4S0HB

Tbx5 db, nkx2.5 hd, anf dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
b'RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-box transcription factor TBX5
publication title Intermolecular Interactions of Cardiac Transcription Factors NKX2.5 and TBX5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 19
structure length 53
sequence length 53
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-12-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4s0hB00
3GTLJ 2FQ4A 2DA6A 1U8BA 2QF7A 2XB5A 1U78A 1RETA 1PUFA 4L5EA 3C2BA 5M5WJ 1YRNB 1K61A 1BJZA 2I10A 2JK3A 1MBJA 1CQTA 3GTJJ 1SFOJ 4IHWA 2EZHA 1MNMC 5JLXA 5F0FA 3UKGA 4W1UA 2N8GA 1GDTA 4W97A 4C3IJ 3GTKJ 4C3HJ 9ANTA 4LOCA 2XPVA 3G1MA 3ZOBA 1HDDC 3SJMA 1OFCX 3Q3SA 4XRMA 2ME6A 5IP9J 2M0CA 4X6AJ 1IDYA 2W48A 3LSRA 3A03A 2KT0A 2HYJA 1ZKGA 4DZJA 3GTQJ 1EF4A 1FTZA 5C3EJ 2EQRA 4IHVA 5IOZA 4XICA 1NK3P 4J19A 5EG0A 3RQIA 3I4NJ 3S2HJ 2Y31A 1IUFA 2E2JJ 2CJJA 3HEFA 5F08A 1BL0A 4A69C 1W0UA 2CUEA 1UHSA 4CYCA 1JJ8C 4DYCA 2LK2A 3B6CA 3LSGA 2EZLA 2PMZN 3M4OJ 1IRZA 1JKOC 2ME0A 3TEDA 3TW6A 1JTYA 2R5YA 3S1RJ 3BTJA 1JUSA 4MO7A 1IJWC 5FKNA 5JLWA 1APLC 5E3LA 1LE8B 1FIAA 1G2HA 1GV2A 1F43A 3FK6A 3JRIA 5J3LA 1FJLA 2LKXA 3JRAA 3HOXJ 1MBEA 2CQXA 3CCYA 4V2GA 4XK4A 1OJLA 3HKZN 2X6OA 1Y1WJ 2LP0A 1X2NA 3ZQCA 2HOSA 3IV5A 1E3OC 1ETQA 4MLOA 1ETKA 5J1UA 5FKOA 5M3FJ 2K9SA 5FJ8J 2M9HA 3HOWJ 3A02A 4RBOA 5J1RA 1RKTA 2JA7J 4A3MJ 2Y0SN 4I6ZA 5M5XJ 1HCRA 4M3DA 2QCOA 1QVTA 1U9OA 4A3DJ 1TWFJ 4MIMA 1MBHA 2O7OA 2FJ1A 3B6AA 1ZQ3P 1BW6A 3JRBA 1Z0XA 2EH3A 2XB0X 2NVXJ 4M3FA 4JX4A 3A01B 1JTXA 3S1QJ 4BBSJ 2HDDA 1S7EA 2DA2A 3O8HA 4BY1J 4BY7J 2R92J 2NOGA 2WB1N 2K9QA 3BR5A 2IAIA 2ECBA 3S16J 2HOAA 4D7NA 5E3NA 1X2MA 3BQZA 3VPRA 5E3MA 3SDGA 3NARA 4BXXJ 3QPLA 5C4XJ 4M3EA 4HNVA 3RZDJ 1OCTC 3ZQFA 1FIPA 2LR8A 2VPRA 4DW6A 4FCYA 1ZK8A 2JMWA 1B8IA 5F27A 2OF7A 3BR3A 3MKLA 2LY9A 2H1KA 1GV5A 1AU7A 2XGCA 1RR7A 2E19A 1JT0A 1B72B 1H89C 5C4JJ 1ORKA 2XPWA 5DS9A 1DU0A 2RAEA 3BTIA 4A3FJ 2CRGA 2WV1A 2EBIA 2DA4A 2LVSA 2P81A 2FX0A 1K83J 3HDDA 1IV6A 2AO9A 5EDNA 1ENHA 3H0GJ 5EGOA 2IBDA 3Q0VA 5K7FA 1R9TJ 2R0QC 5EEAA 3ZQGA 3QPSA 2GM4A 1FEXA 2TCTA 1X58A 1H88C 2H8RA 4M3GA 3HOUJ 1HOMA 3BR0A 1I6HJ 2DMTA 1QVUA 4D5FA 2R5ZB 1XC5A 1GT0C 1OCPA 2D5VA 5IYDJ 5IPAA 3DEWA 1TWHJ 3BG3A 1ETYA 2EZIA 2MW8A 1NK2P 2Y30A 5E3OA 2JJ7A 1ETXA 1ZR4A 1IGNA 1ETVA 3IH2A 2NVQJ 3E7LA 1RPWA 3BTLA 2HXIA 4A3LJ 3ZQIA 1I3QJ 3BTCA 3G1OA 5EYRA 4A3CJ 2VI6A 2L7MP 4D7MA 4UUSA 3HM5A 1WH5A 3IH3A 1D5YA 4X1EA 3K7AJ 3HGYA 1NTCA 4FE7A 2E2HJ 3OOUA 1AKHA 4QSHA 1PUFB 4NDLA 1LFBA 4M6VA 2AHQA 1MH3A 3S2DJ 3TP3A 3BR2A 4IHXA 1VF9A 1YRNA 2EZKA 2NS7A 1MH4A 2M34A 1TC3C 3Q0WA 2HQ5A 4A3JJ 2ID6A 5FKMA 1JT6A 5GP9A 2L7FP 3D1NI 2HXOA 2L9RA 5K7HA 2VKVA 3S1MJ 2GBYA 2CU7A 3JRDA 1WI3A 4MFEA 3BT9A 5M5YJ 1P7IA 2XPUA 2YUSA 3OSGA 1U9NA 5F04A 1JKQC 2JN6A 2LFBA 4C3JJ 5FKLA 2JA8J 3JR9A 5DTDA 4XRSA 3TW7A 3WHCA 1HLVA 1DU6A 3HOZJ 3MN2A 4B4CA 4JYKA 4JP0A 4JX6A 5IP7J 5EG0B 2ID3A 3GTGJ 1POGA 1O4XA 1UMQA 3L1PA 1ZR2A 4CYCB 4IEJA 5F0HA 3FKIJ 1TWAJ 1SANA 2NS8A 1AHDP 2IEKA 3GBGA 1H8AC 2ZB9A 1QRYA 3JREA 2Y9YA 4MFDA 3W6VA 5F0CA 2HOTA 1JKRC 3HOYJ 2L0KA 2R5YB 3HB9A 3DCFA 5IP6A 3SFIA 3JRGA 1MBFA 2TRTA 3CQZJ 1JKPC 3GTMJ 5HODA 4B1RA 1WPKA 1IG7A 1WGXA 4AUXA 3H3VK 1VI0A 2DTZA 4QIWN 1GUUA 1LE8A 3HGGA 4JX5A 1TWGJ 3Q0UA 1FTTA 2XRLA 3PO3J 1RKWA 1GVDA 3ZQHA 2JA6J 1WCMJ 3M3YJ 1T56A 1ZGWA 4DYQA 1ITYA 4D5CA 4BBRJ 2DA1A 3BQYA 4C2MJ 2LD5A 4Y7NJ 2X48A 4A3EJ 2O9LA 3ZQLA 3WHBA 5GPAA 1XG1A 5J1YA 5F1JA 2HI3A 1ETOA 5FLVA 4M3BA 3FK7A 2CQQA 3NAUA 2NVTJ 3FISA 3LNQA 1ETWA 4QTRA 1UG2A 3QQAA 1W0TA 3LSPA 1MBKA 3HOVJ 2KDZA 2MGQA 2YU9J 5EZHA 1VNDA 3BG9A 4FTHA 3I4MJ 2XSDC 1HF0A 2M2EA 3JRCA 2XGEA 2M8GX 2R93J 2Y2ZA 1RESA 3A01A 4XRSG 2L7ZA 1TWCJ 1VFCA 2X9DA 4UUTA 3S15J 1JUPA 1P7JA 3LOCA 5K7ZA 2DMQA 3OIOA 4IHYA 3GTOJ 1Y1VJ 1Z77A 3JRFA 1BW5A 5IYCJ 2MG4A 3RKQA 2DA5A 1QPIA 1B8IB 2CUFA 4DYRA 4ABZA 4DZPA 3G1LA 2LLKA 3OSFA 1T33A 3K2AA 4Y52J 4A93J 3GTPJ 1BA5A 2G0EA 4XIDA 2R7ZJ 1B72A 4B3AA 2VUMJ 3O8GA 1ZTRA 1MBGA 2LTPA 2DJNA 3F0CA 1JUMA 1LFUP 3S17J 5IYBJ 2DMPA 2MSYA 4A3IJ 4AYBN 3S14J 5EGOB 3JRHA 5C44J 3BR1A 4EEFG 1F36A 1MSEC 3PM1A 1IDZA 2O8KA 3LSJA 2DMNA 2COBA 3CDLA 2DA7A 1Q1VA 4A3GJ 4AC0A 2NVYJ 4S0HB 2R5ZA 4A3KJ 3CMYA 2E2IJ 1A6IA 3FIWA 1WH7A 3IH4A 4G12A 4GFBA 1MSFC 3HBLA 2DMUA 4A3BJ 4V2FA 3S1NJ 2OPTA 1A5JA 3TP0A 1JGGA 4FISA 2ELKA 2K40A 4I76A 5GPCA 2WAQN 3BR6A 5FLMJ 3MVPA 2DN0A 1IC8A 5EZGA 1XS9A 2GLOA 2DA3A 5FKKA 4UUSB 4RDUA 1JJ6C 4BKXA 5IOYA 2Y9ZA 2B63J 4FE4A 2JA5J 5BNGA 2YS9A 2FD5A 2E1OA 5M3MJ 5EF6A 3RZOJ 1HDPA 1AKHB 2K9NA 3BG5A 2JWTA 3PO2J 1I50J 2XGDA 2VKEA 2ECCA
chains in the Genus database with same CATH superfamily
1XX5A 3B02A 2FQ4A 4S05A 2R7OA 3NQOA 2PEXA 4L5EA 1S6LA 1WRJA 4I0BA 3C2BA 3EYIA 4XONA 1BJZA 2DT5A 4HF1A 2JK3A 1CQTA 3GTJJ 1MZBA 1XMAA 2OQRA 1SFOJ 4IHWA 3L7WA 4R79A 2AQFA 3A0BC 2M0MA 1STZA 2KRFA 3VEPA 4W1UA 1YOVB 2N8GA 2PJRB 2X6XA 2XPVA 3LSIA 3ZOBA 4OIOF 2ZO4A 3SJMA 3DKYA 5BQTA 4XRMA 1KYWA 2NNYA 1ZG5A 1IDYA 1FNNA 2OAZA 2BOLA 4IRIA 4L0YB 3MZHA 3H5RA 1FP2A 3JCUC 3E5UA 4OIRF 4RB0A 4BACA 1EF4A 3AFHA 1BJAA 1FTZA 1IZ1A 4IHVA 4Y17A 2OZUA 2CUJA 3OWTA 3IRRA 4KDPA 3M07A 1EH6A 4ZYEA 5EG0A 1PYVA 2ETHA 2HGCA 5FO5A 3FHZA 3S2HJ 1TZLA 2Y31A 4P9UA 2E2JJ 1LPQA 1DUXC 3KEOA 2GAUA 5ICFA 4IQJA 1UHSA 3WODF 1JJ8C 3KP6A 4CCLA 3F21A 2KISA 2OCCH 2LK2A 2HYFA 4Q5SF 1G59A 1Y56A 1YG2A 3TEDA 1JTYA 2EIKH 3JSPA 3N05A 4YELA 1APLC 2P5VA 4L18B 1FIAA 3HSRA 4G9YA 4OWRB 2JA2A 1OCRH 5J3LA 5H2FC 3JRAA 3JRIA 3EUAA 2HKOA 4QWQA 1R71A 1OJLA 1L3LA 3HKZN 5KAIC 1R58A 5E1ZB 1X4OA 2LP0A 1AA7A 5CVRA 3T0YA 5KVRA 5GADJ 4ON0A 3IV5A 1E3OC 1ETKA 3O3KA 5FKOA 3OY9A 3HC7A 2HR3A 2IW5A 3PNVA 2ZFUA 3HOWJ 1FZPB 2EFWA 1VQOI 2F6CA 2W1OA 1P6RA 3ZMSA 1MD0A 2XF5A 5M5XJ 1EJ9A 2IT0A 2F5FA 2QCOA 3BPVA 1U9OA 3OR2C 4A3DJ 2M4KA 2GOXB 1H9GA 3RJPA 3CCQI 3N4MA 1XSDA 3B6AA 1BW6A 3JRBA 4KITB 5HS7A 1Z0XA 1XDUA 2XB0X 5LRRA 3VDXA 2C6YA 3A01B 4ZDPA 4RGXA 2HDDA 5CQEA 2V6CA 3F6VA 4AYBA 3EPZA 3HRUA 2FBHA 5KHDA 3S16J 2RQPA 3M8EA 2CWEA 3F8MA 4D7NA 5E3NA 1YQAA 3LFUA 3CF5F 1J59A 3GFMA 3NARA 1UAAA 3PQKA 5C4XJ 2FNPA 2KJCA 4M6XA 3L9FA 3RZDJ 4IL6C 2A6EF 3H0DA 1SFEA 2KIQA 2OUMA 5F27A 3MKLA 4RGSA 3GYHX 1WHUA 1J0RA 4IXAA 5DUKA 1IO2A 3WE2A 1RRJA 1G3WA 1RR7A 2E19A 2XGCA 5HNHA 1H89C 1BI1A 4WF2A 1KQ8A 5C4JJ 1ORKA 1SVMA 5AIPA 3GX4X 3F6OA 4GCVA 4AWXB 1R4NB 2XAUA 3WTWC 1V54H 2LVSA 4BXUA 2D1VA 3J81K 1VQNI 3RYPA 3HYIA 4CCMA 1WSUA 5EDNA 4E7HA 3DEUA 1R23A 3HSEA 1IRXA 2O03A 2TDXA 1R9TJ 2R7XA 4LIVA 2ZMEC 3F8CA 1FEXA 3OYIA 2VQGA 3RPUA 4M3GA 1BIAA 3CDIA 2CW8A 2GXBA 3RDIA 1D0YA 1X3UA 4XNFA 1GT0C 4BNCA 2XDVA 4Y13A 2OC6A 4A0ZA 3I59A 2VKHA 2OQGA 3I9V2 4AU7A 3BLYA 2JJ7A 2PMHA 3KZZA 4UV9A 2X4HA 3S32A 3CCEI 1IGNA 4OIQF 2BXZA 1YW7A 3E7LA 4A2UA 1DPUA 3WU2C 4RB1A 3K69A 1TLHB 2W25A 2HXIA 2V9KA 3DV8A 4I09A 1FBQA 4PFPA 5EYRA 4A3CJ 3WTXC 3T1BA 3ZXSA 2K3PA 2QEXI 3DFGA 3OYNA 1KU2A 5J8FA 3MCZA 1FYMA 2DOFA 1J7KA 2E7XA 1RIOH 3HGYA 1F1ZA 3QPTA 1NTCA 4XLPF 3MD2A 4FE7A 3Q9SA 1B9NA 1IN4A 5FFZA 4E4HA 1DGRM 1Z1DA 3GFJA 2VOPA 4O5VA 4BHPA 3TP3A 2HQAA 1V4RA 3GF2A 3SFZA 2IP2A 5ILSA 3MKWB 1MH4A 3M1CA 2M34A 3DEEA 1IAWA 4E70A 2XASA 3K4KA 2XC7A 4A3JJ 2DOAA 4KIBA 5FKMA 2UXNA 5GP9A 2L7FP 3D1NI 2VXDA 4WXCA 3M7GA 3K1MA 5K7HA 2VKVA 2PJRA 4RAZA 4RGUA 4KIGA 5CVIA 3JRDA 2FE3A 3BT9A 1P7IA 2XPUA 3OSGA 1RZ4A 1U9NA 2JN6A 4L9NA 1U8RA 4BGDA 1W5TA 2W4SA 4Y15A 3KEQA 1ZREA 2ESNA 2L9SA 5LBQA 1EKEA 3WHCA 2V1XA 3D5SC 1DU6A 4CGZA 3HOZJ 5JVGF 4JYKA 2CG4A 1XN7A 4CCJA 4JP0A 2LF7A 3CC7I 2NRAC 3I4PA 3C3WA 3G73A 2CGPA 4AM3A 2Z1DA 2MBFA 4EM0B 1UMQA 4HQEA 2ZKZA 3F23A 3L1PA 1ZR2A 4IEJA 2DT7B 5F0HA 1K78B 1PP7U 3DU5A 1TWAJ 5DD8A 2NS8A 3GBGA 1H8AC 2ZB9A 2EK5A 1X19A 2KZGA 4MFDA 2FOWA 4C2UA 3HB9A 2HQRA 2KPMA 3HSFA 4J01A 3WTZA 1JHFA 2IS2A 4UVAA 1ZAOA 4HPQA 4M6YA 3J81Z 4IHSA 1JKPC 3QPHA 2YX7A 4E7SA 3GTMJ 4IQ4A 2A5YB 1WGXA 2HZDA 4QIWN 2DTZA 1ON1A 1J9IA 1TWGJ 4B44A 5DUIA 1WKMA 1FTTA 2DO7A 1SAUA 2DFEA 5F64A 3R6SA 1RKWA 3SYTA 4UNOA 3MKZA 1OR7C 2QZ8A 4FHTA 1IXSB 2XAGA 1Y39A 3RQ4A 4OIPF 2DA1A 3BQYA 3HPHA 1FSHA 3QAHA 4UV8A 4A3EJ 2O9LA 2VONA 3ZQLA 5GPAA 4FX4A 1XG1A 4XR6A 5FLVA 5HDNA 2IA2A 4U0WA 4A12A 2CQQA 5ERIA 4IF4A 4BAYA 2YPRA 4I0AA 2E5ZA 5HS8A 3DTEA 3QQAA 3E97A 3LSPA 2GXAA 3FMSA 1MBKA 1FOKA 3RKWA 2JT1A 4ETSA 2BHZA 3WE3A 2DDAA 5TGTA 4FTHA 2XSDC 1HF0A 2QKMB 3OL4A 4L0ZB 2M2EA 1D8KA 4HSRA 4EGZA 1S9HA 2P6SA 5J6XA 1RESA 3A01A 3SQNA 4XRSG 4N0BA 4PJNA 4CUGA 1ULYA 3L00A 4WK8F 2X9DA 2PQ8A 2ZC2A 4UUTA 5BS6A 1E3HA 2FXAA 2M7BA 4HSTA 2RN7A 2W82A 3LA3A 1ACIA 4RMNA 1A36A 1FY7A 5E17F 2DYRH 2CUFA 5GAEJ 4YIFA 5J47A 2XF6A 2K86A 4DZPA 5KNLA 4G7HF 5E1XA 4HF2A 1D3YA 1P9QC 2CO5A 