2CQKA

Solution structure of the la domain of c-mpl binding protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GSSGSSGAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the La domain of c-Mpl binding protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords C-Mpl binding protein
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cqkA00
4EGYA 1PUEE 3F8CA 3GF2A 4KFCA 3AAFA 3WTVC 3R61A 3FXUA 5FLXZ 3J80K 2LNBA 3WE3A 1BI2A 2HKOA 2XGXA 1BOAA 4L9NA 2IRFG 4U0VA 4JK1X 1KYWA 2OBPA 2D45A 1PP8F 2FXAA 3GZ6A 3HSEA 3LQQA 1UB9A 4I98B 3GYHX 2VE9A 1TQIA 1BIBA 2FNPA 5LGUA 1XGMA 4ZYEA 2P6TA 1IXSB 4OIOF 1LDDA 2JRTA 4HLYA 2V1DA 2L3DA 2NRAC 1SFEA 4LG0A 3MZHA 3ELKA 5K5RA 5HDGA 2QZ8A 4ASNA 4EM2A 3FX3A 1HW1A 5EEHA 3NRVA 1Z6TA 3G3ZA 4EV0A 1DP7P 5ILVA 2IPQX 2P5KA 4KUMA 1JXSA 4M9SA 3DXJF 4U88A 2DPUA 2PN6A 3GEZA 3S2WA 2XASA 1LQ1A 4NHJA 2ZBKA 3E97A 4A0XA 3SFZA 2IT0A 2JPBA 4Y13A 4LLLA 1U6GA 3RYRA 3EDPA 2EV5A 4I7HA 4MEXF 1R58A 2RNJA 4KN4X 2Z33A 3VEPA 3W6JB 5FGMA 4HDUA 4KMFA 2OQRA 3FWEA 1CGPA 4MEYF 1K7AA 2JSCA 3ERED 1LB2A 1KQ8A 2XHKA 4CXFA 3GZ5A 1CF7B 1DUXC 1KGSA 1W7PA 2K02A 3HUGA 2GXGA 2W85A 3LSTA 3O6BB 1S6LA 5TJJA 2KIMA 1XSVA 1T98A 1J0RA 4ZZLA 3BJ6A 3DKWA 2XAFA 3KP4A 5DUKA 4CGZA 2STTA 4HX4A 4F7ZA 3IHUA 3BDDA 3LAPA 3ZQ7A 4KNYA 3G73A 3QU3A 2L4AA 2XIGA 2EV0A 5D6FA 3WGHA 1O3TA 5ILSA 3E5XA 2RQPA 1TQMA 3QP5A 1IN4A 2R7FA 2V9VA 3RI4A 1SD4A 5D6EA 1G4DA 4UHTA 3I54A 1S8NA 1S29A 3CUOA 5DEQA 5ICEA 2DW4A 1ZAOA 3V7RA 2M30A 3B73A 1BJAA 2YSRA 3DPTA 4CO8A 3RKXA 4NQWA 1EH6A 1OMIA 2HYFA 1R23A 5F64A 4A6EA 5D8LB 3SQNA 4AWXB 2A5YB 4UUVA 1IN5A 4QLCU 2HR3A 2ZNZA 5AIQA 4M9XA 2OZ6A 4IRHA 4EJWA 3TO7A 2MLKA 2F5FA 5LBQA 3T8TA 1MJAA 1QZYA 3BROA 2VT3A 1LDJA 2YR2A 2W57A 3RJPA 3PQKA 2YPRA 2CG4A 2NNYA 2MA3A 3E5QA 5FB2A 2G7UA 4BHPA 3MWMA 3L9FA 4LK0F 3OV8A 3DF8A 3HHGA 5HDKA 1KYZA 2ZO4A 1WKMA 3SZPA 2O03A 4LD5A 3P7NA 4HDVA 5IT3A 1FPQA 4HQEA 2PG4A 2DQLA 2OAZA 2FA5A 5J8FA 2HQRA 2W24A 2QM3A 2M8EA 2XAGA 2Y75A 2VBYA 4WWCA 2P5LC 4WF2A 4EMSA 5HS8A 2OU2A 5FO5A 5LHHA 3JTHA 2QENA 3CUQA 3LWFA 4EJUA 2VBZA 4H0EA 5CLSA 1YO5C 3E6MA 2A3SA 1I1GA 2DT5A 4XLPF 4K2EA 1FBUA 4L0ZB 3EYIA 4CDGA 5DYMA 1SMTA 1YW8A 3RTRA 3JAMZ 1KU2A 2RDPA 2EWNA 4B8XA 1VTNC 2G9WA 2UXXA 2WV0A 1QO0D 3H92A 3FXQA 1U5TB 4PZJA 1KU9A 1IN8A 2HKXA 1S3JA 2M87A 1K78B 5CJ9A 1OR7A 5D5WB 1RUOA 3GFJA 3IKVA 3C3WA 4B09A 1WQ2A 2KIFA 2X4HA 3ZMUA 2GWRA 3GVAA 1BC8C 2Y48A 2XUBA 5KK1A 2M5WA 1YQAA 2JPCA 1R5HA 5DD8A 5JR3A 1WI9A 2ACJA 1Y0UA 2H94A 2GQQA 5H6QA 5ICGA 2P7VB 2HTSA 2PLYA 4OMZA 1MDMA 1P4AA 2KKOA 3DV8A 1QQIA 4RGXA 5BOXA 2Q8KA 2M45A 2FF4A 2CYYA 1U78A 3MEXA 3VOEA 1I5ZA 2PFBA 1ZH5A 4HX7A 2BGCA 2PJPA 4ENKA 2FQ3A 4P9FA 1WRJA 1DDNA 1IF1A 3EUHA 3WTSC 3ML6A 3U2RA 1YW9A 4A0ZA 3C1DA 1UHWA 1ZYRF 3K1MA 3KEOA 1ZREA 2STWA 4GCVA 2DK5A 2LSOA 4I2OA 3V4GA 4JQFA 5F1RA 5E1WA 2DTRA 3JSOA 3DFGA 3P9CA 4XSXF 2DI3A 1Z9CA 2QBYA 2KRFA 3IRRA 2GIVA 2Z3YA 4UVBA 1IXCA 3WU1B 3WODF 3BZ6A 4TV7A 1QGPA 1BI0A 1ZLKA 4OIRF 2XAHA 1B6AA 5E20A 1ZARA 1TLHB 3I53A 1QNTA 3WTTC 2VE8A 4O6JA 3F21A 3T0YA 1R1TA 3R6SA 5CYVA 3K1PA 1SD7A 2DO7A 4HOBA 1W5SA 3I59A 4CICA 4GO1A 1P6RA 1WWXA 2ZCWA 2CWEA 2O6GE 3CUQC 1XCBA 1B9MA 4LB6B 3EETA 3SHFA 1ZLJA 1T2KA 1JHHA 3F6VA 3TDZC 2QWWA 3SZTA 2KJCA 2VOPA 4ENMA 2ESHA 1ZRCA 3WTUC 3T1BA 4KMUX 2FMYA 2R7DA 2HGCA 4KICA 4BQAA 2IA1A 1XGNA 2DBBA 2XKOA 3RDIA 3CO7C 1YTYA 3HRSA 1MJ9A 1HQCA 4PGHA 5L3DA 1HXDA 1RNLA 1IW7F 3ZMDA 4KIBA 3LA7A 2A68F 4LFUA 5D8KB 2DQRA 2CSOA 1ZGJA 3V8LA 1F4KA 3ZMVA 4BH9A 2HDCA 4G8XA 1UHMA 3IC7A 3MFKA 1O7FA 1KU3A 3N97A 1O3RA 1MZBA 5BPIA 1W4MA 3FMRA 1FBSA 2FMLA 4OIQF 4U7BA 2PI0A 2O61A 4RGSA 4PGGA 4OU0A 1TW2A 3WU0A 3JAMK 2V79A 3I58A 2KJBA 5LEJA 5L3EA 4IRIA 1MGTA 4EJTA 3HIFA 1QPMA 2RC4A 5DDGA 1PP7U 2QLZA 4L5JA 1TW3A 2NS0A 4AVPA 5JHUA 1FP2A 4HW0A 1DPUA 2QUFA 3L2CA 2O0YA 4NB5A 1H9TA 3ZN0A 1I27A 2HWVA 5LLQA 5ILUA 3KE2A 3H3ZA 1HKTA 4QWQA 1HSJA 4A0YA 2Z5UA 3MCZA 2D1HA 1T38A 1P4WA 4ON0A 2K4JA 2DPDA 5HS7A 1GVJA 1ZGAA 1ZG5A 3FF5A 2HYGD 4KYWA 1CF7A 3BPXA 3V7CA 2OD5A 5DCMA 2V1XA 3TOAA 6PAXA 3BY6A 2K86A 3BPVA 1JE8A 2W25A 3TDUC 5AONA 2B0LA 2P5VA 4Z2YA 3I0TA 4WXCA 1GXQA 2Z99A 1LNWA 2ISZA 3M8FA 3K9TA 3F8BA 3KP5A 1ZRDA 1FSHA 3J80Z 2MC3A 4N0BA 2KIUA 3Q5FA 3DPLC 4HLXA 2PMHA 4IXAA 1ON2A 2H09A 4A5MA 1H0MA 5FD6A 1D3YA 4Q48A 4ZYGA 5LGTA 1J2XA 3QOPA 1MDMB 3ROUA 4R79A 1D8KA 4A12A 4WXHA 5EEGA 4MHGA 4RS8A 3V8KA 3LA2A 3F8MA 2FU4A 4G7HF 3HRMA 1FYKA 5D4SA 2HEOA 1LEAA 1XDSA 5FD5A 2DU9A 2VC0A 1F1ZA 1R5GA 3CDHA 2ISYA 3GUDA 2CW0F 2IVMA 2Q0OA 1USTA 3H3UA 4HX8A 3D0SA 4N9IA 2G7HA 2LKPA 4G7OF 1ZN2A 1XMAA 4CZZA 1FYLA 3KETA 1Z91A 1QBJA 2P6SA 2A61A 3WTWC 1ZG3A 3WGGA 2PMUA 3KP6A 1E2XA 1RIOH 2FRHA 5L3GA 1SAXA 3DQVC 3GFLA 2IA2A 4KDPA 2HS5A 2ADUA 3WTXC 3O3KA 3LAJA 1LEBA 5D4RA 2FEZA 3KZYA 3F3XA 1Z7UA 1SFUA 2VXZA 4HF2A 2VT2A 1G3WA 3LQRA 2XAJA 3N4MA 5IT9Z 3KLOA 3B02A 2ZMEB 2RKHA 4EM1A 2NYXA 2ZFWA 3M1EA 3P9IA 5BPDA 1FY7A 1ZRFA 3ZMZA 3SXYA 2FOKA 4R8HA 5LEKA 2VBXA 4I01A 4KIGA 5HDNA 1XSXA 1UCRA 3BJAA 4I09A 1I1SA 4RGRA 3HYIA 4M72A 2O8XA 3RYPA 2DLLA 2QQ9A 4G9YA 3HRTA 1ON1A 4UVAA 3V8JA 4OOIA 3ECHA 1K79A 1J75A 1T0FA 3D5LA 5K5QA 1R36A 2FBHA 3GFIA 4RB1A 2CFXA 4YG2F 5LRSA 4A2UA 2CQKA 1L0OC 5BQTA 5L3FA 2QVOA 3V7SA 4AIKA 5DCMB 3L00A 4XRFA 5AIPA 2EJRA 3BJOA 3HTSB 3EQLF 2YX4A 4D0PA 2F5CA 4EVIA 5E1ZB 1FX7A 2X0LA 4P55A 2GAUA 2QQBA 2ZJ2A 5ED4A 1F9NA 4UV9A 1S7OA 4KN7X 5ICFA 2UZKA 2FBKA 2A07F 5CVIA 2RV8A 5FLXK 3I71A 4GYIA 1TNSA 3PQJA 3QU6A 2AXLA 2M1BA 1IRFA 1P92A 5A2QZ 1YLFA 2F5DA 2OQGA 2TDXA 1L3LA 5L3CA 1X3UA 1BN5A 2E7WA 4ENNA 1J59A 1NHAA 4AIJA 2UXNA 3GFMA 4S05A 3J7AO 3FM5A 5K5OA 4MTDA 5J8CA 3DP7A 4HYEA 1REPC 3K0LA 4M73A 3REOA 1Z6RA 3ZP5A 1V3FA 2Z9OA 2BE5F 1FLIA 3HTUA 1JHFA 3ZMSA 3R0JA 1XDUA 1EH7A 1OKRA 1SD6A 2IW5A 4EQQA 4M71A 1R00A 1HBXG 1R22A 5DCFA 2H6BA 3FHZA 4G6DA 1XGSA 2E1CA 2O3FA 2GA2A 3T5XA 2E1NA 1IN6A 1FP1D 1XD7A 3R0AA 4OMYA 4EGZA 1BC7C 2FSWA 4GXOA 3GX4X 3F72A 1IUYA 2VN2A 5FFZA 2AS5F 1U5TC 2XVCA 3L09A 3LFKA 2K27A 3E3VA 5H20A 3GWZA 1FYMA 4MNUA 2L01A 2ZMEA 1SFXA 4RB0A 4FX4A 2ZNYA 1KQ9A 3F8FA 1V4RA 5CVVA 1O3SA 4KA4A 2WC2A 4R1HA 3GLXA 1D8JA 3CUQB 5CVRA 4YIIA 4L5IA 3EYYA 4WX9A 4A6DA 3JTGA 1IRGA 5D5UB 1MD0A 2RN7A 2P7CB 4RB2C 4A5NA 1ZG1A 4Y15A 2E7XA 3CLOA 3KCCA 3MQ0A 4I02A 5CVUA 4M6YA 4DQ2A 3QAHA 4O5VA 5E17F 3M8EA 4LB5A 4LLNA 5HLHA 1OPCA 2DK8A 1R1UA 2J5OA 1W7PB 1ZHFA 4CYDA 2ETHA 3QPTA 2EFOA 2K4BA 4ESFA 4BNCA 4UNOA 1EH8A 2NAZA 4LJZF 3T8RA 4WK8F 4E70A 3J81Z 4UV8A 4OIPF 4IHTA 1IXRC 4HZFA 4ESBA 4ZZDA 4FX0A 3Q9SA 2EA4A 4UXNA 4KIFA 3TGNA 2XROA 4RGUA 4HQMA 2YX7A 2UWMA 4HAMA 1HKSA 4O3MA 3BWGA 4LG0B 1G3SA 1J7KA 1USSA 1HSTA 1Z05A 1G3TA 4L0YB 1IAWA 1P4XA 2EB7A 1ODDA 1KU7A 1FC3A 1FBQA 1GHCA 3P9KA 1XSDA 2EA2A 1LVAA 5A2QK 5DD4A 3RKWA 2L4MA 2K7LA 5DUIA 1HKQA 1SD5A 2FNAA 2ESNA 1U3EM 4ZYDA 2WTEA 5LHIA 1YS6A 2MBFA 1O3QA 5ERIA 3KP7A 3GW2A 1QZZA 3R60A 1IZ1A 2MH2A 2XAQA 1A04A 4KT5C 1BI1A 3I4PA 4HV5A 4BYYA 2BYVE 4YFNF 4P9UA 2JT1A 3HOTA 3ZPLA 1TBXA 4BXUA 3TO9A 5HVQC 4L18B 3RPUA 2GZWA 2PBIA 3FZVA 1YYVA 1GXPA 3E6DA 1UFMA 1FT9A 3TOBA 3GXOA 2JTVA 4DNCA 3L7WA 1YW7A 5E8IA 3KZZA 3HHHA 4YFKF 3K1NA 2BBYA 2HFHA 5FFXA 2F2EA 4WCGA 3E6CC 1RZ4A 3MZYA 4MGRA 4XBFA 1OYIA 3VODA 4Q5SF 4IVNA 1MKMA 2Y0MA 1AOYA 3WTYC 3NQOA 2ELHA 4FT8A 2H27A 1B1BA 5E8GA 1BM9A 1G6NA 3ULQB 1RUNA 4PDKA 2OZUA 1OYWA 3O2PE 1U5TA 2HQNA 5L3BA 2BEOA 1FSEA 1FOKA 4P96A 4XLNF 2HOEA 1FWZA 2VBWA 1FZPB 3JSPA 3I64A 4Q4ZF 5BS6A 5D5XB 4EJVA 2EK5A 3Q9VA 1XGOA 3I5UA 2W84A 4L9TA 2EFPA 1EV7A 3IRQA 5LRRA 2GA1A 3HRUA 1XMKA 3HSFA 4YFXF 2LF7A 1G3YA 3COAC 1R7JA 1BIAA 2HZTA 4OINF 1O57A 3TKYA 3JW4A 1H9GA 3OOPA 2YU3A 3NEUA 4L9VA 1J5YA 2FBIA 3QRFF 3RIRA 3K2ZA 4LMYA 2DFIA 2EFQA 3IKTA 3FM3A 3GO5A 2DAOA 2IP2A 3WTZA 2FE3A 4RB3C 5CVJA 4ETSA 4MTEA 3FXRA 2XRNA 3W6KB 5HLIA 3M9AA 3M7GA 5HOOA 1BI3A 3BP8A 5LGNA 3VB2A 3IWFA 3LA3A 1LDKB 3R4KA 4EJOA 4I0AA 3F6OA 3J81K 3F23A 4FHTA 2NNNA 3TQNA 4LLGF 1YG2A 2VODA 3CTAA 3RPQA 5HLGA 1TQPA 1K78A 2XKPA 2BV6A 2CGPA 1W5TA 3HSRA 1BBYA 3FMSA 5JVTA 4BHBA 2CO5A 2C6YA 1RI7A 3CO6C 2OA4A 2RVCA 1SMYF 1JGSA 5JFRA 1KQ0A 3E6BA 1T39A 3U1DA 1ONVA 4ENJA 1YS7A 1K6OA 1IN7A 1FNNA 3ECOA 2D2WA 1WSUA 3IWZA 3WE2A 1S7AA 4ZYHA 3HOSA 1B9NA 4HF0A 2VONA 2QQAA 2RGVA 3KLNA 3ISPA 4I0BA 2A6HF 4IF4A 2GXBA 1XCVA 5F6FA 5IT9K 4AIHA 4GGGA 3QP6A 1KA8A 3WG9A 1P2FA 4IJAA 5E18F 2VOOA 2LF8A 1DPRA 3BOQA 2MH9A 1AWCA 2HTJA 4S04A 5K1YA 3TO6A 2IA0A 1OYYA 3I59B 2EFWA 1YIOA 1U8RA 1LJ9A 4JBAA 4M6XA 4HF1A 1YFHA 2D1VA 2EV6A 5BMZA 4ZH4F 3ZMTA 3QPHA 1B4AA 3F22A 2A6EF 2ZXJA 4MQ9F 1J9IA 3MAJA 5HS9A 4ESJA 4GYGA 3RKYA 4G7ZF 2IJLA 5KVRA 1HW5A 5ICCA 4U0YA 2A69F 1I6XA 2L02A 5H6RA 3F8NA 5J6XA 1R1VA 2F5EA 3KP3A 4LGWA 4M74A 2V1UA 2COMA 3U9GA 2V6CA 3DEUA 3KP2A 1HW2A 5D5VB 2EFNA 1W7PD 1XN7A 1E17A 4AD9A 4BAYA 4WXDA 1B59A 4CHUA 3WGIA 2L54A 3K69A 4BHCA 1T6SA 4IHSA 5DV5A 2Q2EA 4MQVA 3ZN1A 4N9HA 4G94A 3PFIA 2H6CA 2QYOA 3KFWX 2MLGA 2JZYA 1TNTA 2PEXA 4YIFA 4G6QA 2XV4S 4IRGA 4Q47A 2P8TA 3CJNA 2VC1A 3ABTA 4PCQA 5E1XA 4RAYA 4Y17A 4U7DA 1ULYA 4M9ZA 3E5UA 2ZKZA 2WWYA 1TTYA 1C0WA 1Z1DA 1PDNC 2P4WA 4HA8A 1D5VA 4IPAA 4RAZA 4EM0B 1MJBA 5JI6A 4U0WA 3IL2A 2MD5A 2PQ8A 4HV6A 3KEQA 4XSZF 3ABUA 1Q1HA 3C18A 3VFZA 2LDUA 4HBLA 5TRDA 1U2WA 1F5TA 3FMQA 2QBYB 1XB4A 1O7LA 4L9JA 4UVCA 5LHGA 2J5PA 4LK1F 4P5OA 1STZA 2R3SA 3C7JA
chains in the Genus database with same CATH superfamily
2EH3A 4EGYA 4PFPA 1PUEE 3F8CA 3GF2A 4KFCA 2L5QA 3ESWB 3AAFA 3WTVC 2X51A 2XPVA 2BVLA 3OIPA 5F1JA 5M3FJ 1WJAA 2L7MP 4YRVA 3R61A 2ZFUA 4C3IJ 3FXUA 2OUMA 3K4JA 5FKLA 1X3WB 5FLXZ 3J80K 5KAIC 2LNBA 5FRNA 3WE3A 1BI2A 2BHZA 3ASOH 3HOWJ 2HKOA 1ZR4A 2IAIA 2XGXA 1BOAA 4L9NA 3CMAI 2IRFG 4U0VA 1FIAA 4LG3A 4JK1X 1KYWA 2CUEA 3LSGA 2OBPA 2D45A 4B1RA 1WJCA 1PP8F 2K9LA 3ZQGA 2IS2A 4PK4A 2JVHA 2FXAA 3GZ6A 3HSEA 3LQQA 1UB9A 1NG6A 2H8WA 3FIWA 2L7FP 3OY9A 4I98B 3GYHX 2VE9A 1TQIA 3UR3C 1BIBA 1XX5A 3GTGJ 2FNPA 4JYKA 5LGUA 1R49A 1Z3XA 1XGMA 3ABMH 4ZYEA 2P6TA 1IXSB 4OIOF 2DA4A 1LDDA 2JRTA 5E79C 4HRIA 3EUHC 2FUG2 4HLYA 3H9JA 1GV2A 1OLTA 1ZKGA 2V1DA 1JJ8C 5IYCJ 2WB1N 2HOTA 2L3DA 2LG4A 2NRAC 1EJ9A 3OIQA 1S5LC 4UY8I 1GVDA 1SFEA 4LG0A 3MZHA 4JOMA 3S93A 3ELKA 5K5RA 5C4JJ 4E7JA 2R7VA 5F0CA 2L9RA 5HDGA 3DCFA 2LH9A 2QZ8A 1MMSA 4ASNA 4EM2A 3FX3A 5LD2C 1HW1A 2L0KA 3ZQFA 4KT6A 3GTOJ 5EEHA 3NRVA 1VQKI 1Z6TA 3G3ZA 4EV0A 1DP7P 5ILVA 1TWCJ 2IPQX 2P5KA 4KUMA 1GUUA 1DGRM 1JXSA 3UNGC 4M9SA 2QSFX 3OSFA 3HKZA 5B5EC 3DXJF 4U88A 2DPUA 2WV1A 2HXOA 1APLC 2PN6A 3GEZA 4BJTA 3S2WA 4HEA2 4DBQA 2OV7A 2XASA 1RESA 2ZBKA 3E97A 1LQ1A 4A0XA 4DW6A 4NHJA 3SFZA 2IT0A 2JPBA 5EGOA 3OYCA 2LKXA 4Y13A 1G8XA 4LLLA 4XRSA 3PM1A 2XGDA 1U6GA 3RYRA 3EDPA 2EV5A 4I7HA 4MEXF 1R58A 1UG2A 2RNJA 2LC2A 4KN4X 2Z33A 1JJ6C 3VEPA 3W6JB 1KONA 5FGMA 2LR8A 3VYSB 3RZOJ 4HDUA 4KMFA 2OQRA 3FWEA 1CGPA 4MEYF 1K7AA 2JSCA 3ERED 1LB2A 2XRLA 1KQ8A 4BJ6C 2R7WA 2XHKA 4CXFA 2R7TA 3GZ5A 3DTEA 1CF7B 3M1CA 1DUXC 1KGSA 1W7PA 2K02A 2LVSA 2R7OA 2R7QA 3HUGA 2DMUA 2GXGA 5GPCA 2W85A 3LSTA 4QPOA 3O6BB 1S6LA 3TW6A 1GT0C 3L2WA 3MN2A 2NS7A 5TJJA 3L2RA 2RAEA 3HDDA 2KIMA 1A31A 5DTDA 1FEXA 1XSVA 3JCUC 1T98A 1JUSA 3I4MJ 3MKWB 3CJTB 2DN0A 1J0RA 4ZZLA 3BJ6A 4E7HA 2FX0A 4YIRX 1VQNI 3DKWA 2E60A 2JQ7A 2XAFA 2CW8A 1YITI 3KP4A 3HM5A 5DUKA 4CGZA 2V26A 4A3KJ 1R9TJ 2STTA 4RBOA 4HX4A 4F7ZA 1JTXA 3IHUA 4MIMA 3ZGKA 3BDDA 3IAM2 2EPFA 2XB0X 1WGXA 3ZQ7A 4F91B 3LAPA 1A6IA 4EEFG 4KNYA 3G73A 2O7OA 1K4SA 4IHYA 4CYCA 3QU3A 3HOXJ 1HCRA 4M3EA 3ZQIA 2L4AA 1A5JA 1FMVA 2XIGA 2EV0A 5D6FA 3CP8A 2LMDA 3WGHA 3DWLE 1O3TA 1I50J 5ILSA 3E5XA 3ZQQA 2RQPA 1TQMA 1X58A 3QP5A 4BJ5C 1IN4A 1UMQA 2R7FA 2KL4A 2V9VA 3RI4A 3CCRI 1SD4A 4AYBN 1VQLI 5D6EA 1G4DA 4UHTA 2XDVA 3I54A 3TEDA 5J1YA 