4S0HB

Tbx5 db, nkx2.5 hd, anf dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords T-box transcription factor TBX5
publication title Intermolecular Interactions of Cardiac Transcription Factors NKX2.5 and TBX5.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 53
sequence length 53
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4s0hB00
1LE8A 2R5YB 2Y9ZA 1UHSA 5GP9A 1H8AC 1Z77A 4C3HJ 2CRGA 5IPAA 2M2EA 1MNMC 1BA5A 1IC8A 4IHWA 1JUMA 1ZK8A 2L0KA 1B72A 5JLXA 3TW6A 1W0UA 1ETVA 1XC5A 3BR5A 3O8HA 5J1UA 1NK3P 3C2BA 3IV5A 1OCTC 3I4NJ 4MFDA 5JLWA 2ID6A 3ZQLA 1WPKA 1VFCA 3GBGA 3LSPA 4IHVA 5DS9A 1TWCJ 2PMZN 1UG2A 1OCPA 1DU0A 2DA1A 1I3QJ 2M0CA 3HB9A 4W97A 1HDDC 2DTZA 2FX0A 1RR7A 4MLOA 3ZQFA 3HGYA 3JRBA 1FTTA 2AO9A 2IBDA 2L7FP 2K40A 4QSHA 1Z0XA 3FISA 1LE8B 5C3EJ 2YU9J 2E1OA 2XGEA 4A3BJ 3CMYA 1JTXA 1H88C 4IHYA 2ECBA 1LFBA 2EQRA 5M5WJ 1B72B 4IHXA 5IYDJ 2EZHA 1X2MA 1IG7A 1QVTA 1JKPC 4DW6A 4Y52J 5IOZA 3LSRA 1BJZA 3JRIA 5EZHA 2LFBA 4V2FA 3HM5A 5M3FJ 4ABZA 5HODA 1Y1VJ 2JA5J 3ZQCA 2E2JJ 2ME0A 2XGDA 5IP6A 1RKTA 3S14J 2WAQN 1JKRC 2LVSA 5J1YA 2JJ7A 3FK6A 2CUEA 3BQZA 5EG0A 3DCFA 1ZKGA 4NDLA 1TC3C 3E7LA 3TW7A 4BKXA 2EZLA 5K7HA 5FKLA 2Y31A 3BG3A 3BR6A 4FE4A 1ITYA 1TWHJ 4JX5A 2VKEA 5M5XJ 4JX6A 4FISA 1O4XA 1ENHA 1ZGWA 4AYBN 4A3MJ 4XRSA 2DA6A 4MO7A 4RDUA 2JK3A 2DMUA 2TCTA 2ID3A 1P7JA 2COBA 1IJWC 2JWTA 3S2HJ 2ECCA 3S1QJ 2FD5A 2KT0A 3JREA 1MBKA 3ZQIA 3WHBA 1MBJA 1Q1VA 3GTJJ 2WB1N 2LTPA 3QQAA 4QIWN 5K7FA 5EEAA 1IV6A 3HOXJ 2L7ZA 2DA3A 5F27A 5EG0B 2E2HJ 3JRDA 3S15J 2DA2A 2JN6A 3GTOJ 4M6VA 1FIPA 5EGOA 2DA7A 4B3AA 1P7IA 2O9LA 3G1MA 1B8IA 1BW6A 2QF7A 2DMNA 4FE7A 1TWGJ 4I6ZA 3K7AJ 5F0CA 1H89C 4CYCA 3H0GJ 1T33A 2H1KA 1AU7A 3ZQGA 4A3GJ 3JRCA 2DMTA 3TEDA 1GVDA 2FJ1A 1U9OA 1ORKA 2DN0A 1IRZA 4HNVA 3QPSA 4UUSA 1ETYA 2XSDC 3JRGA 1T56A 2HOAA 1JKOC 4X6AJ 3VPRA 3TP0A 4BBRJ 3BR0A 1AKHB 3G1OA 5EGOB 4BBSJ 1NK2P 3RZOJ 4JX4A 1JTYA 2W48A 2NOGA 1B8IB 3H3VK 3HDDA 1MBEA 2DMQA 4M3GA 4JP0A 3BR2A 1PUFA 4B4CA 4A3FJ 2EZIA 2YUSA 3TP3A 3S17J 4D5CA 3HKZN 3Q3SA 2XPVA 2MSYA 2DMPA 5F0FA 4CYCB 3A01A 1WI3A 1NTCA 3MKLA 1VNDA 3PO2J 1JJ8C 2M9HA 2LP0A 4MFEA 2JA7J 2EH3A 2NS7A 2Y2ZA 2HQ5A 1ZR4A 5J1RA 2XB5A 5DTDA 2XRLA 2OF7A 1RPWA 4UUSB 1F36A 5C44J 3RKQA 3LSJA 3PO3J 3IH4A 2K9SA 4BY1J 2HDDA 2AHQA 2JA8J 9ANTA 4XK4A 4JYKA 3FKIJ 4C3JJ 1ETQA 3JRAA 3RZDJ 5BNGA 3I4MJ 5M5YJ 3QPLA 1EF4A 4I76A 1S7EA 3S2DJ 4D7MA 2L7MP 1ETWA 4XRMA 5F0HA 5IOYA 5C4JJ 4A3JJ 1PUFB 2JA6J 2X9DA 2CJJA 1JKQC 4GFBA 3SFIA 1GDTA 1TWAJ 1HDPA 5FKKA 1VI0A 4M3FA 3L1PA 3A01B 4C3IJ 3CDLA 1LFUP 5FJ8J 2G0EA 1MBGA 5E3LA 5M3MJ 1JGGA 1IDZA 2LR8A 4EEFG 1JT0A 2CQQA 5E3MA 1HOMA 3NAUA 1FIAA 4W1UA 3JRHA 5EZGA 1D5YA 1MBFA 2ME6A 1APLC 3OOUA 4FTHA 3A02A 2TRTA 1Y1WJ 3Q0UA 3NARA 5F1JA 3M3YJ 4IEJA 2HYJA 3Q0VA 1MH3A 4LOCA 5FKNA 3JR9A 2MW8A 2NS8A 4DZJA 2NVXJ 2H8RA 4DYRA 2VKVA 1TWFJ 3K2AA 1JJ6C 1SANA 2LK2A 4D5FA 4D7NA 1SFOJ 1AKHA 3GTGJ 3BQYA 2I10A 1I6HJ 3B6CA 2DA5A 4C2MJ 2NVYJ 4DZPA 4V2GA 3HOWJ 1IDYA 2Y9YA 2Y0SN 3OIOA 3IH2A 2VUMJ 1GUUA 1W0TA 1A6IA 2DA4A 1IGNA 5K7ZA 1CQTA 3JRFA 1RESA 3DEWA 4XICA 4A69C 5F04A 1VF9A 1MSFC 3W6VA 1U78A 2NVQJ 2ZB9A 1X2NA 4A3EJ 2K9NA 2MGQA 2Y30A 2GBYA 3GTLJ 2R0QC 1ZTRA 5IYBJ 1U8BA 2HXOA 2NVTJ 1AHDP 2XB0X 5J3LA 3S1RJ 3S1MJ 1RKWA 2HOTA 2DJNA 1HCRA 2CUFA 4BY7J 3BTJA 3GTQJ 3CQZJ 2B63J 1F43A 3F0CA 3B6AA 1X58A 1GV5A 2XPUA 1POGA 3SJMA 1HF0A 1MH4A 3FIWA 3OSFA 1JT6A 4FCYA 4G12A 3HEFA 5C4XJ 3UKGA 3BR1A 1RETA 3BR3A 1GV2A 1QPIA 2KDZA 2X6OA 1WH7A 3BG5A 5EYRA 1I50J 3BTLA 1R9TJ 3HBLA 2P81A 3BG9A 2EZKA 1ZQ3P 3HOYJ 4XRSG 2HXIA 2LY9A 1JUPA 3SDGA 1XG1A 3GTPJ 2D5VA 5FLMJ 2X48A 3Q0WA 1OFCX 2FQ4A 3S1NJ 4X1EA 2R5ZA 4B1RA 2VI6A 1DU6A 2K9QA 2GLOA 3BT9A 3PM1A 4UUTA 4DYQA 4J19A 2E19A 3MVPA 4A3DJ 2MG4A 5IP7J 2HI3A 4AC0A 4AUXA 3BTIA 2L9RA 3HGGA 1ZR2A 5FKMA 1HLVA 3HOUJ 3WHCA 3BTCA 2LKXA 5IP9J 1QRYA 1FEXA 2QCOA 5FKOA 5E3NA 1ETOA 2WV1A 3RQIA 2E2IJ 3G1LA 3D1NI 4A3IJ 1YRNA 3HOVJ 4M3BA 3GTKJ 1FJLA 2M34A 3MN2A 4XIDA 1ETXA 3FK7A 5EF6A 5F08A 3A03A 2O7OA 5EDNA 3GTMJ 1U9NA 1QVUA 2EBIA 2JMWA 2LD5A 4Y7NJ 3IH3A 1UMQA 2ELKA 2OPTA 4M3DA 2R5ZB 2R92J 5FLVA 2R5YA 2YS9A 3HOZJ 1JUSA 1E3OC 1G2HA 3CCYA 2RAEA 2O8KA 2HOSA 3LNQA 5GPCA 5GPAA 1FTZA 2VPRA 5IYCJ 1K61A 3OSGA 1OJLA 2IEKA 4A3KJ 2R93J 1WH5A 3O8GA 1XS9A 2CQXA 2IAIA 1MSEC 3M4OJ 1K83J 4M3EA 2CU7A 2XGCA 4QTRA 1BL0A 4S0HB 1YRNB 1WCMJ 1MBHA 4RBOA 1IUFA 2LLKA 4L5EA 4A93J 5E3OA 4MIMA 1ETKA 1GT0C 3LOCA 4A3CJ 3LSGA 4DYCA 2XPWA 3ZOBA 1BW5A 2R7ZJ 1A5JA 3ZQHA 4A3LJ 2M8GX 1WGXA 4BXXJ 2N8GA 2GM4A 3S16J
chains in the Genus database with same CATH superfamily
2ZJ2A 3CLOA 1MJ9A 2E36A 1F4KA 1Q1HA 3CMAI 3OY9A 1H8AC 1LJ9A 1Z77A 1ZHFA 2IS6A 3KEYA 3CJRB 4EATA 1IC8A 3DF8A 3G73A 2E35A 3AKZA 1MW7A 2L0KA 3OYFA 5JLXA 3F3XA 1W0UA 1ETVA 2UUZA 3QOEA 2ZCWA 3BR5A 5J1UA 1IO2A 4DBRA 1J5YA 3BOQA 1OCTC 2HGCA 2GQQA 2JVGA 2ID6A 3WTZA 4RM3A 3HHGA 3M1EA 1VFCA 2H09A 5BPIA 3HOTA 1MMDA 3ZQQA 2V9KA 4RGUA 3R60A 2PMZN 3OL4A 1DU0A 1XX5A 3HB9A 2DPUA 4XONA 5CQEA 5HDKA 4XBFA 1HDDC 3CC4I 2FX0A 2R7DA 3C2HA 1SD4A 1FBQA 1SVLA 5E1XA 3JRBA 2AO9A 2OZUA 3ULQB 2EILH 2K40A 4QSHA 1Z0XA 2OBPA 5LD2C 1LE8B 2K02A 3MD2A 4H4KC 2E1OA 2PBIA 3CF2A 3A2KA 3CMYA 1H88C 1TNSA 2VBWA 2ECBA 1X3ZB 3F22A 3CO7C 2DOEA 1LFBA 2XAFA 4BE1A 4RLQA 1HBXG 3ZMSA 4DOZA 4XSXF 2P0WA 4IHXA 3K70C 3DU5A 1LDDA 4HW0A 1W7PB 1QVTA 2ZXHA 1FLIA 4CCLA 1QZZA 3DLLF 1DGWY 1BJZA 3WGIA 1HKTA 2LFBA 3HM5A 2E7XA 4KN4X 4KMFA 4NUBA 1OR7C 2QUFA 5HDNA 3FM3A 4BDYA 1W5TA 2FMLA 2XGDA 2CV1A 2EIMH 3H35A 1U3EM 2LVSA 1YIOA 2E5NA 1K79A 2JJ7A 2CYYA 4FX4A 2PEXA 3WE2A 4I0AA 3ZN0A 4EJUA 3DCFA 4NDLA 3TQNA 1LPQA 3BG7A 3I59B 2HQNA 1U5TA 2RN7A 2HDWA 2EZLA 3LMMA 4A2UA 2KIMA 1G8XA 2VE8A 2Y31A 3BG3A 2BHZA 2XHKA 4IRHA 2VPLA 2BOLA 3QRFF 2VKEA 3HKZA 2VBZA 2FOKA 4Q48A 3NWTA 2O8XA 4WXDA 3SEQA 1XSXA 1USSA 1O4XA 1ENHA 4A3MJ 3M1CA 3S16J 3U21A 2FQ3A 3Q9VA 4O5VA 4RDUA 3I55I 1BN5A 1BR2A 3M8JA 2COBA 3RKXA 3DEEA 2KT0A 2VBYA 3FMSA 3JREA 1PDNC 4IHTA 2RREA 1J9IA 2ZSIB 2DJIA 3ZQIA 1V5FA 5L3DA 2VOOA 1MBJA 4O3MA 1OCRH 1HKQA 3OR1C 4HF0A 4MQVA 2TDXA 3W2WA 2L7ZA 1XGSA 5EG0B 3S15J 2IGKA 4L5IA 5AIPA 4L18B 3GTOJ 2JN6A 4M6VA 5EGOA 4C30A 3FXQA 2DA7A 3DKYA 4B3AA 4Y3OA 5J8FA 1LKXA 3CJNA 4NQWA 5FO5A 3FBNB 1B9NA 4M6XA 1IAWA 1V3FA 3KCCA 3V4GA 1YO5C 4XLFA 1D5VA 4S05A 3LFKA 4ZYHA 1RRJA 1R22A 1TW2A 4CA0A 5HS9A 2BW3A 4FE7A 2VE9A 5D5WB 3LA7A 3DTIA 2CW0F 4Y33A 1HA8A 3CUQA 4GCVA 1G3SA 2X6YA 3ZQGA 2H1KA 4BQNA 2G7UA 5DUIA 2HPMA 1JGSA 3O2PE 4OIOF 2VLAA 3CF5F 3P7NA 4ZDOA 1KZHA 4ZZDA 1OCZH 4DGWB 2XSDC 1WWXA 3ERED 3LSMA 2UZKA 1JKOC 4I0BA 2IGNA 4HX7A 5EEHA 4ZTJA 1MDMB 3EDPA 1YITI 4BEHB 4E70A 2HYGD 1W36C 3OYDA 3KP3A 4PJJA 4PGHA 2KZGA 2STTA 3BCBA 5B66C 3OOPA 1B8IB 2L54A 2RKHA 2LG4A 3TO9A 1PUFA 4B4CA 3QAHA 1E17A 4A3FJ 2CWEA 3V8LA 1OISA 2E34A 3VDXA 4D5CA 3Q3SA 3LSIA 4RGXA 4F52A 2XUBA 1UG0A 5E17F 1REPC 4C2UA 1R23A 3P5JA 3TBIA 4BACA 1IRGA 2NS7A 2PMHA 2Y2ZA 5J1RA 2MA3A 4IXAA 4B43A 2OF7A 5KNLA 4UUSB 4NC7A 2DQLA 2O3FA 3IH4A 2KHMA 3K69A 4BY1J 5DDGA 3C7JA 3T8TA 2JA8J 4HV5A 1T8IA 2IS4A 4JYKA 1ETQA 2DOFA 2GAUA 3ZMVA 5BNGA 2ZC2A 2QENA 4M9SA 4L0ZB 3I4MJ 4XLHA 4P9FA 3ZQ7A 1EF4A 2ZBKA 3EYYA 2KPMA 4I76A 2NAZA 1Z6TA 3DFGA 3ZXSA 5C4JJ 4A3JJ 5F0HA 5IOYA 3ABLH 2CJJA 2QQBA 4GFBA 5TJJA 4XN3A 3WGHA 2HWVA 1GDTA 1XB4A 3BG6A 1ZRFA 2W57A 1OYIA 3L1PA 3A01B 2IVMA 5FRNA 1CGPA 3CDHA 2R7TA 2V4JC 5FJ8J 2MD5A 3W6JB 3L2QA 5E3LA 2CMPA 2GIZA 3CMEI 2JVHA 3IRQA 2X85A 1MJBA 4IOCF 3NAUA 5EZGA 1YJWI 3P9KA 3OYNA 1APLC 1HC8A 2TRTA 4HDVA 2W00A 2FUG2 1Y1WJ 2UXXA 4E7JA 1N78A 3GXOA 4L0YB 3GZ5A 3QYFA 2NS8A 2NVXJ 4A0ZA 2H8RA 4DYRA 2R7QA 3K2AA 2LK2A 1SFOJ 1USTA 1YYVA 2QKMB 3I54A 3BQYA 3F8NA 1K4TA 5ILUA 2DI3A 1I6HJ 4YFKF 3F8CA 2CV2A 3PQKA 1T2KA 2W82A 2YU3A 3V7CA 1IDYA 2Y0SN 5FROA 3GFIA 1CF7B 5LGTA 4G8XA 1ERDA 4GGGA 4A69C 4EVIA 1VF9A 2XAQA 3PUBA 1R1VA 2DK5A 2OCEA 2NVQJ 5D5UB 2GA2A 1X2NA 4HYEA 1Z6RA 2Y30A 5HLHA 4AIJA 3VODA 1I1SA 1U8BA 3OYAA 2HXOA 3ISPA 2D2WA 1O3TA 2NVTJ 2A61A 5J3LA 3S1MJ 4FHTA 2DAOA 1FYLA 1O7FA 1RKWA 4G6DA 2F4OB 3CCEI 4DIQA 3ZP5A 1MD0A 1RI7A 4PDKA 3BY6A 2KRHA 3GTQJ 3F0CA 5AIQA 1FBSA 5CVUA 1X58A 4XNFA 1KGSA 5FB2A 5LEKA 3CC2I 3KLNA 5LLQA 2VKHA 2Y48A 1G6NA 3GLLA 3F8MA 4G12A 1Z91A 3DLAA 3R0AA 1I3AA 1ZRDA 5DCMA 2EWNA 3HSFA 1GV2A 2J5PA 2KDZA 3K4NA 1S29A 1WH7A 4YFNF 3HBLA 4E6KG 1B1BA 5DCFA 3BG9A 3L2UA 2XC7A 3FX3A 3IHUA 1HKSA 2LY9A 3EUAA 4MHGA 3GTPJ 2D5VA 1G4DA 4GRIA 4HNUA 3WTTC 3Q0WA 1R49A 2ESNA 2B0LA 3B02A 5GADJ 2J5OA 4B1RA 4OOIA 1TZLA 1DP7P 2PJPA 2K9QA 1QZEA 2GLOA 1WJAA 4PJMA 2VIXA 4XKCA 5JHUA 4KN7X 3ABUA 4DYQA 2AQEA 1X1CA 3MVPA 4UVBA 2MG4A 1IN7A 1Z9CA 2X51A 2HI3A 4AC0A 4BQQA 3BTIA 2ISZA 1ZN2A 1ZR2A 3WU0A 2VQHA 3LA3A 5FKMA 3HOUJ 2UV1A 