2W1OA

Nmr structure of dimerization domain of human ribosomal protein p2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S ACIDIC RIBOSOMAL PROTEIN P2
publication title Solution Structure of the Dimerization Domain of Ribosomal Protein P2 Provides Insights for the Structural Organization of Eukaryotic Stalk.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 20
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w1oA01
2LBFB 4BEHA 2LBFA 2W1OA 3A1YA 4BEHB
chains in the Genus database with same CATH superfamily
5DYMA 2CQKA 3I53A 3L2CA 1O7FA 4O3MA 4FISA 4Y4RA 2YX7A 3F6VA 1IV8A 1MZBA 2F5EA 2TRTA 1SFXA 4XLFA 1IC8A 2L3DA 4IHWA 2M34A 2L2OA 3O6BB 4L9JA 2GXBA 1Y0NA 5EEHA 3I4MJ 5HNFA 5ICCA 5D5WB 1F9NA 2VKEA 2R7DA 3OYEA 3QPSA 1R1UA 5DM6F 4HZFA 4A93J 5GPAA 4IZZA 2E1OA 1OLTA 3GLXA 1MJBA 3RYRA 2PMZN 5HVQC 4EJOA 4D0PA 2XAQA 2KFDA 2MABA 2AXTC 2HVRA 3F6OA 1AOYA 4KFCA 1A6IA 1U2WA 1DU0A 1TLHB 1T08B 4N9IA 2QKMB 2GAUA 4UNOA 3ECHA 2M7AA 3O3KA 4M3GA 2LDUA 3OIQA 1S72I 1DP7P 2IGMA 2IAIA 4GDFA 1A35A 3EUKL 3K4BA 2LD5A 4XORA 3A02A 2DFFA 3GCMA 3J80K 4EATA 5J47A 3CCLI 5F1RA 4CICA 3ZQGA 3AG4H 2Z33A 1R00A 2EIKH 2LNBA 1X2NA 2L7ZA 3N05A 4WWCA 3C2HA 2E5NA 1BI3A 3BTJA 3IKTA 1R58A 1XB4A 2VXZA 4CGZA 2CQXA 5CQEA 1YG2A 3QU3A 2DQRA 2EV5A 1DPRA 4MEYF 1OISA 2GA2A 3ZN1A 1MD0A 2WC2A 2R5ZB 1IN6A 2A69F 2CS3A 2E35A 2LY1A 2PG4A 3K4CA 3CMEI 3VEPA 3BQYA 1KYZA 5BPIA 3HHGA 2FQ4A 1Z1DA 2A6HF 4LK0F 3QPHA 2UXXA 3L9FA 2EIMH 3G71I 1APLC 4N0BA 2IVMA 2QZ8A 4M9XA 1VTNC 3OYNA 1JJ8C 1IGNA 3VWBA 3F9KA 5EEGA 2UZKA 4HLXA 1LFBA 3FF5A 1LVKA 5LD2C 1W4MA 2XC7A 1S6LA 3G1OA 3CCUI 4M3DA 2A6TA 3KX2A 2V1UA 1WI3A 3FBIB 5DDGA 3LA3A 1HQCA 4P96A 4BQOA 3BG9A 1BI1A 4UUSA 4IOAF 2W1OA 3OS0A 4FE4A 3G1LA 2ELJA 2L01A 3K4KA 1OYWA 1HW5A 1BOAA 1W5CC 3P5JA 4XQFA 1A6QA 1ENHA 4NC6A 3U9GA 2O5RA 5EG0A 1YTYA 5IY5H 2LBFA 2XAFA 2P5KA 1QGPA 2FX0A 2VJ5A 2WV0A 3BCBA 4KN4X 1T38A 1PUFA 2NS8A 4UV8A 1WJBA 2HTSA 4AUXA 5ERIA 1F43A 3HOSA 4A3DJ 2YR2A 1IN4A 1D1BA 1MBFA 2PMHA 4JX5A 3JSOA 5HS8A 3K10A 3ZQLA 3KEQA 2PQ8A 1WRJA 3DPTA 2DOAA 2KDZA 5ILUA 5IYCJ 2P8TA 3LMMA 5K7HA 1W5TA 5FGMA 3JSPA 3RKQA 1WPKA 1SD6A 3BROA 2DK8A 4IQ4A 3DF8A 5M5XJ 5FRNA 2OCEA 3FMQA 4KIBA 2HPMA 1DU6A 3VFZA 1R4NB 4RGRA 2A5YB 5IP6A 3ZQQA 5JI6A 2JT1A 3I3LA 1R1VA 1ZLJA 2XSDC 5FD5A 3CCQI 3GTPJ 1QQIA 3HL2A 2QUFA 1ULYA 1FTTA 4F3QA 3CMMA 3CMAI 2HI3A 2FBIA 1B59A 2YX4A 5FFZA 1V5GA 1ETKA 2BZTA 4I01A 4MGRA 1X3UA 3BR1A 2HYJA 3CESA 1LDDA 3HIFA 3WTSC 1FYKA 3U21A 5BS6A 1U3EM 1G59A 3MZ8A 3H9QA 4WXDA 2WV1A 4ZYAA 1FOYA 2VT3A 4M73A 2AO9A 4XRFA 1O3TA 1JE8A 4RLFA 1FYLA 3FXRA 1ZHFA 2QBYA 5GP9A 3ZQHA 4PSWA 3H1CA 4HDUA 2H09A 1FOKA 2BW3A 1ZELA 4ZYDA 1OKRA 3JRBA 2R3SA 4XRMA 2KIFA 1PP8F 1XDSA 2H6CA 2N8GA 2A3SA 2ELHA 5E18F 5JLXA 3K4NA 2DBBA 2M45A 5EDNA 1BJZA 2P6SA 3E1SA 4AWXB 4RB1A 3KEYA 3L7WA 3W2VA 1B72A 1G2HA 1YRNB 2HVSA 3N4MA 3VB2A 5IT3A 5D6EA 3EUHC 1YOVB 3QQAA 4GXOA 3RYPA 4HQEA 4YIFA 4LB5A 4L5EA 2ZKZA 4KMUX 1FIPA 2CO5A 4DQ2A 4ZDLA 2YS9A 2F48A 5F27A 2KT0A 4MNUA 1SVMA 1TWFJ 2E34A 3T8RA 4KIGA 4OINF 1IXSB 4I2OA 3K4MA 4XK4A 1SD5A 3GF2A 2VQLA 2IA2A 5D5VB 2HXOA 1LKXA 3BC8A 4CCOA 4BQNA 1I27A 4PFOA 1BM9A 2LVSA 2HTJA 4EJWA 4UVBA 1GV2A 4ESBA 3RI4A 4YEJA 1QZEA 1PP7U 1Y1VJ 3VYRB 2HVQA 5K7FA 2HXIA 2WA0A 5B5EC 2VQHA 4DBQA 1A36A 3PJRA 3HSFA 2ZJQF 1R71A 3RIRA 3B02A 2G7HA 3HGYA 1TW2A 3P7NA 5E8GA 1HC8A 3E5XA 2A68F 4JK1X 2FBHA 2RGVA 4GFBA 3HPGA 3BJ6A 1TBXA 3ZMTA 5DCMB 1LUJB 1YLFA 2KISA 2L02A 3ISPA 4ON0A 3ZCOA 3LSMA 4DJAA 4DBRA 5ILVA 1B8IB 5LGNA 3J7AY 2LY9A 4OWRB 1T95A 4A69C 4PJMA 2KZGA 4Z6YA 3IV5A 2CW7A 2ZMEA 2CV0A 1MIJA 1Z77A 3G4SI 1SD7A 2XIGA 3ZMDA 4AIKA 5FKKA 4L18B 3K1PA 2VIXA 2AQFA 1UG0A 1BC7C 3K0LA 4LD5A 3J7YJ 2O7OA 5F1JA 4KN7X 3GFJA 5E3LA 2H6BA 4E70A 5IOYA 2E71A 4IX7A 3JCUC 4DYQA 1K4TA 3A0HC 1AKHB 4E4HA 3ZQ7A 1K83J 5ILSA 2R0QC 3Q0VA 5JHFA 3ZOBA 2F6CA 3A4CA 5IYBJ 5TGTA 3S16J 3ZMSA 5E3NA 4N9HA 1E3PA 2EWNA 1X4OA 4KIFA 3BR2A 3HC7A 1FOWA 1F36A 4ZTFA 2QA4I 2LOOA 4BQQA 3H35A 4XLEA 4BE1A 1VI0A 2FQ3A 2M4KA 5AIQA 1Z6RA 2WAFA 3GO5A 1X1CA 3L09A 3BP8A 3DQVC 1S7EA 1VQ9I 4P9FA 2XKPA 5HS7A 4BUPA 2EFOA 1B6AA 2M87A 3OS1A 5E3OA 1FLIA 1PDNC 2CQNA 5F0FA 4KT5C 4X0GA 4U7BA 4S0HB 3LSJA 5IP7J 3BJOA 5C4XJ 5IP9J 2ID6A 3H0DA 3K2AA 3TP0A 1RETA 1WJFA 2VONA 4I02A 4AIDA 5JR3A 2O6GE 4UV9A 2NVXJ 1XGMA 3FM5A 5GAEJ 2D2WA 3CCJI 1BN5A 4A3KJ 3CZ6A 4XN3A 5EGOA 1RUNA 1X58A 2QWWA 2KJBA 1S8NA 2HQNA 3ZQFA 4A3MJ 3M9AA 5LHIA 2QQ9A 3PIOF 4F93B 3V7CA 2UUZA 3FIWA 3FM3A 1JKOC 3AL0C 2FF4A 1XMXA 1H9GA 3FXUA 4PFPA 1H0MA 1SVLA 5FB2A 3IH4A 3A0BC 2W25A 2ACJA 1HXDA 2DDAA 2XRNA 3HZJA 1WGXA 2QSFX 2M9HA 3BR6A 3HOTA 4XKWA 1XMKA 1F1ZA 4RB3C 5JVGF 1V5FA 3A2KA 2VJIA 3IUOA 1DPUA 1T2KA 2R7FA 1UFMA 4BGDA 2VLAA 1O3SA 2IW5A 1MBHA 4A2UA 3LSTA 4EGYA 1LE8A 3UNGC 4CCLA 1U9OA 2HWVA 3K9TA 3MQ0A 2HOTA 1BIBA 1GV5A 2FNAA 1G4DA 1BOBA 4U0YA 2GIZA 2GOMA 3WHBA 2W84A 3FZVA 2DK5A 1RC9A 4G8XA 4Y33A 3L2WA 4CCKA 2FE3A 5BPDA 1ZREA 1K79A 1SFKA 1Y6IA 3PUFA 2NAZA 1ZG5A 5AONA 2HU9A 3AG3H 3OYHA 2VI6A 4HV6A 4BE2A 2DCEA 1YITI 4AD9A 4IVNA 4E7HA 5EZGA 3S1QJ 3HYIA 1U5TB 3EYIA 3LL7A 2EA2A 2W82A 4MIMA 2DOEA 1WKMA 3GZ5A 3I54A 2V26A 2R93J 4IQJA 3GVAA 3CLOA 1BC8C 2LG4A 1JUSA 2E1MB 1WH5A 3KYLA 3Q9VA 2VE9A 2F4OB 1XG1A 2VL8A 2LTPA 4LK1F 1K4SA 3KP6A 1ZRCA 1IXRC 3WU2C 1GUUA 1QO0D 4HNTA 3JAMK 5M5WJ 4HAMA 1D3YA 3EPZA 3H36A 4XBFA 3CJNA 1T0FA 3AKZA 4Y17A 2L7FP 3D0SA 4TV7A 4ZH4F 3QU6A 2PEXA 4QTRA 3CC2I 1SAXA 1OPCA 4CYCB 2V1XA 3RKWA 5DTDA 1OR7C 3G2BA 1QU3A 4BJ6C 3IL2A 2JN6A 3OS2A 2XAJA 1N78A 2FD5A 1YW9A 2LSOA 2K9NA 3KLNA 2DODA 1S29A 3KCCA 1FBSA 3PIPF 2IGNA 2OF7A 2DA4A 1KGSA 4EJUA 3PO3J 5B1AH 3I56I 1FC3A 3UR3C 3GTMJ 3JW4A 1R7JA 1Y1WJ 3U1DA 4NC7A 4CSWA 2V79A 3GX4X 1EH6A 2P4WA 5D5UB 1IRGA 2DA1A 1YW8A 2PN6A 2AHQA 3SZGA 5LLQA 3RSNA 3S1MJ 2X6YA 1OYIA 1J59A 2IPQX 3I59B 1XCBA 2DMTA 1S9HA 1K78B 2GIVA 2PJPA 4IKFA 1IN8A 2CQ7A 1MNEA 1G3SA 2ECCA 1SFUA 4B3XA 3NRVA 5DEQA 1V3FA 2JA2A 1DUXC 3OYIA 3OYBA 5E8IA 2VT2A 2Q1ZB 3CQZJ 4L9NA 1IO2A 3FWEA 3QP6A 1GT0C 4XIDA 2WAQA 3GEZA 3L00A 2PX9A 3FXKA 2DN0A 2F4IA 3QAHA 1VQLI 4KICA 2XHKA 1XMAA 2MA3A 2BGCA 3S32A 3OYLA 3FHZA 4G6DA 4N4NB 3HEFA 5J8FA 1G3WA 2DU9A 1O3QA 4BY7J 2R92J 3KP5A 1LEAA 4UY8I 3B6AA 2HR3A 1P92A 4NDLA 1DGWY 3HRUA 3GFIA 2VODA 1U5TC 1VZ0A 2R7UA 3V7RA 3H9JA 2KP6A 1ON2A 2KIMA 2XV4S 3ZR8X 2QGUA 4BBRJ 1VQPI 2VUMJ 3DV8A 2JPBA 3H3VK 1XGNA 5HDGA 2DYSH 2ZO4A 3BDDA 2E1MC 2JSCA 3QYBA 2CV2A 4IF4A 4XLHA 1OCCH 4MFDA 1JKRC 1K7AA 2KPMA 5ICEA 2H8WA 1PYVA 2R7SA 1E2XA 3V4GA 1B9MA 2IGKA 4A5MA 1VQKI 4FT8A 4S04A 2Z16A 3M07A 1R1TA 4L9TA 1WJAA 3S2WA 4AU7A 4A3FJ 1I6HJ 3VOEA 5LHGA 1Y56A 3GYHX 1Y8QB 4XKBA 4G9YA 4W97A 1OCTC 1TQIA 2L9RA 2JJ7A 2XAUA 5M3FJ 2K4JA 3RPUD 2X6WA 2IS1A 3H5AA 2L9SA 5ICGA 3WGIA 1ITYA 5CKTA 3LSHA 5FRMA 2ZXIA 4UUVA 1VQNI 1XN7A 3K70D 4ASNA 2Y9ZA 4RGSA 3LSRA 3HOYJ 1F5TA 2OZUA 4A3JJ 4YFKF 2BY2A 1J7KA 4B48A 1Z91A 2JPCA 1IRZA 2ISYA 2M2EA 4HF0A 3F8NA 1YO5C 3A01B 4X1EA 2OD5A 3W2WA 3RQ4A 2QEXI 2IS6A 3HPHA 1P6RA 1KU9A 4FCYA 2LF8A 2JA6J 3ZN0A 2CW0F 1UHMA 3HDDA 1RKWA 2ELKA 3F8MA 2X1CA 2MBFA 3RTRA 3I4NJ 3WODF 3GZNB 4XICA 4HW0A 1IG7A 2FEZA 1KZHA 1MNMC 3M1CA 2JA5J 2CH0A 3RKYA 2BXYA 4OAYA 3I64A 1SMYF 2Q8KA 5GTHC 4HOBA 2L7MP 1MBEA 3PNYA 4WF2A 2O03A 4G7HF 3IAS2 2NVYJ 1UELB 3HKZA 4BXXJ 4MO7A 2BBYA 2BV6A 1IAWA 3HOZJ 4G7OF 3QWLA 4LFUA 2IJLA 1UG2A 3BZ6A 1KQ8A 1KA8A 3Q0UA 5DD4A 3FK7A 4XRSG 2R7TA 3GMEA 5C3EJ 2EZHA 5JFRA 4I76A 4FTHA 4QIWN 1I3QJ 1T39A 2V6CA 4LMYA 