1S8NA 2X1CA 1IJWC 2FOWA 1S29A 4JP0A 1VQOI 3CUOA 2E5ZA 2V1NA 5DEQA 5ICEA 4XIDA 1IGNA 2DW4A 2VASA 2W4SA 1LE8A 1ZAOA 3OYEA 1AKHB 3V7RA 5F0FA 3ZOBA 4BE1A 2JUCA 1MBHA 5B1BH 2M30A 3B73A 1BJAA 4ZDPA 1JKPC 2YSRA 3DPTA 4CO8A 1FTTA 3RKXA 4NQWA 1RR8C 4GDFA 1EH6A 2F5VA 2V6EA 1OMIA 4ZDLA 3G1OA 2HYFA 1R23A 5F64A 4A6EA 5D8LB 1DQUA 3SQNA 3PSIA 2EINH 4AWXB 2A5YB 4Y33A 1IUFA 4UUVA 5F04A 2KQRA 1IN5A 3S1QJ 3G2BA 3OYLA 4XRSG 4QLCU 4BDZA 2HR3A 2ZNZA 4NBQA 4M3DA 5AIQA 3BLYA 1BR4A 4M9XA 2OZ6A 4IRHA 4EJWA 2KRCA 3IH4A 3TO7A 1YHQI 1OCTC 3A2KA 3S15J 2F48A 4CCKA 2MLKA 2F5FA 1XMXA 4G6TB 3OYAA 2CV2A 5LBQA 1ZR2A 2W82A 3T8TA 4NNJA 1MJAA 5FKOA 3LSKA 1QRYA 2L9NA 3IP4B 4I6ZA 4LITA 4XLCA 1QZYA 2LKSA 3K4MA 3N05A 3BROA 2QSGX 2M8GX 2VT3A 1LDJA 2YR2A 1TWAJ 2UV1A 4XKWA 2W57A 3B6CA 3HOUJ 3BTLA 3RJPA 1W36C 3PQKA 2YPRA 2CG4A 2NNYA 3JREA 2MA3A 3E5QA 2K9MA 5FB2A 4BE0A 3Q3SA 2KPMA 3ZQCA 2G7UA 3HC7A 3SEQA 4ABZA 2VI6A 1IO2A 3PSFA 4BHPA 2W7NA 3MWMA 3L9FA 1T95A 4LK0F 4XM3A 2IBDA 4C9YA 3OV8A 3DF8A 2QSHX 3HHGA 1KZHA 2LD5A 2R7XA 3S14J 5HDKA 1KYZA 2ZO4A 1WKMA 1FIPA 3SZPA 2O03A 4LD5A 3P7NA 3ZRGA 2M34A 4N4NB 2OCCH 3CCEI 4HDVA 5IT3A 1FPQA 4S0HB 1M1EB 4HQEA 2PG4A 5C44J 4AU7A 2DQLA 1E0EA 2OAZA 4NC8A 3MMYB 3H3VK 2FA5A 5HLTA 5J8FA 3BR0A 4PJ0C 5IPAA 2HQRA 2W24A 4XNFA 3CMMA 2QM3A 1ETKA 2M8EA 2XAGA 4PSWA 1BA5A 2Y75A 2HOSA 2VBYA 4WWCA 2P5LC 1MIJA 5E3MA 1E3OC 4WF2A 5JVGF 4EMSA 3GTJJ 5HS8A 2OU2A 5FO5A 3V42A 4IZZA 3DKXA 2IS1A 2HYJA 2JN6A 3WU2C 5LHHA 4CCNA 2XPUA 2DMQA 3JTHA 3SEZA 1X3ZB 3CMEI 3AG3H 4M3GA 2QENA 3CUQA 2CMPA 3LWFA 2CS3A 4A3DJ 2CQNA 4EJUA 4F3QA 1SFOJ 1QVUA 3BTIA 2VBZA 4IX7A 1F36A 4H0EA 5CLSA 1FTZA 2E2JJ 3ZXSA 1YO5C 3E6MA 2BZTA 1R4NB 2V4JC 4QPQA 2A3SA 1I1GA 1X19A 2BXZA 2DT5A 4XLPF 2DOEA 3K4LA 2LLKA 1FBUA 4K2EA 3PIPF 2R92J 3U21A 3X2QH 3EYIA 4L0ZB 2Y0SN 4CDGA 1V5FA 5DYMA 5EF6A 2IGNA 3PUFA 2JA8J 3PL8A 5GAEJ 1SMTA 5GTHC 1YW8A 3M8JA 3RTRA 3BCAA 3JAMZ 3RZDJ 1K61A 1VQ5I 1KU2A 2AQEA 2RDPA 4CCMA 3AFHA 3MZ8A 4D1QA 2EWNA 4B8XA 1VTNC 2G9WA 2UXXA 2WV0A 1QO0D 3H92A 4LIUA 3FXQA 1U5TB 4PZJA 1I39A 1OFCX 1KU9A 2VJIA 1IN8A 2HKXA 4ZC3A 1S3JA 2M87A 3HUGB 3LOCA 1K78B 2ID3A 2EIJH 2Y9ZA 5CJ9A 1OR7A 5D5WB 2R7UA 2VQLA 1RUOA 1B8IB 5FRMA 3GFJA 3BG3A 3IKVA 3BR5A 2CJJA 3C3WA 4B09A 1WQ2A 1W0UA 5EEAA 2KIFA 1VQ8I 2X4HA 3ZMUA 3PO2J 2GWRA 3AL0B 1R5ID 2EIKH 3GVAA 1BC8C 2VB6A 2Y48A 3DTIA 2YU9J 2XUBA 2DFHA 5KK1A 2M5WA 1YQAA 2JPCA 1R5HA 3NARA 5DD8A 1WI9A 5JR3A 1VFCA 2ACJA 4HNVA 2VIXA 1Y0UA 2F4IA 2H94A 2GOXB 2XGEA 5H2FC 2GQQA 2JK3A 5H6QA 5ICGA 2P7VB 3JRFA 1RKWA 1UZCA 2HTSA 4OMZA 4CYCB 2PLYA 4NDLA 2ZSHB 1OR7C 4CCOA 4E7IA 2A5WA 1MDMA 4BBSJ 1P4AA 2KKOA 3DV8A 1QQIA 4RGXA 5BOXA 1JI8A 2Q8KA 1RC9A 2M45A 2FF4A 2EZHA 2CYYA 2B63J 4AIDA 3FXJA 1TZLA 3ZQLA 2X6YA 1TC3C 2VQCA 1U78A 1OCCH 3MEXA 3VOEA 1I5ZA 2Z1DA 2QA4I 2PFBA 1VZ0A 3K4CA 3W3CA 4HX7A 1ZH5A 2JSPA 2BGCA 2P0WA 2PJPA 4ENKA 1D1BA 1P7IA 2FQ3A 4P9FA 1WRJA 2E19A 1DDNA 1IF1A 2DOAA 3EUHA 2Y31A 5F0HA 3WTSC 3ML6A 3U2RA 1HOMA 1D5YA 3HEFA 4A3GJ 1YW9A 4A0ZA 3C1DA 5FLMJ 1J09A 4B4CA 2DMPA 1UHWA 1ZYRF 4C2UA 3K1MA 3KEOA 4RAGA 3OYIA 1ZREA 1XTAA 2STWA 4GCVA 1NK2P 2DK5A 4JX6A 4W1UA 3QODA 5CKTA 2LSOA 4I2OA 1D0ZA 3V4GA 4JQFA 5F1RA 5E1WA 1T8IA 2DTRA 3JSOA 2M0MA 3DFGA 3P9CA 5FKKA 2LY1A 4XSXF 3QYBA 1OCZH 2DI3A 1TT0A 4XKBA 1XC5A 1Z9CA 2QBYA 2KRFA 3OS2A 3IRRA 3C2HA 4HPQA 2GIVA 1AA7A 2Z3YA 1IXCA 4UVBA 3WU1B 3WODF 4MFDA 3BZ6A 4ITVA 4Y7NJ 4TV7A 4F93B 1QGPA 2JUGA 1BI0A 1ZLKA 4BXXJ 4OIRF 2CUJA 2XAHA 3SDBA 1B6AA 5E20A 5J3LA 3OMYA 3SZGA 1ZARA 1TLHB 3I53A 1QNTA 2BY3A 2XB5A 4KITB 3WTTC 4J00A 3WHBA 3GTPJ 1TL8A 2VE8A 4O6JA 3F21A 2WAFA 3T0YA 1R1TA 3OYNA 3OL3A 1SC7A 3VSLA 1HA8A 3DBRB 5EYRA 3R6SA 5CYVA 3K1PA 1SD7A 4FQGA 2DO7A 4HOBA 1W5SA 4E6KG 2RQQA 1EA3A 2F6CA 1FMWA 3H35A 3I59A 1PVEA 4XLEA 4UUSB 4CICA 4DYQA 4GO1A 1P6RA 1VQ7I 1WWXA 2ZCWA 1ITYA 2CWEA 1XS9A 2O6GE 3CUQC 1XCBA 1ORKA 2EQRA 1B9MA 4LB6B 3K70D 1BL0A 3E1SA 2HI3A 4RDUA 2ZC2A 3EETA 1WFXA 3SHFA 1ZLJA 1T2KA 1JHHA 3VYTB 2M4KA 3F6VA 3TDZC 2QWWA 4BQNA 3SZTA 4LIVA 4ZTFA 2KJCA 2VOPA 2Q2EB 2MSYA 4ENMA 2ESHA 1MMAA 1ZRCA 3WTUC 3T1BA 2CUFA 4KMUX 3BR6A 2JA7J 2FMYA 2HU9A 2R7DA 1ZQ3P 2HGCA 4KICA 4OAYA 4BQAA 3C2GA 2IA1A 1RKTA 1E3HA 1XGNA 2DBBA 2XKOA 3RDIA 3CO7C 1YTYA 3HRSA 1MJ9A 1HQCA 4XN0A 4PGHA 2IS4A 5L3DA 1P7JA 2VXDA 1HXDA 1R6RA 1RNLA 1IW7F 3ZMDA 4BGDA 4KIBA 3LA7A 2A68F 4LFUA 5D8KB 1QPIA 2DQRA 4H4KC 2CSOA 1PJRA 5E3NA 1ZGJA 3V8LA 4BEHA 4II3A 2ZJPF 2LOOA 5EG0B 3ZMVA 4BH9A 1F4KA 2HDCA 4G8XA 3J7YJ 1UHMA 3IC7A 3MFKA 1ETWA 1O7FA 5J1RA 1KU3A 3N97A 1O3RA 1LVKA 1MZBA 5BPIA 1W4MA 1NH3A 3FMRA 3QYEA 1FBSA 2FMLA 3DU5A 2BXYA 1WJFA 1I6HJ 4FETA 4ZDOA 4Y3OA 1DP3A 4DOZA 4OIQF 4N4OB 4U7BA 2PI0A 3NWTA 2O61A 4RGSA 2R93J 3HG9A 4PGGA 2HVRA 4OU0A 1TW2A 3WU0A 2NXNB 4QTRA 3JAMK 2V79A 3I58A 2KJBA 4DYRA 5LEJA 3B6AA 4B3AA 1X1BA 2GBYA 5L3EA 4X1EA 4IRIA 4FTHA 5TISC 4PJJA 1MGTA 4EJTA 2EIMH 3JRHA 2OCEA 2WA0A 3HIFA 5M5XJ 1QPMA 2RC4A 3G71I 2XF5A 5DDGA 1PP7U 2QLZA 1ETOA 4L5JA 4XORA 1TW3A 2R5YA 4BE2A 1S72I 2NS0A 4AVPA 5JHUA 1B8IA 1FP2A 4HW0A 3A01A 1DPUA 1BR2A 2QUFA 2BY0A 2VKHA 3L2CA 1BJZA 2O0YA 3S1MJ 1EF4A 4NB5A 1H9TA 2DFEA 3ZN0A 1I27A 2WAQN 2HWVA 5DM6F 5LLQA 5ILUA 3KE2A 3BTJA 2E5NA 2OF7A 3H3ZA 1H89C 4QWQA 1HKTA 1WCMJ 1HDPA 1HSJA 2Z5UA 3A0HC 3MCZA 4A0YA 1D1CA 2D1HA 2HQ5A 1T38A 2CQQA 1MH3A 1P4WA 1WVRA 4ON0A 2DODA 2K4JA 2QKMB 2DPDA 3BZKA 2LFBA 3WHCA 2JVGA 5HS7A 1IDZA 2KIQA 1GVJA 2X6OA 2DMNA 2HPMA 2I10A 5IYBJ 1ZGAA 3FISA 3FF5A 1ZG5A 4JX5A 5IP7J 3S8PA 2HYGD 1TWFJ 2VJ4A 4ZYAA 2CRGA 4KYWA 3S32A 1Y8QB 1CF7A 4G12A 1MSFC 4E7KA 3CF5F 3DEWA 3BPXA 2EBIA 5JLXA 1BW6A 3V7CA 2OD5A 2K3PA 5DCMA 1JKRC 2PJRB 2V1XA 3TOAA 2B9SA 6PAXA 3BY6A 2K86A 3BPVA 3QOEA 1JE8A 2W25A 2R7ZJ 3TDUC 5AONA 1IDYA 3I56I 2B0LA 9ANTA 1V5GA 2P5VA 4Z2YA 4XN3A 1Q1VA 1VQMI 3I0TA 4WXCA 5CQGA 2X6XA 2R5ZB 1GXQA 2Z99A 1LNWA 3S3OA 1QA6A 2ISZA 3M8FA 3K9TA 3F8BA 1LUJB 3KP5A 1ZRDA 3BC8A 1FSHA 1K6YA 3J80Z 2MC3A 4N0BA 2KIUA 3DKYA 1OCRH 3Q5FA 3DPLC 1T33A 5J47A 4HLXA 5IYDJ 2PMHA 2CFOA 5FJ8J 4IXAA 1ON2A 4C30A 4BQOA 3G4SI 3MKZA 2H09A 4A5MA 1H0MA 5FD6A 1D3YA 4IOAF 2HPIA 4Q48A 4ZYGA 1WJ5A 5LGTA 1J2XA 3QOPA 1SEUA 2DXIA 1MDMB 2WADA 4IKFA 2LREA 1OISA 3ROUA 4WXHA 1D8KA 2K5CA 5EEGA 4MHGA 4R79A 4A12A 4RS8A 3V8KA 3LA2A 5B3SH 3F8MA 3GTQJ 3FK7A 2FU4A 3D5SC 3ZR8X 4G7HF 1JT6A 3HRMA 4IEJA 2HDWA 3I3LA 3JRBA 1FYKA 3KYDB 5D4SA 1VQ9I 2HEOA 1LEAA 2QF7A 3S3NA 1XDSA 4XLAA 2HVSA 3H0DA 4BUPA 3A02A 1TWGJ 5FD5A 2DU9A 3L2UA 1G2HA 2VC0A 1F1ZA 1R5GA 3LL7A 3KPHA 3CDHA 2ISYA 3GUDA 2QEXI 2CW0F 3RPUD 4A69C 2IVMA 4BQQA 3H5AA 1UAAA 1LPQA 2Q0OA 1USTA 3H3UA 4HX8A 3D0SA 4N9IA 3J7ZI 1FJLA 2G7HA 2LKPA 3CC2I 1IC8A 2VKEA 2M2EA 1H88C 3W2AA 4G7OF 3A4CA 4CUGA 3DLLF 1ZN2A 1XMAA 3NWSA 4NUBA 4FE7A 4CZZA 1FYLA 2Z2SB 3KETA 3TMOA 1Z91A 4D7MA 1QBJA 2VQHA 2P6SA 2A61A 3I4NJ 3WTWC 5TGTA 1ZG3A 5EDNA 4IQ4A 3WGGA 2CW7A 2PMUA 4HG2A 4A3IJ 2FJ1A 3KP6A 1MBKA 1E2XA 1RIOH 2FRHA 5L3GA 1SAXA 3DQVC 1WPKA 3GFLA 2IA2A 4J01A 4KDPA 1ETQA 2HS5A 3TW7A 2ADUA 5IOYA 3WTXC 1IRXA 3O3KA 3W2WA 3LAJA 1LEBA 3BTCA 2NVYJ 4ANJA 3S3MA 5D4RA 1VQ4I 2FEZA 3KZYA 4Y4RA 2VL8A 4IL6C 1ENHA 3F3XA 1Z7UA 2B7EA 1SFUA 2VXZA 4HF2A 2IGMA 2VT2A 1MBEA 1G3WA 3LQRA 2XAJA 3N4MA 5EZGA 5B1AH 3HXLA 5FLVA 5IT9Z 2ZMEC 3KLOA 4C3HJ 2XF6A 3OYFA 1MH4A 3B02A 2V7FA 4L5EA 2ZMEB 2X1EA 2RKHA 4EM1A 2NYXA 2E2HJ 1T0FC 2OTJI 2ZFWA 4KJZA 2VPRA 3M1EA 3P9IA 5BPDA 2VQGA 1FY7A 4RM3A 3HPGA 1ZRFA 3ZMZA 5KCMA 3SXYA 1GDTA 3K6GA 1A35A 2FOKA 1IV6A 4R8HA 1OCPA 5LEKA 2VBXA 4I01A 4KIGA 1ETYA 4OWRB 2NS8A 5HDNA 1XSXA 1UCRA 3BJAA 3GTLJ 2HQAA 4I09A 5CPRB 1I1SA 4RGRA 3HYIA 4M72A 2O8XA 3RYPA 3H0GJ 2DLLA 1WJDA 4KISA 2QQ9A 3GLLA 2LBFA 4G9YA 3I55I 3HRTA 1ON1A 4UVAA 3V8JA 4OOIA 1WH5A 3ECHA 1K79A 1J75A 1T0FA 3D5LA 1JKQC 5K5QA 1R36A 2FBHA 3GFIA 2LTPA 4RB1A 2WAEA 3DPUA 2CFXA 3SYTA 5J4YA 4YG2F 2Y9YA 5LRSA 4A2UA 3L2VA 3H9GA 2CQKA 1L0OC 5BQTA 3P5JA 2GM4A 2KHMA 5L3FA 2QVOA 1OJLA 3E0JB 2XSDC 3GMEA 3V7SA 4AIKA 4AUXA 5DCMB 4BXFA 4XLHA 3OYKA 3L00A 4XRFA 3BG5A 5AIPA 3K70C 2EJRA 3BJOA 3HTSB 3CCLI 1VQ6I 3EQLF 1WI3A 1YE9A 2YX4A 4D0PA 2F5CA 3CCJI 3HOYJ 5KAFC 4RMNA 2PJRA 4EVIA 3OYBA 1Z7LA 2Y30A 5E1ZB 1FX7A 2X0LA 4P55A 2GAUA 1TP4A 2Z16A 2QQBA 2ZJ2A 5ED4A 1F9NA 4UV9A 3MKYB 4YEJA 1S7OA 1AKHA 4KN7X 1U9OA 1DU0A 5GADJ 2ELJA 2HOAA 5ICFA 4CCLA 2UZKA 1DGWY 2FBKA 2A07F 5CVIA 3F9KA 2RV8A 2XAUA 5FLXK 3S16J 1VF9A 1UJ8A 2MW8A 3I71A 4GYIA 4NQWB 1TNSA 1Y0NA 3EUAA 4A3JJ 3PQJA 2P81A 3QU6A 4I76A 1NG7A 2AXLA 2M1BA 3ERMA 1IRFA 4ZTJA 3H36A 1WHUA 1D1AA 1P92A 5A2QZ 1YLFA 5E3OA 2F5DA 1W36D 3HKZN 2OQGA 2TDXA 1YOVB 1L3LA 5L3CA 1X3UA 1A6QA 1BN5A 2E7WA 3HGGA 1R71A 4ENNA 1J59A 1NHAA 4AIJA 5K7ZA 1BR1A 2K3FA 3DTKA 3CD6I 2UXNA 4MO7A 3I9V2 2DA6A 3GFMA 3CLQA 1WJEA 3DLAA 3FM5A 3O8HA 4S05A 2NVQJ 3J7AO 1R4MB 2UUZA 2DTZA 5K5OA 4MTDA 1Y56A 3FK6A 5J8CA 3DP7A 4HYEA 3CCSI 2ECBA 2K9NA 1REPC 2BVMA 3BG9A 3K0LA 4M73A 1ETXA 2HZDA 3REOA 1YI2I 2HNHA 2W48A 1Z6RA 3CJRB 3ZP5A 1V3FA 2Z9OA 2BE5F 2EILH 1FLIA 3HTUA 1JHFA 1Z0XA 1ZELA 3ZMSA 3R0JA 1XDUA 1EH7A 1OKRA 1SD6A 2IW5A 4EQQA 1MBFA 2O8KA 3OYGA 4M71A 1R00A 5K7HA 1B72B 4MLOA 1HBXG 1WJBA 3ASNH 1R22A 2NVTJ 2CQ7A 3IUOA 5DCFA 2H6BA 3FHZA 1WZ2A 4G6DA 3HGYA 3OL4A 1XGSA 3K4NA 1MW7A 2E1CA 2O3FA 2GA2A 2JMWA 4M3FA 3T5XA 2JJ7A 3EUKL 2E1NA 3K7AJ 2PMZN 2EZIA 3CCUI 1IN6A 1FP1D 1XD7A 5GAGJ 3D5RC 3R0AA 3FKIJ 4EGZA 4OMYA 1BC7C 1I3AA 5J1UA 2FSWA 4GXOA 3GX4X 3HJEA 3FXKA 3F72A 2KZGA 4F55A 1IUYA 4IQJA 2VN2A 5FFZA 2G0EA 5EZHA 1U5TC 2AS5F 2XVCA 1D0XA 3L09A 3LFKA 1POGA 2K27A 3VWBA 3E3VA 5H20A 5IP6A 1XPXA 3K4KA 3OS0A 3C2BA 3GWZA 1QZEA 3SJMA 4DIQA 1FYMA 2DT7B 4MNUA 3HOZJ 2L01A 1W5CC 3BR3A 2JWTA 2ZMEA 2ME6A 1H8AC 1SFXA 1K83J 3FBNB 4RB0A 1S7EA 4FX4A 4II2A 1TT5B 1MBGA 1U9NA 2ZNYA 1KQ9A 3F8FA 1V4RA 5CVVA 1O3SA 2QGUA 1CQTA 2L9VA 4KA4A 2WC2A 4R1HA 2AXTC 3GLXA 4D9JA 1D8JA 3CUQB 5CVRA 1BOBA 2MFZA 2ZXIA 1YX5A 4XL9A 5F08A 4AYBA 4UUSA 1AHDP 4YIIA 4L5IA 2JA2A 3EYYA 4A6DA 4WX9A 3JTGA 1IRGA 5GTIC 5J4VA 5D5UB 1MD0A 2RN7A 1HF0A 1MNEA 1X4OA 4B43A 3FXOA 5IY5H 3PFYA 2LBFB 2P7CB 1JTYA 1V55H 4HNUA 1G59A 2CU7A 4RB2C 2X85A 4A5NA 2Y69H 1ZG1A 1RRJA 4Y15A 2E7XA 3CLOA 4B3XA 3SFIA 3S1NJ 3W6VA 2VKVA 4U87A 1ACIA 3KCCA 2H1KA 3LSHA 3WG7H 3MQ0A 2NOGA 3S1RJ 3BR1A 3DU6A 2EZKA 3PIOF 1D0YA 4I02A 3DEEA 5CVUA 4AC0A 3OYHA 4M6YA 3QYFA 3KYLA 4DQ2A 3TP0A 3QAHA 4O5VA 5E17F 1V54H 3M8EA 3LFUA 3H5NA 2TCTA 3IV5A 4LB5A 2L2OA 5GPAA 4LLNA 4XOPA 5IP9J 3PJRA 2O5RA 3L2QA 5HLHA 2BW3B 1OPCA 2QCOA 4QSHA 1ERDA 3S17J 2DK8A 1R1UA 2ID6A 2J5OA 1W7PB 3IH3A 3LSJA 2R5YB 1ZHFA 4DGWB 4GFBA 4CYDA 2ETHA 3QPTA 2EFOA 2K4BA 4ESFA 3CESA 3H9QA 5EGOB 2GOMA 4BNCA 4UNOA 2K40A 1EH8A 4C3JJ 1T08B 4RAFA 2M9HA 1SAUA 2NAZA 4LJZF 2ZXWH 3T8RA 3LSMA 4DZPA 2E1OA 1YJNI 4WK8F 3HB9A 4JX4A 2DOFA 2Q1ZB 3JR9A 2DA3A 4A3MJ 2I8DA 4DZJA 4E70A 3J81Z 4W97A 4UV8A 4OIPF 3CQZJ 4IHTA 1IXRC 4HZFA 4ESBA 2ZJRF 4ZZDA 4FX0A 3Q9SA 4BY1J 2EA4A 4IO9F 4UXNA 3CF2A 3E7LA 2YUSA 3GCMA 4KIFA 3TGNA 2XROA 3GTKJ 2AQFA 4RA2A 4HSRA 4RGUA 4HQMA 3FHNA 2YX7A 2E1MB 3A03A 2UWMA 3FDYA 4B48A 2VPLA 1MNDA 4HAMA 1I3QJ 3OIOA 1HKSA 4O3MA 1O4XA 4B44A 3BWGA 4XR6A 3M3YJ 4LG0B 2X9DA 3BZCA 2W00A 5FKMA 3JRGA 3LNQA 1T56A 1G3SA 1JGGA 5DS9A 1J7KA 1USSA 1HSTA 3S2HJ 2IXSA 3K4BA 1Z05A 1G3TA 2K9QA 1IAWA 4L0YB 1P4XA 2R7RA 4MFEA 2EB7A 1ODDA 4FCYA 3ABKH 1KU7A 3L1PA 1FC3A 2WB1A 3LSRA 1FBQA 1GHCA 4XLFA 3P9KA 4QIWN 1X4PA 2R4GA 2EA2A 1LVAA 2VJ5A 5A2QK 5HODA 5DD4A 3RKWA 1XSDA 2L7ZA 2L4MA 2K7LA 3OR1C 5DUIA 1HKQA 1SD5A 3M4OJ 2FNAA 2ESNA 1U3EM 2AO9A 4XMYA 3JRDA 4ZYDA 2WTEA 5LHIA 4X0GA 1YRNA 1YS6A 3G6EI 5K7FA 2MBFA 3VSKA 2KDZA 1O3QA 3DBLB 5ERIA 4AM3A 2TRTA 3KP7A 3GW2A 1QZZA 2M0CA 3R60A 1IZ1A 2MH2A 2XAQA 4PJLA 3RCOA 1PYVA 3RKQA 1A04A 4KT5C 1BI1A 4XK4A 3FXMA 