2CQKA

Solution structure of the la domain of c-mpl binding protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GSSGSSGAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords C-Mpl binding protein
publication title Solution structure of the La domain of c-Mpl binding protein
rcsb
source organism Homo sapiens
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cqkA00
5BQTA 1XMKA 5LEKA 1MDMA 2FNPA 3M8EA 2F5FA 4AIHA 3I5UA 2YX4A 1J9IA 3ZQ7A 3TO7A 3IWZA 2J5OA 2HR3A 3MAJA 4OMZA 3ECHA 1PUEE 1LEAA 2NAZA 1H9GA 4N0BA 4G6QA 1XCVA 3ABTA 1HQCA 4FX0A 4O6JA 2IRFG 3R0JA 2DPUA 1BBYA 4RAYA 4IHSA 2FEZA 2D45A 2PEXA 3FMSA 2BV6A 1J2XA 4GGGA 3WE3A 4HV5A 3SXYA 1KU9A 1MD0A 1BOAA 3V8LA 3FWEA 1D5VA 1O7LA 1IXSB 4IPAA 1Z7UA 4KNYA 4Q48A 3LAJA 2NRAC 5DCMA 2EFPA 4G8XA 3RKXA 1FWZA 3ZMSA 5DD4A 1XGMA 1IW7F 1LJ9A 4ZYEA 1SFEA 5D5UB 2QBYA 1FP2A 3WGHA 2UZKA 4YFKF 3DQVC 3LQQA 4G9YA 3QU3A 5AIQA 4A0ZA 4EVIA 2FBIA 2R3SA 2H6CA 2WTEA 4YFNF 2XAGA 4IRHA 3PFIA 2G9WA 2PFBA 4WXCA 2JSCA 2VE8A 4FHTA 3KCCA 1ZLKA 2HTJA 2VBYA 1FP1D 2GZWA 5K5RA 3HSFA 2V6CA 4OOIA 3WTYC 4UNOA 5D6EA 3J81K 2LF8A 2XRNA 1R23A 2IVMA 3K2ZA 1LQ1A 1UHMA 1ON2A 3JSPA 3DV8A 5HS8A 1T0FA 3L9FA 5CLSA 1I1GA 4DQ2A 1Z6TA 2PN6A 3TOAA 4Y15A 2D2WA 2PQ8A 1CF7B 3W6KB 1J59A 3IL2A 5E18F 3GUDA 5KK1A 1FBSA 1U3EM 3I64A 3KZYA 1D8KA 5HLIA 2M45A 3GLXA 2VBWA 5L3DA 1SD7A 4PZJA 2HZTA 3BZ6A 3I53A 5FLXZ 2F5CA 5ICGA 1XGOA 3CUQB 3MFKA 1EH7A 2IA1A 3FM3A 2IP2A 2ZO4A 3L7WA 5CVUA 5FO5A 1REPC 1R1UA 1K7AA 2ZMEB 4HBLA 1FSHA 2L4AA 1IN4A 2A61A 4HLXA 2XROA 2LNBA 1L0OC 3LSTA 5DDGA 3S2WA 3F8CA 1RI7A 2FSWA 3VOEA 5H20A 2Z99A 2EB7A 2VC1A 4M73A 5HDGA 1GVJA 3E3VA 1ON1A 2G7HA 1PP8F 3U1DA 3G3ZA 5AIPA 5FD5A 1EH6A 1Z9CA 3K9TA 2DW4A 4HOBA 3J7AO 3R0AA 3HTSB 1WWXA 1ZG3A 3QOPA 3K1PA 4GXOA 4HX7A 2HOEA 4WWCA 2YU3A 3ECOA 2E1NA 3BJAA 4HV6A 3KP5A 3BJOA 4RGUA 1SAXA 1XGNA 3TO6A 5AONA 2FA5A 3E6MA 2ACJA 4AIKA 1MJ9A 4A0XA 4ETSA 4CYDA 5CVRA 2ESHA 3SHFA 2LF7A 4YG2F 4RB2C 1XSDA 5LRRA 2NNYA 3I59B 3F21A 1EH8A 2E1CA 1D8JA 3LAPA 1R36A 3PQJA 1ZREA 4MQ9F 1T98A 4FX4A 4MHGA 2VC0A 5L3FA 4IRIA 1WKMA 3GZ5A 2HKOA 3T8TA 3VODA 3L2CA 4ZYHA 1CGPA 3D0SA 2OD5A 4KA4A 1QGPA 1DPUA 4U88A 1LDJA 3WTVC 4RGXA 4GYIA 3IKTA 4LG0A 4A0YA 4P55A 1FBQA 4ESJA 1IRFA 4ON0A 1HW2A 3RYRA 4ZZDA 1S7AA 1YW8A 4YFXF 3V7RA 2FXAA 3E6CC 1Z05A 5K5QA 2L54A 2Q8KA 5LRSA 3LA7A 2KRFA 4BHPA 4I09A 2EFOA 1BI2A 3WGIA 1BN5A 2DU9A 2XKPA 1RUNA 1XMAA 2DO7A 3V7SA 3VB2A 2K86A 4B09A 4BH9A 5ICEA 2EA2A 2QVOA 3CUQA 2GA1A 4IXAA 1B59A 3EETA 3P7NA 2Z5UA 3MQ0A 1MDMB 4IF4A 5BS6A 2CFXA 3ZMDA 4XBFA 2QZ8A 4JQFA 5DUKA 5E1WA 2RQPA 3GZ6A 1VTNC 3KETA 2HGCA 4OIQF 3T0YA 4UVCA 1I1SA 1HW1A 5HS9A 3BPXA 3K1MA 4I01A 2HDCA 2DK5A 3CTAA 2JRTA 1TQPA 3C18A 3FMQA 3OV8A 2WV0A 1J7KA 3CDHA 1ULYA 5H6RA 4KN7X 2ESNA 2DLLA 3TQNA 2XGXA 3KP4A 3GFLA 1SMYF 2V9VA 3TDZC 3IHUA 2XKOA 2ISZA 2QQBA 4XLNF 2HEOA 4CICA 5J8CA 5DCMB 5D5WB 2P8TA 1FX7A 3B02A 1ZH5A 4KDPA 1FBUA 1BIAA 4A6DA 3E97A 2CYYA 4A6EA 3GVAA 1RUOA 4EJWA 2QBYB 3RJPA 4L9JA 2M30A 4M6YA 3BOQA 4M74A 3JAMZ 5L3GA 3U2RA 4PCQA 3E5XA 2V1XA 2H94A 3WTWC 5D4SA 1X3UA 4EM0B 1MJAA 2PMUA 1MGTA 4KIBA 1XN7A 1TNSA 3TOBA 2P4WA 3T8RA 1GXPA 2Z9OA 3L09A 1K6OA 1HSTA 5JI6A 1G3YA 3LFKA 4KIGA 2A69F 3HOTA 3GFMA 2J5PA 4LB6B 4RB1A 3WODF 1UHWA 1PDNC 1YTYA 2OZUA 2FU4A 4BHBA 2TDXA 4EM2A 1IRGA 5L3EA 2IJLA 4HF1A 2RKHA 3FXUA 1F9NA 4IHTA 2XASA 2YX7A 4I98B 2R7FA 3RKWA 1LB2A 1Z6RA 4OU0A 3ZP5A 3ZPLA 1W5TA 2AS5F 2EV5A 2QLZA 4EM1A 5LGTA 3FMRA 4KN4X 2BBYA 4HW0A 1BI0A 1KQ9A 2MA3A 3NRVA 1SFXA 2GA2A 4FT8A 4P9FA 1I6XA 2K02A 2NS0A 3F3XA 5D6FA 1IF1A 1V4RA 3QP5A 3EYIA 1Z91A 1UB9A 2A3SA 2V1DA 2XAJA 1STZA 4I7HA 3QPHA 5E1XA 5D4RA 3J80Z 4A12A 3V8KA 1FLIA 2QUFA 3FXRA 1I27A 2P7CB 2OA4A 3JAMK 2EV0A 2XHKA 1LVAA 4RB0A 2RN7A 3IWFA 4LFUA 1TLHB 4I2OA 4B8XA 2KIMA 1G3WA 1JHHA 2JZYA 1BM9A 2GWRA 4MQVA 5ICFA 2Q0OA 2EWNA 4AVPA 4ZYDA 1C0WA 3NEUA 4ZYGA 4NB5A 4MGRA 3KFWX 1S3JA 1U2WA 2CQKA 3H3UA 4HLYA 1Z1DA 1FC3A 2ZNYA 4EJUA 2CGPA 1WSUA 4RS8A 1XD7A 2FBKA 4LG0B 5A2QK 4CGZA 3ULQB 2D1VA 1EV7A 1S7OA 1P4AA 3IRQA 2E7WA 1ZLJA 1YFHA 5HDNA 2CW0F 2QM3A 1S8NA 4RB3C 3SZPA 3F8NA 2W84A 5HLHA 4LD5A 2FF4A 3WTSC 4O3MA 3FZVA 3JTGA 4EJTA 4P96A 3E6DA 3Q9VA 4UV9A 3MWMA 2FOKA 1KQ8A 3CO6C 3ZN0A 2FRHA 3ZMUA 3JSOA 4MNUA 3KP3A 1IN5A 4LJZF 3E6BA 4HQMA 2DBBA 2PLYA 4YIFA 4LMYA 2QWWA 1TQMA 1IN6A 2MLKA 3O2PE 5L3CA 3CJNA 3KLOA 5FGMA 2OAZA 1SMTA 3ML6A 4O5VA 1YW9A 3F72A 3ISPA 2XAQA 2EJRA 2MD5A 2HFHA 1W7PA 5LLQA 1QQIA 1ZGJA 2D1HA 1U6GA 3J80K 5K5OA 4UUVA 3I0TA 4PGHA 5H6QA 1G4DA 2STWA 2GAUA 4HX8A 2A68F 2PJPA 1KU3A 1R22A 5J6XA 3QRFF 3M8FA 3KEQA 5LEJA 1TBXA 3I58A 1P4WA 4G94A 1OYYA 4LB5A 2KIFA 3WE2A 1IAWA 4Y17A 2O6GE 1XDUA 4AWXB 2JPCA 2XUBA 1YG2A 2VBXA 1JHFA 4M9XA 2B0LA 2CSOA 3HRMA 1V3FA 1I5ZA 4G7HF 1BC7C 2CWEA 2HYFA 3GF2A 3OOPA 4M9ZA 2GXBA 1WQ2A 1B6AA 4LK0F 2RGVA 4LK1F 4XSXF 2IT0A 3JW4A 3F23A 3BDDA 1R5GA 2MC3A 2W57A 3VEPA 3R60A 4IRGA 4BNCA 3CUOA 2L3DA 2NNNA 5LGNA 1IN8A 1DDNA 3WU0A 2JPBA 1RNLA 2VONA 1QPMA 2OU2A 2Y75A 3RTRA 3ZN1A 3F22A 4CHUA 4ENKA 3ABUA 2BGCA 2HQRA 2DFIA 2Z3YA 2BYVE 3D5LA 3DEUA 3HHHA 3R61A 3GO5A 4EGZA 1LDKB 1YS6A 2RV8A 3EQLF 1R7JA 5FLXK 2HS5A 2VODA 2OZ6A 1E2XA 3EUHA 4A2UA 4WCGA 3C3WA 3CO7C 4P9UA 3W6JB 5JFRA 4BXUA 2DAOA 2DT5A 1BIBA 4L0ZB 4GCVA 4HA8A 2EFNA 2ZNZA 2ZXJA 2Y0MA 3H3ZA 4ESBA 3REOA 3DFGA 2XIGA 3RI4A 1HKQA 2BE5F 2XV4S 5CVIA 1FY7A 2P5VA 4Y13A 1PP7U 1YYVA 1ZGAA 5E1ZB 1H0MA 1HW5A 5LHIA 1NHAA 1KYWA 4ENNA 1YLFA 4PGGA 3FM5A 1K78A 2EV6A 2GQQA 2HYGD 4R8HA 1MZBA 4UV8A 3VFZA 4L5JA 1USSA 1FPQA 1O3TA 2GIVA 2O3FA 5BPDA 3TKYA 4M72A 3HSRA 4L9NA 1HBXG 1ZN2A 4JBAA 1JXSA 2IA2A 3WGGA 5FD6A 1J0RA 5KVRA 2CO5A 3DPLC 5BOXA 1YIOA 2K7LA 3V4GA 1TNTA 2LKPA 1SD5A 1P6RA 4EV0A 1OPCA 1F1ZA 4AIJA 5ILUA 4S05A 3MCZA 2H27A 4S04A 4R79A 5K1YA 2P7VB 5F6FA 4Q47A 3HHGA 1R5HA 4KMFA 2M8EA 5HLGA 2PI0A 5LGUA 4U7DA 2M5WA 5HS7A 4ZZLA 3K1NA 3V7CA 2KJBA 1R00A 1XCBA 1HXDA 1LEBA 2VBZA 3HIFA 1AWCA 1J5YA 4A5NA 2Q2EA 1W7PD 1MKMA 3GFIA 1O3SA 1W5SA 2P6TA 1YQAA 4I0BA 4R1HA 4GO1A 1ONVA 4N9IA 4WF2A 3WTTC 2QENA 3I71A 3HRTA 2VXZA 1KA8A 2A07F 2O03A 4BHCA 4GYGA 4M9SA 3HRUA 4E70A 3WU1B 3IRRA 2YSRA 4UVBA 5FB2A 4TV7A 2H6BA 3MZYA 2PBIA 2ETHA 1ZAOA 2ZKZA 4OINF 1SFUA 3SQNA 3GYHX 5ILVA 2FQ3A 3HOSA 4WK8F 4EJOA 2K4JA 4XLPF 4OMYA 2ZFWA 3KP7A 1MJBA 4D0PA 4JK1X 4I0AA 1FT9A 3B73A 3I54A 3DKWA 5HVQC 1DP7P 4MTEA 5DYMA 2PMHA 5JVTA 3DXJF 4LLGF 1KQ0A 1XGSA 2V79A 3GX4X 3RIRA 5D8KB 2QYOA 2ISYA 3RKYA 1BJAA 4OIOF 3GW2A 1P4XA 3HUGA 3QP6A 1UFMA 2HTSA 2DQLA 2P6SA 2ZBKA 1W7PB 1FYLA 4HQEA 2DI3A 2DTRA 1B9MA 1XSXA 2VOPA 1Y0UA 5J8FA 4ESFA 5EEGA 1OYWA 1KU7A 1OMIA 2IW5A 3RPQA 2A6EF 3CLOA 3L00A 3KZZA 3M1EA 3TGNA 2A6HF 4BQAA 3QU6A 2G7UA 1RZ4A 4QWQA 4HDVA 3BROA 3H92A 4L9TA 1QNTA 1P92A 3BY6A 3M9AA 1DPRA 3MZHA 4UVAA 2OQRA 4PDKA 3TDUC 3DF8A 5TJJA 4ENJA 1O3RA 4KIFA 4NHJA 4ZH4F 3KLNA 2O61A 1ZRCA 5CJ9A 1ZYRF 5F64A 4UXNA 3ZMZA 3F8MA 4L5IA 3NQOA 4EJVA 4MEXF 1HKTA 1WRJA 2HKXA 4L0YB 3P9IA 2L02A 2W25A 3MEXA 4HF2A 1TTYA 1YO5C 1ODDA 5CYVA 3U9GA 3I4PA 1AOYA 1XSVA 1U5TA 2WC2A 4NQWA 4CDGA 5D8LB 2UWMA 2RC4A 1SD6A 1ZG5A 1TQIA 1KYZA 4N9HA 4UHTA 1G3SA 1T6SA 1B1BA 4KT5C 5E8GA 4RGRA 4ASNA 1FNNA 4LLNA 1FOKA 2FNAA 2X0LA 1T39A 4MTDA 1BC8C 1IN7A 1OYIA 1QZZA 3KP6A 3Q5FA 1UCRA 2DK8A 3TO9A 4CZZA 2XVCA 1S6LA 4XRFA 4KICA 5ED4A 1BI3A 1KU2A 2WWYA 2PG4A 3RPUA 4EMSA 5EEHA 3QPTA 1H9TA 2FMYA 2UXNA 1R1VA 5HDKA 2VOOA 2L4MA 4Q5SF 2IPQX 2O0YA 4EGYA 4U0WA 1T2KA 1YW7A 2F2EA 3HTUA 3JTHA 2DQRA 4RAZA 5E17F 2KJCA 3WTZA 1K79A 3C1DA 2M87A 3Q9SA 1K78B 1O3QA 2X4HA 1S29A 3IKVA 4M71A 2RVCA 3N4MA 2Z33A 3WG9A 3IC7A 1O7FA 3RDIA 3N97A 5CVJA 2XAHA 3LQRA 2FMLA 1QO0D 1L3LA 3WTUC 2JT1A 1DUXC 5TRDA 4OIPF 1JGSA 4Q4ZF 1GHCA 2AXLA 3K69A 4OIRF 5IT9Z 2COMA 5ICCA 3BP8A 2OBPA 3DP7A 5D5VB 3F8BA 4HAMA 3KE2A 1U5TC 2M1BA 2K4BA 3LWFA 1TW2A 5CVVA 3FF5A 2LSOA 4P5OA 2ADUA 5LHHA 3FX3A 4WX9A 2RDPA 2RNJA 2VT2A 1RIOH 2F5EA 1IZ1A 2UXXA 1SD4A 1G3TA 2E7XA 1E17A 1XDSA 1W4MA 4L18B 2ELHA 2IA0A 3WTXC 2STTA 6PAXA 2JTVA 3V8JA 3KP2A 4A5MA 1F4KA 1F5TA 4KMUX 3P9KA 5ILSA 3SFZA 2FBHA 4HDUA 1IXCA 2EFWA 1ZRDA 1QBJA 4KUMA 2YPRA 2W85A 2O8XA 1J75A 1WI9A 1Q1HA 2MLGA 1IUYA 4U7BA 3BPVA 3F8FA 2VE9A 1LDDA 1T38A 3P9CA 4IJAA 1CF7A 1XB4A 3KEOA 3LA3A 2KKOA 3M7GA 3AAFA 2Y48A 3BJ6A 4WXHA 4BAYA 1R1TA 2FE3A 4HYEA 2MBFA 5DEQA 4Z2YA 1B4AA 5F1RA 2EA4A 4KFCA 2W24A 1B9NA 3O6BB 2VN2A 3EYYA 2QQ9A 1FYKA 2HWVA 4G7OF 2GXGA 5L3BA 4ENMA 4G7ZF 2CG4A 1HKSA 2ZMEA 2H09A 2VT3A 2L01A 1U78A 2MH9A 2ZJ2A 3BWGA 3GFJA 4CO8A 1QZYA 5BMZA 5DCFA 3SZTA 4MEYF 3T1BA 4I02A 1LNWA 5D5XB 5LBQA 3E5UA 3HRSA 5IT9K 1FYMA 3ZMVA 2EFQA 2YR2A 2ZCWA 5DUIA 4G6DA 2KIUA 3O3KA 1KGSA 3RYPA 3R6SA 4CXFA 4M6XA 1FZPB 1OKRA 4AD9A 5FFZA 5DV5A 5IT3A 5LHGA 2V1UA 1JE8A 4XSZF 4KYWA 4L9VA 4IVNA 3PQKA 1FSEA 2DPDA 2F5DA 4U0YA 1OR7A 3EDPA 3I59A 5ERIA 4BYYA 2NYXA 4DNCA 1TW3A 1O57A 1HSJA 1GXQA 1R58A 5JHUA 4HF0A 2A5YB 3GEZA 1YS7A 1IXRC 2P5LC 5JR3A 4H0EA 3FXQA 1ZHFA 4HX4A 4K2EA 4HZFA 3ELKA 4EQQA 1U8RA 3CUQC 3HSEA 1P2FA 4WXDA 2LDUA 3ZMTA 5FFXA 1ZARA 3F6OA 1U5TB 3COAC 5E8IA 2OQGA 3T5XA 5HOOA 3ERED 1A04A 3GWZA 3FHZA 4RGSA 1USTA 3ROUA 3QAHA 3G73A 1ZG1A 4YIIA 1G6NA 2R7DA 5A2QZ 3J81Z 2BEOA 5DD8A 4LGWA 3E5QA 2K27A 3K0LA 4LLLA 5E20A 2HQNA 3R4KA 1ZRFA 2QQAA 3GXOA 2C6YA 1BI1A 2XAFA 2P5KA 3HYIA 3LA2A 2EK5A 3DPTA 2MH2A 4U0VA 5BPIA 1D3YA 3C7JA 4F7ZA 3F6VA 4QLCU
chains in the Genus database with same CATH superfamily
5BQTA 1XMKA 5LEKA 3TW7A 3ZRGA 1UZCA 1MDMA 2GBYA 2FNPA 3M8EA 2DTZA 2F5FA 1Y0NA 4AIHA 2XGEA 3I5UA 2YX4A 3DBRB 4XKCA 2O8KA 1J9IA 5KAFC 3ZQ7A 2F5VA 3TO7A 2ZXIA 3IWZA 5GAEJ 2J5OA 2HR3A 3FKJA 4JOMA 1Z3YA 3MAJA 3OYHA 2LYCA 1OR7C 4OMZA 4BY7J 2BW3B 2CQNA 1MMSA 3L2WA 1PUFA 2R7ZJ 2L9NA 3ECHA 3ERMA 1PUEE 4BE1A 1LEAA 2NAZA 1H9GA 4N0BA 4G6QA 1XCVA 4JYKA 3ABTA 1HQCA 4ZYAA 4FX0A 4O6JA 2IRFG 2NVQJ 1QVTA 2KISA 4IHWA 2LG4A 1ETOA 3R0JA 5GAHJ 2DPUA 1BBYA 2V9PA 3OIOA 2FEZA 2K40A 2Q1ZB 4RAYA 4E7HA 1PJRA 2PEXA 2D45A 3OOUA 3FMSA 1PVEA 2BV6A 1NK2P 4OWRB 4B44A 1J2XA 4GGGA 2W4SA 3WE3A 4HV5A 3SXYA 2CUEA 3G71I 1V55H 2HDDA 3CMMA 1KU9A 1MD0A 2DDBA 2IEKA 4UUSB 1BOAA 3V8LA 3FWEA 4D9JA 1O7LA 2XSDC 3JRFA 1XMXA 3HOVJ 1IXSB 4IPAA 1LFUP 3SEZA 3IAM2 1V5EA 2WAFA 1QZEA 1Z7UA 4KNYA 1QRYA 5GAGJ 4Q48A 3RQ4A 3LAJA 2R5ZB 2NRAC 5DCMA 2EFPA 2G0EA 4G8XA 3RKXA 1FWZA 2CV0A 3ZMSA 5DD4A 2LY9A 1XGMA 2CV2A 1RKWA 1IW7F 1LJ9A 4ZYEA 3QYBA 4J01A 2HOSA 1SFEA 2CQ7A 2MG4A 3CCYA 3OYGA 5FKKA 1UG2A 5D5UB 2JA8J 2DJIA 2QBYA 1FP2A 3WGHA 2UZKA 3AG2H 4YFKF 1N77A 1B8IB 2Z1DA 2DT6A 3DQVC 4XLCA 3G4SI 3LQQA 4G9YA 2XRLA 1V5GA 5CKTA 3QU3A 2L9VA 5AIQA 4A0ZA 4M3FA 4EVIA 1ETQA 5EF6A 2FBIA 2R3SA 3BZKA 2H6CA 2WTEA 3ZQGA 4YFNF 2X6OA 2XAGA 3SZGA 4IRHA 3PFIA 5EZHA 2EZHA 2G9WA 2PFBA 4BL0B 5C4XJ 3K7AJ 4WXCA 2JSCA 2VE8A 2ZJRF 4FHTA 3KCCA 1W5CC 4XK4A 2XGDA 3ZQHA 4BQOA 1ZLKA 2HTJA 2VBYA 3BG6A 1FP1D 2GZWA 5K5RA 3OY9A 3HSFA 2EH3A 4W97A 1VI0A 2V6CA 4OOIA 1MSEC 3WTYC 3DTIA 2MGQA 4UB6C 4UNOA 1EJ9A 5D6EA 4E7ZA 3J81K 2LF8A 2XRNA 5JLXA 1R23A 2IVMA 3K2ZA 2F48A 3A02A 1SFKA 1LQ1A 4Y33A 3QYEA 1UHMA 4B4CA 1ON2A 3G2BA 4J00A 3JSPA 1D1AA 3DV8A 3EUAA 3NAUA 5HS8A 1T0FA 3L9FA 1DU6A 5CLSA 2BZTA 1I1GA 3BC8A 4DQ2A 1Z6TA 4AU7A 3W3CA 2PN6A 2DA1A 2Y31A 1T33A 3TOAA 2QQ8A 4Y15A 2R7QA 3DEEA 2LY2A 1X1DA 2D2WA 2PQ8A 3FK7A 3HC7A 3H9QA 1CF7B 4IHYA 4Y3OA 3W6KB 1J59A 1X4OA 3IL2A 1IJWC 4EATA 1T8IA 1OCCH 2P0WA 5E18F 3GUDA 5KK1A 1FBSA 1U3EM 2Y2ZA 3GZNB 1VQLI 3I64A 3KZYA 2M7AA 2M0MA 1D8KA 1P7IA 4CYCA 5HLIA 2Y0SA 3CJTB 1WJFA 2M45A 3GLXA 4A3CJ 2P81A 1GDTA 1HOMA 1A5JA 2VBWA 5L3DA 1SD7A 4PZJA 2HZTA 3BZ6A 3I53A 2WB1A 5FLXZ 2F5CA 5ICGA 1XGOA 3CUQB 3MFKA 1EH7A 2IA1A 1RR8C 3FM3A 2B7EA 2R92J 2HYJA 4XIDA 2IP2A 1YI2I 2MABA 3FXOA 5B66C 1ITYA 2ZO4A 