2VN2A

Crystal structure of the n-terminal domain of dnad protein from geobacillus kaustophilus hta426
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
110
Chain Sequence
MEKKKVAEWLAQGSIAVPKLLLGHYKQLGLGEGELVLLLHMQSFFEEGVLFPTPAELAERMTVSAAECMEMVRRLLQKGMIAIEEKYTLEPLWEKLVHHLYTQAAQQGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHROMOSOME REPLICATION INITIATION PROTEIN
publication title Crystal Structure of the N-Terminal Domain of Geobacillus Kaustophilus Hta426 Dnad Protein.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Replication
total genus 36
structure length 110
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vn2A00
2G7UA 3F8NA 5CVRA 3IKVA 4IPAA 2X0LA 1MGTA 4MQVA 2HYGD 3TOBA 1CGPA 2VC1A 4EV0A 3ZMSA 3M8EA 2A3SA 2VBXA 3BP8A 3RPUA 1ZHFA 3F6VA 3WTWC 3V8JA 2ZNYA 3RYPA 5AIPA 1ON2A 1LDJA 1YQAA 4O3MA 3QU6A 2O6GE 5HVQC 1XDUA 5HS9A 1R58A 3CO6C 5H6RA 3K1NA 3GXOA 1ZLJA 2Z99A 5BPDA 1U2WA 3HHHA 2E7XA 3ROUA 4U0VA 4XSXF 2WV0A 1U6GA 2GWRA 2IA0A 1P4AA 3RIRA 3CDHA 3FM3A 2DI3A 1YW7A 3GFIA 3GF2A 3D0SA 2GAUA 3JAMK 1FBSA 4A6DA 2VC0A 2WC2A 2BGCA 2XKPA 3HYIA 2GA2A 2XV4S 4KIBA 1BM9A 1H0MA 1XGNA 2P7VB 2L02A 1B1BA 3GFMA 1T38A 4IVNA 3NEUA 2FMLA 1SD5A 1BC8C 4HAMA 3VFZA 3V7SA 5D5VB 4G94A 2JZYA 5ICCA 3COAC 4A0YA 3ZMVA 2IJLA 2XUBA 4U7DA 3CTAA 1R22A 2GIVA 3QP5A 4AD9A 1O57A 4LG0A 1YFHA 4OIOF 2CW0F 3PQKA 5E8GA 1J75A 1XGMA 2P5KA 5HLIA 4LFUA 4ZH4F 4JK1X 5E1XA 4OOIA 4U7BA 2XIGA 1TW3A 2MD5A 1HW5A 5FGMA 2PI0A 5DD8A 3M7GA 1RUNA 3VODA 4BHCA 1R00A 1CF7B 4R1HA 3QPTA 2DLLA 3GFJA 3NQOA 3T8RA 1BIBA 4LB5A 2RN7A 2F5FA 2L4AA 3E5UA 5JI6A 4M9SA 1SD4A 3HIFA 4EGYA 5CVVA 4A6EA 1IN4A 2R7DA 4ZYEA 4PGHA 2FQ3A 3ZQ7A 4EM0B 5AONA 2A69F 4RAZA 1T2KA 2ISZA 1YO5C 4L5JA 2DT5A 4MHGA 1SAXA 4B09A 1VTNC 3L7WA 3EQLF 1JE8A 5DYMA 4HLXA 1FC3A 4UUVA 2B0LA 1S7AA 2E7WA 1ZAOA 3GX4X 5AIQA 1FT9A 2H27A 3S2WA 3BJAA 3F21A 1XD7A 1Y0UA 4WCGA 1ZARA 2Z3YA 5CLSA 4I7HA 2DPUA 2VBZA 1KYWA 3F8BA 6PAXA 5D5WB 4WF2A 4ZYDA 2OBPA 2OA4A 3ML6A 4OIQF 1JHFA 2UXNA 1ZRCA 2OD5A 3WTSC 3EDPA 5JFRA 3MFKA 1DPRA 2P5VA 3JTHA 1SMYF 1D8KA 3SHFA 3ZP5A 3TKYA 2CFXA 2HKOA 2YX4A 5DEQA 5KVRA 2QQAA 2X4HA 1YS6A 4MGRA 1YLFA 4M73A 3MQ0A 4M74A 4ENNA 3ZPLA 2Q0OA 2QENA 1WKMA 2LDUA 3FHZA 4BXUA 3IWZA 4G8XA 4M72A 1IN7A 2M5WA 2VN2A 3H3ZA 1P6RA 1PP7U 1BBYA 1WRJA 1SFUA 1KU9A 3ABUA 4N0BA 2OZ6A 2ZJ2A 2EFPA 3B02A 4OIRF 2HOEA 4LK0F 5D5XB 4HOBA 1C0WA 4UXNA 1O3TA 3RKYA 3I4PA 4YFXF 4HYEA 2PMHA 2EV0A 4EJWA 4WWCA 3L00A 3ISPA 4YFNF 5LGTA 2A07F 1OYYA 1HKSA 2HFHA 1J9IA 3SFZA 4GXOA 2QBYB 2VOOA 3I54A 5L3DA 2MH2A 2O03A 5L3CA 1HW2A 1TBXA 2HTJA 1USSA 4PGGA 2QWWA 4M6XA 2VXZA 4ESJA 4AIKA 2HTSA 3P7NA 2R7FA 2ZMEB 3MZYA 4RB2C 5ICGA 1WI9A 1TTYA 3KETA 4HLYA 1JHHA 2KIUA 2W84A 3V4GA 2MLGA 2VBYA 3P9KA 2IA1A 1R7JA 3KP3A 4HF0A 4OMZA 1ODDA 4HF2A 3H3UA 4N9HA 1MZBA 4ZZLA 5F1RA 3GFLA 4HA8A 4EGZA 3WG9A 3E3VA 1QQIA 2JPBA 4ZZDA 1XN7A 1FSHA 2Z5UA 5E18F 3SXYA 5HDNA 2STWA 3J81K 1V4RA 5TRDA 2EK5A 4CO8A 3I58A 2Z9OA 2O3FA 3T5XA 2XAHA 1O3RA 5LRSA 4HQMA 4Y17A 2F2EA 1ONVA 1H9TA 1Z91A 4AIHA 2BBYA 3KEQA 4CXFA 4Z2YA 1TLHB 5ILVA 3JW4A 2HGCA 3HOTA 3RYRA 4O6JA 2QYOA 5DCMA 2AXLA 2P8TA 2JTVA 1W5SA 5D8LB 1BN5A 4UHTA 4WX9A 1GVJA 3J80K 4I0AA 1KQ8A 3HSFA 3BOQA 4BAYA 5K5QA 5D5UB 1P2FA 2JSCA 3ULQB 4AIJA 1IN6A 3SZTA 4HDVA 1EV7A 3DXJF 2K86A 1IAWA 5FD5A 1T6SA 3F6OA 4ETSA 1A04A 3GVAA 5FLXZ 3TGNA 4I02A 1QPMA 4UVAA 1ZGJA 5HLGA 2DAOA 2DW4A 4F7ZA 4FT8A 2K02A 2RC4A 4Q47A 1XGOA 3I59A 3E5QA 4LB6B 3IKTA 5CJ9A 3TO7A 1U5TA 2W85A 3CUOA 1FNNA 3JSPA 3WU1B 1ZREA 4ENJA 1QGPA 1SD7A 4UVBA 3IRQA 4RGRA 1LVAA 3T0YA 1S7OA 3WU0A 3U1DA 2XAGA 2CWEA 2LKPA 3EYYA 2EFNA 1FYMA 5IT9Z 2RQPA 3L2CA 1J2XA 1ZN2A 2M87A 2H94A 2K7LA 4UV8A 1K7AA 5A2QK 1SMTA 2FMYA 5L3EA 2VT2A 2XHKA 4G9YA 3CLOA 3FMQA 1QNTA 2IP2A 1T0FA 2HS5A 3RKXA 2Z33A 3RPQA 3FZVA 4ZYHA 4IRHA 4P9UA 3GW2A 2FEZA 3M8FA 1P4XA 2ESHA 2FF4A 2VONA 3LAJA 4EJVA 2NNNA 3W6JB 3W6KB 2H6BA 2DFIA 2FXAA 2RKHA 3PQJA 3KLOA 3E97A 1J7KA 4OIPF 2ISYA 1KQ0A 2E1NA 1JXSA 2EJRA 3E6DA 2V1DA 4IRGA 2BE5F 1QZYA 4L0ZB 4ENMA 1W7PB 4RGUA 5LHIA 5DV5A 2KRFA 3KZYA 1B9MA 4FX4A 1I5ZA 4JBAA 5FB2A 4PCQA 2PLYA 2OQRA 2NRAC 5L3BA 2PN6A 1MDMA 2IW5A 3T1BA 1RNLA 4UV9A 4IF4A 1YS7A 2C6YA 1MD0A 3BWGA 1IUYA 1UCRA 2FBHA 3QP6A 5EEGA 5TJJA 1FY7A 2XAJA 2IRFG 1ZG1A 1LQ1A 2GXBA 1XB4A 2L3DA 4KNYA 1R1UA 2ZXJA 5E20A 3FX3A 2P6TA 3SQNA 3GLXA 4IXAA 2L54A 1XCBA 4KUMA 3GUDA 4L5IA 4HX4A 4S04A 5K1YA 1XSVA 1TQMA 3EYIA 5D8KB 3IHUA 2FE3A 3R6SA 2KJBA 3NRVA 4MQ9F 1U5TB 5E8IA 4A12A 4Y15A 3H92A 3P9IA 1Z1DA 4GO1A 2ZO4A 1B9NA 1FYLA 2D1VA 1MJAA 3R60A 1TQIA 1SFXA 2IVMA 3LQRA 3HOSA 2H09A 2V1UA 4LLGF 3HTSB 4FX0A 1UFMA 1ZYRF 1FSEA 1MJ9A 5BS6A 4WXDA 5ILUA 4LMYA 4HBLA 2D1HA 1HSTA 3G3ZA 1OMIA 1UHWA 2Y48A 1IXCA 3GO5A 5HLHA 2HKXA 5LHHA 2G7HA 3JAMZ 1FWZA 2A61A 2ZNZA 1X3UA 1Z7UA 3WGGA 2QVOA 2D2WA 1I1SA 4HQEA 4MEYF 3VEPA 5BQTA 3LA2A 3KE2A 3GZ6A 1WSUA 2DTRA 2VBWA 2BV6A 4G6QA 3RTRA 1YTYA 1FBQA 4KT5C 4A2UA 5CVJA 5HDKA 1TQPA 3QU3A 4XLNF 3V8KA 3MZHA 4GCVA 5ICEA 5F6FA 2RVCA 4U0YA 1KGSA 1OPCA 1MDMB 4XSZF 2HZTA 1R5HA 1MKMA 2OU2A 2D45A 1KA8A 2G9WA 2GZWA 2LF8A 2XVCA 3U9GA 1UB9A 4HF1A 3BJOA 2A5YB 4Q4ZF 2PQ8A 4ASNA 4LG0B 4R8HA 4EJOA 3EUHA 3WE3A 3QRFF 4I2OA 5D4SA 4XBFA 3E6CC 1PUEE 3J7AO 1ZGAA 2HDCA 1T39A 3KFWX 1U78A 2TDXA 2RGVA 3FMSA 1FZPB 4G7HF 2DQRA 5FO5A 2V1XA 3WTTC 2XROA 4R79A 2CGPA 3IWFA 2IPQX 5CVIA 3L9FA 1IW7F 5J8CA 2V79A 2RNJA 1FBUA 2DBBA 3F8MA 2P7CB 1JGSA 2QQBA 2OAZA 4RGSA 5KK1A 1U5TC 4KN4X 3LQQA 2NYXA 3GYHX 1YIOA 1TNSA 1DDNA 3B73A 5EEHA 3HRUA 1FYKA 1R1VA 1WQ2A 5DDGA 3SZPA 1I27A 4A0ZA 4PZJA 3I71A 4HX7A 3K1PA 1L3LA 1S29A 3EETA 4JQFA 4U0WA 4D0PA 1W5TA 3MAJA 1QO0D 2EFQA 4IHTA 1ULYA 5ILSA 4UNOA 5F64A 1YYVA 4AVPA 3RDIA 3CJNA 1IXSB 4Y13A 3TDUC 3FXRA 2O61A 3JSOA 2BYVE 1HKQA 2KIFA 2QZ8A 2LNBA 4I01A 3BPXA 2IA2A 2CYYA 4KIFA 4BH9A 2GXGA 2MA3A 3F22A 1GHCA 1K79A 1PDNC 2L01A 4CICA 1Q1HA 1LDDA 1F9NA 4GGGA 2O0YA 3I5UA 3CUQA 5FFZA 1Z6RA 5H6QA 2EA2A 4ENKA 1FP1D 3C18A 2ZFWA 3WTVC 2STTA 3KP5A 4OMYA 3HSEA 3REOA 4CGZA 4HDUA 3WGHA 5DUIA 4MEXF 1XSXA 2V6CA 4AWXB 4OU0A 5LGUA 4EJUA 3FM5A 5H20A 2E1CA 1ZRFA 3HRTA 4DQ2A 2H6CA 2QUFA 3R0AA 2JRTA 1BIAA 3TOAA 4MTDA 4LJZF 4NHJA 4FHTA 2QM3A 2PFBA 2W57A 3IRRA 1STZA 4A5MA 1KYZA 1BI3A 2FNAA 2VOPA 1P92A 3HRMA 1P4WA 5LEJA 3GZ5A 2M30A 4RS8A 4CHUA 3MCZA 2YSRA 1LEAA 5E1WA 3K69A 1LDKB 1LB2A 1SD6A 5HOOA 5DUKA 3RKWA 4A0XA 1RUOA 1E17A 3D5LA 3WTZA 1YW9A 3ZMTA 5HS8A 1OR7A 3V8LA 3LA3A 5LLQA 1KU2A 3K0LA 2DO7A 2KKOA 2PEXA 1I6XA 3WTYC 3QOPA 4HW0A 5J8FA 3J81Z 3U2RA 1O3SA 3HHGA 2HQNA 4N9IA 3TO6A 3K9TA 5BOXA 2Q8KA 3F8CA 3Q9VA 2XAFA 1G3WA 1R36A 3ZN0A 2VE8A 3DKWA 3BPVA 3JTGA 2EV6A 1TW2A 2L4MA 3R61A 4EM2A 3IC7A 3K1MA 1D5VA 1OYWA 2MC3A 1ZRDA 4KYWA 3CUQB 4HV6A 2MH9A 1OYIA 3I0TA 4P5OA 2R3SA 2M8EA 5BPIA 5HS7A 1G4DA 2F5CA 5JR3A 1O3QA 3J80Z 2FBIA 3DFGA 4G7ZF 5DCMB 2F5EA 1G6NA 5CYVA 3M1EA 1IN5A 2NNYA 2KIMA 3BDDA 2XAQA 1KU3A 4Q48A 1DUXC 3C1DA 1GXPA 3HRSA 3F23A 1V3FA 1RI7A 1E2XA 2UZKA 1F4KA 3FXUA 1RZ4A 4U88A 3DV8A 5D4RA 3O2PE 2K4JA 3ZMUA 4RAYA 3KP7A 4IJAA 1S8NA 1LNWA 3E5XA 5JHUA 5E1ZB 5ED4A 2PMUA 4CZZA 3KEOA 4NQWA 3ABTA 3T8TA 1J0RA 2UWMA 1LEBA 1XGSA 2HWVA 1U8RA 2VODA 5D6FA 5JVTA 1XDSA 3KCCA 2RV8A 4EJTA 3IL2A 4HV5A 3ECOA 2XRNA 4BYYA 2IT0A 2HEOA 1LJ9A 2A68F 1W4MA 4K2EA 4QWQA 3BJ6A 1AWCA 1R1TA 3I59B 2FU4A 4GYIA 3ZMZA 3QPHA 4LLNA 2PG4A 3TO9A 5LBQA 4M9XA 4UVCA 5LHGA 5A2QZ 2QLZA 5IT3A 4M71A 3BROA 2XKOA 1J59A 1DP7P 1YG2A 1FPQA 2DQLA 4IHSA 2COMA 4KFCA 1F5TA 3M9AA 4HZFA 1B6AA 2WWYA 3V7RA 4LD5A 4G7OF 4RB1A 4BQAA 1REPC 3WGIA 4YFKF 2EWNA 2EV5A 2QBYA 1EH8A 1U3EM 4ZYGA 3ERED 5ICFA 2W25A 1K6OA 2M45A 4YIIA 4EMSA 2ETHA 4S05A 4NB5A 2ZMEA 2W24A 3R4KA 3WTUC 3BY6A 2HQRA 3HUGA 4PDKA 3WODF 4P96A 5DCFA 5L3FA 5DD4A 1RIOH 4L9TA 4EVIA 1ZLKA 2J5OA 3WE2A 3C7JA 4KICA 1KQ9A 4L9VA 4P55A 2YPRA 3R0JA 2ZKZA 1BI1A 4M6YA 3TQNA 4KA4A 3CUQC 2Y75A 2HR3A 2NAZA 1ZG3A 1KU7A 2M1BA 2YR2A 1K78A 3DP7A 1IRFA 2PBIA 4L0YB 1XMAA 1YW8A 3I64A 3DQVC 4IRIA 1G3TA 3KP6A 2EB7A 2EFOA 3VB2A 1Z05A 2VT3A 4I98B 2Y0MA 3V7CA 2P5LC 4YG2F 1IF1A 3FF5A 1GXQA 1B4AA 1G3YA 5K5RA 2RDPA 4BHPA 3ZN1A 2OQGA 3C3WA 1IN8A 2P6SA 1ON1A 5FD6A 2XGXA 3HSRA 4MTEA 4Q5SF 1USTA 4A5NA 3Q5FA 1HXDA 3RI4A 3DPTA 3PFIA 2FSWA 2PJPA 1XCVA 4B8XA 4LLLA 3BZ6A 1BI0A 4M9ZA 3QAHA 3KP2A 1IRGA 4TV7A 4LGWA 5BMZA 1EH7A 2DPDA 5LEKA 3MWMA 2CG4A 5L3GA 4RB0A 2CO5A 2FBKA 4ESBA 2MBFA 3E6MA 3OV8A 1O7FA 1FX7A 3CO7C 2DK8A 2YU3A 3LWFA 2K4BA 4O5VA 2A6EF 4I0BA 2JPCA 2QQ9A 3ECHA 2F5DA 1FLIA 1HW1A 4HX8A 1IXRC 4WK8F 3HTUA 4EQQA 2CQKA 2ADUA 3GEZA 1F1ZA 1BJAA 5ERIA 3E6BA 2XASA 4MNUA 1S6LA 3MEXA 5FFXA 1UHMA 1HQCA 2FRHA 5FLXK 2WTEA 1ZH5A 1Z9CA 1O7LA 2GA1A 3DPLC 3L09A 3DEUA 3TDZC 4ON0A 1XSDA 4L18B 4P9FA 1W7PD 2O8XA 4DNCA 4XRFA 3LFKA 4BHBA 5LRRA 4KMUX 1SFEA 1TNTA 3GWZA 2JT1A 3VOEA 2DU9A 3O6BB 2ZBKA 4KMFA 4WXHA 2A6HF 3KP4A 3DF8A 4KN7X 1HBXG 3FXQA 1WWXA 1AOYA 4OINF 1K78B 5HDGA 3OOPA 3FMRA 2VE9A 2OZUA 2ACJA 3Q9SA 3ZMDA 4LK1F 1T98A 4KDPA 1EH6A 5IT9K 1G3SA 4E70A 3AAFA 3N97A 4CYDA 2FA5A 4G6DA 1H9GA 1D3YA 1BC7C 1HSJA 2V9VA 1BOAA 3LSTA 2FNPA 1R23A 1I1GA 2CSOA 2HYFA 1PP8F 1OKRA 4XLPF 1QBJA 2EA4A 5CVUA 1J5YA 3G73A 1DPUA 3FWEA 1S3JA 1R5GA 1HKTA 1L0OC 2ELHA 2NS0A 3I53A 1B59A 3N4MA 2KJCA 4I09A 3P9CA 3KLNA 1W7PA 2BEOA 2MLKA 1XMKA 4GYGA 4H0EA 1ZG5A 2AS5F 1FP2A 2K27A 5D6EA 2EFWA 4CDGA 5LGNA 3K2ZA 2UXXA 4L9NA 5E17F 2J5PA 3KZZA 1QZZA 1D8JA 2LF7A 2DK5A 3O3KA 1Z6TA 4YIFA 4RGXA 2FOKA 3WTXC 4QLCU 5J6XA 3RJPA 1IZ1A 2LSOA 3F72A 2Q2EA 3F3XA 3LA7A 4RB3C 1FOKA 4EM1A 1BI2A 4L9JA 4BNCA 2ESNA 2GQQA 3LAPA 1CF7A 1NHAA 1MJBA 5K5OA 2YX7A 3F8FA 4KIGA 4WXCA 4ESFA 2ZCWA 3ELKA 2P4WA
chains in the Genus database with same CATH superfamily
2G7UA 3F8NA 5CVRA 2XSJC 1ETQA 3IKVA 4IPAA 3VPRA 1O4XA 2KFDA 1MGTA 2X0LA 2HYGD 1ZK8A 4MQVA 5IOZA 3TOBA 4A3MJ 2VC1A 4JX4A 1CGPA 4EV0A 3ZMSA 3M8EA 2A3SA 2VBXA 3BP8A 3RPUA 5M5WJ 1ZHFA 3F6VA 4UY8I 3WTWC 3QYFA 2HI3A 3V8JA 3HJEA 1QPIA 1Z3YA 2HQ5A 2ZNYA 2CUEA 1W5CC 3HOZJ 4IOCF 2RAEA 2FUG2 4IOAF 1AU7A 3RYPA 5AIPA 1OLTA 1ON2A 4J00A 3DTKA 1LDJA 1YQAA 2ELKA 4O3MA 3QU6A 3RZDJ 2HZDA 2O6GE 3H5NA 3UKGA 3U21A 5HVQC 3FXKA 4DIQA 3IH4A 5M5YJ 1OCTC 3IH2A 3BTLA 4KISA 2CQNA 2IBDA 1XDUA 3AG2H 5HS9A 1R58A 3CO6C 2LBFA 3KEYA 5H6RA 3K1NA 3GXOA 1ZLJA 2Z99A 3DEEA 3H5RA 5BPDA 1U2WA 1JI8A 2EIKH 3HHHA 2X1DA 2FOWA 4LIUA 2E7XA 1SFKA 2HDDA 1RETA 3ROUA 2DFFA 3K70D 4U0VA 4XSXF 1HDPA 1ZKGA 2WV0A 2LFBA 3W2VA 1U6GA 2GWRA 2IA0A 1YRNB 1P4AA 2JUCA 3RIRA 3CDHA 1TWGJ 5B5EC 2XGDA 1FOWA 3FM3A 4C2UA 1ETVA 2DI3A 4CYCB 1YW7A 4CZCA 1TWHJ 2OTLI 3GFIA 3PNYA 3GF2A 3D0SA 2GAUA 2NS8A 4M3EA 3JAMK 1FOXA 5E3MA 1FBSA 3NWTA 3RQIA 4A6DA 1VQ8I 2VJ4A 3DTIA 2X6OA 2VC0A 3BQYA 2WC2A 4B43A 2BGCA 2XKPA 3HYIA 2GA2A 2XV4S 3S1NJ 4KIBA 3EUHC 4RM2A 3NWSA 3A2KA 1BM9A 5C4JJ 1K61A 1N77A 2DN0A 1H0MA 1XGNA 2P7VB 2L02A 1B1BA 3GFMA 1T38A 1V54H 4IVNA 1SVOA 3G1OA 1OJLA 2HPIA 3NEUA 2FMLA 1SD5A 3PSIA 1BC8C 4HAMA 4DZPA 3HOVJ 3DU5A 3VFZA 3TW6A 3V7SA 5D5VB 3JRHA 4G94A 3IAM2 3CCJI 2K9SA 2A5WA 2JZYA 5ICCA 2Z1DA 4G12A 3COAC 2F48A 2XF6A 4XRSG 4A0YA 3DBRB 4F55A 1VQ5I 4F91B 4BJ5C 3ZMVA 2IJLA 2XUBA 3J7AY 3S32A 4U7DA 3CTAA 4OWRB 1R22A 3OYDA 2GIVA 1RPWA 2JA7J 3QP5A 4BEHA 2VKEA 4AD9A 5KNLA 1YHQI 5EGOB 1O57A 2DTZA 1G59A 4LG0A 4C2MJ 1UG2A 1YFHA 2CW0F 1X1PA 4OIOF 3PQKA 1YX3A 1UG0A 5E8GA 1MSEC 1J75A 1XGMA 2P5KA 5HLIA 4LFUA 4ZH4F 1D5YA 4JK1X 5E1XA 5F27A 5H2FC 2WAQA 2F4IA 4OOIA 4C3IJ 4I6ZA 4U7BA 2XIGA 1TW3A 2MD5A 1VQ9I 1HW5A 5FGMA 3A02A 4D5CA 2PI0A 1RESA 5EZHA 5B1AH 2BW3B 3PUBA 5DD8A 3M7GA 3OMYA 1VQPI 1VI0A 2DOFA 1RUNA 3VODA 4BHCA 1R00A 1CF7B 4R1HA 3QPTA 2MG4A 2DLLA 2HXIA 3OYMA 3GFJA 3NQOA 3T8RA 2GLOA 1BIBA 4LB5A 2RN7A 4CCOA 2F5FA 2L4AA 4QPQA 3E5UA 3S16J 2V6EA 5JI6A 4M9SA 1Y39A 