3I4PA 4HV5A 2M3AA 4BYYA 2BYVE 2LY9A 4YFNF 2R0QC 1Z67A 3H5RA 2ZB9A 4XKCA 4P9UA 2JT1A 3HOTA 1QHHD 4DBRA 3ZPLA 1TBXA 4C2MJ 4BXUA 3TO9A 3HBLA 4FE4A 5HVQC 4L18B 4A93J 1AU7A 2H1LA 5LFAA 4CSWA 3MVPA 4DJAA 3CCMI 4I99C 4UUTA 3RPUA 4RM2A 3KZIC 2GZWA 2PBIA 2A6TA 2K85A 5CQEA 3GTMJ 5C4XJ 3FZVA 1RPWA 4D5FA 1YYVA 2MG4A 1GXPA 3E6DA 1UFMA 4PJMA 4XQFA 1FT9A 3TOBA 1Y6IA 3GXOA 1PUFB 2NVUB 2JTVA 2KP6A 3VPRA 1B72A 4DNCA 2BOLA 3L7WA 3D1NI 1YW7A 4E7SA 4PJNA 5E8IA 2XSJC 2IGOA 3KYCB 3AKZA 3KZZA 1Z77A 3HHHA 3GZNB 2M7AA 1Z3YA 3TP3A 4YFKF 2XPWA 4M3BA 2E36A 3CC7I 3K1NA 1SFKA 2BBYA 3HZJA 2DJIA 2QKLB 2OTLI 3BQZA 2HFHA 5FFXA 2KLOA 2F2EA 4WCGA 3E6CC 1RZ4A 3MZYA 2DDAA 1SANA 4BU2A 4MGRA 1YJ9I 1JT0A 1Y1VJ 3BG7A 1OYIA 4XBFA 3VODA 4Q5SF 4IVNA 1LFUP 5GAHJ 1MMDA 1MKMA 2Y0MA 1AOYA 3WTYC 4A3BJ 2LP0A 2ELHA 3NQOA 1HDDC 1NTCA 4FT8A 1FOXA 2H27A 2HDDA 1B1BA 3OR2C 2E2IJ 2E34A 2OJED 1BM9A 1E3PA 1G6NA 5E8GA 3ULQB 1RUNA 4PDKA 2OZUA 1OYWA 3O2PE 1U5TA 2HQNA 2KISA 2HXIA 5L3BA 2BEOA 1LFBA 1FSEA 2L7KA 1FOKA 2H8RA 1P9QC 4P96A 1Y39A 4XLNF 2HOEA 2MC4A 2ME0A 3OWTA 1FWZA 5JLWA 3FKJA 2VBWA 1X2MA 2V9KA 1FZPB 3JSPA 3I64A 4Q4ZF 5BS6A 3CDLA 5D5XB 4EJVA 2EK5A 3Q9VA 1OQYA 4IOCF 1XGOA 3I5UA 2W84A 4L9TA 2WAQA 2EFPA 1EV7A 3IRQA 5LRRA 2BHYA 2GA1A 3ABLH 3QQAA 3HRUA 1HC8A 2XC7A 1XMKA 2KFDA 4EATA 3OS1A 1OCOH 3HSFA 4YFXF 2LF7A 1JUMA 1G3YA 1HLVA 4FISA 3COAC 1R7JA 1YJWI 1BIAA 1ETVA 2HZTA 4OINF 1O57A 3TKYA 3JW4A 4AVZA 1H9GA 3JRCA 1MBJA 3RQ4A 3OOPA 3ZQHA 4BS9A 4HSTA 2YU3A 1JUPA 4E7ZA 3NEUA 4A3CJ 2DA1A 2OPTA 4L9VA 1J5YA 2FBIA 3QRFF 1UHSA 1LKXA 3RIRA 1VI0A 2FD5A 3K2ZA 4LMYA 5F27A 3MKLA 2DFIA 2EFQA 4D7NA 3S2DJ 4C2TA 3IKTA 3A0BC 3FM3A 3GO5A 3CCYA 3IH2A 2DAOA 2IP2A 3WTZA 4V19K 2FE3A 4PFOA 4RB3C 5CVJA 4ETSA 3IAS2 4E4HA 3A01B 2X48A 4MTEA 3FXRA 2XRNA 2RNGA 3W6KB 3CMYA 5HLIA 2JA6J 3M9AA 4BDYA 3M7GA 4IHXA 5HOOA 4D5CA 1SVOA 1BI3A 3Q0WA 3CCVI 3G1MA 1QVTA 4M6VA 2IS6A 4PSXA 1MMNA 1ZTRA 2KZVA 3BP8A 4BL0B 2D5VA 5LGNA 3BG6A 3CZ6A 3AG4H 3VB2A 4CZCA 3IWFA 4E7LA 3ONQA 2DYRH 2VJJA 3LA3A 1TWHJ 2I5UA 1LDKB 3R4KA 4EJOA 1Y8RB 1ZK8A 3GBGA 4XICA 2X6WA 1A36A 3OSGA 2QQ8A 4I0AA 3F6OA 3J81K 3F23A 4FHTA 2NNNA 3TQNA 4LLGF 2EZLA 1YG2A 2VODA 3ZCOA 3CTAA 1Y1WJ 2M4GA 3A1YA 3RPQA 2R7SA 5HLGA 1TQPA 1K78A 1S9HA 2KRHA 2XKPA 2BV6A 2CGPA 4BKXA 2V9PA 1W5TA 3HSRA 3BR2A 5M3MJ 2HVQA 3VDXA 2JRMA 1BBYA 3FMSA 4V2FA 1MSEC 5JVTA 2ICWG 3LMMA 4BHBA 2CO5A 3K10A 2C6YA 2VLAA 1RI7A 2BY1A 3QPLA 3HL2A 3CO6C 2OA4A 4XOTA 3TBIA 4F92B 3PNVA 2AHQA 2RVCA 5C3EJ 1SMYF 1JGSA 5JFRA 2LYCA 1KQ0A 3E6BA 1T39A 4A3EJ 2XGCA 3U1DA 1ONVA 2MYSA 4ENJA 2DA5A 1YS7A 2LY2A 2DFFA 2DJNA 1IN7A 1FNNA 4A3FJ 1K6OA 4XONA 3ECOA 1FOYA 4BY7J 2D2WA 1WSUA 2F4OB 4RLFA 2E71A 5JHFA 3IWZA 2ZSIB 3WE2A 4ZJZA 1S7AA 1X1AA 3HPHA 4ZYHA 3HOSA 2KDOA 1B9NA 4HF0A 2VONA 2QQAA 2RGVA 2A05A 3KLNA 1YRNB 3ISPA 4I0BA 2A6HF 3K2AA 2MD0A 4IF4A 3FBIB 4J19A 2O9LA 2VUMJ 3CJQB 3BQYA 3KIOA 2GXBA 4PUSA 2X1DA 2DMTA 1XCVA 5F6FA 5IT9K 1X2NA 4AIHA 4GGGA 3QP6A 3BT9A 1XG1A 1K4TA 1KA8A 1SVLA 3WG9A 1P2FA 4IJAA 5E18F 1X1DA 2VOOA 5M5WJ 1Z21A 2LF8A 1DPRA 3BOQA 2WY8Q 5HNHA 2MH9A 1AWCA 2HTJA 1V5EA 4S04A 3OYMA 2Y0SA 5K1YA 3TO6A 2IA0A 1OYYA 3QWLA 3I59B 2EFWA 1YIOA 1VNDA 3PNYA 5DM7F 1U8RA 1LJ9A 4JBAA 4M6XA 4HF1A 1YFHA 2D1VA 1QHGA 2ZXHA 2EV6A 5BMZA 2NVXJ 3AG2H 4ZH4F 1PUFA 1GV5A 3ZMTA 3QPHA 4BEHB 1B4AA 2Y2ZA 4YELA 3F22A 1VQPI 2A6EF 2ZXJA 3OOUA 4MQ9F 5HNFA 1U0JA 3M07A 1J9IA 3MAJA 1LFPA 1X1PA 5HS9A 4ESJA 3BCBA 3LSIA 1SVMA 4GYGA 1IRZA 3PUBA 3RKYA 4G7ZF 4GRIA 2IJLA 4BACA 5KVRA 2GXAA 1HW5A 4OAZA 5ICCA 4NC7A 4U0YA 2A69F 1I6XA 2LRDA 3JRIA 4A3LJ 2GIZA 2L02A 3VYRB 3W2VA 5H6RA 3LSPA 2E35A 4RLQA 2M7BA 4XKVA 2N8GA 3F8NA 3KX2A 3MD2A 5J6XA 1R1VA 2F5EA 2KMUA 3KP3A 4LGWA 2IEKA 1QU3A 4M74A 4F52A 2ECCA 3SDGA 3UKGA 2V1UA 2COMA 1X1CA 5BNGA 3U9GA 2DT6A 2V6CA 5B66C 1UELB 4XRMA 4X6AJ 4Z6YA 4DYCA 3DEUA 2JA5J 2MGQA 3H1CA 3KP2A 5M5YJ 1HW2A 5D5VB 2EFNA 1W7PD 3J7AY 1XN7A 2E1MC 3O8GA 4CA0A 3CP2A 1E17A 1FOWA 4LOCA 4UB8C 4B47A 2DA7A 2DA2A 4AD9A 4BAYA 4WXDA 1B59A 4CHUA 2ELKA 2L9SA 4P1WA 3WGIA 2L54A 2WY7Q 3RSNA 1MNMC 3K69A 4IHWA 2F4MB 5E3LA 4BHCA 3PNTA 1T6SA 2MABA 4IHSA 5DV5A 2Q2EA 5EJCA 3OYDA 4MQVA 1W0TA 1N78A 3ZN1A 1MMGA 4N9HA 1JKOC 4CCJA 4G94A 3PFIA 2H6CA 2QYOA 3KFWX 2MLGA 3G1LA 1EKEA 2JZYA 1TNTA 2PEXA 2XF7A 4YIFA 3CDIA 4G6QA 4Y52J 2XV4S 1RETA 4IRGA 2K9SA 2IGKA 3U1KA 2BW3A 2CH0A 4Q47A 2P8TA 2CUZA 3RQIA 4FASD 2CV1A 3PO3J 1ZGWA 3CJNA 2DCEA 2RREA 2VC1A 2COBA 3ABTA 4PCQA 3F0CA 2ZJQF 2NOJB 4V2GA 1YIJI 1IV8A 5E1XA 4NC6A 2FQ4A 4RAYA 4Y17A 2LK2A 3VYUB 3Q0VA 1DU6A 4U7DA 1N25A 2CV0A 1N75A 1ULYA 2OC6A 3Q0UA 5EG0A 2KT0A 4M9ZA 4BBRJ 3E5UA 3NAUA 2ZKZA 3KEYA 2WWYA 1IG7A 1TTYA 1UG0A 5FKNA 1BW5A 1C0WA 1GLNA 1Z1DA 1PDNC 2P4WA 3DBHB 2DDBA 4UB6C 5FROA 4HA8A 2BY2A 1D5VA 1LE8B 2R5ZA 4IPAA 3CC4I 1WH7A 4RAZA 1NK3P 5J40A 4EM0B 2GLOA 1MJBA 5JI6A 4U0WA 3AG1H 3IL2A 2MD5A 3EPZA 5KHDA 4CH7A 3FXLA 3JRAA 2PQ8A 4HV6A 1F43A 3KEQA 4XSZF 1U8BA 3ABUA 1Q1HA 3C18A 2W1OA 3VFZA 1N77A 4HNTA 2LDUA 2CQXA 3OYJA 3HOVJ 4HBLA 5IOZA 2PMZA 2PX9A 5TRDA 3TL4X 1U2WA 1F5TA 5GP9A 1RR7A 3FMQA 3QPSA 2QBYB 2WBMA 1XB4A 1O7LA 3CCQI 4L9JA 4UVCA 4IHVA 5LHGA 2J5PA 3AL0C 4LK1F 4P5OA 2YS9A 2DYSH 1STZA 2VKDA 1YX3A 5KNLA 2R3SA 3C7JA 1W1WE
chains in the Genus database with same CATH topology
4EGYA 1PUEE 3F8CA 3GF2A 4KFCA 3AAFA 3WTVC 3R61A 3FXUA 5FLXZ 3J80K 2LNBA 3WE3A 1BI2A 2HKOA 2XGXA 1BOAA 4L9NA 2IRFG 4U0VA 4JK1X 1KYWA 2OBPA 2D45A 1PP8F 2FXAA 3GZ6A 3HSEA 3LQQA 1UB9A 4I98B 3GYHX 2VE9A 1TQIA 1BIBA 2FNPA 5LGUA 1XGMA 4ZYEA 2P6TA 1IXSB 4OIOF 1LDDA 2JRTA 4HLYA 2V1DA 2L3DA 2NRAC 1SFEA 4LG0A 3MZHA 3ELKA 5K5RA 5HDGA 2QZ8A 4ASNA 4EM2A 3FX3A 1HW1A 5EEHA 3NRVA 1Z6TA 3G3ZA 4EV0A 1DP7P 5ILVA 2IPQX 2P5KA 4KUMA 1JXSA 4M9SA 3DXJF 4U88A 2DPUA 2PN6A 3GEZA 3S2WA 2XASA 1LQ1A 4NHJA 2ZBKA 3E97A 4A0XA 3SFZA 2IT0A 2JPBA 4Y13A 4LLLA 1U6GA 3RYRA 3EDPA 2EV5A 4I7HA 4MEXF 1R58A 2RNJA 4KN4X 2Z33A 3VEPA 3W6JB 5FGMA 4HDUA 4KMFA 2OQRA 3FWEA 1CGPA 4MEYF 1K7AA 2JSCA 3ERED 1LB2A 1KQ8A 2XHKA 4CXFA 3GZ5A 1CF7B 1DUXC 1KGSA 1W7PA 2K02A 3HUGA 2GXGA 2W85A 3LSTA 3O6BB 1S6LA 5TJJA 2KIMA 1XSVA 1T98A 1J0RA 4ZZLA 3BJ6A 3DKWA 2XAFA 3KP4A 5DUKA 4CGZA 2STTA 4HX4A 4F7ZA 3IHUA 3BDDA 3LAPA 3ZQ7A 4KNYA 3G73A 3QU3A 2L4AA 2XIGA 2EV0A 5D6FA 3WGHA 1O3TA 5ILSA 3E5XA 2RQPA 1TQMA 3QP5A 1IN4A 2R7FA 2V9VA 3RI4A 1SD4A 5D6EA 1G4DA 4UHTA 3I54A 1S8NA 1S29A 3CUOA 5DEQA 5ICEA 2DW4A 1ZAOA 3V7RA 2M30A 3B73A 1BJAA 2YSRA 3DPTA 4CO8A 3RKXA 4NQWA 1EH6A 1OMIA 2HYFA 1R23A 5F64A 4A6EA 5D8LB 3SQNA 4AWXB 2A5YB 4UUVA 1IN5A 4QLCU 2HR3A 2ZNZA 5AIQA 4M9XA 2OZ6A 4IRHA 4EJWA 3TO7A 2MLKA 2F5FA 5LBQA 3T8TA 1MJAA 1QZYA 3BROA 2VT3A 1LDJA 2YR2A 2W57A 3RJPA 3PQKA 2YPRA 2CG4A 2NNYA 2MA3A 3E5QA 5FB2A 2G7UA 4BHPA 3MWMA 3L9FA 4LK0F 3OV8A 3DF8A 3HHGA 5HDKA 1KYZA 2ZO4A 1WKMA 3SZPA 2O03A 4LD5A 3P7NA 4HDVA 5IT3A 1FPQA 4HQEA 2PG4A 2DQLA 2OAZA 2FA5A 5J8FA 2HQRA 2W24A 2QM3A 2M8EA 2XAGA 2Y75A 2VBYA 4WWCA 2P5LC 4WF2A 4EMSA 5HS8A 2OU2A 5FO5A 5LHHA 3JTHA 2QENA 3CUQA 3LWFA 4EJUA 2VBZA 4H0EA 5CLSA 1YO5C 3E6MA 2A3SA 1I1GA 2DT5A 4XLPF 4K2EA 1FBUA 4L0ZB 3EYIA 4CDGA 5DYMA 1SMTA 1YW8A 3RTRA 3JAMZ 1KU2A 2RDPA 2EWNA 4B8XA 1VTNC 2G9WA 2UXXA 2WV0A 1QO0D 3H92A 3FXQA 1U5TB 4PZJA 1KU9A 1IN8A 2HKXA 1S3JA 2M87A 1K78B 5CJ9A 1OR7A 5D5WB 1RUOA 3GFJA 3IKVA 3C3WA 4B09A 1WQ2A 2KIFA 2X4HA 3ZMUA 2GWRA 3GVAA 1BC8C 2Y48A 2XUBA 5KK1A 2M5WA 1YQAA 2JPCA 1R5HA 5DD8A 5JR3A 1WI9A 2ACJA 1Y0UA 2H94A 2GQQA 5H6QA 5ICGA 2P7VB 2HTSA 2PLYA 4OMZA 1MDMA 1P4AA 2KKOA 3DV8A 1QQIA 4RGXA 5BOXA 2Q8KA 2M45A 2FF4A 2CYYA 1U78A 3MEXA 3VOEA 1I5ZA 2PFBA 1ZH5A 4HX7A 2BGCA 2PJPA 4ENKA 2FQ3A 4P9FA 1WRJA 1DDNA 1IF1A 3EUHA 3WTSC 3ML6A 3U2RA 1YW9A 4A0ZA 3C1DA 1UHWA 1ZYRF 3K1MA 3KEOA 1ZREA 2STWA 4GCVA 2DK5A 2LSOA 4I2OA 3V4GA 4JQFA 5F1RA 5E1WA 2DTRA 3JSOA 3DFGA 3P9CA 4XSXF 2DI3A 1Z9CA 2QBYA 2KRFA 3IRRA 2GIVA 2Z3YA 4UVBA 1IXCA 3WU1B 3WODF 3BZ6A 4TV7A 1QGPA 1BI0A 1ZLKA 4OIRF 2XAHA 1B6AA 5E20A 1ZARA 1TLHB 3I53A 1QNTA 3WTTC 2VE8A 4O6JA 3F21A 3T0YA 1R1TA 3R6SA 5CYVA 3K1PA 1SD7A 2DO7A 4HOBA 1W5SA 3I59A 4CICA 4GO1A 1P6RA 1WWXA 2ZCWA 2CWEA 2O6GE 3CUQC 1XCBA 1B9MA 4LB6B 3EETA 3SHFA 1ZLJA 1T2KA 1JHHA 3F6VA 3TDZC 2QWWA 3SZTA 2KJCA 2VOPA 4ENMA 2ESHA 1ZRCA 3WTUC 3T1BA 4KMUX 2FMYA 2R7DA 2HGCA 4KICA 4BQAA 2IA1A 1XGNA 2DBBA 2XKOA 3RDIA 3CO7C 1YTYA 3HRSA 1MJ9A 1HQCA 4PGHA 5L3DA 1HXDA 1RNLA 1IW7F 3ZMDA 4KIBA 3LA7A 2A68F 4LFUA 5D8KB 2DQRA 2CSOA 1ZGJA 3V8LA 1F4KA 3ZMVA 4BH9A 2HDCA 4G8XA 1UHMA 3IC7A 3MFKA 1O7FA 1KU3A 3N97A 1O3RA 1MZBA 5BPIA 1W4MA 3FMRA 1FBSA 2FMLA 4OIQF 4U7BA 2PI0A 2O61A 4RGSA 4PGGA 4OU0A 1TW2A 3WU0A 3JAMK 2V79A 3I58A 2KJBA 5LEJA 5L3EA 4IRIA 1MGTA 4EJTA 3HIFA 1QPMA 2RC4A 5DDGA 1PP7U 2QLZA 4L5JA 1TW3A 2NS0A 4AVPA 5JHUA 1FP2A 4HW0A 1DPUA 2QUFA 3L2CA 2O0YA 4NB5A 1H9TA 3ZN0A 1I27A 2HWVA 5LLQA 5ILUA 3KE2A 3H3ZA 1HKTA 4QWQA 1HSJA 4A0YA 2Z5UA 3MCZA 2D1HA 1T38A 1P4WA 4ON0A 2K4JA 2DPDA 5HS7A 1GVJA 1ZGAA 1ZG5A 3FF5A 2HYGD 4KYWA 1CF7A 3BPXA 3V7CA 2OD5A 5DCMA 2V1XA 3TOAA 6PAXA 3BY6A 2K86A 3BPVA 1JE8A 2W25A 3TDUC 5AONA 2B0LA 2P5VA 4Z2YA 3I0TA 4WXCA 1GXQA 2Z99A 1LNWA 2ISZA 3M8FA 3K9TA 3F8BA 3KP5A 1ZRDA 1FSHA 3J80Z 2MC3A 4N0BA 2KIUA 3Q5FA 3DPLC 4HLXA 2PMHA 4IXAA 1ON2A 2H09A 4A5MA 1H0MA 5FD6A 1D3YA 4Q48A 4ZYGA 5LGTA 1J2XA 3QOPA 1MDMB 3ROUA 4R79A 1D8KA 4A12A 4WXHA 5EEGA 4MHGA 4RS8A 3V8KA 3LA2A 3F8MA 2FU4A 4G7HF 3HRMA 1FYKA 5D4SA 2HEOA 1LEAA 1XDSA 5FD5A 2DU9A 2VC0A 1F1ZA 1R5GA 3CDHA 2ISYA 3GUDA 2CW0F 2IVMA 2Q0OA 1USTA 3H3UA 4HX8A 3D0SA 4N9IA 2G7HA 2LKPA 4G7OF 1ZN2A 1XMAA 4CZZA 1FYLA 3KETA 1Z91A 1QBJA 2P6SA 2A61A 3WTWC 1ZG3A 3WGGA 2PMUA 3KP6A 1E2XA 1RIOH 2FRHA 5L3GA 1SAXA 3DQVC 3GFLA 2IA2A 4KDPA 2HS5A 2ADUA 3WTXC 3O3KA 3LAJA 1LEBA 5D4RA 2FEZA 3KZYA 3F3XA 1Z7UA 1SFUA 2VXZA 4HF2A 2VT2A 1G3WA 3LQRA 2XAJA 3N4MA 5IT9Z 3KLOA 3B02A 2ZMEB 2RKHA 4EM1A 2NYXA 2ZFWA 3M1EA 3P9IA 5BPDA 1FY7A 1ZRFA 3ZMZA 3SXYA 2FOKA 4R8HA 5LEKA 2VBXA 4I01A 4KIGA 5HDNA 1XSXA 1UCRA 3BJAA 4I09A 1I1SA 4RGRA 3HYIA 4M72A 2O8XA 3RYPA 2DLLA 2QQ9A 4G9YA 3HRTA 1ON1A 4UVAA 3V8JA 4OOIA 3ECHA 1K79A 1J75A 1T0FA 3D5LA 5K5QA 1R36A 2FBHA 3GFIA 4RB1A 2CFXA 4YG2F 5LRSA 4A2UA 2CQKA 1L0OC 5BQTA 5L3FA 2QVOA 3V7SA 4AIKA 5DCMB 3L00A 4XRFA 5AIPA 2EJRA 3BJOA 3HTSB 3EQLF 2YX4A 4D0PA 2F5CA 4EVIA 5E1ZB 1FX7A 2X0LA 4P55A 2GAUA 2QQBA 2ZJ2A 5ED4A 1F9NA 4UV9A 1S7OA 4KN7X 5ICFA 2UZKA 2FBKA 2A07F 5CVIA 2RV8A 5FLXK 3I71A 4GYIA 1TNSA 3PQJA 3QU6A 2AXLA 2M1BA 1IRFA 1P92A 5A2QZ 1YLFA 2F5DA 2OQGA 2TDXA 1L3LA 5L3CA 1X3UA 1BN5A 2E7WA 4ENNA 1J59A 1NHAA 4AIJA 2UXNA 3GFMA 4S05A 3J7AO 3FM5A 5K5OA 4MTDA 5J8CA 3DP7A 4HYEA 1REPC 3K0LA 4M73A 3REOA 1Z6RA 3ZP5A 1V3FA 2Z9OA 2BE5F 1FLIA 3HTUA 1JHFA 3ZMSA 3R0JA 1XDUA 1EH7A 1OKRA 1SD6A 2IW5A 4EQQA 4M71A 1R00A 1HBXG 1R22A 5DCFA 2H6BA 3FHZA 4G6DA 1XGSA 2E1CA 2O3FA 2GA2A 3T5XA 2E1NA 1IN6A 1FP1D 1XD7A 3R0AA 4OMYA 4EGZA 1BC7C 2FSWA 4GXOA 3GX4X 3F72A 1IUYA 2VN2A 5FFZA 2AS5F 1U5TC 2XVCA 3L09A 3LFKA 2K27A 3E3VA 5H20A 3GWZA 1FYMA 4MNUA 2L01A 2ZMEA 1SFXA 4RB0A 4FX4A 2ZNYA 1KQ9A 3F8FA 1V4RA 5CVVA 1O3SA 4KA4A 2WC2A 4R1HA 3GLXA 1D8JA 3CUQB 5CVRA 4YIIA 4L5IA 3EYYA 4WX9A 4A6DA 3JTGA 1IRGA 5D5UB 1MD0A 2RN7A 2P7CB 4RB2C 4A5NA 1ZG1A 4Y15A 2E7XA 3CLOA 3KCCA 3MQ0A 4I02A 5CVUA 4M6YA 4DQ2A 3QAHA 4O5VA 5E17F 3M8EA 4LB5A 4LLNA 5HLHA 1OPCA 2DK8A 1R1UA 2J5OA 1W7PB 1ZHFA 4CYDA 2ETHA 3QPTA 2EFOA 2K4BA 4ESFA 4BNCA 4UNOA 1EH8A 2NAZA 4LJZF 3T8RA 4WK8F 4E70A 3J81Z 4UV8A 4OIPF 4IHTA 1IXRC 4HZFA 4ESBA 4ZZDA 4FX0A 3Q9SA 2EA4A 4UXNA 4KIFA 3TGNA 2XROA 4RGUA 4HQMA 2YX7A 2UWMA 4HAMA 1HKSA 4O3MA 3BWGA 4LG0B 1G3SA 1J7KA 1USSA 1HSTA 1Z05A 1G3TA 4L0YB 1IAWA 1P4XA 2EB7A 1ODDA 1KU7A 1FC3A 1FBQA 1GHCA 3P9KA 1XSDA 2EA2A 1LVAA 5A2QK 5DD4A 3RKWA 2L4MA 