2VN2A

Crystal structure of the n-terminal domain of dnad protein from geobacillus kaustophilus hta426
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
110
Chain Sequence
MEKKKVAEWLAQGSIAVPKLLLGHYKQLGLGEGELVLLLHMQSFFEEGVLFPTPAELAERMTVSAAECMEMVRRLLQKGMIAIEEKYTLEPLWEKLVHHLYTQAAQQGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords CHROMOSOME REPLICATION INITIATION PROTEIN
publication title Crystal Structure of the N-Terminal Domain of Geobacillus Kaustophilus Hta426 Dnad Protein.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
total genus 36
structure length 110
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vn2A00
2AS5F 2DW4A 2R7DA 1HW5A 4A2UA 3GVAA 3LA3A 2DQRA 4M6XA 3WG9A 5ICCA 3WTVC 1TW3A 1R1TA 1BI1A 1XDSA 2LDUA 3GFLA 5D4RA 1S3JA 3WE2A 1KU3A 2WWYA 5KK1A 1RZ4A 3F72A 3HSEA 3JW4A 5ICEA 4P5OA 4AIJA 1U8RA 3FXUA 3JAMK 2GIVA 4M6YA 2IRFG 2E7XA 2DK8A 1KQ0A 3DPTA 5DUIA 1FNNA 4KNYA 3ELKA 3KCCA 2YX7A 1USSA 2COMA 2VT3A 3HRMA 1EH7A 1J0RA 4RGXA 1KU7A 2KKOA 2QZ8A 4IRHA 4EGZA 3G73A 1T39A 2K4BA 3TDZC 4I01A 2C6YA 4CHUA 2PMHA 4I02A 4ENJA 1QPMA 5D5WB 4KICA 4EJUA 4LG0A 3IHUA 5HLGA 4HZFA 4EJVA 1XCBA 4P96A 4GO1A 2BBYA 2EB7A 2LSOA 2EA4A 3T8TA 3DXJF 4HDVA 5E18F 1DUXC 4PGGA 3R0JA 2FRHA 5EEHA 3HIFA 4O3MA 2EV5A 4IPAA 2VBXA 5LRSA 5LHIA 1AOYA 3VFZA 2FQ3A 1SMTA 4AIKA 2OZ6A 1OYWA 3N97A 1FZPB 3RYPA 1JGSA 2EWNA 1IN7A 1L3LA 5J8CA 2F5EA 2ESNA 3ECOA 3ABTA 2HTSA 1KYWA 2W24A 4UVBA 5ED4A 3GEZA 3GLXA 2HEOA 3O3KA 4EJWA 5HVQC 3K1MA 2VT2A 1XSVA 2DLLA 1FP2A 3SXYA 2JTVA 3TGNA 3QPHA 3LQRA 3N4MA 2PQ8A 3LFKA 4M9SA 2GWRA 4KIBA 5IT3A 5D6EA 2P6TA 5AIPA 4NQWA 2GA2A 4YIFA 2JSCA 1O3TA 4LGWA 3WTSC 4AIHA 1XGSA 3P9CA 3E6BA 2A5YB 4M72A 1J5YA 2YU3A 4NB5A 4Q5SF 4H0EA 1IN6A 1R5GA 3GW2A 3IWFA 3K2ZA 1ZG3A 3CUQC 1XCVA 2RQPA 4R79A 2HFHA 1IN5A 3ZMSA 1KU9A 5FLXZ 3IRQA 2IJLA 1U2WA 1SMYF 3ML6A 5J8FA 3LAPA 3BJ6A 2OA4A 2ETHA 3IC7A 2XIGA 2WTEA 1XSXA 2Y48A 3L7WA 1IUYA 1E17A 1EV7A 3J7AO 2O61A 1AWCA 2VONA 1P6RA 1WWXA 4WK8F 2STWA 2JZYA 2VC1A 1Z9CA 5H6RA 4YFXF 5H6QA 2DFIA 2ZFWA 3GFIA 2UXXA 2Z3YA 2KIUA 3ZN0A 3QU6A 4E70A 2UXNA 1F5TA 4DQ2A 4FT8A 1Z1DA 3F8CA 5FLXK 3CLOA 3C3WA 5DD8A 3KETA 2ELHA 2OD5A 4ENMA 1HW1A 2XAFA 4BHBA 1HKQA 3CUQA 4UHTA 1RNLA 2WV0A 4TV7A 5DCMB 1BJAA 3EQLF 1IRGA 5TJJA 1IZ1A 2MC3A 2HWVA 1U3EM 3F8FA 1QZZA 4ENNA 1O7FA 1S8NA 4ESBA 5FO5A 4B09A 2DK5A 3PQJA 4ZZDA 3RPUA 4HF0A 2DAOA 1KU2A 2Y75A 3I53A 1U6GA 1TTYA 5BOXA 1ULYA 2XAQA 5HS8A 3J81Z 4A5MA 4N0BA 3D5LA 1J7KA 3U1DA 3BWGA 1LEBA 3CUOA 5K5RA 2A69F 2H94A 4WXHA 5L3GA 1IW7F 4G7HF 1CGPA 3L2CA 3DFGA 2FBIA 3WGHA 3S2WA 1YO5C 4MEYF 1OPCA 1ZN2A 4CYDA 1LDKB 1UHWA 1TQMA 1IN4A 2FBHA 2G7UA 4LK1F 4Q47A 3ZMDA 5LLQA 3BY6A 1ZARA 4AWXB 1G3YA 3MEXA 4BAYA 5E8IA 5DD4A 5D5UB 4G94A 2DTRA 2P4WA 4G6QA 3FHZA 1Z91A 2A68F 1U5TC 3KEQA 2H6BA 4CICA 3F22A 3HOTA 1K6OA 2B0LA 3G3ZA 2QENA 3DKWA 5E1WA 1XB4A 4RGRA 4ZYDA 4I09A 2NRAC 3T8RA 2ADUA 1LJ9A 2HR3A 2NNYA 2EJRA 3FMRA 3M8FA 4UV9A 2OBPA 1W5SA 2EFPA 2IW5A 3O6BB 2J5PA 1FY7A 1I6XA 3NEUA 2P8TA 3HRSA 1K79A 2A3SA 2HYGD 2JT1A 5D6FA 1BM9A 1O7LA 3GZ5A 3SHFA 4ON0A 2MD5A 4UNOA 3F6VA 2DQLA 2HTJA 3I54A 4WXDA 5BS6A 1L0OC 3GFMA 4CXFA 4U0WA 2Q2EA 1LQ1A 1USTA 5ERIA 4KDPA 4Y15A 2HQNA 4HYEA 3R60A 3C1DA 3ZMZA 2FE3A 1OMIA 2PG4A 5LGNA 1B59A 5K5QA 3FWEA 2KJCA 1B1BA 5IT9K 3WGIA 2QQAA 4Y17A 2RKHA 1D8KA 5DCFA 3MWMA 2O0YA 2Q8KA 2VE9A 3REOA 2DPUA 1YS7A 3GUDA 3HSRA 1PDNC 1A04A 3V8KA 1XSDA 2NS0A 2VE8A 3R61A 4UXNA 2ZMEB 4IJAA 3WTTC 3E6CC 4G7ZF 5HLHA 3FMSA 1YIOA 1ZLJA 2ZJ2A 2VBZA 4AD9A 1P92A 3KEOA 4LB5A 1GVJA 4JK1X 5LHHA 1U78A 3FMQA 4HF2A 4A0YA 4GGGA 1ZRFA 3IL2A 3DV8A 1QQIA 4KN7X 1XGOA 1P2FA 5CVIA 3NRVA 3VOEA 1GXQA 2O8XA 2HS5A 1KA8A 1KGSA 2HDCA 1H9GA 3U9GA 4LFUA 3M1EA 2VXZA 3HHGA 5CJ9A 1F4KA 1R7JA 3CDHA 5F64A 3KZZA 1ZREA 4LD5A 2K4JA 2EFWA 4HV6A 2XGXA 1TBXA 4O6JA 1SD4A 1XGMA 3E3VA 4L0ZB 3QOPA 3E5UA 1WSUA 1ZG1A 2DT5A 1S6LA 4EJTA 2ISYA 3TO9A 2K02A 5L3FA 1K78B 3L9FA 2V1DA 5J6XA 2YSRA 3HTUA 2TDXA 4KMFA 3QRFF 3KP5A 3KLOA 2ZNYA 3FXRA 3CTAA 2L4AA 1R22A 1SFUA 4L18B 4LB6B 2HKXA 4EV0A 4HOBA 4OIRF 2UZKA 1DPUA 1DP7P 4KIFA 4M9XA 5ICFA 3M7GA 2IT0A 2O3FA 2IVMA 2P7CB 2DI3A 3Q5FA 4I98B 4IRIA 2M8EA 2ZCWA 4CO8A 1YW9A 3SZPA 2F5CA 2NYXA 2Y0MA 2H09A 2QQBA 3BP8A 1FBQA 4LLLA 1ZYRF 2CYYA 2RGVA 1TW2A 3FM5A 2H27A 4BYYA 1BI3A 2ESHA 5DEQA 2OQGA 2XKOA 3K1NA 4HQEA 2L01A 3KZYA 1MD0A 2KIFA 2BE5F 1B9NA 2D1VA 4FHTA 1OR7A 1XMKA 3KP7A 1FT9A 2VC0A 2MLGA 4G7OF 5LRRA 2IA2A 2YX4A 4MHGA 4UV8A 2KIMA 2X0LA 3JTHA 1BOAA 1CF7A 2ZXJA 3PQKA 3EDPA 4RB2C 5HDKA 2CQKA 3AAFA 3T1BA 3F3XA 5BPIA 1SFEA 1QBJA 1FSEA 2V9VA 1VTNC 2PEXA 5CLSA 2FSWA 3V4GA 3KFWX 1R00A 1H0MA 2IP2A 1XN7A 3WU1B 3JSPA 2BYVE 3BDDA 4ZZLA 3HOSA 2PLYA 1LNWA 2MH2A 1KYZA 5HDNA 2FXAA 1ZGJA 5ILUA 4XRFA 1WI9A 4BHPA 2VOPA 1W4MA 1T6SA 5HOOA 2MBFA 1Z05A 2RV8A 4I7HA 3IRRA 3BPXA 3MZHA 2GZWA 4KIGA 1E2XA 4KA4A 4UUVA 3E5QA 4YIIA 2V6CA 2FNAA 1KQ8A 5FD6A 4OIPF 2W25A 2EA2A 2UWMA 3IKVA 1T38A 4WXCA 2L4MA 4L0YB 2LKPA 3KP6A 4B8XA 4XLNF 3SFZA 5H20A 1JE8A 2P6SA 4ZYEA 3J80Z 1MZBA 1R36A 3F8NA 2VODA 2AXLA 4N9HA 3GF2A 4G8XA 1HXDA 3ECHA 5D5VB 1BI0A 3FF5A 5JHUA 3H3UA 2XASA 4N9IA 4MQVA 3RPQA 2V79A 4A6EA 1QNTA 4KFCA 1XGNA 2ZO4A 1Y0UA 4UVCA 3WTXC 1R1VA 4MTEA 3LQQA 4F7ZA 4EM1A 3MFKA 4YFKF 1FPQA 3U2RA 4GXOA 1OYIA 1R23A 2K86A 2XKPA 1BI2A 4GCVA 4R8HA 3QP6A 4A0ZA 4OMYA 1YFHA 4EM2A 2H6CA 5A2QZ 3E6DA 1T2KA 2HZTA 3FXQA 3LWFA 4ETSA 2F2EA 4EM0B 3SQNA 2EV0A 4IXAA 2PN6A 3E5XA 1PP8F 1H9TA 5AIQA 4HA8A 2EFOA 2KJBA 5L3EA 2M5WA 5D5XB 1Z6TA 1HW2A 1EH6A 5BQTA 1RI7A 4EJOA 5LGUA 4LLGF 3RIRA 3VB2A 1LDDA 1SFXA 4U7BA 2LF7A 2PJPA 2Z9OA 3HRUA 3I59B 1Q1HA 2YPRA 3J81K 2R7FA 1FYMA 3T5XA 1O3RA 5K1YA 4MTDA 2BGCA 4S04A 1FBSA 3BJOA 3L09A 4L9NA 1IF1A 1MDMA 4HF1A 2KRFA 3CJNA 2P5KA 3H3ZA 5E8GA 1W7PB 4FX0A 2NAZA 1FWZA 4I0BA 3F8BA 4WCGA 4HV5A 2EV6A 3OV8A 4L5JA 2L3DA 4KYWA 2HGCA 1XD7A 1V3FA 2L54A 1B9MA 3I71A 4PDKA 4G6DA 2W57A 1FSHA 2Z5UA 3TQNA 1RUNA 5LGTA 4S05A 2M30A 3F6OA 1QGPA 1F9NA 2HOEA 3B02A 1D8JA 1UFMA 1J2XA 1G3WA 4MGRA 1ON1A 2FEZA 3WU0A 1U5TA 2P7VB 2VOOA 1YS6A 3KLNA 1REPC 3WTYC 2GA1A 1TNSA 3ZPLA 3ZMTA 1Z6RA 2PMUA 1OYYA 3MCZA 5LEKA 1D5VA 4L9TA 1DDNA 3RKXA 4WWCA 5ICGA 5BMZA 1MKMA 1FLIA 3BROA 1OKRA 3PFIA 2VBWA 4MQ9F 5L3CA 1XMAA 1UB9A 4ESJA 3JSOA 1O3QA 1ZLKA 2STTA 3M9AA 3H92A 2GXGA 2CG4A 3GX4X 4KT5C 1FYLA 5L3DA 4Z2YA 1NHAA 1TLHB 1WRJA 3ERED 2XAHA 2XVCA 4BQAA 5DYMA 2F5DA 3F8MA 2XV4S 3SZTA 2E1CA 4P9UA 2XAJA 1J75A 3V8JA 2A6HF 3WTWC 3EYIA 4KN4X 5E17F 4KMUX 3EUHA 3KP3A 4MNUA 2MH9A 4ESFA 2V1XA 3W6KB 4EQQA 3BPVA 2QWWA 2OU2A 1PP7U 3DPLC 1HKSA 4HAMA 3LSTA 1I5ZA 2W85A 3ZQ7A 2MLKA 3W6JB 4U88A 2LF8A 5TRDA 5FGMA 4HW0A 4M9ZA 2K27A 1RIOH 2QBYA 3HHHA 3IKTA 2HKOA 2G9WA 3T0YA 1BIBA 1IXRC 4JQFA 2ZMEA 4RB1A 2CGPA 5JR3A 4XBFA 1HKTA 5JI6A 3TO7A 2ZNZA 4YFNF 3RKWA 1IXSB 5HS9A 4ZH4F 2ISZA 2O03A 4LLNA 3K9TA 1S29A 3GZ6A 4FX4A 4WF2A 2J5OA 3TOAA 5FB2A 1HQCA 3L00A 1XDUA 4LG0B 3FM3A 5LHGA 1JXSA 2IPQX 2QM3A 1HBXG 2FA5A 3C18A 4HLXA 3O2PE 3KE2A 3RDIA 2OZUA 3B73A 1G3SA 5JFRA 3V8LA 5F1RA 2K7LA 1ONVA 2PFBA 4CZZA 2P5LC 2QLZA 3QP5A 2IA1A 3EYYA 2HYFA 4R1HA 2W84A 3WTUC 1G4DA 2CWEA 3V7RA 1O3SA 4L9JA 1IN8A 1P4AA 2FOKA 4HLYA 4Q48A 2RVCA 4IHTA 3WE3A 2EFQA 3MQ0A 3HTSB 3P9IA 2Z99A 1K78A 3WODF 2FF4A 3P7NA 3TOBA 3HYIA 3KP4A 4A12A 1K7AA 3M8EA 5F6FA 1RUOA 5DUKA 4GYIA 2DBBA 1CF7B 2O6GE 4M71A 1ZRDA 1FC3A 1J9IA 5LBQA 2D2WA 4LK0F 4OU0A 1SD6A 1ZRCA 5DV5A 1D3YA 1SD5A 2CFXA 4RGUA 2PBIA 2HQRA 5D8LB 5HS7A 4RAYA 1W7PD 3HUGA 2CSOA 1SAXA 3GFJA 3GO5A 3Q9VA 2XRNA 1FX7A 3GXOA 3GYHX 4MEXF 3I58A 1IXCA 3V7SA 1IAWA 1G6NA 1LDJA 3LA7A 4U7DA 4U0VA 1R1UA 1BBYA 1T98A 2PI0A 4P55A 1YYVA 2ACJA 4ENKA 3RJPA 5E1XA 2JPBA 3HSFA 2Z33A 4XSXF 3F23A 2E1NA 3IWZA 4RGSA 3I0TA 2RDPA 3EETA 2ZBKA 3VODA 1LB2A 4IF4A 2BV6A 1JHFA 5CVJA 1TQIA 1QZYA 1ODDA 3BZ6A 4L5IA 2A07F 3E6MA 2VBYA 2GQQA 1MJ9A 2X4HA 3ZMVA 4GYGA 4I0AA 3HRTA 2NNNA 3Q9SA 4Q4ZF 1ZH5A 1YTYA 1ZHFA 1JHHA 3CO6C 2D45A 5KVRA 2IA0A 1F1ZA 3CUQB 3TKYA 1P4WA 4OOIA 1FP1D 3C7JA 3V7CA 4WX9A 4PZJA 4OMZA 4PGHA 1YG2A 1TQPA 4D0PA 4OINF 4OIQF 3FZVA 4HX7A 1LEAA 4Y13A 4EVIA 1SD7A 1KQ9A 1YW8A 3ULQB 3MAJA 4A6DA 3LAJA 4LJZF 5L3BA 4BNCA 1MGTA 3I5UA 2MA3A 2ZKZA 2CO5A 2FNPA 1X3UA 3I4PA 4AVPA 1YQAA 1C0WA 5CVUA 2G7HA 3VEPA 2E7WA 1I1SA 2GXBA 2D1HA 4PCQA 2VN2A 3ISPA 4DNCA 4CDGA 3WTZA 1GHCA 2WC2A 4M74A 3ABUA 1ON2A 1V4RA 1PUEE 5E20A 4BH9A 4RAZA 5HLIA 4QWQA 4QLCU 3DF8A 1R5HA 3J80K 4HBLA 4EMSA 3D0SA 1S7OA 1UHMA 5DCMA 1MJAA 1LVAA 3WGGA 1P4XA 4IVNA 3GWZA 1MDMB 5JVTA 3BOQA 4U0YA 3R4KA 5CVRA 3RI4A 5ILVA 5CVVA 3TDUC 2BEOA 3P9KA 3RYRA 4K2EA 5FD5A 2QQ9A 1QO0D 3ZMUA 3QPTA 4G9YA 4A0XA 2P5VA 2EFNA 1WQ2A 1BIAA 1BN5A 3RKYA 3K69A 4LMYA 5DDGA 5A2QK 1HSTA 2DPDA 4P9FA 2QYOA 3NQOA 4ASNA 2DO7A 1Z7UA 2YR2A 2R3SA 4RB3C 1G3TA 4JBAA 2CW0F 1FYKA 3QU3A 1U5TB 2GAUA 2A6EF 1B4AA 3K0LA 3F21A 1O57A 3FX3A 5D4SA 1EH8A 1BC8C 2XUBA 4UVAA 3I59A 4HQMA 5HDGA 1YW7A 4HDUA 3MZYA 2DU9A 2M1BA 5AONA 1ZAOA 3OOPA 2A61A 5IT9Z 3JTGA 2FMYA 3K1PA 2XROA 4ZYHA 2JRTA 1ZG5A 1I1GA 2QUFA 4ZYGA 4NHJA 5K5OA 1S7AA 1DPRA 2OQRA 1TNTA 5E1ZB 3COAC 4XLPF 3DP7A 5D8KB 1W7PA 1FOKA 5ILSA 2F5FA 4M73A 2XAGA 4KUMA 1R58A 3CO7C 2OAZA 4A5NA 5LEJA 6PAXA 4OIOF 3R0AA 2FU4A 4CGZA 1ZGAA 4RS8A 2LNBA 4O5VA 3ROUA 4IRGA 1WKMA 4XSZF 3TO6A 3BJAA 4BXUA 3R6SA 1B6AA 4HX4A 1UCRA 2RC4A 4L9VA 4IHSA 1I27A 2EK5A 3DQVC 3ZP5A 2M87A 2QVOA 2XHKA 4YG2F 2FMLA 1BC7C 2JPCA 1J59A 2FBKA 3E97A 1YLFA 1W5TA 2Q0OA 3KP2A 1HSJA 3QAHA 2QBYB 3RTRA 2RN7A 4I2OA 1T0FA 2V1UA 4HX8A 5BPDA 3DEUA 1STZA 3LA2A 1GXPA 2L02A 2M45A 2RNJA 5CYVA 3I64A 1FBUA 1IRFA 5FFZA 4BHCA 3ZN1A 1MJBA 4EGYA 5FFXA 5EEGA 3JAMZ 4RB0A
chains in the Genus database with same CATH superfamily
1WHUA 1VQ9I 2AS5F 2LP0A 2DW4A 2R7DA 1HW5A 4A2UA 3GVAA 3LA3A 3PO2J 3RPUD 1WI3A 2DQRA 3KIOA 2M0CA 3CDLA 9ANTA 4M6XA 3TBIA 3WG9A 1X1PA 5ICCA 3WTVC 2CFOA 1TW3A 1BR2A 1RR7A 4NBQA 1R1TA 1BI1A 1XDSA 3S3NA 3D5SC 2LDUA 3GFLA 4AUXA 5D4RA 2L9RA 3CJRB 1QVTA 2M2EA 2F4MB 4XLHA 1HLVA 1XG1A 1S3JA 3BR1A 3WE2A 1VQMI 1KU3A 2WWYA 5KK1A 5K7FA 1RZ4A 3F72A 3HSEA 3JW4A 2FJ1A 5IPAA 1UZCA 5ICEA 4P5OA 1YJNI 2NVTJ 4AIJA 4M3DA 2ZSHB 1U8RA 3FXUA 4GRIA 3JAMK 1Z3XA 2AO9A 3LOCA 4BUPA 3CC4I 2GIVA 4M6YA 2IRFG 2E7XA 2DK8A 1KQ0A 3DPTA 5DUIA 2RAEA 2XGEA 1FNNA 4KNYA 1K6YA 2K9QA 2VKEA 3ELKA 4M6VA 3KCCA 5HNFA 3A2KA 4XORA 2R5ZA 2YX7A 1USSA 1N25A 2COMA 2VT3A 3HRMA 2JVGA 5DTDA 2X85A 1EH7A 1J0RA 2HOAA 4RGXA 1QHHD 2KKOA 2QZ8A 4IRHA 1YJWI 4EGZA 1KU7A 1GDTA 3G73A 1T39A 2K4BA 1QVUA 3TDZC 4I01A 2C6YA 1IV6A 4CHUA 1LVKA 3DTKA 4BJTA 2EH3A 2PMHA 4I02A 4ENJA 1MBHA 1QPMA 2BOLA 4D5FA 2OUMA 5D5WB 3Q3SA 4KICA 4EJUA 2EIKH 3LSJA 2FUG2 3JCUC 3X2QH 4F91B 1WJ5A 4LG0A 4LOCA 3ZQIA 3IHUA 1BW6A 5HLGA 4RLFA 4HZFA 4EJVA 3JRGA 3HOYJ 1XCBA 1WJCA 5LD2C 3S1QJ 4BQOA 3L2WA 3DBLB 3E0JB 4GO1A 4P96A 4CA0A 2VXDA 3LSGA 4ZTJA 2BBYA 1M1EB 2EB7A 2LSOA 4I76A 5EG0A 2MABA 5GAHJ 4KITB 2EA4A 4XL9A 3T8TA 3DXJF 3S16J 4HDVA 5E18F 1DUXC 2DODA 4PGGA 3R0JA 2FRHA 5EEHA 3HIFA 4O3MA 2EV5A 3LSMA 4IPAA 1RR8C 2L2OA 2VBXA 4B1RA 4E6KG 5E3MA 3AG1H 5LRSA 4B4CA 5LHIA 1AOYA 1MMSA 3VFZA 4DJAA 2FQ3A 2RREA 1SMTA 4AIKA 1V5EA 3LFUA 1JKRC 2JA8J 4XKWA 2DOAA 3OYAA 2OZ6A 1OQYA 1FOYA 1OYWA 3N97A 1FZPB 3RYPA 3CMYA 4CZCA 1JGSA 1RETA 2EWNA 1IN7A 1HC8A 1L3LA 5J8CA 2ID6A 2F5EA 2ESNA 3ECOA 3ABTA 2HTSA 4Y3OA 1KYWA 4A3DJ 2W24A 2K85A 5IP7J 4UVBA 3VWBA 5ED4A 3GEZA 3GLXA 3BG3A 2M8GX 5F0CA 2F5VA 1D0YA 4ZDPA 2HEOA 1VQ6I 3O3KA 4EJWA 5HVQC 3K1MA 1OCTC 2VT2A 1XSVA 2DLLA 2V6EA 1FP2A 1Z77A 3SXYA 2JTVA 3TGNA 5DM6F 1I39A 1UMQA 4FQGA 1MBFA 4IOAF 3QPHA 2R7ZJ 3JRDA 1NK3P 3LQRA 3N4MA 3JR9A 3CJTB 2DA6A 2PQ8A 2VI6A 3LFKA 3HOUJ 1T33A 1WH7A 3OYDA 5B5EC 2JQ7A 1A5JA 3CP8A 2EINH 4M9SA 1ZTRA 2GOMA 2YU9J 1BA5A 4FE4A 2GWRA 4KIBA 