2CQKA

Solution structure of the la domain of c-mpl binding protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
GSSGSSGAVSTEDLKECLKKQLEFCFSRENLSKDLYLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-Mpl binding protein
publication title Solution structure of the La domain of c-Mpl binding protein
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2cqkA00
1AOYA 3EUHA 5E20A 5HLIA 4ZH4F 5D5XB 1MKMA 3O2PE 3R4KA 5KK1A 3CO6C 4S04A 3ELKA 2Z33A 5DV5A 3Q5FA 2MLKA 2W57A 2YR2A 2HZTA 4HX8A 4ENMA 4XRFA 1I5ZA 1U3EM 3TDZC 3D0SA 5FLXZ 3V8JA 3KP5A 1FOKA 4OIQF 4ENKA 4KIBA 1HQCA 4XSZF 3GF2A 3HTUA 1SMYF 3F8CA 1ZAOA 2QM3A 2HYFA 2BEOA 3TOBA 3KP2A 3J80Z 1HKSA 1PP8F 1R36A 4Z2YA 2WV0A 1YW9A 3T0YA 3M8FA 2P4WA 5DCFA 2BBYA 4Q4ZF 4A5MA 1IAWA 1IUYA 2HWVA 2VOPA 1O3QA 1HW1A 4NHJA 3T8RA 2QLZA 1OYWA 1I1GA 2F5DA 1W7PD 2LKPA 1ZYRF 4U0VA 3AAFA 4RS8A 4AIJA 3KE2A 1J75A 1J9IA 4BNCA 4EVIA 3J7AO 1BIAA 4KMUX 3L9FA 2IRFG 3ZN0A 3FM5A 3FM3A 1XD7A 3WTXC 3K1MA 3MZYA 4CICA 3FXRA 5CJ9A 2O8XA 4MTDA 4ENJA 4L0YB 2PQ8A 4D0PA 4AIHA 5E1WA 2X4HA 2FA5A 1SFEA 3PQJA 4I02A 4Q48A 4GO1A 1YO5C 1FBUA 4P9UA 5ILVA 2PG4A 3CTAA 3QU3A 2MC3A 2C6YA 2JRTA 3WTYC 1PDNC 1YYVA 3HHGA 2PBIA 2UWMA 4UV9A 5CYVA 3E5QA 3IRQA 4YFKF 2ISYA 2D45A 2LF8A 4UHTA 1MJAA 4BAYA 1USSA 4ESJA 2P8TA 3WODF 4CGZA 1FSHA 3LFKA 4HX4A 3O6BB 1H0MA 3IHUA 4BHPA 3GFIA 3MQ0A 5J8CA 1FPQA 3WGGA 4PCQA 4OOIA 1J7KA 3L09A 1TLHB 1ZG3A 1T38A 3FF5A 1MDMA 3RKYA 3RKWA 1BI0A 2ZMEB 3ZMDA 2GIVA 2UZKA 3L00A 4ZYGA 3TKYA 3H92A 3ZQ7A 4RB2C 2VBXA 2G7HA 1RI7A 2VBYA 2NRAC 1ZHFA 2XRNA 5CVRA 5E17F 1R1VA 2P6SA 1CF7B 2CG4A 2FBIA 1FZPB 5L3DA 5JFRA 5LRSA 2VXZA 2LNBA 1O3TA 4E70A 4G6DA 1FP1D 4A0ZA 5K5RA 3OOPA 2BE5F 3I59A 4EJWA 2L4MA 3RYPA 2V1UA 3K1NA 2FEZA 4MQVA 1RUOA 4PDKA 1D3YA 1ZLKA 4EGZA 3DPLC 1L0OC 3IWFA 5DDGA 4UNOA 3CLOA 3BDDA 3I58A 2K02A 1ZRDA 1XCVA 1TQIA 1R00A 2OBPA 4MEXF 3ULQB 2LF7A 5HS8A 4ZYHA 1IZ1A 3J80K 5D5UB 3RI4A 2QQAA 2CGPA 3NEUA 2DLLA 3MZHA 1D8JA 5FFXA 3DP7A 2YX4A 2IW5A 3CUQB 2B0LA 1LB2A 1KA8A 3RKXA 1QNTA 3E3VA 4HLXA 3F23A 2E7WA 3WTUC 2FRHA 2QQBA 3L7WA 3W6JB 2RDPA 1HSTA 2RV8A 1FYLA 1FY7A 4M6XA 4KFCA 3FMRA 3JAMZ 5J6XA 3R60A 3WG9A 5F1RA 2GA1A 4A6DA 1P4AA 4RGSA 4UVBA 1ZREA 5FB2A 3KZZA 3RTRA 2F5FA 1IN4A 2D1HA 4RB3C 4CYDA 3LQRA 2M45A 1U2WA 1P4XA 3WGHA 4M73A 4CXFA 4IRIA 3I54A 1J0RA 4KIGA 1QPMA 3KCCA 4CO8A 1KYWA 1MJBA 1JHHA 1KU9A 4L0ZB 2DI3A 1G3SA 4U0WA 4BHBA 3FXQA 4IJAA 4IF4A 3V7SA 1E17A 2XHKA 4UUVA 3F8NA 3EYIA 1OYIA 5BPIA 1BOAA 4LGWA 3TDUC 5L3CA 2XASA 1AWCA 1LEBA 2FBHA 4KIFA 3LA7A 4EM0B 2D2WA 1ZLJA 2M87A 4EJUA 4LG0B 4WX9A 1R1UA 2XVCA 3JSPA 2L01A 2OZUA 2ZKZA 4I7HA 3F72A 4BHCA 3F8BA 2EFQA 2ADUA 2H94A 4B8XA 5F64A 2H27A 3HRSA 1TNSA 1MDMB 2L02A 4XBFA 3QRFF 2FE3A 4MEYF 1GXPA 3R6SA 5IT3A 1KU2A 3PQKA 2LDUA 3HTSB 5BQTA 3E5XA 2ESNA 2STTA 4I2OA 1KU3A 1G4DA 1UFMA 5JR3A 1O57A 4P96A 1ZGJA 2JSCA 3I64A 2KIFA 2A6EF 1BI3A 2ZFWA 1IXSB 2ETHA 3RYRA 5FO5A 4BH9A 3V7RA 2HTJA 4WCGA 3BY6A 5DUKA 4FHTA 2HKOA 3QU6A 4P9FA 2FU4A 3ZP5A 5JVTA 3REOA 1XDUA 4K2EA 4MNUA 2NNNA 2CYYA 4R79A 1Y0UA 3WTTC 2VBWA 2DFIA 1Z6RA 5LLQA 3MAJA 2RQPA 5FGMA 3WTWC 2R7FA 3H3UA 4HF2A 2E7XA 2EJRA 4GYGA 2CSOA 1BN5A 3FMQA 1YS6A 2VC1A 3I71A 1I6XA 4M74A 5JI6A 1U6GA 4U7BA 4GXOA 4CDGA 1FBQA 1LJ9A 3MCZA 1TW3A 3WU1B 1IXCA 1XMAA 1G6NA 4YG2F 1W4MA 5CVJA 1D5VA 1I1SA 1CF7A 5H6QA 3HUGA 3C1DA 1WI9A 2HDCA 1S8NA 2A61A 1TBXA 3PFIA 4YIFA 2Y75A 1U5TB 2Z3YA 1RZ4A 1G3YA 4YIIA 3BJ6A 4ETSA 4M71A 1XCBA 1P92A 5FD5A 4OINF 4EQQA 3KP7A 1S7OA 5LBQA 2M5WA 3KETA 4HBLA 1XSDA 5FFZA 5L3BA 3K9TA 2RC4A 5BMZA 3HOSA 2FBKA 3ZPLA 1O3RA 3DV8A 5CVUA 3KP3A 5JHUA 3E97A 4M72A 1BJAA 1SFUA 4HQMA 1HBXG 4ZYEA 1W7PB 2DO7A 3CUQA 1ZN2A 1P6RA 1YW7A 4N9HA 4L9NA 3LA3A 1YG2A 2K27A 3SHFA 3QP5A 4KT5C 2HEOA 1B1BA 2EWNA 1KU7A 2QBYA 3FMSA 4MQ9F 2FMLA 1RUNA 1DPUA 1B4AA 2FXAA 2W85A 2BGCA 2IJLA 1ZRCA 3HRTA 3BJOA 3LWFA 5BS6A 1ZGAA 3U1DA 3GXOA 1S3JA 2V9VA 5D5WB 2PEXA 1DP7P 1KQ8A 4G94A 4EM2A 1STZA 1RIOH 2Y0MA 3JTGA 2HQRA 4KMFA 4UV8A 3RPUA 3LAJA 3K1PA 2V1DA 5K5OA 2IA0A 3B73A 2XGXA 4LK1F 4M9SA 2OQRA 4OMZA 4PZJA 2GWRA 3T8TA 4EJVA 5HOOA 1FBSA 1BC8C 5HVQC 1BIBA 2JT1A 3ZMZA 5IT9K 1ONVA 3WE3A 2CFXA 2P5LC 2A69F 4UXNA 1HKTA 4LG0A 2P7CB 4G7ZF 3GZ5A 2ZNZA 2MD5A 4L9VA 2BYVE 3WE2A 2HFHA 1FT9A 1R23A 2VT2A 2QZ8A 3N97A 2MBFA 4EJOA 3WU0A 4HV6A 4AVPA 1B9NA 1OMIA 5BOXA 3C3WA 5LHIA 5FD6A 3LAPA 2Q0OA 3LA2A 3KEOA 1L3LA 1IF1A 3GLXA 3P9CA 3GFJA 1XSXA 5CLSA 2UXXA 2KIMA 3EQLF 1Z9CA 3I53A 3I4PA 1F1ZA 2DK5A 3QOPA 4AIKA 2M30A 4H0EA 2EFNA 1F9NA 5CVVA 2F2EA 4WXHA 3N4MA 3VFZA 1SMTA 3TOAA 1TQMA 3BOQA 1BI2A 2F5EA 3HSFA 2ACJA 2XAJA 4RAZA 1PP7U 2NYXA 1K7AA 5FLXK 3CJNA 3GEZA 2H6BA 5A2QZ 4RGUA 1FYKA 4IXAA 1DDNA 3VODA 3QAHA 1KQ9A 4A5NA 2EV5A 4IPAA 3C7JA 3VB2A 2EK5A 4WWCA 3M8EA 2EFPA 1IW7F 5HLHA 2EA2A 1XN7A 2DK8A 4LK0F 2V79A 2M8EA 2MH2A 2NS0A 1ON1A 2HR3A 2ZJ2A 3LQQA 1QZZA 3GW2A 1GHCA 1GVJA 4I01A 1EH6A 1XDSA 2FF4A 1SFXA 2EV6A 3BPVA 1UB9A 2FMYA 1J5YA 3CUOA 1U8RA 2CO5A 3I5UA 5D8LB 4O3MA 4LJZF 3FHZA 2OZ6A 4KUMA 4JBAA 3RJPA 3QPTA 2HGCA 5E1ZB 1LEAA 4I0BA 3CDHA 1IRGA 1O3SA 2DAOA 2ZO4A 2QBYB 3FX3A 1U5TA 3GWZA 1SD4A 2GQQA 3E6CC 3F21A 3SZPA 4XSXF 5E18F 2YU3A 1J59A 3SZTA 3J81Z 3HSEA 4BXUA 4NQWA 4A0YA 5DD8A 5D6EA 1T2KA 3KP4A 2A6HF 3OV8A 1HW2A 3BJAA 1JXSA 4HDVA 2E1CA 1ZG1A 2ISZA 1S7AA 3HSRA 2X0LA 4HOBA 1NHAA 4WK8F 3V4GA 1XB4A 4FX0A 4HF1A 1S29A 3BROA 2YSRA 2L54A 2V6CA 4CHUA 1TQPA 1W7PA 1Q1HA 3TO7A 3KLNA 2V1XA 2EA4A 1Z91A 2HS5A 1MJ9A 4LD5A 4Y15A 2HTSA 1OKRA 3K0LA 3IWZA 1WSUA 3Q9SA 5TJJA 3DEUA 4IRGA 2GA2A 2GAUA 3ROUA 2OU2A 2BV6A 5D5VB 2A07F 1T98A 4EGYA 2Q2EA 4OIPF 2HQNA 4RB0A 5HS9A 5DYMA 1BM9A 3FWEA 3WTSC 2K86A 1DUXC 2WTEA 1D8KA 4JK1X 1ULYA 4MTEA 3P9IA 1IN5A 1YTYA 1SD5A 5LHHA 1X3UA 1C0WA 1KQ0A 2IP2A 3P7NA 2DPDA 4Y17A 4BYYA 3TGNA 3M7GA 2YPRA 4BQAA 3WGIA 2J5OA 1FX7A 1H9TA 4ZZDA 3QPHA 4NB5A 4I0AA 2M1BA 2Y48A 2HOEA 3R61A 4HA8A 4L9JA 3VOEA 3SFZA 4IHSA 1ZH5A 5EEHA 2P5KA 1P4WA 2W25A 2KJBA 1O7FA 5D4SA 2G7UA 1LDKB 5A2QK 4I09A 2IPQX 1XMKA 4GGGA 2Z99A 3ABUA 1JGSA 5D8KB 5LGNA 2DBBA 2FSWA 4IRHA 2Z5UA 5D4RA 1A04A 2H09A 3NQOA 2H6CA 1WQ2A 3K69A 3C18A 1U5TC 1P2FA 2COMA 5KVRA 4A0XA 2VONA 3EETA 1USTA 2P6TA 5HDKA 1SAXA 2GZWA 2O03A 2Q8KA 4KDPA 2MA3A 4N9IA 1MZBA 2VE9A 1LVAA 3IC7A 2WWYA 2KKOA 5DCMB 4GYIA 3E5UA 2ZNYA 4GCVA 3P9KA 2A68F 3ERED 4UVAA 3I0TA 4IVNA 5DD4A 3F22A 5AIQA 2Z9OA 3JAMK 2QYOA 3GVAA 2CW0F 4M9ZA 1FSEA 4I98B 3SQNA 2P7VB 2O3FA 4FT8A 3J81K 1UHMA 1R58A 4R1HA 1J2XA 2PN6A 5ICFA 2OA4A 4KA4A 4U88A 3JSOA 3JTHA 5K5QA 2AS5F 1XGOA 3DXJF 1Z7UA 3WTZA 2RNJA 2STWA 2KIUA 4Q47A 1HKQA 1QO0D 4EM1A 2HKXA 1Z6TA 4P55A 2FNAA 1B9MA 3GZ6A 5E1XA 4KN7X 3TO9A 2IA1A 5ILSA 2A3SA 2DW4A 6PAXA 4AWXB 2XROA 1ZRFA 4MGRA 5EEGA 4Y13A 2LSOA 3ML6A 2MH9A 3MWMA 2PJPA 1WWXA 3RPQA 2A5YB 2EFOA 4LFUA 3U2RA 3SXYA 2K4JA 3IKVA 2VT3A 2IVMA 4S05A 3HRUA 5E8GA 4LLNA 4KNYA 1WRJA 1ODDA 4B09A 1YIOA 2VBZA 3TO6A 2VE8A 5HDGA 5LEJA 1WKMA 4LLGF 3HRMA 4ON0A 1FNNA 4HDUA 1QBJA 2PLYA 4A6EA 2ZBKA 4HZFA 2E1NA 4KYWA 4HAMA 5LRRA 2WC2A 2DT5A 1T39A 3O3KA 2RGVA 2D1VA 2KRFA 5AIPA 3ZMTA 1LDDA 5ILUA 2GXGA 3BZ6A 2OAZA 3KEQA 1JE8A 4WF2A 4R8HA 4UVCA 2IT0A 3K2ZA 1FWZA 1YLFA 5ICGA 2DQRA 3G73A 3R0AA 3ECOA 3L2CA 4U0YA 1G3TA 2KJCA 4L18B 3RIRA 3F6OA 2ZCWA 1OPCA 3TQNA 1FLIA 4ESBA 2CWEA 1K79A 2JZYA 1U78A 2O0YA 3KZYA 1ZG5A 1TTYA 1H9GA 3EDPA 4A2UA 4LB6B 1T0FA 4L5IA 1SD6A 2QUFA 1EV7A 1TW2A 5LGTA 3V8LA 2EFWA 2DQLA 1UHWA 3D5LA 2XV4S 2RVCA 3T1BA 5LGUA 1R7JA 1JHFA 3COAC 3H3ZA 2IA2A 1UCRA 4U7DA 1KGSA 5L3GA 4L5JA 2RKHA 4HF0A 4WXCA 3VEPA 4KN4X 3ISPA 1BBYA 5ICCA 2EV0A 5CVIA 1QZYA 1MGTA 5H6RA 3CO7C 1K78B 3MFKA 1O7LA 3CUQC 2L4AA 1MD0A 1YFHA 2O61A 2AXLA 3GYHX 2YX7A 1XGNA 4DQ2A 4XLPF 2XKOA 4QLCU 2FQ3A 2XUBA 1VTNC 4HX7A 3QP6A 2XAQA 3BWGA 4PGHA 4ENNA 1YQAA 1HXDA 4MHGA 5TRDA 2XAFA 3S2WA 3E6MA 1V3FA 3MEXA 3DQVC 5HLGA 3B02A 2PMUA 5DCMA 4M9XA 5DUIA 4OIOF 3F8FA 5D6FA 1YW8A 3Q9VA 4XLNF 5ERIA 3ZMSA 4PGGA 4G7OF 3IRRA 3F8MA 3GUDA 4DNCA 1REPC 1ON2A 4YFNF 3G3ZA 3WTVC 1BC7C 1YS7A 4KICA 2VN2A 3U9GA 2OQGA 4L9TA 2W84A 1DPRA 5E8IA 1Z1DA 4EMSA 4Q5SF 5J8FA 1PUEE 3DFGA 4HV5A 3HIFA 1T6SA 1V4RA 1LNWA 1R5HA 2JTVA 1E2XA 1XSVA 3GFLA 3JW4A 1XGMA 3ABTA 2QVOA 4WXDA 1F5TA 1GXQA 4JQFA 3NRVA 4G6QA 5LEKA 4N0BA 1G3WA 4YFXF 2DPUA 3F3XA 4ASNA 1FYMA 4O6JA 1S6LA 3M9AA 2DTRA 3KFWX 4TV7A 2VODA 4O5VA 3IL2A 2O6GE 3V7CA 2K4BA 2QQ9A 1I27A 3EYYA 1R5GA 2FOKA 1Z05A 1TNTA 4P5OA 3BP8A 5L3FA 2PMHA 1IXRC 3HHHA 3RDIA 3KLOA 1ZARA 2GXBA 3R0JA 3T5XA 1FC3A 1B59A 5DEQA 3HOTA 2EB7A 5HDNA 2HYGD 3M1EA 2RN7A 3LSTA 4FX4A 2ZXJA 1IN7A 4ESFA 1CGPA 1KYZA 3ZMUA 2PI0A 3W6KB 3GX4X 2W24A 5K1YA 4F7ZA 1QQIA 2OD5A 4RB1A 3BPXA 1EH8A 4EJTA 2CQKA 4G8XA 4M6YA 2K7LA 2VC0A 4CZZA 2G9WA 2FNPA 3DPTA 2QWWA 2TDXA 5ED4A 4RAYA 1LDJA 2ELHA 3F6VA 2J5PA 2R3SA 1HSJA 2UXNA 4HQEA 1BI1A 1B6AA 3E6DA 2XAHA 3ECHA 2DU9A 5LHGA 2XIGA 1LQ1A 3DF8A 2P5VA 2NAZA 4OU0A 1K6OA 2NNYA 5H20A 1R1TA 5IT9Z 3GO5A 1RNLA 4ZYDA 5ICEA 3V8KA 3I59B 1R22A 3E6BA 3ZN1A 4A12A 1HW5A 3FXUA 2XAGA 4IHTA 5AONA 1XGSA 4EV0A 4HW0A 4RGRA 2QENA 4OIRF 2MLGA 1IN6A 5F6FA 4LMYA 4LLLA 3IKTA 1F4KA 4G7HF 3KP6A 1IRFA 1FP2A 1W5TA 2ZMEA 3FZVA 3DKWA 5L3EA 2R7DA 2JPCA 3GFMA 2F5CA 3ZMVA 1SD7A 1OYYA 1QGPA 4ZZLA 4QWQA 4RGXA 2XKPA 1W5SA 5HS7A 2PFBA 4AD9A 1OR7A 2L3DA 4HLYA 1EH7A 5BPDA 2ESHA 4G9YA 2JPBA 1K78A 3HYIA 2VOOA 4HYEA 1IN8A 4LB5A 4OMYA
chains in the Genus database with same CATH superfamily
1AOYA 1QU3A 3EUHA 1P7JA 4DIQA 4XKBA 5E20A 3BTCA 5HLIA 3HG9A 1TWFJ 4ZH4F 5D5XB 2CV1A 1MKMA 3O2PE 2JMWA 3R4KA 5KK1A 1QRYA 3CO6C 4S04A 2MGQA 3ELKA 2Z33A 5DV5A 3D5RC 1YJWI 3Q5FA 2DXIA 2V9KA 1DP3A 4NC6A 3U1KA 2X6OA 3OYNA 2CUFA 4IHWA 1ETOA 2MLKA 2W57A 2YR2A 2HZTA 4HX8A 4JYKA 1YJNI 3DKXA 4ENMA 4XRFA 1I5ZA 3K70C 3DBRB 1U3EM 1VFCA 3TDZC 3D0SA 5FLXZ 3V8JA 5JVGF 3KP5A 3S2HJ 1FOKA 4OIQF 2M7BA 4W1UA 4ENKA 1YE9A 4KIBA 1HQCA 1Z67A 4H4KC 4XSZF 1ACIA 3GF2A 4XONA 3HTUA 1XS9A 3GLLA 1SMYF 3F8CA 1ZAOA 2QM3A 2O5RA 2HYFA 2BEOA 3H5NA 3NARA 1E3OC 3CP8A 2BXZA 3TOBA 4C3JJ 3KP2A 1HOMA 4XK4A 3J80Z 1HKSA 1PP8F 1R36A 3L1PA 4U87A 4XRSG 4Z2YA 2CRGA 3ZQGA 4RDUA 2H1KA 2WV0A 1YW9A 3T0YA 2AQFA 3M8FA 4A3BJ 2P4WA 5DCFA 3LSKA 2BBYA 2X1EA 3V42A 4Q4ZF 2VQHA 4DZPA 4A5MA 1IAWA 1IUYA 2HWVA 2VOPA 1O3QA 1HW1A 4NHJA 3J7ZI 1ZK8A 5EG0B 3OYKA 3K4JA 2CMPA 1YRNB 3BR6A 3T8RA 3S2DJ 2DCEA 2QLZA 2BVLA 4A3JJ 1OYWA 1I1GA 2F5DA 1W7PD 2RQQA 2LKPA 1ZYRF 2OC6A 3S1QJ 4U0VA 1JTXA 1V55H 1VQ6I 3AAFA 5B1BH 4A3FJ 2Y69H 2K40A 4RS8A 4AIJA 2KISA 1PVEA 3KE2A 3DU5A 4F93B 1J75A 4MIMA 2MW8A 4XKWA 4C9YA 1J9IA 2IS6A 1T8IA 4BNCA 2VB6A 3SZGA 3OYEA 2DDBA 3RCOA 3MKWB 3WG7H 4RMNA 4EVIA 3A1YA 3J7AO 4XLAA 4MO7A 2V6EA 1U9NA 1BIAA 4KMUX 3FXJA 3L9FA 4D5FA 2IRFG 3ZN0A 3TW7A 4AU7A 2OF7A 3FM5A 1TWCJ 3G1OA 3FM3A 2V4JC 1XD7A 2ZJRF 2FD5A 1MNEA 4BXXJ 3WTXC 1SVOA 3K1MA 1WFXA 3MZYA 4CICA 3FXRA 2ME0A 5CJ9A 2O8XA 4C2MJ 4MTDA 2B7EA 5FLVA 4ENJA 4L0YB 2PQ8A 2PJRA 1V5FA 4D0PA 4AIHA 5E1WA 2X4HA 2HDWA 2FA5A 3LFUA 1SFEA 3PQJA 4I02A 4Q48A 3ZQIA 1AA7A 5J40A 3ONQA 2JQ7A 1MW7A 1I39A 2TCTA 4GO1A 2RREA 2E1MB 1YO5C 3IH3A 3LOCA 4DYCA 1FBUA 1PJRA 4P9UA 5ILVA 2PG4A 1BW5A 3CTAA 3QU3A 2MC3A 2C6YA 2JRTA 3WTYC 2OPTA 1WHUA 1PDNC 5F08A 4F91B 1YYVA 1XPXA 3HHGA 2PBIA 2UWMA 4UV9A 5CYVA 3ZGKA 3E5QA 1FTZA 4BJ6C 3IRQA 4YFKF 3FHNA 2MYSA 2ISYA 3G2BA 2D45A 4C3IJ 2LF8A 4UHTA 2PMZN 1MJAA 1MIJA 1Z3YA 1USSA 2NOJB 2P8TA 4BAYA 4ESJA 3WODF 2EPFA 4CGZA 4HPQA 1FSHA 2LREA 3LFKA 4HX4A 3O6BB 4F3QA 2DMPA 2W48A 2L9NA 1H0MA 4RA2A 2M0CA 3IHUA 4BHPA 3W2WA 3GFIA 1CQTA 3I4NJ 4NC8A 4D7NA 3MQ0A 5J8CA 1FPQA 3WGGA 1RR8C 4PCQA 2WAQN 5EEAA 4OOIA 1J7KA 3L09A 4AVZA 1TLHB 1ZG3A 1T38A 4N4OB 3FF5A 2MFZA 1MDMA 3RKYA 1VQOI 1P9QC 2IXSA 3DU6A 2MABA 3RKWA 2DMUA 1BI0A 2VLAA 2ZMEB 