2DDBA

Crystal structure of pseudecin from pseudechis porphyriacus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
207
Chain Sequence
b'NYQKEIVDKHNALRRSVKPTARNMLQMKWNSHAAQNAKRWADRCTFAHSPPNTRTVGKLRCGENIFMSSQPFPWSGVVQAWYDEIKNFVYGIGAKPPGSVIGHYTQVVWYKSHLIGCASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADCPSACVNRLCTNPCNYNNDFSNCKSLAKKSKCQTEWIKKKCPASCFCHNKII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudecin
publication title Structures of pseudechetoxin and pseudecin, two snake-venom cysteine-rich secretory proteins that target cyclic nucleotide-gated ion channels: implications for movement of the C-terminal cysteine-rich domain
pubmed doi rcsb
molecule tags Toxin
total genus 60
structure length 207
sequence length 207
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
A PF08562 Crisp Crisp
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.740 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Crisp domain 2ddbA02
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 2ddbA01
3S6VA 4NUNA 2DDAA 2CQ7A 3Q2UA 3U3UC 1QNXA 1RC9A 4IFAA 3S6UA 3S6SA 2VZNA 3U3LC 4D53A 2DDBA 4NUIA 3MZ8A 4AIWA 4G2UA 1WVRA 4H0AA 5JYSA 4LY5A 2A05A 4TPVA 4P27A 3U3NC 1CFEA 1SMBA 2GIZA 4NUOA 3NT8A 5ETEA 2EPFA 1U53A 4NUKA 1XX5A 3Q2RA 1XTAA
chains in the Genus database with same CATH superfamily
3S6VA 3BQZA 4EGYA 1IXRC 1K4TA 1YJ9I 3LA2A 4LJZF 1WH5A 3V8KA 4A6EA 1ETOA 5CPRB 3CC4I 1IXCA 1RZ4A 4KN4X 3ZMVA 2E71A 3A02A 3J7AO 3JRCA 2ADUA 1ZYRF 4X6AJ 2CO5A 2YUSA 4N4NB 3IP4B 4KN7X 3K70C 1D1AA 3AFHA 2GXGA 5FLXZ 1VQPI 5BMZA 1F1ZA 4F3QA 2G9WA 1XDUA 2HVSA 4EJOA 2P5KA 3GFIA 2MFZA 5HNHA 5GAEJ 2O7OA 3T5XA 4DW6A 3A2KA 3ZQFA 2AXLA 2E5ZA 3U2RA 4BQQA 3WU1B 3SHFA 4II2A 4BKXA 1U8BA 2H27A 1W7PA 1WH7A 4HOBA 4HSRA 2M1BA 2I10A 3NQOA 3HSRA 3CD6I 3PIPF 1WVRA 4B43A 1R9TJ 2EFWA 2OCEA 4G7HF 1RIOH 1B8IA 3KYDB 1C0WA 2LTPA 4GXOA 3OR1C 5DYMA 3PL8A 3TEDA 2BZTA 1WPKA 3KLNA 3Q0VA 4YIFA 3OSGA 3KIOA 3HTSB 3FHNA 1FOYA 2VT3A 4JK1X 3QP5A 1LFBA 3S8PA 2LR8A 2XDVA 1R1TA 2WB1N 1LVKA 1V5FA 5FKLA 4S05A 3JTHA 3COAC 2DTZA 3A1YA 3D5RC 3GTQJ 2VXZA 3FMRA 5LD2C 1W1WE 2L3DA 5KAIC 1PP7U 5CVVA 4BJTA 4BDYA 3QPHA 3S3MA 1Z7LA 5HDNA 3IC7A 3DEWA 1LNWA 3ECHA 2D2WA 1R49A 3F21A 4V19K 3SDGA 1A31A 1OISA 2XGEA 4KICA 3BT9A 2HU9A 4U0YA 3P5JA 1LDJA 2OZ6A 2R7RA 2R3SA 2IP2A 4HQEA 1QVUA 2DXIA 2QM3A 2WY8Q 2DI3A 4HNVA 2IBDA 1W36D 3L9FA 1MIJA 2WV0A 1Z6RA 2I8DA 4ETSA 3ABTA 5EEGA 3A0HC 1MNEA 1WJFA 1UB9A 4Y4RA 2VIXA 5FFZA 2TDXA 2QQ9A 2JVHA 5LEKA 2HR3A 2OAZA 2JA8J 1SD7A 3RYPA 2GAUA 2O5RA 1Z21A 4JP0A 3CO6C 5GAGJ 1F5TA 2K27A 1Z6TA 3BWGA 3EETA 5F0CA 5LLQA 2Z3YA 3PSIA 1IO2A 2HOTA 2BEOA 1W5TA 4CZCA 2OA4A 1AA7A 5E1WA 2LMDA 3I59A 3CMAI 3G3ZA 3DPTA 3V8LA 5IOZA 1X3WB 1XD7A 4E6KG 2EK5A 1BOBA 3OYJA 4WK8F 4L0ZB 1JI8A 2QVOA 1T6SA 3F8NA 4D7NA 3R0JA 2H6BA 2R0QC 4L5IA 3Q3SA 1TZLA 3D1NI 2O0YA 1BC8C 1JJ8C 1D5VA 1YIOA 4CYCB 4Q5SF 3S2WA 3TGNA 5IYDJ 3E97A 4DZJA 2IW5A 2A68F 4ITVA 1FBUA 4LLNA 2X9DA 4XOPA 2DA2A 2FQ3A 4LLGF 4ZZDA 1EH6A 4M9ZA 4I6ZA 1MJBA 4L9JA 3FF5A 4R79A 3M4OJ 4XK4A 5ILVA 2V9VA 2QKMB 2O03A 2RVCA 2CW7A 2DDBA 2DMUA 3J7AY 4PJ0C 3WTUC 3K4CA 3BTJA 1X1AA 3P9KA 1TQIA 2LREA 4NDLA 2JUGA 1ACIA 2LBFA 2UXXA 3HXLA 3QOEA 2DYSH 4JX5A 2WC2A 2DMTA 1Z0XA 3ABKH 2VC1A 3CDHA 4E7IA 1IW7F 2VN2A 2KKOA 3FMSA 2CUEA 1MDMA 1SFKA 1D1CA 3KYCB 3HPHA 2DU9A 4CXFA 4B4CA 4ESFA 1Y6IA 2CW0F 1MH3A 2PFBA 3P9CA 4OIOF 1MH4A 1RC9A 1ODDA 2VC0A 4NUIA 5D5WB 3E5XA 4FX0A 4ABZA 3OL4A 1X1CA 3K4BA 2L7MP 3DTKA 5K7ZA 1I39A 4RGXA 4LY5A 2DMPA 2JK3A 2VPRA 2C6YA 2A61A 3IAS2 3TO6A 5J8FA 2GIZA 3P7NA 1FSEA 1XX5A 3QRFF 1VNDA 2CWEA 1HC8A 3HRTA 2FA5A 2HZDA 3DKWA 3IH3A 4A3EJ 2CQQA 2F4IA 1WGXA 1S7OA 4AU7A 2W57A 5DCMB 3TBIA 1OCCH 1BI0A 4NB5A 5LBQA 2M0CA 3ZP5A 1W5SA 2A07F 1HW1A 4Q47A 4EJTA 2JRMA 3ZGKA 4XRMA 4F52A 1LUJB 4HDUA 3SZGA 1WJEA 2UXNA 4ON0A 1XDSA 4A93J 4C9YA 5FRMA 4X0GA 3S2HJ 1VQ4I 1ZLJA 2Q0OA 3MEXA 2CS3A 2KPMA 5JVGF 2F5DA 3H9QA 5ED4A 3I0TA 3WTVC 3G73A 4PGGA 3OYKA 4PK4A 2KRFA 3ZMSA 2XAFA 3MKZA 3GMEA 5L3CA 5KNLA 2R7WA 1W0UA 3JAMK 2WA0A 3OYCA 2QLZA 2Z5UA 1LB2A 2PI0A 2EZHA 1Z1DA 4PJJA 4P9UA 4IRIA 5HS7A 1XCBA 1TP4A 2O3FA 1R71A 1VQLI 3J80Z 3HSEA 3WTWC 3OYDA 4U88A 3D5SC 4BU2A 5IP6A 1JGGA 3HOUJ 4II3A 5CVIA 1G8XA 2EZKA 2L54A 4XM3A 1IN8A 2ELKA 2FBHA 5TRDA 1YI2I 1GUUA 4XLHA 3LSIA 3WG7H 2JUCA 3N4MA 4IVNA 4OIQF 2BE5F 2MH9A 2KJBA 4RAGA 2L7KA 2VXDA 4BQNA 5DD4A 3MVPA 5K5RA 4ZDLA 2WBMA 2ZFUA 4F7ZA 3FX3A 1FP1D 2G7HA 2GBYA 4ESJA 5IT9Z 1OCRH 2A3SA 2XGDA 3C3WA 4CZZA 2L2OA 1KU3A 1XC5A 2JJ7A 1JXSA 5J1YA 4XLPF 1QHHD 3ZR8X 1LVAA 1KONA 2CQKA 3OOPA 5DS9A 5L3FA 3LAJA 2ZKZA 2QQAA 2CGPA 4H0EA 2XPVA 2E60A 1CQTA 1YIJI 2PJRB 4BH9A 3AG3H 1O7FA 4EM1A 3K70D 4WX9A 2J5PA 2NVYJ 5JFRA 4HW0A 4CO8A 4XLCA 3F8BA 2VE9A 5K5QA 4MGRA 4WWCA 4A6DA 3QYEA 4I99C 3HC7A 4LGWA 4IL6C 4AIKA 4B48A 3CLQA 3FXKA 1ITYA 3TKYA 3K0LA 3VB2A 1IJWC 3IWFA 1OPCA 4PUSA 5E3NA 3BR3A 2IT0A 4C30A 1Z3YA 4BBRJ 2FSWA 4NUBA 4GRIA 2I5UA 3ESWB 3IKTA 2W25A 5JLXA 2ID3A 2VKEA 4D1QA 3LNQA 1I1SA 2E1MC 3CDLA 4IEJA 1Y8QB 2BW3B 2W4SA 3HGYA 5HLIA 4ZH4F 3F22A 1D8KA 1BC7C 5D5XB 1SFEA 1IN5A 2HKXA 3DXJF 2E36A 4HX4A 5IY5H 1JUSA 1ZQ3P 4NQWB 4I98B 3EUHA 3GWZA 1PUEE 1P9QC 1YYVA 4CCKA 1TWHJ 3QYFA 1K6OA 1QU3A 1GLNA 3BROA 2CUJA 2JA2A 2WAFA 4RM3A 5J40A 2VUMJ 2ESHA 3OOUA 2W82A 2ZBKA 4KFCA 2PQ8A 5LGUA 2HXIA 3DV8A 3GFJA 3LQRA 2NS0A 4RAZA 3S1MJ 4FQGA 1T33A 5H20A 3T1BA 3LSKA 4JBAA 1E17A 3HOXJ 2HPIA 2LNBA 3M8FA 5IYBJ 1K78B 1P6RA 4IHSA 1ETXA 2OQGA 3OIOA 1STZA 3M8JA 3MFKA 2E5NA 5GP9A 1B72B 2AQFA 2Z2SB 3GTJJ 5J47A 4ZTJA 1TT0A 3U9GA 2HEOA 3VSKA 2AXTC 3ZQHA 1UHWA 3F6OA 3S6SA 4ZYEA 1Y8RB 4CYCA 2K4BA 4AIWA 2M4KA 3FBIB 4B47A 4AIDA 5A2QK 3C18A 3V7RA 2K02A 2GOXB 1D3YA 1FMVA 1XGNA 2V1NA 2OBPA 3JRGA 3BQYA 3PNTA 1FTTA 1KU7A 4DBRA 4MEYF 2K3FA 3MKYB 2OZUA 1P4WA 3M07A 1QVTA 4AD9A 2QYOA 1ZH5A 1O3TA 1R6RA 4ZZLA 2F2EA 1O3SA 4IXAA 3CO7C 2AO9A 4C3JJ 4RBOA 2LKXA 3HEFA 4HNUA 1IV6A 2VODA 4G2UA 2TCTA 1TWFJ 2E2IJ 2V79A 2VQGA 1ZGWA 5C4XJ 2CFOA 2HKOA 5IP9J 5C3EJ 3I71A 2Y30A 4UVAA 1J59A 4WXDA 2V9PA 2L01A 3OYBA 1QPIA 2HTJA 2YSRA 2M30A 3RSNA 3HRMA 4HLYA 3DU5A 3FDYA 2D5VA 3TO7A 3JRHA 2X1EA 2PMZN 5EZGA 1AOYA 2IXSA 1BOAA 2FF4A 4ZC3A 1S7AA 5C44J 1HBXG 4AVZA 4EGZA 3H3VK 5E17F 2JPCA 3GZ6A 2PMUA 3ASNH 2HQ5A 2PG4A 1G59A 2DOEA 1FBQA 1JTXA 2F5VA 4UUTA 2XRNA 4HYEA 3K1MA 2DK8A 4DNCA 1MBKA 2UV1A 2BY2A 