3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
1K78B 5EHIA 4RB2C 3FTCA 2ZKZA 2H94A 4P7KA 3M4XA 4AIHA 1H9GA 1ZARA 2YR0A 3E23A 3UA4A 2G72A 2GXGA 1BN5A 2OBPA 2KIMA 5K8VA 1FOKA 5BW5A 4AWXB 3EGIA 4I02A 2PWPA 3HRUA 5DV5A 1ZG3A 4BHPA 1ZRCA 5HLHA 1N7JA 2GA1A 1XDUA 3EQLF 3TGNA 2NXJA 3NWEA 4GC5A 3R0AA 4DA4A 3IKTA 1U5TB 3OOPA 4QVKA 2EX4A 2VOOA 1YLFA 5BP7A 5K1YA 5EEGA 5CD1A 1T98A 2ZLBA 1ZG1A 4B8XA 2Q41A 4V0RA 1QO0D 2FF4A 2MH9A 1I1SA 3ZMDA 1RJDA 3HSEA 1NW3A 4ZTBA 3H3ZA 3IL2A 3O3KA 4X61A 1NKVA 2WWYA 4L0YB 1MJFA 2IH2A 3QU3A 4QQNA 1D2HA 3GFJA 3HSFA 4A5NA 2EG5A 3C1DA 3FTDA 4IV0A 2ZCWA 3AY0A 2QUFA 3VB2A 5FFXA 5FD5A 4MEXF 4WXCA 3N97A 2ZULA 4HLXA 4LLNA 4XUEA 5K09A 3VOEA 4KYWA 4XSXF 5J6XA 5DD8A 1X1AA 2LF7A 2DQLA 2F5CA 1YFLA 3L09A 3FYCA 4HF1A 3EGEA 2Z5UA 3TQSA 2YUIA 1R8XA 3QV2A 2GA2A 1RZ4A 4CHUA 5EEHA 3J7AO 4KNYA 4EV0A 4U7TB 2UZ4A 5HIKA 2KKOA 3VODA 1O57A 4EKIA 3L8DA 3HHHA 1QAQA 2JG3A 5L3BA 3EVGA 1BI1A 1M6EX 2GZWA 3GEZA 2FYTA 2CFXA 3ABTA 1JQEA 2FOKA 2PMUA 4OIPF 2HV9A 3MERA 1Q0SA 3BGVA 1YW9A 2ZFUA 5E2BA 2Z6UA 3I58A 3MFKA 4X41A 4CKCA 3E97A 1NW5A 4RX1A 4HF0A 2XYRA 4LWPA 3F8FA 1WSUA 5FA5A 5BQTA 4PYNA 2STTA 4E70A 2C6YA 5K0EA 2GLUA 1RIOH 2PT9A 2V74B 4KIBA 1BIAA 3LDGA 2VBZA 2ZTHA 2DT5A 4RTSA 5LRSA 3EYYA 4DF3A 2ERCA 1FBQA 2ZSUA 2OO3A 2PV0A 1O7LA 4GEKA 5FHRA 4L18B 3KP6A 1WWXA 1QANA 3F8NA 1XN7A 5B1SA 3IWZA 1KXZA 1L0OC 1TTYA 2EK5A 2GB4A 4K6MA 2I62A 1MJAA 2FK8A 3NMUF 1SMTA 4XLNF 3TO6A 3HTUA 3LFKA 4RGUA 3E5QA 5JVTA 3J80K 5E8RA 3KR9A 2ESHA 2OB1A 2A6HF 2W84A 4BQAA 2GAFA 3CGGA 3KPUA 5EMKA 1S7AA 2QM3A 3SR4A 1PDNC 5DXJA 1SFXA 1XB4A 2RGVA 4RS8A 2Z3YA 2CG4A 3HHGA 3OV8A 2OD5A 4FR0A 1F1ZA 2VDWA 5FQNA 4BLVA 1IXSB 3ER8A 2AOTB 1D2GA 3T7RA 3HVHA 1RI1A 1WRJA 3T7SA 1FT9A 1JG3A 3MTEA 3WG9A 2BGCA 1QBJA 5D8KB 4M9XA 3G2PA 4FZVA 3WU0A 1K79A 1G6Q1 4RTKA 2H11A 1IW7F 4AD9A 5DTMA 4CXFA 3FHZA 5JHUA 2GAUA 1WG8A 4MIKA 1WXXA 3K9TA 4HX8A 4RTLA 1IXCA 3D5LA 1Z91A 1AQJA 4GOMD 2ELHA 2VS1A 3KQVA 3KP5A 2C7PA 3HRMA 3BPVA 5FWDA 5D6EA 3R6SA 2P6SA 2I9KA 4KDCA 3JWJA 1WS6A 3SSOA 4KW7A 1FZPB 5K0NA 2XAGA 5JUWA 1SUSA 5LQKA 2OA4A 1XSVA 3M8FA 1DCTA 3M6XA 3RPUA 4ER6A 2AR0A 2VOPA 1H1DA 1FSHA 3BKXA 2V79A 2OZVA 5HOQA 3A27A 1PP7U 5MHTA 2V7EA 3KPJA 1KU7A 5GIPE 2EFOA 3BROA 2NNWB 4R8SA 5HDKA 3UJ8A 1B9MA 2OQRA 3FUVA 3CJRA 2H6BA 2DQRA 2HKOA 9MHTA 5FLXK 2K4MA 3V8LA 4ER5A 2JHCA 1MJ9A 4BH9A 3DXZA 2D2WA 5BOXA 2YR2A 5LQAA 2UYHA 4PGGA 3AAFA 4UNOA 5H6QA 2A3SA 3KR2A 5BS6A 4KRGA 3FUUA 4GBED 4FT8A 1ZRDA 5HS8A 4CXMA 4XSZF 5CVDA 1VL5A 2FBHA 5ED4A 3P71T 2UYCA 4L0ZB 5H02A 2PQ8A 1IXRC 1U2ZA 2V1UA 2QWWA 3DFGA 1J2XA 1TNSA 3ISPA 2G7UA 4B17A 4YUYA 1P1CA 3F72A 1JHHA 4PIPA 2W57A 1W7PA 4HV5A 3M70A 4XLPF 1EIZA 1P39A 4C03A 4N0BA 5C9ZA 1AV6A 3DPTA 4HW0A 4RGXA 5DDGA 2AOUA 1BBYA 2ZO4A 1Z7UA 3CTAA 1GXQA 4PGHA 3EETA 3PQJA 4WXHA 4C05A 4KICA 4QDJA 3VC1A 1HNNA 2NYUA 3SX0A 4WCGA 1ZGAA 5F2OA 1SG9A 1FP1D 1ODDA 1I4WA 2ZIGA 3B3FA 3WTZA 4PIMA 1CGPA 2R6ZA 1EQAA 3T7TA 3C3YA 2B0LA 2B9EA 3DP7A 3ER9A 4P7FA 4YFNF 5FFZA 4IVNA 2PBFA 3TOAA 2LNBA 1USTA 1ZLJA 1U6GA 5L3GA 2FK7A 2CWEA 3AWIA 2HWVA 3QRFF 3DMGA 4LFUA 1SMYF 1LDJA 3KQYA 1O3TA 5FHQA 4P58A 3SHFA 2HWKA 2C7QA 1J9IA 2F5EA 5L3CA 2XASA 2G1PA 3WTYC 3K2ZA 3WSTA 2O07A 5K5RA 5KVAA 2WA1A 2I6GA 2E1NA 2W25A 2YSRA 2OY0A 5F2NA 2EJRA 5E1DA 1EH8A 1G3SA 4RGRA 2VBYA 2P4WA 3CLOA 4L5IA 1G60A 1YG2A 4BP3A 3FTFA 1XGMA 3JTGA 3DKWA 3ML6A 2R7DA 2Z33A 3G88A 3W6JB 3ELKA 5LHGA 3LKDA 4GQBA 3G7UA 4R05A 3UWPA 2IBTA 4ENMA 2AN3A 2DTRA 1YFJA 1NW8A 1R5GA 3NDJA 5KS2A 2FXAA 2JH8A 2O0LA 5LGUA 3REOA 4AX8A 3TDZC 4YIFA 1XDSA 4L7VA 3P9IA 3UFBA 3FXRA 1GXPA 2BR3A 4GOOD 5ICGA 3ZPLA 1HSJA 4YV1A 1R1UA 5E1MA 2ZFWA 2OXTA 1LEBA 4U88A 3EMDA 3R6TA 3L2CA 5GM2A 1U5TA 2EB7A 2K02A 4ESJA 1VBFA 4WWCA 4C07A 3A4TA 3BUSA 2KRFA 5CYVA 3HSRA 4BXUA 1IY9A 2QBYA 2R3SA 3G2OA 2VZ9A 2JJQA 5LHHA 5E9JA 1I1NA 2FRXA 2FBIA 3KP3A 3V7RA 4RTJA 2LDUA 1SAXA 5K5OA 2VE9A 2BM8A 4WF2A 2VP3A 3GDHA 1QAMA 1L1EA 4Y17A 3RKYA 1UFMA 2YPRA 4P9UA 1EAMA 5FD6A 2NXCA 3RIEA 4HC4A 5HEKA 3ROUA 1R5HA 2GS9A 4A0YA 5TJJA 4HZFA 3PTAA 4GYGA 4M9SA 2Y1XA 4ER7A 2PLYA 2G71A 3BGDA 5HZMA 5BXYA 3PLAE 3NRVA 2PX8A 3HP7A 3SM3A 3IHUA 3HOSA 4RAZA 3GWZA 2QBYB 2QVOA 2PX4A 3BWBA 1QPMA 4YUXA 2V1DA 5BMZA 1EJ0A 4RTQA 2DW4A 2M5WA 3PB3A 1TW2A 4S05A 5K5QA 4G6QA 1O9GA 1I5ZA 4BLUA 4E33A 1NW7A 4GC9A 5GM1A 1EH7A 3KE2A 5EGSA 3I5UA 1KPIA 2RV8A 1QYRA 1X1BA 4MTLA 3KZYA 3T8TA 4CDGA 1IF1A 3IHTA 4EGYA 1K7AA 4BNCA 4U7PB 3SMQA 3U81A 2ZZNA 2JHPA 2A69F 2VC1A 3HVJA 1FSEA 2MLGA 3CJTA 3FUTA 3CDHA 3KU1A 3GU3A 3KQSA 1LEAA 1ZH5A 2M45A 3IKVA 1QGPA 5ILVA 3MQ0A 3BPXA 3LWFA 3K1MA 1AF7A 3ZMZA 3ZMSA 2KJCA 3I71A 1YS7A 4FX0A 1M6YA 4KDRA 3HA3A 2XAHA 4ZZDA 5DWQA 4Y30A 5IT3A 1IZ1A 2EA2A 2P3LA 5HVQC 4PYMA 1QQIA 3WTUC 2NRAC 1Y0UA 4OA5A 4O6JA 2PY6A 1ZG5A 3HYIA 3KR1A 5EMMA 3EUHA 5DLYA 1XCBA 3THSA 3GYHX 3LQQA 4A0ZA 5HOOA 2GH1A 2K7LA 5EIWA 1RNLA 3E7PA 3TR6A 3JTHA 2B3TA 4I0AA 4I98B 3BT7A 4EKGA 1TLHB 1P4XA 5ERGB 5EKXA 2PLWA 3MTIA 2H27A 3MCTA 2RNJA 1JQ3A 2HNKA 2O57A 3HA5A 4FS8A 3G89A 4RWZA 2GWRA 