3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
b'TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
3GFIA 4MEXF 4NECA 3NVKI 1OKRA 3ZMZA 5FWDA 3NWEA 1G3TA 2H6CA 4F86A 1EH6A 4RGXA 3O3KA 1BC7C 1HMYA 2ZZKA 2QVOA 3K9TA 4QVKA 5T6BA 1U5TC 1G6NA 3F8BA 4TV7A 5LEKA 2UXXA 4CKBA 2DPMA 2VN2A 3R9XB 2HZTA 2YQZA 1OYIA 4YV0A 3E6MA 3HRSA 4ESJA 1BC5A 5EKUA 2JPCA 2QRVA 4ER5A 4MQVA 1MKMA 1RI7A 1UCRA 3RPUA 5E8RA 4M73A 1FYMA 3KPWA 3LQQA 3SQNA 3DLCA 1W7PB 1WY7A 2IH4A 2PGXA 3HTUA 2IT0A 5DPMA 2K4BA 3LQRA 3WTZA 1ZKDA 1XXLA 2C7PA 3O4FA 5FUBA 2RQPA 3I58A 4HGYA 3DFGA 3RIEA 1YW7A 4KIGA 3TQSA 2EV6A 5K0FA 3TDUC 3FZGA 5IH3A 3N4MA 1O9HA 5E9JA 2Z3YA 1HSJA 1NE2A 3KP5A 5HLHA 1NT2A 5GP1A 5BOXA 4CXFA 3JWJA 1HKQA 3ZMDA 4NB5A 5E8IA 3ERCA 3B3GA 3IEIA 1AF7A 2BM8A 3TGNA 1H9TA 3OFKA 2MLKA 2O07A 1RI4A 2IH2A 4UVBA 1IN6A 4XLNF 2E7XA 2O05A 2DT5A 4KMUX 4BH9A 1BI2A 1R23A 4R6XA 4RB2C 3QP5A 5E9WA 4BHPA 3TLJA 4OBXA 4P7GA 4UUVA 3TM4A 1BIBA 1ZARA 5DUKA 5K0JA 3HTXA 4ER0A 2LF8A 3M6VA 1YTYA 3FPHA 4HTFA 3FUVA 5D8LB 3WE2A 4UVCA 1XSVA 4PGHA 5T67A 2P1DA 3HCFA 5LQKA 4M74A 3FUXA 4WXHA 3IHTA 5E2AA 2EFQA 5LHGA 4EJUA 3K2ZA 3BJAA 5E8GA 1YFHA 3THSA 4RTSA 3E8SA 1OYWA 3DMHA 5D1NA 3TKAA 3VB2A 1NW7A 1F4KA 1P6RA 3HTSB 4E2WA 2HGCA 2G7UA 1IZ1A 1FBUA 3TOAA 4AIHA 4HSGA 3A27A 2E1CA 1O7FA 1FX7A 3CVOA 1QPMA 1XGOA 3NMUF 1QGPA 3ERED 3UBTA 2BH2A 4KVZA 3EVCA 4RGUA 2DAOA 3L9FA 1BOAA 3GWZA 1REPC 5E2BA 1UHMA 4O5VA 1LJ9A 3PTAA 5DV5A 1S7AA 2BR4A 5EOVA 1KPGA 2GAFA 3BPXA 2V1XA 1RJEA 1XJ5A 5CVVA 2OZUA 2PXCA 4EJVA 2P40A 5GM2A 1VLMA 1I6XA 4WK8F 5ED4A 5DT2A 2YXDA 2HFHA 2DW4A 2JPBA 2B3TA 2A69F 3IRRA 1I1GA 2IBTA 1XN7A 4AWXB 5BW4A 1U2ZA 2Y48A 2NYXA 2UYQA 2A6HF 4M9ZA 4MGRA 1QAQA 3WSTA 2ZBKA 3DXJF 3P9IA 3H92A 4X41A 2GXBA 3ULQB 5FD5A 4XRFA 4HZFA 1DDNA 1VBFA 1W5TA 2ZNYA 1D8KA 3G88A 2JJQA 2DFIA 5K5RA 4KICA 2ZTHA 3MFKA 4PDKA 1NHAA 4IJAA 1SVUA 3QOPA 4XUEA 5DM0A 1RIOH 1JQEA 5EQJB 4G8XA 4OIPF 1OMIA 2X0LA 2P5VA 1NW8A 1WXWA 4YUVA 2Q41A 5HLIA 4L9NA 3WODF 1USTA 3EETA 4QDJA 5FLXZ 1E2XA 4DF3A 3J7AO 4EJTA 1P39A 1AQIA 1WKMA 4MHTA 3RKYA 2ORED 2UZKA 4LLNA 3C7JA 1BI0A 2HTSA 3ORHA 4BHBA 4KDRA 3IL2A 1ODDA 4E33A 1HQCA 3ELKA 3KR2A 2YX1A 4CXMA 4UV9A 3MB5A 3R6SA 4L9JA 1BBYA 2ZJ2A 1T0FA 1YS6A 2Y1WA 2A14A 3GRZA 1YG2A 4XBFA 1O3RA 4ER3A 3T5XA 5DDGA 1Z91A 3I9FA 5DRTA 2ESRA 2ZBPA 3HSFA 5HS7A 3A26A 4PYQA 2ZBRA 4ZYGA 3CLOA 2CO5A 3OV8A 3UA3A 5EMKA 4A0YA 4I98B 1WWXA 1WQ2A 2C7OA 3SZTA 5IT9Z 2CMGA 2YPRA 3C0KA 4PINA 4CWAA 1G3YA 1ONVA 4LG0B 1UFMA 2HKXA 4CO8A 3M8EA 4U0WA 5HVQC 2P8JA 3F21A 3FYCA 1ZN2A 1JSXA 5FO5A 3OFJA 2A6EF 4WVLA 3A4TA 4MTLA 4RTNA 4ATNA 1V4RA 1R5HA 3NDIA 2C7QA 3C3PA 4Q48A 5EC8A 1FSEA 3VC1A 2O03A 5KQRA 2H6BA 3J81K 3R6TA 3J80Z 3EYIA 3L2CA 2KRFA 4IRIA 1SG9A 3ME5A 3R0QA 1P1CA 3VC2A 4FX0A 4ASNA 1SUSA 1TQIA 4MTDA 3A7EA 4P9UA 5HOQA 1RZ4A 2FMLA 4FT4A 2JRTA 1B9NA 1EV7A 4L9TA 2AN3A 1G3WA 3T7TA 2IPQX 4KYWA 3VSEA 1J75A 1TW3A 4Y17A 4AIKA 4R79A 1ON2A 2O0LA 4BHCA 5C1IA 1EG2A 1JTFA 4GC5A 5A2QK 4E32A 4HRAA 3ELUA 1YIOA 5CVEA 3UJCA 4CGZA 4M7RA 1FBQA 4YFKF 1K79A 5FHQA 5K1YA 1AV6A 2PVCA 1LEBA 2JH8A 4A0ZA 4V0QA 1Z7UA 2EFPA 2CW0F 1KA8A 1R1UA 2NXCA 9MHTA 2FA5A 3I59B 3BWBA 3F8CA 2JSCA 5KVRA 4M6XA 2MLGA 2FU4A 2XRNA 3LA2A 2D1VA 3F8NA 3EGEA 3CDHA 3HVIA 1ZRCA 1TPYA 2KIMA 3KPJA 3IWFA 1U5TA 1M0EA 4KDPA 2EJRA 3KQPA 2D45A 2J5OA 1IXSB 4G6DA 3E6CC 2VONA 5L3CA 4CDGA 1DL5A 4FZVA 3OU2A 1Z6RA 2OA4A 2QQAA 1OPCA 2XYVA 3O2PE 1P2FA 2MC3A 1N7IA 2OAZA 2XKOA 3JAMK 3B73A 5K05A 1MD0A 2VDVE 3CJQA 1NW6A 1J9IA 2AS5F 2PMHA 3FUWA 4RTMA 3EVFA 4HAMA 2OQRA 1XDSA 2V74B 2PSSA 3EPPA 2QRVB 4IHSA 3X0DA 3RKXA 2CG4A 2P6SA 5HEKA 3GNLA 4ZYDA 4YUXA 5DX0A 2ZO4A 1EIZA 5LHHA 2AOTA 5K5OA 4AZTA 1D5VA 2GA9A 5H6QA 5EHIA 1RJDA 3NRVA 1FSHA 1UHWA 1Q1HA 3KR0A 2QUFA 4U88A 4HDVA 2WTEA 3ZQ7A 1EH7A 3HVHA 3HA5A 4DNCA 2VBZA 2W57A 2AOXA 1FP1D 2G7HA 3NW9A 2O8XA 4HQEA 1MZBA 1ZYRF 4JXJA 5JFRA 4EMSA 4EV0A 3CO6C 1VQ1A 3E5UA 2IA1A 2M8EA 5K0CA 2R3SA 5J6XA 2R6ZA 2VBWA 5HS9A 4E70A 4YFNF 4KFCA 3KU1A 4PWYA 4C08A 1YS7A 2EFOA 5F1RA 3V8LA 4D0PA 1PP7U 4L5JA 1JQDA 3Q7EA 5FTWA 2I62A 5LQAA 1B59A 1MJFA 3QP6A 2ZZNA 5MHTA 1QANA 1MDMA 4G6QA 3FTDA 3HHHA 3BWCA 5ICFA 4H0NA 3R3HA 4QQKA 3BPVA 4CKEA 4HTFB 2OB1A 2HQNA 3GZ5A 2FPOA 4DKJA 1AOYA 1MGTA 2AVDA 3FMSA 3F8FA 4FSDA 4AUKA 4PYOA 1T98A 1I5ZA 2CKDA 2G71A 4E2YA 1BOOA 2Z6QA 4HX4A 3LSTA 1RNLA 2R7DA 1EQAA 4BLUA 4DZRA 3F6VA 3BWGA 4U0YA 4OOIA 2EJTA 5BXYA 3PFIA 4PCLA 3SX0A 3ZMUA 1P4XA 4Q47A 4ZZLA 4RS8A 4OIOF 2UXNA 1XGSA 3IKTA 2EG5A 5G02A 3M6UA 2PBFA 2WV0A 3CJTA 3LAJA 3FXQA 4PGGA 4QTUB 5F2OA 5HIKA 5HFJA 3ZP5A 3MAGA 4U7PB 2FRXA 3BOQA 1XD7A 1HSTA 4I01A 1R00A 1O9GA 3V97A 4N0BA 2PY6A 1S6LA 3FPEA 3GDHA 1FPQA 2IH5A 3DKWA 4QDKA 1G6Q1 1EAMA 3GFLA 3GXOA 3TMAA 4O6JA 1MJ9A 3G3ZA 3L00A 4I09A 2QY6A 3CJRA 2OQGA 1XB4A 3MGGA 2IJLA 3GYHX 3EYYA 5JVTA 4L0ZB 5E9QA 4M71A 3DP7A 4HV6A 4LMYA 4RTKA 3U2RA 3AXSA 2RKHA 3G2MA 4HDUA 3GFJA 2IBSA 2VBXA 2BYVE 2QZ8A 1O54A 5ICCA 4KA4A 2ZZMA 5EIFA 4ENNA 3F3XA 2FK7A 4OQDA 1ZQ9A 1KGSA 5DUIA 2A3SA 2CGPA 2LNBA 4FHTA 3BY6A 5JHUA 1HW1A 