3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
3P71T 3HRUA 3RPQA 3BY6A 4GYGA 2PEXA 4OINF 5ILVA 5EEGA 3DLCA 4M71A 5LHIA 2EV5A 2Z5UA 3S2WA 4GQBA 1W7PB 5CVUA 1YQAA 3GRVA 1WWXA 4LLGF 2JTVA 2W84A 1R22A 1YW8A 5K0EA 3SQNA 1Y8CA 3TR6A 4HG2A 3G2MA 5BPDA 3DOUA 3ZMVA 1RNLA 3FXRA 3EMDA 2IA1A 4I02A 1KQ8A 4AIJA 3DUWA 2Z6QA 2ZLBA 1KP9A 3GO5A 4P7GA 2VDVE 4FT4A 4HX7A 2CMHA 3F8CA 3HVHA 2OZUA 5LQCA 3WTUC 4U7DA 4QLCU 2NAZA 4OIRF 4CHUA 5E9JA 1B6AA 1MDMB 2XROA 4I2OA 1FC3A 2YX7A 2VDUE 2XVCA 1QZYA 1R8YA 4ZH4F 4MNUA 1P1CA 3E05A 2DW4A 3PX3A 4RSRA 4U88A 2D45A 4ISCA 3MQ0A 4KIBA 2G8NA 2Z9OA 1RI4A 3P8ZA 3IL2A 1B4AA 4EGYA 3OZRA 5T64A 2Y75A 3U9GA 4A6EA 3HSEA 3BROA 1IN6A 2QLZA 3ELWA 2UYHA 2YU3A 4KA4A 1DL5A 4QVKA 3KPWA 3KQVA 4EMSA 5FFZA 5FA5A 3CJTA 2IA0A 5D6FA 5KVRA 3UWPA 2BH2A 5CJ9A 1YTYA 1AOYA 5HDKA 4AZSA 3EVAA 3X0DA 1GVJA 3HEMA 2IH4A 3GWZA 4PYJA 3BWCA 1T0FA 4LB6B 2KIMA 4BP1A 5H6QA 1FNNA 3C3WA 1YFJA 3E7PA 1G6NA 2G71A 3RYRA 3VYWA 3KP3A 4EKIA 1W5TA 3JTGA 5HIJA 4G8XA 2HOEA 1YZ3A 3LCCA 3JWGA 5LQJA 1XDZA 2R7DA 2V79A 3FUTA 2FE3A 4P7FA 5GWXA 2O8XA 4L0ZB 4AVPA 3L2CA 2ZTHA 1P2FA 3RDIA 1R7JA 4EV0A 2DFIA 1AF7A 1ZN2A 2IP2A 3BUSA 1BI0A 2ERCA 3I4PA 3K1PA 3RW9A 3L00A 4PWYA 5FFXA 1G8AA 2IGTA 3JWHA 3OZTA 4YG2F 2KIUA 4FS8A 1XN7A 2UXNA 2NXCA 1MJAA 1ZQ9A 2AOTA 3DR5A 1YFHA 5LQNA 3KR9A 3R61A 2M30A 4YMHA 2VP3A 2IH2A 3GRYA 1R8XA 2BE5F 1EJ0A 4BP3A 2ZW9A 1R1VA 3AY0A 1LEAA 2PV0A 4GCVA 5HIIA 1SMYF 4E2YA 1RUNA 4Y13A 4LG0A 3G7UA 4MHTA 1FZPB 1XDUA 2NP6A 2OA4A 5HS8A 3G3ZA 1EH8A 5D5VB 4IWNA 1LDJA 3C1DA 3WTZA 5BQTA 3HSFA 3DF8A 3KE2A 4E2ZA 4N9IA 4Q5SF 5DUIA 3KKZA 5EKXA 1B1BA 4HGZA 1DCTA 1KPGA 1V4RA 2V1XA 3K0LA 1F5TA 2NXEA 3J80K 3OFKA 4KDRA 1FLIA 3OZSA 5EGSA 1ZG3A 3M1EA 4UVAA 3LDUA 5DCMB 3DPTA 2EFWA 1RI1A 4QTUB 3MFKA 1SUSA 3CGGA 5ILSA 3WTYC 1DPUA 4HV6A 3WGGA 1JQ3A 2P35A 4WCGA 5DRYA 3GFMA 3F4KA 4HLYA 1EIZA 3FPEA 1TNSA 2R3SA 2CG4A 1Z9CA 3Q9SA 1WXXA 3FM3A 2PT6A 5HLGA 4CXMA 1T39A 1REPC 3TO7A 3EVDA 2DI3A 5ICCA 5E8JA 4WXHA 4DCGA 1U5TB 2PQ8A 3Q5FA 4F85A 3G5TA 1R74A 3CBGA 4EJUA 1RJFA 5EEHA 1P4WA 2MC3A 1S3JA 2QYOA 3M6XA 2I6GA 3J81K 2XAGA 5E1WA 5ED4A 1NW8A 4M38A 5K1YA 4C08A 5L3CA 3O4FA 2PX5A 5T67A 5HOOA 2XAJA 4IRHA 1G6Q1 2YTZA 3KEQA 5E8RA 3RODA 4HX4A 3ORHA 3RKXA 2Q41A 2ZIEA 2OPBA 1YW9A 3RJPA 2IRFG 4Q47A 4KMUX 5HIKA 1RJDA 2YXEA 5DPMA 5FTWA 3GGDA 1LVAA 3CUOA 3T0YA 5GIPE 1O57A 4IRIA 2FBIA 3K1NA 2FSWA 2BZGA 3WU1B 3A7EA 4K6MA 3UJDA 2WV0A 2XAFA 3F6VA 1FJXA 4LMYA 5CCBA 1XGOA 1CF7B 5E9WA 5H20A 3LECA 3NJRA 2DPUA 1TW3A 2A6HF 2UZKA 4PYNA 5MHTA 1QANA 2AN3A 2QRVB 1K78A 3P97A 2FNAA 3TQSA 3BWYA 3HCCA 3GZ5A 1X3UA 3KZZA 1U78A 3CDHA 4RGRA 1UB9A 3MAGA 5DUKA 2P5KA 5CIYA 4D0PA 2ZBRA 2PX8A 2K86A 4ZYHA 5K5RA 2LKPA 1R5HA 4KIFA 2HR3A 2GB4A 2K27A 3TQNA 1BKYA 2NNYA 4U0YA 4R6WA 4KN7X 2EFOA 4IPAA 1ZYRF 3KQSA 3WG9A 1NKVA 2P7CB 5CVJA 1M6YA 5D1HA 1DP7P 1WRJA 3ELKA 3EETA 4A6DA 1Z6TA 5EQJB 3NDIA 2W57A 3SHFA 3GDHA 1OKRA 1VLMA 1X19A 1IN8A 5F6FA 2N47A 3ER9A 3I64A 3CCFA 4ATNA 1TNTA 3P9IA 5D5WB 5BP7A 4KWCA 2HNKA 1SQGA 3V4GA 4PYIA 4YMGA 2HFHA 3I58A 1IAWA 3WTWC 3DFGA 2DK8A 2FMYA 5ICEA 2BR5A 1Z3CA 1ZG1A 5D4RA 2CL5A 2EB7A 2FMLA 4BQAA 5EMMA 2ZCWA 4OX9Y 2UWMA 1ONVA 1WZNA 1RI7A 2ACJA 2OD5A 2JT1A 2VN2A 5DM1A 3ECOA 2P5LC 3EEYA 4LK0F 3HTSB 3GO4A 1UFMA 4ENJA 5JI6A 4AD9A 4RGXA 2IT0A 4FGZA 2EFJA 5K01A 1N2XA 4BNCA 4TV7A 2G7UA 4YV2A 2M8EA 2UYOA 5DSXA 4H0EA 4QVGA 1GHCA 4L9JA 2HDCA 3R4KA 4WXCA 2GQQA 2FRXA 2JSCA 1T2KA 2PKWA 2Q2EA 1VIDA 1IY9A 1YFLA 3M9AA 4X60A 2YUIA 4OIPF 4P55A 1SQFA 2JJQA 3DTNA 2ESNA 3GFJA 1ORHA 1AV6A 1EH7A 3JTHA 3EVFA 5ERGB 3VSEA 2GLUA 1RIOH 4KUMA 2FBHA 2C7PA 1XB4A 3HRMA 2JPCA 1WY7A 4JXJA 1B42A 3R6SA 1ODDA 2YX1A 3IRQA 3QU3A 3C7JA 5HILA 5L3BA 4ZYEA 2Z3YA 2MLGA 1HKSA 1JG2A 3LDFA 2OBFA 3M70A 2C7QA 2EFPA 1XD7A 2X0LA 1O3RA 1OPCA 5CYVA 5A2QK 3NTVA 5IKMA 4O6JA 1IXKA 4HGYA 1P4AA 1G55A 1C0WA 1XGMA 4GXOA 4FR0A 2XHKA 3BJAA 3SZPA 3SSOA 2C6YA 3MGGA 1FSEA 1KXZA 4XRFA 1FBSA 1VPTA 2FK7A 4AZWA 4WX9A 1I5ZA 4CO8A 5FD5A 1TW2A 1L3IA 2VDWA 1LB2A 3BWGA 5FUBA 3VFZA 5E1DA 4HF0A 4A0ZA 4E70A 3HA3A 3JAMK 5ICFA 3HTXA 1U2ZA 3M8FA 4Y17A 3UJCA 4NQWA 2JHCA 4S05A 1VBFA 1WG8A 2STTA 3HCEA 1R5GA 5DD8A 1QNTA 5EIWA 2I62A 3IHUA 4P96A 3CC8A 2NRAC 4WXDA 4C04A 3HOSA 2DULA 3BZ6A 3B3GA 4M37A 3DP7A 2PX4A 4HQEA 2HKOA 1EH6A 2O06A 5CVVA 4ASNA 1G38A 2VT2A 1G3TA 5CVRA 2MBFA 5CVEA 4O29A 1XXLA 4M6YA 1BHJA 3BXOA 3CVOA 5K0GA 1FY7A 3C3PA 2P8TA 4HAMA 2PI0A 4GYIA 2ORED 2XV4S 3QAHA 5GM1A 1FBUA 4ER6A 2DQLA 1VQ1A 1ORIA 2KW5A 4IRGA 5GM2A 1TQPA 5LBQA 5EMLA 4DF3A 3GFLA 1XDSA 5DX8A 4G7HF 1NBHA 4KRGA 3RIRA 1BN5A 4IVNA 1F1ZA 1JTFA 3HA5A 5K5OA 2B0LA 1I1SA 5CUQA 1CGPA 2XGXA 4YFXF 2AS0A 3FXQA 4HW0A 2R6ZA 2QBYB 1ZRFA 4DA4A 1HW5A 1XSDA 1HNNA 4QDKA 3P9CA 1BJAA 2IA2A 5IT9Z 2OKCA 3OCJA 2FEZA 1BI2A 5LQUA 4L9VA 3BJ6A 1NW7A 2Z6AA 3B02A 1SD5A 4G6DA 4KW7A 1W7PD 2A69F 1SD4A 2G70A 2YR0A 1J2XA 5ILUA 3ZQ7A 4HDUA 2H6BA 2PVCA 2YVLA 3ZP5A 3KZYA 1J9IA 4DNCA 1XCBA 1YYVA 2A6EF 4LLLA 4UVCA 5AONA 4MQ9F 4OBWA 5TJJA 1BI1A 2FHPA 1ZREA 3CLOA 4M36A 3ZMUA 1D8JA 