3DXJF 3V8KA 1HKQA 2PJDA 3BJ6A 4A6EA 4HA8A 1IN5A 2GPYA 3E5UA 4ETSA 1ZRFA 3TFWA 2AN4A 2AOUB 4LG1A 2XKOA 2IDKA 3PS9A 3KCCA 3JWHA 3E6BA 4CKBA 3B02A 2BR5A 3KQOA 3TOSA 4YV2A 2MA3A 1QAOA 4MQ4A 3BJOA 2AZTA 4HX4A 1XGNA 2HZTA 1FX7A 3WTWC 2PT6A 1JHFA 4FT2A 2Z9OA 1FYMA 3TPZA 1FLIA 2F5DA 1EV7A 1SQGA 1J7KA 3F23A 3RIRA 4BAYA 1RJFA 5DX1A 4UVAA 4HLYA 1VPTA 4LG0A 2JTVA 2PX2A 3BY6A 3BXOA 3VC2A 2IA0A 2Y0MA 2Y75A 2ADMA 5IT9Z 4QQKA 3MCZA 5KQSA 4E2ZA 4EJTA 3MZHA 1L9KA 2XIGA 3MZYA 3HM2A 1OKRA 3SXJA 2NXEA 4L9NA 4KMUX 4NECA 1WI9A 4OOIA 3KLNA 4V0QA 4PCQA 1IN6A 2IFTA 3KQTA 1IN7A 4Z2YA 1WZNA 2WV0A 4ZYGA 1T0FA 5CVJA 4G7ZF 2VT3A 1RJGA 3HCDA 3CUQA 1XCLA 2OKCA 2P3OA 4OQEA 3PFGA 2Z99A 4HG2A 2ZWVA 2AS0A 3DEUA 3KHKA 3IEIA 3FWEA 3KPYA 4IF4A 1D2CA 3E5XA 1G38A 3OZTA 4MTEA 2V6CA 2BEOA 4WK8F 3KLOA 5E1OA 4R8HA 3VSEA 1ZAOA 1R1VA 2ZXJA 3KQWA 2HR1A 1BHJA 1KHHA 3M9AA 4A2UA 2YXLA 1Q0TA 2E1CA 1KGSA 3BJAA 2ZIFA 1HKSA 1G3WA 3WTXC 1Y8CA 2A5YB 4HDUA 1T38A 1ZLKA 3MAGA 3C0KA 1OR8A 1O3RA 4QTTB 3BWYA 4L9TA 1K6OA 1E2XA 4Y2HA 3JSOA 2FNPA 4F85A 2K27A 3TLJA 2FRHA 4EQZA 5K05A 1R8YA 1HQCA 3I0TA 3P2KA 1O3QA 2M87A 3F8BA 5LEKA 3HA7A 1SFEA 1DPRA 4BY9E 3HTSB 4RVDA 2XVMA 2H1RA 3FMQA 4YUZA 3C7JA 1SKMA 3R60A 4IHTA 3R0JA 3COAC 2PSSA 5FWAA 3F22A 3T8RA 2HYGD 3DQVC 3WGGA 4BLWA 4JQFA 2ONYA 5EHGA 3T0IA 2QLZA 1OR7A 2BE5F 1MDMB 4KN7X 1YW7A 1MZBA 3CCFA 1R58A 2ONZA 2EWNA 2WK1A 1T39A 2KIFA 4Q47A 1LJ9A 2ADUA 5DRYA 2M30A 4CWAA 1J5YA 1W5SA 4DMGA 3EGVA 3U2RA 4OIQF 5D1HA 2RC4A 4PCLA 3QOPA 1YQAA 1AOYA 3LA3A 3P9NA 1SVUA 3BWGA 1MJBA 5DCMB 1F5TA 1NW6A 2OAZA 3JSPA 2ZCJA 1YFHA 3SQNA 1ORHA 4YMGA 2RKHA 2GQQA 3ZMUA 3H92A 5EC8A 4E30A 4XUDA 1IN4A 3BDDA 3G5TA 4X63A 4FGZA 5P8WA 3OFJA 4P9FA 2EA4A 3I64A 3RW9A 4HTFA 3LHDA 1KP9A 3ZMTA 2JSCA 4WXDA 4OIOF 1T43A 2BR4A 1VE3A 3TQNA 4UVCA 3KFWX 5HIMA 4I0BA 2IIPA 5L3FA 1X19A 3EVFA 3BZBA 3S68A 2ACJA 1TPYA 4MGRA 2XAQA 4HDVA 1NV9A 3LQRA 3TM4A 2UYOA 2IPQX 2PG4A 4KDPA 5FTWA 2AXLA 3G2MA 1HXDA 4G94A 3WGHA 4BHBA 2AOTA 3FXUA 4KIGA 4O5VA 1B42A 3BOQA 1PJZA 1NT2A 4ZH4F 3O7WA 2PMHA 3K1PA 5FULA 4GXOA 3GRUA 2A68F 3FF5A 4FP9A 2PX5A 5K0BA 4OQDA 5IH3A 5CUQA 3ID6C 5GIOE 3LPMA 2MC3A 4EJVA 4DZRA 2AN5A 5EIFA 3BP8A 4LLGF 3I59B 3FZVA 5FGMA 1LDKB 4TV7A 1YZ3A 5EQJB 1D8JA 2FEZA 2ESRA 3I54A 5CVRA 3E6MA 1XDZA 4ZYEA 1U3EM 1UHMA 4LB6B 1XMKA 5DX0A 4DKJA 3E6CC 1JG1A 2IVMA 1O9HA 3G2QA 4QDKA 4I01A 2W24A 3GW2A 2CMHA 3KQQA 2O6GE 3DUWA 3HVIA 3PQKA 4MNUA 3RJPA 2HKXA 1R00A 5KK1A 3WU1B 2L3DA 4MHGA 1I27A 3M33A 1DP7P 3J81K 5HDGA 4K2EA 3CUOA 5LQJA 2FBKA 1FJXA 2NP6A 3I53A 2DO7A 1VP9A 1IM8A 4YUWA 5CVVA 1B4AA 4ATNA 3HCAA 2UXXA 5K0FA 2CYYA 3G73A 3EMBA 5U4XA 3FRHA 4HBLA 2FCAA 2IW5A 1S8NA 3GX4X 3D2LA 2Z6QA 1P92A 3P2IA 3Q87B 5LBQA 2HDCA 4N9HA 3WE2A 3D0SA 3ELWA 3G8AA 3EPPA 4HGYA 2MH2A 3TKAA 1V3FA 1X1DA 3WGIA 2COMA 4ZZLA 3CO6C 3HVKA 3R3HA 2BH2A 3C6MA 3HTXA 4U0YA 4P5OA 2NAZA 1TBXA 1JQDA 2K4JA 2HS5A 1ONVA 2VXZA 4EJWA 2KW5A 5BW4A 2FQ3A 1B1BA 5KVRA 4CTKA 4DNCA 4KVZA 3DMFA 3KEQA 3M8EA 5FO5A 3JWGA 1Z3CA 2QE6A 3EVZA 3ABUA 2QY6A 4A12A 1C0WA 4HGZA 1J59A 1OYIA 5D8LB 2PGXA 1VP3A 1ZYRF 5T64A 1P1BA 1XGSA 2KIUA 1FC3A 1YW8A 1NBIA 3C6KA 4M74A 2L4AA 3LAPA 2FA5A 2HYFA 10MHA 2XROA 1O3SA 4CKEA 1GHCA 3SZPA 2H6CA 3BZ6A 4UV8A 4M71A 3OU7A 5HFJA 5HDNA 4U7DA 3L7WA 1H0MA 1R23A 2A6EF 3Q9SA 4R79A 4PYLA 3KPWA 3SZTA 3H3UA 3KP2A 3SXYA 1P6RA 1XVAA 4ESFA 4M36A 2O05A 5E18F 3ERED 3B89A 3SVZA 2J5OA 3ANXA 5GOZA 2OB2A 2PN6A 5EKUA 1IXKA 3R24A 4PYKA 4EMSA 2IRFG 1TQMA 1V39A 5HS7A 5C0OE 3MHTA 4AVPA 1F3LA 5HLIA 3GXOA 5TRDA 2QQBA 2DK8A 1EJ6A 5HLGA 4LJZF 2O06A 1J0RA 4H0EA 5T6BA 1DL5A 1JG4A 5A2QK 1XSXA 2ZZKA 3Q7EA 3B5IA 5JFRA 2FMYA 5C1IA 1I6XA 3CJNA 3LSTA 3WODF 2C7RA 3O6BB 3RPQA 1U8RA 3T5XA 3HUGA 1KIAA 3C3PA 3UJBA 3WE3A 4IXAA 1R36A 2JT1A 2PVCA 4R8RA 4GO1A 5DUKA 4UHTA 2DULA 4HQEA 5D5VB 1B9NA 2NNYA 2IT0A 1XSDA 3B3GA 3KP7A 3MQ2A 5K0CA 4XBFA 2IA1A 3E6DA 3K6RA 4IHSA 1LDDA 2XGXA 5K0GA 2PXAA 3ELDA 3P2EA 3CJQA 6PAXA 1YB2A 3GRVA 3LCUA 2CMGA 2JPBA 5DM2A 1VQ1A 5HIIA 1JTEA 3Q9VA 4IRHA 2KJBA 2ZNZA 3BGIA 2P1DA 3A26A 3F8CA 3W6KB 4LECA 1SD5A 1JGSA 5LGNA 3QOWA 5T67A 5K0LA 3DH0A 4XUCA 3UJ7A 3EVCA 4E32A 1SD6A 4JXJA 2OZ6A 2O8XA 3GNLA 1QNTA 1EH6A 3GUDA 1O54A 2O03A 2Y48A 3KZZA 1P4AA 1I9GA 3K1NA 4P7GA 3J80Z 5DCMA 4E2XA 2ISYA 3LDUA 2HEOA 4LK0F 5CLSA 4GCVA 5F2KA 5EMJA 2P8TA 5FB2A 5D5UB 2CO5A 3KQMA 1K78A 3PFHA 4C04A 2GIVA 1TQIA 4FHTA 4LB5A 2UWMA 1JG2A 2E7XA 2ZMEB 4DQ2A 3GZ5A 5ILUA 1N7IA 3NWBA 3HOTA 4DCMA 4M37A 2QQ9A 1R1TA 3FTEA 5D4SA 2H00A 1KYWA 1LVAA 4PCAA 3L9FA 3GO5A 4RTMA 2QZ8A 3GZ6A 2PEXA 1R6AA 1ZQ9A 2VODA 5EPEA 3ZN1A 1S6LA 1IRFA 3ZP5A 3OU2A 3FZGA 1Z9CA 1UFKA 5HILA 2EFJA 4PDKA 5DPMA 1BM9A 3FX3A 4PZJA 5J8CA 4NHJA 1BI3A 2YXEA 2ZIEA 2DBBA 3CC8A 3TDUC 5EZQA 5G02A 2G70A 1FWZA 3K69A 5DD4A 2EV6A 2OU2A 3A7DA 4KIFA 4D0PA 3KQPA 1W5TA 4ISCA 1HKTA 1F38A 2DAOA 1Z05A 1W7PB 4I2OA 3F8MA 4QPNA 1VIDA 1FPQA 4U7BA 2DFIA 3DLIA 3PX2A 1R18A 4HH4A 3FPGA 1DUXC 4QWQA 3QP6A 1NV8A 2CGPA 2VN2A 4LG0B 4UXNA 3FPEA 1RI7A 4EM2A 5D5XB 4RV9A 1DDNA 2LD4A 5ICEA 3GRRA 3NJRA 3RDIA 