3P9KA

Crystal structure of perennial ryegrass lpomt1 complexed with s-adenosyl-l-homocysteine and coniferaldehyde
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
TAADMAASADEDACMFALQLASSSVLPMTLKNAIELGLLEILVAAGGKSLTPTEVAAKLPSAANPEAPDMVDRILRLLASYNVVTCLVEEGKDGRLSRSYGAAPVCKFLTPNEDGVSMAALALMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMSAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLELYHGFEGLGTLVDVGGGVGATVAAIAAHYPTIKGVNFDLPHVISEAPQFPGVTHVGGDMFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQGVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Analyses of a Caffeic Acid O-Methyltransferase from Perennial Ryegrass Reveal the Molecular Basis for Substrate Preference.
pubmed doi rcsb
source organism Lolium perenne
molecule tags Transferase
molecule keywords Caffeic acid O-methyltransferase
total genus 115
structure length 357
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p9kA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p9kA02
2IJLA 4KIGA 4HLXA 1R18A 1ZH5A 2ZZMA 2F5EA 2HKXA 5E2BA 3SMQA 4LK1F 1ONVA 3MERA 4AZSA 2HTJA 3P2KA 1J9IA 4BLWA 1W7PD 2Z9OA 1MDMA 3SSOA 3TFWA 1JG4A 1BKYA 2A3SA 4EK9A 2F8LA 5G02A 4UVBA 1ZAOA 2H6CA 1ZRDA 3B3JA 1YW8A 4WWCA 4YUWA 3PFIA 1R8XA 1HSTA 2E1CA 5IT3A 5ILVA 3CJTA 2HFHA 1X3UA 4IJAA 2Q2EA 1T38A 5C0OE 3NWEA 4Z2YA 4PIMA 3G8AA 1GHCA 2EA2A 1SMYF 4ENJA 3VODA 2D2WA 3WGGA 4Q5SF 5H02A 2Z5UA 2GXGA 3WTWC 1M0EA 3FHZA 3G5TA 3Q7EA 4P7JA 4R8RA 2HWKA 4HDVA 5LQUA 3HSFA 3CJNA 3FRIA 3QV2A 5ICGA 3MZYA 1FBSA 3DFGA 4HX7A 3C6KA 4OBWA 4F86A 2DPMA 3OCJA 1QANA 3GVAA 3ZMZA 1C0WA 3QU3A 1DUXC 1PP8F 5ICCA 4L0ZB 2ESNA 3I5UA 5LHHA 4HF1A 2EK5A 2AVNA 2ZBQA 2W57A 3COAC 3UJCA 1GXQA 4PYIA 4ZYGA 3I4PA 3OFKA 4L9VA 3AXSA 4EMSA 3RDIA 1Z91A 1L0OC 2K86A 3CVOA 5A2QK 4ASNA 1WSUA 3HTXA 1OYWA 1HNNA 4A12A 1P1CA 3L09A 4LG1A 5EIWA 2IH5A 3K0LA 4M73A 3FYCA 3RYPA 5FWAA 1TW2A 2DULA 1TBXA 3HCFA 4LG0A 3FPFA 4E33A 1FBNA 4HTFA 1SD7A 4A6EA 1LEAA 2JH9A 2O8XA 4HF0A 1R23A 1KPHA 4AZVA 3V8LA 1SFUA 3FTEA 3U2RA 2XAFA 2X4HA 2ONZA 3GNLA 5HOOA 4BHPA 3KPVA 2VC1A 2KW5A 2TDXA 1LJ9A 4WK8F 4Y2HA 3GW2A 3KP5A 2EFJA 1UIRA 1MD0A 2YQZA 2VBYA 1I27A 2OQRA 2XGXA 1MJFA 3R9XB 3KP3A 2E5WA 2GA2A 4AIKA 1DPUA 1QYRA 1D8KA 4LGWA 3HHHA 3BWMA 1BI1A 1RJGA 5CM2Z 1Z05A 4RAYA 3DMHA 1KU2A 2IH2A 5CCBA 2PN6A 1JE8A 4KDCA 2LDUA 2GS9A 3LX6A 3KFWX 5LQKA 2M87A 5MHTA 3TQNA 5HILA 4EKIA 4R8HA 3M6XA 4MHGA 4LMYA 5DRYA 3O31A 2CKDA 3KQWA 5JHUA 3IEIA 2L02A 4YUZA 1MKMA 1ODDA 3TDZC 4K6MA 5D5UB 3WTUC 4OIQF 2EJUA 2H1RA 5E1DA 3QP6A 4GO1A 2PMUA 4DKJA 3K9TA 4E70A 5HS7A 2GA9A 2WA1A 4YFXF 2P41A 1QZYA 1JR4A 1FPQA 4IWNA 1YFLA 4KN7X 5E18F 3NMUF 1SAXA 4BYYA 2P8TA 5BW5A 4UVCA 3DH0A 4P58A 2FRXA 1F1ZA 5EKXA 3HNRA 2ZKZA 3JSPA 4M36A 4GBED 4KIFA 1J75A 2IFTA 2PG4A 3NDIA 1YG2A 5DM2A 1IF1A 1M6EX 3JTGA 1CGPA 1RUNA 1XSXA 2FOKA 3ZMUA 2IGTA 4RGSA 1FJXA 4G7HF 1MZBA 2P8JA 3J80Z 1XB4A 4U0WA 4IPAA 4PYLA 3E6BA 2ORED 3OZRA 3OZSA 3MQ0A 1IUYA 1KYZA 4M6YA 1B6AA 4ER3A 5HDNA 1TQMA 1SD5A 2KIUA 3P7NA 3U1DA 1XMAA 2AN3A 1I9GA 3CJRA 2XROA 5BW4A 1D5VA 3WE3A 5KVRA 2HWVA 3HVHA 2ACJA 1K78A 3HA3A 2P3OA 2MBFA 5D4SA 2GIVA 5GOZA 3FUXA 2ZSUA 1U78A 1QZZA 2DPDA 5M5BA 5DPMA 3PX3A 5LEKA 1HKTA 3LDGA 4EV0A 5E9JA 4CXMA 3MAGA 1ZG3A 2VN2A 4QWQA 5AONA 4BHCA 2NRAC 3ZMSA 3LGAA 5LR6A 1AV6A 5E1OA 1KR5A 4HH4A 2EJRA 4FSDA 3CUQA 1U6GA 3QAHA 4IHSA 3R0QA 3EDPA 3CJQA 4ISCA 4EVIA 2P1DA 2V79A 5KYGA 5LLQA 2EX4A 3TKYA 2AS5F 4IRHA 1NE2A 1Z3CA 3BY6A 3MZHA 2ZIEA 3E05A 3F4KA 3KR9A 3NTVA 4EGZA 4EGYA 5FHRA 3OU6A 2O3FA 1D2HA 1KP9A 4HQEA 3HCEA 1BM9A 3LKZA 5E20A 1HQCA 2C7RA 2P5KA 3HTSB 4MWZA 4UHTA 4ZZDA 4P7FA 3FTDA 3LSTA 4KMFA 1O9GA 1XCJA 4RTOA 4LD5A 2DO7A 5J8FA 1FYKA 1IAWA 4RB2C 1BOAA 4HW0A 2YXEA 4KYWA 2N47A 1SKMA 3FPHA 3RTRA 5E2AA 1QPMA 4I01A 3M6WA 2HGCA 3M8EA 1DL5A 4CKCA 4EM1A 5DUIA 4A5NA 2O57A 1L3BA 3TOSA 2RKHA 5FTWA 4R1HA 1DDNA 1O9HA 1BC8C 3KR2A 5D6FA 5EKUA 2M30A 2DLLA 2FBKA 2LNBA 5L3DA 2GLUA 3DLCA 5CVVA 3EQLF 2E7WA 3TOAA 2ZCJA 1BHJA 3F72A 4V0QA 1NW7A 1TPYA 5KK1A 2FF4A 2LF8A 3HCBA 4ENKA 2VE9A 3LA3A 1S29A 1I6XA 4ZYEA 4KNYA 2PT6A 1FC3A 1IM8A 2O6GE 2ADUA 1LNWA 1F9NA 2I62A 3CBGA 3E7PA 3M4XA 1SG9A 2P40A 1T2KA 1IXRC 2VS1A 1I5ZA 2AOUA 4AZWA 3E6CC 1XXLA 1O7LA 2AVDA 4CDGA 2PXCA 5E1WA 1IN5A 2G70A 5EMLA 3WTVC 4DCGA 4EQZA 4L7VA 2BEOA 3RKYA 3BGIA 5KQSA 4G7OF 2L4MA 3R6TA 1LDJA 2XAJA 4KW7A 3TR6A 3MTEA 3H3ZA 5EZQA 4LFUA 4ENMA 5E1MA 4A0ZA 2OU2A 4PYMA 1YB2A 3C3YA 4WXHA 1G3TA 1S6LA 1R6AA 2QLZA 3DULA 4PGHA 3C6MA 2RN7A 4RTLA 5BQTA 2UXNA 4L5IA 2JPBA 5LQCA 2NXCA 1UHWA 3KEQA 3E8SA 2ZMEB 1ZYRF 9MHTA 2JJQA 3M6UA 2G7HA 2JHCA 4Q4ZF 3LAJA 4ER5A 2RNJA 2PKWA 4D0PA 4BQAA 5F2KA 3IKVA 3ELWA 3J81K 4ESBA 2IP2A 1ZG5A 3WU1B 3DP7A 2FK8A 3IWFA 3KQTA 1IXCA 3K69A 4ESFA 5L3GA 5DX1A 1FT9A 3UJ9A 5BPIA 1R36A 2KIFA 3WG9A 1YS6A 3LFKA 3Q9VA 2P7VB 3R61A 1NW3A 5GP1A 1QBJA 4BLUA 4RTMA 1XGSA 4ENNA 3G7UA 5D6EA 5KQRA 2IPXA 3RKWA 3B3FA 1FLIA 4RTJA 5L3BA 3HEMA 4A0XA 5DLYA 2Y1XA 1YYVA 2Z99A 5LGTA 3AY0A 4GUAA 4EM2A 4LJZF 5DYMA 3I59B 2B2CA 2JRTA 2YX1A 1RUOA 4DQ0A 1JG1A 5JR3A 2OZUA 1FYLA 3AXTA 3HOTA 2BM9A 1ON1A 2QRVA 2E7XA 4R8SA 3R4KA 4GOMD 5CVEA 4B09A 2YPRA 2B9EA 