3SDGA 3ZMDA 3JRCA 3RQ4A 2GIVA 2KFDA 2EIJH 5DM6F 2UZKA 1DU6A 1S5LC 3L00A 4II3A 3ABMH 4ZYGA 4N4NB 3TKYA 1K4TA 2P81A 3OR2C 3H92A 1T08B 2XAUA 3ZQ7A 4JX5A 3ZQCA 4XQFA 4RB2C 2KLOA 2VBXA 1FIPA 2G7HA 2V9PA 5JLXA 2R5ZB 1XX5A 5BNGA 1RI7A 3OWTA 4GFBA 2VBYA 4IHXA 2NRAC 1ZHFA 2XRNA 3CJTB 5CVRA 5E17F 1UJ8A 1R1VA 2E36A 2P6SA 1CF7B 2CG4A 3RZOJ 2FBIA 2E5ZA 1FZPB 3ABKH 5L3DA 3HUGB 2LVSA 4YELA 5JFRA 2VXZA 3IAS2 4EEFG 5LRSA 2LNBA 2XC7A 2DFEA 4E70A 1O3TA 4G6DA 1FP1D 2PMZA 1Y39A 4A0ZA 3E1SA 5K5RA 2BW3A 1HDPA 3OOPA 2BE5F 3I59A 4BE0A 5C4JJ 3PM1A 4EJWA 2L4MA 2YU9J 2CQ7A 3ZQQA 3RYPA 1W36D 2V1UA 2V26A 3K1NA 3HOXJ 2FEZA 2Z16A 1Z0XA 2IGKA 4KITB 1X1BA 4MQVA 1RUOA 4PDKA 1D3YA 2HXOA 1ZLKA 4EGZA 3DPLC 2A05A 1L0OC 1Y8QB 3IWFA 5EYRA 2UV1A 2V1NA 5DDGA 4UNOA 3CLOA 1MBKA 3BDDA 3I58A 2K02A 3OMYA 1FIAA 1XCVA 4NDLA 1TQIA 4BU2A 2XB0X 4ZTJA 1ZRDA 1R00A 2WB1A 2OBPA 3KYLA 4MEXF 3ULQB 2LF7A 5HS8A 3BG6A 4ZYHA 4A69C 1IZ1A 3GZNB 4E4HA 3J80K 1WJBA 2QKLB 3H9GA 5D5UB 4MFDA 3RI4A 2QQAA 1MBEA 4UB6C 1N25A 3KIOA 2AO9A 2CGPA 1E3PA 3NEUA 2DLLA 3JRGA 3MZHA 2Z1DA 5FFXA 5C4XJ 3DP7A 1D8JA 1GV5A 3L2UA 1YX5A 4BE1A 1ETKA 1FOXA 2YX4A 1R9TJ 2IS2A 2IW5A 5IY5H 3CUQB 2B0LA 1LB2A 3ASOH 1KA8A 3RKXA 5FRMA 4I6ZA 1QNTA 1BR4A 1JUPA 2CW7A 3E3VA 4HLXA 3F23A 1XTAA 1Y8RB 5J1RA 2EZHA 4J00A 5K7ZA 2E7WA 3WTUC 2FRHA 2QQBA 1M1EB 3L7WA 3W6JB 2RDPA 2DA1A 1HSTA 1OLTA 1MMGA 2RV8A 1FYLA 1FY7A 4M6XA 4KFCA 3A01B 3I9V2 3K10A 3QOEA 3HDDA 3FMRA 2VI6A 1FTTA 3JAMZ 5J6XA 4BBSJ 2JUCA 3ERMA 3R60A 3WG9A 3OL4A 4BUPA 4W97A 4A3DJ 3QYBA 2R7OA 5F1RA 1IRXA 3H1CA 3S1RJ 3QWLA 1NG7A 1RPWA 2GA1A 2WY8Q 3Q0UA 2XF6A 4RBOA 4A6DA 1A31A 2ZXWH 1P4AA 3PNTA 4RGSA 5B1AH 3LSJA 1MMDA 1Z21A 2RNGA 1IUFA 3IV5A 4UVBA 1VQ4I 1ZREA 5FB2A 4Y7NJ 1A6IA 2BY0A 3KZZA 3RTRA 3KYCB 3JRAA 2F5FA 1IN4A 2D1HA 4RB3C 4CYDA 1ETYA 4RLFA 2LKXA 3LQRA 2M45A 2M2EA 1U2WA 2OTLI 2HXIA 1P4XA 5K7HA 3WGHA 4M73A 4CXFA 4D7MA 4IRIA 2NS7A 3I54A 1J0RA 2WADA 3TP0A 4KIGA 1ORKA 2AHQA 1QPMA 3KCCA 4CO8A 3JR9A 2WY7Q 1KYWA 1MJBA 1JHHA 1KU9A 4L0ZB 2KRCA 2DI3A 2LG4A 1G3SA 4U0WA 2QA4I 4BHBA 3FXQA 4BQOA 1UAAA 1Z3XA 1SEUA 4IJAA 4IF4A 5EG0A 3V7SA 2K9LA 1E17A 3TW6A 2XHKA 4UUVA 3F8NA 3EYIA 1OYIA 3CCVI 2R7VA 5BPIA 3H36A 1IV6A 1BOAA 4LGWA 3TDUC 5L3CA 4M3GA 2XASA 1AWCA 2ECCA 1LEBA 2FBHA 4KIFA 3LA7A 5CQGA 2D2WA 2L2OA 1ZLJA 2M87A 4AYBA 4FE7A 4EM0B 4EJUA 4BACA 4FETA 3TP3A 3LSHA 1BL0A 4LG0B 4A3GJ 4WX9A 1R1UA 3S16J 2XVCA 1X4PA 1Y0NA 2L01A 4UUTA 3JSPA 2OZUA 2ZKZA 4I7HA 5J4VA 3NWTA 2GXAA 3PJRA 2R7XA 3J7AY 3F72A 4BHCA 3F8BA 2EFQA 3EUKL 4RAGA 2ADUA 1FJLA 2VJ4A 1QPIA 2H94A 4B8XA 3S14J 5F64A 2H27A 2O7OA 1TL8A 2Q1ZB 2NOGA 3HRSA 2Y9YA 5F27A 1TNSA 5GADJ 2L02A 1MDMB 4XBFA 3QRFF 2VQLA 2FE3A 4MEYF 2XSDC 1GXPA 3R6SA 5IT3A 1KU2A 3PQKA 4ZYAA 1DQUA 3JRHA 2LDUA 3A4CA 3HTSB 4XN0A 2QSGX 2XGEA 3JCUC 3SFIA 1K6YA 5BQTA 2E60A 3E5XA 5C44J 3LMMA 2ESNA 2STTA 3ASNH 4I2OA 1KU3A 4XMYA 3L2WA 1G4DA 1UFMA 3ZQLA 5JR3A 2LOOA 1O57A 4PSWA 4P96A 2ELJA 1ZGJA 2K85A 1N75A 2QKMB 2JSCA 3I64A 2KIFA 3OYBA 4BDYA 2DODA 2VASA 1POGA 3BC8A 3OYHA 4XR6A 2A6EF 1BI3A 2DFFA 2ZFWA 1IXSB 2KDZA 2ETHA 3RYRA 5FO5A 4BH9A 3V7RA 2HTJA 1N77A 1VQ9I 1X1AA 4WCGA 3BY6A 5DUKA 3A0HC 4FHTA 2OCCH 4C2TA 2HKOA 3QU6A 4ITVA 4P9FA 2FU4A 3CF5F 1WJEA 3PUBA 2IGMA 3ZP5A 2K9SA 2H8WA 1WGXA 5JVTA 3REOA 5M5YJ 1XDUA 2WBMA 4K2EA 4MNUA 1G8XA 2BW3B 2CYYA 2NNNA 4BJTA 4D5CA 4R79A 1Y0UA 2YUSA 2BHYA 2LRDA 3WTTC 3OYDA 3PIOF 2VBWA 2DFIA 4AC0A 2FQ4A 2KPMA 1Z6RA 3OOUA 5LLQA 3MAJA 3K4CA 2R5YB 2X51A 2RQPA 5FGMA 4DYRA 1EA3A 2LD5A 3WTWC 3BTIA 1JGGA 1D5YA 2R7FA 3H3UA 4A3CJ 2MSYA 4HF2A 1TWAJ 2BZTA 2E7XA 3AFHA 2EJRA 2VPRA 1OCCH 4BY1J 4FQGA 4GYGA 1MNDA 4F55A 2CSOA 1BN5A 4M3DA 4Z6YA 2KRHA 4FISA 3FMQA 3K4MA 1YS6A 3MKZA 1MNMC 4XRMA 5EZHA 3I55I 1TT5B 2VC1A 3A0BC 4IKFA 3I71A 1I6XA 4M74A 5JI6A 1U6GA 4DBQA 2NVXJ 4QPOA 4U7BA 1O4XA 3C2HA 4GXOA 1PYVA 5F0FA 3GTJJ 4CDGA 1FBQA 3OIQA 2R5ZA 1BA5A 2JVGA 1LJ9A 3MCZA 1TW3A 1R4MB 3WHBA 4DW6A 1IXCA 3VYSB 3WU1B 1XMAA 1MH4A 2I5UA 1G6NA 3WHCA 1W4MA 5CVJA 4YG2F 1D5VA 1I1SA 3E0JB 1CF7A 3FXOA 3PFYA 3SYTA 5H6QA 5TGTA 3HUGA 3C1DA 3HM5A 4I76A 1WI9A 1R49A 5E3OA 2HDCA 3BR5A 1SAUA 1S8NA 2F48A 4NC7A 2A61A 1TBXA 1LFBA 2IAIA 5E79C 5E3NA 2HI3A 2UUZA 3PFIA 4YIFA 3G4SI 1YOVB 5EDNA 2DA6A 2Y75A 3MVPA 1NH3A 1U5TB 2Z3YA 5EJCA 4IHYA 1RZ4A 1G3YA 3SJMA 4YIIA 3BJ6A 4ETSA 3LNQA 2CJJA 4M71A 1XCBA 5IP7J 1P92A 5FD5A 4OINF 2DOEA 4EQQA 2DA3A 2LY1A 4ZTFA 3KP7A 1RETA 1OISA 3IAM2 1S7OA 5LBQA 3JRFA 2M5WA 4NBQA 3QYFA 2M9HA 5LFAA 3LSRA 3KETA 4NQWB 2QEXI 4HBLA 1XSDA 5FFZA 5IOYA 5L3BA 3GBGA 3K9TA 4A3KJ 3W6VA 2E1OA 2COBA 1V5GA 1OCRH 2RC4A 5BMZA 2CU7A 3H9QA 3HOSA 2FBKA 3ZPLA 1O3RA 3DV8A 3OIPA 5CVUA 3HEFA 3KP3A 5JHUA 1BR1A 3E97A 2VQCA 1RKTA 4M72A 1BJAA 2EILH 3CLQA 4II2A 2DMTA 1SFUA 4HQMA 2ID6A 2R7UA 1HBXG 1H89C 4ZYEA 1W7PB 2DO7A 3CUQA 3LSMA 3CCQI 1ZN2A 3IUOA 3ZR8X 1P6RA 1VZ0A 4QIWN 3FXLA 5CQEA 1YW7A 3BTJA 1UG2A 1DU0A 4YRVA 4Y33A 4N9HA 3Q3SA 1YI2I 4L9NA 1OCPA 1VQ8I 3LA3A 1YG2A 2K27A 4M3BA 3SHFA 3QP5A 2XRLA 4KT5C 1D0ZA 2X48A 1OCOH 2HEOA 1B1BA 2HOTA 2EWNA 1KU7A 3A01A 3OSFA 3TMOA 2E1MC 2XSJC 1UMQA 2QBYA 3FMSA 1GT0C 4B3AA 4Y4RA 1W1WE 4MQ9F 2FMLA 1RUNA 3H5RA 1DPUA 1B4AA 5EGOB 2FXAA 2W85A 2VPLA 2BGCA 2IJLA 1ZRCA 3HRTA 3AG4H 3BJOA 3LWFA 5BS6A 1ZGAA 2M0MA 2Q2EB 3S32A 3U1DA 1S72I 3GXOA 1S3JA 2WAEA 2V9VA 5D5WB 3DBHB 1ZELA 2PEXA 1DP7P 3JRDA 1KQ8A 4G94A 4EM2A 4CCJA 2KT0A 3IH2A 3OS2A 3BQZA 4LIUA 2R93J 3AL0B 1STZA 4OWRB 1RIOH 1ZGWA 3M1CA 2Y0MA 3JTGA 2HQRA 2NVUB 3S3OA 4KMFA 4UV8A 3RPUA 3LAJA 3K1PA 2V1DA 4XORA 5M3FJ 5K5OA 2IA0A 3B73A 2XGXA 4LK1F 2HNHA 2OQRA 4M9SA 3BCBA 4OMZA 5F0CA 4CYCB 3J7YJ 1K4SA 4J01A 2VKDA 4KT6A 4PZJA 2ZMEC 2GWRA 3T8TA 4EJVA 3LSPA 3AG1H 2F4OB 3FIWA 5HOOA 2EZKA 1FBSA 2F4MB 4GRIA 2LBFB 3OYMA 2DN0A 1FOYA 3OIOA 1BC8C 1JJ8C 4FASD 5HVQC 1BIBA 3OYLA 5IP6A 4AUXA 2JT1A 3ZMZA 4EATA 3W2AA 4IOAF 5IT9K 1ONVA 1TP4A 1A5JA 3WE3A 4ZDPA 5HNHA 2AQEA 2HQ5A 2CFXA 2NS8A 1OR7C 2KP6A 2Y30A 4BS9A 2P5LC 2A69F 4UXNA 1HKTA 4LG0A 3ZQFA 2BHZA 3HB9A 4CSWA 1AKHA 4IL6C 1QHHD 3HJEA 2P7CB 1WJ5A 2QF7A 4G7ZF 2ZJQF 1T33A 3BZCA 2CW8A 2XB5A 3GZ5A 1B72A 4JP0A 5KHDA 2ZNZA 2MD5A 2KIQA 2BYVE 4L9VA 3EUHC 3MKYB 3WE2A 3S15J 2GOMA 2HFHA 4IHVA 1FT9A 1R23A 3CQZJ 4BDZA 1N78A 1LE8B 2HOAA 2JSPA 3GMEA 3G71I 2VT2A 4CCOA 2VXDA 1W36C 1HLVA 2QZ8A 4UB8C 4V2FA 3N97A 2MBFA 4EJOA 3WU0A 1W0UA 4HV6A 4AVPA 1B9NA 1OMIA 5BOXA 1SFKA 2MC4A 2WB1N 3C3WA 4XNFA 5LHIA 4E7KA 1JJ6C 5FD6A 1ETQA 1TWGJ 3LAPA 4IZZA 3A03A 2DDAA 2ZJPF 2Q0OA 3LA2A 1UELB 3KEOA 1L3LA 2GM4A 1JKQC 1IF1A 4E7LA 3CJQB 3GLXA 3P9CA 3GFJA 1XSXA 5CLSA 5HNFA 4XLFA 4FCYA 3CCRI 2UXXA 4PFPA 3VSLA 3I56I 2KIMA 1QA6A 1VF9A 3EQLF 3BG9A 3TBIA 2WA0A 3I53A 1Z9CA 3I4PA 2KZVA 2E2HJ 4GDFA 1F1ZA 3HPHA 2DK5A 2I8DA 3QOPA 4AIKA 2M30A 3FDYA 1BR2A 3OL3A 4H0EA 2EFNA 4BQNA 1F9NA 2EBIA 2F4IA 4D1QA 5CVVA 4JOMA 2F2EA 1UHSA 4WXHA 3N4MA 3HKZA 3VFZA 4PJJA 3AG3H 4XRSA 1WJCA 2NVYJ 1SMTA 3TOAA 1TQMA 3BOQA 1BI2A 2X9DA 2F5EA 3HSFA 2ACJA 4BKXA 2XPUA 2XAJA 4RAZA 1PP7U 1HC8A 5C3EJ 2NYXA 2BXYA 2VQGA 3VPRA 1K7AA 2R5YA 2LP0A 2WAFA 4V2GA 5FLXK 5DS9A 3CJNA 3GEZA 2H6BA 5A2QZ 4RGUA 1FYKA 4IXAA 1DDNA 2HVSA 2JA5J 3VODA 4XICA 3S17J 2OV7A 2JN6A 3QAHA 1KQ9A 5GP9A 3RSNA 3K4LA 4A5NA 5HODA 2EV5A 4IPAA 4I99C 3C7JA 3TEDA 3VB2A 2EK5A 2HPIA 4WWCA 3PNYA 3M8EA 2EFPA 1IW7F 5HLHA 2EA2A 1XN7A 2DK8A 4LK0F 4P1WA 1I6HJ 2QGUA 3DTIA 2V79A 2MD0A 2M8EA 3CMEI 2MH2A 3QPLA 2CH0A 2NS0A 3DPUA 2JVHA 3CCEI 3BR1A 2CUZA 1ON1A 3GTKJ 3HOUJ 2HR3A 2ZJ2A 3LQQA 1QZZA 3GW2A 4M3FA 1GHCA 1GVJA 2R7WA 4BE2A 4I01A 2HQAA 2LY2A 1WJAA 1EH6A 1ZQ3P 1XDSA 2FF4A 1SFXA 2EV6A 1WZ2A 3BPVA 2IS1A 1UB9A 2FMYA 1J5YA 3CUOA 1U8RA 2CO5A 3I5UA 5D8LB 4O3MA 2DMQA 4MLOA 4LJZF 1R4NB 4PJMA 3FHZA 2OZ6A 3LSIA 3QQAA 2BY3A 4KUMA 4JBAA 2O9LA 9ANTA 3RJPA 3QPTA 2HGCA 5GAEJ 4QPQA 2BVMA 5E1ZB 1LEAA 4S0HB 3CDLA 3CDHA 4I0BA 1X1DA 1IRGA 1O3SA 2DAOA 4AYBN 2DYRH 1RKWA 5J3LA 2ZO4A 2QBYB 3FX3A 4A3MJ 1BJZA 5GAGJ 2YS9A 4BQQA 5KCMA 1U5TA 3GWZA 1SD4A 2GQQA 2X85A 1EKEA 1ETVA 1VQLI 3E6CC 3F21A 3KZIC 4XSXF 1X2MA 3SZPA 2YU3A 5E18F 2LYCA 2L0KA 1J59A 3SZTA 3J81Z 1D0XA 1HDDC 2F5VA 1V5EA 2X6WA 3A2KA 3HSEA 4PJLA 4C30A 2Y0SN 2DMNA 4BXUA 4NQWA 4A0YA 5DD8A 5D6EA 3RZDJ 1T2KA 5GPAA 1FEXA 4XOPA 3KP4A 2A6HF 3OV8A 1HW2A 3BJAA 4HNTA 1WPKA 1JXSA 4HDVA 2E1CA 4LOCA 1ZG1A 2CQXA 2ISZA 1HA8A 3FXMA 4CZCA 1I50J 1F36A 1S7AA 5HLTA 3OYAA 2H1LA 3HSRA 3MZ8A 3ZOBA 3Q0VA 2X0LA 2BOLA 3FBNB 4HOBA 1NHAA 3BCAA 4WK8F 3V4GA 1XB4A 4NUBA 4FX0A 4IEJA 4HF1A 1S29A 2MG4A 3BROA 2YSRA 2L54A 1Y1WJ 2V6CA 4CHUA 1TQPA 5FROA 2CQQA 1W7PA 1Q1HA 1WCMJ 3TO7A 4PFOA 3KLNA 2V1XA 1J09A 1Z91A 2EA4A 2HS5A 3LL7A 3HL2A 1MJ9A 1LFUP 5FKOA 1VQPI 2CQNA 3OYGA 4LD5A 3W3CA 4Y15A 5IYCJ 1ETXA 2HTSA 1OQYA 2L9RA 1OKRA 2JUGA 3SEQA 3ZXSA 1OJLA 4PUSA 4LG3A 3K0LA 3IWZA 3CMMA 4OAZA 2AXTC 1WSUA 3Q9SA 2LLKA 1AKHB 1IC8A 5TJJA 4RM3A 4CCKA 1A35A 3DEUA 1B8IB 3CC4I 1HF0A 3GTOJ 4IRGA 3ESWB 1B72B 2XDVA 3U21A 2D5VA 4OAYA 4D9JA 2GA2A 2HOSA 3GTGJ 2X6XA 2GAUA 3BR3A 5EGOA 2W82A 3ROUA 1IO2A 2OU2A 3MKLA 3KEYA 2BV6A 5D5VB 2KMUA 2A07F 1T98A 4EGYA 2Q2EA 3P5JA 5M5XJ 2K9QA 5GTHC 4OIPF 2Y0SA 2HQNA 4RB0A 4L5EA 5HS9A 5DYMA 1BM9A 3FWEA 3WTSC 5CKTA 2K86A 1GVDA 1DUXC 1R6RA 2WTEA 1D8KA 4JK1X 3FK7A 1ULYA 4MTEA 1Q1VA 1YITI 2VIXA 1IN5A 3P9IA 5GAHJ 2FUG2 3I3LA 2Y2ZA 1YTYA 5FKMA 1SD5A 2KZGA 3G1LA 1JUMA 5LHHA 1X3UA 1C0WA 4HG2A 1TZLA 1KQ0A 1I3AA 4CYCA 2DT7B 3M8JA 2IP2A 2O8KA 3P7NA 2DPDA 4Y17A 2L9SA 2IGOA 2HYJA 3CMAI 4BYYA 3DLLF 3TGNA 3M7GA 1Z7LA 2YPRA 1RRJA 4BQAA 3WGIA 2W7NA 2J5OA 5IOZA 1FX7A 4B44A 5FLMJ 1H9TA 2LBFA 3F9KA 2CFOA 3PUFA 4ZZDA 3QPHA 4NB5A 4I0AA 1WJFA 3S3MA 1FMWA 2M1BA 2Y48A 2HOEA 3R61A 4HA8A 4IQ4A 4L9JA 3VOEA 3SFZA 4B4CA 1WH7A 4ABZA 5DM7F 4IHSA 1ZH5A 5EEHA 2P5KA 1P4WA 4HEA2 4Y52J 1XC5A 1IDYA 2W25A 1Y6IA 4XKVA 2KJBA 1O7FA 3PSIA 2LFBA 3ZRGA 1GLNA 5D4SA 1OFCX 2XPWA 2QCOA 2G7UA 1LDKB 5A2QK 4I09A 2IPQX 3FKIJ 4C3HJ 2LH9A 4B43A 1ETWA 2CUJA 1XMKA 2DOFA 4GGGA 2Z99A 2ICWG 3ABUA 1NK3P 1LE8A 2M3AA 3DCFA 1JGSA 5D8KB 5LGNA 2DBBA 2ELKA 2FSWA 4UUSB 4IRHA 4FE4A 5FJ8J 2Z5UA 5D4RA 1A04A 2H09A 3NQOA 2OUMA 2H6CA 3CDIA 1WQ2A 3K69A 3C18A 5KNLA 1U5TC 1P2FA 2COMA 5KVRA 4A0XA 4B3XA 5M5WJ 2ZSHB 4PK4A 2VONA 3HC7A 3EETA 1USTA 2P6TA 5HDKA 1SAXA 2GZWA 2O03A 2Q8KA 4KDPA 2MA3A 3H3VK 4N9IA 4DJAA 2JA2A 2E2JJ 5FKKA 3WU2C 2JK3A 2JA8J 1MZBA 2VE9A 1LVAA 3IC7A 2WWYA 2KKOA 1X4OA 5DCMB 4BEHA 4GYIA 3E5UA 2ZNYA 1TWHJ 4GCVA 3QPSA 1GUUA 2F6CA 5FKNA 3P9KA 2EQRA 2A68F 3ERED 4UVAA 3SEZA 3I0TA 4IVNA 5DD4A 5IP9J 2M4KA 3F22A 1LFPA 2M7AA 1KZHA 3BG7A 4A3IJ 5AIQA 1MBGA 2Z9OA 3JAMK 3IP4B 2QYOA 5EF6A 3GCMA 3GVAA 2CW0F 4M9ZA 3B6CA 2DA4A 1VQKI 1FSEA 2TRTA 2R7QA 3BQYA 2K5CA 4I98B 3CZ6A 2P7VB 3SQNA 1ZTRA 2O3FA 4FT8A 3J81K 2VKVA 4ZC3A 1UHMA 1Z77A 1S9HA 2A5WA 5B3SH 1SFOJ 4XLEA 1R58A 4R1HA 1J2XA 2PN6A 5ICFA 2OA4A 4B48A 5B5EC 4KA4A 2ME6A 4U88A 3JSOA 3JTHA 2EIMH 5K5QA 2AS5F 1XGOA 3DXJF 1Z7UA 3WTZA 2RNJA 2R7RA 1YIJI 2STWA 1E0EA 2KIUA 1LPQA 3LSGA 4Q47A 1MSEC 1HKQA 5KAFC 1QO0D 3M4OJ 1IRZA 3HZJA 3H35A 4EM1A 2HKXA 4PSXA 3JRBA 1Z6TA 4X1EA 3OR1C 3VDXA 4P55A 2FNAA 1B9MA 2L7FP 3GZ6A 4CCLA 1AU7A 5E1XA 4KN7X 3BR0A 3TO9A 2IA1A 5ILSA 1JI8A 1YX3A 2A3SA 2DW4A 4G12A 1K83J 3VWBA 6PAXA 4AWXB 2XROA 1ZRFA 4MGRA 5EEGA 4Y13A 4PJ0C 2LSOA 3ML6A 2VJ5A 2MH9A 3MWMA 4KJZA 2PJPA 4YIRX 2N8GA 5H2FC 3AL0C 3PIPF 1WWXA 5K7FA 1K61A 1E3HA 3ZCOA 3RPQA 2A5YB 2EFOA 1ZR2A 4LFUA 3KYDB 3OY9A 2NVTJ 1UZCA 1X2NA 3S3NA 1D0YA 3U2RA 4RM2A 1D1AA 3OYIA 3HOVJ 3SXYA 2K4JA 3IKVA 4E7IA 4XLHA 5LD2C 2VT3A 2IVMA 3CCYA 3JREA 1NG6A 2GLOA 2IGNA 4S05A 3HRUA 5E8GA 4LLNA 4KNYA 2DOAA 4ANJA 1WRJA 3BT9A 5J47A 3H0GJ 4RAFA 1EJ9A 3BZKA 1ODDA 4BGDA 1PUFB 4B09A 3S93A 3S1MJ 3M3YJ 1SVMA 2IEKA 3K4KA 1YIOA 3GTPJ 2VBZA 1P7IA 5IPAA 