2F5FA 1U5TC 3ZN0A 5KK1A 4WVLA 4POOA 3G2OA 4YUXA 1ZRDA 4CWAA 2LDUA 5K8VA 5DRTA 2W85A 5EZQA 1OR8A 2BGCA 3VC1A 9MHTA 2E5WA 1ZLJA 1XCJA 4Q48A 2NXNA 1BC5A 1AQIA 1XCLA 4U7TB 2PWPA 2QUFA 4EQZA 4Q4ZF 3AWIA 2XRNA 3RPUA 2L4AA 2AOUA 4I0AA 4CZZA 3BGIA 5HZMA 5E1OA 4OA8A 4QTTB 5EHGA 5DM2A 2GXBA 3EPPA 2AVNA 1L3LA 2PT9A 3WTXC 2H09A 5JR3A 3QPHA 3M8EA 2B78A 1MD0A 4A0XA 1M0EA 4A5NA 2Z6UA 3M33A 5IH3A 4DM3A 3HTUA 3HNRA 4RTKA 3QP6A 4R8SA 1JSZA 2RN7A 1LEBA 1YUBA 4ON0A 3OV8A 2DBBA 1F3LA 2B9EA 4RB0A 3ZMZA 4BAYA 4AZVA 4AUKA 4DQ0A 5CVIA 2CFXA 4A2UA 3THRA 1QPMA 3B3FA 4RGUA 4AWXB 2CMGA 5FGMA 2PMHA 4KICA 4NB5A 1O3TA 3UJ6A 1UCRA 1J0RA 3HCFA 3NRVA 2AOXA 1JXSA 4N0BA 2ISYA 3UZUA 2YQZA 3LCVB 5F2NA 2RQPA 2PXAA 5EMJA 3G88A 2LNBA 4X61A 5HFJA 2DK5A 3BDDA 4RTOA 3TOSA 1KR5A 3LAJA 3DXXA 2ZKZA 1OYYA 3WODF 1K79A 2VOOA 3HA7A 4I01A 2Q8KA 3T7TA 3NMUF 1AQJA 2XAHA 1G3WA 1RI5A 3LQQA 1SD7A 2YR2A 3HCBA 1Y0UA 2A5YB 5F2OA 3KQOA 4UV8A 5DV5A 3F72A 2MLKA 4O3MA 3HRSA 3HVIA 2E1CA 2L02A 2QVOA 4RX1A 3MWMA 2VXZA 3VEPA 1BM9A 3DMFA 3MQ2A 5BPIA 4M7RA 1FYMA 3U1DA 3PTAA 3G8AA 3GCZA 3I59A 1JE8A 3FTCA 1T43A 4C4AA 1I6XA 2VZ9A 1TQIA 4IKPA 4P58A 1K6OA 1D2HA 2P6TA 3FUXA 4GOND 3I0TA 3BKXA 4OIOF 2BEOA 5D1NA 4E31A 1KU7A 3LDGA 2BYVE 7MHTA 5L3FA 2OXTA 4HF1A 3E23A 3V8JA 2NXJA 3DXYA 2ZBKA 4PDKA 5BW4A 1I27A 3DEUA 3FHZA 4GC9A 1ZGJA 2XBMA 5EIFA 1R36A 2QY6A 4EM1A 1FP2A 1NW6A 1J7KA 3JSOA 2A68F 1JHHA 3KR1A 4XBFA 3GRUA 1YW7A 3UJ8A 1JHFA 1R23A 1U6GA 3A4TA 1YS6A 4F86A 1T6SA 2O57A 2GA1A 3TO6A 2P7HA 4GGGA 2ZFUA 4R6XA 1BIAA 5E1BA 5FD6A 1KU9A 3L8DA 1R58A 4H0NA 2QRVA 4RB3C 2ONZA 2LD4A 2PLWA 4DMGA 5IT9K 3C0KA 5BW5A 3THSA 5EVJA 4R8HA 2V1UA 5J8FA 4HTFA 1YS7A 3MTEA 2GXGA 1P39A 1QQIA 2P6SA 2PJPA 1SMTA 3E3VA 3LL7A 1X1CA 2ISZA 3Q87B 3J7AO 3M6VA 5LHHA 5G02A 1HKTA 5C1IA 2AR0A 3P7NA 5LQRA 2HV9A 2BM9A 3FTEA 1VE3A 3HYIA 3HOTA 1HBXG 2HTEA 2GPYA 1GXQA 4ENKA 5E8IA 1NBIA 2RDPA 3NQOA 4Y2HA 3OPNA 3TOAA 2I7CA 3CUQA 4KN4X 1WQ2A 4RYLA 3VC2A 2X4HA 4EJVA 2HWVA 2JG3A 3T8RA 1XCVA 1TQMA 3T1BA 3COAC 5DD4A 3TM5A 1V39A 3FUUA 1YB2A 3EGVA 3T5XA 4RTRA 1TLHB 5A2QZ 2VC0A 4MIKA 3UJ9A 2K4BA 4GUAA 4C03A 4YIFA 2PXCA 1OYIA 3QPTA 2AOUB 1D8KA 3H2BA 3OFJA 4PONA 4G6QA 6PAXA 2CW0F 1X1AA 3O2PE 3NWEA 1U8RA 3WU0A 2AOVA 3ID6C 3SFZA 3ZPLA 1S29A 4KDPA 3FYCA 3ELUA 3JAMZ 2ZXJA 3ISPA 2IW5A 4Z2YA 1OMIA 2VE9A 4KVZA 4PCLA 1L1EA 5E1ZB 3LKZA 3OU6A 2O03A 3V8VA 3P9KA 4ZZDA 2DO7A 1QAOA 5DCFA 2B25A 4CKEA 2ZBPA 5KQRA 4YUWA 2WC2A 4R79A 4KDCA 3FWEA 3UBTA 3FPFA 2ZIGA 2GS9A 3VODA 3PT9A 1OR7A 3BWMA 3DULA 3ME5A 2YPRA 1S6LA 2QQAA 3G5LA 4ESFA 1SAXA 1RJEA 3R0AA 1NT2A 4I98B 3FYDA 1IXSB 1ZARA 3B73A 1Z1DA 1BIBA 2Y1WA 4N9HA 2P7IA 3MTIA 3MEXA 5BS6A 4V0QA 3AXTA 5IT3A 4XLPF 3HHHA 4PZJA 3OE4A 4PYOA 5JUWA 2QQBA 3H92A 3RI4A 3V8LA 3IWZA 2HTJA 4YUZA 2W25A 1IRGA 3SGLA 3LA7A 3QP5A 4OMZA 2ESHA 3GF2A 1IZ1A 3GXOA 1TPYA 2EJUA 2EFNA 3F8MA 4HLXA 4CKCA 4K2EA 4LK1F 4U7BA 4L9NA 2D1HA 3CJQA 3BWBA 3H3ZA 5E20A 5FLXZ 2O3FA 2STWA 2MA3A 3E6MA 3C6MA 4C07A 4GEKA 3F8NA 1KU3A 3DKWA 1H9GA 2PMUA 2XAQA 1PP7U 4EKGA 1ULYA 1UHMA 1XGNA 5H02A 1QO0D 4MGRA 2ZZNA 2H11A 2P3OA 2CGPA 2EK5A 3HRTA 3E5UA 3EYIA 1VTNC 2Z33A 5D5UB 3L7WA 1O3QA 1YO5C 5E8GA 1O7LA 3NEUA 5KVAA 3GZ6A 4LG1A 3ABUA 3PVCA 4YFNF 5DTMA 2G7HA 4DKJA 1P6RA 5DM0A 4IHSA 2LF8A 1O7FA 3E6BA 4RVFA 4G56A 4PYQA 2OAZA 1G8SA 1VP3A 5HS7A 1F9NA 3I53A 3TDZC 5D8LB 2IPXA 2NP7A 3C3YA 2R7FA 2IBTA 3I5UA 4RAZA 5KYGA 4UXNA 2XVAA 4HX8A 1J75A 4IV8A 2BV6A 3M7GA 3ELYA 2PJDA 4BLUA 3KP6A 4RB2C 3B3JA 2ZZMA 3WSTA 1R18A 1PRYA 5BOXA 1XMAA 3BOQA 3U2RA 3R24A 2B2CA 1HW2A 3R60A 2PX2A 1MJFA 3F3XA 2CQKA 1SUIA 4G9YA 4B8XA 2O07A 2UYQA 2XYQA 3MERA 2GAUA 3K9TA 1KGSA 2JH9A 3ROUA 4P9UA 3CJRA 4FX4A 3PFHA 4MTLA 2YXLA 1FSHA 4EK9A 2D1VA 5EG5A 4LECA 1IM8A 1ON1A 1U2WA 3RKYA 3WGHA 4EM2A 1JG3A 4JBAA 4LJZF 3CO7C 1Q0SA 5K0JA 1O3SA 5TRDA 3OE5A 4RTNA 2HWKA 3V7RA 4F7ZA 4EJWA 4OBXA 2ELHA 4OMYA 2P7VB 2AVDA 1BI3A 3NVKI 2FXAA 1H9TA 3L09A 2AN5A 4QPPA 2KJBA 1VL5A 3DLIA 1HQCA 3KP5A 1FPQA 1B59A 1HW1A 1E2XA 1MJ9A 2IFTA 5HVQC 1FBQA 4OOIA 3LGAA 2QQ9A 4RWZA 1FT9A 5DXAA 3EVCA 3RKWA 2A61A 2OB2A 1IN5A 1YLFA 3LFKA 1HMYA 5DT2A 5D4SA 4KNYA 5LGUA 3G73A 1NE2A 1KA8A 4XLNF 3ULQB 2OBPA 3TGNA 4HQMA 2QE6A 4BLVA 4L7VA 2WA2A 5E9QA 2RV8A 2NYUA 3CUQC 2HEOA 4UHTA 5DX0A 2VODA 4RVHA 4UOEA 3JW4A 1MKMA 1IUYA 3FUWA 1XMKA 2HYFA 5EMKA 3EMBA 1A04A 5E2BA 2GIVA 5AIQA 5B1SA 3PFIA 4ESJA 3TLJA 2L01A 4XCXA 2PSSA 1JQDA 3HIFA 2K7LA 1FBNA 1KIAA 3IRRA 5HLIA 4A0YA 3FZVA 4L5JA 5E1MA 2L4MA 1DPRA 4HBLA 2NYXA 2K4MA 3R6TA 4QQKA 3EEOA 3LA3A 3FMRA 5LLQA 2F2EA 3DH0A 1J59A 4PIPA 4BYYA 4MEYF 4BH9A 4XUDA 4PGHA 1BOOA 3J81Z 5LRSA 3FTFA 1JTEA 2EV0A 1QYRA 5JHUA 4CGZA 3D5LA 2G9WA 2OZVA 4ER7A 4ER0A 5FQOA 3E97A 2BBYA 1RI3A 2L3DA 3B89A 1M6EX 3I59B 3FTDA 4Y30A 1WSUA 5EKUA 1F4KA 1XSVA 3UJAA 2UXXA 1HSTA 2HQRA 3TRKA 2WWYA 2EWNA 1Z7UA 5EHIA 3WTVC 3HM2A 3WE3A 2FBKA 5LGTA 3ABTA 3KFWX 3LKDA 3MCZA 2XKPA 3BJOA 4MHGA 2PN6A 3EVZA 2UYCA 2XASA 1NV8A 3ZMSA 1RI2A 5EZSA 2HS5A 1LDKB 2OO3A 3EGIA 4U0WA 3A25A 4FHTA 2V7EA 2ZFWA 2QWWA 3V7SA 3A27A 3KPYA 