1OYIA

Solution structure of the z-dna binding domain of the vaccinia virus gene e3l
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
RSNAEIVCEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords double-stranded RNA-binding protein
publication title The solution structure of the N-terminal domain of E3L shows a tyrosine conformation that may explain its reduced affinity to Z-DNA in vitro.
pubmed doi rcsb
source organism Vaccinia virus
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1oyiA00
2XRNA 5HS9A 3IKTA 2FA5A 2YR2A 2CYYA 5AONA 3W6JB 1I6XA 1BOAA 3BDDA 3KEQA 2RQPA 4S05A 1KU9A 2L3DA 1I5ZA 4MEXF 5E18F 2VBXA 4RGRA 5ICCA 1TTYA 2DQRA 2L02A 1IN6A 1ZG3A 5FGMA 1S6LA 1XDUA 5D5XB 4HLXA 1P4WA 3FX3A 1B1BA 3BJOA 4EJVA 4AIJA 1UHMA 5JHUA 1TW3A 1O57A 4BXUA 2VBYA 5LGTA 2STTA 3DV8A 4IRHA 2EA2A 2JRTA 3AAFA 4LG0B 3F3XA 1BI2A 3WE2A 3WODF 4UVCA 5L3EA 3SQNA 3J7AO 2VOPA 1JGSA 1FLIA 2E1NA 4CO8A 3DPTA 1ZGJA 3CUQA 2FE3A 4WXDA 2Z99A 1TNSA 2XVCA 1KQ8A 4HDUA 3ZMDA 2W85A 2J5PA 4IVNA 3GLXA 1BN5A 1SD7A 4IRIA 1Q1HA 2CWEA 5JVTA 3FF5A 4M6YA 2OAZA 5ED4A 2NNYA 1FX7A 3HSFA 1W7PB 1YYVA 5D4SA 4Z2YA 4I0AA 1FP2A 1T98A 5FB2A 1PP7U 2YX7A 4EGYA 4EJWA 2UZKA 3RPQA 1FP1D 3KEOA 1STZA 2V6CA 1J9IA 4KN4X 1WI9A 2LSOA 5L3GA 4L0YB 2FQ3A 1D8JA 2STWA 3JTGA 3WTWC 3TQNA 2KIMA 3GUDA 2XASA 4HDVA 4I7HA 1SFUA 1HKTA 3H3UA 3F6OA 2K27A 3F22A 4XSXF 5CVUA 4N9HA 3LQRA 2OA4A 3TO9A 4U0WA 1H9TA 3M1EA 3RKWA 5LGNA 5IT9Z 2DTRA 1FBSA 2PN6A 3CO6C 1IUYA 1WWXA 4AWXB 1FYKA 2NS0A 3R0AA 3FM3A 1OYIA 1FZPB 4I09A 1AOYA 3IRRA 4PDKA 3P7NA 4G9YA 4I2OA 1R58A 3VFZA 4PCQA 5BPDA 1BC7C 4BH9A 4EV0A 2BE5F 1U5TC 2LF7A 4JK1X 1GVJA 5LBQA 1F5TA 2M45A 3JSOA 3FZVA 3WTZA 3JAMZ 1IN8A 1JHHA 1R1UA 2MH9A 3E6BA 3IC7A 2VONA 4HA8A 2OBPA 1W5SA 2W24A 2GA1A 1QNTA 1KU2A 2QM3A 4UVBA 4OOIA 5HLGA 2V1DA 2HWVA 4OIOF 3QAHA 2P5VA 1J7KA 4IRGA 5L3DA 1CF7A 1I27A 4U7BA 2EV5A 4UV9A 2PMUA 4HV6A 1YLFA 1HBXG 2A5YB 2YX4A 4M73A 4A6EA 1U78A 4EJOA 1G4DA 1LVAA 1NHAA 3CUQC 3QRFF 2D45A 3FMSA 2UWMA 2J5OA 2VBZA 3L09A 1YIOA 2XAJA 2XROA 3TDUC 5LHGA 1XGSA 3RJPA 1S3JA 3GWZA 4AIKA 1H0MA 2CG4A 3KETA 1LQ1A 4ENMA 3QP5A 1BBYA 3ZP5A 3WTYC 3IHUA 1EH7A 1MDMB 4I0BA 3T1BA 4IXAA 2O8XA 2XUBA 5ERIA 1UB9A 3ZMUA 1ZRCA 4A0XA 3RI4A 3FXUA 1V4RA 4U7DA 4U0VA 1YFHA 2EK5A 2BYVE 3ZQ7A 1LJ9A 2ISZA 2FF4A 2VODA 1R00A 2EFWA 2Z33A 4OINF 2VBWA 4WF2A 4RB3C 1OYWA 2XAFA 4Y17A 4P9FA 1REPC 2VOOA 2P8TA 1T6SA 1I1GA 4P5OA 3PQJA 3HTUA 5KK1A 2QBYA 5LHIA 2HYFA 2YPRA 2A69F 4U88A 1MJ9A 1Z1DA 1ZREA 3JAMK 4TV7A 2O6GE 2B0LA 2DU9A 2COMA 2AS5F 4N9IA 3J81Z 2CW0F 4FT8A 4QLCU 4L9VA 2EV6A 4I02A 1MJAA 4LLLA 5E20A 2DO7A 4L9TA 2E1CA 2Y48A 4G6DA 5ILSA 2FNPA 2XKOA 3G73A 4CGZA 3WU0A 1T2KA 3R6SA 2ZNYA 2ETHA 2ZJ2A 4RB2C 3ZMTA 2PG4A 5F64A 3C7JA 1Z91A 2FOKA 1IRFA 2BGCA 2V1XA 2JPCA 5E1XA 5DEQA 4I01A 1FPQA 1IN5A 2W57A 3ABTA 3CO7C 1SMYF 5E8IA 3K1NA 4G94A 2P7CB 4AD9A 1WRJA 2HEOA 1MD0A 1UCRA 1FBUA 2F5CA 3VEPA 2MA3A 3FM5A 4KMFA 3MQ0A 1MZBA 2GWRA 2ESNA 3F8CA 3EYIA 3EYYA 5DDGA 1G3TA 3ZN1A 1GHCA 3ZMSA 5DV5A 1D5VA 3DPLC 3MWMA 3U1DA 1TQIA 2F5EA 4BHBA 2K4BA 2GA2A 3E97A 1YTYA 5TRDA 3EDPA 1Z6TA 4R79A 2TDXA 2XAQA 4XRFA 5LEKA 4O6JA 2X4HA 2Z5UA 2HZTA 2P6SA 3HOSA 4HZFA 1YQAA 2W25A 1LNWA 4ETSA 1O3QA 4M9XA 3PFIA 2FMLA 5K5OA 4O3MA 3ECHA 1JE8A 2GIVA 5IT3A 2QENA 4LJZF 1L0OC 4M74A 2PMHA 3E6CC 1P4XA 3IWFA 4LK1F 4F7ZA 1ON2A 2H6BA 1ZLJA 4KUMA 4YFKF 4YIIA 4WXCA 5CYVA 1QQIA 1K78B 4HBLA 4DQ2A 1IF1A 3I4PA 1ZN2A 2DW4A 2PI0A 3P9CA 1OKRA 1IXSB 2K86A 3F23A 2XAGA 1SFEA 4M6XA 3V7SA 2LDUA 1O3RA 2M30A 3BPVA 3QU6A 3VOEA 4FX4A 3R61A 3I54A 3O6BB 1EV7A 3BWGA 3I58A 4A12A 5DCMB 4LLNA 4LD5A 1IXCA 5ILUA 1I1SA 3R60A 2XAHA 5EEGA 1J75A 1B4AA 2EFNA 3SHFA 1SD5A 3V4GA 3V8JA 3KZYA 5EEHA 4XSZF 1XGMA 2PLYA 5DUIA 4Y13A 4WWCA 2YSRA 1U5TA 4GGGA 4P96A 1AWCA 1B9MA 5H6RA 4D0PA 2ADUA 3QP6A 5D5UB 4RS8A 1XGOA 2X0LA 2BV6A 5ICGA 2JTVA 1HKQA 2A6HF 4KIBA 2E7WA 2ZFWA 3KP4A 3SXYA 2BEOA 1PP8F 2K02A 2G7HA 2GAUA 3TGNA 5FD6A 4G7HF 5L3FA 2ZMEA 3KP6A 1ZRFA 1R5HA 3C1DA 2NRAC 2ISYA 2R7DA 4EJUA 2KKOA 2OD5A 4KIGA 1RI7A 4ESBA 4R1HA 3F8BA 3WTUC 4B09A 4RAYA 2O03A 4FX0A 3J80K 3CUQB 2CQKA 1VTNC 2PEXA 1F9NA 3QU3A 1DUXC 2DQLA 3I64A 1BM9A 4U0YA 3COAC 2EWNA 2OU2A 2RN7A 1DP7P 4A6DA 3T5XA 2ACJA 2R7FA 4HOBA 1RUNA 1ZAOA 2ZBKA 5CVIA 3E6MA 5HLHA 3LQQA 1XMAA 1IRGA 2CO5A 4ZH4F 4BHPA 3IL2A 1FSEA 4ZYHA 2ZXJA 4CICA 1OYYA 4BYYA 3MCZA 4BHCA 4R8HA 2HQRA 2P5LC 3H92A 3E5QA 5A2QZ 4LLGF 3H3ZA 1USTA 1R22A 5ICFA 2IPQX 1BIAA 1HKSA 2DFIA 1SD6A 4HF1A 2QWWA 3WTSC 3KCCA 2W84A 4K2EA 4N0BA 1W5TA 1C0WA 2A3SA 3IRQA 2GZWA 2V1UA 1TQMA 1ZH5A 1HSTA 1HW2A 2EJRA 4PZJA 3VB2A 3KP3A 3C3WA 1B9NA 4HW0A 4A5NA 3LAPA 3WGIA 1JXSA 2HTSA 4OMZA 1WSUA 4NQWA 3D5LA 2JZYA 2PFBA 3BROA 4MEYF 5LRRA 2CFXA 4CXFA 3CTAA 3BOQA 4G8XA 3SZPA 1R23A 4JQFA 1FYLA 2M1BA 3L7WA 3Q9SA 1G3SA 5CLSA 4H0EA 5DYMA 4HX4A 3P9KA 1CF7B 3S2WA 5CVVA 2R3SA 1IZ1A 2XV4S 1T0FA 5DD8A 2ELHA 5FFXA 6PAXA 1U6GA 3U2RA 2JT1A 3FWEA 5AIPA 5CVJA 2AXLA 1UHWA 1ZYRF 2Y0MA 2QQBA 2VE9A 2IA1A 3WGHA 2PBIA 3GFIA 3TOBA 3V8KA 2H27A 2Q0OA 3SFZA 2L4MA 4A2UA 4HV5A 3U9GA 5A2QK 4EQQA 4HX7A 3CLOA 1RZ4A 1E17A 4I98B 3KP7A 4HQEA 2L4AA 3GFLA 2FU4A 3FMQA 3GX4X 2A07F 5IT9K 1ZG1A 1GXPA 1Z05A 5D8LB 4L5JA 2UXXA 4M71A 4GO1A 2FEZA 1LDKB 4Q4ZF 2Q2EA 3MAJA 1MJBA 1EH8A 5HDKA 3DP7A 3I59A 3BPXA 2HKOA 3HHGA 2A61A 2DPDA 1ZLKA 2F5FA 5HDGA 4ENJA 1JHFA 4XLNF 3HRMA 3WG9A 4S04A 4KT5C 2JPBA 1XDSA 2QQ9A 3V8LA 3BJ6A 2QBYB 5D5WB 3GF2A 4EJTA 3IWZA 3TO7A 1Z7UA 4BNCA 2XIGA 3F21A 4UXNA 4UNOA 3GFMA 4Q48A 5H6QA 3GW2A 3B73A 4HF0A 1X3UA 2QUFA 4MNUA 4GCVA 5LEJA 2Z9OA 1YS6A 1UFMA 4MQ9F 2IRFG 5J8CA 3EUHA 1H9GA 4QWQA 2WTEA 3GYHX 1SMTA 2XHKA 3T8RA 2LF8A 1CGPA 1J0RA 1R36A 3HRTA 4G7ZF 1FYMA 3KLNA 1ZRDA 3ZPLA 4IHSA 4KN7X 4B8XA 1ULYA 4HYEA 4KFCA 4A0YA 3HOTA 3RTRA 3PQKA 4YG2F 3FXQA 1S7OA 2L54A 2WV0A 1OPCA 3BZ6A 4GYIA 1T38A 4EGZA 4RAZA 1A04A 2FRHA 3GXOA 2UXNA 5CJ9A 1R1TA 1USSA 2CGPA 2V9VA 1ZG5A 2ESHA 4YFNF 2IT0A 2VT3A 2HDCA 2FBKA 2O61A 2DBBA 1IN7A 4UHTA 3ERED 1Z9CA 1HW5A 4LB6B 4WX9A 2NYXA 1P4AA 2QQAA 3L2CA 1BC8C 3V7CA 3GO5A 1XSXA 3HYIA 1OR7A 2DT5A 5L3CA 2HTJA 4EM2A 1S29A 5JFRA 4HQMA 5HVQC 1O7LA 2MLGA 3F72A 1TW2A 1W7PD 1R1VA 3RYRA 3I71A 5F6FA 4L0ZB 4ESJA 2A68F 3RKXA 4LK0F 4UVAA 1G6NA 1U8RA 5DUKA 3DXJF 5D5VB 3F8FA 1OMIA 3LA3A 2EFOA 2V79A 3M8FA 4HLYA 3F8MA 4YIFA 3J81K 4BAYA 3W6KB 3DQVC 4ASNA 1WKMA 4EVIA 3I5UA 3M9AA 3K1MA 4M72A 2FSWA 4PGGA 1QGPA 1ONVA 2MH2A 3RKYA 5ICEA 2HOEA 2CSOA 4LMYA 1Y0UA 5LGUA 1FWZA 1BI1A 2FMYA 5K5QA 4KA4A 2IW5A 5HLIA 3WTVC 3REOA 3Q5FA 1SAXA 4M9ZA 2BBYA 3R4KA 5BMZA 2Y75A 1XSVA 4GXOA 2RGVA 3WU1B 1XB4A 2IVMA 2ZCWA 2FBHA 4LGWA 2NAZA 3HRUA 5FO5A 1P2FA 3HRSA 3NQOA 4HX8A 4OU0A 1O3TA 1Z6RA 4ZZLA 4MTDA 2JSCA 4ZYDA 2DK8A 4KYWA 4ON0A 3VODA 3TOAA 1HQCA 1BJAA 1J59A 4OMYA 1YW9A 1KU3A 3M8EA 3N97A 3BP8A 2OZ6A 1U5TB 2KJBA 1XCVA 3WTXC 4EMSA 1XCBA 1U2WA 4KICA 1BI0A 2PQ8A 5DCFA 2C6YA 3RDIA 3E5XA 1YG2A 3WGGA 3GFJA 4Q47A 2WWYA 2M8EA 2ZMEB 3HSEA 1L3LA 3KE2A 2RDPA 3ABUA 1XD7A 5HOOA 5E1WA 4LG0A 4ZYGA 2EA4A 1ZHFA 1F4KA 2RKHA 4Y15A 3JW4A 4MTEA 3HTSB 3O2PE 1XSDA 5J8FA 2DK5A 1FY7A 3RIRA 4YFXF 2MD5A 1QO0D 3BY6A 5E17F 4P9UA 4WXHA 1W7PA 2QVOA 1S8NA 3GEZA 1WQ2A 2EB7A 4KDPA 3GZ6A 2P4WA 4WK8F 3HUGA 1F1ZA 3T0YA 4A0ZA 2H94A 4RGSA 3OV8A 1FSHA 2ZNZA 3E5UA 2HS5A 4LB5A 4A5MA 2XGXA 4MQVA 1FBQA 2M87A 4RB0A 4DNCA 2Z3YA 5ILVA 2VN2A 3ZMZA 1V3FA 1XMKA 3ZN0A 4WCGA 2OQRA 3F6VA 1KQ0A 1ON1A 1B59A 4EM0B 3L00A 3G3ZA 4CZZA 4PGHA 2D1HA 3I53A 3HHHA 2VC0A 2O3FA 4JBAA 1PUEE 1KYZA 1YW7A 4HF2A 2G9WA 1B6AA 5BQTA 5TJJA 2OQGA 2ZO4A 3CJNA 3V7RA 1QZYA 4O5VA 5CVRA 3D0SA 1S7AA 1QBJA 2MLKA 3MFKA 1ZGAA 3F8NA 1G3WA 4KIFA 5LRSA 3MZYA 4IJAA 1P6RA 3ECOA 2VXZA 3K0LA 3R0JA 4NHJA 2OZUA 1DPUA 5K1YA 4ENNA 5FFZA 1BIBA 2IA2A 3K9TA 1MGTA 3QPTA 1QZZA 4OIRF 3OOPA 3C18A 3ZMVA 5J6XA 5JR3A 4ENKA 1FC3A 2RC4A 1O3SA 3QOPA 2RNJA 3N4MA 1R7JA 1TNTA 2RV8A 4RGUA 1GXQA 1LEAA 3RYPA 4E70A 4L18B 4AIHA 2H6CA 4CDGA 2PJPA 3FMRA 3LA2A 1J2XA 3LSTA 4IHTA 4EM1A 4GYGA 1LEBA 1ZARA 1YS7A 2FBIA 4ZZDA 3RPUA 3FXRA 1YW8A 3O3KA 3LFKA 4FHTA 2DAOA 4G6QA 4CYDA 4RGXA 1HXDA 4BQAA 5D8KB 1K7AA 2RVCA 4OIPF 3BJAA 1EH6A 1IXRC 1MDMA 4M9SA 4P55A 5AIQA 2GXBA 3GZ5A 1MKMA 1DDNA 1RIOH 4UUVA 2FNAA 5D6EA 3I59B 5K5RA 1TQPA 5BPIA 2F5DA 2G7UA 3JSPA 3MEXA 3B02A 3KFWX 5LLQA 3LA7A 2L01A 5L3BA 1D8KA 5D6FA 1K79A 4LFUA 1K6OA 1KGSA 2KIUA 3P9IA 3TO6A 1RNLA 2VE8A 5H20A 3NEUA 1FT9A 3HSRA 4L5IA 1IAWA 1PDNC 5FLXZ 1O7FA 1LDDA 3DEUA 2XKPA 1RUOA 3ISPA 2MC3A 5BS6A 2FXAA 3E6DA 1ODDA 2EV0A 4OIQF 3T8TA 2Q8KA 4L9JA 1HSJA 2DLLA 2IJLA 3KZZA 4XLPF 1KQ9A 3CDHA 2K4JA 3KP2A 2DI3A 3TKYA 2GXGA 1LB2A 4Q5SF 2P6TA 3WE3A 3FHZA 2EFQA 2DPUA 2P5KA 1KU7A 2P7VB 1TLHB 2LNBA 4KMUX 5F1RA 4UV8A 3HIFA 2KRFA 2WC2A 1SFXA 1TBXA 3NRVA 2IP2A 5JI6A 2KIFA 2YU3A 1R5GA 1DPRA 1BI3A 2HGCA 3DF8A 4HAMA 1U3EM 2QLZA 2F2EA 3ROUA 5BOXA 2QZ8A 4IPAA 2HQNA 3E3VA 3QPHA 5LHHA 1J5YA 1T39A 2A6EF 2H09A 1KYWA 2HYGD 4L9NA 1FOKA 4MGRA 4AVPA 4XBFA 2VT2A 1G3YA 1IN4A 5E1ZB 3K69A 3SZTA 2D1VA 2E7XA 4ZYEA 4RB1A 3ELKA 2K7LA 5KVRA 3TDZC 2D2WA 2KJCA 2M5WA 2ZKZA 5FLXK 3CUOA 3EQLF 3LAJA 3ML6A 1P92A 3DFGA 3ULQB 4IF4A 3IKVA 2VC1A 1FNNA 4G7OF 3M7GA 5DD4A 4CHUA 5HS7A 3I0TA 1D3YA 5HS8A 4MHGA 1LDJA 2HR3A 2LKPA 4ESFA 3KLOA 1HW1A 2IA0A 3WTTC 1XGNA 1K78A 3DKWA 3J80Z 2O0YA 2QYOA 5HDNA 2NNNA 3Q9VA 1IW7F 2GQQA 1QPMA 5E8GA 1SD4A 1W4MA 3MZHA 3K2ZA 4KNYA 3JTHA 1YO5C 5FD5A 2EFPA 2MBFA 1E2XA 4NB5A 1XN7A 3LWFA 1KA8A 2HKXA 3EETA 5D4RA 3GVAA 3K1PA 5DCMA 3L9FA 2HFHA 3KP5A
chains in the Genus database with same CATH superfamily
1B8IB 2XRNA 4E7HA 1GT0C 5HS9A 5FRMA 3K4LA 2Y69H 3IKTA 1JJ6C 2JRMA 3VYTB 2FA5A 2ZSHB 1UG0A 2YR2A 4AM3A 3BZKA 2CYYA 5AONA 3W6JB 4QPQA 1I6XA 3AG2H 4XNFA 2PJRB 1RPWA 3PSFA 1BOAA 3BDDA 3GTGJ 4A3BJ 3KEQA 4X0GA 2RQPA 3NAUA 4S05A 1KU9A 2K9NA 2L3DA 2K9QA 3HBLA 1I5ZA 1MMSA 3QYFA 5FKLA 4MEXF 5E18F 4C3HJ 2VBXA 3HKZN 3PIPF 4RGRA 5ICCA 1TTYA 3LSRA 2NVXJ 3ASOH 2DQRA 2KLOA 2L02A 1IN6A 4CCJA 1ZG3A 5FGMA 2IS1A 3RSNA 1YHQI 3HB9A 1LFPA 4P1WA 2R5ZA 1S6LA 1XDUA 2R93J 5D5XB 3LOCA 4ZDLA 4HLXA 4I6ZA 2XGDA 1P4WA 3FX3A 2PMZN 3LMMA 2TCTA 2NVTJ 4HG2A 2RQQA 4BJTA 1B1BA 3GTJJ 3GTPJ 1JTYA 3BJOA 4EJVA 4AIJA 4CSWA 1UHMA 5JHUA 1TW3A 3L1PA 4F92B 3OIQA 1O57A 2WY8Q 4BXUA 2VBYA 5EGOA 1WJDA 4XMYA 3VSKA 4L5EA 1TL8A 2EPFA 5LGTA 2STTA 3DV8A 4G12A 1ACIA 4IRHA 1X19A 2EA2A 2JRTA 1H88C 3DPUA 4Y33A 2JVHA 1T56A 2VQLA 5E3NA 3AAFA 1BL0A 4LG0B 3G1OA 3F3XA 1BI2A 3WE2A 3C2HA 3VYUB 2NXNB 3WODF 4UVCA 5L3EA 3SQNA 3J7AO 2VOPA 1JGSA 1FLIA 2E1NA 4CO8A 1NH3A 4E6KG 1NK3P 3DPTA 1ZGJA 3CUQA 2OTLI 2FE3A 4WXDA 2Z99A 2VKEA 1TNSA 2XVCA 1KQ8A 4HDUA 3N05A 1VQKI 4UUTA 1IDZA 3VYRB 1ETXA 3QODA 3ZMDA 2W85A 2J5PA 4IVNA 4N4NB 4DBQA 5E3OA 3MKLA 3GLXA 1BN5A 2HI3A 4FE4A 4BS9A 3UR3C 2Z1DA 1SD7A 1FIPA 1WFXA 4BEHA 3S3MA 4IRIA 3TP3A 4D9JA 1Q1HA 2CWEA 2LBFA 5JVTA 3FF5A 2HVQA 3HPHA 4M6YA 2OAZA 1X58A 4FTHA 5ED4A 2MC4A 1FX7A 3HSFA 1W7PB 4CCMA 2X1DA 2NNYA 1YYVA 2K3PA 5D4SA 3PUFA 2GLOA 4Z2YA 3FDYA 4I0AA 1FP2A 3HKZA 3OYIA 1T98A 5FB2A 2BY1A 1PP7U 4JX5A 3AG1H 2YX7A 3X2QH 1OLTA 1X3WB 4HRIA 2KZGA 4EGYA 2E2HJ 4I76A 4B1RA 3BT9A 1MH4A 4EJWA 2UZKA 3HUGB 3RPQA 2F6CA 1FP1D 4NNJA 3I9V2 3KEOA 1STZA 3LSIA 1YX5A 2V6CA 1J9IA 4KN4X 1WI9A 1YJNI 2LSOA 2LR8A 3HOZJ 2JA7J 5L3GA 4L0YB 4HSTA 2FQ3A 1D8JA 2STWA 4E7IA 3JTGA 2H8RA 1YRNB 3WTWC 3TQNA 4XOTA 1A35A 2KIMA 3GUDA 2XASA 2LRDA 1J09A 4II2A 5B1BH 3CMEI 4HDVA 2E19A 4I7HA 2M4GA 3BQZA 1SFUA 1WGXA 2LMDA 4JYKA 3SYTA 3J7YJ 1FTTA 2LC2A 1HKTA 3H3UA 3F6OA 1R4NB 5J40A 2K27A 3A01A 3F22A 1NG6A 1JKQC 1ETOA 4XSXF 5EZHA 5CVUA 4N9HA 2AHQA 1FMVA 1TWAJ 2I10A 3LQRA 2OA4A 3TO9A 3IH2A 4UB8C 4U0WA 1H9TA 3M1EA 2BY3A 3GLLA 3RKWA 5LGNA 5IT9Z 2DTRA 1FBSA 3ZQFA 2PN6A 3CO6C 3CP8A 3GTKJ 