1ENHA 4XKCA 1F43A 2GIZA 3TO6A 2VE8A 5HDGA 3L2VA 4HSRA 5LEJA 4DZJA 1WKMA 2FX0A 2RAEA 4LLGF 2DA7A 3K70D 3HRMA 4ON0A 1JKPC 1FNNA 4HDUA 1QHGA 1QBJA 2PLYA 2LR8A 3FK6A 2EINH 2CV0A 3S1NJ 2EZLA 4NNJA 3HPGA 4A6EA 5M3MJ 2ZBKA 3DLAA 1U9OA 4HZFA 2E1NA 2ECBA 1R71A 4KYWA 5IYBJ 4HAMA 2PX9A 4A3LJ 5LRRA 2WC2A 4IO9F 2DT5A 2LC2A 3B6AA 1T39A 3O3KA 4DBRA 4IQJA 2RGVA 2D1VA 3DBLB 1A6QA 1D1BA 2KRFA 1YHQI 5AIPA 3ZMTA 5DTDA 2G0EA 3NWSA 1LDDA 5ILUA 2GXGA 3C2BA 4CUGA 2P0WA 4QTRA 3D5SC 3BZ6A 2OAZA 2ZFUA 3KEQA 1JE8A 4WF2A 4R8HA 4CCMA 4UVCA 2IT0A 5JLWA 3K2ZA 1FWZA 1YLFA 2JJ7A 5ICGA 1TC3C 1AHDP 2DQRA 1VQ5I 3HKZN 3OYJA 3G73A 2JRMA 2E19A 3R0AA 3ECOA 1X19A 4U0YA 1G3TA 4F92B 3L2CA 3OS0A 2KJCA 1MBFA 3VYUB 4E6KG 2IS4A 4L18B 3RIRA 3H5AA 3F6OA 2ZCWA 1DGWY 3IH4A 3QYEA 4IX7A 1B8IA 5E3LA 1VQMI 1OPCA 3TQNA 1FLIA 2DJNA 3OYCA 4ESBA 1VI0A 3HOYJ 2CWEA 1K79A 2NVQJ 2JZYA 5GPCA 1IJWC 2L5QA 1APLC 3CESA 4DOZA 1U78A 2O0YA 1OCTC 3MN2A 3KZYA 2JWTA 1ZG5A 4Y3OA 2Y9ZA 2HVQA 1GDTA 3CD6I 3K2AA 3M07A 1TTYA 2W1OA 2QSFX 1H9GA 3EDPA 2VL8A 4A2UA 4DYQA 3S8PA 4LB6B 2XF7A 1T0FA 2DYSH 4L5IA 1SD6A 2QUFA 1EV7A 2X1DA 1TW2A 3AKZA 5LGTA 4X0GA 3V8LA 2R4GA 2EFWA 2DQLA 3I4MJ 1ZR4A 3PO3J 1X3WB 2K9NA 1UHWA 1WI3A 2M8GX 3D5LA 1T56A 2XV4S 2KDOA 1VQ7I 2A6TA 3G1MA 2RVCA 3T1BA 5LGUA 4BEHB 4LIVA 1R7JA 2BY2A 3OS1A 1JHFA 3COAC 3H3ZA 2IA2A 1UCRA 4U7DA 5EZGA 1KGSA 2K9MA 5L3GA 4HNVA 2EIKH 4L5JA 3C2GA 2L7KA 4JX4A 1JKOC 2RKHA 4HF0A 1SANA 2GBYA 4WXCA 3VEPA 2R7TA 2LKSA 3PO2J 4KN4X 1JT6A 3ISPA 1BBYA 4HNUA 3HOWJ 4BBRJ 4PJNA 5ICCA 1VQNI 2B9SA 2EV0A 3FISA 5KAIC 3CCJI 1FMVA 1I3QJ 3CC7I 3HOZJ 2ZXHA 1QZEA 5CVIA 1QZYA 1MGTA 4JX6A 5H6RA 3CO7C 1MMNA 1K78B 3MFKA 1O7LA 3QODA 3H9JA 3CUQC 1W5CC 3BG5A 2XF5A 2L4AA 1MD0A 4QSHA 3E7LA 4AIDA 1YFHA 2O61A 2AXLA 2BY1A 3GYHX 2YX7A 3RQIA 1XG1A 1XGNA 2X6YA 2X1CA 3N05A 4DQ2A 5E3MA 4XIDA 4XLPF 4E7JA 2DA2A 1MMAA 2XKOA 2XGDA 3BLYA 1WJDA 3X2QH 3VYRB 2FQ3A 4QLCU 5F1JA 3DEEA 2XUBA 2ID3A 4UUSA 4HRIA 5FKLA 1VTNC 4KISA 4HX7A 1HCRA 3QP6A 2XAQA 2XPVA 3VYTB 3BWGA 2H8RA 3CC2I 4X6AJ 4PGHA 1H88C 4ENNA 1YQAA 1HXDA 3KPHA 2E34A 1BOBA 4MHGA 2WAQA 2R7SA 5TRDA 2XAFA 3S2WA 3E6MA 2KHMA 1V3FA 3MEXA 3DQVC 3K7AJ 5HLGA 3B02A 2KQRA 2R7ZJ 3HBLA 3CCUI 2PMUA 5DCMA 3EPZA 4M9XA 2OTJI 2DJIA 5DUIA 1WH5A 2FOWA 4OIOF 3F8FA 1JUSA 3KX2A 5D6FA 4BXFA 1YW8A 4BL0B 2CUEA 1NTCA 3TL4X 3Q9VA 3MD2A 4XLNF 4BY7J 2EZIA 5ERIA 3ZMSA 4PGGA 3A02A 2GOXB 4XL9A 2Z2SB 4CA0A 3IRRA 4G7OF 3F8MA 3GUDA 3Q0WA 4B1RA 4RLQA 4DNCA 3HXLA 1REPC 1ON2A 4YFNF 2CS3A 3G3ZA 3WTVC 3O8HA 1BC7C 1IV8A 1YS7A 4KICA 5B66C 3DKYA 1LUJB 2VN2A 3U9GA 3UKGA 2EH3A 2OQGA 4L9TA 3NAUA 2W84A 1DPRA 2V7FA 2B63J 5E8IA 1Z1DA 4EMSA 4AM3A 3HGGA 1W0TA 4Q5SF 5J8FA 1PUEE 1Y1VJ 3DFGA 4HV5A 3HIFA 1T6SA 1SVLA 3DTKA 1V4RA 1LNWA 2JA7J 1R5HA 3UNGC 3DTEA 2JTVA 1E2XA 1U8BA 4J19A 1WVRA 1XSVA 3GFLA 3JW4A 3FKJA 4XN3A 3UR3C 1XGMA 3ABTA 1H8AC 4ZDOA 3GTLJ 2QVOA 1X58A 1BW6A 3CCLI 2LMDA 1MBJA 1GV2A 4WXDA 4A93J 1F5TA 1GXQA 4JQFA 3NRVA 4G6QA 2HPMA 5LEKA 4N0BA 1XMXA 1G3WA 4YFXF 2DPUA 3F3XA 1X1PA 4ASNA 2DFHA 1FYMA 1UG0A 1IGNA 4O6JA 1S6LA 3M9AA 2DTRA 4YEJA 2FJ1A 2ZSIB 3KFWX 2M4GA 2R0QC 3ABLH 2ZC2A 4TV7A 1T0FC 4XM3A 2VODA 4O5VA 3IL2A 3OYFA 2HDDA 3DWLE 1OCZH 2O6GE 3V7CA 2R92J 2K4BA 2QQ9A 2VJIA 4C2UA 1I27A 5J1UA 3EYYA 1R5GA 3FBIB 2FOKA 3L2RA 1Z05A 1Y56A 3CMYA 2PJRB 1MMSA 3EUAA 1U0JA 3G6EI 2E71A 1TNTA 3BTLA 4P5OA 3RPUD 5TISC 2VKHA 2DA5A 3BP8A 2QQ8A 5L3FA 2PMHA 1IXRC 1QVUA 1MSFC 3HHHA 3RDIA 2W4SA 3KLOA 1T95A 1ZARA 2GXBA 3R0JA 3T5XA 1FC3A 2LTPA 5GTIC 1YRNA 2L7ZA 1B59A 5DEQA 1IG7A 3O8GA 2EB7A 5HDNA 3HOTA 1LKXA 2HYGD 1YJ9I 1JKRC 3M1EA 2RN7A 3LSTA 4FX4A 2ZXJA 5IYDJ 1PUFA 2K3FA 2VKEA 1IN7A 1LVKA 1JT0A 4ESFA 3D1NI 1CGPA 1KYZA 3ZMUA 2PI0A 3W6KB 2L7MP 1ITYA 1RR7A 2DTZA 3GX4X 2W24A 4E7SA 5K1YA 4F7ZA 4ZJZA 1QQIA 2OD5A 4CH7A 2E2IJ 2ZB9A 4UY8I 3F0CA 4RB1A 3BPXA 2E35A 1EH8A 3GTMJ 4EJTA 2HU9A 2CQKA 3ZQHA 4G8XA 1KONA 4M6YA 1SC7A 2K7LA 1ERDA 2VC0A 4CZZA 4M3EA 2G9WA 3GTQJ 5J1YA 2K3PA 2FNPA 4LITA 4A3EJ 3DPTA 3VSKA 3HGYA 2QWWA 4V19K 2IBDA 3OSGA 2TDXA 3PL8A 4RAYA 4XLCA 5ED4A 3BG3A 1LDJA 4M6VA 2ELHA 3F6VA 2J5PA 2R3SA 4FTHA 2LY9A 2DT6A 1HSJA 3FXKA 2WV1A 2UXNA 1RC9A 4HQEA 4E7HA 1NK2P 2CV2A 1BI1A 1B6AA 3E6DA 1S7EA 2OJED 4ZDLA 2OCEA 2NXNB 2XAHA 3ECHA 1DGRM 2KL4A 5J4YA 2HZDA 3K4NA 2DU9A 5LHGA 2XIGA 3CP2A 3RKQA 1LQ1A 3DF8A 3PNVA 2P5VA 1QVTA 1FOWA 2VJJA 1RESA 2NAZA 1TT0A 3K6GA 3PSFA 3K4BA 3CF2A 4OU0A 3W2VA 5F0HA 3CCMI 1EF4A 1MH3A 1K6OA 2E5NA 4B47A 2NNYA 3H0DA 1MBHA 2VUMJ 5H20A 4BJ5C 2QSHX 1R1TA 5IT9Z 1V54H 1JTYA 1X3ZB 3BR2A 3GO5A 1RNLA 5ICEA 2XGCA 4ZYDA 3V8KA 3I59B 2JA6J 1G59A 3CJRB 1G2HA 1R22A 3JRIA 3E6BA 3ZN1A 4A12A 1HW5A 3DEWA 3FXUA 2XAGA 4IHTA 5CPRB 3AG2H 5AONA 1XGSA 4EV0A 4HW0A 4RGRA 5F04A 2QENA 4OIRF 3SDBA 4G6TB 5JHFA 2MLGA 1IN6A 4HSTA 5F6FA 2M34A 4LMYA 4LLLA 3IKTA 4MFEA 1F4KA 4G7HF 2I10A 3KP6A 2ZXIA 1IRFA 1IDZA 1FP2A 1W5TA 2ZMEA 3FZVA 3DKWA 5L3EA 2R7DA 2JPCA 3GFMA 2F5CA 3ZMVA 5FRNA 1SD7A 1OYYA 2W00A 1X1CA 1QGPA 1VNDA 4ZZLA 1D1CA 3MMYB 3L2QA 2HVRA 4QWQA 4RGXA 4CCNA 4DGWB 2XKPA 1W5SA 5HS7A 1R5ID 1ZKGA 3CCSI 1A36A 2PFBA 4F52A 4AD9A 1OR7A 2L3DA 4E7ZA 4HLYA 1EH7A 5BPDA 2ESHA 4G9YA 2JPBA 1K78A 4IOCF 3HYIA 2VOOA 4HYEA 1IN8A 2L9VA 2Y31A 4LB5A 4OMYA 4XOTA 2LK2A
chains in the Genus database with same CATH topology
1AOYA 3EUHA 5E20A 5HLIA 4ZH4F 5D5XB 1MKMA 3O2PE 3R4KA 5KK1A 3CO6C 4S04A 3ELKA 2Z33A 5DV5A 3Q5FA 2MLKA 2W57A 2YR2A 2HZTA 4HX8A 4ENMA 4XRFA 1I5ZA 1U3EM 3TDZC 3D0SA 5FLXZ 3V8JA 3KP5A 1FOKA 4OIQF 4ENKA 4KIBA 1HQCA 4XSZF 3GF2A 3HTUA 1SMYF 3F8CA 1ZAOA 2QM3A 2HYFA 2BEOA 3TOBA 3KP2A 3J80Z 1HKSA 1PP8F 1R36A 4Z2YA 2WV0A 1YW9A 3T0YA 3M8FA 2P4WA 5DCFA 2BBYA 4Q4ZF 4A5MA 1IAWA 1IUYA 2HWVA 2VOPA 1O3QA 1HW1A 4NHJA 3T8RA 2QLZA 1OYWA 1I1GA 2F5DA 1W7PD 2LKPA 1ZYRF 4U0VA 3AAFA 4RS8A 4AIJA 3KE2A 1J75A 1J9IA 4BNCA 4EVIA 3J7AO 1BIAA 4KMUX 3L9FA 2IRFG 3ZN0A 3FM5A 3FM3A 1XD7A 3WTXC 3K1MA 3MZYA 4CICA 3FXRA 5CJ9A 2O8XA 4MTDA 4ENJA 4L0YB 2PQ8A 4D0PA 4AIHA 5E1WA 2X4HA 2FA5A 1SFEA 3PQJA 4I02A 4Q48A 4GO1A 1YO5C 1FBUA 4P9UA 5ILVA 2PG4A 3CTAA 3QU3A 2MC3A 2C6YA 2JRTA 3WTYC 1PDNC 1YYVA 3HHGA 2PBIA 2UWMA 4UV9A 5CYVA 3E5QA 3IRQA 4YFKF 2ISYA 2D45A 2LF8A 4UHTA 1MJAA 4BAYA 1USSA 4ESJA 2P8TA 3WODF 4CGZA 1FSHA 3LFKA 4HX4A 3O6BB 1H0MA 3IHUA 4BHPA 3GFIA 3MQ0A 5J8CA 1FPQA 3WGGA 4PCQA 4OOIA 1J7KA 3L09A 1TLHB 1ZG3A 1T38A 3FF5A 1MDMA 3RKYA 3RKWA 1BI0A 2ZMEB 3ZMDA 2GIVA 2UZKA 3L00A 4ZYGA 3TKYA 3H92A 3ZQ7A 4RB2C 2VBXA 2G7HA 1RI7A 2VBYA 2NRAC 1ZHFA 2XRNA 5CVRA 5E17F 1R1VA 2P6SA 1CF7B 2CG4A 2FBIA 1FZPB 5L3DA 5JFRA 5LRSA 2VXZA 2LNBA 1O3TA 4E70A 4G6DA 1FP1D 4A0ZA 5K5RA 3OOPA 2BE5F 3I59A 4EJWA 2L4MA 3RYPA 2V1UA 3K1NA 2FEZA 4MQVA 1RUOA 4PDKA 1D3YA 1ZLKA 4EGZA 3DPLC 1L0OC 3IWFA 5DDGA 4UNOA 3CLOA 3BDDA 3I58A 2K02A 1ZRDA 1XCVA 1TQIA 1R00A 2OBPA 4MEXF 3ULQB 2LF7A 5HS8A 4ZYHA 1IZ1A 3J80K 5D5UB 3RI4A 2QQAA 2CGPA 3NEUA 2DLLA 3MZHA 1D8JA 5FFXA 3DP7A 2YX4A 2IW5A 3CUQB 2B0LA 1LB2A 1KA8A 3RKXA 1QNTA 3E3VA 4HLXA 3F23A 2E7WA 3WTUC 2FRHA 2QQBA 3L7WA 3W6JB 2RDPA 1HSTA 2RV8A 1FYLA 1FY7A 4M6XA 4KFCA 3FMRA 3JAMZ 5J6XA 3R60A 3WG9A 5F1RA 2GA1A 4A6DA 1P4AA 4RGSA 4UVBA 1ZREA 5FB2A 3KZZA 3RTRA 2F5FA 1IN4A 2D1HA 4RB3C 4CYDA 3LQRA 2M45A 1U2WA 1P4XA 3WGHA 4M73A 4CXFA 4IRIA 3I54A 1J0RA 4KIGA 1QPMA 3KCCA 4CO8A 1KYWA 1MJBA 1JHHA 1KU9A 4L0ZB 2DI3A 1G3SA 4U0WA 4BHBA 3FXQA 4IJAA 4IF4A 3V7SA 1E17A 2XHKA 4UUVA 3F8NA 3EYIA 1OYIA 5BPIA 1BOAA 4LGWA 3TDUC 5L3CA 2XASA 1AWCA 1LEBA 2FBHA 4KIFA 3LA7A 4EM0B 2D2WA 1ZLJA 2M87A 4EJUA 4LG0B 4WX9A 1R1UA 2XVCA 3JSPA 2L01A 2OZUA 2ZKZA 4I7HA 3F72A 4BHCA 3F8BA 2EFQA 2ADUA 2H94A 4B8XA 5F64A 2H27A 3HRSA 1TNSA 1MDMB 2L02A 4XBFA 3QRFF 2FE3A 4MEYF 1GXPA 3R6SA 5IT3A 1KU2A 3PQKA 2LDUA 3HTSB 5BQTA 3E5XA 2ESNA 2STTA 4I2OA 1KU3A 1G4DA 1UFMA 5JR3A 1O57A 4P96A 1ZGJA 2JSCA 3I64A 2KIFA 2A6EF 1BI3A 2ZFWA 1IXSB 2ETHA 3RYRA 5FO5A 4BH9A 3V7RA 2HTJA 4WCGA 3BY6A 5DUKA 4FHTA 2HKOA 3QU6A 4P9FA 2FU4A 3ZP5A 5JVTA 3REOA 1XDUA 4K2EA 4MNUA 2NNNA 2CYYA 4R79A 1Y0UA 3WTTC 2VBWA 2DFIA 1Z6RA 5LLQA 3MAJA 2RQPA 5FGMA 3WTWC 2R7FA 3H3UA 4HF2A 2E7XA 2EJRA 4GYGA 2CSOA 1BN5A 3FMQA 1YS6A 2VC1A 3I71A 1I6XA 4M74A 5JI6A 1U6GA 4U7BA 4GXOA 4CDGA 1FBQA 1LJ9A 3MCZA 1TW3A 3WU1B 1IXCA 1XMAA 1G6NA 4YG2F 1W4MA 5CVJA 1D5VA 1I1SA 1CF7A 5H6QA 3HUGA 3C1DA 1WI9A 2HDCA 1S8NA 2A61A 1TBXA 3PFIA 4YIFA 2Y75A 1U5TB 2Z3YA 1RZ4A 1G3YA 4YIIA 3BJ6A 4ETSA 4M71A 1XCBA 1P92A 5FD5A 4OINF 4EQQA 3KP7A 1S7OA 5LBQA 2M5WA 3KETA 4HBLA 1XSDA 5FFZA 5L3BA 3K9TA 2RC4A 5BMZA 3HOSA 2FBKA 3ZPLA 1O3RA 3DV8A 5CVUA 3KP3A 5JHUA 3E97A 4M72A 1BJAA 1SFUA 4HQMA 1HBXG 4ZYEA 1W7PB 2DO7A 3CUQA 1ZN2A 1P6RA 1YW7A 4N9HA 4L9NA 3LA3A 1YG2A 2K27A 3SHFA 3QP5A 4KT5C 2HEOA 1B1BA 2EWNA 1KU7A 2QBYA 3FMSA 4MQ9F 2FMLA 1RUNA 1DPUA 1B4AA 2FXAA 2W85A 2BGCA 2IJLA 1ZRCA 3HRTA 3BJOA 3LWFA 5BS6A 1ZGAA 3U1DA 3GXOA 1S3JA 2V9VA 5D5WB 2PEXA 1DP7P 1KQ8A 4G94A 4EM2A 1STZA 1RIOH 2Y0MA 3JTGA 2HQRA 4KMFA 4UV8A 3RPUA 3LAJA 3K1PA 2V1DA 5K5OA 2IA0A 3B73A 2XGXA 4LK1F 4M9SA 2OQRA 4OMZA 4PZJA 2GWRA 3T8TA 4EJVA 5HOOA 1FBSA 1BC8C 5HVQC 1BIBA 2JT1A 3ZMZA 5IT9K 1ONVA 3WE3A 2CFXA 2P5LC 2A69F 4UXNA 1HKTA 4LG0A 2P7CB 4G7ZF 3GZ5A 2ZNZA 2MD5A 4L9VA 2BYVE 3WE2A 2HFHA 1FT9A 1R23A 2VT2A 2QZ8A 3N97A 2MBFA 4EJOA 3WU0A 4HV6A 4AVPA 1B9NA 1OMIA 5BOXA 3C3WA 5LHIA 5FD6A 3LAPA 2Q0OA 3LA2A 3KEOA 1L3LA 1IF1A 3GLXA 3P9CA 3GFJA 1XSXA 5CLSA 2UXXA 2KIMA 3EQLF 1Z9CA 3I53A 3I4PA 1F1ZA 2DK5A 3QOPA 4AIKA 2M30A 4H0EA 2EFNA 1F9NA 5CVVA 2F2EA 4WXHA 3N4MA 3VFZA 1SMTA 3TOAA 1TQMA 3BOQA 1BI2A 2F5EA 3HSFA 2ACJA 2XAJA 4RAZA 1PP7U 2NYXA 1K7AA 5FLXK 3CJNA 3GEZA 2H6BA 5A2QZ 4RGUA 1FYKA 4IXAA 1DDNA 3VODA 3QAHA 1KQ9A 4A5NA 2EV5A 4IPAA 3C7JA 3VB2A 2EK5A 4WWCA 3M8EA 2EFPA 1IW7F 5HLHA 2EA2A 1XN7A 2DK8A 4LK0F 2V79A 2M8EA 2MH2A 2NS0A 1ON1A 2HR3A 2ZJ2A 3LQQA 1QZZA 3GW2A 1GHCA 1GVJA 4I01A 1EH6A 1XDSA 2FF4A 1SFXA 2EV6A 3BPVA 1UB9A 2FMYA 1J5YA 3CUOA 1U8RA 2CO5A 3I5UA 5D8LB 4O3MA 4LJZF 3FHZA 2OZ6A 4KUMA 4JBAA 3RJPA 3QPTA 2HGCA 5E1ZB 1LEAA 4I0BA 3CDHA 1IRGA 1O3SA 2DAOA 2ZO4A 2QBYB 3FX3A 1U5TA 3GWZA 1SD4A 2GQQA 3E6CC 3F21A 3SZPA 4XSXF 5E18F 2YU3A 1J59A 3SZTA 3J81Z 3HSEA 4BXUA 4NQWA 4A0YA 5DD8A 5D6EA 1T2KA 3KP4A 2A6HF 3OV8A 1HW2A 3BJAA 1JXSA 4HDVA 2E1CA 1ZG1A 2ISZA 1S7AA 3HSRA 2X0LA 4HOBA 1NHAA 4WK8F 3V4GA 1XB4A 4FX0A 4HF1A 1S29A 3BROA 2YSRA 2L54A 2V6CA 4CHUA 1TQPA 1W7PA 1Q1HA 3TO7A 3KLNA 2V1XA 2EA4A 1Z91A 2HS5A 1MJ9A 4LD5A 4Y15A 2HTSA 1OKRA 3K0LA 3IWZA 1WSUA 3Q9SA 5TJJA 3DEUA 4IRGA 2GA2A 2GAUA 3ROUA 2OU2A 2BV6A 5D5VB 2A07F 1T98A 4EGYA 2Q2EA 4OIPF 2HQNA 4RB0A 5HS9A 5DYMA 1BM9A 3FWEA 3WTSC 2K86A 1DUXC 2WTEA 1D8KA 4JK1X 1ULYA 4MTEA 3P9IA 1IN5A 1YTYA 1SD5A 5LHHA 1X3UA 1C0WA 1KQ0A 2IP2A 3P7NA 2DPDA 4Y17A 4BYYA 3TGNA 3M7GA 2YPRA 4BQAA 3WGIA 2J5OA 1FX7A 1H9TA 4ZZDA 3QPHA 4NB5A 4I0AA 2M1BA 2Y48A 2HOEA 3R61A 4HA8A 4L9JA 3VOEA 3SFZA 4IHSA 1ZH5A 5EEHA 2P5KA 1P4WA 2W25A 2KJBA 1O7FA 5D4SA 2G7UA 1LDKB 5A2QK 4I09A 2IPQX 1XMKA 4GGGA 2Z99A 3ABUA 1JGSA 5D8KB 5LGNA 2DBBA 2FSWA 4IRHA 2Z5UA 5D4RA 1A04A 2H09A 3NQOA 2H6CA 1WQ2A 3K69A 3C18A 1U5TC 1P2FA 2COMA 5KVRA 4A0XA 2VONA 3EETA 1USTA 2P6TA 5HDKA 1SAXA 2GZWA 2O03A 2Q8KA 4KDPA 2MA3A 4N9IA 1MZBA 2VE9A 1LVAA 3IC7A 2WWYA 2KKOA 5DCMB 4GYIA 3E5UA 2ZNYA 4GCVA 3P9KA 2A68F 3ERED 4UVAA 3I0TA 4IVNA 5DD4A 3F22A 5AIQA 2Z9OA 3JAMK 2QYOA 3GVAA 2CW0F 4M9ZA 1FSEA 4I98B 3SQNA 2P7VB 2O3FA 4FT8A 3J81K 1UHMA 1R58A 4R1HA 1J2XA 2PN6A 5ICFA 2OA4A 4KA4A 4U88A 3JSOA 3JTHA 5K5QA 2AS5F 1XGOA 3DXJF 1Z7UA 3WTZA 2RNJA 2STWA 2KIUA 4Q47A 1HKQA 1QO0D 4EM1A 2HKXA 1Z6TA 4P55A 2FNAA 1B9MA 3GZ6A 5E1XA 4KN7X 3TO9A 2IA1A 5ILSA 2A3SA 2DW4A 6PAXA 4AWXB 2XROA 1ZRFA 4MGRA 5EEGA 4Y13A 2LSOA 3ML6A 2MH9A 3MWMA 2PJPA 1WWXA 3RPQA 2A5YB 