2H94A 4LWOA 2DW4A 3GFIA 5KS2A 1SUSA 3TMAA 3GJYA 3PFGA 2O07A 3FPGA 5EGSA 1RI4A 4RGUA 3TGNA 5P8WA 1KGSA 3E6DA 3K0BA 4WF2A 4OA8A 2CG4A 2PT9A 4IXAA 2D1HA 3ECOA 3TM5A 2A6EF 1NT2A 4F7ZA 4HDUA 3HCCA 1YTYA 2FE3A 3BWGA 1XDUA 5DTQA 1W7PA 3UJ7A 4E2ZA 3ERCA 3IHUA 2W85A 2HEOA 1IZ1A 4C04A 2VDUE 2Y75A 4HV5A 4I09A 4PIPA 4OINF 1XGMA 2HZTA 3J80K 5U4XA 3KQSA 3EMDA 5EMMA 2X0LA 3KP4A 3BROA 5H6QA 4CGZA 1XJ5A 3LDFA 4AIHA 2IH4A 1EH6A 4XUDA 2OD5A 3EVBA 2YX4A 4X61A 1NKVA 2PI0A 2BH2A 2MA3A 1IN8A 1X1CA 3HRUA 3LWFA 1G8AA 2QVOA 2B0LA 4YMHA 3LKDA 5DM1A 3RI4A 5BPDA 3O6BB 4OBXA 1UFKA 3M70A 1R7JA 2IDJA 3HSRA 1VBFA 3V97A 4BHBA 5DV5A 3G88A 4DNCA 2VOOA 3EVAA 1F4KA 3T7TA 3F8BA 5HDKA 4KMUX 2Z6AA 4UVAA 3DMFA 4DF3A 2GPYA 3EVEA 2VDVE 5LRRA 5DD4A 2UYQA 1J5YA 3LQQA 3V7SA 2I6GA 2JHAA 3KQMA 3FM5A 2O05A 2L01A 2DAOA 4L9TA 3BGVA 5ICFA 4X60A 1YW9A 3PVCA 3SVZA 2QQBA 3DV8A 4DCMA 2CFXA 3HYIA 3P9CA 2WK1A 1XSDA 1X1DA 4ER0A 2UZKA 3L9FA 1ZREA 4P5OA 1H0MA 4EJUA 4CXFA 5FFXA 5LQNA 2RDPA 2B78A 4HYEA 2C6YA 1MJAA 2GH1A 2PSSA 4HGZA 4RTQA 3KPWA 3FX3A 1VP9A 3GF2A 1SQFA 4ER7A 2AN5A 4ETSA 1G55A 3P8ZA 4LLGF 2EA4A 1MJ9A 1RI3A 1X19A 4X63A 1U5TA 3E97A 2JTVA 2RGVA 2NNYA 1FP2A 4HG2A 2FA5A 3EYYA 3NW9A 1GVJA 1WKMA 5FA5A 1QAQA 3T0IA 3GO5A 2F5FA 5D5VB 4CICA 4EJVA 2PV0A 4PGGA 1WZNA 2PX8A 3V7RA 2RC4A 3HP7A 1S7OA 2L3DA 1DCTA 5FLXK 5DXJA 3H3UA 5A2QZ 4N0BA 4P7GA 1PJZA 1XCBA 4MQVA 4E30A 3MTIA 2EFNA 3PFHA 5GWXA 3CGGA 2EFOA 4RSRA 5HEKA 4IRIA 2VXZA 3NJRA 3SZPA 2EV6A 2W24A 3M9AA 3KZYA 3CLOA 1S3JA 1LDKB 4WX9A 2EV0A 5EVJA 5E1BA 4GOND 3PX2A 4C06A 1FSHA 4U88A 4L9NA 3F8FA 1MGTA 4HBLA 3IL2A 2Z33A 3CKKA 5EZSA 3F6VA 3FUVA 1HKSA 2NXEA 4QDKA 2YUIA 2WA2A 1O7FA 1LDDA 2HR3A 5K0BA 3MFKA 1BJAA 1FBQA 2LSOA 3SFZA 5EG5A 1XMKA 3FUUA 3AWIA 3FPEA 2ZLBA 3E3VA 1KU7A 2WTEA 1OYIA 2BBYA 4RB3C 3R3HA 2PMHA 3GIWA 4OX9Y 2KRFA 1LVAA 5DTMA 3IV6A 2CSOA 2HTSA 1DP7P 1UB9A 3CO7C 1Z6RA 4M71A 3ULQB 1JXSA 3HCAA 2MLGA 1B59A 4RTPA 4M38A 4C05A 4C4AA 2V1UA 2AOWA 5F64A 4RVGA 1OR8A 3HRMA 4CTJA 2OZ6A 3VC1A 5CIYA 4KN4X 1FX7A 2XAHA 1R00A 2D45A 2XKPA 3DR5A 1J59A 4OOIA 4PWYA 3I0TA 2P7CB 4F84A 4BAYA 2HOEA 3DPLC 5FFZA 4MTDA 5ERIA 1D2GA 3SGLA 3LCVB 2H09A 1XTPA 3THRA 4IVNA 2PEXA 4OU0A 1P91A 1V3FA 2XUBA 5CYVA 4L18B 3D5LA 3GCZA 5J8CA 2JH8A 5H20A 4LG0B 2NXJA 2CWEA 1PRYA 2ZXJA 5DSTA 2XVCA 1NW5A 1T0FA 5LQRA 4XUEA 2CQKA 2CO5A 2EG5A 2G71A 3BPXA 4ZYDA 2VC0A 5FB2A 5EEGA 4EJTA 3BJ6A 4EQQA 4I98B 3HOSA 2H6BA 2ISYA 3KP2A 4CHUA 3FZVA 2RQPA 3QPTA 3I64A 5CVJA 3G8BA 5AIPA 1CF7A 2E1NA 4RYLA 2F5CA 5K01A 1DPRA 1R5GA 2IRFG 5BP7A 2KIMA 4RGXA 3IRRA 3Q9SA 4PYJA 3TRKA 4HOBA 1QGPA 1G60A 2JT1A 1R22A 2HTEA 2OB1A 1J0RA 5FGMA 3JSOA 1SMTA 3GRUA 3SHFA 1BIBA 4BH9A 1RI1A 2ZNZA 3ABTA 3ZN1A 5LQJA 1CF7B 3HIFA 2PX5A 1WXWA 3KP6A 3ZMVA 5JUWA 4O29A 2K02A 3RIRA 4QQNA 1K7AA 4WCGA 3GFJA 4I2OA 5HLGA 2GAUA 4O3MA 5DCMB 4HV6A 3F3XA 1L3CA 1USSA 3GLXA 4AZTA 3KQOA 4RV9A 1J2XA 3T8RA 2IIPA 5FLXZ 4QQKA 1I1SA 5FQNA 3C3WA 4OQDA 3B89A 2LF7A 2QZ8A 2AS0A 3CC8A 5DM0A 2WV0A 3CCFA 5EOVA 1FSEA 4Y15A 3ZP5A 5DSXA 3EGVA 2ZO4A 4MTLA 1T43A 2J5PA 3RPUA 3R60A 1QAMA 2A6HF 4M9XA 3A7EA 3G2OA 3CUQB 3V8KA 2EFQA 1FZPB 1WI9A 2YX7A 2PX2A 4E32A 2DK8A 4HLYA 2JZYA 4UOEA 4YUYA 1IRFA 2PXXA 1RI5A 5K0LA 5K0GA 5IH3A 2COMA 1YS7A 2P6SA 3B7PA 5BXYA 3DPTA 5BOXA 4PYQA 1QNTA 4JBAA 4GF5A 1B9NA 4A5MA 1JQDA 3RW9A 1YLFA 4UV8A 2YSRA 3GRRA 4HAMA 1KPGA 3HUGA 2P3LA 5E17F 3QPHA 4I0AA 2NS0A 2VBZA 2V1DA 4PCAA 2XAQA 2FBHA 3FMSA 1RIOH 1F5TA 4H0NA 3P9NA 1HSJA 1YUBA 1OYYA 4DMGA 3O3KA 3L7WA 2XYVA 1EH8A 4L5JA 4NB5A 3RPQA 5EEHA 3GXOA 3B73A 3SXJA 3FMRA 2PBIA 3SZTA 5D8LB 3WTXC 3QRFF 5K1YA 2H11A 1Z9CA 3VYWA 1EG2A 2CGPA 4K2EA 3NQOA 3JAMK 3FXQA 3I53A 4Y13A 5HS9A 4YFKF 5L3FA 3KCCA 2YR0A 1BI0A 2IVMA 1HKQA 4PNEA 2PQ8A 1AQIA 3H92A 2GAFA 2R3SA 3L2CA 5EPEA 4OIPF 3F22A 5HIIA 4ZH4F 2ERCA 3LECA 1KA8A 3LPMA 3C0KA 5DX0A 4M6XA 4KRGA 1SQGA 3DLIA 4C03A 1TTYA 2DFIA 3E5QA 2Z6UA 1XCVA 2HNKA 3WTZA 1RJDA 4BP3A 3CUOA 3WTYC 2ZJ2A 1U5TC 1S7AA 2PGXA 5E8JA 3UA3A 3DXJF 1JQEA 1IN4A 3EEYA 4RTKA 2H27A 2K4BA 1EH7A 3LBFA 1R8YA 2V6CA 3SQNA 5BMZA 3GO4A 3CTAA 4ON0A 2BE5F 2PJPA 5K5RA 3MAJA 2QQ9A 2HQNA 2DI3A 2IBSA 4TV7A 4LB5A 3MCZA 2V9VA 2BR3A 3HRTA 4FR0A 3OU7A 5E8IA 2ZBRA 3PLAE 3GX4X 4IV0A 4XLNF 2CL5A 4KDRA 5EHIA 5IT9Z 3P2IA 2R7DA 1A04A 3KLOA 3KETA 4XLPF 4BP1A 5E8RA 3KHKA 5LRSA 4GYGA 1U8RA 2YVLA 1Z6TA 3GWZA 2QE6A 3OFJA 4F85A 3ZMTA 5FHQA 5HIMA 4RGRA 1G6Q1 1I1GA 4FGZA 1PDNC 2QM3A 4YV2A 5DCFA 3MHTA 2AOVA 2BYVE 3KPYA 3TO7A 2ZBKA 3SM3A 2UWMA 2OO3A 4ATNA 3BJAA 5ICEA 4G7ZF 2GZWA 2B25A 2F2EA 4JXJA 4YG2F 3P9KA 3JTHA 2EWNA 2QY6A 1HW1A 2Q41A 2BGCA 1NHAA 5EMKA 3FXRA 3GFLA 2OA4A 4GOLD 4LK0F 4CZZA 2PVCA 2V1XA 3WE2A 5EQJB 2HR1A 1USTA 5FWDA 5F2NA 3IWZA 1L3IA 2ZWVA 2DU9A 2AXLA 2OBFA 4N9IA 3BXOA 2FU4A 4G56A 3LHDA 3DOUA 3P97A 4G6QA 1ZLKA 1RJFA 1ZQ9A 3FRHA 5F1RA 1O57A 5EMJA 1EQAA 5F6FA 2ZIFA 3ELYA 4RTSA 1XDSA 3ECHA 1XN7A 4YUXA 3KU1A 1Q0TA 5CVUA 1ZRFA 3UJDA 5K5QA 7MHTA 5HIKA 1JQ3A 5J6XA 3IRQA 1W5SA 1P2FA 4GQBA 3T0YA 1L1EA 1TLHB 2ISZA 4G8XA 4DZRA 2JSCA 2KKOA 3ZN0A 2K4MA 1P6RA 4HTFB 4PINA 3MQ2A 2P3QA 4PYNA 3GDHA 3WTSC 2OXTA 5BS6A 2UYOA 3PQJA 5IT9K 4E2WA 3LL7A 4FHTA 2AOXA 1TW3A 3GYHX 