2VN2A

Crystal structure of the n-terminal domain of dnad protein from geobacillus kaustophilus hta426
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
110
Chain Sequence
MEKKKVAEWLAQGSIAVPKLLLGHYKQLGLGEGELVLLLHMQSFFEEGVLFPTPAELAERMTVSAAECMEMVRRLLQKGMIAIEEKYTLEPLWEKLVHHLYTQAAQQGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHROMOSOME REPLICATION INITIATION PROTEIN
publication title Crystal Structure of the N-Terminal Domain of Geobacillus Kaustophilus Hta426 Dnad Protein.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Replication
total genus 36
structure length 110
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vn2A00
4ZYGA 4M74A 4I0BA 2W85A 5DD8A 2HTSA 1OPCA 1R00A 4DNCA 1BJAA 1AOYA 2L01A 1ZRCA 2Q2EA 3F21A 3FM3A 1IRFA 3RKWA 5LRRA 3I0TA 2M87A 3KETA 4O6JA 2TDXA 4HYEA 4A6DA 2MLKA 2MA3A 2BE5F 4LMYA 2OZ6A 2BV6A 3CLOA 3M1EA 2ISZA 5EEGA 1ON1A 2VXZA 3LAJA 1R1VA 2JTVA 2L4MA 4XSXF 2XAFA 4UUVA 3GX4X 2DTRA 1KYWA 3RIRA 3K0LA 1D3YA 3I5UA 3ZMSA 1F1ZA 4XRFA 3I53A 3GWZA 4HW0A 1CF7B 1FLIA 2GA1A 3R0AA 3ZMZA 2XKPA 2CFXA 1T6SA 4L9NA 4LLGF 3T8RA 4G7ZF 2UXNA 2KIUA 5TRDA 1FYLA 2HKOA 1TW3A 3PQJA 3WE3A 2W84A 5K1YA 3I58A 3FZVA 1U3EM 2V1XA 3HUGA 2ZXJA 3E97A 4BHCA 2FNPA 2YX7A 1O7FA 2O61A 1RNLA 1R22A 1XGNA 2KJBA 2V79A 3GYHX 3LFKA 1OYWA 3LQQA 4ESJA 3KP6A 5DCMB 1OYYA 2XKOA 3R60A 3SXYA 3ROUA 2QUFA 5HLGA 4RGUA 5DV5A 1G4DA 1G6NA 3GXOA 3E6BA 4KFCA 2COMA 3LQRA 1P6RA 3WTUC 4BYYA 2A6HF 3IWFA 2CO5A 4G7HF 4GO1A 4TV7A 3KCCA 1P4AA 3F23A 1XSXA 2VBWA 1Z7UA 3F8MA 3HSRA 2ZMEB 1SD5A 2PMUA 3RPQA 2Z99A 4QLCU 2HQRA 3DPLC 5FB2A 3OV8A 3FX3A 1BC7C 3WGHA 2HEOA 2QQBA 2PG4A 3O2PE 4EM0B 1IAWA 5CVIA 4CHUA 1PUEE 4G6QA 3GFIA 4ZZLA 2K7LA 4D0PA 2HYGD 2VE8A 2F5EA 2QVOA 3P7NA 4HLXA 4NHJA 1XDUA 4E70A 1H9GA 5CYVA 5HDGA 1I5ZA 2QYOA 5F6FA 1GXQA 1XDSA 2GWRA 2Q0OA 1YFHA 4WXCA 1ZHFA 1EH7A 5HDKA 5H20A 3TO7A 1R1TA 4UHTA 1J75A 4BHPA 4ENNA 1G3WA 3L9FA 4MTDA 1ZG1A 2MBFA 3IRQA 1P4WA 5FGMA 1HW1A 4ENJA 2RKHA 1ZH5A 1V4RA 4EJVA 2A07F 5BS6A 4Y15A 1FBUA 1W5SA 3DPTA 4LB6B 4I7HA 2DQLA 5L3BA 1K7AA 4RAYA 1D5VA 1QZYA 1TTYA 1RI7A 4KICA 2F2EA 2QBYB 3WTZA 4CGZA 3F8CA 2P5KA 3MCZA 5LHIA 3BJ6A 4YFXF 2OA4A 1YW7A 1CF7A 2KIMA 5L3EA 4R1HA 5E18F 3QRFF 1IRGA 3FMRA 3MZYA 3Q9SA 2RDPA 1B1BA 2K86A 3KP4A 6PAXA 2A3SA 5AONA 1B9NA 4NQWA 1WRJA 3TOAA 5E17F 1TBXA 3O3KA 4Q48A 2VBZA 3EDPA 4B09A 4IHSA 4A6EA 1GXPA 2DU9A 4LJZF 2EFQA 2WTEA 4L0ZB 4HOBA 4RB1A 3RPUA 4KA4A 4OU0A 5CVJA 1S7OA 3ZQ7A 5BMZA 1XD7A 1YW9A 3DFGA 3FXQA 2B0LA 1HSTA 3M7GA 1RIOH 1KU9A 2E7WA 1B6AA 1YW8A 3IWZA 2QM3A 3U2RA 1BI1A 5CVUA 2VODA 4EVIA 3P9CA 1HXDA 4KT5C 3JTHA 1Z9CA 1UCRA 1J5YA 2P6TA 3DF8A 3T8TA 2HOEA 1SMYF 5HS7A 2ZMEA 1O3SA 3JTGA 1U78A 4ENMA 5JHUA 2A6EF 5K5OA 1U6GA 3GLXA 2KKOA 1O3RA 4WXHA 2RV8A 2UZKA 1K78B 3BDDA 3KP3A 2HQNA 2QQAA 2STTA 2MLGA 1J7KA 4HQMA 2JPCA 1SFEA 1Z1DA 3LA2A 2D1HA 5HOOA 2P6SA 4P5OA 1Z05A 5E1XA 2EA2A 4HF2A 5F1RA 4I09A 4L5IA 2RN7A 3DQVC 5DUIA 3K1NA 3I54A 4U7DA 3BROA 1J9IA 3M8FA 3QP5A 2FBHA 4RB2C 2A5YB 1YS6A 2J5OA 2M8EA 3VODA 4OIRF 3KE2A 2BYVE 4O5VA 1IXSB 2RVCA 2CSOA 2ISYA 3R0JA 1RZ4A 2XUBA 2O03A 5J6XA 4CZZA 5E1WA 2QWWA 2PQ8A 3W6JB 3WTSC 3C18A 2QLZA 1FSEA 3KP5A 2RNJA 1G3SA 4UVCA 2ETHA 4KNYA 2RC4A 1ONVA 5FLXK 2PEXA 3HHHA 2QBYA 4NB5A 2V1DA 1Y0UA 5K5RA 1MKMA 4AIJA 2HS5A 1ON2A 2BBYA 1B59A 1R5HA 1U5TC 5L3DA 2PFBA 5LBQA 3J81K 3V7SA 1G3YA 5LRSA 4WXDA 1PDNC 5DUKA 4CICA 5L3FA 1I6XA 1IN8A 2QENA 4ENKA 4U88A 1EH6A 1FOKA 4WCGA 2ADUA 1TNTA 3BWGA 2P8TA 1IZ1A 2EWNA 3D5LA 5IT9K 4HV6A 5LGUA 3U9GA 2K4JA 3N97A 5BQTA 3TDUC 1EV7A 1P4XA 3GZ5A 3ZMUA 1JHFA 3WTXC 3J80K 4M6YA 4F7ZA 4ZZDA 4XSZF 4N9IA 2IA0A 1K6OA 3H3UA 1T2KA 1KQ9A 2FA5A 3ELKA 2CW0F 2ZJ2A 5JVTA 1IN5A 4L18B 3ZMTA 2H6BA 5EEHA 2O3FA 3NEUA 2PN6A 1T98A 5FD5A 3HIFA 2HYFA 4MHGA 3V4GA 5BPIA 4G8XA 1MZBA 2FF4A 3BY6A 3HHGA 1F9NA 4EJTA 3EYIA 2MH9A 1TNSA 3HRSA 1Z6TA 4BAYA 2IVMA 4RGRA 3D0SA 4U0YA 4JK1X 2A61A 3L00A 1ZARA 4AIHA 1BI2A 1SD7A 1ZLKA 2ZNYA 5D4SA 2VE9A 2ACJA 2EJRA 3CJNA 4PGHA 2UWMA 1K78A 3GZ6A 2XGXA 4HBLA 3I4PA 2RQPA 3G3ZA 3E3VA 1BN5A 2L3DA 4KYWA 3L09A 2W57A 1J2XA 1FNNA 4OOIA 2VBYA 5DEQA 1KYZA 2VC1A 2XAGA 3K1PA 3Q5FA 3N4MA 3QU6A 5BPDA 2IP2A 3E5XA 1KQ0A 3TKYA 2BGCA 4WX9A 3F6OA 3HRMA 4ASNA 4ZH4F 1F4KA 4AIKA 1A04A 4XBFA 1SD4A 2P4WA 5E8GA 4YIFA 3I59B 3JW4A 4KDPA 3HTUA 1X3UA 4PZJA 2GQQA 2X0LA 2Y75A 2UXXA 2HR3A 1STZA 2IPQX 2XIGA 3COAC 1JXSA 3WTVC 3KP2A 1XGMA 4ETSA 4OMYA 2AXLA 3HSFA 2DLLA 3E6MA 1PP7U 1ZRDA 1HQCA 2NAZA 3KLNA 2XHKA 2L4AA 1BM9A 1ZN2A 5IT3A 1ZREA 4U0WA 4R8HA 4A5MA 4JBAA 4HX4A 5CLSA 5D8LB 1QBJA 3TDZC 3FWEA 3RYPA 1R5GA 3JAMZ 4Y13A 2FXAA 1DPUA 4G7OF 3RTRA 3KP7A 3WE2A 3DXJF 2ESNA 2D2WA 3QP6A 4UV9A 2LF7A 3CUQA 3HRUA 1LDDA 2VC0A 2ZNZA 1REPC 5AIQA 3WGIA 3EUHA 3ULQB 4AD9A 2MC3A 1FPQA 3QPTA 4WWCA 4P96A 3KLOA 1IF1A 4P55A 2L02A 2PLYA 1PP8F 2E7XA 2ZKZA 1W5TA 2W24A 2Q8KA 2FEZA 3OOPA 4FX4A 3KFWX 2YX4A 1HSJA 2H09A 1E17A 1XSDA 3HOSA 3O6BB 1IXRC 4O3MA 3IKVA 3V7CA 1LJ9A 5ERIA 2IA2A 2DW4A 4OIOF 1T39A 3F6VA 3BPXA 3V8LA 1FZPB 5KK1A 5DD4A 4A0XA 1IXCA 1O57A 1SFXA 2Z9OA 4PGGA 1IUYA 2DPDA 4OIQF 3GO5A 1Z91A 2R3SA 4G9YA 1LDKB 2W25A 4ESBA 4M6XA 3MWMA 3EETA 5ICGA 2H27A 3MFKA 3GUDA 2RGVA 4I01A 4MGRA 1BC8C 2CWEA 2ZO4A 1FSHA 3KZZA 3WU0A 4HAMA 3IKTA 1FBSA 1FWZA 4M9XA 3PQKA 1XB4A 5H6RA 4I0AA 1ULYA 1SAXA 4LFUA 2VONA 3WODF 4EGZA 1ZAOA 1IN6A 2OD5A 2M5WA 5J8FA 2K4BA 4YIIA 4KIFA 4ZYEA 1JHHA 3ECHA 2HWVA 4FX0A 2GXGA 4UNOA 5DCMA 2O8XA 1KQ8A 2EFPA 3K2ZA 3QPHA 1DUXC 3ZN0A 5JI6A 1TQMA 2EA4A 1BIAA 3VOEA 4LK1F 5D5WB 1OR7A 3K9TA 5F64A 3I59A 4A0YA 2XAJA 3IHUA 5LEJA 2KIFA 3ML6A 1ZYRF 2FMYA 1H9TA 3BJAA 3R6SA 2ZBKA 2M30A 2GZWA 5E8IA 1U2WA 2J5PA 1QNTA 4MQVA 1HKTA 3T1BA 3J7AO 2NNYA 1QGPA 4YFNF 3H3ZA 4EJWA 4MQ9F 4WK8F 3RDIA 2D45A 3MAJA 1HW5A 4IRHA 2FQ3A 3FXUA 2DPUA 1XCVA 1MGTA 1TQPA 3HTSB 4GGGA 3I71A 2YSRA 4L9VA 2EK5A 4DQ2A 5A2QZ 4KMUX 4BXUA 2Z33A 2K27A 3IRRA 1IN4A 2ESHA 2XROA 2F5CA 2VOOA 2LDUA 3TQNA 4JQFA 1W4MA 3ISPA 2G7HA 2WC2A 2Z5UA 2ELHA 1SFUA 4UVAA 1I1SA 4S04A 3S2WA 4MEYF 5D6EA 1P92A 4Q5SF 4EM2A 1HKSA 4LLNA 3GEZA 4RAZA 1R58A 1TLHB 5LHGA 2A69F 1DP7P 2OAZA 2DO7A 3BJOA 3CO6C 1UB9A 1WI9A 3ZN1A 4RB3C 1UHWA 3PFIA 4LK0F 1D8KA 3FMQA 3ZP5A 4R79A 4UV8A 3R61A 4U7BA 2HGCA 3F3XA 1KU3A 3MQ0A 2IA1A 5D8KB 2JRTA 1XN7A 1KU2A 2GA2A 1S7AA 5ICFA 1BOAA 3F8NA 2JPBA 1LEBA 1BI3A 4HDVA 1LB2A 1T0FA 3ZMVA 4IVNA 5ED4A 3RJPA 1DDNA 4I98B 4EM1A 2JSCA 3RKXA 3KZYA 1H0MA 1W7PB 1XMKA 3RYRA 2DFIA 2FBIA 4OINF 1QPMA 2V9VA 3REOA 4HA8A 3LSTA 1XGOA 2P5LC 1U8RA 3L7WA 3GFLA 5CJ9A 2OQRA 4OIPF 2EFOA 2OZUA 4A0ZA 3F8FA 5ILVA 1JE8A 2QZ8A 3V7RA 1AWCA 2FRHA 2PJPA 1QZZA 1L0OC 2DI3A 4EMSA 1I1GA 2GXBA 2FMLA 3G73A 2F5FA 2FSWA 4LD5A 3GFMA 3MZHA 5H6QA 2VBXA 2F5DA 1KU7A 5DYMA 3VEPA 4YG2F 5DCFA 1YYVA 5AIPA 1LQ1A 1HKQA 5LGNA 2EV6A 2DQRA 3KEQA 3CO7C 1FC3A 1BBYA 4GXOA 1TW2A 2VT3A 2EFNA 4LB5A 4BQAA 3JSOA 3K1MA 4I02A 3TO9A 1RUOA 3SZPA 4HQEA 2P7VB 1FX7A 3P9KA 1YQAA 3GW2A 3M8EA 3ZPLA 1OKRA 4A2UA 2IT0A 4M9SA 2DT5A 1Q1HA 4FT8A 4HX7A 1R1UA 1TQIA 5HLHA 2P7CB 1YO5C 3E5QA 2JT1A 2YR2A 5LGTA 2DK8A 1WWXA 1LVAA 1XGSA 2LSOA 4HDUA 4LG0B 2K02A 1J59A 1D8JA 3H92A 3C3WA 4GCVA 3RKYA 4U0VA 1FP2A 3HOTA 4UXNA 2IJLA 2HDCA 4IPAA 3EQLF 5HDNA 4Z2YA 3BP8A 5FD6A 1O3TA 2BEOA 1XCBA 4RGXA 5KVRA 3NRVA 4HLYA 2WV0A 3K69A 2O6GE 3ERED 2CQKA 3LWFA 2VN2A 3SHFA 3U1DA 1S6LA 1O3QA 1U5TB 4XLNF 4ZYHA 4EJOA 1WKMA 4BNCA 2R7DA 1LDJA 1QQIA 3SFZA 4IRIA 3VFZA 3ABUA 2M1BA 4K2EA 1SD6A 5HS8A 3NQOA 4HF1A 4GYGA 1LEAA 1KA8A 4KUMA 5L3GA 2FBKA 4M72A 4GYIA 1FP1D 1QO0D 3DP7A 2KJCA 3W6KB 5HVQC 3QU3A 1J0RA 2HTJA 2QQ9A 4I2OA 1IN7A 1W7PA 3JAMK 4IHTA 3HSEA 1YLFA 4A12A 2ZCWA 3LAPA 2CGPA 4AWXB 4IF4A 4H0EA 2MH2A 4CDGA 4KN4X 2VOPA 2DK5A 1G3TA 2XRNA 3WG9A 2XASA 3ABTA 2G9WA 2HKXA 1BI0A 1XMAA 1W7PD 5ICEA 1T38A 2A68F 5D5XB 3WTWC 3L2CA 1O7LA 3SQNA 4N0BA 4ON0A 2FOKA 4L0YB 5JFRA 5E1ZB 3ECOA 2FU4A 1YG2A 3TOBA 1UHMA 2HZTA 2JZYA 5FO5A 2G7UA 4KN7X 3M9AA 2FE3A 2PMHA 1FT9A 1LNWA 2VT2A 4IJAA 1MDMB 3WTYC 1MJ9A 4Q47A 4BHBA 4BH9A 1GVJA 3GVAA 2L54A 4M71A 3DV8A 3TO6A 1ZGAA 3VB2A 4L5JA 4MTEA 2HFHA 2IW5A 1UFMA 4XLPF 2OQGA 3F8BA 3ZMDA 1B4AA 1JGSA 2DAOA 4HF0A 3SZTA 1EH8A 3E5UA 4L9TA 4G94A 3E6CC 1S8NA 4P9FA 5D6FA 2EV5A 2PBIA 2LF8A 3CDHA 3HYIA 3T0YA 5J8CA 3BPVA 3CTAA 5FFZA 2EFWA 2X4HA 3C1DA 4KMFA 3B02A 4LG0A 3WGGA 4EQQA 1E2XA 3F72A 1CGPA 1NHAA 4ZYDA 2ZFWA 2V1UA 1R36A 1S29A 5ILSA 4Q4ZF 2CYYA 3CUQC 1F5TA 1ZRFA 2E1NA 4WF2A 2R7FA 1IW7F 4L9JA 3B73A 1R7JA 4IRGA 1HW2A 4P9UA 2Z3YA 4A5NA 1ZG3A 5HS9A 1ZLJA 2OBPA 1C0WA 3HRTA 4LGWA 1WSUA 3FMSA 3GF2A 5LEKA 3QOPA 4AVPA 1U5TA 4B8XA 3FHZA 3GFJA 2EB7A 2PI0A 5FFXA 5JR3A 1FY7A 4RS8A 1HBXG 2Y48A 3DEUA 2STWA 4ESFA 4UVBA 1OYIA 2AS5F 5BOXA 4MEXF 5ICCA 2IRFG 1XSVA 2LKPA 3QAHA 2EV0A 2LNBA 1I27A 4M73A 3WTTC 2GIVA 1USTA 4CXFA 2P5VA 2V6CA 1WQ2A 2H94A 3T5XA 4OMZA 1Z6RA 1RUNA 1L3LA 5HLIA 5CVVA 2XAHA 3CUOA 4KIGA 5CVRA 3I64A 5L3CA 5TJJA 3WU1B 1GHCA 4PDKA 4EV0A 4CYDA 1V3FA 5ILUA 5E20A 1ZGJA 1ODDA 2DBBA 2CG4A 5DDGA 4FHTA 2XVCA 2YU3A 3MEXA 2YPRA 2E1CA 1KGSA 4HZFA 2XV4S 4N9HA 2KRFA 2GAUA 1BIBA 5A2QK 5LLQA 2D1VA 4RB0A 3AAFA 4HX8A 4CO8A 3DKWA 3E6DA 4Y17A 3V8KA 2M45A 1MD0A 1MJAA 3EYYA 3LA7A 5FLXZ 1USSA 1ZG5A 1DPRA 2NRAC 5K5QA 1YIOA 3V8JA 3FF5A 1S3JA 4HV5A 2H6CA 3P9IA 2FNAA 4M9ZA 2O0YA 3F22A 2OU2A 2XAQA 4QWQA 1MDMA 3IL2A 1P2FA 1FYKA 3TGNA 1B9MA 3J81Z 1K79A 5D5VB 1FBQA 4YFKF 1YS7A 1VTNC 4PCQA 4S05A 3FM5A 4G6DA 3JSPA 2NNNA 4RGSA 1OMIA 2NYXA 3KEOA 1MJBA 5IT9Z 1SMTA 3RI4A 3R4KA 4EGYA 2C6YA 3LA3A 2NS0A 3C7JA 2Y0MA 3J80Z 3BOQA 5D5UB 4LLLA 3FXRA 2MD5A 5LHHA 1FYMA 1YTYA 4MNUA 4EJUA 3BZ6A 3CUQB 1R23A 5D4RA 2WWYA 4IXAA 3Q9VA 3IC7A 4KIBA
chains in the Genus database with same CATH superfamily
4JP0A 4ZYGA 3P5JA 3OYHA 1DQUA 4M74A 2KDZA 4I0BA 2W85A 5DD8A 2HTSA 1OPCA 2V7FA 1R00A 4PJNA 3L2QA 3MD2A 4DNCA 2LBFA 1VQMI 1U9OA 1TT5B 1BJAA 3CJQB 5IOYA 3BR3A 1AOYA 2L01A 2M7AA 1ZRCA 2Q2EA 2E60A 3F21A 3ASOH 3FM3A 1Y6IA 3DCFA 1IRFA 3RKWA 3S3NA 5LRRA 4HRIA 2CW8A 2DT6A 3I0TA 2M87A 3ZQFA 4XQFA 2OF7A 2VKEA 3EUAA 3KETA 4O6JA 2TDXA 1UG2A 2MG4A 1YX5A 1FOXA 1WJDA 4HYEA 4A6DA 2MLKA 2MA3A 2BE5F 3BG6A 5JLWA 4LMYA 2OZ6A 1ETXA 2E34A 1NK2P 3K70C 2BV6A 3H1CA 3CLOA 3W2VA 2WY8Q 3M1EA 3ABMH 2RNGA 3A02A 2ISZA 5EEGA 4CUGA 5M3FJ 1ON1A 1MH4A 2VXZA 3E7LA 4XN0A 3LAJA 3DU6A 2YU9J 5LFAA 2EIKH 3HM5A 2IS4A 2K9MA 1R1VA 2JTVA 2L4MA 3FBNB 4XSXF 1WPKA 2XAFA 4UUVA 3GX4X 3V42A 2DTRA 2XPVA 1KYWA 3RIRA 2BVLA 3OYBA 3K0LA 1D3YA 3I5UA 3ZMSA 1MMNA 1F1ZA 4XRFA 4C2MJ 3H0GJ 3I53A 4HEA2 3CCMI 2DFFA 3GWZA 4HW0A 3K7AJ 3GTPJ 2ME0A 1CF7B 1FLIA 3BZCA 2GA1A 3R0AA 3ZMZA 2XKPA 1K4SA 3GTMJ 1OISA 3S3OA 2MD0A 2WAQN 2CFXA 1T6SA 4L9NA 4LLGF 3T8RA 2K85A 4G7ZF 2UXNA 1ZGWA 2KIUA 5TRDA 2EZHA 1FYLA 2K40A 2HKOA 1TW3A 3PQJA 3WE3A 2W84A 2KISA 2Z2SB 1W36D 3CESA 4BUPA 3CQZJ 4D1QA 4B3XA 4HSRA 5K1YA 1MIJA 2QSGX 3I58A 3FZVA 4G12A 1U3EM 2V1XA 3QPSA 3HUGA 2ZXJA 1FTTA 1ZK8A 3E97A 5FKLA 4BHCA 2FNPA 2YX7A 1O7FA 4NC6A 4NQWB 2YS9A 1Z3YA 3ZOBA 2O61A 1ZR4A 1RNLA 1MMSA 1T0FC 3JRIA 4X0GA 1R22A 1XGNA 2KJBA 2V79A 1R6RA 2VQGA 3ZR8X 3VYSB 3GYHX 1S5LC 3LFKA 4PSWA 2KMUA 1OYWA 4BQQA 2IBDA 5IY5H 5JLXA 3ERMA 3LQQA 4ESJA 3K4MA 3KP6A 4M3EA 5DCMB 3CCRI 3KX2A 2LH9A 1X1PA 1OYYA 2XKOA 4ZDOA 1UZCA 1U8BA 3R60A 3SXYA 2CUFA 3ROUA 2QUFA 5HLGA 4RGUA 1IDYA 2M4GA 5DV5A 2VQHA 1G4DA 3HKZA 3DWLE 1QA6A 1G6NA 1X4OA 4BACA 3GXOA 1Z0XA 1G8XA 2M9HA 3E6BA 1JUPA 2E19A 3VYTB 4CZCA 4IO9F 2KQRA 4CH7A 4KFCA 1JTXA 2COMA 3LQRA 1P6RA 2JQ7A 3WTUC 4E7JA 2R4GA 4BYYA 4PSXA 2A6HF 2WAFA 5FRNA 1JT6A 4NNJA 1IUFA 3IWFA 3A01B 1YIJI 4A3FJ 2CO5A 4PJLA 4G7HF 4BKXA 4EEFG 4GO1A 4TV7A 2VQLA 1P4AA 3KCCA 3F23A 4A93J 1XSXA 4IZZA 2VBWA 4JX6A 1Z7UA 2OC6A 3F8MA 4BJTA 5KCMA 4XOTA 1BR4A 2ZMEB 3HSRA 3GTOJ 2LFBA 4DGWB 4E7HA 