1ORKA 3ZQCA 1IUYA 1WWXA 4AWXB 1FYKA 2VIXA 2NS0A 1LVKA 3R0AA 3FM3A 3OYCA 2HXOA 3D5RC 1SVOA 1OYIA 1FZPB 2JN6A 2WB1N 4I09A 1AOYA 3IRRA 1O4XA 2VKDA 4PDKA 3RQ4A 4QIWN 2BZTA 3B6CA 3P7NA 2O5RA 4G9YA 3S8PA 4W97A 4I2OA 2K9LA 3M8JA 1K6YA 1R58A 3ZQLA 3VFZA 1FIAA 4PCQA 5BPDA 2W7NA 1BC7C 4BH9A 4EV0A 2BE5F 3U21A 1K61A 1BR1A 1U5TC 2LF7A 4AVZA 4JK1X 1GVJA 3CJTB 2W00A 5LBQA 1F5TA 2M45A 3JSOA 2L0KA 3FZVA 3AFHA 4XOPA 3WTZA 3JAMZ 3A2KA 2ELKA 2LKSA 2IS6A 1IN8A 1JHHA 3CDIA 1RR7A 1R1UA 2MH9A 2QSFX 3E6BA 3IC7A 2VONA 4HA8A 1E0EA 2EINH 4A3JJ 2OBPA 1GDTA 2H1LA 1W5SA 2LY2A 2W24A 2GA1A 1QNTA 3ONQA 1KU2A 3OL4A 3OYDA 2QM3A 4UVBA 3S16J 4OOIA 1VQ9I 1CQTA 1RESA 5HLGA 2V1DA 2HWVA 4OIOF 5EDNA 3K10A 2DOEA 3KYLA 3QAHA 2DMQA 1J7KA 2P5VA 3HGGA 4IRGA 3MMYB 4JP0A 5L3DA 1CF7A 1I27A 4U7BA 2EV5A 3FHNA 4E7ZA 3BCBA 4UV9A 1V5GA 5E3MA 2PMUA 4HV6A 1YLFA 1HBXG 4PFPA 3K70C 1D0ZA 4UB6C 2LYCA 3S1RJ 2A5YB 2DTZA 2YX4A 4M73A 4A6EA 1U78A 2E5NA 4EJOA 1G4DA 3PO3J 2D5VA 1LVAA 1NHAA 2BY2A 1AKHA 3CUQC 1MSEC 4RM2A 3QRFF 2D45A 1IRXA 3FMSA 2UWMA 2J5OA 2ECBA 2VBZA 4DJAA 3L09A 2R7XA 1YIOA 4IHXA 2GBYA 2XAJA 3PUBA 4RA2A 2XROA 2VB6A 3TDUC 3BG3A 1I3AA 5LHGA 1MBGA 1XGSA 3RJPA 1S3JA 3GWZA 1DGWY 2WB1A 4AIKA 2X6XA 1H0MA 2CG4A 3KETA 5EZGA 1LQ1A 4ENMA 4CCNA 2ICWG 2DA4A 2HOAA 3QP5A 5KHDA 2XB0X 1BBYA 3ZP5A 1PVEA 3WTYC 2L7ZA 3IHUA 3A0BC 4XQFA 1EH7A 2ZXHA 1WCMJ 4DZPA 1MDMB 4I0BA 3ZQHA 3T1BA 4IXAA 2BHZA 1NK2P 2O8XA 1IGNA 3AL0C 4IKFA 2XUBA 3ESWB 4XLAA 4XRMA 5ERIA 1UB9A 3ZMUA 1ZRCA 4A0XA 1GLNA 2NVUB 3RI4A 3FXUA 2XF6A 1V4RA 4E7LA 4D7NA 4U7DA 4U0VA 4YIRX 1YFHA 2VPRA 2EK5A 1MMNA 2BYVE 3ZQ7A 5HLTA 2KDOA 3CF5F 1LJ9A 2ISZA 2FF4A 2VODA 1VNDA 1R00A 1V54H 2EFWA 1PUFA 2ID6A 2Z33A 3J7ZI 3UKGA 4OINF 3SZGA 2VBWA 4WF2A 4RB3C 2NS7A 4DGWB 4CCLA 1ZK8A 1OYWA 4ZC3A 2XAFA 4Y17A 3AG3H 4P9FA 3OL3A 1REPC 2VOOA 2KRHA 4G6TB 3BR2A 4A69C 2P8TA 3Q0VA 3K4MA 2F4OB 2MFZA 1T6SA 1I1GA 3W2AA 2K85A 4P5OA 2X51A 3PQJA 3HTUA 5KK1A 2QBYA 1YOVB 5IY5H 5LHIA 2HYFA 2YPRA 2A69F 4U88A 4B3XA 1W36C 2IGKA 1MJ9A 1AU7A 3LSJA 5GPCA 1Z1DA 2Y0SA 4DW6A 3CESA 1ZREA 3JAMK 4IOCF 4TV7A 2O6GE 2B0LA 2DU9A 2COMA 2E71A 2W4SA 1VQOI 3CJQB 2AS5F 4N9IA 3J81Z 2CW0F 4FT8A 4QLCU 4L9VA 3KPHA 2HVRA 2EV6A 4I02A 3ABLH 2I8DA 1MJAA 4LLLA 5E20A 1DP3A 2YUSA 2JQ7A 2DO7A 4L9TA 2BXZA 2E1CA 2Y48A 3PO2J 1MNMC 4BXXJ 4G6DA 5ILSA 1G8XA 3HPGA 3S1MJ 4FE7A 3JRCA 2FNPA 2AQFA 2XKOA 3G73A 4CGZA 1WI3A 2L9VA 4BQOA 3S15J 4FETA 3WU0A 1T2KA 2G0EA 3R6SA 2ZNYA 5FROA 2ETHA 2ZJ2A 4RB2C 1OCOH 5M3FJ 3ZMTA 2PG4A 1NTCA 5F64A 2R7UA 3C7JA 1Z91A 4HPQA 2FOKA 1IRFA 5TGTA 2BGCA 2V1XA 2JPCA 5E1XA 4XM3A 5DEQA 1Y0NA 4I01A 4ZYAA 3D5SC 1FPQA 4DYQA 3G1MA 1IN5A 3JRFA 2I5UA 2W57A 3ABTA 4B44A 3HM5A 1U8BA 3CO7C 1SMYF 4XR6A 2X6WA 5E8IA 3K1NA 4G94A 2P7CB 1MSFC 4AD9A 5DS9A 2LH9A 1VQNI 1WRJA 3PFYA 2HEOA 1PYVA 4ITVA 2DFFA 1MD0A 2OCEA 1UCRA 1FBUA 2F5CA 3VEPA 2MA3A 3FM5A 3I4NJ 4KMFA 3MQ0A 5B1AH 5FLMJ 1MZBA 2GWRA 2ESNA 3F8CA 3EYIA 1T33A 3EYYA 1OISA 5DDGA 1G3TA 3ZN1A 1GHCA 1LFUP 2CQXA 4B43A 2CV0A 2R7ZJ 3ZMSA 5DV5A 1T0FC 4E7SA 1D5VA 3DPLC 1R49A 3OYBA 3MWMA 3U1DA 4CUGA 1TQIA 2F5EA 4BHBA 2K4BA 2NOJB 2GA2A 3AG4H 3E97A 2JMWA 1YTYA 5TRDA 4IEJA 3DLLF 3EDPA 3CDLA 2DA6A 1Z6TA 4R79A 3BG7A 2LK2A 2KFDA 2E60A 2TDXA 1R9TJ 1TT0A 2XAQA 4XRFA 3L2VA 5M5WJ 5LEKA 4O6JA 2X4HA 4XLEA 2JA6J 2Z5UA 4CYCB 3ABMH 3KYDB 3CCQI 3HOWJ 3OYFA 2HZTA 2P6SA 2QF7A 3HOSA 3H9QA 4HZFA 3JRDA 1OCZH 2VQCA 3IH3A 1YQAA 2W25A 1LNWA 3H35A 4OWRB 4ETSA 4UUSA 3I3LA 1O3QA 4M9XA 3PFIA 1X4PA 2F4MB 2KHMA 1ZTRA 2R5YB 2FMLA 1YI2I 5K5OA 4O3MA 2ZB9A 3ECHA 4PJNA 1JE8A 3O8GA 2GIVA 3S17J 5IT3A 2QENA 4LJZF 4F3QA 1L0OC 4B4CA 4M74A 3BR0A 2PMHA 3E6CC 1P4XA 3IWFA 3D1NI 4M3EA 4LK1F 3WHBA 4F7ZA 1OCCH 4V19K 1ON2A 2R0QC 5EG0A 2H6BA 3SDGA 3RZDJ 4MLOA 1ZLJA 3HOUJ 2WAQA 4KUMA 4YFKF 4YIIA 4WXCA 3IUOA 5F0CA 3CCUI 3OYGA 5CYVA 1QQIA 4BDYA 1K78B 4HBLA 2MGQA 4DQ2A 1IF1A 3I4PA 1ZN2A 2DW4A 1I39A 1Y8QB 2IGNA 3P9CA 1R71A 1VQ8I 2PI0A 4RDUA 3DEEA 2RREA 4XK4A 4YELA 4RM3A 2AXTC 1OKRA 1IXSB 2K86A 5K7HA 4IZZA 1BA5A 3TBIA 3F23A 1OCPA 2XAGA 2X9DA 5DM6F 1SFEA 4M6XA 3V7SA 4IX7A 2LDUA 1O3RA 4PFOA 2M30A 4S0HB 2L9SA 2DA7A 3BPVA 5CKTA 4PK4A 3QU6A 2Z16A 3VOEA 2ID3A 4FX4A 3R61A 3I54A 5F08A 2XPUA 5IYCJ 3O6BB 1EV7A 3BWGA 3I58A 3QPLA 5DCMB 5E3LA 4A12A 2PX9A 4LLNA 4LD5A 3BTJA 2CW8A 1ITYA 3EUHC 1HOMA 2HOTA 1IXCA 5ILUA 1I1SA 3R60A 4XN0A 4DYCA 2XAHA 5EEGA 1J75A 1MW7A 1B4AA 5JLXA 2DDAA 2R7TA 4CZCA 4C9YA 1ZGWA 3PNYA 2EFNA 3SHFA 1HDDC 3CC7I 2HZDA 3S32A 2XPVA 4EATA 1SD5A 3V4GA 1X3ZB 3V8JA 1YJWI 3DWLE 3KZYA 4LIVA 2HQ5A 5EEHA 4XSZF 3FBNB 3G6EI 1XGMA 2PLYA 2A6TA 5DUIA 4Y13A 4WWCA 1XC5A 2YSRA 2L9RA 3DU6A 1U5TA 4GGGA 4P96A 1Y1WJ 1AWCA 1B9MA 5H6RA 2KQRA 4D0PA 2ADUA 5EF6A 3QP6A 4HNUA 4RS8A 5D5UB 1XGOA 2X0LA 2BV6A 5ICGA 2JTVA 2K5CA 1HKQA 2ZJQF 2HDWA 2R5ZB 3CC4I 1YE9A 2WA0A 2A6HF 2CUZA 4KIBA 2E5ZA 4PSWA 3PJRA 2E7WA 3G4SI 2ZFWA 3KP4A 3PNVA 4J19A 1SFOJ 3SXYA 2DA5A 2BEOA 3HEFA 1PP8F 2K02A 4LITA 2R7SA 3C2BA 2G7HA 2GAUA 5J1RA 2BVLA 3TGNA 2XF7A 5FD6A 4G7HF 3ZXSA 1NG7A 5L3FA 2ZMEA 3KP6A 3DTEA 5TISC 1E3HA 1ZRFA 3WHCA 4J01A 1R5HA 2KT0A 1SVMA 3C1DA 5EGOB 1QRYA 4XRSG 2NRAC 3KIOA 3HXLA 4GRIA 1JGGA 3K2AA 2FOWA 2WY7Q 2ISYA 2R7DA 2AQEA 4EJUA 1OR7C 3I55I 3TL4X 4C2TA 1DU6A 2KKOA 2OD5A 4KIGA 3JREA 2L5QA 1RI7A 3OYMA 4ESBA 4ANJA 2EIMH 2M0CA 4R1HA 3L2RA 3RQIA 2CMPA 1HF0A 3F8BA 4B48A 3WTUC 2M3AA 4A3EJ 4A3DJ 3L2WA 2EH3A 4B09A 4RAYA 2O03A 4FX0A 3J80K 2CH0A 2O9LA 3CUQB 2P81A 2JUCA 2CQKA 1VTNC 2L7MP 2PEXA 2XC7A 1F9NA 3QU3A 1DUXC 1XX5A 2DQLA 3I64A 1BM9A 5CPRB 4U0YA 3COAC 4BEHB 4XLHA 3A02A 1VQ5I 2EWNA 1HC8A 2OU2A 2LBFB 2CV2A 2DT7B 4NC8A 3JRGA 2RN7A 1DP7P 3IV5A 4A6DA 3T5XA 2ACJA 2R7FA 4HOBA 1RUNA 1ZAOA 2JA5J 2P0WA 2ZBKA 5CVIA 1ZR2A 3GTLJ 3ZOBA 2YS9A 3E6MA 4NC6A 1BJZA 4QPOA 3V42A 5HLHA 3LQQA 3AL0B 4HEA2 5C3EJ 2DMUA 1WJEA 3HOYJ 2IS4A 1XMAA 1IRGA 3OMYA 2X1EA 2GOMA 2K40A 3H3VK 1AHDP 4XKBA 1V5EA 3OYEA 2HPMA 1APLC 4IHVA 2X48A 1V55H 2CO5A 2CV1A 2YU9J 4ZH4F 4BHPA 2BXYA 3IL2A 5GAGJ 1FSEA 4RAGA 4ZYHA 5JVGF 2JUGA 2ZXJA 4CICA 1OYYA 4BYYA 2VQGA 3MCZA 4BHCA 2R7RA 1IC8A 1BR2A 3MVPA 3QPSA 4R8HA 4UY8I 1BOBA 2VL8A 2GXAA 2HQRA 2P5LC 2MD0A 3H92A 4MIMA 3E1SA 5LFAA 3BC8A 4F91B 3FXLA 3L2QA 3TMOA 3SJMA 3OS0A 1X1DA 1YX3A 3E5QA 2BHYA 3HC7A 2XGCA 5A2QZ 4LLGF 3H3ZA 1D0YA 3F0CA 3A01B 1USTA 1R22A 5ICFA 4BY7J 2VXDA 2B9SA 1X4OA 2IPQX 1BIAA 1HKSA 2DFIA 3PL8A 2EZHA 1SD6A 4M3BA 1UMQA 4HF1A 2QWWA 3WTSC 3KCCA 2W84A 5E79C 4K2EA 4N0BA 3Q0WA 1VI0A 1W5TA 1C0WA 2A3SA 3IRQA 2GZWA 2V1UA 1TQMA 5EEAA 1ZH5A 2DFHA 2E34A 1HSTA 5KAFC 1QA6A 2VJ4A 3G2BA 2O7OA 1HW2A 2EJRA 4PZJA 3VB2A 3KP3A 2NVYJ 1XMXA 2M7AA 2IS2A 3CCRI 1IV8A 2Q1ZB 3C3WA 1B9NA 3FISA 4XLCA 4HW0A 4A5NA 1MNDA 3LAPA 3WGIA 1JXSA 2HTSA 4OMZA 1WSUA 4CA0A 4NQWA 3D5LA 2BY0A 2JZYA 4XLFA 2PFBA 1X1PA 3BROA 3H5RA 4MEYF 2M7BA 5LRRA 2CFXA 4CXFA 2QQ8A 1RR8C 3CTAA 1UG2A 2OTJI 4M3FA 3BOQA 4G8XA 1JKOC 3SZPA 1GV5A 2FQ4A 1R23A 4JQFA 1DGRM 4A3KJ 1FYLA 2WBMA 2M1BA 3HJEA 3L7WA 3J7AY 3Q9SA 1G3SA 5CLSA 5F0FA 4H0EA 5DYMA 4Y7NJ 2ZMEC 4HX4A 3P9KA 1CF7B 3S2WA 5CVVA 2R3SA 1IZ1A 3SFIA 2XV4S 4HSRA 1T0FA 3ZR8X 4BJ5C 5DD8A 3QYBA 2ELHA 1YJ9I 1T95A 2IBDA 2WAEA 1WJBA 5FFXA 6PAXA 2HNHA 1U6GA 2VI6A 3U2RA 3TW7A 3S14J 2Y0SN 3JR9A 5M3MJ 2JT1A 3FWEA 3GBGA 2H8WA 4XICA 1UELB 5IYDJ 2N8GA 1QU3A 2V9PA 5CVJA 5AIPA 1AKHB 2AXLA 3OSFA 2ZJPF 1UHWA 1ZYRF 2Y0MA 2QQBA 2VE9A 4NC7A 2IA1A 4BQQA 3WGHA 1Z21A 3ZQIA 2PBIA 2CUEA 3TOBA 3V8KA 2EIKH 3GFIA 2VJ5A 1N77A 2H27A 2Q0OA 2LOOA 2DFEA 3SFZA 4U87A 2L4MA 2IGMA 4XKWA 4A2UA 2XF5A 5CQEA 4C2MJ 4HV5A 3U9GA 5A2QK 4EQQA 1Z7LA 4HX7A 3CLOA 1RZ4A 4B47A 1E17A 3OSGA 4I98B 3KP7A 3H0GJ 3OIPA 4HQEA 4CCKA 2EBIA 1S72I 2MABA 1QPIA 2L4AA 3GFLA 1JUSA 2FU4A 3FMQA 3GX4X 1AA7A 3LNQA 1ZG1A 1GXPA 5GP9A 2A07F 5IT9K 1Z05A 5D8LB 4L5JA 4BBSJ 5J4YA 3L2UA 2UXXA 3F9KA 4M71A 2NOGA 4DIQA 4GO1A 2CFOA 2FEZA 3MN2A 2W48A 1LDKB 4Q4ZF 2Q2EA 4AYBA 3MAJA 1MJBA 1EH8A 5HDKA 3DP7A 3I59A 1W0UA 1PUFB 5FKOA 2DMPA 1PJRA 3BPXA 3K4NA 2HKOA 2QA4I 3HHGA 2EZLA 1Z0XA 4A3IJ 3FK7A 4JX4A 2A61A 1U0JA 2DPDA 1ZLKA 2VJJA 2F5FA 5HDGA 4ENJA 3HZJA 1JHFA 4XLNF 3HRMA 3WG9A 5KCMA 4S04A 1N75A 3BQYA 3OIOA 4FISA 3S2HJ 4KT5C 2JPBA 4RLQA 4BDZA 1XDSA 2QQ9A 3V8LA 1ZR4A 2ZSIB 3PIOF 3BJ6A 2QBYB 5D5WB 3GF2A 4EJTA 2ME0A 3IWZA 3OY9A 3TO7A 1Z7UA 1LKXA 2LY1A 3B6AA 4BNCA 2XIGA 4JOMA 3F21A 1F43A 4C3IJ 3NARA 4UXNA 4UNOA 3GFMA 4Q48A 5H6QA 1R4MB 3W2WA 2TRTA 1QHGA 2DJNA 3GW2A 3OWTA 3B73A 4HF0A 1X3UA 5K7ZA 2QUFA 4MNUA 4GCVA 5LEJA 4CCOA 2Z9OA 1MBFA 1YS6A 1UFMA 1TWGJ 3JRBA 3CD6I 4MQ9F 2IRFG 5J8CA 4HNTA 3EUHA 1T8IA 1RETA 1H9GA 4QWQA 3H9GA 5F04A 2B63J 2WTEA 3GYHX 1SMTA 2XHKA 3T8RA 2LF8A 2K9SA 4BACA 4E7JA 1CGPA 1J0RA 1R36A 1IUFA 3HRTA 4X1EA 4G7ZF 1FYMA 3GTOJ 3KLNA 1ZRDA 3ZPLA 1TWFJ 3M4OJ 3ERMA 2KDZA 5F1JA 1VQPI 3JCUC 3NWTA 4KN7X 4IHSA 5M5YJ 5C4XJ 1BW5A 4B3AA 4B8XA 1ULYA 2E36A 4HYEA 4KFCA 4A0YA 3CCYA 3BG9A 4XKCA 4PJLA 3HOTA 3RTRA 3PQKA 4YG2F 3FXQA 1S7OA 2L54A 2WV0A 3W3CA 1OPCA 3BZ6A 4GYIA 3OYHA 1XS9A 1T38A 4EGZA 4RAZA 1A04A 2FRHA 1S9HA 3GXOA 4XORA 3QWLA 2VKVA 2UXNA 5CJ9A 1R1TA 1B72A 3MD2A 1HA8A 2VPLA 1USSA 2CGPA 2V9VA 2WAQN 2VQHA 1ZG5A 2ESHA 4YFNF 4RLFA 2VT3A 1SEUA 1B72B 2IT0A 2QSHX 2HDCA 2FBKA 2O61A 3MKWB 2DBBA 1IN7A 4UHTA 3ERED 1Z9CA 3FXMA 1HW5A 3A1YA 4D5FA 4LB6B 4YEJA 1MBEA 1MMAA 4WX9A 2CW7A 2NYXA 1SANA 1P4AA 2QQAA 3BTCA 3L2CA 1BC8C 2M4KA 3EUAA 3S93A 1FTZA 2V1NA 3DBRB 3V7CA 1JUPA 4BKXA 2CUFA 3FBIB 3GO5A 1XSXA 1W1WE 5HODA 3HYIA 1FOYA 2ZXWH 1VF9A 1OR7A 3IAS2 2DT5A 3CCVI 2CQ7A 1QHHD 1W0TA 3O8HA 5L3CA 2HTJA 3FXOA 3A0HC 2MYSA 2XGEA 3K4JA 4EM2A 1S29A 2X6YA 5JFRA 4HQMA 5HVQC 1O7LA 1E3OC 3OR2C 2MLGA 3F72A 1TW2A 5HNFA 5C44J 1W7PD 1R1VA 3RYRA 4ZJZA 3I71A 5F6FA 2V6EA 4L0ZB 4ESJA 3W2VA 1MBHA 2A68F 3CQZJ 3RKXA 4LK0F 4UVAA 1G6NA 1U8RA 3H0DA 3QQAA 5DUKA 3DXJF 3ZQGA 1X2NA 5D5VB 3SEZA 4UUSB 5FRNA 3F8FA 1OMIA 3K4BA 3LA3A 2EFOA 2V79A 3FIWA 3M8FA 4HLYA 1H8AC 1DU0A 3F8MA 1YIJI 4YIFA 1EJ9A 3J81K 4A3CJ 4BAYA 3W6KB 3DQVC 5JLWA 4ASNA 1MIJA 3BCAA 1WKMA 4EVIA 2GIZA 3I5UA 2GM4A 4F52A 1D5YA 3M9AA 5J1UA 3C2GA 3K1MA 3TEDA 4Y4RA 4M72A 3OYNA 4F55A 2FSWA 1GV2A 5EG0B 3K6GA 4PGGA 1QGPA 1ONVA 2MH2A 1P7JA 3RKYA 5ICEA 1G59A 1JKRC 2HOEA 2CSOA 4N4OB 1LFBA 4LMYA 1Y0UA 1LE8A 4A93J 1X1BA 5LGUA 1FWZA 1BI1A 2FMYA 5K5QA 4KA4A 4C2UA 1QVTA 1BW6A 5M5XJ 4RAFA 2IW5A 1LUJB 3GMEA 2QSGX 4PJJA 5HLIA 1IJWC 3WTVC 1VQ7I 2Y31A 3REOA 3Q5FA 1SAXA 4M9ZA 2BBYA 2LKXA 3R4KA 1MMGA 2KPMA 1S7EA 2XSJC 5BMZA 2Y75A 1D1AA 4QSHA 1XSVA 3HOVJ 4GXOA 3E7LA 1K83J 4HNVA 3BR6A 3LFUA 2HU9A 2XAUA 2RGVA 1MNEA 3JRAA 1EKEA 3WU1B 1XB4A 2IVMA 3KYCB 3VSLA 2ZCWA 2FBHA 2IEKA 1OJLA 4LGWA 2NAZA 3EUKL 3HRUA 4NBQA 1P2FA 3HRSA 5FO5A 3DU5A 4BU2A 3NQOA 4HX8A 3M07A 4OU0A 3LSHA 1O3TA 3I4MJ 1WHUA 1Z6RA 4ZZLA 4MTDA 3CP2A 1DQUA 2JSCA 5DM7F 1B8IA 4Y52J 4IOAF 1WPKA 3CCMI 4XN3A 4ZYDA 2DK8A 4BJ6C 4KYWA 2KMUA 4ON0A 3A4CA 1U9NA 3VODA 4BE1A 3TOAA 4YRVA 1HQCA 2PJRA 1BJAA 4J00A 4LOCA 1J59A 4OMYA 4LIUA 4GDFA 1YW9A 2MG4A 1KU3A 3M8EA 2UUZA 1U9OA 3N97A 3BP8A 2OZ6A 2QGUA 1U5TB 2KJBA 5J4VA 3MZ8A 4PUSA 1WH7A 4E4HA 1XCVA 3CCSI 3WTXC 4EMSA 2CU7A 3KZIC 3SDBA 1XCBA 3CCEI 1U2WA 1FOXA 4KICA 1BI0A 2PQ8A 5DCFA 2C6YA 2L7FP 2EIJH 3HGYA 3RDIA 2IXSA 2RAEA 1POGA 3VYSB 1A31A 3E5XA 1YG2A 2F4IA 3CC2I 3WGGA 3GFJA 2COBA 2V26A 2E35A 4E7KA 4Q47A 2WWYA 4ZDPA 2M8EA 2ZMEB 3S3NA 3K4CA 3HSEA 2LG4A 3S1NJ 3BR3A 1L3LA 3KE2A 2RDPA 3ABUA 4ZTFA 1XD7A 1ZELA 3RPUD 5HOOA 1X1AA 5J1YA 5LD2C 1JKPC 2R7WA 4F93B 4XL9A 1A6IA 5E1WA 4KISA 2OF7A 1LPQA 1GVDA 4LG0A 5B3SH 3H9JA 4ZYGA 2EA4A 1ZHFA 5EJCA 3BG6A 3EPZA 3DLAA 3KEYA 3OS2A 1F4KA 2HVSA 9ANTA 2L2OA 3M1CA 2RKHA 3PSIA 4Y15A 3JW4A 4MTEA 3VPRA 3HTSB 1I50J 2CUJA 2XDVA 3O2PE 1XPXA 1XSDA 1XTAA 2DYSH 2M8GX 3VDXA 1SFKA 5J8FA 2HQAA 2M2EA 