2W1OA

Nmr structure of dimerization domain of human ribosomal protein p2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
b'AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S ACIDIC RIBOSOMAL PROTEIN P2
publication title Solution Structure of the Dimerization Domain of Ribosomal Protein P2 Provides Insights for the Structural Organization of Eukaryotic Stalk.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 20
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w1oA01
2LBFB 3A1YA 4BEHB 2W1OA 2LBFA 4BEHA
chains in the Genus database with same CATH superfamily
2BVMA 2R93J 2ZCWA 2RQQA 3DPLC 1QGPA 1BC8C 1KZHA 4O3MA 1PUEE 5BS6A 1ZRFA 1R00A 4HNUA 3QYEA 4RGUA 3HDDA 5K7HA 2OA4A 4M3FA 4A3IJ 1H0MA 1S6LA 2JUCA 1DGWY 1MJAA 1JJ6C 1BA5A 3I0TA 1JT0A 3MKWB 1JTXA 4OIRF 3ZQQA 1UHSA 1TQPA 4M74A 5E3NA 2DPDA 4UUVA 2IS1A 2P7CB 1WRJA 2BBYA 2X6OA 5EJCA 2JA6J 1J09A 3I55I 1VQLI 2JUGA 3BDDA 2KRCA 5HS7A 2XSDC 4BY7J 1ZQ3P 1ZHFA 3PJRA 2E35A 3LL7A 3FM5A 1HW1A 1UHMA 3JSOA 1USSA 4AIJA 3BTCA 1OR7C 2XSJC 4U0YA 1GV5A 3HOZJ 3TO6A 2EPFA 5IP7J 2Y69H 1VQ8I 2RDPA 3A03A 2DYSH 2X85A 3FDYA 2CFOA 3LFUA 2IJLA 3RZDJ 5JVGF 1H8AC 4G6TB 1QBJA 3K4LA 3JSPA 3QRFF 2WV0A 2Y9YA 2Z33A 3C7JA 3I4MJ 2WBMA 2FRHA 2GZWA 1ZAOA 1D1CA 4BUPA 5E8IA 3KP3A 4GCVA 2XRNA 1OCTC 3LNQA 5A2QZ 2OV7A 1K4SA 3RTRA 3WU0A 4B09A 2VJIA 1HSTA 1V5GA 2XC7A 5CLSA 4GRIA 5CVUA 3ASNH 2BEOA 4AIHA 5L3BA 1YE9A 4A0YA 2LG4A 4NHJA 1B6AA 2FBHA 3V7RA 2O9LA 4Y17A 2LP0A 2CW0F 1FTTA 1E17A 3GFIA 5EEHA 2M2EA 2QZ8A 1XB4A 2JT1A 3O6BB 5DEQA 1RESA 1GVDA 2CJJA 3CJQB 3MN2A 2VKHA 1POGA 5C4JJ 4CICA 2DTRA 2EIMH 4GO1A 5FGMA 4E70A 2Q1ZB 5HNHA 2FD5A 4RAZA 3ECOA 1GUUA 2CFXA 3ZXSA 2R7SA 4HF1A 1TQIA 4Y52J 1WZ2A 9ANTA 1UHWA 3MEXA 5FFZA 2HKOA 4A3LJ 3SZTA 4ZYHA 1I27A 1RETA 4HX8A 3CCSI 1O3TA 2AS5F 3AG4H 3FIWA 3MD2A 2EWNA 4KMUX 2HQ5A 3GTKJ 4YFKF 2QUFA 2E1MC 3KZZA 1BJZA 3BCAA 2R7OA 2VC0A 2DOEA 3AL0C 1MMNA 3T8TA 4BHCA 3S1RJ 2MH9A 3OYMA 2D1VA 5FD5A 4AD9A 1OYIA 3DF8A 1FPQA 4AUXA 3W2AA 2HDCA 1JKRC 1YQAA 3DBLB 4OOIA 3BR0A 1A04A 1JHHA 3RQIA 2AQEA 2QKMB 3HYIA 3S17J 3VEPA 3TDZC 4ABZA 4AVPA 2DMQA 1KU2A 2KT0A 2XDVA 1FYKA 1TNTA 2H1LA 3QPHA 1MIJA 1B8IA 4KA4A 1A35A 4QPQA 1W5CC 2FQ3A 1QRYA 2M5WA 4X6AJ 1FTZA 2HS5A 2DMUA 4CCOA 1JJ8C 3DLLF 1GDTA 5DUKA 2EZIA 1Z9CA 4RGRA 2HI3A 2ZNZA 3WG7H 3KX2A 4DYQA 2ELKA 4U7BA 2V7FA 3L2UA 5LBQA 3ZQHA 3KYLA 1FZPB 3L09A 4MFEA 1SFKA 3C2HA 2DFFA 4CUGA 5D6EA 3GX4X 1JGSA 2F4OB 3OYIA 2QCOA 4GGGA 2R5YB 4RGSA 5GP9A 2L7MP 3CDHA 3LA3A 4B44A 1WHUA 4PJJA 4OAZA 5FLMJ 1BIBA 3BJ6A 5CVVA 2DAOA 2YX4A 3DEEA 3TQNA 2WB1A 2NNYA 2DA3A 3PNYA 1RIOH 2JVHA 1IUFA 1F36A 2UUZA 3O3KA 4L0YB 1B9MA 1K61A 1IG7A 2KP6A 1XMKA 2FU4A 4ENJA 1IDZA 2BY2A 1MGTA 3BR2A 3HHGA 1LDDA 5E20A 4AM3A 2KMUA 1IN4A 3EUHA 2Z5UA 4KIBA 2Q8KA 5LHGA 3RSNA 1U0JA 3I9V2 3GTPJ 1NH3A 2R7WA 4KISA 1MH3A 1OYWA 1STZA 4H0EA 4BACA 2LY9A 1YOVB 4D5FA 1ZLJA 1ETXA 2AO9A 3PUFA 2MLKA 2CGPA 2XGDA 1E3HA 2XPWA 3ZQIA 3ZQGA 2FNAA 2CQ7A 2M7BA 4A5NA 3HUGA 4GXOA 1U5TB 2GIVA 2L4AA 2LLKA 2UZKA 1MMAA 1YG2A 4MTDA 1Z1DA 5BPDA 3J80Z 2V79A 2DFHA 1SFEA 2CSOA 3WTUC 3ESWB 2E60A 3HZJA 3OIOA 2P5VA 2QVOA 3FXQA 1N77A 5M5YJ 2AXLA 5F6FA 4E6KG 5CKTA 1T39A 4JK1X 4UVAA 4D1QA 4IRIA 5JHUA 2DFEA 4RAGA 5C3EJ 4LIUA 4LJZF 3KYCB 4EJUA 4C3IJ 1ACIA 2LK2A 4WXDA 3G4SI 1D5VA 2Q0OA 3S2DJ 2HPIA 3AFHA 4I7HA 3IRQA 3TO7A 2XF6A 2R7ZJ 2WAQA 5E1ZB 2KIQA 2VLAA 2MA3A 3SQNA 2VB6A 5FKKA 1HLVA 2HWVA 5IOZA 2A6TA 1XGMA 3K70C 2IA0A 1OKRA 1CF7B 4FE4A 4OWRB 2E2HJ 3QYFA 3OWTA 1XMAA 3FBNB 4PK4A 2ZNYA 3LSJA 1BOAA 3CD6I 2MYSA 3H3ZA 2A5YB 4RAFA 1D1BA 2CQQA 3E7LA 4CYCA 2P7VB 2MABA 2H94A 3NWTA 5L3CA 4MTEA 4Z6YA 2LREA 2K3FA 3OR2C 3D0SA 1WWXA 4AU7A 2MD0A 2V4JC 1QZYA 2K9LA 4WXHA 4GFBA 5DV5A 3PFIA 3CC2I 5CVJA 2NVYJ 2DT5A 3T8RA 3JRHA 3H3VK 3SXYA 1VQ9I 2XKPA 2FMYA 3J7AY 1TWAJ 3HSEA 3QOEA 5F04A 5DUIA 3DTIA 2CQXA 4QTRA 1ETYA 2V6CA 1I5ZA 2DJNA 2G0EA 2HTJA 2VODA 1V5EA 4I98B 4ZZLA 2VBWA 4Y15A 3SEZA 2LYCA 4CDGA 1D5YA 4OMZA 2CU7A 4E4HA 2WC2A 3GTQJ 2ME0A 2P6SA 3CP8A 2VOOA 4CCJA 2Q2EA 1Z3YA 3KCCA 4I0BA 4K2EA 1ENHA 4A3DJ 2EV0A 5HDNA 3BLYA 2OAZA 1WFXA 2KZGA 1ZG1A 2PJPA 3KP7A 2H6CA 4IZZA 3T0YA 1FOXA 1GV2A 3KEYA 5H6QA 2NVTJ 1MBKA 4XN3A 4N9IA 1H89C 4XORA 3M7GA 2RAEA 2DMNA 4CA0A 3FZVA 2WY8Q 1ZLKA 2RNJA 2YUSA 3F9KA 2OTLI 1MBEA 4ZDOA 1YRNB 1FNNA 1R58A 3CUQA 3FMRA 3GBGA 4XOTA 4DZJA 1S7AA 5IT9K 5EZHA 3ELKA 5DM6F 3K7AJ 2VONA 3OYNA 2M34A 4GYIA 4V2GA 2V1NA 4YEJA 4XL9A 3H0GJ 2HOTA 3CQZJ 2KDZA 3KP4A 2VIXA 1JI8A 2Y75A 1TBXA 4FX0A 3H35A 4HSRA 4BAYA 5EGOA 3L2QA 4KUMA 2E1NA 2DDBA 3MKYB 5F1RA 1T0FA 1VQNI 4A0XA 1IRZA 3SZPA 1QO0D 3FISA 2Y0SA 3CDLA 2W00A 1X1DA 4HF2A 5K7FA 4IRHA 3HOXJ 2XVCA 4LGWA 3VDXA 4DYRA 3HXLA 2ISYA 1WJEA 3TW7A 2HQNA 4CO8A 1IN6A 3BROA 1QVUA 4M9XA 3F72A 3SEQA 4ENNA 3BR1A 2WY7Q 1W5TA 3K1MA 5GTHC 2HDWA 4I6ZA 1YLFA 2VKDA 3GO5A 4IL6C 3JAMK 3OYLA 3R0JA 5BMZA 5KCMA 1U8BA 4Q5SF 1DUXC 4D7MA 4BXUA 1Y56A 2R3SA 3LSRA 4M72A 2ZXIA 3QU3A 3OS1A 3C2GA 1YX3A 1BC7C 1L3LA 2EFOA 1SVOA 4RLFA 3ABTA 2ZBKA 1UZCA 3CJRB 2EZHA 2DA4A 3B02A 2CUFA 4HNVA 3E5QA 1YS6A 1XCBA 3TO9A 3K4MA 3RYRA 2R5ZB 4Y4RA 3K4NA 4OIQF 4MEXF 1IDYA 2RQPA 5TJJA 3F8CA 5KAFC 1S72I 2BVLA 1O4XA 3IH4A 3CTAA 3J81Z 1MSFC 4J19A 4DOZA 1HXDA 1IN5A 3CUQC 1WI3A 5DD8A 4KIFA 3K4JA 4EVIA 1H9TA 3EYIA 1YTYA 1FP1D 2M1BA 2YSRA 4JP0A 2BY0A 2L9VA 4YRVA 1PJRA 1BL0A 1IXRC 1S9HA 2F5CA 2VBZA 4XQFA 3AAFA 3QODA 4LB6B 1FY7A 2QBYB 3GZ6A 1KU7A 4M9ZA 4FCYA 4G8XA 1IRXA 3DU5A 1RZ4A 4XLFA 1J7KA 1NK3P 2JRTA 3GTMJ 3RZOJ 3DV8A 1FX7A 5KNLA 1X2MA 1X1PA 1TC3C 4E7KA 3KEQA 3JRCA 1R1UA 3SFIA 2ADUA 1TP4A 3D5LA 3MZYA 4MFDA 1SVLA 1T0FC 2BW3B 3FXKA 3GVAA 1IN7A 1SMTA 5L3DA 3KLNA 3KP6A 3SDGA 3KP5A 1FWZA 3QPTA 2NYXA 2VBXA 2FMLA 4B43A 4C30A 4HV5A 1OFCX 5FLXZ 4MGRA 1KU9A 2W82A 2X9DA 1R4MB 2WA0A 3CO7C 2JSPA 2BE5F 2D45A 4UB8C 1HBXG 2XF7A 2NVQJ 1WJCA 1Y8RB 1Q1VA 3RCOA 1SAXA 2ECBA 3OY9A 2QYOA 1D3YA 3IL2A 2XB5A 3IUOA 1MSEC 4I0AA 1IAWA 1VZ0A 5HLTA 4XM3A 1NG6A 1TQMA 1X58A 4EJTA 2ZMEC 3COAC 3BPXA 2W24A 2KRHA 3GEZA 1MDMB 4IX7A 3SHFA 1LPQA 4YIFA 5GPAA 2HYJA 4ITVA 2M4KA 1EA3A 5HVQC 3HC7A 2E5ZA 3CC4I 3SZGA 5ICCA 3J7ZI 1EKEA 4ZH4F 2R7VA 1B1BA 3MVPA 2MBFA 2KIMA 2E7XA 2XV4S 2BGCA 1S29A 4P55A 2O03A 1PP8F 3S2HJ 2LTPA 4G6DA 3KZYA 1BM9A 1JKOC 1WJBA 4YIIA 1LE8A 2PJRB 2GA1A 5M3MJ 4LLLA 5JFRA 3LSHA 1XSDA 3M07A 3R4KA 1M1EB 3C3WA 4YIRX 2NRAC 3SDBA 5FKLA 1G3TA 2L7FP 3H9JA 4RGXA 4L5JA 1IN8A 1Y39A 3MKLA 5ILSA 4NDLA 2Y2ZA 1GVJA 3GCMA 5ICGA 4I76A 3O8HA 3GW2A 3HOUJ 3DXJF 2WADA 5F64A 3ML6A 2A05A 1RR8C 2Y9ZA 2EZKA 4EMSA 3BZKA 2CUJA 3BOQA 4EJWA 4PFOA 3OYHA 1P4AA 2JWTA 2RREA 2IGOA 4DBQA 2RGVA 2DK5A 3UKGA 1Y6IA 4Y13A 1U9NA 2B9SA 3D1NI 1GHCA 4L5IA 2ZFUA 2IGKA 2M4GA 1MBGA 2VASA 4BL0B 2G7HA 3Q9VA 1S5LC 2DA7A 1FLIA 1XSXA 3ONQA 1P4XA 5J6XA 3K70D 1I6XA 2JPBA 1Q1HA 1OISA 1R5GA 2HYGD 2M0MA 1IV6A 2BHYA 3CJNA 2VC1A 3AL0B 4IQJA 4CCNA 3CZ6A 4U88A 5AONA 5EG0A 3CCQI 1QQIA 2XUBA 1DU0A 2IS6A 2B0LA 5AIQA 2CRGA 3BQZA 5D5XB 4YFNF 3WTWC 1AOYA 1LFPA 2V1XA 1BI3A 4IHYA 5KAIC 4XR6A 3KETA 4WXCA 3L1PA 4ZTJA 2QSFX 3AG2H 1T6SA 1F4KA 4LOCA 3Q5FA 3IWFA 2BXZA 4KICA 4X0GA 4G6QA 1RUOA 3SJMA 4M73A 3LSKA 1BOBA 3PNTA 2L7ZA 2LR8A 2PQ8A 4ESJA 2R7RA 1XG1A 3PO3J 1MNDA 2ID3A 2DMPA 4EM1A 3VSKA 2E34A 4LLGF 4KT6A 1W0TA 2DU9A 2Z1DA 3ABKH 3CESA 2VQGA 5E3LA 1WJAA 2ZXJA 4A3KJ 2IS2A 1SFOJ 3R61A 4D9JA 1ETWA 4XLCA 3EQLF 5FO5A 1JT6A 1MJBA 1YX5A 2DXIA 4CXFA 3IWZA 2FBKA 3PQJA 2PBIA 4A2UA 2EB7A 5L3EA 2M8GX 3GXOA 2OBPA 1WJDA 1FBSA 2IS4A 2QEXI 