3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
3UA3A 3MHTA 1HKQA 2VE8A 1TNTA 1IRFA 4FT8A 3KQSA 4CYDA 3KPJA 1IXRC 2IGTA 2NNNA 2JT1A 4LGWA 2RV8A 4UHTA 1RI5A 5KQSA 1ZAOA 2ZIGA 1XCVA 3I5UA 2WTEA 4YIFA 1YS7A 1XGSA 4Y13A 4X61A 1I1SA 2AVNA 2QM3A 2GPYA 4MHTA 3VSEA 5HVQC 3OU7A 4FSXA 3FPHA 1OR7A 2G70A 2EFOA 2FMLA 4F7ZA 4I0BA 3OV8A 5ED4A 2XUBA 1B6AA 2V79A 5FD6A 2NAZA 1L9KA 2Z3YA 3DULA 3IEIA 3C1DA 1NBHA 2FSWA 1WWXA 3KQTA 2I7CA 3BGDA 2ZJ2A 4HW0A 5D4SA 1JG2A 2MLKA 4A6DA 1XJ5A 2IBSA 1YW7A 5E9QA 2ZFWA 1FSHA 2A69F 2WK1A 2EG5A 5L3DA 1YF3A 3BJAA 4LG0A 3EVZA 2G71A 2UXXA 3HRSA 4P7FA 3FUTA 4HGZA 5ILVA 2F8LA 2YUIA 5LEJA 1WQ2A 2HTJA 4M7RA 3SXJA 5FQNA 2STWA 5K0EA 4F86A 1T38A 4M73A 2VBXA 2XAFA 1BI3A 2RC4A 5ILSA 4DKJA 1YLFA 3PQJA 1BN5A 3IWFA 2AOWA 2OXTA 1XGMA 3A7DA 5CVRA 3PX2A 4QTUB 3GZ5A 3MAJA 1B1BA 4A0YA 3QPHA 1NW5A 4LG1A 3MZYA 1TW2A 3HCAA 2DLLA 1NT2A 3CUQB 5K0NA 2LKPA 3HTSB 2IBTA 3KP5A 4GCVA 4O6JA 4X63A 4YUZA 3I58A 4L9VA 1NV8A 3V8KA 5MHTA 3M7GA 4LD5A 3BWBA 4K2EA 5H20A 4RYLA 1Z6TA 1JTFA 3NQOA 2OZ6A 3IHTA 3G5TA 1O3QA 2EWNA 1S8NA 3GGDA 2EJRA 2O07A 5K8VA 3RYPA 2G7HA 3KQVA 3QOXA 1RUOA 4YFKF 2QBYB 4KIFA 5GM2A 4I7HA 1VTNC 1YIOA 4BLUA 5E1ZB 2Q2EA 1EH7A 1YTYA 1DPUA 1ORIA 1JHFA 4EV0A 4FP9A 1R1VA 4IXAA 2NXEA 1ZREA 4MNUA 3IRRA 5T67A 5JUWA 2GA2A 3GDHA 4KW7A 3KPVA 2XAJA 4C06A 2C7OA 1ZGJA 2JHAA 2GIVA 2XVCA 3P8ZA 3J81K 4HC4A 3HSEA 1Y0UA 4EGZA 1UCRA 2XVAA 2PT9A 4EQZA 1JR4A 4DCGA 3DLIA 3GX4X 1INLA 4R05A 1HKSA 2XYVA 3QP5A 2MBFA 4QPNA 5E8GA 4KA4A 2L3DA 3T0YA 2XV4S 1MKMA 1SQFA 3ZN1A 3HEMA 2PX8A 2COMA 3A27A 5E2BA 3DQVC 3R6TA 2XYQA 1XCBA 3GO4A 2FRXA 5HDNA 4IRIA 4AIJA 3F72A 2ZZKA 2PXXA 2G7UA 2AOUB 4G7ZF 1FX7A 5J8CA 3BUSA 2HZTA 1OYYA 2IW5A 1XD7A 2R3SA 4CXMA 3FM3A 3RDIA 2HMYB 3FTFA 2W85A 3HTXA 3V7CA 4G9YA 5DCFA 3EGIA 4WCGA 3MQ0A 4M72A 2ZFUA 3DKWA 2UYQA 4YMHA 4LLNA 2R7FA 3HOSA 2ZMEA 4KN7X 2AXLA 4ENMA 3KP4A 3EVGA 2Z33A 5HIIA 3U81A 1VQ1A 2H27A 3VFZA 1YZ3A 4BP1A 4EM2A 3KR1A 3MTEA 3EGVA 3LKDA 2EA4A 1G8AA 3PQKA 2FCAA 4H0NA 3H3ZA 1OKRA 4QDKA 1I27A 5FULA 2OZUA 2P35A 5EQJB 5L3CA 3CC8A 5DM4A 2VBYA 4AIKA 4P7JA 3HSFA 1IN5A 4Q47A 1IM8A 2ACJA 4MHGA 4P9UA 2P5LC 3G8AA 2V74B 3TM4A 2E7XA 1WXWA 2DI3A 3LA2A 1CF7B 2JJQA 5F6FA 2HKXA 4HTFA 4PCLA 2UYOA 4LWPA 4PINA 1QQIA 1ZH5A 4MEXF 2ZWVA 3J81Z 4BLWA 2JH9A 4PYKA 4XUEA 4WVLA 1KU7A 1DL5A 1J5YA 4POOA 4GOOD 4HX8A 4PYLA 3H3UA 1YB2A 1B9MA 1ZG1A 5DWQA 4M9XA 4S05A 5D5WB 1IRGA 1F38A 4R8RA 4A6EA 3V8JA 2XRNA 3RKWA 3D5LA 1FBNA 3DPLC 4M6YA 2DTRA 5FD5A 1NW7A 2BM8A 2ZCWA 5EKUA 2OD5A 1K78A 3GO5A 3HP7A 3IYLW 3F8BA 4GXOA 3RPQA 3BWMA 2OA4A 2NNYA 4P7GA 4E32A 1NW3A 5FFXA 3HRMA 3IHUA 1FYKA 3M6WA 3BGVA 1RJFA 3B3GA 3TM5A 3MQ2A 5DSXA 4OQDA 2HGCA 2F5DA 1L3CA 1X3UA 2ZIFA 1NHAA 3W6KB 3MWMA 4BHBA 1NV9A 4M38A 3A25A 1E2XA 1PP7U 1FZPB 4R8SA 1KGSA 1R18A 3UJ9A 2QRVA 4YUYA 1UWVA 2UZKA 2FQ3A 5LRSA 1GXQA 5EHIA 3FM5A 2ZNYA 2QUFA 1W5TA 1WZNA 3AXTA 2LF8A 3L9FA 5EG5A 1DCTA 5M5BA 3GUDA 2A14A 4G6DA 2Z5UA 3HIFA 3P97A 1GVJA 5CVUA 1QZZA 2O6GE 4X60A 3HCCA 2QY6A 1F1ZA 3DFGA 1QO0D 2VS1A 3BDDA 5FA5A 1ZN2A 1YO5C 2A68F 5DCMA 5D8KB 4LG0B 1D3YA 1YG2A 2JHCA 3F4KA 4LB5A 2M8EA 1Q1HA 3T0IA 1BIBA 2NXNA 1P92A 3DTNA 1AWCA 1J7KA 4WK8F 2PFBA 3F6VA 1HKTA 5EMMA 2FMYA 2A6EF 2HYFA 5HLGA 3DP7A 4R79A 2WWYA 5HIMA 3QV2A 1I6XA 4YV0A 2O61A 4YG2F 2A07F 2IVMA 4OQEA 1MDMB 4D0PA 4P5OA 4P96A 1E17A 1UFMA 3M8EA 3BT7A 4RTSA 3SR4A 2BR4A 4MTEA 2ERCA 2ZSUA 3HNRA 3SQNA 1KPIA 3KP3A 2F5CA 3WTZA 3ELUA 2RVCA 3K0BA 1FT9A 2FNPA 3EDPA 3M6XA 4MEYF 3FUUA 3UZUA 3NWBA 2XGXA 2VOOA 4M6XA 3KQQA 4H0EA 3RKYA 2AS5F 1NKVA 1ORHA 3UA4A 1G38A 2RKHA 2B2CA 5BPDA 5D6EA 5HOQA 4RVFA 3FTEA 3KLOA 4ZH4F 2O05A 3KLNA 4HG2A 5K5RA 5HFJA 2AOTB 2NYUA 1RI4A 3WTWC 1YS6A 2J5OA 1FBQA 5DTMA 2W24A 5EZSA 2ZBPA 4XUDA 3KHKA 3OU6A 2FBKA 1HNNA 4PYMA 3LCCA 2GA1A 1EQAA 5BS6A 5EIWA 3IRQA 2IDKA 1VP3A 5ICFA 4C4AA 2NP6A 4WX9A 3JWJA 1G3YA 5KYGA 2JSCA 1TBXA 4RTKA 4GYGA 4JBAA 4E2ZA 1ONVA 2ISYA 2KIFA 1IXSB 2GS9A 2EB7A 3Q9VA 2DK5A 1I5ZA 1SD5A 1XXLA 3EQLF 5K09A 5CVVA 2EV6A 2XIGA 2HWVA 5HILA 1IW7F 3QRFF 3PLAE 1F5TA 4U7TB 4PCQA 3HVHA 4GF5A 1ON1A 2VT3A 2XKOA 3P9NA 2Q8KA 2OB2A 5LLQA 5L3EA 3Q87B 4HF2A 1EH8A 4UOEA 2OQGA 1DP7P 1BHJA 2KIUA 2V7EA 1T2KA 2VC1A 3LA7A 3T5XA 1G4DA 1XSVA 2EFPA 1QPMA 3CLOA 3ZMTA 1MD0A 3GYHX 3DUWA 3FHZA 4BXUA 3FXUA 2GLUA 2M30A 3DXYA 4V0RA 3F23A 1U2WA 4WXDA 4UV8A 3SZPA 2IRFG 2RDPA 3NEUA 1RI2A 2A61A 3BROA 4EJOA 4M37A 2NXJA 2AN4A 2UYCA 3ISPA 2CO5A 2IPQX 2M5WA 1ZG5A 3PS9A 2NS0A 1HW2A 1X19A 1ZLJA 4KNYA 1LDJA 1USTA 2ZMEB 3FUXA 3M1EA 1FNNA 2BE5F 5DM1A 4CTKA 1TQIA 3TKYA 4G7HF 2VOPA 3DMGA 2EK5A 3GLXA 3ZP5A 1D8JA 3O4FA 4RAYA 2QZ8A 5CM2Z 2PXAA 5GM1A 1QANA 1OPCA 4RV9A 4AIHA 1KQ8A 2BZGA 1KU3A 2PY6A 1D2GA 4O3MA 3RTRA 5CIYA 3LBFA 1VPTA 2OO3A 2DAOA 3WODF 1UFKA 1JSZA 2VN2A 2ZZMA 3ERCA 2KRFA 4HTFB 1L1EA 4ESJA 4UUVA 5K5QA 1JG4A 4HGYA 2GZWA 1H9GA 4IRHA 4KDPA 3CJTA 2IP2A 3KZZA 3DMFA 5K01A 4ON0A 2PXCA 2JPCA 3OPNA 2O03A 4Q5SF 3P9IA 5D4RA 5BW5A 1LDDA 5K03A 5DLYA 4I0AA 4RB3C 1Z3CA 3C6MA 4PWYA 4ZYDA 1KQ0A 4M9SA 4EJWA 5CVIA 