4IJAA 3OYBA 1QRYA 1R58A 2A3SA 1OKRA 3PSFA 1U2WA 2GXGA 2KIFA 3C3WA 1ETOA 4G7OF 4DNCA 4ITVA 3TO6A 1W4MA 4BH9A 4A3IJ 2PMZA 3O3KA 1P9QC 2OC6A 4G6QA 3MN2A 1G3YA 3F8FA 1ETXA 5CVVA 2W24A 1XMXA 3A03A 2O7OA 4HSRA 3D5LA 1U9NA 1STZA 3LL7A 1QVUA 2JMWA 2ZKZA 3A0HC 1FOKA 5J6XA 4BJTA 3KYLA 1ZH5A 3FHNA 3SEZA 3WGGA 2R5ZB 2R92J 4XOPA 2M7AA 3OL3A 2JZYA 5D4SA 3ASNH 1E3OC 3F6VA 3V8KA 2H1LA 2O8KA 3CZ6A 3LNQA 2GIVA 5IT3A 2P5KA 5DM7F 3OYKA 3K10A 2IA1A 2NS0A 1T39A 1OJLA 3C1DA 2H94A 1IN6A 2BBYA 4A3KJ 4J01A 5E79C 4C2TA 4CZZA 1WH5A 3IL2A 3O8GA 1IZ1A 4JBAA 5AONA 5TISC 2LY2A 3M4OJ 3H0DA 5EJCA 1ONVA 2NNYA 1K83J 2CW7A 4M3EA 3SFZA 1L0OC 1VQMI 4QTRA 3W3CA 4G94A 2LKPA 5FFZA 3GF2A 5E3OA 1SFKA 1O3QA 2KRCA 3HJEA 1YJNI 2M4GA 3HRTA 4ETSA 2GZWA 2WY8Q 1YG2A 2OTJI 3HXLA 5GAHJ 2OV7A 5LRSA 3T8RA 2Y9ZA 3E6MA 5BS6A 1B59A 4E7HA 4RA2A 3HRMA 3BZ6A 2CRGA 5IPAA 4OU0A 2M2EA 1MNMC 1BA5A 2ISYA 4ANJA 1D0ZA 4EGYA 1ZK8A 2XVCA 3CO6C 1HW1A 1B72A 3GZNB 3IP4B 3TW6A 1A35A 1Y6IA 1XC5A 4F92B 3I4NJ 1IN5A 3SQNA 2AS5F 2JT1A 3ZMTA 1XMAA 4M74A 1WPKA 4CCJA 1RUOA 3IWFA 4IHVA 3LSPA 1I27A 2I8DA 4RAZA 5DS9A 2KDOA 4KIFA 3VFZA 1R5ID 1FC3A 1RC9A 1OCPA 1UG2A 1YOVB 2F5EA 2Z99A 4ZYDA 4KT5C 1I3QJ 2M0CA 2HYFA 3E3VA 4W97A 2HEOA 4GYGA 3U2RA 3CCRI 4CCOA 2ETHA 1LNWA 3HGYA 5CLSA 3F8BA 5JR3A 2Q1ZB 4RS8A 3AAFA 4I7HA 4IHYA 2JUCA 4U0VA 4WXHA 2VB6A 4D1QA 4BE2A 2VJJA 1BC8C 2DQRA 3NWSA 5FD5A 2R4GA 4KMUX 3MKWB 5IYDJ 1I1GA 1IG7A 1E3PA 3SXYA 2KISA 5IOZA 4Y52J 2PJRA 3QOPA 1FMWA 5HLTA 3KEQA 4ABZA 2VODA 1FOXA 1Y1VJ 2L5QA 3SZGA 1VQLI 1WVRA 1RKTA 4XMYA 5DEQA 4WCGA 2HOEA 1JKRC 5J1YA 3K9TA 2QM3A 1LDKB 4O6JA 2HDCA 2EPFA 1JHHA 3L2RA 1TC3C 1A6QA 3TW7A 5IT9Z 3CUOA 2F4MB 2ZJQF 2WBMA 2DU9A 2XIGA 4BKXA 2FNPA 4EJVA 2BYVE 3F9KA 2Z1DA 1TWHJ 3D5RC 5ERIA 5L3FA 4XOTA 3FXRA 2RQPA 3FXJA 2VJIA 3NQOA 1P6RA 4HEA2 4TV7A 4FISA 2K9MA 3I0TA 5H20A 1MKMA 2CW8A 4N4NB 2ZNYA 2LKSA 1X4PA 1L3LA 3FZVA 4IF4A 2JK3A 2DMUA 3DTKA 2ID3A 1YS7A 1ZGAA 1P7JA 2ZXWH 1OYWA 4XLPF 2JWTA 2BVLA 3S2HJ 4ZYEA 1S6LA 1DGRM 3HSRA 2FD5A 2WADA 5E8GA 2MH9A 2DFEA 1MBKA 4QPQA 4HX8A 2X1DA 4RMNA 4MTDA 2A68F 3PSIA 1XDUA 2FBIA 1Y0NA 3T0YA 2FRHA 3RKYA 6PAXA 2WB1N 4QIWN 5EEAA 1RIOH 3HOXJ 2Z3YA 5F27A 2E2HJ 1T98A 4EJWA 1XSVA 4L9NA 3KP5A 4LB6B 3BPVA 1U5TB 1JI8A 1U5TC 2K86A 1YHQI 2O9LA 4B09A 2VOPA 1WSUA 1SD6A 3E97A 4UB8C 1FYKA 4MGRA 2BZTA 4EM0B 4OAZA 1K78A 2FU4A 3FMRA 2DMNA 2YX7A 1JXSA 2KP6A 1X4OA 2V9PA 1X1BA 3FXUA 1P4AA 1AU7A 5D5VB 3E6CC 1O3RA 1T6SA 3NEUA 2DMTA 1HSJA 2EFNA 1GVDA 1G59A 4PUSA 2IA2A 4LG3A 5DV5A 4XLEA 4HNVA 1IRZA 4P96A 5JFRA 1MJAA 2VT3A 3JRGA 2HOAA 1XD7A 1IXSB 2W25A 1WJEA 5H2FC 5EGOB 2XRNA 2VQLA 1WI9A 3RZOJ 3HTUA 1Y56A 2DTRA 4JX4A 4NQWB 1KU7A 4FT8A 1JTYA 2JPBA 4KICA 1H0MA 2EJRA 2DMQA 2KQRA 4M3GA 2Y0SA 2G7HA 2UWMA 4JP0A 3BR2A 2DDBA 4U0YA 1S72I 2YUSA 3S17J 2VXZA 1ZG5A 5CPRB 2BW3B 3G2BA 3HUGA 2HVSA 2EINH 1V54H 3GO5A 3CDIA 3J7ZI 3CUQB 1NTCA 1TQMA 2X6XA 4YRVA 3GCMA 2M9HA 2LP0A 3KP4A 4MFEA 1WJ5A 2P5VA 2L4MA 5KHDA 4JK1X 5D8KB 2K3PA 5A2QZ 1ZR4A 3CD6I 3T1BA 4ZDLA 2XRLA 4LMYA 1G3WA 3WTVC 3RKQA 3LSJA 1IRFA 4HDUA 3PO3J 3H5RA 3DTEA 2K9SA 2A5WA 1X19A 2BY2A 5BOXA 4RB0A 4XK4A 4UY8I 3M8FA 3ESWB 2A07F 5GAGJ 3JRAA 2X6WA 1T0FA 2FSWA 4IQ4A 2DOAA 2Z5UA 3L7WA 5M5YJ 2IS2A 2ZO4A 2EA4A 1YX3A 1OCOH 2NNNA 1AOYA 2WC2A 5E1ZB 1XGNA 3K1PA 5BPDA 2VJ5A 2EV0A 5CQGA 3F21A 3GZ6A 3MZ8A 4XRMA 1PUFB 2JA6J 3QWLA 3V42A 2X9DA 1O7LA 3SFIA 2X0LA 3MCZA 5HLIA 3S3OA 4XKVA 1DP3A 4C9YA 1HDPA 1NHAA 4ESFA 3ONQA 1R5GA 3CDLA 1LFUP 3U1KA 4N4OB 5M3MJ 1JGGA 4L9JA 1IDZA 1UHMA 3REOA 1LEBA 1H9TA 1B6AA 2CQQA 5E3MA 1FIAA 1D5YA 4HBLA 1MBFA 2ME6A 3A02A 1J09A 2XAJA 4IZZA 3GFJA 3VSLA 4BL0B 1T95A 4KITB 4RB3C 2VBXA 4IEJA 2HYJA 3WTWC 3Q0VA 4LOCA 3E5XA 2MW8A 1XMKA 5J47A 4B44A 4XLAA 4EMSA 1EH8A 4Y13A 3K4MA 3JCUC 3WU2C 1SANA 2B9SA 2XSJC 3I58A 4NC8A 4F55A 2I10A 2KJBA 1MGTA 1YW9A 3ZCOA 3OYLA 1EA3A 3MKZA 2E1MB 2BXZA 4DZPA 3IWZA 1VQOI 4F93B 2W84A 3QU6A 1GUUA 1W0TA 2F4IA 1KYZA 3I9V2 3QU3A 3L2CA 5K7ZA 2KJCA 1RESA 4XICA 3AG4H 5F04A 5LBQA 1MSFC 2A6TA 3P9CA 4LIVA 4XR6A 3W6VA 2Q2EA 3J7AY 2WAEA 4A3EJ 5IT9K 2GBYA 3CJQB 3GTLJ 4I99C 2R0QC 5KK1A 1QHGA 1LUJB 2BE5F 3S1RJ 2LY1A 3T5XA 3PIOF 3OMYA 4XN0A 3KPHA 3KETA 1HCRA 4KIGA 2D1VA 4BY7J 3BTJA 5CVIA 1F5TA 4PGGA 1F43A 2XF7A 2FBKA 3OS0A 2Q0OA 3B6AA 1R1TA 3TKYA 1J0RA 2D45A 1POGA 1HF0A 3OSFA 5H6QA 1VQ5I 1JT6A 1OLTA 3HEFA 2RQQA 3IUOA 5ED4A 3UKGA 3WTSC 1SVMA 1SAUA 3JW4A 4R79A 4PSXA 4E7LA 3HSEA 3BG5A 5EYRA 1YX5A 5HVQC 4OWRB 3BTLA 3PQJA 4ZH4F 1MMNA 4BAYA 2K7LA 3OS2A 1SMYF 1R9TJ 1I6XA 2KZVA 1ZQ3P 5D6FA 3Q5FA 4XRSG 1LQ1A 4U7BA 5TRDA 5FLMJ 2X48A 4LJZF 1I5ZA 2O61A 5LHIA 4ZC3A 2FQ4A 3S1NJ 1Z1DA 2VI6A 1TT5B 1RR8C 3PNYA 1N77A 4MEXF 4K2EA 1WQ2A 2A05A 2NOJB 3BT9A 3PM1A 2M4KA 3HPHA 2IGOA 3M07A 1UCRA 4HAMA 4A3DJ 1Y8RB 1TNTA 4F91B 2BY0A 2L3DA 4L9TA 1BR1A 3OYJA 4BJ6C 4HRIA 3O6BB 1Y0UA 3FWEA 5DCMB 3CMMA 1U0JA 3AL0B 3RQIA 2XF5A 1RZ4A 2A69F 1PVEA 1EV7A 1X1AA 1EH6A 1FJLA 5FLXZ 1QGPA 3SZTA 4KISA 5EF6A 5F08A 2BHYA 3J80Z 2E1CA 5EDNA 2DPDA 5L3GA 1D0XA 2IW5A 4ZTFA 3S2WA 3BJAA 3L2VA 3MZYA 4UXNA 4NNJA 1UMQA 3COAC 3SZPA 2OA4A 1W1WE 3HPGA 2R5YA 3DWLE 2L2OA 2CQ7A 3D5SC 2IJLA 2KRFA 2RNGA 3MMYB 5CKTA 4Z2YA 2ZXJA 3CLQA 4HPQA 1YI2I 4U87A 5GPAA 1FTZA 2PI0A 2VPRA 4OMYA 3ABMH 3BPXA 4HLXA 1YQAA 2CH0A 3I56I 2K9LA 4AIHA 1XS9A 1QHHD 2IGMA 2IAIA 1MSEC 1PP7U 5A2QK 5E8IA 4RAYA 2CU7A 4A0YA 4LGWA 3WTYC 1KONA 2RNJA 4S0HB 2F48A 1R1UA 1IUFA 1X1DA 4KT6A 2LLKA 1J75A 4L5EA 4MIMA 1ETKA 1V5GA 1BW5A 3HIFA 3S93A 2LBFA 5J8CA 2HKOA 2JRMA 2MABA 2MBFA 3SYTA 1TL8A 1WGXA 3J81Z 4BXXJ 3CP8A 1DU6A 5LHGA 2CGPA 3JAMZ 2JUGA 3WG7H 5GP9A 2STWA 4GO1A 4Q5SF 2ICWG 4CXFA 4CCNA 4C3HJ 2MLKA 4HOBA 2M45A 4IHWA 4P55A 3EPZA 3ZMZA 4LK0F 1VQ7I 4HV6A 4OINF 1DUXC 1R5HA 1SFXA 5KAIC 1YLFA 2LYCA 1Z7UA 3O8HA 1NK3P 1QQIA 2Y69H 3C2BA 1LVKA 4XM3A 1QU3A 4F7ZA 1UB9A 3ZQLA 3CTAA 3DBHB 4GDFA 4BYYA 3GBGA 1IRXA 1DPRA 1ULYA 1TWCJ 3CCJI 4N9IA 4IKFA 4BE0A 3H5AA 2CSOA 3H36A 4BGDA 2WB1A 4YEJA 4L5JA 3CCVI 2QVOA 1UAAA 2DTZA 1D8JA 3PFIA 1C0WA 1RR7A 4MLOA 3ZMUA 3ZQFA 1NH3A 4N9HA 2IBDA 2LNBA 4CGZA 3HG9A 1YW7A 2HPIA 5C3EJ 2YU9J 3JTHA 1UHWA 4FX0A 5CVJA 3K70D 1FOYA 3E0JB 4A3BJ 1IUYA 1ZGJA 4I09A 4IHSA 1JTXA 3DEUA 3DKWA 2GWRA 2V1DA 3L00A 2WWYA 5M5WJ 4HLYA 3I64A 4WX9A 1B72B 3GFMA 3MKYB 1XDSA 2QKLB 3J7YJ 4IRGA 2EZHA 1X2MA 3GFLA 5L3EA 1QPMA 3TOAA 2O5RA 4DW6A 3LSRA 1NG6A 5EZHA 1BIBA 5M3FJ 3M9AA 3EUKL 3S3MA 2YR2A 1D0YA 1KYWA 2DCEA 2ME0A 3RYRA 3HYIA 5IP6A 2WAQN 1UJ8A 1UZCA 4XLCA 3FK6A 5B5EC 1AWCA 2ZJPF 2CUEA 3BQZA 2XKOA 4RB2C 3B73A 1TP4A 3E7LA 1LDJA 3VSKA 1FOWA 3PUFA 4RAGA 5FKLA 3K4CA 3FDYA 3OR2C 3BR6A 4BDZA 2HQRA 4JX5A 3VB2A 2EFOA 4MEYF 4AM3A 2EK5A 3CC7I 5M5XJ 4BNCA 4EM1A 4LFUA 3JSOA 1ZGWA 4B8XA 4XRSA 2DA6A 4XRFA 5ILSA 4MO7A 3QYEA 2PJRB 1OCCH 1R4MB 1ZG3A 2EFPA 4V19K 2BV6A 3OS1A 2RC4A 1VQ8I 1W5SA 3FMQA 2ZNZA 3OYHA 1DQUA 3GUDA 2V6CA 1Q1VA 2F2EA 3GTJJ 3D0SA 2LTPA 3UNGC 4CYDA 2IA0A 5J40A 5K7FA 1WJDA 3VYRB 3JRDA 4E7KA 2DA2A 1FIPA 4OMZA 2BY1A 2Q8KA 3KE2A 2P7CB 2M8EA 2C6YA 1P7IA 1D3YA 4AIKA 1ZELA 2QA4I 4IPAA 5FRMA 4ASNA 1Z3YA 3DPUA 3W2VA 4MTEA 2HTJA 2QGUA 1MZBA 1BOBA 4E7IA 1TWGJ 2LF7A 2NRAC 3LSTA 4BXFA 5HNFA 4CYCA 1H89C 1ACIA 3H0GJ 1OQYA 3TOBA 4A3GJ 4CCMA 1IF1A 3KZZA 4UUVA 2HU9A 3C2GA 1M1EB 3TEDA 2QYOA 4I02A 5B1BH 1U9OA 1UELB 3RKWA 1J59A 1BC7C 1W36D 3KIOA 3CESA 1ETYA 1WJCA 1T56A 4GXOA 3TP0A 3I3LA 4BBRJ 3HOSA 1FZPB 2FMYA 3AG2H 4Q4ZF 3L2WA 2K27A 3G1OA 3FHZA 1R4NB 4XKBA 4OAYA 2I5UA 1E0EA 2H6CA 2W48A 2NOGA 4ZJZA 3H3VK 1EJ9A 4CZCA 5FD6A 1K78B 3QP6A 1WZ2A 1VTNC 3A0BC 1S5LC 5GAEJ 2MSYA 2DMPA 4EGZA 3KYCB 2CQKA 5ICCA 3IRRA 3Q9SA 1X3UA 1ON1A 1VNDA 2EA2A 4UVCA 3PO2J 1QNTA 1HW5A 4PK4A 4M72A 3OIPA 2M7BA 2JA7J 3ABKH 4ENNA 2HQ5A 1KU2A 3JAMK 2GXAA 3KP2A 5DTDA 4E4HA 3I53A 3E6DA 2OD5A 5L3BA 2V1XA 3ZMDA 1J2XA 3IAS2 2W4SA 5GTHC 2FNAA 4ZZLA 2HDDA 1Y8QB 2R3SA 1BI3A 3G71I 2O6GE 4C3JJ 5IY5H 2KL4A 1SEUA 4NC6A 4M6YA 1ZAOA 3MEXA 3BDDA 2CUJA 2ZMEA 2VKDA 1ZLJA 2F5VA 1S7EA 2VN2A 4LLNA 3S2DJ 4YG2F 2L7MP 1ETWA 5LRRA 5K5RA 2V7FA 1JKQC 3WE3A 2QBYB 2XROA 4M9XA 1XGMA 1TWAJ 2GOXB 1PJRA 2LSOA 4PZJA 3HUGB 3TDZC 2JSPA 4LG0A 4C3IJ 5E1WA 4ZYAA 2RV8A 2Z16A 1SMTA 2OUMA 1FP2A 1YS6A 3FXMA 2M0MA 1VQPI 1ZYRF 3LAJA 2LR8A 1O3SA 1JT0A 5KAFC 1HOMA 2QSFX 4W1UA 2JSCA 3C18A 4FTHA 1WJFA 1LVAA 4HG2A 2E5ZA 3ZPLA 3ZN1A 4UV9A 5EEGA 3EUHA 4D0PA 4LK1F 3EQLF 1P4WA 1MH3A 1VQNI 2R7RA 2GOMA 1WFXA 1QBJA 1GXPA 3VWBA 1D8KA 2VKVA 1TWFJ 2CO5A 1VQKI 1R7JA 3V7RA 4D7NA 1R36A 4IX7A 3GTGJ 1Y39A 4ZDPA 2G9WA 3DPTA 2E1NA 3TMOA 3B6CA 4CDGA 2DA5A 4FASD 2NVYJ 3ZR8X 3SDBA 2Y9YA 3RCOA 1QA6A 3OIOA 3BCAA 3DPLC 4KA4A 1A6IA 1IN8A 3SHFA 1U6GA 2UXNA 1ZRCA 2F6CA 1OMIA 3DEWA 3VYUB 3H3ZA 4QLCU 1U78A 1F9NA 1QO0D 4Y17A 3RPQA 3VOEA 2FEZA 