4S0HB

Tbx5 db, nkx2.5 hd, anf dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-box transcription factor TBX5
publication title Intermolecular Interactions of Cardiac Transcription Factors NKX2.5 and TBX5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 19
structure length 53
sequence length 53
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4s0hB00
4W1UA 4JX6A 4A3LJ 4G12A 1B8IA 1K83J 2EZLA 1JT0A 3FK6A 2R5ZB 2VUMJ 1ZTRA 1GUUA 3GTGJ 4UUSB 1G2HA 1JTXA 2DA3A 1ETQA 2CRGA 1BW5A 3HDDA 3Q0WA 1MSFC 3BR6A 1A5JA 4M3FA 3TEDA 2OF7A 1MBFA 3JRGA 2HDDA 2XGDA 1NTCA 2HOAA 3GTJJ 2DMUA 3A02A 2K40A 3PM1A 5IP9J 5EG0B 5EZHA 1OCTC 1IDZA 4A3MJ 1MBKA 2X9DA 4BY7J 2K9SA 1RETA 3JRCA 1WH5A 4W97A 1JT6A 2NVTJ 5E3OA 3F0CA 5IYBJ 3H0GJ 3BTCA 3A03A 5EGOA 2VKEA 3RZDJ 2XPUA 1RPWA 2IBDA 4Y52J 3ZQGA 2JN6A 3JRDA 2R92J 2DTZA 1TC3C 4BXXJ 3GTLJ 1RKTA 3QQAA 2LD5A 4A93J 1GT0C 1OJLA 2XPVA 4IHVA 2DMTA 1ETYA 2P81A 2LTPA 2MW8A 2O8KA 3LSRA 1ETOA 4I76A 4X6AJ 3HEFA 3QPSA 4A3BJ 2LFBA 3IV5A 3HOWJ 1OCPA 1HOMA 3ZQHA 4MLOA 4AYBN 1JUSA 3JRHA 4D5FA 4HNVA 3BR1A 1WPKA 4XRSG 2H8RA 1FTZA 2CJJA 5K7ZA 1AKHB 1Z0XA 1F36A 4A3CJ 2QF7A 5IP6A 2XGEA 2TCTA 2XPWA 4QTRA 1Y1WJ 1BJZA 4M3BA 4EEFG 2EH3A 3CMYA 5E3LA 1VI0A 5FKNA 4DYQA 3MVPA 4D7MA 2Y9ZA 5IYCJ 2LP0A 5JLXA 5FJ8J 1ETXA 3BR2A 2DA4A 2R5YB 1F43A 2WV1A 2NVQJ 1JKRC 5M3FJ 1IDYA 1NK3P 3TW7A 2R5ZA 3BR3A 1NK2P 3BG3A 4UUSA 3S2HJ 5EDNA 4JYKA 3S1RJ 3FISA 2MSYA 4LOCA 1X58A 4FE4A 2FX0A 1U9NA 2XB5A 4DZPA 2DMQA 3IH3A 5GPCA 3NAUA 1X2MA 1T33A 4MO7A 4D5CA 3BR0A 2GM4A 3D1NI 1ORKA 4A3FJ 1T56A 2DA1A 1IJWC 3OSFA 1ZQ3P 2E19A 1XS9A 4B3AA 1MBEA 2JA8J 2DMNA 2NVYJ 2EZIA 5IP7J 1AU7A 2B63J 2GLOA 1FJLA 1FIPA 9ANTA 1EF4A 5C3EJ 1W0UA 3IH4A 2CU7A 3OOUA 4M3DA 1QVUA 5F04A 4BBRJ 1FIAA 3NARA 2PMZN 3PO2J 2EZKA 1WI3A 3BT9A 3GTPJ 4IHWA 4AC0A 3A01B 1APLC 3S2DJ 1ETWA 4JP0A 4L5EA 5IPAA 2O9LA 4MFEA 4BKXA 4QSHA 2NOGA 2L7FP 2HOTA 3QPLA 1UMQA 3HOZJ 1HLVA 3GTQJ 2EQRA 3O8GA 3B6CA 3E7LA 3WHCA 2FJ1A 1JKQC 4A3KJ 1W0TA 4DW6A 2M0CA 5F1JA 1JKOC 1TWGJ 5K7HA 2DJNA 1IGNA 4CYCB 3BQYA 1HF0A 3OIOA 2L7ZA 5K7FA 1GV5A 2ECBA 4XK4A 4I6ZA 1X2NA 2M2EA 5FLMJ 3Q0VA 1ETVA 1TWCJ 2K9NA 3BR5A 1AKHA 1MBGA 4V2FA 4RDUA 2ECCA 1ZR4A 3HOYJ 1JUPA 1WGXA 1U9OA 4JX4A 3C2BA 5J3LA 1VF9A 3JR9A 1HCRA 2R5YA 5GP9A 2XSDC 3GBGA 1YRNB 1IRZA 1Q1VA 4M3EA 5F08A 4XRSA 1TWAJ 1XG1A 2CQXA 2DMPA 4V2GA 2O7OA 2AO9A 1RKWA 2FD5A 5C44J 1BA5A 3K2AA 2R0QC 5BNGA 3G1MA 3HKZN 3BTIA 1D5YA 1IG7A 2KDZA 2M9HA 1IUFA 4FTHA 3W6VA 3GTKJ 2OPTA 1AHDP 2VKVA 3IH2A 3HOXJ 3CCYA 1P7JA 2HQ5A 3OSGA 1JGGA 3Q3SA 4A3GJ 3MN2A 4C3JJ 1HDPA 1ENHA 5EYRA 1TWFJ 3ZOBA 2ME0A 3FK7A 4BY1J 3LSPA 3ZQLA 2R7ZJ 5E3NA 1BW6A 4M3GA 2ZB9A 2IEKA 1SANA 1VFCA 1MNMC 3DCFA 3DEWA 3LNQA 2DA7A 3TP0A 3HOUJ 2QCOA 2H1KA 2M8GX 3SDGA 4C2MJ 4A3IJ 3ZQFA 3PO3J 1VNDA 2G0EA 3A01A 1MSEC 2E1OA 3SFIA 2LVSA 1FTTA 3LSJA 3S17J 3BTJA 5FKKA 4MIMA 5GPAA 3TP3A 5JLWA 1MBHA 2LKXA 1ZR2A 2JA6J 3G1LA 3L1PA 2X6OA 2YS9A 1H88C 4IHXA 4DYCA 1DU0A 4M6VA 1K61A 3CQZJ 4ABZA 1POGA 4A69C 2D5VA 1LE8B 2NS8A 5M5YJ 3MKLA 5FKLA 2XB0X 5EEAA 1GV2A 2NS7A 4CYCA 2CUEA 3K7AJ 1DU6A 3B6AA 2NVXJ 4DYRA 2XRLA 3G1OA 3RKQA 3LOCA 3HBLA 2R93J 1BL0A 2AHQA 2Y9YA 4UUTA 2KT0A 4QIWN 3S15J 1I6HJ 1QPIA 4FCYA 3HGGA 4B1RA 5IYDJ 1JJ6C 2HI3A 2TRTA 1PUFB 1YRNA 1I50J 5FKMA 3HB9A 2ID6A 3I4NJ 2LLKA 2E2HJ 2K9QA 1RESA 2MGQA 4IEJA 2JK3A 1UG2A 3HM5A 2LR8A 2LY9A 3S14J 4RBOA 3M3YJ 3H3VK 1GVDA 4X1EA 1U78A 2MG4A 1SFOJ 1A6IA 3S16J 3ZQIA 2VI6A 3ZQCA 4A3DJ 1CQTA 2ME6A 2HOSA 2EZHA 5F0FA 3S1NJ 4FE7A 2DN0A 1JJ8C 1JTYA 2HXIA 2E2IJ 2Y2ZA 1B72B 3TW6A 2XGCA 5M3MJ 2YUSA 1TWHJ 5E3MA 3GTMJ 1GDTA 2ELKA 4JX5A 1ETKA 3VPRA 4NDLA 5J1RA 2RAEA 5M5XJ 2Y0SN 1B8IB 1OFCX 2Y30A 1ZK8A 1MBJA 3SJMA 4A3EJ 2L7MP 3LSGA 1ZKGA 1ITYA 1FEXA 2WB1N 3UKGA 2Y31A 5DS9A 1UHSA 4IHYA 2IAIA 2JA5J 1O4XA 4D7NA 5DTDA 2COBA 1R9TJ 4Y7NJ 5F27A 2ID3A 2L0KA 5J1YA 2DA6A 4A3JJ 2FQ4A 1H8AC 2E2JJ 1LE8A 3RQIA 3M4OJ 5EZGA 1I3QJ 2M34A 2I10A 3I4MJ 1E3OC 3RZOJ 3O8HA 5J1UA 4XIDA 3BG5A 1P7IA 2HXOA 4MFDA 3HGYA 5IOZA 3BTLA 5EGOB 2DA5A 2L9RA 1Z77A 4B4CA 2JWTA 1LFBA 1MH3A 1U8BA 5IOYA 5C4JJ 2CQQA 1PUFA 1LFUP 2N8GA 1H89C 2YU9J 4XRMA 1WCMJ 3BG9A 4S0HB 5C4XJ 3JREA 1IV6A 3JRBA 2DA2A 5F0HA 2HYJA 4GFBA 2JMWA 2LK2A 4AUXA 4XICA 3S1MJ 3FIWA 3Q0UA 4FISA 3BQZA 2JJ7A 1JKPC 1WH7A 2WAQN 3JRIA 4C3HJ 4DZJA 3JRAA 3HOVJ 1QVTA 1JUMA 1IC8A 2CUFA 3WHBA 5M5WJ 5HODA 2JA7J 4BBSJ 3FKIJ 5EF6A 1MH4A 5EG0A 4J19A 1HDDC 3CDLA 1ZGWA 2GBYA 1S7EA 3GTOJ 4C3IJ 3JRFA 1QRYA 5FLVA 2VPRA 1RR7A 1B72A 5F0CA 2W48A 1Y1VJ 3S1QJ 1XC5A 2X48A 5FKOA 2EBIA
chains in the Genus database with same CATH superfamily
3HXLA 5F64A 4W1UA 2DDAA 4JX6A 4XRFA 2DPUA 2FMYA 2BY2A 4G12A 1YYVA 4IOCF 1B8IA 3U1DA 1R6RA 1ZTRA 3I64A 3OMYA 5E20A 2VUMJ 1YI2I 1G2HA 2BXYA 3KZZA 2DA3A 1ETQA 2VL8A 5HS7A 2CO5A 3TMOA 2DT5A 2M5WA 3AG2H 1WJCA 1MSFC 3LA2A 3TEDA 2OF7A 3ISPA 1XCBA 4TV7A 3K4LA 2ELHA 2M45A 2VE8A 4CUGA 4DBRA 1R1TA 2DMUA 3PM1A 1J5YA 2XAQA 5IP9J 5H2FC 3OYGA 1OCTC 1E3PA 1FT9A 4RB3C 3G4SI 3DP7A 3S2WA 5KAFC 1OR7C 3TOBA 3DPTA 1IXSB 1WH5A 4W97A 1S8NA 4JBAA 2NVTJ 3M8FA 4HF0A 4NQWA 1ERDA 3F8CA 1HQCA 3WTTC 3K70D 1KU3A 2NAZA 3H0GJ 3OYHA 1U5TC 5EGOA 2XPUA 1FSEA 1VQ4I 1MMAA 3OS2A 2RV8A 2XAGA 1LUJB 5JFRA 2E1MB 3OYMA 2F5FA 5ICEA 2DTZA 3S8PA 4BXXJ 3CF2A 4AIJA 2WAQA 4C30A 3F22A 4ASNA 4L9TA 4IRIA 4OIQF 5CVJA 4JOMA 2Z3YA 1YX5A 4LD5A 1BR4A 5H6QA 5FROA 3WU1B 2XAHA 4IHVA 1D1AA 3ABMH 3L2QA 2LTPA 1IN4A 3LSRA 4I76A 2HTSA 4X6AJ 3HEFA 3L7WA 2Z1DA 1FSHA 2M3AA 4EM2A 5HS9A 3F6OA 2QM3A 3Q5FA 3JRHA 2JSCA 1QNTA 4XLNF 4D5FA 1DPRA 1XGMA 2CJJA 3HSEA 1F36A 3FMRA 1T2KA 4A3CJ 2VASA 5KAIC 2XF7A 1XPXA 2M87A 2STTA 2Z99A 1Y1WJ 4IHSA 4EEFG 2BBYA 1SFKA 2CS3A 1FNNA 3ASOH 3ZQ7A 5E3LA 3KLOA 2FSWA 1OMIA 1YE9A 3LSKA 4A2UA 3BJ6A 2QBYB 1AA7A 3V7CA 3K4CA 2WA0A 3ZR8X 1XSDA 2QSHX 2E7XA 1LNWA 2IA0A 3BR3A 2DTRA 1G59A 3SZGA 3PQKA 4XKBA 2DT6A 1ACIA 4L5JA 4BQNA 4JYKA 3EUKL 3F8MA 3FISA 3B02A 5DUKA 3CCQI 2FX0A 2XB5A 4DZPA 3EUHA 3GW2A 1TTYA 2NS0A 3V7SA 2H27A 4PFPA 2E1CA 1WJBA 1T56A 1IJWC 1ZQ3P 3P9IA 1ONVA 1XS9A 5DCFA 1W36C 1MBEA 4WXHA 2JA8J 2NVYJ 2R7SA 4IZZA 1TW2A 1MZBA 3JCUC 1FIPA 3K1NA 2BW3B 2HR3A 2VOPA 5E18F 1XGOA 1KZHA 4MTEA 2M30A 3QPHA 2Z9OA 5F04A 3NARA 2PMZN 2IW5A 3PO2J 2OBPA 4IX7A 4U87A 3HRUA 3ELKA 4QWQA 3I3LA 2A5WA 2W00A 3CCUI 1WI3A 5IT9Z 3BT9A 5LGUA 1P4WA 4KUMA 3GVAA 4AC0A 3CJTB 3IWFA 3S2DJ 3GLLA 1FMVA 4ENMA 5KVRA 1V55H 1VTNC 3CD6I 4BKXA 2XIGA 1R49A 4AYBA 2NOGA 2KISA 2CFXA 4XKVA 1UMQA 2FOWA 1TLHB 1RNLA 3V42A 4HOBA 4ZDOA 4F92B 3B6CA 3E7LA 3FHNA 3CESA 1JKOC 3OYJA 5CQEA 1MJBA 5DD4A 5K7HA 1J7KA 2KL4A 3BQYA 3I4PA 5K7FA 1GV5A 2EV0A 4I6ZA 1X2NA 4CH7A 5FLMJ 3Q0VA 1TWCJ 1QHHD 3K1MA 3K69A 1USSA 1MBGA 2RC4A 4HQMA 5HNHA 3L9FA 1FP2A 3HOYJ 1WGXA 2MC4A 1WQ2A 4JX4A 4UVAA 1VQ5I 1JE8A 2QBYA 2XSDC 3TOAA 1B9NA 1YRNB 4M3EA 4HF1A 1YOVB 3RIRA 1TWAJ 2CQXA 5LEKA 3I55I 2VBYA 3KPHA 4EJOA 4C2TA 2FD5A 1BA5A 4AIHA 1BR2A 3G1MA 3CTAA 5B66C 3CF5F 3HKZN 5E1ZB 3CJRB 1VQ9I 2A3SA 2OPTA 5B1AH 5E8GA 1J75A 5EEHA 2HQ5A 3GEZA 4C3JJ 3D5RC 2HYFA 3DWLE 1HDPA 5EYRA 2UWMA 4PGHA 3DKWA 1R5GA 3FK7A 4B44A 4BY1J 3FXLA 2GXAA 4A0ZA 4Y33A 4L0ZB 1Y0NA 3FMSA 1OLTA 1WVRA 1BIBA 2KFDA 2BW3A 2LY2A 4GXOA 1ZREA 4XONA 5KHDA 1VFCA 4R1HA 1R00A 3QPTA 1VZ0A 4HA8A 2TDXA 1OYWA 2DQLA 2OCEA 4E7ZA 3OYAA 2X6XA 4C2MJ 5E17F 3ZQFA 1JXSA 3GXOA 1IRGA 1O3RA 4Z2YA 5GAHJ 4OMYA 2IRFG 1O7LA 2E1OA 2L9SA 2CG4A 2GQQA 3HUGB 1LDJA 4I7HA 3BTJA 2HFHA 1B1BA 2JA6J 3G1LA 4KITB 1QU3A 2Y69H 5CQGA 4M6VA 1E3HA 2OAZA 4ABZA 3K4BA 4E7KA 1N78A 3BJOA 2V1UA 1ZG5A 2QEXI 5LLQA 2KQRA 5FKLA 1VQ6I 5K5QA 1GV2A 5DDGA 4BYYA 3WG7H 2VQCA 3EPZA 1I1SA 2NVXJ 3H9GA 4DYRA 3D5LA 1QQIA 4ZJZA 1I3AA 2R93J 1S3JA 2AHQA 2DI3A 4UUTA 3RTRA 3W6KB 4RM3A 2KT0A 2GIVA 4QIWN 4YFNF 2ZNYA 4UVBA 1JJ6C 4CCKA 2FNPA 3DXJF 1D0XA 1YRNA 3ZN0A 4D0PA 1I50J 1BOAA 1KONA 2IPQX 2ID6A 3NWSA 1K78B 3M1CA 3FXQA 2K9QA 1HW2A 3MWMA 4DGWB 2JK3A 2ZXIA 1UG2A 3HM5A 4HSTA 1QBJA 4R8HA 3SXYA 4M71A 4XLEA 4LK1F 4RBOA 3M3YJ 4CDGA 1GVDA 3DEUA 2JVGA 5ICFA 3KP4A 2QKMB 5D6FA 1U78A 4A0YA 5BS6A 4F55A 4A3DJ 2XUBA 2Y48A 3MKYB 4OIPF 4I01A 3ZRGA 2GAUA 3RDIA 4RGXA 2VJJA 3JTGA 3S1NJ 5ERIA 2DN0A 3IC7A 3PNVA 1FPQA 2DYSH 1PDNC 5E3MA 1YJNI 1TNSA 3GTMJ 4JX5A 3U21A 2F5VA 2QWWA 1WFXA 2R7XA 3BROA 2LOOA 3SYTA 2DAOA 2IGNA 2A61A 2F5EA 4UB6C 2HDCA 2Y0MA 4LLNA 2DJIA 1I6XA 3OYLA 3PUBA 4L0YB 2BZTA 3CCVI 1EH6A 3CP8A 3E0JB 3HUGA 1ITYA 4LIUA 2Y31A 3K6GA 1UHSA 5DS9A 2DXIA 1KQ8A 2IAIA 2W1OA 1D0ZA 4D7NA 3CJQB 1W5CC 1QO0D 2LG4A 4I0BA 1ODDA 4L9NA 4Y7NJ 5F27A 2WTEA 2ID3A 2L0KA 3GCMA 3E97A 3KP7A 4A3JJ 1H8AC 1XMAA 2DBBA 3RQIA 3M4OJ 2V6EA 4AIKA 1PUEE 2GOMA 3K9TA 1I3QJ 2K27A 1T39A 2R3SA 4HV5A 2K4BA 3E5QA 3KZYA 3RZOJ 5D5XB 3I56I 1UAAA 2BE5F 2P6SA 