1SD5A 2PMUA 3RPQA 3TBIA 2LD5A 2Z99A 3W2WA 4QLCU 2BZTA 2HQRA 1MMGA 3J7AY 3DPLC 3OYFA 2M34A 5FB2A 1SEUA 3OV8A 3FX3A 1BC7C 3WGHA 2X6OA 3B6CA 2HEOA 2QQBA 2PG4A 3O2PE 4EM0B 3TP0A 1VQ6I 3S8PA 5CVIA 1IAWA 2M4KA 1YITI 3OIQA 1HA8A 4CHUA 2YUSA 1HLVA 3MKZA 4C30A 1PUEE 4G6QA 3NAUA 3GFIA 4JOMA 2BY0A 2K9QA 3PL8A 4ZZLA 3VPRA 4A3IJ 2AHQA 2XF6A 2K7LA 3QQAA 2HDWA 3I55I 3AKZA 1PUFA 4D0PA 2HYGD 3CZ6A 2VE8A 2F5EA 2QVOA 3P7NA 4HLXA 5J1UA 1XDUA 4NHJA 3W3CA 4E70A 1H9GA 5CYVA 2NS7A 5HDGA 1I5ZA 2QYOA 3BQZA 3KPHA 3IH4A 1K4TA 1FMVA 5F6FA 1GXQA 2Y0SA 1XDSA 4LITA 2HPMA 2GWRA 2CQQA 2Q0OA 1YFHA 4WXCA 1ZHFA 1EH7A 4W1UA 1WGXA 5HDKA 5H20A 2QQ8A 3TO7A 1S7EA 1R1TA 4UHTA 1J75A 4BHPA 4ENNA 1G3WA 3L9FA 1JKRC 4MTDA 1ZG1A 3MMYB 2MBFA 2DA5A 3IRQA 1P4WA 5B1AH 2XRLA 4Y52J 5FGMA 1HW1A 4BY7J 3CCJI 4ENJA 2RKHA 2XSJC 1X19A 1RETA 1ZH5A 4DIQA 2W4SA 1V4RA 4XONA 3AL0B 2WY7Q 4AYBA 4EJVA 2A07F 5BS6A 3ZRGA 4Y15A 1FBUA 1W5SA 3DPTA 4LB6B 4RDUA 1OCOH 4I7HA 2DQLA 5L3BA 1K7AA 4RAYA 1D5VA 1QZYA 1TTYA 2R7SA 2XB5A 1RI7A 3CP8A 2V26A 4KICA 2NVUB 4RLFA 5GAGJ 2F2EA 2QBYB 3WTZA 3Q0WA 3BG3A 4CGZA 3F8CA 2P5KA 3MCZA 4FE7A 2M7BA 2K3PA 1QRYA 5LHIA 3BJ6A 4YFXF 1KZHA 4UUTA 1A6QA 4BQOA 2OA4A 1XC5A 3FXLA 3CCLI 1YW7A 2L9SA 1CF7A 2KIMA 3OYGA 2CQNA 3BTJA 5L3EA 4QIWN 2LP0A 5C3EJ 4R1HA 5E18F 3QRFF 1IRGA 3FMRA 1X1BA 3MZYA 3Q9SA 2RDPA 1B1BA 1I3QJ 2V9KA 2K86A 3IH2A 3KP4A 1ETVA 2XB0X 1WJ5A 2JA2A 3MZ8A 5FKNA 2BY3A 6PAXA 3MKLA 4HNTA 2A3SA 5EZHA 3CCUI 1XMXA 1JGGA 1Y0NA 5AONA 1GV2A 2GIZA 4XRMA 1B9NA 4YEJA 4NQWA 1WRJA 3TOAA 1LFPA 5E17F 1TBXA 3O3KA 2XGEA 4Q48A 2VKHA 1VQ7I 2CS3A 2VBZA 3EDPA 4B09A 4IHSA 4RA2A 2V9PA 1QVUA 4A6EA 1GXPA 2DU9A 4RAGA 4LJZF 1ZR2A 2E2IJ 2EFQA 2WTEA 3HKZN 4L0ZB 2ZC2A 4XM3A 4HOBA 1D5YA 4XL9A 4RB1A 4A3EJ 4RLQA 3RPUA 4KA4A 4OU0A 5CVJA 4C3HJ 1WH7A 4IKFA 1S7OA 3ZQ7A 2XAUA 5BMZA 1XD7A 1YW9A 1WJFA 2ZXHA 2FOWA 2R7XA 2O5RA 2R7QA 3DFGA 3FXQA 5FKMA 2B0LA 1HSTA 3M7GA 1RIOH 2N8GA 3K4JA 4BXXJ 1KU9A 2CUJA 2E7WA 1B6AA 1YW8A 3LSHA 3IWZA 3SZGA 2QM3A 3U2RA 1BI1A 5CVUA 4MFEA 1MW7A 5E3LA 4S0HB 2VODA 2X1CA 4XKVA 4EVIA 3RPUD 3P9CA 1HXDA 1YHQI 4KT5C 2B63J 2DOAA 4LOCA 3JTHA 1Z9CA 1I6HJ 1UCRA 1J5YA 3F9KA 2RAEA 4CCKA 1ORKA 3G4SI 4DYQA 2P6TA 3OYAA 3HL2A 4ZJZA 2VUMJ 2IS6A 4I99C 3DF8A 2COBA 3T8TA 2HOEA 1SMYF 5HS7A 4IHVA 2HOTA 2ZMEA 1O3SA 1RRJA 3VYUB 3QYFA 3JTGA 1N78A 1U78A 4ENMA 5JHUA 4PJMA 3FIWA 2A6EF 5K5OA 4E7LA 3BCBA 1U6GA 3UNGC 3GLXA 5K7ZA 2X6XA 2DMQA 2HXOA 2KHMA 2KKOA 1O3RA 4WXHA 2RV8A 2UZKA 1XTAA 3LMMA 1K78B 3BDDA 2Y2ZA 3KP3A 1R4NB 2HQNA 3CMYA 2QQAA 1VQNI 4C2TA 1QU3A 2STTA 2MLGA 4E7KA 1J7KA 4HQMA 2JPCA 1SFEA 3FDYA 4NUBA 4BU2A 1Z1DA 4M6VA 5F0FA 3LA2A 2D1HA 5HOOA 2P6SA 4P5OA 1Z05A 4Y33A 1YE9A 5E1XA 4Y7NJ 2EA2A 5F27A 3ZQCA 2DMPA 5F1RA 1F36A 4I09A 4L5IA 4HF2A 2RN7A 3DQVC 5DUIA 2Y0SN 4GDFA 3K1NA 3S93A 3CF5F 3QYEA 4V2FA 3I54A 3IP4B 2W00A 3BROA 4C3IJ 4U7DA 4JYKA 1J9IA 2P81A 1VI0A 3M8FA 2F48A 3DBLB 3JRFA 3QP5A 1P7JA 2FBHA 1ETWA 4RB2C 2A5YB 1DP3A 1YS6A 4MFDA 4NDLA 4FE4A 2EZKA 2J5OA 2M8EA 2IGMA 3VODA 1FOYA 2W7NA 4J01A 4OIRF 5F04A 3KE2A 2BYVE 4AYBN 4O5VA 4F92B 4MO7A 2MSYA 1IXSB 2BY1A 2RVCA 3S16J 3H0DA 2CSOA 1W1WE 2ISYA 3R0JA 1RZ4A 1YJNI 2XUBA 2EH3A 2O03A 5J6XA 4CZZA 4IHXA 1K61A 3OIOA 4BEHB 5E1WA 3TP3A 5M3MJ 1A35A 2JWTA 1ETYA 2QWWA 2XPWA 2M3AA 2PQ8A 2R7ZJ 3W6JB 2LMDA 3WTSC 3C18A 1A31A 2QLZA 1FSEA 3KP5A 4IQJA 3S1QJ 2RNJA 1G3SA 4UVCA 2ETHA 4KNYA 2RC4A 1D0XA 1ONVA 2W48A 2KRCA 4ITVA 4JX5A 2PEXA 1GT0C 5FLXK 3BR0A 3S1RJ 1BOBA 3HHHA 2QBYA 3CC2I 4NB5A 2V1DA 1Y0UA 1R9TJ 1I3AA 5K5RA 1R4MB 4QSHA 1I39A 2A5WA 3L2WA 3CF2A 1FTZA 3I9V2 3OYNA 1MKMA 4AIJA 2HYJA 4HNVA 2X6WA 2EZLA 2HS5A 1ON2A 2BBYA 2HZDA 2BXZA 1B59A 1TWCJ 1R5HA 3HZJA 4BE1A 4BL0B 1U5TC 3DKXA 1GLNA 5L3DA 5J47A 5C4JJ 2PFBA 5LBQA 3J81K 1J09A 1T95A 3V7SA 4RMNA 3VYRB 1G3YA 2DMNA 3S15J 4FQGA 5LRSA 3QOEA 4XLAA 4V2GA 3S1NJ 2CMPA 4WXDA 1PDNC 5DUKA 4CICA 5L3FA 2LKXA 5EGOB 1I6XA 1IN8A 2QENA 4ENKA 2O8KA 4U88A 1EH6A 2R7WA 5M5WJ 1FOKA 3G1MA 4WCGA 4DOZA 1LUJB 1TNTA 2ADUA 1R71A 3BWGA 2P8TA 3I3LA 1IZ1A 1FIPA 2EWNA 5FKKA 3GTLJ 3D5LA 5IT9K 4HV6A 5E3OA 5LGUA 3U9GA 1U9NA 2K4JA 3N97A 5BQTA 3TDUC 1EV7A 4M3DA 1P4XA 1K6YA 2EILH 2CUEA 3GZ5A 3ZMUA 1JHFA 3WTXC 1HC8A 3PUBA 2ECCA 3J80K 1AKHB 4M6YA 1N25A 4F7ZA 4ZZDA 2R7TA 1MBGA 3SEZA 4F3QA 4IHYA 2VPRA 4XSZF 3OYIA 4N9IA 2IA0A 3TW6A 1K6OA 1AHDP 3H3UA 1T2KA 1KQ9A 5DTDA 3JR9A 1WFXA 1LFBA 2FA5A 3U21A 1JKQC 2HQAA 2CW0F 2ZJ2A 3ELKA 5JVTA 1IN5A 4L18B 3H35A 2ID3A 5DS9A 3ZMTA 2H6BA 3H9JA 4D5CA 3CCVI 5EEHA 2O3FA 2VKDA 3NEUA 1AA7A 4UB8C 2PN6A 1CQTA 1T98A 3C2GA 5FD5A 3RCOA 2GLOA 2LC2A 1MSEC 3HIFA 2HYFA 4MHGA 4DBQA 5HNFA 4P1WA 5HNHA 3V4GA 2I8DA 5BPIA 3Q0UA 2CW7A 4G8XA 2NVXJ 3PIOF 1MZBA 5C44J 2FF4A 3BY6A 4B1RA 3HHGA 2DA2A 2DA3A 3SYTA 1Y39A 1F9NA 1G2HA 1GDTA 2E1MC 3ZQQA 3CDIA 4EJTA 3EYIA 2MH9A 3DLLF 3IAM2 1IV6A 2K9LA 2V6EA 1TNSA 4QPOA 3HRSA 2XGDA 2Y30A 1MBFA 2ID6A 1Z6TA 3A4CA 5E79C 2VJIA 2KL4A 1ZKGA 2WB1N 4BAYA 2IVMA 4RGRA 3D0SA 4U0YA 4JK1X 4BXFA 2A61A 3L00A 1ZARA 4AIHA 3ZXSA 1BI2A 2ZJRF 1SD7A 1ZLKA 5C4XJ 2ZNYA 3H3VK 3KYLA 5D4SA 2VE9A 2ACJA 3UR3C 1SANA 2LLKA 2V1NA 2EJRA 3CJNA 4PGHA 4YELA 2UWMA 1K78A 3GZ6A 2XGXA 4HBLA 3RZDJ 2R92J 4U87A 2ZJPF 3GZNB 3I4PA 2RQPA 2DA4A 3G3ZA 3E3VA 1BN5A 2L3DA 1MNMC 2MC4A 2OCEA 4KYWA 3L09A 4LIVA 2W57A 2DMUA 3GLLA 1J2XA 1OJLA 4MIMA 1FNNA 3KIOA 1B72B 3QPLA 5IYDJ 4OOIA 3DEWA 3WHBA 1LE8B 2VBYA 4DJAA 2ZB9A 5DEQA 3PFYA 1KYZA 2VC1A 2XAGA 3K1PA 2LRDA 5TISC 3Q5FA 3N4MA 3QU6A 5BPDA 5IYCJ 2IP2A 3E5XA 5EG0B 2PMZA 1KQ0A 2JA5J 3AG4H 1JTYA 3FKIJ 3KYCB 3TKYA 1S72I 3A1YA 4C9YA 1YI2I 2BGCA 3GTKJ 2NS8A 4WX9A 1O4XA 3F6OA 1GVDA 3HRMA 4ASNA 4ZH4F 1F4KA 4AIKA 2RREA 3L2UA 1A04A 4XBFA 1E3OC 1SD4A 1NTCA 2P4WA 2X1DA 5E8GA 4YIFA 3I59B 3JW4A 3U1KA 5M5YJ 4KDPA 3HTUA 1X3UA 1T33A 4PZJA 1K83J 1OQYA 2GQQA 2X0LA 2Y75A 2UXXA 2QSHX 2JUCA 5B3SH 1YRNB 2HR3A 1W0UA 3S2HJ 1STZA 4B3AA 2IPQX 2XIGA 1ETQA 4CYCB 3COAC 1JXSA 3WTVC 2F4OB 2X51A 3KP2A 1XGMA 4ETSA 2H1LA 1GUUA 2VXDA 3KYDB 2FX0A 2K5CA 2DTZA 4OMYA 1PYVA 2AXLA 3HSFA 2O9LA 1N75A 4PK4A 2DLLA 3E6MA 2JMWA 2K9NA 4AU7A 4F93B 5F1JA 2VQCA 2XSDC 2HVQA 2LK2A 1PP7U 2FUG2 5EYRA 1X2MA 1E0EA 1ZRDA 4B44A 1HQCA 2NAZA 3KLNA 2XHKA 1RC9A 2Y9YA 2L4AA 2BXYA 2E2JJ 1BM9A 2VIXA 1ZN2A 4N4OB 5IT3A 1ZREA 4U0WA 3PNYA 5B66C 4R8HA 4A5MA 4JBAA 4HX4A 5CLSA 5D8LB 1QBJA 3TDZC 3BR1A 3FWEA 2H8RA 4M3FA 2K9SA 4D5FA 3RYPA 1R5GA 3JAMZ 4Y13A 2FXAA 1DPUA 1ETKA 4AC0A 5FKOA 4G7OF 2IGKA 1TWGJ 2E5NA 2R5YB 3RTRA 3SEQA 5E3MA 3KP7A 2BOLA 1OCZH 3WE2A 3AG3H 2XF7A 1BW6A 2F4MB 3DXJF 2ESNA 5EGOA 1Y1WJ 3H5NA 1DU6A 4E7SA 1Z67A 2D2WA 3QP6A 3BTCA 4UV9A 1S9HA 2LF7A 3CUQA 3HRUA 4CCOA 1LDDA 2VC0A 2W82A 4A3MJ 2ZNZA 1REPC 5AIQA 4A3BJ 2LG4A 3WGIA 3OWTA 3JRGA 3EUHA 3ULQB 4AD9A 2MC3A 5KAIC 4ANJA 2L9NA 1FPQA 1X2NA 2B7EA 3QPTA 4WWCA 3OYDA 5FROA 9ANTA 4P96A 3KLOA 1IF1A 4P55A 2L02A 1V5GA 2JVHA 1AKHA 4GRIA 2PLYA 3L2VA 1PP8F 2QEXI 2E7XA 2ZKZA 1W5TA 2DT7B 3HBLA 4A3JJ 1OCTC 2W24A 3BG7A 1UHSA 2Q8KA 2FEZA 3HB9A 3OOPA 4FX4A 3S14J 1VFCA 2LY1A 4XMYA 3KFWX 2YX4A 3CC4I 1VQ8I 1HSJA 3IUOA 4AIDA 2H09A 1X3WB 2UUZA 1E17A 3MN2A 1XSDA 3HOSA 3O6BB 1I50J 3OL3A 4J19A 1IXRC 4O3MA 1B8IB 3IKVA 3V7CA 1SVOA 1LJ9A 5ERIA 4A69C 2IA2A 2VI6A 2DW4A 2UV1A 4OIOF 1T39A 4A3DJ 3F6VA 2HXIA 1EKEA 3BPXA 3OYKA 3SJMA 3V8LA 2CU7A 3E0JB 3ABLH 1FZPB 5KK1A 4BY1J 3HXLA 5DD4A 4A0XA 1IXCA 1O57A 3C2BA 1SFXA 4XORA 2Z9OA 4PGGA 1BA5A 1IUYA 2DPDA 3OY9A 4OIQF 3GO5A 5IP9J 1Z91A 4BS9A 2R3SA 4G9YA 2M8GX 3GTGJ 1IDZA 1LDKB 1TWFJ 3OIPA 2W25A 3LSPA 1WVRA 4ESBA 1RESA 4M6XA 4KITB 3MWMA 1V54H 3EETA 4OAZA 5ICGA 2H27A 3MFKA 3GUDA 2DDAA 4DZPA 3RKQA 2RGVA 4I01A 3LNQA 2CQ7A 5DM6F 3AG1H 1IRXA 1JKOC 1ACIA 3RQ4A 4MGRA 2QF7A 1BC8C 1PVEA 3HPGA 2DA6A 2CWEA 2ZO4A 4RAFA 1FSHA 3KZZA 2MW8A 4IEJA 4HAMA 3WU0A 3IKTA 2Q1ZB 2BY2A 2HOSA 1FBSA 3MKYB 4XKBA 1FWZA 1FIAA 2OJED 1A5JA 4M9XA 3PQKA 1JUMA 3VSLA 2MFZA 4FTHA 1JKPC 2DFHA 1XB4A 3CDLA 5H6RA 4I0AA 1ULYA 2K3FA 2H8WA 2R7OA 4A3KJ 1ERDA 3DTKA 2XDVA 1VQ9I 1SAXA 4LFUA 1QPIA 2VONA 3WODF 2HI3A 2AO9A 4ABZA 4M3GA 3EUKL 4EGZA 1EA3A 3CMMA 4E7IA 1B72A 3W6VA 1XS9A 1ZAOA 1IN6A 2OD5A 2M5WA 5J8FA 4E4HA 1LE8A 2PMZN 1IV8A 2K4BA 4YIIA 4KIFA 2R7VA 2EIMH 4ZYEA 3HOUJ 3CJRB 1H8AC 1JHHA 3DTIA 3ECHA 2HWVA 4FX0A 2GXGA 5EG0A 4UNOA 4D7NA 3OS2A 3RZOJ 5DCMA 2O8XA 2ZSIB 1KQ8A 4ZC3A 3S17J 5B5EC 2EFPA 3K2ZA 2ZFUA 3QPHA 1DUXC 3G1OA 1SVLA 3JRHA 3G6EI 3ZN0A 5JI6A 1LVKA 1TQMA 2EA4A 1JUSA 2HDDA 5KNLA 3ZQGA 1BIAA 5EF6A 3VOEA 1BW5A 2IGNA 1QVTA 4LK1F 5D5WB 1OR7A 3K9TA 5F64A 3I59A 4A0YA 5GP9A 2XAJA 3IHUA 2WBMA 3HPHA 2ZSHB 5LEJA 5CQEA 4ZTFA 2KIFA 1FOWA 3ML6A 3FXOA 1YRNA 1ZYRF 2FMYA 3D5RC 1H9TA 3BJAA 3WHCA 4BE0A 1APLC 4CYCA 3R6SA 2ZBKA 1VF9A 2M30A 2VASA 3BR5A 3A01A 2GZWA 5E8IA 1NG6A 3I56I 1U2WA 2QSFX 4Z6YA 1SFOJ 2J5PA 4XLCA 1QNTA 1R5ID 4II2A 4MQVA 2LTPA 1HKTA 4DYRA 3T1BA 3J7AO 2NNYA 2JJ7A 1QGPA 1Z77A 4YFNF 3H3ZA 4EJWA 4MQ9F 4WK8F 2JN6A 4A3GJ 1W5CC 3RDIA 2D45A 3MAJA 1HW5A 2DMTA 4IRHA 2FQ3A 3FXUA 3LSKA 3LSIA 2EPFA 4LG3A 2QKLB 4IL6C 2DPUA 1XCVA 1MGTA 2DODA 1TQPA 3LSMA 3HTSB 4GGGA 4KT6A 2R5YA 3I71A 2YSRA 3LSGA 4BJ6C 3K10A 2GOMA 3NWTA 2PX9A 4L9VA 4PJJA 3BR2A 2EK5A 3TMOA 2X48A 1X1AA 2BW3B 1YX3A 1OLTA 4UY8I 4DQ2A 5A2QZ 2EIJH 4NC7A 1MBHA 2IAIA 4KMUX 3CMAI 3HOWJ 3OYCA 3M07A 3BG5A 3KZIC 4BXUA 5JVGF 3C2HA 3HUGB 2RQQA 2Z33A 1V5EA 2K27A 1JJ6C 3UKGA 3IRRA 1E3HA 3DBRB 1IN4A 2H1KA 2L5QA 3L1PA 2ESHA 4IQ4A 4XNFA 2XROA 2F5CA 5F0HA 1TL8A 2HNHA 5CPRB 2VOOA 2LDUA 1NK3P 2GOXB 2FQ4A 3TQNA 1X4PA 4JQFA 1W4MA 5J1YA 3G71I 3ISPA 4XICA 2G7HA 2WC2A 2M0MA 1BL0A 2OUMA 3J7YJ 2Z5UA 2ELHA 4FCYA 1B8IA 1SFUA 5K7FA 4UVAA 1I1SA 1LPQA 4S04A 3S2WA 4MEYF 2L7ZA 5D6EA 4UUSB 3MVPA 4X6AJ 5K7HA 1P92A 3K70D 4Q5SF 2Z1DA 1HKSA 3HGGA 4EM2A 4LIUA 5J1RA 1EJ9A 4M3BA 4LLNA 3GEZA 4RAZA 1R58A 1TLHB 5LHGA 2TRTA 1MSFC 2A69F 1DP7P 2OAZA 4J00A 2DO7A 2ZXIA 3BJOA 3CO6C 4XLEA 1ETOA 1UB9A 1WI9A 3ZN1A 4B47A 4RB3C 3ASNH 1UHWA 3S3MA 1BJZA 3PFIA 4LK0F 3OYJA 1D8KA 2LY9A 3FMQA 4HNUA 1ZTRA 3ZP5A 2GBYA 4R79A 4UV8A 3HC7A 4XLFA 3R61A 4U7BA 2HGCA 1DU0A 3F3XA 2F6CA 1KU3A 1AU7A 2ECBA 2OTJI 5J40A 3MQ0A 2CV2A 3PO2J 2IA1A 2EZIA 5D8KB 2JRTA 1XN7A 1KU2A 2GA2A 1S7AA 5ICFA 3K4CA 1BOAA 4XIDA 3ZQLA 1KONA 2M2EA 3F8NA 2JPBA 3DBHB 3FXMA 3PSIA 1LEBA 2CQXA 4V19K 1BI3A 5HODA 5F08A 1YJ9I 3QYBA 4HDVA 1LB2A 1T0FA 3ZMVA 4IVNA 5ED4A 2NVQJ 5EEAA 4F55A 3RJPA 2ICWG 1DDNA 4DW6A 4I98B 3EPZA 2VJ4A 3SDGA 4EM1A 3H5AA 2JSCA 3RKXA 4CA0A 2R5ZB 3D5SC 1V55H 1BR2A 3KZYA 3ONQA 1H0MA 1W7PB 3DTEA 3S2DJ 1Z21A 3NARA 1XMKA 3RYRA 1BR1A 2ZMEC 2DFIA 2FBIA 4DZJA 4AM3A 4OINF 1QPMA 2V9VA 3REOA 4HA8A 3LSTA 1XGOA 4OAYA 1YJWI 3S1MJ 5EDNA 2P5LC 1U8RA 3L7WA 1ITYA 2LVSA 3GFLA 3NWSA 5CJ9A 4HPQA 2ZXWH 3J7ZI 3BTLA 2OQRA 4OIPF 2EINH 2EFOA 2OZUA 4A0ZA 3F8FA 5ILVA 1JE8A 3OSGA 2QZ8A 3V7RA 1AWCA 2FRHA 2PJPA 1IJWC 2LKSA 1QZZA 2XF5A 3CD6I 3OYMA 4I76A 4II3A 1L0OC 2DI3A 1DGWY 3FISA 1UMQA 2E36A 1WJEA 3BT9A 4EMSA 3LOCA 1I1GA 2P0WA 2XC7A 2GXBA 2FMLA 4PFOA 3G73A 2Y69H 2EQRA 2F5FA 2FSWA 4LD5A 3GFMA 3MZHA 5H6QA 4RBOA 2VBXA 3TW7A 2F5DA 5TGTA 4ZYAA 1KU7A 3HDDA 5DYMA 1UELB 4UB6C 3VEPA 4YG2F 5DCFA 1YYVA 1LKXA 5AIPA 1A36A 1LQ1A 1HKQA 2DA1A 4PUSA 5LGNA 1Z7LA 4QTRA 4CCJA 1FEXA 2CJJA 2EV6A 2DDBA 1Z3XA 4BBSJ 4E7ZA 2DQRA 3KEQA 2QKMB 4RM3A 1FJLA 4XK4A 3FK7A 3CO7C 3O8HA 3Q0VA 1FC3A 1SFKA 5HLTA 4PJ0C 2VT3A 1BBYA 1TW2A 2F5VA 2EFNA 4GXOA 3AL0C 2XPUA 3ABKH 4LB5A 4BQAA 3JSOA 1N77A 5KHDA 3K1MA 4I02A 2JK3A 2HPIA 2WAEA 4IOAF 3TO9A 2VB6A 1RUOA 3SZPA 4HQEA 2P7VB 1T08B 2LR8A 1FX7A 2KP6A 3IH3A 3DLAA 3P9KA 1YQAA 3GW2A 3M8EA 5FJ8J 1RKWA 3ZPLA 1OKRA 1XG1A 4A2UA 2GXAA 4QPQA 2IT0A 4M9SA 2DT5A 3LL7A 3QODA 1Q1HA 4FT8A 4HX7A 4FETA 1R1UA 3Q3SA 2BW3A 3RSNA 2VKVA 5IPAA 1WI3A 2MGQA 1TQIA 5HLHA 2P7CB 1YO5C 3JRDA 3CMEI 3E5QA 3OOUA 3HOYJ 2HOAA 