2A 3HIFA 4Q48A 4WK8F 4G9YA 2GZWA 1Z91A 5L3DA 3JAMK 5FGMA 3HRMA 2A07F 3I54A 2OA4A 2QQBA 3JTHA 4MNUA 3BROA 3WTYC 4BQAA 1YQAA 2M8EA 2HTSA 3U2RA 1I27A 1KYWA 3I64A 2YPRA 4KICA 3CUQB 2HTJA 4UXNA 1FT9A 4DNCA 3IRQA 1QZZA 4N9HA 2FMLA 3T8TA 5KK1A 3PFIA 4ENMA 2XAJA 4RGSA 3ZMVA 3I0TA 1WSUA 2O61A 2YX4A 2AS5F 1G6NA 3MWMA 3I5UA 4MEXF 4AIKA 5J6XA 3S2WA 1U3EM 2PEXA 4RGXA 1YW8A 4FX4A 1OR7A 2FNAA 3E5XA 1P4XA 1X3UA 4G6DA 3BP8A 1IN8A 1YIOA 4BNCA 1DPRA 2FXAA 3FMQA 2BE5F 4HBLA 5FD5A 3WGHA 4KFCA 1A04A 3FMSA 1ZAOA 4HYEA 1BI1A 2F5FA 2XIGA 3VEPA 4UVAA 1REPC 1UB9A 3RKWA 1WRJA 1FSHA 4HX7A 3CO6C 1L3LA 2YSRA 3RKXA 4CDGA 2JTVA 3HRSA 1JHHA 1R58A 2TDXA 1J59A 4LB5A 3IHUA 4EMSA 4GO1A 3WGIA 5H6QA 3R4KA 3DXJF 2DPUA 4OOIA 5TJJA 3KP2A 2EA2A 2DK8A 1S3JA 5BPIA 2VC0A 3CJNA 4PGHA 4KMFA 1FY7A 3DPLC 2MLKA 1H9TA 3J81K 3E6DA 2OBPA 3N4MA 3M8EA 4LLNA 2DW4A 3F72A 3NRVA 3KP7A 4ZYHA 4N0BA 4ON0A 5L3EA 2HDCA 2FE3A 2PMUA 2PN6A 1LNWA 1F4KA 4IPAA 4H0EA 1FOKA 5L3CA 2NAZA 4F7ZA 2K4BA 2DQRA 3HRTA 2FQ3A 2JSCA 4YG2F 4MGRA 2HKOA 4KIFA 3V7SA 3H92A 3IRRA 1XMAA 2PLYA 4ZH4F 1SFUA 4A2UA 2HFHA 4MQ9F 3GXOA 3E97A 1O3RA 2Z9OA 3F8NA 1BM9A 2Q0OA 3ULQB 5BOXA 5ICFA 2ZMEA 2ZJ2A 3HOTA 1JGSA 2KIMA 3DEUA 3LSTA 2JT1A 1HXDA 1ZG5A 2CG4A 2P5KA 1R1UA 1ZH5A 2M5WA 4L0ZB 5LHIA 3TO7A 2AXLA 3EQLF 3GFIA 2QYOA 3TO6A 1U5TB 2QBYA 5K1YA 4L5IA 1UCRA 2CSOA 4BHCA 4ENJA 2P8TA 2IA0A 2ZO4A 3KZYA 3F8CA 3FM3A 3KETA 3LWFA 1LDJA 2GIVA 5LEJA 2F2EA 1FYMA 1TBXA 1IXCA 3LAJA 3M1EA 5BMZA 2XKOA 1ZN2A 3BJOA 2IRFG 5LRRA 2HS5A 4JQFA 3ABTA 2HZTA 2Z3YA 1FBUA 4KN7X 4BAYA 1ZLJA 4LJZF 1ZYRF 4EM0B 3GVAA 3DPTA 1T39A 1G3TA 1GVJA 1XSVA 5JHUA 1HBXG 4LD5A 2V1DA 1FBQA 5AIPA 2DK5A 3C1DA 5HDGA 1YYVA 2FEZA 1YS6A 1STZA 1J9IA 2WV0A 3VOEA 1T38A 4Q47A 3VB2A 1BC8C 3REOA 1ZRCA 4EVIA 5EEGA 3QP6A 4I01A 4GYGA 2K7LA 3P9IA 2DFIA 3E6BA 2P7CB 4OIQF 1TW3A 4PZJA 2VBXA 3C7JA 1HKQA 1Z6RA 2FF4A 4UV9A 5JR3A 5HS7A 1RZ4A 3EYYA 1R5GA 4ETSA 5DDGA 2MD5A 5L3BA 2EK5A 4HOBA 3QPTA 4EM1A 4L0YB
chains in the Genus database with same CATH superfamily
1H9GA 2BW3B 2XGCA 2EA4A 5LHGA 2HQNA 1GDTA 3QWLA 2JWTA 5DS9A 3FKIJ 1GXPA 5GTHC 3FKJA 1ETOA 2K40A 3HSEA 3GWZA 1AWCA 4LOCA 4J19A 1IF1A 4PSWA 1K78B 2M4KA 2JA2A 2O03A 2KFDA 2RQPA 1QPIA 2DO7A 4HLYA 1EJ9A 1X2MA 3BCBA 3I4PA 2E1MC 2XAUA 1FBSA 2L54A 2O5RA 2LP0A 1LVKA 1LE8B 4ABZA 4BXFA 1MJBA 2OQRA 2GA1A 4KIGA 3ZPLA 2CFXA 5IP7J 4GGGA 1TWCJ 2VBYA 4UV8A 2G9WA 2NVYJ 4FASD 5FB2A 1QBJA 1R00A 3GZNB 4NUBA 3K4CA 4BS9A 3FXMA 5EG0B 3QPHA 4YFNF 2HZDA 1P2FA 3D5RC 2UUZA 3H36A 1X1AA 5D8LB 2V9KA 2XF6A 4XLNF 3WU2C 1ZGJA 4B4CA 1HKTA 4HSTA 4JX4A 3C2GA 1WJEA 2VE8A 5IOYA 3CD6I 3ZQQA 1IZ1A 1T0FA 1A6QA 1RKTA 5KHDA 1Z7LA 3ZCOA 5D5WB 1MSFC 2O8KA 1WQ2A 1MJ9A 3BLYA 4R79A 3K4BA 2HWVA 5M3FJ 3V4GA 3I59A 4UVCA 3M8JA 3DU6A 1IW7F 2CO5A 2W48A 4CICA 4G6QA 3W2VA 3MQ0A 1R22A 3S2DJ 2PI0A 1G8XA 1S7OA 3S1RJ 1LB2A 2BOLA 2FBKA 1OR7C 2DT7B 4WXHA 1MMDA 3X2QH 3CMMA 4CCKA 1U9NA 1IUFA 5EYRA 4W97A 1UAAA 3F0CA 4D7MA 1RETA 1HLVA 1GHCA 4A3BJ 3L2WA 2ICWG 1XGOA 5HLGA 3IAS2 5CYVA 1O4XA 1WH5A 2F4MB 2PBIA 4UUSB 3RTRA 4IHVA 3KEQA 4OMYA 2BY2A 3F21A 1TT0A 2D1VA 1FP1D 2JA6J 3OS2A 1PUFB 3KEOA 1JGGA 2DPDA 1D5YA 4M9SA 4M6VA 4JP0A 5F6FA 1IV6A 3OR2C 4FX0A 4XLPF 5B1AH 1FMWA 2E19A 2JA5J 2LD5A 1Z3YA 3FK7A 1MBHA 3GFMA 2XB0X 3L1PA 4RLFA 3TW7A 2CFOA 2VIXA 3OYBA 1D1BA 1HQCA 3DCFA 3QOPA 2IP2A 5LGTA 2HKXA 1SFEA 2ME6A 2FOWA 1GLNA 3L9FA 2WWYA 4HLXA 4FCYA 2VN2A 3M4OJ 3HUGB 2R3SA 2Z99A 5KCMA 2DMQA 2FBHA 3E6MA 5E1WA 3Q0VA 3QU3A 1TNSA 1FYKA 4M6YA 1GT0C 4X6AJ 1X1CA 2KRCA 4A0YA 2CRGA 4MO7A 4XR6A 2CH0A 2VASA 5J1RA 2OZUA 1R5HA 4QPOA 1ZGAA 2BXYA 3GFJA 1KZHA 1HSJA 2IS6A 1V4RA 2EFOA 3S14J 2NYXA 2PFBA 1UMQA 1C0WA 2VJJA 4EJVA 1ONVA 2M9HA 5HLHA 3UKGA 2XC7A 1XCBA 1R9TJ 5DCMB 2KDZA 1VQ7I 3H9JA 3KE2A 1UFMA 9ANTA 3HHGA 3ABMH 3BOQA 3PFYA 1UHWA 4IXAA 2V9VA 1XC5A 3OYCA 1GV5A 4YIIA 1HW5A 3H35A 4LGWA 3R0JA 5E3NA 1WWXA 2DFFA 3R60A 4IL6C 1FNNA 1XD7A 1RIOH 1BI2A 1T33A 1FTZA 1TQPA 2R5YB 3TDZC 2O9LA 2LY1A 3FHZA 3L2CA 1FZPB 2NS8A 3HPHA 2BY0A 3TKYA 5GAEJ 1NK3P 3OYEA 3A01B 3W6KB 1O3TA 2HQAA 3HTSB 1TW2A 2DQLA 1A6IA 4OAYA 4S05A 5IYCJ 4CGZA 2CYYA 2GLOA 4FHTA 5DYMA 1R1VA 3DLLF 1XMKA 4YRVA 2ZKZA 2RDPA 1T98A 1KONA 4L9VA 2V6EA 1WGXA 3DEWA 2LR8A 4AVZA 3H0GJ 2Y75A 1RR8C 1LFBA 3H3UA 2CS3A 1SD5A 5HODA 3CMYA 4QWQA 1WHUA 2JK3A 4HF1A 3TL4X 3K4NA 1BIAA 4UHTA 3OOPA 4M3DA 4XONA 3RPUD 1EH8A 3ABLH 4FTHA 4BYYA 2Y0SA 5J40A 2OZ6A 4XLEA 3ZQGA 3J80Z 3CC2I 4I0BA 1CF7B 2FSWA 1SFXA 2PG4A 5M5YJ 3AAFA 4I09A 3ROUA 2ZMEC 4DJAA 2LVSA 1FYLA 4IHSA 4LG0B 2DTRA 3K9TA 2KZVA 2P5LC 3PJRA 2MA3A 4LK0F 2XPWA 3M8FA 1IO2A 5M3MJ 2LG4A 1A5JA 2VQGA 1LEAA 1IN4A 5ED4A 3K4JA 3BG6A 1X1BA 4QIWN 3GUDA 3CZ6A 2JRTA 1X2NA 2DTZA 4YEJA 5DM6F 1J75A 4E7KA 5D4RA 2ADUA 4P96A 2K9LA 1BR4A 3OS1A 4RB2C 3SHFA 3TOBA 3CJQB 2JA7J 2CJJA 3BT9A 4OIRF 1USTA 1JE8A 1ZRFA 4U88A 1K79A 1CGPA 1TWGJ 3M3YJ 1O3QA 3SXYA 1D3YA 2VBWA 4PGGA 5HDKA 1LKXA 2EV6A 3MKZA 4AIDA 4PUSA 5FRMA 2EZIA 1PYVA 4CUGA 2XUBA 5J1YA 1A31A 2A5YB 3ELKA 5F1RA 3KP5A 2K86A 3GTLJ 1PP8F 1P9QC 2KZGA 4LIUA 1DUXC 4LK1F 2RN7A 4AIHA 1ORKA 2D1HA 5HNHA 4CZZA 2ECCA 1JKPC 1AOYA 4MFDA 2MSYA 2YX7A 2HQRA 2HDWA 2J5PA 2K5CA 1WJFA 4N4NB 4G7HF 1RNLA 4XMYA 1SAXA 3HZJA 2JMWA 3DV8A 4BH9A 5C4XJ 1FPQA 3FXRA 4BACA 1MMSA 3G2BA 5DD4A 1VQLI 2EFQA 2XRNA 2ZNZA 1VQ9I 5LHHA 4EV0A 3S8PA 2DA6A 4XSZF 2UXXA 3FXLA 3SQNA 5BPDA 3B02A 5IYBJ 1Y56A 4Y7NJ 4N9IA 2VBZA 2OV7A 2XF7A 1W1WE 1U8BA 1T8IA 2PMZA 2FNPA 3DP7A 4K2EA 1UG2A 3IWFA 2Q8KA 5HVQC 2K27A 3DPUA 3QODA 3CUQA 2DA7A 4A3MJ 4MLOA 4XLFA 3S15J 1IGNA 5ERIA 2HI3A 3RI4A 4MIMA 4XBFA 4EJWA 2AQEA 2B9SA 3S1QJ 5D5XB 5LD2C 1MMAA 2L3DA 5K5RA 4KA4A 1O3SA 2X0LA 3RPUA 3JTGA 2QQ9A 4BE2A 1SANA 2GM4A 1XG1A 2RV8A 4L5EA 3OYGA 2WB1N 3U1KA 2DAOA 3P5JA 3LSMA 4Y15A 1FOWA 3S16J 2F4IA 4XN0A 2LF7A 3BG5A 2Z16A 2ZB9A 5CVIA 2B63J 1D8JA 3CCRI 1U8RA 2LRDA 3KCCA 4EJUA 2L4MA 4NC6A 4PFOA 1X19A 3FISA 4IJAA 2M30A 1JUPA 1H0MA 2TCTA 1SD7A 1R71A 5CVVA 3RDIA 1BI0A 2VT2A 3B6AA 4RMNA 3D1NI 4HF2A 2IA2A 5KAIC 2JPCA 3DTKA 4KMUX 3CP2A 3LQRA 2OUMA 3WTWC 2A5WA 3V42A 4KN4X 1TWAJ 3CO7C 3MZYA 1PVEA 3DBRB 3VYUB 2MABA 2VKEA 2CQ7A 4B43A 1HW1A 1K7AA 2DMNA 4CCOA 3P9KA 3ML6A 2WB1A 1WZ2A 2A6HF 3OIQA 3PQKA 2HVRA 1T6SA 4II3A 2R7XA 4KUMA 1VNDA 4XLAA 5E3OA 3HPGA 3GW2A 5TRDA 1N75A 3ZQCA 1DDNA 4NQWA 5D5UB 3MVPA 1ZR4A 4E70A 2DMPA 3OWTA 2A61A 1XSXA 1YFHA 2DOAA 4RAFA 4ESJA 1LPQA 3WTZA 2ISYA 2RKHA 2XAFA 3SJMA 5IT3A 1WJBA 3HJEA 4D7NA 3TOAA 1V5FA 2M0CA 4LFUA 2FBIA 1UHMA 4PSXA 3B6CA 1RUOA 2YU3A 5HS9A 4HW0A 1F1ZA 2DMUA 5EGOB 2O6GE 3MZHA 2P7VB 2IA1A 1R4NB 3KLOA 2AHQA 4DYQA 3CJRB 3J7AY 1ODDA 1W7PB 2FA5A 3TW6A 3GLXA 3C18A 3FX3A 4ESBA 3OY9A 3N97A 1A36A 2BYVE 2XGDA 3DKYA 3F8FA 3IAM2 3KP3A 3T0YA 3FIWA 4AUXA 2DCEA 4ZYGA 1B9NA 2LK2A 4F55A 1RUNA 3VWBA 3SYTA 5JHFA 3CMAI 4HSRA 1HCRA 2E36A 3ECOA 4IOAF 1W36C 2YU9J 4C2UA 4E4HA 2ETHA 3OSGA 2PX9A 5GPCA 2P5VA 1VQOI 4F93B 2C6YA 3N05A 2JZYA 4EEFG 3V8LA 2O8XA 3T1BA 1MNMC 4ASNA 1I6XA 5JI6A 5CVUA 1PP7U 3H3VK 1YJ9I 1T0FC 4X1EA 2LNBA 4KYWA 1I6HJ 3ZXSA 3WTSC 2OTLI 4C3JJ 2RAEA 1VTNC 2JVGA 2KL4A 1ZGWA 3DF8A 3I58A 1APLC 1MNEA 4HV5A 2K85A 2VB6A 1Y0NA 1Z05A 3IH4A 5FFZA 2R7DA 4FE7A 3EUHA 2W24A 4EGYA 2X1EA 1KA8A 2FQ4A 2ID6A 3WTUC 2HXOA 2MYSA 3C2HA 3D5LA 4DZJA 5BQTA 2CV2A 2LF8A 4D5FA 1YW9A 1TL8A 1XX5A 2A69F 2ESHA 2KIFA 4C30A 1QZEA 4NDLA 2ZCWA 4XOPA 1IXSB 3KP6A 2QM3A 2ZNYA 4CCNA 4LB6B 4F52A 4CHUA 1TT5B 1LDDA 2EH3A 2X51A 3ZMTA 5E3LA 1D8KA 4EQQA 2QSGX 1BN5A 1Z1DA 5C3EJ 3S3OA 1JTXA 3FXJA 3U21A 3IH2A 2ZXWH 1XPXA 3FXOA 3ZN0A 2M3AA 3QP5A 4A5NA 1FX7A 2QQAA 4B44A 5IP6A 4RA2A 1JUSA 1YX5A 3SDBA 3MFKA 2WBMA 4KT6A 1ZRDA 2VE9A 4A0XA 3GYHX 4BXXJ 5D4SA 4ZZDA 5E1ZB 3BZ6A 5FKNA 3BWGA 2QKLB 3L2RA 1OCPA 1LFPA 4BQQA 1J5YA 3F23A 2OQGA 1K4SA 1B9MA 2ZBKA 5JVGF 1GXQA 2RC4A 1BI3A 4XORA 3A0HC 2XVCA 4CYCA 4BDYA 2OU2A 4PK4A 3PIOF 5L3GA 3KFWX 2HR3A 1IXRC 3I53A 3FBNB 2XB5A 1O7FA 3CF5F 2E35A 4BJ5C 4Z6YA 1U5TA 4IRGA 2IPQX 2I5UA 3RQIA 4RAGA 3KP4A 5FFXA 1R23A 2DA4A 2O0YA 3HEFA 1MJAA 2IGKA 2RQQA 3CUOA 2Q2EB 3OV8A 3I4MJ 1WI9A 4P9UA 2VONA 2Y9YA 3A02A 2F5EA 3FXQA 5AIQA 4DBQA 2KQRA 1YJWI 3WE3A 3ZMZA 1BW6A 1MD0A 2VQLA 2JSPA 2L01A 3T8RA 4V2GA 3QU6A 3LQQA 2E2HJ 2NVXJ 1JHFA 2IW5A 3GZ5A 2K02A 4AM3A 1B6AA 3G71I 4RS8A 3WU0A 3NQOA 1L0OC 3PNTA 1EKEA 3JRFA 2LKXA 4B1RA 2HYJA 1BBYA 2VXDA 1W5SA 5J3LA 4HZFA 3G3ZA 4BQNA 1GVDA 1AHDP 1J2XA 3SDGA 1TP4A 2VOOA 3RIRA 3CCSI 4WWCA 3KYLA 2UZKA 1XDSA 3PQJA 2X6XA 3K1NA 4DGWB 4F3QA 3OS0A 2QA4I 3RYRA 2QZ8A 1QHHD 4GFBA 1P6RA 2M45A 3GCMA 4U0YA 2RNJA 1B8IA 1VZ0A 1O57A 2AXTC 3PUBA 1IUYA 3FM5A 2IJLA 2X6YA 4JBAA 4B47A 1Z67A 1HDPA 3W2WA 2X85A 3RSNA 4HAMA 4YFXF 2ZXJA 5BS6A 2R7FA 2IS2A 4PJLA 1X3ZB 1P92A 3O8HA 3F6OA 3K1MA 3ERED 5C44J 4A0ZA 1K6YA 2OCEA 2KRFA 4CXFA 2MW8A 2EPFA 3BR5A 3HKZA 3E5UA 5EEHA 1S5LC 4G8XA 1BJAA 4HDUA 1MSEC 1R6RA 2D2WA 3NEUA 5K5OA 1W5CC 4UB8C 1DU6A 2H27A 5DEQA 3OR1C 4NBQA 1XB4A 1MDMB 3EYIA 3E3VA 1IV8A 1QA6A 4ESFA 2I8DA 3F9KA 1S9HA 4GYIA 1XGMA 1KU3A 1TZLA 2NNNA 2GXGA 2VJ5A 4CYDA 1UJ8A 4ZTJA 1B1BA 4OIOF 3QOEA 4QPQA 1LJ9A 2ID3A 2ESNA 2L02A 2Z1DA 2NVUB 1IN6A 1NG6A 3W6VA 2DN0A 3C3WA 3E6CC 3E7LA 1K4TA 1ZKGA 2XAQA 5E17F 3GMEA 2UV1A 1QQIA 3K4MA 1MGTA 3JCUC 3SFZA 3WTXC 1EA3A 3J7YJ 2IT0A 1KGSA 3K2ZA 1E3OC 2VKDA 1TQMA 1ZTRA 4KT5C 2IXSA 4RB1A 3BJ6A 2VQCA 1WI3A 2MC4A 4RB0A 5IYDJ 3R61A 3BR0A 2R0QC 2VPLA 3ASOH 4U0WA 1MMNA 2VUMJ 1MZBA 3V8KA 1IAWA 4H4KC 3OYJA 1T2KA 4B3XA 2ZJPF 2LOOA 4JX5A 4BQOA 3M7GA 2VODA 3CJTB 2ZXHA 5E18F 2BW3A 5DCFA 2ELJA 5F64A 5ICGA 5IY5H 2J5OA 5HOOA 5LGNA 1QNTA 1V5GA 3V8JA 3WHCA 5H2FC 3S3NA 3OYFA 4DYCA 5CQEA 3TBIA 2VQHA 4M72A 3HOZJ 5D5VB 3OYDA 2PJPA 4MTEA 1J7KA 3HC7A 1K78A 2BGCA 2QEXI 1FP2A 3HYIA 1OISA 2DT6A 4RAZA 4AVPA 2GWRA 1SFKA 3CUQC 1FSEA 3KZIC 2G0EA 1YW7A 2EFNA 1LE8A 1R1TA 2XASA 3H9GA 5K7FA 4ANJA 5J4VA 2GQQA 3P9CA 4BE1A 1DP3A 1OYIA 4CSWA 2R7WA 2G7UA 2XKPA 2EINH 4CA0A 4KNYA 4HQEA 3M07A 2V1XA 2Y48A 1W4MA 4ZC3A 4NC7A 5GAGJ 5EG0A 2B7EA 2E1CA 3JSOA 4M9XA 5CKTA 2A05A 3BTLA 4UB6C 1IN5A 3BPXA 1NTCA 5BNGA 4WXDA 3IP4B 4JX6A 1ZREA 2R7TA 1YIJI 4HNVA 2E1NA 4G7OF 4A3CJ 1KU9A 5LEKA 1PUEE 2HU9A 3A1YA 2E1MB 1D0YA 1JI8A 3JRAA 2EB7A 3VSLA 3Q5FA 3TO9A 1FJLA 2QUFA 1G3WA 2EV0A 4XKWA 1BIBA 4CZCA 4XK4A 2W1OA 2CW0F 4UY8I 1D5VA 3FMRA 3LOCA 2UWMA 2VI6A 3DEEA 4II2A 3DTIA 4XKBA 2R7SA 3DQVC 2L0KA 2Y0SN 3RJPA 1T95A 3OYAA 1J0RA 2X9DA 1EV7A 3MMYB 4EGZA 4HV6A 2EQRA 1VQNI 2KIUA 1HKSA 4L9NA 4RAYA 4LG3A 2NRAC 4BXUA 1I39A 2OD5A 5E79C 5D6FA 5JLWA 2VPRA 1PJRA 3WGGA 4UUSA 3LSHA 5DD8A 1U9OA 1FWZA 1OCRH 2E1OA 4ZZLA 2CV1A 3WE2A 2NNYA 4RGRA 3PO3J 3S1NJ 2F5DA 2NXNB 3TGNA 1PUFA 1WKMA 2EFPA 2MH9A 3LSPA 2Z33A 1T56A 5C4JJ 2XF5A 2STTA 1WJCA 5H6RA 2VT3A 2PJRB 2LREA 1K6OA 2COBA 3V7CA 1Y1VJ 2GBYA 1X1DA 3OOUA 3P7NA 1LVAA 2GA2A 1BR1A 4ZYEA 1OKRA 4BE0A 