4BL0B 3ZPLA 3HGYA 3L00A 3CUQB 4XBFA 1FBQA 3BTLA 2IP2A 3ECOA 2L9RA 1Z77A 2JWTA 1U8BA 1UJ8A 2N8GA 2YU9J 1O3QA 5C4XJ 1TNTA 2L4MA 3EYIA 1IV6A 1K78A 4GFBA 1XDUA 2JMWA 2LK2A 3E5UA 1IN8A 1Z91A 2P5VA 4O3MA 3R61A 3FXOA 3FIWA 4BQAA 4FISA 3CMMA 2PJRB 1JKPC 4LB5A 5K1YA 1WH7A 1T8IA 2WAQN 3GFMA 1E0EA 4I09A 3IRQA 2M1BA 5KNLA 1GHCA 3F3XA 1JUMA 4LGWA 2KIMA 3T8TA 1X1AA 3LSMA 5M5WJ 3L2UA 4KT5C 3NRVA 3FKIJ 4FASD 3N05A 4I02A 3CDHA 3CDLA 4ETSA 1ZGWA 4MTDA 2VKDA 3VYTB 2VPRA 3LQRA 1RR7A 4PJMA 5F0CA 2EFPA 3SHFA 2WB1A 2ISZA 1JI8A 2BY1A 1XC5A 2X48A 2O5RA 3ZXSA 2EFWA 2GXBA 2BYVE 3MFKA 4YIRX 2P7CB 1V3FA 2DDBA 3FM5A 4RAZA 3FXRA 4AWXB 3BWGA 3M8JA 3GZ5A 1TQIA 2GA1A 1EH8A 1KQ9A 2ZNZA 2OQRA 3S93A 1A5JA 1QZZA 2HKXA 3I0TA 1EA3A 4AIDA 4NBQA 3HZJA 3GTJJ 2IJLA 3A0BC 3ABTA 5EG0B 3CCEI 1MJAA 4ZTFA 1T0FA 2L54A 4BNCA 4A3MJ 2C6YA 1MBKA 2X9DA 3RKYA 2MABA 4KN7X 2K9SA 3PSFA 2QVOA 1OCCH 1V5GA 1HKTA 4JQFA 4RA2A 2VJ4A 1JT6A 1TP4A 5E3OA 4NUBA 1T38A 5IYBJ 3CUQA 4L18B 3A03A 4Y13A 4KNYA 1LB2A 3DQVC 2MD5A 3WE3A 3AL0C 2PX9A 3R6SA 2R92J 3EUAA 4S05A 1DUXC 3GMEA 5FRNA 1FOWA 1RKTA 3QQAA 2CH0A 3OYCA 2FBHA 2OQGA 1GT0C 5IT9K 3HHHA 1OJLA 2XPVA 1ETYA 3L2RA 4MEYF 2DQRA 2MW8A 2W57A 1ZAOA 2PJRA 2O8XA 3VDXA 3WGHA 2IXSA 4GO1A 5DUIA 1FYMA 2E35A 2FNAA 2W85A 4G7ZF 2V9VA 2UV1A 2VKHA 3HC7A 4YELA 1D0YA 3O2PE 4AYBN 1W7PD 2XF6A 3BR1A 4XRSG 2CV2A 2H8RA 2Z33A 2OZUA 5K7ZA 1SC7A 1C0WA 1SVOA 2JRMA 4EQQA 3PSIA 5IP6A 2XPWA 1FYLA 4XLAA 2EH3A 2HPIA 3CMYA 3KETA 5FKNA 3CC2I 2VODA 2LP0A 3PIOF 2G7HA 5JLXA 1ETXA 2WAFA 4ZDPA 2WV1A 3ZP5A 3WTZA 1MW7A 2CFOA 2L7KA 5FD6A 3DPLC 1NK3P 4OWRB 2LF7A 5DM7F 3S3OA 1I1GA 3CDIA 3ZMTA 3CO6C 3W6JB 3S2HJ 1FBSA 1X1DA 1TT5B 1USTA 3S1RJ 2MSYA 3I54A 4AVPA 2PI0A 1X58A 1U9NA 2GXGA 3CMAI 2DYRH 2D1VA 3S32A 5E1XA 4MO7A 4D5CA 2RNJA 5HVQC 2QKLB 1UB9A 2ZSHB 4ENJA 2OTJI 1WZ2A 3M7GA 2WWYA 1XMKA 1QZEA 1R5HA 5IP7J 1FJLA 2A6HF 1W0UA 1HSTA 3OOUA 4L9VA 1LJ9A 1FIAA 2MLGA 2G9WA 4JK1X 3PUFA 2P5KA 5HOOA 3VYRB 2CGPA 3R60A 4ESJA 3KYDB 4ZYAA 1I39A 2W24A 2WY8Q 4YIFA 2KIQA 1BC7C 4FT8A 1H9GA 1SFXA 2KKOA 5D8LB 4BHBA 5DM6F 3QP5A 4CSWA 4QSHA 3EYYA 3QWLA 1YG2A 3BZ6A 3ABLH 2ZJPF 2K3FA 3FMQA 2L7FP 1LVAA 1XDSA 2Q0OA 4LJZF 2O61A 4R79A 1X19A 3RYRA 5ICGA 3ZMVA 3F8FA 2B7EA 2GIZA 1XB4A 5D5UB 3BLYA 2BVMA 2X1CA 1IXRC 4DW6A 2M0CA 2MC3A 4Y15A 5F1JA 3UR3C 2KJBA 2DJNA 1TZLA 3QYBA 2OZ6A 1HF0A 3OIOA 1J59A 4OMZA 1P2FA 2ECBA 1FX7A 4EJVA 3BJAA 2F2EA 2QSFX 1ETVA 3BR5A 3BY6A 4HPQA 1WJFA 1KU7A 1YW7A 3DKYA 3J80Z 3A2KA 1DDNA 4LLGF 1UFMA 2JZYA 1VQ7I 5HDGA 2VBXA 5J3LA 2R7VA 1HCRA 1YFHA 5BPIA 3H0DA 4XRSA 1ZELA 4GCVA 1XG1A 4E7IA 4V2GA 2AQFA 1K4SA 2AO9A 2DFIA 1SEUA 1YW9A 4A6EA 3K2AA 3ESWB 5J4VA 1HXDA 1R23A 1IG7A 2KDZA 4GRIA 2VBWA 4YIIA 2QQ9A 3G3ZA 1T95A 2VKVA 2E34A 2EIKH 1R36A 4IXAA 1P7JA 1ZG1A 4BH9A 5ICCA 1ZN2A 1IO2A 3Q3SA 3OSGA 2V4JC 2CQNA 1EJ9A 1ENHA 1TWFJ 3D0SA 3IP4B 1RRJA 2OC6A 4DOZA 3ZOBA 2FF4A 4A12A 1PP8F 3WTSC 4BE0A 3LL7A 2VXZA 3ZQLA 2R7ZJ 5E3NA 3BPXA 2DFHA 3LWFA 4M3GA 2IS4A 2F4IA 2IEKA 4L5IA 4G7HF 3HOSA 3WTUC 4EJWA 1YS7A 1FY7A 2HS5A 3TP0A 4HF2A 5B1BH 1ZHFA 3HOUJ 2M7AA 2FQ3A 3LAPA 1YX3A 2PN6A 2HQRA 4NC7A 3V8KA 1VNDA 2BHYA 2G0EA 3D5SC 3P9KA 1YO5C 3OIPA 5L3FA 3HRTA 1FMWA 2WV0A 3SFIA 2RQPA 3K1PA 3SEZA 3W2VA 4PFOA 3LSJA 2ZJ2A 3S17J 3TDZC 5K5OA 3TP3A 1OCZH 1MBHA 4ZYGA 4H0EA 3DLLF 4IHXA 4DYCA 1S29A 3R0JA 1EKEA 1NHAA 4IO9F 4PJJA 3CQZJ 4RM2A 2EINH 4UV8A 4O5VA 1POGA 4XKCA 2IT0A 1LE8B 2RKHA 1R7JA 5M5YJ 2NOJB 4BXUA 5EEAA 2R7QA 1HW1A 1S7AA 5BMZA 4FETA 1DU6A 3SZTA 3M9AA 3B6AA 2ZC2A 4WXCA 3WG9A 4RGUA 4KFCA 2Q1ZB 2XRLA 3RKQA 1D1CA 3L09A 4BQQA 4F3QA 2V26A 3LMMA 3S15J 3DTEA 1WI9A 1I6HJ 3G2BA 1QPIA 2OU2A 2HKOA 4FCYA 3HGGA 4B1RA 5LHHA 3ONQA 3QYFA 2HI3A 1PUFB 2ZJQF 1FOYA 2WADA 3T0YA 1RZ4A 1BI0A 4CCLA 2X4HA 2ZSIB 5FKMA 4BDYA 1E17A 3DU5A 4IHTA 2JA2A 3OOPA 5GAEJ 5TRDA 1ZYRF 3Q9VA 1W7PB 1XX5A 2M4GA 1RESA 4XLPF 4G6DA 1H0MA 3C18A 2P7VB 5J4YA 4LIVA 4A0XA 3OV8A 3MKZA 4B3XA 2CW7A 2ZMEC 4YRVA 4CYDA 2PFBA 2QQAA 2L9NA 1LQ1A 3W3CA 1RR8C 4DNCA 4KIBA 3NEUA 3BP8A 4EVIA 1CQTA 1WKMA 1T6SA 3IAM2 4NB5A 2L5QA 3K4KA 4XORA 3AKZA 1XSVA 5FGMA 2PMHA 3PL8A 4YG2F 2HXIA 4BE2A 4KDPA 1M1EB 2Y2ZA 5H6RA 1B72B 2PEXA 3KLNA 1OCRH 1UHWA 3F9KA 4U0VA 1OYIA 2NYXA 1GDTA 2K9LA 4GGGA 2IS2A 3VPRA 3OL4A 2I8DA 3HG9A 2XSJC 4F7ZA 4KA4A 5M5XJ 2QYOA 3C2GA 1OFCX 2MD0A 1MIJA 4LB6B 2DT7B 1ZK8A 3J7AY 1KU2A 2A6TA 4UV9A 3RKXA 4QPQA 2ZO4A 3VOEA 5J8CA 4J00A 2WB1N 4XN3A 4N4OB 2CSOA 4IHYA 1DQUA 4Q4ZF 4CZCA 3R4KA 1FZPB 2COBA 3AFHA 1XN7A 1R9TJ 2P8TA 3RQ4A 5J1YA 4AU7A 1TQPA 3HJEA 2FUG2 3W2AA 4G6QA 2E2JJ 3OWTA 1LE8A 2QQ8A 3ULQB 2FU4A 4YFKF 2PBIA 2X6YA 5EZGA 3MZHA 1DPUA 3ABUA 2ADUA 2M34A 1BM9A 5L3CA 1U5TB 5LHGA 1V5FA 1Z6TA 2OD5A 5J1UA 1WJAA 4XIDA 4ZYHA 5D4SA 5HDKA 1P7IA 3VEPA 3KFWX 1KGSA 2HGCA 2BY3A 4AD9A 3QOPA 3DLAA 3N97A 1CF7B 2LF8A 1PUFA 1XTAA 4XRMA 1WCMJ 3ASNH 2VC1A 3RSNA 4CHUA 4L9JA 4RLQA 3JREA 3JRBA 3V8JA 3MKWB 4HNUA 1W7PA 3PNYA 2XF5A 2A5YB 4AUXA 4UVCA 4U0WA 3E5XA 1W5SA 2FRHA 4Z6YA 3H3ZA 3Q0UA 2CW8A 4CCMA 3BQZA 4XLHA 2BY0A 4MGRA 3GFIA 2L9VA 2VQLA 3K2ZA 4E70A 3QOEA 2UUZA 5GADJ 1PYVA 3BG6A 4DZJA 1QVTA 2V9KA 1Z3XA 5JVGF 1IC8A 4KMUX 1GLNA 1L0OC 1QHGA 3WHBA 1P4XA 1YIOA 2JA7J 3GZNB 3VFZA 4BGDA 4J19A 3L2CA 3COAC 2WC2A 2Y0SA 2ZBKA 3GTOJ 1QRYA 4IJAA 1IRFA 1B72A 4HRIA 3FM3A 2FBKA 3S1QJ 2R7UA 1MNMC 1UG0A 5FKOA 2EBIA 3OS1A 1N75A 2DU9A 4AM3A 4RAGA 2FMLA 5BQTA 3TQNA 5D8KB 1JT0A 1W1WE 2X6WA 4RB2C 1MMSA 5EEGA 4B43A 1GUUA 4WX9A 2A07F 3GTGJ 3TO7A 4I2OA 1BW5A 3HDDA 5IY5H 3Q0WA 4M3FA 2A69F 1B9MA 2ZJRF 1SAUA 5CLSA 1D3YA 3E6MA 3FXKA 2HDDA 1JGSA 4UY8I 3O6BB 1RUOA 2HOAA 1OR7A 1FP1D 3A02A 2K40A 4HDUA 4E4HA 3DV8A 5EZHA 1IDZA 4U7DA 1R1UA 1JHFA 4BY7J 4KICA 1SD4A 1U5TA 1F9NA 2LKSA 2BOLA 2F48A 1RETA 1G3TA 4M9ZA 1WSUA 5DCMB 1X3UA 5J47A 2ZKZA 3V8LA 5JHUA 2MBFA 2VC0A 3ERMA 2DOAA 3F0CA 2MH2A 3REOA 1HKSA 2DO7A 2XVCA 2OCCH 2VT3A 3BTCA 2VKEA 3VSLA 1CF7A 2IBDA 5AONA 4Y52J 3ZQGA 1ZGJA 2PLYA 2WY7Q 1R4NB 1PVEA 1X1CA 3JRDA 1P4AA 2HTJA 1TC3C 3CC7I 1UCRA 1RC9A 1CGPA 2HVSA 3GTLJ 2GWRA 4WCGA 5FLXZ 4LK0F 4M6YA 4M72A 1Q1HA 3BZKA 4RAFA 3L2WA 4K2EA 1S9HA 2EV6A 3HRSA 3RPUA 4E7LA 1Y6IA 4OAZA 1MNEA 3MAJA 3A0HC 1FC3A 2O8KA 3K4MA 5HNFA 3OYEA 4CO8A 1MKMA 4A3BJ 3MMYB 2HVQA 3IV5A 1YITI 1S7OA 4PJNA 3ZQHA 5F1RA 3KP5A 2ZFUA 3V7RA 4S04A 1WPKA 1FTZA 4OINF 3H1CA 4KIFA 1AKHB 3BDDA 2QF7A 2TCTA 2YX7A 1BJZA 4ZC3A 2KZVA 3OYDA 4KJZA 2VJ5A 2Q8KA 1U8RA 1ZG3A 4DYQA 1Z67A 3MVPA 4M6XA 4Y3OA 2DPDA 5IYCJ 3J7AO 3GZ6A 3DF8A 3BR2A 3WGIA 2R5YB 2W4SA 1Y8RB 5D5WB 3OYNA 2NVQJ 2OA4A 1WJDA 1BC8C 1AOYA 3I53A 1YTYA 1R58A 3J80K 5M3FJ 2COMA 1R1VA 4N9HA 1W5TA 5DEQA 3TW7A 2XAFA 1BN5A 2GOXB 3BG3A 4KIGA 1BI2A 1A35A 3U9GA 3SFZA 5EDNA 1HA8A 4P5OA 5FFXA 3KYLA 3MEXA 4LOCA 5E79C 4FE4A 1J09A 5CJ9A 2KDOA 2D45A 3VYSB 3NAUA 1X2MA 1T33A 2YPRA 2VONA 3BR0A 3PQJA 2VE9A 2GZWA 2LSOA 3OSFA 2E19A 2Z2SB 4B3AA 4XSXF 3EUHC 3DKXA 1Z1DA 4D9JA 1MNDA 1D1BA 5HLHA 2B63J 3ECHA 4BU2A 4PDKA 9ANTA 1EF4A 2BGCA 4DIQA 5C3EJ 4LG3A 5DCMA 4P96A 1QVUA 3RKWA 3CO7C 2R7WA 1Z21A 2QGUA 3Q9SA 2VXDA 2JSPA 3TO6A 4HNTA 4IHWA 3GTPJ 2H6BA 4BQOA 3DTKA 1K4TA 3GFJA 2VIXA 4N9IA 1ZARA 1Y0UA 2JUGA 3IKTA 1ETWA 4PGGA 4JP0A 4L5EA 4BAYA 2BEOA 2OUMA 1KYWA 4XOPA 2E1MC 1ON1A 3LQQA 1Z3YA 3KE2A 3QPLA 1SVMA 1HLVA 1MMDA 2HNHA 3GTQJ 3IWZA 3O8GA 2FJ1A 2DK5A 3K10A 5HLGA 4A3KJ 4PZJA 4G8XA 2NVUB 1W0TA 3NWTA 5D6EA 3TBIA 2CV0A 4DBQA 4PSXA 2A6EF 2CQKA 4CYCB 3ROUA 1STZA 4BJ6C 2KP6A 1UHMA 4HW0A 4CA0A 2H1LA 1AKHA 4RDUA 2D2WA 3NQOA 1S72I 2ECCA 1ZR4A 3HSFA 1E2XA 3ZMZA 1U9OA 2DW4A 2KRHA 4B47A 4PUSA 3RPQA 3U2RA 3C2BA 1J2XA 1S6LA 1H9TA 1ZGAA 3C7JA 4U7BA 2R5YA 5GP9A 1IRZA 1Q1VA 5F08A 4Y17A 5CPRB 2DMPA 3HOTA 1IV8A 4E7SA 2XAUA 2H6CA 2O7OA 3BPVA 3H92A 4MQ9F 4EGYA 3PFYA 3WTXC 2R0QC 5BNGA 4BHCA 2LREA 2VJIA 1D5YA 5LD2C 1IUFA 1TBXA 2MA3A 2KIFA 5TJJA 2XDVA 1K6YA 3V4GA 1O3TA 3IH2A 5GTIC 4IVNA 3CCYA 3H5NA 1IRXA 2IGKA 1JGGA 2WBMA 5FD5A 3U1KA 1VQNI 2M0MA 3MN2A 2H94A 4IRHA 3KP6A 2XKPA 1Y8QB 2H8WA 2VB6A 3HRMA 2F5DA 3MCZA 5TGTA 2CWEA 3ZMDA 2ME0A 3TO9A 2VN2A 5EJCA 4HYEA 5J6XA 3LSPA 2W25A 1FOXA 2BVLA 1BW6A 4OIOF 4XLFA 1SANA 2IGOA 3ML6A 1RI7A 1NH3A 3AG4H 2D1HA 2YU3A 2QCOA 1LEAA 2JTVA 3VWBA 5TISC 2M8GX 4ZZLA 2XV4S 4GDFA 1ZLJA 1QGPA 2QZ8A 5E1WA 4M74A 1MSEC 3C1DA 4MQVA 3C2HA 4HX4A 5LGTA 1FTTA 1UELB 4UHTA 1LDDA 3EDPA 1JHHA 4ESFA 5FKKA 1I5ZA 4MIMA 3DTIA 2RN7A 5GPAA 4F93B 1ZR2A 3PFIA 3L1PA 5DD8A 2X6OA 4BHPA 1TQMA 3RYPA 5JHFA 2ISYA 2L01A 4HG2A 1K61A 1IN5A 4GYGA 2E60A 2F4MB 1TL8A 2K86A 5L3GA 2D5VA 2HYGD 2NS8A 3MKLA 1XGSA 1YJ9I 2NS7A 4CYCA 2CUEA 3K7AJ 1Z6RA 4C9YA 4HEA2 2P0WA 5J8FA 3FXMA 4A6DA 3G1OA 2JRTA 1IAWA 1ZLKA 3C3WA 4G9YA 2BXZA 4G7OF 3QP6A 2PQ8A 1J9IA 4U0YA 5IYDJ 4RAYA 2TRTA 2X85A 5KCMA 5GAGJ 3OYKA 3HB9A 