5IT3A 1TP4A 2OV7A 3BZCA 5D6EA 2P6TA 3S3OA 4QIWN 5AIPA 3S2HJ 3HPHA 4NQWA 2XC7A 3H5NA 1LPQA 4F93B 3OOUA 4RA2A 2GA2A 4KISA 2I10A 5CPRB 2IS2A 3BG5A 4YIFA 2JSCA 1O3TA 4LGWA 1I50J 3LMMA 3WTSC 3BR3A 3DBHB 4AIHA 1XGSA 2M7AA 3GTPJ 3P9CA 3E6BA 2A5YB 5CKTA 2M4GA 3J7YJ 4M72A 1J5YA 3U21A 2YU3A 4NB5A 4Q5SF 2X6XA 4H0EA 2LY9A 1IN6A 1TC3C 1R5GA 3GW2A 3IWFA 3K2ZA 3FK7A 3BR5A 1ZG3A 3CUQC 1XCVA 3CCUI 3S32A 2RQPA 1ZELA 4R79A 1SFOJ 1QPIA 2HFHA 1IN5A 3ZMSA 1KU9A 3W2VA 5FLXZ 3IRQA 4RBOA 2IJLA 1U2WA 4CUGA 2JA7J 1SVOA 1OLTA 2XPWA 2DJIA 2E71A 2HQAA 3BTLA 2R7OA 4NC7A 1LUJB 1SMYF 2XPUA 3ML6A 1R71A 4JYKA 1EJ9A 2IS6A 5J8FA 1NTCA 1IUFA 3LAPA 3BJ6A 3OS1A 1JTXA 2OA4A 4HSTA 2DDAA 3HDDA 2Y0SN 1AKHB 2ETHA 3DBRB 3IC7A 4CYCB 2XIGA 2WTEA 1XSXA 2GIZA 2Y48A 3L7WA 1IUYA 1E17A 1EV7A 3J7AO 2O61A 1AWCA 4IHXA 2VONA 1P6RA 1WWXA 2IS4A 4WK8F 2STWA 2JZYA 2VC1A 1Z9CA 1APLC 5H6RA 2DA1A 4YFXF 2QA4I 5H6QA 2DFIA 2ZFWA 1LKXA 3GFIA 1ACIA 2UXXA 3Q0VA 2Z3YA 3CQZJ 3UNGC 1YIJI 2KIUA 3ZN0A 4BGDA 3QU6A 4NNJA 1TWHJ 4E70A 2UXNA 1K61A 1F5TA 3LSIA 4DQ2A 4FT8A 4BEHA 1Z1DA 4X0GA 1FOWA 3F8CA 3WHBA 1YHQI 5FLXK 2VUMJ 2DMNA 2LKSA 3W2AA 2VL8A 3CLOA 3C3WA 5DD8A 3KETA 2ELHA 2OD5A 4UB6C 3W2WA 2HVSA 2G0EA 2X1DA 2X51A 4ENMA 1HW1A 2XAFA 4BHBA 1HKQA 1IRZA 3CUQA 4UHTA 1I3AA 1RNLA 2WV0A 1MIJA 2LFBA 4TV7A 3QYFA 5DCMB 1I3QJ 1BJAA 1Y6IA 1WJBA 2FX0A 3EQLF 4C3IJ 1MMDA 1IRGA 5TJJA 5JLXA 2F48A 1IZ1A 2MC3A 2HWVA 2HZDA 4I6ZA 1U3EM 3S1MJ 4NUBA 3F8FA 2LTPA 1QZZA 2DMUA 3I56I 1WZ2A 1TWAJ 1O7FA 1S8NA 4LITA 4ESBA 5FO5A 4B09A 4ENNA 1FOXA 2DK5A 3PQJA 4ZZDA 1WH5A 3PFYA 3RPUA 3CCMI 3K4LA 4HF0A 2DAOA 1TL8A 1KU2A 3S17J 2Y75A 5EZHA 3I53A 5JLWA 2KDZA 1H89C 1U6GA 1D0XA 4HSRA 4HRIA 1TTYA 5J1YA 5BOXA 2KFDA 1ULYA 4YIRX 2XAQA 3KX2A 5HS8A 3J81Z 2QQ8A 1OISA 2OJED 2CUZA 4N0BA 4A5MA 3D5LA 2LKXA 1J7KA 4U87A 1MW7A 3U1DA 3BWGA 3H35A 1LEBA 2ZJQF 3CUOA 5K5RA 2PJRA 3OIPA 2A69F 2H94A 2KLOA 1VQ5I 4WXHA 5KHDA 2ME6A 5L3GA 1JI8A 1KONA 4S0HB 2DMPA 4GFBA 3VYTB 1UAAA 4OAYA 2HXOA 1IW7F 2XGDA 3OYNA 2X1EA 2LRDA 3H0GJ 4G7HF 1VQ8I 1CGPA 3L2CA 3CMMA 3DFGA 2FBIA 2XF6A 4AU7A 4BS9A 3WGHA 5B66C 3BQYA 1JUMA 3S2WA 4MEYF 5B3SH 2VQGA 1YO5C 1OPCA 3FXJA 1ZN2A 4CYDA 1LDKB 1UHWA 1TQMA 1IN4A 3BTJA 2FBHA 2G7UA 4LK1F 4Q47A 2R5YB 3ZMDA 2HVQA 2XSJC 1VZ0A 5LLQA 3BY6A 1ZARA 2XB0X 4AWXB 1G3YA 3MEXA 4X6AJ 1Z21A 3D5RC 4BAYA 3O8HA 3J7ZI 5E8IA 4PSXA 2E34A 4AIDA 5DD4A 4UUTA 1IC8A 2ID3A 1MBKA 5D5UB 3CLQA 1E3HA 4G94A 2DTRA 3PNTA 2P4WA 2XF5A 4G6QA 3FHZA 3JREA 4PJMA 5E3LA 1Z91A 2A68F 1U5TC 3KEQA 2H6BA 4CICA 3F22A 3HOTA 1K6OA 4E7HA 3SZGA 2M34A 1GV2A 3S14J 4H4KC 2B0LA 3OSGA 1K4TA 5EDNA 2B7EA 3G3ZA 2BY2A 3AFHA 1VQPI 1W36D 2QENA 3DKWA 5FJ8J 5E1WA 5HNHA 4A3KJ 1XB4A 4RGRA 2BW3B 4ZYDA 2R7XA 4I09A 1NK2P 2NRAC 3T8RA 2ADUA 5FKMA 1LJ9A 2HR3A 1W0TA 2DMTA 2NNYA 2R0QC 4J00A 3S2DJ 4BE0A 2EJRA 3FMRA 3M8FA 3RZOJ 4C9YA 3H3VK 2GXAA 2VJJA 1T95A 1MNEA 1GV5A 4UV9A 2OBPA 2PX9A 1U9OA 4N4OB 1W5SA 1T08B 4HNTA 2EFPA 1OCPA 2IW5A 3HJEA 3O6BB 4A3FJ 2J5PA 3DLAA 1FY7A 1I6XA 2M4KA 2CH0A 2P8TA 3NEUA 4XMYA 3HRSA 1K79A 2XAUA 2A3SA 5KNLA 2HYGD 2JT1A 5D6FA 1BM9A 1O7LA 3AG4H 3GZ5A 1ZR2A 3SHFA 2IXSA 4B3XA 4ON0A 1EKEA 2MD5A 4UNOA 5M5XJ 2V4JC 1GUUA 2JN6A 3F6VA 3FKJA 2MYSA 3V42A 1B8IB 1BW5A 1TT5B 2DQLA 2HTJA 3I54A 4WXDA 2LG4A 5BS6A 2JA6J 1L0OC 2ZFUA 3GFMA 3ZQCA 4CXFA 2ZJRF 3FXKA 3F9KA 2CUFA 4U0WA 1GT0C 3DCFA 2Q2EA 3BR2A 1LQ1A 1USTA 5ERIA 4IHVA 4KDPA 3W6VA 1XX5A 4Y15A 5EEAA 2IBDA 2HQNA 3H9QA 4HYEA 2WY7Q 1UG2A 2QF7A 3R60A 2Y69H 3C1DA 3ZMZA 2FE3A 1QRYA 2HDDA 3WU2C 3OR1C 5FKOA 1OMIA 1R49A 2R93J 2PG4A 3EUHC 1IJWC 3QPSA 5LGNA 1B59A 3EUKL 5K5QA 3OIOA 4BACA 5EGOB 3FWEA 2KJCA 1B1BA 1VF9A 5IT9K 2ZXWH 3WGIA 1LE8A 5FRMA 3A01A 3VDXA 2QQAA 2WV1A 4A3EJ 3FXLA 1H8AC 3H1CA 2AHQA 4Y17A 2RKHA 2HNHA 3QYEA 1D8KA 3OR2C 5TISC 2NVQJ 5DCFA 1SAUA 3IV5A 3MWMA 4A3IJ 2DXIA 1MH4A 2DYSH 2O0YA 3CCYA 2Q8KA 2VE9A 2KL4A 3HG9A 3REOA 2DPUA 1YS7A 2DCEA 2QGUA 3GUDA 1IGNA 3QQAA 5F27A 4PJ0C 3HSRA 1PDNC 2WA0A 1A04A 3V8KA 3ZRGA 1XSDA 4IHWA 2M3AA 1JT0A 2NS0A 3K4JA 2VE8A 2VQLA 2Y31A 3R61A 4BKXA 3G1LA 5E3NA 4UXNA 1N78A 3DTEA 2ZMEB 4IJAA 3WTTC 1U0JA 1ETOA 3E6CC 4G7ZF 1ETQA 5HLHA 3L2QA 4RLQA 3FMSA 1YIOA 2LY2A 3OIQA 1ZLJA 2ZJ2A 3AL0B 2HOSA 2Y9ZA 2VBZA 4AD9A 1P92A 3DKXA 3KEOA 4F52A 4IX7A 4LB5A 3OYEA 4I99C 1GVJA 2RQQA 1YJ9I 4JK1X 4BU2A 5LHHA 1U78A 3AG2H 3FMQA 3M3YJ 1OCCH 1B72A 4HF2A 1IRXA 1SANA 4C30A 4A0YA 5M5YJ 4GGGA 1ZRFA 1U8BA 4ABZA 1MMAA 5IP6A 3IL2A 3DV8A 4RDUA 1QQIA 3GCMA 4KN7X 1XGOA 2F4OB 1P2FA 2F4IA 5F04A 1AU7A 2D5VA 5CVIA 3NRVA 3VOEA 2GOXB 2DA4A 1PUFB 3AG3H 3DU5A 1GXQA 2O8XA 2OCEA 3CJQB 2HS5A 4E7ZA 1KA8A 3LSKA 1KGSA 4A3LJ 4B43A 2HDCA 2DYRH 1H9GA 1VI0A 3U9GA 4LFUA 3M1EA 1ETKA 2R7TA 2VXZA 4D7MA 3HHGA 5CJ9A 3OYIA 2EZLA 2K40A 1F4KA 1R7JA 3CDHA 2WAQA 4W1UA 5IY5H 5F64A 3KZZA 5J47A 1VQ4I 2H1KA 1ZREA 4LD5A 4QTRA 1MMGA 2K4JA 2EFWA 1IG7A 4HV6A 2XGXA 1TBXA 4O6JA 4OAZA 4BJ6C 2DJNA 2LR8A 4JX6A 2Z2SB 2UUZA 1SD4A 2R5ZB 1XGMA 1RC9A 3E3VA 1RPWA 4L0ZB 2LH9A 1Y0NA 2LK2A 3QOPA 3MZ8A 4NC8A 3E5UA 2VIXA 3DKYA 1Y56A 1WSUA 3PL8A 3K70D 1ZG1A 3FK6A 2DT5A 1S6LA 3KYLA 2PMZN 4EJTA 2OF7A 1YX5A 2ISYA 3TO9A 2K02A 1SVMA 5L3FA 1K78B 3L9FA 2W48A 3VYUB 2V1DA 2DOEA 5J6XA 4XICA 3IP4B 5IP9J 4BXXJ 2YSRA 1ENHA 3G1MA 3HTUA 1D0ZA 2TDXA 1Y1WJ 4KMFA 3FKIJ 3QRFF 3KP5A 3KLOA 2ZNYA 3FXRA 1HA8A 3CTAA 3DWLE 1OR7C 2E36A 2L4AA 5EG0B 2E60A 2V9PA 2KP6A 2ECBA 3IAM2 1R22A 1SFUA 4L18B 3PUBA 1W36C 2E2IJ 1V54H 3PIOF 4LB6B 3VPRA 2HKXA 4EV0A 2EILH 1Z67A 3OMYA 4HOBA 4PFPA 4ZC3A 4OIRF 2UZKA 3SJMA 1LFUP 1DPUA 3BC8A 1DP7P 2KDOA 3QWLA 4KIFA 4XNFA 3ZQGA 2B63J 4M9XA 5ICFA 3OYCA 2HVRA 3TL4X 1UJ8A 4XRSA 3M7GA 4RM2A 2VQHA 2O3FA 4JX4A 3JRAA 2IT0A 3M8JA 1HF0A 2L0KA 2IVMA 2P7CB 4PUSA 4XKBA 4F3QA 3ZGKA 1ZKGA 2DI3A 2EZIA 3ZQFA 3Q5FA 1N77A 2LOOA 2VPRA 5KAFC 4I98B 3HUGB 4IRIA 1Z3YA 2M8EA 1KZHA 2ZCWA 4CO8A 4CCNA 2R7VA 1YW9A 3SZPA 2F5CA 2NYXA 1N75A 2BY1A 2Y0MA 2H09A 2M0MA 2QQBA 3BP8A 1FBQA 1ETWA 2NOJB 4LLLA 1ZYRF 2WAEA 2CYYA 4RB0A 2RGVA 2M9HA 1TW2A 3C2BA 3FM5A 2H27A 3BG7A 2MC4A 4BYYA 1IDZA 1BI3A 1S5LC 5F1JA 3O8GA 2ESHA 5DEQA 3HOXJ 2OQGA 2XKOA 3K1NA 4HQEA 2L01A 2TCTA 3M4OJ 3QOEA 3KZYA 1MD0A 2KIFA 2BE5F 1B9NA 3N05A 2D1VA 4FHTA 1OR7A 1XMKA 3KP7A 1FT9A 2LY1A 1JKPC 2VC0A 3OS2A 3MMYB 2MLGA 3BCAA 4G7OF 1ITYA 5LRRA 4ANJA 1BL0A 4XIDA 4FE7A 2DMQA 3ABMH 4AVZA 2IA2A 2YX4A 4AC0A 2X9DA 4MHGA 4UV8A 4ZTFA 5E79C 2KIMA 3MD2A 1A36A 3BT9A 2X0LA 1OJLA 3JTHA 1BOAA 1CF7A 1FTZA 1PVEA 1Y1VJ 2ZXJA 3K10A 3PQKA 3A4CA 3EDPA 4RB2C 5FKLA 1PYVA 1R5ID 5HDKA 2CQKA 3AAFA 3RKQA 2QKMB 4BXFA 3GMEA 3T1BA 5B1AH 3F3XA 4MIMA 1SFEA 5BPIA 3OYBA 4IZZA 4C2TA 1QBJA 1MNDA 1FSEA 2F6CA 2V9VA 2OCCH 2W7NA 5EYRA 2Y9YA 2I8DA 1VTNC 1ZK8A 1OCRH 2XGCA 2PEXA 3OYJA 5CLSA 2UV1A 2FSWA 3V4GA 1FJLA 2IEKA 3KFWX 1R00A 1H0MA 4LIVA 1WVRA 4HNUA 2IP2A 1XN7A 1S7EA 4XRMA 3WU1B 4JX5A 3VSKA 3JSPA 2A6TA 1X1DA 2BYVE 3BDDA 4UB8C 5GTIC 3SFIA 3OYMA 1JUSA 4ZZLA 3HOSA 4BY1J 5FKNA 3CCRI 3G71I 4BDYA 3K4BA 2PLYA 1LNWA 2MH2A 3EPZA 1KYZA 5HDNA 2FXAA 1O4XA 4JOMA 1ZGJA 2DT6A 5GP9A 4XRFA 1WCMJ 1WI9A 4B48A 4BQNA 5ILUA 5GPCA 3RZDJ 3I3LA 4EATA 2NOGA 4BHPA 4BDZA 2VOPA 1W4MA 4C3HJ 1T6SA 5HOOA 2MBFA 1Z05A 2RV8A 4I7HA 1ERDA 2ICWG 2JK3A 3IRRA 3BPXA 3HEFA 1RKTA 2O5RA 3MZHA 2GZWA 4A3JJ 4KIGA 2FOWA 3CCVI 4MO7A 2JSPA 4BEHB 1E2XA 1WJDA 2XF7A 4KA4A 4UUVA 3E5QA 4YIIA 2Z1DA 3U1KA 2V6CA 3OYFA 2FNAA 2VLAA 1KQ8A 1P7IA 5FD6A 2E2HJ 5C4XJ 4OIPF 2W25A 4IHYA 2EA2A 2UWMA 3IKVA 1T38A 1TZLA 3H5AA 4WXCA 3KZIC 2XSDC 3IAS2 1SC7A 4A3CJ 2L4MA 1R4NB 2QSHX 3GBGA 4L0YB 5J4YA 2LKPA 3FISA 1BJZA 2H8WA 2HOTA 1J09A 3S1NJ 4B44A 1YI2I 3KP6A 1E3PA 4XLNF 4B8XA 3SFZA 5H20A 3TW6A 1JE8A 2P6SA 2JA5J 4IQ4A 4ZYEA 3K70C 3NAUA 1QZEA 4XN0A 3FIWA 3J80Z 1BR4A 1MZBA 2X48A 1R36A 3F8NA 1V5GA 1CQTA 2VODA 4G12A 2AXLA 4N9HA 3GF2A 3BTIA 4G8XA 4QPOA 1HXDA 2K5CA 1ORKA 3ECHA 4CH7A 2QKLB 2RNGA 2V7FA 5D5VB 5J3LA 1BI0A 3FF5A 1AKHA 5JHUA 3CC2I 3H3UA 4CYCA 2HU9A 2BZTA 4JP0A 2XASA 4N9IA 4MQVA 3GTQJ 5DS9A 4ITVA 2WBMA 3RPQA 2V79A 1DQUA 3HKZA 4A6EA 1QNTA 3ZOBA 4D9JA 3G2BA 4KFCA 1XGNA 2ZO4A 1Y0UA 3VYRB 2JMWA 2R7UA 4UVCA 3WTXC 1R1VA 4DBRA 2JA2A 2CUJA 4MTEA 3LQQA 4F7ZA 2BHYA 5K7ZA 4EM1A 4E7SA 3MFKA 3GTLJ 4YFKF 1FPQA 2CQXA 1Y39A 3U2RA 4GDFA 3JAMZ 1YRNB 1WFXA 4GXOA 3NARA 1OYIA 1R23A 3PJRA 3PSIA 2K86A 2XKPA 5JHFA 1BI2A 2L7FP 3CP2A 4GCVA 4RMNA 3TP3A 2K9SA 4R8HA 3QP6A 4A0ZA 4OMYA 3CESA 1YFHA 4EM2A 2H6CA 5A2QZ 3E6DA 1T2KA 2BXZA 3CMAI 3C2GA 2HZTA 3FXQA 3LWFA 4PSWA 4ETSA 2F2EA 5JVGF 4EM0B 3SQNA 2XRLA 5DM7F 2EV0A 1R9TJ 4ZYAA 4IXAA 2PN6A 3E5XA 2OC6A 1PP8F 1ETXA 1H9TA 5AIQA 4HA8A 2EFOA 2KJBA 2NXNB 1X1AA 3EUAA 2E1MB 2M5WA 5FKKA 5D5XB 5L3EA 4PJJA 2DT7B 1T56A 1YITI 2GM4A 3HZJA 1Z6TA 1HW2A 1EH6A 5BQTA 5IYCJ 1RI7A 4EJOA 5KAIC 2IAIA 2VKHA 5LGUA 4LLGF 5C4JJ 4IOCF 3RIRA 3QPLA 3VB2A 4CCJA 1LDDA 1SFXA 2ZJPF 4U7BA 2LF7A 2PJPA 2Z9OA 3HRUA 2MG4A 3I59B 1Q1HA 2YPRA 4E7IA 2R92J 4EEFG 1YOVB 4RAGA 3J81K 5HLTA 2R7FA 1DGRM 3T5XA 1O3RA 1FYMA 3LSPA 3ZR8X 2CW8A 3BTCA 1JKOC 5LFAA 4RM3A 5K1YA 1X2MA 5GAGJ 4MTDA 2BGCA 4S04A 3IH2A 1FBSA 3BJOA 3L09A 3PNYA 1LFBA 1X19A 4L9NA 1IF1A 1MDMA 4HF1A 2KRFA 3CJNA 3CCEI 2KPMA 3TMOA 2P5KA 3H3ZA 3A0HC 2O8KA 3FBIB 3L2UA 3I55I 5E8GA 2Q1ZB 4UY8I 1W7PB 1FIPA 2DDBA 4FX0A 1FMWA 2NAZA 1FWZA 3NWTA 4I0BA 4XLCA 2BHZA 3F8BA 4WCGA 4M3FA 4HV5A 2WAQN 2EV6A 3OV8A 4BL0B 2R5YA 4L5JA 2L3DA 4KYWA 1D1AA 2HGCA 2L7KA 1XD7A 1V3FA 2LLKA 3IH4A 2L54A 2R7RA 1B9MA 3I71A 4PDKA 3BZKA 4G6DA 2W57A 3VYSB 2ELJA 4A3BJ 1FSHA 2Z5UA 3TQNA 1G8XA 1RUNA 4XONA 1MSFC 2GBYA 3K4KA 5GTHC 3BR6A 5LGTA 4S05A 4BE1A 4BBSJ 2M30A 4DZJA 2K9NA 4QSHA 3F6OA 5H2FC 1QGPA 1F9NA 2HOEA 2R7QA 5M5WJ 3B02A 1D8JA 1UFMA 1X58A 3KYCB 1J2XA 1G3WA 2R4GA 4XOTA 1W1WE 3AKZA 4DIQA 4MGRA 1ON1A 2FEZA 1E3OC 2OTJI 2CJJA 2Y30A 3WU0A 2NS7A 4PJLA 3BCBA 2QCOA 1U5TA 2BW3A 3MVPA 2P7VB 3F0CA 2VOOA 1YS6A 2KZGA 2HXIA 5M3MJ 3L2RA 3ABLH 3CCLI 3KLNA 1REPC 2OTLI 3WTYC 3TP0A 2GA1A 4FTHA 1DU6A 1K4SA 4II3A 2VASA 1MBJA 2EQRA 1TNSA 4XM3A 3ZPLA 2EPFA 3ZMTA 1Z6RA 5GPAA 1FMVA 1X1CA 2KRCA 4QPQA 2PMUA 4CCLA 2V9KA 5F08A 1K83J 1OYYA 3CF5F 1XPXA 2O7OA 3HPGA 1U9NA 3MCZA 2LBFB 3WHCA 2ELKA 5LEKA 1D5VA 3UKGA 4L9TA 1DDNA 1B8IA 2IGOA 3RKXA 4WWCA 1T8IA 3GZNB 5ICGA 4XR6A 5BMZA 1MKMA 1FLIA 3OS0A 3BROA 1OKRA 3PFIA 2MD0A 1A6IA 2VBWA 4MQ9F 5L3CA 3GTMJ 2DFFA 3CC7I 1XMAA 3MN2A 1UB9A 2ZMEC 4ESJA 3JSOA 3HC7A 4DGWB 2DN0A 1O3QA 3PIPF 1HDDC 1ZLKA 2STTA 3AL0C 3M9AA 4E7KA 2HDWA 2P0WA 3H92A 1G59A 3HL2A 3PUFA 2JRMA 2GXGA 2CG4A 5C3EJ 3GX4X 4KT5C 2EIMH 5L3DA 1FYLA 4Z2YA 1NHAA 5TGTA 1TLHB 1WRJA 4FCYA 1IDYA 5J4VA 3ERED 4IQJA 2XAHA 2XVCA 4UUSA 4BQAA 4LG3A 5DYMA 1VQ7I 2F5DA 3F8MA 2E2JJ 5J40A 2XV4S 4AM3A 5FLVA 3SZTA 2E1CA 2AQFA 3K2AA 4P9UA 2XAJA 5EGOA 1J75A 2IS1A 3V8JA 2MW8A 2DA7A 1VQLI 2A6HF 4XLFA 1Q1VA 3WTWC 3EYIA 3RSNA 2CV0A 4B47A 2R7WA 4KN4X 1RKWA 2LC2A 3K4MA 5E17F 4KMUX 4MLOA 3EUHA 3FDYA 3ZXSA 1X1BA 2KIQA 3KP3A 2KQRA 3K4CA 4MNUA 2MH9A 4ESFA 4DYCA 1DGWY 1ETYA 4RAFA 2V1XA 3W6KB 4EQQA 5EF6A 3BPVA 2QWWA 2OU2A 1PP7U 3DPLC 1HKSA 1JUPA 4HAMA 3LSTA 1I5ZA 4LIUA 2W85A 3ZQ7A 4HPQA 2QSGX 2WY8Q 2MLKA 3W6JB 4U88A 2LF8A 5KCMA 2JVHA 3G4SI 5TRDA 2JUGA 2VJ5A 5FGMA 2CQNA 4HW0A 4M9ZA 1R4MB 2K27A 1RIOH 2QBYA 3HHHA 3Q0UA 2HKOA 3IKTA 2G9WA 4DOZA 1WJEA 3T0YA 1BIBA 1IXRC 4JQFA 2ZMEA 1SEUA 4RB1A 2COBA 2CGPA 4FETA 4L5EA 5JR3A 3M1CA 4XBFA 4PFOA 2K3PA 1HKTA 3L2VA 4PJNA 5IYBJ 5JI6A 1A35A 3TO7A 2ZNZA 4YFNF 3BG9A 2AQEA 3JRHA 3RKWA 1IXSB 5HS9A 3VSLA 4ZH4F 2ISZA 2O03A 4LLNA 2QEXI 3KPHA 4A3GJ 1X2NA 3K9TA 1AHDP 4CCMA 1S29A 4Y52J 3SDBA 4D7NA 3GZ6A 4FX4A 2NVUB 3FXMA 4J01A 4WF2A 4BE2A 1Z0XA 2J5OA 3TOAA 5FB2A 3RQ4A 3TEDA 1HQCA 3MKYB 2B9SA 4KT6A 2LVSA 5B1BH 2WB1A 4IKFA 3L00A 1XDUA 4LG0B 3DPUA 3FM3A 4CSWA 1PUFA 4W97A 3GTJJ 5LHGA 2DTZA 5J1RA 1JXSA 2E5NA 4V2FA 