1BA5A 1SD4A 3HIFA 4EGYA 5CVVA 1MBHA 4A6EA 1IN4A 2LVSA 2R7DA 1X58A 5K7ZA 4ZYEA 4PGHA 1VQNI 4ZDOA 1WPKA 2FQ3A 4RAGA 2L5QA 1HF0A 3ZQ7A 2VXDA 3PO3J 3LSKA 4EM0B 5AONA 1S7EA 2A69F 4RAZA 4BUPA 1WCMJ 5CPRB 2R7XA 3DBLB 1T2KA 4AU7A 2ISZA 2V26A 1Z7LA 1YO5C 4IHVA 1D0YA 4L5JA 3LSRA 3K10A 1PUFA 1VQMI 2DT5A 4GDFA 4MHGA 5M3MJ 1SAXA 1HCRA 4B09A 1FTTA 2R7QA 5EJCA 4ZYAA 4FQGA 2VJIA 1VTNC 3L7WA 3EQLF 1JE8A 1HOMA 5DYMA 4HLXA 3J7ZI 1FC3A 3CCUI 3FXJA 2L9NA 3AFHA 1MMNA 4UUVA 2B0LA 3BR6A 1S7AA 2E7WA 3QYEA 4BY7J 1ZAOA 3GX4X 4X0GA 5AIQA 2H1KA 1FT9A 4NC7A 2DMNA 1Y0NA 2M4KA 4H4KC 2H27A 3S2WA 3BJAA 3F21A 5TGTA 1WJBA 1XD7A 1Y0UA 3WG7H 4WCGA 3ZQLA 1HC8A 3FKIJ 1ZARA 4BE0A 2Z3YA 5CLSA 4I7HA 5KHDA 4BY1J 2DPUA 2VBZA 5IYBJ 1KYWA 3F8BA 3FK6A 6PAXA 1AKHA 3OY9A 3MMYB 5D5WB 4WF2A 3HPGA 4ZYDA 2OBPA 2OA4A 3ML6A 4OIQF 1JHFA 5EG0B 1V5EA 1Z21A 2UXNA 2K9NA 1ZRCA 2OD5A 3WTSC 2FJ1A 2K3FA 3EDPA 5JFRA 3MFKA 1DPRA 3ZR8X 3LNQA 2P5VA 3JTHA 2DMQA 1SMYF 3M8JA 1D8KA 3SHFA 3ZP5A 3BG3A 3TKYA 2CFXA 2HKOA 2YX4A 4NQWB 5DEQA 1ACIA 1SVLA 5KVRA 2QQAA 2X4HA 1YS6A 4MGRA 1YLFA 4M73A 1K4SA 3LSPA 1R71A 3MQ0A 4IHXA 3BR2A 4M74A 4ENNA 2E34A 4JYKA 1JT0A 3ZPLA 3ZQGA 2Q0OA 5E3OA 4FCYA 2QENA 4AVZA 1WKMA 4PJJA 2LDUA 3FHZA 2GIZA 4BXUA 3G1LA 3IWZA 4G8XA 2YUSA 1IN7A 4M72A 4BEHB 2AXTC 2M5WA 2Y0SA 2LKXA 2VN2A 3LSIA 2VJ5A 1WJCA 3H3ZA 1P6RA 1PP7U 1BBYA 1WRJA 3LFUA 4XL9A 1SFUA 1D0ZA 1TWCJ 3B6AA 3CCEI 3DWLE 3GTLJ 1KU9A 3ABUA 4N0BA 5FJ8J 3CJQB 2XC7A 4ANJA 3LSJA 2OZ6A 2ZJ2A 2EFPA 3QWLA 2R7WA 3B02A 1G2HA 1R4NB 1T33A 4OIRF 2HOEA 3OIOA 4ZDLA 1K4TA 2DCEA 4LK0F 5D5XB 1TWAJ 4HOBA 2XB5A 5HNFA 1C0WA 2B63J 2OTJI 5FRNA 4UXNA 1O3TA 3GMEA 3RKYA 3I56I 3I4PA 2R7ZJ 4YFXF 4HYEA 2LG4A 5TISC 2IGKA 2PMHA 4XIDA 2EV0A 1MBEA 2K9QA 1OR7C 4II2A 2IAIA 2JA2A 3K4NA 4EJWA 5FRMA 4WWCA 3L00A 2CRGA 2JSPA 3ISPA 1JT6A 4YFNF 5LGTA 1WH5A 2O7OA 1X1DA 2A07F 1OYYA 1HKSA 5KAIC 2HFHA 1J9IA 3SFZA 3HKZA 3BZCA 4GXOA 2QBYB 3BT9A 2VOOA 3I54A 5L3DA 1PUFB 1I39A 2MH2A 2O03A 5L3CA 2DDAA 1HW2A 2W7NA 3L2QA 1TBXA 2HTJA 1A36A 1JKPC 4CH7A 1V55H 2M0MA 1USSA 4PGGA 2QWWA 4M6XA 1B72A 2VXZA 4ESJA 4AIKA 3OYNA 5F0FA 3H0DA 2HTSA 2Y31A 4D9JA 3S1MJ 3P7NA 3QOEA 2R7FA 5DM6F 2ZMEB 3MZYA 1GUUA 3CF2A 4I76A 4RB2C 5ICGA 3HGYA 3PNVA 2VQHA 3H0GJ 5JLWA 3E1SA 1WI9A 3FXOA 1TTYA 3KETA 4HLYA 1JHHA 3OR1C 1J09A 4IEJA 4PJNA 5FROA 3G71I 2I5UA 4ZTJA 2KIUA 1JUMA 1P7IA 3SFIA 4HF2A 5C44J 2W84A 3V4GA 1DU6A 1P7JA 2MLGA 2VBYA 2LYCA 3P9KA 4LITA 2IA1A 1R7JA 3KP3A 1ITYA 4HF0A 4V2GA 3UNGC 4OMZA 2B9SA 4QTRA 3WHCA 1ODDA 1QHHD 2JK3A 3ESWB 1MZBA 2ZSIB 3H3UA 3K7AJ 4N9HA 1NTCA 3VYUB 4ZZLA 5F1RA 3GFLA 3HBLA 4HA8A 4EGZA 1AKHB 1TT5B 2KLOA 3WG9A 3E3VA 3LMMA 1LE8B 2KIQA 1QQIA 2JPBA 3AL0B 4ZZDA 5IP6A 1XN7A 2OF7A 1LPQA 1FSHA 3GTJJ 2Z5UA 3JCUC 5E18F 3SXYA 5HDNA 2M2EA 2STWA 2L7FP 2CH0A 3M07A 3J81K 1V4RA 5TRDA 2EK5A 3I55I 4B47A 4CO8A 1Y8RB 3I58A 2Z9OA 2O3FA 3CMAI 2K9LA 5F0CA 1YJNI 3JRCA 3T5XA 2OJED 2XAHA 1O3RA 4Y52J 3JRBA 4NC6A 5LRSA 3EUKL 4HQMA 4Y17A 2F2EA 1ONVA 1LVKA 3K4BA 1H9TA 1Z91A 4AIHA 2BBYA 3KEQA 1X3ZB 4CXFA 1VZ0A 2QCOA 4Z2YA 2PMZA 4J19A 1VQ6I 1TLHB 4XOTA 4HNUA 2HPMA 5ILVA 3JW4A 3O8GA 4XN3A 2HGCA 3HOTA 5EYRA 1H8AC 3UR3C 3RYRA 5F1JA 1A35A 1MMSA 4O6JA 3SZGA 2QYOA 1ETOA 3PSFA 2AXLA 5DCMA 2P8TA 3GTPJ 1OCOH 2JTVA 1W5SA 2HXOA 5D8LB 1S72I 4W1UA 2CV2A 1BN5A 1OQYA 2CV0A 1WGXA 4UHTA 4WX9A 3K4CA 1Z3XA 4QSHA 1GVJA 4BACA 2QA4I 2CFOA 1CQTA 3CC2I 3J80K 4I0AA 1OISA 3MKWB 4XKVA 1KQ8A 3HSFA 3BOQA 4BAYA 5K5QA 1P2FA 2JSCA 2K9MA 3K4JA 3ULQB 2JJ7A 5D5UB 4AIJA 4MIMA 1IN6A 1YE9A 2OC6A 2WB1N 4PJ0C 4UUTA 3SZTA 4DZJA 1EV7A 3DXJF 4HDVA 1T08B 2HVSA 2K86A 1IAWA 2ID6A 5FD5A 3K2AA 1T6SA 2DODA 3F6OA 4ETSA 1N25A 1H88C 1A04A 2AQFA 1F43A 4YEJA 2ECBA 3GVAA 4RM3A 2WBMA 4BE1A 1A31A 3FK7A 5FLXZ 2WADA 2CQQA 3TGNA 4I02A 2P81A 3MKYB 1QPMA 2VASA 2DMUA 2WA0A 2VKHA 3OYHA 4UVAA 2L7ZA 3RSNA 2QKLB 1ZGJA 5HLGA 1B8IB 1VNDA 2DAOA 4AIDA 3BG6A 2ICWG 4NC8A 2DW4A 5GPCA 2DFEA 4F7ZA 2LC2A 2K02A 4FT8A 3ZGKA 4PJMA 1Y1WJ 2RC4A 2V1NA 1TC3C 2XAUA 3HOUJ 3VYRB 4Q47A 4KT6A 1XGOA 3I59A 3E5QA 4LB6B 3IKTA 5GTHC 4MFEA 5CJ9A 3TO7A 1U5TA 2NVTJ 2W85A 3CUOA 1FNNA 3DEWA 4X6AJ 4AYBA 3JSPA 3WU1B 1ZREA 1QGPA 1SD7A 4ENJA 4UVBA 3VWBA 2PX9A 3M4OJ 2KQRA 3IRQA 3HL2A 1LFUP 4RGRA 5B1BH 1LVAA 1FIAA 3T0YA 3CD6I 1S7OA 3WU0A 3U1DA 2XAGA 3I4NJ 2CWEA 2ZMEC 2LKPA 3EYYA 2EFNA 2IXSA 4IX7A 2RQPA 3L2CA 1J2XA 1ZN2A 1FYMA 5IT9Z 3OSFA 1KONA 2M87A 2XF5A 2IEKA 3AG1H 1MW7A 2H94A 1ZELA 2X48A 2K7LA 4UV8A 1YI2I 4LIVA 1K7AA 5A2QK 4AUXA 1SMTA 2FMYA 5L3EA 4NUBA 2VT2A 2XHKA 4G9YA 3CLOA 3FMQA 1QNTA 4XLHA 1M1EB 2IP2A 4F3QA 1QVUA 1T0FA 1BW5A 2HS5A 3M3YJ 4YRVA 3RKXA 2Z33A 1ETYA 3RPQA 3MKZA 3FZVA 1GDTA 4ZYHA 2R0QC 4IRHA 2E5ZA 4P9UA 3GW2A 2FEZA 1N75A 3ZXSA 1OCZH 4FASD 3ZCOA 2B7EA 3M8FA 3AKZA 1NH3A 1U9NA 4M3DA 1P4XA 3HZJA 3AL0C 4XR6A 5K7FA 2ESHA 2FF4A 3CP2A 5CKTA 2JQ7A 2VONA 3LAJA 2R5YA 4EJVA 2UUZA 2NNNA 3W6JB 2JA5J 1NK2P 3BG9A 2O8KA 1X3WB 3W6KB 4IZZA 1RR8C 1VQLI 2H6BA 2DFIA 2FXAA 2RKHA 2BHYA 3PQJA 3KLOA 2L7KA 3E97A 3WTUC 4GFBA 1J7KA 2KDOA 1W0UA 4OIPF 4BQOA 1VQ7I 2ISYA 2W00A 2EIJH 3EPZA 3RQ4A 1KQ0A 2E1NA 1JXSA 2EJRA 2Z16A 3E6DA 4DYRA 2V1DA 4IRGA 2BE5F 1QZYA 4L0ZB 1A6IA 4ENMA 3ZRGA 1W7PB 4RGUA 5LHIA 5E3LA 5DV5A 2RNGA 2FD5A 3GTKJ 2KRFA 4M6VA 3KZYA 1B9MA 4FX4A 1I5ZA 4JBAA 5FB2A 4PCQA 1FMVA 2PLYA 2OQRA 2NRAC 5L3BA 2PN6A 1FOYA 2IW5A 1MDMA 3CCVI 1ZQ3P 2AO9A 2TCTA 3T1BA 1RNLA 1JTXA 1WJAA 4BBRJ 3OYAA 2E2HJ 3KZIC 3TEDA 4UV9A 4IF4A 1YS7A 3FISA 3Q0WA 2C6YA 1MD0A 5J40A 3BWGA 2HOTA 1UMQA 1IUYA 1UCRA 2FBHA 3QP6A 5EEGA 5TJJA 5J4VA 2EPFA 1FY7A 2XAJA 2IRFG 1ZG1A 2EZIA 1LQ1A 2GXBA 1XB4A 2DYSH 2L3DA 4KNYA 2HYJA 1R1UA 2ZXJA 2QSHX 5E20A 4PFOA 3E0JB 3FX3A 4FE7A 3VYTB 2Y9ZA 2P6TA 2DFHA 3MD2A 2Q2EB 2UV1A 3CF5F 3SDBA 2HVQA 3SQNA 3DPUA 4YIRX 3GLXA 2M34A 4IXAA 4J01A 2L54A 1XCBA 4KUMA 3GUDA 4L5IA 4HX4A 5F0HA 4S04A 1U0JA 2DA4A 5K1YA 1XSVA 3CCQI 1TQMA 3EYIA 2M3AA 1X19A 5D8KB 4XOPA 4UUSA 2RREA 3IHUA 2FE3A 3R6SA 2KJBA 3NRVA 4MQ9F 1U5TB 5E8IA 2X51A 4ABZA 4A12A 2X6XA 2L9VA 4Y15A 4B3XA 3H92A 3P9IA 1Z1DA 4GO1A 2ZO4A 3PIPF 2QGUA 1FTZA 2V4JC 2XRLA 1RKTA 4CCNA 2KT0A 1B9NA 2LR8A 1FYLA 2D1VA 1MJAA 3R60A 1TQIA 3BG7A 4C2TA 3DCFA 1SFXA 2IVMA 3GBGA 1SFOJ 3LQRA 5J1YA 3HOSA 2H09A 2V1UA 4AC0A 4LLGF 3HTSB 4FX0A 1UFMA 1ZYRF 2E1OA 2IGMA 1IG7A 3FHNA 4XLEA 3W2AA 1FIPA 1WH7A 2VIXA 1FSEA 2X6YA 1PYVA 1HDDC 2M7BA 2IS6A 1MJ9A 4E7LA 2H8RA 2E5NA 2ZXHA 5BS6A 4WXDA 1X1CA 5ILUA 4LMYA 4HBLA 2D1HA 1HSTA 3M1CA 1IGNA 1A6QA 4W97A 1F36A 1ETXA 2DA6A 2NS7A 4RA2A 3G3ZA 3SYTA 1OMIA 4DOZA 2LBFB 1UHWA 2I8DA 1BR1A 1E3HA 3H9JA 2Y48A 3CMMA 3MVPA 1GVDA 1IXCA 3GO5A 5HLHA 2HKXA 5LHHA 2BXYA 1IV6A 4CCJA 2G7HA 4FE4A 3JAMZ 2ZJPF 1SC7A 5GP9A 1JKQC 1FWZA 2JA8J 1RRJA 2A61A 2ZNZA 1X3UA 1Z7UA 3WGGA 2QVOA 2D2WA 5J47A 1I1SA 4HQEA 1IC8A 4MEYF 3VEPA 3VDXA 2CQ7A 5BQTA 2R5YB 2E35A 3LA2A 3OWTA 3KE2A 3H3VK 3TP3A 3GZ6A 2VQCA 1Y56A 4UB8C 4LOCA 1WSUA 5K7HA 2DTRA 2VBWA 3BCBA 4E7KA 4HSRA 2BV6A 4G6QA 3RTRA 1YTYA 1FBQA 2EBIA 3QODA 4KT5C 3S3MA 4CCLA 1VFCA 4A2UA 5CVJA 2IS2A 2VLAA 3DLLF 5HDKA 3HDDA 1I50J 3PFYA 1TQPA 3QU3A 4XLNF 1APLC 4G6TB 4A93J 4DBQA 2DA7A 3V8KA 3MZHA 4GCVA 5ICEA 2F4MB 2QKMB 5F6FA 4HNVA 1SEUA 2ZJRF 2RVCA 4U0YA 1KGSA 1OPCA 1MDMB 2BY1A 4XSZF 2HZTA 4MFDA 3CCSI 1R5HA 4KITB 3H1CA 1MKMA 2LY1A 2OU2A 2NVQJ 1FEXA 2D45A 4HNTA 1SANA 1KA8A 3OYKA 4FISA 2G9WA 3CDLA 2DMPA 2GZWA 1RKWA 5F04A 1ETWA 1YIJI 3HOWJ 2W82A 1D0XA 2LF8A 1NG6A 2XPWA 2XVCA 4PK4A 3U9GA 1UB9A 2CW7A 3BJOA 4HF1A 2A5YB 2NOGA 5IYCJ 4M3BA 4Q4ZF 2PQ8A 4ASNA 1U8BA 2V9PA 2JWTA 4A3DJ 3DKXA 1I6HJ 4LG0B 4R8HA 2LLKA 4EJOA 3NAUA 5M5XJ 2R4GA 3EUHA 3S14J 1W36C 4XK4A 3KYLA 3WE3A 3QRFF 4I2OA 2DYRH 1XG1A 5D4SA 3CC4I 2GOXB 4XBFA 3E6CC 1PUEE 3J7AO 1R4MB 1ZGAA 5HLTA 2HDCA 4XKBA 1T39A 5IP7J 1IRZA 3KFWX 1U78A 2TDXA 3WU2C 2M4GA 2RGVA 3FMSA 5EF6A 1FZPB 2K5CA 3FDYA 3DLAA 4RLQA 2ME6A 1IO2A 5EEAA 4G7HF 2DQRA 5FO5A 5J1UA 2V1XA 3WTTC 3V42A 1S5LC 2R93J 3ABLH 2XROA 3S15J 4R79A 2WAEA 4XLFA 3IWFA 2CGPA 4XLAA 2IPQX 5CVIA 3L9FA 1IV8A 3OR2C 1IW7F 2MGQA 5J8CA 2V79A 1W1WE 3K6GA 2RNJA 4PSWA 1FBUA 3QPLA 3ZOBA 3ZQHA 2DBBA 1R49A 3F8MA 1MBKA 3HGGA 2E19A 3OS1A 2P7CB 1QU3A 1JGSA 1BW6A 2QQBA 1ZR2A 2OAZA 4IHWA 4RGSA 1WJEA 5KK1A 4F92B 2ID3A 3HOXJ 1U5TC 2LP0A 4KN4X 1QA6A 4GRIA 3LQQA 2X6WA 4E7ZA 1MH3A 3I4MJ 2NYXA 3GYHX 1YIOA 1K83J 1TNSA 1UZCA 1DDNA 3B73A 5EEHA 3K4KA 3HRUA 1YITI 1FYKA 1X2NA 1R1VA 1WQ2A 5DDGA 2R5ZA 4C3JJ 4BS9A 1BR4A 3SZPA 1I27A 4KJZA 4A0ZA 2W1OA 4IL6C 2BHZA 5E3NA 2WV1A 3DTEA 2MC4A 4PZJA 3I71A 2WAQN 3H5AA 3QYBA 2BY0A 3K1PA 4HX7A 5FLMJ 2KMUA 1L3LA 1S29A 4CUGA 4BL0B 1DU0A 3EETA 4DJAA 2O5RA 4JQFA 4U0WA 4D0PA 3ASOH 4A3GJ 5B3SH 2CS3A 1W5TA 1X4OA 5GADJ 2EZHA 5FKMA 1E3OC 3CQZJ 3MAJA 1QO0D 2EFQA 2IGNA 3Q0VA 4NNJA 1XS9A 4HRIA 1VF9A 4IHTA 1ULYA 5ILSA 4JX6A 4UNOA 5F64A 1YYVA 3SJMA 4AVPA 2LD5A 3L2VA 3RDIA 3CJNA 1W0TA 1P9QC 3BTCA 1NG7A 1HA8A 1ORKA 1IXSB 4QIWN 4Y13A 1E3PA 3TDUC 5DTDA 4B48A 3FXRA 3S1QJ 2O61A 3JSOA 2BYVE 3IAS2 4RBOA 3LSHA 1HKQA 2KIFA 2QZ8A 2KDZA 1ENHA 2H1LA 2LNBA 2QQ8A 3A0BC 4I01A 3CP8A 3BPXA 1V5FA 2CYYA 2IA2A 4KIFA 4XKCA 4PUSA 4BH9A 1R5ID 3SEZA 2GXGA 2DA1A 2HOSA 5GTIC 3KIOA 3HC7A 2MA3A 2DA2A 5GPAA 3F22A 1GHCA 3ONQA 1K79A 3FBNB 3B6CA 3A0HC 1PDNC 3S93A 2L01A 2X9DA 2E71A 4A3JJ 5HODA 3ZQIA 4CICA 1EKEA 1Q1HA 1LDDA 4C9YA 3L1PA 1F9NA 2KPMA 4GGGA 2O0YA 1TWFJ 2E1MB 3I5UA 3Q0UA 1QRYA 1SVMA 3CUQA 5FFZA 3OL3A 1Z6RA 2D5VA 1WJDA 3RZOJ 5H6QA 1MBFA 2EA2A 2JVHA 4ENKA 1FP1D 3C18A 2ZFWA 3WTVC 2CV1A 2STTA 3KP5A 4OMYA 3HSEA 3REOA 4CGZA 2ZFUA 4HDUA 3BR3A 3PJRA 3WGHA 5DUIA 3F9KA 1AHDP 1D1AA 2QSGX 4ZTFA 4MEXF 3PO2J 1XSXA 4JOMA 3OIQA 2V6CA 2DJIA 2OUMA 2GOMA 4MO7A 4AWXB 1Z0XA 4OU0A 5LGUA 4CYCA 4EJUA 4XKWA 2LOOA 3FM5A 4XMYA 5H20A 2E1CA 4E7JA 1ZRFA 3HRTA 4DQ2A 2H6CA 2QUFA 3R0AA 2JRTA 1BIAA 2X1EA 2QF7A 3TOAA 4LJZF 5J4YA 4MTDA 4NHJA 3CCLI 3U1KA 3S3OA 4FHTA 3E7LA 2R7RA 2QM3A 4A3KJ 2DMTA 2PFBA 2W57A 2DT6A 3IRRA 1STZA 4A5MA 3RPUD 1KYZA 1BI3A 4BQQA 2GBYA 2FNAA 2VOPA 2ZXWH 1P92A 3HRMA 3K70C 4FTHA 4BBSJ 1P4WA 2ZC2A 2EQRA 5LEJA 3GZ5A 3OYFA 2M30A 1JJ8C 4RS8A 4CHUA 3PM1A 1LUJB 5KAFC 4A3BJ 3MCZA 3TP0A 2OCCH 1Z67A 2YSRA 1LEAA 1QVTA 4OAYA 1WJ5A 5E1WA 2EILH 3K69A 5FLVA 4IQ4A 3S2HJ 2R7VA 3H36A 3H9GA 3JRFA 3HB9A 2XGEA 2ZB9A 1LDKB 2MFZA 1LB2A 1SD6A 4BU2A 5HOOA 1B72B 5DUKA 3RKWA 4A0XA 2K40A 3CMYA 1RUOA 2Y2ZA 1NK3P 1E17A 3D5LA 3CCYA 3WTZA 1H89C 5EGOA 1YW9A 1E0EA 2Y0SN 2KISA 3NARA 2R5ZB 1VQ4I 3GTGJ 3ZMTA 4B3AA 4MLOA 1X2MA 1OR7A 5HS8A 2VUMJ 2F4OB 3HOYJ 3V8LA 2LK2A 5C4XJ 1JUSA 3ABKH 3LA3A 4V19K 2VKDA 5LLQA 1KU2A 3OL4A 2VJJA 3K0LA 2CUJA 2DO7A 2KKOA 2PEXA 1GLNA 4N4OB 4DGWB 1I6XA 3WTYC 3QOPA 2VKVA 2W48A 2PJRA 4IQJA 4HW0A 3HXLA 5J8FA 4CSWA 3J81Z 3U2RA 3S2DJ 1O3SA 4B1RA 2XPUA 3MKLA 3HHGA 2K85A 2HQNA 3QPSA 4N9IA 2ZXIA 3TO6A 4UB6C 3K9TA 5BOXA 2Q8KA 1XX5A 2JUGA 2NVYJ 1U9OA 3F8CA 3Q9VA 2XAFA 1G3WA 1R36A 3ZN0A 3TBIA 3AG3H 1EA3A 3HKZN 2FQ4A 5JVGF 2VE8A 2EINH 3DKWA 3BPVA 3JTGA 2EV6A 1TW2A 2L4MA 3H9QA 5FKKA 1MMAA 3R61A 4EM2A 3W2WA 3IC7A 5JLXA 3K1MA 3L2UA 1D5VA 1OYWA 1G8XA 1RC9A 3D5SC 2MC3A 2R7TA 3GLLA 2DXIA 1ZRDA 4KYWA 3BG5A 4E4HA 3CUQB 4HV6A 1EJ9A 2XF7A 4DYCA 2MH9A 1JGGA 1OYIA 3I0TA 4P5OA 2R3SA 2Y30A 2M8EA 5BPIA 5HS7A 3LSGA 2BOLA 4XORA 3I3LA 3DKYA 1G4DA 2F5CA 1WFXA 5JR3A 5C3EJ 1O3QA 3J80Z 2FBIA 3CESA 3DFGA 4G7ZF 5DCMB 2F5EA 1G6NA 5CYVA 3M1EA 1IN5A 2CUZA 2NNYA 2KIMA 2JA6J 3BDDA 2X85A 2VPLA 1JUPA 2XAQA 3GZNB 2DOAA 2BZTA 4E6KG 3IP4B 1KU3A 4Q48A 3H35A 1DUXC 3CC7I 3C1DA 2E1MC 1IJWC 3HRSA 1GXPA 3F23A 3FXMA 5J1RA 3BCAA 3JRAA 1IDZA 1V3FA 1IDYA 1RI7A 1LFPA 1E2XA 2UZKA 1F4KA 3CZ6A 3FXUA 2LRDA 1RZ4A 4U88A 5EG0A 3DV8A 4B4CA 5D4RA 3O2PE 2K4JA 5GAEJ 1IRXA 3ZMUA 2KL4A 4RAYA 3KP7A 4IJAA 1XPXA 1HLVA 2KRCA 1S8NA 5DM7F 1MMGA 5B66C 3OYLA 2F6CA 2KRHA 