1U9OA 3Q5FA 3H0DA 4B3AA 1CF7B 1G3YA 3ABLH 1UHMA 1W7PD 2Z99A 4DQ2A 1DU0A 2X1DA 4XLNF 5F0HA 3GYHX 1QHGA 4DBQA 4PFOA 1XB4A 3BPVA 5DCMA 3SEZA 2HOSA 1BA5A 5HLTA 4NUKA 3FXLA 2QBYA 3I54A 4M6YA 4KA4A 2EIJH 3LSJA 3I4MJ 2FMYA 2ELJA 3DKYA 4M9SA 3QU6A 2DFIA 4A3FJ 1R1VA 2ACJA 4G6DA 1FIAA 2KRHA 4QWQA 3JREA 2GM4A 1OYYA 3FK7A 3E5UA 4XONA 3EUHC 1B1BA 1IDZA 3T8RA 1TNTA 3OS2A 3U21A 3S32A 4IPAA 1B4AA 3CJNA 2K9LA 3HOVJ 4C3IJ 3KZZA 2IPQX 4HF2A 2RGVA 2EZIA 2LF8A 3M3YJ 4EM2A 2R7XA 2XC7A 1FLIA 3KFWX 1KU9A 2XPWA 1QO0D 2L7FP 2M87A 3M1CA 3JSOA 2XASA 3HOYJ 2E1OA 4G94A 4K2EA 4ZYGA 3EYYA 3GTOJ 1YG2A 3CCSI 1Q1HA 3CC7I 4RLQA 1N25A 3ZN0A 2DK5A 2EJRA 2MYSA 2ZNZA 3JRAA 3FKIJ 2VJ4A 1MD0A 1WFXA 5M5XJ 1B9NA 2L02A 3JRBA 3C2HA 1OQYA 1X2MA 3ML6A 1Z3XA 4G7OF 1FMWA 2W00A 2KIMA 4U0WA 3LQQA 3CDIA 1ONVA 2IVMA 5DM6F 2GLOA 5F1RA 4J00A 2VQCA 1IRXA 2KIFA 4QLCU 2R7FA 3CJTB 2LYCA 1J5YA 5LHIA 2GOMA 3MZ8A 2X6YA 2FOKA 3OYNA 4L0YB 2EH3A 1D0XA 2O8KA 3DEUA 3H5NA 3EUAA 2WWYA 1TWAJ 4XN0A 1KGSA 1QZEA 3E1SA 3M1EA 4C3HJ 2YR2A 3BPXA 1G4DA 2DT7B 3E6BA 1RPWA 5CVJA 3ASOH 4Y15A 2RN7A 2QCOA 1TNSA 1Y1WJ 1MKMA 1Y0UA 1YE9A 1ETYA 3Q0UA 3ZQIA 2QSGX 1ULYA 3CMMA 3PJRA 3WTZA 2M0MA 1SVOA 3KZIC 1XMKA 5EDNA 4OU0A 1S29A 3K6GA 4UUVA 2HQNA 2E1CA 2UWMA 1A04A 3WE2A 2M45A 4IOAF 3ROUA 1BR1A 1DGWY 1LDDA 3W6JB 5HLHA 2H1KA 3HUGB 4D53A 5FD5A 4XOTA 1REPC 1BI2A 2M3AA 1LEAA 1V54H 4FE7A 3ULQB 1XG1A 1R23A 2J5OA 3VOEA 4CICA 5F1JA 3IRQA 2QZ8A 4PJLA 2LFBA 2VBZA 1O3RA 3VYSB 1UCRA 2R7QA 4AYBN 2MC4A 3HTUA 2W48A 4Z2YA 4BAYA 1YRNB 3PFIA 1S9HA 4DOZA 1EJ9A 1E0EA 2E7WA 2VOPA 3OIQA 4AC0A 5J1RA 2O6GE 5CYVA 4A3IJ 3OIPA 4M3DA 2FMLA 2LK2A 2GQQA 1IRZA 4HV6A 1ETQA 3V4GA 2MD0A 3C1DA 1KQ8A 1JGSA 1MMGA 4Z6YA 3S15J 1SD6A 3FXRA 2ICWG 2D45A 4LD5A 1MMSA 1WCMJ 2VONA 1U2WA 5EG0A 4NC7A 3VDXA 3TO9A 5D4SA 2E34A 3Q0WA 4BHCA 2ZXHA 1LEBA 3SDBA 4DGWB 4GDFA 3L7WA 2JT1A 2BV6A 2DA1A 2HXOA 2IJLA 3AG4H 1R5HA 2K4JA 1Q1VA 3VYUB 5F64A 3X2QH 3F8FA 2DBBA 2ZXWH 3GCMA 3VYTB 1X2NA 4DIQA 3W2AA 4LIUA 1K7AA 3OYEA 3R4KA 1ZTRA 4P5OA 4A3BJ 3M7GA 1UG2A 2EZLA 2CSOA 1RRJA 1K61A 2V1XA 4UVBA 3BCBA 1KYWA 4Y3OA 3MKLA 2OTJI 2AHQA 4M3GA 1JHFA 4IHYA 4BEHA 3ZMTA 2Y9ZA 2ZXJA 1WJCA 5LGTA 2FX0A 1BI1A 2DA5A 4OIRF 2L7ZA 1ON2A 2H8RA 1PP8F 2IGMA 3H0GJ 4XRFA 3NARA 1BW6A 4LFUA 2QSFX 3HBLA 1TW3A 1RETA 2ZMEB 2CQXA 1EF4A 3I58A 1DPUA 1YS6A 4NC6A 4FTHA 2CFXA 1IUFA 2A6TA 3WTTC 5BS6A 1ZELA 2R7SA 1YW9A 2B9SA 4FHTA 1ZGJA 2B7EA 3OSFA 1HOMA 3KP7A 5KVRA 1ETVA 2PEXA 4M73A 3CCJI 5E1ZB 4IKFA 3SXYA 3OYAA 1X3UA 3G1MA 4P96A 3OYGA 3RJPA 3TW7A 5AIQA 3ECOA 4DYCA 2DLLA 4KYWA 1A6QA 2M7BA 4N9IA 1YX5A 2DFFA 3V8JA 2EV0A 3ABUA 4N0BA 4C2MJ 2HTSA 3IH2A 2DPUA 5E8IA 4D5CA 1K83J 1YTYA 5JHUA 2ZFWA 3K1NA 2IS6A 1Z05A 2HZTA 3EYIA 1IN7A 1B9MA 2VBWA 3MKWB 4BXUA 1USTA 2H94A 3IHUA 4G6TB 1P2FA 3MCZA 3K4NA 4KT6A 4IHTA 4XMYA 3RI4A 3QPTA 4HBLA 2G0EA 1VF9A 3MN2A 2Y48A 5J3LA 2E7XA 3BTCA 2EA2A 4A5MA 2QWWA 5HVQC 3N05A 1QRYA 1T2KA 2VQLA 3B02A 4YIIA 2EV6A 1U5TB 1MBGA 3PNVA 3QU3A 3EDPA 5IPAA 5D5UB 5JYSA 4A0ZA 2M7AA 5FLXK 4UUSA 2DQRA 3T0YA 4HQMA 1OFCX 2VOOA 3T8TA 4LK0F 2XSDC 5K7FA 1UJ8A 3DQVC 2XAJA 4ZDPA 2VJIA 2E35A 1DP3A 2VZNA 3KEQA 4O3MA 1UELB 1BBYA 4A12A 5BPIA 4FETA 4HF0A 5H6RA 2XKOA 3DLLF 6PAXA 1IGNA 5F6FA 3VFZA 3I64A 2HQRA 3VSLA 3OY9A 2KISA 4IQ4A 4XR6A 3SEQA 3S2DJ 1EA3A 1Y56A 2D1HA 1UZCA 4Y7NJ 4CCLA 1VQ5I 1OYWA 3FXJA 1MBEA 3IUOA 4N9HA 2MW8A 5TISC 3DBHB 2BBYA 2EQRA 4ENMA 2FXAA 3S3OA 4HPQA 4KMUX 1P4AA 3U1DA 1I50J 3BZKA 1YLFA 2IEKA 2Q1ZB 2RC4A 4G7ZF 1W0TA 2CV1A 1HSJA 5B5EC 2XB0X 4LK1F 4X1EA 3OYIA 1H88C 1LKXA 2Q2EB 5ERIA 2QQBA 2R5YB 5L3EA 2NVXJ 3K10A 3VYRB 2HVRA 2LH9A 5B1BH 3KETA 3A0BC 2K7LA 2K9QA 4IHWA 2EINH 2VB6A 3G2BA 4F92B 4J19A 2IGKA 2LP0A 1SAUA 3WU2C 3KYLA 2VJJA 1P7IA 1BI3A 5L3DA 3VWBA 4BY7J 5JHFA 2STTA 3DPLC 5DDGA 1HW5A 2BXZA 3A01A 5F08A 2V7FA 4MFDA 3J7ZI 3OYMA 3ERMA 5FLVA 1K6YA 5M3FJ 5CJ9A 4A3JJ 2W1OA 1FEXA 1FPQA 4U87A 2F4OB 1WQ2A 2JN6A 5D6EA 1ZR4A 1FX7A 1GXPA 4QPOA 1QBJA 5EGOA 2K9SA 3AL0C 2VQHA 1UHSA 4XORA 4JOMA 3QQAA 3CP8A 3LSHA 1V55H 4CCNA 4ZJZA 3RPUA 5BQTA 4YELA 4KIFA 3CUQB 2P6SA 4UY8I 1SANA 2K5CA 3OYFA 3P9IA 3H3UA 4XKWA 1GHCA 3IL2A 5DUIA 2GIVA 5D6FA 1YRNA 2ZXIA 1R36A 2E1NA 2XF7A 3WGIA 2F6CA 3R6SA 5FFXA 2Z9OA 2OU2A 5J4VA 1FNNA 3GW2A 5CQGA 4LB5A 3GX4X 1CFEA 3OWTA 3DP7A 5FKOA 3V7SA 2XAGA 3V42A 2X6XA 4CYDA 2Z1DA 2ZSHB 5FKNA 3TDZC 3L1PA 2V9KA 4IHVA 1KQ9A 2HPMA 2NS7A 4RGRA 2GXAA 1YQAA 2YU9J 5K1YA 3CJQB 4YIRX 2NVQJ 2LRDA 2X4HA 4OIPF 4M3EA 1SC7A 1CGPA 4GYGA 3U1KA 1RR7A 3O6BB 3KX2A 2NVUB 3DKXA 3B73A 2HWVA 4RA2A 1PUFB 1FP2A 4XSXF 4MTDA 3CESA 3QAHA 4L9TA 2D1VA 1DUXC 3I53A 3BJ6A 4JYKA 2HYFA 1DDNA 3CCMI 3UKGA 4XLFA 1YJNI 3F8CA 1IDYA 5BPDA 2IS1A 1YOVB 3WGGA 2V6CA 5DUKA 4A0YA 3EQLF 3WTXC 1PYVA 1RI7A 4PGHA 3L2QA 1XPXA 2IA2A 2M8EA 2PJPA 2A05A 2XAHA 3WE3A 5F04A 5F27A 4U7BA 2DQLA 2VPLA 1ETWA 2XVCA 4KISA 3CCVI 2HS5A 3H92A 3SZTA 1F43A 4WXHA 1MNDA 3CCQI 5FKMA 3D5LA 1DQUA 3L00A 3GTKJ 1U9NA 3KP5A 1S7EA 4IX7A 2PN6A 2ZMEA 2XF5A 2Y0MA 3HHHA 5HDGA 3DWLE 3LSTA 5H6QA 3MZHA 1IV8A 2FOWA 3H3ZA 4YFKF 4A5NA 1V3FA 5CQEA 1YS7A 3FMQA 2JQ7A 4BNCA 3JR9A 4XIDA 5DCFA 1BL0A 1QGPA 2BY0A 2DYRH 1JKOC 2Q8KA 2ECBA 1NK3P 3RIRA 3ZMUA 4B3XA 3CCYA 3E6MA 2ESNA 4HZFA 2P0WA 2LVSA 2RNGA 4I2OA 2PBIA 3KEYA 3CZ6A 2BY3A 2KL4A 2MD5A 2XGCA 1APLC 4HG2A 1JKQC 1FOWA 3IRRA 2DJIA 2ZC2A 2JMWA 2MC3A 2DT6A 4KMFA 1YW8A 2G7UA 2RNJA 3K4KA 1VQ7I 3G71I 4GCVA 2HYGD 3QODA 1LE8B 1TQPA 2M4GA 1Y0NA 1I5ZA 5B3SH 2DODA 2NOJB 3QWLA 4OOIA 5E3OA 3H5AA 1O57A 1ENHA 3E5QA 3GLXA 3I9V2 3KPHA 1YX3A 5E20A 1J0RA 4ZYAA 2Z33A 1WRJA 1BW5A 3HOZJ 3UNGC 2W7NA 3IV5A 1MZBA 4TV7A 2NRAC 2N8GA 1MBHA 4KITB 3LFUA 3BR2A 1XGMA 1FOKA 3ABMH 4B1RA 4CH7A 4RB1A 1GVDA 1MJAA 2BVMA 1KQ0A 4XKCA 1ZARA 5FRNA 1OYIA 3J80K 2GA1A 2WADA 3GUDA 3RYRA 2JA7J 4Y33A 2MABA 3J81Z 2JZYA 3OL3A 1QA6A 2R7TA 1VQKI 2O61A 3HZJA 2MA3A 4AIJA 3PIOF 1W4MA 2XIGA 1AWCA 2CU7A 3FISA 1A36A 3L2RA 1Y1VJ 2Y31A 4A3KJ 2BYVE 5L3BA 1W7PB 3I5UA 2E2HJ 4V2GA 4ZDOA 4KJZA 3HDDA 5IT9K 3U3NC 5EYRA 2NNYA 3G4SI 3OYHA 2JVGA 4HDVA 3FXOA 5GTIC 4P1WA 5LRRA 5FB2A 3JRDA 3E0JB 5TJJA 5HS8A 5HS9A 1ZLKA 3LL7A 2KZVA 4ANJA 1B59A 2Q2EA 1SD5A 1E3PA 1X3ZB 5E3LA 5LRSA 2R5YA 1VZ0A 2Y2ZA 2KDZA 2EV5A 2DA7A 2KMUA 5GADJ 2K9MA 5HNFA 2ZMEC 2WY7Q 3WHBA 1RUNA 2W85A 4CCMA 3ONQA 2YX4A 3CMEI 4KDPA 1MBJA 1FWZA 4V2FA 3KEOA 2LC2A 1A35A 3UR3C 1EKEA 3FM3A 1O4XA 2B0LA 1JE8A 4M6XA 3OYLA 1G3TA 