4ZDLA 3MFKA 4BEHA 2ETHA 4A6EA 4OU0A 4ZC3A 4BKXA 4BU2A 3ZMZA 5IPAA 3ABUA 1MW7A 1BI1A 3I59A 3BR5A 3WTXC 3IKTA 5D8LB 2NS0A 4M6VA 2HVQA 3AG3H 2GA2A 2JJ7A 4OIPF 5F0FA 3W6KB 4M9SA 1B4AA 2VQLA 1BR4A 4ZDPA 5LEKA 3I5UA 1RNLA 3NAUA 2O0YA 1XMXA 4G9YA 4HW0A 4NQWA 1FSHA 1HA8A 3JRGA 1MD0A 1P7JA 2XHKA 4E7IA 1RC9A 4W1UA 4HV6A 3M9AA 1R36A 1XC5A 4RBOA 1IC8A 2R4GA 3L2CA 3I56I 1JUSA 2PG4A 2STTA 1CGPA 2I5UA 1HDDC 2DDAA 1R23A 1USTA 1SD6A 1T8IA 1XDSA 3RPUD 1FYLA 3GTGJ 1FMWA 2JN6A 4IO9F 1J5YA 2JA7J 5E3OA 3CCUI 4PSWA 3RKWA 3TKYA 2NNNA 1YS7A 3P5JA 4KN7X 3FX3A 4Q48A 2ISZA 1E3OC 2IXSA 4RB2C 2BV6A 1LFUP 5J47A 2KDOA 2LVSA 3BR3A 5KK1A 4J00A 3W3CA 2Y0SN 4JYKA 1LQ1A 1LDKB 2IP2A 1OQYA 2N8GA 4R8HA 2MC3A 1DP3A 2EJRA 3ERED 5LRSA 4BDYA 1T2KA 3EYYA 3QP6A 3TP3A 3N97A 1DGRM 1TNSA 4A3JJ 5LD2C 4HEA2 2ZJ2A 4PFPA 3K6GA 1FOKA 3DP7A 5KHDA 1HKTA 3F8NA 4ENMA 2VJ5A 2UXNA 1TT0A 3FK7A 3WHCA 3AG1H 5LFAA 1MMGA 3ROUA 1T56A 1ULYA 1V3FA 3F3XA 3PNVA 3OL4A 3HG9A 4UUTA 4CZZA 2DK8A 4FQGA 3I4NJ 2F6CA 1HKQA 4EJOA 3ZQCA 2QGUA 4BJTA 1JXSA 1F43A 1YI2I 4HF0A 4BQOA 1W1WE 5M3FJ 5DD4A 2MSYA 1O7FA 4L9VA 2O7OA 1ONVA 2DA1A 2DQLA 4AWXB 5EDNA 2R92J 1BN5A 2ESNA 3OSFA 1O57A 4Y3OA 2D1HA 4LG0A 3JRDA 4Y7NJ 3CCYA 1V55H 3N4MA 2IT0A 1OCPA 2XAHA 3OYFA 1QZZA 1WJFA 1FOYA 4B1RA 5K5RA 2F4MB 3ZPLA 2JPCA 1VF9A 3TOAA 2KZVA 2ICWG 1J0RA 4P9UA 3DKWA 1TW2A 3FWEA 2ID6A 1R7JA 2HKXA 4L9NA 2QQBA 2OZ6A 1LEBA 3BG5A 3DPTA 1RRJA 3T1BA 1OYYA 2DBBA 2XAFA 3RJPA 4HX7A 2XKOA 3E6DA 1W7PD 2EFWA 3CMYA 3S32A 2P5LC 1W36D 3S3OA 2HOEA 4LB5A 4XONA 2E2JJ 2RC4A 2OJED 2GM4A 2H27A 2R7DA 1T33A 2CS3A 2KISA 4RDUA 3UNGC 1X2NA 1ETQA 1QNTA 4I01A 5GAEJ 4F93B 2CV0A 1ZGWA 4NBQA 1O3SA 3V8LA 5BNGA 2JMWA 2W85A 4PZJA 4P1WA 4XBFA 1JUPA 3DTEA 3P7NA 4A5MA 5HS9A 4HNTA 1EJ9A 5IYBJ 4A0ZA 1YIOA 1JE8A 2E19A 1V54H 3WTTC 6PAXA 4MNUA 4CGZA 3ERMA 4S05A 2FSWA 2UWMA 5HLHA 2M9HA 4LD5A 4QWQA 1LJ9A 3G1LA 1ZH5A 1X3UA 2TCTA 3O8GA 3G71I 2ZSHB 1BW5A 4MQVA 5FB2A 1MNEA 2OU2A 4XLEA 3H9QA 3M8FA 3OYEA 4MHGA 4MO7A 4IF4A 1K78B 3TW6A 3GWZA 3OV8A 3K10A 4FT8A 4XSZF 4W97A 5GTIC 1YO5C 1O3QA 3UR3C 1KONA 4ZZDA 2I8DA 2ZSIB 3G73A 1G59A 1LB2A 1MMSA 2KQRA 3GMEA 1IGNA 2HVSA 1IXCA 2V9PA 1R71A 2YU9J 2Q2EB 4UNOA 3GFMA 2PX9A 2VL8A 4G7HF 2FA5A 3HIFA 3IC7A 2XGEA 2B7EA 1WSUA 1VQKI 1FBUA 1APLC 3G2BA 3TP0A 3QQAA 5D4SA 1G6NA 3K4KA 5JLXA 2F5EA 1ORKA 3D5RC 3ZQFA 2V1UA 2A6EF 3IHUA 2QWWA 4N4OB 3J81K 5F08A 1UMQA 2MW8A 3I53A 3KZIC 2R5YA 2CW8A 3ABMH 2C6YA 1E2XA 3CUQB 2WWYA 1VQOI 1D8KA 2Z16A 2HOSA 3S1MJ 3A4CA 4PJ0C 3HRUA 3L2WA 3JTHA 3H5RA 1MBHA 3DBRB 3HSRA 2V9KA 3C2BA 4ZYDA 2VPRA 3V7SA 3KPHA 1G3SA 2UV1A 3EUHC 4HG2A 4D7NA 2PI0A 1B9NA 1JKPC 3K2ZA 3KIOA 2A07F 3WE2A 3I4PA 1UAAA 5L3GA 5EGOB 1W0UA 1OCCH 5HDGA 4QSHA 2O61A 4FX4A 1Z7LA 2W84A 2A61A 3J7YJ 2ZJQF 3BC8A 4HA8A 3CMMA 2L9SA 4FETA 3FKJA 4MIMA 3A02A 4WF2A 4KMFA 5TGTA 4Z2YA 1OLTA 2DFIA 3QPSA 3M8EA 2LRDA 3SYTA 4EJVA 3F8FA 4PJNA 2AQFA 2JRMA 2KIUA 4YELA 3GF2A 1BW6A 2DA2A 2Y31A 3OS0A 3TEDA 1JHFA 3EUKL 2NS7A 1Z77A 2PMZN 1KQ8A 2L2OA 2FF4A 1PUFA 2V26A 2JVGA 1W7PB 3P9CA 3HOSA 3HHHA 2DQRA 2ZMEB 2A69F 2QSHX 1AWCA 2X4HA 2A3SA 1EV7A 2MLGA 3F21A 4L9TA 3LQQA 1IRGA 2F5VA 3M1EA 3DWLE 5TISC 3RKXA 1K6YA 2HU9A 4KIGA 2PN6A 4IEJA 1GXQA 3B6AA 1D0XA 1VTNC 2DMTA 4BHPA 4XICA 2KJCA 1SD5A 2K27A 1B72A 1KQ0A 2OZUA 1I1SA 3QWLA 2VJJA 3ZMUA 2O8KA 2VPLA 4UV9A 5F1JA 1ZARA 3PQKA 4RM2A 4GYGA 3WODF 3R6SA 2W25A 4IPAA 3CP2A 1X3WB 3CCEI 5KVRA 4E7LA 5M5XJ 4BYYA 4BE0A 3B6CA 3E3VA 4BXXJ 4FHTA 1X4PA 1QA6A 3GTOJ 3OYJA 2EV5A 1D0YA 2F5DA 4N9HA 4E7ZA 2W4SA 1WVRA 2DOAA 3VWBA 2H6BA 1WH5A 2IRFG 5TRDA 4A69C 2Y48A 3MZ8A 5IY5H 4ZYGA 5JR3A 3OOUA 5B66C 1Z6TA 1FMVA 3ZP5A 3FXOA 4XN0A 2HZTA 4HOBA 4G12A 3VPRA 1MKMA 1QHGA 3H36A 2HEOA 3VB2A 3HPHA 3JRIA 1X3ZB 3A0BC 3M8JA 1N75A 3GLXA 2FBIA 4HLXA 2K86A 3KYDB 2VUMJ 2VBYA 2GLOA 2RV8A 3I58A 1U9OA 2R7QA 3LMMA 2GWRA 5BPIA 2K3PA 2EK5A 1J75A 2VQCA 3EETA 2IA1A 4QPOA 5GAGJ 3FXRA 4XOPA 3BZCA 4BE1A 4I99C 1H9GA 1MH4A 3NARA 4IXAA 4BQNA 4KNYA 3L7WA 4XLAA 4KDPA 3TOBA 3CCRI 2R7UA 3PFYA 3IH3A 4BNCA 5D5VB 4G7ZF 4D5CA 2CV2A 2K02A 2LF8A 2BXYA 3IAS2 2H8RA 1CQTA 1EH7A 2KKOA 1TTYA 2XAGA 1V4RA 3BZ6A 3J7AO 2F48A 4HQMA 3CC7I 5HLIA 4RB3C 3QYBA 1WQ2A 5FD6A 4BH9A 1W5SA 4C9YA 1XDUA 4EEFG 2CQKA 2M3AA 3BQYA 5FRMA 1K79A 1OJLA 2WTEA 2IGMA 2P81A 4ON0A 3V8JA 1I39A 3BTLA 4G7OF 1FC3A 4H4KC 5LGUA 1VQ4I 2O6GE 1XSVA 1U2WA 2X1DA 2CG4A 2YX7A 4GDFA 1R1VA 3N05A 1GXPA 3HOWJ 4BBRJ 4U0WA 3V7CA 2LBFA 2HGCA 2E71A 2IBDA 2VE9A 2PMHA 1KA8A 2P6TA 3TGNA 3AKZA 4ZTFA 2Z9OA 5ICFA 5CVIA 3OYCA 4EGYA 3EUAA 2H09A 1AKHB 3M4OJ 2X48A 4M3BA 4ZYEA 1MZBA 4DBRA 5J4YA 2TRTA 3TDUC 4IQ4A 3H1CA 3FF5A 5B1AH 2LY1A 2HYFA 3FKIJ 4BE2A 4IHVA 2CYYA 3WGHA 3CF5F 1XTAA 1HQCA 4CH7A 4A93J 3MAJA 3Q0UA 2P5KA 3OYDA 2HOAA 2Z99A 3IH2A 2ZB9A 2O3FA 3KLOA 3RKQA 4UUSB 4KT5C 3CCJI 5FLVA 2XAQA 2VKVA 5EG0B 1ON1A 3BJAA 2COMA 4XMYA 3E6MA 2CW7A 5A2QK 2XAJA 1TW3A 4HDUA 5CJ9A 1FIAA 4UHTA 3U2RA 4FISA 1W4MA 3BG9A 1WI9A 1YHQI 3R60A 4UVBA 1PYVA 3WTZA 5DM7F 3PIOF 1JTYA 5B1BH 1RUNA 3R0AA 4AVZA 2R5ZA 1Z6RA 3ISPA 2DTZA 2MD5A 2CQNA 5IP6A 1DPUA 3DBHB 4EATA 1IJWC 1ZG5A 5DTDA 3FMQA 3CUOA 5D6FA 4II3A 4JQFA 2K9MA 4DJAA 2XGCA 1S7OA 4RB1A 3WE3A 2X6YA 5IT9Z 3IRRA 1LUJB 4UY8I 2EFQA 3A2KA 5E17F 2FOKA 3JCUC 3B73A 5CPRB 5LHHA 2KL4A 1LEAA 2FX0A 5ILVA 2MGQA 1DDNA 5E79C 5J1YA 4JBAA 3A0HC 3A01A 4A3GJ 2QM3A 1RPWA 4I09A 2FJ1A 4F92B 1LDJA 2DCEA 4C2MJ 1OCZH 1FJLA 4C2UA 2DO7A 2NAZA 1X1CA 2VT3A 3VSLA 4HDVA 1Y0NA 4MQ9F 3IV5A 3FHZA 1T98A 2ELHA 3DEWA 1SAUA 4BHBA 2L54A 1IF1A 3U9GA 2E1MB 1ITYA 5F27A 3S15J 4WCGA 2IPQX 5JLWA 2VE8A 4M3GA 4AC0A 3HKZA 1LNWA 1IW7F 2EZLA 3X2QH 3HTUA 5M5WJ 1K4TA 2K9SA 1L0OC 1JKQC 2HVRA 1JGGA 1IRFA 1ZGJA 1BR1A 3ZR8X 1D0ZA 3JTGA 3E97A 1TLHB 1FSEA 3GYHX 3I64A 4L9JA 3WU1B 4AYBN 1KYZA 1IO2A 2X51A 3I71A 2DLLA 2P4WA 2ME6A 1LVKA 1TWHJ 1AHDP 2GXBA 2IW5A 3MKZA 5DS9A 4NQWB 2JA2A 2R0QC 3OIQA 2W1OA 4DZPA 2R7TA 2NVXJ 3E0JB 3ZCOA 1HSJA 1K83J 1J59A 3FXJA 4RB0A 4XRSA 2PMZA 1SD4A 4KN4X 2LMDA 2V1DA 3ZMSA 3HB9A 3REOA 3S1QJ 2IAIA 2HNHA 4XSXF 4A12A 2UXXA 5EYRA 4WK8F 2PJRA 4IHSA 4YG2F 1XS9A 4PJLA 3BT9A 2GXGA 4HYEA 3FMSA 4LK1F 2OCEA 4L18B 3BJOA 3NQOA 1O7LA 3ZOBA 1Z0XA 2EIKH 4I02A 2HQAA 3JW4A 1P6RA 2YS9A 4JX5A 4A3FJ 4RLQA 4ZYAA 4XKWA 4C3HJ 5EF6A 1X4OA 2V9VA 3K1NA 4NC8A 2IVMA 3LQRA 2L7KA 2STWA 2DA6A 4M6YA 1DPRA 3HGGA 2EFNA 2MG4A 3E6CC 2DPUA 1WGXA 4OMYA 1EH8A 2L01A 5DCMA 3MWMA 3K1PA 4CSWA 1UFMA 1TL8A 2XPUA 2K4JA 3BTIA 2FNPA 1A6QA 2QQAA 1N25A 2ELJA 3HOTA 2OTJI 2OCCH 2NOGA 2JSCA 1S8NA 2D2WA 3D5SC 2FXAA 2H1KA 1BBYA 1ZK8A 1WCMJ 3BG6A 3Q3SA 4D0PA 3J80K 2GXAA 3V8KA 3OL3A 4OINF 1U8RA 5HOOA 2QENA 5K7ZA 4BDZA 3LSIA 2DI3A 3PL8A 2ZKZA 2GBYA 1G4DA 3FXMA 2X1EA 1R1TA 5EEGA 3FM3A 4RAYA 2OD5A 3S16J 5IT3A 1I50J 2DT6A 1B8IB 4LG0B 2HZDA 2XAUA 4F3QA 1DP7P 2DT7B 2P8TA 2OPTA 1IV8A 3HRSA 4NUBA 4KFCA 3BTJA 2YR2A 2K9NA 5ICEA 2RVCA 2Y30A 3GFJA 4XRFA 3S14J 5FFXA 2L02A 1F5TA 2PMUA 4CHUA 3WHBA 1RR7A 4HRIA 1HKSA 1BR2A 2M7AA 3G1MA 3RIRA 1B59A 2H8WA 2BY1A 2E1OA 3CF2A 1ODDA 4KITB 1FP2A 4G94A 3NEUA 4LIVA 3W6VA 1K6OA 5LHIA 3VYSB 1PDNC 3MZHA 1BI0A 3EDPA 2VI6A 3GLLA 2KIFA 2XGXA 1MNMC 3S1NJ 3VYUB 1I3QJ 2EQRA 3L9FA 1Y1VJ 4BQQA 4RS8A 3CLOA 2FEZA 5IYCJ 5JI6A 4EM0B 1RI7A 3SFZA 1DU6A 3ZRGA 1X1AA 3JRBA 1U6GA 4DYCA 1S7EA 1QHHD 4XLPF 2RN7A 3K4CA 3LSMA 3JRAA 3KP2A 3LAPA 5EZGA 4N0BA 1FOWA 3E5XA 1YITI 4HAMA 5J3LA 1SFUA 4PDKA 5LEJA 1REPC 5HDKA 3L2VA 1Z67A 4F52A 2XRLA 2ZJPF 3OIPA 4CCKA 3HUGB 1QU3A 2JZYA 1P4WA 1HCRA 1R5HA 3TL4X 3OOPA 