5GAHJ

Rnc in complex with srp with detached ng domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
134
structure length
134
Chain Sequence
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5gahJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5gahJ01
4UY8I 3CCMI 4V19K 2E34A 3CCUI 3I56I 1FOYA 3G71I 2NXNB 2E35A 1VQ5I 3CF5F 1VQLI 3CCSI 1VQOI 3CD6I 3I55I 1HC8A 5GAHJ 2ZJRF 1ACIA 1FOXA 2ZJQF 2E36A 2QEXI 3J7ZI 2H8WA 3CCEI 1VQKI 3G6EI 3CJQB 1VQ9I 5GADJ 5GAEJ 1YHQI 3CCLI 1VQ4I 2JQ7A 1YJ9I 1YJWI 3CC4I 4IOAF 3CJSB 1VQ8I 1WIBA 3CJRB 3CC2I 5GAGJ 5DM6F 1VQ6I 1VQ7I 3CCRI 3PIPF 3CCJI 1VQPI 2K3FA 1VQMI 1VQNI 1YIJI 2ZJPF 3CMEI 3CJTB 3EGVB 3DLLF 4IO9F 1FOWA 2OTJI 3CCVI 1YITI 1S72I 2OTLI 3G4SI 2QA4I 1YJNI 1QA6A 5JVGF 4IOCF 2FOWA 5DM7F 1Y39A 3CC7I 3CCQI 3PIOF 3J7YJ 3CMAI 1MMSA 1YI2I
chains in the Genus database with same CATH superfamily
3RZDJ 1YX3A 1HLVA 4PJLA 1EJ9A 3CCUI 3W2VA 3BR6A 4CCNA 3KLNA 4EM0B 1V54H 2MH2A 1NHAA 1FIPA 5DD8A 3W6JB 1W36C 5L3DA 4HX4A 1RETA 3HB9A 3I53A 1GV2A 3PUBA 3MKZA 4XLPF 2PMZN 2MH9A 2J5PA 3CLQA 2UWMA 5L3BA 3VB2A 1MBGA 2CQQA 1ZYRF 2LH9A 2ZFWA 1OCPA 4P55A 3OYEA 1OFCX 1SFEA 3RDIA 1CF7A 3PJRA 1F1ZA 1ORKA 2L9RA 5JLWA 3TQNA 4HF2A 2BVMA 2L7MP 4ZYAA 1J0RA 5ILVA 1O3SA 2EWNA 4IOAF 4HQEA 4Q5SF 3HG9A 3V7SA 2L7ZA 3CJRB 5GTHC 3RYRA 5GAGJ 3LFKA 3CC2I 5IP9J 4ZDOA 1TC3C 3LL7A 5A2QK 1J7KA 2OZUA 3V7CA 1PUFA 3KP6A 2P8TA 4M6VA 1Z0XA 2VN2A 1P92A 3K2AA 4AC0A 3TDUC 3FF5A 2QLZA 3GEZA 3L2RA 3BG6A 1VQPI 1XD7A 2G7HA 2L4AA 1EF4A 4YFXF 5J8FA 5HDGA 1FIAA 1FTTA 1Z77A 1IUYA 1W0UA 4BAYA 1R23A 4QWQA 3GTKJ 2F5VA 3WGHA 3JRGA 1UG0A 1Y8RB 2PEXA 4RDUA 3ZR8X 1FOWA 3LQQA 1LE8A 2D2WA 2GA1A 2GA2A 2WADA 3TO6A 3IWZA 2IA0A 4I7HA 2KZVA 4ENJA 3FHZA 2Z33A 2E5NA 2Y2ZA 1IXSB 2OAZA 3FXQA 4C3IJ 5E17F 3GTJJ 4O6JA 1PP8F 5DEQA 2NVTJ 3K1MA 3Q0VA 3ASOH 4RB2C 2X48A 3L2QA 1K78B 2YS9A 2ZXJA 5KNLA 4U87A 1BM9A 4N4OB 2HDCA 4A5MA 4GYIA 2M8EA 4GFBA 3H9GA 3CJNA 2A05A 1NTCA 2DLLA 2M1BA 3BCBA 4A3BJ 1A5JA 3F9KA 4PDKA 3OYDA 2R5ZA 3DKWA 4HLXA 3MD2A 1O57A 2M3AA 2VKDA 4G94A 5EJCA 5F64A 1W0TA 1SFUA 4E7JA 2HNHA 3FM3A 2A6HF 5CVUA 1XCBA 3BQZA 1GV5A 3GMEA 2GAUA 3TP3A 3O8GA 3V4GA 3W3CA 2XASA 2X51A 3VYTB 1LVKA 4KMFA 1P4XA 5GTIC 1VQLI 5EF6A 3K4CA 2A3SA 1A04A 1FBQA 1VQOI 1GDTA 1LFUP 2JA2A 4W97A 3L09A 3S3NA 3BJAA 2HXIA 2AS5F 2ADUA 1XTAA 3G3ZA 1SFKA 3ML6A 1OLTA 1DPUA 4E4HA 4PCQA 2XAJA 4M3DA 1WI3A 1I50J 1D0ZA 3P7NA 5TISC 4IZZA 4M3GA 5GADJ 1E3HA 1TLHB 2O0YA 2WAQN 1OCRH 2JUGA 4KT6A 2O3FA 3ERMA 1QHGA 1ON1A 1AWCA 4L9JA 3TL4X 2E7WA 4QIWN 1IO2A 3DBLB 3IKVA 4H4KC 3M1CA 3TOAA 3L9FA 3ONQA 5DDGA 3F72A 3PO2J 2R7OA 3FBIB 1PUFB 3GTMJ 1VQ7I 2FXAA 4BKXA 4AM3A 1U9NA 1A31A 2W48A 2M9HA 3VYSB 3MKYB 4E7SA 3IH2A 5EG0B 2DA3A 5HS7A 1I3QJ 5J4VA 4D9JA 3KP7A 3SDBA 1MMDA 4CO8A 3BDDA 1FMVA 2E1MC 3FDYA 1JI8A 2AQEA 3E6BA 4F92B 3CMEI 4YIRX 2XV4S 2QGUA 2LG4A 3FKIJ 3OYLA 1BR4A 1FT9A 2Y31A 2VPLA 3TP0A 4ZTFA 4BQAA 3H5RA 4C2MJ 1QRYA 2FMLA 3WE3A 1XSDA 2GIVA 1TNTA 2KPMA 4G8XA 2O8KA 2QBYB 1SFXA 5FKKA 2K40A 1KYZA 3OYKA 2COMA 2H09A 4UB6C 3NWSA 1P7JA 3RI4A 2HVSA 2YX4A 1WJDA 2NRAC 2IGMA 2M87A 3H9QA 3DFGA 3FMSA 4LK1F 4CUGA 4FETA 2Y48A 5HNFA 2PN6A 3C3WA 5B1AH 3BCAA 2BW3B 5D8KB 2KLOA 4I01A 1HW1A 4G9YA 2KIUA 1HBXG 1E3OC 3W2WA 3CCYA 4PGGA 2M5WA 4KFCA 4C30A 3GUDA 1DGRM 2O5RA 2V7FA 1X19A 4IF4A 2W84A 1T2KA 1SFOJ 1PP7U 3GBGA 1ZQ3P 1WRJA 3CMAI 4IX7A 2CG4A 4NHJA 2OUMA 1WJCA 2QUFA 4NQWA 1PYVA 3FK6A 3GFLA 4DYQA 2ACJA 3EQLF 2VUMJ 3BTLA 4M71A 2DJIA 3SYTA 3F22A 1TWAJ 4ENMA 1VFCA 4LB6B 5D6EA 2MA3A 3F6VA 4CYCB 2HKOA 3NEUA 3H3UA 4KIGA 4FX4A 4AVZA 3WGGA 3HKZN 1I27A 1QU3A 4UNOA 2UV1A 2EQRA 1MBKA 4AVPA 2LR8A 1V5EA 4EJOA 5DCFA 2P5KA 3KEYA 1LKXA 1SMYF 3SZTA 2W00A 3ZOBA 1X3WB 1XB4A 1IRFA 2XGXA 3I54A 3M4OJ 1K79A 3H3ZA 3X2QH 4FQGA 4EJWA 1S9HA 2QQAA 1I1SA 1V3FA 2DMNA 1QZEA 4RLQA 2X0LA 1HKQA 3K4LA 1XGMA 4M3FA 1HOMA 2KIFA 3GZNB 4RGUA 5IYBJ 4ZJZA 1KQ0A 2VI6A 1JHFA 1YTYA 2I5UA 1JKOC 2FJ1A 3A1YA 1X1DA 3B02A 5FLVA 4XKBA 3ZCOA 2Q2EA 3IH3A 2MD5A 2V1NA 2OU2A 3K4MA 4IJAA 2MD0A 4Y15A 2ICWG 2EIKH 2L02A 3ZXSA 2E2IJ 3IHUA 1QPMA 4Y4RA 3T8TA 4A3EJ 2WV1A 5LGTA 5E20A 2JRTA 3CJTB 4GCVA 5EEHA 5ED4A 4MO7A 3S15J 2EV6A 2PMUA 4HNTA 3J7AY 3I9V2 4BJ6C 2P6TA 4EJVA 1QBJA 1KZHA 3IRRA 2DPDA 3GW2A 4HDUA 2RQPA 2TRTA 3LMMA 2CW0F 3G1OA 1HXDA 2ZMEA 1ZH5A 1MD0A 2DMQA 4A3IJ 3CQZJ 1D1CA 2EZKA 5C4JJ 5CVVA 3PNYA 1IN5A 2DPUA 3U9GA 4LIVA 3S17J 2ME0A 1AHDP 2MLKA 3WTYC 2ECCA 3E5XA 1Z6TA 2DN0A 3KX2A 1YW9A 3WG9A 1MIJA 1F36A 2Y30A 2QCOA 2V1DA 2RGVA 2M2EA 2QF7A 4FISA 4BL0B 1IC8A 2JA8J 1FSEA 3PIOF 1ZG5A 2W1OA 1FC3A 2XKPA 3OR1C 1X1AA 2V6CA 1MMSA 2HOEA 4PJ0C 3KP4A 2WAFA 4JOMA 3RKQA 2XF5A 1AOYA 3RQIA 4E7HA 5E3MA 2KT0A 1ZGWA 2ZSHB 4DZJA 1F5TA 4MGRA 3HOTA 1I3AA 1X4PA 1OCZH 5F0FA 2K5CA 3K4KA 5H2FC 5ICCA 3DV8A 2AXTC 1LFPA 2E19A 3M07A 2KDOA 1F4KA 5GAHJ 2EH3A 3L7WA 1JKRC 1R6RA 2XB5A 2EFNA 3ISPA 1MW7A 2YU3A 3ELKA 1H9GA 4A3FJ 5L3FA 3KEQA 1IRZA 1J9IA 4A0ZA 2PJRA 1IN6A 3C2BA 1YS6A 4K2EA 5IOYA 1W7PA 2P7VB 1G3SA 1MGTA 2F4MB 3K70C 4AWXB 5FLMJ 2VL8A 2DMPA 3DTIA 1U6GA 2BHYA 3HGGA 3V42A 2COBA 3GVAA 4IRHA 4IQJA 2GBYA 4BY7J 2DYSH 3CDHA 5DM6F 2XGEA 2AO9A 3F8FA 1HF0A 3BR3A 3I4MJ 2XAQA 4LD5A 3RSNA 1MH3A 2P5LC 3AG2H 1YIJI 3LSJA 3NQOA 3JRAA 2K7LA 4M3BA 3JTHA 1YQAA 5BNGA 4F3QA 4CYDA 2DOFA 4BS9A 2ZXHA 3NWTA 4A3GJ 4Q47A 3DU5A 4D7NA 2GXBA 4KA4A 2Q8KA 4ZYDA 1U8BA 1USSA 3C18A 3A0HC 1BIAA 3P9KA 3ZQ7A 4BE1A 1JE8A 1UAAA 1Y8QB 4EEFG 4JX5A 4L5JA 3R0JA 4R8HA 1MDMA 2DFEA 4IHYA 3U21A 3H5AA 4BXUA 1IN4A 4JK1X 3J81Z 2CW8A 1XPXA 2M0MA 2F4IA 3ROUA 3I59A 2NVXJ 5E18F 2FOWA 3ASNH 3F8BA 3FK7A 1KU9A 1VF9A 3EUAA 2A61A 2FA5A 2O7OA 3HOYJ 1MJAA 1X58A 5F27A 2HZTA 1RUOA 1EH8A 1U8RA 3H3VK 3AKZA 5HLGA 4RGRA 4XKCA 5FO5A 5C4XJ 2FNAA 2CV1A 1O3RA 1IZ1A 1MH4A 4IHXA 1XS9A 2JVHA 2PG4A 1ZRCA 3ZQQA 4EGYA 1R9TJ 1ZG3A 3I64A 4II3A 4KIBA 4HQMA 2YX7A 1R5ID 2DYRH 1JKQC 2R3SA 1HW5A 2KQRA 2E1NA 3RZOJ 1A6QA 2LLKA 3BG7A 2WTEA 1YFHA 1JUMA 4LGWA 2MC3A 1TQIA 5K7ZA 3IUOA 1KQ8A 1WCMJ 3HL2A 2WB1A 4RLFA 2E7XA 2RVCA 5EEAA 5HVQC 1WJAA 2V6EA 3FXMA 3A02A 3AAFA 1W7PB 2L5QA 2XB0X 3HUGB 4RGSA 3OMYA 2JSPA 4GYGA 4I02A 1Z9CA 2O9LA 1YJWI 2NOJB 3FXUA 2VJ5A 4DIQA 4BY1J 5GPCA 1R22A 3E1SA 4M9SA 3OYHA 2H1KA 2IP2A 2L9VA 2FOKA 4FE4A 4HX7A 4F55A 1N77A 2CQKA 2DOEA 1TBXA 2D1HA 3SEQA 2K86A 4P1WA 1U78A 3DBRB 4C2TA 3RKXA 5F0HA 3F6OA 2FD5A 4Q48A 3T8RA 1YOVB 2KISA 2W82A 2JSCA 3FMQA 2XAFA 2XPWA 5KCMA 4HF0A 3DTKA 1OYWA 3OYGA 