2R7DA 1IRGA 1I1GA 5HNFA 4A93J 3C1DA 4ZYHA 1ZG1A 1ZLKA 5L3DA 1OQYA 4ZJZA 4U0YA 3CUQB 4HDVA 4PGHA 1BA5A 3L2RA 2R7ZJ 5IT9K 2ZMEA 2H8WA 3O8GA 5CVJA 3F0CA 4FASD 1LFUP 3MAJA 3TKYA 1BC7C 3BZCA 2HPIA 5IYBJ 1ONVA 2M7AA 3CCJI 2DK5A 3D5RC 1KU9A 4LJZF 5EGOB 2QQ8A 4IRHA 1MMDA 2E5NA 2CS3A 5C44J 3BR1A 3BZKA 3MQ0A 3W6KB 4ZH4F 2NOJB 4HZFA 4G7ZF 3BCAA 1MSEC 3GZ5A 4NC6A 3V7CA 2KLOA 1VQMI 2QGUA 1ZRDA 3CUQC 1D1CA 1N78A 1FPQA 3CDLA 4ZZDA 1SMYF 4GGGA 2O61A 1Q1VA 2UZKA 1V55H 2EA2A 4A3GJ 4IKFA 3OYEA 4S0HB 6PAXA 1LVKA 1TNTA 4D9JA 4PZJA 2E2IJ 1X3WB 3ECOA 3IH4A 4G12A 2D2WA 3CC2I 4DOZA 1QHHD 4C9YA 2ACJA 1A5JA 1JGGA 3PSFA 2HTSA 4FISA 1XMXA 2G7HA 5FLMJ 3BR6A 4UVBA 1P4AA 3QOEA 3TL4X 3MVPA 4ESFA 1YJ9I 2V4JC 2VJ4A 2M8EA 4RAGA 2VXZA 1Q1HA 3OIPA 5IOYA 3OYCA 2Y9ZA 3MMYB 3ZCOA 1GXQA 2OJED 3ZP5A 1YLFA 5BNGA 2YS9A 1ZARA 2DDBA 1MW7A 2FD5A 2AXTC 3RZOJ 1X1CA 1AKHB 4F52A 2HWVA 2JWTA 1T8IA 3PO2J 2JPCA 2ECCA 4Y33A 3OYJA 1HOMA 2GWRA 1FWZA 2QF7A 3E6BA 2QUFA 2Z9OA 4HBLA 4U88A 1TQPA 2I10A 1MBJA 1T95A 2ADUA 2GIVA 5F1RA 1HA8A 3EQLF 3G71I 2EZHA 3CCRI 1CGPA 4EVIA 1BC8C 3T8RA 3UKGA 2NNNA 1SFUA 4BUPA 4W97A 3GTKJ 4XQFA 9ANTA 2PLYA 1HDDC 1OFCX 3CUOA 2LYCA 3GLLA 5LEJA 4X6AJ 2EFQA 1PDNC 1TW3A 3U1DA 4AVZA 1K7AA 2DU9A 3LSMA 1QHGA 3S8PA 3V4GA 2HVRA 3H3ZA 3GTQJ 3S93A 4HF0A 2XGXA 3FXQA 4CCKA 5LRSA 2KJBA 3I4NJ 1R1UA 3VYRB 2KMUA 2FMYA 1IUFA 3ELKA 3H9JA 3VB2A 3AAFA 4IO9F 1K78A 4DNCA 5A2QK 4C2TA 3GO5A 2ZCWA 2HZTA 2VJJA 5CJ9A 2PX9A 5IT9Z 3P7NA 5LFAA 1KGSA 2ZXIA 3M4OJ 2VIXA 1ZG3A 1OR7A 2UV1A 3S1RJ 2MLGA 1JUSA 4MO7A 5FKNA 3DLAA 2DFFA 1G2HA 4IOAF 1Y0UA 2DXIA 3LAPA 2MFZA 2GOMA 3FXOA 3CLQA 4JQFA 1VQ7I 3CCYA 4IPAA 5E18F 3FBNB 4Y4RA 2WTEA 1X1DA 2F5DA 4UB8C 2L7KA 1OCZH 4GRIA 4MLOA 4CH7A 3CJTB 1TP4A 1FT9A 3W2AA 1NG6A 2K9SA 1UG0A 5M3FJ 3WGHA 2K5CA 1J75A 1V3FA 2KFDA 3KYCB 2A6TA 2EWNA 4RBOA 4U87A 2R7UA 4ZYDA 2W00A 3HTSB 2DCEA 1SFXA 1GVJA 2OV7A 3OIQA 2Y0SN 1HCRA 3C7JA 3V8JA 4HLYA 2UWMA 4GO1A 4XSXF 4FT8A 1ZRCA 3BROA 1E17A 1XGSA 2EH3A 3KP2A 4M3FA 2LY1A 4A5MA 1QO0D 4CO8A 3M8FA 5H20A 3HXLA 4BY1J 2R92J 1Y8QB 2KQRA 4BY7J 2NVUB 1RUNA 2NOGA 4IOCF 4A5NA 2A3SA 4FETA 4HX8A 1BR1A 2HOAA 3BQZA 2HDWA 2R7RA 3FM3A 1QNTA 2VQLA 1UHWA 4BL0B 3ZQFA 4FCYA 3E6CC 3S3OA 1MNDA 3ABTA 4OOIA 2BXYA 2HTJA 2H1KA 2IGOA 5E79C 1GV5A 1VQ8I 1ZLJA 2WY7Q 2BBYA 3ZQQA 2XPWA 4UVCA 2HPMA 3K70D 4GDFA 3CUQA 1TW2A 4XLHA 2KDOA 2RAEA 3CZ6A 4E7ZA 1LFPA 3CC4I 2EBIA 1C0WA 3GZNB 2DA4A 1I1SA 2MABA 2YSRA 3HDDA 1IV6A 4F92B 3FKJA 2L02A 1HKSA 2MC4A 5KK1A 5EGOA 2ELHA 2IBDA 2DPDA 1JHHA 1NHAA 3Q0VA 3RSNA 2L4MA 3MWMA 3OOPA 3CDHA 3TO9A 3HRSA 2TCTA 2ZNZA 1H88C 2BE5F 3BR0A 3LFKA 2ICWG 1BIBA 2DOEA 4D5FA 2CYYA 1XC5A 5GAGJ 2K85A 5KCMA 1DPRA 2R5ZB 1A6QA 1LDDA 5IPAA 3DEWA 1TWHJ 2FBIA 2H09A 4GYGA 3VYSB 5A2QZ 4HV6A 4EJVA 1K6YA 2MW8A 3HTUA 2EFPA 4AIDA 2B0LA 2M45A 2XAJA 3HHHA 4UY8I 5K5QA 2DI3A 3D0SA 3JAMK 1YO5C 1RPWA 2XHKA 2LREA 4A3LJ 3ZQIA 2RV8A 3A0HC 1BM9A 1WJ5A 3JTHA 2CSOA 3BC8A 2O0YA 4I02A 1MDMB 1WH5A 2DK8A 1D5YA 1VQPI 4X1EA 1VQLI 3TOBA 2Z16A 2M87A 4AIHA 5JHFA 5DYMA 3ERMA 2WC2A 3TBIA 3OOUA 1AKHA 2O6GE 1PUFB 1FOXA 3PFIA 3W6JB 2R7WA 3GXOA 3ABMH 2FF4A 4HX4A 3ZGKA 4M6VA 3TOAA 2VT3A 1LB2A 1MH3A 3IHUA 3DPTA 4LLLA 2EZKA 3CJRB 1HKTA 3G4SI 1TC3C 2R3SA 3BZ6A 4OU0A 2HQ5A 4C30A 1MKMA 1Z91A 2K27A 3GW2A 2L9RA 4KN7X 1VQ6I 2CU7A 2GXGA 2W24A 5GTIC 1YX3A 1B4AA 2UXXA 3V42A 5F04A 4GXOA 1HW2A 1HW1A 5FKLA 4C3JJ 2JA8J 2W57A 1QZZA 4N9IA 3TW7A 4XRSA 2V6EA 1SEUA 4B09A 4BQQA 4JX6A 3SEZA 2F4IA 2ID3A 4DBRA 3RKYA 1S8NA 2EFNA 5LGNA 1MGTA 5AONA 1KQ9A 1ZN2A 4I7HA 2Z33A 4ENMA 2RQQA 1SMTA 3HHGA 2OD5A 1AOYA 2IEKA 3VWBA 1FMWA 4YEJA 3U9GA 2CV0A 5F0CA 2HOTA 2L0KA 2M3AA 2WWYA 1SD4A 3LL7A 1R22A 1S72I 2F48A 2QKLB 4LLGF 3KLOA 3JRGA 3LSTA 2TRTA 3HOSA 5HODA 3KIOA 3KLNA 4AUXA 1VI0A 1GUUA 4LG3A 5FROA 4KUMA 4ZDOA 2FRHA 2VOOA 1N75A 3ZPLA 4G6QA 2A61A 1GVDA 3C18A 2FOKA 4U7DA 2O8XA 1ZGWA 3G3ZA 2MC3A 3V8KA 5EJCA 3OYMA 2WB1A 3KP7A 2WAEA 4DBQA 1OCOH 1SD5A 1D5VA 4MQVA 1W7PB 3S3NA 5J1YA 2HI3A 3E1SA 3CMAI 4XM3A 1ETWA 3MKYB 3JAMZ 4QTRA 2L9VA 1UG2A 2BZTA 5TISC 5K5RA 5D4SA 2KP6A 1W0TA 1LEBA 3F72A 4XL9A 3AL0B 2KL4A 3HOVJ 5DM7F 5GTHC 3AG3H 2XUBA 4LGWA 1ZRFA 2XGEA 3N97A 2M8GX 1YS7A 3OS0A 4P5OA 1A04A 4UXNA 2EIMH 2F4OB 3LMMA 1S3JA 1IRFA 1FSEA 1JUPA 5K5OA 1TNSA 2E1MB 2F4MB 3GFLA 3LOCA 4DJAA 1KQ0A 3BJAA 5K7ZA 1FYLA 1AWCA 4RAYA 3ECHA 3ONQA 3SHFA 2JUCA 1QPIA 3SDBA 4Q4ZF 3H3UA 4ABZA 4BE1A 2VE8A 3G1LA 2LLKA 2P8TA 1R36A 5DDGA 2VLAA 3OSFA 1K79A 3CLOA 1U5TB 3KFWX 2VPLA 3K2AA 5DCFA 2CW7A 2VE9A 3A2KA 5EEHA 4Y52J 3NRVA 1UB9A 1YTYA 3PNTA 3BJOA 3CCMI 4ZTFA 1N25A 1I3AA 2Q2EB 5D8LB 3I53A 4M9SA 1ZTRA 1MBGA 2V79A 2LTPA 4PSWA 2DJNA 3TMOA 3ZQ7A 1E3PA 1JUMA 3HRTA 3VFZA 2IS1A 3S17J 2Y48A 1XPXA 3QYBA 3VSLA 4XKBA 2MSYA 3H9QA 4AYBN 1YW9A 3NWSA 3ABUA 2RNGA 1F36A 2K9MA 1YX5A 2EJRA 2IGKA 5KAFC 3VYTB 4B8XA 2MH9A 3Q9VA 1YJWI 4BU2A 2QSHX 1R00A 4M73A 2DA7A 2CFXA 4CXFA 2BW3B 4IZZA 2R5ZA 1OMIA 3H92A 1Z05A 4F93B 3CMYA 1A6IA 2HVSA 4GFBA 3HBLA 2EV0A 4V19K 4V2FA 4CDGA 2R4GA 2GQQA 2OPTA 3GCMA 2JTVA 1UHMA 2K40A 3F3XA 1F4KA 1IC8A 1ZYRF 3KYLA 1XS9A 3FZVA 2GLOA 4UUSB 4RDUA 1O3RA 1MJ9A 3RPUD 1TTYA 2CQ7A 1MDMA 4H4KC 5D6EA 2R7SA 4XKCA 2BVLA 2E1OA 2VC0A 3L2CA 3K2ZA 4OAZA 4EJUA 5D5UB 1NH3A 5BOXA 1LUJB 3ISPA 4PUSA 2P6TA 4RLQA 3GTLJ 3DF8A 2DA6A 1U8BA 3KZIC 3O6BB 1PUFA 1T0FA 2BY0A 1G3YA 4Z2YA 1QZEA 4NC7A 1ZH5A 1UELB 4LB6B 4AVPA 2K7LA 3DBRB 1P4WA 4FX0A 2XIGA 1BI2A 1LVAA 4UUVA 3I71A 1MNMC 2ZXWH 5TRDA 3AG4H 4MHGA 1S7OA 4C3IJ 4C3HJ 2FNAA 3X2QH 3FBIB 4PJJA 3BPXA 3FM5A 2CV1A 3OYDA 3Q3SA 2ME6A 4BXFA 2BY1A 5IP9J 2M0CA 2OU2A 2R7TA 5L3BA 4ZDLA 1GHCA 3K4BA 4RB3C 1ZKGA 3TO6A 2XKOA 3VOEA 2E1CA 1DGWY 4DZJA 3BWGA 3ERED 4QPOA 5C3EJ 2EQRA 1S29A 1NK3P 1SVOA 4NUBA 3R60A 2ZJ2A 3RYRA 3EUHC 4WX9A 3RQIA 4DQ2A 2W84A 4MEYF 1BOAA 2NYXA 4RS8A 3QYEA 3WG7H 1TL8A 2BGCA 3KYDB 2QBYB 3BOQA 2Z2SB 2P0WA 2P7CB 3F22A 3OYGA 3HUGB 4DYCA 4P55A 3ABKH 3BG6A 4I2OA 3A4CA 3LSGA 1HC8A 3CCUI 2MYSA 2JZYA 2X6WA 3TW6A 4EJWA 1B9MA 1TQMA 1FLIA 1IN5A 1LDJA 3U21A 5JLWA 3FX3A 1IJWC 2MD5A 1SVLA 4RM2A 3U1KA 5LGTA 4AIJA 5B3SH 2E7WA 2ZNYA 3CP8A 3HOXJ 1MBEA 4MEXF 4RA2A 3E0JB 5E20A 4V2GA 3W2WA 1SC7A 3PQJA 1X2NA 2DYSH 3CMEI 4O6JA 1MMGA 2HS5A 5FD5A 3CMMA 1PP8F 3HG9A 2COMA 2UUZA 5GAHJ 3FXLA 4XBFA 4A6DA 2Y0MA 1XCBA 2DPUA 4XKVA 2JPBA 1I39A 1W7PA 1RKTA 2JVHA 2XAHA 2EFOA 4LIUA 1ZGJA 2JA7J 4NNJA 4WXHA 1XGMA 3S2WA 2ISYA 4BJ5C 4HRIA 4XLFA 3K9TA 3IUOA 1IF1A 1QVTA 2QQAA 2VASA 4XLNF 1TWFJ 4MIMA 4M9ZA 2IXSA 2O7OA 2BY2A 3H36A 3IRQA 1ZQ3P 3LWFA 1KYZA 2VKDA 3ROUA 2NXNB 5E8GA 3IAM2 1WZ2A 4JX4A 2KIUA 3WTVC 1JTXA 3RPQA 1T2KA 2AS5F 3P9CA 3O8HA 1KA8A 1MMNA 3GZ6A 2K9QA 3BR5A 2ECBA 1Z6TA 2MLKA 1Y0NA 3OS1A 3BG7A 4MQ9F 1IXRC 3SDGA 4BH9A 4BXXJ 4M3EA 2X85A 4HNVA 5LHGA 1O3SA 2DQRA 1V5GA 3IL2A 4HQMA 2LR8A 1K6OA 4MTEA 1ZK8A 4NBQA 3SZTA 2OF7A 1VQ5I 2LY9A 3H1CA 4KISA 1R5HA 5D4RA 1AU7A 1U5TA 3F9KA 1OKRA 1H9TA 4LB5A 3DKWA 1IXCA 2F2EA 1X1PA 3KCCA 1J5YA 1R6RA 2CFOA 4UHTA 1X1AA 1DU0A 1O7LA 4E7LA 2R7QA 3BTIA 2HEOA 2LDUA 2Q2EA 3AKZA 2WAQA 3F8FA 2FX0A 2DBBA 1K83J 5L3FA 1HSJA 5TJJA 2AO9A 3VYUB 4HEA2 3H0GJ 4XRFA 4N4OB 5HLGA 4EM2A 4F55A 2E1NA 2R0QC 3WTSC 3E6DA 3I5UA 3M8JA 3QU6A 3QWLA 2R7FA 2H8RA 5F6FA 3PIPF 3WG9A 5HLIA 3WU1B 4LK0F 1X1BA 1OCPA 3OMYA 3BG3A 5ICGA 2LOOA 2BW3A 4NHJA 4RB2C 1KONA 4HOBA 5CQGA 1OLTA 1G3SA 1ETXA 4EMSA 4NB5A 1ETVA 4CYDA 3E5QA 5DEQA 3IH2A 4KA4A 2VBWA 2X51A 4BDZA 1REPC 2BEOA 3DTIA 2DT6A 2ELJA 2VBZA 2DW4A 1VQ4I 3EYYA 2IGMA 1U0JA 1I3QJ 3BTCA 1UZCA 4D7MA 1TBXA 3ZMVA 4UUSA 3L2QA 2Z5UA 5LLQA 2PBIA 3FF5A 1RNLA 1WVRA 2K02A 5JFRA 3F8NA 2RKHA 2OTLI 2HOEA 2PFBA 4YIIA 2F5CA 2L3DA 3B73A 4XN3A 3L2UA 4XN0A 2E2HJ 4IRGA 1I5ZA 4BJ6C 5K1YA 4EATA 4NDLA 2VBYA 4BHBA 2I5UA 3LQRA 2IA0A 2YR2A 2AHQA 4XOPA 2F5VA 3BR2A 3RKXA 2LNBA 1VF9A 1D1AA 2VQCA 2J5PA 1TQIA 1VQ9I 3V7SA 1CF7B 2KRHA 5CYVA 3DU6A 3TGNA 5E8IA 3WU0A 5B66C 3SEQA 3ZR8X 1R5GA 5HDGA 2KIFA 2RDPA 3ZMDA 3S1MJ 1Y8RB 2GBYA 3EUHA 4E7JA 4A6EA 4MFEA 3OYHA 2LRDA 1YE9A 3I58A 1YIJI 1T39A 1TT5B 4EJTA 3DBHB 3EUKL 5DTDA 1MIJA 1TT0A 4XLEA 3HKZA 5AIQA 3VSKA 2A07F 3W3CA 2RGVA 2NS0A 2JVGA 5IP7J 2X0LA 3GTGJ 4BDYA 2VJ5A 4EJOA 2DQLA 5JHUA 4CYCB 1JGSA 1SANA 2RC4A 1QRYA 2QBYA 2Y9YA 3W6VA 2LY2A 4KN4X 3HUGA 2R5YB 3EETA 3CO6C 3KX2A 4Q48A 1VQKI 1R49A 4CHUA 5IP6A 5H6RA 4BE0A 2L9NA 3IKTA 3MZYA 3FHNA 2B9SA 3IC7A 2EA4A 2M5WA 2E71A 3HGGA 4JX5A 4WCGA 5DV5A 2DJIA 3Q0UA 1GXPA 5L3EA 4MTDA 1SD6A 2WAFA 2CUZA 1ZELA 2IS4A 3LA7A 3DPUA 1WCMJ 1T56A 5DCMB 4DYQA 1Z9CA 4U0VA 5FB2A 1OISA 3FXKA 1IN6A 2VB6A 2IA1A 4D5CA 4BBRJ 2Q0OA 4BQNA 3EDPA 2LD5A 1G6NA 3OL3A 4N4NB 4Y7NJ 2Y69H 5FRMA 2H94A 2WY8Q 5D5VB 2K9LA 2BY3A 4L5IA 3WHBA 5F1JA 3J7AO 1O3TA 3FXMA 3NAUA 3GUDA 3RTRA 5IY5H 5JI6A 3LNQA 1XMKA 4KT6A 