3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
1IRFA 1F5TA 2CWWA 1K79A 4LK1F 3A4TA 3PT9A 1PUEE 1EIZA 5LLQA 4EGYA 3BZBA 4POOA 2R7FA 4OIOF 4L5IA 3C18A 5LEJA 2ZKZA 4M9XA 4GYIA 3DMGA 1P6RA 1XGNA 3I9FA 5CD1A 3V7CA 2G8NA 4LWPA 1WSUA 2VOPA 2EFNA 1XGOA 1Q0SA 2H1RA 3HVKA 3HTUA 3EGVA 2CKDA 4HG2A 1STZA 3BZ6A 3LHDA 3EGEA 1WXXA 4B17A 5D8LB 3HHGA 4AD9A 5ICEA 5EG5A 4ASNA 4L9VA 2PJPA 1FP1D 2UYOA 4KIBA 3T8RA 3HCBA 3P9CA 5H6QA 5D1HA 3KQPA 5AIQA 4HOBA 3OZRA 4L9JA 4AUKA 2JT1A 1VP3A 2CMGA 5KQRA 3F3XA 4E30A 2VONA 1SQGA 4H0EA 5DDGA 5FADA 3UFBA 4RGSA 5K05A 2NP7A 3M9AA 3BPVA 5FUBA 2FEZA 1B9MA 4GXOA 3CGGA 2QENA 5K0GA 1KIAA 5E1WA 1R00A 4ON0A 2CFXA 3ZMUA 5FLXK 1XCJA 1ZKDA 4JQFA 3CJTA 1L3BA 1U78A 5E1OA 4FX0A 3ORHA 3P2KA 2QBYB 1P39A 2HTSA 1Z6RA 2ZVJA 2E1CA 2TDXA 5C0OE 5LQJA 3TDZC 2ERCA 4EJUA 2PT9A 5DXJA 3FTFA 1KQ0A 1T98A 4QTTB 5EOVA 1UWVA 1TQIA 4C03A 2HYFA 1J75A 3JAMZ 4ETSA 3KE2A 1S7AA 1REPC 3RYPA 3HTSB 3JWHA 3DMFA 3GRVA 3TM5A 2P3OA 4M71A 2XYVA 3HRMA 3MAGA 3IHTA 2OD5A 4PYMA 2VT2A 2ZBRA 1QAMA 1ZYRF 4DM3A 1FWZA 1KHHA 2E5WA 4M73A 5FQOA 4QLCU 5LGNA 2XKOA 5HLIA 2O03A 1KU3A 1YFHA 3ERCA 5D1NA 3TFWA 3SHFA 2EWNA 4L0YB 3BKXA 1SVUA 3RPUA 3LX6A 2E1NA 1BI0A 2UYQA 4FR0A 2NAZA 2O0YA 1EQAA 1YG2A 1XCLA 2OZUA 3BY6A 4GCVA 1NBHA 3V8VA 3E5QA 4G9YA 2CG4A 3GO4A 2DFIA 3MCTA 2PJDA 3SMQA 5B1SA 4CWAA 3M1EA 4C4AA 5LQNA 2DPDA 2LF8A 1FX7A 5A2QK 5CVIA 3MQ0A 5EZSA 2GA1A 2UXXA 1IN5A 1V4RA 3ZMTA 4HDVA 1EH8A 2ZLBA 1JQEA 3ISPA 3F23A 5CJ9A 1RIOH 5AIPA 3JWIA 3CO6C 3KQQA 4CYDA 4Y15A 5LGTA 5GINE 1KPIA 2KIMA 1EAMA 5DM1A 2UYCA 4NQWA 2G1PA 1ON1A 3CJRA 1BC8C 4P55A 2LSOA 4FZVA 3HCEA 1U5TC 2D1HA 2M87A 1YIOA 2ZJ2A 2QRVB 3BGDA 3SGLA 3CDHA 2ACJA 1X19A 4RSRA 4RAZA 2R6ZA 1FBNA 5K5QA 3RKXA 3NVMB 3ZP5A 1R18A 1HBXG 5LQAA 2VT3A 2BH2A 3LDUA 1GXQA 5KYGA 4X63A 2YUIA 5FO5A 5FCDA 3F6OA 3BWMA 4LG1A 3GGDA 1QPMA 2IH5A 1UHWA 5DSTA 3GCZA 2L54A 3KEQA 2EJRA 2FK8A 4NECA 3A7DA 1OR8A 4WX9A 4GF5A 4DCGA 1SUIA 2AOUB 1G4DA 4IHSA 4WWCA 2QUFA 3FXQA 5FHQA 1XN7A 2OBFA 1FP2A 3DPLC 5LQRA 4OA8A 3PFGA 3H2BA 1SFEA 2QBYA 2Z6UA 5FFZA 4ESBA 3RODA 1O57A 4M7RA 4L0ZB 1HNNA 3C0KA 3OE5A 4M9ZA 2YX7A 2FRXA 3G73A 5KK1A 2FBKA 3WTXC 1NT2A 2ZWVA 1UFKA 5DWQA 3V4GA 2J5OA 2W85A 2EV6A 2P8TA 2P8JA 2Z3YA 1LDJA 3J80Z 5JHUA 4L9NA 1BOAA 2FOKA 1LEBA 3F8MA 1YZHA 3LKDA 4AIHA 2A14A 3PQJA 3BPXA 3GRYA 1QO0D 2B0LA 4QQNA 4MIKA 3GWZA 1BC5A 3EMBA 1JTEA 2Z33A 3BDDA 4ZYEA 1JG1A 4GQBA 2ADUA 5FD5A 5JI6A 2WK1A 2UZKA 2OB1A 4B8XA 4BQAA 4PINA 2QVOA 3P9IA 4I2OA 2GPYA 3S68A 3E97A 3VB2A 3W6JB 3MFKA 2I6GA 3T7RA 4EKIA 3DH0A 3J81Z 4KYWA 3O7WA 3LQQA 4AIKA 2BE5F 3MWMA 5HLGA 3SR4A 4IKPA 4N9IA 4XSXF 3HCDA 4LK0F 3CJNA 1G3SA 1A04A 3FUUA 1BJAA 2PY6A 4RTJA 1IXCA 1F9NA 4ENJA 2RN7A 1ZG3A 2JZYA 1KU2A 3GUDA 2DULA 3KU1A 5F2KA 5EIWA 3R0JA 1L9KA 4DKJA 4E33A 4QVGA 1ORIA 1XSVA 1KPHA 2GQQA 4PYLA 5E1ZB 4IXAA 1O3SA 4OBXA 2A61A 3C6MA 1USSA 2GAFA 2DLLA 2IVMA 4FP9A 5EVJA 4HDUA 3TO9A 3NWEA 3RIEA 5LQCA 2MD5A 3OE4A 1XJ5A 1J9IA 5JR3A 3B02A 3ZPLA 2JH8A 4PYJA 4KDPA 2Q0OA 5FWDA 2ETHA 5HOOA 2K27A 2VBXA 4RV9A 2C7QA 3KP2A 3TGNA 3BJ6A 5DRTA 2EX4A 1Z1DA 4XLPF 1KR5A 1XDUA 3ZN1A 3E5XA 2JTVA 3FRHA 5K0EA 3EEYA 2ADMA 1UIRA 2YVLA 1R6AA 4EQQA 3COAC 2AXLA 2XASA 4A6EA 2G7HA 4YUWA 5CYVA 3A26A 4A5MA 4P9FA 4QWQA 1ZRCA 4CZZA 3HOSA 4QDKA 3E05A 4YIIA 1R1TA 4HLXA 1R5HA 5T67A 4JBAA 3MTEA 4GOOD 5EGSA 2AOXA 4AZWA 5H02A 4GC9A 4XLNF 3LCCA 4Q48A 4KN7X 2GXBA 3TO7A 1FYKA 1D2GA 4CKEA 2V74B 4X61A 4P58A 4UHTA 2Z6QA 2HMYB 1BIBA 4Y17A 4IWNA 2GIVA 2XROA 5K09A 2FMYA 3MZHA 3ELKA 3TOBA 5FULA 5LQKA 1FSEA 3MQ2A 3WE3A 1N7JA 3Q7EA 3QPHA 2BYVE 1ODDA 3SSMA 5IKMA 5DTMA 1W4MA 4Q5SF 3B3JA 1YS7A 1KQ9A 2FNAA 2O06A 9MHTA 1D2HA 4MTEA 2PXCA 1DP7P 4YV2A 3L8DA 3T8TA 3HCCA 2OY0A 2PV0A 1VE3A 2F8LA 5M5BA 3ECHA 3QU6A 5ILVA 3AWIA 3IC7A 4O29A 3KQYA 1DUSA 1G6Q1 3THSA 3X0DA 4CHUA 1RJDA 4PONA 1P91A 3FMSA 1YFJA 3ULQB 3G5TA 1UHMA 3GIWA 4M74A 3DMHA 2NS0A 2KIUA 4E2ZA 1W7PD 2LKPA 1OKRA 2HFHA 4A6DA 1YW7A 4YFNF 3L09A 5LHGA 3LA7A 2AOTB 1S6LA 4BXUA 2V1UA 2ZIFA 2D2WA 1MDMB 1TPYA 3EYYA 5HIJA 4PCQA 4RAYA 2C7PA 1E2XA 3LBFA 4ENNA 2ZNYA 5HOQA 5EMMA 1KA8A 1XB4A 1JG3A 4KICA 4OOIA 4MEYF 2AS5F 5EIFA 4KNYA 2OYRA 5TRDA 1W7PB 2RDPA 4F85A 2PX4A 1G38A 1F4KA 5HIKA 2HGCA 4BHBA 1JSZA 3MEXA 2O57A 3TKYA 3RKWA 2RQPA 1OPCA 1NW3A 4PZJA 4RB1A 1DDNA 4LLGF 1IZ1A 5HS7A 2O6GE 2YSRA 3G5LA 5K0JA 5D5WB 1BI1A 2BV6A 1QBJA 3PS9A 4HW0A 3FPFA 1J7KA 4L9TA 3TLJA 3RYRA 1ZAOA 4PDKA 2EFOA 4OA5A 2VC0A 1Z6TA 2G71A 5K0LA 2HNKA 2A6EF 2RKHA 2VBYA 1KPGA 3K6RA 3RW9A 2CGPA 1J5YA 4K2EA 1RNLA 2AN3A 5FGMA 1L3IA 3QOWA 4LFUA 4DNCA 3KFWX 2N47A 4FT8A 2K4JA 4PCLA 3GDHA 3U2RA 4PNEA 5ED4A 3GYHX 1NKVA 4ER0A 3OOPA 1FYMA 5E1MA 3P2EA 4E32A 3CKKA 1R36A 2ZIEA 1XCVA 3I0TA 3F4KA 4G56A 3H3ZA 6PAXA 2IRFG 1LVAA 2Q41A 4JK1X 5GM1A 2P5KA 3IHUA 4WXCA 3F8FA 2NXCA 3RTRA 4Y2HA 1XGMA 1M6EX 4YMHA 2CMHA 1OYWA 2HTEA 2BR4A 3DTNA 3LAPA 3WTYC 3RDIA 4BLVA 1HXDA 2EFWA 4L5JA 1DL5A 4V0RA 3P7NA 2FU4A 3SM3A 4RTSA 2DQRA 8MHTA 2XKPA 5E18F 3IL2A 1AQIA 2M8EA 3G2OA 5CCXA 1YZ3A 2VE8A 1PJZA 1VIDA 1E17A 