2DDBA

Crystal structure of pseudecin from pseudechis porphyriacus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
207
Chain Sequence
NYQKEIVDKHNALRRSVKPTARNMLQMKWNSHAAQNAKRWADRCTFAHSPPNTRTVGKLRCGENIFMSSQPFPWSGVVQAWYDEIKNFVYGIGAKPPGSVIGHYTQVVWYKSHLIGCASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADCPSACVNRLCTNPCNYNNDFSNCKSLAKKSKCQTEWIKKKCPASCFCHNKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Pseudecin
publication title Structures of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels: implications for movement of the C-terminal cysteine-rich domain
pubmed doi rcsb
total genus 60
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 2ddbA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 2ddbA01
4NUIA 2CQ7A 3U3NC 2DDAA 3Q2UA 4D53A 4NUNA 1XTAA 3S6UA 1RC9A 3MZ8A 3S6VA 1XX5A 1SMBA 3S6SA 5JYSA 2GIZA 2VZNA 4P27A 3Q2RA 1U53A 4AIWA 4H0AA 2DDBA 2EPFA 4NUKA 4LY5A 4G2UA 4NUOA 1CFEA 1WVRA 5ETEA 3U3UC 1QNXA 3NT8A 3U3LC 2A05A 4TPVA 4IFAA
chains in the Genus database with same CATH superfamily
3HTSB 1YE9A 2X48A 1YS6A 2VPLA 2XDVA 1LKXA 4PJMA 5F64A 2W82A 1PJRA 2EBIA 1LPQA 2VPRA 1D0ZA 4Y4RA 2LBFB 3T5XA 4DOZA 4CICA 1J59A 2EZLA 1BOBA 2DT6A 1FSHA 3S32A 3LSMA 4LOCA 2E5NA 4JOMA 2VZNA 4DZPA 1FYMA 2FBIA 2LY9A 3OYFA 4G12A 4ZYAA 4ZZLA 3RDIA 2AQFA 4EVIA 2VC0A 3AL0C 3KP6A 5ETEA 4DZJA 1R22A 3CJQB 1HKQA 3RI4A 3H0GJ 2BOLA 5FRMA 2ZCWA 4BYYA 3LQRA 3GO5A 3CDLA 2MC4A 4PGGA 4HA8A 1HQCA 5IOZA 2XRLA 3A0HC 2VKEA 3CDHA 1SAXA 4BDYA 5F08A 2EFOA 2KISA 2WAQA 2DDBA 2O03A 4EATA 2BHZA 3IAM2 1OYYA 1Y1VJ 2DOEA 2TRTA 1BA5A 2EV0A 4CCKA 1WVRA 4DIQA 1K78A 3QYFA 4HLYA 1GUUA 2JT1A 5LFAA 4J01A 1AHDP 3HEFA 2CFOA 1S3JA 3HSEA 1XSVA 2MLGA 2PN6A 3CZ6A 2QQAA 4FT8A 5ILVA 3CESA 3P7NA 2IGMA 2KRCA 5DYMA 4I76A 1IRZA 3HG9A 4A3IJ 1UG2A 3DU5A 3LL7A 1OCPA 1JT0A 4XRSG 1LJ9A 2YU9J 2PG4A 3CUOA 5LHIA 1WJ5A 4XMYA 4F92B 2M34A 3I59B 1NK2P 3B73A 2Z99A 3OYLA 2STTA 2HZTA 2LBFA 2OCCH 4XK4A 1Z6RA 2G7UA 2CQKA 4OOIA 1T56A 2LP0A 2KFDA 2XKPA 2KZVA 2R4GA 2I10A 5D5VB 1KQ0A 4XIDA 1D0YA 2DJNA 3HTUA 4NUNA 2KJBA 3GTPJ 1JUSA 1RC9A 2E71A 2AO9A 4DJAA 3ABKH 3BROA 1MIJA 1S72I 4PFOA 5TJJA 3NEUA 2PQ8A 2OQGA 2HOTA 1BIAA 3CQZJ 4F93B 1ETYA 2XB5A 5EDNA 3QQAA 4C30A 3ABMH 3OYKA 1A36A 1YOVB 2Z16A 1D8JA 3L2UA 2X1EA 1WZ2A 3ELKA 1HF0A 4PZJA 3H92A 2F2EA 1W36D 4A3GJ 3P9KA 2DA3A 3KP3A 2WWYA 3W6KB 2M3AA 4DBRA 2E1MC 4E7SA 3GFJA 4B43A 1S5LC 4MQVA 2L9RA 1SMTA 2XPWA 2V1DA 3G71I 2IS1A 5H20A 4GRIA 1VQLI 3S2DJ 4NUKA 2DK8A 2ZMEC 3ERMA 1I6XA 3FXJA 3J81K 1BM9A 1H0MA 3PSFA 3BR3A 2JVGA 2EFQA 1J09A 3HRTA 2JQ7A 3HOZJ 5AIPA 4CCOA 3I55I 3CO6C 3I59A 1IN4A 2JVHA 2P5LC 3JRFA 1HDDC 2R93J 3C1DA 5DDGA 3LSIA 1U2WA 4PGHA 3Q3SA 3RYRA 1YW9A 2XGXA 4AIJA 3J81Z 1Z3YA 2VKVA 1S29A 3PIPF 4XSZF 1QZEA 4HNUA 4HX8A 4KDPA 3CC7I 3R61A 5TGTA 1X4PA 4HX7A 1QHGA 2K40A 2GIVA 3ZQQA 2OCEA 2VASA 4LK1F 2QZ8A 4I2OA 2MGQA 3KE2A 4FASD 5E18F 5CQGA 3MD2A 4HAMA 2DFHA 1LFUP 4G7HF 2HTSA 2Y30A 4AVPA 3CCLI 1Z77A 2QQBA 2VN2A 2KT0A 1ZRDA 2ZXWH 4MFDA 4O6JA 4A69C 2Z9OA 3PNVA 3H36A 4OMZA 4WXHA 3CCRI 3K1PA 1QA6A 2JTVA 2DT7B 4C3IJ 1RR8C 1RZ4A 1XMKA 3W6VA 1HLVA 1OLTA 2BHYA 1GXPA 4PUSA 4B09A 2A69F 3G73A 4BE1A 1K79A 3HKZA 5L3EA 5HDGA 4BY1J 2DW4A 2ZKZA 4IRIA 4UV8A 2VQGA 3R0AA 4MO7A 1TQPA 4BHBA 5E79C 2LH9A 2F48A 2XSJC 1AA7A 1ENHA 2EZKA 2CUFA 1XGNA 1G3YA 2BV6A 2FXAA 2V1NA 2OZ6A 3SHFA 4YFKF 2Z33A 1U5TB 3GTLJ 2PLYA 4EJVA 4ANJA 1TNSA 3U2RA 4NQWB 4IO9F 5BOXA 3DPLC 1KU9A 5C4XJ 4FQGA 4HSRA 4NUBA 2Z3YA 4B48A 5AONA 1ORKA 3PO3J 5KNLA 5FGMA 2DK5A 1QZZA 3Q5FA 2IS6A 3CMAI 4FX4A 2NOGA 4V19K 1K7AA 2NVXJ 2NAZA 3L00A 1R7JA 1U0JA 2YU3A 5KK1A 2Q8KA 2JPCA 3S3NA 2JK3A 2WTEA 4M6XA 3RYPA 3UKGA 3BTLA 4M6YA 2EV5A 1OFCX 5L3GA 1GT0C 3RPUD 1HW1A 2P5VA 3BT9A 2RV8A 2R92J 1Z7LA 4MEYF 3ML6A 4IQ4A 1T39A 4L5JA 2NNYA 4UB8C 1OCCH 4HSTA 2HDCA 5M3FJ 2VE9A 3MCZA 2A05A 2MD5A 4I98B 3DF8A 5EZHA 1X1CA 4KN4X 4OIQF 3ZMZA 2Y2ZA 3FIWA 3RPQA 1Z67A 3IRRA 2BY1A 1JKPC 2LYCA 1B1BA 3D5RC 3ECHA 3E97A 4TPVA 4A6EA 3VSLA 3GYHX 2KDOA 5DV5A 2I8DA 3CUQB 3GXOA 1X1BA 3OIOA 1P4WA 2GWRA 4A0YA 3ISPA 3H1CA 2BE5F 3M7GA 3N05A 3CC2I 3L09A 5JI6A 2MLKA 3F6VA 4QSHA 1BN5A 3G1OA 2IXSA 2YX4A 4E7KA 2QEXI 2CQQA 1YFHA 1QPMA 2K9LA 2VL8A 4A3BJ 2DDAA 5B1AH 1XDSA 1OCOH 1YS7A 5BQTA 4PFPA 1PUFB 3RKWA 5IP9J 1BI2A 2OUMA 2GOMA 2QLZA 1FOKA 5J6XA 2V4JC 1HKTA 3A0BC 2LY2A 1PP7U 1YQAA 2VKDA 2NVTJ 2E36A 5LRSA 4MIMA 2CJJA 3CMYA 3OYMA 1X1PA 5D5UB 1OYWA 5JHFA 3HRSA 3Q2UA 1X58A 4GYIA 5M5XJ 1FBSA 2ZSIB 4PJNA 3E0JB 2KRFA 1ZTRA 2DLLA 4XRFA 4II2A 5J1RA 2NNNA 2LSOA 4RA2A 4B44A 5FKLA 1PP8F 4IF4A 5FKNA 2VJIA 3G3ZA 1MMDA 2X6WA 2LKXA 2VI6A 4G6DA 2Y9YA 1KU3A 3FMQA 1ZG5A 1OCRH 3H9JA 2LLKA 2WC2A 4NB5A 2IAIA 3TMOA 5DUIA 3M8EA 3IUOA 1Y39A 4RS8A 2NS0A 2XPVA 3R6SA 1QZYA 1C0WA 2X9DA 2CQXA 5LLQA 3JREA 2X1CA 3H35A 3TBIA 2QSFX 4L9NA 1OQYA 4L9VA 4G7ZF 1P7JA 1GVDA 2EIKH 1O3SA 1GXQA 4PK4A 2QGUA 2OAZA 3IWZA 1QVTA 3LAJA 4RGXA 1DP7P 3BPVA 4KIGA 1QNTA 2Y75A 3WTSC 4IJAA 4YIIA 2EZIA 3LA7A 1PUFA 3PFIA 2DAOA 4RLFA 2FQ4A 1TT5B 4DNCA 3QRFF 1NHAA 1HSTA 3IKVA 5ED4A 4HPQA 3HOYJ 4D53A 4Y52J 1USTA 5CYVA 1D1BA 3FM3A 3PL8A 4HW0A 4K2EA 4CA0A 1HW5A 4EM0B 3WGHA 2KDZA 1QRYA 2E7WA 5EYRA 4DW6A 4QPOA 3BZKA 2VJJA 2M0MA 5CQEA 2CU7A 3K4MA 3QU6A 1NTCA 3TOBA 3CC4I 5B66C 3GFMA 3SQNA 2V6CA 2XGDA 3KIOA 2PX9A 3WG7H 4X1EA 1EH8A 3JR9A 1DPUA 1ERDA 2HU9A 1MJ9A 2VIXA 4RMNA 4MHGA 1I3AA 2DA4A 5GP9A 1E3PA 3CD6I 3BC8A 4HDUA 2QM3A 2NVQJ 2MG4A 5KAFC 3EQLF 2IGOA 2M7BA 5JHUA 3PUFA 4S05A 3I54A 4LIUA 1MSEC 1APLC 4B4CA 2FOWA 2D2WA 4IHVA 4B3XA 4C3JJ 1LEAA 1ZG1A 4A0XA 3I64A 2E2IJ 4P1WA 3Q9VA 2A5WA 2V6EA 3RQ4A 4AM3A 3OYIA 5H6QA 1XSDA 1MBKA 3LSKA 4UUTA 4EJUA 4OINF 1TLHB 1XG1A 5IYBJ 1BBYA 2GA2A 3BY6A 2A3SA 1BC7C 4XSXF 3SDBA 3K70D 5LEJA 4XKBA 2GA1A 1X3WB 3RJPA 1IN8A 1YI2I 3LSPA 5BMZA 3DP7A 3JTGA 4KFCA 2CUJA 2X0LA 1RETA 1Z21A 1SFKA 2F5EA 2O3FA 3P5JA 2GXAA 1KONA 2Z5UA 1M1EB 4BKXA 5L3FA 2XAUA 2A5YB 2ECBA 2VKHA 1SFOJ 3C3WA 2HVQA 4UNOA 2EA4A 2O8XA 4HV6A 4UVCA 2M4GA 1OCTC 2RGVA 4KYWA 1XMXA 2ADUA 1IF1A 1VFCA 1JKOC 3H9QA 3HPHA 1R9TJ 1TZLA 2FSWA 5IYCJ 4CXFA 5IYDJ 3F23A 4CYCB 1FNNA 4N4NB 2W57A 3H3VK 2XB0X 2L54A 4E7IA 2RREA 1YYVA 2PMZN 4LG3A 3LAPA 3BCAA 2R7FA 3TP0A 5K5OA 3D1NI 4IQJA 1Z91A 4IEJA 3WTVC 4JQFA 3IRQA 2FBHA 2ZB9A 4ZDLA 1K6YA 1QGPA 3TEDA 1O3RA 3NWTA 1FC3A 1TL8A 1VQ8I 4CGZA 3REOA 1O3QA 