4G94A

G1 orf67 / staphyloccus aureus sigmaa domain 4 complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
62
structure length
62
Chain Sequence
MKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords RNA polymerase sigma factor rpoD
publication title Promoter-specific transcription inhibition in Staphylococcus aureus by a phage protein.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 20
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g94A00
2PI0A 4RAZA 1U5TC 2FBHA 4UNOA 3F8CA 1U3EM 5LLQA 3MFKA 5FFXA 1O3TA 2HDCA 1U5TB 5TRDA 2G9WA 4MNUA 1PP8F 3EYIA 4GO1A 4O6JA 2TDXA 2XGXA 1T38A 1TW2A 3GVAA 3HUGA 5DD8A 4AVPA 4KICA 3BJAA 2BV6A 1XCBA 3E5QA 3V7SA 4M9ZA 1BI0A 1FLIA 3DF8A 4LG0A 3I54A 4BHCA 1REPC 5DCFA 3WG9A 3HTUA 3ULQB 1V4RA 5D8KB 4GXOA 4ON0A 3VODA 3KFWX 1QBJA 5DV5A 2VXZA 4CZZA 1DP7P 2XROA 1IN8A 4A5MA 3JAMK 1C0WA 1TLHB 4BH9A 1XDUA 5LHIA 1R1VA 3J80Z 3HIFA 5LEJA 2P7CB 2GXBA 3K1NA 2P4WA 2EV0A 3KZZA 4RGUA 3E6MA 1ZN2A 2O03A 5DEQA 4ESFA 4L5IA 3GX4X 4U0WA 5CVIA 2KJBA 3W6JB 5IT3A 1Z05A 4LB5A 3U2RA 5AIQA 1TTYA 1K78B 2DU9A 3EQLF 1HBXG 2QBYB 4LK1F 3GZ5A 5ILUA 5HVQC 3V7RA 1R58A 4IJAA 1DDNA 4I09A 5D5XB 2F2EA 3WTZA 3LQQA 1TBXA 5H6RA 1YO5C 4LGWA 4WWCA 2L4MA 1IW7F 3WTWC 4A2UA 4KMFA 2PQ8A 3R0JA 1SMYF 2DTRA 2LF8A 3ZMSA 3ECOA 2MBFA 3Q5FA 3E5XA 1R7JA 3IC7A 5HS9A 2GA1A 5HLGA 3F23A 2DW4A 3DPTA 2PMUA 1S7OA 1F4KA 4ENNA 3HTSB 1SAXA 2P7VB 5FFZA 3CUOA 1G4DA 4Z2YA 1KGSA 2E7XA 2E1CA 3FMQA 4IHSA 1Q1HA 2FE3A 3BPVA 3K0LA 1IZ1A 3BP8A 4HAMA 3KE2A 5DCMB 2M8EA 2P5VA 4LB6B 2M30A 5LGNA 3Q9VA 4GCVA 3KCCA 3ABUA 4I7HA 1QO0D 1R1UA 4L9VA 3FZVA 4EJTA 3LA7A 2YPRA 4OOIA 2HKOA 1KQ8A 1ZRCA 3ELKA 4HA8A 1O3QA 4HQEA 4M71A 2QWWA 4KA4A 2CO5A 5LHHA 4KYWA 2Y0MA 5JR3A 1JXSA 4Y15A 1RUOA 1BC8C 4S05A 1STZA 3O3KA 2JT1A 1FNNA 2V9VA 4M9SA 1RUNA 5E18F 3TKYA 2GZWA 5ICEA 2DPDA 5ILVA 2Z5UA 2WV0A 2RN7A 3E6BA 3WTSC 1LQ1A 4NQWA 2ELHA 2X4HA 3RKWA 2IRFG 2JPBA 1J59A 2ESHA 4EM2A 3KEQA 4YFXF 2VODA 3JW4A 1U5TA 4P9FA 3I53A 5A2QZ 2D2WA 3F8BA 1G3YA 5L3CA 3HSEA 1OYWA 5KVRA 2VE8A 2M1BA 2XIGA 1ZG5A 4CGZA 4ENJA 3T1BA 2FNAA 1HSJA 4KDPA 2OAZA 2Y48A 3DPLC 3O6BB 3L00A 4P5OA 1P92A 1T2KA 1W4MA 3K69A 4M73A 1LB2A 3BOQA 4NB5A 3HSRA 4HV5A 2ISYA 5LGUA 2QQAA 3J80K 1G3SA 3ZPLA 1YW8A 2HTJA 1QQIA 2D45A 4A12A 1QNTA 4LLGF 5JI6A 2CWEA 1KYWA 1ON2A 4A6DA 2IPQX 2FMYA 4S04A 4A0XA 3LAPA 2V1DA 4I0AA 3KLNA 5ICCA 1YTYA 3ECHA 2XRNA 3C18A 2JZYA 5CVJA 2F5CA 3BWGA 2UXNA 4L9TA 2RKHA 3QOPA 3PQKA 4TV7A 2O3FA 1DPUA 2H6CA 5BPDA 1IN5A 5FB2A 4U0VA 1IXSB 4N0BA 3QU6A 1XDSA 3RPQA 1JHHA 1P4XA 2M87A 4HX8A 4EJVA 1ONVA 1B6AA 2GA2A 3DXJF 3G73A 2OBPA 4A5NA 2VN2A 4HF2A 4G7ZF 4YFKF 2OA4A 4G6DA 2IA1A 1WSUA 1XGSA 1IUYA 2K4JA 5F1RA 4JQFA 2QYOA 3F6VA 5HDGA 2H27A 3RPUA 1R00A 5D6FA 4HF1A 2Q0OA 4PCQA 5BPIA 2BYVE 4ZYDA 3LFKA 3KLOA 4UHTA 4R1HA 5E17F 2FEZA 3I64A 1QGPA 2Z99A 5JHUA 3IRRA 3KP6A 4JBAA 3F3XA 1MDMB 3U1DA 2ADUA 2XAFA 5E1WA 5LBQA 3I0TA 2W85A 2ZBKA 4WXHA 1S6LA 4PGGA 4O3MA 2K02A 2CYYA 1ZH5A 2JTVA 5H6QA 1LEBA 1SD5A 2A6EF 1L0OC 4YIIA 4OU0A 1LJ9A 3FXUA 1DPRA 4A6EA 2V1XA 4OINF 2QUFA 2B0LA 2FBKA 5DCMA 3RTRA 1FX7A 1U6GA 2PMHA 3H3ZA 5E8IA 4PGHA 1MKMA 3T8TA 3R61A 3P9IA 1B1BA 3GZ6A 4AIKA 2OZUA 3NRVA 3MEXA 5EEGA 3FMRA 2G7HA 3V8KA 1BIBA 2O6GE 1IRFA 2NNNA 3GW2A 4L0YB 1ZG3A 2HKXA 2QZ8A 3QPTA 1OYIA 1ZLJA 1H0MA 3FF5A 4KIGA 2UZKA 2KKOA 1W7PB 2C6YA 3S2WA 4EQQA 4I98B 3GWZA 3ZN1A 4BQAA 1FY7A 1RNLA 3HSFA 2A3SA 2FF4A 4N9IA 1PP7U 4EMSA 1HKSA 3NQOA 3F8FA 4GGGA 2HEOA 3M9AA 2MH2A 3F22A 3VEPA 1WWXA 1FBUA 5A2QK 2NNYA 1GHCA 3OV8A 1XN7A 4WCGA 4AD9A 4M6XA 5ILSA 2IA0A 4HLXA 1FZPB 1JHFA 5LGTA 2ZNYA 1GVJA 1YIOA 2LNBA 3WTTC 4B8XA 3DFGA 1D5VA 3F6OA 4LJZF 1Z1DA 2K4BA 2EWNA 2IJLA 5CVRA 2XV4S 5KK1A 1HW1A 2ZXJA 1K7AA 2F5DA 5K5QA 1XMAA 4HDVA 5L3BA 2KJCA 3P7NA 5E1XA 4IPAA 3T5XA 1O7LA 3JTGA 2FU4A 2CGPA 5H20A 2XAJA 2DFIA 5L3EA 2IW5A 3R60A 5CJ9A 1XSXA 2O0YA 3KP5A 4HX7A 4EGYA 1HXDA 4I2OA 1IN7A 3MAJA 2RDPA 3BPXA 2VOOA 4IRGA 1F1ZA 5IT9K 5EEHA 4YG2F 1OR7A 1J7KA 5LRSA 2ZJ2A 2R3SA 3CTAA 1D8JA 2CQKA 1CF7A 3HOSA 1X3UA 3ZN0A 1BIAA 4FX4A 2QLZA 2GAUA 2JSCA 4UVCA 4O5VA 3GFIA 3GFLA 1YS7A 4HZFA 1P2FA 3TOBA 3RKYA 3BY6A 1ZGAA 3CO6C 2O61A 3J81Z 3IRQA 1Z7UA 1O3SA 2F5EA 1K6OA 4MTDA 5HLIA 3GF2A 1F5TA 2HFHA 2YX7A 2ZMEA 4ZH4F 1R36A 5F64A 4WK8F 3M7GA 3WODF 2XASA 5LEKA 4KFCA 1XSVA 2RVCA 4EV0A 2EV5A 4G8XA 2P6SA 1SFUA 2EFQA 2FRHA 1SD4A 4KIFA 5D5WB 1R5HA 1S29A 1I1SA 2A69F 1AOYA 3J7AO 4G6QA 1OPCA 2L3DA 2XAGA 1ZRFA 3M1EA 4BHBA 4I0BA 1S3JA 2ISZA 1UFMA 2CW0F 2DQRA 3ZMZA 5HOOA 5L3DA 5ERIA 3WTUC 2R7FA 1FC3A 3M8FA 3WU1B 4XSXF 4U7BA 4HV6A 4IHTA 1GXPA 5HS8A 1FP1D 3EDPA 3TO7A 4FT8A 2E1NA 4UUVA 2L02A 4MTEA 3IKVA 3IKTA 4N9HA 1AWCA 3QRFF 2W24A 1FOKA 1EH8A 1XMKA 2J5PA 3GFMA 3RYPA 3KP4A 1VTNC 2VT2A 3R4KA 3E5UA 3BROA 3SFZA 4OIRF 1QPMA 1R23A 3K2ZA 1MJBA 4NHJA 2ZKZA 1MD0A 4UXNA 1TQMA 5AIPA 2PJPA 2EJRA 1HW2A 3EYYA 2PG4A 3TGNA 2FNPA 3SHFA 3BJ6A 2DT5A 5FLXK 3GYHX 2UWMA 3I4PA 3QP5A 2L01A 2UXXA 4XRFA 4IVNA 1D3YA 1LEAA 1EH7A 1F9NA 2FQ3A 1SFEA 4E70A 2A5YB 1USSA 4I02A 2Y75A 2QQBA 2Z9OA 1FBQA 4M72A 1HSTA 3ZMVA 2DBBA 1B4AA 1IN4A 4A0ZA 3TOAA 3RJPA 5DUKA 4RGXA 4D0PA 4RB3C 2EFNA 1KA8A 2M5WA 2D1VA 1XD7A 1B9NA 2GWRA 2NAZA 4KMUX 5HS7A 2VT3A 5CYVA 4FHTA 2EA4A 1BI2A 1IXCA 2MLKA 3PQJA 4GYIA 4P55A 1FYMA 2ACJA 1HKQA 1KYZA 3EUHA 2NRAC 3L9FA 2CSOA 2XKPA 1S8NA 5FO5A 4ZYEA 3SZTA 3JSPA 4Q47A 4ZYGA 2QVOA 1CGPA 3SXYA 2DK8A 2EFOA 3GUDA 3WTVC 2KIMA 3WTYC 3RYRA 2YR2A 3JAMZ 4KT5C 1ULYA 2V79A 2IVMA 4JK1X 3CJNA 1R22A 1TQIA 2G7UA 2HTSA 3ZMDA 4Q5SF 3I58A 1K79A 3F21A 3J81K 1J0RA 2STTA 4EJOA 2OU2A 1E2XA 1J9IA 2Z33A 1BN5A 3C3WA 1P4WA 3VB2A 4EJUA 1K78A 3ZMTA 2IT0A 3JSOA 2QBYA 1YW9A 1A04A 2KIUA 1SD6A 4DQ2A 2L4AA 4RGRA 2PLYA 3L7WA 4EVIA 2FXAA 