2W1OA

Nmr structure of dimerization domain of human ribosomal protein p2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S ACIDIC RIBOSOMAL PROTEIN P2
publication title Solution Structure of the Dimerization Domain of Ribosomal Protein P2 Provides Insights for the Structural Organization of Eukaryotic Stalk.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 20
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w1oA01
4BEHB 4BEHA 2W1OA 2LBFA 3A1YA 2LBFB
chains in the Genus database with same CATH superfamily
2BE5F 1KA8A 3LFKA 3HBLA 1YO5C 2E7XA 4KMUX 4U0YA 4Y52J 2A6TA 4YELA 1DUXC 3DEEA 4Y13A 3ZQCA 3ZOBA 3U21A 2RNGA 1S9HA 4HQMA 4A5NA 1MZBA 3CLOA 4EM1A 1Y1VJ 5B3SH 3PFIA 2KJCA 1V5EA 3BQYA 3OWTA 4M3FA 2CMPA 3NWTA 1FOKA 1SFKA 3K4KA 2QQAA 3NARA 4EGYA 2W24A 1PVEA 5CPRB 5DEQA 2M8GX 3ZR8X 2CJJA 4OMZA 1DGWY 2HS5A 2YX7A 2EPFA 3RPUA 1S6LA 2V79A 1K78A 3TO9A 4CCKA 3BROA 1YRNA 3CF5F 4I01A 2QEXI 4BL0B 4BBSJ 2P7VB 3K2ZA 4PUSA 3FHNA 2Z33A 4G7ZF 3W6VA 2OF7A 3K2AA 1VF9A 4HNTA 3DKXA 1SAXA 3P5JA 5LD2C 3HTSB 1X1BA 1MMNA 3MKYB 1ZHFA 2KPMA 1USTA 3M9AA 2OBPA 1WSUA 2X51A 3S14J 2P5KA 3ASNH 4RM2A 4V19K 3BJOA 3GFLA 3SJMA 1VQ8I 2H8RA 2MYSA 2PG4A 5EF6A 1R36A 1RIOH 3K4JA 2YUSA 2EBIA 2QUFA 5H20A 2PBIA 3C2BA 3I55I 3IAM2 5L3CA 2K3FA 3G1OA 3QPHA 1OR7A 2K85A 2EFOA 4E7SA 4P9UA 2JK3A 2HPIA 4H4KC 3RI4A 3RDIA 2BGCA 4XSZF 1YIJI 2DOEA 4B3XA 2QVOA 3TQNA 3FXLA 1UCRA 4HDUA 3I4MJ 4HF0A 3T1BA 4KISA 3H5AA 5D5VB 2VXDA 2H09A 4LLGF 3ZQFA 4AIJA 1VFCA 3BR0A 5DCMB 5J40A 1BBYA 4S05A 3K0LA 2HZDA 3OYCA 1LUJB 4LD5A 4M6XA 3GLXA 5TISC 3MD2A 5H6QA 2GIVA 4L0YB 3QPLA 2JT1A 2XUBA 2L4MA 3KZIC 1FY7A 2JRMA 4HBLA 4M3GA 3OR2C 3V7SA 5EGOB 1H8AC 2HTSA 2MSYA 4CHUA 4NDLA 1J75A 3OYGA 4ZC3A 2AXLA 3V8KA 1ZRCA 3IC7A 3BC8A 3MWMA 4G7HF 3V4GA 4RLQA 2I8DA 2DT6A 2RV8A 3KE2A 4WK8F 1QA6A 2XIGA 3ZQ7A 4UV9A 3M07A 1U8BA 1FWZA 4IHXA 1O3RA 2Z1DA 3L2UA 2P81A 3WTUC 2JMWA 3WU2C 1KONA 2DFIA 4LLLA 3ZMDA 1QVTA 2DFEA 3MQ0A 1F4KA 3H5NA 2XAFA 3KFWX 3SZTA 5EZGA 3ISPA 4ZZLA 3FX3A 5KNLA 2IGOA 3M4OJ 1MNEA 1YG2A 6PAXA 4IF4A 4UUSB 2KT0A 2E1CA 1PDNC 4U0WA 4IXAA 3C2HA 5F0CA 5JVGF 3ONQA 4BHPA 2M4GA 2MG4A 2A5WA 4C3IJ 2HPMA 3OYNA 3EQLF 4I99C 1XGSA 3ZQHA 3DCFA 3R4KA 4LB6B 3M1CA 5LFAA 2CFXA 2DI3A 1OYWA 2DBBA 1JUPA 2QSFX 3HUGB 3ZMZA 2CH0A 2L54A 3FISA 2ZCWA 5ICEA 3A01B 2XKPA 1FYMA 1WZ2A 1XGMA 2WV1A 5FFZA 3WTSC 4KYWA 1IF1A 3WTXC 2PN6A 3E6MA 4ZDPA 1GT0C 1MDMB 2R5YA 1SANA 2CUJA 2HR3A 2O7OA 1D5VA 3Q3SA 3ABTA 2KFDA 1E17A 3AFHA 4M6YA 4ZDLA 5EZHA 1LB2A 2CUFA 3CP2A 1S72I 1RI7A 3VSKA 3L2QA 1WVRA 2WADA 1ETXA 3OY9A 3KLNA 4ON0A 1U2WA 1TWCJ 4V2GA 5CQGA 4IRIA 4YRVA 2O5RA 4FHTA 2UZKA 2KIQA 3ZRGA 4PSWA 3PNYA 4JBAA 1YHQI 1STZA 2JRTA 3NAUA 3Q0VA 2EFWA 1QPIA 3I59A 4AYBA 1R4MB 3JREA 4I7HA 1TC3C 2VI6A 2DTZA 3QODA 4YIRX 3HC7A 4OIOF 2HXIA 4PZJA 4IHYA 1OYIA 3K9TA 2IEKA 4NC7A 3FXRA 4LJZF 1RRJA 2DCEA 2OD5A 2Y48A 3KYCB 1WH5A 2UUZA 2KIFA 4IJAA 2E60A 1Q1VA 3IHUA 2O61A 3OOUA 1GV2A 4HAMA 4NC8A 1K7AA 3K4CA 3B02A 1IN4A 2P8TA 4ZTFA 2D1VA 5BS6A 2ZMEB 1YW8A 1R5GA 1G59A 3KP2A 1IGNA 3CJNA 4MTEA 3QOPA 2AXTC 2L5QA 3QYFA 2HOAA 2Q1ZB 3J7ZI 1MGTA 1HW2A 3WGHA 5JLXA 4XRMA 2F48A 3LAPA 5J8FA 2YS9A 4I0AA 4IL6C 5D4RA 5A2QK 1XMXA 3OYMA 4GXOA 3LSGA 2R7VA 3OYDA 3OYKA 2X85A 3CLQA 3FXOA 2NAZA 2CO5A 1BN5A 4CXFA 3QQAA 3I53A 1W4MA 3E5XA 1B8IB 2CW7A 3DXJF 1D1CA 3D1NI 2R92J 1IRXA 2DQLA 2VJJA 5IP9J 4BXXJ 2R7RA 1DPUA 2LTPA 1HSTA 1T38A 2XAHA 3LSTA 3CDIA 3WG9A 1Z3YA 2IS1A 2BEOA 4HV6A 3MEXA 1ETYA 1OKRA 2W57A 5J47A 4WXCA 1JUMA 2ID6A 4KA4A 2MBFA 4M9SA 1LE8B 1VI0A 3OIPA 3D0SA 4AWXB 2LR8A 1SMTA 2KHMA 2BOLA 1Z7LA 2DK5A 3F8BA 1BW5A 1AU7A 3IP4B 5CYVA 4FX0A 3TMOA 3A02A 1YS6A 2LP0A 4BQAA 2OQRA 1OPCA 3G71I 1HKTA 3VYRB 3ZGKA 1B72A 2NOGA 4A3JJ 1DP7P 3AG3H 4GYGA 1FX7A 2V4JC 2CS3A 1VQ6I 3K4LA 3BR1A 4UVBA 4A6EA 5D6FA 5LRRA 5E3LA 3KEOA 5FLVA 4S04A 4BXUA 3BG3A 5GTIC 3PIOF 4P5OA 3PUBA 1CGPA 2DJNA 3K69A 2QYOA 2HTJA 3F8MA 2VASA 2QSHX 2F5EA 3W2WA 1HKSA 1ZYRF 3BZCA 2LDUA 3OV8A 1V5FA 2Y0SA 4HX7A 2R7XA 1WJDA 4BUPA 1RNLA 1SFXA 3RKQA 3OYFA 1BOBA 4LG3A 4NUBA 1QRYA 1NK3P 1TQPA 4I76A 4E4HA 4XRFA 4DBRA 3KEYA 1FPQA 2HWVA 2W82A 2CW0F 3F72A 3CC7I 2CQKA 3I54A 4G12A 2VXZA 4NHJA 4PJ0C 2X1DA 2HFHA 5ICFA 2JA7J 1MMDA 3JTHA 5IYDJ 2G7HA 1AHDP 1TW3A 2XAJA 5DV5A 3S3NA 4RAYA 4FX4A 5HLGA 5DUKA 3N05A 5DS9A 1H0MA 5J1UA 3P9KA 1NTCA 1MBKA 3DKWA 1KU3A 1W36D 1U5TC 2A6HF 4OWRB 4BAYA 2O03A 1A31A 5D4SA 1XTAA 3ZXSA 1UHWA 2HI3A 5FKLA 1P7JA 2PJRA 2ZSHB 1Z3XA 2PI0A 2BXYA 1FNNA 5IYBJ 2KIMA 4CZCA 4IKFA 2KZGA 4A5MA 2DQRA 3L09A 3NEUA 2DN0A 1XS9A 2F5VA 2CRGA 1R6RA 2LBFB 1V4RA 2CU7A 2XGXA 2ZXJA 1MH3A 2NYXA 4HX8A 4PK4A 1ITYA 4Y33A 2FE3A 4M72A 3OSFA 1PYVA 2W7NA 4I2OA 1FEXA 2GQQA 1S7AA 2X4HA 4BXFA 5HLHA 2BY3A 3SEZA 2LVSA 3GTQJ 2W4SA 1ZR4A 1R7JA 1BI2A 4ESJA 1IN5A 3DPUA 3JRIA 4L18B 1G3SA 3QU3A 3G1MA 2ECCA 2BW3A 2FNPA 3FK7A 2EIMH 3H3UA 2EZIA 4LITA 4RDUA 2R5ZA 3AG4H 4LK1F 2JVHA 3BTJA 4LIVA 4BBRJ 3CCEI 3I56I 2XKOA 5JHFA 3M3YJ 5CQEA 2VOOA 2PMZN 1MW7A 4A3KJ 1XB4A 5EEAA 4NQWA 3LSKA 3CUQC 2ZO4A 1W0TA 1TTYA 1U5TA 2NVYJ 4B48A 2WV0A 4UXNA 2F4MB 3PO2J 5A2QZ 5E17F 2M45A 3V7RA 2HQNA 4BYYA 3V8JA 2K9LA 3TGNA 2V1NA 1ZARA 3BTLA 1P4WA 4X0GA 2OZ6A 4CUGA 1Z6TA 1PJRA 1D3YA 3WTVC 1WI9A 3OR1C 3CC2I 1UG2A 5FROA 4ANJA 3S15J 2Z2SB 1LPQA 1TWAJ 4OMYA 2O8KA 1XGNA 1ENHA 2AO9A 5HODA 2QKLB 4WXDA 1IV6A 4UY8I 3IAS2 2R7SA 2VQHA 2LKXA 1FBSA 2VPRA 4R1HA 3MZYA 2E71A 3LOCA 2CUEA 2BHZA 2JUCA 4L9VA 3BR2A 1UB9A 3S17J 5IYCJ 1QO0D 1G8XA 4QIWN 4JQFA 2VKDA 2ZFUA 4XBFA 2HNHA 4Y7NJ 2HYFA 5F1RA 4EVIA 2MLKA 2WWYA 4EEFG 3EYYA 4XLFA 3CUQA 4XLEA 4AIKA 5DYMA 4XRSA 1QVUA 2F4IA 3JW4A 4FASD 4V2FA 3JRBA 1T39A 4PGHA 1YX3A 4MO7A 1ZGAA 2CSOA 3A2KA 3UNGC 4DZPA 5M5WJ 2J5PA 3P9CA 4DYRA 4TV7A 1XCVA 1IC8A 1I3AA 3GZ5A 2UWMA 3S8PA 1SVOA 1QBJA 3DBHB 2TCTA 1GVJA 2JUGA 2XB0X 1NHAA 2IP2A 3LFUA 3LSIA 2X6OA 4HNVA 3QPSA 1ORKA 2HKXA 3WE2A 1IW7F 2L02A 1AKHB 2YU9J 3BTIA 5DM6F 4ZZDA 1A6QA 2H1LA 2NS8A 4RBOA 1FP1D 1VNDA 4EM0B 4RB2C 3ECHA 1D1BA 5HDGA 3CP8A 4A12A 4ETSA 4RS8A 2X48A 3JRGA 4E7KA 2M2EA 3S3MA 1OCOH 5DD8A 4HZFA 4ABZA 3IKTA 1T0FC 2KQRA 4L5IA 4XOPA 3F3XA 2LRDA 1XDUA 1ETVA 4RGUA 3HOWJ 5AONA 3TL4X 3QRFF 1KQ0A 2Q2EB 1AOYA 1FLIA 3JSPA 3O2PE 3TBIA 4ITVA 4Q48A 2OV7A 4I98B 1YJ9I 1N75A 1LDDA 3VYSB 2DJIA 5E8IA 4CYCB 5F27A 4IPAA 3TW7A 4D9JA 2L9NA 2EA4A 4QPOA 5EYRA 2ZKZA 1PUFB 2XGCA 4UV8A 3E0JB 3ZQGA 4EM2A 4F3QA 1VQ5I 2B63J 2XSDC 2D5VA 3GBGA 2V1UA 2JZYA 2LK2A 2R7WA 4ZYEA 2OU2A 3KP7A 5L3DA 2ID3A 2XRNA 3KP5A 5HLTA 4HF1A 1IG7A 2Z16A 1WFXA 5FKNA 1TT5B 3DTEA 1ZN2A 3QU6A 1GV5A 4LIUA 4B44A 1X2NA 3ESWB 3IH4A 1E3OC 1W0UA 1W7PB 1XDSA 4Y3OA 1BM9A 2ESNA 1KQ9A 4QSHA 5LEKA 1DU6A 2DU9A 1D5YA 2E2JJ 2BY2A 2NS7A 3FXUA 3B6CA 1UHSA 5FKKA 4Z2YA 4IHVA 1T0FA 3AL0B 4GYIA 1DGRM 4G94A 2PFBA 4A0ZA 4CA0A 3HKZA 3HSEA 3FMSA 4CYDA 3UKGA 3O6BB 3OS0A 3SDBA 4DGWB 3S93A 2RVCA 5C4JJ 2K3PA 2JN6A 3I4PA 2UV1A 2EILH 5ILSA 2XPWA 1REPC 1WQ2A 3GF2A 5C4XJ 2ISYA 2ZSIB 3FMRA 2K40A 4EJOA 2PLYA 5BMZA 4KT5C 4OAYA 4BHBA 4L9NA 4EGZA 1LKXA 4UUSA 2ZB9A 3G3ZA 4UB8C 3RKYA 4II3A 2VN2A 1D1AA 2QSGX 1WWXA 3RSNA 2Y2ZA 3IRQA 1HW1A 2QQBA 2GA1A 3I5UA 3FMQA 4E7ZA 2XGEA 1K4TA 3RKWA 5E20A 2ISZA 3IH2A 3WG7H 4AVPA 1UFMA 5FO5A 2ZNYA 3CCYA 3HUGA 3PIPF 2ZMEC 3DEUA 1G6NA 3ZPLA 2E35A 4PJLA 3A01A 2CQ7A 1IAWA 3CESA 4ENNA 4A0YA 4AIHA 2M0CA 2IRFG 3DKYA 5JFRA 3RIRA 4BDYA 4U0VA 3HTUA 3BDDA 1RUOA 2ELKA 2ZXHA 4MNUA 2GXGA 5K7HA 4I6ZA 3H5RA 4N9IA 4IX7A 4U88A 2FBHA 2IT0A 4MQVA 3S2DJ 1GVDA 