4FT2A 3QOXA 2BR3A 4KT5C 2EV6A 5DSTA 1GXPA 4F84A 3O31A 3IKTA 2ESRA 4PYMA 3HVKA 1H0MA 1X1DA 1UIRA 2E7WA 1FYKA 3PS9A 2L54A 3JWIA 3IWFA 2H6CA 3FXUA 4JQFA 2MD5A 5ICGA 2XYVA 3N97A 1L0OC 1R6AA 3KQWA 2VC1A 1L3CA 2H27A 2ONYA 4OIQF 4CTJA 1D5VA 1SG9A 2CWWA 4BLWA 4PIMA 1R1TA 4RTLA 2FU4A 2HMYB 3EVBA 3T0IA 4AIKA 2CKDA 1G3SA 2O61A 2AOWA 1U3EM 3E6CC 1X1BA 4RTQA 1LJ9A 4HYEA 1JG4A 2F5EA 4M72A 3FRHA 3BPXA 4WK8F 2K4JA 3FPHA 2ZJ2A 4I0BA 3KP7A 4MTDA 4HF2A 3BPVA 1F38A 4PYLA 3B5IA 3ECHA 2QBYA 1SVUA 4WF2A 1ZLKA 3M6UA 3LCUA 2DU9A 4QDJA 2ZZKA 2JRTA 4X41A 4HA8A 3ELDA 2ZMEA 4ZTBA 3OU7A 2PY6A 2WK1A 4IHTA 4E2XA 2P3LA 5FO5A 4ESBA 2XVMA 2MH9A 4ZYGA 1W5SA 3AJDA 1IRFA 2GZWA 3HVJA 2QZ8A 3A26A 4L9TA 3REOA 2O05A 2FF4A 3KQTA 3LSTA 4RGSA 1IF1A 4FSDA 5M5BA 3IV6A 4YUYA 2D2WA 1KPIA 4JK1X 3LBYA 1WXWA 3IC7A 4I7HA 1UFKA 4HZFA 2VT3A 1FOKA 3HSRA 3KQMA 2YX4A 3OOPA 4GC5A 3R9XB 3GX4X 3SR4A 3GLXA 3KR2A 3ERED 4IF4A 1BBYA 1QAMA 3K6RA 5DX1A 2Q0OA 5K03A 1YZHA 2H00A 3BP8A 3LWFA 4XUEA 1SFEA 1KQ0A 2YXDA 1O54A 3LPMA 1P91A 3CKKA 1ZRCA 4MTEA 3GIWA 1S7OA 2DLLA 3FMSA 4HTFB 5C0OE 1G3YA 3MZHA 1EG2A 4L18B 3KPUA 4DZRA 2HYGD 3K69A 3F22A 5K0CA 3TPZA 3PLAE 4RS8A 2CSOA 2DTRA 3M4XA 3UA3A 3FM5A 2ZNYA 4RAYA 10MHA 3HHGA 1I1NA 4ZYDA 2V74B 3P2EA 1VP9A 5FADA 3SZTA 4GO1A 2E1NA 5DTRA 2OU2A 5LQKA 2A3SA 3B7PA 5LGNA 3DXZA 4QQNA 4PYKA 2O0LA 3PFGA 2GA2A 5LRRA 4ER3A 1KHHA 4E32A 1J5YA 5KQSA 1JSXA 3FF5A 3E6DA 4R8RA 3TFWA 2VE8A 5L3GA 5FHRA 2ADUA 3V8KA 2IH5A 3ZMTA 4DQ2A 3VOEA 2FPOA 4OQEA 5F2KA 5H6RA 5K0FA 4A5MA 2CYYA 5HDGA 2M45A 4NHJA 1XTPA 2Y0MA 2GWRA 1HKQA 4PCAA 1STZA 5AIPA 1W7PA 4CKBA 3WGIA 1FWZA 3SMQA 2OQGA 4OU0A 3KQQA 2P5VA 1XJ5A 5EC8A 4BXUA 3C6KA 3K1MA 2KKOA 4RTSA 5J8CA 5DTQA 4B17A 1IN7A 2G72A 2FRHA 3KLNA 2WA1A 1SFUA 3T7SA 2PG4A 4LD5A 1LNWA 4A12A 3GRRA 1ZHFA 1DDNA 4EJOA 1DUXC 2P4WA 2DPDA 3SX0A 4PCQA 1N7IA 2ETHA 5LR6A 1OYWA 4HDVA 4KFCA 4L0YB 2ZWVA 3WE2A 1RUOA 4GOMD 5BXYA 4RB1A 1SD6A 3KETA 3GUDA 2ZO4A 2PLYA 4GF5A 4KYWA 1BOAA 1QGPA 5K09A 3CO6C 2COMA 3EGEA 5LHGA 3EVEA 3NW9A 1YG2A 4MQ4A 3I54A 3R0QA 1BC7C 1I4WA 1MDMA 5FHQA 2CWEA 3BGVA 5FWDA 4HOBA 2CO5A 4C05A 3EDPA 2FOKA 3RYPA 4YV0A 3SSMA 2UZ4A 3CUQB 3FZGA 3G8BA 4IXAA 2XYRA 2BR4A 4MWZA 4BHPA 2RVCA 2AN4A 2JPBA 4QWQA 2VS1A 3OU2A 1ZG5A 1MGTA 3F8BA 3FX3A 2HZTA 3I71A 3GEZA 2ZULA 3DPLC 2JZYA 3LBFA 3TOBA 3V97A 3KHKA 5HDNA 5FQNA 2G1PA 3MAJA 2EX4A 3NVMB 1B9MA 3UA4A 4ENNA 2EFQA 4FX0A 3C18A 4HH4A 1P92A 3O6BB 2C7RA 2FK8A 3ZN1A 4LLNA 1KPHA 3LQRA 4U7PB 1PP8F 1EAMA 2P3QA 1RZ4A 4C06A 4M6XA 3MB5A 1IN4A 5J6XA 3P9NA 3LAPA 3WTTC 3GJYA 1WKMA 3T8TA 3GYHX 3KPVA 3IEIA 1USTA 3O7WA 1JQEA 5CVDA 5P8WA 4PGGA 3H3UA 1P4XA 2P1DA 5EOVA 4E2WA 4RVDA 4YIIA 1L3BA 2OYRA 3ML6A 3SXYA 5JVTA 2A14A 3RTRA 4GOLD 3HCDA 4L5IA 3GRZA 3DV8A 3SXJA 3AXSA 2ZVJA 4YUVA 1UWVA 4LG0B 2VBZA 1ON2A 4XUCA 2V9VA 3BKWA 4M9SA 5DLYA 1USSA 1XVAA 4HC4A 3F6OA 3BGDA 4ZZLA 1PUEE 2V6CA 1H1DA 1KU2A 3KR0A 3JWJA 3TM4A 1EV7A 2ZBQA 4R05A 4P9FA 1ZKDA 1ZAOA 2FNPA 2Z99A 1N7JA 3ER8A 2IVMA 3QOPA 1E17A 3PB3A 3GNLA 4B09A 4KIGA 4M9ZA 3HP7A 3P2IA 3TKYA 4HRAA 1YF3A 1LQ1A 2OY0A 4UUVA 2P40A 4EM0B 2B3TA 5DDGA 1R00A 2M5WA 4V0RA 2GA9A 3E5XA 5EPEA 3PQKA 1PJZA 2F8LA 1O9HA 1FX7A 5E18F 4LWPA 3S68A 4KMFA 3CJNA 1R1UA 1O9GA 3MCTA 2OB1A 2IDKA 5K0LA 2EG5A 3MHTA 3GW2A 2IPQX 2HQNA 1JGSA 2OQRA 3TMAA 1ZH5A 3L9FA 5DEQA 2IDJA 3K2ZA 1LDDA 4YV1A 1K7AA 3HUGA 4M73A 3KU1A 2C7OA 3AAFA 3BT7A 5L3DA 2J5OA 4RTMA 4G7ZF 1DUSA 4FT8A 2H94A 4NECA 2PBFA 1MZBA 3I9FA 1UHWA 3TKAA 2YSRA 5GINE 1PDNC 5LEJA 4DCMA 4AIHA 1Q0TA 2HGCA 3SVZA 3KLOA 2PBIA 3RIEA 1Q1HA 2AXLA 2A07F 1Z05A 2EA2A 5K0NA 1U5TA 4S04A 3IYLW 3LHDA 1YIOA 2RKHA 4MEXF 3EYYA 3FMQA 1I1GA 5CD1A 2E7XA 3G2PA 3E5QA 4G94A 2FQ3A 4CTKA 1W4MA 4OA5A 1QAQA 4FSXA 3IHTA 5D8KB 5JFRA 2QENA 3Q7EA 5FB2A 2ZIFA 3HCAA 4UNOA 2DQRA 2NNWB 4O5VA 5E2AA 3WTSC 4FP9A 3SM3A 3F23A 2P8JA 4G7OF 1EQAA 4UV9A 2VBYA 2ZSUA 5K05A 3O3KA 3W6KB 3Q9VA 1RJGA 2WTEA 2MH2A 4ENMA 3LX6A 2ZNZA 3GU3A 2Y1XA 3UFBA 4MQVA 3N4MA 3V7CA 4BHBA 5GIOE 5GOZA 4RVGA 2AZTA 3UJBA 3QOWA 5BMZA 2QM3A 2KRFA 1JG1A 3KQPA 1NV9A 3T7RA 3FPJA 2FCAA 3PQJA 3D0SA 5DCMA 3G2QA 5ERIA 3ZMDA 2KIFA 1V3FA 3TDUC 4IV0A 4RV9A 4BHCA 2V1DA 1MHTA 3KQYA 1S8NA 1MJBA 5L3EA 3KP2A 4PNEA 2VBWA 2IJLA 1G4DA 1NW5A 4LWOA 3DMHA 1WI9A 1FYLA 1KYZA 5DYMA 2DPMA 3KP4A 3ANXA 1IXRC 5DXJA 4I09A 4M74A 2W24A 2OZ6A 1HXDA 3DXJF 1NW3A 4X63A 1QZZA 2F5CA 2ZMEB 4OQDA 5KS2A 1NHAA 1QBJA 4FZVA 2Y48A 4ER5A 2TDXA 4P7KA 4CYDA 2DT5A 3EUHA 5HS9A 3DQVC 3JSPA 3CTAA 2HKXA 2GH1A 2P41A 2PGXA 4IJAA 5U4XA 4E30A 5HOQA 3ERCA 4CICA 1INLA 3GFIA 5D6EA 5E1XA 1SKMA 3U81A 1FP1D 3QV2A 5CCXA 2IBSA 4AZTA 2FYTA 3MZYA 4EVIA 2VONA 3F21A 3W6JB 3UJ7A 2O6GE 5LEKA 3DMGA 4HV5A 3FRIA 4CDGA 2EJRA 4P7JA 2AS5F 4XSXF 4E33A 3R0JA 1I9GA 2LF7A 4LGWA 2PWYA 5DWQA 2M87A 1BC8C 3FUVA 5E17F 3FPGA 4EJTA 4CXFA 1K78B 2KJCA 3SSNA 4GBED 1XGSA 4RTPA 1TBXA 1WS6A 4P5OA 2NS0A 1AWCA 1S7AA 4RTJA 5F1RA 3BZBA 1D2CA 2EA4A 3PX2A 4EQQA 4XSZF 2PFBA 4UVBA 4PINA 5FWAA 4Y15A 4M9XA 5FA8A 2RNJA 3LA2A 1P1BA 2AOTB 2NNNA 1Z91A 2F5DA 1KQ9A 5LQAA 5HEKA 1T98A 4R1HA 5CM2Z 4WWCA 5HIMA 2EJTA 1HSJA 2XUBA 3TO9A 2O0YA 5GP1A 5C9ZA 1D2GA 5F64A 3M6WA 3R3HA 2HR1A 2M1BA 2JHAA 2RC4A 2LSOA 5D5XB 2HTSA 5CLSA 2J5PA 3IKVA 4U0VA 5T6BA 4X1OA 3K0BA 2XKOA 3E8SA 3EQLF 2DAOA 2IIPA 5K0BA 1XSXA 3EVGA 1IXCA 2FA5A 5HLHA 4EGZA 2ADMA 2VOPA 3NWBA 1D3YA 3VB2A 1IW7F 3P2KA 2PXXA 2ZCJA 3J80Z 1G60A 2H1RA 3KPJA 3NDJA 4QPNA 2XIGA 5DM4A 4ETSA 1L9KA 2K02A 3KEOA 1T38A 2ZWAA 1CF7A 2JH8A 4YFKF 4AX8A 5K5QA 1KYWA 2VBXA 1JR4A 5FCDA 1B9NA 5FULA 1EJ6A 2BM8A 4HSGA 3G89A 4BY9E 8MHTA 4LFUA 3KCCA 3QRFF 4LB5A 2JHPA 3F8FA 2I9KA 1ZGAA 1SFXA 3QU6A 5LSAA 3D2LA 5FLXK 2GAFA 2RGVA 1TTYA 3GVAA 1Z6RA 3A7DA 4GOOD