1AOYA 3FUTA 5E20A 3AXTA 4KW7A 5LHHA 3F6VA 5KQSA 2K02A 5DTRA 2GA2A 4EJTA 1P4AA 3KPWA 4RTLA 3M6WA 1G3YA 3ML6A 2B78A 5H20A 1VLMA 2H11A 5EKXA 3J7AO 1RI1A 4AX8A 2QQBA 2COMA 2QQ9A 1SFXA 4G94A 3KQTA 4FT4A 1I4WA 4EKGA 2XUBA 1MJBA 2M1BA 3HOTA 1CGPA 4ZZDA 1EV7A 1SFUA 3KP4A 4FX4A 1VTNC 2XVAA 2XBMA 2BGCA 2AOTA 2KIFA 3GXOA 5LGUA 3UJ9A 4YUZA 1MDMA 3BWGA 2DU9A 1R22A 2NXJA 1MJAA 5FB2A 5LHIA 4U0VA 4PIMA 1X3UA 3ZMDA 5KVRA 1RZ4A 1U5TB 3MAJA 1W5TA 4OIQF 3CJQA 1W7PA 3M33A 2EA2A 3S2WA 3RPQA 2IH2A 4RGRA 1XSXA 1IAWA 2OAZA 2GXGA 2XVCA 3CLOA 3KR1A 2GLUA 4U7BA 4IVNA 5L3EA 3ME5A 4HQMA 4LJZF 1H0MA 2XAJA 2VP3A 3IRQA 5HIIA 5LRSA 1N2XA 3B3FA 5EEHA 2ZFUA 5E8IA 3F8NA 3LGAA 4HRAA 3GRRA 2BBYA 2P1DA 4XBFA 3BGVA 3EMDA 3BJOA 1JHFA 1ON2A 4U7TB 2E7WA 2AVDA 2Z99A 3CVOA 3M70A 5DXAA 2IH4A 3EVDA 3B3GA 3C3YA 1O3RA 3E7PA 3E3VA 2L01A 2ZBQA 3EUHA 4WF2A 2CW0F 3A27A 1IRGA 3I59B 3P2IA 4MNUA 1SAXA 1FT9A 2M45A 2B9EA 1AQJA 1KP9A 1YQAA 1G8AA 1Y0UA 3HCAA 3DOUA 4C06A 3LQRA 4OIPF 4P7FA 3F22A 5DM2A 2AOVA 2B3TA 3UJDA 5DV5A 3WTWC 2CSOA 3FWEA 3KR2A 4HV5A 5AONA 1LQ1A 3QP5A 3GFMA 3SSOA 3KETA 1GHCA 1Z3CA 3DR5A 3GRUA 3BWYA 3FRIA 2Y75A 3EVBA 3IEIA 5FTWA 2HOEA 4I09A 4YFKF 2V7EA 5L3GA 1OYYA 2PLWA 3REOA 1SD4A 4V0QA 3BWCA 3CCFA 1D2CA 2O61A 2HZTA 1JTFA 3KQVA 4DCMA 1SKMA 1TNTA 4P96A 2OQGA 1WKMA 1NW5A 4H0NA 3HSEA 4FHTA 2O8XA 1W5SA 1P1CA 4S04A 1D3YA 3UJBA 3HNRA 3LDFA 2MLKA 5DRYA 2PX5A 1OR7A 1XMKA 1UB9A 1PP8F 4G8XA 5FA8A 4EJWA 1DUXC 4M36A 4IV0A 1BM9A 3WGGA 4ESJA 4RTRA 1YLFA 4I0AA 2Y0MA 3DKWA 3N97A 3KLNA 2B2CA 1QZYA 1B9NA 5E8RA 3FPHA 3M7GA 1O3QA 3RIRA 5K0FA 5EPEA 4O6JA 1U5TA 3OFKA 2BR5A 3NMUF 2KW5A 5LR6A 1O3TA 1TW2A 3LECA 1SG9A 3GO5A 4I7HA 4G6QA 3UJ8A 3OFJA 3FZGA 2ZFWA 1NV9A 3E5UA 1NW6A 1IM8A 4XUEA 2ZZNA 1KYWA 3M6XA 1SD7A 5D6FA 3GEZA 2HTJA 3D5LA 3R61A 1J59A 3UZUA 5CVEA 3GVAA 4G7HF 2XAHA 2ESRA 3T5XA 3Q9VA 4XSZF 1EJ0A 2P7IA 3P97A 1FBSA 4CXFA 2P41A 2UWMA 3GRZA 3UWPA 5EQJB 5FLXZ 1NV8A 2JJQA 2HYGD 3EDPA 4ER7A 2P40A 4IJAA 4KFCA 1SUSA 2VC1A 5L3BA 2IJLA 3HM2A 4GYGA 3I59A 2B25A 4X1OA 1VBFA 4M9SA 4U7PB 2FE3A 3SZPA 4EGZA 2R3SA 4BYYA 3EVCA 3DP7A 3PVCA 2XGXA 1O7LA 2V79A 2VS1A 5ILSA 5DTQA 4RVDA 5D4SA 3HHHA 1IXKA 3TPZA 2JRTA 1MD0A 2FF4A 3WGHA 2EJTA 3HSFA 3U1DA 1IUYA 1XTPA 3HA5A 4FS8A 4YUVA 2PBIA 3G2PA 2FBIA 1FY7A 4CKBA 3E23A 2HR3A 2ZXJA 4C04A 2NP6A 3E6CC 3BXOA 3DF8A 3P9KA 4PIPA 2JHCA 1YW8A 5HDNA 2PVCA 2H6BA 5K5RA 4Y30A 3B5IA 1YS6A 1VL5A 2HEOA 4G7OF 4ISCA 3OZTA 3LAJA 5HEKA 1T0FA 3VEPA 5FA5A 3L2CA 1HSTA 1AWCA 4HGYA 4RTOA 4LWOA 3G8AA 4KIFA 2FXAA 1AV6A 1BOOA 4MTLA 2HS5A 4RX1A 4PGHA 3ZQ7A 1L1EA 3QU3A 5D4RA 2X0LA 4YFXF 1FJXA 3WTUC 1R5GA 3LPMA 5C1IA 2VOOA 4CICA 4R8RA 5A2QZ 4KMFA 2XAGA 4CO8A 2JHPA 4OMYA 3PX3A 2FBHA 2W25A 3EVAA 3T0YA 4U0WA 1KYZA 2ZMEB 1P92A 4ZZLA 5FQNA 3THRA 4LMYA 1M6YA 5BPIA 3NTVA 3F8CA 2IA0A 4FT2A 1GXPA 1JG2A 2D45A 1S29A 2ZCJA 4BNCA 2PQ8A 4QQKA 3GLXA 2O07A 3QPTA 4HQEA 3MERA 1QZZA 1YO5C 5T64A 4LB6B 4HLYA 1X1DA 2EV0A 1HKQA 1IN8A 3OPNA 2O0LA 5E1DA 5TJJA 2Q8KA 1WWXA 1V3FA 5CVRA 1FOKA 2FCAA 1MHTA 2WWYA 3KPJA 4OU0A 1ZG5A 1SQFA 3TQNA 3O31A 2L4AA 5ILUA 4DZRA 3KQOA 2P7VB 2VDVE 2XYQA 4RB3C 1ZLKA 2RVCA 2P6SA 2OQRA 4UVAA 2OO3A 4UV9A 4U0YA 5BOXA 2IGTA 2Y48A 2VZ9A 1INLA 2HV9A 4BHCA 4AZVA 3M6UA 5JUWA 2PXXA 1M0EA 3VOEA 4O5VA 3LFKA 3HSRA 1P2FA 2VBZA 4HTFB 1G6NA 3H92A 5D8KB 2STTA 2DQLA 1U2WA 3NRVA 4ENKA 1ORHA 3RKYA 2UXNA 2EJUA 1IN4A 2QM3A 3ANXA 4E2WA 3I4PA 2Y1WA 4HF1A 4TV7A 3ZMVA 1BKYA 2DPUA 4X60A 1X1AA 3SXYA 4UXNA 2FSWA 3E8SA 5CM2Z 3QAHA 3HEMA 4AWXB 3DFGA 1YYVA 3GFIA 2FHPA 3ROUA 1WZNA 3D0SA 4BHPA 3CO7C 2ZIGA 3O3KA 2XVMA 5K03A 2D1VA 4HBLA 2YXDA 3FTCA 2OXTA 1LJ9A 4CTJA 4KT5C 4OINF 1ZREA 4U88A 2GAUA 2KKOA 1K78B 3LBYA 3OU7A 2JG3A 4IPAA 3D2LA 2YPRA 3FPEA 4GOND 1H9GA 1XMAA 1IY9A 5EMJA 4K6MA 4YMGA 5K8VA 3FHZA 2LDUA 3KEOA 2W24A 1TTYA 3R9XB 3AJDA 3TR6A 3A25A 5EHGA 3ECOA 1F38A 1FBQA 5HS9A 1Z9CA 4RGUA 1S8NA 1TNSA 1RJGA 2L3DA 4OQDA 2JPBA 3V97A 2IFTA 4YV1A 3I58A 3BOQA 4OMZA 3TQSA 2MH9A 3K2ZA 3SQNA 2CYYA 1QAOA 1USTA 2V6CA 3L9FA 5BW4A 3M8FA 2FYTA 3GFJA 3FM5A 4EM1A 4R79A 1KU9A 5LQUA 2FK7A 4BP3A 2ZMEA 3V8LA 2QY6A 5L3DA 2DTRA 4HSGA 5CCBA 2PI0A 3JTHA 1Q0TA 3K1NA 3KP5A 3FUWA 3NWBA 3G2MA 2OB2A 3C7JA 4C07A 2UZ4A 4HV6A 4Y13A 1XVAA 2V9VA 2H27A 3MHTA 4HA8A 3PX2A 3HVHA 1WRJA 3JWGA 3HUGA 3R0AA 4EV0A 5K5OA 3FX3A 3CUOA 2IW5A 4QDJA 5DSXA 1JQDA 1UFMA 1ULYA 5HVQC 1B59A 3ELWA 1T39A 3AXSA 3ELYA 5LEKA 5EKUA 2ZSUA 4KRGA 1RJEA 1D8KA 4I01A 5P8WA 3EQLF 3PQKA 5K0BA 4NHJA 5DCFA 3MCZA 2MC3A 1BIAA 1FBUA 4EJVA 4C05A 3G3ZA 2XYRA 5GP1A 5DX8A 1Z05A 4Q4ZF 3ABUA 5DM4A 2QZ8A 4M6YA 2Z9OA 4M37A 3KZYA 2IBSA 3KLOA 2EFPA 1R8YA 5F2OA 3KP7A 2PWYA 2R7DA 3Q9SA 4MWZA 5IT9Z 3VC2A 5DYMA 4HGZA 4HTFA 3LA2A 5DUKA 2QWWA 5DCMB 2Y1XA 4OBWA 3EVGA 4RWZA 1BI2A 3FXRA 1HQCA 1X1CA 2P6TA 3ER8A 3QOXA 3VSEA 1DCTA 2PFBA 4A0YA 4Z2YA 4BH9A 3JW4A 2NRAC 1NE2A 2GB4A 1NW8A 3KQSA 4MHGA 4EM2A 1ZGJA 2ISZA 3MTIA 2VN2A 4FGZA 2VXZA 5D5VB 1P4WA 3LL7A 4ZH4F 4RVGA 1I1GA 3DLCA 5U4XA 4QPNA 1K7AA 1MZBA 2ZULA 3C3PA 3EEOA 1K78A 4EMSA 1BN5A 4RYLA 3ZMSA 1O7FA 