1F9NA 4ZDOA 4J00A 5GPAA 2FU4A 3ZRGA 2ME0A 2R7QA 1SMTA 1G4DA 2DYSH 5HDNA 1V3FA 1MBKA 2HOEA 2P6TA 1P4AA 2KHMA 1ZLKA 3JSPA 1P4WA 5EZGA 2H1LA 3HUGA 3LMMA 1IRFA 5F0CA 2R5ZB 3OL3A 3SZGA 2XDVA 1HSTA 4Y3OA 3S32A 4P1WA 1FOXA 3HL2A 2RGVA 3CCLI 4G12A 3OYHA 2KT0A 2R7VA 3GTQJ 1SVOA 3KZZA 2DJNA 1JJ6C 2ZFWA 1VQMI 1YS7A 3I9V2 2WAFA 3SEQA 4ZDLA 1YLFA 2A3SA 5DCMA 4UNOA 4E7LA 1KYZA 2EIJH 3LSIA 2WC2A 4U87A 4N4OB 4WCGA 2G7HA 5CLSA 1FLIA 3ISPA 4QTRA 4HX4A 3EUHC 1OMIA 3QYBA 4B8XA 1Q1VA 2NOGA 3CC4I 3BQYA 1B4AA 1DGRM 3QPLA 1RC9A 2QSFX 3OSFA 1ULYA 3EUKL 2PMZN 4KJZA 2V26A 1OCZH 3R6SA 2R5YA 5H20A 2LFBA 2Z5UA 3A01A 2CQNA 2K9QA 2I10A 2W25A 4D5CA 4XNFA 1Q1HA 4U7BA 1EF4A 2QENA 3K0LA 4E7JA 2H8WA 1TQIA 3UR3C 5HNFA 2QWWA 4Q4ZF 4TV7A 1BC7C 2NVTJ 2LLKA 1RRJA 1ACIA 1V55H 1QZYA 4UVBA 4XIDA 2NVQJ 3LA7A 4E7HA 2Y69H 4WX9A 1ETVA 5EDNA 2Y0MA 1XSDA 1ZQ3P 2CWEA 1QU3A 3LSKA 4HX8A 3FWEA 1AKHB 4P9FA 2QGUA 5TGTA 2MLGA 3ABKH 4BY1J 3DKWA 5CVJA 5CQGA 1VQ4I 3LA3A 4OU0A 4O3MA 1G59A 1CF7A 2DXIA 4O5VA 6PAXA 1XGNA 2WTEA 4LITA 4M71A 3COAC 2VJ4A 2V1UA 3H5NA 1R36A 4FT8A 4OAZA 4LG0A 2EZLA 3MN2A 4AIJA 1XTAA 5LFAA 4MTDA 1H89C 1F36A 3DWLE 2EJRA 2JPBA 4XM3A 2LKPA 5KNLA 4IO9F 1S7EA 3MD2A 2VKHA 4A3KJ 4Y17A 4PCQA 3GF2A 4R1HA 1USSA 2XPUA 3HHHA 5JFRA 1VQ8I 5B66C 2WY8Q 2O7OA 1F5TA 2ELHA 1U5TC 1V5EA 4NC8A 1IRXA 2GXBA 2YR2A 2IGMA 3SZTA 2OC6A 3MCZA 4XOTA 3WG9A 3W6JB 4S04A 3OYNA 4A3EJ 1Z6TA 2KJCA 3FXUA 4LMYA 3GEZA 4MFEA 3TDUC 1DP7P 2OJED 2ZMEB 2IS1A 3HG9A 2NS0A 2L9NA 3V7RA 3HOSA 2X4HA 2L5QA 1Z3XA 2CW8A 3O2PE 3RKYA 2OCCH 3WG7H 1VF9A 3M9AA 3SFIA 4XRSG 3KPHA 1SFOJ 3BY6A 3E5QA 4J01A 2DOFA 3ZMSA 1NG7A 4XSXF 4CO8A 2ZJRF 3HOUJ 2UXNA 1QHGA 4DBRA 3OYMA 4IRHA 1I1GA 3ZP5A 4ZDPA 5K5QA 2QBYB 2RVCA 3QPSA 2BEOA 3E1SA 1YRNB 2KKOA 4D9JA 3K1PA 5J1UA 1W0UA 2M87A 1K83J 2CQQA 1R7JA 2P6SA 4HQMA 4I02A 5J8CA 2HYFA 3IKTA 3EUAA 1YX3A 4BHBA 3IH3A 1IJWC 4QLCU 1V54H 3ZMUA 5E8IA 1ON1A 1ZHFA 1W7PD 3I55I 3ZQ7A 4U0VA 5F0HA 1WJAA 3VFZA 3JW4A 2V7FA 1S29A 1ON2A 2H6CA 3ABUA 4RB3C 2W00A 5TISC 1LFUP 3KEYA 3L09A 4B48A 2K9MA 1LQ1A 4F92B 1BJZA 3T5XA 3L2UA 2QQ8A 1U78A 2IEKA 1JKOC 4WXCA 4ENKA 3CCEI 2KRHA 2VKVA 5FO5A 2M4GA 3CDLA 3HSFA 4E7ZA 2XAGA 3GFLA 4EM2A 1OLTA 4NHJA 3L00A 4DQ2A 3WODF 4WF2A 3W2AA 4QSHA 3OMYA 3HGGA 2XHKA 2P4WA 4IVNA 3KX2A 1F43A 3K7AJ 4BHPA 4B09A 5DV5A 4GXOA 3BTIA 3GTKJ 4FETA 4G6TB 4L9TA 3TP3A 1GUUA 3GTOJ 4GDFA 2LDUA 2N8GA 4R8HA 2F5VA 3CF2A 2FRHA 1XN7A 1ZK8A 1QO0D 4AD9A 3I4NJ 4C3IJ 5IT9Z 5GP9A 4BJTA 2R4GA 5E1XA 3HRUA 1P7JA 3AG4H 3VYTB 2XSDC 3HOXJ 4C2TA 2W84A 3HB9A 5D8KB 4B3AA 4KISA 1PDNC 4OIPF 1I50J 3R0AA 4A12A 2DA2A 2W57A 4I98B 5J8FA 2EBIA 4EJTA 1FTTA 1IRGA 1Z21A 3ZR8X 1E17A 2FOKA 3LSJA 3CTAA 2DODA 5FLXZ 2GOXB 1MMGA 2E2IJ 1O7LA 1XCVA 2DA5A 3Q3SA 3CDHA 2R7ZJ 3J80K 3JRDA 2EFWA 1R5ID 1MKMA 2ZC2A 3I3LA 3F6VA 2CQXA 3ZQIA 1E3HA 2KIQA 4FISA 1A35A 3AL0C 1EH6A 1OJLA 3AFHA 2BVMA 3ZMDA 2BV6A 3PL8A 1KQ8A 2GOMA 5D6EA 2A68F 4IRIA 2EIMH 4FQGA 2XROA 4BBRJ 1S7AA 1RPWA 2LKSA 2E60A 5JVTA 3IV5A 2K3PA 2V6CA 3HTUA 3RPQA 4Y4RA 3CCJI 1OCTC 3HDDA 5EGOA 1NH3A 4P5OA 3CDIA 1IN7A 1U0JA 4BEHB 4IHTA 5E8GA 5B3SH 2ACJA 4V19K 2LBFB 2P0WA 1W7PA 1QPMA 1SVLA 2F5CA 2L2OA 4Y13A 3CCQI 2A6TA 1ZG3A 5M5XJ 2H94A 1N25A 4Z2YA 5FROA 4E7SA 2CGPA 1BW5A 4A6DA 3JRBA 4YELA 2R7RA 2OAZA 2FMYA 4L18B 2EV5A 3CCYA 1YI2I 3CLOA 5FRNA 2XRLA 3IKVA 5K7HA 1OPCA 5F1JA 5ICCA 1TTYA 1BA5A 5GAHJ 4CCMA 1SC7A 3CMEI 2STWA 4AU7A 1Y6IA 2XSJC 1TWFJ 3FF5A 4Q5SF 3HSRA 3NARA 1RI7A 1I1SA 2M0MA 3ASNH 3DU5A 4M9ZA 1ZARA 1OQYA 5AONA 1U6GA 1YO5C 4RDUA 3VSKA 2COMA 4RM3A 5A2QZ 4U7DA 3J7AO 1G3SA 2MC3A 2XGXA 1DU0A 2K4JA 1ITYA 2LY9A 4CCJA 3LSGA 1VQ6I 4KIBA 4IQ4A 1GV2A 3JAMZ 5HLTA 4G7ZF 3G1MA 1SD4A 1ETWA 3IWZA 4EJOA 3S3MA 5DUIA 4V2FA 2QVOA 1Z77A 3ECHA 1SD6A 2BHZA 3HKZN 5L3FA 2KISA 2R7UA 4YIRX 5K7ZA 3S93A 3MAJA 2ZFUA 3CCUI 3K70D 4P55A 1TLHB 2F6CA 4HA8A 2KPMA 2LSOA 3I59B 1Y8RB 2DDAA 2B0LA 4IX7A 3JRIA 4PJJA 2DI3A 4A3IJ 4ZTFA 2Q1ZB 4DYRA 2CU7A 4PJMA 2DLLA 3HM5A 2BXZA 4Y33A 2JN6A 1OYWA 2E7XA 2WAQA 5HLIA 4LLLA 5ILVA 3FXKA 4IZZA 4YIFA 2KMUA 3PO2J 3MKYB 3EDPA 3U1DA 3K4KA 3Q9VA 1QGPA 3F3XA 1DQUA 4GCVA 4HDVA 4KDPA 1KU7A 2DBBA 3VPRA 1S8NA 3H1CA 2OTJI 2JA8J 2VXZA 3IC7A 3JRGA 2V9PA 1W5TA 2O3FA 2YS9A 3O3KA 2K9NA 4L5JA 2JUCA 2Y2ZA 2F4OB 2MBFA 1E2XA 1NHAA 1LDKB 1G3YA 4NNJA 1SVMA 2CUJA 4JYKA 4HPQA 1JT0A 1JTYA 1DPUA 4A6EA 5E3MA 3QYEA 4ZYDA 3LA2A 3G73A 5HS8A 3DLAA 2HDDA 1WCMJ 4MQVA 3MKLA 3FZVA 3C2BA 4BY7J 2JQ7A 2Q2EA 2QKMB 5LRSA 2K3FA 2BBYA 4HF0A 4AYBA 3H3ZA 3L7WA 1D0XA 4ENNA 2DU9A 3GBGA 1QRYA 2QSHX 4HNTA 1XMXA 1YTYA 2V4JC 3WTVC 2V79A 4E7IA 4E6KG 1U2WA 1D0ZA 1OYYA 2IVMA 5F0FA 3LAPA 1ETQA 5JLXA 3S1MJ 4PJ0C 3KYCB 1VFCA 3RYPA 3QAHA 3TQNA 1HW2A 1TNTA 2LY2A 1G2HA 3K4LA 1M1EB 3A0BC 3KLNA 4CCLA 3OIPA 1YJNI 1SEUA 2WV1A 2CW7A 3GTJJ 1RESA 3BR3A 4YFKF 2LTPA 1LEBA 1HDDC 1IG7A 2Z2SB 3F8MA 1UHSA 5IOZA 1JKRC 3BDDA 4RLQA 4M73A 1IDZA 4I0AA 3GO5A 3H5RA 4XRFA 5EEAA 2EZHA 5KVRA 1RKWA 1MBJA 3WTTC 3LL7A 3O6BB 1JXSA 5LBQA 1WFXA 3Q9SA 5ICEA 5KAFC 2WAEA 2EIKH 3NWSA 3BZCA 2L9RA 2E34A 4BJ6C 5E20A 3PSIA 3B73A 2ISZA 4A93J 1BL0A 4JK1X 2D5VA 4A69C 3G6EI 5IT9K 4F91B 3J7ZI 1FC3A 2L4AA 3L2QA 4OINF 2KJBA 3D0SA 1ERDA 3RZDJ 4MHGA 3SZPA 2QLZA 3G1OA 2DYRH 3VODA 2R7OA 1BR2A 4D1QA 3FK6A 1R49A 2E7WA 5CVRA 1VI0A 3J81Z 4NB5A 2D45A 2HOAA 5LGUA 3F8BA 1YOVB 3DKXA 5FLXK 1HF0A 3DFGA 1Y1WJ 5FD6A 2XV4S 4IEJA 1OCCH 1KQ0A 1XDUA 4G94A 2K9SA 4IKFA 1MDMA 5CJ9A 1MH4A 2DA3A 4L9JA 4PDKA 2HEOA 2MG4A 3JRHA 1T08B 2PQ8A 2W82A 1I5ZA 3GZ6A 2A6EF 4I2OA 2GIZA 1UELB 2M8GX 4LLGF 3WHBA 1I3QJ 2FJ1A 1B59A 4D0PA 1MBEA 2DT5A 2NS7A 3BPVA 2HVQA 4DZPA 1ZG1A 1SMYF 3BQZA 2MGQA 1BOAA 3HBLA 4PJNA 1KU2A 2PMHA 4OMZA 2CQKA 3F22A 3ONQA 3ZQHA 3QRFF 3U9GA 1ZELA 4M3FA 1KQ9A 2XAHA 4BKXA 3S17J 3D5SC 2VC1A 3RZOJ 4DW6A 2H09A 1WH7A 4BBSJ 4W1UA 3HGYA 2HGCA 1FOYA 3KIOA 2HYGD 5ILSA 1EH7A 2MH2A 1Z9CA 5DUKA 4EATA 3ERMA 4A3FJ 3MEXA 3OL4A 1S6LA 2BY1A 4MEYF 1MBFA 1Z7UA 3ZGKA 3QQAA 2E71A 3WU1B 2E5ZA 5LLQA 3W3CA 4UUVA 4O6JA 1Y0UA 1XGSA 2DA1A 2H6BA 2M2EA 3PIPF 3I71A 4PFPA 3JR9A 2GAUA 3RCOA 3K69A 2V1NA 3EETA 1QVTA 3FBIB 2DOEA 3SEZA 2M34A 2CMPA 2W85A 1BOBA 2EWNA 2M1BA 4I7HA 4IF4A 4A5MA 2LYCA 3GTPJ 5ILUA 3LFKA 3BJAA 3GX4X 4AWXB 2RNGA 1YG2A 3MKWB 2HOSA 3ZN1A 2VOPA 4M6XA 4M74A 3OYIA 5A2QK 4M3GA 4RGUA 3IL2A 2RREA 4HG2A 3HIFA 4Q48A 4WK8F 4G9YA 3CESA 2GZWA 1Z91A 3Q0WA 5L3DA 3I56I 1UZCA 3JAMK 1H88C 5FGMA 3HRMA 2A07F 3I54A 2IBDA 2OA4A 3AG2H 2QQBA 3JTHA 1JJ8C 4C3HJ 3AG1H 4MNUA 3BROA 1LUJB 3WTYC 4GRIA 2WADA 1YQAA 1H8AC 4BQAA 2M8EA 2HTSA 3U2RA 3ZQLA 1I27A 4HNUA 1KYWA 3I64A 3CP8A 3QYFA 2YPRA 3OYKA 1MIJA 4KICA 3HOYJ 1R4MB 3CUQB 2HTJA 1VQKI 4UUTA 4UXNA 1FT9A 2ECBA 4DNCA 3IRQA 4M3EA 1N78A 2BHYA 1QZZA 4N9HA 5EZHA 2FMLA 3T8TA 5KK1A 3PFIA 4ENMA 2IAIA 2XAJA 4RGSA 2X1DA 3ZMVA 3BR1A 2HQ5A 2JRMA 3I0TA 3VYRB 1WSUA 2O61A 2YX4A 1E3PA 1CQTA 2AS5F 2H8RA 3PNVA 2P81A 4XL9A 1Z0XA 3TMOA 2M7BA 1G6NA 1YE9A 3EPZA 3MWMA 3I5UA 4I76A 2BY3A 3GLLA 4MEXF 3O8GA 5J6XA 4AIKA 2VJIA 4DOZA 3S2WA 1U3EM 2PEXA 4RGXA 1DGWY 1YW8A 4FX4A 2DDBA 1OR7A 2FNAA 3E5XA 2PJRA 1P4XA 1X3UA 3NWTA 2Y31A 4G6DA 3BP8A 2DFEA 3IUOA 1IN8A 5DTDA 1YIOA 4BNCA 1NK2P 1DPRA 2FXAA 1ETKA 2M7AA 4RBOA 1Y8QB 3FMQA 2BE5F 4HBLA 2HPIA 5FD5A 3WGHA 4KFCA 3CQZJ 1A04A 4BUPA 2NOJB 2DFHA 3JREA 3FMSA 1ZAOA 4I99C 4NQWB 1YHQI 4HYEA 3ZOBA 1BI1A 2R5ZA 2F5FA 2XIGA 4IHWA 3VEPA 3PSFA 3S2HJ 3CLQA 4UVAA 3AKZA 1REPC 1UB9A 3RKWA 4XKVA 1WRJA 1FSHA 2ZJQF 4HX7A 3CO6C 3K6GA 4CH7A 4FE4A 1L3LA 1RR7A 2YSRA 3RKXA 4CDGA 2JTVA 3HRSA 2QF7A 1JHHA 1R58A 2TDXA 1J59A 1E0EA 2ELKA 4LB5A 3IHUA 4EMSA 2ZSIB 1WJ5A 4GO1A 3VYSB 3WGIA 5H6QA 3R4KA 1YITI 3DXJF 3FHNA 3Q0UA 1X58A 4XLCA 4AC0A 2DPUA 4OOIA 5TJJA 2IS4A 3KP2A 4ITVA 3K2AA 2Y30A 2EA2A 1VQPI 2DK8A 3CCVI 3GTMJ 1S3JA 5BPIA 2VC0A 1OFCX 3CJNA 4PGHA 1J09A 3BR6A 2MD0A 4KMFA 2R93J 1FY7A 3DPLC 2HNHA 2LC2A 2MLKA 1H9TA 4XKCA 3J81K 3E6DA 4XLHA 2OBPA 1ETXA 3N4MA 1WJDA 3M8EA 4LLNA 2EZKA 2DW4A 3F72A 3NRVA 4RM2A 1FIPA 3PNYA 2KLOA 3KP7A 2F48A 2FD5A 4ZYHA 4BDZA 4N0BA 4ON0A 5L3EA 2HDCA 2FE3A 1AKHA 2ZXIA 2AO9A 2CUZA 2KDOA 1JT6A 2PMUA 2PN6A 1LNWA 4LIVA 2EILH 3H9QA 3A4CA 2L7FP 1F4KA 1OCOH 1D1AA 3OIOA 2VL8A 4IPAA 1JUMA 1X1PA 4H0EA 1FOKA 5L3CA 1QVUA 1WVRA 2X6WA 2NAZA 2X6OA 2MFZA 2K4BA 4F7ZA 5FLVA 3RQ4A 2DQRA 3HRTA 2FQ3A 2JSCA 2L9VA 4YG2F 2AQFA 1K61A 5FKLA 4MGRA 2HKOA 4KIFA 3V7SA 3TP0A 5FKKA 3H92A 3IRRA 1XMAA 2BZTA 2PLYA 3DBHB 4ZH4F 1SFUA 2IGOA 5FKOA 4A2UA 2HFHA 4XRSA 1IRZA 1IC8A 1TC3C 4MQ9F 3GXOA 3E97A 1O3RA 2DMTA 3F8NA 2Z9OA 1BM9A 2TRTA 2QCOA 4IOCF 2Q0OA 3CCMI 3ULQB 5BOXA 5ICFA 2ZMEA 2ZJ2A 3HOVJ 2JVHA 3HOTA 3A2KA 1JGSA 2KIMA 3DEUA 3LSTA 4ZYAA 2IGNA 3PUFA 1AA7A 1SAUA 2JT1A 1HXDA 2FX0A 5B5EC 1ZG5A 2CG4A 1HC8A 2P5KA 1R1UA 1ZH5A 2M5WA 4CYCB 4XRMA 4L0ZB 2X1CA 1IDYA 2LMDA 2L7KA 5LHIA 3TO7A 2XGEA 3BG3A 3VDXA 4C2MJ 3G4SI 2AXLA 3EQLF 4IHYA 3GFIA 3H0DA 2JUGA 1WPKA 3HXLA 2QYOA 3BCAA 2HXIA 3TO6A 1U5TB 2WY7Q 3FDYA 2QBYA 1YRNA 5K1YA 4L5IA 2X48A 2GXAA 1UCRA 3E0JB 4A3LJ 2CSOA 2DJIA 1X4PA 4BHCA 4XICA 1VQ5I 4ENJA 1D1CA 3CC7I 2P8TA 2HPMA 2Y9ZA 1JKQC 2IA0A 2W4SA 1HOMA 2ZO4A 5FKMA 3KZYA 4IQJA 3F8CA 3FM3A 3M1CA 2LH9A 3KETA 2W7NA 2CUEA 3MZ8A 2H1KA 5F27A 2OPTA 1B72B 3LWFA 2KP6A 5F08A 3K70C 1LDJA 4A3JJ 1UG0A 2WA0A 3A03A 2GIVA 3BTCA 5LEJA 4C9YA 3RKQA 3HOWJ 4A3DJ 2F2EA 3LNQA 1FYMA 1TBXA 1IXCA 5IPAA 2L7MP 4ZJZA 5GTIC 3KYDB 2OF7A 3LAJA 3M1EA 5BMZA 2CUFA 5FLMJ 1I3AA 2XKOA 2R92J 1Y39A 1ZN2A 4OWRB 4IHXA 3BZKA 4A3GJ 4Y52J 1S72I 1B8IB 5GADJ 2E2JJ 3BJOA 1XS9A 2IRFG 3ESWB 5LRRA 3BR2A 1W0TA 2HS5A 3H5AA 4JQFA 4BGDA 3ABTA 4BU2A 1X4OA 2HZTA 4M3BA 2Z3YA 1FBUA 4X0GA 4KN7X 4BAYA 1ZLJA 2HVSA 4LJZF 1W36D 1ZYRF 4EM0B 1MBGA 3GVAA 2JJ7A 3DPTA 3LSRA 1T39A 1G3TA 1GVJA 1XSVA 5JHUA 1HBXG 4LD5A 5M5WJ 5EF6A 2V1DA 5IP9J 3L2VA 2FUG2 1FBQA 5AIPA 4DIQA 2WAQN 3DBLB 3AG3H 1P7IA 2DK5A 3C1DA 5HDGA 2XPVA 2HOTA 4HRIA 3TEDA 4JOMA 1YYVA 2FEZA 1YS6A 2CV0A 1STZA 1J9IA 2WV0A 3VOEA 1T38A 4Q47A 4XN3A 3NAUA 3VB2A 2E5NA 1FIAA 3BC8A 3BTJA 5EJCA 4S0HB 1BC8C 3REOA 1HA8A 2L7ZA 1ZRCA 1MW7A 2ZSHB 3K10A 5B1BH 4KITB 4EVIA 5EEGA 4HEA2 1TWHJ 3BG7A 5J47A 3QP6A 5F04A 5DM7F 3JRCA 3ZQFA 4I01A 5J4YA 4GYGA 3UNGC 2K7LA 5FJ8J 3P9IA 2DFIA 5CPRB 2L9SA 1ETYA 3DTEA 3E6BA 3PM1A 2P7CB 4OIQF 1TW3A 1B72A 3G1LA 4BL0B 4PZJA 2VBXA 3C7JA 1HKQA 4I6ZA 3OYLA 1Z6RA 2FF4A 3LFUA 4UV9A 5JR3A 1MNDA 4BEHA 1AU7A 5HS7A 1POGA 1RZ4A 3BG9A 2VLAA 3EYYA 2LBFA 1ZR2A 3GTGJ 4AYBN 1R5GA 2YUSA 1MH3A 4ETSA 3AL0B 1FMVA 1FEXA 5DDGA 2MD5A 5L3BA 1ENHA 2EK5A 4XQFA 4HOBA 2BVLA 3QPTA 4EM1A 1N77A 1X3WB 4L0YB
chains in the Genus database with same CATH topology