chains in the Genus database with same CATH superfamily
3SMVA 1PUFA 2IYOA 3M1IA 3BY6A 1M1YB 2NSYA 1EDBA 1MDFA 2PEXA 3G2LA 4G8DA 4PPQA 4XLTA 1R4ZA 4KE6A 3CESA 3RAJA 5EEGA 3M07A 4XOIA 5LHIA 4KACA 2VJNA 2JPDA 4J4BA 4XONA 5J40A 5A5DA 2FRDA 5CVUA 2VG8A 1WBDA 1B1AA 1KOFA 2FPGB 2A2ZA 1WMEA 2OBYA 2BUBA 3IMKA 2JTVA 1FMCA 2ZRDA 3S1LA 1ZUNB 4DPMA 3PJDA 2XCRB 5EKDA 4YHHB 5JS6A 3OCZA 4TMFA 3KJQA 1ZTRA 2KWIA 2MMCA 3DFZA 1R22A 1ETWA 3FDIA 4GM0A 4IDBA 1MKYA 3SQNA 3RQIA 2V45A 3F9RA 3VR6D 5I48A 1AQ6A 4JQZA 2WJZB 3N8DA 2IELA 4E5VA 1IJWC 1WTCA 1NTCA 2ZWIA 2VLAA 1X8JA 3HA2A 2IA1A 1PBNA 5EXDA 3VHLB 3WWOA 3ADCA 1IXYA 4F3NA 1VPWA 3AFNA 1F5NA 2H2WA 3AJ9A 2NU9B 4JEUA 2WOOA 2PUFA 1E89A 1K6JA 2DBVO 4BVFA 1GRNA 1ZZGA 3DUWA 4N1AA 3SZMA 3NQ41 3IH4A 4JLAA 1W34A 1LUJB 3HWWA 2JA1A 3A6KA 1PAUA 1XTSA 4Z9BA 4CETA 2W5UA 4JYMA 1RRMA 2CMHA 2W9XA 3GLFA 1G20B 3ZZ0A 3BCRA 4C08A 4CG3A 1SPXA 1YA8A 2FJUA 5JSUA 4K3UA 4B4VA 2A9OA 3G8DA 1CD5A 3NHWA 3E3NA 3MRTA 4MP3A 2AI2A 2F00A 2ZB7A 2IUYA 1XWIA 1HCRA 2FA9A 2VNIA 3N2GA 4MRNA 4D8WA 3W5IA 3WTUC 5CQEA 4EI8A 5J5VA 1XHLA 4FEYA 4OIRF 1KK3A 4OHVA 4OH1A 5AKIA 1ZRMA 3R7WB 1SVNA 2FMXA 2E36A 2PM8A 2VQ3A 4X3CA 1MV8A 1HL7A 4JLJA 4P7BA 3AVXA 1UZMA 2EERA 4ZH4F 1QLWA 2Q9AA 5FLEX 3WNZA 1KTVA 3L8CA 2IZ7A 4YJHA 2YOGA 4U8GA 3PX3A 5ILOA 2J0QA 4RSRA 4U88A 1YE3A 3ZU2A 4AFNA 5E3OA 3A2KA 4P86A 1H8EA 5L3ZA 5BN5B 1AKQA 5THKA 3HDDA 1V37A 2G8NA 3KKNA 4M1QA 2MG4A 2Z9OA 1M2GA 1UOOA 1YJ8A 3KBOA 4GDMA 2NZJA 3O6VA 4EKDA 3VJLA 1EFLA 2CLHB 5HNHA 3N2KA 1GN9A 1IBRA 1ZCBA 3OZRA 4Z99A 5T64A 5D3QA 5CFZA 4TZ6A 5E7MA 3GLHE 3U9GA 2R7XA 2P6NA 3BEOA 3ENQA 1N7HA 4G8CA 5EJMA 4RKFA 2HXOA 3FPBA 3J7ZI 3BR3A 4A3KJ 4OHZA 3ZHCA 4B6EA 5KTYA 1J8MF 2IUUA 3UC9A 5AUNB 1T56A 4CM8A 3S55A 4V3BA 5T8KA 1OFTA 1QZTA 1Z0IA 2QZJA 1VE7A 4MA4A 2PQMA 4QVKA 3PHJA 3KPWA 4EB8A 3A14A 2YV4A 4TZKA 2XRMA 4ZEVA 2R85A 3I9OA 3M82A 4R3WA 2PGOA 5JT1A 5HTOA 2GZ1A 3BR6A 4LRXA 5F2EA 4KH1A 1EA7A 3LUKA 4R8KA 3AVTA 1Q7BA 3E5RA 1YTYA 1AOYA 1LU9A 5ALVA 3QW2A 5DM7F 1SVLA 2DA3A 4Z6YA 2BFDA 2H4ZA 2F43B 2TSYB 3HEMA 4I4TA 1SVOA 1VBKA 4ABYA 2ZJOA 4HVLA 2IH4A 3X1DA 1XHEA 2VNKA 3I04M 2G67A 4BP1A 1FTWA 2QUJA 2XNDD 4TTAA 3IURA 1LC3A 2LCIA 5KNBH 1CP2A 4DYDA 3TLGB 3VH3A 4DQVA 1H1TA 2R93J 3QKTA 5DNCA 1VCMA 3GLGB 1WDMA 5C52B 5H70A 3GEGA 4MB2A 3GFFA 3UTCA 5E6UB 2BFFB 5H5JA 3WL8A 1PD1A 3C1TA 1IH8A 3KP3A 3LBIA 5HZHA 1KI7A 4F92B 3W04A 5DNUA 4Q9NA 1IPEA 3JWGA 5LQJA 1FFXA 1XDZA 2C78A 2X7JA 4P7FA 5GWXA 1GSIA 1LWNA 1USIA 4HMPA 4AVPA 2ZJBA 2XNDA 4J3JA 4RD4A 1PVEA 1VQ9I 1YJAA 1Y6RA 4YPFA 4M6WB 3ZNNA 3DEKA 3GTGJ 2FX2A 3RFCA 3UK7A 3IUEA 2HEIA 1J20A 3PIOF 3BR1A 3I4CA 5CBKA 3H05A 2QDKA 2RBGA 4UHCA 1NNSA 2C04A 3CX7A 4AS3A 1UBEA 4IKEA 1BI0A 4MP8A 1F1JA 2HTFA 5IDWA 4FU0A 4OBEA 5JANA 4IIYA 4IEEA 4LDJA 4XVCA 4N5NA 4FR2A 1NUTA 2Y0BA 4OLBA 4YAGA 1OPXA 3FM9A 1ZQ9A 4P82A 3DR5A 1V45E 3HPQA 1WQ4A 1YBHA 2R0QC 3ZDBA 4QFCA 4BQRA 4UNPA 1YS1X 2M2IA 2Y6UA 4RJIA 1Z63A 4B83A 4KXYA 1RPWA 4O8ZA 5KDDA 2NVXJ 1CUBA 4FCYA 1AK1A 1X94A 2IU4A 3V1KA 1OLUB 1FRQA 1STOA 4CQJA 1P9NA 1JIXA 2R8EA 3HJNA 4OQFA 4C7KA 2ZKIA 2C9ZA 1WZ2A 1E3PA 4ZANA 2XITA 2ZW9A 4ZOBA 5IF9A 1R1VA 4TLEA 1LEAA 1YRNB 2Q7XA 2M6SA 1KEZA 1Q84A 1XDBA 2A94A 3ED1A 2REBA 4AJJA 4UTOA 3Q0WA 3T41A 3TG8A 2M3AA 3IPYA 3OP4A 5HIIA 3DW1X 1E7RA 3A6ZA 4HRVA 5DN6D 5HKBA 3R3XA 2I4RA 4GX2A 3B6KA 3EDMA 1MHPA 4IS3A 3G7UA 3V32A 4KO8A 1BR1A 5H81A 3V4OA 3TLEA 1XJQA 1IRIA 4EMBA 5LNK1 1SUAA 5DULA 2OA4A 1C80A 2B37A 1EH8A 3F6RA 3LGXA 3GCXA 1P7ZA 1AZTA 2BBWA 9LDBA 4DG9A 2C07A 2IYLD 4UBKA 2VPWA 5I51A 5KVAA 5FTKA 4LPKA 4JOQA 2QMYA 2YWCA 3DF8A 4D81A 4TRMA 4E2ZA 4Q5SF 5DUIA 1XAIA 2JRLA 5G0VA 4UJ3A 5IK2A 1F9EA 1XKLA 2P9JA 1VJGA 4HGZA 4MVJF 2D3WA 2X7HA 1EJ2A 4HDAA 2DWPA 2DHDA 4BQIA 4TQAA 2VSQA 2DJ5A 2I2CA 1F5TA 1KMQA 4HN4B 4KDRA 4YMTA 4JB3A 4HD8A 3SS9X 4KBYA 3UWKA 1FLIA 4F4JA 4J7AA 1ONNA 4QNNA 5EGSA 4YH1A 4K9SA 3IUQA 3DL0A 3LDUA 3UNGC 1RWBA 1ECFA 3DPTA 3R8XA 2QIOA 1RI1A 2TECE 3B6MA 3HRIA 5TLSA 1TJ5A 2HT6A 4J7UA 3CGGA 2X58A 3IERA 1QK4A 1KP2A 1WW8A 1DPUA 1IY1A 3FWHA 4C0KA 4HV6A 3WGGA 2DFVA 5IFKA 4OMCA 3OTGA 5JRDS 2ODEA 3V1TC 1LDYA 3GFMA 1OCOH 2GCIA 1QPZA 2CE7A 4I4CA 3KWMA 3UAGA 3V7YA 3H1GA 1SCUA 4CMEA 1Z29A 1T9GS 4OUKX 3ZHRA 1A5JA 3UMBA 3FM3A 4MO9A 4BMCA 4CXMA 2AXNA 1PUFB 1LNZA 2J08A 3NO4A 3OPMA 5IDYA 1DFGA 3T35A 5AOVA 4JI5B 2BTEA 3VISA 1HRDA 2DI3A 5E8JA 2DSNA 1RBZA 4WXHA 1U5TB 