5KVAA 3TM4A 2AN5A 2E7XA 2FPOA 3LSTA 2AS0A 3JAMK 3ELUA 3IYLW 1MJFA 2EV5A 2ZZKA 5ICFA 1TBXA 3RI4A 2EA4A 3F8BA 3EVFA 3IWZA 1BBYA 3UA4A 1DPUA 2EK5A 4RTPA 1EJ6A 4AZSA 5CVUA 2ZBKA 4WCGA 2OKCA 3M4XA 5G02A 4WK8F 1QANA 1HKTA 2AN4A 1R1UA 2I9KA 3C6KA 2KRFA 4HYEA 3DEUA 3EVZA 1U3EM 4S05A 5CVDA 3WTZA 4BP1A 3NW9A 2A07F 4IV8A 3BUSA 5BXYA 1ZG1A 5DEQA 5HIMA 2GWRA 2YQZA 1OMIA 4JXJA 4YUXA 5LBQA 2J5PA 2ONYA 2CWEA 1B42A 3HA3A 3UA3A 5DUIA 5DLYA 4HF0A 4MQVA 2RV8A 3U81A 5E17F 1IN7A 3NEUA 5T6BA 4KWCA 4XRFA 2P3QA 3Q87B 5HDGA 3E6MA 1I5ZA 1DPRA 3GNLA 4DQ0A 4I0BA 3K0BA 4UVBA 2XHKA 2HKXA 5CUQA 4F7ZA 1ONVA 2H09A 5LSAA 5CVJA 5HILA 1XSDA 4P9UA 5BPDA 4ER3A 4UOEA 2DI3A 1FYLA 2OU2A 3ERED 2ESNA 3C1DA 1KQ8A 2ELHA 4IF4A 5HFJA 2H6CA 4KDRA 4OX9Y 4R6XA 3ELDA 1YB2A 1B6AA 1XD7A 3B73A 3R0QA 2NXNA 3P71T 5HDKA 2OZ6A 5EC8A 2ZWAA 4A0XA 3HP7A 3SVZA 1Q1HA 2DW4A 2VODA 3LA3A 4YIFA 1G3TA 3HCFA 1CF7B 4DMGA 2P7HA 1WY7A 1FSHA 2PX8A 3DXZA 3V8KA 3T7SA 2PX2A 4EQZA 1TQPA 3OU2A 1TLHB 4GUAA 5DCMA 4I98B 4AVPA 1ZQ9A 4LECA 3ZN0A 5FWAA 3NDIA 4A2UA 4E70A 5GM2A 1U6GA 3MZYA 5D6EA 1WS6A 2DBBA 1SMYF 2F5DA 2IIPA 4GGGA 4ER6A 3OU6A 1ZN2A 3M6VA 4GOLD 4ZYHA 3TKAA 3UJ6A 2G9WA 4R1HA 1R8XA 5E9WA 4WXDA 4A5NA 1SD6A 3FM3A 1R58A 2Z6AA 1FNNA 2PBFA 4KIGA 3UJAA 4YUYA 1HW2A 1LEAA 3FTEA 1N7IA 1D5VA 2WV0A 4YV0A 3BKWA 4CXMA 2UYHA 2HQNA 3FPJA 5EMLA 3GW2A 2P7CB 3PFHA 2MA3A 1ZGAA 1NW7A 4ZTBA 1Y8CA 4QTUB 1VQ1A 2F5CA 1WXWA 1T2KA 2WA1A 2P4WA 3I71A 3KZZA 2IT0A 3SXJA 2VDWA 2NNYA 4OQEA 1P1BA 2ZBPA 3J80K 2LF7A 1LB2A 3LKZA 4DF3A 1MKMA 1G3WA 2YXLA 2YR2A 3C3WA 1S7OA 2H00A 4PYOA 5C9ZA 3K1MA 3MB5A 4CKCA 3BROA 3U9GA 1O54A 2Q2EA 2EG5A 2VDUE 5FHRA 4CTKA 4C08A 3GZ5A 2XIGA 2NNWB 3CTAA 5BS6A 4XUDA 2PEXA 3I64A 1O9HA 4RTKA 3J81K 2FMLA 4PGGA 2ZZMA 3P9NA 3HVIA 4ATNA 1JQ3A 3LCUA 4HX7A 3JSOA 4EJOA 1TW3A 3F72A 2JPCA 3FUVA 1YW9A 2ZNZA 5GOZA 3CUQB 2H94A 5E2AA 2MLGA 1LNWA 1WQ2A 1EG2A 2PGXA 2AR0A 2A3SA 2YR0A 3UJ7A 3GZ6A 3WTSC 4RVFA 5H6RA 2VE9A 1V39A 2AVNA 1YUBA 2NNNA 3SSNA 2W84A 5L3FA 3VFZA 3NDJA 3T7TA 3T0IA 3G89A 2IPQX 1D8JA 3R3HA 4RVHA 4GO1A 1FC3A 3K1PA 2GH1A 3CC8A 5DT2A 3E6DA 5K01A 3VODA 2DO7A 2C7RA 2P35A 1FZPB 5BW5A 2V1DA 4HX4A 5DD8A 1JXSA 1XCBA 4MGRA 2ZTHA 2GZWA 4LG0B 1CF7A 3OCJA 2BR3A 3KCCA 4PYQA 5JFRA 3OV8A 1IN6A 4GEKA 1KXZA 3DLIA 3FTDA 3BGIA 3IV6A 4ENMA 1H1DA 3DULA 3PTAA 1VPTA 4LLNA 4F86A 2DT5A 3SZTA 2ZCWA 2LNBA 4UV8A 3JTGA 1O9GA 3BT7A 2FQ3A 3V7SA 1TQMA 3GU3A 1J2XA 2OA4A 3EETA 4A0ZA 5DM0A 1L3LA 1NHAA 1G60A 5F1RA 5L3CA 2IBTA 3ID6C 2ESHA 1LDDA 1I1NA 2PWPA 1RUNA 3FPGA 3KPVA 3LCVB 2YU3A 3DV8A 1K6OA 1G8SA 4M72A 4UUVA 2O05A 5EZQA 5F64A 3SFZA 4RB2C 3HIFA 3KPUA 5HZMA 4LD5A 3I54A 2STWA 3B7PA 4MEXF 3FZVA 2F2EA 1ZH5A 3B89A 3AAFA 4GBED 3EPPA 1RUOA 2BM8A 5DX1A 1RI2A 5MHTA 1T43A 1BC7C 2NYUA 2W57A 2XV4S 3K9TA 3L7WA 2OZVA 2FRHA 3R6TA 5BMZA 2P5LC 3DXXA 2K86A 3G2QA 3KKZA 2A68F 2PMUA 3BJAA 2HKOA 3WSTA 5DD4A 2RNJA 1H9TA 1EH7A 2VBWA 2HWVA 3TO6A 1P4XA 5K0NA 2IA2A 3R6SA 3WTVC 1L0OC 4WXHA 4QPPA 3DXYA 5K0CA 4M6XA 1RI7A 4B09A 1ZARA 2QE6A 1I27A 3KR0A 2YX1A 3R4KA 1Z7UA 2A5YB 4R8HA 2KJBA 5E8GA 3FUXA 5K1YA 2MH2A 4AZTA 1GVJA 4OIRF 1WI9A 1L3CA 3K0LA 1QYRA 5GIPE 4EK9A 4BLWA 2G7UA 1JG4A 1T38A 4P7KA 3Q5FA 3HRTA 2A6HF 5GIOE 2ORED 1S3JA 3CUQA 2RC4A 3CUQC 3JWJA 4FSDA 1FPQA 4UVCA 1J0RA 3HVJA 3ER9A 1FLIA 4U7DA 1RI5A 3V7RA 1HW5A 4KA4A 2C6YA 3KQWA 5FFXA 1QAQA 3NQOA 1PP7U 2YTZA 2P3LA 1JE8A 2PMHA 2QRVA 2NYXA 2PLYA 3KP3A 2PG4A 5D5UB 2F5FA 2DPMA 2L02A 3PB3A 1WG8A 5IH3A 1HMYA 5F6FA 1HW1A 3N4MA 2X4HA 3QP6A 3EVEA 1ZRDA 5E1BA 3R24A 3G7UA 4P7JA 5BP7A 3GJYA 3A7EA 4LG0A 5E9QA 3QRFF 3FXUA 4HX8A 3WODF 4R8SA 4G6DA 2OPBA 2HDCA 1B1BA 4MHTA 2EFJA 3DXJF 5ERGB 1XGSA 4RS8A 3M8EA 3GX4X 1QQIA 1KU7A 3KPYA 2LD4A 2M5WA 4CGZA 4MQ9F 2RGVA 4GOMD 1T6SA 3I53A 1RI3A 2WC2A 3H3UA 3EYIA 2CL5A 4DQ2A 2KJCA 2AOUA 1I1SA 2QQAA 1BI3A 4LGWA 1IF1A 5IT9K 3SX0A 1YFLA 2IDJA 4E2XA 2GA9A 1G55A 1RJFA 2JH9A 5BQTA 2K7LA 4I02A 2ONZA 2FA5A 4N0BA 1I6XA 2MBFA 3LWFA 4L18B 1R23A 2C7OA 3TMAA 5FD6A 2PKWA 4A12A 4AIJA 3IWFA 1KGSA 5HS8A 2QYOA 2F5EA 4XUCA 2OBPA 4FSXA 1R7JA 3NJRA 3BWBA 1YTYA 1AF7A 4LB5A 5CVVA 5DPMA 3GFLA 2JHAA 1X1BA 1IXRC 3E6BA 2DK5A 3BP8A 4D0PA 1U8RA 2BEOA 5JVTA 3WU0A 2PXAA 2FNPA 4BLUA 5ICGA 2XAFA 4G7ZF 1PDNC 1XDSA 4KVZA 4IRIA 4YG2F 2NXEA 5DX0A 10MHA 3PFIA 2ZW9A 3HRUA 4HC4A 4PWYA 4PYIA 4Q47A 4RGXA 4RTQA 4CDGA 3TRKA 2EB7A 4HAMA 3UBTA 2XRNA 4N9HA 4E2YA 2QLZA 3HYIA 1LDKB 4GC5A 2P5VA 2A69F 5J8FA 2O3FA 2PSSA 2L4MA 2AZTA 3FYCA 3MGGA 4IHTA 2M30A 5LRRA 4R05A 5CIYA 4P7GA 3AY0A 3FYDA 5E1XA 3IKVA 3O2PE 3UJCA 4KUMA 2CQKA 3FF5A 4KMUX 5IT3A 1F1ZA 4KN4X 2BM9A 2I7CA 2YXEA 1JSXA 3O4FA 5EHIA 4HH4A 3TOSA 3FMRA 4LLLA 2IA1A 4X41A 1QNTA 1XDZA 3TDUC 3G88A 1B4AA 2DK8A 3HRSA 5CLSA 5J8CA 2YX4A 1ZHFA 3DQVC 1JGSA 3GF2A 4HZFA 4PYNA 1JHHA 3CBGA 1JR4A 4QVKA 3VYWA 5HLHA 4UNOA 1I9GA 4F84A 1OYIA 2G70A 1VP9A 4PCAA 4BAYA 3QOPA 3OZSA 3I5UA 2IDKA 5E2BA 5KS2A 3WGIA 3TOAA 4EM0B 4E31A 5ERIA 3WG9A 1IXSB 5ICCA 3KHKA 4PYKA 4ZYDA 3IRRA 4O3MA 4DA4A 5E9JA 3K69A 3WU1B 2I62A 3R60A 1ZLJA 2PT6A 1Z91A 3FMQA 3IKTA 2G72A 4ZYGA 4BY9E 3DPTA 2DAOA 4WVLA 1R1VA 3KQMA 4P5OA 3WE2A 1R74A 4M38A 4ER5A 3WTTC 5D5XB 3KP6A 4ESFA 1C0WA 3DUWA 2ZO4A 3V8JA 1IW7F 3EGIA 1ZRFA 2HR1A 1XXLA 1MJ9A 3F21A 3ABTA 2WTEA 1UCRA 3JSPA 2GS9A 4IRHA 1HSJA 1SMTA 2XAQA 4XCXA 1QGPA 1EH6A 1RI4A 3KR9A 3O6BB 1PRYA 2K4MA 1U2ZA 2Z5UA 4MTDA 4RTMA 3ZMZA 4MQ4A 2CO5A 3P8ZA 5GWXA 1F3LA 2PN6A 7MHTA 3RJPA 4KDCA 1SD5A 5EEGA 3W6KB 3QV2A 4L7VA 2IP2A 1BHJA 1MGTA 3NVKI 3T1BA 4NB5A 5F2NA 2BZGA 3PLAE 4IRGA 5E8JA 4R6WA 3L00A 2EFQA 2K4BA 2JSCA 1NBIA 1HKSA 3HA7A 4EVIA 2IPXA 3VC1A 1YF3A 5J6XA 4HF2A 5EMKA 4RTNA 2ISYA 2HQRA 2V1XA 2AOWA 3HTXA 3LDGA 3G8BA 2HWKA 2WA2A 4RB0A