2FX0A 2A05A 1LNWA 3E5XA 5JHUA 5E1ZB 3LSMA 2NOJB 5LD2C 5ED4A 2PMUA 4CZZA 3KEOA 3FIWA 4NQWA 5GAHJ 3X2QH 4HEA2 3ABTA 2MW8A 2M0CA 1J0RA 4RMNA 3T8TA 2ZJQF 1MSFC 2UWMA 1ZTRA 2BY3A 1LEBA 2TRTA 5FKLA 1XGSA 2HWVA 3CLQA 1U8RA 4Y7NJ 1Z77A 3Q3SA 2OCEA 2VB6A 2XDVA 4ZDPA 2VODA 4S0HB 4E7SA 1Q1VA 5D6FA 4L5EA 1XDSA 5JVTA 3KCCA 2E60A 2RV8A 3WHBA 4EJTA 3IL2A 2Y9YA 4A3FJ 4HV5A 3ECOA 2PMZN 2XRNA 4BYYA 2DJNA 2DOEA 1MNDA 2IT0A 3A01A 2HEOA 1LJ9A 2A68F 3I9V2 1I3QJ 4V2FA 1W4MA 2G0EA 4K2EA 4QWQA 2M7AA 3BJ6A 2BVLA 4QPOA 1AWCA 1R1TA 3I59B 2FU4A 4BKXA 4GYIA 2VQLA 1K6YA 2NVXJ 3KX2A 3ZMZA 1I3AA 2EIMH 3QPHA 3QQAA 2PG4A 4EATA 4LLNA 4A3EJ 1XTAA 4FETA 4ZJZA 2LREA 1GV5A 1MNMC 3TO9A 5LBQA 3JRGA 4HPQA 1X4PA 4M9XA 1QZEA 2BVMA 4XLCA 4UVCA 5LHGA 5A2QZ 2PJRB 3HM5A 2QLZA 2JN6A 1Y6IA 1X1AA 5IT3A 4M71A 2R92J 3BROA 2XKOA 1J59A 1DP7P 1YG2A 3A4CA 3OS0A 2ELJA 4DBRA 1JKRC 5FKNA 1FPQA 1YOVB 2DQLA 1MNEA 4IHSA 2COMA 4KFCA 1F5TA 3OYBA 1XMXA 3M9AA 4BJTA 3L2RA 4HZFA 5CQGA 1B6AA 1D1CA 3O8HA 4RAFA 3V7RA 2WWYA 1A5JA 2O9LA 4D1QA 4LD5A 4G7OF 2EH3A 5J3LA 4RB1A 4BQAA 5IPAA 2M8GX 1REPC 1POGA 3AG4H 3WGIA 4YFKF 2EWNA 2EV5A 2N8GA 3N05A 3G6EI 2QBYA 1EH8A 4I99C 4ZYGA 5HNHA 3ERED 1U3EM 3IUOA 3HG9A 2W25A 2KZVA 5ICFA 5DS9A 1K6OA 2YS9A 4HSTA 4JX5A 2MSYA 2M45A 4YIIA 4EMSA 4IHYA 3BLYA 2ETHA 2L2OA 4S05A 4NB5A 2CJJA 1Y1VJ 3IV5A 3S17J 2MD0A 3SDGA 4BGDA 2ZMEA 4A3CJ 2HNHA 2W24A 3R4KA 3BY6A 2RQQA 1UJ8A 2HQRA 3HUGA 3LL7A 4PDKA 2COBA 5CQEA 3WODF 4Z6YA 4P96A 3MN2A 5DCFA 5L3FA 2CW8A 5DD4A 1RIOH 4E7IA 4L9TA 3LOCA 2GXAA 4EVIA 1FJLA 2EZLA 3OS2A 1ZLKA 2J5OA 2DA3A 4P1WA 5JHFA 2IS4A 3WE2A 3G2BA 4AYBN 3C7JA 3KPHA 2VPRA 4KICA 1KQ9A 4L9VA 4P55A 2YPRA 2CU7A 3DU6A 4IO9F 3R0JA 2BY2A 2L7MP 2F5VA 1TT0A 1PJRA 1GV2A 2MABA 2ZKZA 3JRIA 4CCMA 1BI1A 3A1YA 4M6YA 4NDLA 5GAGJ 3TQNA 1UELB 4KA4A 1Y8QB 4E7HA 4BE2A 3CUQC 2Y75A 2HR3A 2NAZA 1TZLA 1ZG3A 1KU7A 2M1BA 2YR2A 1JJ6C 1LE8A 3VSLA 1K78A 3DP7A 4DW6A 1IRFA 2PBIA 4M3FA 4L0YB 3RKQA 1XMAA 1DP3A 4PSXA 2LTPA 3F0CA 1YW8A 1LFBA 2WB1A 3I64A 1ERDA 3DQVC 4IRIA 1G3TA 3KP6A 1YJ9I 4A3LJ 1EF4A 3OYCA 4XM3A 2EB7A 2EFOA 3SEQA 3VB2A 1Z05A 5IY5H 1MH4A 4X1EA 4C30A 2DT7B 1DGWY 2VT3A 4I98B 2Y0MA 4LG3A 4RLFA 3V7CA 2P5LC 2AQEA 2LY2A 4YG2F 2VI6A 3BQZA 4NBQA 4BXFA 1IF1A 3FF5A 1GXQA 1R9TJ 1B4AA 4D7MA 1RR7A 3OYIA 1G3YA 5K5RA 2P0WA 1DQUA 2RDPA 4BHPA 1TL8A 1IUFA 2VL8A 2L9SA 3JR9A 3ZN1A 3S1RJ 2OQGA 5E79C 3C3WA 3ZQFA 1IN8A 2P6SA 1ON1A 5FD6A 2XGXA 3HSRA 4MTEA 1VQOI 1SAUA 3BR1A 4Q5SF 2ZSHB 1USTA 4A5NA 3D1NI 5IP9J 3A01B 1HXDA 2ME0A 4PFPA 3Q5FA 3RI4A 4UUSB 3DPTA 1OCCH 3PFIA 2FSWA 3FBIB 2PJPA 1V5GA 1XCVA 4B8XA 4XRSA 1T56A 3J7YJ 4LLLA 3BZ6A 2HVRA 1BI0A 2JRMA 3BC8A 4M9ZA 3QAHA 3KP2A 3CDIA 1IRGA 4TV7A 3OYGA 4LGWA 2OV7A 4IKFA 5BMZA 1EH7A 2DPDA 3A03A 3BZKA 4PJLA 2LMDA 5LEKA 2R7OA 3MWMA 3TL4X 1WZ2A 1DGRM 2CG4A 5L3GA 1ZR4A 4RB0A 2CO5A 4JP0A 2FBKA 2M9HA 2MBFA 4ESBA 3E6MA 3OV8A 2I10A 4Y33A 4XNFA 1O7FA 4RDUA 1FX7A 2Q1ZB 1KZHA 3CO7C 2LKSA 4F93B 4XICA 2DK8A 9ANTA 1OCPA 5F08A 2YU3A 3LWFA 2XSDC 2K4BA 3CCRI 4O5VA 2JMWA 2A6EF 2H8WA 2JVGA 4I0BA 2JPCA 2QQ9A 4B44A 3ECHA 2F5DA 1T8IA 1FLIA 3S3NA 1GT0C 1HW1A 1JTYA 4HX8A 1IXRC 4OAZA 3ZQCA 4WK8F 3CJTB 3HTUA 4EQQA 2CQKA 1XC5A 2ADUA 2E2JJ 3GEZA 2V7FA 2HU9A 1F1ZA 1B8IA 1QHGA 3GTQJ 1BJAA 1ETKA 1VQKI 3GTMJ 5ERIA 5M3FJ 2W4SA 3E6BA 2XASA 4MNUA 1S6LA 3MEXA 5FFXA 1D1BA 1UHMA 1HQCA 2FRHA 5FLXK 3HUGB 2WTEA 3PNTA 3L2WA 3G4SI 2DA5A 2EZKA 5EDNA 1ZH5A 1Z9CA 2DDBA 1O7LA 2GA1A 3DPLC 3L09A 3VYSB 3DEUA 1BOBA 3FXLA 4XN0A 3GCMA 3TDZC 3GTOJ 2XGCA 3C2HA 4M3GA 4DYQA 4ON0A 2XB0X 1XSDA 4L18B 4P9FA 2LH9A 2LY9A 1T0FC 2V9KA 1WJFA 2KZGA 1W7PD 2O8XA 4DNCA 1X1BA 4XRFA 3LFKA 4D5FA 2WAFA 4BHBA 5LRRA 4KMUX 1SFEA 3C2GA 1TNTA 3GWZA 1WVRA 2JT1A 3VOEA 2DU9A 1W36D 3O6BB 2ZBKA 2YU9J 4KMFA 4WXHA 2L0KA 1YX5A 2A6HF 3FKJA 3KP4A 1TP4A 1R6RA 3DF8A 4KN7X 1HBXG 1OFCX 3FXQA 1WWXA 1AOYA 4ITVA 4OINF 2OPTA 1K78B 2IGOA 3ABMH 2KHMA 4HG2A 5HDGA 3BTJA 3OOPA 3FMRA 2VE9A 3OOUA 4BQNA 2VQGA 2OZUA 2ACJA 3Q9SA 4N4NB 3ZMDA 3PIOF 5IYDJ 4LK1F 5IOYA 2QSFX 1T98A 3JRDA 2NXNB 4KDPA 3K4LA 2R7SA 1EH6A 5IT9K 1G3SA 3ERMA 4E70A 4D7NA 4U87A 3AAFA 3N97A 4CYDA 2FA5A 1T95A 1UHSA 4G6DA 1H9GA 1D3YA 1BC7C 1YRNA 5LFAA 1MBGA 1HSJA 2V9VA 4Y3OA 2HQAA 4CCKA 2CQXA 2E36A 1BOAA 1S9HA 2FNPA 3EUAA 3LSTA 1R23A 1I1GA 1LKXA 2L9RA 2CSOA 3OSGA 2HYFA 1PP8F 3OIPA 1OKRA 4XLPF 1QBJA 2CMPA 2EA4A 5CVUA 4CA0A 1J5YA 3TMOA 3G73A 1OCRH 1DPUA 3BTIA 2KP6A 3FWEA 3KYCB 1S3JA 1R5GA 1HKTA 1L0OC 2ELHA 1MBJA 4BDZA 3CMEI 3OYJA 2NS0A 3PL8A 3W3CA 3I53A 1B59A 3RCOA 4EEFG 3N4MA 2KJCA 2K3PA 4I09A 3P9CA 3KLNA 5BNGA 4C3HJ 1W7PA 2BEOA 2MLKA 1XMKA 2GM4A 2WY8Q 4GYGA 4BDYA 4H0EA 1ZG5A 3ZQQA 2AS5F 5KCMA 2XPVA 1FP2A 2K27A 2MYSA 3BR5A 5D6EA 2EFWA 4CDGA 3HPHA 5LGNA 1YJWI 3K2ZA 2BXZA 3TW7A 2UXXA 3MZ8A 3P5JA 4A69C 3BR0A 3CJRB 4L9NA 5E17F 2J5PA 4ZC3A 3W6VA 3KZZA 3JREA 2E2IJ 5EZGA 2CUFA 2AHQA 1QZZA 1D8JA 3D5RC 3VSKA 5FKOA 3HEFA 2LF7A 4XQFA 4F52A 2DK5A 3O3KA 1WI3A 1Z6TA 3PUFA 4YIFA 4RGXA 2ECCA 2FOKA 3WTXC 4QLCU 5J6XA 4XRMA 3KYDB 3RJPA 2Y69H 1IZ1A 4Y4RA 3DBHB 1N78A 2LSOA 3F72A 1ZGWA 2R7UA 2Q2EA 3F3XA 3LA7A 4RB3C 1BL0A 4YELA 2HDWA 3ASNH 1BJZA 1BR2A 2IS1A 1AA7A 1FMWA 1MIJA 1PVEA 3IH3A 1FOKA 4EM1A 3CCMI 1BI2A 3G1MA 4L9JA 4BNCA 2BW3A 2HOAA 4II3A 3OYEA 2ESNA 3C2BA 2X1CA 4AM3A 2QEXI 2GQQA 3LAPA 1CF7A 2Z2SB 1NHAA 2NVUB 1MJBA 1JKOC 5K5OA 2WY7Q 1UAAA 2YX7A 3K4MA 3S8PA 4BJ6C 3F8FA 4KIGA 2A6TA 4XONA 1MMDA 4WXCA 4ESFA 2ZCWA 3ELKA 4BXXJ 2P4WA 1WHUA 4A3IJ
chains in the Genus database with same CATH topology
2G7UA 3F8NA 5CVRA 3IKVA 4IPAA 2X0LA 1MGTA 4MQVA 2HYGD 3TOBA 1CGPA 2VC1A 4EV0A 3ZMSA 3M8EA 2A3SA 2VBXA 3BP8A 3RPUA 1ZHFA 3F6VA 3WTWC 3V8JA 2ZNYA 3RYPA 5AIPA 1ON2A 1LDJA 1YQAA 4O3MA 3QU6A 2O6GE 5HVQC 1XDUA 5HS9A 1R58A 3CO6C 5H6RA 3K1NA 3GXOA 1ZLJA 2Z99A 5BPDA 1U2WA 3HHHA 2E7XA 3ROUA 4U0VA 4XSXF 2WV0A 1U6GA 2GWRA 2IA0A 1P4AA 3RIRA 3CDHA 3FM3A 2DI3A 1YW7A 3GFIA 3GF2A 3D0SA 2GAUA 3JAMK 1FBSA 4A6DA 2VC0A 2WC2A 2BGCA 2XKPA 3HYIA 2GA2A 2XV4S 4KIBA 1BM9A 1H0MA 1XGNA 2P7VB 2L02A 1B1BA 3GFMA 1T38A 4IVNA 3NEUA 2FMLA 1SD5A 1BC8C 4HAMA 3VFZA 3V7SA 5D5VB 4G94A 2JZYA 5ICCA 3COAC 4A0YA 3ZMVA 2IJLA 2XUBA 4U7DA 3CTAA 1R22A 2GIVA 3QP5A 4AD9A 1O57A 4LG0A 1YFHA 4OIOF 2CW0F 3PQKA 5E8GA 1J75A 1XGMA 2P5KA 5HLIA 4LFUA 4ZH4F 4JK1X 5E1XA 4OOIA 4U7BA 2XIGA 1TW3A 2MD5A 1HW5A 5FGMA 2PI0A 5DD8A 3M7GA 1RUNA 3VODA 4BHCA 1R00A 1CF7B 4R1HA 3QPTA 2DLLA 3GFJA 3NQOA 3T8RA 1BIBA 4LB5A 2RN7A 2F5FA 2L4AA 3E5UA 5JI6A 4M9SA 1SD4A 3HIFA 4EGYA 5CVVA 4A6EA 1IN4A 2R7DA 4ZYEA 4PGHA 2FQ3A 3ZQ7A 4EM0B 5AONA 2A69F 4RAZA 1T2KA 2ISZA 1YO5C 4L5JA 2DT5A 4MHGA 1SAXA 4B09A 1VTNC 3L7WA 3EQLF 1JE8A 5DYMA 4HLXA 1FC3A 4UUVA 2B0LA 1S7AA 2E7WA 1ZAOA 3GX4X 5AIQA 1FT9A 2H27A 3S2WA 3BJAA 3F21A 1XD7A 1Y0UA 4WCGA 1ZARA 2Z3YA 5CLSA 4I7HA 2DPUA 2VBZA 1KYWA 3F8BA 6PAXA 5D5WB 4WF2A 4ZYDA 2OBPA 2OA4A 3ML6A 4OIQF 1JHFA 2UXNA 1ZRCA 2OD5A 3WTSC 3EDPA 5JFRA 3MFKA 1DPRA 2P5VA 3JTHA 1SMYF 1D8KA 3SHFA 3ZP5A 3TKYA 2CFXA 2HKOA 2YX4A 5DEQA 5KVRA 2QQAA 2X4HA 1YS6A 4MGRA 1YLFA 4M73A 3MQ0A 4M74A 4ENNA 3ZPLA 2Q0OA 2QENA 1WKMA 2LDUA 3FHZA 4BXUA 3IWZA 4G8XA 4M72A 1IN7A 2M5WA 2VN2A 3H3ZA 1P6RA 1PP7U 1BBYA 1WRJA 1SFUA 1KU9A 3ABUA 4N0BA 2OZ6A 2ZJ2A 2EFPA 3B02A 4OIRF 2HOEA 4LK0F 5D5XB 4HOBA 1C0WA 4UXNA 1O3TA 3RKYA 3I4PA 4YFXF 4HYEA 2PMHA 2EV0A 4EJWA 4WWCA 3L00A 3ISPA 4YFNF 5LGTA 2A07F 1OYYA 1HKSA 2HFHA 1J9IA 3SFZA 4GXOA 2QBYB 2VOOA 3I54A 5L3DA 2MH2A 2O03A 5L3CA 1HW2A 1TBXA 2HTJA 1USSA 4PGGA 2QWWA 4M6XA 2VXZA 4ESJA 4AIKA 2HTSA 3P7NA 2R7FA 2ZMEB 3MZYA 4RB2C 5ICGA 1WI9A 1TTYA 3KETA 4HLYA 1JHHA 2KIUA 2W84A 3V4GA 2MLGA 2VBYA 3P9KA 2IA1A 1R7JA 3KP3A 4HF0A 4OMZA 1ODDA 4HF2A 3H3UA 4N9HA 1MZBA 4ZZLA 5F1RA 3GFLA 4HA8A 4EGZA 3WG9A 3E3VA 1QQIA 2JPBA 4ZZDA 1XN7A 1FSHA 2Z5UA 5E18F 3SXYA 5HDNA 2STWA 3J81K 1V4RA 5TRDA 2EK5A 4CO8A 3I58A 2Z9OA 2O3FA 3T5XA 2XAHA 1O3RA 5LRSA 4HQMA 4Y17A 2F2EA 1ONVA 1H9TA 1Z91A 4AIHA 2BBYA 3KEQA 4CXFA 4Z2YA 1TLHB 5ILVA 3JW4A 2HGCA 3HOTA 3RYRA 4O6JA 2QYOA 5DCMA 2AXLA 2P8TA 2JTVA 1W5SA 5D8LB 1BN5A 4UHTA 4WX9A 1GVJA 3J80K 4I0AA 1KQ8A 3HSFA 3BOQA 4BAYA 5K5QA 5D5UB 1P2FA 2JSCA 3ULQB 4AIJA 1IN6A 3SZTA 4HDVA 1EV7A 3DXJF 2K86A 1IAWA 5FD5A 1T6SA 3F6OA 4ETSA 1A04A 3GVAA 5FLXZ 3TGNA 4I02A 1QPMA 4UVAA 1ZGJA 5HLGA 2DAOA 2DW4A 4F7ZA 4FT8A 2K02A 2RC4A 4Q47A 1XGOA 3I59A 3E5QA 4LB6B 3IKTA 5CJ9A 3TO7A 1U5TA 2W85A 3CUOA 1FNNA 3JSPA 3WU1B 1ZREA 4ENJA 1QGPA 1SD7A 4UVBA 3IRQA 4RGRA 1LVAA 3T0YA 1S7OA 3WU0A 3U1DA 2XAGA 2CWEA 2LKPA 3EYYA 2EFNA 1FYMA 5IT9Z 2RQPA 3L2CA 1J2XA 1ZN2A 2M87A 2H94A 2K7LA 4UV8A 1K7AA 5A2QK 1SMTA 2FMYA 5L3EA 2VT2A 2XHKA 4G9YA 3CLOA 3FMQA 1QNTA 2IP2A 1T0FA 2HS5A 3RKXA 2Z33A 3RPQA 3FZVA 4ZYHA 4IRHA 4P9UA 3GW2A 2FEZA 3M8FA 1P4XA 2ESHA 2FF4A 2VONA 3LAJA 4EJVA 2NNNA 3W6JB 3W6KB 2H6BA 2DFIA 2FXAA 2RKHA 3PQJA 3KLOA 3E97A 1J7KA 4OIPF 2ISYA 1KQ0A 2E1NA 1JXSA 2EJRA 3E6DA 2V1DA 4IRGA 2BE5F 1QZYA 4L0ZB 4ENMA 1W7PB 4RGUA 5LHIA 5DV5A 2KRFA 3KZYA 1B9MA 4FX4A 1I5ZA 4JBAA 5FB2A 4PCQA 2PLYA 2OQRA 2NRAC 5L3BA 2PN6A 1MDMA 2IW5A 3T1BA 1RNLA 4UV9A 4IF4A 1YS7A 2C6YA 1MD0A 3BWGA 1IUYA 1UCRA 2FBHA 3QP6A 5EEGA 5TJJA 1FY7A 2XAJA 2IRFG 1ZG1A 1LQ1A 2GXBA 1XB4A 2L3DA 4KNYA 1R1UA 2ZXJA 5E20A 3FX3A 2P6TA 3SQNA 3GLXA 4IXAA 2L54A 1XCBA 4KUMA 3GUDA 4L5IA 4HX4A 4S04A 5K1YA 1XSVA 1TQMA 3EYIA 5D8KB 3IHUA 2FE3A 3R6SA 2KJBA 3NRVA 4MQ9F 1U5TB 5E8IA 4A12A 4Y15A 3H92A 3P9IA 1Z1DA 4GO1A 2ZO4A 1B9NA 1FYLA 2D1VA 1MJAA 3R60A 1TQIA 1SFXA 2IVMA 3LQRA 3HOSA 2H09A 2V1UA 4LLGF 3HTSB 4FX0A 1UFMA 1ZYRF 1FSEA 1MJ9A 5BS6A 4WXDA 5ILUA 4LMYA 4HBLA 2D1HA 1HSTA 3G3ZA 1OMIA 1UHWA 2Y48A 1IXCA 3GO5A 5HLHA 2HKXA 5LHHA 2G7HA 3JAMZ 1FWZA 2A61A 2ZNZA 1X3UA 1Z7UA 3WGGA 2QVOA 2D2WA 1I1SA 4HQEA 4MEYF 3VEPA 5BQTA 3LA2A 3KE2A 3GZ6A 1WSUA 2DTRA 2VBWA 2BV6A 4G6QA 3RTRA 1YTYA 1FBQA 4KT5C 4A2UA 5CVJA 5HDKA 1TQPA 3QU3A 4XLNF 3V8KA 3MZHA 4GCVA 5ICEA 5F6FA 2RVCA 4U0YA 1KGSA 1OPCA 1MDMB 4XSZF 2HZTA 1R5HA 1MKMA 2OU2A 2D45A 1KA8A 2G9WA 2GZWA 2LF8A 2XVCA 3U9GA 1UB9A 4HF1A 3BJOA 2A5YB 4Q4ZF 2PQ8A 4ASNA 4LG0B 4R8HA 4EJOA 3EUHA 3WE3A 3QRFF 4I2OA 5D4SA 4XBFA 3E6CC 1PUEE 3J7AO 1ZGAA 2HDCA 1T39A 3KFWX 1U78A 2TDXA 2RGVA 3FMSA 1FZPB 4G7HF 2DQRA 5FO5A 2V1XA 3WTTC 2XROA 4R79A 2CGPA 3IWFA 2IPQX 5CVIA 3L9FA 1IW7F 5J8CA 2V79A 2RNJA 1FBUA 2DBBA 3F8MA 2P7CB 1JGSA 2QQBA 2OAZA 4RGSA 5KK1A 1U5TC 4KN4X 3LQQA 2NYXA 3GYHX 1YIOA 1TNSA 1DDNA 3B73A 5EEHA 3HRUA 1FYKA 1R1VA 1WQ2A 5DDGA 3SZPA 1I27A 4A0ZA 4PZJA 3I71A 4HX7A 3K1PA 1L3LA 1S29A 3EETA 4JQFA 4U0WA 4D0PA 1W5TA 3MAJA 1QO0D 2EFQA 4IHTA 1ULYA 5ILSA 4UNOA 5F64A 1YYVA 4AVPA 3RDIA 3CJNA 1IXSB 4Y13A 3TDUC 3FXRA 2O61A 3JSOA 2BYVE 1HKQA 2KIFA 2QZ8A 2LNBA 4I01A 3BPXA 2IA2A 2CYYA 4KIFA 4BH9A 2GXGA 2MA3A 3F22A 1GHCA 1K79A 1PDNC 2L01A 4CICA 1Q1HA 1LDDA 1F9NA 4GGGA 2O0YA 3I5UA 3CUQA 5FFZA 1Z6RA 5H6QA 2EA2A 4ENKA 1FP1D 3C18A 2ZFWA 3WTVC 2STTA 3KP5A 4OMYA 3HSEA 3REOA 4CGZA 4HDUA 3WGHA 5DUIA 4MEXF 1XSXA 2V6CA 4AWXB 4OU0A 5LGUA 4EJUA 3FM5A 5H20A 2E1CA 1ZRFA 3HRTA 4DQ2A 2H6CA 2QUFA 3R0AA 2JRTA 1BIAA 3TOAA 4MTDA 4LJZF 4NHJA 4FHTA 2QM3A 2PFBA 2W57A 3IRRA 1STZA 4A5MA 1KYZA 1BI3A 2FNAA 2VOPA 1P92A 3HRMA 1P4WA 5LEJA 3GZ5A 2M30A 4RS8A 4CHUA 3MCZA 2YSRA 1LEAA 5E1WA 3K69A 1LDKB 1LB2A 1SD6A 5HOOA 5DUKA 3RKWA 4A0XA 1RUOA 1E17A 3D5LA 3WTZA 1YW9A 3ZMTA 5HS8A 1OR7A 3V8LA 3LA3A 5LLQA 1KU2A 3K0LA 2DO7A 2KKOA 2PEXA 1I6XA 3WTYC 3QOPA 4HW0A 5J8FA 3J81Z 3U2RA 1O3SA 3HHGA 2HQNA 4N9IA 3TO6A 3K9TA 5BOXA 2Q8KA 3F8CA 3Q9VA 2XAFA 1G3WA 1R36A 3ZN0A 2VE8A 3DKWA 3BPVA 3JTGA 2EV6A 1TW2A 2L4MA 3R61A 4EM2A 3IC7A 3K1MA 1D5VA 1OYWA 2MC3A 1ZRDA 4KYWA 3CUQB 4HV6A 2MH9A 1OYIA 3I0TA 4P5OA 2R3SA 2M8EA 5BPIA 5HS7A 1G4DA 2F5CA 5JR3A 1O3QA 3J80Z 2FBIA 3DFGA 4G7ZF 5DCMB 2F5EA 1G6NA 5CYVA 3M1EA 1IN5A 