1FTZA 2NO4A 2I54A 5A5EA 1CQZA 4QNRA 1OA1A 1CZUA 4RMHA 2X1VA 1P4WA 2QYOA 1S3JA 3FCYA 2JA6J 2QZPA 2XAUA 4H3HB 3ZE9A 3G85A 3RIMA 1VOTA 3F71A 4W97A 2O7RA 5DLDA 3J81K 2QR2A 1BX3A 1PVVA 4BNTA 1Z5GA 1CW2B 1IMJA 2I2AA 3VNQA 3WK9A 1RHUA 3ZBUA 3ESYA 4A03A 3C16C 2XUHA 4JFRA 3O4FA 5T67A 2ICAA 2XAJA 1AGYA 1BJRE 1P0IA 2CUTA 4DE5A 1QK5A 2H1FA 2J30A 1YHNA 3VX4A 5BV2P 4K9NA 3RZOJ 1MJHA 5EN4A 3KEQA 2H6EA 4DY6A 3AI3A 1TCUA 3O84A 5E8RA 4HX4A 1NMSA 1TVCA 1Q0UA 1DLJA 2HYJA 2Q41A 3HQ4O 3UFXB 3EIUA 1TXGA 1AF4A 1RR7A 2CHQA 5C37A 1GUAA 2JFWA 4L0CA 5FRDA 4IGAA 4KMUX 4MULA 2WMYA 3AL3A 1PJAA 1RSZA 3A9TA 4IOLA 4UTZA 1CUCA 3DDUA 3SZUA 1GQSA 4FZJA 5JIBA 1X7XB 1X9IA 4Z4QA 1QH8B 1TF7A 2FZWA 2OGWA 3GGDA 4QYXA 5JNVA 3CCLI 4CCSA 2Z6VA 3F8TA 3ZY2A 1W4BA 2GHQA 1GXSB 1GSOA 2I4TA 4L95C 1P0PA 4M21A 2FBIA 3K1NA 3O75A 3K7AJ 3WXMA 4RSGA 1Z0ZA 3A3PA 4M8LA 3FETA 2WV0A 2XAFA 3F6VA 2YZ2A 3STWA 4CHTA 1FJXA 4HL6A 2QJOA 4GP7A 1XGOA 3PWTA 2OP1A 5E9WA 5H20A 2OVFA 4AYTA 3A04A 1MBJA 2YL2A 3VR3D 4OI4A 1ZD1A 4AY5A 4ZGBA 5A4AA 4PYNA 4DHEA 5MHTA 1QANA 4OI0A 4FLEA 5IANA 3WQHA 3RYCA 3WB0A 2FDCA 4G4JA 2V1NA 3FBNB 1Y3AA 4IDQA 3ICOA 5CX1B 1G9TA 2DC1A 2X5KO 2AXQA 3TQSA 3I3OA 2FZEA 5JD3A 4XLZA 3WFJA 1HNZB 2A9RA 2TMYA 2XT6A 4GR9A 4QAQA 3KV1A 3ZDCA 4RUKA 2CKMA 3VPCA 4BV9A 1BRTA 3AP1A 3AR2A 4NNPA 2VNSA 3ZCUA 4I1YA 2GPTA 2HQBA 3N53A 2NU6A 2NYVA 4A4DA 5BSWA 3KD3A 3SJBA 1QHXA 3AB8A 4CQMB 1A71A 1P75A 1VTKA 2WVGA 5M5XJ 2K86A 5CPBA 4ZYHA 5AM3A 5A62A 2H1OA 2ID7A 3AY6A 1UKAA 1NW9B 1U0EA 2GFQA 4KIFA 4BUPA 3CFYA 4GYKA 2HR3A 5AVJA 1VI0A 2K27A 4I0WB 4F97A 1QGDA 3I4NJ 2NNYA 3G9ZA 5JADA 1ULUA 1T26A 2IYRA 4R6WA 3TD2A 3NFRA 1Q77A 4KWIA 4F5EA 4IDHA 1CEQA 4Y6LA 4JP3A 1O58A 3I2HA 1JFSA 3FHCB 5AW9A 2JIBA 4RTOA 1TF5A 1UG2A 2P7CB 5HTKA 1AZWA 1PNRA 1MD9A 3BQZA 1P5RA 1UMBB 1ZP6A 1LTKA 4JT2A 2B4KA 2P0WA 1P2VA 3IDZA 4P4NA 1Z5OA 2KLBA 2KP6A 3TOCA 2PMFA 3L40A 4FNAA 3TSCA 2XVXA 1I3MA 3SEFA 2BZTA 4RXUA 4YYZA 1ZMXA 2W57A 3MYRA 4FFPA 3SHFA 4Q9IA 1L1QA 4TXHA 1JHAA 3SJ7A 1E3EA 1BCSB 4V0ME 4YAWA 2GAJA 1IN8A 3CXRA 2AMJA 2Z4RA 1JJVA 2H5EA 1L5KA 3EXEA 2A9FA 5I5GA 5HQ3B 3F5MA 3U9TA 3DV2A 4RK1A 1PR4A 3PICA 4WCDA 3Q9LA 4BNUA 5BP7A 3U44A 2F1RA 4KWCA 4XJSA 2HNKA 1SQGA 3E18A 3LCRA 4HSTA 4YMGA 1BCRB 4AYBN 1IAWA 3CX8A 2A33A 1MEOA 2DN0A 2HOAA 5ICEA 2FMYA 2AHRA 2Y9YA 1EQ2A 5J1TB 1Z3CA 3T7IA 2KDZA 1I0IA 4C3IJ 3DF7A 4OAZA 4C30A 3NWJA 4KCGA 4F4DA 4R3UC 2IHNA 1V3VA 1XLTC 2ODWA 1G9XA 4QBFA 1NATA 4YRIA 1WZNA 3EIWA 1KFEB 4ZJYA 1RI7A 3IBFA 2XQFA 3WHCA 4BFCA 2JT1A 4PNPA 2VN2A 1V48A 3P0RA 3OY9A 2QK4A 3U62A 3ECOA 2BFBB 1ZI8A 2PWBA 3A8TA 2ZXIA 2FFAA 3EEYA 5CJPA 3WB2A 5CT8A 1E2HA 1ZH6A 1U7XA 2WSBA 5FFFA 5C44J 5LKRA 4GT1A 3BF7A 4OQMA 5KJCA 2IT0A 3QFFA 4NVRA 4ZDLA 5K01A 1AMOA 1I30A 2VI6A 1E66A 1KEUA 2G7UA 2YYAA 4NCAA 4QYTA 3EUHC 1N3IA 4B1RA 4PZAA 2ZQYA 4KE9A 3UH0A 4PCVA 2IYYA 4YV2A 1JEEA 2HK9A 1JLKA 3OQMA 2VPLA 2PZAA 3CLUC 1K5GA 3BMQB 3LGSA 1EK1A 4KWEA 1GHCA 3JQ6A 3L1VA 3R6WA 2XT0A 3C1UA 3R4KA 4B3JA 1MH4A 1LLQA 4ENWA 1Z22A 3OZXA 1WF6A 1T2KA 1ZD2P 1VIDA 1XN4A 1CJVC 2HA5A 2PKWA 3CG4A 3QMWA 4G26A 5AI4A 5ALOA 3JQ7B 3KSBC 2HSDA 3IULA 1KE1A 1SQFA 5KHDA 1Y42X 4DNPA 2IYAA 3GFJA 1X8KA 1ORHA 3HNOA 4G4GA 2GEJA 2IYPA 3EVFA 2IPLA 4I3HA 3STUA 4L8GA 4K5QA 5AKXA 3CRVA 2JAQA 4IHVA 1EHIA 3O8BA 4BGUA 1G21A 1ZOSA 2BZSA 2WJGA 3BEDA 1GQQA 4YRAA 5FV4A 3OC0A 3NDBB 1XB4A 1PZMA 3A4YA 1Q1NA 3OCVA 4MRMA 3UG7A 4PTZA 4UM5A 4BX2A 3CZQA 3IXQA 4Q4HA 4ZZ2A 4D0NA 2GARA 5D84A 3HO8A 4WKNA 4DC9A 1SUDA 1B42A 1DQPA 4HZIA 4N4NB 1OX5A 1R4MA 5FL7D 3ZHVA 4ZZ3A 1R5ID 5JRJA 5E6SA 1JEYA 3EXFB 1C7IA 1U0BB 2G1AA 3AL0B 1HOXA 1V8FA 1S1CA 1GKLA 3GPIA 3C7JA 2R7RA 3VR1A 2A78A 1WSAA 2P6OA 4MDHA 3UPDA 1RVV1 4RNCA 1JHDA 1PSZA 4ZYEA 1IVNA 2DQZA 2Z3YA 2R00C 4MITA 1CYDA 3AVVA 1V1MB 3D9QX 2K2QB 3TQRA 1KMIY 4HFNA 2H4YA 5A2QK 1RD4A 3NTVA 3U5TA 3DJFA 1J8VA 1IXKA 1HK7A 1R10A 2XAAA 3FJ1A 3QBJA 2NWQA 4XGNA 3NEPX 1G55A 1XCOA 4AM3A 1UDCA 2V7GA 3QG5A 3GNQA 4CT5A 5JTTA 1Z0UA 1R37A 3MS2A 1ENYA 1W35A 4LE2A 1FSEA 1KXZA 5C4IA 1VPTA 2LY1A 3R6GA 3D8NA 3EW9A 3K1AB 3NRBA 3G7NA 3SJCA 4AZWA 5JLJA 1I5ZA 1M72A 2ZBUA 4N03A 5FD5A 1KWGA 1MP0A 3MT7A 2BMJA 1LZLA 1RHJA 1VIAA 3KSDO 3W3AD 3VFZA 1YZGA 4J2HA 4QGSA 3HEFA 4MIOA 4TQGA 3T3PB 3AUYA 4V0LA 3CT6A 3V1YA 4MLPA 4NOLA 3JAMK 2WWWA 3QSYA 1E1KA 3M8FA 4A8PA 4Y17A 2CCJA 1B14A 3OQBA 4LHEA 3UJCA 3BWEA 3CW8X 3NAZA 2AJCA 2IJGX 1SIWA 2IZOA 2X42A 1NRWA 4NMHA 2TRSB 2UZAA 2DGDA 2BGTA 1YZQA 3QF4A 1I3NA 2EU8A 4CIYA 5BMOA 3ND7A 2I62A 4EFNA 3IHUA 4P96A 1A50B 1TM2A 2C54A 2IYXA 2RGNA 3OJXA 4J6FA 4O4JF 4BCBA 3BC8A 4WXDA 2XOKD 2Y0SN 3KLMX 1UFQA 2QTZA 2YWBA 4AP6A 4FXPA 4CKZA 5M5YJ 1U3TA 3AJ8A 4D92A 1RQLA 4YK7A 5F7XA 3BSWA 1ORVA 4ID9A 5DCUA 3UJNA 2MT9A 2O3RA 4X7BA 2O06A 4D8YA 3DQQA 1L6RA 5CYPA 3ZDQA 1G3TA 1EX6A 3KOYA 2MBFA 3ZWWA 3HOZJ 2CNLA 4TKUA 5FORA 5IVKA 4O29A 2GR9A 3GC6A 1ZY2A 1NPDA 5FI1B 2I2WA 2KM1A 2R1ZA 1BHJA 2R6JA 5K0GA 1ZEJA 5ADUS 2CLSA 5F12A 3L41A 3AEKA 1H9BA 5E4JA 3GCMA 3GFBA 3C3PA 2ZIUB 3R20A 5DSZA 3GJ4A 2VL8A 3M3PA 3SIRA 1QGZA 2ORED 1B15A 