chains in the Genus database with same CATH superfamily
3AEUB 1I7NA 3R5SA 3G9QA 4LRSB 3MLBA 4EP1A 1EIZA 1W4BA 4EGYA 1RWKA 5EG0B 2FSVC 3CX4A 2Q21A 1SKAA 4FN4A 1V9SA 1ABEA 3LHDA 1WXXA 4HNAB 3AKCA 5F5XA 2Q1SA 1VMKA 3OZRA 4H15A 1VP3A 3K0HA 1C4WA 1HT0A 5BYJA 1U5BA 1VKRA 3M9AA 3C15C 3UC9A 5J4HA 1JDVA 5J3LA 1RQXA 2HWUA 3HDQA 5LNK1 2CL0X 3PXGA 2C4MA 3EZGA 4FX0A 5JJBA 3VDRA 3E8MA 2AQEA 2TDXA 2X40A 3WAKA 1W2GA 1MNEA 1VRWA 3ANNA 1TQIA 3JAMZ 4ON9A 5JAOA 3GRKA 1ZQ3P 1VE9A 2E1MB 5BRJA 4PYMA 4G1MB 2WPNA 3RI3A 1FWZA 1KHHA 1Y3AA 1HTWA 1T4GA 4NFHA 3BKXA 4GE0A 1NAIA 2QXUA 2IYPA 4F3NA 4FONA 3UUEA 2O0YA 4B1FA 4JMLA 2DWOA 5CB4F 3SYRA 2EFGA 4WXMA 2DETA 4G9YA 2I2BA 5FROA 4FQ5A 3BB4A 3R20A 1A8UA 1LW7A 3IHWA 4AN0A 5BQ3A 5CMLA 4BPRA 5CVIA 1Q91A 1IV8A 2EJWA 4F9TA 2QX7A 3TLGB 1SC4A 4AQ7A 4XE5A 2B94A 4RQTA 5CDFE 2O8VA 3CLTC 4QSMA 4L9AA 2PUAA 5FH9A 2ZJ2A 1X1EA 2FWBA 1N5LA 4G07A 2K40A 1G66A 3RKXA 3RVNA 2EW2A 1IJKA 5LQAA 1L2TA 2BH2A 3LDUA 2HXOA 1KKMA 4X63A 4LYDA 5BORA 4IJ5A 3GGDA 2RG1A 3HOXJ 1ABFA 3QW4B 1Q0LA 4NCAA 4CT4B 2ZSHA 3AETB 1TK2A 2EBHX 1GNQA 2QR2A 3ZWQA 1KYVA 2PZMA 3Q7QA 4AG5A 5TF4A 5C80A 5EKSA 2BFFA 3BK2A 2ZJ0A 2LNDA 2OCAA 5C8ZA 2ATXA 1WDWB 4C3VA 5LPNA 2P8JA 2OTJI 1G3IA 2DFFA 4LQ4A 4K5QA 2JGKA 2QQ5A 3H1CA 3ZU4A 5U1PA 1XNQB 1JYSA 3R8XA 1N2CE 1GUDA 1CD5A 4NHEA 3C70A 5NLLA 4U7GA 4RZQA 2D5IA 3UT0A 4B8XA 2CFRA 3WHPA 2UDPA 3VHLB 3EZNA 4TTQA 3J81Z 3O7WA 4HFRA 3N8KA 2C03A 3OLYA 2VWPA 2OQ2A 3CJNA 3JQEA 4NPHA 5P21A 1QGUB 1I6KA 4BX9A 4DTCA 3PQ7A 4GOKA 3O6VA 3QYPA 4NPCA 3EMKA 1MSFC 2A5GA 2QGNA 3AL0C 4JBHA 5HKLA 1ILWA 4NE2A 2FRDC 5BV0A 5FWDA 3IBCA 4B76A 2WQ6A 2F4MB 3W1WA 5EXTA 4I1PA 5DIFA 2IHVA 3UKGA 2GNPA 1XTTA 4JUBA 3S55A 3U4AA 1U5AA 5CBPA 1UIRA 3CLRD 1RQPA 2POQX 4DLAA 4KO1S 4IINA 3GRFA 3H13A 2R7XA 4TVOA 1UJ2A 3VWBA 2CFTA 2IXAA 1DKPA 1IBMB 3HSKA 3W3AA 1LVHA 3GTPJ 4Y6QA 4PG6A 2C07A 3MZHA 3HZJA 3ICVA 3JVIA 4RVUA 3TOZA 5KO2A 3NIWA 4MVJM 5LQKA 4MCJA 3OR1C 3D6VA 3QHPA 2O8FB 1W35A 4NCBA 4MDHA 2F48A 5IPAA 3R8CA 3VZBA 3PUKA 1N1GA 1RJ9B 2QVLA 4OXIA 4XM0A 3H19A 5KOHB 1NX9A 2O2JA 1M2JA 1R5NA 1J99A 1FX0B 3RHZA 3UOGA 2CLHB 1RAGA 3GIWA 1ODTC 3QA9A 3VPSA 2J3DA 3WLNA 3EDCA 3Q6MA 2CUZA 4RAYA 1GTVA 1X39A 2C2HA 3GNSA 621PA 1DG1G 3TNJA 2BGGA 2IITA 1YOVB 4J1QA 1BGXT 2NPFA 1BVHA 2AS5F 1UT6A 2IIQA 1XMIA 3D7NA 2IYZA 4FNOA 1OVMA 1P80A 1SNYA 4IXDA 3RJTA 1FVFA 3MBIA 1CY7A 5JLXA 2O6GE 1XSEA 5EUMA 4KACA 3SJZA 1KYQA 5IYZA 4EPTA 1TZJA 2R60A 4QU0A 1F9AA 5DNVA 1RC0A 2B8TA 1N0IA 2W71A 2WUDA 3GYHX 4P54A 4EJFA 2YZMA 4E32A 2CLMB 4GZ5A 1IHXA 2CCJA 1G5HA 5AM0A 1PQ4A 4DV4B 1MRNA 3WYGA 5EJGA 2CF6A 2WF9A 3O3CA 4EG0A 2CMHA 1ZY2A 5A06A 1YULA 4IMRA 1EK0A 3TK1A 4FSHA 1P1RA 4E09A 2W11A 2Q46A 2FU4A 2N0SA 3EXAA 1QIIA 5E18F 2M8EA 4LHWA 3G2OA 2XT0A 2VE8A 3I6QA 4L50A 4Z0PA 2LIPA 2ZQZA 1PE0A 2H11A 3R77A 3NO4A 4OQLA 3NHBA 1SFXA 3MMNA 1I4WA 4GYKA 5KKCA 2VQCA 2QTLA 2X22A 4W6ZA 4RH1A 4ZDKA 1NG7A 4HRVA 4W8GA 4KPFC 3H9UA 4OMUA 3D5TA 1T13A 2GNAA 3N5CA 4RGRA 2QM8A 3DAFA 3FHNA 4IVNA 2PS3A 4YJ3A 5AK0A 1N2XA 2GETA 3X1JA 4HRAA 3LF2A 2VQHA 1E3WA 2Z99A 3IAM6 4ASUA 1VE1A 1GUZA 4B82A 1KQGA 1OD6A 3T5MA 1AO3A 3H2JA 4F4DA 2GAAA 4GXTA 2BFPA 1O0BA 4OIPF 5A02A 1IE3A 4UUPA 1GILA 1OX5A 2K87A 5FTKA 2VIIA 3HRKA 1DJOA 4QEDA 3LC7O 4Y2SA 4BFSA 1LQ1A 4QUJA 3RIMA 4D6PA 3QU9A 2FR8A 1W30A 4F91B 3EVBA 2WU8A 4URVR 4B3DA 4I09A 1BG6A 1QYXA 4XFKA 2PLWA 3ULKA 4NV0A 1T0BA 3AF2A 1CZKA 3PDUA 1KEUA 1OXSC 1ZMTA 4H35A 3KQVA 4DCMA 5F3RA 2KQUA 4AI6A 2ACKA 1U9OA 2F3TA 3C5EA 2NU6B 1OFUA 3BH6A 1OFGA 3NBZC 3TMYA 2EERA 2BUCA 4I6EA 5T7BA 4OXQA 1DT3A 4LSGA 5BN1A 4PGFA 2BDUA 1DB3A 1PT5A 3UQZA 1D1CA 4U6NA 3RU7A 4RTRA 4MS1B 2YWFA 3LSHA 2GCEA 3FAZA 2HRDA 4DY6A 4LSZA 2B2CA 3WL6A 5K7SA 3DMDA 1XAHA 3BA1A 1YQ9A 1YACA 3GG2A 4OLFA 1E3DA 1JU4A 4R3NA 4FYWA 1HE1C 4GM4A 3T9BA 3PITA 3KHTA 4TKUA 1N1EA 2OP1A 1Q50A 5AVVA 1SG9A 2ID6A 3FZGA 4UCXA 1RXEA 4XICA 1BS1A 4XUEA 1KYWA 3C6BA 1JDUA 1ZNYA 3IAS2 2LY9A 4RHUA 5IP5A 1NX6A 2R8BA 3MXOA 2DVMA 4TWBA 1OCTC 4TYNA 3GA0A 1GLVA 1ZIXA 4GYGA 3OSZA 3OP4A 2WHYA 4IIBA 3Q8XB 3RU9A 4BFWA 1K5PA 2Q2WA 5CA0B 4RK6A 3TPZA 3GLTA 2B5WA 2EJTA 2E2IJ 3CZAA 6Q21A 3INGA 3OZWA 3UPTA 4B7UA 2HT6A 1O0CA 3VPBA 1RYHA 4G7OF 3EDRA 1UKEA 2Y27A 3NTLA 2VDMB 2O0KA 2HLPA 2HS5A 3FCAA 2NO1A 3E1SA 4YFXF 4B40A 3QE4A 4R8RA 5C37A 3FVVA 1U28C 5EHQA 5IHXA 1T3ZA 3PX3A 2FBHA 4ADSG 4A0HA 4O8CA 3D6FA 2W83A 1M6YA 4PFJA 4DREA 