2EV6A 4Y33A 4DNCA 2LNBA 2JQ7A 1I3AA 5HLGA 3IKVA 4A6DA 1Y8QB 5H20A 2P0WA 3LFKA 4IHTA 5CQEA 2O5RA 2HXIA 2L9NA 4CCMA 3P9IA 2CV1A 1ZR4A 3V4GA 5FROA 1R9TJ 2M45A 3ZQLA 3CMAI 3HOYJ 4FE7A 1VQMI 1MMDA 3DLAA 3QOPA 3IAM2 2VKEA 1FYMA 1VQ6I 3HBLA 1BJAA 1SMYF 2DYRH 2CUEA 5JVTA 4RM3A 1VQPI 2LOOA 2ZXHA 2ZJRF 4O5VA 2G7UA 2IEKA 4P9FA 4IOCF 2NXNB 1ZRDA 4E7SA 3PO2J 4IRGA 4HZFA 1WJ5A 2F5FA 1TZLA 1ZN2A 3ZMVA 3OYAA 2A5WA 3F23A 3QPLA 2EA4A 4B4CA 4B8XA 4CYDA 4N4NB 4EM2A 3IP4B 1R49A 2E2IJ 4HPQA 2GIZA 3GTLJ 1QZEA 3DTKA 5C44J 5GADJ 4CYCB 5FKMA 4EV0A 1KQ9A 2QQ9A 1D1AA 1R6RA 3BG3A 5CYVA 2VXZA 3LWFA 2B63J 2J5PA 1BI2A 3HL2A 2EINH 2OC6A 2XB0X 1FEXA 2EA2A 2LFBA 1SEUA 3T5XA 3U21A 1Z91A 5K1YA 4ZJZA 1OCRH 5LGTA 2ZC2A 1Y1WJ 1LFBA 3VODA 3L2RA 4XLHA 4BY1J 4U0VA 2M8EA 1XPXA 3OYKA 2KJBA 3EPZA 3HRMA 2G9WA 4ETSA 4JX4A 4ESFA 3BWGA 2F2EA 3WU2C 4DW6A 1GT0C 3O2PE 5J1RA 2OF7A 1MBFA 2D5VA 2VN2A 4KJZA 2DJIA 1HW5A 1KU3A 3OSGA 4PGHA 4BJ6C 4IHWA 1N78A 2CWEA 2E36A 2KLOA 2RKHA 3VYRB 4FTHA 2WV1A 2O8XA 1SC7A 1PUFB 3OR1C 1OCOH 1UG2A 2DW4A 4PCQA 3S93A 2XASA 5C4XJ 1YJNI 4AYBA 3MMYB 4BS9A 2A68F 4NNJA 2NS8A 2OQRA 3CJTB 5CQGA 4V19K 3ZN0A 1QPIA 3GFLA 1OPCA 2LSOA 3NRVA 3PSFA 1P2FA 3BP8A 3G3ZA 3DQVC 3DPUA 4DQ2A 3L00A 3I54A 2W48A 5AIPA 1I6HJ 3LAJA 3ZN1A 4C2TA 3RQ4A 1EF4A 1X1BA 1WPKA 4M3EA 1A36A 3M3YJ 4WWCA 1MJ9A 2R7XA 1B72B 1R5ID 3VYTB 3HKZN 5D4RA 2IA2A 2M0CA 1Y0UA 3BR6A 4JOMA 3HPGA 2HXOA 3LA2A 2KPMA 1VQ7I 4F55A 2X6XA 1P7IA 1ZELA 4II2A 1T95A 1SANA 2X6WA 2L0KA 2EFPA 4XKBA 5D8KB 1HW2A 2BY3A 3DKXA 2CH0A 5B3SH 1P9QC 3BCBA 3F8BA 2LKXA 3RPUA 4S0HB 5FLXK 2BHZA 1F1ZA 1KGSA 1SFXA 5GAHJ 2MH2A 3F6OA 3I3LA 4PJMA 3K69A 2YU3A 1R4NB 2F4IA 1U5TA 5JHFA 1IUYA 2PFBA 2EILH 4PGGA 1Z05A 3PM1A 2DN0A 4BGDA 2X1CA 3VOEA 5FJ8J 1ZRCA 1XD7A 4CZCA 1K78A 3FXUA 2FOWA 3BY6A 2QQ8A 4A3BJ 1A6IA 2I10A 1ZG3A 5FKOA 4LLNA 3GZ5A 5J40A 4QLCU 4M6XA 1AA7A 3Q9SA 5E18F 4A3MJ 4NB5A 4QIWN 3HOVJ 5HNFA 1GLNA 2Z3YA 5BQTA 4ENKA 2TDXA 4NC7A 3RPQA 3TBIA 3PUBA 5ILUA 1YW9A 3CDIA 1VNDA 3G6EI 5IP9J 1E3PA 3FHNA 4PUSA 1U78A 4HX4A 1RKWA 3H5AA 3H92A 4XLNF 3K2AA 1HDPA 3BPVA 1CF7A 2W7NA 4OIOF 2L3DA 4LG3A 2JA5J 2VJ4A 1ZR2A 1Z21A 2GQQA 3BG7A 4E7JA 4I2OA 3K4BA 2MC4A 1ZYRF 1XGSA 5FKNA 1MBJA 3HTSB 2BYVE 1YIJI 2W57A 5F0CA 5E3MA 1IXSB 3OYGA 2QSGX 4ESBA 2EIJH 4LK0F 4BQAA 2CMPA 4B3XA 5D5WB 1A5JA 2BOLA 5LGNA 5IOYA 3FXLA 4IVNA 4EGZA 3W6JB 3C18A 3H0DA 1G8XA 1JUMA 4Q47A 3S2WA 2XROA 2K40A 5K5QA 3Q0VA 1IZ1A 3Q0WA 2LBFB 4ANJA 1ZREA 3ZMDA 1U5TC 2K4BA 2VOPA 2ESHA 1Z3XA 5J4VA 2KFDA 1FBQA 1G3WA 5L3FA 2LKPA 1R22A 2OQGA 3H3UA 2HDDA 1ZTRA 4F7ZA 3HGYA 1A31A 2K5CA 4R1HA 3RDIA 4BXFA 3U1DA 3WG9A 2KHMA 4AIDA 4V2FA 3W2VA 1UCRA 5E1WA 3KEOA 2JTVA 1U3EM 1W7PA 1T08B 4RA2A 3RKYA 4UV8A 3LSPA 3VFZA 5ED4A 2ZMEA 2E7WA 2JK3A 5D5UB 1RKTA 2EH3A 4LITA 3WTSC 2QLZA 3OS2A 3U1KA 4EQQA 3JR9A 5LRRA 3GZNB 5DCFA 1YRNA 1WKMA 3ZGKA 1UB9A 3QU6A 5ERIA 3PIPF 3W2WA 4FASD 1XGOA 4M3DA 1UG0A 2QF7A 2LD5A 5J8CA 4B3AA 4XRMA 3E1SA 4L0ZB 1HF0A 2FE3A 4HQEA 1G3YA 3V42A 1G2HA 2WAFA 1X19A 1TT5B 2RNGA 3K9TA 3ULQB 3C1DA 3CCMI 3DFGA 5DDGA 2LKSA 5J8FA 1LE8B 3E6BA 2K9QA 4NC6A 2LC2A 2M30A 2QKLB 5FRNA 3LSGA 3CMEI 1SVMA 3ECHA 1OMIA 1XCVA 1NTCA 4XNFA 3OYBA 2ACJA 5F0HA 4HLYA 3KE2A 3HJEA 3JRFA 4DIQA 5LLQA 3K0LA 4HSTA 1ERDA 2LDUA 3CCLI 4IHXA 1NG7A 3QP5A 3RYPA 4IKFA 4XIDA 1ETVA 1UELB 1ZGAA 2NOJB 4KYWA 4MLOA 3A01B 1Z7UA 1SD7A 2XIGA 3H9GA 4MEYF 3F0CA 4XKCA 1HC8A 1O3RA 4Q4ZF 4AIKA 3ZMTA 3LSTA 4HBLA 4F91B 2XF5A 1F9NA 1FIPA 3ABLH 4IJAA 2GAUA 4PSXA 3DKYA 3HSFA 3HEFA 2E5NA 1FT9A 2K85A 3A1YA 4RMNA 2K7LA 2HPMA 4A3CJ 2KRFA 4R79A 3WGGA 2V6EA 1UJ8A 4LFUA 4U87A 1TWCJ 4P5OA 5E1XA 2BZTA 2QA4I 5E8GA 3WGIA 2R7FA 1W36C 3PSIA 1QPMA 1ON2A 1D8JA 1QVTA 4E7HA 1BIAA 1KYWA 4L5EA 2J5OA 2PEXA 2ECCA 3F6VA 3RI4A 2COBA 3E5UA 1VFCA 2NVUB 3F8MA 1I1GA 5BOXA 1LVAA 1XGNA 2FQ4A 2X0LA 3NWSA 1XX5A 1YJ9I 2CUZA 2WB1N 1T38A 4UB6C 5GPCA 3DCFA 1J9IA 2WAEA 2GOXB 2HQRA 4B48A 5H2FC 1EH6A 2IGNA 1XN7A 4X1EA 4TV7A 3G1OA 1E0EA 2Y0MA 3KFWX 1LKXA 2QBYA 3MQ0A 3S3MA 2HR3A 3DU6A 4UXNA 2LY2A 2AXTC 2M87A 2MFZA 4OAYA 4BJ5C 1K7AA 3M1CA 1NHAA 2YPRA 4YFXF 2Z2SB 2PLYA 3GUDA 4J01A 4B47A 2L9RA 4ASNA 2ZXWH 4S04A 3CCVI 4BBSJ 4LMYA 5HS8A 1AU7A 2BW3A 1PVEA 3WTYC 2LF7A 2ZO4A 4WX9A 2HFHA 4C3JJ 1YJWI 3LA7A 2E1CA 1DQUA 1YW8A 4BEHB 2XPVA 1VI0A 3I59B 5EEAA 3S3NA 5IYDJ 1YYVA 2AHQA 3ZQ7A 4A3EJ 5K5OA 5B5EC 1AKHA 2L4MA 1HOMA 5DCMB 1ZKGA 1ETOA 1P92A 2CO5A 1OR7A 2ZFWA 2EBIA 5DYMA 3H5NA 2A6HF 2LH9A 3DEUA 3MCZA 4M71A 4CCLA 2OUMA 1WH7A 3ASOH 3P9KA 3OMYA 1TWFJ 1VQ5I 3JAMZ 2VXDA 4XKVA 2GOMA 3F22A 3FK6A 5J1UA 1MDMA 3HM5A 1C0WA 2VQHA 3FBIB 2HTSA 3S8PA 4XK4A 1H88C 2JA8J 4IOAF 3HRTA 4UUSA 4XRSG 1J2XA 1ETKA 4UVCA 4P96A 2DOFA 5H6RA 3TMOA 1YW7A 1V5FA 3CLQA 2L5QA 2WAQN 4O6JA 1S3JA 5CVRA 2DODA 2DA5A 5HODA 1NK2P 3JREA 2VT2A 4U7DA 1TWGJ 3CO6C 1PP7U 4DGWB 1YFHA 3QAHA 3LOCA 3GTJJ 3WTVC 2FUG2 4JX6A
chains in the Genus database with same CATH topology
1OLTA 2BVMA 2O5RA 2L9NA 4XLFA 1IRXA 2RQQA 3DPLC 3DU5A 4CCMA 2LRDA 3SYTA 2CV1A 5FROA 4PJNA 2AQFA 5KNLA 4YELA 4HNUA 4E7KA 3QYEA 3OS0A 3D5LA 1MMDA 3DLAA 1T0FC 2BW3B 3EUKL 3IAM2 1DGWY 2L2OA 2V26A 2JVGA 4B43A 4C30A 3MKWB 4RM3A 3HOSA 3ZQQA 2LOOA 2W82A 2ZXHA 2WA0A 2JSPA 4E7SA 2XF7A 2IS1A 1WJ5A 1WJCA 3RCOA 1TZLA 2F5VA 3DWLE 1J09A 3OY9A 3OYAA 1K6YA 2A5WA 2HU9A 2JUGA 2KRCA 3IUOA 1VZ0A 3PJRA 5HLTA 4XM3A 3LL7A 1NG6A 4N4NB 3IP4B 2KRHA 1D0XA 4IX7A 4HPQA 4ITVA 2M4KA 1OR7C 3DTKA 2XSJC 1EA3A 5HVQC 3HC7A 2E5ZA 3SZGA 1D1AA 1R6RA 2VXZA 2X85A 3FDYA 2VJJA 2CFOA 3LFUA 3HL2A 2VPLA 2R7VA 2OC6A 4G6TB 4RM2A 3K4LA 3U21A 4ZJZA 3CP2A 4E7LA 1WJBA 3L2RA 2PJRB 4BE0A 2WBMA 4XLHA 4BUPA 1D1CA 3OYKA 3EPZA 1X4PA 3LSHA 3OYJA 2OV7A 1D0YA 3RTRA 3SDBA 3H9JA 2VJIA 4E7ZA 1V5GA 2DJIA 2W4SA 4KJZA 2XC7A 2DOAA 4GRIA 3VWBA 1YE9A 4BJ6C 3OOUA 1N78A 2LG4A 2WADA 1FMVA 2KLOA 3VYRB 4XN0A 3OR1C 1QHGA 2CUJA 3HPHA 4PFOA 3M8JA 3S93A 1N75A 3OYHA 2RREA 2IGOA 3CJQB 4AYBA 4DBQA 3MMYB 4BS9A 4NNJA 2VKHA 1Y6IA 5CQGA 2ZFUA 2IGKA 2M4GA 2R7QA 3LMMA 2VASA 2Q1ZB 4BL0B 5HNHA 2K3PA 3PSFA 3DQVC 3DPUA 3ZXSA 3ONQA 2R7SA 2VQCA 4QPOA 3K70D 2M0MA 4XOPA 4BE1A 4C2TA 3AL0B 3RQ4A 1X1BA 4IQJA 4CCNA 3CZ6A 4BQNA 4XLAA 2IS6A 2R7XA 3MD2A 2R7UA 3PFYA 3VYTB 2E1MC 4JOMA 3HPGA 1LFPA 2KPMA 4F55A 2CV2A 2X6XA 3BCAA 2R7OA 1ZELA 4II2A 4XR6A 4ZTJA 3AL0C 1MMNA 1T95A 2X6WA 3IAS2 3OYMA 4XKBA 4X0GA 3DKXA 2CH0A 1P9QC 3BCBA 3W2AA 3LSKA 3QYBA 1BOBA 4C9YA 3PNTA 3I3LA 2AQEA 2QKMB 2M3AA 4PJMA 5FRMA 2R7RA 2F4IA 2IGMA 2XDVA 5JHFA 1MNDA 4H4KC 4QPQA 3VSKA 2X1DA 4CCOA 4KT6A 3N05A 2Z1DA 3CESA 2LBFA 2X1CA 2VQGA 4BGDA 1WJAA 4CZCA 2IS2A 3KX2A 4U7BA 2V7FA 4D9JA 3L2UA 3AKZA 4XLCA 4ZTFA 3OYCA 1YX5A 3EUAA 3KYLA 2DXIA 1SFKA 3C2HA 1AA7A 4CUGA 4DBRA 3OYIA 4IQ4A 2LY1A 4BE2A 1WJDA 5HNFA 1GLNA 2IS4A 4CH7A 4NC7A 4ZDLA 3TBIA 3PUBA 4B44A 4PJJA 4BEHA 4OAZA 4BU2A 4ZC3A 3OYDA 3DEEA 1MW7A 2WB1A 3PNYA 2JVHA 3FHNA 4PUSA 2HVQA 3H5AA 2UUZA 4XMYA 2KP6A 2CW7A 2W7NA 4LG3A 2VQLA 2VJ4A 1BR4A 4ZDPA 1Z21A 3BG7A 4E7JA 2KMUA 3K4BA 2MC4A 3RSNA 1U0JA 1HA8A 1PYVA 3I9V2 4AVZA 2R7WA 4E7IA 4KISA 4EATA 3OYGA 4BACA 2CMPA 4B3XA 2R4GA 2BOLA 4II3A 4JQFA 2K9MA 4DJAA 3H0DA 1G8XA 2M7BA 3RPUD 2X6YA 1FMWA 1MMAA 4PSWA 3A2KA 5CPRB 2KL4A 2IXSA 2E60A 2LBFB 4ANJA 1N77A 1Z3XA 4E6KG 2KDOA 4J00A 5CKTA 4F92B 2DCEA 3W3CA 4D1QA 1LDKB 2K5CA 4C2UA 4LIUA 3VSLA 1DP3A 1X1CA 4BXFA 2KHMA 3W2VA 4BDYA 1SAUA 1DGRM 2E1MB 2HPIA 5LD2C 3AFHA 4HEA2 2XF6A 4PFPA 3K6GA 2WAQA 3HKZA 2VLAA 5KHDA 2HVRA 2VB6A 4LITA 2A6TA 2VJ5A 1BR1A 3OS2A 1TT0A 3ZR8X 