1NW6A 3BGDA 2P7IA 2RVCA 3EGEA 1H1DA 1JG3A 2KJBA 3ABUA 3OPNA 4FT2A 3HVKA 2ZBPA 2YXDA 5EIFA 3EETA 3ISPA 1HBXG 2PXAA 4FT4A 4RVFA 4RX1A 4MIKA 2DK5A 3I58A 4CTKA 1INLA 2BR5A 3R24A 5GM2A 3T7SA 2OBPA 3JWGA 2AN4A 1LEBA 3VC2A 3DF8A 3I9FA 2UYHA 3GEZA 4M74A 1AQJA 3NVKI 2VDWA 1RI2A 3FWEA 2K7LA 3NWBA 2Y0MA 2I7CA 2O61A 1NW8A 2PWYA 5CD1A 3E5UA 4DA4A 3HCDA 3OU2A 2Y48A 1BBYA 3TDUC 1BC5A 2PY6A 1W4MA 2HMYB 4YFNF 2QUFA 1SUIA 2HV9A 4YIFA 3UJBA 3G2PA 1P4XA 2Z3YA 2ZW9A 5HVQC 5FD6A 2P5LC 3W6KB 3OE4A 2K4JA 2VZ9A 4V0RA 1G6NA 2Z6QA 2ELHA 2NNNA 3BP8A 1FBUA 1U2ZA 2AZTA 2VE8A 1I4WA 3FPJA 3NDJA 4R05A 4M9ZA 3WTTC 4EJWA 3V7CA 4A0YA 2MH9A 2B3TA 3X0DA 1XVAA 3UA4A 4P55A 1BN5A 1JHFA 4R79A 4FT8A 2OPBA 2XASA 2GWRA 3DXXA 1ULYA 3DKWA 3K6RA 3GRVA 3FUWA 2GA1A 1XGNA 4NHJA 4RS8A 1Q0SA 3M33A 4ER6A 3EMBA 5CUQA 1Y8CA 3GGDA 3VEPA 5HIJA 1V39A 2I9KA 2L4AA 3R6SA 3BWCA 3EVFA 1VTNC 3HTUA 1E2XA 4RVHA 5FUBA 2PLWA 1TQIA 10MHA 2OY0A 2P7HA 4IV8A 3BZBA 3C7JA 3T5XA 5AIQA 3FTFA 1JTFA 4CWAA 1YW7A 4X1OA 4U0YA 3IKTA 3MGGA 2CW0F 5HLHA 1W7PB 2EB7A 1EJ0A 2VBWA 1WS6A 3HA5A 3SR4A 4OIRF 3TOBA 4MTEA 1VE3A 5DX8A 1J7KA 4QPPA 3J7AO 1G3SA 3TO6A 5K05A 3BKXA 3RIEA 4AIJA 4AD9A 3KKZA 5FO5A 5H6RA 5D5WB 2QYOA 5FQOA 3TPZA 3D2LA 3KP7A 2VBXA 2NP6A 5ILSA 1QAOA 4HX4A 4RTRA 2LKPA 2XVMA 4B8XA 1JSZA 4PDKA 3UFBA 3JWHA 1TQPA 1O3SA 2G9WA 1TNTA 3DQVC 5JI6A 1VQ1A 1UHMA 3VB2A 4S04A 5D5XB 4C08A 3NVMB 1QQIA 2P4WA 3EYIA 1WY7A 3MCTA 1G3WA 4P9FA 4MHTA 1IXKA 2A14A 3EPPA 2DTRA 2ZULA 4EM0B 3CO6C 3KE2A 4HF2A 3FXUA 1BOOA 2HS5A 4KDPA 2MD5A 3K1MA 4OA5A 3ROUA 2WC2A 4JK1X 3K1NA 1FNNA 4E2YA 2CMHA 2XYQA 3E5XA 5C1IA 4H0EA 1EJ6A 5DD8A 4O5VA 2YR2A 3A4TA 1ZHFA 3FZGA 2FNPA 1ZKDA 5JFRA 1HXDA 3ME5A 4P9UA 3B5IA 3T7RA 1BI2A 1P4AA 5T64A 5KVAA 1VPTA 4S05A 1U2WA 4XSXF 3RODA 3SX0A 2BV6A 3F6OA 2DT5A 4YV0A 5L3EA 1ZRCA 1AF7A 2ZIGA 1O3QA 2YTZA 4ESJA 1KQ8A 3ZPLA 5DM4A 1JSXA 5LBQA 4R6WA 1OPCA 3N4MA 4I0BA 2ZFWA 4RB1A 1PP7U 6PAXA 4CKEA 2OYRA 3KQYA 2M1BA 2FNAA 2EFWA 2DPUA 2K27A 5F2OA 2FPOA 4KWCA 4IHTA 2JHPA 4KICA 1ORHA 4LLNA 3M6VA 3T8TA 5DXAA 4A2UA 2MH2A 3O7WA 4MQ4A 5K8VA 5HDGA 4MGRA 3G5LA 2V7EA 4RB0A 1YZHA 4G6DA 1SFEA 3R0JA 3PTAA 3KLNA 4YUVA 4WXCA 3KEOA 3O4FA 4ZZLA 2R7FA 1K78B 5DCMA 3EVDA 3FTCA 5HZMA 1OKRA 3AJDA 4UNOA 2VT2A 2P35A 3DTNA 4QTTB 2FSWA 2QBYA 3B3GA 2JPCA 1NV8A 3BPVA 1KQ0A 5K0FA 2JG3A 2HYGD 1B9MA 1RZ4A 3GU3A 1F38A 3V4GA 3LDUA 3WGHA 5TRDA 1YO5C 3S2WA 3OE5A 4PYOA 3BDDA 3FYDA 2ADMA 2CWWA 5E9QA 4FS8A 4XBFA 4YV1A 4U7PB 3B02A 4XSZF 4BNCA 4ZYHA 5DWQA 1R1TA 3EGIA 3HVIA 2W25A 4M9SA 1BC7C 2XHKA 4HA8A 3I71A 2FMLA 1STZA 2ZNYA 1P92A 3V8JA 1WXXA 2PBFA 4QVGA 1IW7F 1S8NA 3EVZA 3ER8A 2ZMEA 4UXNA 1P1BA 4PCQA 1RJEA 3A26A 4AUKA 2A68F 1G3YA 3ANXA 5GIPE 3BZ6A 3P9IA 1N2XA 4MNUA 3Q5FA 3A25A 3UJ6A 2FMYA 2OQGA 2ZFUA 3KZZA 2XYRA 5E1XA 4RVDA 1O54A 1KQ9A 2ONYA 2QQAA 3C1DA 5JVTA 2D1VA 2ESRA 4LLLA 3WU0A 5LEJA 1FY7A 2AOTA 1KHHA 3THSA 4BY9E 4GEKA 5LHIA 1ON2A 1SD4A 2M8EA 5T6BA 2CYYA 2XIGA 2IA0A 3BWBA 1Z1DA 3I54A 4M7RA 3OZTA 3VFZA 2C7OA 2XVAA 4RAZA 1YIOA 1E17A 1NBHA 4HSGA 5K0EA 3ZQ7A 5ERGB 3IHTA 2A5YB 4PZJA 3ERED 1G4DA 4NQWA 4PYKA 1MJBA 3ML6A 5DEQA 1SFXA 3G73A 4XCXA 1ZG1A 1LB2A 2W84A 2FYTA 5CLSA 3TQSA 3NEUA 4IKPA 3BOQA 5HLIA 4LB6B 1EV7A 2FEZA 3EVCA 4YMGA 2IA1A 5LQAA 3KQVA 3SSMA 5GIOE 3QOXA 3UZUA 1WWXA 1D2CA 1SVUA 1R1VA 3HA7A 3BT7A 3ELDA 2O0LA 4KVZA 1UCRA 2P5VA 4B17A 2XKOA 4OQEA 1YZ3A 4BXUA 3G3ZA 2L54A 3J81Z 2UXXA 1UWVA 2XV4S 1ZGJA 1MHTA 2EJTA 1IN6A 3L8DA 1WRJA 4AX8A 1WG8A 4KA4A 1XD7A 5FD5A 4YIIA 3GZ6A 3LCCA 1LQ1A 5DRTA 2A07F 2NNWB 3K2ZA 1NBIA 8MHTA 1TNSA 5CCXA 3UWPA 3G2QA 5HFJA 5CVDA 4CO8A 3KPJA 3HVJA 2ZCWA 5CJ9A 2ZWAA 1VP3A 2G72A 2FK7A 3I59A 2STTA 5LGUA 2QWWA 3GUDA 1HW5A 1JG2A 3A7DA 3CUQC 1KU3A 3ORHA 2VOPA 3TLJA 1VL5A 3M1EA 4QDJA 3KR0A 4QVKA 4I7HA 2FCAA 2PX4A 1B4AA 4L9JA 4GC5A 1P4WA 4P7KA 2IDKA 5D1HA 2BR4A 2ZZNA 4G94A 5E9WA 5HS8A 1WQ2A 3UBTA 3DUWA 1XSVA 3V8VA 2YU3A 2AR0A 4LWPA 3O2PE 2OKCA 3RJPA 2FBIA 3T1BA 2QBYB 3QU6A 3C3PA 3DXZA 1T6SA 5K0NA 2HYFA 3EUHA 3LA7A 3K1PA 5ED4A 3EVGA 1VLMA 4KIBA 3WGIA 4AWXB 2Y1WA 3PB3A 1IXSB 3DEUA 2PFBA 2HDCA 3A27A 1XCLA 4GYIA 4MEXF 3VOEA 1G38A 1W5TA 1Z7UA 3F21A 4A6DA 4FX0A 3DXYA 2NYXA 2XRNA 3RYRA 3E23A 1FYMA 3OOPA 3L00A 2BM8A 4NECA 3MWMA 2XAGA 2MLKA 1FWZA 4BLVA 1JTEA 3ELKA 2VP3A 3F8MA 2OZVA 1R58A 4I02A 1ORIA 4PCLA 1U5TB 1HW2A 4OMYA 3F8CA 2ZVJA 3LCUA 3G2MA 4HRAA 1ZLJA 4GC9A 3PT9A 3U81A 1G8SA 3TM4A 1B1BA 3ELUA 2UYCA 3WODF 1EIZA 2OB2A 5K09A 4FP9A 4Y30A 4QPNA 5GINE 4GOOD 1U3EM 5D1NA 2UZ4A 2H00A 1P39A 2VT3A 2ESHA 1YFHA 2GXBA 3JW4A 2KJCA 4M72A 5D4RA 1ZN2A 1O3RA 2M5WA 3ID6C 4Y17A 3F8NA 3LA2A 4AVPA 1BIAA 4PONA 2DQLA 3BJOA 1H9GA 5E8GA 5K03A 2FRHA 3QOPA 1T39A 2RV8A 2P6TA 4FSXA 4OIOF 2GQQA 1F3LA 3DMGA 1R5HA 3QP5A 2YXLA 3IYLW 3GRZA 5EHGA 2CMGA 4DM3A 2NP7A 1L9KA 2IW5A 1FP1D 2DBBA 2BZGA 4R6XA 3M7GA 2IA2A 5L3CA 2PLYA 4CKBA 4L0YB 4O6JA 3VSEA 1JGSA 3KR1A 5DT2A 5E1ZB 4KFCA 5C9ZA 3REOA 2DQRA 3TKAA 1V4RA 1YQAA 1FOKA 4HQMA 1AOYA 4MQ9F 3HRSA 2G8NA 1RI7A 1DUSA 2QRVB 4GXOA 4WVLA 3ER9A 1QO0D 5DTRA 5TJJA 2O06A 3SSNA 3MB5A 3TO9A 4LECA 1REPC 4ZTBA 5K0JA 3JAMZ 2VODA 2LD4A 1IY9A 4KT5C 3HM2A 3KPUA 3LBYA 1KU9A 4MEYF 2A69F 3JWJA 1K79A 