2STWA 2LDUA 1IUYA 4OINF 4Y17A 5IOYA 2X0LA 1GV2A 3HYIA 1NK2P 4EM0B 4IFAA 2FBKA 2ZCWA 4HNTA 2XUBA 1D0YA 1W5CC 4M71A 2RQPA 1UFMA 3F72A 4Q48A 3SQNA 1SVMA 1S3JA 1ZGAA 3SFZA 4MEXF 1S72I 3CUQA 2VKVA 4I7HA 4YFXF 1FYLA 2XAUA 3HIFA 3LFKA 3TP0A 4XNFA 1TL8A 3FXUA 5HDKA 3IKVA 3WG9A 2MH2A 1RKWA 4HSTA 4JX4A 2YX7A 1ZR2A 2R93J 1G3SA 3FK6A 1R5ID 3HRSA 1ON1A 1TLHB 3F0CA 3PO2J 5J6XA 2VBXA 2JSPA 1AKHB 3MAJA 4UVCA 2ZJ2A 1HKSA 1SFXA 4IO9F 1YFHA 1T38A 4BJ5C 4E4HA 1R5GA 4FISA 1TW2A 1OMIA 5DD8A 1ZHFA 2HQAA 3PSFA 3CLOA 2A69F 3DCFA 5HODA 2OV7A 1XTAA 4I09A 3JCUC 4LIVA 4Q4ZF 5LHGA 1YHQI 1R1UA 2KJCA 1T0FA 2DN0A 3W2WA 3I4NJ 3DLAA 2Y0SA 3I59B 2V1DA 1GDTA 4QPQA 5GAHJ 2WB1A 3GTPJ 4W1UA 3RZDJ 2BY1A 3RCOA 3RKYA 1PDNC 4JX6A 3JTGA 1QPMA 1R00A 3PNYA 1JKPC 4FASD 1H9GA 2KHMA 1X4OA 2B63J 4XQFA 2EIKH 2CMPA 3MMYB 3BG3A 2BGCA 2X6WA 4UNOA 3R0AA 2DDAA 1MGTA 3HSFA 4BXXJ 1N77A 5LHHA 1U78A 4HX8A 4PDKA 2LY9A 3HJEA 5JR3A 1V4RA 5AONA 1MBFA 2FRHA 3TMOA 2ZJQF 4IRHA 4MO7A 2QSHX 4KT5C 2YS9A 4O5VA 5J8CA 2EWNA 4BGDA 1OCTC 1Z9CA 5GPCA 1D0ZA 5JLWA 2LBFB 2KIQA 3NAUA 3DBLB 1P92A 2PJRA 2IA0A 5L3GA 1WSUA 2BHYA 1HDPA 4XSZF 1MDMB 2CQNA 1JT0A 3RTRA 1EH8A 1OCOH 1MMNA 3C7JA 3HPGA 4D9JA 1JUMA 3CMYA 3Q9SA 4H0AA 1BJAA 1SMTA 2R7OA 4AVPA 4OAZA 3K9TA 3QOPA 4P27A 2QQ8A 5LFAA 4B09A 3VPRA 3EPZA 3HOTA 3S1NJ 1K79A 2LOOA 3GO5A 3LSGA 2DA6A 4XLAA 1E2XA 3Q2UA 3BR5A 2PX9A 3CQZJ 3G1LA 2OCCH 2X6OA 3BDDA 2CQ7A 4L5JA 4HRIA 1VQNI 1OJLA 5K7HA 2EB7A 1S8NA 1UG0A 2BW3A 2CW8A 2YU3A 1VQ8I 1IRFA 2MGQA 3ERED 3ZPLA 4FT8A 4LG0B 1KA8A 2KZGA 3CUQC 2KLOA 2VE8A 3DFGA 4GGGA 1NTCA 4PSWA 1LFPA 2DA4A 5M3MJ 2CUZA 3FZVA 2ZSIB 3VODA 4IOCF 4RB2C 3ZMZA 4NC8A 3CP2A 1DU6A 2R7DA 3PM1A 3BJAA 4NQWA 3SZPA 4S04A 4XKVA 4BACA 1J9IA 2M9HA 1SMBA 2QGUA 4XL9A 5D8LB 2IS4A 2GWRA 3F6VA 2DPDA 3ZQGA 4A3DJ 3K69A 4OMYA 1B6AA 4E7KA 3ZQLA 2Y9YA 3Q2RA 1FZPB 2VLAA 2CRGA 1WHUA 2DCEA 2JSCA 2R4GA 4HX7A 1P4XA 4U7DA 3BTLA 4UV9A 2O9LA 3TW6A 1VQMI 1WZ2A 1TWCJ 3IAM2 2IGOA 4D0PA 1FOXA 1QNTA 1Z7UA 4E7ZA 1K78A 3HGGA 2X48A 3QP6A 4J01A 1TBXA 3BLYA 2P5LC 2L5QA 3S17J 4W97A 1B72A 1FYMA 2AQEA 2FQ4A 4XKBA 2QENA 1T0FC 3JW4A 1PVEA 4UB8C 3BTIA 2CYYA 4E7SA 1KU2A 3HG9A 3H5RA 3GVAA 3S16J 1T95A 3CC2I 1GV5A 3WU0A 3U3UC 1QZZA 1FY7A 4HLXA 3BR6A 2L4AA 3DBRB 1F36A 3EUKL 3GFLA 3RPUD 3OS1A 4M9XA 1FT9A 1MW7A 1VQ9I 1FIPA 3TDUC 1Z67A 2HYJA 1HCRA 1P7JA 3HOWJ 1UMQA 2CH0A 1ZG1A 1AHDP 3L2UA 3BR0A 4R1HA 2XAQA 2K9NA 4RLFA 2JA6J 4MNUA 4U0VA 3C2BA 2V6EA 1G6NA 2O8XA 4EVIA 2UUZA 2Y0SN 2FEZA 4HEA2 1R7JA 3RQIA 4JQFA 4L5EA 3CJRB 2XKPA 3GFMA 1X19A 1ZG3A 2X85A 2PLYA 2KIUA 3NWTA 4CCOA 1Y39A 1WWXA 1ORKA 1YITI 1ZKGA 3H1CA 3A4CA 1FSHA 2HVQA 4BQOA 3F9KA 4ASNA 3ZMDA 3N97A 5EF6A 4ENJA 5D5VB 2XF6A 3PQJA 3BJOA 4NUNA 1I27A 1BIBA 4ENNA 3BG6A 3NWSA 3BZCA 4C2TA 5FROA 2LG4A 1CF7A 3GBGA 3I3LA 4IQJA 1DP7P 1X58A 3HB9A 1JUPA 2OPTA 2P5VA 4A2UA 2LLKA 3E6DA 5EEAA 2P7CB 1I3AA 1WI3A 2DTRA 4CGZA 3RKQA 3KZYA 2ME0A 4RM2A 3ZQ7A 3MD2A 3E3VA 1AKHA 1T98A 3HM5A 2FU4A 4A69C 4BUPA 1XGOA 3CCEI 4BY1J 4XBFA 2IGNA 3TP3A 4Y52J 2DO7A 3AKZA 2NOGA 4WF2A 2FNAA 2MBFA 2ZO4A 2F5FA 5CVUA 1A5JA 2DT5A 3QYBA 2Y75A 3BG7A 3LOCA 3MZYA 3PFYA 4XLEA 4AUXA 4HV5A 4EEFG 5ICGA 1DGRM 1POGA 1HXDA 1OKRA 3L2CA 3H36A 1O3QA 1IAWA 3BP8A 3SJMA 2V1UA 4OWRB 2K86A 4WXCA 3WODF 1ZG5A 2R7UA 3F8MA 3GF2A 3KLOA 2UZKA 2TRTA 4OAYA 4G8XA 3RZOJ 5ICFA 4RGUA 1SFUA 3B6AA 5HOOA 5KHDA 2DAOA 1H8AC 2DOFA 3JAMZ 4M72A 3JSPA 1U3EM 1SVLA 1KZHA 1DPRA 4P9FA 3R60A 3NRVA 4PFPA 4D5FA 4M3BA 4DYRA 5IYCJ 4YRVA 3ZXSA 4LLLA 4LB6B 5KK1A 2RDPA 3W6VA 2K85A 4CSWA 1WJBA 3HKZA 5FD6A 5E1XA 5E3MA 4XN3A 1XSVA 4KUMA 2P7VB 4R8HA 4A3GJ 5B66C 2MLKA 4MHGA 3CF5F 1NG6A 1ZN2A 2KP6A 1HA8A 2EBIA 4E7LA 2ME6A 2LKPA 3E6CC 1O7LA 3CCUI 5M5WJ 3VEPA 4BS9A 1XGSA 4LITA 1K4SA 4F55A 1ZK8A 2EFPA 2IAIA 3S3NA 4RMNA 1D8JA 2HDDA 3HHGA 2R7VA 5KAFC 3KCCA 2JPBA 2M2EA 3JRFA 5CLSA 1TC3C 3MWMA 3DU6A 3K4MA 3CTAA 4QTRA 4CDGA 4UV8A 5FJ8J 4ZTFA 1V5GA 4IHXA 3KP3A 3HUGA 1VTNC 2P4WA 4IJAA 3QPSA 2F5CA 2CV2A 3BCAA 5GTHC 3LA3A 2VJ5A 4BDZA 1YW7A 2K40A 1H0MA 1FC3A 1BR4A 2L4MA 3FBNB 1R58A 3TOAA 2VT2A 2E2JJ 2X51A 2OC6A 2HDWA 5FLMJ 3BR1A 5CVRA 2EIMH 4G6QA 2CJJA 1BIAA 3LSRA 2XRLA 4M3FA 2M5WA 3S6UA 4RAYA 4LG0A 4E70A 1R4NB 2MSYA 4KIGA 4F93B 2R92J 3S1RJ 5C4JJ 2QBYB 2H09A 4EJUA 2CG4A 1JTYA 1MJ9A 2IA1A 3OR2C 4XICA 1QQIA 1KYZA 1IC8A 2KT0A 2L9SA 3GTLJ 1XN7A 5J1UA 1HKQA 5ILUA 3J7YJ 4NNJA 3A03A 1HW2A 3O8HA 3LWFA 5E79C 3WTYC 2R5ZB 1OR7A 3GZNB 1U53A 4FX4A 1M1EB 2H6CA 2HOAA 2F5EA 5E18F 3ZN1A 1OCPA 1T08B 3LSPA 3LAPA 2NXNB 1H89C 1J2XA 4MQ9F 4PZJA 3KP4A 4M6VA 2QUFA 1HKTA 2HI3A 4BHBA 3RPQA 1BJZA 2GXBA 1UAAA 1IXSB 2OD5A 2VI6A 3GZ5A 3LA7A 2EA4A 1AU7A 2F4MB 1T56A 1FBSA 3O8GA 1A6IA 1LFUP 4IZZA 2EFOA 1RNLA 3V7CA 4RB0A 2VKHA 4LG3A 2LD5A 4KIBA 4ZYDA 2LY1A 3BOQA 4YG2F 4B8XA 1JHHA 2DA3A 1XMXA 5M5YJ 1ERDA 1JJ6C 2RREA 2CV0A 4P55A 5EJCA 3LSMA 3FIWA 2DFHA 5DM7F 5DV5A 4NHJA 2PMZA 3TL4X 5LEJA 2OF7A 2YPRA 4A3MJ 2COMA 1OCZH 2HGCA 5JI6A 1WJAA 3FKJA 3DEEA 3ZQQA 2XV4S 3L09A 5FO5A 5A2QZ 1LQ1A 1SD4A 3IH4A 2Z16A 1G2HA 5ICEA 4ENKA 2F48A 2JRTA 4I01A 3KP6A 5IP7J 1TTYA 3H35A 4UXNA 1FTZA 4CUGA 4NUOA 3BG9A 1WJ5A 1XCVA 3GLLA 1T8IA 4M74A 4MFEA 4L18B 4UB6C 4GYIA 4EV0A 3F3XA 3HL2A 2FE3A 4FE4A 2M34A 4PCQA 1BR2A 2WAEA 3B6CA 1S5LC 1XMAA 3HKZN 1R22A 3REOA 4EJWA 4DJAA 2EFQA 1SMYF 3FHZA 1IRGA 1X1DA 1WJDA 1Z77A 2LSOA 2VASA 2WAQA 2XPUA 2KQRA 3GXOA 4TPVA 2L9NA 3AG1H 3ZCOA 3TOBA 4S0HB 4AM3A 3NT8A 2ETHA 4BL0B 2XGXA 3LMMA 3ISPA 2OQRA 4QIWN 1JKRC 4D7MA 1MNMC 2KDOA 3O3KA 1U5TA 2X1CA 2Y69H 5FGMA 1ZRCA 3RDIA 2ID6A 3ZQCA 1ETKA 2QEXI 1E3HA 5DTDA 3I56I 3CUOA 5FKKA 3IWZA 3AAFA 3KE2A 2FNPA 2W84A 4QSHA 2BOLA 5H2FC 1MMAA 2DJNA 3D0SA 1FYKA 1R4MB 2XHKA 3FM5A 3F23A 4WCGA 1F4KA 1MMDA 3WTSC 4I02A 1D1BA 2V26A 4BYYA 5EG0B 3H9JA 3I55I 1TWGJ 4MIMA 1RUOA 2ELHA 2M8GX 4ZYHA 2V4JC 1OLTA 5KCMA 2QF7A 4GFBA 5ICCA 1F9NA 2WTEA 1SFOJ 1QZYA 4DZPA 5B1AH 1I1GA 2R7ZJ 4IF4A 1GT0C 4PJMA 1OR7C 1USSA 2NVTJ 2DFEA 1J7KA 3I4PA 1ZRDA 2QA4I 1D5YA 4RGSA 2FJ1A 1BM9A 2OTLI 2ISYA 1EV7A 5D4RA 2HNHA 2W24A 4DYQA 1W36C 1B8IB 2NS8A 1X1BA 2NAZA 2ISZA 4A3CJ 3ZOBA 1LJ9A 4G9YA 4BEHB 5DEQA 3RKXA 2JWTA 2MLGA 1L3LA 1NHAA 4YFNF 5K5OA 4BE1A 3RQ4A 1RESA 2L9RA 4I76A 3WHCA 5BNGA 2NNNA 2DOAA 4BHPA 1LDKB 4LMYA 5LGNA 2LF7A 1HSTA 3E7LA 2FUG2 3H9GA 4AYBA 3L2VA 1WI9A 3HOSA 3S1QJ 5ILSA 2EPFA 3GTGJ 2CUFA 1GVJA 2XB5A 1ZRFA 4RAFA 2JTVA 3G6EI 2MG4A 4I0BA 3OS0A 1ZAOA 