2DDBA

Crystal structure of pseudecin from pseudechis porphyriacus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
207
Chain Sequence
NYQKEIVDKHNALRRSVKPTARNMLQMKWNSHAAQNAKRWADRCTFAHSPPNTRTVGKLRCGENIFMSSQPFPWSGVVQAWYDEIKNFVYGIGAKPPGSVIGHYTQVVWYKSHLIGCASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADCPSACVNRLCTNPCNYNNDFSNCKSLAKKSKCQTEWIKKKCPASCFCHNKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudecin
publication title Structures of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels: implications for movement of the C-terminal cysteine-rich domain
pubmed doi rcsb
molecule tags Toxin
total genus 60
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 2ddbA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 2ddbA01
2CQ7A 3NT8A 4G2UA 4P27A 1CFEA 4TPVA 1XTAA 2EPFA 3MZ8A 4IFAA 4NUIA 4NUNA 2GIZA 1QNXA 2A05A 5JYSA 4H0AA 3Q2RA 2DDBA 5ETEA 1U53A 4NUKA 2DDAA 4LY5A 1XX5A 3U3LC 4AIWA 3S6SA 1WVRA 1RC9A 3S6VA 4D53A 4NUOA 3Q2UA 2VZNA 1SMBA 3U3NC 3S6UA 3U3UC
chains in the Genus database with same CATH superfamily
2JK3A 3WU1B 3H3UA 5F27A 2VONA 2X6YA 2WC2A 3G73A 2CS3A 1R00A 2XKPA 2P0WA 2DI3A 4M9ZA 4HX7A 2VASA 4M6XA 5B66C 3V8LA 4W1UA 1JT6A 2EZLA 1RR8C 1TQMA 2L4AA 3JRGA 2DMNA 4Y4RA 5CQGA 2DK5A 5AONA 2JUCA 1K7AA 2DT6A 3N4MA 1XSDA 2DQRA 2R7DA 4XN3A 3QOPA 1U2WA 5JVTA 3U2RA 2M4KA 2IAIA 5M3MJ 2ZMEB 2OTJI 5EYRA 1J2XA 4U7BA 2EPFA 2KPMA 3S2WA 4IQJA 2UZKA 3V4GA 3E6DA 3ECHA 2VJ5A 2CQQA 1P9QC 5KAFC 5E3NA 1B4AA 3FWEA 5AIPA 1A6IA 3S17J 3PL8A 1PDNC 1MSFC 1LUJB 3HGYA 4BQAA 2RV8A 4D53A 2NRAC 4IHSA 2QKLB 3CC7I 1XMXA 1P92A 2OC6A 2DLLA 3OYJA 2NXNB 5KCMA 1YJNI 5LGUA 3WTTC 4CDGA 2VB6A 1GT0C 4ESFA 1T98A 4MQ9F 3Q0UA 3JAMZ 5L3CA 2WADA 1B8IA 5DUKA 4YFNF 5HVQC 2L7KA 3K10A 2IGNA 3I53A 3ZMUA 2VOOA 5ILSA 5EF6A 2M3AA 2QZ8A 3KEOA 1XCBA 4I02A 2AXTC 4IZZA 3UR3C 2XAJA 2R7SA 2IA1A 4YRVA 5HLTA 1DUXC 4PJJA 2OD5A 5DS9A 1IUFA 3PUFA 1HCRA 5C4JJ 4B47A 3IL2A 5EEAA 3E0JB 5K1YA 4XKCA 4A2UA 1R36A 3RKXA 1NH3A 1ZTRA 2OBPA 1VQ4I 4M3FA 2OJED 4ZYAA 1IAWA 4S04A 1Q1HA 3ONQA 2TDXA 4A5NA 4PSWA 3U3LC 2L3DA 1DU6A 3MN2A 1Z7LA 1WVRA 2VT2A 2GM4A 3ABKH 3CC4I 2PMZA 4Y17A 1R9TJ 1IUYA 1YW9A 4V2GA 5FD5A 4S0HB 1BN5A 3FXKA 2R92J 2R3SA 1ZGWA 3OS0A 4H0EA 4IFAA 3WGGA 1BIAA 5K5QA 1C0WA 4HLXA 3RKWA 4LB5A 2LP0A 3WTXC 2IXSA 4XORA 1FJLA 2KDOA 1ZLJA 2XV4S 3OR2C 1TL8A 2HVSA 2A07F 3V7RA 4KMFA 1V5GA 4QTRA 2VXZA 4CUGA 2KJBA 5E1ZB 3PSFA 3QOEA 3M8FA 2HZTA 3GXOA 2CW0F 4RGXA 5H6RA 3F22A 2CUZA 5EGOA 4A3JJ 1KQ8A 4U87A 4EGYA 1SD4A 3TO6A 4OWRB 1B6AA 3O8GA 3HGGA 3ZP5A 6PAXA 2YS9A 1GV5A 3ESWB 1X2MA 2CUFA 2V4JC 4P5OA 2LOOA 2FEZA 2PN6A 4AIHA 1MMGA 2ISZA 3EUKL 1H0MA 3VFZA 3BOQA 3DF8A 3DTKA 3RKYA 3F8CA 5BPDA 1O3QA 2QA4I 3TKYA 3F6VA 4BXUA 3LSPA 1YS6A 2P6TA 3GEZA 2WAQN 4ENJA 2DA5A 1IN4A 3ZQ7A 3QP5A 4HNVA 3A4CA 3RTRA 4XKBA 3BQZA 2HDCA 4LG0A 4HF2A 1GLNA 3AG4H 1RETA 2COMA 5B3SH 2XSDC 2DODA 2EFNA 4HQMA 2JSCA 5D5UB 4I99C 4A3EJ 1DP7P 1MNMC 2M87A 2HOTA 3H9QA 3HL2A 2E1CA 2LR8A 3KIOA 5ILVA 5FROA 2M4GA 1KGSA 2EV6A 3ISPA 1UFMA 2Z5UA 4BHCA 3L9FA 1S7EA 1VQ7I 4HEA2 3BDDA 2EQRA 5GPAA 2LKSA 2P7VB 3M1CA 2DMPA 1UAAA 1D3YA 1VQKI 4RM3A 2RQPA 4UUSB 4KN4X 1VQNI 2W48A 1LDKB 1T0FC 3CP8A 1LEBA 3MCZA 1OQYA 1Y6IA 4OOIA 4B3AA 1OYIA 3KP3A 1JTXA 2Y30A 3HRMA 2DT7B 3P9IA 5IYDJ 2W57A 4EM0B 2KJCA 4GXOA 4LMYA 1VNDA 5E20A 3R6SA 3OYIA 2WAFA 1A04A 2DA6A 4RA2A 3RSNA 5E3OA 1R1VA 2DBBA 2Q8KA 4DZPA 1R71A 1I6XA 4JX4A 3CCEI 3GTGJ 3TEDA 3GTQJ 1MDMA 1XN7A 5FFXA 2LTPA 2EWNA 4BHBA 4F91B 2QENA 1ENHA 3OS2A 1FMWA 2HOAA 2P81A 1N77A 2O5RA 3F21A 3E6CC 3K2AA 4M3BA 3HZJA 1N78A 2LF8A 1VI0A 3IC7A 4HF0A 3I0TA 3HSEA 2ME6A 4HV6A 1T38A 1HW2A 2KFDA 2ZNZA 4LLNA 3ZQFA 2YUSA 3GZ5A 4X6AJ 1FY7A 4RAFA 4E7JA 3RQIA 3COAC 3CF2A 2X1EA 3ZGKA 4U0WA 2R7VA 4IXAA 1QQIA 2BOLA 4LLGF 4UUTA 5ICFA 4AC0A 1V5EA 3MQ0A 1FT9A 2L7FP 3MKWB 1FX7A 1UHSA 2STWA 2VZNA 4XBFA 3FMQA 1A5JA 2Q1ZB 2VJIA 3PSIA 4GYIA 2DAOA 3GBGA 4KT6A 2MD0A 4XLPF 4NC7A 3S3NA 4HBLA 1QO0D 5FGMA 3DPLC 3AKZA 2XPUA 3IAS2 3FF5A 4X0GA 5M3FJ 4DW6A 4X1EA 2VBYA 3CCYA 4KJZA 2L9VA 3LMMA 3FXUA 3DBLB 4MTEA 4ABZA 1TWAJ 2E5NA 2E2IJ 1XX5A 5J47A 5IYBJ 3V42A 1GXQA 2LD5A 1V4RA 3K0LA 5CVRA 2Z33A 5HLIA 4GDFA 1I1GA 2V1UA 3F9KA 1G6NA 5GP9A 4C30A 4AD9A 4F55A 4I01A 1JTYA 2M0CA 3JSOA 4RLFA 5EEGA 2R7ZJ 3O3KA 3V7CA 2P5VA 4PSXA 2VJ4A 2WB1N 3T0YA 1S8NA 3L2CA 3ZPLA 5DYMA 1SVLA 4OIRF 3DFGA 1XGOA 3ZMZA 2IBDA 1FP2A 4DBRA 2JA6J 4BYYA 3TOAA 2DYRH 3EUHC 1BI3A 1YLFA 3ZMSA 4YELA 1V55H 2KZGA 2QQBA 3PNVA 1MMDA 4A3LJ 1PJRA 2Z2SB 4BEHB 4F3QA 3SJMA 4Q48A 1QBJA 1IXCA 2W84A 2FMLA 3A02A 2EB7A 3ASNH 3MEXA 1DPUA 1G3SA 4Q5SF 1UG0A 4CCLA 1LPQA 1F5TA 2XB0X 2XGEA 1X2NA 1RI7A 3S8PA 4I0BA 4BKXA 3KFWX 3SEQA 2ELJA 1G3YA 4O6JA 4CCJA 2EFWA 5CQEA 4UV9A 1YS7A 2A61A 2D2WA 4XOTA 4FQGA 3IH3A 3DEUA 4XONA 2R7UA 4HSRA 3SXYA 3TMOA 2HOEA 4NUKA 1P6RA 2BXYA 1KU9A 4BE1A 1EA3A 1YI2I 1XG1A 5K5RA 4ZTFA 3BR6A 1G3WA 5CVUA 1MNEA 5LRRA 4A0XA 4D7MA 1T8IA 1JGGA 2QSGX 3DEWA 1P4XA 2JA7J 3WODF 3W3CA 3LSHA 5CLSA 3C2HA 4EJVA 3NWSA 2KRCA 1SC7A 4KMUX 2OCEA 3K1NA 1MBFA 2L7ZA 5CVIA 4II2A 2FRHA 4CYCA 2B0LA 2LBFA 1KA8A 3OL3A 5DCMB 2IJLA 4BJTA 2RREA 5J8CA 3KYCB 3TO7A 3AL0C 4MHGA 2L7MP 3WTUC 2D1HA 1IRFA 2K9SA 1SVMA 4HNUA 5EJCA 3ZQIA 1LDJA 5LLQA 1T0FA 4Y33A 1K78A 5JVGF 3G1OA 1WKMA 2BVMA 4I2OA 1YHQI 3S32A 4Y52J 2QM3A 1XTAA 2ZCWA 4LITA 5HLHA 3J7ZI 1IF1A 3FM5A 1O3RA 1R4NB 2GOMA 3ROUA 2DMQA 3FXQA 2FOKA 2W85A 2HKXA 1BI2A 1WRJA 4ZC3A 4G7OF 3HOTA 2JT1A 1EH8A 1A36A 1WCMJ 2GIVA 3IHUA 3OYAA 4E7KA 3A1YA 1B72B 4BJ5C 3S1QJ 4LFUA 5EZHA 2IA2A 2UWMA 1RESA 3BY6A 4U0VA 4A3GJ 5CKTA 3BPXA 4CYDA 4ESJA 2EZHA 2PJPA 3K4LA 5LD2C 2E2JJ 3BR3A 4IHYA 3OYLA 3EPZA 2XAUA 5IOYA 3G4SI 1QU3A 5F0HA 1J0RA 1NG7A 2GIZA 4OAZA 1QRYA 1JUPA 5J8FA 1GV2A 2M0MA 4AYBA 5BQTA 2DYSH 2E1MB 5LHGA 4DQ2A 5FFZA 4RB0A 4WF2A 1B9MA 2IGOA 4L9TA 4AIWA 1K79A 1ZKGA 4IOCF 4G7HF 3S6SA 3OSGA 2Q2EA 1STZA 3ABTA 3PFIA 5L3DA 2BW3B 3HOZJ 2K9NA 2YU3A 2WAQA 2E7XA 3E5UA 1JKOC 4UVAA 5GADJ 1U78A 1D5VA 1U5TA 3BG5A 1SVOA 2VPLA 1VQ8I 4F93B 3HRUA 3HTUA 5JI6A 4Y15A 1VTNC 4PGGA 3DP7A 1AHDP 3MAJA 2MFZA 1X3UA 1DGRM 1T2KA 1MBJA 3GTJJ 2X1DA 4Z2YA 3S16J 3K70C 1SAUA 2DXIA 3G1LA 2L9RA 1W36D 1ETWA 1ETXA 3RDIA 2AHQA 4NC6A 1VQOI 1XGNA 2O8KA 4XN0A 2PMHA 1FTTA 1OKRA 2CQKA 1UCRA 2C6YA 1Y8QB 3CLOA 3D5LA 2CSOA 1QNTA 4ETSA 3ZQCA 2DU9A 2A05A 2CUEA 2LC2A 2HKOA 