2K7LA 5DUIA 1HKQA 1SD5A 2FNAA 2ESNA 1U3EM 4ZYDA 2WTEA 5LHIA 1YS6A 2MBFA 1O3QA 5ERIA 3KP7A 3GW2A 1QZZA 3R60A 1IZ1A 2MH2A 2XAQA 1A04A 4KT5C 1BI1A 3I4PA 4HV5A 4BYYA 2BYVE 4YFNF 4P9UA 2JT1A 3HOTA 3ZPLA 1TBXA 4BXUA 3TO9A 5HVQC 4L18B 3RPUA 2GZWA 2PBIA 3FZVA 1YYVA 1GXPA 3E6DA 1UFMA 1FT9A 3TOBA 3GXOA 2JTVA 4DNCA 3L7WA 1YW7A 5E8IA 3KZZA 3HHHA 4YFKF 3K1NA 2BBYA 2HFHA 5FFXA 2F2EA 4WCGA 3E6CC 1RZ4A 3MZYA 4MGRA 4XBFA 1OYIA 3VODA 4Q5SF 4IVNA 1MKMA 2Y0MA 1AOYA 3WTYC 3NQOA 2ELHA 4FT8A 2H27A 1B1BA 5E8GA 1BM9A 1G6NA 3ULQB 1RUNA 4PDKA 2OZUA 1OYWA 3O2PE 1U5TA 2HQNA 5L3BA 2BEOA 1FSEA 1FOKA 4P96A 4XLNF 2HOEA 1FWZA 2VBWA 1FZPB 3JSPA 3I64A 4Q4ZF 5BS6A 5D5XB 4EJVA 2EK5A 3Q9VA 1XGOA 3I5UA 2W84A 4L9TA 2EFPA 1EV7A 3IRQA 5LRRA 2GA1A 3HRUA 1XMKA 3HSFA 4YFXF 2LF7A 1G3YA 3COAC 1R7JA 1BIAA 2HZTA 4OINF 1O57A 3TKYA 3JW4A 1H9GA 3OOPA 2YU3A 3NEUA 4L9VA 1J5YA 2FBIA 3QRFF 3RIRA 3K2ZA 4LMYA 2DFIA 2EFQA 3IKTA 3FM3A 3GO5A 2DAOA 2IP2A 3WTZA 2FE3A 4RB3C 5CVJA 4ETSA 4MTEA 3FXRA 2XRNA 3W6KB 5HLIA 3M9AA 3M7GA 5HOOA 1BI3A 3BP8A 5LGNA 3VB2A 3IWFA 3LA3A 1LDKB 3R4KA 4EJOA 4I0AA 3F6OA 3J81K 3F23A 4FHTA 2NNNA 3TQNA 4LLGF 1YG2A 2VODA 3CTAA 3RPQA 5HLGA 1TQPA 1K78A 2XKPA 2BV6A 2CGPA 1W5TA 3HSRA 1BBYA 3FMSA 5JVTA 4BHBA 2CO5A 2C6YA 1RI7A 3CO6C 2OA4A 2RVCA 1SMYF 1JGSA 5JFRA 1KQ0A 3E6BA 1T39A 3U1DA 1ONVA 4ENJA 1YS7A 1K6OA 1IN7A 1FNNA 3ECOA 2D2WA 1WSUA 3IWZA 3WE2A 1S7AA 4ZYHA 3HOSA 1B9NA 4HF0A 2VONA 2QQAA 2RGVA 3KLNA 3ISPA 4I0BA 2A6HF 4IF4A 2GXBA 1XCVA 5F6FA 5IT9K 4AIHA 4GGGA 3QP6A 1KA8A 3WG9A 1P2FA 4IJAA 5E18F 2VOOA 2LF8A 1DPRA 3BOQA 2MH9A 1AWCA 2HTJA 4S04A 5K1YA 3TO6A 2IA0A 1OYYA 3I59B 2EFWA 1YIOA 1U8RA 1LJ9A 4JBAA 4M6XA 4HF1A 1YFHA 2D1VA 2EV6A 5BMZA 4ZH4F 3ZMTA 3QPHA 1B4AA 3F22A 2A6EF 2ZXJA 4MQ9F 1J9IA 3MAJA 5HS9A 4ESJA 4GYGA 3RKYA 4G7ZF 2IJLA 5KVRA 1HW5A 5ICCA 4U0YA 2A69F 1I6XA 2L02A 5H6RA 3F8NA 5J6XA 1R1VA 2F5EA 3KP3A 4LGWA 4M74A 2V1UA 2COMA 3U9GA 2V6CA 3DEUA 3KP2A 1HW2A 5D5VB 2EFNA 1W7PD 1XN7A 1E17A 4AD9A 4BAYA 4WXDA 1B59A 4CHUA 3WGIA 2L54A 3K69A 4BHCA 1T6SA 4IHSA 5DV5A 2Q2EA 4MQVA 3ZN1A 4N9HA 4G94A 3PFIA 2H6CA 2QYOA 3KFWX 2MLGA 2JZYA 1TNTA 2PEXA 4YIFA 4G6QA 2XV4S 4IRGA 4Q47A 2P8TA 3CJNA 2VC1A 3ABTA 4PCQA 5E1XA 4RAYA 4Y17A 4U7DA 1ULYA 4M9ZA 3E5UA 2ZKZA 2WWYA 1TTYA 1C0WA 1Z1DA 1PDNC 2P4WA 4HA8A 1D5VA 4IPAA 4RAZA 4EM0B 1MJBA 5JI6A 4U0WA 3IL2A 2MD5A 2PQ8A 4HV6A 3KEQA 4XSZF 3ABUA 1Q1HA 3C18A 3VFZA 2LDUA 4HBLA 5TRDA 1U2WA 1F5TA 3FMQA 2QBYB 1XB4A 1O7LA 4L9JA 4UVCA 5LHGA 2J5PA 4LK1F 4P5OA 1STZA 2R3SA 3C7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EGY A;  1PUE E;  3F8C A;  3GF2 A;  4KFC A;  3AAF A;  3WTV C;  3R61 A;  3FXU A;  5FLX Z;  3J80 K;  2LNB A;  3WE3 A;  1BI2 A;  2HKO A;  2XGX A;  1BOA A;  4L9N A;  2IRF G;  4U0V A;  4JK1 X;  1KYW A;  2OBP A;  2D45 A;  1PP8 F;  2FXA A;  3GZ6 A;  3HSE A;  3LQQ A;  1UB9 A;  4I98 B;  3GYH X;  2VE9 A;  1TQI A;  1BIB A;  2FNP A;  5LGU A;  1XGM A;  4ZYE A;  2P6T A;  1IXS B;  4OIO F;  1LDD A;  2JRT A;  4HLY A;  2V1D A;  2L3D A;  2NRA C;  1SFE A;  4LG0 A;  3MZH A;  3ELK A;  5K5R A;  5HDG A;  2QZ8 A;  4ASN A;  4EM2 A;  3FX3 A;  1HW1 A;  5EEH A;  3NRV A;  1Z6T A;  3G3Z A;  4EV0 A;  1DP7 P;  5ILV A;  2IPQ X;  2P5K A;  4KUM A;  1JXS A;  4M9S A;  3DXJ F;  4U88 A;  2DPU A;  2PN6 A;  3GEZ A;  3S2W A;  2XAS A;  1LQ1 A;  4NHJ A;  2ZBK A;  3E97 A;  4A0X A;  3SFZ A;  2IT0 A;  2JPB A;  4Y13 A;  4LLL A;  1U6G A;  3RYR A;  3EDP A;  2EV5 A;  4I7H A;  4MEX F;  1R58 A;  2RNJ A;  4KN4 X;  2Z33 A;  3VEP A;  3W6J B;  5FGM A;  4HDU A;  4KMF A;  2OQR A;  3FWE A;  1CGP A;  4MEY F;  1K7A A;  2JSC A;  3ERE D;  1LB2 A;  1KQ8 A;  2XHK A;  4CXF A;  3GZ5 A;  1CF7 B;  1DUX C;  1KGS A;  1W7P A;  2K02 A;  3HUG A;  2GXG A;  2W85 A;  3LST A;  3O6B B;  1S6L A;  5TJJ A;  2KIM A;  1XSV A;  1T98 A;  1J0R A;  4ZZL A;  3BJ6 A;  3DKW A;  2XAF A;  3KP4 A;  5DUK A;  4CGZ A;  2STT A;  4HX4 A;  4F7Z A;  3IHU A;  3BDD A;  3LAP A;  3ZQ7 A;  4KNY A;  3G73 A;  3QU3 A;  2L4A A;  2XIG A;  2EV0 A;  5D6F A;  3WGH A;  1O3T A;  5ILS A;  3E5X A;  2RQP A;  1TQM A;  3QP5 A;  1IN4 A;  2R7F A;  2V9V A;  3RI4 A;  1SD4 A;  5D6E A;  1G4D A;  4UHT A;  3I54 A;  1S8N A;  1S29 A;  3CUO A;  5DEQ A;  5ICE A;  2DW4 A;  1ZAO A;  3V7R A;  2M30 A;  3B73 A;  1BJA A;  2YSR A;  3DPT A;  4CO8 A;  3RKX A;  4NQW A;  1EH6 A;  1OMI A;  2HYF A;  1R23 A;  5F64 A;  4A6E A;  5D8L B;  3SQN A;  4AWX B;  2A5Y B;  4UUV A;  1IN5 A;  4QLC U;  2HR3 A;  2ZNZ A;  5AIQ A;  4M9X A;  2OZ6 A;  4IRH A;  4EJW A;  3TO7 A;  2MLK A;  2F5F A;  5LBQ A;  3T8T A;  1MJA A;  1QZY A;  3BRO A;  2VT3 A;  1LDJ A;  2YR2 A;  2W57 A;  3RJP A;  3PQK A;  2YPR A;  2CG4 A;  2NNY A;  2MA3 A;  3E5Q A;  5FB2 A;  2G7U A;  4BHP A;  3MWM A;  3L9F A;  4LK0 F;  3OV8 A;  3DF8 A;  3HHG A;  5HDK A;  1KYZ A;  2ZO4 A;  1WKM A;  3SZP A;  2O03 A;  4LD5 A;  3P7N A;  4HDV A;  5IT3 A;  1FPQ A;  4HQE A;  2PG4 A;  2DQL A;  2OAZ A;  2FA5 A;  5J8F A;  2HQR A;  2W24 A;  2QM3 A;  2M8E A;  2XAG A;  2Y75 A;  2VBY A;  4WWC A;  2P5L C;  4WF2 A;  4EMS A;  5HS8 A;  2OU2 A;  5FO5 A;  5LHH A;  3JTH A;  2QEN A;  3CUQ A;  3LWF A;  4EJU A;  2VBZ A;  4H0E A;  5CLS A;  1YO5 C;  3E6M A;  2A3S A;  1I1G A;  2DT5 A;  4XLP F;  4K2E A;  1FBU A;  4L0Z B;  3EYI A;  4CDG A;  5DYM A;  1SMT A;  1YW8 A;  3RTR A;  3JAM Z;  1KU2 A;  2RDP A;  2EWN A;  4B8X A;  1VTN C;  2G9W A;  2UXX A;  2WV0 A;  1QO0 D;  3H92 A;  3FXQ A;  1U5T B;  4PZJ A;  1KU9 A;  1IN8 A;  2HKX A;  1S3J A;  2M87 A;  1K78 B;  5CJ9 A;  1OR7 A;  5D5W B;  1RUO A;  3GFJ A;  3IKV A;  3C3W A;  4B09 A;  1WQ2 A;  2KIF A;  2X4H A;  3ZMU A;  2GWR A;  3GVA A;  1BC8 C;  2Y48 A;  2XUB A;  5KK1 A;  2M5W A;  1YQA A;  2JPC A;  1R5H A;  5DD8 A;  5JR3 A;  1WI9 A;  2ACJ A;  1Y0U A;  2H94 A;  2GQQ A;  5H6Q A;  5ICG A;  2P7V B;  2HTS A;  2PLY A;  4OMZ A;  1MDM A;  1P4A A;  2KKO A;  3DV8 A;  1QQI A;  4RGX A;  5BOX A;  2Q8K A;  2M45 A;  2FF4 A;  2CYY A;  1U78 A;  3MEX A;  3VOE A;  1I5Z A;  2PFB A;  1ZH5 A;  4HX7 A;  2BGC A;  2PJP A;  4ENK A;  2FQ3 A;  4P9F A;  1WRJ A;  1DDN A;  1IF1 A;  3EUH A;  3WTS C;  3ML6 A;  3U2R A;  1YW9 A;  4A0Z A;  3C1D A;  1UHW A;  1ZYR F;  3K1M A;  3KEO A;  1ZRE A;  2STW A;  4GCV A;  2DK5 A;  2LSO A;  4I2O A;  3V4G A;  4JQF A;  5F1R A;  5E1W A;  2DTR A;  3JSO A;  3DFG A;  3P9C A;  4XSX F;  2DI3 A;  1Z9C A;  2QBY A;  2KRF A;  3IRR A;  2GIV A;  2Z3Y A;  4UVB A;  1IXC A;  3WU1 B;  3WOD F;  3BZ6 A;  4TV7 A;  1QGP A;  1BI0 A;  1ZLK A;  4OIR F;  2XAH A;  1B6A A;  5E20 A;  1ZAR A;  1TLH B;  3I53 A;  1QNT A;  3WTT C;  2VE8 A;  4O6J A;  3F21 A;  3T0Y A;  1R1T A;  3R6S A;  5CYV A;  3K1P A;  1SD7 A;  2DO7 A;  4HOB A;  1W5S A;  3I59 A;  4CIC A;  4GO1 A;  1P6R A;  1WWX A;  2ZCW A;  2CWE A;  2O6G E;  3CUQ C;  1XCB A;  1B9M A;  4LB6 B;  3EET A;  3SHF A;  1ZLJ A;  1T2K A;  1JHH A;  3F6V A;  3TDZ C;  2QWW A;  3SZT A;  2KJC A;  2VOP A;  4ENM A;  2ESH A;  1ZRC A;  3WTU C;  3T1B A;  4KMU X;  2FMY A;  2R7D A;  2HGC A;  4KIC A;  4BQA A;  2IA1 A;  1XGN A;  2DBB A;  2XKO A;  3RDI A;  3CO7 C;  1YTY A;  3HRS A;  1MJ9 A;  1HQC A;  4PGH A;  5L3D A;  1HXD A;  1RNL A;  1IW7 F;  3ZMD A;  4KIB A;  3LA7 A;  2A68 F;  4LFU A;  5D8K B;  2DQR A;  2CSO A;  1ZGJ A;  3V8L A;  1F4K A;  3ZMV A;  4BH9 A;  2HDC A;  4G8X A;  1UHM A;  3IC7 A;  3MFK A;  1O7F A;  1KU3 A;  3N97 A;  1O3R A;  1MZB A;  5BPI A;  1W4M A;  3FMR A;  1FBS A;  2FML A;  4OIQ F;  4U7B A;  2PI0 A;  2O61 A;  4RGS A;  4PGG A;  4OU0 A;  1TW2 A;  3WU0 A;  3JAM K;  2V79 A;  3I58 A;  2KJB A;  5LEJ A;  5L3E A;  4IRI A;  1MGT A;  4EJT A;  3HIF A;  1QPM A;  2RC4 A;  5DDG A;  1PP7 U;  2QLZ A;  4L5J A;  1TW3 A;  2NS0 A;  4AVP A;  5JHU A;  1FP2 A;  4HW0 A;  1DPU A;  2QUF A;  3L2C A;  2O0Y A;  4NB5 A;  1H9T A;  3ZN0 A;  1I27 A;  2HWV A;  5LLQ A;  5ILU A;  3KE2 A;  3H3Z A;  1HKT A;  4QWQ A;  1HSJ A;  4A0Y A;  2Z5U A;  3MCZ A;  2D1H A;  1T38 A;  1P4W A;  4ON0 A;  2K4J A;  2DPD A;  5HS7 A;  1GVJ A;  1ZGA A;  1ZG5 A;  3FF5 A;  2HYG D;  4KYW A;  1CF7 A;  3BPX A;  3V7C A;  2OD5 A;  5DCM A;  2V1X A;  3TOA A;  6PAX A;  3BY6 A;  2K86 A;  3BPV A;  1JE8 A;  2W25 A;  3TDU C;  5AON A;  2B0L A;  2P5V A;  4Z2Y A;  3I0T A;  4WXC A;  1GXQ A;  2Z99 A;  1LNW A;  2ISZ A;  3M8F A;  3K9T A;  3F8B A;  3KP5 A;  1ZRD A;  1FSH A;  3J80 Z;  2MC3 A;  4N0B A;  2KIU A;  3Q5F A;  3DPL C;  4HLX A;  2PMH A;  4IXA A;  1ON2 A;  2H09 A;  4A5M A;  1H0M A;  5FD6 A;  1D3Y A;  4Q48 A;  4ZYG A;  5LGT A;  1J2X A;  3QOP A;  1MDM B;  3ROU A;  4R79 A;  1D8K A;  4A12 A;  4WXH A;  5EEG A;  4MHG A;  4RS8 A;  3V8K A;  3LA2 A;  3F8M A;  2FU4 A;  4G7H F;  3HRM A;  1FYK A;  5D4S A;  2HEO A;  1LEA A;  1XDS A;  5FD5 A;  2DU9 A;  2VC0 A;  1F1Z A;  1R5G A;  3CDH A;  2ISY A;  3GUD A;  2CW0 F;  2IVM A;  2Q0O A;  1UST A;  3H3U A;  4HX8 A;  3D0S A;  4N9I A;  2G7H A;  2LKP A;  4G7O F;  1ZN2 A;  1XMA A;  4CZZ A;  1FYL A;  3KET A;  1Z91 A;  1QBJ A;  2P6S A;  2A61 A;  3WTW C;  1ZG3 A;  3WGG A;  2PMU A;  3KP6 A;  1E2X A;  1RIO H;  2FRH A;  5L3G A;  1SAX A;  3DQV C;  3GFL A;  2IA2 A;  4KDP A;  2HS5 A;  2ADU A;  3WTX C;  3O3K A;  3LAJ A;  1LEB A;  5D4R A;  2FEZ A;  3KZY A;  3F3X A;  1Z7U A;  1SFU A;  2VXZ A;  4HF2 A;  2VT2 A;  1G3W A;  3LQR A;  2XAJ A;  3N4M A;  5IT9 Z;  3KLO A;  3B02 A;  2ZME B;  2RKH A;  4EM1 A;  2NYX A;  2ZFW A;  3M1E A;  3P9I A;  5BPD A;  1FY7 A;  1ZRF A;  3ZMZ A;  3SXY A;  2FOK A;  4R8H A;  5LEK A;  2VBX A;  4I01 A;  4KIG A;  5HDN A;  1XSX A;  1UCR A;  3BJA A;  4I09 A;  1I1S A;  4RGR A;  3HYI A;  4M72 A;  2O8X A;  3RYP A;  2DLL A;  2QQ9 A;  4G9Y A;  3HRT A;  1ON1 A;  4UVA A;  3V8J A;  4OOI A;  3ECH A;  1K79 A;  1J75 A;  1T0F A;  3D5L A;  5K5Q A;  1R36 A;  2FBH A;  3GFI A;  4RB1 A;  2CFX A;  4YG2 F;  5LRS A;  4A2U A;  2CQK A;  1L0O C;  5BQT A;  5L3F A;  2QVO A;  3V7S A;  4AIK A;  5DCM B;  3L00 A;  4XRF A;  5AIP A;  2EJR A;  3BJO A;  3HTS B;  3EQL F;  2YX4 A;  4D0P A;  2F5C A;  4EVI A;  5E1Z B;  1FX7 A;  2X0L A;  4P55 A;  2GAU A;  2QQB A;  2ZJ2 A;  5ED4 A;  1F9N A;  4UV9 A;  1S7O A;  4KN7 X;  5ICF A;  2UZK A;  2FBK A;  2A07 F;  5CVI A;  2RV8 A;  5FLX K;  3I71 A;  4GYI A;  1TNS A;  3PQJ A;  3QU6 A;  2AXL A;  2M1B A;  1IRF A;  1P92 A;  5A2Q Z;  1YLF A;  2F5D A;  2OQG A;  2TDX A;  1L3L A;  5L3C A;  1X3U A;  1BN5 A;  2E7W A;  4ENN A;  1J59 A;  1NHA A;  4AIJ A;  2UXN A;  3GFM A;  4S05 A;  3J7A O;  3FM5 A;  5K5O A;  4MTD A;  5J8C A;  3DP7 A;  4HYE A;  1REP C;  3K0L A;  4M73 A;  3REO A;  1Z6R A;  3ZP5 A;  1V3F A;  2Z9O A;  2BE5 F;  1FLI A;  3HTU A;  1JHF A;  3ZMS A;  3R0J A;  1XDU A;  1EH7 A;  1OKR A;  1SD6 A;  2IW5 A;  4EQQ A;  4M71 A;  1R00 A;  1HBX G;  1R22 A;  5DCF A;  2H6B A;  3FHZ A;  4G6D A;  1XGS A;  2E1C A;  2O3F A;  2GA2 A;  3T5X A;  2E1N A;  1IN6 A;  1FP1 D;  1XD7 A;  3R0A A;  4OMY A;  4EGZ A;  1BC7 C;  2FSW A;  4GXO A;  3GX4 X;  3F72 A;  1IUY A;  2VN2 A;  5FFZ A;  2AS5 F;  1U5T C;  2XVC A;  3L09 A;  3LFK A;  2K27 A;  3E3V A;  5H20 A;  3GWZ A;  1FYM A;  4MNU A;  2L01 A;  2ZME A;  1SFX A;  4RB0 A;  4FX4 A;  2ZNY A;  1KQ9 A;  3F8F A;  1V4R A;  5CVV A;  1O3S A;  4KA4 A;  2WC2 A;  4R1H A;  3GLX A;  1D8J A;  3CUQ B;  5CVR A;  4YII A;  4L5I A;  3EYY A;  4WX9 A;  4A6D A;  3JTG A;  1IRG A;  5D5U B;  1MD0 A;  2RN7 A;  2P7C B;  4RB2 C;  4A5N A;  1ZG1 A;  4Y15 A;  2E7X A;  3CLO A;  3KCC A;  3MQ0 A;  4I02 A;  5CVU A;  4M6Y A;  4DQ2 A;  3QAH A;  4O5V A;  5E17 F;  3M8E A;  4LB5 A;  4LLN A;  5HLH A;  1OPC A;  2DK8 A;  1R1U A;  2J5O A;  1W7P B;  1ZHF A;  4CYD A;  2ETH A;  3QPT A;  2EFO A;  2K4B A;  4ESF A;  4BNC A;  4UNO A;  1EH8 