4ZYHA 3CBGA 4BP1A 4R6XA 4X1OA 4F84A 2E5WA 1BI2A 2XAJA 2ZWAA 2L54A 3LDFA 3X0DA 4A6DA 3B3JA 1TNTA 3CO7C 3ULQB 1HSTA 2D1HA 3U9GA 3DXXA 3TM5A 4OA8A 3E8SA 1L3CA 3OZSA 2VDUE 3HRTA 2P7HA 3TMAA 5ILSA 2K86A 1UIRA 3M1EA 2HOEA 1KR5A 4EM1A 3IC7A 1IRGA 4RGSA 4NQWA 4A5MA 4E31A 1U5TC 4MTDA 1FBSA 4RB3C 1XCJA 1USSA 3FYDA 4P7JA 3V7CA 4UVBA 3K0LA 3JAMZ 3BWMA 3I59A 3GF2A 3QPTA 3KEOA 3V8VA 3UBTA 2MD5A 5K01A 5E1ZB 3M6VA 4LWOA 2F8LA 2CQKA 2NXNA 3IV6A 1JR4A 1HW1A 3AXTA 5CVUA 3TRKA 1JTFA 3LCVB 1YZHA 2FE3A 4EM0B 3FPJA 2A61A 2VC0A 5KYGA 2NNNA 1G3TA 3QP5A 3E3VA 3L00A 2IH4A 4KMFA 5HIJA 1Q1HA 4PYJA 1DUSA 3C3WA 4G7HF 3BKWA 2BV6A 1KQ0A 5E1XA 3V97A 1S29A 1XJ5A 5LQCA 3P9KA 1YO5C 3B73A 2XBMA 1ON1A 1OYYA 4NB5A 2P7IA 2L4MA 4I09A 1IUYA 3QOXA 5H6RA 4ASNA 3C18A 3O2PE 5IT9K 4BHCA 2EFNA 3HCCA 5F1RA 3SGLA 1G55A 5CJ9A 5DCFA 1BC7C 3V7SA 1VTNC 1OYWA 3PVCA 3HRSA 4KT5C 1NBHA 1BOOA 2ZNYA 3HEMA 5DTQA 4CO8A 3JAMK 4RVFA 4DCGA 2YXDA 3V4GA 3FUXA 2DU9A 4FSDA 2L02A 3V8JA 4EK9A 3BWCA 2ETHA 3FPFA 1CF7A 2FMLA 4U0WA 1LB2A 3OU6A 4LMYA 2JRTA 2DPUA 3FM5A 3MAJA 5E8IA 1JSZA 2IDJA 2IBSA 3O31A 3FRIA 5CCBA 2JH9A 4MWZA 4LK1F 2ZZMA 3FPHA 2B2CA 2IJLA 4UV9A 5DSTA 4HX7A 2PWYA 4DQ0A 2EJTA 2X0LA 4IJAA 4GOND 4ENJA 4EVIA 1ULYA 4AZSA 1D5VA 4PYQA 5GINE 1FYLA 1EG2A 2V1XA 4PONA 2HQNA 3RODA 3RYPA 3MB5A 3E05A 1Z1DA 4JK1X 4WX9A 3LAJA 3UA3A 4KFCA 3CUQC 4HV6A 1AQIA 2P6TA 1PP8F 2JPCA 4KWCA 2Q8KA 2ISZA 3EVBA 4Y13A 3I9FA 5D5WB 1ON2A 3GRYA 2C7OA 4RTOA 1A04A 2W85A 4A0XA 3HNRA 1XMAA 3R9XB 2PFBA 2B25A 1G8AA 1RJEA 2ZVJA 4OBWA 4YFXF 1QZYA 3K0BA 3SFZA 4AZWA 5F6FA 4OMYA 1RI2A 3HCFA 4G8XA 2FU4A 1Z6RA 4EJOA 2IP2A 3UZUA 3DTNA 3M6WA 1UCRA 2BYVE 5F64A 4B09A 2CW0F 4YFKF 4RTNA 3WTSC 1V4RA 1KQ9A 1F9NA 3M7GA 2XUBA 1XCVA 3FM3A 1D8KA 3NQOA 1KQ8A 4FSXA 4PYIA 3QPHA 4Q48A 2YX1A 4OINF 1HMYA 5DM1A 2PXCA 1LNWA 3ZN0A 2DPDA 3DV8A 2VONA 2G7HA 5EZSA 3VFZA 4RTPA 1B59A 3MGGA 2STWA 5M5BA 2OYRA 3LX6A 2XAFA 4POOA 1XTPA 2TDXA 4PYOA 5ICFA 2EV0A 2P5KA 2Y1WA 4DM3A 3M6UA 1R74A 3LKZA 3IWFA 2WC2A 2EJUA 1TW3A 1GVJA 1BOAA 1RI3A 2UXNA 4L9VA 2CL5A 2P41A 3B7PA 1BC5A 4L5JA 2NS0A 1KA8A 2AOVA 2AVDA 4OX9Y 4GUAA 1DPUA 4ER0A 5E2AA 2DLLA 5E1BA 3MWMA 2DK5A 3HIFA 1UB9A 2O61A 1SQFA 5D6FA 3LGAA 4R6WA 4Q5SF 5FCDA 3EDPA 3P7NA 4EQQA 2I7CA 1M0EA 4Y15A 3H2BA 3DF8A 2BBYA 4GYIA 3FMSA 2OZUA 4OBXA 1RUOA 4CTJA 4IRIA 5HS9A 2P3QA 1FYKA 1T6SA 2Z6AA 1G3YA 3F21A 1RUNA 2HTEA 5LQUA 2PBIA 4GGGA 4AIJA 7MHTA 4EJUA 2EFPA 1JXSA 1YIOA 3F6VA 2UYQA 4KN4X 4XCXA 3GGDA 1HW2A 3NVMB 2AOXA 4C4AA 1YS6A 4P96A 2L01A 5KQRA 5LQNA 4RB0A 3LA7A 4ENKA 1FY7A 2Q0OA 3SSNA 4M6XA 4CYDA 1NHAA 3IRRA 2IGTA 5EG5A 4AZTA 2A14A 1ORIA 2BZGA 4GOLD 2XYVA 3GJYA 5FUBA 5GP1A 2NP7A 3O4FA 5D1NA 5LHIA 2A07F 5AIPA 3A25A 3EVDA 3NEUA 2HQRA 1BJAA 3CUQB 3CVOA 4AZVA 1BC8C 4IPAA 3EEYA 2O3FA 5EVJA 4Q4ZF 4M6YA 2UZKA 4QVGA 1KPGA 2EV5A 4MQ9F 1KU9A 3ECOA 1RI4A 3F6OA 4OU0A 1CF7B 3RKXA 3OE5A 5DT2A 5E9QA 1JE8A 1G6NA 1G8SA 1MHTA 5DUIA 1W7PD 3SSMA 4QTUB 3ELYA 5FLXZ 4M7RA 5DSXA 5ICCA 1BIBA 3OCJA 3ORHA 4JBAA 5E17F 3ECHA 3R4KA 2V9VA 3EYIA 1N2XA 2M1BA 5L3DA 5DYMA 2VT2A 1REPC 4HSGA 3RTRA 2QYOA 2D45A 1ZGJA 4ER3A 1IAWA 1KU2A 4RVGA 1WQ2A 2VDVE 2RVCA 2MBFA 2IH5A 2G9WA 5LR6A 2DPMA 4LD5A 3P8ZA 1BI0A 5K03A 1MKMA 3GFLA 4RB1A 3ZMVA 1PUEE 3WTTC 2XVAA 1HW5A 4MEYF 1STZA 3I4PA 1YTYA 4CZZA 2R7FA 2XRNA 3HCEA 3PX3A 5DM4A 1L3IA 2YVLA 4H0NA 3GFIA 4YG2F 4HTFB 3FXQA 4ENNA 2DI3A 2OPBA 4QLCU 3G5LA 1R7JA 1PRYA 3QU6A 4X60A 5DM0A 4AUKA 1KU3A 2P40A 4M72A 5H20A 2XHKA 5DTRA 5LLQA 4PWYA 3TO9A 2ZBRA 1NE2A 3RYRA 1P2FA 4HOBA 2HTJA 5E1WA 3KR0A 2ESNA 4ZYDA 3DOUA 4P55A 4L9JA 3ZQ7A 8MHTA 4HF2A 4E2WA 4IKPA 2XYQA 3U1DA 5AONA 4IV8A 4E2YA 3DPLC 4PINA 4I7HA 5AIQA 4UOEA 2FHPA 3EVAA 1L3BA 5LSAA 3ERCA 3T0YA 1SD4A 1RI5A 5DRTA 1FNNA 1W4MA 2ORED 4RTRA 4LGWA 2OBFA 4HRAA 2YX7A 3KPVA 2XVCA 4OMZA 3GRZA 3TO7A 1P4WA 4UUVA 2QENA 2X4HA 4IRGA 2WTEA 1ZN2A 1WXWA 2EFQA 4KA4A 1MDMA 2P35A 2XV4S 1JSXA 2P8JA 2PXXA 2M8EA 3LA2A 5K0JA 2K4BA 2LKPA 4GF5A 3VYWA 3DR5A 3UJ9A 3IRQA 3GFMA 1XXLA 3GLXA 3NDIA 4HYEA 3KP4A 2VBXA 1WKMA 3LCCA 2LF8A 5A2QZ 3R61A 1MD0A 1F4KA 5DEQA 3OZRA 3GIWA 4C06A 5J8FA 5CM2Z 2ZMEA 2HMYB 2RQPA 3NW9A 2ZJ2A 4EGZA 1YYVA 2ZW9A 4G56A 2ZBQA 2AS5F 2F2EA 3QAHA 4CGZA 4CICA 5CVIA 3Q5FA 1IN8A 3UJAA 3THRA 5LEJA 1ZKDA 1MGTA 1G4DA 3NTVA 3RKWA 4XRFA 3LL7A 3GO4A 2HR3A 1YUBA 2FPOA 3UJCA 2VE8A 2O0YA 4R1HA 5EMLA 1J75A 5CVEA 5ERIA 4ESBA 3NVKI 2FSWA 1I1GA 1UWVA 2H09A 3MEXA 4BYYA 3LBYA 3AXSA 2HFHA 3ME5A 4G7OF 1S7OA 3FUWA 3OE4A 2IA2A 2PI0A 4MQVA 3ELUA 3F4KA 3G8BA 5FADA 3TKYA 3JWIA 1B6AA 2J5PA 4YV0A 3KETA 5E8JA 1FBNA 2OQGA 1QZZA 3N4MA 5EOVA 5BPDA 4WVLA 3JW4A 2CSOA 3WTVC 1LQ1A 3PT9A 3DMHA 2HGCA 4LLLA 3LECA 1SFUA 5JI6A 3A7EA 1U2WA 1ZREA 1S3JA 1WY7A 4M9ZA 2D1VA 1D3YA 4HAMA 3IYLW 2NYXA 4F7ZA 5FQOA 4PNEA 2E7WA 4G9YA 2PKWA 3DLCA 1SD7A 2FNAA 2AVNA 3FMRA 4F86A 3S2WA 4IWNA 3LBFA 3KKZA 5E9WA 4S04A 2BM9A 5LGTA 2CWWA 2JHAA 2Q2EA 2GXBA 1HBXG 5BPIA 1INLA 3T1BA 1R22A 3UJDA 1AWCA 2N47A 3TOBA 3PFIA 4FX4A 2G8NA 2YQZA 3UJ6A 2LSOA 3GVAA 3VEPA 3HCBA 3GCZA 5FA8A 4MHTA 3AJDA 4KUMA 5GWXA 3P97A 2IPXA 4RAYA 3DXYA 2VBWA 2RDPA 1FBUA 2ZBKA 3P9CA 4YIIA 4RSRA 1BKYA 3DULA 1X1CA 4C08A 2P7VB 4YUVA 2EFWA 4HQMA 4OIRF 1ZHFA 2YX4A 1T2KA 2F5FA 1P91A 3F3XA 2QQAA 1E17A 2QRVA 2AOWA 2MLKA 2B78A 4G6DA 4U0VA 2JZYA 2P5LC 1U78A 2P7CB 2YU3A 1OPCA 1KYZA 1YF3A 4YMHA 3J81Z 1O7FA 1X3UA 3G3ZA 5LRRA 5DX8A 5CCXA 4O29A 3OFKA 1UHWA 5D4RA 4FT4A 2ZBPA 2PJPA 3OPNA 5LQRA 3CKKA 1FP2A 4AIKA 5IKMA 3EEOA 5DXAA 1TQPA 1H9TA 4QPPA 4O3MA 2HTSA 4N9IA 4M73A 2RN7A 1XGOA 5JR3A 2WA2A 4ON0A 1VLMA 3RI4A 2GA9A 2XKPA 1OMIA 1L3LA 5E8GA 4RYLA 3R0QA 4M38A 5CIYA 1KPHA 5E20A 2CKDA 4RVHA 5L3EA 2P5VA 1SUIA 2QRVB 2YTZA 1XD7A 3EVEA 1Z6TA