2CRGA 3JSPA 2R7SA 3FXLA 4AC0A 1XGMA 1R6RA 1UHSA 3LMMA 2Y48A 2V9PA 2G7HA 1YX5A 2JA8J 2YPRA 2HVRA 1VQ4I 4HLXA 4RGUA 3OYGA 3J80K 4C9YA 2VONA 1YJ9I 2CFXA 4IVNA 1DGRM 4HDVA 4LFUA 5D5WB 4BJ6C 3JRCA 2WV0A 5BNGA 3TKYA 3BWGA 3M07A 4BBSJ 2IS4A 5EEGA 2OBPA 3MKWB 2R3SA 3F8NA 4LITA 1ACIA 5K5QA 3AG2H 1X19A 5FJ8J 3J80Z 1Z7UA 1Z6TA 2L9SA 5K5RA 4A5NA 3LSJA 3E5QA 2R7ZJ 4XLCA 1EV7A 5GAGJ 3G6EI 1UZCA 1IAWA 1D1AA 2ZXJA 4W97A 3HOWJ 2XV4S 3A4CA 1MJBA 3LFKA 4AIHA 1T0FA 1T98A 1TQIA 4QPQA 5F0HA 3L2VA 2LD5A 2EWNA 2E19A 4A3DJ 1Y0NA 1FPQA 1GDTA 2L9NA 2KZGA 2L4MA 3M8JA 4E7LA 1VQMI 2L0KA 2ZJQF 4EEFG 3GMEA 2L3DA 4CCMA 1I5ZA 1G8XA 4QTRA 4C2MJ 3OYJA 2L2OA 3NAUA 3QU3A 4AUXA 3S6VA 3GVAA 3QWLA 5J1UA 3M1EA 1LB2A 5KAIC 1Y0UA 3E3VA 3OWTA 2VLAA 3FDYA 2EQRA 1AKHB 2OA4A 2LOOA 5DEQA 3VPRA 1KA8A 1ETKA 1EF4A 4KJZA 2DA5A 4E6KG 3HOXJ 4XR6A 4G7OF 3SFIA 4YFXF 1FJLA 2FF4A 2FU4A 3AG1H 4JP0A 5ILSA 1W36C 3PNYA 3OR2C 2P6TA 2CGPA 4C2TA 3V7RA 5EZGA 1K83J 4ABZA 4U0YA 4LIVA 3ZQFA 4BHPA 3FXKA 1K78B 3FMRA 4DBQA 2RNGA 3ZQ7A 1MMNA 3S15J 1IRXA 4BQQA 1SVLA 2HYJA 1IXCA 2YX7A 2WY7Q 5HLIA 1W5SA 2M45A 2A68F 2HZDA 1SMYF 3VODA 5HS8A 2ZO4A 3HGGA 5IP7J 2CV1A 3ZP5A 2JA2A 1XD7A 2IPQX 3WTYC 2CW0F 3Q0UA 1P6RA 4YIRX 2P7VB 3PUBA 2ZMEA 1U9NA 3HYIA 2PMZA 2EV6A 4HG2A 2JMWA 2A07F 2WAFA 4A3LJ 2BVLA 2F5DA 2F5CA 2VQHA 5JLXA 4WXCA 1BR2A 2DMNA 3OYHA 1NH3A 1HA8A 2CYYA 5BS6A 2XSDC 5DCMB 3TDZC 3COAC 3LFUA 1TWAJ 3K0LA 1ETVA 2TDXA 5C3EJ 3FKIJ 2DQLA 1AKHA 4MEXF 2WB1N 1BR4A 1PVEA 3ZMUA 5F6FA 4M6VA 4BS9A 3S3MA 5K1YA 3FXRA 2B0LA 3BR5A 5GTIC 3U9GA 4P9UA 2O61A 2LRDA 1P7IA 1FBUA 3V8JA 4LD5A 5D8KB 1FZPB 1A35A 2B7EA 1SVOA 4OIPF 2H27A 2Q2EA 2YSRA 2HS5A 3HIFA 2EINH 3U3NC 2W7NA 1ODDA 3C2GA 2HYFA 4MTEA 3FBIB 2HEOA 4ZYDA 2QKLB 3JCUC 4KIFA 1LDKB 3MN2A 3OY9A 2DMQA 5F27A 4FETA 5F1JA 2OTLI 1VQ6I 2I5UA 3ZQGA 1YHQI 2ICWG 4LJZF 2DO7A 5D6FA 5J3LA 3U1DA 3TOAA 2LF7A 3GZNB 2MC3A 4BXUA 3DXJF 4B8XA 2R5ZB 1OCZH 3BQYA 5IT9Z 1ZYRF 4CH7A 4A93J 3CJTB 2A6HF 3KYCB 4N9IA 4A2UA 3QPTA 2Z2SB 1LDDA 5L3CA 1EKEA 2P81A 3NRVA 3KETA 2LK2A 3L2WA 1IDYA 2RC4A 3H5RA 5GPAA 2B63J 3EETA 2MYSA 5DCMA 2XHKA 2ZFWA 3HB9A 1GVJA 2LF8A 3DKXA 3LNQA 3CO7C 2HVSA 2IGNA 2ACJA 2PI0A 2JSCA 5E3NA 4HF1A 5FB2A 4KNYA 1IXRC 4F55A 4LMYA 4NHJA 5F0CA 2MA3A 2PMHA 4W1UA 4WWCA 3OIPA 4JBAA 4DQ2A 4EM2A 3PNTA 2RNJA 3WGGA 1SANA 1PDNC 2E2JJ 1UAAA 1ZGAA 2M8EA 3K4KA 5KVRA 2CSOA 3FHNA 4M73A 4IZZA 2GIZA 2IVMA 4HQEA 3GW2A 1WI3A 2D45A 3G2BA 4XLFA 2DJIA 2FUG2 3GLLA 1N75A 3ZCOA 2CV2A 5HLGA 5M3MJ 4E70A 1GLNA 3IP4B 4NC6A 1Y8QB 5HLTA 4KIBA 1VI0A 1OMIA 3O3KA 3B02A 2LG4A 2CV0A 3V4GA 1TW2A 3VOEA 3FF5A 2E7XA 2QSHX 2R5YA 4BEHB 1R36A 3AG4H 1BW5A 3G1MA 3SZPA 2FE3A 2R5ZA 4HV5A 1T8IA 1NK3P 3BR0A 1KQ8A 3DTIA 1JKRC 3F8FA 5HDKA 4UVBA 1MBGA 5JYSA 4XLEA 3FX3A 1LNWA 5D4RA 3LOCA 4HEA2 4AD9A 1ZG3A 1YRNB 2R7VA 2WB1A 4XKVA 5CVIA 2DOFA 1ZRFA 4MTDA 2VQCA 4BL0B 4BNCA 4HYEA 1P2FA 3S2HJ 1W4MA 2DYSH 1W7PB 5CKTA 1Z0XA 1SD6A 4Q5SF 2ZJPF 2BW3A 3MFKA 4WCGA 5IP6A 3ONQA 5LHHA 4M9XA 3GBGA 1WH7A 1ZARA 2RAEA 2W00A 3L7WA 4I0BA 2XF5A 1B6AA 4V2GA 1B9MA 1CQTA 3LSRA 4LG0A 1WCMJ 4RM2A 1R58A 1IN6A 1S9HA 1LVAA 2NS8A 1I39A 5B1BH 5E1XA 2XUBA 4F3QA 2Y9ZA 2VC1A 2NYXA 4G94A 3H5AA 3MZHA 4F52A 2K9SA 3CTAA 1YJNI 3KFWX 3QPLA 3OYEA 3CF2A 2YUSA 2ZBKA 3BJAA 1K6OA 4B1RA 2L7FP 3WU1B 1WI9A 3ZMTA 2L7ZA 1Z05A 3EUHA 2B9SA 3QP5A 3DKYA 2KIMA 4AWXB 3I58A 4GYGA 1BR1A 4BEHA 2O6GE 4LY5A 3F6OA 1SD7A 2KKOA 3IKTA 4XLPF 1ZH5A 3IAS2 3CLQA 2JSPA 3GX4X 1J2XA 4OAYA 2DTZA 4X6AJ 2K9MA 1IRFA 1XGOA 3S1RJ 3BP8A 3AKZA 3KZZA 3F72A 3T0YA 2OU2A 1A31A 1YRNA 1ETQA 3GZ5A 4LLLA 3LA3A 3JTHA 3KEOA 4M3EA 3JRBA 3KP7A 3PM1A 4G9YA 3RKQA 1VQ7I 1WWXA 3KPHA 4RAFA 2G9WA 4BE0A 1W7PA 3QPSA 1WHUA 4RGRA 4KITB 4XLNF 2UWMA 1JHHA 3GTGJ 2L02A 3VYSB 1IUFA 5A2QK 1ON1A 2DN0A 2HKXA 2P7CB 3W2AA 4I01A 3VSKA 4MQ9F 3KEQA 5TRDA 4Y17A 3T8RA 4IHSA 1RR7A 3W3CA 2ECCA 2XGEA 4D0PA 1B8IA 4E4HA 3A01B 1U8RA 4OU0A 2XF7A 2HXOA 1G6NA 2QWWA 3N4MA 4A3MJ 3IHUA 3CCQI 5K7HA 4M71A 1N78A 3GEZA 1W1WE 3OYCA 3W2VA 4AU7A 5EF6A 5A2QZ 2L9VA 2W84A 1L0OC 2ZXHA 2GXBA 1F9NA 4H0AA 2QQ8A 5IT3A 2EFWA 3D0SA 4JX6A 4EV0A 1BJZA 2KQRA 4B3AA 2XF6A 1BI1A 2AXTC 1Y1WJ 2VBYA 2HOSA 2VQLA 1R5HA 1BW6A 1BI0A 4RAYA 4QLCU 2IJLA 1FYKA 3OR1C 2O0YA 2BY2A 2BZTA 2FMLA 2M9HA 4FHTA 3OS1A 4ZJZA 1VQNI 3KP5A 2E1CA 2L4AA 3V7CA 4C3HJ 3P9CA 4YRVA 1WRJA 4GGGA 1IXSB 2F5FA 2X51A 2A6EF 2PEXA 1MNDA 2XAFA 4P5OA 9ANTA 5JLWA 3CCJI 5GTHC 3O8HA 4RDUA 3WGIA 4PJLA 3MWMA 1RPWA 4M9SA 1F4KA 1FP2A 4RB1A 4HX4A 2Y0SN 2CG4A 3ZQHA 3DBRB 4EJTA 2HPIA 5LEKA 4A3KJ 3HRUA 2DXIA 1JKQC 3PJRA 4GDFA 1NG7A 2KP6A 5HOOA 3A01A 1WGXA 5AIQA 3L2RA 4JX4A 4ASNA 3FK7A 4BQOA 5ERIA 1XSXA 1X1AA 3IL2A 4KICA 2OJED 4IL6C 1K61A 2DTRA 1HSJA 1VQ9I 2CW8A 2VT2A 2K3FA 2QF7A 2GM4A 1GV5A 3NARA 4WXDA 2BEOA 3WE3A 4S0HB 4BJTA 2V1XA 3ZOBA 2DYRH 3KZYA 3CP2A 2IA1A 3SEZA 4LB5A 1G4DA 3FM5A 1TTYA 3Q2RA 2DMUA 1IO2A 2AXLA 1JT6A 2GZWA 3WODF 2H6BA 1CFEA 4U7BA 4HZFA 1ZR4A 5GAHJ 2EZHA 1JGSA 4KN7X 1MNEA 4ETSA 1HOMA 3R60A 5DS9A 1V3FA 3BG7A 4J19A 2GAUA 1QO0D 1DU0A 5HODA 2EB7A 1IGNA 3F8CA 5TISC 4A3FJ 2NS7A 1ZGWA 5EJCA 1VQPI 2IGKA 1JGGA 2HOAA 4KMFA 1E3HA 2FBKA 1G3TA 1V4RA 3BCBA 3BJ6A 4NC8A 3BPXA 3J7AO 3J7ZI 1X2MA 1X2NA 3M4OJ 1UHWA 1HKSA 3VYTB 3HHGA 4CYDA 4EGZA 4KT5C 2HTJA 3G1LA 1SEUA 4OWRB 4L9JA 5B5EC 1QBJA 5EG0B 1D5VA 2DPDA 1XN7A 1HCRA 3H9GA 4RB3C 4E7JA 3BJOA 3DV8A 2QBYA 3HSFA 3BG9A 3OOUA 4A0ZA 1IC8A 2QYOA 1NG6A 1TT0A 3OMYA 2LDUA 3QYBA 1MSFC 2DT5A 1I50J 3OS2A 2DFFA 2ESNA 2FNAA 2K02A 3MZ8A 3V8LA 3DTEA 1LFBA 4CO8A 2WA0A 1VTNC 5EEAA 4XRSA 2FD5A 2GXGA 2K86A 4OMYA 1MMSA 5FD5A 1JI8A 2V1UA 1LDJA 3NQOA 4I99C 1WJCA 4UB6C 1PUEE 4PSXA 2R7XA 4IKFA 3HGYA 3BG3A 5IOYA 2MBFA 1MGTA 2P4WA 1GHCA 1MH4A 3E6MA 4AIDA 2BXYA 5J8CA 2UXXA 5GADJ 1T2KA 2OQRA 2IT0A 3AL0B 2Q1ZB 3GFIA 2M30A 4ESFA 1RNLA 1U5TC 2E1NA 3IC7A 2UUZA 2FOKA 4O5VA 2MH2A 3DBHB 4R1HA 4U88A 5LGUA 3S16J 2WV1A 3LSHA 3CDIA 1VZ0A 3WTXC 1WKMA 2FQ3A 4L0YB 1YW7A 5JVGF 3HOTA 4ZTJA 1FYLA 1P4AA 4PCQA 3F8BA 1RESA 4A3CJ 6PAXA 2QSGX 3OYAA 2Y0SA 2DODA 1MMAA 2HDWA 2OD5A 1BL0A 1ZQ3P 3ZR8X 1R49A 1FBQA 2CW7A 5EGOB 3C2BA 2XGCA 4CDGA 3QYEA 3OOPA 1XDUA 1BC8C 1A04A 1F1ZA 2CO5A 3TP3A 4XORA 1T6SA 1FEXA 3DEWA 5EG0A 2KL4A 3A1YA 3E5XA 3ECOA 3I4MJ 1R4MB 3BTJA 4CUGA 3MAJA 5B3SH 1DUXC 3SZTA 2R7TA 3X2QH 1ZKGA 3OL3A 2OF7A 1FOXA 1O3TA 2F4IA 3WE2A 1JJ6C 3KCCA 3R4KA 3VYRB 4Y15A 