2MA3A 4O3MA 1J09A 4KYWA 2QM3A 3PNYA 4CZZA 2LKSA 1T08B 1YW8A 2KDZA 1W5CC 2A69F 2MGQA 2RVCA 2M4GA 1BOBA 3I4MJ 3PUBA 1XTAA 3JRCA 3GFIA 2X6YA 3HOTA 4PSXA 1U3EM 2JQ7A 5LEKA 2B7EA 2XAFA 4HV5A 2HYGD 2L7ZA 4RM3A 1TWCJ 1VFCA 3CP2A 4G8XA 2J5OA 2HNHA 4BYYA 2R7VA 1IUYA 2ZSHB 1P7JA 3OIOA 3GTOJ 1Y1VJ 1Z77A 3ABLH 4ITVA 3JRFA 3LA2A 3DP7A 1FMVA 1JI8A 2MG4A 3CJNA 1KZHA 3OYAA 2LKPA 4RLFA 4XOTA 1B8IB 5EEGA 3OS2A 3FWEA 3ZRGA 2XF7A 1W4MA 1R5ID 3TDUC 5DM6F 3H5NA 1T33A 2LMDA 3RI4A 2ZJPF 2L54A 1A31A 1WJAA 3K4CA 5CPRB 4ZC3A 3GTPJ 3ESWB 1R4MB 4B3AA 4FQGA 2L01A 3G6EI 2VUMJ 4HW0A 1B1BA 4KNYA 2PG4A 2WADA 5BPIA 2L2OA 3KPHA 1A35A 3HL2A 3AG1H 1QU3A 4A3IJ 1NG7A 3S14J 2HQNA 1J2XA 2PMZA 2X1CA 3FXUA 4PK4A 1O3QA 4G7OF 1T0FC 4BJTA 3QYFA 2OA4A 2Z99A 1YIOA 2DODA 5ILVA 4NC8A 3NEUA 1V5EA 3J7YJ 1YFHA 3LSJA 1UJ8A 1XDSA 2DMNA 3RCOA 4X0GA 3M9AA 3LAJA 4HDUA 2COBA 3CD6I 1QPMA 1JXSA 3HJEA 4G94A 4XMYA 2QSGX 4GYIA 4AC0A 1FP1D 2NVYJ 2I8DA 1FOWA 4CA0A 2FSWA 4A3KJ 3OYKA 2ZXJA 1WH7A 4YIRX 4MGRA 2BVMA 3IWFA 1MSFC 4ESBA 2DMUA 2QENA 3COAC 4BQAA 4A3BJ 2EV6A 1WJEA 3K0LA 4EGYA 4IHTA 3LQQA 3TP0A 4HYEA 2ELKA 2H6BA 4I76A 1N77A 2FA5A 3MZ8A 2V1NA 2VODA 2XV4S 5EZGA 3DXJF 3FDYA 2DA3A 1D1BA 4BHCA 2B63J 4B3XA 4FE4A 1BR4A 3KEYA 5CKTA 1JE8A 3GWZA 4ESJA 1YS6A 2GZWA 2CV2A 5B5EC 1HDPA 3GVAA 2XSJC 1HW5A 5ICEA 1HKQA 2XGDA 1QA6A 1U78A 2OCEA 2XB5A 1RETA 2EIJH 1USSA 3QODA 3G2BA 5M5WJ 1ON2A 1YRNB 1K61A 5CVUA 4CCNA 4HX7A 1K4SA 1WFXA 2ZMEB 1VZ0A 4BEHB 5IT3A 1BBYA 2A5WA 2ZJQF 2L5QA 2XKPA 4K2EA 5FLXK 5JLXA 5F0FA 1XSXA 1Y6IA 1WI9A 4ZTJA 2IPQX 4L9JA 1XGOA 1CF7A 1GDTA 3IWZA 4PGGA 5J4VA 4LITA 4LOCA 3LSHA 3G1MA 2HFHA 3I3LA 4A0XA 1I6XA 3I56I 5LHHA 4Y3OA 4ASNA 4HA8A 2E36A 2W48A 1HXDA 4PJMA 3U2RA 2V1DA 3LSRA 3A03A 4OMYA 3SZGA 1MMSA 4LLNA 2KT0A 2IJLA 2P5KA 2HYJA 4LMYA 1FBSA 1E2XA 1BI3A 2K4BA 5L3GA 4YRVA 3JSOA 2QQ9A 2WA0A 5IOZA 4XICA 4ENKA 4J19A 3CCVI 4R8HA 3ASOH 3LSKA 3KETA 2CJJA 1GLNA 3HEFA 1W5SA 5F08A 1BL0A 2H27A 2QA4I 4A69C 1W0UA 2CUEA 1Z67A 4PCQA 4OAYA 2OTJI 1X3ZB 4CYCA 3AL0C 1WJBA 4L9VA 3A1YA 4CCOA 1DDNA 4PJLA 5LHIA 3K4MA 2PN6A 3JW4A 1W36C 3B6CA 1YYVA 2EZLA 4Q47A 2PMZN 1IRZA 4H0EA 1JKOC 2ME0A 1B59A 1MJBA 2R5YA 2JRMA 3BTJA 2O5RA 3FXJA 4I99C 4E7KA 1EA3A 5E3LA 1LE8B 2KKOA 1GV2A 1BN5A 3FK6A 1YI2I 1FJLA 1F43A 2LKXA 2E1MC 2PJPA 1HSTA 2CQXA 2X1EA 4XK4A 4YFKF 2CH0A 2X6OA 2BV6A 1Y1WJ 4LG0B 1QGPA 5ICCA 2HDCA 4L9TA 3ZQCA 2HOSA 3DPLC 1ETQA 1D0XA 1T38A 3AG2H 5J1UA 3KP5A 1U5TC 5FJ8J 2M9HA 5DCMA 1G8XA 4OINF 3ZMTA 3PIOF 2PI0A 4WXDA 3QU3A 2P5LC 3A02A 4S04A 2A6HF 3MEXA 5J1RA 1Z3YA 3UNGC 3I64A 2DFHA 2K4JA 4KMFA 2A68F 4KFCA 4E6KG 4A3MJ 4I6ZA 2RREA 5FFXA 3PUFA 4M3DA 3KP4A 1S7AA 5HOOA 5D8KB 4JK1X 1MBHA 3R4KA 2XRNA 1ODDA 2E34A 2FJ1A 2M30A 2Q1ZB 2QVOA 5B1AH 3QP6A 3SXYA 2VJIA 3O2PE 2NVXJ 2EV5A 4IVNA 2OZ6A 2IRFG 4XORA 3S1QJ 4BBSJ 5J4YA 2BYVE 1S7EA 2DA2A 4M72A 1T6SA 3GEZA 1PVEA 2WB1N 3WGGA 5HLTA 2IAIA 4IX7A 5HDKA 2F5EA 5H6QA 1X2MA 3VPRA 1W1WE 5E3MA 2LBFB 4EQQA 3QPLA 4WWCA 2DFIA 5L3CA 1P4XA 3KP3A 2M1BA 3WGIA 1OCTC 1FIPA 2VPRA 2VL8A 4DW6A 3CCSI 5BPDA 4CZCA 1X4PA 2JMWA 2Y75A 5FD6A 1B8IA 1P92A 3BR3A 3K70C 2YU3A 5FLXZ 2VBXA 2IVMA 4EV0A 2QLZA 1JT0A 1OCCH 1XCVA 1MJAA 3K6GA 1B72B 1WWXA 5DS9A 1RUOA 5D5XB 4A3FJ 3DQVC 2CRGA 2WV1A 4HNUA 3ASNH 2P81A 2QSFX 2ZXHA 1Z6RA 2D1HA 3DTKA 1Z3XA 1ENHA 1BI0A 5K7FA 1HQCA 1L0OC 1FBUA 3NWTA 4B48A 4DGWB 2YX4A 3ZQGA 5EEAA 3QPSA 2GM4A 3IP4B 1X58A 3K4LA 4I98B 3HOUJ 3R61A 1IN8A 1P2FA 2EPFA 1I6HJ 2DMTA 3DKXA 1QVUA 1SAXA 4NQWB 3HIFA 2V7FA 2D5VA 5IYDJ 4KJZA 4G6TB 4U7BA 1MMAA 1ETYA 3I55I 2CW0F 2EZIA 3P9IA 1D8JA 1NK2P 2Y30A 5E3OA 3C2HA 5BMZA 2LH9A 2AQEA 4KIFA 1ZR4A 2ZFWA 1F9NA 2NVQJ 4XKWA 5HVQC 1R1TA 3BTLA 5FRNA 2ESHA 1QQIA 1O7FA 4LD5A 3UR3C 2W7NA 3G1OA 2VI6A 2L7MP 1XSVA 1USTA 2ZJRF 3HM5A 3IH3A 4KICA 4A0YA 1R1VA 4IJAA 3K7AJ 1KU3A 2G9WA 2FEZA 2P7VB 3HPGA 2FQ3A 4B43A 1UFMA 2WBMA 4QSHA 3DBLB 4RAFA 1LQ1A 1PUEE 3TQNA 3OYFA 4XLCA 4P96A 1EH7A 3KZYA 1LFBA 2KIMA 4G6DA 4YFXF 3OYBA 2HVQA 3S2DJ 2QWWA 4IHXA 1M1EB 3K10A 4HG2A 1WQ2A 2V9PA 2NS7A 3BDDA 1YRNA 1KU7A 1S5LC 3J80K 2HU9A 3Q0WA 4BEHA 1YITI 3ULQB 4AIKA 2ID6A 4PFOA 1JT6A 1EH8A 2G7UA 1V5FA 3GLXA 4PDKA 2MD0A 3IKVA 5FGMA 2HXOA 2QYOA 1Z7UA 1XD7A 4RGRA 2KHMA 2WV0A 5LGUA 3J7ZI 2VQHA 4ZYGA 1WI3A 2LSOA 5M5YJ 4ENNA 2YUSA 2BHYA 1O57A 1PJRA 3WTUC 1JKQC 2HKXA 3Q5FA 3L09A 3SZPA 1IV8A 2LFBA 4EM1A 4UB6C 4BE2A 3JR9A 1LJ9A 2AXLA 4R1HA 1HLVA 1EV7A 3IAS2 3MN2A 4B4CA 3OYLA 5B1BH 1DP7P 3BY6A 3T8TA 2VN2A 5EG0B 3ZMZA 1POGA 1ZGAA 5E1WA 3REOA 4HNTA 2MH2A 3CJQB 1LEAA 3V7RA 1G3TA 1RR8C 1O4XA 3M1EA 1U6GA 2LF8A 4OMZA 3FKIJ 4JOMA 1OYYA 1AHDP 2FUG2 4AD9A 1HBXG 3TDZC 2VC1A 3PSIA 3JREA 2D45A 2FU4A 4QPQA 2GA1A 2VT2A 2X1DA 2JRTA 4BS9A 1YHQI 1JKRC 2GIZA 3HOYJ 3V8LA 4YFNF 3DCFA 2KRCA 1Z21A 3SFIA 2Y0SA 3BCBA 2JSPA 1MBFA 3CF2A 3L2VA 4F3QA 2FMLA 1VTNC 1LKXA 3CQZJ 3KE2A 5HS9A 3OR1C 1QZYA 4B1RA 1WPKA 3MFKA 1BR2A 5JR3A 1FOYA 1IG7A 1LE8A 3H3VK 3D5LA 4ZZLA 3H9GA 2P4WA 3RIRA 1QBJA 3ZN1A 1E0EA 2XRLA 2A05A 2H1LA 3GMEA 3PFYA 4HLXA 3PO3J 3R0AA 3ZQHA 4LG0A 4JBAA 2JA6J 1ERDA 3WTYC 3M3YJ 2RNJA 2KZVA 4YG2F 1FX7A 2E60A 1ITYA 4C2MJ 3ML6A 1XB4A 2O3FA 4II2A 5ED4A 2V9VA 3E3VA 2X48A 3HZJA 4QLCU 2V1UA 3DLLF 4ZYAA 2IGNA 2W85A 4ENJA 3K1PA 3OV8A 1ETOA 1OYIA 2EB7A 4M3BA 3FK7A 1SD7A 2NVTJ 3FISA 4XSZF 2STTA 1G4DA 1WJFA 2EILH 5DD4A 2E35A 3CESA 2XROA 3J7AY 2YU9J 5EZHA 1VNDA 3BG9A 2EINH 2PMUA 5HLHA 2STWA 3TO7A 4BQOA 2ZBKA 3F8BA 1YJNI 1OYWA 3E6MA 2JUGA 2R93J 2DTRA 1LNWA 2Y2ZA 3PJRA 2LC2A 2ISZA 4M9XA 3VODA 1R7JA 2K3FA 2IS6A 5J8CA 1DP3A 1T98A 3S15J 3K4NA 4D0PA 1W7PD 3BP8A 2DMQA 4IHYA 4N9HA 4I01A 1BW5A 5IYCJ 4II3A 3QOPA 2ZSIB 3RKQA 2LBFA 3QP5A 2Z3YA 4TV7A 2DA5A 1WJDA 4KMUX 5D6FA 4DYRA 1DQUA 2H6CA 1XGNA 3CCLI 3J80Z 3FXRA 1SFKA 1K4TA 2XVCA 2QQBA 1U2WA 3QRFF 1IW7F 1D0ZA 4M71A 2CMPA 1H0MA 2OBPA 3K4JA 4LFUA 3BJ6A 1W36D 2G0EA 4XIDA 1B72A 4ANJA 3E5XA 2FBKA 2DAOA 3W2VA 4HAMA 2DMPA 5J40A 3FMQA 1Z7LA 3HRMA 5CVVA 4Z6YA 3P5JA 4F7ZA 3JRHA 1RI7A 4KT5C 2CQNA 1I27A 4EEFG 1UCRA 3H5AA 3S3MA 4B47A 3PM1A 4M74A 2DLLA 1IDZA 3ZN0A 2O8KA 2L4AA 1MNEA 4P1WA 1F5TA 5LD2C 1ZHFA 4D1QA 4XLAA 3I59B 3P9KA 4NQWA 2V26A 4PJ0C 1LDKB 4P9FA 3H35A 1B6AA 3T5XA 1FYKA 3FIWA 4F91B 4DIQA 3FMRA 4MNUA 4E7IA 5CLSA 4LK1F 3S1NJ 1OPCA 4J00A 2GA2A 2JSCA 3I0TA 1FC3A 3WTTC 5GPCA 2WAQN 3ZMUA 1RC9A 2CQKA 2DN0A 2XAQA 5FKKA 3CTAA 1WJCA 1JJ6C 2LG4A 4BKXA 3CO7C 2NAZA 4L5JA 2JA5J 1IN7A 3L2WA 3PL8A 3C2GA 3K1NA 4CSWA 4CICA 3DWLE 5M3MJ 2Q8KA 5D5WB 5EF6A 3JTGA 2K9NA 3BG5A 3R0JA 5ILUA 3I54A 1I50J 2VKEA 5JVTA
chains in the Genus database with same CATH topology
3GTLJ 2FQ4A 2DA6A 1U8BA 2QF7A 2XB5A 1U78A 1RETA 1PUFA 4L5EA 3C2BA 5M5WJ 1YRNB 1K61A 1BJZA 2I10A 2JK3A 1MBJA 1CQTA 3GTJJ 1SFOJ 4IHWA 2EZHA 1MNMC 5JLXA 5F0FA 3UKGA 4W1UA 2N8GA 1GDTA 4W97A 4C3IJ 3GTKJ 4C3HJ 9ANTA 4LOCA 2XPVA 3G1MA 3ZOBA 1HDDC 3SJMA 1OFCX 3Q3SA 4XRMA 2ME6A 5IP9J 2M0CA 4X6AJ 1IDYA 2W48A 3LSRA 3A03A 2KT0A 2HYJA 1ZKGA 4DZJA 3GTQJ 1EF4A 1FTZA 5C3EJ 2EQRA 4IHVA 5IOZA 4XICA 1NK3P 4J19A 5EG0A 3RQIA 3I4NJ 3S2HJ 2Y31A 1IUFA 2E2JJ 2CJJA 3HEFA 5F08A 1BL0A 4A69C 1W0UA 2CUEA 1UHSA 4CYCA 1JJ8C 4DYCA 2LK2A 3B6CA 3LSGA 2EZLA 2PMZN 3M4OJ 1IRZA 1JKOC 2ME0A 3TEDA 3TW6A 1JTYA 2R5YA 3S1RJ 3BTJA 1JUSA 4MO7A 1IJWC 5FKNA 5JLWA 1APLC 5E3LA 1LE8B 1FIAA 1G2HA 1GV2A 1F43A 3FK6A 3JRIA 5J3LA 1FJLA 2LKXA 3JRAA 3HOXJ 1MBEA 2CQXA 3CCYA 4V2GA 4XK4A 1OJLA 3HKZN 2X6OA 1Y1WJ 2LP0A 1X2NA 3ZQCA 2HOSA 3IV5A 1E3OC 1ETQA 4MLOA 1ETKA 5J1UA 5FKOA 5M3FJ 2K9SA 5FJ8J 2M9HA 3HOWJ 3A02A 4RBOA 5J1RA 1RKTA 2JA7J 4A3MJ 2Y0SN 4I6ZA 5M5XJ 1HCRA 4M3DA 2QCOA 1QVTA 1U9OA 4A3DJ 1TWFJ 4MIMA 1MBHA 2O7OA 2FJ1A 3B6AA 1ZQ3P 1BW6A 3JRBA 1Z0XA 2EH3A 2XB0X 2NVXJ 4M3FA 4JX4A 3A01B 1JTXA 3S1QJ 4BBSJ 2HDDA 1S7EA 2DA2A 3O8HA 4BY1J 4BY7J 2R92J 2NOGA 2WB1N 2K9QA 3BR5A 2IAIA 2ECBA 3S16J 2HOAA 4D7NA 5E3NA 1X2MA 3BQZA 3VPRA 5E3MA 3SDGA 3NARA 4BXXJ 3QPLA 5C4XJ 4M3EA 4HNVA 3RZDJ 1OCTC 3ZQFA 1FIPA 2LR8A 2VPRA 4DW6A 4FCYA 1ZK8A 2JMWA 1B8IA 5F27A 2OF7A 3BR3A 3MKLA 2LY9A 2H1KA 1GV5A 1AU7A 2XGCA 1RR7A 2E19A 1JT0A 1B72B 1H89C 5C4JJ 1ORKA 2XPWA 5DS9A 1DU0A 2RAEA 3BTIA 4A3FJ 2CRGA 2WV1A 2EBIA 2DA4A 2LVSA 2P81A 2FX0A 1K83J 3HDDA 1IV6A 2AO9A 5EDNA 1ENHA 3H0GJ 5EGOA 2IBDA 3Q0VA 5K7FA 1R9TJ 2R0QC 5EEAA 3ZQGA 3QPSA 2GM4A 1FEXA 2TCTA 1X58A 1H88C 2H8RA 4M3GA 3HOUJ 1HOMA 3BR0A 1I6HJ 2DMTA 1QVUA 4D5FA 2R5ZB 1XC5A 1GT0C 1OCPA 2D5VA 5IYDJ 5IPAA 3DEWA 1TWHJ 3BG3A 1ETYA 2EZIA 2MW8A 1NK2P 2Y30A 5E3OA 2JJ7A 1ETXA 1ZR4A 1IGNA 1ETVA 3IH2A 2NVQJ 3E7LA 1RPWA 3BTLA 2HXIA 4A3LJ 3ZQIA 1I3QJ 3BTCA 3G1OA 5EYRA 4A3CJ 2VI6A 2L7MP 4D7MA 4UUSA 3HM5A 1WH5A 3IH3A 1D5YA 4X1EA 3K7AJ 3HGYA 1NTCA 4FE7A 2E2HJ 3OOUA 1AKHA 4QSHA 1PUFB 4NDLA 1LFBA 4M6VA 2AHQA 1MH3A 3S2DJ 3TP3A 3BR2A 