1OFTA 3SHQA 4L5CA 3RR2A 2CBGA 2NUAB 1ZS9A 4DILA 5IT0A 3UK0A 1QHIA 2QSUA 2BCEA 3UG7A 3PRJA 1VQ6I 5LP1A 5BT8A 3AI2A 1OGJA 1QR6A 4ZAXA 2CSXA 1LV8A 5CVRA 3QPWA 2FCAA 5B1BH 1KDPA 5ALIA 1JZQA 1UP4A 5JXWA 1NQ5A 1EX7A 3FH0A 4ZQHA 3IDFA 2RVCA 3AJRA 1CNEA 1Q3HA 1ZESA 3CIOA 2P9HA 3KOYA 1SVOA 3T95A 2ETVA 2ZUSA 4U2FA 3LJKA 1K88A 1G21B 2Z4TA 3C87A 4HB3A 2PUBA 4IEEA 5D8DA 2DPUA 2VSQA 4MVYA 1J33A 2Z8YA 4O8ZA 1C3EA 2IHYA 4OHFA 2PGAA 1P3Y1 1VDZA 4YJGA 4CUKA 2V7QD 1LJ9A 3E7XA 3L1UA 1FQJA 1PWYE 2KKOA 2NTVA 4N5HX 1UPTA 2ZIVB 5FLXA 3D7KA 2Z2KA 2NV2B 1IMOA 1P9WA 4HN4B 4KXQA 4LYJA 1XTIA 2I1LA 2P9EA 2IPNA 3I04M 2VPPA 1F38A 4RGUA 4NK4A 4CKXA 4LBZA 3BWVA 4OMZA 3IV7A 3VVLA 3WRVA 1DVRA 4HMPA 4GFDA 2PZEA 2J31A 3GFJA 2QQ0A 1PFYA 2HD4A 4NZZA 3QENA 1FFXA 1K4YA 1XTQA 4MZDA 2QY6A 5CCBA 3ICEA 1J21A 2Z9BA 1EFDN 5J23A 1YB7A 4ZT6A 4Y13A 3H2HA 2WTAA 1WHUA 3CZMA 2VRWA 4QBKA 1RPZA 3ETEA 4MH0R 1JQDA 1BFKA 1SXJE 1MB0A 4TKLA 3TUIC 4D9KA 3RRXA 5DT9A 4I01A 5EHXA 2L7FP 5A9SB 1BDIA 3T9FA 1EPUA 1W6UA 2J3EA 5BSHA 4B3FX 2XYRA 2CVQA 3I3LA 3WDSA 2XF6A 2QZ8A 2Z9OA 4ZOLA 2RGGA 3TB6A 4Z1MD 3WLHA 2QWWA 3A0BC 4CR6A 2P6TA 3QVVA 1HDEA 3TL2A 5DSZA 3ZU3A 1SHKA 1P7WA 5E6RA 4PGAA 4CMIA 2JRMA 1W29A 3KQSA 3TIVA 1VPWA 4PSCA 1G64A 3H6HA 3CCLI 4HS4A 2CXHA 3TSCA 3K7EA 1Q16A 1MC8A 4H9GA 3CV3A 2CU7A 2PKEA 1O4VA 3A1UA 1O8CA 2JI8A 3ELUA 2I80A 4GKKB 4MQEA 2AUTA 3WLFA 3O7MA 1XRJA 2X1CA 4G5HA 4Q3AA 2IYVA 1DU6A 4H1TA 3UMCA 2EP7A 1IFXA 3E1GA 4WBNA 4JLAA 1CZHA 2O52A 4IDAA 1YQUA 4HYEA 3D6UA 3A2KA 4HBZA 1DBPA 4JXJA 1B42A 4QUDA 4D7AA 3SNKA 1SCIA 4HF0A 1E7WA 1WF3A 3U81A 1P4JA 3NEUA 3IHKA 1DPRA 1GTJ1 2C88A 4IRUB 3K0BA 1T5TA 4BBPA 1P2DA 2CMDA 3W6NA 2HDNB 2D5VA 1AKYA 4R6XA 2ZPUA 1MOQA 4ZHQA 1VI0A 3JAWB 4MWOA 4MFDA 1XN1A 5EC8A 4KITB 2VP9A 3WE7A 1DLJA 1YBMA 3DM9B 1VBKA 2AG1A 2W6JA 5FFMA 2JFHA 3ZBUA 3H8WA 4B34A 1UDAA 2ZT7A 2Z5GA 1QKJA 1M2KA 4OAOA 3TG8A 3DBRB 3T7SA 1E3OC 3RS4A 2ZJ1A 3C4VA 1TECE 1NBMA 2PKQO 1ZIOA 5DCMA 1DAGA 4G5YA 4AVPA 4A2UA 3P7MA 5GM2A 2V45A 3B70A 1AIPA 3C5WP 3H5LA 4JB3A 2I0FA 3OU6A 4RHXA 2C2KA 1U9IA 2O2EA 2P4QA 5JMWA 4A5NA 2J46A 3PJFA 4JXXA 2Y71A 5K4GA 2Z6AA 4E4YA 4J75A 1S2LA 1QH0A 4D0NA 3IGFA 2BW3A 2D5LA 2YJ4A 4FDMA 4OHCA 3L6CA 4BFCA 3JWEA 3EB9A 4RHFA 3ISTA 4J19A 4DF3A 5FI0B 4EF6A 3PKIA 3BROA 2V6GA 4G4JA 2LP4Y 1U8YA 4OP3A 3R0XA 4M0KA 2Z3ZA 2XOKD 2XIGA 2VBGA 3QGMA 2PEXA 1FMTA 3GT7A 2EYUA 4UMFA 5AJHA 2ILTA 2O8BA 3ESXA 3FXJA 1OY1A 4QNMA 4HX7A 4U3JA 1EM8B 3R3XA 2DFPA 1YW9A 2ZNZA 4GNRA 2X5NA 4MIOA 1R10A 3EIQA 1H88C 2PGXA 4D9HA 1T0JB 4D7MA 2GPBA 2BF4A 3ZKWA 1MJHA 4J8PA 3MJVA 1GPH1 5EYRA 4RVHA 4LE1A 4UVDA 1HORA 2BZTA 2O20A 4GPEA 2QTRA 4HWTA 2Y6VA 3L7LA 5NULA 5ER9A 2QZZA 4MR9B 3VDXA 3OEYA 1I94B 3V1MA 1TQDA 4PX3A 1KVQA 2R1ZA 5TISC 4RF2A 3L8YA 2PEYA 2VNIA 4CODB 5B6JA 2OA4A 4LJ9A 4DLLA 3CCRI 2ESHA 1CDDA 4L0DA 3ZVNA 3REQA 4Z9XA 2H59A 1GRNA 4RB2C 2FZ4A 2DY0A 2XA9A 5CB4A 4DQUA 1XD9A 4MYCA 1G41A 4TGLA 5E6SA 2CLSA 3RYFA 3A14A 3TTTA 3I92A 3ZCQA 1XWIA 2E36A 2Y77A 5DHFA 4XRMA 4GDFA 2FPIA 3NT2A 4HB0A 2DUJA 3CB4A 2FI1A 3F2VA 2B61A 3ESQA 1IY0A 3NGLA 1CYEA 4X1EA 4LCBA 5GPBA 2COBA 1L0OC 2RDMA 2OUMA 3EPLA 2QN2A 1IRZA 5B12A 3QJYA 5EGOB 2GBYA 4F11A 1H0KA 2FW8A 2MH2A 3K0LA 3WDKA 4UOQA 4WLNA 2REOA 1CUWA 3MWJA 3DGEC 1O97C 3ZEIA 1LNQA 3D4IA 1KDTA 3OYAA 2WJWA 5CAEA 3CUQA 3G2BA 1FDUA 3H1FA 1F2TB 1TI7A 4MA5A 3DFKA 4PVCA 1ZYUA 1QAQA 1DRWA 1G8HA 1CERA 2ZVPX 5AM3A 2ZIUB 2J85A 1GITA 3KO8A 2BEUB 4LG0A 4Y2TA 2OV1A 2OPBA 4RGQA 3I6ZA 2P6NA 2GN2A 4KOAA 1OISA 3SYNA 4DRYA 5TJHA 4YIRX 2XYPA 1CUSA 2O48X 1I1SA 1JQLB 1PVEA 1Y3CE 2HL6A 2ZTLA 1P29A 2PH1A 2V7BA 1RJFA 1JGTA 1AHPA 1KFCB 5IMSA 2BFCB 5FD6A 1FNDA 2DFEA 3QVOA 3IEUA 1FXWF 5CVVA 1U7HA 1RTKA 4OLBA 5DPMA 4FFSA 3BF7A 2C83A 1R6TA 1IXRC 4GX2A 1PSZA 5I9SA 3D8HA 4EYKA 5TRTA 2JIZA 2PXAA 3GEGA 5DM60 3GLHA 3PXCX 2OPTA 4HC4A 2IKSA 2OUIA 2XGDA 3KV1A 1R0SA 1XV5A 1PVVA 3LT4A 3BZWA 5J8FA 2H2FA 2L4MA 3OETA 3AR4A 1YC2A 2JKYA 2JW5A 3FA2A 5IT3A 1J06A 4OXKA 2X1EA 1CS0A 6ABPA 1H65A 3G88A 4YDRA 1HH4A 2EWVA 4DR6B 4QATA 3GF2A 2FPGA 4QVKA 1MTOA 4YRPA 3JZIA 3I09A 3ZQGA 1WP4A 5I9TA 4DIQA 4IHJB 4A15A 3FFWA 4JC8A 1MQ9A 1WEKA 3AOEC 3L8MA 3ZK9A 4B4KA 1T5IA 5C31A 2C5EA 4F7WA 1ZLJA 3VSBA 3IKTA 4G12A 1HTTA 3H04A 3ANMA 3KQMA 4ER5A 4TKMA 4KR6A 4B3GA 3OIVA 2ZO4A 4PJNA 4DA0A 1I9CA 4LYYA 5F5LA 4YC7A 4NBSA 4UVIA 4DM7A 5CIQA 2RONA 1IHUA 3BWEA 4TYPA 4FDAA 2N8GA 2FGKA 3U1KA 4N8DA 3FETA 4KDCA 1FFDA 1JJ7A 2ZP1A 1G7RA 2GYVA 3ZH2A 3CRQA 3UFXA 4HATA 3M6FA 2EFQA 1MH3A 4Q18A 1YQTA 4QRHA 4OLJA 3IMEA 4M8IA 2QL9A 4G8JA 4I4IA 4E2FA 2QU7A 3I3OA 3MT9A 5AW1A 3WAJA 1IRFA 4TZKA 1PIWA 1ETQA 3L2WA 1CR2A 4POOA 1EQUA 4FDTA 3CLVA 3R41A 4N9QA 4CEHB 3ITDA 5LLDA 2QMEA 2P5SA 3V7CA 3SYTA 2F64A 2QLTA 2FSFA 1KO1A 1X4OA 1S5PA 1N8NA 4JI7B 1WF6A 2YFHA 3E22A 3AR6A 3L4BC 3R74A 1OWLA 3VVBA 4KIBA 3HCBA 3EMVA 1N57A 5KYXB 1YZQA 1O95A 4HOBA 1NVTA 1Q7BA 1BO6A 3ZQCA 3G0GA 5A7GA 3HOWJ 2HHAA 5FBWB 3DDHA 4B4VA 2LKCA 5FLXK 4J0JA 1L3BA 2IEZA 4FJ0A 2HTSA 3ZWKA 1I3NA 5F7JA 1HYEA 1QQBA 2NTJA 1UWVA 3DTVA 2HYFA 