4XLAA 3CCVI 1SD4A 3CF5F 5JVTA 2UXNA 5CJ9A 2J5OA 2K7LA 2K9QA 3EPZA 2CS3A 3HDDA 3KEYA 3CUQC 1ETWA 2GOXB 1YO5C 4IPAA 1J5YA 4PDKA 2COBA 2GBYA 1DQUA 1WSUA 2MABA 1JE8A 4ZYGA 1OPCA 4P9FA 2XASA 1DGWY 2MH9A 1IN5A 3H0DA 4CHUA 4FE7A 1K4SA 2VXDA 4FE4A 4L18B 1D5YA 4XKWA 1AU7A 3U3LC 1UJ8A 4ZTFA 3K2ZA 2KLOA 3HPGA 2H94A 1FOYA 2HQ5A 2X85A 5K7ZA 2V9VA 3VYUB 2Y69H 2IS2A 1UMQA 3DBLB 1SFEA 3DU6A 3BQZA 1ZGJA 4LB6B 1B4AA 2Q0OA 1IDZA 1MJAA 5EGOA 1SFXA 1SVMA 2E1MB 2W25A 3TO7A 3HOSA 2HKOA 2XPUA 3BTCA 3WU0A 3UR3C 5F1RA 3HL2A 3GTMJ 2G0EA 1W7PD 4HQMA 3OYDA 2DA2A 4Z2YA 1TWGJ 3FXOA 2H6CA 3JW4A 3I4NJ 4U7DA 5ILUA 2LMDA 4V2FA 1R00A 1MH3A 1ZLJA 2L7KA 2ZMEB 3ASOH 1ULYA 3K4JA 5FKMA 1ZLKA 1FSEA 3K69A 4GXOA 3TW7A 2M0CA 1K4TA 1BI3A 1YW8A 3ABLH 5CVUA 1XTAA 2QENA 3L9FA 3SXYA 2IW5A 5ICFA 5LGNA 2W1OA 2N8GA 4L5EA 1FLIA 3SZGA 2HNHA 2HQAA 3IV5A 5JFRA 2HR3A 1FMWA 1WFXA 3BOQA 3GTJJ 4ESJA 4U0WA 5E17F 3U1KA 3GUDA 3G4SI 1G3WA 3CJNA 5DD8A 3NT8A 3DFGA 1VNDA 3T1BA 3IH3A 4OIOF 1XS9A 4YIFA 4LLNA 1MDMB 2W24A 1RKTA 1WJBA 4ENNA 2ZNYA 3RPUA 1FY7A 3MQ0A 3WU2C 5HS7A 1ON2A 2MD0A 2O7OA 3ZN0A 3DWLE 2Q2EB 2EPFA 1G59A 4S04A 3IWFA 3JRIA 3EDPA 1F5TA 3UNGC 1QNXA 3HOUJ 1LUJB 2EIJH 3U21A 1R5GA 1TBXA 3WG9A 2KIUA 4Y3OA 2PMUA 3WHCA 3LWFA 2OTJI 3EUKL 2DA6A 2OV7A 1R5ID 1FTZA 4HRIA 3K2AA 3FZVA 3IH2A 5HDNA 3VFZA 1A5JA 3A2KA 2JA5J 2H8RA 2K4JA 1BIBA 4Q4ZF 1G2HA 1HBXG 4XM3A 5CVJA 3L1PA 2ISYA 4NC7A 3GTKJ 3JRHA 5FKKA 2AQEA 1I1SA 1S7EA 1MKMA 1XB4A 5CVRA 4XRMA 2DA1A 4BGDA 2LKSA 4IHYA 2C6YA 3S1QJ 4UV9A 4Y13A 4XN0A 3ZQIA 1KQ9A 3PFYA 2V9KA 4KUMA 4EQQA 4L0ZB 4E7ZA 3KLOA 4AYBN 1R23A 1OISA 2GQQA 1MDMA 5DD4A 4BACA 3BLYA 4NUOA 1J7KA 2IBDA 2ISZA 2COMA 3KYDB 1HDPA 1ZR2A 1GV2A 4A6DA 2FX0A 2AHQA 1TWFJ 2KHMA 2CQ7A 1RIOH 1CGPA 3A02A 1LQ1A 3C7JA 2X6OA 1TC3C 4HF0A 4YG2F 3N97A 1U8BA 3KZIC 3S6UA 5IT9K 4Y33A 1HXDA 1TP4A 1Z3XA 3DPTA 3OSGA 1H8AC 4ZYHA 2VJ5A 2ZNZA 4PJJA 3DKWA 3V42A 3D5SC 1OR7C 1POGA 3DEEA 1I1GA 2FJ1A 1U78A 5GAEJ 5M5YJ 1BJAA 2R5YB 4TV7A 1VF9A 1RI7A 1KGSA 1HW2A 2L01A 3P9IA 2F4MB 4YEJA 1X4OA 3AG3H 2LKPA 2CUZA 1O4XA 2XAHA 2O5RA 4XICA 1OKRA 1T0FC 5EEHA 1MBEA 2QCOA 2EA2A 3HKZN 2F5VA 5LRRA 2WAEA 2XKOA 2KIFA 4G6TB 1ZELA 3H5NA 3CMMA 2QQ9A 2VE8A 2VBZA 5IY5H 1KZHA 3SDGA 1D8KA 5FFXA 2BW3B 1IW7F 2NVYJ 4R8HA 1V55H 3QOPA 3QOEA 4YFNF 1ONVA 3S8PA 4G6QA 4DYQA 1N25A 1F36A 4NNJA 4LG0B 1R1UA 4XKCA 4XOTA 3GZ6A 3K7AJ 3ZMDA 4H4KC 5BPIA 4N9HA 4UVAA 2R7UA 4LLGF 3GF2A 4KISA 3T8TA 1MW7A 4N4OB 1MNMC 1T95A 3I4PA 3M9AA 3V8KA 3FXQA 1YTYA 3F8MA 1VQOI 1R1TA 3ZGKA 4FTHA 4RLQA 3K4BA 4RB0A 5KCMA 2O8KA 1IZ1A 4ZDPA 2VBXA 1QPIA 1E17A 2DI3A 2E2HJ 2FNPA 3PQKA 1A6IA 2V26A 3LSGA 1YLFA 5J47A 4XBFA 4I02A 4I6ZA 3ULQB 2FMYA 5E8IA 1S7OA 3FXMA 2AS5F 2RDPA 2CH0A 2Z1DA 5KHDA 4ZZDA 1IV8A 2FEZA 2M1BA 2UZKA 2E35A 2BY0A 1A6QA 2LFBA 3R0JA 4ENKA 1JHFA 2CWEA 3BR1A 2J5PA 2EFPA 1JXSA 2LR8A 3RTRA 5E8GA 4D9JA 1Q1HA 2OZUA 4NBQA 2EJRA 1UG0A 4FISA 4O3MA 2E5ZA 5F0FA 1Q1VA 5FKOA 4KMUX 3V7SA 2WY8Q 1LVKA 1TQMA 5L3BA 3LQQA 2CQNA 3S1NJ 3C18A 3TQNA 4AYBA 4D7MA 4WK8F 5LBQA 1MBFA 2OC6A 2M87A 1RUOA 1LE8B 3I3LA 4RB2C 1QQIA 2JA6J 1RRJA 4IHXA 1YITI 2ZXIA 2KRHA 3WTWC 1VQKI 4QIWN 2HGCA 1B8IB 1D0XA 1D1CA 3ASNH 4G2UA 2E60A 2XRNA 5E3LA 1B9NA 5FLVA 2H8WA 1Z1DA 4BY7J 3K1MA 4AVZA 1YG2A 2K5CA 3ZQLA 1IV6A 3TO9A 1TNTA 1YIOA 4QWQA 5DM7F 2H09A 2OPTA 2DCEA 4D5FA 1DDNA 4HBLA 2XIGA 2VBWA 3ABTA 3K4NA 3KP2A 2KJCA 2A61A 4YELA 1V5GA 3F22A 1H9GA 3CP8A 2Y0MA 5E1ZB 4BBRJ 3F0CA 3Q0WA 4U87A 1S7AA 4IHTA 3GLXA 1JJ8C 3HRMA 4BJ5C 2YS9A 2ESHA 3JSOA 1WJAA 2R7DA 3ABUA 2JN6A 3K1NA 2ME6A 2VOOA 3BZ6A 3S14J 1MBHA 1KYWA 2X6XA 4B47A 4OIRF 2D1HA 5ICCA 2XAJA 1Y56A 3BDDA 1UCRA 2IA0A 2JZYA 2HXIA 5K7FA 1T08B 2VUMJ 3I0TA 4ENJA 2V7FA 3HZJA 4PJ0C 4BQNA 3HOVJ 1I27A 3ZXSA 3BG6A 5E3MA 1H88C 2DOAA 4JYKA 4HF2A 3DLLF 1KU7A 3WTTC 2TCTA 4ITVA 4XLHA 3IH4A 1P9QC 1SFUA 2HYGD 4ZH4F 5FFZA 4RGSA 5J4YA 4M72A 5HLHA 2EIMH 2R7QA 1LE8A 3ZRGA 1UELB 3A03A 4GFBA 2CUEA 4I09A 2EK5A 2ID3A 3KP4A 3CMEI 2QVOA 5HNHA 1U9OA 5DUKA 4ZC3A 1PYVA 1S8NA 2VJ4A 5ICEA 2W85A 2BGCA 2DA7A 2IA2A 4EGYA 1XC5A 3EUAA 5LGTA 2BVMA 2K9NA 2R7WA 1P4XA 4D7NA 3E6CC 4CZZA 4HOBA 2ID6A 2JRTA 2X1DA 2UV1A 3KLNA 3Q9SA 3SEQA 3QPHA 4P55A 2H1KA 3ZMVA 4XL9A 3GFLA 2NVUB 3Q0VA 4LGWA 2VOPA 5M5WJ 3KYLA 1UHMA 4D1QA 1JUPA 3ZN1A 1IN7A 5HNFA 4J00A 1KU2A 2ELHA 3DPUA 3DCFA 1R4NB 1XMAA 5D8LB 3TL4X 3CJRB 5E20A 3F3XA 4CCNA 2LREA 1IUYA 4C2UA 3J7AY 4RAZA 2QA4I 1FX7A 3VEPA 3SFZA 3GTOJ 1QVUA 4HNVA 5HS9A 3K70C 2KIQA 1V5FA 3TW6A 4BQAA 2JWTA 4CZCA 1S6LA 4XOPA 3WTZA 2HI3A 4RAGA 1U3EM 2K27A 3FMSA 3MMYB 3MVPA 3M1CA 2L7MP 3B6CA 1CF7B 1U5TA 3GWZA 2PFBA 4IXAA 1DU6A 1V54H 4NQWA 4IOCF 1B59A 3ROUA 1MBJA 1EJ9A 4JX5A 5DM6F 3OV8A 3E6BA 2JJ7A 4OAZA 1SMBA 2ELJA 2E34A 4AIWA 3HUGB 3HHHA 4RM3A 2PJRB 4N0BA 2QBYB 3BR2A 3HSRA 2IEKA 2Y31A 5D4SA 1P92A 2FRHA 1B72B 5FO5A 1FTTA 5CLSA 2MW8A 2DPUA 4IRHA 4R79A 2R7RA 2K85A 1ZREA 2HDDA 1BOAA 3RKYA 1FIPA 2JUGA 2ZJ2A 3K10A 5FLMJ 2IRFG 4ESBA 1F43A 3HM5A 1E3OC 2W48A 1LEBA 1D3YA 3J7YJ 4UUVA 1T38A 3CLOA 3EUHC 4XN3A 2JUCA 1ZHFA 1YX3A 3GTQJ 4Z6YA 4RBOA 3PQJA 3BZCA 3CUQA 3FBNB 3H3UA 1ZN2A 3VB2A 1Z9CA 3K6GA 3F21A 2STWA 2F6CA 4L5IA 3OL4A 4EJOA 4E7HA 3CCSI 4FX0A 3TDUC 3BTIA 3DEUA 2VT3A 3I56I 1J75A 3O6BB 5C44J 1CF7A 2DFEA 3EYIA 1T33A 4BDZA 3MKYB 1UB9A 3GCMA 3HC7A 4UHTA 3I53A 1XCBA 5D6EA 3H3ZA 2DFIA 1USSA 4BUPA 2BBYA 5LD2C 3S2WA 4KA4A 1TWHJ 4FCYA 3S3OA 2VODA 3U3UC 1I6HJ 1AWCA 1JUMA 2P0WA 2DU9A 4ON0A 4LK0F 2M8GX 3FKJA 3HUGA 1WH5A 3E7LA 3WTUC 2PJRA 2WBMA 3RCOA 1Y6IA 2LY1A 1X1DA 5J4VA 1EH7A 2A6TA 2BY3A 1OYIA 2M4KA 5ICGA 1B72A 4A3JJ 2O9LA 2F4OB 3OYNA 4UXNA 3DQVC 1DP3A 2P5KA 3B6AA 3MEXA 4EM1A 1YJWI 3QP6A 3K4CA 3M8FA 5H6RA 2W4SA 4IHWA 3ERED 2HPMA 3OIQA 5H2FC 2RQPA 1V5EA 3I9V2 1KYZA 4GCVA 4BXFA 4XQFA 1ZAOA 3RQIA 1VQ5I 2GLOA 2DMTA 4IX7A 3HBLA 2HWVA 4MLOA 2P8TA 3KX2A 4UUSB 1QU3A 4BU2A 1JTXA 3L2QA 5J40A 2XC7A 4II3A 2D5VA 1X3UA 4CSWA 2RKHA 1QHHD 1TW3A 3RKXA 3S93A 1I3QJ 2EFNA 3M3YJ 2YR2A 3CCEI 1SD5A 3C2HA 4X0GA 2R0QC 4ENMA 2V79A 3O2PE 4MFEA 1U6GA 1IG7A 3ZPLA 5LHGA 1MD0A 1J9IA 4F7ZA 1UFMA 5J8FA 5L3DA 3S1MJ 2VXZA 4U0VA 3QODA 3FHZA 4A5MA 5FLXK 5FRNA 3E5UA 4DGWB 3SJMA 4L9TA 4DYCA 1R71A 1TWCJ 2RVCA 3RSNA 4M3FA 2D1VA 2HOEA 4PSWA 3OSFA 1W0UA 2CMPA 3I5UA 4BHCA 1MZBA 3K4LA 2BYVE 1E0EA 3MZYA 2DMPA 2LC2A 4XNFA 4Q47A 5FLXZ 4F91B 2HFHA 1SC7A 5C4JJ 3AFHA 3JRDA 1XPXA 4CCJA 3I71A 