chains in the Genus database with same CATH superfamily
2AD1A 1Q1ZA 4TKLA 1E7WA 3FTCA 4YO7A 3PXDA 2QE7D 4RNDB 2PCLA 2H94A 1X2EA 1QZXA 3GPIA 4NV3A 3ZDYB 4F2PA 4IS2A 1H9GA 1ZARA 2GZ2A 4MVJF 2X42A 5ILQA 4YCSA 5DM6F 1AF4A 1GEGA 3TSCA 2CFSA 3ZCUA 5ISMA 3DE1X 1BN5A 1F5SA 2KIMA 5J1RA 2BE9A 3GG9A 3QKRA 3VR2D 5K8VA 5JJIA 4UARA 1T5SA 2C42A 1RLIA 2YVQA 1WW2A 3WMRA 1RAHA 2PWPA 1SBIA 3KL4A 4HWPA 2K7FA 5HLHA 1D0YA 1BCRB 1G2QA 2Q1XA 2R6FA 2W2NA 1XDUA 2YOHA 3GVHA 2NXJA 2DE0X 3L93A 3R0AA 4GP9A 3QJGA 4BXOB 3U44B 4KJZA 1FX1A 1SG6A 1QHYA 2ZU0C 4RD4A 1ABBA 3OOPA 1HDXA 1NVVR 1OLUA 4TN1A 4FWIB 2EHDA 4DJTA 2HWXA 3OCXA 4LGMA 5A7HA 3GLSA 1EVQA 1R5OA 5LJLA 2RC5A 2O8NA 3LNTA 5CT9A 3TG2A 1ZM4A 3SZUA 1MBJA 3FA2A 4XSGA 3TMYA 4BQRA 4D3FA 2PQ2A 1JEYB 1FFSA 4D9CA 3P27A 4UNIA 2LGJA 2QRLA 1XZPA 3OT5A 4JR1A 4M0PA 2W6JA 2E7ZA 4ZYLA 4X1IB 2ABWA 2FKNA 4CODB 1GY8A 4IIJF 4UPVA 2LCFA 1E3QA 1O95D 3CR7A 2VXCA 4ZTBA 4ARSA 2DFEA 4R7TA 4UU1A 2ELJA 1ID1A 4L0YB 1MJFA 1JA9A 2ZRDA 1PAUA 3BJIC 2QF7A 3B70A 3QU3A 1ISIA 3HGQA 4ILKA 2EYQA 3KT8A 4NNOA 5JYCA 4L72A 2VAWA 3CC4I 2QVLA 4Q4AB 4QSMA 4OQLA 2O1XA 4KAAA 3CUTA 3UMSA 2QV0A 2VHQA 4DR6B 2QUFA 2AN1A 1CY2A 2CHGA 1Z38A 4ZDIA 5FD5A 1Z2DA 2IE8A 4RJJA 1YCDA 4QPQA 3C5VA 5K8LA 2ZYIA 1RESA 1Y9ZA 2ZULA 3OA0A 4K8OA 4Q1CA 3D59A 5JXGA 3L4JA 4GZ5A 4N8EA 2HGZA 4LY3A 2IW3A 2H3HA 3D1NI 1L5WA 1QO0A 1KSGA 5JSYA 5BN3B 3SS7X 1I0ZA 2H5LA 1QMGA 5I7WA 1X1AA 5KYUB 5FOTA 3DMTC 3ZC3A 2LF7A 4P32A 1PD0A 2H4HA 4HF1A 2OR3A 3U9TA 5EIOA 1LLFA 4XB2A 4GXQA 2W2KA 2IGOA 4TLBA 3VU1A 5B4TA 3OP1A 4NMMA 3WGTA 4F6CA 2NSLA 4HLUC 4HAOA 1N4AA 3GLGB 3QV2A 4Y33A 4BVFA 2Q6IA 4BV2A 4UHBA 1PNTA 1QV7A 2GN4A 4KNYA 4EV0A 4M0DA 4BCDA 2R92J 1E4EB 1IHPA 1ZWLA 3Q2KA 4GYWA 4J16C 1NNUA 4DIMA 3QX3A 2BV3A 1UANA 3DL2A 1Z4PX 1HSZA 4YWHA 4EKIA 1BMFD 4Q7LA 2TCTA 3ENQA 1LCIA 2G07A 1ABFA 5HNFA 2JCSA 4MUJA 5AW5A 2A78A 5AQEA 3ZY6A 1Y1PA 1NJ8A 1YZQA 4N49A 1M1YA 3OFSA 2PRSA 4C01A 5IH7A 3GEZA 5BRJA 3WY9A 1JIUA 5K8UA 3H9UA 4ARZB 4JJIA 2FOKA 2HQAA 2EZKA 4NAHA 1ST3A 5ENVA 4O4IB 3T3MB 3BCSA 2PMUA 2HV9A 3A06A 3ESCA 4MCAA 2X6WA 3MERA 3TQCA 2BCJQ 1PJ8A 3TVYA 4EL5A 5JFTA 5MN4A 4N5MA 2ZFUA 5E2BA 1LXCA 1SFRA 2DOFA 2ZQ5A 3CXRA 3OX1A 4Q93A 4ETMA 1KI3A 3MFKA 4PZEA 4RCVA 3T1TA 4CKCA 1NW5A 1MO6A 2JRMA 1K7FB 3EEFA 1JKQC 2OCKA 4K8RB 1TYDE 4P4GA 4WCFC 3OKAA 4ETWA 5BQTA 4PYNA 1F06A 3OE1A 3JAWA 2STTA 4B3AA 1B2LA 4KV9A 4Y7DA 1T3GA 5K0EA 3EQ7A 1RIOH 2PH5A 2V74B 5TQ2A 2EYUA 3FGZA 1AHPA 3P9YA 5KX5A 1DC8A 2BFFB 4P4UA 3F7TA 2GOXB 1E2LA 3ENZA 4JIGA 4QBIA 2HPHA 4R1NA 3LOQA 1IOWA 3PNVA 2A0XA 5EPOA 1Z13A 2Y0BA 1FE8A 2F00A 1CD5A 3L1PA 1EWRA 2CLLB 3SYLA 2XUGA 3NEYA 2C61A 4MSUA 4Q7QA 3TOCA 1CUIA 4X66B 3WXMA 1ZA2A 2R5YA 4YGYA 3KQHA 1WHTB 4CUZA 4G0WA 1R10A 2ZSUA 1M7HA 4U7GA 3EX7C 2C7GA 1JHYA 1FRNA 2BGIA 4XOPA 4G4SP 3A1TA 3BG6A 3DOCA 4D0RA 3AI2A 2RK4A 1Q7RA 3HBMA 2CY0A 4NU0A 3RROA 9LDBA 5F51A 1P7VA 1WWXA 1QANA 3NC0C 5B1SA 3SEFA 4EEFG 3IWZA 1D2NA 4K9QA 2FLKA 1E9FA 3L1IA 1R12A 5FFNA 5A3QA 3ETCA 4XLNF 3SBDA 3SQMA 3ZE1B 1JMVA 2W11A 4RGUA 3E5QA 2VBCA 1DBVO 3KALA 2OO7A 2NTEA 3TTUA 4LUCA 4H9GA 4ZCTA 3J80K 4LNAA 4MHOA 4N39A 2KE5A 3N8HA 1HL7A 3OSZA 4OHRA 1F43A 1T1GA 4HWOA 3KR9A 2OB1A 1PL7A 2A6HF 1NRXA 3AETB 3L6RA 3ONVA 3UCXA 3PIDA 2M9MA 1JUSA 3OQBA 1FX0A 1S7AA 1P1RA 2QM3A 1R5JA 4NEQA 4KZKA 4PRZA 3QITA 4Z7NB 1VLHA 1SFXA 1HETA 1YWGO 1T9AA 2RGVA 3S7TA 3TL3A 1W85B 2XYGA 1C29B 1EP2B 4I1PA 2LG4A 1XLTA 3E82A 4CKEB 3H9QA 1Z0DA 2YNMC 1YR8A 2UUOA 3BSFA 3HLTA 4FR0A 3I6MA 1ZN7A 2AOTB 2N42A 3OA2A 1D2GA 1G1AA 4LQLA 3ER8A 2QPAA 5LBUA 3KQKA 4G6ZA 3VPRA 1FT9A 3GLVA 4XX0B 1OH7A 2PUBA 2YHAA 2BGCA 4YRAA 3OYAA 1NY5A 2C2MA 1KMIY 1C0LA 1MTZA 3E3OA 3WLTA 3CPJB 3FCUB 1N1MA 3IQXA 1CR0A 4NU8X 1NUSA 5KREA 5BR4A 2PMBA 1TCVA 1PSWA 4M9XA 3G2PA 1WJFA 1NQXA 3WU0A 1DKRA 1K79A 1U2SA 4YQYA 4CIXA 4YS6A 2H11A 2Q0QA 3OCCA 4O2AB 4PAQA 1KAEA 5IW8A 4DA7A 2C4TA 4LPKA 2GAUA 1OAOC 1WG8A 2Z3VA 2VJ5A 1VCMA 3MHPA 4R31A 4ZYTA 1NLZA 3LL4A 4HX8A 3HU2A 4L6IA 3S1SA 4FMBB 3NGXA 2POCA 3SC4A 3S1RJ 1Z91A 5C44J 4NYIQ 3Q8XB 1ZJJA 2VS1A 1W8IA 1YZFA 4HDMA 3UK1A 4ECEA 4KCGA 4BFCA 1FJ2A 4OJYA 1WZIA 1QQ6A 3CPEA 5G41A 3OQMA 2RMKA 2HWUA 1Q57A 2OCAA 2WOOA 3ABKH 2P6SA 3OECA 2VQSA 1T9HA 1WS6A 2ZBEA 1QF7A 3L7OA 4TRNA 1TFRA 4QULA 1ECBA 2CNKA 1E6UA 5CTJA 2V5VA 1SUSA 2C7VA 4Q02A 3CF2A 2JK3A 1AZSC 2PMWB 3C4VA 1E60A 1EFVA 3IMFA 3I01A 4DQXA 3QXSA 1N0HA 2Y1FA 