3M8EA 1R22A 2ZXHA 1OCPA 4EV0A 4OINF 1FLIA 3P5JA 3EYYA 1JXSA 3C2BA 2LNBA 1BL0A 2W1OA 5ETEA 1OJLA 3DWLE 4L5IA 1KU3A 5H2FC 1HKTA 4Y13A 2DJIA 2DPUA 3EUHA 1WJEA 4M3DA 5E18F 2VE9A 4JP0A 4KISA 2WV0A 1OCCH 2EFOA 5KVRA 1IN6A 1R5HA 4LLLA 3OYDA 4M9SA 1WQ2A 1E3PA 1GUUA 5BS6A 1PYVA 2J5OA 4PZJA 1FIPA 5BNGA 1UB9A 1XGMA 1PP7U 1FYLA 4ITVA 1SMYF 1U3EM 2BY3A 3EDPA 5J4YA 1SFXA 1DQUA 3B73A 4AM3A 1R49A 2PBIA 3R60A 1WH5A 3HOSA 2MG4A 1PUFA 2XGDA 3BTCA 1KONA 1YW7A 2VC1A 2O3FA 1SANA 1Z9CA 4A3FJ 3OYGA 2O03A 2M8GX 2KP6A 5JFRA 1O4XA 3JREA 3RI4A 5BOXA 2ZJQF 3S1NJ 2XAGA 2VBWA 1PVEA 2L0KA 5TRDA 1XSVA 1YX3A 1Z3YA 5DUIA 4CCNA 2DFIA 3REOA 5E3LA 4P9FA 4BE0A 4XK4A 1XMAA 5FLXK 4I0AA 3WU0A 5HS7A 1DPRA 2RNJA 2TCTA 4CZCA 3FBNB 3FMSA 5LFAA 5IY5H 1WPKA 5ED4A 1OLTA 4FISA 3AAFA 2E60A 4ON0A 1KQ9A 1QNXA 4XMYA 1IN5A 3MKZA 2R5YA 4BBRJ 4HQEA 1OR7C 4BUPA 1WGXA 2VLAA 1X1BA 4N9IA 4ZYDA 3GFJA 2P4WA 3CESA 3MKYB 4YIRX 1RKWA 4NUBA 1Z6TA 1ZHFA 3F6OA 2YU9J 5DCFA 4RBOA 3OOPA 3KX2A 4UHTA 1MW7A 4HSTA 2COBA 1PP8F 1KYZA 3CMMA 2K7LA 2VE8A 2I8DA 4HG2A 2E35A 3KLNA 2JMWA 2D45A 3CC2I 3JRBA 4FX4A 2QLZA 4JX5A 3MWMA 5L3FA 1QA6A 3CQZJ 1MKMA 2ICWG 4M71A 1YYVA 3HB9A 4CXFA 4QPQA 4E70A 5KNLA 1G8XA 2PQ8A 2PI0A 2QWWA 4NQWA 5E1XA 4BGDA 1YRNA 3TO9A 2PFBA 3O2PE 2AS5F 2X9DA 2IP2A 5FD6A 3CCVI 1ZR2A 4NDLA 2V9KA 4BNCA 2EINH 5IP6A 1IRGA 4AWXB 1WJAA 3TQNA 1LFUP 1R58A 1M1EB 2O6GE 4RAZA 1UHWA 5EGOB 3S15J 2V6EA 4ZDPA 4CA0A 3I4NJ 3TOBA 3MKLA 2XF7A 4PUSA 1TNTA 1DU0A 2VT3A 3HPGA 1LNWA 2L2OA 4UB8C 2VJJA 2P7CB 3H5NA 3RPUD 2H1KA 1IC8A 5HNHA 4ZTJA 1I3QJ 3CCSI 1RZ4A 5HLGA 2MSYA 2L4MA 2X85A 3ZQGA 1W0UA 2JA8J 3P7NA 3VEPA 3MZYA 1VQPI 1WJDA 3BC8A 1IDZA 4XLFA 1LVAA 4E6KG 2HYGD 4IQ4A 1H9TA 2H27A 1MJ9A 2UXXA 2K02A 1OCRH 2NOGA 2P8TA 1G59A 1DGWY 2VKHA 4LG0B 3CCMI 2VBXA 2WWYA 1BC7C 1R1TA 2XAQA 1IO2A 2XB5A 3QWLA 1XD7A 3JTHA 1Z77A 4IRGA 2GZWA 2DOAA 1DDNA 3T8TA 3H3ZA 1W0TA 4XSZF 2E19A 5C4XJ 1JI8A 5F08A 4E7SA 1TWHJ 2E5ZA 3GF2A 4EGZA 3H5RA 5FLXZ 4DGWB 2LK2A 2QEXI 1IXRC 2NS8A 4UVCA 3H9JA 4BU2A 1K83J 2CO5A 1SD6A 4HAMA 2A6TA 4L5EA 4PJLA 3JRIA 2QBYA 4PDKA 3B6AA 3DPTA 4II3A 2HFHA 2YPRA 4ZYGA 2VQHA 1VQ9I 1WSUA 3ELKA 1UJ8A 1VZ0A 3HM5A 1RPWA 3EQLF 3OYCA 4A3MJ 3U3NC 4A3BJ 2IEKA 2L54A 1GVJA 5HNFA 2JA5J 3J7AY 1IGNA 2M34A 2VI6A 2IA0A 2WBMA 3LA3A 5M5XJ 5CPRB 2VC0A 5B1AH 2DMUA 2OQGA 3BG7A 1T56A 2ZNYA 3HOUJ 2PLYA 1FYKA 1CQTA 2ISYA 3CUQC 1XC5A 3U1KA 3WG7H 1O7LA 4DJAA 3IV5A 3S1RJ 2XSJC 1MDMB 2F5VA 1JUSA 4AVZA 4E4HA 2CH0A 2KT0A 4NB5A 4RLQA 1N75A 1X1CA 1WH7A 1JGSA 5ICCA 3KZZA 3IKVA 4C2UA 4OMYA 2XF5A 1ZGJA 1HSTA 3JRAA 1AKHA 2X0LA 5HOOA 4RM2A 1TT5B 3QAHA 1LJ9A 3CJNA 3JCUC 3LNQA 4AYBN 3IAM2 4U7DA 3QP6A 2XPVA 4R79A 3HSRA 4EEFG 2HVQA 3PQKA 4WK8F 1OR7A 4A3KJ 4BJ6C 2V1NA 3L2VA 2HQRA 1YG2A 3BWGA 2A5YB 3O8HA 4BL0B 2M8EA 1WZ2A 3I9V2 3WG9A 1LVKA 1WJCA 1J9IA 2X48A 3W6JB 3BROA 3JRFA 2R93J 1MBGA 2R7OA 3KP2A 1OISA 4YFKF 2O8XA 3VPRA 3MZHA 5H20A 1NHAA 2DDAA 2L9SA 4WXDA 1D0ZA 2ZJRF 2FNAA 1ONVA 4HPQA 1BOBA 2X6WA 2HPIA 3HTSB 3BJOA 3HBLA 3QYBA 1T6SA 1YE9A 2X4HA 5EG0A 3FXJA 3HIFA 3GTPJ 4L5JA 3GTMJ 1ZLKA 3DKXA 4F92B 2HEOA 1X58A 4QPOA 5CJ9A 2DK8A 2MLGA 5DDGA 3HUGA 5GTIC 1VFCA 5DM6F 4C2MJ 1IZ1A 4JYKA 3ZMTA 2GWRA 2BY0A 3OYBA 2E7WA 3HXLA 4YFXF 4MQVA 4Y3OA 3U21A 3D1NI 1ZRDA 2G7HA 1I50J 2CV1A 3TP3A 3HJEA 5HS9A 2DPDA 2O61A 2DFEA 3KEYA 1UZCA 4LD5A 2PEXA 3BR0A 2OAZA 5EDNA 5L3GA 3SZPA 3ULQB 2CQNA 2O0YA 2A6HF 3OYEA 4FX0A 4BE2A 4HDVA 3DKYA 3LSKA 1QVTA 4D5CA 1RIOH 4KFCA 3IUOA 2XPWA 2XAHA 3JSPA 2K27A 2K40A 5ICEA 2HWVA 4XLHA 3SEZA 1TLHB 3V8KA 3R0JA 3CO6C 1TT0A 2OUMA 5LEJA 5FRNA 2Y31A 2E34A 3I71A 5F04A 1MSEC 4C3HJ 2FBHA 4PGHA 3WTYC 2ESHA 3KP5A 1F4KA 1E0EA 3N05A 2HVRA 1ZR4A 1HA8A 3M7GA 3H36A 4DIQA 3G3ZA 3LWFA 1TW2A 3SDGA 3IRQA 3BT9A 2KHMA 2V9PA 3SFZA 1BW6A 5DV5A 3JRCA 1TWGJ 2IVMA 3TL4X 3RIRA 5KHDA 2MW8A 1U5TC 3CDHA 3D5SC 4GRIA 2H6CA 3OY9A 2HYFA 4MEYF 4ESBA 1SAXA 2HDWA 2E36A 2MYSA 3VDXA 3Q2UA 1FIAA 5D4RA 3KZYA 3RJPA 5D5XB 4F52A 2CQ7A 3P9CA 5DTDA 1D5YA 2LBFB 2PMUA 1MBKA 2LYCA 1QHGA 4G9YA 4OAYA 3VB2A 5M5YJ 3G1MA 4B3XA 2HU9A 4FETA 1F43A 3DBRB 1RNLA 3V7SA 2CUJA 4IOAF 2M45A 1K78B 4J00A 4JX6A 4BQNA 5LBQA 2FE3A 1BR2A 1UHMA 3WTZA 2RKHA 4NC8A 4M6YA 4IX7A 3PM1A 4ANJA 2H8WA 2R4GA 3L1PA 3BG3A 3KP6A 3A01A 1P2FA 3MVPA 5HODA 2P5LC 1FOXA 2B63J 2V1XA 5K7HA 1EF4A 2CRGA 2LKXA 3LSGA 3HHGA 4RB1A 3S6UA 3CUQA 3RYRA 2FU4A 1WJBA 3DU5A 1QZYA 3S93A 1ZK8A 4PCQA 1G4DA 2JPCA 4B4CA 2FD5A 3BZKA 1JT0A 3OSFA 2DTZA 1GXPA 2V26A 5F0FA 5FRMA 4C3JJ 2LY2A 3CCJI 2JRMA 1U0JA 4UV8A 2B9SA 3JRHA 1Y8RB 4UUSA 3RQ4A 3DLAA 2LDUA 5GAGJ 2ZBKA 2XC7A 1FSHA 4S05A 4BDYA 3ZN0A 1MJAA 4M73A 1H89C 3FDYA 4CHUA 4JOMA 2A5WA 3VOEA 3VWBA 1ON2A 3MMYB 1VQMI 3MFKA 1H88C 1UG2A 3K4MA 4AIDA 3GFIA 2Q2EB 2P6SA 5JYSA 3UKGA 4H0AA 4B1RA 4UUVA 3R0AA 1MGTA 1P7JA 5K5OA 1PUEE 2I10A 4C2TA 3A2KA 2K9QA 5J3LA 1F36A 2NS0A 2K9MA 1HF0A 2R7WA 4AU7A 1KYWA 2HYJA 3K70D 3F72A 2DA4A 2AO9A 2RC4A 2Z99A 2KIFA 3LQQA 2A68F 3IKTA 2IS1A 3I54A 3IH4A 2L02A 4BH9A 2XKOA 5F6FA 3WHBA 3W2AA 2KIMA 1A6QA 4NUNA 1KQ0A 3JW4A 1JKPC 2ADUA 2FQ4A 1Z7UA 4HW0A 4XNFA 2AQFA 2X1CA 4CCMA 4YG2F 4ZZDA 1ZYRF 3FK7A 4G12A 4L9NA 4WWCA 3F23A 1YIJI 1A31A 2JQ7A 4V19K 3CP2A 1UELB 2JRTA 2ELHA 1Z05A 2KRFA 1ZAOA 3ABLH 3HYIA 3F8NA 1TQPA 3U9GA 3PQJA 3GZ6A 4N9HA 5FKMA 1FMVA 5DM7F 3E5QA 1HW1A 1LQ1A 2LF7A 2QYOA 4MEXF 4BQQA 1ULYA 2EIKH 2JVHA 3ZQHA 4XQFA 1O3SA 3SQNA 2NVTJ 2IS6A 2ID3A 1ZARA 3HHHA 5FLMJ 3E6BA 3GFLA 3L2UA 3ZQQA 2Z16A 4NUIA 1MNDA 2QQ8A 4MFDA 1OCTC 2HXIA 4CO8A 2ZC2A 3CJQB 4O5VA 3M07A 5CYVA 3HSFA 2R7XA 2DN0A 2KKOA 3V8JA 3HEFA 3MD2A 1K61A 4IKFA 3IRRA 1ETVA 3WGIA 3FBIB 2W82A 3NRVA 2JZYA 1FZPB 1TW3A 3H5AA 3TW7A 1TC3C 3LFKA 2WV1A 3GWZA 2DQLA 2XF6A 3CUOA 3GW2A 2Y0MA 3QU3A 2CW7A 1QZEA 1ACIA 3HKZN 2KDZA 4O3MA 1USSA 1OCOH 1N25A 2LG4A 1PUFB 3CJRB 4D9JA 2R7RA 3A0HC 3G71I 3S3MA 5D6EA 3OYKA 3LSRA 1V54H 2MA3A 1L0OC 2MD5A 3ERMA 3T5XA 1YTYA 2IT0A 2CMPA 2OCCH 5IT3A 1ON1A 3LL7A 2EV0A 3IH2A 4BEHA 1JE8A 2NNNA 3BR5A 3I56I 1Z6RA 1R23A 3IWZA 2Y48A 1X1PA 2KZVA 4G94A 1GVDA 1VQ5I 3BG9A 1L3LA 2LFBA 5HDNA 4PFOA 4ENNA 4FTHA 4MO7A 4JBAA 2J5PA 3Q2RA 1ZG5A 2L01A 2RGVA 1HDDC 4LOCA 5FO5A 1QPMA 2F4IA 3RCOA 3EETA 2M7AA 5IYCJ 5AIQA 1EH7A 9ANTA 2MBFA 4NNJA 1IW7F 2ZO4A 3CDLA 3VSLA 3F8FA 3I55I 2VN2A 3AL0B 2EIJH 2LREA 4KUMA 4L9JA 1DP3A 3KCCA 2R5YB 1D0XA 4XLNF 5HDKA 2R7TA 2EV5A 3ZQLA 2OV7A 4A5MA 