1AU7A 2M8GX 2YSRA 2YUSA 2XPUA 4XIDA 1ZR4A 1HSJA 1XG1A 2X4HA 1FY7A 3JRDA 2QQ8A 2VT3A 4I09A 1B72B 5AIQA 1BL0A 1FBSA 3EGVB 2M7BA 2K02A 1BJAA 2OZ6A 1TP4A 5F1JA 5BPIA 4L5EA 2DA1A 4PJJA 4MHGA 2XSDC 2H27A 3JAMZ 4ESBA 2F5EA 3EPZA 5K5QA 5DYMA 3ZQHA 3S14J 2ZNZA 1TW2A 2EFOA 3EDPA 4HF1A 1MDMB 3Q9VA 5DCMA 4WXCA 2HVRA 3BWGA 3KP2A 2E1MB 3HBLA 4UUSB 3J81K 2KRCA 1MZBA 3ZMDA 2K4BA 2V1UA 1HSTA 3D5RC 2XDVA 2NYXA 3TW7A 5HLHA 4AIDA 5DM7F 4BACA 3PM1A 1S6LA 3DBHB 2VXDA 1DUXC 1WH5A 3RQ4A 1IF1A 1LUJB 2E71A 3E0JB 4Y52J 3L00A 2D1VA 4E7IA 1RIOH 3E6CC 3HJEA 3B73A 2DTZA 2UZKA 1G3WA 4P9FA 1AKHB 2X6OA 4DBRA 2IGKA 1GLNA 2E34A 3S2HJ 2EILH 2NS8A 4U88A 4ZYHA 1EH7A 5M3MJ 1WJ5A 2ZO4A 1IW7F 2F5FA 3GTQJ 1OYYA 1MNDA 2LVSA 4RB3C 1DP7P 1FMWA 3KFWX 1H8AC 4LLGF 2IS2A 3RKYA 5CKTA 3OYMA 9ANTA 3KE2A 4ZYGA 2LF8A 2ZJQF 5EGOA 2IPQX 2G9WA 2RC4A 5LRSA 4DOZA 1MKMA 3CCEI 1J59A 1I6XA 1I6HJ 3PQJA 2UXXA 3KLOA 1W5SA 1HW2A 5H6QA 2P0WA 1TWGJ 2NVQJ 3C7JA 4XR6A 4UUVA 2CO5A 3ZGKA 1ZG1A 5FKOA 2DODA 5L3EA 2VJIA 2DTRA 4MFEA 3T5XA 1Y1WJ 2K85A 3T1BA 3R60A 2EFWA 1SD7A 1BN5A 1Z91A 4N9HA 3QU3A 5HOOA 1UZCA 2CJJA 3PIPF 3CCJI 5KK1A 1K7AA 3F23A 5TRDA 4I2OA 3E5UA 2ESHA 4GGGA 2F5CA 3M7GA 4PSXA 2P4WA 3UR3C 2OV7A 3S1RJ 2RN7A 2JA7J 4ESJA 3MQ0A 3JSPA 3LAJA 3L2WA 1OISA 2HR3A 3HC7A 1W1WE 5E79C 3DEUA 3EUKL 3MZ8A 1ETYA 4PUSA 4BQQA 2BOLA 4V2FA 5E1XA 1V4RA 2HTSA 2OPTA 1G3YA 4GRIA 1MNMC 1LEBA 3BTJA 2V4JC 2DCEA 3IH4A 3PFYA 4PZJA 3N4MA 3BZKA 2BY3A 3HPHA 2ISZA 2ELKA 2F5DA 1ZK8A 5CLSA 3M8EA 4KJZA 4KN4X 2DK8A 2DI3A 4EATA 1RKTA 2YU9J 2BXYA 1A6IA 2LTPA 3F0CA 4QPOA 3V8LA 4Y13A 2FNPA 1T0FA 1YLFA 4JQFA 3WU1B 4L9TA 4NBQA 2JA6J 3WTWC 4CH7A 2E2HJ 3SHFA 1YE9A 4C2UA 5IT9Z 3DPLC 1NK2P 1YO5C 2R7SA 1DU6A 2V1XA 3HRSA 4XL9A 4U7BA 2DA5A 3QOEA 1BI1A 4HLYA 4BEHA 4XK4A 1TT5B 2ISYA 1ETVA 1T38A 1VTNC 2XGDA 5JHUA 3BPXA 2W57A 1B6AA 3ESWB 2IRFG 4MIMA 4XLHA 2P81A 1YI2I 2CUFA 4XLEA 4D5CA 4NC8A 3MVPA 3F8MA 3TGNA 2VKVA 5K7FA 1R7JA 2XC7A 1WPKA 2MFZA 5ERIA 2P5VA 3GLXA 3N97A 4X6AJ 4HAMA 3FX3A 2NAZA 3TO7A 1VQ5I 3QQAA 1MBEA 3WTVC 1U5TA 4G12A 2R7DA 3MZYA 2QSGX 5J40A 2TDXA 3BG9A 1G8XA 1FYLA 5IT3A 3WTXC 3LWFA 1TQPA 2JPBA 3BY6A 2DDBA 3Q3SA 1XX5A 4B1RA 4J19A 1QPIA 3WU0A 2E36A 2B7EA 2H8WA 2HI3A 3VFZA 1H88C 4UUTA 5H20A 1JJ6C 2X6WA 1JKPC 4CCKA 3CCLI 2OF7A 3FISA 4EVIA 1R4MB 1TZLA 1XGOA 1S8NA 1YJ9I 2WA0A 5TGTA 1IV6A 3F8NA 4E6KG 4B44A 3I0TA 5EYRA 3QWLA 3CDIA 4NUBA 4O5VA 1IXRC 2WBMA 2BXZA 2CU7A 4MEXF 4LLLA 3BZ6A 2GXAA 3ZQIA 1QVTA 2Y69H 5M5YJ 2CFOA 1BI3A 5LBQA 2NS0A 3K1NA 3KYCB 2LKXA 3HKZA 1PUEE 1D3YA 1WHUA 1EA3A 1CF7B 4G6DA 2M7AA 1XMAA 1DP3A 3JRIA 4LB5A 4M9ZA 2DJNA 2QVOA 1Z7LA 2MG4A 2DAOA 1X4OA 1XCVA 1FYMA 3OYJA 2UUZA 2HDDA 2LF7A 3KEOA 2BZTA 2HFHA 5KAIC 5BMZA 4W1UA 2DXIA 1FBUA 2LY9A 2R7FA 2ZSIB 1BOAA 2VBXA 1YJNI 1R5HA 5FGMA 2J5OA 1OCCH 4P96A 1G2HA 3H9JA 1LVAA 1R49A 2Z5UA 3FM5A 5CPRB 3HSRA 2HZDA 2OQGA 4E70A 1LE8B 1D1BA 2R7RA 5IYDJ 3PO3J 3LSIA 4YIIA 2FBIA 1GHCA 4G7ZF 4BDYA 1K6YA 3PNVA 2LP0A 1Z1DA 3ABTA 1JGSA 3E6MA 1MBFA 4LG3A 3CMMA 5EEGA 2HKXA 4RM2A 2L0KA 1R1TA 2DA2A 4XRSA 1P2FA 4LJZF 2E35A 1OJLA 5HDKA 1A36A 5HLIA 3CF5F 4OAYA 2JWTA 1W4MA 2DMUA 1KU2A 2R5ZB 1TQMA 4A93J 3HHGA 2R7ZJ 4Y3OA 4CCJA 5ICGA 4AIKA 1IXCA 1Z21A 3JRFA 1ZKGA 2L9SA 4QSHA 3C1DA 4MQVA 1VQKI 2KKOA 1MSEC 4HV6A 3CJQB 4KYWA 1WJBA 5LRRA 4X0GA 3KZZA 3QYBA 1YIOA 2EZHA 2FEZA 3K6GA 2CSOA 5EZHA 3J7AO 1G59A 4AYBA 1OR7C 5ILUA 3Q0WA 1VZ0A 3LSMA 3S93A 4C3HJ 4MTDA 1FP1D 1X3UA 1SAXA 3JW4A 1DQUA 2PJPA 2R4GA 4WWCA 3RPUD 1W36D 1TW3A 2CUEA 2LK2A 1VI0A 3ZMUA 1R5GA 4A12A 4G7HF 2KP6A 4XICA 2ID6A 3DKYA 1JUPA 3HM5A 3U2RA 4WXDA 1RI7A 1FNNA 2WC2A 2X6XA 2V9KA 2QENA 1F9NA 2R7QA 1RRJA 2KIQA 3G2BA 3I58A 1SAUA 3U1DA 3LA2A 3ABMH 3FHNA 4J01A 3KP5A 3EYIA 4XRMA 3DTEA 2BY2A 4ZH4F 5AIPA 2LOOA 3OIQA 1LEAA 2AQFA 3HTSB 2E2JJ 5JLXA 4XNFA 3SFIA 2VONA 3S2WA 2O03A 2UXNA 3ECHA 5ICFA 1R36A 4BDZA 1YITI 1IG7A 2BY1A 2L4MA 2ZB9A 4MLOA 1DGWY 1JHHA 1TT0A 1Z3YA 2HEOA 2IJLA 3OSGA 1D0XA 4KICA 3BQYA 2VQHA 4HNVA 3GO5A 1S3JA 2ZCWA 2CV0A 3T0YA 3RPUA 5JVGF 3DKXA 3O8HA 2CGPA 4DYCA 4EM1A 4HEA2 2EZIA 1GVJA 1AA7A 3BPVA 3HXLA 5IPAA 2FBKA 2E1CA 4QLCU 2OCEA 3WE2A 1PDNC 4EM2A 4BH9A 5D5XB 4Y7NJ 2NVUB 3QRFF 5FB2A 1UELB 4FHTA 5JFRA 2WV0A 1FSHA 2R7TA 1OMIA 4UY8I 2OCCH 1WSUA 3R0AA 3FZVA 1BBYA 2B9SA 3JREA 3IV5A 3KCCA 2W7NA 1LJ9A 1YW8A 4CCLA 3KPHA 2EB7A 2LBFA 2K9MA 4HPQA 1BOBA 3QYFA 3HOVJ 3IAM2 3JRCA 5K7HA 2KDZA 1E2XA 1FZPB 1Z67A 2DBBA 3S3OA 2A6TA 3EUHC 5LGUA 2JT1A 4H0EA 5IP7J 3F8CA 4HRIA 1EKEA 2QSFX 3J7ZI 3LQRA 3OSFA 4NQWB 4A3LJ 3QOPA 2XVCA 3C2GA 3HOZJ 1Y6IA 1SEUA 1K4TA 1OCOH 5LHGA 1SC7A 3I4PA 5HNHA 2K3PA 1GT0C 2EV0A 4S0HB 2IBDA 2VPRA 5JR3A 5IYCJ 2HPIA 1ZGJA 4HX8A 1R58A 2OJED 3JRBA 3K4BA 4FT8A 4XN0A 2XAGA 4BBRJ 3AG3H 5LD2C 1BI2A 5J47A 1MNEA 2LNBA 2VQLA 3HSFA 3O3KA 3QAHA 4BHCA 4CSWA 3MCZA 2JMWA 5D4SA 4G7OF 2FSWA 2RREA 3SZGA 3FXKA 3HGYA 3HRMA 1T56A 4OINF 1YRNA 1ZLKA 4FASD 2OA4A 2CQNA 5HODA 1LFBA 5BPDA 1SVOA 2HOAA 2A68F 2BYVE 2JPCA 3GLLA 1Y0UA 1PJRA 1R1VA 1RKWA 1STZA 4BHPA 2DK5A 5E8GA 5D5UB 4BGDA 2O61A 3IC7A 1ZRDA 1HQCA 2VBZA 3REOA 2CYYA 2HYGD 3K69A 5EDNA 1USTA 2OTLI 5CVIA 1RESA 2Q2EB 2ID3A 2O8XA 1HDPA 1IUFA 1IJWC 2Z9OA 2FX0A 4F52A 1JTYA 4XM3A 3KP3A 5J1RA 1UHMA 3S32A 4M9XA 1XC5A 2PMHA 3IP4B 3QPHA 3GWZA 4IRGA 1M1EB 2VKHA 2HPMA 2GLOA 1QHHD 2ZMEB 2E1OA 1FPQA 1KGSA 3UNGC 3M1EA 5HLTA 3GTGJ 1T98A 1A35A 5L3GA 1APLC 1MJBA 2R92J 2EV5A 4YEJA 1SVMA 4HW0A 1IDZA 1U5TC 2OD5A 4BHBA 2HQAA 1S7OA 4MNUA 4IQ4A 3WTTC 2JZYA 5LGNA 2RNJA 2VJ4A 1UFMA 3QPLA 5FFZA 1WJEA 2QKMB 2ZJRF 4IXAA 2BE5F 2QEXI 1BIBA 2Y0SA 2DA6A 3LA7A 2DO7A 4PK4A 5LLQA 3IL2A 1YHQI 2JVGA 2FRHA 3CUQA 2JA5J 3F3XA 1O7LA 2L01A 1O3QA 5FKMA 4HNUA 3CTAA 3CP8A 1S29A 4B3AA 2QQBA 2Z1DA 2X1CA 2Z16A 3D1NI 4LIUA 3CJSB 1T8IA 1QVUA 1QZZA 3LAPA 4ENNA 5BQTA 3QPTA 4IPAA 3RCOA 4XRSG 3CCRI 2VC1A 2JN6A 4DGWB 1EH6A 3CESA 2MSYA 5B5EC 1OPCA 5J4YA 1IDYA 3FKJA 2PJRB 4RB1A 2BHZA 1YRNB 2R7XA 1BI0A 5HS8A 2L7FP 2R93J 2DFFA 5CYVA 2GOXB 4OIOF 1LDKB 4A3KJ 4CGZA 3FWEA 3I3LA 1TTYA 1YYVA 1ZRFA 4ITVA 3DLLF 3LSGA 3KIOA 2O6GE 1KONA 4N0BA 1O4XA 3CDLA 3HDDA 1D1AA 1W5TA 2HQNA 3HHHA 2DT7B 3JCUC 4Z6YA 3KZIC 4HBLA 4BUPA 4RMNA 2RKHA 1Z7UA 4HSRA 4B3XA 3WTZA 4BYYA 1BR1A 3HOSA 2VBWA 4PFOA 1LB2A 2HU9A 2VC0A 4XBFA 3ZQGA 2PMZA 2IS4A 3H92A 2JRMA 1WQ2A 4AIHA 3ZP5A 2Q1ZB 3R4KA 3TOBA 1MBHA 2M34A 2B63J 1GUUA 2QQ9A 3J80Z 4WX9A 1WGXA 1X3ZB 1YS7A 2LMDA 1GXQA 3BR0A 3VEPA 4A3MJ 3LA3A 2A6EF 2CUJA 4B47A 