1D0ZA 3K70C 5LFAA 4OWRB 1MMGA 3PNVA 3QYFA 3OWTA 3OL4A 3ZGKA 3HG9A 3FBNB 4PK4A 2X51A 3W2WA 4FASD 2F6CA 1LVKA 1UG0A 2MYSA 3MKZA 3E1SA 4NQWB 4BJTA 2JA2A 3V42A 2WAFA 1X19A 2RNGA 2W1OA 3OIQA 1D1BA 4BQOA 2R7TA 2MABA 3E0JB 3NWTA 3ZCOA 2LREA 3OR2C 2LC2A 2QKLB 5FRNA 4AU7A 2MD0A 2V4JC 2K9LA 3LSGA 2PMZA 4XNFA 4Y3OA 3OYBA 3J7AY 3QOEA 2HNHA 3DTIA 3OYFA 2PJRA 4DIQA 1WJFA 4HSTA 1ERDA 1V5EA 4PJLA 1NG7A 3SEZA 4IKFA 2LYCA 1UELB 2NOJB 4MLOA 4E4HA 2KZVA 4XKCA 3CP8A 3H9GA 2HQAA 4CCJA 4F91B 1Z3YA 2XF5A 4RLQA 4ZYAA 4XKWA 1X4OA 4NC8A 3BLYA 4PSXA 2L7KA 3DKYA 1WFXA 2E5NA 3DPTA 4IZZA 3A1YA 4RMNA 3KEYA 4XN3A 2HPMA 4XORA 3S32A 1W36D 4R79A 3S3OA 2V6EA 4CA0A 4CSWA 2WY8Q 4XONA 4U87A 4P5OA 2CS3A 3F9KA 3UNGC 4F93B 1W36C 4ZDOA 2ELJA 3HOTA 2CV0A 3PSIA 3GBGA 4XOTA 4E7HA 4P1WA 3D5SC 3DTEA 3OYNA 3BG6A 4HNTA 3OL3A 2V1NA 5HOOA 4YEJA 4XL9A 4BDZA 3LSIA 3NWSA 3PL8A 2UWMA 2CUZA 2VIXA 2X1EA 1JI8A 3H35A 4HSRA 2WAEA 2GOXB 4B48A 2IGNA 2DT6A 3L2QA 2ZSHB 2HZDA 2XAUA 4F3QA 3MKYB 2DT7B 1MNEA 1E0EA 4XLEA 3H9QA 1LKXA 3S3MA 3OYEA 4NUBA 3DU6A 2Y0SA 2LY2A 2MFZA 4OAYA 4BJ5C 2W00A 1X1DA 3M1CA 2Z2SB 3K10A 4J01A 4B47A 3UR3C 1KONA 2I8DA 2ZSIB 3VDXA 1G59A 3HXLA 2KQRA 2HVSA 1WJEA 2BW3A 2Q2EB 4HRIA 2VL8A 1BR2A 2M7AA 3SEQA 2WY7Q 2HDWA 3CF2A 2VKDA 4KITB 3G2BA 3OYLA 1DQUA 4LIVA 5KCMA 4BEHB 3K4KA 3S3NA 3VYSB 1Y56A 3D5RC 2ZXIA 3OS1A 3VYUB 3C2GA 3H5NA 1YX3A 2LH9A 4BQQA 4N4OB 4CCLA 4RLFA 2OUMA 2CW8A 3OMYA 3ZRGA 1X1AA 3CJRB 2VXDA 4XKVA 2GOMA 2VQHA 2Z16A 3FBIB 1QHHD 3S8PA 3A4CA 3K4MA 3L2WA 3K4CA 3H5RA 3K4NA 4Y4RA 3LSMA 2V9KA 2BVLA 3TMOA 1V5FA 2L5QA 4DOZA 2UV1A 3EUHC 4HG2A 3L2VA 3K4JA 4F52A 3OIPA 4CCKA 1UAAA 3HUGB 1QU3A 4YRVA 1PJRA 3TL4X 1S9HA 4Y33A 4XQFA 1Z7LA 3QODA 4DGWB 3BC8A 3CMMA 2L9SA 2P0WA 3FKJA 4FETA 2FUG2 5CQEA 5TGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF B;  3A1Y A;  4BEH B;  2W1O A;  2LBF A;  4BEH A; 
#chains in the Genus database with same CATH topology
 2BVM A;  2R93 J;  2ZCW A;  2RQQ A;  3DPL C;  1QGP A;  1BC8 C;  1KZH A;  4O3M A;  1PUE E;  5BS6 A;  1ZRF A;  1R00 A;  4HNU A;  3QYE A;  4RGU A;  3HDD A;  5K7H A;  2OA4 A;  4M3F A;  4A3I J;  1H0M A;  1S6L A;  2JUC A;  1DGW Y;  1MJA A;  1JJ6 C;  1BA5 A;  3I0T A;  1JT0 A;  3MKW B;  1JTX A;  4OIR F;  3ZQQ A;  1UHS A;  1TQP A;  4M74 A;  5E3N A;  2DPD A;  4UUV A;  2IS1 A;  2P7C B;  1WRJ A;  2BBY A;  2X6O A;  5EJC A;  2JA6 J;  1J09 A;  3I55 I;  1VQL I;  2JUG A;  3BDD A;  2KRC A;  5HS7 A;  2XSD C;  4BY7 J;  1ZQ3 P;  1ZHF A;  3PJR A;  2E35 A;  3LL7 A;  3FM5 A;  1HW1 A;  1UHM A;  3JSO A;  1USS A;  4AIJ A;  3BTC A;  1OR7 C;  2XSJ C;  4U0Y A;  1GV5 A;  3HOZ J;  3TO6 A;  2EPF A;  5IP7 J;  2Y69 H;  1VQ8 I;  2RDP A;  3A03 A;  2DYS H;  2X85 A;  3FDY A;  2CFO A;  3LFU A;  2IJL A;  3RZD J;  5JVG F;  1H8A C;  4G6T B;  1QBJ A;  3K4L A;  3JSP A;  3QRF F;  2WV0 A;  2Y9Y A;  2Z33 A;  3C7J A;  3I4M J;  2WBM A;  2FRH A;  2GZW A;  1ZAO A;  1D1C A;  4BUP A;  5E8I A;  3KP3 A;  4GCV A;  2XRN A;  1OCT C;  3LNQ A;  5A2Q Z;  2OV7 A;  1K4S A;  3RTR A;  3WU0 A;  4B09 A;  2VJI A;  1HST A;  1V5G A;  2XC7 A;  5CLS A;  4GRI A;  5CVU A;  3ASN H;  2BEO A;  4AIH A;  5L3B A;  1YE9 A;  4A0Y A;  2LG4 A;  4NHJ A;  1B6A A;  2FBH A;  3V7R A;  2O9L A;  4Y17 A;  2LP0 A;  2CW0 F;  1FTT A;  1E17 A;  3GFI A;  5EEH A;  2M2E A;  2QZ8 A;  1XB4 A;  2JT1 A;  3O6B B;  5DEQ A;  1RES A;  1GVD A;  2CJJ A;  3CJQ B;  3MN2 A;  2VKH A;  1POG A;  5C4J J;  4CIC A;  2DTR A;  2EIM H;  4GO1 A;  5FGM A;  4E70 A;  2Q1Z B;  5HNH A;  2FD5 A;  4RAZ A;  3ECO A;  1GUU A;  2CFX A;  3ZXS A;  2R7S A;  4HF1 A;  1TQI A;  4Y52 J;  1WZ2 A;  9ANT A;  1UHW A;  3MEX A;  5FFZ A;  2HKO A;  4A3L J;  3SZT A;  4ZYH A;  1I27 A;  1RET A;  4HX8 A;  3CCS I;  1O3T A;  2AS5 F;  3AG4 H;  3FIW A;  3MD2 A;  2EWN A;  4KMU X;  2HQ5 A;  3GTK J;  4YFK F;  2QUF A;  2E1M C;  3KZZ A;  1BJZ A;  3BCA A;  2R7O A;  2VC0 A;  2DOE A;  3AL0 C;  1MMN A;  3T8T A;  4BHC A;  3S1R J;  2MH9 A;  3OYM A;  2D1V A;  5FD5 A;  4AD9 A;  1OYI A;  3DF8 A;  1FPQ A;  4AUX A;  3W2A A;  2HDC A;  1JKR C;  1YQA A;  3DBL B;  4OOI A;  3BR0 A;  1A04 A;  1JHH A;  3RQI A;  2AQE A;  2QKM B;  3HYI A;  3S17 J;  3VEP A;  3TDZ C;  4ABZ A;  4AVP A;  2DMQ A;  1KU2 A;  2KT0 A;  2XDV A;  1FYK A;  1TNT A;  2H1L A;  3QPH A;  1MIJ A;  1B8I A;  4KA4 A;  1A35 A;  4QPQ A;  1W5C C;  2FQ3 A;  1QRY A;  2M5W A;  4X6A J;  1FTZ A;  2HS5 A;  2DMU A;  4CCO A;  1JJ8 C;  3DLL F;  1GDT A;  5DUK A;  2EZI A;  1Z9C A;  4RGR A;  2HI3 A;  2ZNZ A;  3WG7 H;  3KX2 A;  4DYQ A;  2ELK A;  4U7B A;  2V7F A;  3L2U A;  5LBQ A;  3ZQH A;  3KYL A;  1FZP B;  3L09 A;  4MFE A;  1SFK A;  3C2H A;  2DFF A;  4CUG A;  5D6E A;  3GX4 X;  1JGS A;  2F4O B;  3OYI A;  2QCO A;  4GGG A;  2R5Y B;  4RGS A;  5GP9 A;  2L7M P;  3CDH A;  3LA3 A;  4B44 A;  1WHU A;  4PJJ A;  4OAZ A;  5FLM J;  1BIB A;  3BJ6 A;  5CVV A;  2DAO A;  2YX4 A;  3DEE A;  3TQN A;  2WB1 A;  2NNY A;  2DA3 A;  3PNY A;  1RIO H;  2JVH A;  1IUF A;  1F36 A;  2UUZ A;  3O3K A;  4L0Y B;  1B9M A;  1K61 A;  1IG7 A;  2KP6 A;  1XMK A;  2FU4 A;  4ENJ A;  1IDZ A;  2BY2 A;  1MGT A;  3BR2 A;  3HHG A;  1LDD A;  5E20 A;  4AM3 A;  2KMU A;  1IN4 A;  3EUH A;  2Z5U A;  4KIB A;  2Q8K A;  5LHG A;  3RSN A;  1U0J A;  3I9V 2;  3GTP J;  1NH3 A;  2R7W A;  4KIS A;  1MH3 A;  1OYW A;  1STZ A;  4H0E A;  4BAC A;  2LY9 A;  1YOV B;  4D5F A;  1ZLJ A;  1ETX A;  2AO9 A;  3PUF A;  2MLK A;  2CGP A;  2XGD A;  1E3H A;  2XPW A;  3ZQI A;  3ZQG A;  2FNA A;  2CQ7 A;  2M7B A;  4A5N A;  3HUG A;  4GXO A;  1U5T B;  2GIV A;  2L4A A;  2LLK A;  2UZK A;  1MMA A;  1YG2 A;  4MTD A;  1Z1D A;  5BPD A;  3J80 Z;  2V79 A;  2DFH A;  1SFE A;  2CSO A;  3WTU C;  3ESW B;  2E60 A;  3HZJ A;  3OIO A;  2P5V A;  2QVO A;  3FXQ A;  1N77 A;  5M5Y J;  2AXL A;  5F6F A;  4E6K G;  5CKT A;  1T39 A;  4JK1 X;  4UVA A;  4D1Q A;  4IRI A;  5JHU A;  2DFE A;  4RAG A;  5C3E J;  4LIU A;  4LJZ F;  3KYC B;  4EJU A;  4C3I J;  1ACI A;  2LK2 A;  4WXD A;  3G4S I;  1D5V A;  2Q0O A;  3S2D J;  2HPI A;  3AFH A;  4I7H A;  3IRQ A;  3TO7 A;  2XF6 A;  2R7Z J;  2WAQ A;  5E1Z B;  2KIQ A;  2VLA A;  2MA3 A;  3SQN A;  2VB6 A;  5FKK A;  1HLV A;  2HWV A;  5IOZ A;  2A6T A;  1XGM A;  3K70 C;  2IA0 A;  1OKR A;  1CF7 B;  4FE4 A;  4OWR B;  2E2H J;  3QYF A;  3OWT A;  1XMA A;  3FBN B;  4PK4 A;  2ZNY A;  3LSJ A;  1BOA A;  3CD6 I;  2MYS A;  3H3Z A;  2A5Y B;  4RAF A;  1D1B A;  2CQQ A;  3E7L A;  4CYC A;  2P7V B;  2MAB A;  2H94 A;  3NWT A;  5L3C A;  4MTE A;  4Z6Y A;  2LRE A;  2K3F A;  3OR2 C;  3D0S A;  1WWX A;  4AU7 A;  2MD0 A;  2V4J C;  1QZY A;  2K9L A;  4WXH A;  4GFB A;  5DV5 A;  3PFI A;  3CC2 I;  5CVJ A;  2NVY J;  2DT5 A;  3T8R A;  3JRH A;  3H3V K;  3SXY A;  1VQ9 I;  2XKP A;  2FMY A;  3J7A Y;  1TWA J;  3HSE A;  3QOE A;  5F04 A;  5DUI A;  3DTI A;  2CQX A;  4QTR A;  1ETY A;  2V6C A;  1I5Z A;  2DJN A;  2G0E A;  2HTJ A;  2VOD A;  1V5E A;  4I98 B;  4ZZL A;  2VBW A;  4Y15 A;  3SEZ A;  2LYC A;  4CDG A;  1D5Y A;  4OMZ A;  2CU7 A;  4E4H A;  2WC2 A;  3GTQ J;  2ME0 A;  2P6S A;  3CP8 A;  2VOO A;  4CCJ A;  2Q2E A;  1Z3Y A;  3KCC A;  4I0B A;  4K2E A;  1ENH A;  4A3D J;  2EV0 A;  5HDN A;  3BLY A;  2OAZ A;  1WFX A;  2KZG A;  1ZG1 A;  2PJP A;  3KP7 A;  2H6C A;  4IZZ A;  3T0Y A;  1FOX A;  1GV2 A;  3KEY A;  5H6Q A;  2NVT J;  1MBK A;  4XN3 A;  4N9I A;  1H89 C;  4XOR A;  3M7G A;  2RAE A;  2DMN A;  4CA0 A;  3FZV A;  2WY8 Q;  1ZLK A;  2RNJ A;  2YUS A;  3F9K A;  2OTL I;  