2CQKA

Solution structure of the la domain of c-mpl binding protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GSSGSSGAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-Mpl binding protein
publication title Solution structure of the La domain of c-Mpl binding protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cqkA00
1BM9A 4ENNA 2EV5A 1I1SA 2OQRA 3W6KB 1MD0A 2DQRA 2ESHA 4UV9A 1ON2A 5BPIA 3FMSA 4MTDA 4IHTA 1HKTA 5JHUA 2RC4A 4GGGA 4UVCA 1BJAA 1I5ZA 5TJJA 4HQMA 1IN6A 4FX0A 1WQ2A 2ISYA 1K7AA 2XAFA 3V7RA 3KP5A 2GXBA 1XMKA 3JTGA 4NQWA 3HUGA 1D5VA 1RUNA 5CJ9A 2IRFG 3F8MA 2A68F 5J8CA 3WE2A 2M8EA 2GA2A 2JPBA 3T0YA 4RS8A 1IN7A 2G7HA 3GFJA 2ZNZA 2L4AA 5ERIA 1JHHA 3V8JA 1ZREA 1UHMA 1KYWA 3DV8A 4UVAA 1OYIA 3PFIA 3P9KA 2ZCWA 3R61A 2WWYA 4R79A 3LSTA 4HX8A 1KQ8A 3BZ6A 5LLQA 4OOIA 1BI0A 2G7UA 1LVAA 4N9HA 1J0RA 1V4RA 2A61A 1FY7A 1I6XA 1DUXC 4HQEA 4LMYA 2JT1A 4U88A 1XSVA 4L5IA 5LEJA 3V8KA 3MFKA 1H0MA 2FSWA 2HYFA 3LWFA 3DXJF 5DUIA 2QQAA 3FMQA 2V1UA 3T1BA 2KIMA 1XD7A 2F5EA 5FB2A 4LD5A 1HSTA 1GXPA 5AIPA 2WTEA 2MLKA 4R1HA 3O2PE 3FXRA 4M9SA 1AOYA 2FNPA 3ZN1A 4KMUX 1FT9A 1IXCA 2LDUA 3RKXA 3MQ0A 3TGNA 3EUHA 5HLIA 2L4MA 1U2WA 1FLIA 4EJOA 2K4BA 4KFCA 3SFZA 5JVTA 1IAWA 3ZP5A 2FOKA 2RVCA 4I02A 4OMZA 4XRFA 2V6CA 2PN6A 1WI9A 2VT2A 2EA2A 4RB2C 5L3CA 1QGPA 2AXLA 2CYYA 1TW3A 3TOAA 3GFIA 4ZYEA 4HZFA 1XMAA 4FHTA 3M7GA 2FEZA 2BEOA 1S29A 5E1WA 4OMYA 2ZNYA 2R7DA 4ESBA 2FA5A 1OYYA 4EGZA 1S7AA 3HSFA 4ZYGA 4YFXF 4HX7A 5IT3A 4G7HF 3LA2A 2XKOA 2BGCA 1HKQA 2QZ8A 3HTUA 5F6FA 3EDPA 4IHSA 4P96A 2BBYA 1WSUA 3HRTA 1O3TA 3O3KA 4NHJA 2P4WA 1GVJA 1Z7UA 1S6LA 4U0WA 4MQVA 4KDPA 5ILVA 4MQ9F 3FM5A 2Q2EA 5H6RA 2OZ6A 4LLNA 2STTA 2HOEA 4PDKA 5F64A 4S05A 3BROA 4XLPF 5FLXK 5J6XA 2FU4A 4IF4A 1LEAA 1U5TB 2VC1A 3EQLF 4HLXA 2FBHA 4HF1A 1YW9A 2JRTA 2VBZA 3ECOA 1J5YA 4B09A 2XKPA 1X3UA 2E1NA 4EVIA 3FX3A 2PLYA 1ZYRF 3IWFA 4EJVA 3B73A 1IN5A 5J8FA 1FBSA 1P4XA 1T2KA 2YX4A 2MC3A 2ADUA 3ECHA 1LNWA 3HSRA 2HZTA 3R60A 1Z1DA 1XGOA 4P5OA 4RGSA 2VBYA 3NEUA 5FFXA 2RN7A 4MTEA 3GFLA 3JAMK 1TW2A 3WTWC 3LQRA 1SFUA 2MD5A 2O03A 4M73A 1R1VA 3MZYA 4L0ZB 4YG2F 1BC8C 2J5PA 5EEHA 4PZJA 5D4RA 4IRHA 5DCMB 1SMYF 4AIHA 1B9MA 4M6YA 4EGYA 1MDMA 3L00A 4RB1A 4AIJA 3ERED 1ZG1A 2EA4A 5K5OA 3V8LA 4RAYA 2CW0F 2AS5F 4QLCU 4WWCA 1XGNA 1SD7A 4A6EA 2TDXA 5BMZA 2W57A 3DFGA 5H20A 4MHGA 1KU9A 1SD6A 3DQVC 1ZH5A 4A6DA 3ABTA 2HTSA 2OU2A 4OU0A 5K5RA 4EMSA 2DQLA 5LHGA 1YO5C 2PI0A 4P9FA 4XBFA 1U5TC 3LAPA 2Q8KA 1G3TA 3HOTA 4WXCA 3DPLC 1LDJA 3SZTA 1RZ4A 2PJPA 3KP7A 1QO0D 3REOA 3MCZA 5CVJA 4HF0A 1Z6TA 2LF7A 2W84A 1DPRA 4IPAA 3VB2A 2Z5UA 4CO8A 5DD4A 2R3SA 1U5TA 3CUQB 3HRSA 1HW5A 5CLSA 2OQGA 1QBJA 1MJAA 2QBYB 2XIGA 2KJBA 2Z3YA 3QRFF 3WTVC 1SD5A 3WTYC 2DBBA 5LGUA 1XSDA 1I1GA 5K1YA 3KEOA 4GXOA 1XCVA 1O7FA 3DPTA 5HDKA 2Q0OA 5DDGA 3CDHA 2E1CA 2ELHA 4CDGA 2B0LA 4G6QA 1E2XA 4MGRA 3KLNA 1I27A 4LK1F 4BHPA 1XCBA 3DEUA 2GAUA 1KYZA 1XN7A 3FMRA 2JTVA 4EM0B 2A69F 5D5WB 3NQOA 4U7DA 5BPDA 1LDKB 2IT0A 5IT9Z 1R1TA 1EH7A 5BS6A 4KA4A 5D4SA 2DT5A 5DCMA 3J81Z 3K69A 1XSXA 4YFKF 3I71A 2NAZA 1OMIA 4N9IA 4ZZDA 3VEPA 4ENJA 2QM3A 3TOBA 4YFNF 2VXZA 3G73A 1JHFA 3LA3A 3WGGA 3TDZC 1T38A 2A07F 1GXQA 3K0LA 1R5GA 3GW2A 3I4PA 3GF2A 1QPMA 3K1MA 1FP2A 1OKRA 2DK8A 4AVPA 1DDNA 1FSHA 2ZO4A 4OIOF 2XAHA 4GCVA 2YU3A 3HIFA 3R0JA 3E5UA 2DU9A 3OV8A 3O6BB 1PUEE 4G94A 2VODA 3IHUA 3M8FA 3SHFA 2KRFA 3P7NA 2CWEA 1ZG3A 3H3UA 2F5FA 4Z2YA 3GX4X 4G8XA 3GXOA 2PEXA 2ISZA 1UHWA 3WTSC 4I01A 3Q5FA 5HS8A 1J9IA 4I2OA 2HYGD 3H3ZA 3E5QA 3I58A 1Z6RA 3KEQA 2VOOA 1STZA 3CUQA 3V7CA 4KNYA 5FD6A 2V79A 3ZMDA 1RI7A 4P9UA 2DPDA 1MKMA 4JBAA 5HDNA 2QBYA 2H27A 1JGSA 2XAQA 2CQKA 2KKOA 4M6XA 5ILUA 2CFXA 2XHKA 3JTHA 2QQ9A 1FWZA 3RPUA 3KETA 4IRGA 2D1HA 3FXQA 2K4JA 2LF8A 3N4MA 1IF1A 4AIKA 3IWZA 4BH9A 1BC7C 4ESFA 3KP2A 2LKPA 5L3EA 1FP1D 2EJRA 3U1DA 3I5UA 4U0VA 2Z99A 2QUFA 4IXAA 2EV0A 1G3WA 3BWGA 3MAJA 4KIBA 2V1XA 4A5NA 2MH9A 1LEBA 3U9GA 1TQPA 2HKOA 1J7KA 1JXSA 1S3JA 2EWNA 3HRUA 5FGMA 3LQQA 2MBFA 2L01A 1SFEA 1QZZA 3T8RA 2STWA 3TO9A 1R7JA 4LLGF 1BI3A 1HSJA 3LA7A 1XB4A 1G4DA 3F72A 5LBQA 1MDMB 5LEKA 2KJCA 3QP6A 3L09A 4EJWA 2M45A 1ZLKA 1FBQA 4A0YA 3FWEA 4IRIA 1IN4A 2DAOA 3ABUA 1JE8A 4M72A 3ZMVA 3WGHA 4RAZA 2M1BA 2EFWA 2JPCA 3FHZA 1TLHB 4HLYA 1FX7A 2MA3A 2O8XA 2NS0A 5K5QA 2XAGA 4WX9A 3E6CC 1D8JA 5D8KB 2P5VA 4EJTA 4GO1A 5LRRA 4MEYF 2O6GE 4BQAA 5E1ZB 3KP4A 2HWVA 2P6SA 3ZMSA 1REPC 3RKWA 4A5MA 3HOSA 3KFWX 4N0BA 3KE2A 3WTZA 3NRVA 5ICGA 5HVQC 4M9ZA 2CGPA 3VOEA 4M9XA 5D6FA 5A2QK 1IUYA 1OYWA 1FSEA 3WODF 3J7AO 2NYXA 1R1UA 5FLXZ 3I0TA 3BDDA 2HQNA 1EH6A 4PGHA 3G3ZA 1J75A 1T0FA 5DUKA 4DQ2A 2LSOA 5A2QZ 3QPTA 1W7PD 2HEOA 1S7OA 3PQKA 3IRRA 1XDUA 2OZUA 6PAXA 4KICA 4L18B 3KCCA 1Z9CA 4Y15A 1EV7A 3HHHA 1CGPA 1J59A 4FX4A 1P2FA 4S04A 1Y0UA 2P8TA 1Z05A 3ZN0A 2HKXA 5FO5A 2FBKA 3BPXA 3RDIA 4XSXF 4KUMA 2FBIA 2BYVE 1F1ZA 4G7ZF 2DO7A 3FM3A 1F5TA 2P6TA 2MH2A 3DP7A 1QQIA 1R58A 1UB9A 4EM2A 4HDVA 1LQ1A 3CO7C 4U0YA 1WKMA 2PBIA 3JAMZ 1PP7U 1MJ9A 4HX4A 3R6SA 5L3FA 5L3DA 4IVNA 1BI1A 2QWWA 3I54A 3D5LA 4RGUA 2KIFA 1R5HA 3F8CA 2M5WA 2V1DA 3SZPA 3WTXC 4BHCA 1KGSA 5E18F 4M74A 1IXRC 3ULQB 4H0EA 2QVOA 3DF8A 1O57A 2GXGA 2D1VA 2L02A 4BAYA 1KQ9A 3IKTA 1R36A 4ENMA 5H6QA 3GLXA 2A5YB 2O61A 2F5CA 1KA8A 3GEZA 2M87A 4CHUA 3QP5A 1ODDA 3CTAA 2RNJA 2HQRA 4LG0B 1HBXG 4ASNA 1OPCA 2DW4A 1IN8A 2KIUA 1ONVA 1LJ9A 3WU0A 2XRNA 2DTRA 3HHGA 1RUOA 4I7HA 1IXSB 1QZYA 1USSA 4CXFA 3V4GA 3FXUA 2ZJ2A 3J80K 1FYLA 2O3FA 2UXNA 3TO6A 1HW1A 5E20A 1G3YA 2P7VB 2Z33A 5JFRA 3QOPA 5CVIA 3SXYA 2RV8A 1ZHFA 1YS6A 3W6JB 4UUVA 4I0AA 5DCFA 5CYVA 1O3RA 3MWMA 1R22A 4PGGA 1ZG5A 5BQTA 4ENKA 3VODA 4MEXF 1ZGAA 1UFMA 1O3QA 2F2EA 2EV6A 3KP3A 4PCQA 3RIRA 2RQPA 4F7ZA 4L9VA 5HLHA 5D6EA 4UHTA 4XSZF 4HBLA 5HDGA 1ZRFA 3E5XA 3F8NA 4JK1X 2M30A 4CYDA 1UCRA 2VBWA 3RPQA 2H94A 1DP7P 4LFUA 1QNTA 2FQ3A 1ZARA 5FD5A 2HFHA 1J2XA 2H09A 4EJUA 5ICCA 1P92A 1USTA 4HOBA 3RTRA 1K78B 3F22A 2VE9A 5CVRA 2V9VA 4CICA 4CZZA 4LK0F 2K7LA 1PP8F 3ZMUA 2K02A 3R4KA 2E7WA 1P4AA 2ZFWA 4AD9A 3PQJA 2IA0A 4XLNF 4Q5SF 1FPQA 1W5SA 4UNOA 1FZPB 3QU3A 3M9AA 5DEQA 4L9NA 2QYOA 1XDSA 4O6JA 1YG2A 1BIAA 3GUDA 1VTNC 1YW8A 3WE3A 2HR3A 4Q48A 4YIFA 2XASA 3L9FA 5D5UB 4LB5A 2G9WA 4LG0A 4I98B 5LGNA 3WGIA 3CUQC 3M1EA 2BE5F 2WC2A 1RIOH 1K79A 1D8KA 2QLZA 4RB3C 1SFXA 1D3YA 3BY6A 3GYHX 3QPHA 2CSOA 4L5JA 5E8IA 4ZYDA 1P6RA 3I64A 1ZRCA 4CGZA 4Y13A 1B4AA 2K86A 1H9GA 2YPRA 1IRGA 3CJNA 1L3LA 4UVBA 3F6OA 1TQMA 1BIBA 3AAFA 3QAHA 3WTUC 1U6GA 2Z9OA 1HW2A 4GYGA 1P4WA 3FF5A 3KZYA 1TBXA 2PMUA 4WXDA 1KU2A 4LLLA 5E1XA 2JZYA 2RDPA 3RJPA 3SQNA 3RKYA 4A12A 2VE8A 5D8LB 4I09A 3M8EA 2WV0A 4A0XA 3MZHA 2FRHA 4EQQA 3F21A 2F5DA 2FNAA 4G7OF 2LNBA 1PDNC 3F8FA 1YFHA 2PQ8A 1MJBA 3IKVA 2L54A 3MEXA 3HTSB 3GFMA 2DK5A 4BYYA 3ZMTA 3K1PA 2IVMA 1A04A 3ML6A 3GZ6A 1B9NA 1FNNA 1YS7A 3JSPA 2H6CA 2XUBA 2YX7A 1R00A 4Q4ZF 3CUOA 4B8XA 1K78A 5EEGA 4JQFA 4ETSA 2EFPA 1ZRDA 1XGSA 2OBPA 5FFZA 2ETHA 3ZQ7A 1LB2A 1CF7B 1BBYA 5HLGA 4K2EA 3RYPA 2VBXA 2IA2A 1BOAA 2D45A 3TO7A 3ELKA 1MGTA 4WF2A 3GWZA 1KU7A 1R23A 3WTTC 3T8TA 4P55A 4KMFA 2VC0A 2MLGA 2A6HF 2UZKA 4ZH4F 5L3GA 1BI2A 4Q47A 1U3EM 2EFNA 5D5VB 4OIRF 2EK5A 2GZWA 2P7CB 4HV5A 3OOPA 2PMHA 3V7SA 2FXAA 1FBUA 3HSEA 4KYWA 2UWMA 4OINF 2GQQA 4OIPF 2VONA 3LFKA 1W7PB 1WRJA 4HV6A 3ROUA 3ZPLA 4AWXB 1DPUA 1TTYA 2EFOA 3QU6A 1SD4A 2GWRA 4HA8A 2ACJA 3E6BA 3JSOA 1KQ0A 4MNUA 3BOQA 3L7WA 4L9JA 3KLOA 5HS9A 3IRQA 2P5KA 2ZKZA 2E7XA 4R8HA 2DPUA 1HKSA 4UV8A 2D2WA 3I59B 3E97A 1L0OC 3R0AA 2HGCA 4ZZLA 1YYVA 2HS5A 3BP8A 1TQIA 2X4HA 1G3SA 3S2WA 2A3SA 5DYMA 5AIQA 1GHCA 1SMTA 3DKWA 2Y75A 2CO5A 2FMYA 3F6VA 4D0PA 5LGTA 5BOXA 2BV6A 1EH8A 3RYRA 2DI3A 1B1BA 1XGMA 3BJOA 4A0ZA 5TRDA 5HS7A 1T39A 2RKHA 1IZ1A 2A6EF 2W25A 3F3XA 5D5XB 4I0BA 1U8RA 1YIOA 3BJ6A 1FC3A 1O3SA 2IPQX 4YIIA 1YLFA 4RGXA 4LB6B 2ZMEB 1CF7A 2Y0MA 4KIGA 2X0LA 1MZBA 2NRAC 4BNCA 5LHIA 4U7BA 2XROA 1WWXA 3F23A 2XV4S 3EETA 2ZBKA 5KVRA 1W4MA 2OD5A 3IL2A 3KP6A 1YW7A 2IP2A 1KU3A 2ESNA 4G6DA 2YR2A 4RB0A 2FE3A 4QWQA 2OAZA 4ZYHA 2PG4A 3C7JA 3K2ZA 5F1RA 1IW7F 2L3DA 4E70A 4BXUA 1NHAA 1O7LA 2YSRA 4O5VA 3COAC 5DD8A 3VFZA 4L9TA 3K9TA 2NNYA 3EYIA 1HQCA 4TV7A 2UXXA 1IRFA 1W5TA 1OR7A 3Q9SA 5ILSA 1W7PA 1U78A 3BPVA 4EV0A 3HYIA 3K1NA 5DV5A 4HAMA 4O3MA 3C1DA 3TQNA 2XGXA 3FZVA 2IA1A 4HF2A 1FOKA 1ULYA 2JSCA 4LJZF 3U2RA 3E6MA 4DNCA 1E17A 1V3FA 3N97A 3I59A 3KZZA 1ZLJA 4HW0A 1TNTA 1SAXA 3TKYA 1S8NA 2DFIA 2RGVA 2VT3A 5ICEA 1Q1HA 1RNLA 2EB7A 4NB5A 1HXDA 2CG4A 1Z91A 2IJLA 3HRMA 4A2UA 3T5XA 3Q9VA 5JI6A 1K6OA 2GIVA 2W85A 2QQBA 3IC7A 2IW5A 1AWCA 1B6AA 1TNSA 4M71A 4KIFA 2R7FA 1C0WA 4ESJA 3J80Z 4BHBA 2HTJA 5KK1A 3BJAA 4IJAA 4OIQF 3E3VA 3E6DA 2VN2A 4EM1A 5E17F 1T6SA 1LDDA 5LRSA 5CVVA 2C6YA 1T98A 3C18A 2FF4A 4LGWA 1H9TA 1ZN2A 2ZMEA 4HDUA 3GO5A 2DLLA 2VOPA 4G9YA 1ON1A 2FMLA 1ZGJA 5JR3A 5HOOA 5AONA 3WU1B 2COMA 3P9IA 1FYMA 1FYKA 5IT9K 4UXNA 3CO6C 1G6NA 2PFBA 3JW4A 3J81K 3H92A 4WK8F 2OA4A 3TDUC 2XVCA 4GYIA 4ON0A 3LAJA 4KN7X 3I53A 3F8BA 2Y48A 4WXHA 3B02A 2EFQA 2GA1A 2O0YA 2H6BA 2K27A 1F4KA 3CLOA 4HYEA 5CVUA 2NNNA 2XAJA 4FT8A 2J5OA 3C3WA 5ED4A 2HDCA 3ISPA 3L2CA 2P5LC 5E8GA 1YQAA 5LHHA 3GVAA 3RI4A 4Y17A 3D0SA 4KT5C 1YTYA 3ZMZA 4RGRA 4L0YB 3GZ5A 4KN4X 1F9NA 2W24A 2ZXJA 3P9CA 4WCGA 3WG9A 2QENA 5ICFA 1BN5A 1B59A 5L3BA 1ZAOA 3EYYA
chains in the Genus database with same CATH superfamily
1BM9A 4B43A 4ENNA 3HM5A 4CYCB 3A0BC 2EV5A 5C3EJ 2NVYJ 1I1SA 1D1CA 2OQRA 3LL7A 3W6KB 1MD0A 2COBA 2DQRA 1WJCA 3H5AA 2ESHA 1IRXA 4UV9A 2DFFA 1ON2A 1ACIA 1SFKA 5BPIA 3FMSA 4MTDA 1XX5A 1I3AA 4IHTA 1HKTA 5JHUA 3DBRB 2L9NA 4B47A 2RC4A 4GGGA 4UVCA 1MBHA 3DWLE 4A3FJ 1BJAA 1I5ZA 2ZSHB 5TJJA 5FKKA 5F08A 2MD0A 4HQMA 2EPFA 1IN6A 5HODA 4FX0A 1WQ2A 2M7AA 5EZGA 2ISYA 3OWTA 3BR2A 1K7AA 2XAFA 3V7RA 3KP5A 3CDIA 2GXBA 3AG1H 5B5EC 4AM3A 1NTCA 1XMKA 3JTGA 4NQWA 3ZQGA 3HUGA 1X1DA 3QWLA 2DT7B 2X6YA 4UB8C 1D5VA 3MKWB 2VB6A 1QA6A 1RUNA 1VFCA 3TW7A 2DA3A 2M0MA 5CJ9A 2IRFG 3F8MA 4DOZA 4PJMA 3OIQA 2DA7A 1UMQA 2A68F 2LKXA 5J8CA 2L7MP 2HVRA 4A69C 3WE2A 1ETOA 2M8EA 2GA2A 3A01A 2JPBA 3T0YA 2VJ4A 4C3IJ 4GRIA 4RS8A 1IN7A 2ICWG 1TWGJ 4XRSG 2G7HA 2HQAA 3GFJA 5J1UA 3BR5A 3QODA 4XN3A 2ZNZA 2L4AA 5ERIA 3AFHA 1JHHA 2ECCA 2QKMB 2Q2EB 5M5YJ 4NUBA 3V8JA 2PX9A 4QIWN 3WG7H 2VL8A 1ZREA 1UHMA 1KYWA 3DV8A 4IZZA 4UVAA 1OYIA 2LP0A 3PFIA 4FQGA 3DKXA 2VI6A 3A0HC 3P9KA 4XONA 4BJ5C 3A02A 2XSDC 2ZCWA 3BG7A 3R61A 2WWYA 1HDDC 4R79A 5C4JJ 4BU2A 3LSTA 4HX8A 2DTZA 4BY7J 1KQ8A 3RZDJ 2LREA 3BZ6A 5LLQA 4A3KJ 3D5SC 4OOIA 1BI0A 1QRYA 3PFYA 2G7UA 1LVAA 1LKXA 2DA4A 4N9HA 3OY9A 1J0RA 1S72I 1V4RA 2A61A 2BXYA 3CP8A 1FY7A 1I6XA 1DUXC 1X1CA 4HQEA 4LMYA 2IEKA 2DDAA 2JT1A 4U88A 4XL9A 1XSVA 2AO9A 4L5IA 5LEJA 3V8KA 3MFKA 1H0MA 2FSWA 1QPIA 2HYFA 5GPCA 3LWFA 2NS8A 1MBFA 2JA2A 3DXJF 5DUIA 3HC7A 2QQAA 3DTIA 5H2FC 2DOFA 3FMQA 3TP3A 2V1UA 3T1BA 2KIMA 1XD7A 2F5EA 4I76A 4MO7A 4MIMA 4LD5A 1HSTA 5FB2A 1GXPA 5AIPA 2WTEA 2MLKA 1VQLI 4R1HA 3O2PE 2ZXIA 2L9VA 5FLMJ 4LIUA 2K9LA 3FXRA 4M9SA 1G2HA 1AOYA 1MMGA 2FNPA 3ZN1A 4KMUX 2KZGA 4PJLA 5IY5H 1FT9A 1E3HA 1IXCA 2LDUA 3RKXA 4E7JA 1HC8A 2JRMA 3MQ0A 3TGNA 3EUHA 4C2TA 5HLIA 2L4MA 2E2IJ 1FOXA 3C2GA 1U2WA 1JKOC 1FLIA 4EJOA 2JA7J 1FTTA 2DN0A 3G4SI 2K4BA 1VQMI 1VQ6I 4KFCA 3SFZA 5JVTA 1IAWA 2GBYA 4F52A 3ZP5A 2Y9ZA 2FOKA 4ZDLA 1MNMC 2RVCA 4I02A 3BR0A 4OMZA 4IO9F 4XRFA 2V26A 1NG7A 3BG6A 1HA8A 1R49A 2V6CA 1T8IA 4P1WA 2PN6A 1WI9A 4A3GJ 5TGTA 2VT2A 2EA2A 1QVUA 5L3CA 4RB2C 1ETYA 1QGPA 4CYCA 2AXLA 2CYYA 2NS7A 1TW3A 3DTEA 4IL6C 3TOAA 1XC5A 3GFIA 4ZYEA 4HZFA 4ZTFA 3IH2A 1XMAA 4FHTA 1VQNI 3M7GA 2FEZA 2BEOA 2NOJB 1S29A 5E1WA 4OMYA 2ZNYA 2F48A 2R7DA 4ESBA 1NH3A 2OCCH 1MMAA 2FA5A 1OYYA 1Y39A 3SDGA 2ZXWH 3J7YJ 