3HTSB 3DMFA 4M71A 4FHZA 2F1KA 3U3ZA 4X1KB 1ZUIA 3EY9A 2R7QA 5HLIA 1HQKA 4G67A 2QTWB 2EBIA 1G16A 1GTMA 2V7WA 2A2ZA 1ZITA 5ILOA 4QZVA 2XVZA 5BYKA 1FS4A 4IX1A 2BY4A 4Z7NB 2QUZA 5KUTA 1SN7A 2DFIA 1I0IA 1R37A 3QXJA 2WM2A 4RCVA 2O7QA 4LXHA 4E7LA 2WD9A 4ZRMA 2NTYC 1J09A 2GA1A 4YONB 2UXXA 3TYXA 3ZMTA 2W4QA 2Y4NA 3GLGA 2OO5C 4JP8A 4HNTA 1Q2UA 5KJ1A 2NZ8A 2BGNA 1QIFA 1JALA 1U8CB 2KIMA 3EUFA 4Q9DA 1NSFA 4YWHA 5GAGJ 3F9RA 4KFUA 1WPQA 1YQWA 2O54A 2ACJA 1QHGA 2DCMA 1UOPA 2GN1A 3F1LA 2FPPA 1IWBB 3ZJUA 4CE6A 3ECCA 3GROA 4QBIA 4K2HA 3C7DB 3V2HA 2AXQA 1RE1A 1W581 3ZQIA 4MAMA 5E4JA 1AA6A 4D3YA 1B0ZA 5AI8A 4E7KA 4CCLA 3FB4A 2FK8A 1DKNA 1QYWA 5KB3A 2XAUA 3B1WA 1UM9A 3WU2C 1U0RA 4G5RA 3FBGA 2VYCA 4OA8A 3PQ5A 1VGRA 1IBKB 1JI3A 1PLKA 3ENKA 3FD8A 1NTCA 1T8PA 4CPDA 4M9ZA 2ZRLA 4C6HA 1NT2A 1W7AA 4XTRA 4DSZA 5L95A 3GJ5A 2REQA 1Y8ZA 1ZI9A 3CEAA 4EMUA 1R0LA 2RG7A 3A3YA 1AZTA 1JTEA 2BFDB 1V6AA 3BDDA 4ZYEA 1T8YA 1D0IA 2MHCA 1GV5A 2FTKE 3E2PA 3I0MA 5CEFA 3AJ8A 4DE5A 3K71B 2QVOA 3P9IA 4I2OA 3S68A 5C3MA 1XRRA 3PWKA 3GBPA 4I81A 3L46A 4O1MA 2QUIA 3PC4A 3LQ2A 1L7QA 4RTJA 2HT1A 3TZHA 2PLAA 1DBSA 1ZG3A 2C00A 5B1AH 3CP8A 1SU7A 1ZZGA 1RRJA 2B9SA 3A0HC 4FMBB 4KO4S 4NE9A 2YHBA 5HM8A 1FJHA 3L1PA 1J9IA 3ZPLA 1O77A 3HY6A 4MTCA 4ENSA 5BUCA 3EZXA 3KP2A 3DUFA 1PGQA 4GMXA 4LWZA 1XDUA 4GPAA 1PT6A 5C8DA 3E5XA 4JELA 1V7CA 3HUUA 2GOMA 1TAGA 2F9LA 2YVLA 4R84A 5FEUA 4UXIA 4GXRA 1ULHA 5I3CA 3HCNA 4BLRA 2ZE5A 2RHJA 4B6EA 1Q84A 2VI6A 3MJTA 1DG9A 2AF4C 4D9NA 4I6JA 3A70A 4NFYA 4RGYA 3OE7A 2PJRB 4CLRA 3I9NA 1WXFA 5JZBA 1JH9A 3OYIA 3CH4B 2JDIA 2FX2A 5LBIA 2X0JA 4IHQA 3SBXA 1Z15A 5FULA 3LX5A 4JK3A 2YN2A 3PGXA 3OPYB 4F21A 4B74A 4AC0A 2JVIA 3G2NA 4OTZA 3W8RA 4G26A 1D2HA 5EUQB 4XQEA 3N6VA 1LVGA 1D7AA 3HNPA 3NHFA 1C9KA 3ECHA 2Y9PB 3KB8A 1H8ED 2E2HJ 2YBEA 2EZHA 1UJMA 3G5TA 5KDDA 3AHJA 3COPA 4DB2A 4OJYA 3OQHA 5A5DA 4P0TA 5LHGA 4HDMB 2MMCA 2R6CA 2TMKA 3W4JA 1TFUA 5AKEA 2C7PA 3LBFA 4ENNA 3OA0A 4I9UA 2A1TR 4OOIA 3BRCA 5EIFA 2CDRA 2PX4A 4ZKDA 1PFKA 4GH5A 3C3DA 2YFYA 3JQBA 4LFBB 3RSQA 4JU9A 1ETWA 3AG4H 1CRWG 4LLGF 1CUXA 3HJNA 3TJZA 1BI1A 1ZM2A 2FMHA 1BL0A 1TX4B 4L9TA 4NIMA 1ZAOA 1MV5A 3CNHA 1W4LA 1M34A 1BJZA 2GD1O 1GRCA 1WMSA 1KAEA 4K2EA 2CCKA 2VKEA 4Y1EA 1VJ1A 1Z6PA 1VI5A 2Q6IA 4YJHB 4HJRA 4ER0A 4BQOA 3I0ZA 4YT8A 5BMVB 4X0GA 7REQA 4EJSA 3K09A 1NK2P 4JK1X 4I4NA 3ETCA 1W0TA 3INRA 1JUDA 4MUKA 1XMXA 2HTEA 1OYWA 3SJAA 3L8ZA 3SE0A 4AF8A 2ZREA 5BT9A 4UTPA 1ZCAA 1WW2A 4IJMA 2CJXA 4KQGA 2BGRA 2L9RA 1G3YA 2CHVA 4KC0A 1FYVA 3CLTD 2H3EA 4G94A 3RBAA 2XITA 1NOJA 1RBMA 2VCHA 4NQZA 3D5RC 3NWTA 4U87A 1FUUA 4XPIB 1YAJA 4F4HA 2XBMA 4D0GA 2Z56A 2H1WA 1X7ZA 1TMOA 1E2QA 2FHSA 1M2GA 4R9NA 2XRFA 1HLVA 1RZ4A 3MCUA 3S2WA 1RW4A 4HEQA 1Y1KE 2RD2A 3HN6A 3KP1A 1KC1A 2GLUA 5GV7A 1KMHB 4WTOA 2XAJA 1GPWB 3WB0A 1KH1A 3EIOA 2P5UA 2PR2A 2DKOA 1FFHA 2V5VA 1O3RA 1V11B 2GPTA 3EUHC 1A2KC 3W2WA 3QHAA 2CW0F 2UUBB 1PJLA 3GN1A 1ISGA 2Z2XA 4LHVA 1RAHA 4Q3EA 3ZX5A 1YZVA 4ZCQA 4YBZA 1DIHA 2OM2A 3OCUA 4CI9A 1KJ8A 1FDTA 5FKMA 3S2FA 5KWIA 3HXKA 4O4LF 3S27A 3GQBA 4D8WA 3OURA 3GIDA 1EA5A 2WU1A 3E9EA 3PDIA 2OHGA 4HADA 1PDWA 1VG1A 4UM9D 1OI7A 1V3TA 3UQYS 2V7EA 1XLWA 4WCDA 4GDMA 1A9TA 2D2IA 4EFNA 1EBFA 3MWFA 1MRSA 2XPCA 2HHCA 4MS3B 4PZEA 1H3EA 4BMZA 4MVCA 4HH3C 1OR7A 3FAKA 2ES4A 1R5BA 2TYSB 1X7WA 1DUXC 2IF2A 1FS5A 2BEVA 1H0RA 3KSDO 2PU5A 1QZYA 5KWEA 3QWAA 3CX8A 1O3QA 3CO5A 5K0FA 5DGTA 5FBLB 4YRRA 3OFKA 2F5VA 1VQKI 3LO5A 4OH7A 4G6QA 4NV3A 1NW6A 3M6XA 2VHCA 3HPQA 5I6DA 1CJSA 4TV8B 2XTNA 3RE1A 3M4JA 1JL3A 2AE1A 2RCNA 3RPEA 4XSZF 3KDPA 2WWGA 3P0IA 1XZMA 4O4HB 2UWMA 3DMNA 1Z35A 4HX5A 2JJQA 3HI4A 1H4SA 4RKQA 1HURA 1L5QA 1HF0A 3L2QA 2FE3A 3SZPA 3CN7A 2AEMA 3P2YA 3CONA 1VKJA 1EQ2A 1NU6A 4Z4CA 1QHEA 1MD0A 3GNTA 3H5WA 2FBIA 1FY7A 3JQ7A 4EMBA 2NP6A 1IB6A 3HXLA 3P9KA 3T1YB 2JHCA 3CINA 4RMJA 5FKOA 4BL0B 2VI5A 4E94A 2OCYC 4JCOA 5KTOA 1QIJA 2YFQA 5DCLA 4DLSA 5FIUA 4DZTA 4E22A 2M32A 5DHPA 4JEHA 1XT6A 3ROZA 1L1EA 5C1DA 4U5XA 3NOQA 2H4XA 2GCNA 1C29B 1GGMA 4BBRJ 5I47A 2D1YA 4G5FA 2UZAA 3Q0UA 3AINA 4NTZA 1T95A 2GFHA 4FT2A 4EY6A 1JRLA 2Z2SB 1AUQA 4RD4A 1K27A 3C2BA 2CD9A 4X00A 4HQEA 3MERA 2JCXA 1ZOOA 1HEIA 5DDIP 2M4GA 3K4JA 5EZ6B 3C14C 5JG7A 2FD5A 2GAJA 1Y6IA 1ZNZA 3NNSA 2B7CA 3FXOA 4TVKA 2PUCA 4P3NA 1NFRA 2JL1A 1UEXC 1F06A 3D9QX 2CXQA 1KBOA 4KLRA 2HDWA 2PNJA 1QGED 4NY1A 1M0EA 2R7NA 4N12A 4BJTA 4CLOA 2O2DA 2STTA 1NBAA 4X3OA 2DBYA 2UXNA 1XL0A 3I4PA 1A36A 2HRRA 3C2GA 3PDJA 3ZW8A 5HR5A 4S1WA 5EY5B 1T4DA 4EDHA 4DIKA 1YRHA 1W34A 2Z43A 2BJHA 3OAAA 2P77A 4KT5C 2CW5A 4LRWA 5MN4A 2VLAA 4NAHA 3BCUA 1MAVA 4RF5A 1C3OA 4O4IB 5L3RA 2L18A 3SXUB 1YZLA 3A25A 3M8JA 4INAA 4AAYA 1Z9CA 4BNVA 3DDZX 3T06B 2FJ1A 4O1IA 3JRAA 2D4HA 4YCAA 3ESRA 4DCPA 1TVMA 4G01B 3V8LA 1RXCA 1H0SA 1WKVA 5KWJA 2BI8A 1COZA 3HM9A 4BWGA 3FUWA 4EYOA 1KFJB 1KU0A 2HN9A 3EQ9A 4XYGA 2M7BA 2H27A 3MHTA 5FDFA 3LZ6A 3HFGA 4RK1A 4EV0A 2RB5A 3QOEA 1BRMA 2AG0A 2SECE 4XQCA 1UMKA 1D8KA 3FPSA 4Y0AA 4EJ6A 4J6FA 5HX7A 5K3EA 2HA7A 3EA5A 3G3ZA 1KARA 4EO9A 3Q0WA 3GCDA 1TEHA 3LHKA 