2FXAA 2PWPA 4HX8A 2J5OA 4HZFA 1I1NA 2F5DA 2A61A 3BKWA 3KQPA 3BWYA 5D8KB 5LHGA 3S68A 5EC8A 3UJ8A 1AWCA 3FM3A 5FULA 4G9YA 3BUSA 1MDMB 4Q47A 3CDHA 4GCVA 2C7PA 2IT0A 3GZ5A 4XRFA 3E6MA 2VONA 2IBTA 4UV9A 1O3TA 3M8FA 2NAZA 1EAMA 2AOUB 3RKXA 1SD6A 3OV8A 3HSEA 3AAFA 2STWA 2AOTB 4FZVA 1HMYA 2WWYA 5LGNA 2M45A 2HQRA 3QOWA 1R1UA 1RNLA 3N97A 3G89A 5CVIA 1T98A 5FA8A 1GXPA 1UFMA 2ZZKA 4CYDA 4IRGA 1VIDA 4QLCU 3LAPA 5GM1A 2NYUA 4OMZA 5IKMA 1BI3A 3PQKA 4FX4A 1KPIA 2IPQX 1N7JA 4U0VA 5DUKA 1PUEE 3GFMA 2G7UA 3IC7A 4JQFA 1KXZA 1X1AA 3WSTA 1L3LA 1YF3A 4N9HA 4KUMA 2V74B 3EEOA 3HHGA 3ZMDA 2XBMA 5FADA 4EJOA 5DDGA 2EFPA 1NV9A 2MC3A 1XGOA 1XDZA 4P96A 4U7TB 5ILUA 4UUVA 1M6YA 3C18A 4M37A 3F23A 3KQQA 1D8JA 3FF5A 5LSAA 1KYWA 4RTNA 1ZARA 3MEXA 1Q1HA 4HGYA 3NRVA 1OR7A 1N7IA 3FMQA 1YFJA 4IF4A 3UJAA 2Q0OA 3LQRA 4Q48A 4E31A 2O0YA 3JWIA 4HC4A 4WXDA 4QTUB 1D3YA 1KIAA 5K5OA 3P2EA 3PS9A 2PJDA 5FCDA 4C07A 4X41A 5K0CA 3U9GA 2C7QA 3H2BA 2QENA 3R0AA 3Q87B 5T67A 1K6OA 2OAZA 1X1BA 1Y0UA 5HOQA 4POOA 2HKOA 5B1SA 4DQ2A 3P71T 2O03A 3D0SA 2G1PA 2EV5A 5CVRA 2Q8KA 4GGGA 1IN7A 4U7BA 2FHPA 2ZTHA 2NXNA 1R74A 1H9TA 4EKGA 1ZGAA 1IRGA 2FQ3A 3W6JB 2R6ZA 4XUCA 3SXYA 3GRYA 1OMIA 4U7DA 4E2XA 2ETHA 1B42A 4RWZA 1JHHA 2GB4A 3FUTA
chains in the Genus database with same CATH superfamily
3WK4A 2P6RA 3DZJA 1LVHA 4JC5A 2H4HA 2PD4A 4GFBA 4JUDX 3W9UA 5C2JB 2ZB4A 3SMQA 4D4KA 4PZEA 2JVKA 2HTJA 1GQFA 3AGQA 1HTWA 2PMWB 3MIIA 1U0TA 2VAVA 1LPPA 1U4SA 3PEWA 4DKXA 3FLEA 2BEVA 3GNSA 1SC6A 2XNSA 1CUBA 2F8LA 1DB3A 2HF7A 4KVAA 4EK9A 421PA 3G5MA 2O3SA 3HV0A 1PK7A 3RAFC 4AJ9A 1ECJA 2H6CA 3ZHTA 4CBVA 3GJ0A 3TMOA 4HS9A 3K8ZA 1YW8A 4WN9A 4MLOA 1NOIA 5HNHA 3EGXA 3VZBA 1RWOA 4YUWA 3ABSB 3VO2A 3RUCA 3GFFA 4N49A 2QVBA 3OVMA 3UHOA 3OSUA 1A95A 2RHJA 2AHRA 2VQDA 2XQIA 5B1YA 3VDMA 1Q1VA 3ABMH 3AFNA 1ZC3A 1YFZA 2X77A 4KITB 2ZI3A 3HHEA 5IC6A 3AG6A 2Q2EA 1D6SA 1DELA 2OM2A 2Q8NA 3ACBA 3BQ9A 4PWZA 4YK7A 3VGJA 5SYAA 3W9YA 3DCJA 4IDFA 4WKPA 2ZRJA 4X1YB 1SMYF 4IYRA 4ENJA 3VODA 1DQSA 3EZ6A 3WGGA 4Q5SF 3KE8A 3F9RA 1BS1A 2Q2VA 3NV7A 3O0TA 2R5YB 3PR1A 4M7OA 5KYNA 4B3SB 1JFLA 1UBGA 2GXGA 4BCCA 1J2TA 1QIKA 1VYTA 3GARA 3MT8A 2X4DA 1B0AA 1QCZA 1JF8A 2RQQA 1PZFA 1UADA 3I2HA 3G5TA 2Y2VA 4PSCA 5BNGA 3PUIA 1F12A 1YRNB 1RQLA 5EXXA 1PJ2A 4F06A 2ZRPA 1QCYA 5LQUA 3HSFA 1RZRD 1E7SA 4HSRA 3IUMA 1GGVA 3FRIA 3MZYA 4E5SA 3C8HA 1EHYA 1V6AA 3CRRA 4HX7A 4IVQA 3D6HA 4TS4A 3ZHSA 2J0UA 4HCJA 2O2DA 4CTOA 4F7WA 4DZZA 2VH1A 3OYJA 2CXUA 2ZJBA 4U8GA 3GVAA 5FD8A 4QOFA 1J25A 1DUXC 2BFPA 5ICCA 2DLNA 1MCZA 1PE0A 5AWFC 5FOSA 3M6AA 2WTUA 3NBUA 4I2NA 1V35A 4A1FA 5BN3A 1M34E 3T9BA 4UC0A 5AKHA 4U2BA 1FS5A 2ECQA 2AYZA 5GZ6A 3I5UA 1Q7CA 3AB3A 1OILA 1JDNA 3KUDA 3FXOA 1KDOA 2ZPUA 3ROKA 2EXXA 1V11B 1C1YA 4IFTA 2GD0A 4JJFA 4GVLA 4A23A 5I8WA 1GXQA 1I7SB 2UV8A 3ZWDA 4L9VA 1Y5IA 1QQAA 1U6KA 3D0OA 5FOXA 3IO5A 4XICA 1CBUA 2OP0A 3IQDB 2QJFA 1DUVG 1SBYA 4B2YA 3EZNA 4HFMA 1ZMXA 1IUOA 3CVOA 5F76A 5GONA 3H1FA 1OYWA 3F5QA 2EIHA 3PJGA 4KO2S 5CB0A 4AF8A 4A12A 2V97A 3B13B 1DCMA 3K0LA 1BVYF 3T99A 3OZEA 4M73A 3RIMA 3RR2A 1ZD2P 3RYPA 2NS7A 1TTQB 2DY0A 2DULA 2BISA 2GYYA 2HLNA 4BO7A 3Q6MA 5AVVA 4LG0A 2LC2A 2P81A 2QHXA 3ZTYA 4E33A 2ZB9A 3S2HJ 5FRDA 2JEOA 1SD7A 1N6KA 2AEMA 3MF4A 2IOQA 2FEMA 5EEAA 3WWCA 4G0VA 1NVEA 4P0QB 7MDHA 3UK1A 3ZBPA 4X6UA 3RYFB 3FSGA 1OPRA 3A1DA 3ZNPA 1VE6A 3FXLA 2VZ0A 2VHJA 5EJMA 1XTZA 4JDUA 1KPHA 4P35A 2OA0A 3V8LA 5FJJA 1KI3A 1M0WA 2PU5A 5FKJA 5K8JB 2XAFA 4BNMA 1X7WB 2VG8A 4C29A 3CN7A 3KPVA 1IWPB 1QORA 2GD2A 2O19A 3JZFA 2HRZA 2X5NA 1A96A 4Y2HA 5J59A 3WNDA 1NRIA 1NL3A 5LQSA 1FMWA 1FX0A 3KP5A 2R92J 1S2OA 2EFJA 3ITNA 5AKZA 3AVVA 1Z67A 1WD5A 1MD0A 1E3WA 1I3OA 1PL8A 2Q5JA 4CW7A 1AKRA 4OHMA 1MJFA 1DV2A 1X86B 2JIMA 2WFAA 1XQYA 3L7MA 4NCIA 1NASA 5ILQA 1QBGA 3W4KA 1DCTA 2G5PA 2ODNA 4B43A 3TD6A 2DA1A 2JJMA 1RRGA 4JA0A 1BGXT 4PV7A 3TBFA 5CXQA 1GFZA 1TMYA 1A8QA 4U39A 4TYWA 1DZ3A 1LJLA 4IHWA 1XZEA 3BWMA 3IO3A 1BI1A 4FQ7A 4HVCA 3VZCA 5IM4A 4L9AA 4JT9A 3T4PA 2ZUBA 3G79A 1DIBA 3L6BA 3UF0A 4B7ZA 1Z05A 1YDFA 4O5OA 3AUYA 3U4DA 1N33B 1ZRHA 5IYZB 2DFFA 3T34A 1V1RB 2H8GA 2ZIUB 3DLHA 5GP9A 1KMMA 1VJTA 5EFZA 2LDUA 4CQNA 4CH7A 2R86A 3WBJA 3GOQA 2H2WA 4Z8YA 1B3BA 3U31A 2M87A 3UGQA 3WQRA 3TQNA 3WWDA 4C1NA 5JH7B 4EKIA 1IL0A 3C1OA 4M21A 4M8SA 3GUVA 1XPUA 4L51A 2WIFA 1J09A 3O31A 4BX3A 1PFUA 3KQWA 2RBGA 2RGCA 3RM3A 3N0XA 1BOBA 5D5QA 3JALA 3DDOA 3TDZC 5CYGA 4PZCA 4R51A 5AW4A 5IT4A 3PNYA 3N3BC 5D5UB 2QZZA 4H3SA 5DYNA 2QXUA 1T2DA 2H1RA 2YJGA 2G77B 2IKQA 3ABKH 2BV3A 1OCZH 2NOGA 3CF4A 3E2PA 4ZYYA 3K9TA 4IIXA 3S2DJ 4TXNA 5MF6A 3H13A 1N6IA 2MSWA 4MR7B 3I2GA 3ZIAD 3ANMA 1ORWA 4NQZA 1SXPA 3M89A 4KJXA 4TTQA 1BHQ1 5IDQA 5DULA 2O8EB 1V1MA 4J16C 1OKKA 3BM5A 4UEQA 2VNHA 3QOYA 3RRZA 2AC4A 3QVVA 4FDAA 2I78A 3G6WA 1T91A 3RAEC 2IE8A 3PE4A 3ZWCA 4MZDA 3JSPA 2RHRA 4UHBA 5M29A 4MDEA 4KIFA 2R6GA 3M82A 2E5FA 1J75A 1OC2A 2H5EA 4RKWA 5TEVA 4CKZA 5KTKA 4Q1AA 2A78A 3KOXA 5KKAA 1FUEA 1TUIA 3U7HB 2B30A 3JTGA 3Q11A 2H0RA 1RUNA 4DOMA 3R8CA 4MV5A 1UEJA 2IGTA 3KE9A 3FBGA 5A0TA 4RGSA 4NHEA 2HIAA 3LW8A 1VM6A 5L7WA 3BX1A 3OQNA 3DKXA 1R4MB 2PL5A 1XB4A 3T1TA 1Z62A 4IPAA 1DTSA 4BWFB 1Y1TA 