4UB6C 4GFBA 1FMWA 1WJCA 4M3BA 3VYUB 4J19A 1SFUA 2FD5A 2GAUA 4Z6YA 1ETQA 1LJ9A 3HZJA 3ZMTA 3GZ6A 2W84A 4D7MA 2R7FA 3HOTA 4DBQA 4PCQA 2NRAC 4XLCA 3S1MJ 3FXKA 1FBQA 1I50J 2WY8Q 2YSRA 2OUMA 3WODF 5BPIA 4P96A 3LMMA 2A3SA 1DP3A 2LF8A 2DA4A 2BVMA 2QQ9A 3ECOA 2WAQA 4LLNA 3S1RJ 2QLZA 3GTLJ 2H8WA 1R1VA 1WCMJ 1IRGA 1UHMA 2BXZA 1AWCA 2ZMEA 4RMNA 2KDZA 2AQFA 3GTPJ 4D0PA 1USSA 2MLGA 1WH7A 2RN7A 3CZ6A 1MBEA 1A5JA 4KUMA 3I71A 1W5TA 2MH2A 2QENA 4OINF 3TOBA 3L2RA 1P92A 3RZDJ 2A68F 2JJ7A 4JX5A 3MZHA 1PP7U 5CVJA 5E3OA 1N77A 4MTDA 2D2WA 1MNDA 2ADUA 1KGSA 1Y8RB 2DMNA 1F43A 1UZCA 1BI1A 4F91B 3OYAA 3TEDA 4A3MJ 2HQ5A 2FSWA 3N97A 2KP6A 1B6AA 1Z9CA 5HS8A 1IRZA 3FBNB 1WRJA 2E19A 3K4MA 2TDXA 3A0HC 1HOMA 4XMYA 4B4CA 1SVMA 1GHCA 2EZLA 2DDAA 1P4XA 2LKSA 1DQUA 3DU5A 3O8HA 2M34A 1YW9A 5IT9Z 3VSLA 5LBQA 5ILUA 1LE8A 4XONA 1YYVA 4BEHB 2LH9A 4CCLA 2Y9ZA 3DTIA 1QHHD 3TP3A 2XSJC 2O0YA 3GVAA 2CV1A 3NQOA 1F9NA 4MLOA 2STTA 3ZMUA 3QPTA 2OCEA 1I6HJ 3F8CA 4RA2A 2DOFA 1U6GA 5ED4A 4O6JA 4PDKA 4ZYDA 4AYBN 2L01A 1G3YA 1WGXA 2RREA 3EUHC 3KYLA 1E2XA 1ETOA 1OMIA 3OOPA 2DMUA 4AVZA 4CGZA 4BJ5C 1MBFA 1QZYA 3T5XA 3PUFA 3OYHA 1BW6A 2E5ZA 4PJJA 5H2FC 1OCPA 4FE7A 2V9KA 4A3FJ 3AG1H 3CO6C 1FT9A 1I6XA 1ETWA 2R7TA 1ODDA 5HS7A 1IXRC 4GRIA 3SXYA 2HVQA 3VYTB 4A93J 5TRDA 3J80Z 3JRDA 2BY1A 3WU0A 5BQTA 4A3BJ 5L3GA 4CO8A 5E79C 5KCMA 2X1EA 3WTWC 4HQEA 3KETA 1SVLA 3IH3A 3SQNA 3G1LA 3I4NJ 2HDCA 3D5LA 3A03A 1D8JA 4UHTA 1TQMA 1UELB 3QP6A 5KAIC 3IUOA 4BY1J 1WJAA 4OOIA 1U9NA 3W2AA 1R23A 1I27A 5FLXZ 1YS7A 1YRNB 1VQMI 2Z99A 1ZG3A 2GLOA 2M8EA 3S16J 5C3EJ 4FCYA 5F0HA 4QTRA 1G2HA 1Z6RA 1MMAA 2WA0A 4RB3C 1JT0A 2M9HA 1K79A 2FOWA 1BJAA 2E7WA 3LA3A 1JKOC 2KJBA 1X2MA 2H6CA 3HDDA 1MBHA 4UUTA 4YFNF 2ZBKA 3S1NJ 4M9XA 3EUHA 2MABA 2IS6A 1S8NA 2EK5A 5AIPA 4AM3A 1X1CA 3C3WA 2LBFA 3WTZA 4ENJA 2E1OA 4A3DJ 5ICGA 1F36A 4HEA2 1SC7A 3FXMA 4IEJA 2E1NA 1IDYA 1T33A 5J8CA 4KMFA 4M71A 5D5UB 5F6FA 2IS4A 1HA8A 3FKJA 1P9QC 4G9YA 4FE4A 4JP0A 1OCRH 2K9SA 3JRAA 2CUZA 2HVRA 1LEAA 1R1UA 2XVCA 1ZRFA 4IOAF 1X3UA 4QWQA 4XNFA 1SAUA 1I39A 4YG2F 3TDUC 1Y8QB 2CG4A 3PJRA 5DM7F 1YX5A 5FD6A 4HG2A 1ZK8A 4D5FA 3OL3A 2MD0A 4R79A 1TT0A 1O57A 2P6SA 2Y0SN 5ILVA 3SFZA 2FQ3A 3E7LA 5D6EA 2JA8J 4AIDA 1U78A 3DLAA 3GCMA 1IXSB 2NVUB 3ABUA 5D5XB 5LHIA 2YR2A 2ZXIA 2JVGA 3RQ4A 4ZYGA 4G8XA 1HSJA 3L7WA 1MSEC 5H6RA 3OS1A 1YJWI 5EG0A 4GO1A 4M9ZA 5EEGA 2Q8KA 1B9MA 3K70D 1XN7A 4MEYF 4UUVA 3TO7A 2V1DA 3J81Z 4CCOA 3CCLI 2FF4A 2M7AA 3OSGA 1I3QJ 1T6SA 2EJRA 1W7PD 4KDPA 2E2HJ 2MFZA 3H3ZA 3DQVC 2FXAA 1D0ZA 1RESA 4RB0A 2FMLA 5L3BA 1QQIA 4GDFA 3NWSA 3CQZJ 2VBWA 2R93J 2HYJA 5TGTA 4I0BA 1J2XA 2W00A 1JI8A 1G3TA 2RAEA 5FRMA 1BR1A 3WTTC 4MGRA 1RKTA 1FYKA 1EV7A 5DCFA 3KLOA 1VQ9I 1ZAOA 4RB1A 4IHSA 2JPCA 1WHUA 2IBDA 2RKHA 3OS2A 3MAJA 3JRHA 1A6IA 4DYQA 4XLNF 1QZZA 4Y17A 4EJWA 2F2EA 1J5YA 2MD5A 1U9OA 5LGUA 2RQQA 4MFEA 1UAAA 2HKOA 1VTNC 5D5WB 1ZGJA 4IHTA 5GAEJ 2VT2A 2EV6A 1R5ID 5JHUA 1OCTC 2K9MA 2X1CA 5C44J 2DTRA 2OTLI 3PL8A 3BTCA 2EV5A 2OZUA 1H89C 1XG1A 2L7ZA 2F5FA 1MMGA 4BH9A 2BBYA 2IVMA 4CCMA 3I59B 5E1WA 3HYIA 1UMQA 4MIMA 1XCBA 3CCUI 2DW4A 2K86A 2MW8A 3CTAA 5E8GA 2O9LA 5KHDA 2YX4A 5LLQA 4IVNA 1X4PA 1I1SA 4BE1A 1YOVB 2P7CB 2CFOA 2ZNZA 2F5CA 3K70C 1LVKA 5DUIA 3BJ6A 2ME6A 1T95A 3CCRI 4UNOA 4BHCA 4IO9F 2ME0A 1MD0A 3BT9A 3QYEA 1RPWA 1XSDA 2Z9OA 1YE9A 4IQJA 2LLKA 2I10A 2R7DA 2W48A 3ZN0A 5EDNA 2E5NA 3R0AA 2FOKA 4XRSG 5M3MJ 5KK1A 1H9TA 3JCUC 1T08B 1LFUP 2FQ4A 2QBYB 1FZPB 3HPHA 5KVRA 2CQQA 2K5CA 3TP0A 5L3FA 4WWCA 1HC8A 2CGPA 1HXDA 2EA2A 4YIIA 2Q2EA 2ZFWA 3MKLA 3S2WA 3KIOA 3TOAA 3GTOJ 4XLPF 2P0WA 1GLNA 2XF5A 2LD5A 1BC8C 3K4BA 3SFIA 1A36A 2XB5A 1SD5A 1YI2I 2F5DA 2X6YA 4UVCA 2EH3A 2RGVA 2O6GE 2Y31A 1HLVA 2H94A 4M3EA 1G4DA 1H9GA 1BOAA 5E1ZB 2GWRA 1MBJA 1BJZA 3MFKA 1FOWA 1MH4A 1XMAA 4KJZA 3JRFA 1RR8C 1IO2A 2V9PA 5CVRA 2NVTJ 1ZTRA 1J9IA 3BOQA 3W3CA 3VWBA 3E6BA 3FZVA 4M3DA 5FRNA 3DU6A 4OIPF 2WB1A 1YFHA 3LWFA 1YITI 3H9JA 3I9V2 1HF0A 3PM1A 4AUXA 4A6DA 3K4NA 3EETA 1OYYA 2F6CA 3SHFA 3BLYA 2G9WA 4GCVA 2K4JA 1W7PA 1IUFA 2OC6A 1B72B 1X3ZB 3S32A 3WHCA 4C3JJ 2E1MB 3I58A 3GX4X 2ZJQF 4FISA 4E7HA 3ZQLA 2X9DA 1ZGWA 2M0MA 4KIBA 3DFGA 5DDGA 2XAUA 4J01A 4KFCA 5J1YA 2HU9A 2BVLA 5LGTA 2MC4A 2GA2A 1Y1WJ 1Z7UA 2GOXB 3CDLA 2G7UA 1B4AA 5E3NA 1QHGA 2KKOA 1N78A 5HLIA 4F55A 1APLC 4A3EJ 4XL9A 1ZREA 5B66C 3COAC 3HHGA 1JKPC 2OA4A 5M3FJ 2VBYA 2I5UA 1ZG5A 3FDYA 2EV0A 1OFCX 1QZEA 1T2KA 1TZLA 1V54H 4IRGA 1UJ8A 4I09A 2KDOA 3R6SA 2HQRA 3ZMSA 3LQRA 5JVTA 3HG9A 1BA5A 2BYVE 2ZJ2A 1R9TJ 2DYRH 1JT6A 4XKWA 3K10A 2MGQA 1FC3A 4JOMA 2LY1A 3BZ6A 2OAZA 3CMEI 1WJBA 2R7UA 1XMKA 1BR4A 4RAGA 3ABKH 1C0WA 2W25A 3E6DA 2XPUA 4XKVA 4KNYA 3L1PA 4FQGA 2DA5A 2WAFA 2CQXA 2R7ZJ 2GBYA 2LG4A 1ZR2A 2KISA 3R60A 1R5HA 4PFOA 2CV0A 4XLHA 2KZVA 4L0ZB 3IRRA 3U1DA 4Q4ZF 3F0CA 2XHKA 3D5RC 3GTMJ 1O4XA 2UXXA 2KRHA 2LFBA 5L3EA 2DT7B 2VQGA 3Q5FA 1FBUA 2VC1A 1U8RA 2DMPA 4HPQA 5HOOA 1ZH5A 4JK1X 4H0EA 4AU7A 4D1QA 4BQQA 3CCMI 1U0JA 4I02A 2EFPA 1R1TA 5HNFA 4XN3A 4KIGA 4HSRA 4BKXA 4LG0B 4ZJZA 3A4CA 3HKZN 1FP2A 1BI3A 5HS9A 1HW5A 1FIAA 3CCJI 4N4OB 2BZTA 2QCOA 2JA6J 2EINH 2VQCA 3M8JA 3JAMK 2DXIA 1X1PA 3TO6A 1VQ4I 4NQWB 1Z67A 1WPKA 3BR5A 4JX4A 1ACIA 4E70A 2M7BA 1F1ZA 2LYCA 2Q0OA 1EH8A 2L4AA 4BQNA 4ZYHA 2XASA 2BY0A 3DP7A 3PO3J 4NB5A 1KZHA 4QLCU 3LL7A 4KITB 4HLYA 5DCMA 1RZ4A 3AKZA 1MJAA 3REOA 3PQJA 2DOAA 5B1BH 1JUSA 3RKXA 5LGNA 1K6OA 1SD6A 1TNSA 5IT9K 5LEJA 3HSRA 5JI6A 1NG6A 2KRCA 3KCCA 3O3KA 4RM3A 1K6YA 3JRCA 3E5QA 1IRFA 1BIAA 2IA1A 4C2TA 1CF7B 2M1BA 2AHQA 2COMA 1LQ1A 1XD7A 3J7YJ 1FMVA 1GXPA 4PJMA 1OQYA 2FU4A 2B0LA 1XSXA 3HXLA 5EGOA 1BC7C 4B43A 2DA2A 1MKMA 2XF6A 3U9GA 5IP7J 2IXSA 1QU3A 4N4NB 1YIOA 4EJTA 1B1BA 3E1SA 2CV2A 3KX2A 5LHHA 4M6VA 3VPRA 3NRVA 2ZC2A 2O3FA 1JJ8C 2X6WA 3P7NA 4PJNA 4RLFA 2Y0MA 2IGMA 9ANTA 4BEHA 4ESBA 1Y6IA 3J80K 1FYLA 4C30A 2LY9A 2R3SA 1V5GA 4BACA 2M30A 2PMHA 4HNUA 1HDPA 3CUQB 1Z0XA 3GW2A 1FIPA 5CVUA 2LREA 5BOXA 2QM3A 3F8FA 4X6AJ 2VB6A 5CLSA 1Z05A 3GMEA 2E36A 1FOYA 4E7IA 3K6GA 2EQRA 5KAFC 1X1AA 5J4VA 1LVAA 4R8HA 1YQAA 2CW8A 1ETKA 5FLXK 2D45A 3PQKA 2MA3A 2VLAA 3A1YA 5HVQC 4HX4A 3ML6A 3CD6I 2QZ8A 2XRLA 2V6EA 1R58A 1B59A 2WAQN 2LC2A 1JXSA 4BS9A 1MDMA 3BPVA 3A0BC 3GUDA 4E7JA 1YW7A 2K7LA 2JSCA 4PSXA 2VBZA 1A35A 4Q47A 4EJVA 5JLWA 3R0JA 3IWZA 1MIJA 1BIBA 5F08A 4WCGA 1ZG1A 3K1MA 2NS0A 2ZJRF 1Y0UA 2F4OB 1MJ9A 2Z5UA 4MQ9F 3ULQB 3FK6A 4DYCA 1TLHB 4D7NA 2VKVA 3K1NA 1R00A 2FMYA 3GFMA 3CC4I 3P9IA 1JKRC 3SZPA 3CDHA 4X1EA 4OIQF 1FJLA 3W2VA 3E6CC 2OPTA 2HVSA 3B6AA 1KQ8A 1HKQA 1KYWA 1OJLA 1R4NB 4NBQA 2JA5J 1Y0NA 5HNHA 2EWNA 2ETHA 5K5OA 1CQTA 4YFKF 4B47A 4U7DA 2VOPA 2L2OA 3JSOA 4BGDA 3C7JA 2J5OA 5IOZA 1U3EM 4G6TB 3KYDB 4E6KG 4LGWA 3GLLA 3B73A 1P4AA 4ZTJA 3Q9SA 3CCSI 4KICA 4LOCA 4P9FA 4U87A 4ESFA 5JR3A 1VQOI 4A3LJ 1JGSA 4XKCA 3TW6A 1R49A 4DQ2A 3DTKA 3IWFA 4M74A 3UR3C 4B09A 2DODA 2EIKH 3WGGA 3LAJA 2ELJA 2GXBA 3HOYJ 2JTVA 3HSFA 3J81K 5FD5A 3FWEA 4A2UA 3JAMZ 1IDZA 2KRFA 1NG7A 1B8IA 2Y9YA 3FM3A 2K4BA 2FUG2 5GAGJ 4Q5SF 4CSWA 2E2IJ 4ENKA 3AAFA 2FEZA 1RKWA 1SD7A 3HRTA 2L9RA 1LDKB 4CCJA 3MVPA 4EJUA 4L9TA 4PFPA 3SZGA 2R7OA 3TKYA 5FB2A 4WF2A 2XC7A 4BE0A 1WJ5A 2P4WA 4F93B 4D5CA 1IUYA 2OTJI 2M4KA 1QPMA 4BJTA 2HOEA 5LRSA 4OU0A 3GYHX 1FTZA 1IV8A 3MKZA 4HSTA 5GTHC 2ECBA 1Z77A 1ON1A 1JGGA 3FIWA 2L7KA 2ZXWH 1JHFA 4UVAA 4DJAA 2DT5A 2PQ8A 3Q9VA 1T8IA 2LF7A 5F64A 2NNNA 3PNTA 1O3QA 3BR6A 3HRSA 4XLAA 3ZN1A 1X19A 3VB2A 2KIUA 1LDJA 1R22A 2VPLA 4HDVA 1ULYA 3E97A 3W6JB 