1H9GA 2EA4A 5LHGA 2HQNA 1GXPA 3HSEA 3GWZA 1AWCA 1IF1A 1K78B 2O03A 2RQPA 2DO7A 4HLYA 3I4PA 1FBSA 2L54A 1MJBA 2OQRA 2GA1A 4KIGA 3ZPLA 2CFXA 4GGGA 2VBYA 4UV8A 2G9WA 5FB2A 1QBJA 1R00A 3QPHA 4YFNF 1P2FA 5D8LB 4XLNF 1ZGJA 1HKTA 2VE8A 1IZ1A 1T0FA 5D5WB 1WQ2A 1MJ9A 4R79A 2HWVA 3V4GA 3I59A 4UVCA 1IW7F 2CO5A 4CICA 4G6QA 3MQ0A 1R22A 2PI0A 1S7OA 1LB2A 2FBKA 4WXHA 1GHCA 1XGOA 5HLGA 5CYVA 2PBIA 3RTRA 3KEQA 4OMYA 3F21A 2D1VA 1FP1D 3KEOA 2DPDA 4M9SA 5F6FA 4FX0A 4XLPF 3GFMA 1HQCA 3QOPA 2IP2A 5LGTA 2HKXA 1SFEA 2WWYA 3L9FA 4HLXA 2VN2A 2R3SA 2Z99A 2FBHA 3E6MA 5E1WA 3QU3A 1TNSA 1FYKA 4M6YA 4A0YA 2OZUA 1R5HA 1ZGAA 3GFJA 1HSJA 1V4RA 2EFOA 2NYXA 2PFBA 1C0WA 4EJVA 1ONVA 5HLHA 1XCBA 5DCMB 3KE2A 1UFMA 3HHGA 3BOQA 1UHWA 4IXAA 2V9VA 4YIIA 1HW5A 4LGWA 3R0JA 1WWXA 3R60A 1FNNA 1XD7A 1RIOH 1BI2A 1TQPA 3TDZC 3FHZA 3L2CA 1FZPB 3TKYA 3W6KB 1O3TA 3HTSB 1TW2A 2DQLA 4S05A 4CGZA 2CYYA 4FHTA 5DYMA 1R1VA 1XMKA 2ZKZA 2RDPA 1T98A 4L9VA 2Y75A 3H3UA 1SD5A 4QWQA 4HF1A 1BIAA 4UHTA 3OOPA 1EH8A 4BYYA 2OZ6A 3J80Z 4I0BA 1CF7B 2FSWA 1SFXA 2PG4A 3AAFA 4I09A 3ROUA 1FYLA 4IHSA 4LG0B 2DTRA 3K9TA 2P5LC 2MA3A 4LK0F 3M8FA 1LEAA 1IN4A 5ED4A 3GUDA 2JRTA 1J75A 5D4RA 2ADUA 4P96A 4RB2C 3SHFA 3TOBA 4OIRF 1USTA 1JE8A 1ZRFA 4U88A 1K79A 1CGPA 1O3QA 3SXYA 1D3YA 2VBWA 4PGGA 5HDKA 2EV6A 2XUBA 2A5YB 3ELKA 5F1RA 3KP5A 2K86A 1PP8F 1DUXC 4LK1F 2RN7A 4AIHA 2D1HA 4CZZA 1AOYA 2YX7A 2HQRA 2J5PA 4G7HF 1RNLA 1SAXA 3DV8A 4BH9A 1FPQA 3FXRA 5DD4A 2EFQA 2XRNA 2ZNZA 5LHHA 4EV0A 4XSZF 2UXXA 3SQNA 5BPDA 3B02A 4N9IA 2VBZA 2FNPA 3DP7A 4K2EA 3IWFA 2Q8KA 5HVQC 2K27A 3CUQA 5ERIA 3RI4A 4XBFA 4EJWA 5D5XB 2L3DA 5K5RA 4KA4A 1O3SA 2X0LA 3RPUA 3JTGA 2QQ9A 2RV8A 2DAOA 4Y15A 2LF7A 5CVIA 1D8JA 1U8RA 3KCCA 4EJUA 2L4MA 4IJAA 2M30A 1H0MA 1SD7A 5CVVA 3RDIA 1BI0A 2VT2A 4HF2A 2IA2A 2JPCA 4KMUX 3LQRA 3WTWC 4KN4X 3CO7C 3MZYA 1HW1A 1K7AA 3P9KA 3ML6A 2A6HF 3PQKA 1T6SA 4KUMA 3GW2A 5TRDA 1DDNA 4NQWA 5D5UB 4E70A 2A61A 1XSXA 1YFHA 4ESJA 3WTZA 2ISYA 2RKHA 2XAFA 5IT3A 3TOAA 4LFUA 2FBIA 1UHMA 1RUOA 2YU3A 5HS9A 4HW0A 1F1ZA 2O6GE 3MZHA 2P7VB 2IA1A 3KLOA 1ODDA 1W7PB 2FA5A 3GLXA 3C18A 3FX3A 4ESBA 3N97A 2BYVE 3F8FA 3KP3A 3T0YA 4ZYGA 1B9NA 1RUNA 3ECOA 2ETHA 2P5VA 2C6YA 2JZYA 3V8LA 2O8XA 3T1BA 4ASNA 1I6XA 5JI6A 5CVUA 1PP7U 2LNBA 4KYWA 3WTSC 1VTNC 3DF8A 3I58A 4HV5A 1Z05A 5FFZA 2R7DA 3EUHA 2W24A 4EGYA 1KA8A 3WTUC 3D5LA 5BQTA 2LF8A 1YW9A 2A69F 2ESHA 2KIFA 2ZCWA 1IXSB 3KP6A 2QM3A 2ZNYA 4LB6B 4CHUA 1LDDA 3ZMTA 1D8KA 4EQQA 1BN5A 1Z1DA 3ZN0A 3QP5A 4A5NA 1FX7A 2QQAA 3MFKA 1ZRDA 2VE9A 4A0XA 3GYHX 5D4SA 4ZZDA 5E1ZB 3BZ6A 3BWGA 1J5YA 3F23A 2OQGA 1B9MA 2ZBKA 1GXQA 2RC4A 1BI3A 2XVCA 2OU2A 5L3GA 3KFWX 2HR3A 1IXRC 3I53A 1O7FA 1U5TA 4IRGA 2IPQX 3KP4A 5FFXA 1R23A 2O0YA 1MJAA 3CUOA 3OV8A 1WI9A 4P9UA 2VONA 3FXQA 2F5EA 5AIQA 3WE3A 3ZMZA 1MD0A 2L01A 3T8RA 3QU6A 3LQQA 1JHFA 2IW5A 3GZ5A 2K02A 1B6AA 4RS8A 3WU0A 3NQOA 1L0OC 1BBYA 1W5SA 4HZFA 3G3ZA 1J2XA 2VOOA 3RIRA 4WWCA 2UZKA 1XDSA 3PQJA 3K1NA 3RYRA 2QZ8A 1P6RA 2M45A 4U0YA 2RNJA 1O57A 1IUYA 3FM5A 2IJLA 4JBAA 5BS6A 4HAMA 4YFXF 2ZXJA 2R7FA 1P92A 3F6OA 3K1MA 3ERED 4A0ZA 2KRFA 4CXFA 3E5UA 5EEHA 4G8XA 1BJAA 4HDUA 2D2WA 3NEUA 5K5OA 2H27A 5DEQA 1XB4A 1MDMB 3EYIA 3E3VA 4ESFA 4GYIA 1XGMA 1KU3A 2NNNA 4CYDA 2GXGA 1B1BA 4OIOF 1LJ9A 2ESNA 2L02A 1IN6A 3C3WA 3E6CC 2XAQA 5E17F 1QQIA 1MGTA 3SFZA 3WTXC 2IT0A 1KGSA 3K2ZA 1TQMA 4KT5C 4RB1A 3BJ6A 4RB0A 3R61A 4U0WA 1MZBA 3V8KA 1IAWA 1T2KA 3M7GA 2VODA 5E18F 5DCFA 5ICGA 5F64A 2J5OA 5HOOA 5LGNA 1QNTA 3V8JA 4M72A 5D5VB 2PJPA 4MTEA 1J7KA 1K78A 2BGCA 1FP2A 3HYIA 4RAZA 4AVPA 2GWRA 3CUQC 1FSEA 1YW7A 2EFNA 1R1TA 2XASA 2GQQA 3P9CA 1OYIA 2G7UA 2XKPA 4KNYA 4HQEA 2V1XA 2Y48A 1W4MA 2E1CA 3JSOA 4M9XA 1IN5A 3BPXA 4WXDA 1ZREA 2E1NA 4G7OF 1KU9A 5LEKA 1PUEE 2EB7A 3Q5FA 3TO9A 2QUFA 1G3WA 2EV0A 1BIBA 2CW0F 1D5VA 3FMRA 2UWMA 3DQVC 3RJPA 1J0RA 1EV7A 4EGZA 4HV6A 2KIUA 1HKSA 4L9NA 4RAYA 2NRAC 4BXUA 2OD5A 5D6FA 3WGGA 5DD8A 1FWZA 4ZZLA 3WE2A 2NNYA 4RGRA 2F5DA 3TGNA 1WKMA 2EFPA 2MH9A 2Z33A 2STTA 5H6RA 2VT3A 1K6OA 3V7CA 3P7NA 1LVAA 2GA2A 4ZYEA 1OKRA 1F9NA 2FU4A 1SMTA 1G4DA 5HDNA 1V3FA 2HOEA 2P6TA 1P4AA 1ZLKA 3JSPA 1P4WA 3HUGA 1IRFA 1HSTA 2RGVA 3KZZA 2ZFWA 1YS7A 1YLFA 2A3SA 5DCMA 4UNOA 1KYZA 2WC2A 4WCGA 2G7HA 5CLSA 1FLIA 3ISPA 4HX4A 1OMIA 4B8XA 1B4AA 1ULYA 3R6SA 5H20A 2Z5UA 2W25A 4U7BA 1Q1HA 2QENA 3K0LA 1TQIA 2QWWA 4Q4ZF 4TV7A 1BC7C 1QZYA 4UVBA 3LA7A 4WX9A 2Y0MA 1XSDA 2CWEA 4HX8A 3FWEA 4P9FA 2MLGA 3DKWA 5CVJA 3LA3A 4OU0A 4O3MA 1CF7A 4O5VA 6PAXA 1XGNA 2WTEA 4M71A 3COAC 2V1UA 1R36A 4FT8A 4LG0A 4AIJA 4MTDA 2EJRA 2JPBA 2LKPA 4Y17A 4PCQA 3GF2A 4R1HA 1USSA 3HHHA 5JFRA 1F5TA 2ELHA 1U5TC 2GXBA 2YR2A 3SZTA 3MCZA 3WG9A 3W6JB 4S04A 1Z6TA 2KJCA 3FXUA 4LMYA 3GEZA 3TDUC 1DP7P 2ZMEB 2NS0A 3V7RA 3HOSA 2X4HA 3O2PE 3RKYA 3M9AA 3BY6A 3E5QA 3ZMSA 4XSXF 4CO8A 2UXNA 4IRHA 1I1GA 3ZP5A 5K5QA 2QBYB 2RVCA 2BEOA 2KKOA 3K1PA 2M87A 1R7JA 2P6SA 4HQMA 4I02A 5J8CA 2HYFA 3IKTA 4BHBA 4QLCU 3ZMUA 5E8IA 1ON1A 1ZHFA 1W7PD 3ZQ7A 4U0VA 3VFZA 3JW4A 1S29A 1ON2A 2H6CA 3ABUA 4RB3C 3L09A 1LQ1A 3T5XA 1U78A 4WXCA 4ENKA 5FO5A 3HSFA 2XAGA 3GFLA 4EM2A 4NHJA 3L00A 4DQ2A 3WODF 4WF2A 2XHKA 2P4WA 4IVNA 4BHPA 4B09A 5DV5A 4GXOA 4L9TA 2LDUA 4R8HA 2FRHA 1XN7A 4AD9A 1QO0D 5IT9Z 5E1XA 3HRUA 4OIPF 2W84A 5D8KB 1PDNC 3R0AA 4A12A 2W57A 4I98B 5J8FA 4EJTA 1IRGA 1E17A 2FOKA 3CTAA 5FLXZ 1O7LA 1XCVA 3CDHA 3J80K 2EFWA 1MKMA 3F6VA 1EH6A 3ZMDA 2BV6A 1KQ8A 5D6EA 2A68F 4IRIA 2XROA 1S7AA 5JVTA 2V6CA 3HTUA 3RPQA 4P5OA 1IN7A 4IHTA 5E8GA 2ACJA 1W7PA 1QPMA 4Y13A 2F5CA 1ZG3A 2H94A 4Z2YA 2CGPA 4A6DA 2OAZA 2FMYA 4L18B 2EV5A 3CLOA 3IKVA 1OPCA 5ICCA 1TTYA 2STWA 3FF5A 4Q5SF 3HSRA 1RI7A 1I1SA 4M9ZA 1ZARA 5AONA 1U6GA 1YO5C 2COMA 5A2QZ 4U7DA 3J7AO 1G3SA 2MC3A 2XGXA 2K4JA 4KIBA 3JAMZ 4G7ZF 1SD4A 3IWZA 4EJOA 5DUIA 2QVOA 3ECHA 1SD6A 5L3FA 3MAJA 4P55A 1TLHB 4HA8A 2LSOA 3I59B 2B0LA 2DI3A 2DLLA 1OYWA 2E7XA 5HLIA 4LLLA 5ILVA 4YIFA 3EDPA 3U1DA 3Q9VA 1QGPA 3F3XA 4GCVA 4HDVA 4KDPA 1KU7A 2DBBA 1S8NA 2VXZA 3IC7A 1W5TA 2O3FA 3O3KA 4L5JA 2MBFA 1E2XA 1NHAA 1LDKB 1G3YA 1DPUA 4A6EA 4ZYDA 3LA2A 3G73A 5HS8A 4MQVA 3FZVA 2Q2EA 5LRSA 2BBYA 4HF0A 3H3ZA 3L7WA 4ENNA 2DU9A 1YTYA 3WTVC 2V79A 1U2WA 1OYYA 2IVMA 3LAPA 3RYPA 3QAHA 3TQNA 1HW2A 1TNTA 3KLNA 4YFKF 1LEBA 3F8MA 3BDDA 4M73A 4I0AA 3GO5A 4XRFA 5KVRA 3WTTC 3O6BB 1JXSA 5LBQA 3Q9SA 5ICEA 5E20A 3B73A 2ISZA 4JK1X 5IT9K 1FC3A 2L4AA 4OINF 2KJBA 3D0SA 4MHGA 3SZPA 2QLZA 3VODA 2E7WA 5CVRA 3J81Z 4NB5A 2D45A 5LGUA 3F8BA 5FLXK 3DFGA 5FD6A 2XV4S 1KQ0A 1XDUA 4G94A 1MDMA 5CJ9A 4L9JA 4PDKA 2HEOA 2PQ8A 1I5ZA 3GZ6A 2A6EF 4I2OA 4LLGF 1B59A 4D0PA 2DT5A 3BPVA 1ZG1A 1SMYF 1BOAA 1KU2A 2PMHA 4OMZA 2CQKA 3F22A 3QRFF 3U9GA 1KQ9A 2XAHA 2VC1A 2H09A 2HGCA 2HYGD 5ILSA 1EH7A 2MH2A 1Z9CA 5DUKA 3MEXA 1S6LA 4MEYF 1Z7UA 3WU1B 5LLQA 4UUVA 4O6JA 1Y0UA 1XGSA 2H6BA 3I71A 2GAUA 3K69A 3EETA 2W85A 2EWNA 4I7HA 2M1BA 4IF4A 4A5MA 5ILUA 3LFKA 3BJAA 3GX4X 4AWXB 1YG2A 3ZN1A 2VOPA 4M6XA 4M74A 5A2QK 4RGUA 3IL2A 3HIFA 4Q48A 4WK8F 4G9YA 2GZWA 1Z91A 5L3DA 3JAMK 5FGMA 3HRMA 2A07F 3I54A 2OA4A 2QQBA 3JTHA 4MNUA 3BROA 3WTYC 4BQAA 1YQAA 2M8EA 2HTSA 3U2RA 1I27A 1KYWA 3I64A 2YPRA 4KICA 3CUQB 2HTJA 4UXNA 1FT9A 4DNCA 3IRQA 1QZZA 4N9HA 2FMLA 3T8TA 5KK1A 3PFIA 4ENMA 2XAJA 4RGSA 3ZMVA 3I0TA 1WSUA 2O61A 2YX4A 2AS5F 1G6NA 3MWMA 3I5UA 4MEXF 4AIKA 5J6XA 3S2WA 1U3EM 2PEXA 4RGXA 1YW8A 4FX4A 1OR7A 2FNAA 3E5XA 1P4XA 1X3UA 4G6DA 3BP8A 1IN8A 1YIOA 4BNCA 1DPRA 2FXAA 3FMQA 2BE5F 4HBLA 5FD5A 3WGHA 4KFCA 1A04A 3FMSA 1ZAOA 4HYEA 1BI1A 2F5FA 2XIGA 3VEPA 4UVAA 1REPC 1UB9A 3RKWA 1WRJA 1FSHA 4HX7A 3CO6C 1L3LA 2YSRA 3RKXA 4CDGA 2JTVA 3HRSA 1JHHA 1R58A 2TDXA 1J59A 4LB5A 3IHUA 4EMSA 4GO1A 3WGIA 5H6QA 3R4KA 3DXJF 2DPUA 4OOIA 5TJJA 3KP2A 2EA2A 2DK8A 1S3JA 5BPIA 2VC0A 3CJNA 4PGHA 4KMFA 1FY7A 3DPLC 2MLKA 1H9TA 3J81K 3E6DA 2OBPA 3N4MA 3M8EA 4LLNA 2DW4A 3F72A 3NRVA 3KP7A 4ZYHA 4N0BA 4ON0A 5L3EA 2HDCA 2FE3A 2PMUA 2PN6A 1LNWA 1F4KA 4IPAA 4H0EA 1FOKA 5L3CA 2NAZA 4F7ZA 2K4BA 2DQRA 3HRTA 2FQ3A 2JSCA 4YG2F 4MGRA 2HKOA 4KIFA 3V7SA 3H92A 3IRRA 1XMAA 2PLYA 4ZH4F 1SFUA 4A2UA 2HFHA 4MQ9F 3GXOA 3E97A 1O3RA 2Z9OA 3F8NA 1BM9A 2Q0OA 3ULQB 5BOXA 5ICFA 2ZMEA 2ZJ2A 3HOTA 1JGSA 2KIMA 3DEUA 3LSTA 2JT1A 1HXDA 1ZG5A 2CG4A 2P5KA 1R1UA 1ZH5A 2M5WA 4L0ZB 5LHIA 3TO7A 2AXLA 3EQLF 3GFIA 2QYOA 3TO6A 1U5TB 2QBYA 5K1YA 4L5IA 1UCRA 2CSOA 4BHCA 4ENJA 2P8TA 2IA0A 2ZO4A 3KZYA 3F8CA 3FM3A 3KETA 3LWFA 1LDJA 2GIVA 5LEJA 2F2EA 1FYMA 1TBXA 1IXCA 3LAJA 3M1EA 5BMZA 2XKOA 1ZN2A 3BJOA 2IRFG 5LRRA 2HS5A 4JQFA 3ABTA 2HZTA 2Z3YA 1FBUA 4KN7X 4BAYA 1ZLJA 4LJZF 1ZYRF 4EM0B 3GVAA 3DPTA 1T39A 1G3TA 1GVJA 1XSVA 5JHUA 1HBXG 4LD5A 2V1DA 1FBQA 5AIPA 2DK5A 3C1DA 5HDGA 1YYVA 2FEZA 1YS6A 1STZA 1J9IA 2WV0A 3VOEA 1T38A 4Q47A 3VB2A 1BC8C 3REOA 1ZRCA 4EVIA 5EEGA 3QP6A 4I01A 4GYGA 2K7LA 3P9IA 2DFIA 3E6BA 2P7CB 4OIQF 1TW3A 4PZJA 2VBXA 3C7JA 1HKQA 1Z6RA 2FF4A 4UV9A 5JR3A 5HS7A 1RZ4A 3EYYA 1R5GA 4ETSA 5DDGA 2MD5A 5L3BA 2EK5A 4HOBA 3QPTA 4EM1A 4L0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9G A;  2EA4 A;  5LHG A;  2HQN A;  1GXP A;  3HSE A;  3GWZ A;  1AWC A;  1IF1 A;  1K78 B;  2O03 A;  2RQP A;  2DO7 A;  4HLY A;  3I4P A;  1FBS A;  2L54 A;  1MJB A;  2OQR A;  2GA1 A;  4KIG A;  3ZPL A;  2CFX A;  4GGG A;  2VBY A;  4UV8 A;  2G9W A;  5FB2 A;  1QBJ A;  1R00 A;  3QPH A;  4YFN F;  1P2F A;  5D8L B;  4XLN F;  1ZGJ A;  1HKT A;  2VE8 A;  1IZ1 A;  1T0F A;  5D5W B;  1WQ2 A;  1MJ9 A;  4R79 A;  2HWV A;  3V4G A;  3I59 A;  4UVC A;  1IW7 F;  2CO5 A;  4CIC A;  4G6Q A;  3MQ0 A;  1R22 A;  2PI0 A;  1S7O A;  1LB2 A;  2FBK A;  4WXH A;  1GHC A;  1XGO A;  5HLG A;  5CYV A;  2PBI A;  3RTR A;  3KEQ A;  4OMY A;  3F21 A;  2D1V A;  1FP1 D;  3KEO A;  2DPD A;  4M9S A;  5F6F A;  4FX0 A;  4XLP F;  3GFM A;  1HQC A;  3QOP A;  2IP2 A;  5LGT A;  2HKX A;  1SFE A;  2WWY A;  3L9F A;  4HLX A;  2VN2 A;  2R3S A;  2Z99 A;  2FBH A;  3E6M A;  5E1W A;  3QU3 A;  1TNS A;  1FYK A;  4M6Y A;  4A0Y A;  2OZU A;  1R5H A;  1ZGA A;  3GFJ A;  1HSJ A;  1V4R A;  2EFO A;  2NYX A;  2PFB A;  1C0W A;  4EJV A;  1ONV A;  5HLH A;  1XCB A;  5DCM B;  3KE2 A;  1UFM A;  3HHG A;  3BOQ A;  1UHW A;  4IXA A;  2V9V A;  4YII A;  1HW5 A;  4LGW A;  3R0J A;  1WWX A;  3R60 A;  1FNN A;  1XD7 A;  1RIO H;  1BI2 A;  1TQP A;  3TDZ C;  3FHZ A;  3L2C A;  1FZP B;  3TKY A;  3W6K B;  1O3T A;  3HTS B;  1TW2 A;  2DQL A;  4S05 A;  4CGZ A;  2CYY A;  4FHT A;  5DYM A;  1R1V A;  1XMK A;  2ZKZ A;  2RDP A;  1T98 A;  4L9V A;  2Y75 A;  3H3U A;  1SD5 A;  4QWQ A;  4HF1 A;  1BIA A;  4UHT A;  3OOP A;  1EH8 A;  4BYY A;  2OZ6 A;  3J80 Z;  4I0B A;  1CF7 B;  2FSW A;  1SFX A;  2PG4 A;  3AAF A;  4I09 A;  3ROU A;  1FYL A;  4IHS A;  4LG0 B;  2DTR A;  3K9T A;  2P5L C;  2MA3 A;  4LK0 F;  3M8F A;  1LEA A;  1IN4 A;  5ED4 A;  3GUD A;  2JRT A;  1J75 A;  5D4R A;  2ADU A;  4P96 A;  4RB2 C;  3SHF A;  3TOB A;  4OIR F;  1UST A;  1JE8 A;  1ZRF A;  4U88 A;  1K79 A;  1CGP A;  1O3Q A;  3SXY A;  1D3Y A;  2VBW A;  4PGG A;  5HDK A;  2EV6 A;  2XUB A;  