5GPCA 2LNBA 1W5CC 5E3OA 2HQRA 4NDLA 2XROA 1H89C 3DLAA 4BH9A 1RUNA 1YIJI 3RZDJ 1L3LA 2JA7J 2PJPA 4KT6A 1E2XA 3PIOF 3L2CA 4Q48A 4A3EJ 3E6DA 2K3PA 1O7FA 3VWBA 2DBBA 4BXXJ 3LSTA 2NOJB 1OJLA 1WPKA 2L5QA 4M9ZA 5HVQC 1WJFA 2K4BA 2IP2A 5J1YA 4IOAF 2NXNB 4IRGA 4UUSA 2PBIA 1REPC 3FK6A 3JAMK 4Y7NJ 1FOWA 2RQQA 4HNTA 1MMGA 2EILH 1W5TA 4A12A 2EH3A 1AOYA 4AIKA 1LFPA 2LTPA 2MSYA 5FD6A 5F04A 1FP1D 2E1OA 1ETXA 1EA3A 1HC8A 2M2EA 4G8XA 4CCLA 4D5CA 1O57A 2X4HA 5JR3A 2BXZA 1U53A 2MFZA 1FMVA 2XVCA 4XONA 3QAHA 3SYTA 3JAMZ 2HQNA 3FISA 1IRGA 1XCVA 3E1SA 4EJWA 1IJWC 1FT9A 4M3GA 2X6YA 2JRMA 2WAQN 1SAUA 1Y8RB 3HXLA 1XGSA 1W0TA 1FWZA 2ELKA 1H9TA 2LVSA 1OR7A 4JK1X 3K9TA 2M5WA 1WQ2A 5IPAA 3W2WA 3S6SA 1N77A 5BPDA 3EYYA 5D5XB 3ZQCA 3ZMSA 4EMSA 1DPRA 2KMUA 3OS0A 2M7AA 4UY8I 3FXUA 2WADA 1J0RA 1G3SA 3PSIA 3JRGA 1ETOA 1X3ZB 3DTKA 4CYCA 4IFAA 2QUFA 2H1LA 2QKMB 3BR6A 5DTDA 4NUIA 4M74A 3AAFA 4MNUA 5E1WA 2ZC2A 1O7LA 3MKLA 4ZYEA 1R1VA 4M3DA 3ESWB 4MGRA 4I0AA 3RIRA 2P6SA 3NWSA 3CCYA 1XX5A 3HJEA 1FIAA 2RN7A 3FWEA 3OYBA 3W6JB 2ZJRF 4GO1A 4P27A 4M3BA 2R7OA 3JRAA 2VB6A 2KPMA 3CCUI 4WF2A 1EH6A 3RZOJ 4P96A 5CPRB 3O8GA 4BAYA 3BG5A 2ZSHB 1JTYA 1RKWA 3LA2A 2ME0A 5FROA 2NRAC 4BE2A 1ZRCA 4I7HA 2DQRA 3TO6A 1ITYA 2FA5A 2XAGA 2ETHA 2ZFUA 4DYRA 3F9KA 3D5LA 4WX9A 1STZA 2XAQA 3TGNA 5CVVA 2JPBA 1WJEA 3WHBA 3S17J 3PO2J 3MKZA 5DCFA 1ZK8A 4H0EA 1WJDA 4ZDOA 3CCMI 3VDXA
chains in the Genus database with same CATH topology
4NUIA 2CQ7A 3U3NC 2DDAA 3Q2UA 4D53A 4NUNA 1XTAA 3S6UA 1RC9A 3MZ8A 3S6VA 1XX5A 1SMBA 3S6SA 5JYSA 2GIZA 2VZNA 4P27A 3Q2RA 1U53A 4AIWA 4H0AA 2DDBA 2EPFA 4NUKA 4LY5A 4G2UA 4NUOA 1CFEA 1WVRA 5ETEA 3U3UC 1QNXA 3NT8A 3U3LC 2A05A 4TPVA 4IFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUI A;  2CQ7 A;  3U3N C;  2DDA A;  3Q2U A;  4D53 A;  4NUN A;  1XTA A;  3S6U A;  1RC9 A;  3MZ8 A;  3S6V A;  1XX5 A;  1SMB A;  3S6S A;  5JYS A;  2GIZ A;  2VZN A;  4P27 A;  3Q2R A;  1U53 A;  4AIW A;  4H0A A;  2DDB A;  2EPF A;  4NUK A;  4LY5 A;  4G2U A;  4NUO A;  1CFE A;  1WVR A;  5ETE A;  3U3U C;  1QNX A;  3NT8 A;  3U3L C;  2A05 A;  4TPV A;  4IFA A; 
#chains in the Genus database with same CATH topology
 3HTS B;  1YE9 A;  2X48 A;  1YS6 A;  2VPL A;  2XDV A;  1LKX A;  4PJM A;  5F64 A;  2W82 A;  1PJR A;  2EBI A;  1LPQ A;  2VPR A;  1D0Z A;  4Y4R A;  2LBF B;  3T5X A;  4DOZ A;  4CIC A;  1J59 A;  2EZL A;  1BOB A;  2DT6 A;  1FSH A;  3S32 A;  3LSM A;  4LOC A;  2E5N A;  4JOM A;  2VZN A;  4DZP A;  1FYM A;  2FBI A;  2LY9 A;  3OYF A;  4G12 A;  4ZYA A;  4ZZL A;  3RDI A;  2AQF A;  4EVI A;  2VC0 A;  3AL0 C;  3KP6 A;  5ETE A;  4DZJ A;  1R22 A;  3CJQ B;  1HKQ A;  3RI4 A;  3H0G J;  2BOL A;  5FRM A;  2ZCW A;  4BYY A;  3LQR A;  3GO5 A;  3CDL A;  2MC4 A;  4PGG A;  4HA8 A;  1HQC A;  5IOZ A;  2XRL A;  3A0H C;  2VKE A;  3CDH A;  1SAX A;  4BDY A;  5F08 A;  2EFO A;  2KIS A;  2WAQ A;  2DDB A;  2O03 A;  4EAT A;  2BHZ A;  3IAM 2;  1OYY A;  1Y1V J;  2DOE A;  2TRT A;  1BA5 A;  2EV0 A;  4CCK A;  1WVR A;  4DIQ A;  1K78 A;  3QYF A;  4HLY A;  1GUU A;  2JT1 A;  5LFA A;  4J01 A;  1AHD P;  3HEF A;  2CFO A;  1S3J A;  3HSE A;  1XSV A;  2MLG A;  2PN6 A;  3CZ6 A;  2QQA A;  4FT8 A;  5ILV A;  3CES A;  3P7N A;  2IGM A;  2KRC A;  5DYM A;  4I76 A;  1IRZ A;  3HG9 A;  4A3I J;  1UG2 A;  3DU5 A;  3LL7 A;  1OCP A;  1JT0 A;  4XRS G;  1LJ9 A;  2YU9 J;  2PG4 A;  3CUO A;  5LHI A;  1WJ5 A;  4XMY A;  4F92 B;  2M34 A;  3I59 B;  1NK2 P;  3B73 A;  2Z99 A;  3OYL A;  2STT A;  2HZT A;  2LBF A;  2OCC H;  4XK4 A;  1Z6R A;  2G7U A;  2CQK A;  4OOI A;  1T56 A;  2LP0 A;  2KFD A;  2XKP A;  2KZV A;  2R4G A;  2I10 A;  5D5V B;  1KQ0 A;  4XID A;  1D0Y A;  2DJN A;  3HTU A;  4NUN A;  2KJB A;  3GTP J;  1JUS A;  1RC9 A;  2E71 A;  2AO9 A;  4DJA A;  3ABK H;  3BRO A;  1MIJ A;  1S72 I;  4PFO A;  5TJJ A;  3NEU A;  2PQ8 A;  2OQG A;  2HOT A;  1BIA A;  3CQZ J;  4F93 B;  1ETY A;  2XB5 A;  5EDN A;  3QQA A;  4C30 A;  3ABM H;  3OYK A;  1A36 A;  1YOV B;  2Z16 A;  1D8J A;  3L2U A;  2X1E A;  1WZ2 A;  3ELK A;  1HF0 A;  4PZJ A;  3H92 A;  2F2E A;  1W36 D;  4A3G J;  3P9K A;  2DA3 A;  3KP3 A;  2WWY A;  3W6K B;  2M3A A;  4DBR A;  2E1M C;  4E7S A;  3GFJ A;  4B43 A;  1S5L C;  4MQV A;  2L9R A;  1SMT A;  2XPW A;  2V1D A;  3G71 I;  2IS1 A;  5H20 A;  4GRI A;  1VQL I;  3S2D J;  4NUK A;  2DK8 A;  2ZME C;  3ERM A;  1I6X A;  3FXJ A;  3J81 K;  1BM9 A;  1H0M A;  3PSF A;  3BR3 A;  2JVG A;  2EFQ A;  1J09 A;  3HRT A;  2JQ7 A;  3HOZ J;  5AIP A;  4CCO A;  3I55 I;  3CO6 C;  3I59 A;  1IN4 A;  2JVH A;  2P5L C;  3JRF A;  1HDD C;  2R93 J;  3C1D A;  5DDG A;  3LSI A;  1U2W A;  4PGH A;  3Q3S A;  3RYR A;  1YW9 A;  2XGX A;  4AIJ A;  3J81 Z;  1Z3Y A;  2VKV A;  1S29 A;  3PIP F;  4XSZ F;  1QZE A;  4HNU A;  4HX8 A;  4KDP A;  3CC7 I;  3R61 A;  5TGT A;  1X4P A;  4HX7 A;  1QHG A;  2K40 A;  2GIV A;  3ZQQ A;  2OCE A;  2VAS A;  4LK1 F;  2QZ8 A;  4I2O A;  2MGQ A;  3KE2 A;  4FAS D;  5E18 F;  5CQG A;  3MD2 A;  4HAM A;  2DFH A;  1LFU P;  4G7H F;  2HTS A;  2Y30 A;  4AVP A;  3CCL I;  1Z77 A;  2QQB A;  2VN2 A;  2KT0 A;  1ZRD A;  2ZXW H;  4MFD A;  4O6J A;  4A69 C;  2Z9O A;  3PNV A;  3H36 A;  4OMZ A;  4WXH A;  3CCR I;  3K1P A;  1QA6 A;  2JTV A;  2DT7 B;  4C3I J;  1RR8 C;  1RZ4 A;  1XMK A;  3W6V A;  1HLV A;  1OLT A;  2BHY A;  1GXP A;  4PUS A;  4B09 A;  2A69 F;  3G73 A;  4BE1 A;  1K79 A;  3HKZ A;  5L3E A;  5HDG A;  4BY1 J;  2DW4 A;  2ZKZ A;  4IRI A;  4UV8 A;  2VQG A;  3R0A A;  4MO7 A;  1TQP A;  4BHB A;  5E79 C;  2LH9 A;  2F48 A;  2XSJ C;  1AA7 A;  1ENH A;  2EZK A;  2CUF A;  1XGN A;  1G3Y A;  2BV6 A;  2FXA A;  2V1N A;  2OZ6 A;  3SHF A;  4YFK F;  2Z33 A;  1U5T B;  3GTL J;  2PLY A;  4EJV A;  4ANJ A;  1TNS A;  3U2R A;  4NQW B;  4IO9 F;  5BOX A;  3DPL C;  1KU9 A;  5C4X J;  4FQG A;  4HSR A;  4NUB A;  2Z3Y A;  4B48 A;  5AON A;  1ORK A;  3PO3 J;  5KNL A;  5FGM A;  2DK5 A;  1QZZ A;  3Q5F A;  2IS6 A;  3CMA I;  4FX4 A;  2NOG A;  4V19 K;  1K7A A;  2NVX J;  2NAZ A;  3L00 A;  1R7J A;  1U0J A;  2YU3 A;  5KK1 A;  2Q8K A;  2JPC A;  3S3N A;  2JK3 A;  2WTE A;  4M6X A;  3RYP A;  3UKG A;  3BTL A;  4M6Y A;  2EV5 A;  1OFC X;  5L3G A;  1GT0 C;  3RPU D;  1HW1 A;  2P5V A;  3BT9 A;  2RV8 A;  2R92 J;  1Z7L A;  4MEY F;  3ML6 A;  4IQ4 A;  1T39 A;  4L5J A;  2NNY A;  4UB8 C;  1OCC H;  4HST A;  2HDC A;  5M3F