2IPQX 2QM3A 3HM5A 1HBXG 4Y4RA 2FA5A 4XN3A 3OY9A 3C18A 3JRIA 5GAEJ 2X6WA 4HLXA 3OYGA 3O2PE 3KE2A 2CV2A 3RDIA 1D5YA 2OZUA 3B73A 1JJ8C 1G3SA 5JFRA 3E1SA 3V8LA 5F1RA 2K7LA 4DBQA 1ONVA 1ZGWA 3RQIA 2PFBA 4CZZA 2P5LC 2QLZA 1XMXA 3QP5A 1D1CA 4N4NB 3OYKA 3OL3A 2X6YA 2IA1A 3LL7A 2WAFA 2HYFA 3EYYA 3HGGA 4R1HA 2W84A 3WTUC 2HQ5A 1G4DA 2CWEA 3V7RA 3BLYA 1F36A 2ECCA 1O3SA 4L9JA 2HPIA 1IN8A 2FOKA 5GADJ 4HLYA 4Q48A 1XC5A 2L9NA 2RVCA 4IHTA 1FEXA 3WE3A 1UELB 2EFQA 3MQ0A 3BG6A 3HTSB 3HB9A 3P9IA 2Z99A 1K78A 3WODF 1R6RA 1MSEC 2FF4A 3HOWJ 3H0DA 2EZHA 3P7NA 3MKZA 2EBIA 2NS8A 3TOBA 3HYIA 4AYBA 2K3FA 3KP4A 3SYTA 2BY0A 4A12A 1K7AA 2YUSA 3M8EA 2A5WA 3HGYA 5F6FA 1X3WB 4DZPA 2CQ7A 1A6QA 4V19K 1ZQ3P 3MKWB 1NG7A 1RUOA 3DTIA 3W3CA 5DUKA 4X1EA 4GYIA 3ZQQA 2DBBA 1CF7B 2O6GE 2XPVA 1POGA 4M71A 2IGKA 1MNMC 1ZRDA 3S93A 2FD5A 2OPTA 1FC3A 1J9IA 5LBQA 4CCKA 2D2WA 4HG2A 5FLMJ 4LK0F 1SFKA 4OU0A 1SD6A 1ZRCA 5DV5A 1D3YA 1QHGA 4NQWB 1JJ6C 1SD5A 2CFXA 4NDLA 2XB5A 4RGUA 2PBIA 3H5RA 2HQRA 2DFHA 3KYDB 1IO2A 5D8LB 3ESWB 3HKZN 2W4SA 5HS7A 2IGNA 4RAYA 1W7PD 3BQZA 1A31A 1MBGA 3CZ6A 4DW6A 2E35A 2VKVA 3HUGA 1MH3A 3S15J 5EJCA 3WG7H 3PSFA 4XKCA 2VKDA 2CSOA 1SAXA 3GFJA 3GO5A 3Q9VA 2XRNA 1FX7A 3GXOA 3GYHX 1TWCJ 4MEXF 1WGXA 4A69C 3I58A 1IXCA 2N8GA 3V7SA 4PK4A 1IAWA 1G6NA 1LDJA 3LA7A 1YX3A 4A3MJ 1LFPA 4U7DA 4U0VA 1R1UA 1BBYA 1IV8A 1T98A 2X6OA 2PI0A 4P55A 1YYVA 2ACJA 1S9HA 5IOZA 1OCZH 2CQQA 2V1NA 3RJPA 5E1XA 2JPBA 3HSFA 4ENKA 2HPMA 3HXLA 2CMPA 2Z33A 4XSXF 3F23A 1E0EA 4MFDA 2E1NA 5J1UA 5BNGA 3HOVJ 1VNDA 3IWZA 4RGSA 4DYRA 3I0TA 4Z6YA 3S8PA 2RDPA 3EETA 2ZBKA 3VODA 3LNQA 1ZR4A 1LB2A 5M3FJ 3GTKJ 4IF4A 4ZDLA 5F0FA 4HNVA 3M07A 2BV6A 1JHFA 5CVJA 4A93J 1TQIA 3CCSI 1QZYA 1ODDA 2CUEA 1JTYA 1WJAA 3BZ6A 4NC6A 4L5IA 2A07F 2NVXJ 3H9JA 3E6MA 2VBYA 2PMZA 2GQQA 1MJ9A 2X4HA 2KT0A 3DEEA 3ZMVA 1VFCA 5CQGA 4GYGA 4I0AA 2P81A 3HRTA 2JUCA 3P5JA 2NNNA 3Q9SA 3QODA 2I5UA 4Q4ZF 1ZH5A 1YTYA 2ZB9A 1P9QC 4DYQA 4C2UA 1ZHFA 1JHHA 2DA2A 4YRVA 3CO6C 2VJ4A 2H1LA 3A02A 2D45A 5KVRA 2IA0A 1F1ZA 4MFEA 3CDIA 1P7JA 3CUQB 3LSRA 3TKYA 2XDVA 1P4WA 2L9SA 4OOIA 1FP1D 3C7JA 3V7CA 4WX9A 3ZQLA 4D5CA 4PZJA 4OMZA 4PGHA 1YG2A 1TQPA 4D0PA 4OINF 3B6CA 4OIQF 1Z7LA 4G6TB 3FZVA 4HX7A 1LEAA 1MMNA 4Y13A 2ZXHA 1SD7A 4EVIA 5CQEA 1KQ9A 1YW8A 3ULQB 3HOZJ 3PM1A 1X4PA 1QA6A 2X1CA 2Z16A 3MAJA 4A6DA 3L1PA 2M7BA 3LAJA 4LJZF 3ASNH 3ABKH 2DA5A 2JWTA 2GLOA 5L3BA 2L7ZA 1MGTA 3I5UA 4BNCA 1H88C 2MA3A 2ZKZA 4D1QA 2CO5A 3FHNA 2FNPA 1X3UA 3I4PA 2FQ4A 4AVPA 1YQAA 1C0WA 3S3MA 2CU7A 5CVUA 2G7HA 3J7AY 3LSHA 2PJRB 3VEPA 2E7WA 1I1SA 1NG6A 3CD6I 2GXBA 2LREA 1G2HA 2D1HA 4PCQA 3K6GA 1HOMA 2VN2A 3ISPA 3UR3C 4DNCA 4CDGA 3A1YA 2DOFA 3WTZA 1GHCA 2WC2A 1EA3A 3K4NA 4M74A 3ABUA 2MFZA 3OSFA 1ON2A 1V4RA 4E7JA 1PUEE 2BXYA 2CV1A 4F92B 5FROA 3MKLA 5E20A 4XLAA 3G1OA 3IH3A 4BH9A 4BJ5C 4RAZA 2K9MA 5HLIA 4QWQA 4QLCU 2V26A 3DF8A 1R5HA 3J80K 2LD5A 4HBLA 4M3BA 4EMSA 3E7LA 1VQNI 1BR1A 3D0SA 1S7OA 2E1MC 5E3OA 2H8RA 1MBEA 1UHMA 4J19A 2DA3A 3ZQHA 1GLNA 5DCMA 1MJAA 4KJZA 4F55A 3I4NJ 1DP3A 1LVAA 1VQKI 3WGGA 2KISA 1P4XA 3BR0A 4IVNA 4E7LA 4M3EA 4XOPA 3GTOJ 3Q0WA 3GWZA 4XK4A 1MDMB 1RRJA 4HEA2 1TWFJ 3DLLF 1JGGA 3ASOH 5JVTA 3BOQA 4U0YA 3S1RJ 1UHSA 3R4KA 5CVRA 5IOYA 3RI4A 2A05A 5ILVA 1V5FA 5CVVA 1OCOH 3TDUC 1D1BA 2BEOA 2W82A 3P9KA 3RYRA 1PJRA 4ZJZA 4ZDOA 1AA7A 2BVLA 4II2A 2K9LA 3I9V2 3B6AA 3A0BC 4K2EA 5FD5A 5FRNA 3I4MJ 2KMUA 2QQ9A 3RCOA 1QO0D 4BY7J 3QPTA 3ZMUA 5HODA 2KRHA 3ONQA 2KHMA 1YRNA 2ZSIB 3HBLA 4G9YA 3FBNB 4A0XA 2P5VA 2W00A 5K7HA 2EFNA 1WQ2A 4IO9F 1BIAA 2CS3A 1BN5A 1BOBA 3RKYA 3JRBA 3K69A 4LMYA 4E4HA 3FXOA 5DDGA 5A2QK 1HSTA 2DPDA 4P9FA 1HDPA 1Y8QB 2QYOA 4V2GA 1W0UA 3NQOA 4ASNA 2DO7A 1Z7UA 2YR2A 2LYCA 2R3SA 4Y33A 4RB3C 1G3TA 4JBAA 2CW0F 1XTAA 2Q2EB 1YE9A 1FIAA 1EF4A 2VPLA 1FYKA 2TRTA 3KEYA 3QU3A 3PNVA 2Y0SA 1I6HJ 1U5TB 1JT6A 2GAUA 1ETVA 2A6EF 1B4AA 3K0LA 1RESA 1O57A 3FX3A 3F21A 5D4SA 1EH8A 1BC8C 2XUBA 1JKQC 2NVYJ 4UVAA 3I59A 4HQMA 5HDGA 1YW7A 2WADA 3MZYA 4HDUA 2DU9A 2M1BA 3CMEI 2W1OA 1HCRA 5AONA 1ZAOA 3OOPA 2CRGA 2R7SA 2A61A 5IT9Z 1LE8B 3JTGA 2FMYA 3A01B 3K1PA 3ZCOA 2XROA 5F0HA 2BVMA 4ZYHA 3CCJI 2JRTA 1DU0A 1FTTA 1ZG5A 1I1GA 2WB1N 3K7AJ 2QUFA 4B3AA 4ZYGA 4NHJA 1TWGJ 2ZXIA 5K5OA 1S7AA 1DPRA 1S72I 2OQRA 1TNTA 3DEWA 3GTGJ 2YS9A 2VJIA 5E1ZB 3SDGA 4XKVA 3COAC 2VB6A 4XLPF 1T0FC 3DP7A 1GVDA 1W7PA 5D8KB 1FOKA 5ILSA 2F5FA 4M73A 2XAGA 2L9VA 2CW7A 4KUMA 1R58A 5IYDJ 1Y8RB 3CO7C 2OAZA 3ERMA 4A5NA 3PO3J 5LEJA 6PAXA 4OIOF 3R0AA 4YEJA 1VQOI 1NH3A 2FU4A 2KZVA 1WJFA 4CGZA 3OYLA 3TW7A 1ZGAA 4UUSB 4RS8A 2LNBA 4O5VA 3D1NI 3ROUA 1WPKA 4IEJA 4IRGA 1WKMA 2DFEA 4P1WA 1X4OA 3QYBA 4XSZF 3TO6A 3OYHA 3BJAA 4BXUA 2MSYA 3C2HA 3H9GA 3R6SA 1V55H 1B6AA 4HX4A 1X3ZB 1UCRA 2LMDA 2RC4A 4L9VA 2QSFX 1I27A 4IHSA 4C3JJ 1B72B 2EK5A 1TT0A 3DQVC 3ZP5A 3SEZA 4BQQA 4M3GA 2M87A 4BBRJ 4AYBN 2QVOA 2ZC2A 2XHKA 1QU3A 5C44J 2L5QA 3H36A 2Y2ZA 4OWRB 4YG2F 3CCQI 2FMLA 3IUOA 2E1OA 1BC7C 2O9LA 1UG0A 2JPCA 1J59A 2FBKA 2MGQA 4XLEA 1OFCX 2HI3A 2ME0A 3E97A 1YLFA 3G6EI 3CF2A 1W5TA 2Q0OA 2JJ7A 2L7MP 3DU6A 3KP2A 4YELA 1HSJA 2HYJA 3QAHA 3SEQA 2QBYB 3RTRA 2EZKA 4IL6C 2RN7A 2EIJH 4I2OA 1SVLA 5EZGA 2AXTC 1T0FA 2V1UA 4XRSG 4HX8A 5BPDA 2IGMA 3DEUA 3A03A 1STZA 3LA2A 2LBFA 1GXPA 2L02A 2M45A 2RNJA 5CYVA 3I64A 3JRFA 1W5CC 4FISA 1FBUA 3NWSA 3JRCA 1IRFA 3OL4A 5FFZA 4BHCA 4XQFA 3ZN1A 1MJBA 2E5ZA 2BY3A 4CCOA 4Y7NJ 4EGYA 5FFXA 2E19A 2VQCA 1XS9A 4C2MJ 4FASD 1F43A 3OWTA 5EEGA 1P4AA 3GLLA
chains in the Genus database with same CATH topology
2AS5F 2DW4A 2R7DA 1HW5A 4A2UA 3GVAA 3LA3A 2DQRA 4M6XA 3WG9A 5ICCA 3WTVC 1TW3A 1R1TA 1BI1A 1XDSA 2LDUA 3GFLA 5D4RA 1S3JA 3WE2A 1KU3A 2WWYA 5KK1A 1RZ4A 3F72A 3HSEA 3JW4A 5ICEA 4P5OA 4AIJA 1U8RA 3FXUA 3JAMK 2GIVA 4M6YA 2IRFG 2E7XA 2DK8A 1KQ0A 3DPTA 5DUIA 1FNNA 4KNYA 3ELKA 3KCCA 2YX7A 1USSA 2COMA 2VT3A 3HRMA 1EH7A 1J0RA 4RGXA 1KU7A 2KKOA 2QZ8A 4IRHA 4EGZA 3G73A 1T39A 2K4BA 3TDZC 4I01A 2C6YA 4CHUA 2PMHA 4I02A 4ENJA 1QPMA 5D5WB 4KICA 4EJUA 4LG0A 3IHUA 5HLGA 4HZFA 4EJVA 1XCBA 4P96A 4GO1A 2BBYA 2EB7A 2LSOA 2EA4A 3T8TA 3DXJF 4HDVA 5E18F 1DUXC 4PGGA 3R0JA 2FRHA 5EEHA 3HIFA 4O3MA 2EV5A 4IPAA 2VBXA 5LRSA 5LHIA 1AOYA 3VFZA 2FQ3A 1SMTA 4AIKA 2OZ6A 1OYWA 3N97A 1FZPB 3RYPA 1JGSA 2EWNA 1IN7A 1L3LA 5J8CA 2F5EA 2ESNA 3ECOA 3ABTA 2HTSA 1KYWA 2W24A 4UVBA 5ED4A 3GEZA 3GLXA 2HEOA 3O3KA 4EJWA 5HVQC 3K1MA 2VT2A 1XSVA 2DLLA 1FP2A 3SXYA 2JTVA 3TGNA 3QPHA 3LQRA 3N4MA 2PQ8A 3LFKA 4M9SA 2GWRA 4KIBA 5IT3A 5D6EA 2P6TA 5AIPA 4NQWA 2GA2A 4YIFA 2JSCA 1O3TA 4LGWA 3WTSC 4AIHA 1XGSA 3P9CA 3E6BA 2A5YB 4M72A 1J5YA 2YU3A 4NB5A 4Q5SF 4H0EA 1IN6A 1R5GA 3GW2A 3IWFA 3K2ZA 1ZG3A 3CUQC 1XCVA 2RQPA 4R79A 2HFHA 1IN5A 3ZMSA 1KU9A 5FLXZ 3IRQA 2IJLA 1U2WA 1SMYF 3ML6A 5J8FA 3LAPA 3BJ6A 2OA4A 2ETHA 3IC7A 2XIGA 2WTEA 1XSXA 2Y48A 3L7WA 1IUYA 1E17A 1EV7A 3J7AO 2O61A 1AWCA 2VONA 1P6RA 1WWXA 4WK8F 2STWA 2JZYA 2VC1A 1Z9CA 5H6RA 4YFXF 5H6QA 2DFIA 2ZFWA 3GFIA 2UXXA 2Z3YA 2KIUA 3ZN0A 3QU6A 4E70A 2UXNA 1F5TA 4DQ2A 4FT8A 1Z1DA 3F8CA 5FLXK 3CLOA 3C3WA 5DD8A 3KETA 2ELHA 2OD5A 4ENMA 1HW1A 2XAFA 4BHBA 1HKQA 3CUQA 4UHTA 1RNLA 2WV0A 4TV7A 5DCMB 1BJAA 3EQLF 1IRGA 5TJJA 1IZ1A 2MC3A 2HWVA 1U3EM 3F8FA 1QZZA 4ENNA 1O7FA 1S8NA 4ESBA 5FO5A 4B09A 2DK5A 3PQJA 4ZZDA 3RPUA 4HF0A 2DAOA 1KU2A 2Y75A 3I53A 1U6GA 1TTYA 5BOXA 1ULYA 2XAQA 5HS8A 3J81Z 4A5MA 4N0BA 3D5LA 1J7KA 3U1DA 3BWGA 1LEBA 3CUOA 5K5RA 2A69F 2H94A 4WXHA 5L3GA 1IW7F 4G7HF 1CGPA 3L2CA 3DFGA 2FBIA 3WGHA 3S2WA 1YO5C 4MEYF 1OPCA 1ZN2A 4CYDA 1LDKB 1UHWA 1TQMA 1IN4A 2FBHA 2G7UA 4LK1F 4Q47A 3ZMDA 5LLQA 3BY6A 1ZARA 4AWXB 1G3YA 3MEXA 4BAYA 5E8IA 5DD4A 5D5UB 4G94A 2DTRA 2P4WA 4G6QA 3FHZA 1Z91A 2A68F 1U5TC 3KEQA 2H6BA 4CICA 3F22A 3HOTA 1K6OA 2B0LA 3G3ZA 2QENA 3DKWA 5E1WA 1XB4A 4RGRA 4ZYDA 4I09A 2NRAC 3T8RA 2ADUA 1LJ9A 2HR3A 2NNYA 2EJRA 3FMRA 3M8FA 4UV9A 2OBPA 1W5SA 2EFPA 2IW5A 3O6BB 2J5PA 1FY7A 1I6XA 3NEUA 2P8TA 3HRSA 1K79A 2A3SA 2HYGD 2JT1A 5D6FA 1BM9A 1O7LA 3GZ5A 3SHFA 4ON0A 2MD5A 4UNOA 3F6VA 2DQLA 2HTJA 3I54A 4WXDA 5BS6A 1L0OC 3GFMA 4CXFA 4U0WA 2Q2EA 1LQ1A 1USTA 5ERIA 4KDPA 4Y15A 2HQNA 4HYEA 3R60A 3C1DA 3ZMZA 2FE3A 1OMIA 2PG4A 5LGNA 1B59A 5K5QA 3FWEA 2KJCA 1B1BA 5IT9K 3WGIA 2QQAA 4Y17A 2RKHA 1D8KA 5DCFA 3MWMA 2O0YA 2Q8KA 2VE9A 3REOA 2DPUA 1YS7A 3GUDA 3HSRA 1PDNC 1A04A 3V8KA 1XSDA 2NS0A 2VE8A 3R61A 4UXNA 2ZMEB 4IJAA 3WTTC 3E6CC 4G7ZF 5HLHA 3FMSA 1YIOA 1ZLJA 2ZJ2A 2VBZA 4AD9A 1P92A 3KEOA 4LB5A 1GVJA 4JK1X 5LHHA 1U78A 3FMQA 4HF2A 4A0YA 4GGGA 1ZRFA 3IL2A 3DV8A 1QQIA 4KN7X 1XGOA 1P2FA 5CVIA 3NRVA 3VOEA 1GXQA 2O8XA 2HS5A 1KA8A 1KGSA 2HDCA 1H9GA 3U9GA 4LFUA 3M1EA 2VXZA 3HHGA 5CJ9A 1F4KA 1R7JA 3CDHA 5F64A 3KZZA 1ZREA 4LD5A 2K4JA 2EFWA 4HV6A 2XGXA 1TBXA 4O6JA 1SD4A 1XGMA 3E3VA 4L0ZB 3QOPA 3E5UA 1WSUA 1ZG1A 2DT5A 1S6LA 4EJTA 2ISYA 3TO9A 2K02A 5L3FA 1K78B 3L9FA 2V1DA 5J6XA 2YSRA 3HTUA 2TDXA 4KMFA 3QRFF 3KP5A 3KLOA 2ZNYA 3FXRA 3CTAA 2L4AA 1R22A 1SFUA 4L18B 4LB6B 2HKXA 4EV0A 4HOBA 4OIRF 2UZKA 1DPUA 1DP7P 4KIFA 4M9XA 5ICFA 3M7GA 2IT0A 2O3FA 2IVMA 2P7CB 2DI3A 3Q5FA 4I98B 4IRIA 2M8EA 2ZCWA 4CO8A 1YW9A 3SZPA 2F5CA 2NYXA 2Y0MA 2H09A 2QQBA 3BP8A 1FBQA 4LLLA 1ZYRF 2CYYA 2RGVA 1TW2A 3FM5A 2H27A 4BYYA 1BI3A 2ESHA 5DEQA 2OQGA 2XKOA 3K1NA 4HQEA 2L01A 3KZYA 1MD0A 2KIFA 2BE5F 1B9NA 2D1VA 4FHTA 1OR7A 1XMKA 3KP7A 1FT9A 2VC0A 2MLGA 4G7OF 5LRRA 2IA2A 2YX4A 4MHGA 4UV8A 2KIMA 2X0LA 3JTHA 1BOAA 1CF7A 2ZXJA 3PQKA 3EDPA 4RB2C 5HDKA 2CQKA 3AAFA 3T1BA 3F3XA 5BPIA 1SFEA 1QBJA 1FSEA 2V9VA 1VTNC 2PEXA 5CLSA 2FSWA 3V4GA 3KFWX 1R00A 1H0MA 2IP2A 1XN7A 3WU1B 3JSPA 2BYVE 3BDDA 4ZZLA 3HOSA 2PLYA 1LNWA 2MH2A 1KYZA 5HDNA 2FXAA 1ZGJA 5ILUA 4XRFA 1WI9A 4BHPA 2VOPA 1W4MA 1T6SA 5HOOA 2MBFA 1Z05A 2RV8A 4I7HA 3IRRA 3BPXA 3MZHA 2GZWA 4KIGA 1E2XA 4KA4A 4UUVA 3E5QA 4YIIA 2V6CA 2FNAA 1KQ8A 5FD6A 4OIPF 2W25A 2EA2A 2UWMA 3IKVA 1T38A 4WXCA 2L4MA 4L0YB 2LKPA 3KP6A 4B8XA 4XLNF 3SFZA 5H20A 1JE8A 2P6SA 4ZYEA 3J80Z 1MZBA 1R36A 3F8NA 2VODA 2AXLA 4N9HA 3GF2A 4G8XA 1HXDA 3ECHA 5D5VB 1BI0A 3FF5A 5JHUA 3H3UA 2XASA 4N9IA 4MQVA 3RPQA 2V79A 4A6EA 1QNTA 4KFCA 1XGNA 2ZO4A 1Y0UA 4UVCA 3WTXC 1R1VA 4MTEA 3LQQA 4F7ZA 4EM1A 3MFKA 4YFKF 1FPQA 3U2RA 4GXOA 1OYIA 1R23A 2K86A 2XKPA 1BI2A 4GCVA 4R8HA 3QP6A 4A0ZA 4OMYA 1YFHA 4EM2A 2H6CA 5A2QZ 3E6DA 1T2KA 2HZTA 3FXQA 3LWFA 4ETSA 2F2EA 4EM0B 3SQNA 2EV0A 4IXAA 2PN6A 3E5XA 1PP8F 1H9TA 5AIQA 4HA8A 2EFOA 2KJBA 5L3EA 2M5WA 5D5XB 1Z6TA 1HW2A 1EH6A 5BQTA 1RI7A 4EJOA 5LGUA 4LLGF 3RIRA 3VB2A 1LDDA 1SFXA 4U7BA 2LF7A 2PJPA 2Z9OA 3HRUA 3I59B 1Q1HA 2YPRA 3J81K 2R7FA 1FYMA 3T5XA 1O3RA 5K1YA 4MTDA 2BGCA 4S04A 1FBSA 3BJOA 3L09A 4L9NA 1IF1A 1MDMA 4HF1A 2KRFA 3CJNA 2P5KA 3H3ZA 5E8GA 1W7PB 4FX0A 2NAZA 1FWZA 4I0BA 3F8BA 4WCGA 4HV5A 2EV6A 3OV8A 4L5JA 2L3DA 4KYWA 2HGCA 1XD7A 1V3FA 2L54A 1B9MA 3I71A 4PDKA 4G6DA 2W57A 1FSHA 2Z5UA 3TQNA 1RUNA 5LGTA 4S05A 2M30A 3F6OA 1QGPA 1F9NA 2HOEA 3B02A 1D8JA 1UFMA 1J2XA 1G3WA 4MGRA 1ON1A 2FEZA 3WU0A 1U5TA 2P7VB 2VOOA 1YS6A 3KLNA 1REPC 3WTYC 2GA1A 1TNSA 3ZPLA 3ZMTA 1Z6RA 2PMUA 1OYYA 3MCZA 5LEKA 1D5VA 4L9TA 1DDNA 3RKXA 4WWCA 5ICGA 5BMZA 1MKMA 1FLIA 3BROA 1OKRA 3PFIA 2VBWA 4MQ9F 5L3CA 1XMAA 1UB9A 4ESJA 3JSOA 1O3QA 1ZLKA 2STTA 3M9AA 3H92A 2GXGA 2CG4A 3GX4X 4KT5C 1FYLA 5L3DA 4Z2YA 1NHAA 1TLHB 1WRJA 3ERED 2XAHA 2XVCA 4BQAA 5DYMA 2F5DA 3F8MA 2XV4S 3SZTA 2E1CA 4P9UA 2XAJA 1J75A 3V8JA 2A6HF 3WTWC 3EYIA 4KN4X 5E17F 4KMUX 3EUHA 3KP3A 4MNUA 2MH9A 4ESFA 2V1XA 3W6KB 4EQQA 3BPVA 2QWWA 2OU2A 1PP7U 3DPLC 1HKSA 4HAMA 3LSTA 1I5ZA 2W85A 3ZQ7A 2MLKA 3W6JB 4U88A 2LF8A 5TRDA 5FGMA 4HW0A 4M9ZA 2K27A 1RIOH 2QBYA 3HHHA 3IKTA 2HKOA 2G9WA 3T0YA 1BIBA 1IXRC 4JQFA 2ZMEA 4RB1A 2CGPA 5JR3A 4XBFA 1HKTA 5JI6A 3TO7A 2ZNZA 4YFNF 3RKWA 1IXSB 5HS9A 4ZH4F 2ISZA 2O03A 4LLNA 3K9TA 1S29A 3GZ6A 4FX4A 4WF2A 2J5OA 