2HDCA 2XF5A 2ZXHA 3IH2A 3TP3A 2EFQA 4B1RA 4W1UA 5L3CA 1TL8A 1QRYA 2KRHA 3QYFA 2LKPA 4F7ZA 1GHCA 4L5JA 3KP4A 4G7ZF 2QQBA 4KYWA 2L4MA 2GQQA 4FETA 4GO1A 4E7LA 4GYGA 1HA8A 2IEKA 2KL4A 2JQ7A 3DKXA 2DOFA 1T6SA 3CO7C 1KU2A 3B6CA 3MVPA 9ANTA 3DTKA 3LQRA 4Q5SF 3WTXC 2EJRA 3IKVA 1IUFA 3V8LA 2DMPA 1X3ZB 3CDHA 1TT0A 2O61A 5D8KB 2QYOA 1MJ9A 4ENKA 3CDLA 3SFZA 2R5ZA 1W7PB 4M6YA 2HQRA 3HOWJ 1XSVA 2X1DA 1QPIA 2CWEA 1Z6TA 3WG7H 1FEXA 3NQOA 1W1WE 1TNSA 2W48A 2V1DA 4CYDA 2Y30A 4II3A 4ZDOA 2LFBA 4L0YB 2WY7Q 3E6BA 2FXAA 3JREA 2K3PA 4LIUA 1YS6A 2EQRA 2GOXB 2E7WA 3PFIA 1FMVA 3ONQA 3JTHA 3IRRA 4C2TA 3ERMA 3MKLA 3TO6A 3ABKH 1OMIA 2VKVA 2BVMA 3CTAA 4BJ5C 1NK3P 1G3YA 1SD4A 1OCZH 4RB2C 2QF7A 1D5YA 2CV1A 2ESHA 2MG4A 4G6TB 4LLNA 2W7NA 3EUHA 1NK2P 1Z3YA 5F0CA 5HLGA 5FLXZ 1UAAA 4IHTA 1LJ9A 2LREA 1A5JA 1IDZA 2QVOA 5GADJ 1VQ6I 4HEA2 2STTA 4ENJA 3EDPA 5D4RA 2QM3A 5CQGA 5CPRB 4QLCU 2Y0SN 4OIOF 4DZJA 1MMNA 4LLGF 3TO9A 4AYBA 4PZJA 1YS7A 1FT9A 4XR6A 2CYYA 1BA5A 1MKMA 3C2GA 1BIAA 1FIAA 1POGA 1DDNA 5K5RA 4KNYA 1D0XA 3BG3A 3L1PA 4OOIA 2P81A 4D1QA 2CUZA 1UHSA 3FXJA 4FHTA 1P7JA 1TZLA 4QPQA 4D7NA 2DT5A 1IF1A 2HZTA 1LDJA 2JZYA 2X6OA 4ESFA 5CLSA 2E5ZA 3M1EA 3DBRB 1WSUA 4OIRF 5JVTA 1XGOA 4GGGA 4A6DA 1JKQC 2IXSA 1VF9A 1MH4A 2M30A 3D5RC 1RI7A 2XAGA 3DTEA 5IPAA 2HOAA 2DJNA 2EILH 3ZRGA 4P9UA 3LSPA 4ZC3A 2XAHA 2DMQA 2VC0A 1D1CA 2KHMA 4V19K 3S14J 3CCYA 1ETXA 3KLOA 4B44A 4NBQA 5L3GA 4LG0B 5LEKA 1U8BA 4BDZA 4CCMA 1R5GA 2NOJB 2ZC2A 1SANA 1O4XA 2EB7A 3ROUA 2E1CA 2LR8A 3ZMZA 1W36D 3H0GJ 3TO7A 2V4JC 4J19A 3FDYA 3C7JA 3SDGA 5DS9A 1IUYA 2RQQA 2ZFWA 3CMYA 1AA7A 5E1ZB 5B1BH 4EQQA 1B4AA 5H6QA 2I5UA 3R0JA 3OYFA 4IHXA 4J01A 5DD8A 4RA2A 3GBGA 1VQMI 5E1XA 1ZRDA 2DFEA 3D5LA 3BTIA 1RRJA 4A3IJ 5J4VA 1E3OC 5DUIA 3ERED 1AU7A 4ITVA 5TRDA 2MC4A 3E3VA 1VNDA 3QRFF 5AIPA 5J6XA 1OCPA 2JA8J 1B72B 3CUQB 4D5FA 2GXGA 1H8AC 1D0YA 3CJQB 1U9NA 2P7CB 1USSA 3IAM2 1XX5A 3NWSA 4XKCA 4MEXF 4HDVA 2DA2A 1YRNA 3IH3A 1BW6A 1WQ2A 1BBYA 2EZLA 3NEUA 3REOA 4B09A 1W7PD 3C18A 4Y52J 3Q3SA 4KISA 1SC7A 5EEAA 2JK3A 2X48A 2Z2SB 3TBIA 1G8XA 1WFXA 2KRFA 2O8KA 2R7VA 2PI0A 5GAGJ 5TJJA 5FLXK 1X1PA 2X0LA 1JHHA 4IJAA 5KCMA 2W00A 1YFHA 2MH9A 3PQJA 2WB1A 4GCVA 5IT9Z 1USTA 2XRLA 4CUGA 2Z99A 4LIVA 4HSTA 4BQAA 1NG7A 5E1WA 2V9VA 4AVPA 1TWHJ 4B4CA 3E97A 2VOOA 4HSRA 1Z9CA 4QPOA 2VB6A 3FHNA 5FKNA 5B3SH 1MDMB 1ZGAA 3W6KB 2RC4A 4BU2A 1VQOI 1KQ0A 3HTUA 3ABUA 3O2PE 4RGXA 1VQ7I 5BMZA 1EKEA 2MFZA 4YFNF 2QSHX 2V6EA 4ABZA 5EF6A 3W3CA 4BXUA 3DCFA 5ED4A 1R5ID 3QOEA 5L3BA 3L2QA 3F22A 2YU3A 2XF7A 5DCMA 3J7ZI 2BXZA 3QPLA 1B8IA 5M5YJ 4CCJA 5EJCA 5A2QZ 3LAPA 4EEFG 4JYKA 2R7QA 4M9ZA 3KPHA 4JBAA 3GTOJ 3K1MA 1N75A 2LK2A 2OUMA 2ZNZA 3ELKA 2EFWA 3M4OJ 3BJAA 1ETVA 1IDYA 2JA7J 2NVQJ 3NAUA 5H20A 2LRDA 3ZQCA 2NVUB 2B0LA 2OQGA 5M3MJ 4IHYA 2DMNA 1HCRA 3FMSA 2M0MA 4JQFA 2YSRA 3VYTB 1AKHA 4YRVA 1MGTA 3PL8A 3HSEA 4DGWB 3OYDA 3I0TA 4BKXA 4FE7A 3OYCA 3OV8A 2ZXWH 2R7XA 1STZA 1Z0XA 2DA5A 3KP2A 1Y8RB 5F08A 4UUTA 3LOCA 1ZN2A 3OL3A 4LJZF 5E20A 4Y15A 1HW1A 3G3ZA 4BHBA 3DU5A 3MKYB 5H2FC 2ZNYA 2K02A 1UMQA 3AAFA 3V42A 4P55A 3IWFA 1U8RA 4LLLA 4E7JA 3WTZA 1FNNA 3WGHA 2A05A 5L3EA 3MKWB 2EA4A 3LSGA 3TGNA 2PLYA 1FBQA 2X9DA 3H9GA 4I6ZA 4OIQF 3WU1B 1WJCA 1EA3A 5F0HA 1YJWI 2BY3A 2R5YB 3A03A 4PDKA 3KYCB 1G6NA 2CFXA 2ID3A 2Q2EB 5GPCA 4L5IA 4DYRA 2Q0OA 2AQEA 4GYIA 3I55I 1OR7A 3GTQJ 1Z7UA 4MLOA 3DBHB 3LQQA 5DCFA 3CCVI 4H0EA 2ESNA 4NC8A 2BE5F 3HRMA 1I3AA 5C44J 2JMWA 2KLOA 1FSEA 3JRIA 2BHYA 4RS8A 1B9NA 3FK6A 3F72A 3D5SC 1ZGJA 4EGZA 3C2BA 5D5XB 5FJ8J 1RIOH 3TW6A 3A1YA 1PUEE 2DAOA 3DEUA 4XRSA 4YIIA 4HA8A 3WTYC 1P2FA 3LSIA 3I71A 4HBLA 4IEJA 4HQMA 1SAUA 1EH7A 2K9MA 3S3NA 4KT6A 3W6VA 4HRIA 1J09A 1XPXA 3Q5FA 1O3RA 2DPDA 5D6FA 3SXYA 2IGOA 1R36A 1JT6A 2ADUA 3LFKA 5J1UA 4CHUA 4CO8A 1SFOJ 1R22A 3FXMA 2HFHA 3FXOA 1TWAJ 4G6QA 3VPRA 2Y2ZA 3HTSB 3OYKA 1J2XA 1TP4A 4XM3A 3RQIA 3GW2A 4BEHB 3ASNH 2W24A 3WU0A 5BQTA 2STWA 4KITB 4PJLA 1EH8A 2L9VA 4DYCA 5E3MA 1FP2A 4M3FA 4BHCA 4DZPA 3COAC 1W0TA 2H27A 4UXNA 3F0CA 4OMYA 1U0JA 3HUGB 4HX4A 2CG4A 3RPQA 2PJRB 2ZJ2A 2WTEA 1TT5B 3U1KA 1H88C 5KHDA 1HLVA 4X6AJ 1NHAA 1T56A 1YI2I 2FUG2 4F91B 4NQWB 1TTYA 3DTIA 1U5TA 2IBDA 2GBYA 3EUAA 2IRFG 4KMFA 2CGPA 2C6YA 2FSWA 2DA7A 3RPUA 3BCAA 5HLHA 1XDUA 3S15J 4ENMA 1IZ1A 1GDTA 4PJJA 4RM2A 5CVUA 1WJDA 2OA4A 4XLAA 4HNUA 2DO7A 2XVCA 1LQ1A 1MH3A 1R9TJ 1YIJI 5ICFA 2YU9J 3JRDA 1G3TA 3BOQA 4U88A 1QBJA 2L9NA 2DTZA 1CF7B 3MWMA 2ZB9A 3C1DA 1IV6A 3RJPA 5FLMJ 5F64A 1WJEA 3BWGA 4YIRX 1ERDA 1UCRA 2EZKA 2KMUA 3NWTA 2M3AA 3PM1A 3SEZA 5GTIC 1H89C 2AS5F 2QLZA 3R60A 2VPLA 1JUPA 4CYCA 2OAZA 3DWLE 3FXLA 3KZYA 4G12A 2D1VA 2FBKA 1DP3A 3WG9A 2ME0A 4YG2F 4UVCA 1ZG1A 1TWCJ 1ZTRA 4RBOA 3TOAA 4P1WA 4XN0A 4WXCA 2A5WA 2TCTA 3MFKA 3M8EA 2AXLA 3I5UA 3PSIA 4IO9F 3HB9A 3HOUJ 3WTWC 1HF0A 5HLIA 3V7SA 1V54H 3DPLC 4BDYA 2RVCA 4E7IA 3F21A 3ZMVA 2W57A 5F04A 4CA0A 2HZDA 2WADA 2DW4A 2PBIA 2DMUA 4IL6C 4IPAA 2LC2A 3SEQA 2DA6A 1QPMA 1ZLKA 2RN7A 3I59A 4ZJZA 5FLVA 4NB5A 1E17A 1A31A 4EM1A 4M6VA 5DM7F 2MGQA 1BI0A 1J0RA 3OYMA 2L5QA 4D5CA 3CJRB 5KAIC 5J1YA 4QWQA 1U6GA 2GM4A 5CVJA 3OWTA 1ETOA 1FJLA 3WGGA 1HKTA 2WB1N 3I9V2 1ZARA 1V55H 1RUOA 3T5XA 4R79A 2K86A 3DKWA 2DT7B 3T1BA 1LB2A 1EJ9A 2EIJH 3HJEA 2CU7A 3ZMUA 3O8GA 1XC5A 2VC1A 3K1NA 4EM2A 2WAEA 5J8CA 5LRSA 4OMZA 2E2HJ 2K5CA 1GVJA 2VN2A 5JHUA 1TWGJ 2ME6A 3E6MA 5CVVA 3L2RA 3AG2H 3SYTA 3VSKA 1X4PA 3K70C 2R7RA 4OIPF 1HBXG 3LA2A 3F3XA 1FYMA 3RZDJ 2Y48A 3K2ZA 2RNGA 4IRHA 4I98B 5TISC 1WHUA 2VXDA 3J80Z 2HEOA 3TDZC 2Y9YA 5HNHA 2IT0A 4FQGA 5KAFC 2JSPA 3CCMI 1BR4A 1Z05A 2L0KA 1FX7A 1HSTA 1D5VA 3X2QH 4HLYA 4Y3OA 3MN2A 3IC7A 1SEUA 3KP7A 4BAYA 1S3JA 4HF2A 2YUSA 1XSDA 4IRGA 3CP2A 3HRTA 1D1AA 1KYWA 4OU0A 3SJMA 2LKXA 1KONA 3PUBA 2RKHA 2FMYA 4Y7NJ 2LY2A 1TNTA 3T8TA 1ZG3A 3GFMA 3BG6A 5FKMA 2ZFUA 2DQLA 3MZYA 4V2FA 1FTZA 2JUCA 1I5ZA 3GLLA 4G94A 4MQ9F 4F52A 1XD7A 4EM0B 5LGUA 3J81Z 3ABLH 3VDXA 4A0YA 1DQUA 3GZ6A 2XUBA 2EFNA 2M7BA 2CUFA 1AHDP 2I10A 3S1NJ 3A01A 4D9JA 3E0JB 5KNLA 3C3WA 2DFHA 1FWZA 3CP8A 3OMYA 2DLLA 2L4AA 2EBIA 5BOXA 3MMYB 4LG3A 4II2A 3DP7A 4AVZA 3ECOA 1N77A 3CUOA 1WZ2A 2MLGA 1OCRH 3DLLF 3BTLA 3CD6I 2M4GA 3H5NA 4LB6B 3FMRA 1D8JA 2L54A 1VFCA 2QCOA 3BPXA 3NARA 4PJ0C 1WCMJ 2IS4A 3S17J 3PNTA 4GRIA 4PJNA 1K6YA 2K7LA 3OY9A 4C9YA 4C3HJ 5CVIA 2JRTA 3JRFA 2RV8A 2DT6A 1Z21A 4Q47A 2OQRA 1B1BA 2JTVA 2ETHA 1FPQA 2HDWA 2VASA 4IHSA 2GA1A 2KKOA 4D7MA 3FKJA 1MMGA 3ESWB 2XGDA 2HGCA 3V8KA 1MBJA 2XASA 3M8JA 2P7VB 1ZGWA 3MKZA 4RGUA 3G73A 3CF2A 3H92A 4BL0B 1YX3A 4XLNF 4ZYHA 3KYDB 3WE3A 2HQAA 1GXQA 2X85A 2J5PA 1BL0A 1BJAA 2FJ1A 4BJTA 4Y13A 1X1DA 3WTUC 1ZH5A 3GTLJ 3BPVA 3CCRI 3W6JB 2Z3YA 4M72A 5D8LB 1T98A 2M8EA 3E6DA 2XF6A 4RAFA 2HKOA 4L9VA 3DLAA 2QQAA 1GXPA 4E7KA 2DTRA 5FD6A 2GZWA 4EMSA 5LFAA 4RM3A 2HYFA 4XOTA 4NHJA 2R7OA 1W7PA 3LSKA 4MFEA 2UWMA 4A0XA 2BY0A 4O6JA 1K6OA 2EK5A 2M5WA 3AFHA 1YQAA 2OBPA 3MEXA 3LNQA 1MMAA 1X1BA 3S2HJ 4UUSB 1ETWA 4WCGA 1I1GA 1MW7A 3J81K 1QZYA 2MD5A 3TOBA 2DPUA 4AM3A 3KEOA 1OCOH 4DOZA 2E1NA 3CC7I 1HOMA 3CLQA 2XGCA 2UXNA 1QA6A 5IOZA 5EG0B 5FROA 2O9LA 2LBFB 2HS5A 1PUFB 2FNPA 3OIPA 1CQTA 2FRHA 1ZAOA 2HPIA 4RAZA 2ZXJA 2BHZA 3FBNB 4NNJA 4B3AA 2XPVA 3I4PA 3BZKA 2LMDA 2DA3A 3HG9A 3V8JA 4M74A 2E2IJ 3ZP5A 1P7IA 1J9IA 3BLYA 4I0AA 4S05A 2FOWA 2BEOA 2LYCA 4YELA 1GVDA 3DPUA 5K7ZA 4EJVA 4AC0A 2P5LC 3N97A 3IRQA 2DXIA 1IRFA 1W36C 3E6CC 4ETSA 5B66C 3B73A 1LPQA 2F5VA 3JRHA 5KVRA 1YYVA 1ZKGA 1YX5A 3MZHA 3M3YJ 3OYJA 4HF1A 3K6GA 4UVAA 