2VQGA 4HQEA 3K4JA 5FFZA 4IOAF 4XSZF 4IEJA 3CP2A 2QENA 1XGNA 3N4MA 2E7WA 2LR8A 2HEOA 4BXFA 3J81Z 2ZXJA 4BUPA 2A05A 3CCSI 2O6GE 3KP2A 3IKVA 4WF2A 4X1EA 4I99C 2EA2A 2R7FA 2MG4A 2QUFA 1A6IA 1LKXA 1QA6A 3ZQIA 4RB1A 3RPUD 2V1DA 5GTHC 3TKYA 2HOSA 2E5NA 2M7BA 2P4WA 4U88A 4EV0A 4YEJA 5F0FA 1K7AA 4FE7A 1JJ8C 2G7UA 1JTYA 1P9QC 5DYMA 2W84A 2YR2A 3OR2C 5M3MJ 2YUSA 3E6CC 3HPHA 2R7DA 1ON2A 2YSRA 5LEJA 1SVLA 2XC7A 4EM1A 1RUNA 3PIPF 2FA5A 2O0YA 4BJ5C 4KMFA 5AIPA 2RAEA 2Y0SN 3S3MA 1MBJA 2XAJA 3FBNB 4A3EJ 1X1PA 3KIOA 3LSGA 2E71A 1FEXA 3RJPA 2AXLA 1WJEA 4ANJA 2HQAA 2JA5J 1X3WB 1Z9CA 3MQ0A 1O4XA 2Z16A 5DTDA 2HOEA 4B48A 5H20A 1WJ5A 1YW8A 1ZRFA 3DEEA 1BIAA 1B4AA 2K85A 3WTVC 3FKJA 3EETA 4HV6A 2LC2A 5KK1A 4DQ2A 1T08B 2ESHA 2OV7A 2LY1A 1W36D 4I0AA 5JI6A 1Z7UA 3K70C 3JAMZ 4HAMA 5CKTA 2I10A 2ETHA 1SD5A 2EK5A 2ZXHA 3I4MJ 3SZPA 5FB2A 3AL0B 3M1EA 3RCOA 2HXOA 3UNGC 4MFDA 4FQGA 2X1DA 3R0AA 4QLCU 2IVMA 3MD2A 3SDBA 1MH3A 5ED4A 5IOYA 1LFUP 3I58A 2B9SA 2KZGA 4O6JA 1DP7P 4B8XA 3CCLI 4XKWA 2XASA 4OOIA 1BI3A 1NG6A 2DA2A 1P92A 3WGGA 3IL2A 1O7FA 1D5VA 2E36A 1P6RA 4XICA 4GYIA 1R5ID 5A2QK 6PAXA 3I59B 2IA2A 3GWZA 2LKPA 5FLXK 1KYZA 3VSKA 4C3HJ 3JRAA 4HLYA 3KZIC 4ITVA 2Y75A 2RREA 3IRRA 3ZMUA 5HDNA 1G8XA 3HTUA 2HVRA 4BBSJ 2LMDA 5HODA 5FO5A 5EF6A 2EILH 2P5LC 2KIUA 1HDDC 4IF4A 2GBYA 1S7EA 4C3IJ 3JRFA 4BE1A 5FLVA 4F52A 2J5PA 2YX4A 2KRCA 2W48A 2RVCA 3ZN1A 3J7ZI 2DK8A 4LFUA 1UZCA 2ZFWA 3LSIA 4E7JA 1PJRA 2VOOA 4ZDLA 3BG7A 4A3LJ 3FZVA 3GUDA 1K83J 2EZLA 2DFFA 2IGMA 3B73A 1R22A 2CMPA 3FK6A 3LA3A 4H4KC 2R5ZB 1WHUA 3T5XA 3OYIA 2F6CA 4CICA 2VBZA 3BC8A 4UUSB 3MZYA 2RNGA 1YIJI 1JTXA 4ON0A 3GLXA 2CRGA 4EJUA 2O03A 1N77A 3BR6A 3H35A 1TT0A 1Y56A 1MBFA 4J01A 3JRGA 2EB7A 1IN6A 2XGDA 3BOQA 1NTCA 3T1BA 4CCNA 2HZDA 2LH9A 4RGRA 3LSHA 2I5UA 1LVKA 1K79A 1LPQA 3KX2A 3E3VA 2ICWG 3GF2A 5J40A 3S3NA 5ILSA 3JRCA 4ZTJA 4RLFA 1T0FC 3FBIB 2DLLA 4HLXA 3F8NA 1DP3A 2IA1A 3RZDJ 1RPWA 2LBFB 2DODA 2MH9A 2JN6A 5HLIA 3KCCA 4IRGA 1YLFA 4WK8F 3KYCB 3SEQA 4UNOA 3OIQA 3HIFA 3CUQC 3IHUA 3K4NA 5DV5A 2K3PA 4FHTA 5HLTA 2LD5A 4Q5SF 3F6VA 3DBRB 4XOTA 4A93J 1HC8A 3ERED 4XMYA 4G6TB 2E1NA 2EFNA 3GFLA 4HX7A 4OAYA 2DMTA 1IXCA 2P81A 2E5ZA 3FDYA 3I59A 1ETOA 3CCRI 4HSRA 2XHKA 3JSOA 3A1YA 4KT6A 3QPSA 4AVZA 1ZRCA 4KYWA 2CYYA 1A04A 2LFBA 4CCOA 3QRFF 3HOWJ 1OCPA 1HOMA 1QZYA 4WXDA 3RI4A 3LSTA 4MLOA 1JUSA 2KJCA 4F91B 5ILVA 4WWCA 1PP7U 1IUYA 1BR1A 4HNVA 3WE2A 2NXNB 3T8RA 3TGNA 4HBLA 1VQ8I 1Z0XA 2XGEA 4QTRA 5D4RA 3OL3A 4M3BA 4E7HA 1A31A 3WTYC 3F72A 2XRNA 3FHZA 1VI0A 2OJED 3BCAA 4D7MA 5LRSA 2Y9ZA 2ACJA 2VLAA 1XMXA 2HZTA 2R4GA 5FJ8J 2DA4A 3WU2C 5CVVA 3CCJI 1F43A 2NRAC 4RMNA 4PJ0C 1JKRC 3HYIA 1IDYA 2FEZA 3FF5A 2R5ZA 2BHZA 1WRJA 4P9UA 1NK2P 4EATA 4UUSA 1GXQA 1BBYA 1IF1A 3JTHA 2XROA 3J7YJ 3LAJA 1FYKA 3M07A 2DMQA 2KHMA 3IH3A 5GPCA 1OPCA 2V7FA 2GM4A 3D1NI 1OQYA 1ORKA 3GO5A 4A3FJ 2DA1A 1OYYA 2FBIA 1FBUA 4NNJA 2DMNA 1L3LA 2KMUA 2EZIA 5BPDA 1AU7A 2GLOA 1A6QA 4G94A 3M8EA 2V1XA 1G3SA 5IT3A 3IH4A 4OU0A 2CU7A 4M3DA 2K02A 2EV5A 2Z5UA 3HSRA 4PSWA 4BBRJ 4ZYEA 4OIRF 2EZKA 3DFGA 1KA8A 1U2WA 1MMGA 2LBFA 2K4JA 1OKRA 2A68F 3FX3A 3A01B 1IN7A 1APLC 2M4KA 1U3EM 2DOEA 2CUJA 4A5MA 1QPMA 4LITA 1LDKB 3H5RA 4Y4RA 5IPAA 4ENNA 4MFEA 2O9LA 4X0GA 1K6OA 2CV1A 4P9FA 5L3EA 3OS0A 2HOTA 3KP3A 3FWEA 3HOZJ 2JQ7A 4MNUA 4BS9A 4BDZA 1FWZA 2CQ7A 2CUZA 2EQRA 1JKQC 3WHCA 1EV7A 2H09A 2JPCA 2RQQA 3JW4A 1ULYA 1TWGJ 3KEYA 1IGNA 2L2OA 4BACA 3ZMSA 1R4MB 2L7ZA 1MD0A 3H5AA 1B6AA 2F4OB 4II2A 4XK4A 2UZKA 4V19K 2M2EA 1SAXA 3TDUC 2K9NA 4HDVA 2QLZA 4V2FA 4CCJA 4ENKA 5A2QZ 1R71A 4UXNA 4N0BA 1JUPA 2EPFA 1Z7LA 2LYCA 1VF9A 2HPMA 1FOKA 3LA7A 3JR9A 3QODA 1KU9A 1N25A 2WAEA 3GBGA 2NNNA 2ELJA 4XL9A 3BZCA 1U6GA 2LNBA 2ZCWA 3I9V2 3VODA 2RDPA 3OY9A 2EJRA 2V79A 1SD7A 1MDMB 1RKWA 2ZMEB 4QPOA 3CCMI 5C44J 1A36A 2JVHA 3WODF 4XM3A 1MJ9A 2V1NA 1RIOH 2DCEA 1HBXG 1GXPA 3BTIA 1YQAA 2JPBA 1OISA 2M9HA 4FTHA 2AS5F 2EWNA 1O57A 4CXFA 1W4MA 5B3SH 1AHDP 3W6VA 3GTKJ 3HOXJ 2DFEA 4YFXF 5LFAA 3G6EI 2MYSA 4EMSA 3H9JA 2FXAA 4A3GJ 4NC8A 4IQ4A 4M9XA 4N4NB 3OYFA 4PK4A 2PMZA 1BJAA 1BI1A 1Z05A 3J81K 1V5EA 1AWCA 4BEHB 4A5NA 4CZZA 4EM0B 2L3DA 2ZB9A 3E6BA 3P9CA 2PG4A 4CGZA 2QQBA 3QU6A 3DCFA 3DEWA 3LNQA 2DA7A 3HPGA 3SQNA 5ILUA 3PNTA 4IPAA 1O3SA 4NHJA 1WWXA 2QA4I 3CLQA 3E6DA 3SDGA 2H1KA 2RGVA 3P7NA 4A3IJ 1SMYF 3PO3J 1IW7F 4XN0A 4XR6A 1SFEA 5JVTA 3A01A 1LEBA 1SD6A 2B0LA 3CUOA 2LVSA 2K5CA 2XKOA 2XGXA 2CW0F 3WU0A 3GYHX 2L02A 5JLWA 2JT1A 1J0RA 1MMNA 5CVRA 2LKXA 1H88C 2YS9A 1TW3A 1EH7A 5LBQA 4HX8A 2M8EA 2PMUA 2HWVA 3IAS2 1DU0A 2VQHA 2LRDA 4A69C 1SFUA 3CC4I 1U0JA 2X0LA 5FRMA 1VQOI 2XB0X 4MEXF 5AIQA 3H36A 3IUOA 2ZXWH 3DBHB 2O3FA 3ABKH 3FXJA 3LFUA 3HTSB 1T98A 3LOCA 3HBLA 4M73A 4RGSA 1BL0A 2Y9YA 3DBLB 3L2VA 3X2QH 3I5UA 3ZQQA 2W7NA 3HKZA 1HKQA 2K7LA 5LHIA 4ZZDA 3JAMK 4MHGA 5D5VB 1BOBA 4Q47A 4XQFA 1G4DA 3I4NJ 2LLKA 5LRRA 1MDMA 3CZ6A 3W2WA 2ZMEA 2VPLA 2E2HJ 4EGZA 1NG7A 2MGQA 4IQJA 3AG1H 2LY9A 2HQNA 2V9PA 3S14J 4PJLA 1HSJA 2Q2EB 3BCBA 3MZ8A 4BJTA 3H3VK 2K9MA 2NNYA 3H9QA 3G71I 1D8JA 1X3ZB 1SFOJ 4FX4A 5CVUA 2EIMH 3S16J 3ZGKA 3HHGA 3I71A 2LDUA 2VI6A 2V6CA 3JSPA 3ZQCA 1VQMI 2ME6A 3TL4X 1IZ1A 1LFPA 2STWA 4NC6A 4C2UA 1ZH5A 4RB0A 1B59A 2EZHA 4M9SA 3F23A 4BEHA 4LG0B 3H3UA 2E2IJ 2HDWA 1V54H 1MGTA 2IS6A 2F5CA 3CJNA 2R7TA 3TW6A 3VB2A 2XGCA 3CMEI 1XD7A 1TWHJ 4XLCA 5K5RA 2ELKA 1ETKA 1V4RA 1F1ZA 1KQ0A 2J5OA 2EIJH 2DOFA 4NDLA 5J1RA 5B5EC 1OCOH 5E8IA 4E6KG 1B8IB 2AQEA 2VT2A 4ZH4F 2Y30A 2KLOA 5HS8A 1G3YA 3SJMA 4RS8A 2P6TA 2L7MP 1ZKGA 3QU3A 4P55A 1X4OA 4LLLA 1X4PA 3P5JA 5L3BA 3UKGA 1YHQI 1ZRDA 3AG3H 2UXXA 1HW5A 1REPC 1VQLI 2IS1A 2JUCA 1X1BA 4FX0A 1I27A 2KRFA 4UB8C 5JR3A 2EFOA 4KN4X 2DA6A 2L4AA 2FQ4A 3VYUB 2MFZA 1F4KA 4DJAA 1Y39A 1S5LC 3HL2A 2R7OA 3QAHA 4B09A 2PJPA 2X51A 3O3KA 2R7RA 3FXUA 1E3OC 4HZFA 3O8HA 5L3DA 4IKFA 1D8KA 1DGWY 5BOXA 4D1QA 3BG5A 2UXNA 3F8BA 4NQWB 3DPUA 1YJWI 1GVJA 3KEOA 3PJRA 5IOZA 3OYBA 5EGOB 2DA5A 3LFKA 4B4CA 4UUVA 1LFBA 1YS6A 5C4JJ 2CQQA 3OR1C 4I98B 2QSGX 2HU9A 4II3A 1H89C 3BG9A 4S0HB 2OTLI 1G6NA 3QYEA 3K0LA 4Q48A 2ESNA 1FLIA 2W82A 2FE3A 1F5TA 5F0HA 2HYJA 3E1SA 5CVIA 3DU6A 2EA4A 4KISA 4PCQA 3S1MJ 2X1EA 3CLOA 4EJTA 5CYVA 2Q2EA 3A4CA 4LMYA 2MLKA 2JJ7A 4ESBA 4ZYDA 1G3WA 1XCVA 1VQKI 1XSXA 3AAFA 3JRIA 3EQLF 4IL6C 3HOVJ 2EFQA 4P1WA 3G73A 2AXTC 4XNFA 3ZCOA 2CUFA 3WTWC 3GX4X 2FOKA 5F6FA 1DGRM 1SMTA 2KPMA 1VQPI 1MH4A 5EG0A 3F21A 4LG0A 2GA2A 2BV6A 1Y1VJ 3KEQA 5LGNA
chains in the Genus database with same CATH topology
4W1UA 4JX6A 4A3LJ 4G12A 1B8IA 1K83J 2EZLA 1JT0A 3FK6A 2R5ZB 2VUMJ 1ZTRA 1GUUA 3GTGJ 4UUSB 1G2HA 1JTXA 2DA3A 1ETQA 2CRGA 1BW5A 3HDDA 3Q0WA 1MSFC 3BR6A 1A5JA 4M3FA 3TEDA 2OF7A 1MBFA 3JRGA 2HDDA 2XGDA 1NTCA 2HOAA 3GTJJ 2DMUA 3A02A 2K40A 3PM1A 5IP9J 5EG0B 5EZHA 1OCTC 1IDZA 4A3MJ 1MBKA 2X9DA 4BY7J 2K9SA 1RETA 3JRCA 1WH5A 4W97A 1JT6A 2NVTJ 5E3OA 3F0CA 5IYBJ 3H0GJ 3BTCA 3A03A 5EGOA 2VKEA 3RZDJ 2XPUA 1RPWA 2IBDA 4Y52J 3ZQGA 2JN6A 3JRDA 2R92J 2DTZA 1TC3C 4BXXJ 3GTLJ 1RKTA 3QQAA 2LD5A 4A93J 1GT0C 1OJLA 2XPVA 4IHVA 2DMTA 1ETYA 2P81A 2LTPA 2MW8A 2O8KA 3LSRA 1ETOA 4I76A 4X6AJ 3HEFA 3QPSA 4A3BJ 2LFBA 3IV5A 3HOWJ 1OCPA 1HOMA 3ZQHA 4MLOA 4AYBN 1JUSA 3JRHA 4D5FA 4HNVA 3BR1A 1WPKA 4XRSG 2H8RA 1FTZA 2CJJA 5K7ZA 1AKHB 1Z0XA 1F36A 4A3CJ 2QF7A 5IP6A 2XGEA 2TCTA 2XPWA 4QTRA 1Y1WJ 1BJZA 4M3BA 4EEFG 2EH3A 3CMYA 5E3LA 1VI0A 5FKNA 4DYQA 3MVPA 4D7MA 2Y9ZA 5IYCJ 2LP0A 5JLXA 5FJ8J 1ETXA 3BR2A 2DA4A 2R5YB 1F43A 2WV1A 2NVQJ 1JKRC 5M3FJ 1IDYA 1NK3P 3TW7A 2R5ZA 3BR3A 1NK2P 3BG3A 4UUSA 3S2HJ 5EDNA 4JYKA 3S1RJ 3FISA 2MSYA 4LOCA 1X58A 4FE4A 2FX0A 1U9NA 2XB5A 4DZPA 2DMQA 3IH3A 5GPCA 3NAUA 1X2MA 1T33A 4MO7A 4D5CA 3BR0A 2GM4A 3D1NI 1ORKA 4A3FJ 1T56A 2DA1A 1IJWC 3OSFA 1ZQ3P 2E19A 1XS9A 4B3AA 1MBEA 2JA8J 2DMNA 2NVYJ 2EZIA 5IP7J 1AU7A 2B63J 2GLOA 1FJLA 1FIPA 9ANTA 1EF4A 5C3EJ 1W0UA 3IH4A 2CU7A 3OOUA 4M3DA 1QVUA 5F04A 4BBRJ 1FIAA 3NARA 2PMZN 3PO2J 2EZKA 1WI3A 3BT9A 3GTPJ 4IHWA 4AC0A 3A01B 1APLC 3S2DJ 1ETWA 4JP0A 4L5EA 5IPAA 2O9LA 4MFEA 4BKXA 4QSHA 2NOGA 2L7FP 2HOTA 3QPLA 1UMQA 3HOZJ 1HLVA 3GTQJ 2EQRA 3O8GA 3B6CA 3E7LA 3WHCA 2FJ1A 1JKQC 4A3KJ 1W0TA 4DW6A 2M0CA 5F1JA 1JKOC 1TWGJ 5K7HA 2DJNA 1IGNA 4CYCB 3BQYA 1HF0A 3OIOA 2L7ZA 5K7FA 1GV5A 2ECBA 4XK4A 4I6ZA 1X2NA 2M2EA 5FLMJ 3Q0VA 1ETVA 1TWCJ 2K9NA 3BR5A 1AKHA 1MBGA 4V2FA 4RDUA 2ECCA 1ZR4A 3HOYJ 1JUPA 1WGXA 1U9OA 4JX4A 3C2BA 5J3LA 1VF9A 3JR9A 1HCRA 2R5YA 5GP9A 2XSDC 3GBGA 1YRNB 1IRZA 1Q1VA 4M3EA 5F08A 4XRSA 1TWAJ 1XG1A 2CQXA 2DMPA 4V2GA 2O7OA 2AO9A 1RKWA 2FD5A 5C44J 1BA5A 3K2AA 2R0QC 5BNGA 3G1MA 3HKZN 3BTIA 1D5YA 1IG7A 2KDZA 2M9HA 1IUFA 4FTHA 3W6VA 3GTKJ 2OPTA 1AHDP 2VKVA 3IH2A 3HOXJ 3CCYA 1P7JA 2HQ5A 3OSGA 1JGGA 3Q3SA 4A3GJ 3MN2A 4C3JJ 1HDPA 