2AS5F

Structure of the dna binding domains of nfat and foxp2 bound specifically to dna.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(TP*TP*AP*GP*GP*AP*AP*AP*AP*TP*TP*TP*GP*TP*TP*TP*CP*AP*T
publication title FOXP3 Controls Regulatory T Cell Function through Cooperation with NFAT.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 83
sequence length 83
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2as5F00
1ZYRF 2FMLA 1FNNA 2ZKZA 1R1UA 4WX9A 3L9FA 3G73A 1SMTA 1R23A 1HBXG 4HLXA 5H6QA 5L3GA 1R5GA 1EH6A 3LAJA 3R0JA 4HA8A 3HRUA 5FB2A 5TRDA 3Q9SA 1XB4A 2QM3A 2ZFWA 1IW7F 4GYIA 4G7HF 3GFIA 1ZHFA 2XRNA 2HYGD 1LDKB 2OA4A 4OU0A 5LGNA 5LRRA 1B59A 4OIRF 2FRHA 4EGZA 4L9TA 3OV8A 5JR3A 5K5QA 4G6DA 3ROUA 4WCGA 2DU9A 3RJPA 3T5XA 3HHGA 4CHUA 3KP7A 2HR3A 1R22A 4RS8A 2RNJA 1JGSA 3LA3A 5A2QZ 4Y13A 1UFMA 2FE3A 3C3WA 2R7FA 4AVPA 1WI9A 5AIQA 2H6CA 2EWNA 2W57A 4G6QA 4HQMA 4KDPA 4KUMA 1GHCA 2Z9OA 3NRVA 5LHIA 3R0AA 3J81Z 1QO0D 3GO5A 5FD5A 3COAC 5CJ9A 1C0WA 5CLSA 3FZVA 4BHCA 4CXFA 2LF8A 1LQ1A 1CGPA 4DNCA 3MFKA 3N97A 4WWCA 4ESJA 2KRFA 2VOPA 3JSPA 3ZMUA 3F72A 1OYWA 2L4AA 1W4MA 5FLXK 4EJVA 1XMAA 2F5EA 2VBZA 4LGWA 2OD5A 4YFXF 3GZ6A 1FP1D 4XSZF 3GUDA 1K78A 3SQNA 1D5VA 2QBYA 1KQ0A 5E1WA 3RYRA 1BIAA 3F6OA 2DLLA 1PDNC 1EV7A 1I5ZA 1QGPA 1H0MA 5ED4A 2HTJA 1ZRDA 1ZREA 1ZRFA 2LKPA 3CDHA 3IKVA 2D1VA 5HLIA 2OBPA 5EEGA 1J75A 1SMYF 1F1ZA 3VOEA 3U2RA 2AXLA 5DCMA 2F5DA 3REOA 5H6RA 4OINF 3B02A 4HV5A 4D0PA 4IJAA 1TQIA 5D5UB 2QQ9A 4RB3C 1T2KA 3E6CC 2EK5A 1WRJA 2OAZA 5LGTA 2P5KA 2VBWA 3W6KB 4O3MA 2EFPA 4G94A 3CTAA 2RKHA 4LG0A 4KYWA 1FSEA 3JAMK 1WSUA 4CO8A 3HYIA 3NQOA 2XKPA 4XSXF 1YS6A 4JBAA 3SHFA 2RDPA 4MTDA 2ELHA 1U5TA 1Z91A 3F21A 1YG2A 5FFXA 3M8FA 1FBSA 1MGTA 3V8JA 4OMYA 1FYKA 1XN7A 1A04A 4G9YA 3QP5A 1G3TA 3QPTA 2DO7A 3GYHX 4RB2C 1W5SA 2L4MA 1ULYA 4B09A 1HSTA 3ZQ7A 2BEOA 2P8TA 4I98B 5KK1A 2FF4A 4A5NA 4HDVA 2HS5A 4ZYGA 1QBJA 1W7PA 4Y15A 2FMYA 4PGGA 1MKMA 3HRSA 3WGIA 1KQ9A 2RC4A 4HV6A 3IC7A 4PCQA 1AOYA 3BY6A 1OMIA 2O03A 1B9NA 2OU2A 1SFXA 2P5LC 4DQ2A 3IWFA 1BOAA 4IXAA 2MH2A 3ZP5A 2HQRA 2VC1A 1SD7A 3RTRA 2XGXA 1OKRA 4GCVA 2ESNA 3TOBA 5D6EA 1YQAA 5JHUA 1O3SA 1U8RA 4LFUA 3RYPA 4LB6B 3E5QA 3BJ6A 1IF1A 4NB5A 1ZG3A 2OZ6A 2P7CB 3M7GA 3RIRA 1NHAA 4ZYHA 5HDKA 1B4AA 1IN7A 1OR7A 3R61A 3F8BA 4RB1A 1B6AA 4MGRA 1J7KA 4I7HA 3KETA 1HKSA 1G3WA 3KP2A 2UXNA 3V7RA 3SXYA 3K0LA 4U0YA 3FMSA 1IXSB 4QWQA 3WU1B 2PN6A 1O57A 2FSWA 2G9WA 3F22A 1IRGA 2NNNA 2EV0A 5E8IA 1FPQA 5AONA 4Z2YA 4ESFA 3K2ZA 2CW0F 1I27A 4KIFA 1MDMA 3P9IA 3GFLA 5J8FA 4HAMA 2GAUA 3QU6A 3H92A 4IRGA 2AS5F 2JSCA 2L3DA 4KMUX 3L00A 1YO5C 2H94A 1TNSA 2DTRA 4RGXA 2MD5A 4U0WA 4EM2A 1K6OA 1R1TA 5D8LB 1O7FA 1KA8A 6PAXA 3FM5A 3HOTA 1JHFA 5TJJA 1S3JA 2ZJ2A 4KN7X 1VTNC 1DDNA 3HRMA 3HSEA 4M72A 4U7BA 3WG9A 2GA2A 3O2PE 1EH8A 2M45A 2VN2A 2HTSA 4CGZA 2OQRA 1K78B 1GXPA 3R60A 2IA0A 4P96A 3FM3A 4YFKF 3KE2A 1DPRA 2JZYA 1I1SA 4GGGA 2VXZA 3DF8A 5K5RA 5HOOA 1XDUA 2IRFG 4A5MA 3U9GA 4ZZLA 1SD5A 4E70A 2WC2A 2DPDA 2A69F 3DPTA 1TTYA 4ENJA 3E6DA 1J5YA 2ISYA 3KEOA 1U78A 5DCMB 1JE8A 3MAJA 1IAWA 1O3TA 3FHZA 1S7AA 5F6FA 3VFZA 1R36A 4MEXF 4P9FA 1T39A 3ML6A 2F5FA 2FBKA 2Q2EA 2MBFA 3J80Z 2K27A 2O61A 5FD6A 2VC0A 3DPLC 2X0LA 3KP3A 1IUYA 3I0TA 3KP6A 4HX7A 2Z5UA 4LG0B 2H27A 2GWRA 1HW2A 3I4PA 3T8TA 3C7JA 1FSHA 4LLNA 1V4RA 1U5TB 2HOEA 4BAYA 4UVCA 1RI7A 5ILVA 1PP8F 3C1DA 5DD8A 1IZ1A 1RIOH 4HW0A 2DI3A 3P7NA 3DQVC 4L9NA 4LK0F 2IA2A 2Q8KA 2DT5A 2MLKA 2K4JA 1ON1A 1LDJA 2HKXA 2H09A 2R3SA 2P6TA 3MWMA 4JQFA 1BI3A 2QWWA 3PQJA 4A0ZA 5D4RA 1W7PB 4KIGA 5BPDA 2NS0A 4HYEA 2IW5A 1ZN2A 4UNOA 1YW9A 4MNUA 3WTWC 1T0FA 5L3FA 3G3ZA 2ISZA 4R1HA 2YX4A 5CVUA 2CSOA 3JTGA 4EMSA 3VEPA 4ENMA 4EM0B 1FP2A 1BI1A 4GO1A 3EUHA 2PMUA 2FBIA 1LEBA 1D8JA 3DFGA 3MEXA 3ZN0A 1XCBA 5F1RA 3IRRA 3K1PA 3Q9VA 2D2WA 4K2EA 3F8MA 4F7ZA 2G7UA 3WTZA 1XGMA 2FU4A 5JFRA 1T38A 4U0VA 4UHTA 3ABUA 5FGMA 1WKMA 5LGUA 4A0YA 1J0RA 1IN5A 3LFKA 4LMYA 4G8XA 2G7HA 2RQPA 1MDMB 3T8RA 1TW3A 1T98A 3JW4A 3K9TA 4IPAA 5D6FA 2CFXA 1V3FA 3ZMDA 3I71A 1FOKA 4ENKA 3TDUC 2JT1A 1SAXA 5LHGA 5CVJA 2H6BA 4Q47A 2C6YA 5HVQC 3W6JB 5LHHA 4A6DA 4ESBA 3VODA 1X3UA 3LQRA 1E2XA 1KU3A 3BROA 5J6XA 2Z99A 3WGGA 5E18F 5CYVA 2ZMEA 2HKOA 4FX4A 1WWXA 3GVAA 1Q1HA 3R6SA 4M6XA 4RGUA 3QP6A 2HZTA 1REPC 1S8NA 3L09A 4WXHA 1FX7A 2FQ3A 2LNBA 4JK1X 3KZZA 4MTEA 3ECHA 5D5XB 3PQKA 1ZGAA 3TQNA 1XGOA 5A2QK 2M87A 2PQ8A 2HFHA 2EFOA 2V6CA 3IKTA 2PI0A 2A6HF 1G3SA 1MZBA 2QVOA 2XKOA 2Y75A 2FXAA 1FY7A 4I0BA 1MJ9A 3J81K 2ZNYA 2VE8A 3Q5FA 1XDSA 1DUXC 2CYYA 3F3XA 4ENNA 2FEZA 2V9VA 1R7JA 2XUBA 3FF5A 4M9SA 2L01A 4LD5A 1USSA 5L3CA 1P4WA 2COMA 4M71A 1P92A 2XASA 5EEHA 1LJ9A 3GLXA 5F64A 1GVJA 1I6XA 4MHGA 3HSRA 2GIVA 3FXRA 2DW4A 1OYIA 3PFIA 4HQEA 5D5WB 1MD0A 5E17F 2XAFA 4IHTA 2UWMA 1R58A 3SZTA 3O3KA 3DKWA 3ZMSA 1Z6TA 2V1XA 3WTTC 2NRAC 2UZKA 4EGYA 5LLQA 4A0XA 2EFQA 2ZBKA 5CVIA 2O8XA 4PDKA 2V1DA 3QAHA 1DP7P 3MZHA 2VBYA 3TOAA 5K5OA 3E6BA 3LQQA 5HS7A 3F8FA 2W24A 3CUOA 4Y17A 1YLFA 2Z3YA 5DDGA 1W5TA 2EA2A 5HS8A 1JHHA 1SFUA 2D1HA 1IN6A 3GX4X 3I58A 3FXQA 4P5OA 2A07F 2NYXA 4RB0A 3O6BB 5E20A 1YYVA 1I1GA 2X4HA 2RGVA 2P6SA 3JSOA 2P5VA 2XV4S 3GFJA 4L5JA 4P9UA 1B1BA 2YSRA 1D8KA 3CJNA 2O3FA 1ZLKA 4Q5SF 1G3YA 5L3DA 5HDNA 3DXJF 1Z6RA 3BJOA 2O6GE 3HTSB 2STTA 2D45A 3V8KA 5ICCA 2F2EA 3RPQA 3N4MA 4OIQF 5IT3A 4ZZDA 2V79A 3F8NA 4AD9A 1RNLA 2XVCA 4M6YA 3T0YA 2J5OA 5D5VB 3QRFF 3CO7C 4UV8A 5DUKA 2BBYA 4IRIA 1P4AA 2HYFA 4BXUA 2KJBA 1O3QA 2FA5A 3RKWA 1KU9A 4L0YB 2QZ8A 2EFNA 3OOPA 1USTA 3AAFA 1TNTA 3ERED 2IT0A 4EVIA 4UVAA 4AIJA 5IT9Z 4UVBA 3GF2A 4WXCA 2V1UA 1BI0A 2ZCWA 2A5YB 2VT3A 1ZG5A 4EJTA 3K69A 4OIPF 2DPUA 4I0AA 3RPUA 1XSXA 1SFEA 5J8CA 4HOBA 1B9MA 4L5IA 2CG4A 3V4GA 2M1BA 1YS7A 2KIUA 3QPHA 1LB2A 1HXDA 1Z1DA 2OQGA 2ZMEB 3KCCA 5E1XA 2GXBA 2ZNZA 2PEXA 3ZMZA 3F23A 4ZYDA 3HOSA 3I54A 3P9KA 3ZMTA 4YIFA 1BI2A 4WF2A 4S04A 1TLHB 2W85A 2A68F 4MQVA 1CF7A 2CQKA 2BE5F 5DYMA 1LNWA 4ETSA 5CVRA 5BS6A 4I02A 4Q48A 1BN5A 2XAGA 3BOQA 4RAYA 1YTYA 1SD6A 1FYLA 3BPVA 1LEAA 2ZO4A 2BV6A 3EDPA 4UXNA 4ZYEA 3JTHA 3FMRA 4NHJA 2HEOA 3IWZA 1KYZA 2J5PA 2OZUA 3TKYA 1YW8A 3E5XA 4BQAA 2E7XA 5HDGA 4LB5A 5L3BA 4NQWA 2VE9A 3K1NA 1R1VA 3WE3A 1P6RA 5LRSA 2K86A 2EA4A 4FHTA 1H9GA 4RGSA 5DUIA 1TQMA 1QPMA 2P7VB 2W84A 1ON2A 2JTVA 2GQQA 2A3SA 4YG2F 4H0EA 2YPRA 1Y0UA 2CWEA 4WXDA 3CUQA 2EV5A 2M5WA 2QQAA 4XLNF 5DV5A 5HLHA 1AWCA 3I59A 3KP4A 1K7AA 5CVVA 1KU7A 1BIBA 3L7WA 3C18A 1UHWA 3V8LA 2IPQX 2BYVE 2LF7A 4A12A 2DQRA 2VONA 4YIIA 2PBIA 4A2UA 1S7OA 2PMHA 3MQ0A 3J80K 1QNTA 4UV9A 4LK1F 1KQ8A 2ETHA 4PGHA 3LWFA 5BQTA 4CZZA 1O3RA 1L3LA 4G7OF 5FLXZ 2VOOA 3L2CA 1FBUA 5JVTA 3E97A 4HZFA 4P55A 4KT5C 2YR2A 3EETA 1L0OC 1QQIA 4HF1A 1MJBA 2QLZA 1FYMA 1TW2A 3HSFA 4U7DA 1W7PD 2EFWA 2EJRA 2A61A 5BMZA 3E6MA 1ZARA 4KICA 2NAZA 3HTUA 2IA1A 4FT8A 1FT9A 2L54A 3CUQC 2FBHA 4LJZF 3HHHA 4MQ9F 2XHKA 2QYOA 1ZRCA 2Y0MA 4CYDA 2KJCA 1PP7U 3WTYC 4GXOA 1LDDA 4LLLA 1BM9A 1F4KA 4R8HA 1OYYA 2QQBA 4Q4ZF 4KNYA 4QLCU 5DEQA 3M1EA 3LA2A 2XAHA 1TBXA 2PG4A 3GWZA 3H3UA 3JAMZ 5FFZA 1F5TA 3KEQA 1IXCA 3WTUC 1XSVA 3IL2A 3BPXA 4M73A 3D0SA 4L9VA 4EM1A 3U1DA 3B73A 2ZXJA 3QOPA 3FWEA 2CGPA 4XRFA 3FX3A 2YU3A 3KZYA 1J59A 3TO9A 2LSOA 3DV8A 3ABTA 1XGNA 5K1YA 3F6VA 1HW5A 4IRHA 3GZ5A 1BBYA 1R5HA 2JPBA 1Z05A 2ACJA 4KA4A 3MZYA 3TO6A 4EQQA 3S2WA 2JPCA 2JRTA 3ULQB 5E1ZB 2Y48A 2WV0A 4M9ZA 3RI4A 3EYYA 1PUEE 4OIOF 1TQPA 2DFIA 1ONVA 4N0BA 2NNYA 5HS9A 2E1CA 3BP8A 1XD7A 1F9NA 1E17A 1CF7B 2FOKA 5BOXA 1UCRA 2PLYA 1IXRC 2K4BA 3ZPLA 1HW1A 5KVRA 1HKTA 4XBFA 1RUOA 3I5UA 1ZGJA 1U2WA 2QENA 2LDUA 4PZJA 3SZPA 1S6LA 4LLGF 3T1BA 4L18B 4UUVA 1ODDA 1ZH5A 2DQLA 3BJAA 3DP7A 4HX4A 1WQ2A 3FXUA 4IVNA 3EYIA 3MCZA 4BHPA 1G4DA 3TGNA 4KFCA 1QZZA 2EB7A 2MH9A 1EH7A 3LSTA 3RDIA 4B8XA 4HF2A 4HBLA 1K79A 4BH9A 2VODA 2CO5A 2ADUA 3J7AO 3H3ZA 2E7WA 3BDDA 4I01A 3P9CA 3WTSC 4GYGA 2MLGA 3CUQB 2GA1A 5JI6A 4CDGA 1KGSA 3I59B 3TDZC 4I2OA 1P4XA 4HX8A 2QUFA 3LAPA 1YW7A 3I64A 4N9HA 1Z9CA 1HQCA 3V7CA 4O6JA 1FC3A 3E3VA 5LEKA 5ICFA 5FO5A 4YFNF 2ESHA 4KN4X 3K1MA 3R4KA 4ASNA 2XROA 5D4SA 1D3YA 2W25A 3ELKA 1XGSA 2K7LA 3IRQA 3ZMVA 1ZAOA 5ERIA 2Q0OA 1OPCA 3M9AA 5DCFA 1P2FA 3FMQA 4L0ZB 4RGRA 1G6NA 2XIGA 4L9JA 3V7SA 1IN4A 3BWGA 5ICEA 1J2XA 1U5TC 4WK8F 4TV7A 5HLGA 3BZ6A 4ZH4F 2VT2A 5ILUA 1UB9A 4S05A 3KP5A 3LA7A 2XAJA 4N9IA 3TO7A 1IN8A 1BJAA 1O7LA 4EJUA 4R79A 3ISPA 1XSDA 4M74A 2FNPA 2KIMA 5L3EA 4EJWA 4U88A 5LBQA 5BPIA 2IJLA 2E1NA 1FZPB 1YFHA 3KLNA 1QZYA 2DK5A 1KYWA 1RZ4A 2MA3A 3CLOA 1UHMA 2XAQA 1FWZA 1BC7C 4EJOA 2HWVA 1LVAA 2YX7A 1STZA 2PFBA 3WGHA 2HGCA 4OOIA 2RN7A 1IRFA 2UXXA 2M8EA 4CICA 2DBBA 1XMKA 4BHBA 2VBXA 3KFWX 2B0LA 2R7DA 2RVCA 3CO6C 1XCVA 4M9XA 4RAZA 3SFZA 4EV0A 5LEJA 3VB2A 1FLIA 2KKOA 5E8GA 1Z7UA 2RV8A 3WE2A 2QBYB 4FX0A 2A6EF 2TDXA 1YIOA 1BC8C 5ICGA 1FBQA 4KIBA 3M8EA 3GFMA 2HDCA 2L02A 2MC3A 1DPUA 3GEZA 4MEYF 3GXOA 3KLOA 4KMFA 2GZWA 3GW2A 2DAOA 1MJAA 1ZG1A 2BGCA 1H9TA 3I53A 5IT9K 1J9IA 3DEUA 5D8KB 1ZLJA 2IP2A 2IVMA 4AIKA 3D5LA 3HRTA 4BNCA 2F5CA 3RKXA 3HIFA 4HF0A 2Z33A 4IHSA 3F8CA 2WWYA 1KU2A 4ON0A 1R00A 1RUNA 4O5VA 3WODF 4OMZA 2DK8A 2HQNA 2M30A 4IF4A 2FNAA 3IHUA 2STWA 3E5UA 5DD4A 3ZN1A 3QU3A 3WTXC 2EV6A 3EQLF 1T6SA 3HUGA 1JXSA 4A6EA 2PJPA 4AIHA 1GXQA 4G7ZF 3RKYA 3ECOA 1SD4A 2O0YA 1U3EM 5AIPA 5H20A 1S29A 2WTEA 4BYYA 2GXGA 4HLYA 4I09A 1HSJA 2P4WA 5ILSA 3NEUA 4HDUA 4XLPF 3WTVC 4AWXB 3WU0A 1HKQA 1U6GA 2KIFA 2K02A
chains in the Genus database with same CATH superfamily
3H0DA 2VI6A 1ZYRF 5J40A 3RZDJ 5HNFA 2FMLA 1FNNA 2ZKZA 4XRSG 1R1UA 4WX9A 2BY0A 4FE7A 3L9FA 5M5YJ 3AG1H 1OJLA 4BDYA 3G73A 4BS9A 1SMTA 2PMZA 2CJJA 2NVQJ 5KHDA 1R23A 1HBXG 3O8HA 4RAFA 4W97A 4HLXA 5H6QA 3EUKL 4EEFG 5L3GA 1R5GA 1EH6A 3LAJA 3R0JA 2RREA 4HA8A 3HRUA 4AC0A 5FB2A 3TEDA 3A02A 5TRDA 2EILH 3Q9SA 1XB4A 4J01A 2DDBA 4A3DJ 5KCMA 1JTXA 3CCSI 3KPHA 2QM3A 2ZFWA 1IW7F 3OYAA 4GYIA 4G7HF 1A6IA 3HGGA 3GFIA 1ZHFA 2DMPA 2K9QA 2XRNA 2HYGD 3CJQB 2VJIA 1MMSA 1R6RA 2JA8J 1LDKB 2OA4A 4OU0A 3CCUI 4Y52J 2E71A 2IGMA 5LGNA 4YIRX 3ERMA 1B59A 5LRRA 4OIRF 2FRHA 4UUTA 4EGZA 4L9TA 3HB9A 3OV8A 3TL4X 4Y33A 3TP3A 5JR3A 4A3CJ 2I10A 2Y0SA 2CUEA 5IP9J 5K5QA 3HGYA 4G6DA 3ROUA 1D5YA 3BG5A 1WJCA 3L2WA 3WG7H 5LFAA 3K6GA 4WCGA 2DU9A 3RJPA 3T5XA 3HHGA 1U8BA 4C2MJ 4CHUA 3KP7A 1W36D 4BKXA 2Q1ZB 2HR3A 4FE4A 1R22A 3S14J 4BEHB 3IV5A 3LNQA 2X6XA 1RETA 2WAQN 4RS8A 1GVDA 2RNJA 2W82A 1JGSA 3LA3A 2PJRB 4FCYA 5A2QZ 4Y13A 1UFMA 2FE3A 3C3WA 1JUMA 2R7FA 4AVPA 1WI9A 2WA0A 5AIQA 2H6CA 2EWNA 2HYJA 3HJEA 4MIMA 2W57A 4G6QA 4HQMA 4XLAA 4KDPA 4KUMA 1GHCA 2Z9OA 3K7AJ 3NRVA 5LHIA 3R0AA 2BW3B 2BY2A 3NWSA 4RLFA 3J81Z 3ABMH 1QO0D 3GO5A 5FD5A 2EZKA 3COAC 3JRCA 2JK3A 5CJ9A 1C0WA 1OQYA 5CLSA 3FZVA 4BHCA 4CXFA 2LF8A 1LQ1A 2KZVA 5JHFA 1CGPA 1B72A 4DNCA 4BACA 5GAEJ 3MFKA 3N97A 4LIUA 4WWCA 4JX4A 4ESJA 2KRFA 2I5UA 1DQUA 2X85A 3DEEA 2VOPA 3BR3A 3DU5A 4NDLA 3JSPA 3ZMUA 3F72A 1OYWA 2L4AA 1PYVA 1W4MA 3P5JA 5FLXK 4EJVA 1XC5A 1XMAA 4F3QA 2F5EA 2BHYA 2M0CA 2VBZA 1JGGA 4LGWA 4PJNA 2OD5A 1YRNA 1FMWA 2DOEA 2LKSA 2R7UA 4YFXF 3GZ6A 1FP1D 4XSZF 1T0FC 2JUGA 3GUDA 1YJ9I 1K78A 3SQNA 2IS4A 1D5VA 1IDYA 1MSFC 1IRZA 2QBYA 1KQ0A 2JA6J 5E1WA 2FX0A 2B9SA 3RYRA 2ZJQF 3QODA 4JX5A 1ZTRA 2NXNB 1BIAA 3F6OA 2DLLA 2FUG2 2L9NA 1PDNC 1EV7A 1QHHD 1MSEC 1I5ZA 2X51A 1QGPA 3EUHC 3CCMI 1H0MA 5ED4A 2I8DA 2HTJA 2DDAA 5E3LA 3CCEI 4FQGA 4PJJA 5C3EJ 1ZRDA 1ZRFA 1ZREA 2E5NA 3LOCA 1T8IA 5C4XJ 2LKPA 3CDHA 3IKVA 2D1VA 1FOYA 4B44A 5HLIA 2JQ7A 2OBPA 5EEGA 1AKHA 3CQZJ 1J75A 1YOVB 3BG3A 4ZDPA 4II3A 1UG0A 1SMYF 1F1ZA 4DYQA 3ZQLA 3VOEA 5LD2C 3U2RA 2AXLA 5DCMA 3S16J 4LITA 1A36A 2F5DA 4XOPA 3REOA 5H6RA 3Q0VA 4OINF 3B02A 4UUSA 4HV5A 5FLMJ 4D0PA 4BE0A 4IJAA 1TQIA 4N4NB 1YIJI 1DU6A 3HG9A 5D5UB 