1WVRA 3CDIA 3BQZA 4IRIA 1L3LA 1SFEA 3BR3A 3QOPA 1RZ4A 1KQ9A 2K9LA 2V9PA 2G9WA 3BR0A 1JT0A 1JI8A 4CH7A 3BZCA 4KUMA 1MSFC 2WAQN 3R0AA 2DFIA 4U0WA 1U78A 1XCVA 3BR5A 2MYSA 1TQPA 1MJAA 1LDKB 4E7ZA 1MBGA 4PCQA 2HOSA 2LKSA 2LP0A 2A6EF 2XKOA 1O57A 3S3OA 2D5VA 1XS9A 2IA1A 3JRGA 2PFBA 3H5RA 3R6SA 2CSOA 4EVIA 1KU3A 1YW7A 4XOPA 2CFOA 3GXOA 4CCNA 3HRSA 2NNYA 2JRMA 2KDOA 3OR2C 5HLTA 2QBYB 4LG0A 4L0ZB 2NRAC 2BOLA 3OYAA 2O0YA 1FY7A 1J5YA 2IA0A 3IHUA 3HOVJ 2BW3B 3MAJA 3CC4I 3JR9A 3DU6A 3PSFA 5DUKA 1BW5A 2H1KA 2FU4A 1P4XA 2MW8A 1FSHA 2FMLA 3VYSB 2DYRH 1UB9A 5C4JJ 1TC3C 2O3FA 4ENNA 3BG7A 3G1MA 3GTJJ 3S8PA 3HHHA 5J40A 1YE9A 2D45A 5E79C 2LH9A 1RKTA 4LITA 2ECBA 3RKXA 2F5CA 1ON1A 2OCCH 5LHHA 3CF5F 5L3DA 2XPUA 4F55A 4ZZDA 1JXSA 2W85A 1EF4A 3KZIC 3L2VA 2K4BA 2L7KA 2KJCA 2WBMA 3GFLA 3CUQA 2EV6A 2Y69H 1YHQI 2JWTA 2COBA 3RZOJ 2V9KA 5H6RA 3F8CA 3HBLA 4YFXF 3KZZA 1W5SA 3DXJF 4I09A 1ZK8A 1YIOA 4WXHA 3SZTA 4XSXF 1FZPB 2DJIA 3EQLF 3ML6A 4MTEA 1Y0UA 3SDBA 1LFUP 1VQ5I 4QSHA 1E0EA 2R7WA 1YJNI 3P9CA 3OR1C 4P5OA 2QQ8A 1LFPA 4RAGA 1REPC 4XNFA 1ETYA 1TQMA 2F4MB 3KP3A 2JUGA 5CYVA 2GLOA 3DBLB 5J3LA 1QHHD 3EYYA 2X4HA 1X3WB 4FX4A 1QHGA 5KK1A 1HKQA 1Z3XA 4HPQA 3S1RJ 2K27A 3KE2A 2G7UA 4WK8F 2Z1DA 1NTCA 1OFCX 1MDMA 1AWCA 3ULQB 4RDUA 3AL0B 2XPWA 2Y0MA 1IN5A 2H1LA 5J4YA 3M8FA 2WWYA 2ZMEB 4KA4A 2NXNB 2NNNA 3QP5A 2OJED 3EETA 2ZSHB 3ASOH 3PQKA 2H8RA 3SQNA 3S93A 2ZCWA 4XL9A 2VBWA 1UJ8A 3HKZN 3L2UA 1MNDA 5BNGA 2P0WA 2BYVE 1ZR4A 3ABMH 5EZHA 2OV7A 1BR1A 5K5QA 4U7DA 4BXFA 3D1NI 2KZVA 3KIOA 5L3FA 4M6XA 2A61A 1XTAA 3VODA 1X2MA 2OU2A 1JTXA 1HSJA 4H4KC 2JVHA 1XSXA 2V1NA 1ONVA 1I6XA 5CVRA 2EFPA 1JGSA 1WJ5A 2E7XA 5FKLA 2NOGA 3LFUA 1I1SA 1J75A 2QENA 3OSFA 3P9IA 3SHFA 2NS0A 3GUDA 4Z2YA 4ZTJA 2HDDA 4JP0A 1PJRA 3CUQC 3DFGA 4A5NA 1UZCA 5FO5A 3ZPLA 3FKIJ 2BVLA 3F8BA 4I99C 3AG1H 1EV7A 2JVGA 3JAMZ 1W0UA 4DW6A 1RR7A 2XSJC 1E3HA 1N25A 4ESJA 3ABTA 2E19A 5DV5A 4M3BA 1BR2A 4U0VA 4UHTA 3RDIA 1P4AA 2OPTA 1L0OC 2XB5A 3HM5A 5LRRA 3WTVC 2M1BA 2RNJA 2DI3A 3IWZA 2FA5A 1MMSA 2A07F 2UV1A 5CJ9A 2P5VA 3HSRA 1R49A 1X1AA 3WTTC 2GXAA 1I39A 2D1HA 3E5QA 5FKOA 2VBZA 4C2UA 1P4WA 4XLPF 2R5YA 4M3EA 5EGOB 2X1EA 2P6TA 3LA7A 4ZYEA 4AIHA 1FBUA 2EZIA 2Q2EA 3LAJA 5IT9K 2CJJA 4R1HA 2LF7A 3K7AJ 4LOCA 1OQYA 1T33A 2EINH 5HOOA 1ZYRF 1KU7A 3H3ZA 3MD2A 3ZXSA 2VKDA 4ZZLA 1Y39A 1K61A 5GAHJ 2W4SA 4XSZF 3QYEA 5HDNA 1MBKA 3JTGA 2PMZA 5F6FA 4IHVA 4JX4A 2CRGA 4BNCA 2RAEA 3GTKJ 4MTDA 1Z67A 4DIQA 2Z9OA 2Y75A 4HX8A 4MQVA 1IRXA 3P9KA 1LE8B 2I8DA 5HS9A 2ZMEC 1WWXA 2RQPA 5FFXA 4AYBN 2H94A 1QZZA 4OAZA 4V2GA 1LNWA 2B7EA 3TQNA 2KQRA 5EYRA 4HX7A 1R5HA 1IW7F 1ZRFA 4PGGA 4CZCA 2OTJI 2KIUA 5A2QK 4N4OB 3T0YA 1ORKA 2HKXA 4JX6A 1O7LA 4A3EJ 3WHCA 3OL4A 1JHFA 2COMA 1SMTA 4I0BA 4A0ZA 1DGRM 1WH7A 2KRCA 2EH3A 1S5LC 2CUJA 3DKYA 1CGPA 4XONA 4R8HA 2HNHA 4A3CJ 3TDUC 3FXQA 2XGEA 1JTYA 3PNVA 4BEHA 2V7FA 2QKLB 3VSLA 2K85A 2MH2A 2LLKA 2OC6A 4HYEA 1F4KA 2R7ZJ 3K4JA 4EJTA 1Q1HA 3HUGA 2PJRA 3W2AA 3CO6C 4KJZA 2IP2A 1VQ8I 3LWFA 2M0CA 4Q4ZF 4RAYA 3Q9SA 2HYGD 2G0EA 4NQWA 4EV0A 2CW8A 2DDBA 4CDGA 2CUEA 1M1EB 1WI9A 2ZJPF 4ZYGA 5HODA 1D8KA 1QVUA 2E2JJ 2XB0X 1H9TA 4BS9A 2VE8A 1RESA 2K3FA 4PUSA 2VJJA 3I58A 4HV5A 1I50J 4O5VA 3DEWA 3OIOA 3JRAA 2RREA 2YPRA 1LVAA 4C3IJ 4A3LJ 2EV0A 3SFIA 3PFYA 3S3MA 3TKYA 1FMWA 2MLKA 3E7LA 3OSGA 5J1RA 1UHWA 1CF7A 3G6EI 1GLNA 3OOPA 1YJ9I 3BT9A 2VPRA 3TMOA 2Z5UA 3HXLA 2WY8Q 4A12A 2CQQA 1RPWA 2F5DA 4E7SA 3H3UA 2K9QA 2CMPA 4UB6C 4FASD 2QSGX 2VBYA 4RMNA 2Y0SA 3BTCA 3BY6A 4K2EA 1HKSA 2K40A 4C2MJ 4C30A 4M71A 5K1YA 4BACA 2GWRA 1Z7LA 1PVEA 3BG5A 1ETQA 2XROA 4M9SA 2OTLI 3PO2J 4AIJA 4UB8C 1V5EA 1K78A 4F92B 4CZZA 1FOXA 1ODDA 1OYYA 4RLQA 2B63J 2IS2A 4A3BJ 1ZQ3P 1X19A 2M8GX 4BE0A 5K5OA 3F23A 2BY1A 4B43A 3KETA 4XKVA 4CXFA 3Q0WA 3QODA 4C3JJ 1C0WA 2ZSIB 4A3GJ 2MSYA 1XGSA 3J7AO 3SZPA 2B9SA 3M7GA 2O8XA 4PK4A 4J00A 2TDXA 1T8IA 5D4SA 1MMDA 2X51A 2VKHA 4A6EA 1QNTA 2XGXA 4B8XA 2NVTJ 3F8FA 3GWZA 1A04A 3K4LA 4NUBA 4ANJA 1JGGA 3CCEI 3IP4B 3QPTA 4HG2A 2J5OA 3R4KA 1JJ6C 1HW2A 4DNCA 3CCSI 2ISZA 2E60A 2MC3A 4U87A 1R4MB 1OJLA 3UKGA 3TW7A 1S7OA 1RNLA 4JOMA 4RB0A 4I7HA 5JLWA 2F5FA 1VQ4I 2KIQA 4E6KG 3ZGKA 5LBQA 3HOXJ 2ICWG 3O8HA 1R6RA 2MD0A 1BI2A 4PSXA 2RDPA 3R61A 1IN7A 2NS7A 4BHPA 1S7AA 2OZ6A 4FX0A 2F2EA 2NYXA 1T0FC 3E5UA 1ZR2A 3ZQIA 1RR8C 3OOUA 2XDVA 4WX9A 4IOCF 4HNVA 3FX3A 2X6XA 3JRCA 4XMYA 4ZDPA 3HGGA 1NG6A 1FP1D 2ZBKA 2HQ5A 4BY1J 4BBSJ 5LEJA 6PAXA 1LEBA 1Q1VA 1JUMA 1R23A 1QVTA 2VQGA 2ZJRF 3TL4X 4IXAA 1TW3A 2K9SA 4MHGA 2E36A 1V4RA 4Q48A 3DEEA 2VJ4A 5IYDJ 3K69A 4B47A 1MSEC 2FOKA 3RCOA 1HDDC 2Y31A 3GTGJ 3S2DJ 4KDPA 1IJWC 3TEDA 4BH9A 1HDPA 5HDKA 2EPFA 2PMUA 1P9QC 3WE2A 4BYYA 3VYUB 3FISA 3U2RA 2VQCA 4XLCA 1JKPC 3KFWX 3CJTB 1SVOA 1IXCA 5LGTA 1D0ZA 2VOPA 3MCZA 2HOEA 4LGWA 4PGHA 5E17F 2R4GA 1ACIA 2VBXA 1NH3A 3OYGA
chains in the Genus database with same CATH topology
1OR7C 2K9LA 3G2BA 4Y4RA 4BJ6C 1QU3A 1JI8A 3VYTB 4CH7A 4YRVA 3OS2A 1N78A 3PL8A 4DGWB 3OYDA 4XLFA 2MYSA 3OYCA 2L2OA 2R7XA 2IGNA 1LDKB 4E7ZA 5HNFA 3OL3A 3UR3C 3DU5A 3MKYB 3OYEA 3S3OA 4NC7A 4CSWA 3V42A 3H5RA 4IZZA 3SZGA 4E7JA 1OLTA 3RSNA 2X6YA 4XOPA 5HVQC 2CFOA 4CCNA 2MABA 2KDOA 3MKWB 3LSGA 3OR2C 5HLTA 2HVRA 2BOLA 3OYAA 3H9GA 1S9HA 4IKFA 1MNEA 2BW3B 1WJCA 1EA3A 2QKMB 3DU6A 3PSFA 4B3XA 2JA2A 2M7AA 3OYIA 3VYSB 3OYBA 3OIQA 2Q2EB 2Q1ZB 2AQEA 2IGMA 3BG7A 3EUKL 3S8PA 3K4BA 4MLOA 4XORA 1YE9A 4EATA 2LH9A 4LITA 2WAQA 4NC8A 2KLOA 2F4IA 4F55A 3N05A 3C2HA 3D5SC 2E5NA 3S32A 3OYLA 4N4NB 2VXZA 5CQEA 3A1YA 3L2VA 2L7KA 2WBMA 1DGWY 3LSIA 2V9KA 1VZ0A 2R7UA 2CS3A 2KP6A 2LY1A 3H9JA 3K4CA 3S3NA 1SAUA 2K9MA 4KT6A 4HRIA 3ZR8X 2DJIA 4JQFA 3SDBA 1J09A 1E0EA 2R7WA 2IGOA 3QYBA 2E1MC 3OR1C 4P5OA 3OYNA 2CV2A 1LFPA 4XLHA 3VWBA 4XNFA 3F9KA 2KPMA 2JUGA 1PYVA 2R7SA 1LVKA 5LD2C 2IGKA 2XC7A 1QHHD 3OYKA 2A6TA 3KX2A 1QHGA 3FBIB 4XM3A 2Z16A 1Z3XA 4HPQA 1WJAA 4AU7A 4BEHB 4BQOA 4KITB 4PJLA 1Y56A 2W1OA 2Z1DA 4XKBA 3OS0A 1U0JA 2ELJA 2XAUA 3HUGB 2PJRB 3AL0B 3RPUD 3K4KA 2X6WA 2IS1A 5KHDA 3H5AA 2L9SA 4XQFA 2FUG2 3LSHA 4NQWB 5CKTA 3DTIA 4F91B 2O5RA 5FRMA 2ZXIA 3EUAA 2LBFA 2ZSHB 2VJ5A 3BCBA 3K70D 3S93A 1WJBA 3BCAA 4XL9A 3HOSA 3L2UA 1MNDA 4PJJA 4RM2A 2P0WA 1WJDA 4XLAA 4HNUA 1D1BA 4B48A 2OV7A 1BR1A 4BXFA 2KZVA 3K10A 2L9NA 3DPTA 2DOAA 3RQ4A 3W2WA 4H4KC 2IS6A 3LMMA 3HPHA 2JVHA 2V1NA 1WJEA 1WJ5A 1ERDA 4IQ4A 3SEZA 2KMUA 3NWTA 2M3AA 3LFUA 5FRNA 2VPLA 2HPMA 3DWLE 1DP3A 2X1CA 3ZQQA 4ZTJA 3RTRA 3I3LA 1PJRA 3HL2A 4P1WA 4XN0A 4F3QA 3CMMA 3M1CA 2A5WA 2BVLA 3PSIA 2CH0A 4OAYA 1V5GA 2JVGA 2XSJC 3CESA 3PNYA 3DPLC 4BDYA 3IAS2 3U21A 4E7IA 1UELB 1BR2A 1G59A 3HKZA 3H9QA 4CA0A 2HZDA 2WADA 4ZYAA 2LC2A 3SEQA 4RLFA 4ZJZA 2UV1A 4PSWA 2R7TA 3OYMA 1X1AA 2L5QA 2BW3A 1ZELA 3CJRB 4C2UA 3OWTA 2X1EA 3I9V2 2XF5A 2ZXHA 4R79A 2DT7B 2KRHA 3K4NA 3QYFA 5HOOA 3E1SA 3KEYA 3W2VA 3MD2A 4FETA 3ZXSA 2HVSA 2VKDA 4E7LA 1HA8A 2W4SA 2KL4A 3QYEA 3DKXA 3EUHC 2PMZA 3DTKA 2WAEA 2K5CA 4ZDLA 4DIQA 3L2RA 1IRXA 1TT0A 2I8DA 3SYTA 3VSKA 1X4PA 3K70C 2R7RA 4OAZA 3K4MA 2KQRA 2X1DA 2VQLA 1LKXA 3BC8A 4CCOA 4BQNA 2RNGA 4PFOA 4II3A 4CZCA 4ZDOA 4N4OB 2VXDA 5HNHA 2WY7Q 2JSPA 4YEJA 1BR4A 3OL4A 3VYRB 2K3PA 2HVQA 2WA0A 1DGRM 4LIUA 2VQHA 4DBQA 2GOXB 4Y3OA 2KRCA 3PJRA 2CUJA 3DKYA 1FMVA 3ONQA 4XONA 4C2TA 2HNHA 2BVMA 4BJ5C 3HPGA 3PNVA 4BEHA 3CP2A 2V7FA 2QKLB 1D1AA 3VSLA 2CV1A 4G6TB 3ZCOA 4DJAA 4DBRA 2W7NA 1KONA 2OC6A 3LSMA 3J7AY 3PUBA 3K4JA 1Z3YA 1T95A 4OWRB 1UAAA 2LY2A 2LREA 4PJMA 4HEA2 3W2AA 2PJRA 4KJZA 5CQGA 5CPRB 