2A5Y B;  3ELK A;  5F1R A;  3KP5 A;  2K86 A;  1PP8 F;  1DUX C;  4LK1 F;  2RN7 A;  4AIH A;  2D1H A;  4CZZ A;  1AOY A;  2YX7 A;  2HQR A;  2J5P A;  4G7H F;  1RNL A;  1SAX A;  3DV8 A;  4BH9 A;  1FPQ A;  3FXR A;  5DD4 A;  2EFQ A;  2XRN A;  2ZNZ A;  5LHH A;  4EV0 A;  4XSZ F;  2UXX A;  3SQN A;  5BPD A;  3B02 A;  4N9I A;  2VBZ A;  2FNP A;  3DP7 A;  4K2E A;  3IWF A;  2Q8K A;  5HVQ C;  2K27 A;  3CUQ A;  5ERI A;  3RI4 A;  4XBF A;  4EJW A;  5D5X B;  2L3D A;  5K5R A;  4KA4 A;  1O3S A;  2X0L A;  3RPU A;  3JTG A;  2QQ9 A;  2RV8 A;  2DAO A;  4Y15 A;  2LF7 A;  5CVI A;  1D8J A;  1U8R A;  3KCC A;  4EJU A;  2L4M A;  4IJA A;  2M30 A;  1H0M A;  1SD7 A;  5CVV A;  3RDI A;  1BI0 A;  2VT2 A;  4HF2 A;  2IA2 A;  2JPC A;  4KMU X;  3LQR A;  3WTW C;  4KN4 X;  3CO7 C;  3MZY A;  1HW1 A;  1K7A A;  3P9K A;  3ML6 A;  2A6H F;  3PQK A;  1T6S A;  4KUM A;  3GW2 A;  5TRD A;  1DDN A;  4NQW A;  5D5U B;  4E70 A;  2A61 A;  1XSX A;  1YFH A;  4ESJ A;  3WTZ A;  2ISY A;  2RKH A;  2XAF A;  5IT3 A;  3TOA A;  4LFU A;  2FBI A;  1UHM A;  1RUO A;  2YU3 A;  5HS9 A;  4HW0 A;  1F1Z A;  2O6G E;  3MZH A;  2P7V B;  2IA1 A;  3KLO A;  1ODD A;  1W7P B;  2FA5 A;  3GLX A;  3C18 A;  3FX3 A;  4ESB A;  3N97 A;  2BYV E;  3F8F A;  3KP3 A;  3T0Y A;  4ZYG A;  1B9N A;  1RUN A;  3ECO A;  2ETH A;  2P5V A;  2C6Y A;  2JZY A;  3V8L A;  2O8X A;  3T1B A;  4ASN A;  1I6X A;  5JI6 A;  5CVU A;  1PP7 U;  2LNB A;  4KYW A;  3WTS C;  1VTN C;  3DF8 A;  3I58 A;  4HV5 A;  1Z05 A;  5FFZ A;  2R7D A;  3EUH A;  2W24 A;  4EGY A;  1KA8 A;  3WTU C;  3D5L A;  5BQT A;  2LF8 A;  1YW9 A;  2A69 F;  2ESH A;  2KIF A;  2ZCW A;  1IXS B;  3KP6 A;  2QM3 A;  2ZNY A;  4LB6 B;  4CHU A;  1LDD A;  3ZMT A;  1D8K A;  4EQQ A;  1BN5 A;  1Z1D A;  3ZN0 A;  3QP5 A;  4A5N A;  1FX7 A;  2QQA A;  3MFK A;  1ZRD A;  2VE9 A;  4A0X A;  3GYH X;  5D4S A;  4ZZD A;  5E1Z B;  3BZ6 A;  3BWG A;  1J5Y A;  3F23 A;  2OQG A;  1B9M A;  2ZBK A;  1GXQ A;  2RC4 A;  1BI3 A;  2XVC A;  2OU2 A;  5L3G A;  3KFW X;  2HR3 A;  1IXR C;  3I53 A;  1O7F A;  1U5T A;  4IRG A;  2IPQ X;  3KP4 A;  5FFX A;  1R23 A;  2O0Y A;  1MJA A;  3CUO A;  3OV8 A;  1WI9 A;  4P9U A;  2VON A;  3FXQ A;  2F5E A;  5AIQ A;  3WE3 A;  3ZMZ A;  1MD0 A;  2L01 A;  3T8R A;  3QU6 A;  3LQQ A;  1JHF A;  2IW5 A;  3GZ5 A;  2K02 A;  1B6A A;  4RS8 A;  3WU0 A;  3NQO A;  1L0O C;  1BBY A;  1W5S A;  4HZF A;  3G3Z A;  1J2X A;  2VOO A;  3RIR A;  4WWC A;  2UZK A;  1XDS A;  3PQJ A;  3K1N A;  3RYR A;  2QZ8 A;  1P6R A;  2M45 A;  4U0Y A;  2RNJ A;  1O57 A;  1IUY A;  3FM5 A;  2IJL A;  4JBA A;  5BS6 A;  4HAM A;  4YFX F;  2ZXJ A;  2R7F A;  1P92 A;  3F6O A;  3K1M A;  3ERE D;  4A0Z A;  2KRF A;  4CXF A;  3E5U A;  5EEH A;  4G8X A;  1BJA A;  4HDU A;  2D2W A;  3NEU A;  5K5O A;  2H27 A;  5DEQ A;  1XB4 A;  1MDM B;  3EYI A;  3E3V A;  4ESF A;  4GYI A;  1XGM A;  1KU3 A;  2NNN A;  4CYD A;  2GXG A;  1B1B A;  4OIO F;  1LJ9 A;  2ESN A;  2L02 A;  1IN6 A;  3C3W A;  3E6C C;  2XAQ A;  5E17 F;  1QQI A;  1MGT A;  3SFZ A;  3WTX C;  2IT0 A;  1KGS A;  3K2Z A;  1TQM A;  4KT5 C;  4RB1 A;  3BJ6 A;  4RB0 A;  3R61 A;  4U0W A;  1MZB A;  3V8K A;  1IAW A;  1T2K A;  3M7G A;  2VOD A;  5E18 F;  5DCF A;  5ICG A;  5F64 A;  2J5O A;  5HOO A;  5LGN A;  1QNT A;  3V8J A;  4M72 A;  5D5V B;  2PJP A;  4MTE A;  1J7K A;  1K78 A;  2BGC A;  1FP2 A;  3HYI A;  4RAZ A;  4AVP A;  2GWR A;  3CUQ C;  1FSE A;  1YW7 A;  2EFN A;  1R1T A;  2XAS A;  2GQQ A;  3P9C A;  1OYI A;  2G7U A;  2XKP A;  4KNY A;  4HQE A;  2V1X A;  2Y48 A;  1W4M A;  2E1C A;  3JSO A;  4M9X A;  1IN5 A;  3BPX A;  4WXD A;  1ZRE A;  2E1N A;  4G7O F;  1KU9 A;  5LEK A;  1PUE E;  2EB7 A;  3Q5F A;  3TO9 A;  2QUF A;  1G3W A;  2EV0 A;  1BIB A;  2CW0 F;  1D5V A;  3FMR A;  2UWM A;  3DQV C;  3RJP A;  1J0R A;  1EV7 A;  4EGZ A;  4HV6 A;  2KIU A;  1HKS A;  4L9N A;  4RAY A;  2NRA C;  4BXU A;  2OD5 A;  5D6F A;  3WGG A;  5DD8 A;  1FWZ A;  4ZZL A;  3WE2 A;  2NNY A;  4RGR A;  2F5D A;  3TGN A;  1WKM A;  2EFP A;  2MH9 A;  2Z33 A;  2STT A;  5H6R A;  2VT3 A;  1K6O A;  3V7C A;  3P7N A;  1LVA A;  2GA2 A;  4ZYE A;  1OKR A;  1F9N A;  2FU4 A;  1SMT A;  1G4D A;  5HDN A;  1V3F A;  2HOE A;  2P6T A;  1P4A A;  1ZLK A;  3JSP A;  1P4W A;  3HUG A;  1IRF A;  1HST A;  2RGV A;  3KZZ A;  2ZFW A;  1YS7 A;  1YLF A;  2A3S A;  5DCM A;  4UNO A;  1KYZ A;  2WC2 A;  4WCG A;  2G7H A;  5CLS A;  1FLI A;  3ISP A;  4HX4 A;  1OMI A;  4B8X A;  1B4A A;  1ULY A;  3R6S A;  5H20 A;  2Z5U A;  2W25 A;  4U7B A;  1Q1H A;  2QEN A;  3K0L A;  1TQI A;  2QWW A;  4Q4Z F;  4TV7 A;  1BC7 C;  1QZY A;  4UVB A;  3LA7 A;  4WX9 A;  2Y0M A;  1XSD A;  2CWE A;  4HX8 A;  3FWE A;  4P9F A;  2MLG A;  3DKW A;  5CVJ A;  3LA3 A;  4OU0 A;  4O3M A;  1CF7 A;  4O5V A;  6PAX A;  1XGN A;  2WTE A;  4M71 A;  3COA C;  2V1U A;  1R36 A;  4FT8 A;  4LG0 A;  4AIJ A;  4MTD A;  2EJR A;  2JPB A;  2LKP A;  4Y17 A;  4PCQ A;  3GF2 A;  4R1H A;  1USS A;  3HHH A;  5JFR A;  1F5T A;  2ELH A;  1U5T C;  2GXB A;  2YR2 A;  3SZT A;  3MCZ A;  3WG9 A;  3W6J B;  4S04 A;  1Z6T A;  2KJC A;  3FXU A;  4LMY A;  3GEZ A;  3TDU C;  1DP7 P;  2ZME B;  2NS0 A;  3V7R A;  3HOS A;  2X4H A;  3O2P E;  3RKY A;  3M9A A;  3BY6 A;  3E5Q A;  3ZMS A;  4XSX F;  4CO8 A;  2UXN A;  4IRH A;  1I1G A;  3ZP5 A;  5K5Q A;  2QBY B;  2RVC A;  2BEO A;  2KKO A;  3K1P A;  2M87 A;  1R7J A;  2P6S A;  4HQM A;  4I02 A;  5J8C A;  2HYF A;  3IKT A;  4BHB A;  4QLC U;  3ZMU A;  5E8I A;  1ON1 A;  1ZHF A;  1W7P D;  3ZQ7 A;  4U0V A;  3VFZ A;  3JW4 A;  1S29 A;  1ON2 A;  2H6C A;  3ABU A;  4RB3 C;  3L09 A;  1LQ1 A;  3T5X A;  1U78 A;  4WXC A;  4ENK A;  5FO5 A;  3HSF A;  2XAG A;  3GFL A;  4EM2 A;  4NHJ A;  3L00 A;  4DQ2 A;  3WOD F;  4WF2 A;  2XHK A;  2P4W A;  4IVN A;  4BHP A;  4B09 A;  5DV5 A;  4GXO A;  4L9T A;  2LDU A;  4R8H A;  2FRH A;  1XN7 A;  4AD9 A;  1QO0 D;  5IT9 Z;  5E1X A;  3HRU A;  4OIP F;  2W84 A;  5D8K B;  1PDN C;  3R0A A;  4A12 A;  2W57 A;  4I98 B;  5J8F A;  4EJT A;  1IRG A;  1E17 A;  2FOK A;  3CTA A;  5FLX Z;  1O7L A;  1XCV A;  3CDH A;  3J80 K;  2EFW A;  1MKM A;  3F6V A;  1EH6 A;  3ZMD A;  2BV6 A;  1KQ8 A;  5D6E A;  2A68 F;  4IRI A;  2XRO A;  1S7A A;  5JVT A;  2V6C A;  3HTU A;  3RPQ A;  4P5O A;  1IN7 A;  4IHT A;  5E8G A;  2ACJ A;  1W7P A;  1QPM A;  4Y13 A;  2F5C A;  1ZG3 A;  2H94 A;  4Z2Y A;  2CGP A;  4A6D A;  2OAZ A;  2FMY A;  4L18 B;  2EV5 A;  3CLO A;  3IKV A;  1OPC A;  5ICC A;  1TTY A;  2STW A;  3FF5 A;  4Q5S F;  3HSR A;  1RI7 A;  1I1S A;  4M9Z A;  1ZAR A;  5AON A;  1U6G A;  1YO5 C;  2COM A;  5A2Q Z;  4U7D A;  3J7A O;  1G3S A;  2MC3 A;  2XGX A;  2K4J A;  4KIB A;  3JAM Z;  4G7Z F;  1SD4 A;  3IWZ A;  4EJO A;  5DUI A;  2QVO A;  3ECH A;  1SD6 A;  5L3F A;  3MAJ A;  4P55 A;  1TLH B;  4HA8 A;  2LSO A;  3I59 B;  2B0L A;  2DI3 A;  2DLL A;  1OYW A;  2E7X A;  5HLI A;  4LLL A;  5ILV A;  4YIF A;  3EDP A;  3U1D A;  3Q9V A;  1QGP A;  3F3X A;  4GCV A;  4HDV A;  4KDP A;  1KU7 A;  2DBB A;  1S8N A;  2VXZ A;  3IC7 A;  1W5T A;  2O3F A;  3O3K A;  4L5J A;  2MBF A;  1E2X A;  1NHA A;  1LDK B;  1G3Y A;  1DPU A;  4A6E A;  4ZYD A;  3LA2 A;  3G73 A;  5HS8 A;  4MQV A;  3FZV A;  2Q2E A;  5LRS A;  2BBY A;  4HF0 A;  3H3Z A;  3L7W A;  4ENN A;  2DU9 A;  1YTY A;  3WTV C;  2V79 A;  1U2W A;  1OYY A;  2IVM A;  3LAP A;  3RYP A;  3QAH A;  3TQN A;  1HW2 A;  1TNT A;  3KLN A;  4YFK F;  1LEB A;  3F8M A;  3BDD A;  4M73 A;  4I0A A;  3GO5 A;  4XRF A;  5KVR A;  3WTT C;  3O6B B;  1JXS A;  5LBQ A;  3Q9S A;  5ICE A;  5E20 A;  3B73 A;  2ISZ A;  4JK1 X;  5IT9 K;  1FC3 A;  2L4A A;  4OIN F;  2KJB A;  3D0S A;  4MHG A;  3SZP A;  2QLZ A;  3VOD A;  2E7W A;  5CVR A;  3J81 Z;  4NB5 A;  2D45 A;  5LGU A;  3F8B A;  5FLX K;  3DFG A;  5FD6 A;  2XV4 S;  1KQ0 A;  1XDU A;  4G94 A;  1MDM A;  5CJ9 A;  4L9J A;  4PDK A;  2HEO A;  2PQ8 A;  1I5Z A;  3GZ6 A;  2A6E F;  4I2O A;  4LLG F;  1B59 A;  4D0P A;  2DT5 A;  3BPV A;  1ZG1 A;  1SMY F;  1BOA A;  1KU2 A;  2PMH A;  4OMZ A;  2CQK A;  3F22 A;  3QRF F;  3U9G A;  1KQ9 A;  2XAH A;  2VC1 A;  2H09 A;  2HGC A;  2HYG D;  5ILS A;  1EH7 A;  2MH2 A;  1Z9C A;  5DUK A;  3MEX A;  1S6L A;  4MEY F;  1Z7U A;  3WU1 B;  5LLQ A;  4UUV A;  4O6J A;  1Y0U A;  1XGS A;  2H6B A;  3I71 A;  2GAU A;  3K69 A;  3EET A;  2W85 A;  2EWN A;  4I7H A;  2M1B A;  4IF4 A;  4A5M A;  5ILU A;  3LFK A;  3BJA A;  3GX4 X;  4AWX B;  1YG2 A;  3ZN1 A;  2VOP A;  4M6X A;  4M74 A;  5A2Q K;  4RGU A;  3IL2 A;  3HIF A;  4Q48 A;  4WK8 F;  4G9Y A;  2GZW A;  1Z91 A;  5L3D A;  3JAM K;  5FGM A;  3HRM A;  2A07 F;  3I54 A;  2OA4 A;  2QQB A;  3JTH A;  4MNU A;  3BRO A;  3WTY C;  4BQA A;  1YQA A;  2M8E A;  2HTS A;  3U2R A;  1I27 A;  1KYW A;  3I64 A;  2YPR A;  4KIC A;  3CUQ B;  2HTJ A;  4UXN A;  1FT9 A;  4DNC A;  3IRQ A;  1QZZ A;  4N9H A;  2FML A;  3T8T A;  5KK1 A;  3PFI A;  4ENM A;  2XAJ A;  4RGS A;  3ZMV A;  3I0T A;  1WSU A;  2O61 A;  2YX4 A;  2AS5 F;  1G6N A;  3MWM A;  3I5U A;  4MEX F;  4AIK A;  5J6X A;  3S2W A;  1U3E M;  2PEX A;  4RGX A;  1YW8 A;  4FX4 A;  1OR7 A;  2FNA A;  3E5X A;  1P4X A;  1X3U A;  4G6D A;  3BP8 A;  1IN8 A;  1YIO A;  4BNC A;  1DPR A;  2FXA A;  3FMQ A;  2BE5 F;  4HBL A;  5FD5 A;  3WGH A;  4KFC A;  1A04 A;  3FMS A;  1ZAO A;  4HYE A;  1BI1 A;  2F5F A;  2XIG A;  3VEP A;  4UVA A;  1REP C;  1UB9 A;  3RKW A;  1WRJ A;  1FSH A;  4HX7 A;  3CO6 C;  1L3L A;  2YSR A;  3RKX A;  4CDG A;  2JTV A;  3HRS A;  1JHH A;  1R58 A;  2TDX A;  1J59 A;  4LB5 A;  3IHU A;  4EMS A;  4GO1 A;  3WGI A;  5H6Q A;  3R4K A;  3DXJ F;  2DPU A;  4OOI A;  5TJJ A;  3KP2 A;  2EA2 A;  2DK8 A;  1S3J A;  5BPI A;  2VC0 A;  3CJN A;  4PGH A;  4KMF A;  1FY7 A;  3DPL C;  2MLK A;  1H9T A;  3J81 K;  3E6D A;  2OBP A;  3N4M A;  3M8E A;  4LLN A;  2DW4 A;  3F72 A;  3NRV A;  3KP7 A;  4ZYH A;  4N0B A;  4ON0 A;  5L3E A;  2HDC A;  2FE3 A;  2PMU A;  2PN6 A;  1LNW A;  1F4K A;  4IPA A;  4H0E A;  1FOK A;  5L3C A;  2NAZ A;  4F7Z A;  2K4B A;  2DQR A;  3HRT A;  2FQ3 A;  2JSC A;  4YG2 F;  4MGR A;  2HKO A;  4KIF A;  3V7S A;  3H92 A;  3IRR A;  1XMA A;  2PLY A;  4ZH4 F;  1SFU A;  4A2U A;  2HFH A;  4MQ9 F;  3GXO A;  3E97 A;  1O3R A;  2Z9O A;  3F8N A;  1BM9 A;  2Q0O A;  3ULQ B;  5BOX A;  5ICF A;  2ZME A;  2ZJ2 A;  3HOT A;  1JGS A;  2KIM A;  3DEU A;  3LST A;  2JT1 A;  1HXD A;  1ZG5 A;  2CG4 A;  2P5K A;  1R1U A;  1ZH5 A;  2M5W A;  4L0Z B;  5LHI A;  3TO7 A;  2AXL A;  3EQL F;  3GFI A;  2QYO A;  3TO6 A;  1U5T B;  2QBY A;  5K1Y A;  4L5I A;  1UCR A;  2CSO A;  4BHC A;  4ENJ A;  2P8T A;  2IA0 A;  2ZO4 A;  3KZY A;  3F8C A;  3FM3 A;  3KET A;  3LWF A;  1LDJ A;  2GIV A;  5LEJ A;  2F2E A;  1FYM A;  1TBX A;  1IXC A;  3LAJ A;  3M1E A;  5BMZ A;  2XKO A;  1ZN2 A;  3BJO A;  2IRF G;  5LRR A;  2HS5 A;  4JQF A;  3ABT A;  2HZT A;  2Z3Y A;  1FBU A;  4KN7 X;  4BAY A;  1ZLJ A;  4LJZ F;  1ZYR F;  4EM0 B;  3GVA A;  3DPT A;  1T39 A;  1G3T A;  1GVJ A;  1XSV A;  5JHU A;  1HBX G;  4LD5 A;  2V1D A;  1FBQ A;  5AIP A;  2DK5 A;  3C1D A;  5HDG A;  1YYV A;  2FEZ A;  1YS6 A;  1STZ A;  1J9I A;  2WV0 A;  3VOE A;  1T38 A;  4Q47 A;  3VB2 A;  1BC8 C;  3REO A;  1ZRC A;  4EVI A;  5EEG A;  3QP6 A;  4I01 A;  4GYG A;  2K7L A;  3P9I A;  2DFI A;  3E6B A;  2P7C B;  4OIQ F;  1TW3 A;  4PZJ A;  2VBX A;  3C7J A;  1HKQ A;  1Z6R A;  2FF4 A;  4UV9 A;  5JR3 A;  5HS7 A;  1RZ4 A;  3EYY A;  1R5G A;  4ETS A;  5DDG A;  2MD5 A;  5L3B A;  2EK5 A;  4HOB A;  3QPT A;  4EM1 A;  4L0Y B; 