4IHXA 1VF9A 1YRNA 2EZKA 2NS7A 1MH4A 2M34A 1TC3C 3Q0WA 2HQ5A 4A3JJ 2ID6A 5FKMA 1JT6A 5GP9A 2L7FP 3D1NI 2HXOA 2L9RA 5K7HA 2VKVA 3S1MJ 2GBYA 2CU7A 3JRDA 1WI3A 4MFEA 3BT9A 5M5YJ 1P7IA 2XPUA 2YUSA 3OSGA 1U9NA 5F04A 1JKQC 2JN6A 2LFBA 4C3JJ 5FKLA 2JA8J 3JR9A 5DTDA 4XRSA 3TW7A 3WHCA 1HLVA 1DU6A 3HOZJ 3MN2A 4B4CA 4JYKA 4JP0A 4JX6A 5IP7J 5EG0B 2ID3A 3GTGJ 1POGA 1O4XA 1UMQA 3L1PA 1ZR2A 4CYCB 4IEJA 5F0HA 3FKIJ 1TWAJ 1SANA 2NS8A 1AHDP 2IEKA 3GBGA 1H8AC 2ZB9A 1QRYA 3JREA 2Y9YA 4MFDA 3W6VA 5F0CA 2HOTA 1JKRC 3HOYJ 2L0KA 2R5YB 3HB9A 3DCFA 5IP6A 3SFIA 3JRGA 1MBFA 2TRTA 3CQZJ 1JKPC 3GTMJ 5HODA 4B1RA 1WPKA 1IG7A 1WGXA 4AUXA 3H3VK 1VI0A 2DTZA 4QIWN 1GUUA 1LE8A 3HGGA 4JX5A 1TWGJ 3Q0UA 1FTTA 2XRLA 3PO3J 1RKWA 1GVDA 3ZQHA 2JA6J 1WCMJ 3M3YJ 1T56A 1ZGWA 4DYQA 1ITYA 4D5CA 4BBRJ 2DA1A 3BQYA 4C2MJ 2LD5A 4Y7NJ 2X48A 4A3EJ 2O9LA 3ZQLA 3WHBA 5GPAA 1XG1A 5J1YA 5F1JA 2HI3A 1ETOA 5FLVA 4M3BA 3FK7A 2CQQA 3NAUA 2NVTJ 3FISA 3LNQA 1ETWA 4QTRA 1UG2A 3QQAA 1W0TA 3LSPA 1MBKA 3HOVJ 2KDZA 2MGQA 2YU9J 5EZHA 1VNDA 3BG9A 4FTHA 3I4MJ 2XSDC 1HF0A 2M2EA 3JRCA 2XGEA 2M8GX 2R93J 2Y2ZA 1RESA 3A01A 4XRSG 2L7ZA 1TWCJ 1VFCA 2X9DA 4UUTA 3S15J 1JUPA 1P7JA 3LOCA 5K7ZA 2DMQA 3OIOA 4IHYA 3GTOJ 1Y1VJ 1Z77A 3JRFA 1BW5A 5IYCJ 2MG4A 3RKQA 2DA5A 1QPIA 1B8IB 2CUFA 4DYRA 4ABZA 4DZPA 3G1LA 2LLKA 3OSFA 1T33A 3K2AA 4Y52J 4A93J 3GTPJ 1BA5A 2G0EA 4XIDA 2R7ZJ 1B72A 4B3AA 2VUMJ 3O8GA 1ZTRA 1MBGA 2LTPA 2DJNA 3F0CA 1JUMA 1LFUP 3S17J 5IYBJ 2DMPA 2MSYA 4A3IJ 4AYBN 3S14J 5EGOB 3JRHA 5C44J 3BR1A 4EEFG 1F36A 1MSEC 3PM1A 1IDZA 2O8KA 3LSJA 2DMNA 2COBA 3CDLA 2DA7A 1Q1VA 4A3GJ 4AC0A 2NVYJ 4S0HB 2R5ZA 4A3KJ 3CMYA 2E2IJ 1A6IA 3FIWA 1WH7A 3IH4A 4G12A 4GFBA 1MSFC 3HBLA 2DMUA 4A3BJ 4V2FA 3S1NJ 2OPTA 1A5JA 3TP0A 1JGGA 4FISA 2ELKA 2K40A 4I76A 5GPCA 2WAQN 3BR6A 5FLMJ 3MVPA 2DN0A 1IC8A 5EZGA 1XS9A 2GLOA 2DA3A 5FKKA 4UUSB 4RDUA 1JJ6C 4BKXA 5IOYA 2Y9ZA 2B63J 4FE4A 2JA5J 5BNGA 2YS9A 2FD5A 2E1OA 5M3MJ 5EF6A 3RZOJ 1HDPA 1AKHB 2K9NA 3BG5A 2JWTA 3PO2J 1I50J 2XGDA 2VKEA 2ECCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL J;  2FQ4 A;  2DA6 A;  1U8B A;  2QF7 A;  2XB5 A;  1U78 A;  1RET A;  1PUF A;  4L5E A;  3C2B A;  5M5W J;  1YRN B;  1K61 A;  1BJZ A;  2I10 A;  2JK3 A;  1MBJ A;  1CQT A;  3GTJ J;  1SFO J;  4IHW A;  2EZH A;  1MNM C;  5JLX A;  5F0F A;  3UKG A;  4W1U A;  2N8G A;  1GDT A;  4W97 A;  4C3I J;  3GTK J;  4C3H J;  9ANT A;  4LOC A;  2XPV A;  3G1M A;  3ZOB A;  1HDD C;  3SJM A;  1OFC X;  3Q3S A;  4XRM A;  2ME6 A;  5IP9 J;  2M0C A;  4X6A J;  1IDY A;  2W48 A;  3LSR A;  3A03 A;  2KT0 A;  2HYJ A;  1ZKG A;  4DZJ A;  3GTQ J;  1EF4 A;  1FTZ A;  5C3E J;  2EQR A;  4IHV A;  5IOZ A;  4XIC A;  1NK3 P;  4J19 A;  5EG0 A;  3RQI A;  3I4N J;  3S2H J;  2Y31 A;  1IUF A;  2E2J J;  2CJJ A;  3HEF A;  5F08 A;  1BL0 A;  4A69 C;  1W0U A;  2CUE A;  1UHS A;  4CYC A;  1JJ8 C;  4DYC A;  2LK2 A;  3B6C A;  3LSG A;  2EZL A;  2PMZ N;  3M4O J;  1IRZ A;  1JKO C;  2ME0 A;  3TED A;  3TW6 A;  1JTY A;  2R5Y A;  3S1R J;  3BTJ A;  1JUS A;  4MO7 A;  1IJW C;  5FKN A;  5JLW A;  1APL C;  5E3L A;  1LE8 B;  1FIA A;  1G2H A;  1GV2 A;  1F43 A;  3FK6 A;  3JRI A;  5J3L A;  1FJL A;  2LKX A;  3JRA A;  3HOX J;  1MBE A;  2CQX A;  3CCY A;  4V2G A;  4XK4 A;  1OJL A;  3HKZ N;  2X6O A;  1Y1W J;  2LP0 A;  1X2N A;  3ZQC A;  2HOS A;  3IV5 A;  1E3O C;  1ETQ A;  4MLO A;  1ETK A;  5J1U A;  5FKO A;  5M3F J;  2K9S A;  5FJ8 J;  2M9H A;  3HOW J;  3A02 A;  4RBO A;  5J1R A;  1RKT A;  2JA7 J;  4A3M J;  2Y0S N;  4I6Z A;  5M5X J;  1HCR A;  4M3D A;  2QCO A;  1QVT A;  1U9O A;  4A3D J;  1TWF J;  4MIM A;  1MBH A;  2O7O A;  2FJ1 A;  3B6A A;  1ZQ3 P;  1BW6 A;  3JRB A;  1Z0X A;  2EH3 A;  2XB0 X;  2NVX J;  4M3F A;  4JX4 A;  3A01 B;  1JTX A;  3S1Q J;  4BBS J;  2HDD A;  1S7E A;  2DA2 A;  3O8H A;  4BY1 J;  4BY7 J;  2R92 J;  2NOG A;  2WB1 N;  2K9Q A;  3BR5 A;  2IAI A;  2ECB A;  3S16 J;  2HOA A;  4D7N A;  5E3N A;  1X2M A;  3BQZ A;  3VPR A;  5E3M A;  3SDG A;  3NAR A;  4BXX J;  3QPL A;  5C4X J;  4M3E A;  4HNV A;  3RZD J;  1OCT C;  3ZQF A;  1FIP A;  2LR8 A;  2VPR A;  4DW6 A;  4FCY A;  1ZK8 A;  2JMW A;  1B8I A;  5F27 A;  2OF7 A;  3BR3 A;  3MKL A;  2LY9 A;  2H1K A;  1GV5 A;  1AU7 A;  2XGC A;  1RR7 A;  2E19 A;  1JT0 A;  1B72 B;  1H89 C;  5C4J J;  1ORK A;  2XPW A;  5DS9 A;  1DU0 A;  2RAE A;  3BTI A;  4A3F J;  2CRG A;  2WV1 A;  2EBI A;  2DA4 A;  2LVS A;  2P81 A;  2FX0 A;  1K83 J;  3HDD A;  1IV6 A;  2AO9 A;  5EDN A;  1ENH A;  3H0G J;  5EGO A;  2IBD A;  3Q0V A;  5K7F A;  1R9T J;  2R0Q C;  5EEA A;  3ZQG A;  3QPS A;  2GM4 A;  1FEX A;  2TCT A;  1X58 A;  1H88 C;  2H8R A;  4M3G A;  3HOU J;  1HOM A;  3BR0 A;  1I6H J;  2DMT A;  1QVU A;  4D5F A;  2R5Z B;  1XC5 A;  1GT0 C;  1OCP A;  2D5V A;  5IYD J;  5IPA A;  3DEW A;  1TWH J;  3BG3 A;  1ETY A;  2EZI A;  2MW8 A;  1NK2 P;  2Y30 A;  5E3O A;  2JJ7 A;  1ETX A;  1ZR4 A;  1IGN A;  1ETV A;  3IH2 A;  2NVQ J;  3E7L A;  1RPW A;  3BTL A;  2HXI A;  4A3L J;  3ZQI A;  1I3Q J;  3BTC A;  3G1O A;  5EYR A;  4A3C J;  2VI6 A;  2L7M P;  4D7M A;  4UUS A;  3HM5 A;  1WH5 A;  3IH3 A;  1D5Y A;  4X1E A;  3K7A J;  3HGY A;  1NTC A;  4FE7 A;  2E2H J;  3OOU A;  1AKH A;  4QSH A;  1PUF B;  4NDL A;  1LFB A;  4M6V A;  2AHQ A;  1MH3 A;  3S2D J;  3TP3 A;  3BR2 A;  4IHX A;  1VF9 A;  1YRN A;  2EZK A;  2NS7 A;  1MH4 A;  2M34 A;  1TC3 C;  3Q0W A;  2HQ5 A;  4A3J J;  2ID6 A;  5FKM A;  1JT6 A;  5GP9 A;  2L7F P;  3D1N I;  2HXO A;  2L9R A;  5K7H A;  2VKV A;  3S1M J;  2GBY A;  2CU7 A;  3JRD A;  1WI3 A;  4MFE A;  3BT9 A;  5M5Y J;  1P7I A;  2XPU A;  2YUS A;  3OSG A;  1U9N A;  5F04 A;  1JKQ C;  2JN6 A;  2LFB A;  4C3J J;  5FKL A;  2JA8 J;  3JR9 A;  5DTD A;  4XRS A;  3TW7 A;  3WHC A;  1HLV A;  1DU6 A;  3HOZ J;  3MN2 A;  4B4C A;  4JYK A;  4JP0 A;  4JX6 A;  5IP7 J;  5EG0 B;  2ID3 A;  3GTG J;  1POG A;  1O4X A;  1UMQ A;  3L1P A;  1ZR2 A;  4CYC B;  4IEJ A;  5F0H A;  3FKI J;  1TWA J;  1SAN A;  2NS8 A;  1AHD P;  2IEK A;  3GBG A;  1H8A C;  2ZB9 A;  1QRY A;  3JRE A;  2Y9Y A;  4MFD A;  3W6V A;  5F0C A;  2HOT A;  1JKR C;  3HOY J;  2L0K A;  2R5Y B;  3HB9 A;  3DCF A;  5IP6 A;  3SFI A;  3JRG A;  1MBF A;  2TRT A;  3CQZ J;  1JKP C;  3GTM J;  5HOD A;  4B1R A;  1WPK A;  1IG7 A;  1WGX A;  4AUX A;  3H3V K;  1VI0 A;  2DTZ A;  4QIW N;  1GUU A;  1LE8 A;  3HGG A;  4JX5 A;  1TWG J;  3Q0U A;  1FTT A;  2XRL A;  3PO3 J;  1RKW A;  1GVD A;  3ZQH A;  2JA6 J;  1WCM J;  3M3Y J;  1T56 A;  1ZGW A;  4DYQ A;  1ITY A;  4D5C A;  4BBR J;  2DA1 A;  3BQY A;  4C2M J;  2LD5 A;  4Y7N J;  2X48 A;  4A3E J;  2O9L A;  3ZQL A;  3WHB A;  5GPA A;  1XG1 A;  5J1Y A;  5F1J A;  2HI3 A;  1ETO A;  5FLV A;  4M3B A;  3FK7 A;  2CQQ A;  3NAU A;  2NVT J;  3FIS A;  3LNQ A;  1ETW A;  4QTR A;  1UG2 A;  3QQA A;  1W0T A;  3LSP A;  1MBK A;  3HOV J;  2KDZ A;  2MGQ A;  2YU9 J;  5EZH A;  1VND A;  3BG9 A;  4FTH A;  3I4M J;  2XSD C;  1HF0 A;  2M2E A;  3JRC A;  2XGE A;  2M8G X;  2R93 J;  2Y2Z A;  1RES A;  3A01 A;  4XRS G;  2L7Z A;  1TWC J;  1VFC A;  2X9D A;  4UUT A;  3S15 J;  1JUP A;  1P7J A;  3LOC A;  5K7Z A;  2DMQ A;  3OIO A;  4IHY A;  3GTO J;  1Y1V J;  1Z77 A;  3JRF A;  1BW5 A;  5IYC J;  2MG4 A;  3RKQ A;  2DA5 A;  1QPI A;  1B8I B;  2CUF A;  4DYR A;  4ABZ A;  4DZP A;  3G1L A;  2LLK A;  3OSF A;  1T33 A;  3K2A A;  4Y52 J;  4A93 J;  3GTP J;  1BA5 A;  2G0E A;  4XID A;  2R7Z J;  1B72 A;  4B3A A;  2VUM J;  3O8G A;  1ZTR A;  1MBG A;  2LTP A;  2DJN A;  3F0C A;  1JUM A;  1LFU P;  3S17 J;  5IYB J;  2DMP A;  2MSY A;  4A3I J;  4AYB N;  3S14 J;  5EGO B;  3JRH A;  5C44 J;  3BR1 A;  4EEF G;  1F36 A;  1MSE C;  3PM1 A;  1IDZ A;  2O8K A;  3LSJ A;  2DMN A;  2COB A;  3CDL A;  2DA7 A;  1Q1V A;  4A3G J;  4AC0 A;  2NVY J;  4S0H B;  2R5Z A;  4A3K J;  3CMY A;  2E2I J;  1A6I A;  3FIW A;  1WH7 A;  3IH4 A;  4G12 A;  4GFB A;  1MSF C;  3HBL A;  2DMU A;  4A3B J;  4V2F A;  3S1N J;  2OPT A;  1A5J A;  3TP0 A;  1JGG A;  4FIS A;  2ELK A;  2K40 A;  4I76 A;  5GPC A;  2WAQ N;  3BR6 A;  5FLM J;  3MVP A;  2DN0 A;  1IC8 A;  5EZG A;  1XS9 A;  2GLO A;  2DA3 A;  5FKK A;  4UUS B;  4RDU A;  1JJ6 C;  4BKX A;  5IOY A;  2Y9Z A;  2B63 J;  4FE4 A;  2JA5 J;  5BNG A;  2YS9 A;  2FD5 A;  2E1O A;  5M3M J;  5EF6 A;  3RZO J;  1HDP A;  1AKH B;  2K9N A;  3BG5 A;  2JWT A;  3PO2 J;  1I50 J;  2XGD A;  2VKE A;  2ECC A; 
#chains in the Genus database with same CATH topology