4E7LA 3HPGA 1RR7A 3CJQB 4XORA 3W6KB 4A3GJ 4QPQA 3MKWB 1I1GA 4RGRA 3CMAI 1D0YA 3G2BA 5LHGA 2VBXA 5HDNA 2IAIA 2BHYA 2FA5A 3I0TA 2XDVA 5IOYA 5M5XJ 3V7CA 1RUNA 2R4GA 4G6DA 1K61A 2EB7A 2H27A 1ZQ3P 1KU2A 3HEFA 3WGIA 1AA7A 2HQAA 1TBXA 2LMDA 1VQLI 1XSVA 4ZYAA 2DK8A 1JKQC 2Y69H 3F23A 2M5WA 4C2UA 1K78B 3VOEA 3JR9A 1VQNI 5CVIA 3L2VA 3BQZA 1JHHA 4PGGA 4EMSA 1IN8A 2Y30A 3V42A 2L7MP 3L2CA 2VE8A 3ERED 4B8XA 2NNYA 4NC6A 2VE9A 1JJ6C 1JE8A 5J3LA 2ELHA 4RGXA 2P5LC 4C9YA 2A6EF 3HGGA 2L3DA 1J09A 2LOOA 1HCRA 2IPQX 3CCQI 1Y56A 3Q0WA 4NNJA 4G7OF 3F6OA 3BCBA 1W1WE 3M7GA 3PSIA 5GPCA 4J00A 2NVXJ 3ERMA 3ELKA 3G6EI 2R7QA 2DAOA 2GIZA 2VKEA 3HOSA 4CCNA 3EUKL 2NXNB 2QF7A 2XROA 3ZQIA 1FOXA 2JQ7A 4F92B 2DMQA 2DA1A 3LSHA 3DBLB 3H9GA 3FBIB 3L00A 2WTEA 4XK4A 5EEHA 1EA3A 2XF7A 5CKTA 4IZZA 3FF5A 4OAZA 2IW5A 1E0EA 4L5JA 3RCOA 1SEUA 2E1MC 3S3OA 2ZJPF 1KU7A 1FSHA 3BCAA 2A5YB 3ABLH 1QNTA 3LSMA 2FBIA 3I64A 3GTKJ 3H1CA 3HJEA 1O3SA 2B9SA 2QBYA 2IS2A 2E34A 2PX9A 1TWFJ 2VJIA 5F04A 4W1UA 4HLXA 4IQ4A 3OIQA 1IXCA 3VDXA 3OYIA 4WX9A 5CJ9A 2CQNA 2OJED 1I5ZA 2QGUA 3U1KA 3O8GA 1TL8A 1LEBA 4WXHA 1SFEA 1OCZH 3BY6A 4O5VA 1DU0A 4DNCA 2VODA 3OYBA 1O7FA 3HGYA 3CCVI 4B3AA 2MC3A 3WHBA 2RC4A 3BP8A 3BWGA 2PJPA 4A3CJ 1ERDA 3QOEA 3GFIA 4RGSA 3I3LA 3F6VA 3C2GA 1P7IA 3HRMA 1S29A 2G0EA 3K1PA 4AD9A 1D8KA 1DPRA 3MZ8A 2IGNA 3M8EA 1VQKI 4CZZA 3OYEA 4HRIA 5FKMA 1O3TA 3C1DA 2YPRA 5D8KB 3LNQA 1A04A 3IV5A 1TNTA 3CF2A 5K7ZA 1OISA 3D5SC 2XAQA 3HRUA 4P55A 5GADJ 1EF4A 2COBA 2EIJH 3DLLF 2DLLA 3E3VA 5TJJA 4C3HJ 1PP8F 1MMSA 4U7BA 4KN4X 1BI0A 1K4SA 2D1HA 1PUEE 2RNJA 2MH9A 1E3PA 2IJLA 2HXOA 2PEXA 4DIQA 1EH6A 1LNWA 3V8LA 3F22A 1WJFA 3EPZA 3OYLA 3K7AJ 2DA7A 3LQQA 2ESHA 3ABMH 2VIXA 3L2WA 2DO7A 3PNVA 3EDPA 1VZ0A 5GPAA 1TP4A 3FHZA 5HDKA 3ASOH 2HZTA 2R5YB 3J7AY 2AS5F 3LSRA 4FT8A 3ZCOA 3R61A 4BQOA 4F7ZA 3RQIA 2A69F 2Z3YA 3ZP5A 1IZ1A 2DDBA 4MHGA 2JA2A 1IN6A 1S7EA 4EQQA 2LNBA 2X0LA 5AIQA 4HYEA 2K27A 4IOCF 4A0XA 4II2A 2VT3A 4L5EA 3DBRB 2B7EA 4BNCA 5DTDA 1SD4A 2FRHA 3GTJJ 5D8LB 4BJ6C 4ASNA 4ZH4F 3F8NA 3AG2H 3RZOJ 4CDGA 1FTTA 2ACJA 1ON2A 2BV6A 2W85A 2WBMA 5J4YA 2KLOA 1IN7A 1EJ9A 3WE3A 1Y39A 1AKHA 2R0QC 4M73A 1EKEA 4EATA 4A3IJ 3MCZA 4KN7X 1J59A 4HF2A 1YTYA 1TW2A 3HB9A 3FXJA 1WKMA 3H35A 3G73A 2QQ8A 5EJCA 2M87A 3HOXJ 5ERIA 1GDTA 1V3FA 1X1DA 2C6YA 2L7FP 4L9JA 2VJ5A 3X2QH 1KU9A 4LB5A 1WJEA 1OCCH 2LKPA 3CJRB 2RQPA 2WB1N 3EUAA 3KPHA 4LK0F 2V9VA 3AL0C 2M3AA 1DDNA 2DMTA 1RETA 3DF8A 3RJPA 4F52A 4BDZA 3ZQQA 4XM3A 3CO7C 1X58A 3BPXA 5J1RA 5E3MA 3IL2A 2V6CA 4DOZA 2A05A 2P5VA 2STWA 4EV0A 1V55H 1HQCA 1X4OA 2LSOA 3H0GJ 2DPDA 1N25A 3RYRA 4HOBA 4CYCA 3ZMVA 1ZLJA 3H9QA 4LG0A 3H36A 1WI3A 2EZHA 3WU1B 4FETA 3C18A 3F9KA 5FKOA 4YIFA 3PFYA 1PUFA 3HHHA 5DD4A 1S3JA 3T8RA 2FNAA 1TWHJ 1QGPA 5B1AH 3PSFA 3FM5A 2HOSA 1YJNI 1XC5A 4MFDA 4MEXF 4DZJA 1ZRDA 3GWZA 3T0YA 5GAHJ 1XGOA 2GM4A 2H1KA 1K83J 4BU2A 4K2EA 2OQGA 3WTYC 3DEWA 5EG0B 1MSFC 1M1EB 3OMYA 2VONA 2UXNA 1SMYF 2IGKA 2WY7Q 2K9QA 4N9HA 2W1OA 3S1QJ 4IHWA 2K9NA 3U2RA 1MJBA 3QYBA 3EYIA 2OCCH 4XQFA 1CF7A 1W36C 2HYGD 3N4MA 1GXQA 1HBXG 1BL0A 1KYZA 2L9SA 2VQLA 5K7FA 2GZWA 3MMYB 2EZKA 4ZDOA 3BZKA 3M8FA 2IA2A 3SDGA 1YLFA 4N0BA 4Y4RA 1BR2A 3CJTB 2CYYA 2PMZA 2JPBA 1Z21A 2XPVA 2V7FA 4S0HB 1P6RA 4LFUA 1J0RA 4GGGA 1VQ7I 1MNMC 3DPTA 1UG0A 3LA2A 4RAZA 5IP6A 3CUOA 4CICA 1XX5A 3OIOA 5IY5H 1FSEA 3KP6A 2JSPA 5BNGA 2P6TA 3QWLA 2VC0A 2RDPA 5FGMA 1ZKGA 2NVQJ 3Q0UA 2DYSH 4HV5A 3VFZA 5B5EC 1HDDC 2N8GA 2XGDA 3RYPA 2YU3A 4YEJA 3ROUA 5GP9A 3DPLC 3KP4A 4XIDA 4XSXF 3IKVA 2PJRB 3GXOA 1E3HA 4YFXF 3GEZA 4ENMA 3RPUD 1JTYA 2XV4S 2KL4A 4XN0A 2DA3A 2X6XA 2Y75A 5FJ8J 4C2MJ 1T98A 5E1XA 2GXAA 2HDWA 2GOMA 1NH3A 5FFXA 2EFQA 3CMMA 5K5QA 2A07F 1L3LA 2JWTA 3MN2A 1XPXA 1Q1HA 1LFBA 2BW3B 3GFJA 3M1EA 4W97A 5E18F 2O8XA 3DV8A 3KZZA 3HL2A 2DPUA 2QA4I 2HGCA 2KMUA 4AC0A 1MBGA 2R5ZB 1POGA 1D0XA 2H6BA 4HW0A 4LMYA 3QP5A 2TRTA 1L0OC 3BG5A 3RPQA 3H0DA 3J7AO 1T56A 1Z91A 3VODA 4A69C 5K5RA 3SYTA 4O3MA 2DA6A 3TDZC 1ZLKA 1B9NA 2EFNA 3BR3A 1U5TB 4KIFA 5BPDA 2HDDA 3HOZJ 2VKHA 1ONVA 4FTHA 2WC2A 5F1JA 3GZNB 4XOTA 3LSPA 5IT3A 1EH7A 4JYKA 1TWGJ 2L0KA 1H88C 3VEPA 5K1YA 1TQIA 3H3VK 1W5CC 4JX6A 1Z1DA 1S7OA 4G6QA 2QKMB 2ICWG 2LY2A 1F5TA 1X3WB 2FJ1A 3OL4A 2V26A 3S2HJ 2DFFA 1JTXA 3L9FA 3HIFA 2VUMJ 2DFHA 3HOVJ 3HOUJ 3HM5A 2FX0A 3GO5A 1LFPA 2VL8A 2XAGA 4HA8A 5ICCA 4BE2A 1S5LC 3BG9A 1OLTA 4XKBA 3F21A 2AQEA 2WAEA 1W5SA 2QWWA 3T8TA 3JTGA 4Y15A 3BJAA 2NOJB 4IRHA 5J6XA 2IA0A 3FKIJ 3KP3A 1RC9A 4DW6A 4P1WA 4CH7A 3E5UA 3KZYA 5CVVA 2A61A 5IPAA 4B1RA 3G4SI 3GTGJ 5F0FA 5FLMJ 1J7KA 2CWEA 3CMYA 2L9VA 3LA7A 2V1XA 3LSJA 1R71A 5M5YJ 1G3WA 1IJWC 2HOTA 2HEOA 3RTRA 4RAFA 4XICA 3DWLE 4BY7J 1SFOJ 3QAHA 2PMUA 4XR6A 2FBKA 1P2FA 4KT6A 3KEQA 3OYJA 1O7LA 1GUUA 3BG7A 3FXQA 3H92A 1ZELA 4OIRF 3SEQA 1VQPI 1NK2P 2VJ4A 2K02A 3BG6A 1OR7C
chains in the Genus database with same CATH topology
1YX3A 2XDVA 2A6TA 4YELA 2R4GA 3DEEA 2RQQA 1UAAA 3A2KA 3U21A 3UNGC 2RNGA 1S9HA 1AA7A 2HQAA 4ZYAA 2K9MA 2X1CA 4C2UA 1V5EA 3OWTA 2UWMA 3S8PA 2CMPA 3NWTA 3PL8A 3L2VA 1SFKA 3K4KA 5CPRB 3ZR8X 2JUGA 1DGWY 3V42A 3LFUA 3LSIA 1MMGA 4CCMA 4C9YA 4CCKA 1J09A 2LOOA 4BL0B 5KHDA 1Y56A 4NNJA 4PUSA 3FHNA 3BCBA 3PSIA 1D1BA 1X4PA 3CP8A 4HNTA 4J00A 3DKXA 5LD2C 4BE1A 1X1BA 4E7KA 3S3MA 2CFOA 3K70C 1MMNA 1LVKA 3MKYB 2KPMA 2R7QA 1T95A 2X51A 1T0FC 4RM2A 2KQRA 3HOSA 4XOPA 4CCNA 3EUKL 3QYEA 2LRDA 1YE9A 2MYSA 4IQJA 2E5NA 3K4JA 4F92B 3TL4X 3IAM2 3LSHA 3H9GA 2Q2EB 3FBIB 3TBIA 4ITVA 1EA3A 2XF7A 5CKTA 4IZZA 4E7SA 2OV7A 3HPHA 2HPIA 4H4KC 4OAZA 1E0EA 3RCOA 1N75A 2E1MC 2K5CA 3VYSB 4B3XA 3S3OA 3BCAA 2DJIA 4D9JA 2L9NA 3LSMA 4QPOA 4KISA 3H5AA 2VXDA 2P0WA 2IS2A 3E0JB 1GLNA 4F3QA 2VJIA 2XF5A 4IQ4A 3K4BA 3OIQA 3VDXA 3GBGA 3OYCA 3OYIA 2HZDA 2R7WA 2X6YA 5HLTA 2Z16A 1WFXA 3OYBA 3DTEA 3MD2A 4KJZA 4LIUA 4B44A 1ERDA 3QOEA 3I3LA 3C2GA 3OR2C 4Y3OA 3W3CA 3VWBA 5FRNA 3DU6A 3OYGA 2IGNA 2WB1A 4ZC3A 4HRIA 3I9V2 3OYEA 3BC8A 3K4NA 4RLQA 2I8DA 2DT6A 3AL0B 2F6CA 1DGRM 3BLYA 2OC6A 3S32A 3CF2A 2E1MB 3HKZA 4CA0A 2Z1DA 3L2UA 3D5SC 1KONA 4E7HA 3OS0A 2M0MA 3SDBA 4J01A 2XAUA 4DGWB 3H5NA 3S93A 2HU9A 2BVLA 2K3PA 4U7BA 5KNLA 2IGOA 1MNEA 2UV1A 2MC4A 2GOXB 3C2HA 1QHGA 4DIQA 2ZSIB 1N78A 4F55A 3ONQA 2M4GA 4XL9A 2A5WA 4OAYA 1WJFA 3EPZA 3OYNA 2HPMA 3OYLA 1LKXA 3L2WA 3FDYA 2VIXA 3PNVA 5LFAA 3M1CA 1VZ0A 1TZLA 4II3A 1D1AA 3J7AY 2KDOA 3RSNA 3HUGB 2CH0A 4E7ZA 3ZCOA 3HG9A 4BQOA 4ZDPA 4XKWA 2JA2A 3K10A 2CUJA 4JOMA 2LY1A 4PJLA 1WJBA 3AFHA 4ZDLA 2R7UA 4II2A 3CESA 3CP2A 1BR4A 3DKYA 4BDYA 3VSKA 3L2QA 2WADA 4XKVA 4BJ6C 3OY9A 2WAFA 5CQGA 2ZXHA 2LG4A 4YRVA 2O5RA 3H5RA 3ZRGA 4PSWA 3PNYA 4PFOA 2CV0A 2WBMA 4XLHA 2KLOA 2KZVA 4IX7A 4AYBA 1FMWA 4EATA 3D5RC 1WJCA 3VYUB 3QODA 2KRHA 3HC7A 3H35A 2DT7B 2VQGA 4HPQA 4NC7A 5HOOA 2DCEA 1X1DA 4AU7A 2UUZA 2VJ5A 3HOTA 4DBQA 4D1QA 4XLCA 1WJEA 2E60A 4BQQA 3CJRB 3EUAA 3OOUA 3AL0C 2M3AA 4NC8A 1U0JA 2WY8Q 2OUMA 3K4CA 5HNFA 4F52A 4BDZA 3LMMA 4XN3A 3ZQQA 4ZTFA 1DP3A 4XM3A 2BVMA 4HSRA 1G59A 4ZJZA 3A4CA 4DOZA 2WAQA 4N4OB 2L5QA 3QYFA 2Q1ZB 1X4OA 2VQCA 3M8JA 2DXIA 2R7VA 3OYMA 3LSGA 3H9QA 4NQWB 4RMNA 3OYDA 2X85A 3OYKA 2AQFA 2M7BA 2LYCA 4FETA 3F9KA 3PFYA 4BQNA 3CZ6A 4KITB 3PSFA 3LL7A 2CW7A 1D1CA 3AKZA 1IRXA 2VJJA 3L2RA 2DOAA 2R7RA 1N77A 1MNDA 1Z3YA 2IS1A 3OYAA 4F91B 4BU2A 1NG6A 2KRCA 4RM3A 2KP6A 1K6YA 3OMYA 4C2TA 3FBNB 3K4MA 1FMVA 4PJMA 3OIPA 4XMYA 3HXLA 2IGKA 2WY7Q 2W1OA 2KHMA 4B43A 2BOLA 1Z7LA 2XF6A 1DQUA 3DU5A 3QYBA 3IP4B 2IXSA 1QU3A 4XQFA 4N4NB 3TMOA 3VSLA 