2EFOA 4LFUA 3U2RA 3SXYA 2K4JA 3IKVA 2VT3A 2IVMA 4S05A 3HRUA 5E8GA 4LLNA 4KNYA 1WRJA 1ODDA 4B09A 1YIOA 2VBZA 3TO6A 2VE8A 5HDGA 5LEJA 1WKMA 4LLGF 3HRMA 4ON0A 1FNNA 4HDUA 1QBJA 2PLYA 4A6EA 2ZBKA 4HZFA 2E1NA 4KYWA 4HAMA 5LRRA 2WC2A 2DT5A 1T39A 3O3KA 2RGVA 2D1VA 2KRFA 5AIPA 3ZMTA 1LDDA 5ILUA 2GXGA 3BZ6A 2OAZA 3KEQA 1JE8A 4WF2A 4R8HA 4UVCA 2IT0A 3K2ZA 1FWZA 1YLFA 5ICGA 2DQRA 3G73A 3R0AA 3ECOA 3L2CA 4U0YA 1G3TA 2KJCA 4L18B 3RIRA 3F6OA 2ZCWA 1OPCA 3TQNA 1FLIA 4ESBA 2CWEA 1K79A 2JZYA 1U78A 2O0YA 3KZYA 1ZG5A 1TTYA 1H9GA 3EDPA 4A2UA 4LB6B 1T0FA 4L5IA 1SD6A 2QUFA 1EV7A 1TW2A 5LGTA 3V8LA 2EFWA 2DQLA 1UHWA 3D5LA 2XV4S 2RVCA 3T1BA 5LGUA 1R7JA 1JHFA 3COAC 3H3ZA 2IA2A 1UCRA 4U7DA 1KGSA 5L3GA 4L5JA 2RKHA 4HF0A 4WXCA 3VEPA 4KN4X 3ISPA 1BBYA 5ICCA 2EV0A 5CVIA 1QZYA 1MGTA 5H6RA 3CO7C 1K78B 3MFKA 1O7LA 3CUQC 2L4AA 1MD0A 1YFHA 2O61A 2AXLA 3GYHX 2YX7A 1XGNA 4DQ2A 4XLPF 2XKOA 4QLCU 2FQ3A 2XUBA 1VTNC 4HX7A 3QP6A 2XAQA 3BWGA 4PGHA 4ENNA 1YQAA 1HXDA 4MHGA 5TRDA 2XAFA 3S2WA 3E6MA 1V3FA 3MEXA 3DQVC 5HLGA 3B02A 2PMUA 5DCMA 4M9XA 5DUIA 4OIOF 3F8FA 5D6FA 1YW8A 3Q9VA 4XLNF 5ERIA 3ZMSA 4PGGA 4G7OF 3IRRA 3F8MA 3GUDA 4DNCA 1REPC 1ON2A 4YFNF 3G3ZA 3WTVC 1BC7C 1YS7A 4KICA 2VN2A 3U9GA 2OQGA 4L9TA 2W84A 1DPRA 5E8IA 1Z1DA 4EMSA 4Q5SF 5J8FA 1PUEE 3DFGA 4HV5A 3HIFA 1T6SA 1V4RA 1LNWA 1R5HA 2JTVA 1E2XA 1XSVA 3GFLA 3JW4A 1XGMA 3ABTA 2QVOA 4WXDA 1F5TA 1GXQA 4JQFA 3NRVA 4G6QA 5LEKA 4N0BA 1G3WA 4YFXF 2DPUA 3F3XA 4ASNA 1FYMA 4O6JA 1S6LA 3M9AA 2DTRA 3KFWX 4TV7A 2VODA 4O5VA 3IL2A 2O6GE 3V7CA 2K4BA 2QQ9A 1I27A 3EYYA 1R5GA 2FOKA 1Z05A 1TNTA 4P5OA 3BP8A 5L3FA 2PMHA 1IXRC 3HHHA 3RDIA 3KLOA 1ZARA 2GXBA 3R0JA 3T5XA 1FC3A 1B59A 5DEQA 3HOTA 2EB7A 5HDNA 2HYGD 3M1EA 2RN7A 3LSTA 4FX4A 2ZXJA 1IN7A 4ESFA 1CGPA 1KYZA 3ZMUA 2PI0A 3W6KB 3GX4X 2W24A 5K1YA 4F7ZA 1QQIA 2OD5A 4RB1A 3BPXA 1EH8A 4EJTA 2CQKA 4G8XA 4M6YA 2K7LA 2VC0A 4CZZA 2G9WA 2FNPA 3DPTA 2QWWA 2TDXA 5ED4A 4RAYA 1LDJA 2ELHA 3F6VA 2J5PA 2R3SA 1HSJA 2UXNA 4HQEA 1BI1A 1B6AA 3E6DA 2XAHA 3ECHA 2DU9A 5LHGA 2XIGA 1LQ1A 3DF8A 2P5VA 2NAZA 4OU0A 1K6OA 2NNYA 5H20A 1R1TA 5IT9Z 3GO5A 1RNLA 4ZYDA 5ICEA 3V8KA 3I59B 1R22A 3E6BA 3ZN1A 4A12A 1HW5A 3FXUA 2XAGA 4IHTA 5AONA 1XGSA 4EV0A 4HW0A 4RGRA 2QENA 4OIRF 2MLGA 1IN6A 5F6FA 4LMYA 4LLLA 3IKTA 1F4KA 4G7HF 3KP6A 1IRFA 1FP2A 1W5TA 2ZMEA 3FZVA 3DKWA 5L3EA 2R7DA 2JPCA 3GFMA 2F5CA 3ZMVA 1SD7A 1OYYA 1QGPA 4ZZLA 4QWQA 4RGXA 2XKPA 1W5SA 5HS7A 2PFBA 4AD9A 1OR7A 2L3DA 4HLYA 1EH7A 5BPDA 2ESHA 4G9YA 2JPBA 1K78A 3HYIA 2VOOA 4HYEA 1IN8A 4LB5A 4OMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOY A;  3EUH A;  5E20 A;  5HLI A;  4ZH4 F;  5D5X B;  1MKM A;  3O2P E;  3R4K A;  5KK1 A;  3CO6 C;  4S04 A;  3ELK A;  2Z33 A;  5DV5 A;  3Q5F A;  2MLK A;  2W57 A;  2YR2 A;  2HZT A;  4HX8 A;  4ENM A;  4XRF A;  1I5Z A;  1U3E M;  3TDZ C;  3D0S A;  5FLX Z;  3V8J A;  3KP5 A;  1FOK A;  4OIQ F;  4ENK A;  4KIB A;  1HQC A;  4XSZ F;  3GF2 A;  3HTU A;  1SMY F;  3F8C A;  1ZAO A;  2QM3 A;  2HYF A;  2BEO A;  3TOB A;  3KP2 A;  3J80 Z;  1HKS A;  1PP8 F;  1R36 A;  4Z2Y A;  2WV0 A;  1YW9 A;  3T0Y A;  3M8F A;  2P4W A;  5DCF A;  2BBY A;  4Q4Z F;  4A5M A;  1IAW A;  1IUY A;  2HWV A;  2VOP A;  1O3Q A;  1HW1 A;  4NHJ A;  3T8R A;  2QLZ A;  1OYW A;  1I1G A;  2F5D A;  1W7P D;  2LKP A;  1ZYR F;  4U0V A;  3AAF A;  4RS8 A;  4AIJ A;  3KE2 A;  1J75 A;  1J9I A;  4BNC A;  4EVI A;  3J7A O;  1BIA A;  4KMU X;  3L9F A;  2IRF G;  3ZN0 A;  3FM5 A;  3FM3 A;  1XD7 A;  3WTX C;  3K1M A;  3MZY A;  4CIC A;  3FXR A;  5CJ9 A;  2O8X A;  4MTD A;  4ENJ A;  4L0Y B;  2PQ8 A;  4D0P A;  4AIH A;  5E1W A;  2X4H A;  2FA5 A;  1SFE A;  3PQJ A;  4I02 A;  4Q48 A;  4GO1 A;  1YO5 C;  1FBU A;  4P9U A;  5ILV A;  2PG4 A;  3CTA A;  3QU3 A;  2MC3 A;  2C6Y A;  2JRT A;  3WTY C;  1PDN C;  1YYV A;  3HHG A;  2PBI A;  2UWM A;  4UV9 A;  5CYV A;  3E5Q A;  3IRQ A;  4YFK F;  2ISY A;  2D45 A;  2LF8 A;  4UHT A;  1MJA A;  4BAY A;  1USS A;  4ESJ A;  2P8T A;  3WOD F;  4CGZ A;  1FSH A;  3LFK A;  4HX4 A;  3O6B B;  1H0M A;  3IHU A;  4BHP A;  3GFI A;  3MQ0 A;  5J8C A;  1FPQ A;  3WGG A;  4PCQ A;  4OOI A;  1J7K A;  3L09 A;  1TLH B;  1ZG3 A;  1T38 A;  3FF5 A;  1MDM A;  3RKY A;  3RKW A;  1BI0 A;  2ZME B;  3ZMD A;  2GIV A;  2UZK A;  3L00 A;  4ZYG A;  3TKY A;  3H92 A;  3ZQ7 A;  4RB2 C;  2VBX A;  2G7H A;  1RI7 A;  2VBY A;  2NRA C;  1ZHF A;  2XRN A;  5CVR A;  5E17 F;  1R1V A;  2P6S A;  1CF7 B;  2CG4 A;  2FBI A;  1FZP B;  5L3D A;  5JFR A;  5LRS A;  2VXZ A;  2LNB A;  1O3T A;  4E70 A;  4G6D A;  1FP1 D;  4A0Z A;  5K5R A;  3OOP A;  2BE5 F;  3I59 A;  4EJW A;  2L4M A;  3RYP A;  2V1U A;  3K1N A;  2FEZ A;  4MQV A;  1RUO A;  4PDK A;  1D3Y A;  1ZLK A;  4EGZ A;  3DPL C;  1L0O C;  3IWF A;  5DDG A;  4UNO A;  3CLO A;  3BDD A;  3I58 A;  2K02 A;  1ZRD A;  1XCV A;  1TQI A;  1R00 A;  2OBP A;  4MEX F;  3ULQ B;  2LF7 A;  5HS8 A;  4ZYH A;  1IZ1 A;  3J80 K;  5D5U B;  3RI4 A;  2QQA A;  2CGP A;  3NEU A;  2DLL A;  3MZH A;  1D8J A;  5FFX A;  3DP7 A;  2YX4 A;  2IW5 A;  3CUQ B;  2B0L A;  1LB2 A;  1KA8 A;  3RKX A;  1QNT A;  3E3V A;  4HLX A;  3F23 A;  2E7W A;  3WTU C;  2FRH A;  2QQB A;  3L7W A;  3W6J B;  2RDP A;  1HST A;  2RV8 A;  1FYL A;  1FY7 A;  4M6X A;  4KFC A;  3FMR A;  3JAM Z;  5J6X A;  3R60 A;  3WG9 A;  5F1R A;  2GA1 A;  4A6D A;  1P4A A;  4RGS A;  4UVB A;  1ZRE A;  5FB2 A;  3KZZ A;  3RTR A;  2F5F A;  1IN4 A;  2D1H A;  4RB3 C;  4CYD A;  3LQR A;  2M45 A;  1U2W A;  1P4X A;  3WGH A;  4M73 A;  4CXF A;  4IRI A;  3I54 A;  1J0R A;  4KIG A;  1QPM A;  3KCC A;  4CO8 A;  1KYW A;  1MJB A;  1JHH A;  1KU9 A;  4L0Z B;  2DI3 A;  1G3S A;  4U0W A;  4BHB A;  3FXQ A;  4IJA A;  4IF4 A;  3V7S A;  1E17 A;  2XHK A;  4UUV A;  3F8N A;  3EYI A;  1OYI A;  5BPI A;  1BOA A;  4LGW A;  3TDU C;  5L3C A;  2XAS A;  1AWC A;  1LEB A;  2FBH A;  4KIF A;  3LA7 A;  4EM0 B;  2D2W A;  1ZLJ A;  2M87 A;  4EJU A;  4LG0 B;  4WX9 A;  1R1U A;  2XVC A;  3JSP A;  2L01 A;  2OZU A;  2ZKZ A;  4I7H A;  3F72 A;  4BHC A;  3F8B A;  2EFQ A;  2ADU A;  2H94 A;  4B8X A;  5F64 A;  2H27 A;  3HRS A;  1TNS A;  1MDM B;  2L02 A;  4XBF A;  3QRF F;  2FE3 A;  4MEY F;  1GXP A;  3R6S A;  5IT3 A;  1KU2 A;  3PQK A;  2LDU A;  3HTS B;  5BQT A;  3E5X A;  2ESN A;  2STT A;  4I2O A;  1KU3 A;  1G4D A;  1UFM A;  5JR3 A;  1O57 A;  4P96 A;  1ZGJ A;  2JSC A;  3I64 A;  2KIF A;  2A6E F;  1BI3 A;  2ZFW A;  1IXS B;  2ETH A;  3RYR A;  5FO5 A;  4BH9 A;  3V7R A;  2HTJ A;  4WCG A;  3BY6 A;  5DUK A;  4FHT A;  2HKO A;  3QU6 A;  4P9F A;  2FU4 A;  3ZP5 A;  5JVT A;  3REO A;  1XDU A;  4K2E A;  4MNU A;  2NNN A;  2CYY A;  4R79 A;  1Y0U A;  3WTT C;  2VBW A;  2DFI A;  1Z6R A;  5LLQ A;  3MAJ A;  2RQP A;  5FGM A;  3WTW C;  2R7F A;  3H3U A;  4HF2 A;  2E7X A;  2EJR A;  4GYG A;  2CSO A;  1BN5 A;  3FMQ A;  1YS6 A;  2VC1 A;  3I71 A;  1I6X A;  4M74 A;  5JI6 A;  1U6G A;  4U7B A;  4GXO A;  4CDG A;  1FBQ A;  1LJ9 A;  3MCZ A;  1TW3 A;  3WU1 B;  1IXC A;  1XMA A;  1G6N A;  4YG2 F;  1W4M A;  5CVJ A;  1D5V A;  1I1S A;  1CF7 A;  5H6Q A;  3HUG A;  3C1D A;  1WI9 A;  2HDC A;  1S8N A;  2A61 A;  1TBX A;  3PFI A;  4YIF A;  2Y75 A;  1U5T B;  2Z3Y A;  1RZ4 A;  1G3Y A;  4YII A;  3BJ6 A;  4ETS A;  4M71 A;  1XCB A;  1P92 A;  5FD5 A;  4OIN F;  4EQQ A;  3KP7 A;  1S7O A;  5LBQ A;  2M5W A;  3KET A;  4HBL A;  1XSD A;  5FFZ A;  5L3B A;  3K9T A;  2RC4 A;  5BMZ A;  3HOS A;  2FBK A;  3ZPL A;  1O3R A;  3DV8 A;  5CVU A;  3KP3 A;  5JHU A;  3E97 A;  4M72 A;  1BJA A;  1SFU A;  4HQM A;  1HBX G;  4ZYE A;  1W7P B;  2DO7 A;  3CUQ A;  1ZN2 A;  1P6R A;  1YW7 A;  4N9H A;  4L9N A;  3LA3 A;  1YG2 A;  2K27 A;  3SHF A;  3QP5 A;  4KT5 C;  2HEO A;  1B1B A;  2EWN A;  1KU7 A;  2QBY A;  3FMS A;  4MQ9 F;  2FML A;  1RUN A;  1DPU A;  1B4A A;  2FXA A;  2W85 A;  2BGC A;  2IJL A;  1ZRC A;  3HRT A;  3BJO A;  3LWF A;  5BS6 A;  1ZGA A;  3U1D A;  3GXO A;  1S3J A;  2V9V A;  5D5W B;  2PEX A;  1DP7 P;  1KQ8 A;  4G94 A;  4EM2 A;  1STZ A;  1RIO H;  2Y0M A;  3JTG A;  2HQR A;  4KMF A;  4UV8 A;  3RPU A;  3LAJ A;  3K1P A;  2V1D A;  5K5O A;  2IA0 A;  3B73 A;  2XGX A;  4LK1 F;  4M9S A;  2OQR A;  4OMZ A;  4PZJ A;  2GWR A;  3T8T A;  4EJV A;  5HOO A;  1FBS A;  1BC8 C;  5HVQ C;  1BIB A;  2JT1 A;  3ZMZ A;  5IT9 K;  1ONV A;  3WE3 A;  2CFX A;  2P5L C;  2A69 F;  4UXN A;  1HKT A;  4LG0 A;  2P7C B;  4G7Z F;  3GZ5 A;  2ZNZ A;  2MD5 A;  4L9V A;  2BYV E;  3WE2 A;  2HFH A;  1FT9 A;  1R23 A;  2VT2 A;  2QZ8 A;  3N97 A;  2MBF A;  4EJO A;  3WU0 A;  4HV6 A;  4AVP A;  1B9N A;  1OMI A;  5BOX A;  3C3W A;  5LHI A;  5FD6 A;  3LAP A;  2Q0O A;  3LA2 A;  3KEO A;  1L3L A;  1IF1 A;  3GLX A;  3P9C A;  3GFJ A;  1XSX A;  5CLS A;  2UXX A;  2KIM A;  3EQL F;  1Z9C A;  3I53 A;  3I4P A;  1F1Z A;  2DK5 A;  3QOP A;  4AIK A;  2M30 A;  4H0E A;  2EFN A;  1F9N A;  5CVV A;  2F2E A;  4WXH A;  3N4M A;  3VFZ A;  1SMT A;  3TOA A;  1TQM A;  3BOQ A;  1BI2 A;  2F5E A;  3HSF A;  2ACJ A;  2XAJ A;  4RAZ A;  1PP7 U;  2NYX A;  1K7A A;  5FLX K;  3CJN A;  3GEZ A;  2H6B A;  5A2Q Z;  4RGU A;  1FYK A;  4IXA A;  1DDN A;  3VOD A;  3QAH A;  1KQ9 A;  4A5N A;  2EV5 A;  4IPA A;  3C7J A;  3VB2 A;  2EK5 A;  4WWC A;  3M8E A;  2EFP A;  1IW7 F;  5HLH A;  2EA2 A;  1XN7 A;  2DK8 A;  4LK0 F;  2V79 A;  2M8E A;  2MH2 A;  2NS0 A;  1ON1 A;  2HR3 A;  2ZJ2 A;  3LQQ A;  1QZZ A;  3GW2 A;  1GHC A;  1GVJ A;  4I01 A;  1EH6 A;  1XDS A;  2FF4 A;  1SFX A;  2EV6 A;  3BPV A;  1UB9 A;  2FMY A;  1J5Y A;  3CUO A;  1U8R A;  2CO5 A;  3I5U A;  5D8L B;  4O3M A;  4LJZ F;  3FHZ A;  2OZ6 A;  4KUM A;  4JBA A;  3RJP A;  3QPT A;  2HGC A;  5E1Z B;  1LEA A;  4I0B A;  3CDH A;  1IRG A;  1O3S A;  2DAO A;  2ZO4 A;  2QBY B;  3FX3 A;  1U5T A;  3GWZ A;  1SD4 A;  2GQQ A;  3E6C C;  3F21 A;  3SZP A;  4XSX F;  5E18 F;  2YU3 A;  1J59 A;  3SZT A;  3J81 Z;  3HSE A;  4BXU A;  4NQW A;  4A0Y A;  5DD8 A;  5D6E A;  1T2K A;  3KP4 A;  2A6H F;  3OV8 A;  1HW2 A;  3BJA A;  1JXS A;  4HDV A;  2E1C A;  1ZG1 A;  2ISZ A;  1S7A A;  3HSR A;  2X0L A;  4HOB A;  1NHA A;  4WK8 F;  3V4G A;  1XB4 A;  4FX0 A;  4HF1 A;  1S29 A;  3BRO A;  2YSR A;  2L54 A;  2V6C A;  4CHU A;  1TQP A;  1W7P A;  1Q1H A;  3TO7 A;  3KLN A;  2V1X A;  2EA4 A;  1Z91 A;  2HS5 A;  1MJ9 A;  4LD5 A;  4Y15 A;  2HTS A;  1OKR A;  3K0L A;  3IWZ A;  1WSU A;  3Q9S A;  5TJJ A;  3DEU A;  4IRG A;  2GA2 A;  2GAU A;  3ROU A;  2OU2 A;  2BV6 A;  5D5V B;  2A07 F;  1T98 A;  4EGY A;  2Q2E A;  4OIP F;  2HQN A;  4RB0 A;  5HS9 A;  5DYM A;  1BM9 A;  3FWE A;  3WTS C;  2K86 A;  1DUX C;  2WTE A;  1D8K A;  4JK1 X;  1ULY A;  4MTE A;  3P9I A;  1IN5 A;  1YTY A;  1SD5 A;  5LHH A;  1X3U A;  1C0W A;  1KQ0 A;  2IP2 A;  3P7N A;  2DPD A;  4Y17 A;  4BYY A;  3TGN A;  3M7G A;  2YPR A;  4BQA A;  3WGI A;  2J5O A;  1FX7 A;  1H9T A;  4ZZD A;  3QPH A;  4NB5 A;  4I0A A;  2M1B A;  2Y48 A;  2HOE A;  3R61 A;  4HA8 A;  4L9J A;  3VOE A;  3SFZ A;  4IHS A;  1ZH5 A;  5EEH A;  2P5K A;  1P4W A;  2W25 A;  2KJB A;  1O7F A;  5D4S A;  2G7U A;  1LDK B;  5A2Q K;  4I09 A;  2IPQ X;  1XMK A;  4GGG A;  2Z99 A;  3ABU A;  1JGS A;  5D8K B;  5LGN A;  2DBB A;  2FSW A;  4IRH A;  2Z5U A;  5D4R A;  1A04 A;  2H09 A;  3NQO A;  2H6C A;  1WQ2 A;  3K69 A;  3C18 A;  1U5T C;  1P2F A;  2COM A;  5KVR A;  4A0X A;  2VON A;  3EET A;  1UST A;  2P6T A;  5HDK A;  1SAX A;  2GZW A;  2O03 A;  2Q8K A;  4KDP A;  2MA3 A;  4N9I A;  1MZB A;  2VE9 A;  1LVA A;  3IC7 A;  2WWY A;  2KKO A;  5DCM B;  4GYI A;  3E5U A;  2ZNY A;  4GCV A;  3P9K A;  2A68 F;  3ERE D;  4UVA A;  3I0T A;  4IVN A;  5DD4 A;  3F22 A;  5AIQ A;  2Z9O A;  3JAM K;  2QYO A;  3GVA A;  2CW0 F;  4M9Z A;  1FSE A;  4I98 B;  3SQN A;  2P7V B;  2O3F A;  4FT8 A;  3J81 K;  1UHM