3CF2A 3L7WA 1XC5A 5CVUA 5FO5A 1REPC 2DFHA 2N8GA 2V26A 1R1UA 3VDXA 1K7AA 2ZMEB 3S14J 1B72B 4HBLA 3DBLB 1FSHA 3H0DA 2L4AA 2JN6A 4DZJA 2E2IJ 1IN4A 2A61A 4RLFA 2M9HA 4HLXA 5GPAA 2XROA 2LNBA 2ZSHB 1L0OC 2IS1A 3LSTA 1HLVA 2DA4A 5DDGA 3S2WA 3F8CA 4B47A 2K9SA 1RI7A 2FSWA 1LPQA 3K2AA 2HVQA 3VOEA 4A69C 5H20A 5JLWA 2Z99A 2EB7A 2X6YA 1BR2A 1PYVA 4RBOA 2VC1A 1EA3A 4M73A 5HDGA 1GVJA 3E3VA 1ON1A 2G7HA 4QSHA 1PP8F 4HSTA 2L0KA 3JRAA 3U1DA 3G3ZA 3WHBA 5AIPA 5FD5A 1EH6A 1EF4A 1Z9CA 3FBIB 4B3AA 2LLKA 3I4MJ 3CJQB 5E3NA 1ZKGA 3K9TA 2HDWA 3OR1C 2DW4A 4HOBA 3J7AO 3R0AA 3HTSB 3NARA 4NNJA 4N4OB 3MZ8A 1WWXA 4AIDA 1ZG3A 3QOPA 3K1PA 2KZVA 3CJRB 4GXOA 1Y6IA 3C2GA 4HX7A 1H8AC 2HOEA 4WWCA 2I5UA 2YU3A 3ECOA 2E71A 1ETXA 3GTMJ 2M4GA 3O8GA 2IGMA 2E1NA 3BJAA 4HV6A 3KP5A 4ZDLA 4S0HB 2XB5A 3BJOA 3BTJA 2ZJPF 3ZR8X 4RGUA 1SAXA 1XGNA 4E7LA 3IAS2 5AONA 3TO6A 2FA5A 3E6MA 2RNGA 2CUFA 2ACJA 4AIKA 2LFBA 2WAQA 1MJ9A 4A0XA 3MKLA 3BR5A 4ETSA 5J4VA 4CYDA 5FJ8J 5C3EJ 5CVRA 3BR0A 2ESHA 3SHFA 5F08A 3PL8A 1W0TA 2LF7A 4YG2F 2DMQA 4XKVA 4RB2C 1X1CA 1XSDA 4LIUA 3FXKA 3I59B 1FIPA 3A0BC 5LRRA 4B43A 3F21A 1EH8A 2NNYA 2E1CA 1D8JA 4XLHA 3LAPA 4PJMA 1R36A 3PQJA 4I6ZA 1ZREA 2LREA 3P5JA 5LFAA 4MQ9F 1YOVB 3HGGA 1MW7A 4IEJA 1T98A 3D5SC 4MHGA 2L7FP 2VC0A 5L3FA 4FX4A 4IRIA 2K9NA 1WKMA 3GZ5A 5F0HA 2HKOA 3T8TA 1MNEA 3VODA 4BE2A 3IH4A 3L2CA 4ZYHA 1CGPA 3D0SA 4OAZA 3PNTA 1SEUA 2F4OB 2EIJH 2VB6A 2OD5A 4KA4A 1RESA 1QGPA 2K3FA 3HDDA 2ZSIB 1DPUA 3CCRI 4U88A 1QHHD 3WU2C 1LDJA 4C3JJ 5J1YA 2ME0A 5EGOB 4RGXA 3WTVC 4GYIA 3ZQIA 2R7RA 4C30A 4UUTA 3IKTA 2VI6A 1ETYA 4LG0A 3ZQLA 4A0YA 4P55A 5KCMA 1FBQA 2M4KA 4ESJA 1IRFA 3Q0VA 4ON0A 3K4MA 3CQZJ 1HW2A 2JVGA 3RYRA 4ZZDA 2DJNA 3OYBA 1S7AA 4IQJA 1OCPA 1YW8A 4BJ6C 1K4TA 5EG0B 3B6CA 2LBFA 3V7RA 4YFXF 2FXAA 3E6CC 1Z05A 3K6GA 2KHMA 5K5QA 4II2A 2L54A 2JA2A 2Q8KA 2LY1A 3LA7A 5LRSA 2KRFA 4BHPA 4I09A 2EFOA 1BI2A 3WGIA 4DOZA 1BN5A 1Y1VJ 5BNGA 2DU9A 4BEHA 3U21A 2K9MA 2XKPA 3HXLA 1XMAA 2DO7A 2WA0A 1RUNA 3GTLJ 4BJ5C 1X2NA 4JX5A 3S15J 2E36A 4XNFA 3I9V2 3V7SA 1AA7A 3BTLA 3DBHB 3VB2A 1APLC 4DBRA 2K86A 3GTKJ 4B09A 4BH9A 5ICEA 3S16J 2EA2A 3H0GJ 1MMDA 2QVOA 3CUQA 5IP7J 2GA1A 4RM3A 4IXAA 2DA5A 2XF6A 3OYMA 1B59A 3EETA 3P7NA 5EJCA 1MH3A 3HL2A 2K5CA 2Z5UA 1MBEA 3MQ0A 3FHNA 1MDMB 3MD2A 1GLNA 4A3DJ 3LSGA 4IF4A 5BS6A 2CFXA 3ZMDA 1ETKA 4XBFA 2QZ8A 4JQFA 1B72A 3BT9A 5DUKA 5E1WA 2KDOA 3GTOJ 1OQYA 2BY0A 1JUMA 3FIWA 2RQPA 3H5NA 3GZ6A 4GDFA 1VTNC 1EKEA 3LSJA 2L7ZA 1YJ9I 1UMQA 3KETA 5HODA 1IRZA 1PUFB 1JKOC 2HGCA 2ID6A 4I99C 4OIQF 3T0YA 3HBLA 2VIXA 2OC6A 4UVCA 3ZQFA 1TZLA 1I1SA 1HW1A 2QKLB 3BPXA 5HS9A 4HNTA 3K1MA 1TP4A 4I01A 2DK5A 2HDCA 3CTAA 2JRTA 1U0JA 1TQPA 3C18A 3FMQA 3OV8A 2WV0A 3RKQA 1J7KA 2BOLA 1F36A 2DDAA 1NH3A 3CDHA 1ULYA 1ZQ3P 3KZIC 3A4CA 5H6RA 3OYJA 3S1MJ 4KN7X 2JK3A 3KYLA 2ESNA 2DLLA 4UB8C 3S1NJ 5E3LA 2E19A 2IGKA 3TQNA 2XGXA 3KP4A 4MLOA 4DZPA 3ABLH 3GFLA 1SMYF 2V9VA 3TDZC 3MKYB 2JJ7A 3S32A 3PO2J 1TT5B 3IHUA 2Y69H 2XKOA 2ISZA 2QQBA 4D7NA 4XLNF 2BVMA 3Q0UA 2HEOA 3DU5A 3PSIA 4CICA 3AKZA 5J8CA 5DCMB 5D5WB 2P8TA 5IY5H 1FX7A 3A2KA 3B02A 5J40A 1IDYA 1ZH5A 4KDPA 2CRGA 3H5RA 1FBUA 4IL6C 2E2JJ 1BIAA 3X2QH 1JUSA 4A6DA 4E7SA 1K4SA 3E97A 1TL8A 2CYYA 1R49A 4A6EA 2XGCA 2CUZA 3GVAA 1S72I 2HPMA 1RUOA 4EJWA 2QBYB 2XF5A 3RJPA 2W82A 4L9JA 4RMNA 2M30A 2E2HJ 5FKMA 1MBJA 5KHDA 5LD2C 2M2EA 4M6YA 3CCUI 4KT6A 3BOQA 4M74A 3JAMZ 1D1CA 3TW6A 3EUHC 1MMGA 3C2BA 5L3GA 3E0JB 1RRJA 3U2RA 4BUPA 4PCQA 3HOXJ 3E5XA 2NS7A 3NWTA 2V1XA 2H94A 4OAYA 1Z7LA 3TP0A 1GV2A 3WTWC 5D4SA 4KISA 1X3UA 4EM0B 1MJAA 4A3EJ 2HOTA 2PMUA 4RLQA 3IUOA 3E1SA 5JHFA 1MGTA 1RETA 4E4HA 3HKZA 4KIBA 2ELKA 1XN7A 1TNSA 2QSFX 3TOBA 2P4WA 3T8RA 1GXPA 2O5RA 2Z9OA 1R5ID 3L09A 1XS9A 4NC6A 3DEWA 1K6OA 3DLLF 1HSTA 3SYTA 3BCAA 5JI6A 3TEDA 1G3YA 3LFKA 3CC4I 5M5WJ 4NUBA 3CP2A 3WG7H 4KIGA 2A69F 3CF5F 4M3EA 3HOTA 2VKEA 3GFMA 2LTPA 2J5PA 4LB6B 2WB1N 4RB1A 4P1WA 2CFOA 3WODF 1UHWA 4RAGA 1PDNC 2R5YA 1YTYA 2AXTC 2OZUA 2QA4I 2WADA 3BG3A 2FU4A 2EIMH 3UKGA 1TWFJ 1G59A 3D5RC 4BHBA 2TDXA 4EM2A 1IRGA 9ANTA 5L3EA 1VZ0A 4Y4RA 2LK2A 2IJLA 4HF1A 2NVXJ 1DP3A 5GP9A 2RKHA 3FXUA 1F9NA 4CYCB 4IHTA 2XASA 2YX7A 4YELA 4I98B 2DFEA 3AL0C 4LIVA 2WY7Q 2R7FA 3RKWA 1LB2A 1Z6RA 4OU0A 3ZP5A 4KJZA 1W5TA 3ZPLA 2AS5F 2QLZA 2EV5A 4EM1A 3H9GA 3S8PA 4AYBA 2KFDA 5LGTA 3FMRA 2FQ4A 1FOXA 4KN4X 1HDPA 2NOGA 2BBYA 4HW0A 1BI0A 2XB0X 4NDLA 4BS9A 4EEFG 1KQ9A 2MA3A 3NRVA 1SAUA 1SFXA 3HB9A 1IV6A 2GA2A 3K4LA 2I10A 4BACA 3CCSI 2XPUA 4FT8A 2VKVA 4P9FA 4B48A 1I6XA 5J47A 1F43A 2K02A 1MBKA 3SJMA 2NS0A 1ENHA 3DCFA 1OLTA 3F3XA 1POGA 1WJBA 3DPUA 3JRCA 1U9OA 1LUJB 5D6FA 1IF1A 2E5NA 2LVSA 1V4RA 3QP5A 3EYIA 4LG3A 3TL4X 1Z91A 2WAQN 5DM7F 2JA5J 4XQFA 1UB9A 3RCOA 3PNYA 2A3SA 2MC4A 2V1DA 2XAJA 1STZA 4I7HA 3QPHA 5IP9J 5M5YJ 1I50J 5E1XA 5D4RA 3J80Z 4A12A 1DQUA 3V8KA 4BGDA 1FLIA 2QUFA 3ABKH 2K9QA 3M07A 2OUMA 1FJLA 3FXRA 1I27A 1SVMA 2WV1A 2P7CB 1JGGA 1NTCA 2OA4A 1JI8A 1IRXA 2TRTA 3JAMK 2EV0A 4XOTA 2XHKA 2NVTJ 3HOZJ 1LVAA 5FKNA 1H88C 1T95A 1T08B 4C2UA 3SDBA 4RB0A 2RN7A 3IWFA 3OYEA 2W1OA 1V5FA 4LFUA 4D7MA 1SC7A 1TLHB 4I2OA 1G2HA 4B8XA 3CESA 2CJJA 3CCEI 1TWAJ 2KIMA 1G3WA 1JHHA 2DFFA 4XL9A 2CH0A 4F3QA 2JZYA 1HA8A 4MIMA 1BOBA 2CQXA 1A6IA 2VPRA 1HCRA 3LL7A 2COBA 2QSHX 5CPRB 3PSFA 3AFHA 1BM9A 2GWRA 4MQVA 1FOYA 5ICFA 2Q0OA 5IP6A 2EWNA 4AVPA 4ZYDA 1C0WA 3NEUA 2GOMA 1UJ8A 4ZYGA 3PJRA 2EZIA 4NB5A 4MGRA 3KFWX 3I55I 2VJIA 4AC0A 1S3JA 1TWCJ 1U2WA 2EINH 4CCKA 4E6KG 2CQKA 3H3UA 4HLYA 1Z1DA 2WBMA 1FC3A 2X1DA 2ZNYA 4EJUA 2CGPA 4IQ4A 4HSRA 1WSUA 5GPCA 2O9LA 4RS8A 1XD7A 4F52A 3OS1A 3JR9A 2F4MB 2FBKA 2H1LA 4LG0B 5A2QK 1YX5A 3BLYA 2D1VA 3ULQB 2PMZA 2XSJC 1EV7A 5IPAA 4XRMA 4CGZA 1UELB 2EIKH 4PJLA 4XLFA 4IHXA 1S7OA 4XICA 1P4AA 3IRQA 2Y30A 2E7WA 3FKIJ 2LBFB 1ZLJA 1YFHA 4Y7NJ 5HDNA 2CW0F 2QM3A 1S8NA 4RB3C 5J1UA 3SZPA 4BJTA 3F8NA 2OF7A 2F6CA 2XPVA 2KMUA 2DOFA 2W84A 1TWHJ 5KNLA 5HLHA 4G6TB 4A93J 2EILH 4LD5A 4XMYA 3L2VA 2PJRA 1XG1A 4BEHB 2KIQA 2FF4A 3WTSC 4O3MA 2IAIA 2A5WA 3FZVA 3JTGA 1N75A 3O8HA 4EJTA 4P96A 3E6DA 3Q9VA 4UV9A 3MWMA 2GOXB 2BY2A 2K85A 2FOKA 2W48A 1KQ8A 3LMMA 2XAUA 3H36A 3CO6C 5JVGF 2VKHA 3ZN0A 2FRHA 5E79C 3ZMUA 3S2DJ 4ITVA 3JSOA 4MNUA 3ZQQA 2E1MC 3KP3A 2HVSA 1IN5A 4LJZF 4CZCA 1R71A 3E6BA 3S17J 1V54H 4HQMA 3VYTB 2DBBA 4PK4A 3J7AY 2MD0A 3BTCA 1NK3P 4XN3A 2PLYA 4BBSJ 4YIFA 3L2QA 2KT0A 4LMYA 2QWWA 1ACIA 1TQMA 1IN6A 1VQ6I 2MLKA 3O2PE 5L3CA 3CJNA 4D1QA 3KLOA 5FGMA 3PFYA 1R9TJ 2OAZA 1SMTA 3ML6A 4O5VA 2A05A 5E3OA 2EZKA 3Q3SA 1YW9A 3F72A 3ISPA 2DMNA 2OCCH 2XAQA 2YS9A 2EJRA 3UNGC 2MD5A 2OTJI 4CUGA 2HFHA 5IYCJ 2R7VA 1W7PA 1IDZA 5LLQA 1ORKA 1QQIA 3GCMA 4AVZA 1DGRM 2PX9A 1WH7A 1ZGJA 1O4XA 2D1HA 2R4GA 1U6GA 2NOJB 3L2UA 2X51A 3J80K 5K5OA 4UUVA 3OS2A 3I0TA 4PGHA 1FTTA 3I4NJ 3G1OA 3MMYB 5H6QA 3OYIA 1G4DA 4ZJZA 3LOCA 2STWA 1I6HJ 2GAUA 4HX8A 3LSRA 5GTHC 2A68F 2PJPA 1KU3A 1R22A 4FASD 3QQAA 3S3MA 5J6XA 3QRFF 3M8FA 2AQFA 3KEQA 5LEJA 3DU6A 1TBXA 3I58A 1LFPA 1P4WA 4G94A 3AL0B 1OYYA 4LB5A 4M6VA 2KIFA 3WE2A 1IAWA 1SANA 4Y17A 4MFEA 1HF0A 2O6GE 1XDUA 4AWXB 2DT7B 1SVLA 2JPCA 2XUBA 1YRNA 2VBXA 1YG2A 2LKSA 1JHFA 2KQRA 4M9XA 1R4NB 2B0LA 1QPIA 4QPOA 2JVHA 2CSOA 3HRMA 5CQGA 2KDZA 4XKWA 1V3FA 1MIJA 3KYCB 4Z6YA 1I5ZA 3K4KA 3IP4B 4G7HF 1WH5A 2JQ7A 1BC7C 1D5VA 2CWEA 2AO9A 2HYFA 2UUZA 3GF2A 3OOPA 5TISC 3PM1A 4M9ZA 2GXBA 1WQ2A 4CCOA 2DA7A 2R7UA 1B6AA 2TCTA 1IGNA 4LK0F 2RGVA 4LK1F 1LVKA 4XSXF 2IT0A 3JW4A 3HKZN 3F23A 3BDDA 4ZC3A 1R5GA 2MC3A 2W57A 3ASNH 3VEPA 1OISA 3TP3A 3R60A 4IRGA 1ZTRA 4C2TA 1OFCX 3PNVA 4BNCA 3CUOA 4LOCA 2L3DA 3OMYA 1P7JA 5K7FA 2NNNA 5LGNA 1IN8A 1DDNA 4CH7A 3WU0A 1N78A 2JPBA 1RNLA 1Y8RB 2VONA 1QPMA 2M3AA 2OU2A 2Y75A 3DWLE 3RTRA 3ZN1A 1D0ZA 4CCLA 1U9NA 3WHCA 3F22A 4CHUA 4ENKA 1CQTA 3ABUA 2BGCA 3HOWJ 2HQRA 2DFIA 2Z3YA 2BYVE 3D5LA 3DEUA 3HHHA 3R61A 2LC2A 4BQNA 3GO5A 4EGZA 2HQ5A 1LDKB 1FOWA 1G8XA 1YS6A 1TWGJ 2ECCA 2RV8A 2X6WA 2DODA 3EQLF 1R7JA 1ZELA 2EBIA 5FLXK 3OSFA 3I56I 2HS5A 2VODA 2V9KA 2OZ6A 3GBGA 1E2XA 4H4KC 3EUHA 4XRSG 3JRHA 4A2UA 4WCGA 5B1BH 2R5YB 3C3WA 3CO7C 4P9UA 3W6JB 5JFRA 2K9LA 2L5QA 4BXUA 2DAOA 4AYBN 4HG2A 4PSXA 2DT5A 2M34A 3TBIA 1BW5A 1BIBA 4L0ZB 4GCVA 4HA8A 2EFNA 1X1AA 2ZNZA 2ZXJA 2Y0MA 5B1AH 3H3ZA 4ESBA 3REOA 3DFGA 3FK6A 2XIGA 3RI4A 1HKQA 3M8JA 1X4PA 4NC8A 2BE5F 2XV4S 3A0HC 3EUKL 5CVIA 3VYRB 4N4NB 2GM4A 4DYRA 2GIZA 1FY7A 2EZLA 2P5VA 4Y13A 1PP7U 3A01A 1AHDP 3DKYA 1YYVA 2QSGX 2JWTA 4BDZA 4A3KJ 4C9YA 1Z3XA 3ZGKA 1ZGAA 5E1ZB 1H0MA 2DA2A 1HW5A 5LHIA 1NHAA 1YJNI 3OYDA 2HZDA 5B5EC 1KYWA 4ENNA 3ZXSA 1YLFA 3L1PA 4UY8I 1MMNA 4PGGA 2ZXWH 3FM5A 1K78A 1IC8A 2EV6A 1MBHA 2GQQA 4M3DA 1NG7A 3ABMH 2HYGD 4R8HA 1MZBA 4UV8A 3VFZA 4F92B 4L5JA 1FIAA 2FOWA 2FUG2 1USSA 1FPQA 2CW7A 1O3TA 1ETWA 2GIVA 1JT6A 2O3FA 4DGWB 5BPDA 3TKYA 4M72A 3HSRA 3FDYA 1N25A 4DW6A 4L9NA 1HBXG 1ZN2A 4JBAA 2VQCA 3CCMI 2IA2A 3WGGA 1JXSA 4BXXJ 5FD6A 1J0RA 5KVRA 1KONA 2CO5A 3DPLC 4QIWN 5BOXA 3QYFA 2WAEA 1YIOA 2K7LA 3V4GA 1TNTA 1JKQC 3CP8A 2GLOA 2LKPA 1SD5A 1P6RA 1HDDC 4EV0A 1OPCA 2UV1A 1F1ZA 4AIJA 1S7EA 5ILUA 5J1RA 4S05A 3LFUA 3MCZA 4FTHA 2R7XA 2H27A 4S04A 2V4JC 2XPWA 3HJEA 4R79A 1K83J 5K1YA 5J4YA 2RREA 2P7VB 2X9DA 3JRBA 5F6FA 4MFDA 1VQ8I 3G1LA 3K4JA 4XR6A 5C44J 3V42A 2L9RA 4Q47A 3HHGA 1R5HA 2DXIA 2VLAA 3ESWB 4I76A 4KMFA 2VJ5A 2M8EA 5HLGA 2PI0A 5LGUA 3CMEI 4U7DA 2M5WA 2IS2A 2KPMA 2L7MP 5HS7A 4ZZLA 3L2RA 3K1NA 3V7CA 2KJBA 1VQMI 1R00A 1XCBA 1KZHA 3S1QJ 1R6RA 1HXDA 4IO9F 1WJ5A 3ZCOA 2ECBA 1LEBA 2VBZA 3HIFA 1AWCA 2PMZN 1J5YA 1FEXA 2BXZA 4A5NA 2Q2EA 3MKWB 1W7PD 1MKMA 3GFIA 3N05A 1O3SA 3M1CA 3F0CA 2ZFUA 4PFOA 1W5SA 2P6TA 1YQAA 4I0BA 4R1HA 4GO1A 1ONVA 4N9IA 4WF2A 3WTTC 3QWLA 4DYCA 4XONA 4M3BA 5GADJ 2XDVA 3MKZA 2QENA 3I71A 2E1OA 1BR1A 3HRTA 3OWTA 2VXZA 3W6VA 1KA8A 2A07F 2BHZA 3AG1H 2O03A 4BHCA 4GYGA 4M3GA 1R4MB 4M9SA 2FX0A 2HXIA 5F1JA 2Y9ZA 3M4OJ 3CDLA 3HRUA 4E70A 3WU1B 1ZGWA 2QEXI 3IRRA 2YSRA 3BG7A 4UVBA 2MSYA 3BR6A 1JTXA 4TV7A 5FB2A 1Y39A 2H6BA 3QOEA 5DTDA 3MZYA 2PBIA 4IZZA 4BU2A 1X2MA 4DYQA 4J19A 3JCUC 2DOEA 1SVOA 2ETHA 2OJED 2OCEA 2Y0SN 4PJ0C 1ZAOA 4D5FA 4QTRA 2ZKZA 1TT0A 2KRCA 2R7WA 2O7OA 4OINF 1JKPC 2E35A 1SFUA 3SQNA 1DGWY 1QU3A 3GYHX 1OJLA 5ILVA 4NQWB 4GFBA 3RZDJ 2FQ3A 3HOSA 4V19K 1D0XA 3DKXA 1MSFC 4IHSA 4BY1J 4WK8F 3JRDA 4EJOA 4A3IJ 1X19A 4FCYA 1T56A 4GRIA 2K4JA 3HOUJ 4XLPF 1RC9A 4OMYA 4IX7A 5EEAA 2ZFWA 3KP7A 2PJRB 1X1BA 1JJ8C 4RAFA 1MJBA 4FE4A 4D0PA 4JK1X 2X1CA 4I0AA 5F0CA 1FT9A 3B73A 4A3FJ 1WFXA 3I54A 3DKWA 1RPWA 5HVQC 1X3WB 4A3GJ 1VNDA 2CMPA 3SEQA 2I8DA 3LSPA 1DU0A 5FRNA 1DP7P 1IO2A 4MTEA 3FISA 5DYMA 3FXJA 1FMVA 1FTZA 5EDNA 4PJNA 2PMHA 5JVTA 5E3MA 2ZB9A 4A3BJ 3DXJF 4LLGF 1K6YA 2DYSH 3DTEA 5EZGA 3J7YJ 1KQ0A 2K3PA 1XGSA 2V79A 3GX4X 3RIRA 5D8KB 2QYOA 5FROA 2ISYA 3RKYA 2CQQA 1BJAA 4PJJA 4OIOF 2FD5A 3GW2A 1P4XA 2DOAA 3BG5A 3HUGA 3QP6A 5FRMA 5FKLA 1UFMA 2HTSA 2DQLA 2P6SA 4KITB 2VUMJ 2XF7A 1MMAA 2ZBKA 2LOOA 1WCMJ 4CA0A 1W7PB 4RM2A 4YRVA 5C4JJ 4XLAA 1W36C 1FYLA 2CS3A 4RA2A 5K7ZA 4HQEA 2L7KA 2DI3A 2DTRA 1B9MA 2DA3A 1MNDA 1XSXA 2DCEA 2EQRA 4MO7A 2JMWA 2VOPA 2V6EA 2V1NA 1Y0UA 1QA6A 5J8FA 2BHYA 4ESFA 5EEGA 1OYWA 3BQZA 1Z67A 1KU7A 4FISA 1OMIA 1A35A 2LRDA 1WJEA 2IW5A 4E7JA 3RPQA 2A6EF 2EPFA 3CCLI 3ASOH 3CLOA 3L00A 3KZZA 2B9SA 3M1EA 3IH2A 3TGNA 2A6HF 4PFPA 4G12A 4BQAA 1WJCA 3QU6A 2G7UA 1YHQI 4QPQA 3ZQCA 1RZ4A 4QWQA 4HDVA 2LH9A 3BR2A 4IKFA 3BROA 1BJZA 3RZOJ 4FQGA 1XPXA 3H92A 1YRNB 5HNFA 3JREA 3TMOA 3RQIA 3OIPA 4L9TA 1QNTA 1X1PA 3OYKA 1P92A 5FLMJ 3E7LA 4ABZA 3BY6A 3KPHA 1XX5A 3FXMA 3M9AA 3K10A 1YX3A 1DPRA 3MZHA 4UVAA 2OQRA 4PDKA 2DN0A 2DMUA 4JX6A 3TDUC 3KX2A 3DF8A 5TJJA 1U8BA 1LFBA 4ENJA 1LE8B 1O3RA 2R7OA 4KIFA 3BTIA 2RQQA 4NHJA 4A3MJ 2R7SA 1Q1VA 3Q0WA 4ZH4F 3KLNA 