1W36C 4XONA 4BEHB 2L9SA 2VQLA 3E1SA 3VYRB 3ZGKA 2LH9A 4CCLA 3KX2A 3DTIA 3MMYB 2CV2A 4ZDOA 2V4JC 1QHHD 2CS3A 3K4LA 2XSJC 2CV1A 4Y4RA 1BR2A 4MLOA 2X6WA 4PJNA 2PMZA 4RLFA 2IGMA 1Z21A 2V7FA 4BEHA 4P5OA 1Y6IA 3PUBA 2RREA 4C30A 3EUHC 1V5GA 4BACA 3KYLA 2VASA 1UG0A 3DPTA 4HNUA 3W2WA 4AVZA 1V5FA 2LREA 2Y0SA 4BJ5C 3OYHA 2R7XA 2E5ZA 1WJDA 4PJJA 4BUPA 2VB6A 2V9KA 4E7IA 3OYFA 2JSPA 1BOBA 3K6GA 4LG3A 4NUBA 1X1AA 2R7TA 4E4HA 2CW8A 4DBRA 3KEYA 4GRIA 2HVQA 3VYTB 2W82A 2VLAA 2VXZA 3A1YA 5HVQC 4YEJA 2X1DA 1MMDA 5KCMA 2X1EA 3DPLC 2V6EA 2LC2A 4BS9A 3S3NA 2PJRB 4E7JA 3N05A 3D5LA 4PSXA 1W36D 1UELB 3IUOA 4OWRB 1WJAA 3W2AA 3RPUD 3ZXSA 2PJRA 2KL4A 4XN0A 2ZSHB 1Z3XA 2X6XA 4CZCA 4IKFA 2WA0A 1MMAA 2HDWA 2GOMA 2F5VA 3CMMA 1R6RA 2LBFB 4PK4A 4Y33A 1PYVA 2W7NA 2BW3B 2MABA 4BXFA 2IS6A 3W2VA 3HL2A 2HVSA 3SEZA 2W4SA 2KMUA 3DPUA 1X1CA 1D0XA 5HNHA 2LBFA 3H0DA 4HEA2 4B47A 2L2OA 2BW3A 4BGDA 3SYTA 2IS4A 1HA8A 3FKJA 1P9QC 4G6TB 4LITA 4E6KG 2CUZA 2JVHA 4LIVA 2HVRA 2VKHA 4ZTJA 5JHFA 4U87A 5CQEA 4XNFA 1SAUA 4XKCA 4XOTA 1MW7A 3PJRA 1YX5A 3DTKA 3UR3C 3LSKA 4HG2A 2ELJA 3OL3A 2MD0A 4R79A 1TT0A 4B48A 2QKMB 2LY2A 3OL4A 2V26A 1NG7A 2FUG2 2K9LA 2V1NA 3DLAA 4CSWA 4X0GA 4CUGA 2ZXIA 1LFPA 2JVGA 2VL8A 3RQ4A 1PJRA 4BE2A 1LDKB 3OR1C 4CCJA 1OLTA 4XKBA 5FROA 4ANJA 3OS1A 2AQEA 4PFPA 3SZGA 2Z2SB 2R7OA 2WAEA 2XC7A 4BE0A 3K70D 1WJ5A 4F93B 2NOJB 2M4KA 4CCOA 4BJTA 2M7AA 2QKLB 4P1WA 4CH7A 3MKZA 2MFZA 4HSTA 3DQVC 3IAS2 1D0ZA 2R7SA 2VQHA 2L7KA 4DJAA 3NWSA 5TGTA 3PNTA 1G8XA 4JQFA 2W00A 4XLAA 1X19A 1JI8A 3RTRA 5FRMA 1BR1A 2VPLA 2VKDA 2ZFUA 3DWLE 2HNHA 4E7LA 3HPGA 3CJQB 4XORA 4XR6A 4KT6A 4QPQA 4XLFA 3MKWB 3OS2A 3OYJA 1D0YA 3G2BA 3BG7A 1ZELA 3SEQA 4XLEA 2F4IA 4FASD 2VJ4A 3H9JA 3BG6A 1OR7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEH B;  4BEH A;  2W1O A;  2LBF A;  3A1Y A;  2LBF B; 
#chains in the Genus database with same CATH topology
 2BE5 F;  1KA8 A;  3LFK A;  3HBL A;  1YO5 C;  2E7X A;  4KMU X;  4U0Y A;  4Y52 J;  2A6T A;  4YEL A;  1DUX C;  3DEE A;  4Y13 A;  3ZQC A;  3ZOB A;  3U21 A;  2RNG A;  1S9H A;  4HQM A;  4A5N A;  1MZB A;  3CLO A;  4EM1 A;  1Y1V J;  5B3S H;  3PFI A;  2KJC A;  1V5E A;  3BQY A;  3OWT A;  4M3F A;  2CMP A;  3NWT A;  1FOK A;  1SFK A;  3K4K A;  2QQA A;  3NAR A;  4EGY A;  2W24 A;  1PVE A;  5CPR B;  5DEQ A;  2M8G X;  3ZR8 X;  2CJJ A;  4OMZ A;  1DGW Y;  2HS5 A;  2YX7 A;  2EPF A;  3RPU A;  1S6L A;  2V79 A;  1K78 A;  3TO9 A;  4CCK A;  3BRO A;  1YRN A;  3CF5 F;  4I01 A;  2QEX I;  4BL0 B;  4BBS J;  2P7V B;  3K2Z A;  4PUS A;  3FHN A;  2Z33 A;  4G7Z F;  3W6V A;  2OF7 A;  3K2A A;  1VF9 A;  4HNT A;  3DKX A;  1SAX A;  3P5J A;  5LD2 C;  3HTS B;  1X1B A;  1MMN A;  3MKY B;  1ZHF A;  2KPM A;  1UST A;  3M9A A;  2OBP A;  1WSU A;  2X51 A;  3S14 J;  2P5K A;  3ASN H;  4RM2 A;  4V19 K;  3BJO A;  3GFL A;  3SJM A;  1VQ8 I;  2H8R A;  2MYS A;  2PG4 A;  5EF6 A;  1R36 A;  1RIO H;  3K4J A;  2YUS A;  2EBI A;  2QUF A;  5H20 A;  2PBI A;  3C2B A;  3I55 I;  3IAM 2;  5L3C A;  2K3F A;  3G1O A;  3QPH A;  1OR7 A;  2K85 A;  2EFO A;  4E7S A;  4P9U A;  2JK3 A;  2HPI A;  4H4K C;  3RI4 A;  3RDI A;  2BGC A;  4XSZ F;  1YIJ I;  2DOE A;  4B3X A;  2QVO A;  3TQN A;  3FXL A;  1UCR A;  4HDU A;  3I4M J;  4HF0 A;  3T1B A;  4KIS A;  3H5A A;  5D5V B;  2VXD A;  2H09 A;  4LLG F;  3ZQF A;  4AIJ A;  1VFC A;  3BR0 A;  5DCM B;  5J40 A;  1BBY A;  4S05 A;  3K0L A;  2HZD A;  3OYC A;  1LUJ B;  4LD5 A;  4M6X A;  3GLX A;  5TIS C;  3MD2 A;  5H6Q A;  2GIV A;  4L0Y B;  3QPL A;  2JT1 A;  2XUB A;  2L4M A;  3KZI C;  1FY7 A;  2JRM A;  4HBL A;  4M3G A;  3OR2 C;  3V7S A;  5EGO B;  1H8A C;  2HTS A;  2MSY A;  4CHU A;  4NDL A;  1J75 A;  3OYG A;  4ZC3 A;  2AXL A;  3V8K A;  1ZRC A;  3IC7 A;  3BC8 A;  3MWM A;  4G7H F;  3V4G A;  4RLQ A;  2I8D A;  2DT6 A;  2RV8 A;  3KE2 A;  4WK8 F;  1QA6 A;  2XIG A;  3ZQ7 A;  4UV9 A;  3M07 A;  1U8B A;  1FWZ A;  4IHX A;  1O3R A;  2Z1D A;  3L2U A;  2P81 A;  3WTU C;  2JMW A;  3WU2 C;  1KON A;  2DFI A;  4LLL A;  3ZMD A;  1QVT A;  2DFE A;  3MQ0 A;  1F4K A;  3H5N A;  2XAF A;  3KFW X;  3SZT A;  5EZG A;  3ISP A;  4ZZL A;  3FX3 A;  5KNL A;  2IGO A;  3M4O J;  1MNE A;  1YG2 A;  6PAX A;  4IF4 A;  4UUS B;  2KT0 A;  2E1C A;  1PDN C;  4U0W A;  4IXA A;  3C2H A;  5F0C A;  5JVG F;  3ONQ A;  4BHP A;  2M4G A;  2MG4 A;  2A5W A;  4C3I J;  2HPM A;  3OYN A;  3EQL F;  4I99 C;  1XGS A;  3ZQH A;  3DCF A;  3R4K A;  4LB6 B;  3M1C A;  5LFA A;  2CFX A;  2DI3 A;  1OYW A;  2DBB A;  1JUP A;  2QSF X;  3HUG B;  3ZMZ A;  2CH0 A;  2L54 A;  3FIS A;  2ZCW A;  5ICE A;  3A01 B;  2XKP A;  1FYM A;  1WZ2 A;  1XGM A;  2WV1 A;  5FFZ A;  3WTS C;  4KYW A;  1IF1 A;  3WTX C;  2PN6 A;  3E6M A;  4ZDP A;  1GT0 C;  1MDM B;  2R5Y A;  1SAN A;  2CUJ A;  2HR3 A;  2O7O A;  1D5V A;  3Q3S A;  3ABT A;  2KFD A;  1E17 A;  3AFH A;  4M6Y A;  4ZDL A;  5EZH A;  1LB2 A;  2CUF A;  3CP2 A;  1S72 I;  1RI7 A;  3VSK A;  3L2Q A;  1WVR A;  2WAD A;  1ETX A;  3OY9 A;  3KLN A;  4ON0 A;  1U2W A;  1TWC J;  4V2G A;  5CQG A;  4IRI A;  4YRV A;  2O5R A;  4FHT A;  2UZK A;  2KIQ A;  3ZRG A;  4PSW A;  3PNY A;  4JBA A;  1YHQ I;  1STZ A;  2JRT A;  3NAU A;  3Q0V A;  2EFW A;  1QPI A;  3I59 A;  4AYB A;  1R4M B;  3JRE A;  4I7H A;  1TC3 C;  2VI6 A;  2DTZ A;  3QOD A;  4YIR X;  3HC7 A;  4OIO F;  2HXI A;  4PZJ A;  4IHY A;  1OYI A;  3K9T A;  2IEK A;  4NC7 A;  3FXR A;  4LJZ F;  1RRJ A;  2DCE A;  2OD5 A;  2Y48 A;  3KYC B;  1WH5 A;  2UUZ A;  2KIF A;  4IJA A;  2E60 A;  1Q1V A;  3IHU A;  2O61 A;  3OOU A;  1GV2 A;  4HAM A;  4NC8 A;  1K7A A;  3K4C A;  3B02 A;  1IN4 A;  2P8T A;  4ZTF A;  2D1V A;  5BS6 A;  2ZME B;  1YW8 A;  1R5G A;  1G59 A;  3KP2 A;  1IGN A;  3CJN A;  4MTE A;  3QOP A;  2AXT C;  2L5Q A;  3QYF A;  2HOA A;  2Q1Z B;  3J7Z I;  1MGT A;  1HW2 A;  3WGH A;  5JLX A;  4XRM A;  2F48 A;  3LAP A;  5J8F A;  2YS9 A;  4I0A A;  4IL6 C;  5D4R A;  5A2Q K;  1XMX A;  3OYM A;  4GXO A;  3LSG A;  2R7V A;  3OYD A;  3OYK A;  2X85 A;  3CLQ A;  3FXO A;  2NAZ A;  2CO5 A;  1BN5 A;  4CXF A;  3QQA A;  3I53 A;  1W4M A;  3E5X A;  1B8I B;  2CW7 A;  3DXJ F;  1D1C A;  3D1N I;  2R92 J;  1IRX A;  2DQL A;  2VJJ A;  5IP9 J;  4BXX J;  2R7R A;  1DPU A;  2LTP A;  1HST A;  1T38 A;  2XAH A;  3LST A;  3CDI A;  3WG9 A;  1Z3Y A;  2IS1 A;  2BEO A;  4HV6 A;  3MEX A;  1ETY A;  1OKR A;  2W57 A;  5J47 A;  4WXC A;  1JUM A;  2ID6 A;  4KA4 A;  2MBF A;  4M9S A;  1LE8 B;  1VI0 A;  3OIP A;  3D0S A;  4AWX B;  2LR8 A;  1SMT A;  2KHM A;  2BOL A;  1Z7L A;  2DK5 A;  3F8B A;  1BW5 A;  1AU7 A;  3IP4 B;  5CYV A;  4FX0 A;  3TMO A;  3A02 A;  1YS6 A;  2LP0 A;  4BQA A;  2OQR A;  1OPC A;  3G71 I;  1HKT A;  3VYR B;  3ZGK A;  1B72 A;  2NOG A;  4A3J J;  1DP7 P;  3AG3 H;  4GYG A;  1FX7 A;  2V4J C;  2CS3 A;  1VQ6 I;  3K4L A;  3BR1 A;  4UVB A;  4A6E A;  5D6F A;  5LRR A;  5E3L A;  3KEO A;  5FLV A;  4S04 A;  4BXU A;  3BG3 A;  5GTI C;  3PIO F;  4P5O A;  3PUB A;  1CGP A;  2DJN A;  3K69 A;  2QYO A;  2HTJ A;  3F8M A;  2VAS A;  2QSH X;  2F5E A;  3W2W A;  1HKS A;  1ZYR F;  3BZC A;  2LDU A;  3OV8 A;  1V5F A;  2Y0S A;  4HX7 A;  2R7X A;  1WJD A;  4BUP A;  1RNL A;  1SFX A;  3RKQ A;  3OYF A;  1BOB A;  4LG3 A;  4NUB A;  1QRY A;  1NK3 P;  1TQP A;  4I76 A;  4E4H A;  4XRF A;  4DBR A;  3KEY A;  1FPQ A;  2HWV A;  2W82 A;  2CW0 F;  3F72 A;  3CC7 I;  2CQK A;  3I54 A;  4G12 A;  2VXZ A;  4NHJ A;  4PJ0 C;  2X1D A;  2HFH A;  5ICF A;  2JA7 J;  1MMD A;  3JTH A;  5IYD J;  2G7H A;  