A;  1R58 A;  4R1H A;  1J2X A;  2PN6 A;  5ICF A;  2OA4 A;  4KA4 A;  4U88 A;  3JSO A;  3JTH A;  5K5Q A;  2AS5 F;  1XGO A;  3DXJ F;  1Z7U A;  3WTZ A;  2RNJ A;  2STW A;  2KIU A;  4Q47 A;  1HKQ A;  1QO0 D;  4EM1 A;  2HKX A;  1Z6T A;  4P55 A;  2FNA A;  1B9M A;  3GZ6 A;  5E1X A;  4KN7 X;  3TO9 A;  2IA1 A;  5ILS A;  2A3S A;  2DW4 A;  6PAX A;  4AWX B;  2XRO A;  1ZRF A;  4MGR A;  5EEG A;  4Y13 A;  2LSO A;  3ML6 A;  2MH9 A;  3MWM A;  2PJP A;  1WWX A;  3RPQ A;  2A5Y B;  2EFO A;  4LFU A;  3U2R A;  3SXY A;  2K4J A;  3IKV A;  2VT3 A;  2IVM A;  4S05 A;  3HRU A;  5E8G A;  4LLN A;  4KNY A;  1WRJ A;  1ODD A;  4B09 A;  1YIO A;  2VBZ A;  3TO6 A;  2VE8 A;  5HDG A;  5LEJ A;  1WKM A;  4LLG F;  3HRM A;  4ON0 A;  1FNN A;  4HDU A;  1QBJ A;  2PLY A;  4A6E A;  2ZBK A;  4HZF A;  2E1N A;  4KYW A;  4HAM A;  5LRR A;  2WC2 A;  2DT5 A;  1T39 A;  3O3K A;  2RGV A;  2D1V A;  2KRF A;  5AIP A;  3ZMT A;  1LDD A;  5ILU A;  2GXG A;  3BZ6 A;  2OAZ A;  3KEQ A;  1JE8 A;  4WF2 A;  4R8H A;  4UVC A;  2IT0 A;  3K2Z A;  1FWZ A;  1YLF A;  5ICG A;  2DQR A;  3G73 A;  3R0A A;  3ECO A;  3L2C A;  4U0Y A;  1G3T A;  2KJC A;  4L18 B;  3RIR A;  3F6O A;  2ZCW A;  1OPC A;  3TQN A;  1FLI A;  4ESB A;  2CWE A;  1K79 A;  2JZY A;  1U78 A;  2O0Y A;  3KZY A;  1ZG5 A;  1TTY A;  1H9G A;  3EDP A;  4A2U A;  4LB6 B;  1T0F A;  4L5I A;  1SD6 A;  2QUF A;  1EV7 A;  1TW2 A;  5LGT A;  3V8L A;  2EFW A;  2DQL A;  1UHW A;  3D5L A;  2XV4 S;  2RVC A;  3T1B A;  5LGU A;  1R7J A;  1JHF A;  3COA C;  3H3Z A;  2IA2 A;  1UCR A;  4U7D A;  1KGS A;  5L3G A;  4L5J A;  2RKH A;  4HF0 A;  4WXC A;  3VEP A;  4KN4 X;  3ISP A;  1BBY A;  5ICC A;  2EV0 A;  5CVI A;  1QZY A;  1MGT A;  5H6R A;  3CO7 C;  1K78 B;  3MFK A;  1O7L A;  3CUQ C;  2L4A A;  1MD0 A;  1YFH A;  2O61 A;  2AXL A;  3GYH X;  2YX7 A;  1XGN A;  4DQ2 A;  4XLP F;  2XKO A;  4QLC U;  2FQ3 A;  2XUB A;  1VTN C;  4HX7 A;  3QP6 A;  2XAQ A;  3BWG A;  4PGH A;  4ENN A;  1YQA A;  1HXD A;  4MHG A;  5TRD A;  2XAF A;  3S2W A;  3E6M A;  1V3F A;  3MEX A;  3DQV C;  5HLG A;  3B02 A;  2PMU A;  5DCM A;  4M9X A;  5DUI A;  4OIO F;  3F8F A;  5D6F A;  1YW8 A;  3Q9V A;  4XLN F;  5ERI A;  3ZMS A;  4PGG A;  4G7O F;  3IRR A;  3F8M A;  3GUD A;  4DNC A;  1REP C;  1ON2 A;  4YFN F;  3G3Z A;  3WTV C;  1BC7 C;  1YS7 A;  4KIC A;  2VN2 A;  3U9G A;  2OQG A;  4L9T A;  2W84 A;  1DPR A;  5E8I A;  1Z1D A;  4EMS A;  4Q5S F;  5J8F A;  1PUE E;  3DFG A;  4HV5 A;  3HIF A;  1T6S A;  1V4R A;  1LNW A;  1R5H A;  2JTV A;  1E2X A;  1XSV A;  3GFL A;  3JW4 A;  1XGM A;  3ABT A;  2QVO A;  4WXD A;  1F5T A;  1GXQ A;  4JQF A;  3NRV A;  4G6Q A;  5LEK A;  4N0B A;  1G3W A;  4YFX F;  2DPU A;  3F3X A;  4ASN A;  1FYM A;  4O6J A;  1S6L A;  3M9A A;  2DTR A;  3KFW X;  4TV7 A;  2VOD A;  4O5V A;  3IL2 A;  2O6G E;  3V7C A;  2K4B A;  2QQ9 A;  1I27 A;  3EYY A;  1R5G A;  2FOK A;  1Z05 A;  1TNT A;  4P5O A;  3BP8 A;  5L3F A;  2PMH A;  1IXR C;  3HHH A;  3RDI A;  3KLO A;  1ZAR A;  2GXB A;  3R0J A;  3T5X A;  1FC3 A;  1B59 A;  5DEQ A;  3HOT A;  2EB7 A;  5HDN A;  2HYG D;  3M1E A;  2RN7 A;  3LST A;  4FX4 A;  2ZXJ A;  1IN7 A;  4ESF A;  1CGP A;  1KYZ A;  3ZMU A;  2PI0 A;  3W6K B;  3GX4 X;  2W24 A;  5K1Y A;  4F7Z A;  1QQI A;  2OD5 A;  4RB1 A;  3BPX A;  1EH8 A;  4EJT A;  2CQK A;  4G8X A;  4M6Y A;  2K7L A;  2VC0 A;  4CZZ A;  2G9W A;  2FNP A;  3DPT A;  2QWW A;  2TDX A;  5ED4 A;  4RAY A;  1LDJ A;  2ELH A;  3F6V A;  2J5P A;  2R3S A;  1HSJ A;  2UXN A;  4HQE A;  1BI1 A;  1B6A A;  3E6D A;  2XAH A;  3ECH A;  2DU9 A;  5LHG A;  2XIG A;  1LQ1 A;  3DF8 A;  2P5V A;  2NAZ A;  4OU0 A;  1K6O A;  2NNY A;  5H20 A;  1R1T A;  5IT9 Z;  3GO5 A;  1RNL A;  4ZYD A;  5ICE A;  3V8K A;  3I59 B;  1R22 A;  3E6B A;  3ZN1 A;  4A12 A;  1HW5 A;  3FXU A;  2XAG A;  4IHT A;  5AON A;  1XGS A;  4EV0 A;  4HW0 A;  4RGR A;  2QEN A;  4OIR F;  2MLG A;  1IN6 A;  5F6F A;  4LMY A;  4LLL A;  3IKT A;  1F4K A;  4G7H F;  3KP6 A;  1IRF A;  1FP2 A;  1W5T A;  2ZME A;  3FZV A;  3DKW A;  5L3E A;  2R7D A;  2JPC A;  3GFM A;  2F5C A;  3ZMV A;  1SD7 A;  1OYY A;  1QGP A;  4ZZL A;  4QWQ A;  4RGX A;  2XKP A;  1W5S A;  5HS7 A;  2PFB A;  4AD9 A;  1OR7 A;  2L3D A;  4HLY A;  1EH7 A;  5BPD A;  2ESH A;  4G9Y A;  2JPB A;  1K78 A;  3HYI A;  2VOO A;  4HYE A;  1IN8 A;  4LB5 A;  4OMY A; 
#chains in the Genus database with same CATH topology
 1AOY A;  1QU3 A;  3EUH A;  1P7J A;  4DIQ A;  4XKB A;  5E20 A;  3BTC A;  5HLI A;  3HG9 A;  1TWF J;  4ZH4 F;  5D5X B;  2CV1 A;  1MKM A;  3O2P E;  2JMW A;  3R4K A;  5KK1 A;  1QRY A;  3CO6 C;  4S04 A;  2MGQ A;  3ELK A;  2Z33 A;  5DV5 A;  3D5R C;  1YJW I;  3Q5F A;  2DXI A;  2V9K A;  1DP3 A;  4NC6 A;  3U1K A;  2X6O A;  3OYN A;  2CUF A;  4IHW A;  1ETO A;  2MLK A;  2W57 A;  2YR2 A;  2HZT A;  4HX8 A;  4JYK A;  1YJN I;  3DKX A;  4ENM A;  4XRF A;  1I5Z A;  3K70 C;  3DBR B;  1U3E M;  1VFC A;  3TDZ C;  3D0S A;  5FLX Z;  3V8J A;  5JVG F;  3KP5 A;  3S2H J;  1FOK A;  4OIQ F;  2M7B A;  4W1U A;  4ENK A;  1YE9 A;  4KIB A;  1HQC A;  1Z67 A;  4H4K C;  4XSZ F;  1ACI A;  3GF2 A;  4XON A;  3HTU A;  1XS9 A;  3GLL A;  1SMY F;  3F8C A;  1ZAO A;  2QM3 A;  2O5R A;  2HYF A;  2BEO A;  3H5N A;  3NAR A;  1E3O C;  3CP8 A;  2BXZ A;  3TOB A;  4C3J J;  3KP2 A;  1HOM A;  4XK4 A;  3J80 Z;  1HKS A;  1PP8 F;  1R36 A;  3L1P A;  4U87 A;  4XRS G;  4Z2Y A;  2CRG A;  3ZQG A;  4RDU A;  2H1K A;  2WV0 A;  1YW9 A;  3T0Y A;  2AQF A;  3M8F A;  4A3B J;  2P4W A;  5DCF A;  3LSK A;  2BBY A;  2X1E A;  3V42 A;  4Q4Z F;  2VQH A;  4DZP A;  4A5M A;  1IAW A;  1IUY A;  2HWV A;  2VOP A;  1O3Q A;  1HW1 A;  4NHJ A;  3J7Z I;  1ZK8 A;  5EG0 B;  3OYK A;  3K4J A;  2CMP A;  1YRN B;  3BR6 A;  3T8R A;  3S2D J;  2DCE A;  2QLZ A;  2BVL A;  4A3J J;  1OYW A;  1I1G A;  2F5D A;  1W7P D;  2RQQ A;  2LKP A;  1ZYR F;  2OC6 A;  3S1Q J;  4U0V A;  1JTX A;  1V55 H;  1VQ6 I;  3AAF A;  5B1B H;  4A3F J;  2Y69 H;  2K40 A;  4RS8 A;  4AIJ A;  2KIS A;  1PVE A;  3KE2 A;  3DU5 A;  4F93 B;  1J75 A;  4MIM A;  2MW8 A;  4XKW A;  4C9Y A;  1J9I A;  2IS6 A;  1T8I A;  4BNC A;  2VB6 A;  3SZG A;  3OYE A;  2DDB A;  3RCO A;  3MKW B;  3WG7 H;  4RMN A;  4EVI A;  3A1Y A;  3J7A O;  4XLA A;  4MO7 A;  2V6E A;  1U9N A;  1BIA A;  4KMU X;  3FXJ A;  3L9F A;  4D5F A;  2IRF G;  3ZN0 A;  3TW7 A;  4AU7 A;  2OF7 A;  3FM5 A;  1TWC J;  3G1O A;  3FM3 A;  2V4J C;  1XD7 A;  2ZJR F;  2FD5 A;  1MNE A;  4BXX J;  3WTX C;  1SVO A;  3K1M A;  1WFX A;  3MZY A;  4CIC A;  3FXR A;  2ME0 A;  5CJ9 A;  2O8X A;  4C2M J;  4MTD A;  2B7E A;  5FLV A;  4ENJ A;  4L0Y B;  2PQ8 A;  2PJR A;  1V5F A;  4D0P A;  4AIH A;  5E1W A;  2X4H A;  2HDW A;  2FA5 A;  3LFU A;  1SFE A;  3PQJ A;  4I02 A;  4Q48 A;  3ZQI A;  1AA7 A;  5J40 A;  3ONQ A;  2JQ7 A;  1MW7 A;  1I39 A;  2TCT A;  4GO1 A;  2RRE A;  2E1M B;  1YO5 C;  3IH3 A;  3LOC A;  4DYC A;  1FBU A;  1PJR A;  4P9U A;  5ILV A;  2PG4 A;  1BW5 A;  3CTA A;  3QU3 A;  2MC3 A;  2C6Y A;  2JRT A;  3WTY C;  2OPT A;  1WHU A;  1PDN C;  5F08 A;  4F91 B;  1YYV A;  1XPX A;  3HHG A;  2PBI A;  2UWM A;  4UV9 A;  5CYV A;  3ZGK A;  3E5Q A;  1FTZ A;  4BJ6 C;  3IRQ A;  4YFK F;  3FHN A;  2MYS A;  2ISY A;  3G2B A;  2D45 A;  4C3I J;  2LF8 A;  4UHT A;  2PMZ N;  1MJA A;  1MIJ A;  1Z3Y A;  1USS A;  2NOJ B;  2P8T A;  4BAY A;  4ESJ A;  3WOD F;  2EPF A;  4CGZ A;  4HPQ A;  1FSH A;  2LRE A;  3LFK A;  4HX4 A;  3O6B B;  4F3Q A;  2DMP A;  2W48 A;  2L9N A;  1H0M A;  4RA2 A;  2M0C A;  3IHU A;  4BHP A;  3W2W A;  3GFI A;  1CQT A;  3I4N J;  4NC8 A;  4D7N A;  3MQ0 A;  5J8C A;  1FPQ A;  3WGG A;  1RR8 C;  4PCQ A;  2WAQ N;  5EEA A;  4OOI A;  1J7K A;  3L09 A;  4AVZ A;  1TLH B;  1ZG3 A;  1T38 A;  4N4O B;  3FF5 A;  2MFZ A;  1MDM A;  3RKY A;  1VQO I;  1P9Q C;  2IXS A;  3DU6 A;  2MAB A;  3RKW A;  2DMU A;  1BI0 A;  2VLA A;  2ZME B;  3SDG A;  3ZMD A;  3JRC A;  3RQ4 A;  2GIV A;  2KFD A;  2EIJ H;  5DM6 F;  2UZK A;  1DU6 A;  1S5L C;  3L00 A;  4II3 A;  3ABM H;  4ZYG A;  4N4N B;  3TKY A;  1K4T A;  2P81 A;  3OR2 C;  3H92 A;  1T08 B;  2XAU A;  3ZQ7 A;  4JX5 A;  3ZQC A;  4XQF A;  4RB2 C;  2KLO A;  2VBX A;  1FIP A;  2G7H A;  2V9P A;  5JLX A;  2R5Z B;  1XX5 A;  5BNG A;  1RI7 A;  3OWT A;  4GFB A;  2VBY A;  4IHX A;  2NRA C;  1ZHF A;  2XRN A;  3CJT B;  5CVR A;  5E17 F;  1UJ8 A;  1R1V A;  2E36 A;  2P6S A;  1CF7 B;  2CG4 A;  3RZO J;  2FBI A;  2E5Z A;  1FZP B;  3ABK H;  5L3D A;  3HUG B;  2LVS A;  4YEL A;  5JFR A;  2VXZ A;  3IAS 2;  4EEF G;  5LRS A;  2LNB A;  2XC7 A;  2DFE A;  4E70 A;  1O3T A;  4G6D A;  1FP1 D;  2PMZ A;  1Y39 A;  4A0Z A;  3E1S A;  5K5R A;  2BW3 A;  1HDP A;  3OOP A;  2BE5 F;  3I59 A;  4BE0 A;  5C4J J;  3PM1 A;  4EJW A;  2L4M A;  2YU9 J;  2CQ7 A;  3ZQQ A;  3RYP A;  1W36 D;  2V1U A;  2V26 A;  3K1N A;  3HOX J;  2FEZ A;  2Z16 A;  1Z0X A;  2IGK A;  4KIT B;  1X1B A;  4MQV A;  1RUO A;  4PDK A;  1D3Y A;  2HXO A;  1ZLK A;  4EGZ A;  3DPL C;  2A05 A;  1L0O C;  1Y8Q B;  3IWF A;  5EYR A;  2UV1 A;  2V1N A;  5DDG A;  4UNO A;  3CLO A;  1MBK A;  3BDD A;  3I58 A;  2K02 A;  3OMY A;  1FIA A;  1XCV A;  4NDL A;  1TQI A;  4BU2 A;  2XB0 X;  4ZTJ A;  1ZRD A;  1R00 A;  2WB1 A;  2OBP A;  3KYL A;  4MEX F;  3ULQ B;  2LF7 A;  5HS8 A;  3BG6 A;  4ZYH A;  4A69 C;  1IZ1 A;  3GZN B;  4E4H A;  3J80 K;  1WJB A;  2QKL B;  3H9G A;  5D5U B;  4MFD A;  3RI4 A;  2QQA A;  1MBE A;  4UB6 C;  1N25 A;  3KIO A;  2AO9 A;  2CGP A;  1E3P A;  3NEU A;  2DLL A;  3JRG A;  3MZH A;  2Z1D A;  5FFX A;  5C4X J;  3DP7 A;  1D8J A;  1GV5 A;  3L2U A;  1YX5 A;  4BE1 A;  1ETK A;  1FOX A;  2YX4 A;  1R9T J;  2IS2 A;  2IW5 A;  5IY5 H;  3CUQ B;  2B0L A;  1LB2 A;  3ASO H;  1KA8 A;  3RKX A;  5FRM A;  4I6Z A;  1QNT A;  1BR4 A;  1JUP A;  2CW7 A;  3E3V A;  4HLX A;  3F23 A;  1XTA A;  1Y8R B;  5J1R A;  2EZH A;  4J00 A;  5K7Z A;  2E7W A;  3WTU C;  2FRH A;  2QQB A;  1M1E B;  3L7W A;  3W6J B;  2RDP A;  2DA1 A;  1HST A;  1OLT A;  1MMG A;  2RV8 A;  1FYL A;  1FY7 A;  4M6X A;  4KFC A;  3A01 B;  3I9V 2;  3K10 A;  3QOE A;  3HDD A;  3FMR A;  2VI6 A;  1FTT A;  3JAM Z;  5J6X A;  4BBS J;  2JUC A;  3ERM A;  3R60 A;  3WG9 A;  3OL4 A;  4BUP A;  4W97 A;  4A3D J;  3QYB A;  2R7O A;  5F1R A;  1IRX A;  3H1C A;  3S1R J;  3QWL A;  1NG7 A;  1RPW A;  2GA1 A;  2WY8 Q;  3Q0U A;  2XF6 A;  4RBO A;  4A6D A;  1A31 A;  2ZXW H;  1P4A A;  3PNT A;  4RGS A;  5B1A H;  3LSJ A;  1MMD A;  1Z21 A;  2RNG A;  1IUF A;  3IV5 A;  4UVB A;  1VQ4 I;  1ZRE A;  5FB2 A;  4Y7N J;  1A6I A;  2BY0 A;  3KZZ A;  3RTR A;  3KYC B;  3JRA A;  2F5F A;  1IN4 A;  2D1H A;  4RB3 C;  4CYD A;  1ETY A;  4RLF A;  2LKX A;  3LQR A;  2M45 A;  2M2E A;  1U2W A;  2OTL I;  2HXI A;  1P4X A;  5K7H A;  3WGH A;  4M73 A;  4CXF A;  4D7M A;  4IRI A;  2NS7 A;  3I54 A;  1J0R A;  2WAD A;  3TP0 A;  4KIG A;  1ORK A;  2AHQ A;  1QPM A;  3KCC A;  4CO8 A;  3JR9 A;  2WY7 Q;  1KYW A;  1MJB A;  1JHH A;  1KU9 A;  4L0Z B;  2KRC A;  2DI3 A;  2LG4 A;  1G3S A;  4U0W A;  2QA4 I;  4BHB A;  3FXQ A;  4BQO A;  1UAA A;  1Z3X A;  1SEU A;  4IJA A;  4IF4 A;  5EG0 A;  3V7S A;  2K9L A;  1E17 A;  3TW6 A;  2XHK A;  4UUV A;  3F8N A;  3EYI A;  1OYI A;  3CCV I;  2R7V A;  5BPI A;  3H36 A;  1IV6 A;  1BOA A;  4LGW A;  3TDU C;  5L3C A;  4M3G A;  2XAS A;  1AWC A;  2ECC A;  1LEB A;  2FBH A;  4KIF A;  3LA7 A;  5CQG A;  2D2W A;  2L2O A;  1ZLJ A;  2M87 A;  4AYB A;  4FE7 A;  4EM0 B;  4EJU A;  4BAC A;  4FET A;  3TP3 A;  3LSH A;  1BL0 A;  4LG0 B;  4A3G J;  4WX9 A;  1R1U A;  3S16 J;  2XVC A;  1X4P A;  1Y0N A;  2L01 A;  4UUT A;  3JSP A;  2OZU A;  2ZKZ A;  4I7H A;  5J4V A;  3NWT A;  2GXA A;  3PJR A;  2R7X A;  3J7A Y;  3F72 A;  4BHC A;  3F8B A;  2EFQ A;  3EUK L;  4RAG A;  2ADU A;  1FJL A;  2VJ4 