2MGQA 2DT7B 3E5QA 4ON0A 3E1SA 3FXLA 4AU7A 2PFBA 2LREA 3V8JA 2ELHA 2XB0X 2YX4A 2XAGA 5HLGA 4AVPA 3L09A 3FF5A 2CUFA 3K1NA 3QPHA 1MIJA 4AYBA 3JTGA 1R71A 3CQZJ 2B63J 5F1RA 3A4CA 3H3UA 3IKVA 1GV5A 3J7AO 5LHHA 4P1WA 1V4RA 1VQ6I 3M7GA 3SJMA 4KJZA 1MH4A 3BWGA 3FIWA 2HNHA 3GX4X 4HSTA 4UNOA 1P2FA 2E71A 3BR1A 2OTLI 2IS1A 2Y0MA 2ZJRF 4BXUA 1KQ0A 2X6OA 4XL9A 2QBYA 2M87A 1KA8A 3K0LA 1B4AA 1I50J 2WY7Q 3GWZA 5D6EA 4LB5A 2FXAA 2R7UA 3HOYJ 4IL6C 3ZRGA 2LH9A 1A31A 3CUQC 2HXIA 2Q2EB 1X1PA 2AXLA 3I5UA 3SDGA 3IKTA 4XLNF 3KFWX 1D1CA 2FBHA 2LF8A 2ZFUA 3CJTB 3NRVA 3PFYA 3WTXC 4A5MA 1OFCX 2CS3A 3OYGA 4X1EA 3P9IA 1ODDA 3TDUC 3CCMI 5HOOA 3N05A 1FX7A 2HZTA 2B7EA 4BU2A 3F23A 3K4BA 1FYMA 2PX9A 4BHBA 2V1UA 3W6KB 5LEJA 3KP6A 4U88A 2L9RA 4RLFA 2XDVA 3R0JA 4PFOA 1HLVA 3DKXA 2VQGA 3WHCA 5ICGA 3AG3H 3EYIA 1UFMA 3KLOA 1BBYA 5JHFA 2QCOA 5FKOA 2DFHA 4LIUA 2EIKH 1K7AA 2A5YB 4BQOA 3KX2A 4AD9A 4CHUA 2E2IJ 1XTAA 2JPCA 2FE3A 3D1NI 1YRNA 2AQFA 5HS7A 4ZYGA 2M34A 4XIDA 3I4PA 3FK7A 2Z33A 1PP8F 2R7FA 1WKMA 5F64A 2KIUA 2FOWA 1DDNA 4KDPA 2ELKA 2HKXA 2OPTA 1V55H 2H6BA 4NBQA 4R1HA 1OYYA 1X3WB 3CCUI 5FLVA 2MYSA 2YS9A 2BVMA 2LC2A 3CCYA 3K1MA 5LGUA 4B47A 4BHCA 2CFXA 2VXDA 3CCLI 3N4MA 2L9VA 4I98B 4EJTA 4U0WA 3OV8A 5IYCJ 4FETA 1ZARA 2ACJA 4KNYA 3PNVA 4ESBA 1IXCA 4ENMA 1KU3A 2KFDA 4YELA 4PJLA 2E1MC 3K6GA 3K4LA 4PCQA 3FKJA 1FNNA 1WRJA 1WCMJ 5KCMA 5TGTA 3G3ZA 2FF4A 2WAQA 2WA0A 1GT0C 4A3CJ 3LOCA 2DLLA 3VYSB 3ZOBA 4DJAA 2V6EA 2KMUA 4WF2A 1FMVA 1O57A 4XKWA 3ZQHA 2VONA 1ZREA 4A3LJ 1BM9A 1GVJA 2N8GA 1SFUA 4KUMA 1LE8A 2R5YB 1UHSA 3QP5A 4EJOA 4RB1A 5E20A 4YFXF 1TBXA 3G6EI 3OWTA 4D9JA 4EQQA 1JUMA 2DT6A 2EFQA 3MFKA 4WK8F 2MC4A 1IW7F 2QSHX 1W7PA 2RGVA 4JOMA 2DFIA 3IV5A 3E6BA 4KFCA 4MFDA 5JLWA 3BC8A 4BS9A 1TTYA 1OR7A 1D1AA 5DYMA 4UHTA 2EIJH 4UVAA 1BIAA 2YSRA 2PG4A 2DA1A 2P8TA 2V9VA 3DBLB 4X0GA 2LBFB 3KZYA 3WU1B 2CQNA 4H0EA 1FTTA 3ERMA 2L7FP 1ON2A 1GXQA 3I59A 3FISA 5FGMA 2QQ8A 2CUZA 3K4JA 4CO8A 2XGEA 4CCKA 2VL8A 2WAFA 2QQAA 4M71A 3F72A 4YIIA 1P4XA 2COMA 2EQRA 3LSKA 2V79A 2OQRA 4BQAA 2L01A 4A0XA 3HRSA 3KEOA 3TGNA 2IXSA 5H6RA 3RTRA 3FXKA 1JKPC 1XPXA 5BMZA 3HRUA 1AA7A 4S04A 3H1CA 3JRIA 4V2FA 5HODA 4M73A 2DXIA 2JA5J 1K6YA 3ZQCA 3AL0C 2E2JJ 3WG9A 3M8EA 1A04A 5DD4A 4LD5A 1MMSA 1HXDA 3S14J 3IC7A 1JHFA 2CG4A 2CFOA 4DBQA 5FFXA 1WHUA 3K2ZA 2QQ9A 1XGOA 3H9JA 5EG0A 1GLNA 1ZKGA 2EB7A 3RQ4A 5HDGA 3E5UA 3ROUA 3RJPA 4BUPA 5J4VA 5K7HA 2P5LC 3LQQA 5BQTA 2OQGA 2BY3A 1S3JA 4HNTA 2M1BA 1H9GA 3F6OA 1BR4A 2VQCA 2DBBA 4FE4A 5CVRA 2PMUA 1ITYA 4PSWA 5B3SH 4QPOA 3OYMA 1YTYA 2EFWA 2HFHA 2DFFA 1WJBA 1YJ9I 4L9VA 2L4AA 4JX6A 5DUKA 3PJRA 3A1YA 2QLZA 4AYBN 3MAJA 1KQ9A 1TLHB 2AXTC 3OIQA 2DO7A 4AWXB 2HS5A 2BXYA 4MQ9F 3OYCA 1MMGA 2TCTA 1IJWC 3PL8A 1T08B 1S8NA 5KVRA 1LB2A 2ECCA 2M3AA 3S1QJ 1RNLA 4N0BA 3IAM2 4UB6C 4CICA 1R6RA 5K5OA 3WHBA 2ADUA 1HSTA 1J7KA 4HQEA 4CUGA 1EH7A 3FBIB 3QQAA 4B48A 1MDMA 1IV6A 2DA3A 4BEHA 1MNDA 1KU9A 2IT0A 2JA2A 4RM2A 3H9QA 3MZHA 1YW8A 3QODA 3DBRB 3G1MA 3S32A 2Y75A 5ICFA 1B8IA 5L3CA 4WWCA 1BW6A 2QF7A 3RPUA 1OPCA 2BEOA 2NVUB 4I6ZA 4HF2A 3K7AJ 2DW4A 2ZXIA 5F0CA 2LRDA 2KLOA 1T33A 3GMEA 2MH2A 1YE9A 2ESHA 2QZ8A 2VJ4A 2HVRA 3HL2A 1XCBA 3JRCA 2E7WA 1EKEA 1FT9A 1TW3A 1HW2A 5JVTA 1MNEA 2FJ1A 3K4KA 4BJ5C 2HTSA 3LA2A 1ORKA 2DN0A 4JQFA 1SFEA 3QPSA 4UUSA 3W2AA 2Z2SB 5F6FA 3ABTA 5LFAA 4X6AJ 3BJOA 3VPRA 4OIRF 3LSHA 3LWFA 4LLGF 3BR0A 4EM2A 2P4WA 1AKHB 2KKOA 4J00A 3WODF 4IRIA 1MMAA 3H9GA 1RUNA 4BBSJ 4AIDA 3OYIA 2GA1A 1NK2P 4ESJA 3RIRA 2R7WA 4E7ZA 3HDDA 1MBEA 4QWQA 3BP8A 4HF1A 1W7PD 1FPQA 2EZIA 3TP3A 3MQ0A 3HKZN 3I71A 4F3QA 2XAUA 1S9HA 2XPVA 4CYCB 2P6TA 3R4KA 4LITA 5F0FA 3A01A 1BI2A 4FQGA 1T38A 1WI3A 3MKLA 3BJ6A 1PYVA 2FA5A 1JJ8C 2EH3A 1SC7A 2XKPA 3CCSI 4EV0A 2MFZA 3U9GA 3PIPF 1XN7A 2VC1A 1K4SA 1R00A 2XB5A 3LFUA 3RYPA 4P9UA 1RPWA 1TQPA 1F36A 5C44J 5D8LB 2M30A 4OIPF 5K5QA 1VZ0A 3GEZA 2ZFWA 1YFHA 5ICEA 2AHQA 4MNUA 9ANTA 2A6HF 4WXCA 3FKIJ 2PN6A 3TL4X 2MLGA 3X2QH 3RZDJ 5J4YA 1FSEA 4A6DA 2JQ7A 5LGNA 3DP7A 3QPLA 3HZJA 1BOAA 2K85A 3UR3C 1U8RA 2K5CA 1FP1D 4D7MA 2VASA 2EV6A 1LFPA 2OJED 4PJ0C 4UV8A 1QZYA 4G7HF 3CP2A 5FKKA 4IO9F 1VI0A 4M3FA 3JSPA 3ML6A 2IP2A 5HNHA 4ENKA 1CF7A 2G0EA 1MBGA 3VYTB 3RDIA 2WTEA 4EEFG 1N75A 1HQCA 3BZCA 3JRHA 2L02A 2QSGX 1XSDA 4IOAF 4PFPA 3OOUA 1BI0A 3Q0UA 2V1NA 3NARA 5F1JA 3M3YJ 1FWZA 5FKNA 3JR9A 4CH7A 1N25A 4XSZF 2IPQX 3OYEA 2F5CA 5ILVA 4HA8A 1JJ6C 2K4BA 4D5FA 1E3HA 2X4HA 1AKHA 2ZMEB 3DQVC 4NB5A 2ZMEC 3ECHA 3HHHA 1K6OA 1V5EA 3ELKA 4R8HA 4C2MJ 3RSNA 4ENJA 4V2GA 3HOWJ 1SD7A 3FM5A 4RGSA 3DV8A 4Q47A 3IH2A 4LG0B 2VUMJ 1GHCA 2DA4A 1IGNA 2Z9OA 2L9NA 4HZFA 5FLXK 3MWMA 3H5NA 2ELJA 4IVNA 3JRFA 4Z6YA 1CQTA 4A6EA 1SAXA 2M5WA 3J80K 2R7OA 2ZB9A 2MC3A 4RGRA 2LOOA 1BI1A 2K9NA 2O03A 2H27A 3PNTA 1ZTRA 5IYBJ 3FXOA 4LLLA 2QWWA 1Z05A 1VQ9I 1AHDP 3GLXA 3S8PA 3EUHC 2VT2A 2MD0A 2HOTA 4XORA 2DJNA 1SVOA 5DD8A 2XV4S 5JVGF 2DODA 1B9MA 2HVQA 4I01A 4CSWA 3ZGKA 2XGXA 2XPUA 2XASA 2YPRA 3RPUD 3U1DA 2X1CA 1W5CC 4FCYA 3HTSB 3G4SI 2K3FA 1S7AA 1NG7A 4HQMA 4G7ZF 2CV0A 5C4XJ 2D1HA 1RETA 3S3NA 3BR3A 1QPIA 2V26A 4KYWA 4XQFA 2BGCA 2E60A 5B1AH 1XCVA 2H8WA 2KIQA 1S7OA 2P81A 3EETA 2EZKA 2ZSHB 3KZIC 2NXNB 2OCCH 2L7KA 3QPTA 1VQ4I 3HC7A 2R7VA 2NYXA 1JUPA 1XG1A 4II3A 3LQRA 3V7SA 3J81K 4KIBA 1FBUA 2R5ZA 1LEAA 3LAPA 1I39A 1G3TA 3DXJF 5K1YA 2RVCA 3AG1H 4B3XA 4UUTA 1Z3XA 2P7VB 1E2XA 4OIQF 3DU6A 4J19A 3H92A 4G9YA 2EV5A 2E19A 3GW2A 1TT0A 5IP7J 3RI4A 3R61A 1A36A 4DQ2A 4AUXA 3HGGA 5GTIC 1P92A 1ZG1A 5D5XB 2W85A 1SD5A 3BTCA 2XF6A 1DPUA 2R7SA 4IQJA 2LKXA 3R6SA 5IP9J 1FEXA 5E3NA 3AFHA 2IRFG 2WV1A 2OZ6A 2LMDA 4A12A 3G1LA 3HOVJ 4M3BA 3GTKJ 2HQAA 2HZDA 1JE8A 4HX4A 3ECOA 3TO7A 1PUEE 4I2OA 4E7SA 2R7XA 4PJNA 4Y15A 3GTMJ 4YIRX 4AVZA 2EBIA 1Z21A 4RAFA 5CYVA 1D1BA 2DK8A 4BHPA 2LD5A 2OAZA 1YIJI 3CCQI 4Y7NJ 2PLYA 5CJ9A 3IH3A 4M3DA 2K4JA 3VEPA 4P5OA 3KP7A 4A5NA 3GVAA 3HOZJ 2P6SA 1JUSA 2JRTA 3BROA 4II2A 2RDPA 1G2HA 2RAEA 2OU2A 2HOSA 2GXBA 1FSHA 5GPCA 2LDUA 2QEXI 1IV8A 2DYRH 2O0YA 4U7DA 1K61A 3L9FA 2VC0A 3OSGA 2WV0A 1T0FC 2JTVA 4YIFA 2IEKA 3KYDB 2R93J 3BLYA 2CQXA 1TQIA 4G6TB 2DT5A 1IN4A 2A6EF 4M9ZA 2HR3A 1KQ8A 1Z67A 2XGCA 1BL0A 5E18F 1YRNB 2L9SA 1FY7A 1MBHA 1Z7LA 3WTUC 4RBOA 2X1EA 2PQ8A 3GYHX 3QYBA 5HS8A 2W7NA 2F5DA 1F1ZA 3ASOH 4A93J 1IXRC 2W1OA 1BJAA 3LSGA 4DYCA 5DM6F 1ZLKA 2XPWA 4Y4RA 5D4RA 2F5FA 2DDAA 2R7ZJ 2DYSH 3N97A 5JI6A 1A5JA 4GYIA 2M8GX 2XAHA 4DZJA 2GM4A 3BZKA 4NHJA
chains in the Genus database with same CATH topology
1LE8A 2R5YB 2Y9ZA 1UHSA 5GP9A 1H8AC 1Z77A 4C3HJ 2CRGA 5IPAA 2M2EA 1MNMC 1BA5A 1IC8A 4IHWA 1JUMA 1ZK8A 2L0KA 1B72A 5JLXA 3TW6A 1W0UA 1ETVA 1XC5A 3BR5A 3O8HA 5J1UA 1NK3P 3C2BA 3IV5A 1OCTC 3I4NJ 4MFDA 5JLWA 2ID6A 3ZQLA 1WPKA 1VFCA 3GBGA 3LSPA 4IHVA 5DS9A 1TWCJ 2PMZN 1UG2A 1OCPA 1DU0A 2DA1A 1I3QJ 2M0CA 3HB9A 4W97A 1HDDC 2DTZA 2FX0A 1RR7A 4MLOA 3ZQFA 3HGYA 3JRBA 1FTTA 2AO9A 2IBDA 2L7FP 2K40A 4QSHA 1Z0XA 3FISA 1LE8B 5C3EJ 2YU9J 2E1OA 2XGEA 4A3BJ 3CMYA 1JTXA 1H88C 4IHYA 2ECBA 1LFBA 2EQRA 5M5WJ 1B72B 4IHXA 5IYDJ 2EZHA 1X2MA 1IG7A 1QVTA 1JKPC 4DW6A 4Y52J 5IOZA 3LSRA 1BJZA 3JRIA 5EZHA 2LFBA 4V2FA 3HM5A 5M3FJ 4ABZA 5HODA 1Y1VJ 2JA5J 3ZQCA 2E2JJ 2ME0A 2XGDA 5IP6A 1RKTA 3S14J 2WAQN 1JKRC 2LVSA 5J1YA 2JJ7A 3FK6A 2CUEA 3BQZA 5EG0A 3DCFA 1ZKGA 4NDLA 1TC3C 3E7LA 3TW7A 4BKXA 2EZLA 5K7HA 5FKLA 2Y31A 3BG3A 3BR6A 4FE4A 1ITYA 1TWHJ 4JX5A 2VKEA 5M5XJ 4JX6A 4FISA 1O4XA 1ENHA 1ZGWA 4AYBN 4A3MJ 4XRSA 2DA6A 4MO7A 4RDUA 2JK3A 2DMUA 2TCTA 2ID3A 1P7JA 2COBA 1IJWC 2JWTA 3S2HJ 2ECCA 3S1QJ 2FD5A 2KT0A 3JREA 1MBKA 3ZQIA 3WHBA 1MBJA 1Q1VA 3GTJJ 2WB1N 2LTPA 3QQAA 4QIWN 5K7FA 5EEAA 1IV6A 3HOXJ 2L7ZA 2DA3A 5F27A 5EG0B 2E2HJ 3JRDA 3S15J 2DA2A 2JN6A 3GTOJ 4M6VA 1FIPA 5EGOA 2DA7A 4B3AA 1P7IA 2O9LA 3G1MA 1B8IA 1BW6A 2QF7A 2DMNA 4FE7A 1TWGJ 4I6ZA 3K7AJ 5F0CA 1H89C 4CYCA 3H0GJ 1T33A 2H1KA 1AU7A 3ZQGA 4A3GJ 3JRCA 2DMTA 3TEDA 1GVDA 2FJ1A 1U9OA 1ORKA 2DN0A 1IRZA 4HNVA 3QPSA 4UUSA 1ETYA 2XSDC 3JRGA 1T56A 2HOAA 1JKOC 4X6AJ 3VPRA 3TP0A 4BBRJ 3BR0A 1AKHB 3G1OA 5EGOB 4BBSJ 1NK2P 3RZOJ 4JX4A 1JTYA 2W48A 2NOGA 1B8IB 3H3VK 3HDDA 1MBEA 2DMQA 4M3GA 4JP0A 3BR2A 1PUFA 4B4CA 4A3FJ 2EZIA 2YUSA 3TP3A 3S17J 4D5CA 3HKZN 3Q3SA 2XPVA 2MSYA 2DMPA 5F0FA 4CYCB 3A01A 1WI3A 1NTCA 3MKLA 1VNDA 3PO2J 1JJ8C 2M9HA 2LP0A 4MFEA 2JA7J 2EH3A 2NS7A 2Y2ZA 2HQ5A 1ZR4A 5J1RA 2XB5A 5DTDA 2XRLA 2OF7A 1RPWA 4UUSB 1F36A 5C44J 3RKQA 3LSJA 3PO3J 3IH4A 2K9SA 4BY1J 2HDDA 2AHQA 2JA8J 9ANTA 4XK4A 4JYKA 3FKIJ 4C3JJ 1ETQA 3JRAA 3RZDJ 5BNGA 3I4MJ 5M5YJ 3QPLA 1EF4A 4I76A 1S7EA 3S2DJ 4D7MA 2L7MP 1ETWA 4XRMA 5F0HA 5IOYA 5C4JJ 4A3JJ 1PUFB 2JA6J 2X9DA 2CJJA 1JKQC 4GFBA 3SFIA 1GDTA 1TWAJ 1HDPA 5FKKA 1VI0A 4M3FA 3L1PA 3A01B 4C3IJ 3CDLA 1LFUP 5FJ8J 2G0EA 