4WL0A 1RIIA 5KPJA 5AKYA 4E4TA 3LA2A 2W2QA 1QF6A 3L1HA 2NVXJ 3UOAB 4RULA 1DCTA 2PWAA 2Z1NA 1PK7A 2NRAC 4JC4A 3OQIA 3PVZA 5KJCA 1U0BB 2VN2A 4QDUA 2RHLA 4R9SA 2YV3A 5SZHB 2VXZA 3CNNA 4QPNA 3VR6A 5CK4A 1MZBA 4GU5A 2Y0CA 1KR2A 4PLHA 5ALFA 4K0RA 4RPKA 4YRJA 4AP5A 1NQTA 5JLAA 3QRWA 3OIOA 2HADA 2XR1A 4XKCA 2VHVA 4I99A 3LOUA 5KAIC 3RI4A 4LJ6A 3GFSA 1EHYA 1PR9A 3A4YA 1PR4A 1DPUA 3IEKA 4AZSA 2OKCA 4WK8F 2RJNA 2I9KA 3PQ8A 1KOJA 2QE7D 3NW9A 3HBFA 5HA5A 3WYEA 5HIMA 5ICSA 1X86B 5AOCA 1U2PA 2PS1A 4MQVA 3TLZA 1M1ZA 5FWYB 1H5UA 3SY8A 2ZUBA 4KWCA 3RAJA 2W00A 4Q82A 1A5BB 1AS0A 1R27A 2Q2NA 2CUEA 1YHNA 3GGJA 2IW3A 4UAVA 4WT7A 4CLXA 2ON6A 3K2BA 5MGNA 3C8MA 4UOEA 1TMGE 4DR3B 2P5TB 3U17A 1KGDA 2WPDA 1KQ8A 1YU6A 1R0RE 3ENVA 1U0OC 3ELDA 3LCJA 1XD7A 3CR8A 4WRRA 4DBLC 3R3YA 3P71T 2WFZA 4U9HS 4YRZA 2ZWAA 3BTSA 2IPOA 1K4MA 3AZPA 4AZ3B 5TARA 4DMGA 1QH1A 2QJOA 4M89A 2I34A 3KKOA 4WGFA 2PX8A 5I7VA 3DXZA 1V16A 5F33A 5J1YA 4EJ0A 1E1LA 3ONQA 3THXA 2R86A 4E70A 2CLKB 3ESCA 4UREA 4WDQA 3DBLA 2DBBA 2QAGC 1SMYF 5EXDA 2XSZD 4ZYHA 3WSVA 4XKVA 3DL7A 4H7FA 3RUDA 3KZNA 4EGQA 5J1TB 5JC1A 4HV4A 3SBOA 3L8GA 1QP7A 4ZEOA 2HQNA 2P7CB 4EFKA 3L7AA 3F4LA 4LCEA 2HJGA 1B8IA 2E89A 2F4OB 3W0LB 1ZA2A 3EZ6A 2C94A 4MW6A 2BHYA 1WPGA 1YRLA 2MFZA 1LC3A 3U9GA 4HXFB 5FHRA 3E9CA 3UTDA 3JR9A 4TTAA 3HB7A 3KKPA 3AHIA 4K8OA 5EJEA 1N0WA 4H59A 5E6UB 5DN6A 2MYSA 1TW3A 2H94A 3OJEA 5KYVA 4BXOA 5LZ2A 4AG3A 4QPJC 2VE9A 4PSVA 3SSNA 2P6MA 4MARA 2BPOA 3T0IA 1U9ZA 4HEA6 1OWPA 1WTCA 1X7HA 3CEPB 4OL0A 1OH5A 4IOJA 2Q5QA 2PHZA 2JB9A 3SJCA 4EKNB 3OT5A 5BUZA 3LDHA 3PEEA 4FCVA 4BN5A 1KBQA 4UUBA 3OLCX 4QOGA 1YCFA 4PZPA 4D4GA 3JD0A 2Q07A 4G09A 2LIVA 3TLYA 3K8YA 3DMTC 2FVYA 4DMRA 3G2JA 1GKYA 3F90A 4D45A 4MV6A 4BEVA 1B74A 4YIKA 2C84A 1VKOA 1E60A 2ZYTX 1LKZA 5F1KA 4J0DA 3C1AA 3MJSA 3IVXA 4WWHA 4H1VA 3DV8A 5JPCA 1VJDA 4M72A 2B35A 2RGAA 4MA0A 3K9GA 5CDUA 3GW8A 5DYIA 3NTOA 4QOFA 3G23A 4ESVA 3T52A 2NYUA 1DC4A 2VBCA 2W57A 4OBBA 4UNSA 3UKDA 2Y1GA 3MS2A 4EKEA 5B4TA 4HWRA 1G5RA 3ZY2A 5CFPA 5IYBJ 3IV5A 2JA1A 2WIKA 4B09A 3V5NA 2GEFA 2QK4A 3HFSA 1YZNA 4AUXA 1D09A 1M6VB 1E0EA 3BFVA 1H3FA 2G7UA 1DFGA 2IYRA 1XFDA 2HU7A 3FN4A 3RVPA 3MRTA 1ZIYA 1EKEA 3Q5FA 3AKEA 2PGLA 3PC8C 2VK8A 3GFTA 2ISSD 1HA3A 4IP0A 5HKOA 3HJFA 1OZGA 4E07A 4G0QA 4TVBA 3CUSA 3OYBA 4NFSA 1Z4PX 1NMXA 1T2AA 2JANA 4Y98A 3ZE7A 4KA4A 3IQZA 5DF1A 4IHXA 5DB4A 4DCVA 1RPJA 4Q3LA 5D5UB 3GHYA 4F1WA 4WKGA 2L02A 4ZYZA 4NENB 4W5QA 3R6GA 1BAPA 1KO4A 1XRMA 3QVJA 1V8BA 1BTOA 1VECA 2C0CA 4JC5A 2FN9A 1IVSA 2PCLA 2REXB 1XZIA 1XZCA 3RK0A 5FLEX 1EZ4A 3VXKA 1ES9A 4CGZA 1EFHA 4J90A 4A36A 5ENZA 3LLVA 1YFLA 1RKBA 4BFVA 4Z0HO 2ECFA 4FBLA 4V0ME 2ONZA 2FA5A 4N0BA 2MBFA 1EXNA 4A12A 2I3GA 3BH7A 2M2EA 1YTYA 5KC8A 3V3KA 4YGYA 4Q24A 3AR7A 1P9QC 3VUFA 3R8FA 4E5VA 1JHYA 1UDWA 4PS1A 4CLDA 4BLUA 3QJ5A 4LZOA 4M3GA 1VDMA 4PLGA 2XAFA 2H1HA 4CLHA 1N34B 3WBJA 3C3XA 2ZW9A 3ZTWA 3UMRA 5AHKA 2C1XA 4IXWA 1LDKB 4GC5A 1GEEA 5IAGA 3THWA 4P1WA 1E6UA 4R05A 3QLUC 2DTDA 1KVUA 1W0KD 2ENUA 3S1SA 2AJ8A 5LKAA 3RYHA 1H8AC 4JBXA 2NADA 2FPKA 5G0SA 4IBOA 2VHWA 4TLLB 5F77A 1B4AA 2BFBA 4NU8X 2R9VA 4EG5A 3IC5A 4Q1VA 1EFUA 2LUOA 4JOQA 1EE2A 4BNNA 1OT3A 3DBVO 1G5PA 1HKHA 1GNVA 2H7XA 4U63A 2FOIA 3K69A 3FMGA 4I50B 4JD5A 3ZVKA 2QGZA 2R7KA 3RLFA 1AQLA 4J0KA 4NC9A 3GR6A 5JNLA 3GQVA 3L06A 4XKJA 2QWXA 3CMYA 5DBFA 3ADBA 2I2CA 4G0UA 1ZRMA 1GQQA 4IRHA 4DV1B 2IXGA 3K1TA 3QU5A 1XEXB 3CRNA 1Q1ZA 1RHMA 2XCUA 3FXAA 1G4HA 2H17A 3P8ZA 9LDTA 5IYDJ 1F3LA 4Q1CA 2JC3A 3LSGA 2HIGA 3RJPA 3DE6X 3JVDA 1BXGB 5F2NA 3PLAE 5L6LB 3L00A 4MV7A 5B2ZA 1FMJA 5JNUA 4YK7A 4MUFA 3EWIA 1OB2A 1VLZA 1P31A 2IVZA 3EXFB 3LDGA 4QM6A 3PEUA 4AICA 2I4IA 1YQXA 1F5TA 4LK1F 1TYEB 2WKWA 1PK8A 4C7OB 4XQ9A 4XRGA 5LA6A 3CZ5A 1I2ZA 2HLDA 3Q0EA 1Q0UA 3DMGA 1LK7A 5THQA 4YFYA 2V5AA 3TN7A 4MQFB 2KPOA 1TUBA 2P5YA 5COBA 2W6IA 4RNDB 5KTTA 2PQ2A 3VR1A 4L4YA 1NUTA 4AD9A 5ICEA 1CS4C 1LZKA 5LZ8A 1VQNI 4R8KA 2UYOA 4EPXA 5H6QA 5D1HA 3OZIA 4C78A 4I5EA 2IDMA 1Y9JA 5K05A 1KDZA 4TS3A 3BMOB 3OMYA 2RQQA 1R00A 4LXGA 3A9WA 3GARA 3K2AA 3EC2A 4D26A 4F5EA 4MRAA 4B8WA 1BW9A 2ORYA 5C0OE 3GTQJ 1Z8DA 1ZM7A 1KKUA 4H16A 1A3CA 1SOMA 1E61A 2P3OA 1D4OA 3BTUA 3NDPA 1GTZA 2RH8A 4E7HA 3LF1A 3EA4A 2BY2A 4LZLA 3ZZ1A 5D1NA 3TFWA 2VOJA 1ADCA 1EA7A 1FJLA 3ZGVA 4RQAA 3PUVA 3ZGXA 2RH5A 2DRIA 3H6KA 2L82A 2OZUA 2CQNA 4NZYA 4QGGA 3SDBA 4ZZ0A 1ZGBA 5B1SA 4CWAA 5I7EA 2WB4A 3PNKA 4A0FA 4LISA 5ALSA 1F51E 3NP9A 5A2QK 2YUSA 1C9JA 4HDVA 5CJ9A 1V0JA 3BORA 2TRTA 3WQHA 4DOMA 1QU2A 1U2GC 3OIUA 4NQWA 2A9PA 3PL8A 2ZJ5A 2HU8A 5IDVA 5JO0A 3NBKA 2M87A 3AUYA 3DKRA 2YOGA 2X41A 1DIGA 1P60A 1U11A 1W8IA 4YIHA 4TLMB 1IBSA 4JLSA 4OI2A 2WD7B 4O4LA 2ZE7A 4R2LA 1B41A 3AFMA 4L4SA 1KORA 3A0RB 4NYMQ 3IP6A 4GPZA 4M54A 2O8CB 2X5OA 1WHSA 1JAIA 2A0WA 3RIXA 3VSCA 4LYGA 4WA8A 4WWCA 2V65A 3TZQA 3FBTA 5EINA 4I5IA 1E79A 2IHKA 2XGSA 3F3MA 4ARZB 4JJAA 5JECA 1OTHA 1H2RS 3L2UA 4FDVA 5H1YA 1DI0A 1UFKA 3RARA 1DFHA 5DBHX 2W85A 3D3EA 4DEVA 2E1MC 3V8PA 1ML4A 2VJLA 3JATA 5GADl 1T3HA 1FVOA 1FF9A 2A14A 3ICQB 1B8NA 