2NNYA 2KIMA 3BDDA 2XAQA 1KU3A 4Q48A 1DUXC 3C1DA 1GXPA 3HRSA 3F23A 1V3FA 1RI7A 1E2XA 2UZKA 1F4KA 3FXUA 1RZ4A 4U88A 3DV8A 5D4RA 3O2PE 2K4JA 3ZMUA 4RAYA 3KP7A 4IJAA 1S8NA 1LNWA 3E5XA 5JHUA 5E1ZB 5ED4A 2PMUA 4CZZA 3KEOA 4NQWA 3ABTA 3T8TA 1J0RA 2UWMA 1LEBA 1XGSA 2HWVA 1U8RA 2VODA 5D6FA 5JVTA 1XDSA 3KCCA 2RV8A 4EJTA 3IL2A 4HV5A 3ECOA 2XRNA 4BYYA 2IT0A 2HEOA 1LJ9A 2A68F 1W4MA 4K2EA 4QWQA 3BJ6A 1AWCA 1R1TA 3I59B 2FU4A 4GYIA 3ZMZA 3QPHA 4LLNA 2PG4A 3TO9A 5LBQA 4M9XA 4UVCA 5LHGA 5A2QZ 2QLZA 5IT3A 4M71A 3BROA 2XKOA 1J59A 1DP7P 1YG2A 1FPQA 2DQLA 4IHSA 2COMA 4KFCA 1F5TA 3M9AA 4HZFA 1B6AA 2WWYA 3V7RA 4LD5A 4G7OF 4RB1A 4BQAA 1REPC 3WGIA 4YFKF 2EWNA 2EV5A 2QBYA 1EH8A 1U3EM 4ZYGA 3ERED 5ICFA 2W25A 1K6OA 2M45A 4YIIA 4EMSA 2ETHA 4S05A 4NB5A 2ZMEA 2W24A 3R4KA 3WTUC 3BY6A 2HQRA 3HUGA 4PDKA 3WODF 4P96A 5DCFA 5L3FA 5DD4A 1RIOH 4L9TA 4EVIA 1ZLKA 2J5OA 3WE2A 3C7JA 4KICA 1KQ9A 4L9VA 4P55A 2YPRA 3R0JA 2ZKZA 1BI1A 4M6YA 3TQNA 4KA4A 3CUQC 2Y75A 2HR3A 2NAZA 1ZG3A 1KU7A 2M1BA 2YR2A 1K78A 3DP7A 1IRFA 2PBIA 4L0YB 1XMAA 1YW8A 3I64A 3DQVC 4IRIA 1G3TA 3KP6A 2EB7A 2EFOA 3VB2A 1Z05A 2VT3A 4I98B 2Y0MA 3V7CA 2P5LC 4YG2F 1IF1A 3FF5A 1GXQA 1B4AA 1G3YA 5K5RA 2RDPA 4BHPA 3ZN1A 2OQGA 3C3WA 1IN8A 2P6SA 1ON1A 5FD6A 2XGXA 3HSRA 4MTEA 4Q5SF 1USTA 4A5NA 3Q5FA 1HXDA 3RI4A 3DPTA 3PFIA 2FSWA 2PJPA 1XCVA 4B8XA 4LLLA 3BZ6A 1BI0A 4M9ZA 3QAHA 3KP2A 1IRGA 4TV7A 4LGWA 5BMZA 1EH7A 2DPDA 5LEKA 3MWMA 2CG4A 5L3GA 4RB0A 2CO5A 2FBKA 4ESBA 2MBFA 3E6MA 3OV8A 1O7FA 1FX7A 3CO7C 2DK8A 2YU3A 3LWFA 2K4BA 4O5VA 2A6EF 4I0BA 2JPCA 2QQ9A 3ECHA 2F5DA 1FLIA 1HW1A 4HX8A 1IXRC 4WK8F 3HTUA 4EQQA 2CQKA 2ADUA 3GEZA 1F1ZA 1BJAA 5ERIA 3E6BA 2XASA 4MNUA 1S6LA 3MEXA 5FFXA 1UHMA 1HQCA 2FRHA 5FLXK 2WTEA 1ZH5A 1Z9CA 1O7LA 2GA1A 3DPLC 3L09A 3DEUA 3TDZC 4ON0A 1XSDA 4L18B 4P9FA 1W7PD 2O8XA 4DNCA 4XRFA 3LFKA 4BHBA 5LRRA 4KMUX 1SFEA 1TNTA 3GWZA 2JT1A 3VOEA 2DU9A 3O6BB 2ZBKA 4KMFA 4WXHA 2A6HF 3KP4A 3DF8A 4KN7X 1HBXG 3FXQA 1WWXA 1AOYA 4OINF 1K78B 5HDGA 3OOPA 3FMRA 2VE9A 2OZUA 2ACJA 3Q9SA 3ZMDA 4LK1F 1T98A 4KDPA 1EH6A 5IT9K 1G3SA 4E70A 3AAFA 3N97A 4CYDA 2FA5A 4G6DA 1H9GA 1D3YA 1BC7C 1HSJA 2V9VA 1BOAA 3LSTA 2FNPA 1R23A 1I1GA 2CSOA 2HYFA 1PP8F 1OKRA 4XLPF 1QBJA 2EA4A 5CVUA 1J5YA 3G73A 1DPUA 3FWEA 1S3JA 1R5GA 1HKTA 1L0OC 2ELHA 2NS0A 3I53A 1B59A 3N4MA 2KJCA 4I09A 3P9CA 3KLNA 1W7PA 2BEOA 2MLKA 1XMKA 4GYGA 4H0EA 1ZG5A 2AS5F 1FP2A 2K27A 5D6EA 2EFWA 4CDGA 5LGNA 3K2ZA 2UXXA 4L9NA 5E17F 2J5PA 3KZZA 1QZZA 1D8JA 2LF7A 2DK5A 3O3KA 1Z6TA 4YIFA 4RGXA 2FOKA 3WTXC 4QLCU 5J6XA 3RJPA 1IZ1A 2LSOA 3F72A 2Q2EA 3F3XA 3LA7A 4RB3C 1FOKA 4EM1A 1BI2A 4L9JA 4BNCA 2ESNA 2GQQA 3LAPA 1CF7A 1NHAA 1MJBA 5K5OA 2YX7A 3F8FA 4KIGA 4WXCA 4ESFA 2ZCWA 3ELKA 2P4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7U A;  3F8N A;  5CVR A;  3IKV A;  4IPA A;  2X0L A;  1MGT A;  4MQV A;  2HYG D;  3TOB A;  1CGP A;  2VC1 A;  4EV0 A;  3ZMS A;  3M8E A;  2A3S A;  2VBX A;  3BP8 A;  3RPU A;  1ZHF A;  3F6V A;  3WTW C;  3V8J A;  2ZNY A;  3RYP A;  5AIP A;  1ON2 A;  1LDJ A;  1YQA A;  4O3M A;  3QU6 A;  2O6G E;  5HVQ C;  1XDU A;  5HS9 A;  1R58 A;  3CO6 C;  5H6R A;  3K1N A;  3GXO A;  1ZLJ A;  2Z99 A;  5BPD A;  1U2W A;  3HHH A;  2E7X A;  3ROU A;  4U0V A;  4XSX F;  2WV0 A;  1U6G A;  2GWR A;  2IA0 A;  1P4A A;  3RIR A;  3CDH A;  3FM3 A;  2DI3 A;  1YW7 A;  3GFI A;  3GF2 A;  3D0S A;  2GAU A;  3JAM K;  1FBS A;  4A6D A;  2VC0 A;  2WC2 A;  2BGC A;  2XKP A;  3HYI A;  2GA2 A;  2XV4 S;  4KIB A;  1BM9 A;  1H0M A;  1XGN A;  2P7V B;  2L02 A;  1B1B A;  3GFM A;  1T38 A;  4IVN A;  3NEU A;  2FML A;  1SD5 A;  1BC8 C;  4HAM A;  3VFZ A;  3V7S A;  5D5V B;  4G94 A;  2JZY A;  5ICC A;  3COA C;  4A0Y A;  3ZMV A;  2IJL A;  2XUB A;  4U7D A;  3CTA A;  1R22 A;  2GIV A;  3QP5 A;  4AD9 A;  1O57 A;  4LG0 A;  1YFH A;  4OIO F;  2CW0 F;  3PQK A;  5E8G A;  1J75 A;  1XGM A;  2P5K A;  5HLI A;  4LFU A;  4ZH4 F;  4JK1 X;  5E1X A;  4OOI A;  4U7B A;  2XIG A;  1TW3 A;  2MD5 A;  1HW5 A;  5FGM A;  2PI0 A;  5DD8 A;  3M7G A;  1RUN A;  3VOD A;  4BHC A;  1R00 A;  1CF7 B;  4R1H A;  3QPT A;  2DLL A;  3GFJ A;  3NQO A;  3T8R A;  1BIB A;  4LB5 A;  2RN7 A;  2F5F A;  2L4A A;  3E5U A;  5JI6 A;  4M9S A;  1SD4 A;  3HIF A;  4EGY A;  5CVV A;  4A6E A;  1IN4 A;  2R7D A;  4ZYE A;  4PGH A;  2FQ3 A;  3ZQ7 A;  4EM0 B;  5AON A;  2A69 F;  4RAZ A;  1T2K A;  2ISZ A;  1YO5 C;  4L5J A;  2DT5 A;  4MHG A;  1SAX A;  4B09 A;  1VTN C;  3L7W A;  3EQL F;  1JE8 A;  5DYM A;  4HLX A;  1FC3 A;  4UUV A;  2B0L A;  1S7A A;  2E7W A;  1ZAO A;  3GX4 X;  5AIQ A;  1FT9 A;  2H27 A;  3S2W A;  3BJA A;  3F21 A;  1XD7 A;  1Y0U A;  4WCG A;  1ZAR A;  2Z3Y A;  5CLS A;  4I7H A;  2DPU A;  2VBZ A;  1KYW A;  3F8B A;  6PAX A;  5D5W B;  4WF2 A;  4ZYD A;  2OBP A;  2OA4 A;  3ML6 A;  4OIQ F;  1JHF A;  2UXN A;  1ZRC A;  2OD5 A;  3WTS C;  3EDP A;  5JFR A;  3MFK A;  1DPR A;  2P5V A;  3JTH A;  1SMY F;  1D8K A;  3SHF A;  3ZP5 A;  3TKY A;  2CFX A;  2HKO A;  2YX4 A;  5DEQ A;  5KVR A;  2QQA A;  2X4H A;  1YS6 A;  4MGR A;  1YLF A;  4M73 A;  3MQ0 A;  4M74 A;  4ENN A;  3ZPL A;  2Q0O A;  2QEN A;  1WKM A;  2LDU A;  3FHZ A;  4BXU A;  3IWZ A;  4G8X A;  4M72 A;  1IN7 A;  2M5W A;  2VN2 A;  3H3Z A;  1P6R A;  1PP7 U;  1BBY A;  1WRJ A;  1SFU A;  1KU9 A;  3ABU A;  4N0B A;  2OZ6 A;  2ZJ2 A;  2EFP A;  3B02 A;  4OIR F;  2HOE A;  4LK0 F;  5D5X B;  4HOB A;  1C0W A;  4UXN A;  1O3T A;  3RKY A;  3I4P A;  4YFX F;  4HYE A;  2PMH A;  2EV0 A;  4EJW A;  4WWC A;  3L00 A;  3ISP A;  4YFN F;  5LGT A;  2A07 F;  1OYY A;  1HKS A;  2HFH A;  1J9I A;  3SFZ A;  4GXO A;  2QBY B;  2VOO A;  3I54 A;  5L3D A;  2MH2 A;  2O03 A;  5L3C A;  1HW2 A;  1TBX A;  2HTJ A;  1USS A;  4PGG A;  2QWW A;  4M6X A;  2VXZ A;  4ESJ A;  4AIK A;  2HTS A;  3P7N A;  2R7F A;  2ZME B;  3MZY A;  4RB2 C;  5ICG A;  1WI9 A;  1TTY A;  3KET A;  4HLY A;  1JHH A;  2KIU A;  2W84 A;  3V4G A;  2MLG A;  2VBY A;  3P9K A;  2IA1 A;  1R7J A;  3KP3 A;  4HF0 A;  4OMZ A;  1ODD A;  4HF2 A;  3H3U A;  4N9H A;  1MZB A;  4ZZL A;  5F1R A;  3GFL A;  4HA8 A;  4EGZ A;  3WG9 A;  3E3V A;  1QQI A;  2JPB A;  4ZZD A;  1XN7 A;  1FSH A;  2Z5U A;  5E18 F;  3SXY A;  5HDN A;  2STW A;  3J81 K;  1V4R A;  5TRD A;  2EK5 A;  4CO8 A;  3I58 A;  2Z9O A;  2O3F A;  3T5X A;  2XAH A;  1O3R A;  5LRS A;  4HQM A;  4Y17 A;  2F2E A;  1ONV A;  1H9T A;  1Z91 A;  4AIH A;  2BBY A;  3KEQ A;  4CXF A;  4Z2Y A;  1TLH B;  5ILV A;  3JW4 A;  2HGC A;  3HOT A;  3RYR A;  4O6J A;  2QYO A;  5DCM A;  2AXL A;  2P8T A;  2JTV A;  1W5S A;  5D8L B;  1BN5 A;  4UHT A;  4WX9 A;  1GVJ A;  3J80 K;  4I0A A;  1KQ8 A;  3HSF A;  3BOQ A;  4BAY A;  5K5Q A;  5D5U B;  1P2F A;  2JSC A;  3ULQ B;  4AIJ A;  1IN6 A;  3SZT A;  4HDV A;  1EV7 A;  3DXJ F;  2K86 A;  1IAW A;  5FD5 A;  1T6S A;  3F6O A;  4ETS A;  1A04 A;  3GVA A;  5FLX Z;  3TGN A;  4I02 A;  1QPM A;  4UVA A;  1ZGJ A;  5HLG A;  2DAO A;  2DW4 A;  4F7Z A;  4FT8 A;  2K02 A;  2RC4 A;  4Q47 A;  1XGO A;  3I59 A;  3E5Q A;  4LB6 B;  3IKT A;  5CJ9 A;  3TO7 A;  1U5T A;  2W85 A;  3CUO A;  1FNN A;  3JSP A;  3WU1 B;  1ZRE A;  4ENJ A;  1QGP A;  1SD7 A;  4UVB A;  3IRQ A;  4RGR A;  1LVA A;  3T0Y A;  1S7O A;  3WU0 A;  3U1D A;  2XAG A;  2CWE A;  2LKP A;  3EYY A;  2EFN A;  1FYM A;  5IT9 Z;  2RQP A;  3L2C A;  1J2X A;  1ZN2 A;  2M87 A;  2H94 A;  2K7L A;  4UV8 A;  1K7A A;  5A2Q K;  1SMT A;  2FMY A;  5L3E A;  2VT2 A;  2XHK A;  4G9Y A;  3CLO A;  3FMQ A;  1QNT A;  2IP2 A;  1T0F A;  2HS5 A;  3RKX A;  2Z33 A;  3RPQ A;  3FZV A;  4ZYH A;  4IRH A;  4P9U A;  3GW2 A;  2FEZ A;  3M8F A;  1P4X A;  2ESH A;  2FF4 A;  2VON A;  3LAJ A;  4EJV A;  2NNN A;  3W6J B;  3W6K B;  2H6B A;  2DFI A;  2FXA A;  2RKH A;  3PQJ A;  3KLO A;  3E97 A;  1J7K A;  4OIP F;  2ISY A;  1KQ0 A;  2E1N A;  1JXS A;  2EJR A;  3E6D A;  2V1D A;  4IRG A;  2BE5 F;  1QZY A;  4L0Z B;  4ENM A;  1W7P B;  4RGU A;  5LHI A;  5DV5 A;  2KRF A;  3KZY A;  1B9M A;  4FX4 A;  1I5Z A;  4JBA A;  5FB2 A;  4PCQ A;  2PLY A;  2OQR A;  2NRA C;  5L3B A;  2PN6 A;  1MDM A;  2IW5 A;  3T1B A;  1RNL A;  4UV9 A;  4IF4 A;  1YS7 A;  2C6Y A;  1MD0 A;  3BWG A;  1IUY A;  1UCR A;  2FBH A;  3QP6 A;  5EEG A;  5TJJ A;  1FY7 A;  2XAJ A;  2IRF G;  1ZG1 A;  1LQ1 A;  2GXB A;  1XB4 A;  2L3D A;  4KNY A;  1R1U A;  2ZXJ A;  5E20 A;  3FX3 A;  2P6T A;  3SQN A;  3GLX A;  4IXA A;  2L54 A;  1XCB A;  4KUM A;  3GUD A;  4L5I A;  4HX4 A;  4S04 A;  5K1Y A;  1XSV A;  1TQM A;  3EYI A;  5D8K B;  3IHU A;  2FE3 A;  3R6S A;  2KJB A;  3NRV A;  4MQ9 F;  1U5T B;  5E8I A;  4A12 A;  4Y15 A;  3H92 A;  3P9I A;  1Z1D A;  4GO1 A;  2ZO4 A;  1B9N A;  1FYL A;  2D1V A;  1MJA A;  3R60 A;  1TQI A;  1SFX A;  2IVM A;  3LQR A;  3HOS A;  2H09 A;  2V1U A;  4LLG F;  3HTS B;  4FX0 A;  1UFM A;  1ZYR F;  1FSE A;  1MJ9 A;  5BS6 A;  4WXD A;  5ILU A;  4LMY A;  4HBL A;  2D1H A;  1HST A;  3G3Z A;  1OMI A;  1UHW A;  2Y48 A;  1IXC A;  3GO5 A;  5HLH A;  2HKX A;  5LHH A;  2G7H A;  3JAM Z;  1FWZ A;  2A61 A;  2ZNZ A;  1X3U A;  1Z7U A;  3WGG A;  2QVO A;  2D2W A;  1I1S A;  4HQE A;  4MEY F;  3VEP A;  5BQT A;  3LA2 A;  3KE2 A;  3GZ6 A;  1WSU A;  2DTR A;  2VBW A;  2BV6 A;  4G6Q A;  3RTR A;  1YTY A;  1FBQ A;  4KT5 C;  4A2U A;  5CVJ A;  5HDK A;  1TQP A;  3QU3 A;  4XLN F;  3V8K A;  3MZH A;  4GCV A;  5ICE A;  5F6F A;  2RVC A;  4U0Y A;  1KGS A;  1OPC A;  1MDM B;  4XSZ F;  2HZT A;  1R5H A;  1MKM A;  2OU2 A;  2D45 A;  1KA8 A;  2G9W A;  2GZW A;  2LF8 A;  2XVC A;  3U9G A;  1UB9 A;  4HF1 A;  3BJO A;  2A5Y B;  4Q4Z F;  2PQ8 A;  4ASN A;  4LG0 B;  4R8H A;  4EJO A;  3EUH A;  3WE3 A;  3QRF F;  4I2O A;  5D4S A;  4XBF A;  3E6C C;  1PUE E;  3J7A O;  1ZGA A;  2HDC A;  1T39 A;  3KFW X;  1U78 A;  2TDX A;  2RGV A;  3FMS A;  1FZP B;  4G7H F;  2DQR A;  5FO5 A;  2V1X A;  3WTT C;  2XRO A;  4R79 A;  2CGP A;  3IWF A;  2IPQ X;  5CVI A;  3L9F A;  1IW7 F;  5J8C A;  2V79 A;  2RNJ A;  1FBU A;  2DBB A;  3F8M A;  2P7C B;  1JGS A;  2QQB A;  2OAZ A;  4RGS A;  5KK1 A;  1U5T C;  4KN4 X;  3LQQ A;  2NYX A;  3GYH X;  1YIO A;  1TNS A;  1DDN A;  3B73 A;  5EEH A;  3HRU A;  1FYK A;  1R1V A;  1WQ2 A;  5DDG A;  3SZP A;  1I27 A;  4A0Z A;  4PZJ A;  3I71 A;  4HX7 A;  3K1P A;  1L3L A;  1S29 A;  3EET A;  4JQF A;  4U0W A;  4D0P A;  1W5T A;  3MAJ A;  1QO0 D;  2EFQ A;  4IHT A;  1ULY A;  5ILS A;  4UNO A;  5F64 A;  1YYV A;  4AVP A;  3RDI A;  3CJN A;  1IXS B;  4Y13 A;  3TDU C;  3FXR A;  2O61 A;  3JSO A;  2BYV E;  1HKQ A;  2KIF A;  2QZ8 A;  2LNB A;  4I01 A;  3BPX A;  2IA2 A;  2CYY A;  4KIF A;  4BH9 A;  2GXG A;  2MA3 A;  3F22 A;  1GHC A;  1K79 A;  1PDN C;  2L01 A;  4CIC A;  1Q1H A;  1LDD A;  1F9N A;  4GGG A;  2O0Y A;  3I5U A;  3CUQ A;  5FFZ A;  1Z6R A;  5H6Q A;  2EA2 A;  4ENK A;  1FP1 D;  3C18 A;  2ZFW A;  3WTV C;  2STT A;  3KP5 A;  4OMY A;  3HSE A;  3REO A;  4CGZ A;  4HDU A;  3WGH A;  5DUI A;  4MEX F;  1XSX A;  2V6C A;  4AWX B;  4OU0 A;  5LGU A;  4EJU A;  3FM5 A;  5H20 A;  2E1C A;  1ZRF A;  3HRT A;  4DQ2 A;  2H6C A;  2QUF A;  3R0A A;  2JRT A;  1BIA A;  3TOA A;  4MTD A;  4LJZ F;  4NHJ A;  4FHT A;  2QM3 A;  2PFB A;  2W57 A;  3IRR A;  1STZ A;  4A5M A;  1KYZ A;  1BI3 A;  2FNA A;  2VOP A;  1P92 A;  3HRM A;  1P4W A;  5LEJ A;  3GZ5 A;  2M30 A;  4RS8 A;  4CHU A;  3MCZ A;  2YSR A;  1LEA A;  5E1W A;  3K69 A;  1LDK B;  1LB2 A;  1SD6 A;  5HOO A;  5DUK A;  3RKW A;  4A0X A;  1RUO A;  1E17 A;  3D5L A;  3WTZ A;  1YW9 A;  3ZMT A;  5HS8 A;  1OR7 A;  3V8L A;  3LA3 A;  5LLQ A;  1KU2 A;  3K0L A;  2DO7 A;  2KKO A;  2PEX A;  1I6X A;  3WTY C;  3QOP A;  4HW0 A;  5J8F A;  3J81 Z;  3U2R A;  1O3S A;  3HHG A;  2HQN A;  4N9I A;  3TO6 A;  3K9T A;  5BOX A;  2Q8K A;  3F8C A;  3Q9V A;  2XAF A;  1G3W A;  1R36 A;  3ZN0 A;  2VE8 A;  3DKW A;  