3WYAA 4O4JB 3RPUA 4ER6A 2H1CA 1RRGA 6ABPA 1SCUB 4YC7A 5YASA 5EJ8A 1M1ZA 3SQOA 3T3OA 1HM5A 2ICAA 3KZKA 3N2EA 5KVVA 1BS1A 3WYCA 1Q7GA 5ALRA 2VOPA 4ZDOA 3L49A 1MB4A 2V79A 1XQVA 2WJWA 4LXYA 4AWBA 5A6SA 2XMCA 2XXAA 3V80A 3ZK7A 2JEOA 2GXSA 2V7EA 2A84A 1H3FA 3K5HA 3KPJA 3P9QA 4IXTA 4EW2A 5HIAA 5GIPE 5A2QA 4MK4A 2G6TA 4R8SA 2Q4RA 3JARA 3F4BA 2CN1A 4EG8A 2VJ4A 3I56I 1TZJA 3UJ8A 5F7ZA 1UXOA 4Y2XA 5IX8A 3FUVA 5HJ7A 1NVVQ 1SKBA 2OVBA 1M5TA 3CJRA 3CVVA 1BH2A 2VBIA 3K8ZA 3I9MA 4KOEC 3W5VA 5LMCA 5FLXK 4OU5A 4I5DA 3V8LA 3F6PA 2JHCA 3QPSA 3GEEA 4MVJG 2PJRB 3HVRA 1WMSA 4ZU6X 4ZK2A 4BH9A 4W99A 5BOXA 1YZKA 4B85A 5BWMA 5LQAA 2UYHA 4PGGA 2DUUA 4ZKDA 1ELOA 2RARA 2PT5A 5FKMA 5FNZA 4C7OB 3ZXYA 2F1OA 4GOJA 1D6MA 5BS6A 4TMZA 2IU3A 1AQ6A 4JENA 2Y9ZA 1CUWA 4RABA 1ZD9A 1ZUNB 1DKOA 3JARB 3KAQA 3OFVA 1XQ6A 1DMSA 4XSZF 2P5UA 1VL5A 2FBHA 5ED4A 4G07A 4W6ZA 5CVDA 4L0ZB 3K8YA 2PQ8A 2ZEJA 4GRIA 5DHAA 3RK4A 1J8MF 3GJ3A 3W3AA 1M8KA 3DFGA 3CH7A 3I92A 1W2WB 3O3NB 3ISPA 1SCDA 4JJKA 4U5QA 4B17A 3U44A 3QPAA 1UXJA 2O7NA 1N9KA 4BFXA 1J25A 4W7HA 1BCRA 4EGJA 1L4GA 3F72A 1JHHA 2FV8A 2NO0A 3HKEB 2B4YA 2BWJA 4WZAE 2Z8ZA 4XJTA 5G1OA 4HV5A 3UT5B 3GLFB 2ROQA 1AH2A 1EIZA 2QZ4A 5C9ZA 2HMVA 4HW0A 1RYNA 3MKZA 2P2CA 3L2OB 3DNMA 4LITA 3PTLA 2V4UA 3AW8A 4I8IA 2GAOA 1UJBA 2J7PD 2NV0A 1Z7UA 1EM8A 1R0RE 5FYQA 3RUIA 4BAUA 5CDUA 4PGHA 3NHLA 3EETA 3PQJA 3RTDA 5F5NA 1T25A 4OQMA 4YIKA 1I50J 1RAIA 1EB8A 6GPBA 1NJ6A 1J39A 3DP9A 4EY4A 2XUFA 3U1BA 2IYPA 2HCTA 2EL9A 4H4KC 3OCZA 4JLJA 2JLUA 4WCGA 3LSMA 1E7RA 2WUWE 3PIPF 3AEYA 3ON5A 3A32A 3DYBA 3PKJA 2GTIA 1U90A 4KFSA 2X2OA 4DTCA 4XDGA 4IFBA 3MJTA 1NNEA 3NX4A 5TF4A 1Q91A 3WNZA 5BSHA 4RE5A 1UJ5A 3KK0A 3ZHQA 1EQAA 3OHMA 1DAGA 5INTA 1L5NA 1Y37A 4XK4A 2R86A 2E6KA 2B0LA 2TMGA 2B9EA 3C1UA 3F3MA 3OZFA 4EPXA 1IXZA 4B6OA 4P7BA 1L7BA 1USTA 5L3GA 2FK7A 4JSTA 4L0CA 5ALOA 4ENSA 2ECQA 1GT0C 4MAAA 5JH7B 2GXQA 5AXBA 1X1RA 3COZA 3MOGA 3K05A 3RI3A 3ZK8A 2Q4BA 1CZUA 4DHWA 4IMRA 1TIKA 3DPIA 4JEIA 5E6RB 1QFMA 3GTGJ 3T5TA 4ZXPA 1IOLA 2WJVA 4BVJA 2ZIAA 1SMYF 1TCCA 4OXQA 3IEMA 1O3TA 4LYAA 2Q07A 4P58A 1DOAA 3IVGA 1GA4A 1NP7A 4ZDPA 4I50A 4LWQA 4PW0A 3X1XA 4KYTA 3ZI4A 3WTYC 3OT4A 4UEJA 4PX3A 3WFZA 4E11A 1YX5A 4YRMA 4E7ZA 4Q7KA 4AY5A 3Q9UA 4JVSB 2O07A 3NPMA 3KYCA 1RWVA 3N9IA 5HVNA 4FE4A 1SGWA 2RGXA 3L7BA 4WKCA 3LPAA 1ZRHA 5T4BA 5E1DA 1TKAA 1R3UA 4C9YA 1GL3A 3KKNA 3I12A 4H3SA 4WLEA 1UBTS 2FW8A 2UKDA 3GFVA 3QWFA 3CLOA 4L5IA 1Q5PA 3JQ9A 1XUOA 4RDHA 4UFOA 5ERXA 3H3VK 2R7RA 1XGMA 2VDRB 3A0BC 1M1EB 1HURA 1DKQA 1I24A 2CDAA 2VSXA 3HL4A 3MINB 1PGJA 2Y92A 3DKWA 3WWEA 1KFJB 3NFRA 3ML6A 2G9ZA 1M75A 2NZ2A 2M6KA 3ZXUB 2Y77A 3Q40A 2QU7A 1GPNA 3OR2C 4JDPA 2YHSA 3QI2A 4CGYA 2H2DA 4ESHA 3TGPA 1HNWB 3IQWA 3PC7A 3V8NA 2OVFA 4I4CA 3MG9A 3DZ8A 1UXIA 5DGCA 4DYQA 1EF4A 1JR2A 2HRZA 4ZCMA 2ID3A 1NW8A 1UKZA 1Y8RA 4GNRA 1QRAA 2JH8A 4RD1A 5IC4A 3REOA 1K8YB 1PLJA 1XCPA 1EQUA 2IXFA 1RYDA 4QC2A 3E5MA 3TDZC 4YIFA 2DDBA 3OPMA 4ARVA 1XDSA 2DLNA 2PAFA 1Q1QA 2ZVQX 2FSPA 1RFLA 3VV3A 1FDOA 4IJKA 2BFFA 1A31A 1HSJA 3UHJA 5FPKA 3DZHA 3RLFA 1I2DA 2GERA 5BOSA 5DGIA 2HJRA 2J0UA 3GEIA 4Q4CA 3PD1A 3ZWOA 1CLUA 5GM2A 1GKYA 1V47A 3OCUA 3ZGNA 1ML4A 2AXPA 2R6R1 4XR9A 2O1SA 3EZYA 1EAYA 3H7AA 1VBFA 2VQCA 3FTQA 4WWCA 2GM5A 3WHBA 3GA7A 4XFKA 4BN4A 5J2TA 4NATA 4E51A 1BFUA 2PLRA 1JJBA 2DFLA 2KRFA 5CYVA 1L8LA 3OJOA 4IG9A 3CLSD 3RYFA 1P4HA 2R47A 2QBYA 1V25A 3EVNA 2R3SA 4ZC1A 3EYAA 3STUA 4PVDA 2FLVA 3AJ9A 3G2OA 4DBLC 1COWD 3QU7A 4OOEA 3V1YA 5I4IA 4X1YA 3QWAA 5DHTA 1R0SA 2HXIA 3JQGA 3V7RA 4G1VA 2PFGA 3T3NA 4AF7A 5A05A 3A9CA 4D0NA 4MINA 2G9NA 3UIEA 5JS2A 3H5RA 2K3FA 3HGMA 2WUFA 3H99A 1ESNA 1NLUA 2FPMA 2UDPA 3GDHA 4DIFA 5EZYF 1L1EA 2JFWA 2JHGA 2XT6A 1EVIA 3CLKA 1BO6A 1XPJA 1IO2A 4FDAA 2ES4A 4FFRA 4NOJA 4YRNA 2GD0A 5D3MB 1UOPA 2H9YA 2H5EA 2VHXA 4LJYA 4LVOA 4P9UA 5SY9A 4QYIB 1C2YA 3ROUA 4E7OA 3BR3A 2VH1A 1D07A 1K4KA 2BTOA 1JZQA 2RGDA 3EIWA 3EBOA 3QYPA 4W63A 2WD7A 5DYNA 3USES 2FXVA 3NUGA 3PUXA 4CFYA 3PTAA 4C1NA 1ZUIA 4ER7A 2PLYA 3C5HA 4V39A 3AG3H 3M1CA 3MMSA 3PLAE 4PLTA 2PX8A 2I7DA 2OGUA 1KFBB 3SM3A 3IHUA 1OPXA 4RAZA 2WIDA 3GWZA 2HL6A 3CP2A 2QVOA 1RRMA 2P2YA 5DLPA 4HHEA 5DN9A 1YDFA 3IUEA 3ESXA 4OBBA 1CT9A 1PYGA 1J2JA 3JR7A 3OOYA 4RVUA 3QUBA 5F76A 1UADA 2VPYA 1Z4IA 2V1DA 2ZPUA 4RD0A 3ZQUA 4ZCIA 5AQ1A 2WF5A 2DW4A 3FYTA 1QLHA 1B2RA 1WETA 1XNJA 5GZ1A 4J0HA 1S96A 1TW2A 1OA0A 4S05A 2JFXA 3UJPA 2JIRA 1I3KA 2EKLA 2VPPA 3I8XA 2WIKA 3A2NA 2QWXA 4G6QA 1IMOA 4FEYA 3UICA 3OS0A 3HUGB 1UBOS 4JB3A 1TGVA 3EEBA 3LGSA 2B8WA 3FCCA 2CMPA 1SKYE 3OG9A 5DSZA 3QLJA 4E33A 1Z3XA 1LZLA 5GM1A 2PKRA 1P45A 1KPIA 3NANA 3FWPA 1X1BA 2RV8A 1ZH4A 2FXIA 4AN4A 4MTLA 4NCHA 3RSOA 3PJDA 4CDGA 1X9HA 1K7AA 1GNRA 3OUTA 2KISA 2GF0A 2P67A 4HNSA 4J76A 1N57A 4U7PB 3ZH9B 1HYQA 1MC4A 1CP3A 2JDID 4QARA 2A9KA 4B40A 3GG2A 3MRXA 2JHPA 3EZLA 1A7AA 1ESZA 3CPSA 5FRDA 5HUHA 4R3WA 2VC1A 1I7QB 1VC2A 1ULZA 4IQ8A 1MIJA 1CZOA 3A4LA 3FUTA 5ALEA 2IEGA 4V1CI 3EUKL 1ZRNA 4U0KA 3KQSA 4XICA 1DAHA 2RHCA 1ZH5A 2BZ0A 4PX5A 3RDPA 2M45A 2PUEA 4WTOA 3IKVA 