3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
2P7VB 4LJZF 9MHTA 5EC8A 4ZYGA 2A07F 2NNYA 4A5NA 4P7JA 5D1HA 3DP7A 3ULQB 7MHTA 2LKPA 3GRVA 4O29A 1SQGA 4BY9E 3OOPA 3EDPA 5JFRA 2YXDA 4XSXF 3P8ZA 2DO7A 3GU3A 1MKMA 1YF3A 3KQYA 1O54A 3PFGA 4RS8A 5F2KA 5BQTA 2P7HA 1MDMB 1USTA 4WF2A 2QQAA 3R0AA 2FQ3A 3KQWA 2HR1A 3IL2A 3R3HA 1D2GA 2GIVA 4DQ0A 3OV8A 1BJAA 3UA3A 5DM1A 3DTNA 3H3UA 5E9JA 5EG5A 3QRFF 1IXCA 2C7QA 1J59A 3DLIA 3A7EA 2J5OA 2VN2A 1DPRA 3ME5A 4LD5A 2ESHA 2IPQX 1ZG3A 3VB2A 2PQ8A 2VONA 2FU4A 3EVDA 1ORHA 3ZN0A 1GXPA 1B1BA 4AZTA 4M74A 1RUNA 1RI4A 1U2WA 5LGTA 3DXYA 3E3VA 4WXCA 3M6XA 2AXLA 2JPCA 3HCFA 5K03A 6PAXA 2CSOA 2ZBQA 4PYNA 3M8EA 3MQ0A 1J0RA 5FLXK 4ER3A 5D6FA 4PGHA 3ZMVA 2AVDA 1LDJA 3PX3A 3J81K 2IH2A 4X60A 3BXOA 1S7OA 3DR5A 5BPDA 2FRHA 2ERCA 1LNWA 4WK8F 1OKRA 2QENA 1TBXA 4CWAA 3LDGA 4MIKA 2AN3A 3FUVA 1ZRCA 1QANA 1TW2A 3MCZA 2HNKA 1SFUA 2ELHA 1XCLA 3R6TA 1X1BA 3DEUA 5K0NA 3BY6A 2GZWA 4RSRA 2E7XA 2FBKA 1KU7A 1TTYA 1O57A 3KEQA 1R1VA 3FX3A 4GYGA 3LCCA 5CYVA 2PX4A 4O6JA 2UYHA 2VC0A 2IH4A 3E97A 3CJTA 3L09A 1SAXA 3DMFA 3ERED 2GXBA 4B09A 3GXOA 3A7DA 3FMRA 2M8EA 2PFBA 3RKYA 3F4KA 2B3TA 5LRSA 3BZBA 4QDKA 2MLGA 1HW5A 2F2EA 2ZZKA 3V8JA 2A5YB 2XIGA 1TQIA 2HR3A 3MB5A 4MHTA 3E8SA 1RNLA 5E8RA 5D4RA 4E2ZA 1AQIA 2OB1A 5HDGA 2PN6A 3O3KA 2I7CA 2P7CB 2NXNA 2PBFA 4P9FA 1SVUA 3K1PA 1YLFA 4U7DA 2B25A 4PCQA 1T39A 1EIZA 1ZQ9A 3TOSA 1KPHA 4I98B 3NMUF 5LQUA 4EM0B 1VE3A 1BHJA 3TKYA 5GP1A 3BKXA 4WVLA 1QQIA 5CVRA 2DU9A 2ONZA 3B5IA 3PFHA 2MH2A 1KU2A 4IRHA 3SSNA 5KQRA 3NDJA 3BKWA 1EAMA 3LA7A 4GUAA 4GO1A 5K5RA 3UJCA 3FZGA 1BI0A 2ZZMA 2ZULA 3EVCA 1V4RA 3FTDA 2PT9A 5E1WA 3GUDA 3WSTA 4CKCA 5HDNA 1Q1HA 2IA0A 2VBXA 1P2FA 5E18F 2IIPA 5ICEA 2O3FA 3QU3A 3V8KA 4CICA 1FC3A 1TNTA 2BZGA 1S6LA 1PDNC 2QRVA 1JXSA 2NXJA 3FM3A 3BGVA 2E1NA 1XVAA 2PLWA 3HTSB 4FS8A 3S68A 4G8XA 3F21A 3RPUA 2AS5F 1SQFA 2DULA 1LDDA 3GRRA 1SG9A 2CFXA 1IN5A 1ZARA 1T6SA 4DNCA 2R7FA 3HM2A 1G6Q1 1IAWA 3QP6A 5HZMA 3KR0A 3HVJA 4FZVA 5DX0A 3P2EA 2L4AA 5JUWA 5CIYA 4YMGA 3HUGA 5D1NA 2CG4A 4AD9A 5HOQA 5EZQA 4L9VA 3MTIA 3SX0A 4ZH4F 4PNEA 4YUVA 5K5QA 2QWWA 5DD8A 5DD4A 1RIOH 4YIFA 4LWOA 3BJOA 3T7RA 3GO5A 2H27A 3G2OA 3QOPA 4NQWA 2FK8A 5K0FA 2OAZA 3NTVA 1FP2A 4RGRA 2V1DA 4I7HA 1IRFA 4OBXA 3BWGA 1USSA 4HW0A 2ISZA 3EVZA 2VDWA 1BC5A 3KHKA 2EJUA 2LDUA 3OCJA 4ESBA 2P5LC 3F8CA 1P6RA 3VOEA 4R79A 1HW1A 1WKMA 4A2UA 3F22A 3BPVA 3L8DA 1ZH5A 3FXUA 2AS0A 4KDRA 1ZKDA 1O3QA 4G6DA 2ZBKA 4U0WA 2P3OA 3MZYA 4HAMA 3UJ7A 4AX8A 5FD5A 3LAJA 2HQRA 3M6UA 5GOZA 1PJZA 1X1CA 1R36A 4MWZA 3JAMZ 3ZP5A 2XGXA 2O0YA 5E1OA 5BW5A 1DUXC 4KRGA 4LMYA 2Z33A 2FBHA 1ZRDA 2Z3YA 4IKPA 4WXDA 5EMJA 2CO5A 3LDFA 2O61A 1QBJA 1ZREA 3BWBA 4MGRA 1R1UA 1AF7A 2KIUA 2FA5A 4HDUA 2IH5A 4LLLA 3M6WA 5P8WA 2OU2A 4M37A 2V1UA 3BZ6A 2UYQA 3C0KA 1XDUA 2E1CA 1FWZA 3EVFA 5HIMA 2R3SA 1M6EX 2FMLA 4DA4A 3KCCA 4EMSA 1VP3A 3TGNA 4C04A 3V7CA 4A6DA 3KPVA 3VYWA 2PMHA 3WTUC 2VDUE 2XHKA 3U9GA 2CGPA 3MWMA 3WE3A 3CVOA 3T5XA 3OPNA 5HLIA 2IA2A 3ER9A 4RGXA 5ICFA 3KZZA 2HQNA 4HX4A 1JG2A 2FYTA 3CBGA 4DQ2A 1QNTA 2RV8A 2QLZA 1XTPA 2Q8KA 3TO7A 1T2KA 1KYZA 2VOPA 1VLMA 4N9IA 4ZZDA 3J80K 2NYUA 1RI3A 4WX9A 2ESNA 1J7KA 4GF5A 4YUYA 1G38A 3HTXA 5LHGA 1JG3A 3B89A 4DZRA 3H92A 3L2CA 4N9HA 3TRKA 1O9GA 3KPWA 2JH8A 3GNLA 5F2NA 2VP3A 2L54A 3HA3A 2Z99A 4POOA 2ZCWA 3FTEA 3KQVA 1R23A 3M70A 3HSEA 4Z2YA 2XRNA 3HCDA 3NJRA 5M5BA 5LHHA 4X63A 5E8IA 3RKWA 2WTEA 3EYIA 5DX1A 4ENMA 3K0LA 4LK0F 2JG3A 1D3YA 5J6XA 1EH7A 2NP6A 1F4KA 3VODA 1J9IA 2C6YA 1I27A 1OYWA 2K86A 2YX4A 2M87A 5F64A 3JTGA 4ENNA 1RJGA 3GWZA 2YQZA 4AZVA 2ZW9A 2IRFG 2L3DA 5DCFA 1I1SA 3AAFA 4Y2HA 3O7WA 2EB7A 2OY0A 2XYRA 5LQRA 4BLWA 5T64A 1WS6A 1J5YA 3QAHA 10MHA 4GOMD 2PSSA 5CVEA 3FMSA 5K0LA 5DCMB 3GW2A 3NQOA 1W7PA 1PRYA 4M9SA 5HIJA 1FBQA 4AIHA 2I9KA 1U3EM 3GRZA 1G4DA 1SD6A 4BNCA 3HHGA 4XUEA 2RC4A 3FUWA 3M6VA 1T43A 4RV9A 3JW4A 1ZG1A 1NV9A 2MLKA 4HOBA 3DQVC 5A2QZ 5BW4A 5AIQA 3E6CC 1BI3A 3SZPA 3KP5A 2AOXA 2G8NA 2COMA 4RAZA 1XD7A 4G7OF 4GOLD 4EK9A 1R5HA 1YQAA 4B8XA 2ZJ2A 3VC2A 1RZ4A 1J75A 2P4WA 2WK1A 3PT9A 4TV7A 2NXCA 2O03A 5KVRA 3IRQA 2M45A 2G71A 1LJ9A 2DPMA 5E9WA 3FPEA 1FYLA 4H0EA 1L3CA 5K0BA 1ZLJA 2QQBA 3E5XA 4OINF 4XSZF 3U1DA 1PP7U 1S3JA 1FBUA 1QPMA 2ZNYA 4GOOD 4P7KA 4R6WA 2GB4A 3UBTA 3BGIA 4PYLA 5HFJA 3KKZA 2O07A 4EV0A 2DBBA 3KETA 3O2PE 1X19A 4OIOF 3KQMA 3KLOA 3IWZA 4R1HA 3HCCA 4L9JA 3O4FA 2YXLA 2OA4A 2OQRA 2P41A 2P5VA 2XAFA 2VE9A 3ORHA 3EUHA 4YUXA 3E6BA 1OYYA 3PS9A 4LGWA 4KN4X 2P35A 4G6QA 1IUYA 2NP7A 5IT3A 3HIFA 2ETHA 2G7HA 1SFXA 2UXNA 2OZUA 4DMGA 3HVIA 3P2IA 4BQAA 1JG1A 1I1NA 3PTAA 2E5WA 1R6AA 2Y1XA 4RB2C 5U4XA 4XUCA 4GGGA 5HS8A 3TM5A 4YV1A 4L7VA 3QPHA 1W5TA 3AJDA 2IA1A 1R5GA 2YX1A 4HH4A 5FHQA 1EJ0A 2XUBA 3U2RA 3K1MA 2A3SA 2HV9A 2ZXJA 2VE8A 3REOA 2P3QA 1SMTA 3DMGA 2VODA 4GXOA 1Z91A 3EVBA 2W84A 4HZFA 1GXQA 3P9IA 1SD5A 2Y75A 4GBED 1D8KA 1ODDA 4M9XA 3JWIA 1H0MA 3D2LA 3PFIA 3HRMA 4KA4A 2ZKZA 3F3XA 3SXYA 2H94A 5HLGA 2F5DA 1WG8A 3ECHA 2EG5A 5T6BA 4MTEA 3BJAA 1MJFA 1X3UA 2P1DA 5GINE 4BXUA 5HDKA 