2O3FA 4RGRA 3KKZA 5EIWA 2IFTA 2ZSUA 2L4MA 3B3FA 5HDKA 2DK8A 3CCFA 5CCXA 3P9KA 3D2LA 3BKXA 5K8VA 5M5BA 2HYFA 3BWMA 5DCMA 5LEJA 4U7TB 1EJ0A 1R5GA 5J8CA 1J0RA 2HKOA 2NYUA 3TOSA 3LDFA 2GQQA 4RTQA 4M38A 5BMZA 2OB2A 2XAFA 5IKMA 4IRGA 4C04A 3CBGA 4OMZA 3DMFA 3KLOA 3HNRA 3OPNA 2YXEA 4EM1A 3ELDA 4BNCA 1IRGA 3NWBA 2ZMEA 1YZHA 2VOPA 1JGSA 3IYLW 3FMQA 2ERCA 3K6RA 3UZUA 4GOMD 1KQ8A 3ANXA 2RGVA 1X1BA 3F23A 2IP2A 5HS8A 1XDUA 2DLLA 3R24A 1SQGA 5DD8A 4I7HA 4RX1A 4G7HF 3COAC 3DV8A 1F38A 5H02A 1FNNA 4R8HA 1G4DA 2PMUA 4F7ZA 3T8RA 5DEQA 2P3OA 4G94A 3M7GA 5CVIA 1SD4A 3GO4A 3L8DA 2ZXJA 2P3LA 1KU9A 3MQ2A 4QQNA 4K6MA 4KT5C 3LA3A 3KQQA 3HEMA 4A2UA 3HCBA 3LBYA 4ZTBA 3SSNA 2BGCA 3NDJA 2KJCA 5DX1A 4QVGA 2Z6AA 1K7AA 1KR5A 4G56A 1KU7A 1FBNA 1FWZA 2DPUA 5L3GA 2IRFG 1ZH5A 2YVLA 4GBED 5EMJA 2L54A 3SHFA 2QQBA 2OO3A 4IV8A 2HWKA 3DXXA 2F5CA 3BROA 3BGDA 5E8JA 5CIYA 4M36A 3KEOA 2C7RA 1A04A 1D8JA 1R36A 4P7FA 3CKKA 5DXJA 4PIMA 2QENA 2VE8A 4XSXF 1PUEE 3HOTA 2QQ9A 2P6TA 3BGIA 5L3DA 5KS2A 3ZN0A 5K5QA 2I6GA 1QQIA 3JSPA 1YUBA 5E1WA 4XLPF 2VXZA 3QPTA 3V8KA 4ER6A 4C06A 3KE2A 4YUZA 1L3LA 3OZSA 1OR8A 2P4WA 4CZZA 4XSZF 3HCEA 4BLVA 2ZWVA 2ZCJA 2QWWA 3M1EA 5J8FA 1JG4A 1UFKA 1B9MA 2GZWA 2FF4A 1QBJA 3P9NA 2CYYA 4YMHA 5LQCA 3I0TA 3GFMA 4G7OF 4QPPA 5KQSA 4C4AA 3GO5A 2P5KA 2COMA 2W85A 2HTJA 2L01A 4CYDA 1R6AA 2B9EA 5DD4A 2K86A 1LVAA 1GVJA 3QU6A 3DF8A 2DPDA 2P7IA 3V8VA 2DQRA 3MEXA 4ESFA 1L9KA 3WTSC 1JTEA 4C05A 2ZIEA 3RW9A 2PG4A 2XGXA 4MHGA 3EMBA 2Q8KA 2A68F 3LKDA 3CC8A 3E6DA 2RC4A 5TJJA 1XGMA 1KHHA 2G1PA 4JK1X 5F6FA 3CTAA 4HV5A 3DTNA 3ER9A 1U5TB 1KYWA 3ZPLA 4HW0A 1B4AA 4S04A 2B2CA 3FXUA 3GRRA 4N9IA 2HR1A 4R8SA 4ON0A 3GVAA 4GCVA 4BQAA 2MH9A 5EHGA 1UIRA 3GUDA 3WGIA 5FLXK 3CGGA 3NQOA 3HSEA 2G8NA 5K0GA 4GQBA 3FPJA 5DM1A 1JSZA 1QYRA 4WCGA 2ZFWA 2B78A 3F72A 5TRDA 1X19A 1STZA 5AIPA 5BW5A 5L3EA 2KKOA 2PJDA 5E1DA 2XYQA 3TOBA 3DULA 1H9GA 3EEYA 1I1NA 2NXEA 3SZPA 3GZ6A 2VE9A 5LGUA 2P5LC 2PLWA 4A12A 2AOTB 3KP7A 3KEQA 4MTEA 4HF1A 4YMGA 3EVZA 1KU2A 4ER7A 1VTNC 3C1DA 2PWYA 1U8RA 2RDPA 3UJ7A 4QWQA 4NQWA 2ZFUA 2F5FA 1J7KA 3M6WA 2KW5A 4ETSA 2WA1A 3GRYA 4S05A 1O3SA 5DTRA 2GIVA 4X61A 1NKVA 2IIPA 3KQMA 2DBBA 2XYRA 4P55A 1TBXA 5EMMA 2OD5A 3AY0A 1FYKA 1OYYA 2DQLA 1NV8A 5IT9K 6PAXA 4RVHA 3F22A 4B17A 1T2KA 1QAMA 2OBFA 1PRYA 1MDMB 2FBKA 5D1HA 2YR2A 1VP3A 5LRRA 5EEHA 1HNNA 2XAQA 5CM2Z 5DM2A 2XBMA 1B6AA 3DXZA 3M9AA 3RI4A 3FTEA 5BP7A 1NW5A 2M1BA 2ELHA 1KYZA 4YG2F 5D5VB 1F9NA 3DLIA 4HOBA 4YFXF 1BM9A 3GW2A 4WWCA 2G9WA 3H3UA 1ORHA 1W4MA 5IT3A 3Q87B 1SAXA 2UYHA 3AXTA 3OE5A 1L3BA 4EM2A 4BAYA 3BGVA 1R74A 3LCVB 1XCBA 1SKMA 1SD6A 4FSXA 4HG2A 2ZCWA 3K1PA 2P8TA 3RIRA 5LR6A 2XKPA 2FSWA 2A61A 2M87A 3HRMA 1B1BA 4P58A 4ENJA 4YV1A 2FBHA 3JSOA 2MBFA 4KN7X 5EKXA 5H20A 3KQSA 1P4WA 4HYEA 3T8TA 2EV5A 4UOEA 2LDUA 3ELYA 1IN7A 1D3YA 3HA7A 2GWRA 2PXXA 2VDWA 3LL7A 2NP6A 3S2WA 5EG5A 1XDZA 1Z05A 2FQ3A 2IVMA 3KQWA 4OMYA 3M70A 4HGZA 3S68A 4L9VA 5CLSA 2JHAA 2UWMA 4H0EA 3FPGA 3JTHA 2YR0A 2HV9A 2ONYA 2XASA 2D1HA 4ISCA 3M33A 2R7FA 5HIJA 1IN4A 3CUOA 1GXQA 1EJ6A 4N9HA 2GAUA 3FX3A 4WX9A 3JW4A 2K7LA 1ZRFA 1ZGJA 4GXOA 3RPQA 4MQ4A 4MNUA 3ECHA 3PB3A 2HOEA 1ON1A 1YZ3A 4JBAA 4KUMA 2EFJA 4ZYEA 2Q2EA 4KIFA 1UWVA 3GLXA 5AONA 5FCDA 1XMKA 4PYKA 3OU7A 4XCXA 5ILVA 1LDDA 5CJ9A 1FLIA 3TO9A 1S7OA 5DCMB 4Y13A 4OIQF 2FBIA 1G8SA 2ESNA 4PIPA 1WG8A 2DK5A 1U6GA 3I4PA 1WS6A 2KIUA 1Z9CA 4CKCA 4OIRF 3DPTA 3TO7A 5K0EA 4EK9A 2JHCA 2RVCA 2FE3A 4E2XA 3MCZA 3VOEA 5ICGA 1YQAA 3A25A 5C9ZA 2GLUA 2VDUE 1YFJA 2ZMEB 2OU2A 2BZGA 3J81Z 3MCTA 5DTMA 3WE3A 5B1SA 4DMGA 4F84A 3THRA 1BI3A 2H11A 5FQOA 2NP7A 2O61A 1JR4A 1MHTA 5BPDA 4QPNA 3SGLA 5K03A 4LGWA 3ELWA 2RNJA 2O0YA 2O6GE 3O7WA 4FR0A 2EV0A 2Z99A 2G70A 3IC7A 2VP3A 2FOKA 2YXLA 1IM8A 4G9YA 3FYDA 3B89A 5KYGA 1KP9A 2ZKZA 1R58A 3HUGA 5EVJA 4KRGA 1I4WA 4KDCA 3K0BA 4HLXA 3TDZC 3UJAA 1G3SA 3LDGA 2NNNA 3WTVC 5GM1A 3C18A 4PYMA 1KQ9A 1JQ3A 1RI5A 2VODA 3SR4A 2HS5A 3LKZA 3V7CA 4Y2HA 2AXLA 2L3DA 1BI1A 2JHPA 3FMRA 2PX5A 4O29A 2E7WA 1QZYA 4E31A 2CMHA 3EVBA 1J59A 2YU3A 4E30A 1ORIA 1P1BA 5HLGA 1FOKA 3NVMB 2QBYB 1PDNC 4OA5A 2GB4A 1YF3A 2P35A 1QNTA 1WSUA 3NTVA 4CICA 1FBSA 2TDXA 2AOWA 1QO0D 1IXCA 3RYPA 3AWIA 3LX6A 3PLAE 3MERA 2F5EA 3C6KA 5JUWA 2XVCA 2W25A 3ISPA 8MHTA 5FADA 2PFBA 2F5DA 3JTGA 3UJBA 2P7HA 4C03A 1IN8A 3QPHA 1I27A 4M72A 3KP4A 5DM4A 2PV0A 3QU3A 1J2XA 2XAJA 3DEUA 2STWA 1XCLA 3HIFA 3E6BA 4I0BA 4HBLA 2DTRA 3WGGA 2WWYA 2QLZA 1PJZA 4BP3A 3HA3A 1OR7A 3ML6A 3R4KA 4BLWA 4IVNA 4DCGA 3E5QA 4EJOA 1CGPA 4IV0A 5E1OA 2NXNA 2ZIFA 3RYRA 2WA2A 1JXSA 4RV9A 3TRKA 4PZJA 1W7PD 2XVMA 2FEZA 1XVAA 4CTKA 2F8LA 3D0SA 2FYTA 1IY9A 5K0LA 1ZHFA 4M9SA 2P7VB 2JG3A 1IW7F 3QOXA 1UB9A 2UYOA 3KETA 4CTJA 4A5MA 1CF7A 1ZG1A 2FMYA 1RJGA 5D5UB 2WK1A 2MD5A 5D6FA 4FGZA 4GOLD 4ZZDA 2L02A 2JZYA 3QAHA 2YUIA 4FT8A 2BV6A 4YV2A 5GIOE 1LB2A 5F2NA 2GS9A 3KQVA 3KQYA 3R60A 1KU3A 2OXTA 2P7CB 4BP1A 3K1NA 2N47A 3DXYA 2BM9A 4PCAA 4GOND 3UJ9A 4KMFA 3P2IA 1SFXA 4EM0B 1FZPB 1FY7A 3KPYA 1FYLA 2FNPA 5HIIA 3F4KA 1TQMA 3G8AA 1LDKB 3LWFA 1D2GA 4JQFA 1VP9A 