1MBE A;  4ZDO A;  1YRN B;  1FNN A;  1R58 A;  3CUQ A;  3FMR A;  3GBG A;  4XOT A;  4DZJ A;  1S7A A;  5IT9 K;  5EZH A;  3ELK A;  5DM6 F;  3K7A J;  2VON A;  3OYN A;  2M34 A;  4GYI A;  4V2G A;  2V1N A;  4YEJ A;  4XL9 A;  3H0G J;  2HOT A;  3CQZ J;  2KDZ A;  3KP4 A;  2VIX A;  1JI8 A;  2Y75 A;  1TBX A;  4FX0 A;  3H35 A;  4HSR A;  4BAY A;  5EGO A;  3L2Q A;  4KUM A;  2E1N A;  2DDB A;  3MKY B;  5F1R A;  1T0F A;  1VQN I;  4A0X A;  1IRZ A;  3SZP A;  1QO0 D;  3FIS A;  2Y0S A;  3CDL A;  2W00 A;  1X1D A;  4HF2 A;  5K7F A;  4IRH A;  3HOX J;  2XVC A;  4LGW A;  3VDX A;  4DYR A;  3HXL A;  2ISY A;  1WJE A;  3TW7 A;  2HQN A;  4CO8 A;  1IN6 A;  3BRO A;  1QVU A;  4M9X A;  3F72 A;  3SEQ A;  4ENN A;  3BR1 A;  2WY7 Q;  1W5T A;  3K1M A;  5GTH C;  2HDW A;  4I6Z A;  1YLF A;  2VKD A;  3GO5 A;  4IL6 C;  3JAM K;  3OYL A;  3R0J A;  5BMZ A;  5KCM A;  1U8B A;  4Q5S F;  1DUX C;  4D7M A;  4BXU A;  1Y56 A;  2R3S A;  3LSR A;  4M72 A;  2ZXI A;  3QU3 A;  3OS1 A;  3C2G A;  1YX3 A;  1BC7 C;  1L3L A;  2EFO A;  1SVO A;  4RLF A;  3ABT A;  2ZBK A;  1UZC A;  3CJR B;  2EZH A;  2DA4 A;  3B02 A;  2CUF A;  4HNV A;  3E5Q A;  1YS6 A;  1XCB A;  3TO9 A;  3K4M A;  3RYR A;  2R5Z B;  4Y4R A;  3K4N A;  4OIQ F;  4MEX F;  1IDY A;  2RQP A;  5TJJ A;  3F8C A;  5KAF C;  1S72 I;  2BVL A;  1O4X A;  3IH4 A;  3CTA A;  3J81 Z;  1MSF C;  4J19 A;  4DOZ A;  1HXD A;  1IN5 A;  3CUQ C;  1WI3 A;  5DD8 A;  4KIF A;  3K4J A;  4EVI A;  1H9T A;  3EYI A;  1YTY A;  1FP1 D;  2M1B A;  2YSR A;  4JP0 A;  2BY0 A;  2L9V A;  4YRV A;  1PJR A;  1BL0 A;  1IXR C;  1S9H A;  2F5C A;  2VBZ A;  4XQF A;  3AAF A;  3QOD A;  4LB6 B;  1FY7 A;  2QBY B;  3GZ6 A;  1KU7 A;  4M9Z A;  4FCY A;  4G8X A;  1IRX A;  3DU5 A;  1RZ4 A;  4XLF A;  1J7K A;  1NK3 P;  2JRT A;  3GTM J;  3RZO J;  3DV8 A;  1FX7 A;  5KNL A;  1X2M A;  1X1P A;  1TC3 C;  4E7K A;  3KEQ A;  3JRC A;  1R1U A;  3SFI A;  2ADU A;  1TP4 A;  3D5L A;  3MZY A;  4MFD A;  1SVL A;  1T0F C;  2BW3 B;  3FXK A;  3GVA A;  1IN7 A;  1SMT A;  5L3D A;  3KLN A;  3KP6 A;  3SDG A;  3KP5 A;  1FWZ A;  3QPT A;  2NYX A;  2VBX A;  2FML A;  4B43 A;  4C30 A;  4HV5 A;  1OFC X;  5FLX Z;  4MGR A;  1KU9 A;  2W82 A;  2X9D A;  1R4M B;  2WA0 A;  3CO7 C;  2JSP A;  2BE5 F;  2D45 A;  4UB8 C;  1HBX G;  2XF7 A;  2NVQ J;  1WJC A;  1Y8R B;  1Q1V A;  3RCO A;  1SAX A;  2ECB A;  3OY9 A;  2QYO A;  1D3Y A;  3IL2 A;  2XB5 A;  3IUO A;  1MSE C;  4I0A A;  1IAW A;  1VZ0 A;  5HLT A;  4XM3 A;  1NG6 A;  1TQM A;  1X58 A;  4EJT A;  2ZME C;  3COA C;  3BPX A;  2W24 A;  2KRH A;  3GEZ A;  1MDM B;  4IX7 A;  3SHF A;  1LPQ A;  4YIF A;  5GPA A;  2HYJ A;  4ITV A;  2M4K A;  1EA3 A;  5HVQ C;  3HC7 A;  2E5Z A;  3CC4 I;  3SZG A;  5ICC A;  3J7Z I;  1EKE A;  4ZH4 F;  2R7V A;  1B1B A;  3MVP A;  2MBF A;  2KIM A;  2E7X A;  2XV4 S;  2BGC A;  1S29 A;  4P55 A;  2O03 A;  1PP8 F;  3S2H J;  2LTP A;  4G6D A;  3KZY A;  1BM9 A;  1JKO C;  1WJB A;  4YII A;  1LE8 A;  2PJR B;  2GA1 A;  5M3M J;  4LLL A;  5JFR A;  3LSH A;  1XSD A;  3M07 A;  3R4K A;  1M1E B;  3C3W A;  4YIR X;  2NRA C;  3SDB A;  5FKL A;  1G3T A;  2L7F P;  3H9J A;  4RGX A;  4L5J A;  1IN8 A;  1Y39 A;  3MKL A;  5ILS A;  4NDL A;  2Y2Z A;  1GVJ A;  3GCM A;  5ICG A;  4I76 A;  3O8H A;  3GW2 A;  3HOU J;  3DXJ F;  2WAD A;  5F64 A;  3ML6 A;  2A05 A;  1RR8 C;  2Y9Z A;  2EZK A;  4EMS A;  3BZK A;  2CUJ A;  3BOQ A;  4EJW A;  4PFO A;  3OYH A;  1P4A A;  2JWT A;  2RRE A;  2IGO A;  4DBQ A;  2RGV A;  2DK5 A;  3UKG A;  1Y6I A;  4Y13 A;  1U9N A;  2B9S A;  3D1N I;  1GHC A;  4L5I A;  2ZFU A;  2IGK A;  2M4G A;  1MBG A;  2VAS A;  4BL0 B;  2G7H A;  3Q9V A;  1S5L C;  2DA7 A;  1FLI A;  1XSX A;  3ONQ A;  1P4X A;  5J6X A;  3K70 D;  1I6X A;  2JPB A;  1Q1H A;  1OIS A;  1R5G A;  2HYG D;  2M0M A;  1IV6 A;  2BHY A;  3CJN A;  2VC1 A;  3AL0 B;  4IQJ A;  4CCN A;  3CZ6 A;  4U88 A;  5AON A;  5EG0 A;  3CCQ I;  1QQI A;  2XUB A;  1DU0 A;  2IS6 A;  2B0L A;  5AIQ A;  2CRG A;  3BQZ A;  5D5X B;  4YFN F;  3WTW C;  1AOY A;  1LFP A;  2V1X A;  1BI3 A;  4IHY A;  5KAI C;  4XR6 A;  3KET A;  4WXC A;  3L1P A;  4ZTJ A;  2QSF X;  3AG2 H;  1T6S A;  1F4K A;  4LOC A;  3Q5F A;  3IWF A;  2BXZ A;  4KIC A;  4X0G A;  4G6Q A;  1RUO A;  3SJM A;  4M73 A;  3LSK A;  1BOB A;  3PNT A;  2L7Z A;  2LR8 A;  2PQ8 A;  4ESJ A;  2R7R A;  1XG1 A;  3PO3 J;  1MND A;  2ID3 A;  2DMP A;  4EM1 A;  3VSK A;  2E34 A;  4LLG F;  4KT6 A;  1W0T A;  2DU9 A;  2Z1D A;  3ABK H;  3CES A;  2VQG A;  5E3L A;  1WJA A;  2ZXJ A;  4A3K J;  2IS2 A;  1SFO J;  3R61 A;  4D9J A;  1ETW A;  4XLC A;  3EQL F;  5FO5 A;  1JT6 A;  1MJB A;  1YX5 A;  2DXI A;  4CXF A;  3IWZ A;  2FBK A;  3PQJ A;  2PBI A;  4A2U A;  2EB7 A;  5L3E A;  2M8G X;  3GXO A;  2OBP A;  1WJD A;  1FBS A;  2IS4 A;  2QEX I;  4ZDL A;  3MFK A;  4BEH A;  2ETH A;  4A6E A;  4OU0 A;  4ZC3 A;  4BKX A;  4BU2 A;  3ZMZ A;  5IPA A;  3ABU A;  1MW7 A;  1BI1 A;  3I59 A;  3BR5 A;  3WTX C;  3IKT A;  5D8L B;  2NS0 A;  4M6V A;  2HVQ A;  3AG3 H;  2GA2 A;  2JJ7 A;  4OIP F;  5F0F A;  3W6K B;  4M9S A;  1B4A A;  2VQL A;  1BR4 A;  4ZDP A;  5LEK A;  3I5U A;  1RNL A;  3NAU A;  2O0Y A;  1XMX A;  4G9Y A;  4HW0 A;  4NQW A;  1FSH A;  1HA8 A;  3JRG A;  1MD0 A;  1P7J A;  2XHK A;  4E7I A;  1RC9 A;  4W1U A;  4HV6 A;  3M9A A;  1R36 A;  1XC5 A;  4RBO A;  1IC8 A;  2R4G A;  3L2C A;  3I56 I;  1JUS A;  2PG4 A;  2STT A;  1CGP A;  2I5U A;  1HDD C;  2DDA A;  1R23 A;  1UST A;  1SD6 A;  1T8I A;  1XDS A;  3RPU D;  1FYL A;  3GTG J;  1FMW A;  2JN6 A;  4IO9 F;  1J5Y A;  2JA7 J;  5E3O A;  3CCU I;  4PSW A;  3RKW A;  3TKY A;  2NNN A;  1YS7 A;  3P5J A;  4KN7 X;  3FX3 A;  4Q48 A;  2ISZ A;  1E3O C;  2IXS A;  4RB2 C;  2BV6 A;  1LFU P;  5J47 A;  2KDO A;  2LVS A;  3BR3 A;  5KK1 A;  4J00 A;  3W3C A;  2Y0S N;  4JYK A;  1LQ1 A;  1LDK B;  2IP2 A;  1OQY A;  2N8G A;  4R8H A;  2MC3 A;  1DP3 A;  2EJR A;  3ERE D;  5LRS A;  4BDY A;  1T2K A;  3EYY A;  3QP6 A;  3TP3 A;  3N97 A;  1DGR M;  1TNS A;  4A3J J;  5LD2 C;  4HEA 2;  2ZJ2 A;  4PFP A;  3K6G A;  1FOK A;  3DP7 A;  5KHD A;  1HKT A;  3F8N A;  4ENM A;  2VJ5 A;  2UXN A;  1TT0 A;  3FK7 A;  3WHC A;  3AG1 H;  5LFA A;  1MMG A;  3ROU A;  1T56 A;  1ULY A;  1V3F A;  3F3X A;  3PNV A;  3OL4 A;  3HG9 A;  4UUT A;  4CZZ A;  2DK8 A;  4FQG A;  3I4N J;  2F6C A;  1HKQ A;  4EJO A;  3ZQC A;  2QGU A;  4BJT A;  1JXS A;  1F43 A;  1YI2 I;  4HF0 A;  4BQO A;  1W1W E;  5M3F J;  5DD4 A;  2MSY A;  1O7F A;  4L9V A;  2O7O A;  1ONV A;  2DA1 A;  2DQL A;  4AWX B;  5EDN A;  2R92 J;  1BN5 A;  2ESN A;  3OSF A;  1O57 A;  4Y3O A;  2D1H A;  4LG0 A;  3JRD A;  4Y7N J;  3CCY A;  1V55 H;  3N4M A;  2IT0 A;  1OCP A;  2XAH A;  3OYF A;  1QZZ A;  1WJF A;  1FOY A;  4B1R A;  5K5R A;  2F4M B;  3ZPL A;  2JPC A;  1VF9 A;  3TOA A;  2KZV A;  2ICW G;  1J0R A;  4P9U A;  3DKW A;  1TW2 A;  3FWE A;  2ID6 A;  1R7J A;  2HKX A;  4L9N A;  2QQB A;  2OZ6 A;  1LEB A;  3BG5 A;  3DPT A;  1RRJ A;  3T1B A;  1OYY A;  2DBB A;  2XAF A;  3RJP A;  4HX7 A;  2XKO A;  3E6D A;  1W7P D;  2EFW A;  3CMY A;  3S32 A;  2P5L C;  1W36 D;  3S3O A;  2HOE A;  4LB5 A;  4XON A;  2E2J J;  2RC4 A;  2OJE D;  2GM4 A;  2H27 A;  2R7D A;  1T33 A;  2CS3 A;  2KIS A;  4RDU A;  3UNG C;  1X2N A;  1ETQ A;  1QNT A;  4I01 A;  5GAE J;  4F93 B;  2CV0 A;  1ZGW A;  4NBQ A;  1O3S A;  3V8L A;  5BNG A;  2JMW A;  2W85 A;  4PZJ A;  4P1W A;  4XBF A;  1JUP A;  3DTE A;  3P7N A;  4A5M A;  5HS9 A;  4HNT A;  1EJ9 A;  5IYB J;  4A0Z A;  1YIO A;  1JE8 A;  2E19 A;  