5FUVA 5J2UF 1W73A 1MO4A 1RZUA 2BGKA 2RARA 4IRGA 3MWDB 4MK4A 1MAAA 5LBQA 1UEJA 1FBTA 1GG5A 4AJLA 2JVGA 4M6WA 4NYMR 5JQWA 3M3YJ 3KT0A 5IN5A 1VC2A 2F59A 4XWYA 2GBYA 2PSJA 4G7HF 2FPSA 1W4ZA 2HSEA 2QRZA 3CNNA 4KIJA 2FKAA 4RKQA 5AP9A 3WYCA 1Z7LA 2ADOA 2YZGA 3RVKA 2E18A 5DOVA 4IQFA 5JCOA 4FEAA 1IY0A 1F1ZA 1LS6A 1RLMA 1JTFA 3ZE6A 3KHSA 2HBZA 4ZYLA 1GNQA 2QQ5A 3NIGB 3Q7RA 4XWAA 4Y9TA 5CNKA 1YR3A 2OECA 1CGPA 5F4BA 2X9QA 3Q6MA 4MHOA 1Y5IA 1FJ2A 2AS0A 1F7UA 3WC4A 4IHWA 3UV7A 4MUIA 3S99A 2WTUA 2R6ZA 1UM9A 4RELA 4O08A 2QBYB 1YHYA 3TSOA 4YASA 3GVCA 1RMTA 1T3ZA 1HW5A 4MS3A 2JMWA 4N4AA 5HR5A 5KJ1A 1KL7A 4QDKA 4V1CA 1H6CA 2EZ8A 4BU0A 4MV8A 1G8FA 4N0EA 2I3BA 1KZGB 1TT5A 3T3HA 4L9VA 2BW0A 1E7YA 3VOTA 1EFKA 1J21A 3I2IA 2I10A 4BV8A 1NW7A 4U7HA 1IJFA 1BD3A 2OXCA 3KO8A 2Q9CA 5CB4B 4MPTA 4OU4A 1XA0A 1A2KC 2ZTMA 4DAOA 2JDID 1LV8A 4R83A 1SD4A 3IT2A 2HRBA 2QP3A 5AOAA 5BYKA 4CTNA 4HN2A 3L2WA 1V11B 2YHSA 2E60A 3VNVA 3MGAA 4HZGA 3ETLA 1NN1A 2H6BA 4JVOA 3T54A 1JHPA 1HT1E 1YQQA 3F8WA 5CLIA 5T4FA 1ETYA 4MJXA 4DNCA 4Q9HA 5JMTA 4LLLA 2BFCB 4UVCA 2ZSEA 5AONA 4UW9A 5TGDA 1DWPA 5I4KA 1BI1A 1H5QA 2FHPA 2OLKA 3LUDA 2H1CA 4NBLA 4M36A 5AVRA 1GPKA 3LXUX 4XM0A 5AM0A 4LF8B 4MR9A 2BGRA 4OU5A 3ZN0A 2JAXA 4WVLA 2VBCA 3RARA 5ALPA 2I71A 4TYMA 2WUVA 3A0HC 1NM5A 2ZBEA 5ESDA 1PR2A 5EIHA 5KHLB 4G97A 2LDUA 1CX9B 4BGEA 5JZVA 5DRTA 2PGLA 4XVQA 3ZDRA 5EZQA 4TM8A 2V4MA 5U4QA 3O83A 3PHLA 4M1EA 1E63A 2EJWA 1Y0BA 4C3HJ 3E9EA 4MQ6A 4F56A 5A3RA 4DW6A 1AXEA 3LD9A 2AOUA 3E03A 1N6KA 4G5SA 1G8HA 2WEKA 2CZCA 3BF8A 3HOYJ 3ZGLA 3FDXA 3ZNQA 4JLMA 5PNTA 5CDUA 2XZOA 5G1PA 4TMKA 4BNDB 1Z9BA 3GW8A 3PQCA 2GXBA 4WE3A 4OJKA 5BMVB 1E32A 5JAOA 2XZTA 4L9WA 3RAEC 3TUZC 2HMSA 4AZ0A 4ZWNA 3ASVA 5BV8A 2YV2A 1ISFA 3ZTWA 3ADDA 1TDJA 5JJCA 3HB9A 1XLTA 4A5OA 2C0CA 2QG6A 4EPTA 1L7EA 1D03A 2QLTA 3MT9A 4YCAA 5A04A 3IEVA 1MD0A 1IAVA 2P9EA 4A5NA 1US8A 2HWUA 4HH3C 3A4IA 3ZHOA 1ZC4A 1U9YA 2JFBA 5GV7A 5GTIC 1E1RA 4ZU1X 2B5VA 2WM3A 3QP6A 4R8SA 5JDCC 2HY7A 1IGNA 2RN7A 2XRFA 3TMKA 3EPZA 3UGQA 3CVYA 3VYSB 1M8GA 1W85A 3FOWA 4OKSA 5DNWA 1XSEA 3RU9A 4JQCA 3VR2D 5IEJA 1CR0A 2QUBA 3OV8A 3AINA 5E38A 2CNNA 3AW9A 2BI8A 2QX9A 2VA8A 3SYNA 3CNLA 3O9MA 2QWXA 3COVA 3UAOA 2PH7A 2I78A 4M9QA 4PZUA 2MD0A 4JUCA 2FKNA 4BN5A 1RYHA 4DS3A 1OB2A 2QTMA 4DQ0A 3H0EA 2PNJA 5CVIA 2CFXA 4A2UA 4PXAA 4B81A 3INYA 3AUAA 3HJHA 3ZGYA 3B3FA 1N5JA 3DAGA 2GN8A 3A28A 4V2UA 3FFWA 3K2IA 3QENA 4Q37A 2PGDA 3N2EA 3VR2A 2CMGA 2DQKA 2PRSA 3CHYA 3NYWA 2C9BA 3MMPA 4KICA 1NOJA 2VXCA 1CPYA 2CF5A 2FH5B 1J0RA 1Y1WJ 2I7TA 2QRLA 3BCAA 5KX5A 1YE8A 3PG5A 3R7SA 3BB1A 1JX6A 3M9WA 2ISYA 3UZUA 1SCAA 3BD8A 3LXMA 3ABSB 3HPGA 1KZHA 1H5NA 1VLLA 2QEQA 2W2LA 2WJJA 1IRZA 4HAUA 4BO0A 4C0LA 1JIKA 1U3VA 3BBPA 5K9ZA 3LP8A 1V54H 3C2GA 1Y6ZA 2PXAA 3OIFA 5EI5A 4JLSA 4M8IA 2PMBA 3B2EA 1HKUA 1QVZA 1APLC 3NB0A 2LNBA 4L85A 1G5RA 3BT9A 1WPGA 1KAGA 1WE2A 2EQ5A 3DHWC 3KP1A 4ISBA 5HFJA 5IJXA 4L9AA 3A1SA 4MDEA 1WJFA 1EBBA 3DXXA 4XNFA 1OYYA 5IY5H 1E7QA 3EG5A 3H0KA 3B9QA 1KNXA 4O4LB 1SKQA 2B8JA 2OXEA 2VHUA 4WNCA 5B57C 3H3XA 1HTTA 5CA1B 5B53A 2XCSB 5CT6A 2Q8KA 2HDNB 3PQ4A 4XCVA 2HC9A 5BW6B 3AG2H 5JC1A 3OLYA 2BGMA 4RE6A 3O2JA 2WZBA 3RKRA 2OESA 4QATA 3P2YA 3UY4A 3MKZA 2DQYA 3AVPA 4MKHA 5HKOA 5DTDA 4RWEA 2YS9A 3GJZA 1MQ9A 2QTAA 2Q9BA 5F2OA 4JK3A 4UV8A 1RRKA 3F72A 3DV0A 2JNWA 2QORA 3JRCA 2V4UA 3FIUA 3PVSA 4P3OA 1QQ7A 4KQ9A 2Q29A 1IUOA 3F3KA 4FLMA 4KX3A 4L9SA 4QULA 2G4LA 1MO2A 2XPUA 3HRSA 2E1CA 1PSWA 3L2QA 2H2GA 1AS2A 2QJWA 2FEPA 2JIDA 4FTHA 2QT9A 4O4IF 4QD3A 5KSYA 3VEPA 2VXZA 4FZ3A 4EX6A 4UQLA 1H3EA 1SOVA 1U4OA 1ZBDA 2C2BA 2XMQA 1BQ3A 3QUTA 4EJSC 3U1DA 1YOBA 1ZYUA 4RIEA 3PTAA 4YRZA 2KPMA 3CSDA 1G5IA 1ISJA 4OAPA 2HNBA 4QOEA 3I59A 2GBFA 2YN0A 3LOQA 2FMHA 4JDPA 1HDRA 1FVOA 1G0NA 1MABB 4ZK6A 3TTWA 3R74A 4CCMA 3MKWB 2V0NA 4W1SA 3FXKA 1TYEB 3KXLA 3MOGA 1YVDA 3PD0A 4DXDA 1N8TA 1Q91A 5B4VA 2I3AA 1M2VA 1SXJA 2P6TA 1G21B 1CJMA 4H9GA 3FUXA 3M4NA 3JVUA 4GOND 4JR2A 4IF6A 1V35A 4W8OA 3I0TA 2J5XA 4H4DA 4K8RB 5D1NA 2V5AA 2G7MC 4URUR 4YJFB 5DHAA 1M7GA 3UR3C 2KBEA 3AEKB 4EO4A 4F72A 3W5BA 3N86A 3FOFC 1QC5A 3HCRA 2C88A 1P29A 3N58A 4ND3A 1JDPA 2BYVE 2JAUA 2OXTA 1N5OX 3AP3A 1Z7EA 4ES6A 3IIEA 4GYJA 2ZBKA 2RKOA 5BW4A 9ATCA 1Z8NA 1CZHA 3ZWDA 1MPTA 3GZTB 4OCZA 5KYYB 4FFLA 1ZGJA 1Z25A 2XBMA 3GAAA 5EIFA 2VHCA 2C3MA 2OM2A 3DL2A 3A9CA 3FTPA 2R6CA 4KN9S 3SEAA 1KK2A 3OYMA 3D5EA 4A92A 4AXBA 5HPYB 3W5SA 5F0CA 4EGFA 1D1QA 4E88A 5ED0A 5E3LA 1PP4A 1PQPA 4M1YA 4C88A 1J7KA 1PEKE 3QPLA 1VPLA 2HA2A 3EMVA 2A68F 4DCJA 3IE1A 3R9XA 3KR1A 2EJBA 1WMAA 3G59A 3HZRA 1EMDA 3ZZNA 4F86A 1I2DA 1T6SA 4D5EA 3NCHA 2WD9A 4I2NA 2NT3A 2P7HA 3UTDA 1IQRA 3VXKA 4Q3KA 1BIAA 2DUWA 4RULA 2JZOA 4P4UA 2FW6A 2A5FA 2XV1A 3EFEA 4GVLA 4MYRA 2J5KA 6CHYA 3FWPA 1PHPA 4DMGA 4NXNB 3C0KA 5IXJA 1WXDA 1QIMA 4OGLA 3THSA 2IDMA 3JYPA 2IF2A 4GLJA 4HR7A 5AOBA 3ZBPA 5ERYA 2B94A 4WV3A 5EVJA 1HWYA 1TQDA 5GTDA 2CLKB 2C7VA 1YS7A 2PZ8A 2W4MA 3MTEA 5EKSA 1DMSA 1LW6E 5JYCA 1F6BA 2CMKA 5KNLA 3HBJA 1P39A 1YL5A 1QQIA 2P6SA 2PJPA 1SMTA 2HAEA 