1HW2A 1SFUA 2CWWA 1JHFA 1VPTA 3VODA 1RJFA 1D2HA 1YLFA 3V4GA 1FJXA 3U9GA 1KPHA 2PJPA 1TW2A 3SSMA 4FS8A 5FHRA 2PT6A 2LKPA 4M37A 5ERGB 4GEKA 1H1DA 4EJWA 10MHA 4DQ0A 2IW5A 2XVAA 2IA0A 3QOWA 2FK8A 1U78A 1T43A 4LFUA 2ZWAA 2BEOA 3WTWC 4OA8A 4HA8A 3MWMA 4RB1A 3WTUC 4LK1F 4ENMA 1V39A 1S8NA 5L3FA 1T38A 3B3JA 3MTIA 3K1MA 3HYIA 1YW8A 3PFHA 2BR3A 2JT1A 2I9KA 1SMTA 2EA2A 3D5LA 5FA8A 3E5XA 3HOSA 1DPUA 3KR9A 4AX8A 4IKPA 5BQTA 1KQ0A 3BUSA 3Q9VA 2VC0A 3WTTC 4KNYA 3LPMA 3LBFA 3V7RA 3SXYA 5BS6A 3KCCA 4WXDA 2VOOA 5K09A 1BN5A 4LK0F 2CFXA 1R18A 4HX8A 1HBXG 1L3IA 3ZN1A 2FXAA 2ZULA 1Z3CA 4U7DA 5DXAA 1RI2A 3DPLC 4AIJA 3HP7A 3WU1B 3GF2A 4L7VA 4I02A 4KN4X 4QTTB 1BIAA 2BBYA 1Z1DA 2QYOA 3WU0A 5JI6A 3M4XA 3DMGA 2ADMA 1V3FA 3CJNA 1G38A 2K27A 1WZNA 2G72A 2VS1A 1KPIA 3GRVA 1LEAA 4LLGF 1HW5A 4GGGA 1XCJA 2W84A 2I7CA 3KPUA 2P41A 4DA4A 5FQNA 3C3YA 4M9XA 5EPEA 4LJZF 3ZMSA 4F85A 1WI9A 3G73A 4MEYF 2VZ9A 4IWNA 1MJBA 1TTYA 1NBIA 3LDUA 3G7UA 3RKWA 3BJ6A 4UXNA 2PX4A 1DUXC 1S3JA 2HYGD 3JWHA 3KR1A 5ILUA 3WTXC 5GINE 3MZHA 5E18F 2D2WA 3DUWA 5KK1A 1PP8F 1K78A 1LQ1A 2CSOA 1G60A 4LB6B 3P2EA 3P7NA 2QBYA 3G8BA 2EWNA 4EQZA 4OX9Y 1SUIA 4HX7A 3FPFA 3LA7A 5E20A 2FRHA 3ZMTA 4GF5A 2M45A 3JWGA 1LNWA 3E05A 2L4AA 4IPAA 1LDJA 3O6BB 4POOA 2AOUA 4RTOA 3BZ6A 4RVDA 4G7ZF 4X63A 3E97A 1S29A 3RJPA 2LSOA 1JG3A 5CVRA 3G2QA 5D6EA 5P8WA 5E17F 3GU3A 2OBPA 2IDJA 4BYYA 3TPZA 4FP9A 2FHPA 2V79A 5JR3A 4QLCU 4A6EA 1RI1A 3MHTA 4OU0A 4OINF 2AN4A 1D2CA 4EKGA 3PQJA 4I2OA 1YYVA 5CVUA 4A6DA 1H0MA 3PS9A 3KZZA 1U3EM 4RTPA 2Z5UA 3G5TA 3GCZA 2A07F 2E1NA 2V9VA 5GIPE 1R8YA 4KIBA 2HNKA 1HKTA 2XAHA 4GC9A 2Q0OA 5KVAA 5CCBA 3ZMVA 3EVEA 5LGTA 2ZBQA 3VFZA 4RGSA 3PQKA 3HVJA 1TLHB 1TNTA 2EFNA 5DCFA 2K4MA 1ZLJA 2IPXA 1IXKA 1U2WA 5DTQA 3FXRA 2Z9OA 4MWZA 2IA2A 1R1TA 5LHIA 1L3CA 3CUQC 1HKSA 5DWQA 4HF2A 3GGDA 4IXAA 3DQVC 4PYIA 2AS0A 2P3QA 4B09A 2NS0A 3IV6A 3SFZA 4RAYA 2YTZA 1BHJA 2PWPA 2YX7A 2DI3A 3IHUA 2M5WA 5DYMA 5L3BA 3FZVA 2DU9A 4PYJA 4OBWA 3EDPA 2HWVA 2ZNZA 3KFWX 2W24A 1C0WA 1ZLKA 2GPYA 5LBQA 4HLYA 1KXZA 3KQOA 3R61A 1O3TA 3E3VA 2AZTA 1IAWA 3G2PA 5F64A 3CO7C 1O3QA 3P2KA 1TQPA 3FHZA 1INLA 2V7EA 3P8ZA 1JHHA 4GUAA 4PYLA 3TKYA 3R0AA 1J5YA 1I1SA 3JWIA 4EVIA 4PONA 2UZ4A 3FWEA 3P71T 5F2KA 3W6JB 4FX4A 2XUBA 1M6YA 5FD6A 1ZGAA 3EQLF 3BXOA 3HCAA 3NEUA 2H00A 4Q4ZF 1IXRC 5E1ZB 5D4SA 2CL5A 3T7SA 1DCTA 5LQJA 5ILSA 2NNYA 4LECA 2HQRA 2YSRA 3HHGA 3MQ0A 1MJAA 1O57A 2ZIGA 3IRQA 2XV4S 4YIIA 2B25A 2HEOA 5HIMA 3IKVA 3I54A 1JE8A 3LHDA 4RTLA 3UJ8A 2B0LA 3EVAA 2LF7A 3Q5FA 3E7PA 2BE5F 3EUHA 4R8RA 3VEPA 5LRSA 3HVKA 5T64A 2X4HA 4L18B 4A0XA 5EGSA 1IUYA 4ZYHA 3SSOA 4XUDA 3J80K 2WC2A 4GYGA 2UYCA 1T6SA 2ETHA 3OU6A 3UWPA 3WTYC 3KP6A 4DQ2A 1AQJA 1BC8C 1IF1A 4RB0A 3FUUA 1FC3A 4EQQA 2IGTA 4L5IA 1F5TA 1X1DA 2BR5A 2GA2A 4IRHA 2XROA 2KIFA 3HCCA 4IF4A 3OZTA 3CUQB 3SM3A 5DSXA 2Z6UA 4MQ9F 1ZAOA 4LLLA 5EZSA 5HDGA 2ISZA 4R6WA 5LQNA 3GIWA 5GOZA 3H3ZA 2Y75A 1R22A 4PNEA 2HR3A 3T1BA 4P7JA 4AZVA 4YIFA 2ZW9A 1VIDA 5EZQA 2NNWB 4ENKA 1IN5A 5LQUA 4PYNA 2H27A 3BZBA 3PX3A 1W7PA 3P9CA 2QM3A 5FGMA 2EX4A 1CF7B 5BPIA 1ZREA 3GRUA 3HM2A 4I0AA 1HXDA 4WXCA 4RB3C 4LG1A 4LWOA 3BDDA 3L7WA 4NHJA 3AJDA 4RWZA 2K02A 3AAFA 2QE6A 2FCAA 1W5SA 5CYVA 5H6RA 2CQKA 2KJBA 4LD5A 3T7RA 3EMDA 2PQ8A 5DSTA 3KP2A 3V7SA 5K01A 4WF2A 3ER8A 3K0LA 2C6YA 2VT3A 3OOPA 3KZYA 3ABUA 1DUSA 1L1EA 3OZRA 3TM5A 1R8XA 4B8XA 2AN5A 2RN7A 3C6MA 2ZLBA 3LECA 4X60A 3HRTA 3L09A 2M30A 4HF0A 3FRIA 2OY0A 3OCJA 2PBIA 1BJAA 3U1DA 2E5WA 2ISYA 4KWCA 2EFWA 2F2EA 2PX2A 5EEGA 2XAGA 3UJDA 2NAZA 4P7KA 4P96A 3G89A 3KLNA 1ZRDA 1VL5A 3B02A 4UNOA 1E17A 4PCQA 3SXJA 3TO6A 1NV9A 3FTFA 3FUTA 1XSXA 2AR0A 2OPBA 4L0YB 2GH1A 3B7PA 3V8JA 3UFBA 2DO7A 1XMAA 4DM3A 3ECOA 3N97A 2GXGA 3REOA 2RV8A 2HMYB 5HDNA 2NXJA 5EMLA 5K0NA 3KPVA 3PX2A 5CD1A 2XHKA 5LQRA 4GYIA 3O31A 2VBYA 4AVPA 7MHTA 2ADUA 5D5WB 5D5XB 3G5LA 5FWAA 3GJYA 1GXPA 3K69A 2O06A 3I64A 1QAOA 3GX4X 1KIAA 4ESBA 5GWXA 1N7JA 3UJ6A 5CVJA 2NRAC 3W6KB 2H09A 4M6YA 3F6OA 1AWCA 3VYWA 5HZMA 4GOOD 2MA3A 5D4RA 4RSRA 1O7LA 3PT9A 1P4AA 5A2QZ 4OQEA 1P92A 4UHTA 4HH4A 5K0BA 1F3LA 5HOOA 2EK5A 1YW9A 1YFLA 3TR6A 3MTEA 4UV8A 3BT7A 1P91A 5C0OE 4P5OA 1XTPA 3TFWA 4RTJA 2VC1A 3RDIA 2OYRA 3I5UA 1R7JA 3SMQA 2LD4A 4BXUA 4EKIA 3IWZA 4LWPA 1F1ZA 2K4JA 5DRYA 3I53A 4UVAA 4C07A 4AD9A 1GHCA 1K78B 1XCVA 2V1UA 3NJRA 3FF5A 3MAJA 3PVCA 2ONZA 4MIKA 1FT9A 1ULYA 2PLYA 1G8AA 4LB5A 3EGVA 5AIQA 2AOUB 1Q0TA 4RYLA 4RVFA 3JAMZ 1NW3A 3GEZA 3U81A 1Y8CA 3HRUA 4YUYA 1T39A 5CUQA 1JG2A 2MH2A 3QRFF 1X1CA 2PX8A 4FT2A 2PEXA 2XIGA 3KP3A 2ACJA 2ESHA 4YUWA 2PKWA 3BKWA 2EB7A 5FULA 2PT9A 2CWEA 2ZVJA 4DCMA 3I71A 3CUQA 3ROUA 3EVDA 5DLYA 2EA4A 2AOVA 3QV2A 4HQMA 4Y15A 4KW7A 2A5YB 2J5PA 1SFEA 2V1DA 5ERIA 3TQNA 3DR5A 3G2OA 3KQTA 1X3UA 4X1OA 4EGYA 5LLQA 2JH9A 3BP8A 4BY9E 3HSRA 3LFKA 4ZH4F 4Q5SF 1L0OC 3DH0A 2Z33A 2OZ6A 3LAPA 1YO5C 4Z2YA 3LGAA 4U0VA 1DPRA 3R0JA 2O57A 2VT2A 4HC4A 2H94A 4LG0A 1WXXA 1IRFA 3F8MA 4AZSA 3A7DA 3T0IA 4EGZA 5FB2A 3FTCA 5FFXA 1X1AA 5D8KB 4E2ZA 2IDKA 4RVGA 4RTRA 1XSDA 1K6OA 1B42A 2GA1A 1BKYA 1EH8A 1R1VA 3PFGA 5E1XA 5CVDA 2PXAA 1SMYF 2Y0MA 5HILA 1YB2A 3FM5A 3LCUA 5U4XA 1RI3A 3Q9SA 3EEOA 3M8FA 1Q0SA 3BJOA 2PI0A 1XGNA 1TNSA 2DULA 3ABTA 3WG9A 3RTRA 3SVZA 2HTEA 2Y1XA 3OE4A 4IHTA 3EGIA 2V6CA 1ZG5A 3UA4A 2HDCA 1JG1A 3KHKA 2H1RA 1NBHA 4A5NA 3ID6C 1SQFA 2FNAA 1DP7P 4CHUA 4O3MA 2JTVA 3LCCA 3HCDA 4XUCA 3DOUA 2YX4A 2EJUA 3BWYA 3MZYA 3FM3A 1WRJA 1M6EX 5E1MA 1USSA 3WGHA 2STTA 1Z6TA 4R1HA 1RUNA 2OKCA 1SD5A 4U7BA 1Y0UA 4V0RA 5ICEA 4RAZA 4AZWA 3I59A 3RODA 1QZZA 3FRHA 1VE3A 3P97A 2AVNA 4Y30A 5DX8A 5LGNA 5FA5A 3B5IA 1N2XA 4R05A 4P9FA 1FP2A 2PN6A 3H2BA 5LSAA 1RUOA 3T0YA 1G55A 4GO1A 2OZVA 5E1BA 4K2EA 1SD7A 1I9GA 3EVGA 1ZG3A 3M6XA 3C3WA 3E23A 5FFZA
