5GAHJ

Rnc in complex with srp with detached ng domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
134
structure length
134
Chain Sequence
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
total genus 24
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5gahJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5gahJ01
1VQLI 3CCRI 3CCQI 1VQ8I 2JQ7A 2OTJI 2ZJRF 1VQ5I 1YITI 3I56I 3I55I 4IO9F 1YJWI 4IOCF 1YHQI 1VQOI 3DLLF 2E35A 1YJ9I 3CJSB 2K3FA 3CD6I 2ZJPF 4IOAF 1VQPI 3PIPF 1FOWA 1S72I 5GAEJ 1YJNI 1HC8A 3CMAI 3CMEI 3PIOF 2QEXI 3CF5F 1FOXA 3CJRB 3EGVB 1VQ6I 1YI2I 3CCVI 1VQ9I 2H8WA 5DM7F 3J7ZI 3G6EI 1VQ7I 1Y39A 1ACIA 2QA4I 3CJQB 2FOWA 1FOYA 5DM6F 2E34A 2ZJQF 3CCSI 1YIJI 1MMSA 5GADJ 1VQKI 5GAGJ 3G71I 3G4SI 3CC7I 2E36A 2OTLI 3CJTB 3CCLI 3CC2I 3CCUI 4UY8I 4V19K 5JVGF 3CCEI 3CC4I 1QA6A 1WIBA 2NXNB 3CCJI 1VQ4I 5GAHJ 1VQMI 3CCMI 3J7YJ 1VQNI
chains in the Genus database with same CATH superfamily
4PDKA 4R1HA 5LBQA 1VZ0A 1VQ8I 1X3ZB 1IDZA 5LGUA 1BR1A 2AQEA 1ETWA 1I27A 3I56I 2EJRA 3RDIA 2K3PA 3F6OA 2VJ4A 2VT3A 1T2KA 3AG4H 1Z7LA 3SZTA 3WTWC 5FLXK 3RKWA 1YG2A 4LITA 5GP9A 3SZPA 3WG7H 1YJ9I 3M4OJ 2VIXA 2RV8A 1OPCA 2DMPA 3ISPA 2P8TA 3ZQHA 3F23A 4KNYA 3LOCA 4MHGA 1XMAA 4JQFA 3AKZA 2L4MA 3WU1B 4IOAF 2PJRB 3ABLH 2ME6A 1VQPI 1QVTA 1N78A 3M8EA 2IPQX 1X2MA 3IC7A 3FK6A 2M3AA 4XR6A 3TOBA 1P92A 3I4NJ 4RAGA 2M0CA 3F72A 2A6EF 1ZG1A 3BZ6A 3H0GJ 3EQLF 2Z2SB 3TO7A 1V5GA 2D45A 1HA8A 3IH4A 1JUSA 5L3EA 1RUNA 3V4GA 4BBRJ 2CQKA 2LBFB 2XF6A 2MBFA 1TNTA 2EIMH 2GAUA 5JFRA 2KIMA 2DDAA 3E6BA 3KLOA 2KRHA 1BI2A 2Q8KA 1FZPB 3S16J 2BV6A 3L7WA 2CYYA 1KU9A 2JTVA 3I64A 5HLTA 2PLYA 2FNPA 3MN2A 4PGGA 3EUAA 1S7AA 4I0BA 4N9HA 1ZYRF 4A5MA 4PJ0C 1NK2P 3ABUA 3BDDA 3C1DA 4BE2A 2Z33A 2WY8Q 2ZXIA 5JVGF 1SC7A 1IUYA 1TQIA 3R4KA 4B3XA 3RCOA 5E3LA 4ZJZA 3WTYC 4ESFA 3VYTB 2PMZA 2N8GA 4OMYA 3RKYA 5GAHJ 5CKTA 4II2A 4XK4A 2HYGD 3CCMI 1BI0A 2F6CA 4XLAA 3O8HA 1JXSA 4QPQA 3OSFA 2ZB9A 1E3HA 2VKHA 1YFHA 2OU2A 4M3EA 4RB1A 5FGMA 2EINH 4GRIA 4XOTA 2OTJI 3K2ZA 2R5ZB 4WWCA 1PYVA 1UAAA 4A3JJ 3PL8A 2IJLA 5LEJA 3ZQFA 5H6QA 2VJIA 3K69A 3ECHA 1XGOA 1XD7A 2LRDA 1WFXA 3EYIA 2CV1A 3TP0A 4JX5A 4C2TA 4EMSA 3VYSB 4DQ2A 2ETHA 2H6BA 2XDVA 4CYDA 3GTJJ 5KVRA 5ICGA 4KYWA 1FIAA 3ZMDA 2LNBA 1LQ1A 3BLYA 4UUVA 2YUSA 2K3FA 2MW8A 3HG9A 3KX2A 2E5ZA 4PCQA 4R79A 5F1RA 4BJ6C 2LR8A 4GXOA 2LF7A 1W36C 1YJNI 4H0EA 1BC7C 4FHTA 2QSHX 4XRSG 5LLQA 1FYMA 1LKXA 1B1BA 1EA3A 1MMDA 1R5GA 2J5OA 3FXQA 4M6XA 1MD0A 2F4MB 2NNNA 4J01A 1KYWA 1MKMA 2EFWA 3FBIB 2WB1N 4B43A 3RIRA 3IH3A 1FMWA 2ZFUA 2ZMEC 2CQ7A 1Y39A 2BY3A 3U21A 3JRGA 2I10A 3ZGKA 1FLIA 2KFDA 3W6JB 3A4CA 2W84A 2XB0X 4O3MA 3AFHA 2UXNA 2B63J 4IKFA 2NVYJ 1NG7A 1R6RA 2WAFA 2E71A 1DPUA 2W1OA 3J80Z 2HTSA 3HEFA 3JRFA 1B9NA 1WZ2A 3LFUA 3QPTA 3KYCB 1DQUA 2ZMEB 1DPRA 3ZMUA 4C9YA 5JHUA 2ID3A 5HNHA 2L7FP 4ZZDA 5BOXA 4HF0A 4HBLA 5ERIA 4O5VA 1P4XA 5EJCA 5E1WA 4DNCA 3C2GA 5K7ZA 1IF1A 3HGYA 3GF2A 2V79A 1N25A 5CQGA 5IPAA 3GX4X 1T8IA 1IXRC 1E3OC 4A3BJ 1GV5A 4UB6C 1QVUA 4V2FA 4XSXF 4CDGA 3BG7A 4B48A 3F9KA 4AWXB 4E6KG 3BQYA 3T1BA 3TL4X 4A0YA 4YFXF 2LFBA 2M30A 4QTRA 1BC8C 2X51A 2AXLA 1ZTRA 3DCFA 2F5CA 1JUPA 4X0GA 5HOOA 4Z6YA 1XSDA 1USTA 3L9FA 1ERDA 3SHFA 4QWQA 2BOLA 2QQBA 1S6LA 2MH9A 1R4MB 3HDDA 4XICA 3QQAA 3P7NA 4G9YA 2LLKA 1FP2A 3S2WA 2WWYA 3CP8A 2FEZA 3O6BB 2HS5A 2KPMA 4L5JA 2F5DA 5F6FA 1R49A 1IV8A 4HG2A 1H88C 3S93A 3CDHA 4IL6C 5HDNA 2X48A 4HW0A 1TC3C 1XGMA 4L9VA 1P4AA 3K4LA 5L3FA 3WU2C 4EM0B 1R5ID 3M1CA 1U8BA 2WV0A 3WG9A 4IZZA 1JT0A 3DTIA 3KCCA 4HDVA 5DUIA 1TLHB 3IH2A 4HX7A 1HW1A 1FJLA 3ZQCA 1C0WA 3SQNA 1F1ZA 3G2BA 3EUHA 4M74A 5AONA 5J8CA 1GVDA 2HKXA 1RKTA 1CF7B 1ZELA 2L0KA 2DU9A 2EZLA 2IA1A 3OYJA 3MAJA 2B9SA 2WADA 2ESHA 3PIOF 3K9TA 2FSWA 2P4WA 5FO5A 5DYMA 3COAC 4I6ZA 2YSRA 4E7LA 2IEKA 3LSHA 1T56A 3DLAA 3MD2A 3S1QJ 1XN7A 2DBBA 3CLOA 4D0PA 1KU7A 3ZP5A 3GFIA 2IXSA 3M8JA 3JTHA 3OIPA 1QBJA 1LDKB 3PM1A 3QU6A 3DPUA 4ZYGA 4ZYDA 5GTIC 4OIRF 3MEXA 2E34A 3F6VA 5JVTA 1OCOH 2M7BA 2KIUA 2VQLA 4E7SA 3VYUB 2W85A 1U78A 1WJBA 4NC7A 3E3VA 4BU2A 3QRFF 3UKGA 2NAZA 2ISZA 4FCYA 4HNVA 3L2CA 5L3GA 1YS7A 2PJRA 2H8RA 2MD5A 4BY1J 3LSGA 3P5JA 5LRSA 1OYWA 1JT6A 2QGUA 5ICFA 4KIFA 2OQGA 2LY9A 2Y48A 1HCRA 4UY8I 3S2DJ 2JK3A 2PEXA 1K79A 1OCTC 1LDDA 1YYVA 1RETA 4KN7X 4BHPA 2P0WA 3BY6A 5H6RA 2OZ6A 1FBSA 1JE8A 2PMUA 1A6QA 2QYOA 4YEJA 5CPRB 2NRAC 3K4JA 2RC4A 3ZXSA 5LHGA 5J6XA 2L54A 1DP7P 4RM2A 2LBFA 4IJAA 4A6DA 2Y9ZA 2W7NA 3BG6A 2R4GA 3WTZA 3S3OA 2XUBA 2G9WA 1IRGA 1MNEA 4TV7A 5BPDA 1V3FA 2MLKA 1ODDA 1LUJB 3HJEA 3A0HC 4M72A 2Y2ZA 3A02A 4D5CA 2VE9A 5DCFA 2CW8A 4MEXF 2BY0A 1R71A 3VODA 5K5RA 2YU9J 4BY7J 3JRDA 3IL2A 3IP4B 3GLXA 1UG0A 2CFOA 3LWFA 4IQ4A 4XMYA 3ZQGA 4F52A 4AVZA 4UUSB 3TQNA 4E7KA 2PFBA 4L0ZB 1VNDA 2VBWA 3HSFA 3WTTC 4XKCA 2QQ8A 5ILUA 2DO7A 1VF9A 4GCVA 5D5VB 4ZYAA 2VASA 2V9PA 3EUKL 3DFGA 4CUGA 4RMNA 1I50J 3FXLA 1STZA 2K86A 2HU9A 1AU7A 4M9SA 1IDYA 4FE4A 3PFYA 4HAMA 1R1UA 1W7PB 1X3WB 3DEWA 2UXXA 3I4PA 5CQEA 5D5UB 2R5ZA 4XLFA 2EFNA 2DPDA 5KAIC 5C4JJ 2IW5A 1MBHA 2F5EA 1VQ7I 2CQNA 3U1KA 3ESWB 1ACIA 3PQJA 3DU6A 3ML6A 4E7JA 2IT0A 4HEA2 4F91B 2QA4I 2KL4A 3KE2A 3RQIA 2DA7A 1ETVA 2FNAA 2GZWA 1ZGJA 3SZGA 5A2QK 3S2HJ 2GWRA 2DMNA 2KQRA 3GVAA 3OYMA 4YFKF 3S3NA 2HOAA 5DTDA 2JA7J 2EH3A 2DCEA 3S14J 2NS7A 3DBLB 3DKWA 5FD5A 2BVMA 3LNQA 4O6JA 1Y1VJ 3G71I 4IRIA 2ZSHB 2EV0A 2E36A 4G6TB 3JRCA 2NNYA 2WAQA 1CGPA 2H1KA 3CO6C 3MKWB 1X1DA 4P9FA 5M3MJ 2DOEA 1P4WA 2HGCA 5KAFC 2DA6A 4LIVA 3CC4I 3GFMA 1Z0XA 5DUKA 2GM4A 4CSWA 1IN7A 2Q2EB 1I39A 2RQQA 3BC8A 4M3DA 4ESJA 2K4BA 2V4JC 2VOPA 3R61A 4YIFA 2DFFA 3S8PA 1UMQA 2DT5A 3K4KA 3DTEA 2K9SA 4MTDA 5K5QA 4BGDA 3J7YJ 1A31A 4CO8A 5KNLA 1EF4A 4D1QA 3RI4A 4ZTJA 1PUEE 2EV5A 4A5NA 2WB1A 3X2QH 1OKRA 2Q1ZB 4LGWA 4RA2A 1X1BA 4UHTA 3ZR8X 3OIOA 3WGGA 5AIPA 2W48A 2JPBA 5EDNA 2Z5UA 4N4NB 3I55I 1QNTA 3QU3A 3CESA 3K0LA 2ZMEA 1YIOA 4HSRA 1TP4A 4UB8C 1K78B 1TWFJ 1SVOA 4M9XA 3S3MA 2O5RA 4OWRB 4BXXJ 4LK0F 2MGQA 3TP3A 1R00A 4DW6A 1E3PA 1Z1DA 1ETXA 3NEUA 4WXHA 5F27A 4BEHB 3Q0VA 1MDMA 1ORKA 5J8FA 3I5UA 5FRMA 1ZLKA 4RM3A 1HW5A 3CCYA 5LRRA 1FOWA 2VE8A 2R7SA 2FOKA 1B6AA 2UUZA 2XAFA 3FXJA 5FKKA 4DJAA 4A3GJ 3OIQA 4KT6A 3HOZJ 1D0XA 4U0WA 1QU3A 2IGNA 2KJCA 3GZ6A 4PJLA 2V9KA 2KDOA 2R7OA 1IW7F 4CH7A 5D4RA 5IT9K 1IRXA 1KZHA 3GLLA 3BZCA 2B0LA 3M3YJ 3FKJA 1U5TA 4MIMA 1J5YA 3QWLA 5F04A 2P5VA 2CV0A 4FX4A 5FD6A 1Z3XA 1D1CA 3K4MA 6PAXA 4HPQA 2P81A 1MSFC 1HKTA 2Y30A 3IKTA 2FMLA 1KU2A 2FOWA 3BJAA 4DYRA 4A12A 3J7AO 2CG4A 2K4JA 3HSRA 4FQGA 4AIKA 3WTSC 1V54H 2KIQA 3SFZA 3O2PE 3W6KB 1WPKA 5TRDA 2IA0A 1O57A 2R7DA 1H9TA 3J7AY 4MO7A 3G4SI 4S05A 3OSGA 2OF7A 5EEGA 1B4AA 1P9QC 2Z16A 3PJRA 3PUFA 3H3VK 1CF7A 2E19A 2VLAA 2EA2A 2DN0A 1Y1WJ 2HDWA 3DF8A 3HIFA 3AL0B 3CCEI 2WAEA 2TDXA 4PSWA 3SDGA 3T8RA 2OD5A 1U3EM 2R7RA 3E5XA 2LTPA 1EH6A 2QUFA 4FISA 4NDLA 2VPLA 4MEYF 2CO5A 5ICCA 3KPHA 1F36A 3IAM2 4OMZA 3P9KA 4OAZA 3HB9A 1O7FA 3MZ8A 2LKXA 2OJED 3EUHC 1D8KA 4I09A 2W00A 3U2RA 4LG3A 3BG9A 2VOOA 2K85A 4M71A 1BBYA 2RNGA 4AIHA 2JZYA 4EM1A 3A03A 5EEAA 1FTZA 1JHHA 5EYRA 2L9SA 1RUOA 1ZRFA 4LG0B 1ZH5A 3UNGC 3WTXC 1JGGA 1TZLA 3NRVA 4A3LJ 2X4HA 1TT5B 5CVVA 1SD6A 4I2OA 3M8FA 1SFKA 4E7HA 4CA0A 1NG6A 3WGIA 3RJPA 2L9NA 3OS2A 4PFOA 5D5WB 5AIQA 2KISA 1W36D 2KP6A 1J0RA 2G0EA 1LVAA 3BPXA 4RLQA 3ABKH 3IAS2 3WTVC 3BP8A 3IRRA 4OU0A 2R5YA 2RAEA 1HC8A 1P2FA 1K4SA 3FBNB 3EPZA 3MKYB 3WU0A 1MMGA 2EZIA 2CUJA 3AG3H 5HLGA 3KETA 3ULQB 2R7TA 4KA4A 1R58A 1OFCX 1FTTA 1TTYA 3LA3A 3MFKA 3ECOA 1GUUA 4WCGA 5M5WJ 2XRLA 2YX7A 4LMYA 1D1BA 4IEJA 2XASA 1W5SA 5BPIA 4C3JJ 4CICA 2NOGA 3CMMA 4RGXA 3TOAA 1X58A 4AIJA 2ZCWA 3CJQB 1K4TA 3ZMVA 2CQQA 2GBYA 2VQGA 2QVOA 4V2GA 2M4KA 2ESNA 4UUSA 1YS6A 1BOBA 4LD5A 4WXDA 3TDUC 3Q9SA 3KP5A 5FFZA 3Q0UA 2R7FA 4BJ5C 3MQ0A 1L3LA 2XAGA 2HOSA 3ZCOA 5LD2C 1ZR4A 1QGPA 1RKWA 1J09A 4HQEA 4MQ9F 1YO5C 3LSMA 4G6DA 1V55H 2UV1A 2DMUA 1T95A 2R7QA 3CCLI 3L00A 3CC2I 3PO3J 3CCUI 1S5LC 1FSEA 1LVKA 2X1EA 2A69F 3GMEA 4PJMA 5CVUA 4F55A 3J81Z 4ENJA 1D5YA 4GYIA 5BMZA 5DD8A 4E4HA 3PNYA 1MMNA 1W7PA 4EEFG 4IHSA 1FWZA 4RAZA 3GUDA 5B66C 5M5YJ 2DQRA 2HWVA 3C2BA 3Q5FA 4D5FA 2DTRA 2E1NA 5IP9J 4Z2YA 1ITYA 3KP6A 4M3GA 5IOZA 1OLTA 1UFMA 1A6IA 3FISA 2EBIA 1Y0NA 2CS3A 3GW2A 2HDCA 4NHJA 1I1GA 3RKXA 4JX4A 3WTUC 3LQQA 5FFXA 4EJUA 3BTJA 1YITI 3GTMJ 1TWCJ 3DP7A 4A3DJ 4G7OF 1SEUA 2LKPA 2PJPA 3PFIA 1OYIA 4W1UA 3BWGA 1APLC 3KP4A 3JAMZ 3GFJA 4HA8A 3N97A 1IV6A 4G7ZF 2H09A 2CH0A 1POGA 5LEKA 2Y0SN 5D8LB 2G7HA 5LGTA 2HDDA 4RGUA 2Q2EA 2M8GX 3EDPA 4ENKA 1DDNA 1LEAA 1Z6TA 3R0JA 1I5ZA 2FMYA 2E7XA 2DT7B 1LJ9A 2IBDA 5J3LA 1IJWC 5LHHA 2IVMA 4C30A 4BXUA 3HBLA 3OYHA 3T0YA 3OYNA 3E6DA 1Z7UA 5K1YA 1QZZA 3RPUA 4HOBA 4RAYA 2DMTA 1E2XA 1T6SA 1RNLA 1TT0A 1EV7A 2ECBA 1OR7C 3KEOA 4UUTA 3S1NJ 3HOWJ 1LPQA 2ELJA 4IVNA 3BR6A 4AYBN 4BL0B 5D8KB 4L5EA 2M45A 1G4DA 1JTYA 1Z9CA 5HLIA 4EVIA 1K78A 3RYRA 5E17F 5FKOA 1XX5A 1FOYA 4NC8A 3LAPA 4ZC3A 3I53A 5E8IA 2IRFG 1HOMA 2V26A 5CVRA 3U1DA 4BEHA 2ZKZA 1QHHD 1SANA 3E6MA 5IT3A 5EF6A 1ZQ3P 3HRSA 3D1NI 5TGTA 3HC7A 1BR4A 3CJTB 3BOQA 1IG7A 3GEZA 5FLMJ 2LYCA 4BH9A 1EKEA 3L1PA 1HKSA 4BDZA 1UB9A 1RESA 2H27A 1P7IA 2GXBA 3LSTA 4Y7NJ 4EJOA 2DI3A 3K6GA 3PSFA 2BVLA 1QRYA 3CCJI 5J4YA 4IQJA 2MH2A 2DLLA 4AVPA 2HZDA 2DTZA 1WKMA 1ZR2A 1ENHA 1V5FA 5C3EJ 2O3FA 2HXIA 3DPLC 3W2WA 5J4VA 1A35A 4L0YB 2LMDA 2RGVA 4IHYA 4ASNA 1O3SA 5DCMA 5F1JA 4E7IA 2VONA 1Z6RA 3CCRI 3K4NA 4U88A 2V1XA 5B1AH 2ZJRF 2P5LC 2HVSA 1QHGA 2XVCA 3PUBA 2IAIA 1XMKA 2RN7A 1YJWI 2F5VA 1MDMB 1WJ5A 4HF2A 2X1CA 1U5TC 3C2HA 2W4SA 4RB3C 2D1VA 2YS9A 1W7PD 1Y6IA 1DU6A 3F8BA 3A01B 2CW0F 4PSXA 2QKMB 2QF7A 1WH5A 3GO5A 1OCZH 2K7LA 3TW7A 4II3A 3IHUA 3RKQA 5F64A 3L2QA 1YX3A 3NQOA 4UV9A 1U5TB 4RDUA 2P7VB 1LFBA 3BG5A 3HUGB 3FX3A 4YG2F 1AKHB 3K1NA 4AUXA 4X6AJ 2OUMA 5HS7A 2VPRA 4M6VA 2L9RA 3VB2A 1P6RA 1W1WE 1EH8A 3WODF 1GV2A 2QEXI 3PNTA 3RZOJ 2P6TA 5C4XJ 4P1WA 2VB6A 1BJAA 2L02A 2B7EA 3CF2A 2K27A 1SFOJ 1ZK8A 2E1MC 1BIBA 1TW3A 1ZREA 4ABZA 2JRMA 1PJRA 4LG0A 2FBKA 2Z3YA 4UV8A 2VXZA 3GTOJ 1TWHJ 2FUG2 3BR1A 4MLOA 3E5QA 3A1YA 1SMTA 2OCEA 2WV1A 4G8XA 1SAUA 3CZ6A 2DFHA 4MNUA 3ZQ7A 1ZRDA 2O9LA 4I7HA 2PN6A 2E1MB 2HYJA 3FM3A 3I71A 4N4OB 3S32A 4C2UA 1MBGA 2MLGA 1IO2A 2VKDA 3DKXA 3SXYA 4A0ZA 3HOSA 4J00A 1G3YA 1X2NA 3BROA 2DYRH 1MNDA 3P9CA 4FETA 3RPQA 5HDGA 3RPUD 3TW6A 1XC5A 5LHIA 1HSTA 2E5NA 2DAOA 1D0YA 2FD5A 2JPCA 1MGTA 3N4MA 3G73A 1MSEC 3HOUJ 2MSYA 1LE8B 3SJMA 1F9NA 1Z91A 2XSJC 4MTEA 2L4AA 3AG2H 1WVRA 3H92A 4DBQA 4B09A 1VQ4I 1BA5A 2CU7A 3OV8A 1WI9A 3JSOA 4KIGA 3HRTA 1U9NA 2GIZA 4XKBA 3CLQA 5IP6A 4G7HF 2QKLB 1OCCH 5BS6A 4LOCA 3VDXA 1T39A 1YLFA 3T8TA 1OJLA 1FBUA 1VQ5I 4XLPF 2OZUA 3HRMA 2GLOA 4NQWA 3OYFA 1SAXA 3P9IA 1RR8C 2IP2A 2Y75A 1XB4A 1YW7A 3K7AJ 2HEOA 1Y56A 3H36A 4U7DA 2FXAA 3OR2C 3PSIA 2R7XA 3GBGA 2R7VA 3H5AA 4JYKA 3V8LA 4XQFA 2M5WA 4IXAA 2JWTA 1G8XA 2R5YB 1YE9A 3K1PA 1JKPC 4FT8A 3IUOA 2XSDC 1X19A 3SEQA 1ON2A 2XAHA 2BW3A 1I1SA 3HKZN 1WSUA 5GTHC 2OC6A 4RB2C 1F5TA 1BR2A 1LDJA 2VKVA 4I99C 4CYCA 1R4NB 1S3JA 4Y33A 2E7WA 5D6FA 4M3FA 1RPWA 3CP2A 3KZZA 1FYKA 3L2UA 1H89C 2R3SA 5HLHA 5E1ZB 3PNVA 3K70C 1SVMA 1ZLJA 3I9V2 3VYRB 1XTAA 4EQQA 1YI2I 2FBHA 3JREA 2H8WA 2L9VA 4XBFA 1G2HA 4JBAA 5TJJA 1ON1A 2ZXJA 1IZ1A 2DFIA 4R8HA 5DM7F 2HKOA 2EZHA 3FXRA 3BJOA 3U9GA 3VFZA 3F8NA 4B1RA 2COBA 5DV5A 4YELA 4HNUA 1WWXA 3I4MJ 2DODA 2LG4A 3OYAA 1ZGAA 4ANJA 2EIKH 2VBYA 4LLGF 1PDNC 3MCZA 1Z21A 1U8RA 2VC0A 2DJNA 1GHCA 2FE3A 3WHBA 3CTAA 3G1OA 3JSPA 4ENMA 3S1MJ 2K9QA 1W5TA 2AS5F 2ICWG 2DMQA 2VQCA 5FKNA 1FNNA 4UNOA 1UELB 4FASD 5ILVA 1TQPA 3ZN0A 3E97A 3I54A 1P7JA 3BCAA 4CCJA 2E1OA 2HI3A 5B3SH 5IY5H 2HQRA 5DS9A 2ECCA 2Y0SA 2J5PA 3LQRA 3HSEA 2STWA 1KU3A 1WJCA 3A2KA 4IRGA 3M9AA 2XKPA 2V6EA 1JI8A 2Z99A 1DP3A 4BJTA 4YFNF 3HHGA 2KZGA 2XF5A 2OA4A 2ZXWH 5ED4A 4Y13A 1SFXA 2DOAA 3BZKA 2CFXA 4Y52J 2LC2A 1J75A 3OR1C 1YQAA 3DXJF 4HV6A 2FX0A 3KLNA 4JX6A 1JUMA 4KMUX 1T0FA 3JRBA 4GGGA 1MJ9A 5M3FJ 3BR2A 4BYYA 3OYEA 2LF8A 4AYBA 2COMA 1OR7A 3OL3A 4W97A 3TO6A 5FROA 2YX4A 4CHUA 3ZPLA 2ZFWA 4BQAA 2GA2A 4QIWN 2A6TA 1ZARA 2DOFA 5HNFA 4IO9F 5BQTA 4HRIA 4IOCF 1ZG3A 3WE3A 1ETQA 1SMYF 5E1XA 3TGNA 2HQNA 4A2UA 3V8KA 1ZHFA 4FTHA 1V4RA 3ASNH 1UZCA 4P9UA 3OYLA 4MFDA 1WHUA 5JLXA 4B47A 4F3QA 1YW9A 1IXCA 3M7GA 3CD6I 2BYVE 4G94A 3QAHA 1H9GA 1SD4A 1ETOA 3W3CA 3TKYA 2L7KA 2MABA 3OOUA 1FPQA 1X3UA 3S17J 3PIPF 1OQYA 3QP6A 4NUBA 5L3BA 5GAEJ 1X4OA 4BQQA 2XROA 4RGSA 1X1CA 4DYCA 3HYIA 4A6EA 1XCVA 3R6SA 2GIVA 4KMFA 3F0CA 1PUFB 3F3XA 1LB2A 2XPVA 2DQLA 3W2VA 4LLLA 3CF5F 2VJ5A 2CGPA 3FXMA 3KYDB 4P96A 4KICA 5F0HA 2XIGA 5IOYA 4OIPF 2XGCA 3GTQJ 3J7ZI 4AC0A 2OPTA 5CYVA 3ABTA 2K9NA 2MC4A 4KDPA 2M9HA 2CRGA 3ZMTA 5DM6F 2L2OA 4DBRA 3A01A 2VN2A 1WJAA 2DT6A 5D5XB 3GYHX 3H9GA 1YIJI 4ESBA 5FLXZ 3DEUA 2R93J 3REOA 3CDLA 2VI6A 1G3SA 1D1AA 3V7RA 4CCNA 3K4BA 2EFQA 3HUGA 4ZH4F 1AKHA 1A36A 5IP7J 2EV6A 3ZMSA 1ETKA 4J19A 1N75A 2BEOA 2O6GE 1WI3A 1IN5A 