3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
3KQYA 4IHTA 3DPLC 4GO1A 5E8IA 2VODA 1S3JA 1L9KA 3DLIA 1XXLA 3HA3A 3UJAA 2YX4A 5D5UB 1FYMA 1LJ9A 2AN3A 4F86A 5DCFA 4X63A 3GDHA 1IRGA 2XAGA 2ISYA 3AY0A 1UFKA 5HS8A 1YLFA 2F5FA 2B9EA 3QOWA 2KW5A 2ZWVA 4R05A 3P97A 1DL5A 4M6YA 5EQJB 1AQIA 5EIFA 2N47A 2HTEA 2EV6A 5T67A 5DSTA 2BGCA 2ADMA 3B3JA 4M7RA 2ZMEB 8MHTA 4QTUB 1KXZA 2XAHA 1RI2A 2HNKA 5FHRA 2M8EA 1USSA 1HSTA 3JWGA 3GYHX 2PG4A 4ZYGA 2EFPA 2ETHA 1HKTA 2LDUA 3E23A 3NVKI 4G8XA 3LHDA 4HGZA 1USTA 3I53A 4MQ9F 2HV9A 3V97A 2FSWA 4X41A 3O7WA 4E2WA 2P40A 4HGYA 4OIPF 4MQ4A 4MTEA 2HDCA 5DDGA 3FPJA 3GGDA 4ISCA 3B5IA 1XGOA 4HTFB 5BQTA 4PCAA 4HF0A 5EOVA 4EM2A 3G89A 4MNUA 2RN7A 3F8NA 4DNCA 2RC4A 1UCRA 2P35A 3EVAA 3HP7A 3TMAA 4P96A 1Z1DA 3FMRA 3LQRA 2AN4A 1UHWA 1ZAOA 2RKHA 3F6OA 3RI4A 4HLYA 2PVCA 4FP9A 2HS5A 4M71A 5BOXA 2EA2A 1DCTA 2A3SA 3MQ0A 1IXCA 2I9KA 4YV1A 3F8CA 2PX8A 4M6XA 4LG0A 2FK8A 5KQRA 3E3VA 3NDJA 4KDRA 3GLXA 3FUUA 1QPMA 1OPCA 3GRZA 3FUXA 2PXXA 6PAXA 4F84A 1T98A 5FWDA 4DA4A 3KR2A 1KQ9A 4UNOA 1P91A 1KIAA 4GBED 4KFCA 3FTFA 3D0SA 5DUIA 1IN8A 4PWYA 4KT5C 2P41A 1DPUA 1XDUA 2ELHA 3NTVA 4HYEA 2KJCA 3LFKA 4U0YA 4YUYA 1V39A 1SKMA 1JQEA 1P1BA 3SSMA 4RTQA 5LQUA 1BI3A 1YFHA 2IT0A 4FT4A 3HRUA 5EZQA 1OKRA 1WS6A 3L8DA 1FBUA 3U1DA 1BI2A 5ICEA 3BXOA 1YUBA 3HRMA 3UJ6A 4EGZA 4PINA 4UOEA 3LKDA 3LA2A 4YG2F 4U7BA 5K5QA 3F21A 3JWHA 3ZMDA 2Y48A 4QQNA 3KPYA 4OA5A 1MZBA 2GH1A 2UWMA 2NNWB 3T8RA 4G6QA 2D45A 1ZLJA 2V74B 1PJZA 3ELKA 2B3TA 1JR4A 4RWZA 3ECHA 5D4RA 5E18F 3OV8A 4OIQF 2XBMA 1MD0A 2P3LA 3IRQA 1KYWA 4RTRA 2C6YA 4AZVA 3F8FA 1EH7A 3FF5A 4FR0A 4V0RA 3AAFA 4ENJA 4ZYEA 3NW9A 4HC4A 3HM2A 2Z3YA 5DRTA 3EEYA 4ZZLA 3QAHA 2ZBPA 5F2KA 1FWZA 2RVCA 1IXKA 3BWYA 2V9VA 1R00A 3KU1A 4Y15A 2R6ZA 5FQNA 2DK8A 5GP1A 2H1RA 3P9IA 5FLXK 3TRKA 5ICGA 5ERGB 4RTJA 1JSZA 1VL5A 2GLUA 4MTLA 1NW3A 3NQOA 4GC9A 4MQVA 1J9IA 2H6BA 1QAOA 4RS8A 3U2RA 3E6CC 4KVZA 3QU3A 1ORIA 2O0YA 5BXYA 3SSNA 1L3IA 3FMQA 1ZREA 1U5TA 2AZTA 2AXLA 2XKOA 4HG2A 4XUEA 3WTSC 5ED4A 5E1WA 3VC2A 3QU6A 1XCLA 3IWZA 3I59B 3OE4A 1EAMA 3KPUA 3UJ7A 3SQNA 3WGGA 2VT2A 4I02A 2HFHA 3TQSA 5K1YA 4PZJA 2FF4A 5KYGA 4EGYA 2PQ8A 5FWAA 2W25A 3V8LA 2P4WA 4LGWA 3PS9A 5DM1A 3CLOA 1MDMA 1O9HA 3BY6A 4BXUA 2PX4A 1NKVA 4LWOA 2YXLA 3ISPA 3HNRA 4HF2A 1FX7A 2ZBRA 5D1NA 5DCMB 1BC7C 2CW0F 3WTYC 3LBYA 4XUCA 4RTMA 2KJBA 3F4KA 4E2ZA 3HVJA 1GVJA 5EHGA 3PB3A 1SD5A 3PX3A 3R9XB 4XSZF 5BW4A 3V8VA 4OQEA 1R1TA 2NAZA 2YR2A 4IV0A 2JSCA 5CCXA 5D5VB 2AOXA 3QOXA 4F7ZA 4YMGA 2OZ6A 3HSRA 4IJAA 3MCZA 4G6DA 5J8CA 1BC8C 3BGVA 2K86A 1HBXG 3LAPA 1KQ0A 3F23A 3IHTA 3RW9A 3HHHA 1BOOA 2V1UA 3A7DA 5K0EA 5T6BA 1DPRA 4X61A 3G5TA 4GOOD 4B09A 4HV6A 1RNLA 4RX1A 4FS8A 2WK1A 4KICA 2K27A 2PLWA 4L9JA 3TR6A 3K1NA 5DX0A 3G7UA 1J75A 4YUXA 3CO7C 3FYCA 2BR4A 2MLGA 2YQZA 4Y13A 4GXOA 4C03A 3K1PA 4ER3A 1STZA 2YUIA 1Z6RA 1QAQA 1KHHA 4FSDA 1P1CA 3P2KA 4D0PA 4M36A 1NBHA 3DUWA 2UYCA 1MDMB 2YXDA 4CYDA 1X1CA 2F5CA 3I9FA 5EEHA 4EM0B 3CCFA 3R6SA 3MZHA 3PX2A 2PFBA 4CKEA 3EVBA 3JWJA 5E8RA 2EWNA 5K0CA 1TNSA 4C06A 3TOAA 3ELUA 3ORHA 4DF3A 5E9QA 5L3EA 1S29A 2KIMA 2L4AA 5AIQA 2IA0A 4CZZA 3FTEA 4N9HA 5K03A 2OZUA 3HCAA 3KP6A 1B59A 1BKYA 4HX8A 3WU1B 2G7HA 2I62A 5CVDA 5K05A 5D8LB 4GOLD 5EGSA 5DD8A 4MTDA 2X0LA 1IXRC 2PLYA 2QWWA 5A2QZ 1XDZA 1QYRA 5LQRA 3FXUA 1TW2A 3RPQA 1ZQ9A 1WRJA 2GA2A 4YFKF 3Q9SA 3THRA 1CF7A 5HEKA 4EKIA 2OPBA 3R4KA 2V7EA 1OYWA 1VQ1A 1OR7A 5E1OA 2H11A 1G6Q1 1G8AA 4U0WA 3OPNA 4AD9A 1U8RA 4I7HA 3SVZA 4E2YA 3IKVA 1W5SA 5LRSA 4Q47A 3HTSB 5FUBA 3BWMA 3IL2A 5IT9Z 2P7HA 1GXPA 4LD5A 3UJCA 1HSJA 3UJ9A 5DXAA 2KKOA 3DH0A 2NXEA 2OKCA 2JRTA 1ZKDA 3M6XA 3O4FA 2XHKA 1XJ5A 3RIEA 3KZYA 2ONYA 4HZFA 1Z6TA 4PYNA 1OYIA 3C6KA 3A25A 1VBFA 4Y2HA 2FE3A 1YW9A 3GWZA 3TOBA 5LR6A 1I6XA 2FMLA 3ZMSA 1IN5A 1MJBA 3L2CA 4M72A 3HCDA 4P7JA 2PBFA 5LGTA 3MCTA 3K69A 4POOA 1MHTA 1LNWA 4RB2C 2CGPA 2I6GA 3EVEA 1YTYA 3DEUA 1MJ9A 2STWA 4QPNA 5GINE 2NP6A 2CO5A 2QQBA 2AOTA 5T64A 5L3CA 3KEOA 2AVNA 1K6OA 2XROA 4GYGA 4KRGA 3U9GA 3CO6C 2C7RA 5P8WA 3K0LA 4QQKA 3O31A 1IN7A 2XV4S 3UWPA 3KQVA 1N7JA 2COMA 1UFMA 3S2WA 3N97A 2YX1A 2XAQA 1ON2A 5BMZA 2DBBA 3MWMA 3KP7A 2IBTA 1QGPA 2KIUA 5LSAA 1IW7F 2G7UA 3SSOA 1T0FA 4AWXB 5FA5A 4AZSA 4HSGA 1ZLKA 4YV2A 3KLNA 2GAUA 2JPCA 4L18B 3ZMTA 1YW8A 4R8HA 2NNNA 1LDJA 3KHKA 2W24A 5FD6A 2XVAA 3I58A 4LK0F 2ZFUA 3BWGA 2GZWA 1BN5A 1XN7A 1IF1A 2O61A 2FRHA 5EKUA 2IH2A 4ER6A 4C4AA 3HRTA 3ME5A 1PDNC 1TTYA 2IP2A 1HKSA 9MHTA 3DULA 3KPWA 4MIKA 1U6GA 5CIYA 4RVFA 2Y1XA 2VBXA 1ZG5A 1N7IA 3O3KA 3KR0A 1J7KA 3M9AA 5EG5A 2GA1A 2Y75A 1SFXA 1O7FA 1ZGAA 5TJJA 5DLYA 1NE2A 1IN4A 3X0DA 2UXNA 3G8BA 1Z9CA 3LL7A 1V4RA 2HTJA 4EQZA 3G2MA 2BH2A 4RTSA 1KPIA 4BP3A 1BI0A 1RZ4A 1MGTA 3HSFA 2PY6A 3JSPA 2DK5A 4R1HA 1O7LA 4GOMD 1UWVA 2BE5F 3I0TA 3GRRA 5C9ZA 2IPXA 2ZO4A 2C7QA 1BJAA 4OMYA 1LDDA 4HX4A 2VC0A 2ESNA 1R7JA 2L54A 5DV5A 4MHTA 3J81Z 1ODDA 4XRFA 2ZSUA 3J80K 3JW4A 5F6FA 5BS6A 2ZW9A 4YFNF 5GIOE 1R36A 2JH8A 4M9XA 5DSXA 3ZP5A 2AN5A 1WXXA 1XGSA 2AOUB 1BHJA 2ZWAA 4A0XA 2BZGA 3KQOA 