1V54 H;  3WTT C;  6PAX A;  4MNU A;  4CGZ A;  3ERM A;  4S05 A;  2FSW A;  2UWM A;  5HLH A;  2M9H A;  4LD5 A;  4QWQ A;  1LJ9 A;  3G1L A;  1ZH5 A;  1X3U A;  2TCT A;  3O8G A;  3G71 I;  2ZSH B;  1BW5 A;  4MQV A;  5FB2 A;  1MNE A;  2OU2 A;  4XLE A;  3H9Q A;  3M8F A;  3OYE A;  4MHG A;  4MO7 A;  4IF4 A;  1K78 B;  3TW6 A;  3GWZ A;  3OV8 A;  3K10 A;  4FT8 A;  4XSZ F;  4W97 A;  5GTI C;  1YO5 C;  1O3Q A;  3UR3 C;  1KON A;  4ZZD A;  2I8D A;  2ZSI B;  3G73 A;  1G59 A;  1LB2 A;  1MMS A;  2KQR A;  3GME A;  1IGN A;  2HVS A;  1IXC A;  2V9P A;  1R71 A;  2YU9 J;  2Q2E B;  4UNO A;  3GFM A;  2PX9 A;  2VL8 A;  4G7H F;  2FA5 A;  3HIF A;  3IC7 A;  2XGE A;  2B7E A;  1WSU A;  1VQK I;  1FBU A;  1APL C;  3G2B A;  3TP0 A;  3QQA A;  5D4S A;  1G6N A;  3K4K A;  5JLX A;  2F5E A;  1ORK A;  3D5R C;  3ZQF A;  2V1U A;  2A6E F;  3IHU A;  2QWW A;  4N4O B;  3J81 K;  5F08 A;  1UMQ A;  2MW8 A;  3I53 A;  3KZI C;  2R5Y A;  2CW8 A;  3ABM H;  2C6Y A;  1E2X A;  3CUQ B;  2WWY A;  1VQO I;  1D8K A;  2Z16 A;  2HOS A;  3S1M J;  3A4C A;  4PJ0 C;  3HRU A;  3L2W A;  3JTH A;  3H5R A;  1MBH A;  3DBR B;  3HSR A;  2V9K A;  3C2B A;  4ZYD A;  2VPR A;  3V7S A;  3KPH A;  1G3S A;  2UV1 A;  3EUH C;  4HG2 A;  4D7N A;  2PI0 A;  1B9N A;  1JKP C;  3K2Z A;  3KIO A;  2A07 F;  3WE2 A;  3I4P A;  1UAA A;  5L3G A;  5EGO B;  1W0U A;  1OCC H;  5HDG A;  4QSH A;  2O61 A;  4FX4 A;  1Z7L A;  2W84 A;  2A61 A;  3J7Y J;  2ZJQ F;  3BC8 A;  4HA8 A;  3CMM A;  2L9S A;  4FET A;  3FKJ A;  4MIM A;  3A02 A;  4WF2 A;  4KMF A;  5TGT A;  4Z2Y A;  1OLT A;  2DFI A;  3QPS A;  3M8E A;  2LRD A;  3SYT A;  4EJV A;  3F8F A;  4PJN A;  2AQF A;  2JRM A;  2KIU A;  4YEL A;  3GF2 A;  1BW6 A;  2DA2 A;  2Y31 A;  3OS0 A;  3TED A;  1JHF A;  3EUK L;  2NS7 A;  1Z77 A;  2PMZ N;  1KQ8 A;  2L2O A;  2FF4 A;  1PUF A;  2V26 A;  2JVG A;  1W7P B;  3P9C A;  3HOS A;  3HHH A;  2DQR A;  2ZME B;  2A69 F;  2QSH X;  1AWC A;  2X4H A;  2A3S A;  1EV7 A;  2MLG A;  3F21 A;  4L9T A;  3LQQ A;  1IRG A;  2F5V A;  3M1E A;  3DWL E;  5TIS C;  3RKX A;  1K6Y A;  2HU9 A;  4KIG A;  2PN6 A;  4IEJ A;  1GXQ A;  3B6A A;  1D0X A;  1VTN C;  2DMT A;  4BHP A;  4XIC A;  2KJC A;  1SD5 A;  2K27 A;  1B72 A;  1KQ0 A;  2OZU A;  1I1S A;  3QWL A;  2VJJ A;  3ZMU A;  2O8K A;  2VPL A;  4UV9 A;  5F1J A;  1ZAR A;  3PQK A;  4RM2 A;  4GYG A;  3WOD F;  3R6S A;  2W25 A;  4IPA A;  3CP2 A;  1X3W B;  3CCE I;  5KVR A;  4E7L A;  5M5X J;  4BYY A;  4BE0 A;  3B6C A;  3E3V A;  4BXX J;  4FHT A;  1X4P A;  1QA6 A;  3GTO J;  3OYJ A;  2EV5 A;  1D0Y A;  2F5D A;  4N9H A;  4E7Z A;  2W4S A;  1WVR A;  2DOA A;  3VWB A;  2H6B A;  1WH5 A;  2IRF G;  5TRD A;  4A69 C;  2Y48 A;  3MZ8 A;  5IY5 H;  4ZYG A;  5JR3 A;  3OOU A;  5B66 C;  1Z6T A;  1FMV A;  3ZP5 A;  3FXO A;  4XN0 A;  2HZT A;  4HOB A;  4G12 A;  3VPR A;  1MKM A;  1QHG A;  3H36 A;  2HEO A;  3VB2 A;  3HPH A;  3JRI A;  1X3Z B;  3A0B C;  3M8J A;  1N75 A;  3GLX A;  2FBI A;  4HLX A;  2K86 A;  3KYD B;  2VUM J;  2VBY A;  2GLO A;  2RV8 A;  3I58 A;  1U9O A;  2R7Q A;  3LMM A;  2GWR A;  5BPI A;  2K3P A;  2EK5 A;  1J75 A;  2VQC A;  3EET A;  2IA1 A;  4QPO A;  5GAG J;  3FXR A;  4XOP A;  3BZC A;  4BE1 A;  4I99 C;  1H9G A;  1MH4 A;  3NAR A;  4IXA A;  4BQN A;  4KNY A;  3L7W A;  4XLA A;  4KDP A;  3TOB A;  3CCR I;  2R7U A;  3PFY A;  3IH3 A;  4BNC A;  5D5V B;  4G7Z F;  4D5C A;  2CV2 A;  2K02 A;  2LF8 A;  2BXY A;  3IAS 2;  2H8R A;  1CQT A;  1EH7 A;  2KKO A;  1TTY A;  2XAG A;  1V4R A;  3BZ6 A;  3J7A O;  2F48 A;  4HQM A;  3CC7 I;  5HLI A;  4RB3 C;  3QYB A;  1WQ2 A;  5FD6 A;  4BH9 A;  1W5S A;  4C9Y A;  1XDU A;  4EEF G;  2CQK A;  2M3A A;  3BQY A;  5FRM A;  1K79 A;  1OJL A;  2WTE A;  2IGM A;  2P81 A;  4ON0 A;  3V8J A;  1I39 A;  3BTL A;  4G7O F;  1FC3 A;  4H4K C;  5LGU A;  1VQ4 I;  2O6G E;  1XSV A;  1U2W A;  2X1D A;  2CG4 A;  2YX7 A;  4GDF A;  1R1V A;  3N05 A;  1GXP A;  3HOW J;  4BBR J;  4U0W A;  3V7C A;  2LBF A;  2HGC A;  2E71 A;  2IBD A;  2VE9 A;  2PMH A;  1KA8 A;  2P6T A;  3TGN A;  3AKZ A;  4ZTF A;  2Z9O A;  5ICF A;  5CVI A;  3OYC A;  4EGY A;  3EUA A;  2H09 A;  1AKH B;  3M4O J;  2X48 A;  4M3B A;  4ZYE A;  1MZB A;  4DBR A;  5J4Y A;  2TRT A;  3TDU C;  4IQ4 A;  3H1C A;  3FF5 A;  5B1A H;  2LY1 A;  2HYF A;  3FKI J;  4BE2 A;  4IHV A;  2CYY A;  3WGH A;  3CF5 F;  1XTA A;  1HQC A;  4CH7 A;  4A93 J;  3MAJ A;  3Q0U A;  2P5K A;  3OYD A;  2HOA A;  2Z99 A;  3IH2 A;  2ZB9 A;  2O3F A;  3KLO A;  3RKQ A;  4UUS B;  4KT5 C;  3CCJ I;  5FLV A;  2XAQ A;  2VKV A;  5EG0 B;  1ON1 A;  3BJA A;  2COM A;  4XMY A;  3E6M A;  2CW7 A;  5A2Q K;  2XAJ A;  1TW3 A;  4HDU A;  5CJ9 A;  1FIA A;  4UHT A;  3U2R A;  4FIS A;  1W4M A;  3BG9 A;  1WI9 A;  1YHQ I;  3R60 A;  4UVB A;  1PYV A;  3WTZ A;  5DM7 F;  3PIO F;  1JTY A;  5B1B H;  1RUN A;  3R0A A;  4AVZ A;  2R5Z A;  1Z6R A;  3ISP A;  2DTZ A;  2MD5 A;  2CQN A;  5IP6 A;  1DPU A;  3DBH B;  4EAT A;  1IJW C;  1ZG5 A;  5DTD A;  3FMQ A;  3CUO A;  5D6F A;  4II3 A;  4JQF A;  2K9M A;  4DJA A;  2XGC A;  1S7O A;  4RB1 A;  3WE3 A;  2X6Y A;  5IT9 Z;  3IRR A;  1LUJ B;  4UY8 I;  2EFQ A;  3A2K A;  5E17 F;  2FOK A;  3JCU C;  3B73 A;  5CPR B;  5LHH A;  2KL4 A;  1LEA A;  2FX0 A;  5ILV A;  2MGQ A;  1DDN A;  5E79 C;  5J1Y A;  4JBA A;  3A0H C;  3A01 A;  4A3G J;  2QM3 A;  1RPW A;  4I09 A;  2FJ1 A;  4F92 B;  1LDJ A;  2DCE A;  4C2M J;  1OCZ H;  1FJL A;  4C2U A;  2DO7 A;  2NAZ A;  1X1C A;  2VT3 A;  3VSL A;  4HDV A;  1Y0N A;  4MQ9 F;  3IV5 A;  3FHZ A;  1T98 A;  2ELH A;  3DEW A;  1SAU A;  4BHB A;  2L54 A;  1IF1 A;  3U9G A;  2E1M B;  1ITY A;  5F27 A;  3S15 J;  4WCG A;  2IPQ X;  5JLW A;  2VE8 A;  4M3G A;  4AC0 A;  3HKZ A;  1LNW A;  1IW7 F;  2EZL A;  3X2Q H;  3HTU A;  5M5W J;  1K4T A;  2K9S A;  1L0O C;  1JKQ C;  2HVR A;  1JGG A;  1IRF A;  1ZGJ A;  1BR1 A;  3ZR8 X;  1D0Z A;  3JTG A;  3E97 A;  1TLH B;  1FSE A;  3GYH X;  3I64 A;  4L9J A;  3WU1 B;  4AYB N;  1KYZ A;  1IO2 A;  2X51 A;  3I71 A;  2DLL A;  2P4W A;  2ME6 A;  1LVK A;  1TWH J;  1AHD P;  2GXB A;  2IW5 A;  3MKZ A;  5DS9 A;  4NQW B;  2JA2 A;  2R0Q C;  3OIQ A;  2W1O A;  4DZP A;  2R7T A;  2NVX J;  3E0J B;  3ZCO A;  1HSJ A;  1K83 J;  1J59 A;  3FXJ A;  4RB0 A;  4XRS A;  2PMZ A;  1SD4 A;  4KN4 X;  2LMD A;  2V1D A;  3ZMS A;  3HB9 A;  3REO A;  3S1Q J;  2IAI A;  2HNH A;  4XSX F;  4A12 A;  2UXX A;  5EYR A;  4WK8 F;  2PJR A;  4IHS A;  4YG2 F;  1XS9 A;  4PJL A;  3BT9 A;  2GXG A;  4HYE A;  3FMS A;  4LK1 F;  2OCE A;  4L18 B;  3BJO A;  3NQO A;  1O7L A;  3ZOB A;  1Z0X A;  2EIK H;  4I02 A;  2HQA A;  3JW4 A;  1P6R A;  2YS9 A;  4JX5 A;  4A3F J;  4RLQ A;  4ZYA A;  4XKW A;  4C3H J;  5EF6 A;  1X4O A;  2V9V A;  3K1N A;  4NC8 A;  2IVM A;  3LQR A;  2L7K A;  2STW A;  2DA6 A;  4M6Y A;  1DPR A;  3HGG A;  2EFN A;  2MG4 A;  3E6C C;  2DPU A;  1WGX A;  4OMY A;  1EH8 A;  2L01 A;  5DCM A;  3MWM A;  3K1P A;  4CSW A;  1UFM A;  1TL8 A;  2XPU A;  2K4J A;  3BTI A;  2FNP A;  1A6Q A;  2QQA A;  1N25 A;  2ELJ A;  3HOT A;  2OTJ I;  2OCC H;  2NOG A;  2JSC A;  1S8N A;  2D2W A;  3D5S C;  2FXA A;  2H1K A;  1BBY A;  1ZK8 A;  1WCM J;  3BG6 A;  3Q3S A;  4D0P A;  3J80 K;  2GXA A;  3V8K A;  3OL3 A;  4OIN F;  1U8R A;  5HOO A;  2QEN A;  5K7Z A;  4BDZ A;  3LSI A;  2DI3 A;  3PL8 A;  2ZKZ A;  2GBY A;  1G4D A;  3FXM A;  2X1E A;  1R1T A;  5EEG A;  3FM3 A;  4RAY A;  2OD5 A;  3S16 J;  5IT3 A;  1I50 J;  2DT6 A;  1B8I B;  4LG0 B;  2HZD A;  2XAU A;  4F3Q A;  1DP7 P;  2DT7 B;  2P8T A;  2OPT