3BPV A;  3JTG A;  2EV6 A;  1TW2 A;  2L4M A;  3R61 A;  4EM2 A;  3IC7 A;  3K1M A;  1D5V A;  1OYW A;  2MC3 A;  1ZRD A;  4KYW A;  3CUQ B;  4HV6 A;  2MH9 A;  1OYI A;  3I0T A;  4P5O A;  2R3S A;  2M8E A;  5BPI A;  5HS7 A;  1G4D A;  2F5C A;  5JR3 A;  1O3Q A;  3J80 Z;  2FBI A;  3DFG A;  4G7Z F;  5DCM B;  2F5E A;  1G6N A;  5CYV A;  3M1E A;  1IN5 A;  2NNY A;  2KIM A;  3BDD A;  2XAQ A;  1KU3 A;  4Q48 A;  1DUX C;  3C1D A;  1GXP A;  3HRS A;  3F23 A;  1V3F A;  1RI7 A;  1E2X A;  2UZK A;  1F4K A;  3FXU A;  1RZ4 A;  4U88 A;  3DV8 A;  5D4R A;  3O2P E;  2K4J A;  3ZMU A;  4RAY A;  3KP7 A;  4IJA A;  1S8N A;  1LNW A;  3E5X A;  5JHU A;  5E1Z B;  5ED4 A;  2PMU A;  4CZZ A;  3KEO A;  4NQW A;  3ABT A;  3T8T A;  1J0R A;  2UWM A;  1LEB A;  1XGS A;  2HWV A;  1U8R A;  2VOD A;  5D6F A;  5JVT A;  1XDS A;  3KCC A;  2RV8 A;  4EJT A;  3IL2 A;  4HV5 A;  3ECO A;  2XRN A;  4BYY A;  2IT0 A;  2HEO A;  1LJ9 A;  2A68 F;  1W4M A;  4K2E A;  4QWQ A;  3BJ6 A;  1AWC A;  1R1T A;  3I59 B;  2FU4 A;  4GYI A;  3ZMZ A;  3QPH A;  4LLN A;  2PG4 A;  3TO9 A;  5LBQ A;  4M9X A;  4UVC A;  5LHG A;  5A2Q Z;  2QLZ A;  5IT3 A;  4M71 A;  3BRO A;  2XKO A;  1J59 A;  1DP7 P;  1YG2 A;  1FPQ A;  2DQL A;  4IHS A;  2COM A;  4KFC A;  1F5T A;  3M9A A;  4HZF A;  1B6A A;  2WWY A;  3V7R A;  4LD5 A;  4G7O F;  4RB1 A;  4BQA A;  1REP C;  3WGI A;  4YFK F;  2EWN A;  2EV5 A;  2QBY A;  1EH8 A;  1U3E M;  4ZYG A;  3ERE D;  5ICF A;  2W25 A;  1K6O A;  2M45 A;  4YII A;  4EMS A;  2ETH A;  4S05 A;  4NB5 A;  2ZME A;  2W24 A;  3R4K A;  3WTU C;  3BY6 A;  2HQR A;  3HUG A;  4PDK A;  3WOD F;  4P96 A;  5DCF A;  5L3F A;  5DD4 A;  1RIO H;  4L9T A;  4EVI A;  1ZLK A;  2J5O A;  3WE2 A;  3C7J A;  4KIC A;  1KQ9 A;  4L9V A;  4P55 A;  2YPR A;  3R0J A;  2ZKZ A;  1BI1 A;  4M6Y A;  3TQN A;  4KA4 A;  3CUQ C;  2Y75 A;  2HR3 A;  2NAZ A;  1ZG3 A;  1KU7 A;  2M1B A;  2YR2 A;  1K78 A;  3DP7 A;  1IRF A;  2PBI A;  4L0Y B;  1XMA A;  1YW8 A;  3I64 A;  3DQV C;  4IRI A;  1G3T A;  3KP6 A;  2EB7 A;  2EFO A;  3VB2 A;  1Z05 A;  2VT3 A;  4I98 B;  2Y0M A;  3V7C A;  2P5L C;  4YG2 F;  1IF1 A;  3FF5 A;  1GXQ A;  1B4A A;  1G3Y A;  5K5R A;  2RDP A;  4BHP A;  3ZN1 A;  2OQG A;  3C3W A;  1IN8 A;  2P6S A;  1ON1 A;  5FD6 A;  2XGX A;  3HSR A;  4MTE A;  4Q5S F;  1UST A;  4A5N A;  3Q5F A;  1HXD A;  3RI4 A;  3DPT A;  3PFI A;  2FSW A;  2PJP A;  1XCV A;  4B8X A;  4LLL A;  3BZ6 A;  1BI0 A;  4M9Z A;  3QAH A;  3KP2 A;  1IRG A;  4TV7 A;  4LGW A;  5BMZ A;  1EH7 A;  2DPD A;  5LEK A;  3MWM A;  2CG4 A;  5L3G A;  4RB0 A;  2CO5 A;  2FBK A;  4ESB A;  2MBF A;  3E6M A;  3OV8 A;  1O7F A;  1FX7 A;  3CO7 C;  2DK8 A;  2YU3 A;  3LWF A;  2K4B A;  4O5V A;  2A6E F;  4I0B A;  2JPC A;  2QQ9 A;  3ECH A;  2F5D A;  1FLI A;  1HW1 A;  4HX8 A;  1IXR C;  4WK8 F;  3HTU A;  4EQQ A;  2CQK A;  2ADU A;  3GEZ A;  1F1Z A;  1BJA A;  5ERI A;  3E6B A;  2XAS A;  4MNU A;  1S6L A;  3MEX A;  5FFX A;  1UHM A;  1HQC A;  2FRH A;  5FLX K;  2WTE A;  1ZH5 A;  1Z9C A;  1O7L A;  2GA1 A;  3DPL C;  3L09 A;  3DEU A;  3TDZ C;  4ON0 A;  1XSD A;  4L18 B;  4P9F A;  1W7P D;  2O8X A;  4DNC A;  4XRF A;  3LFK A;  4BHB A;  5LRR A;  4KMU X;  1SFE A;  1TNT A;  3GWZ A;  2JT1 A;  3VOE A;  2DU9 A;  3O6B B;  2ZBK A;  4KMF A;  4WXH A;  2A6H F;  3KP4 A;  3DF8 A;  4KN7 X;  1HBX G;  3FXQ A;  1WWX A;  1AOY A;  4OIN F;  1K78 B;  5HDG A;  3OOP A;  3FMR A;  2VE9 A;  2OZU A;  2ACJ A;  3Q9S A;  3ZMD A;  4LK1 F;  1T98 A;  4KDP A;  1EH6 A;  5IT9 K;  1G3S A;  4E70 A;  3AAF A;  3N97 A;  4CYD A;  2FA5 A;  4G6D A;  1H9G A;  1D3Y A;  1BC7 C;  1HSJ A;  2V9V A;  1BOA A;  3LST A;  2FNP A;  1R23 A;  1I1G A;  2CSO A;  2HYF A;  1PP8 F;  1OKR A;  4XLP F;  1QBJ A;  2EA4 A;  5CVU A;  1J5Y A;  3G73 A;  1DPU A;  3FWE A;  1S3J A;  1R5G A;  1HKT A;  1L0O C;  2ELH A;  2NS0 A;  3I53 A;  1B59 A;  3N4M A;  2KJC A;  4I09 A;  3P9C A;  3KLN A;  1W7P A;  2BEO A;  2MLK A;  1XMK A;  4GYG A;  4H0E A;  1ZG5 A;  2AS5 F;  1FP2 A;  2K27 A;  5D6E A;  2EFW A;  4CDG A;  5LGN A;  3K2Z A;  2UXX A;  4L9N A;  5E17 F;  2J5P A;  3KZZ A;  1QZZ A;  1D8J A;  2LF7 A;  2DK5 A;  3O3K A;  1Z6T A;  4YIF A;  4RGX A;  2FOK A;  3WTX C;  4QLC U;  5J6X A;  3RJP A;  1IZ1 A;  2LSO A;  3F72 A;  2Q2E A;  3F3X A;  3LA7 A;  4RB3 C;  1FOK A;  4EM1 A;  1BI2 A;  4L9J A;  4BNC A;  2ESN A;  2GQQ A;  3LAP A;  1CF7 A;  1NHA A;  1MJB A;  5K5O A;  2YX7 A;  3F8F A;  4KIG A;  4WXC A;  4ESF A;  2ZCW A;  3ELK A;  2P4W A; 
#chains in the Genus database with same CATH topology
 2G7U A;  3F8N A;  5CVR A;  2XSJ C;  1ETQ A;  3IKV A;  4IPA A;  3VPR A;  1O4X A;  2KFD A;  1MGT A;  2X0L A;  2HYG D;  1ZK8 A;  4MQV A;  5IOZ A;  3TOB A;  4A3M J;  2VC1 A;  4JX4 A;  1CGP A;  4EV0 A;  3ZMS A;  3M8E A;  2A3S A;  2VBX A;  3BP8 A;  3RPU A;  5M5W J;  1ZHF A;  3F6V A;  4UY8 I;  3WTW C;  3QYF A;  2HI3 A;  3V8J A;  3HJE A;  1QPI A;  1Z3Y A;  2HQ5 A;  2ZNY A;  2CUE A;  1W5C C;  3HOZ J;  4IOC F;  2RAE A;  2FUG 2;  4IOA F;  1AU7 A;  3RYP A;  5AIP A;  1OLT A;  1ON2 A;  4J00 A;  3DTK A;  1LDJ A;  1YQA A;  2ELK A;  4O3M A;  3QU6 A;  3RZD J;  2HZD A;  2O6G E;  3H5N A;  3UKG A;  3U21 A;  5HVQ C;  3FXK A;  4DIQ A;  3IH4 A;  5M5Y J;  1OCT C;  3IH2 A;  3BTL A;  4KIS A;  2CQN A;  2IBD A;  1XDU A;  3AG2 H;  5HS9 A;  1R58 A;  3CO6 C;  2LBF A;  3KEY A;  5H6R A;  3K1N A;  3GXO A;  1ZLJ A;  2Z99 A;  3DEE A;  3H5R A;  5BPD A;  1U2W A;  1JI8 A;  2EIK H;  3HHH A;  2X1D A;  2FOW A;  4LIU A;  2E7X A;  1SFK A;  2HDD A;  1RET A;  3ROU A;  2DFF A;  3K70 D;  4U0V A;  4XSX F;  1HDP A;  1ZKG A;  2WV0 A;  2LFB A;  3W2V A;  1U6G A;  2GWR A;  2IA0 A;  1YRN B;  1P4A A;  2JUC A;  3RIR A;  3CDH A;  1TWG J;  5B5E C;  2XGD A;  1FOW A;  3FM3 A;  4C2U A;  1ETV A;  2DI3 A;  4CYC B;  1YW7 A;  4CZC A;  1TWH J;  2OTL I;  3GFI A;  3PNY A;  3GF2 A;  3D0S A;  2GAU A;  2NS8 A;  4M3E A;  3JAM K;  1FOX A;  5E3M A;  1FBS A;  3NWT A;  3RQI A;  4A6D A;  1VQ8 I;  2VJ4 A;  3DTI A;  2X6O A;  2VC0 A;  3BQY A;  2WC2 A;  4B43 A;  2BGC A;  2XKP A;  3HYI A;  2GA2 A;  2XV4 S;  3S1N J;  4KIB A;  3EUH C;  4RM2 A;  3NWS A;  3A2K A;  1BM9 A;  5C4J J;  1K61 A;  1N77 A;  2DN0 A;  1H0M A;  1XGN A;  2P7V B;  2L02 A;  1B1B A;  3GFM A;  1T38 A;  1V54 H;  4IVN A;  1SVO A;  3G1O A;  1OJL A;  2HPI A;  3NEU A;  2FML A;  1SD5 A;  3PSI A;  1BC8 C;  4HAM A;  4DZP A;  3HOV J;  3DU5 A;  3VFZ A;  3TW6 A;  3V7S A;  5D5V B;  3JRH A;  4G94 A;  3IAM 2;  3CCJ I;  2K9S A;  2A5W A;  2JZY A;  5ICC A;  2Z1D A;  4G12 A;  3COA C;  2F48 A;  2XF6 A;  4XRS G;  4A0Y A;  3DBR B;  4F55 A;  1VQ5 I;  4F91 B;  4BJ5 C;  3ZMV A;  2IJL A;  2XUB A;  3J7A Y;  3S32 A;  4U7D A;  3CTA A;  4OWR B;  1R22 A;  3OYD A;  2GIV A;  1RPW A;  2JA7 J;  3QP5 A;  4BEH A;  2VKE A;  4AD9 A;  5KNL A;  1YHQ I;  5EGO B;  1O57 A;  2DTZ A;  1G59 A;  4LG0 A;  4C2M J;  1UG2 A;  1YFH A;  2CW0 F;  1X1P A;  4OIO F;  3PQK A;  1YX3 A;  1UG0 A;  5E8G A;  1MSE C;  1J75 A;  1XGM A;  2P5K A;  5HLI A;  4LFU A;  4ZH4 F;  1D5Y A;  4JK1 X;  5E1X A;  5F27 A;  5H2F C;  2WAQ A;  2F4I A;  4OOI A;  4C3I J;  4I6Z A;  4U7B A;  2XIG A;  1TW3 A;  2MD5 A;  1VQ9 I;  1HW5 A;  5FGM A;  3A02 A;  4D5C A;  2PI0 A;  1RES A;  5EZH A;  5B1A H;  2BW3 B;  3PUB A;  5DD8 A;  3M7G A;  3OMY A;  1VQP I;  1VI0 A;  2DOF A;  1RUN A;  3VOD A;  4BHC A;  1R00 A;  1CF7 B;  4R1H A;  3QPT A;  2MG4 A;  2DLL A;  2HXI A;  3OYM A;  3GFJ A;  3NQO A;  3T8R A;  2GLO A;  1BIB A;  4LB5 A;  2RN7 A;  4CCO A;  2F5F A;  2L4A A;  4QPQ A;  3E5U A;  3S16 J;  2V6E A;  5JI6 A;  4M9S A;  1Y39 A;  1BA5 A;  1SD4 A;  3HIF A;  4EGY A;  5CVV A;  1MBH A;  4A6E A;  1IN4 A;  2LVS A;  2R7D A;  1X58 A;  5K7Z A;  4ZYE A;  4PGH A;  1VQN I;  4ZDO A;  1WPK A;  2FQ3 A;  4RAG A;  2L5Q A;  1HF0 A;  3ZQ7 A;  2VXD A;  3PO3 J;  3LSK A;  4EM0 B;  5AON A;  1S7E A;  2A69 F;  4RAZ A;  4BUP A;  1WCM J;  5CPR B;  2R7X A;  3DBL B;  1T2K A;  4AU7 A;  2ISZ A;  2V26 A;  1Z7L A;  1YO5 C;  4IHV A;  1D0Y A;  4L5J A;  3LSR A;  3K10 A;  1PUF A;  1VQM I;  2DT5 A;  4GDF A;  4MHG A;  5M3M J;  1SAX A;  1HCR A;  4B09 A;  1FTT A;  2R7Q A;  5EJC A;  4ZYA A;  4FQG A;  2VJI A;  1VTN C;  3L7W A;  3EQL F;  1JE8 A;  1HOM A;  5DYM A;  4HLX A;  3J7Z I;  1FC3 A;  3CCU I;  3FXJ A;  2L9N A;  3AFH A;  1MMN A;  4UUV A;  2B0L A;  3BR6 A;  1S7A A;  2E7W A;  3QYE A;  4BY7 J;  1ZAO A;  3GX4 X;  4X0G A;  5AIQ A;  2H1K A;  1FT9 A;  4NC7 A;  2DMN A;  1Y0N A;  2M4K A;  4H4K C;  2H27 A;  3S2W A;  3BJA A;  3F21 A;  5TGT A;  1WJB A;  1XD7 A;  1Y0U A;  3WG7 H;  4WCG A;  3ZQL A;  1HC8 A;  3FKI J;  1ZAR A;  4BE0 A;  2Z3Y A;  5CLS A;  4I7H A;  5KHD A;  4BY1 J;  2DPU A;  2VBZ A;  5IYB J;  1KYW A;  3F8B A;  3FK6 A;  6PAX A;  1AKH A;  3OY9 A;  3MMY B;  5D5W B;  4WF2 A;  3HPG A;  4ZYD A;  2OBP A;  2OA4 A;  3ML6 A;  4OIQ F;  1JHF A;  5EG0 B;  1V5E A;  1Z21 A;  2UXN A;  2K9N A;  1ZRC A;  2OD5 A;  3WTS C;  2FJ1 A;  2K3F A;  3EDP A;  5JFR A;  3MFK A;  1DPR A;  3ZR8 X;  3LNQ A;  2P5V A;  3JTH A;  2DMQ A;  1SMY F;  3M8J A;  1D8K A;  3SHF A;  3ZP5 A;  3BG3 A;  3TKY A;  2CFX A;  2HKO A;  2YX4 A;  4NQW B;  5DEQ A;  1ACI A;  1SVL A;  5KVR A;  2QQA A;  2X4H A;  1YS6 A;  4MGR A;  1YLF A;  4M73 A;  1K4S A;  3LSP A;  1R71 A;  3MQ0 A;  4IHX A;  3BR2 A;  4M74 A;  4ENN A;  2E34 A;  4JYK A;  1JT0 A;  3ZPL A;  3ZQG A;  2Q0O A;  5E3O A;  4FCY A;  2QEN A;  4AVZ A;  1WKM A;  4PJJ A;  2LDU A;  3FHZ A;  2GIZ A;  4BXU A;  3G1L A;  3IWZ A;  4G8X A;  2YUS A;  1IN7 A;  4M72 A;  4BEH B;  2AXT C;  2M5W A;  2Y0S A;  2LKX A;  2VN2 A;  3LSI A;  2VJ5 A;  1WJC A;  3H3Z A;  1P6R A;  1PP7 U;  1BBY A;  1WRJ A;  3LFU A;  4XL9 A;  1SFU A;  1D0Z A;  1TWC J;  3B6A A;  3CCE I;  3DWL E;  3GTL J;  1KU9 A;  3ABU A;  4N0B A;  5FJ8 J;  3CJQ B;  2XC7 A;  4ANJ A;  3LSJ A;  2OZ6 A;  2ZJ2 A;  2EFP A;  3QWL A;  2R7W A;  3B02 A;  1G2H A;  1R4N B;  1T33 A;  4OIR F;  2HOE A;  3OIO A;  4ZDL A;  1K4T A;  2DCE A;  4LK0 F;  5D5X B;  1TWA J;  4HOB A;  2XB5 A;  5HNF A;  1C0W A;  2B63 J;  2OTJ I;  5FRN A;  4UXN A;  1O3T A;  3GME A;  3RKY A;  3I56 I;  3I4P A;  2R7Z J;  4YFX F;  4HYE A;  2LG4 A;  5TIS C;  2IGK A;  2PMH A;  4XID A;  2EV0 A;  1MBE A;  2K9Q A;  1OR7 C;  4II2 A;  2IAI A;  2JA2 A;  3K4N A;  4EJW A;  5FRM A;  4WWC A;  3L00 A;  2CRG A;  2JSP A;  3ISP A;  1JT6 A;  4YFN F;  5LGT A;  1WH5 A;  2O7O A;  1X1D A;  2A07 F;  1OYY A;  1HKS A;  5KAI C;  2HFH A;  1J9I A;  3SFZ A;  3HKZ A;  3BZC A;  4GXO A;  2QBY B;  3BT9 A;  2VOO A;  3I54 A;  5L3D A;  1PUF B;  1I39 A;  2MH2 A;  2O03 A;  5L3C A;  2DDA A;  1HW2 A;  2W7N A;  3L2Q A;  1TBX A;  2HTJ A;  1A36 A;  1JKP C;  4CH7 A;  1V55 H;  2M0M A;  1USS A;  4PGG A;  2QWW A;  4M6X A;  1B72 A;  2VXZ A;  4ESJ A;  4AIK A;  3OYN A;  5F0F A;  3H0D A;  2HTS A;  2Y31 A;  4D9J A;  3S1M J;  3P7N A;  3QOE A;  2R7F A;  5DM6 F;  2ZME B;  3MZY A;  1GUU A;  3CF2 A;  4I76 A;  4RB2 C;  5ICG A;  3HGY A;  3PNV A;  2VQH A;  3H0G J;  5JLW A;  3E1S A;  1WI9 A;  3FXO A;  1TTY A;  3KET A;  4HLY A;  1JHH A;  3OR1 C;  1J09 A;  4IEJ A;  4PJN A;  5FRO A;  3G71 I;  2I5U A;  4ZTJ A;  2KIU A;  1JUM A;  1P7I A;  3SFI A;  4HF2 A;  5C44 J;  2W84 A;  3V4G A;  1DU6 A;  1P7J A;  2MLG A;  2VBY A;  2LYC A;  3P9K A;  4LIT A;  2IA1 A;  1R7J A;  3KP3 A;  1ITY A;  4HF0 A;  4V2G A;  3UNG C;  4OMZ A;  2B9S A;  4QTR A;  3WHC A;  1ODD A;  1QHH D;  2JK3 A;  3ESW B;  1MZB A;  2ZSI B;  3H3U A;  3K7A J;  4N9H A;  1NTC A;  3VYU B;  4ZZL A;  5F1R A;  3GFL A;  3HBL A;  4HA8 A;  4EGZ A;  1AKH B;  1TT5 B;  2KLO A;  3WG9 A;  3E3V A;  3LMM A;  1LE8 B;  2KIQ A;  1QQI A;  2JPB A;  3AL0 B;  4ZZD A;  5IP6 A;  1XN7 A;  2OF7 A;  1LPQ A;  1FSH A;  3GTJ J;  2Z5U A;  