3IJ5A 4QYMA 2XF7A 2C4TA 4HI0E 3S6JA 4UTNA 1GAEO 4PBSA 1EAYA 3LL7A 1BH2A 4QGGA 1X1CA 4D97A 1PTJA 1SVIA 3J7AO 3VO2A 3OSGA 2D7JA 1HKTA 4PLYA 5G02A 5C1IA 4OYHA 1W25A 1A7JA 3B38A 3WAGA 1OCTC 2IGOA 3DDCA 4ZZIA 4TMYA 1NDQA 1YL7A 2ZXWH 1XRNA 2DR3A 4ZOEA 2GAAA 3WL7A 4X71A 5EHZA 2RE8A 2GPYA 4ENKA 2HU2A 2PZEA 4A1FA 1MW7A 4DLZA 4F6RA 3OPNA 2I7CA 2PMZN 2C29D 1JT6A 3GZNB 2HSJA 4OGFA 4Y6OA 1Q15A 1A77A 2GZRA 1E6EA 2N0SA 3LA6A 5JPCA 5DI3A 2HWVA 1XCVA 1G2QA 2W6JA 3BB4A 4GI5A 2QMZA 4JLNA 1CHNA 4PZ9A 1VL1A 3T1BA 1BFKA 5GOTA 1BDHA 4H7KA 2IOQA 2G1KA 1VE1A 3EDRA 4N12A 1Y0NA 5GTHC 2I2DA 1V39A 4L8WB 4AUEA 4L8FA 4WJZA 3DMNA 2RB4A 3FSGD 1BN7A 4X1YB 1KIFA 4D4GA 1PR0A 3GFSA 3UHOA 1J0XO 2F3SA 2PMEA 1TLHB 1EE9A 3DG9A 3M4ZA 4BASA 2VJQA 3ZJUA 2VC0A 2VUMJ 1YZNA 3IAXA 3U7QB 5IYZF 2BBSA 5C1PA 3UJ9A 4EG0A 4NFYA 4U6QA 1OGYA 2COEA 1Y1VJ 2GPAA 2ZRIA 1XHFA 2PXCA 3DZHA 3EY4A 2AOUB 3IAM6 3KWFA 1NJFA 4QSMA 4EJFA 1ETUA 2YZNA 2H2IA 1IUKA 2BHYA 3OCXA 4OQQA 3H2BA 3NOVA 4PONA 2EKQA 1C14A 6PAXA 4FS3A 4PHTA 2Y77A 2FTKE 3NV9A 1V3UA 1Z0AA 3AM3A 2FEWB 3NORA 4RDCA 4RDXA 4UHEA 2AOVA 2ES4A 2NUBA 3VWBA 4TL9A 4YAOA 1D4AA 1DC7A 2PS1A 2J31A 1E1QA 5FLYA 3DCYA 4CM4A 1YDEA 1XPOA 5BQXA 1P5ZB 4BVKA 1XNRB 1GA4A 4AMGA 3WMWA 3ISPA 5SZHB 3ICQB 3P9QA 3O4JA 3ENKA 3UMGA 3VHXA 2NVQJ 1Y4ZA 4NDLA 2E6KA 2P9QA 4HP8A 3ZR4B 4P0QB 1SBQA 3F4BA 3OU6A 4J3FA 2JW5A 4UNNA 1OWOA 1WPQA 1CLEA 3H5VA 1MGPA 1XK7A 2DO7A 1QAOA 2JFFA 3B9RA 3TRHA 4BRWA 1QB7A 8GPBA 3NETA 3S70A 2WC2A 4R79A 1U4SA 2IXDA 2V6BA 1URPA 2DUMA 4ZD6A 4YREA 3ZW9A 5AIBA 2QPAA 3UHJA 2B7BA 4UFOA 3RWBA 4LQ4A 3ZHQA 4QUGA 2XR1A 3K20A 1Z4KA 4Q7JB 5J5AA 1U3GA 2GK3A 2XADA 2NVWA 2R8XA 4PF1A 3VPXA 3VU1A 4IQ0A 1I7PA 4PS1A 3SXUB 1BX0A 3HJGA 3O3CA 1KJIA 2QVZX 3TINA 4HWRA 3WGMA 1WVRA 1VE6A 3G5LA 3V4PB 1OXXK 2WMDA 4FOLA 4RJJA 3R0AA 1ZWLA 4QJ3A 4YONB 2LKCA 3TGWA 3H8SA 2D1QA 5L45A 5K6AC 4L5BA 1Z1DA 4V38A 5TQVA 2Y1WA 3WIDA 1NAHA 1QGUA 3MTIA 1WUHS 2QW0X 4UMDA 3T1YB 2CUNA 4XLPF 1DAHA 4BO7A 4JEIA 2QR5A 4P2BA 2EG9A 4PYOA 1Q1ZA 4LX0A 4EFDA 2P0AA 1NMEA 3GN1A 1XRSB 2B4YA 1QQ5A 3ILSA 4J1TA 4PRKA 4R40A 1XKXA 5EE1A 5LBIA 1SWWA 1Y39A 4O2BA 5BXQC 5A06A 4CODB 2QYSA 2YV1A 4D3FA 3KZVA 1M0TA 2HTJA 3GBPA 4F2WA 4YUZA 2F48A 4V2FA 1QG2A 1LDGA 1X13A 2ZUSA 4MSUA 2DYSH 3LA7A 1LDMA 5AO9A 1FF9A 2Y69H 2E55A 3DSRA 3ZCTA 1JEYB 1Y1QA 1THZA 1YR9A 4N7BA 3JQAA 3AONB 3PL5A 5GJCA 2WSSD 2WT9A 3OEWA 4IDFA 2DMTA 2BGWA 3L7CA 2EFNA 1X6VA 2ZXFA 3CPHA 3OIYA 4B40A 5MGNA 3SVLA 4LK1F 3Q10A 4U7BA 4B87A 2D1HA 2IZ1A 1FUUA 4TTJA 4KQ6A 4ONEA 3BWBA 4XAQA 2HVSA 2IGMA 3L3BA 3U3ZA 2O3FA 2GBIA 4QJIA 1N5RA 5EZYA 1EX9A 4EZEA 1LLCA 4TKMA 1ZW6A 4MLCA 4G1FA 2E21A 2HF8A 4QA9A 4TYNA 2WG0A 3L1JA 2OGZA 2CD7A 4JXZA 3N0VA 1H9GA 3R3ZA 3T7CA 1DWOA 5CDGA 3D6HA 1HEUA 2K2WA 4YP6A 1FVXA 1E2LA 1ETXA 4WK2B 2GBCA 4ID3A 5IS2A 1SNYA 1V6CA 3O4HA 1QO0D 3H2JA 3H5RA 2ZZNA 3QVMA 2P3OA 4YT2A 2CGPA 1I4LD 2HOQA 5HWSA 1SURA 4BO9A 3EYIA 1OV4A 2EZ9A 3S3TA 3LUPA 1KF0A 2BPOA 1VTNC 3VR0A 1NG1A 4FUTA 1VCIA 5MN4A 1X4PA 1OFCX 4IG9A 4UQOA 3ESWB 1W47A 2X1DA 3HB7A 4DRXA 5SYNA 5AT1A 2CH0A 1W0JD 3MWLA 5JBQA 1VL8A 3COPA 2YS6A 2QS9A 4WDRA 2AE2A 3ABUA 5F3DA 1WH7A 2HJVA 2J45A 3PXAA 4OM8A 4QQ8A 1GZDA 3K8ZA 2JC3A 4KJXA 3SOZA 4BMPB 2YWHA 4JL8A 3VO1A 1E0AA 2JCXA 1DAMA 5A9SB 2FG6C 1U2PA 3FY4A 1W4LA 3E7FA 1P6RA 2KZGA 1D6SA 3C43A 3NHPA 2ZK7A 4YDQA 4IMJB 3FH0A 3UUEA 3CPJB 4ZHQA 2VTBB 3GLHA 1AJEA 1KSHA 1BMTA 1TCAA 1WCWA 3JR3A 4I81A 4RVFA 1EK5A 4LE0A 1YB7A 2DSTA 3UAXA 4KYTA 2AIRA 3DPSA 4KTTE 2OAZA 1XTUA 5DM70 4D46A 2ZBDA 4RESA 1BO6A 2QSHX 1X7GA 2X4IA 2NP7A 3P96A 5LYJB 3KSAC 4B6RA 2PS9A 3LY5A 2JZNA 1ZN7A 1SCDA 1KI9A 1Z0KA 2G5CA 2JF0A 2HSZA 5HNFA 2JAPA 1E2MA 2O2YA 3M7GA 2YNMC 4UM8B 3K4NA 1WMFA 4YYEA 5AVSA 1PGQA 3I8SA 1JHUA 3P4UA 4BLUA 4D2IA 3KP6A 4DMMA 2OV6A 5BWLA 3B3JA 4B7XA 4AY6A 4N8DA 3B7GA 3UHAA 3VNAA 4UZSA 2RJNA 1KK0A 2HF7A 2L0KA 1P60A 1KZ4A 1Y5LA 1FDRA 3OI7A 2OUMA 3FROA 4RK4A 5CNMA 2WJAA 2J6BA 3ZVMA 3U2RA 1M1UA 1IE3A 3C3MA 4KIWA 3RK0A 2B2CA 3CO5A 1HW2A 1SU7A 1JU4A 1K8XB 3FJYA 1R7RA 4XLHA 3IBTA 1XMQB 3SEZA 4RY9A 3R60A 4HPWA 1LJ8A 3Q0IA 4IIVA 1T1GA 3E7XA 1KI6B 3VPRA 1NQ5A 1X7ZB 3AZOA 4GBMA 3V7FA 1KMHA 3A2MA 3IPLA 1H5UA 1Z06A 3ZQQA 4F11A 2IZZA 2PX2A 2Y0EA 3QTBA 3F3XA 3BH6A 4X85A 3L46A 4GP9A 4G9YA 4GE0A 1KSGA 3I56I 2UYQA 2HLDA 1N34B 3PC2A 2EINH 4NG5A 1KGSA 3KVYA 3URMA 1HYEA 4CYMA 5JHGB 3L2UA 4MV0A 2C94A 1J9EA 3N9IA 4JB0A 3ZG6A 1TUEA 1U2QA 2UUPA 2GEFA 2V7XA 1GRCA 3FYUB 3S2FA 2F2TA 5HP4A 3D1JA 1JFTA 2BEVA 2H54A 2WNHA 3AERA 4R5HA 3TMOA 2VQLA 5KYVA 4TMWA 3U13A 5CBPA 4QELA 4EKEA 4M3GA 1TJYA 3CTPA 2QSZA 1FUYB 2Q4DA 4OHKA 3SHVA 4EM2A 1JG3A 1MJGA 2XUJA 4KFUA 4UXHA 3DZCA 3T1VA 4CEIB 1J24A 3RIHA 5J4YA 5KC9A 3LLCA 1SK9A 4P3YA 4PLFA 1C0IA 3CO7C 1Q0SA 5TARA 1YE5A 4WLUA 4KR7A 1Y9DA 4P22A 1WV1A 3OE5A 2BFAA 2IYQA 4CMKA 2YMLA 4X3OA 3HM9A 1PVOA 3B6CA 3ZOZA 2ZUTA 1P4HA 5TISC 3VTZA 4AICA 2O3JA 3WDSA 4DBRA 1A9XA 4R68A 4OMYA 1YTUA 2VF5X 2FZKA 1EWTA 2AXTC 1G3QA 1JQ5A 2HCTA 2C1XA 4QICA 1G1MA 3PDIB 1FFYA 4Z53A 1MMFB 2NXWA 4HMQA 2C2ZA 3KYBA 