1ENHA 5EYRA 1TWFJ 3ZOBA 2ME0A 3FK7A 4BY1J 3LSPA 3ZQLA 2R7ZJ 5E3NA 1BW6A 4M3GA 2ZB9A 2IEKA 1SANA 1VFCA 1MNMC 3DCFA 3DEWA 3LNQA 2DA7A 3TP0A 3HOUJ 2QCOA 2H1KA 2M8GX 3SDGA 4C2MJ 4A3IJ 3ZQFA 3PO3J 1VNDA 2G0EA 3A01A 1MSEC 2E1OA 3SFIA 2LVSA 1FTTA 3LSJA 3S17J 3BTJA 5FKKA 4MIMA 5GPAA 3TP3A 5JLWA 1MBHA 2LKXA 1ZR2A 2JA6J 3G1LA 3L1PA 2X6OA 2YS9A 1H88C 4IHXA 4DYCA 1DU0A 4M6VA 1K61A 3CQZJ 4ABZA 1POGA 4A69C 2D5VA 1LE8B 2NS8A 5M5YJ 3MKLA 5FKLA 2XB0X 5EEAA 1GV2A 2NS7A 4CYCA 2CUEA 3K7AJ 1DU6A 3B6AA 2NVXJ 4DYRA 2XRLA 3G1OA 3RKQA 3LOCA 3HBLA 2R93J 1BL0A 2AHQA 2Y9YA 4UUTA 2KT0A 4QIWN 3S15J 1I6HJ 1QPIA 4FCYA 3HGGA 4B1RA 5IYDJ 1JJ6C 2HI3A 2TRTA 1PUFB 1YRNA 1I50J 5FKMA 3HB9A 2ID6A 3I4NJ 2LLKA 2E2HJ 2K9QA 1RESA 2MGQA 4IEJA 2JK3A 1UG2A 3HM5A 2LR8A 2LY9A 3S14J 4RBOA 3M3YJ 3H3VK 1GVDA 4X1EA 1U78A 2MG4A 1SFOJ 1A6IA 3S16J 3ZQIA 2VI6A 3ZQCA 4A3DJ 1CQTA 2ME6A 2HOSA 2EZHA 5F0FA 3S1NJ 4FE7A 2DN0A 1JJ8C 1JTYA 2HXIA 2E2IJ 2Y2ZA 1B72B 3TW6A 2XGCA 5M3MJ 2YUSA 1TWHJ 5E3MA 3GTMJ 1GDTA 2ELKA 4JX5A 1ETKA 3VPRA 4NDLA 5J1RA 2RAEA 5M5XJ 2Y0SN 1B8IB 1OFCX 2Y30A 1ZK8A 1MBJA 3SJMA 4A3EJ 2L7MP 3LSGA 1ZKGA 1ITYA 1FEXA 2WB1N 3UKGA 2Y31A 5DS9A 1UHSA 4IHYA 2IAIA 2JA5J 1O4XA 4D7NA 5DTDA 2COBA 1R9TJ 4Y7NJ 5F27A 2ID3A 2L0KA 5J1YA 2DA6A 4A3JJ 2FQ4A 1H8AC 2E2JJ 1LE8A 3RQIA 3M4OJ 5EZGA 1I3QJ 2M34A 2I10A 3I4MJ 1E3OC 3RZOJ 3O8HA 5J1UA 4XIDA 3BG5A 1P7IA 2HXOA 4MFDA 3HGYA 5IOZA 3BTLA 5EGOB 2DA5A 2L9RA 1Z77A 4B4CA 2JWTA 1LFBA 1MH3A 1U8BA 5IOYA 5C4JJ 2CQQA 1PUFA 1LFUP 2N8GA 1H89C 2YU9J 4XRMA 1WCMJ 3BG9A 4S0HB 5C4XJ 3JREA 1IV6A 3JRBA 2DA2A 5F0HA 2HYJA 4GFBA 2JMWA 2LK2A 4AUXA 4XICA 3S1MJ 3FIWA 3Q0UA 4FISA 3BQZA 2JJ7A 1JKPC 1WH7A 2WAQN 3JRIA 4C3HJ 4DZJA 3JRAA 3HOVJ 1QVTA 1JUMA 1IC8A 2CUFA 3WHBA 5M5WJ 5HODA 2JA7J 4BBSJ 3FKIJ 5EF6A 1MH4A 5EG0A 4J19A 1HDDC 3CDLA 1ZGWA 2GBYA 1S7EA 3GTOJ 4C3IJ 3JRFA 1QRYA 5FLVA 2VPRA 1RR7A 1B72A 5F0CA 2W48A 1Y1VJ 3S1QJ 1XC5A 2X48A 5FKOA 2EBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W1U A;  4JX6 A;  4A3L J;  4G12 A;  1B8I A;  1K83 J;  2EZL A;  1JT0 A;  3FK6 A;  2R5Z B;  2VUM J;  1ZTR A;  1GUU A;  3GTG J;  4UUS B;  1G2H A;  1JTX A;  2DA3 A;  1ETQ A;  2CRG A;  1BW5 A;  3HDD A;  3Q0W A;  1MSF C;  3BR6 A;  1A5J A;  4M3F A;  3TED A;  2OF7 A;  1MBF A;  3JRG A;  2HDD A;  2XGD A;  1NTC A;  2HOA A;  3GTJ J;  2DMU A;  3A02 A;  2K40 A;  3PM1 A;  5IP9 J;  5EG0 B;  5EZH A;  1OCT C;  1IDZ A;  4A3M J;  1MBK A;  2X9D A;  4BY7 J;  2K9S A;  1RET A;  3JRC A;  1WH5 A;  4W97 A;  1JT6 A;  2NVT J;  5E3O A;  3F0C A;  5IYB J;  3H0G J;  3BTC A;  3A03 A;  5EGO A;  2VKE A;  3RZD J;  2XPU A;  1RPW A;  2IBD A;  4Y52 J;  3ZQG A;  2JN6 A;  3JRD A;  2R92 J;  2DTZ A;  1TC3 C;  4BXX J;  3GTL J;  1RKT A;  3QQA A;  2LD5 A;  4A93 J;  1GT0 C;  1OJL A;  2XPV A;  4IHV A;  2DMT A;  1ETY A;  2P81 A;  2LTP A;  2MW8 A;  2O8K A;  3LSR A;  1ETO A;  4I76 A;  4X6A J;  3HEF A;  3QPS A;  4A3B J;  2LFB A;  3IV5 A;  3HOW J;  1OCP A;  1HOM A;  3ZQH A;  4MLO A;  4AYB N;  1JUS A;  3JRH A;  4D5F A;  4HNV A;  3BR1 A;  1WPK A;  4XRS G;  2H8R A;  1FTZ A;  2CJJ A;  5K7Z A;  1AKH B;  1Z0X A;  1F36 A;  4A3C J;  2QF7 A;  5IP6 A;  2XGE A;  2TCT A;  2XPW A;  4QTR A;  1Y1W J;  1BJZ A;  4M3B A;  4EEF G;  2EH3 A;  3CMY A;  5E3L A;  1VI0 A;  5FKN A;  4DYQ A;  3MVP A;  4D7M A;  2Y9Z A;  5IYC J;  2LP0 A;  5JLX A;  5FJ8 J;  1ETX A;  3BR2 A;  2DA4 A;  2R5Y B;  1F43 A;  2WV1 A;  2NVQ J;  1JKR C;  5M3F J;  1IDY A;  1NK3 P;  3TW7 A;  2R5Z A;  3BR3 A;  1NK2 P;  3BG3 A;  4UUS A;  3S2H J;  5EDN A;  4JYK A;  3S1R J;  3FIS A;  2MSY A;  4LOC A;  1X58 A;  4FE4 A;  2FX0 A;  1U9N A;  2XB5 A;  4DZP A;  2DMQ A;  3IH3 A;  5GPC A;  3NAU A;  1X2M A;  1T33 A;  4MO7 A;  4D5C A;  3BR0 A;  2GM4 A;  3D1N I;  1ORK A;  4A3F J;  1T56 A;  2DA1 A;  1IJW C;  3OSF A;  1ZQ3 P;  2E19 A;  1XS9 A;  4B3A A;  1MBE A;  2JA8 J;  2DMN A;  2NVY J;  2EZI A;  5IP7 J;  1AU7 A;  2B63 J;  2GLO A;  1FJL A;  1FIP A;  9ANT A;  1EF4 A;  5C3E J;  1W0U A;  3IH4 A;  2CU7 A;  3OOU A;  4M3D A;  1QVU A;  5F04 A;  4BBR J;  1FIA A;  3NAR A;  2PMZ N;  3PO2 J;  2EZK A;  1WI3 A;  3BT9 A;  3GTP J;  4IHW A;  4AC0 A;  3A01 B;  1APL C;  3S2D J;  1ETW A;  4JP0 A;  4L5E A;  5IPA A;  2O9L A;  4MFE A;  4BKX A;  4QSH A;  2NOG A;  2L7F P;  2HOT A;  3QPL A;  1UMQ A;  3HOZ J;  1HLV A;  3GTQ J;  2EQR A;  3O8G A;  3B6C A;  3E7L A;  3WHC A;  2FJ1 A;  1JKQ C;  4A3K J;  1W0T A;  4DW6 A;  2M0C A;  5F1J A;  1JKO C;  1TWG J;  5K7H A;  2DJN A;  1IGN A;  4CYC B;  3BQY A;  1HF0 A;  3OIO A;  2L7Z A;  5K7F A;  1GV5 A;  2ECB A;  4XK4 A;  4I6Z A;  1X2N A;  2M2E A;  5FLM J;  3Q0V A;  1ETV A;  1TWC J;  2K9N A;  3BR5 A;  1AKH A;  1MBG A;  4V2F A;  4RDU A;  2ECC A;  1ZR4 A;  3HOY J;  1JUP A;  1WGX A;  1U9O A;  4JX4 A;  3C2B A;  5J3L A;  1VF9 A;  3JR9 A;  1HCR A;  2R5Y A;  5GP9 A;  2XSD C;  3GBG A;  1YRN B;  1IRZ A;  1Q1V A;  4M3E A;  5F08 A;  4XRS A;  1TWA J;  1XG1 A;  2CQX A;  2DMP A;  4V2G A;  2O7O A;  2AO9 A;  1RKW A;  2FD5 A;  5C44 J;  1BA5 A;  3K2A A;  2R0Q C;  5BNG A;  3G1M A;  3HKZ N;  3BTI A;  1D5Y A;  1IG7 A;  2KDZ A;  2M9H A;  1IUF A;  4FTH A;  3W6V A;  3GTK J;  2OPT A;  1AHD P;  2VKV A;  3IH2 A;  3HOX J;  3CCY A;  1P7J A;  2HQ5 A;  3OSG A;  1JGG A;  3Q3S A;  4A3G J;  3MN2 A;  4C3J J;  1HDP A;  1ENH A;  5EYR A;  1TWF J;  3ZOB A;  2ME0 A;  3FK7 A;  4BY1 J;  3LSP A;  3ZQL A;  2R7Z J;  5E3N A;  1BW6 A;  4M3G A;  2ZB9 A;  2IEK A;  1SAN A;  1VFC A;  1MNM C;  3DCF A;  3DEW A;  3LNQ A;  2DA7 A;  3TP0 A;  3HOU J;  2QCO A;  2H1K A;  2M8G X;  3SDG A;  4C2M J;  4A3I J;  3ZQF A;  3PO3 J;  1VND A;  2G0E A;  3A01 A;  1MSE C;  2E1O A;  3SFI A;  2LVS A;  1FTT A;  3LSJ A;  3S17 J;  3BTJ A;  5FKK A;  4MIM A;  5GPA A;  3TP3 A;  5JLW A;  1MBH A;  2LKX A;  1ZR2 A;  2JA6 J;  3G1L A;  3L1P A;  2X6O A;  2YS9 A;  1H88 C;  4IHX A;  4DYC A;  1DU0 A;  4M6V A;  1K61 A;  3CQZ J;  4ABZ A;  1POG A;  4A69 C;  2D5V A;  1LE8 B;  2NS8 A;  5M5Y J;  3MKL A;  5FKL A;  2XB0 X;  5EEA A;  1GV2 A;  2NS7 A;  4CYC A;  2CUE A;  3K7A J;  1DU6 A;  3B6A A;  2NVX J;  4DYR A;  2XRL A;  3G1O A;  3RKQ A;  3LOC A;  3HBL A;  2R93 J;  1BL0 A;  2AHQ A;  2Y9Y A;  4UUT A;  2KT0 A;  4QIW N;  3S15 J;  1I6H J;  1QPI A;  4FCY A;  3HGG A;  4B1R A;  5IYD J;  1JJ6 C;  2HI3 A;  2TRT A;  1PUF B;  1YRN A;  1I50 J;  5FKM A;  3HB9 A;  2ID6 A;  3I4N J;  2LLK A;  2E2H J;  2K9Q A;  1RES A;  2MGQ A;  4IEJ A;  2JK3 A;  1UG2 A;  3HM5 A;  2LR8 A;  2LY9 A;  3S14 J;  4RBO A;  3M3Y J;  3H3V K;  1GVD A;  4X1E A;  1U78 A;  2MG4 A;  1SFO J;  1A6I A;  3S16 J;  3ZQI A;  2VI6 A;  3ZQC A;  4A3D J;  1CQT A;  2ME6 A;  2HOS A;  2EZH A;  5F0F A;  3S1N J;  4FE7 A;  2DN0 A;  1JJ8 C;  1JTY A;  2HXI A;  2E2I J;  2Y2Z A;  1B72 B;  3TW6 A;  2XGC A;  5M3M J;  2YUS A;  1TWH J;  5E3M A;  3GTM J;  1GDT A;  2ELK A;  4JX5 A;  1ETK A;  3VPR A;  4NDL A;  5J1R A;  2RAE A;  5M5X J;  2Y0S N;  1B8I B;  1OFC X;  2Y30 A;  1ZK8 A;  1MBJ A;  3SJM A;  4A3E J;  2L7M P;  3LSG A;  1ZKG A;  1ITY A;  1FEX A;  2WB1 N;  3UKG A;  2Y31 A;  5DS9 A;  1UHS A;  4IHY A;  2IAI A;  2JA5 J;  1O4X A;  4D7N A;  5DTD A;  2COB A;  1R9T J;  4Y7N J;  5F27 A;  2ID3 A;  2L0K A;  5J1Y A;  2DA6 A;  4A3J J;  2FQ4 A;  1H8A C;  2E2J J;  1LE8 A;  3RQI A;  3M4O J;  5EZG A;  1I3Q J;  2M34 A;  2I10 A;  3I4M J;  1E3O C;  3RZO J;  3O8H A;  5J1U A;  4XID A;  3BG5 A;  1P7I A;  2HXO A;  4MFD A;  3HGY A;  5IOZ A;  3BTL A;  5EGO B;  2DA5 A;  2L9R A;  1Z77 A;  4B4C A;  2JWT A;  1LFB A;  1MH3 A;  1U8B A;  5IOY A;  5C4J J;  2CQQ A;  1PUF A;  1LFU P;  2N8G A;  1H89 C;  2YU9 J;  4XRM A;  1WCM J;  3BG9 A;  4S0H B;  5C4X J;  3JRE A;  1IV6 A;  3JRB A;  2DA2 A;  5F0H A;  2HYJ A;  4GFB A;  2JMW A;  2LK2 A;  4AUX A;  4XIC A;  3S1M J;  3FIW A;  3Q0U A;  4FIS A;  3BQZ A;  2JJ7 A;  1JKP C;  1WH7 A;  2WAQ N;  3JRI A;  4C3H J;  4DZJ A;  3JRA A;  3HOV J;  1QVT A;  1JUM A;  1IC8 A;  2CUF A;  3WHB A;  5M5W J;  5HOD A;  2JA7 J;  4BBS J;  3FKI J;  5EF6 A;  1MH4 A;  5EG0 A;  4J19 A;  1HDD C;  3CDL A;  1ZGW A;  2GBY A;  1S7E A;  3GTO J;  4C3I J;  3JRF A;  1QRY A;  5FLV A;  2VPR A;  1RR7 A;  1B72 A;  5F0C A;  2W48 A;  1Y1V J;  3S1Q J;  1XC5 A;  2X48 A;  5FKO A;  2EBI A; 
#chains in the Genus database with same CATH topology