chains in the Genus database with same CATH superfamily
4MEXF 2KT0A 2BEKA 4TQAA 4MICA 3O3KA 4ADSG 1H0KA 3TFOA 4BBAA 1OILA 4XWTA 3E6MA 1M83A 1PLLA 5LA6A 4GM0A 4C5CA 2ZRMA 1V48A 1FMTA 4TS9A 4R1UA 4ZHSA 3LQQA 2FZCA 3SQNA 4JJIA 5K6AC 1QPGA 5FRMA 4ENQA 2PMZN 3PNVA 2VUSA 3V8RA 5BPFA 4MFEA 3GARA 5IYZB 3ERCA 4J7AA 2HLDD 1P5ZB 5KX5B 1XVVA 3RVQA 1K83J 2EVWX 2J48A 4BHPA 4RXTA 1P2VA 4OBXA 4ER0A 5JZOA 3SZMA 3CU5A 5LNK1 3ON5A 3B5EA 1AKVA 2W90A 4FOSA 1YIAA 4WT7A 4EJUA 1KRHA 4YP9A 5AM2A 2QY9A 2HMAA 2Y1FA 1L4FA 1LPSA 4ALIA 5G1OA 2HGCA 4RGQA 4F0JA 2AK2A 4TN1A 1A9RA 3PSIA 3C48A 3CVOA 3X1KA 1WJEA 2W70A 4D4HA 1XMQB 3EVCA 1K0UA 3EXEB 1A9YA 5BWOA 4MITA 2VJMA 2R6R1 1BDBA 1REPC 3KYCB 1UHMA 3VM6A 3PTAA 3T1HB 1WJCA 4D42A 2A1UA 4KITB 3G6EI 1GU7A 4UNPA 1E61A 1S3FA 4JB0A 1I50J 2YXDA 4MQFA 1JZSA 4Z4IA 3CY6A 4DIQA 4YMLA 2H2IA 4PG7A 2IOQA 3T5DA 1EFVB 2HBYA 1K3FA 4YNBA 3CE6A 1JHRA 4O4IA 2ETXA 1Y7TA 2Q6VA 4AVYA 1CKEA 4AY5A 3ODPA 2HPZA 3KOYA 4ZDPA 1CS4C 1KI6A 3GJXC 1TAGA 4YR7A 3ZHZA 3SFVA 2V6IA 2B83A 4M3GA 5IJ9B 4BXFA 2FLVA 3N3BC 3W5BA 4FINA 3ZK7A 4BFXA 2G9VA 3A0HC 2DMNA 1RWQA 3OWOA 1MH9A 3ONWA 4XGKA 4O59O 2H1LA 3S0JA 5CYOA 2DR2A 1IU9A 2E2JJ 2WKWA 3HBJA 1IWBB 1YHYA 4KFSA 2Z58A 5FOXA 4MRPA 2HPVA 2QVLA 5DDGA 2Y3IA 3G4SI 3EAGA 5COAA 3W8DA 3KWMA 3CZRA 5JRJA 2UVDA 4YJ2A 2EJVA 5KPDA 3PX7A 4NC9A 1WZCA 1RYEA 4LCBA 5A3VA 1PS8A 1RWNA 1T2NA 5H80A 1MFZA 4W7IA 2DCEA 2VH5R 5EGOA 5FF9A 3II6X 3QEAZ 4MTLA 2XY4A 2OL4A 4JUDX 1SJ9A 2YINC 4A3BJ 1GRRA 5LL6P 4EJSB 3DOHA 3CA8A 3KZIC 4Z0TA 4LFAB 1N5MA 1SUSA 1JA0A 2XZTA 4OM8A 3D54D 2A0WA 4RFVA 5HOQA 3DE3X 3DHEA 4W1QA 1W9HA 1LKXA 5HNHA 4LMBA 2VJOA 2H0RA 4JJFA 2D13A 1LTKA 2QPAA 1ZPDA 4CYCB 1ISHA 4JXKA 1ODCA 2J85A 3ENKA 2GSDA 1Z7UA 4WZZA 4C78A 1FFAA 4MYDA 1QVZA 5IDXA 3MMNA 2C2HA 2EQ5A 1ADBA 4RJLA 1MRSA 3RYCA 2NVTJ 4GIBA 2PRKA 4LYFA 2J5OA 1U31A 3FG9A 1DRVA 4TGLA 4BNFA 2PUFA 1N7IA 1Y4UA 2AYYA 1TK9A 2FB9A 4Y2SA 3ZWOA 3TN7A 2F4OB 1J9IA 3M9XA 2FPPB 2VATA 1DJMA 3COVA 4X20A 1Z0DA 1YBFA 4GZ6A 5KBYA 3KTAA 4IHSA 5AJUA 3TD9A 2X6QA 4P8RA 1Q1HA 3RVBA 2V59A 2PM8A 5SY9A 2BLLA 4DABA 3WI7A 3OTHA 1GG5A 5IJ9A 1A9XA 4IV5A 2QSUA 3OQOA 4EHNA 1IFXA 3G0CA 5LLSA 2ZXWH 1FSSA 3MJDA 5FOVA 4U2BA 4Y2PA 4IM7A 5K0ZA 4LYHA 3SBOA 4UBLA 2RGAA 3HHHA 1NN3A 3W9BA 3HLKA 5DJ5A 4CEJB 3LYLA 2VYNA 3A6ZA 3X2SA 2G4VA 1I5ZA 3EZ9A 1PJ3A 2EWWA 2GA8A 5DHAA 1PJBA 1KYQA 2GKSA 1V0JA 3AR8A 3UHOA 3HKEA 5HK9A 4P3OA 2BF7A 2XHZA 4X93A 3IEMA 3CCLI 1B8NA 4CMBA 3QKRA 4I55B 1JF8A 4B8YA 3KJEA 1A2QA 2YOFA 4GLFA 3FCEA 4Q9DA 3VR6A 1A72A 2JRMA 4Q3AA 3Q2OA 4HEA1 3REGA 4PZPA 2SHKA 3T3GA 2D1YA 3RUHA 3JQAB 5MGBA 5K1ZA 4DJEC 4RTKA 2K3PA 4V39A 4FD3A 1PFVA 3QVGA 1TLTA 2FK7A 2A3SA 1P5FA 3IOEA 5H3HA 5HDKA 3ZE8A 3V8PA 1X7YA 3N59A 1NI3A 3BKXA 3BWMA 3N9IA 9ABPA 1R5GA 1FX0A 2PSJA 2NYUA 5THXA 2JGAA 3RGGA 5K3FB 1TVKB 3F73A 1Q3HA 3HADA 2PMFA 5F7OA 1ODSA 3KSZO 4OAYA 1KQ8A 1NZDA 4MQ5A 4XFKA 2BKUA 4GM1A 4RX1A 4NDNE 1ZUIA 4O2AF 1VYVA 2BGNA 4TTJA 4KGXA 4KT5C 3FWPA 4ZTBA 3AIKA 1ZJJA 1KR5A 4GNKA 4Y3OA 2FG7C 2IRFG 2AO9A 1RC9A 5IFLA 2EIXA 1A4IA 3TAXA 1XKQA 4ZPXA 5CIYA 2J33A 5E8JA 3FPLA 1K97A 3D31A 2C7RA 2HD4A 2JZNA 3BGIA 3ZN0A 2I6GA 3RS9A 3JSPA 1XX6A 4XLPF 2CHEA 3OT4A 2RGXA 3OZSA 4R51A 1OR8A 2W0MA 5JZMA 4XSZF 1A7KA 1NMQA 5FUWA 5DHRA 3K7AJ 1D0YA 2AQKA 3JTEA 1PKEA 2FF4A 3ADKA 1FSPA 4LBYA 4XD7D 1EE1A 4G7OF 3Q7TA 4Y2TA 3JZIA 2YIDA 3R6GA 2V6FA 5DD4A 1DC7A 2HF7A 3S2FA 2WICA 3CWCA 3P2JA 3C5EA 4C05A 3JPYA 4KLAA 4KUGA 2ZJ0A 3EXHA 4B6OA 1P18A 1UEIA 5F0FA 5DN6A 2IHNA 3M6FA 1EX1A 3OPYB 4E5VA 3V4LA 1MOPA 3WGZA 3MFYA 1TRKA 2LOOA 1B4AA 2Q5JA 2IYZA 4II2A 4UFNA 5KTNA 3GVAA 1UIRA 1IY8A 1P9WA 3CEPB 4Y2GA 5GY7A 4GQBA 2R4QA 1DXOA 3R3ZA 4TVOA 1PSZA 4GYWA 3LBNA 1HETA 4HDRB 3PI6A 4OBBA 1Q12A 1RRGA 3LM8A 1ZM3A 4EKDA 3PC8A 2Q0XA 1LRJA 2ENWA 5AK6A 1QE3A 1J7KA 3JR7A 4EFKA 4QXAA 4ASUD 2ZB3A 2XDYA 2AQFA 2F9MA 3CX3A 1T0HB 1M2VB 4KR3A 4KAFA 2OCPA 1M74A 3FVTA 3G8YA 3H4IA 4IIDA 1K86A 5EINA 2AG1A 3UK2A 4KQJA 3H5AA 4HWOA 1AA7A 4ZAZA 2A86A 3ICEA 3LMKA 1R16A 2EKDA 2YXNA 5IT3A 3HKDA 1HQDA 1EIWA 2HCTA 3OCZA 1M34E 3T4EA 1G3UA 3B3AA 3WLKX 2EJBA 2FSWA 1YAJA 5DK6A 3AJ9A 4TV9B 3KQSA 4OXIA 1XEWX 4UOQA 1U99A 1VMIA 4GXRA 4UOEA 3LDHA 1D3YA 1QF9A 2EEZA 3VU8A 1XFAA 3K4QA 4DZPA 3K4JA 3M70A 1E1NA 2BGGA 3IQZA 4G67A 1K0FA 2I4IA 2YZ2A 4B74A 1K7YA 5EJFA 1N2CB 3CUEF 2H0QA 4CLHA 3L3BA 1PG0A 1ZKGA 