3DMGA 1FNNA 3B02A 5HOOA 5HILA 2FOKA 5J6XA 5LEJA 5TRDA 3DQVC 3ANXA 3E97A 2LD4A 3EUHA 5C0OE 1VTNC 2GPYA 2D1VA 4C07A 3EEOA 3GFIA 4V0QA 3Q9VA 3HCFA 4RV9A 3HOSA 4GUAA 2VDVE 2CMHA 2ESRA 1LQ1A 5ERIA 3H2BA 1FSEA 4HX7A 1MJAA 3GFJA 2Z6AA 1HXDA 3KP2A 2P7IA 2NNYA 4YFXF 2L4MA 2WA2A 3GCZA 3CTAA 3GZ5A 3JAMK 1IXSB 2DAOA 3E7PA 4LFUA 2A68F 3CUQA 4M9ZA 5FFXA 3DXZA 4OMZA 4DQ2A 4A5MA 4PNEA 1ZGJA 1PRYA 3OU7A 4OIOF 5KS2A 4AZTA 2PN6A 4Y30A 4PYJA 3L09A 3OFJA 1YS7A 2LSOA 4DM3A 4AIHA 3OZSA 2NP7A 4OOIA 1FT9A 5DD4A 5DWQA 2P8JA 1I5ZA 4RB3C 1I27A 3KQTA 4HDVA 4ER0A 3GNLA 3TM5A 1G4DA 4QDJA 4GF5A 4M73A 4B8XA 3BOQA 1SUIA 3HVKA 2V1XA 2IH5A 3ZMVA 3GU3A 2P8TA 1E17A 3R24A 4P58A 4EKGA 3BT7A 2DLLA 3LDGA 2XUBA 5E1BA 1F5TA 3HCEA 4CXFA 2P5LC 2W85A 2GWRA 5F1RA 4BHBA 4ZH4F 1BIBA 1D5VA 3BPVA 2UZ4A 5K8VA 5JVTA 1YG2A 2GB4A 4HRAA 1KYZA 3LA7A 1J0RA 1JGSA 1FBQA 3DMFA 4R79A 3VOEA 4C05A 2OB2A 3ZPLA 3V8KA 2B2CA 3MB5A 5L3GA 3CJRA 4U7DA 3QOPA 3P9KA 1S7AA 2BEOA 7MHTA 3IWFA 1JQDA 3DXYA 3LDFA 3QRFF 3FYDA 2AR0A 2YU3A 3ECOA 4G7HF 4UVAA 4ON0A 3EVCA 4A6EA 2PJDA 3M7GA 3CUQB 2Q8KA 3OE5A 3V7SA 4M37A 4KNYA 4AIKA 3AWIA 2ZNYA 2AOVA 3UA3A 4O29A 3ER8A 2O03A 2PEXA 1KR5A 1IM8A 5JFRA 1CGPA 3VYWA 3DTNA 2XVMA 2PX5A 4U7TB 4GEKA 3T7RA 1B42A 2CQKA 5FGMA 4E70A 4LLNA 3RKWA 4MGRA 3DXXA 5EVJA 1T38A 2HMYB 2DPMA 3G88A 4S05A 5KVAA 5GOZA 2HR1A 4CHUA 1MJFA 1G38A 3P9NA 2UYHA 5LQCA 3SXYA 1G55A 1RI7A 1IZ1A 3IKTA 2F2EA 4PYQA 4BYYA 4G94A 2XAJA 2XVCA 1B4AA 1TW3A 4QVGA 2G9WA 4P7KA 2DPDA 3FUWA 2VBWA 3PQKA 2QQ9A 1YFLA 3WTUC 5GM1A 2FHPA 1EV7A 4RYLA 3SZPA 4HLXA 4L0YB 5DT2A 4BY9E 4OU0A 2EFWA 3MFKA 4OX9Y 3KR1A 3UJ8A 2WA1A 2W84A 2HKOA 2PGXA 3GFMA 1X3UA 1RIOH 3RTRA 3FX3A 1Z7UA 1GHCA 1FLIA 1RUOA 4CGZA 5CCBA 3PTAA 1YO5C 2HYFA 3NVMB 1K7AA 2ZJ2A 4ER7A 4FT2A 4LLLA 4NQWA 2CYYA 5L3FA 2GS9A 3CJNA 4U0VA 1X1AA 4ZYDA 2ESHA 3RJPA 4LG0B 5FCDA 4QPPA 3OZTA 5LHGA 1FP1D 2M30A 2IPQX 3G2OA 3R0QA 3A4TA 4M38A 3P8ZA 4L5JA 3BZBA 3HEMA 2P6TA 2HZTA 4PYLA 4Z2YA 4BLWA 2GXGA 1LB2A 3RDIA 3HTXA 2OB1A 4CO8A 5LQNA 4P55A 3R61A 2EFJA 3O6BB 4I2OA 2ZZMA 1E2XA 4OIRF 2VONA 4G9YA 5FHQA 4BLVA 1VPTA 1K79A 4FX0A 4CWAA 5D8KB 1W7PD 4EM1A 1SMYF 2XASA 2JHAA 4FSXA 3T5XA 1NW8A 1M6YA 1U2WA 3ROUA 1R1VA 3I64A 3R0AA 4DCGA 1T39A 1R23A 5BP7A 4LG1A 1FZPB 5LGUA 2ZLBA 2M87A 1SQFA 2C7PA 2ZNZA 2ADUA 3KQWA 2DTRA 4BAYA 2H09A 3GIWA 3R60A 1AOYA 3HOTA 1VE3A 1HW1A 1JG4A 4JQFA 2VXZA 3BGIA 3FRHA 4DCMA 3BKWA 5D1HA 2OZVA 1U2ZA 2QVOA 2OXTA 2VT3A 1K78A 5CUQA 4O5VA 5HFJA 4ZYHA 1QZZA 2IGTA 4YV0A 4IXAA 3HVIA 1LDKB 3EYIA 3K1MA 2E5WA 2JHPA 5JUWA 2O3FA 1WKMA 5LRRA 3TPZA 1D2GA 2EB7A 3KQPA 2A6EF 3LCUA 1BBYA 3EGIA 5CVIA 4EJTA 5K01A 3FHZA 1XSXA 3HRSA 3OZRA 4QWQA 4N0BA 1F38A 3M1EA 3SX0A 3LQQA 1J59A 1L3LA 2H00A 5DX8A 1SD4A 3O2PE 4QDKA 1ZYRF 1U5TB 1Z91A 1IAWA 4NB5A 4WX9A 2CWWA 1NBIA 3OFKA 2ISZA 2F8LA 4P7FA 2BYVE 4H0NA 1FBSA 2JTVA 2OA4A 2HGCA 1T6SA 1L3BA 4JXJA 4YUWA 1G3TA 2CWEA 4OA8A 1F9NA 3IRRA 3LCCA 3W6JB 5EHIA 5H20A 4PYIA 2GXBA 2VBYA 1AWCA 3TO7A 2CFXA 1QO0D 3VODA 1O3TA 4NECA 3KP3A 4L9TA 4P9UA 4U7PB 3C1DA 4WXDA 4G7OF 5EZSA 2EG5A 4K6MA 1TQPA 3ID6C 4P9FA 2JPBA 2ZFWA 1ZRDA 2K4MA 1BM9A 4IRGA 2JZYA 3IC7A 3BKXA 3THSA 1K78B 3R3HA 4WK8F 1HW2A 3LPMA 3LX6A 2AOWA 2F5DA 5HIKA 4UVCA 1FYKA 3F22A 3ZMUA 2NXJA 1EJ0A 5LHIA 5FLXZ 4MWZA 1J2XA 1LVAA 2X4HA 1ZRCA 4L0ZB 4Q48A 1QQIA 4KW7A 3I4PA 3GRUA 3RYPA 4G7ZF 3RODA 3TQNA 2ZKZA 1OYYA 3OU6A 1HNNA 1U78A 2EA4A 2HR3A 1F1ZA 2QLZA 5L3BA 2FBKA 2P1DA 5BW5A 3Q7EA 5E9WA 4RGUA 1EH6A 3A7EA 1BIAA 1D3YA 2DQLA 3IHUA 1NT2A 4AX8A 4PCQA 4EV0A 5LHHA 3M8EA 1R6AA 2QM3A 2DPUA 3KCCA 2CL5A 3PT9A 5CVVA 2IFTA 4C08A 2B0LA 4RGRA 3B89A 2PMUA 5ILVA 1D2CA 1QANA 5DUKA 4FHTA 5M5BA 2PI0A 1NV9A 1SQGA 4I0AA 3GO4A 1SFEA 2GIVA 4ZZDA 4GYIA 2BV6A 5GWXA 4N9IA 1N2XA 1NW5A 2BM9A 4E33A 5D4SA 2WV0A 2FK7A 1ZARA 3HTUA 2ZIFA 3V8JA 4DKJA 4RGSA 1P6RA 2V1DA 3FUVA 1G3WA 3LKZA 3K9TA 4Y17A 1EJ6A 4EJUA 4CXMA 2P6SA 1O3RA 1MKMA 3JTGA 2EX4A 2FBHA 1VIDA 2BR3A 2R3SA 3FZGA 1XGMA 2EJTA 3WG9A 2I7CA 3KFWX 2QBYA 1XCVA 3P2IA 2FQ3A 2QE6A 4QVKA 3BGDA 3WSTA 1R5GA 1IY9A 4PONA 3KPVA 1P4WA 2JH9A 4WXCA 2CG4A 4CTJA 1KA8A 2ZCWA 4L9VA 2YTZA 3GFLA 3GO5A 4PGGA 4R6WA 5CYVA 5H6RA 5HZMA 3AXSA 2FMYA 3M8FA 4YIFA 1CF7B 4BNCA 4KWCA 5EKXA 4O3MA 1XSVA 3PFHA 4UV9A 5H6QA 3BJOA 5CD1A 2DU9A 5G02A 2MBFA 5E20A 3V7CA 3P71T 5DX1A 1U3EM 2HTSA 1I4WA 3TKYA 4PIPA 1I1NA 1D8JA 3BZ6A 1WXWA 2PV0A 2ZXJA 2ZBKA 1O54A 2YPRA 4LB6B 3FUTA 2FXAA 1QNTA 2DI3A 2D1HA 2P3OA 4YUZA 5K0NA 3WGIA 2DULA 3C3PA 2OD5A 1YYVA 3NEUA 1YFJA 3M6UA 1JSXA 3T7SA 2RGVA 2YSRA 1SG9A 2FNAA 1P4XA 4UUVA 1D8KA 2JJQA 2UYQA 5FTWA 3GX4X 5U4XA 4UXNA 1TLHB 5E2BA 5KK1A 5HVQC 1H1DA 1R8XA 4PCLA 4KIFA 1QAMA 3FPEA 5LGNA 3RKXA 3WTXC 3ABTA 1ZG1A 2AOTB 1YW7A 3FWEA 3R0JA 4RVGA 1ZG3A 1F4KA 5F64A 3ABUA 3BPXA 3H3UA 1WI9A 1DUXC 3FXRA 2DW4A 2MC3A 2AS0A 1IUYA 4IF4A 3EVGA 3SM3A 1FP2A 1G3SA 4FT8A 3A26A 3TO6A 4EJOA 3CVOA 5E8JA 3F6VA 1XD7A 2A61A 4KMUX 1M0EA 1L0OC 3RIRA 4DQ0A 1RJDA 1KQ8A 3N4MA 4IRIA 2OU2A 2QRVA 1PP7U 3SHFA 1XCJA 2XYRA 5EEGA 2XGXA 3MTEA 2ZMEA 2H94A 5BPDA 5E9JA 1KU2A 