2K4JA 2HYFA 2YR2A 4D5FA 1P6RA 5C44J 3K1PA 3G71I 1P4AA 4MTEA 1X2NA 5FRNA 3I59B 2LFBA 3ECOA 2G7UA 1UG2A 3ZQCA 2HVQA 1OCTC 3DEWA 4ON0A 3BJ6A 2LSOA 1TWHJ 4PJNA 1C0WA 3P9IA 2ECBA 3A4CA 3MEXA 4PFPA 4R79A 2EPFA 1NG7A 4QPQA 2ZXWH 2H94A 2ZC2A 4BQOA 1V5FA 3JTGA 1FWZA 4YFNF 2KZGA 3NAUA 4IL6C 1ULYA 3QU6A 3S3MA 1UMQA 3GCMA 2QM3A 4M6YA 3TEDA 5M3FJ 5IY5H 2EJRA 2EA4A 1RZ4A 4FE7A 3CC4I 3OIOA 3QYEA 5DUIA 1ETKA 3H0DA 4ENKA 3G1MA 2HWVA 2W24A 1VQ8I 5ILSA 3ZMTA 3WU2C 2STTA 5TJJA 3KYDB 2Z2SB 4JP0A 5E3LA 2VIXA 1E0EA 2DOAA 2VASA 2MGQA 4M6XA 2GOMA 4X1EA 3CUOA 4PGHA 2EINH 1IRXA 1VQNI 3IWFA 3NARA 2VKEA 1K4SA 1WWXA 1K78A 1FJLA 3SZPA 5E1WA 3OOPA 3PNTA 4TV7A 3TKYA 4WCGA 2WB1N 4ZDPA 5DUKA 3GX4X 3W6VA 4E7ZA 2C6YA 4RS8A 2AXLA 2HQ5A 1LDJA 5AONA 4C3JJ 3VSLA 2HXOA 4OOIA 3K70D 2HOTA 2LRDA 4KUMA 2P6SA 3CMYA 5E3OA 3CCVI 2VLAA 1REPC 1U3EM 4OMYA 3D5SC 4QTRA 3OIPA 1J09A 1ODDA 5FD6A 3SDGA 1FLIA 1J5YA 1NG6A 5DTDA 3PQKA 4OIPF 4LMYA 4XSZF 4CA0A 3M8FA 3GTOJ 4RB0A 3J80K 4NB5A 3VPRA 1FEXA 4I0BA 1UHSA 1G6NA 3M9AA 2VJJA 5BOXA 3CCQI 1P9QC 4M74A 5M5WJ 2DMTA 1G3TA 2WAQA 1QGPA 4XSXF 4ANJA 2CQXA 3JAMK 3WGIA 4Q4ZF 4A0XA 3J7YJ 4RAGA 3WHBA 2LD5A 2ZMEC 3BOQA 5DCMB 1WVRA 3AG4H 3RTRA 2XKOA 2QYOA 4LOCA 4ZTJA 4Y17A 2WY7Q 3MKWB 1WI9A 1XDSA 3OS0A 4EMSA 4XOTA 1BR2A 3CCSI 3E6DA 3SFZA 2IGOA 4XLNF 3I55I 4D0PA 1P4WA 1YG2A 4RGXA 1Y1VJ 4MFDA 1XGNA 3A0BC 1BA5A 1YX5A 1POGA 1QQIA 5J6XA 3RKWA 3TBIA 3HOUJ 4YRVA 3OYIA 2CRGA 2HDWA 3HZJA 4HDVA 2IS1A 4B09A 1B8IA 5EG0A 4G6QA 2IAIA 2L9NA 3E3VA 4U0WA 1FOKA 4YIFA 3IAS2 4P5OA 1R1UA 5JI6A 1QZYA 2LREA 1XDUA 5ICEA 3HOXJ 3TW6A 3W6KB 3GTLJ 3LSPA 3BG3A 2DT5A 3OYFA 1N25A 1ZELA 3DQVC 3H36A 4KIFA 2E5ZA 3DF8A 1DDNA 4EJUA 2RQQA 3S2DJ 5EGOB 4XLAA 2QBYA 1R4NB 1XSXA 4BQNA 2NNNA 5F08A 1RPWA 4NNJA 2MC4A 3QP5A 2X1EA 2XRNA 1UJ8A 3GFIA 2WY8Q 2XF7A 4OIQF 2K3FA 3DU6A 1FX7A 6PAXA 1F43A 1GVDA 4YFKF 2STWA 1QO0D 2CMPA 2ELHA 4M73A 2DA7A 2KHMA 2BW3A 3DLAA 1ONVA 2XPVA 4PJMA 3I71A 3SEZA 3OWTA 4R1HA 3BTCA 3SXYA 3IRQA 1T08B 4RAZA 5KHDA 3P5JA 1I1GA 3P9CA 5IOZA 4DW6A 1D8KA 1X1CA 3OV8A 1D0YA 1FYKA 3MWMA 2EIJH 3HSEA 2W25A 2IEKA 1HDDC 3BC8A 3G4SI 5FLXZ 4I99C 2QA4I 3ABKH 5CVJA 2IVMA 3R6SA 1TL8A 3S1NJ 2ME6A 4A0YA 2XSJC 1T6SA 3WTUC 4N9IA 2ZBKA 1WKMA 2FBHA 2XIGA 2OBPA 5LEJA 1O7FA 2PBIA 3TO9A 2L54A 2PQ8A 4A6DA 4CYCA 1BJZA 1X2MA 4FTHA 1O3TA 2D5VA 4B8XA 1JTXA 4A3DJ 4FX0A 3OL3A 3RYPA 2P7CB 4HG2A 1V5GA 4IRIA 1HCRA 2R7VA 1ON2A 3QODA 2PLYA 3HPGA 5FD5A 4M3EA 3OYAA 4BNCA 4V19K 2M30A 5IT9K 5LHHA 2KJBA 5K5RA 4S04A 2ESNA 4E7LA 4HZFA 1KQ9A 1H0MA 2LC2A 4CCMA 3FXOA 2MLGA 2TCTA 3ZMVA 1ENHA 4KMUX 3JRHA 3AL0B 4BEHB 4XORA 1SANA 1HC8A 4II2A 2G0EA 1ETQA 3ZRGA 4C9YA 4YG2F 4DYRA 3HRTA 1ETWA 1BC8C 4ZZDA 1L3LA 1B8IB 3C2HA 4ZC3A 2NOGA 2BBYA 1HA8A 2DT6A 2VBYA 2EK5A 3B6CA 1JT6A 3TMOA 1VQ4I 3B6AA 4IHWA 2R7UA 1CGPA 4DBQA 3CUQC 1U5TB 2JQ7A 4AUXA 4BJTA 3WG7H 2XRLA 2XAHA 1GXPA 1TWFJ 4ETSA 4G6TB 4A5NA 1WIBA 2HYJA 2M4KA 4RAFA 2HTJA 4U7DA 2EZLA 1Q1HA 1ERDA 4KT5C 3G1LA 1I5ZA 1WH7A 2ZXIA 3A01A 2ZKZA 1U2WA 2K9LA 3CLOA 3OOUA 4XLCA 3IKTA 3OYBA 4IHSA 3LSHA 5FJ8J 2LYCA 2XHKA 1VQMI 3GF2A 1IAWA 3S16J 4ASNA 4KITB 4S05A 3HYIA 3COAC 3EYYA 1B9MA 1MSFC 1LPQA 5LHIA 3K7AJ 1RC9A 5KAFC 2RNGA 1HKTA 4F91B 2KMUA 4IO9F 2X1DA 1LDDA 4KISA 2H6CA 3K0LA 1UCRA 4XN3A 4LG0A 5H6RA 3MAJA 4AIJA 4XOPA 2EA2A 3DEEA 1I39A 4UXNA 3JR9A 3ULQB 5FLXK 1XSVA 2LDUA 4XKWA 1S72I 2I10A 2PFBA 3GFJA 5F6FA 1ZN2A 3RPQA 4WXHA 2DA4A 3GFMA 3MMYB 1N78A 3ABLH 3VSKA 3VYRB 3LSRA 3VWBA 4E7KA 1MMGA 4A6EA 4J00A 4A2UA 4XONA 4IOCF 4BXXJ 1Y56A 5FKNA 2ETHA 3CF2A 1ETXA 4XRFA 1ZHFA 3ZPLA 3LOCA 2XUBA 1U9OA 4OAZA 2HOSA 2VQCA 2E60A 3GZ5A 2VXZA 4FCYA 3BR5A 4BE2A 1JT0A 4OWRB 1R00A 4IKFA 2F4OB 2R5YA 1B1BA 4NC6A 1ZARA 3AG1H 2VQGA 3K4JA 2X6YA 3HTUA 2VE9A 3GTPJ 3K4NA 1FOYA 2NXNB 4HV5A 4IHTA 1UB9A 5C3EJ 2JUCA 2Z99A 2M0CA 2WWYA 3HRUA 2Q0OA 4OU0A 5HDNA 3OS2A 2KFDA 2W85A 5B66C 1RNLA 1XGSA 4BE0A 4A3CJ 2CH0A 3DPTA 5F1RA 4I76A 1H89C 2MYSA 1MBJA 1XMKA 1HKSA 2H1LA 4RM3A 3G6EI 1L0OC 3ERED 3Q5FA 2V26A 2I8DA 4DQ2A 2LKSA 5J8CA 2QWWA 2KL4A 1YW7A 3PFIA 3H1CA 4IVNA 1SD6A 3BTIA 3A03A 3Q0UA 3MN2A 4LK0F 5D6FA 2H8RA 4CHUA 5HS9A 5EZGA 1ZR2A 1R71A 2FE3A 1X1PA 2XF6A 2K9SA 1W5CC 3N05A 1VQ6I 1Z05A 3A01B 3TDZC 3WHCA 2Y9YA 2DDAA 3VODA 3KETA 2V79A 1DU0A 4XQFA 3H35A 1T39A 3MFKA 2A5YB 4BU2A 1SD5A 2CW7A 2L7KA 4I98B 3BROA 1SMTA 5CQEA 2PI0A 2R0QC 2NVYJ 5FRMA 2HS5A 1ZAOA 1CQTA 2KJCA 3ZN0A 3F21A 4ZZLA 1W7PD 1ZREA 4RA2A 2R7WA 4LG0B 3DPUA 1VNDA 2WAEA 1WZ2A 2NNYA 3FXJA 1ZLJA 3LNQA 3S1MJ 4AYBN 1OKRA 4EGZA 1MMAA 3ZMZA 3HEFA 5CVRA 5BS6A 2MBFA 3GYHX 1S7EA 1ETOA 1S7AA 3O2PE 1KA8A 2A07F 3DXJF 3WTSC 2V9VA 3ZN1A 1K6OA 5JVTA 2DFHA 4NC7A 5D8LB 3U1KA 4CZZA 2Z3YA 2VODA 3W2AA 3BZCA 3UKGA 4MEYF 4V2GA 2BY0A 3LFUA 2JTVA 4RAYA 4CXFA 2KIMA 5FFXA 5J3LA 1S5LC 1KYWA 5FROA 3OYCA 2R5YB 4GO1A 5KVRA 1Q1VA 2L3DA 1EV7A 1X1BA 1H9TA 2JK3A 1FTZA 4EQQA 1RR7A 1PVEA 3I5UA 1T0FC 2MW8A 4L9NA 3HUGA 2IA1A 2K9NA 1DPRA 4ZYEA 4ESFA 4UV9A 2LY1A 2ELJA 3DP7A 3CD6I 3CO7C 3VOEA 3BP8A 3AL0C 1BC7C 3JSOA 1KU7A 5E8IA 2EFPA 1RUNA 1ACIA 5K5OA 1FOXA 4UVBA 5CJ9A 3GZ6A 2GIZA 2MABA 5D4RA 2CUZA 2X85A 1LNWA 2ZFUA 1VQ9I 1T33A 2XGCA 3RIRA 1B4AA 2DFIA 3H5NA 5D5WB 4WK8F 4WF2A 2OC6A 2OQRA 2VB6A 2BGCA 2CV2A 2Y0MA 3AFHA 2DU9A 1ZGAA 2LBFB 4L9VA 3EETA 3Q9SA 3I4NJ 2IGNA 2IA2A 2GZWA 2ZNYA 3M3YJ 3E7LA 3D0SA 1B72A 3FXRA 1V55H 5F0CA 4AD9A 4GXOA 5DV5A 2RDPA 4UVCA 4XMYA 3BLYA 3OR2C 5LFAA 3L2UA 1Z6RA 2LKPA 2EFQA 1TNSA 5B1BH 3OS1A 4D1QA 1J75A 2A69F 3BT9A 4MQ9F 4A3JJ 2W4SA 4RBOA 2EBIA 3L2VA 4L18B 1D5YA 4JBAA 3V7RA 4JX4A 4UUSA 5CQGA 2GXGA 4HYEA 2ZJ2A 4AU7A 1G4DA 2GM4A 2F6CA 1JUSA 2CFXA 1B59A 2VOOA 4ABZA 3VYUB 4BXFA 4UHTA 3BR2A 1TWCJ 4IHVA 4B4CA 3M8JA 4KNYA 2F48A 3ABUA 2RAEA 3CP2A 4I6ZA 4U0YA 3OL4A 3V8JA 4B43A 2IW5A 3BR1A 4CICA 4NDLA 4KDPA 3QPSA 1AKHA 1IN7A 4JX6A 2CQ7A 2VOPA 4M72A 3KZYA 2RV8A 1IGNA 3FIWA 4U0VA 3G73A 1OQYA 4DZPA 2XAUA 1IN8A 5J1UA 4UV8A 3GXOA 4O3MA 2NS7A 4P9UA 4LFUA 5E1ZB 3CC7I 3K9TA 4BBSJ 1OYIA 2DQLA 3RJPA 5L3CA 5LEKA 1JXSA 3HIFA 1WJFA 1BW6A 2HGCA 1Z3XA 4HSTA 3FBNB 3CCMI 2K27A 1IV8A 1P7IA 3K10A 3K2ZA 2X9DA 1J2XA 4YELA 1Y0NA 3S1QJ 3PSFA 3I56I 5E3NA 3E5QA 2KRHA 1OR7A 4PSWA 3LSTA 2D45A 5J1YA 2FUG2 3OY9A 2VE8A 4LLNA 4DJAA 2HQRA 5GP9A 1JGGA 4UVAA 4XLFA 3V8KA 2EIMH 1T95A 2VT2A 1K83J 3PSIA 1SD4A 3R61A 3L2CA 2BV6A 3D5LA 4JYKA 5FKLA 4L0ZB 2FU4A 2B0LA 3H0GJ 3MZHA 1B9NA 2FQ4A 2JJ7A 4OMZA 1XMXA 3FXLA 1FP2A 1MMNA 3MKLA 5GAEJ 4EJTA 2GWRA 4DNCA 4Y33A 2FMYA 3O6BB 2M4GA 4XKVA 3S8PA 3FMRA 4BJ5C 1U0JA 3SJMA 5DD4A 5GPAA 1JJ8C 3LSKA 4LITA 1N75A 1LQ1A 4A69C 3A2KA 1D8JA 3E97A 3OYNA 3PL8A 5A2QZ 1E3PA 4CDGA 3WODF 5DS9A 5M5XJ 2DQRA 3VDXA 4F7ZA 1D5VA 3CUQB 2CS3A 4L5IA 1SVLA 4KN7X 2L2OA 2ZJPF 4F93B 2Y75A 2M45A 3BG5A 3SQNA 1NH3A 2AHQA 2KRFA 2Y0SN 1KU3A 2V9PA 1RR8C 1ZTRA 3NRVA 4ZDLA 5JHFA 1NK3P 3DWLE 2BVLA 4OIRF 2A5WA 2OTJI 3ZQFA 4HOBA 5F04A 2FQ3A 2K9QA 4CCOA 3CO6C 2DW4A 3ZQLA 2CWEA 2FF4A 5IP6A 2BEOA 5K1YA 3HOWJ 3QP6A 2IXSA 4GDFA 1QA6A 2IT0A 3PUFA 2N8GA 1QNTA 2IS6A 4CZCA 4EV0A 4IEJA 1K61A 2GQQA 1ITYA 5D5VB 2H6BA 2QKLB 4D7MA 2YPRA 1BW5A 1E17A 3BJOA 3KYLA 1Y39A 4L0YB 5B3SH 2QZ8A 3L1PA 2Y9ZA 4I0AA 1IRGA 2LY2A 1WFXA 2XROA 4B48A 4N4NB 1MJ9A 2F2EA 3EUHA 2QSHX 3ZMSA 3CZ6A 4Z2YA 4HA8A 3DCFA 4UB8C 1UHWA 2PX9A 1XN7A