5DV5A 4PYOA 5D5UB 1BIBA 1AV6A 3NRVA 1I1GA 2WA2A 3LKZA 4PONA 4MQ9F 4PGGA 4RAYA 1G3SA 2A69F 2MBFA 3TOBA 2AOVA 5FHRA 4RTRA 1K7AA 4QPPA 4BHCA 3I71A 1I6XA 2K02A 3EYYA 1FNNA 2XKOA 3E7PA 3IV6A 5CUQA 5ERIA 2ZMEA 3TQNA 4R8RA 2UXXA 3SHFA 5EMMA 2R7DA 2DK5A 2NNWB 3UJAA 3HSRA 5DEQA 3WGHA 4KYWA 3NWEA 3LL7A 2JT1A 1TPYA 2LNBA 2XAGA 3WU1B 2O8XA 1UWVA 5EVJA 5ICGA 1W7PB 4PIMA 3M33A 3EPPA 3PLAE 2ZCJA 4IVNA 1HSJA 1XCBA 3G73A 2X4HA 1IXRC 5TJJA 2EV5A 2B2CA 1SD4A 4ATNA 3RIRA 3NW9A 3K9TA 3J7AO 4KWCA 1R8XA 3SMQA 1YYVA 4D0PA 5C0OE 5CVIA 3NEUA 1SUSA 4HQMA 2O0LA 4HC4A 2P40A 3EEOA 4LK1F 2H6BA 3TO9A 1JHFA 3CC8A 2MD5A 2LD4A 2IDJA 1Z6TA 3WTSC 1XSVA 2GA9A 2BYVE 2FK7A 4Q5SF 5DXJA 5B1SA 5L3DA 3GFLA 3FM5A 1PP8F 4PCLA 5C9ZA 3FRIA 2PKWA 1TNSA 4EVIA 5FQOA 1JQ3A 1JTEA 3L00A 1NW5A 4OQDA 5DRTA 1IN6A 4M6YA 2EX4A 4U7TB 3LQRA 4FHTA 2FPOA 3BT7A 4V0RA 2DK8A 2Y0MA 1DL5A 4RTKA 2XASA 2HGCA 2YSRA 4BHPA 2HWKA 2CWEA 3OU2A 1R58A 5H02A 1RI1A 1W4MA 1OR7A 3T8TA 1HNNA 1B9NA 3I5UA 3G5TA 1SKMA 2AOTA 1JSXA 2BR5A 4BLVA 3Q7EA 3J80Z 3L7WA 1MJBA 2IVMA 2OZ6A 4CDGA 2K7LA 5DT2A 3GF2A 3T7TA 1UHWA 3LHDA 3ELWA 3G8BA 1P4XA 4MNUA 3W6KB 3TQSA 1R00A 3A27A 4Y13A 4HF2A 4UVBA 3DPLC 1YB2A 2AOUB 4PYQA 2V7EA 4F84A 4RB0A 3GEZA 4OMYA 2PJPA 3EVEA 3X0DA 2HZTA 4C06A 3FPJA 5L3GA 3KR9A 5E2BA 4EM1A 2HMYB 4LLNA 3DKWA 3G3ZA 5LRRA 4S04A 2LSOA 4QQKA 2GAFA 3M9AA 2IT0A 3HVHA 1NW3A 4M71A 3MGGA 3BGDA 3I9FA 4KMFA 4KIFA 1SD7A 3R24A 2V6CA 3I4PA 3E23A 4CKBA 1FPQA 5FCDA 3ZMDA 3FUUA 1Q0TA 1Y0UA 3CUQA 3TOAA 2JTVA 1K79A 2PGXA 1U2ZA 4CTJA 5CCBA 2FCAA 1T0FA 5LQJA 3ELUA 5K8VA 3J81Z 3P9KA 1XDZA 2B78A 3SXJA 5D5VB 1WZNA 3H2BA 2F5CA 3HYIA 4A0XA 2DPDA 4MEYF 2G7UA 3G7UA 2KJBA 4E30A 4P7FA 4HX7A 3COAC 2RQPA 1IN8A 4I09A 4A6EA 3F8BA 1IN7A 3RPQA 1W7PD 4JBAA 2EK5A 2VXZA 2DTRA 3HRSA 4XCXA 3R0JA 3ANXA 5K0EA 2H1RA 2OBPA 3LCVB 4LG1A 2LF8A 1CF7B 4GOND 2BR4A 4YMHA 1FLIA 4Y30A 1HKSA 3KPJA 4ETSA 5TRDA 1NW8A 2OZVA 1XJ5A 4U88A 4L5JA 1LVAA 1MDMA 1VL5A 5HVQC 1W5SA 2K4MA 2CKDA 1H1DA 3FHZA 3FPFA 5HS7A 2DQRA 4P58A 2YU3A 1ZLKA 3G2QA 3C6KA 3GJYA 4G94A 1B4AA 3R60A 4KN7X 1L3BA 4I2OA 3G8AA 3JWHA 2EFNA 4G56A 2JHAA 3EMBA 2VBZA 2L02A 1QAMA 4LWPA 2BE5F 2UZKA 3A4TA 1XXLA 3V4GA 2RNJA 2ORED 2I62A 2EFOA 2DFIA 3ML6A 2YUIA 5CVUA 2GA1A 4AIKA 1XGMA 2QRVB 3JAMK 4KT5C 5DLYA 3OFJA 4AWXB 3WODF 2Z6UA 4CZZA 2B0LA 2JHCA 4RVFA 2LF7A 1VBFA 4I0BA 1OYIA 3HCBA 2CQKA 3Q9VA 5E1DA 3OFKA 3BJ6A 3QOWA 1Q0SA 4NECA 8MHTA 4ZYDA 5ILVA 3G2PA 2EWNA 5EZSA 4JK1X 3I53A 1U5TB 2JRTA 3KLNA 3CJQA 2JHPA 4L18B 5J8FA 1QZZA 2I6GA 2DAOA 4UV8A 3AWIA 2PXAA 5LR6A 3P7NA 1WSUA 3DXJF 2K27A 3F72A 4NB5A 1WXXA 5F2OA 1KR5A 3FF5A 4BHBA 2H09A 2VOOA 2RVCA 4L0ZB 2EA2A 3EGIA 1Z6RA 4PYIA 4HGZA 3CUQB 5D8KB 4ESJA 1M0EA 2HTEA 3DPTA 2AN5A 5DDGA 4Y15A 2V79A 2HWVA 1V3FA 3I59A 2GLUA 3HVKA 3PVCA 4IRGA 4DF3A 1WQ2A 3RYRA 5ICCA 2FRXA 5J8CA 5LLQA 1TQPA 1IW7F 4RGSA 5FQNA 1KU3A 5GIPE 3B02A 3WTZA 3QOXA 1T98A 1XMKA 2XKPA 2VS1A 5BP7A 3TFWA 1P1BA 3ZQ7A 5D8LB 1S7AA 3UJ9A 2HKXA 2CYYA 4KVZA 4RGUA 1KXZA 3TMAA 2O06A 2XVMA 3MHTA 3I0TA 2OB2A 5BXYA 2GXGA 4CGZA 5E1MA 4UVCA 5E20A 3B3JA 1XSDA 5EKXA 2JJQA 4Q48A 4I0AA 4XRFA 3ZN1A 4Q4ZF 1TQMA 3BUSA 1ZAOA 1XCJA 4FX4A 4JXJA 3N97A 1YUBA 2RDPA 1FYKA 4RWZA 5LEJA 2WA1A 3PQJA 5ED4A 2Q2EA 5DX8A 2GWRA 3HRUA 3FRHA 2IGTA 4RB3C 5EIFA 3WTWC 3T0YA 3HA5A 2FF4A 5HOOA 5K0CA 2L4MA 3FPHA 3KPYA 4P7GA 4G9YA 5ERGB 1YTYA 4BAYA 2ZFWA 1QAOA 4ZYEA 1F1ZA 3KR1A 1G3TA 3GX4X 3EETA 3RTRA 4ON0A 3NDIA 3THRA 2EFWA 4XBFA 1L0OC 4ER6A 1FJXA 3WGIA 4RVHA 3OE4A 4IV8A 1AWCA 2DW4A 4N0BA 2XBMA 3LAPA 1YZHA 1D5VA 4EJTA 3KEOA 3KP7A 5ILUA 1HBXG 3KU1A 3HCEA 1G3WA 3GFIA 4AZSA 1DUSA 3GRUA 2H6CA 1R18A 2HYFA 5FADA 2ISYA 5LQCA 3ZMUA 1YW8A 3RYPA 1C0WA 4CYDA 1SUIA 4QQNA 2HS5A 5CVJA 2VBWA 3LDUA 4EGZA 5DSXA 4QTUB 2HYGD 4PINA 5HILA 4YG2F 3LGAA 5E8GA 3DV8A 1YS6A 4I01A 2QZ8A 4PZJA 1EQAA 2YXEA 1JTFA 1R1TA 3KQPA 3UA4A 4H0NA 1VIDA 4I02A 4YUZA 2BEOA 4UOEA 4DCGA 4ZTBA 3LPMA 1L3IA 1INLA 2ZSUA 2VT3A 4AVPA 1JE8A 3EQLF 1H9TA 1EJ6A 2FOKA 2XV4S 3B3FA 2FNPA 1S8NA 5EMLA 1JHHA 1JQEA 4L9TA 4FX0A 3SVZA 2P5KA 3PB3A 1G55A 3P2KA 2P6SA 2IFTA 3HA7A 3C6MA 3GIWA 2ZMEB 2PXCA 2D45A 3C3WA 2HOEA 2YR2A 5L3FA 5FA8A 2ZZNA 3W6JB 2PX5A 2H00A 1RI7A 1YFJA 4ASNA 5F6FA 4A0ZA 5LEKA 4OX9Y 3Q87B 5KQSA 3WG9A 1RI5A 2V74B 3TLJA 2JH9A 3JWJA 3WU0A 4A12A 3UJBA 4LG0A 3O31A 2W24A 2YPRA 4EJVA 4E33A 1V39A 5K1YA 3HCAA 5FFZA 3FUXA 4HF0A 3D0SA 1B9MA 4XLPF 4EKIA 5DWQA 2FHPA 4M7RA 5CD1A 5LHIA 4QWQA 2MA3A 2W25A 4OIPF 5E1BA 3FPGA 2ZFUA 1YW7A 4QVGA 2PXXA 4C07A 5E1ZB 5AIPA 1KIAA 2JZYA 2MC3A 3MQ2A 1Z1DA 1BKYA 1J2XA 4OA8A 3P71T 5H6QA 2B9EA 2NNNA 2ONYA 2FSWA 2PT6A 3K0BA 4P96A 2A61A 4P9UA 2KW5A 3WE2A 3SZTA 1FOKA 3JWGA 3PQKA 3THSA 2EA4A 3V7SA 4A5MA 2FXAA 2HTJA 4U7PB 1MZBA 4NHJA 3VEPA 1NKVA 1ON2A 3E5QA 4RTMA 3BOQA 3JTHA 4IF4A 1SMYF 3HP7A 3KR2A 4KDCA 4UV9A 2ZBRA 4OQEA 4HBLA 2QYOA 4P55A 2FMYA 4F86A 2D1HA 3GO4A 1BC7C 1X1DA 4R6XA 1IY9A 1YS7A 2YX7A 3ZMTA 1KP9A 1D2HA 2XYQA 2AR0A 4CKEA 3ROUA 3K69A 5DM0A 4MTLA 4A0YA 4F7ZA 1YG2A 3CJRA 1M6YA 4X1OA 4CO8A 2J5PA 3MAGA 4OBWA 3G88A 