 3HXL A;  5F64 A;  4W1U A;  2DDA A;  4JX6 A;  4XRF A;  2DPU A;  2FMY A;  2BY2 A;  4G12 A;  1YYV A;  4IOC F;  1B8I A;  3U1D A;  1R6R A;  1ZTR A;  3I64 A;  3OMY A;  5E20 A;  2VUM J;  1YI2 I;  1G2H A;  2BXY A;  3KZZ A;  2DA3 A;  1ETQ A;  2VL8 A;  5HS7 A;  2CO5 A;  3TMO A;  2DT5 A;  2M5W A;  3AG2 H;  1WJC A;  1MSF C;  3LA2 A;  3TED A;  2OF7 A;  3ISP A;  1XCB A;  4TV7 A;  3K4L A;  2ELH A;  2M45 A;  2VE8 A;  4CUG A;  4DBR A;  1R1T A;  2DMU A;  3PM1 A;  1J5Y A;  2XAQ A;  5IP9 J;  5H2F C;  3OYG A;  1OCT C;  1E3P A;  1FT9 A;  4RB3 C;  3G4S I;  3DP7 A;  3S2W A;  5KAF C;  1OR7 C;  3TOB A;  3DPT A;  1IXS B;  1WH5 A;  4W97 A;  1S8N A;  4JBA A;  2NVT J;  3M8F A;  4HF0 A;  4NQW A;  1ERD A;  3F8C A;  1HQC A;  3WTT C;  3K70 D;  1KU3 A;  2NAZ A;  3H0G J;  3OYH A;  1U5T C;  5EGO A;  2XPU A;  1FSE A;  1VQ4 I;  1MMA A;  3OS2 A;  2RV8 A;  2XAG A;  1LUJ B;  5JFR A;  2E1M B;  3OYM A;  2F5F A;  5ICE A;  2DTZ A;  3S8P A;  4BXX J;  3CF2 A;  4AIJ A;  2WAQ A;  4C30 A;  3F22 A;  4ASN A;  4L9T A;  4IRI A;  4OIQ F;  5CVJ A;  4JOM A;  2Z3Y A;  1YX5 A;  4LD5 A;  1BR4 A;  5H6Q A;  5FRO A;  3WU1 B;  2XAH A;  4IHV A;  1D1A A;  3ABM H;  3L2Q A;  2LTP A;  1IN4 A;  3LSR A;  4I76 A;  2HTS A;  4X6A J;  3HEF A;  3L7W A;  2Z1D A;  1FSH A;  2M3A A;  4EM2 A;  5HS9 A;  3F6O A;  2QM3 A;  3Q5F A;  3JRH A;  2JSC A;  1QNT A;  4XLN F;  4D5F A;  1DPR A;  1XGM A;  2CJJ A;  3HSE A;  1F36 A;  3FMR A;  1T2K A;  4A3C J;  2VAS A;  5KAI C;  2XF7 A;  1XPX A;  2M87 A;  2STT A;  2Z99 A;  1Y1W J;  4IHS A;  4EEF G;  2BBY A;  1SFK A;  2CS3 A;  1FNN A;  3ASO H;  3ZQ7 A;  5E3L A;  3KLO A;  2FSW A;  1OMI A;  1YE9 A;  3LSK A;  4A2U A;  3BJ6 A;  2QBY B;  1AA7 A;  3V7C A;  3K4C A;  2WA0 A;  3ZR8 X;  1XSD A;  2QSH X;  2E7X A;  1LNW A;  2IA0 A;  3BR3 A;  2DTR A;  1G59 A;  3SZG A;  3PQK A;  4XKB A;  2DT6 A;  1ACI A;  4L5J A;  4BQN A;  4JYK A;  3EUK L;  3F8M A;  3FIS A;  3B02 A;  5DUK A;  3CCQ I;  2FX0 A;  2XB5 A;  4DZP A;  3EUH A;  3GW2 A;  1TTY A;  2NS0 A;  3V7S A;  2H27 A;  4PFP A;  2E1C A;  1WJB A;  1T56 A;  1IJW C;  1ZQ3 P;  3P9I A;  1ONV A;  1XS9 A;  5DCF A;  1W36 C;  1MBE A;  4WXH A;  2JA8 J;  2NVY J;  2R7S A;  4IZZ A;  1TW2 A;  1MZB A;  3JCU C;  1FIP A;  3K1N A;  2BW3 B;  2HR3 A;  2VOP A;  5E18 F;  1XGO A;  1KZH A;  4MTE A;  2M30 A;  3QPH A;  2Z9O A;  5F04 A;  3NAR A;  2PMZ N;  2IW5 A;  3PO2 J;  2OBP A;  4IX7 A;  4U87 A;  3HRU A;  3ELK A;  4QWQ A;  3I3L A;  2A5W A;  2W00 A;  3CCU I;  1WI3 A;  5IT9 Z;  3BT9 A;  5LGU A;  1P4W A;  4KUM A;  3GVA A;  4AC0 A;  3CJT B;  3IWF A;  3S2D J;  3GLL A;  1FMV A;  4ENM A;  5KVR A;  1V55 H;  1VTN C;  3CD6 I;  4BKX A;  2XIG A;  1R49 A;  4AYB A;  2NOG A;  2KIS A;  2CFX A;  4XKV A;  1UMQ A;  2FOW A;  1TLH B;  1RNL A;  3V42 A;  4HOB A;  4ZDO A;  4F92 B;  3B6C A;  3E7L A;  3FHN A;  3CES A;  1JKO C;  3OYJ A;  5CQE A;  1MJB A;  5DD4 A;  5K7H A;  1J7K A;  2KL4 A;  3BQY A;  3I4P A;  5K7F A;  1GV5 A;  2EV0 A;  4I6Z A;  1X2N A;  4CH7 A;  5FLM J;  3Q0V A;  1TWC J;  1QHH D;  3K1M A;  3K69 A;  1USS A;  1MBG A;  2RC4 A;  4HQM A;  5HNH A;  3L9F A;  1FP2 A;  3HOY J;  1WGX A;  2MC4 A;  1WQ2 A;  4JX4 A;  4UVA A;  1VQ5 I;  1JE8 A;  2QBY A;  2XSD C;  3TOA A;  1B9N A;  1YRN B;  4M3E A;  4HF1 A;  1YOV B;  3RIR A;  1TWA J;  2CQX A;  5LEK A;  3I55 I;  2VBY A;  3KPH A;  4EJO A;  4C2T A;  2FD5 A;  1BA5 A;  4AIH A;  1BR2 A;  3G1M A;  3CTA A;  5B66 C;  3CF5 F;  3HKZ N;  5E1Z B;  3CJR B;  1VQ9 I;  2A3S A;  2OPT A;  5B1A H;  5E8G A;  1J75 A;  5EEH A;  2HQ5 A;  3GEZ A;  4C3J J;  3D5R C;  2HYF A;  3DWL E;  1HDP A;  5EYR A;  2UWM A;  4PGH A;  3DKW A;  1R5G A;  3FK7 A;  4B44 A;  4BY1 J;  3FXL A;  2GXA A;  4A0Z A;  4Y33 A;  4L0Z B;  1Y0N A;  3FMS A;  1OLT A;  1WVR A;  1BIB A;  2KFD A;  2BW3 A;  2LY2 A;  4GXO A;  1ZRE A;  4XON A;  5KHD A;  1VFC A;  4R1H A;  1R00 A;  3QPT A;  1VZ0 A;  4HA8 A;  2TDX A;  1OYW A;  2DQL A;  2OCE A;  4E7Z A;  3OYA A;  2X6X A;  4C2M J;  5E17 F;  3ZQF A;  1JXS A;  3GXO A;  1IRG A;  1O3R A;  4Z2Y A;  5GAH J;  4OMY A;  2IRF G;  1O7L A;  2E1O A;  2L9S A;  2CG4 A;  2GQQ A;  3HUG B;  1LDJ A;  4I7H A;  3BTJ A;  2HFH A;  1B1B A;  2JA6 J;  3G1L A;  4KIT B;  1QU3 A;  2Y69 H;  5CQG A;  4M6V A;  1E3H A;  2OAZ A;  4ABZ A;  3K4B A;  4E7K A;  1N78 A;  3BJO A;  2V1U A;  1ZG5 A;  2QEX I;  5LLQ A;  2KQR A;  5FKL A;  1VQ6 I;  5K5Q A;  1GV2 A;  5DDG A;  4BYY A;  3WG7 H;  2VQC A;  3EPZ A;  1I1S A;  2NVX J;  3H9G A;  4DYR A;  3D5L A;  1QQI A;  4ZJZ A;  1I3A A;  2R93 J;  1S3J A;  2AHQ A;  2DI3 A;  4UUT A;  3RTR A;  3W6K B;  4RM3 A;  2KT0 A;  2GIV A;  4QIW N;  4YFN F;  2ZNY A;  4UVB A;  1JJ6 C;  4CCK A;  2FNP A;  3DXJ F;  1D0X A;  1YRN A;  3ZN0 A;  4D0P A;  1I50 J;  1BOA A;  1KON A;  2IPQ X;  2ID6 A;  3NWS A;  1K78 B;  3M1C A;  3FXQ A;  2K9Q A;  1HW2 A;  3MWM A;  4DGW B;  2JK3 A;  2ZXI A;  1UG2 A;  3HM5 A;  4HST A;  1QBJ A;  4R8H A;  3SXY A;  4M71 A;  4XLE A;  4LK1 F;  4RBO A;  3M3Y J;  4CDG A;  1GVD A;  3DEU A;  2JVG A;  5ICF A;  3KP4 A;  2QKM B;  5D6F A;  1U78 A;  4A0Y A;  5BS6 A;  4F55 A;  4A3D J;  2XUB A;  2Y48 A;  3MKY B;  4OIP F;  4I01 A;  3ZRG A;  2GAU A;  3RDI A;  4RGX A;  2VJJ A;  3JTG A;  3S1N J;  5ERI A;  2DN0 A;  3IC7 A;  3PNV A;  1FPQ A;  2DYS H;  1PDN C;  5E3M A;  1YJN I;  1TNS A;  3GTM J;  4JX5 A;  3U21 A;  2F5V A;  2QWW A;  1WFX A;  2R7X A;  3BRO A;  2LOO A;  3SYT A;  2DAO A;  2IGN A;  2A61 A;  2F5E A;  4UB6 C;  2HDC A;  2Y0M A;  4LLN A;  2DJI A;  1I6X A;  3OYL A;  3PUB A;  4L0Y B;  2BZT A;  3CCV I;  1EH6 A;  3CP8 A;  3E0J B;  3HUG A;  1ITY A;  4LIU A;  2Y31 A;  3K6G A;  1UHS A;  5DS9 A;  2DXI A;  1KQ8 A;  2IAI A;  2W1O A;  1D0Z A;  4D7N A;  3CJQ B;  1W5C C;  1QO0 D;  2LG4 A;  4I0B A;  1ODD A;  4L9N A;  4Y7N J;  5F27 A;  2WTE A;  2ID3 A;  2L0K A;  3GCM A;  3E97 A;  3KP7 A;  4A3J J;  1H8A C;  1XMA A;  2DBB A;  3RQI A;  3M4O J;  2V6E A;  4AIK A;  1PUE E;  2GOM A;  3K9T A;  1I3Q J;  2K27 A;  1T39 A;  2R3S A;  4HV5 A;  2K4B A;  3E5Q A;  3KZY A;  3RZO J;  5D5X B;  3I56 I;  1UAA A;  2BE5 F;  2P6S A;  4BL0 B;  3ZPL A;  3HGY A;  3L00 A;  3CUQ B;  4XBF A;  1FBQ A;  3BTL A;  2IP2 A;  3ECO A;  2L9R A;  1Z77 A;  2JWT A;  1U8B A;  1UJ8 A;  2N8G A;  2YU9 J;  1O3Q A;  5C4X J;  1TNT A;  2L4M A;  3EYI A;  1IV6 A;  1K78 A;  4GFB A;  1XDU A;  2JMW A;  2LK2 A;  3E5U A;  1IN8 A;  1Z91 A;  2P5V A;  4O3M A;  3R61 A;  3FXO A;  3FIW A;  4BQA A;  4FIS A;  3CMM A;  2PJR B;  1JKP C;  4LB5 A;  5K1Y A;  1WH7 A;  1T8I A;  2WAQ N;  3GFM A;  1E0E A;  4I09 A;  3IRQ A;  2M1B A;  5KNL A;  1GHC A;  3F3X A;  1JUM A;  4LGW A;  2KIM A;  3T8T A;  1X1A A;  3LSM A;  5M5W J;  3L2U A;  4KT5 C;  3NRV A;  3FKI J;  4FAS D;  3N05 A;  4I02 A;  3CDH A;  3CDL A;  4ETS A;  1ZGW A;  4MTD A;  2VKD A;  3VYT B;  2VPR A;  3LQR A;  1RR7 A;  4PJM A;  5F0C A;  2EFP A;  3SHF A;  2WB1 A;  2ISZ A;  1JI8 A;  2BY1 A;  1XC5 A;  2X48 A;  2O5R A;  3ZXS A;  2EFW A;  2GXB A;  2BYV E;  3MFK A;  4YIR X;  2P7C B;  1V3F A;  2DDB A;  3FM5 A;  4RAZ A;  3FXR A;  4AWX B;  3BWG A;  3M8J A;  3GZ5 A;  1TQI A;  2GA1 A;  1EH8 A;  1KQ9 A;  2ZNZ A;  2OQR A;  3S93 A;  1A5J A;  1QZZ A;  2HKX A;  3I0T A;  1EA3 A;  4AID A;  4NBQ A;  3HZJ A;  3GTJ J;  2IJL A;  3A0B C;  3ABT A;  5EG0 B;  3CCE I;  1MJA A;  4ZTF A;  1T0F A;  2L54 A;  4BNC A;  4A3M J;  2C6Y A;  1MBK A;  2X9D A;  3RKY A;  2MAB A;  4KN7 X;  2K9S A;  3PSF A;  2QVO A;  1OCC H;  1V5G A;  1HKT A;  4JQF A;  4RA2 A;  2VJ4 A;  1JT6 A;  1TP4 A;  5E3O A;  4NUB A;  1T38 A;  5IYB J;  3CUQ A;  4L18 B;  3A03 A;  4Y13 A;  4KNY A;  1LB2 A;  3DQV C;  2MD5 A;  3WE3 A;  3AL0 C;  2PX9 A;  3R6S A;  2R92 J;  3EUA A;  4S05 A;  1DUX C;  3GME A;  5FRN A;  1FOW A;  1RKT A;  3QQA A;  2CH0 A;  3OYC A;  2FBH A;  2OQG A;  1GT0 C;  5IT9 K;  3HHH A;  1OJL A;  2XPV A;  1ETY A;  3L2R A;  4MEY F;  2DQR A;  2MW8 A;  2W57 A;  1ZAO A;  2PJR A;  2O8X A;  3VDX A;  3WGH A;  2IXS A;  4GO1 A;  5DUI A;  1FYM A;  2E35 A;  2FNA A;  2W85 A;  4G7Z F;  2V9V A;  2UV1 A;  2VKH A;  3HC7 A;  4YEL A;  1D0Y A;  3O2P E;  4AYB N;  1W7P D;  2XF6 A;  3BR1 A;  4XRS G;  2CV2 A;  2H8R A;  2Z33 A;  2OZU A;  5K7Z A;  1SC7 A;  1C0W A;  1SVO A;  2JRM A;  4EQQ A;  3PSI A;  5IP6 A;  2XPW A;  1FYL A;  4XLA A;  2EH3 A;  2HPI A;  3CMY A;  3KET A;  5FKN A;  3CC2 I;  2VOD A;  2LP0 A;  3PIO F;  2G7H A;  5JLX A;  1ETX A;  2WAF A;  4ZDP A;  2WV1 A;  3ZP5 A;  3WTZ A;  1MW7 A;  2CFO A;  2L7K A;  5FD6 A;  3DPL C;  1NK3 P;  4OWR B;  2LF7 A;  5DM7 F;  3S3O A;  1I1G A;  3CDI A;  3ZMT A;  3CO6 C;  3W6J B;  3S2H J;  1FBS A;  1X1D A;  1TT5 B;  1UST A;  3S1R J;  2MSY A;  3I54 A;  4AVP A;  2PI0 A;  1X58 A;  1U9N A;  2GXG A;  3CMA I;  2DYR H;  2D1V A;  3S32 A;  5E1X A;  4MO7 A;  4D5C A;  2RNJ A;  5HVQ C;  2QKL B;  1UB9 A;  2ZSH B;  4ENJ A;  2OTJ I;  1WZ2 A;  3M7G A;  2WWY A;  1XMK A;  1QZE A;  1R5H A;  5IP7 J;  1FJL A;  2A6H F;  1W0U A;  1HST A;  3OOU A;  4L9V A;  1LJ9 A;  1FIA A;  2MLG A;  2G9W A;  4JK1 X;  3PUF A;  2P5K A;  5HOO A;  