#chains in the Genus database with same CATH topology
 1H9G A;  2BW3 B;  2XGC A;  2EA4 A;  5LHG A;  2HQN A;  1GDT A;  3QWL A;  2JWT A;  5DS9 A;  3FKI J;  1GXP A;  5GTH C;  3FKJ A;  1ETO A;  2K40 A;  3HSE A;  3GWZ A;  1AWC A;  4LOC A;  4J19 A;  1IF1 A;  4PSW A;  1K78 B;  2M4K A;  2JA2 A;  2O03 A;  2KFD A;  2RQP A;  1QPI A;  2DO7 A;  4HLY A;  1EJ9 A;  1X2M A;  3BCB A;  3I4P A;  2E1M C;  2XAU A;  1FBS A;  2L54 A;  2O5R A;  2LP0 A;  1LVK A;  1LE8 B;  4ABZ A;  4BXF A;  1MJB A;  2OQR A;  2GA1 A;  4KIG A;  3ZPL A;  2CFX A;  5IP7 J;  4GGG A;  1TWC J;  2VBY A;  4UV8 A;  2G9W A;  2NVY J;  4FAS D;  5FB2 A;  1QBJ A;  1R00 A;  3GZN B;  4NUB A;  3K4C A;  4BS9 A;  3FXM A;  5EG0 B;  3QPH A;  4YFN F;  2HZD A;  1P2F A;  3D5R C;  2UUZ A;  3H36 A;  1X1A A;  5D8L B;  2V9K A;  2XF6 A;  4XLN F;  3WU2 C;  1ZGJ A;  4B4C A;  1HKT A;  4HST A;  4JX4 A;  3C2G A;  1WJE A;  2VE8 A;  5IOY A;  3CD6 I;  3ZQQ A;  1IZ1 A;  1T0F A;  1A6Q A;  1RKT A;  5KHD A;  1Z7L A;  3ZCO A;  5D5W B;  1MSF C;  2O8K A;  1WQ2 A;  1MJ9 A;  3BLY A;  4R79 A;  3K4B A;  2HWV A;  5M3F J;  3V4G A;  3I59 A;  4UVC A;  3M8J A;  3DU6 A;  1IW7 F;  2CO5 A;  2W48 A;  4CIC A;  4G6Q A;  3W2V A;  3MQ0 A;  1R22 A;  3S2D J;  2PI0 A;  1G8X A;  1S7O A;  3S1R J;  1LB2 A;  2BOL A;  2FBK A;  1OR7 C;  2DT7 B;  4WXH A;  1MMD A;  3X2Q H;  3CMM A;  4CCK A;  1U9N A;  1IUF A;  5EYR A;  4W97 A;  1UAA A;  3F0C A;  4D7M A;  1RET A;  1HLV A;  1GHC A;  4A3B J;  3L2W A;  2ICW G;  1XGO A;  5HLG A;  3IAS 2;  5CYV A;  1O4X A;  1WH5 A;  2F4M B;  2PBI A;  4UUS B;  3RTR A;  4IHV A;  3KEQ A;  4OMY A;  2BY2 A;  3F21 A;  1TT0 A;  2D1V A;  1FP1 D;  2JA6 J;  3OS2 A;  1PUF B;  3KEO A;  1JGG A;  2DPD A;  1D5Y A;  4M9S A;  4M6V A;  4JP0 A;  5F6F A;  1IV6 A;  3OR2 C;  4FX0 A;  4XLP F;  5B1A H;  1FMW A;  2E19 A;  2JA5 J;  2LD5 A;  1Z3Y A;  3FK7 A;  1MBH A;  3GFM A;  2XB0 X;  3L1P A;  4RLF A;  3TW7 A;  2CFO A;  2VIX A;  3OYB A;  1D1B A;  1HQC A;  3DCF A;  3QOP A;  2IP2 A;  5LGT A;  2HKX A;  1SFE A;  2ME6 A;  2FOW A;  1GLN A;  3L9F A;  2WWY A;  4HLX A;  4FCY A;  2VN2 A;  3M4O J;  3HUG B;  2R3S A;  2Z99 A;  5KCM A;  2DMQ A;  2FBH A;  3E6M A;  5E1W A;  3Q0V A;  3QU3 A;  1TNS A;  1FYK A;  4M6Y A;  1GT0 C;  4X6A J;  1X1C A;  2KRC A;  4A0Y A;  2CRG A;  4MO7 A;  4XR6 A;  2CH0 A;  2VAS A;  5J1R A;  2OZU A;  1R5H A;  4QPO A;  1ZGA A;  2BXY A;  3GFJ A;  1KZH A;  1HSJ A;  2IS6 A;  1V4R A;  2EFO A;  3S14 J;  2NYX A;  2PFB A;  1UMQ A;  1C0W A;  2VJJ A;  4EJV A;  1ONV A;  2M9H A;  5HLH A;  3UKG A;  2XC7 A;  1XCB A;  1R9T J;  5DCM B;  2KDZ A;  1VQ7 I;  3H9J A;  3KE2 A;  1UFM A;  9ANT A;  3HHG A;  3ABM H;  3BOQ A;  3PFY A;  1UHW A;  4IXA A;  2V9V A;  1XC5 A;  3OYC A;  1GV5 A;  4YII A;  1HW5 A;  3H35 A;  4LGW A;  3R0J A;  5E3N A;  1WWX A;  2DFF A;  3R60 A;  4IL6 C;  1FNN A;  1XD7 A;  1RIO H;  1BI2 A;  1T33 A;  1FTZ A;  1TQP A;  2R5Y B;  3TDZ C;  2O9L A;  2LY1 A;  3FHZ A;  3L2C A;  1FZP B;  2NS8 A;  3HPH A;  2BY0 A;  3TKY A;  5GAE J;  1NK3 P;  3OYE A;  3A01 B;  3W6K B;  1O3T A;  2HQA A;  3HTS B;  1TW2 A;  2DQL A;  1A6I A;  4OAY A;  4S05 A;  5IYC J;  4CGZ A;  2CYY A;  2GLO A;  4FHT A;  5DYM A;  1R1V A;  3DLL F;  1XMK A;  4YRV A;  2ZKZ A;  2RDP A;  1T98 A;  1KON A;  4L9V A;  2V6E A;  1WGX A;  3DEW A;  2LR8 A;  4AVZ A;  3H0G J;  2Y75 A;  1RR8 C;  1LFB A;  3H3U A;  2CS3 A;  1SD5 A;  5HOD A;  3CMY A;  4QWQ A;  1WHU A;  2JK3 A;  4HF1 A;  3TL4 X;  3K4N A;  1BIA A;  4UHT A;  3OOP A;  4M3D A;  4XON A;  3RPU D;  1EH8 A;  3ABL H;  4FTH A;  4BYY A;  2Y0S A;  5J40 A;  2OZ6 A;  4XLE A;  3ZQG A;  3J80 Z;  3CC2 I;  4I0B A;  1CF7 B;  2FSW A;  1SFX A;  2PG4 A;  5M5Y J;  3AAF A;  4I09 A;  3ROU A;  2ZME C;  4DJA A;  2LVS A;  1FYL A;  4IHS A;  4LG0 B;  2DTR A;  3K9T A;  2KZV A;  2P5L C;  3PJR A;  2MA3 A;  4LK0 F;  2XPW A;  3M8F A;  1IO2 A;  5M3M J;  2LG4 A;  1A5J A;  2VQG A;  1LEA A;  1IN4 A;  5ED4 A;  3K4J A;  3BG6 A;  1X1B A;  4QIW N;  3GUD A;  3CZ6 A;  2JRT A;  1X2N A;  2DTZ A;  4YEJ A;  5DM6 F;  1J75 A;  4E7K A;  5D4R A;  2ADU A;  4P96 A;  2K9L A;  1BR4 A;  3OS1 A;  4RB2 C;  3SHF A;  3TOB A;  3CJQ B;  2JA7 J;  2CJJ A;  3BT9 A;  4OIR F;  1UST A;  1JE8 A;  1ZRF A;  4U88 A;  1K79 A;  1CGP A;  1TWG J;  3M3Y J;  1O3Q A;  3SXY A;  1D3Y A;  2VBW A;  4PGG A;  5HDK A;  1LKX A;  2EV6 A;  3MKZ A;  4AID A;  4PUS A;  5FRM A;  2EZI A;  1PYV A;  4CUG A;  2XUB A;  5J1Y A;  1A31 A;  2A5Y B;  3ELK A;  5F1R A;  3KP5 A;  2K86 A;  3GTL J;  1PP8 F;  1P9Q C;  2KZG A;  4LIU A;  1DUX C;  4LK1 F;  2RN7 A;  4AIH A;  1ORK A;  2D1H A;  5HNH A;  4CZZ A;  2ECC A;  1JKP C;  1AOY A;  4MFD A;  2MSY A;  2YX7 A;  2HQR A;  2HDW A;  2J5P A;  2K5C A;  1WJF A;  4N4N B;  4G7H F;  1RNL A;  4XMY A;  1SAX A;  3HZJ A;  2JMW A;  3DV8 A;  4BH9 A;  5C4X J;  1FPQ A;  3FXR A;  4BAC A;  1MMS A;  3G2B A;  5DD4 A;  1VQL I;  2EFQ A;  2XRN A;  2ZNZ A;  1VQ9 I;  5LHH A;  4EV0 A;  3S8P A;  2DA6 A;  4XSZ F;  2UXX A;  3FXL A;  3SQN A;  5BPD A;  3B02 A;  5IYB J;  1Y56 A;  4Y7N J;  4N9I A;  2VBZ A;  2OV7 A;  2XF7 A;  1W1W E;  1U8B A;  1T8I A;  2PMZ A;  2FNP A;  3DP7 A;  4K2E A;  1UG2 A;  3IWF A;  2Q8K A;  5HVQ C;  2K27 A;  3DPU A;  3QOD A;  3CUQ A;  2DA7 A;  4A3M J;  4MLO A;  4XLF A;  3S15 J;  1IGN A;  5ERI A;  2HI3 A;  3RI4 A;  4MIM A;  4XBF A;  4EJW A;  2AQE A;  2B9S A;  3S1Q J;  5D5X B;  5LD2 C;  1MMA A;  2L3D A;  5K5R A;  4KA4 A;  1O3S A;  2X0L A;  3RPU A;  3JTG A;  2QQ9 A;  4BE2 A;  1SAN A;  2GM4 A;  1XG1 A;  2RV8 A;  4L5E A;  3OYG A;  2WB1 N;  3U1K A;  2DAO A;  3P5J A;  3LSM A;  4Y15 A;  1FOW A;  3S16 J;  2F4I A;  4XN0 A;  2LF7 A;  3BG5 A;  2Z16 A;  2ZB9 A;  5CVI A;  2B63 J;  1D8J A;  3CCR I;  1U8R A;  2LRD A;  3KCC A;  4EJU A;  2L4M A;  4NC6 A;  4PFO A;  1X19 A;  3FIS A;  4IJA A;  2M30 A;  1JUP A;  1H0M A;  2TCT A;  1SD7 A;  1R71 A;  5CVV A;  3RDI A;  1BI0 A;  2VT2 A;  3B6A A;  4RMN A;  3D1N I;  4HF2 A;  2IA2 A;  5KAI C;  2JPC A;  3DTK A;  4KMU X;  3CP2 A;  3LQR A;  2OUM A;  3WTW C;  2A5W A;  3V42 A;  4KN4 X;  1TWA J;  3CO7 C;  3MZY A;  1PVE A;  3DBR B;  3VYU B;  2MAB A;  2VKE A;  2CQ7 A;  4B43 A;  1HW1 A;  1K7A A;  2DMN A;  4CCO A;  3P9K A;  3ML6 A;  2WB1 A;  1WZ2 A;  2A6H F;  3OIQ A;  3PQK A;  2HVR A;  1T6S A;  4II3 A;  2R7X A;  4KUM A;  1VND A;  4XLA A;  5E3O A;  3HPG A;  3GW2 A;  5TRD A;  1N75 A;  3ZQC A;  1DDN A;  4NQW A;  5D5U B;  3MVP A;  1ZR4 A;  4E70 A;  2DMP A;  3OWT A;  2A61 A;  1XSX A;  1YFH A;  2DOA A;  4RAF A;  4ESJ A;  1LPQ A;  3WTZ A;  2ISY A;  2RKH A;  2XAF A;  3SJM A;  5IT3 A;  1WJB A;  3HJE A;  4D7N A;  3TOA A;  1V5F A;  2M0C A;  4LFU A;  2FBI A;  1UHM A;  4PSX A;  3B6C A;  1RUO A;  2YU3 A;  5HS9 A;  4HW0 A;  1F1Z A;  2DMU A;  5EGO B;  2O6G E;  3MZH A;  2P7V B;  2IA1 A;  1R4N B;  3KLO A;  2AHQ A;  4DYQ A;  3CJR B;  3J7A Y;  1ODD A;  1W7P B;  2FA5 A;  3TW6 A;  3GLX A;  3C18 A;  3FX3 A;  4ESB A;  3OY9 A;  3N97 A;  1A36 A;  2BYV E;  2XGD A;  3DKY A;  3F8F A;  3IAM 2;  3KP3 A;  3T0Y A;  3FIW A;  4AUX A;  2DCE A;  4ZYG A;  1B9N A;  2LK2 A;  4F55 A;  1RUN A;  3VWB A;  3SYT A;  5JHF A;  3CMA I;  4HSR A;  1HCR A;  2E36 A;  3ECO A;  4IOA F;  1W36 C;  2YU9 J;  4C2U A;  4E4H A;  2ETH A;  3OSG A;  2PX9 A;  5GPC A;  2P5V A;  1VQO I;  4F93 B;  2C6Y A;  3N05 A;  2JZY A;  4EEF G;  3V8L A;  2O8X A;  3T1B A;  1MNM C;  4ASN A;  1I6X A;  5JI6 A;  5CVU A;  1PP7 U;  3H3V K;  1YJ9 I;  1T0F C;  4X1E A;  2LNB A;  4KYW A;  1I6H J;  3ZXS A;  3WTS C;  2OTL I;  4C3J J;  2RAE A;  1VTN C;  2JVG A;  2KL4 A;  1ZGW A;  3DF8 A;  3I58 A;  1APL C;  1MNE A;  4HV5 A;  2K85 A;  2VB6 A;  1Y0N A;  1Z05 A;  3IH4 A;  5FFZ A;  2R7D A;  4FE7 A;  3EUH A;  2W24 A;  4EGY A;  2X1E A;  1KA8 A;  2FQ4 A;  2ID6 A;  3WTU C;  2HXO A;  2MYS A;  3C2H A;  3D5L A;  4DZJ A;  5BQT A;  2CV2 A;  2LF8 A;  4D5F A;  1YW9 A;  1TL8 A;  1XX5 A;  2A69 F;  2ESH A;  2KIF A;  4C30 A;  1QZE A;  4NDL A;  2ZCW A;  4XOP A;  1IXS B;  3KP6 A;  2QM3 A;  2ZNY A;  4CCN A;  4LB6 B;  4F52 A;  4CHU A;  1TT5 B;  1LDD A;  2EH3 A;  2X51 A;  3ZMT A;  5E3L A;  1D8K A;  4EQQ A;  2QSG X;  1BN5 A;  1Z1D A;  5C3E J;  3S3O A;  1JTX A;  3FXJ A;  3U21 A;  3IH2 A;  2ZXW H;  1XPX A;  3FXO A;  3ZN0 A;  2M3A A;  3QP5 A;  4A5N A;  1FX7 A;  2QQA A;  4B44 A;  5IP6 A;  4RA2 A;  1JUS A;  1YX5 A;  3SDB A;  3MFK A;  2WBM A;  4KT6 A;  1ZRD A;  2VE9 A;  4A0X A;  3GYH X;  4BXX J;  5D4S A;  4ZZD A;  5E1Z B;  3BZ6 A;  5FKN A;  3BWG A;  2QKL B;  3L2R A;  1OCP A;  1LFP A;  4BQQ A;  1J5Y A;  3F23 A;  2OQG A;  1K4S A;  1B9M A;  2ZBK A;  5JVG F;  1GXQ A;  2RC4 A;  1BI3 A;  4XOR A;  3A0H C;  2XVC A;  4CYC A;  4BDY A;  2OU2 A;  4PK4 A;  3PIO F;  5L3G A;  3KFW X;  2HR3 A;  1IXR C;  3I53 A;  3FBN B;  2XB5 A;  1O7F A;  3CF5 F;  2E35 A;  4BJ5 C;  4Z6Y A;  1U5T A;  4IRG A;  2IPQ X;  2I5U A;  3RQI A;  4RAG A;  3KP4 A;  5FFX A;  1R23 A;  2DA4 A;  2O0Y A;  3HEF A;  1MJA A;  2IGK A;  2RQQ A;  3CUO A;  2Q2E B;  3OV8 A;  3I4M J;  1WI9 A;  4P9U A;  2VON A;  2Y9Y A;  3A02 A;  2F5E A;  3FXQ A;  5AIQ A;  4DBQ A;  2KQR A;  1YJW I;  3WE3 A;  3ZMZ A;  1BW6 A;  1MD0 A;  2VQL A;  2JSP A;  2L01 A;  3T8R A;  4V2G A;  3QU6 A;  3LQQ A;  2E2H J;  2NVX J;  1JHF A;  2IW5 A;  3GZ5 A;  2K02 A;  4AM3 A;  1B6A A;  3G71 I;  4RS8 A;  3WU0 A;  3NQO A;  1L0O C;  3PNT A;  1EKE A;  3JRF A;  2LKX A;  4B1R A;  2HYJ A;  1BBY A;  2VXD A;  1W5S A;  5J3L A;  4HZF A;  3G3Z A;  4BQN A;  1GVD A;  1AHD P;  1J2X A;  3SDG A;  1TP4 A;  2VOO A;  3RIR A;  3CCS I;  4WWC A;  3KYL A;  2UZK A;  1XDS A;  3PQJ A;  2X6X A;  3K1N A;  4DGW B;  4F3Q A;  3OS0 A;  2QA4 I;  3RYR A;  2QZ8 A;  1QHH D;  4GFB A;  1P6R A;  2M45 A;  3GCM A;  4U0Y A;  2RNJ A;  1B8I A;  1VZ0 A;  1O57 A;  2AXT C;  3PUB A;  1IUY A;  3FM5 A;  2IJL A;  2X6Y A;  4JBA A;  4B47 A;  1Z67 A;  1HDP A;  3W2W A;  2X85 A;  3RSN A;  4HAM A;  4YFX F;  2ZXJ A;  5BS6 A;  2R7F A;  2IS2 A;  4PJL A;  1X3Z B;  1P92 A;  3O8H A;  3F6O A;  3K1M A;  3ERE D;  5C44 J;  4A0Z A;  1K6Y A;  2OCE A;  2KRF A;  4CXF A;  2MW8 A;  