3TOAA 5FB2A 1HQCA 3L00A 1XDUA 4LG0B 3FM3A 5LHGA 1JXSA 2IPQX 2QM3A 1HBXG 2FA5A 3C18A 4HLXA 3O2PE 3KE2A 3RDIA 2OZUA 3B73A 1G3SA 5JFRA 3V8LA 5F1RA 2K7LA 1ONVA 2PFBA 4CZZA 2P5LC 2QLZA 3QP5A 2IA1A 3EYYA 2HYFA 4R1HA 2W84A 3WTUC 1G4DA 2CWEA 3V7RA 1O3SA 4L9JA 1IN8A 1P4AA 2FOKA 4HLYA 4Q48A 2RVCA 4IHTA 3WE3A 2EFQA 3MQ0A 3HTSB 3P9IA 2Z99A 1K78A 3WODF 2FF4A 3P7NA 3TOBA 3HYIA 3KP4A 4A12A 1K7AA 3M8EA 5F6FA 1RUOA 5DUKA 4GYIA 2DBBA 1CF7B 2O6GE 4M71A 1ZRDA 1FC3A 1J9IA 5LBQA 2D2WA 4LK0F 4OU0A 1SD6A 1ZRCA 5DV5A 1D3YA 1SD5A 2CFXA 4RGUA 2PBIA 2HQRA 5D8LB 5HS7A 4RAYA 1W7PD 3HUGA 2CSOA 1SAXA 3GFJA 3GO5A 3Q9VA 2XRNA 1FX7A 3GXOA 3GYHX 4MEXF 3I58A 1IXCA 3V7SA 1IAWA 1G6NA 1LDJA 3LA7A 4U7DA 4U0VA 1R1UA 1BBYA 1T98A 2PI0A 4P55A 1YYVA 2ACJA 4ENKA 3RJPA 5E1XA 2JPBA 3HSFA 2Z33A 4XSXF 3F23A 2E1NA 3IWZA 4RGSA 3I0TA 2RDPA 3EETA 2ZBKA 3VODA 1LB2A 4IF4A 2BV6A 1JHFA 5CVJA 1TQIA 1QZYA 1ODDA 3BZ6A 4L5IA 2A07F 3E6MA 2VBYA 2GQQA 1MJ9A 2X4HA 3ZMVA 4GYGA 4I0AA 3HRTA 2NNNA 3Q9SA 4Q4ZF 1ZH5A 1YTYA 1ZHFA 1JHHA 3CO6C 2D45A 5KVRA 2IA0A 1F1ZA 3CUQB 3TKYA 1P4WA 4OOIA 1FP1D 3C7JA 3V7CA 4WX9A 4PZJA 4OMZA 4PGHA 1YG2A 1TQPA 4D0PA 4OINF 4OIQF 3FZVA 4HX7A 1LEAA 4Y13A 4EVIA 1SD7A 1KQ9A 1YW8A 3ULQB 3MAJA 4A6DA 3LAJA 4LJZF 5L3BA 4BNCA 1MGTA 3I5UA 2MA3A 2ZKZA 2CO5A 2FNPA 1X3UA 3I4PA 4AVPA 1YQAA 1C0WA 5CVUA 2G7HA 3VEPA 2E7WA 1I1SA 2GXBA 2D1HA 4PCQA 2VN2A 3ISPA 4DNCA 4CDGA 3WTZA 1GHCA 2WC2A 4M74A 3ABUA 1ON2A 1V4RA 1PUEE 5E20A 4BH9A 4RAZA 5HLIA 4QWQA 4QLCU 3DF8A 1R5HA 3J80K 4HBLA 4EMSA 3D0SA 1S7OA 1UHMA 5DCMA 1MJAA 1LVAA 3WGGA 1P4XA 4IVNA 3GWZA 1MDMB 5JVTA 3BOQA 4U0YA 3R4KA 5CVRA 3RI4A 5ILVA 5CVVA 3TDUC 2BEOA 3P9KA 3RYRA 4K2EA 5FD5A 2QQ9A 1QO0D 3ZMUA 3QPTA 4G9YA 4A0XA 2P5VA 2EFNA 1WQ2A 1BIAA 1BN5A 3RKYA 3K69A 4LMYA 5DDGA 5A2QK 1HSTA 2DPDA 4P9FA 2QYOA 3NQOA 4ASNA 2DO7A 1Z7UA 2YR2A 2R3SA 4RB3C 1G3TA 4JBAA 2CW0F 1FYKA 3QU3A 1U5TB 2GAUA 2A6EF 1B4AA 3K0LA 3F21A 1O57A 3FX3A 5D4SA 1EH8A 1BC8C 2XUBA 4UVAA 3I59A 4HQMA 5HDGA 1YW7A 4HDUA 3MZYA 2DU9A 2M1BA 5AONA 1ZAOA 3OOPA 2A61A 5IT9Z 3JTGA 2FMYA 3K1PA 2XROA 4ZYHA 2JRTA 1ZG5A 1I1GA 2QUFA 4ZYGA 4NHJA 5K5OA 1S7AA 1DPRA 2OQRA 1TNTA 5E1ZB 3COAC 4XLPF 3DP7A 5D8KB 1W7PA 1FOKA 5ILSA 2F5FA 4M73A 2XAGA 4KUMA 1R58A 3CO7C 2OAZA 4A5NA 5LEJA 6PAXA 4OIOF 3R0AA 2FU4A 4CGZA 1ZGAA 4RS8A 2LNBA 4O5VA 3ROUA 4IRGA 1WKMA 4XSZF 3TO6A 3BJAA 4BXUA 3R6SA 1B6AA 4HX4A 1UCRA 2RC4A 4L9VA 4IHSA 1I27A 2EK5A 3DQVC 3ZP5A 2M87A 2QVOA 2XHKA 4YG2F 2FMLA 1BC7C 2JPCA 1J59A 2FBKA 3E97A 1YLFA 1W5TA 2Q0OA 3KP2A 1HSJA 3QAHA 2QBYB 3RTRA 2RN7A 4I2OA 1T0FA 2V1UA 4HX8A 5BPDA 3DEUA 1STZA 3LA2A 1GXPA 2L02A 2M45A 2RNJA 5CYVA 3I64A 1FBUA 1IRFA 5FFZA 4BHCA 3ZN1A 1MJBA 4EGYA 5FFXA 5EEGA 3JAMZ 4RB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AS5 F;  2DW4 A;  2R7D A;  1HW5 A;  4A2U A;  3GVA A;  3LA3 A;  2DQR A;  4M6X A;  3WG9 A;  5ICC A;  3WTV C;  1TW3 A;  1R1T A;  1BI1 A;  1XDS A;  2LDU A;  3GFL A;  5D4R A;  1S3J A;  3WE2 A;  1KU3 A;  2WWY A;  5KK1 A;  1RZ4 A;  3F72 A;  3HSE A;  3JW4 A;  5ICE A;  4P5O A;  4AIJ A;  1U8R A;  3FXU A;  3JAM K;  2GIV A;  4M6Y A;  2IRF G;  2E7X A;  2DK8 A;  1KQ0 A;  3DPT A;  5DUI A;  1FNN A;  4KNY A;  3ELK A;  3KCC A;  2YX7 A;  1USS A;  2COM A;  2VT3 A;  3HRM A;  1EH7 A;  1J0R A;  4RGX A;  1KU7 A;  2KKO A;  2QZ8 A;  4IRH A;  4EGZ A;  3G73 A;  1T39 A;  2K4B A;  3TDZ C;  4I01 A;  2C6Y A;  4CHU A;  2PMH A;  4I02 A;  4ENJ A;  1QPM A;  5D5W B;  4KIC A;  4EJU A;  4LG0 A;  3IHU A;  5HLG A;  4HZF A;  4EJV A;  1XCB A;  4P96 A;  4GO1 A;  2BBY A;  2EB7 A;  2LSO A;  2EA4 A;  3T8T A;  3DXJ F;  4HDV A;  5E18 F;  1DUX C;  4PGG A;  3R0J A;  2FRH A;  5EEH A;  3HIF A;  4O3M A;  2EV5 A;  4IPA A;  2VBX A;  5LRS A;  5LHI A;  1AOY A;  3VFZ A;  2FQ3 A;  1SMT A;  4AIK A;  2OZ6 A;  1OYW A;  3N97 A;  1FZP B;  3RYP A;  1JGS A;  2EWN A;  1IN7 A;  1L3L A;  5J8C A;  2F5E A;  2ESN A;  3ECO A;  3ABT A;  2HTS A;  1KYW A;  2W24 A;  4UVB A;  5ED4 A;  3GEZ A;  3GLX A;  2HEO A;  3O3K A;  4EJW A;  5HVQ C;  3K1M A;  2VT2 A;  1XSV A;  2DLL A;  1FP2 A;  3SXY A;  2JTV A;  3TGN A;  3QPH A;  3LQR A;  3N4M A;  2PQ8 A;  3LFK A;  4M9S A;  2GWR A;  4KIB A;  5IT3 A;  5D6E A;  2P6T A;  5AIP A;  4NQW A;  2GA2 A;  4YIF A;  2JSC A;  1O3T A;  4LGW A;  3WTS C;  4AIH A;  1XGS A;  3P9C A;  3E6B A;  2A5Y B;  4M72 A;  1J5Y A;  2YU3 A;  4NB5 A;  4Q5S F;  4H0E A;  1IN6 A;  1R5G A;  3GW2 A;  3IWF A;  3K2Z A;  1ZG3 A;  3CUQ C;  1XCV A;  2RQP A;  4R79 A;  2HFH A;  1IN5 A;  3ZMS A;  1KU9 A;  5FLX Z;  3IRQ A;  2IJL A;  1U2W A;  1SMY F;  3ML6 A;  5J8F A;  3LAP A;  3BJ6 A;  2OA4 A;  2ETH A;  3IC7 A;  2XIG A;  2WTE A;  1XSX A;  2Y48 A;  3L7W A;  1IUY A;  1E17 A;  1EV7 A;  3J7A O;  2O61 A;  1AWC A;  2VON A;  1P6R A;  1WWX A;  4WK8 F;  2STW A;  2JZY A;  2VC1 A;  1Z9C A;  5H6R A;  4YFX F;  5H6Q A;  2DFI A;  2ZFW A;  3GFI A;  2UXX A;  2Z3Y A;  2KIU A;  3ZN0 A;  3QU6 A;  4E70 A;  2UXN A;  1F5T A;  4DQ2 A;  4FT8 A;  1Z1D A;  3F8C A;  5FLX K;  3CLO A;  3C3W A;  5DD8 A;  3KET A;  2ELH A;  2OD5 A;  4ENM A;  1HW1 A;  2XAF A;  4BHB A;  1HKQ A;  3CUQ A;  4UHT A;  1RNL A;  2WV0 A;  4TV7 A;  5DCM B;  1BJA A;  3EQL F;  1IRG A;  5TJJ A;  1IZ1 A;  2MC3 A;  2HWV A;  1U3E M;  3F8F A;  1QZZ A;  4ENN A;  1O7F A;  1S8N A;  4ESB A;  5FO5 A;  4B09 A;  2DK5 A;  3PQJ A;  4ZZD A;  3RPU A;  4HF0 A;  2DAO A;  1KU2 A;  2Y75 A;  3I53 A;  1U6G A;  1TTY A;  5BOX A;  1ULY A;  2XAQ A;  5HS8 A;  3J81 Z;  4A5M A;  4N0B A;  3D5L A;  1J7K A;  3U1D A;  3BWG A;  1LEB A;  3CUO A;  5K5R A;  2A69 F;  2H94 A;  4WXH A;  5L3G A;  1IW7 F;  4G7H F;  1CGP A;  3L2C A;  3DFG A;  2FBI A;  3WGH A;  3S2W A;  1YO5 C;  4MEY F;  1OPC A;  1ZN2 A;  4CYD A;  1LDK B;  1UHW A;  1TQM A;  1IN4 A;  2FBH A;  2G7U A;  4LK1 F;  4Q47 A;  3ZMD A;  5LLQ A;  3BY6 A;  1ZAR A;  4AWX B;  1G3Y A;  3MEX A;  4BAY A;  5E8I A;  5DD4 A;  5D5U B;  4G94 A;  2DTR A;  2P4W A;  4G6Q A;  3FHZ A;  1Z91 A;  2A68 F;  1U5T C;  3KEQ A;  2H6B A;  4CIC A;  3F22 A;  3HOT A;  1K6O A;  2B0L A;  3G3Z A;  2QEN A;  3DKW A;  5E1W A;  1XB4 A;  4RGR A;  4ZYD A;  4I09 A;  2NRA C;  3T8R A;  2ADU A;  1LJ9 A;  2HR3 A;  2NNY A;  2EJR A;  3FMR A;  3M8F A;  4UV9 A;  2OBP A;  1W5S A;  2EFP A;  2IW5 A;  3O6B B;  2J5P A;  1FY7 A;  1I6X A;  3NEU A;  2P8T A;  3HRS A;  1K79 A;  2A3S A;  2HYG D;  2JT1 A;  5D6F A;  1BM9 A;  1O7L A;  3GZ5 A;  3SHF A;  4ON0 A;  2MD5 A;  4UNO A;  3F6V A;  2DQL A;  2HTJ A;  3I54 A;  4WXD A;  5BS6 A;  1L0O C;  3GFM A;  4CXF A;  4U0W A;  2Q2E A;  1LQ1 A;  1UST A;  5ERI A;  4KDP A;  4Y15 A;  2HQN A;  4HYE A;  3R60 A;  3C1D A;  3ZMZ A;  2FE3 A;  1OMI A;  2PG4 A;  5LGN A;  1B59 A;  5K5Q A;  3FWE A;  2KJC A;  1B1B A;  5IT9 K;  3WGI A;  2QQA A;  4Y17 A;  2RKH A;  1D8K A;  5DCF A;  3MWM A;  2O0Y A;  2Q8K A;  2VE9 A;  3REO A;  2DPU A;  1YS7 A;  3GUD A;  3HSR A;  1PDN C;  1A04 A;  3V8K A;  1XSD A;  2NS0 A;  2VE8 A;  3R61 A;  4UXN A;  2ZME B;  4IJA A;  3WTT C;  3E6C C;  4G7Z F;  5HLH A;  3FMS A;  1YIO A;  1ZLJ A;  2ZJ2 A;  2VBZ A;  4AD9 A;  1P92 A;  3KEO A;  4LB5 A;  1GVJ A;  4JK1 X;  5LHH A;  1U78 A;  3FMQ A;  4HF2 A;  4A0Y A;  4GGG A;  1ZRF A;  3IL2 A;  3DV8 A;  1QQI A;  4KN7 X;  1XGO A;  1P2F A;  5CVI A;  3NRV A;  3VOE A;  1GXQ A;  2O8X A;  2HS5 A;  1KA8 A;  1KGS A;  2HDC A;  1H9G A;  3U9G A;  4LFU A;  3M1E A;  2VXZ A;  3HHG A;  5CJ9 A;  1F4K A;  1R7J A;  3CDH A;  5F64 A;  3KZZ A;  1ZRE A;  4LD5 A;  2K4J A;  2EFW A;  4HV6 A;  2XGX A;  1TBX A;  4O6J A;  1SD4 A;  1XGM A;  3E3V A;  4L0Z B;  3QOP A;  3E5U A;  1WSU A;  1ZG1 A;  2DT5 A;  1S6L A;  4EJT A;  2ISY A;  3TO9 A;  2K02 A;  5L3F A;  1K78 B;  3L9F A;  2V1D A;  5J6X A;  2YSR A;  3HTU A;  2TDX A;  4KMF A;  3QRF F;  3KP5 A;  3KLO A;  2ZNY A;  3FXR A;  3CTA A;  2L4A A;  1R22 A;  1SFU A;  4L18 B;  4LB6 B;  2HKX A;  4EV0 A;  4HOB A;  4OIR F;  2UZK A;  1DPU A;  1DP7 P;  4KIF A;  4M9X A;  5ICF A;  3M7G A;  2IT0 A;  2O3F A;  2IVM A;  2P7C B;  2DI3 A;  3Q5F A;  4I98 B;  4IRI A;  2M8E A;  2ZCW A;  4CO8 A;  1YW9 A;  3SZP A;  2F5C A;  2NYX A;  2Y0M A;  2H09 A;  2QQB A;  3BP8 A;  1FBQ A;  4LLL A;  1ZYR F;  2CYY A;  2RGV A;  1TW2 A;  3FM5 A;  2H27 A;  4BYY A;  1BI3 A;  2ESH A;  5DEQ A;  2OQG A;  2XKO A;  3K1N A;  4HQE A;  2L01 A;  3KZY A;  1MD0 A;  2KIF A;  2BE5 F;  1B9N A;  2D1V A;  4FHT A;  1OR7 A;  1XMK A;  3KP7 A;  1FT9 A;  2VC0 A;  2MLG A;  4G7O F;  5LRR A;  2IA2 A;  2YX4 A;  4MHG A;  4UV8 A;  2KIM A;  2X0L A;  3JTH A;  1BOA A;  1CF7 A;  2ZXJ A;  3PQK A;  3EDP A;  4RB2 C;  5HDK A;  2CQK A;  3AAF A;  3T1B A;  3F3X A;  5BPI A;  1SFE A;  1QBJ A;  1FSE A;  2V9V A;  1VTN C;  2PEX A;  5CLS A;  2FSW A;  3V4G A;  3KFW X;  1R00 A;  1H0M A;  2IP2 A;  1XN7 A;  3WU1 B;  3JSP A;  2BYV E;  3BDD A;  4ZZL A;  3HOS A;  2PLY A;  1LNW A;  2MH2 A;  1KYZ A;  5HDN A;  2FXA A;  1ZGJ A;  5ILU A;  4XRF A;  1WI9 A;  4BHP A;  2VOP A;  1W4M A;  1T6S A;  5HOO A;  2MBF A;  1Z05 A;  2RV8 A;  4I7H A;  3IRR A;  3BPX A;  3MZH A;  2GZW A;  4KIG A;  1E2X A;  4KA4 A;  4UUV A;  3E5Q A;  4YII A;  2V6C A;  2FNA A;  1KQ8 A;  5FD6 A;  4OIP F;  2W25 A;  2EA2 A;  2UWM A;  3IKV A;  1T38 A;  4WXC A;  2L4M A;  4L0Y B;  2LKP A;  3KP6 A;  4B8X A;  4XLN F;  3SFZ A;  5H20 A;  1JE8 A;  2P6S A;  4ZYE A;  3J80 Z;  1MZB A;  1R36 A;  3F8N A;  2VOD A;  2AXL A;  4N9H A;  3GF2 A;  4G8X A;  1HXD A;  3ECH A;  5D5V B;  1BI0 A;  3FF5 A;  5JHU A;  3H3U A;  2XAS A;  4N9I A;  4MQV A;  3RPQ A;  2V79 A;  4A6E A;  1QNT A;  4KFC A;  1XGN A;  2ZO4 A;  1Y0U A;  4UVC A;  3WTX C;  1R1V A;  4MTE A;  3LQQ A;  4F7Z A;  4EM1 A;  3MFK A;  4YFK F;  1FPQ A;  3U2R A;  4GXO A;  1OYI A;  1R23 A;  2K86 A;  2XKP A;  1BI2 A;  4GCV A;  4R8H A;  3QP6 A;  4A0Z A;  4OMY A;  1YFH A;  4EM2 A;  2H6C A;  5A2Q Z;  3E6D A;  1T2K A;  2HZT A;  3FXQ A;  3LWF A;  4ETS A;  2F2E A;  4EM0 B;  3SQN A;  2EV0 A;  4IXA A;  2PN6 A;  3E5X A;  1PP8 F;  1H9T A;  5AIQ A;  4HA8 A;  2EFO A;  2KJB A;  5L3E A;  2M5W A;  5D5X B;  1Z6T A;  1HW2 A;  1EH6 A;  5BQT A;  1RI7 A;  4EJO A;  5LGU A;  4LLG F;  3RIR A;  3VB2 A;  1LDD A;  1SFX A;  4U7B A;  2LF7 A;  2PJP A;  2Z9O A;  3HRU A;  3I59 B;  1Q1H A;  2YPR A;  3J81 K;  2R7F A;  1FYM A;  3T5X A;  1O3R A;  5K1Y A;  4MTD A;  2BGC A;  4S04 A;  1FBS A;  3BJO A;  3L09 A;  4L9N A;  1IF1 A;  1MDM A;  4HF1 A;  2KRF A;  3CJN A;  2P5K A;  3H3Z A;  5E8G A;  1W7P B;  4FX0 A;  2NAZ A;  1FWZ A;  4I0B A;  3F8B A;  4WCG A;  4HV5 A;  2EV6 A;  3OV8 A;  4L5J A;  2L3D A;  4KYW A;  2HGC A;  1XD7 A;  1V3F A;  2L54 A;  1B9M A;  3I71 A;  4PDK A;  4G6D A;  2W57 A;  1FSH A;  2Z5U A;  3TQN A;  1RUN A;  5LGT A;  4S05 A;  2M30 A;  3F6O A;  1QGP A;  1F9N A;  2HOE A;  3B02 A;  1D8J A;  1UFM A;  1J2X A;  1G3W A;  4MGR A;  1ON1 A;  2FEZ A;  3WU0 A;  1U5T A;  2P7V B;  2VOO A;  1YS6 A;  3KLN A;  1REP C;  3WTY C;  2GA1 A;  1TNS A;  3ZPL A;  3ZMT A;  1Z6R A;  2PMU A;  1OYY A;  3MCZ A;  5LEK A;  1D5V A;  4L9T A;  1DDN A;  3RKX A;  4WWC A;  5ICG A;  5BMZ A;  1MKM A;  1FLI A;  3BRO A;  1OKR A;  3PFI A;  2VBW A;  4MQ9 F;  5L3C A;  1XMA A;  1UB9 A;  4ESJ A;  3JSO A;  1O3Q A;  1ZLK A;  2STT A;  3M9A A;  3H92 A;  2GXG A;  2CG4 A;  3GX4 X;  4KT5 C;  1FYL A;  5L3D A;  4Z2Y A;  1NHA A;  1TLH B;  1WRJ A;  3ERE D;  2XAH A;  2XVC A;  4BQA A;  5DYM A;  2F5D A;  3F8M A;  2XV4 S;  3SZT A;  2E1C A;  4P9U A;  2XAJ A;  1J75 A;  3V8J A;  2A6H F;  3WTW C;  3EYI A;  4KN4 X;  5E17 F;  4KMU X;  3EUH A;  3KP3 A;  4MNU A;  2MH9 A;  4ESF A;  2V1X A;  3W6K B;  4EQQ A;  3BPV A;  2QWW A;  2OU2 A;  1PP7 U;  3DPL C;  1HKS A;  4HAM A;  3LST A;  1I5Z A;  2W85 A;  3ZQ7 A;  2MLK A;  3W6J B;  4U88 A;  