1MMNA 3BG6A 2CW7A 2ZFUA 2CV0A 2CW8A 4AYBA 4XR6A 3C2GA 2VIXA 2AQFA 4F52A 1UG0A 4BS9A 1D0XA 3VDXA 1DQUA 2VJJA 4PUSA 4D1QA 2CUZA 4IX7A 2M7BA 2RREA 1TZLA 4QPQA 4E4HA 4D9JA 5JHFA 3E0JB 2F6CA 3A4CA 3PFYA 1FMWA 2E5ZA 5TGTA 5KNLA 3S3MA 3CP8A 3OMYA 1GLNA 1X4OA 3MMYB 2IXSA 3TMOA 4LG3A 4II2A 3D5RC 3HC7A 3HXLA 4AVZA 3DTEA 1N77A 2WY8Q 4ZTFA 2LOOA 3ZRGA 4BQQA 3H35A 4E7SA 4XLEA 2M4GA 3H5NA 4ZC3A 4BE1A 2M4KA 1D1CA 2CMPA 2WAFA 1X1CA 2KHMA 4FASD 3DQVC 4RMNA 4BUPA 2Y0SA 2IS4A 4B44A 3PNTA 4GRIA 4PJNA 1K6YA 3OS1A 4C30A 4BDZA 3OY9A 4CCMA 4BACA 2NOJB 4X0GA 1Z7LA 4C9YA 1W36D 4U7BA 2V4JC 3FDYA 1V5EA 2DT6A 4F92B 2RQQA 1Z21A 1AA7A 2HDWA 2VASA 4RLQA 3FKJA 3OYFA 4J01A 1MMGA 2IS2A 3GBGA 3H0DA 1X19A 3M8JA 4BE0A 1WJFA 4B43A 3MKZA 4XKVA 3D5LA 3CF2A 3QODA 2ZSIB 4BL0B 1YX3A 4PK4A 4J00A 4ITVA 2MC4A 3CZ6A 4XN3A 1MMDA 2X51A 2VKHA 2HQAA 2X85A 4NUBA 3K4LA 4ANJA 4BJTA 1D0YA 3CJQB 4F93B 1X1DA 2UUZA 3IAM2 3IP4B 4HG2A 3AL0C 4PFPA 3NWSA 4XKCA 2E60A 2XF6A 4U87A 3HOTA 4XKWA 4JOMA 3DLAA 3A2KA 1V5FA 2VJIA 3IUOA 4KISA 4E7KA 4BGDA 2VLAA 3TBIA 2Z2SB 4E6KG 3ZGKA 5LFAA 1G8XA 1WFXA 4RM3A 2R7VA 3UNGC 1R6RA 2MD0A 4PSXA 4CCLA 4XOTA 2R7OA 3LSKA 5KCMA 1BOBA 2W00A 2GOMA 2UWMA 1T0FC 2WB1A 4Y33A 3L2WA 4CCKA 3AFHA 4CUGA 3OOUA 1MMAA 1X1BA 2XDVA 4LIVA 4HSTA 1SFKA 1Y6IA 1NG7A 2X6XA 4XMYA 4ZDPA 2HU9A 4HSRA 4QPOA 1NG6A 2VB6A 3FHNA 3OYHA 1MW7A 4BE2A 2DCEA 4BU2A 4E7HA 2VQGA 4DOZA 3TL4X 2MFZA 2V6EA 5FROA 3LL7A 3W3CA 3DEEA 2LBFB 2VJ4A 3QOEA 3L2QA 2W82A 3OIPA 4B47A 3RCOA 2XF7A 2HPIA 4NNJA 3FBNB 2V26A 4IQJA 3HG9A 2LG4A 2E1MB 3BLYA 4CCJA 2LYCA 4YELA 3DPUA 3KYLA 2VL8A 2R7QA 1P9QC 3VYUB 2DXIA 2VQCA 4XLCA 4HNTA 1W36C 1N75A 2OUMA 2F5VA 3EPZA 2LRDA 1D0ZA 1YX5A 3AKZA 3OYJA 3K6GA 2R4GA 2M0MA 3OYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF B;  4BEH A;  2LBF A;  2W1O A;  3A1Y A;  4BEH B; 
#chains in the Genus database with same CATH topology
 5DYM A;  2CQK A;  3I53 A;  3L2C A;  1O7F A;  4O3M A;  4FIS A;  4Y4R A;  2YX7 A;  3F6V A;  1IV8 A;  1MZB A;  2F5E A;  2TRT A;  1SFX A;  4XLF A;  1IC8 A;  2L3D A;  4IHW A;  2M34 A;  2L2O A;  3O6B B;  4L9J A;  2GXB A;  1Y0N A;  5EEH A;  3I4M J;  5HNF A;  5ICC A;  5D5W B;  1F9N A;  2VKE A;  2R7D A;  3OYE A;  3QPS A;  1R1U A;  5DM6 F;  4HZF A;  4A93 J;  5GPA A;  4IZZ A;  2E1O A;  1OLT A;  3GLX A;  1MJB A;  3RYR A;  2PMZ N;  5HVQ C;  4EJO A;  4D0P A;  2XAQ A;  2KFD A;  2MAB A;  2AXT C;  2HVR A;  3F6O A;  1AOY A;  4KFC A;  1A6I A;  1U2W A;  1DU0 A;  1TLH B;  1T08 B;  4N9I A;  2QKM B;  2GAU A;  4UNO A;  3ECH A;  2M7A A;  3O3K A;  4M3G A;  2LDU A;  3OIQ A;  1S72 I;  1DP7 P;  2IGM A;  2IAI A;  4GDF A;  1A35 A;  3EUK L;  3K4B A;  2LD5 A;  4XOR A;  3A02 A;  2DFF A;  3GCM A;  3J80 K;  4EAT A;  5J47 A;  3CCL I;  5F1R A;  4CIC A;  3ZQG A;  3AG4 H;  2Z33 A;  1R00 A;  2EIK H;  2LNB A;  1X2N A;  2L7Z A;  3N05 A;  4WWC A;  3C2H A;  2E5N A;  1BI3 A;  3BTJ A;  3IKT A;  1R58 A;  1XB4 A;  2VXZ A;  4CGZ A;  2CQX A;  5CQE A;  1YG2 A;  3QU3 A;  2DQR A;  2EV5 A;  1DPR A;  4MEY F;  1OIS A;  2GA2 A;  3ZN1 A;  1MD0 A;  2WC2 A;  2R5Z B;  1IN6 A;  2A69 F;  2CS3 A;  2E35 A;  2LY1 A;  2PG4 A;  3K4C A;  3CME I;  3VEP A;  3BQY A;  1KYZ A;  5BPI A;  3HHG A;  2FQ4 A;  1Z1D A;  2A6H F;  4LK0 F;  3QPH A;  2UXX A;  3L9F A;  2EIM H;  3G71 I;  1APL C;  4N0B A;  2IVM A;  2QZ8 A;  4M9X A;  1VTN C;  3OYN A;  1JJ8 C;  1IGN A;  3VWB A;  3F9K A;  5EEG A;  2UZK A;  4HLX A;  1LFB A;  3FF5 A;  1LVK A;  5LD2 C;  1W4M A;  2XC7 A;  1S6L A;  3G1O A;  3CCU I;  4M3D A;  2A6T A;  3KX2 A;  2V1U A;  1WI3 A;  3FBI B;  5DDG A;  3LA3 A;  1HQC A;  4P96 A;  4BQO A;  3BG9 A;  1BI1 A;  4UUS A;  4IOA F;  2W1O A;  3OS0 A;  4FE4 A;  3G1L A;  2ELJ A;  2L01 A;  3K4K A;  1OYW A;  1HW5 A;  1BOA A;  1W5C C;  3P5J A;  4XQF A;  1A6Q A;  1ENH A;  4NC6 A;  3U9G A;  2O5R A;  5EG0 A;  1YTY A;  5IY5 H;  2LBF A;  2XAF A;  2P5K A;  1QGP A;  2FX0 A;  2VJ5 A;  2WV0 A;  3BCB A;  4KN4 X;  1T38 A;  1PUF A;  2NS8 A;  4UV8 A;  1WJB A;  2HTS A;  4AUX A;  5ERI A;  1F43 A;  3HOS A;  4A3D J;  2YR2 A;  1IN4 A;  1D1B A;  1MBF A;  2PMH A;  4JX5 A;  3JSO A;  5HS8 A;  3K10 A;  3ZQL A;  3KEQ A;  2PQ8 A;  1WRJ A;  3DPT A;  2DOA A;  2KDZ A;  5ILU A;  5IYC J;  2P8T A;  3LMM A;  5K7H A;  1W5T A;  5FGM A;  3JSP A;  3RKQ A;  1WPK A;  1SD6 A;  3BRO A;  2DK8 A;  4IQ4 A;  3DF8 A;  5M5X J;  5FRN A;  2OCE A;  3FMQ A;  4KIB A;  2HPM A;  1DU6 A;  3VFZ A;  1R4N B;  4RGR A;  2A5Y B;  5IP6 A;  3ZQQ A;  5JI6 A;  2JT1 A;  3I3L A;  1R1V A;  1ZLJ A;  2XSD C;  5FD5 A;  3CCQ I;  3GTP J;  1QQI A;  3HL2 A;  2QUF A;  1ULY A;  1FTT A;  4F3Q A;  3CMM A;  3CMA I;  2HI3 A;  2FBI A;  1B59 A;  2YX4 A;  5FFZ A;  1V5G A;  1ETK A;  2BZT A;  4I01 A;  4MGR A;  1X3U A;  3BR1 A;  2HYJ A;  3CES A;  1LDD A;  3HIF A;  3WTS C;  1FYK A;  3U21 A;  5BS6 A;  1U3E M;  1G59 A;  3MZ8 A;  3H9Q A;  4WXD A;  2WV1 A;  4ZYA A;  1FOY A;  2VT3 A;  4M73 A;  2AO9 A;  4XRF A;  1O3T A;  1JE8 A;  4RLF A;  1FYL A;  3FXR A;  1ZHF A;  2QBY A;  5GP9 A;  3ZQH A;  4PSW A;  3H1C A;  4HDU A;  2H09 A;  1FOK A;  2BW3 A;  1ZEL A;  4ZYD A;  1OKR A;  3JRB A;  2R3S A;  4XRM A;  2KIF A;  1PP8 F;  1XDS A;  2H6C A;  2N8G A;  2A3S A;  2ELH A;  5E18 F;  5JLX A;  3K4N A;  2DBB A;  2M45 A;  5EDN A;  1BJZ A;  2P6S A;  3E1S A;  4AWX B;  4RB1 A;  3KEY A;  3L7W A;  3W2V A;  1B72 A;  1G2H A;  1YRN B;  2HVS A;  3N4M A;  3VB2 A;  5IT3 A;  5D6E A;  3EUH C;  1YOV B;  3QQA A;  4GXO A;  3RYP A;  4HQE A;  4YIF A;  4LB5 A;  4L5E A;  2ZKZ A;  4KMU X;  1FIP A;  2CO5 A;  4DQ2 A;  4ZDL A;  2YS9 A;  2F48 A;  5F27 A;  2KT0 A;  4MNU A;  1SVM A;  1TWF J;  2E34 A;  3T8R A;  4KIG A;  4OIN F;  1IXS B;  4I2O A;  3K4M A;  4XK4 A;  1SD5 A;  3GF2 A;  2VQL A;  2IA2 A;  5D5V B;  2HXO A;  1LKX A;  3BC8 A;  4CCO A;  4BQN A;  1I27 A;  4PFO A;  1BM9 A;  2LVS A;  2HTJ A;  4EJW A;  4UVB A;  1GV2 A;  4ESB A;  3RI4 A;  4YEJ A;  1QZE A;  1PP7 U;  1Y1V J;  3VYR B;  2HVQ A;  5K7F A;  2HXI A;  2WA0 A;  5B5E C;  2VQH A;  4DBQ A;  1A36 A;  3PJR A;  3HSF A;  2ZJQ F;  1R71 A;  3RIR A;  3B02 A;  2G7H A;  3HGY A;  1TW2 A;  3P7N A;  5E8G A;  1HC8 A;  3E5X A;  2A68 F;  4JK1 X;  2FBH A;  2RGV A;  4GFB A;  3HPG A;  3BJ6 A;  1TBX A;  3ZMT A;  5DCM B;  1LUJ B;  1YLF A;  2KIS A;  2L02 A;  3ISP A;  4ON0 A;  3ZCO A;  3LSM A;  4DJA A;  4DBR A;  5ILV A;  1B8I B;  5LGN A;  3J7A Y;  2LY9 A;  4OWR B;  1T95 A;  4A69 C;  4PJM A;  2KZG A;  4Z6Y A;  3IV5 A;  2CW7 A;  2ZME A;  2CV0 A;  1MIJ A;  1Z77 A;  3G4S I;  1SD7 A;  2XIG A;  3ZMD A;  4AIK A;  5FKK A;  4L18 B;  3K1P A;  2VIX A;  2AQF A;  1UG0 A;  1BC7 C;  3K0L A;  4LD5 A;  3J7Y J;  2O7O A;  5F1J A;  4KN7 X;  3GFJ A;  5E3L A;  2H6B A;  4E70 A;  5IOY A;  2E71 A;  4IX7 A;  3JCU C;  4DYQ A;  1K4T A;  3A0H C;  1AKH B;  4E4H A;  3ZQ7 A;  1K83 J;  5ILS A;  2R0Q C;  3Q0V A;  5JHF A;  3ZOB A;  2F6C A;  3A4C A;  5IYB J;  5TGT A;  3S16 J;  3ZMS A;  5E3N A;  4N9H A;  1E3P A;  2EWN A;  1X4O A;  4KIF A;  3BR2 A;  3HC7 A;  1FOW A;  1F36 A;  4ZTF A;  2QA4 I;  2LOO A;  4BQQ A;  3H35 A;  4XLE A;  4BE1 A;  1VI0 A;  2FQ3 A;  2M4K A;  5AIQ A;  1Z6R A;  2WAF A;  3GO5 A;  1X1C A;  3L09 A;  3BP8 A;  3DQV C;  1S7E A;  1VQ9 I;  4P9F A;  2XKP A;  5HS7 A;  4BUP A;  2EFO A;  1B6A A;  2M87 A;  3OS1 A;  5E3O A;  1FLI A;  1PDN C;  2CQN A;  5F0F A;  4KT5 C;  4X0G A;  4U7B A;  4S0H B;  3LSJ A;  5IP7 J;  3BJO A;  5C4X J;  5IP9 J;  2ID6 A;  3H0D A;  