1YQAA 3EVZA 2OYRA 2M1BA 2Q41A 2K4JA 3Q5FA 2A5YB 5KVRA 3ER9A 3TM4A 3OU2A 3V7RA 4CKBA 2M5WA 1KU7A 3I54A 1KGSA 3T1BA 4RSRA 2ORED 2G72A 3SXJA 1KP9A 1YZ3A 3GVAA 2IDKA 3C7JA 2TDXA 3TO9A 1JQ3A 1D2HA 3JTHA 2STTA 5HS7A 3B7PA 4OINF 1YS6A 4HTFA 5HLIA 4LECA 2NYUA 2VC1A 3BWCA 2HQRA 4DMGA 1PUEE 4BHCA 4IRHA 4HOBA 1WG8A 4WVLA 4R6XA 3Q87B 1HQCA 2KRFA 4HV5A 2HKXA 3BROA 1P4AA 1IN6A 2OQGA 1PP8F 5BPIA 2DFIA 1O3QA 4B17A 1X19A 4KN4X 3AXTA 1FC3A 3ZMZA 2WTEA 4E32A 1ZN2A 3G3ZA 4MEYF 2VDUE 4XCXA 2OBFA 4IKPA 5LQJA 1O9GA 2ERCA 3E6DA 2E7XA 4IWNA 4IHSA 5EIWA 1FY7A 3UA4A 5HLHA 2A6HF 4OBXA 2FPOA 1ORHA 3LAJA 4M9SA 4ASNA 4RB0A 5FO5A 1H0MA 3TLJA 5FFZA 5LQKA 3A27A 4P7GA 4ETSA 2PT9A 1SMTA 2DT5A 3G2QA 1ONVA 5K09A 2Z6UA 2QRVB 5HIJA 2EFNA 3L00A 4ATNA 1AV6A 3E5XA 2ZULA 3QV2A 1SVUA 1Q0TA 1XMKA 4A0ZA 3NDIA 3KE2A 3K2ZA 3NJRA 4ER5A 4CKCA 1G3YA 3FPHA 2E7WA 5ILUA 1YZHA 3CUOA 4RAYA 3KQQA 5CLSA 1S6LA 4WXHA 4KDPA 1RJFA 1JTFA 4HQEA 3IEIA 2OQRA 3CUQC 4U88A 4CICA 3HA5A 5HLGA 2IW5A 3HUGA 1SFUA 4AUKA 4KN7X 2Z99A 2G8NA 3UJDA 3K0BA 4WWCA 2G71A 1RI4A 3VEPA 2ZIGA 3GRYA 4MEXF 4LK1F 3IYLW 4KA4A 3TOSA 2QENA 1W5TA 3PFIA 1RJGA 5DRYA 2YVLA 1JG2A 3CJTA 3QPTA 4WCGA 1ZRFA 2VS1A 4CTKA 1KU9A 3MEXA 1O3SA 5K0FA 1XGNA 2JG3A 2ZZKA 3ELDA 3ELWA 2J5PA 4QLCU 1GXQA 5F2OA 4XLNF 4ESBA 4TV7A 3VB2A 3DKWA 3M33A 4K2EA 3D2LA 4PGHA 2UYOA 2VOOA 1B9MA 3R6TA 2QQAA 4GC5A 1WWXA 2RNJA 2ZVJA 3FMSA 3J80Z 2FA5A 1B6AA 1W7PA 2AVDA 1SUSA 2BR5A 1A04A 2A14A 3C3WA 2NRAC 1R18A 2UZKA 4L5IA 4O6JA 4PIMA 2XKPA 5E1ZB 5ICCA 2GAFA 1AF7A 3WGHA 2LF8A 3DF8A 4I09A 4ESJA 5EMKA 2ZCJA 1YF3A 4EMSA 4HF1A 4M74A 5DM2A 1HKQA 2XYVA 5E17F 5DTMA 4BHPA 1REPC 2DQRA 1FBNA 3NRVA 5LBQA 3WTZA 1DDNA 1EG2A 3C6MA 3ULQB 5EPEA 2OO3A 4XLPF 2XAFA 2P3QA 5FQOA 3M6VA 5CVEA 1ZHFA 3D5LA 1R8YA 3JAMZ 2GQQA 3HYIA 1O57A 3E8SA 3I59A 5HDGA 4EVIA 4KIGA 2FEZA 3MAJA 3V4GA 3QP5A 3PVCA 2ONZA 2ZZNA 3P7NA 5K0GA 3DMHA 3OOPA 3EDPA 3G8AA 3LDUA 1DUSA 2F5EA 1JG3A 4EJVA 1BOAA 4NHJA 2BBYA 3TFWA 2OBPA 4IV8A 1G6NA 3PQJA 5DCMA 4EK9A 1FJXA 2EV5A 3MERA 4HQMA 3WE2A 5JI6A 3GW2A 3E5UA 4DZRA 4XSXF 5E1XA 3F3XA 3L7WA 2G70A 1W7PB 3KR9A 3EGVA 5HIIA 3JSOA 2VP3A 1SD7A 1RI3A 4PYMA 2HYGD 3KEQA 2JHCA 4RTPA 2NXNA 2J5OA 3H92A 1W4MA 3ML6A 3BUSA 2WWYA 5KQSA 4EQQA 2VOPA 1QZYA 5A2QK 1H9GA 4RVDA 3HIFA 3FXQA 3SFZA 2WC2A 3U81A 3I5UA 3DR5A 4PYKA 1Y0UA 3DV8A 3BP8A 3HVHA 4ZTBA 2BM8A 3T0IA 3T8TA 2IDJA 4FX4A 1LEAA 2AS5F 1YIOA 1WY7A 3M70A 2B25A 2DO7A 1V3FA 4Q4ZF 2YR0A 2PKWA 5IT9K 4FGZA 3WU0A 3KQSA 3F8BA 2IRFG 3DLCA 2RV8A 4R8SA 1UB9A 5FA8A 2GA9A 1WQ2A 1QBJA 4RVHA 3W6KB 5IT3A 4KUMA 4JBAA 2XYQA 4KMFA 3LA3A 1SD6A 2A07F 5DTQA 2HEOA 3WTWC 2H6CA 1EH8A 3DP7A 1Q1HA 3P9CA 5EC8A 5AIPA 2Z33A 4YIIA 3B73A 3SZTA 4UVBA 3LGAA 4KDCA 3HCCA 2RDPA 3TDUC 4WF2A 5AONA 3RPUA 3C0KA 5EMLA 2FBIA 3H3ZA 3IV6A 1P2FA 3P2EA 5H02A 4I98B 2CKDA 2O8XA 4I0BA 2PSSA 3JWIA 2Z5UA 4F85A 4ENMA 1U5TC 4XUDA 3ERED 1EIZA 1NV8A 3ELYA 4CDGA 3UZUA 1KPGA 4A2UA 4OQDA 3UFBA 1XCBA 4PDKA 4RTLA 1UHMA 3GEZA 2HWVA 3G73A 1VLMA 4BLUA 2ACJA 3NWEA 5DYMA 1P39A 1UIRA 2Q0OA 5ICFA 3KP5A 4BQAA 2E1NA 1T43A 1F3LA 2QY6A 4BP1A 4LB5A 1C0WA 1XSDA 2O0LA 2A69F 4P5OA 3B3FA 1J5YA 2Y0MA 3E5QA 5K0BA 2MH9A 2FYTA 2LKPA 1I9GA 4E31A 5FB2A 2HQNA 3QPHA 3G2PA 4AVPA 4HDUA 3KLOA 2IA1A 3EQLF 2PMHA 3GUDA 1B1BA 2OY0A 1KU3A 5DXJA 2ZBQA 3M4XA 3CGGA 1JHHA 3HSEA 4GOND 4LWPA 5B1SA 3KQMA 3EYYA 1DP7P 1OR8A 2EK5A 3ERCA 3T0YA 3BJAA 3C3YA 2VZ9A 2LF7A 3WE3A 4GGGA 1RI1A 1B9NA 2CSOA 2IBSA 1AQJA 5FADA 3KKZA 4A6DA 1SAXA 5CJ9A 3LCVB 3F72A 4RB1A 2Z6QA 3BDDA 1JG1A 1R1UA 2IVMA 2O07A 3GF2A 2FRXA 2PXCA 4EJWA 5E1DA 3REOA 5J8FA 2Z9OA 1LEBA 5C1IA 1INLA 2P5VA 3WODF 5E1MA 2G1PA 2Q2EA 3MQ2A 2P7VB 3J81K 2FNPA 3ZN1A 1Z3CA 2KIFA 5CVJA 4BH9A 4ESFA 3CDHA 4HA8A 4HH4A 3B3GA 2L01A 3EETA 3DFGA 3DPTA 2IJLA 5D6EA 4AZWA 2H27A 4X60A 4E2XA 2MD5A 1XDSA 1ON1A 1I1SA 4ENKA 1KPHA 1X1DA 1G60A 2XRNA 3EMDA 1JXSA 3MTIA 3EVDA 3I71A 3SMQA 5GIPE 2MH2A 5LLQA 4S04A 2OAZA 2IA2A 3CJQA 1TPYA 1TQMA 3LWFA 3DOUA 4I01A 4RTNA 2K4BA 1R58A 2O06A 2P5KA 1R22A 2K7LA 1P92A 3QP6A 4IVNA 3GZ6A 4RTKA 2R7FA 3FZVA 3WTTC 5DPMA 5JR3A 2NYXA 1NHAA 1L1EA 5IH3A 4IPAA 3SGLA 2QUFA 1M6EX 5DM4A 1X1BA 1IRFA 3LSTA 2VDWA 3BWBA 3ZN0A 4PYOA 2NXCA 2D2WA 1NW6A 5EMMA 3CKKA 3VC1A 5D6FA 5JHUA 1JTEA 3EPPA 2C7OA 1S7OA 3KZZA 1BC5A 2EJRA 3MHTA 2JT1A 4GQBA 3OCJA 3FM3A 3WTVC 4KIBA 2YX7A 2PXAA 2MLKA 1H9TA 4E30A 4GCVA 2L02A 4LLGF 3LBFA 5DTRA 2PJPA 5E2AA 5FD5A 2XIGA 3F8MA 5K0LA 5HDKA 2CMGA 1L3CA 3KPJA 4L9NA 5D5WB 2EFQA 1JE8A 1T2KA 2E1CA 3L9FA 5CM2Z 4YUVA 3TGNA 4G56A 1OMIA 2QZ8A 1Y8CA 5LEKA 2AOUA 3RKYA 2P7CB 1YB2A 3PFGA 3TKAA 4XBFA 3TDZC 4YMHA 3HCBA 5CVRA 1XVAA 4QTTB 10MHA 3LECA 3GRVA 1XMAA 2R7DA 3FTCA 2PWPA 1R5HA 1Z05A 3MZYA 3EMBA 3HHGA 5EMJA 4LJZF 1EQAA 1XB4A 3EGEA 5K5OA 2HWKA 1NW7A 2PBIA 4R8RA 2V79A 4UHTA 2O6GE 4A0YA 4LMYA 2B78A 1VP9A 3AJDA 3E05A 2VN2A 2FU4A 3K6RA 1FOKA 3G5LA 1I1GA 4A12A 4ENNA 2VBZA 5HOQA 5DEQA 2PX2A 3M6WA 4A5NA 3GXOA 4RTOA 2QBYB 5ILSA 3SR4A 3FM5A 4HBLA 2PT6A 1TNTA 5CVUA 3FPGA 3NWBA 1RJEA 2VE8A 3MGGA 2IH4A 2M45A 3FRIA 4HW0A 3NMUF 4H0EA 2EV0A 3HA7A 5E8GA 1ULYA 4C04A 5K0JA 4MHGA 3VSEA 1RI5A 3COAC 2MA3A 2PWYA 1FSHA 2W57A 3E6MA 4HAMA 3EVFA 2RQPA 5DM0A 1S8NA 4AIJA 3T7TA 1TQIA 3DXJF 2FCAA 2O57A 4JK1X 1TBXA 3J7AO 4RAZA 3ZQ7A 4Q5SF 2VE9A 5FULA 4L7VA 3UBTA 2UXXA 3E6BA 3KETA 3KP4A 1ZH5A 5L3DA 3GJYA 5LQAA 1WSUA 5HIMA 5GM2A 1Q0SA 1FPQA 3C18A 5MHTA 1WZNA 4KYWA 4UV8A 3S68A 1JHFA 3VFZA 3FPFA 5F2NA 1G8SA 2ZTHA 2L3DA 1RUNA 3UJBA 1XTPA 3MAGA 5D5XB 2LNBA 3RYRA 4OBWA 2K02A 2EFOA 2EJUA 3PLAE 5K5RA 2HOEA 3CC8A 4RGXA 4X1OA 4FZVA 2IIPA 2V6CA 1BI1A 3BJ6A 2O05A 5HS9A 1R74A 5IKMA 2QYOA 5HDNA 3FTDA 1FYLA 1VP3A 2ZIEA 1HMYA 2YXEA 1HW5A 2Y1WA 3CBGA 2NS0A