2LF8 A;  5TRD A;  5FGM A;  4HW0 A;  4M9Z A;  2K27 A;  1RIO H;  2QBY A;  3HHH A;  3IKT A;  2HKO A;  2G9W A;  3T0Y A;  1BIB A;  1IXR C;  4JQF A;  2ZME A;  4RB1 A;  2CGP A;  5JR3 A;  4XBF A;  1HKT A;  5JI6 A;  3TO7 A;  2ZNZ A;  4YFN F;  3RKW A;  1IXS B;  5HS9 A;  4ZH4 F;  2ISZ A;  2O03 A;  4LLN A;  3K9T A;  1S29 A;  3GZ6 A;  4FX4 A;  4WF2 A;  2J5O A;  3TOA A;  5FB2 A;  1HQC A;  3L00 A;  1XDU A;  4LG0 B;  3FM3 A;  5LHG A;  1JXS A;  2IPQ X;  2QM3 A;  1HBX G;  2FA5 A;  3C18 A;  4HLX A;  3O2P E;  3KE2 A;  3RDI A;  2OZU A;  3B73 A;  1G3S A;  5JFR A;  3V8L A;  5F1R A;  2K7L A;  1ONV A;  2PFB A;  4CZZ A;  2P5L C;  2QLZ A;  3QP5 A;  2IA1 A;  3EYY A;  2HYF A;  4R1H A;  2W84 A;  3WTU C;  1G4D A;  2CWE A;  3V7R A;  1O3S A;  4L9J A;  1IN8 A;  1P4A A;  2FOK A;  4HLY A;  4Q48 A;  2RVC A;  4IHT A;  3WE3 A;  2EFQ A;  3MQ0 A;  3HTS B;  3P9I A;  2Z99 A;  1K78 A;  3WOD F;  2FF4 A;  3P7N A;  3TOB A;  3HYI A;  3KP4 A;  4A12 A;  1K7A A;  3M8E A;  5F6F A;  1RUO A;  5DUK A;  4GYI A;  2DBB A;  1CF7 B;  2O6G E;  4M71 A;  1ZRD A;  1FC3 A;  1J9I A;  5LBQ A;  2D2W A;  4LK0 F;  4OU0 A;  1SD6 A;  1ZRC A;  5DV5 A;  1D3Y A;  1SD5 A;  2CFX A;  4RGU A;  2PBI A;  2HQR A;  5D8L B;  5HS7 A;  4RAY A;  1W7P D;  3HUG A;  2CSO A;  1SAX A;  3GFJ A;  3GO5 A;  3Q9V A;  2XRN A;  1FX7 A;  3GXO A;  3GYH X;  4MEX F;  3I58 A;  1IXC A;  3V7S A;  1IAW A;  1G6N A;  1LDJ A;  3LA7 A;  4U7D A;  4U0V A;  1R1U A;  1BBY A;  1T98 A;  2PI0 A;  4P55 A;  1YYV A;  2ACJ A;  4ENK A;  3RJP A;  5E1X A;  2JPB A;  3HSF A;  2Z33 A;  4XSX F;  3F23 A;  2E1N A;  3IWZ A;  4RGS A;  3I0T A;  2RDP A;  3EET A;  2ZBK A;  3VOD A;  1LB2 A;  4IF4 A;  2BV6 A;  1JHF A;  5CVJ A;  1TQI A;  1QZY A;  1ODD A;  3BZ6 A;  4L5I A;  2A07 F;  3E6M A;  2VBY A;  2GQQ A;  1MJ9 A;  2X4H A;  3ZMV A;  4GYG A;  4I0A A;  3HRT A;  2NNN A;  3Q9S A;  4Q4Z F;  1ZH5 A;  1YTY A;  1ZHF A;  1JHH A;  3CO6 C;  2D45 A;  5KVR A;  2IA0 A;  1F1Z A;  3CUQ B;  3TKY A;  1P4W A;  4OOI A;  1FP1 D;  3C7J A;  3V7C A;  4WX9 A;  4PZJ A;  4OMZ A;  4PGH A;  1YG2 A;  1TQP A;  4D0P A;  4OIN F;  4OIQ F;  3FZV A;  4HX7 A;  1LEA A;  4Y13 A;  4EVI A;  1SD7 A;  1KQ9 A;  1YW8 A;  3ULQ B;  3MAJ A;  4A6D A;  3LAJ A;  4LJZ F;  5L3B A;  4BNC A;  1MGT A;  3I5U A;  2MA3 A;  2ZKZ A;  2CO5 A;  2FNP A;  1X3U A;  3I4P A;  4AVP A;  1YQA A;  1C0W A;  5CVU A;  2G7H A;  3VEP A;  2E7W A;  1I1S A;  2GXB A;  2D1H A;  4PCQ A;  2VN2 A;  3ISP A;  4DNC A;  4CDG A;  3WTZ A;  1GHC A;  2WC2 A;  4M74 A;  3ABU A;  1ON2 A;  1V4R A;  1PUE E;  5E20 A;  4BH9 A;  4RAZ A;  5HLI A;  4QWQ A;  4QLC U;  3DF8 A;  1R5H A;  3J80 K;  4HBL A;  4EMS A;  3D0S A;  1S7O A;  1UHM A;  5DCM A;  1MJA A;  1LVA A;  3WGG A;  1P4X A;  4IVN A;  3GWZ A;  1MDM B;  5JVT A;  3BOQ A;  4U0Y A;  3R4K A;  5CVR A;  3RI4 A;  5ILV A;  5CVV A;  3TDU C;  2BEO A;  3P9K A;  3RYR A;  4K2E A;  5FD5 A;  2QQ9 A;  1QO0 D;  3ZMU A;  3QPT A;  4G9Y A;  4A0X A;  2P5V A;  2EFN A;  1WQ2 A;  1BIA A;  1BN5 A;  3RKY A;  3K69 A;  4LMY A;  5DDG A;  5A2Q K;  1HST A;  2DPD A;  4P9F A;  2QYO A;  3NQO A;  4ASN A;  2DO7 A;  1Z7U A;  2YR2 A;  2R3S A;  4RB3 C;  1G3T A;  4JBA A;  2CW0 F;  1FYK A;  3QU3 A;  1U5T B;  2GAU A;  2A6E F;  1B4A A;  3K0L A;  3F21 A;  1O57 A;  3FX3 A;  5D4S A;  1EH8 A;  1BC8 C;  2XUB A;  4UVA A;  3I59 A;  4HQM A;  5HDG A;  1YW7 A;  4HDU A;  3MZY A;  2DU9 A;  2M1B A;  5AON A;  1ZAO A;  3OOP A;  2A61 A;  5IT9 Z;  3JTG A;  2FMY A;  3K1P A;  2XRO A;  4ZYH A;  2JRT A;  1ZG5 A;  1I1G A;  2QUF A;  4ZYG A;  4NHJ A;  5K5O A;  1S7A A;  1DPR A;  2OQR A;  1TNT A;  5E1Z B;  3COA C;  4XLP F;  3DP7 A;  5D8K B;  1W7P A;  1FOK A;  5ILS A;  2F5F A;  4M73 A;  2XAG A;  4KUM A;  1R58 A;  3CO7 C;  2OAZ A;  4A5N A;  5LEJ A;  6PAX A;  4OIO F;  3R0A A;  2FU4 A;  4CGZ A;  1ZGA A;  4RS8 A;  2LNB A;  4O5V A;  3ROU A;  4IRG A;  1WKM A;  4XSZ F;  3TO6 A;  3BJA A;  4BXU A;  3R6S A;  1B6A A;  4HX4 A;  1UCR A;  2RC4 A;  4L9V A;  4IHS A;  1I27 A;  2EK5 A;  3DQV C;  3ZP5 A;  2M87 A;  2QVO A;  2XHK A;  4YG2 F;  2FML A;  1BC7 C;  2JPC A;  1J59 A;  2FBK A;  3E97 A;  1YLF A;  1W5T A;  2Q0O A;  3KP2 A;  1HSJ A;  3QAH A;  2QBY B;  3RTR A;  2RN7 A;  4I2O A;  1T0F A;  2V1U A;  4HX8 A;  5BPD A;  3DEU A;  1STZ A;  3LA2 A;  1GXP A;  2L02 A;  2M45 A;  2RNJ A;  5CYV A;  3I64 A;  1FBU A;  1IRF A;  5FFZ A;  4BHC A;  3ZN1 A;  1MJB A;  4EGY A;  5FFX A;  5EEG A;  3JAM Z;  4RB0 A; 
#chains in the Genus database with same CATH topology
 1WHU A;  1VQ9 I;  2AS5 F;  2LP0 A;  2DW4 A;  2R7D A;  1HW5 A;  4A2U A;  3GVA A;  3LA3 A;  3PO2 J;  3RPU D;  1WI3 A;  2DQR A;  3KIO A;  2M0C A;  3CDL A;  9ANT A;  4M6X A;  3TBI A;  3WG9 A;  1X1P A;  5ICC A;  3WTV C;  2CFO A;  1TW3 A;  1BR2 A;  1RR7 A;  4NBQ A;  1R1T A;  1BI1 A;  1XDS A;  3S3N A;  3D5S C;  2LDU A;  3GFL A;  4AUX A;  5D4R A;  2L9R A;  3CJR B;  1QVT A;  2M2E A;  2F4M B;  4XLH A;  1HLV A;  1XG1 A;  1S3J A;  3BR1 A;  3WE2 A;  1VQM I;  1KU3 A;  2WWY A;  5KK1 A;  5K7F A;  1RZ4 A;  3F72 A;  3HSE A;  3JW4 A;  2FJ1 A;  5IPA A;  1UZC A;  5ICE A;  4P5O A;  1YJN I;  2NVT J;  4AIJ A;  4M3D A;  2ZSH B;  1U8R A;  3FXU A;  4GRI A;  3JAM K;  1Z3X A;  2AO9 A;  3LOC A;  4BUP A;  3CC4 I;  2GIV A;  4M6Y A;  2IRF G;  2E7X A;  2DK8 A;  1KQ0 A;  3DPT A;  5DUI A;  2RAE A;  2XGE A;  1FNN A;  4KNY A;  1K6Y A;  2K9Q A;  2VKE A;  3ELK A;  4M6V A;  3KCC A;  5HNF A;  3A2K A;  4XOR A;  2R5Z A;  2YX7 A;  1USS A;  1N25 A;  2COM A;  2VT3 A;  3HRM A;  2JVG A;  5DTD A;  2X85 A;  1EH7 A;  1J0R A;  2HOA A;  4RGX A;  1QHH D;  2KKO A;  2QZ8 A;  4IRH A;  1YJW I;  4EGZ A;  1KU7 A;  1GDT A;  3G73 A;  1T39 A;  2K4B A;  1QVU A;  3TDZ C;  4I01 A;  2C6Y A;  1IV6 A;  4CHU A;  1LVK A;  3DTK A;  4BJT A;  2EH3 A;  2PMH A;  4I02 A;  4ENJ A;  1MBH A;  1QPM A;  2BOL A;  4D5F A;  2OUM A;  5D5W B;  3Q3S A;  4KIC A;  4EJU A;  2EIK H;  3LSJ A;  2FUG 2;  3JCU C;  3X2Q H;  4F91 B;  1WJ5 A;  4LG0 A;  4LOC A;  3ZQI A;  3IHU A;  1BW6 A;  5HLG A;  4RLF A;  4HZF A;  4EJV A;  3JRG A;  3HOY J;  1XCB A;  1WJC A;  5LD2 C;  3S1Q J;  4BQO A;  3L2W A;  3DBL B;  3E0J B;  4GO1 A;  4P96 A;  4CA0 A;  2VXD A;  3LSG A;  4ZTJ A;  2BBY A;  1M1E B;  2EB7 A;  2LSO A;  4I76 A;  5EG0 A;  2MAB A;  5GAH J;  4KIT B;  2EA4 A;  4XL9 A;  3T8T A;  3DXJ F;  3S16 J;  4HDV A;  5E18 F;  1DUX C;  2DOD A;  4PGG A;  3R0J A;  2FRH A;  5EEH A;  3HIF A;  4O3M A;  2EV5 A;  3LSM A;  4IPA A;  1RR8 C;  2L2O A;  2VBX A;  4B1R A;  4E6K G;  5E3M A;  3AG1 H;  5LRS A;  4B4C A;  5LHI A;  1AOY A;  1MMS A;  3VFZ A;  4DJA A;  2FQ3 A;  2RRE A;  1SMT A;  4AIK A;  1V5E A;  3LFU A;  1JKR C;  2JA8 J;  4XKW A;  2DOA A;  3OYA A;  2OZ6 A;  1OQY A;  1FOY A;  1OYW A;  3N97 A;  1FZP B;  3RYP A;  3CMY A;  4CZC A;  1JGS A;  1RET A;  2EWN A;  1IN7 A;  1HC8 A;  1L3L A;  5J8C A;  2ID6 A;  2F5E A;  2ESN A;  3ECO A;  3ABT A;  2HTS A;  4Y3O A;  1KYW A;  4A3D J;  2W24 A;  2K85 A;  5IP7 J;  4UVB A;  3VWB A;  5ED4 A;  3GEZ A;  3GLX A;  3BG3 A;  2M8G X;  5F0C A;  2F5V A;  1D0Y A;  4ZDP A;  2HEO A;  1VQ6 I;  3O3K A;  4EJW A;  5HVQ C;  3K1M A;  1OCT C;  2VT2 A;  1XSV A;  2DLL A;  2V6E A;  1FP2 A;  1Z77 A;  3SXY A;  2JTV A;  3TGN A;  5DM6 F;  1I39 A;  1UMQ A;  4FQG A;  1MBF A;  4IOA F;  3QPH A;  2R7Z J;  3JRD A;  1NK3 P;  3LQR A;  3N4M A;  3JR9 A;  3CJT B;  2DA6 A;  2PQ8 A;  2VI6 A;  3LFK A;  3HOU J;  1T33 A;  1WH7 A;  3OYD A;  5B5E C;  2JQ7 A;  1A5J A;  3CP8 A;  2EIN H;  4M9S A;  1ZTR A;  2GOM A;  2YU9 J;  1BA5 A;  4FE4 A;  2GWR A;  4KIB A;  5IT3 A;  1TP4 A;  2OV7 A;  3BZC A;  5D6E A;  2P6T A;  3S3O A;  4QIW N;  5AIP A;  3S2H J;  3HPH A;  4NQW A;  2XC7 A;  3H5N A;  1LPQ A;  4F93 B;  3OOU A;  4RA2 A;  2GA2 A;  4KIS A;  2I10 A;  5CPR B;  2IS2 A;  3BG5 A;  4YIF A;  2JSC A;  1O3T A;  4LGW A;  1I50 J;  3LMM A;  3WTS C;  3BR3 A;  3DBH B;  4AIH A;  1XGS A;  2M7A A;  3GTP J;  3P9C A;  3E6B A;  2A5Y B;  5CKT A;  2M4G A;  3J7Y J;  4M72 A;  1J5Y A;  3U21 A;  2YU3 A;  4NB5 A;  4Q5S F;  2X6X A;  4H0E A;  2LY9 A;  1IN6 A;  1TC3 C;  1R5G A;  3GW2 A;  3IWF A;  3K2Z A;  3FK7 A;  3BR5 A;  1ZG3 A;  3CUQ C;  1XCV A;  3CCU I;  3S32 A;  2RQP A;  1ZEL A;  4R79 A;  1SFO J;  1QPI A;  2HFH A;  1IN5 A;  3ZMS A;  1KU9 A;  3W2V A;  5FLX Z;  3IRQ A;  4RBO A;  2IJL A;  1U2W A;  4CUG A;  2JA7 J;  1SVO A;  1OLT A;  2XPW A;  2DJI A;  2E71 A;  2HQA A;  3BTL A;  2R7O A;  4NC7 A;  1LUJ B;  1SMY F;  2XPU A;  3ML6 A;  1R71 A;  4JYK A;  1EJ9 A;  2IS6 A;  5J8F A;  1NTC A;  1IUF A;  3LAP A;  3BJ6 A;  3OS1 A;  1JTX A;  2OA4 A;  4HST A;  2DDA A;  3HDD A;  2Y0S N;  1AKH B;  2ETH A;  3DBR B;  3IC7 A;  4CYC B;  2XIG A;  2WTE A;  1XSX A;  2GIZ A;  2Y48 A;  3L7W A;  1IUY A;  1E17 A;  1EV7 A;  3J7A O;  2O61 A;  1AWC A;  4IHX A;  2VON A;  1P6R A;  1WWX A;  2IS4 A;  4WK8 F;  2STW A;  2JZY A;  2VC1 A;  1Z9C A;  1APL C;  5H6R A;  2DA1 A;  4YFX F;  2QA4 I;  5H6Q A;  2DFI A;  2ZFW A;  1LKX A;  3GFI A;  1ACI A;  2UXX A;  3Q0V A;  2Z3Y A;  3CQZ J;  3UNG C;  1YIJ I;  2KIU A;  3ZN0 A;  4BGD A;  3QU6 A;  4NNJ A;  1TWH J;  4E70 A;  2UXN A;  1K61 A;  1F5T A;  3LSI A;  4DQ2 A;  4FT8 A;  4BEH A;  1Z1D A;  4X0G A;  1FOW A;  3F8C A;  3WHB A;  1YHQ I;  5FLX K;  2VUM J;  2DMN A;  2LKS A;  3W2A A;  2VL8 A;  3CLO A;  3C3W A;  5DD8 A;  3KET A;  2ELH A;  2OD5 A;  4UB6 C;  3W2W A;  2HVS A;  2G0E A;  2X1D A;  2X51 A;  4ENM A;  1HW1 A;  2XAF A;  4BHB A;  1HKQ A;  1IRZ A;  3CUQ A;  4UHT A;  1I3A A;  1RNL A;  2WV0 A;  1MIJ A;  2LFB A;  4TV7 A;  3QYF A;  5DCM B;  1I3Q J;  1BJA A;  1Y6I A;  1WJB A;  2FX0 A;  3EQL F;  4C3I J;  1MMD A;  1IRG A;  5TJJ A;  5JLX A;  2F48 A;  1IZ1 A;  2MC3 A;  2HWV A;  2HZD A;  4I6Z A;  1U3E M;  3S1M J;  4NUB A;  3F8F A;  2LTP A;  1QZZ A;  2DMU A;  3I56 I;  1WZ2 A;  1TWA J;  1O7F A;  1S8N A;  4LIT A;  4ESB A;  5FO5 A;  4B09 A;  4ENN A;  1FOX A;  2DK5 A;  3PQJ A;  4ZZD A;  1WH5 A;  3PFY A;  3RPU A;  3CCM I;  3K4L A;  4HF0 A;  2DAO A;  1TL8 A;  1KU2 A;  3S17 J;  2Y75 A;  5EZH A;  3I53 A;  5JLW A;  2KDZ A;  1H89 C;  1U6G A;  1D0X A;  4HSR A;  4HRI A;  1TTY A;  5J1Y A;  5BOX A;  2KFD A;  1ULY A;  4YIR X;  2XAQ A;  3KX2 A;  5HS8 A;  3J81 Z;  2QQ8 A;  1OIS A;  2OJE D;  2CUZ A;  4N0B A;  4A5M A;  3D5L A;  2LKX A;  1J7K A;  4U87 A;  1MW7 A;  3U1D A;  3BWG A;  3H35 A;  1LEB A;  2ZJQ F;  3CUO A;  5K5R A;  2PJR A;  3OIP A;  2A69 F;  2H94 A;  2KLO A;  1VQ5 I;  4WXH A;  5KHD A;  2ME6 A;  5L3G A;  1JI8 A;  1KON A;  4S0H B;  2DMP A;  4GFB A;  3VYT B;  1UAA A;  4OAY A;  2HXO A;  1IW7 F;  2XGD A;  3OYN A;  2X1E A;  2LRD A;  3H0G J;  4G7H F;  1VQ8 I;  1CGP A;  3L2C A;  3CMM A;  3DFG A;  2FBI A;  2XF6 A;  4AU7 A;  4BS9 A;  3WGH A;  5B66 C;  3BQY A;  1JUM A;  3S2W A;  4MEY F;  5B3S H;  2VQG A;  1YO5 C;  1OPC A;  3FXJ A;  1ZN2 A;  4CYD A;  1LDK B;  1UHW A;  1TQM A;  1IN4 A;  3BTJ A;  2FBH A;  2G7U A;  4LK1 F;  4Q47 A;  2R5Y B;  3ZMD A;  2HVQ A;  2XSJ C;  1VZ0 A;  5LLQ A;  3BY6 A;  1ZAR A;  2XB0 X;  4AWX B;  1G3Y A;  3MEX A;  4X6A J;  1Z21 A;  3D5R C;  4BAY A;  3O8H A;  3J7Z I;  5E8I A;  4PSX A;  2E34 A;  4AID A;  5DD4 A;  4UUT A;  1IC8 A;  2ID3 A;  1MBK A;  5D5U B;  3CLQ A;  1E3H A;  4G94 A;  2DTR A;  3PNT A;  2P4W A;  2XF5 A;  4G6Q A;  3FHZ A;  3JRE A;  4PJM A;  5E3L A;  1Z91 A;  2A68 F;  1U5T C;  3KEQ A;  2H6B A;  4CIC A;  3F22 A;  3HOT A;  1K6O A;  4E7H A;  3SZG A;  2M34 A;  1GV2 A;  3S14 J;  4H4K C;  2B0L A;  3OSG A;  1K4T A;  5EDN A;  2B7E A;  3G3Z A;  2BY2 A;  3AFH A;  1VQP I;  1W36 D;  2QEN A;  3DKW A;  5FJ8 J;  5E1W A;  5HNH A;  4A3K J;  1XB4 A;  4RGR A;  2BW3 B;  4ZYD A;  2R7X A;  4I09 A;  1NK2 P;  2NRA C;  