3JCU C;  5E18 F;  3SXY A;  5HDN A;  2M2E A;  2STW A;  2L7F P;  2CH0 A;  3M07 A;  3J81 K;  1V4R A;  5TRD A;  2EK5 A;  3I55 I;  4B47 A;  4CO8 A;  1Y8R B;  3I58 A;  2Z9O A;  2O3F A;  3CMA I;  2K9L A;  5F0C A;  1YJN I;  3JRC A;  3T5X A;  2OJE D;  2XAH A;  1O3R A;  4Y52 J;  3JRB A;  4NC6 A;  5LRS A;  3EUK L;  4HQM A;  4Y17 A;  2F2E A;  1ONV A;  1LVK A;  3K4B A;  1H9T A;  1Z91 A;  4AIH A;  2BBY A;  3KEQ A;  1X3Z B;  4CXF A;  1VZ0 A;  2QCO A;  4Z2Y A;  2PMZ A;  4J19 A;  1VQ6 I;  1TLH B;  4XOT A;  4HNU A;  2HPM A;  5ILV A;  3JW4 A;  3O8G A;  4XN3 A;  2HGC A;  3HOT A;  5EYR A;  1H8A C;  3UR3 C;  3RYR A;  5F1J A;  1A35 A;  1MMS A;  4O6J A;  3SZG A;  2QYO A;  1ETO A;  3PSF A;  2AXL A;  5DCM A;  2P8T A;  3GTP J;  1OCO H;  2JTV A;  1W5S A;  2HXO A;  5D8L B;  1S72 I;  4W1U A;  2CV2 A;  1BN5 A;  1OQY A;  2CV0 A;  1WGX A;  4UHT A;  4WX9 A;  3K4C A;  1Z3X A;  4QSH A;  1GVJ A;  4BAC A;  2QA4 I;  2CFO A;  1CQT A;  3CC2 I;  3J80 K;  4I0A A;  1OIS A;  3MKW B;  4XKV A;  1KQ8 A;  3HSF A;  3BOQ A;  4BAY A;  5K5Q A;  1P2F A;  2JSC A;  2K9M A;  3K4J A;  3ULQ B;  2JJ7 A;  5D5U B;  4AIJ A;  4MIM A;  1IN6 A;  1YE9 A;  2OC6 A;  2WB1 N;  4PJ0 C;  4UUT A;  3SZT A;  4DZJ A;  1EV7 A;  3DXJ F;  4HDV A;  1T08 B;  2HVS A;  2K86 A;  1IAW A;  2ID6 A;  5FD5 A;  3K2A A;  1T6S A;  2DOD A;  3F6O A;  4ETS A;  1N25 A;  1H88 C;  1A04 A;  2AQF A;  1F43 A;  4YEJ A;  2ECB A;  3GVA A;  4RM3 A;  2WBM A;  4BE1 A;  1A31 A;  3FK7 A;  5FLX Z;  2WAD A;  2CQQ A;  3TGN A;  4I02 A;  2P81 A;  3MKY B;  1QPM A;  2VAS A;  2DMU A;  2WA0 A;  2VKH A;  3OYH A;  4UVA A;  2L7Z A;  3RSN A;  2QKL B;  1ZGJ A;  5HLG A;  1B8I B;  1VND A;  2DAO A;  4AID A;  3BG6 A;  2ICW G;  4NC8 A;  2DW4 A;  5GPC A;  2DFE A;  4F7Z A;  2LC2 A;  2K02 A;  4FT8 A;  3ZGK A;  4PJM A;  1Y1W J;  2RC4 A;  2V1N A;  1TC3 C;  2XAU A;  3HOU J;  3VYR B;  4Q47 A;  4KT6 A;  1XGO A;  3I59 A;  3E5Q A;  4LB6 B;  3IKT A;  5GTH C;  4MFE A;  5CJ9 A;  3TO7 A;  1U5T A;  2NVT J;  2W85 A;  3CUO A;  1FNN A;  3DEW A;  4X6A J;  4AYB A;  3JSP A;  3WU1 B;  1ZRE A;  1QGP A;  1SD7 A;  4ENJ A;  4UVB A;  3VWB A;  2PX9 A;  3M4O J;  2KQR A;  3IRQ A;  3HL2 A;  1LFU P;  4RGR A;  5B1B H;  1LVA A;  1FIA A;  3T0Y A;  3CD6 I;  1S7O A;  3WU0 A;  3U1D A;  2XAG A;  3I4N J;  2CWE A;  2ZME C;  2LKP A;  3EYY A;  2EFN A;  2IXS A;  4IX7 A;  2RQP A;  3L2C A;  1J2X A;  1ZN2 A;  1FYM A;  5IT9 Z;  3OSF A;  1KON A;  2M87 A;  2XF5 A;  2IEK A;  3AG1 H;  1MW7 A;  2H94 A;  1ZEL A;  2X48 A;  2K7L A;  4UV8 A;  1YI2 I;  4LIV A;  1K7A A;  5A2Q K;  4AUX A;  1SMT A;  2FMY A;  5L3E A;  4NUB A;  2VT2 A;  2XHK A;  4G9Y A;  3CLO A;  3FMQ A;  1QNT A;  4XLH A;  1M1E B;  2IP2 A;  4F3Q A;  1QVU A;  1T0F A;  1BW5 A;  2HS5 A;  3M3Y J;  4YRV A;  3RKX A;  2Z33 A;  1ETY A;  3RPQ A;  3MKZ A;  3FZV A;  1GDT A;  4ZYH A;  2R0Q C;  4IRH A;  2E5Z A;  4P9U A;  3GW2 A;  2FEZ A;  1N75 A;  3ZXS A;  1OCZ H;  4FAS D;  3ZCO A;  2B7E A;  3M8F A;  3AKZ A;  1NH3 A;  1U9N A;  4M3D A;  1P4X A;  3HZJ A;  3AL0 C;  4XR6 A;  5K7F A;  2ESH A;  2FF4 A;  3CP2 A;  5CKT A;  2JQ7 A;  2VON A;  3LAJ A;  2R5Y A;  4EJV A;  2UUZ A;  2NNN A;  3W6J B;  2JA5 J;  1NK2 P;  3BG9 A;  2O8K A;  1X3W B;  3W6K B;  4IZZ A;  1RR8 C;  1VQL I;  2H6B A;  2DFI A;  2FXA A;  2RKH A;  2BHY A;  3PQJ A;  3KLO A;  2L7K A;  3E97 A;  3WTU C;  4GFB A;  1J7K A;  2KDO A;  1W0U A;  4OIP F;  4BQO A;  1VQ7 I;  2ISY A;  2W00 A;  2EIJ H;  3EPZ A;  3RQ4 A;  1KQ0 A;  2E1N A;  1JXS A;  2EJR A;  2Z16 A;  3E6D A;  4DYR A;  2V1D A;  4IRG A;  2BE5 F;  1QZY A;  4L0Z B;  1A6I A;  4ENM A;  3ZRG A;  1W7P B;  4RGU A;  5LHI A;  5E3L A;  5DV5 A;  2RNG A;  2FD5 A;  3GTK J;  2KRF A;  4M6V A;  3KZY A;  1B9M A;  4FX4 A;  1I5Z A;  4JBA A;  5FB2 A;  4PCQ A;  1FMV A;  2PLY A;  2OQR A;  2NRA C;  5L3B A;  2PN6 A;  1FOY A;  2IW5 A;  1MDM A;  3CCV I;  1ZQ3 P;  2AO9 A;  2TCT A;  3T1B A;  1RNL A;  1JTX A;  1WJA A;  4BBR J;  3OYA A;  2E2H J;  3KZI C;  3TED A;  4UV9 A;  4IF4 A;  1YS7 A;  3FIS A;  3Q0W A;  2C6Y A;  1MD0 A;  5J40 A;  3BWG A;  2HOT A;  1UMQ A;  1IUY A;  1UCR A;  2FBH A;  3QP6 A;  5EEG A;  5TJJ A;  5J4V A;  2EPF A;  1FY7 A;  2XAJ A;  2IRF G;  1ZG1 A;  2EZI A;  1LQ1 A;  2GXB A;  1XB4 A;  2DYS H;  2L3D A;  4KNY A;  2HYJ A;  1R1U A;  2ZXJ A;  2QSH X;  5E20 A;  4PFO A;  3E0J B;  3FX3 A;  4FE7 A;  3VYT B;  2Y9Z A;  2P6T A;  2DFH A;  3MD2 A;  2Q2E B;  2UV1 A;  3CF5 F;  3SDB A;  2HVQ A;  3SQN A;  3DPU A;  4YIR X;  3GLX A;  2M34 A;  4IXA A;  4J01 A;  2L54 A;  1XCB A;  4KUM A;  3GUD A;  4L5I A;  4HX4 A;  5F0H A;  4S04 A;  1U0J A;  2DA4 A;  5K1Y A;  1XSV A;  3CCQ I;  1TQM A;  3EYI A;  2M3A A;  1X19 A;  5D8K B;  4XOP A;  4UUS A;  2RRE A;  3IHU A;  2FE3 A;  3R6S A;  2KJB A;  3NRV A;  4MQ9 F;  1U5T B;  5E8I A;  2X51 A;  4ABZ A;  4A12 A;  2X6X A;  2L9V A;  4Y15 A;  4B3X A;  3H92 A;  3P9I A;  1Z1D A;  4GO1 A;  2ZO4 A;  3PIP F;  2QGU A;  1FTZ A;  2V4J C;  2XRL A;  1RKT A;  4CCN A;  2KT0 A;  1B9N A;  2LR8 A;  1FYL A;  2D1V A;  1MJA A;  3R60 A;  1TQI A;  3BG7 A;  4C2T A;  3DCF A;  1SFX A;  2IVM A;  3GBG A;  1SFO J;  3LQR A;  5J1Y A;  3HOS A;  2H09 A;  2V1U A;  4AC0 A;  4LLG F;  3HTS B;  4FX0 A;  1UFM A;  1ZYR F;  2E1O A;  2IGM A;  1IG7 A;  3FHN A;  4XLE A;  3W2A A;  1FIP A;  1WH7 A;  2VIX A;  1FSE A;  2X6Y A;  1PYV A;  1HDD C;  2M7B A;  2IS6 A;  1MJ9 A;  4E7L A;  2H8R A;  2E5N A;  2ZXH A;  5BS6 A;  4WXD A;  1X1C A;  5ILU A;  4LMY A;  4HBL A;  2D1H A;  1HST A;  3M1C A;  1IGN A;  1A6Q A;  4W97 A;  1F36 A;  1ETX A;  2DA6 A;  2NS7 A;  4RA2 A;  3G3Z A;  3SYT A;  1OMI A;  4DOZ A;  2LBF B;  1UHW A;  2I8D A;  1BR1 A;  1E3H A;  3H9J A;  2Y48 A;  3CMM A;  3MVP A;  1GVD A;  1IXC A;  3GO5 A;  5HLH A;  2HKX A;  5LHH A;  2BXY A;  1IV6 A;  4CCJ A;  2G7H A;  4FE4 A;  3JAM Z;  2ZJP F;  1SC7 A;  5GP9 A;  1JKQ C;  1FWZ A;  2JA8 J;  1RRJ A;  2A61 A;  2ZNZ A;  1X3U A;  1Z7U A;  3WGG A;  2QVO A;  2D2W A;  5J47 A;  1I1S A;  4HQE A;  1IC8 A;  4MEY F;  3VEP A;  3VDX A;  2CQ7 A;  5BQT A;  2R5Y B;  2E35 A;  3LA2 A;  3OWT A;  3KE2 A;  3H3V K;  3TP3 A;  3GZ6 A;  2VQC A;  1Y56 A;  4UB8 C;  4LOC A;  1WSU A;  5K7H A;  2DTR A;  2VBW A;  3BCB A;  4E7K A;  4HSR A;  2BV6 A;  4G6Q A;  3RTR A;  1YTY A;  1FBQ A;  2EBI A;  3QOD A;  4KT5 C;  3S3M A;  4CCL A;  1VFC A;  4A2U A;  5CVJ A;  2IS2 A;  2VLA A;  3DLL F;  5HDK A;  3HDD A;  1I50 J;  3PFY A;  1TQP A;  3QU3 A;  4XLN F;  1APL C;  4G6T B;  4A93 J;  4DBQ A;  2DA7 A;  3V8K A;  3MZH A;  4GCV A;  5ICE A;  2F4M B;  2QKM B;  5F6F A;  4HNV A;  1SEU A;  2ZJR F;  2RVC A;  4U0Y A;  1KGS A;  1OPC A;  1MDM B;  2BY1 A;  4XSZ F;  2HZT A;  4MFD A;  3CCS I;  1R5H A;  4KIT B;  3H1C A;  1MKM A;  2LY1 A;  2OU2 A;  2NVQ J;  1FEX A;  2D45 A;  4HNT A;  1SAN A;  1KA8 A;  3OYK A;  4FIS A;  2G9W A;  3CDL A;  2DMP A;  2GZW A;  1RKW A;  5F04 A;  1ETW A;  1YIJ I;  3HOW J;  2W82 A;  1D0X A;  2LF8 A;  1NG6 A;  2XPW A;  2XVC A;  4PK4 A;  3U9G A;  1UB9 A;  2CW7 A;  3BJO A;  4HF1 A;  2A5Y B;  2NOG A;  5IYC J;  4M3B A;  4Q4Z F;  2PQ8 A;  4ASN A;  1U8B A;  2V9P A;  2JWT A;  4A3D J;  3DKX A;  1I6H J;  4LG0 B;  4R8H A;  2LLK A;  4EJO A;  3NAU A;  5M5X J;  2R4G A;  3EUH A;  3S14 J;  1W36 C;  4XK4 A;  3KYL A;  3WE3 A;  3QRF F;  4I2O A;  2DYR H;  1XG1 A;  5D4S A;  3CC4 I;  2GOX B;  4XBF A;  3E6C C;  1PUE E;  3J7A O;  1R4M B;  1ZGA A;  5HLT A;  2HDC A;  4XKB A;  1T39 A;  5IP7 J;  1IRZ A;  3KFW X;  1U78 A;  2TDX A;  3WU2 C;  2M4G A;  2RGV A;  3FMS A;  5EF6 A;  1FZP B;  2K5C A;  3FDY A;  3DLA A;  4RLQ A;  2ME6 A;  1IO2 A;  5EEA A;  4G7H F;  2DQR A;  5FO5 A;  5J1U A;  2V1X A;  3WTT C;  3V42 A;  1S5L C;  2R93 J;  3ABL H;  2XRO A;  3S15 J;  4R79 A;  2WAE A;  4XLF A;  3IWF A;  2CGP A;  4XLA A;  2IPQ X;  5CVI A;  3L9F A;  1IV8 A;  3OR2 C;  1IW7 F;  2MGQ A;  5J8C A;  2V79 A;  1W1W E;  3K6G A;  2RNJ A;  4PSW A;  1FBU A;  3QPL A;  3ZOB A;  3ZQH A;  2DBB A;  1R49 A;  3F8M A;  1MBK A;  3HGG A;  2E19 A;  3OS1 A;  2P7C B;  1QU3 A;  1JGS A;  1BW6 A;  2QQB A;  1ZR2 A;  2OAZ A;  4IHW A;  4RGS A;  1WJE A;  5KK1 A;  4F92 B;  2ID3 A;  3HOX J;  1U5T C;  2LP0 A;  4KN4 X;  1QA6 A;  4GRI A;  3LQQ A;  2X6W A;  4E7Z A;  1MH3 A;  3I4M J;  2NYX A;  3GYH X;  1YIO A;  1K83 J;  1TNS A;  1UZC A;  1DDN A;  3B73 A;  5EEH A;  3K4K A;  3HRU A;  1YIT I;  1FYK A;  1X2N A;  1R1V A;  1WQ2 A;  5DDG A;  2R5Z A;  4C3J J;  4BS9 A;  1BR4 A;  3SZP A;  1I27 A;  4KJZ A;  4A0Z A;  2W1O A;  4IL6 C;  2BHZ A;  5E3N A;  2WV1 A;  3DTE A;  2MC4 A;  4PZJ A;  3I71 A;  2WAQ N;  3H5A A;  3QYB A;  2BY0 A;  3K1P A;  4HX7 A;  5FLM J;  2KMU A;  1L3L A;  1S29 A;  4CUG A;  4BL0 B;  1DU0 A;  3EET A;  4DJA A;  2O5R A;  4JQF A;  4U0W A;  4D0P A;  3ASO H;  4A3G J;  5B3S H;  2CS3 A;  1W5T A;  1X4O A;  5GAD J;  2EZH A;  5FKM A;  1E3O C;  3CQZ J;  3MAJ A;  1QO0 D;  2EFQ A;  2IGN A;  3Q0V A;  4NNJ A;  1XS9 A;  4HRI A;  1VF9 A;  4IHT A;  1ULY A;  5ILS A;  4JX6 A;  4UNO A;  5F64 A;  1YYV A;  3SJM A;  4AVP A;  2LD5 A;  3L2V A;  3RDI A;  3CJN A;  1W0T A;  1P9Q C;  3BTC A;  1NG7 A;  1HA8 A;  1ORK A;  1IXS B;  4QIW N;  4Y13 A;  1E3P A;  3TDU C;  5DTD A;  4B48 A;  3FXR A;  3S1Q J;  2O61 A;  3JSO A;  2BYV E;  3IAS 2;  4RBO A;  3LSH A;  1HKQ A;  2KIF A;  2QZ8 A;  2KDZ A;  1ENH A;  2H1L A;  2LNB A;  2QQ8 A;  3A0B C;  4I01 A;  3CP8 A;  3BPX A;  1V5F A;  2CYY A;  2IA2 A;  4KIF A;  4XKC A;  4PUS A;  4BH9 A;  1R5I D;  3SEZ A;  2GXG A;  2DA1 A;  2HOS A;  5GTI C;  3KIO A;  3HC7 A;  2MA3 A;  2DA2 A;  5GPA A;  3F22 A;  1GHC A;  3ONQ A;  1K79 A;  3FBN B;  3B6C A;  3A0H C;  1PDN C;  3S93 A;  2L01 A;  2X9D A;  2E71 A;  4A3J J;  5HOD A;  3ZQI A;  4CIC A;  1EKE A;  1Q1H A;  1LDD A;  4C9Y A;  3L1P A;  1F9N A;  2KPM A;  4GGG A;  2O0Y A;  1TWF J;  2E1M B;  3I5U A;  3Q0U A;  1QRY A;  1SVM A;  3CUQ A;  5FFZ A;  3OL3 A;  1Z6R A;  2D5V A;  1WJD A;  3RZO J;  5H6Q A;  1MBF A;  2EA2 A;  2JVH A;  4ENK A;  1FP1 D;  3C18 A;  2ZFW A;  3WTV C;  2CV1 A;  2STT A;  3KP5 A;  4OMY A;  3HSE A;  3REO A;  4CGZ A;  2ZFU A;  4HDU A;  3BR3 A;  3PJR A;  3WGH A;  5DUI A;  3F9K A;  1AHD P;  1D1A A;  2QSG X;  4ZTF A;  4MEX F;  3PO2 J;  1XSX A;  4JOM A;  3OIQ A;  2V6C A;  2DJI A;  2OUM A;  2GOM A;  4MO7 A;  4AWX B;  1Z0X A;  4OU0 A;  5LGU A;  4CYC A;  4EJU A;  4XKW A;  2LOO A;  3FM5 A;  4XMY A;  5H20 A;  2E1C A;  4E7J A;  1ZRF A;  3HRT A;  4DQ2 A;  2H6C A;  2QUF A;  3R0A A;  2JRT A;  1BIA A;  2X1E A;  2QF7 A;  3TOA A;  4LJZ F;  5J4Y A;  4MTD A;  4NHJ A;  3CCL I;  3U1K A;  3S3O A;  4FHT A;  3E7L A;  2R7R A;  2QM3 A;  4A3K J;  2DMT A;  2PFB A;  2W57 A;  2DT6 A;  3IRR A;  1STZ A;  4A5M A;  3RPU D;  1KYZ A;  1BI3 A;  4BQQ A;  2GBY A;  2FNA A;  2VOP A;  2ZXW H;  1P92 A;  3HRM A;  3K70 C;  4FTH A;  4BBS J;  1P4W A;  2ZC2 A;  2EQR A;  5LEJ A;  3GZ5 A;  3OYF A;  2M30 A;  1JJ8 C;  4RS8 A;  4CHU A;  3PM1 A;  1LUJ B;  5KAF C;  4A3B J;  3MCZ A;  3TP0 A;  2OCC H;  1Z67 A;  2YSR A;  1LEA A;  1QVT A;  4OAY A;  1WJ5 A;  5E1W A;  2EIL H;  3K69 A;  5FLV A;  4IQ4 A;  3S2H J;  2R7V A;  3H36 A;  3H9G A;  3JRF A;  3HB9 A;  2XGE A;  2ZB9 A;  1LDK B;  2MFZ A;  1LB2 A;  1SD6 A;  4BU2 A;  5HOO A;  1B72 B;  5DUK A;  3RKW A;  4A0X A;  2K40 A;  3CMY A;  1RUO A;  2Y2Z A;  1NK3 P;  1E17 A;  3D5L A;  3CCY A;  3WTZ A;  1H89 C;  5EGO A;  1YW9 A;  1E0E A;  2Y0S N;  2KIS A;  3NAR A;  2R5Z B;  1VQ4 I;  3GTG J;  3ZMT A;  4B3A A;  4MLO A;  1X2M A;  1OR7 A;  5HS8 A;  2VUM J;  2F4O B;  3HOY J;  3V8L A;  2LK2 A;  5C4X J;  1JUS A;  3ABK H;  3LA3 A;  4V19 K;  2VKD A;  5LLQ A;  1KU2 A;  3OL4 A;  2VJJ A;  3K0L A;  2CUJ A;  2DO7 A;  2KKO A;  2PEX A;  1GLN A;  