A;  1QPI A;  2H94 A;  4B8X A;  3S14 J;  5F64 A;  2H27 A;  2O7O A;  1TL8 A;  2Q1Z B;  2NOG A;  3HRS A;  2Y9Y A;  5F27 A;  1TNS A;  5GAD J;  2L02 A;  1MDM B;  4XBF A;  3QRF F;  2VQL A;  2FE3 A;  4MEY F;  2XSD C;  1GXP A;  3R6S A;  5IT3 A;  1KU2 A;  3PQK A;  4ZYA A;  1DQU A;  3JRH A;  2LDU A;  3A4C A;  3HTS B;  4XN0 A;  2QSG X;  2XGE A;  3JCU C;  3SFI A;  1K6Y A;  5BQT A;  2E60 A;  3E5X A;  5C44 J;  3LMM A;  2ESN A;  2STT A;  3ASN H;  4I2O A;  1KU3 A;  4XMY A;  3L2W A;  1G4D A;  1UFM A;  3ZQL A;  5JR3 A;  2LOO A;  1O57 A;  4PSW A;  4P96 A;  2ELJ A;  1ZGJ A;  2K85 A;  1N75 A;  2QKM B;  2JSC A;  3I64 A;  2KIF A;  3OYB A;  4BDY A;  2DOD A;  2VAS A;  1POG A;  3BC8 A;  3OYH A;  4XR6 A;  2A6E F;  1BI3 A;  2DFF A;  2ZFW A;  1IXS B;  2KDZ A;  2ETH A;  3RYR A;  5FO5 A;  4BH9 A;  3V7R A;  2HTJ A;  1N77 A;  1VQ9 I;  1X1A A;  4WCG A;  3BY6 A;  5DUK A;  3A0H C;  4FHT A;  2OCC H;  4C2T A;  2HKO A;  3QU6 A;  4ITV A;  4P9F A;  2FU4 A;  3CF5 F;  1WJE A;  3PUB A;  2IGM A;  3ZP5 A;  2K9S A;  2H8W A;  1WGX A;  5JVT A;  3REO A;  5M5Y J;  1XDU A;  2WBM A;  4K2E A;  4MNU A;  1G8X A;  2BW3 B;  2CYY A;  2NNN A;  4BJT A;  4D5C A;  4R79 A;  1Y0U A;  2YUS A;  2BHY A;  2LRD A;  3WTT C;  3OYD A;  3PIO F;  2VBW A;  2DFI A;  4AC0 A;  2FQ4 A;  2KPM A;  1Z6R A;  3OOU A;  5LLQ A;  3MAJ A;  3K4C A;  2R5Y B;  2X51 A;  2RQP A;  5FGM A;  4DYR A;  1EA3 A;  2LD5 A;  3WTW C;  3BTI A;  1JGG A;  1D5Y A;  2R7F A;  3H3U A;  4A3C J;  2MSY A;  4HF2 A;  1TWA J;  2BZT A;  2E7X A;  3AFH A;  2EJR A;  2VPR A;  1OCC H;  4BY1 J;  4FQG A;  4GYG A;  1MND A;  4F55 A;  2CSO A;  1BN5 A;  4M3D A;  4Z6Y A;  2KRH A;  4FIS A;  3FMQ A;  3K4M A;  1YS6 A;  3MKZ A;  1MNM C;  4XRM A;  5EZH A;  3I55 I;  1TT5 B;  2VC1 A;  3A0B C;  4IKF A;  3I71 A;  1I6X A;  4M74 A;  5JI6 A;  1U6G A;  4DBQ A;  2NVX J;  4QPO A;  4U7B A;  1O4X A;  3C2H A;  4GXO A;  1PYV A;  5F0F A;  3GTJ J;  4CDG A;  1FBQ A;  3OIQ A;  2R5Z A;  1BA5 A;  2JVG A;  1LJ9 A;  3MCZ A;  1TW3 A;  1R4M B;  3WHB A;  4DW6 A;  1IXC A;  3VYS B;  3WU1 B;  1XMA A;  1MH4 A;  2I5U A;  1G6N A;  3WHC A;  1W4M A;  5CVJ A;  4YG2 F;  1D5V A;  1I1S A;  3E0J B;  1CF7 A;  3FXO A;  3PFY A;  3SYT A;  5H6Q A;  5TGT A;  3HUG A;  3C1D A;  3HM5 A;  4I76 A;  1WI9 A;  1R49 A;  5E3O A;  2HDC A;  3BR5 A;  1SAU A;  1S8N A;  2F48 A;  4NC7 A;  2A61 A;  1TBX A;  1LFB A;  2IAI A;  5E79 C;  5E3N A;  2HI3 A;  2UUZ A;  3PFI A;  4YIF A;  3G4S I;  1YOV B;  5EDN A;  2DA6 A;  2Y75 A;  3MVP A;  1NH3 A;  1U5T B;  2Z3Y A;  5EJC A;  4IHY A;  1RZ4 A;  1G3Y A;  3SJM A;  4YII A;  3BJ6 A;  4ETS A;  3LNQ A;  2CJJ A;  4M71 A;  1XCB A;  5IP7 J;  1P92 A;  5FD5 A;  4OIN F;  2DOE A;  4EQQ A;  2DA3 A;  2LY1 A;  4ZTF A;  3KP7 A;  1RET A;  1OIS A;  3IAM 2;  1S7O A;  5LBQ A;  3JRF A;  2M5W A;  4NBQ A;  3QYF A;  2M9H A;  5LFA A;  3LSR A;  3KET A;  4NQW B;  2QEX I;  4HBL A;  1XSD A;  5FFZ A;  5IOY A;  5L3B A;  3GBG A;  3K9T A;  4A3K J;  3W6V A;  2E1O A;  2COB A;  1V5G A;  1OCR H;  2RC4 A;  5BMZ A;  2CU7 A;  3H9Q A;  3HOS A;  2FBK A;  3ZPL A;  1O3R A;  3DV8 A;  3OIP A;  5CVU A;  3HEF A;  3KP3 A;  5JHU A;  1BR1 A;  3E97 A;  2VQC A;  1RKT A;  4M72 A;  1BJA A;  2EIL H;  3CLQ A;  4II2 A;  2DMT A;  1SFU A;  4HQM A;  2ID6 A;  2R7U A;  1HBX G;  1H89 C;  4ZYE A;  1W7P B;  2DO7 A;  3CUQ A;  3LSM A;  3CCQ I;  1ZN2 A;  3IUO A;  3ZR8 X;  1P6R A;  1VZ0 A;  4QIW N;  3FXL A;  5CQE A;  1YW7 A;  3BTJ A;  1UG2 A;  1DU0 A;  4YRV A;  4Y33 A;  4N9H A;  3Q3S A;  1YI2 I;  4L9N A;  1OCP A;  1VQ8 I;  3LA3 A;  1YG2 A;  2K27 A;  4M3B A;  3SHF A;  3QP5 A;  2XRL A;  4KT5 C;  1D0Z A;  2X48 A;  1OCO H;  2HEO A;  1B1B A;  2HOT A;  2EWN A;  1KU7 A;  3A01 A;  3OSF A;  3TMO A;  2E1M C;  2XSJ C;  1UMQ A;  2QBY A;  3FMS A;  1GT0 C;  4B3A A;  4Y4R A;  1W1W E;  4MQ9 F;  2FML A;  1RUN A;  3H5R A;  1DPU A;  1B4A A;  5EGO B;  2FXA A;  2W85 A;  2VPL A;  2BGC A;  2IJL A;  1ZRC A;  3HRT A;  3AG4 H;  3BJO A;  3LWF A;  5BS6 A;  1ZGA A;  2M0M A;  2Q2E B;  3S32 A;  3U1D A;  1S72 I;  3GXO A;  1S3J A;  2WAE A;  2V9V A;  5D5W B;  3DBH B;  1ZEL A;  2PEX A;  1DP7 P;  3JRD A;  1KQ8 A;  4G94 A;  4EM2 A;  4CCJ A;  2KT0 A;  3IH2 A;  3OS2 A;  3BQZ A;  4LIU A;  2R93 J;  3AL0 B;  1STZ A;  4OWR B;  1RIO H;  1ZGW A;  3M1C A;  2Y0M A;  3JTG A;  2HQR A;  2NVU B;  3S3O A;  4KMF A;  4UV8 A;  3RPU A;  3LAJ A;  3K1P A;  2V1D A;  4XOR A;  5M3F J;  5K5O A;  2IA0 A;  3B73 A;  2XGX A;  4LK1 F;  2HNH A;  2OQR A;  4M9S A;  3BCB A;  4OMZ A;  5F0C A;  4CYC B;  3J7Y J;  1K4S A;  4J01 A;  2VKD A;  4KT6 A;  4PZJ A;  2ZME C;  2GWR A;  3T8T A;  4EJV A;  3LSP A;  3AG1 H;  2F4O B;  3FIW A;  5HOO A;  2EZK A;  1FBS A;  2F4M B;  4GRI A;  2LBF B;  3OYM A;  2DN0 A;  1FOY A;  3OIO A;  1BC8 C;  1JJ8 C;  4FAS D;  5HVQ C;  1BIB A;  3OYL A;  5IP6 A;  4AUX A;  2JT1 A;  3ZMZ A;  4EAT A;  3W2A A;  4IOA F;  5IT9 K;  1ONV A;  1TP4 A;  1A5J A;  3WE3 A;  4ZDP A;  5HNH A;  2AQE A;  2HQ5 A;  2CFX A;  2NS8 A;  1OR7 C;  2KP6 A;  2Y30 A;  4BS9 A;  2P5L C;  2A69 F;  4UXN A;  1HKT A;  4LG0 A;  3ZQF A;  2BHZ A;  3HB9 A;  4CSW A;  1AKH A;  4IL6 C;  1QHH D;  3HJE A;  2P7C B;  1WJ5 A;  2QF7 A;  4G7Z F;  2ZJQ F;  1T33 A;  3BZC A;  2CW8 A;  2XB5 A;  3GZ5 A;  1B72 A;  4JP0 A;  5KHD A;  2ZNZ A;  2MD5 A;  2KIQ A;  2BYV E;  4L9V A;  3EUH C;  3MKY B;  3WE2 A;  3S15 J;  2GOM A;  2HFH A;  4IHV A;  1FT9 A;  1R23 A;  3CQZ J;  4BDZ A;  1N78 A;  1LE8 B;  2HOA A;  2JSP A;  3GME A;  3G71 I;  2VT2 A;  4CCO A;  2VXD A;  1W36 C;  1HLV A;  2QZ8 A;  4UB8 C;  4V2F A;  3N97 A;  2MBF A;  4EJO A;  3WU0 A;  1W0U A;  4HV6 A;  4AVP A;  1B9N A;  1OMI A;  5BOX A;  1SFK A;  2MC4 A;  2WB1 N;  3C3W A;  4XNF A;  5LHI A;  4E7K A;  1JJ6 C;  5FD6 A;  1ETQ A;  1TWG J;  3LAP A;  4IZZ A;  3A03 A;  2DDA A;  2ZJP F;  2Q0O A;  3LA2 A;  1UEL B;  3KEO A;  1L3L A;  2GM4 A;  1JKQ C;  1IF1 A;  4E7L A;  3CJQ B;  3GLX A;  3P9C A;  3GFJ A;  1XSX A;  5CLS A;  5HNF A;  4XLF A;  4FCY A;  3CCR I;  2UXX A;  4PFP A;  3VSL A;  3I56 I;  2KIM A;  1QA6 A;  1VF9 A;  3EQL F;  3BG9 A;  3TBI A;  2WA0 A;  3I53 A;  1Z9C A;  3I4P A;  2KZV A;  2E2H J;  4GDF A;  1F1Z A;  3HPH A;  2DK5 A;  2I8D A;  3QOP A;  4AIK A;  2M30 A;  3FDY A;  1BR2 A;  3OL3 A;  4H0E A;  2EFN A;  4BQN A;  1F9N A;  2EBI A;  2F4I A;  4D1Q A;  5CVV A;  4JOM A;  2F2E A;  1UHS A;  4WXH A;  3N4M A;  3HKZ A;  3VFZ A;  4PJJ A;  3AG3 H;  4XRS A;  1WJC A;  2NVY J;  1SMT A;  3TOA A;  1TQM A;  3BOQ A;  1BI2 A;  2X9D A;  2F5E A;  3HSF A;  2ACJ A;  4BKX A;  2XPU A;  2XAJ A;  4RAZ A;  1PP7 U;  1HC8 A;  5C3E J;  2NYX A;  2BXY A;  2VQG A;  3VPR A;  1K7A A;  2R5Y A;  2LP0 A;  2WAF A;  4V2G A;  5FLX K;  5DS9 A;  3CJN A;  3GEZ A;  2H6B A;  5A2Q Z;  4RGU A;  1FYK A;  4IXA A;  1DDN A;  2HVS A;  2JA5 J;  3VOD A;  4XIC A;  3S17 J;  2OV7 A;  2JN6 A;  3QAH A;  1KQ9 A;  5GP9 A;  3RSN A;  3K4L A;  4A5N A;  5HOD A;  2EV5 A;  4IPA A;  4I99 C;  3C7J A;  3TED A;  3VB2 A;  2EK5 A;  2HPI A;  4WWC A;  3PNY A;  3M8E A;  2EFP A;  1IW7 F;  5HLH A;  2EA2 A;  1XN7 A;  2DK8 A;  4LK0 F;  4P1W A;  1I6H J;  2QGU A;  3DTI A;  2V79 A;  2MD0 A;  2M8E A;  3CME I;  2MH2 A;  3QPL A;  2CH0 A;  2NS0 A;  3DPU A;  2JVH A;  3CCE I;  3BR1 A;  2CUZ A;  1ON1 A;  3GTK J;  3HOU J;  2HR3 A;  2ZJ2 A;  3LQQ A;  1QZZ A;  3GW2 A;  4M3F A;  1GHC A;  1GVJ A;  2R7W A;  4BE2 A;  4I01 A;  2HQA A;  2LY2 A;  1WJA A;  1EH6 A;  1ZQ3 P;  1XDS A;  2FF4 A;  1SFX A;  2EV6 A;  1WZ2 A;  3BPV A;  2IS1 A;  1UB9 A;  2FMY A;  1J5Y A;  3CUO A;  1U8R A;  2CO5 A;  3I5U A;  5D8L B;  4O3M A;  2DMQ A;  4MLO A;  4LJZ F;  1R4N B;  4PJM A;  3FHZ A;  2OZ6 A;  3LSI A;  3QQA A;  2BY3 A;  4KUM A;  4JBA A;  2O9L A;  9ANT A;  3RJP A;  3QPT A;  2HGC A;  5GAE J;  4QPQ A;  2BVM A;  5E1Z B;  1LEA A;  4S0H B;  3CDL A;  3CDH A;  4I0B A;  1X1D A;  1IRG A;  1O3S A;  2DAO A;  4AYB N;  2DYR H;  1RKW A;  5J3L A;  2ZO4 A;  2QBY B;  3FX3 A;  4A3M J;  1BJZ A;  5GAG J;  2YS9 A;  4BQQ A;  5KCM A;  1U5T A;  3GWZ A;  1SD4 A;  2GQQ A;  2X85 A;  1EKE A;  1ETV A;  1VQL I;  3E6C C;  3F21 A;  3KZI C;  4XSX F;  1X2M A;  3SZP A;  2YU3 A;  5E18 F;  2LYC A;  2L0K A;  1J59 A;  3SZT A;  3J81 Z;  1D0X A;  1HDD C;  2F5V A;  1V5E A;  2X6W A;  3A2K A;  3HSE A;  4PJL A;  4C30 A;  2Y0S N;  2DMN A;  4BXU A;  4NQW A;  4A0Y A;  5DD8 A;  5D6E A;  3RZD J;  1T2K A;  5GPA A;  1FEX A;  4XOP A;  3KP4 A;  2A6H F;  3OV8 A;  1HW2 A;  3BJA A;  4HNT A;  1WPK A;  1JXS A;  4HDV A;  2E1C A;  4LOC A;  1ZG1 A;  2CQX A;  2ISZ A;  1HA8 A;  3FXM A;  4CZC A;  1I50 J;  1F36 A;  1S7A A;  5HLT A;  3OYA A;  2H1L A;  3HSR A;  3MZ8 A;  3ZOB A;  3Q0V A;  2X0L A;  2BOL A;  3FBN B;  4HOB A;  1NHA A;  3BCA A;  4WK8 F;  3V4G A;  1XB4 A;  4NUB A;  4FX0 A;  4IEJ A;  4HF1 A;  1S29 A;  2MG4 A;  3BRO A;  2YSR A;  2L54 A;  1Y1W J;  2V6C A;  4CHU A;  1TQP A;  5FRO A;  2CQQ A;  1W7P A;  1Q1H A;  1WCM J;  3TO7 A;  4PFO A;  3KLN A;  2V1X A;  1J09 A;  1Z91 A;  2EA4 A;  2HS5 A;  3LL7 A;  3HL2 A;  1MJ9 A;  1LFU P;  5FKO A;  1VQP I;  2CQN A;  3OYG A;  4LD5 A;  3W3C A;  4Y15 A;  5IYC J;  1ETX A;  2HTS A;  1OQY A;  2L9R A;  1OKR A;  2JUG A;  3SEQ A;  3ZXS A;  1OJL A;  4PUS A;  4LG3 A;  3K0L A;  3IWZ A;  3CMM A;  4OAZ A;  2AXT C;  1WSU A;  3Q9S A;  2LLK A;  1AKH B;  1IC8 A;  5TJJ A;  4RM3 A;  4CCK A;  1A35 A;  3DEU A;  1B8I B;  3CC4 I;  1HF0 A;  3GTO J;  4IRG A;  3ESW B;  1B72 B;  2XDV A;  3U21 A;  2D5V A;  4OAY A;  4D9J A;  2GA2 A;  2HOS A;  3GTG J;  2X6X A;  2GAU A;  3BR3 A;  5EGO A;  2W82 A;  3ROU A;  1IO2 A;  2OU2 A;  3MKL A;  3KEY A;  2BV6 A;  5D5V B;  2KMU A;  2A07 F;  1T98 A;  4EGY A;  2Q2E A;  3P5J A;  5M5X J;  2K9Q A;  5GTH C;  4OIP F;  2Y0S A;  2HQN A;  4RB0 A;  4L5E A;  5HS9 A;  5DYM A;  1BM9 A;  3FWE A;  3WTS C;  5CKT A;  2K86 A;  1GVD A;  1DUX C;  1R6R A;  2WTE A;  1D8K A;  4JK1 X;  3FK7 A;  1ULY A;  4MTE A;  1Q1V A;  1YIT I;  2VIX A;  1IN5 A;  3P9I A;  5GAH J;  2FUG 2;  3I3L A;  2Y2Z A;  1YTY A;  5FKM A;  1SD5 A;  2KZG A;  3G1L A;  1JUM A;  5LHH A;  1X3U A;  1C0W A;  4HG2 A;  1TZL A;  1KQ0 A;  1I3A A;  4CYC A;  2DT7 B;  3M8J A;  2IP2 A;  2O8K A;  3P7N A;  2DPD A;  4Y17 A;  2L9S A;  2IGO A;  2HYJ A;  3CMA I;  4BYY A;  3DLL F;  3TGN A;  3M7G A;  1Z7L A;  2YPR A;  1RRJ A;  4BQA A;  3WGI A;  2W7N A;  2J5O A;  5IOZ A;  1FX7 A;  4B44 A;  5FLM J;  1H9T A;  2LBF A;  3F9K A;  2CFO A;  3PUF A;  4ZZD A;  3QPH A;  4NB5 A;  4I0A A;  1WJF A;  3S3M A;  1FMW A;  2M1B A;  2Y48 A;  2HOE A;  3R61 A;  4HA8 A;  4IQ4 A;  4L9J A;  3VOE A;  3SFZ A;  4B4C A;  1WH7 A;  4ABZ A;  5DM7 F;  4IHS A;  1ZH5 A;  5EEH A;  2P5K A;  1P4W A;  4HEA 2;  4Y52 J;  1XC5 A;  1IDY A;  2W25 A;  1Y6I A;  4XKV A;  2KJB A;  1O7F A;  3PSI A;  2LFB A;  3ZRG A;  1GLN A;  5D4S A;  1OFC X;  2XPW A;  2QCO A;  2G7U A;  1LDK B;  5A2Q K;  4I09 A;  2IPQ X;  3FKI J;  4C3H J;  2LH9 A;  4B43 A;  1ETW A;  2CUJ A;  1XMK A;  2DOF A;  4GGG A;  2Z99 A;  2ICW G;  3ABU A;  1NK3 P;  1LE8 A;  2M3A A;  3DCF A;  1JGS A;  5D8K B;  5LGN A;  2DBB A;  2ELK A;  2FSW A;  4UUS B;  4IRH A;  4FE4 A;  5FJ8 J;  2Z5U A;  5D4R A;  1A04 A;  2H09 A;  3NQO A;  2OUM A;  2H6C A;  3CDI A;  1WQ2 A;  3K69 A;  3C18 A;  5KNL A;  1U5T C;  1P2F A;  2COM A;  5KVR A;  4A0X A;  4B3X A;  5M5W J;  2ZSH B;  4PK4 A;  2VON A;  3HC7 A;  3EET A;  1UST A;  2P6T A;  5HDK A;  1SAX A;  2GZW A;  2O03 A;  2Q8K A;  4KDP A;  2MA3 A;  3H3V K;  4N9I A;  4DJA A;  2JA2 A;  2E2J J;  5FKK A;  3WU2 C;  2JK3 A;  2JA8 J;  1MZB A;  2VE9 A;  1LVA A;  3IC7 A;  2WWY A;  2KKO A;  1X4O A;  5DCM B;  4BEH A;  4GYI A;  3E5U A;  2ZNY A;  1TWH J;  