3T8R A;  2ADU A;  5FKM A;  1LJ9 A;  2HR3 A;  1W0T A;  2DMT A;  2NNY A;  2R0Q C;  4J00 A;  3S2D J;  4BE0 A;  2EJR A;  3FMR A;  3M8F A;  3RZO J;  4C9Y A;  3H3V K;  2GXA A;  2VJJ A;  1T95 A;  1MNE A;  1GV5 A;  4UV9 A;  2OBP A;  2PX9 A;  1U9O A;  4N4O B;  1W5S A;  1T08 B;  4HNT A;  2EFP A;  1OCP A;  2IW5 A;  3HJE A;  3O6B B;  4A3F J;  2J5P A;  3DLA A;  1FY7 A;  1I6X A;  2M4K A;  2CH0 A;  2P8T A;  3NEU A;  4XMY A;  3HRS A;  1K79 A;  2XAU A;  2A3S A;  5KNL A;  2HYG D;  2JT1 A;  5D6F A;  1BM9 A;  1O7L A;  3AG4 H;  3GZ5 A;  1ZR2 A;  3SHF A;  2IXS A;  4B3X A;  4ON0 A;  1EKE A;  2MD5 A;  4UNO A;  5M5X J;  2V4J C;  1GUU A;  2JN6 A;  3F6V A;  3FKJ A;  2MYS A;  3V42 A;  1B8I B;  1BW5 A;  1TT5 B;  2DQL A;  2HTJ A;  3I54 A;  4WXD A;  2LG4 A;  5BS6 A;  2JA6 J;  1L0O C;  2ZFU A;  3GFM A;  3ZQC A;  4CXF A;  2ZJR F;  3FXK A;  3F9K A;  2CUF A;  4U0W A;  1GT0 C;  3DCF A;  2Q2E A;  3BR2 A;  1LQ1 A;  1UST A;  5ERI A;  4IHV A;  4KDP A;  3W6V A;  1XX5 A;  4Y15 A;  5EEA A;  2IBD A;  2HQN A;  3H9Q A;  4HYE A;  2WY7 Q;  1UG2 A;  2QF7 A;  3R60 A;  2Y69 H;  3C1D A;  3ZMZ A;  2FE3 A;  1QRY A;  2HDD A;  3WU2 C;  3OR1 C;  5FKO A;  1OMI A;  1R49 A;  2R93 J;  2PG4 A;  3EUH C;  1IJW C;  3QPS A;  5LGN A;  1B59 A;  3EUK L;  5K5Q A;  3OIO A;  4BAC A;  5EGO B;  3FWE A;  2KJC A;  1B1B A;  1VF9 A;  5IT9 K;  2ZXW H;  3WGI A;  1LE8 A;  5FRM A;  3A01 A;  3VDX A;  2QQA A;  2WV1 A;  4A3E J;  3FXL A;  1H8A C;  3H1C A;  2AHQ A;  4Y17 A;  2RKH A;  2HNH A;  3QYE A;  1D8K A;  3OR2 C;  5TIS C;  2NVQ J;  5DCF A;  1SAU A;  3IV5 A;  3MWM A;  4A3I J;  2DXI A;  1MH4 A;  2DYS H;  2O0Y A;  3CCY A;  2Q8K A;  2VE9 A;  2KL4 A;  3HG9 A;  3REO A;  2DPU A;  1YS7 A;  2DCE A;  2QGU A;  3GUD A;  1IGN A;  3QQA A;  5F27 A;  4PJ0 C;  3HSR A;  1PDN C;  2WA0 A;  1A04 A;  3V8K A;  3ZRG A;  1XSD A;  4IHW A;  2M3A A;  1JT0 A;  2NS0 A;  3K4J A;  2VE8 A;  2VQL A;  2Y31 A;  3R61 A;  4BKX A;  3G1L A;  5E3N A;  4UXN A;  1N78 A;  3DTE A;  2ZME B;  4IJA A;  3WTT C;  1U0J A;  1ETO A;  3E6C C;  4G7Z F;  1ETQ A;  5HLH A;  3L2Q A;  4RLQ A;  3FMS A;  1YIO A;  2LY2 A;  3OIQ A;  1ZLJ A;  2ZJ2 A;  3AL0 B;  2HOS A;  2Y9Z A;  2VBZ A;  4AD9 A;  1P92 A;  3DKX A;  3KEO A;  4F52 A;  4IX7 A;  4LB5 A;  3OYE A;  4I99 C;  1GVJ A;  2RQQ A;  1YJ9 I;  4JK1 X;  4BU2 A;  5LHH A;  1U78 A;  3AG2 H;  3FMQ A;  3M3Y J;  1OCC H;  1B72 A;  4HF2 A;  1IRX A;  1SAN A;  4C30 A;  4A0Y A;  5M5Y J;  4GGG A;  1ZRF A;  1U8B A;  4ABZ A;  1MMA A;  5IP6 A;  3IL2 A;  3DV8 A;  4RDU A;  1QQI A;  3GCM A;  4KN7 X;  1XGO A;  2F4O B;  1P2F A;  2F4I A;  5F04 A;  1AU7 A;  2D5V A;  5CVI A;  3NRV A;  3VOE A;  2GOX B;  2DA4 A;  1PUF B;  3AG3 H;  3DU5 A;  1GXQ A;  2O8X A;  2OCE A;  3CJQ B;  2HS5 A;  4E7Z A;  1KA8 A;  3LSK A;  1KGS A;  4A3L J;  4B43 A;  2HDC A;  2DYR H;  1H9G A;  1VI0 A;  3U9G A;  4LFU A;  3M1E A;  1ETK A;  2R7T A;  2VXZ A;  4D7M A;  3HHG A;  5CJ9 A;  3OYI A;  2EZL A;  2K40 A;  1F4K A;  1R7J A;  3CDH A;  2WAQ A;  4W1U A;  5IY5 H;  5F64 A;  3KZZ A;  5J47 A;  1VQ4 I;  2H1K A;  1ZRE A;  4LD5 A;  4QTR A;  1MMG A;  2K4J A;  2EFW A;  1IG7 A;  4HV6 A;  2XGX A;  1TBX A;  4O6J A;  4OAZ A;  4BJ6 C;  2DJN A;  2LR8 A;  4JX6 A;  2Z2S B;  2UUZ A;  1SD4 A;  2R5Z B;  1XGM A;  1RC9 A;  3E3V A;  1RPW A;  4L0Z B;  2LH9 A;  1Y0N A;  2LK2 A;  3QOP A;  3MZ8 A;  4NC8 A;  3E5U A;  2VIX A;  3DKY A;  1Y56 A;  1WSU A;  3PL8 A;  3K70 D;  1ZG1 A;  3FK6 A;  2DT5 A;  1S6L A;  3KYL A;  2PMZ N;  4EJT A;  2OF7 A;  1YX5 A;  2ISY A;  3TO9 A;  2K02 A;  1SVM A;  5L3F A;  1K78 B;  3L9F A;  2W48 A;  3VYU B;  2V1D A;  2DOE A;  5J6X A;  4XIC A;  3IP4 B;  5IP9 J;  4BXX J;  2YSR A;  1ENH A;  3G1M A;  3HTU A;  1D0Z A;  2TDX A;  1Y1W J;  4KMF A;  3FKI J;  3QRF F;  3KP5 A;  3KLO A;  2ZNY A;  3FXR A;  1HA8 A;  3CTA A;  3DWL E;  1OR7 C;  2E36 A;  2L4A A;  5EG0 B;  2E60 A;  2V9P A;  2KP6 A;  2ECB A;  3IAM 2;  1R22 A;  1SFU A;  4L18 B;  3PUB A;  1W36 C;  2E2I J;  1V54 H;  3PIO F;  4LB6 B;  3VPR A;  2HKX A;  4EV0 A;  2EIL H;  1Z67 A;  3OMY A;  4HOB A;  4PFP A;  4ZC3 A;  4OIR F;  2UZK A;  3SJM A;  1LFU P;  1DPU A;  3BC8 A;  1DP7 P;  2KDO A;  3QWL A;  4KIF A;  4XNF A;  3ZQG A;  2B63 J;  4M9X A;  5ICF A;  3OYC A;  2HVR A;  3TL4 X;  1UJ8 A;  4XRS A;  3M7G A;  4RM2 A;  2VQH A;  2O3F A;  4JX4 A;  3JRA A;  2IT0 A;  3M8J A;  1HF0 A;  2L0K A;  2IVM A;  2P7C B;  4PUS A;  4XKB A;  4F3Q A;  3ZGK A;  1ZKG A;  2DI3 A;  2EZI A;  3ZQF A;  3Q5F A;  1N77 A;  2LOO A;  2VPR A;  5KAF C;  4I98 B;  3HUG B;  4IRI A;  1Z3Y A;  2M8E A;  1KZH A;  2ZCW A;  4CO8 A;  4CCN A;  2R7V A;  1YW9 A;  3SZP A;  2F5C A;  2NYX A;  1N75 A;  2BY1 A;  2Y0M A;  2H09 A;  2M0M A;  2QQB A;  3BP8 A;  1FBQ A;  1ETW A;  2NOJ B;  4LLL A;  1ZYR F;  2WAE A;  2CYY A;  4RB0 A;  2RGV A;  2M9H A;  1TW2 A;  3C2B A;  3FM5 A;  2H27 A;  3BG7 A;  2MC4 A;  4BYY A;  1IDZ A;  1BI3 A;  1S5L C;  5F1J A;  3O8G A;  2ESH A;  5DEQ A;  3HOX J;  2OQG A;  2XKO A;  3K1N A;  4HQE A;  2L01 A;  2TCT A;  3M4O J;  3QOE A;  3KZY A;  1MD0 A;  2KIF A;  2BE5 F;  1B9N A;  3N05 A;  2D1V A;  4FHT A;  1OR7 A;  1XMK A;  3KP7 A;  1FT9 A;  2LY1 A;  1JKP C;  2VC0 A;  3OS2 A;  3MMY B;  2MLG A;  3BCA A;  4G7O F;  1ITY A;  5LRR A;  4ANJ A;  1BL0 A;  4XID A;  4FE7 A;  2DMQ A;  3ABM H;  4AVZ A;  2IA2 A;  2YX4 A;  4AC0 A;  2X9D A;  4MHG A;  4UV8 A;  4ZTF A;  5E79 C;  2KIM A;  3MD2 A;  1A36 A;  3BT9 A;  2X0L A;  1OJL A;  3JTH A;  1BOA A;  1CF7 A;  1FTZ A;  1PVE A;  1Y1V J;  2ZXJ A;  3K10 A;  3PQK A;  3A4C A;  3EDP A;  4RB2 C;  5FKL A;  1PYV A;  1R5I D;  5HDK A;  2CQK A;  3AAF A;  3RKQ A;  2QKM B;  4BXF A;  3GME A;  3T1B A;  5B1A H;  3F3X A;  4MIM A;  1SFE A;  5BPI A;  3OYB A;  4IZZ A;  4C2T A;  1QBJ A;  1MND A;  1FSE A;  2F6C A;  2V9V A;  2OCC H;  2W7N A;  5EYR A;  2Y9Y A;  2I8D A;  1VTN C;  1ZK8 A;  1OCR H;  2XGC A;  2PEX A;  3OYJ A;  5CLS A;  2UV1 A;  2FSW A;  3V4G A;  1FJL A;  2IEK A;  3KFW X;  1R00 A;  1H0M A;  4LIV A;  1WVR A;  4HNU A;  2IP2 A;  1XN7 A;  1S7E A;  4XRM A;  3WU1 B;  4JX5 A;  3VSK A;  3JSP A;  2A6T A;  1X1D A;  2BYV E;  3BDD A;  4UB8 C;  5GTI C;  3SFI A;  3OYM A;  1JUS A;  4ZZL A;  3HOS A;  4BY1 J;  5FKN A;  3CCR I;  3G71 I;  4BDY A;  3K4B A;  2PLY A;  1LNW A;  2MH2 A;  3EPZ A;  1KYZ A;  5HDN A;  2FXA A;  1O4X A;  4JOM A;  1ZGJ A;  2DT6 A;  5GP9 A;  4XRF A;  1WCM J;  1WI9 A;  4B48 A;  4BQN A;  5ILU A;  5GPC A;  3RZD J;  3I3L A;  4EAT A;  2NOG A;  4BHP A;  4BDZ A;  2VOP A;  1W4M A;  4C3H J;  1T6S A;  5HOO A;  2MBF A;  1Z05 A;  2RV8 A;  4I7H A;  1ERD A;  2ICW G;  2JK3 A;  3IRR A;  3BPX A;  3HEF A;  1RKT A;  2O5R A;  3MZH A;  2GZW A;  4A3J J;  4KIG A;  2FOW A;  3CCV I;  4MO7 A;  2JSP A;  4BEH B;  1E2X A;  1WJD A;  2XF7 A;  4KA4 A;  4UUV A;  3E5Q A;  4YII A;  2Z1D A;  3U1K A;  2V6C A;  3OYF A;  2FNA A;  2VLA A;  1KQ8 A;  1P7I A;  5FD6 A;  2E2H J;  5C4X J;  4OIP F;  2W25 A;  4IHY A;  2EA2 A;  2UWM A;  3IKV A;  1T38 A;  1TZL A;  3H5A A;  4WXC A;  3KZI C;  2XSD C;  3IAS 2;  1SC7 A;  4A3C J;  2L4M A;  1R4N B;  2QSH X;  3GBG A;  4L0Y B;  5J4Y A;  2LKP A;  3FIS A;  1BJZ A;  2H8W A;  2HOT A;  1J09 A;  3S1N J;  4B44 A;  1YI2 I;  3KP6 A;  1E3P A;  4XLN F;  4B8X A;  3SFZ A;  5H20 A;  3TW6 A;  1JE8 A;  2P6S A;  2JA5 J;  4IQ4 A;  4ZYE A;  3K70 C;  3NAU A;  1QZE A;  4XN0 A;  3FIW A;  3J80 Z;  1BR4 A;  1MZB A;  2X48 A;  1R36 A;  3F8N A;  1V5G A;  1CQT A;  2VOD A;  4G12 A;  2AXL A;  4N9H A;  3GF2 A;  3BTI A;  4G8X A;  4QPO A;  1HXD A;  2K5C A;  1ORK A;  3ECH A;  4CH7 A;  2QKL B;  2RNG A;  2V7F A;  5D5V B;  5J3L A;  1BI0 A;  3FF5 A;  1AKH A;  5JHU A;  3CC2 I;  3H3U A;  4CYC A;  2HU9 A;  2BZT A;  4JP0 A;  2XAS A;  4N9I A;  4MQV A;  3GTQ J;  5DS9 A;  4ITV A;  2WBM A;  3RPQ A;  2V79 A;  1DQU A;  3HKZ A;  4A6E A;  1QNT A;  3ZOB A;  4D9J A;  3G2B A;  4KFC A;  1XGN A;  2ZO4 A;  1Y0U A;  3VYR B;  2JMW A;  2R7U A;  4UVC A;  3WTX C;  1R1V A;  4DBR A;  2JA2 A;  2CUJ A;  4MTE A;  3LQQ A;  4F7Z A;  2BHY A;  5K7Z A;  4EM1 A;  4E7S A;  3MFK A;  3GTL J;  4YFK F;  1FPQ A;  2CQX A;  1Y39 A;  3U2R A;  4GDF A;  3JAM Z;  1YRN B;  1WFX A;  4GXO A;  3NAR A;  1OYI A;  1R23 A;  3PJR A;  3PSI A;  2K86 A;  2XKP A;  5JHF A;  1BI2 A;  2L7F P;  3CP2 A;  4GCV A;  4RMN A;  3TP3 A;  2K9S A;  4R8H A;  3QP6 A;  4A0Z A;  4OMY A;  3CES A;  1YFH A;  4EM2 A;  2H6C A;  5A2Q Z;  3E6D A;  1T2K A;  2BXZ A;  3CMA I;  3C2G A;  2HZT A;  3FXQ A;  3LWF A;  4PSW A;  4ETS A;  2F2E A;  5JVG F;  4EM0 B;  3SQN A;  2XRL A;  5DM7 F;  2EV0 A;  1R9T J;  4ZYA A;  4IXA A;  2PN6 A;  3E5X A;  2OC6 A;  1PP8 F;  1ETX A;  1H9T A;  5AIQ A;  4HA8 A;  2EFO A;  2KJB A;  2NXN B;  1X1A A;  3EUA A;  2E1M B;  2M5W A;  5FKK A;  5D5X B;  5L3E A;  4PJJ A;  2DT7 B;  1T56 A;  1YIT I;  2GM4 A;  3HZJ A;  1Z6T A;  1HW2 A;  1EH6 A;  5BQT A;  5IYC J;  1RI7 A;  4EJO A;  5KAI C;  2IAI A;  2VKH A;  5LGU A;  4LLG F;  5C4J J;  4IOC F;  3RIR A;  3QPL A;  3VB2 A;  4CCJ A;  1LDD A;  1SFX A;  2ZJP F;  4U7B A;  2LF7 A;  2PJP A;  2Z9O A;  3HRU A;  2MG4 A;  3I59 B;  1Q1H A;  2YPR A;  4E7I A;  2R92 J;  4EEF G;  1YOV B;  4RAG A;  3J81 K;  5HLT A;  2R7F A;  1DGR M;  3T5X A;  1O3R A;  1FYM A;  3LSP A;  3ZR8 X;  2CW8 A;  3BTC A;  1JKO C;  5LFA A;  4RM3 A;  5K1Y A;  1X2M A;  5GAG J;  4MTD A;  2BGC A;  4S04 A;  3IH2 A;  1FBS A;  3BJO A;  3L09 A;  3PNY A;  1LFB A;  1X19 A;  4L9N A;  1IF1 A;  1MDM A;  4HF1 A;  2KRF A;  3CJN A;  3CCE I;  2KPM A;  3TMO A;  2P5K A;  3H3Z A;  3A0H C;  2O8K A;  3FBI B;  3L2U A;  3I55 I;  5E8G A;  2Q1Z B;  4UY8 I;  1W7P B;  1FIP A;  2DDB A;  4FX0 A;  1FMW A;  2NAZ A;  1FWZ A;  3NWT A;  4I0B A;  4XLC A;  2BHZ A;  3F8B A;  4WCG A;  4M3F A;  4HV5 A;  2WAQ N;  2EV6 A;  3OV8 A;  4BL0 B;  2R5Y A;  4L5J A;  2L3D A;  4KYW A;  1D1A A;  2HGC A;  2L7K A;  1XD7 A;  1V3F A;  2LLK A;  3IH4 A;  2L54 A;  2R7R A;  1B9M A;  3I71 A;  4PDK A;  3BZK A;  4G6D A;  2W57 A;  3VYS B;  2ELJ A;  4A3B J;  1FSH A;  2Z5U A;  3TQN A;  1G8X A;  1RUN A;  4XON A;  1MSF C;  2GBY A;  3K4K A;  5GTH C;  3BR6 A;  5LGT A;  4S05 A;  4BE1 A;  4BBS J;  2M30 A;  4DZJ A;  2K9N A;  4QSH A;  3F6O A;  5H2F C;  1QGP A;  1F9N A;  2HOE A;  2R7Q A;  5M5W J;  3B02 A;  1D8J A;  1UFM A;  1X58 A;  3KYC B;  1J2X A;  1G3W A;  2R4G A;  4XOT A;  1W1W E;  3AKZ A;  4DIQ A;  4MGR A;  1ON1 A;  2FEZ A;  1E3O C;  2OTJ I;  2CJJ A;  2Y30 A;  3WU0 A;  2NS7 A;  4PJL A;  3BCB A;  2QCO A;  1U5T A;  2BW3 A;  3MVP A;  2P7V B;  3F0C A;  2VOO A;  1YS6 A;  2KZG A;  2HXI A;  5M3M J;  3L2R A;  3ABL H;  3CCL I;  3KLN A;  1REP C;  2OTL I;  3WTY C;  3TP0 A;  2GA1 A;  4FTH A;  1DU6 A;  1K4S A;  4II3 A;  2VAS A;  1MBJ A;  2EQR A;  1TNS A;  4XM3 A;  3ZPL A;  2EPF A;  3ZMT A;  1Z6R A;  5GPA A;  1FMV A;  1X1C A;  2KRC A;  4QPQ A;  2PMU A;  4CCL A;  2V9K A;  5F08 A;  1K83 J;  1OYY A;  3CF5 F;  1XPX A;  2O7O A;  3HPG A;  1U9N A;  3MCZ A;  2LBF B;  3WHC A;  2ELK A;  5LEK A;  1D5V A;  3UKG A;  4L9T A;  1DDN A;  1B8I A;  2IGO A;  3RKX A;  4WWC A;  1T8I A;  3GZN B;  5ICG A;  4XR6 A;  5BMZ A;  1MKM A;  1FLI A;  3OS0 A;  3BRO A;  1OKR A;  3PFI A;  2MD0 A;  1A6I A;  2VBW A;  4MQ9 F;  5L3C A;  3GTM J;  2DFF A;  3CC7 I;  1XMA A;  3MN2 A;  1UB9 A;  2ZME C;  4ESJ A;  3JSO A;  3HC7 A;  4DGW B;  2DN0 A;  1O3Q A;  3PIP F;  1HDD C;  1ZLK A;  2STT A;  3AL0 C;  3M9A A;  4E7K A;  2HDW A;  2P0W A;  3H92 A;  1G59 A;  3HL2 A;  3PUF A;  2JRM A;  2GXG A;  2CG4 A;  5C3E J;  3GX4 X;  4KT5 C;  2EIM H;  5L3D A;  1FYL A;  4Z2Y A;  1NHA A;  5TGT A;  1TLH B;  1WRJ A;  4FCY A;  1IDY A;  5J4V A;  3ERE D;  4IQJ A;  2XAH A;  2XVC A;  4UUS A;  4BQA A;  4LG3 A;  5DYM