3E0JB 1JT6A 3PM1A 2XB5A 2DK5A 1FY7A 5DTDA 2Y9YA 3RIRA 1M1EB 4YFXF 2MD5A 1QO0D 4DOZA 3BY6A 2LD5A 3OYLA 3OYKA 5E17F 4X6AJ 1MH3A 4P9UA 4WXHA 1ETWA 1W7PA 2QVOA 2M34A 3OS1A 2WAFA 3Q3SA 1S8NA 1WJFA 1VQ4I 3K4KA 1N78A 4XIDA 3GEZA 2KP6A 2ZXIA 1EF4A 1IRZA 1WQ2A 1WJAA 2EB7A 4KDPA 3GZ6A 4DYRA 2P4WA 3DEWA 1XG1A 5GADJ 3FXKA 4WK8F 3HUGA 1F1ZA 3T0YA 3LL7A 4A0ZA 2XRLA 2JSPA 2H94A 4RGSA 1TZLA 3OV8A 3I56I 3PNTA 1FSHA 2ZNZA 3GTMJ 1Y1VJ 2PMZA 3E5UA 1YRNA 2BOLA 2DMNA 4BBRJ 1Z67A 2HS5A 2EZIA 4LB5A 4A5MA 5GAHJ 2XGXA 2OV7A 2V4JC 2Z2SB 4MQVA 4RMNA 1FBQA 2M87A 2ZJRF 4RB0A 1FMWA 4NDLA 4DNCA 3H1CA 2Z3YA 4MFDA 5ILVA 4BGDA 2LREA 2VN2A 3ZMZA 4BXFA 3S3OA 1V3FA 1XMKA 4C30A 3S2DJ 3ZN0A 1ETVA 2BVMA 2E1MC 4WCGA 2R7VA 2OQRA 3F6VA 1KQ0A 3G1LA 1ON1A 1B59A 2A05A 4EM0B 4A3MJ 3L00A 3G3ZA 4V2GA 1OFCX 4CZZA 3LSPA 2RNGA 4PGHA 3ZRGA 2D1HA 3I53A 3HHHA 1MMDA 2VC0A 2O3FA 4JBAA 3TP0A 1EA3A 2CQNA 1MBJA 3S1QJ 1PUEE 1F36A 1KYZA 1YW7A 4HF2A 4MFEA 2G9WA 2JJ7A 1UAAA 1B6AA 2HYJA 5BQTA 4BY1J 1FJLA 4AC0A 3U1KA 5TJJA 4AU7A 2A5WA 5JHFA 2OQGA 3SEQA 5GPAA 2ZO4A 3CJNA 3OOUA 3TW6A 1JJ8C 1HLVA 2DCEA 3V7RA 1N25A 4OAZA 1QZYA 4O5VA 1A5JA 2DOAA 5CVRA 3D0SA 3OR1C 1Y6IA 2QEXI 1S7AA 1K4SA 1QBJA 2MLKA 3W6VA 1HDPA 3MFKA 1ZGAA 4NQWB 3WU2C 1JI8A 3F8NA 1G3WA 4KIFA 3ZCOA 5LRSA 3MZYA 4IJAA 1P6RA 2DYRH 2IAIA 3A03A 3KX2A 3ECOA 1I3QJ 2VXZA 3K0LA 3LSKA 3R0JA 4EEFG 4FASD 4NHJA 4AYBN 2OZUA 4M3DA 1DPUA 2JA8J 5K1YA 1VQLI 1JT0A 1TP4A 1OCRH 4ENNA 1ZKGA 5FFZA 1BIBA 2IA2A 2E2JJ 2EZKA 3K9TA 4C3JJ 4D1QA 3DKYA 1MGTA 3QPTA 1QZZA 1E3PA 4OIRF 3BR5A 3OOPA 1QZEA 3C18A 3ZMVA 5J6XA 5JR3A 4ENKA 1WZ2A 1FC3A 3BZCA 2RC4A 3CMMA 2OC6A 2E1OA 1O3SA 4OAYA 3QOPA 5IOYA 3BLYA 4H4KC 2RNJA 1G2HA 3N4MA 1R7JA 2CQQA 5GTHC 1TNTA 2RV8A 4RGUA 1ETYA 1GXQA 1LEAA 3RYPA 4E70A 5FLVA 4L18B 2X85A 4FQGA 4BQNA 4AIHA 3DBLB 2H6CA 4CDGA 2PJPA 2FX0A 2L9NA 2XPWA 3FMRA 3LA2A 3FKIJ 1J2XA 2DODA 3LSTA 4IQ4A 4IHTA 4EM1A 4GYGA 4DZJA 1LEBA 1ZARA 2K9MA 3ABKH 3MKZA 1YS7A 1UHSA 1IDYA 2FBIA 4ZZDA 3RPUA 1ZQ3P 2IGOA 2K3FA 2DN0A 1R5ID 3FXRA 2Y30A 1QVUA 1WJ5A 1YW8A 3O3KA 1FEXA 5J3LA 2W1OA 3LFKA 4M3GA 1Z77A 4FHTA 2DAOA 1TT5B 3IAM2 4G6QA 1KZHA 4AIDA 3AKZA 3H5AA 4A3GJ 4CYDA 2R4GA 4RGXA 1HXDA 5B66C 4BQAA 2LLKA 5D8KB 1K7AA 1WH5A 4PSXA 2VASA 2RVCA 2VJIA 1MBKA 4OIPF 3HOXJ 3GTQJ 3BJAA 2LTPA 1EH6A 1IXRC 2ELJA 2OJED 1MDMA 4M9SA 4P55A 1WJCA 2JVGA 3CMAI 5AIQA 2GXBA 3DKXA 2JA2A 3GZ5A 4QTRA 3VWBA 1MKMA 1DDNA 2Q2EB 1RIOH 4UUVA 2FNAA 1V5FA 3I59B 5D6EA 5K5RA 2W82A 1TQPA 5BPIA 2ECCA 4V2FA 2F5DA 2G7UA 2L7KA 3JSPA 3HDDA 1UZCA 2GOXB 3MEXA 4I99C 3B02A 3P5JA 3KFWX 5LLQA 3M3YJ 3ZQQA 3LA7A 2L01A 3BG5A 5L3BA 3JRHA 2MW8A 1D8KA 5D6FA 2JWTA 1K79A 4LFUA 1K6OA 1KGSA 2NS8A 4IQJA 2KIUA 3P9IA 3TO6A 1D0XA 2MSYA 1RNLA 1A6QA 1KONA 2VE8A 4II3A 2WV1A 5H20A 3NEUA 1Q1VA 5IP7J 2EILH 3IH4A 1FT9A 2KRCA 3HSRA 3Q0UA 4L5IA 1IAWA 3CF2A 1PDNC 2F48A 5FLXZ 3RKQA 3QOEA 1O7FA 1LDDA 2O8KA 4GFBA 3DEUA 2XKPA 4PJMA 3LSMA 3ISPA 2X6OA 1RUOA 2HOSA 4KJZA 2MC3A 2R92J 2AO9A 2ZFUA 5BS6A 2H1KA 2FXAA 3DTKA 1X2MA 3E6DA 5GAEJ 5HNHA 2R7QA 2B7EA 1ODDA 2EV0A 3WG7H 4XKVA 4XONA 4IHYA 4OIQF 3T8TA 2Q8KA 3OYAA 4L9JA 5H2FC 4CH7A 1HSJA 2DLLA 4BE0A 2IJLA 3KZZA 4IHWA 1UJ8A 4XLPF 1P9QC 1D1BA 1Y56A 2QKLB 3DBHB 1KQ9A 3CDHA 3CCJI 3ASNH 2K4JA 3KP2A 2DI3A 3ZGKA 4KT6A 1RKTA 2KISA 3TKYA 2CRGA 2GXGA 1LB2A 4ZDOA 1VZ0A 2ZC2A 2P6TA 4ABZA 3WE3A 4Q5SF 3FHZA 5F0HA 3CMYA 2EFQA 2OPTA 1H89C 2DPUA 2P5KA 1KU7A 4ZTJA 4A3FJ 2P7VB 4FCYA 4LG3A 1TLHB 2LNBA 4KMUX 2HXIA 3GZNB 4NUBA 2FJ1A 2JK3A 4UV8A 1Z3XA 1RKWA 5F1RA 4M6VA 2DXIA 3HIFA 2KRFA 1VFCA 2WC2A 3FKJA 5FKMA 1SFXA 5B5EC 1TBXA 3NRVA 2IP2A 5JI6A 2KIFA 2YU3A 1JUMA 2CJJA 1R5GA 1S5LC 1DPRA 2OCCH 3FXJA 5FJ8J 1BI3A 2R7OA 2HGCA 4RBOA 3DF8A 5GTIC 3GCMA 4D5CA 3DCFA 1JTXA 2VKHA 4HAMA 5K7FA 2V9KA 1RC9A 1IO2A 3K7AJ 1IV6A 1U3EM 2QCOA 2QLZA 3K70D 2F2EA 2DA3A 3ROUA 5BOXA 4IO9F 2QZ8A 3DTIA 4IPAA 2HQNA 2HPIA 3E3VA 3RZOJ 2CS3A 3QPHA 2ME6A 5LHHA 1J5YA 3JRIA 1T39A 2X1CA 2A6EF 2H09A 1KYWA 1OQYA 2HYGD 4L9NA 2LY9A 2KIQA 1HCRA 2WADA 2Y9ZA 3BTIA 1FOKA 1SVLA 4BE2A 4MGRA 3BR1A 1Z3YA 4AVPA 2E2IJ 1YITI 2OUMA 4XBFA 2VT2A 1P7IA 3NWSA 1G3YA 3CJRB 5IPAA 3G71I 2M0MA 1IN4A 1SAUA 4MO7A 5E1ZB 1X1CA 4PJ0C 2XSDC 3CZ6A 2EQRA 3K69A 3LSGA 3FK6A 3HG9A 3SZTA 2D1VA 4CYCA 2UV1A 2E7XA 4ZYEA 5BNGA 4RB1A 3ELKA 4XRSA 2K7LA 5FKKA 5KVRA 5IP6A 3TDZC 2D2WA 5J47A 2KJCA 2M5WA 4IL6C 1IG7A 4Z6YA 2ZKZA 5FLXK 5KAIC 3CUOA 5IYBJ 2DJIA 1Y8RB 1ETKA 3EQLF 4D7MA 3UNGC 3IP4B 2R5YA 3LAJA 3ML6A 1P92A 2QKMB 3H36A 3BTLA 4AUXA 3DFGA 3ULQB 5IOZA 5KNLA 4IF4A 3IKVA 2VC1A 5IP9J 1FNNA 4G7OF 1FOWA 3M7GA 5DD4A 2DA2A 4CHUA 4DBRA 5CQGA 5FKNA 4BL0B 4BUPA 1ETQA 5EYRA 5HS7A 3I0TA 1D3YA 5HS8A 4MHGA 1D1CA 2V7FA 2LFBA 1LE8B 1LDJA 4W1UA 2HR3A 2M9HA 2Y2ZA 4JX6A 2VUMJ 2DMTA 2LKPA 1TC3C 2DOFA 4ESFA 3KLOA 2HDDA 2F5VA 2FD5A 2KZVA 1HW1A 2IA0A 1TWHJ 3WTTC 1XGNA 1K78A 1W36D 3DKWA 5F27A 3QYEA 2VLAA 1K4TA 3HL2A 3J80Z 2O0YA 2QYOA 5HDNA 2NNNA 1WVRA 3Q9VA 2LP0A 1IW7F 2LVSA 1A36A 3CLQA 2KL4A 2GQQA 1Y39A 1QPMA 4Y3OA 5E8GA 2NVQJ 1TWCJ 2FUG2 1GUUA 2DA1A 1OCTC 1SD4A 1W4MA 3MZHA 4KITB 3K2ZA 4KNYA 1RRJA 2BW3A 5C4JJ 3JTHA 2E1MB 1SC7A 1YO5C 1ENHA 5FD5A 2BW3B 2EFPA 1R6RA 2MBFA 3CCLI 1E2XA 4NB5A 1BR4A 1XN7A 3MKYB 3H5NA 4A3LJ 3LWFA 3RCOA 1KA8A 2HKXA 3EETA 5D4RA 2DDBA 3GVAA 3K1PA 1T08B 5DCMA 3L9FA 3OYJA 1VQ6I 1ERDA 2DT6A 1I6HJ 2HFHA 3KP5A 1W5CC 1VQMI
chains in the Genus database with same CATH topology
2XRNA 5HS9A 3IKTA 2FA5A 2YR2A 2CYYA 5AONA 3W6JB 1I6XA 1BOAA 3BDDA 3KEQA 2RQPA 4S05A 1KU9A 2L3DA 1I5ZA 4MEXF 5E18F 2VBXA 4RGRA 5ICCA 1TTYA 2DQRA 2L02A 1IN6A 1ZG3A 5FGMA 1S6LA 1XDUA 5D5XB 4HLXA 1P4WA 3FX3A 1B1BA 3BJOA 4EJVA 4AIJA 1UHMA 5JHUA 1TW3A 1O57A 4BXUA 2VBYA 5LGTA 2STTA 3DV8A 4IRHA 2EA2A 2JRTA 3AAFA 4LG0B 3F3XA 1BI2A 3WE2A 3WODF 4UVCA 5L3EA 3SQNA 3J7AO 2VOPA 1JGSA 1FLIA 2E1NA 4CO8A 3DPTA 1ZGJA 3CUQA 2FE3A 4WXDA 2Z99A 1TNSA 2XVCA 1KQ8A 4HDUA 3ZMDA 2W85A 2J5PA 4IVNA 3GLXA 1BN5A 1SD7A 4IRIA 1Q1HA 2CWEA 5JVTA 3FF5A 4M6YA 2OAZA 5ED4A 2NNYA 1FX7A 3HSFA 1W7PB 1YYVA 5D4SA 4Z2YA 4I0AA 1FP2A 1T98A 5FB2A 1PP7U 2YX7A 4EGYA 4EJWA 2UZKA 3RPQA 1FP1D 3KEOA 1STZA 2V6CA 1J9IA 4KN4X 1WI9A 2LSOA 5L3GA 4L0YB 2FQ3A 1D8JA 2STWA 3JTGA 3WTWC 3TQNA 2KIMA 3GUDA 2XASA 4HDVA 4I7HA 1SFUA 1HKTA 3H3UA 3F6OA 2K27A 3F22A 4XSXF 5CVUA 4N9HA 3LQRA 2OA4A 3TO9A 4U0WA 1H9TA 3M1EA 3RKWA 5LGNA 5IT9Z 2DTRA 1FBSA 2PN6A 3CO6C 1IUYA 1WWXA 4AWXB 1FYKA 2NS0A 3R0AA 3FM3A 1OYIA 1FZPB 4I09A 1AOYA 3IRRA 4PDKA 3P7NA 4G9YA 4I2OA 1R58A 3VFZA 4PCQA 5BPDA 1BC7C 4BH9A 4EV0A 2BE5F 1U5TC 2LF7A 4JK1X 1GVJA 5LBQA 1F5TA 2M45A 3JSOA 3FZVA 3WTZA 3JAMZ 1IN8A 1JHHA 1R1UA 2MH9A 3E6BA 3IC7A 2VONA 4HA8A 2OBPA 1W5SA 2W24A 2GA1A 1QNTA 1KU2A 2QM3A 4UVBA 4OOIA 5HLGA 2V1DA 2HWVA 4OIOF 3QAHA 2P5VA 1J7KA 4IRGA 5L3DA 1CF7A 1I27A 4U7BA 2EV5A 4UV9A 2PMUA 4HV6A 1YLFA 1HBXG 2A5YB 2YX4A 4M73A 4A6EA 1U78A 4EJOA 1G4DA 1LVAA 1NHAA 3CUQC 3QRFF 2D45A 3FMSA 2UWMA 2J5OA 2VBZA 3L09A 1YIOA 2XAJA 2XROA 3TDUC 5LHGA 1XGSA 3RJPA 1S3JA 3GWZA 4AIKA 1H0MA 2CG4A 3KETA 1LQ1A 4ENMA 3QP5A 1BBYA 3ZP5A 3WTYC 3IHUA 1EH7A 1MDMB 4I0BA 3T1BA 4IXAA 2O8XA 2XUBA 5ERIA 1UB9A 3ZMUA 1ZRCA 4A0XA 3RI4A 3FXUA 1V4RA 4U7DA 4U0VA 1YFHA 2EK5A 2BYVE 3ZQ7A 1LJ9A 2ISZA 2FF4A 2VODA 1R00A 2EFWA 2Z33A 4OINF 2VBWA 4WF2A 4RB3C 1OYWA 2XAFA 4Y17A 4P9FA 1REPC 2VOOA 2P8TA 1T6SA 1I1GA 4P5OA 3PQJA 3HTUA 5KK1A 2QBYA 5LHIA 2HYFA 2YPRA 2A69F 4U88A 1MJ9A 1Z1DA 1ZREA 3JAMK 4TV7A 2O6GE 2B0LA 2DU9A 2COMA 2AS5F 4N9IA 3J81Z 2CW0F 4FT8A 4QLCU 4L9VA 2EV6A 4I02A 1MJAA 4LLLA 5E20A 2DO7A 4L9TA 2E1CA 2Y48A 4G6DA 5ILSA 2FNPA 2XKOA 3G73A 4CGZA 3WU0A 1T2KA 3R6SA 2ZNYA 2ETHA 2ZJ2A 4RB2C 3ZMTA 2PG4A 5F64A 3C7JA 1Z91A 2FOKA 1IRFA 2BGCA 2V1XA 2JPCA 5E1XA 5DEQA 4I01A 1FPQA 1IN5A 2W57A 3ABTA 3CO7C 1SMYF 5E8IA 3K1NA 4G94A 2P7CB 4AD9A 1WRJA 2HEOA 1MD0A 1UCRA 1FBUA 2F5CA 3VEPA 2MA3A 3FM5A 4KMFA 3MQ0A 1MZBA 2GWRA 2ESNA 3F8CA 3EYIA 3EYYA 5DDGA 1G3TA 3ZN1A 1GHCA 3ZMSA 5DV5A 1D5VA 3DPLC 3MWMA 3U1DA 1TQIA 2F5EA 4BHBA 2K4BA 2GA2A 3E97A 1YTYA 5TRDA 3EDPA 1Z6TA 4R79A 2TDXA 2XAQA 4XRFA 5LEKA 4O6JA 2X4HA 2Z5UA 2HZTA 2P6SA 3HOSA 4HZFA 1YQAA 2W25A 1LNWA 4ETSA 1O3QA 4M9XA 3PFIA 2FMLA 5K5OA 4O3MA 3ECHA 1JE8A 2GIVA 5IT3A 2QENA 4LJZF 1L0OC 4M74A 2PMHA 3E6CC 1P4XA 3IWFA 4LK1F 4F7ZA 1ON2A 2H6BA 1ZLJA 4KUMA 4YFKF 4YIIA 4WXCA 5CYVA 1QQIA 1K78B 4HBLA 4DQ2A 1IF1A 3I4PA 1ZN2A 2DW4A 2PI0A 3P9CA 1OKRA 1IXSB 2K86A 3F23A 2XAGA 1SFEA 4M6XA 3V7SA 2LDUA 1O3RA 2M30A 3BPVA 3QU6A 3VOEA 4FX4A 3R61A 3I54A 3O6BB 1EV7A 3BWGA 3I58A 4A12A 5DCMB 4LLNA 4LD5A 1IXCA 5ILUA 1I1SA 3R60A 2XAHA 5EEGA 1J75A 1B4AA 2EFNA 3SHFA 1SD5A 3V4GA 3V8JA 3KZYA 5EEHA 4XSZF 1XGMA 2PLYA 5DUIA 4Y13A 4WWCA 2YSRA 1U5TA 4GGGA 4P96A 1AWCA 1B9MA 5H6RA 4D0PA 2ADUA 3QP6A 5D5UB 4RS8A 1XGOA 2X0LA 2BV6A 5ICGA 2JTVA 1HKQA 2A6HF 4KIBA 2E7WA 2ZFWA 3KP4A 3SXYA 2BEOA 1PP8F 2K02A 2G7HA 2GAUA 3TGNA 5FD6A 4G7HF 5L3FA 2ZMEA 3KP6A 1ZRFA 1R5HA 3C1DA 2NRAC 2ISYA 2R7DA 4EJUA 2KKOA 2OD5A 4KIGA 1RI7A 4ESBA 4R1HA 3F8BA 3WTUC 4B09A 4RAYA 2O03A 4FX0A 3J80K 3CUQB 2CQKA 1VTNC 2PEXA 1F9NA 3QU3A 1DUXC 2DQLA 3I64A 1BM9A 4U0YA 3COAC 2EWNA 2OU2A 2RN7A 1DP7P 4A6DA 3T5XA 2ACJA 2R7FA 4HOBA 1RUNA 1ZAOA 2ZBKA 5CVIA 3E6MA 5HLHA 3LQQA 1XMAA 1IRGA 2CO5A 4ZH4F 4BHPA 3IL2A 1FSEA 4ZYHA 2ZXJA 4CICA 1OYYA 4BYYA 3MCZA 4BHCA 4R8HA 2HQRA 2P5LC 3H92A 3E5QA 5A2QZ 4LLGF 3H3ZA 1USTA 1R22A 5ICFA 2IPQX 1BIAA 1HKSA 2DFIA 1SD6A 4HF1A 2QWWA 3WTSC 3KCCA 2W84A 4K2EA 4N0BA 1W5TA 1C0WA 2A3SA 3IRQA 2GZWA 2V1UA 1TQMA 1ZH5A 1HSTA 1HW2A 2EJRA 4PZJA 3VB2A 3KP3A 3C3WA 1B9NA 4HW0A 4A5NA 3LAPA 3WGIA 1JXSA 2HTSA 4OMZA 1WSUA 4NQWA 3D5LA 2JZYA 2PFBA 3BROA 4MEYF 5LRRA 2CFXA 4CXFA 3CTAA 3BOQA 4G8XA 3SZPA 1R23A 4JQFA 1FYLA 2M1BA 3L7WA 3Q9SA 1G3SA 5CLSA 4H0EA 5DYMA 4HX4A 3P9KA 1CF7B 3S2WA 5CVVA 2R3SA 1IZ1A 2XV4S 1T0FA 5DD8A 2ELHA 5FFXA 6PAXA 1U6GA 3U2RA 2JT1A 3FWEA 5AIPA 5CVJA 2AXLA 1UHWA 1ZYRF 2Y0MA 2QQBA 2VE9A 2IA1A 3WGHA 2PBIA 3GFIA 3TOBA 3V8KA 2H27A 2Q0OA 3SFZA 2L4MA 4A2UA 4HV5A 3U9GA 5A2QK 4EQQA 4HX7A 3CLOA 1RZ4A 1E17A 4I98B 3KP7A 4HQEA 2L4AA 3GFLA 2FU4A 3FMQA 3GX4X 2A07F 5IT9K 1ZG1A 1GXPA 1Z05A 5D8LB 4L5JA 2UXXA 4M71A 4GO1A 2FEZA 1LDKB 4Q4ZF 2Q2EA 3MAJA 1MJBA 1EH8A 5HDKA 3DP7A 3I59A 3BPXA 2HKOA 3HHGA 2A61A 2DPDA 1ZLKA 2F5FA 5HDGA 4ENJA 1JHFA 4XLNF 3HRMA 3WG9A 4S04A 4KT5C 2JPBA 1XDSA 2QQ9A 3V8LA 3BJ6A 2QBYB 5D5WB 3GF2A 4EJTA 3IWZA 3TO7A 1Z7UA 4BNCA 2XIGA 3F21A 4UXNA 4UNOA 3GFMA 4Q48A 5H6QA 3GW2A 3B73A 4HF0A 1X3UA 2QUFA 4MNUA 4GCVA 5LEJA 2Z9OA 1YS6A 1UFMA 4MQ9F 2IRFG 5J8CA 3EUHA 1H9GA 4QWQA 2WTEA 3GYHX 1SMTA 2XHKA 3T8RA 2LF8A 1CGPA 1J0RA 1R36A 3HRTA 4G7ZF 1FYMA 3KLNA 1ZRDA 3ZPLA 4IHSA 4KN7X 4B8XA 1ULYA 4HYEA 4KFCA 4A0YA 3HOTA 3RTRA 3PQKA 4YG2F 3FXQA 1S7OA 2L54A 2WV0A 1OPCA 3BZ6A 4GYIA 1T38A 4EGZA 4RAZA 1A04A 2FRHA 3GXOA 2UXNA 5CJ9A 1R1TA 1USSA 2CGPA 2V9VA 1ZG5A 2ESHA 4YFNF 2IT0A 2VT3A 2HDCA 2FBKA 2O61A 2DBBA 1IN7A 4UHTA 3ERED 1Z9CA 1HW5A 4LB6B 4WX9A 2NYXA 1P4AA 2QQAA 3L2CA 1BC8C 3V7CA 3GO5A 1XSXA 3HYIA 1OR7A 2DT5A 5L3CA 2HTJA 4EM2A 1S29A 5JFRA 4HQMA 5HVQC 1O7LA 2MLGA 3F72A 1TW2A 1W7PD 1R1VA 3RYRA 3I71A 5F6FA 4L0ZB 4ESJA 2A68F 3RKXA 4LK0F 4UVAA 1G6NA 1U8RA 5DUKA 3DXJF 5D5VB 3F8FA 1OMIA 3LA3A 2EFOA 2V79A 3M8FA 4HLYA 3F8MA 4YIFA 3J81K 4BAYA 3W6KB 3DQVC 4ASNA 1WKMA 4EVIA 3I5UA 3M9AA 3K1MA 4M72A 2FSWA 4PGGA 1QGPA 1ONVA 2MH2A 3RKYA 5ICEA 2HOEA 2CSOA 4LMYA 1Y0UA 5LGUA 1FWZA 1BI1A 2FMYA 5K5QA 4KA4A 2IW5A 5HLIA 3WTVC 3REOA 3Q5FA 1SAXA 4M9ZA 2BBYA 3R4KA 5BMZA 2Y75A 1XSVA 4GXOA 2RGVA 3WU1B 1XB4A 2IVMA 2ZCWA 2FBHA 4LGWA 2NAZA 3HRUA 5FO5A 1P2FA 3HRSA 3NQOA 4HX8A 4OU0A 1O3TA 1Z6RA 4ZZLA 4MTDA 2JSCA 4ZYDA 2DK8A 4KYWA 4ON0A 3VODA 3TOAA 1HQCA 1BJAA 1J59A 4OMYA 1YW9A 1KU3A 3M8EA 3N97A 3BP8A 2OZ6A 1U5TB 2KJBA 