chains in the Genus database with same CATH superfamily
2JARA 2HL6A 1Z83A 1LJ9A 2HO5A 2XAGA 3DVRX 3LKBA 1MGPA 2D0OB 3IAS6 3LM8A 2RHHA 3IQEA 4IOMA 1ARZA 3W3AA 2ADMA 2YWDA 4QAQA 3GUCA 2J45A 3PFBA 1RKQA 3AKCA 3IIMA 3P1JA 1SGWA 3ZD8A 3BS4A 1CHDA 3WK8A 4G8XA 4MV5A 5C4MA 4OIPF 3LIPA 4C2TA 4ZCSA 5DDGA 1C0KA 2H5IA 2JFNA 1XGOA 1MKYA 4J6EA 3JRDA 3WBFA 3JRCA 1TUBB 3VSBA 5JS8A 1D09A 1QK3A 2ORIA 1Z1DA 4OHRA 3EPZA 1T5LA 3HCNA 2E21A 1SB9A 3JTEA 1THTA 4OTZA 4PS0A 4UDYX 3E4CA 3S6JA 2ZUCA 3PF9A 1F1JA 3UAGA 1OPCA 1EDBA 5TQJA 3ZZTA 2YZGA 4CG1A 4LMBA 4OGKA 1MO4A 4Q7MB 4K3UA 1P91A 4OCZA 4KFCA 1TQ2A 4CKCB 2RFLA 4UM8B 5K9ZA 2WYIA 5LQUA 3K0FA 4MCJA 2NU9B 4HNAB 5LDDC 2VI5A 3EMKA 4BCDA 4FCWA 3GUYA 4GOJA 5BW6B 1OCRH 3V8MA 4JBGA 5LP6B 1N2BA 3T3GA 4ZDOA 1PJZA 3D1LA 3O4IA 5AI9A 5E18F 3WSVA 2C6YA 1GDHA 3ROEA 2X6YA 1GFZA 2CJYA 1Z68A 3HM2A 5KWSA 3RBAA 3GBVA 4FYPA 1JEDA 1C4OA 2RBGA 4WQMA 1MMDA 2CNWA 3ZS8A 4AJ9A 2VZ0A 2PL1A 3LY7A 1GQQA 5H83A 1JGTA 1CG6A 1YJWI 1FMFA 1P9WA 1XB2A 4XARA 1NOKA 2DODA 3NETA 5HWSA 4H0FA 4LC1A 4FFRA 1EM8B 1U2DA 1V11A 1FU8A 4X84A 5IBRA 1ORIA 3SSNA 1L3IA 4J1SA 4UDXX 5KJCA 4CA0A 2IDZA 1OLTA 4LMRA 5K1YA 4TYWA 3ND8A 3ANYB 3NATA 1RHUA 2NVQJ 3UC9A 2AFRA 4MFDA 3IH4A 4QOGA 3KQNA 3JQ8B 4H2DA 2IXFA 1YGYA 2R5YA 4ECAA 3QVOA 3MIIA 4EAQA 1GRQA 1K2VN 3GA5A 1G2IA 4WKNA 3V8VA 4Z2AA 1WULS 3IQXA 3VU8A 1D1AA 4XZ3A 2PKRA 3TECE 4BJ5A 3IIIA 1I4EB 2BD0A 3Q7IA 5I4BA 4HDNA 3RW9A 4JSYA 1P3DA 5ADVA 1VJ1A 2GK7A 1IK4A 1MMSA 1QP7A 1O94D 1D1TA 5DE3A 4BNUA 4YUXA 3CO7C 2OCPA 1MRZA 3SEZA 3CRNA 1IJFA 4UHBA 4MQ6A 1BX1A 3L2RA 4XK4A 3AETB 1SIOA 2ECOA 1X1CA 4CYDA 1W4BA 5ES4B 3RSHA 1Y8ZA 2LVBA 3MZHA 3EVBA 3FGZA 1GZUA 4O0MA 2R96A 3AJAA 2ZBFA 1WP4A 3ADCA 4UBLA 5A3JA 2R44A 1LLUA 1L4EA 3URMA 1G9XA 3PQDA 2QYHA 3L84A 4HX8A 1N3BA 2CQNA 5EGSA 3M6AA 1IXRC 1GLNA 1VMDA 3FBNB 1BMFD 4F92B 3CFYA 3FXUA 2P6PA 4I8XA 2GA2A 1MB2A 1SC6A 4NMXB 1N9GA 3PZBA 2OLKA 1KJWA 4PC1A 2P2CA 4BGVA 1PLKA 4L5EA 3W6UA 4Q47A 1P2BA 2LIPA 1T9CA 3MNFA 1HSJA 4QXQA 4J03A 5A9RA 1R49A 2FEOA 2OL4A 2GFHA 3EGOA 2YY6A 2PR7A 2FE3A 4UMDA 1Y8AA 5AESA 1BRTA 5KNLA 3L2CA 3VSLA 1EK6A 3MCTA 4POOA 4O4IF 3EVEA 5AM5A 2FAXA 5GINE 5JNVA 3BH7A 2AVNA 4WIAA 4KRGA 5P8WA 3K0LA 2XV4S 1OLXB 4QEDA 1UPUA 2ZS7A 3RS0A 1E79A 4C2AA 4NZ9A 1WXIA 5IS2A 4Q9KA 3T95A 5LSAA 2G7UA 2HM7A 4MLOA 4NE7A 4Q3AA 2O3RA 1YW8A 3CJQB 3KHKA 1HGXA 1ODCA 2PKXA 4U7HA 5J1SB 5SZHB 3IAHA 1VL1A 4MJ3A 4LOAA 2CHFA 3GTLJ 3DEIA 4BB6A 1V4NA 3V8RA 3GOQA 3IUPA 2J30A 2LBFA 3LSJA 3KR0A 4GECA 5ANRB 3Q72A 2Y75A 4QYXA 5DLYA 1V4RA 1X7WB 4JXXA 1KC1A 5M3BA 3JSPA 5EZYA 3K2BA 2QAGA 3GRRA 5TSDA 5C9ZA 3AUKA 2GZ2A 3WBJA 3NIFB 1BDHA 2VIIA 5KOHB 4TXLA 1TB4A 2VUSA 2C4WA 4CM8B 3H42B 1R2QA 1RCUA 3WNZA 4DDUA 3GP3A 4FJ1A 1RQRA 3TQTA 4MYSA 5AKYA 4OJQA 5TIIA 4XLFA 3GFIA 3HO8A 4DS3A 3WAKA 3ILSA 2ZJ0A 1WHTB 1V1MA 2FF5A 4JLJA 1S2MA 5FFXA 3ZQGA 3RUPA 3PJGA 3K72B 4PYJA 2WWTA 2Q5FA 4Q6BA 3FMOB 1YBFA 4AVZA 2JJ8A 2JGLA 4HVCA 1QIIA 3IE2A 3EGDA 2G88A 4IDCA 3C3AA 1PJRA 2P8TA 3IPRA 4JU9A 2FJ1A 2VJ4A 2ZI4A 2PIDA 4RZSA 4UBIA 4V3CA 2C96A 3EBLA 4TKZA 3VWBA 3KM0A 4U2EA 5DV9A 5AOCA 1ULSA 1DEKA 4H1WA 3CLVA 3F74A 1UIMA 3Q1KA 2B2CA 4BNDB 3QKIA 3UOWA 2CJWA 1P0FA 1RR6A 2PMKA 3PD0A 4PLTA 1YACA 1KOFA 5I7HA 1TYDE 1J33A 4CKXA 3Q15C 2QVGA 3PO2J 2HF7A 4M37A 2EL9A 4U6SA 4UQLA 4AIKA 3BIFA 3F5MA 1VA5A 3SDGA 5TQ2A 1I6MA 3QYAA 4JI2B 2E4ZA 3Q1LA 1W1WE 4GX5A 1BQEA 1G3QA 4MV4A 2B94A 4JN6B 4R2WA 1G55A 2IYTA 3GG2A 3UKDA 5IY5H 1MAAA 3CIOA 1V7CA 3FMGA 3VR1A 2G9WA 1CJTC 2VJMB 3G23A 4MW0A 4EFKA 3PQKA 2PYIA 1VCOA 4DABA 2OR3A 3CDLA 1NRXA 5GAEJ 2VUMJ 4DY4A 4QOFA 3FOFC 3GFMA 1RIOH 1PGOA 1XJQA 3U7JA 4MZXA 1RUOA 5JXIA 3VH1A 3D6FA 3WHLA 3EEQA 3BK7A 2OZKA 3ZCXA 3ER6A 4CZ2A 4EHAA 2BEVB 2C2XA 5SYMA 4WOKA 4UNRA 1NVGA 2HMWA 3A04A 2UXDB 1FP1D 2R7WA 2IPQX 1W35A 3AHJA 5GONA 4P4GA 3KG2A 3IR7A 3TLMA 2F9FA 4M22A 4Z2YA 3S2UA 2PTGA 3NVDA 3K0CA 4ZZ1A 3JQAD 3IDSA 2CT8A 3SHOA 4RPJA 4LJYA 4CWAA 1QFZA 2I4RA 4RE6A 2FQ1A 1ORDA 4MINA 3WS7A 1TRKA 4NQRA 2JFGA 2PA3A 4XVUA 4XGQA 1YKFA 2DTRA 1C81A 1WZUA 3R60A 3HOTA 2FE4A 4NBKA 3FKSD 2C2ZA 4MCAA 1IZ8A 2R25B 3FRHA 4M1SA 1S7EA 1EQUA 1W5EA 2JCXA 3AINA 5H4HA 2Q7OE 1K78A 5JNUA 4DIOA 4XD7D 2ELJA 3UMFA 4A3DJ 3HVIA 3EUFA 5ALKA 1RKVA 1MC5A 3U5TA 5F77A 4E4TA 4MVYA 1Q15A 3V8EA 1IQ0A 1RRCA 3NTXA 3GD5A 3SF8A 1F38A 2P4UA 2VDRB 3B2QA 3O2PE 3K10A 1WW8A 1E2KA 3PUBA 1M2WA 2ZRHA 1Z91A 3GTPJ 