A;  1VQ7 I;  2F5D A;  3F8M A;  2E2J J;  5J40 A;  2XV4 S;  4AM3 A;  5FLV A;  3SZT A;  2E1C A;  2AQF A;  3K2A A;  4P9U A;  2XAJ A;  5EGO A;  1J75 A;  2IS1 A;  3V8J A;  2MW8 A;  2DA7 A;  1VQL I;  2A6H F;  4XLF A;  1Q1V A;  3WTW C;  3EYI A;  3RSN A;  2CV0 A;  4B47 A;  2R7W A;  4KN4 X;  1RKW A;  2LC2 A;  3K4M A;  5E17 F;  4KMU X;  4MLO A;  3EUH A;  3FDY A;  3ZXS A;  1X1B A;  2KIQ A;  3KP3 A;  2KQR A;  3K4C A;  4MNU A;  2MH9 A;  4ESF A;  4DYC A;  1DGW Y;  1ETY A;  4RAF A;  2V1X A;  3W6K B;  4EQQ A;  5EF6 A;  3BPV A;  2QWW A;  2OU2 A;  1PP7 U;  3DPL C;  1HKS A;  1JUP A;  4HAM A;  3LST A;  1I5Z A;  4LIU A;  2W85 A;  3ZQ7 A;  4HPQ A;  2QSG X;  2WY8 Q;  2MLK A;  3W6J B;  4U88 A;  2LF8 A;  5KCM A;  2JVH A;  3G4S I;  5TRD A;  2JUG A;  2VJ5 A;  5FGM A;  2CQN A;  4HW0 A;  4M9Z A;  1R4M B;  2K27 A;  1RIO H;  2QBY A;  3HHH A;  3Q0U A;  2HKO A;  3IKT A;  2G9W A;  4DOZ A;  1WJE A;  3T0Y A;  1BIB A;  1IXR C;  4JQF A;  2ZME A;  1SEU A;  4RB1 A;  2COB A;  2CGP A;  4FET A;  4L5E A;  5JR3 A;  3M1C A;  4XBF A;  4PFO A;  2K3P A;  1HKT A;  3L2V A;  4PJN A;  5IYB J;  5JI6 A;  1A35 A;  3TO7 A;  2ZNZ A;  4YFN F;  3BG9 A;  2AQE A;  3JRH A;  3RKW A;  1IXS B;  5HS9 A;  3VSL A;  4ZH4 F;  2ISZ A;  2O03 A;  4LLN A;  2QEX I;  3KPH A;  4A3G J;  1X2N A;  3K9T A;  1AHD P;  4CCM A;  1S29 A;  4Y52 J;  3SDB A;  4D7N A;  3GZ6 A;  4FX4 A;  2NVU B;  3FXM A;  4J01 A;  4WF2 A;  4BE2 A;  1Z0X A;  2J5O A;  3TOA A;  5FB2 A;  3RQ4 A;  3TED A;  1HQC A;  3MKY B;  2B9S A;  4KT6 A;  2LVS A;  5B1B H;  2WB1 A;  4IKF A;  3L00 A;  1XDU A;  4LG0 B;  3DPU A;  3FM3 A;  4CSW A;  1PUF A;  4W97 A;  3GTJ J;  5LHG A;  2DTZ A;  5J1R A;  1JXS A;  2E5N A;  4V2F A;  2IPQ X;  2QM3 A;  3HM5 A;  1HBX G;  4Y4R A;  2FA5 A;  4XN3 A;  3OY9 A;  3C18 A;  3JRI A;  5GAE J;  2X6W A;  4HLX A;  3OYG A;  3O2P E;  3KE2 A;  2CV2 A;  3RDI A;  1D5Y A;  2OZU A;  3B73 A;  1JJ8 C;  1G3S A;  5JFR A;  3E1S A;  3V8L A;  5F1R A;  2K7L A;  4DBQ A;  1ONV A;  1ZGW A;  3RQI A;  2PFB A;  4CZZ A;  2P5L C;  2QLZ A;  1XMX A;  3QP5 A;  1D1C A;  4N4N B;  3OYK A;  3OL3 A;  2X6Y A;  2IA1 A;  3LL7 A;  2WAF A;  2HYF A;  3EYY A;  3HGG A;  4R1H A;  2W84 A;  3WTU C;  2HQ5 A;  1G4D A;  2CWE A;  3V7R A;  3BLY A;  1F36 A;  2ECC A;  1O3S A;  4L9J A;  2HPI A;  1IN8 A;  2FOK A;  5GAD J;  4HLY A;  4Q48 A;  1XC5 A;  2L9N A;  2RVC A;  4IHT A;  1FEX A;  3WE3 A;  1UEL B;  2EFQ A;  3MQ0 A;  3BG6 A;  3HTS B;  3HB9 A;  3P9I A;  2Z99 A;  1K78 A;  3WOD F;  1R6R A;  1MSE C;  2FF4 A;  3HOW J;  3H0D A;  2EZH A;  3P7N A;  3MKZ A;  2EBI A;  2NS8 A;  3TOB A;  3HYI A;  4AYB A;  2K3F A;  3KP4 A;  3SYT A;  2BY0 A;  4A12 A;  1K7A A;  2YUS A;  3M8E A;  2A5W A;  3HGY A;  5F6F A;  1X3W B;  4DZP A;  2CQ7 A;  1A6Q A;  4V19 K;  1ZQ3 P;  3MKW B;  1NG7 A;  1RUO A;  3DTI A;  3W3C A;  5DUK A;  4X1E A;  4GYI A;  3ZQQ A;  2DBB A;  1CF7 B;  2O6G E;  2XPV A;  1POG A;  4M71 A;  2IGK A;  1MNM C;  1ZRD A;  3S93 A;  2FD5 A;  2OPT A;  1FC3 A;  1J9I A;  5LBQ A;  4CCK A;  2D2W A;  4HG2 A;  5FLM J;  4LK0 F;  1SFK A;  4OU0 A;  1SD6 A;  1ZRC A;  5DV5 A;  1D3Y A;  1QHG A;  4NQW B;  1JJ6 C;  1SD5 A;  2CFX A;  4NDL A;  2XB5 A;  4RGU A;  2PBI A;  3H5R A;  2HQR A;  2DFH A;  3KYD B;  1IO2 A;  5D8L B;  3ESW B;  3HKZ N;  2W4S A;  5HS7 A;  2IGN A;  4RAY A;  1W7P D;  3BQZ A;  1A31 A;  1MBG A;  3CZ6 A;  4DW6 A;  2E35 A;  2VKV A;  3HUG A;  1MH3 A;  3S15 J;  5EJC A;  3WG7 H;  3PSF A;  4XKC A;  2VKD A;  2CSO A;  1SAX A;  3GFJ A;  3GO5 A;  3Q9V A;  2XRN A;  1FX7 A;  3GXO A;  3GYH X;  1TWC J;  4MEX F;  1WGX A;  4A69 C;  3I58 A;  1IXC A;  2N8G A;  3V7S A;  4PK4 A;  1IAW A;  1G6N A;  1LDJ A;  3LA7 A;  1YX3 A;  4A3M J;  1LFP A;  4U7D A;  4U0V A;  1R1U A;  1BBY A;  1IV8 A;  1T98 A;  2X6O A;  2PI0 A;  4P55 A;  1YYV A;  2ACJ A;  1S9H A;  5IOZ A;  1OCZ H;  2CQQ A;  2V1N A;  3RJP A;  5E1X A;  2JPB A;  3HSF A;  4ENK A;  2HPM A;  3HXL A;  2CMP A;  2Z33 A;  4XSX F;  3F23 A;  1E0E A;  4MFD A;  2E1N A;  5J1U A;  5BNG A;  3HOV J;  1VND A;  3IWZ A;  4RGS A;  4DYR A;  3I0T A;  4Z6Y A;  3S8P A;  2RDP A;  3EET A;  2ZBK A;  3VOD A;  3LNQ A;  1ZR4 A;  1LB2 A;  5M3F J;  3GTK J;  4IF4 A;  4ZDL A;  5F0F A;  4HNV A;  3M07 A;  2BV6 A;  1JHF A;  5CVJ A;  4A93 J;  1TQI A;  3CCS I;  1QZY A;  1ODD A;  2CUE A;  1JTY A;  1WJA A;  3BZ6 A;  4NC6 A;  4L5I A;  2A07 F;  2NVX J;  3H9J A;  3E6M A;  2VBY A;  2PMZ A;  2GQQ A;  1MJ9 A;  2X4H A;  2KT0 A;  3DEE A;  3ZMV A;  1VFC A;  5CQG A;  4GYG A;  4I0A A;  2P81 A;  3HRT A;  2JUC A;  3P5J A;  2NNN A;  3Q9S A;  3QOD A;  2I5U A;  4Q4Z F;  1ZH5 A;  1YTY A;  2ZB9 A;  1P9Q C;  4DYQ A;  4C2U A;  1ZHF A;  1JHH A;  2DA2 A;  4YRV A;  3CO6 C;  2VJ4 A;  2H1L A;  3A02 A;  2D45 A;  5KVR A;  2IA0 A;  1F1Z A;  4MFE A;  3CDI A;  1P7J A;  3CUQ B;  3LSR A;  3TKY A;  2XDV A;  1P4W A;  2L9S A;  4OOI A;  1FP1 D;  3C7J A;  3V7C A;  4WX9 A;  3ZQL A;  4D5C A;  4PZJ A;  4OMZ A;  4PGH A;  1YG2 A;  1TQP A;  4D0P A;  4OIN F;  3B6C A;  4OIQ F;  1Z7L A;  4G6T B;  3FZV A;  4HX7 A;  1LEA A;  1MMN A;  4Y13 A;  2ZXH A;  1SD7 A;  4EVI A;  5CQE A;  1KQ9 A;  1YW8 A;  3ULQ B;  3HOZ J;  3PM1 A;  1X4P A;  1QA6 A;  2X1C A;  2Z16 A;  3MAJ A;  4A6D A;  3L1P A;  2M7B A;  3LAJ A;  4LJZ F;  3ASN H;  3ABK H;  2DA5 A;  2JWT A;  2GLO A;  5L3B A;  2L7Z A;  1MGT A;  3I5U A;  4BNC A;  1H88 C;  2MA3 A;  2ZKZ A;  4D1Q A;  2CO5 A;  3FHN A;  2FNP A;  1X3U A;  3I4P A;  2FQ4 A;  4AVP A;  1YQA A;  1C0W A;  3S3M A;  2CU7 A;  5CVU A;  2G7H A;  3J7A Y;  3LSH A;  2PJR B;  3VEP A;  2E7W A;  1I1S A;  1NG6 A;  3CD6 I;  2GXB A;  2LRE A;  1G2H A;  2D1H A;  4PCQ A;  3K6G A;  1HOM A;  2VN2 A;  3ISP A;  3UR3 C;  4DNC A;  4CDG A;  3A1Y A;  2DOF A;  3WTZ A;  1GHC A;  2WC2 A;  1EA3 A;  3K4N A;  4M74 A;  3ABU A;  2MFZ A;  3OSF A;  1ON2 A;  1V4R A;  4E7J A;  1PUE E;  2BXY A;  2CV1 A;  4F92 B;  5FRO A;  3MKL A;  5E20 A;  4XLA A;  3G1O A;  3IH3 A;  4BH9 A;  4BJ5 C;  4RAZ A;  2K9M A;  5HLI A;  4QWQ A;  4QLC U;  2V26 A;  3DF8 A;  1R5H A;  3J80 K;  2LD5 A;  4HBL A;  4M3B A;  4EMS A;  3E7L A;  1VQN I;  1BR1 A;  3D0S A;  1S7O A;  2E1M C;  5E3O A;  2H8R A;  1MBE A;  1UHM A;  4J19 A;  2DA3 A;  3ZQH A;  1GLN A;  5DCM A;  1MJA A;  4KJZ A;  4F55 A;  3I4N J;  1DP3 A;  1LVA A;  1VQK I;  3WGG A;  2KIS A;  1P4X A;  3BR0 A;  4IVN A;  4E7L A;  4M3E A;  4XOP A;  3GTO J;  3Q0W A;  3GWZ A;  4XK4 A;  1MDM B;  1RRJ A;  4HEA 2;  1TWF J;  3DLL F;  1JGG A;  3ASO H;  5JVT A;  3BOQ A;  4U0Y A;  3S1R J;  1UHS A;  3R4K A;  5CVR A;  5IOY A;  3RI4 A;  2A05 A;  5ILV A;  1V5F A;  5CVV A;  1OCO H;  3TDU C;  1D1B A;  2BEO A;  2W82 A;  3P9K A;  3RYR A;  1PJR A;  4ZJZ A;  4ZDO A;  1AA7 A;  2BVL A;  4II2 A;  2K9L A;  3I9V 2;  3B6A A;  3A0B C;  4K2E A;  5FD5 A;  5FRN A;  3I4M J;  2KMU A;  2QQ9 A;  3RCO A;  1QO0 D;  4BY7 J;  3QPT A;  3ZMU A;  5HOD A;  2KRH A;  3ONQ A;  2KHM A;  1YRN A;  2ZSI B;  3HBL A;  4G9Y A;  3FBN B;  4A0X A;  2P5V A;  2W00 A;  5K7H A;  2EFN A;  1WQ2 A;  4IO9 F;  1BIA A;  2CS3 A;  1BN5 A;  1BOB A;  3RKY A;  3JRB A;  3K69 A;  4LMY A;  4E4H A;  3FXO A;  5DDG A;  5A2Q K;  1HST A;  2DPD A;  4P9F A;  1HDP A;  1Y8Q B;  2QYO A;  4V2G A;  1W0U A;  3NQO A;  4ASN A;  2DO7 A;  1Z7U A;  2YR2 A;  2LYC A;  2R3S A;  4Y33 A;  4RB3 C;  1G3T A;  4JBA A;  2CW0 F;  1XTA A;  2Q2E B;  1YE9 A;  1FIA A;  1EF4 A;  2VPL A;  1FYK A;  2TRT A;  3KEY A;  3QU3 A;  3PNV A;  2Y0S A;  1I6H J;  1U5T B;  1JT6 A;  2GAU A;  1ETV A;  2A6E F;  1B4A A;  3K0L A;  1RES A;  1O57 A;  3FX3 A;  3F21 A;  5D4S A;  1EH8 A;  1BC8 C;  2XUB A;  1JKQ C;  2NVY J;  4UVA A;  3I59 A;  4HQM A;  5HDG A;  1YW7 A;  2WAD A;  3MZY A;  4HDU A;  2DU9 A;  2M1B A;  3CME I;  2W1O A;  1HCR A;  5AON A;  1ZAO A;  3OOP A;  2CRG A;  2R7S A;  2A61 A;  5IT9 Z;  1LE8 B;  3JTG A;  2FMY A;  3A01 B;  3K1P A;  3ZCO A;  2XRO A;  5F0H A;  2BVM A;  4ZYH A;  3CCJ I;  2JRT A;  1DU0 A;  1FTT A;  1ZG5 A;  1I1G A;  2WB1 N;  3K7A J;  2QUF A;  4B3A A;  4ZYG A;  4NHJ A;  1TWG J;  2ZXI A;  5K5O A;  1S7A A;  1DPR A;  1S72 I;  2OQR A;  1TNT A;  3DEW A;  3GTG J;  2YS9 A;  2VJI A;  5E1Z B;  3SDG A;  4XKV A;  3COA C;  2VB6 A;  4XLP F;  1T0F C;  3DP7 A;  1GVD A;  1W7P A;  5D8K B;  1FOK A;  5ILS A;  2F5F A;  4M73 A;  2XAG A;  2L9V A;  2CW7 A;  4KUM A;  1R58 A;  5IYD J;  1Y8R B;  3CO7 C;  2OAZ A;  3ERM A;  4A5N A;  3PO3 J;  5LEJ A;  6PAX A;  4OIO F;  3R0A A;  4YEJ A;  1VQO I;  1NH3 A;  2FU4 A;  2KZV A;  1WJF A;  4CGZ A;  3OYL A;  3TW7 A;  1ZGA A;  4UUS B;  4RS8 A;  2LNB A;  4O5V A;  3D1N I;  3ROU A;  1WPK A;  4IEJ A;  4IRG A;  1WKM A;  2DFE A;  4P1W A;  1X4O A;  3QYB A;  4XSZ F;  3TO6 A;  3OYH A;  3BJA A;  4BXU A;  2MSY A;  3C2H A;  3H9G A;  3R6S A;  1V55 H;  1B6A A;  4HX4 A;  1X3Z B;  1UCR A;  2LMD A;  2RC4 A;  4L9V A;  2QSF X;  1I27 A;  4IHS A;  4C3J J;  1B72 B;  2EK5 A;  1TT0 A;  3DQV C;  3ZP5 A;  3SEZ A;  4BQQ A;  4M3G A;  2M87 A;  4BBR J;  4AYB N;  2QVO A;  2ZC2 A;  2XHK A;  1QU3 A;  5C44 J;  2L5Q A;  3H36 A;  2Y2Z A;  4OWR B;  4YG2 F;  3CCQ I;  2FML A;  3IUO A;  2E1O A;  1BC7 C;  2O9L A;  1UG0 A;  2JPC A;  1J59 A;  2FBK A;  2MGQ A;  4XLE A;  1OFC X;  2HI3 A;  2ME0 A;  3E97 A;  1YLF A;  3G6E I;  3CF2 A;  1W5T A;  2Q0O A;  2JJ7 A;  2L7M P;  3DU6 A;  3KP2 A;  4YEL A;  1HSJ A;  2HYJ A;  3QAH A;  3SEQ A;  2QBY B;  3RTR A;  2EZK A;  4IL6 C;  2RN7 A;  2EIJ H;  4I2O A;  1SVL A;  5EZG A;  2AXT C;  1T0F A;  2V1U A;  4XRS G;  4HX8 A;  5BPD A;  2IGM A;  3DEU A;  3A03 A;  1STZ A;  3LA2 A;  2LBF A;  1GXP A;  2L02 A;  2M45 A;  2RNJ A;  5CYV A;  3I64 A;  3JRF A;  1W5C C;  4FIS A;  1FBU A;  3NWS A;  3JRC A;  1IRF A;  3OL4 A;  5FFZ A;  4BHC A;  4XQF A;  3ZN1 A;  1MJB A;  2E5Z A;  2BY3 A;  4CCO A;  4Y7N J;  4EGY A;  5FFX A;  2E19 A;  2VQC A;  1XS9 A;  4C2M J;  4FAS D;  1F43 A;  3OWT A;  5EEG A;  1P4A A;  3GLL A; 
#chains in the Genus database with same CATH homology