1XCVA 3WTXC 4EMSA 1XCBA 1U2WA 4KICA 1BI0A 2PQ8A 5DCFA 2C6YA 3RDIA 3E5XA 1YG2A 3WGGA 3GFJA 4Q47A 2WWYA 2M8EA 2ZMEB 3HSEA 1L3LA 3KE2A 2RDPA 3ABUA 1XD7A 5HOOA 5E1WA 4LG0A 4ZYGA 2EA4A 1ZHFA 1F4KA 2RKHA 4Y15A 3JW4A 4MTEA 3HTSB 3O2PE 1XSDA 5J8FA 2DK5A 1FY7A 3RIRA 4YFXF 2MD5A 1QO0D 3BY6A 5E17F 4P9UA 4WXHA 1W7PA 2QVOA 1S8NA 3GEZA 1WQ2A 2EB7A 4KDPA 3GZ6A 2P4WA 4WK8F 3HUGA 1F1ZA 3T0YA 4A0ZA 2H94A 4RGSA 3OV8A 1FSHA 2ZNZA 3E5UA 2HS5A 4LB5A 4A5MA 2XGXA 4MQVA 1FBQA 2M87A 4RB0A 4DNCA 2Z3YA 5ILVA 2VN2A 3ZMZA 1V3FA 1XMKA 3ZN0A 4WCGA 2OQRA 3F6VA 1KQ0A 1ON1A 1B59A 4EM0B 3L00A 3G3ZA 4CZZA 4PGHA 2D1HA 3I53A 3HHHA 2VC0A 2O3FA 4JBAA 1PUEE 1KYZA 1YW7A 4HF2A 2G9WA 1B6AA 5BQTA 5TJJA 2OQGA 2ZO4A 3CJNA 3V7RA 1QZYA 4O5VA 5CVRA 3D0SA 1S7AA 1QBJA 2MLKA 3MFKA 1ZGAA 3F8NA 1G3WA 4KIFA 5LRSA 3MZYA 4IJAA 1P6RA 3ECOA 2VXZA 3K0LA 3R0JA 4NHJA 2OZUA 1DPUA 5K1YA 4ENNA 5FFZA 1BIBA 2IA2A 3K9TA 1MGTA 3QPTA 1QZZA 4OIRF 3OOPA 3C18A 3ZMVA 5J6XA 5JR3A 4ENKA 1FC3A 2RC4A 1O3SA 3QOPA 2RNJA 3N4MA 1R7JA 1TNTA 2RV8A 4RGUA 1GXQA 1LEAA 3RYPA 4E70A 4L18B 4AIHA 2H6CA 4CDGA 2PJPA 3FMRA 3LA2A 1J2XA 3LSTA 4IHTA 4EM1A 4GYGA 1LEBA 1ZARA 1YS7A 2FBIA 4ZZDA 3RPUA 3FXRA 1YW8A 3O3KA 3LFKA 4FHTA 2DAOA 4G6QA 4CYDA 4RGXA 1HXDA 4BQAA 5D8KB 1K7AA 2RVCA 4OIPF 3BJAA 1EH6A 1IXRC 1MDMA 4M9SA 4P55A 5AIQA 2GXBA 3GZ5A 1MKMA 1DDNA 1RIOH 4UUVA 2FNAA 5D6EA 3I59B 5K5RA 1TQPA 5BPIA 2F5DA 2G7UA 3JSPA 3MEXA 3B02A 3KFWX 5LLQA 3LA7A 2L01A 5L3BA 1D8KA 5D6FA 1K79A 4LFUA 1K6OA 1KGSA 2KIUA 3P9IA 3TO6A 1RNLA 2VE8A 5H20A 3NEUA 1FT9A 3HSRA 4L5IA 1IAWA 1PDNC 5FLXZ 1O7FA 1LDDA 3DEUA 2XKPA 1RUOA 3ISPA 2MC3A 5BS6A 2FXAA 3E6DA 1ODDA 2EV0A 4OIQF 3T8TA 2Q8KA 4L9JA 1HSJA 2DLLA 2IJLA 3KZZA 4XLPF 1KQ9A 3CDHA 2K4JA 3KP2A 2DI3A 3TKYA 2GXGA 1LB2A 4Q5SF 2P6TA 3WE3A 3FHZA 2EFQA 2DPUA 2P5KA 1KU7A 2P7VB 1TLHB 2LNBA 4KMUX 5F1RA 4UV8A 3HIFA 2KRFA 2WC2A 1SFXA 1TBXA 3NRVA 2IP2A 5JI6A 2KIFA 2YU3A 1R5GA 1DPRA 1BI3A 2HGCA 3DF8A 4HAMA 1U3EM 2QLZA 2F2EA 3ROUA 5BOXA 2QZ8A 4IPAA 2HQNA 3E3VA 3QPHA 5LHHA 1J5YA 1T39A 2A6EF 2H09A 1KYWA 2HYGD 4L9NA 1FOKA 4MGRA 4AVPA 4XBFA 2VT2A 1G3YA 1IN4A 5E1ZB 3K69A 3SZTA 2D1VA 2E7XA 4ZYEA 4RB1A 3ELKA 2K7LA 5KVRA 3TDZC 2D2WA 2KJCA 2M5WA 2ZKZA 5FLXK 3CUOA 3EQLF 3LAJA 3ML6A 1P92A 3DFGA 3ULQB 4IF4A 3IKVA 2VC1A 1FNNA 4G7OF 3M7GA 5DD4A 4CHUA 5HS7A 3I0TA 1D3YA 5HS8A 4MHGA 1LDJA 2HR3A 2LKPA 4ESFA 3KLOA 1HW1A 2IA0A 3WTTC 1XGNA 1K78A 3DKWA 3J80Z 2O0YA 2QYOA 5HDNA 2NNNA 3Q9VA 1IW7F 2GQQA 1QPMA 5E8GA 1SD4A 1W4MA 3MZHA 3K2ZA 4KNYA 3JTHA 1YO5C 5FD5A 2EFPA 2MBFA 1E2XA 4NB5A 1XN7A 3LWFA 1KA8A 2HKXA 3EETA 5D4RA 3GVAA 3K1PA 5DCMA 3L9FA 2HFHA 3KP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRN A;  5HS9 A;  3IKT A;  2FA5 A;  2YR2 A;  2CYY A;  5AON A;  3W6J B;  1I6X A;  1BOA A;  3BDD A;  3KEQ A;  2RQP A;  4S05 A;  1KU9 A;  2L3D A;  1I5Z A;  4MEX F;  5E18 F;  2VBX A;  4RGR A;  5ICC A;  1TTY A;  2DQR A;  2L02 A;  1IN6 A;  1ZG3 A;  5FGM A;  1S6L A;  1XDU A;  5D5X B;  4HLX A;  1P4W A;  3FX3 A;  1B1B A;  3BJO A;  4EJV A;  4AIJ A;  1UHM A;  5JHU A;  1TW3 A;  1O57 A;  4BXU A;  2VBY A;  5LGT A;  2STT A;  3DV8 A;  4IRH A;  2EA2 A;  2JRT A;  3AAF A;  4LG0 B;  3F3X A;  1BI2 A;  3WE2 A;  3WOD F;  4UVC A;  5L3E A;  3SQN A;  3J7A O;  2VOP A;  1JGS A;  1FLI A;  2E1N A;  4CO8 A;  3DPT A;  1ZGJ A;  3CUQ A;  2FE3 A;  4WXD A;  2Z99 A;  1TNS A;  2XVC A;  1KQ8 A;  4HDU A;  3ZMD A;  2W85 A;  2J5P A;  4IVN A;  3GLX A;  1BN5 A;  1SD7 A;  4IRI A;  1Q1H A;  2CWE A;  5JVT A;  3FF5 A;  4M6Y A;  2OAZ A;  5ED4 A;  2NNY A;  1FX7 A;  3HSF A;  1W7P B;  1YYV A;  5D4S A;  4Z2Y A;  4I0A A;  1FP2 A;  1T98 A;  5FB2 A;  1PP7 U;  2YX7 A;  4EGY A;  4EJW A;  2UZK A;  3RPQ A;  1FP1 D;  3KEO A;  1STZ A;  2V6C A;  1J9I A;  4KN4 X;  1WI9 A;  2LSO A;  5L3G A;  4L0Y B;  2FQ3 A;  1D8J A;  2STW A;  3JTG A;  3WTW C;  3TQN A;  2KIM A;  3GUD A;  2XAS A;  4HDV A;  4I7H A;  1SFU A;  1HKT A;  3H3U A;  3F6O A;  2K27 A;  3F22 A;  4XSX F;  5CVU A;  4N9H A;  3LQR A;  2OA4 A;  3TO9 A;  4U0W A;  1H9T A;  3M1E A;  3RKW A;  5LGN A;  5IT9 Z;  2DTR A;  1FBS A;  2PN6 A;  3CO6 C;  1IUY A;  1WWX A;  4AWX B;  1FYK A;  2NS0 A;  3R0A A;  3FM3 A;  1OYI A;  1FZP B;  4I09 A;  1AOY A;  3IRR A;  4PDK A;  3P7N A;  4G9Y A;  4I2O A;  1R58 A;  3VFZ A;  4PCQ A;  5BPD A;  1BC7 C;  4BH9 A;  4EV0 A;  2BE5 F;  1U5T C;  2LF7 A;  4JK1 X;  1GVJ A;  5LBQ A;  1F5T A;  2M45 A;  3JSO A;  3FZV A;  3WTZ A;  3JAM Z;  1IN8 A;  1JHH A;  1R1U A;  2MH9 A;  3E6B A;  3IC7 A;  2VON A;  4HA8 A;  2OBP A;  1W5S A;  2W24 A;  2GA1 A;  1QNT A;  1KU2 A;  2QM3 A;  4UVB A;  4OOI A;  5HLG A;  2V1D A;  2HWV A;  4OIO F;  3QAH A;  2P5V A;  1J7K A;  4IRG A;  5L3D A;  1CF7 A;  1I27 A;  4U7B A;  2EV5 A;  4UV9 A;  2PMU A;  4HV6 A;  1YLF A;  1HBX G;  2A5Y B;  2YX4 A;  4M73 A;  4A6E A;  1U78 A;  4EJO A;  1G4D A;  1LVA A;  1NHA A;  3CUQ C;  3QRF F;  2D45 A;  3FMS A;  2UWM A;  2J5O A;  2VBZ A;  3L09 A;  1YIO A;  2XAJ A;  2XRO A;  3TDU C;  5LHG A;  1XGS A;  3RJP A;  1S3J A;  3GWZ A;  4AIK A;  1H0M A;  2CG4 A;  3KET A;  1LQ1 A;  4ENM A;  3QP5 A;  1BBY A;  3ZP5 A;  3WTY C;  3IHU A;  1EH7 A;  1MDM B;  4I0B A;  3T1B A;  4IXA A;  2O8X A;  2XUB A;  5ERI A;  1UB9 A;  3ZMU A;  1ZRC A;  4A0X A;  3RI4 A;  3FXU A;  1V4R A;  4U7D A;  4U0V A;  1YFH A;  2EK5 A;  2BYV E;  3ZQ7 A;  1LJ9 A;  2ISZ A;  2FF4 A;  2VOD A;  1R00 A;  2EFW A;  2Z33 A;  4OIN F;  2VBW A;  4WF2 A;  4RB3 C;  1OYW A;  2XAF A;  4Y17 A;  4P9F A;  1REP C;  2VOO A;  2P8T A;  1T6S A;  1I1G A;  4P5O A;  3PQJ A;  3HTU A;  5KK1 A;  2QBY A;  5LHI A;  2HYF A;  2YPR A;  2A69 F;  4U88 A;  1MJ9 A;  1Z1D A;  1ZRE A;  3JAM K;  4TV7 A;  2O6G E;  2B0L A;  2DU9 A;  2COM A;  2AS5 F;  4N9I A;  3J81 Z;  2CW0 F;  4FT8 A;  4QLC U;  4L9V A;  2EV6 A;  4I02 A;  1MJA A;  4LLL A;  5E20 A;  2DO7 A;  4L9T A;  2E1C A;  2Y48 A;  4G6D A;  5ILS A;  2FNP A;  2XKO A;  3G73 A;  4CGZ A;  3WU0 A;  1T2K A;  3R6S A;  2ZNY A;  2ETH A;  2ZJ2 A;  4RB2 C;  3ZMT A;  2PG4 A;  5F64 A;  3C7J A;  1Z91 A;  2FOK A;  1IRF A;  2BGC A;  2V1X A;  2JPC A;  5E1X A;  5DEQ A;  4I01 A;  1FPQ A;  1IN5 A;  2W57 A;  3ABT A;  3CO7 C;  1SMY F;  5E8I A;  3K1N A;  4G94 A;  2P7C B;  4AD9 A;  1WRJ A;  2HEO A;  1MD0 A;  1UCR A;  1FBU A;  2F5C A;  3VEP A;  2MA3 A;  3FM5 A;  4KMF A;  3MQ0 A;  1MZB A;  2GWR A;  2ESN A;  3F8C A;  3EYI A;  3EYY A;  5DDG A;  1G3T A;  3ZN1 A;  1GHC A;  3ZMS A;  5DV5 A;  1D5V A;  3DPL C;  3MWM A;  3U1D A;  1TQI A;  2F5E A;  4BHB A;  2K4B A;  2GA2 A;  3E97 A;  1YTY A;  5TRD A;  3EDP A;  1Z6T A;  4R79 A;  2TDX A;  2XAQ A;  4XRF A;  5LEK A;  4O6J A;  2X4H A;  2Z5U A;  2HZT A;  2P6S A;  3HOS A;  4HZF A;  1YQA A;  2W25 A;  1LNW A;  4ETS A;  1O3Q A;  4M9X A;  3PFI A;  2FML A;  5K5O A;  4O3M A;  3ECH A;  1JE8 A;  2GIV A;  5IT3 A;  2QEN A;  4LJZ F;  1L0O C;  4M74 A;  2PMH A;  3E6C C;  1P4X A;  3IWF A;  4LK1 F;  4F7Z A;  1ON2 A;  2H6B A;  1ZLJ A;  4KUM A;  4YFK F;  4YII A;  4WXC A;  5CYV A;  1QQI A;  1K78 B;  4HBL A;  4DQ2 A;  1IF1 A;  3I4P A;  1ZN2 A;  2DW4 A;  2PI0 A;  3P9C A;  1OKR A;  1IXS B;  2K86 A;  3F23 A;  2XAG A;  1SFE A;  4M6X A;  3V7S A;  2LDU A;  1O3R A;  2M30 A;  3BPV A;  3QU6 A;  3VOE A;  4FX4 A;  3R61 A;  3I54 A;  3O6B B;  1EV7 A;  3BWG A;  3I58 A;  4A12 A;  5DCM B;  4LLN A;  4LD5 A;  1IXC A;  5ILU A;  1I1S A;  3R60 A;  2XAH A;  5EEG A;  1J75 A;  1B4A A;  2EFN A;  3SHF A;  1SD5 A;  3V4G A;  3V8J A;  3KZY A;  5EEH A;  4XSZ F;  1XGM A;  2PLY A;  5DUI A;  4Y13 A;  4WWC A;  2YSR A;  1U5T A;  4GGG A;  4P96 A;  1AWC A;  1B9M A;  5H6R A;  4D0P A;  2ADU A;  3QP6 A;  5D5U B;  4RS8 A;  1XGO A;  2X0L A;  2BV6 A;  5ICG A;  2JTV A;  1HKQ A;  2A6H F;  4KIB A;  2E7W A;  2ZFW A;  3KP4 A;  3SXY A;  2BEO A;  1PP8 F;  2K02 A;  2G7H A;  2GAU A;  3TGN A;  5FD6 A;  4G7H F;  5L3F A;  2ZME A;  3KP6 A;  1ZRF A;  1R5H A;  3C1D A;  2NRA C;  2ISY A;  2R7D A;  4EJU A;  2KKO A;  2OD5 A;  4KIG A;  1RI7 A;  4ESB A;  4R1H A;  3F8B A;  3WTU C;  4B09 A;  4RAY A;  2O03 A;  4FX0 A;  3J80 K;  3CUQ B;  2CQK A;  1VTN C;  2PEX A;  1F9N A;  3QU3 A;  1DUX C;  2DQL A;  3I64 A;  1BM9 A;  4U0Y A;  3COA C;  2EWN A;  2OU2 A;  2RN7 A;  1DP7 P;  4A6D A;  3T5X A;  2ACJ A;  2R7F A;  4HOB A;  1RUN A;  1ZAO A;  2ZBK A;  5CVI A;  3E6M A;  5HLH A;  3LQQ A;  1XMA A;  1IRG A;  2CO5 A;  4ZH4 F;  4BHP A;  3IL2 A;  1FSE A;  4ZYH A;  2ZXJ A;  4CIC A;  1OYY A;  4BYY A;  3MCZ A;  4BHC A;  4R8H A;  2HQR A;  2P5L C;  3H92 A;  3E5Q A;  5A2Q Z;  4LLG F;  3H3Z A;  1UST A;  1R22 A;  5ICF A;  2IPQ X;  1BIA A;  1HKS A;  2DFI A;  1SD6 A;  4HF1 A;  2QWW A;  3WTS C;  3KCC A;  2W84 A;  4K2E A;  4N0B A;  1W5T A;  1C0W A;  2A3S A;  3IRQ A;  2GZW A;  2V1U A;  1TQM A;  1ZH5 A;  1HST A;  1HW2 A;  2EJR A;  4PZJ A;  3VB2 A;  3KP3 A;  3C3W A;  1B9N A;  4HW0 A;  4A5N A;  3LAP A;  3WGI A;  1JXS A;  2HTS A;  4OMZ A;  1WSU A;  4NQW A;  3D5L A;  2JZY A;  2PFB A;  3BRO A;  4MEY F;  5LRR A;  2CFX A;  4CXF A;  3CTA A;  3BOQ A;  4G8X A;  3SZP A;  1R23 A;  4JQF A;  1FYL A;  2M1B A;  3L7W A;  3Q9S A;  1G3S A;  5CLS A;  4H0E A;  5DYM A;  4HX4 A;  3P9K A;  1CF7 B;  3S2W A;  5CVV A;  2R3S A;  1IZ1 A;  2XV4 S;  1T0F A;  5DD8 A;  2ELH A;  5FFX A;  6PAX A;  1U6G A;  3U2R A;  2JT1 A;  3FWE A;  5AIP A;  5CVJ A;  2AXL A;  1UHW A;  1ZYR F;  2Y0M A;  2QQB A;  2VE9 A;  2IA1 A;  3WGH A;  2PBI A;  3GFI A;  3TOB A;  3V8K A;  2H27 A;  2Q0O A;  3SFZ A;  2L4M A;  4A2U A;  4HV5 A;  3U9G A;  5A2Q K;  4EQQ A;  4HX7 A;  3CLO A;  1RZ4 A;  1E17 A;  4I98 B;  3KP7 A;  4HQE A;  2L4A A;  3GFL A;  2FU4 A;  3FMQ A;  3GX4 X;  2A07 F;  5IT9 K;  1ZG1 A;  1GXP A;  1Z05 A;  5D8L B;  4L5J A;  2UXX A;  4M71 A;  4GO1 A;  2FEZ A;  1LDK B;  4Q4Z F;  2Q2E A;  3MAJ A;  1MJB A;  1EH8 A;  5HDK A;  3DP7 A;  3I59 A;  3BPX A;  2HKO A;  3HHG A;  2A61 A;  2DPD A;  1ZLK A;  2F5F A;  5HDG A;  4ENJ A;  1JHF A;  4XLN F;  3HRM A;  3WG9 A;  4S04 A;  4KT5 C;  2JPB A;  1XDS A;  2QQ9 A;  3V8L A;  3BJ6 A;  2QBY B;  5D5W B;  3GF2 A;  4EJT A;  3IWZ A;  3TO7 A;  1Z7U A;  4BNC A;  2XIG A;  3F21 A;  4UXN A;  4UNO A;  3GFM A;  4Q48 A;  5H6Q A;  3GW2 A;  3B73 A;  4HF0 A;  1X3U A;  2QUF A;  4MNU A;  4GCV A;  5LEJ A;  2Z9O A;  1YS6 A;  1UFM A;  4MQ9 F;  2IRF G;  5J8C A;  3EUH A;  1H9G A;  4QWQ A;  2WTE A;  3GYH X;  1SMT A;  2XHK A;  3T8R A;  2LF8 A;  1CGP A;  1J0R A;  1R36 A;  3HRT A;  4G7Z F;  1FYM A;  3KLN A;  1ZRD A;  3ZPL A;  4IHS A;  4KN7 X;  4B8X A;  1ULY A;  4HYE A;  4KFC A;  4A0Y A;  3HOT A;  3RTR A;  3PQK A;  4YG2 F;  3FXQ A;  1S7O A;  2L54 A;  2WV0 A;  1OPC A;  3BZ6 A;  4GYI A;  1T38 A;  4EGZ A;  4RAZ A;  1A04 A;  2FRH A;  3GXO A;  2UXN A;  5CJ9 A;  1R1T A;  1USS A;  2CGP A;  2V9V A;  1ZG5 A;  2ESH A;  4YFN F;  2IT0 A;  2VT3 A;  2HDC A;  2FBK A;  2O61 A;  2DBB A;  1IN7 A;  4UHT A;  3ERE D;  1Z9C A;  1HW5 A;  4LB6 B;  4WX9 A;  2NYX A;  1P4A A;  2QQA A;  3L2C A;  1BC8 C;  3V7C A;  3GO5 A;  1XSX A;  3HYI A;  1OR7 A;  2DT5 A;  5L3C A;  2HTJ A;  4EM2 A;  1S29 A;  5JFR A;  4HQM A;  5HVQ C;  1O7L A;  2MLG A;  3F72 A;  1TW2 A;  1W7P D;  1R1V A;  3RYR A;  3I71 A;  5F6F A;  4L0Z B;  4ESJ A;  2A68 F;  3RKX A;  4LK0 F;  4UVA A;  1G6N A;  1U8R A;  5DUK A;  3DXJ F;  5D5V B;  3F8F A;  1OMI A;  3LA3 A;  2EFO A;  2V79 A;  3M8F A;  4HLY A;  3F8M A;  4YIF A;  3J81 K;  4BAY A;  3W6K B;  3DQV C;  4ASN A;  1WKM A;  4EVI A;  3I5U A;  3M9A A;  3K1M A;  4M72 A;  2FSW A;  4PGG A;  1QGP A;  1ONV A;  2MH2 A;  3RKY A;  5ICE A;  2HOE A;  2CSO A;  4LMY A;  1Y0U A;  5LGU A;  1FWZ A;  1BI1 A;  2FMY A;  5K5Q A;  4KA4 A;  2IW5 A;  5HLI A;  3WTV C;  3REO A;  3Q5F A;  1SAX