chains in the Genus database with same CATH topology
4UY8I 3CCMI 4V19K 2E34A 3CCUI 3I56I 1FOYA 3G71I 2NXNB 2E35A 1VQ5I 3CF5F 1VQLI 3CCSI 1VQOI 3CD6I 3I55I 1HC8A 5GAHJ 2ZJRF 1ACIA 1FOXA 2ZJQF 2E36A 2QEXI 3J7ZI 2H8WA 3CCEI 1VQKI 3G6EI 3CJQB 1VQ9I 5GADJ 5GAEJ 1YHQI 3CCLI 1VQ4I 2JQ7A 1YJ9I 1YJWI 3CC4I 4IOAF 3CJSB 1VQ8I 1WIBA 3CJRB 3CC2I 5GAGJ 5DM6F 1VQ6I 1VQ7I 3CCRI 3PIPF 3CCJI 1VQPI 2K3FA 1VQMI 1VQNI 1YIJI 2ZJPF 3CMEI 3CJTB 3EGVB 3DLLF 4IO9F 1FOWA 2OTJI 3CCVI 1YITI 1S72I 2OTLI 3G4SI 2QA4I 1YJNI 1QA6A 5JVGF 4IOCF 2FOWA 5DM7F 1Y39A 3CC7I 3CCQI 3PIOF 3J7YJ 3CMAI 1MMSA 1YI2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 I;  3CCM I;  4V19 K;  2E34 A;  3CCU I;  3I56 I;  1FOY A;  3G71 I;  2NXN B;  2E35 A;  1VQ5 I;  3CF5 F;  1VQL I;  3CCS I;  1VQO I;  3CD6 I;  3I55 I;  1HC8 A;  5GAH J;  2ZJR F;  1ACI A;  1FOX A;  2ZJQ F;  2E36 A;  2QEX I;  3J7Z I;  2H8W A;  3CCE I;  1VQK I;  3G6E I;  3CJQ B;  1VQ9 I;  5GAD J;  5GAE J;  1YHQ I;  3CCL I;  1VQ4 I;  2JQ7 A;  1YJ9 I;  1YJW I;  3CC4 I;  4IOA F;  3CJS B;  1VQ8 I;  1WIB A;  3CJR B;  3CC2 I;  5GAG J;  5DM6 F;  1VQ6 I;  1VQ7 I;  3CCR I;  3PIP F;  3CCJ I;  1VQP I;  2K3F A;  1VQM I;  1VQN I;  1YIJ I;  2ZJP F;  3CME I;  3CJT B;  3EGV B;  3DLL F;  4IO9 F;  1FOW A;  2OTJ I;  3CCV I;  1YIT I;  1S72 I;  2OTL I;  3G4S I;  2QA4 I;  1YJN I;  1QA6 A;  5JVG F;  4IOC F;  2FOW A;  5DM7 F;  1Y39 A;  3CC7 I;  3CCQ I;  3PIO F;  3J7Y J;  3CMA I;  1MMS A;  1YI2 I; 
#chains in the Genus database with same CATH topology
 3RZD J;  1YX3 A;  1HLV A;  4PJL A;  1EJ9 A;  3CCU I;  3W2V A;  3BR6 A;  4CCN A;  3KLN A;  4EM0 B;  1V54 H;  2MH2 A;  1NHA A;  1FIP A;  5DD8 A;  3W6J B;  1W36 C;  5L3D A;  4HX4 A;  1RET A;  3HB9 A;  3I53 A;  1GV2 A;  3PUB A;  3MKZ A;  4XLP F;  2PMZ N;  2MH9 A;  2J5P A;  3CLQ A;  2UWM A;  5L3B A;  3VB2 A;  1MBG A;  2CQQ A;  1ZYR F;  2LH9 A;  2ZFW A;  1OCP A;  4P55 A;  3OYE A;  1OFC X;  1SFE A;  3RDI A;  1CF7 A;  3PJR A;  1F1Z A;  1ORK A;  2L9R A;  5JLW A;  3TQN A;  4HF2 A;  2BVM A;  2L7M P;  4ZYA A;  1J0R A;  5ILV A;  1O3S A;  2EWN A;  4IOA F;  4HQE A;  4Q5S F;  3HG9 A;  3V7S A;  2L7Z A;  3CJR B;  5GTH C;  3RYR A;  5GAG J;  3LFK A;  3CC2 I;  5IP9 J;  4ZDO A;  1TC3 C;  3LL7 A;  5A2Q K;  1J7K A;  2OZU A;  3V7C A;  1PUF A;  3KP6 A;  2P8T A;  4M6V A;  1Z0X A;  2VN2 A;  1P92 A;  3K2A A;  4AC0 A;  3TDU C;  3FF5 A;  2QLZ A;  3GEZ A;  3L2R A;  3BG6 A;  1VQP I;  1XD7 A;  2G7H A;  2L4A A;  1EF4 A;  4YFX F;  5J8F A;  5HDG A;  1FIA A;  1FTT A;  1Z77 A;  1IUY A;  1W0U A;  4BAY A;  1R23 A;  4QWQ A;  3GTK J;  2F5V A;  3WGH A;  3JRG A;  1UG0 A;  1Y8R B;  2PEX A;  4RDU A;  3ZR8 X;  1FOW A;  3LQQ A;  1LE8 A;  2D2W A;  2GA1 A;  2GA2 A;  2WAD A;  3TO6 A;  3IWZ A;  2IA0 A;  4I7H A;  2KZV A;  4ENJ A;  3FHZ A;  2Z33 A;  2E5N A;  2Y2Z A;  1IXS B;  2OAZ A;  3FXQ A;  4C3I J;  5E17 F;  3GTJ J;  4O6J A;  1PP8 F;  5DEQ A;  2NVT J;  3K1M A;  3Q0V A;  3ASO H;  4RB2 C;  2X48 A;  3L2Q A;  1K78 B;  2YS9 A;  2ZXJ A;  5KNL A;  4U87 A;  1BM9 A;  4N4O B;  2HDC A;  4A5M A;  4GYI A;  2M8E A;  4GFB A;  3H9G A;  3CJN A;  2A05 A;  1NTC A;  2DLL A;  2M1B A;  3BCB A;  4A3B J;  1A5J A;  3F9K A;  4PDK A;  3OYD A;  2R5Z A;  3DKW A;  4HLX A;  3MD2 A;  1O57 A;  2M3A A;  2VKD A;  4G94 A;  5EJC A;  5F64 A;  1W0T A;  1SFU A;  4E7J A;  2HNH A;  3FM3 A;  2A6H F;  5CVU A;  1XCB A;  3BQZ A;  1GV5 A;  3GME A;  2GAU A;  3TP3 A;  3O8G A;  3V4G A;  3W3C A;  2XAS A;  2X51 A;  3VYT B;  1LVK A;  4KMF A;  1P4X A;  5GTI C;  1VQL I;  5EF6 A;  3K4C A;  2A3S A;  1A04 A;  1FBQ A;  1VQO I;  1GDT A;  1LFU P;  2JA2 A;  4W97 A;  3L09 A;  3S3N A;  3BJA A;  2HXI A;  2AS5 F;  2ADU A;  1XTA A;  3G3Z A;  1SFK A;  3ML6 A;  1OLT A;  1DPU A;  4E4H A;  4PCQ A;  2XAJ A;  4M3D A;  1WI3 A;  1I50 J;  1D0Z A;  3P7N A;  5TIS C;  4IZZ A;  4M3G A;  5GAD J;  1E3H A;  1TLH B;  2O0Y A;  2WAQ N;  1OCR H;  2JUG A;  4KT6 A;  2O3F A;  3ERM A;  1QHG A;  1ON1 A;  1AWC A;  4L9J A;  3TL4 X;  2E7W A;  4QIW N;  1IO2 A;  3DBL B;  3IKV A;  4H4K C;  3M1C A;  3TOA A;  3L9F A;  3ONQ A;  5DDG A;  3F72 A;  3PO2 J;  2R7O A;  3FBI B;  1PUF B;  3GTM J;  1VQ7 I;  2FXA A;  4BKX A;  4AM3 A;  1U9N A;  1A31 A;  2W48 A;  2M9H A;  3VYS B;  3MKY B;  4E7S A;  3IH2 A;  5EG0 B;  2DA3 A;  5HS7 A;  1I3Q J;  5J4V A;  4D9J A;  3KP7 A;  3SDB A;  1MMD A;  4CO8 A;  3BDD A;  1FMV A;  2E1M C;  3FDY A;  1JI8 A;  2AQE A;  3E6B A;  4F92 B;  3CME I;  4YIR X;  2XV4 S;  2QGU A;  2LG4 A;  3FKI J;  3OYL A;  1BR4 A;  1FT9 A;  2Y31 A;  2VPL A;  3TP0 A;  4ZTF A;  4BQA A;  3H5R A;  4C2M J;  1QRY A;  2FML A;  3WE3 A;  1XSD A;  2GIV A;  1TNT A;  2KPM A;  4G8X A;  2O8K A;  2QBY B;  1SFX A;  5FKK A;  2K40 A;  1KYZ A;  3OYK A;  2COM A;  2H09 A;  4UB6 C;  3NWS A;  1P7J A;  3RI4 A;  2HVS A;  2YX4 A;  1WJD A;  2NRA C;  2IGM A;  2M87 A;  3H9Q A;  3DFG A;  3FMS A;  4LK1 F;  4CUG A;  4FET A;  2Y48 A;  5HNF A;  2PN6 A;  3C3W A;  5B1A H;  3BCA A;  2BW3 B;  5D8K B;  2KLO A;  4I01 A;  1HW1 A;  4G9Y A;  2KIU A;  1HBX G;  1E3O C;  3W2W A;  3CCY A;  4PGG A;  2M5W A;  4KFC A;  4C30 A;  3GUD A;  1DGR M;  2O5R A;  2V7F A;  1X19 A;  4IF4 A;  2W84 A;  1T2K A;  1SFO J;  1PP7 U;  3GBG A;  1ZQ3 P;  1WRJ A;  3CMA I;  4IX7 A;  2CG4 A;  4NHJ A;  2OUM A;  1WJC A;  2QUF A;  4NQW A;  1PYV A;  3FK6 A;  3GFL A;  4DYQ A;  2ACJ A;  3EQL F;  2VUM J;  3BTL A;  4M71 A;  2DJI A;  3SYT A;  3F22 A;  1TWA J;  4ENM A;  1VFC A;  4LB6 B;  5D6E A;  2MA3 A;  3F6V A;  4CYC B;  2HKO A;  3NEU A;  3H3U A;  4KIG A;  4FX4 A;  4AVZ A;  3WGG