A;  2NAZ A;  4LJZ F;  3T8R A;  4WK8 F;  4E70 A;  3J81 Z;  4UV8 A;  4OIP F;  4IHT A;  1IXR C;  4HZF A;  4ESB A;  4ZZD A;  4FX0 A;  3Q9S A;  2EA4 A;  4UXN A;  4KIF A;  3TGN A;  2XRO A;  4RGU A;  4HQM A;  2YX7 A;  2UWM A;  4HAM A;  1HKS A;  4O3M A;  3BWG A;  4LG0 B;  1G3S A;  1J7K A;  1USS A;  1HST A;  1Z05 A;  1G3T A;  4L0Y B;  1IAW A;  1P4X A;  2EB7 A;  1ODD A;  1KU7 A;  1FC3 A;  1FBQ A;  1GHC A;  3P9K A;  1XSD A;  2EA2 A;  1LVA A;  5A2Q K;  5DD4 A;  3RKW A;  2L4M A;  2K7L A;  5DUI A;  1HKQ A;  1SD5 A;  2FNA A;  2ESN A;  1U3E M;  4ZYD A;  2WTE A;  5LHI A;  1YS6 A;  2MBF A;  1O3Q A;  5ERI A;  3KP7 A;  3GW2 A;  1QZZ A;  3R60 A;  1IZ1 A;  2MH2 A;  2XAQ A;  1A04 A;  4KT5 C;  1BI1 A;  3I4P A;  4HV5 A;  4BYY A;  2BYV E;  4YFN F;  4P9U A;  2JT1 A;  3HOT A;  3ZPL A;  1TBX A;  4BXU A;  3TO9 A;  5HVQ C;  4L18 B;  3RPU A;  2GZW A;  2PBI A;  3FZV A;  1YYV A;  1GXP A;  3E6D A;  1UFM A;  1FT9 A;  3TOB A;  3GXO A;  2JTV A;  4DNC A;  3L7W A;  1YW7 A;  5E8I A;  3KZZ A;  3HHH A;  4YFK F;  3K1N A;  2BBY A;  2HFH A;  5FFX A;  2F2E A;  4WCG A;  3E6C C;  1RZ4 A;  3MZY A;  4MGR A;  4XBF A;  1OYI A;  3VOD A;  4Q5S F;  4IVN A;  1MKM A;  2Y0M A;  1AOY A;  3WTY C;  3NQO A;  2ELH A;  4FT8 A;  2H27 A;  1B1B A;  5E8G A;  1BM9 A;  1G6N A;  3ULQ B;  1RUN A;  4PDK A;  2OZU A;  1OYW A;  3O2P E;  1U5T A;  2HQN A;  5L3B A;  2BEO A;  1FSE A;  1FOK A;  4P96 A;  4XLN F;  2HOE A;  1FWZ A;  2VBW A;  1FZP B;  3JSP A;  3I64 A;  4Q4Z F;  5BS6 A;  5D5X B;  4EJV A;  2EK5 A;  3Q9V A;  1XGO A;  3I5U A;  2W84 A;  4L9T A;  2EFP A;  1EV7 A;  3IRQ A;  5LRR A;  2GA1 A;  3HRU A;  1XMK A;  3HSF A;  4YFX F;  2LF7 A;  1G3Y A;  3COA C;  1R7J A;  1BIA A;  2HZT A;  4OIN F;  1O57 A;  3TKY A;  3JW4 A;  1H9G A;  3OOP A;  2YU3 A;  3NEU A;  4L9V A;  1J5Y A;  2FBI A;  3QRF F;  3RIR A;  3K2Z A;  4LMY A;  2DFI A;  2EFQ A;  3IKT A;  3FM3 A;  3GO5 A;  2DAO A;  2IP2 A;  3WTZ A;  2FE3 A;  4RB3 C;  5CVJ A;  4ETS A;  4MTE A;  3FXR A;  2XRN A;  3W6K B;  5HLI A;  3M9A A;  3M7G A;  5HOO A;  1BI3 A;  3BP8 A;  5LGN A;  3VB2 A;  3IWF A;  3LA3 A;  1LDK B;  3R4K A;  4EJO A;  4I0A A;  3F6O A;  3J81 K;  3F23 A;  4FHT A;  2NNN A;  3TQN A;  4LLG F;  1YG2 A;  2VOD A;  3CTA A;  3RPQ A;  5HLG A;  1TQP A;  1K78 A;  2XKP A;  2BV6 A;  2CGP A;  1W5T A;  3HSR A;  1BBY A;  3FMS A;  5JVT A;  4BHB A;  2CO5 A;  2C6Y A;  1RI7 A;  3CO6 C;  2OA4 A;  2RVC A;  1SMY F;  1JGS A;  5JFR A;  1KQ0 A;  3E6B A;  1T39 A;  3U1D A;  1ONV A;  4ENJ A;  1YS7 A;  1K6O A;  1IN7 A;  1FNN A;  3ECO A;  2D2W A;  1WSU A;  3IWZ A;  3WE2 A;  1S7A A;  4ZYH A;  3HOS A;  1B9N A;  4HF0 A;  2VON A;  2QQA A;  2RGV A;  3KLN A;  3ISP A;  4I0B A;  2A6H F;  4IF4 A;  2GXB A;  1XCV A;  5F6F A;  5IT9 K;  4AIH A;  4GGG A;  3QP6 A;  1KA8 A;  3WG9 A;  1P2F A;  4IJA A;  5E18 F;  2VOO A;  2LF8 A;  1DPR A;  3BOQ A;  2MH9 A;  1AWC A;  2HTJ A;  4S04 A;  5K1Y A;  3TO6 A;  2IA0 A;  1OYY A;  3I59 B;  2EFW A;  1YIO A;  1U8R A;  1LJ9 A;  4JBA A;  4M6X A;  4HF1 A;  1YFH A;  2D1V A;  2EV6 A;  5BMZ A;  4ZH4 F;  3ZMT A;  3QPH A;  1B4A A;  3F22 A;  2A6E F;  2ZXJ A;  4MQ9 F;  1J9I A;  3MAJ A;  5HS9 A;  4ESJ A;  4GYG A;  3RKY A;  4G7Z F;  2IJL A;  5KVR A;  1HW5 A;  5ICC A;  4U0Y A;  2A69 F;  1I6X A;  2L02 A;  5H6R A;  3F8N A;  5J6X A;  1R1V A;  2F5E A;  3KP3 A;  4LGW A;  4M74 A;  2V1U A;  2COM A;  3U9G A;  2V6C A;  3DEU A;  3KP2 A;  1HW2 A;  5D5V B;  2EFN A;  1W7P D;  1XN7 A;  1E17 A;  4AD9 A;  4BAY A;  4WXD A;  1B59 A;  4CHU A;  3WGI A;  2L54 A;  3K69 A;  4BHC A;  1T6S A;  4IHS A;  5DV5 A;  2Q2E A;  4MQV A;  3ZN1 A;  4N9H A;  4G94 A;  3PFI A;  2H6C A;  2QYO A;  3KFW X;  2MLG A;  2JZY A;  1TNT A;  2PEX A;  4YIF A;  4G6Q A;  2XV4 S;  4IRG A;  4Q47 A;  2P8T A;  3CJN A;  2VC1 A;  3ABT A;  4PCQ A;  5E1X A;  4RAY A;  4Y17 A;  4U7D A;  1ULY A;  4M9Z A;  3E5U A;  2ZKZ A;  2WWY A;  1TTY A;  1C0W A;  1Z1D A;  1PDN C;  2P4W A;  4HA8 A;  1D5V A;  4IPA A;  4RAZ A;  4EM0 B;  1MJB A;  5JI6 A;  4U0W A;  3IL2 A;  2MD5 A;  2PQ8 A;  4HV6 A;  3KEQ A;  4XSZ F;  3ABU A;  1Q1H A;  3C18 A;  3VFZ A;  2LDU A;  4HBL A;  5TRD A;  1U2W A;  1F5T A;  3FMQ A;  2QBY B;  1XB4 A;  1O7L A;  4L9J A;  4UVC A;  5LHG A;  2J5P A;  4LK1 F;  4P5O A;  1STZ A;  2R3S A;  3C7J A; 
#chains in the Genus database with same CATH topology
 2EH3 A;  4EGY A;  4PFP A;  1PUE E;  3F8C A;  3GF2 A;  4KFC A;  2L5Q A;  3ESW B;  3AAF A;  3WTV C;  2X51 A;  2XPV A;  2BVL A;  3OIP A;  5F1J A;  5M3F J;  1WJA A;  2L7M P;  4YRV A;  3R61 A;  2ZFU A;  4C3I J;  3FXU A;  2OUM A;  3K4J A;  5FKL A;  1X3W B;  5FLX Z;  3J80 K;  5KAI C;  2LNB A;  5FRN A;  3WE3 A;  1BI2 A;  2BHZ A;  3ASO H;  3HOW J;  2HKO A;  1ZR4 A;  2IAI A;  2XGX A;  1BOA A;  4L9N A;  3CMA I;  2IRF G;  4U0V A;  1FIA A;  4LG3 A;  4JK1 X;  1KYW A;  2CUE A;  3LSG A;  2OBP A;  2D45 A;  4B1R A;  1WJC A;  1PP8 F;  2K9L A;  3ZQG A;  2IS2 A;  4PK4 A;  2JVH A;  2FXA A;  3GZ6 A;  3HSE A;  3LQQ A;  1UB9 A;  1NG6 A;  2H8W A;  3FIW A;  2L7F P;  3OY9 A;  4I98 B;  3GYH X;  2VE9 A;  1TQI A;  3UR3 C;  1BIB A;  1XX5 A;  3GTG J;  2FNP A;  4JYK A;  5LGU A;  1R49 A;  1Z3X A;  1XGM A;  3ABM H;  4ZYE A;  2P6T A;  1IXS B;  4OIO F;  2DA4 A;  1LDD A;  2JRT A;  5E79 C;  4HRI A;  3EUH C;  2FUG 2;  4HLY A;  3H9J A;  1GV2 A;  1OLT A;  1ZKG A;  2V1D A;  1JJ8 C;  5IYC J;  2WB1 N;  2HOT A;  2L3D A;  2LG4 A;  2NRA C;  1EJ9 A;  3OIQ A;  1S5L C;  4UY8 I;  1GVD A;  1SFE A;  4LG0 A;  3MZH A;  4JOM A;  3S93 A;  3ELK A;  5K5R A;  5C4J J;  4E7J A;  2R7V A;  5F0C A;  2L9R A;  5HDG A;  3DCF A;  2LH9 A;  2QZ8 A;  1MMS A;  4ASN A;  4EM2 A;  3FX3 A;  5LD2 C;  1HW1 A;  2L0K A;  3ZQF A;  4KT6 A;  3GTO J;  5EEH A;  3NRV A;  1VQK I;  1Z6T A;  3G3Z A;  4EV0 A;  1DP7 P;  5ILV A;  1TWC J;  2IPQ X;  2P5K A;  4KUM A;  1GUU A;  1DGR M;  1JXS A;  3UNG C;  4M9S A;  2QSF X;  3OSF A;  3HKZ A;  5B5E C;  3DXJ F;  4U88 A;  2DPU A;  2WV1 A;  2HXO A;  1APL C;  2PN6 A;  3GEZ A;  4BJT A;  3S2W A;  4HEA 2;  4DBQ A;  2OV7 A;  2XAS A;  1RES A;  2ZBK A;  3E97 A;  1LQ1 A;  4A0X A;  4DW6 A;  4NHJ A;  3SFZ A;  2IT0 A;  2JPB A;  5EGO A;  3OYC A;  2LKX A;  4Y13 A;  1G8X A;  4LLL A;  4XRS A;  3PM1 A;  2XGD A;  1U6G A;  3RYR A;  3EDP A;  2EV5 A;  4I7H A;  4MEX F;  1R58 A;  1UG2 A;  2RNJ A;  2LC2 A;  4KN4 X;  2Z33 A;  1JJ6 C;  3VEP A;  3W6J B;  1KON A;  5FGM A;  2LR8 A;  3VYS B;  3RZO J;  4HDU A;  4KMF A;  2OQR A;  3FWE A;  1CGP A;  4MEY F;  1K7A A;  2JSC A;  3ERE D;  1LB2 A;  2XRL A;  1KQ8 A;  4BJ6 C;  2R7W A;  2XHK A;  4CXF A;  2R7T A;  3GZ5 A;  3DTE A;  1CF7 B;  3M1C A;  1DUX C;  1KGS A;  1W7P A;  2K02 A;  2LVS A;  2R7O A;  2R7Q A;  3HUG A;  2DMU A;  2GXG A;  5GPC A;  2W85 A;  3LST A;  4QPO A;  3O6B B;  1S6L A;  3TW6 A;  1GT0 C;  3L2W A;  3MN2 A;  2NS7 A;  5TJJ A;  3L2R A;  2RAE A;  3HDD A;  2KIM A;  1A31 A;  5DTD A;  1FEX A;  1XSV A;  3JCU C;  1T98 A;  1JUS A;  3I4M J;  3MKW B;  3CJT B;  2DN0 A;  1J0R A;  4ZZL A;  3BJ6 A;  4E7H A;  2FX0 A;  4YIR X;  1VQN I;  3DKW A;  2E60 A;  2JQ7 A;  2XAF A;  2CW8 A;  1YIT I;  3KP4 A;  3HM5 A;  5DUK A;  4CGZ A;  2V26 A;  4A3K J;  1R9T J;  2STT A;  4RBO A;  4HX4 A;  4F7Z A;  1JTX A;  3IHU A;  4MIM A;  3ZGK A;  3BDD A;  3IAM 2;  2EPF A;  2XB0 X;  1WGX A;  3ZQ7 A;  4F91 B;  3LAP A;  1A6I A;  4EEF G;  4KNY A;  3G73 A;  2O7O A;  1K4S A;  4IHY A;  4CYC A;  3QU3 A;  3HOX J;  1HCR A;  4M3E A;  3ZQI A;  2L4A A;  1A5J A;  1FMV A;  2XIG A;  2EV0 A;  5D6F A;  3CP8 A;  2LMD A;  3WGH A;  3DWL E;  1O3T A;  1I50 J;  5ILS A;  3E5X A;  3ZQQ A;  2RQP A;  1TQM A;  1X58 A;  3QP5 A;  4BJ5 C;  1IN4 A;  1UMQ A;  2R7F A;  2KL4 A;  2V9V A;  3RI4 A;  3CCR I;  1SD4 A;  4AYB N;  1VQL I;  5D6E A;  1G4D A;  4UHT A;  2XDV A;  3I54 A;  3TED A;  5J1Y A;  1S8N A;  2X1C A;  1IJW C;  2FOW A;  1S29 A;  4JP0 A;  1VQO I;  3CUO A;  2E5Z A;  2V1N A;  5DEQ A;  5ICE A;  4XID A;  1IGN A;  2DW4 A;  2VAS A;  2W4S A;  1LE8 A;  1ZAO A;  3OYE A;  1AKH B;  3V7R A;  5F0F A;  3ZOB A;  4BE1 A;  2JUC A;  1MBH A;  5B1B H;  2M30 A;  3B73 A;  1BJA A;  4ZDP A;  1JKP C;  2YSR A;  3DPT A;  4CO8 A;  1FTT A;  3RKX A;  4NQW A;  1RR8 C;  4GDF A;  1EH6 A;  2F5V A;  2V6E A;  1OMI A;  4ZDL A;  3G1O A;  2HYF A;  1R23 A;  5F64 A;  4A6E A;  5D8L B;  1DQU A;  3SQN A;  3PSI A;  2EIN H;  4AWX B;  2A5Y B;  4Y33 A;  1IUF A;  4UUV A;  5F04 A;  2KQR A;  1IN5 A;  3S1Q J;  3G2B A;  3OYL A;  4XRS G;  4QLC U;  4BDZ A;  2HR3 A;  2ZNZ A;  4NBQ A;  4M3D A;  5AIQ A;  3BLY A;  1BR4 A;  4M9X A;  2OZ6 A;  4IRH A;  4EJW A;  2KRC A;  3IH4 A;  3TO7 A;  1YHQ I;  1OCT C;  3A2K A;  3S15 J;  2F48 A;  4CCK A;  2MLK A;  2F5F A;  1XMX A;  4G6T B;  3OYA A;  2CV2 A;  5LBQ A;  1ZR2 A;  2W82 A;  3T8T A;  4NNJ A;  1MJA A;  5FKO A;  3LSK A;  1QRY A;  2L9N A;  3IP4 B;  4I6Z A;  4LIT A;  4XLC A;  1QZY A;  2LKS A;  3K4M A;  3N05 A;  3BRO A;  2QSG X;  2M8G X;  2VT3 A;  1LDJ A;  2YR2 A;  1TWA J;  2UV1 A;  4XKW A;  2W57 A;  3B6C A;  3HOU J;  3BTL A;  3RJP A;  1W36 C;  3PQK A;  2YPR A;  2CG4 A;  2NNY A;  3JRE A;  2MA3 A;  3E5Q A;  2K9M A;  5FB2 A;  4BE0 A;  3Q3S A;  2KPM A;  3ZQC A;  2G7U A;  3HC7 A;  3SEQ A;  4ABZ A;  2VI6 A;  1IO2 A;  3PSF A;  4BHP A;  2W7N A;  3MWM A;  3L9F A;  1T95 A;  4LK0 F;  4XM3 A;  2IBD A;  4C9Y A;  3OV8 A;  3DF8 A;  2QSH X;  3HHG A;  1KZH A;  2LD5 A;  2R7X A;  3S14 J;  5HDK A;  1KYZ A;  2ZO4 A;  1WKM A;  1FIP A;  3SZP A;  2O03 A;  4LD5 A;  3P7N A;  3ZRG A;  2M34 A;  4N4N B;  2OCC H;  3CCE I;  4HDV A;  5IT3 A;  1FPQ A;  4S0H B;  1M1E B;  4HQE A;  2PG4 A;  5C44 J;  4AU7 A;  2DQL A;  1E0E A;  2OAZ A;  4NC8 A;  3MMY B;  3H3V K;  2FA5 A;  5HLT A;  5J8F A;  3BR0 A;  4PJ0 C;  5IPA A;  2HQR A;  2W24 A;  4XNF A;  3CMM A;  2QM3 A;  1ETK A;  2M8E A;  2XAG A;  4PSW A;  1BA5 A;  2Y75 A;  2HOS A;  2VBY A;  4WWC A;  2P5L C;  1MIJ A;  5E3M A;  1E3O C;  4WF2 A;  5JVG F;  4EMS A;  3GTJ J;  5HS8 A;  2OU2 A;  5FO5 A;  3V42 A;  4IZZ A;  3DKX A;  2IS1 A;  2HYJ A;  2JN6 A;  3WU2 C;  5LHH A;  4CCN A;  2XPU A;  2DMQ A;  3JTH A;  3SEZ A;  1X3Z B;  3CME I;  3AG3 H;  4M3G A;  2QEN A;  3CUQ A;  2CMP A;  3LWF A;  2CS3 A;  4A3D J;  2CQN A;  4EJU A;  4F3Q A;  1SFO J;  1QVU A;  3BTI A;  2VBZ A;  4IX7 A;  1F36 A;  4H0E A;  5CLS A;  1FTZ A;  2E2J J;  3ZXS A;  1YO5 C;  3E6M A;  2BZT A;  1R4N B;  2V4J C;  4QPQ A;  2A3S A;  1I1G A;  1X19 A;  2BXZ A;  2DT5 A;  4XLP F;  2DOE A;  3K4L A;  2LLK A;  1FBU A;  4K2E A;  3PIP F;  2R92 J;  3U21 A;  3X2Q H;  3EYI A;  4L0Z B;  2Y0S N;  4CDG A;  1V5F A;  5DYM A;  5EF6 A;  2IGN A;  3PUF A;  2JA8 J;  3PL8 A;  5GAE J;  1SMT A;  5GTH C;  1YW8 A;  3M8J A;  3RTR A;  3BCA A;  3JAM Z;  3RZD J;  1K61 A;  1VQ5 I;  1KU2 A;  2AQE A;  2RDP A;  4CCM A;  3AFH A;  3MZ8 A;  4D1Q A;  2EWN A;  4B8X A;  1VTN C;  2G9W A;  2UXX A;  2WV0 A;  1QO0 D;  3H92 A;  4LIU A;  3FXQ A;  1U5T B;  4PZJ A;  1I39 A;  1OFC X;  1KU9 A;  2VJI A;  1IN8 A;  2HKX A;  4ZC3 A;  1S3J A;  2M87 A;  3HUG B;  3LOC A;  1K78 B;  2ID3 A;  2EIJ H;  2Y9Z A;  5CJ9 A;  1OR7 A;  5D5W B;  2R7U A;  2VQL A;  1RUO A;  1B8I B;  5FRM A;  3GFJ A;  3BG3 A;  3IKV A;  3BR5 A;  2CJJ A;  3C3W A;  4B09 A;  1WQ2 A;  1W0U A;  5EEA A;  2KIF A;  1VQ8 I;  2X4H A;  3ZMU A;  3PO2 J;  2GWR A;  3AL0 B;  1R5I D;  2EIK H;  3GVA A;  1BC8 C;  2VB6 A;  2Y48 A;  3DTI A;  2YU9 J;  2XUB A;  2DFH A;  5KK1 A;  2M5W A;  1YQA A;  2JPC A;  1R5H A;  3NAR A;  5DD8 A;  1WI9 A;  5JR3 A;  1VFC A;  2ACJ A;  4HNV A;  2VIX A;  1Y0U A;  2F4I A;  2H94 A;  2GOX B;  2XGE A;  5H2F C;  2GQQ A;  2JK3 A;  5H6Q A;  5ICG A;  2P7V B;  3JRF A;  1RKW A;  1UZC