A;  4M9Z A;  2BBY A;  3R4K A;  5BMZ A;  2Y75 A;  1XSV A;  4GXO A;  2RGV A;  3WU1 B;  1XB4 A;  2IVM A;  2ZCW A;  2FBH A;  4LGW A;  2NAZ A;  3HRU A;  5FO5 A;  1P2F A;  3HRS A;  3NQO A;  4HX8 A;  4OU0 A;  1O3T A;  1Z6R A;  4ZZL A;  4MTD A;  2JSC A;  4ZYD A;  2DK8 A;  4KYW A;  4ON0 A;  3VOD A;  3TOA A;  1HQC A;  1BJA A;  1J59 A;  4OMY A;  1YW9 A;  1KU3 A;  3M8E A;  3N97 A;  3BP8 A;  2OZ6 A;  1U5T B;  2KJB A;  1XCV A;  3WTX C;  4EMS A;  1XCB A;  1U2W A;  4KIC A;  1BI0 A;  2PQ8 A;  5DCF A;  2C6Y A;  3RDI A;  3E5X A;  1YG2 A;  3WGG A;  3GFJ A;  4Q47 A;  2WWY A;  2M8E A;  2ZME B;  3HSE A;  1L3L A;  3KE2 A;  2RDP A;  3ABU A;  1XD7 A;  5HOO A;  5E1W A;  4LG0 A;  4ZYG A;  2EA4 A;  1ZHF A;  1F4K A;  2RKH A;  4Y15 A;  3JW4 A;  4MTE A;  3HTS B;  3O2P E;  1XSD A;  5J8F A;  2DK5 A;  1FY7 A;  3RIR A;  4YFX F;  2MD5 A;  1QO0 D;  3BY6 A;  5E17 F;  4P9U A;  4WXH A;  1W7P A;  2QVO A;  1S8N A;  3GEZ A;  1WQ2 A;  2EB7 A;  4KDP A;  3GZ6 A;  2P4W A;  4WK8 F;  3HUG A;  1F1Z A;  3T0Y A;  4A0Z A;  2H94 A;  4RGS A;  3OV8 A;  1FSH A;  2ZNZ A;  3E5U A;  2HS5 A;  4LB5 A;  4A5M A;  2XGX A;  4MQV A;  1FBQ A;  2M87 A;  4RB0 A;  4DNC A;  2Z3Y A;  5ILV A;  2VN2 A;  3ZMZ A;  1V3F A;  1XMK A;  3ZN0 A;  4WCG A;  2OQR A;  3F6V A;  1KQ0 A;  1ON1 A;  1B59 A;  4EM0 B;  3L00 A;  3G3Z A;  4CZZ A;  4PGH A;  2D1H A;  3I53 A;  3HHH A;  2VC0 A;  2O3F A;  4JBA A;  1PUE E;  1KYZ A;  1YW7 A;  4HF2 A;  2G9W A;  1B6A A;  5BQT A;  5TJJ A;  2OQG A;  2ZO4 A;  3CJN A;  3V7R A;  1QZY A;  4O5V A;  5CVR A;  3D0S A;  1S7A A;  1QBJ A;  2MLK A;  3MFK A;  1ZGA A;  3F8N A;  1G3W A;  4KIF A;  5LRS A;  3MZY A;  4IJA A;  1P6R A;  3ECO A;  2VXZ A;  3K0L A;  3R0J A;  4NHJ A;  2OZU A;  1DPU A;  5K1Y A;  4ENN A;  5FFZ A;  1BIB A;  2IA2 A;  3K9T A;  1MGT A;  3QPT A;  1QZZ A;  4OIR F;  3OOP A;  3C18 A;  3ZMV A;  5J6X A;  5JR3 A;  4ENK A;  1FC3 A;  2RC4 A;  1O3S A;  3QOP A;  2RNJ A;  3N4M A;  1R7J A;  1TNT A;  2RV8 A;  4RGU A;  1GXQ A;  1LEA A;  3RYP A;  4E70 A;  4L18 B;  4AIH A;  2H6C A;  4CDG A;  2PJP A;  3FMR A;  3LA2 A;  1J2X A;  3LST A;  4IHT A;  4EM1 A;  4GYG A;  1LEB A;  1ZAR A;  1YS7 A;  2FBI A;  4ZZD A;  3RPU A;  3FXR A;  1YW8 A;  3O3K A;  3LFK A;  4FHT A;  2DAO A;  4G6Q A;  4CYD A;  4RGX A;  1HXD A;  4BQA A;  5D8K B;  1K7A A;  2RVC A;  4OIP F;  3BJA A;  1EH6 A;  1IXR C;  1MDM A;  4M9S A;  4P55 A;  5AIQ A;  2GXB A;  3GZ5 A;  1MKM A;  1DDN A;  1RIO H;  4UUV A;  2FNA A;  5D6E A;  3I59 B;  5K5R A;  1TQP A;  5BPI A;  2F5D A;  2G7U A;  3JSP A;  3MEX A;  3B02 A;  3KFW X;  5LLQ A;  3LA7 A;  2L01 A;  5L3B A;  1D8K A;  5D6F A;  1K79 A;  4LFU A;  1K6O A;  1KGS A;  2KIU A;  3P9I A;  3TO6 A;  1RNL A;  2VE8 A;  5H20 A;  3NEU A;  1FT9 A;  3HSR A;  4L5I A;  1IAW A;  1PDN C;  5FLX Z;  1O7F A;  1LDD A;  3DEU A;  2XKP A;  1RUO A;  3ISP A;  2MC3 A;  5BS6 A;  2FXA A;  3E6D A;  1ODD A;  2EV0 A;  4OIQ F;  3T8T A;  2Q8K A;  4L9J A;  1HSJ A;  2DLL A;  2IJL A;  3KZZ A;  4XLP F;  1KQ9 A;  3CDH A;  2K4J A;  3KP2 A;  2DI3 A;  3TKY A;  2GXG A;  1LB2 A;  4Q5S F;  2P6T A;  3WE3 A;  3FHZ A;  2EFQ A;  2DPU A;  2P5K A;  1KU7 A;  2P7V B;  1TLH B;  2LNB A;  4KMU X;  5F1R A;  4UV8 A;  3HIF A;  2KRF A;  2WC2 A;  1SFX A;  1TBX A;  3NRV A;  2IP2 A;  5JI6 A;  2KIF A;  2YU3 A;  1R5G A;  1DPR A;  1BI3 A;  2HGC A;  3DF8 A;  4HAM A;  1U3E M;  2QLZ A;  2F2E A;  3ROU A;  5BOX A;  2QZ8 A;  4IPA A;  2HQN A;  3E3V A;  3QPH A;  5LHH A;  1J5Y A;  1T39 A;  2A6E F;  2H09 A;  1KYW A;  2HYG D;  4L9N A;  1FOK A;  4MGR A;  4AVP A;  4XBF A;  2VT2 A;  1G3Y A;  1IN4 A;  5E1Z B;  3K69 A;  3SZT A;  2D1V A;  2E7X A;  4ZYE A;  4RB1 A;  3ELK A;  2K7L A;  5KVR A;  3TDZ C;  2D2W A;  2KJC A;  2M5W A;  2ZKZ A;  5FLX K;  3CUO A;  3EQL F;  3LAJ A;  3ML6 A;  1P92 A;  3DFG A;  3ULQ B;  4IF4 A;  3IKV A;  2VC1 A;  1FNN A;  4G7O F;  3M7G A;  5DD4 A;  4CHU A;  5HS7 A;  3I0T A;  1D3Y A;  5HS8 A;  4MHG A;  1LDJ A;  2HR3 A;  2LKP A;  4ESF A;  3KLO A;  1HW1 A;  2IA0 A;  3WTT C;  1XGN A;  1K78 A;  3DKW A;  3J80 Z;  2O0Y A;  2QYO A;  5HDN A;  2NNN A;  3Q9V A;  1IW7 F;  2GQQ A;  1QPM A;  5E8G A;  1SD4 A;  1W4M A;  3MZH A;  3K2Z A;  4KNY A;  3JTH A;  1YO5 C;  5FD5 A;  2EFP A;  2MBF A;  1E2X A;  4NB5 A;  1XN7 A;  3LWF A;  1KA8 A;  2HKX A;  3EET A;  5D4R A;  3GVA A;  3K1P A;  5DCM A;  3L9F A;  2HFH A;  3KP5 A; 
#chains in the Genus database with same CATH topology
 1B8I B;  2XRN A;  4E7H A;  1GT0 C;  5HS9 A;  5FRM A;  3K4L A;  2Y69 H;  3IKT A;  1JJ6 C;  2JRM A;  3VYT B;  2FA5 A;  2ZSH B;  1UG0 A;  2YR2 A;  4AM3 A;  3BZK A;  2CYY A;  5AON A;  3W6J B;  4QPQ A;  1I6X A;  3AG2 H;  4XNF A;  2PJR B;  1RPW A;  3PSF A;  1BOA A;  3BDD A;  3GTG J;  4A3B J;  3KEQ A;  4X0G A;  2RQP A;  3NAU A;  4S05 A;  1KU9 A;  2K9N A;  2L3D A;  2K9Q A;  3HBL A;  1I5Z A;  1MMS A;  3QYF A;  5FKL A;  4MEX F;  5E18 F;  4C3H J;  2VBX A;  3HKZ N;  3PIP F;  4RGR A;  5ICC A;  1TTY A;  3LSR A;  2NVX J;  3ASO H;  2DQR A;  2KLO A;  2L02 A;  1IN6 A;  4CCJ A;  1ZG3 A;  5FGM A;  2IS1 A;  3RSN A;  1YHQ I;  3HB9 A;  1LFP A;  4P1W A;  2R5Z A;  1S6L A;  1XDU A;  2R93 J;  5D5X B;  3LOC A;  4ZDL A;  4HLX A;  4I6Z A;  2XGD A;  1P4W A;  3FX3 A;  2PMZ N;  3LMM A;  2TCT A;  2NVT J;  4HG2 A;  2RQQ A;  4BJT A;  1B1B A;  3GTJ J;  3GTP J;  1JTY A;  3BJO A;  4EJV A;  4AIJ A;  4CSW A;  1UHM A;  5JHU A;  1TW3 A;  3L1P A;  4F92 B;  3OIQ A;  1O57 A;  2WY8 Q;  4BXU A;  2VBY A;  5EGO A;  1WJD A;  4XMY A;  3VSK A;  4L5E A;  1TL8 A;  2EPF A;  5LGT A;  2STT A;  3DV8 A;  4G12 A;  1ACI A;  4IRH A;  1X19 A;  2EA2 A;  2JRT A;  1H88 C;  3DPU A;  4Y33 A;  2JVH A;  1T56 A;  2VQL A;  5E3N A;  3AAF A;  1BL0 A;  4LG0 B;  3G1O A;  3F3X A;  1BI2 A;  3WE2 A;  3C2H A;  3VYU B;  2NXN B;  3WOD F;  4UVC A;  5L3E A;  3SQN A;  3J7A O;  2VOP A;  1JGS A;  1FLI A;  2E1N A;  4CO8 A;  1NH3 A;  4E6K G;  1NK3 P;  3DPT A;  1ZGJ A;  3CUQ A;  2OTL I;  2FE3 A;  4WXD A;  2Z99 A;  2VKE A;  1TNS A;  2XVC A;  1KQ8 A;  4HDU A;  3N05 A;  1VQK I;  4UUT A;  1IDZ A;  3VYR B;  1ETX A;  3QOD A;  3ZMD A;  2W85 A;  2J5P A;  4IVN A;  4N4N B;  4DBQ A;  5E3O A;  3MKL A;  3GLX A;  1BN5 A;  2HI3 A;  4FE4 A;  4BS9 A;  3UR3 C;  2Z1D A;  1SD7 A;  1FIP A;  1WFX A;  4BEH A;  3S3M A;  4IRI A;  3TP3 A;  4D9J A;  1Q1H A;  2CWE A;  2LBF A;  5JVT A;  3FF5 A;  2HVQ A;  3HPH A;  4M6Y A;  2OAZ A;  1X58 A;  4FTH A;  5ED4 A;  2MC4 A;  1FX7 A;  3HSF A;  1W7P B;  4CCM A;  2X1D A;  2NNY A;  1YYV A;  2K3P A;  5D4S A;  3PUF A;  2GLO A;  4Z2Y A;  3FDY A;  4I0A A;  1FP2 A;  3HKZ A;  3OYI A;  1T98 A;  5FB2 A;  2BY1 A;  1PP7 U;  4JX5 A;  3AG1 H;  2YX7 A;  3X2Q H;  1OLT A;  1X3W B;  4HRI A;  2KZG A;  4EGY A;  2E2H J;  4I76 A;  4B1R A;  3BT9 A;  1MH4 A;  4EJW A;  2UZK A;  3HUG B;  3RPQ A;  2F6C A;  1FP1 D;  4NNJ A;  3I9V 2;  3KEO A;  1STZ A;  3LSI A;  1YX5 A;  2V6C A;  1J9I A;  4KN4 X;  1WI9 A;  1YJN I;  2LSO A;  2LR8 A;  3HOZ J;  2JA7 J;  5L3G A;  4L0Y B;  4HST A;  2FQ3 A;  1D8J A;  2STW A;  4E7I A;  3JTG A;  2H8R A;  1YRN B;  3WTW C;  3TQN A;  4XOT A;  1A35 A;  2KIM A;  3GUD A;  2XAS A;  2LRD A;  1J09 A;  4II2 A;  5B1B H;  3CME I;  4HDV A;  2E19 A;  4I7H A;  2M4G A;  3BQZ A;  1SFU A;  1WGX A;  2LMD A;  4JYK A;  3SYT A;  3J7Y J;  1FTT A;  2LC2 A;  1HKT A;  3H3U A;  3F6O A;  1R4N B;  5J40 A;  2K27 A;  3A01 A;  3F22 A;  1NG6 A;  1JKQ C;  1ETO A;  4XSX F;  5EZH A;  5CVU A;  4N9H A;  2AHQ A;  1FMV A;  1TWA J;  2I10 A;  3LQR A;  2OA4 A;  3TO9 A;  3IH2 A;  4UB8 C;  4U0W A;  1H9T A;  3M1E A;  2BY3 A;  3GLL A;  3RKW A;  5LGN A;  5IT9 Z;  2DTR A;  1FBS A;  3ZQF A;  2PN6 A;  3CO6 C;  3CP8 A;  3GTK J;  1ORK A;  3ZQC A;  1IUY A;  1WWX A;  4AWX B;  1FYK A;  2VIX A;  2NS0 A;  1LVK A;  3R0A A;  3FM3 A;  3OYC A;  2HXO A;  3D5R C;  1SVO A;  1OYI A;  1FZP B;  2JN6 A;  2WB1 N;  4I09 A;  1AOY A;  3IRR A;  1O4X A;  2VKD A;  4PDK A;  3RQ4 A;  4QIW N;  2BZT A;  3B6C A;  3P7N A;  2O5R A;  4G9Y A;  3S8P A;  4W97 A;  4I2O A;  2K9L A;  3M8J A;  1K6Y A;  1R58 A;  3ZQL A;  3VFZ A;  1FIA A;  4PCQ A;  5BPD A;  2W7N A;  1BC7 C;  4BH9 A;  4EV0 A;  2BE5 F;  3U21 A;  1K61 A;  1BR1 A;  1U5T C;  2LF7 A;  4AVZ A;  4JK1 X;  1GVJ A;  3CJT B;  2W00 A;  5LBQ A;  1F5T A;  2M45 A;  3JSO A;  2L0K A;  3FZV A;  3AFH A;  4XOP A;  3WTZ A;  3JAM Z;  3A2K A;  2ELK A;  2LKS A;  2IS6 A;  1IN8 A;  1JHH A;  3CDI A;  1RR7 A;  1R1U A;  2MH9 A;  2QSF X;  3E6B A;  3IC7 A;  2VON A;  4HA8 A;  1E0E A;  2EIN H;  4A3J J;  2OBP A;  1GDT A;  2H1L A;  1W5S A;  2LY2 A;  2W24 A;  2GA1 A;  1QNT A;  3ONQ A;  1KU2 A;  3OL4 A;  3OYD A;  2QM3 A;  4UVB A;  3S16 J;  4OOI A;  1VQ9 I;  1CQT A;  1RES A;  5HLG A;  2V1D A;  2HWV A;  4OIO F;  5EDN A;  3K10 A;  2DOE A;  3KYL A;  3QAH A;  2DMQ A;  1J7K A;  2P5V A;  3HGG A;  4IRG A;  3MMY B;  4JP0 A;  5L3D A;  1CF7 A;  1I27 A;  4U7B A;  2EV5 A;  3FHN A;  4E7Z A;  3BCB A;  4UV9 A;  1V5G A;  5E3M A;  2PMU A;  4HV6 A;  1YLF A;  1HBX G;  4PFP A;  3K70 C;  1D0Z A;  4UB6 C;  2LYC A;  3S1R J;  2A5Y B;  2DTZ A;  2YX4 A;  4M73 A;  4A6E A;  1U78 A;  2E5N A;  4EJO A;  1G4D A;  3PO3 J;  2D5V A;  1LVA A;  1NHA A;  2BY2 A;  1AKH A;  3CUQ C;  1MSE C;  4RM2 A;  3QRF F;  2D45 A;  1IRX A;  3FMS A;  2UWM A;  2J5O A;  2ECB A;  2VBZ A;  4DJA A;  3L09 A;  2R7X A;  1YIO A;  4IHX A;  2GBY A;  2XAJ A;  3PUB A;  4RA2 A;  2XRO A;  2VB6 A;  3TDU C;  3BG3 A;  1I3A A;  5LHG A;  1MBG A;  1XGS A;  3RJP A;  1S3J A;  3GWZ A;  1DGW Y;  2WB1 A;  4AIK A;  2X6X A;  1H0M A;  2CG4 A;  3KET A;  5EZG A;  1LQ1 A;  4ENM A;  4CCN A;  2ICW G;  2DA4 A;  2HOA A;  3QP5 A;  5KHD A;  2XB0 X;  1BBY A;  3ZP5 A;  1PVE A;  3WTY C;  2L7Z A;  3IHU A;  3A0B C;  4XQF A;  1EH7 A;  2ZXH A;  1WCM J;  4DZP A;  1MDM B;  4I0B A;  3ZQH A;  3T1B A;  4IXA A;  2BHZ A;  1NK2 P;  2O8X A;  1IGN A;  3AL0 C;  4IKF A;  2XUB A;  3ESW B;  4XLA A;  4XRM A;  5ERI A;  1UB9 A;  3ZMU A;  1ZRC A;  4A0X A;  1GLN A;  2NVU B;  3RI4 A;  3FXU A;  2XF6 A;  1V4R A;  4E7L A;  4D7N A;  4U7D A;  4U0V A;  4YIR X;  1YFH A;  2VPR A;  2EK5 A;  1MMN A;  2BYV E;  3ZQ7 A;  5HLT A;  2KDO A;  3CF5 F;  1LJ9 A;  2ISZ A;  2FF4 A;  2VOD A;  1VND A;  1R00 A;  1V54 H;  2EFW A;  1PUF A;  2ID6 A;  2Z33 A;  3J7Z I;  3UKG A;  4OIN F;  3SZG A;  2VBW A;  4WF2 A;  4RB3 C;  2NS7 A;  4DGW B;  4CCL A;  1ZK8 A;  1OYW A;  4ZC3 A;  2XAF A;  4Y17 A;  3AG3 H;  4P9F A;  3OL3 A;  1REP C;  2VOO A;  2KRH A;  4G6T B;  3BR2 A;  4A69 C;  2P8T A;  3Q0V A;  3K4M A;  2F4O B;  2MFZ A;  1T6S A;  1I1G A;  3W2A A;  2K85 A;  4P5O A;  2X51 A;  3PQJ A;  3HTU A;  5KK1 A;  2QBY A;  1YOV B;  5IY5 H;  5LHI A;  2HYF A;  2YPR A;  2A69 F;  4U88 A;  4B3X A;  1W36 C;  2IGK A;  1MJ9 A;  1AU7 A;  3LSJ A;  5GPC A;  1Z1D A;  2Y0S A;  4DW6 A;  3CES A;  1ZRE A;  3JAM K;  4IOC F;  4TV7 A;  2O6G E;  2B0L A;  2DU9 A;  2COM A;  2E71 A;  2W4S A;  1VQO I;  3CJQ B;  2AS5 F;  4N9I A;  3J81 Z;  2CW0 F;  4FT8 A;  4QLC U;  4L9V A;  3KPH A;  2HVR A;  2EV6 A;  4I02 A;  3ABL H;  2I8D A;  1MJA A;  4LLL A;  5E20 A;  1DP3 A;  2YUS A;  2JQ7 A;  2DO7 A;  4L9T A;  2BXZ A;  2E1C A;  2Y48 A;  3PO2 J;  1MNM C;  4BXX J;  4G6D A;  5ILS A;  1G8X A;  3HPG A;  3S1M J;  4FE7 A;  3JRC A;  2FNP A;  2AQF A;  2XKO A;  3G73 A;  4CGZ A;  1WI3 A;  2L9V A;  4BQO A;  3S15 J;  4FET A;  3WU0 A;  1T2K A;  2G0E A;  3R6S A;  2ZNY A;  5FRO A;  2ETH A;  2ZJ2 A;  4RB2 C;  1OCO H;  5M3F J;  3ZMT A;  2PG4 A;  1NTC A;  5F64 A;  2R7U A;  3C7J A;  1Z91 A;  4HPQ A;  2FOK A;  1IRF A;  5TGT A;  2BGC A;  2V1X A;  2JPC A;  5E1X A;  4XM3 A;  5DEQ A;  1Y0N A;  4I01 A;  4ZYA A;  3D5S C;  1FPQ A;  4DYQ A;  3G1M A;  