1MBGA 5E3LA 5M3MJ 1JGGA 1IDZA 2LR8A 4EEFG 1JT0A 2CQQA 5E3MA 1HOMA 3NAUA 1FIAA 4W1UA 3JRHA 5EZGA 1D5YA 1MBFA 2ME6A 1APLC 3OOUA 4FTHA 3A02A 2TRTA 1Y1WJ 3Q0UA 3NARA 5F1JA 3M3YJ 4IEJA 2HYJA 3Q0VA 1MH3A 4LOCA 5FKNA 3JR9A 2MW8A 2NS8A 4DZJA 2NVXJ 2H8RA 4DYRA 2VKVA 1TWFJ 3K2AA 1JJ6C 1SANA 2LK2A 4D5FA 4D7NA 1SFOJ 1AKHA 3GTGJ 3BQYA 2I10A 1I6HJ 3B6CA 2DA5A 4C2MJ 2NVYJ 4DZPA 4V2GA 3HOWJ 1IDYA 2Y9YA 2Y0SN 3OIOA 3IH2A 2VUMJ 1GUUA 1W0TA 1A6IA 2DA4A 1IGNA 5K7ZA 1CQTA 3JRFA 1RESA 3DEWA 4XICA 4A69C 5F04A 1VF9A 1MSFC 3W6VA 1U78A 2NVQJ 2ZB9A 1X2NA 4A3EJ 2K9NA 2MGQA 2Y30A 2GBYA 3GTLJ 2R0QC 1ZTRA 5IYBJ 1U8BA 2HXOA 2NVTJ 1AHDP 2XB0X 5J3LA 3S1RJ 3S1MJ 1RKWA 2HOTA 2DJNA 1HCRA 2CUFA 4BY7J 3BTJA 3GTQJ 3CQZJ 2B63J 1F43A 3F0CA 3B6AA 1X58A 1GV5A 2XPUA 1POGA 3SJMA 1HF0A 1MH4A 3FIWA 3OSFA 1JT6A 4FCYA 4G12A 3HEFA 5C4XJ 3UKGA 3BR1A 1RETA 3BR3A 1GV2A 1QPIA 2KDZA 2X6OA 1WH7A 3BG5A 5EYRA 1I50J 3BTLA 1R9TJ 3HBLA 2P81A 3BG9A 2EZKA 1ZQ3P 3HOYJ 4XRSG 2HXIA 2LY9A 1JUPA 3SDGA 1XG1A 3GTPJ 2D5VA 5FLMJ 2X48A 3Q0WA 1OFCX 2FQ4A 3S1NJ 4X1EA 2R5ZA 4B1RA 2VI6A 1DU6A 2K9QA 2GLOA 3BT9A 3PM1A 4UUTA 4DYQA 4J19A 2E19A 3MVPA 4A3DJ 2MG4A 5IP7J 2HI3A 4AC0A 4AUXA 3BTIA 2L9RA 3HGGA 1ZR2A 5FKMA 1HLVA 3HOUJ 3WHCA 3BTCA 2LKXA 5IP9J 1QRYA 1FEXA 2QCOA 5FKOA 5E3NA 1ETOA 2WV1A 3RQIA 2E2IJ 3G1LA 3D1NI 4A3IJ 1YRNA 3HOVJ 4M3BA 3GTKJ 1FJLA 2M34A 3MN2A 4XIDA 1ETXA 3FK7A 5EF6A 5F08A 3A03A 2O7OA 5EDNA 3GTMJ 1U9NA 1QVUA 2EBIA 2JMWA 2LD5A 4Y7NJ 3IH3A 1UMQA 2ELKA 2OPTA 4M3DA 2R5ZB 2R92J 5FLVA 2R5YA 2YS9A 3HOZJ 1JUSA 1E3OC 1G2HA 3CCYA 2RAEA 2O8KA 2HOSA 3LNQA 5GPCA 5GPAA 1FTZA 2VPRA 5IYCJ 1K61A 3OSGA 1OJLA 2IEKA 4A3KJ 2R93J 1WH5A 3O8GA 1XS9A 2CQXA 2IAIA 1MSEC 3M4OJ 1K83J 4M3EA 2CU7A 2XGCA 4QTRA 1BL0A 4S0HB 1YRNB 1WCMJ 1MBHA 4RBOA 1IUFA 2LLKA 4L5EA 4A93J 5E3OA 4MIMA 1ETKA 1GT0C 3LOCA 4A3CJ 3LSGA 4DYCA 2XPWA 3ZOBA 1BW5A 2R7ZJ 1A5JA 3ZQHA 4A3LJ 2M8GX 1WGXA 4BXXJ 2N8GA 2GM4A 3S16J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LE8 A;  2R5Y B;  2Y9Z A;  1UHS A;  5GP9 A;  1H8A C;  1Z77 A;  4C3H J;  2CRG A;  5IPA A;  2M2E A;  1MNM C;  1BA5 A;  1IC8 A;  4IHW A;  1JUM A;  1ZK8 A;  2L0K A;  1B72 A;  5JLX A;  3TW6 A;  1W0U A;  1ETV A;  1XC5 A;  3BR5 A;  3O8H A;  5J1U A;  1NK3 P;  3C2B A;  3IV5 A;  1OCT C;  3I4N J;  4MFD A;  5JLW A;  2ID6 A;  3ZQL A;  1WPK A;  1VFC A;  3GBG A;  3LSP A;  4IHV A;  5DS9 A;  1TWC J;  2PMZ N;  1UG2 A;  1OCP A;  1DU0 A;  2DA1 A;  1I3Q J;  2M0C A;  3HB9 A;  4W97 A;  1HDD C;  2DTZ A;  2FX0 A;  1RR7 A;  4MLO A;  3ZQF A;  3HGY A;  3JRB A;  1FTT A;  2AO9 A;  2IBD A;  2L7F P;  2K40 A;  4QSH A;  1Z0X A;  3FIS A;  1LE8 B;  5C3E J;  2YU9 J;  2E1O A;  2XGE A;  4A3B J;  3CMY A;  1JTX A;  1H88 C;  4IHY A;  2ECB A;  1LFB A;  2EQR A;  5M5W J;  1B72 B;  4IHX A;  5IYD J;  2EZH A;  1X2M A;  1IG7 A;  1QVT A;  1JKP C;  4DW6 A;  4Y52 J;  5IOZ A;  3LSR A;  1BJZ A;  3JRI A;  5EZH A;  2LFB A;  4V2F A;  3HM5 A;  5M3F J;  4ABZ A;  5HOD A;  1Y1V J;  2JA5 J;  3ZQC A;  2E2J J;  2ME0 A;  2XGD A;  5IP6 A;  1RKT A;  3S14 J;  2WAQ N;  1JKR C;  2LVS A;  5J1Y A;  2JJ7 A;  3FK6 A;  2CUE A;  3BQZ A;  5EG0 A;  3DCF A;  1ZKG A;  4NDL A;  1TC3 C;  3E7L A;  3TW7 A;  4BKX A;  2EZL A;  5K7H A;  5FKL A;  2Y31 A;  3BG3 A;  3BR6 A;  4FE4 A;  1ITY A;  1TWH J;  4JX5 A;  2VKE A;  5M5X J;  4JX6 A;  4FIS A;  1O4X A;  1ENH A;  1ZGW A;  4AYB N;  4A3M J;  4XRS A;  2DA6 A;  4MO7 A;  4RDU A;  2JK3 A;  2DMU A;  2TCT A;  2ID3 A;  1P7J A;  2COB A;  1IJW C;  2JWT A;  3S2H J;  2ECC A;  3S1Q J;  2FD5 A;  2KT0 A;  3JRE A;  1MBK A;  3ZQI A;  3WHB A;  1MBJ A;  1Q1V A;  3GTJ J;  2WB1 N;  2LTP A;  3QQA A;  4QIW N;  5K7F A;  5EEA A;  1IV6 A;  3HOX J;  2L7Z A;  2DA3 A;  5F27 A;  5EG0 B;  2E2H J;  3JRD A;  3S15 J;  2DA2 A;  2JN6 A;  3GTO J;  4M6V A;  1FIP A;  5EGO A;  2DA7 A;  4B3A A;  1P7I A;  2O9L A;  3G1M A;  1B8I A;  1BW6 A;  2QF7 A;  2DMN A;  4FE7 A;  1TWG J;  4I6Z A;  3K7A J;  5F0C A;  1H89 C;  4CYC A;  3H0G J;  1T33 A;  2H1K A;  1AU7 A;  3ZQG A;  4A3G J;  3JRC A;  2DMT A;  3TED A;  1GVD A;  2FJ1 A;  1U9O A;  1ORK A;  2DN0 A;  1IRZ A;  4HNV A;  3QPS A;  4UUS A;  1ETY A;  2XSD C;  3JRG A;  1T56 A;  2HOA A;  1JKO C;  4X6A J;  3VPR A;  3TP0 A;  4BBR J;  3BR0 A;  1AKH B;  3G1O A;  5EGO B;  4BBS J;  1NK2 P;  3RZO J;  4JX4 A;  1JTY A;  2W48 A;  2NOG A;  1B8I B;  3H3V K;  3HDD A;  1MBE A;  2DMQ A;  4M3G A;  4JP0 A;  3BR2 A;  1PUF A;  4B4C A;  4A3F J;  2EZI A;  2YUS A;  3TP3 A;  3S17 J;  4D5C A;  3HKZ N;  3Q3S A;  2XPV A;  2MSY A;  2DMP A;  5F0F A;  4CYC B;  3A01 A;  1WI3 A;  1NTC A;  3MKL A;  1VND A;  3PO2 J;  1JJ8 C;  2M9H A;  2LP0 A;  4MFE A;  2JA7 J;  2EH3 A;  2NS7 A;  2Y2Z A;  2HQ5 A;  1ZR4 A;  5J1R A;  2XB5 A;  5DTD A;  2XRL A;  2OF7 A;  1RPW A;  4UUS B;  1F36 A;  5C44 J;  3RKQ A;  3LSJ A;  3PO3 J;  3IH4 A;  2K9S A;  4BY1 J;  2HDD A;  2AHQ A;  2JA8 J;  9ANT A;  4XK4 A;  4JYK A;  3FKI J;  4C3J J;  1ETQ A;  3JRA A;  3RZD J;  5BNG A;  3I4M J;  5M5Y J;  3QPL A;  1EF4 A;  4I76 A;  1S7E A;  3S2D J;  4D7M A;  2L7M P;  1ETW A;  4XRM A;  5F0H A;  5IOY A;  5C4J J;  4A3J J;  1PUF B;  2JA6 J;  2X9D A;  2CJJ A;  1JKQ C;  4GFB A;  3SFI A;  1GDT A;  1TWA J;  1HDP A;  5FKK A;  1VI0 A;  4M3F A;  3L1P A;  3A01 B;  4C3I J;  3CDL A;  1LFU P;  5FJ8 J;  2G0E A;  1MBG A;  5E3L A;  5M3M J;  1JGG A;  1IDZ A;  2LR8 A;  4EEF G;  1JT0 A;  2CQQ A;  5E3M A;  1HOM A;  3NAU A;  1FIA A;  4W1U A;  3JRH A;  5EZG A;  1D5Y A;  1MBF A;  2ME6 A;  1APL C;  3OOU A;  4FTH A;  3A02 A;  2TRT A;  1Y1W J;  3Q0U A;  3NAR A;  5F1J A;  3M3Y J;  4IEJ A;  2HYJ A;  3Q0V A;  1MH3 A;  4LOC A;  5FKN A;  3JR9 A;  2MW8 A;  2NS8 A;  4DZJ A;  2NVX J;  2H8R A;  4DYR A;  2VKV A;  1TWF J;  3K2A A;  1JJ6 C;  1SAN A;  2LK2 A;  4D5F A;  4D7N A;  1SFO J;  1AKH A;  3GTG J;  3BQY A;  2I10 A;  1I6H J;  3B6C A;  2DA5 A;  4C2M J;  2NVY J;  4DZP A;  4V2G A;  3HOW J;  1IDY A;  2Y9Y A;  2Y0S N;  3OIO A;  3IH2 A;  2VUM J;  1GUU A;  1W0T A;  1A6I A;  2DA4 A;  1IGN A;  5K7Z A;  1CQT A;  3JRF A;  1RES A;  3DEW A;  4XIC A;  4A69 C;  5F04 A;  1VF9 A;  1MSF C;  3W6V A;  1U78 A;  2NVQ J;  2ZB9 A;  1X2N A;  4A3E J;  2K9N A;  2MGQ A;  2Y30 A;  2GBY A;  3GTL J;  2R0Q C;  1ZTR A;  5IYB J;  1U8B A;  2HXO A;  2NVT J;  1AHD P;  2XB0 X;  5J3L A;  3S1R J;  3S1M J;  1RKW A;  2HOT A;  2DJN A;  1HCR A;  2CUF A;  4BY7 J;  3BTJ A;  3GTQ J;  3CQZ J;  2B63 J;  1F43 A;  3F0C A;  3B6A A;  1X58 A;  1GV5 A;  2XPU A;  1POG A;  3SJM A;  1HF0 A;  1MH4 A;  3FIW A;  3OSF A;  1JT6 A;  4FCY A;  4G12 A;  3HEF A;  5C4X J;  3UKG A;  3BR1 A;  1RET A;  3BR3 A;  1GV2 A;  1QPI A;  2KDZ A;  2X6O A;  1WH7 A;  3BG5 A;  5EYR A;  1I50 J;  3BTL A;  1R9T J;  3HBL A;  2P81 A;  3BG9 A;  2EZK A;  1ZQ3 P;  3HOY J;  4XRS G;  2HXI A;  2LY9 A;  1JUP A;  3SDG A;  1XG1 A;  3GTP J;  2D5V A;  5FLM J;  2X48 A;  3Q0W A;  1OFC X;  2FQ4 A;  3S1N J;  4X1E A;  2R5Z A;  4B1R A;  2VI6 A;  1DU6 A;  2K9Q A;  2GLO A;  3BT9 A;  3PM1 A;  4UUT A;  4DYQ A;  4J19 A;  2E19 A;  3MVP A;  4A3D J;  2MG4 A;  5IP7 J;  2HI3 A;  4AC0 A;  4AUX A;  3BTI A;  2L9R A;  3HGG A;  1ZR2 A;  5FKM A;  1HLV A;  3HOU J;  3WHC A;  3BTC A;  2LKX A;  5IP9 J;  1QRY A;  1FEX A;  2QCO A;  5FKO A;  5E3N A;  1ETO A;  2WV1 A;  3RQI A;  2E2I J;  3G1L A;  3D1N I;  4A3I J;  1YRN A;  3HOV J;  4M3B A;  3GTK J;  1FJL A;  2M34 A;  3MN2 A;  4XID A;  1ETX A;  3FK7 A;  5EF6 A;  5F08 A;  3A03 A;  2O7O A;  5EDN A;  3GTM J;  1U9N A;  1QVU A;  2EBI A;  2JMW A;  2LD5 A;  4Y7N J;  3IH3 A;  1UMQ A;  2ELK A;  2OPT A;  4M3D A;  2R5Z B;  2R92 J;  5FLV A;  2R5Y A;  2YS9 A;  3HOZ J;  1JUS A;  1E3O C;  1G2H A;  3CCY A;  2RAE A;  2O8K A;  2HOS A;  3LNQ A;  5GPC A;  5GPA A;  1FTZ A;  2VPR A;  5IYC J;  1K61 A;  3OSG A;  1OJL A;  2IEK A;  4A3K J;  2R93 J;  1WH5 A;  3O8G A;  1XS9 A;  2CQX A;  2IAI A;  1MSE C;  3M4O J;  1K83 J;  4M3E A;  2CU7 A;  2XGC A;  4QTR A;  1BL0 A;  4S0H B;  1YRN B;  1WCM J;  1MBH A;  4RBO A;  1IUF A;  2LLK A;  4L5E A;  4A93 J;  5E3O A;  4MIM A;  1ETK A;  1GT0 C;  3LOC A;  4A3C J;  3LSG A;  4DYC A;  2XPW A;  3ZOB A;  1BW5 A;  2R7Z J;  1A5J A;  3ZQH A;  4A3L J;  2M8G X;  1WGX A;  4BXX J;  2N8G A;  2GM4 A;  3S16 J; 
#chains in the Genus database with same CATH topology