1TT5B 3CF2A 1J75A 4E7HA 1N75A 2VKDA 1X4PA 2VL8A 4C2UA 2AS5F 1X1PA 3L2WA 3NEUA 3JRIA 1MSEC 4BXFA 4EMSA 3AL0B 4XRSA 1RR8C 2A6EF 4HF1A 4Y13A 1SAXA 3R61A 1HF0A 5JVTA 5ETEA 2VBYA 3HRUA 3W2VA 1FJLA 5D8KB 2BVLA 1PJRA 3G1OA 4EQQA 4HA8A 1U6GA 5AIPA 1VQOI 3BY6A 1VQ6I 3BC8A 1XSXA 3CCLI 3WGHA 3BG5A 3MQ0A 2ZB9A 4PSXA 4AWXB 1Z91A 4H4KC 1MSFC 1HQCA 3CCRI 3FXMA 3GEZA 1HLVA 4AIHA 1U5TC 2NYXA 2HDCA 1XS9A 4BBSJ 2HFHA 4CHUA 2A5YB 3J81K 3QPLA 3PUFA 3K4LA 2ZNYA 4UUSB 2K3PA 3TQNA 4MTEA 3S14J 3AG2H 4YEJA 4E7JA 4EJVA 2BXYA 3FXQA 2DMQA 4GO1A 1PUFA 4MQVA 2WAQN 2IS2A 2R5ZA 1IN4A 3GTMJ 1XSDA 3DTEA 2A6HF 1N78A 4OMZA 4PJNA 3M9AA 5J4YA 2GZWA 1VFCA 4IRGA 1SEUA 2XROA 1I3QJ 1LPQA 4LOCA 4L9NA 3S93A 1RKTA 1IZ1A 3M8EA 1YO5C 4MLOA 2DW4A 4CCJA 2KFDA 1YJWI 4NBQA 4EATA 4I0AA 4RS8A 3SYTA 4FCYA 4BQAA 2ZJRF 1V5EA 2COBA 2P8TA 2A5WA 2LKSA 2E19A 1U8RA 3K2ZA 3W6KB 2OJED 4A3LJ 4B44A 4KNYA 2EFNA 9ANTA 4HAMA 1G3WA 2PMHA 2H8WA 3FWEA 5EEHA 4G12A 3ZRGA 2WV1A 2HOEA 1J09A 4F91B 4UHTA 2H1LA 4L9VA 1WKMA 2JA5J 1HDDC 1NG7A 2EILH 3BZ6A 1QNXA 3DTIA 3Q9VA 3W3CA 1H9TA 2OUMA 2LY2A 2P6TA 3A01B 3PQKA 3SFIA 1BN5A 2QKLB 2P81A 1I6XA 2IRFG 1VI0A 3C2GA 2FD5A 5HLGA 3PO3J 5E8GA 5CKTA 5F0FA 3ELKA 4BJ6C 2L9VA 4XRSG 1U0JA 5IT3A 5EZHA 4RDUA 1JT6A 3PUBA 5EGOB 1EH7A 3O2PE 1LE8A 2BHZA 2E1MB 1IF1A 2ZJPF 4ESBA 3DPUA 3U3LC 3RKWA 2RKHA 1L0OC 4O6JA 4BE2A 5BOXA 1IG7A 1ZREA 3K7AJ 2FBIA 1S6LA 3KP2A 4RB3C 1GXQA 3DF8A 4N4OB 3K2AA 4BE0A 1TQMA 2ECCA 2GA2A 1E3OC 5GPAA 2RQQA 2RV8A 3OMYA 3OV8A 2RAEA 1T39A 2XSJC 1NH3A 2DMNA 3K1PA 1I6HJ 1IN6A 5TGTA 4A0XA 4CA0A 2L0KA 2KRCA 3K4JA
chains in the Genus database with same CATH topology
3S6VA 4NUNA 2DDAA 2CQ7A 3Q2UA 3U3UC 1QNXA 1RC9A 4IFAA 3S6UA 3S6SA 2VZNA 3U3LC 4D53A 2DDBA 4NUIA 3MZ8A 4AIWA 4G2UA 1WVRA 4H0AA 5JYSA 4LY5A 2A05A 4TPVA 4P27A 3U3NC 1CFEA 1SMBA 2GIZA 4NUOA 3NT8A 5ETEA 2EPFA 1U53A 4NUKA 1XX5A 3Q2RA 1XTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6V A;  4NUN A;  2DDA A;  2CQ7 A;  3Q2U A;  3U3U C;  1QNX A;  1RC9 A;  4IFA A;  3S6U A;  3S6S A;  2VZN A;  3U3L C;  4D53 A;  2DDB A;  4NUI A;  3MZ8 A;  4AIW A;  4G2U A;  1WVR A;  4H0A A;  5JYS A;  4LY5 A;  2A05 A;  4TPV A;  4P27 A;  3U3N C;  1CFE A;  1SMB A;  2GIZ A;  4NUO A;  3NT8 A;  5ETE A;  2EPF A;  1U53 A;  4NUK A;  1XX5 A;  3Q2R A;  1XTA A; 
#chains in the Genus database with same CATH topology
 3S6V A;  3BQZ A;  4EGY A;  1IXR C;  1K4T A;  1YJ9 I;  3LA2 A;  4LJZ F;  1WH5 A;  3V8K A;  4A6E A;  1ETO A;  5CPR B;  3CC4 I;  1IXC A;  1RZ4 A;  4KN4 X;  3ZMV A;  2E71 A;  3A02 A;  3J7A O;  3JRC A;  2ADU A;  1ZYR F;  4X6A J;  2CO5 A;  2YUS A;  4N4N B;  3IP4 B;  4KN7 X;  3K70 C;  1D1A A;  3AFH A;  2GXG A;  5FLX Z;  1VQP I;  5BMZ A;  1F1Z A;  4F3Q A;  2G9W A;  1XDU A;  2HVS A;  4EJO A;  2P5K A;  3GFI A;  2MFZ A;  5HNH A;  5GAE J;  2O7O A;  3T5X A;  4DW6 A;  3A2K A;  3ZQF A;  2AXL A;  2E5Z A;  3U2R A;  4BQQ A;  3WU1 B;  3SHF A;  4II2 A;  4BKX A;  1U8B A;  2H27 A;  1W7P A;  1WH7 A;  4HOB A;  4HSR A;  2M1B A;  2I10 A;  3NQO A;  3HSR A;  3CD6 I;  3PIP F;  1WVR A;  4B43 A;  1R9T J;  2EFW A;  2OCE A;  4G7H F;  1RIO H;  1B8I A;  3KYD B;  1C0W A;  2LTP A;  4GXO A;  3OR1 C;  5DYM A;  3PL8 A;  3TED A;  2BZT A;  1WPK A;  3KLN A;  3Q0V A;  4YIF A;  3OSG A;  3KIO A;  3HTS B;  3FHN A;  1FOY A;  2VT3 A;  4JK1 X;  3QP5 A;  1LFB A;  3S8P A;  2LR8 A;  2XDV A;  1R1T A;  2WB1 N;  1LVK A;  1V5F A;  5FKL A;  4S05 A;  3JTH A;  3COA C;  2DTZ A;  3A1Y A;  3D5R C;  3GTQ J;  2VXZ A;  3FMR A;  5LD2 C;  1W1W E;  2L3D A;  5KAI C;  1PP7 U;  5CVV A;  4BJT A;  4BDY A;  3QPH A;  3S3M A;  1Z7L A;  5HDN A;  3IC7 A;  3DEW A;  1LNW A;  3ECH A;  2D2W A;  1R49 A;  3F21 A;  4V19 K;  3SDG A;  1A31 A;  1OIS A;  2XGE A;  4KIC A;  3BT9 A;  2HU9 A;  4U0Y A;  3P5J A;  1LDJ A;  2OZ6 A;  2R7R A;  2R3S A;  2IP2 A;  4HQE A;  1QVU A;  2DXI A;  2QM3 A;  2WY8 Q;  2DI3 A;  4HNV A;  2IBD A;  1W36 D;  3L9F A;  1MIJ A;  2WV0 A;  1Z6R A;  2I8D A;  4ETS A;  3ABT A;  5EEG A;  3A0H C;  1MNE A;  1WJF A;  1UB9 A;  4Y4R A;  2VIX A;  5FFZ A;  2TDX A;  2QQ9 A;  2JVH A;  5LEK A;  2HR3 A;  2OAZ A;  2JA8 J;  1SD7 A;  3RYP A;  2GAU A;  2O5R A;  1Z21 A;  4JP0 A;  3CO6 C;  5GAG J;  1F5T A;  2K27 A;  1Z6T A;  3BWG A;  3EET A;  5F0C A;  5LLQ A;  2Z3Y A;  3PSI A;  1IO2 A;  2HOT A;  2BEO A;  1W5T A;  4CZC A;  2OA4 A;  1AA7 A;  5E1W A;  2LMD A;  3I59 A;  3CMA I;  3G3Z A;  3DPT A;  3V8L A;  5IOZ A;  1X3W B;  1XD7 A;  4E6K G;  2EK5 A;  1BOB A;  3OYJ A;  4WK8 F;  4L0Z B;  1JI8 A;  2QVO A;  1T6S A;  3F8N A;  4D7N A;  3R0J A;  2H6B A;  2R0Q C;  4L5I A;  3Q3S A;  1TZL A;  3D1N I;  2O0Y A;  1BC8 C;  1JJ8 C;  1D5V A;  1YIO A;  4CYC B;  4Q5S F;  3S2W A;  3TGN A;  5IYD J;  3E97 A;  4DZJ A;  2IW5 A;  2A68 F;  4ITV A;  1FBU A;  4LLN A;  2X9D A;  4XOP A;  2DA2 A;  2FQ3 A;  4LLG F;  4ZZD A;  1EH6 A;  4M9Z A;  4I6Z A;  1MJB A;  4L9J A;  3FF5 A;  4R79 A;  3M4O J;  4XK4 A;  5ILV A;  2V9V A;  2QKM B;  2O03 A;  2RVC A;  2CW7 A;  2DDB A;  2DMU A;  3J7A Y;  4PJ0 C;  3WTU C;  3K4C A;  3BTJ A;  1X1A A;  3P9K A;  1TQI A;  2LRE A;  4NDL A;  2JUG A;  1ACI A;  2LBF A;  2UXX A;  3HXL A;  3QOE A;  2DYS H;  4JX5 A;  2WC2 A;  2DMT A;  1Z0X A;  3ABK H;  2VC1 A;  3CDH A;  4E7I A;  1IW7 F;  2VN2 A;  2KKO A;  3FMS A;  2CUE A;  1MDM A;  1SFK A;  1D1C A;  3KYC B;  3HPH A;  2DU9 A;  4CXF A;  4B4C A;  4ESF A;  1Y6I A;  2CW0 F;  1MH3 A;  2PFB A;  3P9C A;  4OIO F;  1MH4 A;  1RC9 A;  1ODD A;  2VC0 A;  4NUI A;  5D5W B;  3E5X A;  4FX0 A;  4ABZ A;  3OL4 A;  1X1C A;  3K4B A;  2L7M P;  3DTK A;  5K7Z A;  1I39 A;  4RGX A;  4LY5 A;  2DMP A;  2JK3 A;  2VPR A;  2C6Y A;  2A61 A;  3IAS 2;  3TO6 A;  5J8F A;  2GIZ A;  3P7N A;  1FSE A;  1XX5 A;  3QRF F;  1VND A;  2CWE A;  1HC8 A;  3HRT A;  2FA5 A;  2HZD A;  3DKW A;  3IH3 A;  4A3E J;  2CQQ A;  2F4I A;  1WGX A;  1S7O A;  4AU7 A;  2W57 A;  5DCM B;  3TBI A;  1OCC H;  1BI0 A;  4NB5 A;  5LBQ A;  2M0C A;  3ZP5 A;  1W5S A;  2A07 F;  1HW1 A;  4Q47 A;  4EJT A;  2JRM A;  3ZGK A;  4XRM A;  4F52 A;  1LUJ B;  4HDU A;  3SZG A;  1WJE A;  2UXN A;  4ON0 A;  1XDS A;  4A93 J;  4C9Y A;  5FRM A;  4X0G A;  3S2H J;  1VQ4 I;  1ZLJ A;  2Q0O A;  3MEX A;  2CS3 A;  2KPM A;  5JVG F;  2F5D A;  3H9Q A;  5ED4 A;  3I0T A;  3WTV C;  3G73 A;  4PGG A;  3OYK A;  4PK4 A;  2KRF A;  3ZMS A;  2XAF A;  3MKZ A;  3GME A;  