1IN5 A;  3JRF A;  2I5U A;  2W57 A;  3ABT A;  4B44 A;  3HM5 A;  1U8B A;  3CO7 C;  1SMY F;  4XR6 A;  2X6W A;  5E8I A;  3K1N A;  4G94 A;  2P7C B;  1MSF C;  4AD9 A;  5DS9 A;  2LH9 A;  1VQN I;  1WRJ A;  3PFY A;  2HEO A;  1PYV A;  4ITV A;  2DFF A;  1MD0 A;  2OCE A;  1UCR A;  1FBU A;  2F5C A;  3VEP A;  2MA3 A;  3FM5 A;  3I4N J;  4KMF A;  3MQ0 A;  5B1A H;  5FLM J;  1MZB A;  2GWR A;  2ESN A;  3F8C A;  3EYI A;  1T33 A;  3EYY A;  1OIS A;  5DDG A;  1G3T A;  3ZN1 A;  1GHC A;  1LFU P;  2CQX A;  4B43 A;  2CV0 A;  2R7Z J;  3ZMS A;  5DV5 A;  1T0F C;  4E7S A;  1D5V A;  3DPL C;  1R49 A;  3OYB A;  3MWM A;  3U1D A;  4CUG A;  1TQI A;  2F5E A;  4BHB A;  2K4B A;  2NOJ B;  2GA2 A;  3AG4 H;  3E97 A;  2JMW A;  1YTY A;  5TRD A;  4IEJ A;  3DLL F;  3EDP A;  3CDL A;  2DA6 A;  1Z6T A;  4R79 A;  3BG7 A;  2LK2 A;  2KFD A;  2E60 A;  2TDX A;  1R9T J;  1TT0 A;  2XAQ A;  4XRF A;  3L2V A;  5M5W J;  5LEK A;  4O6J A;  2X4H A;  4XLE A;  2JA6 J;  2Z5U A;  4CYC B;  3ABM H;  3KYD B;  3CCQ I;  3HOW J;  3OYF A;  2HZT A;  2P6S A;  2QF7 A;  3HOS A;  3H9Q A;  4HZF A;  3JRD A;  1OCZ H;  2VQC A;  3IH3 A;  1YQA A;  2W25 A;  1LNW A;  3H35 A;  4OWR B;  4ETS A;  4UUS A;  3I3L A;  1O3Q A;  4M9X A;  3PFI A;  1X4P A;  2F4M B;  2KHM A;  1ZTR A;  2R5Y B;  2FML A;  1YI2 I;  5K5O A;  4O3M A;  2ZB9 A;  3ECH A;  4PJN A;  1JE8 A;  3O8G A;  2GIV A;  3S17 J;  5IT3 A;  2QEN A;  4LJZ F;  4F3Q A;  1L0O C;  4B4C A;  4M74 A;  3BR0 A;  2PMH A;  3E6C C;  1P4X A;  3IWF A;  3D1N I;  4M3E A;  4LK1 F;  3WHB A;  4F7Z A;  1OCC H;  4V19 K;  1ON2 A;  2R0Q C;  5EG0 A;  2H6B A;  3SDG A;  3RZD J;  4MLO A;  1ZLJ A;  3HOU J;  2WAQ A;  4KUM A;  4YFK F;  4YII A;  4WXC A;  3IUO A;  5F0C A;  3CCU I;  3OYG A;  5CYV A;  1QQI A;  4BDY A;  1K78 B;  4HBL A;  2MGQ A;  4DQ2 A;  1IF1 A;  3I4P A;  1ZN2 A;  2DW4 A;  1I39 A;  1Y8Q B;  2IGN A;  3P9C A;  1R71 A;  1VQ8 I;  2PI0 A;  4RDU A;  3DEE A;  2RRE A;  4XK4 A;  4YEL A;  4RM3 A;  2AXT C;  1OKR A;  1IXS B;  2K86 A;  5K7H A;  4IZZ A;  1BA5 A;  3TBI A;  3F23 A;  1OCP A;  2XAG A;  2X9D A;  5DM6 F;  1SFE A;  4M6X A;  3V7S A;  4IX7 A;  2LDU A;  1O3R A;  4PFO A;  2M30 A;  4S0H B;  2L9S A;  2DA7 A;  3BPV A;  5CKT A;  4PK4 A;  3QU6 A;  2Z16 A;  3VOE A;  2ID3 A;  4FX4 A;  3R61 A;  3I54 A;  5F08 A;  2XPU A;  5IYC J;  3O6B B;  1EV7 A;  3BWG A;  3I58 A;  3QPL A;  5DCM B;  5E3L A;  4A12 A;  2PX9 A;  4LLN A;  4LD5 A;  3BTJ A;  2CW8 A;  1ITY A;  3EUH C;  1HOM A;  2HOT A;  1IXC A;  5ILU A;  1I1S A;  3R60 A;  4XN0 A;  4DYC A;  2XAH A;  5EEG A;  1J75 A;  1MW7 A;  1B4A A;  5JLX A;  2DDA A;  2R7T A;  4CZC A;  4C9Y A;  1ZGW A;  3PNY A;  2EFN A;  3SHF A;  1HDD C;  3CC7 I;  2HZD A;  3S32 A;  2XPV A;  4EAT A;  1SD5 A;  3V4G A;  1X3Z B;  3V8J A;  1YJW I;  3DWL E;  3KZY A;  4LIV A;  2HQ5 A;  5EEH A;  4XSZ F;  3FBN B;  3G6E I;  1XGM A;  2PLY A;  2A6T A;  5DUI A;  4Y13 A;  4WWC A;  1XC5 A;  2YSR A;  2L9R A;  3DU6 A;  1U5T A;  4GGG A;  4P96 A;  1Y1W J;  1AWC A;  1B9M A;  5H6R A;  2KQR A;  4D0P A;  2ADU A;  5EF6 A;  3QP6 A;  4HNU A;  4RS8 A;  5D5U B;  1XGO A;  2X0L A;  2BV6 A;  5ICG A;  2JTV A;  2K5C A;  1HKQ A;  2ZJQ F;  2HDW A;  2R5Z B;  3CC4 I;  1YE9 A;  2WA0 A;  2A6H F;  2CUZ A;  4KIB A;  2E5Z A;  4PSW A;  3PJR A;  2E7W A;  3G4S I;  2ZFW A;  3KP4 A;  3PNV A;  4J19 A;  1SFO J;  3SXY A;  2DA5 A;  2BEO A;  3HEF A;  1PP8 F;  2K02 A;  4LIT A;  2R7S A;  3C2B A;  2G7H A;  2GAU A;  5J1R A;  2BVL A;  3TGN A;  2XF7 A;  5FD6 A;  4G7H F;  3ZXS A;  1NG7 A;  5L3F A;  2ZME A;  3KP6 A;  3DTE A;  5TIS C;  1E3H A;  1ZRF A;  3WHC A;  4J01 A;  1R5H A;  2KT0 A;  1SVM A;  3C1D A;  5EGO B;  1QRY A;  4XRS G;  2NRA C;  3KIO A;  3HXL A;  4GRI A;  1JGG A;  3K2A A;  2FOW A;  2WY7 Q;  2ISY A;  2R7D A;  2AQE A;  4EJU A;  1OR7 C;  3I55 I;  3TL4 X;  4C2T A;  1DU6 A;  2KKO A;  2OD5 A;  4KIG A;  3JRE A;  2L5Q A;  1RI7 A;  3OYM A;  4ESB A;  4ANJ A;  2EIM H;  2M0C A;  4R1H A;  3L2R A;  3RQI A;  2CMP A;  1HF0 A;  3F8B A;  4B48 A;  3WTU C;  2M3A A;  4A3E J;  4A3D J;  3L2W A;  2EH3 A;  4B09 A;  4RAY A;  2O03 A;  4FX0 A;  3J80 K;  2CH0 A;  2O9L A;  3CUQ B;  2P81 A;  2JUC A;  2CQK A;  1VTN C;  2L7M P;  2PEX A;  2XC7 A;  1F9N A;  3QU3 A;  1DUX C;  1XX5 A;  2DQL A;  3I64 A;  1BM9 A;  5CPR B;  4U0Y A;  3COA C;  4BEH B;  4XLH A;  3A02 A;  1VQ5 I;  2EWN A;  1HC8 A;  2OU2 A;  2LBF B;  2CV2 A;  2DT7 B;  4NC8 A;  3JRG A;  2RN7 A;  1DP7 P;  3IV5 A;  4A6D A;  3T5X A;  2ACJ A;  2R7F A;  4HOB A;  1RUN A;  1ZAO A;  2JA5 J;  2P0W A;  2ZBK A;  5CVI A;  1ZR2 A;  3GTL J;  3ZOB A;  2YS9 A;  3E6M A;  4NC6 A;  1BJZ A;  4QPO A;  3V42 A;  5HLH A;  3LQQ A;  3AL0 B;  4HEA 2;  5C3E J;  2DMU A;  1WJE A;  3HOY J;  2IS4 A;  1XMA A;  1IRG A;  3OMY A;  2X1E A;  2GOM A;  2K40 A;  3H3V K;  1AHD P;  4XKB A;  1V5E A;  3OYE A;  2HPM A;  1APL C;  4IHV A;  2X48 A;  1V55 H;  2CO5 A;  2CV1 A;  2YU9 J;  4ZH4 F;  4BHP A;  2BXY A;  3IL2 A;  5GAG J;  1FSE A;  4RAG A;  4ZYH A;  5JVG F;  2JUG A;  2ZXJ A;  4CIC A;  1OYY A;  4BYY A;  2VQG A;  3MCZ A;  4BHC A;  2R7R A;  1IC8 A;  1BR2 A;  3MVP A;  3QPS A;  4R8H A;  4UY8 I;  1BOB A;  2VL8 A;  2GXA A;  2HQR A;  2P5L C;  2MD0 A;  3H92 A;  4MIM A;  3E1S A;  5LFA A;  3BC8 A;  4F91 B;  3FXL A;  3L2Q A;  3TMO A;  3SJM A;  3OS0 A;  1X1D A;  1YX3 A;  3E5Q A;  2BHY A;  3HC7 A;  2XGC A;  5A2Q Z;  4LLG F;  3H3Z A;  1D0Y A;  3F0C A;  3A01 B;  1UST A;  1R22 A;  5ICF A;  4BY7 J;  2VXD A;  2B9S A;  1X4O A;  2IPQ X;  1BIA A;  1HKS A;  2DFI A;  3PL8 A;  2EZH A;  1SD6 A;  4M3B A;  1UMQ A;  4HF1 A;  2QWW A;  3WTS C;  3KCC A;  2W84 A;  5E79 C;  4K2E A;  4N0B A;  3Q0W A;  1VI0 A;  1W5T A;  1C0W A;  2A3S A;  3IRQ A;  2GZW A;  2V1U A;  1TQM A;  5EEA A;  1ZH5 A;  2DFH A;  2E34 A;  1HST A;  5KAF C;  1QA6 A;  2VJ4 A;  3G2B A;  2O7O A;  1HW2 A;  2EJR A;  4PZJ A;  3VB2 A;  3KP3 A;  2NVY J;  1XMX A;  2M7A A;  2IS2 A;  3CCR I;  1IV8 A;  2Q1Z B;  3C3W A;  1B9N A;  3FIS A;  4XLC A;  4HW0 A;  4A5N A;  1MND A;  3LAP A;  3WGI A;  1JXS A;  2HTS A;  4OMZ A;  1WSU A;  4CA0 A;  4NQW A;  3D5L A;  2BY0 A;  2JZY A;  4XLF A;  2PFB A;  1X1P A;  3BRO A;  3H5R A;  4MEY F;  2M7B A;  5LRR A;  2CFX A;  4CXF A;  2QQ8 A;  1RR8 C;  3CTA A;  1UG2 A;  2OTJ I;  4M3F A;  3BOQ A;  4G8X A;  1JKO C;  3SZP A;  1GV5 A;  2FQ4 A;  1R23 A;  4JQF A;  1DGR M;  4A3K J;  1FYL A;  2WBM A;  2M1B A;  3HJE A;  3L7W A;  3J7A Y;  3Q9S A;  1G3S A;  5CLS A;  5F0F A;  4H0E A;  5DYM A;  4Y7N J;  2ZME C;  4HX4 A;  3P9K A;  1CF7 B;  3S2W A;  5CVV A;  2R3S A;  1IZ1 A;  3SFI A;  2XV4 S;  4HSR A;  1T0F A;  3ZR8 X;  4BJ5 C;  5DD8 A;  3QYB A;  2ELH A;  1YJ9 I;  1T95 A;  2IBD A;  2WAE A;  1WJB A;  5FFX A;  6PAX A;  2HNH A;  1U6G A;  2VI6 A;  3U2R A;  3TW7 A;  3S14 J;  2Y0S N;  3JR9 A;  5M3M J;  2JT1 A;  3FWE A;  3GBG A;  2H8W A;  4XIC A;  1UEL B;  5IYD J;  2N8G A;  1QU3 A;  2V9P A;  5CVJ A;  5AIP A;  1AKH B;  2AXL A;  3OSF A;  2ZJP F;  1UHW A;  1ZYR F;  2Y0M A;  2QQB A;  2VE9 A;  4NC7 A;  2IA1 A;  4BQQ A;  3WGH A;  1Z21 A;  3ZQI A;  2PBI A;  2CUE A;  3TOB A;  3V8K A;  2EIK H;  3GFI A;  2VJ5 A;  1N77 A;  2H27 A;  2Q0O A;  2LOO A;  2DFE A;  3SFZ A;  4U87 A;  2L4M A;  2IGM A;  4XKW A;  4A2U A;  2XF5 A;  5CQE A;  4C2M J;  4HV5 A;  3U9G A;  5A2Q K;  4EQQ A;  1Z7L A;  4HX7 A;  3CLO A;  1RZ4 A;  4B47 A;  1E17 A;  3OSG A;  4I98 B;  3KP7 A;  3H0G J;  3OIP A;  4HQE A;  4CCK A;  2EBI A;  1S72 I;  2MAB A;  1QPI A;  2L4A A;  3GFL A;  1JUS A;  2FU4 A;  3FMQ A;  3GX4 X;  1AA7 A;  3LNQ A;  1ZG1 A;  1GXP A;  5GP9 A;  2A07 F;  5IT9 K;  1Z05 A;  5D8L B;  4L5J A;  4BBS J;  5J4Y A;  3L2U A;  2UXX A;  3F9K A;  4M71 A;  2NOG A;  4DIQ A;  4GO1 A;  2CFO A;  2FEZ A;  3MN2 A;  2W48 A;  1LDK B;  4Q4Z F;  2Q2E A;  4AYB A;  3MAJ A;  1MJB A;  1EH8 A;  5HDK A;  3DP7 A;  3I59 A;  1W0U A;  1PUF B;  5FKO A;  2DMP A;  1PJR A;  3BPX A;  3K4N A;  2HKO A;  2QA4 I;  3HHG A;  2EZL A;  1Z0X A;  4A3I J;  3FK7 A;  4JX4 A;  2A61 A;  1U0J A;  2DPD A;  1ZLK A;  2VJJ A;  2F5F A;  5HDG A;  4ENJ A;  3HZJ A;  1JHF A;  4XLN F;  3HRM A;  3WG9 A;  5KCM A;  4S04 A;  1N75 A;  3BQY A;  3OIO A;  4FIS A;  3S2H J;  4KT5 C;  2JPB A;  4RLQ A;  4BDZ A;  1XDS A;  2QQ9 A;  3V8L A;  1ZR4 A;  2ZSI B;  3PIO F;  3BJ6 A;  2QBY B;  5D5W B;  3GF2 A;  4EJT A;  2ME0 A;  3IWZ A;  3OY9 A;  3TO7 A;  1Z7U A;  1LKX A;  2LY1 A;  3B6A A;  4BNC A;  2XIG A;  4JOM A;  3F21 A;  1F43 A;  4C3I J;  3NAR A;  4UXN A;  4UNO A;  3GFM A;  4Q48 A;  5H6Q A;  1R4M B;  3W2W A;  2TRT A;  1QHG A;  2DJN A;  3GW2 A;  3OWT A;  3B73 A;  4HF0 A;  1X3U A;  5K7Z A;  2QUF A;  4MNU A;  4GCV A;  5LEJ A;  4CCO A;  2Z9O A;  1MBF A;  1YS6 A;  1UFM A;  1TWG J;  3JRB A;  3CD6 I;  4MQ9 F;  2IRF G;  5J8C A;  4HNT A;  3EUH A;  1T8I A;  1RET A;  1H9G A;  4QWQ A;  3H9G A;  5F04 A;  2B63 J;  2WTE A;  3GYH X;  1SMT A;  2XHK A;  3T8R A;  2LF8 A;  2K9S A;  4BAC A;  4E7J A;  1CGP A;  1J0R A;  1R36 A;  1IUF A;  3HRT A;  4X1E A;  4G7Z F;  1FYM A;  3GTO J;  3KLN A;  1ZRD A;  3ZPL A;  1TWF J;  3M4O J;  3ERM A;  2KDZ A;  5F1J A;  1VQP I;  3JCU C;  3NWT A;  4KN7 X;  4IHS A;  5M5Y J;  5C4X J;  1BW5 A;  4B3A A;  4B8X A;  1ULY A;  2E36 A;  4HYE A;  4KFC A;  4A0Y A;  3CCY A;  3BG9 A;  4XKC A;  4PJL A;  3HOT A;  3RTR A;  3PQK A;  4YG2 F;  3FXQ A;  1S7O A;  2L54 A;  2WV0 A;  3W3C A;  1OPC A;  3BZ6 A;  4GYI A;  3OYH A;  1XS9 A;  1T38 A;  4EGZ A;  4RAZ A;  1A04 A;  2FRH A;  1S9H A;  3GXO A;  4XOR A;  3QWL A;  2VKV A;  2UXN A;  5CJ9 A;  1R1T A;  1B72 A;  3MD2 A;  1HA8 A;  2VPL A;  1USS A;  2CGP A;  2V9V A;  2WAQ N;  2VQH A;  1ZG5 A;  2ESH A;  4YFN F;  4RLF A;  2VT3 A;  1SEU A;  1B72 B;  2IT0 A;  2QSH X;  2HDC A;  2FBK A;  2O61 A;  3MKW B;  2DBB A;  1IN7 A;  4UHT A;  3ERE D;  1Z9C A;  3FXM A;  1HW5 A;  3A1Y A;  4D5F A;  4LB6 B;  4YEJ A;  1MBE A;  1MMA A;  4WX9 A;  2CW7 A;  2NYX A;  1SAN A;  1P4A A;  2QQA A;  3BTC A;  3L2C A;  1BC8 C;  2M4K A;  3EUA A;  3S93 A;  1FTZ A;  2V1N A;  3DBR B;  3V7C A;  1JUP A;  4BKX A;  2CUF A;  3FBI B;  3GO5 A;  1XSX A;  1W1W E;  5HOD A;  3HYI A;  1FOY A;  2ZXW H;  1VF9 A;  1OR7 A;  3IAS 2;  2DT5 A;  3CCV I;  2CQ7 A;  1QHH D;  1W0T A;  3O8H A;  5L3C A;  2HTJ A;  3FXO A;  3A0H C;  2MYS A;  2XGE A;  3K4J A;  4EM2 A;  1S29 A;  2X6Y A;  5JFR A;  4HQM A;  5HVQ C;  1O7L A;  1E3O C;  3OR2 C;  2MLG A;  3F72 A;  1TW2 A;  5HNF A;  5C44 J;  1W7P D;  1R1V A;  3RYR A;  4ZJZ A;  3I71 A;  5F6F A;  2V6E A;  4L0Z B;  4ESJ A;  3W2V A;  1MBH A;  2A68 F;  3CQZ J;  3RKX A;  4LK0 F;  4UVA A;  1G6N A;  1U8R A;  3H0D A;  3QQA A;  5DUK A;  3DXJ F;  3ZQG A;  1X2N A;  5D5V B;  3SEZ A;  4UUS B;  5FRN A;  3F8F A;  1OMI A;  3K4B A;  3LA3 A;  2EFO A;  2V79 A;  3FIW A;  3M8F A;  4HLY A;  1H8A C;  1DU0 A;  3F8M A;  1YIJ I;  4YIF A;  1EJ9 A;  3J81 K;  4A3C J;  4BAY A;  3W6K B;  3DQV C;  5JLW A;  4ASN A;  1MIJ A;  3BCA A;  1WKM A;  4EVI A;  2GIZ A;  3I5U A;  2GM4 A;  4F52 A;  1D5Y A;  3M9A A;  5J1U A;  3C2G A;  3K1M A;  3TED A;  4Y4R A;  4M72 A;  3OYN A;  4F55 A;  2FSW A;  1GV2 A;  5EG0 B;  3K6G A;  4PGG A;  1QGP A;  1ONV A;  2MH2 A;  1P7J A;  3RKY A;  5ICE A;  1G59 A;  1JKR C;  2HOE A;  2CSO A;  4N4O B;  1LFB A;  4LMY A;  1Y0U A;  1LE8 A;  4A93 J;  1X1B A;  5LGU A;  1FWZ A;  1BI1 A;  2FMY A;  5K5Q A;  4KA4 A;  4C2U A;  1QVT A;  1BW6 A;  5M5X J;  4RAF A;  2IW5 A;  1LUJ B;  3GME A;  2QSG X;  4PJJ A;  5HLI A;  1IJW C;  3WTV C;  1VQ7 I;  2Y31 A;  3REO A;  3Q5F A;  1SAX A;  4M9Z A;  2BBY A;  2LKX A;  3R4K A;  1MMG A;  2KPM A;  1S7E A;  2XSJ C;  5BMZ A;  2Y75 A;  1D1A A;  4QSH A;  1XSV A;  3HOV J;  4GXO A;  3E7L A;  1K83 J;  