A;  3HKZ N;  1I27 A;  1QU3 A;  4UNO A;  2UV1 A;  2EQR A;  1MBK A;  4AVP A;  2LR8 A;  1V5E A;  4EJO A;  5DCF A;  2P5K A;  3KEY A;  1LKX A;  1SMY F;  3SZT A;  2W00 A;  3ZOB A;  1X3W B;  1XB4 A;  1IRF A;  2XGX A;  3I54 A;  3M4O J;  1K79 A;  3H3Z A;  3X2Q H;  4FQG A;  4EJW A;  1S9H A;  2QQA A;  1I1S A;  1V3F A;  2DMN A;  1QZE A;  4RLQ A;  2X0L A;  1HKQ A;  3K4L A;  1XGM A;  4M3F A;  1HOM A;  2KIF A;  3GZN B;  4RGU A;  5IYB J;  4ZJZ A;  1KQ0 A;  2VI6 A;  1JHF A;  1YTY A;  2I5U A;  1JKO C;  2FJ1 A;  3A1Y A;  1X1D A;  3B02 A;  5FLV A;  4XKB A;  3ZCO A;  2Q2E A;  3IH3 A;  2MD5 A;  2V1N A;  2OU2 A;  3K4M A;  4IJA A;  2MD0 A;  4Y15 A;  2ICW G;  2EIK H;  2L02 A;  3ZXS A;  2E2I J;  3IHU A;  1QPM A;  4Y4R A;  3T8T A;  4A3E J;  2WV1 A;  5LGT A;  5E20 A;  2JRT A;  3CJT B;  4GCV A;  5EEH A;  5ED4 A;  4MO7 A;  3S15 J;  2EV6 A;  2PMU A;  4HNT A;  3J7A Y;  3I9V 2;  4BJ6 C;  2P6T A;  4EJV A;  1QBJ A;  1KZH A;  3IRR A;  2DPD A;  3GW2 A;  4HDU A;  2RQP A;  2TRT A;  3LMM A;  2CW0 F;  3G1O A;  1HXD A;  2ZME A;  1ZH5 A;  1MD0 A;  2DMQ A;  4A3I J;  3CQZ J;  1D1C A;  2EZK A;  5C4J J;  5CVV A;  3PNY A;  1IN5 A;  2DPU A;  3U9G A;  4LIV A;  3S17 J;  2ME0 A;  1AHD P;  2MLK A;  3WTY C;  2ECC A;  3E5X A;  1Z6T A;  2DN0 A;  3KX2 A;  1YW9 A;  3WG9 A;  1MIJ A;  1F36 A;  2Y30 A;  2QCO A;  2V1D A;  2RGV A;  2M2E A;  2QF7 A;  4FIS A;  4BL0 B;  1IC8 A;  2JA8 J;  1FSE A;  3PIO F;  1ZG5 A;  2W1O A;  1FC3 A;  2XKP A;  3OR1 C;  1X1A A;  2V6C A;  1MMS A;  2HOE A;  4PJ0 C;  3KP4 A;  2WAF A;  4JOM A;  3RKQ A;  2XF5 A;  1AOY A;  3RQI A;  4E7H A;  5E3M A;  2KT0 A;  1ZGW A;  2ZSH B;  4DZJ A;  1F5T A;  4MGR A;  3HOT A;  1I3A A;  1X4P A;  1OCZ H;  5F0F A;  2K5C A;  3K4K A;  5H2F C;  5ICC A;  3DV8 A;  2AXT C;  1LFP A;  2E19 A;  3M07 A;  2KDO A;  1F4K A;  5GAH J;  2EH3 A;  3L7W A;  1JKR C;  1R6R A;  2XB5 A;  2EFN A;  3ISP A;  1MW7 A;  2YU3 A;  3ELK A;  1H9G A;  4A3F J;  5L3F A;  3KEQ A;  1IRZ A;  1J9I A;  4A0Z A;  2PJR A;  1IN6 A;  3C2B A;  1YS6 A;  4K2E A;  5IOY A;  1W7P A;  2P7V B;  1G3S A;  1MGT A;  2F4M B;  3K70 C;  4AWX B;  5FLM J;  2VL8 A;  2DMP A;  3DTI A;  1U6G A;  2BHY A;  3HGG A;  3V42 A;  2COB A;  3GVA A;  4IRH A;  4IQJ A;  2GBY A;  4BY7 J;  2DYS H;  3CDH A;  5DM6 F;  2XGE A;  2AO9 A;  3F8F A;  1HF0 A;  3BR3 A;  3I4M J;  2XAQ A;  4LD5 A;  3RSN A;  1MH3 A;  2P5L C;  3AG2 H;  1YIJ I;  3LSJ A;  3NQO A;  3JRA A;  2K7L A;  4M3B A;  3JTH A;  1YQA A;  5BNG A;  4F3Q A;  4CYD A;  2DOF A;  4BS9 A;  2ZXH A;  3NWT A;  4A3G J;  4Q47 A;  3DU5 A;  4D7N A;  2GXB A;  4KA4 A;  2Q8K A;  4ZYD A;  1U8B A;  1USS A;  3C18 A;  3A0H C;  1BIA A;  3P9K A;  3ZQ7 A;  4BE1 A;  1JE8 A;  1UAA A;  1Y8Q B;  4EEF G;  4JX5 A;  4L5J A;  3R0J A;  4R8H A;  1MDM A;  2DFE A;  4IHY A;  3U21 A;  3H5A A;  4BXU A;  1IN4 A;  4JK1 X;  3J81 Z;  2CW8 A;  1XPX A;  2M0M A;  2F4I A;  3ROU A;  3I59 A;  2NVX J;  5E18 F;  2FOW A;  3ASN H;  3F8B A;  3FK7 A;  1KU9 A;  1VF9 A;  3EUA A;  2A61 A;  2FA5 A;  2O7O A;  3HOY J;  1MJA A;  1X58 A;  5F27 A;  2HZT A;  1RUO A;  1EH8 A;  1U8R A;  3H3V K;  3AKZ A;  5HLG A;  4RGR A;  4XKC A;  5FO5 A;  5C4X J;  2FNA A;  2CV1 A;  1O3R A;  1IZ1 A;  1MH4 A;  4IHX A;  1XS9 A;  2JVH A;  2PG4 A;  1ZRC A;  3ZQQ A;  4EGY A;  1R9T J;  1ZG3 A;  3I64 A;  4II3 A;  4KIB A;  4HQM A;  2YX7 A;  1R5I D;  2DYR H;  1JKQ C;  2R3S A;  1HW5 A;  2KQR A;  2E1N A;  3RZO J;  1A6Q A;  2LLK A;  3BG7 A;  2WTE A;  1YFH A;  1JUM A;  4LGW A;  2MC3 A;  1TQI A;  5K7Z A;  3IUO A;  1KQ8 A;  1WCM J;  3HL2 A;  2WB1 A;  4RLF A;  2E7X A;  2RVC A;  5EEA A;  5HVQ C;  1WJA A;  2V6E A;  3FXM A;  3A02 A;  3AAF A;  1W7P B;  2L5Q A;  2XB0 X;  3HUG B;  4RGS A;  3OMY A;  2JSP A;  4GYG A;  4I02 A;  1Z9C A;  2O9L A;  1YJW I;  2NOJ B;  3FXU A;  2VJ5 A;  4DIQ A;  4BY1 J;  5GPC A;  1R22 A;  3E1S A;  4M9S A;  3OYH A;  2H1K A;  2IP2 A;  2L9V A;  2FOK A;  4FE4 A;  4HX7 A;  4F55 A;  1N77 A;  2CQK A;  2DOE A;  1TBX A;  2D1H A;  3SEQ A;  2K86 A;  4P1W A;  1U78 A;  3DBR B;  4C2T A;  3RKX A;  5F0H A;  3F6O A;  2FD5 A;  4Q48 A;  3T8R A;  1YOV B;  2KIS A;  2W82 A;  2JSC A;  3FMQ A;  2XAF A;  2XPW A;  5KCM A;  4HF0 A;  3DTK A;  1OYW A;  3OYG A;  1AU7 A;  2M8G X;  2YSR A;  2YUS A;  2XPU A;  4XID A;  1ZR4 A;  1HSJ A;  1XG1 A;  2X4H A;  1FY7 A;  3JRD A;  2QQ8 A;  2VT3 A;  4I09 A;  1B72 B;  5AIQ A;  1BL0 A;  1FBS A;  3EGV B;  2M7B A;  2K02 A;  1BJA A;  2OZ6 A;  1TP4 A;  5F1J A;  5BPI A;  4L5E A;  2DA1 A;  4PJJ A;  4MHG A;  2XSD C;  2H27 A;  3JAM Z;  4ESB A;  2F5E A;  3EPZ A;  5K5Q A;  5DYM A;  3ZQH A;  3S14 J;  2ZNZ A;  1TW2 A;  2EFO A;  3EDP A;  4HF1 A;  1MDM B;  3Q9V A;  5DCM A;  4WXC A;  2HVR A;  3BWG A;  3KP2 A;  2E1M B;  3HBL A;  4UUS B;  3J81 K;  2KRC A;  1MZB A;  3ZMD A;  2K4B A;  2V1U A;  1HST A;  3D5R C;  2XDV A;  2NYX A;  3TW7 A;  5HLH A;  4AID A;  5DM7 F;  4BAC A;  3PM1 A;  1S6L A;  3DBH B;  2VXD A;  1DUX C;  1WH5 A;  3RQ4 A;  1IF1 A;  1LUJ B;  2E71 A;  3E0J B;  4Y52 J;  3L00 A;  2D1V A;  4E7I A;  1RIO H;  3E6C C;  3HJE A;  3B73 A;  2DTZ A;  2UZK A;  1G3W A;  4P9F A;  1AKH B;  2X6O A;  4DBR A;  2IGK A;  1GLN A;  2E34 A;  3S2H J;  2EIL H;  2NS8 A;  4U88 A;  4ZYH A;  1EH7 A;  5M3M J;  1WJ5 A;  2ZO4 A;  1IW7 F;  2F5F A;  3GTQ J;  1OYY A;  1MND A;  2LVS A;  4RB3 C;  1DP7 P;  1FMW A;  3KFW X;  1H8A C;  4LLG F;  2IS2 A;  3RKY A;  5CKT A;  3OYM A;  9ANT A;  3KE2 A;  4ZYG A;  2LF8 A;  2ZJQ F;  5EGO A;  2IPQ X;  2G9W A;  2RC4 A;  5LRS A;  4DOZ A;  1MKM A;  3CCE I;  1J59 A;  1I6X A;  1I6H J;  3PQJ A;  2UXX A;  3KLO A;  1W5S A;  1HW2 A;  5H6Q A;  2P0W A;  1TWG J;  2NVQ J;  3C7J A;  4XR6 A;  4UUV A;  2CO5 A;  3ZGK A;  1ZG1 A;  5FKO A;  2DOD A;  5L3E A;  2VJI A;  2DTR A;  4MFE A;  3T5X A;  1Y1W J;  2K85 A;  3T1B A;  3R60 A;  2EFW A;  1SD7 A;  1BN5 A;  1Z91 A;  4N9H A;  3QU3 A;  5HOO A;  1UZC A;  2CJJ A;  3PIP F;  3CCJ I;  5KK1 A;  1K7A A;  3F23 A;  5TRD A;  4I2O A;  3E5U A;  2ESH A;  4GGG A;  2F5C A;  3M7G A;  4PSX A;  2P4W A;  3UR3 C;  2OV7 A;  3S1R J;  2RN7 A;  2JA7 J;  4ESJ A;  3MQ0 A;  3JSP A;  3LAJ A;  3L2W A;  1OIS A;  2HR3 A;  3HC7 A;  1W1W E;  5E79 C;  3DEU A;  3EUK L;  3MZ8 A;  1ETY A;  4PUS A;  4BQQ A;  2BOL A;  4V2F A;  5E1X A;  1V4R A;  2HTS A;  2OPT A;  1G3Y A;  4GRI A;  1MNM C;  1LEB A;  3BTJ A;  2V4J C;  2DCE A;  3IH4 A;  3PFY A;  4PZJ A;  3N4M A;  3BZK