 1XX5 A;  3B02 A;  2FQ4 A;  4S05 A;  2R7O A;  3NQO A;  2PEX A;  4L5E A;  1S6L A;  1WRJ A;  4I0B A;  3C2B A;  3EYI A;  4XON A;  1BJZ A;  2DT5 A;  4HF1 A;  2JK3 A;  1CQT A;  3GTJ J;  1MZB A;  1XMA A;  2OQR A;  1SFO J;  4IHW A;  3L7W A;  4R79 A;  2AQF A;  3A0B C;  2M0M A;  1STZ A;  2KRF A;  3VEP A;  4W1U A;  1YOV B;  2N8G A;  2PJR B;  2X6X A;  2XPV A;  3LSI A;  3ZOB A;  4OIO F;  2ZO4 A;  3SJM A;  3DKY A;  5BQT A;  4XRM A;  1KYW A;  2NNY A;  1ZG5 A;  1IDY A;  1FNN A;  2OAZ A;  2BOL A;  4IRI A;  4L0Y B;  3MZH A;  3H5R A;  1FP2 A;  3JCU C;  3E5U A;  4OIR F;  4RB0 A;  4BAC A;  1EF4 A;  3AFH A;  1BJA A;  1FTZ A;  1IZ1 A;  4IHV A;  4Y17 A;  2OZU A;  2CUJ A;  3OWT A;  3IRR A;  4KDP A;  3M07 A;  1EH6 A;  4ZYE A;  5EG0 A;  1PYV A;  2ETH A;  2HGC A;  5FO5 A;  3FHZ A;  3S2H J;  1TZL A;  2Y31 A;  4P9U A;  2E2J J;  1LPQ A;  1DUX C;  3KEO A;  2GAU A;  5ICF A;  4IQJ A;  1UHS A;  3WOD F;  1JJ8 C;  3KP6 A;  4CCL A;  3F21 A;  2KIS A;  2OCC H;  2LK2 A;  2HYF A;  4Q5S F;  1G59 A;  1Y56 A;  1YG2 A;  3TED A;  1JTY A;  2EIK H;  3JSP A;  3N05 A;  4YEL A;  1APL C;  2P5V A;  4L18 B;  1FIA A;  3HSR A;  4G9Y A;  4OWR B;  2JA2 A;  1OCR H;  5J3L A;  5H2F C;  3JRA A;  3JRI A;  3EUA A;  2HKO A;  4QWQ A;  1R71 A;  1OJL A;  1L3L A;  3HKZ N;  5KAI C;  1R58 A;  5E1Z B;  1X4O A;  2LP0 A;  1AA7 A;  5CVR A;  3T0Y A;  5KVR A;  5GAD J;  4ON0 A;  3IV5 A;  1E3O C;  1ETK A;  3O3K A;  5FKO A;  3OY9 A;  3HC7 A;  2HR3 A;  2IW5 A;  3PNV A;  2ZFU A;  3HOW J;  1FZP B;  2EFW A;  1VQO I;  2F6C A;  2W1O A;  1P6R A;  3ZMS A;  1MD0 A;  2XF5 A;  5M5X J;  1EJ9 A;  2IT0 A;  2F5F A;  2QCO A;  3BPV A;  1U9O A;  3OR2 C;  4A3D J;  2M4K A;  2GOX B;  1H9G A;  3RJP A;  3CCQ I;  3N4M A;  1XSD A;  3B6A A;  1BW6 A;  3JRB A;  4KIT B;  5HS7 A;  1Z0X A;  1XDU A;  2XB0 X;  5LRR A;  3VDX A;  2C6Y A;  3A01 B;  4ZDP A;  4RGX A;  2HDD A;  5CQE A;  2V6C A;  3F6V A;  4AYB A;  3EPZ A;  3HRU A;  2FBH A;  5KHD A;  3S16 J;  2RQP A;  3M8E A;  2CWE A;  3F8M A;  4D7N A;  5E3N A;  1YQA A;  3LFU A;  3CF5 F;  1J59 A;  3GFM A;  3NAR A;  1UAA A;  3PQK A;  5C4X J;  2FNP A;  2KJC A;  4M6X A;  3L9F A;  3RZD J;  4IL6 C;  2A6E F;  3H0D A;  1SFE A;  2KIQ A;  2OUM A;  5F27 A;  3MKL A;  4RGS A;  3GYH X;  1WHU A;  1J0R A;  4IXA A;  5DUK A;  1IO2 A;  3WE2 A;  1RRJ A;  1G3W A;  1RR7 A;  2E19 A;  2XGC A;  5HNH A;  1H89 C;  1BI1 A;  4WF2 A;  1KQ8 A;  5C4J J;  1ORK A;  1SVM A;  5AIP A;  3GX4 X;  3F6O A;  4GCV A;  4AWX B;  1R4N B;  2XAU A;  3WTW C;  1V54 H;  2LVS A;  4BXU A;  2D1V A;  3J81 K;  1VQN I;  3RYP A;  3HYI A;  4CCM A;  1WSU A;  5EDN A;  4E7H A;  3DEU A;  1R23 A;  3HSE A;  1IRX A;  2O03 A;  2TDX A;  1R9T J;  2R7X A;  4LIV A;  2ZME C;  3F8C A;  1FEX A;  3OYI A;  2VQG A;  3RPU A;  4M3G A;  1BIA A;  3CDI A;  2CW8 A;  2GXB A;  3RDI A;  1D0Y A;  1X3U A;  4XNF A;  1GT0 C;  4BNC A;  2XDV A;  4Y13 A;  2OC6 A;  4A0Z A;  3I59 A;  2VKH A;  2OQG A;  3I9V 2;  4AU7 A;  3BLY A;  2JJ7 A;  2PMH A;  3KZZ A;  4UV9 A;  2X4H A;  3S32 A;  3CCE I;  1IGN A;  4OIQ F;  2BXZ A;  1YW7 A;  3E7L A;  4A2U A;  1DPU A;  3WU2 C;  4RB1 A;  3K69 A;  1TLH B;  2W25 A;  2HXI A;  2V9K A;  3DV8 A;  4I09 A;  1FBQ A;  4PFP A;  5EYR A;  4A3C J;  3WTX C;  3T1B A;  3ZXS A;  2K3P A;  2QEX I;  3DFG A;  3OYN A;  1KU2 A;  5J8F A;  3MCZ A;  1FYM A;  2DOF A;  1J7K A;  2E7X A;  1RIO H;  3HGY A;  1F1Z A;  3QPT A;  1NTC A;  4XLP F;  3MD2 A;  4FE7 A;  3Q9S A;  1B9N A;  1IN4 A;  5FFZ A;  4E4H A;  1DGR M;  1Z1D A;  3GFJ A;  2VOP A;  4O5V A;  4BHP A;  3TP3 A;  2HQA A;  1V4R A;  3GF2 A;  3SFZ A;  2IP2 A;  5ILS A;  3MKW B;  1MH4 A;  3M1C A;  2M34 A;  3DEE A;  1IAW A;  4E70 A;  2XAS A;  3K4K A;  2XC7 A;  4A3J J;  2DOA A;  4KIB A;  5FKM A;  2UXN A;  5GP9 A;  2L7F P;  3D1N I;  2VXD A;  4WXC A;  3M7G A;  3K1M A;  5K7H A;  2VKV A;  2PJR A;  4RAZ A;  4RGU A;  4KIG A;  5CVI A;  3JRD A;  2FE3 A;  3BT9 A;  1P7I A;  2XPU A;  3OSG A;  1RZ4 A;  1U9N A;  2JN6 A;  4L9N A;  1U8R A;  4BGD A;  1W5T A;  2W4S A;  4Y15 A;  3KEQ A;  1ZRE A;  2ESN A;  2L9S A;  5LBQ A;  1EKE A;  3WHC A;  2V1X A;  3D5S C;  1DU6 A;  4CGZ A;  3HOZ J;  5JVG F;  4JYK A;  2CG4 A;  1XN7 A;  4CCJ A;  4JP0 A;  2LF7 A;  3CC7 I;  2NRA C;  3I4P A;  3C3W A;  3G73 A;  2CGP A;  4AM3 A;  2Z1D A;  2MBF A;  4EM0 B;  1UMQ A;  4HQE A;  2ZKZ A;  3F23 A;  3L1P A;  1ZR2 A;  4IEJ A;  2DT7 B;  5F0H A;  1K78 B;  1PP7 U;  3DU5 A;  1TWA J;  5DD8 A;  2NS8 A;  3GBG A;  1H8A C;  2ZB9 A;  2EK5 A;  1X19 A;  2KZG A;  4MFD A;  2FOW A;  4C2U A;  3HB9 A;  2HQR A;  2KPM A;  3HSF A;  4J01 A;  3WTZ A;  1JHF A;  2IS2 A;  4UVA A;  1ZAO A;  4HPQ A;  4M6Y A;  3J81 Z;  4IHS A;  1JKP C;  3QPH A;  2YX7 A;  4E7S A;  3GTM J;  4IQ4 A;  2A5Y B;  1WGX A;  2HZD A;  4QIW N;  2DTZ A;  1ON1 A;  1J9I A;  1TWG J;  4B44 A;  5DUI A;  1WKM A;  1FTT A;  2DO7 A;  1SAU A;  2DFE A;  5F64 A;  3R6S A;  1RKW A;  3SYT A;  4UNO A;  3MKZ A;  1OR7 C;  2QZ8 A;  4FHT A;  1IXS B;  2XAG A;  1Y39 A;  3RQ4 A;  4OIP F;  2DA1 A;  3BQY A;  3HPH A;  1FSH A;  3QAH A;  4UV8 A;  4A3E J;  2O9L A;  2VON A;  3ZQL A;  5GPA A;  4FX4 A;  1XG1 A;  4XR6 A;  5FLV A;  5HDN A;  2IA2 A;  4U0W A;  4A12 A;  2CQQ A;  5ERI A;  4IF4 A;  4BAY A;  2YPR A;  4I0A A;  2E5Z A;  5HS8 A;  3DTE A;  3QQA A;  3E97 A;  3LSP A;  2GXA A;  3FMS A;  1MBK A;  1FOK A;  3RKW A;  2JT1 A;  4ETS A;  2BHZ A;  3WE3 A;  2DDA A;  5TGT A;  4FTH A;  2XSD C;  1HF0 A;  2QKM B;  3OL4 A;  4L0Z B;  2M2E A;  1D8K A;  4HSR A;  4EGZ A;  1S9H A;  2P6S A;  5J6X A;  1RES A;  3A01 A;  3SQN A;  4XRS G;  4N0B A;  4PJN A;  4CUG A;  1ULY A;  3L00 A;  4WK8 F;  2X9D A;  2PQ8 A;  2ZC2 A;  4UUT A;  5BS6 A;  1E3H A;  2FXA A;  2M7B A;  4HST A;  2RN7 A;  2W82 A;  3LA3 A;  1ACI A;  4RMN A;  1A36 A;  1FY7 A;  5E17 F;  2DYR H;  2CUF A;  5GAE J;  4YIF A;  5J47 A;  2XF6 A;  2K86 A;  4DZP A;  5KNL A;  4G7H F;  5E1X A;  4HF2 A;  1D3Y A;  1P9Q C;  2CO5 A;  2R7D A;  1IRG A;  1I1G A;  5HNF A;  4A93 J;  3C1D A;  4ZYH A;  1ZG1 A;  1ZLK A;  5L3D A;  1OQY A;  4ZJZ A;  4U0Y A;  3CUQ B;  4HDV A;  4PGH A;  1BA5 A;  3L2R A;  2R7Z J;  5IT9 K;  2ZME A;  2H8W A;  3O8G A;  5CVJ A;  3F0C A;  4FAS D;  1LFU P;  3MAJ A;  3TKY A;  1BC7 C;  3BZC A;  2HPI A;  5IYB J;  1ONV A;  2M7A A;  3CCJ I;  2DK5 A;  3D5R C;  1KU9 A;  4LJZ F;  5EGO B;  2QQ8 A;  4IRH A;  1MMD A;  2E5N A;  2CS3 A;  5C44 J;  3BR1 A;  3BZK A;  3MQ0 A;  3W6K B;  4ZH4 F;  2NOJ B;  4HZF A;  4G7Z F;  3BCA A;  1MSE C;  3GZ5 A;  4NC6 A;  3V7C A;  2KLO A;  1VQM I;  2QGU A;  1ZRD A;  3CUQ C;  1D1C A;  1N78 A;  1FPQ A;  3CDL A;  4ZZD A;  1SMY F;  4GGG A;  2O61 A;  1Q1V A;  2UZK A;  1V55 H;  2EA2 A;  4A3G J;  4IKF A;  3OYE A;  4S0H B;  6PAX A;  1LVK A;  1TNT A;  4D9J A;  4PZJ A;  2E2I J;  1X3W B;  3ECO A;  3IH4 A;  4G12 A;  2D2W A;  3CC2 I;  4DOZ A;  1QHH D;  4C9Y A;  2ACJ A;  1A5J A;  1JGG A;  3PSF A;  2HTS A;  4FIS A;  1XMX A;  2G7H A;  5FLM J;  3BR6 A;  4UVB A;  1P4A A;  3QOE A;  3TL4 X;  3MVP A;  4ESF A;  1YJ9 I;  2V4J C;  2VJ4 A;  2M8E A;  4RAG A;  2VXZ A;  1Q1H A;  3OIP A;  5IOY A;  3OYC A;  2Y9Z A;  3MMY B;  3ZCO A;  1GXQ A;  2OJE D;  3ZP5 A;  1YLF A;  5BNG A;  2YS9 A;  1ZAR A;  2DDB A;  1MW7 A;  2FD5 A;  2AXT C;  3RZO J;  1X1C A;  1AKH B;  4F52 A;  2HWV A;  2JWT A;  1T8I A;  3PO2 J;  2JPC A;  2ECC A;  4Y33 A;  3OYJ A;  1HOM A;  2GWR A;  1FWZ A;  2QF7 A;  3E6B A;  2QUF A;  2Z9O A;  4HBL A;  4U88 A;  1TQP A;  2I10 A;  1MBJ A;  1T95 A;  2ADU A;  2GIV A;  5F1R A;  1HA8 A;  3EQL F;  3G71 I;  2EZH A;  3CCR I;  1CGP A;  4EVI A;  1BC8 C;  3T8R A;  3UKG A;  2NNN A;  1SFU A;  4BUP A;  4W97 A;  3GTK J;  4XQF A;  9ANT A;  2PLY A;  1HDD C;  1OFC X;  3CUO A;  2LYC A;  3GLL A;  5LEJ A;  4X6A J;  2EFQ A;  1PDN C;  1TW3 A;  3U1D A;  4AVZ A;  1K7A A;  2DU9 A;  3LSM A;  1QHG A;  3S8P A;  3V4G A;  2HVR A;  3H3Z A;  3GTQ J;  3S93 A;  4HF0 A;  2XGX A;  3FXQ A;  4CCK A;  5LRS A;  2KJB A;  3I4N J;  1R1U A;  3VYR B;  2KMU A;  2FMY A;  1IUF A;  3ELK A;  3H9J A;  3VB2 A;  3AAF A;  4IO9 F;  1K78 A;  4DNC A;  5A2Q K;  4C2T A;  3GO5 A;  2ZCW A;  2HZT A;  2VJJ A;  5CJ9 A;  2PX9 A;  5IT9 Z;  3P7N A;  5LFA A;  1KGS A;  2ZXI A;  3M4O J;  2VIX A;  1ZG3 A;  1OR7 A;  2UV1 A;  3S1R J;  2MLG A;  1JUS A;  4MO7 A;  5FKN A;  3DLA A;  2DFF A;  1G2H A;  4IOA F;  1Y0U A;  2DXI A;  3LAP A;  2MFZ A;  2GOM A;  3FXO A;  3CLQ A;  4JQF A;  1VQ7 I;  3CCY A;  4IPA A;  5E18 F;  3FBN B;  4Y4R A;  2WTE A;  1X1D A;  2F5D A;  4UB8 C;  2L7K A;  1OCZ H;  4GRI A;  4MLO A;  4CH7 A;  3CJT B;  1TP4 A;  1FT9 A;  3W2A A;  1NG6 A;  2K9S A;  1UG0 A;  5M3F J;  3WGH A;  2K5C A;  1J75 A;  1V3F A;  2KFD A;  3KYC B;  2A6T A;  2EWN A;  4RBO A;  4U87 A;  2R7U A;  4ZYD A;  2W00 A;  3HTS B;  2DCE A;  1SFX A;  1GVJ A;  2OV7 A;  3OIQ A;  2Y0S N;  1HCR A;  3C7J A;  3V8J A;  4HLY A;  2UWM A;  4GO1 A;  4XSX F;  4FT8 A;  1ZRC A;  3BRO A;  1E17 A;  1XGS A;  2EH3 A;  3KP2 A;  4M3F A;  2LY1 A;  4A5M A;  1QO0 D;  4CO8 A;  3M8F