J;  2VE9 A;  3MCZ A;  2A05 A;  2MD5 A;  4I98 B;  3DF8 A;  5EZH A;  1X1C A;  4KN4 X;  4OIQ F;  3ZMZ A;  2Y2Z A;  3FIW A;  3RPQ A;  1Z67 A;  3IRR A;  2BY1 A;  1JKP C;  2LYC A;  1B1B A;  3D5R C;  3ECH A;  3E97 A;  4TPV A;  4A6E A;  3VSL A;  3GYH X;  2KDO A;  5DV5 A;  2I8D A;  3CUQ B;  3GXO A;  1X1B A;  3OIO A;  1P4W A;  2GWR A;  4A0Y A;  3ISP A;  3H1C A;  2BE5 F;  3M7G A;  3N05 A;  3CC2 I;  3L09 A;  5JI6 A;  2MLK A;  3F6V A;  4QSH A;  1BN5 A;  3G1O A;  2IXS A;  2YX4 A;  4E7K A;  2QEX I;  2CQQ A;  1YFH A;  1QPM A;  2K9L A;  2VL8 A;  4A3B J;  2DDA A;  5B1A H;  1XDS A;  1OCO H;  1YS7 A;  5BQT A;  4PFP A;  1PUF B;  3RKW A;  5IP9 J;  1BI2 A;  2OUM A;  2GOM A;  2QLZ A;  1FOK A;  5J6X A;  2V4J C;  1HKT A;  3A0B C;  2LY2 A;  1PP7 U;  1YQA A;  2VKD A;  2NVT J;  2E36 A;  5LRS A;  4MIM A;  2CJJ A;  3CMY A;  3OYM A;  1X1P A;  5D5U B;  1OYW A;  5JHF A;  3HRS A;  3Q2U A;  1X58 A;  4GYI A;  5M5X J;  1FBS A;  2ZSI B;  4PJN A;  3E0J B;  2KRF A;  1ZTR A;  2DLL A;  4XRF A;  4II2 A;  5J1R A;  2NNN A;  2LSO A;  4RA2 A;  4B44 A;  5FKL A;  1PP8 F;  4IF4 A;  5FKN A;  2VJI A;  3G3Z A;  1MMD A;  2X6W A;  2LKX A;  2VI6 A;  4G6D A;  2Y9Y A;  1KU3 A;  3FMQ A;  1ZG5 A;  1OCR H;  3H9J A;  2LLK A;  2WC2 A;  4NB5 A;  2IAI A;  3TMO A;  5DUI A;  3M8E A;  3IUO A;  1Y39 A;  4RS8 A;  2NS0 A;  2XPV A;  3R6S A;  1QZY A;  1C0W A;  2X9D A;  2CQX A;  5LLQ A;  3JRE A;  2X1C A;  3H35 A;  3TBI A;  2QSF X;  4L9N A;  1OQY A;  4L9V A;  4G7Z F;  1P7J A;  1GVD A;  2EIK H;  1O3S A;  1GXQ A;  4PK4 A;  2QGU A;  2OAZ A;  3IWZ A;  1QVT A;  3LAJ A;  4RGX A;  1DP7 P;  3BPV A;  4KIG A;  1QNT A;  2Y75 A;  3WTS C;  4IJA A;  4YII A;  2EZI A;  3LA7 A;  1PUF A;  3PFI A;  2DAO A;  4RLF A;  2FQ4 A;  1TT5 B;  4DNC A;  3QRF F;  1NHA A;  1HST A;  3IKV A;  5ED4 A;  4HPQ A;  3HOY J;  4D53 A;  4Y52 J;  1UST A;  5CYV A;  1D1B A;  3FM3 A;  3PL8 A;  4HW0 A;  4K2E A;  4CA0 A;  1HW5 A;  4EM0 B;  3WGH A;  2KDZ A;  1QRY A;  2E7W A;  5EYR A;  4DW6 A;  4QPO A;  3BZK A;  2VJJ A;  2M0M A;  5CQE A;  2CU7 A;  3K4M A;  3QU6 A;  1NTC A;  3TOB A;  3CC4 I;  5B66 C;  3GFM A;  3SQN A;  2V6C A;  2XGD A;  3KIO A;  2PX9 A;  3WG7 H;  4X1E A;  1EH8 A;  3JR9 A;  1DPU A;  1ERD A;  2HU9 A;  1MJ9 A;  2VIX A;  4RMN A;  4MHG A;  1I3A A;  2DA4 A;  5GP9 A;  1E3P A;  3CD6 I;  3BC8 A;  4HDU A;  2QM3 A;  2NVQ J;  2MG4 A;  5KAF C;  3EQL F;  2IGO A;  2M7B A;  5JHU A;  3PUF A;  4S05 A;  3I54 A;  4LIU A;  1MSE C;  1APL C;  4B4C A;  2FOW A;  2D2W A;  4IHV A;  4B3X A;  4C3J J;  1LEA A;  1ZG1 A;  4A0X A;  3I64 A;  2E2I J;  4P1W A;  3Q9V A;  2A5W A;  2V6E A;  3RQ4 A;  4AM3 A;  3OYI A;  5H6Q A;  1XSD A;  1MBK A;  3LSK A;  4UUT A;  4EJU A;  4OIN F;  1TLH B;  1XG1 A;  5IYB J;  1BBY A;  2GA2 A;  3BY6 A;  2A3S A;  1BC7 C;  4XSX F;  3SDB A;  3K70 D;  5LEJ A;  4XKB A;  2GA1 A;  1X3W B;  3RJP A;  1IN8 A;  1YI2 I;  3LSP A;  5BMZ A;  3DP7 A;  3JTG A;  4KFC A;  2CUJ A;  2X0L A;  1RET A;  1Z21 A;  1SFK A;  2F5E A;  2O3F A;  3P5J A;  2GXA A;  1KON A;  2Z5U A;  1M1E B;  4BKX A;  5L3F A;  2XAU A;  2A5Y B;  2ECB A;  2VKH A;  1SFO J;  3C3W A;  2HVQ A;  4UNO A;  2EA4 A;  2O8X A;  4HV6 A;  4UVC A;  2M4G A;  1OCT C;  2RGV A;  4KYW A;  1XMX A;  2ADU A;  1IF1 A;  1VFC A;  1JKO C;  3H9Q A;  3HPH A;  1R9T J;  1TZL A;  2FSW A;  5IYC J;  4CXF A;  5IYD J;  3F23 A;  4CYC B;  1FNN A;  4N4N B;  2W57 A;  3H3V K;  2XB0 X;  2L54 A;  4E7I A;  2RRE A;  1YYV A;  2PMZ N;  4LG3 A;  3LAP A;  3BCA A;  2R7F A;  3TP0 A;  5K5O A;  3D1N I;  4IQJ A;  1Z91 A;  4IEJ A;  3WTV C;  4JQF A;  3IRQ A;  2FBH A;  2ZB9 A;  4ZDL A;  1K6Y A;  1QGP A;  3TED A;  1O3R A;  3NWT A;  1FC3 A;  1TL8 A;  1VQ8 I;  4CGZ A;  3REO A;  1O3Q A;  2CRG A;  3JSP A;  2R7S A;  3FXL A;  4AC0 A;  1XGM A;  1R6R A;  1UHS A;  3LMM A;  2Y48 A;  2V9P A;  2G7H A;  1YX5 A;  2JA8 J;  2YPR A;  2HVR A;  1VQ4 I;  4HLX A;  4RGU A;  3OYG A;  3J80 K;  4C9Y A;  2VON A;  1YJ9 I;  2CFX A;  4IVN A;  1DGR M;  4HDV A;  4LFU A;  5D5W B;  4BJ6 C;  3JRC A;  2WV0 A;  5BNG A;  3TKY A;  3BWG A;  3M07 A;  4BBS J;  2IS4 A;  5EEG A;  2OBP A;  3MKW B;  2R3S A;  3F8N A;  4LIT A;  1ACI A;  5K5Q A;  3AG2 H;  1X19 A;  5FJ8 J;  3J80 Z;  1Z7U A;  1Z6T A;  2L9S A;  5K5R A;  4A5N A;  3LSJ A;  3E5Q A;  2R7Z J;  4XLC A;  1EV7 A;  5GAG J;  3G6E I;  1UZC A;  1IAW A;  1D1A A;  2ZXJ A;  4W97 A;  3HOW J;  2XV4 S;  3A4C A;  1MJB A;  3LFK A;  4AIH A;  1T0F A;  1T98 A;  1TQI A;  4QPQ A;  5F0H A;  3L2V A;  2LD5 A;  2EWN A;  2E19 A;  4A3D J;  1Y0N A;  1FPQ A;  1GDT A;  2L9N A;  2KZG A;  2L4M A;  3M8J A;  4E7L A;  1VQM I;  2L0K A;  2ZJQ F;  4EEF G;  3GME A;  2L3D A;  4CCM A;  1I5Z A;  1G8X A;  4QTR A;  4C2M J;  3OYJ A;  2L2O A;  3NAU A;  3QU3 A;  4AUX A;  3S6V A;  3GVA A;  3QWL A;  5J1U A;  3M1E A;  1LB2 A;  5KAI C;  1Y0U A;  3E3V A;  3OWT A;  2VLA A;  3FDY A;  2EQR A;  1AKH B;  2OA4 A;  2LOO A;  5DEQ A;  3VPR A;  1KA8 A;  1ETK A;  1EF4 A;  4KJZ A;  2DA5 A;  4E6K G;  3HOX J;  4XR6 A;  4G7O F;  3SFI A;  4YFX F;  1FJL A;  2FF4 A;  2FU4 A;  3AG1 H;  4JP0 A;  5ILS A;  1W36 C;  3PNY A;  3OR2 C;  2P6T A;  2CGP A;  4C2T A;  3V7R A;  5EZG A;  1K83 J;  4ABZ A;  4U0Y A;  4LIV A;  3ZQF A;  4BHP A;  3FXK A;  1K78 B;  3FMR A;  4DBQ A;  2RNG A;  3ZQ7 A;  1MMN A;  3S15 J;  1IRX A;  4BQQ A;  1SVL A;  2HYJ A;  1IXC A;  2YX7 A;  2WY7 Q;  5HLI A;  1W5S A;  2M45 A;  2A68 F;  2HZD A;  1SMY F;  3VOD A;  5HS8 A;  2ZO4 A;  3HGG A;  5IP7 J;  2CV1 A;  3ZP5 A;  2JA2 A;  1XD7 A;  2IPQ X;  3WTY C;  2CW0 F;  3Q0U A;  1P6R A;  4YIR X;  2P7V B;  3PUB A;  2ZME A;  1U9N A;  3HYI A;  2PMZ A;  2EV6 A;  4HG2 A;  2JMW A;  2A07 F;  2WAF A;  4A3L J;  2BVL A;  2F5D A;  2F5C A;  2VQH A;  5JLX A;  4WXC A;  1BR2 A;  2DMN A;  3OYH A;  1NH3 A;  1HA8 A;  2CYY A;  5BS6 A;  2XSD C;  5DCM B;  3TDZ C;  3COA C;  3LFU A;  1TWA J;  3K0L A;  1ETV A;  2TDX A;  5C3E J;  3FKI J;  2DQL A;  1AKH A;  4MEX F;  2WB1 N;  1BR4 A;  1PVE A;  3ZMU A;  5F6F A;  4M6V A;  4BS9 A;  3S3M A;  5K1Y A;  3FXR A;  2B0L A;  3BR5 A;  5GTI C;  3U9G A;  4P9U A;  2O61 A;  2LRD A;  1P7I A;  1FBU A;  3V8J A;  4LD5 A;  5D8K B;  1FZP B;  1A35 A;  2B7E A;  1SVO A;  4OIP F;  2H27 A;  2Q2E A;  2YSR A;  2HS5 A;  3HIF A;  2EIN H;  3U3N C;  2W7N A;  1ODD A;  3C2G A;  2HYF A;  4MTE A;  3FBI B;  