2QQ9A 2L9RA 1TC3C 4YELA 1PJRA 4RB3C 1T2KA 1OFCX 1NK3P 3E6CC 1MNMC 3SJMA 3VYTB 2EK5A 1WRJA 3BG7A 2OAZA 5LGTA 2P5KA 2VBWA 3W6KB 4AVZA 4O3MA 2EFPA 4G94A 3CTAA 2JJ7A 2RKHA 1WJBA 4NNJA 4LG0A 2F4MB 2LREA 4KYWA 3FXJA 1FSEA 3JAMK 4H4KC 1WSUA 2X1EA 5GTIC 1FTZA 2Q2EB 4ZDOA 4CO8A 3HYIA 3KZIC 2XKPA 3NQOA 1YS6A 1LKXA 4XSXF 4JBAA 3CMYA 3SHFA 2V1NA 2RDPA 3CDLA 4M3BA 3KYDB 4DZPA 5E79C 2ELHA 4MTDA 1U5TA 1Z91A 3BR0A 3F21A 2XSDC 1YG2A 5FFXA 5EEAA 3M4OJ 3M8FA 3OYHA 1FBSA 1APLC 1MGTA 2Y9YA 3V8JA 4OMYA 1FYKA 3HUGB 4HNVA 1XN7A 2M0MA 2R92J 2VL8A 1OISA 2ZMEC 1A04A 4D5FA 3W3CA 2HNHA 2R93J 4G9YA 2DA5A 1G3TA 3QP5A 3QPTA 2DO7A 3GYHX 4HNUA 5FKKA 2COBA 1W5SA 5HLTA 4RB2C 3UKGA 2L4MA 2X6OA 1ULYA 4B09A 3W2WA 1HSTA 1V5EA 3ZQ7A 2BEOA 2DA1A 4JOMA 1VQMI 2P8TA 4IX7A 1OCPA 4I98B 1R49A 5KK1A 5J3LA 2FF4A 4A69C 4A5NA 4HDVA 3ZQFA 4BJTA 2GBYA 2HS5A 4ZYGA 1QBJA 2YU9J 2WV1A 4PSWA 2MW8A 4BXXJ 5HNHA 1W7PA 4Y15A 2FMYA 4PGGA 2VLAA 1LPQA 3Q0UA 1MKMA 3HRSA 3WGIA 1KQ9A 2RC4A 2ZC2A 4HV6A 2LMDA 2NVYJ 3IC7A 1HC8A 4PCQA 1AOYA 3PNTA 3BY6A 1OMIA 5CPRB 2O03A 1B9NA 2E60A 1G59A 2MSYA 2E1OA 3I4MJ 2NS8A 2OU2A 1SFXA 1ERDA 2P5LC 2X48A 4DQ2A 3IWFA 3WHCA 1BOAA 2LOOA 4IXAA 2MH2A 3PUFA 2KFDA 3ZP5A 2HQRA 2VC1A 1SD7A 3RTRA 2XGXA 3CJRB 1OKRA 2R7OA 4GCVA 3CF5F 2ESNA 3TOBA 5D6EA 5H2FC 1YQAA 5JHUA 1RC9A 1O3SA 1U8RA 2CQXA 1VQ4I 2R7WA 4IHYA 4ZYAA 4LFUA 3RYPA 4LB6B 2ELJA 3FXKA 2V6EA 3E5QA 4C9YA 3BJ6A 1IF1A 4NB5A 3MMYB 1ZG3A 2VJ4A 4M3FA 2OZ6A 2JUCA 3M7GA 2P7CB 3IAM2 3E7LA 4BJ6C 4A3LJ 3IUOA 3RIRA 2UUZA 1NHAA 1K61A 1HA8A 3CC4I 2BY3A 4ZYHA 5HDKA 1B4AA 1A6QA 4Z6YA 1XX5A 1IN7A 1OR7A 1OLTA 1IDZA 3BC8A 3R61A 3F8BA 4RB1A 1B6AA 1LE8B 4MGRA 4BEHA 3CESA 1UMQA 1J7KA 2AO9A 4I7HA 3KETA 3VYRB 4IHVA 3G2BA 1HKSA 1G3WA 2V9PA 3KP2A 1T56A 2UXNA 3V7RA 3SXYA 3K0LA 4U0YA 3U21A 3BLYA 3FMSA 3HOUJ 1IXSB 1PUFB 4QWQA 1EA3A 3WU1B 4RDUA 2PN6A 1O57A 2FSWA 2G9WA 3F22A 1U9NA 1IRGA 2NNNA 2EV0A 3HKZN 3QYFA 3I4NJ 5E3NA 5E8IA 1FPQA 2W1OA 5AONA 4Z2YA 4ESFA 3K2ZA 4YEJA 2DOAA 5IY5H 2LH9A 1LFBA 2CW0F 1UAAA 1I27A 1MBKA 3B6AA 4KIFA 1MDMA 1QPIA 3P9IA 1S5LC 1WVRA 3GFLA 5J8FA 3KYCB 1LFPA 1H89C 4HAMA 2GAUA 5IP7J 3OYBA 3QU6A 3H92A 4IRGA 2AS5F 2JSCA 2L3DA 4KMUX 1W36C 3L00A 1YO5C 2H94A 4JX6A 1TNSA 2M3AA 2DTRA 4RGXA 1Y6IA 3M3YJ 2MD5A 4XN0A 4U0WA 2VJ5A 4EM2A 5B66C 1K6OA 1B72B 1R1TA 2VQGA 5D8LB 1O7FA 3MKWB 1NG7A 1KA8A 6PAXA 1D1CA 3FM5A 3HOTA 1JHFA 2LVSA 5TJJA 1S3JA 2ZJ2A 4KN7X 4DYCA 1VTNC 1DDNA 3H9JA 3HRMA 3HSEA 4M72A 2V7FA 3VYUB 4U7BA 3RQ4A 3WG9A 2GA2A 3O2PE 1EH8A 2M45A 2VN2A 4D7NA 1VQPI 2DA3A 4B48A 2HTSA 4CGZA 2OQRA 4XIDA 1K78B 2HOSA 3GTQJ 1GXPA 1FIAA 1I39A 2DA6A 4JP0A 3LSPA 1Y39A 3R60A 2IA0A 4P96A 3FM3A 1QRYA 4YFKF 1MMNA 3KE2A 1DPRA 2IGNA 3OR2C 4F91B 2JZYA 3DPUA 1I1SA 1ETQA 4J00A 2L5QA 4GGGA 2VXZA 3AL0C 2CH0A 3DF8A 4NC8A 3GTGJ 5K5RA 5HOOA 1GDTA 1XDUA 2IRFG 4A5MA 1AKHB 3U9GA 4I99C 2LG4A 2LR8A 4ZZLA 1SD5A 4E70A 3LSKA 2WC2A 1EJ9A 2DPDA 2A69F 2TRTA 2BOLA 3DPTA 1TTYA 4ENJA 3L2VA 3E6DA 2ME6A 1J5YA 2ISYA 3VSKA 2TCTA 3KEOA 2HDDA 1U78A 5FKNA 5DCMB 1JE8A 4IL6C 4HRIA 3MAJA 2RAEA 4UUSB 1IAWA 2LLKA 4XL9A 2RNGA 3X2QH 1X1DA 1O3TA 3FHZA 1XS9A 1S7AA 5F6FA 3VFZA 1R36A 3K4BA 4P9FA 4MEXF 1T39A 3ML6A 1BJZA 2F5FA 2V4JC 2FBKA 3LSHA 2Q2EA 4DGWB 1ETOA 2MBFA 2XGCA 3J80Z 2K27A 3ZQGA 2O61A 1F43A 5FD6A 2VC0A 2WBMA 2DFHA 3DPLC 5K7FA 1YE9A 2MABA 2X0LA 3KP3A 2EINH 2K3FA 1IUYA 3GBGA 3I0TA 2WY7Q 3CJTB 3KP6A 4HX7A 2Z5UA 5EG0B 4HEA2 2P0WA 2DMQA 4LG0B 2H27A 2GWRA 3HOWJ 2K5CA 3GZNB 1HW2A 3I4PA 2QSFX 1R9TJ 4RMNA 2IEKA 3CMEI 5JLXA 5EGOB 4D5CA 3T8TA 2VASA 3C7JA 3VWBA 1FSHA 4E7LA 3HKZA 3MD2A 2NVTJ 4G12A 4LLNA 4QIWN 1V4RA 1U5TB 2HOEA 5IYBJ 1ZQ3P 2MD0A 4S0HB 4BAYA 4UVCA 2OCEA 1MH3A 1RI7A 5ILVA 5E3OA 4J19A 3OYCA 5M3MJ 1PP8F 1DU0A 2XB0X 2KRHA 3C1DA 5DD8A 4RBOA 1IZ1A 4AU7A 4HW0A 1RIOH 3VSLA 3GTLJ 2JA2A 2DI3A 1W5CC 3P7NA 5M5WJ 1ETYA 2OCCH 3DQVC 4L9NA 5FROA 3FKIJ 1Z77A 4LK0F 1M1EB 2IA2A 2LY1A 3D5RC 2Q8KA 2DT5A 2GOMA 2MLKA 2O5RA 3DU6A 4KISA 1D0ZA 1ZELA 2K4JA 2L2OA 3FXLA 1ON1A 1LDJA 2HKXA 2H09A 2R3SA 2P6TA 5EZGA 3MWMA 4JQFA 1UJ8A 2JVGA 2CU7A 1BI3A 3JCUC 2QWWA 3PQJA 4A0ZA 5D4RA 3K4NA 3K70D 1W7PB 3ASNH 2LY2A 4KIGA 3SEQA 3ZQIA 3ZOBA 3AFHA 3PM1A 2KHMA 5J4VA 4CCJA 3H36A 5BPDA 4ZC3A 2KP6A 2NS0A 4HYEA 3J7AY 2IW5A 1ZN2A 4UNOA 1YW9A 2MGQA 4MNUA 3WTWC 3SDBA 1MMGA 1T0FA 5L3FA 3G3ZA 1BW5A 3L2RA 2BZTA 2ISZA 1MIJA 4R1HA 4D1QA 1A5JA 1TWFJ 2YX4A 2H1KA 5CVUA 2CSOA 3OYDA 4Y3OA 3FK7A 2L7FP 1MNDA 3JTGA 4EMSA 3DTEA 3VEPA 4FASD 4ENMA 3ZRGA 2XGEA 4EM0B 1LE8A 1BI1A 1FP2A 3RKQA 3K10A 4GO1A 3EUHA 3L1PA 3BG9A 2PMUA 2FBIA 1LEBA 1D8JA 1VFCA 3W2AA 3DFGA 3MEXA 3ZN0A 5IP6A 1XCBA 4A3JJ 1TT0A 1PUFA 5B1AH 5F1RA 4BQNA 3IRRA 3FKJA 2FJ1A 3K1PA 3Q9VA 2D2WA 1GV5A 4K2EA 1JUSA 1SVLA 2W4SA 3F8MA 3W2VA 2GM4A 3M1CA 2E34A 1Z21A 4BL0B 4F7ZA 3KYLA 2G7UA 3WTZA 1XGMA 2FU4A 2KLOA 2LBFA 5JFRA 2GXAA 2GIZA 1T38A 4U0VA 3MVPA 1P9QC 3AL0B 4UHTA 3ABUA 5FGMA 1WKMA 4MFDA 5LGUA 4A0YA 1SC7A 3ZQHA 3HM5A 1J0RA 1IN5A 3DKXA 1JKOC 2HOAA 4ZJZA 3LFKA 1MMDA 4LMYA 1ITYA 1FEXA 5FLVA 2F4IA 2QEXI 4MLOA 2XF5A 1ZR4A 1GV2A 4G8XA 3HOYJ 2QCOA 5GADJ 2F5VA 1D0YA 2OJED 3ONQA 4MFEA 3JRBA 2DFEA 3H35A 2IS2A 3H3VK 2G7HA 2RQPA 1MDMB 3T8RA 3CMAI 1TW3A 1T98A 3JW4A 3K9TA 4IPAA 5D6FA 5B3SH 2CFXA 4A3MJ 1V3FA 3ZMDA 3I71A 3JR9A 4CCKA 4ZDLA 2X9DA 1FOKA 2IGOA 4ENKA 2W7NA 3L2UA 3TDUC 2JT1A 1SAXA 5DM6F 5LHGA 4PUSA 5CVJA 2H6BA 2NVUB 4MO7A 4Q47A 4CCOA 2VQLA 2C6YA 5HVQC 3W6JB 5LHHA 2KDOA 4A6DA 4BY7J 4ESBA 3VODA 1X3UA 3LQRA 1E2XA 1KU3A 3BROA 2YS9A 5J6XA 2Z99A 1S72I 3WGGA 3A0BC 2M7BA 2XPWA 5CYVA 1BR4A 5E18F 2ZMEA 2HKOA 1E0EA 4FX4A 1WWXA 3GVAA 1Q1HA 3R6SA 4M6XA 4RGUA 3QP6A 5E3MA 1VQLI 1X4OA 1IV6A 2HZTA 3PUBA 1REPC 2QF7A 4XLFA 1S8NA 1WJAA 3BQYA 3L09A 2HXOA 4WXHA 1FX7A 2FQ3A 4RM3A 4BQOA 1TP4A 2LNBA 2KPMA 4JK1X 3KZZA 4MTEA 3ECHA 2CQNA 5D5XB 4BE2A 4IQJA 3PQKA 3BTJA 2LYCA 2A05A 4NC7A 1WGXA 1ZGAA 3VPRA 1VQOI 3TQNA 1XGOA 3D1NI 4A3IJ 5DTDA 4M3GA 5A2QK 2K9LA 2M4KA 2XC7A 2M87A 2H8RA 4XKWA 2PQ8A 2HFHA 2JA5J 1NTCA 3OYIA 1SAUA 2CV0A 2EFOA 1Y1WJ 4ZTFA 2V6CA 4A3GJ 3IKTA 2PI0A 2HVRA 2A6HF 4AYBN 1G3SA 2EBIA 3RPUD 1MZBA 2QVOA 2XKOA 2MG4A 3SFIA 1Z3YA 5TGTA 1VI0A 2VKEA 2Y75A 3GLLA 4Y4RA 2E2HJ 2FXAA 2OC6A 1FY7A 4I0BA 1MJ9A 4PJ0C 3J81K 2ZNYA 3PO2J 3J7YJ 1AU7A 2VE8A 3Q5FA 1XDSA 1DUXC 1ETKA 2CYYA 3F3XA 4ENNA 2FEZA 2V9VA 2XPVA 1R7JA 2VJJA 2XUBA 3FF5A 4M9SA 5F0FA 5EG0A 2WAFA 2L01A 4HG2A 4LD5A 2DA2A 1USSA 5K7ZA 1WHUA 5F27A 3OYMA 4LOCA 5L3CA 2EZHA 1P4WA 4FETA 4DBRA 5EGOA 2COMA 4M71A 1P92A 3DLAA 3L2QA 5FJ8J 3RCOA 2XASA 5EEHA 1LJ9A 3GLXA 4D9JA 2R0QC 5F64A 5M3FJ 1GVJA 1I6XA 3G71I 4MHGA 3HSRA 3ESWB 2GIVA 3FXRA 1ETXA 2DW4A 3BZCA 2IS6A 1YX5A 1N25A 1OYIA 3PFIA 4HQEA 2WAQA 2E19A 4CZCA 2NVXJ 4DBQA 1MD0A 5D5WB 3S1QJ 5E17F 2XAFA 1ORKA 3K4JA 4IHTA 1GLNA 2UWMA 1R58A 3C2GA 3DKYA 3CP8A 3SZTA 3O3KA 3DKWA 3ZMSA 2LRDA 1Z6TA 3OYFA 3W6VA 2V1XA 1U9OA 3WTTC 2EIKH 2NRAC 2UZKA 3FHNA 4EGYA 3PNVA 1OCTC 5LLQA 1KZHA 5IPAA 1RKWA 2E2IJ 4A0XA 4BUPA 2EFQA 3MN2A 2ZBKA 5CVIA 1NK2P 5FRNA 2O8XA 2DJIA 3M07A 4PDKA 2V1DA 3LSRA 1T33A 3QAHA 1TZLA 1DP7P 2X6YA 3MZHA 2VBYA 3JRIA 3TOAA 5K5OA 3E6BA 2BY1A 2QGUA 3OMYA 3LQQA 5HS7A 3F8FA 2W24A 3CUOA 4V2GA 4Y17A 4UY8I 5IOZA 3S93A 1YLFA 2Z3YA 3S17J 5DDGA 1W5TA 4X1EA 2EA2A 5HS8A 5B1BH 2O8KA 3O8GA 1JHHA 2P81A 1SFUA 2X1DA 3PO3J 2D1HA 1IN6A 3KEYA 2VPLA 2YUSA 1P7IA 3GX4X 2LP0A 3C2BA 3BR5A 3I58A 3FXQA 3ZQQA 4P5OA 4E6KG 2ZFUA 1WZ2A 2A07F 4XKBA 3BTIA 1R4MB 4LG3A 1D1AA 2NYXA 1TT5B 4RB0A 3O6BB 4OAZA 2JN6A 5E20A 2DXIA 3H0GJ 1YYVA 1I1GA 1D0XA 2X4HA 3OSGA 2RGVA 2P6SA 3OS1A 1LUJB 3UR3C 1V55H 2KL4A 3JSOA 2P5VA 5J1YA 4ZTJA 2XV4S 3GFJA 4L5JA 4P9UA 1B1BA 2YSRA 3PFYA 3SDGA 2XB5A 1AA7A 3PIOF 1VQ8I 1D8KA 3CJNA 2O3FA 1X4PA 4EATA 1T95A 1ZLKA 4Q5SF 4KJZA 1G3YA 5L3DA 5HDNA 2H1LA 2E1MC 3DXJF 4CUGA 1Z6RA 2ME0A 3BJOA 1VQ9I 3S1MJ 2OTJI 3Q0WA 1YHQI 1BR2A 3K70C 2O6GE 2STTA 3KIOA 3HTSB 3EPZA 2D45A 3V8KA 5ICCA 2F2EA 3RPQA 3N4MA 4BJ5C 3CCQI 1JKRC 1XMXA 3HC7A 5CKTA 4OIQF 1ENHA 5IT3A 2QQ8A 4ZZDA 2V79A 3F8NA 3CCLI 1RPWA 2HVSA 3DWLE 4AD9A 5J1RA 2RQQA 2V9KA 1RNLA 2XVCA 4M6YA 3T0YA 2J5OA 5D5VB 3QRFF 2KZGA 3CO7C 4UV8A 4IHWA 5DUKA 2BBYA 4CH7A 2R7TA 4AYBA 5FKLA 3S2DJ 4IRIA 1P4AA 1K4TA 2HYFA 4BXUA 3S3MA 2M2EA 2KJBA 1O3QA 2WB1N 1X1PA 2VPRA 3PIPF 4DW6A 2FA5A 3RKWA 1KU9A 4L0YB 4F55A 2LBFB 3PJRA 2QZ8A 2EFNA 3OOPA 3VDXA 3BR1A 1USTA 3AAFA 1MBHA 3UNGC 2ID3A 3CC7I 1TNTA 3H9QA 2DMTA 3ERED 2IT0A 4EVIA 4E7IA 3JRFA 2CW8A 4UVAA 4AIJA 5IT9Z 5DS9A 4UVBA 3A0HC 4XRMA 2VQHA 3DBRB 3AG2H 3GF2A 3H5NA 4WXCA 2V1UA 1BI0A 3Q3SA 2ZCWA 3LFUA 3BR2A 2A5YB 3QPSA 2VT3A 1Y8QB 2DA7A 1ZG5A 4EJTA 5M5XJ 1Y1VJ 2HPMA 4PK4A 3K69A 4RA2A 4ABZA 2K3PA 4OIPF 4C2TA 3ZQCA 3AG4H 1RR7A 1QZEA 3SYTA 4I0AA 2DPUA 3RPUA 4XM3A 2E2JJ 4XLEA 1XSXA 1EKEA 2ZB9A 1SFEA 3M8JA 5J8CA 2AHQA 4HOBA 3B6CA 3C2HA 1B9MA 1DGRM 2HVQA 1CQTA 4L5IA 2CG4A 5J47A 1P7JA 3V4GA 4DJAA 2M1BA 2K9MA 1YS7A 4F93B 2KIUA 3SEZA 1EF4A 3QPHA 1LB2A 2LTPA 1HXDA 1Z1DA 2OQGA 2ZMEB 3KCCA 5E1XA 4AUXA 1I6HJ 2GXBA 2LKXA 3LL7A 1HDPA 2ZNZA 2PEXA 4V2FA 1GUUA 1VQ5I 4BGDA 3ZMZA 2EIMH 3F23A 4HSTA 1ZKGA 4ZYDA 3HOSA 1RR8C 4XK4A 1W0UA 1IV8A 2BXZA 2AXTC 3I54A 3OYKA 1OCZH 3F0CA 2EZIA 3EUAA 2CRGA 3P9KA 4BE1A 1R71A 3ZMTA 4YIFA 1BI2A 4WF2A 1SEUA 4S04A 4B43A 1TLHB 3HPHA 2W85A 2A68F 2OV7A 4MQVA 3JREA 4M3DA 2CQKA 1CF7A 2BE5F 3OSFA 5DYMA 1LNWA 2B7EA 5IYCJ 3LSGA 4ETSA 5CVRA 5K7HA 2HI3A 5BS6A 4I02A 3GTPJ 4Q48A 1BN5A 2XAGA 5C4JJ 3BOQA 5GAHJ 4RAYA 4QTRA 5FKOA 4D7MA 3FBIB 3GTKJ 1YTYA 3IAS2 5JVGF 1SD6A 2DJNA 1FYLA 1BA5A 2XRLA 3BPVA 4L5EA 1LEAA 1F36A 2ZO4A 3I55I 3K4LA 2BV6A 3MKLA 3EDPA 2JRMA 4II2A 4UXNA 1YJWI 4ZYEA 3JTHA 1B8IA 2L9SA 3FMRA 1MBJA 1IJWC 3CF2A 3TMOA 4ANJA 4XOTA 2L0KA 4HNTA 2NOJB 4NHJA 2HEOA 3IWZA 1KYZA 2J5PA 2OZUA 3TKYA 1YW8A 3HXLA 2DYSH 3K4CA 2WAEA 3E5XA 3OYJA 3BR6A 4BQAA 2E1MB 5GPAA 2E7XA 1NH3A 5HDGA 1RRJA 1QVTA 4LB5A 3ZR8X 5L3BA 2ZJRF 1IO2A 2W00A 1WCMJ 4NQWA 2WB1A 2VE9A 3K1NA 1R1VA 3WE3A 1P6RA 1JKPC 2V26A 4E7ZA 2EIJH 5LRSA 2K86A 3LSJA 3CCVI 2EA4A 2OUMA 4FHTA 3CCRI 4OAYA 4OWRB 2HQ5A 1H9GA 4XQFA 1MBFA 4RGSA 5DUIA 1TQMA 1QPMA 2IXSA 3BCAA 2P7VB 4BU2A 2VQCA 4G6TB 4DOZA 2W84A 5IOYA 1ON2A 1ZGWA 2JTVA 1ACIA 2GQQA 4UB8C 2A3SA 1QA6A 2H8WA 3HL2A 4NBQA 3FXOA 2R7ZJ 4YG2F 4H0EA 4IO9F 1AHDP 3CDIA 2YPRA 1Y0UA 2CWEA 3OS2A 1E3PA 4WXDA 4BBSJ 2M4GA 2R4GA 3CUQA 2EV5A 2M5WA 2QQAA 4XLNF 2F6CA 1ZK8A 5DV5A 5HLHA 1X3ZB 1AWCA 4XLCA 3I59A 2R7SA 3A01A 3KP4A 2K9NA 1K7AA 2QKLB 2L7ZA 5CVVA 3V42A 4AM3A 3FISA 1KU7A 1BIBA 3GTMJ 2A5WA 3L7WA 1N75A 2MYSA 3C18A 5BNGA 1YJNI 4FTHA 1UHWA 5CQGA 4KITB 2KQRA 1BL0A 4P1WA 3V8LA 2IPQX 2BYVE 2LF7A 3QYEA 5J4YA 4A12A 2HDWA 4M6VA 2DQRA 2VONA 4YIIA 2PBIA 4A2UA 1S7OA 2PMHA 3MQ0A 3J80K 1QNTA 3OWTA 4UV9A 1VQ7I 4LK1F 1KQ8A 2ETHA 4IHXA 1TWCJ 4PGHA 4IOCF 3LWFA 2L9VA 5BQTA 4CZZA 1MBEA 1S7EA 1O3RA 1L3LA 1HDDC 4IKFA 4G7OF 5FLXZ 3ZXSA 1HCRA 3HDDA 1WI3A 2VOOA 3L2CA 2HPIA 1FBUA 4XKVA 1VZ0A 3LMMA 4XMYA 5JVTA 3E97A 4HZFA 2OTLI 1WJDA 4P55A 1JJ8C 4KT5C 1BR1A 2R5ZA 3S15J 2YR2A 1X1BA 3JRHA 1V54H 5IYDJ 3EETA 4I6ZA 1WH5A 1L0OC 1QQIA 4HF1A 2BVLA 1SVOA 1MJBA 2QLZA 3DLLF 2R7QA 1FYMA 5F04A 3BZKA 1TW2A 3HSFA 2ICWG 4F92B 4U7DA 2ID6A 1JI8A 3PSIA 2JA7J 1W7PD 5EZHA 1WPKA 2GLOA 2K9SA 2EFWA 3RQIA 2EJRA 2NS7A 4CCLA 5EDNA 3S1RJ 2ECCA 2A61A 2CV1A 3H5AA 5BMZA 1FTTA 2XAUA 1R4NB 5EF6A 3E6MA 3TW7A 1ZARA 4BQQA 1IC8A 3S3OA 1TWGJ 4HPQA 4KICA 4A3BJ 1WJEA 2NAZA 2CUFA 2L7KA 3HTUA 2IA1A 4FT8A 1FT9A 2L54A 3CUQC 2FBHA 5GP9A 4XRSA 4E7HA 4LJZF 3HHHA 1FIPA 4MQ9F 2XHKA 3TP0A 2QYOA 1ZRCA 2Y0MA 4CYDA 2KJCA 1PP7U 3E0JB 3GMEA 2MC4A 3FXMA 3WTYC 2DODA 3PSFA 1LDDA 4GXOA 1BM9A 5TISC 4LLLA 1F4KA 1FOWA 4R8HA 4PFPA 2N8GA 5JLWA 1OYYA 3OYNA 2R7RA 2QQBA 4Q4ZF 4KNYA 4QPQA 3HOZJ 2Z16A 4QLCU 1X1AA 