4EGZA 1S7AA 3M3YJ 3K4BA 2DYSH 3HSFA 4ZYGA 3KYDB 4V2GA 4YFXF 1W1WE 4HX7A 5IT3A 1JUSA 3I55I 1POGA 2MGQA 4G7HF 3LA2A 2XKOA 2BGCA 1UAAA 2AQEA 2HXIA 4NBQA 1HKQA 2NXNB 2QZ8A 3HTUA 2LYCA 3I4NJ 4BE0A 5F6FA 3EDPA 4IHSA 2WAEA 1TT0A 4P96A 2BBYA 1WSUA 3TEDA 3HRTA 2WY7Q 1O3TA 3O3KA 1TWHJ 4NHJA 1S7EA 2P4WA 3MKYB 1GVJA 1Z7UA 1S6LA 1X4OA 4U0WA 5IOZA 2VJJA 3DU6A 2EINH 1ITYA 4MQVA 4FASD 2DJNA 3GTJJ 4KDPA 5ILVA 4MQ9F 3FM5A 1YE9A 2Q2EA 5H6RA 2OZ6A 5JLXA 1RKTA 4LLNA 2STTA 3OR2C 1W5CC 2HOEA 2HOTA 4PDKA 4H4KC 2ECBA 5F64A 4S05A 3BROA 4XLPF 5FLXK 5J6XA 2FU4A 3HDDA 2OV7A 4IF4A 1K4SA 1LEAA 1XTAA 1TT5B 1U5TB 2VC1A 2LK2A 2Q1ZB 4XKVA 2ZC2A 3EQLF 4HLXA 2FBHA 4HF1A 1YW9A 2JRTA 2VBZA 3ECOA 1WJ5A 1J5YA 1YIJI 4B09A 2XKPA 4S0HB 3S3MA 1NG6A 3L1PA 1X3UA 2E1NA 2MFZA 3FX3A 1GVDA 1ZYRF 2V9KA 4EVIA 2PLYA 2EZIA 2VQHA 3IWFA 4EJVA 2BVMA 2WB1N 3B73A 1IN5A 3L2QA 1DU6A 4Y33A 5J8FA 1R71A 3JR9A 3KYCB 1FBSA 1P4XA 1T2KA 1YX3A 3HOVJ 2YX4A 3DKYA 2MC3A 3KZIC 5EDNA 2ADUA 4BY1J 2DA2A 2HQ5A 2O5RA 5IYCJ 3ECHA 1LNWA 3HSRA 1A35A 5LD2C 2JA8J 2HZTA 4E7SA 1LFUP 3R60A 3VYRB 3HOXJ 3CLQA 1WJDA 1Z1DA 3K4MA 4I99C 1XGOA 4P5OA 4RGSA 5IYBJ 3FISA 2VBYA 3FXLA 2L0KA 5KCMA 3NEUA 3OYCA 3I4MJ 5FFXA 2RN7A 1MSFC 4MTEA 3GFLA 2XGCA 1W0TA 4CCLA 4DZJA 3JAMK 1TW2A 3LOCA 4C3JJ 1WGXA 3I56I 3WTWC 3LQRA 2ZXHA 1SFUA 2HI3A 2MD5A 3SZGA 2O03A 4M73A 3E0JB 3G2BA 1R1VA 3DEEA 3MZYA 1LFPA 4L0ZB 4YG2F 2JVHA 1BC8C 2QEXI 1RESA 4JOMA 2VPLA 2J5PA 3DBHB 3IAM2 5EEHA 4PZJA 2A5WA 5D4RA 4IRHA 5DCMB 1SMYF 4AIHA 2L9SA 5K7FA 1A6IA 3S93A 4V19K 2WAQA 5F0CA 1B9MA 3OS0A 2X1DA 4M6YA 2K85A 4EGYA 1MDMA 3L00A 4RB1A 4AIJA 3ERED 3K70C 2X51A 3PNTA 1ZG1A 2ME6A 1WJFA 2EA4A 5K5OA 3V8LA 4RAYA 1ZELA 3IP4B 2CW0F 3VSKA 2AS5F 5KNLA 4BDYA 4QLCU 4WWCA 1XGNA 1SD7A 1I39A 2Y0SA 4A6EA 2TDXA 2XF5A 5BMZA 4HSRA 2W57A 3AG2H 3K4LA 3DFGA 2UV1A 5H20A 4MHGA 1YITI 1KU9A 1SD6A 4J01A 3DQVC 4HPQA 1ZH5A 4A6DA 3ABTA 1RPWA 2R0QC 2M34A 1IDZA 2DCEA 4IOCF 2HTSA 3PIOF 5B1BH 2VJ5A 3GCMA 2OU2A 1Y8QB 2WAFA 4OU0A 2JK3A 5K5RA 4EMSA 2IGNA 3GBGA 2DQLA 3SYTA 5LHGA 3BC8A 2Z1DA 1YO5C 4W1UA 2PI0A 4P9FA 3KEYA 4XBFA 1U5TC 3ZQFA 2I8DA 1WJBA 2EZKA 2K5CA 3LAPA 2K9MA 3S17J 1AA7A 2KFDA 2NVXJ 2Q8KA 3OYMA 1G3TA 1MW7A 3HOUJ 3HOTA 4WXCA 1TWFJ 3DPLC 1GLNA 1LDJA 4JX6A 3SZTA 1RZ4A 2VJIA 1V54H 2PJPA 3KP7A 3GMEA 3OOUA 1QO0D 3REOA 3E7LA 1X4PA 3BTLA 4NDLA 3MCZA 4LIVA 5CVJA 1YI2I 5C44J 3TP0A 2LY1A 4HF0A 4NQWB 1Z6TA 3CMMA 2LF7A 2W84A 1DPRA 3OYFA 3OYGA 4IPAA 5E3MA 3VB2A 2Z5UA 4CO8A 5DD4A 2R3SA 5J40A 1U5TA 3OR1C 4NC8A 1EF4A 2I10A 3CUQB 2X85A 3HRSA 3FK7A 1YJWI 1HW5A 5CLSA 2HVQA 1Z67A 2OQGA 2N8GA 1QBJA 1MJAA 3VWBA 4UB6C 2QBYB 2XIGA 5EG0B 2KJBA 2Z3YA 3QRFF 3DBLB 3WTVC 2HDDA 1IGNA 1SD5A 1A36A 2CH0A 3JCUC 2JA5J 3WTYC 2X48A 5M5XJ 2DBBA 5LGUA 1XSDA 2DODA 1I1GA 4NNJA 5K1YA 1FJLA 3KEOA 4GXOA 3J7AY 1VQ7I 4BJTA 4LITA 1XCVA 2PJRB 2KMUA 1O7FA 3DPTA 5HDKA 2W1OA 5JHFA 4XKCA 1NK2P 2Q0OA 5DDGA 3CDHA 2E1CA 4AYBN 2ELHA 2FJ1A 4CDGA 2B0LA 4G6QA 1E2XA 2TRTA 3ONQA 2X6WA 4MGRA 5HLTA 3WU2C 3CCQI 1MBKA 3KLNA 1TWAJ 1E0EA 1I27A 4LK1F 3CF2A 4BHPA 1XCBA 3DEUA 1BR4A 1TZLA 1XG1A 2A6TA 2GAUA 2VKEA 1CQTA 2WBMA 1KYZA 2K3FA 3JRHA 4G12A 3BZKA 1EA3A 1XN7A 3FMRA 2EIJH 2JTVA 1X1AA 3K4CA 3GLLA 4EM0B 3H3VK 1I6HJ 2A69F 5D5WB 3NQOA 2YU9J 3QYFA 4U7DA 5BPDA 1LDKB 2IT0A 3BLYA 5IT9Z 1Z3YA 1R1TA 1EH7A 2HNHA 2BZTA 5BS6A 5D4SA 4KA4A 2DT5A 5DCMA 3J81Z 3K69A 5M3FJ 1XSXA 1VF9A 3F9KA 4YFKF 3I71A 2NAZA 4MFDA 1OMIA 4N9IA 4ZZDA 3VEPA 4M3GA 4ENJA 2QM3A 3TOBA 4YFNF 2VXZA 1T33A 1IUFA 3HPHA 3G73A 1JHFA 3LA3A 2KPMA 1Z7LA 4E7ZA 3H9QA 3CJQB 1UHSA 1ZKGA 3WGGA 3TDZC 1RETA 1T38A 2A07F 2V4JC 1X2MA 2XC7A 2X1EA 1GXQA 3K0LA 3OYNA 2QSGX 5EZHA 1OCZH 1R5GA 1RC9A 1XMXA 3GW2A 2EZHA 3OL4A 3I4PA 1JI8A 2F4OB 2NVQJ 2FQ4A 3GF2A 1QPMA 3K1MA 3AKZA 2NVUB 1FP2A 3FKIJ 1OKRA 2DK8A 4IQJA 2ELKA 2EH3A 3PUFA 4AVPA 5E3OA 1DDNA 1FSHA 2M4KA 2ZO4A 1QU3A 4OIOF 4II2A 2WAQN 2XAHA 4GCVA 4C30A 1DGWY 1X1PA 2YU3A 1BR2A 3HIFA 3R0JA 3E5UA 4GDFA 2CUFA 2DU9A 3OV8A 3O6BB 1LPQA 1PUEE 3S1NJ 4G94A 2VODA 1VQKI 3IHUA 3M8FA 3K4NA 3CC7I 3SHFA 2KRFA 3P7NA 1YX5A 2CWEA 1ZG3A 2H1LA 1Z3XA 1PYVA 2XRLA 3H3UA 4YRVA 4ZC3A 2F5FA 4Z2YA 5F1JA 4G8XA 3GX4X 2V6EA 2W48A 3GXOA 2Y0SN 2PEXA 2ISZA 1UHWA 1PJRA 2QA4I 3FKJA 3PSIA 3WTSC 1UZCA 2E2JJ 4I01A 4OWRB 4RMNA 3Q5FA 1MMSA 5HS8A 1MH3A 1J9IA 4I2OA 1MIJA 4CH7A 2HYGD 3H3ZA 3E5QA 1VQ4I 3I58A 1Z6RA 3X2QH 3KEQA 1YHQI 2R5YB 2VOOA 1STZA 3CUQA 2OPTA 3V7CA 2KT0A 2HDWA 3RSNA 4KNYA 2X6XA 4E7HA 1KONA 4B4CA 4J00A 5FD6A 2AXTC 2V79A 1F43A 1E3OC 3ZMDA 2OJED 1RI7A 4XLCA 4P9UA 2XPVA 3NAUA 1MKMA 2DPDA 1D5YA 4JBAA 2WB1A 5HDNA 1A31A 2R7XA 2VKVA 2QBYA 5EG0A 5GAHJ 5F04A 2H27A 4DW6A 1JGSA 2XAQA 2CQKA 2KKOA 1JKRC 4M6XA 4DBRA 5ILUA 5F0HA 4A3IJ 3DCFA 2M0CA 3K4JA 2CFXA 2XHKA 2V7FA 3JTHA 2QQ9A 3WHBA 1FWZA 1RR8C 3RPUA 3KETA 4CCJA 1JKPC 4IRGA 2D1HA 1IDYA 2FUG2 2PJRA 3FXQA 2KLOA 2K4JA 2VQGA 4XKBA 2LF8A 3N4MA 1IF1A 2AQFA 4AIKA 2BXZA 2F4MB 3IWZA 4BH9A 1BC7C 2MABA 4ESFA 3KP2A 2LKPA 1D0XA 2E19A 2LD5A 2KQRA 2BOLA 5L3EA 2RAEA 1FP1D 2EJRA 2KDOA 3U1DA 3I5UA 4U0VA 2Z99A 3EUHC 1YOVB 1NK3P 4FCYA 2QUFA 4IXAA 1JJ6C 2EV0A 1G3WA 2H8RA 3BWGA 5E79C 3S16J 3MAJA 4KIBA 3CDLA 1WI3A 2V1XA 3Q3SA 4HNUA 3ZXSA 4A5NA 2MH9A 1DU0A 1LEBA 2HPIA 4A3CJ 3I9V2 3JRDA 3U9GA 1TQPA 1K6YA 5IYDJ 2JMWA 2HKOA 1F36A 2X1CA 3SEQA 4RDUA 1J7KA 3GZNB 1JXSA 4F91B 1S3JA 2CV2A 1ETKA 2EWNA 4BXFA 1HCRA 3HRUA 5FGMA 2WADA 3LQQA 4AVZA 1R4MB 2MBFA 2L01A 2VXDA 5FKLA 1JUPA 1DP3A 4CCOA 2VUMJ 1SFEA 1QZZA 3T8RA 2STWA 2E60A 3BG9A 4XORA 3S3OA 3C2BA 3TO9A 1R7JA 4LLGF 2ZJRF 1IV6A 5HNHA 1BI3A 1LE8B 1HSJA 3LA7A 1XB4A 4YEJA 1YRNB 2M7BA 1G4DA 3ABKH 3F72A 5LBQA 4ZJZA 1MDMB 2ID6A 3H0GJ 5LEKA 4CSWA 1G8XA 1QZEA 2H8WA 2BHYA 2KJCA 2GOMA 3QP6A 3L09A 3QPLA 3EUAA 1OCCH 3TBIA 2GIZA 1WZ2A 1WH5A 4EJWA 1QHGA 2CV1A 2M45A 3P5JA 2UUZA 2ELJA 2Y69H 2JQ7A 2W7NA 3DLAA 1ZLKA 1FBQA 4A0YA 4XLAA 1MBEA 3FWEA 4IRIA 4NC7A 3GTKJ 1IN4A 4XOTA 2ZJQF 1K83J 3M07A 2DAOA 3NWTA 3ABUA 4BEHB 1JE8A 4PJNA 3A03A 4M72A 4RM3A 3ZMVA 3WGHA 3HBLA 3CD6I 4RAZA 2M1BA 2EFWA 1FMVA 2JPCA 2VKHA 4Y52J 1UG2A 3FHZA 1TLHB 4HLYA 1FX7A 2MA3A 2R5YA 3BR1A 2DA1A 2O8XA 2P0WA 3OIOA 2NS0A 1SANA 5K5QA 2DYRH 2XAGA 2YUSA 4WX9A 4XKWA 4PUSA 1FTZA 3E6CC 1OCOH 1D8JA 5FKOA 5D8KB 5EYRA 2P5VA 2CV0A 4EJTA 2BVLA 4GO1A 5LRRA 4MEYF 2O6GE 4BQAA 5E1ZB 2IS4A 3BCAA 3KP4A 3OSGA 1D1BA 4QPQA 2HWVA 3WHCA 2P6SA 3K2AA 3HG9A 4BE2A 3ZMSA 4E7KA 1REPC 1X3ZB 3RKWA 4A5MA 1FIAA 3MKZA 3HOSA 3LSIA 3KFWX 2CW7A 4N0BA 3KE2A 4FISA 3WTZA 3NRVA 3OIPA 2EZLA 1T0FC 3BG3A 4AYBA 3LNQA 5ICGA 1N25A 2I5UA 3M4OJ 5HVQC 4M9ZA 2CGPA 2OF7A 3VOEA 4Y7NJ 1ERDA 4M9XA 5D6FA 3HEFA 5K7ZA 5A2QK 3IAS2 1IUYA 1OYWA 1FSEA 3WODF 4J19A 3L2RA 3J7AO 4HNVA 2HXOA 9ANTA 3RCOA 5DM6F 2NYXA 3GTQJ 1Y1WJ 2M3AA 3MN2A 2OTLI 2HU9A 1HOMA 1EJ9A 1R1UA 3I0TA 2F5VA 5FLXZ 3BDDA 4Z6YA 2HQNA 1EH6A 4I6ZA 4PGHA 1IG7A 3G3ZA 4E4HA 1ETQA 1J75A 1T0FA 1VQ8I 3JRGA 5DUKA 4DQ2A 2LSOA 5A2QZ 3QPTA 1W7PD 2HEOA 3LSJA 2L2OA 1S7OA 3PQKA 2QCOA 3IRRA 1XDUA 2OZUA 4BGDA 1E3PA 6PAXA 1P9QC 1A6QA 4KICA 4L18B 1WH7A 3KCCA 3QYBA 1Z9CA 4Y15A 1JTYA 5GTHC 1EV7A 3HHHA 1CGPA 1J59A 1S9HA 4L5EA 5F27A 1P2FA 3ZCOA 4S04A 3OYEA 1Y0UA 2P8TA 4FX4A 4IHYA 1Z05A 3ZN0A 2HKXA 2RQQA 5FO5A 2FBKA 3BPXA 2IGOA 2R93J 3RDIA 4XSXF 4KUMA 2FBIA 2BYVE 2AHQA 2IS6A 1F1ZA 1D0YA 4G7ZF 1WHUA 1G59A 3G6EI 2DO7A 3FM3A 2E71A 2CW8A 5J3LA 5EEAA 3K70D 1PUFB 4MFEA 1F5TA 2P6TA 5B3SH 2MH2A 1W0UA 3DP7A 1QQIA 1R58A 1UB9A 3CCVI 4EM2A 4E7LA 4HDVA 3GTLJ 2KIQA 3BR3A 1N75A 3CO7C 1IC8A 1LQ1A 3FXJA 4U0YA 3L2UA 1LE8A 1WKMA 2PBIA 1AU7A 3JAMZ 4BQOA 1PP7U 2IXSA 1IRZA 1MNEA 2LVSA 4X1EA 3OS2A 1YRNA 1MJ9A 4HX4A 1FOWA 2LTPA 4JYKA 3R6SA 5L3FA 2OUMA 5L3DA 4ZDOA 4IVNA 4B48A 1BI1A 2QWWA 2Y2ZA 2K40A 3I54A 3LFUA 2EILH 3HPGA 1X19A 3D5LA 4RGUA 2KIFA 4RAGA 1R5HA 3F8CA 3ZQCA 1YJ9I 1SVOA 3S14J 2DMQA 3UKGA 2DMNA 3W2WA 3L2WA 2M5WA 2R92J 4D7MA 1V5FA 2V1DA 3SZPA 3WTXC 4BHCA 1KGSA 2E5NA 5BNGA 3H35A 5E18F 4M74A 2GM4A 1MNDA 1IXRC 3ULQB 4H0EA 2QVOA 3DF8A 3H5RA 4BS9A 3C2HA 1O57A 2GXGA 1V5GA 2D1VA 3HZJA 4BEHA 3TW6A 4FE4A 2L02A 4BAYA 4XQFA 1KQ9A 3IKTA 1R36A 4CUGA 4ENMA 3HKZN 3GLXA 1ZK8A 5H6QA 2FX0A 3SEZA 1SAUA 3B6CA 2A5YB 2O61A 4XIDA 2A05A 1R4NB 2XPUA 3ZOBA 3FBIB 3JRFA 2F5CA 1KA8A 3GEZA 2M87A 3GTOJ 2LOOA 4CHUA 2LG4A 2CU7A 3QP5A 1YJNI 3VDXA 1ODDA 3CTAA 2LLKA 2RNJA 2HQRA 3IV5A 4LG0B 1HBXG 4ASNA 2GOXB 3ABMH 1OPCA 5FRNA 3AL0B 1U9OA 5GADJ 2DW4A 2R7RA 4F92B 1IN8A 2CQ7A 5IP7J 2E5ZA 2KIUA 4PK4A 4QTRA 2DMUA 1ETWA 1ONVA 1LJ9A 3WU0A 2XRNA 2DTRA 2IAIA 3HHGA 1RUOA 3BTIA 1ETVA 2QKLB 2KISA 2ZJPF 4I7HA 1VQ9I 3H9JA 3K7AJ 1IXSB 1QZYA 1UELB 1USSA 4CXFA 3V4GA 2KZVA 3FXUA 1V55H 2ZJ2A 2DMTA 3J80K 2DOAA 3M8JA 5C4XJ 3S1MJ 1FYLA 2O3FA 5DTDA 2UXNA 1GT0C 3QQAA 3HOYJ 1N78A 3TO6A 2WA0A 1HW1A 3LSHA 5E20A 3A1YA 3S3NA 4PFOA 1G3YA 1U0JA 2P7VB 5M5WJ 2Z33A 1R5ID 3FK6A 5JFRA 3QOPA 2KDZA 3H36A 4IKFA 5CVIA 3SXYA 3GTGJ 2RV8A 2V9PA 1ZHFA 1YS6A 3W6JB 1BL0A 4UUVA 4XRMA 4I0AA 5DCFA 1R9TJ 5CYVA 3MZ8A 1O3RA 3MWMA 1R22A 1Q1VA 1XS9A 4PGGA 1ZG5A 4D5CA 5BQTA 1TL8A 2K9SA 4ENKA 4RAFA 4DBQA 3VODA 4B44A 1X1BA 4MEXF 1ZGAA 4LOCA 3VPRA 1UFMA 1O3QA 2F2EA 5J1RA 1BW5A 1OJLA 2EV6A 3KP3A 4PSWA 4A3LJ 4PCQA 3K4KA 3RIRA 3BTJA 2RQPA 5J47A 4F7ZA 4A3EJ 3MMYB 3HGYA 5E3NA 4XICA 4UUSB 4L9VA 5HLHA 3CZ6A 5DM7F 2ZB9A 3MD2A 3JRCA 5D6EA 1PUFA 4UHTA 3NARA 4XSZF 4HBLA 1KZHA 1VI0A 1I50J 4Y4RA 5HDGA 1ZRFA 3E5XA 4D1QA 3F8NA 4IHXA 4JK1X 2M30A 1UCRA 4CYDA 1HLVA 2VBWA 3RPQA 2H94A 1DP7P 1OCTC 2K9QA 1Z0XA 4LFUA 1QNTA 2FQ3A 1ZARA 2LY9A 5FD5A 4EEFG 2HFHA 1J2XA 1SEUA 2H09A 2GLOA 4ABZA 3K6GA 4M3FA 4A3MJ 4EJUA 1I3QJ 1P92A 5ICCA 2CUZA 1GV5A 2W82A 3BT9A 4XRSA 1USTA 1JTXA 2LY2A 1ZQ3P 2VQLA 4HOBA 2R5ZB 3RTRA 1K78B 3KIOA 3F22A 2VE9A 5CVRA 2M8GX 1OLTA 4BE1A 2V9VA 4CICA 4CZZA 4LK0F 3OMYA 2K7LA 1PP8F 3H5NA 2CQQA 3ZMUA 2K02A 3PJRA 3R4KA 2E7WA 2O8KA 1P4AA 3OYHA 2ZFWA 4IX7A 4M3BA 4AD9A 3PQJA 1R6RA 2IA0A 4XLNF 4D9JA 3D5RC 4AUXA 3J7ZI 4A3BJ 4Q5SF 3FXMA 1N77A 1FPQA 5FROA 3G1LA 3FIWA 2HOAA 1W5SA 3AL0C 5CPRB 5IP9J 1FZPB 4UNOA 1Z77A 5CQGA 3S1RJ 3QPSA 3W2AA 3QU3A 2VPRA 3EUKL 4C2UA 3M9AA 5DEQA 4L9NA 2QYOA 1M1EB 3FXKA 4CCNA 3OYKA 4OAZA 1XDSA 3LSMA 4XK4A 4O6JA 2OTJI 1YG2A 1BIAA 3GUDA 1VTNC 1P7IA 2E36A 1YW8A 3CJRB 3WE3A 2HR3A 3S32A 4JP0A 4Q48A 4YIFA 2XASA 3L9FA 3OYBA 4C3HJ 5D5UB 4HG2A 1WPKA 1IO2A 2G9WA 4LG0A 4LB5A 5F0FA 2JA6J 1D1AA 4I98B 5LGNA 2DFHA 3WGIA 3CUQC 1ZR4A 3RPUD 3M1EA 1SFOJ 1MSEC 2BE5F 2WC2A 1RIOH 1K79A 4XLFA 5JLWA 1D8KA 4JX4A 2QLZA 4RB3C 2IS2A 1A5JA 1SFXA 1OCRH 1VQPI 3LSPA 2EIKH 1Y1VJ 3CC4I 1D3YA 3QOEA 3W6VA 2PMZA 2E1MB 5GAEJ 3G71I 3BY6A 3GYHX 3QPHA 4ZTJA 2CSOA 4L5JA 3PM1A 2F6CA 5E8IA 1UJ8A 2KL4A 4ZYDA 1P6RA 3PL8A 1JGGA 3I64A 1ZRCA 2JUCA 4CGZA 3JRBA 2BY1A 3OYIA 4Y13A 1B4AA 2K86A 1H9GA 2YPRA 5KAFC 1IRGA 3FXOA 3O8GA 3G1OA 3CJNA 1L3LA 3CP2A 4DYRA 4E7IA 3PNVA 4UVBA 3CCJI 1T95A 3KYLA 3F6OA 5EJCA 1TQMA 1BIBA 4EATA 3AAFA 2HOSA 2HVSA 3QAHA 3WTUC 1U6GA 1RKWA 2Z9OA 3CF5F 1HW2A 4GYGA 3HB9A 1B8IB 1MMNA 2B63J 1FEXA 1P4WA 5CKTA 3JRAA 4DGWB 1JJ8C 3FF5A 2X9DA 3KZYA 4KJZA 1SVMA 1TBXA 2PMUA 4ITVA 2RNGA 4ZYAA 4KITB 4WXDA 1KU2A 1Y6IA 2FD5A 4LLLA 5E1XA 4YIRX 2JZYA 2RDPA 3ASNH 3LSGA 1FIPA 3RJPA 3S2DJ 3SQNA 2DA6A 3RKYA 2DFEA 4A12A 2VE8A 2Y9YA 5D8LB 4XLHA 4XNFA 5FKNA 4I09A 2H1KA 3M8EA 2WV0A 4A0XA 2MC4A 3MZHA 1DQUA 4BJ6C 3S1QJ 1VQOI 1LFBA 4XM3A 2FRHA 4EQQA 3F21A 4A3JJ 2F5DA 2FNAA 4G7OF 2LNBA 2XGEA 1PDNC 4UUSA 3F8FA 3CCMI 1ENHA 1YFHA 2PQ8A 1MJBA 3CJTB 3IKVA 4JX5A 3CCEI 2L54A 4PJ0C 1MH4A 4HNTA 1MBGA 1S5LC 2JUGA 3MEXA 2LFBA 3GFMA 3HTSB 3CCSI 4HRIA 3S2HJ 2DK5A 4XMYA 4BYYA 3ZMTA 3K1PA 4ANJA 2IVMA 3FHNA 1A04A 3ML6A 1V5EA 3BQZA 3GZ6A 1B9NA 1FNNA 1YS7A 3BTCA 2H6CA 3VSLA 3JSPA 2Z2SB 3HL2A 3CC2I 2IS1A 2XUBA 2YX7A 