4I50F 3HPQA 1UJCA 3AHIA 1C8LA 3SN6A 3JW4A 3EG9A 4D5CA 5B1HA 2M1XA 5MF6A 4CMAA 1AKHB 3CH6A 2WYHA 3EAFA 1TTQB 1F0NA 1RM5A 1U7UA 1Z9CA 3R20A 3KYBA 3MGBA 3CT4A 3OPYA 3TO7A 4Z3DA 3GW8A 1RQ7A 2PRIA 1J2EA 1PYDA 2W2XA 1WMAA 4C4RA 3U37A 2WY8Q 3ZYZA 1WPXA 3EXIA 1LPMA 4CUJA 1NE7A 3GG2A 3H1TA 3ZOBA 2OCDA 5CDTA 4Q4JA 2GD1O 4J4TA 4KDCA 4HLXA 4NTZA 1U0RA 4PZLA 1AN0A 1K7FB 4ZQEA 1YRBA 2VODA 5F76A 2AXLA 1P5HA 1WW8A 3GZTB 3A1EA 1KYXA 4TL9A 3WIBA 3ZJ5A 1JSCA 1M2VA 3I32A 4RLFA 2WIFA 5C3MA 1ZBDA 2EYQA 2RBEA 1VKOA 2Q62A 5L3SB 3LX6A 3MRTA 3C6KA 4TWAA 3RREA 2W25A 3ISPA 5FADA 1GU0A 2V5AA 1UDBA 1IN8A 1TD1A 5L95A 3LLMA 2FN3A 3VR3A 3NXKA 1EA5A 5CP8A 5HKKD 1U1IA 2J8ZA 2P62A 4A2QA 3LLUA 1GM5A 1Q0UA 4W5QA 4MRNA 3GH1A 5JSZB 4B7CA 3I6QA 2JARA 3W5SA 4I8IA 3G0DA 4LFBB 1WKBA 3K5WA 4I36A 5CGZA 3L01A 2TRTA 2R0QC 3TQOA 2DX7A 1V5FA 3QOXA 3KETA 2V3WA 4OD0A 6YASA 5JAIA 1GGKA 2COKA 4NZPA 4UAGA 1RT9A 2MD5A 1NMYA 2KI5A 3THWB 3ISTA 5TQ2A 3VHLB 1H3EA 2P7CB 4QGSA 3G8AA 2O19A 3EEQA 4C01A 1NBEA 1Z33A 5AI8A 1FLDA 3WHLA 4ZYYA 1L2TA 1ZN9A 2EW8A 3MWEA 3EWIA 2JJMA 1J5PA 5EVCA 2ATXA 3FMFA 4U6NA 2GXQA 4BP8A 2JFPA 5IY5H 1WBJB 2RK4A 4EA9A 3EUEA 1S8NA 4KU4A 2J46A 3AVOA 3K1MA 2IUEA 2RGDA 4OMCA 1CK4A 4D3DA 3E5XA 2WP8J 5FR2A 4B83A 2WUWE 2V0GA 3WBFA 5BS6A 2IDZA 4LJLA 5K09A 1CFZA 2G5PA 5DNYB 2CFXA 1L7VC 3I2JA 1MABA 4U7DA 5LU9A 3IH5A 5C37A 1E77A 3WU0A 5JI6A 4MCIA 1P3JA 1LVGA 1ZH8A 3CJNA 1V54H 2YUTA 3G6WA 1IZ7A 1JVNA 2FPWA 2P41A 3ZDZB 3VDXA 4NXNB 4S1VA 4E5KA 2FPLA 5ILUA 1PSDA 1DPGA 3OTQA 4PSUA 1PP8F 2XYHA 2CLKB 3CYFA 4L75A 3VHQA 4CQLB 4MV8A 3KV3O 4RV4A 3U3DA 1VLJA 3ASOH 5C4MA 4H0CA 3K9BA 3G49A 3PFWO 4ZVUA 3BZ6A 4X63A 2VQCA 1N2CE 2PH7A 4F6CA 1NQVA 2FHPA 2YWHA 1UK7A 2ARKA 3MHTA 4HYTA 1H5NA 1Z17A 2W8BB 4UBIA 4EJFA 4RGBA 1E96A 1YYVA 4PBTA 3RRBA 3TSWA 3KZZA 3ETEA 2XDAA 3GCZA 3OQBA 5EAIA 5AW9A 3JWEA 3CCYA 3EGXB 4NBKA 4E7OA 4JKOA 4C22A 4DGSA 2V3CC 3RYFB 1ZLJA 1RD4A 1DTWA 2IPXA 4I4IA 3BG7A 2IXGA 3H4VA 4G6TB 5DWQA 3G7SA 1NJ6A 4RIEA 3FXOA 1K2WA 3K70C 4E03A 2NS0A 3JTMA 1PDOA 1VMEA 1O4WA 2NOJB 2W6IA 2IAIA 1XN1A 5K0TA 4GMGA 4OBWA 4DV0B 3GOHA 4OCZA 1FTTA 1YUNA 2HEIA 4P4TA 3RSSA 2A1IA 5I4CA 2HX1A 4J0FA 4N0MA 3NVDA 4B6SA 4I2VA 4Q3BA 4XYLA 4PPGA 1BA5A 2IU3A 4P4UA 5D4SA 4CQMA 2CL5A 2ECQA 2Z95A 1UKYA 2GEBA 4XE5A 2ONCA 1C3VA 2J9FB 5C4GB 4B3HA 5BN4A 3RAFC 3PWKA 4YRCA 4EZEA 2AC4A 2O4CA 4FMCB 1M7GA 3TXYA 1EUCA 5I9SA 3G59A 4ND2A 3ACCA 3K4CA 1WDLA 5DBFA 3LC1O 4GAEA 4Q4CA 1YOBA 3GP3A 1EJBA 2V54A 1L4UA 4DQ2A 4NHOA 1BW9B 4OX9B 4AG6A 3J7TA 1P7CA 1PP4A 4MQ9F 4LWZA 4HFJA 3ZGYA 3BX1A 3KSBC 1DINA 2H7XA 4KIWA 4N6GA 5EZSA 5HDGA 5GOZA 3ESXA 4QEZA 4Z9XA 4CMCA 3M82A 1CSEE 1ZRMA 1P5JA 1KZHA 1XTIA 2J32A 3HG7A 2QNBA 1W7PA 3W5DA 3GJSA 1II9A 4RCYA 1HXDA 4RB3C 4CQLA 3GCMA 2O7NA 1U8AA 2NVOA 4RWZA 5GZ6A 1ECBA 2CQKA 5MFPA 5SY6A 5B36A 1FMLA 4MUIA 4HUQB 4YCBA 1NYQA 4MGEA 3I45A 1HEYA 3MJEA 1XF9A 2GPWA 1RQRA 4A0GA 3L4KA 1O6GA 2ISYA 2WI8A 3SHOA 4WLEA 4EUNA 2NO4A 1FYEA 3FOBA 3R09A 1CUIA 4BFWA 1BKSB 4ZU1X 3EQ2A 4V1CA 4QL3A 3RYFA 1JEAA 1IVSA 3WK6A 3D4IA 3HJNA 1I2MA 2FEMA 4A5SA 2HUPA 2GXGA 4B4UA 1J9ZA 4D44A 3KPVA 1UBTS 2FEOA 2VK1A 3T7DA 1CR1A 4XR9A 5D5XB 1OFHA 3PVSA 3CZ4A 1S8OA 5DI3A 4JOCA 4MDFA 1XEXA 2BYTA 4L8WB 5FLYA 1JUSA 1EB8A 1I6HJ 3N2YA 3MTDA 4HH4A 2V7PA 2SECE 1L8OA 3ZGKA 3O8CA 5CYPA 2HA7A 3TPFA 3M5PA 1G6KA 5GAGJ 1RFGE 1QQBA 1U0LA 1GSHA 3SF0A 2J9FA 2J9XB 1KC3A 1H2HA 2OPHA 4BBPA 5AIQA 2AOUB 1GGFA 1ZMBA 3DMDA 2M7AA 2X4LA 5A62A 2B4RO 5E2IA 3G9TA 4YT2A 1XTTA 3BKWA 4R8VA 5BNGA 1V7QA 1Y4SA 4AU1A 4ZC1A 3O4RA 5AOCA 3EVDA 1LJ8A 2AR9A 1E5TA 3WGUA 2QMOA 3SNKA 1TCCA 2FX0A 3KAPA 3O8HA 2OP0A 2WAAA 1OI4A 3I01A 2CXQA 2E1RA 4IHJF 4C7JA 2NIPA 4UTPA 3ZCUA 1OJLA 2OGWA 2XGJA 1G42A 1MO3A 8ATCA 5B3KA 2QQGA 1GUBA 4C6SA 2KISA 2QGFA 1YBMA 1Y63A 1KI4A 1P4GA 1VG8A 1U5AA 3F47A 5J2TF 3QVUA 1P9NA 4UDOA 3TSAA 3PFBA 1LUJB 3NHJA 1U1DA 4D56A 4DBVO 2O2CA 2IEYA 1YJWI 3SIXA 3GPLA 1D4AA 1N2HA 3NM5A 2DULA 1WVGA 1T91A 2XB4A 3SVZA 1VHLA 3OE4A 4E7LA 4JDPA 5CTAA 2IYQA 5H16A 5LQDA 3VKUA 3UMYA 3JQ8B 4JBWA 4O1MA 4I3HA 2LP4Y 4B3MB 4N9QA 1ZGGA 2BEVB 1GP2A 5LBUA 3W8RA 2STTA 2R00A 4AS2A 4IEIA 3PKJA 3RS7A 4IRXA 3P97A 1Z56C 4DNQA 1N2XA 1WCV1 1L6RA 1HBJA 4IWYA 3GFIA 4NECA 1EVLA 4FKBA 1G3TA 1GFZA 4QYTA 4DLSA 4JJZA 4X6YA 2JCSA 5T6BA 3D5SC 1U5TC 1G6NA 3RSQA 3FGNA 2IC5A 1J8YF 1SK8A 1UCRA 5E8RA 4HWTA 3R7LA 2XUJA 3D81A 1RRFA 2MWMA 1UC5B 1M2GA 1F17A 4F9EA 4HLUA 2MTBA 1DQZA 3FZGA 3ANLA 4UD6A 1FLVA 3R74A 5BOXA 2V3VA 3N8KA 4JN6B 2QN3A 2DUUA 2E1MB 2BY4A 4YDRA 3CG0A 2D0OB 2R7KA 3RRMA 1D4ZA 2JGIA 1C4OA 1E1MA 2K2QB 3AR9A 1WH5A 1Q7GA 4QDOA 4XQEA 4E15A 2EG9A 2VYND 4YP1A 3KSAC 4ONEA 3M6VA 3UKDA 1GZSA 2G09A 3EPKA 1GNTA 4MINA 5T67A 1UPXA 3HCFA 3KL4A 4Y2VA 1U11A 3D0KA 2WB1A 1E9SA 3H9CA 2HH9A 3A4CA 4JV5B 5ALUA 4YAKA 1KYTA 121PA 3H9BA 4G1UC 4WK6A 2C95A 2QAGB 1HURA 1VXRA 5AJTA 1Q11A 1OKKA 5GOTA 4XH9B 4YIRX 1ZQ3P 1PYOA 2JLRA 1W2WB 2A1TS 1DNPA 1K27A 5BV2P 3FZNA 4JGIA 4I9UA 4FYYA 3SQDA 3CF0A 3JSXA 4OJYA 5KO2A 2YHIA 4G8CA 4HZFA 1HXHA 4BNKA 4EYSA 3AFIA 2X4DA 4R1NA 