 2ZJ2 A;  3CLO A;  1MJ9 A;  2E36 A;  1F4K A;  1Q1H A;  3CMA I;  3OY9 A;  1H8A C;  1LJ9 A;  1Z77 A;  1ZHF A;  2IS6 A;  3KEY A;  3CJR B;  4EAT A;  1IC8 A;  3DF8 A;  3G73 A;  2E35 A;  3AKZ A;  1MW7 A;  2L0K A;  3OYF A;  5JLX A;  3F3X A;  1W0U A;  1ETV A;  2UUZ A;  3QOE A;  2ZCW A;  3BR5 A;  5J1U A;  1IO2 A;  4DBR A;  1J5Y A;  3BOQ A;  1OCT C;  2HGC A;  2GQQ A;  2JVG A;  2ID6 A;  3WTZ A;  4RM3 A;  3HHG A;  3M1E A;  1VFC A;  2H09 A;  5BPI A;  3HOT A;  1MMD A;  3ZQQ A;  2V9K A;  4RGU A;  3R60 A;  2PMZ N;  3OL4 A;  1DU0 A;  1XX5 A;  3HB9 A;  2DPU A;  4XON A;  5CQE A;  5HDK A;  4XBF A;  1HDD C;  3CC4 I;  2FX0 A;  2R7D A;  3C2H A;  1SD4 A;  1FBQ A;  1SVL A;  5E1X A;  3JRB A;  2AO9 A;  2OZU A;  3ULQ B;  2EIL H;  2K40 A;  4QSH A;  1Z0X A;  2OBP A;  5LD2 C;  1LE8 B;  2K02 A;  3MD2 A;  4H4K C;  2E1O A;  2PBI A;  3CF2 A;  3A2K A;  3CMY A;  1H88 C;  1TNS A;  2VBW A;  2ECB A;  1X3Z B;  3F22 A;  3CO7 C;  2DOE A;  1LFB A;  2XAF A;  4BE1 A;  4RLQ A;  1HBX G;  3ZMS A;  4DOZ A;  4XSX F;  2P0W A;  4IHX A;  3K70 C;  3DU5 A;  1LDD A;  4HW0 A;  1W7P B;  1QVT A;  2ZXH A;  1FLI A;  4CCL A;  1QZZ A;  3DLL F;  1DGW Y;  1BJZ A;  3WGI A;  1HKT A;  2LFB A;  3HM5 A;  2E7X A;  4KN4 X;  4KMF A;  4NUB A;  1OR7 C;  2QUF A;  5HDN A;  3FM3 A;  4BDY A;  1W5T A;  2FML A;  2XGD A;  2CV1 A;  2EIM H;  3H35 A;  1U3E M;  2LVS A;  1YIO A;  2E5N A;  1K79 A;  2JJ7 A;  2CYY A;  4FX4 A;  2PEX A;  3WE2 A;  4I0A A;  3ZN0 A;  4EJU A;  3DCF A;  4NDL A;  3TQN A;  1LPQ A;  3BG7 A;  3I59 B;  2HQN A;  1U5T A;  2RN7 A;  2HDW A;  2EZL A;  3LMM A;  4A2U A;  2KIM A;  1G8X A;  2VE8 A;  2Y31 A;  3BG3 A;  2BHZ A;  2XHK A;  4IRH A;  2VPL A;  2BOL A;  3QRF F;  2VKE A;  3HKZ A;  2VBZ A;  2FOK A;  4Q48 A;  3NWT A;  2O8X A;  4WXD A;  3SEQ A;  1XSX A;  1USS A;  1O4X A;  1ENH A;  4A3M J;  3M1C A;  3S16 J;  3U21 A;  2FQ3 A;  3Q9V A;  4O5V A;  4RDU A;  3I55 I;  1BN5 A;  1BR2 A;  3M8J A;  2COB A;  3RKX A;  3DEE A;  2KT0 A;  2VBY A;  3FMS A;  3JRE A;  1PDN C;  4IHT A;  2RRE A;  1J9I A;  2ZSI B;  2DJI A;  3ZQI A;  1V5F A;  5L3D A;  2VOO A;  1MBJ A;  4O3M A;  1OCR H;  1HKQ A;  3OR1 C;  4HF0 A;  4MQV A;  2TDX A;  3W2W A;  2L7Z A;  1XGS A;  5EG0 B;  3S15 J;  2IGK A;  4L5I A;  5AIP A;  4L18 B;  3GTO J;  2JN6 A;  4M6V A;  5EGO A;  4C30 A;  3FXQ A;  2DA7 A;  3DKY A;  4B3A A;  4Y3O A;  5J8F A;  1LKX A;  3CJN A;  4NQW A;  5FO5 A;  3FBN B;  1B9N A;  4M6X A;  1IAW A;  1V3F A;  3KCC A;  3V4G A;  1YO5 C;  4XLF A;  1D5V A;  4S05 A;  3LFK A;  4ZYH A;  1RRJ A;  1R22 A;  1TW2 A;  4CA0 A;  5HS9 A;  2BW3 A;  4FE7 A;  2VE9 A;  5D5W B;  3LA7 A;  3DTI A;  2CW0 F;  4Y33 A;  1HA8 A;  3CUQ A;  4GCV A;  1G3S A;  2X6Y A;  3ZQG A;  2H1K A;  4BQN A;  2G7U A;  5DUI A;  2HPM A;  1JGS A;  3O2P E;  4OIO F;  2VLA A;  3CF5 F;  3P7N A;  4ZDO A;  1KZH A;  4ZZD A;  1OCZ H;  4DGW B;  2XSD C;  1WWX A;  3ERE D;  3LSM A;  2UZK A;  1JKO C;  4I0B A;  2IGN A;  4HX7 A;  5EEH A;  4ZTJ A;  1MDM B;  3EDP A;  1YIT I;  4BEH B;  4E70 A;  2HYG D;  1W36 C;  3OYD A;  3KP3 A;  4PJJ A;  4PGH A;  2KZG A;  2STT A;  3BCB A;  5B66 C;  3OOP A;  1B8I B;  2L54 A;  2RKH A;  2LG4 A;  3TO9 A;  1PUF A;  4B4C A;  3QAH A;  1E17 A;  4A3F J;  2CWE A;  3V8L A;  1OIS A;  2E34 A;  3VDX A;  4D5C A;  3Q3S A;  3LSI A;  4RGX A;  4F52 A;  2XUB A;  1UG0 A;  5E17 F;  1REP C;  4C2U A;  1R23 A;  3P5J A;  3TBI A;  4BAC A;  1IRG A;  2NS7 A;  2PMH A;  2Y2Z A;  5J1R A;  2MA3 A;  4IXA A;  4B43 A;  2OF7 A;  5KNL A;  4UUS B;  4NC7 A;  2DQL A;  2O3F A;  3IH4 A;  2KHM A;  3K69 A;  4BY1 J;  5DDG A;  3C7J A;  3T8T A;  2JA8 J;  4HV5 A;  1T8I A;  2IS4 A;  4JYK A;  1ETQ A;  2DOF A;  2GAU A;  3ZMV A;  5BNG A;  2ZC2 A;  2QEN A;  4M9S A;  4L0Z B;  3I4M J;  4XLH A;  4P9F A;  3ZQ7 A;  1EF4 A;  2ZBK A;  3EYY A;  2KPM A;  4I76 A;  2NAZ A;  1Z6T A;  3DFG A;  3ZXS A;  5C4J J;  4A3J J;  5F0H A;  5IOY A;  3ABL H;  2CJJ A;  2QQB A;  4GFB A;  5TJJ A;  4XN3 A;  3WGH A;  2HWV A;  1GDT A;  1XB4 A;  3BG6 A;  1ZRF A;  2W57 A;  1OYI A;  3L1P A;  3A01 B;  2IVM A;  5FRN A;  1CGP A;  3CDH A;  2R7T A;  2V4J C;  5FJ8 J;  2MD5 A;  3W6J B;  3L2Q A;  5E3L A;  2CMP A;  2GIZ A;  3CME I;  2JVH A;  3IRQ A;  2X85 A;  1MJB A;  4IOC F;  3NAU A;  5EZG A;  1YJW I;  3P9K A;  3OYN A;  1APL C;  1HC8 A;  2TRT A;  4HDV A;  2W00 A;  2FUG 2;  1Y1W J;  2UXX A;  4E7J A;  1N78 A;  3GXO A;  4L0Y B;  3GZ5 A;  3QYF A;  2NS8 A;  2NVX J;  4A0Z A;  2H8R A;  4DYR A;  2R7Q A;  3K2A A;  2LK2 A;  1SFO J;  1UST A;  1YYV A;  2QKM B;  3I54 A;  3BQY A;  3F8N A;  1K4T A;  5ILU A;  2DI3 A;  1I6H J;  4YFK F;  3F8C A;  2CV2 A;  3PQK A;  1T2K A;  2W82 A;  2YU3 A;  3V7C A;  1IDY A;  2Y0S N;  5FRO A;  3GFI A;  1CF7 B;  5LGT A;  4G8X A;  1ERD A;  4GGG A;  4A69 C;  4EVI A;  1VF9 A;  2XAQ A;  3PUB A;  1R1V A;  2DK5 A;  2OCE A;  2NVQ J;  5D5U B;  2GA2 A;  1X2N A;  4HYE A;  1Z6R A;  2Y30 A;  5HLH A;  4AIJ A;  3VOD A;  1I1S A;  1U8B A;  3OYA A;  2HXO A;  3ISP A;  2D2W A;  1O3T A;  2NVT J;  2A61 A;  5J3L A;  3S1M J;  4FHT A;  2DAO A;  1FYL A;  1O7F A;  1RKW A;  4G6D A;  2F4O B;  3CCE I;  4DIQ A;  3ZP5 A;  1MD0 A;  1RI7 A;  4PDK A;  3BY6 A;  2KRH A;  3GTQ J;  3F0C A;  5AIQ A;  1FBS A;  5CVU A;  1X58 A;  4XNF A;  1KGS A;  5FB2 A;  5LEK A;  3CC2 I;  3KLN A;  5LLQ A;  2VKH A;  2Y48 A;  1G6N A;  3GLL A;  3F8M A;  4G12 A;  1Z91 A;  3DLA A;  3R0A A;  1I3A A;  1ZRD A;  5DCM A;  2EWN A;  3HSF A;  1GV2 A;  2J5P A;  2KDZ A;  3K4N A;  1S29 A;  1WH7 A;  4YFN F;  3HBL A;  4E6K G;  1B1B A;  5DCF A;  3BG9 A;  3L2U A;  2XC7 A;  3FX3 A;  3IHU A;  1HKS A;  2LY9 A;  3EUA A;  4MHG A;  3GTP J;  2D5V A;  1G4D A;  4GRI A;  4HNU A;  3WTT C;  3Q0W A;  1R49 A;  2ESN A;  2B0L A;  3B02 A;  5GAD J;  2J5O A;  4B1R A;  4OOI A;  1TZL A;  1DP7 P;  2PJP A;  2K9Q A;  1QZE A;  2GLO A;  1WJA A;  4PJM A;  2VIX A;  4XKC A;  5JHU A;  4KN7 X;  3ABU A;  4DYQ A;  2AQE A;  1X1C A;  3MVP A;  4UVB A;  2MG4 A;  1IN7 A;  1Z9C A;  2X51 A;  2HI3 A;  4AC0 A;  4BQQ A;  3BTI A;  2ISZ A;  1ZN2 A;  1ZR2 A;  3WU0 A;  2VQH A;  3LA3 A;  5FKM A;  3HOU J;  2UV1 A;  4IJA A;  3OYB A;  1QRY A;  1R58 A;  2A3S A;  1OKR A;  3PSF A;  1U2W A;  2GXG A;  2KIF A;  3C3W A;  1ETO A;  4G7O F;  4DNC A;  4ITV A;  3TO6 A;  1W4M A;  4BH9 A;  4A3I J;  2PMZ A;  3O3K A;  1P9Q C;  2OC6 A;  4G6Q A;  3MN2 A;  1G3Y A;  3F8F A;  1ETX A;  5CVV A;  2W24 A;  1XMX A;  3A03 A;  2O7O A;  4HSR A;  3D5L A;  1U9N A;  1STZ A;  3LL7 A;  1QVU A;  2JMW A;  2ZKZ A;  3A0H C;  1FOK A;  5J6X A;  4BJT A;  3KYL A;  1ZH5 A;  3FHN A;  3SEZ A;  3WGG A;  2R5Z B;  2R92 J;  4XOP A;  2M7A A;  3OL3 A;  2JZY A;  5D4S A;  3ASN H;  1E3O C;  3F6V A;  3V8K A;  2H1L A;  2O8K A;  3CZ6 A;  3LNQ A;  2GIV A;  5IT3 A;  2P5K A;  5DM7 F;  3OYK A;  3K10 A;  2IA1 A;  2NS0 A;  1T39 A;  1OJL A;  3C1D A;  2H94 A;  1IN6 A;  2BBY A;  4A3K J;  4J01 A;  5E79 C;  4C2T A;  4CZZ A;  1WH5 A;  3IL2 A;  3O8G A;  1IZ1 A;  4JBA A;  5AON A;  5TIS C;  2LY2 A;  3M4O J;  3H0D A;  5EJC A;  1ONV A;  2NNY A;  1K83 J;  2CW7 A;  4M3E A;  3SFZ A;  1L0O C;  1VQM I;  4QTR A;  3W3C A;  4G94 A;  2LKP A;  5FFZ A;  3GF2 A;  5E3O A;  1SFK A;  1O3Q A;  2KRC A;  3HJE A;  1YJN I;  2M4G A;  3HRT A;  4ETS A;  2GZW A;  2WY8 Q;  1YG2 A;  2OTJ I;  3HXL A;  5GAH J;  2OV7 A;  5LRS A;  3T8R A;  2Y9Z A;  3E6M A;  5BS6 A;  1B59 A;  4E7H A;  4RA2 A;  3HRM A;  3BZ6 A;  2CRG A;  5IPA A;  4OU0 A;  2M2E A;  1MNM C;  1BA5 A;  2ISY A;  4ANJ A;  1D0Z A;  4EGY A;  1ZK8 A;  2XVC A;  3CO6 C;  1HW1 A;  1B72 A;  3GZN B;  3IP4 B;  3TW6 A;  1A35 A;  1Y6I A;  1XC5 A;  4F92 B;  3I4N J;  1IN5 A;  3SQN A;  2AS5 F;  2JT1 A;  3ZMT A;  1XMA A;  4M74 A;  1WPK A;  4CCJ A;  1RUO A;  3IWF A;  4IHV A;  3LSP A;  1I27 A;  2I8D A;  4RAZ A;  5DS9 A;  2KDO A;  4KIF A;  3VFZ A;  1R5I D;  1FC3 A;  1RC9 A;  1OCP A;  1UG2 A;  1YOV B;  2F5E A;  2Z99 A;  4ZYD A;  4KT5 C;  1I3Q J;  2M0C A;  2HYF A;  3E3V A;  4W97 A;  2HEO A;  4GYG A;  3U2R A;  3CCR I;  4CCO A;  2ETH A;  1LNW A;  3HGY A;  5CLS A;  3F8B A;  5JR3 A;  2Q1Z B;  4RS8 A;  3AAF A;  4I7H A;  4IHY A;  2JUC A;  4U0V A;  4WXH A;  2VB6 A;  4D1Q A;  4BE2 A;  2VJJ A;  1BC8 C;  2DQR A;  3NWS A;  5FD5 A;  2R4G A;  4KMU X;  3MKW B;  5IYD J;  1I1G A;  1IG7 A;  1E3P A;  3SXY A;  2KIS A;  5IOZ A;  4Y52 J;  2PJR A;  3QOP A;  1FMW A;  5HLT A;  3KEQ A;  4ABZ A;  2VOD A;  1FOX A;  1Y1V J;  2L5Q A;  3SZG A;  1VQL I;  1WVR A;  1RKT A;  4XMY A;  5DEQ A;  4WCG A;  2HOE A;  1JKR C;  5J1Y A;  3K9T A;  2QM3 A;  1LDK B;  4O6J A;  2HDC A;  2EPF A;  1JHH A;  3L2R A;  1TC3 C;  1A6Q A;  3TW7 A;  5IT9 Z;  3CUO A;  2F4M B;  2ZJQ F;  2WBM A;  2DU9 A;  2XIG A;  4BKX A;  2FNP A;  4EJV A;  2BYV E;  3F9K A;  2Z1D A;  1TWH J;  3D5R C;  5ERI A;  5L3F A;  4XOT A;  3FXR A;  2RQP A;  3FXJ A;  2VJI A;  3NQO A;  1P6R A;  4HEA 2;  4TV7 A;  4FIS A;  2K9M A;  3I0T A;  5H20 A;  1MKM A;  2CW8 A;  4N4N B;  2ZNY A;  2LKS A;  1X4P A;  1L3L A;  3FZV A;  4IF4 A;  2JK3 A;  2DMU A;  3DTK A;  2ID3 A;  1YS7 A;  1ZGA A;  1P7J A;  