1R00A 3JRIA 2R5ZA 4Q4ZF 3CUOA 4B8XA 3OS1A 4HSTA 5EEGA 1H88C 1K78A 4JQFA 2XB5A 4ETSA 2EFPA 4Y3OA 1ZRDA 5GAGJ 1XGSA 2OBPA 4B3AA 5FFZA 2ETHA 3SFIA 3ZQ7A 1LB2A 1CF7B 3PUBA 1BBYA 2BY3A 3VYUB 3M1CA 5HLGA 4K2EA 3RYPA 4DZPA 2YS9A 2VBXA 1FOYA 2CUJA 4XLEA 4UUTA 2IBDA 5TISC 2IA2A 1BOAA 3CQZJ 3JREA 3ERMA 2WV1A 4BQQA 4RBOA 2D45A 4IHWA 3TO7A 2LMDA 2JWTA 3ELKA 1MGTA 3HKZA 4CZCA 5FRMA 4BBSJ 4WF2A 3GWZA 2L9RA 3PIPF 1KU7A 4KISA 1R23A 4G6TB 3WTTC 4F55A 3T8TA 2E1MC 2B7EA 4P55A 2R7QA 4UY8I 2R7WA 3TMOA 4KMFA 2VC0A 4W97A 3VYSB 1AKHB 2MLGA 4CCMA 2R7ZJ 3F0CA 2A6HF 4YELA 4BUPA 2QGUA 2UZKA 1VQ5I 3A4CA 4E6KG 4ZH4F 3BG5A 2QSHX 4F93B 5L3GA 1BI2A 4Q47A 2XF7A 2EFNA 1U3EM 3LSKA 3ESWB 5D5VB 4OIRF 3LSRA 2E35A 4QPOA 2EK5A 2GZWA 2P7CB 4HV5A 3OOPA 2IGMA 2PMHA 3V7SA 2FXAA 1FBUA 3HSEA 4C2MJ 4KYWA 2UWMA 1U8BA 4OINF 2GQQA 1T08B 4OIPF 2VONA 3LFKA 2TCTA 1ZR2A 1DGRM 2W4SA 4N4NB 1W7PB 4BXXJ 1WRJA 4HV6A 3B6AA 3ROUA 3DU5A 3ZPLA 4AWXB 1DPUA 3W2VA 1TTYA 1OISA 2EFOA 1JKQC 3QU6A 4IOAF 1B72B 2EIMH 2CRGA 2DDBA 2VLAA 2XPWA 1SD4A 4KT6A 2GWRA 4HA8A 4V2FA 2ACJA 3E6BA 4OAYA 3JSOA 1KQ0A 4MNUA 5CQEA 1Z21A 1RRJA 2K3PA 2MSYA 2KP6A 1RR7A 3DEWA 2R4GA 1TC3C 3BOQA 2BY2A 3L7WA 4L9JA 3KLOA 5HS9A 3IRQA 2P5KA 2ZKZA 2E7XA 3NWSA 1OCPA 1JT0A 2JSPA 4CA0A 1B8IA 5J4YA 4R8HA 5FLVA 3PO2J 2DPUA 1HKSA 1OFCX 4UV8A 3CCUI 3GTPJ 4X0GA 2KHMA 1IV8A 2D2WA 3HOZJ 3I59B 3RQIA 3A2KA 3E97A 1L0OC 1K61A 3R0AA 3Q0UA 2HGCA 4RLQA 4ZZLA 2R7UA 2PMZN 5M3MJ 1YYVA 2CUEA 2DA5A 1HDPA 2HS5A 3BP8A 4IEJA 1TQIA 2X4HA 1GDTA 1G3SA 3S2WA 2A3SA 1Y8RB 5DYMA 3VYTB 1XPXA 3SJMA 5AIQA 1GHCA 1X3WB 1SMTA 3DKWA 4AU7A 2Y75A 2ID3A 2QSFX 2CO5A 1SVLA 2FMYA 3F6VA 4AIDA 2NOGA 4D0PA 5LGTA 5JVGF 5BOXA 3E1SA 2BV6A 1EH8A 3RYRA 2L7KA 2DI3A 2O9LA 1B1BA 1SC7A 3N05A 4NC6A 2MG4A 2VIXA 1XGMA 3BJOA 3HXLA 3CMAI 3I3LA 1P7JA 4A0ZA 5TRDA 3V42A 4BL0B 5HS7A 1T39A 2RKHA 1Y0NA 1IZ1A 1QHHD 4ZDPA 2A6EF 1GUUA 2W25A 3F3XA 2W00A 4DYQA 5D5XB 4FETA 4RM2A 4I0BA 1U8RA 1YIOA 3MKLA 2GXAA 3BJ6A 1UG0A 1FC3A 4BBRJ 2HZDA 1ZGWA 1K4TA 2R7OA 3U1KA 3ZR8X 2HPMA 1IJWC 1H89C 4A93J 1WJAA 3L2VA 3OSFA 1O3SA 2IPQX 4YIIA 4BKXA 1YLFA 4BQNA 4RGXA 4LB6B 2BW3B 2ZMEB 5DS9A 1CF7A 2Y0MA 3CMYA 4KIGA 2X0LA 1MZBA 1QVTA 2NRAC 4BNCA 5LHIA 4U7BA 3UNGC 2XROA 1WWXA 4DJAA 1TP4A 2K9NA 2XSJC 2LBFB 3F23A 2XV4S 3EETA 2ZBKA 5KVRA 1W4MA 1WVRA 2OD5A 3IL2A 1X58A 3KP6A 1YW7A 1GV2A 2IP2A 5IP6A 3BR6A 1KU3A 4LG3A 1FMWA 3FDYA 2VQCA 2ESNA 2O7OA 2X6OA 4G6DA 2YR2A 4RB0A 2E2HJ 2WY8Q 2L7FP 1OR7C 2FE3A 4QWQA 1X2NA 2OAZA 3O8HA 4ZYHA 1TWCJ 2PG4A 3C7JA 3OYLA 3K2ZA 5F1RA 5EGOB 1IW7F 3BCBA 1AKHA 1U9NA 2L3DA 4E70A 2OCEA 3U21A 4BXUA 1D0ZA 1NHAA 5GP9A 1O7LA 3H9GA 5GPAA 2YSRA 4F3QA 2Z16A 4O5VA 2CQNA 3CCRI 3COAC 5DD8A 3VFZA 4XR6A 4L9TA 3HOWJ 3K9TA 4FTHA 2NNYA 3OYJA 3EYIA 1HQCA 4TV7A 2UXXA 1IRFA 1LVKA 1W5TA 3ASOH 1OR7A 3Q9SA 5ILSA 1W7PA 1U78A 2CMPA 2DXIA 3RZOJ 2DMPA 3BPVA 2LKSA 4XOPA 5LFAA 4EV0A 5J4VA 3CESA 3HGGA 3HYIA 3K1NA 5DV5A 1APLC 4HAMA 1B72A 4O3MA 1Y56A 1MMDA 3C1DA 4U87A 5B1AH 2M9HA 4DIQA 3DPUA 3S15J 5EF6A 1EKEA 3TQNA 3ZGKA 2XGXA 5FJ8J 3FZVA 5IOYA 2G0EA 5IPAA 2IA1A 2M4GA 4HF2A 1FOKA 3GTMJ 3ZRGA 1JT6A 2VKDA 1ULYA 3FBNB 2JSCA 4B3XA 2CQXA 1W36D 4LJZF 3BZCA 3U2RA 4BDZA 4B1RA 2D5VA 3E6MA 4DNCA 2FOWA 2L7ZA 1BOBA 1E17A 1V3FA 3N97A 2XB0X 3ABLH 2KRCA 3I59A 3KZZA 3DLLF 1ZLJA 4D5FA 4HW0A 4II3A 1TNTA 2XF6A 1WFXA 1SAXA 3QYEA 3AG3H 2XAUA 2MYSA 3TKYA 5E3LA 1S8NA 2DFIA 2RGVA 2VT3A 2M2EA 2ZFUA 1Q1HA 2V1NA 5ICEA 3S8PA 1RNLA 1H8AC 3KPHA 2P81A 2EQRA 4CCKA 3H1CA 2EB7A 4NB5A 3OYDA 1HXDA 1W36C 3CMEI 2CG4A 1Z91A 2IJLA 3HRMA 1WCMJ 5KAIC 3T5XA 4A2UA 3ZQLA 3Q9VA 5JI6A 3OL3A 1K6OA 1BJZA 2GIVA 2W85A 1BR1A 2QQBA 2Y31A 1BA5A 2CS3A 3HUGB 3IC7A 2IW5A 3CCYA 2E34A 1B6AA 1AWCA 3RKQA 1TNSA 4M71A 3BQYA 4KIFA 4N4OB 1VNDA 5FKMA 4DYCA 1LUJB 2ZMEC 2R7FA 1C0WA 4ESJA 1J09A 3Q0VA 5J1YA 3J80Z 4BHBA 2HTJA 2RREA 5KK1A 4MLOA 2DJIA 3IH3A 2R7VA 3BJAA 4A3DJ 2B9SA 2XGDA 4IJAA 4OIQF 4BACA 2ZSIB 3E3VA 3A01B 3E6DA 2VN2A 3H0DA 4IHVA 3KX2A 4EM1A 5E17F 1T6SA 1LDDA 1MBJA 2DT6A 2EBIA 5LRSA 3PSFA 5HNFA 4M3DA 3UR3C 3K10A 3AG4H 5CVVA 1AHDP 2QF7A 2C6YA 1T98A 3C18A 2FF4A 4LGWA 1H9TA 1ZN2A 5K7HA 2ME0A 1ZTRA 2Y30A 2BW3A 2ZMEA 4RA2A 2CFOA 3PNYA 1WJEA 4HDUA 3GO5A 2DLLA 4PFPA 3RQ4A 4HEA2 4IQ4A 1T56A 1ORKA 3LMMA 2VOPA 4G9YA 1ON1A 2FMLA 3SDBA 1ZGJA 2LBFA 2JN6A 5JR3A 3ZQIA 5HOOA 5AONA 3WU1B 2COMA 3P9IA 1FYMA 4C9YA 3D1NI 1FYKA 3PO3J 5IT9K 2LH9A 4UXNA 3CO6C 1G6NA 2PFBA 1HF0A 3JW4A 3J81K 3ZQQA 3H92A 4QSHA 4WK8F 4PSXA 3TL4X 2R7TA 2IGKA 2OA4A 3TDUC 2OC6A 2XVCA 4XN0A 4GYIA 4ON0A 1BW6A 3IUOA 5EGOA 3LAJA 4M3EA 4KN7X 1OQYA 3I53A 2CJJA 2VASA 3F8BA 2QQ8A 2Y48A 1PVEA 4WXHA 2R7SA 2LR8A 3B02A 5B66C 3HJEA 2EFQA 2GA1A 2O0YA 2BHZA 2H6BA 4GFBA 2K27A 1F4KA 1VZ0A 3CLOA 2NVTJ 4HYEA 5CVUA 2NNNA 2XAJA 4FT8A 2KRHA 2L5QA 3ZQHA 2E1OA 3G1MA 2J5OA 3C3WA 3MVPA 5ED4A 2HDCA 3ISPA 3L2CA 4X6AJ 3OYAA 2P5LC 1JUMA 2DOEA 5E8GA 3EPZA 3IH4A 4D7NA 4FE7A 1YQAA 5LHHA 3W3CA 2HYJA 3GVAA 3RI4A 4RLFA 4Y17A 2F4IA 3D0SA 5GTIC 4KT5C 1YTYA 2MW8A 2JVGA 3ZMZA 2XDVA 4M6VA 4RGRA 4AC0A 4L0YB 3CCLI 3GZ5A 4KN4X 1F9NA 5KHDA 2JJ7A 2W24A 2ZXJA 2LRDA 3P9CA 4WCGA 3WG9A 2BY0A 3Q0WA 2QENA 5ICFA 3DTKA 1ETXA 1BN5A 1B59A 5L3BA 1ZAOA 1O4XA 4PJJA 2LC2A 3EYYA
chains in the Genus database with same CATH topology
1BM9A 4ENNA 2EV5A 1I1SA 2OQRA 3W6KB 1MD0A 2DQRA 2ESHA 4UV9A 1ON2A 5BPIA 3FMSA 4MTDA 4IHTA 1HKTA 5JHUA 2RC4A 4GGGA 4UVCA 1BJAA 1I5ZA 5TJJA 4HQMA 1IN6A 4FX0A 1WQ2A 2ISYA 1K7AA 2XAFA 3V7RA 3KP5A 2GXBA 1XMKA 3JTGA 4NQWA 3HUGA 1D5VA 1RUNA 5CJ9A 2IRFG 3F8MA 2A68F 5J8CA 3WE2A 2M8EA 2GA2A 2JPBA 3T0YA 4RS8A 1IN7A 2G7HA 3GFJA 2ZNZA 2L4AA 5ERIA 1JHHA 3V8JA 1ZREA 1UHMA 1KYWA 3DV8A 4UVAA 1OYIA 3PFIA 3P9KA 2ZCWA 3R61A 2WWYA 4R79A 3LSTA 4HX8A 1KQ8A 3BZ6A 5LLQA 4OOIA 1BI0A 2G7UA 1LVAA 4N9HA 1J0RA 1V4RA 2A61A 1FY7A 1I6XA 1DUXC 4HQEA 4LMYA 2JT1A 4U88A 1XSVA 4L5IA 5LEJA 3V8KA 3MFKA 1H0MA 2FSWA 2HYFA 3LWFA 3DXJF 5DUIA 2QQAA 3FMQA 2V1UA 3T1BA 2KIMA 1XD7A 2F5EA 5FB2A 4LD5A 1HSTA 1GXPA 5AIPA 2WTEA 2MLKA 4R1HA 3O2PE 3FXRA 4M9SA 1AOYA 2FNPA 3ZN1A 4KMUX 1FT9A 1IXCA 2LDUA 3RKXA 3MQ0A 3TGNA 3EUHA 5HLIA 2L4MA 1U2WA 1FLIA 4EJOA 2K4BA 4KFCA 3SFZA 5JVTA 1IAWA 3ZP5A 2FOKA 2RVCA 4I02A 4OMZA 4XRFA 2V6CA 2PN6A 1WI9A 2VT2A 2EA2A 4RB2C 5L3CA 1QGPA 2AXLA 2CYYA 1TW3A 3TOAA 3GFIA 4ZYEA 4HZFA 1XMAA 4FHTA 3M7GA 2FEZA 2BEOA 1S29A 5E1WA 4OMYA 2ZNYA 2R7DA 4ESBA 2FA5A 1OYYA 4EGZA 1S7AA 3HSFA 4ZYGA 4YFXF 4HX7A 5IT3A 4G7HF 3LA2A 2XKOA 2BGCA 1HKQA 2QZ8A 3HTUA 5F6FA 3EDPA 4IHSA 4P96A 2BBYA 1WSUA 3HRTA 1O3TA 3O3KA 4NHJA 2P4WA 1GVJA 1Z7UA 1S6LA 4U0WA 4MQVA 4KDPA 5ILVA 4MQ9F 3FM5A 2Q2EA 5H6RA 2OZ6A 4LLNA 2STTA 2HOEA 4PDKA 5F64A 4S05A 3BROA 4XLPF 5FLXK 5J6XA 2FU4A 4IF4A 1LEAA 1U5TB 2VC1A 3EQLF 4HLXA 2FBHA 4HF1A 1YW9A 2JRTA 2VBZA 3ECOA 1J5YA 4B09A 2XKPA 1X3UA 2E1NA 4EVIA 3FX3A 2PLYA 1ZYRF 3IWFA 4EJVA 3B73A 1IN5A 5J8FA 1FBSA 1P4XA 1T2KA 2YX4A 2MC3A 2ADUA 3ECHA 1LNWA 3HSRA 2HZTA 3R60A 1Z1DA 1XGOA 4P5OA 4RGSA 2VBYA 3NEUA 5FFXA 2RN7A 4MTEA 3GFLA 3JAMK 1TW2A 3WTWC 3LQRA 1SFUA 2MD5A 2O03A 4M73A 1R1VA 3MZYA 4L0ZB 4YG2F 1BC8C 2J5PA 5EEHA 4PZJA 5D4RA 4IRHA 5DCMB 1SMYF 4AIHA 1B9MA 4M6YA 4EGYA 1MDMA 3L00A 4RB1A 4AIJA 3ERED 1ZG1A 2EA4A 5K5OA 3V8LA 4RAYA 2CW0F 2AS5F 4QLCU 4WWCA 1XGNA 1SD7A 4A6EA 2TDXA 5BMZA 2W57A 3DFGA 5H20A 4MHGA 1KU9A 1SD6A 3DQVC 1ZH5A 4A6DA 3ABTA 2HTSA 2OU2A 4OU0A 5K5RA 4EMSA 2DQLA 5LHGA 1YO5C 2PI0A 4P9FA 4XBFA 1U5TC 3LAPA 2Q8KA 1G3TA 3HOTA 4WXCA 3DPLC 1LDJA 3SZTA 1RZ4A 2PJPA 3KP7A 1QO0D 3REOA 3MCZA 5CVJA 4HF0A 1Z6TA 2LF7A 2W84A 1DPRA 4IPAA 3VB2A 2Z5UA 4CO8A 5DD4A 2R3SA 1U5TA 3CUQB 3HRSA 1HW5A 5CLSA 2OQGA 1QBJA 1MJAA 2QBYB 2XIGA 2KJBA 2Z3YA 3QRFF 3WTVC 1SD5A 3WTYC 2DBBA 5LGUA 1XSDA 1I1GA 5K1YA 3KEOA 4GXOA 1XCVA 1O7FA 3DPTA 5HDKA 2Q0OA 5DDGA 3CDHA 2E1CA 2ELHA 4CDGA 2B0LA 4G6QA 1E2XA 4MGRA 3KLNA 1I27A 4LK1F 4BHPA 1XCBA 3DEUA 2GAUA 1KYZA 1XN7A 3FMRA 2JTVA 4EM0B 2A69F 5D5WB 3NQOA 4U7DA 5BPDA 1LDKB 2IT0A 5IT9Z 1R1TA 1EH7A 5BS6A 4KA4A 5D4SA 2DT5A 5DCMA 3J81Z 3K69A 1XSXA 4YFKF 3I71A 2NAZA 1OMIA 4N9IA 4ZZDA 3VEPA 4ENJA 2QM3A 3TOBA 4YFNF 2VXZA 3G73A 1JHFA 3LA3A 3WGGA 3TDZC 1T38A 2A07F 1GXQA 3K0LA 1R5GA 3GW2A 3I4PA 3GF2A 1QPMA 3K1MA 1FP2A 1OKRA 2DK8A 4AVPA 1DDNA 1FSHA 2ZO4A 4OIOF 2XAHA 4GCVA 2YU3A 3HIFA 3R0JA 3E5UA 2DU9A 3OV8A 3O6BB 1PUEE 4G94A 2VODA 3IHUA 3M8FA 3SHFA 2KRFA 3P7NA 2CWEA 1ZG3A 3H3UA 2F5FA 4Z2YA 3GX4X 4G8XA 3GXOA 2PEXA 2ISZA 1UHWA 3WTSC 4I01A 3Q5FA 5HS8A 1J9IA 4I2OA 2HYGD 3H3ZA 3E5QA 3I58A 1Z6RA 3KEQA 2VOOA 1STZA 3CUQA 3V7CA 4KNYA 5FD6A 2V79A 3ZMDA 1RI7A 4P9UA 2DPDA 1MKMA 4JBAA 5HDNA 2QBYA 2H27A 1JGSA 2XAQA 2CQKA 2KKOA 4M6XA 5ILUA 2CFXA 2XHKA 3JTHA 2QQ9A 1FWZA 3RPUA 3KETA 4IRGA 2D1HA 3FXQA 2K4JA 2LF8A 3N4MA 1IF1A 4AIKA 3IWZA 4BH9A 1BC7C 4ESFA 3KP2A 2LKPA 5L3EA 1FP1D 2EJRA 3U1DA 3I5UA 4U0VA 2Z99A 2QUFA 4IXAA 2EV0A 1G3WA 3BWGA 3MAJA 4KIBA 2V1XA 4A5NA 2MH9A 1LEBA 3U9GA 1TQPA 2HKOA 1J7KA 1JXSA 1S3JA 2EWNA 3HRUA 5FGMA 3LQQA 2MBFA 2L01A 1SFEA 1QZZA 3T8RA 2STWA 3TO9A 1R7JA 4LLGF 1BI3A 1HSJA 3LA7A 1XB4A 1G4DA 3F72A 5LBQA 1MDMB 5LEKA 2KJCA 3QP6A 3L09A 4EJWA 2M45A 1ZLKA 1FBQA 4A0YA 3FWEA 4IRIA 1IN4A 2DAOA 3ABUA 1JE8A 4M72A 3ZMVA 3WGHA 4RAZA 2M1BA 2EFWA 2JPCA 3FHZA 1TLHB 4HLYA 1FX7A 2MA3A 2O8XA 2NS0A 5K5QA 2XAGA 4WX9A 3E6CC 1D8JA 5D8KB 2P5VA 4EJTA 4GO1A 5LRRA 4MEYF 2O6GE 4BQAA 5E1ZB 3KP4A 2HWVA 2P6SA 3ZMSA 1REPC 3RKWA 4A5MA 3HOSA 3KFWX 4N0BA 3KE2A 3WTZA 3NRVA 5ICGA 5HVQC 4M9ZA 2CGPA 3VOEA 4M9XA 5D6FA 5A2QK 1IUYA 1OYWA 1FSEA 3WODF 3J7AO 2NYXA 1R1UA 5FLXZ 3I0TA 3BDDA 2HQNA 1EH6A 4PGHA 3G3ZA 1J75A 1T0FA 5DUKA 4DQ2A 2LSOA 5A2QZ 3QPTA 1W7PD 2HEOA 1S7OA 3PQKA 3IRRA 1XDUA 2OZUA 6PAXA 4KICA 4L18B 3KCCA 1Z9CA 4Y15A 1EV7A 3HHHA 1CGPA 1J59A 4FX4A 1P2FA 4S04A 1Y0UA 2P8TA 1Z05A 3ZN0A 2HKXA 5FO5A 2FBKA 3BPXA 3RDIA 4XSXF 4KUMA 2FBIA 2BYVE 1F1ZA 4G7ZF 2DO7A 3FM3A 1F5TA 2P6TA 2MH2A 3DP7A 1QQIA 1R58A 1UB9A 4EM2A 4HDVA 1LQ1A 3CO7C 4U0YA 1WKMA 2PBIA 3JAMZ 1PP7U 1MJ9A 4HX4A 3R6SA 5L3FA 5L3DA 4IVNA 1BI1A 2QWWA 3I54A 3D5LA 4RGUA 2KIFA 1R5HA 3F8CA 2M5WA 2V1DA 3SZPA 3WTXC 4BHCA 1KGSA 5E18F 4M74A 1IXRC 3ULQB 4H0EA 2QVOA 3DF8A 1O57A 2GXGA 2D1VA 2L02A 4BAYA 1KQ9A 3IKTA 1R36A 4ENMA 5H6QA 3GLXA 2A5YB 2O61A 2F5CA 1KA8A 3GEZA 2M87A 4CHUA 3QP5A 1ODDA 3CTAA 2RNJA 2HQRA 4LG0B 1HBXG 4ASNA 1OPCA 2DW4A 1IN8A 2KIUA 1ONVA 1LJ9A 3WU0A 2XRNA 2DTRA 3HHGA 1RUOA 4I7HA 1IXSB 1QZYA 1USSA 4CXFA 3V4GA 3FXUA 2ZJ2A 3J80K 1FYLA 2O3FA 2UXNA 3TO6A 1HW1A 5E20A 1G3YA 2P7VB 2Z33A 5JFRA 3QOPA 5CVIA 3SXYA 2RV8A 1ZHFA 1YS6A 3W6JB 4UUVA 4I0AA 5DCFA 5CYVA 1O3RA 3MWMA 1R22A 4PGGA 1ZG5A 5BQTA 4ENKA 3VODA 4MEXF 1ZGAA 1UFMA 1O3QA 2F2EA 2EV6A 3KP3A 4PCQA 3RIRA 2RQPA 4F7ZA 4L9VA 5HLHA 5D6EA 4UHTA 4XSZF 4HBLA 5HDGA 1ZRFA 3E5XA 3F8NA 4JK1X 2M30A 4CYDA 1UCRA 2VBWA 3RPQA 2H94A 1DP7P 4LFUA 1QNTA 2FQ3A 1ZARA 5FD5A 2HFHA 1J2XA 2H09A 4EJUA 5ICCA 1P92A 1USTA 4HOBA 3RTRA 1K78B 3F22A 2VE9A 5CVRA 2V9VA 4CICA 4CZZA 4LK0F 2K7LA 1PP8F 3ZMUA 2K02A 3R4KA 2E7WA 1P4AA 2ZFWA 4AD9A 3PQJA 2IA0A 4XLNF 4Q5SF 1FPQA 1W5SA 4UNOA 1FZPB 3QU3A 3M9AA 5DEQA 4L9NA 2QYOA 1XDSA 4O6JA 1YG2A 1BIAA 3GUDA 1VTNC 1YW8A 3WE3A 2HR3A 4Q48A 4YIFA 2XASA 3L9FA 5D5UB 4LB5A 2G9WA 4LG0A 4I98B 5LGNA 3WGIA 3CUQC 3M1EA 2BE5F 2WC2A 1RIOH 1K79A 1D8KA 2QLZA 4RB3C 1SFXA 1D3YA 3BY6A 3GYHX 3QPHA 2CSOA 4L5JA 5E8IA 4ZYDA 1P6RA 3I64A 1ZRCA 4CGZA 4Y13A 1B4AA 2K86A 1H9GA 2YPRA 1IRGA 3CJNA 1L3LA 4UVBA 3F6OA 1TQMA 1BIBA 3AAFA 3QAHA 3WTUC 1U6GA 2Z9OA 1HW2A 4GYGA 1P4WA 3FF5A 3KZYA 1TBXA 2PMUA 4WXDA 1KU2A 4LLLA 5E1XA 2JZYA 2RDPA 3RJPA 3SQNA 3RKYA 4A12A 2VE8A 5D8LB 4I09A 3M8EA 2WV0A 4A0XA 3MZHA 2FRHA 4EQQA 3F21A 2F5DA 2FNAA 4G7OF 2LNBA 1PDNC 3F8FA 1YFHA 2PQ8A 1MJBA 3IKVA 2L54A 3MEXA 3HTSB 3GFMA 