2D5VA 5DEQA 3M1EA 4CYCA 3F9KA 1U0JA 3LA2A 4BBRJ 2F48A 4U87A 4B3XA 4C3HJ 4E4HA 2DT6A 2XAHA 4RAGA 1TBXA 3VYSB 1LFUP 2PG4A 3GWZA 3DEWA 3H3UA 3HZJA 3S2HJ 1VF9A 4AIDA 1JT6A 4ITVA 3JAMZ 3CD6I 5FFZA 1F5TA 3KEQA 3RSNA 1IXCA 2F4OB 3G1OA 3WTUC 4XR6A 5KNLA 2XDVA 1XSVA 3IL2A 3BPXA 2O9LA 2VB6A 4M73A 3D0SA 4UB6C 4L9VA 4EM1A 3U1DA 3FDYA 3JRAA 3B73A 4XN3A 2ZXJA 3I56I 3ZCOA 4PJMA 3QOPA 2CFOA 4A3EJ 3FWEA 2CGPA 4XRFA 3FX3A 1GT0C 2YU3A 3QWLA 1POGA 3KZYA 3AG3H 3NARA 2KIQA 3TO9A 1J59A 4GFBA 2LSOA 3DV8A 3OIOA 3ABTA 3OS0A 3BG6A 1XGNA 5K1YA 3S3NA 3QYBA 2DYRH 2DFFA 3F6VA 1HW5A 4IRHA 5EYRA 3GZ5A 1BBYA 1R5HA 2CQQA 2JPBA 2WADA 1Z05A 2ACJA 4KA4A 3MZYA 3TO6A 4EQQA 1YI2I 3S2WA 1X2MA 2JPCA 4E7JA 4JYKA 2R7VA 1BOBA 2JRTA 3H1CA 4QPOA 1V5GA 3ULQB 2E36A 5E1ZB 1JTYA 2Y48A 2K40A 2WV0A 4M9ZA 3RI4A 1Z67A 3EYYA 1PUEE 2OF7A 4OIOF 1TQPA 2DFIA 3OR1C 1ONVA 4N0BA 4B47A 1VQ6I 1T08B 2NNYA 5HS9A 2E1CA 3BP8A 1XD7A 1F9NA 1E17A 1E3HA 1CF7B 2R5YA 2FOKA 5BOXA 1VNDA 3MZ8A 2IS1A 1UCRA 1Y0NA 2CUZA 2M7AA 3OYEA 2A6TA 2PLYA 4XKCA 2LD5A 3OIPA 1IXRC 2K4BA 3ZPLA 2QSHX 1HW1A 5KVRA 1HKTA 1K6YA 4XBFA 1RUOA 2CUJA 1O4XA 3CLQA 2VKHA 3I5UA 1ETVA 2DCEA 1ZGJA 2L7MP 2R7XA 3I3LA 1U2WA 2QENA 2LDUA 4DZJA 4PZJA 4CCNA 1N78A 3SZPA 3H5RA 1LVKA 1S6LA 3OL3A 4LLGF 3T1BA 4L18B 1B8IB 4UUVA 1ODDA 2M9HA 4GDFA 1S9HA 1ZH5A 4IOAF 3NAUA 2DMUA 1NG6A 2DQLA 2EH3A 2BHZA 4CSWA 5F1JA 1K83J 3BJAA 3CZ6A 1ETWA 4RM2A 3DP7A 2CQ7A 4HX4A 1MMAA 1UZCA 1WQ2A 3FXUA 1UHSA 4IVNA 3G6EI 2EPFA 1QU3A 3EYIA 3MCZA 4BHPA 1FOXA 1I3QJ 2XPUA 4B3AA 4DIQA 3TGNA 4Y7NJ 2ZSIB 1G4DA 3OIQA 1XTAA 2DA4A 4KFCA 1RESA 1QZZA 2DT7B 1WH7A 2KISA 3NWTA 4NQWB 2EB7A 1XPXA 2KRCA 5CQEA 2MH9A 2WY8Q 1EH7A 2W48A 3LSTA 3CC2I 4V19K 3RDIA 2M34A 3DCFA 4B8XA 4HF2A 4HBLA 1K79A 3S32A 4BH9A 2VODA 2CO5A 4KT6A 2ADUA 1IRXA 3J7AO 4NUBA 3H3ZA 2E7WA 2LK2A 2ELKA 2JSPA 3BDDA 3DTIA 5J1UA 4I01A 3K4MA 3P9CA 3TW6A 1QHGA 4W1UA 3WTSC 3G4SI 3I9V2 4GYGA 1Q1VA 3MKZA 2MLGA 3HEFA 5C44J 3CUQB 3HPGA 2GA1A 4HSRA 4XICA 5JI6A 4CDGA 3OY9A 5DM7F 1KGSA 2KMUA 3I59B 3SZGA 3TDZC 3G1MA 3HOVJ 4I2OA 5FRMA 1P4XA 4HX8A 3A01B 2QUFA 3LAPA 1YW7A 3I64A 4N9HA 1Z9CA 1BW6A 1HQCA 3V7CA 4O6JA 4F52A 3K4KA 1FC3A 3E3VA 3N05A 5LEKA 1A31A 4NC6A 5FO5A 5ICFA 3TBIA 2XGDA 4YFNF 2ESHA 4KN4X 3K1MA 5KAIC 3R4KA 1G8XA 4ASNA 2XROA 2Z1DA 3CMMA 5D4SA 1MW7A 2JMWA 1D3YA 4XLHA 1VQKI 2W25A 3ELKA 4C3IJ 1E3OC 2B63J 1XGSA 2K7LA 1FMVA 4I76A 3IRQA 2FQ4A 2XF6A 3ZMVA 4X6AJ 1ZAOA 4PJLA 5ERIA 2Y30A 2Q0OA 3QPLA 1OPCA 3M9AA 5DCFA 3CCYA 2QA4I 2M8GX 4BDZA 2VUMJ 1P2FA 3FMQA 1Z0XA 3CP2A 1Z7LA 4RGRA 4L0ZB 1FJLA 1G6NA 3PNYA 2XIGA 1G2HA 4L9JA 3FBNB 3H9GA 4BY1J 1IUFA 2G0EA 3V7SA 1IN4A 2R5ZB 3BWGA 5ICEA 1X19A 3KX2A 2JWTA 1HF0A 4E7KA 1J2XA 3IH3A 4BXFA 1U5TC 4WK8F 2CS3A 3ZGKA 1X58A 4TV7A 5GAGJ 5HLGA 4C3JJ 3OL4A 3G1LA 1TL8A 3BZ6A 3BCBA 1RKTA 4ZH4F 2VT2A 5ILUA 1UB9A 4S05A 3KP5A 5F0HA 2PJRA 1Y8RB 4RLQA 3WU2C 3LA7A 2XAJA 4FISA 4CA0A 2ECBA 4XONA 1OCRH 4N9IA 3TO7A 1IN8A 1SVMA 4IEJA 2IBDA 1BJAA 1O7LA 4EJUA 4R79A 3ISPA 1XSDA 1X1CA 4M74A 2FNPA 2BXYA 1QVUA 2NOGA 1OCCH 2KIMA 5L3EA 3D5SC 2BW3A 2VXDA 4EJWA 2ZXHA 4U88A 2HQAA 5LBQA 5BPIA 3RZOJ 2IJLA 3S1NJ 2UV1A 2E1NA 2KT0A 1N77A 2Y69H 1FZPB 3S8PA 9ANTA 1YFHA 1IGNA 1WJFA 3KLNA 4X0GA 1HOMA 1QZYA 1Y56A 2DK5A 2EZLA 2DTZA 1KYWA 1RZ4A 4IQ4A 2MA3A 3CLOA 1K4SA 1UHMA 2ZSHB 2XAQA 1FWZA 3FIWA 1UG2A 5GTHC 4CYCB 1BC7C 4EJOA 2HWVA 3JRGA 2E5ZA 1LVAA 1YX3A 2YX7A 1STZA 2LC2A 2AQEA 5B5EC 2PFBA 3WGHA 2HGCA 3ABKH 2RN7A 4M3EA 4OOIA 4DYRA 1IRFA 3MKYB 2UXXA 2HU9A 2M8EA 4CICA 4XORA 4C2UA 2DBBA 1XMKA 4BHBA 3BQZA 3U1KA 2VBXA 3KFWX 1R5ID 2B0LA 2PMZN 3QQAA 4XNFA 2R7DA 2RVCA 3CO6C 1KONA 1MH4A 2Z2SB 1XCVA 4M9XA 4RAZA 3SFZA 4EV0A 5LEJA 1TWHJ 3VB2A 3CCJI 3LSIA 1SFKA 3QOEA 1FLIA 1YRNB 4YRVA 1H8AC 1SFOJ 2KKOA 5E8GA 3PL8A 3DBLB 5KAFC 1D1BA 1Z7UA 2RV8A 3WE2A 2IGKA 2QBYB 2QKMB 4FX0A 2KDZA 1OR7C 5GPCA 3K2AA 2A6EF 2Y2ZA 2TDXA 1YIOA 2X6WA 1BC8C 1DP3A 1JT0A 1W0TA 2HZDA 1FBQA 5ICGA 2LFBA 3A03A 4KIBA 2DOFA 4LIVA 3M8EA 3GFMA 3WHBA 2JVHA 2HDCA 1WJ5A 2L02A 3HOXJ 2MC3A 1JKQC 1DGWY 1DPUA 3GEZA 1VQNI 2VKDA 4MEYF 3GXOA 3GCMA 3KLOA 3DTKA 4KMFA 1V5FA 2GZWA 3GW2A 3GTOJ 2DAOA 1JJ6C 1MJAA 2Y0SN 2BGCA 4E7SA 1ZG1A 1H9TA 1JUPA 2FOWA 3I53A 5IT9K 3A2KA 1J9IA 2E35A 1ZR2A 3ABLH 3DEUA 3ASOH 2BVMA 4B1RA 1MBGA 5D8KB 2ZJPF 1ZLJA 1WFXA 2IP2A 2IVMA 4AIKA 3D5LA 3FK6A 4PFOA 3HRTA 4BNCA 2CV2A 2QSGX 2PX9A 1I50J 2F5CA 2X1CA 2EQRA 3RKXA 1A35A 3HIFA 2HXIA 4HF0A 4A93J 2Z33A 4IHSA 2R5YB 3AKZA 3F8CA 4N4OB 2WWYA 4IZZA 1PVEA 1KU2A 5HODA 1Z3XA 4ON0A 1R00A 1IG7A 4QSHA 1RUNA 4O5VA 2XF7A 1X2NA 2DN0A 3WODF 4OMZA 4B4CA 2DK8A 4PSXA 4GRIA 2HQNA 2VIXA 2M30A 4IF4A 3DBHB 2CW7A 2FNAA 3IH4A 3JRDA 1YITI 1HLVA 3IHUA 2ZXWH 4C30A 2STWA 2Y31A 3E5UA 5DD4A 3OYGA 3ZN1A 2FD5A 3LSMA 3GTJJ 2XSJC 3QU3A 4A3KJ 3WTXC 2EV6A 3EQLF 1T6SA 1TWAJ 3HUGA 3BT9A 1JXSA 4A6EA 1J09A 3J7ZI 2PJPA 3IH2A 3OOUA 2AQFA 4AIHA 4CCMA 1GXQA 2IAIA 4G7ZF 3RKYA 2O7OA 3ECOA 5F08A 1H88C 1SD4A 1MNEA 2O0YA 2Y9ZA 1OCOH 3E1SA 1U3EM 5AIPA 2MFZA 5H20A 5EJCA 2K85A 2LY9A 1S29A 2WTEA 4BYYA 3A1YA 2VKVA 3A4CA 1UELB 2GXGA 2HOTA 2DMNA 4HLYA 4I09A 1HSJA 1XG1A 1SANA 2P4WA 5F0CA 3OYLA 3IP4B 5ILSA 3BTLA 5FKMA 3NEUA 3HBLA 3BTCA 4A3FJ 1X3WB 4HDUA 1W1WE 2OPTA 4XLPF 3WTVC 2ZXIA 4AWXB 3WU0A 1HKQA 1I3AA 2GOXB 1U6GA 2KIFA 2K02A 2CMPA
chains in the Genus database with same CATH topology
1ZYRF 2FMLA 1FNNA 2ZKZA 1R1UA 4WX9A 3L9FA 3G73A 1SMTA 1R23A 1HBXG 4HLXA 5H6QA 5L3GA 1R5GA 1EH6A 3LAJA 3R0JA 4HA8A 3HRUA 5FB2A 5TRDA 3Q9SA 1XB4A 2QM3A 2ZFWA 1IW7F 4GYIA 4G7HF 3GFIA 1ZHFA 2XRNA 2HYGD 1LDKB 2OA4A 4OU0A 5LGNA 5LRRA 1B59A 4OIRF 2FRHA 4EGZA 4L9TA 3OV8A 5JR3A 5K5QA 4G6DA 3ROUA 4WCGA 2DU9A 3RJPA 3T5XA 3HHGA 4CHUA 3KP7A 2HR3A 1R22A 4RS8A 2RNJA 1JGSA 3LA3A 5A2QZ 4Y13A 1UFMA 2FE3A 3C3WA 2R7FA 4AVPA 1WI9A 5AIQA 2H6CA 2EWNA 2W57A 4G6QA 4HQMA 4KDPA 4KUMA 1GHCA 2Z9OA 3NRVA 5LHIA 3R0AA 3J81Z 1QO0D 3GO5A 5FD5A 3COAC 5CJ9A 1C0WA 5CLSA 3FZVA 4BHCA 4CXFA 2LF8A 1LQ1A 1CGPA 4DNCA 3MFKA 3N97A 4WWCA 4ESJA 2KRFA 2VOPA 3JSPA 3ZMUA 3F72A 1OYWA 2L4AA 1W4MA 5FLXK 4EJVA 1XMAA 2F5EA 2VBZA 4LGWA 2OD5A 4YFXF 3GZ6A 1FP1D 4XSZF 3GUDA 1K78A 3SQNA 1D5VA 2QBYA 1KQ0A 5E1WA 3RYRA 1BIAA 3F6OA 2DLLA 1PDNC 1EV7A 1I5ZA 1QGPA 1H0MA 5ED4A 2HTJA 1ZRDA 1ZREA 1ZRFA 2LKPA 3CDHA 3IKVA 2D1VA 5HLIA 2OBPA 5EEGA 1J75A 1SMYF 1F1ZA 3VOEA 3U2RA 2AXLA 5DCMA 2F5DA 3REOA 5H6RA 4OINF 3B02A 4HV5A 4D0PA 4IJAA 1TQIA 5D5UB 2QQ9A 4RB3C 1T2KA 3E6CC 2EK5A 1WRJA 2OAZA 5LGTA 2P5KA 2VBWA 3W6KB 4O3MA 2EFPA 4G94A 3CTAA 2RKHA 4LG0A 4KYWA 1FSEA 3JAMK 1WSUA 4CO8A 3HYIA 3NQOA 2XKPA 4XSXF 1YS6A 4JBAA 3SHFA 2RDPA 4MTDA 2ELHA 1U5TA 1Z91A 3F21A 1YG2A 5FFXA 3M8FA 1FBSA 1MGTA 3V8JA 4OMYA 1FYKA 1XN7A 1A04A 4G9YA 3QP5A 1G3TA 3QPTA 2DO7A 3GYHX 4RB2C 1W5SA 2L4MA 1ULYA 4B09A 1HSTA 3ZQ7A 2BEOA 2P8TA 4I98B 5KK1A 2FF4A 4A5NA 4HDVA 2HS5A 4ZYGA 1QBJA 1W7PA 4Y15A 2FMYA 4PGGA 1MKMA 3HRSA 3WGIA 1KQ9A 2RC4A 4HV6A 3IC7A 4PCQA 1AOYA 3BY6A 1OMIA 2O03A 1B9NA 2OU2A 1SFXA 2P5LC 4DQ2A 3IWFA 1BOAA 4IXAA 2MH2A 3ZP5A 2HQRA 2VC1A 1SD7A 3RTRA 2XGXA 1OKRA 4GCVA 2ESNA 3TOBA 5D6EA 1YQAA 5JHUA 1O3SA 1U8RA 4LFUA 3RYPA 4LB6B 3E5QA 3BJ6A 1IF1A 4NB5A 1ZG3A 2OZ6A 2P7CB 3M7GA 3RIRA 1NHAA 4ZYHA 5HDKA 1B4AA 1IN7A 1OR7A 3R61A 3F8BA 4RB1A 1B6AA 4MGRA 1J7KA 4I7HA 3KETA 1HKSA 1G3WA 3KP2A 2UXNA 3V7RA 3SXYA 3K0LA 4U0YA 3FMSA 1IXSB 4QWQA 3WU1B 2PN6A 1O57A 2FSWA 2G9WA 3F22A 1IRGA 2NNNA 2EV0A 5E8IA 1FPQA 5AONA 4Z2YA 4ESFA 3K2ZA 2CW0F 1I27A 4KIFA 1MDMA 3P9IA 3GFLA 5J8FA 4HAMA 2GAUA 3QU6A 3H92A 4IRGA 2AS5F 2JSCA 2L3DA 4KMUX 3L00A 1YO5C 2H94A 1TNSA 2DTRA 4RGXA 2MD5A 4U0WA 4EM2A 1K6OA 1R1TA 5D8LB 1O7FA 1KA8A 6PAXA 3FM5A 3HOTA 1JHFA 5TJJA 1S3JA 2ZJ2A 4KN7X 1VTNC 1DDNA 3HRMA 3HSEA 4M72A 4U7BA 3WG9A 2GA2A 3O2PE 1EH8A 2M45A 2VN2A 2HTSA 4CGZA 2OQRA 1K78B 1GXPA 3R60A 2IA0A 4P96A 3FM3A 4YFKF 3KE2A 1DPRA 2JZYA 1I1SA 4GGGA 2VXZA 3DF8A 5K5RA 5HOOA 1XDUA 2IRFG 4A5MA 3U9GA 4ZZLA 1SD5A 4E70A 2WC2A 2DPDA 2A69F 3DPTA 1TTYA 4ENJA 3E6DA 1J5YA 2ISYA 3KEOA 1U78A 5DCMB 1JE8A 3MAJA 1IAWA 1O3TA 3FHZA 1S7AA 5F6FA 3VFZA 1R36A 4MEXF 4P9FA 1T39A 3ML6A 2F5FA 2FBKA 2Q2EA 2MBFA 3J80Z 2K27A 2O61A 5FD6A 2VC0A 3DPLC 2X0LA 3KP3A 1IUYA 3I0TA 3KP6A 4HX7A 2Z5UA 4LG0B 2H27A 2GWRA 1HW2A 3I4PA 3T8TA 3C7JA 1FSHA 4LLNA 1V4RA 1U5TB 2HOEA 4BAYA 4UVCA 1RI7A 5ILVA 1PP8F 3C1DA 5DD8A 1IZ1A 1RIOH 4HW0A 2DI3A 3P7NA 3DQVC 4L9NA 4LK0F 2IA2A 2Q8KA 2DT5A 2MLKA 2K4JA 1ON1A 1LDJA 2HKXA 2H09A 2R3SA 2P6TA 3MWMA 4JQFA 1BI3A 2QWWA 3PQJA 4A0ZA 5D4RA 1W7PB 4KIGA 5BPDA 2NS0A 4HYEA 2IW5A 1ZN2A 4UNOA 1YW9A 4MNUA 3WTWC 1T0FA 5L3FA 3G3ZA 2ISZA 4R1HA 2YX4A 5CVUA 2CSOA 3JTGA 4EMSA 3VEPA 4ENMA 4EM0B 1FP2A 1BI1A 4GO1A 3EUHA 2PMUA 2FBIA 1LEBA 1D8JA 3DFGA 3MEXA 3ZN0A 1XCBA 5F1RA 3IRRA 3K1PA 3Q9VA 2D2WA 4K2EA 3F8MA 4F7ZA 2G7UA 3WTZA 1XGMA 2FU4A 5JFRA 1T38A 4U0VA 4UHTA 3ABUA 5FGMA 1WKMA 5LGUA 4A0YA 1J0RA 1IN5A 3LFKA 4LMYA 4G8XA 2G7HA 2RQPA 1MDMB 3T8RA 1TW3A 1T98A 3JW4A 3K9TA 4IPAA 5D6FA 2CFXA 1V3FA 3ZMDA 3I71A 1FOKA 4ENKA 3TDUC 2JT1A 1SAXA 5LHGA 5CVJA 2H6BA 4Q47A 2C6YA 5HVQC 3W6JB 5LHHA 4A6DA 4ESBA 3VODA 1X3UA 3LQRA 1E2XA 1KU3A 3BROA 5J6XA 2Z99A 3WGGA 5E18F 5CYVA 2ZMEA 2HKOA 4FX4A 1WWXA 3GVAA 1Q1HA 3R6SA 4M6XA 4RGUA 3QP6A 2HZTA 1REPC 1S8NA 3L09A 4WXHA 1FX7A 2FQ3A 2LNBA 4JK1X 3KZZA 4MTEA 3ECHA 5D5XB 3PQKA 1ZGAA 3TQNA 1XGOA 5A2QK 2M87A 2PQ8A 2HFHA 2EFOA 2V6CA 3IKTA 2PI0A 2A6HF 1G3SA 1MZBA 2QVOA 2XKOA 2Y75A 2FXAA 1FY7A 4I0BA 1MJ9A 3J81K 2ZNYA 2VE8A 3Q5FA 1XDSA 1DUXC 2CYYA 3F3XA 4ENNA 2FEZA 2V9VA 1R7JA 2XUBA 3FF5A 4M9SA 2L01A 4LD5A 1USSA 5L3CA 1P4WA 2COMA 4M71A 1P92A 2XASA 5EEHA 1LJ9A 3GLXA 5F64A 1GVJA 1I6XA 4MHGA 3HSRA 2GIVA 3FXRA 2DW4A 1OYIA 3PFIA 4HQEA 5D5WB 1MD0A 5E17F 2XAFA 4IHTA 2UWMA 1R58A 3SZTA 3O3KA 3DKWA 3ZMSA 1Z6TA 2V1XA 3WTTC 2NRAC 2UZKA 4EGYA 5LLQA 4A0XA 2EFQA 2ZBKA 5CVIA 2O8XA 4PDKA 2V1DA 3QAHA 1DP7P 3MZHA 2VBYA 3TOAA 5K5OA 3E6BA 3LQQA 5HS7A 3F8FA 2W24A 3CUOA 4Y17A 1YLFA 2Z3YA 5DDGA 1W5TA 2EA2A 5HS8A 1JHHA 1SFUA 2D1HA 1IN6A 3GX4X 3I58A 3FXQA 4P5OA 2A07F 2NYXA 4RB0A 3O6BB 5E20A 1YYVA 1I1GA 2X4HA 2RGVA 2P6SA 3JSOA 2P5VA 2XV4S 3GFJA 4L5JA 4P9UA 1B1BA 2YSRA 1D8KA 3CJNA 2O3FA 1ZLKA 4Q5SF 1G3YA 5L3DA 5HDNA 3DXJF 1Z6RA 3BJOA 2O6GE 3HTSB 2STTA 2D45A 3V8KA 5ICCA 2F2EA 3RPQA 3N4MA 4OIQF 5IT3A 4ZZDA 2V79A 3F8NA 4AD9A 1RNLA 2XVCA 4M6YA 3T0YA 2J5OA 5D5VB 3QRFF 3CO7C 4UV8A 5DUKA 2BBYA 4IRIA 1P4AA 2HYFA 4BXUA 2KJBA 1O3QA 2FA5A 3RKWA 1KU9A 4L0YB 2QZ8A 2EFNA 3OOPA 1USTA 3AAFA 1TNTA 3ERED 2IT0A 4EVIA 4UVAA 4AIJA 5IT9Z 4UVBA 3GF2A 4WXCA 2V1UA 1BI0A 2ZCWA 2A5YB 2VT3A 1ZG5A 4EJTA 3K69A 4OIPF 2DPUA 4I0AA 3RPUA 1XSXA 1SFEA 5J8CA 4HOBA 1B9MA 4L5IA 2CG4A 3V4GA 2M1BA 1YS7A 2KIUA 3QPHA 1LB2A 1HXDA 1Z1DA 2OQGA 2ZMEB 3KCCA 5E1XA 2GXBA 2ZNZA 2PEXA 3ZMZA 3F23A 4ZYDA 3HOSA 3I54A 3P9KA 3ZMTA 4YIFA 1BI2A 4WF2A 4S04A 1TLHB 2W85A 2A68F 4MQVA 1CF7A 2CQKA 2BE5F 5DYMA 1LNWA 4ETSA 5CVRA 5BS6A 4I02A 4Q48A 1BN5A 2XAGA 3BOQA 4RAYA 1YTYA 1SD6A 1FYLA 3BPVA 1LEAA 2ZO4A 2BV6A 3EDPA 4UXNA 4ZYEA 3JTHA 3FMRA 4NHJA 2HEOA 3IWZA 1KYZA 2J5PA 2OZUA 3TKYA 1YW8A 3E5XA 4BQAA 2E7XA 5HDGA 4LB5A 5L3BA 4NQWA 2VE9A 3K1NA 1R1VA 3WE3A 1P6RA 5LRSA 2K86A 2EA4A 4FHTA 1H9GA 4RGSA 5DUIA 1TQMA 1QPMA 2P7VB 2W84A 1ON2A 2JTVA 2GQQA 2A3SA 4YG2F 4H0EA 2YPRA 1Y0UA 2CWEA 4WXDA 3CUQA 2EV5A 2M5WA 2QQAA 4XLNF 5DV5A 5HLHA 1AWCA 3I59A 3KP4A 1K7AA 5CVVA 1KU7A 1BIBA 3L7WA 3C18A 1UHWA 3V8LA 2IPQX 2BYVE 2LF7A 4A12A 2DQRA 2VONA 4YIIA 2PBIA 4A2UA 1S7OA 2PMHA 3MQ0A 3J80K 1QNTA 4UV9A 4LK1F 1KQ8A 2ETHA 4PGHA 3LWFA 5BQTA 4CZZA 1O3RA 1L3LA 4G7OF 5FLXZ 2VOOA 3L2CA 1FBUA 5JVTA 3E97A 4HZFA 4P55A 4KT5C 2YR2A 3EETA 1L0OC 1QQIA 4HF1A 1MJBA 2QLZA 1FYMA 1TW2A 3HSFA 4U7DA 1W7PD 2EFWA 2EJRA 2A61A 5BMZA 3E6MA 1ZARA 4KICA 2NAZA 