1M1EB 1SD5A 2DW4A 5DCMB 4V19K 1FX7A 4XN0A 4UVCA 4B3AA 3IWFA 1ZG5A 2E1CA 2NXNB 2Y9YA 2K9LA 4CCOA 3KEQA 2F4OB 1IN8A 4M3BA 3AL0C 3F8MA 4OIQF 1I3QJ 2ZC2A 4Q48A 1MJBA 2RKHA 4DYQA 3MKZA 3DQVC 1JJ8C 2IS4A 4L9NA 4RGRA 2JUCA 2GXGA 4XONA 5K5OA 3HOTA 1VQNI 1IN4A 1JHFA 1NTCA 1MH3A 3JRHA 3PO2J 3DBRB 2K5CA 2ELKA 4DZPA 3DTKA 2BHYA 2DDBA 2LH9A 2NVUB 3R0AA 2BBYA 1RI7A 4CXFA 1MNMC 2XPUA 3NWTA 4EJTA 5F0FA 2M0MA 4G6QA 5CVIA 5H20A 2EPFA 3MKLA 2VBXA 3MZYA 3BTLA 3OS1A 1OCRH 2F48A 1GVJA 1XGNA 5CLSA 4BNCA 1LE8A 1K6YA 4XNFA 2GOMA 3E6CC 5EGOA 2QQAA 2OBPA 2QENA 3MWMA 5DD4A 5E8GA 4HX4A 2D2WA 4Q5SF 1YRNA 2A07F 4WXCA 1KYZA 2RQPA 3C18A 4M6YA 2JJ7A 3IV5A 1B59A 3CMAI 3H9JA 3RQ4A 1BW5A 4XRSA 1JKQC 3EGVB 2QQ9A 2HOEA 2JMWA 4ON0A 3HRUA 4JK1X 2KMUA 1VTNC 4Q47A 2WBMA 1KA8A 4EM2A 1S7OA 1K61A 1FP1D 2BGCA 2HQAA 1W0TA 1XSXA 3G1LA 5FJ8J 5FRNA 5IYDJ 1IN6A 1WH7A 3N05A 1B8IB 2Z9OA 2X85A 1AA7A 2M87A 1G6NA 3HOVJ 2W24A 2F5FA 4Y4RA 1TWGJ 3NARA 4A0XA 2X6XA 1FEXA 2XAJA 2LVSA 4ZDLA 3FK7A 4KUMA 3F8FA 2XB5A 2XHKA 4EJVA 2P5KA 4C2MJ 4XLCA 1D8JA 3SEZA 2EQRA 5GAGJ 1JKOC 1WCMJ 5JHFA 2Y31A 3H35A 4LB5A 2O0YA 3KP7A 3OL4A 2JSPA 3HKZA 3B73A 3OYBA 4N0BA 1HBXG 3V42A 1QA6A 5D6EA 1O3TA 3JCUC 5E3OA 2KRFA 2H6CA 2O8KA 3LSRA 3HPGA 1N77A 2X6YA 3I3LA 5GPAA 2QBYB 2VC1A 4NQWB 2V1DA 3W2AA 4P5OA 4QLCU 3NAUA 2VL8A 1D0ZA 2IGKA 1XMXA 5FLVA 2XGEA 4WX9A 5IYCJ 2M7AA 2CWEA 3QOEA 3L2RA 3HOYJ 4PZJA 2JQ7A 1HF0A 1BM9A 2GA1A 4PGHA 1HLVA 1IGNA 1XGSA 4MQVA 2GXAA 1FC3A 2H1LA 2R7UA 2BW3B 2EILH 2VBZA 4Y3OA 1ETYA 4U0YA 4H4KC 2I5UA 2XGXA 3HTSB 3CJNA 2AXTC 5J47A 3BQZA 2CW7A 1J9IA 4ETSA 5F08A 1AWCA 2UZKA 3KZIC 2KT0A 4IRHA 1H0MA 1F4KA 3CJSB 1XDUA 4CYCB 3CDIA 5B1BH 1SVLA 1LFUP 4BDYA 3V8JA 3WHCA 1J2XA 4BHBA 3M1EA 2QWWA 2LK2A 3MMYB 3ROUA 2ZJPF 1CQTA 1SD7A 3QPHA 3OYIA 1IC8A 3FWEA 1OISA 2K02A 4M9ZA 4HNTA 2ZJ2A 2TCTA 4WF2A 4P55A 4B4CA 1B72B 4GDFA 4A3KJ 3D5LA 4XN3A 4XRFA 1WJFA 1VQ9I 2E60A 4B8XA 3ERMA 2NOJB 2E2JJ 3ZQIA 2WA0A 2W25A 2LREA 5DDGA 3T5XA 2BHZA 2R92J 2IGMA 2G7UA 2BZTA 1TWAJ 4X1EA 4BXFA 3Q9VA 1Z67A 4AIDA 1T08B 2GQQA 1S29A 1RZ4A 5HODA 1A04A 4HSTA 2XGDA 4C3HJ 5JLWA 1I3AA 2ZJQF 1T0FC 1FSHA 2XKOA 1MMSA 2JVHA 3L2VA 5FB2A 3K4CA 1GT0C 1EH7A 4U7BA 3CMYA 1O3RA 2XF7A 2O61A 2L7ZA 2VODA 3CC7I 2OV7A 4F93B 2QM3A 2XAUA 5JR3A 1MJAA 1TNSA 2HNHA 3LA2A 4EATA 2A6HF 2HFHA 1ZRCA 4EGYA 2ME0A 2Z1DA 3H0DA 1Y8QB 2MYSA 1PUFA 3L2WA 4CCMA 2MD0A 4ZDOA 1WIBA 3GTGJ 2YU3A 3DWLE 1XS9A 3VOEA 1Q1VA 1MBJA 1UHSA 4NC6A 4QSHA 3H3ZA 2ZXHA 2HVRA 1K6OA 1VQMI 1LNWA 2HYFA 2WAQN 4JOMA 2JA5J 2PBIA 4MFEA 1HDDC 2DA3A 4GFBA 2A5YB 5J1RA 5F0CA 3TDZC 3CUQA 3BTCA 3G1MA 4RB0A 2IGOA 4FE7A 2NVXJ 1U9OA 4AU7A 4XL9A 4XOPA 4LJZF 1UG2A 4AM3A 4XLEA 4OOIA 2M1BA 4S0HB 2BXZA 2CJJA 4A3MJ 3LL7A 5ICEA 3E7LA 3HL2A 2PG4A 3D0SA 4A3FJ 2O8XA 1PP7U 1G59A 3E1SA 3KIOA 1YHQI 2W57A 2KKOA 1VQOI 3DLLF 3FHNA 2D5VA 3ERED 4KITB 1I6HJ 1BN5A 4LFUA 2JUGA 5HS9A 1R1VA 3JTGA 1QPMA 1T33A 2R7ZJ 1X1AA 2HVQA 3GWZA 5HDKA 1DUXC 5FKMA 2HZTA 4U0VA 3J81K 1D3YA 3I59B 3GTLJ 3FKIJ 2QZ8A 1S72I 5HVQC 3PQKA 2VUMJ 2DFEA 2DA2A 5LGNA 2IS2A 3K70D 1E17A 3OWTA 3H1CA 1R22A 2LP0A 2A61A 1HW2A 3CMEI 3QYFA 3R60A 1EJ9A 2D1HA 4IHWA 2JA6J 2K40A 2RDPA 2KLOA 2DA4A 3CCVI 2ZNYA 2BE5F 2F4IA 4IHXA 3ZQQA 3FF5A 3ZN1A 4A3CJ 2LKSA 2CUZA 4XM3A 2AQFA 3GFLA 1BI1A 4ZTFA 4BACA 3FXUA 4IX7A 2HPMA 4JP0A 2EK5A 5FKLA 4BQNA 2XAQA 1DU0A 1YX5A 4OAYA 1D5VA 3VSKA 3LFKA 1BI3A 2LY1A 5EEHA 3JR9A 4LLNA 2I8DA 3JRIA 3CCSI 5EG0A 1VI0A 2FQ4A 2RVCA 3FM5A 3JAMK 3V7CA 1S9HA 2PI0A 1SFEA 4XIDA 1VQKI 3DU5A 2FBIA 2EA4A 2XPWA 4NBQA 1T98A 4IHVA 2XV4S 2EIJH 5E3MA 4HLXA 2P7CB 3V7SA 2EFPA 4ZYHA 1KQ8A 4ZZLA 3C3WA 3HM5A 2AO9A 2JRTA 2NVQJ 5K7FA 1QPIA 2AHQA 4I76A 1W5CC 5HS8A 3B6AA 1FT9A 2K9MA 2FQ3A 1MBFA 4PJJA 3UR3C 2CV2A 5B5EC 3E5UA 3OMYA 2PQ8A 2EB7A 4IF4A 3WGHA 3M07A 3VWBA 3D5SC 2IA2A 5JI6A 1JKRC 1Z77A 2OAZA 1Y0UA 4ENNA 2FA5A 2FF4A 4F7ZA 3OYCA 2NS0A 3CQZJ 2JSCA 1L0OC 3OYGA 4BS9A 3LAJA 4EJWA 1B8IA 4GO1A 4GYGA 2FJ1A 1VQLI 1R23A 2LD5A 3OYDA 3BG3A 3KP2A 3OS0A 2KZVA 3VPRA 3GZ5A 5L3CA 2V9VA 3RYPA 3F21A 4G12A 3FXKA 4PJNA 1MH4A 1DGRM 5EGOB 5A2QZ 2A5WA 2E35A 1RR7A 2X9DA 3BJ6A 2VXDA 1RRJA 3K1MA 3KEYA 1YRNB 2FU4A 1QZYA 2JT1A 2O7OA 3OY9A 4XKWA 5J1YA 2LOOA 4L18B 1MZBA 2CSOA 3OYKA 4BKXA 3B6CA 3BR0A 1S8NA 3HTUA 3HOXJ 3QPLA 2JA2A 1FY7A 3LA7A 2F2EA 1WQ2A 3ZQLA 1YW8A 2Q0OA 1NHAA 3OOPA 3H3UA 2QBYA 2MG4A 3Q0WA 3L09A 3EETA 1NH3A 3LSIA 2X6WA 3O3KA 3J80K 4OIOF 2A68F 4BHCA 3BT9A 3TBIA 1VFCA 2RREA 2QSFX 1WJEA 4FX0A 4HDUA 3K2AA 3SYTA 1O3QA 4XRMA 1REPC 2HTJA 1X1PA 2VKEA 3LSKA 1GDTA 1IRFA 2LSOA 2W82A 3IKVA 1IAWA 3C7JA 1XG1A 3FMRA 1UHMA 5D4SA 4RLFA 3HHHA 4DGWB 4NB5A 4BAYA 3VEPA 4KISA 2ZNZA 4YIRX 2L3DA 3TEDA 4HF1A 4KT5C 2DK8A 2L7MP 4QPOA 2V1UA 3HZJA 3SFIA 3RZDJ 1NK3P 3HGGA 3NWSA 1R9TJ 2M8EA 5ILSA 2HQ5A 2V7FA 1TQMA 1BL0A 1FMVA 2M2EA 1SFUA 1ZGWA 1R1TA 4HQMA 4DOZA 4AD9A 1AOYA 4A93J 4RAFA 1IUFA 4RS8A 3IRQA 1W4MA 1BIAA 3ASOH 2YR2A 1Z3YA 4UVBA 1B72A 2Y0MA 2X0LA 4DZJA 2CUFA 2BY2A 1MW7A 2CMPA 2WY7Q 4Y17A 5KK1A 2IS1A 2P6SA 2R0QC 4HZFA 1MBKA 1LFPA 3ABMH 2ZSIB 3FMSA 2HOTA 1HQCA 2DJIA 1XPXA 3W6VA 5IT9Z 3LSJA 1U0JA 2PX9A 3IWZA 1RIOH 1G3TA 3CCQI 3JRAA 2VJJA 4KJZA 1JJ6C 2WC2A 4KIBA 1U2WA 1G3WA 3ZOBA 4HV5A 2BXYA 2GOXB 2M34A 5E20A 1PP8F 4U87A 3EYYA 1HXDA 2ADUA 1JGSA 1USSA 1HSJA 2RNJA 2KRCA 4L5IA 1ONVA 2A05A 1MMAA 4CCKA 2OQRA 2KIFA 2X1DA 5KCMA 1MBEA 1QZEA 3AG1H 1S7EA 5M5XJ 3BPVA 1JTXA 5DEQA 1FBQA 5KHDA 3ONQA 5EZHA 4EV0A 1RC9A 4A3EJ 2JA8J 4N9IA 5J1UA 3DPTA 4PUSA 4YRVA 4KN4X 1F43A 2PMZN 3O8GA 2DA1A 2ACJA 2A3SA 3JW4A 4E7ZA 2CUEA 3FMQA 3ZRGA 3B02A 2LDUA 4BE0A 1FOXA 3QP5A 1VQ6I 4Q4ZF 4LK1F 4BBSJ 3S1RJ 2PMHA 4XSZF 5CVJA 1FYLA 4Y15A 3F8CA 1H8AC 2E2HJ 2QSGX 1LEBA 1OCPA 2EFOA 1XDSA 2YPRA 3HPHA 1B9MA 3KYLA 3FDYA 2ISYA 2NYXA 3A0BC 5LFAA 1TW2A 1R5HA 1DGWY 4D7MA 4I98B 1E0EA 3CUQC 2TRTA 4HLYA 3DEEA 2KJBA 4PK4A 3LMMA 3RSNA 4D7NA 3WE2A 4XKVA 2KHMA 2CQXA 3I59A 1FOKA 1HKQA 4XLNF 1TBXA 1XCBA 3TO9A 1J59A 2OTLI 4D9JA 2IS6A 2FRHA 2KDZA 1IRZA 2VQHA 2EWNA 2C6YA 4K2EA 3K10A 2LY2A 1WGXA 3CUOA 1A5JA 3D5RC 1ZN2A 3CUQB 4UVAA 1YTYA 4ZDPA 2JVGA 5C44J 2NVTJ 3VSLA 2DYSH 4PFPA 1V5EA 4EGZA 2VT2A 3H9QA 4ZYEA 3F22A 2QCOA 4CGZA 3DV8A 3QODA 1HDPA 1ULYA 2X6OA 4UXNA 2UWMA 3ZMZA 5E18F 4CZZA 2H94A 4RBOA 4L9JA 2NS8A 4BUPA 3GZNB 4LB6B 5EZGA 4S04A 4L9TA 1IXSB 4M73A 2EZKA 1BOAA 1FIPA 5J40A 4IHTA 3E0JB 1U6GA 1TL8A 5H2FC 3I0TA 5K7HA 5GPCA 2DPUA 3Q3SA 5BNGA 1O4XA 1OYYA 3FHZA 2QLZA 2STTA 3GTKJ 1KGSA 2XRNA 1OMIA 2Y69H 3MVPA 3QYEA 4BQOA 1UCRA 4CZCA 2XC7A 1Y8RB 2R7WA 2MA3A 1T38A 3BTIA 2ZBKA 2MFZA 1R36A 4ITVA 3DKYA 2O03A 3H5NA 3FIWA 3FZVA 3MZHA 4XLHA 3FXOA 3G3ZA 2L01A 1BW6A 9ANTA 2M4GA 3H5RA 1UJ8A 3RTRA 4HYEA 1ZKGA 4OINF 4I02A 3BR3A 3CJRB 1KQ0A 1J7KA 1GXQA 2HR3A 5TISC 4CCLA 2V1NA 3QPSA 5L3DA 1ZAOA 1QQIA 1YOVB 5EG0B 4LIUA 3HXLA 4YIIA 3G6EI 4BE1A 2OCCH 4XORA 1GXPA 4A3IJ 5E3NA 3CO7C 2ID6A 4MGRA 3BCBA 1W0UA 2ELHA 4C3IJ 1X4PA 2HXOA 1XSVA 1MIJA 3GTPJ 2DA5A 3QOPA 1Q1HA 4A69C 3KP3A 1K7AA 1QO0D 3BR5A 4F92B 1UHWA 1GLNA 5GADJ 4WK8F 2DXIA 1WJDA 2L5QA 4IPAA 4HX8A 3SDBA 2WTEA 2E2IJ 4E70A 1Z05A 3LSPA 4I01A 1K83J 2DK5A 1KQ9A 4NNJA 2BY1A 1I6XA 1AHDP 1PVEA 2HPIA 3DBHB 2MC3A 3S15J 3QYBA 1O7LA 4I0AA 4B44A 4KFCA 5E79C 3TMOA 4DIQA 3ELKA 5IYBJ 1BJZA 3KFWX 3KZYA 3GXOA 3I58A 5CJ9A 1WRJA 3GCMA 1R7JA 1KONA 2JN6A 2V6CA 3AAFA 2ZO4A