1RESA 1ZJ6A 2PM8A 1Y3HA 2HA2A 4HHEA 3VVMA 1DC7A 2FSIA 3ISTA 4ZGWA 1Z47A 3P2OA 2VKDA 2R8BA 3MQ0A 3BRSA 3CKLA 3H5OA 4M6YA 1B6AA 2MSCB 2X5XA 2WP0A 1YOVB 2KIUA 1EQ2A 1JEQA 5C4MA 1BE0A 4L6AA 5LZ9A 1JMYA 3U1DA 1P33A 2DR0A 2ZJRF 2QMYA 1TE2A 2WU1A 3C24A 4KQ2A 1V3UA 1I9GA 3CJRA 4IMJB 2DDBA 2I5UA 1Q7GA 2YASA 3G9QA 5K0JA 1Z5VA 5EQDA 4AKEA 2PUFA 1I1OA 1E2MA 1UR5A 3A28A 3WR5A 5KVRA 2HWVA 1WI3A 3U3MA 1OYOA 1B6TA 1R0RE 1XAGA 3JQBC 4TV9B 3U37A 3UPTA 1HNXB 5GOZA 1D3AA 2MC4A 1V4NA 4C9YA 1W4ZA 2DWCA 4RSMA 4EG7A 4C7OA 1H2EA 3CLHA 4EI2A 4NBTA 1QZZA 2DPDA 5FTJA 3W9BA 1LRLA 4N9QA 2XCLA 2WUVA 2GBIA 3NDRA 4FDLA 3S44A 4AJHA 3LDGA 4CXMA 3MAGA 1PSZA 1L4UA 3L0OA 4KL8S 1ZG3A 2VN2A 2LBFB 1TL7C 4BHCA 2IW1A 2P62A 3QEOA 3TQRA 5BNTA 5LR6A 1N34B 4W1SA 1HI9A 5ER6A 1PEDA 2J3KA 1V7QA 3C8DA 3GEEA 5IXYA 5KINB 4JJGA 4HH4A 2EJRA 2Q5IA 4L28A 2DWQA 3JWEA 1S3SA 1U9YA 5E4YA 3FCEA 3TTTA 1CSEE 5BSEA 3RC1A 2C8LA 1JHAA 1VSUA 1ETVA 3K1YA 4QPCA 4XH9B 3ND8A 4ISCA 3R5KA 4M1MA 1I0ZA 5GPCA 3J7TA 1EE2A 5LLQA 2JJYA 2CHUA 4C3VA 1GT6A 3QBTA 1T36B 5F3RA 1XG5A 1YZFA 4LN1A 3MZHA 1EUCB 1Z37A 1O3YA 2H2DA 1DIGA 3E05A 3MJEA 4OHBA 1LKZA 3KEGA 3P2KA 4MAMA 5CJPA 4BN5A 4EJSA 5CB4A 4CCNA 5JRJA 4R7ZA 1VYVA 3CISA 5SY6A 1KK1A 1MQ9A 3OU6A 1KYYA 5KTYA 1WHTA 4XB2A 5DBIA 5BSUA 2PRJA 2ZI5A 3HCEA 4G8CA 4I50B 1XNRB 4EABA 1XEWY 2C7RA 1J9ZA 3U4AA 3ZCSA 2BHSA 5KWEA 1J7JA 4X8OA 4MWZA 1Y7IA 1ZX1A 1U8ZA 3Q3SA 3HJGA 2NOAA 3GCDA 3LSTA 3N8DA 3R0VA 3WNQA 2RCNA 1ZOOA 3I83A 4JKYA 3T3PB 2WM2A 2OK7A 2R7KA 3PFWO 4BO9A 2C9MA 1BOAA 4FK8A 4KYTA 3G0DA 1RRCA 1ULTA 2CLIB 3OPYA 4KYWA 1J2EA 2R8PA 3HPRA 2YS7A 1SKMA 3FPHA 1ONPA 2QD2A 4LPKA 3NHBA 5E2AA 3TQTA 3ZV4A 3ZLUA 4MUGA 3V8BA 1WSAA 1L8LA 1CZNA 3EC2A 3M6WA 2O8NA 1PHRA 4LY6A 1BJRE 1D0XA 1V45E 5C7OO 1OB2A 2I4RA 4JFAA 4Y6OA 1LBIA 3JZAA 3PC6A 3VNQA 3LSMA 1O9HA 4CCJA 1BC8C 2PMCA 2DQKA 2VBFA 3DAPA 2PQ2A 4P82A 3SIPA 4INOA 5EKUA 3AFHA 5K0TA 3CZCA 4P54A 4B48A 1FDOA 2LNBA 2YYZA 2GLUA 2DFEA 3DLCA 2P2DA 3ZWVA 3B60A 5CVVA 1F8UA 1LNZA 1NLUA 2G80A 1JR3E 3N5CA 4WN9B 3WLIA 1KRWA 5J4LA 4GBJA 5F1PA 4EA7A 4FN4A 2FRDA 1SFRA 1ZESA 1M1NB 1DP4A 1L7BA 2GLXA 1KFKB 2BY1A 2PMBA 1VB5A 4P38A 4EG0A 3TLGB 2XUDA 3KV1A 2W6QA 2OBMA 3TBIA 4HNQA 4QQ8A 2VE9A 3PFBA 4IHJF 4JR1A 5TNXA 1KJ8A 3RIHA 5ENZA 9ATCA 4JI3B 1SKUA 5HRUA 4ZYEA 4KNYA 2QX9A 1TX4B 2IUFA 2CLCX 4FFVA 4HQ6A 4AG6A 4E7PA 1DRJA 1WB4A 3I34X 1FC3A 2JEZA 4KKXB 4NDZA 1UODA 2JJ2A 4I3FA 4JCOA 1YCDA 3VPDA 1NUQA 1EX9A 2YV3A 3HGMA 4DLSA 4LSWA 1A2KC 3CBGA 4I1IA 4DQXA 2EP7A 5EMHA 3GOHA 2DMQA 3LUAA 1V41E 1IXRC 3IUBA 3ELBA 1YZYA 4P4SB 3LYHA 3QFTA 4W8OA 4BPRA 5FKOA 2AOUA 3HYCA 1KKMA 2Y6VA 4O6VA 2JDIA 3DTKA 3E6CC 1GZ3A 2PPVA 3N5KA 4X44A 5A9RA 5BUZA 5J4HA 5JNLA 2E4VA 2VUIB 3KJXA 4Q7LA 4U0KA 4V3BA 1EA5A 2VR1A 5KSPA 5BWOA 5KTNA 2NUAB 2VRCD 3QYPA 4LNAA 1M5UA 1E1NA 1GQOA 4J9UE 5KAFC 1Z34A 1P45A 2P65A 2QZJA 4V0LA 4WZAE 4DCGA 5C52B 4L7VA 4GI2A 1X9GA 4HMQA 3RKYA 4OJTA 2J3JA 1PSWA 1R66A 3OT1A 4HN9A 3I52A 5JJIA 1IJWC 4CR8A 4BQFA 4XRGA 3B6IA 1OCCH 3MBIA 3NJ8A 4R41A 4Z7NB 2L4MA 5CFMA 2GBGA 1L5YA 5HKBA 4DB4A 1LDJA 3JAWA 3QLJA 4RS3A 3TR6A 4P80A 5EZQA 4U9HS 1SGWA 4ENMA 3IXQA 1KO1A 3OF5A 1NSFA 1W0UA 4M87A 1UZNA 2VOJA 2WSLA 5E1MA 3T06B 4D74A 1V6CA 2J5QA 3LF1A 1PR9A 2EC5A 4PYMA 3L93A 4WXHA 1G3TA 3AP1A 3FFXA 3L0SA 3TSAA 1IPEA 2IE0A 4CNQA 5AVTA 1R6AA 4DRYA 2PTGA 4Z49A 1I5OA 3C6MA 4ASUD 4RTLA 5BQTA 4I81A 3T3NA 1RW4A 4PXAA 2JVHA 1DCFA 3BVPA 3W2IA 1NOJA 1PU2A 1CFJA 1UHWA 2ZREA 1LFPA 1Z5ZA 1AA7A 3E8SA 3EG5A 3H9UA 4EG8A 5JDCC 2R0QC 1ZK1A 2RAVA 5C1OA 3GRFA 3M6UA 3HO1A 2IHTA 1HZJA 2HEGA 4DLPA 1A71A 2HSEA 4ER5A 2PKWA 2CVQA 3HYLA 4BTVA 1V1RA 4BXFA 4UAGA 1BWSA 4YLGA 3ELWA 1C81A 4RY0A 5A5FA 4BNGA 4A3KJ 1MENA 4EHKA 2V65A 4FGSA 2IP2A 4QYXA 3UJPA 5BPHA 1PR0A 2YHAA 3WU1B 3DP7A 1P4HA 3AY3A 4G5XA 5JMPA 1T5SA 5TPWA 5IAAA 2QMEA 1T0BA 3BRQA 2WD7B 3GZNB 1GYRA 2V8OA 4EPWA 1WPKA 4MW6A 4QPZA 3NEPX 4B87A 5BPIA 2FLVA 1F8GA 5CK4A 1MDFA 3RYFA 1SNYA 2R1VB 1T5LA 5HNKA 3NQ41 1PUIA 4M6WB 3E3AA 2F3UA 2R11A 3G2LA 4NC9A 3WHLA 2PMFA 2VP9A 3MA0A 1UMDB 2HBRA 4B3XA 2FWJA 2IS6A 1CZHA 2JFYA 2JIZD 4Y4RA 3NBFA 4Z0TA 1FX0B 4BLUA 1O0SA 1VIAA 3G7UA 4ENNA 3RASA 3Q8KA 5D6EA 3FDFA 2IPXA 1VQ4I 4DDWA 3CZ6A 2G1JA 1E9EA 1Z3IX 1N57A 1SN7A 2H6EA 2Z30A 3HEMA 3KT8A 5AM0A 4JU9A 4HYQA 5DLYA 3RV3A 2FSVC 5K6TA 2FJ1A 3EUEA 4KQWA 5FPHA 2EJBA 3NV9A 2Z99A 5K8TA 3NO4A 3ZQIA 2BKUA 1SRRA 2QW1A 3AY0A 3A9SA 4GUAA 5B1IA 4EM2A 1K5HA 3U1VA 3WNBA 2VT7A 2CDAA 3I59B 4BKUA 2C2HA 2KPOA 1NBWB 4M8KA 1VG0B 3JQPA 1NDQA 2I80A 4TMYA 5SYMA 2CEAA 4UE2A 4IOAF 1FYLA 5KKNB 4XAQA 2IUEA 3KFXA 3E18A 4DIOA 2J3MA 3NBYC 3VPGA 2QRVA 3OL4A 3ZQHA 2ZBDA 1Q0RA 1Z08A 4G0ZA 1N2IA 1P0QA 4R8SA 2R6FA 3W90A 4GOMD 1IBKB 3WIOA 3WTBA 5IJZA 1NJ8A 2DXIA 2GERA 1AV7A 2H94A 3R5HA 1EVQA 3NGMA 2X8JB 1TYAE 1EG7A 4TWRA 5DIFA 3MTQA 3ZHYA 4D4IA 4EEXA 5KSOA 4LWOA 5BWMA 3CCMI 3H84A 1Q17A 2KYRA 2WIJA 3OZIA 4RHTA 1NM5A 3QEMB 2FQ1A 3TMAA 2QDXA 1NSTA 1WXHA 2GR9A 4PLZA 3AIKA 1NR7A 4R54A 5DNUA 1KZYC 3HFJA 1TT0A 4JAVC 4B75A 3BZKA 3ROTA 1JYSA 1YTUA 1HC8A 1QRDA 3ZD7A 2JJ8A 3AONB 3CU5A 3LPAA 4E2FA 3E6DA 2L17A 4WF2A 5H68A 5B2ZA 1BN7A 1KZ1A 2PT9A 4IXAA 1E5QA 1ZL2A 2HGSA 