5L3C A;  5KNL A;  2R7W A;  1W0U A;  3JAM K;  2WA0 A;  3OYC A;  2QLZ A;  2Z5U A;  1LB2 A;  2PI0 A;  2EZH A;  1Z1D A;  4PJJ A;  4P9U A;  4IRI A;  5HS7 A;  1XCB A;  1TP4 A;  2O3F A;  1R71 A;  1VQL I;  3J80 Z;  3HSE A;  3WTW C;  3OYD A;  4U88 A;  3D5S C;  4BU2 A;  5IP6 A;  1JGG A;  3HOU J;  4II3 A;  5CVI A;  1G8X A;  2EZK A;  2L54 A;  4XM3 A;  1IN8 A;  2ELK A;  2FBH A;  5TRD A;  1YI2 I;  1GUU A;  4XLH A;  3LSI A;  3WG7 H;  2JUC A;  3N4M A;  4IVN A;  4OIQ F;  2BE5 F;  2MH9 A;  2KJB A;  4RAG A;  2L7K A;  2VXD A;  4BQN A;  5DD4 A;  3MVP A;  5K5R A;  4ZDL A;  2WBM A;  2ZFU A;  4F7Z A;  3FX3 A;  1FP1 D;  2G7H A;  2GBY A;  4ESJ A;  5IT9 Z;  1OCR H;  2A3S A;  2XGD A;  3C3W A;  4CZZ A;  2L2O A;  1KU3 A;  1XC5 A;  2JJ7 A;  1JXS A;  5J1Y A;  4XLP F;  1QHH D;  3ZR8 X;  1LVA A;  1KON A;  2CQK A;  3OOP A;  5DS9 A;  5L3F A;  3LAJ A;  2ZKZ A;  2QQA A;  2CGP A;  4H0E A;  2XPV A;  2E60 A;  1CQT A;  1YIJ I;  2PJR B;  4BH9 A;  3AG3 H;  1O7F A;  4EM1 A;  3K70 D;  4WX9 A;  2J5P A;  2NVY J;  5JFR A;  4HW0 A;  4CO8 A;  4XLC A;  3F8B A;  2VE9 A;  5K5Q A;  4MGR A;  4WWC A;  4A6D A;  3QYE A;  4I99 C;  3HC7 A;  4LGW A;  4IL6 C;  4AIK A;  4B48 A;  3CLQ A;  3FXK A;  1ITY A;  3TKY A;  3K0L A;  3VB2 A;  1IJW C;  3IWF A;  1OPC A;  4PUS A;  5E3N A;  3BR3 A;  2IT0 A;  4C30 A;  1Z3Y A;  4BBR J;  2FSW A;  4NUB A;  4GRI A;  2I5U A;  3ESW B;  3IKT A;  2W25 A;  5JLX A;  2ID3 A;  2VKE A;  4D1Q A;  3LNQ A;  1I1S A;  2E1M C;  3CDL A;  4IEJ A;  1Y8Q B;  2BW3 B;  2W4S A;  3HGY A;  5HLI A;  4ZH4 F;  3F22 A;  1D8K A;  1BC7 C;  5D5X B;  1SFE A;  1IN5 A;  2HKX A;  3DXJ F;  2E36 A;  4HX4 A;  5IY5 H;  1JUS A;  1ZQ3 P;  4NQW B;  4I98 B;  3EUH A;  3GWZ A;  1PUE E;  1P9Q C;  1YYV A;  4CCK A;  1TWH J;  3QYF A;  1K6O A;  1QU3 A;  1GLN A;  3BRO A;  2CUJ A;  2JA2 A;  2WAF A;  4RM3 A;  5J40 A;  2VUM J;  2ESH A;  3OOU A;  2W82 A;  2ZBK A;  4KFC A;  2PQ8 A;  5LGU A;  2HXI A;  3DV8 A;  3GFJ A;  3LQR A;  2NS0 A;  4RAZ A;  3S1M J;  4FQG A;  1T33 A;  5H20 A;  3T1B A;  3LSK A;  4JBA A;  1E17 A;  3HOX J;  2HPI A;  2LNB A;  3M8F A;  5IYB J;  1K78 B;  1P6R A;  4IHS A;  1ETX A;  2OQG A;  3OIO A;  1STZ A;  3M8J A;  3MFK A;  2E5N A;  5GP9 A;  1B72 B;  2AQF A;  2Z2S B;  3GTJ J;  5J47 A;  4ZTJ A;  1TT0 A;  3U9G A;  2HEO A;  3VSK A;  2AXT C;  3ZQH A;  1UHW A;  3F6O A;  3S6S A;  4ZYE A;  1Y8R B;  4CYC A;  2K4B A;  4AIW A;  2M4K A;  3FBI B;  4B47 A;  4AID A;  5A2Q K;  3C18 A;  3V7R A;  2K02 A;  2GOX B;  1D3Y A;  1FMV A;  1XGN A;  2V1N A;  2OBP A;  3JRG A;  3BQY A;  3PNT A;  1FTT A;  1KU7 A;  4DBR A;  4MEY F;  2K3F A;  3MKY B;  2OZU A;  1P4W A;  3M07 A;  1QVT A;  4AD9 A;  2QYO A;  1ZH5 A;  1O3T A;  1R6R A;  4ZZL A;  2F2E A;  1O3S A;  4IXA A;  3CO7 C;  2AO9 A;  4C3J J;  4RBO A;  2LKX A;  3HEF A;  4HNU A;  1IV6 A;  2VOD A;  4G2U A;  2TCT A;  1TWF J;  2E2I J;  2V79 A;  2VQG A;  1ZGW A;  5C4X J;  2CFO A;  2HKO A;  5IP9 J;  5C3E J;  3I71 A;  2Y30 A;  4UVA A;  1J59 A;  4WXD A;  2V9P A;  2L01 A;  3OYB A;  1QPI A;  2HTJ A;  2YSR A;  2M30 A;  3RSN A;  3HRM A;  4HLY A;  3DU5 A;  3FDY A;  2D5V A;  3TO7 A;  3JRH A;  2X1E A;  2PMZ N;  5EZG A;  1AOY A;  2IXS A;  1BOA A;  2FF4 A;  4ZC3 A;  1S7A A;  5C44 J;  1HBX G;  4AVZ A;  4EGZ A;  3H3V K;  5E17 F;  2JPC A;  3GZ6 A;  2PMU A;  3ASN H;  2HQ5 A;  2PG4 A;  1G59 A;  2DOE A;  1FBQ A;  1JTX A;  2F5V A;  4UUT A;  2XRN A;  4HYE A;  3K1M A;  2DK8 A;  4DNC A;  1MBK A;  2UV1 A;  2BY2 A;  1U9O A;  3Q5F A;  3H0D A;  4B3A A;  1CF7 B;  1G3Y A;  3ABL H;  1UHM A;  1W7P D;  2Z99 A;  4DQ2 A;  1DU0 A;  2X1D A;  4XLN F;  5F0H A;  3GYH X;  1QHG A;  4DBQ A;  4PFO A;  1XB4 A;  3BPV A;  5DCM A;  3SEZ A;  2HOS A;  1BA5 A;  5HLT A;  4NUK A;  3FXL A;  2QBY A;  3I54 A;  4M6Y A;  4KA4 A;  2EIJ H;  3LSJ A;  3I4M J;  2FMY A;  2ELJ A;  3DKY A;  4M9S A;  3QU6 A;  2DFI A;  4A3F J;  1R1V A;  2ACJ A;  4G6D A;  1FIA A;  2KRH A;  4QWQ A;  3JRE A;  2GM4 A;  1OYY A;  3FK7 A;  3E5U A;  4XON A;  3EUH C;  1B1B A;  1IDZ A;  3T8R A;  1TNT A;  3OS2 A;  3U21 A;  3S32 A;  4IPA A;  1B4A A;  3CJN A;  2K9L A;  3HOV J;  4C3I J;  3KZZ A;  2IPQ X;  4HF2 A;  2RGV A;  2EZI A;  2LF8 A;  3M3Y J;  4EM2 A;  2R7X A;  2XC7 A;  1FLI A;  3KFW X;  1KU9 A;  2XPW A;  1QO0 D;  2L7F P;  2M87 A;  3M1C A;  3JSO A;  2XAS A;  3HOY J;  2E1O A;  4G94 A;  4K2E A;  4ZYG A;  3EYY A;  3GTO J;  1YG2 A;  3CCS I;  1Q1H A;  3CC7 I;  4RLQ A;  1N25 A;  3ZN0 A;  2DK5 A;  2EJR A;  2MYS A;  2ZNZ A;  3JRA A;  3FKI J;  2VJ4 A;  1MD0 A;  1WFX A;  5M5X J;  1B9N A;  2L02 A;  3JRB A;  3C2H A;  1OQY A;  1X2M A;  3ML6 A;  1Z3X A;  4G7O F;  1FMW A;  2W00 A;  2KIM A;  4U0W A;  3LQQ A;  3CDI A;  1ONV A;  2IVM A;  5DM6 F;  2GLO A;  5F1R A;  4J00 A;  2VQC A;  1IRX A;  2KIF A;  4QLC U;  2R7F A;  3CJT B;  2LYC A;  1J5Y A;  5LHI A;  2GOM A;  3MZ8 A;  2X6Y A;  2FOK A;  3OYN A;  4L0Y B;  2EH3 A;  1D0X A;  2O8K A;  3DEU A;  3H5N A;  3EUA A;  2WWY A;  1TWA J;  4XN0 A;  1KGS A;  1QZE A;  3E1S A;  3M1E A;  4C3H J;  2YR2 A;  3BPX A;  1G4D A;  2DT7 B;  3E6B A;  1RPW A;  5CVJ A;  3ASO H;  4Y15 A;  2RN7 A;  2QCO A;  1TNS A;  1Y1W J;  1MKM A;  1Y0U A;  1YE9 A;  1ETY A;  3Q0U A;  3ZQI A;  2QSG X;  1ULY A;  3CMM A;  3PJR A;  3WTZ A;  2M0M A;  1SVO A;  3KZI C;  1XMK A;  5EDN A;  4OU0 A;  1S29 A;  3K6G A;  4UUV A;  2HQN A;  2E1C A;  2UWM A;  1A04 A;  3WE2 A;  2M45 A;  4IOA F;  3ROU A;  1BR1 A;  1DGW Y;  1LDD A;  3W6J B;  5HLH A;  2H1K A;  3HUG B;  4D53 A;  5FD5 A;  4XOT A;  1REP C;  1BI2 A;  2M3A A;  1LEA A;  1V54 H;  4FE7 A;  3ULQ B;  1XG1 A;  1R23 A;  2J5O A;  3VOE A;  4CIC A;  5F1J A;  3IRQ A;  2QZ8 A;  4PJL A;  2LFB A;  2VBZ A;  1O3R A;  3VYS B;  1UCR A;  2R7Q A;  4AYB N;  2MC4 A;  3HTU A;  2W48 A;  4Z2Y A;  4BAY A;  1YRN B;  3PFI A;  1S9H A;  4DOZ A;  1EJ9 A;  1E0E A;  2E7W A;  2VOP A;  3OIQ A;  4AC0 A;  5J1R A;  2O6G E;  5CYV A;  4A3I J;  3OIP A;  4M3D A;  2FML A;  2LK2 A;  2GQQ A;  1IRZ A;  4HV6 A;  1ETQ A;  3V4G A;  2MD0 A;  3C1D A;  1KQ8 A;  1JGS A;  1MMG A;  4Z6Y A;  3S15 J;  1SD6 A;  3FXR A;  2ICW G;  2D45 A;  4LD5 A;  1MMS A;  1WCM J;  2VON A;  1U2W A;  5EG0 A;  4NC7 A;  3VDX A;  3TO9 A;  5D4S A;  2E34 A;  3Q0W A;  4BHC A;  2ZXH A;  1LEB A;  3SDB A;  4DGW B;  4GDF A;  3L7W A;  2JT1 A;  2BV6 A;  2DA1 A;  2HXO A;  2IJL A;  3AG4 H;  1R5H A;  2K4J