1HMYA 3RKXA 3O31A 1QGPA 4MIKA 2AN5A 1X1CA 1X1AA 2Z6UA 5EEHA 2Z6AA 3FXQA 2G9WA 3SVZA 3HA5A 3TPZA 4AZSA 3R60A 2VE9A 5E9JA 3HCFA 1VIDA 2OY0A 3EETA 4M71A 5IH3A 4FR0A 3B73A 4P9FA 1QAOA 3GJYA 3UJ6A 1SVUA 5KQRA 2IH4A 3ULQB 1MJBA 3UJ8A 2YX4A 4KIBA 4ENNA 4HBLA 3JWGA 3K0LA 2FE3A 3ABUA 1F4KA 5DPMA 3P9CA 1R00A 3ME5A 3DR5A 2LNBA 2M1BA 3LFKA 5EPEA 4U0VA 3B89A 1KP9A 4RTPA 4E2YA 4KRGA 2PX2A 5DCMB 4UVCA 5P8WA 4Q4ZF 3EYIA 3BJOA 2HV9A 3HCBA 4OX9Y 3JTHA 2ZW9A 1P91A 4YUWA 1M6EX 1O7LA 3SSMA 5C1IA 5GWXA 4G8XA 3NJRA 5T6BA 1JSXA 2AS0A 4Y15A 1IZ1A 1I1GA 2JG3A 1BOOA 1JTEA 4HH4A 3H2BA 4QWQA 4HV5A 3MERA 4GC5A 1D5VA 4PZJA 3AXSA 1J2XA 5DX1A 3E6DA 5F64A 1HSTA 3WU1B 1XDSA 3LSTA 1P1BA 3Q5FA 1SKMA 3A7EA 2NYXA 1L3IA 5H6QA 1IY9A 3NTVA 4OIQF 3DXXA 5E8RA 1Q0SA 1YW9A 2HDCA 5LQKA 1N7IA 3G88A 2ADUA 5LHGA 3N97A 3COAC 4EKGA 4HAMA 1NW6A 3KP2A 2EV5A 5L3GA 1A04A 2N47A 5K0CA 2RQPA 2C6YA 3CKKA 5E17F 4PYOA 3FYDA 4JQFA 2FF4A 5D5VB 3I54A 5FADA 3EVFA 2DPMA 4E2XA 1FWZA 4DQ0A 4AX8A 1R8XA 3F22A 1EIZA 5DXAA 2FPOA 4L7VA 2D1VA 1JQEA 2D2WA 2CWEA 2ZIEA 2E1CA 1SD7A 1RIOH 4XLPF 3I53A 2PI0A 3KQMA 1OYWA 1H0MA 4HQMA 3MEXA 2HNKA 1R23A 2NP7A 2B25A 5EKXA 2O3FA 3E05A 3UFBA 2P1DA 3GRRA 3HM2A 3RJPA 2XAGA 5F1RA 1LB2A 1MJAA 2VT2A 3ZQ7A 1Z1DA 1B42A 4S04A 1S3JA 2P3QA 3HA3A 4RTRA 3CUOA 3M9AA 3ER9A 4XCXA 2YR2A 3UJAA 3ML6A 4EM0B 1JQ3A 2JRTA 3I64A 1U5TC 2HFHA 2CKDA 4IJAA 3K9TA 3HRTA 4U0WA 4CICA 3WG9A 1XB4A 3V7SA 3KR0A 4ISCA 3KKZA 7MHTA 1XCJA 5ICEA 2L54A 5EMKA 2CQKA 5DSTA 1R7JA 4RX1A 2FYTA 3REOA 1IXCA 2LD4A 1QNTA 1R5HA 3FMSA 2K27A 4Q48A 5KVAA 1NW8A 4OA8A 4QLCU 3UBTA 4MGRA 2DPDA 2PBFA 2PWYA 3FPEA 1WXXA 3KR9A 3ER8A 3FZVA 3FPFA 4XRFA 5EMJA 2RN7A 2Q0OA 3O7WA 4A0XA 2GXBA 3R0QA 3ZMVA 2ZCJA 3K69A 5DDGA 4HZFA 1REPC 4L9JA 1BC5A 1S6LA 2NXCA 2P3LA 4PYIA 3WTUC 3BKXA 2QENA 5DEQA 2IIPA 2K86A 3FF5A 4BYYA 4DMGA 4RB0A 4HV6A 5L3BA 5E1DA 1Z6RA 4GEKA 1G6Q1 3ROUA 1R74A 1X1DA 5HLHA 4C04A 2PWPA 2DK8A 5E1WA 5F2KA 2PMUA 1L0OC 4OU0A 2CYYA 2E1NA 2GWRA 3MB5A 4R6XA 1HSJA 3GRZA 2B0LA 3CO7C 2WC2A 1BC8C 5DD8A 1KU9A 4OIPF 5ILUA 1KXZA 3X0DA 3V8LA 3DXJF 4A12A 3MCZA 1HW5A 1TLHB 3WE2A 1BI2A 3WTVC 2BBYA 3MFKA 1XVAA 1S7OA 1HQCA 2VBZA 3FZGA 1D8KA 2NNWB 2G1PA 1I1NA 2IA1A 4IV8A 2GXGA 4BQAA 3P2KA 3KPUA 5L3FA 4ETSA 3L2CA 1PJZA 3B5IA 4NQWA 4UXNA 4N9IA 4LLLA 3TMAA 2K7LA 3E6BA 1L3LA 4FS8A 4PGGA 4KN4X 3T8RA 3GRYA 1SFUA 1UHMA 2ESHA 1L3BA 5H02A 1QBJA 4YMGA 5LQJA 2ZBKA 3G3ZA 4XBFA 4ZYHA 3R61A 3LQQA 1XDZA 1U78A 1KU2A 1QYRA 1TQPA 3QOPA 1YUBA 3V4GA 3LGAA 4RWZA 4DA4A 4YFNF 3TOBA 1T0FA 3K1NA 3N4MA 3L09A 1D2HA 3I9FA 1SMTA 2PX5A 1RI1A 5DX8A 3SHFA 2CMGA 2FEZA 5AIPA 4EJUA 2XAHA 1U5TA 3EVAA 4MQVA 1SQGA 3CJNA 2P7HA 3QOWA 2Z6QA 1SMYF 3IKTA 2NRAC 3F8CA 3IKVA 4U7BA 3WTSC 4UV9A 3WTTC 4PYQA 3E6MA 4OMYA 5E2AA 4PYJA 3ID6C 4GO1A 3G73A 3T7TA 2O0LA 4P7KA 1KA8A 3GFMA 5K1YA 1Z05A 5FGMA 3HRUA 3LBYA 2FA5A 3EMBA 3LA3A 5FLXK 5FA8A 3OZRA 1JE8A 3E23A 4ZYGA 1EG2A 2XASA 2H1RA 2IPXA 4B17A 5B1SA 4FHTA 5HIKA 3ELWA 2O8XA 3EVDA 1VL5A 3GFLA 1XTPA 5KK1A 2JHPA 1XN7A 1YFHA 4IKPA 5DRTA 2MC3A 3CTAA 5K0BA 1U6GA 2FK8A 4L5IA 3I71A 5E8IA 2STTA 2BYVE 1XMAA 3WE3A 2ETHA 1T6SA 2AVDA 2OQRA 2KW5A 1Q0TA 2PT6A 2V1DA 2C7PA 2B3TA 4MQ4A 3FXRA 5FWAA 3VC1A 4AZVA 2YXEA 5E9WA 1GHCA 3LAJA 4KFCA 2PJDA 4NB5A 2GQQA 3BWCA 3DH0A 1MZBA 4HA8A 2HYGD 5D6FA 2WA1A 2VONA 4IHSA 4CGZA 4ER3A 1FP2A 4I09A 1TW3A 4LFUA 2GB4A 3TDUC 4E30A 3WU0A 1P2FA 1QAMA 2BR3A 1WRJA 2H6CA 2M45A 2P6TA 3UJCA 2F5FA 3IC7A 3V7RA 1BI0A 1W4MA 4LB6B 1RNLA 3BY6A 4BH9A 1V39A 2O06A 1K79A 3RODA 3GVAA 3SXYA 3ECOA 1YFLA 1FLIA 2PGXA 5J6XA 3HCEA 2L4MA 5FQOA 3DMHA 2JTVA 5DYMA 3RW9A 1O3TA 4YIIA 4ESBA 1XGOA 3ECHA 1WKMA 1ON2A 1HBXG 2Y1XA 3VYWA 1RI3A 5HDKA 1WS6A 5C0OE 4HX4A 2PMHA 5DUIA 3TKAA 4GC9A 2PBIA 1R22A 3VB2A 1B59A 4F85A 2LDUA 2EFQA 5K0LA 2CWWA 4HF1A 2UZ4A 3BPVA 5FLXZ 2EV0A 4AZWA 3LHDA 3F21A 2IA2A 3HHGA 4WXHA 3LWFA 5JFRA 1RI7A 1XMKA 4OIRF 1AF7A 3PVCA 3V97A 1FYMA 1X1BA 3THRA 2IDJA 4KDCA 3LDGA 2X4HA 4MTLA 2YVLA 3AJDA 3NW9A 5E1OA 4L0YB 2P40A 1USSA 1LEBA 2D45A 1KYZA 2ADMA 2XROA 3WGGA 3WSTA 2YXLA 4IF4A 2MH2A 1FC3A 2Z99A 2PN6A 2R7DA 3NRVA 2EFJA 2L4AA 1UHWA 3WGHA 3E8SA 4GOLD 2QE6A 3B3FA 1B9NA 2XKPA 2EJTA 4YUXA 2PKWA 3F8NA 1HW1A 3C3WA 3P9KA 2ISZA 2FXAA 3DV8A 1JHHA 1O7FA 4A0ZA 5FB2A 2P5VA 1PUEE 4LK1F 2HQNA 2O0YA 2ZVJA 1IUYA 2DULA 1YZHA 1Z9CA 2VDUE 3WTYC 4A5NA 3J80K 3LAPA 1KR5A 3GZ6A 3VC2A 3AWIA 4QVGA 1HXDA 3SZTA 3GEZA 4I98B 4IVNA 1I9GA 3F3XA 4UVAA 2X0LA 3QPTA 3MGGA 3TDZC 1J9IA 5BPIA 3THSA 5LQUA 5GP1A 2A6HF 1KIAA 1I4WA 2V9VA 3G8BA 1OR8A 1JGSA 4Y17A 5JR3A 2Z9OA 3L00A 1ZG3A 2RNJA 1TNSA 1LNWA 2ZNZA 2YQZA 1IN7A 3KPWA 4YV2A 3JW4A 2KJCA 4N9HA 4RVGA 1XDUA 1FBSA 2AOUA 3GF2A 3G2MA 3HCDA 2VDVE 3BJ6A 4C08A 2D1HA 1SG9A 3HA7A 1G3SA 4QQNA 3G2OA 5K05A 1G6NA 2TDXA 5FWDA 2HR1A 9MHTA 4CWAA 4OBXA 3K1MA 3OOPA 3E6CC 2E5WA 1BOAA 3IV6A 1ZQ9A 4YFXF 2B9EA 3UJ7A 2VZ9A 5FO5A 3R3HA 2RGVA 3FYCA 3U9GA 5CVEA 5CCXA 2J5PA 2K4BA 5DXJA 4AUKA 3TO6A 2WV0A 2PV0A 2YX7A 5IKMA 3QAHA 1IN8A 5EZQA 5DTQA 2IT0A 5FUBA 1AV6A 1S29A 1YYVA 2BEOA 4ZZLA 5K5OA 1T98A 