3PO2J 4R5MA 2AT1A 4EY4A 2X9GA 2KSQA 4JYMA 1OFTA 3ZD8A 2BI4A 1OVGA 2Y1GA 3GEBA 1T5HX 3HCCA 5EXDA 3RS8A 4XQ9A 4D45A 1PTJC 2GEKA 4B3MB 5FKMA 5IM5A 1CUDA 4RMGA 3HGYA 1MJNA 2F4OB 3BWGA 4CYCA 2OYSA 2NVUA 1S2LA 1WPXA 2QSYA 3AV3A 3N28A 3R7NA 2RG1A 5KTTA 2YWGA 3QJ5A 2VJIA 2IYQA 1UC8A 1VZ0A 3QIVA 5JS7A 5E38A 1IG0A 2XODA 2NT4A 2C2KA 2I8DA 2HHLA 1CRWG 3ZNOA 5JRZA 3IHUA 3PITA 1U8AA 1X0VA 4XK4A 2VDUE 1TO2E 3OCZA 4YJKA 1YCGA 4MYUA 2QV0A 4PIPA 1U0GA 4P4GA 1QVWA 2R7AA 2HZTA 2C5GA 3IUSA 4NU8X 4EPRA 3EMDA 5GV8A 2DTZA 2EINH 2J9GA 2B2NA 3L40A 1O03A 2X0LA 1M6NA 4CGZA 1Q6YA 2ZYVX 4IBOA 4LJYA 3VU9B 4A3GJ 4Y0AA 1C4XA 3IUPA 3S2ZA 5JROA 1Q77A 4A73A 4GWGA 3T94A 5KCZA 3ZVMA 1E2BA 3X43A 4ZFNA 5ALWA 2YX4A 3KIPA 1F0KA 3A9TA 5JVGF 4X61A 2PI0A 2BH2A 3BQYA 2UKDA 3AB8A 4HEJA 1IN8A 4HVTA 3S2IA 4XRSG 3C85A 3QX3A 4BEVA 4TYNA 3KU4A 1SM4A 2BGNA 3UUFA 5LKAA 5KYKA 4JZKA 2TS1A 3CINA 2DSNA 3TZHA 4BIMA 1DADA 2I4LA 2QVOA 5AI9A 4R5HA 4CI9A 1GTSA 1VQ8I 5CNKA 4KRFA 2I54A 2OBBA 1BD4A 3RI4A 2GEUA 4GBMA 3JATA 3KTAA 2GJSA 5BPDA 3O6BB 2HC9A 3ONWA 1UFKA 2VEDA 1R7JA 3QKIA 1GA4A 1V8BA 3FDJA 4JHXA 4LRYA 3ZBTA 3NWSA 1GEEA 1QG6A 5E7JA 4C20A 3IE2A 4C14A 3NEYA 5KJFA 4TRRA 4YCLA 1XA0A 1XO1A 1P5HA 4EW1A 4ENSA 3EYAA 1O8CA 2D2EA 2ID3A 2P4SA 4HQLA 2GM4A 2FR1A 3LDAA 4XGNA 1Z4OA 1C9DB 3E22A 4LPSA 2A9KA 3SQLA 1UPUA 5JD3A 4TTAA 2VOOA 5JO9A 4A8JC 1TUBB 3AEQB 4MYDA 5KAPA 5HDKA 1CQIA 4XDGA 4D41A 4UVAA 1U0HC 1V5WA 3EGOA 1RAIA 3QH4A 1KOFA 5I9TA 1T3TA 1JA1A 3K96A 4Y2GA 4E22A 3IUNA 3LQQA 3SZMA 4BTEA 5CLIA 3JPYA 1SB8A 1R6TA 4XPIA 4XI9A 1RKTA 1DTWB 1T0HB 3DEKA 4QG7A 4ZC1A 3K0AA 4X65B 3F3YA 3OCUA 2EIMH 4ZYZA 5EN4A 2A9RA 1MC4A 1E3WB 1ZD9A 2B9VA 2O05A 2L01A 1Q21A 3G9UA 3L05A 3NM5A 1G4AE 3HN7A 2AI3A 5AHXA 4DXAA 5F9MA 4CE6A 1YMQA 5IM4F 1B16A 4KK4A 4NOJA 5JFTA 2Z2ZA 3DV8A 5EQTA 1IOWA 4DCMA 4C0KA 3KS9A 2CFXA 3HYIA 2IEBA 3K1AB 1E89A 3KBOA 4INJA 4NE7A 3D4LA 5MGBA 1OB5A 1NTOA 3WO0A 4ER0A 1QOPB 4IUYA 1AHPA 2FXIA 4P5OA 1TCVA 3K4QA 5F12A 1KDRA 1SQ5A 3SIXA 4EJUA 1ZNQO 4HF7A 3GH3A 4KQIA 2HWXA 5ARBA 1S8FA 1UT8A 2B78A 1UMCB 2GH1A 3TJZA 4LDAA 1DBRA 4HGZA 4ZOLF 1P62B 2W2TA 4AP5A 4BACA 2YWEA 3VHQA 4RTQA 3GF2A 1SQFA 1ENYA 4L57A 3ZCTA 5FAKA 2PA3A 1KYXA 4ETSA 1X94A 1G55A 4HY3A 4RIEA 5HIAA 2Q5OA 2EA4A 4YRIA 4LOJA 1MJ9A 5DTDA 2BD0A 1X19A 2XI4A 5A4DA 4X63A 5ER9A 2OCBA 2QM0A 1AUXA 1JLHA 2V9KA 2D2IA 2COBA 5JH7F 3ZDBA 4HG2A 3HDQA 1RJ9A 3IV7A 2FA5A 3I2YX 1I6HJ 4W7SA 3NW9A 1GVJA 2OUIA 3ZTTA 2PZBA 1PCXA 2V7QA 3K1ZA 4A93J 1QAQA 5FA5A 4BASA 2X22A 4DNQA 2VC2B 4NPAA 3GP3A 4X84A 1D7OA 1QH0A 3Q8MA 4EJVA 3WFIA 4B2PA 4PGGA 5LU9A 4TKVB 2VP4A 1C3LA 3HUEA 3D8SA 3M2TA 3LHFA 5FNZA 4CL8A 1QH1A 3GBPA 1FU8A 2G4VA 3OLZA 4FEGA 4WK2B 1ZMRA 4ZQCB 5EJIA 3CUTA 1Q2UA 1PUFA 4H27A 5DXJA 4AT1A 1ONNA 2YMQA 2ZRLA 4HP8A 1PJZA 1XFDA 4OAYA 1RLMA 2EWWA 2Z3VA 3CS3A 1L5OA 1Q2XA 2A7QA 4E30A 4M3GA 1TEZA 1O4XA 1VZ2A 3JQAB 1Y1PA 3CGGA 5I8PA 2EFOA 1H0SA 3GLFA 4KXNA 4MOWA 4RSRA 1VQ9I 4B6FA 2KDOA 2ARKA 1I7QB 1OW3B 4P4SA 1WB9A 3NUGA 3IP5A 3RVBA 3IUOA 2VKHA 3CC4I 5L9AA 2I3BA 2W24A 3M9AA 4D99A 1P4RA 4X64B 3EIEA 3ICWA 3CLOA 3O1LA 4ZHQF 1J5EB 4QPJC 4WX9A 1TUBA 1EJ9A 3M07A 1KJWA 1YRHA 4I8DA 4O4HF 5E4JA 4DARA 3PX2A 4Z9BA 4A7PA 4MR8B 4U88A 5K2OA 3F8FA 1CG6A 1A5JA 4HBLA 1D1TA 1TF7A 2PH3A 3OA2A 4M0LA 3RRNA 3RSLA 4DABA 2Z33A 2HF9A 1X14A 2AN1A 1TYDE 3AINA 2PS0A 5EINA 2CK3A 2YUIA 4JX4A 5IYDJ 4TSRA 1A5ZA 1W49A 2X14A 4FE3A 1LDDA 4WCDA 2VP5A 3DLTA 3CMAI 3ABRB 4DLUA 4IGAA 1ZZEA 1J1IA 1W6UA 4K6CA 5LA6B 2C4VA 3EIOA 1OV6A 1JWBB 2E3JA 2YXPX 3E3VA 3FPEA 4TMFA 1IN1A 2GSWA 1MMDA 1OYIA 1Z15A 2BBYA 4RB3C 3R3HA 1YHQI 1K08A 2KRFA 3ONQA 1LVAA 1ZI6A 3CEJA 3IV6A 3W8DA 3WDMA 1XL0A 2NT3A 1N2EA 2VIIA 1MR3F 2ZM5A 3E7FA 4U2DA 3RC3A 3WLAA 5HFAA 1UB9A 4CIDA 4ZVPA 3ULQB 1KHTA 4ILKA 2WUEA 1KAHA 3D7LA 4EF6A 5FEMA 3NGLA 3JR7A 3TSYA 5DNAA 3NRJA 1HNWB 3R5FA 1G3UA 3QX8A 4IMIB 5AVSA 4C4AA 1B2LA 1TM4E 2V1UA 3WRYA 5LXTA 1OWMA 2D0OB 4D8YA 3PFFA 3TGPA 2GFIA 4H7HA 1SVNA 1FLNA 4FMPA 1R37A 4TKMA 1RVDA 4AO8A 2AWOA 2FHSA 1TEXA 4JWKA 2ZIXA 1PK8A 5BSRA 1EVJA 5JZVA 2D5CA 2NWQA 1A1VA 1JDVA 2YXNA 4CVNA 4G5QA 4I1UA 4CTJA 3DWFA 3R3VA 3IURA 2ZRKA 1NY6A 4DCJA 2FETA 3B6MA 4LRTB 1KQGA 1R0YA 1FX7A 2WNSA 3HOXJ 3AOEA 3K9HA 3WISA 3NIBA 3O3MB 4RKEA 1YHNA 2D45A 1C0LA 3EZ9A 2G0EA 2XKPA 1I1HA 1L6RA 1NATA 2QRUA 3DOFA 1GPKA 4B3IA 3D2BA 4N1AA 5L3SB 3OMYA 3SS8A 1DDIA 5PGMA 5FRMA 1S2GA 3LHKA 4PWYA 2VI6A 4V19K 3I2KA 4JMPA 3UR3C 3GTOJ 3LVFO 4F84A 3BFKA 4MTDA 5ERIA 4GQIA 4MV6A 2AXEA 3IBCA 4JBIA 1U1GA 1UL1X 4V02A 1E64A 2GLTA 2V7GA 1V8PA 1NKSA 3DW3X 2HPZA 3PHGA 2H09A 3K5IA 4LMAA 1U4NA 5TEWA 4I1PA 4P34A 1EINA 1WM1A 1SCBA 4OXXA 2X2EA 3THRA 1FIUA 4F8YA 3HLTA 4OU0A 3A36A 3M0EA 3S8MA 4NCAA 1V3FA 2KRHA 2V4MA 2BGKA 3HSKA 3IR6A 5AM2A 3LUPA 2PTHA 4L0QA 1F3OA 5JARA 4FWBA 3VO9A 4OGFA 4QJBA 1B00A 3GCZA 5CA0F 5J8CA 4LG0B 1CF9A 3JQ7A 1UDXA 1QV6A 2YQ4A 3FFTA 3HXMA 2M6SA 1T0FA 4B4UA 2WUGA 1U8EA 2F8MA 2AZ4A 1N92A 4CT5A 2GZRA 2CO5A 2HJHA 2WICA 4JQSA 3FF1A 1Z3YA 4TLEA 3MJDA 1M34A 1M2VB 2WJ4A 4WLUA 4EJ2A 5FB2A 5EEGA 1VCHA 4IEIA 3ZVLA 5KJ1A 3PGXA 1RRJA 3TSCA 4EM6A 4CM1A 1U2PA 4FEYA 2XB4A 5BVGA 1V55H 3J7ZI 3K0FA 4GYKA 1R6UA 4I98B 