A;  5H20 A;  3HXL A;  4BY1 J;  2R92 J;  1Y8Q B;  2KQR A;  4BY7 J;  2NVU B;  1RUN A;  2NOG A;  4IOC F;  4A5N A;  2A3S A;  4FET A;  4HX8 A;  1BR1 A;  2HOA A;  3BQZ A;  2HDW A;  2R7R A;  3FM3 A;  1QNT A;  2VQL A;  1UHW A;  4BL0 B;  3ZQF A;  4FCY A;  3E6C C;  3S3O A;  1MND A;  3ABT A;  4OOI A;  2BXY A;  2HTJ A;  2H1K A;  2IGO A;  5E79 C;  1GV5 A;  1VQ8 I;  1ZLJ A;  2WY7 Q;  2BBY A;  3ZQQ A;  2XPW A;  4UVC A;  2HPM A;  3K70 D;  4GDF A;  3CUQ A;  1TW2 A;  4XLH A;  2KDO A;  2RAE A;  3CZ6 A;  4E7Z A;  1LFP A;  3CC4 I;  2EBI A;  1C0W A;  3GZN B;  2DA4 A;  1I1S A;  2MAB A;  2YSR A;  3HDD A;  1IV6 A;  4F92 B;  3FKJ A;  2L02 A;  1HKS A;  2MC4 A;  5KK1 A;  5EGO A;  2ELH A;  2IBD A;  2DPD A;  1JHH A;  1NHA A;  3Q0V A;  3RSN A;  2L4M A;  3MWM A;  3OOP A;  3CDH A;  3TO9 A;  3HRS A;  2TCT A;  2ZNZ A;  1H88 C;  2BE5 F;  3BR0 A;  3LFK A;  2ICW G;  1BIB A;  2DOE A;  4D5F A;  2CYY A;  1XC5 A;  5GAG J;  2K85 A;  5KCM A;  1DPR A;  2R5Z B;  1A6Q A;  1LDD A;  5IPA A;  3DEW A;  1TWH J;  2FBI A;  2H09 A;  4GYG A;  3VYS B;  5A2Q Z;  4HV6 A;  4EJV A;  1K6Y A;  2MW8 A;  3HTU A;  2EFP A;  4AID A;  2B0L A;  2M45 A;  2XAJ A;  3HHH A;  4UY8 I;  5K5Q A;  2DI3 A;  3D0S A;  3JAM K;  1YO5 C;  1RPW A;  2XHK A;  2LRE A;  4A3L J;  3ZQI A;  2RV8 A;  3A0H C;  1BM9 A;  1WJ5 A;  3JTH A;  2CSO A;  3BC8 A;  2O0Y A;  4I02 A;  1MDM B;  1WH5 A;  2DK8 A;  1D5Y A;  1VQP I;  4X1E A;  1VQL I;  3TOB A;  2Z16 A;  2M87 A;  4AIH A;  5JHF A;  5DYM A;  3ERM A;  2WC2 A;  3TBI A;  3OOU A;  1AKH A;  2O6G E;  1PUF B;  1FOX A;  3PFI A;  3W6J B;  2R7W A;  3GXO A;  3ABM H;  2FF4 A;  4HX4 A;  3ZGK A;  4M6V A;  3TOA A;  2VT3 A;  1LB2 A;  1MH3 A;  3IHU A;  3DPT A;  4LLL A;  2EZK A;  3CJR B;  1HKT A;  3G4S I;  1TC3 C;  2R3S A;  3BZ6 A;  4OU0 A;  2HQ5 A;  4C30 A;  1MKM A;  1Z91 A;  2K27 A;  3GW2 A;  2L9R A;  4KN7 X;  1VQ6 I;  2CU7 A;  2GXG A;  2W24 A;  5GTI C;  1YX3 A;  1B4A A;  2UXX A;  3V42 A;  5F04 A;  4GXO A;  1HW2 A;  1HW1 A;  5FKL A;  4C3J J;  2JA8 J;  2W57 A;  1QZZ A;  4N9I A;  3TW7 A;  4XRS A;  2V6E A;  1SEU A;  4B09 A;  4BQQ A;  4JX6 A;  3SEZ A;  2F4I A;  2ID3 A;  4DBR A;  3RKY A;  1S8N A;  2EFN A;  5LGN A;  1MGT A;  5AON A;  1KQ9 A;  1ZN2 A;  4I7H A;  2Z33 A;  4ENM A;  2RQQ A;  1SMT A;  3HHG A;  2OD5 A;  1AOY A;  2IEK A;  3VWB A;  1FMW A;  4YEJ A;  3U9G A;  2CV0 A;  5F0C A;  2HOT A;  2L0K A;  2M3A A;  2WWY A;  1SD4 A;  3LL7 A;  1R22 A;  1S72 I;  2F48 A;  2QKL B;  4LLG F;  3KLO A;  3JRG A;  3LST A;  2TRT A;  3HOS A;  5HOD A;  3KIO A;  3KLN A;  4AUX A;  1VI0 A;  1GUU A;  4LG3 A;  5FRO A;  4KUM A;  4ZDO A;  2FRH A;  2VOO A;  1N75 A;  3ZPL A;  4G6Q A;  2A61 A;  1GVD A;  3C18 A;  2FOK A;  4U7D A;  2O8X A;  1ZGW A;  3G3Z A;  2MC3 A;  3V8K A;  5EJC A;  3OYM A;  2WB1 A;  3KP7 A;  2WAE A;  4DBQ A;  1OCO H;  1SD5 A;  1D5V A;  4MQV A;  1W7P B;  3S3N A;  5J1Y A;  2HI3 A;  3E1S A;  3CMA I;  4XM3 A;  1ETW A;  3MKY B;  3JAM Z;  4QTR A;  2L9V A;  1UG2 A;  2BZT A;  5TIS C;  5K5R A;  5D4S A;  2KP6 A;  1W0T A;  1LEB A;  3F72 A;  4XL9 A;  3AL0 B;  2KL4 A;  3HOV J;  5DM7 F;  5GTH C;  3AG3 H;  2XUB A;  4LGW A;  1ZRF A;  2XGE A;  3N97 A;  2M8G X;  1YS7 A;  3OS0 A;  4P5O A;  1A04 A;  4UXN A;  2EIM H;  2F4O B;  3LMM A;  1S3J A;  1IRF A;  1FSE A;  1JUP A;  5K5O A;  1TNS A;  2E1M B;  2F4M B;  3GFL A;  3LOC A;  4DJA A;  1KQ0 A;  3BJA A;  5K7Z A;  1FYL A;  1AWC A;  4RAY A;  3ECH A;  3ONQ A;  3SHF A;  2JUC A;  1QPI A;  3SDB A;  4Q4Z F;  3H3U A;  4ABZ A;  4BE1 A;  2VE8 A;  3G1L A;  2LLK A;  2P8T A;  1R36 A;  5DDG A;  2VLA A;  3OSF A;  1K79 A;  3CLO A;  1U5T B;  3KFW X;  2VPL A;  3K2A A;  5DCF A;  2CW7 A;  2VE9 A;  3A2K A;  5EEH A;  4Y52 J;  3NRV A;  1UB9 A;  1YTY A;  3PNT A;  3BJO A;  3CCM I;  4ZTF A;  1N25 A;  1I3A A;  2Q2E B;  5D8L B;  3I53 A;  4M9S A;  1ZTR A;  1MBG A;  2V79 A;  2LTP A;  4PSW A;  2DJN A;  3TMO A;  3ZQ7 A;  1E3P A;  1JUM A;  3HRT A;  3VFZ A;  2IS1 A;  3S17 J;  2Y48 A;  1XPX A;  3QYB A;  3VSL A;  4XKB A;  2MSY A;  3H9Q A;  4AYB N;  1YW9 A;  3NWS A;  3ABU A;  2RNG A;  1F36 A;  2K9M A;  1YX5 A;  2EJR A;  2IGK A;  5KAF C;  3VYT B;  4B8X A;  2MH9 A;  3Q9V A;  1YJW I;  4BU2 A;  2QSH X;  1R00 A;  4M73 A;  2DA7 A;  2CFX A;  4CXF A;  2BW3 B;  4IZZ A;  2R5Z A;  1OMI A;  3H92 A;  1Z05 A;  4F93 B;  3CMY A;  1A6I A;  2HVS A;  4GFB A;  3HBL A;  2EV0 A;  4V19 K;  4V2F A;  4CDG A;  2R4G A;  2GQQ A;  2OPT A;  3GCM A;  2JTV A;  1UHM A;  2K40 A;  3F3X A;  1F4K A;  1IC8 A;  1ZYR F;  3KYL A;  1XS9 A;  3FZV A;  2GLO A;  4UUS B;  4RDU A;  1O3R A;  1MJ9 A;  3RPU D;  1TTY A;  2CQ7 A;  1MDM A;  4H4K C;  5D6E A;  2R7S A;  4XKC A;  2BVL A;  2E1O A;  2VC0 A;  3L2C A;  3K2Z A;  4OAZ A;  4EJU A;  5D5U B;  1NH3 A;  5BOX A;  1LUJ B;  3ISP A;  4PUS A;  2P6T A;  4RLQ A;  3GTL J;  3DF8 A;  2DA6 A;  1U8B A;  3KZI C;  3O6B B;  1PUF A;  1T0F A;  2BY0 A;  1G3Y A;  4Z2Y A;  1QZE A;  4NC7 A;  1ZH5 A;  1UEL B;  4LB6 B;  4AVP A;  2K7L A;  3DBR B;  1P4W A;  4FX0 A;  2XIG A;  1BI2 A;  1LVA A;  4UUV A;  3I71 A;  1MNM C;  2ZXW H;  5TRD A;  3AG4 H;  4MHG A;  1S7O A;  4C3I J;  4C3H J;  2FNA A;  3X2Q H;  3FBI B;  4PJJ A;  3BPX A;  3FM5 A;  2CV1 A;  3OYD A;  3Q3S A;  2ME6 A;  4BXF A;  2BY1 A;  5IP9 J;  2M0C A;  2OU2 A;  2R7T A;  5L3B A;  4ZDL A;  1GHC A;  3K4B A;  4RB3 C;  1ZKG A;  3TO6 A;  2XKO A;  3VOE A;  2E1C A;  1DGW Y;  4DZJ A;  3BWG A;  3ERE D;  4QPO A;  5C3E J;  2EQR A;  1S29 A;  1NK3 P;  1SVO A;  4NUB A;  3R60 A;  2ZJ2 A;  3RYR A;  3EUH C;  4WX9 A;  3RQI A;  4DQ2 A;  2W84 A;  4MEY F;  1BOA A;  2NYX A;  4RS8 A;  3QYE A;  3WG7 H;  1TL8 A;  2BGC A;  3KYD B;  2QBY B;  3BOQ A;  2Z2S B;  2P0W A;  2P7C B;  3F22 A;  3OYG A;  3HUG B;  4DYC A;  4P55 A;  3ABK H;  3BG6 A;  4I2O A;  3A4C A;  3LSG A;  1HC8 A;  3CCU I;  2MYS A;  2JZY A;  2X6W A;  3TW6 A;  4EJW A;  1B9M A;  1TQM A;  1FLI A;  1IN5 A;  1LDJ A;  3U21 A;  5JLW A;  3FX3 A;  1IJW C;  2MD5 A;  1SVL A;  4RM2 A;  3U1K A;  5LGT A;  4AIJ A;  5B3S H;  2E7W A;  2ZNY A;  3CP8 A;  3HOX J;  1MBE A;  4MEX F;  4RA2 A;  3E0J B;  5E20 A;  4V2G A;  3W2W A;  1SC7 A;  3PQJ A;  1X2N A;  2DYS H;  3CME I;  4O6J A;  1MMG A;  2HS5 A;  5FD5 A;  3CMM A;  1PP8 F;  3HG9 A;  2COM A;  2UUZ A;  5GAH J;  3FXL A;  4XBF A;  4A6D A;  2Y0M A;  1XCB A;  2DPU A;  4XKV A;  2JPB A;  1I39 A;  1W7P A;  1RKT A;  2JVH A;  2XAH A;  2EFO A;  4LIU A;  1ZGJ A;  2JA7 J;  4NNJ A;  4WXH A;  1XGM A;  3S2W A;  2ISY A;  4BJ5 C;  4HRI A;  4XLF A;  3K9T A;  3IUO A;  1IF1 A;  1QVT A;  2QQA A;  2VAS A;  4XLN F;  1TWF J;  4MIM A;  4M9Z A;  2IXS A;  2O7O A;  2BY2 A;  3H36 A;  3IRQ A;  1ZQ3 P;  3LWF A;  1KYZ A;  2VKD A;  3ROU A;  2NXN B;  5E8G A;  3IAM 2;  1WZ2 A;  4JX4 A;  2KIU A;  3WTV C;  1JTX A;  3RPQ A;  1T2K A;  2AS5 F;  3P9C A;  3O8H A;  1KA8 A;  1MMN A;  3GZ6 A;  2K9Q A;  3BR5 A;  2ECB A;  1Z6T A;  2MLK A;  1Y0N A;  3OS1 A;  3BG7 A;  4MQ9 F;  1IXR C;  3SDG A;  4BH9 A;  4BXX J;  4M3E A;  2X85 A;  4HNV A;  5LHG A;  1O3S A;  2DQR A;  1V5G A;  3IL2 A;  4HQM A;  2LR8 A;  1K6O A;  4MTE A;  1ZK8 A;  4NBQ A;  3SZT A;  2OF7 A;  1VQ5 I;  2LY9 A;  3H1C A;  4KIS A;  1R5H A;  5D4R A;  1AU7 A;  1U5T A;  3F9K A;  1OKR A;  1H9T A;  4LB5 A;  3DKW A;  1IXC A;  2F2E A;  1X1P A;  3KCC A;  1J5Y A;  1R6R A;  2CFO A;  4UHT A;  1X1A A;  1DU0 A;  1O7L A;  4E7L A;  2R7Q A;  3BTI A;  2HEO A;  2LDU A;  2Q2E A;  3AKZ A;  2WAQ A;  3F8F A;  2FX0 A;  2DBB A;  1K83 J;  5L3F A;  1HSJ A;  5TJJ A;  2AO9 A;  3VYU B;  4HEA 2;  3H0G J;  4XRF A;  4N4O B;  5HLG A;  4EM2 A;  4F55 A;  2E1N A;  2R0Q C;  3WTS C;  3E6D A;  3I5U A;  3M8J A;  3QU6 A;  3QWL A;  2R7F A;  2H8R A;  5F6F A;  3PIP F;  3WG9 A;  5HLI A;  3WU1 B;  4LK0 F;  1X1B A;  1OCP A;  3OMY A;  3BG3 A;  5ICG A;  2LOO A;  2BW3 A;  4NHJ A;  4RB2 C;  1KON A;  4HOB A;  5CQG A;  1OLT A;  1G3S A;  1ETX A;  4EMS A;  4NB5 A;  1ETV A;  4CYD A;  3E5Q A;  5DEQ A;  3IH2 A;  4KA4 A;  2VBW A;  2X51 A;  4BDZ A;  1REP C;  2BEO A;  3DTI A;  2DT6 A;  2ELJ A;  2VBZ A;  2DW4 A;  1VQ4 I;  3EYY A;  2IGM A;  1U0J A;  1I3Q J;  3BTC A;  1UZC A;  4D7M A;  1TBX A;  3ZMV A;  4UUS A;  3L2Q A;  2Z5U A;  5LLQ A;  2PBI A;  3FF5 A;  1RNL A;  1WVR A;  2K02 A;  5JFR A;  3F8N A;  2RKH A;  2OTL I;  2HOE A;  2PFB A;  4YII A;  2F5C A;  2L3D A;  3B73 A;  4XN3 A;  3L2U A;  4XN0 A;  2E2H J;  4IRG A;  1I5Z A;  4BJ6 C;  5K1Y A;  4EAT A;  4NDL A;  2VBY A;  4BHB A;  2I5U A;  3LQR A;  2IA0 A;  2YR2 A;  2AHQ A;  4XOP A;  2F5V A;  3BR2 A;  3RKX A;  2LNB A;  1VF9 A;  1D1A A;  2VQC A;  2J5P A;  1TQI A;  1VQ9 I;  3V7S A;  1CF7 B;  2KRH A;  5CYV A;  3DU6 A;  3TGN A;  5E8I A;  3WU0 A;  5B66 