3HTUA 2IA1A 4FT8A 1FT9A 2L54A 3CUQC 2FBHA 4LJZF 3HHHA 4MQ9F 2XHKA 2QYOA 1ZRCA 2Y0MA 4CYDA 2KJCA 1PP7U 3WTYC 4GXOA 1LDDA 4LLLA 1BM9A 1F4KA 4R8HA 1OYYA 2QQBA 4Q4ZF 4KNYA 4QLCU 5DEQA 3M1EA 3LA2A 2XAHA 1TBXA 2PG4A 3GWZA 3H3UA 3JAMZ 5FFZA 1F5TA 3KEQA 1IXCA 3WTUC 1XSVA 3IL2A 3BPXA 4M73A 3D0SA 4L9VA 4EM1A 3U1DA 3B73A 2ZXJA 3QOPA 3FWEA 2CGPA 4XRFA 3FX3A 2YU3A 3KZYA 1J59A 3TO9A 2LSOA 3DV8A 3ABTA 1XGNA 5K1YA 3F6VA 1HW5A 4IRHA 3GZ5A 1BBYA 1R5HA 2JPBA 1Z05A 2ACJA 4KA4A 3MZYA 3TO6A 4EQQA 3S2WA 2JPCA 2JRTA 3ULQB 5E1ZB 2Y48A 2WV0A 4M9ZA 3RI4A 3EYYA 1PUEE 4OIOF 1TQPA 2DFIA 1ONVA 4N0BA 2NNYA 5HS9A 2E1CA 3BP8A 1XD7A 1F9NA 1E17A 1CF7B 2FOKA 5BOXA 1UCRA 2PLYA 1IXRC 2K4BA 3ZPLA 1HW1A 5KVRA 1HKTA 4XBFA 1RUOA 3I5UA 1ZGJA 1U2WA 2QENA 2LDUA 4PZJA 3SZPA 1S6LA 4LLGF 3T1BA 4L18B 4UUVA 1ODDA 1ZH5A 2DQLA 3BJAA 3DP7A 4HX4A 1WQ2A 3FXUA 4IVNA 3EYIA 3MCZA 4BHPA 1G4DA 3TGNA 4KFCA 1QZZA 2EB7A 2MH9A 1EH7A 3LSTA 3RDIA 4B8XA 4HF2A 4HBLA 1K79A 4BH9A 2VODA 2CO5A 2ADUA 3J7AO 3H3ZA 2E7WA 3BDDA 4I01A 3P9CA 3WTSC 4GYGA 2MLGA 3CUQB 2GA1A 5JI6A 4CDGA 1KGSA 3I59B 3TDZC 4I2OA 1P4XA 4HX8A 2QUFA 3LAPA 1YW7A 3I64A 4N9HA 1Z9CA 1HQCA 3V7CA 4O6JA 1FC3A 3E3VA 5LEKA 5ICFA 5FO5A 4YFNF 2ESHA 4KN4X 3K1MA 3R4KA 4ASNA 2XROA 5D4SA 1D3YA 2W25A 3ELKA 1XGSA 2K7LA 3IRQA 3ZMVA 1ZAOA 5ERIA 2Q0OA 1OPCA 3M9AA 5DCFA 1P2FA 3FMQA 4L0ZB 4RGRA 1G6NA 2XIGA 4L9JA 3V7SA 1IN4A 3BWGA 5ICEA 1J2XA 1U5TC 4WK8F 4TV7A 5HLGA 3BZ6A 4ZH4F 2VT2A 5ILUA 1UB9A 4S05A 3KP5A 3LA7A 2XAJA 4N9IA 3TO7A 1IN8A 1BJAA 1O7LA 4EJUA 4R79A 3ISPA 1XSDA 4M74A 2FNPA 2KIMA 5L3EA 4EJWA 4U88A 5LBQA 5BPIA 2IJLA 2E1NA 1FZPB 1YFHA 3KLNA 1QZYA 2DK5A 1KYWA 1RZ4A 2MA3A 3CLOA 1UHMA 2XAQA 1FWZA 1BC7C 4EJOA 2HWVA 1LVAA 2YX7A 1STZA 2PFBA 3WGHA 2HGCA 4OOIA 2RN7A 1IRFA 2UXXA 2M8EA 4CICA 2DBBA 1XMKA 4BHBA 2VBXA 3KFWX 2B0LA 2R7DA 2RVCA 3CO6C 1XCVA 4M9XA 4RAZA 3SFZA 4EV0A 5LEJA 3VB2A 1FLIA 2KKOA 5E8GA 1Z7UA 2RV8A 3WE2A 2QBYB 4FX0A 2A6EF 2TDXA 1YIOA 1BC8C 5ICGA 1FBQA 4KIBA 3M8EA 3GFMA 2HDCA 2L02A 2MC3A 1DPUA 3GEZA 4MEYF 3GXOA 3KLOA 4KMFA 2GZWA 3GW2A 2DAOA 1MJAA 1ZG1A 2BGCA 1H9TA 3I53A 5IT9K 1J9IA 3DEUA 5D8KB 1ZLJA 2IP2A 2IVMA 4AIKA 3D5LA 3HRTA 4BNCA 2F5CA 3RKXA 3HIFA 4HF0A 2Z33A 4IHSA 3F8CA 2WWYA 1KU2A 4ON0A 1R00A 1RUNA 4O5VA 3WODF 4OMZA 2DK8A 2HQNA 2M30A 4IF4A 2FNAA 3IHUA 2STWA 3E5UA 5DD4A 3ZN1A 3QU3A 3WTXC 2EV6A 3EQLF 1T6SA 3HUGA 1JXSA 4A6EA 2PJPA 4AIHA 1GXQA 4G7ZF 3RKYA 3ECOA 1SD4A 2O0YA 1U3EM 5AIPA 5H20A 1S29A 2WTEA 4BYYA 2GXGA 4HLYA 4I09A 1HSJA 2P4WA 5ILSA 3NEUA 4HDUA 4XLPF 3WTVC 4AWXB 3WU0A 1HKQA 1U6GA 2KIFA 2K02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR F;  2FML A;  1FNN A;  2ZKZ A;  1R1U A;  4WX9 A;  3L9F A;  3G73 A;  1SMT A;  1R23 A;  1HBX G;  4HLX A;  5H6Q A;  5L3G A;  1R5G A;  1EH6 A;  3LAJ A;  3R0J A;  4HA8 A;  3HRU A;  5FB2 A;  5TRD A;  3Q9S A;  1XB4 A;  2QM3 A;  2ZFW A;  1IW7 F;  4GYI A;  4G7H F;  3GFI A;  1ZHF A;  2XRN A;  2HYG D;  1LDK B;  2OA4 A;  4OU0 A;  5LGN A;  5LRR A;  1B59 A;  4OIR F;  2FRH A;  4EGZ A;  4L9T A;  3OV8 A;  5JR3 A;  5K5Q A;  4G6D A;  3ROU A;  4WCG A;  2DU9 A;  3RJP A;  3T5X A;  3HHG A;  4CHU A;  3KP7 A;  2HR3 A;  1R22 A;  4RS8 A;  2RNJ A;  1JGS A;  3LA3 A;  5A2Q Z;  4Y13 A;  1UFM A;  2FE3 A;  3C3W A;  2R7F A;  4AVP A;  1WI9 A;  5AIQ A;  2H6C A;  2EWN A;  2W57 A;  4G6Q A;  4HQM A;  4KDP A;  4KUM A;  1GHC A;  2Z9O A;  3NRV A;  5LHI A;  3R0A A;  3J81 Z;  1QO0 D;  3GO5 A;  5FD5 A;  3COA C;  5CJ9 A;  1C0W A;  5CLS A;  3FZV A;  4BHC A;  4CXF A;  2LF8 A;  1LQ1 A;  1CGP A;  4DNC A;  3MFK A;  3N97 A;  4WWC A;  4ESJ A;  2KRF A;  2VOP A;  3JSP A;  3ZMU A;  3F72 A;  1OYW A;  2L4A A;  1W4M A;  5FLX K;  4EJV A;  1XMA A;  2F5E A;  2VBZ A;  4LGW A;  2OD5 A;  4YFX F;  3GZ6 A;  1FP1 D;  4XSZ F;  3GUD A;  1K78 A;  3SQN A;  1D5V A;  2QBY A;  1KQ0 A;  5E1W A;  3RYR A;  1BIA A;  3F6O A;  2DLL A;  1PDN C;  1EV7 A;  1I5Z A;  1QGP A;  1H0M A;  5ED4 A;  2HTJ A;  1ZRD A;  1ZRE A;  1ZRF A;  2LKP A;  3CDH A;  3IKV A;  2D1V A;  5HLI A;  2OBP A;  5EEG A;  1J75 A;  1SMY F;  1F1Z A;  3VOE A;  3U2R A;  2AXL A;  5DCM A;  2F5D A;  3REO A;  5H6R A;  4OIN F;  3B02 A;  4HV5 A;  4D0P A;  4IJA A;  1TQI A;  5D5U B;  2QQ9 A;  4RB3 C;  1T2K A;  3E6C C;  2EK5 A;  1WRJ A;  2OAZ A;  5LGT A;  2P5K A;  2VBW A;  3W6K B;  4O3M A;  2EFP A;  4G94 A;  3CTA A;  2RKH A;  4LG0 A;  4KYW A;  1FSE A;  3JAM K;  1WSU A;  4CO8 A;  3HYI A;  3NQO A;  2XKP A;  4XSX F;  1YS6 A;  4JBA A;  3SHF A;  2RDP A;  4MTD A;  2ELH A;  1U5T A;  1Z91 A;  3F21 A;  1YG2 A;  5FFX A;  3M8F A;  1FBS A;  1MGT A;  3V8J A;  4OMY A;  1FYK A;  1XN7 A;  1A04 A;  4G9Y A;  3QP5 A;  1G3T A;  3QPT A;  2DO7 A;  3GYH X;  4RB2 C;  1W5S A;  2L4M A;  1ULY A;  4B09 A;  1HST A;  3ZQ7 A;  2BEO A;  2P8T A;  4I98 B;  5KK1 A;  2FF4 A;  4A5N A;  4HDV A;  2HS5 A;  4ZYG A;  1QBJ A;  1W7P A;  4Y15 A;  2FMY A;  4PGG A;  1MKM A;  3HRS A;  3WGI A;  1KQ9 A;  2RC4 A;  4HV6 A;  3IC7 A;  4PCQ A;  1AOY A;  3BY6 A;  1OMI A;  2O03 A;  1B9N A;  2OU2 A;  1SFX A;  2P5L C;  4DQ2 A;  3IWF A;  1BOA A;  4IXA A;  2MH2 A;  3ZP5 A;  2HQR A;  2VC1 A;  1SD7 A;  3RTR A;  2XGX A;  1OKR A;  4GCV A;  2ESN A;  3TOB A;  5D6E A;  1YQA A;  5JHU A;  1O3S A;  1U8R A;  4LFU A;  3RYP A;  4LB6 B;  3E5Q A;  3BJ6 A;  1IF1 A;  4NB5 A;  1ZG3 A;  2OZ6 A;  2P7C B;  3M7G A;  3RIR A;  1NHA A;  4ZYH A;  5HDK A;  1B4A A;  1IN7 A;  1OR7 A;  3R61 A;  3F8B A;  4RB1 A;  1B6A A;  4MGR A;  1J7K A;  4I7H A;  3KET A;  1HKS A;  1G3W A;  3KP2 A;  2UXN A;  3V7R A;  3SXY A;  3K0L A;  4U0Y A;  3FMS A;  1IXS B;  4QWQ A;  3WU1 B;  2PN6 A;  1O57 A;  2FSW A;  2G9W A;  3F22 A;  1IRG A;  2NNN A;  2EV0 A;  5E8I A;  1FPQ A;  5AON A;  4Z2Y A;  4ESF A;  3K2Z A;  2CW0 F;  1I27 A;  4KIF A;  1MDM A;  3P9I A;  3GFL A;  5J8F A;  4HAM A;  2GAU A;  3QU6 A;  3H92 A;  4IRG A;  2AS5 F;  2JSC A;  2L3D A;  4KMU X;  3L00 A;  1YO5 C;  2H94 A;  1TNS A;  2DTR A;  4RGX A;  2MD5 A;  4U0W A;  4EM2 A;  1K6O A;  1R1T A;  5D8L B;  1O7F A;  1KA8 A;  6PAX A;  3FM5 A;  3HOT A;  1JHF A;  5TJJ A;  1S3J A;  2ZJ2 A;  4KN7 X;  1VTN C;  1DDN A;  3HRM A;  3HSE A;  4M72 A;  4U7B A;  3WG9 A;  2GA2 A;  3O2P E;  1EH8 A;  2M45 A;  2VN2 A;  2HTS A;  4CGZ A;  2OQR A;  1K78 B;  1GXP A;  3R60 A;  2IA0 A;  4P96 A;  3FM3 A;  4YFK F;  3KE2 A;  1DPR A;  2JZY A;  1I1S A;  4GGG A;  2VXZ A;  3DF8 A;  5K5R A;  5HOO A;  1XDU A;  2IRF G;  4A5M A;  3U9G A;  4ZZL A;  1SD5 A;  4E70 A;  2WC2 A;  2DPD A;  2A69 F;  3DPT A;  1TTY A;  4ENJ A;  3E6D A;  1J5Y A;  2ISY A;  3KEO A;  1U78 A;  5DCM B;  1JE8 A;  3MAJ A;  1IAW A;  1O3T A;  3FHZ A;  1S7A A;  5F6F A;  3VFZ A;  1R36 A;  4MEX F;  4P9F A;  1T39 A;  3ML6 A;  2F5F A;  2FBK A;  2Q2E A;  2MBF A;  3J80 Z;  2K27 A;  2O61 A;  5FD6 A;  2VC0 A;  3DPL C;  2X0L A;  3KP3 A;  1IUY A;  3I0T A;  3KP6 A;  4HX7 A;  2Z5U A;  4LG0 B;  2H27 A;  2GWR A;  1HW2 A;  3I4P A;  3T8T A;  3C7J A;  1FSH A;  4LLN A;  1V4R A;  1U5T B;  2HOE A;  4BAY A;  4UVC A;  1RI7 A;  5ILV A;  1PP8 F;  3C1D A;  5DD8 A;  1IZ1 A;  1RIO H;  4HW0 A;  2DI3 A;  3P7N A;  3DQV C;  4L9N A;  4LK0 F;  2IA2 A;  2Q8K A;  2DT5 A;  2MLK A;  2K4J A;  1ON1 A;  1LDJ A;  2HKX A;  2H09 A;  2R3S A;  2P6T A;  3MWM A;  4JQF A;  1BI3 A;  2QWW A;  3PQJ A;  4A0Z A;  5D4R A;  1W7P B;  4KIG A;  5BPD A;  2NS0 A;  4HYE A;  2IW5 A;  1ZN2 A;  4UNO A;  1YW9 A;  4MNU A;  3WTW C;  1T0F A;  5L3F A;  3G3Z A;  2ISZ A;  4R1H A;  2YX4 A;  5CVU A;  2CSO A;  3JTG A;  4EMS A;  3VEP A;  4ENM A;  4EM0 B;  1FP2 A;  1BI1 A;  4GO1 A;  3EUH A;  2PMU A;  2FBI A;  1LEB A;  1D8J A;  3DFG A;  3MEX A;  3ZN0 A;  1XCB A;  5F1R A;  3IRR A;  3K1P A;  3Q9V A;  2D2W A;  4K2E A;  3F8M A;  4F7Z A;  2G7U A;  3WTZ A;  1XGM A;  2FU4 A;  5JFR A;  1T38 A;  4U0V A;  4UHT A;  3ABU A;  5FGM A;  1WKM A;  5LGU A;  4A0Y A;  1J0R A;  1IN5 A;  3LFK A;  4LMY A;  4G8X A;  2G7H A;  2RQP A;  1MDM B;  3T8R A;  1TW3 A;  1T98 A;  3JW4 A;  3K9T A;  4IPA A;  5D6F A;  2CFX A;  1V3F A;  3ZMD A;  3I71 A;  1FOK A;  4ENK A;  3TDU C;  2JT1 A;  1SAX A;  5LHG A;  5CVJ A;  2H6B A;  4Q47 A;  2C6Y A;  5HVQ C;  3W6J B;  5LHH A;  4A6D A;  4ESB A;  3VOD A;  1X3U A;  3LQR A;  1E2X A;  1KU3 A;  3BRO A;  5J6X A;  2Z99 A;  3WGG A;  5E18 F;  5CYV A;  2ZME A;  2HKO A;  4FX4 A;  1WWX A;  3GVA A;  1Q1H A;  3R6S A;  4M6X A;  4RGU A;  3QP6 A;  2HZT A;  1REP C;  1S8N A;  3L09 A;  4WXH A;  1FX7 A;  2FQ3 A;  2LNB A;  4JK1 X;  3KZZ A;  4MTE A;  3ECH A;  5D5X B;  3PQK A;  1ZGA A;  3TQN A;  1XGO A;  5A2Q K;  2M87 A;  2PQ8 A;  2HFH A;  2EFO A;  2V6C A;  3IKT A;  2PI0 A;  2A6H F;  1G3S A;  1MZB A;  2QVO A;  2XKO A;  2Y75 A;  2FXA A;  1FY7 A;  4I0B A;  1MJ9 A;  3J81 K;  2ZNY A;  2VE8 A;  3Q5F A;  1XDS A;  1DUX C;  2CYY A;  3F3X A;  4ENN A;  2FEZ A;  2V9V A;  1R7J A;  2XUB A;  3FF5 A;  4M9S A;  2L01 A;  4LD5 A;  1USS A;  5L3C A;  1P4W A;  2COM A;  4M71 A;  1P92 A;  2XAS A;  5EEH A;  1LJ9 A;  3GLX A;  5F64 A;  1GVJ A;  1I6X A;  4MHG A;  3HSR A;  2GIV A;  3FXR A;  2DW4 A;  1OYI A;  3PFI A;  4HQE A;  5D5W B;  1MD0 A;  5E17 F;  2XAF A;  4IHT A;  2UWM A;  1R58 A;  3SZT A;  3O3K A;  3DKW A;  3ZMS A;  1Z6T A;  2V1X A;  3WTT C;  2NRA C;  2UZK A;  4EGY A;  5LLQ A;  4A0X A;  2EFQ A;  2ZBK A;  5CVI A;  2O8X A;  4PDK A;  2V1D A;  3QAH A;  1DP7 P;  3MZH A;  2VBY A;  3TOA A;  5K5O A;  3E6B A;  3LQQ A;  5HS7 A;  3F8F A;  2W24 A;  3CUO A;  4Y17 A;  1YLF A;  2Z3Y A;  5DDG A;  1W5T A;  2EA2 A;  5HS8 A;  1JHH A;  1SFU A;  2D1H A;  1IN6 A;  3GX4 X;  3I58 A;  3FXQ A;  4P5O A;  2A07 F;  2NYX A;  4RB0 A;  3O6B B;  5E20 A;  1YYV A;  1I1G A;  2X4H A;  2RGV A;  2P6S A;  3JSO A;  2P5V A;  2XV4 S;  3GFJ A;  4L5J A;  4P9U A;  1B1B A;  2YSR A;  1D8K A;  3CJN A;  2O3F A;  1ZLK A;  4Q5S F;  1G3Y A;  5L3D A;  5HDN A;  3DXJ F;  1Z6R A;  3BJO A;  2O6G E;  3HTS B;  2STT A;  2D45 A;  3V8K A;  5ICC A;  2F2E A;  3RPQ A;  3N4M A;  4OIQ F;  5IT3 A;  4ZZD A;  2V79 A;  3F8N A;  4AD9 A;  1RNL A;  2XVC A;  4M6Y A;  3T0Y A;  2J5O A;  5D5V B;  3QRF F;  3CO7 C;  4UV8 A;  5DUK A;  2BBY A;  4IRI A;  1P4A A;  2HYF A;  4BXU A;  2KJB A;  1O3Q A;  2FA5 A;  3RKW A;  1KU9 A;  4L0Y B;  2QZ8 A;  2EFN A;  3OOP A;  1UST A;  3AAF A;  1TNT A;  3ERE D;  2IT0 A;  4EVI A;  4UVA A;  4AIJ A;  5IT9 Z;  4UVB A;  3GF2 A;  4WXC A;  2V1U A;  1BI0 A;  2ZCW A;  2A5Y B;  2VT3 A;  1ZG5 A;  4EJT A;  3K69 A;  4OIP F;  2DPU A;  4I0A A;  3RPU A;  1XSX A;  1SFE A;  5J8C A;  4HOB A;  1B9M A;  4L5I A;  2CG4 A;  3V4G A;  2M1B A;  1YS7 A;  2KIU A;  3QPH A;  1LB2 A;  1HXD A;  1Z1D A;  2OQG A;  2ZME B;  3KCC A;  5E1X A;  2GXB A;  2ZNZ A;  2PEX A;  3ZMZ A;  3F23 A;  4ZYD A;  3HOS A;  3I54 A;  3P9K A;  3ZMT A;  4YIF A;  1BI2 A;  4WF2 A;  4S04 A;  1TLH B;  2W85 A;  2A68 F;  4MQV A;  1CF7 A;  2CQK A;  2BE5 F;  5DYM A;  1LNW A;  4ETS A;  5CVR A;  5BS6 A;  4I02 A;  4Q48 A;  1BN5 A;  2XAG A;  3BOQ A;  4RAY A;  1YTY A;  1SD6 A;  1FYL A;  3BPV A;  1LEA A;  2ZO4 A;  2BV6 A;  3EDP A;  4UXN A;  4ZYE A;  3JTH A;  3FMR A;  4NHJ A;  2HEO A;  3IWZ A;  1KYZ A;  2J5P A;  2OZU A;  3TKY A;  1YW8 A;  3E5X A;  4BQA A;  2E7X A;  5HDG A;  4LB5 A;  5L3B A;  4NQW A;  2VE9 A;  3K1N A;  1R1V A;  3WE3 A;  1P6R A;  5LRS A;  2K86 A;  2EA4 A;  4FHT A;  1H9G A;  4RGS A;  5DUI A;  1TQM A;  1QPM A;  2P7V B;  2W84 A;  1ON2 A;  2JTV A;  2GQQ A;  2A3S A;  4YG2 F;  4H0E A;  2YPR A;  1Y0U A;  2CWE A;  4WXD A;  3CUQ A;  2EV5 A;  2M5W A;  2QQA A;  4XLN F;  5DV5 A;  5HLH A;  1AWC A;  3I59 A;  3KP4 A;  1K7A A;  5CVV A;  1KU7 A;  1BIB A;  3L7W A;  3C18 A;  1UHW A;  3V8L A;  2IPQ X;  2BYV E;  2LF7 A;  4A12 A;  2DQR A;  2VON