3VYR B;  2CGP A;  3R60 A;  4ESJ A;  3KYD B;  4ZYA A;  1I39 A;  2W24 A;  2WY8 Q;  4YIF A;  2KIQ A;  1BC7 C;  4FT8 A;  1H9G A;  1SFX A;  2KKO A;  5D8L B;  4BHB A;  5DM6 F;  3QP5 A;  4CSW A;  4QSH A;  3EYY A;  3QWL A;  1YG2 A;  3BZ6 A;  3ABL H;  2ZJP F;  2K3F A;  3FMQ A;  2L7F P;  1LVA A;  1XDS A;  2Q0O A;  4LJZ F;  2O61 A;  4R79 A;  1X19 A;  3RYR A;  5ICG A;  3ZMV A;  3F8F A;  2B7E A;  2GIZ A;  1XB4 A;  5D5U B;  3BLY A;  2BVM A;  2X1C A;  1IXR C;  4DW6 A;  2M0C A;  2MC3 A;  4Y15 A;  5F1J A;  3UR3 C;  2KJB A;  2DJN A;  1TZL A;  3QYB A;  2OZ6 A;  1HF0 A;  3OIO A;  1J59 A;  4OMZ A;  1P2F A;  2ECB A;  1FX7 A;  4EJV A;  3BJA A;  2F2E A;  2QSF X;  1ETV A;  3BR5 A;  3BY6 A;  4HPQ A;  1WJF A;  1KU7 A;  1YW7 A;  3DKY A;  3J80 Z;  3A2K A;  1DDN A;  4LLG F;  1UFM A;  2JZY A;  1VQ7 I;  5HDG A;  2VBX A;  5J3L A;  2R7V A;  1HCR A;  1YFH A;  5BPI A;  3H0D A;  4XRS A;  1ZEL A;  4GCV A;  1XG1 A;  4E7I A;  4V2G A;  2AQF A;  1K4S A;  2AO9 A;  2DFI A;  1SEU A;  1YW9 A;  4A6E A;  3K2A A;  3ESW B;  5J4V A;  1HXD A;  1R23 A;  1IG7 A;  2KDZ A;  4GRI A;  2VBW A;  4YII A;  2QQ9 A;  3G3Z A;  1T95 A;  2VKV A;  2E34 A;  2EIK H;  1R36 A;  4IXA A;  1P7J A;  1ZG1 A;  4BH9 A;  5ICC A;  1ZN2 A;  1IO2 A;  3Q3S A;  3OSG A;  2V4J C;  2CQN A;  1EJ9 A;  1ENH A;  1TWF J;  3D0S A;  3IP4 B;  1RRJ A;  2OC6 A;  4DOZ A;  3ZOB A;  2FF4 A;  4A12 A;  1PP8 F;  3WTS C;  4BE0 A;  3LL7 A;  2VXZ A;  3ZQL A;  2R7Z J;  5E3N A;  3BPX A;  2DFH A;  3LWF A;  4M3G A;  2IS4 A;  2F4I A;  2IEK A;  4L5I A;  4G7H F;  3HOS A;  3WTU C;  4EJW A;  1YS7 A;  1FY7 A;  2HS5 A;  3TP0 A;  4HF2 A;  5B1B H;  1ZHF A;  3HOU J;  2M7A A;  2FQ3 A;  3LAP A;  1YX3 A;  2PN6 A;  2HQR A;  4NC7 A;  3V8K A;  1VND A;  2BHY A;  2G0E A;  3D5S C;  3P9K A;  1YO5 C;  3OIP A;  5L3F A;  3HRT A;  1FMW A;  2WV0 A;  3SFI A;  2RQP A;  3K1P A;  3SEZ A;  3W2V A;  4PFO A;  3LSJ A;  2ZJ2 A;  3S17 J;  3TDZ C;  5K5O A;  3TP3 A;  1OCZ H;  1MBH A;  4ZYG A;  4H0E A;  3DLL F;  4IHX A;  4DYC A;  1S29 A;  3R0J A;  1EKE A;  1NHA A;  4IO9 F;  4PJJ A;  3CQZ J;  4RM2 A;  2EIN H;  4UV8 A;  4O5V A;  1POG A;  4XKC A;  2IT0 A;  1LE8 B;  2RKH A;  1R7J A;  5M5Y J;  2NOJ B;  4BXU A;  5EEA A;  2R7Q A;  1HW1 A;  1S7A A;  5BMZ A;  4FET A;  1DU6 A;  3SZT A;  3M9A A;  3B6A A;  2ZC2 A;  4WXC A;  3WG9 A;  4RGU A;  4KFC A;  2Q1Z B;  2XRL A;  3RKQ A;  1D1C A;  3L09 A;  4BQQ A;  4F3Q A;  2V26 A;  3LMM A;  3S15 J;  3DTE A;  1WI9 A;  1I6H J;  3G2B A;  1QPI A;  2OU2 A;  2HKO A;  4FCY A;  3HGG A;  4B1R A;  5LHH A;  3ONQ A;  3QYF A;  2HI3 A;  1PUF B;  2ZJQ F;  1FOY A;  2WAD A;  3T0Y A;  1RZ4 A;  1BI0 A;  4CCL A;  2X4H A;  2ZSI B;  5FKM A;  4BDY A;  1E17 A;  3DU5 A;  4IHT A;  2JA2 A;  3OOP A;  5GAE J;  5TRD A;  1ZYR F;  3Q9V A;  1W7P B;  1XX5 A;  2M4G A;  1RES A;  4XLP F;  4G6D A;  1H0M A;  3C18 A;  2P7V B;  5J4Y A;  4LIV A;  4A0X A;  3OV8 A;  3MKZ A;  4B3X A;  2CW7 A;  2ZME C;  4YRV A;  4CYD A;  2PFB A;  2QQA A;  2L9N A;  1LQ1 A;  3W3C A;  1RR8 C;  4DNC A;  4KIB A;  3NEU A;  3BP8 A;  4EVI A;  1CQT A;  1WKM A;  1T6S A;  3IAM 2;  4NB5 A;  2L5Q A;  3K4K A;  4XOR A;  3AKZ A;  1XSV A;  5FGM A;  2PMH A;  3PL8 A;  4YG2 F;  2HXI A;  4BE2 A;  4KDP A;  1M1E B;  2Y2Z A;  5H6R A;  1B72 B;  2PEX A;  3KLN A;  1OCR H;  1UHW A;  3F9K A;  4U0V A;  1OYI A;  2NYX A;  1GDT A;  2K9L A;  4GGG A;  2IS2 A;  3VPR A;  3OL4 A;  2I8D A;  3HG9 A;  2XSJ C;  4F7Z A;  4KA4 A;  5M5X J;  2QYO A;  3C2G A;  1OFC X;  2MD0 A;  1MIJ A;  4LB6 B;  2DT7 B;  1ZK8 A;  3J7A Y;  1KU2 A;  2A6T A;  4UV9 A;  3RKX A;  4QPQ A;  2ZO4 A;  3VOE A;  5J8C A;  4J00 A;  2WB1 N;  4XN3 A;  4N4O B;  2CSO A;  4IHY A;  1DQU A;  4Q4Z F;  4CZC A;  3R4K A;  1FZP B;  2COB A;  3AFH A;  1XN7 A;  1R9T J;  2P8T A;  3RQ4 A;  5J1Y A;  4AU7 A;  1TQP A;  3HJE A;  2FUG 2;  3W2A A;  4G6Q A;  2E2J J;  3OWT A;  1LE8 A;  2QQ8 A;  3ULQ B;  2FU4 A;  4YFK F;  2PBI A;  2X6Y A;  5EZG A;  3MZH A;  1DPU A;  3ABU A;  2ADU A;  2M34 A;  1BM9 A;  5L3C A;  1U5T B;  5LHG A;  1V5F A;  1Z6T A;  2OD5 A;  5J1U A;  1WJA A;  4XID A;  4ZYH A;  5D4S A;  5HDK A;  1P7I A;  3VEP A;  3KFW X;  1KGS A;  2HGC A;  2BY3 A;  4AD9 A;  3QOP A;  3DLA A;  3N97 A;  1CF7 B;  2LF8 A;  1PUF A;  1XTA A;  4XRM A;  1WCM J;  3ASN H;  2VC1 A;  3RSN A;  4CHU A;  4L9J A;  4RLQ A;  3JRE A;  3JRB A;  3V8J A;  3MKW B;  4HNU A;  1W7P A;  3PNY A;  2XF5 A;  2A5Y B;  4AUX A;  4UVC A;  4U0W A;  3E5X A;  1W5S A;  2FRH A;  4Z6Y A;  3H3Z A;  3Q0U A;  2CW8 A;  4CCM A;  3BQZ A;  4XLH A;  2BY0 A;  4MGR A;  3GFI A;  2L9V A;  2VQL A;  3K2Z A;  4E70 A;  3QOE A;  2UUZ A;  5GAD J;  1PYV A;  3BG6 A;  4DZJ A;  1QVT A;  2V9K A;  1Z3X A;  5JVG F;  1IC8 A;  4KMU X;  1GLN A;  1L0O C;  1QHG A;  3WHB A;  1P4X A;  1YIO A;  2JA7 J;  3GZN B;  3VFZ A;  4BGD A;  4J19 A;  3L2C A;  3COA C;  2WC2 A;  2Y0S A;  2ZBK A;  3GTO J;  1QRY A;  4IJA A;  1IRF A;  1B72 A;  4HRI A;  3FM3 A;  2FBK A;  3S1Q J;  2R7U A;  1MNM C;  1UG0 A;  5FKO A;  2EBI A;  3OS1 A;  1N75 A;  2DU9 A;  4AM3 A;  4RAG A;  2FML A;  5BQT A;  3TQN A;  5D8K B;  1JT0 A;  1W1W E;  2X6W A;  4RB2 C;  1MMS A;  5EEG A;  4B43 A;  1GUU A;  4WX9 A;  2A07 F;  3GTG J;  3TO7 A;  4I2O A;  1BW5 A;  3HDD A;  5IY5 H;  3Q0W A;  4M3F A;  2A69 F;  1B9M A;  2ZJR F;  1SAU A;  5CLS A;  1D3Y A;  3E6M A;  3FXK A;  2HDD A;  1JGS A;  4UY8 I;  3O6B B;  1RUO A;  2HOA A;  1OR7 A;  1FP1 D;  3A02 A;  2K40 A;  4HDU A;  4E4H A;  3DV8 A;  5EZH A;  1IDZ A;  4U7D A;  1R1U A;  1JHF A;  4BY7 J;  4KIC A;  1SD4 A;  1U5T A;  1F9N A;  2LKS A;  2BOL A;  2F48 A;  1RET A;  1G3T A;  4M9Z A;  1WSU A;  5DCM B;  1X3U A;  5J47 A;  2ZKZ A;  3V8L A;  5JHU A;  2MBF A;  2VC0 A;  3ERM A;  2DOA A;  3F0C A;  2MH2 A;  3REO A;  1HKS A;  2DO7 A;  2XVC A;  2OCC H;  2VT3 A;  3BTC A;  2VKE A;  3VSL A;  1CF7 A;  2IBD A;  5AON A;  4Y52 J;  3ZQG A;  1ZGJ A;  2PLY A;  2WY7 Q;  1R4N B;  1PVE A;  1X1C A;  3JRD A;  1P4A A;  2HTJ A;  1TC3 C;  3CC7 I;  1UCR A;  1RC9 A;  1CGP A;  2HVS A;  3GTL J;  2GWR A;  4WCG A;  5FLX Z;  4LK0 F;  4M6Y A;  4M72 A;  1Q1H A;  3BZK A;  4RAF A;  3L2W A;  4K2E A;  1S9H A;  2EV6 A;  3HRS A;  3RPU A;  4E7L A;  1Y6I A;  4OAZ A;  1MNE A;  3MAJ A;  3A0H C;  1FC3 A;  2O8K A;  3K4M A;  5HNF A;  3OYE A;  4CO8 A;  1MKM A;  4A3B J;  3MMY B;  2HVQ A;  3IV5 A;  1YIT I;  1S7O A;  4PJN A;  3ZQH A;  5F1R A;  3KP5 A;  2ZFU A;  3V7R A;  4S04 A;  1WPK A;  1FTZ A;  4OIN F;  3H1C A;  4KIF A;  1AKH B;  3BDD A;  2QF7 A;  2TCT A;  2YX7 A;  1BJZ A;  4ZC3 A;  2KZV A;  3OYD A;  4KJZ A;  2VJ5 A;  2Q8K A;  1U8R A;  1ZG3 A;  4DYQ A;  1Z67 A;  3MVP A;  4M6X A;  4Y3O A;  2DPD A;  5IYC J;  3J7A O;  3GZ6 A;  3DF8 A;  3BR2 A;  3WGI A;  2R5Y B;  2W4S A;  1Y8R B;  5D5W B;  3OYN A;  2NVQ J;  2OA4 A;  1WJD A;  1BC8 C;  1AOY A;  3I53 A;  1YTY A;  1R58 A;  3J80 K;  5M3F J;  2COM A;  1R1V A;  4N9H A;  1W5T A;  5DEQ A;  3TW7 A;  2XAF A;  1BN5 A;  2GOX B;  3BG3 A;  4KIG A;  1BI2 A;  1A35 A;  3U9G A;  3SFZ A;  5EDN A;  1HA8 A;  4P5O A;  5FFX A;  3KYL A;  3MEX A;  4LOC A;  5E79 C;  4FE4 A;  1J09 A;  5CJ9 A;  2KDO A;  2D45 A;  3VYS B;  3NAU A;  1X2M A;  1T33 A;  2YPR A;  2VON A;  3BR0 A;  3PQJ A;  2VE9 A;  2GZW A;  2LSO A;  3OSF A;  2E19 A;  2Z2S B;  4B3A A;  4XSX F;  3EUH C;  3DKX A;  1Z1D A;  4D9J A;  1MND A;  1D1B A;  5HLH A;  2B63 J;  3ECH A;  4BU2 A;  4PDK A;  9ANT A;  1EF4 A;  2BGC A;  4DIQ A;  5C3E J;  4LG3 A;  5DCM A;  4P96 A;  1QVU A;  3RKW A;  3CO7 C;  2R7W A;  1Z21 A;  2QGU A;  3Q9S A;  2VXD A;  2JSP A;  3TO6 A;  4HNT A;  4IHW A;  3GTP J;  2H6B A;  4BQO A;  3DTK A;  1K4T A;  3GFJ A;  2VIX A;  4N9I A;  1ZAR A;  1Y0U A;  2JUG A;  3IKT A;  1ETW A;  4PGG A;  4JP0 A;  4L5E A;  4BAY A;  2BEO A;  2OUM A;  1KYW A;  4XOP A;  2E1M C;  1ON1 A;  3LQQ A;  1Z3Y A;  3KE2 A;  3QPL A;  1SVM A;  1HLV A;  1MMD A;  2HNH A;  3GTQ J;  3IWZ A;  3O8G A;  2FJ1 A;  2DK5 A;  3K10 A;  5HLG A;  4A3K J;  4PZJ A;  4G8X A;  2NVU B;  1W0T A;  3NWT A;  5D6E A;  3TBI A;  2CV0 A;  4DBQ A;  4PSX A;  2A6E F;  2CQK A;  4CYC B;  3ROU A;  1STZ A;  4BJ6 C;  2KP6 A;  1UHM A;  4HW0 A;  4CA0 A;  2H1L A;  1AKH A;  4RDU A;  2D2W A;  3NQO A;  1S72 I;  2ECC A;  1ZR4 A;  3HSF A;  1E2X A;  3ZMZ A;  1U9O A;  2DW4 A;  2KRH A;  4B47 A;  4PUS A;  3RPQ A;  3U2R A;  3C2B A;  1J2X A;  1S6L A;  1H9T A;  1ZGA A;  3C7J A;  4U7B A;  2R5Y A;  5GP9 A;  1IRZ A;  1Q1V A;  5F08 A;  4Y17 A;  5CPR B;  2DMP A;  3HOT A;  1IV8 A;  4E7S A;  2XAU A;  2H6C A;  2O7O A;  3BPV A;  3H92 A;  4MQ9 F;  4EGY A;  3PFY A;  3WTX C;  2R0Q C;  5BNG A;  4BHC A;  2LRE A;  2VJI A;  1D5Y A;  5LD2 C;  1IUF A;  1TBX A;  2MA3 