C;  3SEQ A;  3ZR8 X;  1R5G A;  5HDG A;  2KIF A;  2RDP A;  3ZMD A;  3S1M J;  1Y8R B;  2GBY A;  3EUH A;  4E7J A;  4A6E A;  4MFE A;  3OYH A;  2LRD A;  1YE9 A;  3I58 A;  1YIJ I;  1T39 A;  1TT5 B;  4EJT A;  3DBH B;  3EUK L;  5DTD A;  1MIJ A;  1TT0 A;  4XLE A;  3HKZ A;  5AIQ A;  3VSK A;  2A07 F;  3W3C A;  2RGV A;  2NS0 A;  2JVG A;  5IP7 J;  2X0L A;  3GTG J;  4BDY A;  2VJ5 A;  4EJO A;  2DQL A;  5JHU A;  4CYC B;  1JGS A;  1SAN A;  2RC4 A;  1QRY A;  2QBY A;  2Y9Y A;  3W6V A;  2LY2 A;  4KN4 X;  3HUG A;  2R5Y B;  3EET A;  3CO6 C;  3KX2 A;  4Q48 A;  1VQK I;  1R49 A;  4CHU A;  5IP6 A;  5H6R A;  4BE0 A;  2L9N A;  3IKT A;  3MZY A;  3FHN A;  2B9S A;  3IC7 A;  2EA4 A;  2M5W A;  2E71 A;  3HGG A;  4JX5 A;  4WCG A;  5DV5 A;  2DJI A;  3Q0U A;  1GXP A;  5L3E A;  4MTD A;  1SD6 A;  2WAF A;  2CUZ A;  1ZEL A;  2IS4 A;  3LA7 A;  3DPU A;  1WCM J;  1T56 A;  5DCM B;  4DYQ A;  1Z9C A;  4U0V A;  5FB2 A;  1OIS A;  3FXK A;  1IN6 A;  2VB6 A;  2IA1 A;  4D5C A;  4BBR J;  2Q0O A;  4BQN A;  3EDP A;  2LD5 A;  1G6N A;  3OL3 A;  4N4N B;  4Y7N J;  2Y69 H;  5FRM A;  2H94 A;  2WY8 Q;  5D5V B;  2K9L A;  2BY3 A;  4L5I A;  3WHB A;  5F1J A;  3J7A O;  1O3T A;  3FXM A;  3NAU A;  3GUD A;  3RTR A;  5IY5 H;  5JI6 A;  3LNQ A;  1XMK A;  4KT6 A;  2MA3 A;  4O3M A;  1J09 A;  4KYW A;  2QM3 A;  3PNY A;  4CZZ A;  2LKS A;  1T08 B;  1YW8 A;  2KDZ A;  1W5C C;  2A69 F;  2MGQ A;  2RVC A;  2M4G A;  1BOB A;  3I4M J;  3PUB A;  1XTA A;  3JRC A;  3GFI A;  2X6Y A;  3HOT A;  4PSX A;  1U3E M;  2JQ7 A;  5LEK A;  2B7E A;  2XAF A;  4HV5 A;  2HYG D;  2L7Z A;  4RM3 A;  1TWC J;  1VFC A;  3CP2 A;  4G8X A;  2J5O A;  2HNH A;  4BYY A;  2R7V A;  1IUY A;  2ZSH B;  1P7J A;  3OIO A;  3GTO J;  1Y1V J;  1Z77 A;  3ABL H;  4ITV A;  3JRF A;  3LA2 A;  3DP7 A;  1FMV A;  1JI8 A;  2MG4 A;  3CJN A;  1KZH A;  3OYA A;  2LKP A;  4RLF A;  4XOT A;  1B8I B;  5EEG A;  3OS2 A;  3FWE A;  3ZRG A;  2XF7 A;  1W4M A;  1R5I D;  3TDU C;  5DM6 F;  3H5N A;  1T33 A;  2LMD A;  3RI4 A;  2ZJP F;  2L54 A;  1A31 A;  1WJA A;  3K4C A;  5CPR B;  4ZC3 A;  3GTP J;  3ESW B;  1R4M B;  4B3A A;  4FQG A;  2L01 A;  3G6E I;  2VUM J;  4HW0 A;  1B1B A;  4KNY A;  2PG4 A;  2WAD A;  5BPI A;  2L2O A;  3KPH A;  1A35 A;  3HL2 A;  3AG1 H;  1QU3 A;  4A3I J;  1NG7 A;  3S14 J;  2HQN A;  1J2X A;  2PMZ A;  2X1C A;  3FXU A;  4PK4 A;  1O3Q A;  4G7O F;  1T0F C;  4BJT A;  3QYF A;  2OA4 A;  2Z99 A;  1YIO A;  2DOD A;  5ILV A;  4NC8 A;  3NEU A;  1V5E A;  3J7Y J;  1YFH A;  3LSJ A;  1UJ8 A;  1XDS A;  2DMN A;  3RCO A;  4X0G A;  3M9A A;  3LAJ A;  4HDU A;  2COB A;  3CD6 I;  1QPM A;  1JXS A;  3HJE A;  4G94 A;  4XMY A;  2QSG X;  4GYI A;  4AC0 A;  1FP1 D;  2NVY J;  2I8D A;  1FOW A;  4CA0 A;  2FSW A;  4A3K J;  3OYK A;  2ZXJ A;  1WH7 A;  4YIR X;  4MGR A;  2BVM A;  3IWF A;  1MSF C;  4ESB A;  2DMU A;  2QEN A;  3COA C;  4BQA A;  4A3B J;  2EV6 A;  1WJE A;  3K0L A;  4EGY A;  4IHT A;  3LQQ A;  3TP0 A;  4HYE A;  2ELK A;  2H6B A;  4I76 A;  1N77 A;  2FA5 A;  3MZ8 A;  2V1N A;  2VOD A;  2XV4 S;  5EZG A;  3DXJ F;  3FDY A;  2DA3 A;  1D1B A;  4BHC A;  2B63 J;  4B3X A;  4FE4 A;  1BR4 A;  3KEY A;  5CKT A;  1JE8 A;  3GWZ A;  4ESJ A;  1YS6 A;  2GZW A;  2CV2 A;  5B5E C;  1HDP A;  3GVA A;  2XSJ C;  1HW5 A;  5ICE A;  1HKQ A;  2XGD A;  1QA6 A;  1U78 A;  2OCE A;  2XB5 A;  1RET A;  2EIJ H;  1USS A;  3QOD A;  3G2B A;  5M5W J;  1ON2 A;  1YRN B;  1K61 A;  5CVU A;  4CCN A;  4HX7 A;  1K4S A;  1WFX A;  2ZME B;  1VZ0 A;  4BEH B;  5IT3 A;  1BBY A;  2A5W A;  2ZJQ F;  2L5Q A;  2XKP A;  4K2E A;  5FLX K;  5JLX A;  5F0F A;  1XSX A;  1Y6I A;  1WI9 A;  4ZTJ A;  2IPQ X;  4L9J A;  1XGO A;  1CF7 A;  1GDT A;  3IWZ A;  4PGG A;  5J4V A;  4LIT A;  4LOC A;  3LSH A;  3G1M A;  2HFH A;  3I3L A;  4A0X A;  1I6X A;  3I56 I;  5LHH A;  4Y3O A;  4ASN A;  4HA8 A;  2E36 A;  2W48 A;  1HXD A;  4PJM A;  3U2R A;  2V1D A;  3LSR A;  3A03 A;  4OMY A;  3SZG A;  1MMS A;  4LLN A;  2KT0 A;  2IJL A;  2P5K A;  2HYJ A;  4LMY A;  1FBS A;  1E2X A;  1BI3 A;  2K4B A;  5L3G A;  4YRV A;  3JSO A;  2QQ9 A;  2WA0 A;  5IOZ A;  4XIC A;  4ENK A;  4J19 A;  3CCV I;  4R8H A;  3ASO H;  3LSK A;  3KET A;  2CJJ A;  1GLN A;  3HEF A;  1W5S A;  5F08 A;  1BL0 A;  2H27 A;  2QA4 I;  4A69 C;  1W0U A;  2CUE A;  1Z67 A;  4PCQ A;  4OAY A;  2OTJ I;  1X3Z B;  4CYC A;  3AL0 C;  1WJB A;  4L9V A;  3A1Y A;  4CCO A;  1DDN A;  4PJL A;  5LHI A;  3K4M A;  2PN6 A;  3JW4 A;  1W36 C;  3B6C A;  1YYV A;  2EZL A;  4Q47 A;  2PMZ N;  1IRZ A;  4H0E A;  1JKO C;  2ME0 A;  1B59 A;  1MJB A;  2R5Y A;  2JRM A;  3BTJ A;  2O5R A;  3FXJ A;  4I99 C;  4E7K A;  1EA3 A;  5E3L A;  1LE8 B;  2KKO A;  1GV2 A;  1BN5 A;  3FK6 A;  1YI2 I;  1FJL A;  1F43 A;  2LKX A;  2E1M C;  2PJP A;  1HST A;  2CQX A;  2X1E A;  4XK4 A;  4YFK F;  2CH0 A;  2X6O A;  2BV6 A;  1Y1W J;  4LG0 B;  1QGP A;  5ICC A;  2HDC A;  4L9T A;  3ZQC A;  2HOS A;  3DPL C;  1ETQ A;  1D0X A;  1T38 A;  3AG2 H;  5J1U A;  3KP5 A;  1U5T C;  5FJ8 J;  2M9H A;  5DCM A;  1G8X A;  4OIN F;  3ZMT A;  3PIO F;  2PI0 A;  4WXD A;  3QU3 A;  2P5L C;  3A02 A;  4S04 A;  2A6H F;  3MEX A;  5J1R A;  1Z3Y A;  3UNG C;  3I64 A;  2DFH A;  2K4J A;  4KMF A;  2A68 F;  4KFC A;  4E6K G;  4A3M J;  4I6Z A;  2RRE A;  5FFX A;  3PUF A;  4M3D A;  3KP4 A;  1S7A A;  5HOO A;  5D8K B;  4JK1 X;  1MBH A;  3R4K A;  2XRN A;  1ODD A;  2E34 A;  2FJ1 A;  2M30 A;  2Q1Z B;  2QVO A;  5B1A H;  3QP6 A;  3SXY A;  2VJI A;  3O2P E;  2NVX J;  2EV5 A;  4IVN A;  2OZ6 A;  2IRF G;  4XOR A;  3S1Q J;  4BBS J;  5J4Y A;  2BYV E;  1S7E A;  2DA2 A;  4M72 A;  1T6S A;  3GEZ A;  1PVE A;  2WB1 N;  3WGG A;  5HLT A;  2IAI A;  4IX7 A;  5HDK A;  2F5E A;  5H6Q A;  1X2M A;  3VPR A;  1W1W E;  5E3M A;  2LBF B;  4EQQ A;  3QPL A;  4WWC A;  2DFI A;  5L3C A;  1P4X A;  3KP3 A;  2M1B A;  3WGI A;  1OCT C;  1FIP A;  2VPR A;  2VL8 A;  4DW6 A;  3CCS I;  5BPD A;  4CZC A;  1X4P A;  2JMW A;  2Y75 A;  5FD6 A;  1B8I A;  1P92 A;  3BR3 A;  3K70 C;  2YU3 A;  5FLX Z;  2VBX A;  2IVM A;  4EV0 A;  2QLZ A;  1JT0 A;  1OCC H;  1XCV A;  1MJA A;  3K6G A;  1B72 B;  1WWX A;  5DS9 A;  1RUO A;  5D5X B;  4A3F J;  3DQV C;  2CRG A;  2WV1 A;  4HNU A;  3ASN H;  2P81 A;  2QSF X;  2ZXH A;  1Z6R A;  2D1H A;  3DTK A;  1Z3X A;  1ENH A;  1BI0 A;  5K7F A;  1HQC A;  1L0O C;  1FBU A;  3NWT A;  4B48 A;  4DGW B;  2YX4 A;  3ZQG A;  5EEA A;  3QPS A;  2GM4 A;  3IP4 B;  1X58 A;  3K4L A;  4I98 B;  3HOU J;  3R61 A;  1IN8 A;  1P2F A;  2EPF A;  1I6H J;  2DMT A;  3DKX A;  1QVU A;  1SAX A;  4NQW B;  3HIF A;  2V7F A;  2D5V A;  5IYD J;  4KJZ A;  4G6T B;  4U7B A;  1MMA A;  1ETY A;  3I55 I;  2CW0 F;  2EZI A;  3P9I A;  1D8J A;  1NK2 P;  2Y30 A;  5E3O A;  3C2H A;  5BMZ A;  2LH9 A;  2AQE A;  4KIF A;  1ZR4 A;  2ZFW A;  1F9N A;  2NVQ J;  4XKW A;  5HVQ C;  1R1T A;  3BTL A;  5FRN A;  2ESH A;  1QQI A;  1O7F A;  4LD5 A;  3UR3 C;  2W7N A;  3G1O A;  2VI6 A;  2L7M P;  1XSV A;  1UST A;  2ZJR F;  3HM5 A;  3IH3 A;  4KIC A;  4A0Y A;  1R1V A;  4IJA A;  3K7A J;  1KU3 A;  2G9W A;  2FEZ A;  2P7V B;  3HPG A;  2FQ3 A;  4B43 A;  1UFM A;  2WBM A;  4QSH A;  3DBL B;  4RAF A;  1LQ1 A;  1PUE E;  3TQN A;  3OYF A;  4XLC A;  4P96 A;  1EH7 A;  3KZY A;  1LFB A;  2KIM A;  4G6D A;  4YFX F;  3OYB A;  2HVQ A;  3S2D J;  2QWW A;  4IHX A;  1M1E B;  3K10 A;  4HG2 A;  1WQ2 A;  2V9P A;  2NS7 A;  3BDD A;  1YRN A;  1KU7 A;  1S5L C;  3J80 K;  2HU9 A;  3Q0W A;  4BEH A;  1YIT I;  3ULQ B;  4AIK A;  2ID6 A;  4PFO A;  1JT6 A;  1EH8 A;  2G7U A;  1V5F A;  3GLX A;  4PDK A;  2MD0 A;  3IKV A;  5FGM A;  2HXO A;  2QYO A;  1Z7U A;  1XD7 A;  4RGR A;  2KHM A;  2WV0 A;  5LGU A;  3J7Z I;  2VQH A;  4ZYG A;  1WI3 A;  2LSO A;  5M5Y J;  4ENN A;  2YUS A;  2BHY A;  1O57 A;  1PJR A;  3WTU C;  1JKQ C;  2HKX A;  3Q5F A;  3L09 A;  3SZP A;  1IV8 A;  2LFB A;  4EM1 A;  4UB6 C;  4BE2 A;  3JR9 A;  1LJ9 A;  2AXL A;  4R1H A;  1HLV A;  1EV7 A;  3IAS 2;  3MN2 A;  4B4C A;  3OYL A;  5B1B H;  1DP7 P;  3BY6 A;  3T8T A;  2VN2 A;  5EG0 B;  3ZMZ A;  1POG A;  1ZGA A;  5E1W A;  3REO A;  4HNT A;  2MH2 A;  3CJQ B;  1LEA A;  3V7R A;  1G3T A;  1RR8 C;  1O4X A;  3M1E A;  1U6G A;  2LF8 A;  4OMZ A;  3FKI J;  4JOM A;  1OYY A;  1AHD P;  2FUG 2;  4AD9 A;  1HBX G;  3TDZ C;  2VC1 A;  3PSI A;  3JRE A;  2D45 A;  2FU4 A;  4QPQ A;  2GA1 A;  2VT2 A;  2X1D A;  2JRT A;  4BS9 A;  1YHQ I;  1JKR C;  2GIZ A;  3HOY J;  3V8L A;  4YFN F;  3DCF A;  2KRC A;  1Z21 A;  3SFI A;  2Y0S A;  3BCB A;  2JSP A;  1MBF A;  3CF2 A;  3L2V A;  4F3Q A;  2FML A;  1VTN C;  1LKX A;  3CQZ J;  3KE2 A;  5HS9 A;  3OR1 C;  1QZY A;  4B1R A;  1WPK A;  3MFK A;  1BR2 A;  5JR3 A;  1FOY A;  1IG7 A;  1LE8 A;  3H3V K;  3D5L A;  4ZZL A;  3H9G A;  2P4W A;  3RIR