1H2XA 4TWBA 2BC9A 3DE3X 3SZOA 5KYKA 3EX7C 1DAPA 3DLIA 3G7SA 1HQCA 3LNTA 4P33A 1GL7A 1XELA 1MJ9A 4IJVA 5JAPA 3DE5X 3CP2A 2WAYA 4W7HA 2TRTA 3R6LA 1XLVA 2W6IA 5COBA 1UP7A 1CB7A 5HVQC 1T4MA 2CC2A 2FMFA 2VPZA 4HDNB 4N3NA 5CVCA 2MR6A 4TZ0A 1Z4NA 5I8ZA 3FYSA 1IB6A 4TUYB 3F0TA 5J63A 4KB5A 2O59A 2O8DA 5DXAA 2EZKA 1POXA 1U7WA 1UPCA 2OG2A 4GLOA 3RKWA 1RYNA 4WKGA 4BJTA 2GPJA 3EDYA 3NIWA 5TEWA 3MQFA 2B4RO 2HGZA 5KVCA 3LFKA 1YLFA 2IYSA 3VUEA 2XQGA 5A2QA 1ESDA 3DTIA 1GQ2A 2O2EA 2Q8NA 3FWNA 4LMPA 4REQA 2ZAMA 4CRWB 1ZRSA 5DV9A 2IYEA 4YLEA 1Q0HA 2OBPA 4R7GA 3TGNA 2B5WA 2VDLB 3DV0B 4RF2A 3DTKA 3WRYA 4ZIRB 4HQMA 4B4DA 4BLVA 3ZDDA 3T5PA 2WA2A 4RVCA 5E7IA 1SHKA 4ND6A 3O74A 5JROA 4UHTA 1IPFA 1DAIA 1Z75A 4ETMA 3DYVA 1DE0A 3NHKA 4H1HA 5LP1A 6LDHA 1ST2A 3AR5A 1Y82A 2RGCA 5EMKA 4DV1B 3QUBA 1QVUA 3GRPA 2G5TA 2GIVA 3G1OA 2BMEA 3NHJA 4TL7A 4D4LA 3PFIA 4HNHA 2XDAA 5KYWA 4Y2VA 4I1VA 3TLJA 5A0TA 1U1DA 4XCXA 4CIAA 1KVQA 1T9GR 2K7LA 1KIAA 2I5PO 2RKBA 3MJEA 1U7TA 4JBXA 5HLIA 4XA8A 2ZXHA 5E1MA 2VHEA 4UREA 1DPRA 2JQ7A 2MSLA 3QVKA 4XQ9A 2HO4A 4FASD 1UPXA 1WHSA 2QKLB 3OO0A 3LOUA 4O2BB 4CKYA 1ECLA 2LIPA 3DDWA 3OX2A 4ABTA 3R6TA 4NYIR 5KI6A 3QMPA 2FR0A 5F73A 2D2FA 1KO5A 3L8FA 3FMRA 1DKUA 1UBOS 5LLQA 2F2EA 2JIZA 2WHXA 3DH0A 4AUXA 3IE2A 3JQ8B 4NDZA 2PNFA 2W2VA 4RE5A 2A1UB 1T9DA 1NNI1 1O96A 3B70A 9ANTA 3FZNA 3HOVJ 1BOOA 1NVUQ 4RY0A 4ZAYA 1VKOA 2Y1FA 1N33B 1O77A 2EV0A 2YICA 1QYRA 4L3OA 5BYJA 3V4LA 4QEKA 3OJOA 1AY0A 4X97A 3OIUA 1WH5A 5BWNA 2G9WA 3PKZA 2FX0A 2NOAA 2JIZD 2PQ6A 3D7KA 4Z3DA 1RI3A 1L7OA 3LPCA 5FPPA 5HF5A 1WD7A 5AK6A 4FK8A 1YI2I 4U7GA 5K3OA 1WSUA 4WXPA 4FWTA 4GDFA 2O0KA 3ERCA 1WJEA 1XSVA 4M0LA 2QB5A 3UJAA 2FMUA 2EYQA 1FMJA 1ORWA 2JJMA 4NFHA 5EMNA 2VK2A 5ALYA 2IYTA 1NVMB 1KDPA 2H48A 2VDWB 3FAZA 3DMRA 1O8CA 2YW9A 3K4BA 1D6JA 3WTVC 5T6MA 3ABTA 4R0VA 2JA5J 5DYTA 3T12A 3LKDA 5C4JJ 2X9DA 3MCZA 1O95D 2X86A 2DUJA 3FSJX 3LBHA 3MLEA 4NZ9A 4RY2A 2XASA 4UZEA 4CNBA 4A8JA 5IP7J 2Z2IA 1F48A 1U5BA 1ZW1A 2OO3A 3EGIA 2J6IA 3ZRGA 2XQJA 2XXBA 2ZU6A 2VJMB 1KOJA 3GRFA 3V7SA 3A27A 1NZDA 4L8LA 2R7AA 3H9JA 1PF7E 3P20A 3GAMA 1MAWA 4AJOA 5ITZB 2AMYA 5JZ9A 4JCCA 3FNQA 3IKTA 3QHQA 1W36C 2OHXA 1FDWA 2TMGA 3M5PA 1BXRA 1X1DA 4UC0A 2Z95A 3HO1A 1KKUA 3S4YA 3DBLA 2O5VA 2IEZA 4XEUA 7YASA 1L5RA 3DMDA 4MI3A 3IWFA 1VYHA 1DXHA 3FXUA 1XS9A 1X7WB 3N2YA 1EZ1A 2R97A 3O8CA 1W0KA 1ZX1A 4D8UA 1NBWB 5JTUA 2QTVB 1RHMA 2UUBB 1Y4SA 3CMCO 3OLXA 4KNVA 3N97A 1L0OC 1BSVA 1VMIA 3KQWA 1K4MA 1LTQA 1L3CA 5F52A 3S7TA 3WJ1A 4BTLA 4J0DA 4PE5B 4WEOA 4N5HX 1P4GA 2NU7A 3HL0A 4U6NA 3JQGB 5DXFA 4CLOB 4ECEA 1TEVA 4OIQF 2QVGA 4D56A 1U63A 2VYQA 2WUDA 2W2PA 5LC1A 4EW3A 4BLWA 3ANYB 4CMCA 2JGFA 3C6QA 3M4JA 1ZVJA 5TIIA 3CP8A 3E2MA 3LC7O 1H2AS 4LKOA 4ZU6X 1QGOA 1XX6A 5DNYB 1ZITA 5BR8B 3PUBA 3QYJA 4EB0A 3WBKA 4FGSA 4CM5A 2A30A 2A8YA 4OYLA 3DFMA 1JR3A 2VZ0A 4RAQA 5EZYF 3WIVA 3WRYC 1X1BA 4WZAA 1C9EA 3K9WA 4YR9A 1MEJA 4HYEA 1WB6A 1FDVA 4CA0A 3Q11A 2DTXA 3EGCA 4FLFA 2Q1YA 5CYFA 1VHWA 5B1EA 1I7LA 3OF5A 2OORA 4TWIA 3NNNA 2K4JA 3FPHA 4AJKA 3ZR8X 4I0BA 4DJTA 2AKYA 1JDUA 3AG1H 1T0BA 4XMYA 5G4KA 5BPHA 5BVGA 2B4TO 5JCJD 4XLFA 5DCLA 5EWMA 3BJMA 1P3JA 3BPVA 1F38A 1KDOA 1PYGA 3KYLA 1TKRA 1KERA 2DOFA 1I1QB 1UFVA 3ECHA 1VSUA 2DPGA 3MIZA 1I3CA 4MJLA 1NNLA 3RRZA 4E6EA 3GCGA 4AO8A 1C1DB 1MOZA 1XF1A 1ZLKA 2O2CA 3LCUA 3PHCA 3S2YA 1TUBB 3B3QA 4MGZR 3UB3A 5A02A 2R79A 3U7FB 5J1RA 4ENRA 1TYBE 4X41A 5DISB 4BZPA 5LZ4A 3T7KA 3OF3A 1QQTA 4QBKA 2ZMEA 2IXBA 4ZTBA 4UTPA 4IHTA 2ACVA 3SK0A 1DEXA 2P3LA 3PDUA 5JCJA 4ZYYA 3D3WA 3ADBA 1P5HA 2XVMA 3IOEA 1W36B 3G0IA 4L6CA 4BXOB 3AJDA 3VU9B 3RAPR 4PY2A 1Z17A 4WFKA 1GQRA 3BIFA 3G5MA 3VVMA 1PEAA 2Q5OA 3V42A 4GXRA 4DY4A 1OLSA 1C3OA 1YQ9A 1RQGA 2IZ6A 2ZE7A 1BWPA 3A26A 3D7MA 5BSGA 5C80A 2J7PD 3U26A 2AQFA 1II9A 4IOJA 2FF4A 1CR2A 3OOSA 4EATA 3FK7A 2O8EA 2F4IA 3CD6I 1S72I 4FSDA 3UF0A 1YO6A 4RM3A 1GPLA 3IXLA 4RPGA 5JJ5A 1KPIA 1JSCA 1JDJA 4JK1X 1V7ZA 3D0QA 5CK5A 1RHRA 1G16A 1KZ1A 1YBAA 5A9RA 5MF6A 4I7HA 1UFKA 4B2LA 4HZFA 3EZ9A 4JX4A 1XMJA 1ES9A 4G1UC 3SXUA 4PZLA 2QVXX 4WKBA 5E0OA 1HORA 1CUYA 2KJQA 1ABBA 1O0CA 1U0SY 1YI8A 2A92A 2B1IA 3DM5A 2IRWA 2YX4A 4G4IA 4RA6B 1DQRA 3P52A 4FDAA 4KKXB 3CRZA 5FUWA 4PJMA 1F2DA 3GX4X 1XRQA 4I5DA 4OQNA 1YV9A 4YELA 4IHQA 3ERED 2YHBA 3E4DA 4BX3A 1GA6A 4IH4A 2YW2A 2Y99A 4P5PA 5DX1A 1YU9A 3LSRA 2Q0OA 3I3LA 1SXGA 2DFDA 1XDGA 3BP8A 4EJSA 1BDBA 1H4SA 1DJMA 1L5SA 5FO1A 3PZBA 1KQ0A 1Q11A 3E8XA 4NOKA 5ELLA 1DPGA 2YXDA 2G07A 1HSOA 4GOXA 4LGVA 3GBVA 2C2WA 4ODIA 2P9TA 5CM9C 1T29A 4C3VA 4HDNA 2NUAB 2HMWA 4KIUA 4HNTA 1P91A 3TEFA 4ILKA 3V33A 3DMPA 3EHEA 4IL6C 1L4BA 2FMKA 4OFZA 4POAA 4U2EA 5LOVB 2DLLA 2HI0A 3FMSA 4OYYA 4XARA 1CUGA 5FKNA 4A0SA 1CJTC 4R5MA 5C0OE 4CDRA 1GTRA 1G3YA 3MZHA 4LOKA 4L18B 1QGYA 5DLEA 3K69A 4U9HS 2GVZC 3RYHA 3VNRA 2ZYVX 4AMBA 1A9ZA 2E9SA 3TPZA 3Q3SA 2P2GA 4RS8A 3VSDA 4C76A 3PTLA 1M1YA 1K3UB 4DUGD 1PFQA 1G7RA 3SC2A 3WMXA 4AROA 1CR1A 4NR0A 2QLLA 3WSVA 1I1NA 4CL0A 2WU4A 2VJYA 3DVSX 4LIVA 2FXIA 1VP9A 3V9AA 5A4MS 1SUPA 4HYTA 4I19A 4P2GA 4WHMA