5KAFC 3VJKA 3UJNA 2C9DA 5IXSA 4MARA 1HDRA 2F8LA 2AUMA 1FBSA 1KKLA 1U5BB 2C7GA 2XMQA 3FTQA 5IZCC 1VPDA 3KB2A 3IRRA 1VSVA 3E9ZA 5E7QA 2CXTA 2VBYA 1AWCA 4ZZ3A 2AE2A 3M7IA 3VODA 3OOEA 3D5QA 2BDUA 5DB4A 4P9FA 1AB5A 3CUKA 4EI7A 1KE1A 4EY4A 1T0IA 3QHQA 1RLOA 1ULAA 2DBYA 3GNTA 3LX6A 1WL8A 1AQUA 4FYKA 5LU8A 4MWCA 1PX0A 2R8RA 3G6EI 3CLTD 5JZ9A 4QA9A 2X4HA 2JFBA 3DDSA 3OF2A 4YRLA 4YAIA 3UMBA 3TPFA 1SUPA 1JHRA 4O6VA 5DI3B 3AF3A 4MRPA 4Z1OA 4AX8A 1NT2A 4C0JA 2AFHE 2CL6X 1R6AA 4DMUB 3DCNA 3EW7A 2JD1A 5A3QA 1ETOA 1E2IA 1QANA 5JMWA 3DAPA 2BGJA 1WHUA 3MTDA 4Z0HO 1FFAA 4FWIB 4R0MA 3CZRA 2FK7A 1VB3A 4ENPA 1S8AA 3RBZA 1NK3P 2VP2A 1MB3A 1HLVA 1D03A 3FDFA 1G3WA 4XGRA 1G19A 5KPDA 3BIOA 3D6VA 5B1EA 5D3MB 4QQRA 1JDPA 2Z43A 4E7OA 4ND5A 4BFUA 2OGWA 4L9VA 1W4ZA 1MO5A 4LFBB 5EZ5A 1NQOA 4YIFA 2NSYA 1Y4DE 3NM6B 4YRPA 3EVNA 2ASVA 3EXAA 2CS3A 3MJSA 3NC0C 3E4DA 2HBQA 2WILA 3GX1A 2PRJA 3DEKA 3U1KA 1SZCA 2FXAA 1GR1A 1RPAA 1I33A 2WJGA 1MAHA 4GE3A 2QP9X 1JSXA 1UDAA 2VXBA 3RS2A 2FNAA 5AVVA 2KI5A 3GLGB 4N54A 1M76A 3DFIA 1SXPA 1W0UA 4LDPA 5DTJA 2O3UA 4EYOA 4AJNA 3JWPA 1CBUA 3TD9A 3CBQA 1YW7A 3LXXA 1EZZA 1NZJA 2VTVA 2YJZA 4PXSA 1TT7A 3OMWA 2QJRA 1NJFA 1HQKA 1G3SA 3UUWA 1WMSA 2PUJA 5ITZB 4KMUX 5C3EJ 4DN6A 3QVXA 3QGMA 1RJDA 1QHGA 1KQ8A 4URXR 2OU2A 2QRVA 2VJDA 3SBOA 4BN5A 2O20A 4PUSA 4U9HS 2PUDA 3STXA 3Q5FA 1SC7A 4LNUB 2DYSH 1BOFA 3DHWC 1MSEC 1BVYF 3PGA1 2P9TA 2FZGA 1HC8A 1RYBA 1OF1A 4QNRA 3C7JA 4P22A 5DBEX 3AF1A 2DUUA 3MBIA 1YS6A 3BM5A 1A8IA 3ET4A 4EY7A 4R6XA 5JDIA 4OFBA 3GGPA 3WIVA 1SVIA 1Y8QB 2F59A 1TFUA 4LXIA 4FD3A 2VDUE 4XCXA 1QNLA 3R5TA 5EIHA 1J8MF 3Q8KA 2VJQA 5EIWA 2EQ5A 3LAJA 4KO2S 4NBQA 1W6UA 2W0SA 5LQKA 1O3YA 2PBLA 1BHQ1 2GXSA 2O8DB 2NVOA 3TG8A 1H8AC 2M2EA 2C4UA 1UXGA 3K2ZA 1AE1A 4HADA 3WZMA 1Q1GA 4CKCA 1F3OA 1G3YA 2CDNA 4QL3A 4BZQA 2E7WA 2ST1A 1VLVA 4HWSA 2NU9A 3AWDA 1LS1A 3QBEA 2RB4A 2XJ4A 3KT3A 4NSNA 1I6KA 4NABA 2HOTA 3OG9A 4MRVA 2WVGA 2PHZA 2XD9A 1D4OA 2Z95A 4DNXA 3ZHCA 1I39A 4DG8A 2DHQA 4PPQA 4MEJA 1WHSB 4YAFA 4ESBA 3JQRA 4G8BA 2CN1A 4JBLA 3UY4A 1B6AA 1D9XA 1P5RA 3F67A 2H2IA 4ESVA 4ND4A 4ESJA 3RZOJ 2CLHB 2RHOA 1X8XA 2FFHA 4HAWA 5B55A 1MJGM 3KUCA 3B1JA 1C9KA 5EXTA 2NZVG 4KH0A 3K4NA 2I2AA 3ES9A 3FM9A 3KDPA 5ICSA 3JAMZ 4LF6B 4GGMX 3IS3A 1O57A 2FW8A 3QEMB 1LEHA 2NUTB 3OR1C 1R8SA 3PFCA 1TWGJ 1A9SA 4UD6A 1CY0A 1E8NA 5D5PA 3DMHA 4MJ7A 1MB4A 3EDPA 4CIBA 3KEGA 2X0DA 1YCFA 1VMEA 4MUYA 3RTAA 3F3XA 3OZVA 1T8YA 4F52A 3NCHA 4RH0A 4XPZA 3Q85A 3W5SA 2DRIA 3L43A 1WDTA 3KEQA 4ZOBA 2J5OA 5BUZA 2FPMA 1Z15A 4RDXA 4LKRA 5DULA 2WWYA 4EQQA 4I6GA 1QTRA 4PYKA 1GARA 4ZTBA 1PKXA 3IPLA 4GPTA 3NARA 2DH5A 3ANNA 2AS5F 4LE0A 1V3FA 4DE5A 4JASB 1FS5A 5LNK1 2X1DA 4DVJA 2PA0A 1CY8A 4BKXA 4CSWA 1FXSA 3FAZA 3QXXA 5JVDB 4PO1A 2HJHA 4JWTA 5G40A 4QDZA 1KJZA 2J0QA 1R0LA 1I30A 4YIIA 4UVBA 3NHSA 3QFSA 3A4IA 1YIDA 3B6JA 1G291 1P1KA 1K3UB 1CZHA 4I0BA 2RKBA 1U5TC 5I7AA 3ZHOA 1U9JA 4RTLA 4OSOA 5E6RB 4X64B 3ZCSA 1QK4A 3KLBA 4XUGB 2CNNA 4FISA 4DKXA 4F1JA 1PZXA 2C03A 2HEGA 1A4IA 1R10A 2Y0MA 5I7UA 4P3XA 1RQPA 4LG3A 1ODKA 2NVBA 5JAZA 3GUDA 1VMKA 4B3TB 1Z39A 3ISVA 1NP7A 3IUBA 1GRVA 4RNCA 3KSAC 3KQMA 1XLVA 4D9FA 1DXHA 2YMLA 2MABA 3EC2A 2Y67A 3S8MA 1GL3A 4YWHA 3KKZA 4G8CA 1R0RE 1UK9A 1VBMA 1R1UA 3V1KA 1COWA 4AM8A 2IOQA 1XCMA 1INLA 4JX9A 3QU4A 2WTXA 1V7QA 4D56A 2OCAA 4JBWA 4BH9A 5CURA 2L01A 1J8VA 1OWNA 3SYKA 3ZK9A 3F2IA 3KZXA 3ANTA 5KHOC 4Y7DA 3C3KA 5DGXA 1NXXA 5H7XA 1KEKA 1P7JA 3CJQA 2W48A 2IGBA 3S5UA 2XCTB 3D0RA 1JL3A 1LK7A 5HQJA 5IVIA 2M98A 9ATCA 4EHFA 3RSGA 4NBTA 1P6UA 1Q1ZA 2RBEA 3NHZA 1FOWA 4QDTA 1Y39A 3NHRA 4INZA 4BRSA 3EWNA 1X7WA 2NU6A 4XJXA 3N53A 1OH7A 1NLMA 4ARSA 2VDQB 1EFLA 4CFSA 2PJPA 3EXIA 1Z34A 5AW6A 4NARA 4N82A 2CMGA 4FOLA 3S3TA 2E1CA 1MPXA 4EENA 2WW8A 3TGNA 4BWYA 4CM8A 2CV2A 4QU5A 3WLRA 3IAS2 3E5NA 4JP2A 1KDYA 3QX9A 2HUPA 4ZEVA 3OQOA 3EA0A 2PWPA 1XFDA 3MZYA 1T2FA 2A0KA 3F7OA 3WYGA 4RH1A 4OATA 1PNQA 5J5VA 4J01A 4JYMA 3T9EA 1WHTA 4DWOA 2EJCA 2FU4A 1I1GA 3X44A 3H2IA 1U8UA 1KI7A 1Z37A 3FWHA 1Y81A 5FBRB 5ILSA 4B1RA 3GMSA 3FWKA 2QD5A 3QX8A 2QP3A 4OMDA 2YY5A 2PT5A 3AUJB 1WY5A 4B4UA 3FRIA 5T4FA 5IK2D 5E8GA 1T0FC 1B8PA 3SX4A 2MA3A 3EVFA 5ESWA 1YVRA 2JZCA 3NBXX 1MABB 2DGDA 5FNZA 1Q0PA 3U4AA 2AI2A 5FULA 3QG5A 3E6BA 2V7PA 1RAHA 1WSUA 5HIMA 3ADBA 2J85A 4PO8A 1NXWA 1OASA 1XTPA 4RHEA 1Y6IA 3GRKA 2ME0A 1JKXA 4YYZA 3IV5A 4BNDA 3IKJA 1Z5GA 3CLSC 4BGDA 1HW5A 1JT0A 4B71A 5L3SB 4DILA 3ZWQA 4CZCA 3Q7RA 4O2BB 1XXLA 3HC7A 4LA4A 1KYVA 1GNSA 1IUNA 4C3UA 3CUEF 3AY0A 2P9FA 2E4WA 4D7NA 1XHLA 1QHHD 4XEHA 1SR8A 1NQWA 4Y2XA 3IHKA 4AKIA 4D45A 1RBMA 1SK9A 3GG9A 1GVHA 2LR0A 1KXZA 3TOXA 2COUA 4D79A 4N7BA 1Z9BA 4OHKA 4KPFC 4MQ9F 2V4JC 3I0MA 1Y7HA 4DJTA 2OV1A 3OS2A 4XICA 4X62B 2VJMA 2EKPA 1H2YA 3AF4A 3JD3A 5JYBA 4X3CA 3W77A 3F8NA 4NH4A 5AI0A 3SQOA 1FZTA 4XYEA 5ADUS 4BO9A 3QPUA 3VOSA 3N5CA 4IAOA 5BOXA 3H18A 3LUDA 4XIYA 4KIJA 3DE6X 2AI1A 1VHJA 1WGXA 1W59A 4GBGA 1ODJA 3VXKA 2JGKA 4KP7A 4MVWA 4KDRA 3SG0A 2XEXA 2FZLA 4CKYA 4E14A 1KK3A 1X6VA 3VR6H 4ZIRB 3S2SA 3FTFA 2JDID 