2DK5A 4BYYA 3ZMTA 3K1PA 2IVMA 1A04A 3ML6A 3GZ6A 1B9NA 1FNNA 1YS7A 3JSPA 2H6CA 2XUBA 2YX7A 1R00A 4Q4ZF 3CUOA 4B8XA 1K78A 5EEGA 4JQFA 4ETSA 2EFPA 1ZRDA 1XGSA 2OBPA 5FFZA 2ETHA 3ZQ7A 1LB2A 1CF7B 1BBYA 5HLGA 4K2EA 3RYPA 2VBXA 2IA2A 1BOAA 2D45A 3TO7A 3ELKA 1MGTA 4WF2A 3GWZA 1KU7A 1R23A 3WTTC 3T8TA 4P55A 4KMFA 2VC0A 2MLGA 2A6HF 2UZKA 4ZH4F 5L3GA 1BI2A 4Q47A 1U3EM 2EFNA 5D5VB 4OIRF 2EK5A 2GZWA 2P7CB 4HV5A 3OOPA 2PMHA 3V7SA 2FXAA 1FBUA 3HSEA 4KYWA 2UWMA 4OINF 2GQQA 4OIPF 2VONA 3LFKA 1W7PB 1WRJA 4HV6A 3ROUA 3ZPLA 4AWXB 1DPUA 1TTYA 2EFOA 3QU6A 1SD4A 2GWRA 4HA8A 2ACJA 3E6BA 3JSOA 1KQ0A 4MNUA 3BOQA 3L7WA 4L9JA 3KLOA 5HS9A 3IRQA 2P5KA 2ZKZA 2E7XA 4R8HA 2DPUA 1HKSA 4UV8A 2D2WA 3I59B 3E97A 1L0OC 3R0AA 2HGCA 4ZZLA 1YYVA 2HS5A 3BP8A 1TQIA 2X4HA 1G3SA 3S2WA 2A3SA 5DYMA 5AIQA 1GHCA 1SMTA 3DKWA 2Y75A 2CO5A 2FMYA 3F6VA 4D0PA 5LGTA 5BOXA 2BV6A 1EH8A 3RYRA 2DI3A 1B1BA 1XGMA 3BJOA 4A0ZA 5TRDA 5HS7A 1T39A 2RKHA 1IZ1A 2A6EF 2W25A 3F3XA 5D5XB 4I0BA 1U8RA 1YIOA 3BJ6A 1FC3A 1O3SA 2IPQX 4YIIA 1YLFA 4RGXA 4LB6B 2ZMEB 1CF7A 2Y0MA 4KIGA 2X0LA 1MZBA 2NRAC 4BNCA 5LHIA 4U7BA 2XROA 1WWXA 3F23A 2XV4S 3EETA 2ZBKA 5KVRA 1W4MA 2OD5A 3IL2A 3KP6A 1YW7A 2IP2A 1KU3A 2ESNA 4G6DA 2YR2A 4RB0A 2FE3A 4QWQA 2OAZA 4ZYHA 2PG4A 3C7JA 3K2ZA 5F1RA 1IW7F 2L3DA 4E70A 4BXUA 1NHAA 1O7LA 2YSRA 4O5VA 3COAC 5DD8A 3VFZA 4L9TA 3K9TA 2NNYA 3EYIA 1HQCA 4TV7A 2UXXA 1IRFA 1W5TA 1OR7A 3Q9SA 5ILSA 1W7PA 1U78A 3BPVA 4EV0A 3HYIA 3K1NA 5DV5A 4HAMA 4O3MA 3C1DA 3TQNA 2XGXA 3FZVA 2IA1A 4HF2A 1FOKA 1ULYA 2JSCA 4LJZF 3U2RA 3E6MA 4DNCA 1E17A 1V3FA 3N97A 3I59A 3KZZA 1ZLJA 4HW0A 1TNTA 1SAXA 3TKYA 1S8NA 2DFIA 2RGVA 2VT3A 5ICEA 1Q1HA 1RNLA 2EB7A 4NB5A 1HXDA 2CG4A 1Z91A 2IJLA 3HRMA 4A2UA 3T5XA 3Q9VA 5JI6A 1K6OA 2GIVA 2W85A 2QQBA 3IC7A 2IW5A 1AWCA 1B6AA 1TNSA 4M71A 4KIFA 2R7FA 1C0WA 4ESJA 3J80Z 4BHBA 2HTJA 5KK1A 3BJAA 4IJAA 4OIQF 3E3VA 3E6DA 2VN2A 4EM1A 5E17F 1T6SA 1LDDA 5LRSA 5CVVA 2C6YA 1T98A 3C18A 2FF4A 4LGWA 1H9TA 1ZN2A 2ZMEA 4HDUA 3GO5A 2DLLA 2VOPA 4G9YA 1ON1A 2FMLA 1ZGJA 5JR3A 5HOOA 5AONA 3WU1B 2COMA 3P9IA 1FYMA 1FYKA 5IT9K 4UXNA 3CO6C 1G6NA 2PFBA 3JW4A 3J81K 3H92A 4WK8F 2OA4A 3TDUC 2XVCA 4GYIA 4ON0A 3LAJA 4KN7X 3I53A 3F8BA 2Y48A 4WXHA 3B02A 2EFQA 2GA1A 2O0YA 2H6BA 2K27A 1F4KA 3CLOA 4HYEA 5CVUA 2NNNA 2XAJA 4FT8A 2J5OA 3C3WA 5ED4A 2HDCA 3ISPA 3L2CA 2P5LC 5E8GA 1YQAA 5LHHA 3GVAA 3RI4A 4Y17A 3D0SA 4KT5C 1YTYA 3ZMZA 4RGRA 4L0YB 3GZ5A 4KN4X 1F9NA 2W24A 2ZXJA 3P9CA 4WCGA 3WG9A 2QENA 5ICFA 1BN5A 1B59A 5L3BA 1ZAOA 3EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BM9 A;  4ENN A;  2EV5 A;  1I1S A;  2OQR A;  3W6K B;  1MD0 A;  2DQR A;  2ESH A;  4UV9 A;  1ON2 A;  5BPI A;  3FMS A;  4MTD A;  4IHT A;  1HKT A;  5JHU A;  2RC4 A;  4GGG A;  4UVC A;  1BJA A;  1I5Z A;  5TJJ A;  4HQM A;  1IN6 A;  4FX0 A;  1WQ2 A;  2ISY A;  1K7A A;  2XAF A;  3V7R A;  3KP5 A;  2GXB A;  1XMK A;  3JTG A;  4NQW A;  3HUG A;  1D5V A;  1RUN A;  5CJ9 A;  2IRF G;  3F8M A;  2A68 F;  5J8C A;  3WE2 A;  2M8E A;  2GA2 A;  2JPB A;  3T0Y A;  4RS8 A;  1IN7 A;  2G7H A;  3GFJ A;  2ZNZ A;  2L4A A;  5ERI A;  1JHH A;  3V8J A;  1ZRE A;  1UHM A;  1KYW A;  3DV8 A;  4UVA A;  1OYI A;  3PFI A;  3P9K A;  2ZCW A;  3R61 A;  2WWY A;  4R79 A;  3LST A;  4HX8 A;  1KQ8 A;  3BZ6 A;  5LLQ A;  4OOI A;  1BI0 A;  2G7U A;  1LVA A;  4N9H A;  1J0R A;  1V4R A;  2A61 A;  1FY7 A;  1I6X A;  1DUX C;  4HQE A;  4LMY A;  2JT1 A;  4U88 A;  1XSV A;  4L5I A;  5LEJ A;  3V8K A;  3MFK A;  1H0M A;  2FSW A;  2HYF A;  3LWF A;  3DXJ F;  5DUI A;  2QQA A;  3FMQ A;  2V1U A;  3T1B A;  2KIM A;  1XD7 A;  2F5E A;  5FB2 A;  4LD5 A;  1HST A;  1GXP A;  5AIP A;  2WTE A;  2MLK A;  4R1H A;  3O2P E;  3FXR A;  4M9S A;  1AOY A;  2FNP A;  3ZN1 A;  4KMU X;  1FT9 A;  1IXC A;  2LDU A;  3RKX A;  3MQ0 A;  3TGN A;  3EUH A;  5HLI A;  2L4M A;  1U2W A;  1FLI A;  4EJO A;  2K4B A;  4KFC A;  3SFZ A;  5JVT A;  1IAW A;  3ZP5 A;  2FOK A;  2RVC A;  4I02 A;  4OMZ A;  4XRF A;  2V6C A;  2PN6 A;  1WI9 A;  2VT2 A;  2EA2 A;  4RB2 C;  5L3C A;  1QGP A;  2AXL A;  2CYY A;  1TW3 A;  3TOA A;  3GFI A;  4ZYE A;  4HZF A;  1XMA A;  4FHT A;  3M7G A;  2FEZ A;  2BEO A;  1S29 A;  5E1W A;  4OMY A;  2ZNY A;  2R7D A;  4ESB A;  2FA5 A;  1OYY A;  4EGZ A;  1S7A A;  3HSF A;  4ZYG A;  4YFX F;  4HX7 A;  5IT3 A;  4G7H F;  3LA2 A;  2XKO A;  2BGC A;  1HKQ A;  2QZ8 A;  3HTU A;  5F6F A;  3EDP A;  4IHS A;  4P96 A;  2BBY A;  1WSU A;  3HRT A;  1O3T A;  3O3K A;  4NHJ A;  2P4W A;  1GVJ A;  1Z7U A;  1S6L A;  4U0W A;  4MQV A;  4KDP A;  5ILV A;  4MQ9 F;  3FM5 A;  2Q2E A;  5H6R A;  2OZ6 A;  4LLN A;  2STT A;  2HOE A;  4PDK A;  5F64 A;  4S05 A;  3BRO A;  4XLP F;  5FLX K;  5J6X A;  2FU4 A;  4IF4 A;  1LEA A;  1U5T B;  2VC1 A;  3EQL F;  4HLX A;  2FBH A;  4HF1 A;  1YW9 A;  2JRT A;  2VBZ A;  3ECO A;  1J5Y A;  4B09 A;  2XKP A;  1X3U A;  2E1N A;  4EVI A;  3FX3 A;  2PLY A;  1ZYR F;  3IWF A;  4EJV A;  3B73 A;  1IN5 A;  5J8F A;  1FBS A;  1P4X A;  1T2K A;  2YX4 A;  2MC3 A;  2ADU A;  3ECH A;  1LNW A;  3HSR A;  2HZT A;  3R60 A;  1Z1D A;  1XGO A;  4P5O A;  4RGS A;  2VBY A;  3NEU A;  5FFX A;  2RN7 A;  4MTE A;  3GFL A;  3JAM K;  1TW2 A;  3WTW C;  3LQR A;  1SFU A;  2MD5 A;  2O03 A;  4M73 A;  1R1V A;  3MZY A;  4L0Z B;  4YG2 F;  1BC8 C;  2J5P A;  5EEH A;  4PZJ A;  5D4R A;  4IRH A;  5DCM B;  1SMY F;  4AIH A;  1B9M A;  4M6Y A;  4EGY A;  1MDM A;  3L00 A;  4RB1 A;  4AIJ A;  3ERE D;  1ZG1 A;  2EA4 A;  5K5O A;  3V8L A;  4RAY A;  2CW0 F;  2AS5 F;  4QLC U;  4WWC A;  1XGN A;  1SD7 A;  4A6E A;  2TDX A;  5BMZ A;  2W57 A;  3DFG A;  5H20 A;  4MHG A;  1KU9 A;  1SD6 A;  3DQV C;  1ZH5 A;  4A6D A;  3ABT A;  2HTS A;  2OU2 A;  4OU0 A;  5K5R A;  4EMS A;  2DQL A;  5LHG A;  1YO5 C;  2PI0 A;  4P9F A;  4XBF A;  1U5T C;  3LAP A;  2Q8K A;  1G3T A;  3HOT A;  4WXC A;  3DPL C;  1LDJ A;  3SZT A;  1RZ4 A;  2PJP A;  3KP7 A;  1QO0 D;  3REO A;  3MCZ A;  5CVJ A;  4HF0 A;  1Z6T A;  2LF7 A;  2W84 A;  1DPR A;  4IPA A;  3VB2 A;  2Z5U A;  4CO8 A;  5DD4 A;  2R3S A;  1U5T A;  3CUQ B;  3HRS A;  1HW5 A;  5CLS A;  2OQG A;  1QBJ A;  1MJA A;  2QBY B;  2XIG A;  2KJB A;  2Z3Y A;  3QRF F;  3WTV C;  1SD5 A;  3WTY C;  2DBB A;  5LGU A;  1XSD A;  1I1G A;  5K1Y A;  3KEO A;  4GXO A;  1XCV A;  1O7F A;  3DPT A;  5HDK A;  2Q0O A;  5DDG A;  3CDH A;  2E1C A;  2ELH A;  4CDG A;  2B0L A;  4G6Q A;  1E2X A;  4MGR A;  3KLN A;  1I27 A;  4LK1 F;  4BHP A;  1XCB A;  3DEU A;  2GAU A;  1KYZ A;  1XN7 A;  3FMR A;  2JTV A;  4EM0 B;  2A69 F;  5D5W B;  3NQO A;  4U7D A;  5BPD A;  1LDK B;  2IT0 A;  5IT9 Z;  1R1T A;  1EH7 A;  5BS6 A;  4KA4 A;  5D4S A;  2DT5 A;  5DCM A;  3J81 Z;  3K69 A;  1XSX A;  4YFK F;  3I71 A;  2NAZ A;  1OMI A;  4N9I A;  4ZZD A;  3VEP A;  4ENJ A;  2QM3 A;  3TOB A;  4YFN F;  2VXZ A;  3G73 A;  1JHF A;  3LA3 A;  3WGG A;  3TDZ C;  1T38 A;  2A07 F;  1GXQ A;  3K0L A;  1R5G A;  3GW2 A;  3I4P A;  3GF2 A;  1QPM A;  3K1M A;  1FP2 A;  1OKR A;  2DK8 A;  4AVP A;  1DDN A;  1FSH A;  2ZO4 A;  4OIO F;  2XAH A;  4GCV A;  2YU3 A;  3HIF A;  3R0J A;  3E5U A;  2DU9 A;  3OV8 A;  3O6B B;  1PUE E;  4G94 A;  2VOD A;  3IHU A;  3M8F A;  3SHF A;  2KRF A;  3P7N A;  2CWE A;  1ZG3 A;  3H3U A;  2F5F A;  4Z2Y A;  3GX4 X;  4G8X A;  3GXO A;  2PEX A;  2ISZ A;  1UHW A;  3WTS C;  4I01 A;  3Q5F A;  5HS8 A;  1J9I A;  4I2O A;  2HYG D;  3H3Z A;  3E5Q A;  3I58 A;  1Z6R A;  3KEQ A;  2VOO A;  1STZ A;  3CUQ A;  3V7C A;  4KNY A;  5FD6 A;  2V79 A;  3ZMD A;  1RI7 A;  4P9U A;  2DPD A;  1MKM A;  4JBA A;  5HDN A;  2QBY A;  2H27 A;  1JGS A;  2XAQ A;  2CQK A;  2KKO A;  4M6X A;  5ILU A;  2CFX A;  2XHK A;  3JTH A;  2QQ9 A;  1FWZ A;  3RPU A;  3KET A;  4IRG A;  2D1H A;  3FXQ A;  2K4J A;  2LF8 A;  3N4M A;  1IF1 A;  4AIK A;  3IWZ A;  4BH9 A;  1BC7 C;  4ESF A;  3KP2 A;  2LKP A;  5L3E A;  1FP1 D;  2EJR A;  3U1D A;  3I5U A;  4U0V A;  2Z99 A;  2QUF A;  4IXA A;  2EV0 A;  1G3W A;  3BWG A;  3MAJ A;  4KIB A;  2V1X A;  4A5N A;  2MH9 A;  1LEB A;  3U9G A;  1TQP A;  2HKO A;  1J7K A;  1JXS A;  1S3J A;  2EWN A;  3HRU A;  5FGM A;  3LQQ A;  2MBF A;  2L01 A;  1SFE A;  1QZZ A;  3T8R A;  2STW A;  3TO9 A;  1R7J A;  4LLG F;  1BI3 A;  1HSJ A;  3LA7 A;  1XB4 A;  1G4D A;  3F72 A;  5LBQ A;  1MDM B;  5LEK A;  2KJC A;  3QP6 A;  3L09 A;  4EJW A;  2M45 A;  1ZLK A;  1FBQ A;  4A0Y A;  3FWE A;  4IRI A;  1IN4 A;  2DAO A;  3ABU A;  1JE8 A;  4M72 A;  3ZMV A;  3WGH A;  4RAZ A;  2M1B A;  2EFW A;  2JPC A;  3FHZ A;  1TLH B;  4HLY A;  1FX7 A;  2MA3 A;  2O8X A;  2NS0 A;  5K5Q A;  2XAG A;  4WX9 A;  3E6C C;  1D8J A;  5D8K B;  2P5V A;  4EJT A;  4GO1 A;  5LRR A;  4MEY F;  2O6G E;  4BQA A;  5E1Z B;  3KP4 A;  2HWV A;  2P6S A;  3ZMS A;  1REP C;  3RKW A;  4A5M A;  3HOS A;  3KFW X;  4N0B A;  3KE2 A;  3WTZ A;  3NRV A;  5ICG A;  5HVQ C;  4M9Z A;  2CGP A;  3VOE A;  4M9X A;  5D6F A;  5A2Q K;  1IUY A;  1OYW A;  1FSE A;  3WOD F;  3J7A O;  2NYX A;  1R1U A;  5FLX Z;  3I0T A;  3BDD A;  2HQN A;  1EH6 A;  4PGH A;  3G3Z A;  1J75 A;  1T0F A;  5DUK A;  4DQ2 A;  2LSO A;  5A2Q Z;  3QPT A;  1W7P D;  2HEO A;  1S7O A;  3PQK A;  3IRR A;  1XDU A;  2OZU A;  6PAX A;  4KIC A;  4L18 B;  3KCC A;  1Z9C A;  4Y15 A;  1EV7 A;  3HHH A;  1CGP A;  1J59 A;  4FX4 A;  1P2F A;  4S04 A;  1Y0U A;  2P8T A;  1Z05 A;  3ZN0 A;  2HKX A;  5FO5 A;  2FBK A;  3BPX A;  3RDI A;  4XSX F;  4KUM A;  2FBI A;  2BYV E;  1F1Z A;  4G7Z F;  2DO7 A;  3FM3 A;  1F5T A;  2P6T A;  2MH2 A;  3DP7 A;  1QQI A;  1R58 A;  1UB9 A;  4EM2 A;  4HDV A;  1LQ1 A;  3CO7 C;  4U0Y A;  1WKM A;  2PBI A;  3JAM Z;  1PP7 U;  1MJ9 A;  4HX4 A;  3R6S A;  5L3F A;  5L3D A;  4IVN A;  1BI1 A;  2QWW A;  3I54 A;  3D5L A;  4RGU A;  2KIF A;  1R5H A;  3F8C A;  2M5W A;  2V1D A;  3SZP A;  3WTX C;  4BHC A;  1KGS A;  5E18 F;  4M74 A;  1IXR C;  3ULQ B;  4H0E A;  2QVO A;  3DF8 A;  1O57 A;  2GXG A;  2D1V A;  2L02 A;  4BAY A;  1KQ9 A;  3IKT A;  1R36 A;  4ENM A;  5H6Q A;  3GLX A;  2A5Y B;  2O61 A;  2F5C A;  1KA8 A;  3GEZ A;  2M87 A;  4CHU A;  3QP5 A;  1ODD A;  3CTA A;  2RNJ A;  2HQR A;  4LG0 B;  1HBX G;  4ASN A;  1OPC A;  2DW4 A;  1IN8 A;  2KIU A;  1ONV A;  1LJ9 A;  3WU0 A;  2XRN A;  2DTR A;  3HHG A;  1RUO A;  4I7H A;  1IXS B;  1QZY A;  1USS A;  4CXF A;  3V4G A;  3FXU A;  2ZJ2 A;  3J80 K;  1FYL A;  2O3F A;  2UXN A;  3TO6 A;  1HW1 A;  5E20 A;  1G3Y A;  2P7V B;  2Z33 A;  5JFR A;  3QOP A;  5CVI A;  3SXY A;  2RV8 A;  1ZHF A;  1YS6 A;  3W6J B;  4UUV A;  4I0A A;  5DCF A;  5CYV A;  1O3R A;  3MWM A;  1R22 A;  4PGG A;  1ZG5 A;  5BQT A;  4ENK A;  3VOD A;  4MEX F;  1ZGA A;  1UFM A;  1O3Q A;  2F2E A;  2EV6 A;  3KP3 A;  4PCQ A;  3RIR A;  2RQP A;  4F7Z A;  4L9V A;  5HLH A;  5D6E A;  4UHT A;  4XSZ F;  4HBL A;  5HDG A;  1ZRF A;  3E5X A;  3F8N A;  4JK1 X;  2M30 A;  4CYD A;  1UCR A;  2VBW A;  3RPQ A;  2H94 A;  1DP7 P;  4LFU A;  1QNT A;  2FQ3 A;  1ZAR A;  5FD5 A;  2HFH A;  1J2X A;  2H09 A;  4EJU A;  5ICC A;  1P92 A;  1UST A;  4HOB A;  3RTR A;  1K78 B;  3F22 A;  2VE9 A;  5CVR A;  2V9V A;  4CIC A;  4CZZ A;  4LK0 F;  2K7L A;  1PP8 F;  3ZMU A;  2K02 A;  3R4K A;  2E7W A;  1P4A A;  2ZFW A;  4AD9 A;  3PQJ A;  2IA0 A;  4XLN F;  4Q5S F;  1FPQ A;  1W5S A;  4UNO A;  1FZP B;  3QU3 A;  3M9A A;  5DEQ A;  4L9N A;  2QYO A;  1XDS A;  4O6J A;  1YG2 A;  1BIA A;  3GUD A;  1VTN C;  1YW8 A;  3WE3 A;  2HR3 A;  4Q48 A;  4YIF A;  2XAS A;  3L9F A;  5D5U B;  4LB5 A;  2G9W A;  4LG0 A;  4I98 B;  5LGN A;  3WGI A;  3CUQ C;  3M1E A;  2BE5 F;  2WC2 A;  1RIO H;  1K79 A;  1D8K A;  2QLZ A;  4RB3 C;  1SFX A;  1D3Y A;  3BY6 A;  3GYH X;  3QPH A;  2CSO A;  4L5J A;  5E8I A;  4ZYD A;  1P6R A;  3I64 A;  1ZRC A;  4CGZ A;  4Y13 A;  1B4A A;  2K86 A;  1H9G A;  2YPR