2ZXW H;  1OYW A;  4XLP F;  2JWT A;  2BVL A;  3S2H J;  4ZYE A;  1S6L A;  1DGR M;  3HSR A;  2FD5 A;  2WAD A;  5E8G A;  2MH9 A;  2DFE A;  1MBK A;  4QPQ A;  4HX8 A;  2X1D A;  4RMN A;  4MTD A;  2A68 F;  3PSI A;  1XDU A;  2FBI A;  1Y0N A;  3T0Y A;  2FRH A;  3RKY A;  6PAX A;  2WB1 N;  4QIW N;  5EEA A;  1RIO H;  3HOX J;  2Z3Y A;  5F27 A;  2E2H J;  1T98 A;  4EJW A;  1XSV A;  4L9N A;  3KP5 A;  4LB6 B;  3BPV A;  1U5T B;  1JI8 A;  1U5T C;  2K86 A;  1YHQ I;  2O9L A;  4B09 A;  2VOP A;  1WSU A;  1SD6 A;  3E97 A;  4UB8 C;  1FYK A;  4MGR A;  2BZT A;  4EM0 B;  4OAZ A;  1K78 A;  2FU4 A;  3FMR A;  2DMN A;  2YX7 A;  1JXS A;  2KP6 A;  1X4O A;  2V9P A;  1X1B A;  3FXU A;  1P4A A;  1AU7 A;  5D5V B;  3E6C C;  1O3R A;  1T6S A;  3NEU A;  2DMT A;  1HSJ A;  2EFN A;  1GVD A;  1G59 A;  4PUS A;  2IA2 A;  4LG3 A;  5DV5 A;  4XLE A;  4HNV A;  1IRZ A;  4P96 A;  5JFR A;  1MJA A;  2VT3 A;  3JRG A;  2HOA A;  1XD7 A;  1IXS B;  2W25 A;  1WJE A;  5H2F C;  5EGO B;  2XRN A;  2VQL A;  1WI9 A;  3RZO J;  3HTU A;  1Y56 A;  2DTR A;  4JX4 A;  4NQW B;  1KU7 A;  4FT8 A;  1JTY A;  2JPB A;  4KIC A;  1H0M A;  2EJR A;  2DMQ A;  2KQR A;  4M3G A;  2Y0S A;  2G7H A;  2UWM A;  4JP0 A;  3BR2 A;  2DDB A;  4U0Y A;  1S72 I;  2YUS A;  3S17 J;  2VXZ A;  1ZG5 A;  5CPR B;  2BW3 B;  3G2B A;  3HUG A;  2HVS A;  2EIN H;  1V54 H;  3GO5 A;  3CDI A;  3J7Z I;  3CUQ B;  1NTC A;  1TQM A;  2X6X A;  4YRV A;  3GCM A;  2M9H A;  2LP0 A;  3KP4 A;  4MFE A;  1WJ5 A;  2P5V A;  2L4M A;  5KHD A;  4JK1 X;  5D8K B;  2K3P A;  5A2Q Z;  1ZR4 A;  3CD6 I;  3T1B A;  4ZDL A;  2XRL A;  4LMY A;  1G3W A;  3WTV C;  3RKQ A;  3LSJ A;  1IRF A;  4HDU A;  3PO3 J;  3H5R A;  3DTE A;  2K9S A;  2A5W A;  1X19 A;  2BY2 A;  5BOX A;  4RB0 A;  4XK4 A;  4UY8 I;  3M8F A;  3ESW B;  2A07 F;  5GAG J;  3JRA A;  2X6W A;  1T0F A;  2FSW A;  4IQ4 A;  2DOA A;  2Z5U A;  3L7W A;  5M5Y J;  2IS2 A;  2ZO4 A;  2EA4 A;  1YX3 A;  1OCO H;  2NNN A;  1AOY A;  2WC2 A;  5E1Z B;  1XGN A;  3K1P A;  5BPD A;  2VJ5 A;  2EV0 A;  5CQG A;  3F21 A;  3GZ6 A;  3MZ8 A;  4XRM A;  1PUF B;  2JA6 J;  3QWL A;  3V42 A;  2X9D A;  1O7L A;  3SFI A;  2X0L A;  3MCZ A;  5HLI A;  3S3O A;  4XKV A;  1DP3 A;  4C9Y A;  1HDP A;  1NHA A;  4ESF A;  3ONQ A;  1R5G A;  3CDL A;  1LFU P;  3U1K A;  4N4O B;  5M3M J;  1JGG A;  4L9J A;  1IDZ A;  1UHM A;  3REO A;  1LEB A;  1H9T A;  1B6A A;  2CQQ A;  5E3M A;  1FIA A;  1D5Y A;  4HBL A;  1MBF A;  2ME6 A;  3A02 A;  1J09 A;  2XAJ A;  4IZZ A;  3GFJ A;  3VSL A;  4BL0 B;  1T95 A;  4KIT B;  4RB3 C;  2VBX A;  4IEJ A;  2HYJ A;  3WTW C;  3Q0V A;  4LOC A;  3E5X A;  2MW8 A;  1XMK A;  5J47 A;  4B44 A;  4XLA A;  4EMS A;  1EH8 A;  4Y13 A;  3K4M A;  3JCU C;  3WU2 C;  1SAN A;  2B9S A;  2XSJ C;  3I58 A;  4NC8 A;  4F55 A;  2I10 A;  2KJB A;  1MGT A;  1YW9 A;  3ZCO A;  3OYL A;  1EA3 A;  3MKZ A;  2E1M B;  2BXZ A;  4DZP A;  3IWZ A;  1VQO I;  4F93 B;  2W84 A;  3QU6 A;  1GUU A;  1W0T A;  2F4I A;  1KYZ A;  3I9V 2;  3QU3 A;  3L2C A;  5K7Z A;  2KJC A;  1RES A;  4XIC A;  3AG4 H;  5F04 A;  5LBQ A;  1MSF C;  2A6T A;  3P9C A;  4LIV A;  4XR6 A;  3W6V A;  2Q2E A;  3J7A Y;  2WAE A;  4A3E J;  5IT9 K;  2GBY A;  3CJQ B;  3GTL J;  4I99 C;  2R0Q C;  5KK1 A;  1QHG A;  1LUJ B;  2BE5 F;  3S1R J;  2LY1 A;  3T5X A;  3PIO F;  3OMY A;  4XN0 A;  3KPH A;  3KET A;  1HCR A;  4KIG A;  2D1V A;  4BY7 J;  3BTJ A;  5CVI A;  1F5T A;  4PGG A;  1F43 A;  2XF7 A;  2FBK A;  3OS0 A;  2Q0O A;  3B6A A;  1R1T A;  3TKY A;  1J0R A;  2D45 A;  1POG A;  1HF0 A;  3OSF A;  5H6Q A;  1VQ5 I;  1JT6 A;  1OLT A;  3HEF A;  2RQQ A;  3IUO A;  5ED4 A;  3UKG A;  3WTS C;  1SVM A;  1SAU A;  3JW4 A;  4R79 A;  4PSX A;  4E7L A;  3HSE A;  3BG5 A;  5EYR A;  1YX5 A;  5HVQ C;  4OWR B;  3BTL A;  3PQJ A;  4ZH4 F;  1MMN A;  4BAY A;  2K7L A;  3OS2 A;  1SMY F;  1R9T J;  1I6X A;  2KZV A;  1ZQ3 P;  5D6F A;  3Q5F A;  4XRS G;  1LQ1 A;  4U7B A;  5TRD A;  5FLM J;  2X48 A;  4LJZ F;  1I5Z A;  2O61 A;  5LHI A;  4ZC3 A;  2FQ4 A;  3S1N J;  1Z1D A;  2VI6 A;  1TT5 B;  1RR8 C;  3PNY A;  1N77 A;  4MEX F;  4K2E A;  1WQ2 A;  2A05 A;  2NOJ B;  3BT9 A;  3PM1 A;  2M4K A;  3HPH A;  2IGO A;  3M07 A;  1UCR A;  4HAM A;  4A3D J;  1Y8R B;  1TNT A;  4F91 B;  2BY0 A;  2L3D A;  4L9T A;  1BR1 A;  3OYJ A;  4BJ6 C;  4HRI A;  3O6B B;  1Y0U A;  3FWE A;  5DCM B;  3CMM A;  1U0J A;  3AL0 B;  3RQI A;  2XF5 A;  1RZ4 A;  2A69 F;  1PVE A;  1EV7 A;  1X1A A;  1EH6 A;  1FJL A;  5FLX Z;  1QGP A;  3SZT A;  4KIS A;  5EF6 A;  5F08 A;  2BHY A;  3J80 Z;  2E1C A;  5EDN A;  2DPD A;  5L3G A;  1D0X A;  2IW5 A;  4ZTF A;  3S2W A;  3BJA A;  3L2V A;  3MZY A;  4UXN A;  4NNJ A;  1UMQ A;  3COA C;  3SZP A;  2OA4 A;  1W1W E;  3HPG A;  2R5Y A;  3DWL E;  2L2O A;  2CQ7 A;  3D5S C;  2IJL A;  2KRF A;  2RNG A;  3MMY B;  5CKT A;  4Z2Y A;  2ZXJ A;  3CLQ A;  4HPQ A;  1YI2 I;  4U87 A;  5GPA A;  1FTZ A;  2PI0 A;  2VPR A;  4OMY A;  3ABM H;  3BPX A;  4HLX A;  1YQA A;  2CH0 A;  3I56 I;  2K9L A;  4AIH A;  1XS9 A;  1QHH D;  2IGM A;  2IAI A;  1MSE C;  1PP7 U;  5A2Q K;  5E8I A;  4RAY A;  2CU7 A;  4A0Y A;  4LGW A;  3WTY C;  1KON A;  2RNJ A;  4S0H B;  2F48 A;  1R1U A;  1IUF A;  1X1D A;  4KT6 A;  2LLK A;  1J75 A;  4L5E A;  4MIM A;  1ETK A;  1V5G A;  1BW5 A;  3HIF A;  3S93 A;  2LBF A;  5J8C A;  2HKO A;  2JRM A;  2MAB A;  2MBF A;  3SYT A;  1TL8 A;  1WGX A;  3J81 Z;  4BXX J;  3CP8 A;  1DU6 A;  5LHG A;  2CGP A;  3JAM Z;  2JUG A;  3WG7 H;  5GP9 A;  2STW A;  4GO1 A;  4Q5S F;  2ICW G;  4CXF A;  4CCN A;  4C3H J;  2MLK A;  4HOB A;  2M45 A;  4IHW A;  4P55 A;  3EPZ A;  3ZMZ A;  4LK0 F;  1VQ7 I;  4HV6 A;  4OIN F;  1DUX C;  1R5H A;  1SFX A;  5KAI C;  1YLF A;  2LYC A;  1Z7U A;  3O8H A;  1NK3 P;  1QQI A;  2Y69 H;  3C2B A;  1LVK A;  4XM3 A;  1QU3 A;  4F7Z A;  1UB9 A;  3ZQL A;  3CTA A;  3DBH B;  4GDF A;  4BYY A;  3GBG A;  1IRX A;  1DPR A;  1ULY A;  1TWC J;  3CCJ I;  4N9I A;  4IKF A;  4BE0 A;  3H5A A;  2CSO A;  3H36 A;  4BGD A;  2WB1 A;  4YEJ A;  4L5J A;  3CCV I;  2QVO A;  1UAA A;  2DTZ A;  1D8J A;  3PFI A;  1C0W A;  1RR7 A;  4MLO A;  3ZMU A;  3ZQF A;  1NH3 A;  4N9H A;  2IBD A;  2LNB A;  4CGZ A;  3HG9 A;  1YW7 A;  2HPI A;  5C3E J;  2YU9 J;  3JTH A;  1UHW A;  4FX0 A;  5CVJ A;  3K70 D;  1FOY A;  3E0J B;  4A3B J;  1IUY A;  1ZGJ A;  4I09 A;  4IHS A;  1JTX A;  3DEU A;  3DKW A;  2GWR A;  2V1D A;  3L00 A;  2WWY A;  5M5W J;  4HLY A;  3I64 A;  4WX9 A;  1B72 B;  3GFM A;  3MKY B;  1XDS A;  2QKL B;  3J7Y J;  4IRG A;  2EZH A;  1X2M A;  3GFL A;  5L3E A;  1QPM A;  3TOA A;  2O5R A;  4DW6 A;  3LSR A;  1NG6 A;  5EZH A;  1BIB A;  5M3F J;  3M9A A;  3EUK L;  3S3M A;  2YR2 A;  1D0Y A;  1KYW A;  2DCE A;  2ME0 A;  3RYR A;  3HYI A;  5IP6 A;  2WAQ N;  1UJ8 A;  1UZC A;  4XLC A;  3FK6 A;  5B5E C;  1AWC A;  2ZJP F;  2CUE A;  3BQZ A;  2XKO A;  4RB2 C;  3B73 A;  1TP4 A;  3E7L A;  1LDJ A;  3VSK A;  1FOW A;  3PUF A;  4RAG A;  5FKL A;  3K4C A;  3FDY A;  3OR2 C;  3BR6 A;  4BDZ A;  2HQR A;  4JX5 A;  3VB2 A;  2EFO A;  4MEY F;  4AM3 A;  2EK5 A;  3CC7 I;  5M5X J;  4BNC A;  4EM1 A;  4LFU A;  3JSO A;  1ZGW A;  4B8X A;  4XRS A;  2DA6 A;  4XRF A;  5ILS A;  4MO7 A;  3QYE A;  2PJR B;  1OCC H;  1R4M B;  1ZG3 A;  2EFP A;  4V19 K;  2BV6 A;  3OS1 A;  2RC4 A;  1VQ8 I;  1W5S A;  3FMQ A;  2ZNZ A;  3OYH A;  1DQU A;  3GUD A;  2V6C A;  1Q1V A;  2F2E A;  3GTJ J;  3D0S A;  2LTP A;  3UNG C;  4CYD A;  2IA0 A;  5J40 A;  5K7F A;  1WJD A;  3VYR B;  3JRD A;  4E7K A;  2DA2 A;  1FIP A;  4OMZ A;  2BY1 A;  2Q8K A;  3KE2 A;  2P7C B;  2M8E A;  2C6Y A;  1P7I A;  1D3Y A;  4AIK A;  1ZEL A;  2QA4 I;  4IPA A;  5FRM A;  4ASN A;  1Z3Y A;  3DPU A;  3W2V A;  4MTE A;  2HTJ A;  2QGU A;  1MZB A;  1BOB A;  4E7I A;  1TWG J;  2LF7 A;  2NRA C;  3LST A;  4BXF A;  5HNF A;  4CYC A;  1H89 C;  1ACI A;  3H0G J;  1OQY A;  3TOB A;  4A3G J;  4CCM A;  1IF1 A;  3KZZ A;  4UUV A;  2HU9 A;  3C2G A;  1M1E B;  3TED A;  2QYO A;  4I02 A;  5B1B H;  1U9O A;  1UEL B;  3RKW A;  1J59 A;  1BC7 C;  1W36 D;  3KIO A;  3CES A;  1ETY A;  1WJC A;  1T56 A;  4GXO A;  3TP0 A;  3I3L A;  4BBR J;  3HOS A;  1FZP B;  2FMY A;  3AG2 H;  4Q4Z F;  3L2W A;  2K27 A;  3G1O A;  3FHZ A;  1R4N B;  4XKB A;  4OAY A;  2I5U A;  1E0E A;  2H6C A;  2W48 A;  2NOG A;  4ZJZ A;  3H3V K;  1EJ9 A;  4CZC A;  5FD6 A;  1K78 B;  3QP6 A;  1WZ2 A;  1VTN C;  3A0B C;  1S5L C;  5GAE J;  2MSY A;  2DMP A;  4EGZ A;  3KYC B;  2CQK A;  5ICC A;  3IRR A;  3Q9S A;  1X3U A;  1ON1 A;  1VND A;  2EA2 A;  4UVC A;  3PO2 J;  1QNT A;  1HW5 A;  4PK4 A;  4M72 A;  3OIP A;  2M7B A;  2JA7 J;  3ABK H;  4ENN A;  2HQ5 A;  1KU2 A;  3JAM K;  2GXA A;  3KP2 A;  5DTD A;  4E4H A;  3I53 A;  3E6D A;  2OD5 A;  5L3B A;  2V1X A;  