2O61A 1ZRCA 5CJ9A 3JRGA 3LNQA 4D5CA 4II3A 2IBDA 1ZYRF 2R93J 5F64A 4IOCF 4UXNA 3ZMZA 1WVRA 3F8MA 3OYCA 3QODA 4L5IA 4BDYA 1VQPI 2BY3A 4JP0A 4HEA2 4A3JJ 1YIJI 2VKDA 4HNUA 4BE0A 3NQOA 3OS0A 4EJVA 4MEXF 2L2OA 1WRJA 2HKXA 4L0YB 1HKTA 3P9IA 4FETA 2L02A 3GTPJ 2VXDA 3HGYA 2W25A 1VQ4I 3MEXA 2MFZA 2QF7A 2AQEA 2QCOA 1NG6A 1D0YA 4HF2A 1TTYA 3S3OA 1YO5C 1AU7A 1IUFA 1ODDA 2X6XA 5CYVA 1Y56A 2HU9A 3U9GA 3I4PA 3G6EI 1I39A 1AOYA 2BY1A 1BR4A 3CZ6A 1XSVA 1U5TA 2WC2A 4NQWA 4CDGA 5D8LB 2UWMA 2RC4A 1SD6A 1ZG5A 1TQIA 2HNHA 3A1YA 1KYZA 2E34A 3W2VA 4N9HA 4UHTA 1G3SA 3PUFA 1T6SA 1JUPA 1B1BA 4KT5C 1W1WE 5E8GA 2E60A 4RGRA 4ASNA 1FNNA 1P9QC 4LLNA 4CCMA 3S1RJ 1FOKA 2FNAA 2X0LA 1OCTC 1T39A 3CLQA 4MTDA 1BC8C 1IN7A 1OYIA 1QZZA 2ZXHA 3KP6A 2JUGA 3Q5FA 1UCRA 5H2FC 2Z2SB 2ME6A 4F55A 2DK8A 3TO9A 4CZZA 1W36D 4E7KA 1A36A 2XVCA 1S6LA 4XRFA 2OV7A 4ANJA 4KICA 3GTQJ 3K70C 1X58A 5ED4A 1BI3A 1KU2A 3H35A 2WWYA 1VQOI 2OTLI 3IV5A 2PG4A 3RPUA 4EMSA 5EEHA 1YJWI 3H1CA 3QPTA 1H9TA 2FMYA 1MH4A 2UXNA 3FBNB 1R1VA 2HOAA 3MVPA 3A01B 5HDKA 1AKHA 2VOOA 2L4MA 4Q5SF 1VQKI 3KEYA 2IPQX 2O0YA 4EGYA 4U0WA 3OYLA 1T2KA 1YW7A 2F2EA 2D5VA 3HTUA 3JTHA 5FLVA 2DQRA 2IGOA 3LSIA 4RAZA 1E3PA 3MN2A 5E17F 2KJCA 1WJAA 1X3ZB 3ONQA 3WTZA 1K79A 3C1DA 2M87A 3Q9SA 1K78B 3OIQA 1O3QA 2CUJA 2X4HA 1S29A 3IKVA 1Z77A 2H8WA 4M71A 2BW3A 2V7FA 1VQNI 1VFCA 3LSHA 4B3XA 2RVCA 3N4MA 2Z33A 2ELJA 2VQLA 1UG0A 2RAEA 4V2FA 2ZJQF 3WG9A 3IC7A 2IXSA 1O7FA 3SDGA 5IYDJ 3HPGA 3RDIA 3N97A 3S2HJ 5CVJA 2HQAA 2XAHA 3LQRA 4BQQA 2FMLA 1QO0D 2HI3A 3BCBA 1L3LA 3CD6I 3WTUC 1IV8A 2JT1A 3S93A 1DUXC 3M3YJ 1WZ2A 5KAIC 5TRDA 1MBFA 1BL0A 4OIPF 1JGSA 2ZC2A 4Q4ZF 2VASA 3HEFA 1ETVA 1GHCA 2AXLA 3K69A 4OIRF 1MNMC 3VYSB 1WJDA 2HXOA 3F9KA 1TC3C 4UUSA 5IT9Z 1RKTA 2COMA 2VQHA 2VL8A 1VQ9I 5ICCA 3BP8A 2KRHA 4ZTFA 3GTGJ 3VSLA 3CCVI 2OBPA 3DP7A 2R5ZA 3VYUB 3EPZA 2Z16A 1S5LC 2LR8A 1WGXA 4ZTJA 5D5VB 3F8BA 4HAMA 2NVYJ 3KE2A 1FMWA 1LE8A 1U5TC 3PO3J 2M1BA 2K4BA 2ID3A 3LWFA 1TW2A 3A03A 5CVVA 3FF5A 2M0CA 2LSOA 4P5OA 1D5YA 2L9SA 5TGTA 2ADUA 5LHHA 3FX3A 4WX9A 4V2GA 1GUUA 2RDPA 4C3IJ 4CCNA 2R0QC 2MYSA 2H8RA 1W0UA 2RNJA 2VT2A 1B8IA 1JJ6C 3HZJA 1RIOH 1T0FC 2F5EA 1IZ1A 2Q2EB 1BW6A 4PSWA 2BXYA 1J09A 2UXXA 1SD4A 3D1NI 2DMTA 4LITA 1G3TA 2E7XA 5J3LA 1E17A 4XRSA 1XDSA 4HRIA 1W4MA 3W2WA 4HPQA 2ELHA 2IA0A 3CCQI 4L18B 2OPTA 4X0GA 3WTXC 1H89C 4IHVA 2STTA 6PAXA 2JTVA 3V8JA 1YITI 3KP2A 4A5MA 3K70D 2WY8Q 1F4KA 1F5TA 3OYNA 4KMUX 3P9KA 3VSKA 3H9JA 2IGNA 1QVUA 2A6TA 1GVDA 2XC7A 1ZR2A 1UHSA 3BQYA 5ILSA 3SFZA 4DIQA 1JKRC 2NXNB 2X48A 1MBGA 2FBHA 2F4IA 2LP0A 4XKBA 3VPRA 2NS8A 4HDUA 4XN0A 1IXCA 3OSGA 1GV5A 2EFWA 1ZRDA 4C2MJ 2YU9J 2CW8A 1A31A 2KP6A 3CDIA 1QBJA 4KUMA 2YPRA 3S3NA 3OL4A 2W85A 3SFIA 2O8XA 5B3SH 1D1BA 1J75A 1WI9A 3FXLA 4NC7A 1Q1HA 3HM5A 2MLGA 1SFOJ 1IUYA 4U7BA 3BPVA 3F8FA 2VE9A 4XORA 1LDDA 1T38A 2DMPA 2B63J 3P9CA 1ZK8A 3LSMA 4X1EA 4IJAA 1CF7A 1XB4A 3KEOA 3LA3A 4AM3A 1Y8QB 2JRMA 4BKXA 2KKOA 3M7GA 4CCJA 3AAFA 3IH3A 2Y48A 1OCRH 3BJ6A 4WXHA 1ZR4A 3DTKA 4BAYA 1R1TA 2FE3A 1XTAA 4HYEA 2MBFA 5DEQA 4Z2YA 3CC2I 2KLOA 1B4AA 1I3AA 3PIPF 5F1RA 3CMAI 2EA4A 4KFCA 2W24A 1B9NA 3O6BB 4F91B 2VN2A 3BR1A 3EYYA 3ZOBA 5EYRA 2QQ9A 1FYKA 2HWVA 4G7OF 2GXGA 3HPHA 5L3BA 3HUGB 4G7ZF 4ENMA 2CG4A 1HKSA 2ZMEA 4BXFA 2GXAA 3I3LA 4FE7A 2H09A 2VT3A 2L01A 1U78A 2MH9A 2ZJ2A 3BWGA 2R7TA 3GFJA 4CO8A 1QZYA 5BMZA 4ZDPA 3PUBA 3K4NA 4B1RA 5DCFA 3SZTA 2M8GX 4MEYF 5M3MJ 3T1BA 4I02A 1LNWA 1QHGA 5D5XB 3E5UA 2JUCA 5LBQA 3HOYJ 4YEJA 3HRSA 3U1KA 5IT9K 1FYMA 3OYFA 3ZMVA 3CCJI 2KZGA 2EFQA 3RSNA 4X6AJ 4XLEA 2AHQA 2YR2A 3VWBA 2ZCWA 4Y52J 1VQ7I 2E1MB 5DUIA 4G6DA 2KIUA 3O3KA 5IOZA 1KGSA 2JA7J 1WI3A 3RYPA 3R6SA 4M6XA 4CXFA 1FZPB 3AG4H 1OKRA 2DA6A 4AD9A 1I3QJ 2BVLA 3OL3A 5FFZA 2IS6A 3QPLA 1OCOH 5DV5A 3BG9A 1VF9A 4IOAF 3QPSA 1JT0A 3RPUD 5IT3A 2JSPA 5LHGA 2V1UA 4F93B 3H5AA 1JE8A 4XSZF 4RDUA 1Z0XA 5M3FJ 4CSWA 4KYWA 1VQ5I 4L9VA 4IVNA 3PQKA 4U87A 4NBQA 4C3HJ 2MW8A 3BR3A 2X1EA 3W2AA 1FSEA 3OR2C 4JX4A 2DPDA 2F5DA 4U0YA 1WPKA 2VPLA 1OR7A 4HNVA 5K7HA 2IS4A 3BZCA 3OYAA 4YIRX 3EDPA 4DBQA 3I59A 3GMEA 5ERIA 4BYYA 5F04A 4PUSA 2W7NA 2NYXA 2YUSA 2QGUA 3DLAA 3G1MA 1RR7A 3JRIA 3H3VK 4DNCA 1IG7A 1BA5A 1TW3A 1O57A 1HSJA 4L5EA 2LD5A 1GXQA 1R58A 1Z21A 5JHUA 4HF0A 2A5YB 3C2HA 3GEZA 1YS7A 1IXRC 1ERDA 2E5ZA 5DS9A 2P5LC 3KIOA 1E0EA 1S9HA 5JR3A 1M1EB 1GT0C 4W1UA 4H0EA 3FXQA 5IOYA 1ZHFA 5IYBJ 5DM6F 1E3OC 4HX4A 2H1KA 3K4BA 1E3HA 5EGOA 4A3LJ 3B6AA 4XOPA 2X85A 5FKOA 4K2EA 3UR3C 1LKXA 4HZFA 3ELKA 4EQQA 5HNHA 4E7IA 1U8RA 3CUQC 5M5XJ 2ICWG 3HSEA 1P2FA 4WXDA 2LDUA 3ZMTA 1HC8A 2M7BA 3CC7I 3PIOF 5CQEA 2Y9YA 5FFXA 5F27A 1ZARA 5GTIC 3F6OA 1U5TB 5EG0A 2HVRA 3COAC 3HG9A 2ZMEC 1OCZH 5E8IA 2VJJA 2NVUB 2CV1A 2VJ4A 2W00A 2OQGA 4AUXA 2VQGA 3CMYA 3T5XA 5F0FA 5HOOA 3ERED 1A04A 3GWZA 3AG3H 2KL4A 3J7ZI 4DJAA 1JTYA 3FHZA 2QKMB 1YE9A 3NWSA 4RGSA 1USTA 3GLLA 3ROUA 3QAHA 1UAAA 3G73A 1ZG1A 2HPIA 1G6NA 2R7DA 4YIIA 5A2QZ 3J81Z 2BEOA 4ZDOA 5DD8A 4LGWA 3LSKA 2LMDA 3E5QA 2DYRH 2K27A 3K4CA 3K0LA 3GTJJ 4LLLA 5E20A 2HQNA 3R4KA 1Y1WJ 3KYDB 2JA6J 4BBRJ 1ZRFA 2QQAA 3GXOA 4XM3A 2FJ1A 2C6YA 1BI1A 1A6QA 2XAFA 2LKXA 2P5KA 3HYIA 3LA2A 2EK5A 5HLTA 3DPTA 2MH2A 4U0VA 2CU7A 5BPIA 1D3YA 3C7JA 4F7ZA 3F6VA 4QLCU 1AKHB 1K61A 1WHUA
chains in the Genus database with same CATH topology
5BQTA 1XMKA 5LEKA 1MDMA 2FNPA 3M8EA 2F5FA 4AIHA 3I5UA 2YX4A 1J9IA 3ZQ7A 3TO7A 3IWZA 2J5OA 2HR3A 3MAJA 4OMZA 3ECHA 1PUEE 1LEAA 2NAZA 1H9GA 4N0BA 4G6QA 1XCVA 3ABTA 1HQCA 4FX0A 4O6JA 2IRFG 3R0JA 2DPUA 1BBYA 4RAYA 4IHSA 2FEZA 2D45A 2PEXA 3FMSA 2BV6A 1J2XA 4GGGA 3WE3A 4HV5A 3SXYA 1KU9A 1MD0A 1BOAA 3V8LA 3FWEA 1D5VA 1O7LA 1IXSB 4IPAA 1Z7UA 4KNYA 4Q48A 3LAJA 2NRAC 5DCMA 2EFPA 4G8XA 3RKXA 1FWZA 3ZMSA 5DD4A 1XGMA 1IW7F 1LJ9A 4ZYEA 1SFEA 5D5UB 2QBYA 1FP2A 3WGHA 2UZKA 4YFKF 3DQVC 3LQQA 4G9YA 3QU3A 5AIQA 4A0ZA 4EVIA 2FBIA 2R3SA 2H6CA 2WTEA 4YFNF 2XAGA 4IRHA 3PFIA 2G9WA 2PFBA 4WXCA 2JSCA 2VE8A 4FHTA 3KCCA 1ZLKA 2HTJA 2VBYA 1FP1D 2GZWA 5K5RA 3HSFA 2V6CA 4OOIA 3WTYC 4UNOA 5D6EA 3J81K 2LF8A 2XRNA 1R23A 2IVMA 3K2ZA 1LQ1A 1UHMA 1ON2A 3JSPA 3DV8A 5HS8A 1T0FA 3L9FA 5CLSA 1I1GA 4DQ2A 1Z6TA 2PN6A 3TOAA 4Y15A 2D2WA 2PQ8A 1CF7B 3W6KB 1J59A 3IL2A 5E18F 3GUDA 5KK1A 1FBSA 1U3EM 3I64A 3KZYA 1D8KA 5HLIA 2M45A 3GLXA 2VBWA 5L3DA 1SD7A 4PZJA 2HZTA 3BZ6A 3I53A 5FLXZ 2F5CA 5ICGA 1XGOA 3CUQB 3MFKA 1EH7A 2IA1A 3FM3A 2IP2A 2ZO4A 3L7WA 5CVUA 5FO5A 1REPC 1R1UA 1K7AA 2ZMEB 4HBLA 1FSHA 2L4AA 1IN4A 2A61A 4HLXA 2XROA 2LNBA 1L0OC 3LSTA 5DDGA 3S2WA 3F8CA 1RI7A 2FSWA 3VOEA 5H20A 2Z99A 2EB7A 2VC1A 4M73A 5HDGA 1GVJA 3E3VA 1ON1A 2G7HA 1PP8F 3U1DA 3G3ZA 5AIPA 5FD5A 1EH6A 1Z9CA 3K9TA 2DW4A 4HOBA 3J7AO 3R0AA 3HTSB 1WWXA 1ZG3A 3QOPA 3K1PA 4GXOA 4HX7A 2HOEA 4WWCA 2YU3A 3ECOA 2E1NA 3BJAA 4HV6A 3KP5A 3BJOA 4RGUA 1SAXA 1XGNA 3TO6A 5AONA 2FA5A 3E6MA 2ACJA 4AIKA 1MJ9A 4A0XA 4ETSA 4CYDA 5CVRA 2ESHA 3SHFA 2LF7A 4YG2F 4RB2C 1XSDA 5LRRA 2NNYA 3I59B 3F21A 1EH8A 2E1CA 1D8JA 3LAPA 1R36A 3PQJA 1ZREA 4MQ9F 1T98A 4FX4A 4MHGA 2VC0A 5L3FA 4IRIA 1WKMA 3GZ5A 2HKOA 3T8TA 3VODA 3L2CA 4ZYHA 1CGPA 3D0SA 2OD5A 4KA4A 1QGPA 1DPUA 4U88A 1LDJA 3WTVC 4RGXA 4GYIA 3IKTA 4LG0A 4A0YA 4P55A 1FBQA 4ESJA 1IRFA 4ON0A 1HW2A 3RYRA 4ZZDA 1S7AA 1YW8A 4YFXF 3V7RA 2FXAA 3E6CC 1Z05A 5K5QA 2L54A 2Q8KA 5LRSA 3LA7A 2KRFA 4BHPA 4I09A 2EFOA 1BI2A 3WGIA 1BN5A 2DU9A 2XKPA 1RUNA 1XMAA 2DO7A 3V7SA 3VB2A 2K86A 4B09A 4BH9A 5ICEA 2EA2A 2QVOA 3CUQA 2GA1A 4IXAA 1B59A 3EETA 3P7NA 2Z5UA 3MQ0A 1MDMB 4IF4A 5BS6A 2CFXA 3ZMDA 4XBFA 2QZ8A 4JQFA 5DUKA 5E1WA 2RQPA 3GZ6A 1VTNC 3KETA 2HGCA 4OIQF 3T0YA 4UVCA 1I1SA 1HW1A 5HS9A 3BPXA 3K1MA 4I01A 2HDCA 2DK5A 3CTAA 2JRTA 1TQPA 3C18A 3FMQA 3OV8A 2WV0A 1J7KA 3CDHA 1ULYA 5H6RA 4KN7X 2ESNA 2DLLA 3TQNA 2XGXA 3KP4A 3GFLA 1SMYF 2V9VA 3TDZC 3IHUA 2XKOA 2ISZA 2QQBA 4XLNF 2HEOA 4CICA 5J8CA 5DCMB 5D5WB 2P8TA 1FX7A 3B02A 1ZH5A 4KDPA 1FBUA 1BIAA 4A6DA 3E97A 2CYYA 4A6EA 3GVAA 1RUOA 4EJWA 2QBYB 3RJPA 4L9JA 2M30A 4M6YA 3BOQA 4M74A 3JAMZ 5L3GA 3U2RA 4PCQA 3E5XA 2V1XA 2H94A 3WTWC 5D4SA 1X3UA 4EM0B 1MJAA 2PMUA 1MGTA 4KIBA 1XN7A 1TNSA 3TOBA 2P4WA 3T8RA 1GXPA 2Z9OA 3L09A 1K6OA 1HSTA 5JI6A 1G3YA 3LFKA 4KIGA 2A69F 3HOTA 3GFMA 2J5PA 4LB6B 4RB1A 3WODF 1UHWA 1PDNC 1YTYA 2OZUA 2FU4A 4BHBA 2TDXA 4EM2A 1IRGA 5L3EA 2IJLA 4HF1A 2RKHA 3FXUA 1F9NA 4IHTA 2XASA 2YX7A 4I98B 2R7FA 3RKWA 1LB2A 1Z6RA 4OU0A 3ZP5A 3ZPLA 1W5TA 2AS5F 2EV5A 2QLZA 4EM1A 5LGTA 3FMRA 4KN4X 2BBYA 4HW0A 1BI0A 1KQ9A 2MA3A 3NRVA 1SFXA 2GA2A 4FT8A 4P9FA 1I6XA 2K02A 2NS0A 3F3XA 5D6FA 1IF1A 1V4RA 3QP5A 3EYIA 1Z91A 1UB9A 2A3SA 2V1DA 2XAJA 1STZA 4I7HA 3QPHA 5E1XA 5D4RA 3J80Z 4A12A 3V8KA 1FLIA 2QUFA 3FXRA 1I27A 2P7CB 2OA4A 3JAMK 2EV0A 2XHKA 1LVAA 4RB0A 2RN7A 3IWFA 4LFUA 1TLHB 4I2OA 4B8XA 2KIMA 1G3WA 1JHHA 2JZYA 1BM9A 2GWRA 4MQVA 5ICFA 2Q0OA 2EWNA 4AVPA 4ZYDA 1C0WA 3NEUA 4ZYGA 4NB5A 4MGRA 3KFWX 1S3JA 1U2WA 2CQKA 3H3UA 4HLYA 1Z1DA 1FC3A 2ZNYA 4EJUA 2CGPA 1WSUA 4RS8A 1XD7A 2FBKA 4LG0B 5A2QK 4CGZA 3ULQB 2D1VA 1EV7A 1S7OA 1P4AA 3IRQA 2E7WA 1ZLJA 1YFHA 5HDNA 2CW0F 2QM3A 1S8NA 4RB3C 3SZPA 3F8NA 2W84A 5HLHA 4LD5A 2FF4A 3WTSC 4O3MA 3FZVA 3JTGA 4EJTA 4P96A 3E6DA 3Q9VA 4UV9A 3MWMA 2FOKA 1KQ8A 3CO6C 3ZN0A 2FRHA 3ZMUA 3JSOA 4MNUA 3KP3A 1IN5A 4LJZF 3E6BA 4HQMA 2DBBA 2PLYA 4YIFA 4LMYA 2QWWA 1TQMA 1IN6A 2MLKA 3O2PE 5L3CA 3CJNA 3KLOA 5FGMA 2OAZA 1SMTA 3ML6A 4O5VA 1YW9A 3F72A 3ISPA 2XAQA 2EJRA 2MD5A 2HFHA 1W7PA 5LLQA 1QQIA 1ZGJA 2D1HA 1U6GA 3J80K 5K5OA 4UUVA 3I0TA 4PGHA 5H6QA 1G4DA 2STWA 2GAUA 4HX8A 2A68F 2PJPA 1KU3A 1R22A 5J6XA 3QRFF 3M8FA 3KEQA 5LEJA 1TBXA 3I58A 1P4WA 4G94A 1OYYA 4LB5A 2KIFA 3WE2A 1IAWA 4Y17A 2O6GE 1XDUA 4AWXB 2JPCA 2XUBA 1YG2A 2VBXA 1JHFA 4M9XA 2B0LA 2CSOA 3HRMA 1V3FA 1I5ZA 4G7HF 1BC7C 2CWEA 2HYFA 3GF2A 3OOPA 4M9ZA 2GXBA 1WQ2A 1B6AA 4LK0F 2RGVA 4LK1F 4XSXF 2IT0A 3JW4A 3F23A 3BDDA 1R5GA 2MC3A 2W57A 3VEPA 3R60A 4IRGA 4BNCA 3CUOA 2L3DA 2NNNA 5LGNA 1IN8A 1DDNA 3WU0A 2JPBA 1RNLA 2VONA 1QPMA 2OU2A 2Y75A 3RTRA 3ZN1A 3F22A 4CHUA 4ENKA 3ABUA 2BGCA 2HQRA 2DFIA 2Z3YA 2BYVE 3D5LA 3DEUA 3HHHA 3R61A 3GO5A 4EGZA 1LDKB 1YS6A 2RV8A 3EQLF 1R7JA 5FLXK 2HS5A 2VODA 2OZ6A 1E2XA 3EUHA 4A2UA 4WCGA 3C3WA 3CO7C 4P9UA 3W6JB 5JFRA 4BXUA 2DAOA 2DT5A 1BIBA 4L0ZB 4GCVA 4HA8A 2EFNA 2ZNZA 2ZXJA 2Y0MA 3H3ZA 4ESBA 3REOA 3DFGA 2XIGA 3RI4A 1HKQA 2BE5F 2XV4S 5CVIA 1FY7A 2P5VA 4Y13A 1PP7U 1YYVA 1ZGAA 5E1ZB 1H0MA 1HW5A 5LHIA 1NHAA 1KYWA 4ENNA 1YLFA 4PGGA 3FM5A 1K78A 2EV6A 2GQQA 2HYGD 4R8HA 1MZBA 4UV8A 3VFZA 4L5JA 1USSA 1FPQA 1O3TA 2GIVA 2O3FA 5BPDA 3TKYA 4M72A 3HSRA 4L9NA 1HBXG 1ZN2A 4JBAA 1JXSA 2IA2A 3WGGA 5FD6A 1J0RA 5KVRA 2CO5A 3DPLC 5BOXA 1YIOA 2K7LA 3V4GA 1TNTA 2LKPA 1SD5A 1P6RA 4EV0A 1OPCA 1F1ZA 4AIJA 5ILUA 4S05A 3MCZA 2H27A 4S04A 4R79A 5K1YA 2P7VB 5F6FA 4Q47A 3HHGA 1R5HA 4KMFA 2M8EA 5HLGA 2PI0A 5LGUA 4U7DA 2M5WA 5HS7A 4ZZLA 3K1NA 3V7CA 2KJBA 1R00A 1XCBA 1HXDA 1LEBA 2VBZA 3HIFA 1AWCA 1J5YA 4A5NA 2Q2EA 1W7PD 1MKMA 3GFIA 1O3SA 1W5SA 2P6TA 1YQAA 4I0BA 4R1HA 4GO1A 1ONVA 4N9IA 4WF2A 3WTTC 2QENA 3I71A 3HRTA 2VXZA 1KA8A 2A07F 2O03A 4BHCA 4GYGA 4M9SA 3HRUA 4E70A 3WU1B 3IRRA 2YSRA 4UVBA 5FB2A 4TV7A 2H6BA 3MZYA 2PBIA 2ETHA 1ZAOA 2ZKZA 4OINF 1SFUA 3SQNA 3GYHX 5ILVA 2FQ3A 3HOSA 4WK8F 4EJOA 2K4JA 4XLPF 4OMYA 2ZFWA 3KP7A 1MJBA 4D0PA 4JK1X 4I0AA 1FT9A 3B73A 3I54A 3DKWA 5HVQC 1DP7P 4MTEA 5DYMA 2PMHA 5JVTA 3DXJF 4LLGF 1KQ0A 1XGSA 2V79A 3GX4X 3RIRA 5D8KB 2QYOA 2ISYA 3RKYA 1BJAA 4OIOF 3GW2A 1P4XA 3HUGA 3QP6A 1UFMA 2HTSA 2DQLA 2P6SA 2ZBKA 1W7PB 1FYLA 4HQEA 2DI3A 2DTRA 1B9MA 1XSXA 2VOPA 1Y0UA 5J8FA 4ESFA 5EEGA 1OYWA 1KU7A 1OMIA 2IW5A 3RPQA 2A6EF 3CLOA 3L00A 3KZZA 3M1EA 3TGNA 2A6HF 4BQAA 3QU6A 2G7UA 1RZ4A 4QWQA 4HDVA 3BROA 3H92A 4L9TA 1QNTA 1P92A 3BY6A 3M9AA 1DPRA 3MZHA 4UVAA 2OQRA 