1XTBA 1W5TA 1QLHA 3DB1A 1GLGA 1VLZA 1W25A 4EFDA 1P5RA 1AK9A 3PR2B 2NO6A 4WXYB 2H54A 4Y18A 2BXZA 4YRGA 2HDHA 3JRXA 1L4LA 1UG0A 4IEEA 2EBHX 2X0LA 4U02A 1USTA 1W52X 1GJRA 4FHGA 1E2XA 1O6CA 3GMDA 3W2GA 3TUIC 4ZCIA 5CA1B 1UBCA 4OAPA 2V0CA 1OTHA 2CFCA 1LE8A 3QQPA 1YRNB 4HDSA 3Q8XB 4WASA 4LMPA 1CUZA 4JFRA 4E22A 4XKWA 4FEGA 3LY5A 1YG2A 1WL8A 2JCBA 1CE8A 5LP6F 2R48A 2CHUA 4YGXB 3RBZA 3JALB 3FMIA 1RZVA 1LFBA 3KYDA 1JH9A 5IT9Z 3FHOA 4LNHA 2VJ5A 1G3YA 2XQVA 2B4QA 5JS2A 4TV8F 3AMVA 4P3YA 1XU7A 1A77A 5FO5A 2NOAA 1PBNA 5KNBH 3LY8A 4YCJA 3PQ5A 4B44A 2RK6A 2B5VA 3BTUA 1M7HA 3L2CA 2IUYA 3F5MA 3R0QA 4J2OA 5CW1A 4L6CA 1XRPA 1VI5A 3PJGA 2H0AA 1DAKA 3K3PA 1QXSA 4Z9YA 1OXVA 5A2QK 2WYIA 3TD6A 4HRAA 4WZAB 1E6EA 1LRKA 1HDGO 1STOA 1YQGA 4O4LA 1FBQA 1MOZA 2X6TA 4EKEA 3TNJA 2O0MA 2X2EA 2QUJA 2KQUA 2EFPA 1ZVKA 2F43B 2AMFA 1R1UA 2OGUA 2Y30A 1S9HA 1LGYA 2DSTA 4N8SA 3F8CA 3DQPA 4BU2A 1HSZA 4OKNA 1L5HB 3WS7A 4B73A 4GFDA 1M0EA 2EJRA 2V96A 1CJUC 1G20B 1T4DA 3QJGA 5FI1B 2FW0A 4TRJA 3FHCB 3THYA 1XZQA 3ET5A 1NUPA 4OTZA 3EXG2 3H2YA 1VQ4I 3QVOA 4YPVA 5KTMA 5AJVB 4P4SA 5KTPA 2ZO4A 4E94A 5B5SA 4IDGA 4J7XA 1RJDA 1DZ3A 3KR0A 5E7JA 1EBBA 4X1YA 1G7SA 3CSDA 5HBRA 2YFYA 2M8EA 1JLMA 3LC7O 2I62A 2BY1A 4ES6A 4M3NA 3PDCA 3RV3A 4CODB 1P19A 4ZT7A 4R41A 2HQNA 3GVHA 3DL2A 5C80A 1T3SA 2UV1A 2I7XA 4QJ5A 1U9CA 3UGKA 1ETYA 2G71A 4W97A 1Q3TA 2QZJA 4J94A 5E0KB 3EUWA 3UH1A 4BLUA 4OOIA 1TPZA 4AI6A 4QQ8A 3H4MA 1SVKA 4OIOF 1VZ0A 5G02A 4AW9A 4D4MA 2PMCA 1OC4A 5HDQA 3GUHA 3QKUA 5HIKA 5THQA 2JBAA 2M3AA 2WM2A 1BMDA 1U80A 2RAFA 3M5CA 3AG6A 4JYAB 4QDKA 2OMEA 4Z6KA 2OWEA 3K20A 3L00A 4IWXA 4P9NA 4F4JA 3CJRA 4D7NA 1RYZA 3VX3A 2X0KA 2GO1A 1OCCH 5JVTA 2K5CA 4IUDS 1V5IA 2QUAA 4XIIA 3C97A 1XQVA 1XWWA 1NLZA 4DRYA 3E8MA 1UZAA 4BGVA 2ZRKA 5EG0B 4UM7A 1KDRA 1QKJA 4BTVA 5J23A 1HZZC 1MCZA 2O3FA 2CF6A 2DK8A 4MV9A 4P08A 1NC1A 1PFGA 2HYFA 5JC1A 2N9UA 4OWRB 2RJNA 1MX9A 4LOAA 3G79A 4ARAA 4FMBB 2XV1A 1G20A 3A6PC 4RV5A 4NQRA 5ESXA 4Q00A 4B6EA 2OOSA 4RZSA 3ANXA 1R9TJ 1SQSA 1DWPA 4UMDA 1SQGA 5THKA 4ND5A 4AYTA 3OIYA 1A5ZA 2VA9A 3WHIA 4FWIB 2BUBA 4NCHA 3RU7A 2Z6AA 2D2IA 3KKNA 5FFMA 1T36B 2Q9BA 3V4FA 2MFZA 4GPZA 1JR6A 1H4TA 1WU8A 2P6MA 2Z4RA 4Q21A 2ODTX 2EFYA 3I2FA 2PIDA 3IVGA 3VVLA 4PIMA 1ADGA 4RAOA 1OF1A 2ODAA 4FZRA 1V16A 3V7WA 4MW5A 4EFLA 2GZSA 3LQ4A 3FM9A 3MMXA 1UHSA 4YAWA 2VXZA 2GSWA 3RYTC 5FL7A 3HCEA 1WDKA 1MC5A 3FA2A 2C54A 1DEAA 2XF5A 3VR3D 3ZDQA 1PD1A 1VQ7I 1KVRA 4D98A 1IBKB 2DPDA 3C6YA 2NM0A 2Z1NA 4LJ4A 3K70D 4DR3B 1XX5A 1BVYF 2NSLA 2NO7A 4WZAE 1U2PA 4JEMA 1H85A 4QLAA 2I1WA 3DTNA 3ER9A 2LP0A 4MKGA 3AHEA 1SANA 2XGMA 4LISA 4XQFA 3VQTA 4MYTA 3MRVA 2R68A 2GEKA 1GPH1 4I5DA 2H48A 2FSPA 1KEVA 2IPAB 3Q3HA 5I9MA 2DF8A 3FSEA 3ETCA 1A98A 1Z4PX 4GPEA 1U3GA 1XTKA 5EWJB 2I6FA 4I9HA 1RBMA 3VOTA 3AHJA 5B6IA 1C7RA 3OZCA 3UWMA 4OL0A 3UWSA 4A8JB 4YMGA 3PLRA 2PWYA 3NYWA 5KTSA 4TLCA 3IKJA 3HOUJ 3ECCA 3Q2IA 2YJ3A 1R4NA 4LNAA 1NVEA 2IIPA 3R1IA 1PT6A 5JAHA 4PSDA 4RHYA 2EZ8A 4L8LA 2ZJBA 1D6JA 5EJ6A 5D1HA 3RAJA 1VTKA 3DEZA 1QHXA 2Q49A 4JY7A 5DM2A 1Y48E 3QQAA 2IS6A 3S2YA 3A1YA 3A28A 1XR3A 5IZ4A 1KYZA 4BO0A 1H1LB 2PMEA 3WFJA 2WHYA 2GF2A 5K99A 2G9WA 4QFCA 2QJOA 3ZCTA 3ZHQA 3Q7QA 3HN2A 4BAYA 3O73A 1RTTA 3AR3A 4MYRA 2VJJA 2P0EA 3ND5A 2WQ6A 2NUPB 4UHEA 3JSOA 2I3GA 3K15A 1C50A 4Y1EA 2JGDB 1ZHHA 2N42A 1ACMA 4CFSA 3ELYA 5IULC 5TX7A 2GWRA 2NAPA 3LQYA 3NYQA 2ZDQA 4Y0VA 4M1YA 3N2GA 3DLLF 2JHAA 5ICSA 1XMPA 1EU1A 2YWDA 5JH7F 3QYAA 2WAMA 3CUOA 4FUTA 2B1QA 1LLCA 2RGCA 3SJUA 2XXBA 1G4UR 2HOEA 1OYOA 3L0YA 3NV9A 1KNQA 2CF5A 3J7YJ 1UMCB 2I78A 2WAQN 1XMKA 5AKKA 1GDHA 1JGGA 2FUG6 2DOEA 1FLIA 3VR2A 4EUKA 5IT0A 3EJ6A 2OENG 1F4LA 1MIOB 1I3QJ 2PBLA 1LXCA 2RVCA 4GU5A 1ERDA 5CB4A 2MSKA 3A25A 1A8QA 3HY4A 4LAFA 1M1YE 5A03A 3OLYA 2K9LA 2PG3A 2B0CA 2PGJA 5TEVA 5IP6A 1HL3A 4CM5A 4WOPA 1FS5A 4WESA 3EVNA 2H08A 1F3OA 1TMOA 2BVMA 1O96A 1IMOA 1UFOA 4CIXA 2D1RA 5C34B 3F6BX 3IA7A 5LYJA 1F2TB 4GZMA 3HUFA 3T1NA 2M2EA 4HADA 3AF2A 3WLEA 4B4DA 2HJ9A 4CQMD 3GFOA 1KQ9A 1T2CA 3HXTA 5CB8A 2JFBA 3M83A 4EHKA 2JAXA 5JCOC 1H4VB 2F3QA 4E31A 3LZDA 1IG0A 1J59A 2Z8XA 3RQSA 5IN5A 1FOKA 1K5DA 3S1QJ 2JKZA 2GHRA 1HYEA 3FCSB 1IY2A 3DKXA 2X5KO 3LI2A 1CJVC 1OLTA 2ZKLA 1MNDA 4D0LB 4LBWA 1U2QA 2XVCA 4ETNA 1HG0A 8MHTA 5CDSA 1LZKA 4MW7A 2W6CX 1BJRE 5BXQC 5A05A 1KJQA 5JE8A 5YASA 3V1NA 4QBTA 2YXBA 3H36A 3DEUA 4Q19A 3SMVA 3DMPA 1ETKA 4KHZA 3OTWA 4IJ5A 3NP9A 5FPHA 1LS1A 1VKJA 3P19A 1JG7A 3CCMI 3K0SA 3L7DA 1NNI1 5E1OA 4PLVA 1UF9A 5EXPA 3RYRA 2WA2A 5BWNA 5I48A 1W7PD 1BU8A 3B6JA 3D6TB 4NZYA 1NGSA 1EDEA 4B34A 4UU0A 1IW7F 2CNLA 1MDBA 3TZLA 5FAXA 1O5IA 3HJUA 2L02A 1JHOA 4FT8A 5KC8A 4YV2A 1DI0A 3RS8A 2YZGA 3IAS6 3K1NA 4URWR 1YTUA 2W93A 1FY7A 4NU6A 1TQMA 2JWTA 3DEYX 3QXSA 2CFTA 4RF5A 5A6SA 3U9GA 2I33A 4KDFA 1PV2A 3AJEA 4GEKA 4KQCA 3PV0A 4XPZA 5L7YA 1QZTA 1ILEA 2QTGA 3TDKA 3VU1A 2KMUA 2A33A 4BJHB 1Q77A 3TRFA 1JAXA 3PRKE 4FHZA 2H06A 3WTUC 3NFRA 2CW5A 1Y56A 2K7FA 4R4JA 4XYMA 1SZJG 1YS2X 3JAWB 4MVYA 3C2HA 5FFNA 5F51A 3C74A 1UXOA 1VJGA 3AR4A 3EGCA 2W83A 1PFKA 