2VC0A 3F6OA 4HLXA 1XGNA 5LSAA 3GRVA 3KR2A 2QQ9A 4CHUA 1IXKA 3HVIA 1K78B 3ZMUA 4IRGA 3ZMDA 5J8FA 4KVZA 5LGNA 5GIPE 2LSOA 5E1MA 5CVJA 2WA2A 2I6GA 2BV6A 5D8LB 3TRKA 2HTSA 5LRRA 1LJ9A 3EGEA 3EYYA 2YPRA 5LR6A 3JWIA 1U5TB 3RIRA 1O3RA 4LJZF 1C0WA 4Y30A 3ANXA 3J80Z 3TLJA 5D1HA 4JXJA 4HX7A 2IJLA 3BZBA 3M6VA 1AQIA 5KS2A 1FOKA 2QRVB 4IWNA 5T64A 4CDGA 2DPUA 3SSNA 5LHIA 3E3VA 3KEOA 3JWHA 1STZA 2GAUA 5HDGA 4PGHA 4ESFA 5G02A 1ZHFA 3P7NA 3WTXC 2OYRA 4HDVA 2KIMA 2DW4A 1BJAA 3ZPLA 1W7PA 3PFIA 3Q9SA 3HTUA 4DF3A 4HLYA 2PLYA 2Q41A 2GH1A 3A26A 3LKZA 4FT4A 3E5UA 3I59A 4KIGA 1SFXA 3ERED 5BP7A 4CXFA 5U4XA 3U2RA 3ZMSA 2F5EA 2V1XA 4M74A 1SUIA 2BH2A 2V6CA 2KKOA 2QWWA 3V8VA 3RPUA 2YR0A 3IWZA 4DQ2A 3UJDA 1WY7A 2H00A 4QQKA 5LEKA 3BKWA 3HYIA 2UYHA 4EGYA 1AQJA 1ZRFA 5CYVA 4DNCA 1Z91A 1EH6A 1FPQA 2CW0F 4R8HA 3KZYA 3LCVB 3T7SA 4A2UA 2DQLA 4GOMD 2Y75A 1SD4A 3FMQA 1KPGA 4C03A 5BMZA 2IFTA 1EJ6A 1W5SA 3RYRA 3L8DA 1R58A 2FBIA 1N7JA 4ENKA 4JK1X 3OFJA 2HTEA 4OMZA 2Y0MA 2CMHA 3KPYA 4OIOF 1PP8F 2OB1A 2EA2A 2QQBA 5C9ZA 3J7AO 4ER6A 2OU2A 2EFNA 2DO7A 4G94A 4FSDA 3D2LA 3G5LA 3M70A 3OE4A 3TQSA 4M9ZA 3GRUA 4CKEA 4WXCA 3HUGA 2BM9A 3DOUA 1UIRA 1MDMA 1T43A 3DLCA 2CL5A 5JI6A 4Y2HA 4RGRA 5EVJA 4E2WA 4X1OA 2ZXJA 2XHKA 3O3KA 2ESRA 1EAMA 1R1TA 3BGIA 3UJBA 3QP6A 5JHUA 2W84A 4CKBA 3KU1A 4GUAA 5E20A 4EKIA 4U7DA 2YX1A 2K02A 1VBFA 2G8NA 1UB9A 4R1HA 2VODA 1RJEA 2ZZNA 4MQ9F 2H94A 1BBYA 4BNCA 2FK7A 4UNOA 2AOVA 1R6AA 5LQRA 2HS5A 4IPAA 3FTDA 5HOOA 4WWCA 3SX0A 1FP1D 2OPBA 2ZBRA 4QVKA 2AOTA 4RAZA 4N0BA 3O2PE 5HS8A 3SSOA 1WI9A 4L18B 4XSXF 4IHTA 3OCJA 5ICGA 5E1BA 2LF7A 3KE2A 3CCFA 5DT2A 1DUSA 3OE5A 10MHA 4HSGA 2Y48A 4HQEA 3NWEA 3TGNA 1J0RA 1O9GA 1RUNA 2AOXA 1MHTA 1TPYA 3E97A 3E5XA 3FTCA 3GCZA 2P7CB 1D2CA 4HYEA 3TR6A 4BAYA 5E18F 4B09A 3CGGA 2AN3A 2DQRA 3LL7A 4RSRA 3HOTA 1OYIA 5IT9K 4OINF 4G56A 4U7PB 5A2QK 3HVKA 3LDFA 2UXNA 4GGGA 3EMDA 4OA5A 1T39A 3I0TA 4FT2A 3C3PA 4L5JA 2DU9A 3HVJA 2ELHA 5AONA 4KMUX 3T8TA 3R4KA 2CSOA 4FX4A 4PNEA 1KHHA 1R8YA 3PB3A 5LBQA 3K2ZA 1K7AA 3C7JA 3DF8A 5BQTA 1LQ1A 3VEPA 3CJQA 2CG4A 4B8XA 3TO9A 1LVAA 2PG4A 3NDIA 4LMYA 3M33A 3QU6A 2V1UA 5HZMA 6PAXA 5GOZA 1WG8A 3W6JB 3DXZA 4RB1A 4EJTA 4HDUA 4CKCA 1G3TA 4RS8A 3P2EA 2I9KA 5DM0A 4R6WA 4ZTBA 5HIJA 2IH5A 2ZLBA 2B78A 3TOAA 3K1PA 1W7PD 5KVRA 2HEOA 5EOVA 2HR3A 3CJRA 2K4JA 4DCMA 3T7RA 4PIMA 2ONZA 4IV0A 1J75A 1KPHA 1F9NA 3P71T 4GBED 2XYRA 4X41A 1DPRA 3HSRA 1BC7C 3FRIA 3B02A 2ESNA 3R6SA 4EMSA 4XUCA 2P4WA 5ERIA 3SGLA 3B3JA 5CUQA 3NMUF 5HS9A 8MHTA 3KQOA 1K6OA 3NDJA 2PLWA 3EPPA 4NECA 3Q7EA 3LQRA 4RGXA 2YTZA 1GXPA 4EJVA 3ELDA 4O5VA 1IN6A 4C05A 2F2EA 2ZTHA 3OZTA 4BLVA 4LECA 4QTTB 2ONYA 1O54A 4AD9A 4DZRA 2ORED 1MJ9A 3EUHA 4U88A 3CUQC 1PDNC 1KQ9A 5DUKA 4ZYEA 3FPGA 2EFWA 2OBPA 5DRYA 3GW2A 3MCTA 2YSRA 2FOKA 4WF2A 3MTIA 4ENJA 5CVDA 2A5YB 2HOEA 5IT9Z 5A2QZ 4ER7A 4ASNA 3SM3A 4LWOA 3R9XB 1BIAA 5HS7A 1V4RA 2JPBA 3SMQA 5E8JA 3QU3A 1XSDA 2MA3A 1U3EM 2HKOA 1H1DA 2JZYA 1SFEA 2GAFA 5CD1A 1RZ4A 1AOYA 3A4TA 1W7PB 1QAQA 2BR5A 5GIOE 3E5QA 2GA9A 3CVOA 1M6YA 1EJ0A 3I59B 4I01A 4RVDA 4V0QA 2CFXA 1WSUA 3FPJA 3GIWA 2I62A 3AY0A 1ZYRF 1J59A 4ER0A 3R0AA 1V3FA 1IAWA 4LLGF 3R0JA 1FSEA 4AWXB 3OFKA 4KMFA 3KQYA 2K4MA 3HHHA 3KCCA 2VBWA 2DFIA 4O29A 1MGTA 2QLZA 3ELYA 3KQPA 2C7RA 2QQAA 4M36A 3VOEA 2W25A 4E33A 1SUSA 4Z2YA 5JVTA 2VDWA 5EGSA 4QPPA 1O3SA 4L9NA 1YQAA 2IA0A 4EK9A 2ZKZA 1JQDA 3M6UA 3ZN0A 5K0JA 3U1DA 2XVMA 2OKCA 3F8MA 3MZHA 3FUWA 3B7PA 1DUXC 4CO8A 2R6ZA 5DM2A 5FHQA 1ULYA 5DD4A 5D5XB 1U8RA 5F2NA 5GINE 2PEXA 5F2OA 1BI1A 5CJ9A 5E1XA 4XSZF 5FCDA 3PX3A 2H09A 3FMRA 3L7WA 3NVMB 2MD5A 4HOBA 4BHCA 5BXYA 2O57A 3S68A 5ICCA 3OZSA 4AVPA 2A3SA 2W57A 2P8TA 1QZYA 3PTAA 5DV5A 4EQQA 3KQWA 3KP6A 1P4AA 3F8FA 2AZTA 2YU3A 1YFJA 4P58A 3EEOA 3TOSA 1B4AA 5TJJA 5LGTA 5IT3A 1PRYA 4RTNA 2XBMA 1O9HA 4BHPA 4A5MA 3FRHA 4BP3A 4KUMA 4K6MA 5D1NA 3EVCA 3DPTA 1R5GA 2P41A 4QDJA 1LDKB 4PYNA 4YUVA 2XAQA 4G6QA 2P3OA 1G3WA 3PFHA 3EVEA 1S7AA 3EEYA 3G2PA 4I02A 4GYIA 3JSOA 2VP3A 1BKYA 3JAMK 1G60A 2HQRA 3SFZA 5EEGA 3T1BA 4L9TA 4DM3A 5HEKA 4RTJA 2PVCA 3CUQA 3E7PA 4RGSA 3MAGA 2MLGA 3O6BB 2E7WA 1IF1A 3LDUA 1DDNA 4RTMA 4HRAA 1ZLKA 4GOND 5H6RA 4KDRA 1BM9A 5TRDA 2H11A 1P4WA 3FUVA 1P39A 3G2QA 3GU3A 1SD6A 5EC8A 3FX3A 3OU2A 4PIPA 5CLSA 3BZ6A 3C6KA 2G72A 3PFGA 4GQBA 3G89A 1KYWA 1JXSA 4ER5A 3CO6C 2QBYA 2P8JA 4FGZA 2QVOA 4RB2C 2PJPA 4C07A 4TV7A 2OZVA 2OBFA 4UVBA 2QYOA 4P55A 2FHPA 4AZTA 3FWEA 3KETA 4RVHA 1TTYA 1U2ZA 1H9TA 1CGPA 1EV7A 4CZZA 2EJUA 5BW4A 1NE2A 2FNAA 2YXDA 3M4XA 5EHGA 1FBUA 1R1UA 2PX4A 2ZULA 3PT9A 3BPXA 3D0SA 2UWMA 3RIEA 5ERGB 1XSXA 4FX0A 5DX0A 3C0KA 1G8SA 3TFWA 1FYLA 4U0YA 1MJFA 3NVKI 2DBBA 2P7IA 3KP7A 2BGCA 5LGUA 4L0ZB 3GXOA 5FFZA 1XCLA 3C18A 1ODDA 1RJGA 4XLNF 1FY7A 3CDHA 2MH9A 4LK0F 2VXZA 3ZMZA 4MWZA 3LCUA 5EIFA 3DEUA 1G55A 2Y1WA 5CCBA 3JAMZ 3IL2A 1IN4A 2FRHA 5AIQA 2P7VB 3P2IA 4PDKA 4OOIA 4EVIA 4KWCA 2PQ8A 3BXOA 3TO7A 2DT5A 2IH2A 4KT5C 4BY9E 3BP8A 3LX6A 4PONA 4I2OA 5LQCA 2M87A 2PSSA 4E70A 3M8FA 1VP9A 1M0EA 4FZVA 2C7QA 3GFIA 2ZBQA 5K0FA 1Y8CA 4ATNA 2JH8A 3K6RA 4CTJA 1YW8A 1JG1A 3KEQA 5BOXA 3KFWX 2KJBA 2L02A 1VE3A 1P1CA 5FHRA 1FJXA 2OAZA 1SAXA 4NHJA 1Z7UA 1ZGAA 3BWGA 3BOQA 4RGUA 1RJDA 3H92A 3JTGA 1F3LA 3VODA 5LHHA 3GNLA 3I4PA 3RI4A 3ORHA 1N2XA 3GWZA 4EM1A 4OBWA 1CF7A 3CBGA 2CGPA 5D5UB 1TQMA 1NBIA 5LQNA 4ZZDA 4G7OF 1ZKDA 4RTLA 2P6SA 2ZWAA 2FBHA 4RTOA 1R36A 4KICA 5HLIA 1LEAA 1ZRCA 3TQNA 2H6BA 2FU4A 3GFJA 2ZO4A 4HF0A 1ZRDA 5LQAA 3EVBA 3ABTA 2P5KA 1VLMA 3BWYA 4MTDA 3UWPA 1ZARA 4E31A 4KYWA 1OMIA 5EMLA 4YV1A 1P6RA 2AR0A 3LECA 3JSPA 3ELKA 4RTQA 3G7UA 2EX4A 1O57A 5K0GA 1JG3A 3AAFA 1P4XA 2L01A 3WGIA 3S2WA 4F84A 2HWKA 3LPMA 3C3YA 3R24A 4PCAA 5FTWA 5DTRA