1JUMA 2HQAA 1X4PA 5B1BH 3EYIA 2F5CA 2JPBA 2YR2A 1P4AA 2ZXJA 2QCOA 3QPTA 3NAUA 4IRHA 2VPRA 1IRZA 3Q3SA 3CTAA 4LIVA 4PJNA 3J80K 2PJRA 2QKMB 1APLC 2F5FA 2HGCA 4IHWA 3E5XA 3J81K 3N97A 2EIMH 4IL6C 4CGZA 3HG9A 4XIDA 3CCRI 4D5FA 1ZGAA 2F4OB 1ZRCA 4H4KC 3OIQA 4R8HA 2VKEA 3DTIA 3RZOJ 1IDYA 2FMYA 1A35A 3QQAA 1XGSA 1LE8A 1W5SA 2XUBA 2Z1DA 3FXOA 3I59A 4CH7A 4PK4A 4I7HA 2ZJ2A 4A93J 2E1NA 1I39A 5HDGA 5K7ZA 1USTA 1B1BA 4LK1F 3ZMVA 3GCMA 1SMBA 5F64A 2A6EF 1HXDA 3U3UC 1VF9A 4J01A 2LLKA 5FJ8J 2V9VA 4IHTA 3CDIA 3RZDJ 2EA4A 2XIGA 2XDVA 4RGSA 4M6VA 5ERIA 2A3SA 4OIOF 3FKIJ 4LK0F 1D1CA 1W5CC 1SMTA 2Y2ZA 2VQCA 4QIWN 1ZELA 2FXAA 2GA2A 3LAJA 1ETOA 5J1UA 4B43A 3QRFF 3KE2A 2R7FA 3I3LA 3OYFA 3BP8A 3CLQA 2EILH 2VOPA 1TBXA 1B8IB 4QWQA 3CO7C 1KU7A 4FE7A 1Z67A 2DA7A 2R5ZA 4OU0A 4UB6C 2ZMEC 3DEEA 1JJ6C 2NS7A 3J7AO 4G6DA 2BY2A 4BBSJ 4A6DA 3GYHX 2VL8A 2BW3A 2ETHA 2DOEA 2HZDA 2CV0A 3H0DA 1E2XA 2CYYA 4P96A 3BZCA 4Q4ZF 4I6ZA 3JR9A 3Q0VA 2NYXA 2F5DA 1H9GA 3W2WA 1X1AA 3K6GA 3QYFA 3J7YJ 3SZTA 4NUOA 3CF5F 3PFYA 4M3EA 4DYRA 1K4TA 3K4CA 4EQQA 3HDDA 2KLOA 5FKNA 2PX9A 3K9TA 1IV6A 4B44A 2Z9OA 3S2HJ 3RPQA 3L2QA 2QBYB 2ECBA 4G6TB 3PIPF 3BZ6A 2NVXJ 3VSKA 4XOPA 2GOXB 4LB6B 3FHZA 5CVVA 4ZDOA 1T95A 4RB3C 1ODDA 1RKTA 2B7EA 2X51A 2O9LA 1J59A 4U88A 2Q0OA 2DA2A 2ESNA 1LFPA 5E79C 4IJAA 2TRTA 4HX8A 2G7UA 4FHTA 2GXAA 1W7PA 3DXJF 2DW4A 3WE3A 4YIFA 4L0ZB 5BMZA 2YX7A 2LH9A 1J7KA 4IO9F 1X4OA 3E7LA 4A12A 3B6CA 1ZRFA 2DA3A 3FIWA 3J80Z 1R4MB 3CD6I 5ILUA 3MZ8A 1BIBA 1HDPA 2IS2A 2AQEA 4M72A 1I5ZA 1U9NA 3J81Z 2HTJA 2MGQA 2Y9YA 2BVLA 5M5WJ 2GA1A 1GDTA 1U6GA 2CFOA 4KIGA 4HNTA 5IP9J 1CF7A 4HV5A 2HR3A 1HC8A 2MC3A 1AKHB 2ZFWA 2GQQA 4RB2C 4EVIA 4E7LA 2BYVE 2G0EA 3GX4X 1FBSA 1RR7A 5DD8A 4QLCU 3GMEA 1FYMA 1SD7A 1AWCA 3SDBA 1ITYA 1YX5A 4LIUA 3HOXJ 3BCBA 1MBEA 2IGKA 2QVOA 1FTZA 3H3VK 2K5CA 3GTKJ 2VQGA 2R7QA 2DO7A 4G8XA 4CZZA 1X19A 3ZN1A 4I76A 2PG4A 4C3IJ 1RUOA 5J40A 2D5VA 2XAFA 5DEQA 4FT8A 2M1BA 4NHJA 5IPAA 3L2RA 4L9VA 4NBQA 1X3WB 1JKRC 2VKDA 2YSRA 5LHIA 5J1RA 1NK2P 1BW5A 4A0YA 1YW8A 1LDDA 3LSTA 1FPQA 5EG0B 1ZG1A 1ERDA 3QODA 2ZXWH 2QQ9A 1MH4A 4HX4A 2QSHX 3PNTA 1SFUA 1TTYA 3FMRA 2H94A 2LSOA 5ICGA 3FXLA 4GYGA 1RC9A 2DT5A 2BZTA 3FM3A 1P7IA 2CG4A 3BR1A 2CWEA 2AXLA 1XSXA 3K7AJ 2IW5A 1BR4A 3HUGB 4GCVA 3DV8A 4RAYA 2OF7A 2Y0SN 1BOAA 1U9OA 1R6RA 3GZNB 4V2FA 5H6QA 2LVSA 3ZXSA 2IPQX 2IGMA 2W7NA 3GTLJ 1FEXA 3K1MA 4KT5C 1QPIA 5FKKA 3R4KA 2EA2A 5E1WA 1BJAA 1R7JA 5GAEJ 3OYNA 1NK3P 4BQOA 3LSMA 1MBHA 3D0SA 3HKZA 4E7ZA 3ZMDA 4OIPF 3BTIA 1TZLA 4JK1X 3TBIA 5L3BA 4MLOA 3OIPA 1Z0XA 1WJ5A 1I1SA 3FKJA 5JLXA 4ZZLA 3CCLI 4RGRA 3OMYA 2HOSA 4N4NB 4XLEA 2EZIA 4Q47A 3LFUA 3DKWA 4XM3A 2FBIA 2WY8Q 2WY7Q 2KISA 4IF4A 3UNGC 2Y9ZA 4A0ZA 3KYDB 3AG2H 3VYRB 4XRFA 3F8MA 2QSFX 1G2HA 4BY7J 2LKPA 2ZMEA 4WX9A 1IG7A 4AIJA 4CICA 4BDZA 3KYLA 2NVYJ 1Z1DA 1OYWA 3M1EA 3BTLA 4XKVA 3SFIA 1LFBA 4PFPA 2NOJB 2JJ7A 4ZH4F 2OTLI 2XASA 2FF4A 4U0YA 3OOUA 2BY1A 2XRLA 4MFEA 4MTDA 4A3IJ 2RAEA 4RGUA 4EJTA 3CZ6A 4B09A 2NVQJ 3LA7A 2K3PA 2N8GA 3LOCA 3WGHA 2W25A 2ZJPF 1IN7A 2DDBA 2XRNA 3E6MA 2D1VA 1U8RA 1BM9A 3HRTA 1HKSA 4EMSA 3ECOA 5JR3A 1OCZH 4HDUA 3K4JA 1SFKA 3D5RC 4RDUA 4LGWA 4KA4A 1NTCA 4G6QA 4ENKA 1Y56A 3JTGA 2ZB9A 2FJ1A 3WE2A 3RKQA 2P5KA 3BTJA 1LEAA 1QZZA 2OQRA 4OIQF 1WJFA 3Q5FA 5A2QK 3DBHB 5L3EA 1K4SA 1UMQA 2BEOA 1XB4A 3C18A 2K3FA 1BI1A 4I09A 1EJ9A 3A01B 1H8AC 2OPTA 3L09A 1R5GA 2JN6A 2Y75A 4BXFA 3F0CA 4M74A 2K4BA 2HDDA 3CUQB 4RMNA 3L2WA 3OYMA 4LY5A 4M9XA 4D1QA 2MABA 2VKVA 3PUBA 5TGTA 1TP4A 1FWZA 4IEJA 1FOKA 1ETKA 2K86A 1TWFJ 3GVAA 1QVUA 3L00A 1WHUA 5TJJA 4XLAA 1IV8A 4P27A 1SD5A 2KRHA 4UXNA 4FASD 1IRXA 2GBYA 4CCOA 5E8GA 3GTOJ 4TPVA 3I4MJ 4P55A 1J09A 3CMYA 1O3TA 1Y39A 1W1WE 3A03A 3PJRA 1BI0A 3GO5A 4ENMA 1U8BA 5D8LB 5DD4A 1E17A 2F48A 3H1CA 4N4OB 5GPCA 5D8KB 3OYHA 2K4JA 3KP7A 2VXDA 3IWFA 4LG3A 3PIOF 4P9UA 1D0YA 2LMDA 1S6LA 2KIUA 4KN7X 2M30A 2RNGA 3Q9VA 1HQCA 1BJZA 3K4BA 3ZR8X 1TWCJ 1RUNA 3H0GJ 1MJBA 2CV2A 3S1MJ 2HPMA 4P1WA 2DFFA 3GFMA 2WTEA 1VQ6I 3FZVA 2M7BA 1ZREA 2DA1A 1XS9A 5D4SA 2JWTA 1U53A 2XGXA 3OS1A 3SHFA 5J6XA 1BR1A 2DMTA 1FP1D 2I5UA 4MGRA 4EJOA 5EEHA 3P9KA 4DYCA 3OWTA 2EFQA 4HRIA 2E2HJ 2UXNA 4E7HA 2HXOA 4CYCB 3GLLA 3HC7A 2OU2A 4R1HA 5F1JA 1EH6A 2M2EA 1RRJA 4CSWA 2F6CA 3C3WA 4N0BA 1R5ID 1FC3A 5HS8A 3B02A 3ZOBA 3LAPA 3QU6A 2KQRA 1EKEA 3SYTA 1SFOJ 3TW6A 2ZKZA 3M4OJ 5F0CA 4EATA 3HOYJ 2OZ6A 1YO5C 4JQFA 4DOZA 3I4PA 5C3EJ 4YEJA 1EV7A 3WTSC 3FISA 5JHUA 2JA2A 1FOWA 2VBZA 2DTRA 1X3ZB 1SFEA 1E3HA 2VODA 4XL9A 4A69C 5K7FA 5LGNA 1XPXA 5D5VB 1G3TA 3ABUA 2XROA 1F9NA 3C2GA 5A2QZ 2NNYA 3ZRGA 4B48A 4XR6A 1W7PD 1WFXA 3JRDA 2HS5A 1WI3A 1Z3XA 3BCAA 3ERED 2F5EA 2CGPA 5JHFA 3KEQA 3R61A 2EZKA 2BBYA 4IRIA 3DPUA 2GXGA 4L0YB 3H35A 4XRSA 2BGCA 4IHXA 2F2EA 1YITI 1MD0A 3G6EI 1JJ8C 4IVNA 2E71A 1OPCA 3EUAA 2E1OA 3M9AA 3GLXA 1IN8A 2BHYA 3M3YJ 4PJMA 4Y7NJ 3VYSB 3X2QH 1J5YA 4BXXJ 1B59A 2FQ3A 5LRSA 4A3DJ 3OL4A 2R0QC 4XICA 2KIQA 5CVJA 1U5TB 3NQOA 4XLCA 2W24A 3QPHA 1R1UA 4HLYA 3Q0WA 1F1ZA 1Z91A 2QGUA 2K85A 4BY1J 1FSEA 3NT8A 3DCFA 2HQNA 3WHCA 3RPUA 4KIFA 1HBXG 3LA2A 1POGA 1D1AA 1S7AA 2G9WA 1X1DA 3ZCOA 1YFHA 1AOYA 4B8XA 2FUG2 2ZSIB 3LSIA 2E1MC 3NARA 2Z3YA 3BG6A 3NEUA 3CMAI 4D7NA 1FBUA 3W6KB 2EJRA 4J19A 1ETQA 3I64A 4AIKA 5IP7J 1YJWI 1K6OA 1AA7A 5FB2A 3S6VA 3H9GA 3CCQI 2RDPA 5LHHA 3QPSA 3KP4A 2GXBA 3LSJA 2IS4A 2Y0SA 4I98B 1E3OC 5FLVA 2MH2A 1HOMA 1ZN2A 4BACA 3F3XA 1QHHD 2W00A 5JLWA 2PJRB 3S3OA 1Y0NA 3VYUB 2Y69H 3ASOH 3LQRA 3KPHA 2M5WA 1SEUA 3E97A 3I5UA 3RYPA 4XKWA 2GAUA 1S72I 2NAZA 4EJWA 1MMAA 3VYTB 3FXMA 2L9NA 1OFCX 1ORKA 3AG3H 1S9HA 2FBKA 4GGGA 3CMEI 4A6EA 1MMNA 2EK5A 1D8KA 3W2VA 4HF1A 2BHZA 3BPVA 1LE8B 2VUMJ 3I59B 1OYYA 2BE5F 1LKXA 2JSPA 1OMIA 2X6OA 1BC8C 2GLOA 1T08B 1FBQA 2FSWA 1ZQ3P 1YOVB 3DTEA 4HZFA 3K2ZA 4D0PA 3H92A 5E8IA 1S5LC 5TISC 3BJ6A 1S29A 5KAIC 5D6FA 4DNCA 3AFHA 1FNNA 4DZJA 1XDSA 1HKQA 2WAEA 1Q1VA 4AVPA 2PMZN 3K4KA 4UY8I 3HOWJ 3A0BC 1V3FA 4KITB 4HYEA 4A3CJ 1WWXA 3QPLA 4TV7A 4C9YA 2L5QA 2M9HA 4DYQA 5IT9K 2WA0A 4KYWA 2XGCA 1LB2A 1O57A 3Q9SA 2JVGA 1Y0UA 3AG1H 3IP4B 1XMKA 5FKLA 2RN7A 2R5ZB 1Y1WJ 2XHKA 2MLKA 4EM1A 2LY1A 2CQXA 2FA5A 2ACJA 3HOVJ 1FOYA 5E17F 2W4SA 1IXSB 3GUDA 4KNYA 2RVCA 3S2DJ 2ID6A 4CCKA 1KZHA 1CGPA 2CJJA 3O6BB 3KETA 1HLVA 2RQQA 5GTHC 1XCVA 3K69A 4BHPA 1YIOA 3FXRA 5J1YA 1XDUA 2HQ5A 2MC4A 3E1SA 2NVUB 3CJTB 4RS8A 4WXHA 