1AHD P;  1TW3 A;  2XAJ A;  5DV5 A;  3S3N A;  4RAY A;  4FX4 A;  5HLG A;  5DUK A;  3N05 A;  5DS9 A;  1H0M A;  5J1U A;  3P9K A;  1NTC A;  1MBK A;  3DKW A;  1KU3 A;  1W36 D;  1U5T C;  2A6H F;  4OWR B;  4BAY A;  2O03 A;  1A31 A;  5D4S A;  1XTA A;  3ZXS A;  1UHW A;  2HI3 A;  5FKL A;  1P7J A;  2PJR A;  2ZSH B;  1Z3X A;  2PI0 A;  2BXY A;  1FNN A;  5IYB J;  2KIM A;  4CZC A;  4IKF A;  2KZG A;  4A5M A;  2DQR A;  3L09 A;  3NEU A;  2DN0 A;  1XS9 A;  2F5V A;  2CRG A;  1R6R A;  2LBF B;  1V4R A;  2CU7 A;  2XGX A;  2ZXJ A;  1MH3 A;  2NYX A;  4HX8 A;  4PK4 A;  1ITY A;  4Y33 A;  2FE3 A;  4M72 A;  3OSF A;  1PYV A;  2W7N A;  4I2O A;  1FEX A;  2GQQ A;  1S7A A;  2X4H A;  4BXF A;  5HLH A;  2BY3 A;  3SEZ A;  2LVS A;  3GTQ J;  2W4S A;  1ZR4 A;  1R7J A;  1BI2 A;  4ESJ A;  1IN5 A;  3DPU A;  3JRI A;  4L18 B;  1G3S A;  3QU3 A;  3G1M A;  2ECC A;  2BW3 A;  2FNP A;  3FK7 A;  2EIM H;  3H3U A;  2EZI A;  4LIT A;  4RDU A;  2R5Z A;  3AG4 H;  4LK1 F;  2JVH A;  3BTJ A;  4LIV A;  4BBR J;  3CCE I;  3I56 I;  2XKO A;  5JHF A;  3M3Y J;  5CQE A;  2VOO A;  2PMZ N;  1MW7 A;  4A3K J;  1XB4 A;  5EEA A;  4NQW A;  3LSK A;  3CUQ C;  2ZO4 A;  1W0T A;  1TTY A;  1U5T A;  2NVY J;  4B48 A;  2WV0 A;  4UXN A;  2F4M B;  3PO2 J;  5A2Q Z;  5E17 F;  2M45 A;  3V7R A;  2HQN A;  4BYY A;  3V8J A;  2K9L A;  3TGN A;  2V1N A;  1ZAR A;  3BTL A;  1P4W A;  4X0G A;  2OZ6 A;  4CUG A;  1Z6T A;  1PJR A;  1D3Y A;  3WTV C;  1WI9 A;  3OR1 C;  3CC2 I;  1UG2 A;  5FRO A;  4ANJ A;  3S15 J;  2Z2S B;  1LPQ A;  1TWA J;  4OMY A;  2O8K A;  1XGN A;  1ENH A;  2AO9 A;  5HOD A;  2QKL B;  4WXD A;  1IV6 A;  4UY8 I;  3IAS 2;  2R7S A;  2VQH A;  2LKX A;  1FBS A;  2VPR A;  4R1H A;  3MZY A;  2E71 A;  3LOC A;  2CUE A;  2BHZ A;  2JUC A;  4L9V A;  3BR2 A;  1UB9 A;  3S17 J;  5IYC J;  1QO0 D;  1G8X A;  4QIW N;  4JQF A;  2VKD A;  2ZFU A;  4XBF A;  2HNH A;  4Y7N J;  2HYF A;  5F1R A;  4EVI A;  2MLK A;  2WWY A;  4EEF G;  3EYY A;  4XLF A;  3CUQ A;  4XLE A;  4AIK A;  5DYM A;  4XRS A;  1QVU A;  2F4I A;  3JW4 A;  4FAS D;  4V2F A;  3JRB A;  1T39 A;  4PGH A;  1YX3 A;  4MO7 A;  1ZGA A;  2CSO A;  3A2K A;  3UNG C;  4DZP A;  5M5W J;  2J5P A;  3P9C A;  4DYR A;  4TV7 A;  1XCV A;  1IC8 A;  1I3A A;  3GZ5 A;  2UWM A;  3S8P A;  1SVO A;  1QBJ A;  3DBH B;  2TCT A;  1GVJ A;  2JUG A;  2XB0 X;  1NHA A;  2IP2 A;  3LFU A;  3LSI A;  2X6O A;  4HNV A;  3QPS A;  1ORK A;  2HKX A;  3WE2 A;  1IW7 F;  2L02 A;  1AKH B;  2YU9 J;  3BTI A;  5DM6 F;  4ZZD A;  1A6Q A;  2H1L A;  2NS8 A;  4RBO A;  1FP1 D;  1VND A;  4EM0 B;  4RB2 C;  3ECH A;  1D1B A;  5HDG A;  3CP8 A;  4A12 A;  4ETS A;  4RS8 A;  2X48 A;  3JRG A;  4E7K A;  2M2E A;  3S3M A;  1OCO H;  5DD8 A;  4HZF A;  4ABZ A;  3IKT A;  1T0F C;  2KQR A;  4L5I A;  4XOP A;  3F3X A;  2LRD A;  1XDU A;  1ETV A;  4RGU A;  3HOW J;  5AON A;  3TL4 X;  3QRF F;  1KQ0 A;  2Q2E B;  1AOY A;  1FLI A;  3JSP A;  3O2P E;  3TBI A;  4ITV A;  4Q48 A;  2OV7 A;  4I98 B;  1YJ9 I;  1N75 A;  1LDD A;  3VYS B;  2DJI A;  5E8I A;  4CYC B;  5F27 A;  4IPA A;  3TW7 A;  4D9J A;  2L9N A;  2EA4 A;  4QPO A;  5EYR A;  2ZKZ A;  1PUF B;  2XGC A;  4UV8 A;  3E0J B;  3ZQG A;  4EM2 A;  4F3Q A;  1VQ5 I;  2B63 J;  2XSD C;  2D5V A;  3GBG A;  2V1U A;  2JZY A;  2LK2 A;  2R7W A;  4ZYE A;  2OU2 A;  3KP7 A;  5L3D A;  2ID3 A;  2XRN A;  3KP5 A;  5HLT A;  4HF1 A;  1IG7 A;  2Z16 A;  1WFX A;  5FKN A;  1TT5 B;  3DTE A;  1ZN2 A;  3QU6 A;  1GV5 A;  4LIU A;  4B44 A;  1X2N A;  3ESW B;  3IH4 A;  1E3O C;  1W0U A;  1W7P B;  1XDS A;  4Y3O A;  1BM9 A;  2ESN A;  1KQ9 A;  4QSH A;  5LEK A;  1DU6 A;  2DU9 A;  1D5Y A;  2E2J J;  2BY2 A;  2NS7 A;  3FXU A;  3B6C A;  1UHS A;  5FKK A;  4Z2Y A;  4IHV A;  1T0F A;  3AL0 B;  4GYI A;  1DGR M;  4G94 A;  2PFB A;  4A0Z A;  4CA0 A;  3HKZ A;  3HSE A;  3FMS A;  4CYD A;  3UKG A;  3O6B B;  3OS0 A;  3SDB A;  4DGW B;  3S93 A;  2RVC A;  5C4J J;  2K3P A;  2JN6 A;  3I4P A;  2UV1 A;  2EIL H;  5ILS A;  2XPW A;  1REP C;  1WQ2 A;  3GF2 A;  5C4X J;  2ISY A;  2ZSI B;  3FMR A;  2K40 A;  4EJO A;  2PLY A;  5BMZ A;  4KT5 C;  4OAY A;  4BHB A;  4L9N A;  4EGZ A;  1LKX A;  4UUS A;  2ZB9 A;  3G3Z A;  4UB8 C;  3RKY A;  4II3 A;  2VN2 A;  1D1A A;  2QSG X;  1WWX A;  3RSN A;  2Y2Z A;  3IRQ A;  1HW1 A;  2QQB A;  2GA1 A;  3I5U A;  3FMQ A;  4E7Z A;  2XGE A;  1K4T A;  3RKW A;  5E20 A;  2ISZ A;  3IH2 A;  3WG7 H;  4AVP A;  1UFM A;  5FO5 A;  2ZNY A;  3CCY A;  3HUG A;  3PIP F;  2ZME C;  3DEU A;  1G6N A;  3ZPL A;  2E35 A;  4PJL A;  3A01 A;  2CQ7 A;  1IAW A;  3CES A;  4ENN A;  4A0Y A;  4AIH A;  2M0C A;  2IRF G;  3DKY A;  5JFR A;  3RIR A;  4BDY A;  4U0V A;  3HTU A;  3BDD A;  1RUO A;  2ELK A;  2ZXH A;  4MNU A;  2GXG A;  5K7H A;  4I6Z A;  3H5R A;  4N9I A;  4IX7 A;  4U88 A;  2FBH A;  2IT0 A;  4MQV A;  3S2D J;  1GVD A;  4UB6 C;  4GFB A;  1FMW A;  1WJC A;  4M3B A;  3VYU B;  4J19 A;  1SFU A;  2FD5 A;  2GAU A;  4Z6Y A;  1ETQ A;  1LJ9 A;  3HZJ A;  3ZMT A;  3GZ6 A;  2W84 A;  4D7M A;  2R7F A;  3HOT A;  4DBQ A;  4PCQ A;  2NRA C;  4XLC A;  3S1M J;  3FXK A;  1FBQ A;  1I50 J;  2WY8 Q;  2YSR A;  2OUM A;  3WOD F;  5BPI A;  4P96 A;  3LMM A;  2A3S A;  1DP3 A;  2LF8 A;  2DA4 A;  2BVM A;  2QQ9 A;  3ECO A;  2WAQ A;  4LLN A;  3S1R J;  2QLZ A;  3GTL J;  2H8W A;  1R1V A;  1WCM J;  1IRG A;  1UHM A;  2BXZ A;  1AWC A;  2ZME A;  4RMN A;  2KDZ A;  2AQF A;  3GTP J;  4D0P A;  1USS A;  2MLG A;  1WH7 A;  2RN7 A;  3CZ6 A;  1MBE A;  1A5J A;  4KUM A;  3I71 A;  1W5T A;  2MH2 A;  2QEN A;  4OIN F;  3TOB A;  3L2R A;  1P92 A;  3RZD J;  2A68 F;  2JJ7 A;  4JX5 A;  3MZH A;  1PP7 U;  5CVJ A;  5E3O A;  1N77 A;  4MTD A;  2D2W A;  1MND A;  2ADU A;  1KGS A;  1Y8R B;  2DMN A;  1F43 A;  1UZC A;  1BI1 A;  4F91 B;  3OYA A;  3TED A;  4A3M J;  2HQ5 A;  2FSW A;  3N97 A;  2KP6 A;  1B6A A;  1Z9C A;  5HS8 A;  1IRZ A;  3FBN B;  1WRJ A;  2E19 A;  3K4M A;  2TDX A;  3A0H C;  1HOM A;  4XMY A;  4B4C A;  1SVM A;  1GHC A;  2EZL A;  2DDA A;  1P4X A;  2LKS A;  1DQU A;  3DU5 A;  3O8H A;  2M34 A;  1YW9 A;  5IT9 Z;  3VSL A;  5LBQ A;  5ILU A;  1LE8 A;  4XON A;  1YYV A;  4BEH B;  2LH9 A;  4CCL A;  2Y9Z A;  3DTI A;  1QHH D;  3TP3 A;  2XSJ C;  2O0Y A;  3GVA A;  2CV1 A;  3NQO A;  1F9N A;  4MLO A;  2STT A;  3ZMU A;  3QPT A;  2OCE A;  1I6H J;  3F8C A;  4RA2 A;  2DOF A;  1U6G A;  5ED4 A;  4O6J A;  4PDK A;  4ZYD A;  4AYB N;  2L01 A;  1G3Y A;  1WGX A;  2RRE A;  3EUH C;  3KYL A;  1E2X A;  1ETO A;  1OMI A;  3OOP A;  2DMU A;  4AVZ A;  4CGZ A;  4BJ5 C;  1MBF A;  1QZY A;  3T5X A;  3PUF A;  3OYH A;  1BW6 A;  2E5Z A;  4PJJ A;  5H2F C;  1OCP A;  4FE7 A;  2V9K A;  4A3F J;  3AG1 H;  3CO6 C;  1FT9 A;  1I6X A;  1ETW A;  2R7T A;  1ODD A;  5HS7 A;  1IXR C;  4GRI A;  3SXY A;  2HVQ A;  3VYT B;  4A93 J;  5TRD A;  3J80 Z;  3JRD A;  2BY1 A;  3WU0 A;  5BQT A;  4A3B J;  5L3G A;  4CO8 A;  5E79 C;  5KCM A;  2X1E A;  3WTW C;  4HQE A;  3KET A;  1SVL A;  3IH3 A;  3SQN A;  3G1L A;  3I4N J;  2HDC A;  3D5L A;  3A03 A;  1D8J A;  4UHT A;  1TQM A;  1UEL B;  3QP6 A;  5KAI C;  3IUO A;  4BY1 J;  1WJA A;  4OOI A;  1U9N A;  3W2A A;  1R23 A;  1I27 A;  5FLX Z;  1YS7 A;  1YRN B;  1VQM I;  2Z99 A;  1ZG3 A;  2GLO A;  2M8E A;  3S16 J;  5C3E J;  4FCY A;  5F0H A;  4QTR A;  1G2H A;  1Z6R A;  1MMA A;  2WA0 A;  4RB3 C;  1JT0 A;  2M9H A;  1K79 A;  2FOW A;  1BJA A;  2E7W A;  3LA3 A;  1JKO C;  2KJB A;  1X2M A;  2H6C A;  3HDD A;  1MBH A;  4UUT A;  4YFN F;  2ZBK A;  3S1N J;  4M9X A;  3EUH A;  