chains in the Genus database with same CATH superfamily
1TK3A 3B2NA 5HGJA 2DTEA 2R7NA 2QMEA 4FT8A 2NVQJ 3DWLE 5E3HA 1KDZA 2ZIGA 1I3OA 3I5UA 2WTEA 3OWHA 3U4CA 2PBZA 2EVWX 3UB2A 4CM3A 1A9YA 1N36B 4R8VA 3DULA 4POAA 4LVOA 1JKPC 2VKHA 1T3TA 5SYAA 2JLCA 5ALXA 5D4SA 3NIFB 1L7DA 3JRXA 1D0IA 3A70A 4ZARA 5JNVA 4HGOA 1KEEA 4ZALA 4BUZA 3QF4A 5LP6B 1WQ2A 1U3FA 3AJ9A 2HTJA 4YI3A 3HUEA 3AR7A 2IAIA 5EE3A 4FPXA 2TMDA 1IPHA 3B2EA 1G8MA 3MAJA 2HF8A 1JWLA 3Q7IA 5TXGA 1W0KD 1E8MA 4YLEA 5KMGA 5JVGF 2ATIA 2LKPA 4GCVA 2BLNA 3RSGA 2HDOA 1NRIA 4KO2S 1QHHD 1IQPA 4B4OA 3BWBA 3HB0A 2RGXA 3TB6A 4XVCA 3GFPA 4HVAA 3KD3A 2NX2A 3DTIA 3W2FA 4L4YA 2G7HA 5AIBA 4JWTA 4YFKF 3BERA 4PQFA 5GM2A 3DE1X 3U7FB 4BLUA 4W1PA 2I22A 3H5NA 1W49A 5BRJA 3MOIA 3ROPA 3VR2A 2GXAA 4U9UA 5ADWA 2F1JA 2NZUG 3RAJA 3ZCPA 4G5FA 1VGQA 4OIFA 1WQ4A 1NVBA 3BULA 1LI5A 2QXYA 2GHIA 3KUCA 3GFTA 2XBUA 2YL2A 1JZQA 3I8XA 4R7GA 3PXAA 3KWFA 2XRFA 3V2IA 4UEWA 1Z4KA 1QRSA 2ZUDA 4Q7JB 4TXLA 1WCMJ 5KNLA 2DUUA 3HTXA 3V7CA 2CNBA 5K8UA 3S99A 4WLEA 1E2IA 2J0UA 4KN7X 5KAFC 3LUAA 5D87A 1NI3A 1E2DA 5GADl 3H3ZA 4P4SB 5KBYA 5KWJA 3LPCA 3K0FA 1XMXA 3OURA 3CUTA 4Z0HO 1CY0A 1A6IA 3W04A 3MLBA 4BEHA 3LO5A 2H4ZA 1PYGA 5BSEA 3W5AA 4ZA2A 3ZWWA 1WXWA 1MDFA 1GLVA 4TKUA 3DFMA 1DOAA 1QQIA 4EY6A 4KEAA 3JQAB 3M4ZA 1SQ6A 2ZWVA 4HNAA 3DZ8A 1U9YA 1HDYA 3TRJA 1THGA 2XEXA 2G9VA 2YN0A 1PUFA 1CVLA 5DU2A 2ECBA 1XA3A 4QWMA 2BMDA 3QXHA 2QGUA 3SBXA 4R8RA 4GAEA 4DVGA 3VISA 1H2HA 1SCBA 3B48A 2FXIA 4IDOA 4XAQA 1KH2A 5DB4A 2VRWA 4CDNA 2BSAA 3CE9A 5ITWA 4PQYA 3IV7A 2D2IA 3HRMA 2BAGA 3IHUA 3U16A 3OHSX 721PA 1YQWA 2HGCA 3ZTTA 4KXLA 4IDPA 4CM9D 4LXGA 4ML3A 4FYYA 3R5SA 3AKZA 3A25A 1E2XA 1PP7U 1LUJB 1RCTE 3D8NA 3EGDA 3QE0A 4C3VA 5LRSA 1YVPA 1G63A 5GTIC 2VF5X 1W5TA 4MUFA 2OVBA 1E3SA 2WM9B 2IWHA 3O73A 3VNUA 5TGTA 3AJRA 4MKRA 3F4KA 1MMAA 3L5OA 5AT1A 1W36D 1B4DA 1KORA 3KFXA 2HYFA 1X7XA 3GLFB 4C9BA 3OIOA 2D1TA 4IP0A 2XE8A 3MHPA 4OYRA 4OQEA 1MDMB 4D0PA 1UMBA 3O4VA 3QYFA 4A10A 4U00A 2R8OA 1O3YA 3CZCA 3EJ6A 2F62A 4RMJA 3JU3A 1DAPA 3EGXA 4RMHA 2FNPA 5C5CA 1M8KA 2X1MA 3WIVA 2CQQA 4B46A 3UA4A 3KDPA 4B3IA 3JATB 4G25A 1EH5A 3AFOA 3J80A 4YY3B 1TJYA 2ZROA 1RHMA 3ETHA 5HF6A 1FFEA 1JEAA 3JWJA 2RHGB 4J01A 3H2KA 3CLRC 2RHWA 2K2WA 4ZT4A 5K4HA 1X0XA 4Y2QA 3Q9VA 3I9OA 2AMJA 3IDSA 1II9A 3A36A 5CVVA 1W1UA 3QY9A 2HWVA 4U7TB 4MW1A 3NBXX 3QE9Y 3OY9A 4B80A 3TZEA 4L0MA 2XGGA 2HLDD 3UT5A 1VQ8I 3T5XA 5AJYA 5IXJA 3KJNA 3DZBA 2ZIZA 2FJUA 3QU4A 1F4VA 3R3VA 3C5CA 2I2BA 1NXQA 5ALQA 3PS9A 2CN1A 3A0HC 2JI9A 4QEKA 1M34B 4V2IA 3KAKA 4PX2A 1HX7A 4RKYA 2WJVA 4RAYA 1Y82A 1ZONA 2QZ8A 4J7UA 2QT0A 2I71A 2GEDA 3COWA 3DV0B 1G4HA 4KZPA 3OLVA 2RGWA 4A0FA 5B3LA 1QZUA 1R12A 1HTTA 4AMZA 2Y1LA 1N3IA 2R2GA 1P33A 2XZOA 1B2LA 2G07A 1EXVA 2J0EA 2Q2OA 3KZZA 1DC6A 1F20A 1P7IA 1T8WA 5AR1A 4DQXA 3B1KA 3PWKA 3GA7A 4LYYA 3QPUA 2JI4A 4HVLA 1JEDA 4RHCA 4A1OA 3MCAA 1SVLA 1Z3CA 5DNWA 3GJSA 3KXLA 2OK7A 1YHNA 3EGCA 5JSZB 2MYPA 5A05A 1YRNB 4WNAA 1RPZA 3UMSA 3K0EA 5BN4A 2RCNA 2ETVA 5JQGB 2C29D 2IOFK 3AG6A 5B55A 3C1UA 5GJCA 2EYQA 4UBJA 2OAQ1 2VDWB 3ILYA 2I4RA 3LSRA 5CK4A 4Z4EA 4BL5A 3CT4A 1HZZA 4HBLA 3JWGA 3K2BA 3S2FA 4G0OA 3IMEA 4GEGA 1VRWA 5T4EA 4LRXA 1NW4A 4KRGA 1PWXA 1KOLA 4XONA 2H2IA 1V4VA 5M5XJ 3QWLA 1UK9A 1CE8A 4WZBB 1Y8ZA 1OCTC 4IG9A 2C9YA 2XOXA 3E2MA 2K9NA 4HH4A 2YFHA 2RAUA 3UC5A 1T8SA 2X4IA 4YGXB 1CZUA 4LUCA 2K3PA 1K88A 3PHLA 3QPCA 3V8QA 1FLNA 3G88A 1QCCA 5LJIA 3U44A 5L4SA 3AV3A 2PMKA 2QM0A 3GPIA 3I6QA 4J1SA 1FEXA 2GFIA 3A9SA 2DPMA 4CM7A 1FWZA 1ZSNA 5DXAA 3FCYA 4CI0B 4L7VA 2VZ0A 4O1HA 4XLPF 4DWOA 1P73A 1TX4B 1NP7A 2XWJI 1H93A 2R5YB 3I2JA 2OV3A 2WW8A 2XAGA 3RRYA 4KVGA 3G2NA 5JDIA 2C4WA 5BVGB 3WKEA 3E1SA 3JVUA 4K88A 1NASA 1A9SA 4IUYA 4OP1A 3A4IA 1PYDA 2PMFA 2FLWA 2JUGA 3BHNA 1CTQA 4QRHA 1QNTA 8LDHA 4D3SA 4Q48A 2YW2A 3DLBA 1YD7A 4J4BA 4AS1A 4EDFA 3UF0A 3ER8A 3NYRA 3O7WA 4G1UC 3R40A 2B7LA 3ZE1B 3O8GA 1CUXA 2P3LA 4PYIA 2GF9A 4JQYA 3U6BA 4RSMA 1FVHA 3KKMA 4GEKA 2O0HA 4JLWA 1TCCA 2PMZN 5FI1B 3ZHCA 2FZCA 5DD8A 4Z99A 2NOJB 2GYUA 3SQMA 1DEOA 3KPUA 2WPDA 1XJ0A 3LUGA 3Q0EA 1WNFA 2CUFA 2VZEA 2OK8A 5JSFA 5H02A 5CFPA 5JWOA 1DG1G 3CZ9A 3QYJA 5JI3E 4ARBA 1QVAA 1X7ZA 1C14A 4MGKR 1C29B 2QW0X 2FFBA 2WZQA 4CRWB 2H8WA 3SYRA 3RE1A 3OM1A 3PFKA 4JXXA 4IIGA 1D2HA 1K3TA 1XUOA 2VHEA 2G4VA 3W5IA 4JP0A 2Z9BA 4JLJA 3BSYA 1ZW1A 4HAIA 1KNXA 1NBMA 4ZZ3A 5E2AA 2ZXIA 2YASA 1P29A 3QGMA 