chains in the Genus database with same CATH topology
1VQLI 3CCRI 3CCQI 1VQ8I 2JQ7A 2OTJI 2ZJRF 1VQ5I 1YITI 3I56I 3I55I 4IO9F 1YJWI 4IOCF 1YHQI 1VQOI 3DLLF 2E35A 1YJ9I 3CJSB 2K3FA 3CD6I 2ZJPF 4IOAF 1VQPI 3PIPF 1FOWA 1S72I 5GAEJ 1YJNI 1HC8A 3CMAI 3CMEI 3PIOF 2QEXI 3CF5F 1FOXA 3CJRB 3EGVB 1VQ6I 1YI2I 3CCVI 1VQ9I 2H8WA 5DM7F 3J7ZI 3G6EI 1VQ7I 1Y39A 1ACIA 2QA4I 3CJQB 2FOWA 1FOYA 5DM6F 2E34A 2ZJQF 3CCSI 1YIJI 1MMSA 5GADJ 1VQKI 5GAGJ 3G71I 3G4SI 3CC7I 2E36A 2OTLI 3CJTB 3CCLI 3CC2I 3CCUI 4UY8I 4V19K 5JVGF 3CCEI 3CC4I 1QA6A 1WIBA 2NXNB 3CCJI 1VQ4I 5GAHJ 1VQMI 3CCMI 3J7YJ 1VQNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL I;  3CCR I;  3CCQ I;  1VQ8 I;  2JQ7 A;  2OTJ I;  2ZJR F;  1VQ5 I;  1YIT I;  3I56 I;  3I55 I;  4IO9 F;  1YJW I;  4IOC F;  1YHQ I;  1VQO I;  3DLL F;  2E35 A;  1YJ9 I;  3CJS B;  2K3F A;  3CD6 I;  2ZJP F;  4IOA F;  1VQP I;  3PIP F;  1FOW A;  1S72 I;  5GAE J;  1YJN I;  1HC8 A;  3CMA I;  3CME I;  3PIO F;  2QEX I;  3CF5 F;  1FOX A;  3CJR B;  3EGV B;  1VQ6 I;  1YI2 I;  3CCV I;  1VQ9 I;  2H8W A;  5DM7 F;  3J7Z I;  3G6E I;  1VQ7 I;  1Y39 A;  1ACI A;  2QA4 I;  3CJQ B;  2FOW A;  1FOY A;  5DM6 F;  2E34 A;  2ZJQ F;  3CCS I;  1YIJ I;  1MMS A;  5GAD J;  1VQK I;  5GAG J;  3G71 I;  3G4S I;  3CC7 I;  2E36 A;  2OTL I;  3CJT B;  3CCL I;  3CC2 I;  3CCU I;  4UY8 I;  4V19 K;  5JVG F;  3CCE I;  3CC4 I;  1QA6 A;  1WIB A;  2NXN B;  3CCJ I;  1VQ4 I;  5GAH J;  1VQM I;  3CCM I;  3J7Y J;  1VQN I; 
#chains in the Genus database with same CATH topology
 4PDK A;  4R1H A;  5LBQ A;  1VZ0 A;  1VQ8 I;  1X3Z B;  1IDZ A;  5LGU A;  1BR1 A;  2AQE A;  1ETW A;  1I27 A;  3I56 I;  2EJR A;  3RDI A;  2K3P A;  3F6O A;  2VJ4 A;  2VT3 A;  1T2K A;  3AG4 H;  1Z7L A;  3SZT A;  3WTW C;  5FLX K;  3RKW A;  1YG2 A;  4LIT A;  5GP9 A;  3SZP A;  3WG7 H;  1YJ9 I;  3M4O J;  2VIX A;  2RV8 A;  1OPC A;  2DMP A;  3ISP A;  2P8T A;  3ZQH A;  3F23 A;  4KNY A;  3LOC A;  4MHG A;  1XMA A;  4JQF A;  3AKZ A;  2L4M A;  3WU1 B;  4IOA F;  2PJR B;  3ABL H;  2ME6 A;  1VQP I;  1QVT A;  1N78 A;  3M8E A;  2IPQ X;  1X2M A;  3IC7 A;  3FK6 A;  2M3A A;  4XR6 A;  3TOB A;  1P92 A;  3I4N J;  4RAG A;  2M0C A;  3F72 A;  2A6E F;  1ZG1 A;  3BZ6 A;  3H0G J;  3EQL F;  2Z2S B;  3TO7 A;  1V5G A;  2D45 A;  1HA8 A;  3IH4 A;  1JUS A;  5L3E A;  1RUN A;  3V4G A;  4BBR J;  2CQK A;  2LBF B;  2XF6 A;  2MBF A;  1TNT A;  2EIM H;  2GAU A;  5JFR A;  2KIM A;  2DDA A;  3E6B A;  3KLO A;  2KRH A;  1BI2 A;  2Q8K A;  1FZP B;  3S16 J;  2BV6 A;  3L7W A;  2CYY A;  1KU9 A;  2JTV A;  3I64 A;  5HLT A;  2PLY A;  2FNP A;  3MN2 A;  4PGG A;  3EUA A;  1S7A A;  4I0B A;  4N9H A;  1ZYR F;  4A5M A;  4PJ0 C;  1NK2 P;  3ABU A;  3BDD A;  3C1D A;  4BE2 A;  2Z33 A;  2WY8 Q;  2ZXI A;  5JVG F;  1SC7 A;  1IUY A;  1TQI A;  3R4K A;  4B3X A;  3RCO A;  5E3L A;  4ZJZ A;  3WTY C;  4ESF A;  3VYT B;  2PMZ A;  2N8G A;  4OMY A;  3RKY A;  5GAH J;  5CKT A;  4II2 A;  4XK4 A;  2HYG D;  3CCM I;  1BI0 A;  2F6C A;  4XLA A;  3O8H A;  1JXS A;  4QPQ A;  3OSF A;  2ZB9 A;  1E3H A;  2VKH A;  1YFH A;  2OU2 A;  4M3E A;  4RB1 A;  5FGM A;  2EIN H;  4GRI A;  4XOT A;  2OTJ I;  3K2Z A;  2R5Z B;  4WWC A;  1PYV A;  1UAA A;  4A3J J;  3PL8 A;  2IJL A;  5LEJ A;  3ZQF A;  5H6Q A;  2VJI A;  3K69 A;  3ECH A;  1XGO A;  1XD7 A;  2LRD A;  1WFX A;  3EYI A;  2CV1 A;  3TP0 A;  4JX5 A;  4C2T A;  4EMS A;  3VYS B;  4DQ2 A;  2ETH A;  2H6B A;  2XDV A;  4CYD A;  3GTJ J;  5KVR A;  5ICG A;  4KYW A;  1FIA A;  3ZMD A;  2LNB A;  1LQ1 A;  3BLY A;  4UUV A;  2YUS A;  2K3F A;  2MW8 A;  3HG9 A;  3KX2 A;  2E5Z A;  4PCQ A;  4R79 A;  5F1R A;  4BJ6 C;  2LR8 A;  4GXO A;  2LF7 A;  1W36 C;  1YJN I;  4H0E A;  1BC7 C;  4FHT A;  2QSH X;  4XRS G;  5LLQ A;  1FYM A;  1LKX A;  1B1B A;  1EA3 A;  1MMD A;  1R5G A;  2J5O A;  3FXQ A;  4M6X A;  1MD0 A;  2F4M B;  2NNN A;  4J01 A;  1KYW A;  1MKM A;  2EFW A;  3FBI B;  2WB1 N;  4B43 A;  3RIR A;  3IH3 A;  1FMW A;  2ZFU A;  2ZME C;  2CQ7 A;  1Y39 A;  2BY3 A;  3U21 A;  3JRG A;  2I10 A;  3ZGK A;  1FLI A;  2KFD A;  3W6J B;  3A4C A;  2W84 A;  2XB0 X;  4O3M A;  3AFH A;  2UXN A;  2B63 J;  4IKF A;  2NVY J;  1NG7 A;  1R6R A;  2WAF A;  2E71 A;  1DPU A;  2W1O A;  3J80 Z;  2HTS A;  3HEF A;  3JRF A;  1B9N A;  1WZ2 A;  3LFU A;  3QPT A;  3KYC B;  1DQU A;  2ZME B;  1DPR A;  3ZMU A;  4C9Y A;  5JHU A;  2ID3 A;  5HNH A;  2L7F P;  4ZZD A;  5BOX A;  4HF0 A;  4HBL A;  5ERI A;  4O5V A;  1P4X A;  5EJC A;  5E1W A;  4DNC A;  3C2G A;  5K7Z A;  1IF1 A;  3HGY A;  3GF2 A;  2V79 A;  1N25 A;  5CQG A;  5IPA A;  3GX4 X;  1T8I A;  1IXR C;  1E3O C;  4A3B J;  1GV5 A;  4UB6 C;  1QVU A;  4V2F A;  4XSX F;  4CDG A;  3BG7 A;  4B48 A;  3F9K A;  4AWX B;  4E6K G;  3BQY A;  3T1B A;  3TL4 X;  4A0Y A;  4YFX F;  2LFB A;  2M30 A;  4QTR A;  1BC8 C;  2X51 A;  2AXL A;  1ZTR A;  3DCF A;  2F5C A;  1JUP A;  4X0G A;  5HOO A;  4Z6Y A;  1XSD A;  1UST A;  3L9F A;  1ERD A;  3SHF A;  4QWQ A;  2BOL A;  2QQB A;  1S6L A;  2MH9 A;  1R4M B;  3HDD A;  4XIC A;  3QQA A;  3P7N A;  4G9Y A;  2LLK A;  1FP2 A;  3S2W A;  2WWY A;  3CP8 A;  2FEZ A;  3O6B B;  2HS5 A;  2KPM A;  4L5J A;  2F5D A;  5F6F A;  1R49 A;  1IV8 A;  4HG2 A;  1H88 C;  3S93 A;  3CDH A;  4IL6 C;  5HDN A;  2X48 A;  4HW0 A;  1TC3 C;  1XGM A;  4L9V A;  1P4A A;  3K4L A;  5L3F A;  3WU2 C;  4EM0 B;  1R5I D;  3M1C A;  1U8B A;  2WV0 A;  3WG9 A;  4IZZ A;  1JT0 A;  3DTI A;  3KCC A;  4HDV A;  5DUI A;  1TLH B;  3IH2 A;  4HX7 A;  1HW1 A;  1FJL A;  3ZQC A;  1C0W A;  3SQN A;  1F1Z A;  3G2B A;  3EUH A;  4M74 A;  5AON