4PDKA 3TDUC 3DF8A 5TJJA 4ENJA 1O3RA 4KIFA 4NHJA 4ZH4F 3KLNA 2O61A 1ZRCA 5CJ9A 1ZYRF 5F64A 4UXNA 3ZMZA 3F8MA 4L5IA 3NQOA 4EJVA 4MEXF 1HKTA 1WRJA 2HKXA 4L0YB 3P9IA 2L02A 2W25A 3MEXA 4HF2A 1TTYA 1YO5C 1ODDA 5CYVA 3U9GA 3I4PA 1AOYA 1XSVA 1U5TA 2WC2A 4NQWA 4CDGA 5D8LB 2UWMA 2RC4A 1SD6A 1ZG5A 1TQIA 1KYZA 4N9HA 4UHTA 1G3SA 1T6SA 1B1BA 4KT5C 5E8GA 4RGRA 4ASNA 1FNNA 4LLNA 1FOKA 2FNAA 2X0LA 1T39A 4MTDA 1BC8C 1IN7A 1OYIA 1QZZA 3KP6A 3Q5FA 1UCRA 2DK8A 3TO9A 4CZZA 2XVCA 1S6LA 4XRFA 4KICA 5ED4A 1BI3A 1KU2A 2WWYA 2PG4A 3RPUA 4EMSA 5EEHA 3QPTA 1H9TA 2FMYA 2UXNA 1R1VA 5HDKA 2VOOA 2L4MA 4Q5SF 2IPQX 2O0YA 4EGYA 4U0WA 1T2KA 1YW7A 2F2EA 3HTUA 3JTHA 2DQRA 4RAZA 5E17F 2KJCA 3WTZA 1K79A 3C1DA 2M87A 3Q9SA 1K78B 1O3QA 2X4HA 1S29A 3IKVA 4M71A 2RVCA 3N4MA 2Z33A 3WG9A 3IC7A 1O7FA 3RDIA 3N97A 5CVJA 2XAHA 3LQRA 2FMLA 1QO0D 1L3LA 3WTUC 2JT1A 1DUXC 5TRDA 4OIPF 1JGSA 4Q4ZF 1GHCA 2AXLA 3K69A 4OIRF 5IT9Z 2COMA 5ICCA 3BP8A 2OBPA 3DP7A 5D5VB 3F8BA 4HAMA 3KE2A 1U5TC 2M1BA 2K4BA 3LWFA 1TW2A 5CVVA 3FF5A 2LSOA 4P5OA 2ADUA 5LHHA 3FX3A 4WX9A 2RDPA 2RNJA 2VT2A 1RIOH 2F5EA 1IZ1A 2UXXA 1SD4A 1G3TA 2E7XA 1E17A 1XDSA 1W4MA 4L18B 2ELHA 2IA0A 3WTXC 2STTA 6PAXA 2JTVA 3V8JA 3KP2A 4A5MA 1F4KA 1F5TA 4KMUX 3P9KA 5ILSA 3SFZA 2FBHA 4HDUA 1IXCA 2EFWA 1ZRDA 1QBJA 4KUMA 2YPRA 2W85A 2O8XA 1J75A 1WI9A 1Q1HA 2MLGA 1IUYA 4U7BA 3BPVA 3F8FA 2VE9A 1LDDA 1T38A 3P9CA 4IJAA 1CF7A 1XB4A 3KEOA 3LA3A 2KKOA 3M7GA 3AAFA 2Y48A 3BJ6A 4WXHA 4BAYA 1R1TA 2FE3A 4HYEA 2MBFA 5DEQA 4Z2YA 1B4AA 5F1RA 2EA4A 4KFCA 2W24A 1B9NA 3O6BB 2VN2A 3EYYA 2QQ9A 1FYKA 2HWVA 4G7OF 2GXGA 5L3BA 4ENMA 4G7ZF 2CG4A 1HKSA 2ZMEA 2H09A 2VT3A 2L01A 1U78A 2MH9A 2ZJ2A 3BWGA 3GFJA 4CO8A 1QZYA 5BMZA 5DCFA 3SZTA 4MEYF 3T1BA 4I02A 1LNWA 5D5XB 5LBQA 3E5UA 3HRSA 5IT9K 1FYMA 3ZMVA 2EFQA 2YR2A 2ZCWA 5DUIA 4G6DA 2KIUA 3O3KA 1KGSA 3RYPA 3R6SA 4CXFA 4M6XA 1FZPB 1OKRA 4AD9A 5FFZA 5DV5A 5IT3A 5LHGA 2V1UA 1JE8A 4XSZF 4KYWA 4L9VA 4IVNA 3PQKA 1FSEA 2DPDA 2F5DA 4U0YA 1OR7A 3EDPA 3I59A 5ERIA 4BYYA 2NYXA 4DNCA 1TW3A 1O57A 1HSJA 1GXQA 1R58A 5JHUA 4HF0A 2A5YB 3GEZA 1YS7A 1IXRC 2P5LC 5JR3A 4H0EA 3FXQA 1ZHFA 4HX4A 4K2EA 4HZFA 3ELKA 4EQQA 1U8RA 3CUQC 3HSEA 1P2FA 4WXDA 2LDUA 3ZMTA 5FFXA 1ZARA 3F6OA 1U5TB 3COAC 5E8IA 2OQGA 3T5XA 5HOOA 3ERED 1A04A 3GWZA 3FHZA 4RGSA 1USTA 3ROUA 3QAHA 3G73A 1ZG1A 4YIIA 1G6NA 2R7DA 5A2QZ 3J81Z 2BEOA 5DD8A 4LGWA 3E5QA 2K27A 3K0LA 4LLLA 5E20A 2HQNA 3R4KA 1ZRFA 2QQAA 3GXOA 2C6YA 1BI1A 2XAFA 2P5KA 3HYIA 3LA2A 2EK5A 3DPTA 2MH2A 4U0VA 5BPIA 1D3YA 3C7JA 4F7ZA 3F6VA 4QLCU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQT A;  1XMK A;  5LEK A;  1MDM A;  2FNP A;  3M8E A;  2F5F A;  4AIH A;  3I5U A;  2YX4 A;  1J9I A;  3ZQ7 A;  3TO7 A;  3IWZ A;  2J5O A;  2HR3 A;  3MAJ A;  4OMZ A;  3ECH A;  1PUE E;  1LEA A;  2NAZ A;  1H9G A;  4N0B A;  4G6Q A;  1XCV A;  3ABT A;  1HQC A;  4FX0 A;  4O6J A;  2IRF G;  3R0J A;  2DPU A;  1BBY A;  4RAY A;  4IHS A;  2FEZ A;  2D45 A;  2PEX A;  3FMS A;  2BV6 A;  1J2X A;  4GGG A;  3WE3 A;  4HV5 A;  3SXY A;  1KU9 A;  1MD0 A;  1BOA A;  3V8L A;  3FWE A;  1D5V A;  1O7L A;  1IXS B;  4IPA A;  1Z7U A;  4KNY A;  4Q48 A;  3LAJ A;  2NRA C;  5DCM A;  2EFP A;  4G8X A;  3RKX A;  1FWZ A;  3ZMS A;  5DD4 A;  1XGM A;  1IW7 F;  1LJ9 A;  4ZYE A;  1SFE A;  5D5U B;  2QBY A;  1FP2 A;  3WGH A;  2UZK A;  4YFK F;  3DQV C;  3LQQ A;  4G9Y A;  3QU3 A;  5AIQ A;  4A0Z A;  4EVI A;  2FBI A;  2R3S A;  2H6C A;  2WTE A;  4YFN F;  2XAG A;  4IRH A;  3PFI A;  2G9W A;  2PFB A;  4WXC A;  2JSC A;  2VE8 A;  4FHT A;  3KCC A;  1ZLK A;  2HTJ A;  2VBY A;  1FP1 D;  2GZW A;  5K5R A;  3HSF A;  2V6C A;  4OOI A;  3WTY C;  4UNO A;  5D6E A;  3J81 K;  2LF8 A;  2XRN A;  1R23 A;  2IVM A;  3K2Z A;  1LQ1 A;  1UHM A;  1ON2 A;  3JSP A;  3DV8 A;  5HS8 A;  1T0F A;  3L9F A;  5CLS A;  1I1G A;  4DQ2 A;  1Z6T A;  2PN6 A;  3TOA A;  4Y15 A;  2D2W A;  2PQ8 A;  1CF7 B;  3W6K B;  1J59 A;  3IL2 A;  5E18 F;  3GUD A;  5KK1 A;  1FBS A;  1U3E M;  3I64 A;  3KZY A;  1D8K A;  5HLI A;  2M45 A;  3GLX A;  2VBW A;  5L3D A;  1SD7 A;  4PZJ A;  2HZT A;  3BZ6 A;  3I53 A;  5FLX Z;  2F5C A;  5ICG A;  1XGO A;  3CUQ B;  3MFK A;  1EH7 A;  2IA1 A;  3FM3 A;  2IP2 A;  2ZO4 A;  3L7W A;  5CVU A;  5FO5 A;  1REP C;  1R1U A;  1K7A A;  2ZME B;  4HBL A;  1FSH A;  2L4A A;  1IN4 A;  2A61 A;  4HLX A;  2XRO A;  2LNB A;  1L0O C;  3LST A;  5DDG A;  3S2W A;  3F8C A;  1RI7 A;  2FSW A;  3VOE A;  5H20 A;  2Z99 A;  2EB7 A;  2VC1 A;  4M73 A;  5HDG A;  1GVJ A;  3E3V A;  1ON1 A;  2G7H A;  1PP8 F;  3U1D A;  3G3Z A;  5AIP A;  5FD5 A;  1EH6 A;  1Z9C A;  3K9T A;  2DW4 A;  4HOB A;  3J7A O;  3R0A A;  3HTS B;  1WWX A;  1ZG3 A;  3QOP A;  3K1P A;  4GXO A;  4HX7 A;  2HOE A;  4WWC A;  2YU3 A;  3ECO A;  2E1N A;  3BJA A;  4HV6 A;  3KP5 A;  3BJO A;  4RGU A;  1SAX A;  1XGN A;  3TO6 A;  5AON A;  2FA5 A;  3E6M A;  2ACJ A;  4AIK A;  1MJ9 A;  4A0X A;  4ETS A;  4CYD A;  5CVR A;  2ESH A;  3SHF A;  2LF7 A;  4YG2 F;  4RB2 C;  1XSD A;  5LRR A;  2NNY A;  3I59 B;  3F21 A;  1EH8 A;  2E1C A;  1D8J A;  3LAP A;  1R36 A;  3PQJ A;  1ZRE A;  4MQ9 F;  1T98 A;  4FX4 A;  4MHG A;  2VC0 A;  5L3F A;  4IRI A;  1WKM A;  3GZ5 A;  2HKO A;  3T8T A;  3VOD A;  3L2C A;  4ZYH A;  1CGP A;  3D0S A;  2OD5 A;  4KA4 A;  1QGP A;  1DPU A;  4U88 A;  1LDJ A;  3WTV C;  4RGX A;  4GYI A;  3IKT A;  4LG0 A;  4A0Y A;  4P55 A;  1FBQ A;  4ESJ A;  1IRF A;  4ON0 A;  1HW2 A;  3RYR A;  4ZZD A;  1S7A A;  1YW8 A;  4YFX F;  3V7R A;  2FXA A;  3E6C C;  1Z05 A;  5K5Q A;  2L54 A;  2Q8K A;  5LRS A;  3LA7 A;  2KRF A;  4BHP A;  4I09 A;  2EFO A;  1BI2 A;  3WGI A;  1BN5 A;  2DU9 A;  2XKP A;  1RUN A;  1XMA A;  2DO7 A;  3V7S A;  3VB2 A;  2K86 A;  4B09 A;  4BH9 A;  5ICE A;  2EA2 A;  2QVO A;  3CUQ A;  2GA1 A;  4IXA A;  1B59 A;  3EET A;  3P7N A;  2Z5U A;  3MQ0 A;  1MDM B;  4IF4 A;  5BS6 A;  2CFX A;  3ZMD A;  4XBF A;  2QZ8 A;  4JQF A;  5DUK A;  5E1W A;  2RQP A;  3GZ6 A;  1VTN C;  3KET A;  2HGC A;  4OIQ F;  3T0Y A;  4UVC A;  1I1S A;  1HW1 A;  5HS9 A;  3BPX A;  3K1M A;  4I01 A;  2HDC A;  2DK5 A;  3CTA A;  2JRT A;  1TQP A;  3C18 A;  3FMQ A;  3OV8 A;  2WV0 A;  1J7K A;  3CDH A;  1ULY A;  5H6R A;  4KN7 X;  2ESN A;  2DLL A;  3TQN A;  2XGX A;  3KP4 A;  3GFL A;  1SMY F;  2V9V A;  3TDZ C;  3IHU A;  2XKO A;  2ISZ A;  2QQB A;  4XLN F;  2HEO A;  4CIC A;  5J8C A;  5DCM B;  5D5W B;  2P8T A;  1FX7 A;  3B02 A;  1ZH5 A;  4KDP A;  1FBU A;  1BIA A;  4A6D A;  3E97 A;  2CYY A;  4A6E A;  3GVA A;  1RUO A;  4EJW A;  2QBY B;  3RJP A;  4L9J A;  2M30 A;  4M6Y A;  3BOQ A;  4M74 A;  3JAM Z;  5L3G A;  3U2R A;  4PCQ A;  3E5X A;  2V1X A;  2H94 A;  3WTW C;  5D4S A;  1X3U A;  4EM0 B;  1MJA A;  2PMU A;  1MGT A;  4KIB A;  1XN7 A;  1TNS A;  3TOB A;  2P4W A;  3T8R A;  1GXP A;  2Z9O A;  3L09 A;  1K6O A;  1HST A;  5JI6 A;  1G3Y A;  3LFK A;  4KIG A;  2A69 F;  3HOT A;  3GFM A;  2J5P A;  4LB6 B;  4RB1 A;  3WOD F;  1UHW A;  1PDN C;  1YTY A;  2OZU A;  2FU4 A;  4BHB A;  2TDX A;  4EM2 A;  1IRG A;  5L3E A;  2IJL A;  4HF1 A;  2RKH A;  3FXU A;  1F9N A;  4IHT A;  2XAS A;  2YX7 A;  4I98 B;  2R7F A;  3RKW A;  1LB2 A;  1Z6R A;  4OU0 A;  3ZP5 A;  3ZPL A;  1W5T A;  2AS5 F;  2EV5 A;  2QLZ A;  4EM1 A;  5LGT A;  3FMR A;  4KN4 X;  2BBY A;  4HW0 A;  1BI0 A;  1KQ9 A;  2MA3 A;  3NRV A;  1SFX A;  2GA2 A;  4FT8 A;  4P9F A;  1I6X A;  2K02 A;  2NS0 A;  3F3X A;  5D6F A;  1IF1 A;  1V4R A;  3QP5 A;  3EYI A;  1Z91 A;  1UB9 A;  2A3S A;  2V1D A;  2XAJ A;  1STZ A;  4I7H A;  3QPH A;  5E1X A;  5D4R A;  3J80 Z;  4A12 A;  3V8K A;  1FLI A;  2QUF A;  3FXR A;  1I27 A;  2P7C B;  2OA4 A;  3JAM K;  2EV0 A;  2XHK A;  1LVA A;  4RB0 A;  2RN7 A;  3IWF A;  4LFU A;  1TLH B;  4I2O A;  4B8X A;  2KIM A;  1G3W A;  1JHH A;  2JZY A;  1BM9 A;  2GWR A;  4MQV A;  5ICF A;  2Q0O A;  2EWN A;  4AVP A;  4ZYD A;  1C0W A;  3NEU A;  4ZYG A;  4NB5 A;  4MGR A;  3KFW X;  1S3J A;  1U2W A;  2CQK A;  3H3U A;  4HLY A;  1Z1D A;  1FC3 A;  2ZNY A;  4EJU A;  2CGP A;  1WSU A;  4RS8 A;  1XD7 A;  2FBK A;  4LG0 B;  5A2Q K;  4CGZ A;  3ULQ B;  2D1V A;  1EV7 A;  1S7O A;  1P4A A;  3IRQ A;  2E7W A;  1ZLJ A;  1YFH A;  5HDN A;  2CW0 F;  2QM3 A;  1S8N A;  4RB3 C;  3SZP A;  3F8N A;  2W84 A;  5HLH A;  4LD5 A;  2FF4 A;  3WTS C;  4O3M A;  3FZV A;  3JTG A;  4EJT A;  4P96 A;  3E6D A;  3Q9V A;  4UV9 A;  3MWM A;  2FOK A;  1KQ8 A;  3CO6 C;  3ZN0 A;  2FRH A;  3ZMU A;  3JSO A;  4MNU A;  3KP3 A;  1IN5 A;  4LJZ F;  3E6B A;  4HQM A;  2DBB A;  2PLY A;  4YIF A;  4LMY A;  2QWW A;  1TQM A;  1IN6 A;  2MLK A;  3O2P E;  5L3C A;  3CJN A;  3KLO A;  5FGM A;  2OAZ A;  1SMT A;  3ML6 A;  4O5V A;  1YW9 A;  3F72 A;  3ISP A;  2XAQ A;  2EJR A;  2MD5 A;  2HFH A;  1W7P A;  5LLQ A;  1QQI A;  1ZGJ A;  2D1H A;  1U6G A;  3J80 K;  5K5O A;  4UUV A;  3I0T A;  4PGH A;  5H6Q A;  1G4D A;  2STW A;  2GAU A;  4HX8 A;  2A68 F;  2PJP A;  1KU3 A;  1R22 A;  5J6X A;  3QRF F;  3M8F A;  3KEQ A;  5LEJ A;  1TBX A;  3I58 A;  1P4W A;  4G94 A;  1OYY A;  4LB5 A;  2KIF A;  3WE2 A;  1IAW A;  4Y17 A;  2O6G E;  1XDU A;  4AWX B;  2JPC A;  2XUB A;  1YG2 A;  2VBX A;  1JHF A;  4M9X A;  2B0L A;  2CSO A;  3HRM A;  1V3F A;  1I5Z A;  4G7H F;  1BC7 C;  2CWE A;  2HYF A;  3GF2 A;  3OOP A;  4M9Z A;  2GXB A;  1WQ2 A;  1B6A A;  4LK0 F;  2RGV A;  4LK1 F;  4XSX F;  2IT0 A;  3JW4 A;  3F23 A;  3BDD A;  1R5G A;  2MC3 A;  2W57 A;  3VEP A;  3R60 A;  4IRG A;  4BNC A;  3CUO A;  2L3D A;  2NNN A;  5LGN A;  1IN8 A;  1DDN A;  3WU0 A;  2JPB A;  1RNL A;  2VON A;  1QPM A;  2OU2 A;  2Y75 A;  3RTR A;  3ZN1 A;  3F22 A;  4CHU A;  4ENK A;  3ABU A;  2BGC A;  2HQR A;  2DFI A;  2Z3Y A;  2BYV E;  3D5L A;  3DEU A;  3HHH A;  3R61 A;  3GO5 A;  4EGZ A;  1LDK B;  1YS6 A;  2RV8 A;  3EQL F;  1R7J A;  5FLX K;  2HS5 A;  2VOD A;  2OZ6 A;  1E2X A;  3EUH A;  4A2U A;  4WCG A;  3C3W A;  3CO7 C;  4P9U A;  3W6J B;  5JFR A;  4BXU A;  2DAO A;  2DT5 A;  1BIB A;  4L0Z B;  4GCV A;  4HA8 A;  2EFN A;  2ZNZ A;  2ZXJ A;  2Y0M A;  3H3Z A;  4ESB A;  3REO A;  3DFG A;  2XIG A;  3RI4 A;  1HKQ A;  2BE5 F;  2XV4 S;  5CVI A;  1FY7 A;  2P5V A;  4Y13 A;  1PP7 U;  1YYV A;  1ZGA A;  5E1Z B;  1H0M A;  1HW5 A;  5LHI A;  1NHA A;  1KYW A;  4ENN A;  1YLF A;  4PGG A;  3FM5 A;  1K78 A;  2EV6 A;  2GQQ A;  2HYG D;  4R8H A;  1MZB A;  4UV8 A;  3VFZ A;  4L5J A;  1USS A;  1FPQ A;  1O3T A;  2GIV A;  2O3F A;  5BPD A;  3TKY A;  4M72 A;  3HSR A;  4L9N A;  1HBX G;  1ZN2 A;  4JBA A;  1JXS A;  2IA2 A;  3WGG A;  5FD6 A;  1J0R A;  5KVR A;  2CO5 A;  3DPL C;  5BOX A;  1YIO A;  2K7L A;  3V4G A;  1TNT A;  2LKP A;  1SD5 A;  1P6R A;  4EV0 A;  1OPC A;  1F1Z A;  4AIJ A;  5ILU A;  4S05 A;  3MCZ A;  2H27 A;  4S04 A;  4R79 A;  5K1Y A;  2P7V B;  5F6F A;  4Q47 A;  3HHG A;  1R5H A;  4KMF A;  2M8E A;  5HLG A;  2PI0 A;  5LGU A;  4U7D A;  2M5W A;  5HS7 A;  4ZZL A;  3K1N A;  3V7C A;  2KJB A;  1R00 A;  1XCB A;  1HXD A;  1LEB A;  2VBZ A;  3HIF A;  1AWC A;  1J5Y A;  4A5N A;  2Q2E A;  1W7P D;  1MKM A;  3GFI A;  1O3S A;  1W5S A;  2P6T A;  1YQA A;  4I0B A;  4R1H A;  4GO1 A;  1ONV A;  4N9I A;  4WF2 A;  3WTT C;  2QEN A;  3I71 A;  3HRT A;  2VXZ A;  1KA8 A;  2A07 F;  2O03 A;  4BHC A;  4GYG A;  4M9S A;  3HRU A;  4E70 A;  3WU1 B;  3IRR A;  2YSR A;  4UVB A;  5FB2 A;  4TV7 A;  2H6B A;  3MZY A;  2PBI A;  2ETH A;  1ZAO A;  2ZKZ A;  4OIN F;  1SFU A;  3SQN A;  3GYH X;  5ILV A;  2FQ3 A;  3HOS A;  4WK8 F;  4EJO A;  2K4J A;  4XLP F;  4OMY A;  2ZFW A;  3KP7 A;  1MJB A;  4D0P A;  4JK1 X;  4I0A A;  1FT9 A;  3B73 A;  3I54 A;  3DKW A;  5HVQ C;  1DP7 P;  4MTE A;  5DYM A;  2PMH A;  5JVT A;  3DXJ F;  4LLG F;  1KQ0 A;  1XGS A;  2V79 A;  3GX4 X;  3RIR A;  5D8K B;  2QYO A;  2ISY A;  3RKY A;  