2EPF A;  3BR5 A;  3HKZ A;  3E5U A;  5EEH A;  1S5L C;  4G8X A;  1BJA A;  4HDU A;  1MSE C;  1R6R A;  2D2W A;  3NEU A;  5K5O A;  1W5C C;  4UB8 C;  1DU6 A;  2H27 A;  5DEQ A;  3OR1 C;  4NBQ A;  1XB4 A;  1MDM B;  3EYI A;  3E3V A;  1IV8 A;  1QA6 A;  4ESF A;  2I8D A;  3F9K A;  1S9H A;  4GYI A;  1XGM A;  1KU3 A;  1TZL A;  2NNN A;  2GXG A;  2VJ5 A;  4CYD A;  1UJ8 A;  4ZTJ A;  1B1B A;  4OIO F;  3QOE A;  4QPQ A;  1LJ9 A;  2ID3 A;  2ESN A;  2L02 A;  2Z1D A;  2NVU B;  1IN6 A;  1NG6 A;  3W6V A;  2DN0 A;  3C3W A;  3E6C C;  3E7L A;  1K4T A;  1ZKG A;  2XAQ A;  5E17 F;  3GME A;  2UV1 A;  1QQI A;  3K4M A;  1MGT A;  3JCU C;  3SFZ A;  3WTX C;  1EA3 A;  3J7Y J;  2IT0 A;  1KGS A;  3K2Z A;  1E3O C;  2VKD A;  1TQM A;  1ZTR A;  4KT5 C;  2IXS A;  4RB1 A;  3BJ6 A;  2VQC A;  1WI3 A;  2MC4 A;  4RB0 A;  5IYD J;  3R61 A;  3BR0 A;  2R0Q C;  2VPL A;  3ASO H;  4U0W A;  1MMN A;  2VUM J;  1MZB A;  3V8K A;  1IAW A;  4H4K C;  3OYJ A;  1T2K A;  4B3X A;  2ZJP F;  2LOO A;  4JX5 A;  4BQO A;  3M7G A;  2VOD A;  3CJT B;  2ZXH A;  5E18 F;  2BW3 A;  5DCF A;  2ELJ A;  5F64 A;  5ICG A;  5IY5 H;  2J5O A;  5HOO A;  5LGN A;  1QNT A;  1V5G A;  3V8J A;  3WHC A;  5H2F C;  3S3N A;  3OYF A;  4DYC A;  5CQE A;  3TBI A;  2VQH A;  4M72 A;  3HOZ J;  5D5V B;  3OYD A;  2PJP A;  4MTE A;  1J7K A;  3HC7 A;  1K78 A;  2BGC A;  2QEX I;  1FP2 A;  3HYI A;  1OIS A;  2DT6 A;  4RAZ A;  4AVP A;  2GWR A;  1SFK A;  3CUQ C;  1FSE A;  3KZI C;  2G0E A;  1YW7 A;  2EFN A;  1LE8 A;  1R1T A;  2XAS A;  3H9G A;  5K7F A;  4ANJ A;  5J4V A;  2GQQ A;  3P9C A;  4BE1 A;  1DP3 A;  1OYI A;  4CSW A;  2R7W A;  2G7U A;  2XKP A;  2EIN H;  4CA0 A;  4KNY A;  4HQE A;  3M07 A;  2V1X A;  2Y48 A;  1W4M A;  4ZC3 A;  4NC7 A;  5GAG J;  5EG0 A;  2B7E A;  2E1C A;  3JSO A;  4M9X A;  5CKT A;  2A05 A;  3BTL A;  4UB6 C;  1IN5 A;  3BPX A;  1NTC A;  5BNG A;  4WXD A;  3IP4 B;  4JX6 A;  1ZRE A;  2R7T A;  1YIJ I;  4HNV A;  2E1N A;  4G7O F;  4A3C J;  1KU9 A;  5LEK A;  1PUE E;  2HU9 A;  3A1Y A;  2E1M B;  1D0Y A;  1JI8 A;  3JRA A;  2EB7 A;  3VSL A;  3Q5F A;  3TO9 A;  1FJL A;  2QUF A;  1G3W A;  2EV0 A;  4XKW A;  1BIB A;  4CZC A;  4XK4 A;  2W1O A;  2CW0 F;  4UY8 I;  1D5V A;  3FMR A;  3LOC A;  2UWM A;  2VI6 A;  3DEE A;  4II2 A;  3DTI A;  4XKB A;  2R7S A;  3DQV C;  2L0K A;  2Y0S N;  3RJP A;  1T95 A;  3OYA A;  1J0R A;  2X9D A;  1EV7 A;  3MMY B;  4EGZ A;  4HV6 A;  2EQR A;  1VQN I;  2KIU A;  1HKS A;  4L9N A;  4RAY A;  4LG3 A;  2NRA C;  4BXU A;  1I39 A;  2OD5 A;  5E79 C;  5D6F A;  5JLW A;  2VPR A;  1PJR A;  3WGG A;  4UUS A;  3LSH A;  5DD8 A;  1U9O A;  1FWZ A;  1OCR H;  2E1O A;  4ZZL A;  2CV1 A;  3WE2 A;  2NNY A;  4RGR A;  3PO3 J;  3S1N J;  2F5D A;  2NXN B;  3TGN A;  1PUF A;  1WKM A;  2EFP A;  2MH9 A;  3LSP A;  2Z33 A;  1T56 A;  5C4J J;  2XF5 A;  2STT A;  1WJC A;  5H6R A;  2VT3 A;  2PJR B;  2LRE A;  1K6O A;  2COB A;  3V7C A;  1Y1V J;  2GBY A;  1X1D A;  3OOU A;  3P7N A;  1LVA A;  2GA2 A;  1BR1 A;  4ZYE A;  1OKR A;  4BE0 A;  1F9N A;  4ZDO A;  4J00 A;  5GPA A;  2FU4 A;  3ZRG A;  2ME0 A;  2R7Q A;  1SMT A;  1G4D A;  2DYS H;  5HDN A;  1V3F A;  1MBK A;  2HOE A;  2P6T A;  1P4A A;  2KHM A;  1ZLK A;  3JSP A;  1P4W A;  5EZG A;  2H1L A;  3HUG A;  3LMM A;  1IRF A;  5F0C A;  2R5Z B;  3OL3 A;  3SZG A;  2XDV A;  1HST A;  4Y3O A;  3S32 A;  4P1W A;  1FOX A;  3HL2 A;  2RGV A;  3CCL I;  4G12 A;  3OYH A;  2KT0 A;  2R7V A;  3GTQ J;  1SVO A;  3KZZ A;  2DJN A;  1JJ6 C;  2ZFW A;  1VQM I;  1YS7 A;  3I9V 2;  2WAF A;  3SEQ A;  4ZDL A;  1YLF A;  2A3S A;  5DCM A;  4UNO A;  4E7L A;  1KYZ A;  2EIJ H;  3LSI A;  2WC2 A;  4U87 A;  4N4O B;  4WCG A;  2G7H A;  5CLS A;  1FLI A;  3ISP A;  4QTR A;  4HX4 A;  3EUH C;  1OMI A;  3QYB A;  4B8X A;  1Q1V A;  2NOG A;  3CC4 I;  3BQY A;  1B4A A;  1DGR M;  3QPL A;  1RC9 A;  2QSF X;  3OSF A;  1ULY A;  3EUK L;  2PMZ N;  4KJZ A;  2V26 A;  1OCZ H;  3R6S A;  2R5Y A;  5H20 A;  2LFB A;  2Z5U A;  3A01 A;  2CQN A;  2K9Q A;  2I10 A;  2W25 A;  4D5C A;  4XNF A;  1Q1H A;  4U7B A;  1EF4 A;  2QEN A;  3K0L A;  4E7J A;  2H8W A;  1TQI A;  3UR3 C;  5HNF A;  2QWW A;  4Q4Z F;  4TV7 A;  1BC7 C;  2NVT J;  2LLK A;  1RRJ A;  1ACI A;  1V55 H;  1QZY A;  4UVB A;  4XID A;  2NVQ J;  3LA7 A;  4E7H A;  2Y69 H;  4WX9 A;  1ETV A;  5EDN A;  2Y0M A;  1XSD A;  1ZQ3 P;  2CWE A;  1QU3 A;  3LSK A;  4HX8 A;  3FWE A;  1AKH B;  4P9F A;  2QGU A;  5TGT A;  2MLG A;  3ABK H;  4BY1 J;  3DKW A;  5CVJ A;  5CQG A;  1VQ4 I;  3LA3 A;  4OU0 A;  4O3M A;  1G59 A;  1CF7 A;  2DXI A;  4O5V A;  6PAX A;  1XGN A;  2WTE A;  4LIT A;  4M71 A;  3COA C;  2VJ4 A;  2V1U A;  3H5N A;  1R36 A;  4FT8 A;  4OAZ A;  4LG0 A;  2EZL A;  3MN2 A;  4AIJ A;  1XTA A;  5LFA A;  4MTD A;  1H89 C;  1F36 A;  3DWL E;  2EJR A;  2JPB A;  4XM3 A;  2LKP A;  5KNL A;  4IO9 F;  1S7E A;  3MD2 A;  2VKH A;  4A3K J;  4Y17 A;  4PCQ A;  3GF2 A;  4R1H A;  1USS A;  2XPU A;  3HHH A;  5JFR A;  1VQ8 I;  5B66 C;  2WY8 Q;  2O7O A;  1F5T A;  2ELH A;  1U5T C;  1V5E A;  4NC8 A;  1IRX A;  2GXB A;  2YR2 A;  2IGM A;  3SZT A;  2OC6 A;  3MCZ A;  4XOT A;  3WG9 A;  3W6J B;  4S04 A;  3OYN A;  4A3E J;  1Z6T A;  2KJC A;  3FXU A;  4LMY A;  3GEZ A;  4MFE A;  3TDU C;  1DP7 P;  2OJE D;  2ZME B;  2IS1 A;  3HG9 A;  2NS0 A;  2L9N A;  3V7R A;  3HOS A;  2X4H A;  2L5Q A;  1Z3X A;  2CW8 A;  3O2P E;  3RKY A;  2OCC H;  3WG7 H;  1VF9 A;  3M9A A;  3SFI A;  4XRS G;  3KPH A;  1SFO J;  3BY6 A;  3E5Q A;  4J01 A;  2DOF A;  3ZMS A;  1NG7 A;  4XSX F;  4CO8 A;  2ZJR F;  3HOU J;  2UXN A;  1QHG A;  4DBR A;  3OYM A;  4IRH A;  1I1G A;  3ZP5 A;  4ZDP A;  5K5Q A;  2QBY B;  2RVC A;  3QPS A;  2BEO A;  3E1S A;  1YRN B;  2KKO A;  4D9J A;  3K1P A;  5J1U A;  1W0U A;  2M87 A;  1K83 J;  2CQQ A;  1R7J A;  2P6S A;  4HQM A;  4I02 A;  5J8C A;  2HYF A;  3IKT A;  3EUA A;  1YX3 A;  4BHB A;  3IH3 A;  1IJW C;  4QLC U;  1V54 H;  3ZMU A;  5E8I A;  1ON1 A;  1ZHF A;  1W7P D;  3I55 I;  3ZQ7 A;  4U0V A;  5F0H A;  1WJA A;  3VFZ A;  3JW4 A;  2V7F A;  1S29 A;  1ON2 A;  2H6C A;  3ABU A;  4RB3 C;  2W00 A;  5TIS C;  1LFU P;  3KEY A;  3L09 A;  4B48 A;  2K9M A;  1LQ1 A;  4F92 B;  1BJZ A;  3T5X A;  3L2U A;  2QQ8 A;  1U78 A;  2IEK A;  1JKO C;  4WXC A;  4ENK A;  3CCE I;  2KRH A;  2VKV A;  5FO5 A;  2M4G A;  3CDL A;  3HSF A;  4E7Z A;  2XAG A;  3GFL A;  4EM2 A;  1OLT A;  4NHJ A;  3L00 A;  4DQ2 A;  3WOD F;  4WF2 A;  3W2A A;  4QSH A;  3OMY A;  3HGG A;  2XHK A;  2P4W A;  4IVN A;  3KX2 A;  1F43 A;  3K7A J;  4BHP A;  4B09 A;  5DV5 A;  4GXO A;  3BTI A;  3GTK J;  4FET A;  4G6T B;  4L9T A;  3TP3 A;  1GUU A;  3GTO J;  4GDF A;  2LDU A;  2N8G A;  4R8H A;  2F5V A;  3CF2 A;  2FRH A;  1XN7 A;  1ZK8 A;  1QO0 D;  4AD9 A;  3I4N J;  4C3I J;  5IT9 Z;  5GP9 A;  4BJT A;  2R4G A;  5E1X A;  3HRU A;  1P7J A;  3AG4 H;  3VYT B;  2XSD C;  3HOX J;  4C2T A;  2W84 A;  3HB9 A;  5D8K B;  4B3A A;  4KIS A;  1PDN C;  4OIP F;  1I50 J;  3R0A A;  4A12 A;  2DA2 A;  2W57 A;  4I98 B;  5J8F A;  2EBI A;  4EJT A;  1FTT A;  1IRG A;  1Z21 A;  3ZR8 X;  1E17 A;  2FOK A;  3LSJ A;  3CTA A;  2DOD A;  5FLX Z;  2GOX B;  1MMG A;  2E2I J;  1O7L A;  1XCV A;  2DA5 A;  3Q3S A;  3CDH A;  2R7Z J;  3J80 K;  3JRD A;  2EFW A;  1R5I D;  1MKM A;  2ZC2 A;  3I3L A;  3F6V A;  2CQX A;  3ZQI A;  1E3H A;  2KIQ A;  4FIS A;  1A35 A;  3AL0 C;  1EH6 A;  1OJL A;  3AFH A;  2BVM A;  3ZMD A;  2BV6 A;  3PL8 A;  1KQ8 A;  2GOM A;  5D6E A;  2A68 F;  4IRI A;  2EIM H;  4FQG A;  2XRO A;  4BBR J;  1S7A A;  1RPW A;  2LKS A;  2E60 A;  5JVT A;  3IV5 A;  2K3P A;  2V6C A;  3HTU A;  3RPQ A;  4Y4R A;  3CCJ I;  1OCT C;  3HDD A;  5EGO A;  1NH3 A;  4P5O A;  3CDI A;  1IN7 A;  1U0J A;  4BEH B;  4IHT A;  5E8G A;  5B3S H;  2ACJ A;  4V19 K;  2LBF B;  2P0W A;  1W7P A;  1QPM A;  1SVL A;  2F5C A;  2L2O A;  4Y13 A;  3CCQ I;  2A6T A;  1ZG3 A;  5M5X J;  2H94 A;  1N25 A;  4Z2Y A;  5FRO A;  4E7S A;  2CGP A;  1BW5 A;  4A6D A;  3JRB A;  4YEL A;  2R7R A;  2OAZ A;  2FMY A;  4L18 B;  2EV5 A;  3CCY A;  1YI2 I;  3CLO A;  5FRN A;  2XRL A;  3IKV A;  5K7H A;  1OPC A;  5F1J A;  5ICC A;  1TTY A;  1BA5 A;  5GAH J;  4CCM A;  1SC7 A;  3CME I;  2STW A;  4AU7 A;  1Y6I A;  2XSJ C;  1TWF J;  3FF5 A;  4Q5S F;  3HSR A;  3NAR A;  1RI7 A;  1I1S A;  2M0M A;  3ASN H;  3DU5 A;  4M9Z A;  1ZAR A;  1OQY A;  5AON A;  1U6G A;  1YO5 C;  4RDU A;  3VSK A;  2COM A;  4RM3 A;  5A2Q Z;  4U7D A;  3J7A O;  1G3S A;  2MC3 A;  2XGX A;  1DU0 A;  2K4J A;  1ITY A;  2LY9 A;  4CCJ A;  3LSG A;  1VQ6 I;  4KIB A;  4IQ4 A;  1GV2 A;  3JAM Z;  5HLT A;  4G7Z F;  3G1M A;  1SD4 A;  1ETW A;  3IWZ A;  4EJO A;  3S3M A;  5DUI A;  4V2F A;  2QVO A;  1Z77 A;  3ECH A;  1SD6 A;  2BHZ A;  3HKZ N;  5L3F A;  2KIS A;  2R7U A;  4YIR X;  5K7Z A;  3S93 A;  3MAJ A;  2ZFU A;  3CCU I;  3K70 D;  4P55 A;  1TLH B;  2F6C A;  4HA8 A;  2KPM A;  2LSO A;  3I59 B;  1Y8R B;  2DDA A;  2B0L A;  4IX7 A;  3JRI A;  4PJJ A;  2DI3 A;  4A3I J;  4ZTF A;  2Q1Z B;  4DYR A;  2CU7 A;  4PJM A;  2DLL A;  3HM5 A;  2BXZ A;  4Y33 A;  2JN6 A;  1OYW A;  2E7X A;  2WAQ A;  5HLI A;  4LLL A;  5ILV A;  3FXK A;  4IZZ A;  4YIF A;  2KMU A;  3PO2 J;  3MKY B;  3EDP A;  3U1D A;  3K4K A;  3Q9V A;  1QGP A;  3F3X A;  1DQU A;  4GCV A;  4HDV A;  4KDP A;  1KU7 A;  2DBB A;  3VPR A;  1S8N A;  3H1C A;  2OTJ I;  2JA8 J;  2VXZ A;  3IC7 A;  3JRG A;  2V9P A;  1W5T A;  2O3F A;  2YS9 A;  3O3K A;  2K9N A;  4L5J A;  2JUC A;  2Y2Z A;  2F4O B;  2MBF A;  1E2X A;  1NHA A;  1LDK B;  1G3Y A;  4NNJ A;  1SVM A;  2CUJ A;  4JYK A;  4HPQ A;  1JT0 A;  1JTY A;  1DPU A;  4A6E A;  5E3M A;  3QYE A;  4ZYD A;  3LA2 A;  3G73 A;  5HS8 A;  3DLA A;  2HDD A;  1WCM J;  4MQV A;  3MKL A;  3FZV A;  3C2B A;  4BY7 J;  2JQ7 A;  2Q2E A;  2QKM B;  5LRS A;  2K3F A;  2BBY A;  4HF0 A;  4AYB A;  3H3Z A;  3L7W A;  1D0X A;  4ENN A;  2DU9 A;  3GBG A;  1QRY A;  2QSH X;  4HNT A;  1XMX A;  1YTY A;  2V4J C;  3WTV C;  2V79 A;  4E7I A;  4E6K G;  1U2W A;  1D0Z A;  1OYY A;  2IVM A;  5F0F A;  3LAP A;  1ETQ A;  5JLX A;  3S1M J;  4PJ0 C;  3KYC B;  1VFC A;  3RYP A;  3QAH A;  3TQN A;  1HW2 A;  1TNT A;  2LY2 A;  1G2H A;  3K4L A;  1M1E B;  3A0B C;  3KLN A;  4CCL A;  3OIP A;  1YJN I;  1SEU A;  2WV1 A;  2CW7 A;  3GTJ J;  1RES A;  3BR3 A;  4YFK F;  2LTP A;  1LEB A;  1HDD C;  1IG7 A;  2Z2S B;  3F8M A;  1UHS A;  5IOZ A;  1JKR C;  3BDD A;  4RLQ A;  4M73 A;  1IDZ A;  4I0A A;  3GO5 A;  3H5R A;  4XRF A;  5EEA A;  2EZH A;  5KVR A;  1RKW A;  1MBJ A;  3WTT C;  3LL7 A;  3O6B B;  1JXS A;  5LBQ A;  1WFX A;  3Q9S A;  5ICE A;  5KAF C;  2WAE A;  2EIK H;  3NWS A;  3BZC A;  2L9R A;  2E34 A;  4BJ6 C;  5E20 A;  3PSI A;  3B73 A;  2ISZ A;  4A93 J;  1BL0 A;  4JK1 X;  2D5V A;  4A69 C;  3G6E I;  5IT9 K;  4F91 B;  3J7Z I;  1FC3 A;  2L4A A;  3L2Q A;  4OIN