4ASNA 4ESJA 1FSHA 2MC3A 1IN6A 2DLLA 3KEOA 3N4MA 2VC1A 2W84A 4KIBA 4XLNF 1J5YA 1Z6RA 1YFHA 4MQVA 1SMTA 1XSDA 5DUIA 4CDGA 4HLYA 1JE8A 1TNTA 2R7DA 4IRHA 1UB9A 3E97A 2OQRA 1WKMA 1HKTA 4LLNA 5HDKA 3CLOA 1D8KA 5BOXA 1G3TA 4L9NA 2KIFA 5K1YA 4M9XA 2P5KA 4L5JA 4RB1A 3CUQC 2O8XA 5DD4A 3FHZA 2XAQA 3IWFA 3CUQB 3KP7A 4EM1A 4HW0A 5HLHA 4RB2C 3REOA 2CFXA 4L0ZB 2K86A 2EK5A 3DP7A 5BMZA 3C7JA 1U78A 3N97A 4M6YA 4L18B 4UV9A 1I27A 2P8TA 4EGZA 4RAYA 4LLLA 3KP2A 2GIVA 1KQ9A 2FA5A 2DAOA 3WE2A 1W5SA 4KUMA 1XB4A 1YLFA 3ZMUA 3TDUC 4HYEA 5ICGA 3LSTA 1ZREA 3HRMA 3KETA 5JVTA 4G7OF 3C1DA 3F8MA 2AS5F 5LRRA 5J6XA 4BHPA 4ZZDA 3GFJA 1MZBA 1J75A 3ABTA 5FGMA 4UVBA 1ZHFA 4BYYA 4U7DA 4CHUA 1GXQA 3D5LA 1Y0UA 3MZYA 4Q4ZF 3IHUA 2RV8A 2HWVA 2QM3A 2VBWA 2VBZA 3WTXC 3MWMA 5K5OA 1Z9CA 2BBYA 3T0YA 4ENKA 5J8FA 3WGIA 4HDUA 2L54A 5FD6A 5TJJA 1G6NA 2K7LA 3MCZA 2F5FA 4R8HA 3I5UA 2EV6A 2PEXA 2BE5F 4OIOF 4B09A 3DV8A 1OKRA 3U9GA 4AIHA 1ON1A 3HOTA 4F7ZA 1FBSA 1HQCA 1NHAA 3O2PE 1U8RA 3W6KB 1PDNC 3FXRA 2HGCA 1WRJA 5DDGA 4OMZA 1T6SA 2H09A 3QPHA 1BC7C 3KZYA 1FYKA 1T98A 3G3ZA 2COMA 2XVCA 3QAHA 4HOBA 3TO6A 3TQNA 3NEUA 4Y17A 3SZPA 3IWZA 5D5UB 3K9TA 1O3RA 2K27A 1RI7A 1I6XA 1OMIA 3P9KA 4RB0A 1YG2A 2DO7A 3R6SA 1SD7A 2VBYA 4CICA 4ENMA 3I59B 4LD5A 5E20A 2RQPA 1LDJA 1BBYA 1W7PD 2HYFA 4XSZF 3HHHA 2OD5A 1WI9A 5DYMA 3EETA 1XGNA 3L09A 5D4RA 1TNSA 2YU3A 4ETSA 1T0FA 3LWFA 3IL2A 3P9CA 5CVVA 4BXUA 2DQLA 3RKXA 4KNYA 1UHMA 4HBLA 1R5GA 4CYDA 1YW7A 2PBIA 3I71A 4LFUA 3VOEA 1BI1A 2D1HA 1QZYA 1FWZA 4MEXF 2ZCWA 3ML6A 2LF7A 3RIRA 2HQRA 1LDKB 3V8LA 2VE9A 1O57A 3F72A 2VOPA 4H0EA 2M45A 3ISPA 1P6RA 5D4SA 4WF2A 1J2XA 1MDMA 3GXOA 3HRUA 3TDZC 2RC4A 1KU2A 3AAFA 4EJWA 2VONA 2BGCA 1FPQA 2HS5A 5L3GA 3WGHA 5LHGA 2E7WA 4G7HF 1ZARA 1IRGA 2ESNA 3SQNA 1RZ4A 3FM3A 1SFXA 3CUQA 2Q8KA 3JTHA 3RDIA 1IAWA 4U0YA 3D0SA 4XLPF 1FP2A 1WQ2A 1PUEE 5E8GA 1RIOH 4HQMA 2HYGD 3TO9A 5D6EA 2CG4A 4WXCA 1L3LA 2Z3YA 2EFPA 3HRTA 1ODDA 3ROUA 3E6CC 4DNCA 4ZZLA 3ZP5A 2Q2EA 1Z6TA 3QU3A 2QENA 3B73A 4Y13A 2JRTA 1XGOA 5ED4A 3WE3A 3MZHA 4LMYA 3L2CA 4IRIA 1W7PA 1XGMA 2P6TA 3WU0A 4L9JA 3DQVC 1H9GA 3HHGA 4CO8A 1S7AA 2GQQA 2W57A 1EH6A 3QP6A 1KU3A 2IA2A 2A07F 2XUBA 2IP2A 5BQTA 1Z91A 1FSEA 4MHGA 5K5RA 2P5LC 1KU7A 2JPCA 2WC2A 3VFZA 4U88A 4BAYA 6PAXA 3T8RA 2WWYA 3FXQA 4HX4A 4AWXB 1FT9A 1TQPA 1I5ZA 3COAC 2ZFWA 3HRSA 4PZJA 2X0LA 1KQ0A 1UCRA 2VBXA 4WX9A 4UV8A 4LG0B 3ZQ7A 1E17A 2WTEA 2XKOA 1YQAA 1BOAA 5E1ZB 3GLXA 4M74A 4MGRA 2KRFA 3LA2A 4GYGA 2DI3A 3H92A 4ZYHA 2STWA 5D5VB 1W5TA 5BS6A 2MA3A 4BNCA 4Q48A 4XBFA 2HR3A 2AXLA 5AONA 5ICFA 5L3FA 1EV7A 3R0AA 3GEZA 1FYLA 2ZO4A 4IF4A 2ZNZA 2FSWA 5F6FA 1H9TA 2H94A 1XCVA 3ERED 1CF7B 4LK0F 4IXAA 1O7FA 5IT9Z 4QWQA 2NS0A 3BDDA 4YFNF 1ZYRF 2FOKA 2J5OA 1G3WA 5D8LB 1U2WA 3I59A 3K1PA 5J8CA 1ZGJA 3CDHA 1IXRC 5CLSA 2YX4A 4RS8A 3H3UA 4OIQF 3B02A 2PFBA 3K1MA 1LDDA 3LQRA 2HQNA 1B59A 2A6HF 4EM0B 1MJAA 4PDKA 4OIPF 4RGSA 1BM9A 2ZMEB 2A68F 2PN6A 1HW5A 2EB7A 4P96A 1P4AA 2V6CA 4KN7X 4R79A 2LSOA 4AIJA 2HZTA 4MEYF 2V1UA 1USTA 1YS6A 3FWEA 3WGGA 5HDNA 3E3VA 3M8EA 2DPUA 2HOEA 4YIFA 1UHWA 4G9YA 2LKPA 2BEOA 1MJ9A 2OQGA 1B9MA 3LAJA 3FM5A 3V8JA 1BI3A 2ETHA 2XAHA 2OZ6A 1V3FA 3MQ0A 2FBIA 3HYIA 2XHKA 3KP3A 3LA3A 1KU9A 3V4GA 1IF1A 3DEUA 3BJOA 4KN4X 4UVAA 2LDUA 3E6DA 3RI4A 4HF0A 1LNWA 4QLCU 2NYXA 4P9UA 2YSRA 3DKWA 1BJAA 5FD5A 1MGTA 4CXFA 2EFWA 1ZRDA 4K2EA 5CVUA 2MH9A 3F8NA 3GO5A 4WXDA 2RNJA 3FMSA 1OYYA 1JGSA 1TW3A 2A61A 4I01A 2DK5A 3V7CA 1DUXC 2H6BA 2RGVA 1T39A 1ZAOA 3CO7C 2VC0A 5JFRA 1R1TA 2MD5A 1I1GA 4OMYA 3OOPA 1ZG1A 2EA2A 1YYVA 1ZLKA 4FX0A 4A0YA 4ESBA 3BZ6A 2MLGA 3FX3A 3PFIA 2QQ9A 4G94A 1LVAA 4MQ9F 3Q9SA 2GXGA 2FMLA 2W25A 1QZZA 5FLXZ
chains in the Genus database with same CATH superfamily
3U21A 2PI0A 5C4XJ 1HA8A 4RAZA 4N4NB 1U5TC 3HOXJ 2FBHA 4UNOA 1WJ5A 2K40A 3F8CA 1U3EM 5LLQA 1MMGA 4C2MJ 3MFKA 5FFXA 1O3TA 2JJ7A 2HDCA 3LSPA 1U5TB 5TRDA 4MLOA 2G9WA 2R5YA 1Z7LA 4MNUA 3AFHA 1PP8F 2KDOA 3EYIA 1CQTA 4GO1A 4CCOA 4O6JA 3ZQLA 2TDXA 1N78A 2XGXA 3H36A 1T38A 3RZOJ 1VI0A 1TW2A 5C4JJ 2DA4A 3GTMJ 2ECCA 2V9KA 3GVAA 3HUGA 5DD8A 1RETA 1DU0A 4AVPA 3S2HJ 2UUZA 4KICA 5DM7F 4RDUA 2CRGA 3QPSA 3BJAA 2BV6A 1XCBA 2WY7Q 3E5QA 3V7SA 4M9ZA 2DA5A 3A2KA 5B1BH 1BI0A 2L9RA 4RLQA 3BZCA 3HJEA 1FLIA 3DF8A 1JJ6C 1R71A 4LG0A 3I54A 2L7MP 4BHCA 2OCEA 1REPC 2X1CA 2XGCA 5DCFA 3WG9A 3GTQJ 4RM3A 3SEQA 3HTUA 1O4XA 2W7NA 3D5SC 3ULQB 1JUPA 3OYFA 4IQJA 5GAEJ 1OCOH 2R0QC 1V4RA 5D8KB 1X1DA 2LP0A 2PMZA 3FXOA 4GXOA 4ON0A 3ZCOA 4J00A 3VODA 4E7SA 3KFWX 5IP6A 5JVGF 3DEWA 1QBJA 2FJ1A 5DV5A 5LFAA 2VXZA 1HOMA 2D5VA 2YU9J 4CZZA 1DP7P 5B3SH 2XROA 1IN8A 4A5MA 3JAMK 4AIDA 3QPLA 3OYCA 1C0WA 1TLHB 4BH9A 1K4TA 2R92J 1XDUA 3LSHA 3HOZJ 2DOEA 1R1VA 5LHIA 2LY2A 3MKLA 3J80Z 3HIFA 2IS2A 1LKXA 5LEJA 2P7CB 2GXBA 2V26A 3K1NA 1MMDA 2P4WA 3LL7A 2EV0A 3KZZA 4CYCA 4RGUA 1J09A 2OJED 2OTJI 3E6MA 1BW6A 1G8XA 1ZN2A 2CJJA 2O03A 1KONA 3HXLA 2OTLI 5DEQA 3CJQB 1RR7A 2Y30A 4ESFA 4L5IA 3HOUJ 3WU2C 3GX4X 4U0WA 2W00A 5CVIA 1WJEA 2KJBA 2Y0SA 3W6JB 1OCCH 2GOMA 5IT3A 1MMNA 1Z05A 2EZHA 4LB5A 3M1CA 1AKHB 1ERDA 1OCZH 4XKVA 3U2RA 4B48A 5AIQA 1TTYA 2K3FA 1K78B 2DU9A 3A02A 4PSXA 1W0TA 3EQLF 1HBXG 2Y31A 1D0ZA 1SANA 4LK1F 1MMAA 1TWFJ 1Z21A 3LSGA 3G71I 2QBYB 1MNEA 3GZ5A 4HG2A 5ILUA 2LKSA 4GFBA 3HOYJ 3NAUA 5HVQC 3V7RA 4A3EJ 4UY8I 3J7AY 1R58A 3ZQFA 4IJAA 3FISA 1DDNA 4I09A 1N25A 3CJRB 4A3KJ 5D5XB 2F2EA 2BY1A 4NUBA 3WTZA 2FX0A 4G12A 3LQQA 1B72A 1TBXA 4KT6A 2EZIA 4HEA2 5H6RA 1YO5C 4LGWA 5CKTA 1IV6A 5BNGA 3PSIA 3SZGA 2UV1A 3VSLA 4WWCA 2L4MA 1IW7F 3DKYA 3WTWC 2MGQA 2KRHA 1QVUA 4A2UA 4KMFA 2PQ8A 2Y69H 2XPVA 3R0JA 1SMYF 2DTRA 1D0XA 2LF8A 3ZMSA 3ECOA 4DOZA 2R7RA 2IGKA 4BE0A 5FKMA 2MBFA 3Q5FA 2X51A 3E5XA 2E35A 1R7JA 4DBQA 3IC7A 5HS9A 1OLTA 2GA1A 