A;  2KIF A;  5TJJ A;  2XDV A;  1K6Y A;  3V4G A;  1O3T A;  3IH2 A;  5GTI C;  4IVN A;  3CCY A;  3H5N A;  1IRX A;  2IGK A;  1JGG A;  2WBM A;  5FD5 A;  3U1K A;  1VQN I;  2M0M A;  3MN2 A;  2H94 A;  4IRH A;  3KP6 A;  2XKP A;  1Y8Q B;  2H8W A;  2VB6 A;  3HRM A;  2F5D A;  3MCZ A;  5TGT A;  2CWE A;  3ZMD A;  2ME0 A;  3TO9 A;  2VN2 A;  5EJC A;  4HYE A;  5J6X A;  3LSP A;  2W25 A;  1FOX A;  2BVL A;  1BW6 A;  4OIO F;  4XLF A;  1SAN A;  2IGO A;  3ML6 A;  1RI7 A;  1NH3 A;  3AG4 H;  2D1H A;  2YU3 A;  2QCO A;  1LEA A;  2JTV A;  3VWB A;  5TIS C;  2M8G X;  4ZZL A;  2XV4 S;  4GDF A;  1ZLJ A;  1QGP A;  2QZ8 A;  5E1W A;  4M74 A;  1MSE C;  3C1D A;  4MQV A;  3C2H A;  4HX4 A;  5LGT A;  1FTT A;  1UEL B;  4UHT A;  1LDD A;  3EDP A;  1JHH A;  4ESF A;  5FKK A;  1I5Z A;  4MIM A;  3DTI A;  2RN7 A;  5GPA A;  4F93 B;  1ZR2 A;  3PFI A;  3L1P A;  5DD8 A;  2X6O A;  4BHP A;  1TQM A;  3RYP A;  5JHF A;  2ISY A;  2L01 A;  4HG2 A;  1K61 A;  1IN5 A;  4GYG A;  2E60 A;  2F4M B;  1TL8 A;  2K86 A;  5L3G A;  2D5V A;  2HYG D;  2NS8 A;  3MKL A;  1XGS A;  1YJ9 I;  2NS7 A;  4CYC A;  2CUE A;  3K7A J;  1Z6R A;  4C9Y A;  4HEA 2;  2P0W A;  5J8F A;  3FXM A;  4A6D A;  3G1O A;  2JRT A;  1IAW A;  1ZLK A;  3C3W A;  4G9Y A;  2BXZ A;  4G7O F;  3QP6 A;  2PQ8 A;  1J9I A;  4U0Y A;  5IYD J;  4RAY A;  2TRT A;  2X85 A;  5KCM A;  5GAG J;  3OYK A;  3HB9 A;  2VQG A;  4HQE A;  3K4J A;  5FFZ A;  4IOA F;  4XSZ F;  4IEJ A;  3CP2 A;  2QEN A;  1XGN A;  3N4M A;  2E7W A;  2LR8 A;  2HEO A;  4BXF A;  3J81 Z;  2ZXJ A;  4BUP A;  2A05 A;  3CCS I;  2O6G E;  3KP2 A;  3IKV A;  4WF2 A;  4X1E A;  4I99 C;  2EA2 A;  2R7F A;  2MG4 A;  2QUF A;  1A6I A;  1LKX A;  1QA6 A;  3ZQI A;  4RB1 A;  3RPU D;  2V1D A;  5GTH C;  3TKY A;  2HOS A;  2E5N A;  2M7B A;  2P4W A;  4U88 A;  4EV0 A;  4YEJ A;  5F0F A;  1K7A A;  4FE7 A;  1JJ8 C;  2G7U A;  1JTY A;  1P9Q C;  5DYM A;  2W84 A;  2YR2 A;  3OR2 C;  5M3M J;  2YUS A;  3E6C C;  3HPH A;  2R7D A;  1ON2 A;  2YSR A;  5LEJ A;  1SVL A;  2XC7 A;  4EM1 A;  1RUN A;  3PIP F;  2FA5 A;  2O0Y A;  4BJ5 C;  4KMF A;  5AIP A;  2RAE A;  2Y0S N;  3S3M A;  1MBJ A;  2XAJ A;  3FBN B;  4A3E J;  1X1P A;  3KIO A;  3LSG A;  2E71 A;  1FEX A;  3RJP A;  2AXL A;  1WJE A;  4ANJ A;  2HQA A;  2JA5 J;  1X3W B;  1Z9C A;  3MQ0 A;  1O4X A;  2Z16 A;  5DTD A;  2HOE A;  4B48 A;  5H20 A;  1WJ5 A;  1YW8 A;  1ZRF A;  3DEE A;  1BIA A;  1B4A A;  2K85 A;  3WTV C;  3FKJ A;  3EET A;  4HV6 A;  2LC2 A;  5KK1 A;  4DQ2 A;  1T08 B;  2ESH A;  2OV7 A;  2LY1 A;  1W36 D;  4I0A A;  5JI6 A;  1Z7U A;  3K70 C;  3JAM Z;  4HAM A;  5CKT A;  2I10 A;  2ETH A;  1SD5 A;  2EK5 A;  2ZXH A;  3I4M J;  3SZP A;  5FB2 A;  3AL0 B;  3M1E A;  3RCO A;  2HXO A;  3UNG C;  4MFD A;  4FQG A;  2X1D A;  3R0A A;  4QLC U;  2IVM A;  3MD2 A;  3SDB A;  1MH3 A;  5ED4 A;  5IOY A;  1LFU P;  3I58 A;  2B9S A;  2KZG A;  4O6J A;  1DP7 P;  4B8X A;  3CCL I;  4XKW A;  2XAS A;  4OOI A;  1BI3 A;  1NG6 A;  2DA2 A;  1P92 A;  3WGG A;  3IL2 A;  1O7F A;  1D5V A;  2E36 A;  1P6R A;  4XIC A;  4GYI A;  1R5I D;  5A2Q K;  6PAX A;  3I59 B;  2IA2 A;  3GWZ A;  2LKP A;  5FLX K;  1KYZ A;  3VSK A;  4C3H J;  3JRA A;  4HLY A;  3KZI C;  4ITV A;  2Y75 A;  2RRE A;  3IRR A;  3ZMU A;  5HDN A;  1G8X A;  3HTU A;  2HVR A;  4BBS J;  2LMD A;  5HOD A;  5FO5 A;  5EF6 A;  2EIL H;  2P5L C;  2KIU A;  1HDD C;  4IF4 A;  2GBY A;  1S7E A;  4C3I J;  3JRF A;  4BE1 A;  5FLV A;  4F52 A;  2J5P A;  2YX4 A;  2KRC A;  2W48 A;  2RVC A;  3ZN1 A;  3J7Z I;  2DK8 A;  4LFU A;  1UZC A;  2ZFW A;  3LSI A;  4E7J A;  1PJR A;  2VOO A;  4ZDL A;  3BG7 A;  4A3L J;  3FZV A;  3GUD A;  1K83 J;  2EZL A;  2DFF A;  2IGM A;  3B73 A;  1R22 A;  2CMP A;  3FK6 A;  3LA3 A;  4H4K C;  2R5Z B;  1WHU A;  3T5X A;  3OYI A;  2F6C A;  4CIC A;  2VBZ A;  3BC8 A;  4UUS B;  3MZY A;  2RNG A;  1YIJ I;  1JTX A;  4ON0 A;  3GLX A;  2CRG A;  4EJU A;  2O03 A;  1N77 A;  3BR6 A;  3H35 A;  1TT0 A;  1Y56 A;  1MBF A;  4J01 A;  3JRG A;  2EB7 A;  1IN6 A;  2XGD A;  3BOQ A;  1NTC A;  3T1B A;  4CCN A;  2HZD A;  2LH9 A;  4RGR A;  3LSH A;  2I5U A;  1LVK A;  1K79 A;  1LPQ A;  3KX2 A;  3E3V A;  2ICW G;  3GF2 A;  5J40 A;  3S3N A;  5ILS A;  3JRC A;  4ZTJ A;  4RLF A;  1T0F C;  3FBI B;  2DLL A;  4HLX A;  3F8N A;  1DP3 A;  2IA1 A;  3RZD J;  1RPW A;  2LBF B;  2DOD A;  2MH9 A;  2JN6 A;  5HLI A;  3KCC A;  4IRG A;  1YLF A;  4WK8 F;  3KYC B;  3SEQ A;  4UNO A;  3OIQ A;  3HIF A;  3CUQ C;  3IHU A;  3K4N A;  5DV5 A;  2K3P A;  4FHT A;  5HLT A;  2LD5 A;  4Q5S F;  3F6V A;  3DBR B;  4XOT A;  4A93 J;  1HC8 A;  3ERE D;  4XMY A;  4G6T B;  2E1N A;  2EFN A;  3GFL A;  4HX7 A;  4OAY A;  2DMT A;  1IXC A;  2P81 A;  2E5Z A;  3FDY A;  3I59 A;  1ETO A;  3CCR I;  4HSR A;  2XHK A;  3JSO A;  3A1Y A;  4KT6 A;  3QPS A;  4AVZ A;  1ZRC A;  4KYW A;  2CYY A;  1A04 A;  2LFB A;  4CCO A;  3QRF F;  3HOW J;  1OCP A;  1HOM A;  1QZY A;  4WXD A;  3RI4 A;  3LST A;  4MLO A;  1JUS A;  2KJC A;  4F91 B;  5ILV A;  4WWC A;  1PP7 U;  1IUY A;  1BR1 A;  4HNV A;  3WE2 A;  2NXN B;  3T8R A;  3TGN A;  4HBL A;  1VQ8 I;  1Z0X A;  2XGE A;  4QTR A;  5D4R A;  3OL3 A;  4M3B A;  4E7H A;  1A31 A;  3WTY C;  3F72 A;  2XRN A;  3FHZ A;  1VI0 A;  2OJE D;  3BCA A;  4D7M A;  5LRS A;  2Y9Z A;  2ACJ A;  2VLA A;  1XMX A;  2HZT A;  2R4G A;  5FJ8 J;  2DA4 A;  3WU2 C;  5CVV A;  3CCJ I;  1F43 A;  2NRA C;  4RMN A;  4PJ0 C;  1JKR C;  3HYI A;  1IDY A;  2FEZ A;  3FF5 A;  2R5Z A;  2BHZ A;  1WRJ A;  4P9U A;  1NK2 P;  4EAT A;  4UUS A;  1GXQ A;  1BBY A;  1IF1 A;  3JTH A;  2XRO A;  3J7Y J;  3LAJ A;  1FYK A;  3M07 A;  2DMQ A;  2KHM A;  3IH3 A;  5GPC A;  1OPC A;  2V7F A;  2GM4 A;  3D1N I;  1OQY A;  1ORK A;  3GO5 A;  4A3F J;  2DA1 A;  1OYY A;  2FBI A;  1FBU A;  4NNJ A;  2DMN A;  1L3L A;  2KMU A;  2EZI A;  5BPD A;  1AU7 A;  2GLO A;  1A6Q A;  4G94 A;  3M8E A;  2V1X A;  1G3S A;  5IT3 A;  3IH4 A;  4OU0 A;  2CU7 A;  4M3D A;  2K02 A;  2EV5 A;  2Z5U A;  3HSR A;  4PSW A;  4BBR J;  4ZYE A;  4OIR F;  2EZK A;  3DFG A;  1KA8 A;  1U2W A;  1MMG A;  2LBF A;  2K4J A;  1OKR A;  2A68 F;  3FX3 A;  3A01 B;  1IN7 A;  1APL C;  2M4K A;  1U3E M;  2DOE A;  2CUJ A;  4A5M A;  1QPM A;  4LIT A;  1LDK B;  3H5R A;  4Y4R A;  5IPA A;  4ENN A;  4MFE A;  2O9L A;  4X0G A;  1K6O A;  2CV1 A;  4P9F A;  5L3E A;  3OS0 A;  2HOT A;  3KP3 A;  3FWE A;  3HOZ J;  2JQ7 A;  4MNU A;  4BS9 A;  4BDZ A;  1FWZ A;  2CQ7 A;  2CUZ A;  2EQR A;  1JKQ C;  3WHC A;  1EV7 A;  2H09 A;  2JPC A;  2RQQ A;  3JW4 A;  1ULY A;  1TWG J;  3KEY A;  1IGN A;  2L2O A;  4BAC A;  3ZMS A;  1R4M B;  2L7Z A;  1MD0 A;  3H5A A;  1B6A A;  2F4O B;  4II2 A;  4XK4 A;  2UZK A;  4V19 K;  2M2E A;  1SAX A;  3TDU C;  2K9N A;  4HDV A;  2QLZ A;  4V2F A;  4CCJ A;  4ENK A;  5A2Q Z;  1R71 A;  4UXN A;  4N0B A;  1JUP A;  2EPF A;  1Z7L A;  2LYC A;  1VF9 A;  2HPM A;  1FOK A;  3LA7 A;  3JR9 A;  3QOD A;  1KU9 A;  1N25 A;  2WAE A;  3GBG A;  2NNN A;  2ELJ A;  4XL9 A;  3BZC A;  1U6G A;  2LNB A;  2ZCW A;  3I9V 2;  3VOD A;  2RDP A;  3OY9 A;  2EJR A;  2V79 A;  1SD7 A;  1MDM B;  1RKW A;  2ZME B;  4QPO A;  3CCM I;  5C44 J;  1A36 A;  2JVH A;  3WOD F;  4XM3 A;  1MJ9 A;  2V1N A;  1RIO H;  2DCE A;  1HBX G;  1GXP A;  3BTI A;  1YQA A;  2JPB A;  1OIS A;  2M9H A;  4FTH A;  2AS5 F;  2EWN A;  1O57 A;  4CXF A;  1W4M A;  5B3S H;  1AHD P;  3W6V A;  3GTK J;  3HOX J;  2DFE A;  4YFX F;  5LFA A;  3G6E I;  2MYS A;  4EMS A;  3H9J A;  2FXA A;  4A3G J;  4NC8 A;  4IQ4 A;  4M9X A;  4N4N B;  3OYF A;  4PK4 A;  2PMZ A;  1BJA A;  1BI1 A;  1Z05 A;  3J81 K;  1V5E A;  1AWC A;  4BEH B;  4A5N A;  4CZZ A;  4EM0 B;  2L3D A;  2ZB9 A;  3E6B A;  3P9C A;  2PG4 A;  4CGZ A;  2QQB A;  3QU6 A;  3DCF A;  3DEW A;  3LNQ A;  2DA7 A;  3HPG A;  3SQN A;  5ILU A;  3PNT A;  4IPA A;  1O3S A;  4NHJ A;  1WWX A;  2QA4 I;  3CLQ A;  3E6D A;  3SDG A;  2H1K A;  2RGV A;  3P7N A;  4A3I J;  1SMY F;  3PO3 J;  1IW7 F;  4XN0 A;  4XR6 A;  1SFE A;  5JVT A;  3A01 A;  1LEB A;  1SD6 A;  2B0L A;  3CUO A;  2LVS A;  2K5C A;  2XKO A;  2XGX A;  2CW0 F;  3WU0 A;  3GYH X;  2L02 A;  5JLW A;  2JT1 A;  1J0R A;  1MMN A;  5CVR A;  2LKX A;  1H88 C;  2YS9 A;  1TW3 A;  1EH7 A;  5LBQ A;  4HX8 A;  2M8E A;  2PMU A;  2HWV A;  3IAS 2;  1DU0 A;  2VQH A;  2LRD A;  4A69 C;  1SFU A;  3CC4 I;  1U0J A;  2X0L A;  5FRM A;  1VQO I;  2XB0 X;  4MEX F;  5AIQ A;  3H36 A;  3IUO A;  2ZXW H;  3DBH B;  2O3F A;  3ABK H;  3FXJ A;  3LFU A;  3HTS B;  1T98 A;  3LOC A;  3HBL A;  4M73 A;  4RGS A;  1BL0 A;  2Y9Y A;  3DBL B;  3L2V A;  3X2Q H;  3I5U A;  3ZQQ A;  2W7N A;  3HKZ A;  1HKQ A;  2K7L A;  5LHI A;  4ZZD A;  3JAM K;  4MHG A;  5D5V B;  1BOB A;  4Q47 A;  4XQF A;  1G4D A;  3I4N J;  2LLK A;  5LRR A;  