A;  1IRG A;  3CJN A;  1L3L A;  4UVB A;  3F6O A;  1TQM A;  1BIB A;  3AAF A;  3QAH A;  3WTU C;  1U6G A;  2Z9O A;  1HW2 A;  4GYG A;  1P4W A;  3FF5 A;  3KZY A;  1TBX A;  2PMU A;  4WXD A;  1KU2 A;  4LLL A;  5E1X A;  2JZY A;  2RDP A;  3RJP A;  3SQN A;  3RKY A;  4A12 A;  2VE8 A;  5D8L B;  4I09 A;  3M8E A;  2WV0 A;  4A0X A;  3MZH A;  2FRH A;  4EQQ A;  3F21 A;  2F5D A;  2FNA A;  4G7O F;  2LNB A;  1PDN C;  3F8F A;  1YFH A;  2PQ8 A;  1MJB A;  3IKV A;  2L54 A;  3MEX A;  3HTS B;  3GFM A;  2DK5 A;  4BYY A;  3ZMT A;  3K1P A;  2IVM A;  1A04 A;  3ML6 A;  3GZ6 A;  1B9N A;  1FNN A;  1YS7 A;  3JSP A;  2H6C A;  2XUB A;  2YX7 A;  1R00 A;  4Q4Z F;  3CUO A;  4B8X A;  1K78 A;  5EEG A;  4JQF A;  4ETS A;  2EFP A;  1ZRD A;  1XGS A;  2OBP A;  5FFZ A;  2ETH A;  3ZQ7 A;  1LB2 A;  1CF7 B;  1BBY A;  5HLG A;  4K2E A;  3RYP A;  2VBX A;  2IA2 A;  1BOA A;  2D45 A;  3TO7 A;  3ELK A;  1MGT A;  4WF2 A;  3GWZ A;  1KU7 A;  1R23 A;  3WTT C;  3T8T A;  4P55 A;  4KMF A;  2VC0 A;  2MLG A;  2A6H F;  2UZK A;  4ZH4 F;  5L3G A;  1BI2 A;  4Q47 A;  1U3E M;  2EFN A;  5D5V B;  4OIR F;  2EK5 A;  2GZW A;  2P7C B;  4HV5 A;  3OOP A;  2PMH A;  3V7S A;  2FXA A;  1FBU A;  3HSE A;  4KYW A;  2UWM A;  4OIN F;  2GQQ A;  4OIP F;  2VON A;  3LFK A;  1W7P B;  1WRJ A;  4HV6 A;  3ROU A;  3ZPL A;  4AWX B;  1DPU A;  1TTY A;  2EFO A;  3QU6 A;  1SD4 A;  2GWR A;  4HA8 A;  2ACJ A;  3E6B A;  3JSO A;  1KQ0 A;  4MNU A;  3BOQ A;  3L7W A;  4L9J A;  3KLO A;  5HS9 A;  3IRQ A;  2P5K A;  2ZKZ A;  2E7X A;  4R8H A;  2DPU A;  1HKS A;  4UV8 A;  2D2W A;  3I59 B;  3E97 A;  1L0O C;  3R0A A;  2HGC A;  4ZZL A;  1YYV A;  2HS5 A;  3BP8 A;  1TQI A;  2X4H A;  1G3S A;  3S2W A;  2A3S A;  5DYM A;  5AIQ A;  1GHC A;  1SMT A;  3DKW A;  2Y75 A;  2CO5 A;  2FMY A;  3F6V A;  4D0P A;  5LGT A;  5BOX A;  2BV6 A;  1EH8 A;  3RYR A;  2DI3 A;  1B1B A;  1XGM A;  3BJO A;  4A0Z A;  5TRD A;  5HS7 A;  1T39 A;  2RKH A;  1IZ1 A;  2A6E F;  2W25 A;  3F3X A;  5D5X B;  4I0B A;  1U8R A;  1YIO A;  3BJ6 A;  1FC3 A;  1O3S A;  2IPQ X;  4YII A;  1YLF A;  4RGX A;  4LB6 B;  2ZME B;  1CF7 A;  2Y0M A;  4KIG A;  2X0L A;  1MZB A;  2NRA C;  4BNC A;  5LHI A;  4U7B A;  2XRO A;  1WWX A;  3F23 A;  2XV4 S;  3EET A;  2ZBK A;  5KVR A;  1W4M A;  2OD5 A;  3IL2 A;  3KP6 A;  1YW7 A;  2IP2 A;  1KU3 A;  2ESN A;  4G6D A;  2YR2 A;  4RB0 A;  2FE3 A;  4QWQ A;  2OAZ A;  4ZYH A;  2PG4 A;  3C7J A;  3K2Z A;  5F1R A;  1IW7 F;  2L3D A;  4E70 A;  4BXU A;  1NHA A;  1O7L A;  2YSR A;  4O5V A;  3COA C;  5DD8 A;  3VFZ A;  4L9T A;  3K9T A;  2NNY A;  3EYI A;  1HQC A;  4TV7 A;  2UXX A;  1IRF A;  1W5T A;  1OR7 A;  3Q9S A;  5ILS A;  1W7P A;  1U78 A;  3BPV A;  4EV0 A;  3HYI A;  3K1N A;  5DV5 A;  4HAM A;  4O3M A;  3C1D A;  3TQN A;  2XGX A;  3FZV A;  2IA1 A;  4HF2 A;  1FOK A;  1ULY A;  2JSC A;  4LJZ F;  3U2R A;  3E6M A;  4DNC A;  1E17 A;  1V3F A;  3N97 A;  3I59 A;  3KZZ A;  1ZLJ A;  4HW0 A;  1TNT A;  1SAX A;  3TKY A;  1S8N A;  2DFI A;  2RGV A;  2VT3 A;  5ICE A;  1Q1H A;  1RNL A;  2EB7 A;  4NB5 A;  1HXD A;  2CG4 A;  1Z91 A;  2IJL A;  3HRM A;  4A2U A;  3T5X A;  3Q9V A;  5JI6 A;  1K6O A;  2GIV A;  2W85 A;  2QQB A;  3IC7 A;  2IW5 A;  1AWC A;  1B6A A;  1TNS A;  4M71 A;  4KIF A;  2R7F A;  1C0W A;  4ESJ A;  3J80 Z;  4BHB A;  2HTJ A;  5KK1 A;  3BJA A;  4IJA A;  4OIQ F;  3E3V A;  3E6D A;  2VN2 A;  4EM1 A;  5E17 F;  1T6S A;  1LDD A;  5LRS A;  5CVV A;  2C6Y A;  1T98 A;  3C18 A;  2FF4 A;  4LGW A;  1H9T A;  1ZN2 A;  2ZME A;  4HDU A;  3GO5 A;  2DLL A;  2VOP A;  4G9Y A;  1ON1 A;  2FML A;  1ZGJ A;  5JR3 A;  5HOO A;  5AON A;  3WU1 B;  2COM A;  3P9I A;  1FYM A;  1FYK A;  5IT9 K;  4UXN A;  3CO6 C;  1G6N A;  2PFB A;  3JW4 A;  3J81 K;  3H92 A;  4WK8 F;  2OA4 A;  3TDU C;  2XVC A;  4GYI A;  4ON0 A;  3LAJ A;  4KN7 X;  3I53 A;  3F8B A;  2Y48 A;  4WXH A;  3B02 A;  2EFQ A;  2GA1 A;  2O0Y A;  2H6B A;  2K27 A;  1F4K A;  3CLO A;  4HYE A;  5CVU A;  2NNN A;  2XAJ A;  4FT8 A;  2J5O A;  3C3W A;  5ED4 A;  2HDC A;  3ISP A;  3L2C A;  2P5L C;  5E8G A;  1YQA A;  5LHH A;  3GVA A;  3RI4 A;  4Y17 A;  3D0S A;  4KT5 C;  1YTY A;  3ZMZ A;  4RGR A;  4L0Y B;  3GZ5 A;  4KN4 X;  1F9N A;  2W24 A;  2ZXJ A;  3P9C A;  4WCG A;  3WG9 A;  2QEN A;  5ICF A;  1BN5 A;  1B59 A;  5L3B A;  1ZAO A;  3EYY A; 
#chains in the Genus database with same CATH topology
 1BM9 A;  4B43 A;  4ENN A;  3HM5 A;  4CYC B;  3A0B C;  2EV5 A;  5C3E J;  2NVY J;  1I1S A;  1D1C A;  2OQR A;  3LL7 A;  3W6K B;  1MD0 A;  2COB A;  2DQR A;  1WJC A;  3H5A A;  2ESH A;  1IRX A;  4UV9 A;  2DFF A;  1ON2 A;  1ACI A;  1SFK A;  5BPI A;  3FMS A;  4MTD A;  1XX5 A;  1I3A A;  4IHT A;  1HKT A;  5JHU A;  3DBR B;  2L9N A;  4B47 A;  2RC4 A;  4GGG A;  4UVC A;  1MBH A;  3DWL E;  4A3F J;  1BJA A;  1I5Z A;  2ZSH B;  5TJJ A;  5FKK A;  5F08 A;  2MD0 A;  4HQM A;  2EPF A;  1IN6 A;  5HOD A;  4FX0 A;  1WQ2 A;  2M7A A;  5EZG A;  2ISY A;  3OWT A;  3BR2 A;  1K7A A;  2XAF A;  3V7R A;  3KP5 A;  3CDI A;  2GXB A;  3AG1 H;  5B5E C;  4AM3 A;  1NTC A;  1XMK A;  3JTG A;  4NQW A;  3ZQG A;  3HUG A;  1X1D A;  3QWL A;  2DT7 B;  2X6Y A;  4UB8 C;  1D5V A;  3MKW B;  2VB6 A;  1QA6 A;  1RUN A;  1VFC A;  3TW7 A;  2DA3 A;  2M0M A;  5CJ9 A;  2IRF G;  3F8M A;  4DOZ A;  4PJM A;  3OIQ A;  2DA7 A;  1UMQ A;  2A68 F;  2LKX A;  5J8C A;  2L7M P;  2HVR A;  4A69 C;  3WE2 A;  1ETO A;  2M8E A;  2GA2 A;  3A01 A;  2JPB A;  3T0Y A;  2VJ4 A;  4C3I J;  4GRI A;  4RS8 A;  1IN7 A;  2ICW G;  1TWG J;  4XRS G;  2G7H A;  2HQA A;  3GFJ A;  5J1U A;  3BR5 A;  3QOD A;  4XN3 A;  2ZNZ A;  2L4A A;  5ERI A;  3AFH A;  1JHH A;  2ECC A;  2QKM B;  2Q2E B;  5M5Y J;  4NUB A;  3V8J A;  2PX9 A;  4QIW N;  3WG7 H;  2VL8 A;  1ZRE A;  1UHM A;  1KYW A;  3DV8 A;  4IZZ A;  4UVA A;  1OYI A;  2LP0 A;  3PFI A;  4FQG A;  3DKX A;  2VI6 A;  3A0H C;  3P9K A;  4XON A;  4BJ5 C;  3A02 A;  2XSD C;  2ZCW A;  3BG7 A;  3R61 A;  2WWY A;  1HDD C;  4R79 A;  5C4J J;  4BU2 A;  3LST A;  4HX8 A;  2DTZ A;  4BY7 J;  1KQ8 A;  3RZD J;  2LRE A;  3BZ6 A;  5LLQ A;  4A3K J;  3D5S C;  4OOI A;  1BI0 A;  1QRY A;  3PFY A;  2G7U A;  1LVA A;  1LKX A;  2DA4 A;  4N9H A;  3OY9 A;  1J0R A;  1S72 I;  1V4R A;  2A61 A;  2BXY A;  3CP8 A;  1FY7 A;  1I6X A;  1DUX C;  1X1C A;  4HQE A;  4LMY A;  2IEK A;  2DDA A;  2JT1 A;  4U88 A;  4XL9 A;  1XSV A;  2AO9 A;  4L5I A;  5LEJ A;  3V8K A;  3MFK A;  1H0M A;  2FSW A;  1QPI A;  2HYF A;  5GPC A;  3LWF A;  2NS8 A;  1MBF A;  2JA2 A;  3DXJ F;  5DUI A;  3HC7 A;  2QQA A;  3DTI A;  5H2F C;  2DOF A;  3FMQ A;  3TP3 A;  2V1U A;  3T1B A;  2KIM A;  1XD7 A;  2F5E A;  4I76 A;  4MO7 A;  4MIM A;  4LD5 A;  1HST A;  5FB2 A;  1GXP A;  5AIP A;  2WTE A;  2MLK A;  1VQL I;  4R1H A;  3O2P E;  2ZXI A;  2L9V A;  5FLM J;  4LIU A;  2K9L A;  3FXR A;  4M9S A;  1G2H A;  1AOY A;  1MMG A;  2FNP A;  3ZN1 A;  4KMU X;  2KZG A;  4PJL A;  5IY5 H;  1FT9 A;  1E3H A;  1IXC A;  2LDU A;  3RKX A;  4E7J A;  1HC8 A;  2JRM A;  3MQ0 A;  3TGN A;  3EUH A;  4C2T A;  5HLI A;  2L4M A;  2E2I J;  1FOX A;  3C2G A;  1U2W A;  1JKO C;  1FLI A;  4EJO A;  2JA7 J;  1FTT A;  2DN0 A;  3G4S I;  2K4B A;  1VQM I;  1VQ6 I;  4KFC A;  3SFZ A;  5JVT A;  1IAW A;  2GBY A;  4F52 A;  3ZP5 A;  2Y9Z A;  2FOK A;  4ZDL A;  1MNM C;  2RVC A;  4I02 A;  3BR0 A;  4OMZ A;  4IO9 F;  4XRF A;  2V26 A;  1NG7 A;  3BG6 A;  1HA8 A;  1R49 A;  2V6C A;  1T8I A;  4P1W A;  2PN6 A;  1WI9 A;  4A3G J;  5TGT A;  2VT2 A;  2EA2 A;  1QVU A;  5L3C A;  4RB2 C;  1ETY A;  1QGP A;  4CYC A;  2AXL A;  2CYY A;  2NS7 A;  1TW3 A;  3DTE A;  4IL6 C;  3TOA A;  1XC5 A;  3GFI A;  4ZYE A;  4HZF A;  4ZTF A;  3IH2 A;  1XMA A;  4FHT A;  1VQN I;  3M7G A;  2FEZ A;  2BEO A;  2NOJ B;  1S29 A;  5E1W A;  4OMY A;  2ZNY A;  2F48 A;  2R7D A;  4ESB A;  1NH3 A;  2OCC H;  1MMA A;  2FA5 A;  1OYY A;  1Y39 A;  3SDG A;  2ZXW H;  3J7Y J;  4EGZ A;  1S7A A;  3M3Y J;  3K4B A;  2DYS H;  3HSF A;  4ZYG A;  3KYD B;  4V2G A;  4YFX F;  1W1W E;  4HX7 A;  5IT3 A;  1JUS A;  3I55 I;  1POG A;  2MGQ A;  4G7H F;  3LA2 A;  2XKO A;  2BGC A;  1UAA A;  2AQE A;  2HXI A;  4NBQ A;  1HKQ A;  2NXN B;  2QZ8 A;  3HTU A;  2LYC A;  3I4N J;  4BE0 A;  5F6F A;  3EDP A;  4IHS A;  2WAE A;  1TT0 A;  4P96 A;  2BBY A;  1WSU A;  3TED A;  3HRT A;  2WY7 Q;  1O3T A;  3O3K A;  1TWH J;  4NHJ A;  1S7E A;  2P4W A;  3MKY B;  1GVJ A;  1Z7U A;  1S6L A;  1X4O A;  4U0W A;  5IOZ A;  2VJJ A;  3DU6 A;  2EIN H;  1ITY A;  4MQV A;  4FAS D;  2DJN A;  3GTJ J;  4KDP A;  5ILV A;  4MQ9 F;  3FM5 A;  1YE9 A;  2Q2E A;  5H6R A;  2OZ6 A;  5JLX A;  1RKT A;  4LLN A;  2STT A;  3OR2 C;  1W5C C;  2HOE A;  2HOT A;  4PDK A;  4H4K C;  2ECB A;  5F64 A;  4S05 A;  3BRO A;  4XLP F;  5FLX K;  5J6X A;  2FU4 A;  3HDD A;  2OV7 A;  4IF4 A;  1K4S A;  1LEA A;  1XTA A;  1TT5 B;  1U5T B;  2VC1 A;  2LK2 A;  2Q1Z B;  4XKV A;  2ZC2 A;  3EQL F;  4HLX A;  2FBH A;  4HF1 A;  1YW9 A;  2JRT A;  2VBZ A;  3ECO A;  1WJ5 A;  1J5Y A;  1YIJ I;  4B09 A;  2XKP A;  4S0H B;  3S3M A;  1NG6 A;  3L1P A;  1X3U A;  2E1N A;  2MFZ A;  3FX3 A;  1GVD A;  1ZYR F;  2V9K A;  4EVI A;  2PLY A;  2EZI A;  2VQH A;  3IWF A;  4EJV A;  2BVM A;  2WB1 N;  3B73 A;  1IN5 A;  3L2Q A;  1DU6 A;  4Y33 A;  5J8F A;  1R71 A;  3JR9 A;  3KYC B;  1FBS A;  1P4X A;  1T2K A;  1YX3 A;  3HOV J;  2YX4 A;  3DKY A;  2MC3 A;  3KZI C;  5EDN A;  2ADU A;  4BY1 J;  2DA2 A;  2HQ5 A;  2O5R A;  5IYC J;  3ECH A;  1LNW A;  3HSR A;  1A35 A;  5LD2 C;  2JA8 J;  2HZT A;  4E7S A;  1LFU P;  3R60 A;  3VYR B;  3HOX J;  3CLQ A;  1WJD A;  1Z1D A;  3K4M A;  4I99 C;  1XGO A;  4P5O A;  4RGS A;  5IYB J;  3FIS A;  2VBY A;  3FXL A;  2L0K A;  5KCM A;  3NEU A;  3OYC A;  3I4M J;  5FFX A;  2RN7 A;  1MSF C;  4MTE A;  3GFL A;  2XGC A;  1W0T A;  4CCL A;  4DZJ A;  3JAM K;  1TW2 A;  3LOC A;  4C3J J;  1WGX A;  3I56 I;  3WTW C;  3LQR A;  2ZXH A;  1SFU A;  2HI3 A;  2MD5 A;  3SZG A;  2O03 A;  4M73 A;  3E0J B;  3G2B A;  1R1V A;  3DEE A;  3MZY A;  1LFP A;  4L0Z B;  4YG2 F;  2JVH A;  1BC8 C;  2QEX I;  1RES A;  4JOM A;  2VPL A;  2J5P A;  3DBH B;  3IAM 2;  5EEH A;  4PZJ A;  2A5W A;  5D4R A;  4IRH A;  5DCM B;  1SMY F;  4AIH A;  2L9S A;  5K7F A;  1A6I A;  3S93 A;  4V19 K;  2WAQ A;  5F0C A;  1B9M A;  3OS0 A;  2X1D A;  4M6Y A;  2K85 A;  4EGY A;  1MDM A;  3L00 A;  4RB1 A;  4AIJ A;  3ERE D;  3K70 C;  2X51 A;  3PNT A;  1ZG1 A;  2ME6 A;  1WJF A;  2EA4 A;  5K5O A;  3V8L A;  4RAY A;  1ZEL A;  3IP4 B;  2CW0 F;  3VSK A;  2AS5 F;  5KNL A;  4BDY A;  4QLC U;  4WWC A;  1XGN A;  1SD7 A;  1I39 A;  2Y0S A;  4A6E A;  2TDX A;  2XF5 A;  5BMZ A;  4HSR A;  2W57 A;  3AG2 H;  3K4L A;  3DFG A;  2UV1 A;  5H20 A;  4MHG A;  1YIT I;  1KU9 A;  1SD6 A;  4J01 A;  3DQV C;  4HPQ A;  1ZH5 A;  4A6D A;  3ABT A;  1RPW A;  2R0Q C;  2M34 A;  1IDZ A;  2DCE A;  4IOC F;  2HTS A;  3PIO F;  5B1B H;  2VJ5 A;  3GCM A;  2OU2 A;  1Y8Q B;  2WAF A;  4OU0 A;  2JK3 A;  5K5R A;  4EMS A;  2IGN A;  3GBG A;  2DQL A;  3SYT A;  5LHG A;  3BC8 A;  2Z1D A;  1YO5 C;  4W1U A;  2PI0 A;  4P9F A;  3KEY A;  4XBF A;  1U5T C;  3ZQF A;  2I8D A;  1WJB A;  2EZK A;  2K5C A;  3LAP A;  2K9M A;  3S17 J;  1AA7 A;  2KFD A;  2NVX J;  2Q8K A;  3OYM A;  1G3T A;  1MW7 A;  3HOU J;  3HOT A;  4WXC A;  1TWF J;  3DPL C;  1GLN A;  1LDJ A;  4JX6 A;  3SZT A;  1RZ4 A;  2VJI A;  1V54 H;  2PJP A;  3KP7 A;  3GME A;  3OOU A;  1QO0 D;  3REO A;  3E7L A;  1X4P A;  3BTL A;  4NDL A;  3MCZ A;  4LIV A;  5CVJ A;  1YI2 I;  5C44 J;  3TP0 A;  2LY1 A;  4HF0 A;  4NQW B;  1Z6T A;  3CMM A;  2LF7 A;  2W84 A;  1DPR A;  3OYF A;  3OYG A;  4IPA A;  5E3M A;  3VB2 A;  2Z5U A;  4CO8 A;  5DD4 A;  2R3S A;  5J40 A;  1U5T A;  3OR1 C;  4NC8 A;  1EF4 A;  2I10 A;  3CUQ B;  