2LY9A 2QUFA 4IHVA 2UV1A 3NWTA 3WU2C 4W97A 3HRSA 1S7OA 2V1DA 4QSHA 2F4MB 2MH9A 4Z6YA 2V6CA 3KZIC 2FNPA 3OIOA 2JTVA 3T8RA 1ZH5A 3FX3A 3L7WA 3OR1C 3TDZC 2DOFA 4XRSG 3TP0A 2QQAA 1BA5A 5B5EC 3PO2J 2O7OA 5KK1A 5FKOA 2IRFG 2QF7A 3DQVC 1CFEA 5DCMA 4WCGA 1I27A 2ZXIA 2KL4A 4WXCA 2EBIA 4HA8A 4FCYA 3KLOA 1T33A 1W4MA 4ZDLA 2CFXA 1W7PB 3U1DA 5IOZA 3BR2A 4NQWB 1HW5A 5E3MA 4UVBA 5GAHJ 1YRNB 1JKQC 5LGTA 4FE4A 4MNUA 4HOBA 3OV8A 4OMZA 3PO3J 1J75A 5BPIA 1YJ9I 3ML6A 1MMSA 4G2UA 1Z21A 3ABMH 1ETYA 3I58A 4PJ0C 1JHHA 1B72A 1KU2A 2BV6A 3DLLF 4LJZF 4IPAA 1Y1VJ 3WTWC 1CF7B 1QGPA 1ZG3A 2H6BA 4BS9A 1O7FA 3W6VA 1MIJA 4G7ZF 1S3JA 2DCEA 4GFBA 2A69F 2DJNA 5LEKA 5F1RA 1MH3A 2EFPA 2K9LA 2VQLA 1YQAA 3QYEA 3HPHA 3TGNA 3JAMK 3VODA 4UNOA 3K4NA 3SZGA 2BXZA 1NG6A 3T1BA 2STTA 1W5TA 2ELKA 2FX0A 2HNHA 3E3VA 3M8JA 2EH3A 2LRDA 3F8BA 4RAGA 3DU6A 4AUXA 4XRMA 4E7IA 4M3GA 3WTVC 1B9NA 3BQYA 1TNSA 3BJAA 4ZJZA 2JUGA 1GHCA 2ECCA 3FK6A 4MIMA 1HSJA 1VQLI 2V7FA 4XSXF 2CW8A 1D1BA 4L18B 1JHFA 4ASNA 3TDUC 2KMUA 2X6XA 4ZYHA 1T39A 5IT9Z 4KIBA 1I6HJ 2CU7A 1D8JA 3K1PA 2H09A 2OA4A 2OZUA 5J4VA 1I3AA 2XVCA 1MZBA 1IJWC 1REPC 2H8RA 1K6YA 1AU7A 4ZYEA 4EJUA 1TQIA 4BAYA 3BLYA 1WI9A 2V79A 2ZFUA 5D5WB 4K2EA 4DBQA 2FOWA 3FHNA 3G2BA 1W36C 4KDPA 3C7JA 4KICA 2ME0A 5C44J 2HI3A 4GO1A 3CCUI 4EM2A 3S14J 4YIIA 3PNYA 4F7ZA 1BBYA 2UUZA 2VIXA 1V5FA 2YX4A 5EZGA 2H1LA 3C1DA 2DFHA 2ZSHB 2HTSA 2WB1A 1P4WA
chains in the Genus database with same CATH topology
2CQ7A 3NT8A 4G2UA 4P27A 1CFEA 4TPVA 1XTAA 2EPFA 3MZ8A 4IFAA 4NUIA 4NUNA 2GIZA 1QNXA 2A05A 5JYSA 4H0AA 3Q2RA 2DDBA 5ETEA 1U53A 4NUKA 2DDAA 4LY5A 1XX5A 3U3LC 4AIWA 3S6SA 1WVRA 1RC9A 3S6VA 4D53A 4NUOA 3Q2UA 2VZNA 1SMBA 3U3NC 3S6UA 3U3UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQ7 A;  3NT8 A;  4G2U A;  4P27 A;  1CFE A;  4TPV A;  1XTA A;  2EPF A;  3MZ8 A;  4IFA A;  4NUI A;  4NUN A;  2GIZ A;  1QNX A;  2A05 A;  5JYS A;  4H0A A;  3Q2R A;  2DDB A;  5ETE A;  1U53 A;  4NUK A;  2DDA A;  4LY5 A;  1XX5 A;  3U3L C;  4AIW A;  3S6S A;  1WVR A;  1RC9 A;  3S6V A;  4D53 A;  4NUO A;  3Q2U A;  2VZN A;  1SMB A;  3U3N C;  3S6U A;  3U3U C; 
#chains in the Genus database with same CATH topology
 2JK3 A;  3WU1 B;  3H3U A;  5F27 A;  2VON A;  2X6Y A;  2WC2 A;  3G73 A;  2CS3 A;  1R00 A;  2XKP A;  2P0W A;  2DI3 A;  4M9Z A;  4HX7 A;  2VAS A;  4M6X A;  5B66 C;  3V8L A;  4W1U A;  1JT6 A;  2EZL A;  1RR8 C;  1TQM A;  2L4A A;  3JRG A;  2DMN A;  4Y4R A;  5CQG A;  2DK5 A;  5AON A;  2JUC A;  1K7A A;  2DT6 A;  3N4M A;  1XSD A;  2DQR A;  2R7D A;  4XN3 A;  3QOP A;  1U2W A;  5JVT A;  3U2R A;  2M4K A;  2IAI A;  5M3M J;  2ZME B;  2OTJ I;  5EYR A;  1J2X A;  4U7B A;  2EPF A;  2KPM A;  3S2W A;  4IQJ A;  2UZK A;  3V4G A;  3E6D A;  3ECH A;  2VJ5 A;  2CQQ A;  1P9Q C;  5KAF C;  5E3N A;  1B4A A;  3FWE A;  5AIP A;  1A6I A;  3S17 J;  3PL8 A;  1PDN C;  1MSF C;  1LUJ B;  3HGY A;  4BQA A;  2RV8 A;  4D53 A;  2NRA C;  4IHS A;  2QKL B;  3CC7 I;  1XMX A;  1P92 A;  2OC6 A;  2DLL A;  3OYJ A;  2NXN B;  5KCM A;  1YJN I;  5LGU A;  3WTT C;  4CDG A;  2VB6 A;  1GT0 C;  4ESF A;  1T98 A;  4MQ9 F;  3Q0U A;  3JAM Z;  5L3C A;  2WAD A;  1B8I A;  5DUK A;  4YFN F;  5HVQ C;  2L7K A;  3K10 A;  2IGN A;  3I53 A;  3ZMU A;  2VOO A;  5ILS A;  5EF6 A;  2M3A A;  2QZ8 A;  3KEO A;  1XCB A;  4I02 A;  2AXT C;  4IZZ A;  3UR3 C;  2XAJ A;  2R7S A;  2IA1 A;  4YRV A;  5HLT A;  1DUX C;  4PJJ A;  2OD5 A;  5DS9 A;  1IUF A;  3PUF A;  1HCR A;  5C4J J;  4B47 A;  3IL2 A;  5EEA A;  3E0J B;  5K1Y A;  4XKC A;  4A2U A;  1R36 A;  3RKX A;  1NH3 A;  1ZTR A;  2OBP A;  1VQ4 I;  4M3F A;  2OJE D;  4ZYA A;  1IAW A;  4S04 A;  1Q1H A;  3ONQ A;  2TDX A;  4A5N A;  4PSW A;  3U3L C;  2L3D A;  1DU6 A;  3MN2 A;  1Z7L A;  1WVR A;  2VT2 A;  2GM4 A;  3ABK H;  3CC4 I;  2PMZ A;  4Y17 A;  1R9T J;  1IUY A;  1YW9 A;  4V2G A;  5FD5 A;  4S0H B;  1BN5 A;  3FXK A;  2R92 J;  2R3S A;  1ZGW A;  3OS0 A;  4H0E A;  4IFA A;  3WGG A;  1BIA A;  5K5Q A;  1C0W A;  4HLX A;  3RKW A;  4LB5 A;  2LP0 A;  3WTX C;  2IXS A;  4XOR A;  1FJL A;  2KDO A;  1ZLJ A;  2XV4 S;  3OR2 C;  1TL8 A;  2HVS A;  2A07 F;  3V7R A;  4KMF A;  1V5G A;  4QTR A;  2VXZ A;  4CUG A;  2KJB A;  5E1Z B;  3PSF A;  3QOE A;  3M8F A;  2HZT A;  3GXO A;  2CW0 F;  4RGX A;  5H6R A;  3F22 A;  2CUZ A;  5EGO A;  4A3J J;  1KQ8 A;  4U87 A;  4EGY A;  1SD4 A;  3TO6 A;  4OWR B;  1B6A A;  3O8G A;  3HGG A;  3ZP5 A;  6PAX A;  2YS9 A;  1GV5 A;  3ESW B;  1X2M A;  2CUF A;  2V4J C;  4P5O A;  2LOO A;  2FEZ A;  2PN6 A;  4AIH A;  1MMG A;  2ISZ A;  3EUK L;  1H0M A;  3VFZ A;  3BOQ A;  3DF8 A;  3DTK A;  3RKY A;  3F8C A;  5BPD A;  1O3Q A;  2QA4 I;  3TKY A;  3F6V A;  4BXU A;  3LSP A;  1YS6 A;  2P6T A;  3GEZ A;  2WAQ N;  4ENJ A;  2DA5 A;  1IN4 A;  3ZQ7 A;  3QP5 A;  4HNV A;  3A4C A;  3RTR A;  4XKB A;  3BQZ A;  2HDC A;  4LG0 A;  4HF2 A;  1GLN A;  3AG4 H;  1RET A;  2COM A;  5B3S H;  2XSD C;  2DOD A;  2EFN A;  4HQM A;  2JSC A;  5D5U B;  4I99 C;  4A3E J;  1DP7 P;  1MNM C;  2M87 A;  2HOT A;  3H9Q A;  3HL2 A;  2E1C A;  2LR8 A;  3KIO A;  5ILV A;  5FRO A;  2M4G A;  1KGS A;  2EV6 A;  3ISP A;  1UFM A;  2Z5U A;  4BHC A;  3L9F A;  1S7E A;  1VQ7 I;  4HEA 2;  3BDD A;  2EQR A;  5GPA A;  2LKS A;  2P7V B;  3M1C A;  2DMP A;  1UAA A;  1D3Y A;  1VQK I;  4RM3 A;  2RQP A;  4UUS B;  4KN4 X;  1VQN I;  2W48 A;  1LDK B;  1T0F C;  3CP8 A;  1LEB A;  3MCZ A;  1OQY A;  1Y6I A;  4OOI A;  4B3A A;  1OYI A;  3KP3 A;  1JTX A;  2Y30 A;  3HRM A;  2DT7 B;  3P9I A;  5IYD J;  2W57 A;  4EM0 B;  2KJC A;  4GXO A;  4LMY A;  1VND A;  5E20 A;  3R6S A;  3OYI A;  2WAF A;  1A04 A;  2DA6 A;  4RA2 A;  3RSN A;  5E3O A;  1R1V A;  2DBB A;  2Q8K A;  4DZP A;  1R71 A;  1I6X A;  4JX4 A;  3CCE I;  3GTG J;  3TED A;  3GTQ J;  1MDM A;  1XN7 A;  5FFX A;  2LTP A;  2EWN A;  4BHB A;  4F91 B;  2QEN A;  1ENH A;  3OS2 A;  1FMW A;  2HOA A;  2P81 A;  1N77 A;  2O5R A;  3F21 A;  3E6C C;  3K2A A;  4M3B A;  3HZJ A;  1N78 A;  2LF8 A;  1VI0 A;  3IC7 A;  4HF0 A;  3I0T A;  3HSE A;  2ME6 A;  4HV6 A;  1T38 A;  1HW2 A;  2KFD A;  2ZNZ A;  4LLN A;  3ZQF A;  2YUS A;  3GZ5 A;  4X6A J;  1FY7 A;  4RAF A;  4E7J A;  3RQI A;  3COA C;  3CF2 A;  2X1E A;  3ZGK A;  4U0W A;  2R7V A;  4IXA A;  1QQI A;  2BOL A;  4LLG F;  4UUT A;  5ICF A;  4AC0 A;  1V5E A;  3MQ0 A;  1FT9 A;  2L7F P;  3MKW B;  1FX7 