2MAB A;  2IS6 A;  1S8N A;  2EK5 A;  5AIP A;  4AM3 A;  1X1C A;  3C3W A;  2LBF A;  3WTZ A;  4ENJ A;  2E1O A;  4A3D J;  5ICG A;  1F36 A;  4HEA 2;  1SC7 A;  3FXM A;  4IEJ A;  2E1N A;  1IDY A;  1T33 A;  5J8C A;  4KMF A;  4M71 A;  5D5U B;  5F6F A;  2IS4 A;  1HA8 A;  3FKJ A;  1P9Q C;  4G9Y A;  4FE4 A;  4JP0 A;  1OCR H;  2K9S A;  3JRA A;  2CUZ A;  2HVR A;  1LEA A;  1R1U A;  2XVC A;  1ZRF A;  4IOA F;  1X3U A;  4QWQ A;  4XNF A;  1SAU A;  1I39 A;  4YG2 F;  3TDU C;  1Y8Q B;  2CG4 A;  3PJR A;  5DM7 F;  1YX5 A;  5FD6 A;  4HG2 A;  1ZK8 A;  4D5F A;  3OL3 A;  2MD0 A;  4R79 A;  1TT0 A;  1O57 A;  2P6S A;  2Y0S N;  5ILV A;  3SFZ A;  2FQ3 A;  3E7L A;  5D6E A;  2JA8 J;  4AID A;  1U78 A;  3DLA A;  3GCM A;  1IXS B;  2NVU B;  3ABU A;  5D5X B;  5LHI A;  2YR2 A;  2ZXI A;  2JVG A;  3RQ4 A;  4ZYG A;  4G8X A;  1HSJ A;  3L7W A;  1MSE C;  5H6R A;  3OS1 A;  1YJW I;  5EG0 A;  4GO1 A;  4M9Z A;  5EEG A;  2Q8K A;  1B9M A;  3K70 D;  1XN7 A;  4MEY F;  4UUV A;  3TO7 A;  2V1D A;  3J81 Z;  4CCO A;  3CCL I;  2FF4 A;  2M7A A;  3OSG A;  1I3Q J;  1T6S A;  2EJR A;  1W7P D;  4KDP A;  2E2H J;  2MFZ A;  3H3Z A;  3DQV C;  2FXA A;  1D0Z A;  1RES A;  4RB0 A;  2FML A;  5L3B A;  1QQI A;  4GDF A;  3NWS A;  3CQZ J;  2VBW A;  2R93 J;  2HYJ A;  5TGT A;  4I0B A;  1J2X A;  2W00 A;  1JI8 A;  1G3T A;  2RAE A;  5FRM A;  1BR1 A;  3WTT C;  4MGR A;  1RKT A;  1FYK A;  1EV7 A;  5DCF A;  3KLO A;  1VQ9 I;  1ZAO A;  4RB1 A;  4IHS A;  2JPC A;  1WHU A;  2IBD A;  2RKH A;  3OS2 A;  3MAJ A;  3JRH A;  1A6I A;  4DYQ A;  4XLN F;  1QZZ A;  4Y17 A;  4EJW A;  2F2E A;  1J5Y A;  2MD5 A;  1U9O A;  5LGU A;  2RQQ A;  4MFE A;  1UAA A;  2HKO A;  1VTN C;  5D5W B;  1ZGJ A;  4IHT A;  5GAE J;  2VT2 A;  2EV6 A;  1R5I D;  5JHU A;  1OCT C;  2K9M A;  2X1C A;  5C44 J;  2DTR A;  2OTL I;  3PL8 A;  3BTC A;  2EV5 A;  2OZU A;  1H89 C;  1XG1 A;  2L7Z A;  2F5F A;  1MMG A;  4BH9 A;  2BBY A;  2IVM A;  4CCM A;  3I59 B;  5E1W A;  3HYI A;  1UMQ A;  4MIM A;  1XCB A;  3CCU I;  2DW4 A;  2K86 A;  2MW8 A;  3CTA A;  5E8G A;  2O9L A;  5KHD A;  2YX4 A;  5LLQ A;  4IVN A;  1X4P A;  1I1S A;  4BE1 A;  1YOV B;  2P7C B;  2CFO A;  2ZNZ A;  2F5C A;  3K70 C;  1LVK A;  5DUI A;  3BJ6 A;  2ME6 A;  1T95 A;  3CCR I;  4UNO A;  4BHC A;  4IO9 F;  2ME0 A;  1MD0 A;  3BT9 A;  3QYE A;  1RPW A;  1XSD A;  2Z9O A;  1YE9 A;  4IQJ A;  2LLK A;  2I10 A;  2R7D A;  2W48 A;  3ZN0 A;  5EDN A;  2E5N A;  3R0A A;  2FOK A;  4XRS G;  5M3M J;  5KK1 A;  1H9T A;  3JCU C;  1T08 B;  1LFU P;  2FQ4 A;  2QBY B;  1FZP B;  3HPH A;  5KVR A;  2CQQ A;  2K5C A;  3TP0 A;  5L3F A;  4WWC A;  1HC8 A;  2CGP A;  1HXD A;  2EA2 A;  4YII A;  2Q2E A;  2ZFW A;  3MKL A;  3S2W A;  3KIO A;  3TOA A;  3GTO J;  4XLP F;  2P0W A;  1GLN A;  2XF5 A;  2LD5 A;  1BC8 C;  3K4B A;  3SFI A;  1A36 A;  2XB5 A;  1SD5 A;  1YI2 I;  2F5D A;  2X6Y A;  4UVC A;  2EH3 A;  2RGV A;  2O6G E;  2Y31 A;  1HLV A;  2H94 A;  4M3E A;  1G4D A;  1H9G A;  1BOA A;  5E1Z B;  2GWR A;  1MBJ A;  1BJZ A;  3MFK A;  1FOW A;  1MH4 A;  1XMA A;  4KJZ A;  3JRF A;  1RR8 C;  1IO2 A;  2V9P A;  5CVR A;  2NVT J;  1ZTR A;  1J9I A;  3BOQ A;  3W3C A;  3VWB A;  3E6B A;  3FZV A;  4M3D A;  5FRN A;  3DU6 A;  4OIP F;  2WB1 A;  1YFH A;  3LWF A;  1YIT I;  3H9J A;  3I9V 2;  1HF0 A;  3PM1 A;  4AUX A;  4A6D A;  3K4N A;  3EET A;  1OYY A;  2F6C A;  3SHF A;  3BLY A;  2G9W A;  4GCV A;  2K4J A;  1W7P A;  1IUF A;  2OC6 A;  1B72 B;  1X3Z B;  3S32 A;  3WHC A;  4C3J J;  2E1M B;  3I58 A;  3GX4 X;  2ZJQ F;  4FIS A;  4E7H A;  3ZQL A;  2X9D A;  1ZGW A;  2M0M A;  4KIB A;  3DFG A;  5DDG A;  2XAU A;  4J01 A;  4KFC A;  5J1Y A;  2HU9 A;  2BVL A;  5LGT A;  2MC4 A;  2GA2 A;  1Y1W J;  1Z7U A;  2GOX B;  3CDL A;  2G7U A;  1B4A A;  5E3N A;  1QHG A;  2KKO A;  1N78 A;  5HLI A;  4F55 A;  1APL C;  4A3E J;  4XL9 A;  1ZRE A;  5B66 C;  3COA C;  3HHG A;  1JKP C;  2OA4 A;  5M3F J;  2VBY A;  2I5U A;  1ZG5 A;  3FDY A;  2EV0 A;  1OFC X;  1QZE A;  1T2K A;  1TZL A;  1V54 H;  4IRG A;  1UJ8 A;  4I09 A;  2KDO A;  3R6S A;  2HQR A;  3ZMS A;  3LQR A;  5JVT A;  3HG9 A;  1BA5 A;  2BYV E;  2ZJ2 A;  1R9T J;  2DYR H;  1JT6 A;  4XKW A;  3K10 A;  2MGQ A;  1FC3 A;  4JOM A;  2LY1 A;  3BZ6 A;  2OAZ A;  3CME I;  1WJB A;  2R7U A;  1XMK A;  1BR4 A;  4RAG A;  3ABK H;  1C0W A;  2W25 A;  3E6D A;  2XPU A;  4XKV A;  4KNY A;  3L1P A;  4FQG A;  2DA5 A;  2WAF A;  2CQX A;  2R7Z J;  2GBY A;  2LG4 A;  1ZR2 A;  2KIS A;  3R60 A;  1R5H A;  4PFO A;  2CV0 A;  4XLH A;  2KZV A;  4L0Z B;  3IRR A;  3U1D A;  4Q4Z F;  3F0C A;  2XHK A;  3D5R C;  3GTM J;  1O4X A;  2UXX A;  2KRH A;  2LFB A;  5L3E A;  2DT7 B;  2VQG A;  3Q5F A;  1FBU A;  2VC1 A;  1U8R A;  2DMP A;  4HPQ A;  5HOO A;  1ZH5 A;  4JK1 X;  4H0E A;  4AU7 A;  4D1Q A;  4BQQ A;  3CCM I;  1U0J A;  4I02 A;  2EFP A;  1R1T A;  5HNF A;  4XN3 A;  4KIG A;  4HSR A;  4BKX A;  4LG0 B;  4ZJZ A;  3A4C A;  3HKZ N;  1FP2 A;  1BI3 A;  5HS9 A;  1HW5 A;  1FIA A;  3CCJ I;  4N4O B;  2BZT A;  2QCO A;  2JA6 J;  2EIN H;  2VQC A;  3M8J A;  3JAM K;  2DXI A;  1X1P A;  3TO6 A;  1VQ4 I;  4NQW B;  1Z67 A;  1WPK A;  3BR5 A;  4JX4 A;  1ACI A;  4E70 A;  2M7B A;  1F1Z A;  2LYC A;  2Q0O A;  1EH8 A;  2L4A A;  4BQN A;  4ZYH A;  2XAS A;  2BY0 A;  3DP7 A;  3PO3 J;  4NB5 A;  1KZH A;  4QLC U;  3LL7 A;  4KIT B;  4HLY A;  5DCM A;  1RZ4 A;  3AKZ A;  1MJA A;  3REO A;  3PQJ A;  2DOA A;  5B1B H;  1JUS A;  3RKX A;  5LGN A;  1K6O A;  1SD6 A;  1TNS A;  5IT9 K;  5LEJ A;  3HSR A;  5JI6 A;  1NG6 A;  2KRC A;  3KCC A;  3O3K A;  4RM3 A;  1K6Y A;  3JRC A;  3E5Q A;  1IRF A;  1BIA A;  2IA1 A;  4C2T A;  1CF7 B;  2M1B A;  2AHQ A;  2COM A;  1LQ1 A;  1XD7 A;  3J7Y J;  1FMV A;  1GXP A;  4PJM A;  1OQY A;  2FU4 A;  2B0L A;  1XSX A;  3HXL A;  5EGO A;  1BC7 C;  4B43 A;  2DA2 A;  1MKM A;  2XF6 A;  3U9G A;  5IP7 J;  2IXS A;  1QU3 A;  4N4N B;  1YIO A;  4EJT A;  1B1B A;  3E1S A;  2CV2 A;  3KX2 A;  5LHH A;  4M6V A;  3VPR A;  3NRV A;  2ZC2 A;  2O3F A;  1JJ8 C;  2X6W A;  3P7N A;  4PJN A;  4RLF A;  2Y0M A;  2IGM A;  9ANT A;  4BEH A;  4ESB A;  1Y6I A;  3J80 K;  1FYL A;  4C30 A;  2LY9 A;  2R3S A;  1V5G A;  4BAC A;  2M30 A;  2PMH A;  4HNU A;  1HDP A;  3CUQ B;  1Z0X A;  3GW2 A;  1FIP A;  5CVU A;  2LRE A;  5BOX A;  2QM3 A;  3F8F A;  4X6A J;  2VB6 A;  5CLS A;  1Z05 A;  3GME A;  2E36 A;  1FOY A;  4E7I A;  3K6G A;  2EQR A;  5KAF C;  1X1A A;  5J4V A;  1LVA A;  4R8H A;  1YQA A;  2CW8 A;  1ETK A;  5FLX K;  2D45 A;  3PQK A;  2MA3 A;  2VLA A;  3A1Y A;  5HVQ C;  4HX4 A;  3ML6 A;  3CD6 I;  2QZ8 A;  2XRL A;  2V6E A;  1R58 A;  1B59 A;  2WAQ N;  2LC2 A;  1JXS A;  4BS9 A;  1MDM A;  3BPV A;  3A0B C;  3GUD A;  4E7J A;  1YW7 A;  2K7L A;  2JSC A;  4PSX A;  2VBZ A;  1A35 A;  4Q47 A;  4EJV A;  5JLW A;  3R0J A;  3IWZ A;  1MIJ A;  1BIB A;  5F08 A;  4WCG A;  1ZG1 A;  3K1M A;  2NS0 A;  2ZJR F;  1Y0U A;  2F4O B;  1MJ9 A;  2Z5U A;  4MQ9 F;  3ULQ B;  3FK6 A;  4DYC A;  1TLH B;  4D7N A;  2VKV A;  3K1N A;  1R00 A;  2FMY A;  3GFM A;  3CC4 I;  3P9I A;  1JKR C;  3SZP A;  3CDH A;  4X1E A;  4OIQ F;  1FJL A;  3W2V A;  3E6C C;  2OPT A;  2HVS A;  3B6A A;  1KQ8 A;  1HKQ A;  1KYW A;  1OJL A;  1R4N B;  4NBQ A;  2JA5 J;  1Y0N A;  5HNH A;  2EWN A;  2ETH A;  5K5O A;  1CQT A;  4YFK F;  4B47 A;  4U7D A;  2VOP A;  2L2O A;  3JSO A;  4BGD A;  3C7J A;  2J5O A;  5IOZ A;  1U3E M;  4G6T B;  3KYD B;  4E6K G;  4LGW A;  3GLL A;  3B73 A;  1P4A A;  4ZTJ A;  3Q9S A;  3CCS I;  4KIC A;  4LOC A;  4P9F