2ZBPA 1Z3CA 3LA2A 3M7GA 4G7ZF 3DXXA 1FZPB 5DTRA 3E6MA 5DSTA 4YIIA 4EGYA 5IH3A 1HQCA 4WXHA 1R74A 5KYGA 3BWYA 4RTOA 5BS6A 4C03A 4U0VA 3ZMZA 3KQTA 3CUOA 1XN7A 1SFEA 2GA2A 3SFZA 3V8LA 3QV2A 1JG4A 2A6HF 5K05A 1RJFA 3DF8A 3GZ5A 3GFMA 2QE6A 1NHAA 2X0LA 1EV7A 3HNRA 2HEOA 1L1EA 4DKJA 4ENKA 1RI2A 5E9QA 3KP2A 3TM4A 2R6ZA 5JVTA 3DLCA 5FA5A 3LSTA 3R61A 3M8FA 5HIKA 3C3YA 1XGSA 3R6SA 2IJLA 5H20A 1L9KA 3IEIA 2W85A 1FSEA 4DM3A 1JQDA 4XUDA 3I54A 4BP1A 3F8NA 2YTZA 4Y17A 2F8LA 2XAQA 3BROA 1G8SA 4B17A 3ISPA 3IRRA 5IT9K 1HSTA 3MAJA 3I64A 2CWWA 5DM2A 5L3CA 1QYRA 2GS9A 4L9NA 3VSEA 4YUWA 4R05A 4WCGA 1U5TA 1G6NA 2K4JA 4ZZLA 2AOUA 3GZ6A 4QDJA 5KK1A 1XDSA 1P4WA 1DPUA 2A68F 1MD0A 5DRYA 4EJWA 4QLCU 1VPTA 1XSXA 3OZRA 2QQ9A 2ZVJA 2Z6AA 4OMZA 3HOTA 1K78A 4ER0A 3LBYA 4LB6B 1MJ9A 4C08A 3V8VA 2HDCA 1R7JA 1FP1D 2GPYA 1ORIA 1ZGAA 3RODA 3M1EA 4AIJA 4QTTB 1STZA 3NVMB 5L3EA 4GQBA 2DQLA 2HTSA 1BN5A 3T0IA 1DCTA 3NWBA 1XGOA 2Q41A 1U5TC 3HRTA 5CLSA 5D5XB 3HEMA 5FULA 1IRGA 1P1CA 1IZ1A 3KQQA 2P6TA 3BDDA 3HSFA 4X41A 2XROA 2IDKA 1WY7A 1REPC 1AOYA 1DDNA 3G2MA 5IKMA 2M5WA 3T7SA 3OE5A 5K09A 3SSOA 3C18A 2FBIA 1QO0D 3JSPA 1YIOA 1LDKB 5FTWA 2GAUA 4ZYHA 2EFJA 1L3LA 3CO7C 4E31A 1E17A 4O3MA 3FYDA 4LB5A 4BYYA 1OR8A 2XVAA 5FGMA 3QU6A 1FT9A 4YV2A 2Z5UA 2WWYA 2ZIEA 3ABTA 5EKUA 5K5OA 3EGVA 1O7FA 1DP7P 4RTQA 3KZYA 2UYOA 1VP9A 1XB4A 2C7RA 2OPBA 4HA8A 4HYEA 4OIRF 4OIQF 2PI0A 4ER5A 4UUVA 5FWAA 3SGLA 1TW3A 4R8SA 3DFGA 4CHUA 2PBIA 5LBQA 5G02A 4M38A 3CCFA 2V9VA 3FXQA 3IYLW 4YV0A 5FD6A 3KP6A 3BPXA 2BBYA 4OU0A 3B73A 1F3LA 1QZYA 5CJ9A 2C7OA 2OXTA 2PJDA 1R22A 1ZN2A 3NVKI 1I9GA 1A04A 1KQ0A 3LBFA 1BOOA 2PY6A 2BGCA 2QBYA 2DT5A 3F8FA 1IN4A 3RDIA 1JSZA 3ELDA 4V0QA 2Y1WA 1GVJA 1AQJA 5CM2Z 4ER7A 1NT2A 3UJ6A 4IHTA 1VQ1A 1O7LA 1BOAA 3LA3A 3U81A 2KRFA 5IT9Z 2G9WA 2KIMA 2H11A 2NAZA 4IJAA 5E17F 3KQSA 2ZIFA 3DXZA 2ZIGA 4AZWA 1EH6A 5LQAA 5DM4A 3I58A 1BC8C 4HGYA 4YFKF 1XGNA 2CMHA 4E2YA 2PLYA 1NE2A 4FGZA 4S05A 1U8RA 3IWFA 4MQVA 2OO3A 2BM9A 4FT2A 2UWMA 2CMGA 4HTFA 2ESRA 3R9XB 1MGTA 4HTFB 4L5IA 4E70A 5LGNA 2PMUA 3E05A 4FP9A 3SSMA 2OD5A 2PWPA 3MERA 1FSHA 5HEKA 5FWDA 4OA5A 2P7IA 2EFPA 3TDZC 1WXWA 2HKOA 4RB1A 3AXSA 3CUQC 3FZVA 3VC1A 4ESFA 4HLYA 3DH0A 4PCAA 2DPUA 1FBSA 5FO5A 2K4BA 2XYVA 4CXFA 1EH8A 1KHHA 1WRJA 3GYHX 5EGSA 2F5FA 4HDVA 4C05A 2O57A 3R4KA 3OU6A 4C4AA 3K1NA 2Z9OA 3TR6A 1XMAA 3L9FA 3RKXA 1LB2A 3I59B 4KUMA 4HSGA 1RUOA 1D8JA 3HHHA 5BPIA 2JSCA 4E2WA 5K0JA 2FEZA 3UWPA 1KYWA 5KS2A 2EJTA 3TDUC 1YFLA 1G8AA 3AY0A 4GYIA 3D5LA 5BMZA 5C1IA 1D2CA 2XVCA 3MCTA 4RTPA 2OQGA 4RTJA 1ZRFA 2PEXA 1FX7A 1UB9A 1JGSA 3HTUA 3IHUA 3KP4A 3FTFA 1HKTA 3CDHA 2DI3A 2VZ9A 2PVCA 2NRAC 4OOIA 3BP8A 1N7JA 2CL5A 5FUBA 2QUFA 3IKTA 2F5EA 4EQQA 3SM3A 4BP3A 1XCVA 5CCXA 4FSXA 3B3GA 2BM8A 3DUWA 4MEXF 4PYJA 3EVAA 4KFCA 1G3YA 2W57A 2ZWAA 4PDKA 4AUKA 1IF1A 3EMDA 3GFJA 3G89A 3Q9SA 1BIAA 2NYXA 2ADUA 1IXKA 1YZ3A 2KJCA 1ZYRF 4O5VA 2IBTA 1UCRA 5GIOE 2EV6A 2QBYB 2AOTB 2EV0A 4KIBA 3E5UA 4L0YB 4KW7A 2L01A 1O3TA 3CGGA 3GGDA 4KICA 5BOXA 4RTLA 2PWYA 2VDVE 2WC2A 1NW6A 3RJPA 4UXNA 2OYRA 3G5LA 5DCMA 3MTEA 3WTVC 4IRIA 3GVAA 2PV0A 4HQEA 5HIIA 4UNOA 2AOWA 4F85A 3ZPLA 3QP5A 5FFXA 5EHIA 4HV6A 4IWNA 3ELKA 2Q0OA 4LECA 2QVOA 3IC7A 2ZO4A 2NS0A 3GDHA 4R8HA 5EIWA 1KPGA 4E32A 1FYMA 3HOSA 1OPCA 4YFXF 2BH2A 3GCZA 4KIGA 3H3ZA 1QGPA 4HV5A 5GWXA 1KGSA 5GM1A 4PYMA 1ON1A 1CF7A 3MEXA 2HFHA 4EM2A 2D1VA 3ID6C 1U6GA 2C7PA 3V97A 4K6MA 3F6VA 2OKCA 5LQKA 1IXSB 5ILSA 3P97A 5H6RA 2M30A 2VC1A 1CGPA 1RJDA 3C3PA 5DPMA 5MHTA 1H9GA 5L3BA 5EPEA 3RIEA 4BH9A 1O3RA 2YR0A 2DLLA 4IV0A 3F8MA 3E6DA 3T8RA 3K2ZA 2AVNA 2ZWVA 4KNYA 5LGUA 5D5WB 5DUKA 1HKQA 3UJDA 3ELYA 3CO6C 3WTYC 5GM2A 1HW2A 5DTQA 3QPTA 4IHSA 3A25A 2O05A 5FLXZ 3A26A 2IP2A 2O6GE 1WWXA 4KMUX 3LQQA 2NXEA 1ONVA 5EQJB 3GRYA 3LX6A 3CTAA 1YFHA 2Y48A 2G72A 4MQ4A 4FT8A 3DULA 1ULYA 1NV8A 2STTA 4MTDA 1I4WA 1HXDA 1PUEE 4EKGA 2STWA 3P9NA 3LCUA 5CVDA 3WTTC 3KFWX 1P39A 3FMQA 2PX8A 3AXTA 3SQNA 2AN4A 2VT2A 2N47A 4M36A 1MHTA 2Z6QA 3C1DA 4WWCA 1KPIA 1X1AA 1U78A 3Q5FA 1G60A 3OZSA 4YFNF 2ZNZA 3WTXC 2G1PA 3FYCA 1LEAA 2BV6A 1BI1A 2IBSA 2CW0F 4MHGA 3OU7A 1ZHFA 3F6OA 1UHMA 1F5TA 4HF1A 3KP3A 4LLGF 1GHCA 3B7PA 2ZTHA 4GC9A 2GQQA 3UFBA 5EHGA 4HLXA 5DUIA 3C7JA 4G7HF 2RKHA 4PWYA 4UVAA 2YVLA 5F1RA 3O6BB 4P5OA 4U0YA 2MH9A 5A2QK 1NBIA 4M72A 4GC5A 2KKOA 3DMHA 2ADMA 1P92A 3ERCA 2JPBA 4E2XA 5JHUA 4BLUA 5D4SA 4HRAA 3S2WA 1BBYA 1S29A 1Z7UA 4RTSA 2M1BA 5EEGA 5FB2A 2OBFA 3UZUA 1B42A 2VBYA 2TDXA 1NW7A 3JSOA 1UIRA 3ZMSA 3FWEA 2XAHA 2IW5A 1FY7A 5EMKA 3GLXA 5EOVA 5T67A 5LQNA 3VFZA 3FUTA 3TKAA 1OMIA 3BWCA 1JR4A 3ABUA 4KDPA 3BWMA 3LECA 5E2AA 4XLNF 1KU9A 1KQ9A 4EQZA 1BI2A 1FBNA 3EVGA 2EJRA 1NBHA 2RN7A 1P4AA 2UYCA 2P8TA 2WV0A 4FSDA 1YW9A 5K01A 3IHTA 3TPZA 4UHTA 2RGVA 3EGEA 2D2WA 1T38A 1UFKA 1ZG5A 2KIFA 2UZ4A 5HS9A 4FT4A 2ACJA 3PX2A 3WGGA 4U7BA 4LG0B 5KVAA 4CXMA 3V7RA 4ENJA 2BR3A 4M6XA 2IPXA 1BM9A 3IKVA 1WI9A 1Y8CA 5JR3A 2PG4A 3N4MA 5LSAA 5CVVA 1I5ZA 2A14A 3FXRA 1K6OA 1P91A 3EEYA 4GCVA 3RI4A 1K78B 1LQ1A 3CLOA 4M73A 1HMYA 4EJUA 5DYMA 3MFKA 3ER8A 3UJ8A 3SR4A 1UFMA 2FE3A 5E1XA 1QAQA 5JI6A 4IXAA 1B6AA 3TO6A 1KQ8A 1VTNC 2A6EF 2QM3A 4RX1A 1E2XA 3KE2A 5K0GA 1F38A 1O3SA 5D6EA 2EFQA 4HX8A 2V1XA 4IPAA 2P8JA 1MJAA 3M4XA 4CTKA 1RJEA 3ECOA 5E8JA 4RYLA 5DTMA 3CJNA 3RW9A 4DCMA 1IM8A 4EJOA 2GH1A 4ISCA 3T1BA 3DOUA 1TLHB 1N2XA 4GEKA 4Q47A 1F9NA 3FTCA 1ZGJA 3LFKA 5HLHA 1KA8A 2PX2A 3P9CA 3F23A 2E7WA 3MZHA 3LWFA 4LFUA 4RVDA 4X61A 1EG2A 4FR0A 3K6RA 2P3LA 5DXAA 4HG2A 2QY6A 1YO5C 3R0QA 2ZLBA 2XAJA 1B59A 3CKKA 4M9ZA 4RVGA 5EEHA 1O9HA 2G70A 4RTNA 1Z9CA 2AZTA 3LKDA 4PIPA 4K2EA 4PYKA 1N7IA 5AONA 2FNAA 4JQFA 3OZTA 1R8YA 1LEBA 4QVKA 4QPNA 1Z05A 3KQOA 3KPUA