A;  1UHS A;  2STW A;  2VZN A;  4XBF A;  3FMQ A;  1A5J A;  2Q1Z B;  2VJI A;  3PSI A;  4GYI A;  2DAO A;  3GBG A;  4KT6 A;  2MD0 A;  4XLP F;  4NC7 A;  3S3N A;  4HBL A;  1QO0 D;  5FGM A;  3DPL C;  3AKZ A;  2XPU A;  3IAS 2;  3FF5 A;  4X0G A;  5M3F J;  4DW6 A;  4X1E A;  2VBY A;  3CCY A;  4KJZ A;  2L9V A;  3LMM A;  3FXU A;  3DBL B;  4MTE A;  4ABZ A;  1TWA J;  2E5N A;  2E2I J;  1XX5 A;  5J47 A;  5IYB J;  3V42 A;  1GXQ A;  2LD5 A;  1V4R A;  3K0L A;  5CVR A;  2Z33 A;  5HLI A;  4GDF A;  1I1G A;  2V1U A;  3F9K A;  1G6N A;  5GP9 A;  4C30 A;  4AD9 A;  4F55 A;  4I01 A;  1JTY A;  2M0C A;  3JSO A;  4RLF A;  5EEG A;  2R7Z J;  3O3K A;  3V7C A;  2P5V A;  4PSX A;  2VJ4 A;  2WB1 N;  3T0Y A;  1S8N A;  3L2C A;  3ZPL A;  5DYM A;  1SVL A;  4OIR F;  3DFG A;  1XGO A;  3ZMZ A;  2IBD A;  1FP2 A;  4DBR A;  2JA6 J;  4BYY A;  3TOA A;  2DYR H;  3EUH C;  1BI3 A;  1YLF A;  3ZMS A;  4YEL A;  1V55 H;  2KZG A;  2QQB A;  3PNV A;  1MMD A;  4A3L J;  1PJR A;  2Z2S B;  4BEH B;  4F3Q A;  3SJM A;  4Q48 A;  1QBJ A;  1IXC A;  2W84 A;  2FML A;  3A02 A;  2EB7 A;  3ASN H;  3MEX A;  1DPU A;  1G3S A;  4Q5S F;  1UG0 A;  4CCL A;  1LPQ A;  1F5T A;  2XB0 X;  2XGE A;  1X2N A;  1RI7 A;  3S8P A;  4I0B A;  4BKX A;  3KFW X;  3SEQ A;  2ELJ A;  1G3Y A;  4O6J A;  4CCJ A;  2EFW A;  5CQE A;  4UV9 A;  1YS7 A;  2A61 A;  2D2W A;  4XOT A;  4FQG A;  3IH3 A;  3DEU A;  4XON A;  2R7U A;  4HSR A;  3SXY A;  3TMO A;  2HOE A;  4NUK A;  1P6R A;  2BXY A;  1KU9 A;  4BE1 A;  1EA3 A;  1YI2 I;  1XG1 A;  5K5R A;  4ZTF A;  3BR6 A;  1G3W A;  5CVU A;  1MNE A;  5LRR A;  4A0X A;  4D7M A;  1T8I A;  1JGG A;  2QSG X;  3DEW A;  1P4X A;  2JA7 J;  3WOD F;  3W3C A;  3LSH A;  5CLS A;  3C2H A;  4EJV A;  3NWS A;  2KRC A;  1SC7 A;  4KMU X;  2OCE A;  3K1N A;  1MBF A;  2L7Z A;  5CVI A;  4II2 A;  2FRH A;  4CYC A;  2B0L A;  2LBF A;  1KA8 A;  3OL3 A;  5DCM B;  2IJL A;  4BJT A;  2RRE A;  5J8C A;  3KYC B;  3TO7 A;  3AL0 C;  4MHG A;  2L7M P;  3WTU C;  2D1H A;  1IRF A;  2K9S A;  1SVM A;  4HNU A;  5EJC A;  3ZQI A;  1LDJ A;  5LLQ A;  1T0F A;  4Y33 A;  1K78 A;  5JVG F;  3G1O A;  1WKM A;  2BVM A;  4I2O A;  1YHQ I;  3S32 A;  4Y52 J;  2QM3 A;  1XTA A;  2ZCW A;  4LIT A;  5HLH A;  3J7Z I;  1IF1 A;  3FM5 A;  1O3R A;  1R4N B;  2GOM A;  3ROU A;  2DMQ A;  3FXQ A;  2FOK A;  2W85 A;  2HKX A;  1BI2 A;  1WRJ A;  4ZC3 A;  4G7O F;  3HOT A;  2JT1 A;  1EH8 A;  1A36 A;  1WCM J;  2GIV A;  3IHU A;  3OYA A;  4E7K A;  3A1Y A;  1B72 B;  4BJ5 C;  3S1Q J;  4LFU A;  5EZH A;  2IA2 A;  2UWM A;  1RES A;  3BY6 A;  4U0V A;  4A3G J;  5CKT A;  3BPX A;  4CYD A;  4ESJ A;  2EZH A;  2PJP A;  3K4L A;  5LD2 C;  2E2J J;  3BR3 A;  4IHY A;  3OYL A;  3EPZ A;  2XAU A;  5IOY A;  3G4S I;  1QU3 A;  5F0H A;  1J0R A;  1NG7 A;  2GIZ A;  4OAZ A;  1QRY A;  1JUP A;  5J8F A;  1GV2 A;  2M0M A;  4AYB A;  5BQT A;  2DYS H;  2E1M B;  5LHG A;  4DQ2 A;  5FFZ A;  4RB0 A;  4WF2 A;  1B9M A;  2IGO A;  4L9T A;  4AIW A;  1K79 A;  1ZKG A;  4IOC F;  4G7H F;  3S6S A;  3OSG A;  2Q2E A;  1STZ A;  3ABT A;  3PFI A;  5L3D A;  2BW3 B;  3HOZ J;  2K9N A;  2YU3 A;  2WAQ A;  2E7X A;  3E5U A;  1JKO C;  4UVA A;  5GAD J;  1U78 A;  1D5V A;  1U5T A;  3BG5 A;  1SVO A;  2VPL A;  1VQ8 I;  4F93 B;  3HRU A;  3HTU A;  5JI6 A;  4Y15 A;  1VTN C;  4PGG A;  3DP7 A;  1AHD P;  3MAJ A;  2MFZ A;  1X3U A;  1DGR M;  1T2K A;  1MBJ A;  3GTJ J;  2X1D A;  4Z2Y A;  3S16 J;  3K70 C;  1SAU A;  2DXI A;  3G1L A;  2L9R A;  1W36 D;  1ETW A;  1ETX A;  3RDI A;  2AHQ A;  4NC6 A;  1VQO I;  1XGN A;  2O8K A;  4XN0 A;  2PMH A;  1FTT A;  1OKR A;  2CQK A;  1UCR A;  2C6Y A;  1Y8Q B;  3CLO A;  3D5L A;  2CSO A;  1QNT A;  4ETS A;  3ZQC A;  2DU9 A;  2A05 A;  2CUE A;  2LC2 A;  2HKO A;  3M8E A;  1R22 A;  2ZXH A;  1OCP A;  4EV0 A;  4OIN F;  1FLI A;  3P5J A;  3EYY A;  1JXS A;  3C2B A;  2LNB A;  1BL0 A;  2W1O A;  5ETE A;  1OJL A;  3DWL E;  4L5I A;  1KU3 A;  5H2F C;  1HKT A;  4Y13 A;  2DJI A;  2DPU A;  3EUH A;  1WJE A;  4M3D A;  5E18 F;  2VE9 A;  4JP0 A;  4KIS A;  2WV0 A;  1OCC H;  2EFO A;  5KVR A;  1IN6 A;  1R5H A;  4LLL A;  3OYD A;  4M9S A;  1WQ2 A;  1E3P A;  1GUU A;  5BS6 A;  1PYV A;  2J5O A;  4PZJ A;  1FIP A;  5BNG A;  1UB9 A;  1XGM A;  1PP7 U;  1FYL A;  4ITV A;  1SMY F;  1U3E M;  2BY3 A;  3EDP A;  5J4Y A;  1SFX A;  1DQU A;  3B73 A;  4AM3 A;  1R49 A;  2PBI A;  3R60 A;  1WH5 A;  3HOS A;  2MG4 A;  1PUF A;  2XGD A;  3BTC A;  1KON A;  1YW7 A;  2VC1 A;  2O3F A;  1SAN A;  1Z9C A;  4A3F J;  3OYG A;  2O03 A;  2M8G X;  2KP6 A;  5JFR A;  1O4X A;  3JRE A;  3RI4 A;  5BOX A;  2ZJQ F;  3S1N J;  2XAG A;  2VBW A;  1PVE A;  2L0K A;  5TRD A;  1XSV A;  1YX3 A;  1Z3Y A;  5DUI A;  4CCN A;  2DFI A;  3REO A;  5E3L A;  4P9F A;  4BE0 A;  4XK4 A;  1XMA A;  5FLX K;  4I0A A;  3WU0 A;  5HS7 A;  1DPR A;  2RNJ A;  2TCT A;  4CZC A;  3FBN B;  3FMS A;  5LFA A;  5IY5 H;  1WPK A;  5ED4 A;  1OLT A;  4FIS A;  3AAF A;  2E60 A;  4ON0 A;  1KQ9 A;  1QNX A;  4XMY A;  1IN5 A;  3MKZ A;  2R5Y A;  4BBR J;  4HQE A;  1OR7 C;  4BUP A;  1WGX A;  2VLA A;  1X1B A;  4N9I A;  4ZYD A;  3GFJ A;  2P4W A;  3CES A;  3MKY B;  4YIR X;  1RKW A;  4NUB A;  1Z6T A;  1ZHF A;  3F6O A;  2YU9 J;  5DCF A;  4RBO A;  3OOP A;  3KX2 A;  4UHT A;  1MW7 A;  4HST A;  2COB A;  1PP8 F;  1KYZ A;  3CMM A;  2K7L A;  2VE8 A;  2I8D A;  4HG2 A;  2E35 A;  3KLN A;  2JMW A;  2D45 A;  3CC2 I;  3JRB A;  4FX4 A;  2QLZ A;  4JX5 A;  3MWM A;  5L3F A;  1QA6 A;  3CQZ J;  1MKM A;  2ICW G;  4M71 A;  1YYV A;  3HB9 A;  4CXF A;  4QPQ A;  4E70 A;  5KNL A;  1G8X A;  2PQ8 A;  2PI0 A;  2QWW A;  4NQW A;  5E1X A;  4BGD A;  1YRN A;  3TO9 A;  2PFB A;  3O2P E;  2AS5 F;  2X9D A;  2IP2 A;  5FD6 A;  3CCV I;  1ZR2 A;  4NDL A;  2V9K A;  4BNC A;  2EIN H;  5IP6 A;  1IRG A;  4AWX B;  1WJA A;  3TQN A;  1LFU P;  1R58 A;  1M1E B;  2O6G E;  4RAZ A;  1UHW A;  5EGO B;  3S15 J;  2V6E A;  4ZDP A;  4CA0 A;  3I4N J;  3TOB A;  3MKL A;  2XF7 A;  4PUS A;  1TNT A;  1DU0 A;  2VT3 A;  3HPG A;  1LNW A;  2L2O A;  4UB8 C;  2VJJ A;  2P7C B;  3H5N A;  3RPU D;  2H1K A;  1IC8 A;  5HNH A;  4ZTJ A;  1I3Q J;  3CCS I;  1RZ4 A;  5HLG A;  2MSY A;  2L4M A;  2X85 A;  3ZQG A;  1W0U A;  2JA8 J;  3P7N A;  3VEP A;  3MZY A;  1VQP I;  1WJD A;  3BC8 A;  1IDZ A;  4XLF A;  1LVA A;  4E6K G;  2HYG D;  4IQ4 A;  1H9T A;  2H27 A;  1MJ9 A;  2UXX A;  2K02 A;  1OCR