A;  2BY3 A;  3HPH A;  2ISZ A;  2ELK A;  2F5D A;  1ZK8 A;  5CLS A;  3M8E A;  4KJZ A;  4KN4 X;  2DK8 A;  2DI3 A;  4EAT A;  1RKT A;  2YU9 J;  2BXY A;  1A6I A;  2LTP A;  3F0C A;  4QPO A;  3V8L A;  4Y13 A;  2FNP A;  1T0F A;  1YLF A;  4JQF A;  3WU1 B;  4L9T A;  4NBQ A;  2JA6 J;  3WTW C;  4CH7 A;  2E2H J;  3SHF A;  1YE9 A;  4C2U A;  5IT9 Z;  3DPL C;  1NK2 P;  1YO5 C;  2R7S A;  1DU6 A;  2V1X A;  3HRS A;  4XL9 A;  4U7B A;  2DA5 A;  3QOE A;  1BI1 A;  4HLY A;  4BEH A;  4XK4 A;  1TT5 B;  2ISY A;  1ETV A;  1T38 A;  1VTN C;  2XGD A;  5JHU A;  3BPX A;  2W57 A;  1B6A A;  3ESW B;  2IRF G;  4MIM A;  4XLH A;  2P81 A;  1YI2 I;  2CUF A;  4XLE A;  4D5C A;  4NC8 A;  3MVP A;  3F8M A;  3TGN A;  2VKV A;  5K7F A;  1R7J A;  2XC7 A;  1WPK A;  2MFZ A;  5ERI A;  2P5V A;  3GLX A;  3N97 A;  4X6A J;  4HAM A;  3FX3 A;  2NAZ A;  3TO7 A;  1VQ5 I;  3QQA A;  1MBE A;  3WTV C;  1U5T A;  4G12 A;  2R7D A;  3MZY A;  2QSG X;  5J40 A;  2TDX A;  3BG9 A;  1G8X A;  1FYL A;  5IT3 A;  3WTX C;  3LWF A;  1TQP A;  2JPB A;  3BY6 A;  2DDB A;  3Q3S A;  1XX5 A;  4B1R A;  4J19 A;  1QPI A;  3WU0 A;  2E36 A;  2B7E A;  2H8W A;  2HI3 A;  3VFZ A;  1H88 C;  4UUT A;  5H20 A;  1JJ6 C;  2X6W A;  1JKP C;  4CCK A;  3CCL I;  2OF7 A;  3FIS A;  4EVI A;  1R4M B;  1TZL A;  1XGO A;  1S8N A;  1YJ9 I;  2WA0 A;  5TGT A;  1IV6 A;  3F8N A;  4E6K G;  4B44 A;  3I0T A;  5EYR A;  3QWL A;  3CDI A;  4NUB A;  4O5V A;  1IXR C;  2WBM A;  2BXZ A;  2CU7 A;  4MEX F;  4LLL A;  3BZ6 A;  2GXA A;  3ZQI A;  1QVT A;  2Y69 H;  5M5Y J;  2CFO A;  1BI3 A;  5LBQ A;  2NS0 A;  3K1N A;  3KYC B;  2LKX A;  3HKZ A;  1PUE E;  1D3Y A;  1WHU A;  1EA3 A;  1CF7 B;  4G6D A;  2M7A A;  1XMA A;  1DP3 A;  3JRI A;  4LB5 A;  4M9Z A;  2DJN A;  2QVO A;  1Z7L A;  2MG4 A;  2DAO A;  1X4O A;  1XCV A;  1FYM A;  3OYJ A;  2UUZ A;  2HDD A;  2LF7 A;  3KEO A;  2BZT A;  2HFH A;  5KAI C;  5BMZ A;  4W1U A;  2DXI A;  1FBU A;  2LY9 A;  2R7F A;  2ZSI B;  1BOA A;  2VBX A;  1YJN I;  1R5H A;  5FGM A;  2J5O A;  1OCC H;  4P96 A;  1G2H A;  3H9J A;  1LVA A;  1R49 A;  2Z5U A;  3FM5 A;  5CPR B;  3HSR A;  2HZD A;  2OQG A;  4E70 A;  1LE8 B;  1D1B A;  2R7R A;  5IYD J;  3PO3 J;  3LSI A;  4YII A;  2FBI A;  1GHC A;  4G7Z F;  4BDY A;  1K6Y A;  3PNV A;  2LP0 A;  1Z1D A;  3ABT A;  1JGS A;  3E6M A;  1MBF A;  4LG3 A;  3CMM A;  5EEG A;  2HKX A;  4RM2 A;  2L0K A;  1R1T A;  2DA2 A;  4XRS A;  1P2F A;  4LJZ F;  2E35 A;  1OJL A;  5HDK A;  1A36 A;  5HLI A;  3CF5 F;  4OAY A;  2JWT A;  1W4M A;  2DMU A;  1KU2 A;  2R5Z B;  1TQM A;  4A93 J;  3HHG A;  2R7Z J;  4Y3O A;  4CCJ A;  5ICG A;  4AIK A;  1IXC A;  1Z21 A;  3JRF A;  1ZKG A;  2L9S A;  4QSH A;  3C1D A;  4MQV A;  1VQK I;  2KKO A;  1MSE C;  4HV6 A;  3CJQ B;  4KYW A;  1WJB A;  5LRR A;  4X0G A;  3KZZ A;  3QYB A;  1YIO A;  2EZH A;  2FEZ A;  3K6G A;  2CSO A;  5EZH A;  3J7A O;  1G59 A;  4AYB A;  1OR7 C;  5ILU A;  3Q0W A;  1VZ0 A;  3LSM A;  3S93 A;  4C3H J;  4MTD A;  1FP1 D;  1X3U A;  1SAX A;  3JW4 A;  1DQU A;  2PJP A;  2R4G A;  4WWC A;  3RPU D;  1W36 D;  1TW3 A;  2CUE A;  2LK2 A;  1VI0 A;  3ZMU A;  1R5G A;  4A12 A;  4G7H F;  2KP6 A;  4XIC A;  2ID6 A;  3DKY A;  1JUP A;  3HM5 A;  3U2R A;  4WXD A;  1RI7 A;  1FNN A;  2WC2 A;  2X6X A;  2V9K A;  2QEN A;  1F9N A;  2R7Q A;  1RRJ A;  2KIQ A;  3G2B A;  3I58 A;  1SAU A;  3U1D A;  3LA2 A;  3ABM H;  3FHN A;  4J01 A;  3KP5 A;  3EYI A;  4XRM A;  3DTE A;  2BY2 A;  4ZH4 F;  5AIP A;  2LOO A;  3OIQ A;  1LEA A;  2AQF A;  3HTS B;  2E2J J;  5JLX A;  4XNF A;  3SFI A;  2VON A;  3S2W A;  2O03 A;  2UXN A;  3ECH A;  5ICF A;  1R36 A;  4BDZ A;  1YIT I;  1IG7 A;  2BY1 A;  2L4M A;  2ZB9 A;  4MLO A;  1DGW Y;  1JHH A;  1TT0 A;  1Z3Y A;  2HEO A;  2IJL A;  3OSG A;  1D0X A;  4KIC A;  3BQY A;  2VQH A;  4HNV A;  3GO5 A;  1S3J A;  2ZCW A;  2CV0 A;  3T0Y A;  3RPU A;  5JVG F;  3DKX A;  3O8H A;  2CGP A;  4DYC A;  4EM1 A;  4HEA 2;  2EZI A;  1GVJ A;  1AA7 A;  3BPV A;  3HXL A;  5IPA A;  2FBK A;  2E1C A;  4QLC U;  2OCE A;  3WE2 A;  1PDN C;  4EM2 A;  4BH9 A;  5D5X B;  4Y7N J;  2NVU B;  3QRF F;  5FB2 A;  1UEL B;  4FHT A;  5JFR A;  2WV0 A;  1FSH A;  2R7T A;  1OMI A;  4UY8 I;  2OCC H;  1WSU A;  3R0A A;  3FZV A;  1BBY A;  2B9S A;  3JRE A;  3IV5 A;  3KCC A;  2W7N A;  1LJ9 A;  1YW8 A;  4CCL A;  3KPH A;  2EB7 A;  2LBF A;  2K9M A;  4HPQ A;  1BOB A;  3QYF A;  3HOV J;  3IAM 2;  3JRC A;  5K7H A;  2KDZ A;  1E2X A;  1FZP B;  1Z67 A;  2DBB A;  3S3O A;  2A6T A;  3EUH C;  5LGU A;  2JT1 A;  4H0E A;  5IP7 J;  3F8C A;  4HRI A;  1EKE A;  2QSF X;  3J7Z I;  3LQR A;  3OSF A;  4NQW B;  4A3L J;  3QOP A;  2XVC A;  3C2G A;  3HOZ J;  1Y6I A;  1SEU A;  1K4T A;  1OCO H;  5LHG A;  1SC7 A;  3I4P A;  5HNH A;  2K3P A;  1GT0 C;  2EV0 A;  4S0H B;  2IBD A;  2VPR A;  5JR3 A;  5IYC J;  2HPI A;  1ZGJ A;  4HX8 A;  1R58 A;  2OJE D;  3JRB A;  3K4B A;  4FT8 A;  4XN0 A;  2XAG A;  4BBR J;  3AG3 H;  5LD2 C;  1BI2 A;  5J47 A;  1MNE A;  2LNB A;  2VQL A;  3HSF A;  3O3K A;  3QAH A;  4BHC A;  4CSW A;  3MCZ A;  2JMW A;  5D4S A;  4G7O F;  2FSW A;  2RRE A;  3SZG A;  3FXK A;  3HGY A;  3HRM A;  1T56 A;  4OIN F;  1YRN A;  1ZLK A;  4FAS D;  2OA4 A;  2CQN A;  5HOD A;  1LFB A;  5BPD A;  1SVO A;  2HOA A;  2A68 F;  2BYV E;  2JPC A;  3GLL A;  1Y0U A;  1PJR A;  1R1V A;  1RKW A;  1STZ A;  4BHP A;  2DK5 A;  5E8G A;  5D5U B;  4BGD A;  2O61 A;  3IC7 A;  1ZRD A;  1HQC A;  2VBZ A;  3REO A;  2CYY A;  2HYG D;  3K69 A;  5EDN A;  1UST A;  2OTL I;  5CVI A;  1RES A;  2Q2E B;  2ID3 A;  2O8X A;  1HDP A;  1IUF A;  1IJW C;  2Z9O A;  2FX0 A;  4F52 A;  1JTY A;  4XM3 A;  3KP3 A;  5J1R A;  1UHM A;  3S32 A;  4M9X A;  1XC5 A;  2PMH A;  3IP4 B;  3QPH A;  3GWZ A;  4IRG A;  1M1E B;  2VKH A;  2HPM A;  2GLO A;  1QHH D;  2ZME B;  2E1O A;  1FPQ A;  1KGS A;  3UNG C;  3M1E A;  5HLT A;  3GTG J;  1T98 A;  1A35 A;  5L3G A;  1APL C;  1MJB A;  2R92 J;  2EV5 A;  4YEJ A;  1SVM A;  4HW0 A;  1IDZ A;  1U5T C;  2OD5 A;  4BHB A;  2HQA A;  1S7O A;  4MNU A;  4IQ4 A;  3WTT C;  2JZY A;  5LGN A;  2RNJ A;  2VJ4 A;  1UFM A;  3QPL A;  5FFZ A;  1WJE A;  2QKM B;  2ZJR F;  4IXA A;  2BE5 F;  2QEX I;  1BIB A;  2Y0S A;  2DA6 A;  3LA7 A;  2DO7 A;  4PK4 A;  5LLQ A;  3IL2 A;  1YHQ I;  2JVG A;  2FRH A;  3CUQ A;  2JA5 J;  3F3X A;  1O7L A;  2L01 A;  1O3Q A;  5FKM A;  4HNU A;  3CTA A;  3CP8 A;  1S29 A;  4B3A A;  2QQB A;  2Z1D A;  2X1C A;  2Z16 A;  3D1N I;  4LIU A;  3CJS B;  