2K9MA 1Y8RB 4XLCA 5HLGA 3F23A 2DW4A 3DPTA 4IX7A 3AG3H 2PMUA 4AU7A 4C2TA 1YI2I 1S7OA 3HG9A 3JCUC 1F4KA 4ENNA 2JUGA 3DTEA 3HTSB 2R7XA 3O8HA 1SAXA 2P7VB 2P81A 2E34A 2RAEA 5FFZA 5IOZA 3CUOA 1G4DA 3HGGA 3DBHB 2CMPA 3QYFA 4Z2YA 1KGSA 2ZSIB 1W1WE 2E7XA 2VLAA 2E1CA 2YS9A 4BY7J 2ICWG 3NWTA 2DTZA 2CQ7A 1E3PA 1JUSA 3FMQA 2QA4I 4IHSA 1AA7A 1Q1HA 2FE3A 3BPVA 3FBIB 1P7IA 4GRIA 5CPRB 3JRAA 1BA5A 3LSJA 2E1MC 3MMYB 3HZJA 3K0LA 1IZ1A 2TRTA 3BP8A 3DLAA 4HAMA 3OYLA 3KE2A 5DCMB 3S15J 2K3PA 2M8EA 4Y33A 2P5VA 2HXIA 3ABKH 4ZTJA 1IO2A 4LB6B 2M30A 5LGNA 3Q9VA 4GCVA 2Y0SN 3KCCA 2CH0A 3ABUA 4I7HA 1QO0D 3BQZA 2HI3A 2CS3A 3MN2A 1JJ8C 5F0HA 1X3ZB 1R1UA 5FKNA 1VQ5I 4L9VA 1K83J 3FZVA 2DCEA 3LA7A 4D1QA 4EJTA 2YPRA 4OOIA 2HKOA 1KQ8A 1ZRCA 4HSRA 3ELKA 4QPOA 3A01B 3OYNA 4HA8A 1O3QA 2E2HJ 1ETYA 3WG7H 3S8PA 4HQEA 4M71A 2QWWA 4KA4A 2CO5A 2M34A 5LHHA 4KYWA 3L2RA 2Y0MA 3BZKA 4MFEA 5JR3A 1JXSA 1Y0NA 4Y15A 2BW3B 3OSGA 3H9QA 1RUOA 1E0EA 1BC8C 1N75A 4S05A 3OIPA 1TL8A 4A3LJ 2R7UA 1MBJA 1STZA 2WAQN 3O3KA 1BOBA 2DA7A 1VQPI 1MBHA 1IJWC 2JT1A 1FNNA 2V9VA 4M9SA 1RUNA 3GTGJ 5E18F 3TKYA 4YIRX 2IS6A 2GZWA 1Y56A 2M0CA 5ICEA 2DPDA 1UZCA 3SDBA 5ILVA 2Z5UA 1FMVA 2WV0A 2RN7A 3F0CA 3HC7A 3E6BA 3WTSC 1LQ1A 4NQWA 2ELHA 2X4HA 1TT0A 2RNGA 3RKWA 2IRFG 1RESA 2JPBA 1Z3YA 1J59A 3CMYA 2OUMA 2ESHA 2LR8A 4EM2A 2V6EA 3KEQA 2LY9A 4YFXF 3I3LA 2VODA 3JW4A 1U5TA 4P9FA 3I53A 5FLMJ 4BL0B 2GLOA 5A2QZ 3Q0WA 2D2WA 3F8BA 3S2DJ 1G3YA 5L3CA 4M3EA 5EG0B 4A3GJ 2F5VA 3HSEA 2VASA 1OYWA 5KVRA 1UHSA 2VE8A 2M1BA 3CCYA 2Y9YA 1ETOA 3B6AA 2F4MB 2XIGA 1ZG5A 4CGZA 2DT6A 3CLQA 4ENJA 3T1BA 2FNAA 2KRCA 1HSJA 3BR1A 4KDPA 2DOFA 2OAZA 2Y48A 3DPLC 5K7ZA 3O6BB 3L00A 4E6KG 4XKWA 4P5OA 1P92A 2DJIA 1T2KA 2JA2A 3S14J 4QSHA 4LG3A 4XOTA 2KISA 1Z3XA 1W4MA 3W6VA 3K69A 4M73A 2HOSA 3BR6A 1XS9A 2VKEA 4RA2A 1LB2A 3BOQA 2KFDA 4NB5A 3BCBA 3FBNB 3HSRA 3I55I 3OY9A 3BQYA 4HV5A 2ISYA 2QCOA 5IYDJ 5LGUA 1OR7C 2QQAA 3RKQA 2NS8A 3J80K 1G3SA 1OQYA 3ZPLA 3TP3A 3BTCA 3HL2A 1YW8A 3L2VA 2EIMH 1F36A 3K4JA 3K4BA 2K85A 4UUSA 2HTJA 1QQIA 5IPAA 1VQKI 2D45A 1YOVB 4A12A 3TL4X 1QNTA 4LLGF 5JI6A 2CWEA 1KYWA 3JRHA 1ON2A 2QQ8A 4XRSA 3H5RA 4A6DA 4JX5A 2IPQX 2FMYA 4S04A 4A0XA 4RM2A 3LAPA 2V1DA 4I0AA 3KLNA 5ICCA 2ME0A 1W36C 3J7ZI 1YTYA 3ECHA 2XRNA 3CQZJ 2VKDA 3C18A 1Z0XA 2JZYA 3KYDB 5CVJA 2IBDA 2ZMEC 1OFCX 2F5CA 3BWGA 2UXNA 4C2UA 3E7LA 4L9TA 2RKHA 3QOPA 3PNVA 2E1OA 3PQKA 4TV7A 2O3FA 1DPUA 2H6CA 5BPDA 1IN5A 4F93B 3Q3SA 5FB2A 4U0VA 1IXSB 1ETWA 4N0BA 3QU6A 3KYLA 1XDSA 3FDYA 4BJ6C 3RPQA 1JHHA 1P4XA 2M87A 4HX8A 2BVLA 4EJVA 1ONVA 4CCNA 1B6AA 2GA2A 3DXJF 3G73A 2OBPA 4A5NA 2WB1A 2VN2A 4HF2A 3CCVI 4G7ZF 3K70C 4YFKF 2NVYJ 4NDLA 2OA4A 4G6DA 4LIVA 2IA1A 1WSUA 1XGSA 3IH2A 1IUYA 2K4JA 5F1RA 1QHGA 3M07A 4JQFA 1BR1A 2QYOA 3V42A 2M9HA 1IDYA 2R7ZJ 3F6VA 5HDGA 3ONQA 5B1AH 1POGA 3JRGA 2H27A 2ZJRF 3RPUA 1R00A 5D6FA 4HF1A 3VYTB 2Q0OA 4PCQA 2BXYA 5BPIA 2BYVE 2L7FP 3ZQHA 4ZYDA 3LFKA 3OYDA 3S32A 1E3HA 3KLOA 4UHTA 4R1HA 5E17F 5TISC 2FEZA 3OYKA 3I64A 1R9TJ 1QGPA 3CF5F 3PJRA 2Z99A 5JHUA 3IRRA 3KP6A 4JBAA 2B7EA 3X2QH 1ITYA 1U9NA 3F3XA 1MDMB 4X6AJ 1PYVA 5GPCA 3U1DA 1MSEC 4XQFA 1AU7A 2X6XA 2ADUA 1DGRM 4W97A 4RAFA 2XDVA 2XAFA 2CFOA 2R5ZB 2W82A 5E1WA 5LBQA 2WAEA 2DT7B 3I0TA 3PUBA 2W85A 5EZGA 2R7VA 2ZBKA 4WXHA 3L2UA 3GCMA 3SYTA 5FJ8J 1S6LA 1SFOJ 4PGGA 4O3MA 2K02A 2KQRA 2CYYA 9ANTA 2HZDA 5H2FC 1T95A 1ZH5A 1WI3A 2MG4A 2JTVA 1R49A 5H6QA 4DZPA 1HF0A 1LEBA 2NXNB 1RKWA 2GOXB 1SC7A 1SVMA 3WHBA 1SD5A 2A6EF 1N77A 1X1PA 1L0OC 2DFEA 4OU0A 4YIIA 2XRLA 1LJ9A 3FXUA 1DPRA 4A6EA 2V1XA 4OINF 2QUFA 2B0LA 4JP0A 2LOOA 4RBOA 1DGWY 2O5RA 1ZTRA 2XGEA 2Y9ZA 2FBKA 4ANJA 3MKZA 5DCMA 1NG6A 3OL4A 3RTRA 1FX7A 1U6GA 1G2HA 2PMHA 1RR8C 2DN0A 3H3ZA 4PGHA 2Y2ZA 5E8IA 1MKMA 2VJ4A 4C3HJ 2W1OA 3T8TA 2TCTA 3KZIC 3P9IA 3R61A 3CC7I 4JX6A 3BTJA 1B1BA 1X2MA 3GZ6A 4AIKA 4C9YA 2OZUA 1X1AA 2LBFA 2OV7A 3NRVA 3MEXA 5EEGA 3BTLA 2LLKA 3FMRA 1SEUA 3OIOA 2G7HA 3V8KA 1D1CA 1BIBA 3KYCB 2EQRA 2Q2EB 2V1NA 2O6GE 1IRFA 2WB1N 2NNNA 3GW2A 1E3OC 4L0YB 1K6YA 1ZG3A 2HKXA 4JYKA 5GTHC 2M4KA 2QZ8A 3QPTA 1OYIA 1ZLJA 3IH3A 1H0MA 1TC3C 1W36D 5EF6A 3FF5A 4KIGA 2UZKA 2KKOA 1W7PB 1MH3A 3OYGA 3S2WA 4EQQA 1HDDC 4I98B 2C6YA 3LSKA 3GLLA 3GWZA 3ZN1A 4B3AA 3DTKA 3K10A 4AC0A 4BQAA 2E2JJ 1FY7A 1RNLA 3HSFA 1YRNB 2A3SA 2FF4A 4N9IA 1PP7U 4XLAA 2ZXWH 2DDBA 2CQNA 4EMSA 1HKSA 3NQOA 4DYRA 3F8FA 3NWSA 3G1LA 4GGGA 2HEOA 3M9AA 2MH2A 1JTXA 3K70D 3F22A 3AL0C 2V7FA 2FD5A 4XN0A 3VEPA 1WWXA 3RQ4A 1RPWA 1FBUA 3CCMI 5A2QK 2NNYA 1ETKA 3AL0B 1VQ7I 4DZJA 1EA3A 4HNTA 1GHCA 1M1EB 3OV8A 1XN7A 2CV0A 2KMUA 2CUEA 4WCGA 4AD9A 4M6XA 4E7JA 5ILSA 2IA0A 4HLXA 4I99C 2GXAA 3OYJA 1FZPB 1JHFA 5IT9Z 2DXIA 5LGTA 2ZNYA 2R7TA 3OS2A 1ZKGA 1GVJA 1YIOA 2LNBA 3WTTC 1V5GA 4BACA 3HKZA 4B8XA 3DFGA 1D5VA 3F6OA 2NVQJ 4II2A 4LJZF 2DOAA 1Z1DA 3AKZA 4W1UA 2MD0A 3HEFA 2K4BA 2RQQA 2EWNA 2IJLA 5CVRA 2XV4S 4QPQA 3CCQI 5KK1A 1HW1A 4FCYA 2H8WA 1KZHA 2ZXJA 1K7AA 3LSIA 2F5DA 4BE2A 5GAGJ 5K5QA 1IGNA 3S1NJ 1XMAA 3EUHC 5L3BA 4JOMA 3L2QA 4HDVA 2KJCA 3P7NA 2CU7A 1MBEA 5E1XA 5J1YA 1IDZA 3UR3C 1BW5A 3CD6I 4IPAA 3T5XA 5IOYA 1H89C 1O7LA 3JTGA 2FU4A 2CGPA 5H20A 2CUFA 2XAJA 4RMNA 3UNGC 5GAHJ 2DFIA 2HXOA 1X3WB 1D1BA 5L3EA 1B8IA 1QA6A 1A6IA 2IW5A 3QOEA 1WJAA 1ZELA 1XPXA 3R60A 3GMEA 5CJ9A 4BQOA 1XSXA 2O0YA 3K2AA 3KP5A 2W48A 4S0HB 2W4SA 4HX7A 2VL8A 1HXDA 4XOPA 4EGYA 4I2OA 5F1JA 1IN7A 3EPZA 3MAJA 2RDPA 3BPXA 3S16J 1DU6A 2HVSA 3OL3A 2VOOA 4CCMA 4IRGA 3CCUI 1F1ZA 5LD2C 4OWRB 5IT9K 5EEHA 4YG2F 1W5CC 2XF7A 4XLEA 2BHZA 1OR7A 1J7KA 3Q0VA 5LRSA 2ZJ2A 2R3SA 3DKXA 4FE7A 3CTAA 1JKOC 2CQKA 2JQ7A 1D8JA 5M3FJ 1CF7A 2X85A 3HOSA 2XB5A 1X3UA 3ZN0A 1BIAA 4FX4A 1Y1WJ 2QLZA 2GAUA 2VPLA 2HU9A 4PSWA 2JSCA 3CMEI 4UVCA 2L9NA 1VQ4I 4O5VA 2FQ4A 4I76A 