A;  5J8C A;  1GVD A;  2HKX A;  1RKT A;  1CF7 B;  1ZEL A;  2L0K A;  2DU9 A;  2EZL A;  2IA1 A;  3OYJ A;  3MAJ A;  2B9S A;  2WAD A;  2ESH A;  3PIO F;  3K9T A;  2FSW A;  2P4W A;  5FO5 A;  5DYM A;  3COA C;  4I6Z A;  2YSR A;  4E7L A;  2IEK A;  3LSH A;  1T56 A;  3DLA A;  3MD2 A;  3S1Q J;  1XN7 A;  2DBB A;  3CLO A;  4D0P A;  1KU7 A;  3ZP5 A;  3GFI A;  2IXS A;  3M8J A;  3JTH A;  3OIP A;  1QBJ A;  1LDK B;  3PM1 A;  3QU6 A;  3DPU A;  4ZYG A;  4ZYD A;  5GTI C;  4OIR F;  3MEX A;  2E34 A;  3F6V A;  5JVT A;  1OCO H;  2M7B A;  2KIU A;  2VQL A;  4E7S A;  3VYU B;  2W85 A;  1U78 A;  1WJB A;  4NC7 A;  3E3V A;  4BU2 A;  3QRF F;  3UKG A;  2NAZ A;  2ISZ A;  4FCY A;  4HNV A;  3L2C A;  5L3G A;  1YS7 A;  2PJR A;  2H8R A;  2MD5 A;  4BY1 J;  3LSG A;  3P5J A;  5LRS A;  1OYW A;  1JT6 A;  2QGU A;  5ICF A;  4KIF A;  2OQG A;  2LY9 A;  2Y48 A;  1HCR A;  4UY8 I;  3S2D J;  2JK3 A;  2PEX A;  1K79 A;  1OCT C;  1LDD A;  1YYV A;  1RET A;  4KN7 X;  4BHP A;  2P0W A;  3BY6 A;  5H6R A;  2OZ6 A;  1FBS A;  1JE8 A;  2PMU A;  1A6Q A;  2QYO A;  4YEJ A;  5CPR B;  2NRA C;  3K4J A;  2RC4 A;  3ZXS A;  5LHG A;  5J6X A;  2L54 A;  1DP7 P;  4RM2 A;  2LBF A;  4IJA A;  4A6D A;  2Y9Z A;  2W7N A;  3BG6 A;  2R4G A;  3WTZ A;  3S3O A;  2XUB A;  2G9W A;  1IRG A;  1MNE A;  4TV7 A;  5BPD A;  1V3F A;  2MLK A;  1ODD A;  1LUJ B;  3HJE A;  3A0H C;  4M72 A;  2Y2Z A;  3A02 A;  4D5C A;  2VE9 A;  5DCF A;  2CW8 A;  4MEX F;  2BY0 A;  1R71 A;  3VOD A;  5K5R A;  2YU9 J;  4BY7 J;  3JRD A;  3IL2 A;  3IP4 B;  3GLX A;  1UG0 A;  2CFO A;  3LWF A;  4IQ4 A;  4XMY A;  3ZQG A;  4F52 A;  4AVZ A;  4UUS B;  3TQN A;  4E7K A;  2PFB A;  4L0Z B;  1VND A;  2VBW A;  3HSF A;  3WTT C;  4XKC A;  2QQ8 A;  5ILU A;  2DO7 A;  1VF9 A;  4GCV A;  5D5V B;  4ZYA A;  2VAS A;  2V9P A;  3EUK L;  3DFG A;  4CUG A;  4RMN A;  1I50 J;  3FXL A;  1STZ A;  2K86 A;  2HU9 A;  1AU7 A;  4M9S A;  1IDY A;  4FE4 A;  3PFY A;  4HAM A;  1R1U A;  1W7P B;  1X3W B;  3DEW A;  2UXX A;  3I4P A;  5CQE A;  5D5U B;  2R5Z A;  4XLF A;  2EFN A;  2DPD A;  5KAI C;  5C4J J;  2IW5 A;  1MBH A;  2F5E A;  1VQ7 I;  2CQN A;  3U1K A;  3ESW B;  1ACI A;  3PQJ A;  3DU6 A;  3ML6 A;  4E7J A;  2IT0 A;  4HEA 2;  4F91 B;  2QA4 I;  2KL4 A;  3KE2 A;  3RQI A;  2DA7 A;  1ETV A;  2FNA A;  2GZW A;  1ZGJ A;  3SZG A;  5A2Q K;  3S2H J;  2GWR A;  2DMN A;  2KQR A;  3GVA A;  3OYM A;  4YFK F;  3S3N A;  2HOA A;  5DTD A;  2JA7 J;  2EH3 A;  2DCE A;  3S14 J;  2NS7 A;  3DBL B;  3DKW A;  5FD5 A;  2BVM A;  3LNQ A;  4O6J A;  1Y1V J;  3G71 I;  4IRI A;  2ZSH B;  2EV0 A;  2E36 A;  4G6T B;  3JRC A;  2NNY A;  2WAQ A;  1CGP A;  2H1K A;  3CO6 C;  3MKW B;  1X1D A;  4P9F A;  5M3M J;  2DOE A;  1P4W A;  2HGC A;  5KAF C;  2DA6 A;  4LIV A;  3CC4 I;  3GFM A;  1Z0X A;  5DUK A;  2GM4 A;  4CSW A;  1IN7 A;  2Q2E B;  1I39 A;  2RQQ A;  3BC8 A;  4M3D A;  4ESJ A;  2K4B A;  2V4J C;  2VOP A;  3R61 A;  4YIF A;  2DFF A;  3S8P A;  1UMQ A;  2DT5 A;  3K4K A;  3DTE A;  2K9S A;  4MTD A;  5K5Q A;  4BGD A;  3J7Y J;  1A31 A;  4CO8 A;  5KNL A;  1EF4 A;  4D1Q A;  3RI4 A;  4ZTJ A;  1PUE E;  2EV5 A;  4A5N A;  2WB1 A;  3X2Q H;  1OKR A;  2Q1Z B;  4LGW A;  4RA2 A;  1X1B A;  4UHT A;  3ZR8 X;  3OIO A;  3WGG A;  5AIP A;  2W48 A;  2JPB A;  5EDN A;  2Z5U A;  4N4N B;  3I55 I;  1QNT A;  3QU3 A;  3CES A;  3K0L A;  2ZME A;  1YIO A;  4HSR A;  1TP4 A;  4UB8 C;  1K78 B;  1TWF J;  1SVO A;  4M9X A;  3S3M A;  2O5R A;  4OWR B;  4BXX J;  4LK0 F;  2MGQ A;  3TP3 A;  1R00 A;  4DW6 A;  1E3P A;  1Z1D A;  1ETX A;  3NEU A;  4WXH A;  5F27 A;  4BEH B;  3Q0V A;  1MDM A;  1ORK A;  5J8F A;  3I5U A;  5FRM A;  1ZLK A;  4RM3 A;  1HW5 A;  3CCY A;  5LRR A;  1FOW A;  2VE8 A;  2R7S A;  2FOK A;  1B6A A;  2UUZ A;  2XAF A;  3FXJ A;  5FKK A;  4DJA A;  4A3G J;  3OIQ A;  4KT6 A;  3HOZ J;  1D0X A;  4U0W A;  1QU3 A;  2IGN A;  2KJC A;  3GZ6 A;  4PJL A;  2V9K A;  2KDO A;  2R7O A;  1IW7 F;  4CH7 A;  5D4R A;  5IT9 K;  1IRX A;  1KZH A;  3GLL A;  3BZC A;  2B0L A;  3M3Y J;  3FKJ A;  1U5T A;  4MIM A;  1J5Y A;  3QWL A;  5F04 A;  2P5V A;  2CV0 A;  4FX4 A;  5FD6 A;  1Z3X A;  1D1C A;  3K4M A;  6PAX A;  4HPQ A;  2P81 A;  1MSF C;  1HKT A;  2Y30 A;  3IKT A;  2FML A;  1KU2 A;  2FOW A;  3BJA A;  4DYR A;  4A12 A;  3J7A O;  2CG4 A;  2K4J A;  3HSR A;  4FQG A;  4AIK A;  3WTS C;  1V54 H;  2KIQ A;  3SFZ A;  3O2P E;  3W6K B;  1WPK A;  5TRD A;  2IA0 A;  1O57 A;  2R7D A;  1H9T A;  3J7A Y;  4MO7 A;  3G4S I;  4S05 A;  3OSG A;  2OF7 A;  5EEG A;  1B4A A;  1P9Q C;  2Z16 A;  3PJR A;  3PUF A;  3H3V K;  1CF7 A;  2E19 A;  2VLA A;  2EA2 A;  2DN0 A;  1Y1W J;  2HDW A;  3DF8 A;  3HIF A;  3AL0 B;  3CCE I;  2WAE A;  2TDX A;  4PSW A;  3SDG A;  3T8R A;  2OD5 A;  1U3E M;  2R7R A;  3E5X A;  2LTP A;  1EH6 A;  2QUF A;  4FIS A;  4NDL A;  2VPL A;  4MEY F;  2CO5 A;  5ICC A;  3KPH A;  1F36 A;  3IAM 2;  4OMZ A;  3P9K A;  4OAZ A;  3HB9 A;  1O7F A;  3MZ8 A;  2LKX A;  2OJE D;  3EUH C;  1D8K A;  4I09 A;  2W00 A;  3U2R A;  4LG3 A;  3BG9 A;  2VOO A;  2K85 A;  4M71 A;  1BBY A;  2RNG A;  4AIH A;  2JZY A;  4EM1 A;  3A03 A;  5EEA A;  1FTZ A;  1JHH A;  5EYR A;  2L9S A;  1RUO A;  1ZRF A;  4LG0 B;  1ZH5 A;  3UNG C;  3WTX C;  1JGG A;  1TZL A;  3NRV A;  4A3L J;  2X4H A;  1TT5 B;  5CVV A;  1SD6 A;  4I2O A;  3M8F A;  1SFK A;  4E7H A;  4CA0 A;  1NG6 A;  3WGI A;  3RJP A;  2L9N A;  3OS2 A;  4PFO A;  5D5W B;  5AIQ A;  2KIS A;  1W36 D;  2KP6 A;  1J0R A;  2G0E A;  1LVA A;  3BPX A;  4RLQ A;  3ABK H;  3IAS 2;  3WTV C;  3BP8 A;  3IRR A;  4OU0 A;  2R5Y A;  2RAE A;  1HC8 A;  1P2F A;  1K4S A;  3FBN B;  3EPZ A;  3MKY B;  3WU0 A;  1MMG A;  2EZI A;  2CUJ A;  3AG3 H;  5HLG A;  3KET A;  3ULQ B;  2R7T A;  4KA4 A;  1R58 A;  1OFC X;  1FTT A;  1TTY A;  3LA3 A;  3MFK A;  3ECO A;  1GUU A;  4WCG A;  5M5W J;  2XRL A;  2YX7 A;  4LMY A;  1D1B A;  4IEJ A;  2XAS A;  1W5S A;  5BPI A;  4C3J J;  4CIC A;  2NOG A;  3CMM A;  4RGX A;  3TOA A;  1X58 A;  4AIJ A;  2ZCW A;  3CJQ B;  1K4T A;  3ZMV A;  2CQQ A;  2GBY A;  2VQG A;  2QVO A;  4V2G A;  2M4K A;  2ESN A;  4UUS A;  1YS6 A;  1BOB A;  4LD5 A;  4WXD A;  3TDU C;  3Q9S A;  3KP5 A;  5FFZ A;  3Q0U A;  2R7F A;  4BJ5 C;  3MQ0 A;  1L3L A;  2XAG A;  2HOS A;  3ZCO A;  5LD2 C;  1ZR4 A;  1QGP A;  1RKW A;  1J09 A;  4HQE A;  4MQ9 F;  1YO5 C;  3LSM A;  4G6D A;  1V55 H;  2UV1 A;  2DMU A;  1T95 A;  2R7Q A;  3CCL I;  3L00 A;  3CC2 I;  3PO3 J;  3CCU I;  1S5L C;  1FSE A;  1LVK