1BJA A;  4OIO F;  3GW2 A;  1P4X A;  3HUG A;  3QP6 A;  1UFM A;  2HTS A;  2DQL A;  2P6S A;  2ZBK A;  1W7P B;  1FYL A;  4HQE A;  2DI3 A;  2DTR A;  1B9M A;  1XSX A;  2VOP A;  1Y0U A;  5J8F A;  4ESF A;  5EEG A;  1OYW A;  1KU7 A;  1OMI A;  2IW5 A;  3RPQ A;  2A6E F;  3CLO A;  3L00 A;  3KZZ A;  3M1E A;  3TGN A;  2A6H F;  4BQA A;  3QU6 A;  2G7U A;  1RZ4 A;  4QWQ A;  4HDV A;  3BRO A;  3H92 A;  4L9T A;  1QNT A;  1P92 A;  3BY6 A;  3M9A A;  1DPR A;  3MZH A;  4UVA A;  2OQR A;  4PDK A;  3TDU C;  3DF8 A;  5TJJ A;  4ENJ A;  1O3R A;  4KIF A;  4NHJ A;  4ZH4 F;  3KLN A;  2O61 A;  1ZRC A;  5CJ9 A;  1ZYR F;  5F64 A;  4UXN A;  3ZMZ A;  3F8M A;  4L5I A;  3NQO A;  4EJV A;  4MEX F;  1HKT A;  1WRJ A;  2HKX A;  4L0Y B;  3P9I A;  2L02 A;  2W25 A;  3MEX A;  4HF2 A;  1TTY A;  1YO5 C;  1ODD A;  5CYV A;  3U9G A;  3I4P A;  1AOY A;  1XSV A;  1U5T A;  2WC2 A;  4NQW A;  4CDG A;  5D8L B;  2UWM A;  2RC4 A;  1SD6 A;  1ZG5 A;  1TQI A;  1KYZ A;  4N9H A;  4UHT A;  1G3S A;  1T6S A;  1B1B A;  4KT5 C;  5E8G A;  4RGR A;  4ASN A;  1FNN A;  4LLN A;  1FOK A;  2FNA A;  2X0L A;  1T39 A;  4MTD A;  1BC8 C;  1IN7 A;  1OYI A;  1QZZ A;  3KP6 A;  3Q5F A;  1UCR A;  2DK8 A;  3TO9 A;  4CZZ A;  2XVC A;  1S6L A;  4XRF A;  4KIC A;  5ED4 A;  1BI3 A;  1KU2 A;  2WWY A;  2PG4 A;  3RPU A;  4EMS A;  5EEH A;  3QPT A;  1H9T A;  2FMY A;  2UXN A;  1R1V A;  5HDK A;  2VOO A;  2L4M A;  4Q5S F;  2IPQ X;  2O0Y A;  4EGY A;  4U0W A;  1T2K A;  1YW7 A;  2F2E A;  3HTU A;  3JTH A;  2DQR A;  4RAZ A;  5E17 F;  2KJC A;  3WTZ A;  1K79 A;  3C1D A;  2M87 A;  3Q9S A;  1K78 B;  1O3Q A;  2X4H A;  1S29 A;  3IKV A;  4M71 A;  2RVC A;  3N4M A;  2Z33 A;  3WG9 A;  3IC7 A;  1O7F A;  3RDI A;  3N97 A;  5CVJ A;  2XAH A;  3LQR A;  2FML A;  1QO0 D;  1L3L A;  3WTU C;  2JT1 A;  1DUX C;  5TRD A;  4OIP F;  1JGS A;  4Q4Z F;  1GHC A;  2AXL A;  3K69 A;  4OIR F;  5IT9 Z;  2COM A;  5ICC A;  3BP8 A;  2OBP A;  3DP7 A;  5D5V B;  3F8B A;  4HAM A;  3KE2 A;  1U5T C;  2M1B A;  2K4B A;  3LWF A;  1TW2 A;  5CVV A;  3FF5 A;  2LSO A;  4P5O A;  2ADU A;  5LHH A;  3FX3 A;  4WX9 A;  2RDP A;  2RNJ A;  2VT2 A;  1RIO H;  2F5E A;  1IZ1 A;  2UXX A;  1SD4 A;  1G3T A;  2E7X A;  1E17 A;  1XDS A;  1W4M A;  4L18 B;  2ELH A;  2IA0 A;  3WTX C;  2STT A;  6PAX A;  2JTV A;  3V8J A;  3KP2 A;  4A5M A;  1F4K A;  1F5T A;  4KMU X;  3P9K A;  5ILS A;  3SFZ A;  2FBH A;  4HDU A;  1IXC A;  2EFW A;  1ZRD A;  1QBJ A;  4KUM A;  2YPR A;  2W85 A;  2O8X A;  1J75 A;  1WI9 A;  1Q1H A;  2MLG A;  1IUY A;  4U7B A;  3BPV A;  3F8F A;  2VE9 A;  1LDD A;  1T38 A;  3P9C A;  4IJA A;  1CF7 A;  1XB4 A;  3KEO A;  3LA3 A;  2KKO A;  3M7G A;  3AAF A;  2Y48 A;  3BJ6 A;  4WXH A;  4BAY A;  1R1T A;  2FE3 A;  4HYE A;  2MBF A;  5DEQ A;  4Z2Y A;  1B4A A;  5F1R A;  2EA4 A;  4KFC A;  2W24 A;  1B9N A;  3O6B B;  2VN2 A;  3EYY A;  2QQ9 A;  1FYK A;  2HWV A;  4G7O F;  2GXG A;  5L3B A;  4ENM A;  4G7Z F;  2CG4 A;  1HKS A;  2ZME A;  2H09 A;  2VT3 A;  2L01 A;  1U78 A;  2MH9 A;  2ZJ2 A;  3BWG A;  3GFJ A;  4CO8 A;  1QZY A;  5BMZ A;  5DCF A;  3SZT A;  4MEY F;  3T1B A;  4I02 A;  1LNW A;  5D5X B;  5LBQ A;  3E5U A;  3HRS A;  5IT9 K;  1FYM A;  3ZMV A;  2EFQ A;  2YR2 A;  2ZCW A;  5DUI A;  4G6D A;  2KIU A;  3O3K A;  1KGS A;  3RYP A;  3R6S A;  4CXF A;  4M6X A;  1FZP B;  1OKR A;  4AD9 A;  5FFZ A;  5DV5 A;  5IT3 A;  5LHG A;  2V1U A;  1JE8 A;  4XSZ F;  4KYW A;  4L9V A;  4IVN A;  3PQK A;  1FSE A;  2DPD A;  2F5D A;  4U0Y A;  1OR7 A;  3EDP A;  3I59 A;  5ERI A;  4BYY A;  2NYX A;  4DNC A;  1TW3 A;  1O57 A;  1HSJ A;  1GXQ A;  1R58 A;  5JHU A;  4HF0 A;  2A5Y B;  3GEZ A;  1YS7 A;  1IXR C;  2P5L C;  5JR3 A;  4H0E A;  3FXQ A;  1ZHF A;  4HX4 A;  4K2E A;  4HZF A;  3ELK A;  4EQQ A;  1U8R A;  3CUQ C;  3HSE A;  1P2F A;  4WXD A;  2LDU A;  3ZMT A;  5FFX A;  1ZAR A;  3F6O A;  1U5T B;  3COA C;  5E8I A;  2OQG A;  3T5X A;  5HOO A;  3ERE D;  1A04 A;  3GWZ A;  3FHZ A;  4RGS A;  1UST A;  3ROU A;  3QAH A;  3G73 A;  1ZG1 A;  4YII A;  1G6N A;  2R7D A;  5A2Q Z;  3J81 Z;  2BEO A;  5DD8 A;  4LGW A;  3E5Q A;  2K27 A;  3K0L A;  4LLL A;  5E20 A;  2HQN A;  3R4K A;  1ZRF A;  2QQA A;  3GXO A;  2C6Y A;  1BI1 A;  2XAF A;  2P5K A;  3HYI A;  3LA2 A;  2EK5 A;  3DPT A;  2MH2 A;  4U0V A;  5BPI A;  1D3Y A;  3C7J A;  4F7Z A;  3F6V A;  4QLC U; 
#chains in the Genus database with same CATH topology
 5BQT A;  1XMK A;  5LEK A;  3TW7 A;  3ZRG A;  1UZC A;  1MDM A;  2GBY A;  2FNP A;  3M8E A;  2DTZ A;  2F5F A;  1Y0N A;  4AIH A;  2XGE A;  3I5U A;  2YX4 A;  3DBR B;  4XKC A;  2O8K A;  1J9I A;  5KAF C;  3ZQ7 A;  2F5V A;  3TO7 A;  2ZXI A;  3IWZ A;  5GAE J;  2J5O A;  2HR3 A;  3FKJ A;  4JOM A;  1Z3Y A;  3MAJ A;  3OYH A;  2LYC A;  1OR7 C;  4OMZ A;  4BY7 J;  2BW3 B;  2CQN A;  1MMS A;  3L2W A;  1PUF A;  2R7Z J;  2L9N A;  3ECH A;  3ERM A;  1PUE E;  4BE1 A;  1LEA A;  2NAZ A;  1H9G A;  4N0B A;  4G6Q A;  1XCV A;  4JYK A;  3ABT A;  1HQC A;  4ZYA A;  4FX0 A;  4O6J A;  2IRF G;  2NVQ J;  1QVT A;  2KIS A;  4IHW A;  2LG4 A;  1ETO A;  3R0J A;  5GAH J;  2DPU A;  1BBY A;  2V9P A;  3OIO A;  2FEZ A;  2K40 A;  2Q1Z B;  4RAY A;  4E7H A;  1PJR A;  2PEX A;  2D45 A;  3OOU A;  3FMS A;  1PVE A;  2BV6 A;  1NK2 P;  4OWR B;  4B44 A;  1J2X A;  4GGG A;  2W4S A;  3WE3 A;  4HV5 A;  3SXY A;  2CUE A;  3G71 I;  1V55 H;  2HDD A;  3CMM A;  1KU9 A;  1MD0 A;  2DDB A;  2IEK A;  4UUS B;  1BOA A;  3V8L A;  3FWE A;  4D9J A;  1O7L A;  2XSD C;  3JRF A;  1XMX A;  3HOV J;  1IXS B;  4IPA A;  1LFU P;  3SEZ A;  3IAM 2;  1V5E A;  2WAF A;  1QZE A;  1Z7U A;  4KNY A;  1QRY A;  5GAG J;  4Q48 A;  3RQ4 A;  3LAJ A;  2R5Z B;  2NRA C;  5DCM A;  2EFP A;  2G0E A;  4G8X A;  3RKX A;  1FWZ A;  2CV0 A;  3ZMS A;  5DD4 A;  2LY9 A;  1XGM A;  2CV2 A;  1RKW A;  1IW7 F;  1LJ9 A;  4ZYE A;  3QYB A;  4J01 A;  2HOS A;  1SFE A;  2CQ7 A;  2MG4 A;  3CCY A;  3OYG A;  5FKK A;  1UG2 A;  5D5U B;  2JA8 J;  2DJI A;  2QBY A;  1FP2 A;  3WGH A;  2UZK A;  3AG2 H;  4YFK F;  1N77 A;  1B8I B;  2Z1D A;  2DT6 A;  3DQV C;  4XLC A;  3G4S I;  3LQQ A;  4G9Y A;  2XRL A;  1V5G A;  5CKT A;  3QU3 A;  2L9V A;  5AIQ A;  4A0Z A;  4M3F A;  4EVI A;  1ETQ A;  5EF6 A;  2FBI A;  2R3S A;  3BZK A;  2H6C A;  2WTE A;  3ZQG A;  4YFN F;  2X6O A;  2XAG A;  3SZG A;  4IRH A;  3PFI A;  5EZH A;  2EZH A;  2G9W A;  2PFB A;  4BL0 B;  5C4X J;  3K7A J;  4WXC A;  2JSC A;  2VE8 A;  2ZJR F;  4FHT A;  3KCC A;  1W5C C;  4XK4 A;  2XGD A;  3ZQH A;  4BQO A;  1ZLK A;  2HTJ A;  2VBY A;  3BG6 A;  1FP1 D;  2GZW A;  5K5R A;  3OY9 A;  3HSF A;  2EH3 A;  4W97 A;  1VI0 A;  2V6C A;  4OOI A;  1MSE C;  3WTY C;  3DTI A;  2MGQ A;  4UB6 C;  4UNO A;  1EJ9 A;  5D6E A;  4E7Z A;  3J81 K;  2LF8 A;  2XRN A;  5JLX A;  1R23 A;  2IVM A;  3K2Z A;  2F48 A;  3A02 A;  1SFK A;  1LQ1 A;  4Y33 A;  3QYE A;  1UHM A;  4B4C A;  1ON2 A;  3G2B A;  4J00 A;  3JSP A;  1D1A A;  3DV8 A;  3EUA A;  3NAU A;  5HS8 A;  1T0F A;  3L9F A;  1DU6 A;  5CLS A;  2BZT A;  1I1G A;  3BC8 A;  4DQ2 A;  1Z6T A;  4AU7 A;  3W3C A;  2PN6 A;  2DA1 A;  2Y31 A;  1T33 A;  3TOA A;  2QQ8 A;  4Y15 A;  2R7Q A;  3DEE A;  2LY2 A;  1X1D A;  2D2W A;  2PQ8 A;  3FK7 A;  3HC7 A;  3H9Q A;  1CF7 B;  4IHY A;  4Y3O A;  3W6K B;  1J59 A;  1X4O A;  3IL2 A;  1IJW C;  4EAT A;  1T8I A;  1OCC H;  2P0W A;  5E18 F;  3GUD A;  5KK1 A;  1FBS A;  1U3E M;  2Y2Z A;  3GZN B;  1VQL I;  3I64 A;  3KZY A;  2M7A A;  2M0M A;  1D8K A;  1P7I A;  4CYC A;  5HLI A;  2Y0S A;  3CJT B;  1WJF A;  2M45 A;  3GLX A;  4A3C J;  2P81 A;  1GDT A;  1HOM A;  1A5J A;  2VBW A;  5L3D A;  1SD7 A;  4PZJ A;  2HZT A;  3BZ6 A;  3I53 A;  2WB1 A;  5FLX Z;  2F5C A;  5ICG A;  1XGO A;  3CUQ B;  3MFK A;  1EH7 A;  2IA1 A;  1RR8 C;  3FM3 A;  2B7E A;  2R92 J;  2HYJ A;  4XID A;  2IP2 A;  1YI2 I;  2MAB A;  3FXO A;  5B66 C;  1ITY A;  2ZO4 A;  3CF2 A;  3L7W A;  1XC5 A;  5CVU A;  5FO5 A;  1REP C;  2DFH A;  2N8G A;  2V26 A;  1R1U A;  3VDX A;  1K7A A;  2ZME B;  3S14 J;  1B72 B;  4HBL A;  3DBL B;  1FSH A;  3H0D A;  2L4A A;  2JN6 A;  4DZJ A;  2E2I J;  1IN4 A;  2A61 A;  4RLF A;  2M9H A;  4HLX A;  5GPA A;  2XRO A;  2LNB A;  2ZSH B;  1L0O C;  2IS1 A;  3LST A;  1HLV A;  2DA4 A;  5DDG A;  3S2W A;  3F8C A;  4B47 A;  2K9S A;  1RI7 A;  2FSW A;  1LPQ A;  3K2A A;  2HVQ A;  3VOE A;  4A69 C;  5H20 A;  5JLW A;  2Z99 A;  2EB7 A;  2X6Y A;  1BR2 A;  1PYV A;  4RBO A;  2VC1 A;  1EA3 A;  4M73 A;  5HDG A;  1GVJ A;  3E3V A;  1ON1 A;  2G7H A;  4QSH A;  1PP8 F;  4HST A;  2L0K A;  3JRA A;  3U1D A;  3G3Z A;  3WHB A;  5AIP A;  5FD5 A;  1EH6 A;  1EF4 A;  1Z9C A;  3FBI B;  4B3A A;  2LLK A;  3I4M J;  3CJQ B;  5E3N A;  1ZKG A;  3K9T A;  2HDW A;  3OR1 C;  2DW4 A;  4HOB A;  3J7A O;  3R0A A;  3HTS B;  3NAR A;  4NNJ A;  4N4O B;  3MZ8 A;  1WWX A;  4AID A;  1ZG3 A;  3QOP A;  3K1P A;  2KZV A;  3CJR B;  4GXO A;  1Y6I A;  3C2G A;  4HX7 A;  1H8A C;  2HOE A;  4WWC A;  2I5U A;  2YU3 A;  3ECO A;  2E71 A;  1ETX A;  3GTM J;  2M4G A;  3O8G A;  2IGM A;  2E1N A;  3BJA A;  4HV6 A;  3KP5 A;  4ZDL A;  4S0H B;  2XB5 A;  3BJO A;  3BTJ A;  2ZJP F;  3ZR8 X;  4RGU A;  1SAX A;  1XGN A;  4E7L A;  3IAS 2;  5AON A;  3TO6 A;  2FA5 A;  3E6M A;  2RNG A;  2CUF A;  2ACJ A;  4AIK A;  2LFB A;  2WAQ A;  1MJ9 A;  4A0X A;  3MKL A;  3BR5 A;  4ETS A;  5J4V A;  4CYD A;  5FJ8 J;  5C3E J;  5CVR A;  3BR0 A;  2ESH A;  3SHF A;  5F08 A;  3PL8 A;  1W0T A;  2LF7 A;  4YG2 F;  2DMQ A;  4XKV A;  4RB2 C;  1X1C A;  1XSD A;  4LIU A;  3FXK A;  3I59 B;  1FIP A;  3A0B C;  5LRR A;  4B43 A;  3F21 A;  1EH8 A;  2NNY A;  2E1C A;  1D8J A;  4XLH A;  3LAP A;  4PJM A;  1R36 A;  3PQJ A;  4I6Z A;  1ZRE A;  2LRE A;  3P5J A;  5LFA A;  4MQ9 F;  1YOV B;  3HGG A;  1MW7 A;  4IEJ A;  1T98 A;  3D5S C;  4MHG A;  2L7F P;  2VC0 A;  5L3F A;  4FX4 A;  4IRI A;  2K9N A;  1WKM A;  3GZ5 A;  5F0H A;  2HKO A;  3T8T A;  1MNE A;  3VOD A;  4BE2 A;  3IH4 A;  3L2C A;  4ZYH A;  1CGP A;  3D0S A;  4OAZ A;  3PNT A;  1SEU A;  2F4O B;  2EIJ H;  2VB6 A;  2OD5 A;  4KA4 A;  1RES A;  1QGP A;  2K3F A;  3HDD A;  2ZSI B;  1DPU A;  3CCR I;  4U88 A;  1QHH D;  3WU2 C;  1LDJ A;  4C3J J;  5J1Y A;  2ME0 A;  5EGO B;  4RGX A;  3WTV C;  4GYI A;  3ZQI A;  2R7R A;  4C30 A;  4UUT A;  3IKT A;  2VI6 A;  1ETY A;  4LG0 A;  3ZQL A;  4A0Y A;  4P55 A;  5KCM A;  1FBQ A;  2M4K A;  4ESJ A;  1IRF A;  3Q0V A;  4ON0 A;  3K4M A;  3CQZ J;  1HW2 A;  2JVG A;  3RYR A;  4ZZD A;  2DJN A;  3OYB A;  1S7A A;  4IQJ A;  1OCP A;  1YW8 A;  4BJ6 C;  1K4T A;  5EG0 B;  3B6C A;  2LBF A;  3V7R A;  4YFX F;  2FXA A;  3E6C C;  1Z05 A;  3K6G A;  2KHM A;  5K5Q A;  4II2 A;  2L54 A;  2JA2 A;  2Q8K A;  2LY1 A;  3LA7 A;  5LRS A;  2KRF A;  4BHP A;  4I09 A;  2EFO A;  1BI2 A;  3WGI A;  4DOZ A;  1BN5 A;  1Y1V J;  5BNG A;  2DU9 A;  4BEH A;  3U21 A;  2K9M A;  2XKP A;  3HXL A;  1XMA A;  2DO7 A;  2WA0 A;  1RUN A;  3GTL J;  4BJ5 C;  1X2N A;  4JX5 A;  3S15 J;  2E36 A;  4XNF A;  3I9V 2;  3V7S A;  1AA7 A;  3BTL A;  3DBH B;  3VB2 A;  1APL C;  4DBR A;  2K86 A;  3GTK J;  4B09 A;  4BH9 A;  5ICE A;  3S16 J;  2EA2 A;  3H0G J;  1MMD A;  2QVO A;  3CUQ A;  5IP7 J;  2GA1 A;  4RM3 A;  4IXA A;  2DA5 A;  2XF6 A;  3OYM A;  1B59 A;  3EET A;  3P7N A;  5EJC A;  1MH3 A;  3HL2 A;  2K5C A;  2Z5U A;  1MBE A;  3MQ0 A;  3FHN A;  1MDM B;  3MD2 A;  1GLN A;  4A3D J;  3LSG A;  4IF4 A;  5BS6 A;  2CFX A;  3ZMD A;  1ETK A;  4XBF A;  2QZ8 A;  4JQF A;  1B72 A;  3BT9 A;  5DUK A;  5E1W A;  2KDO A;  3GTO J;  1OQY A;  2BY0 A;  1JUM A;  3FIW A;  2RQP A;  3H5N A;  3GZ6 A;  4GDF A;  1VTN C;  1EKE A;  3LSJ A;  2L7Z A;  1YJ9 I;  1UMQ A;  3KET A;  5HOD A;  1IRZ A;  1PUF B;  1JKO C;  2HGC A;  2ID6 A;  4I99 C;  4OIQ F;  3T0Y A;  3HBL A;  2VIX A;  2OC6 