H;  2NOG A;  2P8T A;  1G59 A;  1DGW Y;  2VKH A;  4LG0 B;  3CCM I;  2VBX A;  2WWY A;  1BC7 C;  1R1T A;  2XAQ A;  1IO2 A;  2XB5 A;  3QWL A;  1XD7 A;  3JTH A;  1Z77 A;  4IRG A;  2GZW A;  2DOA A;  1DDN A;  3T8T A;  3H3Z A;  1W0T A;  4XSZ F;  2E19 A;  5C4X J;  1JI8 A;  5F08 A;  4E7S A;  1TWH J;  2E5Z A;  3GF2 A;  4EGZ A;  3H5R A;  5FLX Z;  4DGW B;  2LK2 A;  2QEX I;  1IXR C;  2NS8 A;  4UVC A;  3H9J A;  4BU2 A;  1K83 J;  2CO5 A;  1SD6 A;  4HAM A;  2A6T A;  4L5E A;  4PJL A;  3JRI A;  2QBY A;  4PDK A;  3B6A A;  3DPT A;  4II3 A;  2HFH A;  2YPR A;  4ZYG A;  2VQH A;  1VQ9 I;  1WSU A;  3ELK A;  1UJ8 A;  1VZ0 A;  3HM5 A;  1RPW A;  3EQL F;  3OYC A;  4A3M J;  3U3N C;  4A3B J;  2IEK A;  2L54 A;  1GVJ A;  5HNF A;  2JA5 J;  3J7A Y;  1IGN A;  2M34 A;  2VI6 A;  2IA0 A;  2WBM A;  3LA3 A;  5M5X J;  5CPR B;  2VC0 A;  5B1A H;  2DMU A;  2OQG A;  3BG7 A;  1T56 A;  2ZNY A;  3HOU J;  2PLY A;  1FYK A;  1CQT A;  2ISY A;  3CUQ C;  1XC5 A;  3U1K A;  3WG7 H;  1O7L A;  4DJA A;  3IV5 A;  3S1R J;  2XSJ C;  1MDM B;  2F5V A;  1JUS A;  4AVZ A;  4E4H A;  2CH0 A;  2KT0 A;  4NB5 A;  4RLQ A;  1N75 A;  1X1C A;  1WH7 A;  1JGS A;  5ICC A;  3KZZ A;  3IKV A;  4C2U A;  4OMY A;  2XF5 A;  1ZGJ A;  1HST A;  3JRA A;  1AKH A;  2X0L A;  5HOO A;  4RM2 A;  1TT5 B;  3QAH A;  1LJ9 A;  3CJN A;  3JCU C;  3LNQ A;  4AYB N;  3IAM 2;  4U7D A;  3QP6 A;  2XPV A;  4R79 A;  3HSR A;  4EEF G;  2HVQ A;  3PQK A;  4WK8 F;  1OR7 A;  4A3K J;  4BJ6 C;  2V1N A;  3L2V A;  2HQR A;  1YG2 A;  3BWG A;  2A5Y B;  3O8H A;  4BL0 B;  2M8E A;  1WZ2 A;  3I9V 2;  3WG9 A;  1LVK A;  1WJC A;  1J9I A;  2X48 A;  3W6J B;  3BRO A;  3JRF A;  2R93 J;  1MBG A;  2R7O A;  3KP2 A;  1OIS A;  4YFK F;  2O8X A;  3VPR A;  3MZH A;  5H20 A;  1NHA A;  2DDA A;  2L9S A;  4WXD A;  1D0Z A;  2ZJR F;  2FNA A;  1ONV A;  4HPQ A;  1BOB A;  2X6W A;  2HPI A;  3HTS B;  3BJO A;  3HBL A;  3QYB A;  1T6S A;  1YE9 A;  2X4H A;  5EG0 A;  3FXJ A;  3HIF A;  3GTP J;  4L5J A;  3GTM J;  1ZLK A;  3DKX A;  4F92 B;  2HEO A;  1X58 A;  4QPO A;  5CJ9 A;  2DK8 A;  2MLG A;  5DDG A;  3HUG A;  5GTI C;  1VFC A;  5DM6 F;  4C2M J;  1IZ1 A;  4JYK A;  3ZMT A;  2GWR A;  2BY0 A;  3OYB A;  2E7W A;  3HXL A;  4YFX F;  4MQV A;  4Y3O A;  3U21 A;  3D1N I;  1ZRD A;  2G7H A;  1I50 J;  2CV1 A;  3TP3 A;  3HJE A;  5HS9 A;  2DPD A;  2O61 A;  2DFE A;  3KEY A;  1UZC A;  4LD5 A;  2PEX A;  3BR0 A;  2OAZ A;  5EDN A;  5L3G A;  3SZP A;  3ULQ B;  2CQN A;  2O0Y A;  2A6H F;  3OYE A;  4FX0 A;  4BE2 A;  4HDV A;  3DKY A;  3LSK A;  1QVT A;  4D5C A;  1RIO H;  4KFC A;  3IUO A;  2XPW A;  2XAH A;  3JSP A;  2K27 A;  2K40 A;  5ICE A;  2HWV A;  4XLH A;  3SEZ A;  1TLH B;  3V8K A;  3R0J A;  3CO6 C;  1TT0 A;  2OUM A;  5LEJ A;  5FRN A;  2Y31 A;  2E34 A;  3I71 A;  5F04 A;  1MSE C;  4C3H J;  2FBH A;  4PGH A;  3WTY C;  2ESH A;  3KP5 A;  1F4K A;  1E0E A;  3N05 A;  2HVR A;  1ZR4 A;  1HA8 A;  3M7G A;  3H36 A;  4DIQ A;  3G3Z A;  3LWF A;  1TW2 A;  3SDG A;  3IRQ A;  3BT9 A;  2KHM A;  2V9P A;  3SFZ A;  1BW6 A;  5DV5 A;  3JRC A;  1TWG J;  2IVM A;  3TL4 X;  3RIR A;  5KHD A;  2MW8 A;  1U5T C;  3CDH A;  3D5S C;  4GRI A;  2H6C A;  3OY9 A;  2HYF A;  4MEY F;  4ESB A;  1SAX A;  2HDW A;  2E36 A;  2MYS A;  3VDX A;  3Q2U A;  1FIA A;  5D4R A;  3KZY A;  3RJP A;  5D5X B;  4F52 A;  2CQ7 A;  3P9C A;  5DTD A;  1D5Y A;  2LBF B;  2PMU A;  1MBK A;  2LYC A;  1QHG A;  4G9Y A;  4OAY A;  3VB2 A;  5M5Y J;  3G1M A;  4B3X A;  2HU9 A;  4FET A;  1F43 A;  3DBR B;  1RNL A;  3V7S A;  2CUJ A;  4IOA F;  2M45 A;  1K78 B;  4J00 A;  4JX6 A;  4BQN A;  5LBQ A;  2FE3 A;  1BR2 A;  1UHM A;  3WTZ A;  2RKH A;  4NC8 A;  4M6Y A;  4IX7 A;  3PM1 A;  4ANJ A;  2H8W A;  2R4G A;  3L1P A;  3BG3 A;  3KP6 A;  3A01 A;  1P2F A;  3MVP A;  5HOD A;  2P5L C;  1FOX A;  2B63 J;  2V1X A;  5K7H A;  1EF4 A;  2CRG A;  2LKX A;  3LSG A;  3HHG A;  4RB1 A;  3S6U A;  3CUQ A;  3RYR A;  2FU4 A;  1WJB A;  3DU5 A;  1QZY A;  3S93 A;  1ZK8 A;  4PCQ A;  1G4D A;  2JPC A;  4B4C A;  2FD5 A;  3BZK A;  1JT0 A;  3OSF A;  2DTZ A;  1GXP A;  2V26 A;  5F0F A;  5FRM A;  4C3J J;  2LY2 A;  3CCJ I;  2JRM A;  1U0J A;  4UV8 A;  2B9S A;  3JRH A;  1Y8R B;  4UUS A;  3RQ4 A;  3DLA A;  2LDU A;  5GAG J;  2ZBK A;  2XC7 A;  1FSH A;  4S05 A;  4BDY A;  3ZN0 A;  1MJA A;  4M73 A;  1H89 C;  3FDY A;  4CHU A;  4JOM A;  2A5W A;  3VOE A;  3VWB A;  1ON2 A;  3MMY B;  1VQM I;  3MFK A;  1H88 C;  1UG2 A;  3K4M A;  4AID A;  3GFI A;  2Q2E B;  2P6S A;  5JYS A;  3UKG A;  4H0A A;  4B1R A;  4UUV A;  3R0A A;  1MGT A;  1P7J A;  5K5O A;  1PUE E;  2I10 A;  4C2T A;  3A2K A;  2K9Q A;  5J3L A;  1F36 A;  2NS0 A;  2K9M A;  1HF0 A;  2R7W A;  4AU7 A;  1KYW A;  2HYJ A;  3K70 D;  3F72 A;  2DA4 A;  2AO9 A;  2RC4 A;  2Z99 A;  2KIF A;  3LQQ A;  2A68 F;  3IKT A;  2IS1 A;  3I54 A;  3IH4 A;  2L02 A;  4BH9 A;  2XKO A;  5F6F A;  3WHB A;  3W2A A;  2KIM A;  1A6Q A;  4NUN A;  1KQ0 A;  3JW4 A;  1JKP C;  2ADU A;  2FQ4 A;  1Z7U A;  4HW0 A;  4XNF A;  2AQF A;  2X1C A;  4CCM A;  4YG2 F;  4ZZD A;  1ZYR F;  3FK7 A;  4G12 A;  4L9N A;  4WWC A;  3F23 A;  1YIJ I;  1A31 A;  2JQ7 A;  4V19 K;  3CP2 A;  1UEL B;  2JRT A;  2ELH A;  1Z05 A;  2KRF A;  1ZAO A;  3ABL H;  3HYI A;  3F8N A;  1TQP A;  3U9G A;  3PQJ A;  3GZ6 A;  4N9H A;  5FKM A;  1FMV A;  5DM7 F;  3E5Q A;  1HW1 A;  1LQ1 A;  2LF7 A;  2QYO A;  4MEX F;  4BQQ A;  1ULY A;  2EIK H;  2JVH A;  3ZQH A;  4XQF A;  1O3S A;  3SQN A;  2NVT J;  2IS6 A;  2ID3 A;  1ZAR A;  3HHH A;  5FLM J;  3E6B A;  3GFL A;  3L2U A;  3ZQQ A;  2Z16 A;  4NUI A;  1MND A;  2QQ8 A;  4MFD A;  1OCT C;  2HXI A;  4CO8 A;  2ZC2 A;  3CJQ B;  4O5V A;  3M07 A;  5CYV A;  3HSF A;  2R7X A;  2DN0 A;  2KKO A;  3V8J A;  3HEF A;  3MD2 A;  1K61 A;  4IKF A;  3IRR A;  1ETV A;  3WGI A;  3FBI B;  2W82 A;  3NRV A;  2JZY A;  1FZP B;  1TW3 A;  3H5A A;  3TW7 A;  1TC3 C;  3LFK A;  2WV1 A;  3GWZ A;  2DQL A;  2XF6 A;  3CUO A;  3GW2 A;  2Y0M A;  3QU3 A;  2CW7 A;  1QZE A;  1ACI A;  3HKZ N;  2KDZ A;  4O3M A;  1USS A;  1OCO H;  1N25 A;  2LG4 A;  1PUF B;  3CJR B;  4D9J A;  2R7R A;  3A0H C;  3G71 I;  3S3M A;  5D6E A;  3OYK A;  3LSR A;  1V54 H;  2MA3 A;  1L0O C;  2MD5 A;  3ERM A;  3T5X A;  1YTY A;  2IT0 A;  2CMP A;  2OCC H;  5IT3 A;  1ON1 A;  3LL7 A;  2EV0 A;  3IH2 A;  4BEH A;  1JE8 A;  2NNN A;  3BR5 A;  3I56 I;  1Z6R A;  1R23 A;  