3K2A A;  3TP0 A;  1RET A;  1WJF A;  2VON A;  4I02 A;  4AID A;  5JR3 A;  2O6G E;  4UV9 A;  2NVX J;  1XGM A;  3FM5 A;  5GAE J;  2D2W A;  3CCJ I;  1BN5 A;  4A3K J;  3CZ6 A;  4XN3 A;  5EGO A;  1RUN A;  1X58 A;  2QWW A;  2KJB A;  1S8N A;  2HQN A;  3ZQF A;  4A3M J;  3M9A A;  5LHI A;  2QQ9 A;  3PIO F;  4F93 B;  3V7C A;  2UUZ A;  3FIW A;  3FM3 A;  1JKO C;  3AL0 C;  2FF4 A;  1XMX A;  1H9G A;  3FXU A;  4PFP A;  1H0M A;  1SVL A;  5FB2 A;  3IH4 A;  3A0B C;  2W25 A;  2ACJ A;  1HXD A;  2DDA A;  2XRN A;  3HZJ A;  1WGX A;  2QSF X;  2M9H A;  3BR6 A;  3HOT A;  4XKW A;  1XMK A;  1F1Z A;  4RB3 C;  5JVG F;  1V5F A;  3A2K A;  2VJI A;  3IUO A;  1DPU A;  1T2K A;  2R7F A;  1UFM A;  4BGD A;  2VLA A;  1O3S A;  2IW5 A;  1MBH A;  4A2U A;  3LST A;  4EGY A;  1LE8 A;  3UNG C;  4CCL A;  1U9O A;  2HWV A;  3K9T A;  3MQ0 A;  2HOT A;  1BIB A;  1GV5 A;  2FNA A;  1G4D A;  1BOB A;  4U0Y A;  2GIZ A;  2GOM A;  3WHB A;  2W84 A;  3FZV A;  2DK5 A;  1RC9 A;  4G8X A;  4Y33 A;  3L2W A;  4CCK A;  2FE3 A;  5BPD A;  1ZRE A;  1K79 A;  1SFK A;  1Y6I A;  3PUF A;  2NAZ A;  1ZG5 A;  5AON A;  2HU9 A;  3AG3 H;  3OYH A;  2VI6 A;  4HV6 A;  4BE2 A;  2DCE A;  1YIT I;  4AD9 A;  4IVN A;  4E7H A;  5EZG A;  3S1Q J;  3HYI A;  1U5T B;  3EYI A;  3LL7 A;  2EA2 A;  2W82 A;  4MIM A;  2DOE A;  1WKM A;  3GZ5 A;  3I54 A;  2V26 A;  2R93 J;  4IQJ A;  3GVA A;  3CLO A;  1BC8 C;  2LG4 A;  1JUS A;  2E1M B;  1WH5 A;  3KYL A;  3Q9V A;  2VE9 A;  2F4O B;  1XG1 A;  2VL8 A;  2LTP A;  4LK1 F;  1K4S A;  3KP6 A;  1ZRC A;  1IXR C;  3WU2 C;  1GUU A;  1QO0 D;  4HNT A;  3JAM K;  5M5W J;  4HAM A;  1D3Y A;  3EPZ A;  3H36 A;  4XBF A;  3CJN A;  1T0F A;  3AKZ A;  4Y17 A;  2L7F P;  3D0S A;  4TV7 A;  4ZH4 F;  3QU6 A;  2PEX A;  4QTR A;  3CC2 I;  1SAX A;  1OPC A;  4CYC B;  2V1X A;  3RKW A;  5DTD A;  1OR7 C;  3G2B A;  1QU3 A;  4BJ6 C;  3IL2 A;  2JN6 A;  3OS2 A;  2XAJ A;  1N78 A;  2FD5 A;  1YW9 A;  2LSO A;  2K9N A;  3KLN A;  2DOD A;  1S29 A;  3KCC A;  1FBS A;  3PIP F;  2IGN A;  2OF7 A;  2DA4 A;  1KGS A;  4EJU A;  3PO3 J;  5B1A H;  3I56 I;  1FC3 A;  3UR3 C;  3GTM J;  3JW4 A;  1R7J A;  1Y1W J;  3U1D A;  4NC7 A;  4CSW A;  2V79 A;  3GX4 X;  1EH6 A;  2P4W A;  5D5U B;  1IRG A;  2DA1 A;  1YW8 A;  2PN6 A;  2AHQ A;  3SZG A;  5LLQ A;  3RSN A;  3S1M J;  2X6Y A;  1OYI A;  1J59 A;  2IPQ X;  3I59 B;  1XCB A;  2DMT A;  1S9H A;  1K78 B;  2GIV A;  2PJP A;  4IKF A;  1IN8 A;  2CQ7 A;  1MNE A;  1G3S A;  2ECC A;  1SFU A;  4B3X A;  3NRV A;  5DEQ A;  1V3F A;  2JA2 A;  1DUX C;  3OYI A;  3OYB A;  5E8I A;  2VT2 A;  2Q1Z B;  3CQZ J;  4L9N A;  1IO2 A;  3FWE A;  3QP6 A;  1GT0 C;  4XID A;  2WAQ A;  3GEZ A;  3L00 A;  2PX9 A;  3FXK A;  2DN0 A;  2F4I A;  3QAH A;  1VQL I;  4KIC A;  2XHK A;  1XMA A;  2MA3 A;  2BGC A;  3S32 A;  3OYL A;  3FHZ A;  4G6D A;  4N4N B;  3HEF A;  5J8F A;  1G3W A;  2DU9 A;  1O3Q A;  4BY7 J;  2R92 J;  3KP5 A;  1LEA A;  4UY8 I;  3B6A A;  2HR3 A;  1P92 A;  4NDL A;  1DGW Y;  3HRU A;  3GFI A;  2VOD A;  1U5T C;  1VZ0 A;  2R7U A;  3V7R A;  3H9J A;  2KP6 A;  1ON2 A;  2KIM A;  2XV4 S;  3ZR8 X;  2QGU A;  4BBR J;  1VQP I;  2VUM J;  3DV8 A;  2JPB A;  3H3V K;  1XGN A;  5HDG A;  2DYS H;  2ZO4 A;  3BDD A;  2E1M C;  2JSC A;  3QYB A;  2CV2 A;  4IF4 A;  4XLH A;  1OCC H;  4MFD A;  1JKR C;  1K7A A;  2KPM A;  5ICE A;  2H8W A;  1PYV A;  2R7S A;  1E2X A;  3V4G A;  1B9M A;  2IGK A;  4A5M A;  1VQK I;  4FT8 A;  4S04 A;  2Z16 A;  3M07 A;  1R1T A;  4L9T A;  1WJA A;  3S2W A;  4AU7 A;  4A3F J;  1I6H J;  3VOE A;  5LHG A;  1Y56 A;  3GYH X;  1Y8Q B;  4XKB A;  4G9Y A;  4W97 A;  1OCT C;  1TQI A;  2L9R A;  2JJ7 A;  2XAU A;  5M3F J;  2K4J A;  3RPU D;  2X6W A;  2IS1 A;  3H5A A;  2L9S A;  5ICG A;  3WGI A;  1ITY A;  5CKT A;  3LSH A;  5FRM A;  2ZXI A;  4UUV A;  1VQN I;  1XN7 A;  3K70 D;  4ASN A;  2Y9Z A;  4RGS A;  3LSR A;  3HOY J;  1F5T A;  2OZU A;  4A3J J;  4YFK F;  2BY2 A;  1J7K A;  4B48 A;  1Z91 A;  2JPC A;  1IRZ A;  2ISY A;  2M2E A;  4HF0 A;  3F8N A;  1YO5 C;  3A01 B;  4X1E A;  2OD5 A;  3W2W A;  3RQ4 A;  2QEX I;  2IS6 A;  3HPH A;  1P6R A;  1KU9 A;  4FCY A;  2LF8 A;  2JA6 J;  3ZN0 A;  2CW0 F;  1UHM A;  3HDD A;  1RKW A;  2ELK A;  3F8M A;  2X1C A;  2MBF A;  3RTR A;  3I4N J;  3WOD F;  3GZN B;  4XIC A;  4HW0 A;  1IG7 A;  2FEZ A;  1KZH A;  1MNM C;  3M1C A;  2JA5 J;  2CH0 A;  3RKY A;  2BXY A;  4OAY A;  3I64 A;  1SMY F;  2Q8K A;  5GTH C;  4HOB A;  2L7M P;  1MBE A;  3PNY A;  4WF2 A;  2O03 A;  4G7H F;  3IAS 2;  2NVY J;  1UEL B;  3HKZ A;  4BXX J;  4MO7 A;  2BBY A;  2BV6 A;  1IAW A;  3HOZ J;  4G7O F;  3QWL A;  4LFU A;  2IJL A;  1UG2 A;  3BZ6 A;  1KQ8 A;  1KA8 A;  3Q0U A;  5DD4 A;  3FK7 A;  4XRS G;  2R7T A;  3GME A;  5C3E J;  2EZH A;  5JFR A;  4I76 A;  4FTH A;  4QIW N;  1I3Q J;  1T39 A;  2V6C A;  4LMY A;  2HDC A;  2XF5 A;  2ZXH A;  3IH2 A;  3TP3 A;  2EFQ A;  4B1R A;  4W1U A;  5L3C A;  1TL8 A;  1QRY A;  2KRH A;  3QYF A;  2LKP A;  4F7Z A;  1GHC A;  4L5J A;  3KP4 A;  4G7Z F;  2QQB A;  4KYW A;  2L4M A;  2GQQ A;  4FET A;  4GO1 A;  4E7L A;  4GYG A;  1HA8 A;  2IEK A;  2KL4 A;  2JQ7 A;  3DKX A;  2DOF A;  1T6S A;  3CO7 C;  1KU2 A;  3B6C A;  3MVP A;  9ANT A;  3DTK A;  3LQR A;  4Q5S F;  3WTX C;  2EJR A;  3IKV A;  1IUF A;  3V8L A;  2DMP A;  1X3Z B;  3CDH A;  1TT0 A;  2O61 A;  5D8K B;  2QYO A;  1MJ9 A;  4ENK A;  3CDL A;  3SFZ A;  2R5Z A;  1W7P B;  4M6Y A;  2HQR A;  3HOW J;  1XSV A;  2X1D A;  1QPI A;  2CWE A;  1Z6T A;  3WG7 H;  1FEX A;  3NQO A;  1W1W E;  1TNS A;  2W48 A;  2V1D A;  4CYD A;  2Y30 A;  4II3 A;  4ZDO A;  2LFB A;  4L0Y B;  2WY7 Q;  3E6B A;  2FXA A;  3JRE A;  2K3P A;  4LIU A;  1YS6 A;  2EQR A;  2GOX B;  2E7W A;  3PFI A;  1FMV A;  3ONQ A;  3JTH A;  3IRR A;  4C2T A;  3ERM A;  3MKL A;  3TO6 A;  3ABK H;  1OMI A;  2VKV A;  2BVM A;  3CTA A;  4BJ5 C;  1NK3 P;  1G3Y A;  1SD4 A;  1OCZ H;  4RB2 C;  2QF7 A;  1D5Y A;  2CV1 A;  2ESH A;  2MG4 A;  4G6T B;  4LLN A;  2W7N A;  3EUH A;  1NK2 P;  1Z3Y A;  5F0C A;  5HLG A;  5FLX Z;  1UAA A;  4IHT A;  1LJ9 A;  2LRE A;  1A5J A;  1IDZ A;  2QVO A;  5GAD J;  1VQ6 I;  4HEA 2;  2STT A;  4ENJ A;  3EDP A;  5D4R A;  2QM3 A;  5CQG A;  5CPR B;  4QLC U;  2Y0S N;  4OIO F;  4DZJ A;  1MMN A;  4LLG F;  3TO9 A;  4AYB A;  4PZJ A;  1YS7 A;  1FT9 A;  4XR6 A;  2CYY A;  1BA5 A;  1MKM A;  3C2G A;  1BIA A;  1FIA A;  1POG A;  1DDN A;  5K5R A;  4KNY A;  1D0X A;  3BG3 A;  3L1P A;  4OOI A;  2P81 A;  4D1Q A;  2CUZ A;  1UHS A;  3FXJ A;  4FHT A;  1P7J A;  1TZL A;  4QPQ A;  4D7N A;  2DT5 A;  1IF1 A;  2HZT A;  1LDJ A;  2JZY A;  2X6O A;  4ESF A;  5CLS A;  2E5Z A;  3M1E A;  3DBR B;  1WSU A;  4OIR F;  5JVT A;  1XGO A;  4GGG A;  4A6D A;  1JKQ C;  2IXS A;  1VF9 A;  1MH4 A;  2M30 A;  3D5R C;  1RI7 A;  2XAG A;  3DTE A;  5IPA A;  2HOA A;  2DJN A;  2EIL H;  3ZRG A;  4P9U A;  3LSP A;  4ZC3 A;  2XAH A;  2DMQ A;  2VC0 A;  1D1C A;  2KHM A;  4V19 K;  3S14 J;  3CCY A;  1ETX A;  3KLO A;  4B44 A;  4NBQ A;  5L3G A;  4LG0 B;  5LEK A;  1U8B A;  4BDZ A;  4CCM A;  1R5G A;  2NOJ B;  2ZC2 A;  1SAN A;  1O4X A;  2EB7 A;  3ROU A;  2E1C A;  2LR8 A;  3ZMZ A;  1W36 D;  3H0G J;  3TO7 A;  2V4J C;  4J19 A;  3FDY A;  3C7J A;  3SDG A;  5DS9 A;  1IUY A;  2RQQ A;  2ZFW A;  3CMY A;  1AA7 A;  5E1Z B;  5B1B H;  4EQQ A;  1B4A A;  5H6Q A;  2I5U A;  3R0J A;  3OYF A;  4IHX A;  4J01 A;  5DD8 A;  4RA2 A;  3GBG A;  1VQM I;  5E1X A;  1ZRD A;  2DFE A;  3D5L A;  3BTI A;  1RRJ A;  4A3I J;  5J4V A;  1E3O C;  