3GFLA 3GFIA 1YS7A 2VB6A 4HZFA 1P2FA 3TOBA 4CCLA 3RKYA 3BY6A 1ZGAA 3CO6C 2O61A 5FKOA 3ZQCA 1WPKA 2FOWA 2MFZA 3J81Z 3OMYA 3IRQA 1Z7UA 1O3SA 1QZEA 2F5EA 3W2VA 1K6OA 4MTDA 4J01A 4L5EA 3BG9A 5HLIA 3FIWA 3GF2A 1F5TA 1NH3A 1YX3A 2HFHA 2LFBA 2YX7A 2ZMEA 4ZH4F 4HPQA 1R36A 5F64A 4WK8F 3S1QJ 4C3JJ 3QYEA 3M7GA 1BR4A 2X1DA 3ZQGA 5M5WJ 1ETQA 3TW7A 1GV5A 3WODF 3KX2A 3CCRI 4LOCA 2XASA 4C3IJ 5LEKA 4BBSJ 2LH9A 5JLWA 4KFCA 1TP4A 1XSVA 2X9DA 1ZR4A 3BG7A 3I4NJ 2RVCA 4EV0A 2EV5A 1V5EA 3PO2J 4G8XA 2P6SA 4U87A 1SFUA 1Y1VJ 1VQ9I 3G6EI 4BJTA 1U9OA 4XICA 2EFQA 4A3IJ 1T8IA 2FRHA 4JX4A 1SD4A 1X4PA 4KIFA 5D5WB 1R5HA 1S29A 2AQFA 2ZFUA 2Q1ZB 4DJAA 2GM4A 4GDFA 1I1SA 3TW6A 4BXFA 4BE1A 2NS7A 2A69F 3K6GA 3VSKA 1VZ0A 1AOYA 3J7AO 4G6QA 1UAAA 1OPCA 2L3DA 2PMZN 2XAGA 1ZRFA 3H3VK 3M1EA 4BHBA 4I0BA 1S3JA 2ISZA 4A3FJ 1UFMA 2CW0F 4XLFA 3ESWB 2BY2A 2ELKA 4PUSA 3OYMA 2ZB9A 4AUXA 2HOAA 3BR3A 1D5YA 1BR2A 2DQRA 1JT6A 3ZMZA 5HOOA 5L3DA 5ERIA 4UB6C 3WTUC 4BEHB 4BDYA 1VFCA 2R7FA 2CQXA 1JKQC 3ZXSA 1FC3A 2O8KA 3M8FA 3WU1B 1RRJA 4XSXF 4U7BA 3I9V2 4HV6A 4IHTA 2F48A 1GXPA 5HS8A 1FP1D 2L7KA 2KZVA 3EDPA 3TO7A 4FT8A 2E1NA 4UUVA 2L02A 3W2AA 4MTEA 3C2GA 3IKVA 3IKTA 4N9HA 1AWCA 3QRFF 1WJCA 1K61A 2XPWA 2W24A 1FOKA 4XRSG 3OWTA 2I5UA 1VQLI 5KHDA 1EH8A 1XMKA 2XF6A 5B66C 1WH5A 4HNVA 1Y8QB 2J5PA 4CA0A 2VKVA 1JUMA 1PUFA 4B3XA 3G1MA 3GFMA 2CW8A 3HM5A 3OR2C 1WFXA 1VQ8I 3GTPJ 3DPUA 3RYPA 1I3AA 3KP4A 1MW7A 1VTNC 2VT2A 3R4KA 1XTAA 3CF2A 3E5UA 1NK3P 5EYRA 4HNUA 2CUJA 3BROA 3W2WA 2M7BA 3SFZA 1QU3A 2DMQA 3BR5A 4OIRF 3LSMA 1QPMA 1R23A 2MABA 3I4MJ 3K2ZA 2OCCH 1V54H 1MJBA 4NHJA 2ZKZA 1MD0A 1FOXA 4UXNA 1TQMA 3BR0A 5AIPA 1R4NB 3CCEI 2PJPA 2EJRA 1HW2A 1LE8A 4EEFG 5IP9J 3EYYA 2JWTA 4BBRJ 2QEXI 1S72I 4ZDLA 2PG4A 4F3QA 3TGNA 3ZGKA 2FNPA 3SHFA 3BJ6A 4ZYAA 3LSRA 1EKEA 5HNFA 2DT5A 5FLXK 3GYHX 2UWMA 2R4GA 3I4PA 4M3FA 5E3MA 2E36A 3GTOJ 3QP5A 2ID3A 1V55H 4XL9A 3A4CA 3BC8A 1SVOA 4X0GA 2L01A 1P7JA 5EDNA 3HPHA 2UXXA 4XRFA 3K4LA 4IVNA 3TBIA 4BXXJ 1D3YA 2K9NA 1LEAA 2R7QA 2F4IA 1EH7A 1F9NA 3OYAA 2FQ3A 1SFEA 3RPUD 3AG1H 4E70A 2A5YB 1USSA 4I02A 2Y75A 2QQBA 2BVMA 2Z9OA 1FBQA 4M72A 2JA5J 1BL0A 1HSTA 3H9GA 3ZMVA 3C2HA 1WVRA 3FXMA 4NC8A 2DBBA 2R5YB 3ZQIA 1B4AA 3JRDA 3RZDJ 1IN4A 4A0ZA 3TOAA 4XK4A 4CCKA 3RJPA 5DUKA 5IY5H 2JA6J 4RGXA 5FLVA 4D0PA 4E7LA 1GDTA 4H4KC 4CCJA 1OCTC 4RB3C 2EFNA 4D5FA 2H1KA 1KA8A 1RC9A 3BG5A 2M5WA 1YJWI 2D1VA 2KPMA 1XD7A 5HNHA 2L9SA 1B9NA 2GWRA 2NAZA 4KMUX 4P1WA 4PJJA 1MBGA 5HS7A 1MIJA 3PNTA 2VT3A 5CYVA 4FHTA 2EA4A 2GIZA 1X19A 1BI2A 1R6RA 4B4CA 3VWBA 5J3LA 4DBRA 2CUZA 1IXCA 5J4YA 2MLKA 3PQJA 2FUG2 2XSJC 4GYIA 4YRVA 2R7WA 4P55A 1FYMA 4C30A 2LYCA 1D0YA 2ACJA 3IAS2 1JGGA 1HKQA 4Y3OA 1KYZA 3SEZA 3EUHA 2NRAC 4CZCA 1R5ID 1QRYA 2JA8J 3L9FA 2CSOA 2XKPA 5FKLA 3HOWJ 1OCPA 3PIPF 1S8NA 2DMNA 5FO5A 4ZYEA 3SZTA 2M7AA 3JSPA 4Q47A 4OAZA 4DGWB 2LVSA 4ZYGA 2QVOA 1FTTA 1T33A 1VF9A 2E71A 2OPTA 1CGPA 3SXYA 2DK8A 5DS9A 2VUMJ 1FIAA 2EFOA 3GUDA 3WTVC 2KIMA 3QQAA 1VQNI 3WTYC 3RYRA 4CYCB 1ZK8A 2YR2A 3JAMZ 4KT5C 1ULYA 3VYUB 2V79A 2EPFA 4IOCF 2IVMA 4JK1X 3CJNA 1GVDA 1R22A 1TQIA 2G7UA 2HTSA 3OSFA 1WZ2A 2ZJQF 3ZMDA 2R7OA 4ITVA 1UELB 4Q5SF 1A35A 3I58A 4ZC3A 2E5ZA 2VQCA 3LMMA 1K79A 5FRMA 1I3QJ 1LVKA 1T0FC 4NC7A 4ZJZA 3F21A 3J81K 5J1UA 1Y6IA 4FASD 1J0RA 2STTA 4F92B 4EJOA 5EJCA 2OU2A 2X6OA 1YITI 1E2XA 1J9IA 1AKHA 2Z33A 1BN5A 3CDIA 5GTIC 4D7NA 3MKWB 3C3WA 1P4WA 3VB2A 5K7HA 3TP0A 4EJUA 5FKKA 3W3CA 1K78A 3VYRB 3ZMTA 3SDGA 4BJ5C 3S3OA 1OJLA 4XM3A 1GT0C 2O7OA 2IT0A 3DLLF 3JSOA 2QBYA 1YW9A 1A04A 5F08A 2KIUA 1SD6A 4DQ2A 2L4AA 3BR2A 4RGRA 2PLYA 1F43A 3L7WA 2DMTA 4FETA 4EVIA 1APLC 1DQUA 2FXAA 4ASNA 4ESJA 1ORKA 1FSHA 2MC3A 1IN6A 2DLLA 2HVRA 2EINH 3OIQA 3KEOA 1TWGJ 3N4MA 1UG2A 1P9QC 2K9QA 2VC1A 2W84A 4KIBA 4XLNF 1WJBA 1B72B 4IHWA 4J19A 1J5YA 1Z6RA 1YFHA 2YUSA 4MQVA 1SMTA 3ZOBA 1XSDA 5DUIA 3FK7A 4CDGA 1XC5A 1FOWA 4HLYA 1TNTA 1JE8A 1GUUA 2R7DA 4IRHA 3HBLA 3FKJA 3FXKA 1UB9A 3E97A 4PJNA 2OQRA 3JRIA 2VJJA 1WKMA 1HKTA 2AQEA 3S3NA 1PVEA 1DP3A 2QKLB 4M3BA 3PM1A 2DFHA 3CMAI 2WAFA 4LLNA 5HDKA 2MSYA 3CLOA 1D8KA 1U0JA 5BOXA 1G3TA 4L9NA 1XX5A 2KIFA 5K1YA 1EJ9A 1IUFA 1UG0A 3FK6A 4M9XA 4BUPA 2P5KA 2NVUB 4IO9F 4L5JA 4RB1A 1LUJB 1ZQ3P 2A6TA 3CUQC 2O8XA 2KL4A 5DD4A 5EGOB 1IC8A 3FHZA 2ZSHB 2NVTJ 1JKPC 2XAQA 4RAGA 3IWFA 3IAM2 3CUQB 3KP7A 4EM1A 4HW0A 5HLHA 4RB2C 3REOA 4XONA 3IUOA 3N05A 2CFXA 4NBQA 3VDXA 1W0UA 2K86A 4L0ZB 2KDZA 2ECBA 2EK5A 2DA1A 3DP7A 3A1YA 5BMZA 3C7JA 4V2FA 1U78A 1ZR2A 2VJIA 3M8JA 1A36A 3N97A 3BT9A 4M6YA 4L18B 4UV9A 4XN3A 2DA6A 1I27A 1WJDA 3DBLB 2P8TA 1EF4A 4EGZA 1FOYA 4RAYA 4MO7A 4LLLA 3K4CA 1MNDA 4D9JA 3D5RC 4A3CJ 3KP2A 2GIVA 3HOVJ 1KQ9A 2FA5A 3A0HC 3AG4H 1Z77A 1X2NA 3LFUA 4CSWA 2L9VA 1YHQI 2WBMA 4DW6A 3A01A 2DAOA 3WE2A 4XORA 2IAIA 1W5SA 2WV1A 4KUMA 1FMWA 1XB4A 1YLFA 3SFIA 3ZMUA 2G0EA 3TDUC 4HYEA 5ICGA 3LSTA 1ZREA 4B1RA 3HRMA 3KETA 5JVTA 1YX5A 4G7OF 3C1DA 3F8MA 3LNQA 2BW3A 4G6TB 2AS5F 4LITA 3H35A 5LRRA 1K4SA 5J6XA 3LOCA 4BKXA 4BHPA 5KNLA 4ZZDA 3GFJA 1U8BA 1MZBA 1J75A 2COBA 3ABTA 1TWAJ 3B6CA 5FGMA 3K7AJ 4UVBA 1ZHFA 4BYYA 1A5JA 4U7DA 2IGNA 2QGUA 4CHUA 1GXQA 3D5LA 1YJ9I 1Y0UA 3MZYA 3GBGA 3UKGA 4Q4ZF 3IHUA 2RV8A 2HWVA 2QM3A 5B5EC 2VBWA 3C2BA 2VBZA 3FXLA 5DTDA 2E5NA 2XB0X 3WTXC 5F04A 3MWMA 5K5OA 1Z9CA 2BBYA 3T0YA 1SFKA 1YE9A 5J8FA 2I8DA 4ENKA 3ZQQA 2HOTA 4E7IA 2LG4A 2E19A 2WA0A 3H1CA 3WGIA 4HDUA 2L54A 5EG0A 5FD6A 5TJJA 1G6NA 2K7LA 2QSHX 4E7ZA 3MCZA 2F5FA 4CUGA 2KP6A 5M3MJ 2Z1DA 4R8HA 2K5CA 2EV6A 1R4MB 3I5UA 5EZHA 2PEXA 3RCOA 3Q0UA 2BE5F 4OIOF 4B09A 2EBIA 1OKRA 3DV8A 3U9GA 4AIHA 2LC2A 1ON1A 2IEKA 2ME6A 3HOTA 4F7ZA 1FBSA 1HQCA 2KIQA 4M6VA 1NHAA 3O2PE 1YJNI 1U8RA 4YEJA 3W6KB 2AO9A 3K4MA 3GTLJ 1X4OA 1PDNC 1TWHJ 1V5FA 4M3GA 2VPRA 3FXRA 