4EHFA 5BSUA 1NNUA 2VDOB 3EC7A 4JL6A 2JKVA 3U7QB 1JU9A 1KMCA 1BAPA 4UTPA 4FHTA 5GONF 1Z06A 3Q15C 3GFLA 3C5WP 1HA8A 3PPWA 4V0OA 5DRTA 4ZVKA 3RK4A 1JEYB 2ETHA 2VJ4A 5FNVF 1PL0A 2C7PA 4ZODA 3H5RA 3FXRA 5GAEJ 1MAHA 1F6WA 4J75A 1M2VA 3WRYC 4XTCS 5E9WA 2GPAA 3ND9A 1PFKA 1QLWA 1XLTC 1MZBA 3RIGA 4OV6B 1TW3A 4A2QA 3WU0A 2R9VA 5ADHA 4X54A 5ALHA 2D74A 3CURA 4AD8A 4OWRB 3H13A 3H2ZA 5AKHA 2IHZA 1FU8A 1GR1A 3GVAA 2I5UA 2QJRA 4ZQFA 5IEJA 2FPGA 3Q8MA 2L2QA 3IPLA 4HAUA 5HKAA 4M9UA 4ILKA 3AHJA 3ITEA 1RWBA 2B1QA 2VYVD 3OJXA 2EV0A 2B8WA 4F2DA 3S1SA 4OSPA 3HHGA 2HUNA 2HIHA 1XMKA 3W8EA 3I3LA 3QYBA 2MR6A 4AI6A 1L5VA 1KDRA 4YHBA 2WAAA 2IDJA 4YVFA 3U3KA 1AKWA 1MW7A 1USSA 3QELB 1LEBA 5DM7F 3K70B 1K6JA 1WZEA 1O03A 1B9NA 3FFAA 3M1AA 5E3OA 3CNQS 3FNEA 1GDTA 4LSWA 1C9DB 2P5VA 2KM1A 3N0RA 1F4LA 4F7WA 1KQ3A 4PZ9A 1SUEA 3ESAA 3J80K 4I9UA 2HJ9A 3JYLA 3QWAA 2P2NA 3ECCA 2DR3A 5CB8A 3GNTA 4WK2B 1KI3A 1T4BA 1IBKB 3OE7D 4ENWA 2ZYTX 3U3JA 5E3IA 2JFQA 3UMCA 4GKKB 2GTPA 1Z88A 1E5QA 2EFEB 4XEUA 2L9SA 4I6GA 3BAZA 3UICA 1A3CA 2R7VA 4ND5A 2B9EA 4XYEA 2BUCA 2X42A 4YT2A 4AO8A 4BNIA 2IZ7A 3AI3A 2FSVA 3KVNA 5FUBA 5K5OA 4BNYA 4HLXA 2RHLA 4LTDA 1XIVA 1FFXA 5J5CA 3B8HA 3VNRA 2E5FA 4W5TA 1YRLA 1N32B 3F4BA 2OC9A 1KRWA 3OQJA 2OGTA 1YE3A 2CL0X 3O8OB 4G37A 1C0WA 2AN1A 3VOTA 2OCKA 3BZBA 2X86A 4LZPA 4S1PA 3KEMA 1N2BA 3CKMA 1STZA 2QD5A 2OUIA 3EF1A 1J39A 1B00A 4KC0A 2MJLA 4UMVA 3L2UA 1SXHA 3V6MA 2Y68A 1WDTA 5CAEB 2M4GA 1U4SA 1XZPA 4EOGA 2O2HA 2EWWA 1JXAA 3U7IA 2BH2A 3DZFA 3JV7A 3I56I 1D09A 2R47A 4QRIA 2YR0A 1J5XA 1N1GA 4GL4A 4QQKA 3F47A 5KREA 4UUMA 4B2LA 2B6NA 3SJ7A 2DM6A 4MUMA 1YR1A 2Q2QA 3RSHA 2BKXA 4UTZA 1PZHA 4JLDA 1OIVA 5AW7A 2EIJH 5DW3A 1EJ6A 3C2QA 3VO9A 3L8DA 2WD7A 1FE8A 1LFAA 2Y0MA 3NPAA 2PL1A 5C9ZA 2QQBA 4TZTA 1W47A 4E0BA 3FOEC 2BM9A 4M1EA 2UVPB 4RORA 1T43A 3UBMA 2H2FA 3FYUB 1ZD9A 2O54A 3PWTA 1T15A 4K9MA 3LPNA 2E2WA 5E20A 1EFVB 4E5SA 1S8AA 4PLHA 3ACDA 3ZU4A 4OB7A 3MJTA 1VI2A 3HJUA 3CVUA 3PNTA 4LZAA 4EGAA 5IKPA 1GCIA 3O2PE 3SSOA 1DAFA 4XSXF 4D26A 4Y2SA 1Z8DA 3L8CA 4HDNB 2MOKA 3JRHA 3GLUA 3NWEA 1KYTA 1RUNA 1ZVVA 1CY2A 4O4JA 1Q17A 3S93A 4YB8A 3TR6A 3CGGA 4B09A 4L8VA 1SFOJ 1JLSA 4FBMA 1AO3A 3I0TA 2A35A 4ZRDA 3IP9A 1BFUA 1J49A 3PB3A 3PR2B 4MYSA 2H65A 3TO9A 1LVAA 4NI5A 1NNEA 1XLWA 3W6JB 2FFJA 1LBSA 1OA0A 4KQWA 3R7NA 1QPZA 3KHUA 1Z8FA 2O8BB 4URUR 7MDHA 2HJSA 3PHIA 4MV1A 4PS0A 1W7PD 2EKDA 2XGSA 3EW7A 1QG4A 4ZOEA 3MT7A 1R0KA 3H5WA 4X41A 2B7CA 2IYAA 2FQQA 2AEEA 1PQUA 3JQ7B 4XSGA 2WNIA 3ZWXA 4IHKA 1YOVA 2PZEA 4H35A 3IP3A 4Q1EA 4C05A 3PC8C 1QTRA 3N59A 3EUHA 4XYBA 1T5BA 3OEWA 3D6VA 4L9WA 5DRYA 4IW3B 3MCTA 2YSRA 4RVOA 4LS3A 4C6TB 1N9GB 3HY3A 4ENJA 3C7CB 5JV5A 5A2QZ 4BVFA 2EZHA 3ND7A 1BIAA 1RM3A 1HEUA 3N07A 4JV5B 2QTMA 1UP6A 1E6UA 5E8JA 1EZ1A 1K4TA 2IE8A 3E5QA 2ZIUB 3EIWA 4XB1A 1WULS 1J59A 1IAWA 4XVUA 4LLGF 4AWXB 2E5NA 2SBTA 5ALSA 2LRHA 1GAWA 1IZ0A 3JALA 4BQRA 2QVCA 2C7RA 3VOEA 4WLUA 4XVRA 1YQAA 3KSZO 4CU5A 4CLHA 3OYIA 2XOKD 4ZCPA 1I7QB 3T3OA 2P4UA 3IQGX 5FWXB 3RSFA 1XROA 1PNVA 4J4TA 2MD5A 5DBEX 1MFZA 4MARA 2O57A 4MRVA 2J6CA 1QGED 3SHOA 4AVPA 1FFHA 3VYRB 2E1MC 3D4PA 4U0JA 5FO0A 4TL7A 2ZM5A 1B4AA 5TJJA 1ONPA 5L3SA 2OCXA 1P2VA 3CM0A 3WLOA 2IXAA 4KFRA 2P41A 2LBFB 5IM4A 4PYNA 1AKUA 3AMVA 4EIWA 1F3OA 5JE8A 2AW5A 5EEGA 4XIDA 1DKOA 2NU8A 3GEDA 3SZMA 2WBMA 3TGWA 2M0MA 4WXMA 3O6BB 3LSHA 4QGSA 3DDHA 4D46A 1J22A 1OYVA 3USZA 2WA0A 1RKWA 3FUVA 1LNQA 4DZJA 1WDKA 3G89A 1X87A 5IJZA 1ZRMA 3OY2A 4PTZA 3WYGA 5HS6A 2CV2A 3GMTA 1NE2A 2FNAA 3VR6A 1ID8A 3CNEA 3L7AA 3BPXA 4DYQA 4L22A 4PJ0C 4OMDA 4OHPA 1BR1A 2CVFA 4IEJA 4GI1A 3OQBA 3BG3A 3WA6A 4OTZA 4Y18A 1T0IA 1SR8A 3LQ1A 3DFIA 4CM8B 2X6TA 1MMNA 4MVJP 2VUHB 2MC4A 2FMIA 2H63A 1UELB 3PF9A 2P7VB 1V45E 4DCJA 4EVIA 2PQ8A 3TO7A 2VWQA 4FU0A 1FEZA 3JAWB 5DKFA 2I8LA 2NVOA 1KJJA 1QHFA 1JG1A 1SKUA 3KFWX 4F55A 4YA6A 4X65B 5FTNA 2L02A 3DOHA 4EKNB 3AVVA 4A3GJ 4K9QA 4LOIA 4M98A 3RVRA 1KFCB 4XM1A 3PUWA 1Y9JA 5JADA 1ODIA 2CGPA 1C8VB 1Z8NA 5FIUA 2K5UA 1KAMA 3QZUA 2BJWA 1EUCB 1U0TA 4CCKA 4DADA 2FU4A 3GFJA 1L6IA 4NEGA 4I0WB 4GBJA 2WYUA 2O8EA 4YJ2B 5EMLA 4YV1A 3LECA 1FMLA 1E2UA 4RH3A 2PLRA 3HXKA 4LIPD 2ZE8A 1YO6A 1GTRA 1YQDA 3I61A 3ASOH 2ZXUA 3R24A 2V9ZA 4MW4A 3E9NA 2ISQA 3MHTA 1DELA 4G0YA 1GUAA 4O4HA 3RYHA 4AP6A 4EHNA 3FTNA 3NANA 5LQSA 4A8JA 1QUEA 1S2DA 2V7PA 2FEAA 5AI6A 2XIJA 5HVQC 3USES 3H2YA 2CFTA 1N3LA 1PUXA 4G5OA 3DKRA 4IJ6A 3R5XA 2DERA 2H4HA 4JL8A 1O97C 3OSFA 1P18A 4NVRA 5EEAA 4MVJE 1P74A 4L6AA 1FU7A 3CLQA 1N0UA 4CV2A 3K9WA 3N8KA 3HZRA 4Z54A 2OLEA 3FVQA 2HQBA 2Z9DA 3M2TA 5ECDA 1V3QE 1Y3AA 1KZ6A 4V0KA 4P7FA 1KMQA 5KDLA 3I9V6 1MQ9A 2Z56A 2WSSD 3IWFA 1AXRA 4HV4A 3TP0A 1B1BA 4HDKA 3ZWBA 5DNDA 2JIMA 4DDWA 2QVYX 1K8RA 1TL7C 2HU9A 3M7GA 2V45A 1LDGA 4RYLA 1KFEB 3F98A 2O7RA 3G5TA 4BNVA 3OX2A 4UU0A 1QX4A 3C3BA 4KO3S 2H07A 3AVPA 1X13A 3ZKAA 3KHSA 2G40A 2AFIA 2ZUUA 1WV1A 4L5BA 5EAIA 3U7HB 3COJA 4J7CA 1H4QA 4C06A 1J42A 2SECE 4H16A 4EECA 1X2MA 2P0EA 4LFAB 4NDAA 2XVAA 3KJXA 5LNK1 3G1OA 3DLIA 3DBRB 3GX4X 2I7VA 1HKSA 2XYVA 1RZVA 1ZD2P 2CUZA 4G97A 4KYUA 2B61A 4UZEA 5AW3A 2M9MA 5B57C 1CQTA 4EI8A 4RIEA 3B6IA 4PC7A 2ZJ3A 3NI2A 1N1MA 1XAJA 3MIIA 1ID1A 2EG9A 3D4BA 3RCOA 2HA4A 4JKIA 1C9JA 3MQ0A 1AQLA 2UYQA 4BFYA 4LLNA 4JXZA 2EGUA 4KN9S 4TMWA 2PVSA 1O95A 3EGVA 4LMBA 1XRRA 3BRSA 4MV0A 2GZ3A 3QEMB 2P35A 4ZV9A 3WHPA 1GL9B 5CXXA 5ALKA 5JCOA 4OP3A 3MJVA 2P5LC 1Q74A 3EISA 3QVTA 5EFZA 2E7XA 4DV6B 3V4RA 4E94A 1DBVO 1QE5A 4DA0A 3Q0IA 3T94A 3NOQA 3A3YA 2ZJ0A 3BPSA 4DXAA 4DR4B 3QTLA 4GPEA 1YB2A 1JBKA 4A6EA 3COYA 4HNSA 3WDMA 4DBLE 2BM8A 2ZCWA 3I92A 3OBIA 3ESBA 3OT1A 2CT8A 3RK0A 3BHIA 1DGRM 1W4CA 4IG4A 2O1SA 3MQ2A 4M88A 4NK4A 1GSHA 3PD0A 3SXPA 4MRNA 3TLKA 2OCEA 4Q7EA 4Z1MD 2BGKA 3CSUA 3NH6A 3ANLA 1QIJA 4OFWA 3WYFA 4YDHB 2UZKA 4F3TA 4FOSA 5H4HA 1RWWA 3WADA 4B81A 3PQ3A 2A1UA 3VU3A 5DBIA 3GUDA 1ZRSA 2OVFA 3NOVA 7ADHA 2R7AA 1TK2A 4XM0A 3BDDA 2UZ1B 3I04M 2VJBA 5E9AA 1E62A 1L5KA 3VR5D 4XVHA 2HCFA 1IHXA 3RLIA 3IUQA 1EHIA 4MV6A 4WK8F 2H4YA 5BNWA 3DP7A 4CEJA 5AQEA 3F6SA 5IN4A 1NUUA 2A3RA 3ZZTA 1CUFA 4YJHA 4P5OA 2R5WA 5C4GB 1U1EA 3NKVA 3WRXC 2AR7A 3AFIA 1UBOS 3NHKA 2YYYA 1CNFA 3EDPA 1R9NA 4M54A 5DWVA 4QYMA 3T0FA 1FNMA 3NKFA 2AS5F 3ZJUA 2SKDA 2HHHB 3V2UA 4EHDA 2OYCA 2J5OA 2W6MA 2PYDA 4R31A 2ZIXA 3FHOA 2YHIB 5EIWA 3LXXA 4D9JA 3Q3CA 4KNVA 1G3YA 4FHGA 4O2AA 5A5DA 3UNGC 2QG6A 3ZZUA 1IW7F 1Y5NA 1ODLA 4LHXA 2Q8KA 1L0BA 3Q87B 1YQEA 2C2BA 1JDPA 2FG6C 2R6CA 4TSFD 4OFBA 1A7UA 1YI1A 2WD9A 4QOGA 4C29A 1CDZA 3NEUA 1GCUA 1RI2A 3AOEA 2CJXA 4EJOA 2CO5A 4A3DJ 1D4FA 3PWSA 5KTNA 4LW8A 2BHNA 1RCFA 4ZP1A 1WXHA 1VI6A 3DCJA 4GX5A 3DMGA 1E2JA 4FZJA 1D8JA 3OBBA 5DGHA 2FUEA 2HC9A 2CF5A 1BFDA 3L4BC 1P0PA 3TR0A 4OH1A 3T4PA 4GOJA 1PTKA 1UQTA 4DR1B 1DE0A 3TQHA 1FUUA 3TDKA 4HTFB 5G0SA 2IITA 3N6XA 1NN1A 4C0JA 5C4MA 3BMOB 1X4PA 3E48A 4I99A 1CZNA 3T15A 1U3WA 5A3SA 5K01A 4YIHA 2CV0A 4DPLA 3PIDA 4KR9A 1J8FA 2DMRA 4HMOA 3LQKA 1E4EB 2OQIA 3C6MA 4PWYA 5AVJA 1YMQA 1RYFA 1JXOA 3D3JA 1CZLA 4M9SA 1QH8B 3JQQA 1OB5A 2CL6X 5EEHA 2Z6AA 3WWYA 1U9IA 5BSGA 4C4RA 5IH3A 2VYND 3OQMA 3AZOA 2PRZA 1W88A 3ULQB 1BMFA 1E5XA 3KPHA 3CLVA 3EDCA 4ICIA 3PJFA 3ABUA 1F4KA 4OMFG 3A03A 4M3EA 2XQFA 4RTPA 2ZOSA 2W83A 2XPCA 3ZD9A 4QREA 2G9QA 3H5LA 3I1JA 1E5LA 1YUNA 3UJPA 2ZSDA 3P4UA 4CQLA 2YXBA 5JSYA 5C8ZA 2H29A 4G8XA 4TXMA 1WQ1R 2V03A 2F3SA 2VJDA 1SU8A 1PD0A 4NU8X 1SKMA 3DHVA 3NTVA 4WZZA 2OSVA 3TMOA 1XS9A 3RRFA 2HDCA 4XWOA 5IDVA 2IPAB 4A3JJ 2FLKA 6ABPA 5EJ7A 1PN3A 5ECGC 2J08A 3BEOA 2IBMA 4P38A 4ENUA 1FRNA 2QRZA 3CKKA 1YDMA 2LWIA 2DHDA 3FYDA 1ITZA 4Y2PA 2VQHA 4ZU3A 1RZRA 3B82A 4CV0A 1JMYA 3QIAA 4CODB 3IHKA 4WY2A 5MN6A 3IVAA 1JT9A 1U8BA 1IY1A 2CXSA 2O3FA 4KX5A 3RUIA 1OD6A 2RI0A 1LB2A 4BO6A 3ZQ7A 3ADDA 3M2PA 1UBKS 1T0FC 2X13A 2QL6A 2XMQA 2I4IA 3HA3A 3UK7A 3RU3A 1E1LA 1XG1A 3KKLA 3JSAA 2YR2A 3KALA 3UJAA 2FPSA 4HLUC 1G8PA 4Y2GA 4DTCA 4L4ZA 3DT6A 3KR0A 3IP4B 3T4UA 1L7EA 2R4UA 2GN1A 4EQ6A 4MEBA 3V55A 1MENA 2E35A 5H70A 3AL2A 2QN6A 3HVRA 4EEKA 3HFJA 1J0DA 1N34B 3UBTA 1R4NB 1WXQA 4IEEA 4W82A 3U1BA 3KR9A 1T0UA 2Q4OA 4D99A 2JF0A 1YB5A 2GZDA 3DKXA 2FPWA 3TRDA 2NXCA 4HAZA 1B8PA 2QE7D 4MQMA 5F1JA 3R20A 4CMKA 2B69A 5CT5A 1NI4A 2GT1A 5T8KA 1P9RA 1XZGA 5HLHA 2VXCA 2OV2A 2OZPA 1L0OC 2QL9A 4G0WA 3S55A 2QLTA 4BFCA 2WC2A 1S2GA 2QX7A 2QIOA 5F1OA 4K1LA 5CURA 4EG7A 2W0SA 4WJZA 1KK3A 2IXSA 2VVTA 3IAM2 3H1TA 3WE2A 2IZ1A 3QIVA 1XVAA 2VBZA 1ZU4A 1WHUA 4Q19A 3A4CA 1GPKA 1KERA 4FYXA 3PSHA 2O2SA 4NQWA 4FZ3A 4R1SA 2IYNA 1L3LA 2NV6A 1TL8A 4RZ3A 4QBFA 3OQVA 2HYIC 3TSOA 3MGBA 3T4EA 3K09C 4KWTA 5COQA 2EF0A 4LZJA 3HEBA 1P2GA 1KO1A 2W2LA 3H1CA 4UBKA 3LMKA 2Z1MA 4RBNA 1JFFA 4B1FA 4EH1A 1P72A 1UDRA 3HG7A 3AEQB 1MXFA 4GO1A 1ZH4A 4F5DA 1Y3IA 5ECYA 3NV9A 2V6FA 1A4RA 3N7AA 3PVSA 4DZTA 2BMAA 4ZYGA 2ZUCA 1FOYA 1AKHA 4NX2A 1I33A 3FF1A 3DU5A 2QW1A 2OQRA 4D9BA 1EFRA 2RJNA 1HE5A 4OI0A 2V1DA 2ZTUA 2GLOA 3KL2A 2ES4A 2PZGA 2NU7B 3KB6A 1E69A 5L3QB 2L0XA 4F9GA 2B37A 1Z26A 4GVPA 3QPDA 2D1RA 5FQOA 4HZUA 3A4VA 5TVKA 3I52A 4D74A 1DBRA 2LKDA 4L5AA 4QFDA 4TMYA 1B59A 4YR9A 4WTOA 1D1TA 1GCGA 1KAHA 1QLHA 2EIHA 3UMMA 2R25B 4OATA 4R4JA 5FD8A 1ZX1A 3ZWQA 1NK2P 2QX9A 5EZYA 4J0IA 2WOJA 5CW2A 3JVDA 1P1JA 2YCLA 2OO7A 1QKJA 3H7AA 1U2GC 4D9KA 1GY8A 3G1UA 4D3FA 2O0KA 1UKBA 3G0IA 2JIZD 3ZU2A 1NLYA 4KXMA 4FDUA 2Z2ZA 3WGHA 4CN8A 2H4JA 3RWOA 3KKEA 5ULLA 5LD2B 2XB8A 2ISZA 2NN3C 5AJTA 2O5CA 2W6IA 2VPIA 4AVYA 1H8HA 3MF4A 4MJ3A 2QA5A 2C58A 5BQ5A 1I9GA 2C57A 4MO2A 1Q7BA 5HW0A 3MGGA 2PWAA 1J9IA 9LDTA 1R66A 4BPRA 3IE0A 1E1MA 2R92J 5JD5A 2J67A 3IUNA 4M0DA 4R1MA 1LNWA 5A7GA 1U6KA 3CH4B 3JW4A 5DP2A 1WB9A 3GF2A 1W2HA 3FVRA 2DEUA 1K7SN 1F0NA 4CWAA 2B4RO 5BNIA 2VIIA 1UDBA 5IK2D 1EJ9A 5CCXA 4RLQA 2PLFA 3ZGNA 4KPGA 4GMKA 2W8ZA 3ZIUA 2E37A 2IT0A 3PJDA 3X43A 3VNAA 2VTBA 2YHAA 2BKAA 3H35A 2CE7A 2WA2A 2ZCUA 1YBAA 1LSJA 1T5TA 4G86A 1G6HA 1BOFA 3MVPA 2IJLA 3GVHA 2KYRA 2B0JA 3THOA 1P31A 3DFFA 4E03A 3R9XA 2RK3A 1DAIA 4OHWA 1VKHA 5HDGA 5A4DA 3SWWA 3ABKH 2DFTA 1BHSA 3C8ZA 3QX9A 3ZPLA 4IRUB 1NG1A 4OKNA 2BHSA 3SOPA 4CIXA 3LBNA 3E5UA 3NWJA 1PR9A 4K9SA 3W6NA 5JHHB 1PDOA 1XCOA 1IY8A 1J2YA 2XMDA 