A;  1QBJ A;  3ZN1 A;  1E0E A;  2XRL A;  2A05 A;  2H1L A;  3GME A;  3PFY A;  4HLX A;  3PO3 J;  3R0A A;  3ZQH A;  4LG0 A;  4JBA A;  2JA6 J;  1ERD A;  3WTY C;  3M3Y J;  2RNJ A;  2KZV A;  4YG2 F;  1FX7 A;  2E60 A;  1ITY A;  4C2M J;  3ML6 A;  1XB4 A;  2O3F A;  4II2 A;  5ED4 A;  2V9V A;  3E3V A;  2X48 A;  3HZJ A;  4QLC U;  2V1U A;  3DLL F;  4ZYA A;  2IGN A;  2W85 A;  4ENJ A;  3K1P A;  3OV8 A;  1ETO A;  1OYI A;  2EB7 A;  4M3B A;  3FK7 A;  1SD7 A;  2NVT J;  3FIS A;  4XSZ F;  2STT A;  1G4D A;  1WJF A;  2EIL H;  5DD4 A;  2E35 A;  3CES A;  2XRO A;  3J7A Y;  2YU9 J;  5EZH A;  1VND A;  3BG9 A;  2EIN H;  2PMU A;  5HLH A;  2STW A;  3TO7 A;  4BQO A;  2ZBK A;  3F8B A;  1YJN I;  1OYW A;  3E6M A;  2JUG A;  2R93 J;  2DTR A;  1LNW A;  2Y2Z A;  3PJR A;  2LC2 A;  2ISZ A;  4M9X A;  3VOD A;  1R7J A;  2K3F A;  2IS6 A;  5J8C A;  1DP3 A;  1T98 A;  3S15 J;  3K4N A;  4D0P A;  1W7P D;  3BP8 A;  2DMQ A;  4IHY A;  4N9H A;  4I01 A;  1BW5 A;  5IYC J;  4II3 A;  3QOP A;  2ZSI B;  3RKQ A;  2LBF A;  3QP5 A;  2Z3Y A;  4TV7 A;  2DA5 A;  1WJD A;  4KMU X;  5D6F A;  4DYR A;  1DQU A;  2H6C A;  1XGN A;  3CCL I;  3J80 Z;  3FXR A;  1SFK A;  1K4T A;  2XVC A;  2QQB A;  1U2W A;  3QRF F;  1IW7 F;  1D0Z A;  4M71 A;  2CMP A;  1H0M A;  2OBP A;  3K4J A;  4LFU A;  3BJ6 A;  1W36 D;  2G0E A;  4XID A;  1B72 A;  4ANJ A;  3E5X A;  2FBK A;  2DAO A;  3W2V A;  4HAM A;  2DMP A;  5J40 A;  3FMQ A;  1Z7L A;  3HRM A;  5CVV A;  4Z6Y A;  3P5J A;  4F7Z A;  3JRH A;  1RI7 A;  4KT5 C;  2CQN A;  1I27 A;  4EEF G;  1UCR A;  3H5A A;  3S3M A;  4B47 A;  3PM1 A;  4M74 A;  2DLL A;  1IDZ A;  3ZN0 A;  2O8K A;  2L4A A;  1MNE A;  4P1W A;  1F5T A;  5LD2 C;  1ZHF A;  4D1Q A;  4XLA A;  3I59 B;  3P9K A;  4NQW A;  2V26 A;  4PJ0 C;  1LDK B;  4P9F A;  3H35 A;  1B6A A;  3T5X A;  1FYK A;  3FIW A;  4F91 B;  4DIQ A;  3FMR A;  4MNU A;  4E7I A;  5CLS A;  4LK1 F;  3S1N J;  1OPC A;  4J00 A;  2GA2 A;  2JSC A;  3I0T A;  1FC3 A;  3WTT C;  5GPC A;  2WAQ N;  3ZMU A;  1RC9 A;  2CQK A;  2DN0 A;  2XAQ A;  5FKK A;  3CTA A;  1WJC A;  1JJ6 C;  2LG4 A;  4BKX A;  3CO7 C;  2NAZ A;  4L5J A;  2JA5 J;  1IN7 A;  3L2W A;  3PL8 A;  3C2G A;  3K1N A;  4CSW A;  4CIC A;  3DWL E;  5M3M J;  2Q8K A;  5D5W B;  5EF6 A;  3JTG A;  2K9N A;  3BG5 A;  3R0J A;  5ILU A;  3I54 A;  1I50 J;  2VKE A;  5JVT A; 
#chains in the Genus database with same CATH homology
 3GTL J;  2FQ4 A;  2DA6 A;  1U8B A;  2QF7 A;  2XB5 A;  1U78 A;  1RET A;  1PUF A;  4L5E A;  3C2B A;  5M5W J;  1YRN B;  1K61 A;  1BJZ A;  2I10 A;  2JK3 A;  1MBJ A;  1CQT A;  3GTJ J;  1SFO J;  4IHW A;  2EZH A;  1MNM C;  5JLX A;  5F0F A;  3UKG A;  4W1U A;  2N8G A;  1GDT A;  4W97 A;  4C3I J;  3GTK J;  4C3H J;  9ANT A;  4LOC A;  2XPV A;  3G1M A;  3ZOB A;  1HDD C;  3SJM A;  1OFC X;  3Q3S A;  4XRM A;  2ME6 A;  5IP9 J;  2M0C A;  4X6A J;  1IDY A;  2W48 A;  3LSR A;  3A03 A;  2KT0 A;  2HYJ A;  1ZKG A;  4DZJ A;  3GTQ J;  1EF4 A;  1FTZ A;  5C3E J;  2EQR A;  4IHV A;  5IOZ A;  4XIC A;  1NK3 P;  4J19 A;  5EG0 A;  3RQI A;  3I4N J;  3S2H J;  2Y31 A;  1IUF A;  2E2J J;  2CJJ A;  3HEF A;  5F08 A;  1BL0 A;  4A69 C;  1W0U A;  2CUE A;  1UHS A;  4CYC A;  1JJ8 C;  4DYC A;  2LK2 A;  3B6C A;  3LSG A;  2EZL A;  2PMZ N;  3M4O J;  1IRZ A;  1JKO C;  2ME0 A;  3TED A;  3TW6 A;  1JTY A;  2R5Y A;  3S1R J;  3BTJ A;  1JUS A;  4MO7 A;  1IJW C;  5FKN A;  5JLW A;  1APL C;  5E3L A;  1LE8 B;  1FIA A;  1G2H A;  1GV2 A;  1F43 A;  3FK6 A;  3JRI A;  5J3L A;  1FJL A;  2LKX A;  3JRA A;  3HOX J;  1MBE A;  2CQX A;  3CCY A;  4V2G A;  4XK4 A;  1OJL A;  3HKZ N;  2X6O A;  1Y1W J;  2LP0 A;  1X2N A;  3ZQC A;  2HOS A;  3IV5 A;  1E3O C;  1ETQ A;  4MLO A;  1ETK A;  5J1U A;  5FKO A;  5M3F J;  2K9S A;  5FJ8 J;  2M9H A;  3HOW J;  3A02 A;  4RBO A;  5J1R A;  1RKT A;  2JA7 J;  4A3M J;  2Y0S N;  4I6Z A;  5M5X J;  1HCR A;  4M3D A;  2QCO A;  1QVT A;  1U9O A;  4A3D J;  1TWF J;  4MIM A;  1MBH A;  2O7O A;  2FJ1 A;  3B6A A;  1ZQ3 P;  1BW6 A;  3JRB A;  1Z0X A;  2EH3 A;  2XB0 X;  2NVX J;  4M3F A;  4JX4 A;  3A01 B;  1JTX A;  3S1Q J;  4BBS J;  2HDD A;  1S7E A;  2DA2 A;  3O8H A;  4BY1 J;  4BY7 J;  2R92 J;  2NOG A;  2WB1 N;  2K9Q A;  3BR5 A;  2IAI A;  2ECB A;  3S16 J;  2HOA A;  4D7N A;  5E3N A;  1X2M A;  3BQZ A;  3VPR A;  5E3M A;  3SDG A;  3NAR A;  4BXX J;  3QPL A;  5C4X J;  4M3E A;  4HNV A;  3RZD J;  1OCT C;  3ZQF A;  1FIP A;  2LR8 A;  2VPR A;  4DW6 A;  4FCY A;  1ZK8 A;  2JMW A;  1B8I A;  5F27 A;  2OF7 A;  3BR3 A;  3MKL A;  2LY9 A;  2H1K A;  1GV5 A;  1AU7 A;  2XGC A;  1RR7 A;  2E19 A;  1JT0 A;  1B72 B;  1H89 C;  5C4J J;  1ORK A;  2XPW A;  5DS9 A;  1DU0 A;  2RAE A;  3BTI A;  4A3F J;  2CRG A;  2WV1 A;  2EBI A;  2DA4 A;  2LVS A;  2P81 A;  2FX0 A;  1K83 J;  3HDD A;  1IV6 A;  2AO9 A;  5EDN A;  1ENH A;  3H0G J;  5EGO A;  2IBD A;  3Q0V A;  5K7F A;  1R9T J;  2R0Q C;  5EEA A;  3ZQG A;  3QPS A;  2GM4 A;  1FEX A;  2TCT A;  1X58 A;  1H88 C;  2H8R A;  4M3G A;  3HOU J;  1HOM A;  3BR0 A;  1I6H J;  2DMT A;  1QVU A;  4D5F A;  2R5Z B;  1XC5 A;  1GT0 C;  1OCP A;  2D5V A;  5IYD J;  5IPA A;  3DEW A;  1TWH J;  3BG3 A;  1ETY A;  2EZI A;  2MW8 A;  1NK2 P;  2Y30 A;  5E3O A;  2JJ7 A;  1ETX A;  1ZR4 A;  1IGN A;  1ETV A;  3IH2 A;  2NVQ J;  3E7L A;  1RPW A;  3BTL A;  2HXI A;  4A3L J;  3ZQI A;  1I3Q J;  3BTC A;  3G1O A;  5EYR A;  4A3C J;  2VI6 A;  2L7M P;  4D7M A;  4UUS A;  3HM5 A;  1WH5 A;  3IH3 A;  1D5Y A;  4X1E A;  3K7A J;  3HGY A;  1NTC A;  4FE7 A;  2E2H J;  3OOU A;  1AKH A;  4QSH A;  1PUF B;  4NDL A;  1LFB A;  4M6V A;  2AHQ A;  1MH3 A;  3S2D J;  3TP3 A;  3BR2 A;  4IHX A;  1VF9 A;  1YRN A;  2EZK A;  2NS7 A;  1MH4 A;  2M34 A;  1TC3 C;  3Q0W A;  2HQ5 A;  4A3J J;  2ID6 A;  5FKM A;  1JT6 A;  5GP9 A;  2L7F P;  3D1N I;  2HXO A;  2L9R A;  5K7H A;  2VKV A;  3S1M J;  2GBY A;  2CU7 A;  3JRD A;  1WI3 A;  4MFE A;  3BT9 A;  5M5Y J;  1P7I A;  2XPU A;  2YUS A;  3OSG A;  1U9N A;  5F04 A;  1JKQ C;  2JN6 A;  2LFB A;  4C3J J;  5FKL A;  2JA8 J;  3JR9 A;  5DTD A;  4XRS A;  3TW7 A;  3WHC A;  1HLV A;  1DU6 A;  3HOZ J;  3MN2 A;  4B4C A;  4JYK A;  4JP0 A;  4JX6 A;  5IP7 J;  5EG0 B;  2ID3 A;  3GTG J;  1POG A;  1O4X A;  1UMQ A;  3L1P A;  1ZR2 A;  4CYC B;  4IEJ A;  5F0H A;  3FKI J;  1TWA J;  1SAN A;  2NS8 A;  1AHD P;  2IEK A;  3GBG A;  1H8A C;  2ZB9 A;  1QRY A;  3JRE A;  2Y9Y A;  4MFD A;  3W6V A;  5F0C A;  2HOT A;  1JKR C;  3HOY J;  2L0K A;  2R5Y B;  3HB9 A;  3DCF A;  5IP6 A;  3SFI A;  3JRG A;  1MBF A;  2TRT A;  3CQZ J;  1JKP C;  3GTM J;  5HOD A;  4B1R A;  1WPK A;  1IG7 A;  1WGX A;  4AUX A;  3H3V K;  1VI0 A;  2DTZ A;  4QIW N;  1GUU A;  1LE8 A;  3HGG A;  4JX5 A;  1TWG J;  3Q0U A;  1FTT A;  2XRL A;  3PO3 J;  1RKW A;  1GVD A;  3ZQH A;  2JA6 J;  1WCM J;  3M3Y J;  1T56 A;  1ZGW A;  4DYQ A;  1ITY A;  4D5C A;  4BBR J;  2DA1 A;  3BQY A;  4C2M J;  2LD5 A;  4Y7N J;  2X48 A;  4A3E J;  2O9L A;  3ZQL A;  3WHB A;  5GPA A;  1XG1 A;  5J1Y A;  5F1J A;  2HI3 A;  1ETO A;  5FLV A;  4M3B A;  3FK7 A;  2CQQ A;  3NAU A;  2NVT J;  3FIS A;  3LNQ A;  1ETW A;  4QTR A;  1UG2 A;  3QQA A;  1W0T A;  3LSP A;  1MBK A;  3HOV J;  2KDZ A;  2MGQ A;  2YU9 J;  5EZH A;  1VND A;  3BG9 A;  4FTH A;  3I4M J;  2XSD C;  1HF0 A;  2M2E A;  3JRC A;  2XGE A;  2M8G X;  2R93 J;  2Y2Z A;  1RES A;  3A01 A;  4XRS G;  2L7Z A;  1TWC J;  1VFC A;  2X9D A;  4UUT A;  3S15 J;  1JUP A;  1P7J A;  3LOC A;  5K7Z A;  2DMQ A;  3OIO A;  4IHY A;  3GTO J;  1Y1V J;  1Z77 A;  3JRF A;  1BW5 A;  5IYC J;  2MG4 A;  3RKQ A;  2DA5 A;  1QPI A;  1B8I B;  2CUF A;  4DYR A;  4ABZ A;  4DZP A;  3G1L A;  2LLK A;  3OSF A;  1T33 A;  3K2A A;  4Y52 J;  4A93 J;  3GTP J;  1BA5 A;  2G0E A;  4XID A;  2R7Z J;  1B72 A;  4B3A A;  2VUM J;  3O8G A;  1ZTR A;  1MBG A;  2LTP A;  2DJN A;  3F0C A;  1JUM A;  1LFU P;  3S17 J;  5IYB J;  2DMP A;  2MSY A;  4A3I J;  4AYB N;  3S14 J;  5EGO B;  3JRH A;  5C44 J;  3BR1 A;  4EEF G;  1F36 A;  1MSE C;  3PM1 A;  1IDZ A;  2O8K A;  3LSJ A;  2DMN A;  2COB A;  3CDL A;  2DA7 A;  1Q1V A;  4A3G J;  4AC0 A;  2NVY J;  4S0H B;  2R5Z A;  4A3K J;  3CMY A;  2E2I J;  1A6I A;  3FIW A;  1WH7 A;  3IH4 A;  4G12 A;  4GFB A;  1MSF C;  3HBL A;  2DMU A;  4A3B J;  4V2F A;  3S1N J;  2OPT A;  1A5J A;  3TP0 A;  1JGG A;  4FIS A;  2ELK A;  2K40 A;  4I76 A;  5GPC A;  2WAQ N;  3BR6 A;  5FLM J;  3MVP A;  2DN0 A;  1IC8 A;  5EZG A;  1XS9 A;  2GLO A;  2DA3 A;  5FKK A;  4UUS B;  4RDU A;  1JJ6 C;  4BKX A;  5IOY A;  2Y9Z A;  2B63 J;  4FE4 A;  2JA5 J;  5BNG A;  2YS9 A;  2FD5 A;  2E1O A;  5M3M J;  5EF6 A;  3RZO J;  1HDP A;  1AKH B;  2K9N A;  3BG5 A;  2JWT A;  3PO2 J;  1I50 J;  2XGD A;  2VKE A;  2ECC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...