A;  1IV8 A;  3HRS A;  4NUB A;  4KFC A;  3BTJ A;  2YR2 A;  2K9N A;  5ICE A;  2RVC A;  2Y30 A;  3GFJ A;  4XRF A;  3S14 J;  5FFX A;  2L02 A;  1F5T A;  2PMU A;  4CHU A;  3WHB A;  1RR7 A;  4HRI A;  1HKS A;  1BR2 A;  2M7A A;  3G1M A;  3RIR A;  1B59 A;  2H8W A;  2BY1 A;  2E1O A;  3CF2 A;  1ODD A;  4KIT B;  1FP2 A;  4G94 A;  3NEU A;  4LIV A;  3W6V A;  1K6O A;  5LHI A;  3VYS B;  1PDN C;  3MZH A;  1BI0 A;  3EDP A;  2VI6 A;  3GLL A;  2KIF A;  2XGX A;  1MNM C;  3S1N J;  3VYU B;  1I3Q J;  2EQR A;  3L9F A;  1Y1V J;  4BQQ A;  4RS8 A;  3CLO A;  2FEZ A;  5IYC J;  5JI6 A;  4EM0 B;  1RI7 A;  3SFZ A;  1DU6 A;  3ZRG A;  1X1A A;  3JRB A;  1U6G A;  4DYC A;  1S7E A;  1QHH D;  4XLP F;  2RN7 A;  3K4C A;  3LSM A;  3JRA A;  3KP2 A;  3LAP A;  5EZG A;  4N0B A;  1FOW A;  3E5X A;  1YIT I;  4HAM A;  5J3L A;  1SFU A;  4PDK A;  5LEJ A;  1REP C;  5HDK A;  3L2V A;  1Z67 A;  4F52 A;  2XRL A;  2ZJP F;  3OIP A;  4CCK A;  3HUG B;  1QU3 A;  2JZY A;  1P4W A;  1HCR A;  1R5H A;  3TL4 X;  3OOP A;  2EV6 A;  4Y33 A;  4DNC A;  2LNB A;  2JQ7 A;  1I3A A;  5HLG A;  3IKV A;  4A6D A;  1Y8Q B;  5H20 A;  2P0W A;  3LFK A;  4IHT A;  5CQE A;  2O5R A;  2HXI A;  2L9N A;  4CCM A;  3P9I A;  2CV1 A;  1ZR4 A;  3V4G A;  5FRO A;  1R9T J;  2M45 A;  3ZQL A;  3CMA I;  3HOY J;  4FE7 A;  1VQM I;  1MMD A;  3DLA A;  3QOP A;  3IAM 2;  2VKE A;  1FYM A;  1VQ6 I;  3HBL A;  1BJA A;  1SMY F;  2DYR H;  2CUE A;  5JVT A;  4RM3 A;  1VQP I;  2LOO A;  2ZXH A;  2ZJR F;  4O5V A;  2G7U A;  2IEK A;  4P9F A;  4IOC F;  2NXN B;  1ZRD A;  4E7S A;  3PO2 J;  4IRG A;  4HZF A;  1WJ5 A;  2F5F A;  1TZL A;  1ZN2 A;  3ZMV A;  3OYA A;  2A5W A;  3F23 A;  3QPL A;  2EA4 A;  4B4C A;  4B8X A;  4CYD A;  4N4N B;  4EM2 A;  3IP4 B;  1R49 A;  2E2I J;  4HPQ A;  2GIZ A;  3GTL J;  1QZE A;  3DTK A;  5C44 J;  5GAD J;  4CYC B;  5FKM A;  4EV0 A;  1KQ9 A;  2QQ9 A;  1D1A A;  1R6R A;  3BG3 A;  5CYV A;  2VXZ A;  3LWF A;  2B63 J;  2J5P A;  1BI2 A;  3HL2 A;  2EIN H;  2OC6 A;  2XB0 X;  1FEX A;  2EA2 A;  2LFB A;  1SEU A;  3T5X A;  3U21 A;  1Z91 A;  5K1Y A;  4ZJZ A;  1OCR H;  5LGT A;  2ZC2 A;  1Y1W J;  1LFB A;  3VOD A;  3L2R A;  4XLH A;  4BY1 J;  4U0V A;  2M8E A;  1XPX A;  3OYK A;  2KJB A;  3EPZ A;  3HRM A;  2G9W A;  4ETS A;  4JX4 A;  4ESF A;  3BWG A;  2F2E A;  3WU2 C;  4DW6 A;  1GT0 C;  3O2P E;  5J1R A;  2OF7 A;  1MBF A;  2D5V A;  2VN2 A;  4KJZ A;  2DJI A;  1HW5 A;  1KU3 A;  3OSG A;  4PGH A;  4BJ6 C;  4IHW A;  1N78 A;  2CWE A;  2E36 A;  2KLO A;  2RKH A;  3VYR B;  4FTH A;  2WV1 A;  2O8X A;  1SC7 A;  1PUF B;  3OR1 C;  1OCO H;  1UG2 A;  2DW4 A;  4PCQ A;  3S93 A;  2XAS A;  5C4X J;  1YJN I;  4AYB A;  3MMY B;  4BS9 A;  2A68 F;  4NNJ A;  2NS8 A;  2OQR A;  3CJT B;  5CQG A;  4V19 K;  3ZN0 A;  1QPI A;  3GFL A;  1OPC A;  2LSO A;  3NRV A;  3PSF A;  1P2F A;  3BP8 A;  3G3Z A;  3DQV C;  3DPU A;  4DQ2 A;  3L00 A;  3I54 A;  2W48 A;  5AIP A;  1I6H J;  3LAJ A;  3ZN1 A;  4C2T A;  3RQ4 A;  1EF4 A;  1X1B A;  1WPK A;  4M3E A;  1A36 A;  3M3Y J;  4WWC A;  1MJ9 A;  2R7X A;  1B72 B;  1R5I D;  3VYT B;  3HKZ N;  5D4R A;  2IA2 A;  2M0C A;  1Y0U A;  3BR6 A;  4JOM A;  3HPG A;  2HXO A;  3LA2 A;  2KPM A;  1VQ7 I;  4F55 A;  2X6X A;  1P7I A;  1ZEL A;  4II2 A;  1T95 A;  1SAN A;  2X6W A;  2L0K A;  2EFP A;  4XKB A;  5D8K B;  1HW2 A;  2BY3 A;  3DKX A;  2CH0 A;  5B3S H;  1P9Q C;  3BCB A;  3F8B A;  2LKX A;  3RPU A;  4S0H B;  5FLX K;  2BHZ A;  1F1Z A;  1KGS A;  1SFX A;  5GAH J;  2MH2 A;  3F6O A;  3I3L A;  4PJM A;  3K69 A;  2YU3 A;  1R4N B;  2F4I A;  1U5T A;  5JHF A;  1IUY A;  2PFB A;  2EIL H;  4PGG A;  1Z05 A;  3PM1 A;  2DN0 A;  4BGD A;  2X1C A;  3VOE A;  5FJ8 J;  1ZRC A;  1XD7 A;  4CZC A;  1K78 A;  3FXU A;  2FOW A;  3BY6 A;  2QQ8 A;  4A3B J;  1A6I A;  2I10 A;  1ZG3 A;  5FKO A;  4LLN A;  3GZ5 A;  5J40 A;  4QLC U;  4M6X A;  1AA7 A;  3Q9S A;  5E18 F;  4A3M J;  4NB5 A;  4QIW N;  3HOV J;  5HNF A;  1GLN A;  2Z3Y A;  5BQT A;  4ENK A;  2TDX A;  4NC7 A;  3RPQ A;  3TBI A;  3PUB A;  5ILU A;  1YW9 A;  3CDI A;  1VND A;  3G6E I;  5IP9 J;  1E3P A;  3FHN A;  4PUS A;  1U78 A;  4HX4 A;  1RKW A;  3H5A A;  3H92 A;  4XLN F;  3K2A A;  1HDP A;  3BPV A;  1CF7 A;  2W7N A;  4OIO F;  2L3D A;  4LG3 A;  2JA5 J;  2VJ4 A;  1ZR2 A;  1Z21 A;  2GQQ A;  3BG7 A;  4E7J A;  4I2O A;  3K4B A;  2MC4 A;  1ZYR F;  1XGS A;  5FKN A;  1MBJ A;  3HTS B;  2BYV E;  1YIJ I;  2W57 A;  5F0C A;  5E3M A;  1IXS B;  3OYG A;  2QSG X;  4ESB A;  2EIJ H;  4LK0 F;  4BQA A;  2CMP A;  4B3X A;  5D5W B;  1A5J A;  2BOL A;  5LGN A;  5IOY A;  3FXL A;  4IVN A;  4EGZ A;  3W6J B;  3C18 A;  3H0D A;  1G8X A;  1JUM A;  4Q47 A;  3S2W A;  2XRO A;  2K40 A;  5K5Q A;  3Q0V A;  1IZ1 A;  3Q0W A;  2LBF B;  4ANJ A;  1ZRE A;  3ZMD A;  1U5T C;  2K4B A;  2VOP A;  2ESH A;  1Z3X A;  5J4V A;  2KFD A;  1FBQ A;  1G3W A;  5L3F A;  2LKP A;  1R22 A;  2OQG A;  3H3U A;  2HDD A;  1ZTR A;  4F7Z A;  3HGY A;  1A31 A;  2K5C A;  4R1H A;  3RDI A;  4BXF A;  3U1D A;  3WG9 A;  2KHM A;  4AID A;  4V2F A;  3W2V A;  1UCR A;  5E1W A;  3KEO A;  2JTV A;  1U3E M;  1W7P A;  1T08 B;  4RA2 A;  3RKY A;  4UV8 A;  3LSP A;  3VFZ A;  5ED4 A;  2ZME A;  2E7W A;  2JK3 A;  5D5U B;  1RKT A;  2EH3 A;  4LIT A;  3WTS C;  2QLZ A;  3OS2 A;  3U1K A;  4EQQ A;  3JR9 A;  5LRR A;  3GZN B;  5DCF A;  1YRN A;  1WKM A;  3ZGK A;  1UB9 A;  3QU6 A;  5ERI A;  3PIP F;  3W2W A;  4FAS D;  1XGO A;  4M3D A;  1UG0 A;  2QF7 A;  2LD5 A;  5J8C A;  4B3A A;  4XRM A;  3E1S A;  4L0Z B;  1HF0 A;  2FE3 A;  4HQE A;  1G3Y A;  3V42 A;  1G2H A;  2WAF A;  1X19 A;  1TT5 B;  2RNG A;  3K9T A;  3ULQ B;  3C1D A;  3CCM I;  3DFG A;  5DDG A;  2LKS A;  5J8F A;  1LE8 B;  3E6B A;  2K9Q A;  4NC6 A;  2LC2 A;  2M30 A;  2QKL B;  5FRN A;  3LSG A;  3CME I;  1SVM A;  3ECH A;  1OMI A;  1XCV A;  1NTC A;  4XNF A;  3OYB A;  2ACJ A;  5F0H A;  4HLY A;  3KE2 A;  3HJE A;  3JRF A;  4DIQ A;  5LLQ A;  3K0L A;  4HST A;  1ERD A;  2LDU A;  3CCL I;  4IHX A;  1NG7 A;  3QP5 A;  3RYP A;  4IKF A;  4XID A;  1ETV A;  1UEL B;  1ZGA A;  2NOJ B;  4KYW A;  4MLO A;  3A01 B;  1Z7U A;  1SD7 A;  2XIG A;  3H9G A;  4MEY F;  3F0C A;  4XKC A;  1HC8 A;  1O3R A;  4Q4Z F;  4AIK A;  3ZMT A;  3LST A;  4HBL A;  4F91 B;  2XF5 A;  1F9N A;  1FIP A;  3ABL H;  4IJA A;  2GAU A;  4PSX A;  3DKY A;  3HSF A;  3HEF A;  2E5N A;  1FT9 A;  2K85 A;  3A1Y A;  4RMN A;  2K7L A;  2HPM A;  4A3C J;  2KRF A;  4R79 A;  3WGG A;  2V6E A;  1UJ8 A;  4LFU A;  4U87 A;  1TWC J;  4P5O A;  5E1X A;  2BZT A;  2QA4 I;  5E8G A;  3WGI A;  2R7F A;  1W36 C;  3PSI A;  1QPM A;  1ON2 A;  1D8J A;  1QVT A;  4E7H A;  1BIA A;  1KYW A;  4L5E A;  2J5O A;  2PEX A;  2ECC A;  3F6V A;  3RI4 A;  2COB A;  3E5U A;  1VFC A;  2NVU B;  3F8M A;  1I1G A;  5BOX A;  1LVA A;  1XGN A;  2FQ4 A;  2X0L A;  3NWS A;  1XX5 A;  1YJ9 I;  2CUZ A;  2WB1 N;  1T38 A;  4UB6 C;  5GPC A;  3DCF A;  1J9I A;  2WAE A;  2GOX B;  2HQR A;  4B48 A;  5H2F C;  1EH6 A;  2IGN A;  1XN7 A;  4X1E A;  4TV7 A;  3G1O A;  1E0E A;  2Y0M A;  3KFW X;  1LKX A;  2QBY A;  3MQ0 A;  3S3M A;  2HR3 A;  3DU6 A;  4UXN A;  2LY2 A;  2AXT C;  2M87 A;  2MFZ A;  4OAY A;  4BJ5 C;  1K7A A;  3M1C A;  1NHA A;  2YPR A;  4YFX F;  2Z2S B;  2PLY A;  3GUD A;  4J01 A;  4B47 A;  2L9R A;  4ASN A;  2ZXW H;  4S04 A;  3CCV I;  4BBS J;  4LMY A;  5HS8 A;  1AU7 A;  2BW3 A;  1PVE A;  3WTY C;  2LF7 A;  2ZO4 A;  4WX9 A;  2HFH A;  4C3J J;  1YJW I;  3LA7 A;  2E1C A;  1DQU A;  1YW8 A;  4BEH B;  2XPV A;  1VI0 A;  3I59 B;  5EEA A;  3S3N A;  5IYD J;  1YYV A;  2AHQ A;  3ZQ7 A;  4A3E J;  5K5O A;  5B5E C;  1AKH A;  2L4M A;  1HOM A;  5DCM B;  1ZKG A;  1ETO A;  1P92 A;  2CO5 A;  1OR7 A;  2ZFW A;  2EBI A;  5DYM A;  3H5N A;  2A6H F;  2LH9 A;  3DEU A;  3MCZ A;  4M71 A;  4CCL A;  2OUM A;  1WH7 A;  3ASO H;  3P9K A;  3OMY A;  1TWF J;  1VQ5 I;  3JAM Z;  2VXD A;  4XKV A;  2GOM A;  3F22 A;  3FK6 A;  5J1U A;  1MDM A;  3HM5 A;  1C0W A;  2VQH A;  3FBI B;  2HTS A;  3S8P A;  4XK4 A;  1H88 C;  2JA8 J;  4IOA F;  3HRT A;  4UUS A;  4XRS G;  1J2X A;  1ETK A;  4UVC A;  4P96 A;  2DOF A;  5H6R A;  3TMO A;  1YW7 A;  1V5F A;  3CLQ A;  2L5Q A;  2WAQ N;  4O6J A;  1S3J A;  5CVR A;  2DOD A;  2DA5 A;  5HOD A;  1NK2 P;  3JRE A;  2VT2 A;  4U7D A;  1TWG J;  3CO6 C;  1PP7 U;  4DGW B;  1YFH A;  3QAH A;  3LOC A;  3GTJ J;  3WTV C;  2FUG 2;  4JX6 A; 