A;  4YII A;  2PBI A;  4A2U A;  1S7O A;  2PMH A;  3MQ0 A;  3J80 K;  1QNT A;  4UV9 A;  4LK1 F;  1KQ8 A;  2ETH A;  4PGH A;  3LWF A;  5BQT A;  4CZZ A;  1O3R A;  1L3L A;  4G7O F;  5FLX Z;  2VOO A;  3L2C A;  1FBU A;  5JVT A;  3E97 A;  4HZF A;  4P55 A;  4KT5 C;  2YR2 A;  3EET A;  1L0O C;  1QQI A;  4HF1 A;  1MJB A;  2QLZ A;  1FYM A;  1TW2 A;  3HSF A;  4U7D A;  1W7P D;  2EFW A;  2EJR A;  2A61 A;  5BMZ A;  3E6M A;  1ZAR A;  4KIC A;  2NAZ A;  3HTU A;  2IA1 A;  4FT8 A;  1FT9 A;  2L54 A;  3CUQ C;  2FBH A;  4LJZ F;  3HHH A;  4MQ9 F;  2XHK A;  2QYO A;  1ZRC A;  2Y0M A;  4CYD A;  2KJC A;  1PP7 U;  3WTY C;  4GXO A;  1LDD A;  4LLL A;  1BM9 A;  1F4K A;  4R8H A;  1OYY A;  2QQB A;  4Q4Z F;  4KNY A;  4QLC U;  5DEQ A;  3M1E A;  3LA2 A;  2XAH A;  1TBX A;  2PG4 A;  3GWZ A;  3H3U A;  3JAM Z;  5FFZ A;  1F5T A;  3KEQ A;  1IXC A;  3WTU C;  1XSV A;  3IL2 A;  3BPX A;  4M73 A;  3D0S A;  4L9V A;  4EM1 A;  3U1D A;  3B73 A;  2ZXJ A;  3QOP A;  3FWE A;  2CGP A;  4XRF A;  3FX3 A;  2YU3 A;  3KZY A;  1J59 A;  3TO9 A;  2LSO A;  3DV8 A;  3ABT A;  1XGN A;  5K1Y A;  3F6V A;  1HW5 A;  4IRH A;  3GZ5 A;  1BBY A;  1R5H A;  2JPB A;  1Z05 A;  2ACJ A;  4KA4 A;  3MZY A;  3TO6 A;  4EQQ A;  3S2W A;  2JPC A;  2JRT A;  3ULQ B;  5E1Z B;  2Y48 A;  2WV0 A;  4M9Z A;  3RI4 A;  3EYY A;  1PUE E;  4OIO F;  1TQP A;  2DFI A;  1ONV A;  4N0B A;  2NNY A;  5HS9 A;  2E1C A;  3BP8 A;  1XD7 A;  1F9N A;  1E17 A;  1CF7 B;  2FOK A;  5BOX A;  1UCR A;  2PLY A;  1IXR C;  2K4B A;  3ZPL A;  1HW1 A;  5KVR A;  1HKT A;  4XBF A;  1RUO A;  3I5U A;  1ZGJ A;  1U2W A;  2QEN A;  2LDU A;  4PZJ A;  3SZP A;  1S6L A;  4LLG F;  3T1B A;  4L18 B;  4UUV A;  1ODD A;  1ZH5 A;  2DQL A;  3BJA A;  3DP7 A;  4HX4 A;  1WQ2 A;  3FXU A;  4IVN A;  3EYI A;  3MCZ A;  4BHP A;  1G4D A;  3TGN A;  4KFC A;  1QZZ A;  2EB7 A;  2MH9 A;  1EH7 A;  3LST A;  3RDI A;  4B8X A;  4HF2 A;  4HBL A;  1K79 A;  4BH9 A;  2VOD A;  2CO5 A;  2ADU A;  3J7A O;  3H3Z A;  2E7W A;  3BDD A;  4I01 A;  3P9C A;  3WTS C;  4GYG A;  2MLG A;  3CUQ B;  2GA1 A;  5JI6 A;  4CDG A;  1KGS A;  3I59 B;  3TDZ C;  4I2O A;  1P4X A;  4HX8 A;  2QUF A;  3LAP A;  1YW7 A;  3I64 A;  4N9H A;  1Z9C A;  1HQC A;  3V7C A;  4O6J A;  1FC3 A;  3E3V A;  5LEK A;  5ICF A;  5FO5 A;  4YFN F;  2ESH A;  4KN4 X;  3K1M A;  3R4K A;  4ASN A;  2XRO A;  5D4S A;  1D3Y A;  2W25 A;  3ELK A;  1XGS A;  2K7L A;  3IRQ A;  3ZMV A;  1ZAO A;  5ERI A;  2Q0O A;  1OPC A;  3M9A A;  5DCF A;  1P2F A;  3FMQ A;  4L0Z B;  4RGR A;  1G6N A;  2XIG A;  4L9J A;  3V7S A;  1IN4 A;  3BWG A;  5ICE A;  1J2X A;  1U5T C;  4WK8 F;  4TV7 A;  5HLG A;  3BZ6 A;  4ZH4 F;  2VT2 A;  5ILU A;  1UB9 A;  4S05 A;  3KP5 A;  3LA7 A;  2XAJ A;  4N9I A;  3TO7 A;  1IN8 A;  1BJA A;  1O7L A;  4EJU A;  4R79 A;  3ISP A;  1XSD A;  4M74 A;  2FNP A;  2KIM A;  5L3E A;  4EJW A;  4U88 A;  5LBQ A;  5BPI A;  2IJL A;  2E1N A;  1FZP B;  1YFH A;  3KLN A;  1QZY A;  2DK5 A;  1KYW A;  1RZ4 A;  2MA3 A;  3CLO A;  1UHM A;  2XAQ A;  1FWZ A;  1BC7 C;  4EJO A;  2HWV A;  1LVA A;  2YX7 A;  1STZ A;  2PFB A;  3WGH A;  2HGC A;  4OOI A;  2RN7 A;  1IRF A;  2UXX A;  2M8E A;  4CIC A;  2DBB A;  1XMK A;  4BHB A;  2VBX A;  3KFW X;  2B0L A;  2R7D A;  2RVC A;  3CO6 C;  1XCV A;  4M9X A;  4RAZ A;  3SFZ A;  4EV0 A;  5LEJ A;  3VB2 A;  1FLI A;  2KKO A;  5E8G A;  1Z7U A;  2RV8 A;  3WE2 A;  2QBY B;  4FX0 A;  2A6E F;  2TDX A;  1YIO A;  1BC8 C;  5ICG A;  1FBQ A;  4KIB A;  3M8E A;  3GFM A;  2HDC A;  2L02 A;  2MC3 A;  1DPU A;  3GEZ A;  4MEY F;  3GXO A;  3KLO A;  4KMF A;  2GZW A;  3GW2 A;  2DAO A;  1MJA A;  1ZG1 A;  2BGC A;  1H9T A;  3I53 A;  5IT9 K;  1J9I A;  3DEU A;  5D8K B;  1ZLJ A;  2IP2 A;  2IVM A;  4AIK A;  3D5L A;  3HRT A;  4BNC A;  2F5C A;  3RKX A;  3HIF A;  4HF0 A;  2Z33 A;  4IHS A;  3F8C A;  2WWY A;  1KU2 A;  4ON0 A;  1R00 A;  1RUN A;  4O5V A;  3WOD F;  4OMZ A;  2DK8 A;  2HQN A;  2M30 A;  4IF4 A;  2FNA A;  3IHU A;  2STW A;  3E5U A;  5DD4 A;  3ZN1 A;  3QU3 A;  3WTX C;  2EV6 A;  3EQL F;  1T6S A;  3HUG A;  1JXS A;  4A6E A;  2PJP A;  4AIH A;  1GXQ A;  4G7Z F;  3RKY A;  3ECO A;  1SD4 A;  2O0Y A;  1U3E M;  5AIP A;  5H20 A;  1S29 A;  2WTE A;  4BYY A;  2GXG A;  4HLY A;  4I09 A;  1HSJ A;  2P4W A;  5ILS A;  3NEU A;  4HDU A;  4XLP F;  3WTV C;  4AWX B;  3WU0 A;  1HKQ A;  1U6G A;  2KIF A;  2K02 A; 
#chains in the Genus database with same CATH topology
 3H0D A;  2VI6 A;  1ZYR F;  5J40 A;  3RZD J;  5HNF A;  2FML A;  1FNN A;  2ZKZ A;  4XRS G;  1R1U A;  4WX9 A;  2BY0 A;  4FE7 A;  3L9F A;  5M5Y J;  3AG1 H;  1OJL A;  4BDY A;  3G73 A;  4BS9 A;  1SMT A;  2PMZ A;  2CJJ A;  2NVQ J;  5KHD A;  1R23 A;  1HBX G;  3O8H A;  4RAF A;  4W97 A;  4HLX A;  5H6Q A;  3EUK L;  4EEF G;  5L3G A;  1R5G A;  1EH6 A;  3LAJ A;  3R0J A;  2RRE A;  4HA8 A;  3HRU A;  4AC0 A;  5FB2 A;  3TED A;  3A02 A;  5TRD A;  2EIL H;  3Q9S A;  1XB4 A;  4J01 A;  2DDB A;  4A3D J;  5KCM A;  1JTX A;  3CCS I;  3KPH A;  2QM3 A;  2ZFW A;  1IW7 F;  3OYA A;  4GYI A;  4G7H F;  1A6I A;  3HGG A;  3GFI A;  1ZHF A;  2DMP A;  2K9Q A;  2XRN A;  2HYG D;  3CJQ B;  2VJI A;  1MMS A;  1R6R A;  2JA8 J;  1LDK B;  2OA4 A;  4OU0 A;  3CCU I;  4Y52 J;  2E71 A;  2IGM A;  5LGN A;  4YIR X;  3ERM A;  1B59 A;  5LRR A;  4OIR F;  2FRH A;  4UUT A;  4EGZ A;  4L9T A;  3HB9 A;  3OV8 A;  3TL4 X;  4Y33 A;  3TP3 A;  5JR3 A;  4A3C J;  2I10 A;  2Y0S A;  2CUE A;  5IP9 J;  5K5Q A;  3HGY A;  4G6D A;  3ROU A;  1D5Y A;  3BG5 A;  1WJC A;  3L2W A;  3WG7 H;  5LFA A;  3K6G A;  4WCG A;  2DU9 A;  3RJP A;  3T5X A;  3HHG A;  1U8B A;  4C2M J;  4CHU A;  3KP7 A;  1W36 D;  4BKX A;  2Q1Z B;  2HR3 A;  4FE4 A;  1R22 A;  3S14 J;  4BEH B;  3IV5 A;  3LNQ A;  2X6X A;  1RET A;  2WAQ N;  4RS8 A;  1GVD A;  2RNJ A;  2W82 A;  1JGS A;  3LA3 A;  2PJR B;  4FCY A;  5A2Q Z;  4Y13 A;  1UFM A;  2FE3 A;  3C3W A;  1JUM A;  2R7F A;  4AVP A;  1WI9 A;  2WA0 A;  5AIQ A;  2H6C A;  2EWN A;  2HYJ A;  3HJE A;  4MIM A;  2W57 A;  4G6Q A;  4HQM A;  4XLA A;  4KDP A;  4KUM A;  1GHC A;  2Z9O A;  3K7A J;  3NRV A;  5LHI A;  3R0A A;  2BW3 B;  2BY2 A;  3NWS A;  4RLF A;  3J81 Z;  3ABM H;  1QO0 D;  3GO5 A;  5FD5 A;  2EZK A;  3COA C;  3JRC A;  2JK3 A;  5CJ9 A;  1C0W A;  1OQY A;  5CLS A;  3FZV A;  4BHC A;  4CXF A;  2LF8 A;  1LQ1 A;  2KZV A;  5JHF A;  1CGP A;  1B72 A;  4DNC A;  4BAC A;  5GAE J;  3MFK A;  3N97 A;  4LIU A;  4WWC A;  4JX4 A;  4ESJ A;  2KRF A;  2I5U A;  1DQU A;  2X85 A;  3DEE A;  2VOP A;  3BR3 A;  3DU5 A;  4NDL A;  3JSP A;  3ZMU A;  3F72 A;  1OYW A;  2L4A A;  1PYV A;  1W4M A;  3P5J A;  5FLX K;  4EJV A;  1XC5 A;  1XMA A;  4F3Q A;  2F5E A;  2BHY A;  2M0C A;  2VBZ A;  1JGG A;  4LGW A;  4PJN A;  2OD5 A;  1YRN A;  1FMW A;  2DOE A;  2LKS A;  2R7U A;  4YFX F;  3GZ6 A;  1FP1 D;  4XSZ F;  1T0F C;  2JUG A;  3GUD A;  1YJ9 I;  1K78 A;  3SQN A;  2IS4 A;  1D5V A;  1IDY A;  1MSF C;  1IRZ A;  2QBY A;  1KQ0 A;  2JA6 J;  5E1W A;  2FX0 A;  2B9S A;  3RYR A;  2ZJQ F;  3QOD A;  4JX5 A;  1ZTR A;  2NXN B;  1BIA A;  3F6O A;  2DLL A;  2FUG 2;  2L9N A;  1PDN C;  1EV7 A;  1QHH D;  1MSE C;  1I5Z A;  2X51 A;  1QGP A;  3EUH C;  3CCM I;  1H0M A;  5ED4 A;  2I8D A;  2HTJ A;  2DDA A;  5E3L A;  3CCE I;  4FQG A;  4PJJ A;  5C3E J;  1ZRD A;  1ZRF A;  1ZRE A;  2E5N A;  3LOC A;  1T8I A;  5C4X J;  2LKP A;  3CDH A;  3IKV A;  2D1V A;  1FOY A;  4B44 A;  5HLI A;  2JQ7 A;  2OBP A;  5EEG A;  1AKH A;  3CQZ J;  1J75 A;  1YOV B;  3BG3 A;  4ZDP A;  4II3 A;  1UG0 A;  1SMY F;  1F1Z A;  4DYQ A;  3ZQL A;  3VOE A;  5LD2 C;  3U2R A;  2AXL A;  5DCM A;  3S16 J;  4LIT A;  1A36 A;  2F5D A;  4XOP A;  3REO A;  5H6R A;  3Q0V A;  4OIN F;  3B02 A;  4UUS A;  4HV5 A;  5FLM J;  4D0P A;  4BE0 A;  4IJA A;  1TQI A;  4N4N B;  1YIJ I;  1DU6 A;  3HG9 A;  5D5U B;  2QQ9 A;  2L9R A;  1TC3 C;  4YEL A;  1PJR A;  4RB3 C;  1T2K A;  1OFC X;  1NK3 P;  3E6C C;  1MNM C;  3SJM A;  3VYT B;  2EK5 A;  1WRJ A;  3BG7 A;  2OAZ A;  5LGT A;  2P5K A;  2VBW A;  3W6K B;  4AVZ A;  4O3M A;  2EFP A;  4G94 A;  3CTA A;  2JJ7 A;  2RKH A;  1WJB A;  4NNJ A;  4LG0 A;  2F4M B;  2LRE A;  4KYW A;  3FXJ A;  1FSE A;  3JAM K;  4H4K C;  1WSU A;  2X1E A;  5GTI C;  1FTZ A;  2Q2E B;  4ZDO A;  4CO8 A;  3HYI A;  3KZI C;  2XKP A;  3NQO A;  1YS6 A;  1LKX A;  4XSX F;  4JBA A;  3CMY A;  3SHF A;  2V1N A;  2RDP A;  3CDL A;  4M3B A;  3KYD B;  4DZP A;  5E79 C;  2ELH A;  4MTD A;  1U5T A;  1Z91 A;  3BR0 A;  3F21 A;  2XSD C;  1YG2 A;  5FFX A;  5EEA A;  3M4O J;  3M8F A;  3OYH A;  1FBS A;  1APL C;  1MGT A;  2Y9Y A;  3V8J A;  4OMY A;  1FYK A;  3HUG B;  4HNV A;  1XN7 A;  2M0M A;  2R92 J;  2VL8 A;  1OIS A;  2ZME C;  1A04 A;  4D5F A;  3W3C A;  2HNH A;  2R93 J;  4G9Y A;  2DA5 A;  1G3T A;  3QP5 A;  3QPT A;  2DO7 A;  3GYH X;  4HNU A;  5FKK A;  2COB A;  1W5S A;  5HLT A;  4RB2 C;  3UKG A;  2L4M A;  2X6O A;  1ULY A;  4B09 A;  3W2W A;  1HST A;  1V5E A;  3ZQ7 A;  2BEO A;  2DA1 A;  4JOM A;  1VQM I;  2P8T A;  4IX7 A;  1OCP A;  4I98 B;  1R49 A;  5KK1 A;  5J3L A;  2FF4 A;  4A69 C;  4A5N A;  4HDV A;  3ZQF A;  4BJT A;  2GBY A;  2HS5 A;  4ZYG A;  1QBJ A;  2YU9 J;  2WV1 A;  4PSW A;  2MW8 A;  4BXX J;  5HNH A;  1W7P A;  4Y15 A;  2FMY A;  4PGG A;  2VLA A;  1LPQ A;  3Q0U A;  1MKM A;  3HRS A;  3WGI A;  1KQ9 A;  2RC4 A;  2ZC2 A;  4HV6 A;  2LMD A;  2NVY J;  3IC7 A;  1HC8 A;  4PCQ A;  1AOY A;  3PNT A;  3BY6 A;  1OMI A;  5CPR B;  2O03 A;  1B9N A;  2E60 A;  1G59 A;  2MSY A;  2E1O A;  3I4M J;  2NS8 A;  2OU2 A;  1SFX A;  1ERD A;  2P5L C;  2X48 A;  4DQ2 A;  3IWF A;  3WHC A;  1BOA A;  2LOO A;  4IXA A;  2MH2 A;  3PUF A;  2KFD A;  3ZP5 A;  2HQR A;  2VC1 A;  1SD7 A;  3RTR A;  2XGX A;  3CJR B;  1OKR A;  2R7O A;  4GCV A;  3CF5 F;  2ESN A;  3TOB A;  5D6E A;  5H2F C;  1YQA A;  5JHU A;  1RC9 A;  1O3S A;  1U8R A;  2CQX A;  1VQ4 I;  2R7W A;  4IHY A;  4ZYA A;  4LFU A;  3RYP A;  4LB6 B;  2ELJ A;  3FXK A;  2V6E A;  3E5Q A;  4C9Y A;  3BJ6 A;  1IF1 A;  4NB5 A;  3MMY B;  1ZG3 A;  2VJ4 A;  4M3F A;  2OZ6 A;  2JUC A;  3M7G A;  2P7C B;  3IAM 2;  3E7L A;  4BJ6 C;  4A3L J;  3IUO A;  3RIR A;  2UUZ A;  1NHA A;  1K61 A;  1HA8 A;  3CC4 I;  2BY3 A;  4ZYH A;  5HDK A;  1B4A A;  1A6Q A;  4Z6Y A;  1XX5 A;  1IN7 A;  1OR7 A;  1OLT A;  1IDZ A;  3BC8 A;  3R61 A;  3F8B A;  4RB1 A;  1B6A A;  1LE8 B;  4MGR A;  4BEH A;  3CES A;  1UMQ A;  1J7K A;  2AO9 A;  4I7H A;  3KET A;  3VYR B;  4IHV A;  3G2B A;  1HKS A;  1G3W A;  2V9P A;  3KP2 A;  1T56 A;  2UXN A;  3V7R A;  3SXY A;  3K0L A;  4U0Y A;  3U21 A;  3BLY A;  3FMS A;  3HOU J;  1IXS B;  1PUF B;  4QWQ A;  1EA3 A;  3WU1 B;  4RDU A;  2PN6 A;  1O57 A;  2FSW A;  2G9W A;  3F22 A;  1U9N A;  1IRG A;  2NNN A;  2EV0 A;  3HKZ N;  3QYF A;  3I4N J;  5E3N A;  5E8I A;  1FPQ A;  2W1O A;  5AON A;  4Z2Y A;  4ESF A;  3K2Z A;  4YEJ A;  2DOA A;  5IY5 H;  2LH9 A;  1LFB A;  2CW0 F;  1UAA A;  1I27 A;  1MBK A;  3B6A A;  4KIF A;  1MDM A;  1QPI A;  3P9I A;  1S5L C;  1WVR A;  3GFL A;  5J8F A;  3KYC B;  1LFP A;  1H89 C;  4HAM A;  2GAU A;  5IP7 J;  3OYB A;  3QU6 A;  3H92 A;  4IRG A;  2AS5 F;  2JSC A;  2L3D A;  4KMU X;  1W36 C;  3L00 A;  1YO5 C;  2H94 A;  4JX6 A;  1TNS A;  2M3A A;  2DTR A;  4RGX A;  1Y6I A;  3M3Y J;  2MD5 A;  4XN0 A;  4U0W A;  2VJ5 A;  4EM2 A;  5B66 C;  1K6O A;  1B72 B;  1R1T A;  2VQG A;  5D8L B;  1O7F A;  3MKW B;  1NG7 A;  1KA8 A;  6PAX A;  1D1C A;  3FM5 A;  3HOT A;  1JHF A;  2LVS A;  5TJJ A;  1S3J A;  2ZJ2 A;  4KN7 X;  4DYC A;  1VTN C;  1DDN A;  3H9J A;  3HRM A;  3HSE A;  4M72 A;  2V7F A;  3VYU B;  4U7B A;  3RQ4 A;  3WG9 A;  2GA2 A;  3O2P E;  1EH8 A;  2M45 A;  2VN2 A;  4D7N A;  1VQP I;  2DA3 A;  4B48 A;  2HTS A;  4CGZ A;  2OQR A;  4XID A;  1K78 B;  2HOS A;  3GTQ J;  1GXP A;  1FIA A;  1I39 A;  2DA6 A;  4JP0 A;  3LSP A;  1Y39 A;  3R60 A;  2IA0 A;  4P96 A;  3FM3 A;  1QRY A;  4YFK F;  1MMN A;  3KE2 A;  1DPR A;  2IGN A;  3OR2 C;  4F91 B;  2JZY A;  3DPU A;  1I1S A;  1ETQ A;  4J00 A;  2L5Q A;  4GGG A;  2VXZ A;  3AL0 C;  2CH0 A;  3DF8 A;  4NC8 A;  3GTG J;  5K5R A;  5HOO A;  1GDT A;  1XDU A;  2IRF G;  4A5M A;  1AKH B;  3U9G A;  4I99 C;  2LG4 A;  2LR8 A;  4ZZL A;  1SD5 A;  4E70 A;  3LSK A;  2WC2 A;  1EJ9 A;  2DPD A;  2A69 F;  2TRT A;  2BOL A;  3DPT A;  1TTY A;  4ENJ A;  3L2V A;  3E6D A;  2ME6 A;  1J5Y A;  2ISY A;  3VSK A;  2TCT A;  3KEO A;  2HDD A;  1U78 A;  5FKN A;  5DCM B;  1JE8 A;  4IL6 C;  4HRI A;  3MAJ A;  2RAE A;  4UUS B;  1IAW A;  2LLK A;  4XL9 A;  2RNG A;  3X2Q H;  1X1D A;  1O3T A;  3FHZ A;  1XS9 A;  1S7A A;  5F6F A;  3VFZ A;  1R36 A;  3K4B A;  4P9F A;  4MEX F;  1T39 A;  3ML6 A;  1BJZ A;  2F5F A;  2V4J C;  2FBK A;  3LSH A;  2Q2E A;  4DGW B;  1ETO A;  2MBF A;  2XGC A;  3J80 Z;  2K27 A;  3ZQG A;  2O61 A;  1F43 A;  5FD6 A;  2VC0 A;  2WBM A;  2DFH A;  3DPL C;  5K7F A;  1YE9 A;  2MAB A;  2X0L A;  3KP3 A;  2EIN H;  2K3F A;  1IUY A;  3GBG A;  3I0T A;  2WY7 Q;  3CJT B;  3KP6 A;  4HX7 A;  2Z5U A;  5EG0 B;  4HEA 2;  2P0W A;  2DMQ A;  4LG0 B;  2H27 A;  2GWR A;  3HOW J;  2K5C A;  3GZN B;  1HW2 A;  3I4P A;  2QSF X;  1R9T J;  4RMN A;  2IEK A;  3CME I;  5JLX A;  5EGO B;  4D5C A;  3T8T A;  2VAS A;  3C7J A;  3VWB A;  1FSH A;  4E7L A;  3HKZ A;  3MD2 A;  2NVT J;  4G12 A;  4LLN A;  4QIW N;  1V4R A;  1U5T B;  2HOE A;  5IYB J;  1ZQ3 P;  2MD0 A;  4S0H B;  4BAY A;  4UVC A;  2OCE A;  1MH3 A;  1RI7 A;  5ILV A;  5E3O A;  4J19 A;  3OYC A;  5M3M J;  1PP8 F;  1DU0 A;  2XB0 X;  2KRH A;  3C1D A;  5DD8 A;  4RBO A;  1IZ1 A;  4AU7 A;  4HW0 A;  1RIO H;  3VSL A;  3GTL J;  2JA2 A;  2DI3 A;  1W5C C;  3P7N A;  5M5W J;  1ETY A;  2OCC H;  3DQV C;  4L9N A;  5FRO A;  3FKI J;  1Z77 A;  4LK0 F;  1M1E B;  2IA2 A;  2LY1 A;  3D5R C;  2Q8K A;  2DT5 A;  2GOM A;  2MLK A;  2O5R A;  3DU6 A;  4KIS A;  1D0Z A;  1ZEL A;  2K4J A;  2L2O A;  3FXL A;  1ON1 A;  1LDJ A;  2HKX A;  2H09 A;  2R3S A;  2P6T A;  5EZG A;  3MWM A;  4JQF A;  1UJ8 A;  2JVG A;  2CU7 A;  1BI3 A;  3JCU C;  2QWW A;  3PQJ A;  4A0Z A;  5D4R A;  3K4N A;  3K70 D;  1W7P B;  3ASN H;  2LY2 A;  4KIG A;  3SEQ A;  3ZQI A;  3ZOB A;  3AFH A;  3PM1 A;  2KHM A;  5J4V A;  4CCJ A;  3H36 A;  5BPD A;  4ZC3 A;  2KP6 A;  2NS0 A;  4HYE A;  3J7A Y;  2IW5 A;  1ZN2 A;  4UNO A;  1YW9 A;  2MGQ A;  4MNU A;  3WTW C;  3SDB A;  1MMG A;  1T0F A;  5L3F A;  3G3Z A;  1BW5 A;  3L2R A;  2BZT A;  2ISZ A;  1MIJ A;  4R1H A;  4D1Q A;  1A5J A;  1TWF J;  2YX4 A;  2H1K A;  5CVU A;  2CSO A;  3OYD A;  4Y3O A;  3FK7 A;  2L7F P;  1MND A;  3JTG A;  4EMS A;  3DTE A;  3VEP A;  4FAS D;  4ENM A;  3ZRG A;  2XGE A;  4EM0 B;  1LE8 A;  1BI1 A;  1FP2 A;  3RKQ A;  3K10 A;  4GO1 A;  3EUH A;  3L1P A;  3BG9 A;  2PMU A;  2FBI A;  1LEB A;  1D8J A;  1VFC A;  3W2A A;  3DFG A;  3MEX A;  3ZN0 A;  5IP6 A;  1XCB A;  4A3J J;  1TT0 A;  1PUF A;  5B1A H;  5F1R A;  4BQN A;  3IRR A;  3FKJ A;  2FJ1 A;  3K1P A;  3Q9V A;  2D2W A;  1GV5 A;  4K2E A;  1JUS A;  1SVL A;  2W4S A;  3F8M A;  3W2V A;  2GM4 A;  3M1C A;  2E34 A;  1Z21 A;  4BL0 B;  4F7Z A;  3KYL A;  2G7U A;  3WTZ A;  1XGM A;  2FU4 A;  2KLO A;  2LBF A;  5JFR A;  2GXA A;  2GIZ A;  1T38 A;  4U0V A;  3MVP A;  1P9Q C;  3AL0 B;  4UHT A;  3ABU A;  5FGM A;  1WKM A;  4MFD A;  5LGU A;  4A0Y A;  1SC7 A;  3ZQH A;  3HM5 A;  1J0R A;  1IN5 A;  3DKX A;  1JKO C;  2HOA A;  4ZJZ A;  3LFK A;  1MMD A;  4LMY A;  1ITY A;  1FEX A;  5FLV A;  2F4I A;  2QEX I;  4MLO A;  2XF5 A;  1ZR4 A;  1GV2 A;  4G8X A;  3HOY J;  2QCO A;  5GAD J;  2F5V A;  1D0Y A;  2OJE D;  3ONQ A;  4MFE A;  3JRB A;  2DFE A;  3H35 A;  2IS2 A;  3H3V K;  2G7H A;  2RQP A;  1MDM B;  3T8R A;  3CMA I;  1TW3 A;  1T98 A;  3JW4 A;  3K9T A;  4IPA A;  5D6F A;  5B3S H;  2CFX A;  4A3M J;  1V3F A;  3ZMD A;  3I71 A;  3JR9 A;  4CCK A;  4ZDL A;  2X9D A;  1FOK A;  2IGO A;  4ENK A;  2W7N A;  3L2U A;  3TDU C;  2JT1 A;  1SAX A;  5DM6 F;  5LHG A;  4PUS A;  5CVJ A;  2H6B A;  2NVU B;  4MO7 A;  4Q47 A;  4CCO A;  2VQL A;  2C6Y A;  5HVQ C;  3W6J B;  5LHH A;  2KDO A;  4A6D A;  4BY7 J;  4ESB A;  3VOD A;  1X3U A;  3LQR A;  1E2X A;  1KU3 A;  3BRO A;  2YS9 A;  5J6X A;  2Z99 A;  1S72 I;  3WGG A;  3A0B C;  2M7B A;  2XPW A;  5CYV A;  1BR4 A;  5E18 F;  2ZME A;  2HKO A;  1E0E A;  4FX4 A;  1WWX A;  3GVA A;  1Q1H A;  3R6S A;  4M6X A;  4RGU A;  3QP6 A;  5E3M A;  1VQL I;  1X4O A;  1IV6 A;  2HZT A;  3PUB A;  1REP C;  2QF7 A;  4XLF A;  1S8N A;  1WJA A;  3BQY A;  3L09 A;  2HXO A;  4WXH A;  1FX7 A;  2FQ3 A;  4RM3 A;  4BQO A;  1TP4 A;  2LNB A;  2KPM A;  4JK1 X;  3KZZ A;  4MTE A;  3ECH A;  2CQN A;  5D5X B;  4BE2 A;  4IQJ A;  3PQK A;  3BTJ A;  2LYC A;  2A05 A;  4NC7 A;  1WGX A;  1ZGA A;  3VPR A;  1VQO I;  3TQN A;  1XGO A;  3D1N I;  4A3I J;  5DTD A;  4M3G A;  5A2Q K;  2K9L A;  2M4K A;  2XC7 A;  2M87 A;  2H8R A;  4XKW A;  2PQ8 A;  2HFH A;  2JA5 J;  1NTC A;  3OYI A;  1SAU A;  2CV0 A;  2EFO A;  1Y1W J;  4ZTF A;  2V6C A;  4A3G J;  3IKT A;  2PI0 A;  2HVR A;  2A6H F;  4AYB N;  1G3S A;  2EBI A;  3RPU D;  1MZB A;  2QVO A;  2XKO A;  2MG4 A;  3SFI A;  1Z3Y A;  5TGT A;  1VI0 A;  2VKE A;  2Y75 A;  3GLL A;  4Y4R A;  2E2H J;  2FXA A;  2OC6 A;  1FY7 A;  4I0B A;  1MJ9 A;  4PJ0 C;  3J81 K;  2ZNY A;  3PO2 J;  3J7Y J;  1AU7 A;  2VE8 A;  3Q5F A;  1XDS A;  1DUX C;  1ETK A;  2CYY A;  3F3X A;  4ENN A;  2FEZ A;  2V9V A;  2XPV A;  1R7J A;  2VJJ A;  2XUB A;  3FF5 A;  4M9S A;  5F0F A;  5EG0 A;  2WAF A;  2L01 A;  4HG2 A;  4LD5 A;  2DA2 A;  1USS A;  5K7Z A;  1WHU A;  5F27 A;  3OYM A;  4LOC A;  5L3C A;  2EZH A;  1P4W A;  4FET A;  4DBR A;  5EGO A;  2COM A;  4M71 A;  1P92 A;  3DLA A;  3L2Q A;  5FJ8 J;  3RCO A;  2XAS A;  5EEH A;  1LJ9 A;  3GLX A;  4D9J A;  2R0Q C;  5F64 A;  5M3F J;  1GVJ A;  1I6X A;  3G71 I;  4MHG A;  3HSR A;  3ESW B;  2GIV A;  3FXR A;  1ETX A;  2DW4 A;  3BZC A;  2IS6 A;  1YX5 A;  1N25 A;  1OYI A;  3PFI A;  4HQE A;  2WAQ A;  2E19 A;  4CZC A;  2NVX J;  4DBQ A;  1MD0 A;  5D5W B;  3S1Q J;  5E17 F;  2XAF A;  1ORK A;  3K4J A;  4IHT A;  1GLN A;  2UWM A;  1R58 A;  3C2G A;  3DKY A;  3CP8 A;  3SZT A;  3O3K A;  3DKW A;  3ZMS A;  2LRD A;  1Z6T A;  3OYF A;  3W6V A;  2V1X A;  1U9O A;  3WTT C;  2EIK H;  2NRA C;  2UZK A;  3FHN A;  4EGY A;  3PNV A;  1OCT C;  5LLQ A;  1KZH A;  5IPA A;  1RKW A;  2E2I J;  4A0X A;  4BUP A;  2EFQ A;  3MN2 A;  2ZBK A;  5CVI A;  1NK2 P;  5FRN A;  2O8X A;  2DJI A;  3M07 A;  4PDK A;  2V1D A;  3LSR A;  1T33 A;  3QAH A;  1TZL A;  1DP7 P;  2X6Y A;  3MZH A;  2VBY A;  3JRI A;  3TOA A;  5K5O A;  3E6B A;  2BY1 A;  2QGU A;  3OMY A;  3LQQ A;  5HS7 A;  3F8F A;  2W24 A;  3CUO A;  4V2G A;  4Y17 A;  4UY8 I;  5IOZ A;  3S93 A;  1YLF A;  2Z3Y A;  3S17 J;  5DDG A;  1W5T A;  4X1E A;  2EA2 A;  5HS8 A;  5B1B H;  2O8K A;  3O8G A;  1JHH A;  2P81 A;  1SFU A;  2X1D A;  3PO3 J;  2D1H A;  1IN6 A;  3KEY A;  2VPL A;  2YUS A;  1P7I A;  3GX4 X;  2LP0 A;  3C2B A;  3BR5 A;  3I58 A;  3FXQ A;  3ZQQ A;  4P5O A;  4E6K G;  2ZFU A;  1WZ2 A;  2A07 F;  4XKB A;  3BTI A;  1R4M B;  4LG3 A;  1D1A A;  2NYX A;  1TT5 B;  4RB0 A;  3O6B B;  4OAZ A;  2JN6 A;  5E20 A;  2DXI A;  3H0G J;  1YYV A;  1I1G A;  1D0X A;  2X4H A;  3OSG A;  2RGV A;  2P6S A;  3OS1 A;  1LUJ B;  3UR3 C;  1V55 H;  2KL4 A;  3JSO A;  2P5V A;  5J1Y A;  4ZTJ A;  2XV4 S;  3GFJ A;  4L5J A;  4P9U A;  1B1B A;  2YSR A;  3PFY A;  3SDG A;  2XB5 A;  1AA7 A;  3PIO F;  1VQ8 I;  1D8K A;  3CJN A;  2O3F A;  1X4P A;  4EAT A;  1T95 A;  1ZLK A;  4Q5S F;  4KJZ A;  1G3Y A;  5L3D A;  5HDN A;  2H1L A;  2E1M C;  3DXJ F;  4CUG A;  1Z6R A;  2ME0 A;  3BJO A;  1VQ9 I;  3S1M J;  2OTJ I;  3Q0W A;  1YHQ I;  1BR2 A;  3K70 C;  2O6G E;  2STT A;  3KIO A;  3HTS B;  3EPZ A;  2D45 A;  3V8K A;  5ICC A;  2F2E A;  3RPQ A;  3N4M A;  4BJ5 C;  3CCQ I;  1JKR C;  1XMX A;  3HC7 A;  5CKT A;  4OIQ F;  1ENH A;  5IT3 A;  2QQ8 A;  4ZZD A;  2V79 A;  3F8N A;  3CCL I;  1RPW A;  2HVS A;  3DWL E;  4AD9 A;  5J1R A;  2RQQ A;  2V9K A;  1RNL A;  2XVC A;  4M6Y A;  3T0Y A;  2J5O A;  5D5V B;  3QRF F;  2KZG A;  3CO7 C;  4UV8 A;  4IHW A;  5DUK A;  2BBY A;  4CH7 A;  2R7T A;  4AYB A;  5FKL A;  3S2D J;  4IRI A;  1P4A A;  1K4T A;  2HYF A;  4BXU A;  3S3M A;  2M2E A;  2KJB A;  1O3Q A;  2WB1 N;  1X1P A;  2VPR A;  3PIP F;  4DW6 A;  2FA5 A;  3RKW A;  1KU9 A;  4L0Y B;  4F55 A;  2LBF B;  3PJR A;  2QZ8 A;  2EFN A;  3OOP A;  3VDX A;  3BR1 A;  1UST A;  3AAF A;  1MBH A;  3UNG C;  2ID3 A;  3CC7 I;  1TNT A;  3H9Q A;  2DMT A;  3ERE D;  2IT0 A;  4EVI A;  4E7I A;  3JRF A;  2CW8 A;  4UVA A;  4AIJ A;  5IT9 Z;  5DS9 A;  4UVB A;  3A0H C;  4XRM A;  2VQH A;  3DBR B;  3AG2 H;  3GF2 A;  3H5N A;  4WXC A;  2V1U A;  1BI0 A;  3Q3S A;  2ZCW A;  3LFU A;  3BR2 A;  2A5Y B;  3QPS A;  2VT3 A;  1Y8Q B;  2DA7 A;  1ZG5 A;  4EJT A;  5M5X J;  1Y1V J;  2HPM A;  4PK4 A;  3K69 A;  4RA2 A;  4ABZ A;  2K3P A;  4OIP F;  4C2T A;  3ZQC A;  3AG4 H;  1RR7 A;  1QZE A;  3SYT A;  4I0A A;  2DPU A;  3RPU A;  4XM3 A;  2E2J J;  4XLE A;  1XSX A;  1EKE A;  2ZB9 A;  1SFE A;  3M8J A;  5J8C A;  2AHQ A;  4HOB A;  3B6C A;  3C2H A;  1B9M A;  1DGR M;  2HVQ A;  1CQT A;  4L5I A;  2CG4 A;  5J47 A;  1P7J A;  3V4G A;  4DJA A;  2M1B A;  2K9M A;  1YS7 A;  4F93 B;  2KIU A;  3SEZ A;  1EF4 A;  3QPH A;  1LB2 A;  2LTP A;  1HXD A;  1Z1D A;  2OQG A;  2ZME B;  3KCC A;  5E1X A;  4AUX A;  1I6H J;  2GXB A;  2LKX A;  3LL7 A;  1HDP A;  2ZNZ A;  2PEX A;  4V2F A;  1GUU A;  1VQ5 I;  4BGD A;  3ZMZ A;  2EIM H;  3F23 A;  4HST A;  1ZKG A;  4ZYD A;  3HOS A;  1RR8 C;  4XK4 A;  1W0U A;  1IV8 A;  2BXZ A;  2AXT C;  3I54 A;  3OYK A;  1OCZ H;  3F0C A;  2EZI A;  3EUA A;  2CRG A;  3P9K A;  4BE1 A;  1R71 A;  3ZMT A;  4YIF A;  1BI2 A;  4WF2 A;  1SEU A;  4S04 A;  4B43 A;  1TLH B;  3HPH A;  2W85 A;  2A68 F;  2OV7 A;  4MQV A;  3JRE A;  4M3D A;  2CQK A;  1CF7 A;  2BE5 F;  3OSF A;  5DYM A;  1LNW A;  2B7E A;  5IYC J;  3LSG A;  4ETS A;  5CVR A;  5K7H A;  2HI3 A;  5BS6 A;  4I02 A;  3GTP J;  4Q48 A;  1BN5 A;  2XAG A;  5C4J J;  3BOQ A;  5GAH J;  4RAY A;  4QTR A;  5FKO A;  4D7M A;  3FBI B;  3GTK J;  1YTY A;  3IAS 2;  5JVG F;  1SD6 A;  2DJN A;  1FYL A;  1BA5 A;  2XRL A;  3BPV A;  4L5E A;  1LEA A;  1F36 A;  2ZO4 A;  3I55 I;  3K4L A;  2BV6 A;  3MKL A;  3EDP A;  2JRM A;  4II2 A;  4UXN A;  1YJW I;  4ZYE A;  3JTH A;  1B8I A;  2L9S A;  3FMR A;  1MBJ A;  1IJW C;  3CF2 A;  3TMO A;  4ANJ A;  4XOT A;  2L0K A;  4HNT A;  2NOJ B;  4NHJ A;  2HEO A;  3IWZ A;  1KYZ A;  2J5P A;  2OZU A;  3TKY A;  1YW8 A;  3HXL A;  2DYS H;  3K4C A;  2WAE A;  3E5X A;  3OYJ A;  3BR6 A;  4BQA A;  2E1M B;  5GPA A;  2E7X A;  1NH3 A;  5HDG A;  1RRJ A;  1QVT A;  4LB5 A;  3ZR8 X;  5L3B A;  2ZJR F;  1IO2 A;  2W00 A;  1WCM J;  4NQW A;  2WB1 A;  2VE9 A;  3K1N A;  1R1V A;  3WE3 A;  1P6R A;  1JKP C;  2V26 A;  4E7Z A;  2EIJ H;  5LRS A;  2K86 A;  3LSJ A;  3CCV I;  2EA4 A;  2OUM A;  4FHT A;  3CCR I;  4OAY A;  4OWR B;  2HQ5 A;  1H9G A;  4XQF A;  1MBF A;  4RGS A;  5DUI A;  1TQM A;  1QPM A;  2IXS A;  3BCA A;  2P7V B;  4BU2 A;  2VQC A;  4G6T B;  4DOZ A;  2W84 A;  5IOY A;  1ON2 A;  1ZGW A;  2JTV A;  1ACI A;  2GQQ A;  4UB8 C;  2A3S A;  1QA6 A;  2H8W A;  3HL2 A;  4NBQ A;  3FXO A;  2R7Z J;  4YG2 F;  4H0E A;  4IO9 F;  1AHD P;  3CDI A;  2YPR A;  1Y0U A;  2CWE A;  3OS2 A;  1E3P A;  4WXD A;  4BBS J;  2M4G A;  2R4G A;  3CUQ A;  2EV5 A;  2M5W A;  2QQA A;  4XLN F;  2F6C A;  1ZK8 A;  5DV5 A;  5HLH A;  1X3Z B;  1AWC A;  4XLC A;  3I59 A;  2R7S A;  3A01 A;  3KP4 A;  2K9N A;  1K7A A;  2QKL