2P0WA 2HGCA 1WRJA 5DDGA 2XAUA 4A3JJ 5M5XJ 4XKBA 4OMZA 3JRCA 1LFPA 4IKFA 1Q1VA 1T6SA 4PJMA 5F0FA 3PFYA 3VYSB 2LD5A 2H09A 3QPHA 1BC7C 3KZYA 1WJFA 1FYKA 1T98A 3G3ZA 2COMA 2XVCA 3QAHA 4F55A 4HOBA 1Y39A 3TO6A 3TQNA 3NEUA 5C3EJ 2X1EA 4X1EA 1X1CA 1AHDP 4Y17A 3SZPA 4UUSB 3IWZA 5D5UB 4HRIA 3ABLH 3K9TA 1O3RA 4PFPA 3DCFA 2K27A 1RI7A 1I6XA 4PK4A 1OMIA 3P9KA 4RB0A 2KLOA 1YG2A 2QKMB 2DO7A 4II3A 3R6SA 1SD7A 2VBYA 3AG2H 4CICA 4ENMA 4IHYA 1LFBA 3HDDA 2NOGA 4NNJA 3I59B 4LD5A 1ENHA 5E20A 3TMOA 3SJMA 2RQPA 5GADJ 1LDJA 3JR9A 3E1SA 3OYEA 3FHNA 3S1RJ 1BBYA 1W7PD 2L5QA 3KPHA 1NK2P 2HYFA 4XSZF 3HHHA 2OD5A 1WI9A 4IOAF 3DBRB 5DYMA 1HCRA 3EETA 4ZTFA 1XGNA 3QYBA 2IS1A 1I39A 2E60A 2HVQA 2JSPA 5DM6F 3L09A 1HLVA 5D4RA 1TNSA 2YU3A 2XSDC 3NARA 4ETSA 1T0FA 3LWFA 1X1BA 3OYHA 3IL2A 3P9CA 2JMWA 3KIOA 5CVVA 1FJLA 2DMUA 3MZ8A 4BXUA 5E3LA 2DQLA 3KEYA 3O8GA 5F27A 3RKXA 4KNYA 4V2GA 3HKZN 3FXJA 5K7FA 2DA3A 1UHMA 2JK3A 2H1LA 4HBLA 5J47A 1R5GA 1NG7A 4CYDA 1YW7A 3QODA 2EILH 2PBIA 3H0DA 3I71A 4XRMA 1G59A 4LFUA 1MNMC 4BY1J 3VOEA 4A3BJ 1NTCA 1BI1A 3CESA 2D1HA 1QZYA 1FWZA 4NC6A 4MEXF 2ZCWA 2E2IJ 3ML6A 2LF7A 5HODA 4IHXA 4Z6YA 3RIRA 2HQRA 3S17J 1JKRC 1LDKB 2WAQA 4KJZA 4BQNA 3V8LA 2VE9A 4QIWN 2F4OB 1O57A 3F72A 2BOLA 3PNYA 2X6WA 2VOPA 2VIXA 3ABMH 4H0EA 3S93A 2M45A 1VNDA 4V19K 4A3DJ 3H5NA 4IQ4A 3QWLA 3ISPA 1P6RA 1T08B 4MFDA 5D4SA 1IG7A 4WF2A 4XMYA 1UMQA 1J2XA 1MDMA 3MD2A 3GXOA 3HRUA 1FIPA 3TDZC 2RC4A 1KU2A 3AAFA 1GV2A 5JHFA 1HDPA 4EJWA 2VONA 2BGCA 1FPQA 3F9KA 2HS5A 2R5ZA 5L3GA 3WGHA 2HYJA 3H5AA 3DWLE 5LHGA 3J7YJ 4OAYA 4RLFA 2E7WA 3M3YJ 3CDLA 4G7HF 1ZARA 1IRGA 5EGOA 2ESNA 3SQNA 1RZ4A 2IGOA 3FM3A 1X58A 2VQHA 3PL8A 1SFXA 4E4HA 3CUQA 5CQEA 2HNHA 2DJNA 3OS0A 2Q8KA 3L1PA 3IH4A 3EUKL 4PFOA 3JTHA 3RDIA 3OYBA 1IAWA 3D0SA 4XLPF 4U0YA 1FP2A 1WQ2A 1PUEE 4XIDA 5E8GA 3VPRA 3U1KA 1RIOH 4HQMA 2VI6A 1TWCJ 4E7KA 2HYGD 3G2BA 1VQMI 3TO9A 2HQAA 5D6EA 1MBKA 4EATA 2CG4A 2KT0A 4ABZA 3JRBA 4WXCA 1L3LA 2E1MB 2GBYA 3ASNH 2Z3YA 3CMMA 3TEDA 2EFPA 3DU5A 2A05A 3HRTA 2PJRB 3HPGA 1ODDA 1XG1A 2LBFB 4N4OB 2M4GA 3ROUA 3E6CC 4DNCA 4ZZLA 3DU6A 3ZP5A 2BZTA 3IP4B 2Q2EA 1Z6TA 3QU3A 2IXSA 1VQOI 2QENA 3B73A 4Y13A 2JRTA 1XGOA 5FROA 5ED4A 3S3MA 2JN6A 3WE3A 3MZHA 4LMYA 3L2CA 4IRIA 2L7ZA 4AM3A 1W7PA 1XGMA 2P6TA 3WU0A 4L9JA 5IP7J 2VJ5A 2EH3A 3DQVC 1H9GA 2I10A 3HHGA 4CO8A 3CC4I 1S7AA 2LMDA 4Y4RA 2GQQA 2W57A 3GTKJ 1EH6A 3QP6A 4BS9A 1Z67A 2VQGA 1QHHD 1YRNA 1KU3A 2DODA 5GP9A 5M5YJ 2CQQA 2IA2A 2M8GX 2A07F 2XUBA 2IP2A 3CP8A 1MSFC 5BQTA 4DYQA 1RKTA 1Z91A 1FSEA 4MHGA 2M0MA 5K5RA 2B9SA 2HPMA 3CCLI 2P5LC 1T56A 1KU7A 2JPCA 2NOJB 4IL6C 5GPAA 2H8RA 2WC2A 2QSFX 1JT0A 5CQGA 3VFZA 4U88A 4B44A 4BAYA 6PAXA 2MW8A 3K4NA 5HLTA 3T8RA 2WWYA 3FXQA 4M3DA 2Z2SB 5EEAA 4HX4A 3CC2I 2BY3A 4AWXB 2JUCA 3PO3J 3DTIA 2L0KA 5E3NA 1XMXA 3G4SI 1FT9A 1TQPA 1I5ZA 3COAC 2ZFWA 2ZC2A 3HUGB 2LKXA 2EZKA 3PUFA 3E0JB 3HRSA 4PZJA 4HSTA 3OOUA 4E7HA 2JA7J 4ZDOA 1IV8A 2X0LA 2HPIA 2K9LA 1S5LC 1LPQA 2X6YA 1KQ0A 1UCRA 2AHQA 2VBXA 1A31A 3ZR8X 1LFUP 4WX9A 2EZLA 5F0CA 4IEJA 4UV8A 3G1OA 4MIMA 4LG0B 3ZQ7A 2VXDA 2DA2A 2DFFA 2KHMA 2EIKH 1E17A 2WTEA 2XKOA 1YQAA 1BOAA 5E1ZB 3GLXA 4PJ0C 4M74A 4MGRA 2KRFA 2QSGX 3LA2A 4GYGA 2DI3A 2X48A 3H92A 4A93J 2DYRH 4ZYHA 2M3AA 3ERMA 1FEXA 1I6HJ 2STWA 5D5VB 4D7MA 1W5TA 5BS6A 2RREA 2F6CA 5JLXA 2MA3A 2DDAA 4BNCA 1I50J 4XLHA 4Q48A 1MMSA 3M4OJ 4XBFA 1B8IB 4I6ZA 2MC4A 2HR3A 2AXLA 5AONA 5ICFA 1HC8A 4A69C 3P5JA 5L3FA 1EV7A 1A6QA 3BLYA 2V4JC 3R0AA 3GEZA 1FYLA 2ZO4A 4IF4A 2HDWA 2ZNZA 1D1AA 5TGTA 2IS4A 3PIOF 3K4KA 2V9PA 2FSWA 3ASOH 3GZNB 5F6FA 1H9TA 3A03A 4FQGA 2H94A 2XC7A 4PJLA 1XCVA 2A5WA 3ERED 1CF7B 4LK0F 4KITB 2PX9A 3HB9A 1S9HA 4IXAA 4XKCA 1O7FA 1WGXA 4BU2A 4QWQA 2NS0A 3BDDA 4YFNF 1ZYRF 2FOKA 2J5OA 4F91B 5KAFC 1G3WA 2ELJA 1IRZA 5D8LB 1U2WA 3I59A 3OR1C 3HGYA 3BCAA 3H0GJ 3K1PA 5J8CA 1ZGJA 3CDHA 1IXRC 5CLSA 3JREA 4D5CA 2YX4A 4RS8A 3H3UA 4OIQF 3B02A 4AYBA 2PFBA 3K1MA 2JVHA 1LDDA 3LQRA 3WHCA 2HQNA 1B59A 3S1MJ 2A6HF 4EM0B 4DIQA 1MJAA 4PDKA 3L2WA 4IHVA 3OS1A 4A3MJ 1H88C 2CV2A 4OIPF 4BDZA 1ACIA 4RGSA 1BM9A 2ZMEB 2A68F 4UB8C 1OISA 5J4VA 3ZRGA 5E79C 3IV5A 2WADA 2PN6A 1OCRH 1JTYA 1HW5A 2EB7A 4LIUA 4P96A 1P4AA 2V6CA 4KN7X 4R79A 2LSOA 4AIJA 2HZTA 4MEYF 2V1UA 1GLNA 3MVPA 1USTA 1YS6A 2JVGA 3FWEA 3WGGA 2MYSA 5HDNA 3E3VA 3M8EA 3MKYB 1JI8A 2BHYA 2DPUA 5J40A 2K9SA 2HOEA 2Z16A 4YIFA 1MH4A 5KAIC 1UHWA 4G9YA 2LKPA 4CH7A 2BEOA 1MJ9A 2OQGA 2LRDA 1B9MA 2IGMA 3LAJA 3FM5A 3V8JA 1BI3A 2ETHA 4XNFA 2OF7A 2XAHA 3CJTB 2M2EA 2OZ6A 1V3FA 3MQ0A 3CCSI 4Y52J 3BG6A 4YELA 2FBIA 2ZXHA 3HYIA 2XHKA 3KP3A 1QPIA 4FE4A 1TZLA 2ZXIA 4BEHA 1H8AC 1S7EA 2VQLA 3LA3A 1KU9A 1IRXA 3V4GA 1IF1A 3GTJJ 3DEUA 1ETVA 4F52A 1ZGWA 3BJOA 4KN4X 3PSFA 4UVAA 5KCMA 2NVXJ 2LDUA 3E6DA 3RI4A 2BY0A 2R93J 4HF0A 2B63J 1SAUA 1PJRA 2LREA 1LNWA 2EIJH 2NYXA 2XF5A 4QLCU 2R7SA 2VKHA 2XPUA 3RSNA 4P9UA 5C44J 2KZGA 2YSRA 3DKWA 4IZZA 1BJAA 4ZDPA 3EUAA 3H9JA 1MGTA 5FD5A 4CXFA 2EFWA 1PUFB 1ZRDA 2CW7A 4K2EA 5CVUA 2HQ5A 3JRFA 2MH9A 3BG3A 4AVZA 3OYIA 3F8NA 4FISA 2HDDA 4B47A 1WHUA 3GO5A 4KISA 2LTPA 4WXDA 4AYBN 2RNJA 3FMSA 4QTRA 1OYYA 1FTZA 2OC6A 2DYSH 2N8GA 3CP2A 1JGSA 1TW3A 4UUTA 2A61A 2DMPA 4I01A 2ID6A 2DK5A 3A0BC 3I56I 3V7CA 3D1NI 1MBFA 1ETXA 1QVTA 1TT5B 1DUXC 5IYBJ 5FRNA 4FTHA 3CZ6A 2PJRA 2H6BA 2RGVA 1LE8B 1BJZA 1T39A 1ZAOA 5IYCJ 3BTIA 3CO7C 2VC0A 2JRMA 5JFRA 3FKIJ 3CCJI 1R1TA 1YIJI 2MD5A 2WY8Q 1I1GA 2CV1A 4OMYA 3OOPA 2BXZA 3RQIA 4XR6A 4B43A 4DYCA 2AXTC 1ZG1A 1WH7A 2EA2A 1SVLA 2ZJPF 1YYVA 4BQQA 1ZLKA 4FX0A 4A0YA 1UJ8A 4ESBA 3BZ6A 5E3OA 2O9LA 2MLGA 3FX3A 3PFIA 4BGDA 2QQ9A 2LK2A 5J1RA 4G94A 1WCMJ 3DEEA 1LVAA 4MQ9F 2LY1A 2XGDA 3Q9SA 4Y7NJ 2GXGA 2L2OA 2QF7A 2FMLA 1VQ6I 2W25A 1QZZA 4NQWB 5FLXZ
chains in the Genus database with same CATH topology