1J8VA 1JDJA 5H2FC 2QKYA 1H1LA 3MQ0A 2XADA 3KTOA 3TX6A 4BNHA 1DO2A 2H31A 1IRIA 2LRHA 4R1PA 1EVLA 1I14A 2HMUA 4DGQA 9ATCA 3EF0A 4L9AA 3TB4A 3NB0A 3VZBA 1Q83A 1SH7A 2JAHA 3GK3A 3LPDA 3WYBA 1UELB 4MI3A 3ZJYA 3EEOA 4DCVA 1VHWA 3HA3A 4NABA 1ETXA 2O3JA 3RF7A 2B7EA 5IT3A 1IZ1A 3OS1A 2EA2A 1CUHA 2OHOA 3NOQA 3W2IA 1XZHA 3O8NA 5HVQC 3IP4B 3SJMA 1WPQA 3KB6A 5HODA 4PYMA 1LQ2A 1QQIA 5KPJA 2CBGA 1Y0UA 4UUSA 4BQNA 2FOLA 2J5BA 2O0KA 3VKWA 4A4DA 1ZG5A 2ZR0A 2ZJPF 2BGTA 2D0OB 5J1TB 3A3OA 1I2MA 3K8OE 1JIQA 1YO6A 2ZI5A 3KR1A 5AVWA 3NWSA 1P72A 3CPHA 4NPAA 3W4KA 5KMGB 3ROTA 3BILA 2ZCUA 1NQVA 2Z3WA 3THSA 1N6IA 1UPCA 4F1KA 3Q8KA 2A5JA 2CZCA 2YV3A 3I1IA 4A0ZA 4XJVA 5TSDA 2OBMA 4PANA 4TROA 3CX3A 3IP9A 3ZLVA 1SHZA 3DZCA 3LC1O 4GAEA 1PDWA 4L8WB 4QPJC 4D9HA 1QHHB 2QNRA 3WIDA 4OSEA 5KEIA 3DVRX 3S1NJ 1XEXB 3A9SA 3L9XA 2GPTA 3TR6A 2DRIA 3JRNA 1ODJA 3A1DA 4Q05A 3GJ6A 5ARBA 1VKHA 4G84A 1TLHB 4XQ9A 4YP6A 2AWOA 2PL5A 3KVNA 4GR4A 1SCNE 2F1KA 1FX0B 2Z5VA 3K9NA 4CFZA 4DXDA 3DMTA 1GPUA 4LSGA 1UUFA 1IQUA 1ECPA 2GPAA 2PLWA 1JKJA 4CCOA 3B6KA 3MTIA 5AOBA 3MCTA 3WGKA 4JP8A 3CNLA 4LF9B 4ZQEA 1JQ3A 2NYAA 2O57A 3FVVA 3G89A 4AKEA 5TE9A 2Y66A 3N5CA 3DXJF 2KM1A 3L0IB 2RH9B 5H83A 1Q0ZA 4C7MA 4CV1A 1WDTA 2JGLA 1GLGA 1IN5A 2QNIA 4HB4A 2IYXA 4ETSA 1ZRFA 1F20A 1V6AA 1C14A 4DQKA 1OBOA 4UB6C 5JBNA 1LVGA 2GEBA 5J2TF 3ER6A 4LG1A 3RHTA 2XKOA 3NM4A 4Z0HO 1PR1A 3KCCA 3L07A 4XPZA 4TYNA 2I8AA 2ZJ7A 2IEIA 3R7WB 3GLRA 1U9YA 4PZAA 3W78A 3KQOA 3TOSA 1DRVA 4MA5A 3TTWA 2F6CA 3NAQA 3UKOA 1LK7A 3VMMA 1DQYA 1QAOA 2AR7A 2I7TA 3CN9A 4HQKA 4ODIA 3V8MA 4DMKA 2CXHA 4EG1A 4Z3KA 1YVDA 4KRXA 4HX4A 5ERYA 4BO2A 4K6FA 3GB9A 4HGPA 3A1NA 4LJSA 3TZEA 2AG1A 4XGNA 3GDFA 3WTWC 5CFRA 4L0DA 3Q5GA 1FUYB 4GDFA 4H3KB 2WUEA 2LDBA 2PS9A 1OZHA 5FBKA 2PT6A 1OX4A 4YFYA 4JY7A 2Z9OA 4XSVA 3FJ1A 3C6BA 3O4IA 1IUKA 1JDBB 2ZJBA 1GZUA 1XROA 1XRPA 2F5DA 2EW8A 2FSSA 5AKXA 3R0XA 5TGZA 1EFUA 1SQGA 1YBMA 2C4NA 1ZUNA 2C4HA 2NO9A 2PNFA 3RIRA 5J3LA 4GI7A 3M6AA 3EY9A 3L05A 5SYAA 4F8EA 5CFZA 5DX1A 1S1CA 2PX2A 1G6KA 4LG0A 1ZO8A 4LKRA 5ALUA 5I45A 2I91A 2JJ1A 1C7JA 5TV2A 4WOJA 1KU0A 4O2LA 4TMKA 1T15A 3GGPA 2IY8A 3T99A 3IUPA 2Y75A 1PL6A 1ZOOA 1KK2A 3F0TA 3WWDA 1RR6A 4CMIB 5HKKD 2X0RA 5FOSA 3MTDA 5JMTA 1UKEA 3RKUA 1TUBA 3CCUI 3P52A 1KH3A 1KOJA 1H8AC 1FMJA 2FWNA 2QSUA 4MJ7A 4XFJA 1MJNA 4IEFB 3S8MA 4CQMA 2CHFA 4Z54A 3R5FA 3IB6A 4H1WA 4KFRA 4F9TA 3MZYA 1IJWC 2E4UA 2O2YA 4L9NA 4W1UA 3T4PA 1BW6A 2WZQA 3MLAA 3UK6A 2FOIA 1BJTA 1I6LA 1A9ZA 2W90A 2OZPA 3S99A 3QGMA 3HB1A 3GCMA 1FNSA 2W0SA 3D7MA 3KLNA 3D4OA 1SJ9A 4MICA 4R8LA 5EUBA 3SY8A 1IN6A 3V4OA 5EIBC 3BE8A 4AMYA 2IFTA 4BNTA 4EKNB 2GQ0A 1BWPA 1CXZA 5D01A 1YS4A 1ZH0A 2IODA 5KAFC 1GUAA 3EC1A 4UU7A 4RL4A 5BMVA 4FYYA 1SCQA 2WV0A 4ZYGA 1HOXA 1PJ2A 3HCDA 2PQ0A 2YBDA 1GZ6A 2HA4A 2Q21A 3FUCA 3BGWA 4XH9B 3TPFA 3IQDB 3B82A 3PI6A 4M49A 2HYIC 3LFUA 3LLUA 2QAIA 4IOLA 4C0BA 4FNGA 4JYBA 4UNQA 5JJCA 2AS0A 3DEUA 4FZJA 3KHKA 4Q1AA 1O58A 4RXMA 2IHJA 3KKMA 3LYAA 4PCUA 1ETOA 2C9OA 2VHWA 3PXAA 1G38A 1AD2A 3REQA 2ZVPX 1XCOA 2BEOA 4HNQA 1GR0A 5K7ZA 2ZBDA 1P5JA 3ONQA 2TS1A 3NVDA 1R37A 3OLVA 3AL2A 1ZAOA 5CGQB 3U3RA 2A7XA 4FHEA 1LVUA 4OTZA 3VSEA 1TNDA 2E5NA 1XHLA 1KZ7B 2EBWA 2VK2A 3KQWA 5TPZA 2EINH 3PPXA 3M9AA 3H2SA 3PHBE 5AKZA 4BLPA 5FKLA 2GYYA 1MRZA 1ZNWA 2EZ8A 2G1KA 2YXLA 3BL6A 3K8QA 2GXUA 3SSAA 3BJAA 2ZIFA 1RP1A 4UKDA 5IRCD 3KO8A 1YHQI 3STHA 4AG5A 4E30A 2AC4A 3KXKA 3MUEA 2A5YB 1GTJ1 1XCMA 3MVPA 2ZUVA 5E6SB 3U0VA 3JVEA 4QEZA 4QATA 4J4BA 4XGQA 2HT1A 3RF6A 1VHJA 2VA8A 3C0KA 1JT2A 4P31A 1O3RA 3WNVA 2QZPA 3NO4A 3BWYA 2V7BA 1BDHA 4BLSA 3VDNB 3U7RA 1R5NA 3ZZ0A 4OUDA 3BSWA 4EZBA 1E2XA 4FDMA 3JSOA 1D1CA 1P3DA 2FUKA 1I3OA 3IIJA 4JITA 4B0PA 2G17A 3BYZA 1LJLA 2QTWB 3V8QA 3WYNA 4CMAA 1ZITA 3R5SA 1K83J 5FQOA 2PRIA 3EG5A 3TLJA 1E9DA 2FRHA 3GH1A 2OUKA 2OCLA 3PCTA 2FGKA 3I0TA 3H13A 4KQKA 3P2KA 4LYDA 2NTJA 5EJ5A 2VCHA 2XOKD 5B3JA 4HEA6 3BZCA 4NFLA 2R7QA 3TJMA 3KDSE 4M8LA 5LEKA 4IDDA 4PIVA 1WUHS 1EYZA 2PKCA 3DA8A 3HA7A 4N4AA 3MBOA 4P3XA 5DCWA 1MJGM 2GASA 1DPRA 3SJBA 1JPVA 2ZSHB 4RJKA 1NP6A 1RTTA 4RVDA 1RKQA 4WNIA 2G0NA 3SPXA 2CC2A 3KXPA 3C7JA 5JZBA 1ZK1A 3QSYA 3NHRA 1NVFA 3RSNA 4OYRA 5BMVF 3PFBA 3F22A 2HYGD 3DQVC 3A14A 4W4TA 3K70B 4TX1A 1G3RA 3O8GA 3PIIA 4CG0A 1NYQA 1KI7A 1XF9A 1MDMB 1L7RA 2CXOA 4D79A 4BPBA 4A2QA 1T2NA 5JDCA 3TIFA 1KMNA 2C2ZA 4EUFA 2B34A 1V1JA 1P0QA 2F9MA 2NAPA 3FG9A 2WM8A 2EWNA 3EFEA 1PD1A 1PQ4A 2FMXA 4HX9A 1ISMA 2YASA 4OJMX 4AJ1A 2DFKB 1GNQA 3FI9A 4AJJA 4B6GA 4BFUA 5CTAA 4L5EA 2R1ZA 1GUDA 3N8KA 3DMNA 2HTFA 4IZIA 5HBRA 3V2HA 3O8QB 2BFCA 2QTHA 4QNMA 1HMPA 2G9UA 4XLLA 4R0NA 2SECE 2H2AA 4CWAA 3L4BA 1XJQA 4X6LA 4EKYA 1V7ZA 3EGVA 1SG0A 3QF4A 2I80A 4JSRA 5F7JA 2EIHA 1GG5A 4PSUA 4RPHA 2GNOA 3UOGA 1T36B 3ZDAA 4D9MA 3PE3A 5DMHA 5FWXB 1I3AA 4E7HA 1NI4A 1HE4A 1YQAA 1AOYA 1OGIA 2J3HA 1O5TA 3EY4A 4LJ6A 3OJFA 5FTNA 2CFTA 4LZAA 4UXIA 5EE9A 3UPDA 2EFHB 2HLPA 1SBNE 3QP9A 2C9MA 5E4FA 3OC6A 4M0FA 4NR0A 1SUFA 4WUVA 1TAHA 2Z83A 5EZHA 2XSDC 1LTHR 3JSPA 2OHJA 4QT0A 3E70C 1JFFB 2FMIA 