A;  4U87 A;  4ESF A;  5JR3 A;  1VQO I;  4A3L J;  1JGS A;  4XKC A;  3TW6 A;  1R49 A;  4DQ2 A;  3DTK A;  3IWF A;  4M74 A;  3UR3 C;  4B09 A;  2DOD A;  2EIK H;  3WGG A;  3LAJ A;  2ELJ A;  2GXB A;  3HOY J;  2JTV A;  3HSF A;  3J81 K;  5FD5 A;  3FWE A;  4A2U A;  3JAM Z;  1IDZ A;  2KRF A;  1NG7 A;  1B8I A;  2Y9Y A;  3FM3 A;  2K4B A;  2FUG 2;  5GAG J;  4Q5S F;  4CSW A;  2E2I J;  4ENK A;  3AAF A;  2FEZ A;  1RKW A;  1SD7 A;  3HRT A;  2L9R A;  1LDK B;  4CCJ A;  3MVP A;  4EJU A;  4L9T A;  4PFP A;  3SZG A;  2R7O A;  3TKY A;  5FB2 A;  4WF2 A;  2XC7 A;  4BE0 A;  1WJ5 A;  2P4W A;  4F93 B;  4D5C A;  1IUY A;  2OTJ I;  2M4K A;  1QPM A;  4BJT A;  2HOE A;  5LRS A;  4OU0 A;  3GYH X;  1FTZ A;  1IV8 A;  3MKZ A;  4HST A;  5GTH C;  2ECB A;  1Z77 A;  1ON1 A;  1JGG A;  3FIW A;  2L7K A;  2ZXW H;  1JHF A;  4UVA A;  4DJA A;  2DT5 A;  2PQ8 A;  3Q9V A;  1T8I A;  2LF7 A;  5F64 A;  2NNN A;  3PNT A;  1O3Q A;  3BR6 A;  3HRS A;  4XLA A;  3ZN1 A;  1X19 A;  3VB2 A;  2KIU A;  1LDJ A;  1R22 A;  2VPL A;  4HDV A;  1ULY A;  3E97 A;  3W6J B;  4E7L A;  3HPG A;  1RR7 A;  3CJQ B;  4XOR A;  3W6K B;  4A3G J;  4QPQ A;  3MKW B;  1I1G A;  4RGR A;  3CMA I;  1D0Y A;  3G2B A;  5LHG A;  2VBX A;  5HDN A;  2IAI A;  2BHY A;  2FA5 A;  3I0T A;  2XDV A;  5IOY A;  5M5X J;  3V7C A;  1RUN A;  2R4G A;  4G6D A;  1K61 A;  2EB7 A;  2H27 A;  1ZQ3 P;  1KU2 A;  3HEF A;  3WGI A;  1AA7 A;  2HQA A;  1TBX A;  2LMD A;  1VQL I;  1XSV A;  4ZYA A;  2DK8 A;  1JKQ C;  2Y69 H;  3F23 A;  2M5W A;  4C2U A;  1K78 B;  3VOE A;  3JR9 A;  1VQN I;  5CVI A;  3L2V A;  3BQZ A;  1JHH A;  4PGG A;  4EMS A;  1IN8 A;  2Y30 A;  3V42 A;  2L7M P;  3L2C A;  2VE8 A;  3ERE D;  4B8X A;  2NNY A;  4NC6 A;  2VE9 A;  1JJ6 C;  1JE8 A;  5J3L A;  2ELH A;  4RGX A;  2P5L C;  4C9Y A;  2A6E F;  3HGG A;  2L3D A;  1J09 A;  2LOO A;  1HCR A;  2IPQ X;  3CCQ I;  1Y56 A;  3Q0W A;  4NNJ A;  4G7O F;  3F6O A;  3BCB A;  1W1W E;  3M7G A;  3PSI A;  5GPC A;  4J00 A;  2NVX J;  3ERM A;  3ELK A;  3G6E I;  2R7Q A;  2DAO A;  2GIZ A;  2VKE A;  3HOS A;  4CCN A;  3EUK L;  2NXN B;  2QF7 A;  2XRO A;  3ZQI A;  1FOX A;  2JQ7 A;  4F92 B;  2DMQ A;  2DA1 A;  3LSH A;  3DBL B;  3H9G A;  3FBI B;  3L00 A;  2WTE A;  4XK4 A;  5EEH A;  1EA3 A;  2XF7 A;  5CKT A;  4IZZ A;  3FF5 A;  4OAZ A;  2IW5 A;  1E0E A;  4L5J A;  3RCO A;  1SEU A;  2E1M C;  3S3O A;  2ZJP F;  1KU7 A;  1FSH A;  3BCA A;  2A5Y B;  3ABL H;  1QNT A;  3LSM A;  2FBI A;  3I64 A;  3GTK J;  3H1C A;  3HJE A;  1O3S A;  2B9S A;  2QBY A;  2IS2 A;  2E34 A;  2PX9 A;  1TWF J;  2VJI A;  5F04 A;  4W1U A;  4HLX A;  4IQ4 A;  3OIQ A;  1IXC A;  3VDX A;  3OYI A;  4WX9 A;  5CJ9 A;  2CQN A;  2OJE D;  1I5Z A;  2QGU A;  3U1K A;  3O8G A;  1TL8 A;  1LEB A;  4WXH A;  1SFE A;  1OCZ H;  3BY6 A;  4O5V A;  1DU0 A;  4DNC A;  2VOD A;  3OYB A;  1O7F A;  3HGY A;  3CCV I;  4B3A A;  2MC3 A;  3WHB A;  2RC4 A;  3BP8 A;  3BWG A;  2PJP A;  4A3C J;  1ERD A;  3QOE A;  3GFI A;  4RGS A;  3I3L A;  3F6V A;  3C2G A;  1P7I A;  3HRM A;  1S29 A;  2G0E A;  3K1P A;  4AD9 A;  1D8K A;  1DPR A;  3MZ8 A;  2IGN A;  3M8E A;  1VQK I;  4CZZ A;  3OYE A;  4HRI A;  5FKM A;  1O3T A;  3C1D A;  2YPR A;  5D8K B;  3LNQ A;  1A04 A;  3IV5 A;  1TNT A;  3CF2 A;  5K7Z A;  1OIS A;  3D5S C;  2XAQ A;  3HRU A;  4P55 A;  5GAD J;  1EF4 A;  2COB A;  2EIJ H;  3DLL F;  2DLL A;  3E3V A;  5TJJ A;  4C3H J;  1PP8 F;  1MMS A;  4U7B A;  4KN4 X;  1BI0 A;  1K4S A;  2D1H A;  1PUE E;  2RNJ A;  2MH9 A;  1E3P A;  2IJL A;  2HXO A;  2PEX A;  4DIQ A;  1EH6 A;  1LNW A;  3V8L A;  3F22 A;  1WJF A;  3EPZ A;  3OYL A;  3K7A J;  2DA7 A;  3LQQ A;  2ESH A;  3ABM H;  2VIX A;  3L2W A;  2DO7 A;  3PNV A;  3EDP A;  1VZ0 A;  5GPA A;  1TP4 A;  3FHZ A;  5HDK A;  3ASO H;  2HZT A;  2R5Y B;  3J7A Y;  2AS5 F;  3LSR A;  4FT8 A;  3ZCO A;  3R61 A;  4BQO A;  4F7Z A;  3RQI A;  2A69 F;  2Z3Y A;  3ZP5 A;  1IZ1 A;  2DDB A;  4MHG A;  2JA2 A;  1IN6 A;  1S7E A;  4EQQ A;  2LNB A;  2X0L A;  5AIQ A;  4HYE A;  2K27 A;  4IOC F;  4A0X A;  4II2 A;  2VT3 A;  4L5E A;  3DBR B;  2B7E A;  4BNC A;  5DTD A;  1SD4 A;  2FRH A;  3GTJ J;  5D8L B;  4BJ6 C;  4ASN A;  4ZH4 F;  3F8N A;  3AG2 H;  3RZO J;  4CDG A;  1FTT A;  2ACJ A;  1ON2 A;  2BV6 A;  2W85 A;  2WBM A;  5J4Y A;  2KLO A;  1IN7 A;  1EJ9 A;  3WE3 A;  1Y39 A;  1AKH A;  2R0Q C;  4M73 A;  1EKE A;  4EAT A;  4A3I J;  3MCZ A;  4KN7 X;  1J59 A;  4HF2 A;  1YTY A;  1TW2 A;  3HB9 A;  3FXJ A;  1WKM A;  3H35 A;  3G73 A;  2QQ8 A;  5EJC A;  2M87 A;  3HOX J;  5ERI A;  1GDT A;  1V3F A;  1X1D A;  2C6Y A;  2L7F P;  4L9J A;  2VJ5 A;  3X2Q H;  1KU9 A;  4LB5 A;  1WJE A;  1OCC H;  2LKP A;  3CJR B;  2RQP A;  2WB1 N;  3EUA A;  3KPH A;  4LK0 F;  2V9V A;  3AL0 C;  2M3A A;  1DDN A;  2DMT A;  1RET A;  3DF8 A;  3RJP A;  4F52 A;  4BDZ A;  3ZQQ A;  4XM3 A;  3CO7 C;  1X58 A;  3BPX A;  5J1R A;  5E3M A;  3IL2 A;  2V6C A;  4DOZ A;  2A05 A;  2P5V A;  2STW A;  4EV0 A;  1V55 H;  1HQC A;  1X4O A;  2LSO A;  3H0G J;  2DPD A;  1N25 A;  3RYR A;  4HOB A;  4CYC A;  3ZMV A;  1ZLJ A;  3H9Q A;  4LG0 A;  3H36 A;  1WI3 A;  2EZH A;  3WU1 B;  4FET A;  3C18 A;  3F9K A;  5FKO A;  4YIF A;  3PFY A;  1PUF A;  3HHH A;  5DD4 A;  1S3J A;  3T8R A;  2FNA A;  1TWH J;  1QGP A;  5B1A H;  3PSF A;  3FM5 A;  2HOS A;  1YJN I;  1XC5 A;  4MFD A;  4MEX F;  4DZJ A;  1ZRD A;  3GWZ A;  3T0Y A;  5GAH J;  1XGO A;  2GM4 A;  2H1K A;  1K83 J;  4BU2 A;  4K2E A;  2OQG A;  3WTY C;  3DEW A;  5EG0 B;  1MSF C;  1M1E B;  3OMY A;  2VON A;  2UXN A;  1SMY F;  2IGK A;  2WY7 Q;  2K9Q A;  4N9H A;  2W1O A;  3S1Q J;  4IHW A;  2K9N A;  3U2R A;  1MJB A;  3QYB A;  3EYI A;  2OCC H;  4XQF A;  1CF7 A;  1W36 C;  2HYG D;  3N4M A;  1GXQ A;  1HBX G;  1BL0 A;  1KYZ A;  2L9S A;  2VQL A;  5K7F A;  2GZW A;  3MMY B;  2EZK A;  4ZDO A;  3BZK A;  3M8F A;  2IA2 A;  3SDG A;  1YLF A;  4N0B A;  4Y4R A;  1BR2 A;  3CJT B;  2CYY A;  2PMZ A;  2JPB A;  1Z21 A;  2XPV A;  2V7F A;  4S0H B;  1P6R A;  4LFU A;  1J0R A;  4GGG A;  1VQ7 I;  1MNM C;  3DPT A;  1UG0 A;  3LA2 A;  4RAZ A;  5IP6 A;  3CUO A;  4CIC A;  1XX5 A;  3OIO A;  5IY5 H;  1FSE A;  3KP6 A;  2JSP A;  5BNG A;  2P6T A;  3QWL A;  2VC0 A;  2RDP A;  5FGM A;  1ZKG A;  2NVQ J;  3Q0U A;  2DYS H;  4HV5 A;  3VFZ A;  5B5E C;  1HDD C;  2N8G A;  2XGD A;  3RYP A;  2YU3 A;  4YEJ A;  3ROU A;  5GP9 A;  3DPL C;  3KP4 A;  4XID A;  4XSX F;  3IKV A;  2PJR B;  3GXO A;  1E3H A;  4YFX F;  3GEZ A;  4ENM A;  3RPU D;  1JTY A;  2XV4 S;  2KL4 A;  4XN0 A;  2DA3 A;  2X6X A;  2Y75 A;  5FJ8 J;  4C2M J;  1T98 A;  5E1X A;  2GXA A;  2HDW A;  2GOM A;  1NH3 A;  5FFX A;  2EFQ A;  3CMM A;  5K5Q A;  2A07 F;  1L3L A;  2JWT A;  3MN2 A;  1XPX A;  1Q1H A;  1LFB A;  2BW3 B;  3GFJ A;  3M1E A;  4W97 A;  5E18 F;  2O8X A;  3DV8 A;  3KZZ A;  3HL2 A;  2DPU A;  2QA4 I;  2HGC A;  2KMU A;  4AC0 A;  1MBG A;  2R5Z B;  1POG A;  1D0X A;  2H6B A;  4HW0 A;  4LMY A;  3QP5 A;  2TRT A;  1L0O C;  3BG5 A;  3RPQ A;  3H0D A;  3J7A O;  1T56 A;  1Z91 A;  3VOD A;  4A69 C;  5K5R A;  3SYT A;  4O3M A;  2DA6 A;  3TDZ C;  1ZLK A;  1B9N A;  2EFN A;  3BR3 A;  1U5T B;  4KIF A;  5BPD A;  2HDD A;  3HOZ J;  2VKH A;  1ONV A;  4FTH A;  2WC2 A;  5F1J A;  3GZN B;  4XOT A;  3LSP A;  5IT3 A;  1EH7 A;  4JYK A;  1TWG J;  2L0K A;  1H88 C;  3VEP A;  5K1Y A;  1TQI A;  3H3V K;  1W5C C;  4JX6 A;  1Z1D A;  1S7O A;  4G6Q A;  2QKM B;  2ICW G;  2LY2 A;  1F5T A;  1X3W B;  2FJ1 A;  3OL4 A;  2V26 A;  3S2H J;  2DFF A;  1JTX A;  3L9F A;  3HIF A;  2VUM J;  2DFH A;  3HOV J;  3HOU J;  3HM5 A;  2FX0 A;  3GO5 A;  1LFP A;  2VL8 A;  2XAG A;  4HA8 A;  5ICC A;  4BE2 A;  1S5L C;  3BG9 A;  1OLT A;  4XKB A;  3F21 A;  2AQE A;  2WAE A;  1W5S A;  2QWW A;  3T8T A;  3JTG A;  4Y15 A;  3BJA A;  2NOJ B;  4IRH A;  5J6X A;  2IA0 A;  3FKI J;  3KP3 A;  1RC9 A;  4DW6 A;  4P1W A;  4CH7 A;  3E5U A;  3KZY A;  5CVV A;  2A61 A;  5IPA A;  4B1R A;  3G4S I;  3GTG J;  5F0F A;  5FLM J;  1J7K A;  2CWE A;  3CMY A;  2L9V A;  3LA7 A;  2V1X A;  3LSJ A;  1R71 A;  5M5Y J;  1G3W A;  1IJW C;  2HOT A;  2HEO A;  3RTR A;  4RAF A;  4XIC A;  3DWL E;  4BY7 J;  1SFO J;  3QAH A;  2PMU A;  4XR6 A;  2FBK A;  1P2F A;  4KT6 A;  3KEQ A;  3OYJ A;  1O7L A;  1GUU A;  3BG7 A;  3FXQ A;  3H92 A;  1ZEL A;  4OIR F;  3SEQ A;  1VQP I;  1NK2 P;  2VJ4 A;  2K02 A;  3BG6 A;  1OR7 C; 