2JT1A 3HOXJ 2X6YA 1X58A 1RKTA 2YR2A 4CCMA 5LGTA 3PNVA 2DK8A 1WWXA 1LVAA 3TL4X 1XGSA 2LSOA 4HDUA 4LG0B 2K02A 1ZELA 1J59A 1FMWA 1D8JA 3H92A 1WZ2A 2V4JC 4XLHA 2CFOA 3C3WA 4GCVA 2L2OA 3RKYA 1WH5A 2JUGA 4U0VA 1FP2A 3HOTA 4UXNA 2IJLA 2HDCA 2OTLI 4IPAA 3EQLF 4NBQA 5HDNA 2L7MP 1ENHA 4Z2YA 2KZVA 2FD5A 1MBKA 3BP8A 5FD6A 1O3TA 5DM7F 1E3PA 1XCBA 2BEOA 4RGXA 1WJCA 5IP6A 5KVRA 3NRVA 4HLYA 4BEHA 2KIQA 2WV0A 3K69A 3CCYA 2O6GE 3ERED 2VPLA 2CQKA 4UUSA 2B9SA 3LWFA 2Y31A 1Y56A 4BE2A 3LSRA 1RR8C 2VN2A 3SHFA 3BC8A 3U1DA 3O8GA 4HG2A 1S6LA 5H2FC 3PSFA 4B43A 1HF0A 1O3QA 1U5TB 4EATA 2LOOA 4XKWA 3CC7I 4XLNF 4ZYHA 4MLOA 4EJOA 1HCRA 2DA7A 1WKMA 3FXKA 4BNCA 3ESWB 2R7DA 1LDJA 2BHZA 2KPMA 2KFDA 1QQIA 3SFZA 3AG2H 4IRIA 3VFZA 3SFIA 3ABUA 4NC8A 2M1BA 3L2RA 4BGDA 4K2EA 3DPUA 1SD6A 2DFEA 4OWRB 4W97A 5HS8A 3NQOA 4HF1A 4GYGA 1LEAA 1KA8A 2I10A 3GBGA 4KUMA 3HG9A 2X9DA 5L3GA 2GM4A 2X85A 2FBKA 2KLOA 5EZGA 3ZQHA 2HVSA 4M72A 2ELKA 1WJAA 2NOJB 1XPXA 4GYIA 1FP1D 1VQLI 4XR6A 3JREA 1QO0D 3ZGKA 3DP7A 2KJCA 3W6KB 5HVQC 3QU3A 4D7MA 3HEFA 1J0RA 3BZKA 2R5ZA 2HTJA 3TEDA 2QQ9A 4I2OA 1IN7A 5IYBJ 1W7PA 3VWBA 3K4BA 3JAMK 2E5ZA 4IHTA 1W36C 4H4KC 3K4LA 1NH3A 3HSEA 2BHYA 1YLFA 2WADA 3SDBA 2R0QC 4A12A 2ZCWA 3LAPA 1UAAA 3OR1C 2CGPA 1UJ8A 4AWXB 1H88C 2WA0A 1D1CA 1Y8RB 4IF4A 4H0EA 2MH2A 4CDGA 4KN4X 2L0KA 4BDYA 2VOPA 2R7RA 2JA6J 4XRSG 2DK5A 3M3YJ 1G3TA 2XRNA 2NVYJ 5EJCA 3WG9A 1VQOI 2XASA 3ABTA 2DJIA 2G9WA 2IS1A 2HKXA 1BI0A 1XMAA 3BCAA 3HGYA 2L9VA 1W7PD 5ICEA 1T38A 2A68F 2AQFA 5D5XB 2F4IA 4A3CJ 4RM2A 3WTWC 2LREA 3FK6A 3L2CA 1O7LA 4XKCA 2E1MB 3SQNA 4N0BA 4I6ZA 3K6GA 1OCRH 4BJ5C 4ON0A 3ZQIA 4CCLA 2ME6A 1HOMA 2FOKA 1V5FA 3OL4A 4L0YB 1JT0A 5JFRA 5GPCA 3S32A 1MH3A 2E1OA 5E1ZB 3ECOA 2FU4A 2HVRA 1YG2A 2AXTC 4BQNA 2M0CA 3TOBA 1U0JA 2A6TA 3OYEA 3H9QA 3G2BA 1JJ8C 3DU5A 1UHMA 2G0EA 2HZTA 5GPAA 2JZYA 5FO5A 2G7UA 3LSJA 4KN7X 3H5RA 1TT0A 2E35A 2CV1A 2OV7A 3M9AA 5J4YA 5BNGA 1EF4A 2FE3A 4C2UA 1TP4A 2PMHA 1FT9A 2I5UA 1LNWA 1IC8A 2VT2A 3A2KA 4IJAA 1MDMB 5CQGA 3HOZJ 2VJJA 3WTYC 4GFBA 1MJ9A 4Q47A 4BHBA 4BH9A 1GVJA 3A0BC 3GVAA 1TZLA 2L54A 4M71A 1LFUP 2CRGA 5FRMA 3A03A 3DV8A 3TO6A 1ZGAA 3VB2A 4L5JA 4MTEA 3K4NA 2HFHA 1MBJA 1WJBA 3AFHA 2HU9A 2IW5A 4AVZA 1UFMA 4XLPF 2OQGA 3F8BA 1R49A 3OR2C 3ZMDA 1B4AA 2E71A 4BBRJ 1IO2A 1JGSA 2DAOA 4HF0A 4F91B 3SZTA 5M5XJ 1EH8A 3E5UA 3G1LA 4ZTJA 4Y4RA 2WV1A 4L9TA 1ZQ3P 4G94A 5FLVA 1VQ5I 2OPTA 3FXJA 5E3NA 1T56A 3E6CC 3FBIB 4C3JJ 1S8NA 4P9FA 5D6FA 2DXIA 2PJRB 2EV5A 3PM1A 3IV5A 2DOEA 2NXNB 2IEKA 2CUZA 3CP2A 2PBIA 2LF8A 3CDHA 3HYIA 4G6TB 3T0YA 1VQKI 5J8CA 3BPVA 3CTAA 5FFZA 2EFWA 2X4HA 3PIPF 1XX5A 3C1DA 4KMFA 3B02A 4ZDLA 4DBRA 1MNEA 4LG0A 3WGGA 1VQPI 2R7UA 4EQQA 1E2XA 2XGCA 2FJ1A 3F72A 3LFUA 1NHAA 1CGPA 2DN0A 4YRVA 4ZYDA 2ZFWA 2V1UA 1R36A 2KZGA 1S29A 1P7IA 2LBFB 5ILSA 2JRMA 2VJ5A 4Q4ZF 2CYYA 3CUQC 1F5TA 1ZRFA 1WCMJ 5B1BH 2JSPA 2Q2EB 2E1NA 4WF2A 2R7FA 1T8IA 5J3LA 1IW7F 2LY2A 3B73A 4L9JA 2L7FP 1R7JA 3MKWB 4IRGA 2O7OA 1GV5A 1HW2A 3EUHC 4P9UA 1TWAJ 2OCCH 2Z3YA 4IX7A 1Y1VJ 3HOVJ 4A5NA 1ZG3A 1SVMA 5GTIC 5HS9A 1ZLJA 5IOZA 3DEEA 1UG0A 2OBPA 3BG9A 1C0WA 1OCPA 3HRTA 4JX4A 4LGWA 2VLAA 1WSUA 3FMSA 3GF2A 4XRSA 5LEKA 3QOPA 4CSWA 3BQYA 2HQ5A 2ZJQF 4AVPA 1U5TA 4B8XA 4KJZA 3FHZA 3D1NI 2Z16A 3GFJA 2EB7A 2W1OA 4XOPA 5FFXA 2PI0A 5JR3A 3K2AA 5JHFA 3K4KA 1FY7A 4RS8A 3QWLA 3VSKA 1HBXG 1MMAA 2Y48A 3DEUA 3M4OJ 2MABA 4PFPA 3CLQA 4FASD 2STWA 2DOFA 4ESFA 3PJRA 4UVBA 1OYIA 2AS5F 4N4NB 2E2HJ 5GTHC 5BOXA 4MEXF 5ICCA 5LD2C 2IRFG 1XSVA 2LKPA 3H36A 1VZ0A 1D0ZA 3GCMA 3QAHA 2IGOA 2EV0A 3BTIA 4Y3OA 2LNBA 1I27A 4M73A 3WTTC 2GIVA 3BLYA 1USTA 3CCQI 4CXFA 4KISA 2P5VA 2DYSH 2KT0A 2V6CA 1WQ2A 2H94A 2NOGA 3T5XA 4OMZA 2Y9ZA 1SC7A 1RR7A 1Z6RA 1RUNA 1L3LA 5HLIA 5CVVA 2XAHA 3CUOA 3H9GA 4KIGA 5CVRA 3I64A 5L3CA 5TJJA 1POGA 2QCOA 2WB1A 1RPWA 4F52A 3WU1B 2KDOA 1X3ZB 4YIRX 1GHCA 3A0HC 2QGUA 2DYRH 3OMYA 4D9JA 4PDKA 3PO3J 4EV0A 4CYDA 1V3FA 2CH0A 2IXSA 5ILUA 3GTJJ 5E20A 2R93J 1VNDA 3PUFA 1ZGJA 3IAS2 3ZCOA 2VL8A 1ODDA 2WAQA 3CJTB 2DBBA 2CG4A 5DDGA 3OYLA 4FHTA 2XVCA 2YU3A 1OFCX 3MEXA 3FHNA 1OCCH 2YPRA 2QA4I 2E1CA 1KGSA 1Y8QB 4HZFA 2D5VA 2L7KA 2XV4S 4N9HA 2KRFA 2GAUA 4IOCF 1IGNA 1BIBA 3M1CA 5A2QK 5LLQA 2D1VA 4RB0A 2A05A 3E1SA 5GADJ 1X1CA 3I4NJ 3AAFA 1D1AA 4CCNA 3X2QH 1F43A 4HX8A 4CO8A 3DKWA 3E6DA 4Y17A 3V8KA 2DJNA 5IP7J 2M45A 1DGRM 2KRHA 3PNTA 4XN3A 3WG7H 4IHWA 2NVTJ 1QZEA 1JI8A 1G59A 1MD0A 1MJAA 3EYYA 3I4MJ 1W0TA 2X1EA 5GAHJ 3KEYA 1IG7A 1YOVB 3LA7A 2CV0A 1SAUA 2TCTA 5FLXZ 2JA7J 1USSA 1ZG5A 1DPRA 2NRAC 1TWHJ 5F0CA 3RQIA 5K5QA 1YIOA 1P9QC 3V8JA 3FF5A 2BVMA 1H89C 1S3JA 3JRBA 1VQ4I 4HV5A 1MMDA 1PJRA 3BR6A 3OS0A 2H6CA 2MYSA 3N05A 3P9IA 2FNAA 4M9ZA 5J4VA 2O0YA 3F22A 1QHHD 2OU2A 4B48A 3HJEA 1D1BA 4E6KG 4A3LJ 2XAQA 4QWQA 1OR7C 1NG7A 1MDMA 3IL2A 1P2FA 1FYKA 3TGNA 1B9MA 3WU2C 3F0CA 2DCEA 3J81Z 1QHGA 2AQEA 1HDDC 2EBIA 2LYCA 3FKJA 3CCSI 3JRCA 5KAFC 3JCUC 5GAEJ 1K79A 5D5VB 1FBQA 4YFKF 1YS7A 4DYCA 1VTNC 4PCQA 4S05A 4BDZA 4AUXA 1TC3C 3FM5A 1HDPA 1Q1VA 4G6DA 3JSPA 2NNNA 3GTQJ 4HSTA 1WHUA 4RGSA 2ELJA 1M1EB 1OMIA 2NYXA 3KEOA 1MJBA 5IT9Z 3OSFA 1MBEA 4X1EA 1SMTA 3JRAA 3RI4A 3R4KA 2JA8J 2IS2A 5FLMJ 4EGYA 2C6YA 3W2AA 3LA3A 4FISA 4B4CA 2L9RA 2NS0A 3C7JA 3VDXA 2PJRA 4ZDPA 3GMEA 2Y0MA 5CKTA 3CCEI 3M8JA 3BOQA 3J80Z 5D5UB 4LLLA 3FXRA 2MD5A 5LHHA 1FYMA 3B6AA 1MNDA 3DKYA 1YTYA 1X1DA 4MNUA 4EJUA 3BZ6A 1A6IA 3CUQB 4L5EA 1R23A 5D4RA 2JVGA 1D0YA 2WWYA 1IRZA 4IXAA 3Q9VA 3IC7A 3OS1A 1PUFB 4KIBA
chains in the Genus database with same CATH topology
4ZYGA 4M74A 4I0BA 2W85A 5DD8A 2HTSA 1OPCA 1R00A 4DNCA 1BJAA 1AOYA 2L01A 1ZRCA 2Q2EA 3F21A 3FM3A 1IRFA 3RKWA 5LRRA 3I0TA 2M87A 3KETA 4O6JA 2TDXA 4HYEA 4A6DA 2MLKA 2MA3A 2BE5F 4LMYA 2OZ6A 2BV6A 3CLOA 3M1EA 2ISZA 5EEGA 1ON1A 2VXZA 3LAJA 1R1VA 2JTVA 2L4MA 4XSXF 2XAFA 4UUVA 3GX4X 2DTRA 1KYWA 3RIRA 3K0LA 1D3YA 3I5UA 3ZMSA 1F1ZA 4XRFA 3I53A 3GWZA 4HW0A 1CF7B 1FLIA 2GA1A 3R0AA 3ZMZA 2XKPA 2CFXA 1T6SA 4L9NA 4LLGF 3T8RA 4G7ZF 2UXNA 2KIUA 5TRDA 1FYLA 2HKOA 1TW3A 3PQJA 3WE3A 2W84A 5K1YA 3I58A 3FZVA 1U3EM 2V1XA 3HUGA 2ZXJA 3E97A 4BHCA 2FNPA 2YX7A 1O7FA 2O61A 1RNLA 1R22A 1XGNA 2KJBA 2V79A 3GYHX 3LFKA 1OYWA 3LQQA 4ESJA 3KP6A 5DCMB 1OYYA 2XKOA 3R60A 3SXYA 3ROUA 2QUFA 5HLGA 4RGUA 5DV5A 1G4DA 1G6NA 3GXOA 3E6BA 4KFCA 2COMA 3LQRA 1P6RA 3WTUC 4BYYA 2A6HF 3IWFA 2CO5A 4G7HF 4GO1A 4TV7A 3KCCA 1P4AA 3F23A 1XSXA 2VBWA 1Z7UA 3F8MA 3HSRA 2ZMEB 1SD5A 2PMUA 3RPQA 2Z99A 4QLCU 2HQRA 3DPLC 5FB2A 3OV8A 3FX3A 1BC7C 3WGHA 2HEOA 2QQBA 2PG4A 3O2PE 4EM0B 1IAWA 5CVIA 4CHUA 1PUEE 4G6QA 3GFIA 4ZZLA 2K7LA 4D0PA 2HYGD 2VE8A 2F5EA 2QVOA 3P7NA 4HLXA 4NHJA 1XDUA 4E70A 1H9GA 5CYVA 5HDGA 1I5ZA 2QYOA 5F6FA 1GXQA 1XDSA 2GWRA 2Q0OA 1YFHA 4WXCA 1ZHFA 1EH7A 5HDKA 5H20A 3TO7A 1R1TA 4UHTA 1J75A 4BHPA 4ENNA 1G3WA 3L9FA 4MTDA 1ZG1A 2MBFA 3IRQA 1P4WA 5FGMA 1HW1A 4ENJA 2RKHA 1ZH5A 1V4RA 4EJVA 2A07F 5BS6A 4Y15A 1FBUA 1W5SA 3DPTA 4LB6B 4I7HA 2DQLA 5L3BA 1K7AA 4RAYA 1D5VA 1QZYA 1TTYA 1RI7A 4KICA 2F2EA 2QBYB 3WTZA 4CGZA 3F8CA 2P5KA 3MCZA 5LHIA 3BJ6A 4YFXF 2OA4A 1YW7A 1CF7A 2KIMA 5L3EA 4R1HA 5E18F 3QRFF 1IRGA 3FMRA 3MZYA 3Q9SA 2RDPA 1B1BA 2K86A 3KP4A 6PAXA 2A3SA 5AONA 1B9NA 4NQWA 1WRJA 3TOAA 5E17F 1TBXA 3O3KA 4Q48A 2VBZA 3EDPA 4B09A 4IHSA 4A6EA 1GXPA 2DU9A 4LJZF 2EFQA 2WTEA 4L0ZB 4HOBA 4RB1A 3RPUA 4KA4A 4OU0A 5CVJA 1S7OA 3ZQ7A 5BMZA 1XD7A 1YW9A 3DFGA 3FXQA 2B0LA 1HSTA 3M7GA 1RIOH 1KU9A 2E7WA 1B6AA 1YW8A 3IWZA 2QM3A 3U2RA 1BI1A 5CVUA 2VODA 4EVIA 3P9CA 1HXDA 4KT5C 3JTHA 1Z9CA 1UCRA 1J5YA 2P6TA 3DF8A 3T8TA 2HOEA 1SMYF 5HS7A 2ZMEA 1O3SA 3JTGA 1U78A 4ENMA 5JHUA 2A6EF 5K5OA 1U6GA 3GLXA 2KKOA 1O3RA 4WXHA 2RV8A 2UZKA 1K78B 3BDDA 3KP3A 2HQNA 2QQAA 2STTA 2MLGA 1J7KA 4HQMA 2JPCA 1SFEA 1Z1DA 3LA2A 2D1HA 5HOOA 2P6SA 4P5OA 1Z05A 5E1XA 2EA2A 4HF2A 5F1RA 4I09A 4L5IA 2RN7A 3DQVC 5DUIA 3K1NA 3I54A 4U7DA 3BROA 1J9IA 3M8FA 3QP5A 2FBHA 4RB2C 2A5YB 1YS6A 2J5OA 2M8EA 3VODA 4OIRF 3KE2A 2BYVE 4O5VA 1IXSB 2RVCA 2CSOA 2ISYA 3R0JA 1RZ4A 2XUBA 2O03A 5J6XA 4CZZA 5E1WA 2QWWA 2PQ8A 3W6JB 3WTSC 3C18A 2QLZA 1FSEA 3KP5A 2RNJA 1G3SA 4UVCA 2ETHA 4KNYA 2RC4A 1ONVA 5FLXK 2PEXA 3HHHA 2QBYA 4NB5A 2V1DA 1Y0UA 5K5RA 1MKMA 4AIJA 2HS5A 1ON2A 2BBYA 1B59A 1R5HA 1U5TC 5L3DA 2PFBA 5LBQA 3J81K 3V7SA 1G3YA 5LRSA 4WXDA 1PDNC 5DUKA 4CICA 5L3FA 1I6XA 1IN8A 2QENA 4ENKA 4U88A 1EH6A 1FOKA 4WCGA 2ADUA 1TNTA 3BWGA 2P8TA 1IZ1A 2EWNA 3D5LA 5IT9K 4HV6A 5LGUA 3U9GA 2K4JA 3N97A 5BQTA 3TDUC 1EV7A 1P4XA 3GZ5A 3ZMUA 1JHFA 3WTXC 3J80K 4M6YA 4F7ZA 4ZZDA 4XSZF 4N9IA 2IA0A 1K6OA 3H3UA 1T2KA 1KQ9A 2FA5A 3ELKA 2CW0F 2ZJ2A 5JVTA 1IN5A 4L18B 3ZMTA 2H6BA 5EEHA 2O3FA 3NEUA 2PN6A 1T98A 5FD5A 3HIFA 2HYFA 4MHGA 3V4GA 5BPIA 4G8XA 1MZBA 2FF4A 3BY6A 3HHGA 1F9NA 4EJTA 3EYIA 2MH9A 1TNSA 3HRSA 1Z6TA 4BAYA 2IVMA 4RGRA 3D0SA 4U0YA 4JK1X 2A61A 3L00A 1ZARA 4AIHA 1BI2A 1SD7A 1ZLKA 2ZNYA 5D4SA 2VE9A 2ACJA 2EJRA 3CJNA 4PGHA 2UWMA 1K78A 3GZ6A 2XGXA 4HBLA 3I4PA 2RQPA 3G3ZA 3E3VA 1BN5A 2L3DA 4KYWA 3L09A 2W57A 1J2XA 1FNNA 4OOIA 2VBYA 5DEQA 1KYZA 2VC1A 2XAGA 3K1PA 3Q5FA 3N4MA 3QU6A 5BPDA 2IP2A 3E5XA 1KQ0A 3TKYA 2BGCA 4WX9A 3F6OA 3HRMA 4ASNA 4ZH4F 1F4KA 4AIKA 1A04A 4XBFA 1SD4A 2P4WA 5E8GA 4YIFA 3I59B 3JW4A 4KDPA 3HTUA 1X3UA 4PZJA 2GQQA 2X0LA 2Y75A 2UXXA 2HR3A 1STZA 2IPQX 2XIGA 3COAC 1JXSA 3WTVC 3KP2A 1XGMA 4ETSA 4OMYA 2AXLA 3HSFA 2DLLA 3E6MA 1PP7U 1ZRDA 1HQCA 2NAZA 3KLNA 2XHKA 2L4AA 1BM9A 1ZN2A 5IT3A 1ZREA 4U0WA 4R8HA 4A5MA 4JBAA 4HX4A 5CLSA 5D8LB 1QBJA 3TDZC 3FWEA 3RYPA 1R5GA 3JAMZ 4Y13A 2FXAA 1DPUA 4G7OF 3RTRA 3KP7A 3WE2A 3DXJF 2ESNA 2D2WA 3QP6A 4UV9A 2LF7A 3CUQA 3HRUA 1LDDA 2VC0A 2ZNZA 1REPC 5AIQA 3WGIA 3EUHA 3ULQB 4AD9A 2MC3A 1FPQA 3QPTA 4WWCA 4P96A 3KLOA 1IF1A 4P55A 2L02A 2PLYA 1PP8F 2E7XA 2ZKZA 1W5TA 2W24A 2Q8KA 2FEZA 3OOPA 4FX4A 3KFWX 2YX4A 1HSJA 2H09A 1E17A 1XSDA 3HOSA 3O6BB 1IXRC 4O3MA 3IKVA 3V7CA 1LJ9A 5ERIA 2IA2A 2DW4A 4OIOF 1T39A 3F6VA 3BPXA 3V8LA 1FZPB 5KK1A 5DD4A 4A0XA 1IXCA 1O57A 1SFXA 2Z9OA 4PGGA 1IUYA 2DPDA 4OIQF 3GO5A 1Z91A 2R3SA 4G9YA 1LDKB 2W25A 4ESBA 4M6XA 3MWMA 3EETA 5ICGA 2H27A 3MFKA 3GUDA 2RGVA 4I01A 4MGRA 1BC8C 2CWEA 2ZO4A 1FSHA 3KZZA 3WU0A 4HAMA 3IKTA 1FBSA 1FWZA 4M9XA 3PQKA 1XB4A 5H6RA 4I0AA 1ULYA 1SAXA 4LFUA 2VONA 3WODF 4EGZA 1ZAOA 1IN6A 2OD5A 2M5WA 5J8FA 2K4BA 4YIIA 4KIFA 4ZYEA 1JHHA 3ECHA 2HWVA 4FX0A 2GXGA 4UNOA 5DCMA 2O8XA 1KQ8A 2EFPA 3K2ZA 3QPHA 1DUXC 3ZN0A 5JI6A 1TQMA 2EA4A 1BIAA 3VOEA 4LK1F 5D5WB 1OR7A 3K9TA 5F64A 3I59A 4A0YA 2XAJA 3IHUA 5LEJA 2KIFA 3ML6A 1ZYRF 2FMYA 1H9TA 3BJAA 3R6SA 2ZBKA 2M30A 2GZWA 5E8IA 1U2WA 2J5PA 1QNTA 4MQVA 1HKTA 3T1BA 3J7AO 2NNYA 1QGPA 4YFNF 3H3ZA 4EJWA 4MQ9F 4WK8F 3RDIA 2D45A 3MAJA 1HW5A 4IRHA 2FQ3A 3FXUA 2DPUA 1XCVA 1MGTA 1TQPA 3HTSB 4GGGA 3I71A 2YSRA 4L9VA 2EK5A 4DQ2A 5A2QZ 4KMUX 4BXUA 2Z33A 2K27A 3IRRA 1IN4A 2ESHA 2XROA 2F5CA 2VOOA 2LDUA 3TQNA 4JQFA 1W4MA 3ISPA 2G7HA 2WC2A 2Z5UA 2ELHA 1SFUA 4UVAA 1I1SA 4S04A 3S2WA 4MEYF 5D6EA 1P92A 4Q5SF 4EM2A 1HKSA 4LLNA 3GEZA 4RAZA 1R58A 1TLHB 5LHGA 2A69F 1DP7P 2OAZA 2DO7A 3BJOA 3CO6C 1UB9A 1WI9A 3ZN1A 4RB3C 1UHWA 3PFIA 4LK0F 1D8KA 3FMQA 3ZP5A 4R79A 4UV8A 3R61A 4U7BA 2HGCA 3F3XA 1KU3A 3MQ0A 2IA1A 5D8KB 2JRTA 1XN7A 1KU2A 2GA2A 1S7AA 5ICFA 1BOAA 3F8NA 2JPBA 1LEBA 1BI3A 4HDVA 1LB2A 1T0FA 3ZMVA 4IVNA 5ED4A 3RJPA 1DDNA 4I98B 4EM1A 2JSCA 3RKXA 3KZYA 1H0MA 1W7PB 1XMKA 3RYRA 2DFIA 2FBIA 4OINF 1QPMA 2V9VA 3REOA 4HA8A 3LSTA 1XGOA 2P5LC 1U8RA 3L7WA 3GFLA 5CJ9A 2OQRA 4OIPF 2EFOA 2OZUA 4A0ZA 3F8FA 5ILVA 1JE8A 2QZ8A 3V7RA 1AWCA 2FRHA 2PJPA 1QZZA 1L0OC 2DI3A 4EMSA 1I1GA 2GXBA 2FMLA 3G73A 2F5FA 2FSWA 4LD5A 3GFMA 3MZHA 5H6QA 2VBXA 2F5DA 1KU7A 5DYMA 3VEPA 4YG2F 5DCFA 1YYVA 5AIPA 1LQ1A 1HKQA 5LGNA 2EV6A 2DQRA 3KEQA 3CO7C 1FC3A 1BBYA 4GXOA 1TW2A 2VT3A 2EFNA 4LB5A 4BQAA 3JSOA 3K1MA 4I02A 3TO9A 