F;  2KJB A;  3D0S A;  1ERD A;  3RZD J;  4MHG A;  3SZP A;  2QLZ A;  3G1O A;  2DYR H;  3VOD A;  2R7O A;  1BR2 A;  4D1Q A;  3FK6 A;  1R49 A;  2E7W A;  5CVR A;  1VI0 A;  3J81 Z;  4NB5 A;  2D45 A;  2HOA A;  5LGU A;  3F8B A;  1YOV B;  3DKX A;  5FLX K;  1HF0 A;  3DFG A;  1Y1W J;  5FD6 A;  2XV4 S;  4IEJ A;  1OCC H;  1KQ0 A;  1XDU A;  4G94 A;  2K9S A;  4IKF A;  1MDM A;  5CJ9 A;  1MH4 A;  2DA3 A;  4L9J A;  4PDK A;  2HEO A;  2MG4 A;  3JRH A;  1T08 B;  2PQ8 A;  2W82 A;  1I5Z A;  3GZ6 A;  2A6E F;  4I2O A;  2GIZ A;  1UEL B;  2M8G X;  4LLG F;  3WHB A;  1I3Q J;  2FJ1 A;  1B59 A;  4D0P A;  1MBE A;  2DT5 A;  2NS7 A;  3BPV A;  2HVQ A;  4DZP A;  1ZG1 A;  1SMY F;  3BQZ A;  2MGQ A;  1BOA A;  3HBL A;  4PJN A;  1KU2 A;  2PMH A;  4OMZ A;  2CQK A;  3F22 A;  3ONQ A;  3ZQH A;  3QRF F;  3U9G A;  1ZEL A;  4M3F A;  1KQ9 A;  2XAH A;  4BKX A;  3S17 J;  3D5S C;  2VC1 A;  3RZO J;  4DW6 A;  2H09 A;  1WH7 A;  4BBS J;  4W1U A;  3HGY A;  2HGC A;  1FOY A;  3KIO A;  2HYG D;  5ILS A;  1EH7 A;  2MH2 A;  1Z9C A;  5DUK A;  4EAT A;  3ERM A;  4A3F J;  3MEX A;  3OL4 A;  1S6L A;  2BY1 A;  4MEY F;  1MBF A;  1Z7U A;  3ZGK A;  3QQA A;  2E71 A;  3WU1 B;  2E5Z A;  5LLQ A;  3W3C A;  4UUV A;  4O6J A;  1Y0U A;  1XGS A;  2DA1 A;  2H6B A;  2M2E A;  3PIP F;  3I71 A;  4PFP A;  3JR9 A;  2GAU A;  3RCO A;  3K69 A;  2V1N A;  3EET A;  1QVT A;  3FBI B;  2DOE A;  3SEZ A;  2M34 A;  2CMP A;  2W85 A;  1BOB A;  2EWN A;  2M1B A;  4I7H A;  4IF4 A;  4A5M A;  2LYC A;  3GTP J;  5ILU A;  3LFK A;  3BJA A;  3GX4 X;  4AWX B;  2RNG A;  1YG2 A;  3MKW B;  2HOS A;  3ZN1 A;  2VOP A;  4M6X A;  4M74 A;  3OYI A;  5A2Q K;  4M3G A;  4RGU A;  3IL2 A;  2RRE A;  4HG2 A;  3HIF A;  4Q48 A;  4WK8 F;  4G9Y A;  3CES A;  2GZW A;  1Z91 A;  3Q0W A;  5L3D A;  3I56 I;  1UZC A;  3JAM K;  1H88 C;  5FGM A;  3HRM A;  2A07 F;  3I54 A;  2IBD A;  2OA4 A;  3AG2 H;  2QQB A;  3JTH A;  1JJ8 C;  4C3H J;  3AG1 H;  4MNU A;  3BRO A;  1LUJ B;  3WTY C;  4GRI A;  2WAD A;  1YQA A;  1H8A C;  4BQA A;  2M8E A;  2HTS A;  3U2R A;  3ZQL A;  1I27 A;  4HNU A;  1KYW A;  3I64 A;  3CP8 A;  3QYF A;  2YPR A;  3OYK A;  1MIJ A;  4KIC A;  3HOY J;  1R4M B;  3CUQ B;  2HTJ A;  1VQK I;  4UUT A;  4UXN A;  1FT9 A;  2ECB A;  4DNC A;  3IRQ A;  4M3E A;  1N78 A;  2BHY A;  1QZZ A;  4N9H A;  5EZH A;  2FML A;  3T8T A;  5KK1 A;  3PFI A;  4ENM A;  2IAI A;  2XAJ A;  4RGS A;  2X1D A;  3ZMV A;  3BR1 A;  2HQ5 A;  2JRM A;  3I0T A;  3VYR B;  1WSU A;  2O61 A;  2YX4 A;  1E3P A;  1CQT A;  2AS5 F;  2H8R A;  3PNV A;  2P81 A;  4XL9 A;  1Z0X A;  3TMO A;  2M7B A;  1G6N A;  1YE9 A;  3EPZ A;  3MWM A;  3I5U A;  4I76 A;  2BY3 A;  3GLL A;  4MEX F;  3O8G A;  5J6X A;  4AIK A;  2VJI A;  4DOZ A;  3S2W A;  1U3E M;  2PEX A;  4RGX A;  1DGW Y;  1YW8 A;  4FX4 A;  2DDB A;  1OR7 A;  2FNA A;  3E5X A;  2PJR A;  1P4X A;  1X3U A;  3NWT A;  2Y31 A;  4G6D A;  3BP8 A;  2DFE A;  3IUO A;  1IN8 A;  5DTD A;  1YIO A;  4BNC A;  1NK2 P;  1DPR A;  2FXA A;  1ETK A;  2M7A A;  4RBO A;  1Y8Q B;  3FMQ A;  2BE5 F;  4HBL A;  2HPI A;  5FD5 A;  3WGH A;  4KFC A;  3CQZ J;  1A04 A;  4BUP A;  2NOJ B;  2DFH A;  3JRE A;  3FMS A;  1ZAO A;  4I99 C;  4NQW B;  1YHQ I;  4HYE A;  3ZOB A;  1BI1 A;  2R5Z A;  2F5F A;  2XIG A;  4IHW A;  3VEP A;  3PSF A;  3S2H J;  3CLQ A;  4UVA A;  3AKZ A;  1REP C;  1UB9 A;  3RKW A;  4XKV A;  1WRJ A;  1FSH A;  2ZJQ F;  4HX7 A;  3CO6 C;  3K6G A;  4CH7 A;  4FE4 A;  1L3L A;  1RR7 A;  2YSR A;  3RKX A;  4CDG A;  2JTV A;  3HRS A;  2QF7 A;  1JHH A;  1R58 A;  2TDX A;  1J59 A;  1E0E A;  2ELK A;  4LB5 A;  3IHU A;  4EMS A;  2ZSI B;  1WJ5 A;  4GO1 A;  3VYS B;  3WGI A;  5H6Q A;  3R4K A;  1YIT I;  3DXJ F;  3FHN A;  3Q0U A;  1X58 A;  4XLC A;  4AC0 A;  2DPU A;  4OOI A;  5TJJ A;  2IS4 A;  3KP2 A;  4ITV A;  3K2A A;  2Y30 A;  2EA2 A;  1VQP I;  2DK8 A;  3CCV I;  3GTM J;  1S3J A;  5BPI A;  2VC0 A;  1OFC X;  3CJN A;  4PGH A;  1J09 A;  3BR6 A;  2MD0 A;  4KMF A;  2R93 J;  1FY7 A;  3DPL C;  2HNH A;  2LC2 A;  2MLK A;  1H9T A;  4XKC A;  3J81 K;  3E6D A;  4XLH A;  2OBP A;  1ETX A;  3N4M A;  1WJD A;  3M8E A;  4LLN A;  2EZK A;  2DW4 A;  3F72 A;  3NRV A;  4RM2 A;  1FIP A;  3PNY A;  2KLO A;  3KP7 A;  2F48 A;  2FD5 A;  4ZYH A;  4BDZ A;  4N0B A;  4ON0 A;  5L3E A;  2HDC A;  2FE3 A;  1AKH A;  2ZXI A;  2AO9 A;  2CUZ A;  2KDO A;  1JT6 A;  2PMU A;  2PN6 A;  1LNW A;  4LIV A;  2EIL H;  3H9Q A;  3A4C A;  2L7F P;  1F4K A;  1OCO H;  1D1A A;  3OIO A;  2VL8 A;  4IPA A;  1JUM A;  1X1P A;  4H0E A;  1FOK A;  5L3C A;  1QVU A;  1WVR A;  2X6W A;  2NAZ A;  2X6O A;  2MFZ A;  2K4B A;  4F7Z A;  5FLV A;  3RQ4 A;  2DQR A;  3HRT A;  2FQ3 A;  2JSC A;  2L9V A;  4YG2 F;  2AQF A;  1K61 A;  5FKL A;  4MGR A;  2HKO A;  4KIF A;  3V7S A;  3TP0 A;  5FKK A;  3H92 A;  3IRR A;  1XMA A;  2BZT A;  2PLY A;  3DBH B;  4ZH4 F;  1SFU A;  2IGO A;  5FKO A;  4A2U A;  2HFH A;  4XRS A;  1IRZ A;  1IC8 A;  1TC3 C;  4MQ9 F;  3GXO A;  3E97 A;  1O3R A;  2DMT A;  3F8N A;  2Z9O A;  1BM9 A;  2TRT A;  2QCO A;  4IOC F;  2Q0O A;  3CCM I;  3ULQ B;  5BOX A;  5ICF A;  2ZME A;  2ZJ2 A;  3HOV J;  2JVH A;  3HOT A;  3A2K A;  1JGS A;  2KIM A;  3DEU A;  3LST A;  4ZYA A;  2IGN A;  3PUF A;  1AA7 A;  1SAU A;  2JT1 A;  1HXD A;  2FX0 A;  5B5E C;  1ZG5 A;  2CG4 A;  1HC8 A;  2P5K A;  1R1U A;  1ZH5 A;  2M5W A;  4CYC B;  4XRM A;  4L0Z B;  2X1C A;  1IDY A;  2LMD A;  2L7K A;  5LHI A;  3TO7 A;  2XGE A;  3BG3 A;  3VDX A;  4C2M J;  3G4S I;  2AXL A;  3EQL F;  4IHY A;  3GFI A;  3H0D A;  2JUG A;  1WPK A;  3HXL A;  2QYO A;  3BCA A;  2HXI A;  3TO6 A;  1U5T B;  2WY7 Q;  3FDY A;  2QBY A;  1YRN A;  5K1Y A;  4L5I A;  2X48 A;  2GXA A;  1UCR A;  3E0J B;  4A3L J;  2CSO A;  2DJI A;  1X4P A;  4BHC A;  4XIC A;  1VQ5 I;  4ENJ A;  1D1C A;  3CC7 I;  2P8T A;  2HPM A;  2Y9Z A;  1JKQ C;  2IA0 A;  2W4S A;  1HOM A;  2ZO4 A;  5FKM A;  3KZY A;  4IQJ A;  3F8C A;  3FM3 A;  3M1C A;  2LH9 A;  3KET A;  2W7N A;  2CUE A;  3MZ8 A;  2H1K A;  5F27 A;  2OPT A;  1B72 B;  3LWF A;  2KP6 A;  5F08 A;  3K70 C;  1LDJ A;  4A3J J;  1UG0 A;  2WA0 A;  3A03 A;  2GIV A;  3BTC A;  5LEJ A;  4C9Y A;  3RKQ A;  3HOW J;  4A3D J;  2F2E A;  3LNQ A;  1FYM A;  1TBX A;  1IXC A;  5IPA A;  2L7M P;  4ZJZ A;  5GTI C;  3KYD B;  2OF7 A;  3LAJ A;  3M1E A;  5BMZ A;  2CUF A;  5FLM J;  1I3A A;  2XKO A;  2R92 J;  1Y39 A;  1ZN2 A;  4OWR B;  4IHX A;  3BZK A;  4A3G J;  4Y52 J;  1S72 I;  1B8I B;  5GAD J;  2E2J J;  3BJO A;  1XS9 A;  2IRF G;  3ESW B;  5LRR A;  3BR2 A;  1W0T A;  2HS5 A;  3H5A A;  4JQF A;  4BGD A;  3ABT A;  4BU2 A;  1X4O A;  2HZT A;  4M3B A;  2Z3Y A;  1FBU A;  4X0G A;  4KN7 X;  4BAY A;  1ZLJ A;  2HVS A;  4LJZ F;  1W36 D;  1ZYR F;  4EM0 B;  1MBG A;  3GVA A;  2JJ7 A;  3DPT A;  3LSR A;  1T39 A;  1G3T A;  1GVJ A;  1XSV A;  5JHU A;  1HBX G;  4LD5 A;  5M5W J;  5EF6 A;  2V1D A;  5IP9 J;  3L2V A;  2FUG 2;  1FBQ A;  5AIP A;  4DIQ A;  2WAQ N;  3DBL B;  3AG3 H;  1P7I A;  2DK5 A;  3C1D A;  5HDG A;  2XPV A;  2HOT A;  4HRI A;  3TED A;  4JOM A;  1YYV A;  2FEZ A;  1YS6 A;  2CV0 A;  1STZ A;  1J9I A;  2WV0 A;  3VOE A;  1T38 A;  4Q47 A;  4XN3 A;  3NAU A;  3VB2 A;  2E5N A;  1FIA A;  3BC8 A;  3BTJ A;  5EJC A;  4S0H B;  1BC8 C;  3REO A;  1HA8 A;  2L7Z A;  1ZRC A;  1MW7 A;  2ZSH B;  3K10 A;  5B1B H;  4KIT B;  4EVI A;  5EEG A;  4HEA 2;  1TWH J;  3BG7 A;  5J47 A;  3QP6 A;  5F04 A;  5DM7 F;  3JRC A;  3ZQF A;  4I01 A;  5J4Y A;  4GYG A;  3UNG C;  2K7L A;  5FJ8 J;  3P9I A;  2DFI A;  5CPR B;  2L9S A;  1ETY A;  3DTE A;  3E6B A;  3PM1 A;  2P7C B;  4OIQ F;  1TW3 A;  1B72 A;  3G1L A;  4BL0 B;  4PZJ A;  2VBX A;  3C7J A;  1HKQ A;  4I6Z A;  3OYL A;  1Z6R A;  2FF4 A;  3LFU A;  4UV9 A;  5JR3 A;  1MND A;  4BEH A;  1AU7 A;  5HS7 A;  1POG A;  1RZ4 A;  3BG9 A;  2VLA A;  3EYY A;  2LBF A;  1ZR2 A;  3GTG J;  4AYB N;  1R5G A;  2YUS A;  1MH3 A;  4ETS A;  3AL0 B;  1FMV A;  1FEX A;  5DDG A;  2MD5 A;  5L3B A;  1ENH A;  2EK5 A;  4XQF A;  4HOB A;  2BVL A;  3QPT A;  4EM1 A;  1N77 A;  1X3W B;  4L0Y B; 
#chains in the Genus database with same CATH homology
 1H9G A;  2EA4 A;  5LHG A;  2HQN A;  1GXP A;  3HSE A;  3GWZ A;  1AWC A;  1IF1 A;  1K78 B;  2O03 A;  2RQP A;  2DO7 A;  4HLY A;  3I4P A;  1FBS A;  2L54 A;  1MJB A;  2OQR A;  2GA1 A;  4KIG A;  3ZPL A;  2CFX A;  4GGG A;  2VBY A;  4UV8 A;  2G9W A;  5FB2 A;  1QBJ A;  1R00 A;  3QPH A;  4YFN F;  1P2F A;  5D8L B;  4XLN F;  1ZGJ A;  1HKT A;  2VE8 A;  1IZ1 A;  1T0F A;  5D5W B;  1WQ2 A;  1MJ9 A;  4R79 A;  2HWV A;  3V4G A;  3I59 A;  4UVC A;  1IW7 F;  2CO5 A;  4CIC A;  4G6Q A;  3MQ0 A;  1R22 A;  2PI0 A;  1S7O A;  1LB2 A;  2FBK A;  4WXH A;  1GHC A;  1XGO A;  5HLG A;  5CYV A;  2PBI A;  3RTR A;  3KEQ A;  4OMY A;  3F21 A;  2D1V A;  1FP1 D;  3KEO A;  2DPD A;  4M9S A;  5F6F A;  4FX0 A;  4XLP F;  3GFM A;  1HQC A;  3QOP A;  2IP2 A;  5LGT A;  2HKX A;  1SFE A;  2WWY A;  3L9F A;  4HLX A;  2VN2 A;  2R3S A;  2Z99 A;  2FBH A;  3E6M A;  5E1W A;  3QU3 A;  1TNS A;  1FYK A;  4M6Y A;  4A0Y A;  2OZU A;  1R5H A;  1ZGA A;  3GFJ A;  1HSJ A;  1V4R A;  2EFO A;  2NYX A;  2PFB A;  1C0W A;  4EJV A;  1ONV A;  5HLH A;  1XCB A;  5DCM B;  3KE2 A;  1UFM A;  3HHG A;  3BOQ A;  1UHW A;  4IXA A;  2V9V A;  4YII A;  1HW5 A;  4LGW A;  3R0J A;  1WWX A;  3R60 A;  1FNN A;  1XD7 A;  1RIO H;  1BI2 A;  1TQP A;  3TDZ C;  3FHZ A;  3L2C A;  1FZP B;  3TKY A;  3W6K B;  1O3T A;  3HTS B;  1TW2 A;  2DQL A;  4S05 A;  4CGZ A;  2CYY A;  4FHT A;  5DYM A;  1R1V A;  1XMK A;  2ZKZ A;  2RDP A;  1T98 A;  4L9V A;  2Y75 A;  3H3U A;  1SD5 A;  4QWQ A;  4HF1 A;  1BIA A;  4UHT A;  3OOP A;  1EH8 A;  4BYY A;  2OZ6 A;  3J80 Z;  4I0B A;  1CF7 B;  2FSW A;  1SFX A;  2PG4 A;  3AAF A;  4I09 A;  3ROU A;  1FYL A;  4IHS A;  4LG0 B;  2DTR A;  3K9T A;  2P5L C;  2MA3 A;  4LK0 F;  3M8F A;  1LEA A;  1IN4 A;  5ED4 A;  3GUD A;  2JRT A;  1J75 A;  5D4R A;  2ADU A;  4P96 A;  4RB2 C;  3SHF A;  3TOB A;  4OIR F;  1UST A;  1JE8 A;  1ZRF A;  4U88 A;  1K79 A;  1CGP A;  1O3Q A;  3SXY A;  1D3Y A;  2VBW A;  4PGG A;  5HDK A;  2EV6 A;  2XUB A;  2A5Y B;  3ELK A;  5F1R A;  3KP5 A;  2K86 A;  1PP8 F;  1DUX C;  4LK1 F;  2RN7 A;  4AIH A;  2D1H A;  4CZZ A;  1AOY A;  2YX7 A;  2HQR A;  2J5P A;  4G7H F;  1RNL A;  1SAX A;  3DV8 A;  4BH9 A;  1FPQ A;  3FXR A;  5DD4 A;  2EFQ A;  2XRN A;  2ZNZ A;  5LHH A;  4EV0 A;  4XSZ F;  2UXX A;  3SQN A;  5BPD A;  3B02 A;  4N9I A;  2VBZ A;  2FNP A;  3DP7 A;  4K2E A;  3IWF A;  2Q8K A;  5HVQ C;  2K27 A;  3CUQ A;  5ERI A;  3RI4 A;  4XBF A;  4EJW A;  5D5X B;  2L3D A;  5K5R A;  4KA4 A;  1O3S A;  2X0L A;  3RPU A;  3JTG A;  2QQ9 A;  2RV8 A;  2DAO A;  4Y15 A;  2LF7 A;  5CVI A;  1D8J A;  1U8R A;  3KCC A;  4EJU A;  2L4M A;  4IJA A;  2M30 A;  1H0M A;  1SD7 A;  5CVV A;  3RDI A;  1BI0 A;  