3D0SA 2IL1A 1NYTA 3H8JA 2XW6A 2ELHA 4ZCRA 2KJCA 3ZC3A 3JALB 1W0KD 2ODNA 1CNFA 3WWPA 1C8VB 4N8SA 4PINA 1E1DA 4D97A 4P86A 2BOVA 2QN8A 3ZCOA 1P5HA 2C9CA 1ZIOA 2YOFA 2IQ5A 4YP5A 1E2UA 3ELKA 3C39A 2E7ZA 2H4JA 2I1QA 2YW9A 4OIQF 3RTCA 1W5BA 2QUIA 3VZDA 3AAFA 5K0TA 5FTMA 2WG0A 2ZYTX 1WNTA 3QAHA 1MMAA 5AKKA 2PS1A 1XCGB 4COKA 3KLPX 5FLXK 4A3CJ 4TLDA 4EOGA 3R9XA 3TMYA 1YQWA 4LDAA 1WX1A 3K1JA 5C51B 2GYVA 5CBPA 4IGEA 5D3ZA 4OJTA 2VWPA 4OGGA 5CJJA 3CNEA 3MTJA 3A06A 5ELXA 5LJIA 2O2HA 3ZGXA 2VKEA 3AEKB 3F6BX 1CCWA 1O2DA 1U5BA 2ZSHA 2FQXA 1J0EA 2CSUA 1A72A 2PUVA 13PKA 3BSWA 3RV4A 2X4DA 1DBVO 2PQ8A 4UAUA 2Q9BA 1HM5A 3A11A 3INRA 3OYDA 2QD4A 1U90A 3ZKWA 3Q7PA 3S28A 1FSZA 2BFDA 1KH2A 1XWFA 1N6PA 1WUIS 1LZLA 4LF7B 2XF5A 2V6MA 3K1ZA 1PJLA 1XRQA 1RWBA 1XZKA 1X42A 2C95A 3OL4A 3MCZA 4H4EA 2AZXA 1OBOA 1JMVA 3QE4A 5LDGA 1V11B 4W9NA 4GG1A 2H4FA 4UOZA 2F8SA 3QEBZ 2Q2QA 2B4KA 4LI3X 5J1UA 4X94A 1JKQC 3WP1B 3JVEA 3EK2A 1FFYA 1JXMA 4S0ZA 2YQZA 1TEHA 1Y9JA 5I7EA 5B2ZA 5LYYA 2DHDA 1YI8A 2P2ZA 3P2KA 5FL7A 1JRLA 4O2AF 3UJPA 3ELUA 2R5YB 3DMRA 5E9QA 3FDYA 5LUBA 3E9QA 4N9HA 3KUUA 5FJ8J 1QIDA 4GWGA 5C1PA 2J09A 2WNIA 4EY3A 1GDTA 3VPHA 1VF9A 3N8HA 1BCRB 3EWIA 4HDNB 4GVPA 2NTJA 1T0JB 4A8TA 1ZQ9A 4AROA 4KFRA 2HOSA 5JD4A 3P26A 1A4UA 4TN1A 3G4SI 2E36A 1D6JA 2H11A 4AYBN 2GN6A 4H60A 2JD0A 2XZTA 3HTSB 3AFIA 4IZ6A 5FUBA 3ICEA 3LXRA 1QV7A 1GXPA 3W6VA 3P0RA 2VEOA 4M0LA 4TM8A 1IBLB 2JRTA 5ALVA 5JALA 4RQAA 3CIFA 2V97A 1GKIA 3K6GA 4W5QA 1EEHA 4ZU6X 5JDCA 3IDZA 2WUEA 3W79A 3ZG6A 2HFJA 3R3ZA 1IN5A 1Q20A 4R8KA 1I2BA 1PJ3A 1U4OA 4GR9A 4A0HA 4QPNA 1WH7A 4LX8A 4J00A 3TUZC 3L0ZA 3L4EA 5A5EA 1WB6A 2I8DA 3TZLA 1U4SA 3U9GA 3CO6C 4LBWA 1CZLA 1UFMA 1YOVA 2YQ5A 2E3JA 4DTIA 4QPDA 1U9NA 1D9ZA 5DBGA 2QX6A 3ZQHA 4FEYA 3DE7X 5ITZA 2ON6A 3D6HA 4M0CA 4IINA 1N9GB 3OY9A 4X24A 1EK1A 2CYCA 1FFDA 2V7XA 1LDJA 5FD6A 1AURA 3U61B 4LNUA 4Z9YA 3ADPA 1ZRSA 9MHTA 4X8HA 3CW9A 1K8ZB 3ESAA 4JAVC 3C5VA 3AR9A 4OK5A 2WJAA 4QOSA 4IW3B 1KZ9A 3NIWA 5TJJA 5EXSA 3OIOA 3IOCA 5B5SA 3C24A 4HWRA 3KWLA 4EQZA 4KO3S 4IL6C 2BH2A 1U11A 2V3VA 3IOEA 4L76A 2WY8Q 1Y8QA 4Z7NB 2C7QA 1UMDB 4QUGA 1AA7A 4HX4A 2KSQA 1MJNA 3F71A 5DV5A 1MHPA 1YFKA 4XRFA 2ZSUA 2GHQA 2CUNA 3AVPA 2JH8A 4OB6A 1GZ5A 3AI3A 1NDQA 2H0RA 2GEBA 3KQOA 4XLCA 5DHSA 4JYKA 1ZU4A 3ISTA 3D59A 4FMPA 5EERA 3NBMA 1ZYUA 1LWNA 3Q9VA 4AN1A 3AGQA 2VHYA 1ZTRA 3FWYA 1VFNA 1R6VA 4DLZA 1LTKA 5IJ9B 3OZAA 2P7IA 3IPXA 5ADWA 3OJ0A 1ECFA 1K6XA 3CUQA 3HU5A 3DEJA 1ISSA 3PGKA 3PEYA 3NYQA 1XP8A 3WL4A 2PNJA 1C7QA 2H48A 5JJCA 1U1EA 4DM3A 4ZPXA 3KZ1E 3T7CA 3H1AA 2WAMA 3HM9A 4B0PA 4X6YA 3O5AA 1WHSA 1V55H 5LKAA 2ZMEC 5BWCA 2XB2A 4NPAA 2VP5A 3L7NA 1F5TA 3K4HA 3HCEA 4G1VA 4CQMD 5J4KA 3TTUA 4JFAA 4BHBA 5AK4A 5LLTA 2BTEA 5JVTA 2JCYA 4BVAA 1AKHA 1JGGA 2MINA 1CTQA 4NCHA 3KKQA 4FTWA 3WGKA 1EP3B 1R6DA 1QX4A 1V3TA 4WBNA 4RFSB 4JLAA 3ECOA 4G7HF 3HJAA 5FOXA 4JLOA 3ASUA 3IP1A 2Q8KA 2KPMA 2Q4EA 1XJCA 1B0AA 1EYZA 1P2VA 4O29A 2EFGA 5EJ4A 3PI7A 1WTCA 2IHKA 1KJJA 4EMTA 1REQA 3EGDB 3GFRA 1EUDB 2Z16A 2YL2A 4GLOA 1P2TA 3RH0A 1H2BA 3K4MA 3USCS 1OIVA 2HFKA 5EDNA 1RWKA 4EPVA 2PZBA 1G1MA 3S2FA 4JYCA 1EK5A 4DT1A 3KVVA 5GAHJ 3E8XA 3MGCA 4ZHQB 2OECA 2HHLA 2QQ9A 4F3YA 3DZGA 4HLXA 1JHVA 3QJYA 2GAOA 5GPBA 3IVXA 5A62A 2J9GA 2FPXA 4BWGA 3OHSX 3KWMA 5BRJA 2QRZA 2OCBA 5HYVA 1DQZA 5LHGA 3VAYA 2M30A 1ZMBA 5H81A 1P44A 2P6TA 3AEZA 5FUWA 4F1WA 4XVCA 5E38A 1VPEA 1CJCA 2JUGA 4PLVA 5KREA 3PFWO 4HPJB 2ZTSA 4L1KA 4N5HX 1Z4PX 2D5BA 1U2WA 2H2AA 3SS9X 1TFRA 4DCGA 1T39A 2WFMA 4ZC1A 3GIWA 1P1FA 2EQAA 3J7ZI 3VVBA 4YCAA 5KTOA 2Q6VA 2VT3A 2ZC2A 1ECCA 4QUDA 4Q1DA 4IXAA 1TAUA 3M4NA 4JJAA 1P5FA 2JHPA 4BO4A 5B57C 1ZMRA 4MW2A 5BSWA 4C78A 4B9AA 4GX2A 5CVIA 1VTKA 2TSYB 3V2HA 4M60A 3SX0A 4Q03A 1OD6A 2MT9A 1R5BA 5DX8A 2PH1A 4M46A 4UVGA 1X77A 5KC9A 5EP1A 3HG7A 4GZ5A 2LP0A 3PHHA 1G3TA 3RAPR 4BC0A 3ORYA 4U5QA 2YW2A 2M6LA 2H57A 3HXTA 2OTCA 5A02A 3SOPA 5DGDA 4RADA 2ZQ5A 2GDJA 1FMVA 3BKXA 1K78B 4EHHA 2XGGA 3O38A 2IW1A 4YJHA 3R3XA 4GS5A 5DHRA 1G3IA 4BP9A 4C20A 2I3GA 1WLYA 1Z22A 2JGAA 4IIVA 1TD1A 3REFA 4IFTA 3IVMA 4HSRA 1NLZA 4CRWB 5KTPA 2HR3A 2PMZN 3SF8B 4Q12A 1JPJA 3TGLA 2HHHB 3TTVA 3TW6A 4EV0A 2JFYA 1QO7A 4DL9A 3BQYA 1JT2A 3RT7A 4ZYXA 1GVNB 2K3PA 2X5KO 1M1ZA 5ILVA 3BD9A 4EARA 3ETLA 3CG0A 1SZPA 3JARB 3KV1A 1U8EA 2BRUC 1F51E 1JG7A 3GFBA 2Q1ZB 2V9PA 2VO1A 4DJ5X 2X3UA 4HRVA 3T54A 4EJUA 2P6SA 4AWBA 4HZIA 5CNMA 4JP0A 2DZDA 3TZKA 3NTOA 3WO0A 4I66A 1GXSA 2DTEA 1USIA 4YALA 1HOMA 1PT9A 2GLXA 2Q6TA 1R6RA 1K5PA 4BBZA 4KVFA 4TXNA 1GTSA 1GSAA 4RD6A 1NG7A 1XCOA 4P5PA 3NUGA 4NICA 4BFWA 2Q2NA 2WF8A 2XB4A 4P84A 4WXYB 1RZ3A 3JRFA 5BQOA 2NXWA 2YVUA 3JRBA 2PMCA 1WIWA 2YPRA 4LRWA 4LB6B 4CG0A 1E9CA 3R20A 4G3XA 3H2KA 1K92A 1JDUA 4K6FA 3HM5A 1KAHA 1SG9A 4JZYA 2UYQA 2FR8C 5FKLA 5L53A 4KGXA 2R97A 3PKJA 5TT1A 4CM3A 5FLVA 1C3XA 5CQGA 3E0XA 4ZVMA 1KY3A 3DT8A 3GFOA 3LQ2A 1UT6A 2M0MA 4FGKA 2WJYA 2QZ4A 1GVDA 1FCJA 3NAMA 1SOVA 1JIUA 1DBPA 4UAVA 4A92A 3N4MA 1ZBDA 3KQUA 3E9NA 1L2TA 4L28A 3ZWXA 1RZUA 3TQFA 3DFZA 3A6HA 4RK6A 2A5YB 2QU8A 3LK7A 