1RUOA 3SZPA 4HQEA 2P7VB 1FX7A 3P9KA 1YQAA 3GW2A 3M8EA 3ZPLA 1OKRA 4A2UA 2IT0A 4M9SA 2DT5A 1Q1HA 4FT8A 4HX7A 1R1UA 1TQIA 5HLHA 2P7CB 1YO5C 3E5QA 2JT1A 2YR2A 5LGTA 2DK8A 1WWXA 1LVAA 1XGSA 2LSOA 4HDUA 4LG0B 2K02A 1J59A 1D8JA 3H92A 3C3WA 4GCVA 3RKYA 4U0VA 1FP2A 3HOTA 4UXNA 2IJLA 2HDCA 4IPAA 3EQLF 5HDNA 4Z2YA 3BP8A 5FD6A 1O3TA 2BEOA 1XCBA 4RGXA 5KVRA 3NRVA 4HLYA 2WV0A 3K69A 2O6GE 3ERED 2CQKA 3LWFA 2VN2A 3SHFA 3U1DA 1S6LA 1O3QA 1U5TB 4XLNF 4ZYHA 4EJOA 1WKMA 4BNCA 2R7DA 1LDJA 1QQIA 3SFZA 4IRIA 3VFZA 3ABUA 2M1BA 4K2EA 1SD6A 5HS8A 3NQOA 4HF1A 4GYGA 1LEAA 1KA8A 4KUMA 5L3GA 2FBKA 4M72A 4GYIA 1FP1D 1QO0D 3DP7A 2KJCA 3W6KB 5HVQC 3QU3A 1J0RA 2HTJA 2QQ9A 4I2OA 1IN7A 1W7PA 3JAMK 4IHTA 3HSEA 1YLFA 4A12A 2ZCWA 3LAPA 2CGPA 4AWXB 4IF4A 4H0EA 2MH2A 4CDGA 4KN4X 2VOPA 2DK5A 1G3TA 2XRNA 3WG9A 2XASA 3ABTA 2G9WA 2HKXA 1BI0A 1XMAA 1W7PD 5ICEA 1T38A 2A68F 5D5XB 3WTWC 3L2CA 1O7LA 3SQNA 4N0BA 4ON0A 2FOKA 4L0YB 5JFRA 5E1ZB 3ECOA 2FU4A 1YG2A 3TOBA 1UHMA 2HZTA 2JZYA 5FO5A 2G7UA 4KN7X 3M9AA 2FE3A 2PMHA 1FT9A 1LNWA 2VT2A 4IJAA 1MDMB 3WTYC 1MJ9A 4Q47A 4BHBA 4BH9A 1GVJA 3GVAA 2L54A 4M71A 3DV8A 3TO6A 1ZGAA 3VB2A 4L5JA 4MTEA 2HFHA 2IW5A 1UFMA 4XLPF 2OQGA 3F8BA 3ZMDA 1B4AA 1JGSA 2DAOA 4HF0A 3SZTA 1EH8A 3E5UA 4L9TA 4G94A 3E6CC 1S8NA 4P9FA 5D6FA 2EV5A 2PBIA 2LF8A 3CDHA 3HYIA 3T0YA 5J8CA 3BPVA 3CTAA 5FFZA 2EFWA 2X4HA 3C1DA 4KMFA 3B02A 4LG0A 3WGGA 4EQQA 1E2XA 3F72A 1CGPA 1NHAA 4ZYDA 2ZFWA 2V1UA 1R36A 1S29A 5ILSA 4Q4ZF 2CYYA 3CUQC 1F5TA 1ZRFA 2E1NA 4WF2A 2R7FA 1IW7F 4L9JA 3B73A 1R7JA 4IRGA 1HW2A 4P9UA 2Z3YA 4A5NA 1ZG3A 5HS9A 1ZLJA 2OBPA 1C0WA 3HRTA 4LGWA 1WSUA 3FMSA 3GF2A 5LEKA 3QOPA 4AVPA 1U5TA 4B8XA 3FHZA 3GFJA 2EB7A 2PI0A 5FFXA 5JR3A 1FY7A 4RS8A 1HBXG 2Y48A 3DEUA 2STWA 4ESFA 4UVBA 1OYIA 2AS5F 5BOXA 4MEXF 5ICCA 2IRFG 1XSVA 2LKPA 3QAHA 2EV0A 2LNBA 1I27A 4M73A 3WTTC 2GIVA 1USTA 4CXFA 2P5VA 2V6CA 1WQ2A 2H94A 3T5XA 4OMZA 1Z6RA 1RUNA 1L3LA 5HLIA 5CVVA 2XAHA 3CUOA 4KIGA 5CVRA 3I64A 5L3CA 5TJJA 3WU1B 1GHCA 4PDKA 4EV0A 4CYDA 1V3FA 5ILUA 5E20A 1ZGJA 1ODDA 2DBBA 2CG4A 5DDGA 4FHTA 2XVCA 2YU3A 3MEXA 2YPRA 2E1CA 1KGSA 4HZFA 2XV4S 4N9HA 2KRFA 2GAUA 1BIBA 5A2QK 5LLQA 2D1VA 4RB0A 3AAFA 4HX8A 4CO8A 3DKWA 3E6DA 4Y17A 3V8KA 2M45A 1MD0A 1MJAA 3EYYA 3LA7A 5FLXZ 1USSA 1ZG5A 1DPRA 2NRAC 5K5QA 1YIOA 3V8JA 3FF5A 1S3JA 4HV5A 2H6CA 3P9IA 2FNAA 4M9ZA 2O0YA 3F22A 2OU2A 2XAQA 4QWQA 1MDMA 3IL2A 1P2FA 1FYKA 3TGNA 1B9MA 3J81Z 1K79A 5D5VB 1FBQA 4YFKF 1YS7A 1VTNC 4PCQA 4S05A 3FM5A 4G6DA 3JSPA 2NNNA 4RGSA 1OMIA 2NYXA 3KEOA 1MJBA 5IT9Z 1SMTA 3RI4A 3R4KA 4EGYA 2C6YA 3LA3A 2NS0A 3C7JA 2Y0MA 3J80Z 3BOQA 5D5UB 4LLLA 3FXRA 2MD5A 5LHHA 1FYMA 1YTYA 4MNUA 4EJUA 3BZ6A 3CUQB 1R23A 5D4RA 2WWYA 4IXAA 3Q9VA 3IC7A 4KIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYG A;  4M74 A;  4I0B A;  2W85 A;  5DD8 A;  2HTS A;  1OPC A;  1R00 A;  4DNC A;  1BJA A;  1AOY A;  2L01 A;  1ZRC A;  2Q2E A;  3F21 A;  3FM3 A;  1IRF A;  3RKW A;  5LRR A;  3I0T A;  2M87 A;  3KET A;  4O6J A;  2TDX A;  4HYE A;  4A6D A;  2MLK A;  2MA3 A;  2BE5 F;  4LMY A;  2OZ6 A;  2BV6 A;  3CLO A;  3M1E A;  2ISZ A;  5EEG A;  1ON1 A;  2VXZ A;  3LAJ A;  1R1V A;  2JTV A;  2L4M A;  4XSX F;  2XAF A;  4UUV A;  3GX4 X;  2DTR A;  1KYW A;  3RIR A;  3K0L A;  1D3Y A;  3I5U A;  3ZMS A;  1F1Z A;  4XRF A;  3I53 A;  3GWZ A;  4HW0 A;  1CF7 B;  1FLI A;  2GA1 A;  3R0A A;  3ZMZ A;  2XKP A;  2CFX A;  1T6S A;  4L9N A;  4LLG F;  3T8R A;  4G7Z F;  2UXN A;  2KIU A;  5TRD A;  1FYL A;  2HKO A;  1TW3 A;  3PQJ A;  3WE3 A;  2W84 A;  5K1Y A;  3I58 A;  3FZV A;  1U3E M;  2V1X A;  3HUG A;  2ZXJ A;  3E97 A;  4BHC A;  2FNP A;  2YX7 A;  1O7F A;  2O61 A;  1RNL A;  1R22 A;  1XGN A;  2KJB A;  2V79 A;  3GYH X;  3LFK A;  1OYW A;  3LQQ A;  4ESJ A;  3KP6 A;  5DCM B;  1OYY A;  2XKO A;  3R60 A;  3SXY A;  3ROU A;  2QUF A;  5HLG A;  4RGU A;  5DV5 A;  1G4D A;  1G6N A;  3GXO A;  3E6B A;  4KFC A;  2COM A;  3LQR A;  1P6R A;  3WTU C;  4BYY A;  2A6H F;  3IWF A;  2CO5 A;  4G7H F;  4GO1 A;  4TV7 A;  3KCC A;  1P4A A;  3F23 A;  1XSX A;  2VBW A;  1Z7U A;  3F8M A;  3HSR A;  2ZME B;  1SD5 A;  2PMU A;  3RPQ A;  2Z99 A;  4QLC U;  2HQR A;  3DPL C;  5FB2 A;  3OV8 A;  3FX3 A;  1BC7 C;  3WGH A;  2HEO A;  2QQB A;  2PG4 A;  3O2P E;  4EM0 B;  1IAW A;  5CVI A;  4CHU A;  1PUE E;  4G6Q A;  3GFI A;  4ZZL A;  2K7L A;  4D0P A;  2HYG D;  2VE8 A;  2F5E A;  2QVO A;  3P7N A;  4HLX A;  4NHJ A;  1XDU A;  4E70 A;  1H9G A;  5CYV A;  5HDG A;  1I5Z A;  2QYO A;  5F6F A;  1GXQ A;  1XDS A;  2GWR A;  2Q0O A;  1YFH A;  4WXC A;  1ZHF A;  1EH7 A;  5HDK A;  5H20 A;  3TO7 A;  1R1T A;  4UHT A;  1J75 A;  4BHP A;  4ENN A;  1G3W A;  3L9F A;  4MTD A;  1ZG1 A;  2MBF A;  3IRQ A;  1P4W A;  5FGM A;  1HW1 A;  4ENJ A;  2RKH A;  1ZH5 A;  1V4R A;  4EJV A;  2A07 F;  5BS6 A;  4Y15 A;  1FBU A;  1W5S A;  3DPT A;  4LB6 B;  4I7H A;  2DQL A;  5L3B A;  1K7A A;  4RAY A;  1D5V A;  1QZY A;  1TTY A;  1RI7 A;  4KIC A;  2F2E A;  2QBY B;  3WTZ A;  4CGZ A;  3F8C A;  2P5K A;  3MCZ A;  5LHI A;  3BJ6 A;  4YFX F;  2OA4 A;  1YW7 A;  1CF7 A;  2KIM A;  5L3E A;  4R1H A;  5E18 F;  3QRF F;  1IRG A;  3FMR A;  3MZY A;  3Q9S A;  2RDP A;  1B1B A;  2K86 A;  3KP4 A;  6PAX A;  2A3S A;  5AON A;  1B9N A;  4NQW A;  1WRJ A;  3TOA A;  5E17 F;  1TBX A;  3O3K A;  4Q48 A;  2VBZ A;  3EDP A;  4B09 A;  4IHS A;  4A6E A;  1GXP A;  2DU9 A;  4LJZ F;  2EFQ A;  2WTE A;  4L0Z B;  4HOB A;  4RB1 A;  3RPU A;  4KA4 A;  4OU0 A;  5CVJ A;  1S7O A;  3ZQ7 A;  5BMZ A;  1XD7 A;  1YW9 A;  3DFG A;  3FXQ A;  2B0L A;  1HST A;  3M7G A;  1RIO H;  1KU9 A;  2E7W A;  1B6A A;  1YW8 A;  3IWZ A;  2QM3 A;  3U2R A;  1BI1 A;  5CVU A;  2VOD A;  4EVI A;  3P9C A;  1HXD A;  4KT5 C;  3JTH A;  1Z9C A;  1UCR A;  1J5Y A;  2P6T A;  3DF8 A;  3T8T A;  2HOE A;  1SMY F;  5HS7 A;  2ZME A;  1O3S A;  3JTG A;  1U78 A;  4ENM A;  5JHU A;  2A6E F;  5K5O A;  1U6G A;  3GLX A;  2KKO A;  1O3R A;  4WXH A;  2RV8 A;  2UZK A;  1K78 B;  3BDD A;  3KP3 A;  2HQN A;  2QQA A;  2STT A;  2MLG A;  1J7K A;  4HQM A;  2JPC A;  1SFE A;  1Z1D A;  3LA2 A;  2D1H A;  5HOO A;  2P6S A;  4P5O A;  1Z05 A;  5E1X A;  2EA2 A;  4HF2 A;  5F1R A;  4I09 A;  4L5I A;  2RN7 A;  3DQV C;  5DUI A;  3K1N A;  3I54 A;  4U7D A;  3BRO A;  1J9I A;  3M8F A;  3QP5 A;  2FBH A;  4RB2 C;  2A5Y B;  1YS6 A;  2J5O A;  2M8E A;  3VOD A;  4OIR F;  3KE2 A;  2BYV E;  4O5V A;  1IXS B;  2RVC A;  2CSO A;  2ISY A;  3R0J A;  1RZ4 A;  2XUB A;  2O03 A;  5J6X A;  4CZZ A;  5E1W A;  2QWW A;  2PQ8 A;  3W6J B;  3WTS C;  3C18 A;  2QLZ A;  1FSE A;  3KP5 A;  2RNJ A;  1G3S A;  4UVC A;  2ETH A;  4KNY A;  2RC4 A;  1ONV A;  5FLX K;  2PEX A;  3HHH A;  2QBY A;  4NB5 A;  2V1D A;  1Y0U A;  5K5R A;  1MKM A;  4AIJ A;  2HS5 A;  1ON2 A;  2BBY A;  1B59 A;  1R5H A;  1U5T C;  5L3D A;  2PFB A;  5LBQ A;  3J81 K;  3V7S A;  1G3Y A;  5LRS A;  4WXD A;  1PDN C;  5DUK A;  4CIC A;  5L3F A;  1I6X A;  1IN8 A;  2QEN A;  4ENK A;  4U88 A;  1EH6 A;  1FOK A;  4WCG A;  2ADU A;  1TNT A;  3BWG A;  2P8T A;  1IZ1 A;  2EWN A;  3D5L A;  5IT9 K;  4HV6 A;  5LGU A;  3U9G A;  2K4J A;  3N97 A;  5BQT A;  3TDU C;  1EV7 A;  1P4X A;  3GZ5 A;  3ZMU A;  1JHF A;  3WTX C;  3J80 K;  4M6Y A;  4F7Z A;  4ZZD A;  4XSZ F;  4N9I A;  2IA0 A;  1K6O A;  3H3U A;  1T2K A;  1KQ9 A;  2FA5 A;  3ELK A;  2CW0 F;  2ZJ2 A;  5JVT A;  1IN5 A;  4L18 B;  3ZMT A;  2H6B A;  5EEH A;  2O3F A;  3NEU A;  2PN6 A;  1T98 A;  5FD5 A;  3HIF A;  2HYF A;  4MHG A;  3V4G A;  5BPI A;  4G8X A;  1MZB A;  2FF4 A;  3BY6 A;  3HHG A;  1F9N A;  4EJT A;  3EYI A;  2MH9 A;  1TNS A;  3HRS A;  1Z6T A;  4BAY A;  2IVM A;  4RGR A;  3D0S A;  4U0Y A;  4JK1 X;  2A61 A;  3L00 A;  1ZAR A;  4AIH A;  1BI2 A;  1SD7 A;  1ZLK A;  2ZNY A;  5D4S A;  2VE9 A;  2ACJ A;  2EJR A;  3CJN A;  4PGH A;  2UWM A;  1K78 A;  3GZ6 A;  2XGX A;  4HBL A;  3I4P A;  2RQP A;  3G3Z A;  3E3V A;  1BN5 A;  2L3D A;  4KYW A;  3L09 A;  2W57 A;  1J2X A;  1FNN A;  4OOI A;  2VBY A;  5DEQ A;  1KYZ A;  2VC1 A;  2XAG A;  3K1P A;  3Q5F A;  3N4M A;  3QU6 A;  5BPD A;  2IP2 A;  3E5X A;  1KQ0 A;  3TKY A;  2BGC A;  4WX9 A;  3F6O A;  3HRM A;  4ASN A;  4ZH4 F;  1F4K A;  4AIK A;  1A04 A;  4XBF A;  1SD4 A;  2P4W A;  5E8G A;  4YIF A;  3I59 B;  3JW4 A;  4KDP A;  3HTU A;  1X3U A;  4PZJ A;  2GQQ A;  2X0L A;  2Y75 A;  2UXX A;  2HR3 A;  1STZ A;  2IPQ X;  2XIG A;  3COA C;  1JXS A;  3WTV C;  3KP2 A;  1XGM A;  4ETS A;  4OMY A;  2AXL A;  3HSF A;  2DLL A;  3E6M A;  1PP7 U;  1ZRD A;  1HQC A;  2NAZ A;  3KLN A;  2XHK A;  2L4A A;  1BM9 A;  1ZN2 A;  5IT3 A;  1ZRE A;  4U0W A;  4R8H A;  4A5M A;  4JBA A;  4HX4 A;  5CLS A;  5D8L B;  1QBJ A;  3TDZ C;  3FWE A;  3RYP A;  1R5G A;  3JAM Z;  4Y13 A;  2FXA A;  1DPU A;  4G7O F;  3RTR A;  3KP7 A;  3WE2 A;  3DXJ F;  2ESN A;  2D2W A;  3QP6 A;  4UV9 A;  2LF7 A;  3CUQ A;  3HRU A;  1LDD A;  2VC0 A;  2ZNZ A;  1REP C;  5AIQ A;  3WGI A;  3EUH A;  3ULQ B;  4AD9 A;  2MC3 A;  1FPQ A;  3QPT A;  4WWC A;  4P96 A;  3KLO A;  1IF1 A;  4P55 A;  2L02 A;  2PLY A;  1PP8 F;  2E7X A;  2ZKZ A;  1W5T A;  2W24 A;  2Q8K A;  2FEZ A;  3OOP A;  4FX4 A;  3KFW X;  2YX4 A;  1HSJ A;  2H09 A;  1E17 A;  1XSD A;  3HOS A;  3O6B B;  1IXR C;  4O3M A;  3IKV A;  3V7C A;  1LJ9 A;  5ERI A;  2IA2 A;  2DW4 A;  4OIO F;  1T39 A;  3F6V A;  3BPX A;  3V8L A;  1FZP B;  5KK1 A;  5DD4 A;  4A0X A;  1IXC A;  1O57 A;  1SFX A;  2Z9O A;  4PGG A;  1IUY A;  2DPD A;  4OIQ F;  3GO5 A;  1Z91 A;  2R3S A;  4G9Y A;  1LDK B;  2W25 A;  4ESB A;  4M6X A;  3MWM A;  3EET A;  5ICG A;  2H27 A;  3MFK A;  3GUD A;  2RGV A;  4I01 A;  4MGR A;  1BC8 C;  2CWE A;  2ZO4 A;  1FSH A;  3KZZ A;  3WU0 A;  4HAM A;  3IKT A;  1FBS A;  1FWZ A;  4M9X A;  3PQK A;  1XB4 A;  5H6R A;  4I0A A;  1ULY A;  1SAX A;  4LFU A;  2VON A;  3WOD F;  4EGZ A;  1ZAO A;  1IN6 A;  2OD5 A;  2M5W A;  5J8F A;  2K4B A;  4YII A;  4KIF A;  4ZYE A;  1JHH A;  3ECH A;  2HWV A;  4FX0 A;  2GXG A;  4UNO A;  5DCM A;  2O8X A;  1KQ8 A;  2EFP A;  3K2Z A;  3QPH A;  1DUX C;  3ZN0 A;  5JI6 A;  1TQM A;  2EA4 A;  1BIA A;  3VOE A;  4LK1 F;  5D5W B;  1OR7 A;  3K9T A;  5F64 A;  3I59 A;  4A0Y A;  2XAJ A;  3IHU A;  5LEJ A;  2KIF A;  3ML6 A;  1ZYR F;  2FMY A;  1H9T A;  3BJA A;  3R6S A;  2ZBK A;  2M30 A;  2GZW A;  5E8I A;  1U2W A;  2J5P A;  1QNT A;  4MQV A;  1HKT A;  3T1B A;  3J7A O;  2NNY A;  1QGP A;  4YFN F;  3H3Z A;  4EJW A;  4MQ9 F;  4WK8 F;  3RDI A;  2D45 A;  3MAJ A;  1HW5 A;  4IRH A;  2FQ3 A;  3FXU A;  2DPU A;  1XCV A;  1MGT A;  1TQP A;  3HTS B;  4GGG A;  3I71 A;  2YSR A;  4L9V A;  2EK5 A;  4DQ2 A;  5A2Q Z;  4KMU X;  4BXU A;  2Z33 A;  2K27 A;  3IRR A;  1IN4 A;  2ESH A;  2XRO A;  2F5C A;  2VOO A;  2LDU A;  3TQN A;  4JQF A;  1W4M A;  3ISP A;  2G7H A;  2WC2 A;  2Z5U A;  2ELH A;  1SFU A;  4UVA A;  1I1S A;  4S04 A;  3S2W A;  4MEY F;  5D6E A;  1P92 A;  4Q5S F;  4EM2 A;  1HKS A;  4LLN A;  3GEZ A;  4RAZ A;  1R58 A;  1TLH B;  5LHG A;  2A69 F;  1DP7 P;  2OAZ A;  2DO7 A;  3BJO A;  3CO6 C;  1UB9 A;  1WI9 A;  3ZN1 A;  4RB3 C;  1UHW A;  3PFI A;  4LK0 F;  1D8K A;  3FMQ A;  3ZP5 A;  4R79 A;  4UV8 A;  3R61 A;  4U7B A;  2HGC A;  3F3X A;  1KU3 A;  3MQ0 A;  2IA1 A;  5D8K B;  2JRT A;  1XN7 A;  1KU2 A;  2GA2 A;  1S7A A;  5ICF A;  1BOA A;  3F8N A;  2JPB A;  1LEB A;  1BI3 A;  4HDV A;  1LB2 A;  1T0F A;  3ZMV A;  4IVN A;  5ED4 A;  3RJP A;  1DDN A;  4I98 B;  4EM1 A;  2JSC A;  3RKX A;  3KZY A;  1H0M A;  1W7P B;  1XMK A;  3RYR A;  2DFI A;  2FBI A;  4OIN F;  1QPM A;  2V9V A;  3REO A;  4HA8 A;  3LST A;  1XGO A;  2P5L C;  1U8R A;  3L7W A;  3GFL A;  5CJ9 A;  2OQR A;  4OIP F;  2EFO A;  2OZU A;  4A0Z A;  3F8F A;  5ILV A;  1JE8 A;  2QZ8 A;  3V7R A;  1AWC A;  2FRH A;  2PJP A;  1QZZ A;  1L0O C;  2DI3 A;  4EMS A;  