2PI0A 4RAZA 1U5TC 2FBHA 4UNOA 3F8CA 1U3EM 5LLQA 3MFKA 5FFXA 1O3TA 2HDCA 1U5TB 5TRDA 2G9WA 4MNUA 1PP8F 3EYIA 4GO1A 4O6JA 2TDXA 2XGXA 1T38A 1TW2A 3GVAA 3HUGA 5DD8A 4AVPA 4KICA 3BJAA 2BV6A 1XCBA 3E5QA 3V7SA 4M9ZA 1BI0A 1FLIA 3DF8A 4LG0A 3I54A 4BHCA 1REPC 5DCFA 3WG9A 3HTUA 3ULQB 1V4RA 5D8KB 4GXOA 4ON0A 3VODA 3KFWX 1QBJA 5DV5A 2VXZA 4CZZA 1DP7P 2XROA 1IN8A 4A5MA 3JAMK 1C0WA 1TLHB 4BH9A 1XDUA 5LHIA 1R1VA 3J80Z 3HIFA 5LEJA 2P7CB 2GXBA 3K1NA 2P4WA 2EV0A 3KZZA 4RGUA 3E6MA 1ZN2A 2O03A 5DEQA 4ESFA 4L5IA 3GX4X 4U0WA 5CVIA 2KJBA 3W6JB 5IT3A 1Z05A 4LB5A 3U2RA 5AIQA 1TTYA 1K78B 2DU9A 3EQLF 1HBXG 2QBYB 4LK1F 3GZ5A 5ILUA 5HVQC 3V7RA 1R58A 4IJAA 1DDNA 4I09A 5D5XB 2F2EA 3WTZA 3LQQA 1TBXA 5H6RA 1YO5C 4LGWA 4WWCA 2L4MA 1IW7F 3WTWC 4A2UA 4KMFA 2PQ8A 3R0JA 1SMYF 2DTRA 2LF8A 3ZMSA 3ECOA 2MBFA 3Q5FA 3E5XA 1R7JA 3IC7A 5HS9A 2GA1A 5HLGA 3F23A 2DW4A 3DPTA 2PMUA 1S7OA 1F4KA 4ENNA 3HTSB 1SAXA 2P7VB 5FFZA 3CUOA 1G4DA 4Z2YA 1KGSA 2E7XA 2E1CA 3FMQA 4IHSA 1Q1HA 2FE3A 3BPVA 3K0LA 1IZ1A 3BP8A 4HAMA 3KE2A 5DCMB 2M8EA 2P5VA 4LB6B 2M30A 5LGNA 3Q9VA 4GCVA 3KCCA 3ABUA 4I7HA 1QO0D 1R1UA 4L9VA 3FZVA 4EJTA 3LA7A 2YPRA 4OOIA 2HKOA 1KQ8A 1ZRCA 3ELKA 4HA8A 1O3QA 4HQEA 4M71A 2QWWA 4KA4A 2CO5A 5LHHA 4KYWA 2Y0MA 5JR3A 1JXSA 4Y15A 1RUOA 1BC8C 4S05A 1STZA 3O3KA 2JT1A 1FNNA 2V9VA 4M9SA 1RUNA 5E18F 3TKYA 2GZWA 5ICEA 2DPDA 5ILVA 2Z5UA 2WV0A 2RN7A 3E6BA 3WTSC 1LQ1A 4NQWA 2ELHA 2X4HA 3RKWA 2IRFG 2JPBA 1J59A 2ESHA 4EM2A 3KEQA 4YFXF 2VODA 3JW4A 1U5TA 4P9FA 3I53A 5A2QZ 2D2WA 3F8BA 1G3YA 5L3CA 3HSEA 1OYWA 5KVRA 2VE8A 2M1BA 2XIGA 1ZG5A 4CGZA 4ENJA 3T1BA 2FNAA 1HSJA 4KDPA 2OAZA 2Y48A 3DPLC 3O6BB 3L00A 4P5OA 1P92A 1T2KA 1W4MA 3K69A 4M73A 1LB2A 3BOQA 4NB5A 3HSRA 4HV5A 2ISYA 5LGUA 2QQAA 3J80K 1G3SA 3ZPLA 1YW8A 2HTJA 1QQIA 2D45A 4A12A 1QNTA 4LLGF 5JI6A 2CWEA 1KYWA 1ON2A 4A6DA 2IPQX 2FMYA 4S04A 4A0XA 3LAPA 2V1DA 4I0AA 3KLNA 5ICCA 1YTYA 3ECHA 2XRNA 3C18A 2JZYA 5CVJA 2F5CA 3BWGA 2UXNA 4L9TA 2RKHA 3QOPA 3PQKA 4TV7A 2O3FA 1DPUA 2H6CA 5BPDA 1IN5A 5FB2A 4U0VA 1IXSB 4N0BA 3QU6A 1XDSA 3RPQA 1JHHA 1P4XA 2M87A 4HX8A 4EJVA 1ONVA 1B6AA 2GA2A 3DXJF 3G73A 2OBPA 4A5NA 2VN2A 4HF2A 4G7ZF 4YFKF 2OA4A 4G6DA 2IA1A 1WSUA 1XGSA 1IUYA 2K4JA 5F1RA 4JQFA 2QYOA 3F6VA 5HDGA 2H27A 3RPUA 1R00A 5D6FA 4HF1A 2Q0OA 4PCQA 5BPIA 2BYVE 4ZYDA 3LFKA 3KLOA 4UHTA 4R1HA 5E17F 2FEZA 3I64A 1QGPA 2Z99A 5JHUA 3IRRA 3KP6A 4JBAA 3F3XA 1MDMB 3U1DA 2ADUA 2XAFA 5E1WA 5LBQA 3I0TA 2W85A 2ZBKA 4WXHA 1S6LA 4PGGA 4O3MA 2K02A 2CYYA 1ZH5A 2JTVA 5H6QA 1LEBA 1SD5A 2A6EF 1L0OC 4YIIA 4OU0A 1LJ9A 3FXUA 1DPRA 4A6EA 2V1XA 4OINF 2QUFA 2B0LA 2FBKA 5DCMA 3RTRA 1FX7A 1U6GA 2PMHA 3H3ZA 5E8IA 4PGHA 1MKMA 3T8TA 3R61A 3P9IA 1B1BA 3GZ6A 4AIKA 2OZUA 3NRVA 3MEXA 5EEGA 3FMRA 2G7HA 3V8KA 1BIBA 2O6GE 1IRFA 2NNNA 3GW2A 4L0YB 1ZG3A 2HKXA 2QZ8A 3QPTA 1OYIA 1ZLJA 1H0MA 3FF5A 4KIGA 2UZKA 2KKOA 1W7PB 2C6YA 3S2WA 4EQQA 4I98B 3GWZA 3ZN1A 4BQAA 1FY7A 1RNLA 3HSFA 2A3SA 2FF4A 4N9IA 1PP7U 4EMSA 1HKSA 3NQOA 3F8FA 4GGGA 2HEOA 3M9AA 2MH2A 3F22A 3VEPA 1WWXA 1FBUA 5A2QK 2NNYA 1GHCA 3OV8A 1XN7A 4WCGA 4AD9A 4M6XA 5ILSA 2IA0A 4HLXA 1FZPB 1JHFA 5LGTA 2ZNYA 1GVJA 1YIOA 2LNBA 3WTTC 4B8XA 3DFGA 1D5VA 3F6OA 4LJZF 1Z1DA 2K4BA 2EWNA 2IJLA 5CVRA 2XV4S 5KK1A 1HW1A 2ZXJA 1K7AA 2F5DA 5K5QA 1XMAA 4HDVA 5L3BA 2KJCA 3P7NA 5E1XA 4IPAA 3T5XA 1O7LA 3JTGA 2FU4A 2CGPA 5H20A 2XAJA 2DFIA 5L3EA 2IW5A 3R60A 5CJ9A 1XSXA 2O0YA 3KP5A 4HX7A 4EGYA 1HXDA 4I2OA 1IN7A 3MAJA 2RDPA 3BPXA 2VOOA 4IRGA 1F1ZA 5IT9K 5EEHA 4YG2F 1OR7A 1J7KA 5LRSA 2ZJ2A 2R3SA 3CTAA 1D8JA 2CQKA 1CF7A 3HOSA 1X3UA 3ZN0A 1BIAA 4FX4A 2QLZA 2GAUA 2JSCA 4UVCA 4O5VA 3GFIA 3GFLA 1YS7A 4HZFA 1P2FA 3TOBA 3RKYA 3BY6A 1ZGAA 3CO6C 2O61A 3J81Z 3IRQA 1Z7UA 1O3SA 2F5EA 1K6OA 4MTDA 5HLIA 3GF2A 1F5TA 2HFHA 2YX7A 2ZMEA 4ZH4F 1R36A 5F64A 4WK8F 3M7GA 3WODF 2XASA 5LEKA 4KFCA 1XSVA 2RVCA 4EV0A 2EV5A 4G8XA 2P6SA 1SFUA 2EFQA 2FRHA 1SD4A 4KIFA 5D5WB 1R5HA 1S29A 1I1SA 2A69F 1AOYA 3J7AO 4G6QA 1OPCA 2L3DA 2XAGA 1ZRFA 3M1EA 4BHBA 4I0BA 1S3JA 2ISZA 1UFMA 2CW0F 2DQRA 3ZMZA 5HOOA 5L3DA 5ERIA 3WTUC 2R7FA 1FC3A 3M8FA 3WU1B 4XSXF 4U7BA 4HV6A 4IHTA 1GXPA 5HS8A 1FP1D 3EDPA 3TO7A 4FT8A 2E1NA 4UUVA 2L02A 4MTEA 3IKVA 3IKTA 4N9HA 1AWCA 3QRFF 2W24A 1FOKA 1EH8A 1XMKA 2J5PA 3GFMA 3RYPA 3KP4A 1VTNC 2VT2A 3R4KA 3E5UA 3BROA 3SFZA 4OIRF 1QPMA 1R23A 3K2ZA 1MJBA 4NHJA 2ZKZA 1MD0A 4UXNA 1TQMA 5AIPA 2PJPA 2EJRA 1HW2A 3EYYA 2PG4A 3TGNA 2FNPA 3SHFA 3BJ6A 2DT5A 5FLXK 3GYHX 2UWMA 3I4PA 3QP5A 2L01A 2UXXA 4XRFA 4IVNA 1D3YA 1LEAA 1EH7A 1F9NA 2FQ3A 1SFEA 4E70A 2A5YB 1USSA 4I02A 2Y75A 2QQBA 2Z9OA 1FBQA 4M72A 1HSTA 3ZMVA 2DBBA 1B4AA 1IN4A 4A0ZA 3TOAA 3RJPA 5DUKA 4RGXA 4D0PA 4RB3C 2EFNA 1KA8A 2M5WA 2D1VA 1XD7A 1B9NA 2GWRA 2NAZA 4KMUX 5HS7A 2VT3A 5CYVA 4FHTA 2EA4A 1BI2A 1IXCA 2MLKA 3PQJA 4GYIA 4P55A 1FYMA 2ACJA 1HKQA 1KYZA 3EUHA 2NRAC 3L9FA 2CSOA 2XKPA 1S8NA 5FO5A 4ZYEA 3SZTA 3JSPA 4Q47A 4ZYGA 2QVOA 1CGPA 3SXYA 2DK8A 2EFOA 3GUDA 3WTVC 2KIMA 3WTYC 3RYRA 2YR2A 3JAMZ 4KT5C 1ULYA 2V79A 2IVMA 4JK1X 3CJNA 1R22A 1TQIA 2G7UA 2HTSA 3ZMDA 4Q5SF 3I58A 1K79A 3F21A 3J81K 1J0RA 2STTA 4EJOA 2OU2A 1E2XA 1J9IA 2Z33A 1BN5A 3C3WA 1P4WA 3VB2A 4EJUA 1K78A 3ZMTA 2IT0A 3JSOA 2QBYA 1YW9A 1A04A 2KIUA 1SD6A 4DQ2A 2L4AA 4RGRA 2PLYA 3L7WA 4EVIA 2FXAA 4ASNA 4ESJA 1FSHA 2MC3A 1IN6A 2DLLA 3KEOA 3N4MA 2VC1A 2W84A 4KIBA 4XLNF 1J5YA 1Z6RA 1YFHA 4MQVA 1SMTA 1XSDA 5DUIA 4CDGA 4HLYA 1JE8A 1TNTA 2R7DA 4IRHA 1UB9A 3E97A 2OQRA 1WKMA 1HKTA 4LLNA 5HDKA 3CLOA 1D8KA 5BOXA 1G3TA 4L9NA 2KIFA 5K1YA 4M9XA 2P5KA 4L5JA 4RB1A 3CUQC 2O8XA 5DD4A 3FHZA 2XAQA 3IWFA 3CUQB 3KP7A 4EM1A 4HW0A 5HLHA 4RB2C 3REOA 2CFXA 4L0ZB 2K86A 2EK5A 3DP7A 5BMZA 3C7JA 1U78A 3N97A 4M6YA 4L18B 4UV9A 1I27A 2P8TA 4EGZA 4RAYA 4LLLA 3KP2A 