2HEO A;  4ZYD A;  2QKL B;  3JCU C;  4KIF A;  1LDK B;  3MN2 A;  3OY9 A;  2DMQ A;  5F27 A;  4FET A;  5F1J A;  2OTL I;  1VQ6 I;  2I5U A;  3ZQG A;  1YHQ I;  2ICW G;  4LJZ F;  2DO7 A;  5D6F A;  5J3L A;  3U1D A;  3TOA A;  2LF7 A;  3GZN B;  2MC3 A;  4BXU A;  3DXJ F;  4B8X A;  2R5Z B;  1OCZ H;  3BQY A;  5IT9 Z;  1ZYR F;  4CH7 A;  4A93 J;  3CJT B;  2A6H F;  3KYC B;  4N9I A;  4A2U A;  3QPT A;  2Z2S B;  1LDD A;  5L3C A;  1EKE A;  2P81 A;  3NRV A;  3KET A;  2LK2 A;  3L2W A;  1IDY A;  2RC4 A;  3H5R A;  5GPA A;  2B63 J;  3EET A;  2MYS A;  5DCM A;  2XHK A;  2ZFW A;  3HB9 A;  1GVJ A;  2LF8 A;  3DKX A;  3LNQ A;  3CO7 C;  2HVS A;  2IGN A;  2ACJ A;  2PI0 A;  2JSC A;  5E3N A;  4HF1 A;  5FB2 A;  4KNY A;  1IXR C;  4F55 A;  4LMY A;  4NHJ A;  5F0C A;  2MA3 A;  2PMH A;  4W1U A;  4WWC A;  3OIP A;  4JBA A;  4DQ2 A;  4EM2 A;  3PNT A;  2RNJ A;  3WGG A;  1SAN A;  1PDN C;  2E2J J;  1UAA A;  1ZGA A;  2M8E A;  3K4K A;  5KVR A;  2CSO A;  3FHN A;  4M73 A;  4IZZ A;  2GIZ A;  2IVM A;  4HQE A;  3GW2 A;  1WI3 A;  2D45 A;  3G2B A;  4XLF A;  2DJI A;  2FUG 2;  3GLL A;  1N75 A;  3ZCO A;  2CV2 A;  5HLG A;  5M3M J;  4E70 A;  1GLN A;  3IP4 B;  4NC6 A;  1Y8Q B;  5HLT A;  4KIB A;  1VI0 A;  1OMI A;  3O3K A;  3B02 A;  2LG4 A;  2CV0 A;  3V4G A;  1TW2 A;  3VOE A;  3FF5 A;  2E7X A;  2QSH X;  2R5Y A;  4BEH B;  1R36 A;  3AG4 H;  1BW5 A;  3G1M A;  3SZP A;  2FE3 A;  2R5Z A;  4HV5 A;  1T8I A;  1NK3 P;  3BR0 A;  1KQ8 A;  3DTI A;  1JKR C;  3F8F A;  5HDK A;  4UVB A;  1MBG A;  5JYS A;  4XLE A;  3FX3 A;  1LNW A;  5D4R A;  3LOC A;  4HEA 2;  4AD9 A;  1ZG3 A;  1YRN B;  2R7V A;  2WB1 A;  4XKV A;  5CVI A;  2DOF A;  1ZRF A;  4MTD A;  2VQC A;  4BL0 B;  4BNC A;  4HYE A;  1P2F A;  3S2H J;  1W4M A;  2DYS H;  1W7P B;  5CKT A;  1Z0X A;  1SD6 A;  4Q5S F;  2ZJP F;  2BW3 A;  3MFK A;  4WCG A;  5IP6 A;  3ONQ A;  5LHH A;  4M9X A;  3GBG A;  1WH7 A;  1ZAR A;  2RAE A;  2W00 A;  3L7W A;  4I0B A;  2XF5 A;  1B6A A;  4V2G A;  1B9M A;  1CQT A;  3LSR A;  4LG0 A;  1WCM J;  4RM2 A;  1R58 A;  1IN6 A;  1S9H A;  1LVA A;  2NS8 A;  1I39 A;  5B1B H;  5E1X A;  2XUB A;  4F3Q A;  2Y9Z A;  2VC1 A;  2NYX A;  4G94 A;  3H5A A;  3MZH A;  4F52 A;  2K9S A;  3CTA A;  1YJN I;  3KFW X;  3QPL A;  3OYE A;  3CF2 A;  2YUS A;  2ZBK A;  3BJA A;  1K6O A;  4B1R A;  2L7F P;  3WU1 B;  1WI9 A;  3ZMT A;  2L7Z A;  1Z05 A;  3EUH A;  2B9S A;  3QP5 A;  3DKY A;  2KIM A;  4AWX B;  3I58 A;  4GYG A;  1BR1 A;  4BEH A;  2O6G E;  4LY5 A;  3F6O A;  1SD7 A;  2KKO A;  3IKT A;  4XLP F;  1ZH5 A;  3IAS 2;  3CLQ A;  2JSP A;  3GX4 X;  1J2X A;  4OAY A;  2DTZ A;  4X6A J;  2K9M A;  1IRF A;  1XGO A;  3S1R J;  3BP8 A;  3AKZ A;  3KZZ A;  3F72 A;  3T0Y A;  2OU2 A;  1A31 A;  1YRN A;  1ETQ A;  3GZ5 A;  4LLL A;  3LA3 A;  3JTH A;  3KEO A;  4M3E A;  3JRB A;  3KP7 A;  3PM1 A;  4G9Y A;  3RKQ A;  1VQ7 I;  1WWX A;  3KPH A;  4RAF A;  2G9W A;  4BE0 A;  1W7P A;  3QPS A;  1WHU A;  4RGR A;  4KIT B;  4XLN F;  2UWM A;  1JHH A;  3GTG J;  2L02 A;  3VYS B;  1IUF A;  5A2Q K;  1ON1 A;  2DN0 A;  2HKX A;  2P7C B;  3W2A A;  4I01 A;  3VSK A;  4MQ9 F;  3KEQ A;  5TRD A;  4Y17 A;  3T8R A;  4IHS A;  1RR7 A;  3W3C A;  2ECC A;  2XGE A;  4D0P A;  1B8I A;  4E4H A;  3A01 B;  1U8R A;  4OU0 A;  2XF7 A;  2HXO A;  1G6N A;  2QWW A;  3N4M A;  4A3M J;  3IHU A;  3CCQ I;  5K7H A;  4M71 A;  1N78 A;  3GEZ A;  1W1W E;  3OYC A;  3W2V A;  4AU7 A;  5EF6 A;  5A2Q Z;  2L9V A;  2W84 A;  1L0O C;  2ZXH A;  2GXB A;  1F9N A;  4H0A A;  2QQ8 A;  5IT3 A;  2EFW A;  3D0S A;  4JX6 A;  4EV0 A;  1BJZ A;  2KQR A;  4B3A A;  2XF6 A;  1BI1 A;  2AXT C;  1Y1W J;  2VBY A;  2HOS A;  2VQL A;  1R5H A;  1BW6 A;  1BI0 A;  4RAY A;  4QLC U;  2IJL A;  1FYK A;  3OR1 C;  2O0Y A;  2BY2 A;  2BZT A;  2FML A;  2M9H A;  4FHT A;  3OS1 A;  4ZJZ A;  1VQN I;  3KP5 A;  2E1C A;  2L4A A;  3V7C A;  4C3H J;  3P9C A;  4YRV A;  1WRJ A;  4GGG A;  1IXS B;  2F5F A;  2X51 A;  2A6E F;  2PEX A;  1MND A;  2XAF A;  4P5O A;  9ANT A;  5JLW A;  3CCJ I;  5GTH C;  3O8H A;  4RDU A;  3WGI A;  4PJL A;  3MWM A;  1RPW A;  4M9S A;  1F4K A;  1FP2 A;  4RB1 A;  4HX4 A;  2Y0S N;  2CG4 A;  3ZQH A;  3DBR B;  4EJT A;  2HPI A;  5LEK A;  4A3K J;  3HRU A;  2DXI A;  1JKQ C;  3PJR A;  4GDF A;  1NG7 A;  2KP6 A;  5HOO A;  3A01 A;  1WGX A;  5AIQ A;  3L2R A;  4JX4 A;  4ASN A;  3FK7 A;  4BQO A;  5ERI A;  1XSX A;  1X1A A;  3IL2 A;  4KIC A;  2OJE D;  4IL6 C;  1K61 A;  2DTR A;  1HSJ A;  1VQ9 I;  2CW8 A;  2VT2 A;  2K3F A;  2QF7 A;  2GM4 A;  1GV5 A;  3NAR A;  4WXD A;  2BEO A;  3WE3 A;  4S0H B;  4BJT A;  2V1X A;  3ZOB A;  2DYR H;  3KZY A;  3CP2 A;  2IA1 A;  3SEZ A;  4LB5 A;  1G4D A;  3FM5 A;  1TTY A;  3Q2R A;  2DMU A;  1IO2 A;  2AXL A;  1JT6 A;  2GZW A;  3WOD F;  2H6B A;  1CFE A;  4U7B A;  4HZF A;  1ZR4 A;  5GAH J;  2EZH A;  1JGS A;  4KN7 X;  1MNE A;  4ETS A;  1HOM A;  3R60 A;  5DS9 A;  1V3F A;  3BG7 A;  4J19 A;  2GAU A;  1QO0 D;  1DU0 A;  5HOD A;  2EB7 A;  1IGN A;  3F8C A;  5TIS C;  4A3F J;  2NS7 A;  1ZGW A;  5EJC A;  1VQP I;  2IGK A;  1JGG A;  2HOA A;  4KMF A;  1E3H A;  2FBK A;  1G3T A;  1V4R A;  3BCB A;  3BJ6 A;  4NC8 A;  3BPX A;  3J7A O;  3J7Z I;  1X2M A;  1X2N A;  3M4O J;  1UHW A;  1HKS A;  3VYT B;  3HHG A;  4CYD A;  4EGZ A;  4KT5 C;  2HTJ A;  3G1L A;  1SEU A;  4OWR B;  4L9J A;  5B5E C;  1QBJ A;  5EG0 B;  1D5V A;  2DPD A;  1XN7 A;  1HCR A;  3H9G A;  4RB3 C;  4E7J A;  3BJO A;  3DV8 A;  2QBY A;  3HSF A;  3BG9 A;  3OOU A;  4A0Z A;  1IC8 A;  2QYO A;  1NG6 A;  1TT0 A;  3OMY A;  2LDU A;  3QYB A;  1MSF C;  2DT5 A;  1I50 J;  3OS2 A;  2DFF A;  2ESN A;  2FNA A;  2K02 A;  3MZ8 A;  3V8L A;  3DTE A;  1LFB A;  4CO8 A;  2WA0 A;  1VTN C;  5EEA A;  4XRS A;  2FD5 A;  2GXG A;  2K86 A;  4OMY A;  1MMS A;  5FD5 A;  1JI8 A;  2V1U A;  1LDJ A;  3NQO A;  4I99 C;  1WJC A;  4UB6 C;  1PUE E;  4PSX A;  2R7X A;  4IKF A;  3HGY A;  3BG3 A;  5IOY A;  2MBF A;  1MGT A;  2P4W A;  1GHC A;  1MH4 A;  3E6M A;  4AID A;  2BXY A;  5J8C A;  2UXX A;  5GAD J;  1T2K A;  2OQR A;  2IT0 A;  3AL0 B;  2Q1Z B;  3GFI A;  2M30 A;  4ESF A;  1RNL A;  1U5T C;  2E1N A;  3IC7 A;  2UUZ A;  2FOK A;  4O5V A;  2MH2 A;  3DBH B;  4R1H A;  4U88 A;  5LGU A;  3S16 J;  2WV1 A;  3LSH A;  3CDI A;  1VZ0 A;  3WTX C;  1WKM A;  2FQ3 A;  4L0Y B;  1YW7 A;  5JVG F;  3HOT A;  4ZTJ A;  1FYL A;  1P4A A;  4PCQ A;  3F8B