 2AS5 F;  2DW4 A;  2R7D A;  1HW5 A;  4A2U A;  3GVA A;  3LA3 A;  2DQR A;  4M6X A;  3WG9 A;  5ICC A;  3WTV C;  1TW3 A;  1R1T A;  1BI1 A;  1XDS A;  2LDU A;  3GFL A;  5D4R A;  1S3J A;  3WE2 A;  1KU3 A;  2WWY A;  5KK1 A;  1RZ4 A;  3F72 A;  3HSE A;  3JW4 A;  5ICE A;  4P5O A;  4AIJ A;  1U8R A;  3FXU A;  3JAM K;  2GIV A;  4M6Y A;  2IRF G;  2E7X A;  2DK8 A;  1KQ0 A;  3DPT A;  5DUI A;  1FNN A;  4KNY A;  3ELK A;  3KCC A;  2YX7 A;  1USS A;  2COM A;  2VT3 A;  3HRM A;  1EH7 A;  1J0R A;  4RGX A;  1KU7 A;  2KKO A;  2QZ8 A;  4IRH A;  4EGZ A;  3G73 A;  1T39 A;  2K4B A;  3TDZ C;  4I01 A;  2C6Y A;  4CHU A;  2PMH A;  4I02 A;  4ENJ A;  1QPM A;  5D5W B;  4KIC A;  4EJU A;  4LG0 A;  3IHU A;  5HLG A;  4HZF A;  4EJV A;  1XCB A;  4P96 A;  4GO1 A;  2BBY A;  2EB7 A;  2LSO A;  2EA4 A;  3T8T A;  3DXJ F;  4HDV A;  5E18 F;  1DUX C;  4PGG A;  3R0J A;  2FRH A;  5EEH A;  3HIF A;  4O3M A;  2EV5 A;  4IPA A;  2VBX A;  5LRS A;  5LHI A;  1AOY A;  3VFZ A;  2FQ3 A;  1SMT A;  4AIK A;  2OZ6 A;  1OYW A;  3N97 A;  1FZP B;  3RYP A;  1JGS A;  2EWN A;  1IN7 A;  1L3L A;  5J8C A;  2F5E A;  2ESN A;  3ECO A;  3ABT A;  2HTS A;  1KYW A;  2W24 A;  4UVB A;  5ED4 A;  3GEZ A;  3GLX A;  2HEO A;  3O3K A;  4EJW A;  5HVQ C;  3K1M A;  2VT2 A;  1XSV A;  2DLL A;  1FP2 A;  3SXY A;  2JTV A;  3TGN A;  3QPH A;  3LQR A;  3N4M A;  2PQ8 A;  3LFK A;  4M9S A;  2GWR A;  4KIB A;  5IT3 A;  5D6E A;  2P6T A;  5AIP A;  4NQW A;  2GA2 A;  4YIF A;  2JSC A;  1O3T A;  4LGW A;  3WTS C;  4AIH A;  1XGS A;  3P9C A;  3E6B A;  2A5Y B;  4M72 A;  1J5Y A;  2YU3 A;  4NB5 A;  4Q5S F;  4H0E A;  1IN6 A;  1R5G A;  3GW2 A;  3IWF A;  3K2Z A;  1ZG3 A;  3CUQ C;  1XCV A;  2RQP A;  4R79 A;  2HFH A;  1IN5 A;  3ZMS A;  1KU9 A;  5FLX Z;  3IRQ A;  2IJL A;  1U2W A;  1SMY F;  3ML6 A;  5J8F A;  3LAP A;  3BJ6 A;  2OA4 A;  2ETH A;  3IC7 A;  2XIG A;  2WTE A;  1XSX A;  2Y48 A;  3L7W A;  1IUY A;  1E17 A;  1EV7 A;  3J7A O;  2O61 A;  1AWC A;  2VON A;  1P6R A;  1WWX A;  4WK8 F;  2STW A;  2JZY A;  2VC1 A;  1Z9C A;  5H6R A;  4YFX F;  5H6Q A;  2DFI A;  2ZFW A;  3GFI A;  2UXX A;  2Z3Y A;  2KIU A;  3ZN0 A;  3QU6 A;  4E70 A;  2UXN A;  1F5T A;  4DQ2 A;  4FT8 A;  1Z1D A;  3F8C A;  5FLX K;  3CLO A;  3C3W A;  5DD8 A;  3KET A;  2ELH A;  2OD5 A;  4ENM A;  1HW1 A;  2XAF A;  4BHB A;  1HKQ A;  3CUQ A;  4UHT A;  1RNL A;  2WV0 A;  4TV7 A;  5DCM B;  1BJA A;  3EQL F;  1IRG A;  5TJJ A;  1IZ1 A;  2MC3 A;  2HWV A;  1U3E M;  3F8F A;  1QZZ A;  4ENN A;  1O7F A;  1S8N A;  4ESB A;  5FO5 A;  4B09 A;  2DK5 A;  3PQJ A;  4ZZD A;  3RPU A;  4HF0 A;  2DAO A;  1KU2 A;  2Y75 A;  3I53 A;  1U6G A;  1TTY A;  5BOX A;  1ULY A;  2XAQ A;  5HS8 A;  3J81 Z;  4A5M A;  4N0B A;  3D5L A;  1J7K A;  3U1D A;  3BWG A;  1LEB A;  3CUO A;  5K5R A;  2A69 F;  2H94 A;  4WXH A;  5L3G A;  1IW7 F;  4G7H F;  1CGP A;  3L2C A;  3DFG A;  2FBI A;  3WGH A;  3S2W A;  1YO5 C;  4MEY F;  1OPC A;  1ZN2 A;  4CYD A;  1LDK B;  1UHW A;  1TQM A;  1IN4 A;  2FBH A;  2G7U A;  4LK1 F;  4Q47 A;  3ZMD A;  5LLQ A;  3BY6 A;  1ZAR A;  4AWX B;  1G3Y A;  3MEX A;  4BAY A;  5E8I A;  5DD4 A;  5D5U B;  4G94 A;  2DTR A;  2P4W A;  4G6Q A;  3FHZ A;  1Z91 A;  2A68 F;  1U5T C;  3KEQ A;  2H6B A;  4CIC A;  3F22 A;  3HOT A;  1K6O A;  2B0L A;  3G3Z A;  2QEN A;  3DKW A;  5E1W A;  1XB4 A;  4RGR A;  4ZYD A;  4I09 A;  2NRA C;  3T8R A;  2ADU A;  1LJ9 A;  2HR3 A;  2NNY A;  2EJR A;  3FMR A;  3M8F A;  4UV9 A;  2OBP A;  1W5S A;  2EFP A;  2IW5 A;  3O6B B;  2J5P A;  1FY7 A;  1I6X A;  3NEU A;  2P8T A;  3HRS A;  1K79 A;  2A3S A;  2HYG D;  2JT1 A;  5D6F A;  1BM9 A;  1O7L A;  3GZ5 A;  3SHF A;  4ON0 A;  2MD5 A;  4UNO A;  3F6V A;  2DQL A;  2HTJ A;  3I54 A;  4WXD A;  5BS6 A;  1L0O C;  3GFM A;  4CXF A;  4U0W A;  2Q2E A;  1LQ1 A;  1UST A;  5ERI A;  4KDP A;  4Y15 A;  2HQN A;  4HYE A;  3R60 A;  3C1D A;  3ZMZ A;  2FE3 A;  1OMI A;  2PG4 A;  5LGN A;  1B59 A;  5K5Q A;  3FWE A;  2KJC A;  1B1B A;  5IT9 K;  3WGI A;  2QQA A;  4Y17 A;  2RKH A;  1D8K A;  5DCF A;  3MWM A;  2O0Y A;  2Q8K A;  2VE9 A;  3REO A;  2DPU A;  1YS7 A;  3GUD A;  3HSR A;  1PDN C;  1A04 A;  3V8K A;  1XSD A;  2NS0 A;  2VE8 A;  3R61 A;  4UXN A;  2ZME B;  4IJA A;  3WTT C;  3E6C C;  4G7Z F;  5HLH A;  3FMS A;  1YIO A;  1ZLJ A;  2ZJ2 A;  2VBZ A;  4AD9 A;  1P92 A;  3KEO A;  4LB5 A;  1GVJ A;  4JK1 X;  5LHH A;  1U78 A;  3FMQ A;  4HF2 A;  4A0Y A;  4GGG A;  1ZRF A;  3IL2 A;  3DV8 A;  1QQI A;  4KN7 X;  1XGO A;  1P2F A;  5CVI A;  3NRV A;  3VOE A;  1GXQ A;  2O8X A;  2HS5 A;  1KA8 A;  1KGS A;  2HDC A;  1H9G A;  3U9G A;  4LFU A;  3M1E A;  2VXZ A;  3HHG A;  5CJ9 A;  1F4K A;  1R7J A;  3CDH A;  5F64 A;  3KZZ A;  1ZRE A;  4LD5 A;  2K4J A;  2EFW A;  4HV6 A;  2XGX A;  1TBX A;  4O6J A;  1SD4 A;  1XGM A;  3E3V A;  4L0Z B;  3QOP A;  3E5U A;  1WSU A;  1ZG1 A;  2DT5 A;  1S6L A;  4EJT A;  2ISY A;  3TO9 A;  2K02 A;  5L3F A;  1K78 B;  3L9F A;  2V1D A;  5J6X A;  2YSR A;  3HTU A;  2TDX A;  4KMF A;  3QRF F;  3KP5 A;  3KLO A;  2ZNY A;  3FXR A;  3CTA A;  2L4A A;  1R22 A;  1SFU A;  4L18 B;  4LB6 B;  2HKX A;  4EV0 A;  4HOB A;  4OIR F;  2UZK A;  1DPU A;  1DP7 P;  4KIF A;  4M9X A;  5ICF A;  3M7G A;  2IT0 A;  2O3F A;  2IVM A;  2P7C B;  2DI3 A;  3Q5F A;  4I98 B;  4IRI A;  2M8E A;  2ZCW A;  4CO8 A;  1YW9 A;  3SZP A;  2F5C A;  2NYX A;  2Y0M A;  2H09 A;  2QQB A;  3BP8 A;  1FBQ A;  4LLL A;  1ZYR F;  2CYY A;  2RGV A;  1TW2 A;  3FM5 A;  2H27 A;  4BYY A;  1BI3 A;  2ESH A;  5DEQ A;  2OQG A;  2XKO A;  3K1N A;  4HQE A;  2L01 A;  3KZY A;  1MD0 A;  2KIF A;  2BE5 F;  1B9N A;  2D1V A;  4FHT A;  1OR7 A;  1XMK A;  3KP7 A;  1FT9 A;  2VC0 A;  2MLG A;  4G7O F;  5LRR A;  2IA2 A;  2YX4 A;  4MHG A;  4UV8 A;  2KIM A;  2X0L A;  3JTH A;  1BOA A;  1CF7 A;  2ZXJ A;  3PQK A;  3EDP A;  4RB2 C;  5HDK A;  2CQK A;  3AAF A;  3T1B A;  3F3X A;  5BPI A;  1SFE A;  1QBJ A;  1FSE A;  2V9V A;  1VTN C;  2PEX A;  5CLS A;  2FSW A;  3V4G A;  3KFW X;  1R00 A;  1H0M A;  2IP2 A;  1XN7 A;  3WU1 B;  3JSP A;  2BYV E;  3BDD A;  4ZZL A;  3HOS A;  2PLY A;  1LNW A;  2MH2 A;  1KYZ A;  5HDN A;  2FXA A;  1ZGJ A;  5ILU A;  4XRF A;  1WI9 A;  4BHP A;  2VOP A;  1W4M A;  1T6S A;  5HOO A;  2MBF A;  1Z05 A;  2RV8 A;  4I7H A;  3IRR A;  3BPX A;  3MZH A;  2GZW A;  4KIG A;  1E2X A;  4KA4 A;  4UUV A;  3E5Q A;  4YII A;  2V6C A;  2FNA A;  1KQ8 A;  5FD6 A;  4OIP F;  2W25 A;  2EA2 A;  2UWM A;  3IKV A;  1T38 A;  4WXC A;  2L4M A;  4L0Y B;  2LKP A;  3KP6 A;  4B8X A;  4XLN F;  3SFZ A;  5H20 A;  1JE8 A;  2P6S A;  4ZYE A;  3J80 Z;  1MZB A;  1R36 A;  3F8N A;  2VOD A;  2AXL A;  4N9H A;  3GF2 A;  4G8X A;  1HXD A;  3ECH A;  5D5V B;  1BI0 A;  3FF5 A;  5JHU A;  3H3U A;  2XAS A;  4N9I A;  4MQV A;  3RPQ A;  2V79 A;  4A6E A;  1QNT A;  4KFC A;  1XGN A;  2ZO4 A;  1Y0U A;  4UVC A;  3WTX C;  1R1V A;  4MTE A;  3LQQ A;  4F7Z A;  4EM1 A;  3MFK A;  4YFK F;  1FPQ A;  3U2R A;  4GXO A;  1OYI A;  1R23 A;  2K86 A;  2XKP A;  1BI2 A;  4GCV A;  4R8H A;  3QP6 A;  4A0Z A;  4OMY A;  1YFH A;  4EM2 A;  2H6C A;  5A2Q Z;  3E6D A;  1T2K A;  2HZT A;  3FXQ A;  3LWF A;  4ETS A;  2F2E A;  4EM0 B;  3SQN A;  2EV0 A;  4IXA A;  2PN6 A;  3E5X A;  1PP8 F;  1H9T A;  5AIQ A;  4HA8 A;  2EFO A;  2KJB A;  5L3E A;  2M5W A;  5D5X B;  1Z6T A;  1HW2 A;  1EH6 A;  5BQT A;  1RI7 A;  4EJO A;  5LGU A;  4LLG F;  3RIR A;  3VB2 A;  1LDD A;  1SFX A;  4U7B A;  2LF7 A;  2PJP A;  2Z9O A;  3HRU A;  3I59 B;  1Q1H A;  2YPR A;  3J81 K;  2R7F A;  1FYM A;  3T5X A;  1O3R A;  5K1Y A;  4MTD A;  2BGC A;  4S04 A;  1FBS A;  3BJO A;  3L09 A;  4L9N A;  1IF1 A;  1MDM A;  4HF1 A;  2KRF A;  3CJN A;  2P5K A;  3H3Z A;  5E8G A;  1W7P B;  4FX0 A;  2NAZ A;  1FWZ A;  4I0B A;  3F8B A;  4WCG A;  4HV5 A;  2EV6 A;  3OV8 A;  4L5J A;  2L3D A;  4KYW A;  2HGC A;  1XD7 A;  1V3F A;  2L54 A;  1B9M A;  3I71 A;  4PDK A;  4G6D A;  2W57 A;  1FSH A;  2Z5U A;  3TQN A;  1RUN A;  5LGT A;  4S05 A;  2M30 A;  3F6O A;  1QGP A;  1F9N A;  2HOE A;  3B02 A;  1D8J A;  1UFM A;  1J2X A;  1G3W A;  4MGR A;  1ON1 A;  2FEZ A;  3WU0 A;  1U5T A;  2P7V B;  2VOO A;  1YS6 A;  3KLN A;  1REP C;  3WTY C;  2GA1 A;  1TNS A;  3ZPL A;  3ZMT A;  1Z6R A;  2PMU A;  1OYY A;  3MCZ A;  5LEK A;  1D5V A;  4L9T A;  1DDN A;  3RKX A;  4WWC A;  5ICG A;  5BMZ A;  1MKM A;  1FLI A;  3BRO A;  1OKR A;  3PFI A;  2VBW A;  4MQ9 F;  5L3C A;  1XMA A;  1UB9 A;  4ESJ A;  3JSO A;  1O3Q A;  1ZLK A;  2STT A;  3M9A A;  3H92 A;  2GXG A;  2CG4 A;  3GX4 X;  4KT5 C;  1FYL A;  5L3D A;  4Z2Y A;  1NHA A;  1TLH B;  1WRJ A;  3ERE D;  2XAH A;  2XVC A;  4BQA A;  5DYM A;  2F5D A;  3F8M A;  2XV4 S;  3SZT A;  2E1C A;  4P9U A;  2XAJ A;  1J75 A;  3V8J A;  2A6H F;  3WTW C;  3EYI A;  4KN4 X;  5E17 F;  4KMU X;  3EUH A;  3KP3 A;  4MNU A;  2MH9 A;  4ESF A;  2V1X A;  3W6K B;  4EQQ A;  3BPV A;  2QWW A;  2OU2 A;  1PP7 U;  3DPL C;  1HKS A;  4HAM A;  3LST A;  1I5Z A;  2W85 A;  3ZQ7 A;  2MLK A;  3W6J B;  4U88 A;  2LF8 A;  5TRD A;  5FGM A;  4HW0 A;  4M9Z A;  2K27 A;  1RIO H;  2QBY A;  3HHH A;  3IKT A;  2HKO A;  2G9W A;  3T0Y A;  1BIB A;  1IXR C;  4JQF A;  2ZME A;  4RB1 A;  2CGP A;  5JR3 A;  4XBF A;  1HKT A;  5JI6 A;  3TO7 A;  2ZNZ A;  4YFN F;  3RKW A;  1IXS B;  5HS9 A;  4ZH4 F;  2ISZ A;  2O03 A;  4LLN A;  3K9T A;  1S29 A;  3GZ6 A;  4FX4 A;  4WF2 A;  2J5O A;  3TOA A;  5FB2 A;  1HQC A;  3L00 A;  1XDU A;  4LG0 B;  3FM3 A;  5LHG A;  1JXS A;  2IPQ X;  2QM3 A;  1HBX G;  2FA5 A;  3C18 A;  4HLX A;  3O2P E;  3KE2 A;  3RDI A;  2OZU A;  3B73 A;  1G3S A;  5JFR A;  3V8L A;  5F1R A;  2K7L A;  1ONV A;  2PFB A;  4CZZ A;  2P5L C;  2QLZ A;  3QP5 A;  2IA1 A;  3EYY A;  2HYF A;  4R1H A;  2W84 A;  3WTU C;  1G4D A;  2CWE A;  3V7R A;  1O3S A;  4L9J A;  1IN8 A;  1P4A A;  2FOK A;  4HLY A;  4Q48 A;  2RVC A;  4IHT A;  3WE3 A;  2EFQ A;  3MQ0 A;  3HTS B;  3P9I A;  2Z99 A;  1K78 A;  3WOD F;  2FF4 A;  3P7N A;  3TOB A;  3HYI A;  3KP4 A;  4A12 A;  1K7A A;  3M8E A;  5F6F A;  1RUO A;  5DUK A;  4GYI A;  2DBB A;  1CF7 B;  2O6G E;  4M71 A;  1ZRD A;  1FC3 A;  1J9I A;  5LBQ A;  2D2W A;  4LK0 F;  4OU0 A;  1SD6 A;  1ZRC A;  5DV5 A;  1D3Y A;  1SD5 A;  2CFX A;  4RGU A;  2PBI A;  2HQR A;  5D8L B;  5HS7 A;  4RAY A;  1W7P D;  3HUG A;  2CSO A;  1SAX A;  3GFJ A;  3GO5 A;  3Q9V A;  2XRN A;  1FX7 A;  3GXO A;  3GYH X;  4MEX F;  3I58 A;  1IXC A;  3V7S A;  1IAW A;  1G6N A;  1LDJ A;  3LA7 A;  4U7D A;  4U0V A;  1R1U A;  1BBY A;  1T98 A;  2PI0 A;  4P55 A;  1YYV A;  2ACJ A;  4ENK A;  3RJP A;  5E1X A;  2JPB A;  3HSF A;  2Z33 A;  4XSX F;  3F23 A;  2E1N A;  3IWZ A;  4RGS A;  3I0T A;  2RDP A;  3EET A;  2ZBK A;  3VOD A;  1LB2 A;  4IF4 A;  2BV6 A;  1JHF A;  5CVJ A;  1TQI A;  1QZY A;  1ODD A;  3BZ6 A;  4L5I A;  2A07 F;  3E6M A;  2VBY A;  2GQQ A;  1MJ9 A;  2X4H A;  3ZMV A;  4GYG A;  4I0A A;  3HRT A;  2NNN A;  3Q9S A;  4Q4Z F;  1ZH5 A;  1YTY A;  1ZHF A;  1JHH A;  3CO6 C;  2D45 A;  5KVR A;  2IA0 A;  1F1Z A;  3CUQ B;  3TKY A;  1P4W A;  4OOI A;  1FP1 D;  3C7J A;  3V7C A;  4WX9 A;  4PZJ A;  4OMZ A;  4PGH A;  1YG2 A;  1TQP A;  4D0P A;  4OIN F;  4OIQ F;  3FZV A;  4HX7 A;  1LEA A;  4Y13 A;  4EVI A;  1SD7 A;  1KQ9 A;  1YW8 A;  3ULQ B;  3MAJ A;  4A6D A;  3LAJ A;  4LJZ F;  5L3B A;  4BNC A;  1MGT A;  3I5U A;  2MA3 A;  2ZKZ A;  2CO5 A;  2FNP A;  1X3U A;  3I4P A;  4AVP A;  1YQA A;  1C0W A;  5CVU A;  2G7H A;  3VEP A;  2E7W A;  1I1S A;  2GXB A;  2D1H A;  4PCQ A;  2VN2 A;  3ISP A;  4DNC A;  4CDG A;  3WTZ A;  1GHC A;  2WC2 A;  4M74 A;  3ABU A;  1ON2 A;  1V4R A;  1PUE E;  5E20 A;  4BH9 A;  4RAZ A;  5HLI A;  4QWQ A;  4QLC U;  3DF8 A;  1R5H A;  3J80 K;  4HBL A;  4EMS A;  3D0S A;  1S7O A;  1UHM A;  5DCM A;  1MJA A;  1LVA A;  3WGG A;  1P4X A;  4IVN A;  3GWZ A;  1MDM B;  5JVT A;  3BOQ A;  4U0Y A;  3R4K A;  5CVR A;  3RI4 A;  5ILV A;  5CVV A;  3TDU C;  2BEO A;  3P9K A;  3RYR A;  4K2E A;  5FD5 A;  2QQ9 A;  1QO0 D;  3ZMU A;  3QPT A;  4G9Y A;  4A0X A;  2P5V A;  2EFN A;  1WQ2 A;  1BIA A;  1BN5 A;  3RKY A;  3K69 A;  4LMY A;  5DDG A;  5A2Q K;  1HST A;  2DPD A;  4P9F A;  2QYO A;  3NQO A;  4ASN A;  2DO7 A;  1Z7U A;  2YR2 A;  2R3S A;  4RB3 C;  1G3T A;  4JBA A;  2CW0 F;  1FYK A;  3QU3 A;  1U5T B;  2GAU A;  2A6E F;  1B4A A;  3K0L A;  3F21 A;  1O57 A;  3FX3 A;  5D4S A;  1EH8 A;  1BC8 C;  2XUB A;  4UVA A;  3I59 A;  4HQM A;  5HDG A;  1YW7 A;  4HDU A;  3MZY A;  2DU9 A;  2M1B A;  5AON A;  1ZAO A;  3OOP A;  2A61 A;  5IT9 Z;  3JTG A;  2FMY A;  3K1P A;  2XRO A;  4ZYH A;  2JRT A;  1ZG5 A;  1I1G A;  2QUF A;  4ZYG A;  4NHJ A;  5K5O A;  1S7A A;  1DPR A;  2OQR A;  1TNT A;  5E1Z B;  3COA C;  4XLP F;  3DP7 A;  5D8K B;  1W7P A;  1FOK A;  5ILS A;  2F5F A;  4M73 A;  2XAG A;  4KUM A;  1R58 A;  3CO7 C;  2OAZ A;  4A5N A;  5LEJ A;  6PAX A;  4OIO F;  3R0A A;  2FU4 A;  4CGZ A;  1ZGA A;  4RS8 A;  2LNB A;  4O5V A;  3ROU A;  4IRG A;  1WKM A;  4XSZ F;  3TO6 A;  3BJA A;  4BXU A;  3R6S A;  1B6A A;  4HX4 A;  1UCR A;  2RC4 A;  4L9V A;  4IHS A;  1I27 A;  2EK5 A;  3DQV C;  3ZP5 A;  2M87 A;  2QVO A;  2XHK A;  4YG2 F;  2FML A;  1BC7 C;  2JPC A;  1J59 A;  2FBK A;  3E97 A;  1YLF A;  1W5T A;  2Q0O A;  3KP2 A;  1HSJ A;  3QAH A;  2QBY B;  3RTR A;  2RN7 A;  4I2O A;  1T0F A;  2V1U A;  4HX8 A;  5BPD A;  3DEU A;  1STZ A;  3LA2 A;  1GXP A;  2L02 A;  2M45 A;  2RNJ A;  5CYV A;  3I64 A;  1FBU A;  1IRF A;  5FFZ A;  4BHC A;  3ZN1 A;  1MJB A;  4EGY A;  5FFX A;  5EEG A;  3JAM Z;  4RB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...