chains in the Genus database with same CATH superfamily
3QA3E 4Y52J 3IIKA 3N53A 4JELA 2CEKA 1RLJA 5C44J 1QV6A 4JP2A 4O02B 4BO9A 5BNIA 3WXBA 1N0IA 2NNYA 4MZXA 2DFDA 1H3EA 4A5NA 4P7JA 1X92A 1ZD1A 5D1HA 3LQFA 2CNLA 3DP7A 4BU1A 3DNFA 1ETXA 3Q9LA 4MIEA 4O29A 2D7JA 2ZR7A 2ODQA 3A8TA 4UUSB 2CF5A 1COZA 2AG6A 3ANTA 2EIHA 2FEAA 5EFOA 4RBOA 2W6OA 1YZQA 5JFRA 3OJLA 3QJGA 1E94E 2NVOA 5LYJA 4B71A 5EDNA 2HPAA 3X1WA 1MKMA 2VZ8A 2AO9A 5CMLA 6ADHA 1HE3A 5FROA 3L4BC 1N2EA 1FDOA 3L8ZA 2XE8A 4BY1J 1UH5A 5BNGA 5HJ2A 5KINB 2R1ZA 1POGA 1QIJA 3HB1A 2LK2A 3HY6A 2YWJA 1MABB 4MYHA 5SYAA 1PIWA 3RWMB 3Q8XB 2L7MP 1DIBA 5BQTA 1Z5GA 2X3YA 2G0AA 1KIMA 4EB6A 2V5VA 1K89A 2ZXWH 1Q1GA 1POXA 4WF2A 2QQAA 4ZTJA 2FQ3A 1LF5A 1SG6A 2H52A 2G3YA 3KQWA 3LC1O 4K9NA 3DZIA 5CAEB 5JAHA 2GIVA 2RHTA 1YGPA 4TS4A 3RRFA 1IZ7A 3LCJA 3QUCA 4E4RA 1NPYA 3R5JA 4XVCA 2QUZA 1BJAA 1F2UB 4DYCA 1XXHE 2X0IA 3L1IA 3NHAA 4LCJA 4OAQA 3DTNA 2IY7A 5K3SA 3RFCA 2G17A 1EFVB 4U6NA 521PA 4GMDA 4I1OA 4UARA 1RC9A 2IELA 4YVFA 5TNXA 4W1UA 3ZU4A 4DDVA 2C83A 1L5YA 2EZLA 3GPDG 3RJ9A 4MDEA 1JTFA 4J0HA 4C3HJ 4B7UA 3VB2A 5AVRA 4UB8C 3L7DA 4EWLA 2VONA 4RA9B 2QL6A 1P2TA 1GXPA 1NG1A 1E64A 2ZYAA 5C8XA 1O4WA 4AZTA 4M74A 1FJLA 1U2EA 3JQ8B 2V3CC 1KQ3A 3Q8MA 2B9SA 2QNRA 4JL5A 4XGIA 1NHGA 4J9VA 4LCEA 1KK3A 1F36A 3E3VA 5FUVA 1DBSA 3TMYA 1QV9A 5HOEA 2YXPX 1HC8A 3BXPA 3R3ZA 1T2AA 2BMJA 5LVAA 4DDTA 4YV7A 2HJSA 6PAXA 3UT0A 4C01A 4AUNA 4LJ7A 2OESA 3H99A 1J0RA 5HVNA 5FLXK 1WKVA 3URKA 1LF0A 1R71A 3D4OA 1UPXA 2ROQA 2P0WA 2CVPA 3PX3A 4M1QA 821PA 2HU9A 2OUKA 2BFAA 2VAWA 3OYBA 4N76A 2I2WA 3J81K 4ZMBA 1SUWA 2Z9DA 3QOFA 1U5AA 3EODA 3OIWA 1D07A 2W43A 3AUAA 3BXOA 1M1NB 3TTWA 5BPDA 1OH6A 1COWD 2IZ7A 1EAYA 5LFAA 2ERCA 3F3SA 2I1QA 2R7KA 2UZ0A 3FHJA 3HN2A 1OFCX 4Z86A 1Y6GA 1IVYA 4WKOA 4BNHA 5JMTA 3K70B 4CWAA 4DG5A 3UYLA 5FWYA 4MIKA 4BX2A 3QKWA 1WPKA 3TW8A 3S17J 3QWHA 3NWOA 2IU4A 4MGIR 5KMGB 1JFFA 5CNIA 1YCFA 5TMEA 3NM4A 3CB4A 2HNKA 3CLKA 4U5QA 1X58A 3TH5A 4PQRA 1SKQA 2AB0A 1SBHA 4GI7A 4RVOA 5DASA 3O1HB 3UHJA 4TPKA 3ESQA 2IITA 3FOZA 1FZTA 1YZVA 3R6TA 1EWRA 3OQIB 3BL8A 1T5TA 3A05A 5K0NA 3AV0B 3CN9A 4Y6SA 2VAPA 3GFVA 3ZTTA 4IILA 1ZOPA 4DLVA 5IVHA 2CS3A 2CXPA 2JARA 2RREA 1E1NA 3NTOA 1TTYA 1JJVA 1CHDA 1RWNA 3E48A 3GTMJ 2FWNA 2OO7A 4XMYA 3S1MJ 1E66A 3K32A 2DOFA 4GOJA 1NP6A 3ZE6A 4HDNA 4MVJI 5JCOA 2UYHA 1HYQA 1LSOA 4JCOA 4PBSA 4OHVA 4OQPA 1NULA 5AW8A 3T35A 4D9CA 3SYTA 3L09A 5I4CA 3DMFA 2JLZA 2VFAA 1KAGA 1MMAA 2GXBA 2ZXFA 2WVAA 3A7DA 4X90A 2M8EA 2PFBA 5IVKA 4BYGA 4XM2A 2B3TA 1N2HA 2HCBA 4QDKA 4HQ6A 4WVFA 1OLOA 2BEUB 2ZZKA 3OEHD 1GVDA 1DJOA 2EINH 1Q84A 3C2HA 2A5YB 2EJBA 2YV4A 1TQIA 4FMCF 4L6IA 3H04A 3AEYA 3E8SA 4XLZA 1LPOA 3ZCPA 3HN7A 1EINA 1Y7TA 4JA2A 6GPBA 1GYPA 2XDQA 3GT3A 4FEAA 3QA9A 4MRMA 4MUMA 4MSUA 3SJUA 2E5LB 4ED9A 4E2ZA 4J00A 1AQIA 1UXJA 2YYYA 2I0FA 3N8KA 4PANA 1SZDA 4Q24A 4UM9B 2PN6A 3O3KA 4Y9SA 5L3VA 4A0GA 3AHHA 2O2CA 3NDRA 4GYKA 2RH8A 3R3YA 4C22A 1MQSA 1U2RA 2ANBA 1SVUA 1W5AA 3FGPA 4PN3A 1EXNA 4QHYA 2VH1A 3T34A 5BR7A 2N75A 2BP7B 3RPUD 1LFBA 1YB4A 2WC1A 3H2GA 2A3NA 1W5BA 1K1EA 4LSGA 2CBZA 3BF8A 4K6OA 5GONA 1KPHA 3V2IA 3C70A 3AVUA 1MPTA 4Z6KA 3GPIA 1Q0HA 2IX9A 4EM0B 3ONEA 4B74A 4RD0A 2BAGA 1WMBA 2BFCB 2Q4RA 3BKXA 1QQIA 1CRPA 1OE0A 2DU9A 4LYEA 1GEEA 1KU2A 3V55A 1CLUA 4OLAA 4IRHA 1R6DA 2VJMA 5KQRA 1N8KA 4JOQA 1XTAA 2CHGA 3LA7A 2W0SA 2VXOA 3CLSD 3JRWA 4GUAA 5EIXA 3LBNA 5K5RA 1U28A 2IYSA 4QYIB 4HVTA 4GL4A 5EZYF 2XCSB 3SOZA 1D2MA 3WXMA 3DQPA 3MELA 4G63A 4V3CA 3LC2O 3IQDB 3RTAA 3SZOA 1Y3IA 4D9KA 1MW8X 3RKUA 3HWRA 5E1WA 2QDKA 3OQ6A 4JEHA 3A1WA 1GV1A 3L0CA 5CBKA 2SECE 3S2FA 2VBFA 4QVIA 2VBXA 5EGOA 3IAM2 2IXTA 2EQBA 3HLTA 3VUEA 1VQMI 1T91A 2VEOA 1BL0A 3DWIA 3HDHA 1V37A 4M8KA 1VRCA 2V4ZA 5JNLA 2WRZA 3C15C 2J3KA 5DU2A 4WFQA 4Y33A 3BJIC 2ZM5A 4M22A 4W6ZA 1N5OX 3H2YA 4NPAA 3ZYCA 4RDXA 4AULA 5F9HA 1OI7A 3EPZA 4URYR 1FC3A 3ZHVA 1SJ9A 1TJNA 3ZZ1A 4L9RA 1BS2A 2QRVA 3H4VA 4I5IA 3BGVA 1XVAA 1EFUA 3WU2C 3GQBB 1SK8A 3ER6A 1FU7A 3KJQA 5EE1A 3AFOA 3O90A 1OTXA 1ZZGA 3HTSB 3CKYA 1GWNA 3NTQA 3KOYA 4IH9A 1C9NA 1B0PA 3V7YA 1YC5A 4BX9A 5KAIC 4KIUA 1X80B 2DN0A 2DULA 1J22A 2WG1A 3IPAA 4DLNA 3QLEA 3WBJA 4LFBB 1LWNA 3CG4A 3KE9A 1ZARA 5BW6B 1T6SA 3I3LA 4DNCA 1H0RA 4RELA 4W6QA 5A6VA 1KO4A 1X1EA 1EWTA 1UKBA 4X1KB 4DC9A 4EEXA 2Y9ZA 1UDXA 2DAPA 4JUIA 4V0KA 2XPCA 3LGXA 4YGYA 3KR0A 2LREA 4R8KA 5AJWA 3AONB 5TDHA 1NONA 