A;  1RES A;  4A3C J;  6PAX A;  2QSG X;  3OYA A;  2Y0S A;  2DOD A;  1MMA A;  2HDW A;  2OD5 A;  1BL0 A;  1ZQ3 P;  3ZR8 X;  1R49 A;  1FBQ A;  2CW7 A;  5EGO B;  3C2B A;  2XGC A;  4CDG A;  3QYE A;  3OOP A;  1XDU A;  1BC8 C;  1A04 A;  1F1Z A;  2CO5 A;  3TP3 A;  4XOR A;  1T6S A;  1FEX A;  3DEW A;  5EG0 A;  2KL4 A;  3A1Y A;  3E5X A;  3ECO A;  3I4M J;  1R4M B;  3BTJ A;  4CUG A;  3MAJ A;  5B3S H;  1DUX C;  3SZT A;  2R7T A;  3X2Q H;  1ZKG A;  3OL3 A;  2OF7 A;  1FOX A;  1O3T A;  2F4I A;  3WE2 A;  1JJ6 C;  3KCC A;  3R4K A;  3VYR B;  4Y15 A;  4XLA A;  3CCV I;  1SD4 A;  3CF5 F;  5JVT A;  2UXN A;  5CJ9 A;  2J5O A;  2K7L A;  2K9Q A;  3EPZ A;  2CS3 A;  3HDD A;  3KEY A;  3CUQ C;  1ETW A;  2GOX B;  1YO5 C;  4IPA A;  1J5Y A;  4PDK A;  2COB A;  2GBY A;  1DQU A;  1WSU A;  2MAB A;  1JE8 A;  4ZYG A;  1OPC A;  4P9F A;  2XAS A;  1DGW Y;  2MH9 A;  1IN5 A;  3H0D A;  4CHU A;  4FE7 A;  1K4S A;  2VXD A;  4FE4 A;  4L18 B;  1D5Y A;  4XKW A;  1AU7 A;  3U3L C;  1UJ8 A;  4ZTF A;  3K2Z A;  2KLO A;  3HPG A;  2H94 A;  1FOY A;  2HQ5 A;  2X85 A;  5K7Z A;  2V9V A;  3VYU B;  2Y69 H;  2IS2 A;  1UMQ A;  3DBL B;  1SFE A;  3DU6 A;  3BQZ A;  1ZGJ A;  4LB6 B;  1B4A A;  2Q0O A;  1IDZ A;  1MJA A;  5EGO A;  1SFX A;  1SVM A;  2E1M B;  2W25 A;  3TO7 A;  3HOS A;  2HKO A;  2XPU A;  3BTC A;  3WU0 A;  3UR3 C;  5F1R A;  3HL2 A;  3GTM J;  2G0E A;  1W7P D;  4HQM A;  3OYD A;  2DA2 A;  4Z2Y A;  1TWG J;  3FXO A;  2H6C A;  3JW4 A;  3I4N J;  4U7D A;  5ILU A;  2LMD A;  4V2F A;  1R00 A;  1MH3 A;  1ZLJ A;  2L7K A;  2ZME B;  3ASO H;  1ULY A;  3K4J A;  5FKM A;  1ZLK A;  1FSE A;  3K69 A;  4GXO A;  3TW7 A;  2M0C A;  1K4T A;  1BI3 A;  1YW8 A;  3ABL H;  5CVU A;  1XTA A;  2QEN A;  3L9F A;  3SXY A;  2IW5 A;  5ICF A;  5LGN A;  2W1O A;  2N8G A;  4L5E A;  1FLI A;  3SZG A;  2HNH A;  2HQA A;  3IV5 A;  5JFR A;  2HR3 A;  1FMW A;  1WFX A;  3BOQ A;  3GTJ J;  4ESJ A;  4U0W A;  5E17 F;  3U1K A;  3GUD A;  3G4S I;  1G3W A;  3CJN A;  5DD8 A;  3NT8 A;  3DFG A;  1VND A;  3T1B A;  3IH3 A;  4OIO F;  1XS9 A;  4YIF A;  4LLN A;  1MDM B;  2W24 A;  1RKT A;  1WJB A;  4ENN A;  2ZNY A;  3RPU A;  1FY7 A;  3MQ0 A;  3WU2 C;  5HS7 A;  1ON2 A;  2MD0 A;  2O7O A;  3ZN0 A;  3DWL E;  2Q2E B;  2EPF A;  1G59 A;  4S04 A;  3IWF A;  3JRI A;  3EDP A;  1F5T A;  3UNG C;  1QNX A;  3HOU J;  1LUJ B;  2EIJ H;  3U21 A;  1R5G A;  1TBX A;  3WG9 A;  2KIU A;  4Y3O A;  2PMU A;  3WHC A;  3LWF A;  2OTJ I;  3EUK L;  2DA6 A;  2OV7 A;  1R5I D;  1FTZ A;  4HRI A;  3K2A A;  3FZV A;  3IH2 A;  5HDN A;  3VFZ A;  1A5J A;  3A2K A;  2JA5 J;  2H8R A;  2K4J A;  1BIB A;  4Q4Z F;  1G2H A;  1HBX G;  4XM3 A;  5CVJ A;  3L1P A;  2ISY A;  4NC7 A;  3GTK J;  3JRH A;  5FKK A;  2AQE A;  1I1S A;  1S7E A;  1MKM A;  1XB4 A;  5CVR A;  4XRM A;  2DA1 A;  4BGD A;  2LKS A;  4IHY A;  2C6Y A;  3S1Q J;  4UV9 A;  4Y13 A;  4XN0 A;  3ZQI A;  1KQ9 A;  3PFY A;  2V9K A;  4KUM A;  4EQQ A;  4L0Z B;  4E7Z A;  3KLO A;  4AYB N;  1R23 A;  1OIS A;  2GQQ A;  1MDM A;  5DD4 A;  4BAC A;  3BLY A;  4NUO A;  1J7K A;  2IBD A;  2ISZ A;  2COM A;  3KYD B;  1HDP A;  1ZR2 A;  1GV2 A;  4A6D A;  2FX0 A;  2AHQ A;  1TWF J;  2KHM A;  2CQ7 A;  1RIO H;  1CGP A;  3A02 A;  1LQ1 A;  3C7J A;  2X6O A;  1TC3 C;  4HF0 A;  4YG2 F;  3N97 A;  1U8B A;  3KZI C;  3S6U A;  5IT9 K;  4Y33 A;  1HXD A;  1TP4 A;  1Z3X A;  3DPT A;  3OSG A;  1H8A C;  4ZYH A;  2VJ5 A;  2ZNZ A;  4PJJ A;  3DKW A;  3V42 A;  3D5S C;  1OR7 C;  1POG A;  3DEE A;  1I1G A;  2FJ1 A;  1U78 A;  5GAE J;  5M5Y J;  1BJA A;  2R5Y B;  4TV7 A;  1VF9 A;  1RI7 A;  1KGS A;  1HW2 A;  2L01 A;  3P9I A;  2F4M B;  4YEJ A;  1X4O A;  3AG3 H;  2LKP A;  2CUZ A;  1O4X A;  2XAH A;  2O5R A;  4XIC A;  1OKR A;  1T0F C;  5EEH A;  1MBE A;  2QCO A;  2EA2 A;  3HKZ N;  2F5V A;  5LRR A;  2WAE A;  2XKO A;  2KIF A;  4G6T B;  1ZEL A;  3H5N A;  3CMM A;  2QQ9 A;  2VE8 A;  2VBZ A;  5IY5 H;  1KZH A;  3SDG A;  1D8K A;  5FFX A;  2BW3 B;  1IW7 F;  2NVY J;  4R8H A;  1V55 H;  3QOP A;  3QOE A;  4YFN F;  1ONV A;  3S8P A;  4G6Q A;  4DYQ A;  1N25 A;  1F36 A;  4NNJ A;  4LG0 B;  1R1U A;  4XKC A;  4XOT A;  3GZ6 A;  3K7A J;  3ZMD A;  4H4K C;  5BPI A;  4N9H A;  4UVA A;  2R7U A;  4LLG F;  3GF2 A;  4KIS A;  3T8T A;  1MW7 A;  4N4O B;  1MNM C;  1T95 A;  3I4P A;  3M9A A;  3V8K A;  3FXQ A;  1YTY A;  3F8M A;  1VQO I;  1R1T A;  3ZGK A;  4FTH A;  4RLQ A;  3K4B A;  4RB0 A;  5KCM A;  2O8K A;  1IZ1 A;  4ZDP A;  2VBX A;  1QPI A;  1E17 A;  2DI3 A;  2E2H J;  2FNP A;  3PQK A;  1A6I A;  2V26 A;  3LSG A;  1YLF A;  5J47 A;  4XBF A;  4I02 A;  4I6Z A;  3ULQ B;  2FMY A;  5E8I A;  1S7O A;  3FXM A;  2AS5 F;  2RDP A;  2CH0 A;  2Z1D A;  5KHD A;  4ZZD A;  1IV8 A;  2FEZ A;  2M1B A;  2UZK A;  2E35 A;  2BY0 A;  1A6Q A;  2LFB A;  3R0J A;  4ENK A;  1JHF A;  2CWE A;  3BR1 A;  2J5P A;  2EFP A;  1JXS A;  2LR8 A;  3RTR A;  5E8G A;  4D9J A;  1Q1H A;  2OZU A;  4NBQ A;  2EJR A;  1UG0 A;  4FIS A;  4O3M A;  2E5Z A;  5F0F A;  1Q1V A;  5FKO A;  4KMU X;  3V7S A;  2WY8 Q;  1LVK A;  1TQM A;  5L3B A;  3LQQ A;  2CQN A;  3S1N J;  3C18 A;  3TQN A;  4AYB A;  4D7M A;  4WK8 F;  5LBQ A;  1MBF A;  2OC6 A;  2M87 A;  1RUO A;  1LE8 B;  3I3L A;  4RB2 C;  1QQI A;  2JA6 J;  1RRJ A;  4IHX A;  1YIT I;  2ZXI A;  2KRH A;  3WTW C;  1VQK I;  4QIW N;  2HGC A;  1B8I B;  1D0X A;  1D1C A;  3ASN H;  4G2U A;  2E60 A;  2XRN A;  5E3L A;  1B9N A;  5FLV A;  2H8W A;  1Z1D A;  4BY7 J;  3K1M A;  4AVZ A;  1YG2 A;  2K5C A;  3ZQL A;  1IV6 A;  3TO9 A;  1TNT A;  1YIO A;  4QWQ A;  5DM7 F;  2H09 A;  2OPT A;  2DCE A;  4D5F A;  1DDN A;  4HBL A;  2XIG A;  2VBW A;  3ABT A;  3K4N A;  3KP2 A;  2KJC A;  2A61 A;  4YEL A;  1V5G A;  3F22 A;  1H9G A;  3CP8 A;  2Y0M A;  5E1Z B;  4BBR J;  3F0C A;  3Q0W A;  4U87 A;  1S7A A;  4IHT A;  3GLX A;  1JJ8 C;  3HRM A;  4BJ5 C;  2YS9 A;  2ESH A;  3JSO A;  1WJA A;  2R7D A;  3ABU A;  2JN6 A;  3K1N A;  2ME6 A;  2VOO A;  3BZ6 A;  3S14 J;  1MBH A;  1KYW A;  2X6X A;  4B47 A;  4OIR F;  2D1H A;  5ICC A;  2XAJ A;  1Y56 A;  3BDD A;  1UCR A;  2IA0 A;  2JZY A;  2HXI A;  5K7F A;  1T08 B;  2VUM J;  3I0T A;  4ENJ A;  2V7F A;  3HZJ A;  4PJ0 C;  4BQN A;  3HOV J;  1I27 A;  3ZXS A;  3BG6 A;  5E3M A;  1H88 C;  2DOA A;  4JYK A;  4HF2 A;  3DLL F;  1KU7 A;  3WTT C;  2TCT A;  4ITV A;  4XLH A;  3IH4 A;  1P9Q C;  1SFU A;  2HYG D;  4ZH4 F;  