3ZMD A;  1J2X A;  3IAS 2;  2W4S A;  5GTH C;  2FNA A;  4ZZL A;  2HDD A;  1Y8Q B;  2R3S A;  1BI3 A;  3G71 I;  2O6G E;  4C3J J;  5IY5 H;  2KL4 A;  1SEU A;  4NC6 A;  4M6Y A;  1ZAO A;  3MEX A;  3BDD A;  2CUJ A;  2ZME A;  2VKD A;  1ZLJ A;  2F5V A;  1S7E A;  2VN2 A;  4LLN A;  3S2D J;  4YG2 F;  2L7M P;  1ETW A;  5LRR A;  5K5R A;  2V7F A;  1JKQ C;  3WE3 A;  2QBY B;  2XRO A;  4M9X A;  1XGM A;  1TWA J;  2GOX B;  1PJR A;  2LSO A;  4PZJ A;  3HUG B;  3TDZ C;  2JSP A;  4LG0 A;  4C3I J;  5E1W A;  4ZYA A;  2RV8 A;  2Z16 A;  1SMT A;  2OUM A;  1FP2 A;  1YS6 A;  3FXM A;  2M0M A;  1VQP I;  1ZYR F;  3LAJ A;  2LR8 A;  1O3S A;  1JT0 A;  5KAF C;  1HOM A;  2QSF X;  4W1U A;  2JSC A;  3C18 A;  4FTH A;  1WJF A;  1LVA A;  4HG2 A;  2E5Z A;  3ZPL A;  3ZN1 A;  4UV9 A;  5EEG A;  3EUH A;  4D0P A;  4LK1 F;  3EQL F;  1P4W A;  1MH3 A;  1VQN I;  2R7R A;  2GOM A;  1WFX A;  1QBJ A;  1GXP A;  3VWB A;  1D8K A;  2VKV A;  1TWF J;  2CO5 A;  1VQK I;  1R7J A;  3V7R A;  4D7N A;  1R36 A;  4IX7 A;  3GTG J;  1Y39 A;  4ZDP A;  2G9W A;  3DPT A;  2E1N A;  3TMO A;  3B6C A;  4CDG A;  2DA5 A;  4FAS D;  2NVY J;  3ZR8 X;  3SDB A;  2Y9Y A;  3RCO A;  1QA6 A;  3OIO A;  3BCA A;  3DPL C;  4KA4 A;  1A6I A;  1IN8 A;  3SHF A;  1U6G A;  2UXN A;  1ZRC A;  2F6C A;  1OMI A;  3DEW A;  3VYU B;  3H3Z A;  4QLC U;  1U78 A;  1F9N A;  1QO0 D;  4Y17 A;  3RPQ A;  3VOE A;  2FEZ A;  2MGQ A;  2DT7 B;  3E5Q A;  4ON0 A;  3E1S A;  3FXL A;  4AU7 A;  2PFB A;  2LRE A;  3V8J A;  2ELH A;  2XB0 X;  2YX4 A;  2XAG A;  5HLG A;  4AVP A;  3L09 A;  3FF5 A;  2CUF A;  3K1N A;  3QPH A;  1MIJ A;  4AYB A;  3JTG A;  1R71 A;  3CQZ J;  2B63 J;  5F1R A;  3A4C A;  3H3U A;  3IKV A;  1GV5 A;  3J7A O;  5LHH A;  4P1W A;  1V4R A;  1VQ6 I;  3M7G A;  3SJM A;  4KJZ A;  1MH4 A;  3BWG A;  3FIW A;  2HNH A;  3GX4 X;  4HST A;  4UNO A;  1P2F A;  2E71 A;  3BR1 A;  2OTL I;  2IS1 A;  2Y0M A;  2ZJR F;  4BXU A;  1KQ0 A;  2X6O A;  4XL9 A;  2QBY A;  2M87 A;  1KA8 A;  3K0L A;  1B4A A;  1I50 J;  2WY7 Q;  3GWZ A;  5D6E A;  4LB5 A;  2FXA A;  2R7U A;  3HOY J;  4IL6 C;  3ZRG A;  2LH9 A;  1A31 A;  3CUQ C;  2HXI A;  2Q2E B;  1X1P A;  2AXL A;  3I5U A;  3SDG A;  3IKT A;  4XLN F;  3KFW X;  1D1C A;  2FBH A;  2LF8 A;  2ZFU A;  3CJT B;  3NRV A;  3PFY A;  3WTX C;  4A5M A;  1OFC X;  2CS3 A;  3OYG A;  4X1E A;  3P9I A;  1ODD A;  3TDU C;  3CCM I;  5HOO A;  3N05 A;  1FX7 A;  2HZT A;  2B7E A;  4BU2 A;  3F23 A;  3K4B A;  1FYM A;  2PX9 A;  4BHB A;  2V1U A;  3W6K B;  5LEJ A;  3KP6 A;  4U88 A;  2L9R A;  4RLF A;  2XDV A;  3R0J A;  4PFO A;  1HLV A;  3DKX A;  2VQG A;  3WHC A;  5ICG A;  3AG3 H;  3EYI A;  1UFM A;  3KLO A;  1BBY A;  5JHF A;  2QCO A;  5FKO A;  2DFH A;  4LIU A;  2EIK H;  1K7A A;  2A5Y B;  4BQO A;  3KX2 A;  4AD9 A;  4CHU A;  2E2I J;  1XTA A;  2JPC A;  2FE3 A;  3D1N I;  1YRN A;  2AQF A;  5HS7 A;  4ZYG A;  2M34 A;  4XID A;  3I4P A;  3FK7 A;  2Z33 A;  1PP8 F;  2R7F A;  1WKM A;  5F64 A;  2KIU A;  2FOW A;  1DDN A;  4KDP A;  2ELK A;  2HKX A;  2OPT A;  1V55 H;  2H6B A;  4NBQ A;  4R1H A;  1OYY A;  1X3W B;  3CCU I;  5FLV A;  2MYS A;  2YS9 A;  2BVM A;  2LC2 A;  3CCY A;  3K1M A;  5LGU A;  4B47 A;  4BHC A;  2CFX A;  2VXD A;  3CCL I;  3N4M A;  2L9V A;  4I98 B;  4EJT A;  4U0W A;  3OV8 A;  5IYC J;  4FET A;  1ZAR A;  2ACJ A;  4KNY A;  3PNV A;  4ESB A;  1IXC A;  4ENM A;  1KU3 A;  2KFD A;  4YEL A;  4PJL A;  2E1M C;  3K6G A;  3K4L A;  4PCQ A;  3FKJ A;  1FNN A;  1WRJ A;  1WCM J;  5KCM A;  5TGT A;  3G3Z A;  2FF4 A;  2WAQ A;  2WA0 A;  1GT0 C;  4A3C J;  3LOC A;  2DLL A;  3VYS B;  3ZOB A;  4DJA A;  2V6E A;  2KMU A;  4WF2 A;  1FMV A;  1O57 A;  4XKW A;  3ZQH A;  2VON A;  1ZRE A;  4A3L J;  1BM9 A;  1GVJ A;  2N8G A;  1SFU A;  4KUM A;  1LE8 A;  2R5Y B;  1UHS A;  3QP5 A;  4EJO A;  4RB1 A;  5E20 A;  4YFX F;  1TBX A;  3G6E I;  3OWT A;  4D9J A;  4EQQ A;  1JUM A;  2DT6 A;  2EFQ A;  3MFK A;  4WK8 F;  2MC4 A;  1IW7 F;  2QSH X;  1W7P A;  2RGV A;  4JOM A;  2DFI A;  3IV5 A;  3E6B A;  4KFC A;  4MFD A;  5JLW A;  3BC8 A;  4BS9 A;  1TTY A;  1OR7 A;  1D1A A;  5DYM A;  4UHT A;  2EIJ H;  4UVA A;  1BIA A;  2YSR A;  2PG4 A;  2DA1 A;  2P8T A;  2V9V A;  3DBL B;  4X0G A;  2LBF B;  3KZY A;  3WU1 B;  2CQN A;  4H0E A;  1FTT A;  3ERM A;  2L7F P;  1ON2 A;  1GXQ A;  3I59 A;  3FIS A;  5FGM A;  2QQ8 A;  2CUZ A;  3K4J A;  4CO8 A;  2XGE A;  4CCK A;  2VL8 A;  2WAF A;  2QQA A;  4M71 A;  3F72 A;  4YII A;  1P4X A;  2COM A;  2EQR A;  3LSK A;  2V79 A;  2OQR A;  4BQA A;  2L01 A;  4A0X A;  3HRS A;  3KEO A;  3TGN A;  2IXS A;  5H6R A;  3RTR A;  3FXK A;  1JKP C;  1XPX A;  5BMZ A;  3HRU A;  1AA7 A;  4S04 A;  3H1C A;  3JRI A;  4V2F A;  5HOD A;  4M73 A;  2DXI A;  2JA5 J;  1K6Y A;  3ZQC A;  3AL0 C;  2E2J J;  3WG9 A;  3M8E A;  1A04 A;  5DD4 A;  4LD5 A;  1MMS A;  1HXD A;  3S14 J;  3IC7 A;  1JHF A;  2CG4 A;  2CFO A;  4DBQ A;  5FFX A;  1WHU A;  3K2Z A;  2QQ9 A;  1XGO A;  3H9J A;  5EG0 A;  1GLN A;  1ZKG A;  2EB7 A;  3RQ4 A;  5HDG A;  3E5U A;  3ROU A;  3RJP A;  4BUP A;  5J4V A;  5K7H A;  2P5L C;  3LQQ A;  5BQT A;  2OQG A;  2BY3 A;  1S3J A;  4HNT A;  2M1B A;  1H9G A;  3F6O A;  1BR4 A;  2VQC A;  2DBB A;  4FE4 A;  5CVR A;  2PMU A;  1ITY A;  4PSW A;  5B3S H;  4QPO A;  3OYM A;  1YTY A;  2EFW A;  2HFH A;  2DFF A;  1WJB A;  1YJ9 I;  4L9V A;  2L4A A;  4JX6 A;  5DUK A;  3PJR A;  3A1Y A;  2QLZ A;  4AYB N;  3MAJ A;  1KQ9 A;  1TLH B;  2AXT C;  3OIQ A;  2DO7 A;  4AWX B;  2HS5 A;  2BXY A;  4MQ9 F;  3OYC A;  1MMG A;  2TCT A;  1IJW C;  3PL8 A;  1T08 B;  1S8N A;  5KVR A;  1LB2 A;  2ECC A;  2M3A A;  3S1Q J;  1RNL A;  4N0B A;  3IAM 2;  4UB6 C;  4CIC A;  1R6R A;  5K5O A;  3WHB A;  2ADU A;  1HST A;  1J7K A;  4HQE A;  4CUG A;  1EH7 A;  3FBI B;  3QQA A;  4B48 A;  1MDM A;  1IV6 A;  2DA3 A;  4BEH A;  1MND A;  1KU9 A;  2IT0 A;  2JA2 A;  4RM2 A;  3H9Q A;  3MZH A;  1YW8 A;  3QOD A;  3DBR B;  3G1M A;  3S32 A;  2Y75 A;  5ICF A;  1B8I A;  5L3C A;  4WWC A;  1BW6 A;  2QF7 A;  3RPU A;  1OPC A;  2BEO A;  2NVU B;  4I6Z A;  4HF2 A;  3K7A J;  2DW4 A;  2ZXI A;  5F0C A;  2LRD A;  2KLO A;  1T33 A;  3GME A;  2MH2 A;  1YE9 A;  2ESH A;  2QZ8 A;  2VJ4 A;  2HVR A;  3HL2 A;  1XCB A;  3JRC A;  2E7W A;  1EKE A;  1FT9 A;  1TW3 A;  1HW2 A;  5JVT A;  1MNE A;  2FJ1 A;  3K4K A;  4BJ5 C;  2HTS A;  3LA2 A;  1ORK A;  2DN0 A;  4JQF A;  1SFE A;  3QPS A;  4UUS A;  3W2A A;  2Z2S B;  5F6F A;  3ABT A;  5LFA A;  4X6A J;  3BJO A;  3VPR A;  4OIR F;  3LSH A;  3LWF A;  4LLG F;  3BR0 A;  4EM2 A;  2P4W A;  1AKH B;  2KKO A;  4J00 A;  3WOD F;  4IRI A;  1MMA A;  3H9G A;  1RUN A;  4BBS J;  4AID A;  3OYI A;  2GA1 A;  1NK2 P;  4ESJ A;  3RIR A;  2R7W A;  4E7Z A;  3HDD A;  1MBE A;  4QWQ A;  3BP8 A;  4HF1 A;  1W7P D;  1FPQ A;  2EZI A;  3TP3 A;  3MQ0 A;  3HKZ N;  3I71 A;  4F3Q A;  2XAU A;  1S9H A;  2XPV A;  4CYC B;  2P6T A;  3R4K A;  4LIT A;  5F0F A;  3A01 A;  1BI2 A;  4FQG A;  1T38 A;  1WI3 A;  3MKL A;  3BJ6 A;  1PYV A;  2FA5 A;  1JJ8 C;  2EH3 A;  1SC7 A;  2XKP A;  3CCS I;  4EV0 A;  2MFZ A;  3U9G A;  3PIP F;  1XN7 A;  2VC1 A;  1K4S A;  1R00 A;  2XB5 A;  3LFU A;  3RYP A;  4P9U A;  1RPW A;  1TQP A;  1F36 A;  5C44 J;  5D8L B;  2M30 A;  4OIP F;  5K5Q A;  1VZ0 A;  3GEZ A;  2ZFW A;  1YFH A;  5ICE A;  2AHQ A;  4MNU A;  9ANT A;  2A6H F;  4WXC A;  3FKI J;  2PN6 A;  3TL4 X;  2MLG A;  3X2Q H;  3RZD J;  5J4Y A;  1FSE A;  4A6D A;  2JQ7 A;  5LGN A;  3DP7 A;  3QPL A;  3HZJ A;  1BOA A;  2K85 A;  3UR3 C;  1U8R A;  2K5C A;  1FP1 D;  4D7M A;  2VAS A;  2EV6 A;  1LFP A;  2OJE D;  4PJ0 C;  4UV8 A;  1QZY A;  4G7H F;  3CP2 A;  5FKK A;  4IO9 F;  1VI0 A;  4M3F A;  3JSP A;  3ML6 A;  2IP2 A;  5HNH A;  4ENK A;  1CF7 A;  2G0E A;  1MBG A;  3VYT B;  3RDI A;  2WTE A;  4EEF G;  1N75 A;  1HQC A;  3BZC A;  3JRH A;  2L02 A;  2QSG X;  1XSD A;  4IOA F;  4PFP A;  3OOU A;  1BI0 A;  3Q0U A;  2V1N A;  3NAR A;  5F1J A;  3M3Y J;  1FWZ A;  5FKN A;  3JR9 A;  4CH7 A;  1N25 A;  4XSZ F;  2IPQ X;  3OYE A;  2F5C A;  5ILV A;  4HA8 A;  1JJ6 C;  2K4B A;  4D5F A;  1E3H A;  2X4H A;  1AKH A;  2ZME B;  3DQV C;  4NB5 A;  2ZME C;  3ECH A;  3HHH A;  1K6O A;  1V5E A;  3ELK A;  4R8H A;  4C2M J;  3RSN A;  4ENJ A;  4V2G A;  3HOW J;  1SD7 A;  3FM5 A;  4RGS A;  3DV8 A;  4Q47 A;  3IH2 A;  4LG0 B;  2VUM J;  1GHC A;  2DA4 A;  1IGN A;  2Z9O A;  2L9N A;  4HZF A;  5FLX K;  3MWM A;  3H5N A;  2ELJ A;  4IVN A;  3JRF A;  4Z6Y A;  1CQT A;  4A6E A;  1SAX A;  2M5W A;  3J80 K;  2R7O A;  2ZB9 A;  2MC3 A;  4RGR A;  2LOO A;  1BI1 A;  2K9N A;  2O03 A;  2H27 A;  3PNT A;  1ZTR A;  5IYB J;  3FXO A;  4LLL A;  2QWW A;  1Z05 A;  1VQ9 I;  1AHD P;  3GLX A;  3S8P A;  3EUH C;  2VT2 A;  2MD0 A;  2HOT A;  4XOR A;  2DJN