3VU0A 1KOFA 1VDMA 1X1RA 4L4YA 3P2EA 4H0CA 1P8AA 3W78A 2C4UA 3U9SA 3R8CA 4A5OA 1HQYE 1I0ZA 1UJBA 4N9WA 3BJRA 5EXTA 3IKMB 2L4AA 2AEEA 3KLBA 4I5EA 4YMGA 1ZHOA 1GDHA 2B5WA 5FTKA 3S3NA 4XRSG 2Q7XA 1R49A 1ZR4A 3I8OA 2IGNA 1MBGA 1A9YA 4IXDA 3E1GA 3MTQA 3UK7A 4J7XA 4DXAA 1LSSA 1M1ZA 1MG5A 3FG9A 3NJ4A 2FP4B 4LY6A 5HOQA 3DLBA 1DKOA 4UE2A 4ZH4F 5K3AA 2POCA 4DV1B 2WE7A 1ZKMA 1O7JA 2YZ7A 4M1WA 1SFKA 5K5QA 1O94D 3G23A 2J4DA 4MCAA 4B2YA 5DD4A 4IDDA 1V4VA 2EJCA 3LG2A 4YIFA 2W90A 3EYWA 3I2YX 4LWOA 1ZIXA 3GOQA 4GBMA 3DCNA 3QOPA 2FK8A 3G59A 5K0FA 2FZGA 2AG5A 3D7RA 3KT6A 1CUBA 2GARA 1NVGA 1E4YA 2MMCA 2SNIE 3NC1C 1EQ2A 4PQGA 4BGVA 1KNXA 2V1DA 2COKA 1FC0A 4U2GA 3QE3A 2J5KA 3TNYA 3BWGA 2V3WA 1D5YA 4HW0A 3TK1A 1H05A 4NBLA 3EVZA 2VDWA 1BC5A 1X3ZB 1N92A 3OBIA 3DDHA 4GXNA 3D3EA 3OCJA 2P5LC 2WHYA 3B5EA 5JLXA 1NH3A 1WUYA 1N78A 2NQ8A 3H1PA 4YBRA 1JU9A 4C0WA 4XOPA 3L8DA 3BPVA 4JLPA 3RU3A 4TRJA 5JARA 1C3JA 2AI1A 4MYCA 1IIBA 1M2VA 2NIPA 3AF0A 3OZUA 4NCIA 1NF9A 4XRMA 4PPQA 4F71A 3DZFA 1ZM9A 4LE0A 2PK3A 5A3SA 3RS4A 1A5BB 2Q3DA 3QWFA 5KCMA 4KDRA 4MX8A 4NICA 4V38A 5EWMB 2X6YA 1ZKDA 5HF6A 2PYZA 4UM8B 2DTDA 3GYBA 4TTPA 5KYKA 1QHGA 2XGEA 1LDYA 1CUIA 2P3OA 3MZYA 4C2MJ 1D1TA 3BMQB 2Z5VA 3ICPA 3CIFA 4R2LA 5D3ZA 4DDWA 3RU7A 2BY3A 3VDQA 1H22A 2CJYA 3S28A 3V1TC 2JLSA 4BJ1A 4YT4A 1N32B 3P9QA 3M6UA 2A0UA 2X1HA 1NFRA 2OM2A 2XCLA 3PYXA 1ZELA 1Q15A 2E4ZA 2GTHA 3DFIA 1X1CA 3CRZA 4MWZA 3S3MA 3ZP5A 3PYMA 2ZJ7A 4XVUA 5LP1A 1HNWB 3N2EA 1QRDA 4PY2A 5JSFA 5KWSA 1A97A 1SKUA 4Q1DA 2ZTUA 1LTQA 1ZRDA 2DP4E 3PGKA 3TLYA 1TL7C 4WXDA 3CFYA 5LN1A 4BDYA 1AOXA 2O61A 4P32A 5JVGF 3PXDA 1QBJA 1N2IA 3BXFA 1L9XA 4MGRA 1R1UA 1PNVA 2ZVDA 2KIUA 3I2HA 3K6SA 4D56A 5LQAA 4HDUA 5DS9A 1J42A 2QYTA 3M6WA 1Y9AA 4I7EA 4CM9D 2IH5A 2H59A 2YJTD 3BZ6A 1SB9A 3D6VA 4N1AA 1R4ZA 3NYIA 4RZXA 4WN9B 3D8UA 4QUJA 5CPBA 3ABQB 3EVFA 1A95A 3EXIA 1T2EA 2FMLA 1CUDA 3OEHA 3KCCA 3TS1A 4U63A 1KMCA 5TGZA 3SXPA 2P6OA 1RCFA 2WQZA 2MHCA 3IR5A 2AEMA 5EA2A 4EMBA 2I03A 1GVHA 3KPVA 3P9RA 4MB6A 4DBLE 4DM7A 1OU0A 1XBTA 4ZICA 4HAOA 2EDCA 3WOVA 5IY5H 4M8IA 1DOHA 1XL1A 3JQ7A 3HH8A 2AYZA 5CJJA 3VNUA 2VDUE 1IEVA 2BOLA 3R40A 4OH1A 3U9GA 5L6MB 7GPBA 2HPIA 2HGZA 2BEWA 3IQEA 1XTJA 2BXZA 1R3UA 3S3OA 1LJUA 1SKBA 2D13A 3CVOA 3OPNA 4GM4A 4Q4AA 4TS1A 4ABYA 2BKVA 1PVOA 2CHQA 3AR8A 1OX4A 2G9VA 4RY2A 4D26A 3KZZA 2XF6A 4HX4A 3EAQA 2RIPA 4LX0A 3ZVMA 2HZDA 2ZI3A 5DM6F 3K70C 3HWWA 2IPAB 2ZRGA 2FQ4A 1HT0A 1S1CA 1A2BA 5EG0A 3DZ8A 4TUYF 2NTVA 4Y0VA 4JLVA 1KBQA 3ULKA 2GN4A 2RV8A 2BFOA 2QLZA 3COYA 3E0XA 4LRYA 5ULLA 5BN3A 5JROA 2VQ6A 4OI2A 5L3SB 2K3PA 2B2NA 3L7MA 3UMVA 4XCVA 3DDUA 4R2IA 4J4BA 5FUWA 1ORTA 1DLJA 2R86A 3B8EA 2VOEA 4MRRA 5AUQA 2K5UA 4UTNA 3HHPA 3OR1C 2VOPA 2JGAA 2Q50A 1VRVA 2D1QA 3LW8A 1J5EB 2DPHA 3VJKA 1BR1A 2Z56A 5BXQC 1RI3A 1A2QA 1U0SY 4WX9A 2X4GA 2ZIVB 4GF5A 2R44A 4ZOAA 4YUYA 5LIPA 3TGLA 1G38A 1ZVVA 1A5TA 5LHGA 2FZEA 4Y6QA 4FGKA 2RHBA 2H9IA 2J32A 2V55B 3B89A 3E35A 1YRAA 1U6JA 3BILA 3L2CA 4AROA 4DZRA 4N9HA 1OTHA 2OT3B 5FUYA 5TS2A 3TXAA 3KPWA 4CEJA 3PFFA 4KQEA 1PGJA 4WK0B 3TLKA 1J2RA 1JIUA 2KL4A 4H4CA 4BEWA 3CCUI 4YFYA 3PWTA 4GYWA 3X1YA 4TTAA 4WBNA 1XVIA 4CCYA 3LKBA 4XE5A 3QFTA 4P83A 1M6NA 1QYWA 3D1VA 4EX7A 3M70A 3HSEA 4MVJE 4P0QB 4OJMX 1TI7A 3IJPA 2DHQA 3G13A 2FUG6 3C8MA 4L0QA 5LHHA 2CHEA 3I5AA 4I55B 3SZMA 1R3DA 5TB5A 4H18A 2JJ8A 2ZRDA 1FFWA 3PENA 3BQYA 1U7TA 2CFCA 2R8RA 4IOKA 1TYAE 1Y5NA 1GL3A 5DX1A 3JAMA 3DF9A 4JKIA 4XPIA 4A0RA 1KAEA 1P5FA 4UFPA 2PG3A 1SU7A 3MINA 4Q3NA 3K96A 3X2SA 1JDSA 1OLUA 5J6XA 5EQTA 1EMDA 2QP3A 3GV0A 1F4KA 2I67A 5TPZD 2UVPB 2F3TA 2YRXA 2C6YA 4B6SA 4ZKDA 1LD3A 1C80A 1FSGA 3RIYA 1H8EA 3JTGA 1EI9A 5F64A 2KLBA 1XDWA 2JFHA 2V59A 3E2IA 3I32A 3QX7A 4N4OB 4HMOA 4OHWA 3R7BA 2YQZA 2ZAOA 4MARA 3AIIA 4X20A 3L8FA 4GT1A 1L7NA 1RIFA 3QVVA 4DUPA 2IRFG 3OIFA 2K85A 2L3DA 2QX8A 3BH6A 1WE2A 3V8MA 3NBZC 2G67A 4P53A 2HA5A 4OP3A 5E6RA 3JCUC 4Y2HA 1YTLA 1K8ZB 3CXUA 2EB7A 2UDPA 3D6JA 2X5NA 3WICA 2YN2A 1JJAA 2VHVA 3PG5A 4N8EA 2OORA 2PD4A 4OSPA 2C77A 3NQOA 1RMQA 1JKMA 2CXHA 5A3JA 2IEYA 1YBMA 4IVRA 4JBXA 1NG9A 1LPAB 2Y66A 3KELA 4EG1A 5BV0A 5JASA 2G1JA 2OCCH 4TKLA 3ED1A 1U0EA 4NJEB 3UHFA 3QSGA 3OCUA 3OS1A 1VIVA 1HZZA 2Z2ZA 4D5CA 1XA3A 3DBLA 1P74A 3MGBA 4WKBA 4XUEA 1NV9A 1VIYA 2MLKA 5EHQA 4MVJA 4OI1A 4CKXA 1TTPB 2GEDA 2X8BA 4CJXA 3SZPA 3ZU6A 3JQBA 3KP5A 1OSNA 4PLZA 4CMAA 2G8NA 2X5JO 1B8NA 3BG9A 2JI6A 3LP8A 4J03A 2WP0A 3DTVB 4I46A 1XD7A 3QOEA 4EK9A 1SZCA 3Q2IA 2J45A 1E2QA 1CB7A 2O7NA 3VAAA 2DJNA 3BMCA 4M55A 2QTWB 4QXMA 2ZRQA 2L7FP 2P4WA 3AFHA 2FW6A 1FNCA 1X15A 3PT9A 5IC5A 4C0SA 2IGKA 1JVSA 1YBVA 3U4CA 4TYNA 2GN2A 5F33A 3I01A 3WJ1A 3IRQA 2WPDD 2RNGA 2RGYA 2RGEA 4OTZA 5ECWA 2G71A 3OAAA 2O3SA 1TM1E 4FETA 1RR7A 1Q1ZA 3IHWA 4RVNA 4ZRMA 1U4OA 1DTWA 1T6NA 3FPEA 5E9WA 4E0BA 3V1UA 1QYCA 4D92A 5K0BA 3OWHA 3UAVA 1NG7A 3JATB 4PQFA 4OINF 3SSMA 4DARA 5AKHA 4XSZF 1VHLA 4KR0A 5SY9A 4DSNA 2F64A 1DU4A 2H8RA 1GZUA 5L40A 3VXKA 1O6BA 4UUNA 1DV1A 4EH1A 4EGFA 5A4MS 1QPMA 2BKAA 1LE8B 1FQJA 2IXFA 4P7KA 1KOLA 4MFDA 2YNMC 