A;  2HTS A;  4OMZ A;  4CYC B;  2PLY A;  4NDL A;  2ZSH B;  1OR7 C;  4CCO A;  4E7I A;  2A5W A;  1MDM A;  4BBS J;  1P4A A;  2KKO A;  3DV8 A;  1QQI A;  4RGX A;  5BOX A;  1JI8 A;  2Q8K A;  1RC9 A;  2M45 A;  2FF4 A;  2EZH A;  2CYY A;  2B63 J;  4AID A;  3FXJ A;  1TZL A;  3ZQL A;  2X6Y A;  1TC3 C;  2VQC A;  1U78 A;  1OCC H;  3MEX A;  3VOE A;  1I5Z A;  2Z1D A;  2QA4 I;  2PFB A;  1VZ0 A;  3K4C A;  3W3C A;  4HX7 A;  1ZH5 A;  2JSP A;  2BGC A;  2P0W A;  2PJP A;  4ENK A;  1D1B A;  1P7I A;  2FQ3 A;  4P9F A;  1WRJ A;  2E19 A;  1DDN A;  1IF1 A;  2DOA A;  3EUH A;  2Y31 A;  5F0H A;  3WTS C;  3ML6 A;  3U2R A;  1HOM A;  1D5Y A;  3HEF A;  4A3G J;  1YW9 A;  4A0Z A;  3C1D A;  5FLM J;  1J09 A;  4B4C A;  2DMP A;  1UHW A;  1ZYR F;  4C2U A;  3K1M A;  3KEO A;  4RAG A;  3OYI A;  1ZRE A;  1XTA A;  2STW A;  4GCV A;  1NK2 P;  2DK5 A;  4JX6 A;  4W1U A;  3QOD A;  5CKT A;  2LSO A;  4I2O A;  1D0Z A;  3V4G A;  4JQF A;  5F1R A;  5E1W A;  1T8I A;  2DTR A;  3JSO A;  2M0M A;  3DFG A;  3P9C A;  5FKK A;  2LY1 A;  4XSX F;  3QYB A;  1OCZ H;  2DI3 A;  1TT0 A;  4XKB A;  1XC5 A;  1Z9C A;  2QBY A;  2KRF A;  3OS2 A;  3IRR A;  3C2H A;  4HPQ A;  2GIV A;  1AA7 A;  2Z3Y A;  1IXC A;  4UVB A;  3WU1 B;  3WOD F;  4MFD A;  3BZ6 A;  4ITV A;  4Y7N J;  4TV7 A;  4F93 B;  1QGP A;  2JUG A;  1BI0 A;  1ZLK A;  4BXX J;  4OIR F;  2CUJ A;  2XAH A;  3SDB A;  1B6A A;  5E20 A;  5J3L A;  3OMY A;  3SZG A;  1ZAR A;  1TLH B;  3I53 A;  1QNT A;  2BY3 A;  2XB5 A;  4KIT B;  3WTT C;  4J00 A;  3WHB A;  3GTP J;  1TL8 A;  2VE8 A;  4O6J A;  3F21 A;  2WAF A;  3T0Y A;  1R1T A;  3OYN A;  3OL3 A;  1SC7 A;  3VSL A;  1HA8 A;  3DBR B;  5EYR A;  3R6S A;  5CYV A;  3K1P A;  1SD7 A;  4FQG A;  2DO7 A;  4HOB A;  1W5S A;  4E6K G;  2RQQ A;  1EA3 A;  2F6C A;  1FMW A;  3H35 A;  3I59 A;  1PVE A;  4XLE A;  4UUS B;  4CIC A;  4DYQ A;  4GO1 A;  1P6R A;  1VQ7 I;  1WWX A;  2ZCW A;  1ITY A;  2CWE A;  1XS9 A;  2O6G E;  3CUQ C;  1XCB A;  1ORK A;  2EQR A;  1B9M A;  4LB6 B;  3K70 D;  1BL0 A;  3E1S A;  2HI3 A;  4RDU A;  2ZC2 A;  3EET A;  1WFX A;  3SHF A;  1ZLJ A;  1T2K A;  1JHH A;  3VYT B;  2M4K A;  3F6V A;  3TDZ C;  2QWW A;  4BQN A;  3SZT A;  4LIV A;  4ZTF A;  2KJC A;  2VOP A;  2Q2E B;  2MSY A;  4ENM A;  2ESH A;  1MMA A;  1ZRC A;  3WTU C;  3T1B A;  2CUF A;  4KMU X;  3BR6 A;  2JA7 J;  2FMY A;  2HU9 A;  2R7D A;  1ZQ3 P;  2HGC A;  4KIC A;  4OAY A;  4BQA A;  3C2G A;  2IA1 A;  1RKT A;  1E3H A;  1XGN A;  2DBB A;  2XKO A;  3RDI A;  3CO7 C;  1YTY A;  3HRS A;  1MJ9 A;  1HQC A;  4XN0 A;  4PGH A;  2IS4 A;  5L3D A;  1P7J A;  2VXD A;  1HXD A;  1R6R A;  1RNL A;  1IW7 F;  3ZMD A;  4BGD A;  4KIB A;  3LA7 A;  2A68 F;  4LFU A;  5D8K B;  1QPI A;  2DQR A;  4H4K C;  2CSO A;  1PJR A;  5E3N A;  1ZGJ A;  3V8L A;  4BEH A;  4II3 A;  2ZJP F;  2LOO A;  5EG0 B;  3ZMV A;  4BH9 A;  1F4K A;  2HDC A;  4G8X A;  3J7Y J;  1UHM A;  3IC7 A;  3MFK A;  1ETW A;  1O7F A;  5J1R A;  1KU3 A;  3N97 A;  1O3R A;  1LVK A;  1MZB A;  5BPI A;  1W4M A;  1NH3 A;  3FMR A;  3QYE A;  1FBS A;  2FML A;  3DU5 A;  2BXY A;  1WJF A;  1I6H J;  4FET A;  4ZDO A;  4Y3O A;  1DP3 A;  4DOZ A;  4OIQ F;  4N4O B;  4U7B A;  2PI0 A;  3NWT A;  2O61 A;  4RGS A;  2R93 J;  3HG9 A;  4PGG A;  2HVR A;  4OU0 A;  1TW2 A;  3WU0 A;  2NXN B;  4QTR A;  3JAM K;  2V79 A;  3I58 A;  2KJB A;  4DYR A;  5LEJ A;  3B6A A;  4B3A A;  1X1B A;  2GBY A;  5L3E A;  4X1E A;  4IRI A;  4FTH A;  5TIS C;  4PJJ A;  1MGT A;  4EJT A;  2EIM H;  3JRH A;  2OCE A;  2WA0 A;  3HIF A;  5M5X J;  1QPM A;  2RC4 A;  3G71 I;  2XF5 A;  5DDG A;  1PP7 U;  2QLZ A;  1ETO A;  4L5J A;  4XOR A;  1TW3 A;  2R5Y A;  4BE2 A;  1S72 I;  2NS0 A;  4AVP A;  5JHU A;  1B8I A;  1FP2 A;  4HW0 A;  3A01 A;  1DPU A;  1BR2 A;  2QUF A;  2BY0 A;  2VKH A;  3L2C A;  1BJZ A;  2O0Y A;  3S1M J;  1EF4 A;  4NB5 A;  1H9T A;  2DFE A;  3ZN0 A;  1I27 A;  2WAQ N;  2HWV A;  5DM6 F;  5LLQ A;  5ILU A;  3KE2 A;  3BTJ A;  2E5N A;  2OF7 A;  3H3Z A;  1H89 C;  4QWQ A;  1HKT A;  1WCM J;  1HDP A;  1HSJ A;  2Z5U A;  3A0H C;  3MCZ A;  4A0Y A;  1D1C A;  2D1H A;  2HQ5 A;  1T38 A;  2CQQ A;  1MH3 A;  1P4W A;  1WVR A;  4ON0 A;  2DOD A;  2K4J A;  2QKM B;  2DPD A;  3BZK A;  2LFB A;  3WHC A;  2JVG A;  5HS7 A;  1IDZ A;  2KIQ A;  1GVJ A;  2X6O A;  2DMN A;  2HPM A;  2I10 A;  5IYB J;  1ZGA A;  3FIS A;  3FF5 A;  1ZG5 A;  4JX5 A;  5IP7 J;  3S8P A;  2HYG D;  1TWF J;  2VJ4 A;  4ZYA A;  2CRG A;  4KYW A;  3S32 A;  1Y8Q B;  1CF7 A;  4G12 A;  1MSF C;  4E7K A;  3CF5 F;  3DEW A;  3BPX A;  2EBI A;  5JLX A;  1BW6 A;  3V7C A;  2OD5 A;  2K3P A;  5DCM A;  1JKR C;  2PJR B;  2V1X A;  3TOA A;  2B9S A;  6PAX A;  3BY6 A;  2K86 A;  3BPV A;  3QOE A;  1JE8 A;  2W25 A;  2R7Z J;  3TDU C;  5AON A;  1IDY A;  3I56 I;  2B0L A;  9ANT A;  1V5G A;  2P5V A;  4Z2Y A;  4XN3 A;  1Q1V A;  1VQM I;  3I0T A;  4WXC A;  5CQG A;  2X6X A;  2R5Z B;  1GXQ A;  2Z99 A;  1LNW A;  3S3O A;  1QA6 A;  2ISZ A;  3M8F A;  3K9T A;  3F8B A;  1LUJ B;  3KP5 A;  1ZRD A;  3BC8 A;  1FSH A;  1K6Y A;  3J80 Z;  2MC3 A;  4N0B A;  2KIU A;  3DKY A;  1OCR H;  3Q5F A;  3DPL C;  1T33 A;  5J47 A;  4HLX A;  5IYD J;  2PMH A;  2CFO A;  5FJ8 J;  4IXA A;  1ON2 A;  4C30 A;  4BQO A;  3G4S I;  3MKZ A;  2H09 A;  4A5M A;  1H0M A;  5FD6 A;  1D3Y A;  4IOA F;  2HPI A;  4Q48 A;  4ZYG A;  1WJ5 A;  5LGT A;  1J2X A;  3QOP A;  1SEU A;  2DXI A;  1MDM B;  2WAD A;  4IKF A;  2LRE A;  1OIS A;  3ROU A;  4WXH A;  1D8K A;  2K5C A;  5EEG A;  4MHG A;  4R79 A;  4A12 A;  4RS8 A;  3V8K A;  3LA2 A;  5B3S H;  3F8M A;  3GTQ J;  3FK7 A;  2FU4 A;  3D5S C;  3ZR8 X;  4G7H F;  1JT6 A;  3HRM A;  4IEJ A;  2HDW A;  3I3L A;  3JRB A;  1FYK A;  3KYD B;  5D4S A;  1VQ9 I;  2HEO A;  1LEA A;  2QF7 A;  3S3N A;  1XDS A;  4XLA A;  2HVS A;  3H0D A;  4BUP A;  3A02 A;  1TWG J;  5FD5 A;  2DU9 A;  3L2U A;  1G2H A;  2VC0 A;  1F1Z A;  1R5G A;  3LL7 A;  3KPH A;  3CDH A;  2ISY A;  3GUD A;  2QEX I;  2CW0 F;  3RPU D;  4A69 C;  2IVM A;  4BQQ A;  3H5A A;  1UAA A;  1LPQ A;  2Q0O A;  1UST A;  3H3U A;  4HX8 A;  3D0S A;  4N9I A;  3J7Z I;  1FJL A;  2G7H A;  2LKP A;  3CC2 I;  1IC8 A;  2VKE A;  2M2E A;  1H88 C;  3W2A A;  4G7O F;  3A4C A;  4CUG A;  3DLL F;  1ZN2 A;  1XMA A;  3NWS A;  4NUB A;  4FE7 A;  4CZZ A;  1FYL A;  2Z2S B;  3KET A;  3TMO A;  1Z91 A;  4D7M A;  1QBJ A;  2VQH A;  2P6S A;  2A61 A;  3I4N J;  3WTW C;  5TGT A;  1ZG3 A;  5EDN A;  4IQ4 A;  3WGG A;  2CW7 A;  2PMU A;  4HG2 A;  4A3I J;  2FJ1 A;  3KP6 A;  1MBK A;  1E2X A;  1RIO H;  2FRH A;  5L3G A;  1SAX A;  3DQV C;  1WPK A;  3GFL A;  2IA2 A;  4J01 A;  4KDP A;  1ETQ A;  2HS5 A;  3TW7 A;  2ADU A;  5IOY A;  3WTX C;  1IRX A;  3O3K A;  3W2W A;  3LAJ A;  1LEB A;  3BTC A;  2NVY J;  4ANJ A;  3S3M A;  5D4R A;  1VQ4 I;  2FEZ A;  3KZY A;  4Y4R A;  2VL8 A;  4IL6 C;  1ENH A;  3F3X A;  1Z7U A;  2B7E A;  1SFU A;  2VXZ A;  4HF2 A;  2IGM A;  2VT2 A;  1MBE A;  1G3W A;  3LQR A;  2XAJ A;  3N4M A;  5EZG A;  5B1A H;  3HXL A;  5FLV A;  5IT9 Z;  2ZME C;  3KLO A;  4C3H J;  2XF6 A;  3OYF A;  1MH4 A;  3B02 A;  2V7F A;  4L5E A;  2ZME B;  2X1E A;  2RKH A;  4EM1 A;  2NYX A;  2E2H J;  1T0F C;  2OTJ I;  2ZFW A;  4KJZ A;  2VPR A;  3M1E A;  3P9I A;  5BPD A;  2VQG A;  1FY7 A;  4RM3 A;  3HPG A;  1ZRF A;  3ZMZ A;  5KCM A;  3SXY A;  1GDT A;  3K6G A;  1A35 A;  2FOK A;  1IV6 A;  4R8H A;  1OCP A;  5LEK A;  2VBX A;  4I01 A;  4KIG A;  1ETY A;  4OWR B;  2NS8 A;  5HDN A;  1XSX A;  1UCR A;  3BJA A;  3GTL J;  2HQA A;  4I09 A;  5CPR B;  1I1S A;  4RGR A;  3HYI A;  4M72 A;  2O8X A;  3RYP A;  3H0G J;  2DLL A;  1WJD A;  4KIS A;  2QQ9 A;  3GLL A;  2LBF A;  4G9Y A;  3I55 I;  3HRT A;  1ON1 A;  4UVA A;  3V8J A;  4OOI A;  1WH5 A;  3ECH A;  1K79 A;  1J75 A;  1T0F A;  3D5L A;  1JKQ C;  5K5Q A;  1R36 A;  2FBH A;  3GFI A;  2LTP A;  4RB1 A;  2WAE A;  3DPU A;  2CFX A;  3SYT A;  5J4Y A;  4YG2 F;  2Y9Y A;  5LRS A;  4A2U A;  3L2V A;  3H9G A;  2CQK A;  1L0O C;  5BQT A;  3P5J A;  2GM4 A;  2KHM A;  5L3F A;  2QVO A;  1OJL A;  3E0J B;  2XSD C;  3GME A;  3V7S A;  4AIK A;  4AUX A;  5DCM B;  4BXF A;  4XLH A;  3OYK A;  3L00 A;  4XRF A;  3BG5 A;  5AIP A;  3K70 C;  2EJR A;  3BJO A;  3HTS B;  3CCL I;  1VQ6 I;  3EQL F;  1WI3 A;  1YE9 A;  2YX4 A;  4D0P A;  2F5C A;  3CCJ I;  3HOY J;  5KAF C;  4RMN A;  2PJR A;  4EVI A;  3OYB A;  1Z7L A;  2Y30 A;  5E1Z B;  1FX7 A;  2X0L A;  4P55 A;  2GAU A;  1TP4 A;  2Z16 A;  2QQB A;  2ZJ2 A;  5ED4 A;  1F9N A;  4UV9 A;  3MKY B;  4YEJ A;  1S7O A;  1AKH A;  4KN7 X;  1U9O A;  1DU0 A;  5GAD J;  2ELJ A;  2HOA A;  5ICF A;  4CCL A;  2UZK A;  1DGW Y;  2FBK A;  2A07 F;  5CVI A;  3F9K A;  2RV8 A;  2XAU A;  5FLX K;  3S16 J;  1VF9 A;  1UJ8 A;  2MW8 A;  3I71 A;  4GYI A;  4NQW B;  1TNS A;  1Y0N A;  3EUA A;  4A3J J;  3PQJ A;  2P81 A;  3QU6 A;  4I76 A;  1NG7 A;  2AXL A;  2M1B A;  3ERM A;  1IRF A;  4ZTJ A;  3H36 A;  1WHU A;  1D1A A;  1P92 A;  5A2Q Z;  1YLF A;  5E3O A;  2F5D A;  1W36 D;  3HKZ N;  2OQG A;  2TDX A;  1YOV B;  1L3L A;  5L3C A;  1X3U A;  1A6Q A;  1BN5 A;  2E7W A;  3HGG A;  1R71 A;  4ENN A;  1J59 A;  1NHA A;  4AIJ A;  5K7Z A;  1BR1 A;  2K3F A;  3DTK A;  3CD6 I;  2UXN A;  4MO7 A;  3I9V 2;  2DA6 A;  3GFM A;  3CLQ A;  1WJE A;  3DLA A;  3FM5 A;  3O8H A;  4S05 A;  2NVQ J;  3J7A O;  1R4M B;  2UUZ A;  2DTZ A;  5K5O A;  4MTD A;  1Y56 A;  3FK6 A;  5J8C A;  3DP7 A;  4HYE A;  3CCS I;  2ECB A;  2K9N A;  1REP C;  2BVM A;  3BG9 A;  3K0L A;  4M73 A;  1ETX A;  2HZD A;  3REO A;  1YI2 I;  2HNH A;  2W48 A;  1Z6R A;  3CJR B;  3ZP5 A;  1V3F A;  2Z9O A;  2BE5 F;  2EIL H;  1FLI A;  3HTU A;  1JHF A;  1Z0X A;  1ZEL A;  3ZMS A;  3R0J A;  1XDU A;  1EH7 A;  1OKR A;  1SD6 A;  2IW5 A;  4EQQ A;  1MBF A;  2O8K A;  3OYG A;  4M71 A;  1R00 A;  5K7H A;  1B72 B;  4MLO A;  1HBX G;  1WJB A;  3ASN H;  1R22 A;  2NVT J;  2CQ7 A;  3IUO A;  5DCF A;  2H6B A;  3FHZ A;  1WZ2 A;  4G6D A;  3HGY A;  3OL4 A;  1XGS A;  3K4N A;  1MW7 A;  2E1C A;  2O3F A;  2GA2 A;  2JMW A;  4M3F A;  3T5X A;  2JJ7 A;  3EUK L;  2E1N A;  3K7A J;  2PMZ N;  2EZI A;  3CCU I;  1IN6 A;  1FP1 D;  1XD7 A;  5GAG J;  3D5R C;  3R0A A;  3FKI J;  4EGZ A;  4OMY A;  1BC7 C;  1I3A A;  5J1U A;  2FSW A;  4GXO A;  3GX4 X;  3HJE A;  3FXK A;  3F72 A;  2KZG A;  4F55 A;  1IUY A;  4IQJ A;  2VN2 A;  5FFZ A;  2G0E A;  5EZH A;  1U5T C;  2AS5 F;  2XVC A;  1D0X A;  3L09 A;  3LFK A;  1POG A;  2K27 A;  3VWB A;  3E3V A;  5H20 A;  5IP6 A;  1XPX A;  3K4K A;  3OS0 A;  3C2B A;  3GWZ A;  1QZE A;  3SJM A;  4DIQ A;  1FYM A;  2DT7 B;  4MNU A;  3HOZ J;  2L01 A;  1W5C C;  3BR3 A;  2JWT A;  2ZME A;  2ME6 A;  1H8A C;  1SFX A;  1K83 J;  3FBN B;  4RB0 A;  1S7E A;  4FX4 A;  4II2 A;  1TT5 B;  1MBG A;  1U9N A;  2ZNY A;  1KQ9 A;  3F8F A;  1V4R A;  5CVV A;  1O3S A;  2QGU A;  1CQT A;  2L9V A;  4KA4 A;  2WC2 A;  4R1H A;  2AXT C;  3GLX A;  4D9J A;  1D8J A;  3CUQ B;  5CVR A;  1BOB A;  2MFZ A;  2ZXI A;  1YX5 A;  4XL9 A;  5F08 A;  4AYB A;  4UUS A;  1AHD P;  4YII A;  4L5I A;  2JA2 A;  3EYY A;  4A6D A;  4WX9 A;  3JTG A;  1IRG A;  5GTI C;  5J4V A;  5D5U B;  1MD0 A;  2RN7 A;  1HF0 A;  1MNE A;  1X4O A;  4B43 A;  3FXO A;  5IY5 H;  3PFY A;  2LBF B;  2P7C B;  1JTY A;  1V55 H;  4HNU A;  1G59 A;  2CU7 A;  4RB2 C;  2X85 A;  4A5N A;  2Y69 H;  1ZG1 A;  1RRJ A;  4Y15 A;  2E7X A;  3CLO A;  4B3X A;  3SFI A;  3S1N J;  3W6V A;  2VKV A;  4U87 A;  1ACI A;  3KCC A;  2H1K A;  3LSH A;  3WG7 H;  3MQ0 A;  2NOG A;  3S1R J;  3BR1 A;  3DU6 A;  2EZK A;  3PIO F;  1D0Y A;  4I02 A;  3DEE A;  5CVU A;  4AC0 A;  3OYH A;  4M6Y A;  3QYF A;  3KYL A;  4DQ2 A;  3TP0 A;  3QAH A;  4O5V A;  5E17 F;  1V54 H;  3M8E A;  3LFU A;  3H5N A;  2TCT A;  3IV5 A;  4LB5 A;  2L2O