4GCV A;  3QPS A;  1GUU A;  2F6C A;  5FKN A;  3P9K A;  2EQR A;  2A68 F;  3ERE D;  4UVA A;  3SEZ A;  3I0T A;  4IVN A;  5DD4 A;  5IP9 J;  2M4K A;  3F22 A;  1LFP A;  2M7A A;  1KZH A;  3BG7 A;  4A3I J;  5AIQ A;  1MBG A;  2Z9O A;  3JAM K;  3IP4 B;  2QYO A;  5EF6 A;  3GCM A;  3GVA A;  2CW0 F;  4M9Z A;  3B6C A;  2DA4 A;  1VQK I;  1FSE A;  2TRT A;  2R7Q A;  3BQY A;  2K5C A;  4I98 B;  3CZ6 A;  2P7V B;  3SQN A;  1ZTR A;  2O3F A;  4FT8 A;  3J81 K;  2VKV A;  4ZC3 A;  1UHM A;  1Z77 A;  1S9H A;  2A5W A;  5B3S H;  1SFO J;  4XLE A;  1R58 A;  4R1H A;  1J2X A;  2PN6 A;  5ICF A;  2OA4 A;  4B48 A;  5B5E C;  4KA4 A;  2ME6 A;  4U88 A;  3JSO A;  3JTH A;  2EIM H;  5K5Q A;  2AS5 F;  1XGO A;  3DXJ F;  1Z7U A;  3WTZ A;  2RNJ A;  2R7R A;  1YIJ I;  2STW A;  1E0E A;  2KIU A;  1LPQ A;  3LSG A;  4Q47 A;  1MSE C;  1HKQ A;  5KAF C;  1QO0 D;  3M4O J;  1IRZ A;  3HZJ A;  3H35 A;  4EM1 A;  2HKX A;  4PSX A;  3JRB A;  1Z6T A;  4X1E A;  3OR1 C;  3VDX A;  4P55 A;  2FNA A;  1B9M A;  2L7F P;  3GZ6 A;  4CCL A;  1AU7 A;  5E1X A;  4KN7 X;  3BR0 A;  3TO9 A;  2IA1 A;  5ILS A;  1JI8 A;  1YX3 A;  2A3S A;  2DW4 A;  4G12 A;  1K83 J;  3VWB A;  6PAX A;  4AWX B;  2XRO A;  1ZRF A;  4MGR A;  5EEG A;  4Y13 A;  4PJ0 C;  2LSO A;  3ML6 A;  2VJ5 A;  2MH9 A;  3MWM A;  4KJZ A;  2PJP A;  4YIR X;  2N8G A;  5H2F C;  3AL0 C;  3PIP F;  1WWX A;  5K7F A;  1K61 A;  1E3H A;  3ZCO A;  3RPQ A;  2A5Y B;  2EFO A;  1ZR2 A;  4LFU A;  3KYD B;  3OY9 A;  2NVT J;  1UZC A;  1X2N A;  3S3N A;  1D0Y A;  3U2R A;  4RM2 A;  1D1A A;  3OYI A;  3HOV J;  3SXY A;  2K4J A;  3IKV A;  4E7I A;  4XLH A;  5LD2 C;  2VT3 A;  2IVM A;  3CCY A;  3JRE A;  1NG6 A;  2GLO A;  2IGN A;  4S05 A;  3HRU A;  5E8G A;  4LLN A;  4KNY A;  2DOA A;  4ANJ A;  1WRJ A;  3BT9 A;  5J47 A;  3H0G J;  4RAF A;  1EJ9 A;  3BZK A;  1ODD A;  4BGD A;  1PUF B;  4B09 A;  3S93 A;  3S1M J;  3M3Y J;  1SVM A;  2IEK A;  3K4K A;  1YIO A;  3GTP J;  2VBZ A;  1P7I A;  5IPA A;  1ENH A;  4XKC A;  1F43 A;  2GIZ A;  3TO6 A;  2VE8 A;  5HDG A;  3L2V A;  4HSR A;  5LEJ A;  4DZJ A;  1WKM A;  2FX0 A;  2RAE A;  4LLG F;  2DA7 A;  3K70 D;  3HRM A;  4ON0 A;  1JKP C;  1FNN A;  4HDU A;  1QHG A;  1QBJ A;  2PLY A;  2LR8 A;  3FK6 A;  2EIN H;  2CV0 A;  3S1N J;  2EZL A;  4NNJ A;  3HPG A;  4A6E A;  5M3M J;  2ZBK A;  3DLA A;  1U9O A;  4HZF A;  2E1N A;  2ECB A;  1R71 A;  4KYW A;  5IYB J;  4HAM A;  2PX9 A;  4A3L J;  5LRR A;  2WC2 A;  4IO9 F;  2DT5 A;  2LC2 A;  3B6A A;  1T39 A;  3O3K A;  4DBR A;  4IQJ A;  2RGV A;  2D1V A;  3DBL B;  1A6Q A;  1D1B A;  2KRF A;  1YHQ I;  5AIP A;  3ZMT A;  5DTD A;  2G0E A;  3NWS A;  1LDD A;  5ILU A;  2GXG A;  3C2B A;  4CUG A;  2P0W A;  4QTR A;  3D5S C;  3BZ6 A;  2OAZ A;  2ZFU A;  3KEQ A;  1JE8 A;  4WF2 A;  4R8H A;  4CCM A;  4UVC A;  2IT0 A;  5JLW A;  3K2Z A;  1FWZ A;  1YLF A;  2JJ7 A;  5ICG A;  1TC3 C;  1AHD P;  2DQR A;  1VQ5 I;  3HKZ N;  3OYJ A;  3G73 A;  2JRM A;  2E19 A;  3R0A A;  3ECO A;  1X19 A;  4U0Y A;  1G3T A;  4F92 B;  3L2C A;  3OS0 A;  2KJC A;  1MBF A;  3VYU B;  4E6K G;  2IS4 A;  4L18 B;  3RIR A;  3H5A A;  3F6O A;  2ZCW A;  1DGW Y;  3IH4 A;  3QYE A;  4IX7 A;  1B8I A;  5E3L A;  1VQM I;  1OPC A;  3TQN A;  1FLI A;  2DJN A;  3OYC A;  4ESB A;  1VI0 A;  3HOY J;  2CWE A;  1K79 A;  2NVQ J;  2JZY A;  5GPC A;  1IJW C;  2L5Q A;  1APL C;  3CES A;  4DOZ A;  1U78 A;  2O0Y A;  1OCT C;  3MN2 A;  3KZY A;  2JWT A;  1ZG5 A;  4Y3O A;  2Y9Z A;  2HVQ A;  1GDT A;  3CD6 I;  3K2A A;  3M07 A;  1TTY A;  2W1O A;  2QSF X;  1H9G A;  3EDP A;  2VL8 A;  4A2U A;  4DYQ A;  3S8P A;  4LB6 B;  2XF7 A;  1T0F A;  2DYS H;  4L5I A;  1SD6 A;  2QUF A;  1EV7 A;  2X1D A;  1TW2 A;  3AKZ A;  5LGT A;  4X0G A;  3V8L A;  2R4G A;  2EFW A;  2DQL A;  3I4M J;  1ZR4 A;  3PO3 J;  1X3W B;  2K9N A;  1UHW A;  1WI3 A;  2M8G X;  3D5L A;  1T56 A;  2XV4 S;  2KDO A;  1VQ7 I;  2A6T A;  3G1M A;  2RVC A;  3T1B A;  5LGU A;  4BEH B;  4LIV A;  1R7J A;  2BY2 A;  3OS1 A;  1JHF A;  3COA C;  3H3Z A;  2IA2 A;  1UCR A;  4U7D A;  5EZG A;  1KGS A;  2K9M A;  5L3G A;  4HNV A;  2EIK H;  4L5J A;  3C2G A;  2L7K A;  4JX4 A;  1JKO C;  2RKH A;  4HF0 A;  1SAN A;  2GBY A;  4WXC A;  3VEP A;  2R7T A;  2LKS A;  3PO2 J;  4KN4 X;  1JT6 A;  3ISP A;  1BBY A;  4HNU A;  3HOW J;  4BBR J;  4PJN A;  5ICC A;  1VQN I;  2B9S A;  2EV0 A;  3FIS A;  5KAI C;  3CCJ I;  1FMV A;  1I3Q J;  3CC7 I;  3HOZ J;  2ZXH A;  1QZE A;  5CVI A;  1QZY A;  1MGT A;  4JX6 A;  5H6R A;  3CO7 C;  1MMN A;  1K78 B;  3MFK A;  1O7L A;  3QOD A;  3H9J A;  3CUQ C;  1W5C C;  3BG5 A;  2XF5 A;  2L4A A;  1MD0 A;  4QSH A;  3E7L A;  4AID A;  1YFH A;  2O61 A;  2AXL A;  2BY1 A;  3GYH X;  2YX7 A;  3RQI A;  1XG1 A;  1XGN A;  2X6Y A;  2X1C A;  3N05 A;  4DQ2 A;  5E3M A;  4XID A;  4XLP F;  4E7J A;  2DA2 A;  1MMA A;  2XKO A;  2XGD A;  3BLY A;  1WJD A;  3X2Q H;  3VYR B;  2FQ3 A;  4QLC U;  5F1J A;  3DEE A;  2XUB A;  2ID3 A;  4UUS A;  4HRI A;  5FKL A;  1VTN C;  4KIS A;  4HX7 A;  1HCR A;  3QP6 A;  2XAQ A;  2XPV A;  3VYT B;  3BWG A;  2H8R A;  3CC2 I;  4X6A J;  4PGH A;  1H88 C;  4ENN A;  1YQA A;  1HXD A;  3KPH A;  2E34 A;  1BOB A;  4MHG A;  2WAQ A;  2R7S A;  5TRD A;  2XAF A;  3S2W A;  3E6M A;  2KHM A;  1V3F A;  3MEX A;  3DQV C;  3K7A J;  5HLG A;  3B02 A;  2KQR A;  2R7Z J;  3HBL A;  3CCU I;  2PMU A;  5DCM A;  3EPZ A;  4M9X A;  2OTJ I;  2DJI A;  5DUI A;  1WH5 A;  2FOW A;  4OIO F;  3F8F A;  1JUS A;  3KX2 A;  5D6F A;  4BXF A;  1YW8 A;  4BL0 B;  2CUE A;  1NTC A;  3TL4 X;  3Q9V A;  3MD2 A;  4XLN F;  4BY7 J;  2EZI A;  5ERI A;  3ZMS A;  4PGG A;  3A02 A;  2GOX B;  4XL9 A;  2Z2S B;  4CA0 A;  3IRR A;  4G7O F;  3F8M A;  3GUD A;  3Q0W A;  4B1R A;  4RLQ A;  4DNC A;  3HXL A;  1REP C;  1ON2 A;  4YFN F;  2CS3 A;  3G3Z A;  3WTV C;  3O8H A;  1BC7 C;  1IV8 A;  1YS7 A;  4KIC A;  5B66 C;  3DKY A;  1LUJ B;  2VN2 A;  3U9G A;  3UKG A;  2EH3 A;  2OQG A;  4L9T A;  3NAU A;  2W84 A;  1DPR A;  2V7F A;  2B63 J;  5E8I A;  1Z1D A;  4EMS A;  4AM3 A;  3HGG A;  1W0T A;  4Q5S F;  5J8F A;  1PUE E;  1Y1V J;  3DFG A;  4HV5 A;  3HIF A;  1T6S A;  1SVL A;  3DTK A;  1V4R A;  1LNW A;  2JA7 J;  1R5H A;  3UNG C;  3DTE A;  2JTV A;  1E2X A;  1U8B A;  4J19 A;  1WVR A;  1XSV A;  3GFL A;  3JW4 A;  3FKJ A;  4XN3 A;  3UR3 C;  1XGM A;  3ABT A;  1H8A C;  4ZDO A;  3GTL J;  2QVO A;  1X58 A;  1BW6 A;  3CCL I;  2LMD A;  1MBJ A;  1GV2 A;  4WXD A;  4A93 J;  1F5T A;  1GXQ A;  4JQF A;  3NRV A;  4G6Q A;  2HPM A;  5LEK A;  4N0B A;  1XMX A;  1G3W A;  4YFX F;  2DPU A;  3F3X A;  1X1P A;  4ASN A;  2DFH A;  1FYM A;  1UG0 A;  1IGN A;  4O6J A;  1S6L A;  3M9A A;  2DTR A;  4YEJ A;  2FJ1 A;  2ZSI B;  3KFW X;  2M4G A;  2R0Q C;  3ABL H;  2ZC2 A;  4TV7 A;  1T0F C;  4XM3 A;  2VOD A;  4O5V A;  3IL2 A;  3OYF A;  2HDD A;  3DWL E;  1OCZ H;  2O6G E;  3V7C A;  2R92 J;  2K4B A;  2QQ9 A;  2VJI A;  4C2U A;  1I27 A;  5J1U A;  3EYY A;  1R5G A;  3FBI B;  2FOK A;  3L2R A;  1Z05 A;  1Y56 A;  3CMY A;  2PJR B;  1MMS A;  3EUA A;  1U0J A;  3G6E I;  2E71 A;  1TNT A;  3BTL A;  4P5O A;  3RPU D;  5TIS C;  2VKH A;  2DA5 A;  3BP8 A;  2QQ8 A;  5L3F A;  2PMH A;  1IXR C;  1QVU A;  1MSF C;  3HHH A;  3RDI A;  2W4S A;  3KLO A;  1T95 A;  1ZAR A;  2GXB A;  3R0J A;  3T5X A;  1FC3 A;  2LTP A;  5GTI C;  1YRN A;  2L7Z A;  1B59 A;  5DEQ A;  1IG7 A;  3O8G A;  2EB7 A;  5HDN A;  3HOT A;  1LKX A;  2HYG D;  1YJ9 I;  1JKR C;  3M1E A;  2RN7 A;  3LST A;  4FX4 A;  2ZXJ A;  5IYD J;  1PUF A;  2K3F A;  2VKE A;  1IN7 A;  1LVK A;  1JT0 A;  4ESF A;  3D1N I;  1CGP A;  1KYZ A;  3ZMU A;  2PI0 A;  3W6K B;  2L7M P;  1ITY A;  1RR7 A;  2DTZ A;  3GX4 X;  2W24 A;  4E7S A;  5K1Y A;  4F7Z A;  4ZJZ A;  1QQI A;  2OD5 A;  4CH7 A;  2E2I J;  2ZB9 A;  4UY8 I;  3F0C A;  4RB1 A;  3BPX A;  2E35 A;  1EH8 A;  3GTM J;  4EJT A;  2HU9 A;  2CQK A;  3ZQH A;  4G8X A;  1KON A;  4M6Y A;  1SC7 A;  2K7L A;  1ERD A;  2VC0 A;  4CZZ A;  4M3E A;  2G9W A;  3GTQ J;  5J1Y A;  2K3P A;  2FNP A;  4LIT A;  4A3E J;  3DPT A;  3VSK A;  3HGY A;  2QWW A;  4V19 K;  2IBD A;  3OSG A;  2TDX A;  3PL8 A;  4RAY A;  4XLC A;  5ED4 A;  3BG3 A;  1LDJ A;  4M6V A;  2ELH A;  3F6V A;  2J5P A;  2R3S A;  4FTH A;  2LY9 A;  2DT6 A;  1HSJ A;  3FXK A;  2WV1 A;  2UXN A;  1RC9 A;  4HQE A;  4E7H A;  1NK2 P;  2CV2 A;  1BI1 A;  1B6A A;  3E6D A;  1S7E A;  2OJE D;  4ZDL A;  2OCE A;  2NXN B;  2XAH A;  3ECH A;  1DGR M;  2KL4 A;  5J4Y A;  2HZD A;  3K4N A;  2DU9 A;  5LHG A;  2XIG A;  3CP2 A;  3RKQ A;  1LQ1 A;  3DF8 A;  3PNV A;  2P5V A;  1QVT A;  1FOW A;  2VJJ A;  1RES A;  2NAZ A;  1TT0 A;  3K6G A;  3PSF A;  3K4B A;  3CF2 A;  4OU0 A;  3W2V A;  5F0H A;  3CCM I;  1EF4 A;  1MH3 A;  1K6O A;  2E5N A;  4B47 A;  2NNY A;  3H0D A;  1MBH A;  2VUM J;  5H20 A;  4BJ5 C;  2QSH X;  1R1T A;  5IT9 Z;  1V54 H;  1JTY A;  1X3Z B;  3BR2 A;  3GO5 A;  1RNL A;  5ICE A;  2XGC A;  4ZYD A;  3V8K A;  3I59 B;  2JA6 J;  1G59 A;  3CJR B;  1G2H A;  1R22 A;  3JRI A;  3E6B A;  3ZN1 A;  4A12 A;  1HW5 A;  3DEW A;  3FXU A;  2XAG A;  4IHT A;  5CPR B;  3AG2 H;  5AON A;  1XGS A;  4EV0 A;  4HW0 A;  4RGR A;  5F04 A;  2QEN A;  4OIR F;  3SDB A;  4G6T B;  5JHF A;  2MLG A;  1IN6 A;  4HST A;  5F6F A;  2M34 A;  4LMY A;  4LLL A;  3IKT A;  4MFE A;  1F4K A;  4G7H F;  2I10 A;  3KP6 A;  2ZXI A;  1IRF A;  1IDZ A;  1FP2 A;  1W5T A;  2ZME A;  3FZV A;  3DKW A;  5L3E A;  2R7D A;  2JPC A;  3GFM A;  2F5C A;  3ZMV A;  5FRN A;  1SD7 A;  1OYY A;  2W00 A;  1X1C A;  1QGP A;  1VND A;  4ZZL A;  1D1C A;  3MMY B;  3L2Q A;  2HVR A;  4QWQ A;  4RGX A;  4CCN A;  4DGW B;  2XKP A;  1W5S A;  5HS7 A;  1R5I D;  1ZKG A;  3CCS I;  1A36 A;  2PFB A;  4F52 A;  4AD9 A;  1OR7 A;  2L3D A;  4E7Z A;  4HLY A;  1EH7 A;  5BPD A;  2ESH A;  4G9Y A;  2JPB A;  1K78 A;  4IOC F;  3HYI A;  2VOO A;  4HYE A;  1IN8 A;  2L9V A;  2Y31 A;  4LB5 A;  4OMY A;  4XOT A;  2LK2 A; 
#chains in the Genus database with same CATH homology
 1AOY A;  3EUH A;  5E20 A;  5HLI A;  4ZH4 F;  5D5X B;  1MKM A;  3O2P E;  3R4K A;  5KK1 A;  3CO6 C;  4S04 A;  3ELK A;  2Z33 A;  5DV5 A;  3Q5F A;  2MLK A;  2W57 A;  2YR2 A;  2HZT A;  4HX8 A;  4ENM A;  4XRF A;  1I5Z A;  1U3E M;  3TDZ C;  3D0S A;  5FLX Z;  3V8J A;  3KP5 A;  1FOK A;  4OIQ F;  4ENK A;  4KIB A;  1HQC A;  4XSZ F;  3GF2 A;  3HTU A;  1SMY F;  3F8C A;  1ZAO A;  2QM3 A;  2HYF A;  2BEO A;  3TOB A;  3KP2 A;  3J80 Z;  1HKS A;  1PP8 F;  1R36 A;  4Z2Y A;  2WV0 A;  1YW9 A;  3T0Y A;  3M8F A;  2P4W A;  5DCF A;  2BBY A;  4Q4Z F;  4A5M A;  1IAW A;  1IUY A;  2HWV A;  2VOP A;  1O3Q A;  1HW1 A;  4NHJ A;  3T8R A;  2QLZ A;  1OYW A;  1I1G A;  2F5D A;  1W7P D;  2LKP A;  1ZYR F;  4U0V A;  3AAF A;  4RS8 A;  4AIJ A;  3KE2 A;  1J75 A;  1J9I A;  4BNC A;  4EVI A;  3J7A O;  1BIA A;  4KMU X;  3L9F A;  2IRF G;  3ZN0 A;  3FM5 A;  3FM3 A;  1XD7 A;  3WTX C;  3K1M A;  3MZY A;  4CIC A;  3FXR A;  5CJ9 A;  2O8X A;  4MTD A;  4ENJ A;  4L0Y B;  2PQ8 A;  4D0P A;  4AIH A;  5E1W A;  2X4H A;  2FA5 A;  1SFE A;  3PQJ A;  4I02 A;  4Q48 A;  4GO1 A;  1YO5 C;  1FBU A;  4P9U A;  5ILV A;  2PG4 A;  3CTA A;  3QU3 A;  2MC3 A;  2C6Y A;  2JRT A;  3WTY C;  1PDN C;  1YYV A;  3HHG A;  2PBI A;  2UWM A;  4UV9 A;  5CYV A;  3E5Q A;  3IRQ A;  4YFK F;  2ISY A;  2D45 A;  2LF8 A;  4UHT A;  1MJA A;  4BAY A;  1USS A;  4ESJ A;  2P8T A;  3WOD F;  4CGZ A;  1FSH A;  3LFK A;  4HX4 A;  3O6B B;  1H0M A;  3IHU A;  4BHP A;  3GFI A;  3MQ0 A;  5J8C A;  1FPQ A;  3WGG A;  4PCQ A;  4OOI A;  1J7K A;  3L09 A;  1TLH B;  1ZG3 A;  1T38 A;  3FF5 A;  1MDM A;  3RKY A;  3RKW A;  1BI0 A;  2ZME B;  3ZMD A;  2GIV A;  2UZK A;  3L00 A;  4ZYG A;  3TKY A;  3H92 A;  3ZQ7 A;  4RB2 C;  2VBX A;  2G7H A;  1RI7 A;  2VBY A;  2NRA C;  