4N4O B;  4DGW B;  1I6X A;  3WTY C;  3QOP A;  2VKV A;  2W48 A;  2PJR A;  4IQJ A;  4HW0 A;  3HXL A;  5J8F A;  4CSW A;  3J81 Z;  3U2R A;  3S2D J;  1O3S A;  4B1R A;  2XPU A;  3MKL A;  3HHG A;  2K85 A;  2HQN A;  3QPS A;  4N9I A;  2ZXI A;  3TO6 A;  4UB6 C;  3K9T A;  5BOX A;  2Q8K A;  1XX5 A;  2JUG A;  2NVY J;  1U9O A;  3F8C A;  3Q9V A;  2XAF A;  1G3W A;  1R36 A;  3ZN0 A;  3TBI A;  3AG3 H;  1EA3 A;  3HKZ N;  2FQ4 A;  5JVG F;  2VE8 A;  2EIN H;  3DKW A;  3BPV A;  3JTG A;  2EV6 A;  1TW2 A;  2L4M A;  3H9Q A;  5FKK A;  1MMA A;  3R61 A;  4EM2 A;  3W2W A;  3IC7 A;  5JLX A;  3K1M A;  3L2U A;  1D5V A;  1OYW A;  1G8X A;  1RC9 A;  3D5S C;  2MC3 A;  2R7T A;  3GLL A;  2DXI A;  1ZRD A;  4KYW A;  3BG5 A;  4E4H A;  3CUQ B;  4HV6 A;  1EJ9 A;  2XF7 A;  4DYC A;  2MH9 A;  1JGG A;  1OYI A;  3I0T A;  4P5O A;  2R3S A;  2Y30 A;  2M8E A;  5BPI A;  5HS7 A;  3LSG A;  2BOL A;  4XOR A;  3I3L A;  3DKY A;  1G4D A;  2F5C A;  1WFX A;  5JR3 A;  5C3E J;  1O3Q A;  3J80 Z;  2FBI A;  3CES A;  3DFG A;  4G7Z F;  5DCM B;  2F5E A;  1G6N A;  5CYV A;  3M1E A;  1IN5 A;  2CUZ A;  2NNY A;  2KIM A;  2JA6 J;  3BDD A;  2X85 A;  2VPL A;  1JUP A;  2XAQ A;  3GZN B;  2DOA A;  2BZT A;  4E6K G;  3IP4 B;  1KU3 A;  4Q48 A;  3H35 A;  1DUX C;  3CC7 I;  3C1D A;  2E1M C;  1IJW C;  3HRS A;  1GXP A;  3F23 A;  3FXM A;  5J1R A;  3BCA A;  3JRA A;  1IDZ A;  1V3F A;  1IDY A;  1RI7 A;  1LFP A;  1E2X A;  2UZK A;  1F4K A;  3CZ6 A;  3FXU A;  2LRD A;  1RZ4 A;  4U88 A;  5EG0 A;  3DV8 A;  4B4C A;  5D4R A;  3O2P E;  2K4J A;  5GAE J;  1IRX A;  3ZMU A;  2KL4 A;  4RAY A;  3KP7 A;  4IJA A;  1XPX A;  1HLV A;  2KRC A;  1S8N A;  5DM7 F;  1MMG A;  5B66 C;  3OYL A;  2F6C A;  2KRH A;  2FX0 A;  2A05 A;  1LNW A;  3E5X A;  5JHU A;  5E1Z B;  3LSM A;  2NOJ B;  5LD2 C;  5ED4 A;  2PMU A;  4CZZ A;  3KEO A;  3FIW A;  4NQW A;  5GAH J;  3X2Q H;  4HEA 2;  3ABT A;  2MW8 A;  2M0C A;  1J0R A;  4RMN A;  3T8T A;  2ZJQ F;  1MSF C;  2UWM A;  1ZTR A;  2BY3 A;  1LEB A;  2TRT A;  5FKL A;  1XGS A;  2HWV A;  3CLQ A;  1U8R A;  4Y7N J;  1Z77 A;  3Q3S A;  2OCE A;  2VB6 A;  2XDV A;  4ZDP A;  2VOD A;  4S0H B;  4E7S A;  1Q1V A;  5D6F A;  4L5E A;  1XDS A;  5JVT A;  3KCC A;  2E60 A;  2RV8 A;  3WHB A;  4EJT A;  3IL2 A;  2Y9Y A;  4A3F J;  4HV5 A;  3ECO A;  2PMZ N;  2XRN A;  4BYY A;  2DJN A;  2DOE A;  1MND A;  2IT0 A;  3A01 A;  2HEO A;  1LJ9 A;  2A68 F;  3I9V 2;  1I3Q J;  4V2F A;  1W4M A;  2G0E A;  4K2E A;  4QWQ A;  2M7A A;  3BJ6 A;  2BVL A;  4QPO A;  1AWC A;  1R1T A;  3I59 B;  2FU4 A;  4BKX A;  4GYI A;  2VQL A;  1K6Y A;  2NVX J;  3KX2 A;  3ZMZ A;  1I3A A;  2EIM H;  3QPH A;  3QQA A;  2PG4 A;  4EAT A;  4LLN A;  4A3E J;  1XTA A;  4FET A;  4ZJZ A;  2LRE A;  1GV5 A;  1MNM C;  3TO9 A;  5LBQ A;  3JRG A;  4HPQ A;  1X4P A;  4M9X A;  1QZE A;  2BVM A;  4XLC A;  4UVC A;  5LHG A;  5A2Q Z;  2PJR B;  3HM5 A;  2QLZ A;  2JN6 A;  1Y6I A;  1X1A A;  5IT3 A;  4M71 A;  2R92 J;  3BRO A;  2XKO A;  1J59 A;  1DP7 P;  1YG2 A;  3A4C A;  3OS0 A;  2ELJ A;  4DBR A;  1JKR C;  5FKN A;  1FPQ A;  1YOV B;  2DQL A;  1MNE A;  4IHS A;  2COM A;  4KFC A;  1F5T A;  3OYB A;  1XMX A;  3M9A A;  4BJT A;  3L2R A;  4HZF A;  5CQG A;  1B6A A;  1D1C A;  3O8H A;  4RAF A;  3V7R A;  2WWY A;  1A5J A;  2O9L A;  4D1Q A;  4LD5 A;  4G7O F;  2EH3 A;  5J3L A;  4RB1 A;  4BQA A;  5IPA A;  2M8G X;  1REP C;  1POG A;  3AG4 H;  3WGI A;  4YFK F;  2EWN A;  2EV5 A;  2N8G A;  3N05 A;  3G6E I;  2QBY A;  1EH8 A;  4I99 C;  4ZYG A;  5HNH A;  3ERE D;  1U3E M;  3IUO A;  3HG9 A;  2W25 A;  2KZV A;  5ICF A;  5DS9 A;  1K6O A;  2YS9 A;  4HST A;  4JX5 A;  2MSY A;  2M45 A;  4YII A;  4EMS A;  4IHY A;  3BLY A;  2ETH A;  2L2O A;  4S05 A;  4NB5 A;  2CJJ A;  1Y1V J;  3IV5 A;  3S17 J;  2MD0 A;  3SDG A;  4BGD A;  2ZME A;  4A3C J;  2HNH A;  2W24 A;  3R4K A;  3BY6 A;  2RQQ A;  1UJ8 A;  2HQR A;  3HUG A;  3LL7 A;  4PDK A;  2COB A;  5CQE A;  3WOD F;  4Z6Y A;  4P96 A;  3MN2 A;  5DCF A;  5L3F A;  2CW8 A;  5DD4 A;  1RIO H;  4E7I A;  4L9T A;  3LOC A;  2GXA A;  4EVI A;  1FJL A;  2EZL A;  3OS2 A;  1ZLK A;  2J5O A;  2DA3 A;  4P1W A;  5JHF A;  2IS4 A;  3WE2 A;  3G2B A;  4AYB N;  3C7J A;  3KPH A;  2VPR A;  4KIC A;  1KQ9 A;  4L9V A;  4P55 A;  2YPR A;  2CU7 A;  3DU6 A;  4IO9 F;  3R0J A;  2BY2 A;  2L7M P;  2F5V A;  1TT0 A;  1PJR A;  1GV2 A;  2MAB A;  2ZKZ A;  3JRI A;  4CCM A;  1BI1 A;  3A1Y A;  4M6Y A;  4NDL A;  5GAG J;  3TQN A;  1UEL B;  4KA4 A;  1Y8Q B;  4E7H A;  4BE2 A;  3CUQ C;  2Y75 A;  2HR3 A;  2NAZ A;  1TZL A;  1ZG3 A;  1KU7 A;  2M1B A;  2YR2 A;  1JJ6 C;  1LE8 A;  3VSL A;  1K78 A;  3DP7 A;  4DW6 A;  1IRF A;  2PBI A;  4M3F A;  4L0Y B;  3RKQ A;  1XMA A;  1DP3 A;  4PSX A;  2LTP A;  3F0C A;  1YW8 A;  1LFB A;  2WB1 A;  3I64 A;  1ERD A;  3DQV C;  4IRI A;  1G3T A;  3KP6 A;  1YJ9 I;  4A3L J;  1EF4 A;  3OYC A;  4XM3 A;  2EB7 A;  2EFO A;  3SEQ A;  3VB2 A;  1Z05 A;  5IY5 H;  1MH4 A;  4X1E A;  4C30 A;  2DT7 B;  1DGW Y;  2VT3 A;  4I98 B;  2Y0M A;  4LG3 A;  4RLF A;  3V7C A;  2P5L C;  2AQE A;  2LY2 A;  4YG2 F;  2VI6 A;  3BQZ A;  4NBQ A;  4BXF A;  1IF1 A;  3FF5 A;  1GXQ A;  1R9T J;  1B4A A;  4D7M A;  1RR7 A;  3OYI A;  1G3Y A;  5K5R A;  2P0W A;  1DQU A;  2RDP A;  4BHP A;  1TL8 A;  1IUF A;  2VL8 A;  2L9S A;  3JR9 A;  3ZN1 A;  3S1R J;  2OQG A;  5E79 C;  3C3W A;  3ZQF A;  1IN8 A;  2P6S A;  1ON1 A;  5FD6 A;  2XGX A;  3HSR A;  4MTE A;  1VQO I;  1SAU A;  3BR1 A;  4Q5S F;  2ZSH B;  1UST A;  4A5N A;  3D1N I;  5IP9 J;  3A01 B;  1HXD A;  2ME0 A;  4PFP A;  3Q5F A;  3RI4 A;  4UUS B;  3DPT A;  1OCC H;  3PFI A;  2FSW A;  3FBI B;  2PJP A;  1V5G A;  1XCV A;  4B8X A;  4XRS A;  1T56 A;  3J7Y J;  4LLL A;  3BZ6 A;  2HVR A;  1BI0 A;  2JRM A;  3BC8 A;  4M9Z A;  3QAH A;  3KP2 A;  3CDI A;  1IRG A;  4TV7 A;  3OYG A;  4LGW A;  2OV7 A;  4IKF A;  5BMZ A;  1EH7 A;  2DPD A;  3A03 A;  3BZK A;  4PJL A;  2LMD A;  5LEK A;  2R7O A;  3MWM A;  3TL4 X;  1WZ2 A;  1DGR M;  2CG4 A;  5L3G A;  1ZR4 A;  4RB0 A;  2CO5 A;  4JP0 A;  2FBK A;  2M9H A;  2MBF A;  4ESB A;  3E6M A;  3OV8 A;  2I10 A;  4Y33 A;  4XNF A;  1O7F A;  4RDU A;  1FX7 A;  2Q1Z B;  1KZH A;  3CO7 C;  2LKS A;  4F93 B;  4XIC A;  2DK8 A;  9ANT A;  1OCP A;  5F08 A;  2YU3 A;  3LWF A;  2XSD C;  2K4B A;  3CCR I;  4O5V A;  2JMW A;  2A6E F;  2H8W A;  2JVG A;  4I0B A;  2JPC A;  2QQ9 A;  4B44 A;  3ECH A;  2F5D A;  1T8I A;  1FLI A;  3S3N A;  1GT0 C;  1HW1 A;  1JTY A;  4HX8 A;  1IXR C;  4OAZ A;  3ZQC A;  4WK8 F;  3CJT B;  3HTU A;  4EQQ A;  2CQK A;  1XC5 A;  2ADU A;  2E2J J;  3GEZ A;  2V7F A;  2HU9 A;  1F1Z A;  1B8I A;  1QHG A;  3GTQ J;  1BJA A;  1ETK A;  1VQK I;  3GTM J;  5ERI A;  5M3F J;  2W4S A;  3E6B A;  2XAS A;  4MNU A;  1S6L A;  3MEX A;  5FFX A;  1D1B A;  1UHM A;  1HQC A;  2FRH A;  5FLX K;  3HUG B;  2WTE A;  3PNT A;  3L2W A;  3G4S I;  2DA5 A;  2EZK A;  5EDN A;  1ZH5 A;  1Z9C A;  2DDB A;  1O7L A;  2GA1 A;  3DPL C;  3L09 A;  3VYS B;  3DEU A;  1BOB A;  3FXL A;  4XN0 A;  3GCM A;  3TDZ C;  3GTO J;  2XGC A;  3C2H A;  4M3G A;  4DYQ A;  4ON0 A;  2XB0 X;  1XSD A;  4L18 B;  4P9F A;  2LH9 A;  2LY9 A;  1T0F C;  2V9K A;  1WJF A;  2KZG A;  1W7P D;  2O8X A;  4DNC A;  1X1B A;  4XRF A;  3LFK A;  4D5F A;  2WAF A;  4BHB A;  5LRR A;  4KMU X;  1SFE A;  3C2G A;  1TNT A;  3GWZ A;  1WVR A;  2JT1 A;  3VOE A;  2DU9 A;  1W36 D;  3O6B B;  2ZBK A;  2YU9 J;  4KMF A;  4WXH A;  2L0K A;  1YX5 A;  2A6H F;  3FKJ A;  3KP4 A;  1TP4 A;  1R6R A;  3DF8 A;  4KN7 X;  1HBX G;  1OFC X;  3FXQ A;  1WWX A;  1AOY A;  4ITV A;  4OIN F;  2OPT A;  1K78 B;  2IGO A;  3ABM H;  2KHM A;  4HG2 A;  5HDG A;  3BTJ A;  3OOP A;  3FMR A;  2VE9 A;  3OOU A;  4BQN A;  2VQG A;  2OZU A;  2ACJ A;  3Q9S A;  4N4N B;  3ZMD A;  3PIO F;  5IYD J;  4LK1 F;  5IOY A;  2QSF X;  1T98 A;  3JRD A;  2NXN B;  4KDP A;  3K4L A;  2R7S A;  1EH6 A;  5IT9 K;  1G3S A;  3ERM A;  4E70 A;  4D7N A;  4U87 A;  3AAF A;  3N97 A;  4CYD A;  2FA5 A;  1T95 A;  1UHS A;  4G6D A;  1H9G A;  1D3Y A;  1BC7 C;  1YRN A;  5LFA A;  1MBG A;  1HSJ A;  2V9V A;  4Y3O A;  2HQA A;  4CCK A;  2CQX A;  2E36 A;  1BOA A;  1S9H A;  2FNP A;  3EUA A;  3LST A;  1R23 A;  1I1G A;  1LKX A;  2L9R A;  2CSO A;  3OSG A;  2HYF A;  1PP8 F;  3OIP A;  1OKR A;  4XLP F;  1QBJ A;  2CMP A;  2EA4 A;  5CVU A;  4CA0 A;  1J5Y A;  3TMO A;  3G73 A;  1OCR H;  1DPU A;  3BTI A;  2KP6 A;  3FWE A;  3KYC B;  1S3J A;  1R5G A;  1HKT A;  1L0O C;  2ELH A;  1MBJ A;  4BDZ A;  3CME I;  3OYJ A;  2NS0 A;  3PL8 A;  3W3C A;  3I53 A;  1B59 A;  3RCO A;  4EEF G;  3N4M A;  2KJC A;  2K3P A;  4I09 A;  3P9C A;  3KLN A;  5BNG A;  4C3H J;  1W7P A;  2BEO A;  2MLK A;  1XMK A;  2GM4 A;  2WY8 Q;  4GYG A;  4BDY A;  4H0E A;  1ZG5 A;  3ZQQ A;  2AS5 F;  5KCM A;  2XPV A;  1FP2 A;  2K27 A;  2MYS A;  3BR5 A;  5D6E A;  2EFW A;  4CDG A;  3HPH A;  5LGN A;  1YJW I;  3K2Z A;  2BXZ A;  3TW7 A;  2UXX A;  3MZ8 A;  3P5J A;  4A69 C;  3BR0 A;  3CJR B;  4L9N A;  5E17 F;  2J5P A;  4ZC3 A;  3W6V A;  3KZZ A;  3JRE A;  2E2I J;  5EZG A;  2CUF A;  2AHQ A;  1QZZ A;  1D8J A;  3D5R C;  3VSK A;  5FKO A;  3HEF A;  2LF7 A;  4XQF A;  4F52 A;  2DK5 A;  3O3K A;  1WI3 A;  1Z6T A;  3PUF A;  4YIF A;  4RGX A;  2ECC A;  2FOK A;  3WTX C;  4QLC U;  5J6X A;  4XRM A;  3KYD B;  3RJP A;  2Y69 H;  1IZ1 A;  4Y4R A;  3DBH B;  1N78 A;  2LSO A;  3F72 A;  1ZGW A;  2R7U A;  2Q2E A;  3F3X A;  3LA7 A;  4RB3 C;  1BL0 A;  4YEL A;  2HDW A;  3ASN H;  1BJZ A;  1BR2 A;  2IS1 A;  1AA7 A;  1FMW A;  1MIJ A;  1PVE A;  3IH3 A;  1FOK A;  4EM1 A;  3CCM I;  1BI2 A;  3G1M A;  4L9J A;  4BNC A;  2BW3 A;  2HOA A;  4II3 A;  3OYE A;  2ESN A;  3C2B A;  2X1C A;  4AM3 A;  2QEX I;  2GQQ A;  3LAP A;  1CF7 A;  2Z2S B;  1NHA A;  2NVU B;  1MJB A;  1JKO C;  5K5O A;  2WY7 Q;  1UAA A;  2YX7 A;  3K4M A;  3S8P A;  4BJ6 C;  3F8F A;  4KIG A;  2A6T A;  4XON A;  1MMD A;  4WXC A;  4ESF A;  2ZCW A;  3ELK A;  4BXX J;  2P4W A;  1WHU A;  4A3I J; 
#chains in the Genus database with same CATH homology