3BB3A 1P44A 2ZULA 5DXAA 3HKCA 4D0SA 4KN4X 3PNYA 1CJBA 4QBIA 1P0MA 2PYZA 4R3WA 3WGLA 4X6UA 1HW5A 3LWZA 2WD8A 1LK0A 3FW1A 3MJHA 2W48A 4DCCA 2V6EA 2IXAA 3AFGA 3LDUA 3QSYA 1IOWA 4E07A 4KPFC 5KYXB 1E2JA 4GMFA 1NY6A 5DLQC 4AZ3A 2PNJA 1VQKI 5J4HA 2HBQA 1LDJA 1V9LA 4KO1S 4ARBA 5ECGC 2FPIA 4BYYA 2QL9A 3J81k 2V79A 2V6JA 3PLNA 4CCYB 3LUDA 2CRGA 2CSXA 4LCJA 3MTAA 4B3BA 4QZVA 5CVUA 1JEYB 2O2HA 5GZ1A 4A3EJ 2Q4TA 3P9YA 4L4ZA 4YN3A 3A9CA 1OAAA 3VPGA 3DVLA 4CH7A 3H5OA 3L6RA 1EWKA 2V98A 1OLSB 4KB5A 1IDOA 4DEYA 4XIFA 4IKEA 1K8YB 4CLOB 1CU1A 2A5LA 3U7JA 1C1HA 1KZ6A 1Z8HA 2MSCB 3AKZA 5F98A 2RONA 3IAEA 3N0RA 1OCTC 4HNVA 4YGYA 2BGKA 4OQ4A 1NUAA 5E38A 2PS9A 3R61A 3H5WA 3B2NA 2YJNA 3SC6A 3LQKA 3CUKA 3IPCA 4W82A 2WF8A 4E11A 1J2RA 3SQOA 4EAAA 1B1AA 1U7WA 1RETA 4ZYWA 3AUTA 1TB4A 4Q4ZF 5IAOA 2OA0A 5LQJA 2EHJA 5LC1A 2UYGA 2HEOA 3PEWA 2OCXA 1CUSA 3M6MD 1FYDA 1N25A 4DVJA 4F06A 5LRSA 1Z6PA 4ZQIA 5EGSA 5BV0A 1LRLA 5IVHA 2OD7A 3NCHA 1XPOA 5IT4A 1JAYA 4GYGA 4I1PA 2B4YA 4MUKA 3OCVA 1XAIA 4WLOA 1OVGA 1NAHA 2CFIA 3KP6A 1AQJA 4N65A 4RB0A 3AL2A 1F5TA 3OA2A 2H4JA 2ZBGA 1ZK4A 4RPJA 2ZBUA 2K9SA 1GN9A 3D2BA 5KWVA 1ID8A 5BSTA 3O2QB 4V24A 3H16A 4HSEA 1H3FA 4EKYA 1DLIA 2OAQ1 4AB1A 1H0SA 4LBVA 2I5UA 3PX3A 1MAVA 2QM3A 1A5JA 5TDHA 3CT6A 1AQNA 5IRCD 3QWAA 3RKRA 1MFPA 4I1YA 2XCOA 1T1EA 1ORRA 4XRMA 4QO8A 3PHGA 3CP8A 5IYZA 3EMDA 4F1WA 1GUYA 5KX5A 2VT3A 4J07A 3UNXA 3PL5A 3E9DA 1N32B 2ZRHA 4CIDA 3EPZA 1SURA 5JAPA 2NV2B 4KTTE 2OY0A 3U16A 3H5RA 2E5WA 1NVVQ 2WINI 1HDCA 2R5YB 1T2DA 3OTGA 2WVHA 4LJKA 4YJGB 4ENUA 1L7AA 1R0CA 2WYWA 3SXJA 4LMAA 4Z3OA 3GJRA 3D43A 3M9LA 1XSXA 3HM9A 2DWQA 3T7EA 1HE8B 2KRCA 3LOQA 3ZWKA 2HMYB 1ONNA 4UZFA 1NG7A 5I7VA 2N46A 2H5LA 5FI3A 1JFRA 3EXEA 5DT9A 3KYCA 3ES9A 2ZWOA 4OP2A 3C98A 4RA9B 3KRTA 2I8CA 1HDXA 1BS1A 4YT4A 5JMWA 4O02B 4CF5A 3UAOA 1M8FA 1Q1EA 3M7IA 1VGRA 1ELOA 4DA0A 3TR6A 2E7ZA 1E6UA 2FMKA 2X9DA 1EFVA 4V02A 5H3LA 4YPFA 1U94A 1UMBB 1V4VA 5TMEA 1KYYA 2JVHA 2OQ2A 1KWKA 1W49A 4JC0A 4EG3A 4P5EA 3AR5A 1Q15A 2YY5A 2BZ0A 4BUPA 3MAJA 3QVWA 1K66A 4ALMA 2VJCA 3KKOA 2CLDX 4K1LA 5C1BA 2AUNA 2WY7Q 4IJMA 4OLHA 4RVFA 4HPXB 5FBRB 3RF7A 2BHSA 1E59A 5GPAA 4GE0A 3HJCA 4CTMA 1VPDA 4G65A 3F1LA 1LSJA 1V7PC 1BFUA 2BHNA 2PT9A 4Z53A 4J91A 1IRIA 2GCOB 3AK4A 2AOVA 4MVJF 1M34B 4RKWA 3ADOA 3OURA 4EGYA 2JA1A 2VTKA 3HFRA 2Z33A 2PD4A 4DM4A 1LBHA 1H8HA 3ZU6A 4E2FA 4PHHA 2WIJA 3VYVA 2P27A 2V8OA 1XNJA 2JS7A 1TZJA 1PDWA 3PFGA 3UPUA 1CD5A 2R6DA 4BY7J 1FYXA 5HILA 4EJSA 1NVGA 4PLPA 2DUJA 1GT91 4MPPA 4LITA 2RI6A 4G0YA 2AN9A 3ASUA 5K4AA 4CE6A 4GX0A 4PC1A 3HV2A 1D0XA 2Y1XA 3AM3A 4G9GA 4PFPA 3K16A 3DTYA 1H66A 3VO2A 4QICA 2HCRA 1M1NB 2I7VA 2FUKA 1NBHA 3IV7A 4XWYA 3HNPA 3IDQA 4CYCA 3M6LA 4ARIA 4PFSA 2AT1A 5EQDA 2P9CA 2ISQA 4O1IA 3Q6IA 5TB5A 2BHZA 3OD5A 2WADA 4M1SA 1OCEA 3RT7A 1CR4A 1VQMI 4V0ME 3HY6A 1EFLA 4QOGA 2HL6A 4DC0A 1SG6A 5D3KA 2IQ5A 4RCZA 3EFBA 1ZK2A 4YRPA 3PCTA 3MINB 3EMKA 3B7WA 2APJA 1CUAA 2ZJPF 1VI0A 3PL8A 2ZB2A 3ZQIA 1UC4B 2ZK7A 1N1EA 4MAFA 1CTQA 5LEKA 2FPPA 5JEDA 3U3RA 2KQRA 1FFBA 3MT0A 3CN9A 1TIPA 1BC5A 5DK4A 1I7SB 3IQGX 1KSGA 2JH3A 3RPUA 1P9OA 4JXZA 3EY4A 1GQRA 4IZZA 2G9RA 1HL7A 1F60A 5FTMA 4HGYA 3HNOA 3QVSA 3VDRA 4C87A 3GFFA 2QQEA 2PKQO 1RI4A 5A7FA 5IKOA 2PAFA 2WWRA 3U60B 4UUBA 3QP5A 3PDHA 3TLJA 1ZARA 5DUKA 4R9NA 4CEJA 4X8LA 2GCOA 3T5PA 4F9TA 4GP9A 3JW8A 4CW7A 4ENSA 2H4XA 3SDZA 3K8QA 3T5CA 3FOFC 4JI0B 1G3IA 1N5KA 1VPLA 3O3NB 4UXHA 4HEHA 3GRCA 4WQMA 4PG6A 3BR0A 1WQ3A 4HSGA 4FXOA 3L1IA 1DJPA 3UHJA 4XIDA 1RPZA 3GQVA 4Q3OA 4FB5A 4X92A 4I55A 3H19A 3FBGA 1LJ9A 2Y6UA 2XRZA 3M3PA 4RD4A 2G1JA 3CONA 1GVDA 5GM2A 2F1KA 2JIMA 1TJ3A 2ZITA 4LRQA 4S1TA 1UBEA 1U2ZA 3JQAA 3MBKA 4WNYA 1YJBA 1MBHA 2CE7A 1W88B 8LDHA 3L8FA 5L3RA 5BWMA 1M1NA 3BHMA 4A6XA 4IJUA 1JB1A 4GXQA 2CHFA 1YJ9I 1LY1A 1YDFA 3VZDA 1SVUA 2FW9A 2AMJA 1OMIA 1JAIA 5CFPA 4JC8A 2O1WA 4GSKA 3I5XA 5JARA 4AU7A 5K3FA 2BEUB 1TVKA 5HF5A 3BJZA 2BGTA 3G5MA 3L82B 3ACDA 4HVAA 5AHKA 4C3ZA 1I6MA 1RBQA 5C7IO 5B1DA 3RSGA 1QIEA 4QYSA 1LFPA 5BNWA 2F9FA 1YS6A 2V58A 1GL6A 3EZLA 3EY9A 2G08A 2QV7A 5HKOA 2AN1A 2WG1A 2Q3MA 1YD7A 1N6OA 2ZBRA 4B7UA 3LY7A 1E1KA 2CO5A 2E21A 4U2CA 1BOBA 4CG1A 4K40A 1Y81A 3WQSB 3BDAA 5AVWA 4WKGA 1FDSA 4NYIQ 4PINA 5LD2B 3UMFA 1RXCA 3EOAI 1U0NA 3GJZA 1Q91A 3TLKA 1CBUA 3FYCA 1A7AA 2MCFA 1R88A 1R5HA 3NDIA 3V33A 3R3YA 1XD9A 3EZFA 4JI2B 1ZICA 3PC2A 5FL7D 1KZGB 1Y34E 1KYVA 2QMHA 4JT8A 3BERA 1A2OA 2R5ZB 3HN6A 2WB2A 4S2EA 5CEEA 1Z3XA 3KXIA 1I10A 1JLSA 4LE0A 1AUXA 1QIGA 4BGDA 3V2GA 4FBLA 2E0IA 1T5TA 3PCXA 1RLOA 2Q99A 5JNTA 4XMYA 4X90A 2H07A 3HBFA 4C0BA 1F8FA 4FCTA 1TZCA 5IF9A 1SKBA 3QPCA 5IKPA 3EGEA 3TMYA 4C0AC 5ARBA 4K3UA 5ENZA 3QLVA 3EH1A 3EXHC 5L3CA 3NDPA 4GRIA 2XYVA 1U7HA 1FYFA 4LIPD 2OAZA 3V1YA 4DIMA 4PXYA 5HLTA 4WEQA 2ZXFA 5DEIA 1R0YA 4K86A 3QEJA 4HDRA 2VQLA 3A1TA 1YRAA 4U2EA 1Q7CA 2X5NA 4ZOEA 3PL1A 4AZTA 3CRMA 2R8OA 4FXPA 2W57A 1E18A 4NCNA 4EMSA 2VK2A 3LNTA 1SCUB 4MWBA 5MDHA 4O2BF 1JT6A 4ZAWA 1XT6A 4D0PA 3QZUA 1KTVA 3E2PA 3PC8C 1P9QC 1RABA 3S27A 1B59A 1MJFA 1RIFA 4IOMA 3DDZX 3CF4A 