1T8I A;  1QVU A;  1QZZ A;  3LAP A;  4ENN A;  5BQT A;  3QPT A;  4IPA A;  3RCO A;  4XRS G;  3CCR I;  2VC1 A;  2JN6 A;  4DGW B;  1EH6 A;  3CES A;  2MSY A;  5B5E C;  1OPC A;  5J4Y A;  1IDY A;  3FKJ A;  2PJR B;  4RB1 A;  2BHZ A;  1YRN B;  2R7X A;  1BI0 A;  5HS8 A;  2L7F P;  2R93 J;  2DFF A;  5CYV A;  2GOX B;  4OIO F;  1LDK B;  4A3K J;  4CGZ A;  3FWE A;  3I3L A;  1TTY A;  1YYV A;  1ZRF A;  4ITV A;  3DLL F;  3LSG A;  3KIO A;  2O6G E;  1KON A;  4N0B A;  1O4X A;  3CDL A;  3HDD A;  1D1A A;  1W5T A;  2HQN A;  3HHH A;  2DT7 B;  3JCU C;  4Z6Y A;  3KZI C;  4HBL A;  4BUP A;  4RMN A;  2RKH A;  1Z7U A;  4HSR A;  4B3X A;  3WTZ A;  4BYY A;  1BR1 A;  3HOS A;  2VBW A;  4PFO A;  1LB2 A;  2HU9 A;  2VC0 A;  4XBF A;  3ZQG A;  2PMZ A;  2IS4 A;  3H92 A;  2JRM A;  1WQ2 A;  4AIH A;  3ZP5 A;  2Q1Z B;  3R4K A;  3TOB A;  1MBH A;  2M34 A;  2B63 J;  1GUU A;  2QQ9 A;  3J80 Z;  4WX9 A;  1WGX A;  1X3Z B;  1YS7 A;  2LMD A;  1GXQ A;  3BR0 A;  3VEP A;  4A3M J;  3LA3 A;  2A6E F;  2CUJ A;  4B47 A;  2K4J A;  2HYF A;  2YR2 A;  4D5F A;  1P6R A;  5C44 J;  3K1P A;  3G71 I;  1P4A A;  4MTE A;  1X2N A;  5FRN A;  3I59 B;  2LFB A;  3ECO A;  2G7U A;  1UG2 A;  3ZQC A;  2HVQ A;  1OCT C;  3DEW A;  4ON0 A;  3BJ6 A;  2LSO A;  1TWH J;  4PJN A;  1C0W A;  3P9I A;  2ECB A;  3A4C A;  3MEX A;  4PFP A;  4R79 A;  2EPF A;  1NG7 A;  4QPQ A;  2ZXW H;  2H94 A;  2ZC2 A;  4BQO A;  1V5F A;  3JTG A;  1FWZ A;  4YFN F;  2KZG A;  3NAU A;  4IL6 C;  1ULY A;  3QU6 A;  3S3M A;  1UMQ A;  3GCM A;  2QM3 A;  4M6Y A;  3TED A;  5M3F J;  5IY5 H;  2EJR A;  2EA4 A;  1RZ4 A;  4FE7 A;  3CC4 I;  3OIO A;  3QYE A;  5DUI A;  1ETK A;  3H0D A;  4ENK A;  3G1M A;  2HWV A;  2W24 A;  1VQ8 I;  5ILS A;  3ZMT A;  3WU2 C;  2STT A;  5TJJ A;  3KYD B;  2Z2S B;  4JP0 A;  5E3L A;  2VIX A;  1E0E A;  2DOA A;  2VAS A;  2MGQ A;  4M6X A;  2GOM A;  4X1E A;  3CUO A;  4PGH A;  2EIN H;  1IRX A;  1VQN I;  3IWF A;  3NAR A;  2VKE A;  1K4S A;  1WWX A;  1K78 A;  1FJL A;  3SZP A;  5E1W A;  3OOP A;  3PNT A;  4TV7 A;  3TKY A;  4WCG A;  2WB1 N;  4ZDP A;  5DUK A;  3GX4 X;  3W6V A;  4E7Z A;  2C6Y A;  4RS8 A;  2AXL A;  2HQ5 A;  1LDJ A;  5AON A;  4C3J J;  3VSL A;  2HXO A;  4OOI A;  3K70 D;  2HOT A;  2LRD A;  4KUM A;  2P6S A;  3CMY A;  5E3O A;  3CCV I;  2VLA A;  1REP C;  1U3E M;  4OMY A;  3D5S C;  4QTR A;  3OIP A;  1J09 A;  1ODD A;  5FD6 A;  3SDG A;  1FLI A;  1J5Y A;  1NG6 A;  5DTD A;  3PQK A;  4OIP F;  4LMY A;  4XSZ F;  4CA0 A;  3M8F A;  3GTO J;  4RB0 A;  3J80 K;  4NB5 A;  3VPR A;  1FEX A;  4I0B A;  1UHS A;  1G6N A;  3M9A A;  2VJJ A;  5BOX A;  3CCQ I;  1P9Q C;  4M74 A;  5M5W J;  2DMT A;  1G3T A;  2WAQ A;  1QGP A;  4XSX F;  4ANJ A;  2CQX A;  3JAM K;  3WGI A;  4Q4Z F;  4A0X A;  3J7Y J;  4RAG A;  3WHB A;  2LD5 A;  2ZME C;  3BOQ A;  5DCM B;  1WVR A;  3AG4 H;  3RTR A;  2XKO A;  2QYO A;  4LOC A;  4ZTJ A;  4Y17 A;  2WY7 Q;  3MKW B;  1WI9 A;  1XDS A;  3OS0 A;  4EMS A;  4XOT A;  1BR2 A;  3CCS I;  3E6D A;  3SFZ A;  2IGO A;  4XLN F;  3I55 I;  4D0P A;  1P4W A;  1YG2 A;  4RGX A;  1Y1V J;  4MFD A;  1XGN A;  3A0B C;  1BA5 A;  1YX5 A;  1POG A;  1QQI A;  5J6X A;  3RKW A;  3TBI A;  3HOU J;  4YRV A;  3OYI A;  2CRG A;  2HDW A;  3HZJ A;  4HDV A;  2IS1 A;  4B09 A;  1B8I A;  5EG0 A;  4G6Q A;  2IAI A;  2L9N A;  3E3V A;  4U0W A;  1FOK A;  4YIF A;  3IAS 2;  4P5O A;  1R1U A;  5JI6 A;  1QZY A;  2LRE A;  1XDU A;  5ICE A;  3HOX J;  3TW6 A;  3W6K B;  3GTL J;  3LSP A;  3BG3 A;  2DT5 A;  3OYF A;  1N25 A;  1ZEL A;  3DQV C;  3H36 A;  4KIF A;  2E5Z A;  3DF8 A;  1DDN A;  4EJU A;  2RQQ A;  3S2D J;  5EGO B;  4XLA A;  2QBY A;  1R4N B;  1XSX A;  4BQN A;  2NNN A;  5F08 A;  1RPW A;  4NNJ A;  2MC4 A;  3QP5 A;  2X1E A;  2XRN A;  1UJ8 A;  3GFI A;  2WY8 Q;  2XF7 A;  4OIQ F;  2K3F A;  3DU6 A;  1FX7 A;  6PAX A;  1F43 A;  1GVD A;  4YFK F;  2STW A;  1QO0 D;  2CMP A;  2ELH A;  4M73 A;  2DA7 A;  2KHM A;  2BW3 A;  3DLA A;  1ONV A;  2XPV A;  4PJM A;  3I71 A;  3SEZ A;  3OWT A;  4R1H A;  3BTC A;  3SXY A;  3IRQ A;  1T08 B;  4RAZ A;  5KHD A;  3P5J A;  1I1G A;  3P9C A;  5IOZ A;  4DW6 A;  1D8K A;  1X1C A;  3OV8 A;  1D0Y A;  1FYK A;  3MWM A;  2EIJ H;  3HSE A;  2W25 A;  2IEK A;  1HDD C;  3BC8 A;  3G4S I;  5FLX Z;  4I99 C;  2QA4 I;  3ABK H;  5CVJ A;  2IVM A;  3R6S A;  1TL8 A;  3S1N J;  2ME6 A;  4A0Y A;  2XSJ C;  1T6S A;  3WTU C;  4N9I A;  2ZBK A;  1WKM A;  2FBH A;  2XIG A;  2OBP A;  5LEJ A;  1O7F A;  2PBI A;  3TO9 A;  2L54 A;  2PQ8 A;  4A6D A;  4CYC A;  1BJZ A;  1X2M A;  4FTH A;  1O3T A;  2D5V A;  4B8X A;  1JTX A;  4A3D J;  4FX0 A;  3OL3 A;  3RYP A;  2P7C B;  4HG2 A;  1V5G A;  4IRI A;  1HCR A;  2R7V A;  1ON2 A;  3QOD A;  2PLY A;  3HPG A;  5FD5 A;  4M3E A;  3OYA A;  4BNC A;  4V19 K;  2M30 A;  5IT9 K;  5LHH A;  2KJB A;  5K5R A;  4S04 A;  2ESN A;  4E7L A;  4HZF A;  1KQ9 A;  1H0M A;  2LC2 A;  4CCM A;  3FXO A;  2MLG A;  2TCT A;  3ZMV A;  1ENH A;  4KMU X;  3JRH A;  3AL0 B;  4BEH B;  4XOR A;  1SAN A;  1HC8 A;  4II2 A;  2G0E A;  1ETQ A;  3ZRG A;  4C9Y A;  4YG2 F;  4DYR A;  3HRT A;  1ETW A;  1BC8 C;  4ZZD A;  1L3L A;  1B8I B;  3C2H A;  4ZC3 A;  2NOG A;  2BBY A;  1HA8 A;  2DT6 A;  2VBY A;  2EK5 A;  3B6C A;  1JT6 A;  3TMO A;  1VQ4 I;  3B6A A;  4IHW A;  2R7U A;  1CGP A;  4DBQ A;  3CUQ C;  1U5T B;  2JQ7 A;  4AUX A;  4BJT A;  3WG7 H;  2XRL A;  2XAH A;  1GXP A;  1TWF J;  4ETS A;  4G6T B;  4A5N A;  1WIB A;  2HYJ A;  2M4K A;  4RAF A;  2HTJ A;  4U7D A;  2EZL A;  1Q1H A;  1ERD A;  4KT5 C;  3G1L A;  1I5Z A;  1WH7 A;  2ZXI A;  3A01 A;  2ZKZ A;  1U2W A;  2K9L A;  3CLO A;  3OOU A;  4XLC A;  3IKT A;  3OYB A;  4IHS A;  3LSH A;  5FJ8 J;  2LYC A;  2XHK A;  1VQM I;  3GF2 A;  1IAW A;  3S16 J;  4ASN A;  4KIT B;  4S05 A;  3HYI A;  3COA C;  3EYY A;  1B9M A;  1MSF C;  1LPQ A;  5LHI A;  3K7A J;  1RC9 A;  5KAF C;  2RNG A;  1HKT A;  4F91 B;  2KMU A;  4IO9 F;  2X1D A;  1LDD A;  4KIS A;  2H6C A;  3K0L A;  1UCR A;  4XN3 A;  4LG0 A;  5H6R A;  3MAJ A;  4AIJ A;  4XOP A;  2EA2 A;  3DEE A;  1I39 A;  4UXN A;  3JR9 A;  3ULQ B;  5FLX K;  1XSV A;  2LDU A;  4XKW A;  1S72 I;  2I10 A;  2PFB A;  3GFJ A;  5F6F A;  1ZN2 A;  3RPQ A;  4WXH A;  2DA4 A;  3GFM A;  3MMY B;  1N78 A;  3ABL H;  3VSK A;  3VYR B;  3LSR A;  3VWB A;  4E7K A;  1MMG A;  4A6E A;  4J00 A;  4A2U A;  4XON A;  4IOC F;  4BXX J;  1Y56 A;  5FKN A;  2ETH A;  3CF2 A;  1ETX A;  4XRF A;  1ZHF A;  3ZPL A;  3LOC A;  2XUB A;  