2WF6A 5FFFA 1RIFA 3FHJA 1GDDA 3SQNA 1NOJA 2LLKA 3QWBA 1DMRA 1ZCZA 5K3BA 2RKHA 3JQ7B 4RCZA 2O14A 1KZ9A 1BSVA 1A8HA 2AI3A 2XQKA 1SFOJ 3TSZA 3H92A 1IDN1 1Q77A 2B1GA 4QWMA 1SIBE 2R84A 2QR2A 4GLOA 4DMFA 4H60A 2YHIB 2WF9A 2WP8J 4F04A 1COZA 4FTHA 3PHLA 4X63A 5JFGA 5HP4A 4V24A 3OFJA 1OQYA 1PVDA 4UTZA 3I64A 3RW9A 3VVLA 5H9WA 1JFVA 5M5XJ 4QGFA 2EDAA 2PRKA 4CL3A 3ZMTA 4AP5A 1Z7WA 2EFDB 2J7PA 1O0SA 2YJ6A 4BMSA 4OIOF 3AZQA 5C5CA 5MDHA 1VE3A 4ECAA 1WNTA 1WV0A 3H4MA 3AIOA 3O38A 4PFPA 3IVRA 4BJ1A 2O8EA 3ROPA 2IIPA 4IGAA 5JQGF 1N0VC 1TZ2A 2AMYA 3OI7A 4Q4LA 3DW1X 3S17J 4DCSA 5C7IO 2UV1A 1XVIA 2NZUG 4LY6A 1XDWA 4UXJA 3RSCA 2F7SA 3ORFA 4MP6A 1NV9A 3KWMA 5DBOA 3JR3A 4GZMA 3DC7A 3AVQA 3NBMA 2YS9A 3PHHA 4LRXA 4NFSA 3ILSA 4MO9A 1UP6A 4YRPA 5HJEA 5ITZB 1N6PA 1U9CA 1VL2A 2F17A 1QPBA 1DGWY 1BTOA 1XTQA 2A30A 2P9TA 2WU3A 3R41A 4EGSA 1JU4A 1XJ0A 4KIGA 5FROA 2RAUA 2WSSA 4EEKA 3ZS9A 1XLTC 4XN0A 4M0UA 1IY1A 4HEHA 2WQZA 3ICEA 1VJDA 4JFRA 4QU5A 4F1WA 4BB9A 3H5IA 3O7WA 3ANYB 4MRRA 4GXNA 521PA 4GXOA 4AKGA 3DFFA 1CCWA 1NI3A 3LPLA 3U19A 1Z0IA 3MJRA 2A68F 4MGIR 2PZAA 4TUYB 3WL4A 5HTOA 1L5SA 1EU1A 2EQRA 4LZWA 1XD9A 2TMKA 3LPCA 1SB8A 5IH3A 2ZT8A 1L5LA 1S5LC 3K9GA 1KIFA 5JSHA 2GMWA 1PKXA 1Z75A 2RBKA 3ID6C 3IIKA 3MD0A 1EWYA 4EJVA 4X8OA 1RWNA 3TLGB 5J1UA 5EIFA 3EBLA 5IJAA 3AUJB 5CBPA 3EMVA 3GTQJ 4I0WB 4MI9A 4NZYA 3L06A 2HCRA 5FGMA 4ZOLA 4TV7A 2DZDA 1UPAA 4KO4S 4A23A 2FEZA 3LBHA 2P75A 2M0CA 2ESRA 4O0LA 1K0FA 3I54A 3VSCA 4KU4A 1JEYA 4J91A 3GPBA 1WQ3A 2NO4A 5JD3A 3OTHA 1ADGA 4S0HB 1J0XO 1WZEA 4LNUB 4OI4A 4ZYEA 1U3EM 2PZEA 4AIDA 2W6ID 2W8ZA 2OESA 2IEAA 1XMKA 1UBNA 1AKMA 4HUJA 4OO3A 4L78A 4TV9B 3E6CC 5DX0A 4DKJA 1O9HA 1PEAA 4G1EB 4GBJA 4FGUA 3L1JA 2K9NA 4QDKA 5MFPA 2XEDA 2LD5A 4IW3B 2WJPA 3T9AA 3IH4A 3BMXA 5C2JB 1Y3DE 4IX1A 5LZ7A 3TTTA 2O6GE 3I30X 4LCBA 3L7LA 3HVIA 1NXPA 1SBTA 4FOSA 4E6PA 5C81A 2Y8EA 2HIMA 2B82A 5KK1A 2R7KA 4GVLA 1W35A 2VZ0A 2O2GA 3EXG1 1JT9A 3LBAA 4JL6A 3A1WA 1BGWA 2GN2A 2OILA 3C74A 2H2FA 1TUIA 1BU8A 3K96A 3L0ZA 2L3DA 3UV7A 1I27A 4GZ6A 4UNRA 1P6UA 4NBRA 5HQ3B 1FNMA 4DSNA 1XF1A 2GD1O 2AG5A 3D6AA 5KYUA 5EZ6B 3AVXA 3HGYA 1C8VB 1TK2A 1ZOLA 3OO0A 4WADA 1G9TA 3LRPA 2C29D 4X64B 4DOMA 2ZI9A 4D9BA 3V5NA 5J2UA 2IZ7A 1TUBB 5B1YA 2ME0A 2CSUA 1S7CA 3T3IA 2NP6A 1J20A 4Q9JA 3KRTA 1A5SB 3I53A 3EK2A 3L7MA 3NCHA 1Y5MA 2WU8A 1FY2A 5EN4A 1VP9A 1IM8A 3A1VA 3X1DA 4EFDA 4II3A 1JWLA 2M4GA 2C9DA 5EHQA 4J7AA 5IUKC 3Q85A 2GARA 2VHVA 2KDZA 3DE0X 2ZUTA 3G73A 3GLIB 5FLXA 1NYLA 3V7YA 4NDLA 1PBTA 1Z36A 4IDPA 4KDFA 2IW5A 5KO2A 4QX6A 1NF2A 1C4WA 2BHSA 5ECYA 1BS9A 2Z6QA 1P92A 1ZNQO 2D2IA 3AM4A 2J0QA 1JDSA 2NUAA 3F6RA 3QQ5A 1DX6A 4ZV9A 1WXDA 1JHVA 4UFPA 3GCGA 1WJAA 5BWCA 1UFQA 3AO0B 3PCXA 1G3UA 3D0SA 5EJAA 5AW0A 4Y7NJ 2OCIA 1C8KA 2QTTA 1QFYA 1XYYA 2YV5A 3KXLA 4HRVA 5JH7F 4MO2A 5MFZA 1T3ZA 1Z6PA 3P1JA 4FHGA 4MUKA 4X7BA 3JR9A 1ETVA 1TECE 2XMSA 3GX1A 4LOLA 4DG5A 3V4FA 1ZZGA 3DDSA 2H06A 3D3WA 1XTTA 3AQ4A 2COMA 3IQZA 3LKVA 5GPCA 1JIIA 4ZAZA 3RVMA 2JUCA 1MRNA 1AXGA 3WMFA 3VNVA 5GP9A 2BH2A 4E08A 4HJXA 3HTXA 4U0YA 3ULKA 4L50A 1AIPA 2NAZA 1JB1A 1LPAB 1PBNA 2R79A 3K2BA 1TBXA 4PJLA 3PEVA 2IXAA 3IOMA 4I7EA 4O2AF 5ABPA 3RSFA 2HEIA 1ONVA 2QOEA 4MOWA 4UUNA 4MAMA 4NC6A 4EJWA 3SS9X 3VH4A 4BL5A 3AH8A 2C3YA 4DQVA 1B1BA 1SR8A 1BXRB 3GA0A 4J0CA 3P5BA 2VQFB 1SK8A 4DNCA 4KVZA 2XCTB 1F7UA 4YEJA 1Y3FE 3G0IA 3T7IA 4DKXA 3L4EA 3HNOA 2RGWA 3H0KA 4NCKA 1CUYA 5CP8A 4D9IA 4YBRA 3ZW7A 1U0RA 3RREA 2RCNA 1HFEL 1Z3CA 2GK6A 3JRXA 3JWGA 4GSYA 1N6LA 1MMAA 5IFLA 1RQLA 4JOQA 3DVSX 2FLWA 1CSEE 4HBGA 4DLKA 2ZSKA 1PDOA 3B9BA 1ZD1A 2AX3A 3C45A 1MCZA 4JNKA 3TE7A 3W3AH 4TWBA 4Z7JA 2G1UA 1PV2A 4K7JA 2H0QA 4LTMA 4CEHB 3NJ4A 1V1RB 2EGUA 4C0XA 4UTRA 2I1LA 1CP2A 1KA9H 3CINA 2EDCA 3S15J 2XSZA 4H7PA 2GPJA 4BKOA 1YW8A 1FIAA 1QFXA 1NBIA 2GCIA 2WHPA 3MILA 1ZJWA 1BVYF 1BDMA 4O4HA 3BRWD 2P9ZA 4Q9NA 1U63A 1EGQA 1IU9A 4J19A 1HLVA 2DA1A 2L4AA 5DLEA 5AVUA 2JJYA 2P6NA 1UJCA 2O4UX 3RYFB 2JI6A 1T8UA 3SKXA 1O96B 3R0ZA 3T7CA 1GHCA 3ZGOA 2B98A 3EARA 5JY1A 1GV1A 2EZ9A 2XCOA 2PNJA 4AECA 3R7SA 2VJKA 1IV6A 4B4KA 4M71A 2BDUA 1VBMA 2Z0MA 2CJWA 1C80A 2UV8A 1DIHA 2HPIA 3I42A 1CJBA 2CK3A 5BV2P 2H1WA 4P82A 2Q28A 1TTPB 3QX9A 3O4RA 1MMGA 3Q9SA 4HSEA 4I8XA 4XE5A 3RH0A 3SOZA 3W2WA 2YN0A 3QKTA 2I2DA 2D2XA 3KYDA 4KQIA 3W04A 4ENTA 4OB7A 5G4KA 1FFXB 5FOQA 1OMOA 1F2VA 2G3YA 4ZI3A 1D1PA 4HQFA 1IM5A 4X20B 2G6BA 4OREX 2O05A 4MWSA 4OXIA 2ATIA 4C0AC 1NL3A 2BFCB 2X7XA 3B89A 1KDOA 5J9FA 5JI3E 5HCIA 1IBMB 2J5OA 1GRCA 1K66A 1OC2A 3ANXA 2OB2A 2FX5A 3OT1A 4I6EA 4J49A 3Q72A 1Y33E 3H7IA 4OXXA 4QIHA 1PZNA 5EWJA 2X8WA 2PN6A 2PUDA 4KREA 3U21A 3CMAI 4KIUA 5EWMB 1F7VA 4OGGA 1MH9A 1EM6A 4HH1A 4OV6B 1GFZA 4BMDA 1QRSA 3RUFA 4MYCA 4AVPA 1F3LA 3QEKA 5HLIA 1RQNA 4REOA 3GXOA 3MHTA 5TRDA 1VIMA 3KJHA 1MBHA 4ACAA 5HLGA 2XNSA 1KHTA 3LP8A 4G1BA 4UVIA 4FE7A 4BEHA 2ZUWA 3S2GA 3T94A 1RS0A 1RD4A 4DLYA 5LPNA 2H18A 2O54A 5T6BA 5A62A 1IRZA 1XSXA 2NYVA 3Q7EA 3B5IA 4EPVA 2FF5A 4YNBA 1X1SA 3QNUA 3VHQA 4J3JA 2IELA 3OLQA 3LSTA 1GNPA 1WU8A 3N59A 1MQ8B 1HE8B 