2GIVA 1KQ9A 2FA5A 2DAOA 3WE2A 1W5SA 4KUMA 1XB4A 1YLFA 3ZMUA 3TDUC 4HYEA 5ICGA 3LSTA 1ZREA 3HRMA 3KETA 5JVTA 4G7OF 3C1DA 3F8MA 2AS5F 5LRRA 5J6XA 4BHPA 4ZZDA 3GFJA 1MZBA 1J75A 3ABTA 5FGMA 4UVBA 1ZHFA 4BYYA 4U7DA 4CHUA 1GXQA 3D5LA 1Y0UA 3MZYA 4Q4ZF 3IHUA 2RV8A 2HWVA 2QM3A 2VBWA 2VBZA 3WTXC 3MWMA 5K5OA 1Z9CA 2BBYA 3T0YA 4ENKA 5J8FA 3WGIA 4HDUA 2L54A 5FD6A 5TJJA 1G6NA 2K7LA 3MCZA 2F5FA 4R8HA 3I5UA 2EV6A 2PEXA 2BE5F 4OIOF 4B09A 3DV8A 1OKRA 3U9GA 4AIHA 1ON1A 3HOTA 4F7ZA 1FBSA 1HQCA 1NHAA 3O2PE 1U8RA 3W6KB 1PDNC 3FXRA 2HGCA 1WRJA 5DDGA 4OMZA 1T6SA 2H09A 3QPHA 1BC7C 3KZYA 1FYKA 1T98A 3G3ZA 2COMA 2XVCA 3QAHA 4HOBA 3TO6A 3TQNA 3NEUA 4Y17A 3SZPA 3IWZA 5D5UB 3K9TA 1O3RA 2K27A 1RI7A 1I6XA 1OMIA 3P9KA 4RB0A 1YG2A 2DO7A 3R6SA 1SD7A 2VBYA 4CICA 4ENMA 3I59B 4LD5A 5E20A 2RQPA 1LDJA 1BBYA 1W7PD 2HYFA 4XSZF 3HHHA 2OD5A 1WI9A 5DYMA 3EETA 1XGNA 3L09A 5D4RA 1TNSA 2YU3A 4ETSA 1T0FA 3LWFA 3IL2A 3P9CA 5CVVA 4BXUA 2DQLA 3RKXA 4KNYA 1UHMA 4HBLA 1R5GA 4CYDA 1YW7A 2PBIA 3I71A 4LFUA 3VOEA 1BI1A 2D1HA 1QZYA 1FWZA 4MEXF 2ZCWA 3ML6A 2LF7A 3RIRA 2HQRA 1LDKB 3V8LA 2VE9A 1O57A 3F72A 2VOPA 4H0EA 2M45A 3ISPA 1P6RA 5D4SA 4WF2A 1J2XA 1MDMA 3GXOA 3HRUA 3TDZC 2RC4A 1KU2A 3AAFA 4EJWA 2VONA 2BGCA 1FPQA 2HS5A 5L3GA 3WGHA 5LHGA 2E7WA 4G7HF 1ZARA 1IRGA 2ESNA 3SQNA 1RZ4A 3FM3A 1SFXA 3CUQA 2Q8KA 3JTHA 3RDIA 1IAWA 4U0YA 3D0SA 4XLPF 1FP2A 1WQ2A 1PUEE 5E8GA 1RIOH 4HQMA 2HYGD 3TO9A 5D6EA 2CG4A 4WXCA 1L3LA 2Z3YA 2EFPA 3HRTA 1ODDA 3ROUA 3E6CC 4DNCA 4ZZLA 3ZP5A 2Q2EA 1Z6TA 3QU3A 2QENA 3B73A 4Y13A 2JRTA 1XGOA 5ED4A 3WE3A 3MZHA 4LMYA 3L2CA 4IRIA 1W7PA 1XGMA 2P6TA 3WU0A 4L9JA 3DQVC 1H9GA 3HHGA 4CO8A 1S7AA 2GQQA 2W57A 1EH6A 3QP6A 1KU3A 2IA2A 2A07F 2XUBA 2IP2A 5BQTA 1Z91A 1FSEA 4MHGA 5K5RA 2P5LC 1KU7A 2JPCA 2WC2A 3VFZA 4U88A 4BAYA 6PAXA 3T8RA 2WWYA 3FXQA 4HX4A 4AWXB 1FT9A 1TQPA 1I5ZA 3COAC 2ZFWA 3HRSA 4PZJA 2X0LA 1KQ0A 1UCRA 2VBXA 4WX9A 4UV8A 4LG0B 3ZQ7A 1E17A 2WTEA 2XKOA 1YQAA 1BOAA 5E1ZB 3GLXA 4M74A 4MGRA 2KRFA 3LA2A 4GYGA 2DI3A 3H92A 4ZYHA 2STWA 5D5VB 1W5TA 5BS6A 2MA3A 4BNCA 4Q48A 4XBFA 2HR3A 2AXLA 5AONA 5ICFA 5L3FA 1EV7A 3R0AA 3GEZA 1FYLA 2ZO4A 4IF4A 2ZNZA 2FSWA 5F6FA 1H9TA 2H94A 1XCVA 3ERED 1CF7B 4LK0F 4IXAA 1O7FA 5IT9Z 4QWQA 2NS0A 3BDDA 4YFNF 1ZYRF 2FOKA 2J5OA 1G3WA 5D8LB 1U2WA 3I59A 3K1PA 5J8CA 1ZGJA 3CDHA 1IXRC 5CLSA 2YX4A 4RS8A 3H3UA 4OIQF 3B02A 2PFBA 3K1MA 1LDDA 3LQRA 2HQNA 1B59A 2A6HF 4EM0B 1MJAA 4PDKA 4OIPF 4RGSA 1BM9A 2ZMEB 2A68F 2PN6A 1HW5A 2EB7A 4P96A 1P4AA 2V6CA 4KN7X 4R79A 2LSOA 4AIJA 2HZTA 4MEYF 2V1UA 1USTA 1YS6A 3FWEA 3WGGA 5HDNA 3E3VA 3M8EA 2DPUA 2HOEA 4YIFA 1UHWA 4G9YA 2LKPA 2BEOA 1MJ9A 2OQGA 1B9MA 3LAJA 3FM5A 3V8JA 1BI3A 2ETHA 2XAHA 2OZ6A 1V3FA 3MQ0A 2FBIA 3HYIA 2XHKA 3KP3A 3LA3A 1KU9A 3V4GA 1IF1A 3DEUA 3BJOA 4KN4X 4UVAA 2LDUA 3E6DA 3RI4A 4HF0A 1LNWA 4QLCU 2NYXA 4P9UA 2YSRA 3DKWA 1BJAA 5FD5A 1MGTA 4CXFA 2EFWA 1ZRDA 4K2EA 5CVUA 2MH9A 3F8NA 3GO5A 4WXDA 2RNJA 3FMSA 1OYYA 1JGSA 1TW3A 2A61A 4I01A 2DK5A 3V7CA 1DUXC 2H6BA 2RGVA 1T39A 1ZAOA 3CO7C 2VC0A 5JFRA 1R1TA 2MD5A 1I1GA 4OMYA 3OOPA 1ZG1A 2EA2A 1YYVA 1ZLKA 4FX0A 4A0YA 4ESBA 3BZ6A 2MLGA 3FX3A 3PFIA 2QQ9A 4G94A 1LVAA 4MQ9F 3Q9SA 2GXGA 2FMLA 2W25A 1QZZA 5FLXZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI0 A;  4RAZ A;  1U5T C;  2FBH A;  4UNO A;  3F8C A;  1U3E M;  5LLQ A;  3MFK A;  5FFX A;  1O3T A;  2HDC A;  1U5T B;  5TRD A;  2G9W A;  4MNU A;  1PP8 F;  3EYI A;  4GO1 A;  4O6J A;  2TDX A;  2XGX A;  1T38 A;  1TW2 A;  3GVA A;  3HUG A;  5DD8 A;  4AVP A;  4KIC A;  3BJA A;  2BV6 A;  1XCB A;  3E5Q A;  3V7S A;  4M9Z A;  1BI0 A;  1FLI A;  3DF8 A;  4LG0 A;  3I54 A;  4BHC A;  1REP C;  5DCF A;  3WG9 A;  3HTU A;  3ULQ B;  1V4R A;  5D8K B;  4GXO A;  4ON0 A;  3VOD A;  3KFW X;  1QBJ A;  5DV5 A;  2VXZ A;  4CZZ A;  1DP7 P;  2XRO A;  1IN8 A;  4A5M A;  3JAM K;  1C0W A;  1TLH B;  4BH9 A;  1XDU A;  5LHI A;  1R1V A;  3J80 Z;  3HIF A;  5LEJ A;  2P7C B;  2GXB A;  3K1N A;  2P4W A;  2EV0 A;  3KZZ A;  4RGU A;  3E6M A;  1ZN2 A;  2O03 A;  5DEQ A;  4ESF A;  4L5I A;  3GX4 X;  4U0W A;  5CVI A;  2KJB A;  3W6J B;  5IT3 A;  1Z05 A;  4LB5 A;  3U2R A;  5AIQ A;  1TTY A;  1K78 B;  2DU9 A;  3EQL F;  1HBX G;  2QBY B;  4LK1 F;  3GZ5 A;  5ILU A;  5HVQ C;  3V7R A;  1R58 A;  4IJA A;  1DDN A;  4I09 A;  5D5X B;  2F2E A;  3WTZ A;  3LQQ A;  1TBX A;  5H6R A;  1YO5 C;  4LGW A;  4WWC A;  2L4M A;  1IW7 F;  3WTW C;  4A2U A;  4KMF A;  2PQ8 A;  3R0J A;  1SMY F;  2DTR A;  2LF8 A;  3ZMS A;  3ECO A;  2MBF A;  3Q5F A;  3E5X A;  1R7J A;  3IC7 A;  5HS9 A;  2GA1 A;  5HLG A;  3F23 A;  2DW4 A;  3DPT A;  2PMU A;  1S7O A;  1F4K A;  4ENN A;  3HTS B;  1SAX A;  2P7V B;  5FFZ A;  3CUO A;  1G4D A;  4Z2Y A;  1KGS A;  2E7X A;  2E1C A;  3FMQ A;  4IHS A;  1Q1H A;  2FE3 A;  3BPV A;  3K0L A;  1IZ1 A;  3BP8 A;  4HAM A;  3KE2 A;  5DCM B;  2M8E A;  2P5V A;  4LB6 B;  2M30 A;  5LGN A;  3Q9V A;  4GCV A;  3KCC A;  3ABU A;  4I7H A;  1QO0 D;  1R1U A;  4L9V A;  3FZV A;  4EJT A;  3LA7 A;  2YPR A;  4OOI A;  2HKO A;  1KQ8 A;  1ZRC A;  3ELK A;  4HA8 A;  1O3Q A;  4HQE A;  4M71 A;  2QWW A;  4KA4 A;  2CO5 A;  5LHH A;  4KYW A;  2Y0M A;  5JR3 A;  1JXS A;  4Y15 A;  1RUO A;  1BC8 C;  4S05 A;  1STZ A;  3O3K A;  2JT1 A;  1FNN A;  2V9V A;  4M9S A;  1RUN A;  5E18 F;  3TKY A;  2GZW A;  5ICE A;  2DPD A;  5ILV A;  2Z5U A;  2WV0 A;  2RN7 A;  3E6B A;  3WTS C;  1LQ1 A;  4NQW A;  2ELH A;  2X4H A;  3RKW A;  2IRF G;  2JPB A;  1J59 A;  2ESH A;  4EM2 A;  3KEQ A;  4YFX F;  2VOD A;  3JW4 A;  1U5T A;  4P9F A;  3I53 A;  5A2Q Z;  2D2W A;  3F8B A;  1G3Y A;  5L3C A;  3HSE A;  1OYW A;  5KVR A;  2VE8 A;  2M1B A;  2XIG A;  1ZG5 A;  4CGZ A;  4ENJ A;  3T1B A;  2FNA A;  1HSJ A;  4KDP A;  2OAZ A;  2Y48 A;  3DPL C;  