A;  1SVO A;  5DD8 A;  2XV4 S;  5JVG F;  2DOD A;  1B9M A;  2HVQ A;  4I01 A;  4CSW A;  3ZGK A;  2XGX A;  2XPU A;  2XAS A;  2YPR A;  3RPU D;  3U1D A;  2X1C A;  1W5C C;  4FCY A;  3HTS B;  3G4S I;  2K3F A;  1S7A A;  1NG7 A;  4HQM A;  4G7Z F;  2CV0 A;  5C4X J;  2D1H A;  1RET A;  3S3N A;  3BR3 A;  1QPI A;  2V26 A;  4KYW A;  4XQF A;  2BGC A;  2E60 A;  5B1A H;  1XCV A;  2H8W A;  2KIQ A;  1S7O A;  2P81 A;  3EET A;  2EZK A;  2ZSH B;  3KZI C;  2NXN B;  2OCC H;  2L7K A;  3QPT A;  1VQ4 I;  3HC7 A;  2R7V A;  2NYX A;  1JUP A;  1XG1 A;  4II3 A;  3LQR A;  3V7S A;  3J81 K;  4KIB A;  1FBU A;  2R5Z A;  1LEA A;  3LAP A;  1I39 A;  1G3T A;  3DXJ F;  5K1Y A;  2RVC A;  3AG1 H;  4B3X A;  4UUT A;  1Z3X A;  2P7V B;  1E2X A;  4OIQ F;  3DU6 A;  4J19 A;  3H92 A;  4G9Y A;  2EV5 A;  2E19 A;  3GW2 A;  1TT0 A;  5IP7 J;  3RI4 A;  3R61 A;  1A36 A;  4DQ2 A;  4AUX A;  3HGG A;  5GTI C;  1P92 A;  1ZG1 A;  5D5X B;  2W85 A;  1SD5 A;  3BTC A;  2XF6 A;  1DPU A;  2R7S A;  4IQJ A;  2LKX A;  3R6S A;  5IP9 J;  1FEX A;  5E3N A;  3AFH A;  2IRF G;  2WV1 A;  2OZ6 A;  2LMD A;  4A12 A;  3G1L A;  3HOV J;  4M3B A;  3GTK J;  2HQA A;  2HZD A;  1JE8 A;  4HX4 A;  3ECO A;  3TO7 A;  1PUE E;  4I2O A;  4E7S A;  2R7X A;  4PJN A;  4Y15 A;  3GTM J;  4YIR X;  4AVZ A;  2EBI A;  1Z21 A;  4RAF A;  5CYV A;  1D1B A;  2DK8 A;  4BHP A;  2LD5 A;  2OAZ A;  1YIJ I;  3CCQ I;  4Y7N J;  2PLY A;  5CJ9 A;  3IH3 A;  4M3D A;  2K4J A;  3VEP A;  4P5O A;  3KP7 A;  4A5N A;  3GVA A;  3HOZ J;  2P6S A;  1JUS A;  2JRT A;  3BRO A;  4II2 A;  2RDP A;  1G2H A;  2RAE A;  2OU2 A;  2HOS A;  2GXB A;  1FSH A;  5GPC A;  2LDU A;  2QEX I;  1IV8 A;  2DYR H;  2O0Y A;  4U7D A;  1K61 A;  3L9F A;  2VC0 A;  3OSG A;  2WV0 A;  1T0F C;  2JTV A;  4YIF A;  2IEK A;  3KYD B;  2R93 J;  3BLY A;  2CQX A;  1TQI A;  4G6T B;  2DT5 A;  1IN4 A;  2A6E F;  4M9Z A;  2HR3 A;  1KQ8 A;  1Z67 A;  2XGC A;  1BL0 A;  5E18 F;  1YRN B;  2L9S A;  1FY7 A;  1MBH A;  1Z7L A;  3WTU C;  4RBO A;  2X1E A;  2PQ8 A;  3GYH X;  3QYB A;  5HS8 A;  2W7N A;  2F5D A;  1F1Z A;  3ASO H;  4A93 J;  1IXR C;  2W1O A;  1BJA A;  3LSG A;  4DYC A;  5DM6 F;  1ZLK A;  2XPW A;  4Y4R A;  5D4R A;  2F5F A;  2DDA A;  2R7Z J;  2DYS H;  3N97 A;  5JI6 A;  1A5J A;  4GYI A;  2M8G X;  2XAH A;  4DZJ A;  2GM4 A;  3BZK A;  4NHJ A; 
#chains in the Genus database with same CATH homology
 1LE8 A;  2R5Y B;  2Y9Z A;  1UHS A;  5GP9 A;  1H8A C;  1Z77 A;  4C3H J;  2CRG A;  5IPA A;  2M2E A;  1MNM C;  1BA5 A;  1IC8 A;  4IHW A;  1JUM A;  1ZK8 A;  2L0K A;  1B72 A;  5JLX A;  3TW6 A;  1W0U A;  1ETV A;  1XC5 A;  3BR5 A;  3O8H A;  5J1U A;  1NK3 P;  3C2B A;  3IV5 A;  1OCT C;  3I4N J;  4MFD A;  5JLW A;  2ID6 A;  3ZQL A;  1WPK A;  1VFC A;  3GBG A;  3LSP A;  4IHV A;  5DS9 A;  1TWC J;  2PMZ N;  1UG2 A;  1OCP A;  1DU0 A;  2DA1 A;  1I3Q J;  2M0C A;  3HB9 A;  4W97 A;  1HDD C;  2DTZ A;  2FX0 A;  1RR7 A;  4MLO A;  3ZQF A;  3HGY A;  3JRB A;  1FTT A;  2AO9 A;  2IBD A;  2L7F P;  2K40 A;  4QSH A;  1Z0X A;  3FIS A;  1LE8 B;  5C3E J;  2YU9 J;  2E1O A;  2XGE A;  4A3B J;  3CMY A;  1JTX A;  1H88 C;  4IHY A;  2ECB A;  1LFB A;  2EQR A;  5M5W J;  1B72 B;  4IHX A;  5IYD J;  2EZH A;  1X2M A;  1IG7 A;  1QVT A;  1JKP C;  4DW6 A;  4Y52 J;  5IOZ A;  3LSR A;  1BJZ A;  3JRI A;  5EZH A;  2LFB A;  4V2F A;  3HM5 A;  5M3F J;  4ABZ A;  5HOD A;  1Y1V J;  2JA5 J;  3ZQC A;  2E2J J;  2ME0 A;  2XGD A;  5IP6 A;  1RKT A;  3S14 J;  2WAQ N;  1JKR C;  2LVS A;  5J1Y A;  2JJ7 A;  3FK6 A;  2CUE A;  3BQZ A;  5EG0 A;  3DCF A;  1ZKG A;  4NDL A;  1TC3 C;  3E7L A;  3TW7 A;  4BKX A;  2EZL A;  5K7H A;  5FKL A;  2Y31 A;  3BG3 A;  3BR6 A;  4FE4 A;  1ITY A;  1TWH J;  4JX5 A;  2VKE A;  5M5X J;  4JX6 A;  4FIS A;  1O4X A;  1ENH A;  1ZGW A;  4AYB N;  4A3M J;  4XRS A;  2DA6 A;  4MO7 A;  4RDU A;  2JK3 A;  2DMU A;  2TCT A;  2ID3 A;  1P7J A;  2COB A;  1IJW C;  2JWT A;  3S2H J;  2ECC A;  3S1Q J;  2FD5 A;  2KT0 A;  3JRE A;  1MBK A;  3ZQI A;  3WHB A;  1MBJ A;  1Q1V A;  3GTJ J;  2WB1 N;  2LTP A;  3QQA A;  4QIW N;  5K7F A;  5EEA A;  1IV6 A;  3HOX J;  2L7Z A;  2DA3 A;  5F27 A;  5EG0 B;  2E2H J;  3JRD A;  3S15 J;  2DA2 A;  2JN6 A;  3GTO J;  4M6V A;  1FIP A;  5EGO A;  2DA7 A;  4B3A A;  1P7I A;  2O9L A;  3G1M A;  1B8I A;  1BW6 A;  2QF7 A;  2DMN A;  4FE7 A;  1TWG J;  4I6Z A;  3K7A J;  5F0C A;  1H89 C;  4CYC A;  3H0G J;  1T33 A;  2H1K A;  1AU7 A;  3ZQG A;  4A3G J;  3JRC A;  2DMT A;  3TED A;  1GVD A;  2FJ1 A;  1U9O A;  1ORK A;  2DN0 A;  1IRZ A;  4HNV A;  3QPS A;  4UUS A;  1ETY A;  2XSD C;  3JRG A;  1T56 A;  2HOA A;  1JKO C;  4X6A J;  3VPR A;  3TP0 A;  4BBR J;  3BR0 A;  1AKH B;  3G1O A;  5EGO B;  4BBS J;  1NK2 P;  3RZO J;  4JX4 A;  1JTY A;  2W48 A;  2NOG A;  1B8I B;  3H3V K;  3HDD A;  1MBE A;  2DMQ A;  4M3G A;  4JP0 A;  3BR2 A;  1PUF A;  4B4C A;  4A3F J;  2EZI A;  2YUS A;  3TP3 A;  3S17 J;  4D5C A;  3HKZ N;  3Q3S A;  2XPV A;  2MSY A;  2DMP A;  5F0F A;  4CYC B;  3A01 A;  1WI3 A;  1NTC A;  3MKL A;  1VND A;  3PO2 J;  1JJ8 C;  2M9H A;  2LP0 A;  4MFE A;  2JA7 J;  2EH3 A;  2NS7 A;  2Y2Z A;  2HQ5 A;  1ZR4 A;  5J1R A;  2XB5 A;  5DTD A;  2XRL A;  2OF7 A;  1RPW A;  4UUS B;  1F36 A;  5C44 J;  3RKQ A;  3LSJ A;  3PO3 J;  3IH4 A;  2K9S A;  4BY1 J;  2HDD A;  2AHQ A;  2JA8 J;  9ANT A;  4XK4 A;  4JYK A;  3FKI J;  4C3J J;  1ETQ A;  3JRA A;  3RZD J;  5BNG A;  3I4M J;  5M5Y J;  3QPL A;  1EF4 A;  4I76 A;  1S7E A;  3S2D J;  4D7M A;  2L7M P;  1ETW A;  4XRM A;  5F0H A;  5IOY A;  5C4J J;  4A3J J;  1PUF B;  2JA6 J;  2X9D A;  2CJJ A;  1JKQ C;  4GFB A;  3SFI A;  1GDT A;  1TWA J;  1HDP A;  5FKK A;  1VI0 A;  4M3F A;  3L1P A;  3A01 B;  4C3I J;  3CDL A;  1LFU P;  5FJ8 J;  2G0E A;  1MBG A;  5E3L A;  5M3M J;  1JGG A;  1IDZ A;  2LR8 A;  4EEF G;  1JT0 A;  2CQQ A;  5E3M A;  1HOM A;  3NAU A;  1FIA A;  4W1U A;  3JRH A;  5EZG A;  1D5Y A;  1MBF A;  2ME6 A;  1APL C;  3OOU A;  4FTH A;  3A02 A;  2TRT A;  1Y1W J;  3Q0U A;  3NAR A;  5F1J A;  3M3Y J;  4IEJ A;  2HYJ A;  3Q0V A;  1MH3 A;  4LOC A;  5FKN A;  3JR9 A;  2MW8 A;  2NS8 A;  4DZJ A;  2NVX J;  2H8R A;  4DYR A;  2VKV A;  1TWF J;  3K2A A;  1JJ6 C;  1SAN A;  2LK2 A;  4D5F A;  4D7N A;  1SFO J;  1AKH A;  3GTG J;  3BQY A;  2I10 A;  1I6H J;  3B6C A;  2DA5 A;  4C2M J;  2NVY J;  4DZP A;  4V2G A;  3HOW J;  1IDY A;  2Y9Y A;  2Y0S N;  3OIO A;  3IH2 A;  2VUM J;  1GUU A;  1W0T A;  1A6I A;  2DA4 A;  1IGN A;  5K7Z A;  1CQT A;  3JRF A;  1RES A;  3DEW A;  4XIC A;  4A69 C;  5F04 A;  1VF9 A;  1MSF C;  3W6V A;  1U78 A;  2NVQ J;  2ZB9 A;  1X2N A;  4A3E J;  2K9N A;  2MGQ A;  2Y30 A;  2GBY A;  3GTL J;  2R0Q C;  1ZTR A;  5IYB J;  1U8B A;  2HXO A;  2NVT J;  1AHD P;  2XB0 X;  5J3L A;  3S1R J;  3S1M J;  1RKW A;  2HOT A;  2DJN A;  1HCR A;  2CUF A;  4BY7 J;  3BTJ A;  3GTQ J;  3CQZ J;  2B63 J;  1F43 A;  3F0C A;  3B6A A;  1X58 A;  1GV5 A;  2XPU A;  1POG A;  3SJM A;  1HF0 A;  1MH4 A;  3FIW A;  3OSF A;  1JT6 A;  4FCY A;  4G12 A;  3HEF A;  5C4X J;  3UKG A;  3BR1 A;  1RET A;  3BR3 A;  1GV2 A;  1QPI A;  2KDZ A;  2X6O A;  1WH7 A;  3BG5 A;  5EYR A;  1I50 J;  3BTL A;  1R9T J;  3HBL A;  2P81 A;  3BG9 A;  2EZK A;  1ZQ3 P;  3HOY J;  4XRS G;  2HXI A;  2LY9 A;  1JUP A;  3SDG A;  1XG1 A;  3GTP J;  2D5V A;  5FLM J;  2X48 A;  3Q0W A;  1OFC X;  2FQ4 A;  3S1N J;  4X1E A;  2R5Z A;  4B1R A;  2VI6 A;  1DU6 A;  2K9Q A;  2GLO A;  3BT9 A;  3PM1 A;  4UUT A;  4DYQ A;  4J19 A;  2E19 A;  3MVP A;  4A3D J;  2MG4 A;  5IP7 J;  2HI3 A;  4AC0 A;  4AUX A;  3BTI A;  2L9R A;  3HGG A;  1ZR2 A;  5FKM A;  1HLV A;  3HOU J;  3WHC A;  3BTC A;  2LKX A;  5IP9 J;  1QRY A;  1FEX A;  2QCO A;  5FKO A;  5E3N A;  1ETO A;  2WV1 A;  3RQI A;  2E2I J;  3G1L A;  3D1N I;  4A3I J;  1YRN A;  3HOV J;  4M3B A;  3GTK J;  1FJL A;  2M34 A;  3MN2 A;  4XID A;  1ETX A;  3FK7 A;  5EF6 A;  5F08 A;  3A03 A;  2O7O A;  5EDN A;  3GTM J;  1U9N A;  1QVU A;  2EBI A;  2JMW A;  2LD5 A;  4Y7N J;  3IH3 A;  1UMQ A;  2ELK A;  2OPT A;  4M3D A;  2R5Z B;  2R92 J;  5FLV A;  2R5Y A;  2YS9 A;  3HOZ J;  1JUS A;  1E3O C;  1G2H A;  3CCY A;  2RAE A;  2O8K A;  2HOS A;  3LNQ A;  5GPC A;  5GPA A;  1FTZ A;  2VPR A;  5IYC J;  1K61 A;  3OSG A;  1OJL A;  2IEK A;  4A3K J;  2R93 J;  1WH5 A;  3O8G A;  1XS9 A;  2CQX A;  2IAI A;  1MSE C;  3M4O J;  1K83 J;  4M3E A;  2CU7 A;  2XGC A;  4QTR A;  1BL0 A;  4S0H B;  1YRN B;  1WCM J;  1MBH A;  4RBO A;  1IUF A;  2LLK A;  4L5E A;  4A93 J;  5E3O A;  4MIM A;  1ETK A;  1GT0 C;  3LOC A;  4A3C J;  3LSG A;  4DYC A;  2XPW A;  3ZOB A;  1BW5 A;  2R7Z J;  1A5J A;  3ZQH A;  4A3L J;  2M8G X;  1WGX A;  4BXX J;  2N8G A;  2GM4 A;  3S16 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...