2X85 A;  3HRS A;  3FK7 A;  1YJW I;  1HW5 A;  5CLS A;  2HVQ A;  1Z67 A;  2OQG A;  2N8G A;  1QBJ A;  1MJA A;  3VWB A;  4UB6 C;  2QBY B;  2XIG A;  5EG0 B;  2KJB A;  2Z3Y A;  3QRF F;  3DBL B;  3WTV C;  2HDD A;  1IGN A;  1SD5 A;  1A36 A;  2CH0 A;  3JCU C;  2JA5 J;  3WTY C;  2X48 A;  5M5X J;  2DBB A;  5LGU A;  1XSD A;  2DOD A;  1I1G A;  4NNJ A;  5K1Y A;  1FJL A;  3KEO A;  4GXO A;  3J7A Y;  1VQ7 I;  4BJT A;  4LIT A;  1XCV A;  2PJR B;  2KMU A;  1O7F A;  3DPT A;  5HDK A;  2W1O A;  5JHF A;  4XKC A;  1NK2 P;  2Q0O A;  5DDG A;  3CDH A;  2E1C A;  4AYB N;  2ELH A;  2FJ1 A;  4CDG A;  2B0L A;  4G6Q A;  1E2X A;  2TRT A;  3ONQ A;  2X6W A;  4MGR A;  5HLT A;  3WU2 C;  3CCQ I;  1MBK A;  3KLN A;  1TWA J;  1E0E A;  1I27 A;  4LK1 F;  3CF2 A;  4BHP A;  1XCB A;  3DEU A;  1BR4 A;  1TZL A;  1XG1 A;  2A6T A;  2GAU A;  2VKE A;  1CQT A;  2WBM A;  1KYZ A;  2K3F A;  3JRH A;  4G12 A;  3BZK A;  1EA3 A;  1XN7 A;  3FMR A;  2EIJ H;  2JTV A;  1X1A A;  3K4C A;  3GLL A;  4EM0 B;  3H3V K;  1I6H J;  2A69 F;  5D5W B;  3NQO A;  2YU9 J;  3QYF A;  4U7D A;  5BPD A;  1LDK B;  2IT0 A;  3BLY A;  5IT9 Z;  1Z3Y A;  1R1T A;  1EH7 A;  2HNH A;  2BZT A;  5BS6 A;  5D4S A;  4KA4 A;  2DT5 A;  5DCM A;  3J81 Z;  3K69 A;  5M3F J;  1XSX A;  1VF9 A;  3F9K A;  4YFK F;  3I71 A;  2NAZ A;  4MFD A;  1OMI A;  4N9I A;  4ZZD A;  3VEP A;  4M3G A;  4ENJ A;  2QM3 A;  3TOB A;  4YFN F;  2VXZ A;  1T33 A;  1IUF A;  3HPH A;  3G73 A;  1JHF A;  3LA3 A;  2KPM A;  1Z7L A;  4E7Z A;  3H9Q A;  3CJQ B;  1UHS A;  1ZKG A;  3WGG A;  3TDZ C;  1RET A;  1T38 A;  2A07 F;  2V4J C;  1X2M A;  2XC7 A;  2X1E A;  1GXQ A;  3K0L A;  3OYN A;  2QSG X;  5EZH A;  1OCZ H;  1R5G A;  1RC9 A;  1XMX A;  3GW2 A;  2EZH A;  3OL4 A;  3I4P A;  1JI8 A;  2F4O B;  2NVQ J;  2FQ4 A;  3GF2 A;  1QPM A;  3K1M A;  3AKZ A;  2NVU B;  1FP2 A;  3FKI J;  1OKR A;  2DK8 A;  4IQJ A;  2ELK A;  2EH3 A;  3PUF A;  4AVP A;  5E3O A;  1DDN A;  1FSH A;  2M4K A;  2ZO4 A;  1QU3 A;  4OIO F;  4II2 A;  2WAQ N;  2XAH A;  4GCV A;  4C30 A;  1DGW Y;  1X1P A;  2YU3 A;  1BR2 A;  3HIF A;  3R0J A;  3E5U A;  4GDF A;  2CUF A;  2DU9 A;  3OV8 A;  3O6B B;  1LPQ A;  1PUE E;  3S1N J;  4G94 A;  2VOD A;  1VQK I;  3IHU A;  3M8F A;  3K4N A;  3CC7 I;  3SHF A;  2KRF A;  3P7N A;  1YX5 A;  2CWE A;  1ZG3 A;  2H1L A;  1Z3X A;  1PYV A;  2XRL A;  3H3U A;  4YRV A;  4ZC3 A;  2F5F A;  4Z2Y A;  5F1J A;  4G8X A;  3GX4 X;  2V6E A;  2W48 A;  3GXO A;  2Y0S N;  2PEX A;  2ISZ A;  1UHW A;  1PJR A;  2QA4 I;  3FKJ A;  3PSI A;  3WTS C;  1UZC A;  2E2J J;  4I01 A;  4OWR B;  4RMN A;  3Q5F A;  1MMS A;  5HS8 A;  1MH3 A;  1J9I A;  4I2O A;  1MIJ A;  4CH7 A;  2HYG D;  3H3Z A;  3E5Q A;  1VQ4 I;  3I58 A;  1Z6R A;  3X2Q H;  3KEQ A;  1YHQ I;  2R5Y B;  2VOO A;  1STZ A;  3CUQ A;  2OPT A;  3V7C A;  2KT0 A;  2HDW A;  3RSN A;  4KNY A;  2X6X A;  4E7H A;  1KON A;  4B4C A;  4J00 A;  5FD6 A;  2AXT C;  2V79 A;  1F43 A;  1E3O C;  3ZMD A;  2OJE D;  1RI7 A;  4XLC A;  4P9U A;  2XPV A;  3NAU A;  1MKM A;  2DPD A;  1D5Y A;  4JBA A;  2WB1 A;  5HDN A;  1A31 A;  2R7X A;  2VKV A;  2QBY A;  5EG0 A;  5GAH J;  5F04 A;  2H27 A;  4DW6 A;  1JGS A;  2XAQ A;  2CQK A;  2KKO A;  1JKR C;  4M6X A;  4DBR A;  5ILU A;  5F0H A;  4A3I J;  3DCF A;  2M0C A;  3K4J A;  2CFX A;  2XHK A;  2V7F A;  3JTH A;  2QQ9 A;  3WHB A;  1FWZ A;  1RR8 C;  3RPU A;  3KET A;  4CCJ A;  1JKP C;  4IRG A;  2D1H A;  1IDY A;  2FUG 2;  2PJR A;  3FXQ A;  2KLO A;  2K4J A;  2VQG A;  4XKB A;  2LF8 A;  3N4M A;  1IF1 A;  2AQF A;  4AIK A;  2BXZ A;  2F4M B;  3IWZ A;  4BH9 A;  1BC7 C;  2MAB A;  4ESF A;  3KP2 A;  2LKP A;  1D0X A;  2E19 A;  2LD5 A;  2KQR A;  2BOL A;  5L3E A;  2RAE A;  1FP1 D;  2EJR A;  2KDO A;  3U1D A;  3I5U A;  4U0V A;  2Z99 A;  3EUH C;  1YOV B;  1NK3 P;  4FCY A;  2QUF A;  4IXA A;  1JJ6 C;  2EV0 A;  1G3W A;  2H8R A;  3BWG A;  5E79 C;  3S16 J;  3MAJ A;  4KIB A;  3CDL A;  1WI3 A;  2V1X A;  3Q3S A;  4HNU A;  3ZXS A;  4A5N A;  2MH9 A;  1DU0 A;  1LEB A;  2HPI A;  4A3C J;  3I9V 2;  3JRD A;  3U9G A;  1TQP A;  1K6Y A;  5IYD J;  2JMW A;  2HKO A;  1F36 A;  2X1C A;  3SEQ A;  4RDU A;  1J7K A;  3GZN B;  1JXS A;  4F91 B;  1S3J A;  2CV2 A;  1ETK A;  2EWN A;  4BXF A;  1HCR A;  3HRU A;  5FGM A;  2WAD A;  3LQQ A;  4AVZ A;  1R4M B;  2MBF A;  2L01 A;  2VXD A;  5FKL A;  1JUP A;  1DP3 A;  4CCO A;  2VUM J;  1SFE A;  1QZZ A;  3T8R A;  2STW A;  2E60 A;  3BG9 A;  4XOR A;  3S3O A;  3C2B A;  3TO9 A;  1R7J A;  4LLG F;  2ZJR F;  1IV6 A;  5HNH A;  1BI3 A;  1LE8 B;  1HSJ A;  3LA7 A;  1XB4 A;  4YEJ A;  1YRN B;  2M7B A;  1G4D A;  3ABK H;  3F72 A;  5LBQ A;  4ZJZ A;  1MDM B;  2ID6 A;  3H0G J;  5LEK A;  4CSW A;  1G8X A;  1QZE A;  2H8W A;  2BHY A;  2KJC A;  2GOM A;  3QP6 A;  3L09 A;  3QPL A;  3EUA A;  1OCC H;  3TBI A;  2GIZ A;  1WZ2 A;  1WH5 A;  4EJW A;  1QHG A;  2CV1 A;  2M45 A;  3P5J A;  2UUZ A;  2ELJ A;  2Y69 H;  2JQ7 A;  2W7N A;  3DLA A;  1ZLK A;  1FBQ A;  4A0Y A;  4XLA A;  1MBE A;  3FWE A;  4IRI A;  4NC7 A;  3GTK J;  1IN4 A;  4XOT A;  2ZJQ F;  1K83 J;  3M07 A;  2DAO A;  3NWT A;  3ABU A;  4BEH B;  1JE8 A;  4PJN A;  3A03 A;  4M72 A;  4RM3 A;  3ZMV A;  3WGH A;  3HBL A;  3CD6 I;  4RAZ A;  2M1B A;  2EFW A;  1FMV A;  2JPC A;  2VKH A;  4Y52 J;  1UG2 A;  3FHZ A;  1TLH B;  4HLY A;  1FX7 A;  2MA3 A;  2R5Y A;  3BR1 A;  2DA1 A;  2O8X A;  2P0W A;  3OIO A;  2NS0 A;  1SAN A;  5K5Q A;  2DYR H;  2XAG A;  2YUS A;  4WX9 A;  4XKW A;  4PUS A;  1FTZ A;  3E6C C;  1OCO H;  1D8J A;  5FKO A;  5D8K B;  5EYR A;  2P5V A;  2CV0 A;  4EJT A;  2BVL A;  4GO1 A;  5LRR A;  4MEY F;  2O6G E;  4BQA A;  5E1Z B;  2IS4 A;  3BCA A;  3KP4 A;  3OSG A;  1D1B A;  4QPQ A;  2HWV A;  3WHC A;  2P6S A;  3K2A A;  3HG9 A;  4BE2 A;  3ZMS A;  4E7K A;  1REP C;  1X3Z B;  3RKW A;  4A5M A;  1FIA A;  3MKZ A;  3HOS A;  3LSI A;  3KFW X;  2CW7 A;  4N0B A;  3KE2 A;  4FIS A;  3WTZ A;  3NRV A;  3OIP A;  2EZL A;  1T0F C;  3BG3 A;  4AYB A;  3LNQ A;  5ICG A;  1N25 A;  2I5U A;  3M4O J;  5HVQ C;  4M9Z A;  2CGP A;  2OF7 A;  3VOE A;  4Y7N J;  1ERD A;  4M9X A;  5D6F A;  3HEF A;  5K7Z A;  5A2Q K;  3IAS 2;  1IUY A;  1OYW A;  1FSE A;  3WOD F;  4J19 A;  3L2R A;  3J7A O;  4HNV A;  2HXO A;  9ANT A;  3RCO A;  5DM6 F;  2NYX A;  3GTQ J;  1Y1W J;  2M3A A;  3MN2 A;  2OTL I;  2HU9 A;  1HOM A;  1EJ9 A;  1R1U A;  3I0T A;  2F5V A;  5FLX Z;  3BDD A;  4Z6Y A;  2HQN A;  1EH6 A;  4I6Z A;  4PGH A;  1IG7 A;  3G3Z A;  4E4H A;  1ETQ A;  1J75 A;  1T0F A;  1VQ8 I;  3JRG A;  5DUK A;  4DQ2 A;  2LSO A;  5A2Q Z;  3QPT A;  1W7P D;  2HEO A;  3LSJ A;  2L2O A;  1S7O A;  3PQK A;  2QCO A;  3IRR A;  1XDU A;  2OZU A;  4BGD A;  1E3P A;  6PAX A;  1P9Q C;  1A6Q A;  4KIC A;  4L18 B;  1WH7 A;  3KCC A;  3QYB A;  1Z9C A;  4Y15 A;  1JTY A;  5GTH C;  1EV7 A;  3HHH A;  1CGP A;  1J59 A;  1S9H A;  4L5E A;  5F27 A;  1P2F A;  3ZCO A;  4S04 A;  3OYE A;  1Y0U A;  2P8T A;  4FX4 A;  4IHY A;  1Z05 A;  3ZN0 A;  2HKX A;  2RQQ A;  5FO5 A;  2FBK A;  3BPX A;  2IGO A;  2R93 J;  3RDI A;  4XSX F;  4KUM A;  2FBI A;  2BYV E;  2AHQ A;  2IS6 A;  1F1Z A;  1D0Y A;  4G7Z F;  1WHU A;  1G59 A;  3G6E I;  2DO7 A;  3FM3 A;  2E71 A;  2CW8 A;  5J3L A;  5EEA A;  3K70 D;  1PUF B;  4MFE A;  1F5T A;  2P6T A;  5B3S H;  2MH2 A;  1W0U A;  3DP7 A;  1QQI A;  1R58 A;  1UB9 A;  3CCV I;  4EM2 A;  4E7L A;  4HDV A;  3GTL J;  2KIQ A;  3BR3 A;  1N75 A;  3CO7 C;  1IC8 A;  1LQ1 A;  3FXJ A;  4U0Y A;  3L2U A;  1LE8 A;  1WKM A;  2PBI A;  1AU7 A;  3JAM Z;  4BQO A;  1PP7 U;  2IXS A;  1IRZ A;  1MNE A;  2LVS A;  4X1E A;  3OS2 A;  1YRN A;  1MJ9 A;  4HX4 A;  1FOW A;  2LTP A;  4JYK A;  3R6S A;  5L3F A;  2OUM A;  5L3D A;  4ZDO A;  4IVN A;  4B48 A;  1BI1 A;  2QWW A;  2Y2Z A;  2K40 A;  3I54 A;  3LFU A;  2EIL H;  3HPG A;  1X19 A;  3D5L A;  4RGU A;  2KIF A;  4RAG A;  1R5H A;  3F8C A;  3ZQC A;  1YJ9 I;  1SVO A;  3S14 J;  2DMQ A;  3UKG A;  2DMN A;  3W2W A;  3L2W A;  2M5W A;  2R92 J;  4D7M A;  1V5F A;  2V1D A;  3SZP A;  3WTX C;  4BHC A;  1KGS A;  2E5N A;  5BNG A;  3H35 A;  5E18 F;  4M74 A;  2GM4 A;  1MND A;  1IXR C;  3ULQ B;  4H0E A;  2QVO A;  3DF8 A;  3H5R A;  4BS9 A;  3C2H A;  1O57 A;  2GXG A;  1V5G A;  2D1V A;  3HZJ A;  4BEH A;  3TW6 A;  4FE4 A;  2L02 A;  4BAY A;  4XQF A;  1KQ9 A;  3IKT A;  1R36 A;  4CUG A;  4ENM A;  3HKZ N;  3GLX A;  1ZK8 A;  5H6Q A;  2FX0 A;  3SEZ A;  1SAU A;  3B6C A;  2A5Y B;  2O61 A;  4XID A;  2A05 A;  1R4N B;  2XPU A;  3ZOB A;  3FBI B;  3JRF A;  2F5C A;  1KA8 A;  3GEZ A;  2M87 A;  3GTO J;  2LOO A;  4CHU A;  2LG4 A;  2CU7 A;  3QP5 A;  1YJN I;  3VDX A;  1ODD A;  3CTA A;  2LLK A;  2RNJ A;  2HQR A;  3IV5 A;  4LG0 B;  1HBX G;  4ASN A;  2GOX B;  3ABM H;  1OPC A;  5FRN A;  3AL0 B;  1U9O A;  5GAD J;  2DW4 A;  2R7R A;  4F92 B;  1IN8 A;  2CQ7 A;  5IP7 J;  2E5Z A;  2KIU A;  4PK4 A;  4QTR A;  2DMU A;  1ETW A;  1ONV A;  1LJ9 A;  3WU0 A;  2XRN A;  2DTR A;  2IAI A;  3HHG A;  1RUO A;  3BTI A;  1ETV A;  2QKL B;  2KIS A;  2ZJP F;  4I7H A;  1VQ9 I;  3H9J A;  3K7A J;  1IXS B;  1QZY A;  1UEL B;  1USS A;  4CXF A;  3V4G A;  2KZV A;  3FXU A;  1V55 H;  2ZJ2 A;  2DMT A;  3J80 K;  2DOA A;  3M8J A;  5C4X J;  3S1M J;  1FYL A;  2O3F A;  5DTD A;  2UXN A;  1GT0 C;  3QQA A;  3HOY J;  1N78 A;  3TO6 A;  2WA0 A;  1HW1 A;  3LSH A;  5E20 A;  3A1Y A;  3S3N A;  4PFO A;  1G3Y A;  1U0J A;  2P7V B;  5M5W J;  2Z33 A;  1R5I D;  3FK6 A;  5JFR A;  3QOP A;  2KDZ A;  3H36 A;  4IKF A;  5CVI A;  3SXY A;  3GTG J;  2RV8 A;  2V9P A;  1ZHF A;  1YS6 A;  3W6J B;  1BL0 A;  4UUV A;  4XRM A;  4I0A A;  5DCF A;  1R9T J;  5CYV A;  3MZ8 A;  1O3R A;  3MWM A;  1R22 A;  1Q1V A;  1XS9 A;  4PGG A;  1ZG5 A;  4D5C A;  5BQT A;  1TL8 A;  2K9S A;  4ENK A;  4RAF A;  4DBQ A;  3VOD A;  4B44 A;  1X1B A;  4MEX F;  1ZGA A;  4LOC A;  3VPR A;  1UFM A;  1O3Q A;  2F2E A;  5J1R A;  1BW5 A;  1OJL A;  2EV6 A;  3KP3 A;  4PSW A;  4A3L J;  4PCQ A;  3K4K A;  3RIR A;  3BTJ A;  2RQP A;  5J47 A;  4F7Z A;  4A3E J;  3MMY B;  3HGY A;  5E3N A;  4XIC A;  4UUS B;  4L9V A;  5HLH A;  3CZ6 A;  5DM7 F;  2ZB9 A;  3MD2 A;  3JRC A;  5D6E A;  1PUF A;  4UHT A;  3NAR A;  4XSZ F;  4HBL A;  1KZH A;  1VI0 A;  1I50 J;  4Y4R A;  5HDG A;  1ZRF A;  3E5X A;  4D1Q A;  3F8N A;  4IHX A;  4JK1 X;  2M30 A;  1UCR A;  4CYD A;  1HLV A;  2VBW A;  3RPQ A;  2H94 A;  1DP7 P;  1OCT C;  2K9Q A;  1Z0X A;  4LFU A;  1QNT A;  2FQ3 A;  1ZAR A;  2LY9 A;  5FD5 A;  4EEF G;  2HFH A;  1J2X A;  1SEU A;  2H09 A;  2GLO A;  4ABZ A;  3K6G A;  4M3F A;  4A3M J;  4EJU A;  1I3Q J;  1P92 A;  5ICC A;  2CUZ A;  1GV5 A;  2W82 A;  3BT9 A;  4XRS A;  1UST A;  1JTX A;  2LY2 A;  1ZQ3 P;  2VQL A;  4HOB A;  2R5Z B;  3RTR A;  1K78 B;  3KIO A;  3F22 A;  2VE9 A;  5CVR A;  2M8G X;  1OLT A;  4BE1 A;  2V9V A;  4CIC A;  4CZZ A;  4LK0 F;  3OMY A;  2K7L A;  1PP8 F;  3H5N A;  2CQQ A;  3ZMU A;  2K02 A;  3PJR A;  3R4K A;  2E7W A;  2O8K A;  1P4A A;  3OYH A;  2ZFW A;  4IX7 A;  4M3B A;  4AD9 A;  3PQJ A;  1R6R A;  2IA0 A;  4XLN F;  4D9J A;  3D5R C;  4AUX A;  3J7Z I;  4A3B J;  4Q5S F;  3FXM A;  1N77 A;  1FPQ A;  5FRO A;  3G1L A;  3FIW A;  2HOA A;  1W5S A;  3AL0 C;  5CPR B;  5IP9 J;  1FZP B;  4UNO A;  1Z77 A;  5CQG A;  3S1R J;  3QPS A;  3W2A A;  3QU3 A;  2VPR A;  3EUK L;  4C2U A;  3M9A A;  5DEQ A;  4L9N A;  2QYO A;  1M1E B;  3FXK A;  4CCN A;  3OYK A;  4OAZ A;  1XDS A;  3LSM A;  4XK4 A;  4O6J A;  2OTJ I;  1YG2 A;  1BIA A;  3GUD A;  1VTN C;  1P7I A;  2E36 A;  1YW8 A;  3CJR B;  3WE3 A;  2HR3 A;  3S32 A;  4JP0 A;  4Q48 A;  4YIF A;  2XAS A;  3L9F A;  3OYB A;  4C3H J;  5D5U B;  4HG2 A;  1WPK A;  1IO2 A;  2G9W A;  4LG0 A;  4LB5 A;  5F0F A;  2JA6 J;  1D1A A;  4I98 B;  5LGN A;  2DFH A;  3WGI A;  