#chains in the Genus database with same CATH homology
 1OLT A;  2BVM A;  2O5R A;  2L9N A;  4XLF A;  1IRX A;  2RQQ A;  3DPL C;  3DU5 A;  4CCM A;  2LRD A;  3SYT A;  2CV1 A;  5FRO A;  4PJN A;  2AQF A;  5KNL A;  4YEL A;  4HNU A;  4E7K A;  3QYE A;  3OS0 A;  3D5L A;  1MMD A;  3DLA A;  1T0F C;  2BW3 B;  3EUK L;  3IAM 2;  1DGW Y;  2L2O A;  2V26 A;  2JVG A;  4B43 A;  4C30 A;  3MKW B;  4RM3 A;  3HOS A;  3ZQQ A;  2LOO A;  2W82 A;  2ZXH A;  2WA0 A;  2JSP A;  4E7S A;  2XF7 A;  2IS1 A;  1WJ5 A;  1WJC A;  3RCO A;  1TZL A;  2F5V A;  3DWL E;  1J09 A;  3OY9 A;  3OYA A;  1K6Y A;  2A5W A;  2HU9 A;  2JUG A;  2KRC A;  3IUO A;  1VZ0 A;  3PJR A;  5HLT A;  4XM3 A;  3LL7 A;  1NG6 A;  4N4N B;  3IP4 B;  2KRH A;  1D0X A;  4IX7 A;  4HPQ A;  4ITV A;  2M4K A;  1OR7 C;  3DTK A;  2XSJ C;  1EA3 A;  5HVQ C;  3HC7 A;  2E5Z A;  3SZG A;  1D1A A;  1R6R A;  2VXZ A;  2X85 A;  3FDY A;  2VJJ A;  2CFO A;  3LFU A;  3HL2 A;  2VPL A;  2R7V A;  2OC6 A;  4G6T B;  4RM2 A;  3K4L A;  3U21 A;  4ZJZ A;  3CP2 A;  4E7L A;  1WJB A;  3L2R A;  2PJR B;  4BE0 A;  2WBM A;  4XLH A;  4BUP A;  1D1C A;  3OYK A;  3EPZ A;  1X4P A;  3LSH A;  3OYJ A;  2OV7 A;  1D0Y A;  3RTR A;  3SDB A;  3H9J A;  2VJI A;  4E7Z A;  1V5G A;  2DJI A;  2W4S A;  4KJZ A;  2XC7 A;  2DOA A;  4GRI A;  3VWB A;  1YE9 A;  4BJ6 C;  3OOU A;  1N78 A;  2LG4 A;  2WAD A;  1FMV A;  2KLO A;  3VYR B;  4XN0 A;  3OR1 C;  1QHG A;  2CUJ A;  3HPH A;  4PFO A;  3M8J A;  3S93 A;  1N75 A;  3OYH A;  2RRE A;  2IGO A;  3CJQ B;  4AYB A;  4DBQ A;  3MMY B;  4BS9 A;  4NNJ A;  2VKH A;  1Y6I A;  5CQG A;  2ZFU A;  2IGK A;  2M4G A;  2R7Q A;  3LMM A;  2VAS A;  2Q1Z B;  4BL0 B;  5HNH A;  2K3P A;  3PSF A;  3DQV C;  3DPU A;  3ZXS A;  3ONQ A;  2R7S A;  2VQC A;  4QPO A;  3K70 D;  2M0M A;  4XOP A;  4BE1 A;  4C2T A;  3AL0 B;  3RQ4 A;  1X1B A;  4IQJ A;  4CCN A;  3CZ6 A;  4BQN A;  4XLA A;  2IS6 A;  2R7X A;  3MD2 A;  2R7U A;  3PFY A;  3VYT B;  2E1M C;  4JOM A;  3HPG A;  1LFP A;  2KPM A;  4F55 A;  2CV2 A;  2X6X A;  3BCA A;  2R7O A;  1ZEL A;  4II2 A;  4XR6 A;  4ZTJ A;  3AL0 C;  1MMN A;  1T95 A;  2X6W A;  3IAS 2;  3OYM A;  4XKB A;  4X0G A;  3DKX A;  2CH0 A;  1P9Q C;  3BCB A;  3W2A A;  3LSK A;  3QYB A;  1BOB A;  4C9Y A;  3PNT A;  3I3L A;  2AQE A;  2QKM B;  2M3A A;  4PJM A;  5FRM A;  2R7R A;  2F4I A;  2IGM A;  2XDV A;  5JHF A;  1MND A;  4H4K C;  4QPQ A;  3VSK A;  2X1D A;  4CCO A;  4KT6 A;  3N05 A;  2Z1D A;  3CES A;  2LBF A;  2X1C A;  2VQG A;  4BGD A;  1WJA A;  4CZC A;  2IS2 A;  3KX2 A;  4U7B A;  2V7F A;  4D9J A;  3L2U A;  3AKZ A;  4XLC A;  4ZTF A;  3OYC A;  1YX5 A;  3EUA A;  3KYL A;  2DXI A;  1SFK A;  3C2H A;  1AA7 A;  4CUG A;  4DBR A;  3OYI A;  4IQ4 A;  2LY1 A;  4BE2 A;  1WJD A;  5HNF A;  1GLN A;  2IS4 A;  4CH7 A;  4NC7 A;  4ZDL A;  3TBI A;  3PUB A;  4B44 A;  4PJJ A;  4BEH A;  4OAZ A;  4BU2 A;  4ZC3 A;  3OYD A;  3DEE A;  1MW7 A;  2WB1 A;  3PNY A;  2JVH A;  3FHN A;  4PUS A;  2HVQ A;  3H5A A;  2UUZ A;  4XMY A;  2KP6 A;  2CW7 A;  2W7N A;  4LG3 A;  2VQL A;  2VJ4 A;  1BR4 A;  4ZDP A;  1Z21 A;  3BG7 A;  4E7J A;  2KMU A;  3K4B A;  2MC4 A;  3RSN A;  1U0J A;  1HA8 A;  1PYV A;  3I9V 2;  4AVZ A;  2R7W A;  4E7I A;  4KIS A;  4EAT A;  3OYG A;  4BAC A;  2CMP A;  4B3X A;  2R4G A;  2BOL A;  4II3 A;  4JQF A;  2K9M A;  4DJA A;  3H0D A;  1G8X A;  2M7B A;  3RPU D;  2X6Y A;  1FMW A;  1MMA A;  4PSW A;  3A2K A;  5CPR B;  2KL4 A;  2IXS A;  2E60 A;  2LBF B;  4ANJ A;  1N77 A;  1Z3X A;  4E6K G;  2KDO A;  4J00 A;  5CKT A;  4F92 B;  2DCE A;  3W3C A;  4D1Q A;  1LDK B;  2K5C A;  4C2U A;  4LIU A;  3VSL A;  1DP3 A;  1X1C A;  4BXF A;  2KHM A;  3W2V A;  4BDY A;  1SAU A;  1DGR M;  2E1M B;  2HPI A;  5LD2 C;  3AFH A;  4HEA 2;  2XF6 A;  4PFP A;  3K6G A;  2WAQ A;  3HKZ A;  2VLA A;  5KHD A;  2HVR A;  2VB6 A;  4LIT A;  2A6T A;  2VJ5 A;  1BR1 A;  3OS2 A;  1TT0 A;  3ZR8 X;  1D0Z A;  3K70 C;  5LFA A;  4OWR B;  1MMG A;  3PNV A;  3QYF A;  3OWT A;  3OL4 A;  3ZGK A;  3HG9 A;  3FBN B;  4PK4 A;  2X51 A;  3W2W A;  4FAS D;  2F6C A;  1LVK A;  1UG0 A;  2MYS A;  3MKZ A;  3E1S A;  4NQW B;  4BJT A;  2JA2 A;  3V42 A;  2WAF A;  1X19 A;  2RNG A;  2W1O A;  3OIQ A;  1D1B A;  4BQO A;  2R7T A;  2MAB A;  3E0J B;  3NWT A;  3ZCO A;  2LRE A;  3OR2 C;  2LC2 A;  2QKL B;  5FRN A;  4AU7 A;  2MD0 A;  2V4J C;  2K9L A;  3LSG A;  2PMZ A;  4XNF A;  4Y3O A;  3OYB A;  3J7A Y;  3QOE A;  2HNH A;  3DTI A;  3OYF A;  2PJR A;  4DIQ A;  1WJF A;  4HST A;  1ERD A;  1V5E A;  4PJL A;  1NG7 A;  3SEZ A;  4IKF A;  2LYC A;  1UEL B;  2NOJ B;  4MLO A;  4E4H A;  2KZV A;  4XKC A;  3CP8 A;  3H9G A;  2HQA A;  4CCJ A;  4F91 B;  1Z3Y A;  2XF5 A;  4RLQ A;  4ZYA A;  4XKW A;  1X4O A;  4NC8 A;  3BLY A;  4PSX A;  2L7K A;  3DKY A;  1WFX A;  2E5N A;  3DPT A;  4IZZ A;  3A1Y A;  4RMN A;  3KEY A;  4XN3 A;  2HPM A;  4XOR A;  3S32 A;  1W36 D;  4R79 A;  3S3O A;  2V6E A;  4CA0 A;  4CSW A;  2WY8 Q;  4XON A;  4U87 A;  4P5O A;  2CS3 A;  3F9K A;  3UNG C;  4F93 B;  1W36 C;  4ZDO A;  2ELJ A;  3HOT A;  2CV0 A;  3PSI A;  3GBG A;  4XOT A;  4E7H A;  4P1W A;  3D5S C;  3DTE A;  3OYN A;  3BG6 A;  4HNT A;  3OL3 A;  2V1N A;  5HOO A;  4YEJ A;  4XL9 A;  4BDZ A;  3LSI A;  3NWS A;  3PL8 A;  2UWM A;  2CUZ A;  2VIX A;  2X1E A;  1JI8 A;  3H35 A;  4HSR A;  2WAE A;  2GOX B;  4B48 A;  2IGN A;  2DT6 A;  3L2Q A;  2ZSH B;  2HZD A;  2XAU A;  4F3Q A;  3MKY B;  2DT7 B;  1MNE A;  1E0E A;  4XLE A;  3H9Q A;  1LKX A;  3S3M A;  3OYE A;  4NUB A;  3DU6 A;  2Y0S A;  2LY2 A;  2MFZ A;  4OAY A;  4BJ5 C;  2W00 A;  1X1D A;  3M1C A;  2Z2S B;  3K10 A;  4J01 A;  4B47 A;  3UR3 C;  1KON A;  2I8D A;  2ZSI B;  3VDX A;  1G59 A;  3HXL A;  2KQR A;  2HVS A;  1WJE A;  2BW3 A;  2Q2E B;  4HRI A;  2VL8 A;  1BR2 A;  2M7A A;  3SEQ A;  2WY7 Q;  2HDW A;  3CF2 A;  2VKD A;  4KIT B;  3G2B A;  3OYL A;  1DQU A;  4LIV A;  5KCM A;  4BEH B;  3K4K A;  3S3N A;  3VYS B;  1Y56 A;  3D5R C;  2ZXI A;  3OS1 A;  3VYU B;  3C2G A;  3H5N A;  1YX3 A;  2LH9 A;  4BQQ A;  4N4O B;  4CCL A;  4RLF A;  2OUM A;  2CW8 A;  3OMY A;  3ZRG A;  1X1A A;  3CJR B;  2VXD A;  4XKV A;  2GOM A;  2VQH A;  2Z16 A;  3FBI B;  1QHH D;  3S8P A;  3A4C A;  3K4M A;  3L2W A;  3K4C A;  3H5R A;  3K4N A;  4Y4R A;  3LSM A;  2V9K A;  2BVL A;  3TMO A;  1V5F A;  2L5Q A;  4DOZ A;  2UV1 A;  3EUH C;  4HG2 A;  3L2V A;  3K4J A;  4F52 A;  3OIP A;  4CCK A;  1UAA A;  3HUG B;  1QU3 A;  4YRV A;  1PJR A;  3TL4 X;  1S9H A;  4Y33 A;  4XQF A;  1Z7L A;  3QOD A;  4DGW B;  3BC8 A;  3CMM A;  2L9S A;  2P0W A;  3FKJ A;  4FET A;  2FUG 2;  5CQE A;  5TGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...