A;  1Q1V A;  3VYU B;  5F64 A;  3X2Q H;  3F8F A;  2DBB A;  2ZXW H;  3GCM A;  3VYT B;  1X2N A;  4DIQ A;  3W2A A;  4LIU A;  1K7A A;  3OYE A;  3R4K A;  1ZTR A;  4P5O A;  4A3B J;  3M7G A;  1UG2 A;  2EZL A;  2CSO A;  1RRJ A;  1K61 A;  2V1X A;  4UVB A;  3BCB A;  1KYW A;  4Y3O A;  3MKL A;  2OTJ I;  2AHQ A;  4M3G A;  1JHF A;  4IHY A;  4BEH A;  3ZMT A;  2Y9Z A;  2ZXJ A;  1WJC A;  5LGT A;  2FX0 A;  1BI1 A;  2DA5 A;  4OIR F;  2L7Z A;  1ON2 A;  2H8R A;  1PP8 F;  2IGM A;  3H0G J;  4XRF A;  3NAR A;  1BW6 A;  4LFU A;  2QSF X;  3HBL A;  1TW3 A;  1RET A;  2ZME B;  2CQX A;  1EF4 A;  3I58 A;  1DPU A;  1YS6 A;  4NC6 A;  4FTH A;  2CFX A;  1IUF A;  2A6T A;  3WTT C;  5BS6 A;  1ZEL A;  2R7S A;  1YW9 A;  2B9S A;  4FHT A;  1ZGJ A;  2B7E A;  3OSF A;  1HOM A;  3KP7 A;  5KVR A;  1ETV A;  2PEX A;  4M73 A;  3CCJ I;  5E1Z B;  4IKF A;  3SXY A;  3OYA A;  1X3U A;  3G1M A;  4P96 A;  3OYG A;  3RJP A;  3TW7 A;  5AIQ A;  3ECO A;  4DYC A;  2DLL A;  4KYW A;  1A6Q A;  2M7B A;  4N9I A;  1YX5 A;  2DFF A;  3V8J A;  2EV0 A;  3ABU A;  4N0B A;  4C2M J;  2HTS A;  3IH2 A;  2DPU A;  5E8I A;  4D5C A;  1K83 J;  1YTY A;  5JHU A;  2ZFW A;  3K1N A;  2IS6 A;  1Z05 A;  2HZT A;  3EYI A;  1IN7 A;  1B9M A;  2VBW A;  3MKW B;  4BXU A;  1UST A;  2H94 A;  3IHU A;  4G6T B;  1P2F A;  3MCZ A;  3K4N A;  4KT6 A;  4IHT A;  4XMY A;  3RI4 A;  3QPT A;  4HBL A;  2G0E A;  1VF9 A;  3MN2 A;  2Y48 A;  5J3L A;  2E7X A;  3BTC A;  2EA2 A;  4A5M A;  2QWW A;  5HVQ C;  3N05 A;  1QRY A;  1T2K A;  2VQL A;  3B02 A;  4YII A;  2EV6 A;  1U5T B;  1MBG A;  3PNV A;  3QU3 A;  3EDP A;  5IPA A;  5D5U B;  5JYS A;  4A0Z A;  2M7A A;  5FLX K;  4UUS A;  2DQR A;  3T0Y A;  4HQM A;  1OFC X;  2VOO A;  3T8T A;  4LK0 F;  2XSD C;  5K7F A;  1UJ8 A;  3DQV C;  2XAJ A;  4ZDP A;  2VJI A;  2E35 A;  1DP3 A;  2VZN A;  3KEQ A;  4O3M A;  1UEL B;  1BBY A;  4A12 A;  5BPI A;  4FET A;  4HF0 A;  5H6R A;  2XKO A;  3DLL F;  6PAX A;  1IGN A;  5F6F A;  3VFZ A;  3I64 A;  2HQR A;  3VSL A;  3OY9 A;  2KIS A;  4IQ4 A;  4XR6 A;  3SEQ A;  3S2D J;  1EA3 A;  1Y56 A;  2D1H A;  1UZC A;  4Y7N J;  4CCL A;  1VQ5 I;  1OYW A;  3FXJ A;  1MBE A;  3IUO A;  4N9H A;  2MW8 A;  5TIS C;  3DBH B;  2BBY A;  2EQR A;  4ENM A;  2FXA A;  3S3O A;  4HPQ A;  4KMU X;  1P4A A;  3U1D A;  1I50 J;  3BZK A;  1YLF A;  2IEK A;  2Q1Z B;  2RC4 A;  4G7Z F;  1W0T A;  2CV1 A;  1HSJ A;  5B5E C;  2XB0 X;  4LK1 F;  4X1E A;  3OYI A;  1H88 C;  1LKX A;  2Q2E B;  5ERI A;  2QQB A;  2R5Y B;  5L3E A;  2NVX J;  3K10 A;  3VYR B;  2HVR A;  2LH9 A;  5B1B H;  3KET A;  3A0B C;  2K7L A;  2K9Q A;  4IHW A;  2EIN H;  2VB6 A;  3G2B A;  4F92 B;  4J19 A;  2IGK A;  2LP0 A;  1SAU A;  3WU2 C;  3KYL A;  2VJJ A;  1P7I A;  1BI3 A;  5L3D A;  3VWB A;  4BY7 J;  5JHF A;  2STT A;  3DPL C;  5DDG A;  1HW5 A;  2BXZ A;  3A01 A;  5F08 A;  2V7F A;  4MFD A;  3J7Z I;  3OYM A;  3ERM A;  5FLV A;  1K6Y A;  5M3F J;  5CJ9 A;  4A3J J;  2W1O A;  1FEX A;  1FPQ A;  4U87 A;  2F4O B;  1WQ2 A;  2JN6 A;  5D6E A;  1ZR4 A;  1FX7 A;  1GXP A;  4QPO A;  1QBJ A;  5EGO A;  2K9S A;  3AL0 C;  2VQH A;  1UHS A;  4XOR A;  4JOM A;  3QQA A;  3CP8 A;  3LSH A;  1V55 H;  4CCN A;  4ZJZ A;  3RPU A;  5BQT A;  4YEL A;  4KIF A;  3CUQ B;  2P6S A;  4UY8 I;  1SAN A;  2K5C A;  3OYF A;  3P9I A;  3H3U A;  4XKW A;  1GHC A;  3IL2 A;  5DUI A;  2GIV A;  5D6F A;  1YRN A;  2ZXI A;  1R36 A;  2E1N A;  2XF7 A;  3WGI A;  2F6C A;  3R6S A;  5FFX A;  2Z9O A;  2OU2 A;  5J4V A;  1FNN A;  3GW2 A;  5CQG A;  4LB5 A;  3GX4 X;  1CFE A;  3OWT A;  3DP7 A;  5FKO A;  3V7S A;  2XAG A;  3V42 A;  2X6X A;  4CYD A;  2Z1D A;  2ZSH B;  5FKN A;  3TDZ C;  3L1P A;  2V9K A;  4IHV A;  1KQ9 A;  2HPM A;  2NS7 A;  4RGR A;  2GXA A;  1YQA A;  2YU9 J;  5K1Y A;  3CJQ B;  4YIR X;  2NVQ J;  2LRD A;  2X4H A;  4OIP F;  4M3E A;  1SC7 A;  1CGP A;  4GYG A;  3U1K A;  1RR7 A;  3O6B B;  3KX2 A;  2NVU B;  3DKX A;  3B73 A;  2HWV A;  4RA2 A;  1PUF B;  1FP2 A;  4XSX F;  4MTD A;  3CES A;  3QAH A;  4L9T A;  2D1V A;  1DUX C;  3I53 A;  3BJ6 A;  4JYK A;  2HYF A;  1DDN A;  3CCM I;  3UKG A;  4XLF A;  1YJN I;  3F8C A;  1IDY A;  5BPD A;  2IS1 A;  1YOV B;  3WGG A;  2V6C A;  5DUK A;  4A0Y A;  3EQL F;  3WTX C;  1PYV A;  1RI7 A;  4PGH A;  3L2Q A;  1XPX A;  2IA2 A;  2M8E A;  2PJP A;  2A05 A;  2XAH A;  3WE3 A;  5F04 A;  5F27 A;  4U7B A;  2DQL A;  2VPL A;  1ETW A;  2XVC A;  4KIS A;  3CCV I;  2HS5 A;  3H92 A;  3SZT A;  1F43 A;  4WXH A;  1MND A;  3CCQ I;  5FKM A;  3D5L A;  1DQU A;  3L00 A;  3GTK J;  1U9N A;  3KP5 A;  1S7E A;  4IX7 A;  2PN6 A;  2ZME A;  2XF5 A;  2Y0M A;  3HHH A;  5HDG A;  3DWL E;  3LST A;  5H6Q A;  3MZH A;  1IV8 A;  2FOW A;  3H3Z A;  4YFK F;  4A5N A;  1V3F A;  5CQE A;  1YS7 A;  3FMQ A;  2JQ7 A;  4BNC A;  3JR9 A;  4XID A;  5DCF A;  1BL0 A;  1QGP A;  2BY0 A;  2DYR H;  1JKO C;  2Q8K A;  2ECB A;  1NK3 P;  3RIR A;  3ZMU A;  4B3X A;  3CCY A;  3E6M A;  2ESN A;  4HZF A;  2P0W A;  2LVS A;  2RNG A;  4I2O A;  2PBI A;  3KEY A;  3CZ6 A;  2BY3 A;  2KL4 A;  2MD5 A;  2XGC A;  1APL C;  4HG2 A;  1JKQ C;  1FOW A;  3IRR A;  2DJI A;  2ZC2 A;  2JMW A;  2MC3 A;  2DT6 A;  4KMF A;  1YW8 A;  2G7U A;  2RNJ A;  3K4K A;  1VQ7 I;  3G71 I;  4GCV A;  2HYG D;  3QOD A;  1LE8 B;  1TQP A;  2M4G A;  1Y0N A;  1I5Z A;  5B3S H;  2DOD A;  2NOJ B;  3QWL A;  4OOI A;  5E3O A;  3H5A A;  1O57 A;  1ENH A;  3E5Q A;  3GLX A;  3I9V 2;  3KPH A;  1YX3 A;  5E20 A;  1J0R A;  4ZYA A;  2Z33 A;  1WRJ A;  1BW5 A;  3HOZ J;  3UNG C;  2W7N A;  3IV5 A;  1MZB A;  4TV7 A;  2NRA C;  2N8G A;  1MBH A;  4KIT B;  3LFU A;  3BR2 A;  1XGM A;  1FOK A;  3ABM H;  4B1R A;  4CH7 A;  4RB1 A;  1GVD A;  1MJA A;  2BVM A;  1KQ0 A;  4XKC A;  1ZAR A;  5FRN A;  1OYI A;  3J80 K;  2GA1 A;  2WAD A;  3GUD A;  3RYR A;  2JA7 J;  4Y33 A;  2MAB A;  3J81 Z;  2JZY A;  3OL3 A;  1QA6 A;  2R7T A;  1VQK I;  2O61 A;  3HZJ A;  2MA3 A;  4AIJ A;  3PIO F;  1W4M A;  2XIG A;  1AWC A;  2CU7 A;  3FIS A;  1A36 A;  3L2R A;  1Y1V J;  2Y31 A;  4A3K J;  2BYV E;  5L3B A;  1W7P B;  3I5U A;  2E2H J;  4V2G A;  4ZDO A;  4KJZ A;  3HDD A;  5IT9 K;  3U3N C;  5EYR A;  2NNY A;  3G4S I;  3OYH A;  2JVG A;  4HDV A;  3FXO A;  5GTI C;  4P1W A;  5LRR A;  5FB2 A;  3JRD A;  3E0J B;  5TJJ A;  5HS8 A;  5HS9 A;  1ZLK A;  3LL7 A;  2KZV A;  4ANJ A;  1B59 A;  2Q2E A;  1SD5 A;  1E3P A;  1X3Z B;  5E3L A;  5LRS A;  2R5Y A;  1VZ0 A;  2Y2Z