5DUI A;  3ERE D;  1AU7 A;  4ITV A;  5TRD A;  2MC4 A;  3E3V A;  1VND A;  3QRF F;  5AIP A;  5J6X A;  1OCP A;  2JA8 J;  1B72 B;  3CUQ B;  4D5F A;  2GXG A;  1H8A C;  1D0Y A;  3CJQ B;  1U9N A;  2P7C B;  1USS A;  3IAM 2;  1XX5 A;  3NWS A;  4XKC A;  4MEX F;  4HDV A;  2DA2 A;  1YRN A;  3IH3 A;  1BW6 A;  1WQ2 A;  1BBY A;  2EZL A;  3NEU A;  3REO A;  4B09 A;  1W7P D;  3C18 A;  4Y52 J;  3Q3S A;  4KIS A;  1SC7 A;  5EEA A;  2JK3 A;  2X48 A;  2Z2S B;  3TBI A;  1G8X A;  1WFX A;  2KRF A;  2O8K A;  2R7V A;  2PI0 A;  5GAG J;  5TJJ A;  5FLX K;  1X1P A;  2X0L A;  1JHH A;  4IJA A;  5KCM A;  2W00 A;  1YFH A;  2MH9 A;  3PQJ A;  2WB1 A;  4GCV A;  5IT9 Z;  1UST A;  2XRL A;  4CUG A;  2Z99 A;  4LIV A;  4HST A;  4BQA A;  1NG7 A;  5E1W A;  2V9V A;  4AVP A;  1TWH J;  4B4C A;  3E97 A;  2VOO A;  4HSR A;  1Z9C A;  4QPO A;  2VB6 A;  3FHN A;  5FKN A;  5B3S H;  1MDM B;  1ZGA A;  3W6K B;  2RC4 A;  4BU2 A;  1VQO I;  1KQ0 A;  3HTU A;  3ABU A;  3O2P E;  4RGX A;  1VQ7 I;  5BMZ A;  1EKE A;  2MFZ A;  4YFN F;  2QSH X;  2V6E A;  4ABZ A;  5EF6 A;  3W3C A;  4BXU A;  3DCF A;  5ED4 A;  1R5I D;  3QOE A;  5L3B A;  3L2Q A;  3F22 A;  2YU3 A;  2XF7 A;  5DCM A;  3J7Z I;  2BXZ A;  3QPL A;  1B8I A;  5M5Y J;  4CCJ A;  5EJC A;  5A2Q Z;  3LAP A;  4EEF G;  4JYK A;  2R7Q A;  4M9Z A;  3KPH A;  4JBA A;  3GTO J;  3K1M A;  1N75 A;  2LK2 A;  2OUM A;  2ZNZ A;  3ELK A;  2EFW A;  3M4O J;  3BJA A;  1ETV A;  1IDY A;  2JA7 J;  2NVQ J;  3NAU A;  5H20 A;  2LRD A;  3ZQC A;  2NVU B;  2B0L A;  2OQG A;  5M3M J;  4IHY A;  2DMN A;  1HCR A;  3FMS A;  2M0M A;  4JQF A;  2YSR A;  3VYT B;  1AKH A;  4YRV A;  1MGT A;  3PL8 A;  3HSE A;  4DGW B;  3OYD A;  3I0T A;  4BKX A;  4FE7 A;  3OYC A;  3OV8 A;  2ZXW H;  2R7X A;  1STZ A;  1Z0X A;  2DA5 A;  3KP2 A;  1Y8R B;  5F08 A;  4UUT A;  3LOC A;  1ZN2 A;  3OL3 A;  4LJZ F;  5E20 A;  4Y15 A;  1HW1 A;  3G3Z A;  4BHB A;  3DU5 A;  3MKY B;  5H2F C;  2ZNY A;  2K02 A;  1UMQ A;  3AAF A;  3V42 A;  4P55 A;  3IWF A;  1U8R A;  4LLL A;  4E7J A;  3WTZ A;  1FNN A;  3WGH A;  2A05 A;  5L3E A;  3MKW B;  2EA4 A;  3LSG A;  3TGN A;  2PLY A;  1FBQ A;  2X9D A;  3H9G A;  4I6Z A;  4OIQ F;  3WU1 B;  1WJC A;  1EA3 A;  5F0H A;  1YJW I;  2BY3 A;  2R5Y B;  3A03 A;  4PDK A;  3KYC B;  1G6N A;  2CFX A;  2ID3 A;  2Q2E B;  5GPC A;  4L5I A;  4DYR A;  2Q0O A;  2AQE A;  4GYI A;  3I55 I;  1OR7 A;  3GTQ J;  1Z7U A;  4MLO A;  3DBH B;  3LQQ A;  5DCF A;  3CCV I;  4H0E A;  2ESN A;  4NC8 A;  2BE5 F;  3HRM A;  1I3A A;  5C44 J;  2JMW A;  2KLO A;  1FSE A;  3JRI A;  2BHY A;  4RS8 A;  1B9N A;  3FK6 A;  3F72 A;  3D5S C;  1ZGJ A;  4EGZ A;  3C2B A;  5D5X B;  5FJ8 J;  1RIO H;  3TW6 A;  3A1Y A;  1PUE E;  2DAO A;  3DEU A;  4XRS A;  4YII A;  4HA8 A;  3WTY C;  1P2F A;  3LSI A;  3I71 A;  4HBL A;  4IEJ A;  4HQM A;  1SAU A;  1EH7 A;  2K9M A;  3S3N A;  4KT6 A;  3W6V A;  4HRI A;  1J09 A;  1XPX A;  3Q5F A;  1O3R A;  2DPD A;  5D6F A;  3SXY A;  2IGO A;  1R36 A;  1JT6 A;  2ADU A;  3LFK A;  5J1U A;  4CHU A;  4CO8 A;  1SFO J;  1R22 A;  3FXM A;  2HFH A;  3FXO A;  1TWA J;  4G6Q A;  3VPR A;  2Y2Z A;  3HTS B;  3OYK A;  1J2X A;  1TP4 A;  4XM3 A;  3RQI A;  3GW2 A;  4BEH B;  3ASN H;  2W24 A;  3WU0 A;  5BQT A;  2STW A;  4KIT B;  4PJL A;  1EH8 A;  2L9V A;  4DYC A;  5E3M A;  1FP2 A;  4M3F A;  4BHC A;  4DZP A;  3COA C;  1W0T A;  2H27 A;  4UXN A;  3F0C A;  4OMY A;  1U0J A;  3HUG B;  4HX4 A;  2CG4 A;  3RPQ A;  2PJR B;  2ZJ2 A;  2WTE A;  1TT5 B;  3U1K A;  1H88 C;  5KHD A;  1HLV A;  4X6A J;  1NHA A;  1T56 A;  1YI2 I;  2FUG 2;  4F91 B;  4NQW B;  1TTY A;  3DTI A;  1U5T A;  2IBD A;  2GBY A;  3EUA A;  2IRF G;  4KMF A;  2CGP A;  2C6Y A;  2FSW A;  2DA7 A;  3RPU A;  3BCA A;  5HLH A;  1XDU A;  3S15 J;  4ENM A;  1IZ1 A;  1GDT A;  4PJJ A;  4RM2 A;  5CVU A;  1WJD A;  2OA4 A;  4XLA A;  4HNU A;  2DO7 A;  2XVC A;  1LQ1 A;  1MH3 A;  1R9T J;  1YIJ I;  5ICF A;  2YU9 J;  3JRD A;  1G3T A;  3BOQ A;  4U88 A;  1QBJ A;  2L9N A;  2DTZ A;  1CF7 B;  3MWM A;  2ZB9 A;  3C1D A;  1IV6 A;  3RJP A;  5FLM J;  5F64 A;  1WJE A;  3BWG A;  4YIR X;  1ERD A;  1UCR A;  2EZK A;  2KMU A;  3NWT A;  2M3A A;  3PM1 A;  3SEZ A;  5GTI C;  1H89 C;  2AS5 F;  2QLZ A;  3R60 A;  2VPL A;  1JUP A;  4CYC A;  2OAZ A;  3DWL E;  3FXL A;  3KZY A;  4G12 A;  2D1V A;  2FBK A;  1DP3 A;  3WG9 A;  2ME0 A;  4YG2 F;  4UVC A;  1ZG1 A;  1TWC J;  1ZTR A;  4RBO A;  3TOA A;  4P1W A;  4XN0 A;  4WXC A;  2A5W A;  2TCT A;  3MFK A;  3M8E A;  2AXL A;  3I5U A;  3PSI A;  4IO9 F;  3HB9 A;  3HOU J;  3WTW C;  1HF0 A;  5HLI A;  3V7S A;  1V54 H;  3DPL C;  4BDY A;  2RVC A;  4E7I A;  3F21 A;  3ZMV A;  2W57 A;  5F04 A;  4CA0 A;  2HZD A;  2WAD A;  2DW4 A;  2PBI A;  2DMU A;  4IL6 C;  4IPA A;  2LC2 A;  3SEQ A;  2DA6 A;  1QPM A;  1ZLK A;  2RN7 A;  3I59 A;  4ZJZ A;  5FLV A;  4NB5 A;  1E17 A;  1A31 A;  4EM1 A;  4M6V A;  5DM7 F;  2MGQ A;  1BI0 A;  1J0R A;  3OYM A;  2L5Q A;  4D5C A;  3CJR B;  5KAI C;  5J1Y A;  4QWQ A;  1U6G A;  2GM4 A;  5CVJ A;  3OWT A;  1ETO A;  1FJL A;  3WGG A;  1HKT A;  2WB1 N;  3I9V 2;  1ZAR A;  1V55 H;  1RUO A;  3T5X A;  4R79 A;  2K86 A;  3DKW A;  2DT7 B;  3T1B A;  1LB2 A;  1EJ9 A;  2EIJ H;  3HJE A;  2CU7 A;  3ZMU A;  3O8G A;  1XC5 A;  2VC1 A;  3K1N A;  4EM2 A;  2WAE A;  5J8C A;  5LRS A;  4OMZ A;  2E2H J;  2K5C A;  1GVJ A;  2VN2 A;  5JHU A;  1TWG J;  2ME6 A;  3E6M A;  5CVV A;  3L2R A;  3AG2 H;  3SYT A;  3VSK A;  1X4P A;  3K70 C;  2R7R A;  4OIP F;  1HBX G;  3LA2 A;  3F3X A;  1FYM A;  3RZD J;  2Y48 A;  3K2Z A;  2RNG A;  4IRH A;  4I98 B;  5TIS C;  1WHU A;  2VXD A;  3J80 Z;  2HEO A;  3TDZ C;  2Y9Y A;  5HNH A;  2IT0 A;  4FQG A;  5KAF C;  2JSP A;  3CCM I;  1BR4 A;  1Z05 A;  2L0K A;  1FX7 A;  1HST A;  1D5V A;  3X2Q H;  4HLY A;  4Y3O A;  3MN2 A;  3IC7 A;  1SEU A;  3KP7 A;  4BAY A;  1S3J A;  4HF2 A;  2YUS A;  1XSD A;  4IRG A;  3CP2 A;  3HRT A;  1D1A A;  1KYW A;  4OU0 A;  3SJM A;  2LKX A;  1KON A;  3PUB A;  2RKH A;  2FMY A;  4Y7N J;  2LY2 A;  1TNT A;  3T8T A;  1ZG3 A;  3GFM A;  3BG6 A;  5FKM A;  2ZFU A;  2DQL A;  3MZY A;  4V2F A;  1FTZ A;  2JUC A;  1I5Z A;  3GLL A;  4G94 A;  4MQ9 F;  4F52 A;  1XD7 A;  4EM0 B;  5LGU A;  3J81 Z;  3ABL H;  3VDX A;  4A0Y A;  1DQU A;  3GZ6 A;  2XUB A;  2EFN A;  2M7B A;  2CUF A;  1AHD P;  2I10 A;  3S1N J;  3A01 A;  4D9J A;  3E0J B;  5KNL A;  3C3W A;  2DFH A;  1FWZ A;  3CP8 A;  3OMY A;  2DLL A;  2L4A A;  2EBI A;  5BOX A;  3MMY B;  4LG3 A;  4II2 A;  3DP7 A;  4AVZ A;  3ECO A;  1N77 A;  3CUO A;  1WZ2 A;  2MLG A;  1OCR H;  3DLL F;  3BTL A;  3CD6 I;  2M4G A;  3H5N A;  4LB6 B;  3FMR A;  1D8J A;  2L54 A;  1VFC A;  2QCO A;  3BPX A;  3NAR A;  4PJ0 C;  1WCM J;  2IS4 A;  3S17 J;  3PNT A;  4GRI A;  4PJN A;  1K6Y A;  2K7L A;  3OY9 A;  4C9Y A;  4C3H J;  5CVI A;  2JRT A;  3JRF A;  2RV8 A;  2DT6 A;  1Z21 A;  4Q47 A;  2OQR A;  1B1B A;  2JTV A;  2ETH A;  1FPQ A;  2HDW A;  2VAS A;  4IHS A;  2GA1 A;  2KKO A;  4D7M A;  3FKJ A;  1MMG A;  3ESW B;  2XGD A;  2HGC A;  3V8K A;  1MBJ A;  2XAS A;  3M8J A;  2P7V B;  1ZGW A;  3MKZ A;  4RGU A;  3G73 A;  3CF2 A;  3H92 A;  4BL0 B;  1YX3 A;  4XLN F;  4ZYH A;  3KYD B;  3WE3 A;  2HQA A;  1GXQ A;  2X85 A;  2J5P A;  1BL0 A;  1BJA A;  2FJ1 A;  4BJT A;  4Y13 A;  1X1D A;  3WTU C;  1ZH5 A;  3GTL J;  3BPV A;  3CCR I;  3W6J B;  2Z3Y A;  4M72 A;  5D8L B;  1T98 A;  2M8E A;  3E6D A;  2XF6 A;  4RAF A;  2HKO A;  4L9V A;  3DLA A;  2QQA A;  1GXP A;  4E7K A;  2DTR A;  5FD6 A;  2GZW