3CUQ C;  1ZR4 A;  3RPU D;  3M1E A;  1SFO J;  1MSE C;  2BE5 F;  2WC2 A;  1RIO H;  1K79 A;  4XLF A;  5JLW A;  1D8K A;  4JX4 A;  2QLZ A;  4RB3 C;  2IS2 A;  1A5J A;  1SFX A;  1OCR H;  1VQP I;  3LSP A;  2EIK H;  1Y1V J;  3CC4 I;  1D3Y A;  3QOE A;  3W6V A;  2PMZ A;  2E1M B;  5GAE J;  3G71 I;  3BY6 A;  3GYH X;  3QPH A;  4ZTJ A;  2CSO A;  4L5J A;  3PM1 A;  2F6C A;  5E8I A;  1UJ8 A;  2KL4 A;  4ZYD A;  1P6R A;  3PL8 A;  1JGG A;  3I64 A;  1ZRC A;  2JUC A;  4CGZ A;  3JRB A;  2BY1 A;  3OYI A;  4Y13 A;  1B4A A;  2K86 A;  1H9G A;  2YPR A;  5KAF C;  1IRG A;  3FXO A;  3O8G A;  3G1O A;  3CJN A;  1L3L A;  3CP2 A;  4DYR A;  4E7I A;  3PNV A;  4UVB A;  3CCJ I;  1T95 A;  3KYL A;  3F6O A;  5EJC A;  1TQM A;  1BIB A;  4EAT A;  3AAF A;  2HOS A;  2HVS A;  3QAH A;  3WTU C;  1U6G A;  1RKW A;  2Z9O A;  3CF5 F;  1HW2 A;  4GYG A;  3HB9 A;  1B8I B;  1MMN A;  2B63 J;  1FEX A;  1P4W A;  5CKT A;  3JRA A;  4DGW B;  1JJ8 C;  3FF5 A;  2X9D A;  3KZY A;  4KJZ A;  1SVM A;  1TBX A;  2PMU A;  4ITV A;  2RNG A;  4ZYA A;  4KIT B;  4WXD A;  1KU2 A;  1Y6I A;  2FD5 A;  4LLL A;  5E1X A;  4YIR X;  2JZY A;  2RDP A;  3ASN H;  3LSG A;  1FIP A;  3RJP A;  3S2D J;  3SQN A;  2DA6 A;  3RKY A;  2DFE A;  4A12 A;  2VE8 A;  2Y9Y A;  5D8L B;  4XLH A;  4XNF A;  5FKN A;  4I09 A;  2H1K A;  3M8E A;  2WV0 A;  4A0X A;  2MC4 A;  3MZH A;  1DQU A;  4BJ6 C;  3S1Q J;  1VQO I;  1LFB A;  4XM3 A;  2FRH A;  4EQQ A;  3F21 A;  4A3J J;  2F5D A;  2FNA A;  4G7O F;  2LNB A;  2XGE A;  1PDN C;  4UUS A;  3F8F A;  3CCM I;  1ENH A;  1YFH A;  2PQ8 A;  1MJB A;  3CJT B;  3IKV A;  4JX5 A;  3CCE I;  2L54 A;  4PJ0 C;  1MH4 A;  4HNT A;  1MBG A;  1S5L C;  2JUG A;  3MEX A;  2LFB A;  3GFM A;  3HTS B;  3CCS I;  4HRI A;  3S2H J;  2DK5 A;  4XMY A;  4BYY A;  3ZMT A;  3K1P A;  4ANJ A;  2IVM A;  3FHN A;  1A04 A;  3ML6 A;  1V5E A;  3BQZ A;  3GZ6 A;  1B9N A;  1FNN A;  1YS7 A;  3BTC A;  2H6C A;  3VSL A;  3JSP A;  2Z2S B;  3HL2 A;  3CC2 I;  2IS1 A;  2XUB A;  2YX7 A;  1R00 A;  3JRI A;  2R5Z A;  4Q4Z F;  3CUO A;  4B8X A;  3OS1 A;  4HST A;  5EEG A;  1H88 C;  1K78 A;  4JQF A;  2XB5 A;  4ETS A;  2EFP A;  4Y3O A;  1ZRD A;  5GAG J;  1XGS A;  2OBP A;  4B3A A;  5FFZ A;  2ETH A;  3SFI A;  3ZQ7 A;  1LB2 A;  1CF7 B;  3PUB A;  1BBY A;  2BY3 A;  3VYU B;  3M1C A;  5HLG A;  4K2E A;  3RYP A;  4DZP A;  2YS9 A;  2VBX A;  1FOY A;  2CUJ A;  4XLE A;  4UUT A;  2IBD A;  5TIS C;  2IA2 A;  1BOA A;  3CQZ J;  3JRE A;  3ERM A;  2WV1 A;  4BQQ A;  4RBO A;  2D45 A;  4IHW A;  3TO7 A;  2LMD A;  2JWT A;  3ELK A;  1MGT A;  3HKZ A;  4CZC A;  5FRM A;  4BBS J;  4WF2 A;  3GWZ A;  2L9R A;  3PIP F;  1KU7 A;  4KIS A;  1R23 A;  4G6T B;  3WTT C;  4F55 A;  3T8T A;  2E1M C;  2B7E A;  4P55 A;  2R7Q A;  4UY8 I;  2R7W A;  3TMO A;  4KMF A;  2VC0 A;  4W97 A;  3VYS B;  1AKH B;  2MLG A;  4CCM A;  2R7Z J;  3F0C A;  2A6H F;  4YEL A;  4BUP A;  2QGU A;  2UZK A;  1VQ5 I;  3A4C A;  4E6K G;  4ZH4 F;  3BG5 A;  2QSH X;  4F93 B;  5L3G A;  1BI2 A;  4Q47 A;  2XF7 A;  2EFN A;  1U3E M;  3LSK A;  3ESW B;  5D5V B;  4OIR F;  3LSR A;  2E35 A;  4QPO A;  2EK5 A;  2GZW A;  2P7C B;  4HV5 A;  3OOP A;  2IGM A;  2PMH A;  3V7S A;  2FXA A;  1FBU A;  3HSE A;  4C2M J;  4KYW A;  2UWM A;  1U8B A;  4OIN F;  2GQQ A;  1T08 B;  4OIP F;  2VON A;  3LFK A;  2TCT A;  1ZR2 A;  1DGR M;  2W4S A;  4N4N B;  1W7P B;  4BXX J;  1WRJ A;  4HV6 A;  3B6A A;  3ROU A;  3DU5 A;  3ZPL A;  4AWX B;  1DPU A;  3W2V A;  1TTY A;  1OIS A;  2EFO A;  1JKQ C;  3QU6 A;  4IOA F;  1B72 B;  2EIM H;  2CRG A;  2DDB A;  2VLA A;  2XPW A;  1SD4 A;  4KT6 A;  2GWR A;  4HA8 A;  4V2F A;  2ACJ A;  3E6B A;  4OAY A;  3JSO A;  1KQ0 A;  4MNU A;  5CQE A;  1Z21 A;  1RRJ A;  2K3P A;  2MSY A;  2KP6 A;  1RR7 A;  3DEW A;  2R4G A;  1TC3 C;  3BOQ A;  2BY2 A;  3L7W A;  4L9J A;  3KLO A;  5HS9 A;  3IRQ A;  2P5K A;  2ZKZ A;  2E7X A;  3NWS A;  1OCP A;  1JT0 A;  2JSP A;  4CA0 A;  1B8I A;  5J4Y A;  4R8H A;  5FLV A;  3PO2 J;  2DPU A;  1HKS A;  1OFC X;  4UV8 A;  3CCU I;  3GTP J;  4X0G A;  2KHM A;  1IV8 A;  2D2W A;  3HOZ J;  3I59 B;  3RQI A;  3A2K A;  3E97 A;  1L0O C;  1K61 A;  3R0A A;  3Q0U A;  2HGC A;  4RLQ A;  4ZZL A;  2R7U A;  2PMZ N;  5M3M J;  1YYV A;  2CUE A;  2DA5 A;  1HDP A;  2HS5 A;  3BP8 A;  4IEJ A;  1TQI A;  2X4H A;  1GDT A;  1G3S A;  3S2W A;  2A3S A;  1Y8R B;  5DYM A;  3VYT B;  1XPX A;  3SJM A;  5AIQ A;  1GHC A;  1X3W B;  1SMT A;  3DKW A;  4AU7 A;  2Y75 A;  2ID3 A;  2QSF X;  2CO5 A;  1SVL A;  2FMY A;  3F6V A;  4AID A;  2NOG A;  4D0P A;  5LGT A;  5JVG F;  5BOX A;  3E1S A;  2BV6 A;  1EH8 A;  3RYR A;  2L7K A;  2DI3 A;  2O9L A;  1B1B A;  1SC7 A;  3N05 A;  4NC6 A;  2MG4 A;  2VIX A;  1XGM A;  3BJO A;  3HXL A;  3CMA I;  3I3L A;  1P7J A;  4A0Z A;  5TRD A;  3V42 A;  4BL0 B;  5HS7 A;  1T39 A;  2RKH A;  1Y0N A;  1IZ1 A;  1QHH D;  4ZDP A;  2A6E F;  1GUU A;  2W25 A;  3F3X A;  2W00 A;  4DYQ A;  5D5X B;  4FET A;  4RM2 A;  4I0B A;  1U8R A;  1YIO A;  3MKL A;  2GXA A;  3BJ6 A;  1UG0 A;  1FC3 A;  4BBR J;  2HZD A;  1ZGW A;  1K4T A;  2R7O A;  3U1K A;  3ZR8 X;  2HPM A;  1IJW C;  1H89 C;  4A93 J;  1WJA A;  3L2V A;  3OSF A;  1O3S A;  2IPQ X;  4YII A;  4BKX A;  1YLF A;  4BQN A;  4RGX A;  4LB6 B;  2BW3 B;  2ZME B;  5DS9 A;  1CF7 A;  2Y0M A;  3CMY A;  4KIG A;  2X0L A;  1MZB A;  1QVT A;  2NRA C;  4BNC A;  5LHI A;  4U7B A;  3UNG C;  2XRO A;  1WWX A;  4DJA A;  1TP4 A;  2K9N A;  2XSJ C;  2LBF B;  3F23 A;  2XV4 S;  3EET A;  2ZBK A;  5KVR A;  1W4M A;  1WVR A;  2OD5 A;  3IL2 A;  1X58 A;  3KP6 A;  1YW7 A;  1GV2 A;  2IP2 A;  5IP6 A;  3BR6 A;  1KU3 A;  4LG3 A;  1FMW A;  3FDY A;  2VQC A;  2ESN A;  2O7O A;  2X6O A;  4G6D A;  2YR2 A;  4RB0 A;  2E2H J;  2WY8 Q;  2L7F P;  1OR7 C;  2FE3 A;  4QWQ A;  1X2N A;  2OAZ A;  3O8H A;  4ZYH A;  1TWC J;  2PG4 A;  3C7J A;  3OYL A;  3K2Z A;  5F1R A;  5EGO B;  1IW7 F;  3BCB A;  1AKH A;  1U9N A;  2L3D A;  4E70 A;  2OCE A;  3U21 A;  4BXU A;  1D0Z A;  1NHA A;  5GP9 A;  1O7L A;  3H9G A;  5GPA A;  2YSR A;  4F3Q A;  2Z16 A;  4O5V A;  2CQN A;  3CCR I;  3COA C;  5DD8 A;  3VFZ A;  4XR6 A;  4L9T A;  3HOW J;  3K9T A;  4FTH A;  2NNY A;  3OYJ A;  3EYI A;  1HQC A;  4TV7 A;  2UXX A;  1IRF A;  1LVK A;  1W5T A;  3ASO H;  1OR7 A;  3Q9S A;  5ILS A;  1W7P A;  1U78 A;  2CMP A;  2DXI A;  3RZO J;  2DMP A;  3BPV A;  2LKS A;  4XOP A;  5LFA A;  4EV0 A;  5J4V A;  3CES A;  3HGG A;  3HYI A;  3K1N A;  5DV5 A;  1APL C;  4HAM A;  1B72 A;  4O3M A;  1Y56 A;  1MMD A;  3C1D A;  4U87 A;  5B1A H;  2M9H A;  4DIQ A;  3DPU A;  3S15 J;  5EF6 A;  1EKE A;  3TQN A;  3ZGK A;  2XGX A;  5FJ8 J;  3FZV A;  5IOY A;  2G0E A;  5IPA A;  2IA1 A;  2M4G A;  4HF2 A;  1FOK A;  3GTM J;  3ZRG A;  1JT6 A;  2VKD A;  1ULY A;  3FBN B;  2JSC A;  4B3X A;  2CQX A;  1W36 D;  4LJZ F;  3BZC A;  3U2R A;  4BDZ A;  4B1R A;  2D5V A;  3E6M A;  4DNC A;  2FOW A;  2L7Z A;  1BOB A;  1E17 A;  1V3F A;  3N97 A;  2XB0 X;  3ABL H;  2KRC A;  3I59 A;  3KZZ A;  3DLL F;  1ZLJ A;  4D5F A;  4HW0 A;  4II3 A;  1TNT A;  2XF6 A;  1WFX A;  1SAX A;  3QYE A;  3AG3 H;  2XAU A;  2MYS A;  3TKY A;  5E3L A;  1S8N A;  2DFI A;  2RGV A;  2VT3 A;  2M2E A;  2ZFU A;  1Q1H A;  2V1N A;  5ICE A;  3S8P A;  1RNL A;  1H8A C;  3KPH A;  2P81 A;  2EQR A;  4CCK A;  3H1C A;  2EB7 A;  4NB5 A;  3OYD A;  1HXD A;  1W36 C;  3CME I;  2CG4 A;  1Z91 A;  2IJL A;  3HRM A;  1WCM J;  5KAI C;  3T5X A;  4A2U A;  3ZQL A;  3Q9V A;  5JI6 A;  3OL3 A;  1K6O A;  1BJZ A;  2GIV A;  2W85 A;  1BR1 A;  2QQB A;  2Y31 A;  1BA5 A;  2CS3 A;  3HUG B;  3IC7 A;  2IW5 A;  3CCY A;  2E34 A;  1B6A A;  1AWC A;  3RKQ A;  1TNS A;  4M71 A;  3BQY A;  4KIF A;  4N4O B;  1VND A;  5FKM A;  4DYC A;  1LUJ B;  2ZME C;  2R7F A;  1C0W A;  4ESJ A;  1J09 A;  3Q0V A;  5J1Y A;  3J80 Z;  4BHB A;  2HTJ A;  2RRE A;  5KK1 A;  4MLO A;  2DJI A;  3IH3 A;  2R7V A;  3BJA A;  4A3D J;  2B9S A;  2XGD A;  4IJA A;  4OIQ F;  4BAC A;  2ZSI B;  3E3V A;  3A01 B;  3E6D A;  2VN2 A;  3H0D A;  4IHV A;  3KX2 A;  4EM1 A;  5E17 F;  1T6S A;  1LDD A;  1MBJ A;  2DT6 A;  2EBI A;  5LRS A;  3PSF A;  5HNF A;  4M3D A;  3UR3 C;  3K10 A;  3AG4 H;  5CVV A;  1AHD P;  2QF7 A;  2C6Y A;  1T98 A;  3C18 A;  2FF4 A;  4LGW A;  1H9T A;  1ZN2 A;  5K7H A;  2ME0 A;  1ZTR A;  2Y30 A;  2BW3 A;  2ZME A;  4RA2 A;  2CFO A;  3PNY A;  1WJE A;  4HDU A;  3GO5 A;  2DLL A;  4PFP A;  3RQ4 A;  4HEA 2;  4IQ4 A;  1T56 A;  1ORK A;  3LMM A;  2VOP A;  4G9Y A;  1ON1 A;  2FML A;  3SDB A;  1ZGJ A;  2LBF A;  2JN6 A;  5JR3 A;  3ZQI A;  5HOO A;  5AON A;  3WU1 B;  2COM A;  3P9I A;  1FYM A;  4C9Y A;  3D1N I;  1FYK A;  3PO3 J;  5IT9 K;  2LH9 A;  4UXN A;  3CO6 C;  1G6N A;  2PFB A;  1HF0 A;  3JW4 A;  3J81 K;  3ZQQ A;  3H92 A;  4QSH A;  4WK8 F;  4PSX A;  3TL4 X;  2R7T A;  2IGK A;  2OA4 A;  3TDU C;  2OC6 A;  2XVC A;  4XN0 A;  4GYI A;  4ON0 A;  1BW6 A;  3IUO A;  5EGO A;  3LAJ A;  4M3E A;  4KN7 X;  1OQY A;  3I53 A;  2CJJ A;  2VAS A;  3F8B A;  2QQ8 A;  2Y48 A;  1PVE A;  4WXH A;  2R7S A;  2LR8 A;  3B02 A;  5B66 C;  3HJE A;  2EFQ A;  2GA1 A;  2O0Y A;  2BHZ A;  2H6B A;  4GFB A;  2K27 A;  1F4K A;  1VZ0 A;  3CLO A;  2NVT J;  4HYE A;  5CVU A;  2NNN A;  2XAJ A;  4FT8 A;  2KRH A;  2L5Q A;  3ZQH A;  2E1O A;  3G1M A;  2J5O A;  3C3W A;  3MVP A;  5ED4 A;  2HDC A;  3ISP A;  3L2C A;  4X6A J;  3OYA A;  2P5L C;  1JUM A;  2DOE A;  5E8G A;  3EPZ A;  3IH4 A;  4D7N A;  4FE7 A;  1YQA A;  5LHH A;  3W3C A;  2HYJ A;  3GVA A;  3RI4 A;  4RLF A;  4Y17 A;  2F4I A;  3D0S A;  5GTI C;  4KT5 C;  1YTY A;  2MW8 A;  2JVG A;  3ZMZ A;  2XDV A;  4M6V A;  4RGR A;  4AC0 A;  4L0Y B;  3CCL I;  3GZ5 A;  4KN4 X;  1F9N A;  5KHD A;  2JJ7 A;  2W24 A;  2ZXJ A;  2LRD A;  3P9C A;  4WCG A;  3WG9 A;  2BY0 A;  3Q0W A;  2QEN A;  5ICF A;  3DTK A;  1ETX A;  1BN5 A;  1B59 A;  5L3B A;  1ZAO A;  1O4X A;  4PJJ A;  2LC2 A;  3EYY A; 
#chains in the Genus database with same CATH homology
 1BM9 A;  4ENN A;  2EV5 A;  1I1S A;  2OQR A;  3W6K B;  1MD0 A;  2DQR A;  2ESH A;  4UV9 A;  1ON2 A;  5BPI A;  3FMS A;  4MTD A;  4IHT A;  1HKT A;  5JHU A;  2RC4 A;  4GGG A;  4UVC A;  1BJA A;  1I5Z A;  5TJJ A;  4HQM A;  1IN6 A;  4FX0 A;  1WQ2 A;  2ISY A;  1K7A A;  2XAF A;  3V7R A;  3KP5 A;  2GXB A;  1XMK A;  3JTG A;  4NQW A;  3HUG A;  1D5V A;  1RUN A;  5CJ9 A;  2IRF G;  3F8M A;  2A68 F;  5J8C A;  3WE2 A;  2M8E A;  2GA2 A;  2JPB A;  3T0Y A;  4RS8 A;  1IN7 A;  2G7H A;  3GFJ A;  2ZNZ A;  2L4A A;  5ERI A;  1JHH A;  3V8J A;  1ZRE A;  1UHM A;  1KYW A;  3DV8 A;  4UVA A;  1OYI A;  3PFI A;  3P9K A;  2ZCW A;  3R61 A;  2WWY A;  4R79 A;  3LST A;  4HX8 A;  1KQ8 A;  3BZ6 A;  5LLQ A;  4OOI A;  1BI0 A;  2G7U A;  1LVA A;  4N9H A;  1J0R A;  1V4R A;  2A61 A;  1FY7 A;  1I6X A;  1DUX C;  4HQE A;  4LMY A;  2JT1 A;  4U88 A;  1XSV A;  4L5I A;  5LEJ A;  3V8K A;  3MFK A;  1H0M A;  2FSW A;  2HYF A;  3LWF A;  3DXJ F;  5DUI A;  2QQA A;  3FMQ A;  2V1U A;  3T1B A;  2KIM A;  1XD7 A;  2F5E A;  5FB2 A;  4LD5 A;  1HST A;  1GXP A;  5AIP A;  2WTE A;  2MLK A;  4R1H A;  3O2P E;  3FXR A;  4M9S A;  1AOY A;  2FNP A;  3ZN1 A;  4KMU X;  1FT9 A;  1IXC A;  2LDU A;  3RKX A;  3MQ0 A;  3TGN A;  3EUH A;  5HLI A;  2L4M A;  1U2W A;  1FLI A;  4EJO A;  2K4B A;  4KFC A;  3SFZ A;  5JVT A;  1IAW A;  3ZP5 A;  2FOK A;  2RVC A;  4I02 A;  4OMZ A;  4XRF A;  2V6C A;  2PN6 A;  1WI9 A;  2VT2 A;  2EA2 A;  4RB2 C;  5L3C A;  1QGP A;  2AXL A;  2CYY A;  1TW3 A;  3TOA A;  3GFI A;  4ZYE A;  4HZF A;  1XMA A;  4FHT A;  3M7G A;  2FEZ A;  2BEO A;  1S29 A;  5E1W A;  4OMY A;  2ZNY A;  2R7D A;  4ESB A;  2FA5 A;  1OYY A;  4EGZ A;  1S7A A;  3HSF A;  4ZYG A;  4YFX F;  4HX7 A;  5IT3 A;  4G7H F;  3LA2 A;  2XKO A;  2BGC A;  1HKQ A;  2QZ8 A;  3HTU A;  5F6F A;  3EDP A;  4IHS A;  4P96 A;  2BBY A;  1WSU A;  3HRT A;  1O3T A;  3O3K A;  4NHJ A;  2P4W A;  1GVJ A;  1Z7U A;  1S6L A;  4U0W A;  4MQV A;  4KDP A;  5ILV A;  4MQ9 F;  3FM5 A;  2Q2E A;  5H6R A;  2OZ6 A;  4LLN A;  2STT A;  2HOE A;  4PDK A;  5F64 A;  4S05 A;  3BRO A;  4XLP F;  5FLX K;  5J6X A;  2FU4 A;  4IF4 A;  1LEA A;  1U5T B;  2VC1 A;  3EQL F;  4HLX A;  2FBH A;  4HF1 A;  1YW9 A;  2JRT A;  2VBZ A;  3ECO A;  1J5Y A;  4B09 A;  2XKP A;  1X3U A;  2E1N A;  4EVI A;  3FX3 A;  2PLY A;  1ZYR F;  3IWF A;  4EJV A;  3B73 A;  1IN5 A;  5J8F A;  1FBS A;  1P4X A;  1T2K A;  2YX4 A;  2MC3 A;  2ADU A;  3ECH A;  1LNW A;  3HSR A;  2HZT A;  3R60 A;  1Z1D A;  1XGO A;  4P5O A;  4RGS A;  2VBY A;  3NEU A;  5FFX A;  2RN7 A;  4MTE A;  3GFL A;  3JAM K;  1TW2 A;  3WTW C;  3LQR A;  1SFU A;  2MD5 A;  2O03 A;  4M73 A;  1R1V A;  3MZY A;  4L0Z B;  4YG2 F;  1BC8 C;  2J5P A;  5EEH A;  4PZJ A;  5D4R A;  4IRH A;  5DCM B;  1SMY F;  4AIH A;  1B9M A;  4M6Y A;  4EGY A;  1MDM A;  3L00 A;  4RB1 A;  4AIJ A;  3ERE D;  1ZG1 A;  2EA4 A;  5K5O A;  3V8L A;  4RAY A;  2CW0 F;  2AS5 F;  4QLC U;  4WWC A;  1XGN A;  1SD7 A;  4A6E A;  2TDX A;  5BMZ A;  2W57 A;  3DFG A;  5H20 A;  4MHG A;  1KU9 A;  1SD6 A;  3DQV C;  1ZH5 A;  4A6D A;  3ABT A;  2HTS A;  2OU2 A;  4OU0 A;  5K5R A;  4EMS A;  2DQL A;  5LHG A;  1YO5 C;  2PI0 A;  4P9F A;  4XBF A;  1U5T C;  3LAP A;  2Q8K A;  1G3T A;  3HOT A;  4WXC A;  3DPL C;  1LDJ A;  3SZT A;  1RZ4 A;  2PJP A;  3KP7 A;  1QO0 D;  3REO A;  3MCZ A;  5CVJ A;  4HF0 A;  1Z6T A;  2LF7 A;  2W84 A;  1DPR A;  4IPA A;  3VB2 A;  2Z5U A;  4CO8 A;  5DD4 A;  2R3S A;  1U5T A;  3CUQ B;  3HRS A;  1HW5 A;  5CLS A;  2OQG A;  1QBJ A;  1MJA A;  2QBY B;  2XIG A;  2KJB A;  2Z3Y A;  3QRF F;  3WTV C;  1SD5 A;  3WTY C;  2DBB A;  5LGU A;  1XSD A;  1I1G A;  5K1Y A;  3KEO A;  4GXO A;  1XCV A;  1O7F A;  3DPT A;  5HDK A;  2Q0O A;  5DDG A;  3CDH A;  2E1C A;  2ELH A;  4CDG A;  2B0L A;  4G6Q A;  1E2X A;  4MGR A;  3KLN A;  1I27 A;  4LK1 F;  4BHP A;  1XCB A;  3DEU A;  2GAU A;  1KYZ A;  1XN7 A;  3FMR A;  2JTV A;  4EM0 B;  2A69 F;  5D5W B;  3NQO A;  4U7D A;  5BPD A;  1LDK B;  2IT0 A;  5IT9 Z;  1R1T A;  1EH7 A;  5BS6 A;  4KA4 A;  5D4S A;  2DT5 A;  5DCM A;  3J81 Z;  3K69 A;  1XSX A;  4YFK F;  3I71 A;  2NAZ A;  1OMI A;  4N9I A;  4ZZD A;  3VEP A;  4ENJ A;  2QM3 A;  3TOB A;  4YFN F;  2VXZ A;  3G73 A;  1JHF A;  3LA3 A;  3WGG A;  3TDZ C;  1T38 A;  2A07 F;  1GXQ A;  3K0L A;  1R5G A;  3GW2 A;  3I4P A;  3GF2 A;  1QPM A;  3K1M A;  1FP2 A;  1OKR A;  2DK8 A;  4AVP A;  1DDN A;  1FSH A;  2ZO4 A;  4OIO F;  2XAH A;  4GCV A;  2YU3 A;  3HIF A;  3R0J A;  3E5U A;  2DU9 A;  3OV8 A;  3O6B B;  1PUE E;  4G94 A;  2VOD A;  3IHU A;  3M8F A;  3SHF A;  2KRF A;  3P7N A;  2CWE A;  1ZG3 A;  3H3U A;  2F5F A;  4Z2Y A;  3GX4 X;  4G8X A;  3GXO A;  2PEX A;  2ISZ A;  1UHW A;  3WTS C;  4I01 A;  3Q5F A;  5HS8 A;  1J9I A;  4I2O A;  2HYG D;  3H3Z A;  3E5Q A;  3I58 A;  1Z6R A;  3KEQ A;  2VOO A;  1STZ A;  3CUQ A;  3V7C A;  4KNY A;  5FD6 A;  2V79 A;  3ZMD A;  1RI7 A;  4P9U A;  2DPD A;  1MKM A;  4JBA A;  5HDN A;  2QBY A;  2H27 A;  1JGS A;  2XAQ A;  2CQK A;  2KKO A;  4M6X A;  5ILU A;  2CFX A;  2XHK A;  3JTH A;  2QQ9 A;  1FWZ A;  3RPU A;  3KET A;  4IRG A;  2D1H A;  3FXQ A;  2K4J A;  2LF8 A;  3N4M A;  1IF1 A;  4AIK A;  3IWZ A;  4BH9 A;  1BC7 C;  4ESF A;  3KP2 A;  2LKP A;  5L3E A;  1FP1 D;  2EJR A;  3U1D A;  3I5U A;  4U0V A;  2Z99 A;  2QUF A;  4IXA A;  2EV0 A;  1G3W A;  3BWG A;  3MAJ A;  4KIB A;  2V1X A;  4A5N A;  2MH9 A;  1LEB A;  3U9G A;  1TQP A;  2HKO A;  1J7K A;  1JXS A;  1S3J A;  2EWN A;  3HRU A;  5FGM A;  3LQQ A;  2MBF A;  2L01 A;  1SFE A;  1QZZ A;  3T8R A;  2STW A;  3TO9 A;  1R7J A;  4LLG F;  1BI3 A;  1HSJ A;  3LA7 A;  1XB4 A;  1G4D A;  3F72 A;  5LBQ A;  1MDM B;  5LEK A;  2KJC A;  3QP6 A;  3L09 A;  4EJW A;  2M45 A;  1ZLK A;  1FBQ A;  4A0Y A;  3FWE A;  4IRI A;  1IN4 A;  2DAO A;  3ABU A;  1JE8 A;  4M72 A;  3ZMV A;  3WGH A;  4RAZ A;  2M1B A;  2EFW A;  2JPC A;  3FHZ A;  1TLH B;  4HLY A;  1FX7 A;  2MA3 A;  2O8X A;  2NS0 A;  5K5Q A;  2XAG A;  4WX9 A;  3E6C C;  1D8J A;  5D8K B;  2P5V A;  4EJT A;  4GO1 A;  5LRR A;  4MEY F;  2O6G E;  4BQA A;  5E1Z B;  3KP4 A;  2HWV A;  2P6S A;  3ZMS A;  1REP C;  3RKW A;  4A5M A;  3HOS A;  3KFW X;  4N0B A;  3KE2 A;  3WTZ A;  3NRV A;  5ICG A;  5HVQ C;  4M9Z A;  2CGP A;  3VOE A;  4M9X A;  5D6F A;  5A2Q K;  1IUY A;  1OYW A;  1FSE A;  3WOD F;  3J7A O;  2NYX A;  1R1U A;  5FLX Z;  3I0T A;  3BDD A;  2HQN A;  1EH6 A;  4PGH A;  3G3Z A;  1J75 A;  1T0F A;  5DUK A;  4DQ2 A;  2LSO A;  5A2Q Z;  3QPT A;  1W7P D;  2HEO A;  1S7O A;  3PQK A;  3IRR A;  1XDU A;  2OZU A;  6PAX A;  4KIC A;  4L18 B;  3KCC A;  1Z9C A;  4Y15 A;  1EV7 A;  3HHH A;  1CGP A;  1J59 A;  4FX4 A;  1P2F A;  4S04 A;  1Y0U A;  2P8T A;  1Z05 A;  3ZN0 A;  2HKX A;  5FO5 A;  2FBK A;  3BPX A;  3RDI A;  4XSX F;  4KUM A;  2FBI A;  2BYV E;  1F1Z A;  4G7Z F;  2DO7 A;  3FM3 A;  1F5T A;  2P6T A;  2MH2 A;  3DP7 A;  1QQI A;  1R58 A;  1UB9 A;  4EM2 A;  4HDV A;  1LQ1 A;  3CO7 C;  4U0Y A;  1WKM A;  2PBI A;  3JAM Z;  1PP7 U;  1MJ9 A;  4HX4 A;  3R6S A;  5L3F A;  5L3D A;  4IVN A;  1BI1 A;  2QWW A;  3I54 A;  3D5L A;  4RGU A;  2KIF A;  1R5H A;  3F8C A;  2M5W A;  2V1D A;  3SZP A;  3WTX C;  4BHC A;  1KGS A;  5E18 F;  4M74 A;  1IXR C;  3ULQ B;  4H0E A;  2QVO A;  3DF8 A;  1O57 A;  2GXG A;  2D1V A;  2L02 A;  4BAY A;  1KQ9 A;  3IKT A;  1R36 A;  4ENM A;  5H6Q A;  3GLX A;  2A5Y B;  2O61 A;  2F5C A;  1KA8 A;  3GEZ A;  2M87 A;  4CHU A;  3QP5 A;  1ODD A;  3CTA A;  2RNJ A;  2HQR A;  4LG0 B;  1HBX G;  4ASN A;  1OPC A;  2DW4 A;  1IN8 A;  2KIU A;  1ONV A;  1LJ9 A;  3WU0 A;  2XRN A;  2DTR A;  3HHG A;  1RUO A;  4I7H A;  1IXS B;  1QZY A;  1USS A;  4CXF A;  3V4G A;  3FXU A;  2ZJ2 A;  3J80 K;  1FYL A;  2O3F A;  2UXN A;  3TO6 A;  1HW1 A;  5E20 A;  1G3Y A;  2P7V B;  2Z33 A;  5JFR A;  3QOP A;  5CVI A;  3SXY A;  2RV8 A;  1ZHF A;  1YS6 A;  3W6J B;  4UUV A;  4I0A A;  5DCF A;  5CYV A;  1O3R A;  3MWM A;  1R22 A;  4PGG A;  1ZG5 A;  5BQT A;  4ENK A;  3VOD A;  4MEX F;  1ZGA A;  1UFM A;  1O3Q A;  2F2E A;  2EV6 A;  3KP3 A;  4PCQ A;  3RIR A;  2RQP A;  4F7Z A;  4L9V A;  5HLH A;  5D6E A;  4UHT A;  4XSZ F;  4HBL A;  5HDG A;  1ZRF A;  3E5X A;  3F8N A;  4JK1 X;  2M30 A;  4CYD A;  1UCR A;  2VBW A;  3RPQ A;  2H94 A;  1DP7 P;  4LFU A;  1QNT A;  2FQ3 A;  1ZAR A;  5FD5 A;  2HFH A;  1J2X A;  2H09 A;  4EJU A;  5ICC A;  1P92 A;  1UST A;  4HOB A;  3RTR A;  1K78 B;  3F22 A;  2VE9 A;  5CVR A;  2V9V A;  4CIC A;  4CZZ A;  4LK0 F;  2K7L A;  1PP8 F;  3ZMU A;  2K02 A;  3R4K A;  2E7W A;  1P4A A;  2ZFW A;  4AD9 A;  3PQJ A;  2IA0 A;  4XLN F;  4Q5S F;  1FPQ A;  1W5S A;  4UNO A;  1FZP B;  3QU3 A;  3M9A A;  5DEQ A;  4L9N A;  2QYO A;  1XDS A;  4O6J A;  1YG2 A;  1BIA A;  3GUD A;  1VTN C;  1YW8 A;  3WE3 A;  2HR3 A;  4Q48 A;  4YIF A;  2XAS A;  3L9F A;  5D5U B;  4LB5 A;  2G9W A;  4LG0 A;  4I98 B;  5LGN A;  3WGI A;  3CUQ C;  3M1E A;  2BE5 F;  2WC2 A;  1RIO H;  1K79 A;  1D8K A;  2QLZ A;  4RB3 C;  1SFX A;  1D3Y A;  3BY6 A;  3GYH X;  3QPH A;  2CSO A;  4L5J A;  5E8I A;  4ZYD A;  1P6R A;  3I64 A;  1ZRC A;  4CGZ A;  4Y13 A;  1B4A A;  2K86 A;  1H9G A;  2YPR A;  1IRG A;  3CJN A;  1L3L A;  4UVB A;  3F6O A;  1TQM A;  1BIB A;  3AAF A;  3QAH A;  3WTU C;  1U6G A;  2Z9O A;  1HW2 A;  4GYG A;  1P4W A;  3FF5 A;  3KZY A;  1TBX A;  2PMU A;  4WXD A;  1KU2 A;  4LLL A;  5E1X A;  2JZY A;  2RDP A;  3RJP A;  3SQN A;  3RKY A;  4A12 A;  2VE8 A;  5D8L B;  4I09 A;  3M8E A;  2WV0 A;  4A0X A;  3MZH A;  2FRH A;  4EQQ A;  3F21 A;  2F5D A;  2FNA A;  4G7O F;  2LNB A;  1PDN C;  3F8F A;  1YFH A;  2PQ8 A;  1MJB A;  3IKV A;  2L54 A;  3MEX A;  3HTS B;  3GFM A;  2DK5 A;  4BYY A;  3ZMT A;  3K1P A;  2IVM A;  1A04 A;  3ML6 A;  3GZ6 A;  1B9N A;  1FNN A;  1YS7 A;  3JSP A;  2H6C A;  2XUB A;  2YX7 A;  1R00 A;  4Q4Z F;  3CUO A;  4B8X A;  1K78 A;  5EEG A;  4JQF A;  4ETS A;  2EFP A;  1ZRD A;  1XGS A;  2OBP A;  5FFZ A;  2ETH A;  3ZQ7 A;  1LB2 A;  1CF7 B;  1BBY A;  5HLG A;  4K2E A;  3RYP A;  2VBX A;  2IA2 A;  1BOA A;  2D45 A;  3TO7 A;  3ELK A;  1MGT A;  4WF2 A;  3GWZ A;  1KU7 A;  1R23 A;  3WTT C;  3T8T A;  4P55 A;  4KMF A;  2VC0 A;  2MLG A;  2A6H F;  2UZK A;  4ZH4 F;  5L3G A;  1BI2 A;  4Q47 A;  1U3E M;  2EFN A;  5D5V B;  4OIR F;  2EK5 A;  2GZW A;  2P7C B;  4HV5 A;  3OOP A;  2PMH A;  3V7S A;  2FXA A;  1FBU A;  3HSE A;  4KYW A;  2UWM A;  4OIN F;  2GQQ A;  4OIP F;  2VON A;  3LFK A;  1W7P B;  1WRJ A;  4HV6 A;  3ROU A;  3ZPL A;  4AWX B;  1DPU A;  1TTY A;  2EFO A;  3QU6 A;  1SD4 A;  2GWR A;  4HA8 A;  2ACJ A;  3E6B A;  3JSO A;  1KQ0 A;  4MNU A;  3BOQ A;  3L7W A;  4L9J A;  3KLO A;  5HS9 A;  3IRQ A;  2P5K A;  2ZKZ A;  2E7X A;  4R8H A;  2DPU A;  1HKS A;  4UV8 A;  2D2W A;  3I59 B;  3E97 A;  1L0O C;  3R0A A;  2HGC A;  4ZZL A;  1YYV A;  2HS5 A;  3BP8 A;  1TQI A;  2X4H A;  1G3S A;  3S2W A;  2A3S A;  5DYM A;  5AIQ A;  1GHC A;  1SMT A;  3DKW A;  2Y75 A;  2CO5 A;  2FMY A;  3F6V A;  4D0P A;  5LGT A;  5BOX A;  2BV6 A;  1EH8 A;  3RYR A;  2DI3 A;  1B1B A;  1XGM A;  3BJO A;  4A0Z A;  5TRD A;  5HS7 A;  1T39 A;  2RKH A;  1IZ1 A;  2A6E F;  2W25 A;  3F3X A;  5D5X B;  4I0B A;  1U8R A;  1YIO A;  3BJ6 A;  1FC3 A;  1O3S A;  2IPQ X;  4YII A;  1YLF A;  4RGX A;  4LB6 B;  2ZME B;  1CF7 A;  2Y0M A;  4KIG A;  2X0L A;  1MZB A;  2NRA C;  4BNC A;  5LHI A;  4U7B A;  2XRO A;  1WWX A;  3F23 A;  2XV4 S;  3EET A;  2ZBK A;  5KVR A;  1W4M A;  2OD5 A;  3IL2 A;  3KP6 A;  1YW7 A;  2IP2 A;  1KU3 A;  2ESN A;  4G6D A;  2YR2 A;  4RB0 A;  2FE3 A;  4QWQ A;  2OAZ A;  4ZYH A;  2PG4 A;  3C7J A;  3K2Z A;  5F1R A;  1IW7 F;  2L3D A;  4E70 A;  4BXU A;  1NHA A;  1O7L A;  2YSR A;  4O5V A;  3COA C;  5DD8 A;  3VFZ A;  4L9T A;  3K9T A;  2NNY A;  3EYI A;  1HQC A;  4TV7 A;  2UXX A;  1IRF A;  1W5T A;  1OR7 A;  3Q9S A;  5ILS A;  1W7P A;  1U78 A;  3BPV A;  4EV0 A;  3HYI A;  3K1N A;  5DV5 A;  4HAM A;  4O3M A;  3C1D A;  3TQN A;  2XGX A;  3FZV A;  2IA1 A;  4HF2 A;  1FOK A;  1ULY A;  2JSC A;  4LJZ F;  3U2R A;  3E6M A;  4DNC A;  1E17 A;  1V3F A;  3N97 A;  3I59 A;  3KZZ A;  1ZLJ A;  4HW0 A;  1TNT A;  1SAX A;  3TKY A;  1S8N A;  2DFI A;  2RGV A;  2VT3 A;  5ICE A;  1Q1H A;  1RNL A;  2EB7 A;  4NB5 A;  1HXD A;  2CG4 A;  1Z91 A;  2IJL A;  3HRM A;  4A2U A;  3T5X A;  3Q9V A;  5JI6 A;  1K6O A;  2GIV A;  2W85 A;  2QQB A;  3IC7 A;  2IW5 A;  1AWC A;  1B6A A;  1TNS A;  4M71 A;  4KIF A;  2R7F A;  1C0W A;  4ESJ A;  3J80 Z;  4BHB A;  2HTJ A;  5KK1 A;  3BJA A;  4IJA A;  4OIQ F;  3E3V A;  3E6D A;  2VN2 A;  4EM1 A;  5E17 F;  1T6S A;  1LDD A;  5LRS A;  5CVV A;  2C6Y A;  1T98 A;  3C18 A;  2FF4 A;  4LGW A;  1H9T A;  1ZN2 A;  2ZME A;  4HDU A;  3GO5 A;  2DLL A;  2VOP A;  4G9Y A;  1ON1 A;  2FML A;  1ZGJ A;  5JR3 A;  5HOO A;  5AON A;  3WU1 B;  2COM A;  3P9I A;  1FYM A;  1FYK A;  5IT9 K;  4UXN A;  3CO6 C;  1G6N A;  2PFB A;  3JW4 A;  3J81 K;  3H92 A;  4WK8 F;  2OA4 A;  3TDU C;  2XVC A;  4GYI A;  4ON0 A;  3LAJ A;  4KN7 X;  3I53 A;  3F8B A;  2Y48 A;  4WXH A;  3B02 A;  2EFQ A;  2GA1 A;  2O0Y A;  2H6B A;  2K27 A;  1F4K A;  3CLO A;  4HYE A;  5CVU A;  2NNN A;  2XAJ A;  4FT8 A;  2J5O A;  3C3W A;  5ED4 A;  2HDC A;  3ISP A;  3L2C A;  2P5L C;  5E8G A;  1YQA A;  5LHH A;  3GVA A;  3RI4 A;  4Y17 A;  3D0S A;  4KT5 C;  1YTY A;  3ZMZ A;  4RGR A;  4L0Y B;  3GZ5 A;  4KN4 X;  1F9N A;  2W24 A;  2ZXJ A;  3P9C A;  4WCG A;  3WG9 A;  2QEN A;  5ICF A;  1BN5 A;  1B59 A;  5L3B A;  1ZAO A;  3EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...