5FFZ A;  4RGS A;  5J4Y A;  4M72 A;  5HLH A;  2EIM H;  2R7Q A;  1LE8 A;  3ZRG A;  1UEL B;  3A03 A;  4GFB A;  2CUE A;  4I09 A;  2EK5 A;  2ID3 A;  3KP4 A;  3CME I;  2QVO A;  5HNH A;  1U9O A;  5DUK A;  4ZC3 A;  1PYV A;  1S8N A;  2VJ4 A;  5ICE A;  2W85 A;  2BGC A;  2DA7 A;  2IA2 A;  4EGY A;  1XC5 A;  3EUA A;  5LGT A;  2BVM A;  2K9N A;  2R7W A;  1P4X A;  4D7N A;  3E6C C;  4CZZ A;  4HOB A;  2ID6 A;  2JRT A;  2X1D A;  2UV1 A;  3KLN A;  3Q9S A;  3SEQ A;  3QPH A;  4P55 A;  2H1K A;  3ZMV A;  4XL9 A;  3GFL A;  2NVU B;  3Q0V A;  4LGW A;  2VOP A;  5M5W J;  3KYL A;  1UHM A;  4D1Q A;  1JUP A;  3ZN1 A;  1IN7 A;  5HNF A;  4J00 A;  1KU2 A;  2ELH A;  3DPU A;  3DCF A;  1R4N B;  1XMA A;  5D8L B;  3TL4 X;  3CJR B;  5E20 A;  3F3X A;  4CCN A;  2LRE A;  1IUY A;  4C2U A;  3J7A Y;  4RAZ A;  2QA4 I;  1FX7 A;  3VEP A;  3SFZ A;  3GTO J;  1QVU A;  4HNV A;  5HS9 A;  3K70 C;  2KIQ A;  1V5F A;  3TW6 A;  4BQA A;  2JWT A;  4CZC A;  1S6L A;  4XOP A;  3WTZ A;  2HI3 A;  4RAG A;  1U3E M;  2K27 A;  3FMS A;  3MMY B;  3MVP A;  3M1C A;  2L7M P;  3B6C A;  1CF7 B;  1U5T A;  3GWZ A;  2PFB A;  4IXA A;  1DU6 A;  1V54 H;  4NQW A;  4IOC F;  1B59 A;  3ROU A;  1MBJ A;  1EJ9 A;  4JX5 A;  5DM6 F;  3OV8 A;  3E6B A;  2JJ7 A;  4OAZ A;  1SMB A;  2ELJ A;  2E34 A;  4AIW A;  3HUG B;  3HHH A;  4RM3 A;  2PJR B;  4N0B A;  2QBY B;  3BR2 A;  3HSR A;  2IEK A;  2Y31 A;  5D4S A;  1P92 A;  2FRH A;  1B72 B;  5FO5 A;  1FTT A;  5CLS A;  2MW8 A;  2DPU A;  4IRH A;  4R79 A;  2R7R A;  2K85 A;  1ZRE A;  2HDD A;  1BOA A;  3RKY A;  1FIP A;  2JUG A;  2ZJ2 A;  3K10 A;  5FLM J;  2IRF G;  4ESB A;  1F43 A;  3HM5 A;  1E3O C;  2W48 A;  1LEB A;  1D3Y A;  3J7Y J;  4UUV A;  1T38 A;  3CLO A;  3EUH C;  4XN3 A;  2JUC A;  1ZHF A;  1YX3 A;  3GTQ J;  4Z6Y A;  4RBO A;  3PQJ A;  3BZC A;  3CUQ A;  3FBN B;  3H3U A;  1ZN2 A;  3VB2 A;  1Z9C A;  3K6G A;  3F21 A;  2STW A;  2F6C A;  4L5I A;  3OL4 A;  4EJO A;  4E7H A;  3CCS I;  4FX0 A;  3TDU C;  3BTI A;  3DEU A;  2VT3 A;  3I56 I;  1J75 A;  3O6B B;  5C44 J;  1CF7 A;  2DFE A;  3EYI A;  1T33 A;  4BDZ A;  3MKY B;  1UB9 A;  3GCM A;  3HC7 A;  4UHT A;  3I53 A;  1XCB A;  5D6E A;  3H3Z A;  2DFI A;  1USS A;  4BUP A;  2BBY A;  5LD2 C;  3S2W A;  4KA4 A;  1TWH J;  4FCY A;  3S3O A;  2VOD A;  3U3U C;  1I6H J;  1AWC A;  1JUM A;  2P0W A;  2DU9 A;  4ON0 A;  4LK0 F;  2M8G X;  3FKJ A;  3HUG A;  1WH5 A;  3E7L A;  3WTU C;  2PJR A;  2WBM A;  3RCO A;  1Y6I A;  2LY1 A;  1X1D A;  5J4V A;  1EH7 A;  2A6T A;  2BY3 A;  1OYI A;  2M4K A;  5ICG A;  1B72 A;  4A3J J;  2O9L A;  2F4O B;  3OYN A;  4UXN A;  3DQV C;  1DP3 A;  2P5K A;  3B6A A;  3MEX A;  4EM1 A;  1YJW I;  3QP6 A;  3K4C A;  3M8F A;  5H6R A;  2W4S A;  4IHW A;  3ERE D;  2HPM A;  3OIQ A;  5H2F C;  2RQP A;  1V5E A;  3I9V 2;  1KYZ A;  4GCV A;  4BXF A;  4XQF A;  1ZAO A;  3RQI A;  1VQ5 I;  2GLO A;  2DMT A;  4IX7 A;  3HBL A;  2HWV A;  4MLO A;  2P8T A;  3KX2 A;  4UUS B;  1QU3 A;  4BU2 A;  1JTX A;  3L2Q A;  5J40 A;  2XC7 A;  4II3 A;  2D5V A;  1X3U A;  4CSW A;  2RKH A;  1QHH D;  1TW3 A;  3RKX A;  3S93 A;  1I3Q J;  2EFN A;  3M3Y J;  2YR2 A;  3CCE I;  1SD5 A;  3C2H A;  4X0G A;  2R0Q C;  4ENM A;  2V79 A;  3O2P E;  4MFE A;  1U6G A;  1IG7 A;  3ZPL A;  5LHG A;  1MD0 A;  1J9I A;  4F7Z A;  1UFM A;  5J8F A;  5L3D A;  3S1M J;  2VXZ A;  4U0V A;  3QOD A;  3FHZ A;  4A5M A;  5FLX K;  5FRN A;  3E5U A;  4DGW B;  3SJM A;  4L9T A;  4DYC A;  1R71 A;  1TWC J;  2RVC A;  3RSN A;  4M3F A;  2D1V A;  2HOE A;  4PSW A;  3OSF A;  1W0U A;  2CMP A;  3I5U A;  4BHC A;  1MZB A;  3K4L A;  2BYV E;  1E0E A;  3MZY A;  2DMP A;  2LC2 A;  4XNF A;  4Q47 A;  5FLX Z;  4F91 B;  2HFH A;  1SC7 A;  5C4J J;  3AFH A;  3JRD A;  1XPX A;  4CCJ A;  3I71 A;  5GPC A;  2LNB A;  1W5C C;  5E3O A;  2HQR A;  4NDL A;  2XRO A;  1H89 C;  3DLA A;  4BH9 A;  1RUN A;  1YIJ I;  3RZD J;  1L3L A;  2JA7 J;  2PJP A;  4KT6 A;  1E2X A;  3PIO F;  3L2C A;  4Q48 A;  4A3E J;  3E6D A;  2K3P A;  1O7F A;  3VWB A;  2DBB A;  4BXX J;  3LST A;  2NOJ B;  1OJL A;  1WPK A;  2L5Q A;  4M9Z A;  5HVQ C;  1WJF A;  2K4B A;  2IP2 A;  5J1Y A;  4IOA F;  2NXN B;  4IRG A;  4UUS A;  2PBI A;  1REP C;  3FK6 A;  3JAM K;  4Y7N J;  1FOW A;  2RQQ A;  4HNT A;  1MMG A;  2EIL H;  1W5T A;  4A12 A;  2EH3 A;  1AOY A;  4AIK A;  1LFP A;  2LTP A;  2MSY A;  5FD6 A;  5F04 A;  1FP1 D;  2E1O A;  1ETX A;  1EA3 A;  1HC8 A;  2M2E A;  4G8X A;  4CCL A;  4D5C A;  1O57 A;  2X4H A;  5JR3 A;  2BXZ A;  1U53 A;  2MFZ A;  1FMV A;  2XVC A;  4XON A;  3QAH A;  3SYT A;  3JAM Z;  2HQN A;  3FIS A;  1IRG A;  1XCV A;  3E1S A;  4EJW A;  1IJW C;  1FT9 A;  4M3G A;  2X6Y A;  2JRM A;  2WAQ N;  1SAU A;  1Y8R B;  3HXL A;  1XGS A;  1W0T A;  1FWZ A;  2ELK A;  1H9T A;  2LVS A;  1OR7 A;  4JK1 X;  3K9T A;  2M5W A;  1WQ2 A;  5IPA A;  3W2W A;  3S6S A;  1N77 A;  5BPD A;  3EYY A;  5D5X B;  3ZQC A;  3ZMS A;  4EMS A;  1DPR A;  2KMU A;  3OS0 A;  2M7A A;  4UY8 I;  3FXU A;  2WAD A;  1J0R A;  1G3S A;  3PSI A;  3JRG A;  1ETO A;  1X3Z B;  3DTK A;  4CYC A;  4IFA A;  2QUF A;  2H1L A;  2QKM B;  3BR6 A;  5DTD A;  4NUI A;  4M74 A;  3AAF A;  4MNU A;  5E1W A;  2ZC2 A;  1O7L A;  3MKL A;  4ZYE A;  1R1V A;  4M3D A;  3ESW B;  4MGR A;  4I0A A;  3RIR A;  2P6S A;  3NWS A;  3CCY A;  1XX5 A;  3HJE A;  1FIA A;  2RN7 A;  3FWE A;  3OYB A;  3W6J B;  2ZJR F;  4GO1 A;  4P27 A;  4M3B A;  2R7O A;  3JRA A;  2VB6 A;  2KPM A;  3CCU I;  4WF2 A;  1EH6 A;  3RZO J;  4P96 A;  5CPR B;  3O8G A;  4BAY A;  3BG5 A;  2ZSH B;  1JTY A;  1RKW A;  3LA2 A;  2ME0 A;  5FRO A;  2NRA C;  4BE2 A;  1ZRC A;  4I7H A;  2DQR A;  3TO6 A;  1ITY A;  2FA5 A;  2XAG A;  2ETH A;  2ZFU A;  4DYR A;  3F9K A;  3D5L A;  4WX9 A;  1STZ A;  2XAQ A;  3TGN A;  5CVV A;  2JPB A;  1WJE A;  3WHB A;  3S17 J;  3PO2 J;  3MKZ A;  5DCF A;  1ZK8 A;  4H0E A;  1WJD A;  4ZDO A;  3CCM I;  3VDX A; 
#chains in the Genus database with same CATH homology
 4NUI A;  2CQ7 A;  3U3N C;  2DDA A;  3Q2U A;  4D53 A;  4NUN A;  1XTA A;  3S6U A;  1RC9 A;  3MZ8 A;  3S6V A;  1XX5 A;  1SMB A;  3S6S A;  5JYS A;  2GIZ A;  2VZN A;  4P27 A;  3Q2R A;  1U53 A;  4AIW A;  4H0A A;  2DDB A;  2EPF A;  4NUK A;  4LY5 A;  4G2U A;  4NUO A;  1CFE A;  1WVR A;  5ETE A;  3U3U C;  1QNX A;  3NT8 A;  3U3L C;  2A05 A;  4TPV A;  4IFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...