3RYIA 4WXRA 4ZICA 4ICIA 2H6BA 3FHNA 1TVMA 2PH5A 4OKNA 4PG7A 3RRJA 4CHUA 1UPFA 1LTQA 3PYMA 1CUYA 3T3GA 3QPTA 5AKEA 3O9ZA 4UE6A 3F9IA 4KQGA 2NACA 3PQ2A 2JFFA 3DLPX 5KCMA 3G8BA 4Z9XA 5AIPA 3IQXA 3R2JA 2OQ2A 3DV0A 4KXUA 3X44A 2BMFA 4MAFA 5K01A 2CHGA 1SXHA 5IXJA 2HA0A 5IJWA 1Q0ZA 4PYRA 2W37A 3B6EA 4PYJA 4Y2QA 2CSXA 5B1DA 4K1XA 3ZQ6A 3HABA 4KXFB 1L7AA 1DP3A 3IALA 2OB1A 1CRPA 1J0RA 3DBLA 2X1EA 3EXEB 3AUTA 4BEWA 4CIVA 4RDXA 1SMTA 3L02A 1WSWA 1V43A 2DHCA 3OI7A 4BNHA 4DDTA 2M4GA 4ZDOA 3V7UA 3LLSA 4WKBA 4A8JB 4EI7A 1HKHA 1RI1A 4N5IX 4OHPA 3SI7A 1CEYA 2BZ1A 3P9ZA 3IVGA 4UTOA 2H29A 4YXWD 1E1CA 5FNVA 3GXBA 3N75A 3H3JA 1HMPA 1OD6A 3PLRA 4ZEXA 4ALIA 4BMDA 2DAPA 4RNCA 4J0FA 1R0LA 3D4OA 1VHTA 4XOTA 1FDRA 1WXWA 3FHTA 1LJUA 2QTFA 4WVFA 3WGOA 5BQOA 2EF1A 4J1TC 5CDTA 5JUWA 4CCYB 1CEEA 3RIRA 5D51S 1KFEB 3ECSA 4KQFA 1GNSA 1QYWA 1WMDA 2BIFA 2XNKA 5HLGA 3L7NA 4Y9DA 1BW9A 5DCMB 2HXIA 5HOEA 4HV6A 3LF2A 2HDWA 4HGQA 2O8VA 3GLXA 1AKHB 3K0AB 2QL9A 3AM5A 4UE3S 5JFGA 4PAOA 1U5CA 2CKMA 4HXEB 1J2XA 3GNTA 3IT0A 2IIPA 3MBOA 3R6LA 2ZJ8A 4JT2A 4MV9A 3SMVA 2Y1CA 1SEPA 2X51A 4XYBA 4Q39A 2EBWA 1AKTA 3VR5H 2ISSD 1YR1A 5FQNA 2VCYA 2Z4RA 3C3WA 3M34A 3OJCA 4G1VA 1NGSA 2LF7A 4I7EA 4MI9A 4REMA 5DM0A 2WV0A 2N42A 1S3IA 2JKYA 3RRBA 5BT9A 1U63A 2AX3A 3S3NA 3FOAA 4LHZA 1UFRA 4MQ5A 4Y15A 3CZAA 2VL8A 3GAMA 5DSXA 1Z12A 3G0GA 4JS0A 4RJKA 2QRQA 4LW8A 4JQCA 2V8BA 4NQRA 4RFSB 1SEVA 4JYZA 2J5PA 3LX4A 2QZ9A 4RSHA 3OYIA 5CPRB 5ES3A 3GNQA 1M5TA 1MB2A 2E4WA 3L0DA 4W6QA 1CZKA 1I0LA 1DQZA 3G0OA 3R7FA 2I2BA 4LQLA 2X2OA 3AI1A 4FKZA 4HUQB 2JUCA 5DM60 4HDQB 4EY6A 2LMDA 5IOZA 2HD4A 2OCKA 3CUQB 2CNOA 3GDOA 4QD3A 3MWJA 1MUUA 4EH1A 2WHPA 2B92A 1M66A 1VQMI 1II0A 3CWZA 2ZR8A 3IP1A 3L7BA 3Q1KA 4O4LB 1X15A 4DBRA 4Q3DA 1GGNA 4WLFA 1OLXB 4W5WA 3ZOBA 1GGJA 3FAZA 2I0FA 4UOEA 4YUYA 4ZYAA 3EPHA 2LCFA 5JAHA 2VJBA 4ZCLA 4CF3A 4Y33A 2R5WA 3F5MA 3C6QA 3EQ7A 2AK2A 2FPMA 1YS7A 2P6SA 1LEHA 1V7CA 4GKBA 2B6HA 4N3BA 5ICMA 4OG2A 3DPTA 5GQSA 4BDSA 5I7OA 1QNTA 2ZB8A 3ESZA 3FCCA 1QGAA 4JBAA 3E4CA 3FRJA 4GF5A 1ZM7A 2GXQA 4JX9A 1S5PA 2REQB 4DLWA 4A5MA 2XWJI 1JQDA 3BJMA 2LKDA 1YLFA 3CH5A 2ID8A 4XEUA 4QUEA 3BYZA 4HAMA 4UDYX 3T5CA 1KMHA 2WYIA 3WK7A 3N6VA 4PNZA 4OCZA 4NP6A 4K81B 1V4VA 3OWHA 4I0AA 1LD3A 2IYPA 2YVUA 1X1TA 3QNMA 3FMSA 1RIOH 1F5TA 1RAFA 2C7VA 2QLNA 3G2IA 4ACBA 1NF9A 4X1YA 2HRDA 4RQTA 2QRKA 3BCHA 2CUTA 1II9A 3L7WA 2XYVA 2DUWA 3L8FA 3F8WA 2WJYA 4FE7A 2FX0A 1CJBA 2AEEA 2R00A 2WKRA 3EC7A 3P0HA 4IZ6A 3EPKA 3K7EA 2RHMA 1SBZA 2DPGA 2Z2YA 4F8EA 3AVXA 3CCCA 1ZISA 3H5AA 5DGIA 2PKEA 5I7AA 1SXJB 4Y7CA 1DIAA 4A69C 2R96A 1ORKA 1SELA 3B73A 2PANA 3B1FA 3FKQA 2NUTA 4KHZA 3RQIA 4X8LA 5D8LB 4UAJA 2WWHA 4FILA 5ARCA 1ZCAA 5LZ8A 4QLBA 1Z8DA 3HFGA 3T5MA 1EG2A 4K2EA 1DSSG 3BTCA 2WM9B 1DQPA 1FTNA 1XN4A 2IU3A 4NDLA 1C9KA 3AR2A 4UQPA 1OFIA 5KNDA 3F8TA 3R1IA 1LFBA 5B66C 2X0IA 3U4QA 1CQJA 2EF0A 3KCCA 2ZYHA 5ALDA 3A02A 2D1RA 5CP8A 2W83A 4JVLA 3I6BA 5JW6A 2D0DA 2PKXA 2QGZA 3G4SI 2ZAYA 3C41J 3MT9A 4JJ7A 5F5NA 5C80A 4KSBA 1GHTA 1UPTA 5B57C 4DUZB 3ZGNA 1B8OA 3H92A 2OM6A 2F2TA 3INGA 3DT6A 1TCCA 3BL8A 1X42A 3PPIA 1CKEA 3GA5A 3JVIA 4UHCA 2W48A 5TR9A 2P30A 4S1NA 3ADOA 5FPKA 1KEZA 3F22A 1ACLA 2ERCA 2YHBA 1AN0A 1XLWA 4KGVA 3C0KA 2IIBA 4D3ZA 3DMYA 2WWGA 4EGQA 4KRGA 1SQGA 4DVJA 4L6CA 3LAWA 4C03A 1Y1WJ 5JXGA 2Q9CA 4UNSA 1PV2A 2DFIA 1IULA 2CD7A 3DCFA 1H6AA 1UQUA 2OCIA 3JASB 5U1PA 2Z6UA 1JHZA 2XMDA 3TZKA 1E6LA 4OU4A 2VXOA 4I5FA 2QP4A 3WU2C 2O7RA 4EUKA 4XRMA 2QLLA 1U2RA 1OZGA 2QY9A 4KOAA 1XCMA 3FVRA 3LC2O 3DMRA 2P11A 1QRAA 3IV9A 2KWIA 5AOVA 3QHQA 3MCVA 4GSKA 3FPKA 4V2GA 2II6A 3HR7A 4QUDA 4OU5A 1XA4A 4QUGA 2Z2IA 3KFLA 4LC9A 3W34A 1VGQA 2VHUA 1NVWQ 1TLFA 4HGRA 4UPDA 1LSOA 4ESEA 4JXZA 2V6CA 2GJ8A 4EY5A 1WBJB 2C3PA 3CTAA 1TZBA 1W34A 2OHFA 2ZE5A 2P5SA 4GSYA 4ROSA 4BFWA 5ADWA 2PJPA 1SCJA 2LBPA 2PU7A 3LPCA 2QQ9A 1ODTC 3MFYA 2IEKA 1IRIA 1W2WB 2DI3A 3MNFA 3JRHA 1SOUA 3CPJB 4UUBA 2ZB2A 3FFWA 1EBBA 5T5QA 4TV7A 4WASA 4JLAA 5FOUA 3MCZA 4LWZA 5AKJA 3NKFA 2V9VA 4CQMB 5JZMA 3S1RJ 3HRTA 5J5VA 3U44A 3L77A 2HYJA 1O96A 4G0NA 1XXHB 1IUNA 1MAUA 2ZBUA 3IH5A 1CR2A 3BFJA 5IT0A 3GX4X 4O4IB 5EHIA 5GADl 3MS2A 5IT9Z 3P2IA 2OD9A 2OCGA 2G17A 1XNJA 4Y2JA 1EVKA 2VAWA 4EELA 2NXWA 3MXOA 2EFEB 1Y56A 5JSQA 1WJGA 3C7TA 5ITVA 3S8YA 4GYGA 3BGWA 4QDZA 4TSFD 4BJ6A 2YVLA 3RADC 3L8MA 4MR7A 5DCLA 2YZ2A 1S9HA 1EDZA 1QC5B 3GWZA 2YXBA 4RAOA 4CODB 1YVPA 1MAAA 4TKUA 4DGSA 3W6ZA 3DWLE 4CDRA 3TQHA 3OZDA 1KJ9A 5H1YA 1G98A 1JALA 4NV1A 1PDNC 3A8TA 2QM3A 2OE2A 3ST7A 2VSXA 5DCFA 2B99A 4TT3A 2BYVE 4GR9A 1RHJA 4N39A 5FTNA 1UKCA 4A2CA 1NULA 2F5VA 4DLTA 1H2RS 2FTKE 2UWMA 1DEKA 2OO3A 5ICEA 1X1PA 2GN8A 4LY9A 2GCOB 4NZZA 4YG2F 1IG3A 5EAIA 1UAGA 1WUIS 3ROFA 3ZHUA 3JTHA 1OI2A 3N74A 4DR5B 4FNAA 1PNVA 1NP7A 2X6RA 2D5LA 2Q7DA 1RXWA 2Q41A 4K9SA 2QPTA 5AK4A 5K8CA 5TQJA 1NQOA 4AJPA 3RFUA 1D0ZA 3GFLA 3FXRA 2OA4A 4XKCA 1GZ5A 1UKBA 3HJTA 3UO8B 4GOLD 1W1WA 1E6EA 1T2UA 4UBLA 4LK0F 1IEQA 2Q5FA 2C94A 3HBMA 1Y5NA 3OAAA 4FJ1A 5JECA 3DUFA 3L18A 4LRSB 2PVCA 5EWLB 2BHYA 2NV2B 3WE2A 4BEJA 4QOIA 4WTOA 4K2HA 2JGIA 1OBCA 1GNLA 4RYDA 3I4NJ 5CRIA 3ZBUA 2DU9A 4ECAA 1TCBA 2C0CA 1ESEA 3BXOA 5MDHA 1F4PA 