A;  5GPA A;  4LLN A;  4XOP A;  5IP9 J;  3PJR A;  2O5R A;  3L2Q A;  5HLH A;  2BW3 B;  1OPC A;  2QCO A;  4QSH A;  1ERD A;  3S17 J;  2DK8 A;  1R1U A;  2ID6 A;  2J5O A;  1W7P B;  3IH3 A;  3LSJ A;  2R5Y B;  1ZHF A;  4DGW B;  4GFB A;  4CYD A;  2ETH A;  3QPT A;  2EFO A;  2K4B A;  4ESF A;  3CES A;  3H9Q A;  5EGO B;  2GOM A;  4BNC A;  4UNO A;  2K40 A;  1EH8 A;  4C3J J;  1T08 B;  4RAF A;  2M9H A;  1SAU A;  2NAZ A;  4LJZ F;  2ZXW H;  3T8R A;  3LSM A;  4DZP A;  2E1O A;  1YJN I;  4WK8 F;  3HB9 A;  4JX4 A;  2DOF A;  2Q1Z B;  3JR9 A;  2DA3 A;  4A3M J;  2I8D A;  4DZJ A;  4E70 A;  3J81 Z;  4W97 A;  4UV8 A;  4OIP F;  3CQZ J;  4IHT A;  1IXR C;  4HZF A;  4ESB A;  2ZJR F;  4ZZD A;  4FX0 A;  3Q9S A;  4BY1 J;  2EA4 A;  4IO9 F;  4UXN A;  3CF2 A;  3E7L A;  2YUS A;  3GCM A;  4KIF A;  3TGN A;  2XRO A;  3GTK J;  2AQF A;  4RA2 A;  4HSR A;  4RGU A;  4HQM A;  3FHN A;  2YX7 A;  2E1M B;  3A03 A;  2UWM A;  3FDY A;  4B48 A;  2VPL A;  1MND A;  4HAM A;  1I3Q J;  3OIO A;  1HKS A;  4O3M A;  1O4X A;  4B44 A;  3BWG A;  4XR6 A;  3M3Y J;  4LG0 B;  2X9D A;  3BZC A;  2W00 A;  5FKM A;  3JRG A;  3LNQ A;  1T56 A;  1G3S A;  1JGG A;  5DS9 A;  1J7K A;  1USS A;  1HST A;  3S2H J;  2IXS A;  3K4B A;  1Z05 A;  1G3T A;  2K9Q A;  1IAW A;  4L0Y B;  1P4X A;  2R7R A;  4MFE A;  2EB7 A;  1ODD A;  4FCY A;  3ABK H;  1KU7 A;  3L1P A;  1FC3 A;  2WB1 A;  3LSR A;  1FBQ A;  1GHC A;  4XLF A;  3P9K A;  4QIW N;  1X4P A;  2R4G A;  2EA2 A;  1LVA A;  2VJ5 A;  5A2Q K;  5HOD A;  5DD4 A;  3RKW A;  1XSD A;  2L7Z A;  2L4M A;  2K7L A;  3OR1 C;  5DUI A;  1HKQ A;  1SD5 A;  3M4O J;  2FNA A;  2ESN A;  1U3E M;  2AO9 A;  4XMY A;  3JRD A;  4ZYD A;  2WTE A;  5LHI A;  4X0G A;  1YRN A;  1YS6 A;  3G6E I;  5K7F A;  2MBF A;  3VSK A;  2KDZ A;  1O3Q A;  3DBL B;  5ERI A;  4AM3 A;  2TRT A;  3KP7 A;  3GW2 A;  1QZZ A;  2M0C A;  3R60 A;  1IZ1 A;  2MH2 A;  2XAQ A;  4PJL A;  3RCO A;  1PYV A;  3RKQ A;  1A04 A;  4KT5 C;  1BI1 A;  4XK4 A;  3FXM A;  3I4P A;  4HV5 A;  2M3A A;  4BYY A;  2BYV E;  2LY9 A;  4YFN F;  2R0Q C;  1Z67 A;  3H5R A;  2ZB9 A;  4XKC A;  4P9U A;  2JT1 A;  3HOT A;  1QHH D;  4DBR A;  3ZPL A;  1TBX A;  4C2M J;  4BXU A;  3TO9 A;  3HBL A;  4FE4 A;  5HVQ C;  4L18 B;  4A93 J;  1AU7 A;  2H1L A;  5LFA A;  4CSW A;  3MVP A;  4DJA A;  3CCM I;  4I99 C;  4UUT A;  3RPU A;  4RM2 A;  3KZI C;  2GZW A;  2PBI A;  2A6T A;  2K85 A;  5CQE A;  3GTM J;  5C4X J;  3FZV A;  1RPW A;  4D5F A;  1YYV A;  2MG4 A;  1GXP A;  3E6D A;  1UFM A;  4PJM A;  4XQF A;  1FT9 A;  3TOB A;  1Y6I A;  3GXO A;  1PUF B;  2NVU B;  2JTV A;  2KP6 A;  3VPR A;  1B72 A;  4DNC A;  2BOL A;  3L7W A;  3D1N I;  1YW7 A;  4E7S A;  4PJN A;  5E8I A;  2XSJ C;  2IGO A;  3KYC B;  3AKZ A;  3KZZ A;  1Z77 A;  3HHH A;  3GZN B;  2M7A A;  1Z3Y A;  3TP3 A;  4YFK F;  2XPW A;  4M3B A;  2E36 A;  3CC7 I;  3K1N A;  1SFK A;  2BBY A;  3HZJ A;  2DJI A;  2QKL B;  2OTL I;  3BQZ A;  2HFH A;  5FFX A;  2KLO A;  2F2E A;  4WCG A;  3E6C C;  1RZ4 A;  3MZY A;  2DDA A;  1SAN A;  4BU2 A;  4MGR A;  1YJ9 I;  1JT0 A;  1Y1V J;  3BG7 A;  1OYI A;  4XBF A;  3VOD A;  4Q5S F;  4IVN A;  1LFU P;  5GAH J;  1MMD A;  1MKM A;  2Y0M A;  1AOY A;  3WTY C;  4A3B J;  2LP0 A;  2ELH A;  3NQO A;  1HDD C;  1NTC A;  4FT8 A;  1FOX A;  2H27 A;  2HDD A;  1B1B A;  3OR2 C;  2E2I J;  2E34 A;  2OJE D;  1BM9 A;  1E3P A;  1G6N A;  5E8G A;  3ULQ B;  1RUN A;  4PDK A;  2OZU A;  1OYW A;  3O2P E;  1U5T A;  2HQN A;  2KIS A;  2HXI A;  5L3B A;  2BEO A;  1LFB A;  1FSE A;  2L7K A;  1FOK A;  2H8R A;  1P9Q C;  4P96 A;  1Y39 A;  4XLN F;  2HOE A;  2MC4 A;  2ME0 A;  3OWT A;  1FWZ A;  5JLW A;  3FKJ A;  2VBW A;  1X2M A;  2V9K A;  1FZP B;  3JSP A;  3I64 A;  4Q4Z F;  5BS6 A;  3CDL A;  5D5X B;  4EJV A;  2EK5 A;  3Q9V A;  1OQY A;  4IOC F;  1XGO A;  3I5U A;  2W84 A;  4L9T A;  2WAQ A;  2EFP A;  1EV7 A;  3IRQ A;  5LRR A;  2BHY A;  2GA1 A;  3ABL H;  3QQA A;  3HRU A;  1HC8 A;  2XC7 A;  1XMK A;  2KFD A;  4EAT A;  3OS1 A;  1OCO H;  3HSF A;  4YFX F;  2LF7 A;  1JUM A;  1G3Y A;  1HLV A;  4FIS A;  3COA C;  1R7J A;  1YJW I;  1BIA A;  1ETV A;  2HZT A;  4OIN F;  1O57 A;  3TKY A;  3JW4 A;  4AVZ A;  1H9G A;  3JRC A;  1MBJ A;  3RQ4 A;  3OOP A;  3ZQH A;  4BS9 A;  4HST A;  2YU3 A;  1JUP A;  4E7Z A;  3NEU A;  4A3C J;  2DA1 A;  2OPT A;  4L9V A;  1J5Y A;  2FBI A;  3QRF F;  1UHS A;  1LKX A;  3RIR A;  1VI0 A;  2FD5 A;  3K2Z A;  4LMY A;  5F27 A;  3MKL A;  2DFI A;  2EFQ A;  4D7N A;  3S2D J;  4C2T A;  3IKT A;  3A0B C;  3FM3 A;  3GO5 A;  3CCY A;  3IH2 A;  2DAO A;  2IP2 A;  3WTZ A;  4V19 K;  2FE3 A;  4PFO A;  4RB3 C;  5CVJ A;  4ETS A;  3IAS 2;  4E4H A;  3A01 B;  2X48 A;  4MTE A;  3FXR A;  2XRN A;  2RNG A;  3W6K B;  3CMY A;  5HLI A;  2JA6 J;  3M9A A;  4BDY A;  3M7G A;  4IHX A;  5HOO A;  4D5C A;  1SVO A;  1BI3 A;  3Q0W A;  3CCV I;  3G1M A;  1QVT A;  4M6V A;  2IS6 A;  4PSX A;  1MMN A;  1ZTR A;  2KZV A;  3BP8 A;  4BL0 B;  2D5V A;  5LGN A;  3BG6 A;  3CZ6 A;  3AG4 H;  3VB2 A;  4CZC A;  3IWF A;  4E7L A;  3ONQ A;  2DYR H;  2VJJ A;  3LA3 A;  1TWH J;  2I5U A;  1LDK B;  3R4K A;  4EJO A;  1Y8R B;  1ZK8 A;  3GBG A;  4XIC A;  2X6W A;  1A36 A;  3OSG A;  2QQ8 A;  4I0A A;  3F6O A;  3J81 K;  3F23 A;  4FHT A;  2NNN A;  3TQN A;  4LLG F;  2EZL A;  1YG2 A;  2VOD A;  3ZCO A;  3CTA A;  1Y1W J;  2M4G A;  3A1Y A;  3RPQ A;  2R7S A;  5HLG A;  1TQP A;  1K78 A;  1S9H A;  2KRH A;  2XKP A;  2BV6 A;  2CGP A;  4BKX A;  2V9P A;  1W5T A;  3HSR A;  3BR2 A;  5M3M J;  2HVQ A;  3VDX A;  2JRM A;  1BBY A;  3FMS A;  4V2F A;  1MSE C;  5JVT A;  2ICW G;  3LMM A;  4BHB A;  2CO5 A;  3K10 A;  2C6Y A;  2VLA A;  1RI7 A;  2BY1 A;  3QPL A;  3HL2 A;  3CO6 C;  2OA4 A;  4XOT A;  3TBI A;  4F92 B;  3PNV A;  2AHQ A;  2RVC A;  5C3E J;  1SMY F;  1JGS A;  5JFR A;  2LYC A;  1KQ0 A;  3E6B A;  1T39 A;  4A3E J;  2XGC A;  3U1D A;  1ONV A;  2MYS A;  4ENJ A;  2DA5 A;  1YS7 A;  2LY2 A;  2DFF A;  2DJN A;  1IN7 A;  1FNN A;  4A3F J;  1K6O A;  4XON A;  3ECO A;  1FOY A;  4BY7 J;  2D2W A;  1WSU A;  2F4O B;  4RLF A;  2E71 A;  5JHF A;  3IWZ A;  2ZSI B;  3WE2 A;  4ZJZ A;  1S7A A;  1X1A A;  3HPH A;  4ZYH A;  3HOS A;  2KDO A;  1B9N A;  4HF0 A;  2VON A;  2QQA A;  2RGV A;  2A05 A;  3KLN A;  1YRN B;  3ISP A;  4I0B A;  2A6H F;  3K2A A;  2MD0 A;  4IF4 A;  3FBI B;  4J19 A;  2O9L A;  2VUM J;  3CJQ B;  3BQY A;  3KIO A;  2GXB A;  4PUS A;  2X1D A;  2DMT A;  1XCV A;  5F6F A;  5IT9 K;  1X2N A;  4AIH A;  4GGG A;  3QP6 A;  3BT9 A;  1XG1 A;  1K4T A;  1KA8 A;  1SVL A;  3WG9 A;  1P2F A;  4IJA A;  5E18 F;  1X1D A;  2VOO A;  5M5W J;  1Z21 A;  2LF8 A;  1DPR A;  3BOQ A;  2WY8 Q;  5HNH A;  2MH9 A;  1AWC A;  2HTJ A;  1V5E A;  4S04 A;  3OYM A;  2Y0S A;  5K1Y A;  3TO6 A;  2IA0 A;  1OYY A;  3QWL A;  3I59 B;  2EFW A;  1YIO A;  1VND A;  3PNY A;  5DM7 F;  1U8R A;  1LJ9 A;  4JBA A;  4M6X A;  4HF1 A;  1YFH A;  2D1V A;  1QHG A;  2ZXH A;  2EV6 A;  5BMZ A;  2NVX J;  3AG2 H;  4ZH4 F;  1PUF A;  1GV5 A;  3ZMT A;  3QPH A;  4BEH B;  1B4A A;  2Y2Z A;  4YEL A;  3F22 A;  1VQP I;  2A6E F;  2ZXJ A;  3OOU A;  4MQ9 F;  5HNF A;  1U0J A;  3M07 A;  1J9I A;  3MAJ A;  1LFP A;  1X1P A;  5HS9 A;  4ESJ A;  3BCB A;  3LSI A;  1SVM A;  4GYG A;  1IRZ A;  3PUB A;  3RKY A;  4G7Z F;  4GRI A;  2IJL A;  4BAC A;  5KVR A;  2GXA A;  1HW5 A;  4OAZ A;  5ICC A;  4NC7 A;  4U0Y A;  2A69 F;  1I6X A;  2LRD A;  3JRI A;  4A3L J;  2GIZ A;  2L02 A;  3VYR B;  3W2V A;  5H6R A;  3LSP A;  2E35 A;  4RLQ A;  2M7B A;  4XKV A;  2N8G A;  3F8N A;  3KX2 A;  3MD2 A;  5J6X A;  1R1V A;  2F5E A;  2KMU A;  3KP3 A;  4LGW A;  2IEK A;  1QU3 A;  4M74 A;  4F52 A;  2ECC A;  3SDG A;  3UKG A;  2V1U A;  2COM A;  1X1C A;  5BNG A;  3U9G A;  2DT6 A;  2V6C A;  5B66 C;  1UEL B;  4XRM A;  4X6A J;  4Z6Y A;  4DYC A;  3DEU A;  2JA5 J;  2MGQ A;  3H1C A;  3KP2 A;  5M5Y J;  1HW2 A;  5D5V B;  2EFN A;  1W7P D;  3J7A Y;  1XN7 A;  2E1M C;  3O8G A;  4CA0 A;  3CP2 A;  1E17 A;  1FOW A;  4LOC A;  4UB8 C;  4B47 A;  2DA7 A;  2DA2 A;  4AD9 A;  4BAY A;  4WXD A;  1B59 A;  4CHU A;  2ELK A;  2L9S A;  4P1W A;  3WGI A;  2L54 A;  2WY7 Q;  3RSN A;  1MNM C;  3K69 A;  4IHW A;  2F4M B;  5E3L A;  4BHC A;  3PNT A;  1T6S A;  2MAB A;  4IHS A;  5DV5 A;  2Q2E A;  5EJC A;  3OYD A;  4MQV A;  1W0T A;  1N78 A;  3ZN1 A;  1MMG A;  4N9H A;  1JKO C;  4CCJ A;  4G94 A;  3PFI A;  2H6C A;  2QYO A;  3KFW X;  2MLG A;  3G1L A;  1EKE A;  2JZY A;  1TNT A;  2PEX A;  2XF7 A;  4YIF A;  3CDI A;  4G6Q A;  4Y52 J;  2XV4 S;  1RET A;  4IRG A;  2K9S A;  2IGK A;  3U1K A;  2BW3 A;  2CH0 A;  4Q47 A;  2P8T A;  2CUZ A;  3RQI A;  4FAS D;  2CV1 A;  3PO3 J;  1ZGW A;  3CJN A;  2DCE A;  2RRE A;  2VC1 A;  2COB A;  3ABT A;  4PCQ A;  3F0C A;  2ZJQ F;  2NOJ B;  4V2G A;  1YIJ I;  1IV8 A;  5E1X A;  4NC6 A;  2FQ4 A;  4RAY A;  4Y17 A;  2LK2 A;  3VYU B;  3Q0V A;  1DU6 A;  4U7D A;  1N25 A;  2CV0 A;  1N75 A;  1ULY A;  2OC6 A;  3Q0U A;  5EG0 A;  2KT0 A;  4M9Z A;  4BBR J;  3E5U A;  3NAU A;  2ZKZ A;  3KEY A;  2WWY A;  1IG7 A;  1TTY A;  1UG0 A;  5FKN A;  1BW5 A;  1C0W A;  1GLN A;  1Z1D A;  1PDN C;  2P4W A;  3DBH B;  2DDB A;  4UB6 C;  5FRO A;  4HA8 A;  2BY2 A;  1D5V A;  1LE8 B;  2R5Z A;  4IPA A;  3CC4 I;  1WH7 A;  4RAZ A;  1NK3 P;  5J40 A;  4EM0 B;  2GLO A;  1MJB A;  5JI6 A;  4U0W A;  3AG1 H;  3IL2 A;  2MD5 A;  3EPZ A;  5KHD A;  4CH7 A;  3FXL A;  3JRA A;  2PQ8 A;  4HV6 A;  1F43 A;  3KEQ A;  4XSZ F;  1U8B A;  3ABU A;  1Q1H A;  3C18 A;  2W1O A;  3VFZ A;  1N77 A;  4HNT A;  2LDU A;  2CQX A;  3OYJ A;  3HOV J;  4HBL A;  5IOZ A;  2PMZ A;  2PX9 A;  5TRD A;  3TL4 X;  1U2W A;  1F5T A;  5GP9 A;  1RR7 A;  3FMQ A;  3QPS A;  2QBY B;  2WBM A;  1XB4 A;  1O7L A;  3CCQ I;  4L9J A;  4UVC A;  4IHV A;  5LHG A;  2J5P A;  3AL0 C;  4LK1 F;  4P5O A;  2YS9 A;  2DYS H;  1STZ A;  2VKD A;  1YX3 A;  5KNL A;  2R3S A;  3C7J A;  1W1W E; 
#chains in the Genus database with same CATH homology
 4EGY A;  1PUE E;  3F8C A;  3GF2 A;  4KFC A;  3AAF A;  3WTV C;  3R61 A;  3FXU A;  5FLX Z;  3J80 K;  2LNB A;  3WE3 A;  1BI2 A;  2HKO A;  2XGX A;  1BOA A;  4L9N A;  2IRF G;  4U0V A;  4JK1 X;  1KYW A;  2OBP A;  2D45 A;  1PP8 F;  2FXA A;  3GZ6 A;  3HSE A;  3LQQ A;  1UB9 A;  4I98 B;  3GYH X;  2VE9 A;  1TQI A;  1BIB A;  2FNP A;  5LGU A;  1XGM A;  4ZYE A;  2P6T A;  1IXS B;  4OIO F;  1LDD A;  2JRT A;  4HLY A;  2V1D A;  2L3D A;  2NRA C;  1SFE A;  4LG0 A;  3MZH A;  3ELK A;  5K5R A;  5HDG A;  2QZ8 A;  4ASN A;  4EM2 A;  3FX3 A;  1HW1 A;  5EEH A;  3NRV A;  1Z6T A;  3G3Z A;  4EV0 A;  1DP7 P;  5ILV A;  2IPQ X;  2P5K A;  4KUM A;  1JXS A;  4M9S A;  3DXJ F;  4U88 A;  2DPU A;  2PN6 A;  3GEZ A;  3S2W A;  2XAS A;  1LQ1 A;  4NHJ A;  2ZBK A;  3E97 A;  4A0X A;  3SFZ A;  2IT0 A;  2JPB A;  4Y13 A;  4LLL A;  1U6G A;  3RYR A;  3EDP A;  2EV5 A;  4I7H A;  4MEX F;  1R58 A;  2RNJ A;  4KN4 X;  2Z33 A;  3VEP A;  3W6J B;  5FGM A;  4HDU A;  4KMF A;  2OQR A;  3FWE A;  1CGP A;  4MEY F;  1K7A A;  2JSC A;  3ERE D;  1LB2 A;  1KQ8 A;  2XHK A;  4CXF A;  3GZ5 A;  1CF7 B;  1DUX C;  1KGS A;  1W7P A;  2K02 A;  3HUG A;  2GXG A;  2W85 A;  3LST A;  3O6B B;  1S6L A;  5TJJ A;  2KIM A;  1XSV A;  1T98 A;  1J0R A;  4ZZL A;  3BJ6 A;  3DKW A;  2XAF A;  3KP4 A;  5DUK A;  4CGZ A;  2STT A;  4HX4 A;  4F7Z A;  3IHU A;  3BDD A;  3LAP A;  3ZQ7 A;  4KNY A;  3G73 A;  3QU3 A;  2L4A A;  2XIG A;  2EV0 A;  5D6F A;  3WGH A;  1O3T A;  5ILS A;  3E5X A;  2RQP A;  1TQM A;  3QP5 A;  1IN4 A;  2R7F A;  2V9V A;  3RI4 A;  1SD4 A;  5D6E A;  1G4D A;  4UHT A;  3I54 A;  1S8N A;  1S29 A;  3CUO A;  5DEQ A;  5ICE A;  2DW4 A;  1ZAO A;  3V7R A;  2M30 A;  3B73 A;  1BJA A;  2YSR A;  3DPT A;  4CO8 A;  3RKX A;  4NQW A;  1EH6 A;  1OMI