1TT5A 3D6MA 2WLSA 1Q0ZA 3KZYA 2C0PA 4A2UA 1NVXQ 4DMRA 3EXFA 1XL0A 1HM5A 1E1RD 1MUUA 1BXGA 4RPCA 3K0AB 3F7NA 1DU0A 4RF3A 4YJ3F 2DA2A 4PPNA 1UDXA 3VR3D 3GJ6A 3GFFA 2GVZC 5H81A 1FNBA 5JTTA 4PBRA 2WIKA 1CZOA 2XHKA 1CIJA 4HWOA 3D6NB 2NUAB 1F2UA 4U7DA 3O1JC 2CDNA 5A4KA 3HKCB 4TS9A 1MO4A 5HOOA 1ZUIA 2W5UA 1TTHA 1VKJA 3P19A 3O1HB 2AOTA 2QEQA 2HF2A 1EUDB 2I67A 2ZJ7A 1RRCA 4IDDA 3WMWA 4DMKA 1DUVG 2IGMA 4C2MJ 2OTJI 5JZVA 1KXJA 3VVCA 5AVKA 1Z7WA 3E5XA 3ZBQA 3KX2A 1AGXA 2DBYA 2P7CB 2X3UA 3N2KB 4HDSB 4R9UC 1J2RA 5E7JA 1XTQA 4EI9A 2CNWD 4LC1A 5E4JA 3NKLA 3ZLVA 3BXPA 1GSAA 4BLOA 4D79A 1EK2A 2ZRMA 3TFOA 2QCOA 1WD5A 3T12A 5IUNC 3HJTA 5GOZA 1NNLA 4R81A 1ILWA 1BE0A 4BO3A 4EJTA 3V1NA 1KU0A 3D7NA 3PQ7A 2KRHA 2DX7A 3QKUA 3AUYA 4RGYA 4P3XA 2IYXA 2HR3A 2EBHX 4IV0A 5EZ6B 5K8IA 1P9NA 1ZDMA 1FTSA 3GEIA 3OTHA 1Y1KE 3E4CA 1WXGA 2PLWA 4Q3KA 5KX5F 3QPLA 4EJVA 3IVCA 1C3OA 3HU1A 1U0JA 1ECGA 1HRKA 2V55B 4DUYB 4MVJG 4QUJA 4DZRA 4LIVA 5LIPA 3KWLA 3CUQC 5KKAA 4Y52J 2A5YB 1Z6AA 3U5TA 2D1YA 1LVHA 1SRQA 3G9XA 1C4KA 3QU3A 6CHYA 1TIBA 1XSDA 2PRIA 3HOWJ 2Y0SA 4G01B 5GIOE 2K7ZA 5KAPA 5I48A 2NVBA 2Q6VA 4K46A 3AERB 3V8BA 1G7SA 4HXEB 4BN0A 4QXMA 2ID3A 2GFHA 1PWYE 1GYPA 1TAQA 4O29A 1MGTA 4KQEA 3IUYA 4DJDC 3O83A 5EGSA 3LZCA 2M8GX 4PPQA 1WJEA 2VJMB 1JB1A 1G2HA 1CD5A 1WUTA 2EBWA 3GPDG 4CO8A 1UXIA 4I9GA 1VOTA 1JSCA 1V6CA 1S2MA 2GEFA 4V03A 3E5HA 1KDOA 4TUYF 1PJCA 2VP6A 5FPTA 4H4CA 3VH4A 3SJAA 3IT3A 3ZRGA 1UXHA 3UK0A 1JJAA 1CS0B 1MEJA 1KSFX 1PTJC 4GPBA 4NFYA 1I0LA 5EYPA 3FKIJ 3FDJA 4KUMA 1K63A 3U80A 3EZ6A 4CLXA 2EIXA 3EVEA 2RIPA 4J8PA 2HN9A 1B0UA 3OF3A 1D9ZA 3OZUA 3GMDA 1BVHA 1P77A 5TC4A 2B4YA 1T36B 1LFDB 1H23A 4GZLA 1BA2A 4IVQA 4YCNA 4FI3F 4DWJA 2HK9A 3ZY4A 5H6RA 3GAMA 4ID9A 4NP6A 2G0AA 1P4WA 4YRGA 4ZAVA 1A88A 5M29A 2X9GA 3FXKA 2PSHA 2RK4A 1OLUB 3VI3B 2JGAA 4Z4FA 1Z4MA 4AZTA 1N5JA 1K5GA 1OH6A 3GBGA 2XKAA 4MDHA 5DHTA 2C3UA 3UOAB 5C5EA 5EHGA 3D2CA 3VPXA 2PX4A 2D54A 2ZULA 5EHNA 3PHHA 1U1DA 3D0SA 5JZBA 2DSNA 2JA8J 3DG9A 4TM8A 4JLKA 3MWGA 5LBTA 2R97A 4MEJA 4DJ5X 5CDFA 4MLZA 3KS9A 4MUAA 3GTLJ 4ZGWA 4V1CB 2V5AA 1D0XA 5A5EA 1CUCA 1HY3A 3TG2A 1C1DA 2JZOA 3D6AA 1M75A 4F72A 4EI2A 2MIIA 4OUDB 2VXZA 1MZVA 3S27A 3DEUA 2XWSA 1OB2A 2XUOA 1Z4QA 1N33B 4M9QA 1UBJS 3DOCA 4OK3A 4M60A 4DLZA 2RHCA 2ZYUX 4JX4A 4D6PA 3OOUA 1HFEL 1P7PA 4MVCA 3QVMA 2ZANA 2C7QA 4CDMA 1CKEA 5AVSA 2DXIA 1MB2A 4B7AA 3D7LA 1Y6ZA 1T6XA 5EN4A 2BFEA 1FJXA 1DC7A 2WF5A 1X9GA 4FFVA 1ZGAA 3V3TA 2IOHA 1RYNA 1ZUNA 3OZEA 1N2XA 2P6NA 5B1YA 5HZGA 4PGAA 5LQNA 1VYHA 2QI9F 3H16A 3ZXXA 1POWA 1T24A 6AT1A 3KTAA 1WCIB 1RLOA 2EWVA 2QT1A 1K9VF 2A0YA 1FTWA 4DBQA 2PWBA 3EEBA 4QXPA 4X00A 4KH1A 5FKOA 2J9ZB 2YJZA 2NNNA 4LGWA 1WIWA 2PUDA 4ZZ0A 4YIFA 4WCFA 3V4FA 4AJ2A 2QM3A 3C6BA 4FETA 4PTYA 5G3YA 1IOWA 4F6RB 3MWLA 1O8CA 3ONWA 4MR8A 2XKKA 5CNIA 2VJPA 3OYJA 1YE8A 3R1IA 2ZMEC 1IWPB 1P2UA 1ZUHA 1XTSA 1YRQA 3ZWDA 1AV7A 3ZCSA 2NUPA 1Q3KA 4E7ZA 3ONNA 3F6CA 4ZIRB 3IBFA 2YUIA 4JVMA 2IZZA 3EMVA 3VJKA 1PSDA 4WV3A 1XHLA 2W2PA 3P5BA 1DT5A 4JLAA 1QV9A 3CG4A 1IRZA 4QG7A 4MWBA 1E9EA 3ECAA 4KH0A 2I3BA 4DWVA 1DCMA 1Y8RA 1TPZA 1AZWA 1KQGA 1KDVA 1NVAA 1TWCJ 2LVSA 3X1KA 2DHRA 2N8GA 1BEEA 3JZIA 3QYEA 1W8IA 3RSNA 3PRHA 2WG0A 5BSFA 4AS3A 4XGRA 4I7HA 3DD1A 3VJMA 1ORIA 3LYAA 5IT0A 3EAGA 4QU9A 2FX5A 1WSWA 1PFYA 5LU8A 1TKBA 3QTBA 1CY6A 2QOEA 1OHHD 4L4XA 2XVCA 4HJXA 2QGNA 5DI3B 5IYZB 4TTSA 1A9PA 1GPH1 1P5HA 4K40A 4M99A 2NNLD 4LJAA 1INLA 2O3TA 4GSKA 3CLKA 2NYVA 3RUPA 3EWAA 4NQZA 3GTPJ 3RWBA 2ZYSA 3HEMA 1ZGZA 2FRXA 1K1EA 5B2FA 3TLMA 4QUKA 4ETNA 1QFXA 4OI4A 4WX2B 4CXMA 3G5AA 3LYUA 3HOSA 2QB5A 1OAKA 4HB3A 5HIIA 5FJ8J 1CIVA 1Z0KA 3IAHA 5JNTA 1JDSA 4P92A 1VI0A 4C87A 2LCFA 5AMXA 3VPBA 2F9FA 2IVFA 4D4LA 2O8VA 4I8XA 3I83A 1CJVC 1EK0A 5JNSA 4L8LA 2A92A 4Q47A 4MHGA 2IZ5A 1JVNA 2IBDA 1E92A 4YAFA 2DI3A 5G0WA 1IG7A 2WWFA 1L7VC 1MKYA 5JXWA 4XORA 1IAQA 3SSAA 1MJGA 2NU9A 1BJZA 5KOIA 3T38A 1RYDA 2XT0A 2IS6A 4ZCMA 3OQ6A 3PSIA 2VEDA 3RTBA 1IK6A 2R1VA 1VHLA 3EASA 2GESA 2VTKA 3L6RA 1DBIA 3HP7A 3C2BA 4MLDA 3PI7A 4FWIB 4E32A 3VSAA 3TM5A 5DM6F 1OF1A 2QNRA 2H5JA 2BFDA 1PV2A 3HJRA 1HC8A 1RJ9A 1FZPB 2IYYA 2F00A 1XK7A 3OO0A 1UKAA 5I51A 1Y3HA 4CR8A 5CLJA 3K1AA 2WWXA 2Z5UA 3GC6A 3PQ2A 1PHPA 2JKYA 4BMSA 1TLLA 2Z5GA 1II8A 2P6RA 2QY6A 1E6MA 2QYTA 4YRCA 1YO5C 2PJRB 1AKEA 2PQMA 3L9XA 2XMCA 2FWPA 1SUWA 1X7WA 2WKPA 3D64A 3HXLA 3BD6A 4RM2A 4R79A 4I1RA 2Z30A 3W3AA 4Q9LA 3QFTA 2WAQA 2Q07A 1QC5A 3PRJA 1XJQA 4JJ7A 4RJKA 4DPMA 1KO8A 5CB6A 5H9VA 5HQ3B 1Z5WA 1FT9A 1FTNA 3FUUA 3NWBA 4RIIA 3PHCA 4A15A 5HZHA 1O08A 3HZOA 2HLNA 1G38A 2RKHA 4LVCA 1GV1A 2DB3A 1DWUA 2PUAA 5AW8A 5JLJA 3DVQX 4HQNA 4RAGA 1RT9A 2I6QA 3Q1LA 2XX3A 2NSLA 2BY1A 5KYGA 4R7ZA 3HJBA 3FSJX 4HRVA 5JO9A 3EQLF 4AJJA 2XIGA 3JQBA 1TA0A 2AC4A 2LBPA 4TWZA 3I5XA 3GLGA 1RVDA 3ZMTA 1RAEA 4H9GA 3FDXA 3FXUA 4D97A 5KYXA 2TMKA 4LYHA 4GKVA 1H2WA 1JI8A 5HNFA 3QVSA 5JWHA 3DE6X 2OZLB 1ZG5A 3BZUA 2XGCA 3SNHA 4EM6A 2XWQA 3SC2B 4DSAA 2BE5F 4BRWA 1TC1A 1ZW6A 3GLXA 4QQFA 1D6NA 1A0OA 1V1RA 2PXAA 3V4OA 4GWLA 1DKMA 1WB6A 4O3MA 