A;  2X1E A;  2A69 F;  3GME A;  4PJM A;  5CVU A;  4F55 A;  3J81 Z;  4ENJ A;  1D5Y A;  4GYI A;  5BMZ A;  5DD8 A;  4E4H A;  3PNY A;  1MMN A;  1W7P A;  4EEF G;  4IHS A;  1FWZ A;  4RAZ A;  3GUD A;  5B66 C;  5M5Y J;  2DQR A;  2HWV A;  3C2B A;  3Q5F A;  4D5F A;  2DTR A;  2E1N A;  5IP9 J;  4Z2Y A;  1ITY A;  3KP6 A;  4M3G A;  5IOZ A;  1OLT A;  1UFM A;  1A6I A;  3FIS A;  2EBI A;  1Y0N A;  2CS3 A;  3GW2 A;  2HDC A;  4NHJ A;  1I1G A;  3RKX A;  4JX4 A;  3WTU C;  3LQQ A;  5FFX A;  4EJU A;  3BTJ A;  1YIT I;  3GTM J;  1TWC J;  3DP7 A;  4A3D J;  4G7O F;  1SEU A;  2LKP A;  2PJP A;  3PFI A;  1OYI A;  4W1U A;  3BWG A;  1APL C;  3KP4 A;  3JAM Z;  3GFJ A;  4HA8 A;  3N97 A;  1IV6 A;  4G7Z F;  2H09 A;  2CH0 A;  1POG A;  5LEK A;  2Y0S N;  5D8L B;  2G7H A;  5LGT A;  2HDD A;  4RGU A;  2Q2E A;  2M8G X;  3EDP A;  4ENK A;  1DDN A;  1LEA A;  1Z6T A;  3R0J A;  1I5Z A;  2FMY A;  2E7X A;  2DT7 B;  1LJ9 A;  2IBD A;  5J3L A;  1IJW C;  5LHH A;  2IVM A;  4C30 A;  4BXU A;  3HBL A;  3OYH A;  3T0Y A;  3OYN A;  3E6D A;  1Z7U A;  5K1Y A;  1QZZ A;  3RPU A;  4HOB A;  4RAY A;  2DMT A;  1E2X A;  1T6S A;  1RNL A;  1TT0 A;  1EV7 A;  2ECB A;  1OR7 C;  3KEO A;  4UUT A;  3S1N J;  3HOW J;  1LPQ A;  2ELJ A;  4IVN A;  3BR6 A;  4AYB N;  4BL0 B;  5D8K B;  4L5E A;  2M45 A;  1G4D A;  1JTY A;  1Z9C A;  5HLI A;  4EVI A;  1K78 A;  3RYR A;  5E17 F;  5FKO A;  1XX5 A;  1FOY A;  4NC8 A;  3LAP A;  4ZC3 A;  3I53 A;  5E8I A;  2IRF G;  1HOM A;  2V26 A;  5CVR A;  3U1D A;  4BEH A;  2ZKZ A;  1QHH D;  1SAN A;  3E6M A;  5IT3 A;  5EF6 A;  1ZQ3 P;  3HRS A;  3D1N I;  5TGT A;  3HC7 A;  1BR4 A;  3CJT B;  3BOQ A;  1IG7 A;  3GEZ A;  5FLM J;  2LYC A;  4BH9 A;  1EKE A;  3L1P A;  1HKS A;  4BDZ A;  1UB9 A;  1RES A;  2H27 A;  1P7I A;  2GXB A;  3LST A;  4Y7N J;  4EJO A;  2DI3 A;  3K6G A;  3PSF A;  2BVL A;  1QRY A;  3CCJ I;  5J4Y A;  4IQJ A;  2MH2 A;  2DLL A;  4AVP A;  2HZD A;  2DTZ A;  1WKM A;  1ZR2 A;  1ENH A;  1V5F A;  5C3E J;  2O3F A;  2HXI A;  3DPL C;  3W2W A;  5J4V A;  1A35 A;  4L0Y B;  2LMD A;  2RGV A;  4IHY A;  4ASN A;  1O3S A;  5DCM A;  5F1J A;  4E7I A;  2VON A;  1Z6R A;  3CCR I;  3K4N A;  4U88 A;  2V1X A;  5B1A H;  2ZJR F;  2P5L C;  2HVS A;  1QHG A;  2XVC A;  3PUB A;  2IAI A;  1XMK A;  2RN7 A;  1YJW I;  2F5V A;  1MDM B;  1WJ5 A;  4HF2 A;  2X1C A;  1U5T C;  3C2H A;  2W4S A;  4RB3 C;  2D1V A;  2YS9 A;  1W7P D;  1Y6I A;  1DU6 A;  3F8B A;  3A01 B;  2CW0 F;  4PSX A;  2QKM B;  2QF7 A;  1WH5 A;  3GO5 A;  1OCZ H;  2K7L A;  3TW7 A;  4II3 A;  3IHU A;  3RKQ A;  5F64 A;  3L2Q A;  1YX3 A;  3NQO A;  4UV9 A;  1U5T B;  4RDU A;  2P7V B;  1LFB A;  3BG5 A;  3HUG B;  3FX3 A;  4YG2 F;  1AKH B;  3K1N A;  4AUX A;  4X6A J;  2OUM A;  5HS7 A;  2VPR A;  4M6V A;  2L9R A;  3VB2 A;  1P6R A;  1W1W E;  1EH8 A;  3WOD F;  1GV2 A;  2QEX I;  3PNT A;  3RZO J;  2P6T A;  5C4X J;  4P1W A;  2VB6 A;  1BJA A;  2L02 A;  2B7E A;  3CF2 A;  2K27 A;  1SFO J;  1ZK8 A;  2E1M C;  1BIB A;  1TW3 A;  1ZRE A;  4ABZ A;  2JRM A;  1PJR A;  4LG0 A;  2FBK A;  2Z3Y A;  4UV8 A;  2VXZ A;  3GTO J;  1TWH J;  2FUG 2;  3BR1 A;  4MLO A;  3E5Q A;  3A1Y A;  1SMT A;  2OCE A;  2WV1 A;  4G8X A;  1SAU A;  3CZ6 A;  2DFH A;  4MNU A;  3ZQ7 A;  1ZRD A;  2O9L A;  4I7H A;  2PN6 A;  2E1M B;  2HYJ A;  3FM3 A;  3I71 A;  4N4O B;  3S32 A;  4C2U A;  1MBG A;  2MLG A;  1IO2 A;  2VKD A;  3DKX A;  3SXY A;  4A0Z A;  3HOS A;  4J00 A;  1G3Y A;  1X2N A;  3BRO A;  2DYR H;  1MND A;  3P9C A;  4FET A;  3RPQ A;  5HDG A;  3RPU D;  3TW6 A;  1XC5 A;  5LHI A;  1HST A;  2E5N A;  2DAO A;  1D0Y A;  2FD5 A;  2JPC A;  1MGT A;  3N4M A;  3G73 A;  1MSE C;  3HOU J;  2MSY A;  1LE8 B;  3SJM A;  1F9N A;  1Z91 A;  2XSJ C;  4MTE A;  2L4A A;  3AG2 H;  1WVR A;  3H92 A;  4DBQ A;  4B09 A;  1VQ4 I;  1BA5 A;  2CU7 A;  3OV8 A;  1WI9 A;  3JSO A;  4KIG A;  3HRT A;  1U9N A;  2GIZ A;  4XKB A;  3CLQ A;  5IP6 A;  4G7H F;  2QKL B;  1OCC H;  5BS6 A;  4LOC A;  3VDX A;  1T39 A;  1YLF A;  3T8T A;  1OJL A;  1FBU A;  1VQ5 I;  4XLP F;  2OZU A;  3HRM A;  2GLO A;  4NQW A;  3OYF A;  1SAX A;  3P9I A;  1RR8 C;  2IP2 A;  2Y75 A;  1XB4 A;  1YW7 A;  3K7A J;  2HEO A;  1Y56 A;  3H36 A;  4U7D A;  2FXA A;  3OR2 C;  3PSI A;  2R7X A;  3GBG A;  2R7V A;  3H5A A;  4JYK A;  3V8L A;  4XQF A;  2M5W A;  4IXA A;  2JWT A;  1G8X A;  2R5Y B;  1YE9 A;  3K1P A;  1JKP C;  4FT8 A;  3IUO A;  2XSD C;  1X19 A;  3SEQ A;  1ON2 A;  2XAH A;  2BW3 A;  1I1S A;  3HKZ N;  1WSU A;  5GTH C;  2OC6 A;  4RB2 C;  1F5T A;  1BR2 A;  1LDJ A;  2VKV A;  4I99 C;  4CYC A;  1R4N B;  1S3J A;  4Y33 A;  2E7W A;  5D6F A;  4M3F A;  1RPW A;  3CP2 A;  3KZZ A;  1FYK A;  3L2U A;  1H89 C;  2R3S A;  5HLH A;  5E1Z B;  3PNV A;  3K70 C;  1SVM A;  1ZLJ A;  3I9V 2;  3VYR B;  1XTA A;  4EQQ A;  1YI2 I;  2FBH A;  3JRE A;  2H8W A;  2L9V A;  4XBF A;  1G2H A;  4JBA A;  5TJJ A;  1ON1 A;  2ZXJ A;  1IZ1 A;  2DFI A;  4R8H A;  5DM7 F;  2HKO A;  2EZH A;  3FXR A;  3BJO A;  3U9G A;  3VFZ A;  3F8N A;  4B1R A;  2COB A;  5DV5 A;  4YEL A;  4HNU A;  1WWX A;  3I4M J;  2DOD A;  2LG4 A;  3OYA A;  1ZGA A;  4ANJ A;  2EIK H;  2VBY A;  4LLG F;  1PDN C;  3MCZ A;  1Z21 A;  1U8R A;  2VC0 A;  2DJN A;  1GHC A;  2FE3 A;  3WHB A;  3CTA A;  3G1O A;  3JSP A;  4ENM A;  3S1M J;  2K9Q A;  1W5T A;  2AS5 F;  2ICW G;  2DMQ A;  2VQC A;  5FKN A;  1FNN A;  4UNO A;  1UEL B;  4FAS D;  5ILV A;  1TQP A;  3ZN0 A;  3E97 A;  3I54 A;  1P7J A;  3BCA A;  4CCJ A;  2E1O A;  2HI3 A;  5B3S H;  5IY5 H;  2HQR A;  5DS9 A;  2ECC A;  2Y0S A;  2J5P A;  3LQR A;  3HSE A;  2STW A;  1KU3 A;  1WJC A;  3A2K A;  4IRG A;  3M9A A;  2XKP A;  2V6E A;  1JI8 A;  2Z99 A;  1DP3 A;  4BJT A;  4YFN F;  3HHG A;  2KZG A;  2XF5 A;  2OA4 A;  2ZXW H;  5ED4 A;  4Y13 A;  1SFX A;  2DOA A;  3BZK A;  2CFX A;  4Y52 J;  2LC2 A;  1J75 A;  3OR1 C;  1YQA A;  3DXJ F;  4HV6 A;  2FX0 A;  3KLN A;  4JX6 A;  1JUM A;  4KMU X;  1T0F A;  3JRB A;  4GGG A;  1MJ9 A;  5M3F J;  3BR2 A;  4BYY A;  3OYE A;  2LF8 A;  4AYB A;  2COM A;  1OR7 A;  3OL3 A;  4W97 A;  3TO6 A;  5FRO A;  2YX4 A;  4CHU A;  3ZPL A;  2ZFW A;  4BQA A;  2GA2 A;  4QIW N;  2A6T A;  1ZAR A;  2DOF A;  5HNF A;  4IO9 F;  5BQT A;  4HRI A;  4IOC F;  1ZG3 A;  3WE3 A;  1ETQ A;  1SMY F;  5E1X A;  3TGN A;  2HQN A;  4A2U A;  3V8K A;  1ZHF A;  4FTH A;  1V4R A;  3ASN H;  1UZC A;  4P9U A;  3OYL A;  4MFD A;  1WHU A;  5JLX A;  4B47 A;  4F3Q A;  1YW9 A;  1IXC A;  3M7G A;  3CD6 I;  