A;  4UVC A;  3ZQF A;  1TZL A;  1I1S A;  1HW1 A;  2QKL B;  3BPX A;  5HS9 A;  4HNT A;  3K1M A;  1TP4 A;  4I01 A;  2DK5 A;  2HDC A;  3CTA A;  2JRT A;  1U0J A;  1TQP A;  3C18 A;  3FMQ A;  3OV8 A;  2WV0 A;  3RKQ A;  1J7K A;  2BOL A;  1F36 A;  2DDA A;  1NH3 A;  3CDH A;  1ULY A;  1ZQ3 P;  3KZI C;  3A4C A;  5H6R A;  3OYJ A;  3S1M J;  4KN7 X;  2JK3 A;  3KYL A;  2ESN A;  2DLL A;  4UB8 C;  3S1N J;  5E3L A;  2E19 A;  2IGK A;  3TQN A;  2XGX A;  3KP4 A;  4MLO A;  4DZP A;  3ABL H;  3GFL A;  1SMY F;  2V9V A;  3TDZ C;  3MKY B;  2JJ7 A;  3S32 A;  3PO2 J;  1TT5 B;  3IHU A;  2Y69 H;  2XKO A;  2ISZ A;  2QQB A;  4D7N A;  4XLN F;  2BVM A;  3Q0U A;  2HEO A;  3DU5 A;  3PSI A;  4CIC A;  3AKZ A;  5J8C A;  5DCM B;  5D5W B;  2P8T A;  5IY5 H;  1FX7 A;  3A2K A;  3B02 A;  5J40 A;  1IDY A;  1ZH5 A;  4KDP A;  2CRG A;  3H5R A;  1FBU A;  4IL6 C;  2E2J J;  1BIA A;  3X2Q H;  1JUS A;  4A6D A;  4E7S A;  1K4S A;  3E97 A;  1TL8 A;  2CYY A;  1R49 A;  4A6E A;  2XGC A;  2CUZ A;  3GVA A;  1S72 I;  2HPM A;  1RUO A;  4EJW A;  2QBY B;  2XF5 A;  3RJP A;  2W82 A;  4L9J A;  4RMN A;  2M30 A;  2E2H J;  5FKM A;  1MBJ A;  5KHD A;  5LD2 C;  2M2E A;  4M6Y A;  3CCU I;  4KT6 A;  3BOQ A;  4M74 A;  3JAM Z;  1D1C A;  3TW6 A;  3EUH C;  1MMG A;  3C2B A;  5L3G A;  3E0J B;  1RRJ A;  3U2R A;  4BUP A;  4PCQ A;  3HOX J;  3E5X A;  2NS7 A;  3NWT A;  2V1X A;  2H94 A;  4OAY A;  1Z7L A;  3TP0 A;  1GV2 A;  3WTW C;  5D4S A;  4KIS A;  1X3U A;  4EM0 B;  1MJA A;  4A3E J;  2HOT A;  2PMU A;  4RLQ A;  3IUO A;  3E1S A;  5JHF A;  1MGT A;  1RET A;  4E4H A;  3HKZ A;  4KIB A;  2ELK A;  1XN7 A;  1TNS A;  2QSF X;  3TOB A;  2P4W A;  3T8R A;  1GXP A;  2O5R A;  2Z9O A;  1R5I D;  3L09 A;  1XS9 A;  4NC6 A;  3DEW A;  1K6O A;  3DLL F;  1HST A;  3SYT A;  3BCA A;  5JI6 A;  3TED A;  1G3Y A;  3LFK A;  3CC4 I;  5M5W J;  4NUB A;  3CP2 A;  3WG7 H;  4KIG A;  2A69 F;  3CF5 F;  4M3E A;  3HOT A;  2VKE A;  3GFM A;  2LTP A;  2J5P A;  4LB6 B;  2WB1 N;  4RB1 A;  4P1W A;  2CFO A;  3WOD F;  1UHW A;  4RAG A;  1PDN C;  2R5Y A;  1YTY A;  2AXT C;  2OZU A;  2QA4 I;  2WAD A;  3BG3 A;  2FU4 A;  2EIM H;  3UKG A;  1TWF J;  1G59 A;  3D5R C;  4BHB A;  2TDX A;  4EM2 A;  1IRG A;  9ANT A;  5L3E A;  1VZ0 A;  4Y4R A;  2LK2 A;  2IJL A;  4HF1 A;  2NVX J;  1DP3 A;  5GP9 A;  2RKH A;  3FXU A;  1F9N A;  4CYC B;  4IHT A;  2XAS A;  2YX7 A;  4YEL A;  4I98 B;  2DFE A;  3AL0 C;  4LIV A;  2WY7 Q;  2R7F A;  3RKW A;  1LB2 A;  1Z6R A;  4OU0 A;  3ZP5 A;  4KJZ A;  1W5T A;  3ZPL A;  2AS5 F;  2QLZ A;  2EV5 A;  4EM1 A;  3H9G A;  3S8P A;  4AYB A;  2KFD A;  5LGT A;  3FMR A;  2FQ4 A;  1FOX A;  4KN4 X;  1HDP A;  2NOG A;  2BBY A;  4HW0 A;  1BI0 A;  2XB0 X;  4NDL A;  4BS9 A;  4EEF G;  1KQ9 A;  2MA3 A;  3NRV A;  1SAU A;  1SFX A;  3HB9 A;  1IV6 A;  2GA2 A;  3K4L A;  2I10 A;  4BAC A;  3CCS I;  2XPU A;  4FT8 A;  2VKV A;  4P9F A;  4B48 A;  1I6X A;  5J47 A;  1F43 A;  2K02 A;  1MBK A;  3SJM A;  2NS0 A;  1ENH A;  3DCF A;  1OLT A;  3F3X A;  1POG A;  1WJB A;  3DPU A;  3JRC A;  1U9O A;  1LUJ B;  5D6F A;  1IF1 A;  2E5N A;  2LVS A;  1V4R A;  3QP5 A;  3EYI A;  4LG3 A;  3TL4 X;  1Z91 A;  2WAQ N;  5DM7 F;  2JA5 J;  4XQF A;  1UB9 A;  3RCO A;  3PNY A;  2A3S A;  2MC4 A;  2V1D A;  2XAJ A;  1STZ A;  4I7H A;  3QPH A;  5IP9 J;  5M5Y J;  1I50 J;  5E1X A;  5D4R A;  3J80 Z;  4A12 A;  1DQU A;  3V8K A;  4BGD A;  1FLI A;  2QUF A;  3ABK H;  2K9Q A;  3M07 A;  2OUM A;  1FJL A;  3FXR A;  1I27 A;  1SVM A;  2WV1 A;  2P7C B;  1JGG A;  1NTC A;  2OA4 A;  1JI8 A;  1IRX A;  2TRT A;  3JAM K;  2EV0 A;  4XOT A;  2XHK A;  2NVT J;  3HOZ J;  1LVA A;  5FKN A;  1H88 C;  1T95 A;  1T08 B;  4C2U A;  3SDB A;  4RB0 A;  2RN7 A;  3IWF A;  3OYE A;  2W1O A;  1V5F A;  4LFU A;  4D7M A;  1SC7 A;  1TLH B;  4I2O A;  1G2H A;  4B8X A;  3CES A;  2CJJ A;  3CCE I;  1TWA J;  2KIM A;  1G3W A;  1JHH A;  2DFF A;  4XL9 A;  2CH0 A;  4F3Q A;  2JZY A;  1HA8 A;  4MIM A;  1BOB A;  2CQX A;  1A6I A;  2VPR A;  1HCR A;  3LL7 A;  2COB A;  2QSH X;  5CPR B;  3PSF A;  3AFH A;  1BM9 A;  2GWR A;  4MQV A;  1FOY A;  5ICF A;  2Q0O A;  5IP6 A;  2EWN A;  4AVP A;  4ZYD A;  1C0W A;  3NEU A;  2GOM A;  1UJ8 A;  4ZYG A;  3PJR A;  2EZI A;  4NB5 A;  4MGR A;  3KFW X;  3I55 I;  2VJI A;  4AC0 A;  1S3J A;  1TWC J;  1U2W A;  2EIN H;  4CCK A;  4E6K G;  2CQK A;  3H3U A;  4HLY A;  1Z1D A;  2WBM A;  1FC3 A;  2X1D A;  2ZNY A;  4EJU A;  2CGP A;  4IQ4 A;  4HSR A;  1WSU A;  5GPC A;  2O9L A;  4RS8 A;  1XD7 A;  4F52 A;  3OS1 A;  3JR9 A;  2F4M B;  2FBK A;  2H1L A;  4LG0 B;  5A2Q K;  1YX5 A;  3BLY A;  2D1V A;  3ULQ B;  2PMZ A;  2XSJ C;  1EV7 A;  5IPA A;  4XRM A;  4CGZ A;  1UEL B;  2EIK H;  4PJL A;  4XLF A;  4IHX A;  1S7O A;  4XIC A;  1P4A A;  3IRQ A;  2Y30 A;  2E7W A;  3FKI J;  2LBF B;  1ZLJ A;  1YFH A;  4Y7N J;  5HDN A;  2CW0 F;  2QM3 A;  1S8N A;  4RB3 C;  5J1U A;  3SZP A;  4BJT A;  3F8N A;  2OF7 A;  2F6C A;  2XPV A;  2KMU A;  2DOF A;  2W84 A;  1TWH J;  5KNL A;  5HLH A;  4G6T B;  4A93 J;  2EIL H;  4LD5 A;  4XMY A;  3L2V A;  2PJR A;  1XG1 A;  4BEH B;  2KIQ A;  2FF4 A;  3WTS C;  4O3M A;  2IAI A;  2A5W A;  3FZV A;  3JTG A;  1N75 A;  3O8H A;  4EJT A;  4P96 A;  3E6D A;  3Q9V A;  4UV9 A;  3MWM A;  2GOX B;  2BY2 A;  2K85 A;  2FOK A;  2W48 A;  1KQ8 A;  3LMM A;  2XAU A;  3H36 A;  3CO6 C;  5JVG F;  2VKH A;  3ZN0 A;  2FRH A;  5E79 C;  3ZMU A;  3S2D J;  4ITV A;  3JSO A;  4MNU A;  3ZQQ A;  2E1M C;  3KP3 A;  2HVS A;  1IN5 A;  4LJZ F;  4CZC A;  1R71 A;  3E6B A;  3S17 J;  1V54 H;  4HQM A;  3VYT B;  2DBB A;  4PK4 A;  3J7A Y;  2MD0 A;  3BTC A;  1NK3 P;  4XN3 A;  2PLY A;  4BBS J;  4YIF A;  3L2Q A;  2KT0 A;  4LMY A;  2QWW A;  1ACI A;  1TQM A;  1IN6 A;  1VQ6 I;  2MLK A;  3O2P E;  5L3C A;  3CJN A;  4D1Q A;  3KLO A;  5FGM A;  3PFY A;  1R9T J;  2OAZ A;  1SMT A;  3ML6 A;  4O5V A;  2A05 A;  5E3O A;  2EZK A;  3Q3S A;  1YW9 A;  3F72 A;  3ISP A;  2DMN A;  2OCC H;  2XAQ A;  2YS9 A;  2EJR A;  3UNG C;  2MD5 A;  2OTJ I;  4CUG A;  2HFH A;  5IYC J;  2R7V A;  1W7P A;  1IDZ A;  5LLQ A;  1ORK A;  1QQI A;  3GCM A;  4AVZ A;  1DGR M;  2PX9 A;  1WH7 A;  1ZGJ A;  1O4X A;  2D1H A;  2R4G A;  1U6G A;  2NOJ B;  3L2U A;  2X51 A;  3J80 K;  5K5O A;  4UUV A;  3OS2 A;  3I0T A;  4PGH A;  1FTT A;  3I4N J;  3G1O A;  3MMY B;  5H6Q A;  3OYI A;  1G4D A;  4ZJZ A;  3LOC A;  2STW A;  1I6H J;  2GAU A;  4HX8 A;  3LSR A;  5GTH C;  2A68 F;  2PJP A;  1KU3 A;  1R22 A;  4FAS D;  3QQA A;  3S3M A;  5J6X A;  3QRF F;  3M8F A;  2AQF A;  3KEQ A;  5LEJ A;  3DU6 A;  1TBX A;  3I58 A;  1LFP A;  1P4W A;  4G94 A;  3AL0 B;  1OYY A;  4LB5 A;  4M6V A;  2KIF A;  3WE2 A;  1IAW A;  1SAN A;  4Y17 A;  4MFE A;  1HF0 A;  2O6G E;  1XDU A;  4AWX B;  2DT7 B;  1SVL A;  2JPC A;  2XUB A;  1YRN A;  2VBX A;  1YG2 A;  2LKS A;  1JHF A;  2KQR A;  4M9X A;  1R4N B;  2B0L A;  1QPI A;  4QPO A;  2JVH A;  2CSO A;  3HRM A;  5CQG A;  2KDZ A;  4XKW A;  1V3F A;  1MIJ A;  3KYC B;  4Z6Y A;  1I5Z A;  3K4K A;  3IP4 B;  4G7H F;  1WH5 A;  2JQ7 A;  1BC7 C;  1D5V A;  2CWE A;  2AO9 A;  2HYF A;  2UUZ A;  3GF2 A;  3OOP A;  5TIS C;  3PM1 A;  4M9Z A;  2GXB A;  1WQ2 A;  4CCO A;  2DA7 A;  2R7U A;  1B6A A;  2TCT A;  1IGN A;  4LK0 F;  2RGV A;  4LK1 F;  1LVK A;  4XSX F;  2IT0 A;  3JW4 A;  3HKZ N;  3F23 A;  3BDD A;  4ZC3 A;  1R5G A;  2MC3 A;  2W57 A;  3ASN H;  3VEP A;  1OIS A;  3TP3 A;  3R60 A;  4IRG A;  1ZTR A;  4C2T A;  1OFC X;  3PNV A;  4BNC A;  3CUO A;  4LOC A;  2L3D A;  3OMY A;  1P7J A;  5K7F A;  2NNN A;  5LGN A;  1IN8 A;  1DDN A;  4CH7 A;  3WU0 A;  1N78 A;  2JPB A;  1RNL A;  1Y8R B;  2VON A;  1QPM A;  2M3A A;  2OU2 A;  2Y75 A;  3DWL E;  3RTR A;  3ZN1 A;  1D0Z A;  4CCL A;  1U9N A;  3WHC A;  3F22 A;  4CHU A;  4ENK A;  1CQT A;  3ABU A;  2BGC A;  3HOW J;  2HQR A;  2DFI A;  2Z3Y A;  2BYV E;  3D5L A;  3DEU A;  3HHH A;  3R61 A;  2LC2 A;  4BQN A;  3GO5 A;  4EGZ A;  2HQ5 A;  1LDK B;  1FOW A;  1G8X A;  1YS6 A;  1TWG J;  2ECC A;  2RV8 A;  2X6W A;  2DOD A;  3EQL F;  1R7J A;  1ZEL A;  2EBI A;  5FLX K;  3OSF A;  3I56 I;  2HS5 A;  2VOD A;  2V9K A;  2OZ6 A;  3GBG A;  1E2X A;  4H4K C;  3EUH A;  4XRS G;  3JRH A;  4A2U A;  4WCG A;  5B1B H;  2R5Y B;  3C3W A;  3CO7 C;  4P9U A;  3W6J B;  5JFR A;  2K9L A;  2L5Q A;  4BXU A;  2DAO A;  4AYB N;  4HG2 A;  4PSX A;  2DT5 A;  2M34 A;  3TBI A;  1BW5 A;  1BIB A;  4L0Z B;  4GCV A;  4HA8 A;  2EFN A;  1X1A A;  2ZNZ A;  2ZXJ A;  2Y0M A;  5B1A H;  3H3Z A;  4ESB A;  3REO A;  3DFG A;  3FK6 A;  2XIG A;  3RI4 A;  1HKQ A;  3M8J A;  1X4P A;  4NC8 A;  2BE5 F;  2XV4 S;  3A0H C;  3EUK L;  5CVI A;  3VYR B;  4N4N B;  2GM4 A;  4DYR A;  2GIZ A;  1FY7 A;  2EZL A;  2P5V A;  4Y13 A;  1PP7 U;  3A01 A;  1AHD P;  3DKY A;  1YYV A;  2QSG X;  2JWT A;  4BDZ A;  4A3K J;  4C9Y A;  1Z3X A;  3ZGK A;  1ZGA A;  5E1Z B;  1H0M A;  2DA2 A;  1HW5 A;  5LHI A;  1NHA A;  1YJN I;  3OYD A;  2HZD A;  5B5E C;  1KYW A;  4ENN A;  3ZXS A;  1YLF A;  3L1P A;  4UY8 I;  1MMN A;  4PGG A;  2ZXW H;  3FM5 A;  1K78 A;  1IC8 A;  2EV6 A;  1MBH A;  2GQQ A;  4M3D A;  1NG7 A;  3ABM H;  2HYG D;  4R8H A;  1MZB A;  4UV8 A;  3VFZ A;  4F92 B;  4L5J A;  1FIA A;  2FOW A;  2FUG 2;  1USS A;  1FPQ A;  2CW7 A;  1O3T A;  1ETW A;  2GIV A;  1JT6 A;  2O3F A;  4DGW B;  5BPD A;  3TKY A;  4M72 A;  3HSR A;  3FDY A;  1N25 A;  4DW6 A;  4L9N A;  1HBX G;  1ZN2 A;  4JBA A;  2VQC A;  3CCM I;  2IA2 A;  3WGG A;  1JXS A;  4BXX J;  5FD6 A;  1J0R A;  5KVR A;  1KON A;  2CO5 A;  3DPL C;  4QIW N;  5BOX A;  3QYF A;  2WAE A;  1YIO A;  2K7L A;  3V4G A;  1TNT A;  1JKQ C;  3CP8 A;  2GLO A;  2LKP A;  1SD5 A;  1P6R A;  1HDD C;  4EV0 A;  1OPC A;  2UV1 A;  1F1Z A;  4AIJ A;  1S7E A;  5ILU A;  5J1R A;  4S05 A;  3LFU A;  3MCZ A;  4FTH A;  2R7X A;  2H27 A;  4S04 A;  2V4J C;  2XPW A;  3HJE A;  4R79 A;  1K83 J;  5K1Y A;  5J4Y A;  2RRE A;  2P7V B;  2X9D A;  3JRB A;  5F6F A;  4MFD A;  1VQ8 I;  3G1L A;  3K4J A;  4XR6 A;  5C44 J;  3V42 A;  2L9R A;  4Q47 A;  3HHG A;  1R5H A;  2DXI A;  2VLA A;  3ESW B;  4I76 A;  4KMF A;  2VJ5 A;  2M8E A;  5HLG A;  2PI0 A;  5LGU A;  3CME I;  4U7D A;  2M5W A;  2IS2 A;  2KPM A;  2L7M P;  5HS7 A;  4ZZL A;  3L2R A;  3K1N A;  3V7C A;  2KJB A;  1VQM I;  1R00 A;  1XCB A;  1KZH A;  3S1Q J;  1R6R A;  1HXD A;  4IO9 F;  1WJ5 A;  3ZCO A;  2ECB A;  1LEB A;  2VBZ A;  3HIF A;  1AWC A;  2PMZ N;  1J5Y A;  1FEX A;  2BXZ A;  4A5N A;  2Q2E A;  3MKW B;  1W7P D;  1MKM A;  3GFI A;  3N05 A;  1O3S A;  3M1C A;  3F0C A;  2ZFU A;  4PFO A;  1W5S A;  2P6T A;  1YQA A;  4I0B A;  4R1H A;  4GO1 A;  1ONV A;  4N9I A;  4WF2 A;  3WTT C;  3QWL A;  4DYC A;  4XON A;  4M3B A;  5GAD J;  2XDV A;  3MKZ A;  2QEN A;  3I71 A;  2E1O A;  1BR1 A;  3HRT A;  3OWT A;  2VXZ A;  3W6V A;  1KA8 A;  2A07 F;  2BHZ A;  3AG1 H;  2O03 A;  4BHC A;  4GYG A;  4M3G A;  1R4M B;  4M9S A;  2FX0 A;  2HXI A;  5F1J A;  2Y9Z A;  3M4O J;  3CDL A;  3HRU A;  4E70 A;  3WU1 B;  1ZGW A;  2QEX I;  3IRR A;  2YSR A;  3BG7 A;  4UVB A;  2MSY A;  3BR6 A;  1JTX A;  4TV7 A;  5FB2 A;  1Y39 A;  2H6B A;  3QOE A;  5DTD A;  3MZY A;  2PBI A;  4IZZ A;  4BU2 A;  1X2M A;  4DYQ A;  4J19 A;  3JCU C;  2DOE A;  1SVO A;  2ETH A;  2OJE D;  2OCE A;  2Y0S N;  4PJ0 C;  1ZAO A;  4D5F A;  4QTR A;  2ZKZ A;  1TT0 A;  2KRC A;  2R7W A;  2O7O A;  4OIN F;  1JKP C;  2E35 A;  1SFU A;  3SQN A;  1DGW Y;  1QU3 A;  3GYH X;  1OJL A;  5ILV A;  4NQW B;  4GFB A;  3RZD J;  2FQ3 A;  3HOS A;  4V19 K;  1D0X A;  3DKX A;  1MSF C;  4IHS A;  4BY1 J;  4WK8 F;  3JRD A;  4EJO A;  4A3I J;  1X19 A;  4FCY A;  1T56 A;  4GRI A;  2K4J A;  3HOU J;  4XLP F;  1RC9 A;  4OMY A;  4IX7 A;  5EEA A;  2ZFW A;  3KP7 A;  2PJR B;  1X1B A;  1JJ8 C;  4RAF A;  1MJB A;  