4EKNB 3OIVA 1DFHA 3OIUA 2V6BA 4G97A 2XB0X 4XJTA 2A5DA 4CE6A 2O07A 3ZE0B 1GGKA 1REQA 3DOCA 1IY8A 4YJFA 4QGFA 1H4QA 2H4JA 4OIOF 4O6VA 5G0WA 3ZGNA 2ELKA 2GM3A 2O1EA 3GARA 3OZDA 1K7SN 2PRSA 3NU1A 1BYUA 1AU7A 1MG0A 2P41A 2HPHA 2P5VA 2QZ4A 4B3DA 1PJ8A 1W1WE 2IOFA 3ORHA 3QEMB 3LVRE 3E6BA 4FUTA 4NMXB 4I9UA 4D25A 1T0BA 3GVHA 3IA2A 4KN4X 2L0XA 5K8IA 2Q6TA 4UHJA 1IBSA 5F3WB 1K8XB 1CQIA 1IUYA 1SU6A 1ADJA 2GO1A 5IT3A 2Z5GA 2GK3A 3A9TA 3CE6A 4EKYA 3AIKA 1LNSA 2ZRJA 2G7HA 1Z9BA 1ZAKA 2XUAA 3KVVA 2UXNA 2NS8A 3GTJJ 4IZZA 4YWJA 1L5ZA 4X3PA 2NU8A 5EZHA 1DBWA 5HM6A 2F4VB 1XTIA 3OFVA 3MRXA 5H80A 2NU8B 1CDDA 3VGPA 4JVNA 1ZNWA 3OR2C 4Z6YA 2J09A 3OOYA 4L50A 3IV7A 1ODSA 2VPIA 1E3DA 2O4UX 3NNSA 4OQFA 4RB2C 1WJEA 2NSLA 3ZQHA 1M8PA 4EF5A 1IRIA 2GVNA 3VWBA 3ON5A 4XUCA 4L7VA 1HPLA 2EILH 1PTJC 4WGFA 2J87A 2P1RA 3FNBA 4UBOA 2O8CB 4HPQA 1U02A 1U28C 3W2EA 1UT6A 2IA1A 3KKKA 3CRVA 3V8QA 4CIBA 3L01A 2EZKA 2TCTA 3AHCA 1KH2A 4NJEA 1DRWA 2G4LA 3U2RA 3DWEX 1XYGA 2P27A 2NPOA 3K1MA 3BSWA 3VSCA 2ZXJA 2P3QA 2VDRB 2R7OA 1TUEA 3OZFA 5C46F 3HKDB 3UWSA 2VODA 4GE3A 4XLTA 1Z91A 1QIGA 2J5QA 3N58A 3LX8A 1IHDA 3PFWO 2W84A 4KJZA 1X38A 2ENUA 4RZIA 4Z8XA 1SD5A 3N8GA 1ODDA 2XT6A 1F48A 5HZGA 1H0MA 1XF1A 3PFIA 3FJ1A 5IN5A 3P45A 1VKOA 4JZYA 4BU2A 2JFGA 3IALA 2ZKZA 2IUSA 5KTPA 1VTKA 5AW9A 4A6PA 2HOSA 4JSRA 2A05A 5BYJA 2YS6A 5T6BA 5BUCA 4P5EA 1MX1A 2R2AA 4RXUA 5U1PA 1DBVO 2HSZA 1UOQA 1AN9A 2P9QA 2VK2A 2OCEA 5HDKA 4ZQCB 5JBIA 4N54A 2B4RO 1Y82A 5GINE 2GJ9A 5D5UB 2FPIB 5E1BA 4IMJB 3CCSI 4LDRA 4ACAA 4ZZIA 3W5BA 3SQXA 4RUKA 3ONFA 1N0VC 3LKZA 4PONA 1Y37A 4D9GA 2I71A 2NSJA 3AF1A 1NLUA 3HB5X 3PIRA 4GX1A 3U7QB 2X8LA 2FG7C 3LT4A 2AOVA 1J24A 4PPFA 5KREA 2XT0A 3ZLJA 1RT9A 4BHCA 3M6MD 2JZOA 1Z15A 1I6XA 1CQZA 3E7DA 3F49S 1JDZA 1N1MA 1R0WA 4Q4DA 3VNBA 3FX2A 1F5NA 1JYEA 1WOMA 1ZRMA 3JVEA 1BCRA 4IDPA 4ZYUA 3PJFA 3UQYS 4TV9A 3EYYA 2XKOA 3G71I 2DTXA 3L7KA 5KKAA 1ZCFA 3O03A 1ABFA 1F0KA 1EXMA 2ZMEA 3TQNA 1ZW6A 2UXXA 2H57A 2VQ3A 1MU0A 2XMRA 3BRWA 4U8GA 1ZOLA 3T15A 5L4SA 1YK0A 3HSRA 2J4CA 3ML1A 5DGXA 3WGHA 3N6VA 4MJLA 1FP6A 3DMNA 3D7SA 5BSMA 5JI3E 3I4CA 4I9HA 4J0CA 4M1YA 3QUSA 5LOVA 3NWEA 4QNNA 2ZANA 5H9VA 3WP0A 2BH2A 3UOWA 3U9TA 4JC8A 2RCYA 2OKGA 3ICCA 3NIGB 4IFBA 1KETA 1NBME 4I3GA 4L0MA 4TZ6A 2O8XA 4EVQA 2ASEA 5GV8A 3EQ7A 5HDBB 5IDQA 5ICGA 2A5JA 3E7XA 3C8DA 3TJRA 2B8JA 1G5QA 2B99A 4S2EA 1A9SA 5KNBD 2GZ2A 2W6CX 1GTJ1 2BHRA 3AP1A 3GGJA 5IYZB 3SHOA 1NUUA 3EBOA 1IXYA 1KZGB 4Z4CA 4EHIA 1NVEA 1RYEA 3G5UA 2PEZA 4NESA 1JTYA 2EV5A 3I5XA 2RHRA 3RS7A 1EUZA 1N6IA 1DC7A 1Z75A 5KNLA 1DFIA 2FPPA 4FFMA 4LIPD 4YDQA 5B4VA 2GRUA 1LRLA 3KOWA 4HEJA 1N6KA 4KL8S 2AJ8A 2PZEA 4AY5A 4M89A 1WV1A 1SUSA 4GQIA 4XTRA 3ZN2A 2O0LA 2VNHA 4HC4A 4BVJA 2GPSA 3FDIA 2FZLA 4DIEA 1RQ2A 1JVNA 3C4VA 1WMFA 2H6BA 1PX2A 2YBEA 3LD9A 3ZDBA 3UAZA 3JZDA 4LFAB 3H1GA 1GPBA 1JHFA 3KLMX 4ENPA 2DKOA 3C1TA 4DMLA 2D0OB 3H2IA 8GPBA 3RQ4A 4MS1A 3TP0A 4HAVA 1X9IA 2TMDA 3CF0A 4FGUA 3F8TA 1QK3A 2M98A 3C41J 3WTSC 4FZ3A 5CW1A 5TS3A 3OWXA 2X0DA 3DEIA 4P92A 1HRDA 1NT4A 2YZGA 3NORA 4WW0A 5JWOA 5I9IA 5EJFA 1FMJA 3QI7A 1MKYA 2A7QA 4JODA 1JDVA 2DH5A 4ARUA 6ABPA 4CCYB 2ID3A 2XADA 3B53X 1SXJA 3HDTA 4YIKA 3QPSA 4QIWN 4RVCA 3UN1A 4HH0A 2FPPB 4DLXA 5KO2A 2VUIB 3IE2A 3PHLA 4ZQBA 3L0PA 3DE2X 3ZHBA 3AV3A 4DTIA 1T2UA 2BIFA 2OILA 1TNSA 3IQXA 5FQOA 1JQ3A 4J0EA 3QWAA 1K92A 1JHQA 2XZTA 3OZWA 4YFVA 4GG1A 4B3FX 4P3PA 2XWPA 4EEKA 1MB4A 2GOYA 2VIIA 5ESRA 1XN4A 5IH7A 3ASVA 3H5WA 1PGPA 4GR5A 4HH3C 4J7AA 4XM1A 4M6YA 1Z5PA 2EX4A 1WJBA 4KGZA 2CJJA 4U7TB 1NX9A 1F12A 3OY2A 3ZV5A 2XGGA 4ETNA 2AMYA 4M9CA 1GJRA 2TMGA 5AVKA 2XASA 1Q2XA 2HGCA 4BHPA 4CMIB 2HWKA 3THXA 1DP4A 4IUCS 3JYNA 4A2PA 4JENA 1LK7A 1D8AA 1RI1A 1OR7A 1UUFA 1HNNA 4QKQA 3QFSA 2L19A 1ODCA 5HZKA 1HFJA 1WQ3A 1GHTA 1XLTA 4OMDA 3G5TA 3ZWQA 1SKMA 3F1KA 1Z0AA 1JSXA 4G2NA 1KKUA 1C1XA 2RI1A 4DAEA 3J80Z 4XSHA 2F3UA 4Y18A 1PT5A 4XX0A 2OZ6A 1DIGA 2I80A 4JI8B 1SA0B 5JXWA 1D9XA 2DY0A 1U9JA 3CRMA 3K0AB 2HY7A 4MCIA 1G5IA 2VQEB 1IZYA 1MX9A 1ZGHA 2JFUA 4ENRA 5C53B 3ENWA 2BEVA 3LHDA 5EP3A 1SCDA 3DU5A 1N5MA 4BGEA 2WFLB 1VMIA 1QQ7A 3SVTA 1P4XA 3W6KB 1TUIA 3MIZA 3QE4A 3EG5A 4OYLA 5T4HA 4HF2A 4UVBA 3DPLC 2E49A 1O87A 2HA0A 2LCIA 3EW7A 3IQWA 2V7EA 4PYQA 4QICA 4F3NA 3DUFB 4YT5A 3ZBQA 4CU2A 4GP9A 4PLVA 4YEDA 1PBTA 4CGYA 1JEEA 3IQZA 4C06A 5I9NA 1F0PA 2C2GA 3C1OA 5T8KC 4C7OA 2NADA 3C3BA 5A62A 2HMTA 3G1MA 1WSWA 5SZJA 4ZI7F 3P20A 2M4KA 1K5GA 1GXSB 3G3ZA 3NVAA 3P1JA 1T4CA 4HFJA 3B6AA 2YY6A 4P81A 3UUEA 3OM8A 1JLHA 1RR6A 3I6QA 5IDYA 2LSOA 4ESVA 2QN8A 2GAFA 2V03A 5IEBA 3SE0A 1TWAJ 1GN8A 3M9AA 2IT0A 3VTAA 3NRBA 1Q0QA 2L9NA 1Z2EA 2A30A 1V1RB 1FU4A 2DPGA 3HVHA 2PZMA 1ZD2P 4M71A 2QX4A 3MJVA 4WFIA 3SLRA 5DP1A 2NO4A 4P4SB 4TWRA 2DFFA 1VJDA 1H9CA 1SD7A 1UJ2A 1MSFC 3HYLA 1XHEA 4LWZA 1HDPA 5CB4B 1HQKA 4L2IB 3OWOA 4LVCA 3ZWYA 5K3DA 1W1UA 5ALLA 1UBSB 2W2OA 1WEKA 5HRUA 1AD2A 3FUUA 1IUPA 3KKOA 2ZATA 4RD2A 4B8ZA 2VJ5A 3AYXB 3N05A 4BFTA 2PGXA 4BLOA 2IHVA 2IQIA 1U2ZA 1MFZA 4UHEA 4YAJA 2FCAA 3D4NA 5H0IA 1K4TA 5CCBA 1PL8A 