2BYV E;  4G94 A;  3QAH A;  1H9G A;  1SD4 A;  1ETO A;  3W3C A;  3TKY A;  2L7K A;  2MAB A;  3OOU A;  1FPQ A;  1X3U A;  3S17 J;  3PIP F;  1OQY A;  3QP6 A;  4NUB A;  5L3B A;  5GAE J;  1X4O A;  4BQQ A;  2XRO A;  4RGS A;  1X1C A;  4DYC A;  3HYI A;  4A6E A;  1XCV A;  3R6S A;  2GIV A;  4KMF A;  3F0C A;  1PUF B;  3F3X A;  1LB2 A;  2XPV A;  2DQL A;  3W2V A;  4LLL A;  3CF5 F;  2VJ5 A;  2CGP A;  3FXM A;  3KYD B;  4P96 A;  4KIC A;  5F0H A;  2XIG A;  5IOY A;  4OIP F;  2XGC A;  3GTQ J;  3J7Z I;  4AC0 A;  2OPT A;  5CYV A;  3ABT A;  2K9N A;  2MC4 A;  4KDP A;  2M9H A;  2CRG A;  3ZMT A;  5DM6 F;  2L2O A;  4DBR A;  3A01 A;  2VN2 A;  1WJA A;  2DT6 A;  5D5X B;  3GYH X;  3H9G A;  1YIJ I;  4ESB A;  5FLX Z;  3DEU A;  2R93 J;  3REO A;  3CDL A;  2VI6 A;  1G3S A;  1D1A A;  3V7R A;  4CCN A;  3K4B A;  2EFQ A;  3HUG A;  4ZH4 F;  1AKH A;  1A36 A;  5IP7 J;  2EV6 A;  3ZMS A;  1ETK A;  4J19 A;  1N75 A;  2BEO A;  2O6G E;  1WI3 A;  1IN5 A;  1M1E B;  1SD5 A;  2DW4 A;  5DCM B;  4V19 K;  1FX7 A;  4XN0 A;  4UVC A;  4B3A A;  3IWF A;  1ZG5 A;  2E1C A;  2NXN B;  2Y9Y A;  2K9L A;  4CCO A;  3KEQ A;  2F4O B;  1IN8 A;  4M3B A;  3AL0 C;  3F8M A;  4OIQ F;  1I3Q J;  2ZC2 A;  4Q48 A;  1MJB A;  2RKH A;  4DYQ A;  3MKZ A;  3DQV C;  1JJ8 C;  2IS4 A;  4L9N A;  4RGR A;  2JUC A;  2GXG A;  4XON A;  5K5O A;  3HOT A;  1VQN I;  1IN4 A;  1JHF A;  1NTC A;  1MH3 A;  3JRH A;  3PO2 J;  3DBR B;  2K5C A;  2ELK A;  4DZP A;  3DTK A;  2BHY A;  2DDB A;  2LH9 A;  2NVU B;  3R0A A;  2BBY A;  1RI7 A;  4CXF A;  1MNM C;  2XPU A;  3NWT A;  4EJT A;  5F0F A;  2M0M A;  4G6Q A;  5CVI A;  5H20 A;  2EPF A;  3MKL A;  2VBX A;  3MZY A;  3BTL A;  3OS1 A;  1OCR H;  2F48 A;  1GVJ A;  1XGN A;  5CLS A;  4BNC A;  1LE8 A;  1K6Y A;  4XNF A;  2GOM A;  3E6C C;  5EGO A;  2QQA A;  2OBP A;  2QEN A;  3MWM A;  5DD4 A;  5E8G A;  4HX4 A;  2D2W A;  4Q5S F;  1YRN A;  2A07 F;  4WXC A;  1KYZ A;  2RQP A;  3C18 A;  4M6Y A;  2JJ7 A;  3IV5 A;  1B59 A;  3CMA I;  3H9J A;  3RQ4 A;  1BW5 A;  4XRS A;  1JKQ C;  3EGV B;  2QQ9 A;  2HOE A;  2JMW A;  4ON0 A;  3HRU A;  4JK1 X;  2KMU A;  1VTN C;  4Q47 A;  2WBM A;  1KA8 A;  4EM2 A;  1S7O A;  1K61 A;  1FP1 D;  2BGC A;  2HQA A;  1W0T A;  1XSX A;  3G1L A;  5FJ8 J;  5FRN A;  5IYD J;  1IN6 A;  1WH7 A;  3N05 A;  1B8I B;  2Z9O A;  2X85 A;  1AA7 A;  2M87 A;  1G6N A;  3HOV J;  2W24 A;  2F5F A;  4Y4R A;  1TWG J;  3NAR A;  4A0X A;  2X6X A;  1FEX A;  2XAJ A;  2LVS A;  4ZDL A;  3FK7 A;  4KUM A;  3F8F A;  2XB5 A;  2XHK A;  4EJV A;  2P5K A;  4C2M J;  4XLC A;  1D8J A;  3SEZ A;  2EQR A;  5GAG J;  1JKO C;  1WCM J;  5JHF A;  2Y31 A;  3H35 A;  4LB5 A;  2O0Y A;  3KP7 A;  3OL4 A;  2JSP A;  3HKZ A;  3B73 A;  3OYB A;  4N0B A;  1HBX G;  3V42 A;  1QA6 A;  5D6E A;  1O3T A;  3JCU C;  5E3O A;  2KRF A;  2H6C A;  2O8K A;  3LSR A;  3HPG A;  1N77 A;  2X6Y A;  3I3L A;  5GPA A;  2QBY B;  2VC1 A;  4NQW B;  2V1D A;  3W2A A;  4P5O A;  4QLC U;  3NAU A;  2VL8 A;  1D0Z A;  2IGK A;  1XMX A;  5FLV A;  2XGE A;  4WX9 A;  5IYC J;  2M7A A;  2CWE A;  3QOE A;  3L2R A;  3HOY J;  4PZJ A;  2JQ7 A;  1HF0 A;  1BM9 A;  2GA1 A;  4PGH A;  1HLV A;  1IGN A;  1XGS A;  4MQV A;  2GXA A;  1FC3 A;  2H1L A;  2R7U A;  2BW3 B;  2EIL H;  2VBZ A;  4Y3O A;  1ETY A;  4U0Y A;  4H4K C;  2I5U A;  2XGX A;  3HTS B;  3CJN A;  2AXT C;  5J47 A;  3BQZ A;  2CW7 A;  1J9I A;  4ETS A;  5F08 A;  1AWC A;  2UZK A;  3KZI C;  2KT0 A;  4IRH A;  1H0M A;  1F4K A;  3CJS B;  1XDU A;  4CYC B;  3CDI A;  5B1B H;  1SVL A;  1LFU P;  4BDY A;  3V8J A;  3WHC A;  1J2X A;  4BHB A;  3M1E A;  2QWW A;  2LK2 A;  3MMY B;  3ROU A;  2ZJP F;  1CQT A;  1SD7 A;  3QPH A;  3OYI A;  1IC8 A;  3FWE A;  1OIS A;  2K02 A;  4M9Z A;  4HNT A;  2ZJ2 A;  2TCT A;  4WF2 A;  4P55 A;  4B4C A;  1B72 B;  4GDF A;  4A3K J;  3D5L A;  4XN3 A;  4XRF A;  1WJF A;  1VQ9 I;  2E60 A;  4B8X A;  3ERM A;  2NOJ B;  2E2J J;  3ZQI A;  2WA0 A;  2W25 A;  2LRE A;  5DDG A;  3T5X A;  2BHZ A;  2R92 J;  2IGM A;  2G7U A;  2BZT A;  1TWA J;  4X1E A;  4BXF A;  3Q9V A;  1Z67 A;  4AID A;  1T08 B;  2GQQ A;  1S29 A;  1RZ4 A;  5HOD A;  1A04 A;  4HST A;  2XGD A;  4C3H J;  5JLW A;  1I3A A;  2ZJQ F;  1T0F C;  1FSH A;  2XKO A;  1MMS A;  2JVH A;  3L2V A;  5FB2 A;  3K4C A;  1GT0 C;  1EH7 A;  4U7B A;  3CMY A;  1O3R A;  2XF7 A;  2O61 A;  2L7Z A;  2VOD A;  3CC7 I;  2OV7 A;  4F93 B;  2QM3 A;  2XAU A;  5JR3 A;  1MJA A;  1TNS A;  2HNH A;  3LA2 A;  4EAT A;  2A6H F;  2HFH A;  1ZRC A;  4EGY A;  2ME0 A;  2Z1D A;  3H0D A;  1Y8Q B;  2MYS A;  1PUF A;  3L2W A;  4CCM A;  2MD0 A;  4ZDO A;  1WIB A;  3GTG J;  2YU3 A;  3DWL E;  1XS9 A;  3VOE A;  1Q1V A;  1MBJ A;  1UHS A;  4NC6 A;  4QSH A;  3H3Z A;  2ZXH A;  2HVR A;  1K6O A;  1VQM I;  1LNW A;  2HYF A;  2WAQ N;  4JOM A;  2JA5 J;  2PBI A;  4MFE A;  1HDD C;  2DA3 A;  4GFB A;  2A5Y B;  5J1R A;  5F0C A;  3TDZ C;  3CUQ A;  3BTC A;  3G1M A;  4RB0 A;  2IGO A;  4FE7 A;  2NVX J;  1U9O A;  4AU7 A;  4XL9 A;  4XOP A;  4LJZ F;  1UG2 A;  4AM3 A;  4XLE A;  4OOI A;  2M1B A;  4S0H B;  2BXZ A;  2CJJ A;  4A3M J;  3LL7 A;  5ICE A;  3E7L A;  3HL2 A;  2PG4 A;  3D0S A;  4A3F J;  2O8X A;  1PP7 U;  1G59 A;  3E1S A;  3KIO A;  1YHQ I;  2W57 A;  2KKO A;  1VQO I;  3DLL F;  3FHN A;  2D5V A;  3ERE D;  4KIT B;  1I6H J;  1BN5 A;  4LFU A;  2JUG A;  5HS9 A;  1R1V A;  3JTG A;  1QPM A;  1T33 A;  2R7Z J;  1X1A A;  2HVQ A;  3GWZ A;  5HDK A;  1DUX C;  5FKM A;  2HZT A;  4U0V A;  3J81 K;  1D3Y A;  3I59 B;  3GTL J;  3FKI J;  2QZ8 A;  1S72 I;  5HVQ C;  3PQK A;  2VUM J;  2DFE A;  2DA2 A;  5LGN A;  2IS2 A;  3K70 D;  1E17 A;  3OWT A;  3H1C A;  1R22 A;  2LP0 A;  2A61 A;  1HW2 A;  3CME I;  3QYF A;  3R60 A;  1EJ9 A;  2D1H A;  4IHW A;  2JA6 J;  2K40 A;  2RDP A;  2KLO A;  2DA4 A;  3CCV I;  2ZNY A;  2BE5 F;  2F4I A;  4IHX A;  3ZQQ A;  3FF5 A;  3ZN1 A;  4A3C J;  2LKS A;  2CUZ A;  4XM3 A;  2AQF A;  3GFL A;  1BI1 A;  4ZTF A;  4BAC A;  3FXU A;  4IX7 A;  2HPM A;  4JP0 A;  2EK5 A;  5FKL A;  4BQN A;  2XAQ A;  1DU0 A;  1YX5 A;  4OAY A;  1D5V A;  3VSK A;  3LFK A;  1BI3 A;  2LY1 A;  5EEH A;  3JR9 A;  4LLN A;  2I8D A;  3JRI A;  3CCS I;  5EG0 A;  1VI0 A;  2FQ4 A;  2RVC A;  3FM5 A;  3JAM K;  3V7C A;  1S9H A;  2PI0 A;  1SFE A;  4XID A;  1VQK I;  3DU5 A;  2FBI A;  2EA4 A;  2XPW A;  4NBQ A;  1T98 A;  4IHV A;  2XV4 S;  2EIJ H;  5E3M A;  4HLX A;  2P7C B;  3V7S A;  2EFP A;  4ZYH A;  1KQ8 A;  4ZZL A;  3C3W A;  3HM5 A;  2AO9 A;  