B;  2L7Z A;  5CVV A;  3V42 A;  4AM3 A;  3FIS A;  1KU7 A;  1BIB A;  3GTM J;  2A5W A;  3L7W A;  1N75 A;  2MYS A;  3C18 A;  5BNG A;  1YJN I;  4FTH A;  1UHW A;  5CQG A;  4KIT B;  2KQR A;  1BL0 A;  4P1W A;  3V8L A;  2IPQ X;  2BYV E;  2LF7 A;  3QYE A;  5J4Y A;  4A12 A;  2HDW A;  4M6V A;  2DQR A;  2VON A;  4YII A;  2PBI A;  4A2U A;  1S7O A;  2PMH A;  3MQ0 A;  3J80 K;  1QNT A;  3OWT A;  4UV9 A;  1VQ7 I;  4LK1 F;  1KQ8 A;  2ETH A;  4IHX A;  1TWC J;  4PGH A;  4IOC F;  3LWF A;  2L9V A;  5BQT A;  4CZZ A;  1MBE A;  1S7E A;  1O3R A;  1L3L A;  1HDD C;  4IKF A;  4G7O F;  5FLX Z;  3ZXS A;  1HCR A;  3HDD A;  1WI3 A;  2VOO A;  3L2C A;  2HPI A;  1FBU A;  4XKV A;  1VZ0 A;  3LMM A;  4XMY A;  5JVT A;  3E97 A;  4HZF A;  2OTL I;  1WJD A;  4P55 A;  1JJ8 C;  4KT5 C;  1BR1 A;  2R5Z A;  3S15 J;  2YR2 A;  1X1B A;  3JRH A;  1V54 H;  5IYD J;  3EET A;  4I6Z A;  1WH5 A;  1L0O C;  1QQI A;  4HF1 A;  2BVL A;  1SVO A;  1MJB A;  2QLZ A;  3DLL F;  2R7Q A;  1FYM A;  5F04 A;  3BZK A;  1TW2 A;  3HSF A;  2ICW G;  4F92 B;  4U7D A;  2ID6 A;  1JI8 A;  3PSI A;  2JA7 J;  1W7P D;  5EZH A;  1WPK A;  2GLO A;  2K9S A;  2EFW A;  3RQI A;  2EJR A;  2NS7 A;  4CCL A;  5EDN A;  3S1R J;  2ECC A;  2A61 A;  2CV1 A;  3H5A A;  5BMZ A;  1FTT A;  2XAU A;  1R4N B;  5EF6 A;  3E6M A;  3TW7 A;  1ZAR A;  4BQQ A;  1IC8 A;  3S3O A;  1TWG J;  4HPQ A;  4KIC A;  4A3B J;  1WJE A;  2NAZ A;  2CUF A;  2L7K A;  3HTU A;  2IA1 A;  4FT8 A;  1FT9 A;  2L54 A;  3CUQ C;  2FBH A;  5GP9 A;  4XRS A;  4E7H A;  4LJZ F;  3HHH A;  1FIP A;  4MQ9 F;  2XHK A;  3TP0 A;  2QYO A;  1ZRC A;  2Y0M A;  4CYD A;  2KJC A;  1PP7 U;  3E0J B;  3GME A;  2MC4 A;  3FXM A;  3WTY C;  2DOD A;  3PSF A;  1LDD A;  4GXO A;  1BM9 A;  5TIS C;  4LLL A;  1F4K A;  1FOW A;  4R8H A;  4PFP A;  2N8G A;  5JLW A;  1OYY A;  3OYN A;  2R7R A;  2QQB A;  4Q4Z F;  4KNY A;  4QPQ A;  3HOZ J;  2Z16 A;  4QLC U;  1X1A A;  2D5V A;  5DEQ A;  3M1E A;  4CYC A;  3F9K A;  1U0J A;  3LA2 A;  4BBR J;  2F48 A;  4U87 A;  4B3X A;  4C3H J;  4E4H A;  2DT6 A;  2XAH A;  4RAG A;  1TBX A;  3VYS B;  1LFU P;  2PG4 A;  3GWZ A;  3DEW A;  3H3U A;  3HZJ A;  3S2H J;  1VF9 A;  4AID A;  1JT6 A;  4ITV A;  3JAM Z;  3CD6 I;  5FFZ A;  1F5T A;  3KEQ A;  3RSN A;  1IXC A;  2F4O B;  3G1O A;  3WTU C;  4XR6 A;  5KNL A;  2XDV A;  1XSV A;  3IL2 A;  3BPX A;  2O9L A;  2VB6 A;  4M73 A;  3D0S A;  4UB6 C;  4L9V A;  4EM1 A;  3U1D A;  3FDY A;  3JRA A;  3B73 A;  4XN3 A;  2ZXJ A;  3I56 I;  3ZCO A;  4PJM A;  3QOP A;  2CFO A;  4A3E J;  3FWE A;  2CGP A;  4XRF A;  3FX3 A;  1GT0 C;  2YU3 A;  3QWL A;  1POG A;  3KZY A;  3AG3 H;  3NAR A;  2KIQ A;  3TO9 A;  1J59 A;  4GFB A;  2LSO A;  3DV8 A;  3OIO A;  3ABT A;  3OS0 A;  3BG6 A;  1XGN A;  5K1Y A;  3S3N A;  3QYB A;  2DYR H;  2DFF A;  3F6V A;  1HW5 A;  4IRH A;  5EYR A;  3GZ5 A;  1BBY A;  1R5H A;  2CQQ A;  2JPB A;  2WAD A;  1Z05 A;  2ACJ A;  4KA4 A;  3MZY A;  3TO6 A;  4EQQ A;  1YI2 I;  3S2W A;  1X2M A;  2JPC A;  4E7J A;  4JYK A;  2R7V A;  1BOB A;  2JRT A;  3H1C A;  4QPO A;  1V5G A;  3ULQ B;  2E36 A;  5E1Z B;  1JTY A;  2Y48 A;  2K40 A;  2WV0 A;  4M9Z A;  3RI4 A;  1Z67 A;  3EYY A;  1PUE E;  2OF7 A;  4OIO F;  1TQP A;  2DFI A;  3OR1 C;  1ONV A;  4N0B A;  4B47 A;  1VQ6 I;  1T08 B;  2NNY A;  5HS9 A;  2E1C A;  3BP8 A;  1XD7 A;  1F9N A;  1E17 A;  1E3H A;  1CF7 B;  2R5Y A;  2FOK A;  5BOX A;  1VND A;  3MZ8 A;  2IS1 A;  1UCR A;  1Y0N A;  2CUZ A;  2M7A A;  3OYE A;  2A6T A;  2PLY A;  4XKC A;  2LD5 A;  3OIP A;  1IXR C;  2K4B A;  3ZPL A;  2QSH X;  1HW1 A;  5KVR A;  1HKT A;  1K6Y A;  4XBF A;  1RUO A;  2CUJ A;  1O4X A;  3CLQ A;  2VKH A;  3I5U A;  1ETV A;  2DCE A;  1ZGJ A;  2L7M P;  2R7X A;  3I3L A;  1U2W A;  2QEN A;  2LDU A;  4DZJ A;  4PZJ A;  4CCN A;  1N78 A;  3SZP A;  3H5R A;  1LVK A;  1S6L A;  3OL3 A;  4LLG F;  3T1B A;  4L18 B;  1B8I B;  4UUV A;  1ODD A;  2M9H A;  4GDF A;  1S9H A;  1ZH5 A;  4IOA F;  3NAU A;  2DMU A;  1NG6 A;  2DQL A;  2EH3 A;  2BHZ A;  4CSW A;  5F1J A;  1K83 J;  3BJA A;  3CZ6 A;  1ETW A;  4RM2 A;  3DP7 A;  2CQ7 A;  4HX4 A;  1MMA A;  1UZC A;  1WQ2 A;  3FXU A;  1UHS A;  4IVN A;  3G6E I;  2EPF A;  1QU3 A;  3EYI A;  3MCZ A;  4BHP A;  1FOX A;  1I3Q J;  2XPU A;  4B3A A;  4DIQ A;  3TGN A;  4Y7N J;  2ZSI B;  1G4D A;  3OIQ A;  1XTA A;  2DA4 A;  4KFC A;  1RES A;  1QZZ A;  2DT7 B;  1WH7 A;  2KIS A;  3NWT A;  4NQW B;  2EB7 A;  1XPX A;  2KRC A;  5CQE A;  2MH9 A;  2WY8 Q;  1EH7 A;  2W48 A;  3LST A;  3CC2 I;  4V19 K;  3RDI A;  2M34 A;  3DCF A;  4B8X A;  4HF2 A;  4HBL A;  1K79 A;  3S32 A;  4BH9 A;  2VOD A;  2CO5 A;  4KT6 A;  2ADU A;  1IRX A;  3J7A O;  4NUB A;  3H3Z A;  2E7W A;  2LK2 A;  2ELK A;  2JSP A;  3BDD A;  3DTI A;  5J1U A;  4I01 A;  3K4M A;  3P9C A;  3TW6 A;  1QHG A;  4W1U A;  3WTS C;  3G4S I;  3I9V 2;  4GYG A;  1Q1V A;  3MKZ A;  2MLG A;  3HEF A;  5C44 J;  3CUQ B;  3HPG A;  2GA1 A;  4HSR A;  4XIC A;  5JI6 A;  4CDG A;  3OY9 A;  5DM7 F;  1KGS A;  2KMU A;  3I59 B;  3SZG A;  3TDZ C;  3G1M A;  3HOV J;  4I2O A;  5FRM A;  1P4X A;  4HX8 A;  3A01 B;  2QUF A;  3LAP A;  1YW7 A;  3I64 A;  4N9H A;  1Z9C A;  1BW6 A;  1HQC A;  3V7C A;  4O6J A;  4F52 A;  3K4K A;  1FC3 A;  3E3V A;  3N05 A;  5LEK A;  1A31 A;  4NC6 A;  5FO5 A;  5ICF A;  3TBI A;  2XGD A;  4YFN F;  2ESH A;  4KN4 X;  3K1M A;  5KAI C;  3R4K A;  1G8X A;  4ASN A;  2XRO A;  2Z1D A;  3CMM A;  5D4S A;  1MW7 A;  2JMW A;  1D3Y A;  4XLH A;  1VQK I;  2W25 A;  3ELK A;  4C3I J;  1E3O C;  2B63 J;  1XGS A;  2K7L A;  1FMV A;  4I76 A;  3IRQ A;  2FQ4 A;  2XF6 A;  3ZMV A;  4X6A J;  1ZAO A;  4PJL A;  5ERI A;  2Y30 A;  2Q0O A;  3QPL A;  1OPC A;  3M9A A;  5DCF A;  3CCY A;  2QA4 I;  2M8G X;  4BDZ A;  2VUM J;  1P2F A;  3FMQ A;  1Z0X A;  3CP2 A;  1Z7L A;  4RGR A;  4L0Z B;  1FJL A;  1G6N A;  3PNY A;  2XIG A;  1G2H A;  4L9J A;  3FBN B;  3H9G A;  4BY1 J;  1IUF A;  2G0E A;  3V7S A;  1IN4 A;  2R5Z B;  3BWG A;  5ICE A;  1X19 A;  3KX2 A;  2JWT A;  1HF0 A;  4E7K A;  1J2X A;  3IH3 A;  4BXF A;  1U5T C;  4WK8 F;  2CS3 A;  3ZGK A;  1X58 A;  4TV7 A;  5GAG J;  5HLG A;  4C3J J;  3OL4 A;  3G1L A;  1TL8 A;  3BZ6 A;  3BCB A;  1RKT A;  4ZH4 F;  2VT2 A;  5ILU A;  1UB9 A;  4S05 A;  3KP5 A;  5F0H A;  2PJR A;  1Y8R B;  4RLQ A;  3WU2 C;  3LA7 A;  2XAJ A;  4FIS A;  4CA0 A;  2ECB A;  4XON A;  1OCR H;  4N9I A;  3TO7 A;  1IN8 A;  1SVM A;  4IEJ A;  2IBD A;  1BJA A;  1O7L A;  4EJU A;  4R79 A;  3ISP A;  1XSD A;  1X1C A;  4M74 A;  2FNP A;  2BXY A;  1QVU A;  2NOG A;  1OCC H;  2KIM A;  5L3E A;  3D5S C;  2BW3 A;  2VXD A;  4EJW A;  2ZXH A;  4U88 A;  2HQA A;  5LBQ A;  5BPI A;  3RZO J;  2IJL A;  3S1N J;  2UV1 A;  2E1N A;  2KT0 A;  1N77 A;  2Y69 H;  1FZP B;  3S8P A;  9ANT A;  1YFH A;  1IGN A;  1WJF A;  3KLN A;  4X0G A;  1HOM A;  1QZY A;  1Y56 A;  2DK5 A;  2EZL A;  2DTZ A;  1KYW A;  1RZ4 A;  4IQ4 A;  2MA3 A;  3CLO A;  1K4S A;  1UHM A;  2ZSH B;  2XAQ A;  1FWZ A;  3FIW A;  1UG2 A;  5GTH C;  4CYC B;  1BC7 C;  4EJO A;  2HWV A;  3JRG A;  2E5Z A;  1LVA A;  1YX3 A;  2YX7 A;  1STZ A;  2LC2 A;  2AQE A;  5B5E C;  2PFB A;  3WGH A;  2HGC A;  3ABK H;  2RN7 A;  4M3E A;  4OOI A;  4DYR A;  1IRF A;  3MKY B;  2UXX A;  2HU9 A;  2M8E A;  4CIC A;  4XOR A;  4C2U A;  2DBB A;  1XMK A;  4BHB A;  3BQZ A;  3U1K A;  2VBX A;  3KFW X;  1R5I D;  2B0L A;  2PMZ N;  3QQA A;  4XNF A;  2R7D A;  2RVC A;  3CO6 C;  1KON A;  1MH4 A;  2Z2S B;  1XCV A;  4M9X A;  4RAZ A;  3SFZ A;  4EV0 A;  5LEJ A;  1TWH J;  3VB2 A;  3CCJ I;  3LSI A;  1SFK A;  3QOE A;  1FLI A;  1YRN B;  4YRV A;  1H8A C;  1SFO J;  2KKO A;  5E8G A;  3PL8 A;  3DBL B;  5KAF C;  1D1B A;  1Z7U A;  2RV8 A;  3WE2 A;  2IGK A;  2QBY B;  2QKM B;  4FX0 A;  2KDZ A;  1OR7 C;  5GPC A;  3K2A A;  2A6E F;  2Y2Z A;  2TDX A;  1YIO A;  2X6W A;  1BC8 C;  1DP3 A;  1JT0 A;  1W0T A;  2HZD A;  1FBQ A;  5ICG A;  2LFB A;  3A03 A;  4KIB A;  2DOF A;  4LIV A;  3M8E A;  3GFM A;  3WHB A;  2JVH A;  2HDC A;  1WJ5 A;  2L02 A;  3HOX J;  2MC3 A;  1JKQ C;  1DGW Y;  1DPU A;  3GEZ A;  1VQN I;  2VKD A;  4MEY F;  3GXO A;  3GCM A;  3KLO A;  3DTK A;  4KMF A;  1V5F A;  2GZW A;  3GW2 A;  3GTO J;  2DAO A;  1JJ6 C;  1MJA A;  2Y0S N;  2BGC A;  4E7S A;  1ZG1 A;  1H9T A;  1JUP A;  2FOW A;  3I53 A;  5IT9 K;  3A2K A;  1J9I A;  2E35 A;  1ZR2 A;  3ABL H;  3DEU A;  3ASO H;  2BVM A;  4B1R A;  1MBG A;  5D8K B;  2ZJP F;  1ZLJ A;  1WFX A;  2IP2 A;  2IVM A;  4AIK A;  3D5L A;  3FK6 A;  4PFO A;  3HRT A;  4BNC A;  2CV2 A;  2QSG X;  2PX9 A;  1I50 J;  2F5C A;  2X1C A;  2EQR A;  3RKX A;  1A35 A;  3HIF A;  2HXI A;  4HF0 A;  4A93 J;  2Z33 A;  4IHS A;  2R5Y B;  3AKZ A;  3F8C A;  4N4O B;  2WWY A;  4IZZ A;  1PVE A;  1KU2 A;  5HOD A;  1Z3X A;  4ON0 A;  1R00 A;  1IG7 A;  4QSH A;  1RUN A;  4O5V A;  2XF7 A;  1X2N A;  2DN0 A;  3WOD F;  4OMZ A;  4B4C A;  2DK8 A;  4PSX A;  4GRI A;  2HQN A;  2VIX A;  2M30 A;  4IF4 A;  3DBH B;  2CW7 A;  2FNA A;  3IH4 A;  3JRD A;  1YIT I;  1HLV A;  3IHU A;  2ZXW H;  4C30 A;  2STW A;  2Y31 A;  3E5U A;  5DD4 A;  3OYG A;  3ZN1 A;  2FD5 A;  3LSM A;  3GTJ J;  2XSJ C;  3QU3 A;  4A3K J;  3WTX C;  2EV6 A;  3EQL F;  1T6S A;  1TWA J;  3HUG A;  3BT9 A;  1JXS A;  4A6E A;  1J09 A;  3J7Z I;  2PJP A;  3IH2 A;  3OOU A;  2AQF A;  4AIH A;  4CCM A;  1GXQ A;  2IAI A;  4G7Z F;  3RKY A;  2O7O A;  3ECO A;  5F08 A;  1H88 C;  1SD4 A;  1MNE A;  2O0Y A;  2Y9Z A;  1OCO H;  3E1S A;  1U3E M;  5AIP A;  2MFZ A;  5H20 A;  5EJC A;  2K85 A;  2LY9 A;  1S29 A;  2WTE A;  4BYY A;  3A1Y A;  2VKV A;  3A4C A;  1UEL B;  2GXG A;  2HOT A;  2DMN A;  4HLY A;  4I09 A;  1HSJ A;  1XG1 A;  1SAN A;  2P4W A;  5F0C A;  3OYL A;  3IP4 B;  5ILS A;  3BTL A;  5FKM A;  3NEU A;  3HBL A;  3BTC A;  4A3F J;  1X3W B;  4HDU A;  1W1W E;  2OPT A;  4XLP F;  3WTV C;  2ZXI A;  4AWX B;  3WU0 A;  1HKQ A;  1I3A A;  2GOX B;  1U6G A;  2KIF A;  2K02 A;  2CMP A; 
#chains in the Genus database with same CATH homology
 1ZYR F;  2FML A;  1FNN A;  2ZKZ A;  1R1U A;  4WX9 A;  3L9F A;  3G73 A;  1SMT A;  1R23 A;  1HBX G;  4HLX A;  5H6Q A;  5L3G A;  1R5G A;  1EH6 A;  3LAJ A;  3R0J A;  4HA8 A;  3HRU A;  5FB2 A;  5TRD A;  3Q9S A;  1XB4 A;  2QM3 A;  2ZFW A;  1IW7 F;  4GYI A;  4G7H F;  3GFI A;  1ZHF A;  2XRN A;  2HYG D;  1LDK B;  2OA4 A;  4OU0 A;  5LGN A;  5LRR A;  1B59 A;  4OIR F;  2FRH A;  4EGZ A;  4L9T A;  3OV8 A;  5JR3 A;  5K5Q A;  4G6D A;  3ROU A;  4WCG A;  2DU9 A;  3RJP A;  3T5X A;  3HHG A;  4CHU A;  3KP7 A;  2HR3 A;  1R22 A;  4RS8 A;  2RNJ A;  1JGS A;  3LA3 A;  5A2Q Z;  4Y13 A;  1UFM A;  2FE3 A;  3C3W A;  2R7F A;  4AVP A;  1WI9 A;  5AIQ A;  2H6C A;  2EWN A;  2W57 A;  4G6Q A;  4HQM A;  4KDP A;  4KUM A;  1GHC A;  2Z9O A;  3NRV A;  5LHI A;  3R0A A;  3J81 Z;  1QO0 D;  3GO5 A;  5FD5 A;  3COA C;  5CJ9 A;  1C0W A;  5CLS A;  3FZV A;  4BHC A;  4CXF A;  2LF8 A;  1LQ1 A;  1CGP A;  4DNC A;  3MFK A;  3N97 A;  4WWC A;  4ESJ A;  2KRF A;  2VOP A;  3JSP A;  3ZMU A;  3F72 A;  1OYW A;  2L4A A;  1W4M A;  5FLX K;  4EJV A;  1XMA A;  2F5E A;  2VBZ A;  4LGW A;  2OD5 A;  4YFX F;  3GZ6 A;  1FP1 D;  4XSZ F;  3GUD A;  1K78 A;  3SQN A;  1D5V A;  2QBY A;  1KQ0 A;  5E1W A;  3RYR A;  1BIA A;  3F6O A;  2DLL A;  1PDN C;  1EV7 A;  1I5Z A;  1QGP A;  1H0M A;  5ED4 A;  2HTJ A;  1ZRD A;  1ZRE A;  1ZRF A;  2LKP A;  3CDH A;  3IKV A;  2D1V A;  5HLI A;  2OBP A;  5EEG A;  1J75 A;  1SMY F;  1F1Z A;  3VOE A;  3U2R A;  2AXL A;  5DCM A;  2F5D A;  3REO A;  5H6R A;  4OIN F;  3B02 A;  4HV5 A;  4D0P A;  4IJA A;  1TQI A;  5D5U B;  2QQ9 A;  4RB3 C;  1T2K A;  3E6C C;  2EK5 A;  1WRJ A;  2OAZ A;  5LGT A;  2P5K A;  2VBW A;  3W6K B;  4O3M A;  2EFP A;  4G94 A;  3CTA A;  2RKH A;  4LG0 A;  4KYW A;  1FSE A;  3JAM