3IWZ A;  2Y48 A;  1X1P A;  2KZV A;  4G94 A;  1GVD A;  1VQ5 I;  3BG9 A;  1L3L A;  2LFB A;  5HDN A;  4PFO A;  4ENN A;  4FTH A;  4MO7 A;  4JBA A;  2J5P A;  3Q2R A;  1ZG5 A;  2L01 A;  2RGV A;  1HDD C;  4LOC A;  5FO5 A;  1QPM A;  2F4I A;  3RCO A;  3EET A;  2M7A A;  5IYC J;  5AIQ A;  1EH7 A;  9ANT A;  2MBF A;  4NNJ A;  1IW7 F;  2ZO4 A;  3CDL A;  3VSL A;  3F8F A;  3I55 I;  2VN2 A;  3AL0 B;  2EIJ H;  2LRE A;  4KUM A;  4L9J A;  1DP3 A;  3KCC A;  2R5Y B;  1D0X A;  4XLN F;  5HDK A;  2R7T A;  2EV5 A;  3ZQL A;  2OV7 A;  4A5M A;  1JUM A;  2HQA A;  1X4P A;  5B1B H;  3EYI A;  2F5C A;  2JPB A;  2YR2 A;  1P4A A;  2ZXJ A;  2QCO A;  3QPT A;  3NAU A;  4IRH A;  2VPR A;  1IRZ A;  3Q3S A;  3CTA A;  4LIV A;  4PJN A;  3J80 K;  2PJR A;  2QKM B;  1APL C;  2F5F A;  2HGC A;  4IHW A;  3E5X A;  3J81 K;  3N97 A;  2EIM H;  4IL6 C;  4CGZ A;  3HG9 A;  4XID A;  3CCR I;  4D5F A;  1ZGA A;  2F4O B;  1ZRC A;  4H4K C;  3OIQ A;  4R8H A;  2VKE A;  3DTI A;  3RZO J;  1IDY A;  2FMY A;  1A35 A;  3QQA A;  1XGS A;  1LE8 A;  1W5S A;  2XUB A;  2Z1D A;  3FXO A;  3I59 A;  4CH7 A;  4PK4 A;  4I7H A;  2ZJ2 A;  4A93 J;  2E1N A;  1I39 A;  5HDG A;  5K7Z A;  1UST A;  1B1B A;  4LK1 F;  3ZMV A;  3GCM A;  1SMB A;  5F64 A;  2A6E F;  1HXD A;  3U3U C;  1VF9 A;  4J01 A;  2LLK A;  5FJ8 J;  2V9V A;  4IHT A;  3CDI A;  3RZD J;  2EA4 A;  2XIG A;  2XDV A;  4RGS A;  4M6V A;  5ERI A;  2A3S A;  4OIO F;  3FKI J;  4LK0 F;  1D1C A;  1W5C C;  1SMT A;  2Y2Z A;  2VQC A;  4QIW N;  1ZEL A;  2FXA A;  2GA2 A;  3LAJ A;  1ETO A;  5J1U A;  4B43 A;  3QRF F;  3KE2 A;  2R7F A;  3I3L A;  3OYF A;  3BP8 A;  3CLQ A;  2EIL H;  2VOP A;  1TBX A;  1B8I B;  4QWQ A;  3CO7 C;  1KU7 A;  4FE7 A;  1Z67 A;  2DA7 A;  2R5Z A;  4OU0 A;  4UB6 C;  2ZME C;  3DEE A;  1JJ6 C;  2NS7 A;  3J7A O;  4G6D A;  2BY2 A;  4BBS J;  4A6D A;  3GYH X;  2VL8 A;  2BW3 A;  2ETH A;  2DOE A;  2HZD A;  2CV0 A;  3H0D A;  1E2X A;  2CYY A;  4P96 A;  3BZC A;  4Q4Z F;  4I6Z A;  3JR9 A;  3Q0V A;  2NYX A;  2F5D A;  1H9G A;  3W2W A;  1X1A A;  3K6G A;  3QYF A;  3J7Y J;  3SZT A;  4NUO A;  3CF5 F;  3PFY A;  4M3E A;  4DYR A;  1K4T A;  3K4C A;  4EQQ A;  3HDD A;  2KLO A;  5FKN A;  2PX9 A;  3K9T A;  1IV6 A;  4B44 A;  2Z9O A;  3S2H J;  3RPQ A;  3L2Q A;  2QBY B;  2ECB A;  4G6T B;  3PIP F;  3BZ6 A;  2NVX J;  3VSK A;  4XOP A;  2GOX B;  4LB6 B;  3FHZ A;  5CVV A;  4ZDO A;  1T95 A;  4RB3 C;  1ODD A;  1RKT A;  2B7E A;  2X51 A;  2O9L A;  1J59 A;  4U88 A;  2Q0O A;  2DA2 A;  2ESN A;  1LFP A;  5E79 C;  4IJA A;  2TRT A;  4HX8 A;  2G7U A;  4FHT A;  2GXA A;  1W7P A;  3DXJ F;  2DW4 A;  3WE3 A;  4YIF A;  4L0Z B;  5BMZ A;  2YX7 A;  2LH9 A;  1J7K A;  4IO9 F;  1X4O A;  3E7L A;  4A12 A;  3B6C A;  1ZRF A;  2DA3 A;  3FIW A;  3J80 Z;  1R4M B;  3CD6 I;  5ILU A;  3MZ8 A;  1BIB A;  1HDP A;  2IS2 A;  2AQE A;  4M72 A;  1I5Z A;  1U9N A;  3J81 Z;  2HTJ A;  2MGQ A;  2Y9Y A;  2BVL A;  5M5W J;  2GA1 A;  1GDT A;  1U6G A;  2CFO A;  4KIG A;  4HNT A;  5IP9 J;  1CF7 A;  4HV5 A;  2HR3 A;  1HC8 A;  2MC3 A;  1AKH B;  2ZFW A;  2GQQ A;  4RB2 C;  4EVI A;  4E7L A;  2BYV E;  2G0E A;  3GX4 X;  1FBS A;  1RR7 A;  5DD8 A;  4QLC U;  3GME A;  1FYM A;  1SD7 A;  1AWC A;  3SDB A;  1ITY A;  1YX5 A;  4LIU A;  3HOX J;  3BCB A;  1MBE A;  2IGK A;  2QVO A;  1FTZ A;  3H3V K;  2K5C A;  3GTK J;  2VQG A;  2R7Q A;  2DO7 A;  4G8X A;  4CZZ A;  1X19 A;  3ZN1 A;  4I76 A;  2PG4 A;  4C3I J;  1RUO A;  5J40 A;  2D5V A;  2XAF A;  5DEQ A;  4FT8 A;  2M1B A;  4NHJ A;  5IPA A;  3L2R A;  4L9V A;  4NBQ A;  1X3W B;  1JKR C;  2VKD A;  2YSR A;  5LHI A;  5J1R A;  1NK2 P;  1BW5 A;  4A0Y A;  1YW8 A;  1LDD A;  3LST A;  1FPQ A;  5EG0 B;  1ZG1 A;  1ERD A;  3QOD A;  2ZXW H;  2QQ9 A;  1MH4 A;  4HX4 A;  2QSH X;  3PNT A;  1SFU A;  1TTY A;  3FMR A;  2H94 A;  2LSO A;  5ICG A;  3FXL A;  4GYG A;  1RC9 A;  2DT5 A;  2BZT A;  3FM3 A;  1P7I A;  2CG4 A;  3BR1 A;  2CWE A;  2AXL A;  1XSX A;  3K7A J;  2IW5 A;  1BR4 A;  3HUG B;  4GCV A;  3DV8 A;  4RAY A;  2OF7 A;  2Y0S N;  1BOA A;  1U9O A;  1R6R A;  3GZN B;  4V2F A;  5H6Q A;  2LVS A;  3ZXS A;  2IPQ X;  2IGM A;  2W7N A;  3GTL J;  1FEX A;  3K1M A;  4KT5 C;  1QPI A;  5FKK A;  3R4K A;  2EA2 A;  5E1W A;  1BJA A;  1R7J A;  5GAE J;  3OYN A;  1NK3 P;  4BQO A;  3LSM A;  1MBH A;  3D0S A;  3HKZ A;  4E7Z A;  3ZMD A;  4OIP F;  3BTI A;  1TZL A;  4JK1 X;  3TBI A;  5L3B A;  4MLO A;  3OIP A;  1Z0X A;  1WJ5 A;  1I1S A;  3FKJ A;  5JLX A;  4ZZL A;  3CCL I;  4RGR A;  3OMY A;  2HOS A;  4N4N B;  4XLE A;  2EZI A;  4Q47 A;  3LFU A;  3DKW A;  4XM3 A;  2FBI A;  2WY8 Q;  2WY7 Q;  2KIS A;  4IF4 A;  3UNG C;  2Y9Z A;  4A0Z A;  3KYD B;  3AG2 H;  3VYR B;  4XRF A;  3F8M A;  2QSF X;  1G2H A;  4BY7 J;  2LKP A;  2ZME A;  4WX9 A;  1IG7 A;  4AIJ A;  4CIC A;  4BDZ A;  3KYL A;  2NVY J;  1Z1D A;  1OYW A;  3M1E A;  3BTL A;  4XKV A;  3SFI A;  1LFB A;  4PFP A;  2NOJ B;  2JJ7 A;  4ZH4 F;  2OTL I;  2XAS A;  2FF4 A;  4U0Y A;  3OOU A;  2BY1 A;  2XRL A;  4MFE A;  4MTD A;  4A3I J;  2RAE A;  4RGU A;  4EJT A;  3CZ6 A;  4B09 A;  2NVQ J;  3LA7 A;  2K3P A;  2N8G A;  3LOC A;  3WGH A;  2W25 A;  2ZJP F;  1IN7 A;  2DDB A;  2XRN A;  3E6M A;  2D1V A;  1U8R A;  1BM9 A;  3HRT A;  1HKS A;  4EMS A;  3ECO A;  5JR3 A;  1OCZ H;  4HDU A;  3K4J A;  1SFK A;  3D5R C;  4RDU A;  4LGW A;  4KA4 A;  1NTC A;  4G6Q A;  4ENK A;  1Y56 A;  3JTG A;  2ZB9 A;  2FJ1 A;  3WE2 A;  3RKQ A;  2P5K A;  3BTJ A;  1LEA A;  1QZZ A;  2OQR A;  4OIQ F;  1WJF A;  3Q5F A;  5A2Q K;  3DBH B;  5L3E A;  1K4S A;  1UMQ A;  2BEO A;  1XB4 A;  3C18 A;  2K3F A;  1BI1 A;  4I09 A;  1EJ9 A;  3A01 B;  1H8A C;  2OPT A;  3L09 A;  1R5G A;  2JN6 A;  2Y75 A;  4BXF A;  3F0C A;  4M74 A;  2K4B A;  2HDD A;  3CUQ B;  4RMN A;  3L2W A;  3OYM A;  4LY5 A;  4M9X A;  4D1Q A;  2MAB A;  2VKV A;  3PUB A;  5TGT A;  1TP4 A;  1FWZ A;  4IEJ A;  1FOK A;  1ETK A;  2K86 A;  1TWF J;  3GVA A;  1QVU A;  3L00 A;  1WHU A;  5TJJ A;  4XLA A;  1IV8 A;  4P27 A;  1SD5 A;  2KRH A;  4UXN A;  4FAS D;  1IRX A;  2GBY A;  4CCO A;  5E8G A;  3GTO J;  4TPV A;  3I4M J;  4P55 A;  1J09 A;  3CMY A;  1O3T A;  1Y39 A;  1W1W E;  3A03 A;  3PJR A;  1BI0 A;  3GO5 A;  4ENM A;  1U8B A;  5D8L B;  5DD4 A;  1E17 A;  2F48 A;  3H1C A;  4N4O B;  5GPC A;  5D8K B;  3OYH A;  2K4J A;  3KP7 A;  2VXD A;  3IWF A;  4LG3 A;  3PIO F;  4P9U A;  1D0Y A;  