2JRT A;  2NVQ J;  5K7F A;  1QPI A;  2AHQ A;  4I76 A;  1W5C C;  5HS8 A;  3B6A A;  1FT9 A;  2K9M A;  2FQ3 A;  1MBF A;  4PJJ A;  3UR3 C;  2CV2 A;  5B5E C;  3E5U A;  3OMY A;  2PQ8 A;  2EB7 A;  4IF4 A;  3WGH A;  3M07 A;  3VWB A;  3D5S C;  2IA2 A;  5JI6 A;  1JKR C;  1Z77 A;  2OAZ A;  1Y0U A;  4ENN A;  2FA5 A;  2FF4 A;  4F7Z A;  3OYC A;  2NS0 A;  3CQZ J;  2JSC A;  1L0O C;  3OYG A;  4BS9 A;  3LAJ A;  4EJW A;  1B8I A;  4GO1 A;  4GYG A;  2FJ1 A;  1VQL I;  1R23 A;  2LD5 A;  3OYD A;  3BG3 A;  3KP2 A;  3OS0 A;  2KZV A;  3VPR A;  3GZ5 A;  5L3C A;  2V9V A;  3RYP A;  3F21 A;  4G12 A;  3FXK A;  4PJN A;  1MH4 A;  1DGR M;  5EGO B;  5A2Q Z;  2A5W A;  2E35 A;  1RR7 A;  2X9D A;  3BJ6 A;  2VXD A;  1RRJ A;  3K1M A;  3KEY A;  1YRN B;  2FU4 A;  1QZY A;  2JT1 A;  2O7O A;  3OY9 A;  4XKW A;  5J1Y A;  2LOO A;  4L18 B;  1MZB A;  2CSO A;  3OYK A;  4BKX A;  3B6C A;  3BR0 A;  1S8N A;  3HTU A;  3HOX J;  3QPL A;  2JA2 A;  1FY7 A;  3LA7 A;  2F2E A;  1WQ2 A;  3ZQL A;  1YW8 A;  2Q0O A;  1NHA A;  3OOP A;  3H3U A;  2QBY A;  2MG4 A;  3Q0W A;  3L09 A;  3EET A;  1NH3 A;  3LSI A;  2X6W A;  3O3K A;  3J80 K;  4OIO F;  2A68 F;  4BHC A;  3BT9 A;  3TBI A;  1VFC A;  2RRE A;  2QSF X;  1WJE A;  4FX0 A;  4HDU A;  3K2A A;  3SYT A;  1O3Q A;  4XRM A;  1REP C;  2HTJ A;  1X1P A;  2VKE A;  3LSK A;  1GDT A;  1IRF A;  2LSO A;  2W82 A;  3IKV A;  1IAW A;  3C7J A;  1XG1 A;  3FMR A;  1UHM A;  5D4S A;  4RLF A;  3HHH A;  4DGW B;  4NB5 A;  4BAY A;  3VEP A;  4KIS A;  2ZNZ A;  4YIR X;  2L3D A;  3TED A;  4HF1 A;  4KT5 C;  2DK8 A;  2L7M P;  4QPO A;  2V1U A;  3HZJ A;  3SFI A;  3RZD J;  1NK3 P;  3HGG A;  3NWS A;  1R9T J;  2M8E A;  5ILS A;  2HQ5 A;  2V7F A;  1TQM A;  1BL0 A;  1FMV A;  2M2E A;  1SFU A;  1ZGW A;  1R1T A;  4HQM A;  4DOZ A;  4AD9 A;  1AOY A;  4A93 J;  4RAF A;  1IUF A;  4RS8 A;  3IRQ A;  1W4M A;  1BIA A;  3ASO H;  2YR2 A;  1Z3Y A;  4UVB A;  1B72 A;  2Y0M A;  2X0L A;  4DZJ A;  2CUF A;  2BY2 A;  1MW7 A;  2CMP A;  2WY7 Q;  4Y17 A;  5KK1 A;  2IS1 A;  2P6S A;  2R0Q C;  4HZF A;  1MBK A;  1LFP A;  3ABM H;  2ZSI B;  3FMS A;  2HOT A;  1HQC A;  2DJI A;  1XPX A;  3W6V A;  5IT9 Z;  3LSJ A;  1U0J A;  2PX9 A;  3IWZ A;  1RIO H;  1G3T A;  3CCQ I;  3JRA A;  2VJJ A;  4KJZ A;  1JJ6 C;  2WC2 A;  4KIB A;  1U2W A;  1G3W A;  3ZOB A;  4HV5 A;  2BXY A;  2GOX B;  2M34 A;  5E20 A;  1PP8 F;  4U87 A;  3EYY A;  1HXD A;  2ADU A;  1JGS A;  1USS A;  1HSJ A;  2RNJ A;  2KRC A;  4L5I A;  1ONV A;  2A05 A;  1MMA A;  4CCK A;  2OQR A;  2KIF A;  2X1D A;  5KCM A;  1MBE A;  1QZE A;  3AG1 H;  1S7E A;  5M5X J;  3BPV A;  1JTX A;  5DEQ A;  1FBQ A;  5KHD A;  3ONQ A;  5EZH A;  4EV0 A;  1RC9 A;  4A3E J;  2JA8 J;  4N9I A;  5J1U A;  3DPT A;  4PUS A;  4YRV A;  4KN4 X;  1F43 A;  2PMZ N;  3O8G A;  2DA1 A;  2ACJ A;  2A3S A;  3JW4 A;  4E7Z A;  2CUE A;  3FMQ A;  3ZRG A;  3B02 A;  2LDU A;  4BE0 A;  1FOX A;  3QP5 A;  1VQ6 I;  4Q4Z F;  4LK1 F;  4BBS J;  3S1R J;  2PMH A;  4XSZ F;  5CVJ A;  1FYL A;  4Y15 A;  3F8C A;  1H8A C;  2E2H J;  2QSG X;  1LEB A;  1OCP A;  2EFO A;  1XDS A;  2YPR A;  3HPH A;  1B9M A;  3KYL A;  3FDY A;  2ISY A;  2NYX A;  3A0B C;  5LFA A;  1TW2 A;  1R5H A;  1DGW Y;  4D7M A;  4I98 B;  1E0E A;  3CUQ C;  2TRT A;  4HLY A;  3DEE A;  2KJB A;  4PK4 A;  3LMM A;  3RSN A;  4D7N A;  3WE2 A;  4XKV A;  2KHM A;  2CQX A;  3I59 A;  1FOK A;  1HKQ A;  4XLN F;  1TBX A;  1XCB A;  3TO9 A;  1J59 A;  2OTL I;  4D9J A;  2IS6 A;  2FRH A;  2KDZ A;  1IRZ A;  2VQH A;  2EWN A;  2C6Y A;  4K2E A;  3K10 A;  2LY2 A;  1WGX A;  3CUO A;  1A5J A;  3D5R C;  1ZN2 A;  3CUQ B;  4UVA A;  1YTY A;  4ZDP A;  2JVG A;  5C44 J;  2NVT J;  3VSL A;  2DYS H;  4PFP A;  1V5E A;  4EGZ A;  2VT2 A;  3H9Q A;  4ZYE A;  3F22 A;  2QCO A;  4CGZ A;  3DV8 A;  3QOD A;  1HDP A;  1ULY A;  2X6O A;  4UXN A;  2UWM A;  3ZMZ A;  5E18 F;  4CZZ A;  2H94 A;  4RBO A;  4L9J A;  2NS8 A;  4BUP A;  3GZN B;  4LB6 B;  5EZG A;  4S04 A;  4L9T A;  1IXS B;  4M73 A;  2EZK A;  1BOA A;  1FIP A;  5J40 A;  4IHT A;  3E0J B;  1U6G A;  1TL8 A;  5H2F C;  3I0T A;  5K7H A;  5GPC A;  2DPU A;  3Q3S A;  5BNG A;  1O4X A;  1OYY A;  3FHZ A;  2QLZ A;  2STT A;  3GTK J;  1KGS A;  2XRN A;  1OMI A;  2Y69 H;  3MVP A;  3QYE A;  4BQO A;  1UCR A;  4CZC A;  2XC7 A;  1Y8R B;  2R7W A;  2MA3 A;  1T38 A;  3BTI A;  2ZBK A;  2MFZ A;  1R36 A;  4ITV A;  3DKY A;  2O03 A;  3H5N A;  3FIW A;  3FZV A;  3MZH A;  4XLH A;  3FXO A;  3G3Z A;  2L01 A;  1BW6 A;  9ANT A;  2M4G A;  3H5R A;  1UJ8 A;  3RTR A;  4HYE A;  1ZKG A;  4OIN F;  4I02 A;  3BR3 A;  3CJR B;  1KQ0 A;  1J7K A;  1GXQ A;  2HR3 A;  5TIS C;  4CCL A;  2V1N A;  3QPS A;  5L3D A;  1ZAO A;  1QQI A;  1YOV B;  5EG0 B;  4LIU A;  3HXL A;  4YII A;  3G6E I;  4BE1 A;  2OCC H;  4XOR A;  1GXP A;  4A3I J;  5E3N A;  3CO7 C;  2ID6 A;  4MGR A;  3BCB A;  1W0U A;  2ELH A;  4C3I J;  1X4P A;  2HXO A;  1XSV A;  1MIJ A;  3GTP J;  2DA5 A;  3QOP A;  1Q1H A;  4A69 C;  3KP3 A;  1K7A A;  1QO0 D;  3BR5 A;  4F92 B;  1UHW A;  1GLN A;  5GAD J;  4WK8 F;  2DXI A;  1WJD A;  2L5Q A;  4IPA A;  4HX8 A;  3SDB A;  2WTE A;  2E2I J;  4E70 A;  1Z05 A;  3LSP A;  4I01 A;  1K83 J;  2DK5 A;  1KQ9 A;  4NNJ A;  2BY1 A;  1I6X A;  1AHD P;  1PVE A;  2HPI A;  3DBH B;  2MC3 A;  3S15 J;  3QYB A;  1O7L A;  4I0A A;  4B44 A;  4KFC A;  5E79 C;  3TMO A;  4DIQ A;  3ELK A;  5IYB J;  1BJZ A;  3KFW X;  3KZY A;  3GXO A;  3I58 A;  5CJ9 A;  1WRJ A;  3GCM A;  1R7J A;  1KON A;  2JN6 A;  2V6C A;  3AAF A;  2ZO4 A; 
#chains in the Genus database with same CATH homology
 1VQL I;  3CCR I;  3CCQ I;  1VQ8 I;  2JQ7 A;  2OTJ I;  2ZJR F;  1VQ5 I;  1YIT I;  3I56 I;  3I55 I;  4IO9 F;  1YJW I;  4IOC F;  1YHQ I;  1VQO I;  3DLL F;  2E35 A;  1YJ9 I;  3CJS B;  2K3F A;  3CD6 I;  2ZJP F;  4IOA F;  1VQP I;  3PIP F;  1FOW A;  1S72 I;  5GAE J;  1YJN I;  1HC8 A;  3CMA I;  3CME I;  3PIO F;  2QEX I;  3CF5 F;  1FOX A;  3CJR B;  3EGV B;  1VQ6 I;  1YI2 I;  3CCV I;  1VQ9 I;  2H8W A;  5DM7 F;  3J7Z I;  3G6E I;  1VQ7 I;  1Y39 A;  1ACI A;  2QA4 I;  3CJQ B;  2FOW A;  1FOY A;  5DM6 F;  2E34 A;  2ZJQ F;  3CCS I;  1YIJ I;  1MMS A;  5GAD J;  1VQK I;  5GAG J;  3G71 I;  3G4S I;  3CC7 I;  2E36 A;  2OTL I;  3CJT B;  3CCL I;  3CC2 I;  3CCU I;  4UY8 I;  4V19 K;  5JVG F;  3CCE I;  3CC4 I;  1QA6 A;  1WIB A;  2NXN B;  3CCJ I;  1VQ4 I;  5GAH J;  1VQM I;  3CCM I;  3J7Y J;  1VQN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...