#chains in the Genus database with same CATH homology
 1YX3 A;  2XDV A;  2A6T A;  4YEL A;  2R4G A;  3DEE A;  2RQQ A;  1UAA A;  3A2K A;  3U21 A;  3UNG C;  2RNG A;  1S9H A;  1AA7 A;  2HQA A;  4ZYA A;  2K9M A;  2X1C A;  4C2U A;  1V5E A;  3OWT A;  2UWM A;  3S8P A;  2CMP A;  3NWT A;  3PL8 A;  3L2V A;  1SFK A;  3K4K A;  5CPR B;  3ZR8 X;  2JUG A;  1DGW Y;  3V42 A;  3LFU A;  3LSI A;  1MMG A;  4CCM A;  4C9Y A;  4CCK A;  1J09 A;  2LOO A;  4BL0 B;  5KHD A;  1Y56 A;  4NNJ A;  4PUS A;  3FHN A;  3BCB A;  3PSI A;  1D1B A;  1X4P A;  3CP8 A;  4HNT A;  4J00 A;  3DKX A;  5LD2 C;  4BE1 A;  1X1B A;  4E7K A;  3S3M A;  2CFO A;  3K70 C;  1MMN A;  1LVK A;  3MKY B;  2KPM A;  2R7Q A;  1T95 A;  2X51 A;  1T0F C;  4RM2 A;  2KQR A;  3HOS A;  4XOP A;  4CCN A;  3EUK L;  3QYE A;  2LRD A;  1YE9 A;  2MYS A;  4IQJ A;  2E5N A;  3K4J A;  4F92 B;  3TL4 X;  3IAM 2;  3LSH A;  3H9G A;  2Q2E B;  3FBI B;  3TBI A;  4ITV A;  1EA3 A;  2XF7 A;  5CKT A;  4IZZ A;  4E7S A;  2OV7 A;  3HPH A;  2HPI A;  4H4K C;  4OAZ A;  1E0E A;  3RCO A;  1N75 A;  2E1M C;  2K5C A;  3VYS B;  4B3X A;  3S3O A;  3BCA A;  2DJI A;  4D9J A;  2L9N A;  3LSM A;  4QPO A;  4KIS A;  3H5A A;  2VXD A;  2P0W A;  2IS2 A;  3E0J B;  1GLN A;  4F3Q A;  2VJI A;  2XF5 A;  4IQ4 A;  3K4B A;  3OIQ A;  3VDX A;  3GBG A;  3OYC A;  3OYI A;  2HZD A;  2R7W A;  2X6Y A;  5HLT A;  2Z16 A;  1WFX A;  3OYB A;  3DTE A;  3MD2 A;  4KJZ A;  4LIU A;  4B44 A;  1ERD A;  3QOE A;  3I3L A;  3C2G A;  3OR2 C;  4Y3O A;  3W3C A;  3VWB A;  5FRN A;  3DU6 A;  3OYG A;  2IGN A;  2WB1 A;  4ZC3 A;  4HRI A;  3I9V 2;  3OYE A;  3BC8 A;  3K4N A;  4RLQ A;  2I8D A;  2DT6 A;  3AL0 B;  2F6C A;  1DGR M;  3BLY A;  2OC6 A;  3S32 A;  3CF2 A;  2E1M B;  3HKZ A;  4CA0 A;  2Z1D A;  3L2U A;  3D5S C;  1KON A;  4E7H A;  3OS0 A;  2M0M A;  3SDB A;  4J01 A;  2XAU A;  4DGW B;  3H5N A;  3S93 A;  2HU9 A;  2BVL A;  2K3P A;  4U7B A;  5KNL A;  2IGO A;  1MNE A;  2UV1 A;  2MC4 A;  2GOX B;  3C2H A;  1QHG A;  4DIQ A;  2ZSI B;  1N78 A;  4F55 A;  3ONQ A;  2M4G A;  4XL9 A;  2A5W A;  4OAY A;  1WJF A;  3EPZ A;  3OYN A;  2HPM A;  3OYL A;  1LKX A;  3L2W A;  3FDY A;  2VIX A;  3PNV A;  5LFA A;  3M1C A;  1VZ0 A;  1TZL A;  4II3 A;  1D1A A;  3J7A Y;  2KDO A;  3RSN A;  3HUG B;  2CH0 A;  4E7Z A;  3ZCO A;  3HG9 A;  4BQO A;  4ZDP A;  4XKW A;  2JA2 A;  3K10 A;  2CUJ A;  4JOM A;  2LY1 A;  4PJL A;  1WJB A;  3AFH A;  4ZDL A;  2R7U A;  4II2 A;  3CES A;  3CP2 A;  1BR4 A;  3DKY A;  4BDY A;  3VSK A;  3L2Q A;  2WAD A;  4XKV A;  4BJ6 C;  3OY9 A;  2WAF A;  5CQG A;  2ZXH A;  2LG4 A;  4YRV A;  2O5R A;  3H5R A;  3ZRG A;  4PSW A;  3PNY A;  4PFO A;  2CV0 A;  2WBM A;  4XLH A;  2KLO A;  2KZV A;  4IX7 A;  4AYB A;  1FMW A;  4EAT A;  3D5R C;  1WJC A;  3VYU B;  3QOD A;  2KRH A;  3HC7 A;  3H35 A;  2DT7 B;  2VQG A;  4HPQ A;  4NC7 A;  5HOO A;  2DCE A;  1X1D A;  4AU7 A;  2UUZ A;  2VJ5 A;  3HOT A;  4DBQ A;  4D1Q A;  4XLC A;  1WJE A;  2E60 A;  4BQQ A;  3CJR B;  3EUA A;  3OOU A;  3AL0 C;  2M3A A;  4NC8 A;  1U0J A;  2WY8 Q;  2OUM A;  3K4C A;  5HNF A;  4F52 A;  4BDZ A;  3LMM A;  4XN3 A;  3ZQQ A;  4ZTF A;  1DP3 A;  4XM3 A;  2BVM A;  4HSR A;  1G59 A;  4ZJZ A;  3A4C A;  4DOZ A;  2WAQ A;  4N4O B;  2L5Q A;  3QYF A;  2Q1Z B;  1X4O A;  2VQC A;  3M8J A;  2DXI A;  2R7V A;  3OYM A;  3LSG A;  3H9Q A;  4NQW B;  4RMN A;  3OYD A;  2X85 A;  3OYK A;  2AQF A;  2M7B A;  2LYC A;  4FET A;  3F9K A;  3PFY A;  4BQN A;  3CZ6 A;  4KIT B;  3PSF A;  3LL7 A;  2CW7 A;  1D1C A;  3AKZ A;  1IRX A;  2VJJ A;  3L2R A;  2DOA A;  2R7R A;  1N77 A;  1MND A;  1Z3Y A;  2IS1 A;  3OYA A;  4F91 B;  4BU2 A;  1NG6 A;  2KRC A;  4RM3 A;  2KP6 A;  1K6Y A;  3OMY A;  4C2T A;  3FBN B;  3K4M A;  1FMV A;  4PJM A;  3OIP A;  4XMY A;  3HXL A;  2IGK A;  2WY7 Q;  2W1O A;  2KHM A;  4B43 A;  2BOL A;  1Z7L A;  2XF6 A;  1DQU A;  3DU5 A;  3QYB A;  3IP4 B;  2IXS A;  1QU3 A;  4XQF A;  4N4N B;  3TMO A;  3VSL A;  1W36 C;  4XON A;  4BEH B;  2L9S A;  2VQL A;  3E1S A;  3VYR B;  3ZGK A;  2LH9 A;  4CCL A;  3KX2 A;  3DTI A;  3MMY B;  2CV2 A;  4ZDO A;  2V4J C;  1QHH D;  2CS3 A;  3K4L A;  2XSJ C;  2CV1 A;  4Y4R A;  1BR2 A;  4MLO A;  2X6W A;  4PJN A;  2PMZ A;  4RLF A;  2IGM A;  1Z21 A;  2V7F A;  4BEH A;  4P5O A;  1Y6I A;  3PUB A;  2RRE A;  4C30 A;  3EUH C;  1V5G A;  4BAC A;  3KYL A;  2VAS A;  1UG0 A;  3DPT A;  4HNU A;  3W2W A;  4AVZ A;  1V5F A;  2LRE A;  2Y0S A;  4BJ5 C;  3OYH A;  2R7X A;  2E5Z A;  1WJD A;  4PJJ A;  4BUP A;  2VB6 A;  2V9K A;  4E7I A;  3OYF A;  2JSP A;  1BOB A;  3K6G A;  4LG3 A;  4NUB A;  1X1A A;  2R7T A;  4E4H A;  2CW8 A;  4DBR A;  3KEY A;  4GRI A;  2HVQ A;  3VYT B;  2W82 A;  2VLA A;  2VXZ A;  3A1Y A;  5HVQ C;  4YEJ A;  2X1D A;  1MMD A;  5KCM A;  2X1E A;  3DPL C;  2V6E A;  2LC2 A;  4BS9 A;  3S3N A;  2PJR B;  4E7J A;  3N05 A;  3D5L A;  4PSX A;  1W36 D;  1UEL B;  3IUO A;  4OWR B;  1WJA A;  3W2A A;  3RPU D;  3ZXS A;  2PJR A;  2KL4 A;  4XN0 A;  2ZSH B;  1Z3X A;  2X6X A;  4CZC A;  4IKF A;  2WA0 A;  1MMA A;  2HDW A;  2GOM A;  2F5V A;  3CMM A;  1R6R A;  2LBF B;  4PK4 A;  4Y33 A;  1PYV A;  2W7N A;  2BW3 B;  2MAB A;  4BXF A;  2IS6 A;  3W2V A;  3HL2 A;  2HVS A;  3SEZ A;  2W4S A;  2KMU A;  3DPU A;  1X1C A;  1D0X A;  5HNH A;  2LBF A;  3H0D A;  4HEA 2;  4B47 A;  2L2O A;  2BW3 A;  4BGD A;  3SYT A;  2IS4 A;  1HA8 A;  3FKJ A;  1P9Q C;  4G6T B;  4LIT A;  4E6K G;  2CUZ A;  2JVH A;  4LIV A;  2HVR A;  2VKH A;  4ZTJ A;  5JHF A;  4U87 A;  5CQE A;  4XNF A;  1SAU A;  4XKC A;  4XOT A;  1MW7 A;  3PJR A;  1YX5 A;  3DTK A;  3UR3 C;  3LSK A;  4HG2 A;  2ELJ A;  3OL3 A;  2MD0 A;  4R79 A;  1TT0 A;  4B48 A;  2QKM B;  2LY2 A;  3OL4 A;  2V26 A;  1NG7 A;  2FUG 2;  2K9L A;  2V1N A;  3DLA A;  4CSW A;  4X0G A;  4CUG A;  2ZXI A;  1LFP A;  2JVG A;  2VL8 A;  3RQ4 A;  1PJR A;  4BE2 A;  1LDK B;  3OR1 C;  4CCJ A;  1OLT A;  4XKB A;  5FRO A;  4ANJ A;  3OS1 A;  2AQE A;  4PFP A;  3SZG A;  2Z2S B;  2R7O A;  2WAE A;  2XC7 A;  4BE0 A;  3K70 D;  1WJ5 A;  4F93 B;  2NOJ B;  2M4K A;  4CCO A;  4BJT A;  2M7A A;  2QKL B;  4P1W A;  4CH7 A;  3MKZ A;  2MFZ A;  4HST A;  3DQV C;  3IAS 2;  1D0Z A;  2R7S A;  2VQH A;  2L7K A;  4DJA A;  3NWS A;  5TGT A;  3PNT A;  1G8X A;  4JQF A;  2W00 A;  4XLA A;  1X19 A;  1JI8 A;  3RTR A;  5FRM A;  1BR1 A;  2VPL A;  2VKD A;  2ZFU A;  3DWL E;  2HNH A;  4E7L A;  3HPG A;  3CJQ B;  4XOR A;  4XR6 A;  4KT6 A;  4QPQ A;  4XLF A;  3MKW B;  3OS2 A;  3OYJ A;  1D0Y A;  3G2B A;  3BG7 A;  1ZEL A;  3SEQ A;  4XLE A;  2F4I A;  4FAS D;  2VJ4 A;  3H9J A;  3BG6 A;  1OR7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...