1MDM A;  3CZ6 A;  3W2W A;  2ZME A;  2VPL A;  2E2H J;  4EGZ A;  1NG7 A;  2MGQ A;  4IQJ A;  3AG1 H;  2LY9 A;  2HQN A;  2V9P A;  3S14 J;  4PJL A;  1HSJ A;  2Q2E B;  3BCB A;  3MZ8 A;  4BJT A;  3H3V K;  2K9M A;  2NNY A;  3H9Q A;  3G71 I;  1D8J A;  1X3Z B;  1SFO J;  4FX4 A;  5CVU A;  2EIM H;  3S16 J;  3ZGK A;  3HHG A;  3I71 A;  2LDU A;  2VI6 A;  2V6C A;  3JSP A;  3ZQC A;  1VQM I;  2ME6 A;  3TL4 X;  1IZ1 A;  1LFP A;  2STW A;  4NC6 A;  4C2U A;  1ZH5 A;  4RB0 A;  1B59 A;  2EZH A;  4M9S A;  3F23 A;  4BEH A;  4LG0 B;  3H3U A;  2E2I J;  2HDW A;  1V54 H;  1MGT A;  2IS6 A;  2F5C A;  3CJN A;  2R7T A;  3TW6 A;  3VB2 A;  2XGC A;  3CME I;  1XD7 A;  1TWH J;  4XLC A;  5K5R A;  2ELK A;  1ETK A;  1V4R A;  1F1Z A;  1KQ0 A;  2J5O A;  2EIJ H;  2DOF A;  4NDL A;  5J1R A;  5B5E C;  1OCO H;  5E8I A;  4E6K G;  1B8I B;  2AQE A;  2VT2 A;  4ZH4 F;  2Y30 A;  2KLO A;  5HS8 A;  1G3Y A;  3SJM A;  4RS8 A;  2P6T A;  2L7M P;  1ZKG A;  3QU3 A;  4P55 A;  1X4O A;  4LLL A;  1X4P A;  3P5J A;  5L3B A;  3UKG A;  1YHQ I;  1ZRD A;  3AG3 H;  2UXX A;  1HW5 A;  1REP C;  1VQL I;  2IS1 A;  2JUC A;  1X1B A;  4FX0 A;  1I27 A;  2KRF A;  4UB8 C;  5JR3 A;  2EFO A;  4KN4 X;  2DA6 A;  2L4A A;  2FQ4 A;  3VYU B;  2MFZ A;  1F4K A;  4DJA A;  1Y39 A;  1S5L C;  3HL2 A;  2R7O A;  3QAH A;  4B09 A;  2PJP A;  2X51 A;  3O3K A;  2R7R A;  3FXU A;  1E3O C;  4HZF A;  3O8H A;  5L3D A;  4IKF A;  1D8K A;  1DGW Y;  5BOX A;  4D1Q A;  3BG5 A;  2UXN A;  3F8B A;  4NQW B;  3DPU A;  1YJW I;  1GVJ A;  3KEO A;  3PJR A;  5IOZ A;  3OYB A;  5EGO B;  2DA5 A;  3LFK A;  4B4C A;  4UUV A;  1LFB A;  1YS6 A;  5C4J J;  2CQQ A;  3OR1 C;  4I98 B;  2QSG X;  2HU9 A;  4II3 A;  1H89 C;  3BG9 A;  4S0H B;  2OTL I;  1G6N A;  3QYE A;  3K0L A;  4Q48 A;  2ESN A;  1FLI A;  2W82 A;  2FE3 A;  1F5T A;  5F0H A;  2HYJ A;  3E1S A;  5CVI A;  3DU6 A;  2EA4 A;  4KIS A;  4PCQ A;  3S1M J;  2X1E A;  3CLO A;  4EJT A;  5CYV A;  2Q2E A;  3A4C A;  4LMY A;  2MLK A;  2JJ7 A;  4ESB A;  4ZYD A;  1G3W A;  1XCV A;  1VQK I;  1XSX A;  3AAF A;  3JRI A;  3EQL F;  4IL6 C;  3HOV J;  2EFQ A;  4P1W A;  3G73 A;  2AXT C;  4XNF A;  3ZCO A;  2CUF A;  3WTW C;  3GX4 X;  2FOK A;  5F6F A;  1DGR M;  1SMT A;  2KPM A;  1VQP I;  1MH4 A;  5EG0 A;  3F21 A;  4LG0 A;  2GA2 A;  2BV6 A;  1Y1V J;  3KEQ A;  5LGN A; 
#chains in the Genus database with same CATH homology
 4W1U A;  4JX6 A;  4A3L J;  4G12 A;  1B8I A;  1K83 J;  2EZL A;  1JT0 A;  3FK6 A;  2R5Z B;  2VUM J;  1ZTR A;  1GUU A;  3GTG J;  4UUS B;  1G2H A;  1JTX A;  2DA3 A;  1ETQ A;  2CRG A;  1BW5 A;  3HDD A;  3Q0W A;  1MSF C;  3BR6 A;  1A5J A;  4M3F A;  3TED A;  2OF7 A;  1MBF A;  3JRG A;  2HDD A;  2XGD A;  1NTC A;  2HOA A;  3GTJ J;  2DMU A;  3A02 A;  2K40 A;  3PM1 A;  5IP9 J;  5EG0 B;  5EZH A;  1OCT C;  1IDZ A;  4A3M J;  1MBK A;  2X9D A;  4BY7 J;  2K9S A;  1RET A;  3JRC A;  1WH5 A;  4W97 A;  1JT6 A;  2NVT J;  5E3O A;  3F0C A;  5IYB J;  3H0G J;  3BTC A;  3A03 A;  5EGO A;  2VKE A;  3RZD J;  2XPU A;  1RPW A;  2IBD A;  4Y52 J;  3ZQG A;  2JN6 A;  3JRD A;  2R92 J;  2DTZ A;  1TC3 C;  4BXX J;  3GTL J;  1RKT A;  3QQA A;  2LD5 A;  4A93 J;  1GT0 C;  1OJL A;  2XPV A;  4IHV A;  2DMT A;  1ETY A;  2P81 A;  2LTP A;  2MW8 A;  2O8K A;  3LSR A;  1ETO A;  4I76 A;  4X6A J;  3HEF A;  3QPS A;  4A3B J;  2LFB A;  3IV5 A;  3HOW J;  1OCP A;  1HOM A;  3ZQH A;  4MLO A;  4AYB N;  1JUS A;  3JRH A;  4D5F A;  4HNV A;  3BR1 A;  1WPK A;  4XRS G;  2H8R A;  1FTZ A;  2CJJ A;  5K7Z A;  1AKH B;  1Z0X A;  1F36 A;  4A3C J;  2QF7 A;  5IP6 A;  2XGE A;  2TCT A;  2XPW A;  4QTR A;  1Y1W J;  1BJZ A;  4M3B A;  4EEF G;  2EH3 A;  3CMY A;  5E3L A;  1VI0 A;  5FKN A;  4DYQ A;  3MVP A;  4D7M A;  2Y9Z A;  5IYC J;  2LP0 A;  5JLX A;  5FJ8 J;  1ETX A;  3BR2 A;  2DA4 A;  2R5Y B;  1F43 A;  2WV1 A;  2NVQ J;  1JKR C;  5M3F J;  1IDY A;  1NK3 P;  3TW7 A;  2R5Z A;  3BR3 A;  1NK2 P;  3BG3 A;  4UUS A;  3S2H J;  5EDN A;  4JYK A;  3S1R J;  3FIS A;  2MSY A;  4LOC A;  1X58 A;  4FE4 A;  2FX0 A;  1U9N A;  2XB5 A;  4DZP A;  2DMQ A;  3IH3 A;  5GPC A;  3NAU A;  1X2M A;  1T33 A;  4MO7 A;  4D5C A;  3BR0 A;  2GM4 A;  3D1N I;  1ORK A;  4A3F J;  1T56 A;  2DA1 A;  1IJW C;  3OSF A;  1ZQ3 P;  2E19 A;  1XS9 A;  4B3A A;  1MBE A;  2JA8 J;  2DMN A;  2NVY J;  2EZI A;  5IP7 J;  1AU7 A;  2B63 J;  2GLO A;  1FJL A;  1FIP A;  9ANT A;  1EF4 A;  5C3E J;  1W0U A;  3IH4 A;  2CU7 A;  3OOU A;  4M3D A;  1QVU A;  5F04 A;  4BBR J;  1FIA A;  3NAR A;  2PMZ N;  3PO2 J;  2EZK A;  1WI3 A;  3BT9 A;  3GTP J;  4IHW A;  4AC0 A;  3A01 B;  1APL C;  3S2D J;  1ETW A;  4JP0 A;  4L5E A;  5IPA A;  2O9L A;  4MFE A;  4BKX A;  4QSH A;  2NOG A;  2L7F P;  2HOT A;  3QPL A;  1UMQ A;  3HOZ J;  1HLV A;  3GTQ J;  2EQR A;  3O8G A;  3B6C A;  3E7L A;  3WHC A;  2FJ1 A;  1JKQ C;  4A3K J;  1W0T A;  4DW6 A;  2M0C A;  5F1J A;  1JKO C;  1TWG J;  5K7H A;  2DJN A;  1IGN A;  4CYC B;  3BQY A;  1HF0 A;  3OIO A;  2L7Z A;  5K7F A;  1GV5 A;  2ECB A;  4XK4 A;  4I6Z A;  1X2N A;  2M2E A;  5FLM J;  3Q0V A;  1ETV A;  1TWC J;  2K9N A;  3BR5 A;  1AKH A;  1MBG A;  4V2F A;  4RDU A;  2ECC A;  1ZR4 A;  3HOY J;  1JUP A;  1WGX A;  1U9O A;  4JX4 A;  3C2B A;  5J3L A;  1VF9 A;  3JR9 A;  1HCR A;  2R5Y A;  5GP9 A;  2XSD C;  3GBG A;  1YRN B;  1IRZ A;  1Q1V A;  4M3E A;  5F08 A;  4XRS A;  1TWA J;  1XG1 A;  2CQX A;  2DMP A;  4V2G A;  2O7O A;  2AO9 A;  1RKW A;  2FD5 A;  5C44 J;  1BA5 A;  3K2A A;  2R0Q C;  5BNG A;  3G1M A;  3HKZ N;  3BTI A;  1D5Y A;  1IG7 A;  2KDZ A;  2M9H A;  1IUF A;  4FTH A;  3W6V A;  3GTK J;  2OPT A;  1AHD P;  2VKV A;  3IH2 A;  3HOX J;  3CCY A;  1P7J A;  2HQ5 A;  3OSG A;  1JGG A;  3Q3S A;  4A3G J;  3MN2 A;  4C3J J;  1HDP A;  1ENH A;  5EYR A;  1TWF J;  3ZOB A;  2ME0 A;  3FK7 A;  4BY1 J;  3LSP A;  3ZQL A;  2R7Z J;  5E3N A;  1BW6 A;  4M3G A;  2ZB9 A;  2IEK A;  1SAN A;  1VFC A;  1MNM C;  3DCF A;  3DEW A;  3LNQ A;  2DA7 A;  3TP0 A;  3HOU J;  2QCO A;  2H1K A;  2M8G X;  3SDG A;  4C2M J;  4A3I J;  3ZQF A;  3PO3 J;  1VND A;  2G0E A;  3A01 A;  1MSE C;  2E1O A;  3SFI A;  2LVS A;  1FTT A;  3LSJ A;  3S17 J;  3BTJ A;  5FKK A;  4MIM A;  5GPA A;  3TP3 A;  5JLW A;  1MBH A;  2LKX A;  1ZR2 A;  2JA6 J;  3G1L A;  3L1P A;  2X6O A;  2YS9 A;  1H88 C;  4IHX A;  4DYC A;  1DU0 A;  4M6V A;  1K61 A;  3CQZ J;  4ABZ A;  1POG A;  4A69 C;  2D5V A;  1LE8 B;  2NS8 A;  5M5Y J;  3MKL A;  5FKL A;  2XB0 X;  5EEA A;  1GV2 A;  2NS7 A;  4CYC A;  2CUE A;  3K7A J;  1DU6 A;  3B6A A;  2NVX J;  4DYR A;  2XRL A;  3G1O A;  3RKQ A;  3LOC A;  3HBL A;  2R93 J;  1BL0 A;  2AHQ A;  2Y9Y A;  4UUT A;  2KT0 A;  4QIW N;  3S15 J;  1I6H J;  1QPI A;  4FCY A;  3HGG A;  4B1R A;  5IYD J;  1JJ6 C;  2HI3 A;  2TRT A;  1PUF B;  1YRN A;  1I50 J;  5FKM A;  3HB9 A;  2ID6 A;  3I4N J;  2LLK A;  2E2H J;  2K9Q A;  1RES A;  2MGQ A;  4IEJ A;  2JK3 A;  1UG2 A;  3HM5 A;  2LR8 A;  2LY9 A;  3S14 J;  4RBO A;  3M3Y J;  3H3V K;  1GVD A;  4X1E A;  1U78 A;  2MG4 A;  1SFO J;  1A6I A;  3S16 J;  3ZQI A;  2VI6 A;  3ZQC A;  4A3D J;  1CQT A;  2ME6 A;  2HOS A;  2EZH A;  5F0F A;  3S1N J;  4FE7 A;  2DN0 A;  1JJ8 C;  1JTY A;  2HXI A;  2E2I J;  2Y2Z A;  1B72 B;  3TW6 A;  2XGC A;  5M3M J;  2YUS A;  1TWH J;  5E3M A;  3GTM J;  1GDT A;  2ELK A;  4JX5 A;  1ETK A;  3VPR A;  4NDL A;  5J1R A;  2RAE A;  5M5X J;  2Y0S N;  1B8I B;  1OFC X;  2Y30 A;  1ZK8 A;  1MBJ A;  3SJM A;  4A3E J;  2L7M P;  3LSG A;  1ZKG A;  1ITY A;  1FEX A;  2WB1 N;  3UKG A;  2Y31 A;  5DS9 A;  1UHS A;  4IHY A;  2IAI A;  2JA5 J;  1O4X A;  4D7N A;  5DTD A;  2COB A;  1R9T J;  4Y7N J;  5F27 A;  2ID3 A;  2L0K A;  5J1Y A;  2DA6 A;  4A3J J;  2FQ4 A;  1H8A C;  2E2J J;  1LE8 A;  3RQI A;  3M4O J;  5EZG A;  1I3Q J;  2M34 A;  2I10 A;  3I4M J;  1E3O C;  3RZO J;  3O8H A;  5J1U A;  4XID A;  3BG5 A;  1P7I A;  2HXO A;  4MFD A;  3HGY A;  5IOZ A;  3BTL A;  5EGO B;  2DA5 A;  2L9R A;  1Z77 A;  4B4C A;  2JWT A;  1LFB A;  1MH3 A;  1U8B A;  5IOY A;  5C4J J;  2CQQ A;  1PUF A;  1LFU P;  2N8G A;  1H89 C;  2YU9 J;  4XRM A;  1WCM J;  3BG9 A;  4S0H B;  5C4X J;  3JRE A;  1IV6 A;  3JRB A;  2DA2 A;  5F0H A;  2HYJ A;  4GFB A;  2JMW A;  2LK2 A;  4AUX A;  4XIC A;  3S1M J;  3FIW A;  3Q0U A;  4FIS A;  3BQZ A;  2JJ7 A;  1JKP C;  1WH7 A;  2WAQ N;  3JRI A;  4C3H J;  4DZJ A;  3JRA A;  3HOV J;  1QVT A;  1JUM A;  1IC8 A;  2CUF A;  3WHB A;  5M5W J;  5HOD A;  2JA7 J;  4BBS J;  3FKI J;  5EF6 A;  1MH4 A;  5EG0 A;  4J19 A;  1HDD C;  3CDL A;  1ZGW A;  2GBY A;  1S7E A;  3GTO J;  4C3I J;  3JRF A;  1QRY A;  5FLV A;  2VPR A;  1RR7 A;  1B72 A;  5F0C A;  2W48 A;  1Y1V J;  3S1Q J;  1XC5 A;  2X48 A;  5FKO A;  2EBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...