1I1G A;  2GXB A;  2FML A;  3G73 A;  2F5F A;  2FSW A;  4LD5 A;  3GFM A;  3MZH A;  5H6Q A;  2VBX A;  2F5D A;  1KU7 A;  5DYM A;  3VEP A;  4YG2 F;  5DCF A;  1YYV A;  5AIP A;  1LQ1 A;  1HKQ A;  5LGN A;  2EV6 A;  2DQR A;  3KEQ A;  3CO7 C;  1FC3 A;  1BBY A;  4GXO A;  1TW2 A;  2VT3 A;  2EFN A;  4LB5 A;  4BQA A;  3JSO A;  3K1M A;  4I02 A;  3TO9 A;  1RUO A;  3SZP A;  4HQE A;  2P7V B;  1FX7 A;  3P9K A;  1YQA A;  3GW2 A;  3M8E A;  3ZPL A;  1OKR A;  4A2U A;  2IT0 A;  4M9S A;  2DT5 A;  1Q1H A;  4FT8 A;  4HX7 A;  1R1U A;  1TQI A;  5HLH A;  2P7C B;  1YO5 C;  3E5Q A;  2JT1 A;  2YR2 A;  5LGT A;  2DK8 A;  1WWX A;  1LVA A;  1XGS A;  2LSO A;  4HDU A;  4LG0 B;  2K02 A;  1J59 A;  1D8J A;  3H92 A;  3C3W A;  4GCV A;  3RKY A;  4U0V A;  1FP2 A;  3HOT A;  4UXN A;  2IJL A;  2HDC A;  4IPA A;  3EQL F;  5HDN A;  4Z2Y A;  3BP8 A;  5FD6 A;  1O3T A;  2BEO A;  1XCB A;  4RGX A;  5KVR A;  3NRV A;  4HLY A;  2WV0 A;  3K69 A;  2O6G E;  3ERE D;  2CQK A;  3LWF A;  2VN2 A;  3SHF A;  3U1D A;  1S6L A;  1O3Q A;  1U5T B;  4XLN F;  4ZYH A;  4EJO A;  1WKM A;  4BNC A;  2R7D A;  1LDJ A;  1QQI A;  3SFZ A;  4IRI A;  3VFZ A;  3ABU A;  2M1B A;  4K2E A;  1SD6 A;  5HS8 A;  3NQO A;  4HF1 A;  4GYG A;  1LEA A;  1KA8 A;  4KUM A;  5L3G A;  2FBK A;  4M72 A;  4GYI A;  1FP1 D;  1QO0 D;  3DP7 A;  2KJC A;  3W6K B;  5HVQ C;  3QU3 A;  1J0R A;  2HTJ A;  2QQ9 A;  4I2O A;  1IN7 A;  1W7P A;  3JAM K;  4IHT A;  3HSE A;  1YLF A;  4A12 A;  2ZCW A;  3LAP A;  2CGP A;  4AWX B;  4IF4 A;  4H0E A;  2MH2 A;  4CDG A;  4KN4 X;  2VOP A;  2DK5 A;  1G3T A;  2XRN A;  3WG9 A;  2XAS A;  3ABT A;  2G9W A;  2HKX A;  1BI0 A;  1XMA A;  1W7P D;  5ICE A;  1T38 A;  2A68 F;  5D5X B;  3WTW C;  3L2C A;  1O7L A;  3SQN A;  4N0B A;  4ON0 A;  2FOK A;  4L0Y B;  5JFR A;  5E1Z B;  3ECO A;  2FU4 A;  1YG2 A;  3TOB A;  1UHM A;  2HZT A;  2JZY A;  5FO5 A;  2G7U A;  4KN7 X;  3M9A A;  2FE3 A;  2PMH A;  1FT9 A;  1LNW A;  2VT2 A;  4IJA A;  1MDM B;  3WTY C;  1MJ9 A;  4Q47 A;  4BHB A;  4BH9 A;  1GVJ A;  3GVA A;  2L54 A;  4M71 A;  3DV8 A;  3TO6 A;  1ZGA A;  3VB2 A;  4L5J A;  4MTE A;  2HFH A;  2IW5 A;  1UFM A;  4XLP F;  2OQG A;  3F8B A;  3ZMD A;  1B4A A;  1JGS A;  2DAO A;  4HF0 A;  3SZT A;  1EH8 A;  3E5U A;  4L9T A;  4G94 A;  3E6C C;  1S8N A;  4P9F A;  5D6F A;  2EV5 A;  2PBI A;  2LF8 A;  3CDH A;  3HYI A;  3T0Y A;  5J8C A;  3BPV A;  3CTA A;  5FFZ A;  2EFW A;  2X4H A;  3C1D A;  4KMF A;  3B02 A;  4LG0 A;  3WGG A;  4EQQ A;  1E2X A;  3F72 A;  1CGP A;  1NHA A;  4ZYD A;  2ZFW A;  2V1U A;  1R36 A;  1S29 A;  5ILS A;  4Q4Z F;  2CYY A;  3CUQ C;  1F5T A;  1ZRF A;  2E1N A;  4WF2 A;  2R7F A;  1IW7 F;  4L9J A;  3B73 A;  1R7J A;  4IRG A;  1HW2 A;  4P9U A;  2Z3Y A;  4A5N A;  1ZG3 A;  5HS9 A;  1ZLJ A;  2OBP A;  1C0W A;  3HRT A;  4LGW A;  1WSU A;  3FMS A;  3GF2 A;  5LEK A;  3QOP A;  4AVP A;  1U5T A;  4B8X A;  3FHZ A;  3GFJ A;  2EB7 A;  2PI0 A;  5FFX A;  5JR3 A;  1FY7 A;  4RS8 A;  1HBX G;  2Y48 A;  3DEU A;  2STW A;  4ESF A;  4UVB A;  1OYI A;  2AS5 F;  5BOX A;  4MEX F;  5ICC A;  2IRF G;  1XSV A;  2LKP A;  3QAH A;  2EV0 A;  2LNB A;  1I27 A;  4M73 A;  3WTT C;  2GIV A;  1UST A;  4CXF A;  2P5V A;  2V6C A;  1WQ2 A;  2H94 A;  3T5X A;  4OMZ A;  1Z6R A;  1RUN A;  1L3L A;  5HLI A;  5CVV A;  2XAH A;  3CUO A;  4KIG A;  5CVR A;  3I64 A;  5L3C A;  5TJJ A;  3WU1 B;  1GHC A;  4PDK A;  4EV0 A;  4CYD A;  1V3F A;  5ILU A;  5E20 A;  1ZGJ A;  1ODD A;  2DBB A;  2CG4 A;  5DDG A;  4FHT A;  2XVC A;  2YU3 A;  3MEX A;  2YPR A;  2E1C A;  1KGS A;  4HZF A;  2XV4 S;  4N9H A;  2KRF A;  2GAU A;  1BIB A;  5A2Q K;  5LLQ A;  2D1V A;  4RB0 A;  3AAF A;  4HX8 A;  4CO8 A;  3DKW A;  3E6D A;  4Y17 A;  3V8K A;  2M45 A;  1MD0 A;  1MJA A;  3EYY A;  3LA7 A;  5FLX Z;  1USS A;  1ZG5 A;  1DPR A;  2NRA C;  5K5Q A;  1YIO A;  3V8J A;  3FF5 A;  1S3J A;  4HV5 A;  2H6C A;  3P9I A;  2FNA A;  4M9Z A;  2O0Y A;  3F22 A;  2OU2 A;  2XAQ A;  4QWQ A;  1MDM A;  3IL2 A;  1P2F A;  1FYK A;  3TGN A;  1B9M A;  3J81 Z;  1K79 A;  5D5V B;  1FBQ A;  4YFK F;  1YS7 A;  1VTN C;  4PCQ A;  4S05 A;  3FM5 A;  4G6D A;  3JSP A;  2NNN A;  4RGS A;  1OMI A;  2NYX A;  3KEO A;  1MJB A;  5IT9 Z;  1SMT A;  3RI4 A;  3R4K A;  4EGY A;  2C6Y A;  3LA3 A;  2NS0 A;  3C7J A;  2Y0M A;  3J80 Z;  3BOQ A;  5D5U B;  4LLL A;  3FXR A;  2MD5 A;  5LHH A;  1FYM A;  1YTY A;  4MNU A;  4EJU A;  3BZ6 A;  3CUQ B;  1R23 A;  5D4R A;  2WWY A;  4IXA A;  3Q9V A;  3IC7 A;  4KIB A; 
#chains in the Genus database with same CATH topology
 4JP0 A;  4ZYG A;  3P5J A;  3OYH A;  1DQU A;  4M74 A;  2KDZ A;  4I0B A;  2W85 A;  5DD8 A;  2HTS A;  1OPC A;  2V7F A;  1R00 A;  4PJN A;  3L2Q A;  3MD2 A;  4DNC A;  2LBF A;  1VQM I;  1U9O A;  1TT5 B;  1BJA A;  3CJQ B;  5IOY A;  3BR3 A;  1AOY A;  2L01 A;  2M7A A;  1ZRC A;  2Q2E A;  2E60 A;  3F21 A;  3ASO H;  3FM3 A;  1Y6I A;  3DCF A;  1IRF A;  3RKW A;  3S3N A;  5LRR A;  4HRI A;  2CW8 A;  2DT6 A;  3I0T A;  2M87 A;  3ZQF A;  4XQF A;  2OF7 A;  2VKE A;  3EUA A;  3KET A;  4O6J A;  2TDX A;  1UG2 A;  2MG4 A;  1YX5 A;  1FOX A;  1WJD A;  4HYE A;  4A6D A;  2MLK A;  2MA3 A;  2BE5 F;  3BG6 A;  5JLW A;  4LMY A;  2OZ6 A;  1ETX A;  2E34 A;  1NK2 P;  3K70 C;  2BV6 A;  3H1C A;  3CLO A;  3W2V A;  2WY8 Q;  3M1E A;  3ABM H;  2RNG A;  3A02 A;  2ISZ A;  5EEG A;  4CUG A;  5M3F J;  1ON1 A;  1MH4 A;  2VXZ A;  3E7L A;  4XN0 A;  3LAJ A;  3DU6 A;  2YU9 J;  5LFA A;  2EIK H;  3HM5 A;  2IS4 A;  2K9M A;  1R1V A;  2JTV A;  2L4M A;  3FBN B;  4XSX F;  1WPK A;  2XAF A;  4UUV A;  3GX4 X;  3V42 A;  2DTR A;  2XPV A;  1KYW A;  3RIR A;  2BVL A;  3OYB A;  3K0L A;  1D3Y A;  3I5U A;  3ZMS A;  1MMN A;  1F1Z A;  4XRF A;  4C2M J;  3H0G J;  3I53 A;  4HEA 2;  3CCM I;  2DFF A;  3GWZ A;  4HW0 A;  3K7A J;  3GTP J;  2ME0 A;  1CF7 B;  1FLI A;  3BZC A;  2GA1 A;  3R0A A;  3ZMZ A;  2XKP A;  1K4S A;  3GTM J;  1OIS A;  3S3O A;  2MD0 A;  2WAQ N;  2CFX A;  1T6S A;  4L9N A;  4LLG F;  3T8R A;  2K85 A;  4G7Z F;  2UXN A;  1ZGW A;  2KIU A;  5TRD A;  2EZH A;  1FYL A;  2K40 A;  2HKO A;  1TW3 A;  3PQJ A;  3WE3 A;  2W84 A;  2KIS A;  2Z2S B;  1W36 D;  3CES A;  4BUP A;  3CQZ J;  4D1Q A;  4B3X A;  4HSR A;  5K1Y A;  1MIJ A;  2QSG X;  3I58 A;  3FZV A;  4G12 A;  1U3E M;  2V1X A;  3QPS A;  3HUG A;  2ZXJ A;  1FTT A;  1ZK8 A;  3E97 A;  5FKL A;  4BHC A;  2FNP A;  2YX7 A;  1O7F A;  4NC6 A;  4NQW B;  2YS9 A;  1Z3Y A;  3ZOB A;  2O61 A;  1ZR4 A;  1RNL A;  1MMS A;  1T0F C;  3JRI A;  4X0G A;  1R22 A;  1XGN A;  2KJB A;  2V79 A;  1R6R A;  2VQG A;  3ZR8 X;  3VYS B;  3GYH X;  1S5L C;  3LFK A;  4PSW A;  2KMU A;  1OYW A;  4BQQ A;  2IBD A;  5IY5 H;  5JLX A;  3ERM A;  3LQQ A;  4ESJ A;  3K4M A;  3KP6 A;  4M3E A;  5DCM B;  3CCR I;  3KX2 A;  2LH9 A;  1X1P A;  1OYY A;  2XKO A;  4ZDO A;  1UZC A;  1U8B A;  3R60 A;  3SXY A;  2CUF A;  3ROU A;  2QUF A;  5HLG A;  4RGU A;  1IDY A;  2M4G A;  5DV5 A;  2VQH A;  1G4D A;  3HKZ A;  3DWL E;  1QA6 A;  1G6N A;  1X4O A;  4BAC A;  3GXO A;  1Z0X A;  1G8X A;  2M9H A;  3E6B A;  1JUP A;  2E19 A;  3VYT B;  4CZC A;  4IO9 F;  2KQR A;  4CH7 A;  4KFC A;  1JTX A;  2COM A;  3LQR A;  1P6R A;  2JQ7 A;  3WTU C;  4E7J A;  2R4G A;  4BYY A;  4PSX A;  2A6H F;  2WAF A;  5FRN A;  1JT6 A;  4NNJ A;  1IUF A;  3IWF A;  3A01 B;  1YIJ I;  4A3F J;  2CO5 A;  4PJL A;  4G7H F;  4BKX A;  4EEF G;  4GO1 A;  4TV7 A;  2VQL A;  1P4A A;  3KCC A;  3F23 A;  4A93 J;  1XSX A;  4IZZ A;  2VBW A;  4JX6 A;  1Z7U A;  2OC6 A;  3F8M A;  4BJT A;  5KCM A;  4XOT A;  1BR4 A;  2ZME B;  3HSR A;  3GTO J;  2LFB A;  4DGW B;  4E7H A;  1SD5 A;  2PMU A;  3RPQ A;  3TBI A;  2LD5 A;  2Z99 A;  3W2W A;  4QLC U;  2BZT A;  2HQR A;  1MMG A;  3J7A Y;  3DPL C;  3OYF A;  2M34 A;  5FB2 A;  1SEU A;  3OV8 A;  3FX3 A;  1BC7 C;  3WGH A;  2X6O A;  3B6C A;  2HEO A;  2QQB A;  2PG4 A;  3O2P E;  4EM0 B;  3TP0 A;  1VQ6 I;  3S8P A;  5CVI A;  1IAW A;  2M4K A;  1YIT I;  3OIQ A;  1HA8 A;  4CHU A;  2YUS A;  1HLV A;  3MKZ A;  4C30 A;  1PUE E;  4G6Q A;  3NAU A;  3GFI A;  4JOM A;  2BY0 A;  2K9Q A;  3PL8 A;  4ZZL A;  3VPR A;  4A3I J;  2AHQ A;  2XF6 A;  2K7L A;  3QQA A;  2HDW A;  3I55 I;  3AKZ A;  1PUF A;  4D0P A;  2HYG D;  3CZ6 A;  2VE8 A;  2F5E A;  2QVO A;  3P7N A;  4HLX A;  5J1U A;  1XDU A;  4NHJ A;  3W3C A;  4E70 A;  1H9G A;  5CYV A;  2NS7 A;  5HDG A;  1I5Z A;  2QYO A;  3BQZ A;  3KPH A;  3IH4 A;  1K4T A;  1FMV A;  5F6F A;  1GXQ A;  2Y0S A;  1XDS A;  4LIT A;  2HPM A;  2GWR A;  2CQQ A;  2Q0O A;  1YFH A;  4WXC A;  1ZHF A;  1EH7 A;  4W1U A;  1WGX A;  5HDK A;  5H20 A;  2QQ8 A;  3TO7 A;  1S7E A;  1R1T A;  4UHT A;  1J75 A;  4BHP A;  4ENN A;  1G3W A;  3L9F A;  1JKR C;  4MTD A;  1ZG1 A;  3MMY B;  2MBF A;  2DA5 A;  3IRQ A;  1P4W A;  5B1A H;  2XRL A;  4Y52 J;  5FGM A;  1HW1 A;  4BY7 J;  3CCJ I;  4ENJ A;  2RKH A;  2XSJ C;  1X19 A;  1RET A;  1ZH5 A;  4DIQ A;  2W4S A;  1V4R A;  4XON A;  3AL0 B;  2WY7 Q;  4AYB A;  4EJV A;  2A07 F;  5BS6 A;  3ZRG A;  4Y15 A;  1FBU A;  1W5S A;  3DPT A;  4LB6 B;  4RDU A;  1OCO H;  4I7H A;  2DQL A;  5L3B A;  1K7A A;  4RAY A;  1D5V A;  1QZY A;  1TTY A;  2R7S A;  2XB5 A;  1RI7 A;  3CP8 A;  2V26 A;  4KIC A;  2NVU B;  4RLF A;  5GAG J;  2F2E A;  2QBY B;  3WTZ A;  3Q0W A;  3BG3 A;  4CGZ A;  3F8C A;  2P5K A;  3MCZ A;  4FE7 A;  2M7B A;  2K3P A;  1QRY A;  5LHI A;  3BJ6 A;  4YFX F;  1KZH A;  4UUT A;  1A6Q A;  4BQO A;  2OA4 A;  1XC5 A;  3FXL A;  3CCL I;  1YW7 A;  2L9S A;  1CF7 A;  2KIM A;  3OYG A;  2CQN A;  3BTJ A;  5L3E A;  4QIW N;  2LP0 A;  5C3E J;  4R1H A;  5E18 F;  3QRF F;  1IRG A;  3FMR A;  1X1B A;  3MZY A;  3Q9S A;  2RDP A;  1B1B A;  1I3Q J;  2V9K A;  2K86 A;  3IH2 A;  3KP4 A;  1ETV A;  2XB0 X;  1WJ5 A;  2JA2 A;  3MZ8 A;  5FKN A;  2BY3 A;  6PAX A;  3MKL A;  4HNT A;  2A3S A;  5EZH A;  3CCU I;  1XMX A;  1JGG A;  1Y0N A;  5AON A;  1GV2 A;  2GIZ A;  4XRM A;  1B9N A;  4YEJ A;  4NQW A;  1WRJ A;  3TOA A;  1LFP A;  5E17 F;  1TBX A;  3O3K A;  2XGE A;  4Q48 A;  2VKH A;  1VQ7 I;  2CS3 A;  2VBZ A;  3EDP A;  4B09 A;  4IHS A;  4RA2 A;  2V9P A;  1QVU A;  4A6E A;  1GXP A;  2DU9 A;  4RAG A;  4LJZ F;  1ZR2 A;  2E2I J;  2EFQ A;  2WTE A;  3HKZ N;  4L0Z B;  2ZC2 A;  4XM3 A;  4HOB A;  1D5Y A;  4XL9 A;  4RB1 A;  4A3E J;  4RLQ A;  3RPU A;  4KA4 A;  4OU0 A;  5CVJ A;  4C3H J;  1WH7 A;  4IKF A;  1S7O A;  3ZQ7 A;  2XAU A;  5BMZ A;  1XD7 A;  1YW9 A;  1WJF A;  2ZXH A;  2FOW A;  2R7X A;  2O5R A;  2R7Q A;  3DFG A;  3FXQ A;  5FKM A;  2B0L A;  1HST A;  3M7G A;  1RIO H;  2N8G A;  3K4J A;  4BXX J;  1KU9 A;  2CUJ A;  2E7W A;  1B6A A;  1YW8 A;  3LSH A;  3IWZ A;  3SZG A;  2QM3 A;  3U2R A;  1BI1 A;  5CVU A;  4MFE A;  1MW7 A;  5E3L A;  4S0H B;  2VOD A;  2X1C A;  4XKV A;  4EVI A;  3RPU D;  3P9C A;  1HXD A;  1YHQ I;  4KT5 C;  2B63 J;  2DOA A;  4LOC A;  3JTH A;  1Z9C A;  1I6H J;  1UCR A;  1J5Y A;  3F9K A;  2RAE A;  4CCK A;  1ORK A;  3G4S I;  4DYQ A;  2P6T A;  3OYA A;  3HL2 A;  4ZJZ A;  2VUM J;  2IS6 A;  4I99 C;  3DF8 A;  2COB A;  3T8T A;  2HOE A;  1SMY F;  5HS7 A;  4IHV A;  2HOT A;  2ZME A;  1O3S A;  1RRJ A;  3VYU B;  3QYF A;  3JTG A;  1N78 A;  1U78 A;  4ENM A;  5JHU A;  4PJM A;  3FIW A;  2A6E F;  5K5O A;  4E7L A;  3BCB A;  1U6G A;  3UNG C;  3GLX A;  5K7Z A;  2X6X A;  2DMQ A;  2HXO A;  2KHM A;  2KKO A;  1O3R A;  4WXH A;  2RV8 A;  2UZK A;  1XTA A;  3LMM A;  1K78 B;  3BDD A;  2Y2Z A;  3KP3 A;  1R4N B;  2HQN A;  3CMY A;  2QQA A;  1VQN I;  4C2T A;  1QU3 A;  2STT A;  2MLG A;  4E7K A;  1J7K A;  4HQM A;  2JPC A;  1SFE A;  3FDY A;  4NUB A;  4BU2 A;  1Z1D A;  4M6V A;  5F0F A;  3LA2 A;  2D1H A;  5HOO A;  2P6S A;  4P5O A;  1Z05 A;  4Y33 A;  1YE9 A;  5E1X A;  4Y7N J;  2EA2 A;  5F27 A;  3ZQC A;  2DMP A;  5F1R A;  1F36 A;  