3QYJA 1YAHA 3DVSX 2YOFA 3KLBA 3P97A 3WX0A 4G6QA 2D5VA 2NTNA 3BK1A 3BXHA 1T9GS 4LJAA 3D5TA 121PA 1RTTA 1TC2A 1T5IA 2B1RA 3JRFA 2WM8A 2WUDA 4Q4HB 4DHWA 5F1RA 1O57A 1JDBC 4IEFB 3ELYA 3OZVA 3OS0A 1XDSA 4OP1A 1GRCA 3GMEA 1GZSA 2ZVPX 3GZ4A 3RS3A 1JDUA 1EM8B 2C3YA 3KU1A 5CVUA 3PHHA 4JVMA 5K5QA 1C9NA 4M86A 3SS9X 3UN1A 2ZWOA 2AEJA 4W97A 3I73A 1JQ3A 5J6XA 2G9VA 1T4CB 4RPLA 1A50B 3IRQA 2QG4A 3QRWA 2HBZA 2P2ZA 4GQBA 4U8HA 3T0YA 2CFSA 4QUAA 3CF0A 3WKEA 4D96A 3V1UA 4EFLA 2B4QA 3H17A 3RYCB 3UAYA 5C8YB 2AJCA 5CM9C 5C7IO 1E1CB 2CXNA 1FNCA 1UBJS 3QWAA 4ON9A 5DLPA 3EE6A 5FNVB 3OBIA 2P2CA 2XSZA 3U2QA 3MPOA 4PJ0C 4YEJA 3C5WP 3NARA 2IKSA 3MWDA 3OZUA 4LNUB 4TQ9A 3IDAA 3U7JA 3ZDCA 1RQPA 1V5EA 1UJNA 3MUOA 3ZCOA 1ZCJA 2IEAA 4N0PA 2AH5A 5LDDC 3WTSC 1P4SA 4DV2B 3EFBA 4GXTA 4DAOA 1F1JA 1GCGA 1RWNA 4BWGA 1BX0A 3CLUD 3SYNA 4D3YA 5IWCA 3OYBA 4F92B 2AJDA 3GYHX 4ZCRA 1AS0A 3U9SA 2G9ZA 4BQEA 3ZK9A 1JNYA 4RBNA 3HFSA 5AIAA 5J5CA 5FROA 1VKOA 1M6HA 1AURA 2EAUA 4Q02A 1H1DA 4BHTA 5GADJ 2OESA 2Q6KA 1XDWA 2NO6A 1U11A 4FT2A 3RBAA 2AN9A 2PT5A 3HVKA 2NO4A 2ZBPA 4N3NA 2YXDA 4OUDB 2GAIA 4DRXB 4PIVA 2CW5A 4FT4A 4OF4A 2BE7A 2COKA 3T3IA 2VBCA 4MIKA 3WGTA 5BYBA 3ZEAA 4K6OA 3H5WA 3ILSA 3S29A 3CLUC 5EQFA 4MVJI 2GVNA 2BKEA 5HX7A 1VXOA 4Z0HO 4QHSA 2FKAA 1NVAA 3K71B 3DF8A 3TP0A 1DXOA 2PUTA 4C4OA 4HT3B 2UYHA 2POCA 4PPQA 4EZBA 2XGEA 5TT0A 2K5UA 5BSMA 3UT5B 2I8LA 2GARA 1AMNA 1YCHA 2D3TA 2VDWA 3A3YA 5KKCA 4EW3A 3NVKI 5KAIC 3FWEA 3NWBA 2Y0MA 1BMTA 2EIJH 2ME0A 3PXGA 2FF5A 4MYHA 2OFFA 3C3XA 3SNKA 4CG1A 3EQ9A 4Y3UA 1ETOA 1MVOA 4HQ0A 3HCDA 3OU2A 2QUKA 5CD1A 1JIJA 1YA8A 1Q1EA 1BBYA 2MSDB 4GVPA 2LR8A 2C99A 2H1CA 4C9BA 4I46A 1SQ6A 2VJLA 2ZVQX 3X1ZA 4D1YA 4G5SA 4H1WA 1JIXA 1BOFA 2FUNB 1GLNA 2OCLA 2VBGA 3GELA 3OTOB 2RJOA 3JQ6A 2CB9A 5ITZA 5IS2A 4FLEA 1HYBA 2UYYA 4H1UA 1ZM4A 3L8ZA 3HMQA 4CLRA 3KZIC 1P2GA 4V0RA 2Y2UA 4W4TA 4URWR 2ELHA 4JZYA 1DKQA 3BP8A 1FBUA 2AZTA 2MW8A 2FE1A 5FPSA 3O4HA 5ILGA 1KS2A 1CY8A 2BAGA 3A1FA 3C5VA 4I3GA 2PJZA 1DAMA 4K9OA 3CO5A 5KSYA 4RULA 1EVIA 3TOCA 4BS9A 3UA4A 4P55A 2WQ7A 3WIUA 1L9XA 4IH1A 2H5JA 5FJ8J 3DKWA 1VHJA 1CJSA 2ZJYA 3FUWA 2ZVDA 3LNCA 5DN6D 2Q29A 5EGOB 3L6DA 4ZTZB 2GCIA 3CLKA 3SEZA 2XSZD 4TVSA 3GVHA 3OIVA 1YU6A 1Q0SA 5J40A 3EMBA 3K5WA 3L4SO 3V7FA 1NM5C 2XJ9A 3USCS 5T8KA 2ECCA 1ZELA 1G8YA 1XC5A 1V39A 1LC0A 1GZ4A 3EVFA 1WKBA 2F9FA 4ILEA 2F3QA 2HUPA 3OX3A 1ZXBA 4YJFB 1FYDA 1ABEA 10MHA 1ID8A 1YBHA 3TL2A 3H9JA 2GUGA 5E0KB 3T5XA 1RE1A 2NUBA 4BDTA 5DYIA 1TEVA 4PRYA 2W11A 3QXHA 1YI1A 3FTFA 1JTFA 4BGDA 5ALZA 4BFXA 4RVNA 2ILVA 3MGGA 4OHXA 3I55I 1UCFA 5FF9A 1E60A 3TKLA 4DFDA 5E3JA 1EIWA 1LDNA 2BZ0A 4DNOA 2W98A 1A7JA 4H7PA 4GYYA 4IWYA 1EJ0A 2VBWA 4E88A 1HLDA 1SOMA 3H2YA 3HA5A 4L16A 4MUHA 1U31A 4HL6A 3R44A 3SR4A 1IVSA 1IZ8A 1G5RA 3GUUA 2GBLC 4M9RA 5DX8A 4MFEA 1KO4A 4DUGD 1QH8B 1RXUA 1J0XO 1B8UA 2E82A 1A9OA 2KMUA 2XR1A 2QRZA 4MQUA 3WLKX 1UZMA 1PBTA 2JFVA 4N7MA 3ASNH 3M6MD 3RIEA 3WMRA 2BP7B 3P0IA 1AMOA 3ON5A 5FO5A 1HLVA 2ORYA 5H6RA 1JAHA 1VL0A 2CEKA 2QYOA 3USES 1CJUC 2FWMX 1QHGA 1ZKGA 1WUKS 4MKIA 5JHGB 2NP6A 3DO6A 3WTCA 2YMMA 4BFYA 3R23A 4RTRA 2QUJA 2XVMA 4E2XA 1JZTA 1CUXA 3RSZA 5HKOA 2ES4A 3KYCA 3G5AA 4A2WA 2EQBA 3QU2A 2Z57A 5C1BA 3C7CB 4P6VF 4EJSB 2XOKA 1RKXA 1OHHA 3JRDA 4DGWB 4D9JA 1AKWA 3NT5A 1EDOA 4I9UA 1TNTA 5FLKA 4ZOAA 1PDWA 1DLIA 2AUTA 4EWLA 3C8ZA 4YXFA 4ARSA 3SZRA 5TQ0B 1W8DA 3VC3A 3NDBB 1UDCA 2P4WA 1BYIA 4J4TA 2HCJB 1ID1A 5FLXA 2BMVA 2I55A 1AG9A 1GGHA 3C74A 2R7NA 4Y2SA 3DFIA 1QE3A 2BFFB 2COEA 2ONKA 4PQFA 5J1YA 1BW6A 1G3WA 2PJRA 4P9FA 2A5DA 2IXTA 2VFAA 2W6CX 3EFOA 3OMWA 4JL6A 5LMZA 2J8ZA 3TOZA 4F3TA 3A2NA 3JAKB 3K9BA 3NRCA 4HR7A 4JIMA 4MQMA 1JDTA 4PS0A 5E3MA 1J07A 3ZD9A 3Q12A 4UVIA 3KYDB 3F6CA 4HUTA 1RYNA 4EM0B 3CO6C 2V5VA 3CTPA 1WQ3A 1L8OA 4MUBA 2ZC2A 3FXUA 4V1CI 1HSZA 2HS5A 4KDPA 2MD5A 4YP5A 4C0JA 4R1UA 2W58A 1FJLA 3WDSA 1NMZA 2V7VA 1E2UA 1Q3KA 4D81A 1JT9A 4UOZA 2A3RA 1G1AA 1T2AA 2GVZC 5DTEA 1P7IA 3JRCA 2XYQA 1LCIA 4QU9A 1F5SA 3UWOA 2LY9A 4HEA2 2C8JA 3A0HC 2D0IA 2HHJA 1P9RA 2PGJA 3FZGA 2NVYJ 1FSFA 2FNPA 2QMQA 2R1VA 4MQLA 1XZBA 3AR9A 3DT8A 1TADA 3FJYA 1SOWA 3H1GA 1JEAA 3N0WA 4IOLA 2P6MA 5DN9A 4UEWA 3T7RA 3TQFA 5T64A 1ESDA 1WHSB 5EE5B 1E79A 5CHYA 4C7MA 2JAHA 1TUEA 2PKYX 5H4HA 4XSXF 3AVPA 5EJ2A 5JLAA 4AJ4A 1MW8X 2IXBA 2BV6A 3SX0A 3WKAA 1ZL0A 1IZ9A 1SO8A 4QBFA 1XHFA 4URHA 4GOJA 3SS7X 2FUG2 2A8YA 1Q50A 2GKOA 5L3EA 1ZRCA 2WE7A 4L50A 1RXEA 3DZ8A 3RH0A 3TAXA 2H1OA 5TGDA 1O3QA 3UMVA 4ZQGA 2GCGA 3QLUA 3RT1A 6AT1A 3TH5A 4MULA 2YCLA 4O59O 1KQ8A 4OTZA 4EFNA 4TQUS 4B4CA 3OYFA 2ILTA 5DM4A 4TL7A 2ZJQF 1G21A 4R6WA 1L7NA 1Y7TA 3G8DA 1P1RA 3BJEA 2ZFWA 4RB1A 1HOTA 4X71A 1RRKA 1W96A 3V4FA 1JVBA 1V1JA 1DO0A 2OYRA 4O25A 2H0AA 1JV2B 3OS2A 1MRSA 1CRZA 4BNZA 1NBEA 4X3OA 2FNAA 1TM3E 1PL0A 2WAQN 5G4KA 3JZMA 5JWRA 1FVHA 3OY2A 4G85A 4W9MC 5EPOA 4IHTA 5FR2A 5F73A 3Q0WA 4KICA 1ZIPA 4AF6A 3MFQA 5IBCA 1EX6A 1GU0A 4J7UA 4MQBA 4DQKA 2R7QA 3T8TA 1X6VA 2P5TB 2XBUA 2GX6A 1X1QA 2IZ7A 3KKPA 1ECBA 3OE7A 1UQTA 2Y3IA 3PWTA 4JFRA 5GGXA 4E5MA 5K8VA 1SCUB 1CY1A 4MGRA 3N76A 3G5LA 2CT8A 3TRIA 1G2HA 2DECA 4UAVA 4EJ0A 3K6SA 1LW7A 1XQVA 4RB0A 2FPGA 1PEAA 2H7XA 2HRQA