4HNV A;  3BR6 A;  3LFU A;  2HU9 A;  2XAU A;  2RGV A;  1MNE A;  3JRA A;  1EKE A;  3WU1 B;  1XB4 A;  2IVM A;  3KYC B;  3VSL A;  2ZCW A;  2FBH A;  2IEK A;  1OJL A;  4LGW A;  2NAZ A;  3EUK L;  3HRU A;  4NBQ A;  1P2F A;  3HRS A;  5FO5 A;  3DU5 A;  4BU2 A;  3NQO A;  4HX8 A;  3M07 A;  4OU0 A;  3LSH A;  1O3T A;  3I4M J;  1WHU A;  1Z6R A;  4ZZL A;  4MTD A;  3CP2 A;  1DQU A;  2JSC A;  5DM7 F;  1B8I A;  4Y52 J;  4IOA F;  1WPK A;  3CCM I;  4XN3 A;  4ZYD A;  2DK8 A;  4BJ6 C;  4KYW A;  2KMU A;  4ON0 A;  3A4C A;  1U9N A;  3VOD A;  4BE1 A;  3TOA A;  4YRV A;  1HQC A;  2PJR A;  1BJA A;  4J00 A;  4LOC A;  1J59 A;  4OMY A;  4LIU A;  4GDF A;  1YW9 A;  2MG4 A;  1KU3 A;  3M8E A;  2UUZ A;  1U9O A;  3N97 A;  3BP8 A;  2OZ6 A;  2QGU A;  1U5T B;  2KJB A;  5J4V A;  3MZ8 A;  4PUS A;  1WH7 A;  4E4H A;  1XCV A;  3CCS I;  3WTX C;  4EMS A;  2CU7 A;  3KZI C;  3SDB A;  1XCB A;  3CCE I;  1U2W A;  1FOX A;  4KIC A;  1BI0 A;  2PQ8 A;  5DCF A;  2C6Y A;  2L7F P;  2EIJ H;  3HGY A;  3RDI A;  2IXS A;  2RAE A;  1POG A;  3VYS B;  1A31 A;  3E5X A;  1YG2 A;  2F4I A;  3CC2 I;  3WGG A;  3GFJ A;  2COB A;  2V26 A;  2E35 A;  4E7K A;  4Q47 A;  2WWY A;  4ZDP A;  2M8E A;  2ZME B;  3S3N A;  3K4C A;  3HSE A;  2LG4 A;  3S1N J;  3BR3 A;  1L3L A;  3KE2 A;  2RDP A;  3ABU A;  4ZTF A;  1XD7 A;  1ZEL A;  3RPU D;  5HOO A;  1X1A A;  5J1Y A;  5LD2 C;  1JKP C;  2R7W A;  4F93 B;  4XL9 A;  1A6I A;  5E1W A;  4KIS A;  2OF7 A;  1LPQ A;  1GVD A;  4LG0 A;  5B3S H;  3H9J A;  4ZYG A;  2EA4 A;  1ZHF A;  5EJC A;  3BG6 A;  3EPZ A;  3DLA A;  3KEY A;  3OS2 A;  1F4K A;  2HVS A;  9ANT A;  2L2O A;  3M1C A;  2RKH A;  3PSI A;  4Y15 A;  3JW4 A;  4MTE A;  3VPR A;  3HTS B;  1I50 J;  2CUJ A;  2XDV A;  3O2P E;  1XPX A;  1XSD A;  1XTA A;  2DYS H;  2M8G X;  3VDX A;  1SFK A;  5J8F A;  2HQA A;  2M2E A;  3E0J B;  1JT6 A;  3PM1 A;  2XB5 A;  2DK5 A;  1FY7 A;  5DTD A;  2Y9Y A;  3RIR A;  1M1E B;  4YFX F;  2MD5 A;  1QO0 D;  4DOZ A;  3BY6 A;  2LD5 A;  3OYL A;  3OYK A;  5E17 F;  4X6A J;  1MH3 A;  4P9U A;  4WXH A;  1ETW A;  1W7P A;  2QVO A;  2M34 A;  3OS1 A;  2WAF A;  3Q3S A;  1S8N A;  1WJF A;  1VQ4 I;  3K4K A;  1N78 A;  4XID A;  3GEZ A;  2KP6 A;  2ZXI A;  1EF4 A;  1IRZ A;  1WQ2 A;  1WJA A;  2EB7 A;  4KDP A;  3GZ6 A;  4DYR A;  2P4W A;  3DEW A;  1XG1 A;  5GAD J;  3FXK A;  4WK8 F;  3HUG A;  1F1Z A;  3T0Y A;  3LL7 A;  4A0Z A;  2XRL A;  2JSP A;  2H94 A;  4RGS A;  1TZL A;  3OV8 A;  3I56 I;  3PNT A;  1FSH A;  2ZNZ A;  3GTM J;  1Y1V J;  2PMZ A;  3E5U A;  1YRN A;  2BOL A;  2DMN A;  4BBR J;  1Z67 A;  2HS5 A;  2EZI A;  4LB5 A;  4A5M A;  5GAH J;  2XGX A;  2OV7 A;  2V4J C;  2Z2S B;  4MQV A;  4RMN A;  1FBQ A;  2M87 A;  2ZJR F;  4RB0 A;  1FMW A;  4NDL A;  4DNC A;  3H1C A;  2Z3Y A;  4MFD A;  5ILV A;  4BGD A;  2LRE A;  2VN2 A;  3ZMZ A;  4BXF A;  3S3O A;  1V3F A;  1XMK A;  4C30 A;  3S2D J;  3ZN0 A;  1ETV A;  2BVM A;  2E1M C;  4WCG A;  2R7V A;  2OQR A;  3F6V A;  1KQ0 A;  3G1L A;  1ON1 A;  1B59 A;  2A05 A;  4EM0 B;  4A3M J;  3L00 A;  3G3Z A;  4V2G A;  1OFC X;  4CZZ A;  3LSP A;  2RNG A;  4PGH A;  3ZRG A;  2D1H A;  3I53 A;  3HHH A;  1MMD A;  2VC0 A;  2O3F A;  4JBA A;  3TP0 A;  1EA3 A;  2CQN A;  1MBJ A;  3S1Q J;  1PUE E;  1F36 A;  1KYZ A;  1YW7 A;  4HF2 A;  4MFE A;  2G9W A;  2JJ7 A;  1UAA A;  1B6A A;  2HYJ A;  5BQT A;  4BY1 J;  1FJL A;  4AC0 A;  3U1K A;  5TJJ A;  4AU7 A;  2A5W A;  5JHF A;  2OQG A;  3SEQ A;  5GPA A;  2ZO4 A;  3CJN A;  3OOU A;  3TW6 A;  1JJ8 C;  1HLV A;  2DCE A;  3V7R A;  1N25 A;  4OAZ A;  1QZY A;  4O5V A;  1A5J A;  2DOA A;  5CVR A;  3D0S A;  3OR1 C;  1Y6I A;  2QEX I;  1S7A A;  1K4S A;  1QBJ A;  2MLK A;  3W6V A;  1HDP A;  3MFK A;  1ZGA A;  4NQW B;  3WU2 C;  1JI8 A;  3F8N A;  1G3W A;  4KIF A;  3ZCO A;  5LRS A;  3MZY A;  4IJA A;  1P6R A;  2DYR H;  2IAI A;  3A03 A;  3KX2 A;  3ECO A;  1I3Q J;  2VXZ A;  3K0L A;  3LSK A;  3R0J A;  4EEF G;  4FAS D;  4NHJ A;  4AYB N;  2OZU A;  4M3D A;  1DPU A;  2JA8 J;  5K1Y A;  1VQL I;  1JT0 A;  1TP4 A;  1OCR H;  4ENN A;  1ZKG A;  5FFZ A;  1BIB A;  2IA2 A;  2E2J J;  2EZK A;  3K9T A;  4C3J J;  4D1Q A;  3DKY A;  1MGT A;  3QPT A;  1QZZ A;  1E3P A;  4OIR F;  3BR5 A;  3OOP A;  1QZE A;  3C18 A;  3ZMV A;  5J6X A;  5JR3 A;  4ENK A;  1WZ2 A;  1FC3 A;  3BZC A;  2RC4 A;  3CMM A;  2OC6 A;  2E1O A;  1O3S A;  4OAY A;  3QOP A;  5IOY A;  3BLY A;  4H4K C;  2RNJ A;  1G2H A;  3N4M A;  1R7J A;  2CQQ A;  5GTH C;  1TNT A;  2RV8 A;  4RGU A;  1ETY A;  1GXQ A;  1LEA A;  3RYP A;  4E70 A;  5FLV A;  4L18 B;  2X85 A;  4FQG A;  4BQN A;  4AIH A;  3DBL B;  2H6C A;  4CDG A;  2PJP A;  2FX0 A;  2L9N A;  2XPW A;  3FMR A;  3LA2 A;  3FKI J;  1J2X A;  2DOD A;  3LST A;  4IQ4 A;  4IHT A;  4EM1 A;  4GYG A;  4DZJ A;  1LEB A;  1ZAR A;  2K9M A;  3ABK H;  3MKZ A;  1YS7 A;  1UHS A;  1IDY A;  2FBI A;  4ZZD A;  3RPU A;  1ZQ3 P;  2IGO A;  2K3F A;  2DN0 A;  1R5I D;  3FXR A;  2Y30 A;  1QVU A;  1WJ5 A;  1YW8 A;  3O3K A;  1FEX A;  5J3L A;  2W1O A;  3LFK A;  4M3G A;  1Z77 A;  4FHT A;  2DAO A;  1TT5 B;  3IAM 2;  4G6Q A;  1KZH A;  4AID A;  3AKZ A;  3H5A A;  4A3G J;  4CYD A;  2R4G A;  4RGX A;  1HXD A;  5B66 C;  4BQA A;  2LLK A;  5D8K B;  1K7A A;  1WH5 A;  4PSX A;  2VAS A;  2RVC A;  2VJI A;  1MBK A;  4OIP F;  3HOX J;  3GTQ J;  3BJA A;  2LTP A;  1EH6 A;  1IXR C;  2ELJ A;  2OJE D;  1MDM A;  4M9S A;  4P55 A;  1WJC A;  2JVG A;  3CMA I;  5AIQ A;  2GXB A;  3DKX A;  2JA2 A;  3GZ5 A;  4QTR A;  3VWB A;  1MKM A;  1DDN A;  2Q2E B;  1RIO H;  4UUV A;  2FNA A;  1V5F A;  3I59 B;  5D6E A;  5K5R A;  2W82 A;  1TQP A;  5BPI A;  2ECC A;  4V2F A;  2F5D A;  2G7U A;  2L7K A;  3JSP A;  3HDD A;  1UZC A;  2GOX B;  3MEX A;  4I99 C;  3B02 A;  3P5J A;  3KFW X;  5LLQ A;  3M3Y J;  3ZQQ A;  3LA7 A;  2L01 A;  3BG5 A;  5L3B A;  3JRH A;  2MW8 A;  1D8K A;  5D6F A;  2JWT A;  1K79 A;  4LFU A;  1K6O A;  1KGS A;  2NS8 A;  4IQJ A;  2KIU A;  3P9I A;  3TO6 A;  1D0X A;  2MSY A;  1RNL A;  1A6Q A;  1KON A;  2VE8 A;  4II3 A;  2WV1 A;  5H20 A;  3NEU A;  1Q1V A;  5IP7 J;  2EIL H;  3IH4 A;  1FT9 A;  2KRC A;  3HSR A;  3Q0U A;  4L5I A;  1IAW A;  3CF2 A;  1PDN C;  2F48 A;  5FLX Z;  3RKQ A;  3QOE A;  1O7F A;  1LDD A;  2O8K A;  4GFB A;  3DEU A;  2XKP A;  4PJM A;  3LSM A;  3ISP A;  2X6O A;  1RUO A;  2HOS A;  4KJZ A;  2MC3 A;  2R92 J;  2AO9 A;  2ZFU A;  5BS6 A;  2H1K A;  2FXA A;  3DTK A;  1X2M A;  3E6D A;  5GAE J;  5HNH A;  2R7Q A;  2B7E A;  1ODD A;  2EV0 A;  3WG7 H;  4XKV A;  4XON A;  4IHY A;  4OIQ F;  3T8T A;  2Q8K A;  3OYA A;  4L9J A;  5H2F C;  4CH7 A;  1HSJ A;  2DLL A;  4BE0 A;  2IJL A;  3KZZ A;  4IHW A;  1UJ8 A;  4XLP F;  1P9Q C;  1D1B A;  1Y56 A;  2QKL B;  3DBH B;  1KQ9 A;  3CDH A;  3CCJ I;  3ASN H;  2K4J A;  3KP2 A;  2DI3 A;  3ZGK A;  4KT6 A;  1RKT A;  2KIS A;  3TKY A;  2CRG A;  2GXG A;  1LB2 A;  4ZDO A;  1VZ0 A;  2ZC2 A;  2P6T A;  4ABZ A;  3WE3 A;  4Q5S F;  3FHZ A;  5F0H A;  3CMY A;  2EFQ A;  2OPT A;  1H89 C;  2DPU A;  2P5K A;  1KU7 A;  4ZTJ A;  4A3F J;  2P7V B;  4FCY A;  4LG3 A;  1TLH B;  2LNB A;  4KMU X;  2HXI A;  3GZN B;  4NUB A;  2FJ1 A;  2JK3 A;  4UV8 A;  1Z3X A;  1RKW A;  5F1R A;  4M6V A;  2DXI A;  3HIF A;  2KRF A;  1VFC A;  2WC2 A;  3FKJ A;  5FKM A;  1SFX A;  5B5E C;  1TBX A;  3NRV A;  2IP2 A;  5JI6 A;  2KIF A;  2YU3 A;  1JUM A;  2CJJ A;  1R5G A;  1S5L C;  1DPR A;  2OCC H;  3FXJ A;  5FJ8 J;  1BI3 A;  2R7O A;  2HGC A;  4RBO A;  3DF8 A;  5GTI C;  3GCM A;  4D5C A;  3DCF A;  1JTX A;  2VKH A;  4HAM A;  5K7F A;  2V9K A;  1RC9 A;  1IO2 A;  3K7A J;  1IV6 A;  1U3E M;  2QCO A;  2QLZ A;  3K70 D;  2F2E A;  2DA3 A;  3ROU A;  5BOX A;  4IO9 F;  2QZ8 A;  3DTI A;  4IPA A;  2HQN A;  2HPI A;  3E3V A;  3RZO J;  2CS3 A;  3QPH A;  2ME6 A;  5LHH A;  1J5Y A;  3JRI A;  1T39 A;  2X1C A;  2A6E F;  2H09 A;  1KYW A;  1OQY A;  2HYG D;  4L9N A;  2LY9 A;  2KIQ A;  1HCR A;  2WAD A;  2Y9Z A;  3BTI A;  1FOK A;  1SVL A;  4BE2 A;  4MGR A;  3BR1 A;  1Z3Y A;  4AVP A;  2E2I J;  1YIT I;  2OUM A;  4XBF A;  2VT2 A;  1P7I A;  3NWS A;  1G3Y A;  3CJR B;  5IPA A;  3G71 I;  2M0M A;  1IN4 A;  1SAU A;  4MO7 A;  5E1Z B;  1X1C A;  4PJ0 C;  2XSD C;  3CZ6 A;  2EQR A;  3K69 A;  3LSG A;  3FK6 A;  3HG9 A;  3SZT A;  2D1V A;  4CYC A;  2UV1 A;  2E7X A;  4ZYE A;  5BNG A;  4RB1 A;  3ELK A;  4XRS A;  2K7L A;  5FKK A;  5KVR A;  5IP6 A;  3TDZ C;  2D2W A;  5J47 A;  2KJC A;  2M5W A;  4IL6 C;  1IG7 A;  4Z6Y A;  2ZKZ A;  5FLX K;  5KAI C;  3CUO A;  5IYB J;  2DJI A;  1Y8R B;  1ETK A;  3EQL F;  4D7M A;  3UNG C;  3IP4 B;  2R5Y A;  3LAJ A;  3ML6 A;  1P92 A;  2QKM B;  3H36 A;  3BTL A;  4AUX A;  3DFG A;  3ULQ B;  5IOZ A;  5KNL A;  4IF4 A;  3IKV A;  2VC1 A;  5IP9 J;  1FNN A;  4G7O F;  1FOW A;  3M7G A;  5DD4 A;  2DA2 A;  4CHU A;  4DBR A;  5CQG A;  5FKN A;  4BL0 B;  4BUP A;  1ETQ A;  5EYR A;  5HS7 A;  3I0T A;  1D3Y A;  5HS8 A;  4MHG A;  1D1C A;  2V7F A;  2LFB A;  1LE8 B;  1LDJ A;  4W1U A;  2HR3 A;  2M9H A;  2Y2Z A;  4JX6 A;  2VUM J;  2DMT A;  2LKP A;  1TC3 C;  2DOF A;  4ESF A;  3KLO A;  2HDD A;  2F5V A;  2FD5 A;  2KZV A;  1HW1 A;  2IA0 A;  1TWH J;  3WTT C;  1XGN A;  1K78 A;  1W36 D;  3DKW A;  5F27 A;  3QYE A;  2VLA A;  1K4T A;  3HL2 A;  3J80 Z;  2O0Y A;  2QYO A;  5HDN A;  2NNN A;  1WVR A;  3Q9V A;  2LP0 A;  1IW7 F;  2LVS A;  1A36 A;  3CLQ A;  2KL4 A;  2GQQ A;  1Y39 A;  1QPM A;  4Y3O A;  5E8G A;  2NVQ J;  1TWC J;  2FUG 2;  1GUU A;  2DA1 A;  1OCT C;  1SD4 A;  1W4M A;  3MZH A;  4KIT B;  3K2Z A;  4KNY A;  1RRJ A;  2BW3 A;  5C4J J;  3JTH A;  2E1M B;  1SC7 A;  1YO5 C;  1ENH A;  5FD5 A;  2BW3 B;  2EFP A;  1R6R A;  2MBF A;  3CCL I;  1E2X A;  4NB5 A;  1BR4 A;  1XN7 A;  3MKY B;  3H5N A;  4A3L J;  3LWF A;  3RCO A;  1KA8 A;  2HKX A;  3EET A;  5D4R A;  2DDB A;  3GVA A;  3K1P A;  1T08 B;  5DCM A;  3L9F A;  3OYJ A;  1VQ6 I;  1ERD A;  2DT6 A;  1I6H J;  2HFH A;  3KP5 A;  1W5C C;  1VQM I; 
#chains in the Genus database with same CATH homology
 2XRN A;  5HS9 A;  3IKT A;  2FA5 A;  2YR2 A;  2CYY A;  5AON A;  3W6J B;  1I6X A;  1BOA A;  3BDD A;  3KEQ A;  2RQP A;  4S05 A;  1KU9 A;  2L3D A;  1I5Z A;  4MEX F;  5E18 F;  2VBX A;  4RGR A;  5ICC A;  1TTY A;  2DQR A;  2L02 A;  1IN6 A;  1ZG3 A;  5FGM A;  1S6L A;  1XDU A;  5D5X B;  4HLX A;  1P4W A;  3FX3 A;  1B1B A;  3BJO A;  4EJV A;  4AIJ A;  1UHM A;  5JHU A;  1TW3 A;  1O57 A;  4BXU A;  2VBY A;  5LGT A;  2STT A;  3DV8 A;  4IRH A;  2EA2 A;  2JRT A;  3AAF A;  4LG0 B;  3F3X A;  1BI2 A;  3WE2 A;  3WOD F;  4UVC A;  5L3E A;  3SQN A;  3J7A O;  2VOP A;  1JGS A;  1FLI A;  2E1N A;  4CO8 A;  3DPT A;  1ZGJ A;  3CUQ A;  2FE3 A;  4WXD A;  2Z99 A;  1TNS A;  2XVC A;  1KQ8 A;  4HDU A;  3ZMD A;  2W85 A;  2J5P A;  4IVN A;  3GLX A;  1BN5 A;  1SD7 A;  4IRI A;  1Q1H A;  2CWE A;  5JVT A;  3FF5 A;  4M6Y A;  2OAZ A;  5ED4 A;  2NNY A;  1FX7 A;  3HSF A;  1W7P B;  1YYV A;  5D4S A;  4Z2Y A;  4I0A A;  1FP2 A;  1T98 A;  5FB2 A;  1PP7 U;  2YX7 A;  4EGY A;  4EJW A;  2UZK A;  3RPQ A;  1FP1 D;  3KEO A;  1STZ A;  2V6C A;  1J9I A;  4KN4 X;  1WI9 A;  2LSO A;  5L3G A;  4L0Y B;  2FQ3 A;  1D8J A;  2STW A;  3JTG A;  3WTW C;  3TQN A;  2KIM A;  3GUD A;  2XAS A;  4HDV A;  4I7H A;  1SFU A;  1HKT A;  3H3U A;  3F6O A;  2K27 A;  3F22 A;  4XSX F;  5CVU A;  4N9H A;  3LQR A;  2OA4 A;  3TO9 A;  4U0W A;  1H9T A;  3M1E A;  3RKW A;  5LGN A;  5IT9 Z;  2DTR A;  1FBS A;  2PN6 A;  3CO6 C;  1IUY A;  1WWX A;  4AWX B;  1FYK A;  2NS0 A;  3R0A A;  3FM3 A;  1OYI A;  1FZP B;  4I09 A;  1AOY A;  3IRR A;  4PDK A;  3P7N A;  4G9Y A;  4I2O A;  1R58 A;  3VFZ A;  4PCQ A;  5BPD A;  1BC7 C;  4BH9 A;  4EV0 A;  2BE5 F;  1U5T C;  2LF7 A;  4JK1 X;  1GVJ A;  5LBQ A;  1F5T A;  2M45 A;  3JSO A;  3FZV A;  