3ORQA 3CO5A 3FTDA 4H0NA 3RKSA 2R8RA 1YJXA 4DKJA 4UZEA 4D6PA 2QJWA 4H4DA 2R5NA 3RBXA 4YRDA 1L5LA 2JA5J 1JQKA 2VH2A 4HX4A 2HJRA 4I66A 2PRJA 4PJJA 1XAGA 2EJTA 1YZGA 3WLFA 3PFIA 3ZMUA 4ZVKA 1W4BA 4G07A 1V2HE 2Q3LA 3U3MA 5F2OA 4TV9A 5KOHB 3DYIA 2X1LA 2R5WA 1U6KA 2VRWA 4XSGA 2NGRA 1EAMA 1GR1A 4CNQA 1N2CA 2G1UA 1QDLB 1SKUA 1ZH2A 2O3UA 3TRJA 4CF3A 3S40A 1K88A 3I12A 3ZTYA 2IIQA 4WXRA 1AKHA 3VR2D 4ND7A 3PSFA 3ET4A 4ZI5A 4TYPA 3RG8A 2CXOA 4CIYA 3DZCA 5BRNA 5CCXA 5BVHB 3IH4A 3PQ7A 3DKYA 4BUCA 1CC1S 1DEXA 2KM1A 3HDYA 4DXAA 2PMKA 4YJ3B 4NAHA 1FZQA 4JC4A 1ODJA 1Y3AA 1Z13A 3VO9A 3HUEA 4YMWA 2P9ZA 3WU2C 1TWHJ 3K6RA 4G0QA 3W6UA 3GQBB 4P34A 3OY2A 3F23A 2V9CA 1OT5A 2IP2A 3W5VA 2JRLA 4TYYA 1RHMA 5LCXA 4AXXA 1Z8FA 3BHNA 3QLVC 2QG9A 3E9CA 4KQ6A 5JLXA 4X97A 5DMXA 4GI1A 3KQQA 2O8DB 4MQMA 4A2UA 1UJ6A 1XQ9A 2DFPA 3KJFA 2JVGA 1ZH5A 3S5JA 1MNEA 1RWOA 1YRWA 4YP0A 3PEUA 2CNWA 5FBVB 4FN4A 1VZ2A 1H2RS 1BQEA 4YJHB 1X2BA 5DXJA 1N8TA 3DFZA 3SK0A 1URPA 4JX4A 5AVOA 1C4XA 5MN6A 1Y1KE 3L18A 2XMCA 5GAJA 5FRNA 1YUBA 3CXRA 4NEQA 4J1NA 5L3SA 3DQQA 5K3BA 2V03A 2QWWA 3TQQA 2DHCA 1PX0A 1X14A 1KWGA 1GPYA 1TM5E 3H11B 2BISA 5IDVA 3CLTD 5LB4A 4HQOA 1MB3A 4BOYA 1JTEA 3SC3A 3AB7A 5JSZA 3ZWNA 1JB9A 1RE1A 1CDDA 1TQDA 3LKDA 1MF7A 2ID6A 1W36D 4NFHA 3EIEA 4EM6A 4NBWA 5B4TA 1MZPA 3K0AB 3VZBA 4C0SA 2VKHA 1SU8A 2LBPA 2B92A 3THWA 5DBOA 3GRFA 3O2JA 2B78A 1YRYE 4U1RA 1LBSA 1AT1A 4LFCB 3V8EA 3TE7A 5BW5A 3JQ9A 2HWXA 1SXIA 2QGUA 1WV1A 3EEYA 3LQ2A 2G28A 2VLBA 3ABQB 1QQ6A 1R1DA 1TM7E 3GBSA 1K68A 3QMWA 1UJMA 3PBKA 1JDUA 2VK8A 5BVHA 5TMPA 5CIWA 3KKMA 4QIWN 3PGMA 4BVFA 4GOJA 3L7NA 1QG2A 5ALXA 4B17A 3IMGA 1MDMB 3ESRA 2YR2A 1LUAA 5J1SB 4C6RA 4OAZA 1B23P 1P0FA 4BQQA 3ZGXA 4BLRA 5CM2Z 3FDZB 2A58A 4UDNA 3AGPA 4YG2F 4C3IJ 2C97A 3KK0A 1NBOA 2OORA 1W4MA 5HOEA 2OQIA 4EM2A 1VQ5I 4EJ2A 1J8QA 2ZSEA 1NURA 1PW5A 5T7BA 4B1FA 3GELA 3JQ6A 3LCVB 3TL6A 2MR6A 5AM0A 3ZY5A 2ME6A 2O5CA 1LW7A 3HRMA 3ZVMA 2Q3EA 1NQUA 4YV1A 4AAYA 1S0UA 3DFMA 4KN7X 3DZKA 5GP9A 2Q7XA 1SAYA 1XTAA 3SYLA 4CLRB 1K9SA 4L74A 2KMLA 1Z0ZA 2Q5HA 1L4GA 1FBTA 4D3YA 3C7TA 3L41A 1UFVA 1LWOA 4BB0A 1IK6A 1JQJC 3UXMA 3ZHOA 3M3YJ 1JA1A 5ALRA 2K7LA 1GPJA 5T57A 4GXOA 1KY2A 1E3MA 1DAMA 4LJRA 4FEYA 1UPUA 3PB3A 1SOUA 1N9GB 1JDSA 2W8BA 2AH5A 2C31A 4QWWA 4M46A 5FAKA 5FCDA 3W7AA 4U9IS 1ZOPA 1K6MA 2RHDA 2Y76A 1G1AA 1YZNA 3BM5A 2DKOA 4I7EA 3EGXA 3S2DJ 2KIUA 1X4PA 3HHEA 4M8KA 1KSHA 3MCZA 2X8JB 3DM9B 2CNDA 4ZRNA 1FNDA 2VDUE 1UPBA 1BGVA 1Y6RA 5J47A 1AGPA 4EGFA 2NP7A 1XP8A 3DAGA 5NULA 2XKAA 2G04A 3O7WA 3KB1A 1IAQA 1JXMA 3AKYA 3HO6A 2PZEA 3ZY3A 4EENA 3CNEA 1EWRA 2R6AA 4IKOA 3FK6A 4UKDA 3FBNB 3U4HA 4F12A 3AI2A 4YWHA 4EELA 3FTQA 2MDTA 3S70A 1UPTA 2YHUA 1MH3A 2AQ8A 3IURA 3R5KA 4Q9IA 1Y1VJ 4G81A 2FZ5A 3ZU5A 5JOQA 3ZY4A 1G17A 3NCTA 2CZQA 3GTKJ 4IBOA 4HEA6 2F5EA 4ETMA 4EHDA 1D0IA 5JTTA 1DCKA 2C4UA 2XAJA 3HIFA 3IS3A 3E6BA 3A05A 4HBLA 1BW9A 1U7OA 3LL4A 1X70A 1CLEA 3NBMA 1FRFS 3VUFA 1DRUA 3ZE1B 4YBRA 4KZPA 5M04A 1ETWA 4DCGA 4RK0A 3WKCA 1UXGA 2PSDA 2YQ4A 1DIHA 4YDHB 2P5TB 1WR8A 4BXXJ 4CTKA 5FT9A 1QTQA 2QN6A 2P4HX 2NZJA 1T95A 4X6LA 5K0LA 4AKHA 4E7ZA 2VJNA 5L3VA 4NU0A 3ZDDA 4ZYVA 5ITSA 2Q9CA 4MPRA 2WJPA 2AWNA 4QQRA 4F8EA 3H87A 5JNVA 3GBVA 3ZW7A 2WE7A 3R60A 1GNLA 2W4IA 1D2EA 3TCKA 4MOWA 3NDBB 4HUQA 4O08A 1VP9A 1VPTA 3QVMA 2NG1A 3AF5A 1KPHA 3V8BA 2DUNA 4KE8A 4YRQA 4HN9A 1T43A 2XRLA 4OA8A 5K7SA 1N6NA 3QG5A 4FFSA 2PWAA 2BDEA 1FFGA 3OFVA 4UM9B 3HOSA 9LDBA 4KH1A 4XEUA 3NAQA 3IAM2 4DW8A 1RHKA 3KZNA 3IJRA 3N0VA 3RFFA 2AMLA 4UVGA 1VJTA 1HBXG 4WOBA 1CS0B 1DKLA 4QWMA 1Z1DA 2JZCA 3VPDA 1KE2A 2JA2A 4MUYA 5EERA 1PN3A 3T7KA 4H3HB 3TGLA 3ZMSA 1K4YA 4WOKA 1HFJA 3K94A 4FNMA 3G7UA 3LE8A 5IAGA 1JHZA 1DUIA 1PR0A 4NBLA 2ELKA 4GVPA 3WTXC 2FPXA 5E18F 3CLRC 4L27A 3NNNA 4JX5A 4UEJA 1JKMA 4E6PA 4EQZA 1G3MA 3BB1A 4IPAA 1QPIA 4DDVA 1E7MA 2AOUA 2PRZA 4EA7A 5P8WA 5E17F 5CAEB 4YACA 3FNHA 2YDYA 2PS1A 4EKGA 3L2VA 4BUJA 2W6OA 2R4UA 3PE4A 2GGSA 4I6JA 5L45A 3Q7SA 2DA1A 3TOVA 4KXUA 5HUHA 2O7SA 2C83A 4C2UA 4U9HS 5EJ8A 2CJPA 2XUIA 3QUQA 3QFSA 4J4BA 2WJ4A 4Q5IA 4B8WA 4BBRJ 4IH9A 1H8HD 1TC1A 3KT8A 1R1TA 4HF2A 4PF1A 3KCQA 5EJ2A 3VKFA 1FB5A 4RK6A 2F4IA 1ZU4A 2J6CA 1KEPA 2YX7A 4OGKA 3VR6D 2HNAA 3H8WA 3JD4A 1KQNA 2E4ZA 3WL3A 5CFMA 2ZNZA 3T7CA 4KNVA 3OL3A 3AJAA 1JW9B 3ODGA 4DIKA 2QYSA 5M2QA 2W4SA 2XOXA 3Q3IA 5JECA 3ZE2B 1U6IA 3GP8A 1ZN8A 2C77A 3JQ8A 3QX9A 2ERXA 2Q2OA 1DCTA 4ZOLF 2VJBA 1KVQA 5ILSA 1SEVA 3TEDA 2ZIGA 3B8EA 1Y42X 4YIIA 3VJKA 3I9V2 3M81A 2V9ZA 2BEVA 4HQ6A 4B46A 5TRTA 1NONA 1L9XA 3EVAA 3OYGA 1BYUA 3VEPA 4BXOB 1ZXLA 3OQ6A 3DW1X 1ECPA 3I39X 1T8SA 2B7EA 2A6PA 3I04A 1W44A 1BC8C 2R00C 3W34A 3PNQA 1X1DA 2BR5A 4DW6A 4IF4A 2HT1A 2Z6UA 2RHCA 4FQGA 1XS9A 3TL3A 1C8BA 3IUBA 3GTMJ 3H3ZA 2Y75A 3IH3A 3RPUD 4PNEA 1RWXA 2ID4A 5CB4F 5MN5A 4YIFA 3MWYW 2BAGA 4R7GA 3BD8A 4ENKA 2HRRA 4I1UA 1TX4B 3VPSA 3BZBA 3E4DA 4A3MJ 1SY7A 5FGMA 3TLZA 2JAWA 4DARA 5ERXA 3F7OA 4GPIB 5TISC 4GPD1 3GRUA 2I4MA 4AVZA 4QGBA 2PZMA 4UMVA 3HYCA 4CF7A 4HAVA 2M6LA 1L7PA 3ABUA 1L1EA 2QD3A 4HLUC 3A1NA 4V2GA 4B75A