3JYPA 4IHXA 5K8VA 2WOJA 3AG1H 3WLQA 3SXJA 4DJDC 2RDMA 4R4JA 3SPXA 2F8SA 2F5CA 2DPDA 3CMCO 5JYDA 1Q5PA 3L7AA 4L4ZA 5FWNA 2D7DA 1ZINA 4X7MA 3IDOA 4F4FA 5FT9A 4PSXA 3BE6A 1U8XX 3IP5A 5ALYA 4EJSC 4NCKA 1T9GS 1ZA2A 1RM5A 2RONA 4P7FA 2IOYA 3C14C 4HX7A 2G7MC 3FM9A 2RQPA 4LCBA 3WGLA 3L4EA 1FDWA 4QQ8A 4C4OA 5JMWA 4UJ5A 4ZOEA 1K4YA 4WN3A 4L8VA 4D79A 3C3DA 3T3NA 3J7ZI 1RTKA 3K4QA 5JADA 1WH5A 2VRWA 2C4VA 4JBAA 4TLCA 3PKIA 4ZV9A 3LHIA 1QQ5A 2QVYX 3R23A 5ANRB 4FDAA 4YXWD 5K0EA 2OBPA 1NW4A 2HHCA 3FHCB 2YXBA 1NRIA 1NVFA 3LCVB 1VG9B 4K40A 4RWEA 1XMIA 4CF7A 3RAPR 2AJTA 2WZQA 2ZR8A 2VLAA 4KR9A 3LPAA 4LQ4A 3HRHA 2BR4A 3KIPA 1E2EA 5KNCH 2FX0A 1LS6A 4E7LA 3KPJA 1QX4A 3PQCA 1ZD8A 4K9LA 2Y9YA 4AY6A 3NEPX 1ZMOA 4I1UA 1VL5A 3VOSA 1MOQA 5HVQC 2VJMB 4M1ZA 3C5EA 1W5SA 5EERA 1XMPA 2JRCA 3FFAA 4G5RA 1L4UA 2YV3A 3R8FA 5ESDA 3AGPA 4KR2A 1H1DA 4IPTA 4JLDA 4G24A 3WJ2A 4BL5A 1REQB 4F4UA 5ALZA 5JSHA 2XAAA 5KNDA 3L2RA 4YYZA 3BR0A 3HY4A 4Y1EA 5G4KB 2CJWB 4ENSA 4DMMA 1DU0A 5BNWA 1ZLKA 3QY0A 3QP9A 1I39A 4OQNA 1KEZA 4CFZA 1WULS 2Z3WA 3ABZA 3D1JA 1JHYA 3ISVA 4G94A 4COKA 1ZKGA 3GEMA 3R60A 3B1ZA 3G8AA 4I2OA 2OCPA 2VT6A 2EFNA 3BXZA 4G56A 5EAIA 1T8UA 3JATA 2VBZA 2V6MA 1YWGO 4JJ8A 4NE2A 4YJ3A 5BN5B 4M0MA 2F9MA 1DTWB 2QKYA 5IT4A 5D3KA 1UWKA 3ZQFA 2WSBA 3E9NA 4B6JA 4BRZA 4HSTA 3I2IA 3MWEA 1JZSA 4LDJA 1JJ7A 2QJRA 3EIQA 3U4IA 4RKRA 4BCBA 5CVUA 2P67A 4Y1FA 3TR0A 4YMVA 2Q6IA 5KC9A 1XGMA 2Y9MB 5JWHA 3VR3D 3STXA 2Q6VA 2QRVB 4ITUA 3CCVI 4KKXB 3VPBA 4ALNA 4LRQA 1UOOA 2HLNA 4YRFA 4HBZA 1R0ZA 5IT0A 3TCNA 3OFJA 3JRGA 4J76A 4ZAFA 3HSSA 4KIJA 2R00A 2W6NA 3QEBZ 4H6XA 2PKEA 4L4RA 4AIRA 2VTBA 1VG1A 5J3LA 2G0EA 4XIFA 3NGLA 2NU6B 3WFIA 1E59A 1AUPA 3FXLA 4QSHA 4A91A 4FYMA 1A2OA 1Y7PA 3PFCA 4EHKA 4CI9A 2VJJA 1S0UA 1JAYA 1WU8A 4AY4A 4I0BA 1GSOA 1AXEA 2HREA 5GZ3A 2NVBA 2QXYA 3N59A 4C2AA 3L1UA 1AKVA 1FP4A 1ZMTA 3K9NA 2JJYA 3KB2A 1NU6A 4NECA 5D2CA 4XKCA 1B8OA 1QLJA 4JK1X 3FRJA 5D87A 2GJ4A 3NCTA 4K2HA 3KLNA 2YKGA 1NI4A 2WFMA 1GYRA 3AM4A 4QGBA 1ZWLA 2JL1A 4LXYA 4ZAGA 3VU9B 2QQ8A 4GI3A 3JRCA 2DUWA 1CG6A 1EJ9A 1N8NA 3W2IA 3VKVA 4QOEA 1B0AA 4AC0A 1OJ7A 1QZXA 2A78A 1JKIA 1ZM3A 1CDOA 2DAOA 3EMVA 1YQTA 3IDSA 4S0XA 1FLDA 2PAFA 3KZCA 5HTOA 4XWAA 3ZY4A 1A8PA 1U0OC 4DSZA 2K27A 1E58A 5ALVA 1SPXA 5DK6A 1TFRA 1RXYA 1KR5A 1WXXA 1Z8NA 2E18A 2J3JA 2RJOA 3FF4A 2BGWA 4BHBA 1Z7GA 1MAWA 2CHUA 3NHBA 3QRWA 2XXAA 4AYTA 1IK4A 5DBFA 1WJDA 1UQUA 2RVCA 2V9CA 4PJNA 3HL4A 3SYLA 5CITA 2XXAB 1U7OA 3EC1A 2XUZA 2DDAA 5K0SA 4HGZA 1NNI1 3ZY2A 1QTNA 1W2HA 3EZNA 4EMUA 4BY7J 3CXRA 4A2WA 4WLEA 1YDHA 3NIBA 4LF7B 3BTLA 1JXQA 2WKQA 1Z5WA 3ZHTA 5J4HA 4R31A 1T3SA 1KP3A 3KB6A 3D3WA 3VR2A 2NQTA 3PSIA 1CUSA 4HRYA 4HXGA 4N8DA 2V79A 2JGDA 5KYXB 3WB2A 3RREA 5JAMA 3HVKA 1YTUA 1C41A 1BH6A 5J43A 3ZZTA 4R1PA 3GNQA 3RYRA 1F4LA 2CDBA 5J8CA 3O2NA 4FD2A 1TQPA 4LPSA 3UV7A 4DABA 5JANA 1KVQA 1RM4A 3ETDA 1MC5A 2RHMA 4QFBA 2CFIA 3T5DA 3WTZA 5CA1B 1RW4A 4QGHA 5G2OA 5B6PA 1SELA 2OGZA 4C6SA 3GJSA 5E6RB 3YASA 4DWWA 5BP7A 3QEOA 4BNTA 2V5AA 3GBSA 4RZ2A 3TFWA 3SHVA 1CZNA 4TM7A 3ZQ7A 1C7FA 4ENQA 3SJ7A 1N2CE 3OIGA 2WD9A 1WW3A 3B20A 2CYYA 3OYEA 1YJ9I 1WXEA 5CXQA 3A3YA 1ZNYA 3R5SA 4KVZA 5DNWA 1F2UA 4ZDPA 5DHPA 3DBRB 4UQPA 5I7UA 2NVUB 4ZEVA 7ABPA 4Z4QA 4EGAA 2CVFA 3I0TA 2OB2A 3VR5D 1IVSA 1SCNE 5I7FA 2FN9A 5FKKA 3RG2A 1DZ3A 4XVQA 1C7RA 4KC0A 4XR9A 3SNKA 5HFAA 4QODA 2FMKA 4Z4HA 1XMOB 3U2QA 1WHTB 1XSDA 2XWQA 3L5KA 1ZUHA 4EOGA 4Q48A 9ABPA 3D1NI 5JDIC 4HLUA 4I0AA 3SX2A 1KU0A 2ONKA 3L84A 3TQOA 4Q4ZF 3F3YA 2Z3ZA 3E82A 3OYLA 1RKXA 3KZKA 4YTEA 3RRZA 1I5OA 4ND7A 2WWVD 4FX4A 3I9LA 1CYDA 3UG6A 4KXFB 4DIFA 4X1EA 2RDPA 1FYKA 1YUBA 1AHDP 2YYSA 3ILXA 4WLOA 3URMA 3PQJA 4WECA 2W2VA 3QM1A 3WA6A 4UAUA 3ZX4A 2J59A 2A84A 5CFZA 3GUZA 5FP0A 1IUFA 1XTKA 5LBUA 4BU0A 2DY1A 2ANCA 3P0EA 1V1MB 3L8MA 2QHXA 4DJFC 4E1BA 3RC8A 4RB3C 1UK6A 1ACLA 3DEAA 4BQOA 3E18A 1CS0A 1FUKA 2YVAA 3GLHA 4KO2S 4O1HA 1DAPA 3WTWC 4C3JJ 4LGMA 4OIMA 1PKXA 1TWGJ 2D2EA 3GGGA 3NM5A 3HA5A 5HOOA 4KE7A 1FE8A 3IUJA 1U8BA 1TM7E 4OYHA 2VA8A 3KPYA 1MH4A 3EC7A 4A3FJ 3M1YA 4G9YA 4KDFA 4KUGA 5AVOA 4M3DA 3TN7A 4EELA 3NVDA 2OZLA 3C8HA 4RHXA 3DZGA 5IDWA 3FFXA 4DFDA 1J9GA 3Q10A 3A9UA 4EHAA 4LRTB 3WLJA 4X6AJ 4JR1A 3TE6A 1P7JA 4LJKA 3SJCA 5J1TB 2VJAA 1MEJA 6Q21A 3U60B 1YX5A 4NU5A 1ZJWA 3HCWA 4XBFA 2V6JA 1US8B 4ER6A 4QLOA 2JK0A 1OREA 4LMPA 1EFPA 1QLWA 5AW3A 5JNUA 1P4HA 1A35A 2IYVA 2ZC2A 3VVLA 2XNJA 4BAGA 5C52B 3QHAA 1YMQA 4N82A 2B4QA 1ZRHA 1XV5A 3F98A 5CB6A 3OP1A 4Q39A 4UDOA 1A9RA 1A8SA 2J0VA 4N0BA 2QK4A 2H5IA 3LAPA 3D6NB 2ZS9A 3ZD9A 2B36A 1KI6B 2OOSA 3PZBA 3I6MA 2LE0A 1EHYA 1IRZA 1B6SA 1NYLA 3KSUA 5LQSA 3KEOA 5CVDA 5KQMA 1QU2A 1CY7A 4JVLA 3U16A 1MA0A 1PFKA 2AQEA 3ASUA 1VKJA 3HCEA 2LR8A 3CF5F 1RC0A 2QPAA 3IAFA 2Q2EB 4L9AA 3GRUA 2H6CA 5EPOA 1SBQA 4QYXA 2HYFA 5DGCA 2ISYA 3W77A 3ZMUA 1BH2A 1YW8A 3RYPA 1M2NA 1SXJD 3PCTA 2HPMA 2GBLA 2RKBA 3LIPA 2VYVA 4G5OA 4QQNA 5FWYB 2I3BA 1E6UA 3VH2A 4NK4A 4N0PA 5CT5A 4AKTA 4L3OA 3T61A 4OX9Y 1ZJYA 4GIBA 3FMIA 4TV8B 2HYGD 1C7EA 2AG0A 2O52A 1FLNA 2V9ZA 4PINA 