4I09 A;  4L5I A;  4HF2 A;  2RN7 A;  3DQV C;  5DUI A;  2Y0S N;  4GDF A;  3K1N A;  3S93 A;  3CF5 F;  3QYE A;  4V2F A;  3I54 A;  3IP4 B;  2W00 A;  3BRO A;  4C3I J;  4U7D A;  4JYK A;  1J9I A;  2P81 A;  1VI0 A;  3M8F A;  2F48 A;  3DBL B;  3JRF A;  3QP5 A;  1P7J A;  2FBH A;  1ETW A;  4RB2 C;  2A5Y B;  1DP3 A;  1YS6 A;  4MFD A;  4NDL A;  4FE4 A;  2EZK A;  2J5O A;  2M8E A;  2IGM A;  3VOD A;  1FOY A;  2W7N A;  4J01 A;  4OIR F;  5F04 A;  3KE2 A;  2BYV E;  4AYB N;  4O5V A;  4F92 B;  4MO7 A;  2MSY A;  1IXS B;  2BY1 A;  2RVC A;  3S16 J;  3H0D A;  2CSO A;  1W1W E;  2ISY A;  3R0J A;  1RZ4 A;  1YJN I;  2XUB A;  2EH3 A;  2O03 A;  5J6X A;  4CZZ A;  4IHX A;  1K61 A;  3OIO A;  4BEH B;  5E1W A;  3TP3 A;  5M3M J;  1A35 A;  2JWT A;  1ETY A;  2QWW A;  2XPW A;  2M3A A;  2PQ8 A;  2R7Z J;  3W6J B;  2LMD A;  3WTS C;  3C18 A;  1A31 A;  2QLZ A;  1FSE A;  3KP5 A;  4IQJ A;  3S1Q J;  2RNJ A;  1G3S A;  4UVC A;  2ETH A;  4KNY A;  2RC4 A;  1D0X A;  1ONV A;  2W48 A;  2KRC A;  4ITV A;  4JX5 A;  2PEX A;  1GT0 C;  5FLX K;  3BR0 A;  3S1R J;  1BOB A;  3HHH A;  2QBY A;  3CC2 I;  4NB5 A;  2V1D A;  1Y0U A;  1R9T J;  1I3A A;  5K5R A;  1R4M B;  4QSH A;  1I39 A;  2A5W A;  3L2W A;  3CF2 A;  1FTZ A;  3I9V 2;  3OYN A;  1MKM A;  4AIJ A;  2HYJ A;  4HNV A;  2X6W A;  2EZL A;  2HS5 A;  1ON2 A;  2BBY A;  2HZD A;  2BXZ A;  1B59 A;  1TWC J;  1R5H A;  3HZJ A;  4BE1 A;  4BL0 B;  1U5T C;  3DKX A;  1GLN A;  5L3D A;  5J47 A;  5C4J J;  2PFB A;  5LBQ A;  3J81 K;  1J09 A;  1T95 A;  3V7S A;  4RMN A;  3VYR B;  1G3Y A;  2DMN A;  3S15 J;  4FQG A;  5LRS A;  3QOE A;  4XLA A;  4V2G A;  3S1N J;  2CMP A;  4WXD A;  1PDN C;  5DUK A;  4CIC A;  5L3F A;  2LKX A;  5EGO B;  1I6X A;  1IN8 A;  2QEN A;  4ENK A;  2O8K A;  4U88 A;  1EH6 A;  2R7W A;  5M5W J;  1FOK A;  3G1M A;  4WCG A;  4DOZ A;  1LUJ B;  1TNT A;  2ADU A;  1R71 A;  3BWG A;  2P8T A;  3I3L A;  1IZ1 A;  1FIP A;  2EWN A;  5FKK A;  3GTL J;  3D5L A;  5IT9 K;  4HV6 A;  5E3O A;  5LGU A;  3U9G A;  1U9N A;  2K4J A;  3N97 A;  5BQT A;  3TDU C;  1EV7 A;  4M3D A;  1P4X A;  1K6Y A;  2EIL H;  2CUE A;  3GZ5 A;  3ZMU A;  1JHF A;  3WTX C;  1HC8 A;  3PUB A;  2ECC A;  3J80 K;  1AKH B;  4M6Y A;  1N25 A;  4F7Z A;  4ZZD A;  2R7T A;  1MBG A;  3SEZ A;  4F3Q A;  4IHY A;  2VPR A;  4XSZ F;  3OYI A;  4N9I A;  2IA0 A;  3TW6 A;  1K6O A;  1AHD P;  3H3U A;  1T2K A;  1KQ9 A;  5DTD A;  3JR9 A;  1WFX A;  1LFB A;  2FA5 A;  3U21 A;  1JKQ C;  2HQA A;  2CW0 F;  2ZJ2 A;  3ELK A;  5JVT A;  1IN5 A;  4L18 B;  3H35 A;  2ID3 A;  5DS9 A;  3ZMT A;  2H6B A;  3H9J A;  4D5C A;  3CCV I;  5EEH A;  2O3F A;  2VKD A;  3NEU A;  1AA7 A;  4UB8 C;  2PN6 A;  1CQT A;  1T98 A;  3C2G A;  5FD5 A;  3RCO A;  2GLO A;  2LC2 A;  1MSE C;  3HIF A;  2HYF A;  4MHG A;  4DBQ A;  5HNF A;  4P1W A;  5HNH A;  3V4G A;  2I8D A;  5BPI A;  3Q0U A;  2CW7 A;  4G8X A;  2NVX J;  3PIO F;  1MZB A;  5C44 J;  2FF4 A;  3BY6 A;  4B1R A;  3HHG A;  2DA2 A;  2DA3 A;  3SYT A;  1Y39 A;  1F9N A;  1G2H A;  1GDT A;  2E1M C;  3ZQQ A;  3CDI A;  4EJT A;  3EYI A;  2MH9 A;  3DLL F;  3IAM 2;  1IV6 A;  2K9L A;  2V6E A;  1TNS A;  4QPO A;  3HRS A;  2XGD A;  2Y30 A;  1MBF A;  2ID6 A;  1Z6T A;  3A4C A;  5E79 C;  2VJI A;  2KL4 A;  1ZKG A;  2WB1 N;  4BAY A;  2IVM A;  4RGR A;  3D0S A;  4U0Y A;  4JK1 X;  4BXF A;  2A61 A;  3L00 A;  1ZAR A;  4AIH A;  3ZXS A;  1BI2 A;  2ZJR F;  1SD7 A;  1ZLK A;  5C4X J;  2ZNY A;  3H3V K;  3KYL A;  5D4S A;  2VE9 A;  2ACJ A;  3UR3 C;  1SAN A;  2LLK A;  2V1N A;  2EJR A;  3CJN A;  4PGH A;  4YEL A;  2UWM A;  1K78 A;  3GZ6 A;  2XGX A;  4HBL A;  3RZD J;  2R92 J;  4U87 A;  2ZJP F;  3GZN B;  3I4P A;  2RQP A;  2DA4 A;  3G3Z A;  3E3V A;  1BN5 A;  2L3D A;  1MNM C;  2MC4 A;  2OCE A;  4KYW A;  3L09 A;  4LIV A;  2W57 A;  2DMU A;  3GLL A;  1J2X A;  1OJL A;  4MIM A;  1FNN A;  3KIO A;  1B72 B;  3QPL A;  5IYD J;  4OOI A;  3DEW A;  3WHB A;  1LE8 B;  2VBY A;  4DJA A;  2ZB9 A;  5DEQ A;  3PFY A;  1KYZ A;  2VC1 A;  2XAG A;  3K1P A;  2LRD A;  5TIS C;  3Q5F A;  3N4M A;  3QU6 A;  5BPD A;  5IYC J;  2IP2 A;  3E5X A;  5EG0 B;  2PMZ A;  1KQ0 A;  2JA5 J;  3AG4 H;  1JTY A;  3FKI J;  3KYC B;  3TKY A;  1S72 I;  3A1Y A;  4C9Y A;  1YI2 I;  2BGC A;  3GTK J;  2NS8 A;  4WX9 A;  1O4X A;  3F6O A;  1GVD A;  3HRM A;  4ASN A;  4ZH4 F;  1F4K A;  4AIK A;  2RRE A;  3L2U A;  1A04 A;  4XBF A;  1E3O C;  1SD4 A;  1NTC A;  2P4W A;  2X1D A;  5E8G A;  4YIF A;  3I59 B;  3JW4 A;  3U1K A;  5M5Y J;  4KDP A;  3HTU A;  1X3U A;  1T33 A;  4PZJ A;  1K83 J;  1OQY A;  2GQQ A;  2X0L A;  2Y75 A;  2UXX A;  2QSH X;  2JUC A;  5B3S H;  1YRN B;  2HR3 A;  1W0U A;  3S2H J;  1STZ A;  4B3A A;  2IPQ X;  2XIG A;  1ETQ A;  4CYC B;  3COA C;  1JXS A;  3WTV C;  2F4O B;  2X51 A;  3KP2 A;  1XGM A;  4ETS A;  2H1L A;  1GUU A;  2VXD A;  3KYD B;  2FX0 A;  2K5C A;  2DTZ A;  4OMY A;  1PYV A;  2AXL A;  3HSF A;  2O9L A;  1N75 A;  4PK4 A;  2DLL A;  3E6M A;  2JMW A;  2K9N A;  4AU7 A;  4F93 B;  5F1J A;  2VQC A;  2XSD C;  2HVQ A;  2LK2 A;  1PP7 U;  2FUG 2;  5EYR A;  1X2M A;  1E0E A;  1ZRD A;  4B44 A;  1HQC A;  2NAZ A;  3KLN A;  2XHK A;  1RC9 A;  2Y9Y A;  2L4A A;  2BXY A;  2E2J J;  1BM9 A;  2VIX A;  1ZN2 A;  4N4O B;  5IT3 A;  1ZRE A;  4U0W A;  3PNY A;  5B66 C;  4R8H A;  4A5M A;  4JBA A;  4HX4 A;  5CLS A;  5D8L B;  1QBJ A;  3TDZ C;  3BR1 A;  3FWE A;  2H8R A;  4M3F A;  2K9S A;  4D5F A;  3RYP A;  1R5G A;  3JAM Z;  4Y13 A;  2FXA A;  1DPU A;  1ETK A;  4AC0 A;  5FKO A;  4G7O F;  2IGK A;  1TWG J;  2E5N A;  2R5Y B;  3RTR A;  3SEQ A;  5E3M A;  3KP7 A;  2BOL A;  1OCZ H;  3WE2 A;  3AG3 H;  2XF7 A;  1BW6 A;  2F4M B;  3DXJ F;  2ESN A;  5EGO A;  1Y1W J;  3H5N A;  1DU6 A;  4E7S A;  1Z67 A;  2D2W A;  3QP6 A;  3BTC A;  4UV9 A;  1S9H A;  2LF7 A;  3CUQ A;  3HRU A;  4CCO A;  1LDD A;  2VC0 A;  2W82 A;  4A3M J;  2ZNZ A;  1REP C;  5AIQ A;  4A3B J;  2LG4 A;  3WGI A;  3OWT A;  3JRG A;  3EUH A;  3ULQ B;  4AD9 A;  2MC3 A;  5KAI C;  4ANJ A;  2L9N A;  1FPQ A;  1X2N A;  2B7E A;  3QPT A;  4WWC A;  3OYD A;  5FRO A;  9ANT A;  4P96 A;  3KLO A;  1IF1 A;  4P55 A;  2L02 A;  1V5G A;  2JVH A;  1AKH A;  4GRI A;  2PLY A;  3L2V A;  1PP8 F;  2QEX I;  2E7X A;  2ZKZ A;  1W5T A;  2DT7 B;  3HBL A;  4A3J J;  1OCT C;  2W24 A;  3BG7 A;  1UHS A;  2Q8K A;  2FEZ A;  3HB9 A;  3OOP A;  4FX4 A;  3S14 J;  1VFC A;  2LY1 A;  4XMY A;  3KFW X;  2YX4 A;  3CC4 I;  1VQ8 I;  1HSJ A;  3IUO A;  4AID A;  2H09 A;  1X3W B;  2UUZ A;  1E17 A;  3MN2 A;  1XSD A;  3HOS A;  3O6B B;  1I50 J;  3OL3 A;  4J19 A;  1IXR C;  4O3M A;  1B8I B;  3IKV A;  3V7C A;  1SVO A;  1LJ9 A;  5ERI A;  4A69 C;  2IA2 A;  2VI6 A;  2DW4 A;  2UV1 A;  4OIO F;  1T39 A;  4A3D J;  3F6V A;  2HXI A;  1EKE A;  3BPX A;  3OYK A;  3SJM A;  3V8L A;  2CU7 A;  3E0J B;  3ABL H;  1FZP B;  5KK1 A;  4BY1 J;  3HXL A;  5DD4 A;  4A0X A;  1IXC A;  1O57 A;  3C2B A;  1SFX A;  4XOR A;  2Z9O A;  4PGG A;  1BA5 A;  1IUY A;  2DPD A;  3OY9 A;  4OIQ F;  3GO5 A;  5IP9 J;  1Z91 A;  4BS9 A;  2R3S A;  4G9Y A;  2M8G X;  3GTG J;  1IDZ A;  1LDK B;  1TWF J;  3OIP A;  2W25 A;  3LSP A;  1WVR A;  4ESB A;  1RES A;  4M6X A;  4KIT B;  3MWM A;  1V54 H;  3EET A;  4OAZ A;  5ICG A;  2H27 A;  3MFK A;  3GUD A;  2DDA A;  4DZP A;  3RKQ A;  2RGV A;  4I01 A;  3LNQ A;  2CQ7 A;  5DM6 F;  3AG1 H;  1IRX A;  1JKO C;  1ACI A;  3RQ4 A;  4MGR A;  2QF7 A;  1BC8 C;  1PVE A;  3HPG A;  2DA6 A;  2CWE A;  2ZO4 A;  4RAF A;  1FSH A;  3KZZ A;  2MW8 A;  4IEJ A;  4HAM A;  3WU0 A;  3IKT A;  2Q1Z B;  2BY2 A;  2HOS A;  1FBS A;  3MKY B;  4XKB A;  1FWZ A;  1FIA A;  2OJE D;  1A5J A;  4M9X A;  3PQK A;  1JUM A;  3VSL A;  2MFZ A;  4FTH A;  1JKP C;  2DFH A;  1XB4 A;  3CDL A;  5H6R A;  4I0A A;  1ULY A;  2K3F A;  2H8W A;  2R7O A;  4A3K J;  1ERD A;  3DTK A;  2XDV A;  1VQ9 I;  1SAX A;  4LFU A;  1QPI A;  2VON A;  3WOD F;  2HI3 A;  2AO9 A;  4ABZ A;  4M3G A;  3EUK L;  4EGZ A;  1EA3 A;  3CMM A;  4E7I A;  1B72 A;  3W6V A;  1XS9 A;  1ZAO A;  1IN6 A;  2OD5 A;  2M5W A;  5J8F A;  4E4H A;  1LE8 A;  2PMZ N;  1IV8 A;  2K4B A;  4YII A;  4KIF A;  2R7V A;  2EIM H;  4ZYE A;  3HOU J;  3CJR B;  1H8A C;  1JHH A;  3DTI A;  3ECH A;  2HWV A;  4FX0 A;  2GXG A;  5EG0 A;  4UNO A;  4D7N A;  3OS2 A;  3RZO J;  5DCM A;  2O8X A;  2ZSI B;  1KQ8 A;  4ZC3 A;  3S17 J;  5B5E C;  2EFP A;  3K2Z A;  2ZFU A;  3QPH A;  1DUX C;  3G1O A;  1SVL A;  3JRH A;  3G6E I;  3ZN0 A;  5JI6 A;  1LVK A;  1TQM A;  2EA4 A;  1JUS A;  2HDD A;  5KNL A;  3ZQG A;  1BIA A;  5EF6 A;  3VOE A;  1BW5 A;  2IGN A;  1QVT A;  4LK1 F;  5D5W B;  1OR7 A;  3K9T A;  5F64 A;  3I59 A;  4A0Y A;  5GP9 A;  2XAJ A;  3IHU A;  2WBM A;  3HPH A;  2ZSH B;  5LEJ A;  5CQE A;  4ZTF A;  2KIF A;  1FOW A;  3ML6 A;  3FXO A;  1YRN A;  1ZYR F;  2FMY A;  3D5R C;  1H9T A;  3BJA A;  3WHC A;  4BE0 A;  1APL C;  4CYC A;  3R6S A;  2ZBK A;  1VF9 A;  2M30 A;  2VAS A;  3BR5 A;  3A01 A;  2GZW A;  5E8I A;  1NG6 A;  3I56 I;  1U2W A;  2QSF X;  4Z6Y A;  1SFO J;  2J5P A;  4XLC A;  1QNT A;  1R5I D;  4II2 A;  4MQV A;  2LTP A;  1HKT A;  4DYR A;  3T1B A;  3J7A O;  2NNY A;  2JJ7 A;  1QGP A;  1Z77 A;  4YFN F;  3H3Z A;  4EJW A;  4MQ9 F;  4WK8 F;  2JN6 A;  4A3G J;  1W5C C;  3RDI A;  2D45 A;  3MAJ A;  1HW5 A;  2DMT A;  4IRH A;  2FQ3 A;  3FXU A;  3LSK A;  3LSI A;  2EPF A;  4LG3 A;  2QKL B;  4IL6 C;  2DPU A;  1XCV A;  1MGT A;  2DOD A;  1TQP A;  3LSM A;  3HTS B;  4GGG A;  4KT6 A;  2R5Y A;  3I71 A;  2YSR A;  3LSG A;  4BJ6 C;  3K10 A;  2GOM A;  3NWT A;  2PX9 A;  4L9V A;  4PJJ A;  3BR2 A;  2EK5 A;  3TMO A;  2X48 A;  1X1A A;  2BW3 B;  1YX3 A;  1OLT A;  4UY8 I;  4DQ2 A;  5A2Q Z;  2EIJ H;  4NC7 A;  1MBH A;  2IAI A;  4KMU X;  3CMA I;  3HOW J;  3OYC A;  3M07 A;  3BG5 A;  3KZI C;  4BXU A;  5JVG F;  3C2H A;  3HUG B;  2RQQ A;  2Z33 A;  1V5E A;  2K27 A;  1JJ6 C;  3UKG A;  3IRR A;  1E3H A;  3DBR B;  1IN4 A;  2H1K A;  2L5Q A;  3L1P A;  2ESH A;  4IQ4 A;  4XNF A;  2XRO A;  2F5C A;  5F0H A;  1TL8 A;  2HNH A;  5CPR B;  2VOO A;  2LDU A;  1NK3 P;  2GOX B;  2FQ4 A;  3TQN A;  1X4P A;  4JQF A;  1W4M A;  5J1Y A;  3G71 I;  3ISP A;  4XIC A;  2G7H A;  2WC2 A;  2M0M A;  1BL0 A;  2OUM A;  3J7Y J;  2Z5U A;  2ELH A;  4FCY A;  1B8I A;  1SFU A;  5K7F A;  4UVA A;  1I1S A;  1LPQ A;  4S04 A;  3S2W A;  4MEY F;  2L7Z A;  5D6E A;  4UUS B;  3MVP A;  4X6A J;  5K7H A;  1P92 A;  3K70 D;  4Q5S F;  2Z1D A;  1HKS A;  3HGG A;  4EM2 A;  4LIU A;  5J1R A;  1EJ9 A;  4M3B A;  4LLN A;  3GEZ A;  4RAZ A;  1R58 A;  1TLH B;  5LHG A;  2TRT A;  1MSF C;  2A69 F;  1DP7 P;  2OAZ A;  4J00 A;  2DO7 A;  2ZXI A;  3BJO A;  3CO6 C;  4XLE A;  1ETO A;  1UB9 A;  1WI9 A;  3ZN1 A;  4B47 A;  4RB3 C;  3ASN H;  1UHW A;  3S3M A;  1BJZ A;  3PFI A;  4LK0 F;  3OYJ A;  1D8K A;  2LY9 A;  3FMQ A;  4HNU A;  1ZTR A;  3ZP5 A;  2GBY A;  4R79 A;  4UV8 A;  3HC7 A;  4XLF A;  3R61 A;  4U7B A;  2HGC A;  1DU0 A;  3F3X A;  2F6C A;  1KU3 A;  1AU7 A;  2ECB A;  2OTJ I;  5J40 A;  3MQ0 A;  2CV2 A;  3PO2 J;  2IA1 A;  2EZI A;  5D8K B;  2JRT A;  1XN7 A;  1KU2 A;  2GA2 A;  1S7A A;  5ICF A;  3K4C A;  1BOA A;  4XID A;  3ZQL A;  1KON A;  2M2E A;  3F8N A;  2JPB A;  3DBH B;  3FXM A;  3PSI A;  1LEB A;  2CQX A;  4V19 K;  1BI3 A;  5HOD A;  5F08 A;  1YJ9 I;  3QYB A;  4HDV A;  1LB2 A;  1T0F A;  3ZMV A;  4IVN A;  5ED4 A;  2NVQ J;  5EEA A;  4F55 A;  3RJP A;  2ICW G;  1DDN A;  4DW6 A;  4I98 B;  3EPZ A;  2VJ4 A;  3SDG A;  4EM1 A;  3H5A A;  2JSC A;  3RKX A;  4CA0 A;  2R5Z B;  3D5S C;  1V55 H;  1BR2 A;  3KZY A;  3ONQ A;  1H0M A;  1W7P B;  3DTE A;  3S2D J;  1Z21 A;  3NAR A;  1XMK A;  3RYR A;  1BR1 A;  2ZME C;  2DFI A;  2FBI A;  4DZJ A;  4AM3 A;  4OIN F;  1QPM A;  2V9V A;  3REO A;  4HA8 A;  3LST A;  1XGO A;  4OAY A;  1YJW I;  