A;  4EMS A;  5LFA A;  4RM3 A;  2HYF A;  4XOT A;  4NHJ A;  2R7O A;  1W7P A;  3LSK A;  4MFE A;  2UWM A;  4A0X A;  2BY0 A;  4O6J A;  1K6O A;  2EK5 A;  2M5W A;  3AFH A;  1YQA A;  2OBP A;  3MEX A;  3LNQ A;  1MMA A;  1X1B A;  3S2H J;  4UUS B;  1ETW A;  4WCG A;  1I1G A;  1MW7 A;  3J81 K;  1QZY A;  2MD5 A;  3TOB A;  2DPU A;  4AM3 A;  3KEO A;  1OCO H;  4DOZ A;  2E1N A;  3CC7 I;  1HOM A;  3CLQ A;  2XGC A;  2UXN A;  1QA6 A;  5IOZ A;  5EG0 B;  5FRO A;  2O9L A;  2LBF B;  2HS5 A;  1PUF B;  2FNP A;  3OIP A;  1CQT A;  2FRH A;  1ZAO A;  2HPI A;  4RAZ A;  2ZXJ A;  2BHZ A;  3FBN B;  4NNJ A;  4B3A A;  2XPV A;  3I4P A;  3BZK A;  2LMD A;  2DA3 A;  3HG9 A;  3V8J A;  4M74 A;  2E2I J;  3ZP5 A;  1P7I A;  1J9I A;  3BLY A;  4I0A A;  4S05 A;  2FOW A;  2BEO A;  2LYC A;  4YEL A;  1GVD A;  3DPU A;  5K7Z A;  4EJV A;  4AC0 A;  2P5L C;  3N97 A;  3IRQ A;  2DXI A;  1IRF A;  1W36 C;  3E6C C;  4ETS A;  5B66 C;  3B73 A;  1LPQ A;  2F5V A;  3JRH A;  5KVR A;  1YYV A;  1ZKG A;  1YX5 A;  3MZH A;  3M3Y J;  3OYJ A;  4HF1 A;  3K6G A;  4UVA A;  1WVR A;  3CDI A;  3BQZ A;  4IRI A;  1L3L A;  1SFE A;  3BR3 A;  3QOP A;  1RZ4 A;  1KQ9 A;  2K9L A;  2V9P A;  2G9W A;  3BR0 A;  1JT0 A;  1JI8 A;  4CH7 A;  3BZC A;  4KUM A;  1MSF C;  2WAQ N;  3R0A A;  2DFI A;  4U0W A;  1U78 A;  1XCV A;  3BR5 A;  2MYS A;  1TQP A;  1MJA A;  1LDK B;  4E7Z A;  1MBG A;  4PCQ A;  2HOS A;  2LKS A;  2LP0 A;  2A6E F;  2XKO A;  1O57 A;  3S3O A;  2D5V A;  1XS9 A;  2IA1 A;  3JRG A;  2PFB A;  3H5R A;  3R6S A;  2CSO A;  4EVI A;  1KU3 A;  1YW7 A;  4XOP A;  2CFO A;  3GXO A;  4CCN A;  3HRS A;  2NNY A;  2JRM A;  2KDO A;  3OR2 C;  5HLT A;  2QBY B;  4LG0 A;  4L0Z B;  2NRA C;  2BOL A;  3OYA A;  2O0Y A;  1FY7 A;  1J5Y A;  2IA0 A;  3IHU A;  3HOV J;  2BW3 B;  3MAJ A;  3CC4 I;  3JR9 A;  3DU6 A;  3PSF A;  5DUK A;  1BW5 A;  2H1K A;  2FU4 A;  1P4X A;  2MW8 A;  1FSH A;  2FML A;  3VYS B;  2DYR H;  1UB9 A;  5C4J J;  1TC3 C;  2O3F A;  4ENN A;  3BG7 A;  3G1M A;  3GTJ J;  3S8P A;  3HHH A;  5J40 A;  1YE9 A;  2D45 A;  5E79 C;  2LH9 A;  1RKT A;  4LIT A;  2ECB A;  3RKX A;  2F5C A;  1ON1 A;  2OCC H;  5LHH A;  3CF5 F;  5L3D A;  2XPU A;  4F55 A;  4ZZD A;  1JXS A;  2W85 A;  1EF4 A;  3KZI C;  3L2V A;  2K4B A;  2L7K A;  2KJC A;  2WBM A;  3GFL A;  3CUQ A;  2EV6 A;  2Y69 H;  1YHQ I;  2JWT A;  2COB A;  3RZO J;  2V9K A;  5H6R A;  3F8C A;  3HBL A;  4YFX F;  3KZZ A;  1W5S A;  3DXJ F;  4I09 A;  1ZK8 A;  1YIO A;  4WXH A;  3SZT A;  4XSX F;  1FZP B;  2DJI A;  3EQL F;  3ML6 A;  4MTE A;  1Y0U A;  3SDB A;  1LFU P;  1VQ5 I;  4QSH A;  1E0E A;  2R7W A;  1YJN I;  3P9C A;  3OR1 C;  4P5O A;  2QQ8 A;  1LFP A;  4RAG A;  1REP C;  4XNF A;  1ETY A;  1TQM A;  2F4M B;  3KP3 A;  2JUG A;  5CYV A;  2GLO A;  3DBL B;  5J3L A;  1QHH D;  3EYY A;  2X4H A;  1X3W B;  4FX4 A;  1QHG A;  5KK1 A;  1HKQ A;  1Z3X A;  4HPQ A;  3S1R J;  2K27 A;  3KE2 A;  2G7U A;  4WK8 F;  2Z1D A;  1NTC A;  1OFC X;  1MDM A;  1AWC A;  3ULQ B;  4RDU A;  3AL0 B;  2XPW A;  2Y0M A;  1IN5 A;  2H1L A;  5J4Y A;  3M8F A;  2WWY A;  2ZME B;  4KA4 A;  2NXN B;  2NNN A;  3QP5 A;  2OJE D;  3EET A;  2ZSH B;  3ASO H;  3PQK A;  2H8R A;  3SQN A;  3S93 A;  2ZCW A;  4XL9 A;  2VBW A;  1UJ8 A;  3HKZ N;  3L2U A;  1MND A;  5BNG A;  2P0W A;  2BYV E;  1ZR4 A;  3ABM H;  5EZH A;  2OV7 A;  1BR1 A;  5K5Q A;  4U7D A;  4BXF A;  3D1N I;  2KZV A;  3KIO A;  5L3F A;  4M6X A;  2A61 A;  1XTA A;  3VOD A;  1X2M A;  2OU2 A;  1JTX A;  1HSJ A;  4H4K C;  2JVH A;  1XSX A;  2V1N A;  1ONV A;  1I6X A;  5CVR A;  2EFP A;  1JGS A;  1WJ5 A;  2E7X A;  5FKL A;  2NOG A;  3LFU A;  1I1S A;  1J75 A;  2QEN A;  3OSF A;  3P9I A;  3SHF A;  2NS0 A;  3GUD A;  4Z2Y A;  4ZTJ A;  2HDD A;  4JP0 A;  1PJR A;  3CUQ C;  3DFG A;  4A5N A;  1UZC A;  5FO5 A;  3ZPL A;  3FKI J;  2BVL A;  3F8B A;  4I99 C;  3AG1 H;  1EV7 A;  2JVG A;  3JAM Z;  1W0U A;  4DW6 A;  1RR7 A;  2XSJ C;  1E3H A;  1N25 A;  4ESJ A;  3ABT A;  2E19 A;  5DV5 A;  4M3B A;  1BR2 A;  4U0V A;  4UHT A;  3RDI A;  1P4A A;  2OPT A;  1L0O C;  2XB5 A;  3HM5 A;  5LRR A;  3WTV C;  2M1B A;  2RNJ A;  2DI3 A;  3IWZ A;  2FA5 A;  1MMS A;  2A07 F;  2UV1 A;  5CJ9 A;  2P5V A;  3HSR A;  1R49 A;  1X1A A;  3WTT C;  2GXA A;  1I39 A;  2D1H A;  3E5Q A;  5FKO A;  2VBZ A;  4C2U A;  1P4W A;  4XLP F;  2R5Y A;  4M3E A;  5EGO B;  2X1E A;  2P6T A;  3LA7 A;  4ZYE A;  4AIH A;  1FBU A;  2EZI A;  2Q2E A;  3LAJ A;  5IT9 K;  2CJJ A;  4R1H A;  2LF7 A;  3K7A J;  4LOC A;  1OQY A;  1T33 A;  2EIN H;  5HOO A;  1ZYR F;  1KU7 A;  3H3Z A;  3MD2 A;  3ZXS A;  2VKD A;  4ZZL A;  1Y39 A;  1K61 A;  5GAH J;  2W4S A;  4XSZ F;  3QYE A;  5HDN A;  1MBK A;  3JTG A;  2PMZ A;  5F6F A;  4IHV A;  4JX4 A;  2CRG A;  4BNC A;  2RAE A;  3GTK J;  4MTD A;  1Z67 A;  4DIQ A;  2Z9O A;  2Y75 A;  4HX8 A;  4MQV A;  1IRX A;  3P9K A;  1LE8 B;  2I8D A;  5HS9 A;  2ZME C;  1WWX A;  2RQP A;  5FFX A;  4AYB N;  2H94 A;  1QZZ A;  4OAZ A;  4V2G A;  1LNW A;  2B7E A;  3TQN A;  2KQR A;  5EYR A;  4HX7 A;  1R5H A;  1IW7 F;  1ZRF A;  4PGG A;  4CZC A;  2OTJ I;  2KIU A;  5A2Q K;  4N4O B;  3T0Y A;  1ORK A;  2HKX A;  4JX6 A;  1O7L A;  4A3E J;  3WHC A;  3OL4 A;  1JHF A;  2COM A;  1SMT A;  4I0B A;  4A0Z A;  1DGR M;  1WH7 A;  2KRC A;  2EH3 A;  1S5L C;  2CUJ A;  3DKY A;  1CGP A;  4XON A;  4R8H A;  2HNH A;  4A3C J;  3TDU C;  3FXQ A;  2XGE A;  1JTY A;  3PNV A;  4BEH A;  2V7F A;  2QKL B;  3VSL A;  2K85 A;  2MH2 A;  2LLK A;  2OC6 A;  4HYE A;  1F4K A;  2R7Z J;  3K4J A;  4EJT A;  1Q1H A;  3HUG A;  2PJR A;  3W2A A;  3CO6 C;  4KJZ A;  2IP2 A;  1VQ8 I;  3LWF A;  2M0C A;  4Q4Z F;  4RAY A;  3Q9S A;  2HYG D;  2G0E A;  4NQW A;  4EV0 A;  2CW8 A;  2DDB A;  4CDG A;  2CUE A;  1M1E B;  1WI9 A;  2ZJP F;  4ZYG A;  5HOD A;  1D8K A;  1QVU A;  2E2J J;  2XB0 X;  1H9T A;  4BS9 A;  2VE8 A;  1RES A;  2K3F A;  4PUS A;  2VJJ A;  3I58 A;  4HV5 A;  1I50 J;  4O5V A;  3DEW A;  3OIO A;  3JRA A;  2RRE A;  2YPR A;  1LVA A;  4C3I J;  4A3L J;  2EV0 A;  3SFI A;  3PFY A;  3S3M A;  3TKY A;  1FMW A;  2MLK A;  3E7L A;  3OSG A;  5J1R A;  1UHW A;  1CF7 A;  3G6E I;  1GLN A;  3OOP A;  1YJ9 I;  3BT9 A;  2VPR A;  3TMO A;  2Z5U A;  3HXL A;  2WY8 Q;  4A12 A;  2CQQ A;  1RPW A;  2F5D A;  4E7S A;  3H3U A;  2K9Q A;  2CMP A;  4UB6 C;  4FAS D;  2QSG X;  2VBY A;  4RMN A;  2Y0S A;  3BTC A;  3BY6 A;  4K2E A;  1HKS A;  2K40 A;  4C2M J;  4C30 A;  4M71 A;  5K1Y A;  4BAC A;  2GWR A;  1Z7L A;  1PVE A;  3BG5 A;  1ETQ A;  2XRO A;  4M9S A;  2OTL I;  3PO2 J;  4AIJ A;  4UB8 C;  1V5E A;  1K78 A;  4F92 B;  4CZZ A;  1FOX A;  1ODD A;  1OYY A;  4RLQ A;  2B63 J;  2IS2 A;  4A3B J;  1ZQ3 P;  1X19 A;  2M8G X;  4BE0 A;  5K5O A;  3F23 A;  2BY1 A;  4B43 A;  3KET A;  4XKV A;  4CXF A;  3Q0W A;  3QOD A;  4C3J J;  1C0W A;  2ZSI B;  4A3G J;  2MSY A;  1XGS A;  3J7A O;  3SZP A;  2B9S A;  3M7G A;  2O8X A;  4PK4 A;  4J00 A;  2TDX A;  1T8I A;  5D4S A;  1MMD A;  2X51 A;  2VKH A;  4A6E A;  1QNT A;  2XGX A;  4B8X A;  2NVT J;  3F8F A;  3GWZ A;  1A04 A;  3K4L A;  4NUB A;  4ANJ A;  1JGG A;  3CCE I;  3IP4 B;  3QPT A;  4HG2 A;  2J5O A;  3R4K A;  1JJ6 C;  1HW2 A;  4DNC A;  3CCS I;  2ISZ A;  2E60 A;  2MC3 A;  4U87 A;  1R4M B;  1OJL A;  3UKG A;  3TW7 A;  1S7O A;  1RNL A;  4JOM A;  4RB0 A;  4I7H A;  5JLW A;  2F5F A;  1VQ4 I;  2KIQ A;  4E6K G;  3ZGK A;  5LBQ A;  3HOX J;  2ICW G;  3O8H A;  1R6R A;  2MD0 A;  1BI2 A;  4PSX A;  2RDP A;  3R61 A;  1IN7 A;  2NS7 A;  4BHP A;  1S7A A;  2OZ6 A;  4FX0 A;  2F2E A;  2NYX A;  1T0F C;  3E5U A;  1ZR2 A;  3ZQI A;  1RR8 C;  3OOU A;  2XDV A;  4WX9 A;  4IOC F;  4HNV A;  3FX3 A;  2X6X A;  3JRC A;  4XMY A;  4ZDP A;  3HGG A;  1NG6 A;  1FP1 D;  2ZBK A;  2HQ5 A;  4BY1 J;  4BBS J;  5LEJ A;  6PAX A;  1LEB A;  1Q1V A;  1JUM A;  1R23 A;  1QVT A;  2VQG A;  2ZJR F;  3TL4 X;  4IXA A;  1TW3 A;  2K9S A;  4MHG A;  2E36 A;  1V4R A;  4Q48 A;  3DEE A;  2VJ4 A;  5IYD J;  3K69 A;  4B47 A;  1MSE C;  2FOK A;  3RCO A;  1HDD C;  2Y31 A;  3GTG J;  3S2D J;  4KDP A;  1IJW C;  3TED A;  4BH9 A;  1HDP A;  5HDK A;  2EPF A;  2PMU A;  1P9Q C;  3WE2 A;  4BYY A;  3VYU B;  3FIS A;  3U2R A;  2VQC A;  4XLC A;  1JKP C;  3KFW X;  3CJT B;  1SVO A;  1IXC A;  5LGT A;  1D0Z A;  2VOP A;  3MCZ A;  2HOE A;  4LGW A;  4PGH A;  5E17 F;  2R4G A;  1ACI A;  2VBX A;  1NH3 A;  3OYG A; 