1ZHF A;  2XRN A;  5CVR A;  5E17 F;  1R1V A;  2P6S A;  1CF7 B;  2CG4 A;  2FBI A;  1FZP B;  5L3D A;  5JFR A;  5LRS A;  2VXZ A;  2LNB A;  1O3T A;  4E70 A;  4G6D A;  1FP1 D;  4A0Z A;  5K5R A;  3OOP A;  2BE5 F;  3I59 A;  4EJW A;  2L4M A;  3RYP A;  2V1U A;  3K1N A;  2FEZ A;  4MQV A;  1RUO A;  4PDK A;  1D3Y A;  1ZLK A;  4EGZ A;  3DPL C;  1L0O C;  3IWF A;  5DDG A;  4UNO A;  3CLO A;  3BDD A;  3I58 A;  2K02 A;  1ZRD A;  1XCV A;  1TQI A;  1R00 A;  2OBP A;  4MEX F;  3ULQ B;  2LF7 A;  5HS8 A;  4ZYH A;  1IZ1 A;  3J80 K;  5D5U B;  3RI4 A;  2QQA A;  2CGP A;  3NEU A;  2DLL A;  3MZH A;  1D8J A;  5FFX A;  3DP7 A;  2YX4 A;  2IW5 A;  3CUQ B;  2B0L A;  1LB2 A;  1KA8 A;  3RKX A;  1QNT A;  3E3V A;  4HLX A;  3F23 A;  2E7W A;  3WTU C;  2FRH A;  2QQB A;  3L7W A;  3W6J B;  2RDP A;  1HST A;  2RV8 A;  1FYL A;  1FY7 A;  4M6X A;  4KFC A;  3FMR A;  3JAM Z;  5J6X A;  3R60 A;  3WG9 A;  5F1R A;  2GA1 A;  4A6D A;  1P4A A;  4RGS A;  4UVB A;  1ZRE A;  5FB2 A;  3KZZ A;  3RTR A;  2F5F A;  1IN4 A;  2D1H A;  4RB3 C;  4CYD A;  3LQR A;  2M45 A;  1U2W A;  1P4X A;  3WGH A;  4M73 A;  4CXF A;  4IRI A;  3I54 A;  1J0R A;  4KIG A;  1QPM A;  3KCC A;  4CO8 A;  1KYW A;  1MJB A;  1JHH A;  1KU9 A;  4L0Z B;  2DI3 A;  1G3S A;  4U0W A;  4BHB A;  3FXQ A;  4IJA A;  4IF4 A;  3V7S A;  1E17 A;  2XHK A;  4UUV A;  3F8N A;  3EYI A;  1OYI A;  5BPI A;  1BOA A;  4LGW A;  3TDU C;  5L3C A;  2XAS A;  1AWC A;  1LEB A;  2FBH A;  4KIF A;  3LA7 A;  4EM0 B;  2D2W A;  1ZLJ A;  2M87 A;  4EJU A;  4LG0 B;  4WX9 A;  1R1U A;  2XVC A;  3JSP A;  2L01 A;  2OZU A;  2ZKZ A;  4I7H A;  3F72 A;  4BHC A;  3F8B A;  2EFQ A;  2ADU A;  2H94 A;  4B8X A;  5F64 A;  2H27 A;  3HRS A;  1TNS A;  1MDM B;  2L02 A;  4XBF A;  3QRF F;  2FE3 A;  4MEY F;  1GXP A;  3R6S A;  5IT3 A;  1KU2 A;  3PQK A;  2LDU A;  3HTS B;  5BQT A;  3E5X A;  2ESN A;  2STT A;  4I2O A;  1KU3 A;  1G4D A;  1UFM A;  5JR3 A;  1O57 A;  4P96 A;  1ZGJ A;  2JSC A;  3I64 A;  2KIF A;  2A6E F;  1BI3 A;  2ZFW A;  1IXS B;  2ETH A;  3RYR A;  5FO5 A;  4BH9 A;  3V7R A;  2HTJ A;  4WCG A;  3BY6 A;  5DUK A;  4FHT A;  2HKO A;  3QU6 A;  4P9F A;  2FU4 A;  3ZP5 A;  5JVT A;  3REO A;  1XDU A;  4K2E A;  4MNU A;  2NNN A;  2CYY A;  4R79 A;  1Y0U A;  3WTT C;  2VBW A;  2DFI A;  1Z6R A;  5LLQ A;  3MAJ A;  2RQP A;  5FGM A;  3WTW C;  2R7F A;  3H3U A;  4HF2 A;  2E7X A;  2EJR A;  4GYG A;  2CSO A;  1BN5 A;  3FMQ A;  1YS6 A;  2VC1 A;  3I71 A;  1I6X A;  4M74 A;  5JI6 A;  1U6G A;  4U7B A;  4GXO A;  4CDG A;  1FBQ A;  1LJ9 A;  3MCZ A;  1TW3 A;  3WU1 B;  1IXC A;  1XMA A;  1G6N A;  4YG2 F;  1W4M A;  5CVJ A;  1D5V A;  1I1S A;  1CF7 A;  5H6Q A;  3HUG A;  3C1D A;  1WI9 A;  2HDC A;  1S8N A;  2A61 A;  1TBX A;  3PFI A;  4YIF A;  2Y75 A;  1U5T B;  2Z3Y A;  1RZ4 A;  1G3Y A;  4YII A;  3BJ6 A;  4ETS A;  4M71 A;  1XCB A;  1P92 A;  5FD5 A;  4OIN F;  4EQQ A;  3KP7 A;  1S7O A;  5LBQ A;  2M5W A;  3KET A;  4HBL A;  1XSD A;  5FFZ A;  5L3B A;  3K9T A;  2RC4 A;  5BMZ A;  3HOS A;  2FBK A;  3ZPL A;  1O3R A;  3DV8 A;  5CVU A;  3KP3 A;  5JHU A;  3E97 A;  4M72 A;  1BJA A;  1SFU A;  4HQM A;  1HBX G;  4ZYE A;  1W7P B;  2DO7 A;  3CUQ A;  1ZN2 A;  1P6R A;  1YW7 A;  4N9H A;  4L9N A;  3LA3 A;  1YG2 A;  2K27 A;  3SHF A;  3QP5 A;  4KT5 C;  2HEO A;  1B1B A;  2EWN A;  1KU7 A;  2QBY A;  3FMS A;  4MQ9 F;  2FML A;  1RUN A;  1DPU A;  1B4A A;  2FXA A;  2W85 A;  2BGC A;  2IJL A;  1ZRC A;  3HRT A;  3BJO A;  3LWF A;  5BS6 A;  1ZGA A;  3U1D A;  3GXO A;  1S3J A;  2V9V A;  5D5W B;  2PEX A;  1DP7 P;  1KQ8 A;  4G94 A;  4EM2 A;  1STZ A;  1RIO H;  2Y0M A;  3JTG A;  2HQR A;  4KMF A;  4UV8 A;  3RPU A;  3LAJ A;  3K1P A;  2V1D A;  5K5O A;  2IA0 A;  3B73 A;  2XGX A;  4LK1 F;  4M9S A;  2OQR A;  4OMZ A;  4PZJ A;  2GWR A;  3T8T A;  4EJV A;  5HOO A;  1FBS A;  1BC8 C;  5HVQ C;  1BIB A;  2JT1 A;  3ZMZ A;  5IT9 K;  1ONV A;  3WE3 A;  2CFX A;  2P5L C;  2A69 F;  4UXN A;  1HKT A;  4LG0 A;  2P7C B;  4G7Z F;  3GZ5 A;  2ZNZ A;  2MD5 A;  4L9V A;  2BYV E;  3WE2 A;  2HFH A;  1FT9 A;  1R23 A;  2VT2 A;  2QZ8 A;  3N97 A;  2MBF A;  4EJO A;  3WU0 A;  4HV6 A;  4AVP A;  1B9N A;  1OMI A;  5BOX A;  3C3W A;  5LHI A;  5FD6 A;  3LAP A;  2Q0O A;  3LA2 A;  3KEO A;  1L3L A;  1IF1 A;  3GLX A;  3P9C A;  3GFJ A;  1XSX A;  5CLS A;  2UXX A;  2KIM A;  3EQL F;  1Z9C A;  3I53 A;  3I4P A;  1F1Z A;  2DK5 A;  3QOP A;  4AIK A;  2M30 A;  4H0E A;  2EFN A;  1F9N A;  5CVV A;  2F2E A;  4WXH A;  3N4M A;  3VFZ A;  1SMT A;  3TOA A;  1TQM A;  3BOQ A;  1BI2 A;  2F5E A;  3HSF A;  2ACJ A;  2XAJ A;  4RAZ A;  1PP7 U;  2NYX A;  1K7A A;  5FLX K;  3CJN A;  3GEZ A;  2H6B A;  5A2Q Z;  4RGU A;  1FYK A;  4IXA A;  1DDN A;  3VOD A;  3QAH A;  1KQ9 A;  4A5N A;  2EV5 A;  4IPA A;  3C7J A;  3VB2 A;  2EK5 A;  4WWC A;  3M8E A;  2EFP A;  1IW7 F;  5HLH A;  2EA2 A;  1XN7 A;  2DK8 A;  4LK0 F;  2V79 A;  2M8E A;  2MH2 A;  2NS0 A;  1ON1 A;  2HR3 A;  2ZJ2 A;  3LQQ A;  1QZZ A;  3GW2 A;  1GHC A;  1GVJ A;  4I01 A;  1EH6 A;  1XDS A;  2FF4 A;  1SFX A;  2EV6 A;  3BPV A;  1UB9 A;  2FMY A;  1J5Y A;  3CUO A;  1U8R A;  2CO5 A;  3I5U A;  5D8L B;  4O3M A;  4LJZ F;  3FHZ A;  2OZ6 A;  4KUM A;  4JBA A;  3RJP A;  3QPT A;  2HGC A;  5E1Z B;  1LEA A;  4I0B A;  3CDH A;  1IRG A;  1O3S A;  2DAO A;  2ZO4 A;  2QBY B;  3FX3 A;  1U5T A;  3GWZ A;  1SD4 A;  2GQQ A;  3E6C C;  3F21 A;  3SZP A;  4XSX F;  5E18 F;  2YU3 A;  1J59 A;  3SZT A;  3J81 Z;  3HSE A;  4BXU A;  4NQW A;  4A0Y A;  5DD8 A;  5D6E A;  1T2K A;  3KP4 A;  2A6H F;  3OV8 A;  1HW2 A;  3BJA A;  1JXS A;  4HDV A;  2E1C A;  1ZG1 A;  2ISZ A;  1S7A A;  3HSR A;  2X0L A;  4HOB A;  1NHA A;  4WK8 F;  3V4G A;  1XB4 A;  4FX0 A;  4HF1 A;  1S29 A;  3BRO A;  2YSR A;  2L54 A;  2V6C A;  4CHU A;  1TQP A;  1W7P A;  1Q1H A;  3TO7 A;  3KLN A;  2V1X A;  2EA4 A;  1Z91 A;  2HS5 A;  1MJ9 A;  4LD5 A;  4Y15 A;  2HTS A;  1OKR A;  3K0L A;  3IWZ A;  1WSU A;  3Q9S A;  5TJJ A;  3DEU A;  4IRG A;  2GA2 A;  2GAU A;  3ROU A;  2OU2 A;  2BV6 A;  5D5V B;  2A07 F;  1T98 A;  4EGY A;  2Q2E A;  4OIP F;  2HQN A;  4RB0 A;  5HS9 A;  5DYM A;  1BM9 A;  3FWE A;  3WTS C;  2K86 A;  1DUX C;  2WTE A;  1D8K A;  4JK1 X;  1ULY A;  4MTE A;  3P9I A;  1IN5 A;  1YTY A;  1SD5 A;  5LHH A;  1X3U A;  1C0W A;  1KQ0 A;  2IP2 A;  3P7N A;  2DPD A;  4Y17 A;  4BYY A;  3TGN A;  3M7G A;  2YPR A;  4BQA A;  3WGI A;  2J5O A;  1FX7 A;  1H9T A;  4ZZD A;  3QPH A;  4NB5 A;  4I0A A;  2M1B A;  2Y48 A;  2HOE A;  3R61 A;  4HA8 A;  4L9J A;  3VOE A;  3SFZ A;  4IHS A;  1ZH5 A;  5EEH A;  2P5K A;  1P4W A;  2W25 A;  2KJB A;  1O7F A;  5D4S A;  2G7U A;  1LDK B;  5A2Q K;  4I09 A;  2IPQ X;  1XMK A;  4GGG A;  2Z99 A;  3ABU A;  1JGS A;  5D8K B;  5LGN A;  2DBB A;  2FSW A;  4IRH A;  2Z5U A;  5D4R A;  1A04 A;  2H09 A;  3NQO A;  2H6C A;  1WQ2 A;  3K69 A;  3C18 A;  1U5T C;  1P2F A;  2COM A;  5KVR A;  4A0X A;  2VON A;  3EET A;  1UST A;  2P6T A;  5HDK A;  1SAX A;  2GZW A;  2O03 A;  2Q8K A;  4KDP A;  2MA3 A;  4N9I A;  1MZB A;  2VE9 A;  1LVA A;  3IC7 A;  2WWY A;  2KKO A;  5DCM B;  4GYI A;  3E5U A;  2ZNY A;  4GCV A;  3P9K A;  2A68 F;  3ERE D;  4UVA A;  3I0T A;  4IVN A;  5DD4 A;  3F22 A;  5AIQ A;  2Z9O A;  3JAM K;  2QYO A;  3GVA A;  2CW0 F;  4M9Z A;  1FSE A;  4I98 B;  3SQN A;  2P7V B;  2O3F A;  4FT8 A;  3J81 K;  1UHM A;  1R58 A;  4R1H A;  1J2X A;  2PN6 A;  5ICF A;  2OA4 A;  4KA4 A;  4U88 A;  3JSO A;  3JTH A;  5K5Q A;  2AS5 F;  1XGO A;  3DXJ F;  1Z7U A;  3WTZ A;  2RNJ A;  2STW A;  2KIU A;  4Q47 A;  1HKQ A;  1QO0 D;  4EM1 A;  2HKX A;  1Z6T A;  4P55 A;  2FNA A;  1B9M A;  3GZ6 A;  5E1X A;  4KN7 X;  3TO9 A;  2IA1 A;  5ILS A;  2A3S A;  2DW4 A;  6PAX A;  4AWX B;  2XRO A;  1ZRF A;  4MGR A;  5EEG A;  4Y13 A;  2LSO A;  3ML6 A;  2MH9 A;  3MWM A;  2PJP A;  1WWX A;  3RPQ A;  2A5Y B;  2EFO A;  4LFU A;  3U2R A;  3SXY A;  2K4J A;  3IKV A;  2VT3 A;  2IVM A;  4S05 A;  3HRU A;  5E8G A;  4LLN A;  4KNY A;  1WRJ A;  1ODD A;  4B09 A;  1YIO A;  2VBZ A;  3TO6 A;  2VE8 A;  5HDG A;  5LEJ A;  1WKM A;  4LLG F;  3HRM A;  4ON0 A;  1FNN A;  4HDU A;  1QBJ A;  2PLY A;  4A6E A;  2ZBK A;  4HZF A;  2E1N A;  4KYW A;  4HAM A;  5LRR A;  2WC2 A;  2DT5 A;  1T39 A;  3O3K A;  2RGV A;  2D1V A;  2KRF A;  5AIP A;  3ZMT A;  1LDD A;  5ILU A;  2GXG A;  3BZ6 A;  2OAZ A;  3KEQ A;  1JE8 A;  4WF2 A;  4R8H A;  4UVC A;  2IT0 A;  3K2Z A;  1FWZ A;  1YLF A;  5ICG A;  2DQR A;  3G73 A;  3R0A A;  3ECO A;  3L2C A;  4U0Y A;  1G3T A;  2KJC A;  4L18 B;  3RIR A;  3F6O A;  2ZCW A;  1OPC A;  3TQN A;  1FLI A;  4ESB A;  2CWE A;  1K79 A;  2JZY A;  1U78 A;  2O0Y A;  3KZY A;  1ZG5 A;  1TTY A;  1H9G A;  3EDP A;  4A2U A;  4LB6 B;  1T0F A;  4L5I A;  1SD6 A;  2QUF A;  1EV7 A;  1TW2 A;  5LGT A;  3V8L A;  2EFW A;  2DQL A;  1UHW A;  3D5L A;  2XV4 S;  2RVC A;  3T1B A;  5LGU A;  1R7J A;  1JHF A;  3COA C;  3H3Z A;  2IA2 A;  1UCR A;  4U7D A;  1KGS A;  5L3G A;  4L5J A;  2RKH A;  4HF0 A;  4WXC A;  3VEP A;  4KN4 X;  3ISP A;  1BBY A;  5ICC A;  2EV0 A;  5CVI A;  1QZY A;  1MGT A;  5H6R A;  3CO7 C;  1K78 B;  3MFK A;  1O7L A;  3CUQ C;  2L4A A;  1MD0 A;  1YFH A;  2O61 A;  2AXL A;  3GYH X;  2YX7 A;  1XGN A;  4DQ2 A;  4XLP F;  2XKO A;  4QLC U;  2FQ3 A;  2XUB A;  1VTN C;  4HX7 A;  3QP6 A;  2XAQ A;  3BWG A;  4PGH A;  4ENN A;  1YQA A;  1HXD A;  4MHG A;  5TRD A;  2XAF A;  3S2W A;  3E6M A;  1V3F A;  3MEX A;  3DQV C;  5HLG A;  3B02 A;  2PMU A;  5DCM A;  4M9X A;  5DUI A;  4OIO F;  3F8F A;  5D6F A;  1YW8 A;  3Q9V A;  4XLN F;  5ERI A;  3ZMS A;  4PGG A;  4G7O F;  3IRR A;  3F8M A;  3GUD A;  4DNC A;  1REP C;  1ON2 A;  4YFN F;  3G3Z A;  3WTV C;  1BC7 C;  1YS7 A;  4KIC A;  2VN2 A;  3U9G A;  2OQG A;  4L9T A;  2W84 A;  1DPR A;  5E8I A;  1Z1D A;  4EMS A;  4Q5S F;  5J8F A;  1PUE E;  3DFG A;  4HV5 A;  3HIF A;  1T6S A;  1V4R A;  1LNW A;  1R5H A;  2JTV A;  1E2X A;  1XSV A;  3GFL A;  3JW4 A;  1XGM A;  3ABT A;  2QVO A;  4WXD A;  1F5T A;  1GXQ A;  4JQF A;  3NRV A;  4G6Q A;  5LEK A;  4N0B A;  1G3W A;  4YFX F;  2DPU A;  3F3X A;  4ASN A;  1FYM A;  4O6J A;  1S6L A;  3M9A A;  2DTR A;  3KFW X;  4TV7 A;  2VOD A;  4O5V A;  3IL2 A;  2O6G E;  3V7C A;  2K4B A;  2QQ9 A;  1I27 A;  3EYY A;  1R5G A;  2FOK A;  1Z05 A;  1TNT A;  4P5O A;  3BP8 A;  5L3F A;  2PMH A;  1IXR C;  3HHH A;  3RDI A;  3KLO A;  1ZAR A;  2GXB A;  3R0J A;  3T5X A;  1FC3 A;  1B59 A;  5DEQ A;  3HOT A;  2EB7 A;  5HDN A;  2HYG D;  3M1E A;  2RN7 A;  3LST A;  4FX4 A;  2ZXJ A;  1IN7 A;  4ESF A;  1CGP A;  1KYZ A;  3ZMU A;  2PI0 A;  3W6K B;  3GX4 X;  2W24 A;  5K1Y A;  4F7Z A;  1QQI A;  2OD5 A;  4RB1 A;  3BPX A;  1EH8 A;  4EJT A;  2CQK A;  4G8X A;  4M6Y A;  2K7L A;  2VC0 A;  4CZZ A;  2G9W A;  2FNP A;  3DPT A;  2QWW A;  2TDX A;  5ED4 A;  4RAY A;  1LDJ A;  2ELH A;  3F6V A;  2J5P A;  2R3S A;  1HSJ A;  2UXN A;  4HQE A;  1BI1 A;  1B6A A;  3E6D A;  2XAH A;  3ECH A;  2DU9 A;  5LHG A;  2XIG A;  1LQ1 A;  3DF8 A;  2P5V A;  2NAZ A;  4OU0 A;  1K6O A;  2NNY A;  5H20 A;  1R1T A;  5IT9 Z;  3GO5 A;  1RNL A;  4ZYD A;  5ICE A;  3V8K A;  3I59 B;  1R22 A;  3E6B A;  3ZN1 A;  4A12 A;  1HW5 A;  3FXU A;  2XAG A;  4IHT A;  5AON A;  1XGS A;  4EV0 A;  4HW0 A;  4RGR A;  2QEN A;  4OIR F;  2MLG A;  1IN6 A;  5F6F A;  4LMY A;  4LLL A;  3IKT A;  1F4K A;  4G7H F;  3KP6 A;  1IRF A;  1FP2 A;  1W5T A;  2ZME A;  3FZV A;  3DKW A;  5L3E A;  2R7D A;  2JPC A;  3GFM A;  2F5C A;  3ZMV A;  1SD7 A;  1OYY A;  1QGP A;  4ZZL A;  4QWQ A;  4RGX A;  2XKP A;  1W5S A;  5HS7 A;  2PFB A;  4AD9 A;  1OR7 A;  2L3D A;  4HLY A;  1EH7 A;  5BPD A;  2ESH A;  4G9Y A;  2JPB A;  1K78 A;  3HYI A;  2VOO A;  4HYE A;  1IN8 A;  4LB5 A;  4OMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...