2LMD A;  1S6L A;  2KIU A;  4KN7 X;  2M30 A;  2RNG A;  3Q9V A;  1HQC A;  1BJZ A;  3K4B A;  3ZR8 X;  1TWC J;  1RUN A;  3H0G J;  1MJB A;  2CV2 A;  3S1M J;  2HPM A;  4P1W A;  2DFF A;  3GFM A;  2WTE A;  1VQ6 I;  3FZV A;  2M7B A;  1ZRE A;  2DA1 A;  1XS9 A;  5D4S A;  2JWT A;  1U53 A;  2XGX A;  3OS1 A;  3SHF A;  5J6X A;  1BR1 A;  2DMT A;  1FP1 D;  2I5U A;  4MGR A;  4EJO A;  5EEH A;  3P9K A;  4DYC A;  3OWT A;  2EFQ A;  4HRI A;  2E2H J;  2UXN A;  4E7H A;  2HXO A;  4CYC B;  3GLL A;  3HC7 A;  2OU2 A;  4R1H A;  5F1J A;  1EH6 A;  2M2E A;  1RRJ A;  4CSW A;  2F6C A;  3C3W A;  4N0B A;  1R5I D;  1FC3 A;  5HS8 A;  3B02 A;  3ZOB A;  3LAP A;  3QU6 A;  2KQR A;  1EKE A;  3SYT A;  1SFO J;  3TW6 A;  2ZKZ A;  3M4O J;  5F0C A;  4EAT A;  3HOY J;  2OZ6 A;  1YO5 C;  4JQF A;  4DOZ A;  3I4P A;  5C3E J;  4YEJ A;  1EV7 A;  3WTS C;  3FIS A;  5JHU A;  2JA2 A;  1FOW A;  2VBZ A;  2DTR A;  1X3Z B;  1SFE A;  1E3H A;  2VOD A;  4XL9 A;  4A69 C;  5K7F A;  5LGN A;  1XPX A;  5D5V B;  1G3T A;  3ABU A;  2XRO A;  1F9N A;  3C2G A;  5A2Q Z;  2NNY A;  3ZRG A;  4B48 A;  4XR6 A;  1W7P D;  1WFX A;  3JRD A;  2HS5 A;  1WI3 A;  1Z3X A;  3BCA A;  3ERE D;  2F5E A;  2CGP A;  5JHF A;  3KEQ A;  3R61 A;  2EZK A;  2BBY A;  4IRI A;  3DPU A;  2GXG A;  4L0Y B;  3H35 A;  4XRS A;  2BGC A;  4IHX A;  2F2E A;  1YIT I;  1MD0 A;  3G6E I;  1JJ8 C;  4IVN A;  2E71 A;  1OPC A;  3EUA A;  2E1O A;  3M9A A;  3GLX A;  1IN8 A;  2BHY A;  3M3Y J;  4PJM A;  4Y7N J;  3VYS B;  3X2Q H;  1J5Y A;  4BXX J;  1B59 A;  2FQ3 A;  5LRS A;  4A3D J;  3OL4 A;  2R0Q C;  4XIC A;  2KIQ A;  5CVJ A;  1U5T B;  3NQO A;  4XLC A;  2W24 A;  3QPH A;  1R1U A;  4HLY A;  3Q0W A;  1F1Z A;  1Z91 A;  2QGU A;  2K85 A;  4BY1 J;  1FSE A;  3NT8 A;  3DCF A;  2HQN A;  3WHC A;  3RPU A;  4KIF A;  1HBX G;  3LA2 A;  1POG A;  1D1A A;  1S7A A;  2G9W A;  1X1D A;  3ZCO A;  1YFH A;  1AOY A;  4B8X A;  2FUG 2;  2ZSI B;  3LSI A;  2E1M C;  3NAR A;  2Z3Y A;  3BG6 A;  3NEU A;  3CMA I;  4D7N A;  1FBU A;  3W6K B;  2EJR A;  4J19 A;  1ETQ A;  3I64 A;  4AIK A;  5IP7 J;  1YJW I;  1K6O A;  1AA7 A;  5FB2 A;  3S6V A;  3H9G A;  3CCQ I;  2RDP A;  5LHH A;  3QPS A;  3KP4 A;  2GXB A;  3LSJ A;  2IS4 A;  2Y0S A;  4I98 B;  1E3O C;  5FLV A;  2MH2 A;  1HOM A;  1ZN2 A;  4BAC A;  3F3X A;  1QHH D;  2W00 A;  5JLW A;  2PJR B;  3S3O A;  1Y0N A;  3VYU B;  2Y69 H;  3ASO H;  3LQR A;  3KPH A;  2M5W A;  1SEU A;  3E97 A;  3I5U A;  3RYP A;  4XKW A;  2GAU A;  1S72 I;  2NAZ A;  4EJW A;  1MMA A;  3VYT B;  3FXM A;  2L9N A;  1OFC X;  1ORK A;  3AG3 H;  1S9H A;  2FBK A;  4GGG A;  3CME I;  4A6E A;  1MMN A;  2EK5 A;  1D8K A;  3W2V A;  4HF1 A;  2BHZ A;  3BPV A;  1LE8 B;  2VUM J;  3I59 B;  1OYY A;  2BE5 F;  1LKX A;  2JSP A;  1OMI A;  2X6O A;  1BC8 C;  2GLO A;  1T08 B;  1FBQ A;  2FSW A;  1ZQ3 P;  1YOV B;  3DTE A;  4HZF A;  3K2Z A;  4D0P A;  3H92 A;  5E8I A;  1S5L C;  5TIS C;  3BJ6 A;  1S29 A;  5KAI C;  5D6F A;  4DNC A;  3AFH A;  1FNN A;  4DZJ A;  1XDS A;  1HKQ A;  2WAE A;  1Q1V A;  4AVP A;  2PMZ N;  3K4K A;  4UY8 I;  3HOW J;  3A0B C;  1V3F A;  4KIT B;  4HYE A;  4A3C J;  1WWX A;  3QPL A;  4TV7 A;  4C9Y A;  2L5Q A;  2M9H A;  4DYQ A;  5IT9 K;  2WA0 A;  4KYW A;  2XGC A;  1LB2 A;  1O57 A;  3Q9S A;  2JVG A;  1Y0U A;  3AG1 H;  3IP4 B;  1XMK A;  5FKL A;  2RN7 A;  2R5Z B;  1Y1W J;  2XHK A;  2MLK A;  4EM1 A;  2LY1 A;  2CQX A;  2FA5 A;  2ACJ A;  3HOV J;  1FOY A;  5E17 F;  2W4S A;  1IXS B;  3GUD A;  4KNY A;  2RVC A;  3S2D J;  2ID6 A;  4CCK A;  1KZH A;  1CGP A;  2CJJ A;  3O6B B;  3KET A;  1HLV A;  2RQQ A;  5GTH C;  1XCV A;  3K69 A;  4BHP A;  1YIO A;  3FXR A;  5J1Y A;  1XDU A;  2HQ5 A;  2MC4 A;  3E1S A;  2NVU B;  3CJT B;  4RS8 A;  4WXH A;  2LY9 A;  2QUF A;  4IHV A;  2UV1 A;  3NWT A;  3WU2 C;  4W97 A;  3HRS A;  1S7O A;  2V1D A;  4QSH A;  2F4M B;  2MH9 A;  4Z6Y A;  2V6C A;  3KZI C;  2FNP A;  3OIO A;  2JTV A;  3T8R A;  1ZH5 A;  3FX3 A;  3L7W A;  3OR1 C;  3TDZ C;  2DOF A;  4XRS G;  3TP0 A;  2QQA A;  1BA5 A;  5B5E C;  3PO2 J;  2O7O A;  5KK1 A;  5FKO A;  2IRF G;  2QF7 A;  3DQV C;  1CFE A;  5DCM A;  4WCG A;  1I27 A;  2ZXI A;  2KL4 A;  4WXC A;  2EBI A;  4HA8 A;  4FCY A;  3KLO A;  1T33 A;  1W4M A;  4ZDL A;  2CFX A;  1W7P B;  3U1D A;  5IOZ A;  3BR2 A;  4NQW B;  1HW5 A;  5E3M A;  4UVB A;  5GAH J;  1YRN B;  1JKQ C;  5LGT A;  4FE4 A;  4MNU A;  4HOB A;  3OV8 A;  4OMZ A;  3PO3 J;  1J75 A;  5BPI A;  1YJ9 I;  3ML6 A;  1MMS A;  4G2U A;  1Z21 A;  3ABM H;  1ETY A;  3I58 A;  4PJ0 C;  1JHH A;  1B72 A;  1KU2 A;  2BV6 A;  3DLL F;  4LJZ F;  4IPA A;  1Y1V J;  3WTW C;  1CF7 B;  1QGP A;  1ZG3 A;  2H6B A;  4BS9 A;  1O7F A;  3W6V A;  1MIJ A;  4G7Z F;  1S3J A;  2DCE A;  4GFB A;  2A69 F;  2DJN A;  5LEK A;  5F1R A;  1MH3 A;  2EFP A;  2K9L A;  2VQL A;  1YQA A;  3QYE A;  3HPH A;  3TGN A;  3JAM K;  3VOD A;  4UNO A;  3K4N A;  3SZG A;  2BXZ A;  1NG6 A;  3T1B A;  2STT A;  1W5T A;  2ELK A;  2FX0 A;  2HNH A;  3E3V A;  3M8J A;  2EH3 A;  2LRD A;  3F8B A;  4RAG A;  3DU6 A;  4AUX A;  4XRM A;  4E7I A;  4M3G A;  3WTV C;  1B9N A;  3BQY A;  1TNS A;  3BJA A;  4ZJZ A;  2JUG A;  1GHC A;  2ECC A;  3FK6 A;  4MIM A;  1HSJ A;  1VQL I;  2V7F A;  4XSX F;  2CW8 A;  1D1B A;  4L18 B;  1JHF A;  4ASN A;  3TDU C;  2KMU A;  2X6X A;  4ZYH A;  1T39 A;  5IT9 Z;  4KIB A;  1I6H J;  2CU7 A;  1D8J A;  3K1P A;  2H09 A;  2OA4 A;  2OZU A;  5J4V A;  1I3A A;  2XVC A;  1MZB A;  1IJW C;  1REP C;  2H8R A;  1K6Y A;  1AU7 A;  4ZYE A;  4EJU A;  1TQI A;  4BAY A;  3BLY A;  1WI9 A;  2V79 A;  2ZFU A;  5D5W B;  4K2E A;  4DBQ A;  2FOW A;  3FHN A;  3G2B A;  1W36 C;  4KDP A;  3C7J A;  4KIC A;  2ME0 A;  5C44 J;  2HI3 A;  4GO1 A;  3CCU I;  4EM2 A;  3S14 J;  4YII A;  3PNY A;  4F7Z A;  1BBY A;  2UUZ A;  2VIX A;  1V5F A;  2YX4 A;  5EZG A;  2H1L A;  3C1D A;  2DFH A;  2ZSH B;  2HTS A;  2WB1 A;  1P4W A; 
#chains in the Genus database with same CATH homology
 2CQ7 A;  3NT8 A;  4G2U A;  4P27 A;  1CFE A;  4TPV A;  1XTA A;  2EPF A;  3MZ8 A;  4IFA A;  4NUI A;  4NUN A;  2GIZ A;  1QNX A;  2A05 A;  5JYS A;  4H0A A;  3Q2R A;  2DDB A;  5ETE A;  1U53 A;  4NUK A;  2DDA A;  4LY5 A;  1XX5 A;  3U3L C;  4AIW A;  3S6S A;  1WVR A;  1RC9 A;  3S6V A;  4D53 A;  4NUO A;  3Q2U A;  2VZN A;  1SMB A;  3U3N C;  3S6U A;  3U3U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...