3S1M J;  5EDN A;  2P5L C;  1U8R A;  3L7W A;  1ITY A;  2LVS A;  3GFL A;  3NWS A;  5CJ9 A;  4HPQ A;  2ZXW H;  3J7Z I;  3BTL A;  2OQR A;  4OIP F;  2EIN H;  2EFO A;  2OZU A;  4A0Z A;  3F8F A;  5ILV A;  1JE8 A;  3OSG A;  2QZ8 A;  3V7R A;  1AWC A;  2FRH A;  2PJP A;  1IJW C;  2LKS A;  1QZZ A;  2XF5 A;  3CD6 I;  3OYM A;  4I76 A;  4II3 A;  1L0O C;  2DI3 A;  1DGW Y;  3FIS A;  1UMQ A;  2E36 A;  1WJE A;  3BT9 A;  4EMS A;  3LOC A;  1I1G A;  2P0W A;  2XC7 A;  2GXB A;  2FML A;  4PFO A;  3G73 A;  2Y69 H;  2EQR A;  2F5F A;  2FSW A;  4LD5 A;  3GFM A;  3MZH A;  5H6Q A;  4RBO A;  2VBX A;  3TW7 A;  2F5D A;  5TGT A;  4ZYA A;  1KU7 A;  3HDD A;  5DYM A;  1UEL B;  4UB6 C;  3VEP A;  4YG2 F;  5DCF A;  1YYV A;  1LKX A;  5AIP A;  1A36 A;  1LQ1 A;  1HKQ A;  2DA1 A;  4PUS A;  5LGN A;  1Z7L A;  4QTR A;  4CCJ A;  1FEX A;  2CJJ A;  2EV6 A;  2DDB A;  1Z3X A;  4BBS J;  4E7Z A;  2DQR A;  3KEQ A;  2QKM B;  4RM3 A;  1FJL A;  4XK4 A;  3FK7 A;  3CO7 C;  3O8H A;  3Q0V A;  1FC3 A;  1SFK A;  5HLT A;  4PJ0 C;  2VT3 A;  1BBY A;  1TW2 A;  2F5V A;  2EFN A;  4GXO A;  3AL0 C;  2XPU A;  3ABK H;  4LB5 A;  4BQA A;  3JSO A;  1N77 A;  5KHD A;  3K1M A;  4I02 A;  2JK3 A;  2HPI A;  2WAE A;  4IOA F;  3TO9 A;  2VB6 A;  1RUO A;  3SZP A;  4HQE A;  2P7V B;  1T08 B;  2LR8 A;  1FX7 A;  2KP6 A;  3IH3 A;  3DLA A;  3P9K A;  1YQA A;  3GW2 A;  3M8E A;  5FJ8 J;  1RKW A;  3ZPL A;  1OKR A;  1XG1 A;  4A2U A;  2GXA A;  4QPQ A;  2IT0 A;  4M9S A;  2DT5 A;  3LL7 A;  3QOD A;  1Q1H A;  4FT8 A;  4HX7 A;  4FET A;  1R1U A;  3Q3S A;  2BW3 A;  3RSN A;  2VKV A;  5IPA A;  1WI3 A;  2MGQ A;  1TQI A;  5HLH A;  2P7C B;  1YO5 C;  3JRD A;  3CME I;  3E5Q A;  3OOU A;  3HOY J;  2HOA A;  2JT1 A;  3HOX J;  2X6Y A;  1X58 A;  1RKT A;  2YR2 A;  4CCM A;  5LGT A;  3PNV A;  2DK8 A;  1WWX A;  1LVA A;  3TL4 X;  1XGS A;  2LSO A;  4HDU A;  4LG0 B;  2K02 A;  1ZEL A;  1J59 A;  1FMW A;  1D8J A;  3H92 A;  1WZ2 A;  2V4J C;  4XLH A;  2CFO A;  3C3W A;  4GCV A;  2L2O A;  3RKY A;  1WH5 A;  2JUG A;  4U0V A;  1FP2 A;  3HOT A;  4UXN A;  2IJL A;  2HDC A;  2OTL I;  4IPA A;  3EQL F;  4NBQ A;  5HDN A;  2L7M P;  1ENH A;  4Z2Y A;  2KZV A;  2FD5 A;  1MBK A;  3BP8 A;  5FD6 A;  1O3T A;  5DM7 F;  1E3P A;  1XCB A;  2BEO A;  4RGX A;  1WJC A;  5IP6 A;  5KVR A;  3NRV A;  4HLY A;  4BEH A;  2KIQ A;  2WV0 A;  3K69 A;  3CCY A;  2O6G E;  3ERE D;  2VPL A;  2CQK A;  4UUS A;  2B9S A;  3LWF A;  2Y31 A;  1Y56 A;  4BE2 A;  3LSR A;  1RR8 C;  2VN2 A;  3SHF A;  3BC8 A;  3U1D A;  3O8G A;  4HG2 A;  1S6L A;  5H2F C;  3PSF A;  4B43 A;  1HF0 A;  1O3Q A;  1U5T B;  4EAT A;  2LOO A;  4XKW A;  3CC7 I;  4XLN F;  4ZYH A;  4MLO A;  4EJO A;  1HCR A;  2DA7 A;  1WKM A;  3FXK A;  4BNC A;  3ESW B;  2R7D A;  1LDJ A;  2BHZ A;  2KPM A;  2KFD A;  1QQI A;  3SFZ A;  3AG2 H;  4IRI A;  3VFZ A;  3SFI A;  3ABU A;  4NC8 A;  2M1B A;  3L2R A;  4BGD A;  4K2E A;  3DPU A;  1SD6 A;  2DFE A;  4OWR B;  4W97 A;  5HS8 A;  3NQO A;  4HF1 A;  4GYG A;  1LEA A;  1KA8 A;  2I10 A;  3GBG A;  4KUM A;  3HG9 A;  2X9D A;  5L3G A;  2GM4 A;  2X85 A;  2FBK A;  2KLO A;  5EZG A;  3ZQH A;  2HVS A;  4M72 A;  2ELK A;  1WJA A;  2NOJ B;  1XPX A;  4GYI A;  1FP1 D;  1VQL I;  4XR6 A;  3JRE A;  1QO0 D;  3ZGK A;  3DP7 A;  2KJC A;  3W6K B;  5HVQ C;  3QU3 A;  4D7M A;  3HEF A;  1J0R A;  3BZK A;  2R5Z A;  2HTJ A;  3TED A;  2QQ9 A;  4I2O A;  1IN7 A;  5IYB J;  1W7P A;  3VWB A;  3K4B A;  3JAM K;  2E5Z A;  4IHT A;  1W36 C;  4H4K C;  3K4L A;  1NH3 A;  3HSE A;  2BHY A;  1YLF A;  2WAD A;  3SDB A;  2R0Q C;  4A12 A;  2ZCW A;  3LAP A;  1UAA A;  3OR1 C;  2CGP A;  1UJ8 A;  4AWX B;  1H88 C;  2WA0 A;  1D1C A;  1Y8R B;  4IF4 A;  4H0E A;  2MH2 A;  4CDG A;  4KN4 X;  2L0K A;  4BDY A;  2VOP A;  2R7R A;  2JA6 J;  4XRS G;  2DK5 A;  3M3Y J;  1G3T A;  2XRN A;  2NVY J;  5EJC A;  3WG9 A;  1VQO I;  2XAS A;  3ABT A;  2DJI A;  2G9W A;  2IS1 A;  2HKX A;  1BI0 A;  1XMA A;  3BCA A;  3HGY A;  2L9V A;  1W7P D;  5ICE A;  1T38 A;  2A68 F;  2AQF A;  5D5X B;  2F4I A;  4A3C J;  4RM2 A;  3WTW C;  2LRE A;  3FK6 A;  3L2C A;  1O7L A;  4XKC A;  2E1M B;  3SQN A;  4N0B A;  4I6Z A;  3K6G A;  1OCR H;  4BJ5 C;  4ON0 A;  3ZQI A;  4CCL A;  2ME6 A;  1HOM A;  2FOK A;  1V5F A;  3OL4 A;  4L0Y B;  1JT0 A;  5JFR A;  5GPC A;  3S32 A;  1MH3 A;  2E1O A;  5E1Z B;  3ECO A;  2FU4 A;  2HVR A;  1YG2 A;  2AXT C;  4BQN A;  2M0C A;  3TOB A;  1U0J A;  2A6T A;  3OYE A;  3H9Q A;  3G2B A;  1JJ8 C;  3DU5 A;  1UHM A;  2G0E A;  2HZT A;  5GPA A;  2JZY A;  5FO5 A;  2G7U A;  3LSJ A;  4KN7 X;  3H5R A;  1TT0 A;  2E35 A;  2CV1 A;  2OV7 A;  3M9A A;  5J4Y A;  5BNG A;  1EF4 A;  2FE3 A;  4C2U A;  1TP4 A;  2PMH A;  1FT9 A;  2I5U A;  1LNW A;  1IC8 A;  2VT2 A;  3A2K A;  4IJA A;  1MDM B;  5CQG A;  3HOZ J;  2VJJ A;  3WTY C;  4GFB A;  1MJ9 A;  4Q47 A;  4BHB A;  4BH9 A;  1GVJ A;  3A0B C;  3GVA A;  1TZL A;  2L54 A;  4M71 A;  1LFU P;  2CRG A;  5FRM A;  3A03 A;  3DV8 A;  3TO6 A;  1ZGA A;  3VB2 A;  4L5J A;  4MTE A;  3K4N A;  2HFH A;  1MBJ A;  1WJB A;  3AFH A;  2HU9 A;  2IW5 A;  4AVZ A;  1UFM A;  4XLP F;  2OQG A;  3F8B A;  1R49 A;  3OR2 C;  3ZMD A;  1B4A A;  2E71 A;  4BBR J;  1IO2 A;  1JGS A;  2DAO A;  4HF0 A;  4F91 B;  3SZT A;  5M5X J;  1EH8 A;  3E5U A;  3G1L A;  4ZTJ A;  4Y4R A;  2WV1 A;  4L9T A;  1ZQ3 P;  4G94 A;  5FLV A;  1VQ5 I;  2OPT A;  3FXJ A;  5E3N A;  1T56 A;  3E6C C;  3FBI B;  4C3J J;  1S8N A;  4P9F A;  5D6F A;  2DXI A;  2PJR B;  2EV5 A;  3PM1 A;  3IV5 A;  2DOE A;  2NXN B;  2IEK A;  2CUZ A;  3CP2 A;  2PBI A;  2LF8 A;  3CDH A;  3HYI A;  4G6T B;  3T0Y A;  1VQK I;  5J8C A;  3BPV A;  3CTA A;  5FFZ A;  2EFW A;  2X4H A;  3PIP F;  1XX5 A;  3C1D A;  4KMF A;  3B02 A;  4ZDL A;  4DBR A;  1MNE A;  4LG0 A;  3WGG A;  1VQP I;  2R7U A;  4EQQ A;  1E2X A;  2XGC A;  2FJ1 A;  3F72 A;  3LFU A;  1NHA A;  1CGP A;  2DN0 A;  4YRV A;  4ZYD A;  2ZFW A;  2V1U A;  1R36 A;  2KZG A;  1S29 A;  1P7I A;  2LBF B;  5ILS A;  2JRM A;  2VJ5 A;  4Q4Z F;  2CYY A;  3CUQ C;  1F5T A;  1ZRF A;  1WCM J;  5B1B H;  2JSP A;  2Q2E B;  2E1N A;  4WF2 A;  2R7F A;  1T8I A;  5J3L A;  1IW7 F;  2LY2 A;  3B73 A;  4L9J A;  2L7F P;  1R7J A;  3MKW B;  4IRG A;  2O7O A;  1GV5 A;  1HW2 A;  3EUH C;  4P9U A;  1TWA J;  2OCC H;  2Z3Y A;  4IX7 A;  1Y1V J;  3HOV J;  4A5N A;  1ZG3 A;  1SVM A;  5GTI C;  5HS9 A;  1ZLJ A;  5IOZ A;  3DEE A;  1UG0 A;  2OBP A;  3BG9 A;  1C0W A;  1OCP A;  3HRT A;  4JX4 A;  4LGW A;  2VLA A;  1WSU A;  3FMS A;  3GF2 A;  4XRS A;  5LEK A;  3QOP A;  4CSW A;  3BQY A;  2HQ5 A;  2ZJQ F;  4AVP A;  1U5T A;  4B8X A;  4KJZ A;  3FHZ A;  3D1N I;  2Z16 A;  3GFJ A;  2EB7 A;  2W1O A;  4XOP A;  5FFX A;  2PI0 A;  5JR3 A;  3K2A A;  5JHF A;  3K4K A;  1FY7 A;  4RS8 A;  3QWL A;  3VSK A;  1HBX G;  1MMA A;  2Y48 A;  3DEU A;  3M4O J;  2MAB A;  4PFP A;  3CLQ A;  4FAS D;  2STW A;  2DOF A;  4ESF A;  3PJR A;  4UVB A;  1OYI A;  2AS5 F;  4N4N B;  2E2H J;  5GTH C;  5BOX A;  4MEX F;  5ICC A;  5LD2 C;  2IRF G;  1XSV A;  2LKP A;  3H36 A;  1VZ0 A;  1D0Z A;  3GCM A;  3QAH A;  2IGO A;  2EV0 A;  3BTI A;  4Y3O A;  2LNB A;  1I27 A;  4M73 A;  3WTT C;  2GIV A;  3BLY A;  1UST A;  3CCQ I;  4CXF A;  4KIS A;  2P5V A;  2DYS H;  2KT0 A;  2V6C A;  1WQ2 A;  2H94 A;  2NOG A;  3T5X A;  4OMZ A;  2Y9Z A;  1SC7 A;  1RR7 A;  1Z6R A;  1RUN A;  1L3L A;  5HLI A;  5CVV A;  2XAH A;  3CUO A;  3H9G A;  4KIG A;  5CVR A;  3I64 A;  5L3C A;  5TJJ A;  1POG A;  2QCO A;  2WB1 A;  1RPW A;  4F52 A;  3WU1 B;  2KDO A;  1X3Z B;  4YIR X;  1GHC A;  3A0H C;  2QGU A;  2DYR H;  3OMY A;  4D9J A;  4PDK A;  3PO3 J;  4EV0 A;  4CYD A;  1V3F A;  2CH0 A;  2IXS A;  5ILU A;  3GTJ J;  5E20 A;  2R93 J;  1VND A;  3PUF A;  1ZGJ A;  3IAS 2;  3ZCO A;  2VL8 A;  1ODD A;  2WAQ A;  3CJT B;  2DBB A;  2CG4 A;  5DDG A;  3OYL A;  4FHT A;  2XVC A;  2YU3 A;  1OFC X;  3MEX A;  3FHN A;  1OCC H;  2YPR A;  2QA4 I;  2E1C A;  1KGS A;  1Y8Q B;  4HZF A;  2D5V A;  2L7K A;  2XV4 S;  4N9H A;  2KRF A;  2GAU A;  4IOC F;  1IGN A;  1BIB A;  3M1C A;  5A2Q K;  5LLQ A;  2D1V A;  4RB0 A;  2A05 A;  3E1S A;  5GAD J;  1X1C A;  3I4N J;  3AAF A;  1D1A A;  4CCN A;  3X2Q H;  1F43 A;  4HX8 A;  4CO8 A;  3DKW A;  3E6D A;  4Y17 A;  3V8K A;  2DJN A;  5IP7 J;  2M45 A;  1DGR M;  2KRH A;  3PNT A;  4XN3 A;  3WG7 H;  4IHW A;  2NVT J;  1QZE A;  1JI8 A;  1G59 A;  1MD0 A;  1MJA A;  3EYY A;  3I4M J;  1W0T A;  2X1E A;  5GAH J;  3KEY A;  1IG7 A;  1YOV B;  3LA7 A;  2CV0 A;  1SAU A;  2TCT A;  5FLX Z;  2JA7 J;  1USS A;  1ZG5 A;  1DPR A;  2NRA C;  1TWH J;  5F0C A;  3RQI A;  5K5Q A;  1YIO A;  1P9Q C;  3V8J A;  3FF5 A;  2BVM A;  1H89 C;  1S3J A;  3JRB A;  1VQ4 I;  4HV5 A;  1MMD A;  1PJR A;  3BR6 A;  3OS0 A;  2H6C A;  2MYS A;  3N05 A;  3P9I A;  2FNA A;  4M9Z A;  5J4V A;  2O0Y A;  3F22 A;  1QHH D;  2OU2 A;  4B48 A;  3HJE A;  1D1B A;  4E6K G;  4A3L J;  2XAQ A;  4QWQ A;  1OR7 C;  1NG7 A;  1MDM A;  3IL2 A;  1P2F A;  1FYK A;  3TGN A;  1B9M A;  3WU2 C;  3F0C A;  2DCE A;  3J81 Z;  1QHG A;  2AQE A;  1HDD C;  2EBI A;  2LYC A;  3FKJ A;  3CCS I;  3JRC A;  5KAF C;  3JCU C;  5GAE J;  1K79 A;  5D5V B;  1FBQ A;  4YFK F;  1YS7 A;  4DYC A;  1VTN C;  4PCQ A;  4S05 A;  4BDZ A;  4AUX A;  1TC3 C;  3FM5 A;  1HDP A;  1Q1V A;  4G6D A;  3JSP A;  2NNN A;  3GTQ J;  4HST A;  1WHU A;  4RGS A;  2ELJ A;  1M1E B;  1OMI A;  2NYX A;  3KEO A;  1MJB A;  5IT9 Z;  3OSF A;  1MBE A;  4X1E A;  1SMT A;  3JRA A;  3RI4 A;  3R4K A;  2JA8 J;  2IS2 A;  5FLM J;  4EGY A;  2C6Y A;  3W2A A;  3LA3 A;  4FIS A;  4B4C A;  2L9R A;  2NS0 A;  3C7J A;  3VDX A;  2PJR A;  4ZDP A;  3GME A;  2Y0M A;  5CKT A;  3CCE I;  3M8J A;  3BOQ A;  3J80 Z;  5D5U B;  4LLL A;  3FXR A;  2MD5 A;  5LHH A;  1FYM A;  3B6A A;  1MND A;  3DKY A;  1YTY A;  1X1D A;  4MNU A;  4EJU A;  3BZ6 A;  1A6I A;  3CUQ B;  4L5E A;  1R23 A;  5D4R A;  2JVG A;  1D0Y A;  2WWY A;  1IRZ A;  4IXA A;  3Q9V A;  3IC7 A;  3OS1 A;  1PUF B;  4KIB A; 
#chains in the Genus database with same CATH homology