3EF0A 2YL2A 2D00A 1NC3A 3OJFA 3M4OJ 4CQNA 5JAZA 1JUMA 3DH0A 4KYWA 3D7SA 4CV1A 3JQ8B 2IY7A 5HLGA 3E7FA 4N9IA 2R1UA 1GDTA 4R2HA 1QDUA 1HLGA 3W7VA 3GUDA 4RGBA 1M0TA 2F4VB 1U0EA 1NYRA 1MBJA 4RO0A 3PUZA 4ZPXA 4FP9A 4HDUA 3NWEA 1WDMA 5JU6A 1NWCA 5JR3A 3ZD8A 3CSDA 1QORA 3ZXSA 4ZT7A 3ZHQA 4RV9A 2SCUA 3OJWA 4WCVA 3L77A 3AO0B 4XVRA 3U6BA 1QZXA 1DAIA 3JQGB 1ZW1A 5JH7F 3ANYB 4EM6A 2IW1A 1JGGA 4KWTA 2QMQA 5ALQA 3OKCA 1BRTA 1XZEA 4RDUA 4N7JA 1S2IA 1QFSA 3H5TA 4FCTA 1ULUA 1VSBA 2AA3A 1R1TA 3W2EA 3L8CA 4PHFA 2TS1A 4BN4A 4JBAA 4CKEA 3AF3A 2HQSA 3D8SA 2LBPA 3O03A 4CH7A 1EVJA 1E98A 5F5NA 4BJ6A 1C8LA 2B1GA 2VAPA 4C21A 4RSHA 1FDVA 4IAOA 4W9RA 1G3QA 2PRSA 4AJ2A 1I2MA 1NI5A 2GPSA 1OREA 3WLJA 1NVMB 1N1DA 2ZBFA 3T8TA 3ENZA 4P0PB 3G1UA 1YO6A 3Q1KA 3FOAA 4D7NA 4KR0A 1T2UA 1QFYA 4TXJA 3HJTA 3WB1A 4PIVA 4UEWA 2WY2D 1K8ZB 2XDYA 1LDMA 2OBLA 2M7AA 1ZH0A 3VAYA 1UKBA 4WNAB 4BJ5C 4N8SA 4ZVOA 3G6KA 4QTYA 5AR1A 4WCFB 2Q29A 1ZK3A 1G59A 2F2TA 2ZWOA 1JG3A 1UMCA 5TRDA 2X1DA 4PZ9A 1Q7CA 2G80A 3IXLA 2XTAA 2P4EA 1N33B 3A4LA 3HC7A 1NW3A 1OAOC 4I9GA 4JVMA 4L78A 3RRYA 2XQFA 2FUCA 3DTIA 2OA0A 4EHIA 3FUCA 2HBQA 3EXG1 1J5YA 1RNLA 2RNGA 3I9V2 1EMDA 1J9EA 4O33A 3LPAA 4MX8A 3JQAA 1Y5IA 4HNRA 2OHOA 2HW8A 3OOPA 3DPSA 2Y92A 2YCLA 2FPSA 5JXHA 4RJ2A 3ED5A 2EVWX 5GM1A 3T0FA 3KYIB 5JI3E 1FUIA 3DV0A 4GRIA 3DCYA 1XNRB 4B3SB 5IY5H 4CJXA 3RNLA 3KYBA 2N1BA 2WB1A 1X9IA 3V46A 4AKEA 4C76A 3U40A 3GEEA 4PJ0C 3UANA 3GMTA 2WY8Q 4DSNA 3U26A 2NZJA 4XUGB 3ZYZA 1K86A 1Q1QA 5F0CA 4EJTA 3KPWA 1ISSA 2QQ9A 3CC4I 3UHOA 1XB2A 1SQSA 1CGPA 1EM6A 1GPMA 3S16J 2B4TO 1QVWA 1R5JA 2KPMA 1UC8A 2SKCA 4QD3A 1DWQA 1Y1VJ 4U0VA 3GA7A 4AJJA 5HQ3A 2EA2A 2GWHA 4XIFA 1W2WB 5A1JA 4OSEA 4FI3F 1ISPA 3VAAA 4HSEA 2VP3A 4NBWA 1F4PA 3BG3A 1EVIA 2X1MA 2DYKA 1VMAA 3GJXC 1GARA 3E7PA 2L01A 3QUAA 1ETKA 4KXMA 1JAZA 3I59B 1SAXA 1FT9A 3G8YA 4NZ9A 1MGOA 1Y0UA 3ZDYB 2ZYGA 3HCAA 4ND6A 4C06A 1B0UA 1CX9B 2WAOA 1H66A 1VHWA 1TLFA 2Q8QA 3HU5A 1IG0A 1X1QA 5E7JA 2R85A 2P81A 1G7SA 4O63O 4RE5A 1ESMA 3FJ1A 1CDEA 4LFAB 2OUKA 3C98A 4RJIA 1ZI6A 3C43A 2R0QC 1A88A 3AOGA 4RPCA 4ENVA 2ID9A 1TC2A 4JL8A 4FASD 4QULA 4V0QA 3BWCA 3PHCA 3S29A 3D0OA 3AX6A 4RXTA 3GPCA 1RWVA 4E6KG 3HSEA 2YS9A 2A4KA 2XVXA 1XC7A 1AQYA 1P1CA 4IIJB 4B6OA 3GH1A 4WW0A 2EPFA 4CF5A 4DYHA 3I4CA 3C7KA 1XMKA 4G8XA 4XTCS 5A4JA 1YB6A 4B4CA 1N0UA 4PG4A 4DIFA 1AZWA 3E0JB 5EWJA 2RB4A 2QT1A 4HXYA 3A6EA 4RZ3A 2JLSA 4DA6A 2JBWA 5EPEA 3ZNOA 16PKA 4LPSA 4QUBA 5LR6A 3AM4A 4W1QA 1E89A 1ISJA 2OT3B 2RHCA 3GO5A 2CUFA 1MF7A 4CSWA 4NDLA 4BQIA 1IM8A 1SUWA 2ZZNA 4OATA 1DXQA 1WVMA 2HLHA 4E6PA 4R31A 1TWCJ 4L0CA 3RRMA 1DOZA 1UC9A 3A1TA 4CV3A 3CF0A 4ER7A 4HDNB 1CE8A 4ETIA 2R7LA 3EUAA 3ESAA 2BHRA 2WOJA 2P6UA 2AQFA 2XA1A 2V79A 4I1OA 1PQWA 4J91A 5DTQA 3PQ6A 2C9BA 5B3JA 1L5LA 4DLUA 1CUAA 3KZIC 3WGHA 2WYOA 1T2NA 3HJCA 4QXPA 3JARB 4CKBA 4C04A 3E6CC 4N5MA 1W73A 1D9XA 4ZU3A 5IVPA 3CKMA 3EULA 4PIPA 4DPKA 4K0KB 5ALYA 2IX3A 4TSFA 2I67A 2ZRJA 5FNVF 1KA9H 4ZCSA 5JHHB 1KJJA 5JFOA 3NHYA 2D62A 3CUVA 2HA4A 3HBLA 4RX1A 3ZQ7A 1PZMA 4URZR 2GHQA 2V8BA 3SXPA 2HWXA 4QX6A 5KNCD 4CBVA 1HA8A 3TCXB 2Z1DA 2W25A 3I1IA 4C6SA 5CP8A 3O84A 5BPIA 3ZZMA 421PA 3FWYA 1S2DA 3SC2B 1S29A 4JWKA 5KBYA 2AFHE 2ZJOA 3K4BA 4EOGA 4WKPA 4F6RB 5TJJA 3SZMA 2C31A 1M2EA 3BL6A 3SIRA 4XYLA 1SQFA 3EEFA 4PPYA 1JHOA 2ZJ4A 4EYQA 2XYQA 4JI8B 1BYIA 3QPBA 2V6JA 1YR2A 1WIWA 5BOXA 1A71A 3Q40A 3SJ7A 2XJ4A 4A69C 4D25A 3QTLA 2UKDA 2EEZA 3ZY5A 4M0LA 5DGIA 3LUKA 2QM3A 5DXFA 4ZT5A 2X6YA 3IBYA 3RHTA 1OXMA 1GT0C 1ADJA 4F3RA 2X86A 1VB3A 4BQPA 3ROUA 3W2GA 5DGXA 5K03A 1QRSA 4L72A 1SXPA 1LRKA 3X1ZA 4IGAA 4KMOA 4D9GA 1J7JA 1LS6A 1GG2A 1O94A 5L51A 4L5EA 1YMVA 1P17A 1FBQA 1RXSA 2BOVA 2VXCA 1HMPA 4MYHA 2E3JA 3EC7A 2R1TB 3NJ8A 821PA 1XPXA 1XZHA 3AHCA 1R8SA 1CUZA 1QIGA 3FE2A 4CEJA 1MNAA 1R3DA 3E03A 4A92A 3TUZC 4BGUA 1G9TA 5CYFA 4ZOAA 3W6VA 4R1QA 1DDGA 1XX5A 5HKBA 4E4RA 4YLYA 1NRXA 3C5VA 5JNSA 2OORA 1I32A 5G3YA 3MFYA 3PL1A 3ND5A 5L3QA 3MCVA 5DSXA 2PZGA 1NHGA 4GKAA 4M2LA 2CXNA 4OGWA 1ADBA 3G9XA 3P9ZA 5EZYB 3M5DA 1CP3A 1NXVA 1Z7BA 5JHFA 2H65A 3ZTYA 2CGEA 1FJGB 1Z05A 3UYLA 4RU1A 4B0PA 1MEOA 2PU7A 1R8YA 2WTMA 3QWFA 4HTFA 1LBSA 5DUKA 4QIWN 1R88A 2IJGX 5CCDA 4HO1X 2NU9B 2DUWA 2XF7A 4V2UA 1UC5B 3GN2A 3NDRA 1XXHB 2MJLA 3TNLA 2V1NA 3DOEA 1Q1AA 3PA8A 1EGMB 2WJAA 1ZGJA 2O3UA 2Q4TA 3MTIA 1FTNA 3WIOA 2YC4C 3ABQB 4H0CA 2PMZN 2VKQA 3C3PA 3QYAA 1IRIA 3AR8A 3TM4A 1E5LA 2I9PA 1BCSA 3LT1A 1L5WA 2GRAA 3GRAA 4YMSA 3PQFA 3KWLA 1TLTA 1HKTA 4ERXA 3VH1A 2WV1A 4DQLA 3MWEB 4S05A 2IOHA 1XPRA 4CMJA 5JRDS 2EKBA 1JYEA 5DLYA 4BX0A 2RV8A 3ZI4A 2WRZA 4I0BA 4BXXJ 2LV8A 2PGNA 1G5TA 3NH6A 1YHQI 3N8GA 1Z5OA 2JJ1A 1RRFA 4NYMR 5CVJA 2X9GA 4NJEB 4FD2A 2WSSA 3KJQA 2ELHA 4ZO7A 1EX1A 5K2OA 3R0QA 5HDKA 3EIXA 4WLOA 4A0XA 1D3AA 1HLPA 1A7JA 2XCLA 1H22A 2P7HA 2AHOA 3ZCVA 1B6SA 4NPAA 1THMA 1V54H 1MIOB 2ZT6A 1YFZA 3HOYJ 4G0VA 3KUDA 3QU2A 1CU1A 4ZCPA 4ER6A 4CA0A 3T4UA 1TM7E 5FJJA 1RCTE 4G8CA 1SKQA 2PBFA 1JS1X 2GZDA 1ZGZA 1XTUA 2WV0A 4CKWB 3BKWA 4IF6A 1TGVA 4FQ8A 5FBVB 3IMFA 3OQOA 5CX1A