3I55I 4AO8A 3W5DA 4I01A 4RKYA 1EQAA 1YOBA 2J3DA 3AHEA 3CWCA 1R1TA 2B1GA 3DEYX 1XD9A 3G9XA 3QQPA 4OJKA 2YWXA 1XPUA 1BA3A 4ZKEA 3WDMA 4DCGA 2QVZX 5DKFA 3BTCA 1E79A 3LPMA 4M98A 3ZHXA 1TEVA 2ZSUA 3EWNA 2AUTA 4DQDA 4ZYXA 1JE8A 2X9GA 1H9TA 2P5YA 2IYFA 4GM0A 2IGOA 2WSSD 3ORQA 4QPDA 4MGEA 3EUAA 1C3XA 1CIPA 1Q44A 2FNPA 1KFEB 2AX4A 4EO4A 5EMLA 2QMUA 5T7BA 1ZXXA 3T9CA 3CUUA 3IP3A 4PO9A 2GFQA 5KKCA 2A9FA 2AXTC 5PNTA 2JANA 4C4XA 3FOFC 1H4TA 3SVZA 1W0CA 2I91A 3QPCA 4TWZA 1P81A 4KQFA 4TWJA 2IFTA 4X6YA 3RYTC 5CEFA 3C6MA 4JDPA 2QG9A 5SYMA 4AX4A 1HYEA 1G4HA 2HOEA 5DMXA 1IMJA 2ZZNA 1PJ4A 3Q8KA 4NBVA 1P2DA 4NI5A 3W6JB 3WNCA 1JLRA 1XZCA 2FUEA 2H00A 1XRQA 4FGLA 2AUMA 3NGMA 3SHWA 3N3BC 4BQSA 4YNBA 2H2AA 5TGDA 3DCIA 1XFAA 4EGQA 1I13A 4BVEA 5JDCA 3AQIA 2K6GA 1N3YA 3DEKA 4LDAA 3CUVA 2AHRA 4P54A 2IPMA 1IIRA 1JDUA 4MWSA 1ZH8A 3JWJA 3DXFA 2J0UA 1RWBA 3BSYA 3PL5A 4Y9DA 1DKRA 1K6EA 2QD4A 3EOBI 5DH9A 4Q9IA 4RPCA 4YB8A 1XRMA 1B93A 4CLXA 3O31A 2PE5A 3F97A 3BR2A 1ZN9A 1PUIA 2X4IA 3H84A 4UU7A 3ISJA 3HCAA 3NUQA 4JFRA 1WO8A 1YJXA 3D0SA 8LDHA 2BUAA 3WYDA 4F3CA 2BMWA 4DSAA 1B9MA 3GQBA 3WKBA 3DB1A 4W5RA 1XLTC 3V3KA 5LBTA 2FHPA 1ZCJA 2JFYA 1SCJA 3M81A 3IT3A 4IVQA 3WYCA 4TTRA 2HF7A 2IV3A 1PZEA 1VYUA 4CODB 4Z4GA 4OIPF 4LNUA 4Y67A 5EE0A 3FPGA 4R9SA 1WLYA 3PWSA 1E3EA 4AS1A 4EBBA 2PXXA 3C1AA 3MJHA 4TXNA 1E18A 1RABA 1I7SB 5CYGA 3JQDA 5AIPA 2O7RA 5DN6A 5FFMA 2HU8A 1CJUC 3PFBA 1E3MA 2MC3A 3ZR8X 4G0QA 4J1TC 4BNIA 4QM7A 1N6OA 5B4TA 2R8XA 4K7JA 2HHJA 2MMGA 4OA8A 3VR6A 3WWOA 4AMGA 4GR4A 4JI7B 2NNNA 2QU7A 2HOAA 4RH1A 2PT6A 4HN4B 2ABWA 4NEHB 5B36A 1LQ2A 3K1TA 1OPXA 4P96A 5DHFA 4QPQA 1ID1A 1TYDE 4RIHA 3SYNA 1UK7A 3ZWPA 1JPNA 1J06A 3A31A 3IUEA 3ZCTA 3SZTA 3DCFA 2HZBA 1SKYE 2JW5A 4S0ZA 2NSYA 4DN6A 2WLSA 2QJFA 3THSA 3UXMA 2DCMA 2OBMA 2A67A 3HU3A 2RGUA 3V7SA 2Y0SA 1ECCA 3M34A 4LYYA 5JBQA 2FXAA 4TYPA 1N6NA 2V7WA 3HKEA 4L02A 4NHJA 3F8WA 4OGLA 3EZ6A 4RTMA 2RCNA 2VO1A 2NU9B 3L4KA 3KR2A 4PIVA 1NVWQ 4YRGA 3WL7A 1XR3A 3F6PA 3ETGA 4ERNA 5CDTA 2VKQA 4HDQB 5IAKA 4Z51A 2X5OA 1MT3A 1N1DA 4PHFA 5AKYA 2ICWG 4AZVA 3L7LA 1RLIA 3H9GA 1UM8A 1ZISA 1TU4A 5DP2A 4D42A 5JISA 4HBLA 2QYOA 1Z68A 4P55A 2PR2A 1T1RA 2BY2A 2DFTA 2QLMA 3AERA 2IEKA 3EPRA 3KYCA 4N5IX 2D1HA 2B9VA 1P0FA 2D5CA 4XGQA 3WYFA 3B51X 1FNMA 1RAAA 3QYAA 1JHDA 1YRWA 1KZ4A 1R0CA 1UZUA 3MTBA 1IY9A 2FEMA 1UXIA 3MBOA 4PZZA 2YX7A 1NMYA 5FOXA 1O0SA 3QPDA 2WZCA 4JBIA 4IXTA 4DV4B 1W94A 2O3UA 1Z7LA 2DZDA 4C78A 4KQ2A 1L7OA 4PZPA 2BVNA 3FAZA 3HFRA 1YG2A 3CJRA 2ZYWX 3EDQA 4NBUA 1E1CB 5AO9A 2C9MA 2J5PA 3CF6R 1YQEA 3HCRA 2V58A 3NHLA 4OBWA 3G88A 4JI2B 4C7MA 4KWIA 3LA2A 3DXXA 1HQDA 3A9CA 1FZPB 3RSOA 4UUMA 2J3LA 1GO2A 3FR7A 1ULTA 2PX9A 5ED0A 4EHHA 1UAYA 4R0VA 5IH3A 1H2BA 1XZBA 3I62A 2WYIA 2ZIZA 3L93A 3LYHA 1ADCA 3NBXX 3OOWA 2H1SA 2G88A 3PE4A 4OKNA 2H0AA 5FD8A 5KU1A 4RTOA 4PX9A 4JGBA 3DM5A 1BDIA 3L9WA 2CL7X 2ONJA 2Y93A 1ESZA 2X1MA 1QRSA 1MBJA 3EZ2A 3RSGA 4FKMA 1SVKA 3U09A 1G66A 3WL5A 2JLUA 2PJUA 2GERA 2R2GA 4A92A 4Z7QB 3ILVA 4NC7A 2C5GA 4BBAA 5DW3A 3SFZA 1IK6A 4X00A 3WK7A 5JVDF 1RSZA 2AYXA 1JG4A 2ERXA 2HA3A 3FPCA 5AVQA 5K05A 4REQA 4U2CA 3IEUA 2QE6A 2CC2A 4O2BF 5A4DA 1DVRA 4P6VF 4YX9A 2X0LA 2BCJQ 3PWZA 4XORA 1P9WA 3I3SR 1SVLA 2Q62A 2J9XB 3KT0A 3HKBA 3MXTA 1KH1A 4NDAA 4GI1A 3LXUX 1EBFA 2BZ1A 5JRJA 4MXDA 5HCIA 5CDHA 1AKTA 1X7YA 1DX6A 2P6MA 1HE5A 2O8EB 5FA5A 3COWA 1AHHA 1SQ6A 2VYNA 3D3WB 4UVIA 3RAGA 2XKBA 4Z3DA 1VFNA 1CJCA 2E3JA 4QYSA 1ETOA 3TLGB 3WV5A 2FFHA 4WMLA 2R5YA 3PC7A 4H77A 1TKCA 3PUBA 3R6SA 1ZL2A 3O91A 3PKJA 3QK7A 4Q12A 2X48A 3I9V6 4XARA 3JRDA 2RBKA 1SWVA 4GZ5A 4RJ2A 1PT8A 4G86A 4X54A 2LY9A 2NT4A 3TRJA 3KYCB 3A3OA 2W85A 4R1OA 2HBYA 4PZ9A 5FKLA 1W5CC 2WDZA 3IELA 1S2LA 1F9AA 1GZ7A 2O2JA 4F21A 1RLTA 2XAQA 3OJWA 5HRAA 3EUFA 1PWYE 3BROA 3UHPA 5ADVA 2IKSA 1OH7A 1I7DA 2LY2A 1ZIOA 4FC6A 4H1UA 4KODA 4NJMA 4DR7B 1EXDA 4V2IA 2PGLA 4NZZA 5KTRA 4HZUA 1HSTA 3MAJA 2NU9A 3V1LA 3I64A 2CWWA 4NRDA 1HZJA 1XSEA 5L3CA 1QYRA 5JEDA 2F7SA 2R8PA 2HSGA 3CQ9A 4ZYTA 2KPMA 5LA6F 3E5HA 3K09A 1EFKA 3RR2A 4XFKA 4L9NA 1JHRA 5H70A 3VSEA 2WJAA 3PNSA 1K5DA 3LWBA 4BNKA 3L1JA 3SC4A 3STYA 4CMIA 4B3RB 3QUBA 4X5OA 3RAJA 1NF2A 3RUHA 3AHJA 1FP4B 2WJYA 2GXAA 3OIYA 1QV7A 5CLHA 5KK1A 1WUKS 1E5QA 5T57A 3RBXA 2GJAA 4DCNA 4KBFA 1P2SA 1NQAO 5F77A 3W4IA 1DADA 2W2TA 3M4ZA 2JEYA 1XSXA 2W2KA 5DYYA 3FFWA 1BDMA 3OZRA 3CISA 5HE8A 4CL3A 1KJYA 1Z82A 2XIQA 3VVBA 3DV9A 4OMZA 3HOTA 4DQUA 4AUXA 3HBLA 1K78A 4H3HB 1T3HA 4LB6B 1MJ9A 5HLTA 4O4JF 3JY6A 5COQA 1XKTA 2ZRAA 2H9YA 3GLKA 3L5OA 2JFZA 4X8HA 3B9PA 2C7QA 1VE9A 2HDCA 1BWPA 1FP1D 3BZWA 2HHHB 2B6NA 5M7EA 5BPFA 4AS2A 1J0BA 2IYRA 3RODA 4V1CA 1TYCA 3M1EA 4PS0A 1STZA 3FCSB 2DQLA 2HTSA 3T0IA 1JQLB 3U9LA 1DCTA 2JFQA 1LPBB 3H2ZA 4TLBA 1BHSA 1S89A 4QA9A 5BN5A 5B3JA 3S93A 1U5TC 3JQCA 4JIGA 1H2RS 1QMPA 5FX2A 5CLSA 2PIAA 2OPHA 5D5XB 1CV2A 3E22A 4BEBA 4NOJA 2BYTA 1LNQA 3CM0A 3RCBA 1L4YA 2B34A 2IHTA 3KQQA 2XRFA 1V8BA 1TVCA 4Z9YA 1WF6A 4P38A 2Y05A 3CIOA 1TRKA 2YHUA 3TSZA 1WY7A 5G40A 3S2SA 5JRDS 1I2DA 1P29A 3ZUPA 3V1NA 5C37A