 4ZYG A;  4M74 A;  4I0B A;  2W85 A;  5DD8 A;  2HTS A;  1OPC A;  1R00 A;  4DNC A;  1BJA A;  1AOY A;  2L01 A;  1ZRC A;  2Q2E A;  3F21 A;  3FM3 A;  1IRF A;  3RKW A;  5LRR A;  3I0T A;  2M87 A;  3KET A;  4O6J A;  2TDX A;  4HYE A;  4A6D A;  2MLK A;  2MA3 A;  2BE5 F;  4LMY A;  2OZ6 A;  2BV6 A;  3CLO A;  3M1E A;  2ISZ A;  5EEG A;  1ON1 A;  2VXZ A;  3LAJ A;  1R1V A;  2JTV A;  2L4M A;  4XSX F;  2XAF A;  4UUV A;  3GX4 X;  2DTR A;  1KYW A;  3RIR A;  3K0L A;  1D3Y A;  3I5U A;  3ZMS A;  1F1Z A;  4XRF A;  3I53 A;  3GWZ A;  4HW0 A;  1CF7 B;  1FLI A;  2GA1 A;  3R0A A;  3ZMZ A;  2XKP A;  2CFX A;  1T6S A;  4L9N A;  4LLG F;  3T8R A;  4G7Z F;  2UXN A;  2KIU A;  5TRD A;  1FYL A;  2HKO A;  1TW3 A;  3PQJ A;  3WE3 A;  2W84 A;  5K1Y A;  3I58 A;  3FZV A;  1U3E M;  2V1X A;  3HUG A;  2ZXJ A;  3E97 A;  4BHC A;  2FNP A;  2YX7 A;  1O7F A;  2O61 A;  1RNL A;  1R22 A;  1XGN A;  2KJB A;  2V79 A;  3GYH X;  3LFK A;  1OYW A;  3LQQ A;  4ESJ A;  3KP6 A;  5DCM B;  1OYY A;  2XKO A;  3R60 A;  3SXY A;  3ROU A;  2QUF A;  5HLG A;  4RGU A;  5DV5 A;  1G4D A;  1G6N A;  3GXO A;  3E6B A;  4KFC A;  2COM A;  3LQR A;  1P6R A;  3WTU C;  4BYY A;  2A6H F;  3IWF A;  2CO5 A;  4G7H F;  4GO1 A;  4TV7 A;  3KCC A;  1P4A A;  3F23 A;  1XSX A;  2VBW A;  1Z7U A;  3F8M A;  3HSR A;  2ZME B;  1SD5 A;  2PMU A;  3RPQ A;  2Z99 A;  4QLC U;  2HQR A;  3DPL C;  5FB2 A;  3OV8 A;  3FX3 A;  1BC7 C;  3WGH A;  2HEO A;  2QQB A;  2PG4 A;  3O2P E;  4EM0 B;  1IAW A;  5CVI A;  4CHU A;  1PUE E;  4G6Q A;  3GFI A;  4ZZL A;  2K7L A;  4D0P A;  2HYG D;  2VE8 A;  2F5E A;  2QVO A;  3P7N A;  4HLX A;  4NHJ A;  1XDU A;  4E70 A;  1H9G A;  5CYV A;  5HDG A;  1I5Z A;  2QYO A;  5F6F A;  1GXQ A;  1XDS A;  2GWR A;  2Q0O A;  1YFH A;  4WXC A;  1ZHF A;  1EH7 A;  5HDK A;  5H20 A;  3TO7 A;  1R1T A;  4UHT A;  1J75 A;  4BHP A;  4ENN A;  1G3W A;  3L9F A;  4MTD A;  1ZG1 A;  2MBF A;  3IRQ A;  1P4W A;  5FGM A;  1HW1 A;  4ENJ A;  2RKH A;  1ZH5 A;  1V4R A;  4EJV A;  2A07 F;  5BS6 A;  4Y15 A;  1FBU A;  1W5S A;  3DPT A;  4LB6 B;  4I7H A;  2DQL A;  5L3B A;  1K7A A;  4RAY A;  1D5V A;  1QZY A;  1TTY A;  1RI7 A;  4KIC A;  2F2E A;  2QBY B;  3WTZ A;  4CGZ A;  3F8C A;  2P5K A;  3MCZ A;  5LHI A;  3BJ6 A;  4YFX F;  2OA4 A;  1YW7 A;  1CF7 A;  2KIM A;  5L3E A;  4R1H A;  5E18 F;  3QRF F;  1IRG A;  3FMR A;  3MZY A;  3Q9S A;  2RDP A;  1B1B A;  2K86 A;  3KP4 A;  6PAX A;  2A3S A;  5AON A;  1B9N A;  4NQW A;  1WRJ A;  3TOA A;  5E17 F;  1TBX A;  3O3K A;  4Q48 A;  2VBZ A;  3EDP A;  4B09 A;  4IHS A;  4A6E A;  1GXP A;  2DU9 A;  4LJZ F;  2EFQ A;  2WTE A;  4L0Z B;  4HOB A;  4RB1 A;  3RPU A;  4KA4 A;  4OU0 A;  5CVJ A;  1S7O A;  3ZQ7 A;  5BMZ A;  1XD7 A;  1YW9 A;  3DFG A;  3FXQ A;  2B0L A;  1HST A;  3M7G A;  1RIO H;  1KU9 A;  2E7W A;  1B6A A;  1YW8 A;  3IWZ A;  2QM3 A;  3U2R A;  1BI1 A;  5CVU A;  2VOD A;  4EVI A;  3P9C A;  1HXD A;  4KT5 C;  3JTH A;  1Z9C A;  1UCR A;  1J5Y A;  2P6T A;  3DF8 A;  3T8T A;  2HOE A;  1SMY F;  5HS7 A;  2ZME A;  1O3S A;  3JTG A;  1U78 A;  4ENM A;  5JHU A;  2A6E F;  5K5O A;  1U6G A;  3GLX A;  2KKO A;  1O3R A;  4WXH A;  2RV8 A;  2UZK A;  1K78 B;  3BDD A;  3KP3 A;  2HQN A;  2QQA A;  2STT A;  2MLG A;  1J7K A;  4HQM A;  2JPC A;  1SFE A;  1Z1D A;  3LA2 A;  2D1H A;  5HOO A;  2P6S A;  4P5O A;  1Z05 A;  5E1X A;  2EA2 A;  4HF2 A;  5F1R A;  4I09 A;  4L5I A;  2RN7 A;  3DQV C;  5DUI A;  3K1N A;  3I54 A;  4U7D A;  3BRO A;  1J9I A;  3M8F A;  3QP5 A;  2FBH A;  4RB2 C;  2A5Y B;  1YS6 A;  2J5O A;  2M8E A;  3VOD A;  4OIR F;  3KE2 A;  2BYV E;  4O5V A;  1IXS B;  2RVC A;  2CSO A;  2ISY A;  3R0J A;  1RZ4 A;  2XUB A;  2O03 A;  5J6X A;  4CZZ A;  5E1W A;  2QWW A;  2PQ8 A;  3W6J B;  3WTS C;  3C18 A;  2QLZ A;  1FSE A;  3KP5 A;  2RNJ A;  1G3S A;  4UVC A;  2ETH A;  4KNY A;  2RC4 A;  1ONV A;  5FLX K;  2PEX A;  3HHH A;  2QBY A;  4NB5 A;  2V1D A;  1Y0U A;  5K5R A;  1MKM A;  4AIJ A;  2HS5 A;  1ON2 A;  2BBY A;  1B59 A;  1R5H A;  1U5T C;  5L3D A;  2PFB A;  5LBQ A;  3J81 K;  3V7S A;  1G3Y A;  5LRS A;  4WXD A;  1PDN C;  5DUK A;  4CIC A;  5L3F A;  1I6X A;  1IN8 A;  2QEN A;  4ENK A;  4U88 A;  1EH6 A;  1FOK A;  4WCG A;  2ADU A;  1TNT A;  3BWG A;  2P8T A;  1IZ1 A;  2EWN A;  3D5L A;  5IT9 K;  4HV6 A;  5LGU A;  3U9G A;  2K4J A;  3N97 A;  5BQT A;  3TDU C;  1EV7 A;  1P4X A;  3GZ5 A;  3ZMU A;  1JHF A;  3WTX C;  3J80 K;  4M6Y A;  4F7Z A;  4ZZD A;  4XSZ F;  4N9I A;  2IA0 A;  1K6O A;  3H3U A;  1T2K A;  1KQ9 A;  2FA5 A;  3ELK A;  2CW0 F;  2ZJ2 A;  5JVT A;  1IN5 A;  4L18 B;  3ZMT A;  2H6B A;  5EEH A;  2O3F A;  3NEU A;  2PN6 A;  1T98 A;  5FD5 A;  3HIF A;  2HYF A;  4MHG A;  3V4G A;  5BPI A;  4G8X A;  1MZB A;  2FF4 A;  3BY6 A;  3HHG A;  1F9N A;  4EJT A;  3EYI A;  2MH9 A;  1TNS A;  3HRS A;  1Z6T A;  4BAY A;  2IVM A;  4RGR A;  3D0S A;  4U0Y A;  4JK1 X;  2A61 A;  3L00 A;  1ZAR A;  4AIH A;  1BI2 A;  1SD7 A;  1ZLK A;  2ZNY A;  5D4S A;  2VE9 A;  2ACJ A;  2EJR A;  3CJN A;  4PGH A;  2UWM A;  1K78 A;  3GZ6 A;  2XGX A;  4HBL A;  3I4P A;  2RQP A;  3G3Z A;  3E3V A;  1BN5 A;  2L3D A;  4KYW A;  3L09 A;  2W57 A;  1J2X A;  1FNN A;  4OOI A;  2VBY A;  5DEQ A;  1KYZ A;  2VC1 A;  2XAG A;  3K1P A;  3Q5F A;  3N4M A;  3QU6 A;  5BPD A;  2IP2 A;  3E5X A;  1KQ0 A;  3TKY A;  2BGC A;  4WX9 A;  3F6O A;  3HRM A;  4ASN A;  4ZH4 F;  1F4K A;  4AIK A;  1A04 A;  4XBF A;  1SD4 A;  2P4W A;  5E8G A;  4YIF A;  3I59 B;  3JW4 A;  4KDP A;  3HTU A;  1X3U A;  4PZJ A;  2GQQ A;  2X0L A;  2Y75 A;  2UXX A;  2HR3 A;  1STZ A;  2IPQ X;  2XIG A;  3COA C;  1JXS A;  3WTV C;  3KP2 A;  1XGM A;  4ETS A;  4OMY A;  2AXL A;  3HSF A;  2DLL A;  3E6M A;  1PP7 U;  1ZRD A;  1HQC A;  2NAZ A;  3KLN A;  2XHK A;  2L4A A;  1BM9 A;  1ZN2 A;  5IT3 A;  1ZRE A;  4U0W A;  4R8H A;  4A5M A;  4JBA A;  4HX4 A;  5CLS A;  5D8L B;  1QBJ A;  3TDZ C;  3FWE A;  3RYP A;  1R5G A;  3JAM Z;  4Y13 A;  2FXA A;  1DPU A;  4G7O F;  3RTR A;  3KP7 A;  3WE2 A;  3DXJ F;  2ESN A;  2D2W A;  3QP6 A;  4UV9 A;  2LF7 A;  3CUQ A;  3HRU A;  1LDD A;  2VC0 A;  2ZNZ A;  1REP C;  5AIQ A;  3WGI A;  3EUH A;  3ULQ B;  4AD9 A;  2MC3 A;  1FPQ A;  3QPT A;  4WWC A;  4P96 A;  3KLO A;  1IF1 A;  4P55 A;  2L02 A;  2PLY A;  1PP8 F;  2E7X A;  2ZKZ A;  1W5T A;  2W24 A;  2Q8K A;  2FEZ A;  3OOP A;  4FX4 A;  3KFW X;  2YX4 A;  1HSJ A;  2H09 A;  1E17 A;  1XSD A;  3HOS A;  3O6B B;  1IXR C;  4O3M A;  3IKV A;  3V7C A;  1LJ9 A;  5ERI A;  2IA2 A;  2DW4 A;  4OIO F;  1T39 A;  3F6V A;  3BPX A;  3V8L A;  1FZP B;  5KK1 A;  5DD4 A;  4A0X A;  1IXC A;  1O57 A;  1SFX A;  2Z9O A;  4PGG A;  1IUY A;  2DPD A;  4OIQ F;  3GO5 A;  1Z91 A;  2R3S A;  4G9Y A;  1LDK B;  2W25 A;  4ESB A;  4M6X A;  3MWM A;  3EET A;  5ICG A;  2H27 A;  3MFK A;  3GUD A;  2RGV A;  4I01 A;  4MGR A;  1BC8 C;  2CWE A;  2ZO4 A;  1FSH A;  3KZZ A;  3WU0 A;  4HAM A;  3IKT A;  1FBS A;  1FWZ A;  4M9X A;  3PQK A;  1XB4 A;  5H6R A;  4I0A A;  1ULY A;  1SAX A;  4LFU A;  2VON A;  3WOD F;  4EGZ A;  1ZAO A;  1IN6 A;  2OD5 A;  2M5W A;  5J8F A;  2K4B A;  4YII A;  4KIF A;  4ZYE A;  1JHH A;  3ECH A;  2HWV A;  4FX0 A;  2GXG A;  4UNO A;  5DCM A;  2O8X A;  1KQ8 A;  2EFP A;  3K2Z A;  3QPH A;  1DUX C;  3ZN0 A;  5JI6 A;  1TQM A;  2EA4 A;  1BIA A;  3VOE A;  4LK1 F;  5D5W B;  1OR7 A;  3K9T A;  5F64 A;  3I59 A;  4A0Y A;  2XAJ A;  3IHU A;  5LEJ A;  2KIF A;  3ML6 A;  1ZYR F;  2FMY A;  1H9T A;  3BJA A;  3R6S A;  2ZBK A;  2M30 A;  2GZW A;  5E8I A;  1U2W A;  2J5P A;  1QNT A;  4MQV A;  1HKT A;  3T1B A;  3J7A O;  2NNY A;  1QGP A;  4YFN F;  3H3Z A;  4EJW A;  4MQ9 F;  4WK8 F;  3RDI A;  2D45 A;  3MAJ A;  1HW5 A;  4IRH A;  2FQ3 A;  3FXU A;  2DPU A;  1XCV A;  1MGT A;  1TQP A;  3HTS B;  4GGG A;  3I71 A;  2YSR A;  4L9V A;  2EK5 A;  4DQ2 A;  5A2Q Z;  4KMU X;  4BXU A;  2Z33 A;  2K27 A;  3IRR A;  1IN4 A;  2ESH A;  2XRO A;  2F5C A;  2VOO A;  2LDU A;  3TQN A;  4JQF A;  1W4M A;  3ISP A;  2G7H A;  2WC2 A;  2Z5U A;  2ELH A;  1SFU A;  4UVA A;  1I1S A;  4S04 A;  3S2W A;  4MEY F;  5D6E A;  1P92 A;  4Q5S F;  4EM2 A;  1HKS A;  4LLN A;  3GEZ A;  4RAZ A;  1R58 A;  1TLH B;  5LHG A;  2A69 F;  1DP7 P;  2OAZ A;  2DO7 A;  3BJO A;  3CO6 C;  1UB9 A;  1WI9 A;  3ZN1 A;  4RB3 C;  1UHW A;  3PFI A;  4LK0 F;  1D8K A;  3FMQ A;  3ZP5 A;  4R79 A;  4UV8 A;  3R61 A;  4U7B A;  2HGC A;  3F3X A;  1KU3 A;  3MQ0 A;  2IA1 A;  5D8K B;  2JRT A;  1XN7 A;  1KU2 A;  2GA2 A;  1S7A A;  5ICF A;  1BOA A;  3F8N A;  2JPB A;  1LEB A;  1BI3 A;  4HDV A;  1LB2 A;  1T0F A;  3ZMV A;  4IVN A;  5ED4 A;  3RJP A;  1DDN A;  4I98 B;  4EM1 A;  2JSC A;  3RKX A;  3KZY A;  1H0M A;  1W7P B;  1XMK A;  3RYR A;  2DFI A;  2FBI A;  4OIN F;  1QPM A;  2V9V A;  3REO A;  4HA8 A;  3LST A;  1XGO A;  2P5L C;  1U8R A;  3L7W A;  3GFL A;  5CJ9 A;  2OQR A;  4OIP F;  2EFO A;  2OZU A;  4A0Z A;  3F8F A;  5ILV A;  1JE8 A;  2QZ8 A;  3V7R A;  1AWC A;  2FRH A;  2PJP A;  1QZZ A;  1L0O C;  2DI3 A;  4EMS A;  1I1G A;  2GXB A;  2FML A;  3G73 A;  2F5F A;  2FSW A;  4LD5 A;  3GFM A;  3MZH A;  5H6Q A;  2VBX A;  2F5D A;  1KU7 A;  5DYM A;  3VEP A;  4YG2 F;  5DCF A;  1YYV A;  5AIP A;  1LQ1 A;  1HKQ A;  5LGN A;  2EV6 A;  2DQR A;  3KEQ A;  3CO7 C;  1FC3 A;  1BBY A;  4GXO A;  1TW2 A;  2VT3 A;  2EFN A;  4LB5 A;  4BQA A;  3JSO A;  3K1M A;  4I02 A;  3TO9 A;  1RUO A;  3SZP A;  4HQE A;  2P7V B;  1FX7 A;  3P9K A;  1YQA A;  3GW2 A;  3M8E A;  3ZPL A;  1OKR A;  4A2U A;  2IT0 A;  4M9S A;  2DT5 A;  1Q1H A;  4FT8 A;  4HX7 A;  1R1U A;  1TQI A;  5HLH A;  2P7C B;  1YO5 C;  3E5Q A;  2JT1 A;  2YR2 A;  5LGT A;  2DK8 A;  1WWX A;  1LVA A;  1XGS A;  2LSO A;  4HDU A;  4LG0 B;  2K02 A;  1J59 A;  1D8J A;  3H92 A;  3C3W A;  4GCV A;  3RKY A;  4U0V A;  1FP2 A;  3HOT A;  4UXN A;  2IJL A;  2HDC A;  4IPA A;  3EQL F;  5HDN A;  4Z2Y A;  3BP8 A;  5FD6 A;  1O3T A;  2BEO A;  1XCB A;  4RGX A;  5KVR A;  3NRV A;  4HLY A;  2WV0 A;  3K69 A;  2O6G E;  3ERE D;  2CQK A;  3LWF A;  2VN2 A;  3SHF A;  3U1D A;  1S6L A;  1O3Q A;  1U5T B;  4XLN F;  4ZYH A;  4EJO A;  1WKM A;  4BNC A;  2R7D A;  1LDJ A;  1QQI A;  3SFZ A;  4IRI A;  3VFZ A;  3ABU A;  2M1B A;  4K2E A;  1SD6 A;  5HS8 A;  3NQO A;  4HF1 A;  4GYG A;  1LEA A;  1KA8 A;  4KUM A;  5L3G A;  2FBK A;  4M72 A;  4GYI A;  1FP1 D;  1QO0 D;  3DP7 A;  2KJC A;  3W6K B;  5HVQ C;  3QU3 A;  1J0R A;  2HTJ A;  2QQ9 A;  4I2O A;  1IN7 A;  1W7P A;  3JAM K;  4IHT A;  3HSE A;  1YLF A;  4A12 A;  2ZCW A;  3LAP A;  2CGP A;  4AWX B;  4IF4 A;  4H0E A;  2MH2 A;  4CDG A;  4KN4 X;  2VOP A;  2DK5 A;  1G3T A;  2XRN A;  3WG9 A;  2XAS A;  3ABT A;  2G9W A;  2HKX A;  1BI0 A;  1XMA A;  1W7P D;  5ICE A;  1T38 A;  2A68 F;  5D5X B;  3WTW C;  3L2C A;  1O7L A;  3SQN A;  4N0B A;  4ON0 A;  2FOK A;  4L0Y B;  5JFR A;  5E1Z B;  3ECO A;  2FU4 A;  1YG2 A;  3TOB A;  1UHM A;  2HZT A;  2JZY A;  5FO5 A;  2G7U A;  4KN7 X;  3M9A A;  2FE3 A;  2PMH A;  1FT9 A;  1LNW A;  2VT2 A;  4IJA A;  1MDM B;  3WTY C;  1MJ9 A;  4Q47 A;  4BHB A;  4BH9 A;  1GVJ A;  3GVA A;  2L54 A;  4M71 A;  3DV8 A;  3TO6 A;  1ZGA A;  3VB2 A;  4L5J A;  4MTE A;  2HFH A;  2IW5 A;  1UFM A;  4XLP F;  2OQG A;  3F8B A;  3ZMD A;  1B4A A;  1JGS A;  2DAO A;  4HF0 A;  3SZT A;  1EH8 A;  3E5U A;  4L9T A;  4G94 A;  3E6C C;  1S8N A;  4P9F A;  5D6F A;  2EV5 A;  2PBI A;  2LF8 A;  3CDH A;  3HYI A;  3T0Y A;  5J8C A;  3BPV A;  3CTA A;  5FFZ A;  2EFW A;  2X4H A;  3C1D A;  4KMF A;  3B02 A;  4LG0 A;  3WGG A;  4EQQ A;  1E2X A;  3F72 A;  1CGP A;  1NHA A;  4ZYD A;  2ZFW A;  2V1U A;  1R36 A;  1S29 A;  5ILS A;  4Q4Z F;  2CYY A;  3CUQ C;  1F5T A;  1ZRF A;  2E1N A;  4WF2 A;  2R7F A;  1IW7 F;  4L9J A;  3B73 A;  1R7J A;  4IRG A;  1HW2 A;  4P9U A;  2Z3Y A;  4A5N A;  1ZG3 A;  5HS9 A;  1ZLJ A;  2OBP A;  1C0W A;  3HRT A;  4LGW A;  1WSU A;  3FMS A;  3GF2 A;  5LEK A;  3QOP A;  4AVP A;  1U5T A;  4B8X A;  3FHZ A;  3GFJ A;  2EB7 A;  2PI0 A;  5FFX A;  5JR3 A;  1FY7 A;  4RS8 A;  1HBX G;  2Y48 A;  3DEU A;  2STW A;  4ESF A;  4UVB A;  1OYI A;  2AS5 F;  5BOX A;  4MEX F;  5ICC A;  2IRF G;  1XSV A;  2LKP A;  3QAH A;  2EV0 A;  2LNB A;  1I27 A;  4M73 A;  3WTT C;  2GIV A;  1UST A;  4CXF A;  2P5V A;  2V6C A;  1WQ2 A;  2H94 A;  3T5X A;  4OMZ A;  1Z6R A;  1RUN A;  1L3L A;  5HLI A;  5CVV A;  2XAH A;  3CUO A;  4KIG A;  5CVR A;  3I64 A;  5L3C A;  5TJJ A;  3WU1 B;  1GHC A;  4PDK A;  4EV0 A;  4CYD A;  1V3F A;  5ILU A;  5E20 A;  1ZGJ A;  1ODD A;  2DBB A;  2CG4 A;  5DDG A;  4FHT A;  2XVC A;  2YU3 A;  3MEX A;  2YPR A;  2E1C A;  1KGS A;  4HZF A;  2XV4 S;  4N9H A;  2KRF A;  2GAU A;  1BIB A;  5A2Q K;  5LLQ A;  2D1V A;  4RB0 A;  3AAF A;  4HX8 A;  4CO8 A;  3DKW A;  3E6D A;  4Y17 A;  3V8K A;  2M45 A;  1MD0 A;  1MJA A;  3EYY A;  3LA7 A;  5FLX Z;  1USS A;  1ZG5 A;  1DPR A;  2NRA C;  5K5Q A;  1YIO A;  3V8J A;  3FF5 A;  1S3J A;  4HV5 A;  2H6C A;  3P9I A;  2FNA A;  4M9Z A;  2O0Y A;  3F22 A;  2OU2 A;  2XAQ A;  4QWQ A;  1MDM A;  3IL2 A;  1P2F A;  1FYK A;  3TGN A;  1B9M A;  3J81 Z;  1K79 A;  5D5V B;  1FBQ A;  4YFK F;  1YS7 A;  1VTN C;  4PCQ A;  4S05 A;  3FM5 A;  4G6D A;  3JSP A;  2NNN A;  4RGS A;  1OMI A;  2NYX A;  3KEO A;  1MJB A;  5IT9 Z;  1SMT A;  3RI4 A;  3R4K A;  4EGY A;  2C6Y A;  3LA3 A;  2NS0 A;  3C7J A;  2Y0M A;  3J80 Z;  3BOQ A;  5D5U B;  4LLL A;  3FXR A;  2MD5 A;  5LHH A;  1FYM A;  1YTY A;  4MNU A;  4EJU A;  3BZ6 A;  3CUQ B;  1R23 A;  5D4R A;  2WWY A;  4IXA A;  3Q9V A;  3IC7 A;  4KIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...