#chains in the Genus database with same CATH homology
 1OR7 C;  2K9L A;  3G2B A;  4Y4R A;  4BJ6 C;  1QU3 A;  1JI8 A;  3VYT B;  4CH7 A;  4YRV A;  3OS2 A;  1N78 A;  3PL8 A;  4DGW B;  3OYD A;  4XLF A;  2MYS A;  3OYC A;  2L2O A;  2R7X A;  2IGN A;  1LDK B;  4E7Z A;  5HNF A;  3OL3 A;  3UR3 C;  3DU5 A;  3MKY B;  3OYE A;  3S3O A;  4NC7 A;  4CSW A;  3V42 A;  3H5R A;  4IZZ A;  3SZG A;  4E7J A;  1OLT A;  3RSN A;  2X6Y A;  4XOP A;  5HVQ C;  2CFO A;  4CCN A;  2MAB A;  2KDO A;  3MKW B;  3LSG A;  3OR2 C;  5HLT A;  2HVR A;  2BOL A;  3OYA A;  3H9G A;  1S9H A;  4IKF A;  1MNE A;  2BW3 B;  1WJC A;  1EA3 A;  2QKM B;  3DU6 A;  3PSF A;  4B3X A;  2JA2 A;  2M7A A;  3OYI A;  3VYS B;  3OYB A;  3OIQ A;  2Q2E B;  2Q1Z B;  2AQE A;  2IGM A;  3BG7 A;  3EUK L;  3S8P A;  3K4B A;  4MLO A;  4XOR A;  1YE9 A;  4EAT A;  2LH9 A;  4LIT A;  2WAQ A;  4NC8 A;  2KLO A;  2F4I A;  4F55 A;  3N05 A;  3C2H A;  3D5S C;  2E5N A;  3S32 A;  3OYL A;  4N4N B;  2VXZ A;  5CQE A;  3A1Y A;  3L2V A;  2L7K A;  2WBM A;  1DGW Y;  3LSI A;  2V9K A;  1VZ0 A;  2R7U A;  2CS3 A;  2KP6 A;  2LY1 A;  3H9J A;  3K4C A;  3S3N A;  1SAU A;  2K9M A;  4KT6 A;  4HRI A;  3ZR8 X;  2DJI A;  4JQF A;  3SDB A;  1J09 A;  1E0E A;  2R7W A;  2IGO A;  3QYB A;  2E1M C;  3OR1 C;  4P5O A;  3OYN A;  2CV2 A;  1LFP A;  4XLH A;  3VWB A;  4XNF A;  3F9K A;  2KPM A;  2JUG A;  1PYV A;  2R7S A;  1LVK A;  5LD2 C;  2IGK A;  2XC7 A;  1QHH D;  3OYK A;  2A6T A;  3KX2 A;  1QHG A;  3FBI B;  4XM3 A;  2Z16 A;  1Z3X A;  4HPQ A;  1WJA A;  4AU7 A;  4BEH B;  4BQO A;  4KIT B;  4PJL A;  1Y56 A;  2W1O A;  2Z1D A;  4XKB A;  3OS0 A;  1U0J A;  2ELJ A;  2XAU A;  3HUG B;  2PJR B;  3AL0 B;  3RPU D;  3K4K A;  2X6W A;  2IS1 A;  5KHD A;  3H5A A;  2L9S A;  4XQF A;  2FUG 2;  3LSH A;  4NQW B;  5CKT A;  3DTI A;  4F91 B;  2O5R A;  5FRM A;  2ZXI A;  3EUA A;  2LBF A;  2ZSH B;  2VJ5 A;  3BCB A;  3K70 D;  3S93 A;  1WJB A;  3BCA A;  4XL9 A;  3HOS A;  3L2U A;  1MND A;  4PJJ A;  4RM2 A;  2P0W A;  1WJD A;  4XLA A;  4HNU A;  1D1B A;  4B48 A;  2OV7 A;  1BR1 A;  4BXF A;  2KZV A;  3K10 A;  2L9N A;  3DPT A;  2DOA A;  3RQ4 A;  3W2W A;  4H4K C;  2IS6 A;  3LMM A;  3HPH A;  2JVH A;  2V1N A;  1WJE A;  1WJ5 A;  1ERD A;  4IQ4 A;  3SEZ A;  2KMU A;  3NWT A;  2M3A A;  3LFU A;  5FRN A;  2VPL A;  2HPM A;  3DWL E;  1DP3 A;  2X1C A;  3ZQQ A;  4ZTJ A;  3RTR A;  3I3L A;  1PJR A;  3HL2 A;  4P1W A;  4XN0 A;  4F3Q A;  3CMM A;  3M1C A;  2A5W A;  2BVL A;  3PSI A;  2CH0 A;  4OAY A;  1V5G A;  2JVG A;  2XSJ C;  3CES A;  3PNY A;  3DPL C;  4BDY A;  3IAS 2;  3U21 A;  4E7I A;  1UEL B;  1BR2 A;  1G59 A;  3HKZ A;  3H9Q A;  4CA0 A;  2HZD A;  2WAD A;  4ZYA A;  2LC2 A;  3SEQ A;  4RLF A;  4ZJZ A;  2UV1 A;  4PSW A;  2R7T A;  3OYM A;  1X1A A;  2L5Q A;  2BW3 A;  1ZEL A;  3CJR B;  4C2U A;  3OWT A;  2X1E A;  3I9V 2;  2XF5 A;  2ZXH A;  4R79 A;  2DT7 B;  2KRH A;  3K4N A;  3QYF A;  5HOO A;  3E1S A;  3KEY A;  3W2V A;  3MD2 A;  4FET A;  3ZXS A;  2HVS A;  2VKD A;  4E7L A;  1HA8 A;  2W4S A;  2KL4 A;  3QYE A;  3DKX A;  3EUH C;  2PMZ A;  3DTK A;  2WAE A;  2K5C A;  4ZDL A;  4DIQ A;  3L2R A;  1IRX A;  1TT0 A;  2I8D A;  3SYT A;  3VSK A;  1X4P A;  3K70 C;  2R7R A;  4OAZ A;  3K4M A;  2KQR A;  2X1D A;  2VQL A;  1LKX A;  3BC8 A;  4CCO A;  4BQN A;  2RNG A;  4PFO A;  4II3 A;  4CZC A;  4ZDO A;  4N4O B;  2VXD A;  5HNH A;  2WY7 Q;  2JSP A;  4YEJ A;  1BR4 A;  3OL4 A;  3VYR B;  2K3P A;  2HVQ A;  2WA0 A;  1DGR M;  4LIU A;  2VQH A;  4DBQ A;  2GOX B;  4Y3O A;  2KRC A;  3PJR A;  2CUJ A;  3DKY A;  1FMV A;  3ONQ A;  4XON A;  4C2T A;  2HNH A;  2BVM A;  4BJ5 C;  3HPG A;  3PNV A;  4BEH A;  3CP2 A;  2V7F A;  2QKL B;  1D1A A;  3VSL A;  2CV1 A;  4G6T B;  3ZCO A;  4DJA A;  4DBR A;  2W7N A;  1KON A;  2OC6 A;  3LSM A;  3J7A Y;  3PUB A;  3K4J A;  1Z3Y A;  1T95 A;  4OWR B;  1UAA A;  2LY2 A;  2LRE A;  4PJM A;  4HEA 2;  3W2A A;  2PJR A;  4KJZ A;  5CQG A;  5CPR B;  1MMN A;  3BG6 A;  2CW7 A;  2ZFU A;  2CV0 A;  2CW8 A;  4AYB A;  4XR6 A;  3C2G A;  2VIX A;  2AQF A;  4F52 A;  1UG0 A;  4BS9 A;  1D0X A;  3VDX A;  1DQU A;  2VJJ A;  4PUS A;  4D1Q A;  2CUZ A;  4IX7 A;  2M7B A;  2RRE A;  1TZL A;  4QPQ A;  4E4H A;  4D9J A;  5JHF A;  3E0J B;  2F6C A;  3A4C A;  3PFY A;  1FMW A;  2E5Z A;  5TGT A;  5KNL A;  3S3M A;  3CP8 A;  3OMY A;  1GLN A;  1X4O A;  3MMY B;  2IXS A;  3TMO A;  4LG3 A;  4II2 A;  3D5R C;  3HC7 A;  3HXL A;  4AVZ A;  3DTE A;  1N77 A;  2WY8 Q;  4ZTF A;  2LOO A;  3ZRG A;  4BQQ A;  3H35 A;  4E7S A;  4XLE A;  2M4G A;  3H5N A;  4ZC3 A;  4BE1 A;  2M4K A;  1D1C A;  2CMP A;  2WAF A;  1X1C A;  2KHM A;  4FAS D;  3DQV C;  4RMN A;  4BUP A;  2Y0S A;  2IS4 A;  4B44 A;  3PNT A;  4GRI A;  4PJN A;  1K6Y A;  3OS1 A;  4C30 A;  4BDZ A;  3OY9 A;  4CCM A;  4BAC A;  2NOJ B;  4X0G A;  1Z7L A;  4C9Y A;  1W36 D;  4U7B A;  2V4J C;  3FDY A;  1V5E A;  2DT6 A;  4F92 B;  2RQQ A;  1Z21 A;  1AA7 A;  2HDW A;  2VAS A;  4RLQ A;  3FKJ A;  3OYF A;  4J01 A;  1MMG A;  2IS2 A;  3GBG A;  3H0D A;  1X19 A;  3M8J A;  4BE0 A;  1WJF A;  4B43 A;  3MKZ A;  4XKV A;  3D5L A;  3CF2 A;  3QOD A;  2ZSI B;  4BL0 B;  1YX3 A;  4PK4 A;  4J00 A;  4ITV A;  2MC4 A;  3CZ6 A;  4XN3 A;  1MMD A;  2X51 A;  2VKH A;  2HQA A;  2X85 A;  4NUB A;  3K4L A;  4ANJ A;  4BJT A;  1D0Y A;  3CJQ B;  4F93 B;  1X1D A;  2UUZ A;  3IAM 2;  3IP4 B;  4HG2 A;  3AL0 C;  4PFP A;  3NWS A;  4XKC A;  2E60 A;  2XF6 A;  4U87 A;  3HOT A;  4XKW A;  4JOM A;  3DLA A;  3A2K A;  1V5F A;  2VJI A;  3IUO A;  4KIS A;  4E7K A;  4BGD A;  2VLA A;  3TBI A;  2Z2S B;  4E6K G;  3ZGK A;  5LFA A;  1G8X A;  1WFX A;  4RM3 A;  2R7V A;  3UNG C;  1R6R A;  2MD0 A;  4PSX A;  4CCL A;  4XOT A;  2R7O A;  3LSK A;  5KCM A;  1BOB A;  2W00 A;  2GOM A;  2UWM A;  1T0F C;  2WB1 A;  4Y33 A;  3L2W A;  4CCK A;  3AFH A;  4CUG A;  3OOU A;  1MMA A;  1X1B A;  2XDV A;  4LIV A;  4HST A;  1SFK A;  1Y6I A;  1NG7 A;  2X6X A;  4XMY A;  4ZDP A;  2HU9 A;  4HSR A;  4QPO A;  1NG6 A;  2VB6 A;  3FHN A;  3OYH A;  1MW7 A;  4BE2 A;  2DCE A;  4BU2 A;  4E7H A;  2VQG A;  4DOZ A;  3TL4 X;  2MFZ A;  2V6E A;  5FRO A;  3LL7 A;  3W3C A;  3DEE A;  2LBF B;  2VJ4 A;  3QOE A;  3L2Q A;  2W82 A;  3OIP A;  4B47 A;  3RCO A;  2XF7 A;  2HPI A;  4NNJ A;  3FBN B;  2V26 A;  4IQJ A;  3HG9 A;  2LG4 A;  2E1M B;  3BLY A;  4CCJ A;  2LYC A;  4YEL A;  3DPU A;  3KYL A;  2VL8 A;  2R7Q A;  1P9Q C;  3VYU B;  2DXI A;  2VQC A;  4XLC A;  4HNT A;  1W36 C;  1N75 A;  2OUM A;  2F5V A;  3EPZ A;  2LRD A;  1D0Z A;  1YX5 A;  3AKZ A;  3OYJ A;  3K6G A;  2R4G A;  2M0M A;  3OYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...