5KHDA 4KQ1A 1DPFA 4B74A 4I9UA 5BOVA 4C78A 4LVCA 1RM3A 3UJBA 4G5RA 2Y99A 1PO7A 3B9QA 3WJ1A 2HSJA 1PE0A 1W85A 1WJGA 4MS3B 5GAJA 5I6DA 2DMPA 5DUKA 4JT9A 3DCIA 4HQEA 3R5HA 3GCXA 4R3NA 2ZJ4A 1F8GA 1JP7A 1B6GA 2NNYA 3FH0A 3OJEA 1VG0B 1Q19A 2IF0A 5FL7A 3TAXA 4GKJB 2E35A 1NU8A 3RC8A 4CKZA 2CUZA 2C98A 1ECLA 2D13A 4QGSA 4IHSA 2XUIA 4QXAA 2XGXA 1S2OA 3TRFA 2NT4A 3TEDA 1AMOA 3PQ5A 1V71A 4GLLA 6PAXA 3HU1A 4LF6B 1ODSA 4ZEXA 1LW6E 4PJNA 3KUUA 3QVMA 3ZCRA 5JADA 4ZD6A 1KC3A 2CMGA 5ALWA 3R9XA 2X2PA 4P93A 2UZ1A 3K4MA 2A7QA 4ZQHA 3MZ0A 4JBYA 4I76A 4LYJA 3HXOA 1B76A 4JOMA 1E1CA 3FYHA 3GVCA 1UK7A 2KJBA 2ZNZA 2P4UA 2ZBVA 4ZVQA 3ZWDA 1QS0A 2XGJA 3F8CA 2H4WA 2HJHA 1BA3A 5GTHC 2OLEA 3D6VA 1T8IA 3I1YA 3NOXA 4GPEA 3D3NA 2V6EA 4LECA 4DIOA 1XKLA 5LGNA 3PNSA 2VP6A 3QOWA 2JVHA 4JB2A 3UGJA 5JMWA 2Q3HA 1HRDA 2QXYA 3M3HA 3UJ7A 2CRGA 1B8UA 4DZJA 1SD6A 4ZV7A 3LCJA 3A01B 3BDVA 4X44A 3PNMA 4JQZA 4IXWA 2YMPA 4MUFA 4E6KG 2YMLA 2O8XA 4EYEA 1AQNA 1QK4A 4KO2S 2PU5A 4KK3A 1VKRA 4XIDA 1A9PA 3R3SA 4FFBA 5HZHA 4Y67A 5JY6A 3BDAA 2PGOA 4ROTA 4TWJA 3IFSA 4F60A 4LJKA 2CMFA 1FDSA 3J80Z 1MOPA 5DCMA 1L7DA 1YASA 3HOXJ 2FPGB 5KYXA 1JFTA 1FVXA 1DKLA 4X84A 5BNIA 5LYJF 2GILA 3AG1H 3LDUA 4AU7A 3W6VA 2GOYA 4LK0F 2VI5A 4GCVA 3TQHA 2NN3C 3U31A 5D5UB 1X80B 2MOKA 2VWQA 2IOFA 1XVUA 2CO5A 3BRCA 1K78A 3I83A 1D04A 3P96A 3PFHA 4C04A 3F5MA 3STWA 4CCLA 3S8EA 1ZZEA 3HY6A 3KYJB 5AI4A 2BFBB 1KSJA 3AZPA 2UWMA 3JQ8A 3NKVA 4Y9DA 1XRQA 3DUFB 4D3SA 2BMDA 3GEBA 3D4IA 3HEAA 4CKXA 4D4MA 3ASVA 3W6NA 1W30A 1UJ8A 4JBHA 1I32A 3CCYA 1N7IA 1Z9BA 3HU5A 4H1HA 1G20B 1U5BA 2JGIA 3QEMB 3R7AA 1YA6A 5EUCA 2Y76A 4DCMA 3N8NA 4M37A 2P77A 3UPUA 1C5KA 5GAGJ 4LXGA 1NTOA 4ZREA 3W5CA 5KYWA 4PCAA 4QFMA 3GO5A 3D4NA 4R2XA 3O8OB 4IIHA 4V38A 3GZ6A 4S1WA 2GIZA 1PHPA 1W8DA 1XDDA 4JUIA 2CLOB 1RC1A 3ZJUA 4IEIA 5BSRA 3Q8LA 1ZQ9A 3I6BA 3D5QA 3L6CA 3QA3E 4ND8B 3RIEA 4WJLA 4OMCA 5CPFA 5J2UF 3DE2X 2EW2A 2PX3A 2D8MA 3N0XA 3TCKA 1U2TA 4UB8C 3ZN1A 1TEHA 3NHUA 1PZGA 1GCUA 3E5NA 1GCIA 1YRQA 2HRBA 1CQJA 1IRFA 2HMTA 1YQGA 3GUZA 1O4XA 1DLJA 1OB2A 2GYVA 1F2TB 3Q6IA 2LVBA 1ISFA 3STVA 5JAMA 1VSVA 2G5GX 1ZC3A 1BM9A 4C4OA 1I80A 2C95A 4NHJA 1US8B 1YKFA 3C14C 3GDWA 7MDHA 4W9MC 3B2EA 4TL7A 3I9V2 2VEOA 3O8OA 1IHOA 1ZONA 3L7AA 3QI7A 3FXJA 1T1RA 5K3SA 3G8DA 1KYIA 5FUQA 3NAUA 1RRFA 2RIRA 2ZPAA 5JLXA 3EXHB 5G02A 3DE3X 1WY5A 4MZXA 1FWZA 1JJAA 2I1WA 3B1FA 1YRWA 1NUPA 3HSKA 4RU1A 2M98A 3QY0A 2YZGA 3UHOA 5IMSA 2O5VA 2FZVA 1E2GA 1GQSA 4D0PA 2OGZA 4FFNA 1YZGA 4F3NA 1W5EA 3D3KA 3QRWA 4NTZA 1F38A 3RVRA 3NXSA 1PFGA 4J1SA 2PSHA 4N5NA 3QE9Y 3SU8A 3GJTA 3AESA 4US1R 1FPQA 4ZHQF 3GGCA 5JNVA 4NOMA 2AN9A 1XEFA 3G2KA 5F3WB 3RJ9A 2WHQA 3JQRA 4Q9KA 1JB9A 1R49A 1PVVA 1R18A 2HIHA 1GG2A 2GFIA 3H11B 2Q9AA 3PX2A 2MYNA 4TYQA 1T9GS 2EAUA 2XMDA 4Y0NA 1S2LA 2O50A 3MUOA 2L2QA 5EUMA 1EG7A 2V6GA 4GLFA 3TLEA 4PHHA 3H1TA 3EWIA 4EG3A 4EUNA 2VN2A 2JJ2A 1FUUA 2QYTA 3A04A 3FPEA 1AN9A 5F12A 2R4UA 2CMDA 5REQB 4B48A 2PZMA 4Q21A 4WZAA 4Q6WA 5K4AA 3GJSA 2VDJA 4RV9A 3H4VA 5ICEA 5TB5A 2VYVA 4YROA 2X6YA 5E7JA 5ARDA 4BNMA 4CV3A 5B64A 4DR4B 5FJJA 4BO9A 4BWVA 1DADA 3WNBA 1NN0A 1D6NA 1XQ1A 1V41E 1Y4DE 2NACA 1IZ8A 3LLMA 5LOVF 4R6XA 4X1OA 4BRZA 5C46F 2QXTA 2XAJA 4DA9A 2ZWAA 4X90A 4X7RA 1IBRA 1P1FA 2BHYA 2GM9A 4WEOA 1M2FA 2OCBA 3K72B 1UKYA 3CB4A 3OD1A 4JOSA 1FK8A 4MX8A 2CEKA 3WGZA 4JT2A 5CH3A 3B3JA 4LOJA 4RETA 4EECA 5CDGA 1A5ZA 1WCMJ 1QX3A 1UMDA 4WXYB 4DTIA 3FM9A 3DXXA 2WY8Q 3K35A 4JZKA 2PMZN 3CRMA 3PQDA 1V26A 2KMUA 3AESB 3PSAA 1LDGA 1WCYA 4TXHA 1OGJA 2EF1A 1L3CA 4P3NA 5FBQB 1A4IA 3HRTA 5EE0A 5KOJA 2P7HA 1WX1A 4B3HA 3L46A 4KR3A 2Z2SB 2HSDA 4XYGA 1VKNA 4RDIA 1E7MA 1K7CA 3CB2A 3FXLA 3VZSA 2HOEA 1G5QA 1GAJA 2NX2A 3JX9A 4BGEA 4ETNA 3IC7A 1JEQB 4TOIA 4YAEA 3FKIJ 4A5MA 1K6IA 4M3NA 1I2CA 2QTBA 3K1TA 5I9LA 1H4TA 1V35A 4BAGA 2IXEA 3TQTA 2FSGA 3DKRA 3GAMA 5JYDA 1YVPA 4P7JA 5D8DA 1QYXA 4DLNA 4X6XA 4EI8A 3RSGA 4D74A 2XF5A 5IAGA 4D9NA 1I10A 3I2JA 3AG2H 3R23A 2IJGX 4W9RA 2DTXA 1S3GA 5GV7A 3QPTA 1QQAA 3ZBQA 3QEAZ 1T26A 4N3AA 4V2UA 3EUHC 4RY9A 4XWYA 5JAIA 2NWQA 4XWOA 3KEOA 5KNDD 2VJBA 2MD5A 1ZR2A 4N76A 2R5YB 2EU8A 3NYQA 2JFGA 2Z16A 1NQAO 1MZPA 3FN4A 3VJMA 3LA8A 1DJOA 2F8LA 2XODA 3O8QA 3W2EA 3MLBA 2FEOA 4KBGA 3EULA 3LCRA 3ZDRA 3HSSA 1YJCA 3QHPA 3SC2B 2B6HA 2WU4A 3GJ4A 4R0VA 3TRKA 1UMCB 3HZJA 3AR5A 4HO1X 4NARA 1FP4A 2FE3A 3EFOA 1GAWA 4DXHA 4EM0B 1JKOC 3EB9A 4HUQB 4PGAA 5DNAA 2HRQA 5DIZA 1QH8A 4FOOA 5KYGA 3QP5A 4BYGA 1CF4A 3RYCA 4IEJA 2JSPA 4KMFA 2L69A 2CWDA 4F4CA 1UM9A 3VDXA 5AKEA 5IXJA 4PYJA 4QKQA 1LSJA 2H8RA 2VASA 1DUSA 1FCJA 3SJAA 1VMIA 5IVPA 3WRWA 2KBFA 2JDIA 2NS8A 3NLLA 2O8BA 4J0EA 5AW4A 1JNXX 2C1EA 2FDRA 2R8PA 4DREA 3EBPA 4ZCPA 5GZ6A 5JCOC 1A8SA 4M8KA 4L1KA 1EX6A 4MVJM 4OPMA 5F52A 1OYYA 1I13A 2C3PA 3HLKA 3IAS6 1X3WB 1WUTA 3AETA 3B6JA 3GMIA 4L9WA 5F98A 2X9QA 1IUYA 1QXSA 1K4YA 1KY5A 1SBQA 1E94E 1V4NA 2BSAA 5H6RA 2V8BA 3C18A 1QIIA 3AB3A 1SRQA 4QU0A 1M7GA 1YQQA 2PIAA 3GD7A 4MVXA 3I9KA 3KD3A 4IL6C 3U80A 3WI7A 1UG0A 5F1RA 1UP7A 1NVTA 1G55A 2BFAA 3LF2A 1OTHA 4RPLA 1E1NA