3L7LA 3A6FA 2M5WA 2VDOB 1TZMA 4ZTUB 5IT9A 1YZ3A 5DM7F 3T1NA 3T3NA 3HDDA 3JTHA 4QBIA 3C5WP 3DF7A 3KOUA 1OFUX 3B1YA 3E9EA 1HLPA 2WWHA 4MGKR 4RMGA 5LMZA 5H3HA 2KRFA 1N2JA 3RFCA 3GEEA 4TVOA 1OYVA 5BPIA 2CEKA 3BE6A 3WDLA 1JEEA 3GOHA 4FQ8A 4QYSA 4UM9B 2ERCA 3NH9A 1J2EA 1QPGA 2HOQA 2WHXA 1JHDA 1Z0UA 2QRVB 4ZIRA 4A3EJ 3B6CA 1HQYE 3A32A 3AVOA 1DIBA 1L7OA 4AJLA 3NIDB 5KNBA 3JALA 2K9LA 1YZHA 1LBQA 3D9QX 4TXMA 2PLAA 2WWFA 3MF4A 4HQEA 1MRSA 5BWOA 4CICA 2OGUA 4ND8A 3GLFE 1K7EB 1DMRA 1WD7A 3FOAA 3HI6A 3K0BA 2BKXA 1RI4A 2P2SA 3F3YA 3GRYA 4MEXF 4LK1F 4W1RA 3ZJVA 3OE7D 5F21A 3DV9A 5IASA 4BVHA 3LWDA 5HOEA 2X9VA 4XEUA 3DM5A 4HH1A 2UYOA 3T41A 1E7SA 1JJ6C 3W5DA 2EDAA 1Q6YA 3J81A 1TXGA 1B1AA 1R6TA 3ZD7A 2UZKA 1NBEA 1GTZA 2MTBA 4DV4B 3CUWA 2GUWA 4X0GA 3PM1A 4BCBA 3QY0A 4F5EA 2D13A 3ZXXA 1XZLA 1XMSA 1E18A 2PG3A 2OFPA 4RJTA 3RIXA 4F3QA 2VYNA 3AEKA 3A9WA 2A0WA 3UQYS 4M87A 2EYQA 4GBJA 4ZKEA 1L7PA 3E3AA 1KI3A 3L6OO 1GPKA 2JS7A 2P2YA 4G84A 4CFZA 2ZRLA 4YASA 2ZYGA 5CK5A 1Y1RA 1ZY2A 1G6NA 3OQBA 2GDZA 3SR3A 4DZRA 2JFPA 2IHYA 2E1PA 4NYMR 3OS0A 2IYSA 1LX6A 2NWQA 2AD5A 5GGYA 2IWHA 1MF7A 3I5UA 2Y27A 3FA2A 2IDJA 3PL1A 2AWOA 3FF1A 1X7ZB 4V1CB 1WY7A 3IPAA 3CSDA 3JQCA 3G1OA 4YRAA 5LD2C 4EH1A 5MN5A 1KK2A 1MXHA 1F7VA 3V42A 4KUMA 1GUAA 3WTWC 4NZPA 3RF6A 3ILXA 3LFUA 2NOJB 3OZ7A 1SUFA 2FWPA 5EAIA 2GF0A 5FO0A 5JOQA 2Z5UA 3C4VA 1E2JA 1UBUS 1MNEA 4CDGA 2ERYA 1KPGA 1GGKA 4HT3B 1YR7A 1YRQA 3BWDD 1BCRA 1QYCA 2XRLA 4JJ6A 3P52A 5A4JA 4YCLA 3CMCO 2G63A 2VHCA 3WLQA 3B3FA 4MDFA 2FYTA 3Q9LA 2FUCA 2C04A 3AKDA 1H65A 4BTVA 2IA1A 3IE0A 2X51A 2RAFA 1N77A 1KU3A 1G8JA 3O1HB 2QU7A 5K0ZA 1KI8A 1EP9A 5JCZA 3VR5H 1SM4A 4TZTA 5JU6A 3E9RA 1AKUA 2RG1A 1KBQA 3NP9A 4I1VA 3F9IA 3F72A 1NG6A 1IL0A 4EJWA 1KOJA 4B5LA 2B7BA 5C1IA 5CFZA 1U0RA 2I3DA 2P9CA 2XKJE 4PLWA 1A1SA 2W6MA 2DE0X 1PQUA 4TS1A 1OFGA 3BHNA 1Q21A 3U9LA 3QA3E 5F4BA 3F5SA 3UO8B 2WJJA 1CEYA 1HSOA 3M5PA 1BS1A 3EPHA 1TPYA 4I01A 3V1UA 1JI0A 4GL2A 1ZN9A 1SU4A 2PMDA 2R60A 4RTKA 4EGAA 1DDIA 1ADJA 2YJ6A 2YNMD 4WFKA 3PC6A 4MP3A 2W93A 4LWQA 3Q7SA 3UWDA 3RR2A 1WMDA 2X6TA 3MHTA 3OCJA 1I50J 1W581 1KQOA 3DO6A 1IUOA 3T8YA 1UMDA 3BR6A 1ZISA 2VA9A 5HKKA 1HPLA 2Z0MA 4YUVA 4G56A 1N0VC 5DN6A 3PFGA 3N2EA 4TMVA 1XVAA 4L3WA 4MGHA 3IOMA 4OGWA 4XMYA 2XB0X 4G5FA 4OSEA 1E4OA 4YFYA 2VRBA 4ZOEA 2EJBA 1I4OA 3H9QA 4JA0A 3R9KA 4BLSA 5IJ9A 3AJDA 3E05A 1WJEA 4MH0R 3AZQA 4RTOA 3K70D 2C78A 1JEJA 4GKBA 4UARA 2NU6B 3E81A 4BNKA 3G1TA 3T1VA 5TVGA 2M45A 2HCBA 5K0JA 4ZVUA 5KJ1A 2VWQA 4ZDKA 3EXIB 2IV7A 3VH4A 2FCAA 4OYLA 4RPIA 3FGOA 2XT6A 1JQLB 3LP6A 5CAEA 4S1OA 3C18A 1N7GA 4B4WA 1XRNA 4GEGA 3R7BA 1KU6A 3CMYA 3I4NJ 5LP1A 3L05A 1BDBA 3FTDA 2AYZA 2QTAA 1K2WA 4RFSA 3CBGA 1KNXA 2R6R1 2NS0A 3ZIUA 1FNSA 3F90A 3TMOA 2GXQA 1BMQA 3WICA 3HA3A 5D5UB 5JH7A 4ROSA 4P83A 1UFKA 3QFFA 5K8CA 1AKNA 1BX0A 2CY0A 3WLTA 3RUDA 1EUDA 1ITZA 3A4YA 3NT5A 4PGMA 3D7RA 4Z51A 1UJBA 4DUYB 2X9GA 4CQNA 1JLRA 3NI2A 1OBVA 3COVA 2RC5A 3HYSA 4QTUB 2HNKA 2BN4A 2VASA 1GRNA 3FCEA 4Y8VA 4AIIA 3GGGA 2JASA 3BIWA 1EX7A 2KLOA 2HDCA 3OYLA 1QVVA 2W2TA 4HTFB 4QDXA 4OHVA 3W6NA 3WXMA 4ZHQA 2PDAA 3Q3IA 4JP3A 3CH5A 2Q46A 1UDCA 2WPNA 5I4CA 4AURA 5FH9A 1OLOA 3FYHA 1X8LA 1AKYA 1HLFA 3DXFA 4OXIA 4ZOAA 4V39A 4Z9FA 3VO2A 1HNXB 1TJPB 1FUIA 4DMFA 1P31A 5TJHA 4B84A 2IYLD 4MPRA 3V80A 1P1BA 4JGIA 3TRJA 1VFPA 1Q19A 3U1DA 4BPRA 4B4OA 2YDXA 5CGZA 1Z6ZA 5KCMA 3OC6A 5JCJD 1TCBA 2P3LA 1BS2A 1KYWA 3ASVA 2BJHA 4IUBS 1FMJA 2I34A 2Z3YA 4FFOA 1A2QA 2PM8A 2XNDD 2TRSB 1C0LA 1QVTA 3HDYA 4MPTA 2PVPA 1K68A 2BUBA 4JI4B 5FRDA 3PPVA 2WT9A 5C8VA 3H5TA 3Q11A 3CURA 2AXLA 3IP8A 1Z5PA 3VC2A 3RKSA 2DCEA 2R2GA 4C30A 2GJSA 3MWJA 1TIKA 5FWAA 1X74A 1UAYA 4MUXA 3VU1A 1Z21A 4BQEA 1CSEE 3NHYA 1W9HA 4WNAA 2BMEA 1TVCA 3LBYA 1QGAA 2GXUA 4YRGA 4QOHA 1SD5A 3RU3A 5H3CA 2YJTD 3R9XB 5BW4A 5F5NA 3TX2A 3J80A 5CBPB 5D5VB 1U9IC 1FL9A 1XI2A 3OY2A 4K6CA 5CPBA 4XDGA 2QDXA 3NHWA 3KEYA 4P54A 4H9GA 2CXSA 2YQ4A 3K8ZA 3V8NA 3VZSA 3KSMA 3QLJA 2OENG 3RIYA 2MMCA 1HUQA 4NPCA 2ZSHB 3V3TA 2F3SA 4ZALA 2BR4A 1D0XA 3DJYA 3VJRA 1BN7A 1STZA 3JARA 1Z6RA 4PFSA 4TT3A 1QAQA 3PE6A 2RGGA 3CW2A 4O33A 2YCLA 4M36A 2UYCA 3WL8A 1WSAA 2NZ2A 2WV7A 4RGBA 2FPKA 3ZKWB 3TOAA 2BFDB 2QGNA 3SMVA 3G2HA 1JLLB 3JD4A 4EW1A 2R7XA 3H4TA 5AW0A 3LSGA 4HQKA 4LYEA 2ZI7A 1S72I 2BV3A 4AYXA 4XL9A 2F1IA 3EZ6A 1MT3A 3K53A 4I50F 2WINI 2WM2A 1TJ5A 2PSEA 1NL3A 1ZVJA 2LCQA 5HEKA 3UFXB 1NSFA 2A2ZA 3BJZA 4JJ4A 1LVUA 4YCBA 3DR3A 5LQMA 3PQ6A 2ZSJA 4TMFA 3E8MA 2WJPA 1HNWB 1TCVA 3A0HC 3MLEA 5LOVF 2BVNA 2KKOA 4HNSA 1J0CA 3NXKA 3EUEA 4D4IA 3TLEA 1WPGA 3C6KA 3A25A 1Z5ZA 2PSHA 5JNWA 1SFKA 3KSRA 5AO9A 1Z5UA 2HMSA 3K1YA 4O4LA 3HCDA 4R31A 2PV7A 4JMPA 2ZK7A 1GCIA 2Q2EB 4BBSJ 5ALEA 3BJRA 3EDQA 4KQCA 1EZ4A 2FKAA 3KTOA 2R1ZA 3LLUA 1PEKE 5C4XJ 4EYSA 3D5SC 2GZAA 1DWUA 1UQUA 3D1JA 1D4AA 1QG0A 4D9BA 5DGIA 4N3GA 2VCYA 4WCVA 2NO1A 1TQ6A 4UXJA 4W5OA 1AV7A 3B6AA 1SQ0A 1ORKA 1E0JA 1JDVA 5B3SH 4L78A 1TTYA 2YV5A 1NJ8A 2IVFA 5KI6A 2O5EA 4W7HA 5JMPA 3M4ZA 3B78A 3BCUA 3DT6A 1UJ5A 4WHMA 3EW9A 1I7SB 4AM3A 4IIHA 5CEEA 