2VT2 A;  4HF2 A;  2IA2 A;  2JPC A;  4KMU X;  3LQR A;  3WTW C;  4KN4 X;  3CO7 C;  3MZY A;  1HW1 A;  1K7A A;  3P9K A;  3ML6 A;  2A6H F;  3PQK A;  1T6S A;  4KUM A;  3GW2 A;  5TRD A;  1DDN A;  4NQW A;  5D5U B;  4E70 A;  2A61 A;  1XSX A;  1YFH A;  4ESJ A;  3WTZ A;  2ISY A;  2RKH A;  2XAF A;  5IT3 A;  3TOA A;  4LFU A;  2FBI A;  1UHM A;  1RUO A;  2YU3 A;  5HS9 A;  4HW0 A;  1F1Z A;  2O6G E;  3MZH A;  2P7V B;  2IA1 A;  3KLO A;  1ODD A;  1W7P B;  2FA5 A;  3GLX A;  3C18 A;  3FX3 A;  4ESB A;  3N97 A;  2BYV E;  3F8F A;  3KP3 A;  3T0Y A;  4ZYG A;  1B9N A;  1RUN A;  3ECO A;  2ETH A;  2P5V A;  2C6Y A;  2JZY A;  3V8L A;  2O8X A;  3T1B A;  4ASN A;  1I6X A;  5JI6 A;  5CVU A;  1PP7 U;  2LNB A;  4KYW A;  3WTS C;  1VTN C;  3DF8 A;  3I58 A;  4HV5 A;  1Z05 A;  5FFZ A;  2R7D A;  3EUH A;  2W24 A;  4EGY A;  1KA8 A;  3WTU C;  3D5L A;  5BQT A;  2LF8 A;  1YW9 A;  2A69 F;  2ESH A;  2KIF A;  2ZCW A;  1IXS B;  3KP6 A;  2QM3 A;  2ZNY A;  4LB6 B;  4CHU A;  1LDD A;  3ZMT A;  1D8K A;  4EQQ A;  1BN5 A;  1Z1D A;  3ZN0 A;  3QP5 A;  4A5N A;  1FX7 A;  2QQA A;  3MFK A;  1ZRD A;  2VE9 A;  4A0X A;  3GYH X;  5D4S A;  4ZZD A;  5E1Z B;  3BZ6 A;  3BWG A;  1J5Y A;  3F23 A;  2OQG A;  1B9M A;  2ZBK A;  1GXQ A;  2RC4 A;  1BI3 A;  2XVC A;  2OU2 A;  5L3G A;  3KFW X;  2HR3 A;  1IXR C;  3I53 A;  1O7F A;  1U5T A;  4IRG A;  2IPQ X;  3KP4 A;  5FFX A;  1R23 A;  2O0Y A;  1MJA A;  3CUO A;  3OV8 A;  1WI9 A;  4P9U A;  2VON A;  3FXQ A;  2F5E A;  5AIQ A;  3WE3 A;  3ZMZ A;  1MD0 A;  2L01 A;  3T8R A;  3QU6 A;  3LQQ A;  1JHF A;  2IW5 A;  3GZ5 A;  2K02 A;  1B6A A;  4RS8 A;  3WU0 A;  3NQO A;  1L0O C;  1BBY A;  1W5S A;  4HZF A;  3G3Z A;  1J2X A;  2VOO A;  3RIR A;  4WWC A;  2UZK A;  1XDS A;  3PQJ A;  3K1N A;  3RYR A;  2QZ8 A;  1P6R A;  2M45 A;  4U0Y A;  2RNJ A;  1O57 A;  1IUY A;  3FM5 A;  2IJL A;  4JBA A;  5BS6 A;  4HAM A;  4YFX F;  2ZXJ A;  2R7F A;  1P92 A;  3F6O A;  3K1M A;  3ERE D;  4A0Z A;  2KRF A;  4CXF A;  3E5U A;  5EEH A;  4G8X A;  1BJA A;  4HDU A;  2D2W A;  3NEU A;  5K5O A;  2H27 A;  5DEQ A;  1XB4 A;  1MDM B;  3EYI A;  3E3V A;  4ESF A;  4GYI A;  1XGM A;  1KU3 A;  2NNN A;  4CYD A;  2GXG A;  1B1B A;  4OIO F;  1LJ9 A;  2ESN A;  2L02 A;  1IN6 A;  3C3W A;  3E6C C;  2XAQ A;  5E17 F;  1QQI A;  1MGT A;  3SFZ A;  3WTX C;  2IT0 A;  1KGS A;  3K2Z A;  1TQM A;  4KT5 C;  4RB1 A;  3BJ6 A;  4RB0 A;  3R61 A;  4U0W A;  1MZB A;  3V8K A;  1IAW A;  1T2K A;  3M7G A;  2VOD A;  5E18 F;  5DCF A;  5ICG A;  5F64 A;  2J5O A;  5HOO A;  5LGN A;  1QNT A;  3V8J A;  4M72 A;  5D5V B;  2PJP A;  4MTE A;  1J7K A;  1K78 A;  2BGC A;  1FP2 A;  3HYI A;  4RAZ A;  4AVP A;  2GWR A;  3CUQ C;  1FSE A;  1YW7 A;  2EFN A;  1R1T A;  2XAS A;  2GQQ A;  3P9C A;  1OYI A;  2G7U A;  2XKP A;  4KNY A;  4HQE A;  2V1X A;  2Y48 A;  1W4M A;  2E1C A;  3JSO A;  4M9X A;  1IN5 A;  3BPX A;  4WXD A;  1ZRE A;  2E1N A;  4G7O F;  1KU9 A;  5LEK A;  1PUE E;  2EB7 A;  3Q5F A;  3TO9 A;  2QUF A;  1G3W A;  2EV0 A;  1BIB A;  2CW0 F;  1D5V A;  3FMR A;  2UWM A;  3DQV C;  3RJP A;  1J0R A;  1EV7 A;  4EGZ A;  4HV6 A;  2KIU A;  1HKS A;  4L9N A;  4RAY A;  2NRA C;  4BXU A;  2OD5 A;  5D6F A;  3WGG A;  5DD8 A;  1FWZ A;  4ZZL A;  3WE2 A;  2NNY A;  4RGR A;  2F5D A;  3TGN A;  1WKM A;  2EFP A;  2MH9 A;  2Z33 A;  2STT A;  5H6R A;  2VT3 A;  1K6O A;  3V7C A;  3P7N A;  1LVA A;  2GA2 A;  4ZYE A;  1OKR A;  1F9N A;  2FU4 A;  1SMT A;  1G4D A;  5HDN A;  1V3F A;  2HOE A;  2P6T A;  1P4A A;  1ZLK A;  3JSP A;  1P4W A;  3HUG A;  1IRF A;  1HST A;  2RGV A;  3KZZ A;  2ZFW A;  1YS7 A;  1YLF A;  2A3S A;  5DCM A;  4UNO A;  1KYZ A;  2WC2 A;  4WCG A;  2G7H A;  5CLS A;  1FLI A;  3ISP A;  4HX4 A;  1OMI A;  4B8X A;  1B4A A;  1ULY A;  3R6S A;  5H20 A;  2Z5U A;  2W25 A;  4U7B A;  1Q1H A;  2QEN A;  3K0L A;  1TQI A;  2QWW A;  4Q4Z F;  4TV7 A;  1BC7 C;  1QZY A;  4UVB A;  3LA7 A;  4WX9 A;  2Y0M A;  1XSD A;  2CWE A;  4HX8 A;  3FWE A;  4P9F A;  2MLG A;  3DKW A;  5CVJ A;  3LA3 A;  4OU0 A;  4O3M A;  1CF7 A;  4O5V A;  6PAX A;  1XGN A;  2WTE A;  4M71 A;  3COA C;  2V1U A;  1R36 A;  4FT8 A;  4LG0 A;  4AIJ A;  4MTD A;  2EJR A;  2JPB A;  2LKP A;  4Y17 A;  4PCQ A;  3GF2 A;  4R1H A;  1USS A;  3HHH A;  5JFR A;  1F5T A;  2ELH A;  1U5T C;  2GXB A;  2YR2 A;  3SZT A;  3MCZ A;  3WG9 A;  3W6J B;  4S04 A;  1Z6T A;  2KJC A;  3FXU A;  4LMY A;  3GEZ A;  3TDU C;  1DP7 P;  2ZME B;  2NS0 A;  3V7R A;  3HOS A;  2X4H A;  3O2P E;  3RKY A;  3M9A A;  3BY6 A;  3E5Q A;  3ZMS A;  4XSX F;  4CO8 A;  2UXN A;  4IRH A;  1I1G A;  3ZP5 A;  5K5Q A;  2QBY B;  2RVC A;  2BEO A;  2KKO A;  3K1P A;  2M87 A;  1R7J A;  2P6S A;  4HQM A;  4I02 A;  5J8C A;  2HYF A;  3IKT A;  4BHB A;  4QLC U;  3ZMU A;  5E8I A;  1ON1 A;  1ZHF A;  1W7P D;  3ZQ7 A;  4U0V A;  3VFZ A;  3JW4 A;  1S29 A;  1ON2 A;  2H6C A;  3ABU A;  4RB3 C;  3L09 A;  1LQ1 A;  3T5X A;  1U78 A;  4WXC A;  4ENK A;  5FO5 A;  3HSF A;  2XAG A;  3GFL A;  4EM2 A;  4NHJ A;  3L00 A;  4DQ2 A;  3WOD F;  4WF2 A;  2XHK A;  2P4W A;  4IVN A;  4BHP A;  4B09 A;  5DV5 A;  4GXO A;  4L9T A;  2LDU A;  4R8H A;  2FRH A;  1XN7 A;  4AD9 A;  1QO0 D;  5IT9 Z;  5E1X A;  3HRU A;  4OIP F;  2W84 A;  5D8K B;  1PDN C;  3R0A A;  4A12 A;  2W57 A;  4I98 B;  5J8F A;  4EJT A;  1IRG A;  1E17 A;  2FOK A;  3CTA A;  5FLX Z;  1O7L A;  1XCV A;  3CDH A;  3J80 K;  2EFW A;  1MKM A;  3F6V A;  1EH6 A;  3ZMD A;  2BV6 A;  1KQ8 A;  5D6E A;  2A68 F;  4IRI A;  2XRO A;  1S7A A;  5JVT A;  2V6C A;  3HTU A;  3RPQ A;  4P5O A;  1IN7 A;  4IHT A;  5E8G A;  2ACJ A;  1W7P A;  1QPM A;  4Y13 A;  2F5C A;  1ZG3 A;  2H94 A;  4Z2Y A;  2CGP A;  4A6D A;  2OAZ A;  2FMY A;  4L18 B;  2EV5 A;  3CLO A;  3IKV A;  1OPC A;  5ICC A;  1TTY A;  2STW A;  3FF5 A;  4Q5S F;  3HSR A;  1RI7 A;  1I1S A;  4M9Z A;  1ZAR A;  5AON A;  1U6G A;  1YO5 C;  2COM A;  5A2Q Z;  4U7D A;  3J7A O;  1G3S A;  2MC3 A;  2XGX A;  2K4J A;  4KIB A;  3JAM Z;  4G7Z F;  1SD4 A;  3IWZ A;  4EJO A;  5DUI A;  2QVO A;  3ECH A;  1SD6 A;  5L3F A;  3MAJ A;  4P55 A;  1TLH B;  4HA8 A;  2LSO A;  3I59 B;  2B0L A;  2DI3 A;  2DLL A;  1OYW A;  2E7X A;  5HLI A;  4LLL A;  5ILV A;  4YIF A;  3EDP A;  3U1D A;  3Q9V A;  1QGP A;  3F3X A;  4GCV A;  4HDV A;  4KDP A;  1KU7 A;  2DBB A;  1S8N A;  2VXZ A;  3IC7 A;  1W5T A;  2O3F A;  3O3K A;  4L5J A;  2MBF A;  1E2X A;  1NHA A;  1LDK B;  1G3Y A;  1DPU A;  4A6E A;  4ZYD A;  3LA2 A;  3G73 A;  5HS8 A;  4MQV A;  3FZV A;  2Q2E A;  5LRS A;  2BBY A;  4HF0 A;  3H3Z A;  3L7W A;  4ENN A;  2DU9 A;  1YTY A;  3WTV C;  2V79 A;  1U2W A;  1OYY A;  2IVM A;  3LAP A;  3RYP A;  3QAH A;  3TQN A;  1HW2 A;  1TNT A;  3KLN A;  4YFK F;  1LEB A;  3F8M A;  3BDD A;  4M73 A;  4I0A A;  3GO5 A;  4XRF A;  5KVR A;  3WTT C;  3O6B B;  1JXS A;  5LBQ A;  3Q9S A;  5ICE A;  5E20 A;  3B73 A;  2ISZ A;  4JK1 X;  5IT9 K;  1FC3 A;  2L4A A;  4OIN F;  2KJB A;  3D0S A;  4MHG A;  3SZP A;  2QLZ A;  3VOD A;  2E7W A;  5CVR A;  3J81 Z;  4NB5 A;  2D45 A;  5LGU A;  3F8B A;  5FLX K;  3DFG A;  5FD6 A;  2XV4 S;  1KQ0 A;  1XDU A;  4G94 A;  1MDM A;  5CJ9 A;  4L9J A;  4PDK A;  2HEO A;  2PQ8 A;  1I5Z A;  3GZ6 A;  2A6E F;  4I2O A;  4LLG F;  1B59 A;  4D0P A;  2DT5 A;  3BPV A;  1ZG1 A;  1SMY F;  1BOA A;  1KU2 A;  2PMH A;  4OMZ A;  2CQK A;  3F22 A;  3QRF F;  3U9G A;  1KQ9 A;  2XAH A;  2VC1 A;  2H09 A;  2HGC A;  2HYG D;  5ILS A;  1EH7 A;  2MH2 A;  1Z9C A;  5DUK A;  3MEX A;  1S6L A;  4MEY F;  1Z7U A;  3WU1 B;  5LLQ A;  4UUV A;  4O6J A;  1Y0U A;  1XGS A;  2H6B A;  3I71 A;  2GAU A;  3K69 A;  3EET A;  2W85 A;  2EWN A;  4I7H A;  2M1B A;  4IF4 A;  4A5M A;  5ILU A;  3LFK A;  3BJA A;  3GX4 X;  4AWX B;  1YG2 A;  3ZN1 A;  2VOP A;  4M6X A;  4M74 A;  5A2Q K;  4RGU A;  3IL2 A;  3HIF A;  4Q48 A;  4WK8 F;  4G9Y A;  2GZW A;  1Z91 A;  5L3D A;  3JAM K;  5FGM A;  3HRM A;  2A07 F;  3I54 A;  2OA4 A;  2QQB A;  3JTH A;  4MNU A;  3BRO A;  3WTY C;  4BQA A;  1YQA A;  2M8E A;  2HTS A;  3U2R A;  1I27 A;  1KYW A;  3I64 A;  2YPR A;  4KIC A;  3CUQ B;  2HTJ A;  4UXN A;  1FT9 A;  4DNC A;  3IRQ A;  1QZZ A;  4N9H A;  2FML A;  3T8T A;  5KK1 A;  3PFI A;  4ENM A;  2XAJ A;  4RGS A;  3ZMV A;  3I0T A;  1WSU A;  2O61 A;  2YX4 A;  2AS5 F;  1G6N A;  3MWM A;  3I5U A;  4MEX F;  4AIK A;  5J6X A;  3S2W A;  1U3E M;  2PEX A;  4RGX A;  1YW8 A;  4FX4 A;  1OR7 A;  2FNA A;  3E5X A;  1P4X A;  1X3U A;  4G6D A;  3BP8 A;  1IN8 A;  1YIO A;  4BNC A;  1DPR A;  2FXA A;  3FMQ A;  2BE5 F;  4HBL A;  5FD5 A;  3WGH A;  4KFC A;  1A04 A;  3FMS A;  1ZAO A;  4HYE A;  1BI1 A;  2F5F A;  2XIG A;  3VEP A;  4UVA A;  1REP C;  1UB9 A;  3RKW A;  1WRJ A;  1FSH A;  4HX7 A;  3CO6 C;  1L3L A;  2YSR A;  3RKX A;  4CDG A;  2JTV A;  3HRS A;  1JHH A;  1R58 A;  2TDX A;  1J59 A;  4LB5 A;  3IHU A;  4EMS A;  4GO1 A;  3WGI A;  5H6Q A;  3R4K A;  3DXJ F;  2DPU A;  4OOI A;  5TJJ A;  3KP2 A;  2EA2 A;  2DK8 A;  1S3J A;  5BPI A;  2VC0 A;  3CJN A;  4PGH A;  4KMF A;  1FY7 A;  3DPL C;  2MLK A;  1H9T A;  3J81 K;  3E6D A;  2OBP A;  3N4M A;  3M8E A;  4LLN A;  2DW4 A;  3F72 A;  3NRV A;  3KP7 A;  4ZYH A;  4N0B A;  4ON0 A;  5L3E A;  2HDC A;  2FE3 A;  2PMU A;  2PN6 A;  1LNW A;  1F4K A;  4IPA A;  4H0E A;  1FOK A;  5L3C A;  2NAZ A;  4F7Z A;  2K4B A;  2DQR A;  3HRT A;  2FQ3 A;  2JSC A;  4YG2 F;  4MGR A;  2HKO A;  4KIF A;  3V7S A;  3H92 A;  3IRR A;  1XMA A;  2PLY A;  4ZH4 F;  1SFU A;  4A2U A;  2HFH A;  4MQ9 F;  3GXO A;  3E97 A;  1O3R A;  2Z9O A;  3F8N A;  1BM9 A;  2Q0O A;  3ULQ B;  5BOX A;  5ICF A;  2ZME A;  2ZJ2 A;  3HOT A;  1JGS A;  2KIM A;  3DEU A;  3LST A;  2JT1 A;  1HXD A;  1ZG5 A;  2CG4 A;  2P5K A;  1R1U A;  1ZH5 A;  2M5W A;  4L0Z B;  5LHI A;  3TO7 A;  2AXL A;  3EQL F;  3GFI A;  2QYO A;  3TO6 A;  1U5T B;  2QBY A;  5K1Y A;  4L5I A;  1UCR A;  2CSO A;  4BHC A;  4ENJ A;  2P8T A;  2IA0 A;  2ZO4 A;  3KZY A;  3F8C A;  3FM3 A;  3KET A;  3LWF A;  1LDJ A;  2GIV A;  5LEJ A;  2F2E A;  1FYM A;  1TBX A;  1IXC A;  3LAJ A;  3M1E A;  5BMZ A;  2XKO A;  1ZN2 A;  3BJO A;  2IRF G;  5LRR A;  2HS5 A;  4JQF A;  3ABT A;  2HZT A;  2Z3Y A;  1FBU A;  4KN7 X;  4BAY A;  1ZLJ A;  4LJZ F;  1ZYR F;  4EM0 B;  3GVA A;  3DPT A;  1T39 A;  1G3T A;  1GVJ A;  1XSV A;  5JHU A;  1HBX G;  4LD5 A;  2V1D A;  1FBQ A;  5AIP A;  2DK5 A;  3C1D A;  5HDG A;  1YYV A;  2FEZ A;  1YS6 A;  1STZ A;  1J9I A;  2WV0 A;  3VOE A;  1T38 A;  4Q47 A;  3VB2 A;  1BC8 C;  3REO A;  1ZRC A;  4EVI A;  5EEG A;  3QP6 A;  4I01 A;  4GYG A;  2K7L A;  3P9I A;  2DFI A;  3E6B A;  2P7C B;  4OIQ F;  1TW3 A;  4PZJ A;  2VBX A;  3C7J A;  1HKQ A;  1Z6R A;  2FF4 A;  4UV9 A;  5JR3 A;  5HS7 A;  1RZ4 A;  3EYY A;  1R5G A;  4ETS A;  5DDG A;  2MD5 A;  5L3B A;  2EK5 A;  4HOB A;  3QPT A;  4EM1 A;  4L0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...