A;  2KDZ A;  2EV5 A;  2DA7 A;  2KMU A;  5GAD J;  2K9M A;  5HNF A;  2ZME C;  2WY7 Q;  3WHB A;  1RUN A;  2W85 A;  4CCM A;  3ONQ A;  2YX4 A;  3CME I;  4KDP A;  1MBJ A;  1FWZ A;  4V2F A;  3KEO A;  2LC2 A;  1A35 A;  3UR3 C;  1EKE A;  3FM3 A;  1O4X A;  2B0L A;  1JE8 A;  4M6X A;  3OYL A;  1G3T A;  2STW A;  2LDU A;  1IUY A;  4OIN F;  4Y17 A;  5IOY A;  2X0L A;  1GV2 A;  3HYI A;  1NK2 P;  4EM0 B;  4IFA A;  2FBK A;  2ZCW A;  4HNT A;  2XUB A;  1D0Y A;  1W5C C;  4M71 A;  2RQP A;  1UFM A;  3F72 A;  4Q48 A;  3SQN A;  1SVM A;  1S3J A;  1ZGA A;  3SFZ A;  4MEX F;  1S72 I;  3CUQ A;  2VKV A;  4I7H A;  4YFX F;  1FYL A;  2XAU A;  3HIF A;  3LFK A;  3TP0 A;  4XNF A;  1TL8 A;  3FXU A;  5HDK A;  3IKV A;  3WG9 A;  2MH2 A;  1RKW A;  4HST A;  4JX4 A;  2YX7 A;  1ZR2 A;  2R93 J;  1G3S A;  3FK6 A;  1R5I D;  3HRS A;  1ON1 A;  1TLH B;  3F0C A;  3PO2 J;  5J6X A;  2VBX A;  2JSP A;  1AKH B;  3MAJ A;  4UVC A;  2ZJ2 A;  1HKS A;  1SFX A;  4IO9 F;  1YFH A;  1T38 A;  4BJ5 C;  4E4H A;  1R5G A;  4FIS A;  1TW2 A;  1OMI A;  5DD8 A;  1ZHF A;  2HQA A;  3PSF A;  3CLO A;  2A69 F;  3DCF A;  5HOD A;  2OV7 A;  1XTA A;  4I09 A;  3JCU C;  4LIV A;  4Q4Z F;  5LHG A;  1YHQ I;  1R1U A;  2KJC A;  1T0F A;  2DN0 A;  3W2W A;  3I4N J;  3DLA A;  2Y0S A;  3I59 B;  2V1D A;  1GDT A;  4QPQ A;  5GAH J;  2WB1 A;  3GTP J;  4W1U A;  3RZD J;  2BY1 A;  3RCO A;  3RKY A;  1PDN C;  4JX6 A;  3JTG A;  1QPM A;  1R00 A;  3PNY A;  1JKP C;  4FAS D;  1H9G A;  2KHM A;  1X4O A;  2B63 J;  4XQF A;  2EIK H;  2CMP A;  3MMY B;  3BG3 A;  2BGC A;  2X6W A;  4UNO A;  3R0A A;  2DDA A;  1MGT A;  3HSF A;  4BXX J;  1N77 A;  5LHH A;  1U78 A;  4HX8 A;  4PDK A;  2LY9 A;  3HJE A;  5JR3 A;  1V4R A;  5AON A;  1MBF A;  2FRH A;  3TMO A;  2ZJQ F;  4IRH A;  4MO7 A;  2QSH X;  4KT5 C;  2YS9 A;  4O5V A;  5J8C A;  2EWN A;  4BGD A;  1OCT C;  1Z9C A;  5GPC A;  1D0Z A;  5JLW A;  2LBF B;  2KIQ A;  3NAU A;  3DBL B;  1P92 A;  2PJR A;  2IA0 A;  5L3G A;  1WSU A;  2BHY A;  1HDP A;  4XSZ F;  1MDM B;  2CQN A;  1JT0 A;  3RTR A;  1EH8 A;  1OCO H;  1MMN A;  3C7J A;  3HPG A;  4D9J A;  1JUM A;  3CMY A;  3Q9S A;  4H0A A;  1BJA A;  1SMT A;  2R7O A;  4AVP A;  4OAZ A;  3K9T A;  3QOP A;  4P27 A;  2QQ8 A;  5LFA A;  4B09 A;  3VPR A;  3EPZ A;  3HOT A;  3S1N J;  1K79 A;  2LOO A;  3GO5 A;  3LSG A;  2DA6 A;  4XLA A;  1E2X A;  3Q2U A;  3BR5 A;  2PX9 A;  3CQZ J;  3G1L A;  2OCC H;  2X6O A;  3BDD A;  2CQ7 A;  4L5J A;  4HRI A;  1VQN I;  1OJL A;  5K7H A;  2EB7 A;  1S8N A;  1UG0 A;  2BW3 A;  2CW8 A;  2YU3 A;  1VQ8 I;  1IRF A;  2MGQ A;  3ERE D;  3ZPL A;  4FT8 A;  4LG0 B;  1KA8 A;  2KZG A;  3CUQ C;  2KLO A;  2VE8 A;  3DFG A;  4GGG A;  1NTC A;  4PSW A;  1LFP A;  2DA4 A;  5M3M J;  2CUZ A;  3FZV A;  2ZSI B;  3VOD A;  4IOC F;  4RB2 C;  3ZMZ A;  4NC8 A;  3CP2 A;  1DU6 A;  2R7D A;  3PM1 A;  3BJA A;  4NQW A;  3SZP A;  4S04 A;  4XKV A;  4BAC A;  1J9I A;  2M9H A;  1SMB A;  2QGU A;  4XL9 A;  5D8L B;  2IS4 A;  2GWR A;  3F6V A;  2DPD A;  3ZQG A;  4A3D J;  3K69 A;  4OMY A;  1B6A A;  4E7K A;  3ZQL A;  2Y9Y A;  3Q2R A;  1FZP B;  2VLA A;  2CRG A;  1WHU A;  2DCE A;  2JSC A;  2R4G A;  4HX7 A;  1P4X A;  4U7D A;  3BTL A;  4UV9 A;  2O9L A;  3TW6 A;  1VQM I;  1WZ2 A;  1TWC J;  3IAM 2;  2IGO A;  4D0P A;  1FOX A;  1QNT A;  1Z7U A;  4E7Z A;  1K78 A;  3HGG A;  2X48 A;  3QP6 A;  4J01 A;  1TBX A;  3BLY A;  2P5L C;  2L5Q A;  3S17 J;  4W97 A;  1B72 A;  1FYM A;  2AQE A;  2FQ4 A;  4XKB A;  2QEN A;  1T0F C;  3JW4 A;  1PVE A;  4UB8 C;  3BTI A;  2CYY A;  4E7S A;  1KU2 A;  3HG9 A;  3H5R A;  3GVA A;  3S16 J;  1T95 A;  3CC2 I;  1GV5 A;  3WU0 A;  3U3U C;  1QZZ A;  1FY7 A;  4HLX A;  3BR6 A;  2L4A A;  3DBR B;  1F36 A;  3EUK L;  3GFL A;  3RPU D;  3OS1 A;  4M9X A;  1FT9 A;  1MW7 A;  1VQ9 I;  1FIP A;  3TDU C;  1Z67 A;  2HYJ A;  1HCR A;  1P7J A;  3HOW J;  1UMQ A;  2CH0 A;  1ZG1 A;  1AHD P;  3L2U A;  3BR0 A;  4R1H A;  2XAQ A;  2K9N A;  4RLF A;  2JA6 J;  4MNU A;  4U0V A;  3C2B A;  2V6E A;  1G6N A;  2O8X A;  4EVI A;  2UUZ A;  2Y0S N;  2FEZ A;  4HEA 2;  1R7J A;  3RQI A;  4JQF A;  4L5E A;  3CJR B;  2XKP A;  3GFM A;  1X19 A;  1ZG3 A;  2X85 A;  2PLY A;  2KIU A;  3NWT A;  4CCO A;  1Y39 A;  1WWX A;  1ORK A;  1YIT I;  1ZKG A;  3H1C A;  3A4C A;  1FSH A;  2HVQ A;  4BQO A;  3F9K A;  4ASN A;  3ZMD A;  3N97 A;  5EF6 A;  4ENJ A;  5D5V B;  2XF6 A;  3PQJ A;  3BJO A;  4NUN A;  1I27 A;  1BIB A;  4ENN A;  3BG6 A;  3NWS A;  3BZC A;  4C2T A;  5FRO A;  2LG4 A;  1CF7 A;  3GBG A;  3I3L A;  4IQJ A;  1DP7 P;  1X58 A;  3HB9 A;  1JUP A;  2OPT A;  2P5V A;  4A2U A;  2LLK A;  3E6D A;  5EEA A;  2P7C B;  1I3A A;  1WI3 A;  2DTR A;  4CGZ A;  3RKQ A;  3KZY A;  2ME0 A;  4RM2 A;  3ZQ7 A;  3MD2 A;  3E3V A;  1AKH A;  1T98 A;  3HM5 A;  2FU4 A;  4A69 C;  4BUP A;  1XGO A;  3CCE I;  4BY1 J;  4XBF A;  2IGN A;  3TP3 A;  4Y52 J;  2DO7 A;  3AKZ A;  2NOG A;  4WF2 A;  2FNA A;  2MBF A;  2ZO4 A;  2F5F A;  5CVU A;  1A5J A;  2DT5 A;  3QYB A;  2Y75 A;  3BG7 A;  3LOC A;  3MZY A;  3PFY A;  4XLE A;  4AUX A;  4HV5 A;  4EEF G;  5ICG A;  1DGR M;  1POG A;  1HXD A;  1OKR A;  3L2C A;  3H36 A;  1O3Q A;  1IAW A;  3BP8 A;  3SJM A;  2V1U A;  4OWR B;  2K86 A;  4WXC A;  3WOD F;  1ZG5 A;  2R7U A;  3F8M A;  3GF2 A;  3KLO A;  2UZK A;  2TRT A;  4OAY A;  4G8X A;  3RZO J;  5ICF A;  4RGU A;  1SFU A;  3B6A A;  5HOO A;  5KHD A;  2DAO A;  1H8A C;  2DOF A;  3JAM Z;  4M72 A;  3JSP A;  1U3E M;  1SVL A;  1KZH A;  1DPR A;  4P9F A;  3R60 A;  3NRV A;  4PFP A;  4D5F A;  4M3B A;  4DYR A;  5IYC J;  4YRV A;  3ZXS A;  4LLL A;  4LB6 B;  5KK1 A;  2RDP A;  3W6V A;  2K85 A;  4CSW A;  1WJB A;  3HKZ A;  5FD6 A;  5E1X A;  5E3M A;  4XN3 A;  1XSV A;  4KUM A;  2P7V B;  4R8H A;  4A3G J;  5B66 C;  2MLK A;  4MHG A;  3CF5 F;  1NG6 A;  1ZN2 A;  2KP6 A;  1HA8 A;  2EBI A;  4E7L A;  2ME6 A;  2LKP A;  3E6C C;  1O7L A;  3CCU I;  5M5W J;  3VEP A;  4BS9 A;  1XGS A;  4LIT A;  1K4S A;  4F55 A;  1ZK8 A;  2EFP A;  2IAI A;  3S3N A;  4RMN A;  1D8J A;  2HDD A;  3HHG A;  2R7V A;  5KAF C;  3KCC A;  2JPB A;  2M2E A;  3JRF A;  5CLS A;  1TC3 C;  3MWM A;  3DU6 A;  3K4M A;  3CTA A;  4QTR A;  4CDG A;  4UV8 A;  5FJ8 J;  4ZTF A;  1V5G A;  4IHX A;  3KP3 A;  3HUG A;  1VTN C;  2P4W A;  4IJA A;  3QPS A;  2F5C A;  2CV2 A;  3BCA A;  5GTH C;  3LA3 A;  2VJ5 A;  4BDZ A;  1YW7 A;  2K40 A;  1H0M A;  1FC3 A;  1BR4 A;  2L4M A;  