1U9O A;  4OAZ A;  2HOS A;  2VQC A;  2E60 A;  3GZ5 A;  2VXZ A;  4FCY A;  3BR5 A;  4BE2 A;  1JT0 A;  4OWR B;  1R00 A;  4IKF A;  2F4O B;  2R5Y A;  1B1B A;  4NC6 A;  1ZAR A;  3AG1 H;  2VQG A;  3K4J A;  2X6Y A;  3HTU A;  2VE9 A;  3GTP J;  3K4N A;  1FOY A;  2NXN B;  4HV5 A;  4IHT A;  1UB9 A;  5C3E J;  2JUC A;  2Z99 A;  2M0C A;  2WWY A;  3HRU A;  2Q0O A;  4OU0 A;  5HDN A;  3OS2 A;  2KFD A;  2W85 A;  5B66 C;  1RNL A;  1XGS A;  4BE0 A;  4A3C J;  2CH0 A;  3DPT A;  5F1R A;  4I76 A;  1H89 C;  2MYS A;  1MBJ A;  1XMK A;  1HKS A;  2H1L A;  4RM3 A;  3G6E I;  1L0O C;  3ERE D;  3Q5F A;  2V26 A;  2I8D A;  4DQ2 A;  2LKS A;  5J8C A;  2QWW A;  2KL4 A;  1YW7 A;  3PFI A;  3H1C A;  4IVN A;  1SD6 A;  3BTI A;  3A03 A;  3Q0U A;  3MN2 A;  4LK0 F;  5D6F A;  2H8R A;  4CHU A;  5HS9 A;  5EZG A;  1ZR2 A;  1R71 A;  2FE3 A;  1X1P A;  2XF6 A;  2K9S A;  1W5C C;  3N05 A;  1VQ6 I;  1Z05 A;  3A01 B;  3TDZ C;  3WHC A;  2Y9Y A;  2DDA A;  3VOD A;  3KET A;  2V79 A;  1DU0 A;  4XQF A;  3H35 A;  1T39 A;  3MFK A;  2A5Y B;  4BU2 A;  1SD5 A;  2CW7 A;  2L7K A;  4I98 B;  3BRO A;  1SMT A;  5CQE A;  2PI0 A;  2R0Q C;  2NVY J;  5FRM A;  2HS5 A;  1ZAO A;  1CQT A;  2KJC A;  3ZN0 A;  3F21 A;  4ZZL A;  1W7P D;  1ZRE A;  4RA2 A;  2R7W A;  4LG0 B;  3DPU A;  1VND A;  2WAE A;  1WZ2 A;  2NNY A;  3FXJ A;  1ZLJ A;  3LNQ A;  3S1M J;  4AYB N;  1OKR A;  4EGZ A;  1MMA A;  3ZMZ A;  3HEF A;  5CVR A;  5BS6 A;  2MBF A;  3GYH X;  1S7E A;  1ETO A;  1S7A A;  3O2P E;  1KA8 A;  2A07 F;  3DXJ F;  3WTS C;  2V9V A;  3ZN1 A;  1K6O A;  5JVT A;  2DFH A;  4NC7 A;  5D8L B;  3U1K A;  4CZZ A;  2Z3Y A;  2VOD A;  3W2A A;  3BZC A;  3UKG A;  4MEY F;  4V2G A;  2BY0 A;  3LFU A;  2JTV A;  4RAY A;  4CXF A;  2KIM A;  5FFX A;  5J3L A;  1S5L C;  1KYW A;  5FRO A;  3OYC A;  2R5Y B;  4GO1 A;  5KVR A;  1Q1V A;  2L3D A;  1EV7 A;  1X1B A;  1H9T A;  2JK3 A;  1FTZ A;  4EQQ A;  1RR7 A;  1PVE A;  3I5U A;  1T0F C;  2MW8 A;  4L9N A;  3HUG A;  2IA1 A;  2K9N A;  1DPR A;  4ZYE A;  4ESF A;  4UV9 A;  2LY1 A;  2ELJ A;  3DP7 A;  3CD6 I;  3CO7 C;  3VOE A;  3BP8 A;  3AL0 C;  1BC7 C;  3JSO A;  1KU7 A;  5E8I A;  2EFP A;  1RUN A;  1ACI A;  5K5O A;  1FOX A;  4UVB A;  5CJ9 A;  3GZ6 A;  2GIZ A;  2MAB A;  5D4R A;  2CUZ A;  2X85 A;  1LNW A;  2ZFU A;  1VQ9 I;  1T33 A;  2XGC A;  3RIR A;  1B4A A;  2DFI A;  3H5N A;  5D5W B;  4WK8 F;  4WF2 A;  2OC6 A;  2OQR A;  2VB6 A;  2BGC A;  2CV2 A;  2Y0M A;  3AFH A;  2DU9 A;  1ZGA A;  2LBF B;  4L9V A;  3EET A;  3Q9S A;  3I4N J;  2IGN A;  2IA2 A;  2GZW A;  2ZNY A;  3M3Y J;  3E7L A;  3D0S A;  1B72 A;  3FXR A;  1V55 H;  5F0C A;  4AD9 A;  4GXO A;  5DV5 A;  2RDP A;  4UVC A;  4XMY A;  3BLY A;  3OR2 C;  5LFA A;  3L2U A;  1Z6R A;  2LKP A;  2EFQ A;  1TNS A;  5B1B H;  3OS1 A;  4D1Q A;  1J75 A;  2A69 F;  3BT9 A;  4MQ9 F;  4A3J J;  2W4S A;  4RBO A;  2EBI A;  3L2V A;  4L18 B;  1D5Y A;  4JBA A;  3V7R A;  4JX4 A;  4UUS A;  5CQG A;  2GXG A;  4HYE A;  2ZJ2 A;  4AU7 A;  1G4D A;  2GM4 A;  2F6C A;  1JUS A;  2CFX A;  1B59 A;  2VOO A;  4ABZ A;  3VYU B;  4BXF A;  4UHT A;  3BR2 A;  1TWC J;  4IHV A;  4B4C A;  3M8J A;  4KNY A;  2F48 A;  3ABU A;  2RAE A;  3CP2 A;  4I6Z A;  4U0Y A;  3OL4 A;  3V8J A;  4B43 A;  2IW5 A;  3BR1 A;  4CIC A;  4NDL A;  4KDP A;  3QPS A;  1AKH A;  1IN7 A;  4JX6 A;  2CQ7 A;  2VOP A;  4M72 A;  3KZY A;  2RV8 A;  1IGN A;  3FIW A;  4U0V A;  3G73 A;  1OQY A;  4DZP A;  2XAU A;  1IN8 A;  5J1U A;  4UV8 A;  3GXO A;  4O3M A;  2NS7 A;  4P9U A;  4LFU A;  5E1Z B;  3CC7 I;  3K9T A;  4BBS J;  1OYI A;  2DQL A;  3RJP A;  5L3C A;  5LEK A;  1JXS A;  3HIF A;  1WJF A;  1BW6 A;  2HGC A;  1Z3X A;  4HST A;  3FBN B;  3CCM I;  2K27 A;  1IV8 A;  1P7I A;  3K10 A;  3K2Z A;  2X9D A;  1J2X A;  4YEL A;  1Y0N A;  3S1Q J;  3PSF A;  3I56 I;  5E3N A;  3E5Q A;  2KRH A;  1OR7 A;  4PSW A;  3LST A;  2D45 A;  5J1Y A;  2FUG 2;  3OY9 A;  2VE8 A;  4LLN A;  4DJA A;  2HQR A;  5GP9 A;  1JGG A;  4UVA A;  4XLF A;  3V8K A;  2EIM H;  1T95 A;  2VT2 A;  1K83 J;  3PSI A;  1SD4 A;  3R61 A;  3L2C A;  2BV6 A;  3D5L A;  4JYK A;  5FKL A;  4L0Z B;  2FU4 A;  2B0L A;  3H0G J;  3MZH A;  1B9N A;  2FQ4 A;  2JJ7 A;  4OMZ A;  1XMX A;  3FXL A;  1FP2 A;  1MMN A;  3MKL A;  5GAE J;  4EJT A;  2GWR A;  4DNC A;  4Y33 A;  2FMY A;  3O6B B;  2M4G A;  4XKV A;  3S8P A;  3FMR A;  4BJ5 C;  1U0J A;  3SJM A;  5DD4 A;  5GPA A;  1JJ8 C;  3LSK A;  4LIT A;  1N75 A;  1LQ1 A;  4A69 C;  3A2K A;  1D8J A;  3E97 A;  3OYN A;  3PL8 A;  5A2Q Z;  1E3P A;  4CDG A;  3WOD F;  5DS9 A;  5M5X J;  2DQR A;  3VDX A;  4F7Z A;  1D5V A;  3CUQ B;  2CS3 A;  4L5I A;  1SVL A;  4KN7 X;  2L2O A;  2ZJP F;  4F93 B;  2Y75 A;  2M45 A;  3BG5 A;  3SQN A;  1NH3 A;  2AHQ A;  2KRF A;  2Y0S N;  1KU3 A;  2V9P A;  1RR8 C;  1ZTR A;  3NRV A;  4ZDL A;  5JHF A;  1NK3 P;  3DWL E;  2BVL A;  4OIR F;  2A5W A;  2OTJ I;  3ZQF A;  4HOB A;  5F04 A;  2FQ3 A;  2K9Q A;  4CCO A;  3CO6 C;  2DW4 A;  3ZQL A;  2CWE A;  2FF4 A;  5IP6 A;  2BEO A;  5K1Y A;  3HOW J;  3QP6 A;  2IXS A;  4GDF A;  1QA6 A;  2IT0 A;  3PUF A;  2N8G A;  1QNT A;  2IS6 A;  4CZC A;  4EV0 A;  4IEJ A;  1K61 A;  2GQQ A;  1ITY A;  5D5V B;  2H6B A;  2QKL B;  4D7M A;  2YPR A;  1BW5 A;  1E17 A;  3BJO A;  3KYL A;  1Y39 A;  4L0Y B;  5B3S H;  2QZ8 A;  3L1P A;  2Y9Z A;  4I0A A;  1IRG A;  2LY2 A;  1WFX A;  2XRO A;  4B48 A;  4N4N B;  1MJ9 A;  2F2E A;  3EUH A;  2QSH X;  3ZMS A;  3CZ6 A;  4Z2Y A;  4HA8 A;  3DCF A;  4UB8 C;  1UHW A;  2PX9 A;  1XN7 A; 
#chains in the Genus database with same CATH homology
 4UY8 I;  3CCM I;  4V19 K;  2E34 A;  3CCU I;  3I56 I;  1FOY A;  3G71 I;  2NXN B;  2E35 A;  1VQ5 I;  3CF5 F;  1VQL I;  3CCS I;  1VQO I;  3CD6 I;  3I55 I;  1HC8 A;  5GAH J;  2ZJR F;  1ACI A;  1FOX A;  2ZJQ F;  2E36 A;  2QEX I;  3J7Z I;  2H8W A;  3CCE I;  1VQK I;  3G6E I;  3CJQ B;  1VQ9 I;  5GAD J;  5GAE J;  1YHQ I;  3CCL I;  1VQ4 I;  2JQ7 A;  1YJ9 I;  1YJW I;  3CC4 I;  4IOA F;  3CJS B;  1VQ8 I;  1WIB A;  3CJR B;  3CC2 I;  5GAG J;  5DM6 F;  1VQ6 I;  1VQ7 I;  3CCR I;  3PIP F;  3CCJ I;  1VQP I;  2K3F A;  1VQM I;  1VQN I;  1YIJ I;  2ZJP F;  3CME I;  3CJT B;  3EGV B;  3DLL F;  4IO9 F;  1FOW A;  2OTJ I;  3CCV I;  1YIT I;  1S72 I;  2OTL I;  3G4S I;  2QA4 I;  1YJN I;  1QA6 A;  5JVG F;  4IOC F;  2FOW A;  5DM7 F;  1Y39 A;  3CC7 I;  3CCQ I;  3PIO F;  3J7Y J;  3CMA I;  1MMS A;  1YI2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...