2PKQO 1RZ4A 4ARUA 4PQRA 3O90A 2F00A 2O2DA 1KS9A 5BRNA 2ZW9A 1YOVB 2PQ6A 4LOLA 1FPMA 2GWHA 2BMDA 1BHJA 2QRKA 2WAXA 2VNHA 1FNNA 3DMGA 2C29D 2QQFA 2FOKA 3SNHA 2WPDA 3E97A 3IAAA 4YLEA 2KHMA 3ZNPA 3EEOA 3CCSI 2CDAA 3JD0A 3OVMA 1FSEA 1HXDA 1UKCA 1FXWF 3RS4A 3JAMK 4UULA 1IXSB 2FWIA 3HI4A 1U3UA 3E7PA 5DBOA 4II7A 3PSHA 1C7IA 1EWYA 5A4IS 2FSPA 1TYAE 5FRMA 3DL7A 4WKPA 2NADA 4AIHA 3PICA 3V4FA 3FLBA 2VHJA 1DUIA 1I27A 3S2YA 4IDPA 3BOQA 1RAIA 1XRLA 4NP6A 1KZYC 3VPAA 4YP6A 2QTHA 4DCSA 4MVJA 2PZMA 3HY6A 1J39A 4DUGA 2QR5A 2ZSIB 1Q1EA 2XECA 5CXUA 2HBZA 2VSFA 2ZUEA 2XUDA 1SC3A 2HA7A 2GB4A 4YCSA 1EX9A 1KYZA 1JGSA 1GPUA 2BCEA 3V5NA 2ID7A 4OHYA 3BA1A 5B36A 5IWAB 3CJRA 4U7DA 4MP6A 1KOLA 7MDHA 3DXYA 1GGNA 2X7HA 1TZBA 4MNTA 3CUQB 1N1MA 4X85A 3CRRA 4BACA 4Q9HA 2O03A 2PEXA 2FWJA 1YVPA 3OPVA 1V43A 2R7MA 3JY6A 5FNVF 1N6HA 2LGJA 4G0WA 4MICA 2PX5A 2AKAB 1B42A 1GGMA 2CQKA 4EQ6B 4V0SA 5IBCA 1HDYA 5JBNA 4WADA 3V7UA 1Z0SA 1YZLA 3BPSA 4XIJA 2GA8A 4XWWA 4TVKA 3IKTA 1AKHB 2MINB 4BE2A 4CG2A 2P90A 3VUFA 4DQUA 2RQQA 1XGKA 4S35A 3DKYA 4INOA 5KB3A 3SZPA 1GFIA 1V9SA 4WBNB 1X7ZA 4V1CA 2D74A 5IFLA 5AVTA 5FBKA 2L9SA 1KK0A 1CY4A 3TCXB 2O48X 2VUUA 2VAMA 3L7JA 4ZC8A 3RSOA 2XZOA 4FGUA 4BY7J 2IAIA 5H1YA 1W7AA 5KNDA 1W1UA 4IOCF 4DR2B 3MG9A 4N4NB 4KN8A 2OJED 1REQB 2OCGA 3R0QA 3W2WA 5JYDA 1ZITA 1XZIA 4CIXA 2EINH 4X1EA 1Z29A 3RDIA 1HYEA 4FHDA 1GCUA 2OB1A 4EA6A 1CQZA 1FW8A 3DZ8A 1EDZA 5LQNA 2EFJA 2OQIA 3MIZA 4DT1B 5KAIC 1ZK8A 3RNOA 4AB1A 5E3MA 4F4HA 4BJHB 3EF1A 2R7ZJ 4PQFA 1R1VA 3QKUA 3SX2A 2ZNZA 4UQPA 3I39X 4UREA 4MYHA 3KJGA 2BDEA 2DQKA 3BKWA 1FEXA 4HDCA 3FK6A 4JGGA 2VKTA 5GV7A 3TWOA 3HACA 1B1CA 1Y3IA 2XPCA 3M1YA 4QHYA 2BBSA 4DARA 1JU9A 4OAPA 4DV3B 2E5WA 2B0CA 1AKTA 4NRDA 5IYBJ 3N9IA 3GPLA 1F1BA 2R5FA 4KR2A 1KAOA 1MX5A 1AKQA 4F55A 3A1CA 1SCUA 1ZK3A 3HL4A 1EP1B 3FLMA 3HRKA 4LKOA 2ICAA 3PJFA 4AKEA 1EVYA 1DINA 3L4BA 4P7FA 1PVEA 3URKA 4PSUA 2IUYA 2CWEA 4ZO4A 4ENTA 4IXNA 4J0KA 5AICA 4YGYA 4I36A 5BV2P 3IOYA 5CEJA 1NLYA 1H0SA 2X0FA 4CV2A 4G0VA 4PHGA 2JPBA 1PFVA 4P6VF 4QT4A 5HIKA 3O1IC 4KJZA 1CXZA 4N01A 5AK0A 1YA6A 1F17A 4MS3B 2M2IA 1DXYA 1OYYA 3OU6A 4XR4A 1UEIA 1M1UA 4HGRA 4NCNA 4M9CA 4KE6A 3KCNA 3HJUA 3W6OA 1FTSA 1DZIA 2QN7A 1G2PA 3KCCA 2P5UA 4H7EA 3OTOB 3WTBA 2I71A 3PXBA 4ZK2A 5JC1A 1EFTA 1OWLA 2AG6A 4RWEA 1A9ZA 4DDMA 5GWXA 2BM9A 4OMFG 3OYKA 4KBYA 3S8YA 4J4BA 3QVMA 4NYIR 2DMQA 3FFTA 5A4FS 5A4KA 1Z6XA 2DFEA 5DTDA 4YJHB 1PVVA 2FRDA 2FVXA 3T12A 4KNVA 3SZLA 1X3LA 4PONA 3IP6A 5B7GA 3HZHA 2VSXA 1ZINA 4DSAA 1MDBA 2P9GA 1LLCA 1GWNA 4BRZA 4BLRA 2JFXA 3A05A 4PIPA 1II0A 1WXWA 2WAYA 2UVPA 2D0DA 4NIMA 5AMXA 2DI3A 2OD5A 1F6DA 3D8RA 5FRNA 2QRQA 1WWKA 4P0PB 1HY3A 4L0DA 3T7SA 4F9EA 2AQHA 2XMPA 1P4XA 4FC7A 3AI2A 4MV7A 2H4XA 1TLHB 3RV3A 4MOWA 3MMXA 2YV3A 3ZXUB 4WI1A 4MKZA 4ALNA 1GXSB 2P69A 3ETEA 5HODA 3P5BA 1IJWC 1Z13A 4ZPJA 3LT4A 3SM3A 4RVOA 5JMTA 1D2EA 3KJHA 4HNRA 1E1QA 4LXHA 3QNWA 3DWFA 3WK9A 2XYRA 1WPQA 2PKCA 1YQAA 1YONA 4MUGA 3WB2A 2IXGA 5KHDA 1XXHA 3I54A 3QVWA 4DJJA 5CTAA 1N0IA 1XTTA 2JGRA 2VR1A 3M8KA 1ZUIA 5HS7A 4JR2A 1RYMA 1GUFA 4HTFA 1B00A 4CFYA 5A04A 4YMTA 5T8KC 4C3JJ 3K4KA 4ENRA 1YZTA 3GL9A 3WLIA 1J90A 4P5DA 2JGNA 3PGMA 1IN6A 1V5FA 1U1DA 3CXUA 5L95A 4RW0A 1NY5A 4IWNA 4IHSA 1SXJC 1UK6A 1PNVA 4OBXA 5AUPB 3U4DA 4ZMBA 1QVWA 1XNRB 3VU0A 2IEBA 2XTZA 3QFRA 1FTQA 2ZIUB 4Y6GB 2GETA 1EGHA 2VNAA 3E5XA 3NDIA 2R48A 1CUEA 3T1HB 4WWHA 1Y1VJ 1WZEA 4MW4A 4IO9F 4H1HA 1Z2DA 1RJFA 3F4LA 2P1ZA 3ZVLA 4C14A 3HA5A 2IW5A 3QE2A 3K5IA 4ZT2A 3UMCA 4BBPA 3UC5A 4XQCA 4KA4A 5CFQA 1RJGA 1J8FA 3MTAA 4UTPA 5C53B 2VNKA 5FLMJ 2OZPA 4N41A 3HE3A 4UNIA 2N9UA 4TV7A 5E4FA 4K2EA 1JNYA 1SU6A 2GSDA 3RAJA 3JCUC 2P9HA 2FQYA 1W7PA 3MVPA 3I9V6 1AHHA 1WCWA 3EUAA 1J0BA 1VHTA 4G12A 1AF7A 3DL0A 2P3SA 1TLLA 4LRTB 2CLLB 4GI7A 4G4JA 1PR5A 2PTHA 2VQ6A 3O3OB 1ZHFA 1F5SA 4ND8B 2CE7A 2RK4A 3BGSA 1LE8B 1X2BA 1XQYA 1MA0A 3DLAA 2QRLA 1OROA 3QWFA 5A06A 3PVCA 2ZYAA 1E3MA 5JARA 5TMEA 3IBTA 3P7NA 1K5GA 1EVLA 3HZZA 4JCCA 3LDUA 1QQBA 1E7RA 3LRTA 1JG3A 3QVJA 4UHEA 1VOTA 3TTTA 4W5HA 2Y30A 4HQRA 4AAYA 4I3HA 3DTEA 3GVPA 4OQZA 1C0EA 1X0XA 3WHCA 3F5FA 3Q7TA 4M6VA 3MPUA 5J43A 1YDEA 2HYGD 2W6IA 2A5LA 3PRYA 3ML6A 3NKFA 3LT1A 1HX7A 3K31A 1U31A 2QN1A 2XAAA 2GASA 3FXQA 3KIOA 4WNIA 2WU0A 4LRUA 4KE9A 2GF9A 2WUFA 3PL8A 2OBXA 3DEWA 2EW8A 5CB4A 3A9SA 1NHGA 5AM4A 3F8BA 5L3QA 1VA4A 1QGOA 1UB9A 1WMEA 4YHBA 4A93J 5CA0F 3IURA 3OBBA 3VOAA 4AN0A 1VSUA 4KPUA 4ND2A 4S2EA 4DV1B 4ETIA 4DR3B 1QC5B 3OPXA 1OJLA 5EMLA 4IV5A 2QMHA 2D3WA 1JLLA 4ZDIA 4CU5A 4ENMA 4XYLA 1GAEO 2IYRA 2MG4A 3HXQA 4NTZA 3UFBA 1SVSA 1AQNA 4Y6PA 3K09C 4D9KA 1BEUB 3OUZA 3G73A 2ACJA 2Z8YA 2NVXJ 2HNAA 3KP5A 2XSZD 3SNKA 3V7NA 1X7GA 4F3CA 1R37A 2PUWA 2EDCA 3UFXA 2PLFA 1YZNA 2D1TA 3WOVA 2A5DA 4KE8A 3CLKA 4UHJA 3MHPA 1FMCA 2W6CX 2AUTA 5DKFA 1KMNA 2PLNA 1GZ6A 2PMHA 1GL9B 3I2YX 4UHKA 1U2RA 2P6RA 2MSWA 4JT2A 3IUNA 3WFIA 3T0YA 5JMOA 2HHCA 4KQ6A 1B9NA 3CONA 1RE0A 1GZSA 1Q12A 4JITA 4MA4A 4R41A 4RB1A 3CKMA 3DAFA 4CQJA 2I7VA 2K85A 1OWOA 1AZLA 4FN4A 1Z33A 2Q2EA 1XC5A <