3FBN B;  1R58 A;  3TOA A;  2VT2 A;  2E2J J;  2X51 A;  2OC6 A;  2HDW A;  5FLM J;  3BR1 A;  5CVR A;  2EIM H;  4G6Q A;  2CJJ A;  1BIA A;  3LSR A;  2XRL A;  4M3F A;  2M5W A;  3S6U A;  4RAY A;  4LG0 A;  4E70 A;  1R4N B;  2MSY A;  4KIG A;  4F93 B;  2R92 J;  3S1R J;  5C4J J;  2QBY B;  2H09 A;  4EJU A;  2CG4 A;  1JTY A;  1MJ9 A;  2IA1 A;  3OR2 C;  4XIC A;  1QQI A;  1KYZ A;  1IC8 A;  2KT0 A;  2L9S A;  3GTL J;  1XN7 A;  5J1U A;  1HKQ A;  5ILU A;  3J7Y J;  4NNJ A;  3A03 A;  1HW2 A;  3O8H A;  3LWF A;  5E79 C;  3WTY C;  2R5Z B;  1OR7 A;  3GZN B;  1U53 A;  4FX4 A;  1M1E B;  2H6C A;  2HOA A;  2F5E A;  5E18 F;  3ZN1 A;  1OCP A;  1T08 B;  3LSP A;  3LAP A;  2NXN B;  1H89 C;  1J2X A;  4MQ9 F;  4PZJ A;  3KP4 A;  4M6V A;  2QUF A;  1HKT A;  2HI3 A;  4BHB A;  3RPQ A;  1BJZ A;  2GXB A;  1UAA A;  1IXS B;  2OD5 A;  2VI6 A;  3GZ5 A;  3LA7 A;  2EA4 A;  1AU7 A;  2F4M B;  1T56 A;  1FBS A;  3O8G A;  1A6I A;  1LFU P;  4IZZ A;  2EFO A;  1RNL A;  3V7C A;  4RB0 A;  2VKH A;  4LG3 A;  2LD5 A;  4KIB A;  4ZYD A;  2LY1 A;  3BOQ A;  4YG2 F;  4B8X A;  1JHH A;  2DA3 A;  1XMX A;  5M5Y J;  1ERD A;  1JJ6 C;  2RRE A;  2CV0 A;  4P55 A;  5EJC A;  3LSM A;  3FIW A;  2DFH A;  5DM7 F;  5DV5 A;  4NHJ A;  2PMZ A;  3TL4 X;  5LEJ A;  2OF7 A;  2YPR A;  4A3M J;  2COM A;  1OCZ H;  2HGC A;  5JI6 A;  1WJA A;  3FKJ A;  3DEE A;  3ZQQ A;  2XV4 S;  3L09 A;  5FO5 A;  5A2Q Z;  1LQ1 A;  1SD4 A;  3IH4 A;  2Z16 A;  1G2H A;  5ICE A;  4ENK A;  2F48 A;  2JRT A;  4I01 A;  3KP6 A;  5IP7 J;  1TTY A;  3H35 A;  4UXN A;  1FTZ A;  4CUG A;  4NUO A;  3BG9 A;  1WJ5 A;  1XCV A;  3GLL A;  1T8I A;  4M74 A;  4MFE A;  4L18 B;  4UB6 C;  4GYI A;  4EV0 A;  3F3X A;  3HL2 A;  2FE3 A;  4FE4 A;  2M34 A;  4PCQ A;  1BR2 A;  2WAE A;  3B6C A;  1S5L C;  1XMA A;  3HKZ N;  1R22 A;  3REO A;  4EJW A;  4DJA A;  2EFQ A;  1SMY F;  3FHZ A;  1IRG A;  1X1D A;  1WJD A;  1Z77 A;  2LSO A;  2VAS A;  2WAQ A;  2XPU A;  2KQR A;  3GXO A;  4TPV A;  2L9N A;  3AG1 H;  3ZCO A;  3TOB A;  4S0H B;  4AM3 A;  3NT8 A;  2ETH A;  4BL0 B;  2XGX A;  3LMM A;  3ISP A;  2OQR A;  4QIW N;  1JKR C;  4D7M A;  1MNM C;  2KDO A;  3O3K A;  1U5T A;  2X1C A;  2Y69 H;  5FGM A;  1ZRC A;  3RDI A;  2ID6 A;  3ZQC A;  1ETK A;  2QEX I;  1E3H A;  5DTD A;  3I56 I;  3CUO A;  5FKK A;  3IWZ A;  3AAF A;  3KE2 A;  2FNP A;  2W84 A;  4QSH A;  2BOL A;  5H2F C;  1MMA A;  2DJN A;  3D0S A;  1FYK A;  1R4M B;  2XHK A;  3FM5 A;  3F23 A;  4WCG A;  1F4K A;  1MMD A;  3WTS C;  4I02 A;  1D1B A;  2V26 A;  4BYY A;  5EG0 B;  3H9J A;  3I55 I;  1TWG J;  4MIM A;  1RUO A;  2ELH A;  2M8G X;  4ZYH A;  2V4J C;  1OLT A;  5KCM A;  2QF7 A;  4GFB A;  5ICC A;  1F9N A;  2WTE A;  1SFO J;  1QZY A;  4DZP A;  5B1A H;  1I1G A;  2R7Z J;  4IF4 A;  1GT0 C;  4PJM A;  1OR7 C;  1USS A;  2NVT J;  2DFE A;  1J7K A;  3I4P A;  1ZRD A;  2QA4 I;  1D5Y A;  4RGS A;  2FJ1 A;  1BM9 A;  2OTL I;  2ISY A;  1EV7 A;  5D4R A;  2HNH A;  2W24 A;  4DYQ A;  1W36 C;  1B8I B;  2NS8 A;  1X1B A;  2NAZ A;  2ISZ A;  4A3C J;  3ZOB A;  1LJ9 A;  4G9Y A;  4BEH B;  5DEQ A;  3RKX A;  2JWT A;  2MLG A;  1L3L A;  1NHA A;  4YFN F;  5K5O A;  4BE1 A;  3RQ4 A;  1RES A;  2L9R A;  4I76 A;  3WHC A;  5BNG A;  2NNN A;  2DOA A;  4BHP A;  1LDK B;  4LMY A;  5LGN A;  2LF7 A;  1HST A;  3E7L A;  2FUG 2;  3H9G A;  4AYB A;  3L2V A;  1WI9 A;  3HOS A;  3S1Q J;  5ILS A;  2EPF A;  3GTG J;  2CUF A;  1GVJ A;  2XB5 A;  1ZRF A;  4RAF A;  2JTV A;  3G6E I;  2MG4 A;  4I0B A;  3OS0 A;  1ZAO A;  1TT5 B;  3CF2 A;  1J75 A;  4E7H A;  1N75 A;  2VKD A;  1X4P A;  2VL8 A;  4C2U A;  2AS5 F;  1X1P A;  3L2W A;  3NEU A;  3JRI A;  1MSE C;  4BXF A;  4EMS A;  3AL0 B;  4XRS A;  1RR8 C;  2A6E F;  4HF1 A;  4Y13 A;  1SAX A;  3R61 A;  1HF0 A;  5JVT A;  5ETE A;  2VBY A;  3HRU A;  3W2V A;  1FJL A;  5D8K B;  2BVL A;  1PJR A;  3G1O A;  4EQQ A;  4HA8 A;  1U6G A;  5AIP A;  1VQO I;  3BY6 A;  1VQ6 I;  3BC8 A;  1XSX A;  3CCL I;  3WGH A;  3BG5 A;  3MQ0 A;  2ZB9 A;  4PSX A;  4AWX B;  1Z91 A;  4H4K C;  1MSF C;  1HQC A;  3CCR I;  3FXM A;  3GEZ A;  1HLV A;  4AIH A;  1U5T C;  2NYX A;  2HDC A;  1XS9 A;  4BBS J;  2HFH A;  4CHU A;  2A5Y B;  3J81 K;  3QPL A;  3PUF A;  3K4L A;  2ZNY A;  4UUS B;  2K3P A;  3TQN A;  4MTE A;  3S14 J;  3AG2 H;  4YEJ A;  4E7J A;  4EJV A;  2BXY A;  3FXQ A;  2DMQ A;  4GO1 A;  1PUF A;  4MQV A;  2WAQ N;  2IS2 A;  2R5Z A;  1IN4 A;  3GTM J;  1XSD A;  3DTE A;  2A6H F;  1N78 A;  4OMZ A;  4PJN A;  3M9A A;  5J4Y A;  2GZW A;  1VFC A;  4IRG A;  1SEU A;  2XRO A;  1I3Q J;  1LPQ A;  4LOC A;  4L9N A;  3S93 A;  1RKT A;  1IZ1 A;  3M8E A;  1YO5 C;  4MLO A;  2DW4 A;  4CCJ A;  2KFD A;  1YJW I;  4NBQ A;  4EAT A;  4I0A A;  4RS8 A;  3SYT A;  4FCY A;  4BQA A;  2ZJR F;  1V5E A;  2COB A;  2P8T A;  2A5W A;  2LKS A;  2E19 A;  1U8R A;  3K2Z A;  3W6K B;  2OJE D;  4A3L J;  4B44 A;  4KNY A;  2EFN A;  9ANT A;  4HAM A;  1G3W A;  2PMH A;  2H8W A;  3FWE A;  5EEH A;  4G12 A;  3ZRG A;  2WV1 A;  2HOE A;  1J09 A;  4F91 B;  4UHT A;  2H1L A;  4L9V A;  1WKM A;  2JA5 J;  1HDD C;  1NG7 A;  2EIL H;  3BZ6 A;  1QNX A;  3DTI A;  3Q9V A;  3W3C A;  1H9T A;  2OUM A;  2LY2 A;  2P6T A;  3A01 B;  3PQK A;  3SFI A;  1BN5 A;  2QKL B;  2P81 A;  1I6X A;  2IRF G;  1VI0 A;  3C2G A;  2FD5 A;  5HLG A;  3PO3 J;  5E8G A;  5CKT A;  5F0F A;  3ELK A;  4BJ6 C;  2L9V A;  4XRS G;  1U0J A;  5IT3 A;  5EZH A;  4RDU A;  1JT6 A;  3PUB A;  5EGO B;  1EH7 A;  3O2P E;  1LE8 A;  2BHZ A;  2E1M B;  1IF1 A;  2ZJP F;  4ESB A;  3DPU A;  3U3L C;  3RKW A;  2RKH A;  1L0O C;  4O6J A;  4BE2 A;  5BOX A;  1IG7 A;  1ZRE A;  3K7A J;  2FBI A;  1S6L A;  3KP2 A;  4RB3 C;  1GXQ A;  3DF8 A;  4N4O B;  3K2A A;  4BE0 A;  1TQM A;  2ECC A;  2GA2 A;  1E3O C;  5GPA A;  2RQQ A;  2RV8 A;  3OMY A;  3OV8 A;  2RAE A;  1T39 A;  2XSJ C;  1NH3 A;  2DMN A;  3K1P A;  1I6H J;  1IN6 A;  5TGT A;  4A0X A;  4CA0 A;  2L0K A;  2KRC A;  3K4J A; 
#chains in the Genus database with same CATH homology
 3S6V A;  4NUN A;  2DDA A;  2CQ7 A;  3Q2U A;  3U3U C;  1QNX A;  1RC9 A;  4IFA A;  3S6U A;  3S6S A;  2VZN A;  3U3L C;  4D53 A;  2DDB A;  4NUI A;  3MZ8 A;  4AIW A;  4G2U A;  1WVR A;  4H0A A;  5JYS A;  4LY5 A;  2A05 A;  4TPV A;  4P27 A;  3U3N C;  1CFE A;  1SMB A;  2GIZ A;  4NUO A;  3NT8 A;  5ETE A;  2EPF A;  1U53 A;  4NUK A;  1XX5 A;  3Q2R A;  1XTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...