K;  1WSU A;  4CO8 A;  3HYI A;  3NQO A;  2XKP A;  4XSX F;  1YS6 A;  4JBA A;  3SHF A;  2RDP A;  4MTD A;  2ELH A;  1U5T A;  1Z91 A;  3F21 A;  1YG2 A;  5FFX A;  3M8F A;  1FBS A;  1MGT A;  3V8J A;  4OMY A;  1FYK A;  1XN7 A;  1A04 A;  4G9Y A;  3QP5 A;  1G3T A;  3QPT A;  2DO7 A;  3GYH X;  4RB2 C;  1W5S A;  2L4M A;  1ULY A;  4B09 A;  1HST A;  3ZQ7 A;  2BEO A;  2P8T A;  4I98 B;  5KK1 A;  2FF4 A;  4A5N A;  4HDV A;  2HS5 A;  4ZYG A;  1QBJ A;  1W7P A;  4Y15 A;  2FMY A;  4PGG A;  1MKM A;  3HRS A;  3WGI A;  1KQ9 A;  2RC4 A;  4HV6 A;  3IC7 A;  4PCQ A;  1AOY A;  3BY6 A;  1OMI A;  2O03 A;  1B9N A;  2OU2 A;  1SFX A;  2P5L C;  4DQ2 A;  3IWF A;  1BOA A;  4IXA A;  2MH2 A;  3ZP5 A;  2HQR A;  2VC1 A;  1SD7 A;  3RTR A;  2XGX A;  1OKR A;  4GCV A;  2ESN A;  3TOB A;  5D6E A;  1YQA A;  5JHU A;  1O3S A;  1U8R A;  4LFU A;  3RYP A;  4LB6 B;  3E5Q A;  3BJ6 A;  1IF1 A;  4NB5 A;  1ZG3 A;  2OZ6 A;  2P7C B;  3M7G A;  3RIR A;  1NHA A;  4ZYH A;  5HDK A;  1B4A A;  1IN7 A;  1OR7 A;  3R61 A;  3F8B A;  4RB1 A;  1B6A A;  4MGR A;  1J7K A;  4I7H A;  3KET A;  1HKS A;  1G3W A;  3KP2 A;  2UXN A;  3V7R A;  3SXY A;  3K0L A;  4U0Y A;  3FMS A;  1IXS B;  4QWQ A;  3WU1 B;  2PN6 A;  1O57 A;  2FSW A;  2G9W A;  3F22 A;  1IRG A;  2NNN A;  2EV0 A;  5E8I A;  1FPQ A;  5AON A;  4Z2Y A;  4ESF A;  3K2Z A;  2CW0 F;  1I27 A;  4KIF A;  1MDM A;  3P9I A;  3GFL A;  5J8F A;  4HAM A;  2GAU A;  3QU6 A;  3H92 A;  4IRG A;  2AS5 F;  2JSC A;  2L3D A;  4KMU X;  3L00 A;  1YO5 C;  2H94 A;  1TNS A;  2DTR A;  4RGX A;  2MD5 A;  4U0W A;  4EM2 A;  1K6O A;  1R1T A;  5D8L B;  1O7F A;  1KA8 A;  6PAX A;  3FM5 A;  3HOT A;  1JHF A;  5TJJ A;  1S3J A;  2ZJ2 A;  4KN7 X;  1VTN C;  1DDN A;  3HRM A;  3HSE A;  4M72 A;  4U7B A;  3WG9 A;  2GA2 A;  3O2P E;  1EH8 A;  2M45 A;  2VN2 A;  2HTS A;  4CGZ A;  2OQR A;  1K78 B;  1GXP A;  3R60 A;  2IA0 A;  4P96 A;  3FM3 A;  4YFK F;  3KE2 A;  1DPR A;  2JZY A;  1I1S A;  4GGG A;  2VXZ A;  3DF8 A;  5K5R A;  5HOO A;  1XDU A;  2IRF G;  4A5M A;  3U9G A;  4ZZL A;  1SD5 A;  4E70 A;  2WC2 A;  2DPD A;  2A69 F;  3DPT A;  1TTY A;  4ENJ A;  3E6D A;  1J5Y A;  2ISY A;  3KEO A;  1U78 A;  5DCM B;  1JE8 A;  3MAJ A;  1IAW A;  1O3T A;  3FHZ A;  1S7A A;  5F6F A;  3VFZ A;  1R36 A;  4MEX F;  4P9F A;  1T39 A;  3ML6 A;  2F5F A;  2FBK A;  2Q2E A;  2MBF A;  3J80 Z;  2K27 A;  2O61 A;  5FD6 A;  2VC0 A;  3DPL C;  2X0L A;  3KP3 A;  1IUY A;  3I0T A;  3KP6 A;  4HX7 A;  2Z5U A;  4LG0 B;  2H27 A;  2GWR A;  1HW2 A;  3I4P A;  3T8T A;  3C7J A;  1FSH A;  4LLN A;  1V4R A;  1U5T B;  2HOE A;  4BAY A;  4UVC A;  1RI7 A;  5ILV A;  1PP8 F;  3C1D A;  5DD8 A;  1IZ1 A;  1RIO H;  4HW0 A;  2DI3 A;  3P7N A;  3DQV C;  4L9N A;  4LK0 F;  2IA2 A;  2Q8K A;  2DT5 A;  2MLK A;  2K4J A;  1ON1 A;  1LDJ A;  2HKX A;  2H09 A;  2R3S A;  2P6T A;  3MWM A;  4JQF A;  1BI3 A;  2QWW A;  3PQJ A;  4A0Z A;  5D4R A;  1W7P B;  4KIG A;  5BPD A;  2NS0 A;  4HYE A;  2IW5 A;  1ZN2 A;  4UNO A;  1YW9 A;  4MNU A;  3WTW C;  1T0F A;  5L3F A;  3G3Z A;  2ISZ A;  4R1H A;  2YX4 A;  5CVU A;  2CSO A;  3JTG A;  4EMS A;  3VEP A;  4ENM A;  4EM0 B;  1FP2 A;  1BI1 A;  4GO1 A;  3EUH A;  2PMU A;  2FBI A;  1LEB A;  1D8J A;  3DFG A;  3MEX A;  3ZN0 A;  1XCB A;  5F1R A;  3IRR A;  3K1P A;  3Q9V A;  2D2W A;  4K2E A;  3F8M A;  4F7Z A;  2G7U A;  3WTZ A;  1XGM A;  2FU4 A;  5JFR A;  1T38 A;  4U0V A;  4UHT A;  3ABU A;  5FGM A;  1WKM A;  5LGU A;  4A0Y A;  1J0R A;  1IN5 A;  3LFK A;  4LMY A;  4G8X A;  2G7H A;  2RQP A;  1MDM B;  3T8R A;  1TW3 A;  1T98 A;  3JW4 A;  3K9T A;  4IPA A;  5D6F A;  2CFX A;  1V3F A;  3ZMD A;  3I71 A;  1FOK A;  4ENK A;  3TDU C;  2JT1 A;  1SAX A;  5LHG A;  5CVJ A;  2H6B A;  4Q47 A;  2C6Y A;  5HVQ C;  3W6J B;  5LHH A;  4A6D A;  4ESB A;  3VOD A;  1X3U A;  3LQR A;  1E2X A;  1KU3 A;  3BRO A;  5J6X A;  2Z99 A;  3WGG A;  5E18 F;  5CYV A;  2ZME A;  2HKO A;  4FX4 A;  1WWX A;  3GVA A;  1Q1H A;  3R6S A;  4M6X A;  4RGU A;  3QP6 A;  2HZT A;  1REP C;  1S8N A;  3L09 A;  4WXH A;  1FX7 A;  2FQ3 A;  2LNB A;  4JK1 X;  3KZZ A;  4MTE A;  3ECH A;  5D5X B;  3PQK A;  1ZGA A;  3TQN A;  1XGO A;  5A2Q K;  2M87 A;  2PQ8 A;  2HFH A;  2EFO A;  2V6C A;  3IKT A;  2PI0 A;  2A6H F;  1G3S A;  1MZB A;  2QVO A;  2XKO A;  2Y75 A;  2FXA A;  1FY7 A;  4I0B A;  1MJ9 A;  3J81 K;  2ZNY A;  2VE8 A;  3Q5F A;  1XDS A;  1DUX C;  2CYY A;  3F3X A;  4ENN A;  2FEZ A;  2V9V A;  1R7J A;  2XUB A;  3FF5 A;  4M9S A;  2L01 A;  4LD5 A;  1USS A;  5L3C A;  1P4W A;  2COM A;  4M71 A;  1P92 A;  2XAS A;  5EEH A;  1LJ9 A;  3GLX A;  5F64 A;  1GVJ A;  1I6X A;  4MHG A;  3HSR A;  2GIV A;  3FXR A;  2DW4 A;  1OYI A;  3PFI A;  4HQE A;  5D5W B;  1MD0 A;  5E17 F;  2XAF A;  4IHT A;  2UWM A;  1R58 A;  3SZT A;  3O3K A;  3DKW A;  3ZMS A;  1Z6T A;  2V1X A;  3WTT C;  2NRA C;  2UZK A;  4EGY A;  5LLQ A;  4A0X A;  2EFQ A;  2ZBK A;  5CVI A;  2O8X A;  4PDK A;  2V1D A;  3QAH A;  1DP7 P;  3MZH A;  2VBY A;  3TOA A;  5K5O A;  3E6B A;  3LQQ A;  5HS7 A;  3F8F A;  2W24 A;  3CUO A;  4Y17 A;  1YLF A;  2Z3Y A;  5DDG A;  1W5T A;  2EA2 A;  5HS8 A;  1JHH A;  1SFU A;  2D1H A;  1IN6 A;  3GX4 X;  3I58 A;  3FXQ A;  4P5O A;  2A07 F;  2NYX A;  4RB0 A;  3O6B B;  5E20 A;  1YYV A;  1I1G A;  2X4H A;  2RGV A;  2P6S A;  3JSO A;  2P5V A;  2XV4 S;  3GFJ A;  4L5J A;  4P9U A;  1B1B A;  2YSR A;  1D8K A;  3CJN A;  2O3F A;  1ZLK A;  4Q5S F;  1G3Y A;  5L3D A;  5HDN A;  3DXJ F;  1Z6R A;  3BJO A;  2O6G E;  3HTS B;  2STT A;  2D45 A;  3V8K A;  5ICC A;  2F2E A;  3RPQ A;  3N4M A;  4OIQ F;  5IT3 A;  4ZZD A;  2V79 A;  3F8N A;  4AD9 A;  1RNL A;  2XVC A;  4M6Y A;  3T0Y A;  2J5O A;  5D5V B;  3QRF F;  3CO7 C;  4UV8 A;  5DUK A;  2BBY A;  4IRI A;  1P4A A;  2HYF A;  4BXU A;  2KJB A;  1O3Q A;  2FA5 A;  3RKW A;  1KU9 A;  4L0Y B;  2QZ8 A;  2EFN A;  3OOP A;  1UST A;  3AAF A;  1TNT A;  3ERE D;  2IT0 A;  4EVI A;  4UVA A;  4AIJ A;  5IT9 Z;  4UVB A;  3GF2 A;  4WXC A;  2V1U A;  1BI0 A;  2ZCW A;  2A5Y B;  2VT3 A;  1ZG5 A;  4EJT A;  3K69 A;  4OIP F;  2DPU A;  4I0A A;  3RPU A;  1XSX A;  1SFE A;  5J8C A;  4HOB A;  1B9M A;  4L5I A;  2CG4 A;  3V4G A;  2M1B A;  1YS7 A;  2KIU A;  3QPH A;  1LB2 A;  1HXD A;  1Z1D A;  2OQG A;  2ZME B;  3KCC A;  5E1X A;  2GXB A;  2ZNZ A;  2PEX A;  3ZMZ A;  3F23 A;  4ZYD A;  3HOS A;  3I54 A;  3P9K A;  3ZMT A;  4YIF A;  1BI2 A;  4WF2 A;  4S04 A;  1TLH B;  2W85 A;  2A68 F;  4MQV A;  1CF7 A;  2CQK A;  2BE5 F;  5DYM A;  1LNW A;  4ETS A;  5CVR A;  5BS6 A;  4I02 A;  4Q48 A;  1BN5 A;  2XAG A;  3BOQ A;  4RAY A;  1YTY A;  1SD6 A;  1FYL A;  3BPV A;  1LEA A;  2ZO4 A;  2BV6 A;  3EDP A;  4UXN A;  4ZYE A;  3JTH A;  3FMR A;  4NHJ A;  2HEO A;  3IWZ A;  1KYZ A;  2J5P A;  2OZU A;  3TKY A;  1YW8 A;  3E5X A;  4BQA A;  2E7X A;  5HDG A;  4LB5 A;  5L3B A;  4NQW A;  2VE9 A;  3K1N A;  1R1V A;  3WE3 A;  1P6R A;  5LRS A;  2K86 A;  2EA4 A;  4FHT A;  1H9G A;  4RGS A;  5DUI A;  1TQM A;  1QPM A;  2P7V B;  2W84 A;  1ON2 A;  2JTV A;  2GQQ A;  2A3S A;  4YG2 F;  4H0E A;  2YPR A;  1Y0U A;  2CWE A;  4WXD A;  3CUQ A;  2EV5 A;  2M5W A;  2QQA A;  4XLN F;  5DV5 A;  5HLH A;  1AWC A;  3I59 A;  3KP4 A;  1K7A A;  5CVV A;  1KU7 A;  1BIB A;  3L7W A;  3C18 A;  1UHW A;  3V8L A;  2IPQ X;  2BYV E;  2LF7 A;  4A12 A;  2DQR A;  2VON A;  4YII A;  2PBI A;  4A2U A;  1S7O A;  2PMH A;  3MQ0 A;  3J80 K;  1QNT A;  4UV9 A;  4LK1 F;  1KQ8 A;  2ETH A;  4PGH A;  3LWF A;  5BQT A;  4CZZ A;  1O3R A;  1L3L A;  4G7O F;  5FLX Z;  2VOO A;  3L2C A;  1FBU A;  5JVT A;  3E97 A;  4HZF A;  4P55 A;  4KT5 C;  2YR2 A;  3EET A;  1L0O C;  1QQI A;  4HF1 A;  1MJB A;  2QLZ A;  1FYM A;  1TW2 A;  3HSF A;  4U7D A;  1W7P D;  2EFW A;  2EJR A;  2A61 A;  5BMZ A;  3E6M A;  1ZAR A;  4KIC A;  2NAZ A;  3HTU A;  2IA1 A;  4FT8 A;  1FT9 A;  2L54 A;  3CUQ C;  2FBH A;  4LJZ F;  3HHH A;  4MQ9 F;  2XHK A;  2QYO A;  1ZRC A;  2Y0M A;  4CYD A;  2KJC A;  1PP7 U;  3WTY C;  4GXO A;  1LDD A;  4LLL A;  1BM9 A;  1F4K A;  4R8H A;  1OYY A;  2QQB A;  4Q4Z F;  4KNY A;  4QLC U;  5DEQ A;  3M1E A;  3LA2 A;  2XAH A;  1TBX A;  2PG4 A;  3GWZ A;  3H3U A;  3JAM Z;  5FFZ A;  1F5T A;  3KEQ A;  1IXC A;  3WTU C;  1XSV A;  3IL2 A;  3BPX A;  4M73 A;  3D0S A;  4L9V A;  4EM1 A;  3U1D A;  3B73 A;  2ZXJ A;  3QOP A;  3FWE A;  2CGP A;  4XRF A;  3FX3 A;  2YU3 A;  3KZY A;  1J59 A;  3TO9 A;  2LSO A;  3DV8 A;  3ABT A;  1XGN A;  5K1Y A;  3F6V A;  1HW5 A;  4IRH A;  3GZ5 A;  1BBY A;  1R5H A;  2JPB A;  1Z05 A;  2ACJ A;  4KA4 A;  3MZY A;  3TO6 A;  4EQQ A;  3S2W A;  2JPC A;  2JRT A;  3ULQ B;  5E1Z B;  2Y48 A;  2WV0 A;  4M9Z A;  3RI4 A;  3EYY A;  1PUE E;  4OIO F;  1TQP A;  2DFI A;  1ONV A;  4N0B A;  2NNY A;  5HS9 A;  2E1C A;  3BP8 A;  1XD7 A;  1F9N A;  1E17 A;  1CF7 B;  2FOK A;  5BOX A;  1UCR A;  2PLY A;  1IXR C;  2K4B A;  3ZPL A;  1HW1 A;  5KVR A;  1HKT A;  4XBF A;  1RUO A;  3I5U A;  1ZGJ A;  1U2W A;  2QEN A;  2LDU A;  4PZJ A;  3SZP A;  1S6L A;  4LLG F;  3T1B A;  4L18 B;  4UUV A;  1ODD A;  1ZH5 A;  2DQL A;  3BJA A;  3DP7 A;  4HX4 A;  1WQ2 A;  3FXU A;  4IVN A;  3EYI A;  3MCZ A;  4BHP A;  1G4D A;  3TGN A;  4KFC A;  1QZZ A;  2EB7 A;  2MH9 A;  1EH7 A;  3LST A;  3RDI A;  4B8X A;  4HF2 A;  4HBL A;  1K79 A;  4BH9 A;  2VOD A;  2CO5 A;  2ADU A;  3J7A O;  3H3Z A;  2E7W A;  3BDD A;  4I01 A;  3P9C A;  3WTS C;  4GYG A;  2MLG A;  3CUQ B;  2GA1 A;  5JI6 A;  4CDG A;  1KGS A;  3I59 B;  3TDZ C;  4I2O A;  1P4X A;  4HX8 A;  2QUF A;  3LAP A;  1YW7 A;  3I64 A;  4N9H A;  1Z9C A;  1HQC A;  3V7C A;  4O6J A;  1FC3 A;  3E3V A;  5LEK A;  5ICF A;  5FO5 A;  4YFN F;  2ESH A;  4KN4 X;  3K1M A;  3R4K A;  4ASN A;  2XRO A;  5D4S A;  1D3Y A;  2W25 A;  3ELK A;  1XGS A;  2K7L A;  3IRQ A;  3ZMV A;  1ZAO A;  5ERI A;  2Q0O A;  1OPC A;  3M9A A;  5DCF A;  1P2F A;  3FMQ A;  4L0Z B;  4RGR A;  1G6N A;  2XIG A;  4L9J A;  3V7S A;  1IN4 A;  3BWG A;  5ICE A;  1J2X A;  1U5T C;  4WK8 F;  4TV7 A;  5HLG A;  3BZ6 A;  4ZH4 F;  2VT2 A;  5ILU A;  1UB9 A;  4S05 A;  3KP5 A;  3LA7 A;  2XAJ A;  4N9I A;  3TO7 A;  1IN8 A;  1BJA A;  1O7L A;  4EJU A;  4R79 A;  3ISP A;  1XSD A;  4M74 A;  2FNP A;  2KIM A;  5L3E A;  4EJW A;  4U88 A;  5LBQ A;  5BPI A;  2IJL A;  2E1N A;  1FZP B;  1YFH A;  3KLN A;  1QZY A;  2DK5 A;  1KYW A;  1RZ4 A;  2MA3 A;  3CLO A;  1UHM A;  2XAQ A;  1FWZ A;  1BC7 C;  4EJO A;  2HWV A;  1LVA A;  2YX7 A;  1STZ A;  2PFB A;  3WGH A;  2HGC A;  4OOI A;  2RN7 A;  1IRF A;  2UXX A;  2M8E A;  4CIC A;  2DBB A;  1XMK A;  4BHB A;  2VBX A;  3KFW X;  2B0L A;  2R7D A;  2RVC A;  3CO6 C;  1XCV A;  4M9X A;  4RAZ A;  3SFZ A;  4EV0 A;  5LEJ A;  3VB2 A;  1FLI A;  2KKO A;  5E8G A;  1Z7U A;  2RV8 A;  3WE2 A;  2QBY B;  4FX0 A;  2A6E F;  2TDX A;  1YIO A;  1BC8 C;  5ICG A;  1FBQ A;  4KIB A;  3M8E A;  3GFM A;  2HDC A;  2L02 A;  2MC3 A;  1DPU A;  3GEZ A;  4MEY F;  3GXO A;  3KLO A;  4KMF A;  2GZW A;  3GW2 A;  2DAO A;  1MJA A;  1ZG1 A;  2BGC A;  1H9T A;  3I53 A;  5IT9 K;  1J9I A;  3DEU A;  5D8K B;  1ZLJ A;  2IP2 A;  2IVM A;  4AIK A;  3D5L A;  3HRT A;  4BNC A;  2F5C A;  3RKX A;  3HIF A;  4HF0 A;  2Z33 A;  4IHS A;  3F8C A;  2WWY A;  1KU2 A;  4ON0 A;  1R00 A;  1RUN A;  4O5V A;  3WOD F;  4OMZ A;  2DK8 A;  2HQN A;  2M30 A;  4IF4 A;  2FNA A;  3IHU A;  2STW A;  3E5U A;  5DD4 A;  3ZN1 A;  3QU3 A;  3WTX C;  2EV6 A;  3EQL F;  1T6S A;  3HUG A;  1JXS A;  4A6E A;  2PJP A;  4AIH A;  1GXQ A;  4G7Z F;  3RKY A;  3ECO A;  1SD4 A;  2O0Y A;  1U3E M;  5AIP A;  5H20 A;  1S29 A;  2WTE A;  4BYY A;  2GXG A;  4HLY A;  4I09 A;  1HSJ A;  2P4W A;  5ILS A;  3NEU A;  4HDU A;  4XLP F;  3WTV C;  4AWX B;  3WU0 A;  1HKQ A;  1U6G A;  2KIF A;  2K02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...