4FE4 A;  4D0P A;  4JK1 X;  2X1C A;  4I0A A;  5F0C A;  1FT9 A;  3B73 A;  4A3F J;  1WFX A;  3I54 A;  3DKW A;  1RPW A;  5HVQ C;  1X3W B;  4A3G J;  1VND A;  2CMP A;  3SEQ A;  2I8D A;  3LSP A;  1DU0 A;  5FRN A;  1DP7 P;  1IO2 A;  4MTE A;  3FIS A;  5DYM A;  3FXJ A;  1FMV A;  1FTZ A;  5EDN A;  4PJN A;  2PMH A;  5JVT A;  5E3M A;  2ZB9 A;  4A3B J;  3DXJ F;  4LLG F;  1K6Y A;  2DYS H;  3DTE A;  5EZG A;  3J7Y J;  1KQ0 A;  2K3P A;  1XGS A;  2V79 A;  3GX4 X;  3RIR A;  5D8K B;  2QYO A;  5FRO A;  2ISY A;  3RKY A;  2CQQ A;  1BJA A;  4PJJ A;  4OIO F;  2FD5 A;  3GW2 A;  1P4X A;  2DOA A;  3BG5 A;  3HUG A;  3QP6 A;  5FRM A;  5FKL A;  1UFM A;  2HTS A;  2DQL A;  2P6S A;  4KIT B;  2VUM J;  2XF7 A;  1MMA A;  2ZBK A;  2LOO A;  1WCM J;  4CA0 A;  1W7P B;  4RM2 A;  4YRV A;  5C4J J;  4XLA A;  1W36 C;  1FYL A;  2CS3 A;  4RA2 A;  5K7Z A;  4HQE A;  2L7K A;  2DI3 A;  2DTR A;  1B9M A;  2DA3 A;  1MND A;  1XSX A;  2DCE A;  2EQR A;  4MO7 A;  2JMW A;  2VOP A;  2V6E A;  2V1N A;  1Y0U A;  1QA6 A;  5J8F A;  2BHY A;  4ESF A;  5EEG A;  1OYW A;  3BQZ A;  1Z67 A;  1KU7 A;  4FIS A;  1OMI A;  1A35 A;  2LRD A;  1WJE A;  2IW5 A;  4E7J A;  3RPQ A;  2A6E F;  2EPF A;  3CCL I;  3ASO H;  3CLO A;  3L00 A;  3KZZ A;  2B9S A;  3M1E A;  3IH2 A;  3TGN A;  2A6H F;  4PFP A;  4G12 A;  4BQA A;  1WJC A;  3QU6 A;  2G7U A;  1YHQ I;  4QPQ A;  3ZQC A;  1RZ4 A;  4QWQ A;  4HDV A;  2LH9 A;  3BR2 A;  4IKF A;  3BRO A;  1BJZ A;  3RZO J;  4FQG A;  1XPX A;  3H92 A;  1YRN B;  5HNF A;  3JRE A;  3TMO A;  3RQI A;  3OIP A;  4L9T A;  1QNT A;  1X1P A;  3OYK A;  1P92 A;  5FLM J;  3E7L A;  4ABZ A;  3BY6 A;  3KPH A;  1XX5 A;  3FXM A;  3M9A A;  3K10 A;  1YX3 A;  1DPR A;  3MZH A;  4UVA A;  2OQR A;  4PDK A;  2DN0 A;  2DMU A;  4JX6 A;  3TDU C;  3KX2 A;  3DF8 A;  5TJJ A;  1U8B A;  1LFB A;  4ENJ A;  1LE8 B;  1O3R A;  2R7O A;  4KIF A;  3BTI A;  2RQQ A;  4NHJ A;  4A3M J;  2R7S A;  1Q1V A;  3Q0W A;  4ZH4 F;  3KLN A;  2O61 A;  1ZRC A;  5CJ9 A;  3JRG A;  3LNQ A;  4D5C A;  4II3 A;  2IBD A;  1ZYR F;  2R93 J;  5F64 A;  4IOC F;  4UXN A;  3ZMZ A;  1WVR A;  3F8M A;  3OYC A;  3QOD A;  4L5I A;  4BDY A;  1VQP I;  2BY3 A;  4JP0 A;  4HEA 2;  4A3J J;  1YIJ I;  2VKD A;  4HNU A;  4BE0 A;  3NQO A;  3OS0 A;  4EJV A;  4MEX F;  2L2O A;  1WRJ A;  2HKX A;  4L0Y B;  1HKT A;  3P9I A;  4FET A;  2L02 A;  3GTP J;  2VXD A;  3HGY A;  2W25 A;  1VQ4 I;  3MEX A;  2MFZ A;  2QF7 A;  2AQE A;  2QCO A;  1NG6 A;  1D0Y A;  4HF2 A;  1TTY A;  3S3O A;  1YO5 C;  1AU7 A;  1IUF A;  1ODD A;  2X6X A;  5CYV A;  1Y56 A;  2HU9 A;  3U9G A;  3I4P A;  3G6E I;  1I39 A;  1AOY A;  2BY1 A;  1BR4 A;  3CZ6 A;  1XSV A;  1U5T A;  2WC2 A;  4NQW A;  4CDG A;  5D8L B;  2UWM A;  2RC4 A;  1SD6 A;  1ZG5 A;  1TQI A;  2HNH A;  3A1Y A;  1KYZ A;  2E34 A;  3W2V A;  4N9H A;  4UHT A;  1G3S A;  3PUF A;  1T6S A;  1JUP A;  1B1B A;  4KT5 C;  1W1W E;  5E8G A;  2E60 A;  4RGR A;  4ASN A;  1FNN A;  1P9Q C;  4LLN A;  4CCM A;  3S1R J;  1FOK A;  2FNA A;  2X0L A;  1OCT C;  1T39 A;  3CLQ A;  4MTD A;  1BC8 C;  1IN7 A;  1OYI A;  1QZZ A;  2ZXH A;  3KP6 A;  2JUG A;  3Q5F A;  1UCR A;  5H2F C;  2Z2S B;  2ME6 A;  4F55 A;  2DK8 A;  3TO9 A;  4CZZ A;  1W36 D;  4E7K A;  1A36 A;  2XVC A;  1S6L A;  4XRF A;  2OV7 A;  4ANJ A;  4KIC A;  3GTQ J;  3K70 C;  1X58 A;  5ED4 A;  1BI3 A;  1KU2 A;  3H35 A;  2WWY A;  1VQO I;  2OTL I;  3IV5 A;  2PG4 A;  3RPU A;  4EMS A;  5EEH A;  1YJW I;  3H1C A;  3QPT A;  1H9T A;  2FMY A;  1MH4 A;  2UXN A;  3FBN B;  1R1V A;  2HOA A;  3MVP A;  3A01 B;  5HDK A;  1AKH A;  2VOO A;  2L4M A;  4Q5S F;  1VQK I;  3KEY A;  2IPQ X;  2O0Y A;  4EGY A;  4U0W A;  3OYL A;  1T2K A;  1YW7 A;  2F2E A;  2D5V A;  3HTU A;  3JTH A;  5FLV A;  2DQR A;  2IGO A;  3LSI A;  4RAZ A;  1E3P A;  3MN2 A;  5E17 F;  2KJC A;  1WJA A;  1X3Z B;  3ONQ A;  3WTZ A;  1K79 A;  3C1D A;  2M87 A;  3Q9S A;  1K78 B;  3OIQ A;  1O3Q A;  2CUJ A;  2X4H A;  1S29 A;  3IKV A;  1Z77 A;  2H8W A;  4M71 A;  2BW3 A;  2V7F A;  1VQN I;  1VFC A;  3LSH A;  4B3X A;  2RVC A;  3N4M A;  2Z33 A;  2ELJ A;  2VQL A;  1UG0 A;  2RAE A;  4V2F A;  2ZJQ F;  3WG9 A;  3IC7 A;  2IXS A;  1O7F A;  3SDG A;  5IYD J;  3HPG A;  3RDI A;  3N97 A;  3S2H J;  5CVJ A;  2HQA A;  2XAH A;  3LQR A;  4BQQ A;  2FML A;  1QO0 D;  2HI3 A;  3BCB A;  1L3L A;  3CD6 I;  3WTU C;  1IV8 A;  2JT1 A;  3S93 A;  1DUX C;  3M3Y J;  1WZ2 A;  5KAI C;  5TRD A;  1MBF A;  1BL0 A;  4OIP F;  1JGS A;  2ZC2 A;  4Q4Z F;  2VAS A;  3HEF A;  1ETV A;  1GHC A;  2AXL A;  3K69 A;  4OIR F;  1MNM C;  3VYS B;  1WJD A;  2HXO A;  3F9K A;  1TC3 C;  4UUS A;  5IT9 Z;  1RKT A;  2COM A;  2VQH A;  2VL8 A;  1VQ9 I;  5ICC A;  3BP8 A;  2KRH A;  4ZTF A;  3GTG J;  3VSL A;  3CCV I;  2OBP A;  3DP7 A;  2R5Z A;  3VYU B;  3EPZ A;  2Z16 A;  1S5L C;  2LR8 A;  1WGX A;  4ZTJ A;  5D5V B;  3F8B A;  4HAM A;  2NVY J;  3KE2 A;  1FMW A;  1LE8 A;  1U5T C;  3PO3 J;  2M1B A;  2K4B A;  2ID3 A;  3LWF A;  1TW2 A;  3A03 A;  5CVV A;  3FF5 A;  2M0C A;  2LSO A;  4P5O A;  1D5Y A;  2L9S A;  5TGT A;  2ADU A;  5LHH A;  3FX3 A;  4WX9 A;  4V2G A;  1GUU A;  2RDP A;  4C3I J;  4CCN A;  2R0Q C;  2MYS A;  2H8R A;  1W0U A;  2RNJ A;  2VT2 A;  1B8I A;  1JJ6 C;  3HZJ A;  1RIO H;  1T0F C;  2F5E A;  1IZ1 A;  2Q2E B;  1BW6 A;  4PSW A;  2BXY A;  1J09 A;  2UXX A;  1SD4 A;  3D1N I;  2DMT A;  4LIT A;  1G3T A;  2E7X A;  5J3L A;  1E17 A;  4XRS A;  1XDS A;  4HRI A;  1W4M A;  3W2W A;  4HPQ A;  2ELH A;  2IA0 A;  3CCQ I;  4L18 B;  2OPT A;  4X0G A;  3WTX C;  1H89 C;  4IHV A;  2STT A;  6PAX A;  2JTV A;  3V8J A;  1YIT I;  3KP2 A;  4A5M A;  3K70 D;  2WY8 Q;  1F4K A;  1F5T A;  3OYN A;  4KMU X;  3P9K A;  3VSK A;  3H9J A;  2IGN A;  1QVU A;  2A6T A;  1GVD A;  2XC7 A;  1ZR2 A;  1UHS A;  3BQY A;  5ILS A;  3SFZ A;  4DIQ A;  1JKR C;  2NXN B;  2X48 A;  1MBG A;  2FBH A;  2F4I A;  2LP0 A;  4XKB A;  3VPR A;  2NS8 A;  4HDU A;  4XN0 A;  1IXC A;  3OSG A;  1GV5 A;  2EFW A;  1ZRD A;  4C2M J;  2YU9 J;  2CW8 A;  1A31 A;  2KP6 A;  3CDI A;  1QBJ A;  4KUM A;  2YPR A;  3S3N A;  3OL4 A;  2W85 A;  3SFI A;  2O8X A;  5B3S H;  1D1B A;  1J75 A;  1WI9 A;  3FXL A;  4NC7 A;  1Q1H A;  3HM5 A;  2MLG A;  1SFO J;  1IUY A;  4U7B A;  3BPV A;  3F8F A;  2VE9 A;  4XOR A;  1LDD A;  1T38 A;  2DMP A;  2B63 J;  3P9C A;  1ZK8 A;  3LSM A;  4X1E A;  4IJA A;  1CF7 A;  1XB4 A;  3KEO A;  3LA3 A;  4AM3 A;  1Y8Q B;  2JRM A;  4BKX A;  2KKO A;  3M7G A;  4CCJ A;  3AAF A;  3IH3 A;  2Y48 A;  1OCR H;  3BJ6 A;  4WXH A;  1ZR4 A;  3DTK A;  4BAY A;  1R1T A;  2FE3 A;  1XTA A;  4HYE A;  2MBF A;  5DEQ A;  4Z2Y A;  3CC2 I;  2KLO A;  1B4A A;  1I3A A;  3PIP F;  5F1R A;  3CMA I;  2EA4 A;  4KFC A;  2W24 A;  1B9N A;  3O6B B;  4F91 B;  2VN2 A;  3BR1 A;  3EYY A;  3ZOB A;  5EYR A;  2QQ9 A;  1FYK A;  2HWV A;  4G7O F;  2GXG A;  3HPH A;  5L3B A;  3HUG B;  4G7Z F;  4ENM A;  2CG4 A;  1HKS A;  2ZME A;  4BXF A;  2GXA A;  3I3L A;  4FE7 A;  2H09 A;  2VT3 A;  2L01 A;  1U78 A;  2MH9 A;  2ZJ2 A;  3BWG A;  2R7T A;  3GFJ A;  4CO8 A;  1QZY A;  5BMZ A;  4ZDP A;  3PUB A;  3K4N A;  4B1R A;  5DCF A;  3SZT A;  2M8G X;  4MEY F;  5M3M J;  3T1B A;  4I02 A;  1LNW A;  1QHG A;  5D5X B;  3E5U A;  2JUC A;  5LBQ A;  3HOY J;  4YEJ A;  3HRS A;  3U1K A;  5IT9 K;  1FYM A;  3OYF A;  3ZMV A;  3CCJ I;  2KZG A;  2EFQ A;  3RSN A;  4X6A J;  4XLE A;  2AHQ A;  2YR2 A;  3VWB A;  2ZCW A;  4Y52 J;  1VQ7 I;  2E1M B;  5DUI A;  4G6D A;  2KIU A;  3O3K A;  5IOZ A;  1KGS A;  2JA7 J;  1WI3 A;  3RYP A;  3R6S A;  4M6X A;  4CXF A;  1FZP B;  3AG4 H;  1OKR A;  2DA6 A;  4AD9 A;  1I3Q J;  2BVL A;  3OL3 A;  5FFZ A;  2IS6 A;  3QPL A;  1OCO H;  5DV5 A;  3BG9 A;  1VF9 A;  4IOA F;  3QPS A;  1JT0 A;  3RPU D;  5IT3 A;  2JSP A;  5LHG A;  2V1U A;  4F93 B;  3H5A A;  1JE8 A;  4XSZ F;  4RDU A;  1Z0X A;  5M3F J;  4CSW A;  4KYW A;  1VQ5 I;  4L9V A;  4IVN A;  3PQK A;  4U87 A;  4NBQ A;  4C3H J;  2MW8 A;  3BR3 A;  2X1E A;  3W2A A;  1FSE A;  3OR2 C;  4JX4 A;  2DPD A;  2F5D A;  4U0Y A;  1WPK A;  2VPL A;  1OR7 A;  4HNV A;  5K7H A;  2IS4 A;  3BZC A;  3OYA A;  4YIR X;  3EDP A;  4DBQ A;  3I59 A;  3GME A;  5ERI A;  4BYY A;  5F04 A;  4PUS A;  2W7N A;  2NYX A;  2YUS A;  2QGU A;  3DLA A;  3G1M A;  1RR7 A;  3JRI A;  3H3V K;  4DNC A;  1IG7 A;  1BA5 A;  1TW3 A;  1O57 A;  1HSJ A;  4L5E A;  2LD5 A;  1GXQ A;  1R58 A;  1Z21 A;  5JHU A;  4HF0 A;  2A5Y B;  3C2H A;  3GEZ A;  1YS7 A;  1IXR C;  1ERD A;  2E5Z A;  5DS9 A;  2P5L C;  3KIO A;  1E0E A;  1S9H A;  5JR3 A;  1M1E B;  1GT0 C;  4W1U A;  4H0E A;  3FXQ A;  5IOY A;  1ZHF A;  5IYB J;  5DM6 F;  1E3O C;  4HX4 A;  2H1K A;  3K4B A;  1E3H A;  5EGO A;  4A3L J;  3B6A A;  4XOP A;  2X85 A;  5FKO A;  4K2E A;  3UR3 C;  1LKX A;  4HZF A;  3ELK A;  4EQQ A;  5HNH A;  4E7I A;  1U8R A;  3CUQ C;  5M5X J;  2ICW G;  3HSE A;  1P2F A;  4WXD A;  2LDU A;  3ZMT A;  1HC8 A;  2M7B A;  3CC7 I;  3PIO F;  5CQE A;  2Y9Y A;  5FFX A;  5F27 A;  1ZAR A;  5GTI C;  3F6O A;  1U5T B;  5EG0 A;  2HVR A;  3COA C;  3HG9 A;  2ZME C;  1OCZ H;  5E8I A;  2VJJ A;  2NVU B;  2CV1 A;  2VJ4 A;  2W00 A;  2OQG A;  4AUX A;  2VQG A;  3CMY A;  3T5X A;  5F0F A;  5HOO A;  3ERE D;  1A04 A;  3GWZ A;  3AG3 H;  2KL4 A;  3J7Z I;  4DJA A;  1JTY A;  3FHZ A;  2QKM B;  1YE9 A;  3NWS A;  4RGS A;  1UST A;  3GLL A;  3ROU A;  3QAH A;  1UAA A;  3G73 A;  1ZG1 A;  2HPI A;  1G6N A;  2R7D A;  4YII A;  5A2Q Z;  3J81 Z;  2BEO A;  4ZDO A;  5DD8 A;  4LGW A;  3LSK A;  2LMD A;  3E5Q A;  2DYR H;  2K27 A;  3K4C A;  3K0L A;  3GTJ J;  4LLL A;  5E20 A;  2HQN A;  3R4K A;  1Y1W J;  3KYD B;  2JA6 J;  4BBR J;  1ZRF A;  2QQA A;  3GXO A;  4XM3 A;  2FJ1 A;  2C6Y A;  1BI1 A;  1A6Q A;  2XAF A;  2LKX A;  2P5K A;  3HYI A;  3LA2 A;  2EK5 A;  5HLT A;  3DPT A;  2MH2 A;  4U0V A;  2CU7 A;  5BPI A;  1D3Y A;  3C7J A;  4F7Z A;  3F6V A;  4QLC U;  1AKH B;  1K61 A;  1WHU A; 
#chains in the Genus database with same CATH homology
 5BQT A;  1XMK A;  5LEK A;  1MDM A;  2FNP A;  3M8E A;  2F5F A;  4AIH A;  3I5U A;  2YX4 A;  1J9I A;  3ZQ7 A;  3TO7 A;  3IWZ A;  2J5O A;  2HR3 A;  3MAJ A;  4OMZ A;  3ECH A;  1PUE E;  1LEA A;  2NAZ A;  1H9G A;  4N0B A;  4G6Q A;  1XCV A;  3ABT A;  1HQC A;  4FX0 A;  4O6J A;  2IRF G;  3R0J A;  2DPU A;  1BBY A;  4RAY A;  4IHS A;  2FEZ A;  2D45 A;  2PEX A;  3FMS A;  2BV6 A;  1J2X A;  4GGG A;  3WE3 A;  4HV5 A;  3SXY A;  1KU9 A;  1MD0 A;  1BOA A;  3V8L A;  3FWE A;  1D5V A;  1O7L A;  1IXS B;  4IPA A;  1Z7U A;  4KNY A;  4Q48 A;  3LAJ A;  2NRA C;  5DCM A;  2EFP A;  4G8X A;  3RKX A;  1FWZ A;  3ZMS A;  5DD4 A;  1XGM A;  1IW7 F;  1LJ9 A;  4ZYE A;  1SFE A;  5D5U B;  2QBY A;  1FP2 A;  3WGH A;  2UZK A;  4YFK F;  3DQV C;  3LQQ A;  4G9Y A;  3QU3 A;  5AIQ A;  4A0Z A;  4EVI A;  2FBI A;  2R3S A;  2H6C A;  2WTE A;  4YFN F;  2XAG A;  4IRH A;  3PFI A;  2G9W A;  2PFB A;  4WXC A;  2JSC A;  2VE8 A;  4FHT A;  3KCC A;  1ZLK A;  2HTJ A;  2VBY A;  1FP1 D;  2GZW A;  5K5R A;  3HSF A;  2V6C A;  4OOI A;  3WTY C;  4UNO A;  5D6E A;  3J81 K;  2LF8 A;  2XRN A;  1R23 A;  2IVM A;  3K2Z A;  1LQ1 A;  1UHM A;  1ON2 A;  3JSP A;  3DV8 A;  5HS8 A;  1T0F A;  3L9F A;  5CLS A;  1I1G A;  4DQ2 A;  1Z6T A;  2PN6 A;  3TOA A;  4Y15 A;  2D2W A;  2PQ8 A;  1CF7 B;  3W6K B;  1J59 A;  3IL2 A;  5E18 F;  3GUD A;  5KK1 A;  1FBS A;  1U3E M;  3I64 A;  3KZY A;  1D8K A;  5HLI A;  2M45 A;  3GLX A;  2VBW A;  5L3D A;  1SD7 A;  4PZJ A;  2HZT A;  3BZ6 A;  3I53 A;  5FLX Z;  2F5C A;  5ICG A;  1XGO A;  3CUQ B;  3MFK A;  1EH7 A;  2IA1 A;  3FM3 A;  2IP2 A;  2ZO4 A;  3L7W A;  5CVU A;  5FO5 A;  1REP C;  1R1U A;  1K7A A;  2ZME B;  4HBL A;  1FSH A;  2L4A A;  1IN4 A;  2A61 A;  4HLX A;  2XRO A;  2LNB A;  1L0O C;  3LST A;  5DDG