3WTZ A;  3JAM Z;  1IN8 A;  1JHH A;  1R1U A;  2MH9 A;  3E6B A;  3IC7 A;  2VON A;  4HA8 A;  2OBP A;  1W5S A;  2W24 A;  2GA1 A;  1QNT A;  1KU2 A;  2QM3 A;  4UVB A;  4OOI A;  5HLG A;  2V1D A;  2HWV A;  4OIO F;  3QAH A;  2P5V A;  1J7K A;  4IRG A;  5L3D A;  1CF7 A;  1I27 A;  4U7B A;  2EV5 A;  4UV9 A;  2PMU A;  4HV6 A;  1YLF A;  1HBX G;  2A5Y B;  2YX4 A;  4M73 A;  4A6E A;  1U78 A;  4EJO A;  1G4D A;  1LVA A;  1NHA A;  3CUQ C;  3QRF F;  2D45 A;  3FMS A;  2UWM A;  2J5O A;  2VBZ A;  3L09 A;  1YIO A;  2XAJ A;  2XRO A;  3TDU C;  5LHG A;  1XGS A;  3RJP A;  1S3J A;  3GWZ A;  4AIK A;  1H0M A;  2CG4 A;  3KET A;  1LQ1 A;  4ENM A;  3QP5 A;  1BBY A;  3ZP5 A;  3WTY C;  3IHU A;  1EH7 A;  1MDM B;  4I0B A;  3T1B A;  4IXA A;  2O8X A;  2XUB A;  5ERI A;  1UB9 A;  3ZMU A;  1ZRC A;  4A0X A;  3RI4 A;  3FXU A;  1V4R A;  4U7D A;  4U0V A;  1YFH A;  2EK5 A;  2BYV E;  3ZQ7 A;  1LJ9 A;  2ISZ A;  2FF4 A;  2VOD A;  1R00 A;  2EFW A;  2Z33 A;  4OIN F;  2VBW A;  4WF2 A;  4RB3 C;  1OYW A;  2XAF A;  4Y17 A;  4P9F A;  1REP C;  2VOO A;  2P8T A;  1T6S A;  1I1G A;  4P5O A;  3PQJ A;  3HTU A;  5KK1 A;  2QBY A;  5LHI A;  2HYF A;  2YPR A;  2A69 F;  4U88 A;  1MJ9 A;  1Z1D A;  1ZRE A;  3JAM K;  4TV7 A;  2O6G E;  2B0L A;  2DU9 A;  2COM A;  2AS5 F;  4N9I A;  3J81 Z;  2CW0 F;  4FT8 A;  4QLC U;  4L9V A;  2EV6 A;  4I02 A;  1MJA A;  4LLL A;  5E20 A;  2DO7 A;  4L9T A;  2E1C A;  2Y48 A;  4G6D A;  5ILS A;  2FNP A;  2XKO A;  3G73 A;  4CGZ A;  3WU0 A;  1T2K A;  3R6S A;  2ZNY A;  2ETH A;  2ZJ2 A;  4RB2 C;  3ZMT A;  2PG4 A;  5F64 A;  3C7J A;  1Z91 A;  2FOK A;  1IRF A;  2BGC A;  2V1X A;  2JPC A;  5E1X A;  5DEQ A;  4I01 A;  1FPQ A;  1IN5 A;  2W57 A;  3ABT A;  3CO7 C;  1SMY F;  5E8I A;  3K1N A;  4G94 A;  2P7C B;  4AD9 A;  1WRJ A;  2HEO A;  1MD0 A;  1UCR A;  1FBU A;  2F5C A;  3VEP A;  2MA3 A;  3FM5 A;  4KMF A;  3MQ0 A;  1MZB A;  2GWR A;  2ESN A;  3F8C A;  3EYI A;  3EYY A;  5DDG A;  1G3T A;  3ZN1 A;  1GHC A;  3ZMS A;  5DV5 A;  1D5V A;  3DPL C;  3MWM A;  3U1D A;  1TQI A;  2F5E A;  4BHB A;  2K4B A;  2GA2 A;  3E97 A;  1YTY A;  5TRD A;  3EDP A;  1Z6T A;  4R79 A;  2TDX A;  2XAQ A;  4XRF A;  5LEK A;  4O6J A;  2X4H A;  2Z5U A;  2HZT A;  2P6S A;  3HOS A;  4HZF A;  1YQA A;  2W25 A;  1LNW A;  4ETS A;  1O3Q A;  4M9X A;  3PFI A;  2FML A;  5K5O A;  4O3M A;  3ECH A;  1JE8 A;  2GIV A;  5IT3 A;  2QEN A;  4LJZ F;  1L0O C;  4M74 A;  2PMH A;  3E6C C;  1P4X A;  3IWF A;  4LK1 F;  4F7Z A;  1ON2 A;  2H6B A;  1ZLJ A;  4KUM A;  4YFK F;  4YII A;  4WXC A;  5CYV A;  1QQI A;  1K78 B;  4HBL A;  4DQ2 A;  1IF1 A;  3I4P A;  1ZN2 A;  2DW4 A;  2PI0 A;  3P9C A;  1OKR A;  1IXS B;  2K86 A;  3F23 A;  2XAG A;  1SFE A;  4M6X A;  3V7S A;  2LDU A;  1O3R A;  2M30 A;  3BPV A;  3QU6 A;  3VOE A;  4FX4 A;  3R61 A;  3I54 A;  3O6B B;  1EV7 A;  3BWG A;  3I58 A;  4A12 A;  5DCM B;  4LLN A;  4LD5 A;  1IXC A;  5ILU A;  1I1S A;  3R60 A;  2XAH A;  5EEG A;  1J75 A;  1B4A A;  2EFN A;  3SHF A;  1SD5 A;  3V4G A;  3V8J A;  3KZY A;  5EEH A;  4XSZ F;  1XGM A;  2PLY A;  5DUI A;  4Y13 A;  4WWC A;  2YSR A;  1U5T A;  4GGG A;  4P96 A;  1AWC A;  1B9M A;  5H6R A;  4D0P A;  2ADU A;  3QP6 A;  5D5U B;  4RS8 A;  1XGO A;  2X0L A;  2BV6 A;  5ICG A;  2JTV A;  1HKQ A;  2A6H F;  4KIB A;  2E7W A;  2ZFW A;  3KP4 A;  3SXY A;  2BEO A;  1PP8 F;  2K02 A;  2G7H A;  2GAU A;  3TGN A;  5FD6 A;  4G7H F;  5L3F A;  2ZME A;  3KP6 A;  1ZRF A;  1R5H A;  3C1D A;  2NRA C;  2ISY A;  2R7D A;  4EJU A;  2KKO A;  2OD5 A;  4KIG A;  1RI7 A;  4ESB A;  4R1H A;  3F8B A;  3WTU C;  4B09 A;  4RAY A;  2O03 A;  4FX0 A;  3J80 K;  3CUQ B;  2CQK A;  1VTN C;  2PEX A;  1F9N A;  3QU3 A;  1DUX C;  2DQL A;  3I64 A;  1BM9 A;  4U0Y A;  3COA C;  2EWN A;  2OU2 A;  2RN7 A;  1DP7 P;  4A6D A;  3T5X A;  2ACJ A;  2R7F A;  4HOB A;  1RUN A;  1ZAO A;  2ZBK A;  5CVI A;  3E6M A;  5HLH A;  3LQQ A;  1XMA A;  1IRG A;  2CO5 A;  4ZH4 F;  4BHP A;  3IL2 A;  1FSE A;  4ZYH A;  2ZXJ A;  4CIC A;  1OYY A;  4BYY A;  3MCZ A;  4BHC A;  4R8H A;  2HQR A;  2P5L C;  3H92 A;  3E5Q A;  5A2Q Z;  4LLG F;  3H3Z A;  1UST A;  1R22 A;  5ICF A;  2IPQ X;  1BIA A;  1HKS A;  2DFI A;  1SD6 A;  4HF1 A;  2QWW A;  3WTS C;  3KCC A;  2W84 A;  4K2E A;  4N0B A;  1W5T A;  1C0W A;  2A3S A;  3IRQ A;  2GZW A;  2V1U A;  1TQM A;  1ZH5 A;  1HST A;  1HW2 A;  2EJR A;  4PZJ A;  3VB2 A;  3KP3 A;  3C3W A;  1B9N A;  4HW0 A;  4A5N A;  3LAP A;  3WGI A;  1JXS A;  2HTS A;  4OMZ A;  1WSU A;  4NQW A;  3D5L A;  2JZY A;  2PFB A;  3BRO A;  4MEY F;  5LRR A;  2CFX A;  4CXF A;  3CTA A;  3BOQ A;  4G8X A;  3SZP A;  1R23 A;  4JQF A;  1FYL A;  2M1B A;  3L7W A;  3Q9S A;  1G3S A;  5CLS A;  4H0E A;  5DYM A;  4HX4 A;  3P9K A;  1CF7 B;  3S2W A;  5CVV A;  2R3S A;  1IZ1 A;  2XV4 S;  1T0F A;  5DD8 A;  2ELH A;  5FFX A;  6PAX A;  1U6G A;  3U2R A;  2JT1 A;  3FWE A;  5AIP A;  5CVJ A;  2AXL A;  1UHW A;  1ZYR F;  2Y0M A;  2QQB A;  2VE9 A;  2IA1 A;  3WGH A;  2PBI A;  3GFI A;  3TOB A;  3V8K A;  2H27 A;  2Q0O A;  3SFZ A;  2L4M A;  4A2U A;  4HV5 A;  3U9G A;  5A2Q K;  4EQQ A;  4HX7 A;  3CLO A;  1RZ4 A;  1E17 A;  4I98 B;  3KP7 A;  4HQE A;  2L4A A;  3GFL A;  2FU4 A;  3FMQ A;  3GX4 X;  2A07 F;  5IT9 K;  1ZG1 A;  1GXP A;  1Z05 A;  5D8L B;  4L5J A;  2UXX A;  4M71 A;  4GO1 A;  2FEZ A;  1LDK B;  4Q4Z F;  2Q2E A;  3MAJ A;  1MJB A;  1EH8 A;  5HDK A;  3DP7 A;  3I59 A;  3BPX A;  2HKO A;  3HHG A;  2A61 A;  2DPD A;  1ZLK A;  2F5F A;  5HDG A;  4ENJ A;  1JHF A;  4XLN F;  3HRM A;  3WG9 A;  4S04 A;  4KT5 C;  2JPB A;  1XDS A;  2QQ9 A;  3V8L A;  3BJ6 A;  2QBY B;  5D5W B;  3GF2 A;  4EJT A;  3IWZ A;  3TO7 A;  1Z7U A;  4BNC A;  2XIG A;  3F21 A;  4UXN A;  4UNO A;  3GFM A;  4Q48 A;  5H6Q A;  3GW2 A;  3B73 A;  4HF0 A;  1X3U A;  2QUF A;  4MNU A;  4GCV A;  5LEJ A;  2Z9O A;  1YS6 A;  1UFM A;  4MQ9 F;  2IRF G;  5J8C A;  3EUH A;  1H9G A;  4QWQ A;  2WTE A;  3GYH X;  1SMT A;  2XHK A;  3T8R A;  2LF8 A;  1CGP A;  1J0R A;  1R36 A;  3HRT A;  4G7Z F;  1FYM A;  3KLN A;  1ZRD A;  3ZPL A;  4IHS A;  4KN7 X;  4B8X A;  1ULY A;  4HYE A;  4KFC A;  4A0Y A;  3HOT A;  3RTR A;  3PQK A;  4YG2 F;  3FXQ A;  1S7O A;  2L54 A;  2WV0 A;  1OPC A;  3BZ6 A;  4GYI A;  1T38 A;  4EGZ A;  4RAZ A;  1A04 A;  2FRH A;  3GXO A;  2UXN A;  5CJ9 A;  1R1T A;  1USS A;  2CGP A;  2V9V A;  1ZG5 A;  2ESH A;  4YFN F;  2IT0 A;  2VT3 A;  2HDC A;  2FBK A;  2O61 A;  2DBB A;  1IN7 A;  4UHT A;  3ERE D;  1Z9C A;  1HW5 A;  4LB6 B;  4WX9 A;  2NYX A;  1P4A A;  2QQA A;  3L2C A;  1BC8 C;  3V7C A;  3GO5 A;  1XSX A;  3HYI A;  1OR7 A;  2DT5 A;  5L3C A;  2HTJ A;  4EM2 A;  1S29 A;  5JFR A;  4HQM A;  5HVQ C;  1O7L A;  2MLG A;  3F72 A;  1TW2 A;  1W7P D;  1R1V A;  3RYR A;  3I71 A;  5F6F A;  4L0Z B;  4ESJ A;  2A68 F;  3RKX A;  4LK0 F;  4UVA A;  1G6N A;  1U8R A;  5DUK A;  3DXJ F;  5D5V B;  3F8F A;  1OMI A;  3LA3 A;  2EFO A;  2V79 A;  3M8F A;  4HLY A;  3F8M A;  4YIF A;  3J81 K;  4BAY A;  3W6K B;  3DQV C;  4ASN A;  1WKM A;  4EVI A;  3I5U A;  3M9A A;  3K1M A;  4M72 A;  2FSW A;  4PGG A;  1QGP A;  1ONV A;  2MH2 A;  3RKY A;  5ICE A;  2HOE A;  2CSO A;  4LMY A;  1Y0U A;  5LGU A;  1FWZ A;  1BI1 A;  2FMY A;  5K5Q A;  4KA4 A;  2IW5 A;  5HLI A;  3WTV C;  3REO A;  3Q5F A;  1SAX A;  4M9Z A;  2BBY A;  3R4K A;  5BMZ A;  2Y75 A;  1XSV A;  4GXO A;  2RGV A;  3WU1 B;  1XB4 A;  2IVM A;  2ZCW A;  2FBH A;  4LGW A;  2NAZ A;  3HRU A;  5FO5 A;  1P2F A;  3HRS A;  3NQO A;  4HX8 A;  4OU0 A;  1O3T A;  1Z6R A;  4ZZL A;  4MTD A;  2JSC A;  4ZYD A;  2DK8 A;  4KYW A;  4ON0 A;  3VOD A;  3TOA A;  1HQC A;  1BJA A;  1J59 A;  4OMY A;  1YW9 A;  1KU3 A;  3M8E A;  3N97 A;  3BP8 A;  2OZ6 A;  1U5T B;  2KJB A;  1XCV A;  3WTX C;  4EMS A;  1XCB A;  1U2W A;  4KIC A;  1BI0 A;  2PQ8 A;  5DCF A;  2C6Y A;  3RDI A;  3E5X A;  1YG2 A;  3WGG A;  3GFJ A;  4Q47 A;  2WWY A;  2M8E A;  2ZME B;  3HSE A;  1L3L A;  3KE2 A;  2RDP A;  3ABU A;  1XD7 A;  5HOO A;  5E1W A;  4LG0 A;  4ZYG A;  2EA4 A;  1ZHF A;  1F4K A;  2RKH A;  4Y15 A;  3JW4 A;  4MTE A;  3HTS B;  3O2P E;  1XSD A;  5J8F A;  2DK5 A;  1FY7 A;  3RIR A;  4YFX F;  2MD5 A;  1QO0 D;  3BY6 A;  5E17 F;  4P9U A;  4WXH A;  1W7P A;  2QVO A;  1S8N A;  3GEZ A;  1WQ2 A;  2EB7 A;  4KDP A;  3GZ6 A;  2P4W A;  4WK8 F;  3HUG A;  1F1Z A;  3T0Y A;  4A0Z A;  2H94 A;  4RGS A;  3OV8 A;  1FSH A;  2ZNZ A;  3E5U A;  2HS5 A;  4LB5 A;  4A5M A;  2XGX A;  4MQV A;  1FBQ A;  2M87 A;  4RB0 A;  4DNC A;  2Z3Y A;  5ILV A;  2VN2 A;  3ZMZ A;  1V3F A;  1XMK A;  3ZN0 A;  4WCG A;  2OQR A;  3F6V A;  1KQ0 A;  1ON1 A;  1B59 A;  4EM0 B;  3L00 A;  3G3Z A;  4CZZ A;  4PGH A;  2D1H A;  3I53 A;  3HHH A;  2VC0 A;  2O3F A;  4JBA A;  1PUE E;  1KYZ A;  1YW7 A;  4HF2 A;  2G9W A;  1B6A A;  5BQT A;  5TJJ A;  2OQG A;  2ZO4 A;  3CJN A;  3V7R A;  1QZY A;  4O5V A;  5CVR A;  3D0S A;  1S7A A;  1QBJ A;  2MLK A;  3MFK A;  1ZGA A;  3F8N A;  1G3W A;  4KIF A;  5LRS A;  3MZY A;  4IJA A;  1P6R A;  3ECO A;  2VXZ A;  3K0L A;  3R0J A;  4NHJ A;  2OZU A;  1DPU A;  5K1Y A;  4ENN A;  5FFZ A;  1BIB A;  2IA2 A;  3K9T A;  1MGT A;  3QPT A;  1QZZ A;  4OIR F;  3OOP A;  3C18 A;  3ZMV A;  5J6X A;  5JR3 A;  4ENK A;  1FC3 A;  2RC4 A;  1O3S A;  3QOP A;  2RNJ A;  3N4M A;  1R7J A;  1TNT A;  2RV8 A;  4RGU A;  1GXQ A;  1LEA A;  3RYP A;  4E70 A;  4L18 B;  4AIH A;  2H6C A;  4CDG A;  2PJP A;  3FMR A;  3LA2 A;  1J2X A;  3LST A;  4IHT A;  4EM1 A;  4GYG A;  1LEB A;  1ZAR A;  1YS7 A;  2FBI A;  4ZZD A;  3RPU A;  3FXR A;  1YW8 A;  3O3K A;  3LFK A;  4FHT A;  2DAO A;  4G6Q A;  4CYD A;  4RGX A;  1HXD A;  4BQA A;  5D8K B;  1K7A A;  2RVC A;  4OIP F;  3BJA A;  1EH6 A;  1IXR C;  1MDM A;  4M9S A;  4P55 A;  5AIQ A;  2GXB A;  3GZ5 A;  1MKM A;  1DDN A;  1RIO H;  4UUV A;  2FNA A;  5D6E A;  3I59 B;  5K5R A;  1TQP A;  5BPI A;  2F5D A;  2G7U A;  3JSP A;  3MEX A;  3B02 A;  3KFW X;  5LLQ A;  3LA7 A;  2L01 A;  5L3B A;  1D8K A;  5D6F A;  1K79 A;  4LFU A;  1K6O A;  1KGS A;  2KIU A;  3P9I A;  3TO6 A;  1RNL A;  2VE8 A;  5H20 A;  3NEU A;  1FT9 A;  3HSR A;  4L5I A;  1IAW A;  1PDN C;  5FLX Z;  1O7F A;  1LDD A;  3DEU A;  2XKP A;  1RUO A;  3ISP A;  2MC3 A;  5BS6 A;  2FXA A;  3E6D A;  1ODD A;  2EV0 A;  4OIQ F;  3T8T A;  2Q8K A;  4L9J A;  1HSJ A;  2DLL A;  2IJL A;  3KZZ A;  4XLP F;  1KQ9 A;  3CDH A;  2K4J A;  3KP2 A;  2DI3 A;  3TKY A;  2GXG A;  1LB2 A;  4Q5S F;  2P6T A;  3WE3 A;  3FHZ A;  2EFQ A;  2DPU A;  2P5K A;  1KU7 A;  2P7V B;  1TLH B;  2LNB A;  4KMU X;  5F1R A;  4UV8 A;  3HIF A;  2KRF A;  2WC2 A;  1SFX A;  1TBX A;  3NRV A;  2IP2 A;  5JI6 A;  2KIF A;  2YU3 A;  1R5G A;  1DPR A;  1BI3 A;  2HGC A;  3DF8 A;  4HAM A;  1U3E M;  2QLZ A;  2F2E A;  3ROU A;  5BOX A;  2QZ8 A;  4IPA A;  2HQN A;  3E3V A;  3QPH A;  5LHH A;  1J5Y A;  1T39 A;  2A6E F;  2H09 A;  1KYW A;  2HYG D;  4L9N A;  1FOK A;  4MGR A;  4AVP A;  4XBF A;  2VT2 A;  1G3Y A;  1IN4 A;  5E1Z B;  3K69 A;  3SZT A;  2D1V A;  2E7X A;  4ZYE A;  4RB1 A;  3ELK A;  2K7L A;  5KVR A;  3TDZ C;  2D2W A;  2KJC A;  2M5W A;  2ZKZ A;  5FLX K;  3CUO A;  3EQL F;  3LAJ A;  3ML6 A;  1P92 A;  3DFG A;  3ULQ B;  4IF4 A;  3IKV A;  2VC1 A;  1FNN A;  4G7O F;  3M7G A;  5DD4 A;  4CHU A;  5HS7 A;  3I0T A;  1D3Y A;  5HS8 A;  4MHG A;  1LDJ A;  2HR3 A;  2LKP A;  4ESF A;  3KLO A;  1HW1 A;  2IA0 A;  3WTT C;  1XGN A;  1K78 A;  3DKW A;  3J80 Z;  2O0Y A;  2QYO A;  5HDN A;  2NNN A;  3Q9V A;  1IW7 F;  2GQQ A;  1QPM A;  5E8G A;  1SD4 A;  1W4M A;  3MZH A;  3K2Z A;  4KNY A;  3JTH A;  1YO5 C;  5FD5 A;  2EFP A;  2MBF A;  1E2X A;  4NB5 A;  1XN7 A;  3LWF A;  1KA8 A;  2HKX A;  3EET A;  5D4R A;  3GVA A;  3K1P A;  5DCM A;  3L9F A;  2HFH A;  3KP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...