 2G7U A;  3F8N A;  5CVR A;  3IKV A;  4IPA A;  2X0L A;  1MGT A;  4MQV A;  2HYG D;  3TOB A;  1CGP A;  2VC1 A;  4EV0 A;  3ZMS A;  3M8E A;  2A3S A;  2VBX A;  3BP8 A;  3RPU A;  1ZHF A;  3F6V A;  3WTW C;  3V8J A;  2ZNY A;  3RYP A;  5AIP A;  1ON2 A;  1LDJ A;  1YQA A;  4O3M A;  3QU6 A;  2O6G E;  5HVQ C;  1XDU A;  5HS9 A;  1R58 A;  3CO6 C;  5H6R A;  3K1N A;  3GXO A;  1ZLJ A;  2Z99 A;  5BPD A;  1U2W A;  3HHH A;  2E7X A;  3ROU A;  4U0V A;  4XSX F;  2WV0 A;  1U6G A;  2GWR A;  2IA0 A;  1P4A A;  3RIR A;  3CDH A;  3FM3 A;  2DI3 A;  1YW7 A;  3GFI A;  3GF2 A;  3D0S A;  2GAU A;  3JAM K;  1FBS A;  4A6D A;  2VC0 A;  2WC2 A;  2BGC A;  2XKP A;  3HYI A;  2GA2 A;  2XV4 S;  4KIB A;  1BM9 A;  1H0M A;  1XGN A;  2P7V B;  2L02 A;  1B1B A;  3GFM A;  1T38 A;  4IVN A;  3NEU A;  2FML A;  1SD5 A;  1BC8 C;  4HAM A;  3VFZ A;  3V7S A;  5D5V B;  4G94 A;  2JZY A;  5ICC A;  3COA C;  4A0Y A;  3ZMV A;  2IJL A;  2XUB A;  4U7D A;  3CTA A;  1R22 A;  2GIV A;  3QP5 A;  4AD9 A;  1O57 A;  4LG0 A;  1YFH A;  4OIO F;  2CW0 F;  3PQK A;  5E8G A;  1J75 A;  1XGM A;  2P5K A;  5HLI A;  4LFU A;  4ZH4 F;  4JK1 X;  5E1X A;  4OOI A;  4U7B A;  2XIG A;  1TW3 A;  2MD5 A;  1HW5 A;  5FGM A;  2PI0 A;  5DD8 A;  3M7G A;  1RUN A;  3VOD A;  4BHC A;  1R00 A;  1CF7 B;  4R1H A;  3QPT A;  2DLL A;  3GFJ A;  3NQO A;  3T8R A;  1BIB A;  4LB5 A;  2RN7 A;  2F5F A;  2L4A A;  3E5U A;  5JI6 A;  4M9S A;  1SD4 A;  3HIF A;  4EGY A;  5CVV A;  4A6E A;  1IN4 A;  2R7D A;  4ZYE A;  4PGH A;  2FQ3 A;  3ZQ7 A;  4EM0 B;  5AON A;  2A69 F;  4RAZ A;  1T2K A;  2ISZ A;  1YO5 C;  4L5J A;  2DT5 A;  4MHG A;  1SAX A;  4B09 A;  1VTN C;  3L7W A;  3EQL F;  1JE8 A;  5DYM A;  4HLX A;  1FC3 A;  4UUV A;  2B0L A;  1S7A A;  2E7W A;  1ZAO A;  3GX4 X;  5AIQ A;  1FT9 A;  2H27 A;  3S2W A;  3BJA A;  3F21 A;  1XD7 A;  1Y0U A;  4WCG A;  1ZAR A;  2Z3Y A;  5CLS A;  4I7H A;  2DPU A;  2VBZ A;  1KYW A;  3F8B A;  6PAX A;  5D5W B;  4WF2 A;  4ZYD A;  2OBP A;  2OA4 A;  3ML6 A;  4OIQ F;  1JHF A;  2UXN A;  1ZRC A;  2OD5 A;  3WTS C;  3EDP A;  5JFR A;  3MFK A;  1DPR A;  2P5V A;  3JTH A;  1SMY F;  1D8K A;  3SHF A;  3ZP5 A;  3TKY A;  2CFX A;  2HKO A;  2YX4 A;  5DEQ A;  5KVR A;  2QQA A;  2X4H A;  1YS6 A;  4MGR A;  1YLF A;  4M73 A;  3MQ0 A;  4M74 A;  4ENN A;  3ZPL A;  2Q0O A;  2QEN A;  1WKM A;  2LDU A;  3FHZ A;  4BXU A;  3IWZ A;  4G8X A;  4M72 A;  1IN7 A;  2M5W A;  2VN2 A;  3H3Z A;  1P6R A;  1PP7 U;  1BBY A;  1WRJ A;  1SFU A;  1KU9 A;  3ABU A;  4N0B A;  2OZ6 A;  2ZJ2 A;  2EFP A;  3B02 A;  4OIR F;  2HOE A;  4LK0 F;  5D5X B;  4HOB A;  1C0W A;  4UXN A;  1O3T A;  3RKY A;  3I4P A;  4YFX F;  4HYE A;  2PMH A;  2EV0 A;  4EJW A;  4WWC A;  3L00 A;  3ISP A;  4YFN F;  5LGT A;  2A07 F;  1OYY A;  1HKS A;  2HFH A;  1J9I A;  3SFZ A;  4GXO A;  2QBY B;  2VOO A;  3I54 A;  5L3D A;  2MH2 A;  2O03 A;  5L3C A;  1HW2 A;  1TBX A;  2HTJ A;  1USS A;  4PGG A;  2QWW A;  4M6X A;  2VXZ A;  4ESJ A;  4AIK A;  2HTS A;  3P7N A;  2R7F A;  2ZME B;  3MZY A;  4RB2 C;  5ICG A;  1WI9 A;  1TTY A;  3KET A;  4HLY A;  1JHH A;  2KIU A;  2W84 A;  3V4G A;  2MLG A;  2VBY A;  3P9K A;  2IA1 A;  1R7J A;  3KP3 A;  4HF0 A;  4OMZ A;  1ODD A;  4HF2 A;  3H3U A;  4N9H A;  1MZB A;  4ZZL A;  5F1R A;  3GFL A;  4HA8 A;  4EGZ A;  3WG9 A;  3E3V A;  1QQI A;  2JPB A;  4ZZD A;  1XN7 A;  1FSH A;  2Z5U A;  5E18 F;  3SXY A;  5HDN A;  2STW A;  3J81 K;  1V4R A;  5TRD A;  2EK5 A;  4CO8 A;  3I58 A;  2Z9O A;  2O3F A;  3T5X A;  2XAH A;  1O3R A;  5LRS A;  4HQM A;  4Y17 A;  2F2E A;  1ONV A;  1H9T A;  1Z91 A;  4AIH A;  2BBY A;  3KEQ A;  4CXF A;  4Z2Y A;  1TLH B;  5ILV A;  3JW4 A;  2HGC A;  3HOT A;  3RYR A;  4O6J A;  2QYO A;  5DCM A;  2AXL A;  2P8T A;  2JTV A;  1W5S A;  5D8L B;  1BN5 A;  4UHT A;  4WX9 A;  1GVJ A;  3J80 K;  4I0A A;  1KQ8 A;  3HSF A;  3BOQ A;  4BAY A;  5K5Q A;  5D5U B;  1P2F A;  2JSC A;  3ULQ B;  4AIJ A;  1IN6 A;  3SZT A;  4HDV A;  1EV7 A;  3DXJ F;  2K86 A;  1IAW A;  5FD5 A;  1T6S A;  3F6O A;  4ETS A;  1A04 A;  3GVA A;  5FLX Z;  3TGN A;  4I02 A;  1QPM A;  4UVA A;  1ZGJ A;  5HLG A;  2DAO A;  2DW4 A;  4F7Z A;  4FT8 A;  2K02 A;  2RC4 A;  4Q47 A;  1XGO A;  3I59 A;  3E5Q A;  4LB6 B;  3IKT A;  5CJ9 A;  3TO7 A;  1U5T A;  2W85 A;  3CUO A;  1FNN A;  3JSP A;  3WU1 B;  1ZRE A;  4ENJ A;  1QGP A;  1SD7 A;  4UVB A;  3IRQ A;  4RGR A;  1LVA A;  3T0Y A;  1S7O A;  3WU0 A;  3U1D A;  2XAG A;  2CWE A;  2LKP A;  3EYY A;  2EFN A;  1FYM A;  5IT9 Z;  2RQP A;  3L2C A;  1J2X A;  1ZN2 A;  2M87 A;  2H94 A;  2K7L A;  4UV8 A;  1K7A A;  5A2Q K;  1SMT A;  2FMY A;  5L3E A;  2VT2 A;  2XHK A;  4G9Y A;  3CLO A;  3FMQ A;  1QNT A;  2IP2 A;  1T0F A;  2HS5 A;  3RKX A;  2Z33 A;  3RPQ A;  3FZV A;  4ZYH A;  4IRH A;  4P9U A;  3GW2 A;  2FEZ A;  3M8F A;  1P4X A;  2ESH A;  2FF4 A;  2VON A;  3LAJ A;  4EJV A;  2NNN A;  3W6J B;  3W6K B;  2H6B A;  2DFI A;  2FXA A;  2RKH A;  3PQJ A;  3KLO A;  3E97 A;  1J7K A;  4OIP F;  2ISY A;  1KQ0 A;  2E1N A;  1JXS A;  2EJR A;  3E6D A;  2V1D A;  4IRG A;  2BE5 F;  1QZY A;  4L0Z B;  4ENM A;  1W7P B;  4RGU A;  5LHI A;  5DV5 A;  2KRF A;  3KZY A;  1B9M A;  4FX4 A;  1I5Z A;  4JBA A;  5FB2 A;  4PCQ A;  2PLY A;  2OQR A;  2NRA C;  5L3B A;  2PN6 A;  1MDM A;  2IW5 A;  3T1B A;  1RNL A;  4UV9 A;  4IF4 A;  1YS7 A;  2C6Y A;  1MD0 A;  3BWG A;  1IUY A;  1UCR A;  2FBH A;  3QP6 A;  5EEG A;  5TJJ A;  1FY7 A;  2XAJ A;  2IRF G;  1ZG1 A;  1LQ1 A;  2GXB A;  1XB4 A;  2L3D A;  4KNY A;  1R1U A;  2ZXJ A;  5E20 A;  3FX3 A;  2P6T A;  3SQN A;  3GLX A;  4IXA A;  2L54 A;  1XCB A;  4KUM A;  3GUD A;  4L5I A;  4HX4 A;  4S04 A;  5K1Y A;  1XSV A;  1TQM A;  3EYI A;  5D8K B;  3IHU A;  2FE3 A;  3R6S A;  2KJB A;  3NRV A;  4MQ9 F;  1U5T B;  5E8I A;  4A12 A;  4Y15 A;  3H92 A;  3P9I A;  1Z1D A;  4GO1 A;  2ZO4 A;  1B9N A;  1FYL A;  2D1V A;  1MJA A;  3R60 A;  1TQI A;  1SFX A;  2IVM A;  3LQR A;  3HOS A;  2H09 A;  2V1U A;  4LLG F;  3HTS B;  4FX0 A;  1UFM A;  1ZYR F;  1FSE A;  1MJ9 A;  5BS6 A;  4WXD A;  5ILU A;  4LMY A;  4HBL A;  2D1H A;  1HST A;  3G3Z A;  1OMI A;  1UHW A;  2Y48 A;  1IXC A;  3GO5 A;  5HLH A;  2HKX A;  5LHH A;  2G7H A;  3JAM Z;  1FWZ A;  2A61 A;  2ZNZ A;  1X3U A;  1Z7U A;  3WGG A;  2QVO A;  2D2W A;  1I1S A;  4HQE A;  4MEY F;  3VEP A;  5BQT A;  3LA2 A;  3KE2 A;  3GZ6 A;  1WSU A;  2DTR A;  2VBW A;  2BV6 A;  4G6Q A;  3RTR A;  1YTY A;  1FBQ A;  4KT5 C;  4A2U A;  5CVJ A;  5HDK A;  1TQP A;  3QU3 A;  4XLN F;  3V8K A;  3MZH A;  4GCV A;  5ICE A;  5F6F A;  2RVC A;  4U0Y A;  1KGS A;  1OPC A;  1MDM B;  4XSZ F;  2HZT A;  1R5H A;  1MKM A;  2OU2 A;  2D45 A;  1KA8 A;  2G9W A;  2GZW A;  2LF8 A;  2XVC A;  3U9G A;  1UB9 A;  4HF1 A;  3BJO A;  2A5Y B;  4Q4Z F;  2PQ8 A;  4ASN A;  4LG0 B;  4R8H A;  4EJO A;  3EUH A;  3WE3 A;  3QRF F;  4I2O A;  5D4S A;  4XBF A;  3E6C C;  1PUE E;  3J7A O;  1ZGA A;  2HDC A;  1T39 A;  3KFW X;  1U78 A;  2TDX A;  2RGV A;  3FMS A;  1FZP B;  4G7H F;  2DQR A;  5FO5 A;  2V1X A;  3WTT C;  2XRO A;  4R79 A;  2CGP A;  3IWF A;  2IPQ X;  5CVI A;  3L9F A;  1IW7 F;  5J8C A;  2V79 A;  2RNJ A;  1FBU A;  2DBB A;  3F8M A;  2P7C B;  1JGS A;  2QQB A;  2OAZ A;  4RGS A;  5KK1 A;  1U5T C;  4KN4 X;  3LQQ A;  2NYX A;  3GYH X;  1YIO A;  1TNS A;  1DDN A;  3B73 A;  5EEH A;  3HRU A;  1FYK A;  1R1V A;  1WQ2 A;  5DDG A;  3SZP A;  1I27 A;  4A0Z A;  4PZJ A;  3I71 A;  4HX7 A;  3K1P A;  1L3L A;  1S29 A;  3EET A;  4JQF A;  4U0W A;  4D0P A;  1W5T A;  3MAJ A;  1QO0 D;  2EFQ A;  4IHT A;  1ULY A;  5ILS A;  4UNO A;  5F64 A;  1YYV A;  4AVP A;  3RDI A;  3CJN A;  1IXS B;  4Y13 A;  3TDU C;  3FXR A;  2O61 A;  3JSO A;  2BYV E;  1HKQ A;  2KIF A;  2QZ8 A;  2LNB A;  4I01 A;  3BPX A;  2IA2 A;  2CYY A;  4KIF A;  4BH9 A;  2GXG A;  2MA3 A;  3F22 A;  1GHC A;  1K79 A;  1PDN C;  2L01 A;  4CIC A;  1Q1H A;  1LDD A;  1F9N A;  4GGG A;  2O0Y A;  3I5U A;  3CUQ A;  5FFZ A;  1Z6R A;  5H6Q A;  2EA2 A;  4ENK A;  1FP1 D;  3C18 A;  2ZFW A;  3WTV C;  2STT A;  3KP5 A;  4OMY A;  3HSE A;  3REO A;  4CGZ A;  4HDU A;  3WGH A;  5DUI A;  4MEX F;  1XSX A;  2V6C A;  4AWX B;  4OU0 A;  5LGU A;  4EJU A;  3FM5 A;  5H20 A;  2E1C A;  1ZRF A;  3HRT A;  4DQ2 A;  2H6C A;  2QUF A;  3R0A A;  2JRT A;  1BIA A;  3TOA A;  4MTD A;  4LJZ F;  4NHJ A;  4FHT A;  2QM3 A;  2PFB A;  2W57 A;  3IRR A;  1STZ A;  4A5M A;  1KYZ A;  1BI3 A;  2FNA A;  2VOP A;  1P92 A;  3HRM A;  1P4W A;  5LEJ A;  3GZ5 A;  2M30 A;  4RS8 A;  4CHU A;  3MCZ A;  2YSR A;  1LEA A;  5E1W A;  3K69 A;  1LDK B;  1LB2 A;  1SD6 A;  5HOO A;  5DUK A;  3RKW A;  4A0X A;  1RUO A;  1E17 A;  3D5L A;  3WTZ A;  1YW9 A;  3ZMT A;  5HS8 A;  1OR7 A;  3V8L A;  3LA3 A;  5LLQ A;  1KU2 A;  3K0L A;  2DO7 A;  2KKO A;  2PEX A;  1I6X A;  3WTY C;  3QOP A;  4HW0 A;  5J8F A;  3J81 Z;  3U2R A;  1O3S A;  3HHG A;  2HQN A;  4N9I A;  3TO6 A;  3K9T A;  5BOX A;  2Q8K A;  3F8C A;  3Q9V A;  2XAF A;  1G3W A;  1R36 A;  3ZN0 A;  2VE8 A;  3DKW A;  3BPV A;  3JTG A;  2EV6 A;  1TW2 A;  2L4M A;  3R61 A;  4EM2 A;  3IC7 A;  3K1M A;  1D5V A;  1OYW A;  2MC3 A;  1ZRD A;  4KYW A;  3CUQ B;  4HV6 A;  2MH9 A;  1OYI A;  3I0T A;  4P5O A;  2R3S A;  2M8E A;  5BPI A;  5HS7 A;  1G4D A;  2F5C A;  5JR3 A;  1O3Q A;  3J80 Z;  2FBI A;  3DFG A;  4G7Z F;  5DCM B;  2F5E A;  1G6N A;  5CYV A;  3M1E A;  1IN5 A;  2NNY A;  2KIM A;  3BDD A;  2XAQ A;  1KU3 A;  4Q48 A;  1DUX C;  3C1D A;  1GXP A;  3HRS A;  3F23 A;  1V3F A;  1RI7 A;  1E2X A;  2UZK A;  1F4K A;  3FXU A;  1RZ4 A;  4U88 A;  3DV8 A;  5D4R A;  3O2P E;  2K4J A;  3ZMU A;  4RAY A;  3KP7 A;  4IJA A;  1S8N A;  1LNW A;  3E5X A;  5JHU A;  5E1Z B;  5ED4 A;  2PMU A;  4CZZ A;  3KEO A;  4NQW A;  3ABT A;  3T8T A;  1J0R A;  2UWM A;  1LEB A;  1XGS A;  2HWV A;  1U8R A;  2VOD A;  5D6F A;  5JVT A;  1XDS A;  3KCC A;  2RV8 A;  4EJT A;  3IL2 A;  4HV5 A;  3ECO A;  2XRN A;  4BYY A;  2IT0 A;  2HEO A;  1LJ9 A;  2A68 F;  1W4M A;  4K2E A;  4QWQ A;  3BJ6 A;  1AWC A;  1R1T A;  3I59 B;  2FU4 A;  4GYI A;  3ZMZ A;  3QPH A;  4LLN A;  2PG4 A;  3TO9 A;  5LBQ A;  4M9X A;  4UVC A;  5LHG A;  5A2Q Z;  2QLZ A;  5IT3 A;  4M71 A;  3BRO A;  2XKO A;  1J59 A;  1DP7 P;  1YG2 A;  1FPQ A;  2DQL A;  4IHS A;  2COM A;  4KFC A;  1F5T A;  3M9A A;  4HZF A;  1B6A A;  2WWY A;  3V7R A;  4LD5 A;  4G7O F;  4RB1 A;  4BQA A;  1REP C;  3WGI A;  4YFK F;  2EWN A;  2EV5 A;  2QBY A;  1EH8 A;  1U3E M;  4ZYG A;  3ERE D;  5ICF A;  2W25 A;  1K6O A;  2M45 A;  4YII A;  4EMS A;  2ETH A;  4S05 A;  4NB5 A;  2ZME A;  2W24 A;  3R4K A;  3WTU C;  3BY6 A;  2HQR A;  3HUG A;  4PDK A;  3WOD F;  4P96 A;  5DCF A;  5L3F A;  5DD4 A;  1RIO H;  4L9T A;  4EVI A;  1ZLK A;  2J5O A;  3WE2 A;  3C7J A;  4KIC A;  1KQ9 A;  4L9V A;  4P55 A;  2YPR A;  3R0J A;  2ZKZ A;  1BI1 A;  4M6Y A;  3TQN A;  4KA4 A;  3CUQ C;  2Y75 A;  2HR3 A;  2NAZ A;  1ZG3 A;  1KU7 A;  2M1B A;  2YR2 A;  1K78 A;  3DP7 A;  1IRF A;  2PBI A;  4L0Y B;  1XMA A;  1YW8 A;  3I64 A;  3DQV C;  4IRI A;  1G3T A;  3KP6 A;  2EB7 A;  2EFO A;  3VB2 A;  1Z05 A;  2VT3 A;  4I98 B;  2Y0M A;  3V7C A;  2P5L C;  4YG2 F;  1IF1 A;  3FF5 A;  1GXQ A;  1B4A A;  1G3Y A;  5K5R A;  2RDP A;  4BHP A;  3ZN1 A;  2OQG A;  3C3W A;  1IN8 A;  2P6S A;  1ON1 A;  5FD6 A;  2XGX A;  3HSR A;  4MTE A;  4Q5S F;  1UST A;  4A5N A;  3Q5F A;  1HXD A;  3RI4 A;  3DPT A;  3PFI A;  2FSW A;  2PJP A;  1XCV A;  4B8X A;  4LLL A;  3BZ6 A;  1BI0 A;  4M9Z A;  3QAH A;  3KP2 A;  1IRG A;  4TV7 A;  4LGW A;  5BMZ A;  1EH7 A;  2DPD A;  5LEK A;  3MWM A;  2CG4 A;  5L3G A;  4RB0 A;  2CO5 A;  2FBK A;  4ESB A;  2MBF A;  3E6M A;  3OV8 A;  1O7F A;  1FX7 A;  3CO7 C;  2DK8 A;  2YU3 A;  3LWF A;  2K4B A;  4O5V A;  2A6E F;  4I0B A;  2JPC A;  2QQ9 A;  3ECH A;  2F5D A;  1FLI A;  1HW1 A;  4HX8 A;  1IXR C;  4WK8 F;  3HTU A;  4EQQ A;  2CQK A;  2ADU A;  3GEZ A;  1F1Z A;  1BJA A;  5ERI A;  3E6B A;  2XAS A;  4MNU A;  1S6L A;  3MEX A;  5FFX A;  1UHM A;  1HQC A;  2FRH A;  5FLX K;  2WTE A;  1ZH5 A;  1Z9C A;  1O7L A;  2GA1 A;  3DPL C;  3L09 A;  3DEU A;  3TDZ C;  4ON0 A;  1XSD A;  4L18 B;  4P9F A;  1W7P D;  2O8X A;  4DNC A;  4XRF A;  3LFK A;  4BHB A;  5LRR A;  4KMU X;  1SFE A;  1TNT A;  3GWZ A;  2JT1 A;  3VOE A;  2DU9 A;  3O6B B;  2ZBK A;  4KMF A;  4WXH A;  2A6H F;  3KP4 A;  3DF8 A;  4KN7 X;  1HBX G;  3FXQ A;  1WWX A;  1AOY A;  4OIN F;  1K78 B;  5HDG A;  3OOP A;  3FMR A;  2VE9 A;  2OZU A;  2ACJ A;  3Q9S A;  3ZMD A;  4LK1 F;  1T98 A;  4KDP A;  1EH6 A;  5IT9 K;  1G3S A;  4E70 A;  3AAF A;  3N97 A;  4CYD A;  2FA5 A;  4G6D A;  1H9G A;  1D3Y A;  1BC7 C;  1HSJ A;  2V9V A;  1BOA A;  3LST A;  2FNP A;  1R23 A;  1I1G A;  2CSO A;  2HYF A;  1PP8 F;  1OKR A;  4XLP F;  1QBJ A;  2EA4 A;  5CVU A;  1J5Y A;  3G73 A;  1DPU A;  3FWE A;  1S3J A;  1R5G A;  1HKT A;  1L0O C;  2ELH A;  2NS0 A;  3I53 A;  1B59 A;  3N4M A;  2KJC A;  4I09 A;  3P9C A;  3KLN A;  1W7P A;  2BEO A;  2MLK A;  1XMK A;  4GYG A;  4H0E A;  1ZG5 A;  2AS5 F;  1FP2 A;  2K27 A;  5D6E A;  2EFW A;  4CDG A;  5LGN A;  3K2Z A;  2UXX A;  4L9N A;  5E17 F;  2J5P A;  3KZZ A;  1QZZ A;  1D8J A;  2LF7 A;  2DK5 A;  3O3K A;  1Z6T A;  4YIF A;  4RGX A;  2FOK A;  3WTX C;  4QLC U;  5J6X A;  3RJP A;  1IZ1 A;  2LSO A;  3F72 A;  2Q2E A;  3F3X A;  3LA7 A;  4RB3 C;  1FOK A;  4EM1 A;  1BI2 A;  4L9J A;  4BNC A;  2ESN A;  2GQQ A;  3LAP A;  1CF7 A;  1NHA A;  1MJB A;  5K5O A;  2YX7 A;  3F8F A;  4KIG A;  4WXC A;  4ESF A;  2ZCW A;  3ELK A;  2P4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...