5AOVA 4RCVA 3LY8A 1FP4B 4I50B 4CM4A 1V8FA 4M1ZA 5BN1A 4GLFA 2I7XA 3PEVA 3IQWA 1R6UA 1F0YA 3E7LA 3W2WA 1D8TA 3DMFA 3R0ZA 3W1WA 4NZZA 4YCLA 4QUHA 3SP1A 5AM1A 1MO5A 1EA3A 3BL5A 4D0GA 1CR1A 5FJIA 1B8VA 3PEUA 3C43A 4CMJA 3BJEA 3OQPA 1JKXA 1LJLA 3EWNA 1W96A 2FETA 4YMTA 4O63O 1X7YA 3Q3VA 5IFLA 4Y2JA 4UHBA 1U7HA 3QY0A 3K4QA 1I2ZA 2UV1A 1U6IA 2BEUA 2E48A 3R3UA 3BHMA 5C3UA 1V35A 1Y4SA 1IHYA 3G82C 1M2KA 4UW9A 5IYDJ 3DR5A 1Q14A 3LFKA 3SQLA 1VG1A 3TUZC 1QV7A 5AI5A 4XRGA 4Q4ZF 3F5SA 1OFIA 4CCMA 4OX9Y 3JTHA 3OSZA 3NVDA 5K0SA 2HIMA 1GPDG 3NJRA 4LOKA 1IZ1A 1JTEA 3HB4X 4HV5A 1HQYE 1TAHA 3ASZA 4W7HA 2OCBA 1LFBA 1LD3A 4S1NA 2IGKA 2YIMA 4EW6A 2FW0A 3VDXA 3K2AA 1ONNA 3RBXA 1H5QA 3N97A 5F0HA 3WLSA 1UBRS 1NW9B 2Z6VA 4EKGA 2I4TA 2LUOA 4J4HA 4JELA 3KYDB 2FWBA 2EILH 3EIHA 1ELOA 4NU5A 5AVYA 5E17F 4CYMA 2F1KA 2QROA 4KVAA 1JKFA 1JQEA 3ETNA 2D0DA 3JD3A 1SD7A 2K40A 3IAXA 1U2PA 3N0TA 1ZNZA 3E05A 1Y1RA 1ZFNA 4XWYA 3NHPA 2XNHA 3JR3A 3WK4A 2HV8A 4ZCTA 1NR5A 3CZ5A 2ANCA 5CH5A 3NIGB 3CR8A 2R8YA 2OD2A 2VDQB 3HDVA 3W5CA 4ANFA 5LA6A 2V7TA 3T3HA 2A0UA 2A30A 2FYTA 3O8HA 5FH9A 2WIGA 4MVYA 4U7FA 1IGNA 2K27A 2R7MA 4A23A 5CDSA 3ZQUA 2PWYA 2RBGA 3PGKA 3GBVA 5AHKA 3FPFA 2Q5FA 3V8PA 4KDEA 2NVTJ 5JD4A 4JI1B 2P2SA 4FTWA 1DIOB 4A3FJ 2XW6A 3WTUC 1YRBA 2G76A 2DKOA 5BV0A 1E9FA 4WDQA 4HD8A 1VPEA 3DD5A 2PMUA 3GRAA 3T7KA 3CYFA 1XCGB 4PK4A 4KE9A 1TU3A 1XQ6A 2NZWA 1S7OA 3SDZA 1EKEA 4FI3C 1X8JA 3AESA 4LYEA 4NCJA 3IPRA 4FFRA 1ESEA 4LFCB 2EFDB 3P2KA 3ZD6A 1UINA 2GD1O 2K7LA 1QPGA 4BPBA 3JRGA 1O0CA 2Z8YA 1N5IA 1ZGGA 4DV5B 1N5MA 2ZBKA 2QZJA 1YBFA 4YMIA 3U49A 1EP2B 2V4JC 4XLLA 1F2TA 3CE6A 4LCBA 1JDUA 4RWZA 1FTTA 1Z0UA 5UKDA 3OWXA 4PBTA 4G8BA 3ZGXA 3BWVA 5IDQA 4EFDA 1PJ3A 1ULTA 3R3SA 4XCVA 3GDOA 2QHXA 3STTA 3T34A 1L5FA 1SXIA 2IHYA 1JEEA 1YCHA 3ID6C 1FNCA 3W2HA 1J8MF 3NTXA 5TT1A 3B1XA 4TT3A 3LBYA 821PA 3OTIA 1BMQA 4QZVA 4IQFA 3OQOA 2ZUSA 5FUXA 5EJMA 3M3DA 1QHEA 1ESNA 1ZCBA 1VL5A 3AFNA 5KYNA 1LSOA 4GWKA 4WDRA 1FCJA 4HYQA 4MIYA 4I1OA 3ZZMA 5TQJA 3EWSA 2DFNA 4H0FA 4HL6A 1H65A 2ZI5A 3QH4A 2YXEA 2XUDA 1NVUQ 4B4KA 2E9SA 2EP5A 1YI0A 3AHHA 3CWCA 4I09A 4L02A 3FSGD 4HWKA 1UK6A 3KXKA 2KFDA 4OOEA 4JT2A 2QI9C 1Z13A 1BOBA 3BQMB 1AZLA 4YHHB 4LB6B 1S96A 2ZK7A 3SXYA 1SFKA 3UKJA 3DMHA 2JTVA 4JI2B 3N58A 3HC7A 1EEXB 3BXFA 3ECHA 2QSYA 4OGLA 1RMQA 5A1TA 4HQ0A 4AG5A 5AUNB 1KP2A 3JWEA 4Y6QA 3CCEI 4HF1A 2CJWB 3GZJA 4G0ZA 3OO1A 3EHEA 1GNPA 4L15A 5BSVA 4ZEOA 1CIPA 1RI7A 2JPDA 3HKEB 1BE8A 1PUJA 1NBME 4A0RA 2E3JA 5DF1A 3MGKA 2B83A 4F4FA 2VNAA 1RXEA 4B0PA 2GCOA 2XDQB 5BR8B 2PZBA 4ZVSA 3NZEA 5C46F 3K16A 3WGGA 1UADA 3DZKA 3R2JA 1XD2A 4W97A 3QFCA 3OFVA 2QE6A 3O1IC 1NRWA 2B30A 4ASUD 2BEJA 2HQNA 3MBKA 3ZV6A 2DULA 3LAPA 1GRCA 3AWIA 2VHYA 3SZTA 2Y9MB 5A5GA 2EQAA 4CVNA 3SZLA 5G0TA 4UUAA 3A9RA 5IULC 4X7RA 4BBSJ 1I4WA 1XQVA 1TECE 4QBGB 5E6RB 2X4LA 1HSOA 1ZMXA 1R15A 4YBRA 1A9XA 4EKDA 3G2MA 3BJ6A 1XLTA 1DC4A 3HA7A 3G2OA 3OSGA 5EQTA 2GA8A 2JBAA 3OOPA 4G63A 4MB0A 2X0FA 4AUKA 3DM9B 2HVSA 1XU9A 4UBNA 1S29A 4ZZLA 4TT8A 3IHLA 1CQIA 1YB7A 3KR2A 2QQ9A 5FR1A 1XMJA 3U21A 5ITZA 3HVIA 3L1PA 2I66A 3UATA 3R0IA 4PBSA 5JEEA 1ETXA 2BPOA 4ONEA 4PG7A 2C7GA 5KYWA 4YO8A 3OS2A 2IU3A 3AI7A 1YQXA 3F6BX 2MCFA 2UUBB 1XG5A 4BLRA 4BX3A 3KK0A 1DB3A 3ANXA 4B2PA 1G5TA 3IH3A 2QRVB 3NJ8A 4GZ3A 3KEOA 2CCGA 2GAUA 3MJDA 4X95A 2O7NA 3AF4A 3M1LA 2PZ8A 2DW4A 2B8TA 1E5DA 3LKZA 4DDKA 3I59A 3CQZJ 2UVDA 3Q0TA 3IEXA 4D6XA 2BI4A 2QTBA 4RQUA 3B7GA 3WK7A 1VRCA 2HBZA 5FBRB 1PJBA 3S0JA 3S3TA 1JDVA 3QVVA 1RKXA 2H00A 4EYKA 5JC8A 3I1YA 3U26A 4IXTA 3ADCA 4G0NA 5KAIC 4QJ5A 2GN6A 3N86A 1JDBB 2VP0A 3I0NA 3RJMA 1JKQC 3FBGA 1YVEI 5C7IO 4OK5A 1MU0A 1JILA 3INYA 1NMYA 3OFJA 3DB2A 5J47A 3LNTA 1PP8F 4QPQA 2DO7A 4G94A 3G5LA 5DLEA 1FTQA 2FSFA 5F52A 4ETMA 5MFZA 1Z17A 4X7PA 3CISA 3NS7A 1EAMA 5EQFA 3WL3A 1GXSB 1XTAA 2N46A 4E46A 3RRNA 3M49A 4IBOA 1QOPB 4YIRX 1RJEA 3EXIB 3QX8A 3NRCA 1VCOA 4XPIA 3BE8A 2W8BA 5C4IA 3WHIA 5FUVA 4J0EA 4CTNA 1FP1D 4XDZA 5JJCA 5AKZA 4L6IA 4ARZB 1RPNA 5KC9A 1LDMA 3GP3A 1F8FA 3N87A 1MHTA 4KO1S 3LP8A 4LZNA 4I5GA 3E9ZA 3WQSB 4DR3B 1C0PA 1ZM4A 2WJYA 3MJSA 1U9JA 4B3GA 1FVOA 5E7IA 1OYIA 4OINF 1E2PA 3V3KA 4IXNA 2OHJA 3CUEF 3EHDA 2HXYA 4MIEA 4RJ2A 1QK5A 4CMEA 1LQ1A 3PIPF 1IC8A 4N8SA 4G07A 3ROXA 6PAXA 1FFWA 5CM8B 3V33A 3B78A 1E2MA 1QJCA 4B45A 3ZE8A 1BCSA 4R6WA 1MAWA 3CCLI 1VE7A 3TOAA 2H8GA 1T2VA 2BXYA 1KPHA 1X77A 1J5PA 2WJAA 2H2DA 2I7TA 1WUKS 2ZDHA 1CQJA 3TI9A 4JBHA 5JG7A 1IN6A 1SC4A 1C4OA 1JKIA 1O58A 4JUCA 1P1KA 4CKXA 5TMPA 1HH4A 3INGA 2WWHA 1PFWA 4E7OA 5AUOB 3GW2A 1XRQA 3SC6A 5BNZA 4TYPA 3SM3A 3RIYA 1L1QA 1T5OA 2C42A 2EFGA 4BVBA 1YL7A 1H1DA 4MCHA 2OGZA 2CMFA 1VI5A 3PXBA 3K35A 4QLBA 4PZZA 2FG7C 2CFXA 4RAQA 3MD2A 3FPJA 4U2FA 3L4KA 1G7CA 1SCIA 4YJFB 4MW6A 1CYEA 1BZYA 3T3DA 4YWJA 2CNNA 2PV7A 4OJMX 3M81A 4WADA 2W25A 3GB9A 4KWIA 2ZJAA 4QPPA 1GU1A 4WQMA 1DMSA 4XICA 4XLTA 1W7AA 3KT8A 3LYHA 3S40A 4I4NA 1QQ5A 1IRIA 1Z2DA 4RFSB 4DLAA 4I4CA 1SQSA 2XA9A 4P1WA 1OZ0A 1E6CA 2IUSA 3IAUA 4A3EJ 3NNSA 2RJOA 3NVMB 4BHCA 3RWMB 1VRVA 5AW2A <