A;  3S2W A;  3F8C A;  1RI7 A;  2FSW A;  3VOE A;  5H20 A;  2Z99 A;  2EB7 A;  2VC1 A;  4M73 A;  5HDG A;  1GVJ A;  3E3V A;  1ON1 A;  2G7H A;  1PP8 F;  3U1D A;  3G3Z A;  5AIP A;  5FD5 A;  1EH6 A;  1Z9C A;  3K9T A;  2DW4 A;  4HOB A;  3J7A O;  3R0A A;  3HTS B;  1WWX A;  1ZG3 A;  3QOP A;  3K1P A;  4GXO A;  4HX7 A;  2HOE A;  4WWC A;  2YU3 A;  3ECO A;  2E1N A;  3BJA A;  4HV6 A;  3KP5 A;  3BJO A;  4RGU A;  1SAX A;  1XGN A;  3TO6 A;  5AON A;  2FA5 A;  3E6M A;  2ACJ A;  4AIK A;  1MJ9 A;  4A0X A;  4ETS A;  4CYD A;  5CVR A;  2ESH A;  3SHF A;  2LF7 A;  4YG2 F;  4RB2 C;  1XSD A;  5LRR A;  2NNY A;  3I59 B;  3F21 A;  1EH8 A;  2E1C A;  1D8J A;  3LAP A;  1R36 A;  3PQJ A;  1ZRE A;  4MQ9 F;  1T98 A;  4FX4 A;  4MHG A;  2VC0 A;  5L3F A;  4IRI A;  1WKM A;  3GZ5 A;  2HKO A;  3T8T A;  3VOD A;  3L2C A;  4ZYH A;  1CGP A;  3D0S A;  2OD5 A;  4KA4 A;  1QGP A;  1DPU A;  4U88 A;  1LDJ A;  3WTV C;  4RGX A;  4GYI A;  3IKT A;  4LG0 A;  4A0Y A;  4P55 A;  1FBQ A;  4ESJ A;  1IRF A;  4ON0 A;  1HW2 A;  3RYR A;  4ZZD A;  1S7A A;  1YW8 A;  4YFX F;  3V7R A;  2FXA A;  3E6C C;  1Z05 A;  5K5Q A;  2L54 A;  2Q8K A;  5LRS A;  3LA7 A;  2KRF A;  4BHP A;  4I09 A;  2EFO A;  1BI2 A;  3WGI A;  1BN5 A;  2DU9 A;  2XKP A;  1RUN A;  1XMA A;  2DO7 A;  3V7S A;  3VB2 A;  2K86 A;  4B09 A;  4BH9 A;  5ICE A;  2EA2 A;  2QVO A;  3CUQ A;  2GA1 A;  4IXA A;  1B59 A;  3EET A;  3P7N A;  2Z5U A;  3MQ0 A;  1MDM B;  4IF4 A;  5BS6 A;  2CFX A;  3ZMD A;  4XBF A;  2QZ8 A;  4JQF A;  5DUK A;  5E1W A;  2RQP A;  3GZ6 A;  1VTN C;  3KET A;  2HGC A;  4OIQ F;  3T0Y A;  4UVC A;  1I1S A;  1HW1 A;  5HS9 A;  3BPX A;  3K1M A;  4I01 A;  2HDC A;  2DK5 A;  3CTA A;  2JRT A;  1TQP A;  3C18 A;  3FMQ A;  3OV8 A;  2WV0 A;  1J7K A;  3CDH A;  1ULY A;  5H6R A;  4KN7 X;  2ESN A;  2DLL A;  3TQN A;  2XGX A;  3KP4 A;  3GFL A;  1SMY F;  2V9V A;  3TDZ C;  3IHU A;  2XKO A;  2ISZ A;  2QQB A;  4XLN F;  2HEO A;  4CIC A;  5J8C A;  5DCM B;  5D5W B;  2P8T A;  1FX7 A;  3B02 A;  1ZH5 A;  4KDP A;  1FBU A;  1BIA A;  4A6D A;  3E97 A;  2CYY A;  4A6E A;  3GVA A;  1RUO A;  4EJW A;  2QBY B;  3RJP A;  4L9J A;  2M30 A;  4M6Y A;  3BOQ A;  4M74 A;  3JAM Z;  5L3G A;  3U2R A;  4PCQ A;  3E5X A;  2V1X A;  2H94 A;  3WTW C;  5D4S A;  1X3U A;  4EM0 B;  1MJA A;  2PMU A;  1MGT A;  4KIB A;  1XN7 A;  1TNS A;  3TOB A;  2P4W A;  3T8R A;  1GXP A;  2Z9O A;  3L09 A;  1K6O A;  1HST A;  5JI6 A;  1G3Y A;  3LFK A;  4KIG A;  2A69 F;  3HOT A;  3GFM A;  2J5P A;  4LB6 B;  4RB1 A;  3WOD F;  1UHW A;  1PDN C;  1YTY A;  2OZU A;  2FU4 A;  4BHB A;  2TDX A;  4EM2 A;  1IRG A;  5L3E A;  2IJL A;  4HF1 A;  2RKH A;  3FXU A;  1F9N A;  4IHT A;  2XAS A;  2YX7 A;  4I98 B;  2R7F A;  3RKW A;  1LB2 A;  1Z6R A;  4OU0 A;  3ZP5 A;  3ZPL A;  1W5T A;  2AS5 F;  2EV5 A;  2QLZ A;  4EM1 A;  5LGT A;  3FMR A;  4KN4 X;  2BBY A;  4HW0 A;  1BI0 A;  1KQ9 A;  2MA3 A;  3NRV A;  1SFX A;  2GA2 A;  4FT8 A;  4P9F A;  1I6X A;  2K02 A;  2NS0 A;  3F3X A;  5D6F A;  1IF1 A;  1V4R A;  3QP5 A;  3EYI A;  1Z91 A;  1UB9 A;  2A3S A;  2V1D A;  2XAJ A;  1STZ A;  4I7H A;  3QPH A;  5E1X A;  5D4R A;  3J80 Z;  4A12 A;  3V8K A;  1FLI A;  2QUF A;  3FXR A;  1I27 A;  2P7C B;  2OA4 A;  3JAM K;  2EV0 A;  2XHK A;  1LVA A;  4RB0 A;  2RN7 A;  3IWF A;  4LFU A;  1TLH B;  4I2O A;  4B8X A;  2KIM A;  1G3W A;  1JHH A;  2JZY A;  1BM9 A;  2GWR A;  4MQV A;  5ICF A;  2Q0O A;  2EWN A;  4AVP A;  4ZYD A;  1C0W A;  3NEU A;  4ZYG A;  4NB5 A;  4MGR A;  3KFW X;  1S3J A;  1U2W A;  2CQK A;  3H3U A;  4HLY A;  1Z1D A;  1FC3 A;  2ZNY A;  4EJU A;  2CGP A;  1WSU A;  4RS8 A;  1XD7 A;  2FBK A;  4LG0 B;  5A2Q K;  4CGZ A;  3ULQ B;  2D1V A;  1EV7 A;  1S7O A;  1P4A A;  3IRQ A;  2E7W A;  1ZLJ A;  1YFH A;  5HDN A;  2CW0 F;  2QM3 A;  1S8N A;  4RB3 C;  3SZP A;  3F8N A;  2W84 A;  5HLH A;  4LD5 A;  2FF4 A;  3WTS C;  4O3M A;  3FZV A;  3JTG A;  4EJT A;  4P96 A;  3E6D A;  3Q9V A;  4UV9 A;  3MWM A;  2FOK A;  1KQ8 A;  3CO6 C;  3ZN0 A;  2FRH A;  3ZMU A;  3JSO A;  4MNU A;  3KP3 A;  1IN5 A;  4LJZ F;  3E6B A;  4HQM A;  2DBB A;  2PLY A;  4YIF A;  4LMY A;  2QWW A;  1TQM A;  1IN6 A;  2MLK A;  3O2P E;  5L3C A;  3CJN A;  3KLO A;  5FGM A;  2OAZ A;  1SMT A;  3ML6 A;  4O5V A;  1YW9 A;  3F72 A;  3ISP A;  2XAQ A;  2EJR A;  2MD5 A;  2HFH A;  1W7P A;  5LLQ A;  1QQI A;  1ZGJ A;  2D1H A;  1U6G A;  3J80 K;  5K5O A;  4UUV A;  3I0T A;  4PGH A;  5H6Q A;  1G4D A;  2STW A;  2GAU A;  4HX8 A;  2A68 F;  2PJP A;  1KU3 A;  1R22 A;  5J6X A;  3QRF F;  3M8F A;  3KEQ A;  5LEJ A;  1TBX A;  3I58 A;  1P4W A;  4G94 A;  1OYY A;  4LB5 A;  2KIF A;  3WE2 A;  1IAW A;  4Y17 A;  2O6G E;  1XDU A;  4AWX B;  2JPC A;  2XUB A;  1YG2 A;  2VBX A;  1JHF A;  4M9X A;  2B0L A;  2CSO A;  3HRM A;  1V3F A;  1I5Z A;  4G7H F;  1BC7 C;  2CWE A;  2HYF A;  3GF2 A;  3OOP A;  4M9Z A;  2GXB A;  1WQ2 A;  1B6A A;  4LK0 F;  2RGV A;  4LK1 F;  4XSX F;  2IT0 A;  3JW4 A;  3F23 A;  3BDD A;  1R5G A;  2MC3 A;  2W57 A;  3VEP A;  3R60 A;  4IRG A;  4BNC A;  3CUO A;  2L3D A;  2NNN A;  5LGN A;  1IN8 A;  1DDN A;  3WU0 A;  2JPB A;  1RNL A;  2VON A;  1QPM A;  2OU2 A;  2Y75 A;  3RTR A;  3ZN1 A;  3F22 A;  4CHU A;  4ENK A;  3ABU A;  2BGC A;  2HQR A;  2DFI A;  2Z3Y A;  2BYV E;  3D5L A;  3DEU A;  3HHH A;  3R61 A;  3GO5 A;  4EGZ A;  1LDK B;  1YS6 A;  2RV8 A;  3EQL F;  1R7J A;  5FLX K;  2HS5 A;  2VOD A;  2OZ6 A;  1E2X A;  3EUH A;  4A2U A;  4WCG A;  3C3W A;  3CO7 C;  4P9U A;  3W6J B;  5JFR A;  4BXU A;  2DAO A;  2DT5 A;  1BIB A;  4L0Z B;  4GCV A;  4HA8 A;  2EFN A;  2ZNZ A;  2ZXJ A;  2Y0M A;  3H3Z A;  4ESB A;  3REO A;  3DFG A;  2XIG A;  3RI4 A;  1HKQ A;  2BE5 F;  2XV4 S;  5CVI A;  1FY7 A;  2P5V A;  4Y13 A;  1PP7 U;  1YYV A;  1ZGA A;  5E1Z B;  1H0M A;  1HW5 A;  5LHI A;  1NHA A;  1KYW A;  4ENN A;  1YLF A;  4PGG A;  3FM5 A;  1K78 A;  2EV6 A;  2GQQ A;  2HYG D;  4R8H A;  1MZB A;  4UV8 A;  3VFZ A;  4L5J A;  1USS A;  1FPQ A;  1O3T A;  2GIV A;  2O3F A;  5BPD A;  3TKY A;  4M72 A;  3HSR A;  4L9N A;  1HBX G;  1ZN2 A;  4JBA A;  1JXS A;  2IA2 A;  3WGG A;  5FD6 A;  1J0R A;  5KVR A;  2CO5 A;  3DPL C;  5BOX A;  1YIO A;  2K7L A;  3V4G A;  1TNT A;  2LKP A;  1SD5 A;  1P6R A;  4EV0 A;  1OPC A;  1F1Z A;  4AIJ A;  5ILU A;  4S05 A;  3MCZ A;  2H27 A;  4S04 A;  4R79 A;  5K1Y A;  2P7V B;  5F6F A;  4Q47 A;  3HHG A;  1R5H A;  4KMF A;  2M8E A;  5HLG A;  2PI0 A;  5LGU A;  4U7D A;  2M5W A;  5HS7 A;  4ZZL A;  3K1N A;  3V7C A;  2KJB A;  1R00 A;  1XCB A;  1HXD A;  1LEB A;  2VBZ A;  3HIF A;  1AWC A;  1J5Y A;  4A5N A;  2Q2E A;  1W7P D;  1MKM A;  3GFI A;  1O3S A;  1W5S A;  2P6T A;  1YQA A;  4I0B A;  4R1H A;  4GO1 A;  1ONV A;  4N9I A;  4WF2 A;  3WTT C;  2QEN A;  3I71 A;  3HRT A;  2VXZ A;  1KA8 A;  2A07 F;  2O03 A;  4BHC A;  4GYG A;  4M9S A;  3HRU A;  4E70 A;  3WU1 B;  3IRR A;  2YSR A;  4UVB A;  5FB2 A;  4TV7 A;  2H6B A;  3MZY A;  2PBI A;  2ETH A;  1ZAO A;  2ZKZ A;  4OIN F;  1SFU A;  3SQN A;  3GYH X;  5ILV A;  2FQ3 A;  3HOS A;  4WK8 F;  4EJO A;  2K4J A;  4XLP F;  4OMY A;  2ZFW A;  3KP7 A;  1MJB A;  4D0P A;  4JK1 X;  4I0A A;  1FT9 A;  3B73 A;  3I54 A;  3DKW A;  5HVQ C;  1DP7 P;  4MTE A;  5DYM A;  2PMH A;  5JVT A;  3DXJ F;  4LLG F;  1KQ0 A;  1XGS A;  2V79 A;  3GX4 X;  3RIR A;  5D8K B;  2QYO A;  2ISY A;  3RKY A;  1BJA A;  4OIO F;  3GW2 A;  1P4X A;  3HUG A;  3QP6 A;  1UFM A;  2HTS A;  2DQL A;  2P6S A;  2ZBK A;  1W7P B;  1FYL A;  4HQE A;  2DI3 A;  2DTR A;  1B9M A;  1XSX A;  2VOP A;  1Y0U A;  5J8F A;  4ESF A;  5EEG A;  1OYW A;  1KU7 A;  1OMI A;  2IW5 A;  3RPQ A;  2A6E F;  3CLO A;  3L00 A;  3KZZ A;  3M1E A;  3TGN A;  2A6H F;  4BQA A;  3QU6 A;  2G7U A;  1RZ4 A;  4QWQ A;  4HDV A;  3BRO A;  3H92 A;  4L9T A;  1QNT A;  1P92 A;  3BY6 A;  3M9A A;  1DPR A;  3MZH A;  4UVA A;  2OQR A;  4PDK A;  3TDU C;  3DF8 A;  5TJJ A;  4ENJ A;  1O3R A;  4KIF A;  4NHJ A;  4ZH4 F;  3KLN A;  2O61 A;  1ZRC A;  5CJ9 A;  1ZYR F;  5F64 A;  4UXN A;  3ZMZ A;  3F8M A;  4L5I A;  3NQO A;  4EJV A;  4MEX F;  1HKT A;  1WRJ A;  2HKX A;  4L0Y B;  3P9I A;  2L02 A;  2W25 A;  3MEX A;  4HF2 A;  1TTY A;  1YO5 C;  1ODD A;  5CYV A;  3U9G A;  3I4P A;  1AOY A;  1XSV A;  1U5T A;  2WC2 A;  4NQW A;  4CDG A;  5D8L B;  2UWM A;  2RC4 A;  1SD6 A;  1ZG5 A;  1TQI A;  1KYZ A;  4N9H A;  4UHT A;  1G3S A;  1T6S A;  1B1B A;  4KT5 C;  5E8G A;  4RGR A;  4ASN A;  1FNN A;  4LLN A;  1FOK A;  2FNA A;  2X0L A;  1T39 A;  4MTD A;  1BC8 C;  1IN7 A;  1OYI A;  1QZZ A;  3KP6 A;  3Q5F A;  1UCR A;  2DK8 A;  3TO9 A;  4CZZ A;  2XVC A;  1S6L A;  4XRF A;  4KIC A;  5ED4 A;  1BI3 A;  1KU2 A;  2WWY A;  2PG4 A;  3RPU A;  4EMS A;  5EEH A;  3QPT A;  1H9T A;  2FMY A;  2UXN A;  1R1V A;  5HDK A;  2VOO A;  2L4M A;  4Q5S F;  2IPQ X;  2O0Y A;  4EGY A;  4U0W A;  1T2K A;  1YW7 A;  2F2E A;  3HTU A;  3JTH A;  2DQR A;  4RAZ A;  5E17 F;  2KJC A;  3WTZ A;  1K79 A;  3C1D A;  2M87 A;  3Q9S A;  1K78 B;  1O3Q A;  2X4H A;  1S29 A;  3IKV A;  4M71 A;  2RVC A;  3N4M A;  2Z33 A;  3WG9 A;  3IC7 A;  1O7F A;  3RDI A;  3N97 A;  5CVJ A;  2XAH A;  3LQR A;  2FML A;  1QO0 D;  1L3L A;  3WTU C;  2JT1 A;  1DUX C;  5TRD A;  4OIP F;  1JGS A;  4Q4Z F;  1GHC A;  2AXL A;  3K69 A;  4OIR F;  5IT9 Z;  2COM A;  5ICC A;  3BP8 A;  2OBP A;  3DP7 A;  5D5V B;  3F8B A;  4HAM A;  3KE2 A;  1U5T C;  2M1B A;  2K4B A;  3LWF A;  1TW2 A;  5CVV A;  3FF5 A;  2LSO A;  4P5O A;  2ADU A;  5LHH A;  3FX3 A;  4WX9 A;  2RDP A;  2RNJ A;  2VT2 A;  1RIO H;  2F5E A;  1IZ1 A;  2UXX A;  1SD4 A;  1G3T A;  2E7X A;  1E17 A;  1XDS A;  1W4M A;  4L18 B;  2ELH A;  2IA0 A;  3WTX C;  2STT A;  6PAX A;  2JTV A;  3V8J A;  3KP2 A;  4A5M A;  1F4K A;  1F5T A;  4KMU X;  3P9K A;  5ILS A;  3SFZ A;  2FBH A;  4HDU A;  1IXC A;  2EFW A;  1ZRD A;  1QBJ A;  4KUM A;  2YPR A;  2W85 A;  2O8X A;  1J75 A;  1WI9 A;  1Q1H A;  2MLG A;  1IUY A;  4U7B A;  3BPV A;  3F8F A;  2VE9 A;  1LDD A;  1T38 A;  3P9C A;  4IJA A;  1CF7 A;  1XB4 A;  3KEO A;  3LA3 A;  2KKO A;  3M7G A;  3AAF A;  2Y48 A;  3BJ6 A;  4WXH A;  4BAY A;  1R1T A;  2FE3 A;  4HYE A;  2MBF A;  5DEQ A;  4Z2Y A;  1B4A A;  5F1R A;  2EA4 A;  4KFC A;  2W24 A;  1B9N A;  3O6B B;  2VN2 A;  3EYY A;  2QQ9 A;  1FYK A;  2HWV A;  4G7O F;  2GXG A;  5L3B A;  4ENM A;  4G7Z F;  2CG4 A;  1HKS A;  2ZME A;  2H09 A;  2VT3 A;  2L01 A;  1U78 A;  2MH9 A;  2ZJ2 A;  3BWG A;  3GFJ A;  4CO8 A;  1QZY A;  5BMZ A;  5DCF A;  3SZT A;  4MEY F;  3T1B A;  4I02 A;  1LNW A;  5D5X B;  5LBQ A;  3E5U A;  3HRS A;  5IT9 K;  1FYM A;  3ZMV A;  2EFQ A;  2YR2 A;  2ZCW A;  5DUI A;  4G6D A;  2KIU A;  3O3K A;  1KGS A;  3RYP A;  3R6S A;  4CXF A;  4M6X A;  1FZP B;  1OKR A;  4AD9 A;  5FFZ A;  5DV5 A;  5IT3 A;  5LHG A;  2V1U A;  1JE8 A;  4XSZ F;  4KYW A;  4L9V A;  4IVN A;  3PQK A;  1FSE A;  2DPD A;  2F5D A;  4U0Y A;  1OR7 A;  3EDP A;  3I59 A;  5ERI A;  4BYY A;  2NYX A;  4DNC A;  1TW3 A;  1O57 A;  1HSJ A;  1GXQ A;  1R58 A;  5JHU A;  4HF0 A;  2A5Y B;  3GEZ A;  1YS7 A;  1IXR C;  2P5L C;  5JR3 A;  4H0E A;  3FXQ A;  1ZHF A;  4HX4 A;  4K2E A;  4HZF A;  3ELK A;  4EQQ A;  1U8R A;  3CUQ C;  3HSE A;  1P2F A;  4WXD A;  2LDU A;  3ZMT A;  5FFX A;  1ZAR A;  3F6O A;  1U5T B;  3COA C;  5E8I A;  2OQG A;  3T5X A;  5HOO A;  3ERE D;  1A04 A;  3GWZ A;  3FHZ A;  4RGS A;  1UST A;  3ROU A;  3QAH A;  3G73 A;  1ZG1 A;  4YII A;  1G6N A;  2R7D A;  5A2Q Z;  3J81 Z;  2BEO A;  5DD8 A;  4LGW A;  3E5Q A;  2K27 A;  3K0L A;  4LLL A;  5E20 A;  2HQN A;  3R4K A;  1ZRF A;  2QQA A;  3GXO A;  2C6Y A;  1BI1 A;  2XAF A;  2P5K A;  3HYI A;  3LA2 A;  2EK5 A;  3DPT A;  2MH2 A;  4U0V A;  5BPI A;  1D3Y A;  3C7J A;  4F7Z A;  3F6V A;  4QLC U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...