A;  2HYF A;  1R23 A;  5F64 A;  4A6E A;  5D8L B;  3SQN A;  4AWX B;  2A5Y B;  4UUV A;  1IN5 A;  4QLC U;  2HR3 A;  2ZNZ A;  5AIQ A;  4M9X A;  2OZ6 A;  4IRH A;  4EJW A;  3TO7 A;  2MLK A;  2F5F A;  5LBQ A;  3T8T A;  1MJA A;  1QZY A;  3BRO A;  2VT3 A;  1LDJ A;  2YR2 A;  2W57 A;  3RJP A;  3PQK A;  2YPR A;  2CG4 A;  2NNY A;  2MA3 A;  3E5Q A;  5FB2 A;  2G7U A;  4BHP A;  3MWM A;  3L9F A;  4LK0 F;  3OV8 A;  3DF8 A;  3HHG A;  5HDK A;  1KYZ A;  2ZO4 A;  1WKM A;  3SZP A;  2O03 A;  4LD5 A;  3P7N A;  4HDV A;  5IT3 A;  1FPQ A;  4HQE A;  2PG4 A;  2DQL A;  2OAZ A;  2FA5 A;  5J8F A;  2HQR A;  2W24 A;  2QM3 A;  2M8E A;  2XAG A;  2Y75 A;  2VBY A;  4WWC A;  2P5L C;  4WF2 A;  4EMS A;  5HS8 A;  2OU2 A;  5FO5 A;  5LHH A;  3JTH A;  2QEN A;  3CUQ A;  3LWF A;  4EJU A;  2VBZ A;  4H0E A;  5CLS A;  1YO5 C;  3E6M A;  2A3S A;  1I1G A;  2DT5 A;  4XLP F;  4K2E A;  1FBU A;  4L0Z B;  3EYI A;  4CDG A;  5DYM A;  1SMT A;  1YW8 A;  3RTR A;  3JAM Z;  1KU2 A;  2RDP A;  2EWN A;  4B8X A;  1VTN C;  2G9W A;  2UXX A;  2WV0 A;  1QO0 D;  3H92 A;  3FXQ A;  1U5T B;  4PZJ A;  1KU9 A;  1IN8 A;  2HKX A;  1S3J A;  2M87 A;  1K78 B;  5CJ9 A;  1OR7 A;  5D5W B;  1RUO A;  3GFJ A;  3IKV A;  3C3W A;  4B09 A;  1WQ2 A;  2KIF A;  2X4H A;  3ZMU A;  2GWR A;  3GVA A;  1BC8 C;  2Y48 A;  2XUB A;  5KK1 A;  2M5W A;  1YQA A;  2JPC A;  1R5H A;  5DD8 A;  5JR3 A;  1WI9 A;  2ACJ A;  1Y0U A;  2H94 A;  2GQQ A;  5H6Q A;  5ICG A;  2P7V B;  2HTS A;  2PLY A;  4OMZ A;  1MDM A;  1P4A A;  2KKO A;  3DV8 A;  1QQI A;  4RGX A;  5BOX A;  2Q8K A;  2M45 A;  2FF4 A;  2CYY A;  1U78 A;  3MEX A;  3VOE A;  1I5Z A;  2PFB A;  1ZH5 A;  4HX7 A;  2BGC A;  2PJP A;  4ENK A;  2FQ3 A;  4P9F A;  1WRJ A;  1DDN A;  1IF1 A;  3EUH A;  3WTS C;  3ML6 A;  3U2R A;  1YW9 A;  4A0Z A;  3C1D A;  1UHW A;  1ZYR F;  3K1M A;  3KEO A;  1ZRE A;  2STW A;  4GCV A;  2DK5 A;  2LSO A;  4I2O A;  3V4G A;  4JQF A;  5F1R A;  5E1W A;  2DTR A;  3JSO A;  3DFG A;  3P9C A;  4XSX F;  2DI3 A;  1Z9C A;  2QBY A;  2KRF A;  3IRR A;  2GIV A;  2Z3Y A;  4UVB A;  1IXC A;  3WU1 B;  3WOD F;  3BZ6 A;  4TV7 A;  1QGP A;  1BI0 A;  1ZLK A;  4OIR F;  2XAH A;  1B6A A;  5E20 A;  1ZAR A;  1TLH B;  3I53 A;  1QNT A;  3WTT C;  2VE8 A;  4O6J A;  3F21 A;  3T0Y A;  1R1T A;  3R6S A;  5CYV A;  3K1P A;  1SD7 A;  2DO7 A;  4HOB A;  1W5S A;  3I59 A;  4CIC A;  4GO1 A;  1P6R A;  1WWX A;  2ZCW A;  2CWE A;  2O6G E;  3CUQ C;  1XCB A;  1B9M A;  4LB6 B;  3EET A;  3SHF A;  1ZLJ A;  1T2K A;  1JHH A;  3F6V A;  3TDZ C;  2QWW A;  3SZT A;  2KJC A;  2VOP A;  4ENM A;  2ESH A;  1ZRC A;  3WTU C;  3T1B A;  4KMU X;  2FMY A;  2R7D A;  2HGC A;  4KIC A;  4BQA A;  2IA1 A;  1XGN A;  2DBB A;  2XKO A;  3RDI A;  3CO7 C;  1YTY A;  3HRS A;  1MJ9 A;  1HQC A;  4PGH A;  5L3D A;  1HXD A;  1RNL A;  1IW7 F;  3ZMD A;  4KIB A;  3LA7 A;  2A68 F;  4LFU A;  5D8K B;  2DQR A;  2CSO A;  1ZGJ A;  3V8L A;  1F4K A;  3ZMV A;  4BH9 A;  2HDC A;  4G8X A;  1UHM A;  3IC7 A;  3MFK A;  1O7F A;  1KU3 A;  3N97 A;  1O3R A;  1MZB A;  5BPI A;  1W4M A;  3FMR A;  1FBS A;  2FML A;  4OIQ F;  4U7B A;  2PI0 A;  2O61 A;  4RGS A;  4PGG A;  4OU0 A;  1TW2 A;  3WU0 A;  3JAM K;  2V79 A;  3I58 A;  2KJB A;  5LEJ A;  5L3E A;  4IRI A;  1MGT A;  4EJT A;  3HIF A;  1QPM A;  2RC4 A;  5DDG A;  1PP7 U;  2QLZ A;  4L5J A;  1TW3 A;  2NS0 A;  4AVP A;  5JHU A;  1FP2 A;  4HW0 A;  1DPU A;  2QUF A;  3L2C A;  2O0Y A;  4NB5 A;  1H9T A;  3ZN0 A;  1I27 A;  2HWV A;  5LLQ A;  5ILU A;  3KE2 A;  3H3Z A;  1HKT A;  4QWQ A;  1HSJ A;  4A0Y A;  2Z5U A;  3MCZ A;  2D1H A;  1T38 A;  1P4W A;  4ON0 A;  2K4J A;  2DPD A;  5HS7 A;  1GVJ A;  1ZGA A;  1ZG5 A;  3FF5 A;  2HYG D;  4KYW A;  1CF7 A;  3BPX A;  3V7C A;  2OD5 A;  5DCM A;  2V1X A;  3TOA A;  6PAX A;  3BY6 A;  2K86 A;  3BPV A;  1JE8 A;  2W25 A;  3TDU C;  5AON A;  2B0L A;  2P5V A;  4Z2Y A;  3I0T A;  4WXC A;  1GXQ A;  2Z99 A;  1LNW A;  2ISZ A;  3M8F A;  3K9T A;  3F8B A;  3KP5 A;  1ZRD A;  1FSH A;  3J80 Z;  2MC3 A;  4N0B A;  2KIU A;  3Q5F A;  3DPL C;  4HLX A;  2PMH A;  4IXA A;  1ON2 A;  2H09 A;  4A5M A;  1H0M A;  5FD6 A;  1D3Y A;  4Q48 A;  4ZYG A;  5LGT A;  1J2X A;  3QOP A;  1MDM B;  3ROU A;  4R79 A;  1D8K A;  4A12 A;  4WXH A;  5EEG A;  4MHG A;  4RS8 A;  3V8K A;  3LA2 A;  3F8M A;  2FU4 A;  4G7H F;  3HRM A;  1FYK A;  5D4S A;  2HEO A;  1LEA A;  1XDS A;  5FD5 A;  2DU9 A;  2VC0 A;  1F1Z A;  1R5G A;  3CDH A;  2ISY A;  3GUD A;  2CW0 F;  2IVM A;  2Q0O A;  1UST A;  3H3U A;  4HX8 A;  3D0S A;  4N9I A;  2G7H A;  2LKP A;  4G7O F;  1ZN2 A;  1XMA A;  4CZZ A;  1FYL A;  3KET A;  1Z91 A;  1QBJ A;  2P6S A;  2A61 A;  3WTW C;  1ZG3 A;  3WGG A;  2PMU A;  3KP6 A;  1E2X A;  1RIO H;  2FRH A;  5L3G A;  1SAX A;  3DQV C;  3GFL A;  2IA2 A;  4KDP A;  2HS5 A;  2ADU A;  3WTX C;  3O3K A;  3LAJ A;  1LEB A;  5D4R A;  2FEZ A;  3KZY A;  3F3X A;  1Z7U A;  1SFU A;  2VXZ A;  4HF2 A;  2VT2 A;  1G3W A;  3LQR A;  2XAJ A;  3N4M A;  5IT9 Z;  3KLO A;  3B02 A;  2ZME B;  2RKH A;  4EM1 A;  2NYX A;  2ZFW A;  3M1E A;  3P9I A;  5BPD A;  1FY7 A;  1ZRF A;  3ZMZ A;  3SXY A;  2FOK A;  4R8H A;  5LEK A;  2VBX A;  4I01 A;  4KIG A;  5HDN A;  1XSX A;  1UCR A;  3BJA A;  4I09 A;  1I1S A;  4RGR A;  3HYI A;  4M72 A;  2O8X A;  3RYP A;  2DLL A;  2QQ9 A;  4G9Y A;  3HRT A;  1ON1 A;  4UVA A;  3V8J A;  4OOI A;  3ECH A;  1K79 A;  1J75 A;  1T0F A;  3D5L A;  5K5Q A;  1R36 A;  2FBH A;  3GFI A;  4RB1 A;  2CFX A;  4YG2 F;  5LRS A;  4A2U A;  2CQK A;  1L0O C;  5BQT A;  5L3F A;  2QVO A;  3V7S A;  4AIK A;  5DCM B;  3L00 A;  4XRF A;  5AIP A;  2EJR A;  3BJO A;  3HTS B;  3EQL F;  2YX4 A;  4D0P A;  2F5C A;  4EVI A;  5E1Z B;  1FX7 A;  2X0L A;  4P55 A;  2GAU A;  2QQB A;  2ZJ2 A;  5ED4 A;  1F9N A;  4UV9 A;  1S7O A;  4KN7 X;  5ICF A;  2UZK A;  2FBK A;  2A07 F;  5CVI A;  2RV8 A;  5FLX K;  3I71 A;  4GYI A;  1TNS A;  3PQJ A;  3QU6 A;  2AXL A;  2M1B A;  1IRF A;  1P92 A;  5A2Q Z;  1YLF A;  2F5D A;  2OQG A;  2TDX A;  1L3L A;  5L3C A;  1X3U A;  1BN5 A;  2E7W A;  4ENN A;  1J59 A;  1NHA A;  4AIJ A;  2UXN A;  3GFM A;  4S05 A;  3J7A O;  3FM5 A;  5K5O A;  4MTD A;  5J8C A;  3DP7 A;  4HYE A;  1REP C;  3K0L A;  4M73 A;  3REO A;  1Z6R A;  3ZP5 A;  1V3F A;  2Z9O A;  2BE5 F;  1FLI A;  3HTU A;  1JHF A;  3ZMS A;  3R0J A;  1XDU A;  1EH7 A;  1OKR A;  1SD6 A;  2IW5 A;  4EQQ A;  4M71 A;  1R00 A;  1HBX G;  1R22 A;  5DCF A;  2H6B A;  3FHZ A;  4G6D A;  1XGS A;  2E1C A;  2O3F A;  2GA2 A;  3T5X A;  2E1N A;  1IN6 A;  1FP1 D;  1XD7 A;  3R0A A;  4OMY A;  4EGZ A;  1BC7 C;  2FSW A;  4GXO A;  3GX4 X;  3F72 A;  1IUY A;  2VN2 A;  5FFZ A;  2AS5 F;  1U5T C;  2XVC A;  3L09 A;  3LFK A;  2K27 A;  3E3V A;  5H20 A;  3GWZ A;  1FYM A;  4MNU A;  2L01 A;  2ZME A;  1SFX A;  4RB0 A;  4FX4 A;  2ZNY A;  1KQ9 A;  3F8F A;  1V4R A;  5CVV A;  1O3S A;  4KA4 A;  2WC2 A;  4R1H A;  3GLX A;  1D8J A;  3CUQ B;  5CVR A;  4YII A;  4L5I A;  3EYY A;  4WX9 A;  4A6D A;  3JTG A;  1IRG A;  5D5U B;  1MD0 A;  2RN7 A;  2P7C B;  4RB2 C;  4A5N A;  1ZG1 A;  4Y15 A;  2E7X A;  3CLO A;  3KCC A;  3MQ0 A;  4I02 A;  5CVU A;  4M6Y A;  4DQ2 A;  3QAH A;  4O5V A;  5E17 F;  3M8E A;  4LB5 A;  4LLN A;  5HLH A;  1OPC A;  2DK8 A;  1R1U A;  2J5O A;  1W7P B;  1ZHF A;  4CYD A;  2ETH A;  3QPT A;  2EFO A;  2K4B A;  4ESF A;  4BNC A;  4UNO A;  1EH8 A;  2NAZ A;  4LJZ F;  3T8R A;  4WK8 F;  4E70 A;  3J81 Z;  4UV8 A;  4OIP F;  4IHT A;  1IXR C;  4HZF A;  4ESB A;  4ZZD A;  4FX0 A;  3Q9S A;  2EA4 A;  4UXN A;  4KIF A;  3TGN A;  2XRO A;  4RGU A;  4HQM A;  2YX7 A;  2UWM A;  4HAM A;  1HKS A;  4O3M A;  3BWG A;  4LG0 B;  1G3S A;  1J7K A;  1USS A;  1HST A;  1Z05 A;  1G3T A;  4L0Y B;  1IAW A;  1P4X A;  2EB7 A;  1ODD A;  1KU7 A;  1FC3 A;  1FBQ A;  1GHC A;  3P9K A;  1XSD A;  2EA2 A;  1LVA A;  5A2Q K;  5DD4 A;  3RKW A;  2L4M A;  2K7L A;  5DUI A;  1HKQ A;  1SD5 A;  2FNA A;  2ESN A;  1U3E M;  4ZYD A;  2WTE A;  5LHI A;  1YS6 A;  2MBF A;  1O3Q A;  5ERI A;  3KP7 A;  3GW2 A;  1QZZ A;  3R60 A;  1IZ1 A;  2MH2 A;  2XAQ A;  1A04 A;  4KT5 C;  1BI1 A;  3I4P A;  4HV5 A;  4BYY A;  2BYV E;  4YFN F;  4P9U A;  2JT1 A;  3HOT A;  3ZPL A;  1TBX A;  4BXU A;  3TO9 A;  5HVQ C;  4L18 B;  3RPU A;  2GZW A;  2PBI A;  3FZV A;  1YYV A;  1GXP A;  3E6D A;  1UFM A;  1FT9 A;  3TOB A;  3GXO A;  2JTV A;  4DNC A;  3L7W A;  1YW7 A;  5E8I A;  3KZZ A;  3HHH A;  4YFK F;  3K1N A;  2BBY A;  2HFH A;  5FFX A;  2F2E A;  4WCG A;  3E6C C;  1RZ4 A;  3MZY A;  4MGR A;  4XBF A;  1OYI A;  3VOD A;  4Q5S F;  4IVN A;  1MKM A;  2Y0M A;  1AOY A;  3WTY C;  3NQO A;  2ELH A;  4FT8 A;  2H27 A;  1B1B A;  5E8G A;  1BM9 A;  1G6N A;  3ULQ B;  1RUN A;  4PDK A;  2OZU A;  1OYW A;  3O2P E;  1U5T A;  2HQN A;  5L3B A;  2BEO A;  1FSE A;  1FOK A;  4P96 A;  4XLN F;  2HOE A;  1FWZ A;  2VBW A;  1FZP B;  3JSP A;  3I64 A;  4Q4Z F;  5BS6 A;  5D5X B;  4EJV A;  2EK5 A;  3Q9V A;  1XGO A;  3I5U A;  2W84 A;  4L9T A;  2EFP A;  1EV7 A;  3IRQ A;  5LRR A;  2GA1 A;  3HRU A;  1XMK A;  3HSF A;  4YFX F;  2LF7 A;  1G3Y A;  3COA C;  1R7J A;  1BIA A;  2HZT A;  4OIN F;  1O57 A;  3TKY A;  3JW4 A;  1H9G A;  3OOP A;  2YU3 A;  3NEU A;  4L9V A;  1J5Y A;  2FBI A;  3QRF F;  3RIR A;  3K2Z A;  4LMY A;  2DFI A;  2EFQ A;  3IKT A;  3FM3 A;  3GO5 A;  2DAO A;  2IP2 A;  3WTZ A;  2FE3 A;  4RB3 C;  5CVJ A;  4ETS A;  4MTE A;  3FXR A;  2XRN A;  3W6K B;  5HLI A;  3M9A A;  3M7G A;  5HOO A;  1BI3 A;  3BP8 A;  5LGN A;  3VB2 A;  3IWF A;  3LA3 A;  1LDK B;  3R4K A;  4EJO A;  4I0A A;  3F6O A;  3J81 K;  3F23 A;  4FHT A;  2NNN A;  3TQN A;  4LLG F;  1YG2 A;  2VOD A;  3CTA A;  3RPQ A;  5HLG A;  1TQP A;  1K78 A;  2XKP A;  2BV6 A;  2CGP A;  1W5T A;  3HSR A;  1BBY A;  3FMS A;  5JVT A;  4BHB A;  2CO5 A;  2C6Y A;  1RI7 A;  3CO6 C;  2OA4 A;  2RVC A;  1SMY F;  1JGS A;  5JFR A;  1KQ0 A;  3E6B A;  1T39 A;  3U1D A;  1ONV A;  4ENJ A;  1YS7 A;  1K6O A;  1IN7 A;  1FNN A;  3ECO A;  2D2W A;  1WSU A;  3IWZ A;  3WE2 A;  1S7A A;  4ZYH A;  3HOS A;  1B9N A;  4HF0 A;  2VON A;  2QQA A;  2RGV A;  3KLN A;  3ISP A;  4I0B A;  2A6H F;  4IF4 A;  2GXB A;  1XCV A;  5F6F A;  5IT9 K;  4AIH A;  4GGG A;  3QP6 A;  1KA8 A;  3WG9 A;  1P2F A;  4IJA A;  5E18 F;  2VOO A;  2LF8 A;  1DPR A;  3BOQ A;  2MH9 A;  1AWC A;  2HTJ A;  4S04 A;  5K1Y A;  3TO6 A;  2IA0 A;  1OYY A;  3I59 B;  2EFW A;  1YIO A;  1U8R A;  1LJ9 A;  4JBA A;  4M6X A;  4HF1 A;  1YFH A;  2D1V A;  2EV6 A;  5BMZ A;  4ZH4 F;  3ZMT A;  3QPH A;  1B4A A;  3F22 A;  2A6E F;  2ZXJ A;  4MQ9 F;  1J9I A;  3MAJ A;  5HS9 A;  4ESJ A;  4GYG A;  3RKY A;  4G7Z F;  2IJL A;  5KVR A;  1HW5 A;  5ICC A;  4U0Y A;  2A69 F;  1I6X A;  2L02 A;  5H6R A;  3F8N A;  5J6X A;  1R1V A;  2F5E A;  3KP3 A;  4LGW A;  4M74 A;  2V1U A;  2COM A;  3U9G A;  2V6C A;  3DEU A;  3KP2 A;  1HW2 A;  5D5V B;  2EFN A;  1W7P D;  1XN7 A;  1E17 A;  4AD9 A;  4BAY A;  4WXD A;  1B59 A;  4CHU A;  3WGI A;  2L54 A;  3K69 A;  4BHC A;  1T6S A;  4IHS A;  5DV5 A;  2Q2E A;  4MQV A;  3ZN1 A;  4N9H A;  4G94 A;  3PFI A;  2H6C A;  2QYO A;  3KFW X;  2MLG A;  2JZY A;  1TNT A;  2PEX A;  4YIF A;  4G6Q A;  2XV4 S;  4IRG A;  4Q47 A;  2P8T A;  3CJN A;  2VC1 A;  3ABT A;  4PCQ A;  5E1X A;  4RAY A;  4Y17 A;  4U7D A;  1ULY A;  4M9Z A;  3E5U A;  2ZKZ A;  2WWY A;  1TTY A;  1C0W A;  1Z1D A;  1PDN C;  2P4W A;  4HA8 A;  1D5V A;  4IPA A;  4RAZ A;  4EM0 B;  1MJB A;  5JI6 A;  4U0W A;  3IL2 A;  2MD5 A;  2PQ8 A;  4HV6 A;  3KEQ A;  4XSZ F;  3ABU A;  1Q1H A;  3C18 A;  3VFZ A;  2LDU A;  4HBL A;  5TRD A;  1U2W A;  1F5T A;  3FMQ A;  2QBY B;  1XB4 A;  1O7L A;  4L9J A;  4UVC A;  5LHG A;  2J5P A;  4LK1 F;  4P5O A;  1STZ A;  2R3S A;  3C7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...