3O6B B;  3L00 A;  4P5O A;  1P92 A;  1T2K A;  1W4M A;  3K69 A;  4M73 A;  1LB2 A;  3BOQ A;  4NB5 A;  3HSR A;  4HV5 A;  2ISY A;  5LGU A;  2QQA A;  3J80 K;  1G3S A;  3ZPL A;  1YW8 A;  2HTJ A;  1QQI A;  2D45 A;  4A12 A;  1QNT A;  4LLG F;  5JI6 A;  2CWE A;  1KYW A;  1ON2 A;  4A6D A;  2IPQ X;  2FMY A;  4S04 A;  4A0X A;  3LAP A;  2V1D A;  4I0A A;  3KLN A;  5ICC A;  1YTY A;  3ECH A;  2XRN A;  3C18 A;  2JZY A;  5CVJ A;  2F5C A;  3BWG A;  2UXN A;  4L9T A;  2RKH A;  3QOP A;  3PQK A;  4TV7 A;  2O3F A;  1DPU A;  2H6C A;  5BPD A;  1IN5 A;  5FB2 A;  4U0V A;  1IXS B;  4N0B A;  3QU6 A;  1XDS A;  3RPQ A;  1JHH A;  1P4X A;  2M87 A;  4HX8 A;  4EJV A;  1ONV A;  1B6A A;  2GA2 A;  3DXJ F;  3G73 A;  2OBP A;  4A5N A;  2VN2 A;  4HF2 A;  4G7Z F;  4YFK F;  2OA4 A;  4G6D A;  2IA1 A;  1WSU A;  1XGS A;  1IUY A;  2K4J A;  5F1R A;  4JQF A;  2QYO A;  3F6V A;  5HDG A;  2H27 A;  3RPU A;  1R00 A;  5D6F A;  4HF1 A;  2Q0O A;  4PCQ A;  5BPI A;  2BYV E;  4ZYD A;  3LFK A;  3KLO A;  4UHT A;  4R1H A;  5E17 F;  2FEZ A;  3I64 A;  1QGP A;  2Z99 A;  5JHU A;  3IRR A;  3KP6 A;  4JBA A;  3F3X A;  1MDM B;  3U1D A;  2ADU A;  2XAF A;  5E1W A;  5LBQ A;  3I0T A;  2W85 A;  2ZBK A;  4WXH A;  1S6L A;  4PGG A;  4O3M A;  2K02 A;  2CYY A;  1ZH5 A;  2JTV A;  5H6Q A;  1LEB A;  1SD5 A;  2A6E F;  1L0O C;  4YII A;  4OU0 A;  1LJ9 A;  3FXU A;  1DPR A;  4A6E A;  2V1X A;  4OIN F;  2QUF A;  2B0L A;  2FBK A;  5DCM A;  3RTR A;  1FX7 A;  1U6G A;  2PMH A;  3H3Z A;  5E8I A;  4PGH A;  1MKM A;  3T8T A;  3R61 A;  3P9I A;  1B1B A;  3GZ6 A;  4AIK A;  2OZU A;  3NRV A;  3MEX A;  5EEG A;  3FMR A;  2G7H A;  3V8K A;  1BIB A;  2O6G E;  1IRF A;  2NNN A;  3GW2 A;  4L0Y B;  1ZG3 A;  2HKX A;  2QZ8 A;  3QPT A;  1OYI A;  1ZLJ A;  1H0M A;  3FF5 A;  4KIG A;  2UZK A;  2KKO A;  1W7P B;  2C6Y A;  3S2W A;  4EQQ A;  4I98 B;  3GWZ A;  3ZN1 A;  4BQA A;  1FY7 A;  1RNL A;  3HSF A;  2A3S A;  2FF4 A;  4N9I A;  1PP7 U;  4EMS A;  1HKS A;  3NQO A;  3F8F A;  4GGG A;  2HEO A;  3M9A A;  2MH2 A;  3F22 A;  3VEP A;  1WWX A;  1FBU A;  5A2Q K;  2NNY A;  1GHC A;  3OV8 A;  1XN7 A;  4WCG A;  4AD9 A;  4M6X A;  5ILS A;  2IA0 A;  4HLX A;  1FZP B;  1JHF A;  5LGT A;  2ZNY A;  1GVJ A;  1YIO A;  2LNB A;  3WTT C;  4B8X A;  3DFG A;  1D5V A;  3F6O A;  4LJZ F;  1Z1D A;  2K4B A;  2EWN A;  2IJL A;  5CVR A;  2XV4 S;  5KK1 A;  1HW1 A;  2ZXJ A;  1K7A A;  2F5D A;  5K5Q A;  1XMA A;  4HDV A;  5L3B A;  2KJC A;  3P7N A;  5E1X A;  4IPA A;  3T5X A;  1O7L A;  3JTG A;  2FU4 A;  2CGP A;  5H20 A;  2XAJ A;  2DFI A;  5L3E A;  2IW5 A;  3R60 A;  5CJ9 A;  1XSX A;  2O0Y A;  3KP5 A;  4HX7 A;  4EGY A;  1HXD A;  4I2O A;  1IN7 A;  3MAJ A;  2RDP A;  3BPX A;  2VOO A;  4IRG A;  1F1Z A;  5IT9 K;  5EEH A;  4YG2 F;  1OR7 A;  1J7K A;  5LRS A;  2ZJ2 A;  2R3S A;  3CTA A;  1D8J A;  2CQK A;  1CF7 A;  3HOS A;  1X3U A;  3ZN0 A;  1BIA A;  4FX4 A;  2QLZ A;  2GAU A;  2JSC A;  4UVC A;  4O5V A;  3GFI A;  3GFL A;  1YS7 A;  4HZF A;  1P2F A;  3TOB A;  3RKY A;  3BY6 A;  1ZGA A;  3CO6 C;  2O61 A;  3J81 Z;  3IRQ A;  1Z7U A;  1O3S A;  2F5E A;  1K6O A;  4MTD A;  5HLI A;  3GF2 A;  1F5T A;  2HFH A;  2YX7 A;  2ZME A;  4ZH4 F;  1R36 A;  5F64 A;  4WK8 F;  3M7G A;  3WOD F;  2XAS A;  5LEK A;  4KFC A;  1XSV A;  2RVC A;  4EV0 A;  2EV5 A;  4G8X A;  2P6S A;  1SFU A;  2EFQ A;  2FRH A;  1SD4 A;  4KIF A;  5D5W B;  1R5H A;  1S29 A;  1I1S A;  2A69 F;  1AOY A;  3J7A O;  4G6Q A;  1OPC A;  2L3D A;  2XAG A;  1ZRF A;  3M1E A;  4BHB A;  4I0B A;  1S3J A;  2ISZ A;  1UFM A;  2CW0 F;  2DQR A;  3ZMZ A;  5HOO A;  5L3D A;  5ERI A;  3WTU C;  2R7F A;  1FC3 A;  3M8F A;  3WU1 B;  4XSX F;  4U7B A;  4HV6 A;  4IHT A;  1GXP A;  5HS8 A;  1FP1 D;  3EDP A;  3TO7 A;  4FT8 A;  2E1N A;  4UUV A;  2L02 A;  4MTE A;  3IKV A;  3IKT A;  4N9H A;  1AWC A;  3QRF F;  2W24 A;  1FOK A;  1EH8 A;  1XMK A;  2J5P A;  3GFM A;  3RYP A;  3KP4 A;  1VTN C;  2VT2 A;  3R4K A;  3E5U A;  3BRO A;  3SFZ A;  4OIR F;  1QPM A;  1R23 A;  3K2Z A;  1MJB A;  4NHJ A;  2ZKZ A;  1MD0 A;  4UXN A;  1TQM A;  5AIP A;  2PJP A;  2EJR A;  1HW2 A;  3EYY A;  2PG4 A;  3TGN A;  2FNP A;  3SHF A;  3BJ6 A;  2DT5 A;  5FLX K;  3GYH X;  2UWM A;  3I4P A;  3QP5 A;  2L01 A;  2UXX A;  4XRF A;  4IVN A;  1D3Y A;  1LEA A;  1EH7 A;  1F9N A;  2FQ3 A;  1SFE A;  4E70 A;  2A5Y B;  1USS A;  4I02 A;  2Y75 A;  2QQB A;  2Z9O A;  1FBQ A;  4M72 A;  1HST A;  3ZMV A;  2DBB A;  1B4A A;  1IN4 A;  4A0Z A;  3TOA A;  3RJP A;  5DUK A;  4RGX A;  4D0P A;  4RB3 C;  2EFN A;  1KA8 A;  2M5W A;  2D1V A;  1XD7 A;  1B9N A;  2GWR A;  2NAZ A;  4KMU X;  5HS7 A;  2VT3 A;  5CYV A;  4FHT A;  2EA4 A;  1BI2 A;  1IXC A;  2MLK A;  3PQJ A;  4GYI A;  4P55 A;  1FYM A;  2ACJ A;  1HKQ A;  1KYZ A;  3EUH A;  2NRA C;  3L9F A;  2CSO A;  2XKP A;  1S8N A;  5FO5 A;  4ZYE A;  3SZT A;  3JSP A;  4Q47 A;  4ZYG A;  2QVO A;  1CGP A;  3SXY A;  2DK8 A;  2EFO A;  3GUD A;  3WTV C;  2KIM A;  3WTY C;  3RYR A;  2YR2 A;  3JAM Z;  4KT5 C;  1ULY A;  2V79 A;  2IVM A;  4JK1 X;  3CJN A;  1R22 A;  1TQI A;  2G7U A;  2HTS A;  3ZMD A;  4Q5S F;  3I58 A;  1K79 A;  3F21 A;  3J81 K;  1J0R A;  2STT A;  4EJO A;  2OU2 A;  1E2X A;  1J9I A;  2Z33 A;  1BN5 A;  3C3W A;  1P4W A;  3VB2 A;  4EJU A;  1K78 A;  3ZMT A;  2IT0 A;  3JSO A;  2QBY A;  1YW9 A;  1A04 A;  2KIU A;  1SD6 A;  4DQ2 A;  2L4A A;  4RGR A;  2PLY A;  3L7W A;  4EVI A;  2FXA A;  4ASN A;  4ESJ A;  1FSH A;  2MC3 A;  1IN6 A;  2DLL A;  3KEO A;  3N4M A;  2VC1 A;  2W84 A;  4KIB A;  4XLN F;  1J5Y A;  1Z6R A;  1YFH A;  4MQV A;  1SMT A;  1XSD A;  5DUI A;  4CDG A;  4HLY A;  1JE8 A;  1TNT A;  2R7D A;  4IRH A;  1UB9 A;  3E97 A;  2OQR A;  1WKM A;  1HKT A;  4LLN A;  5HDK A;  3CLO A;  1D8K A;  5BOX A;  1G3T A;  4L9N A;  2KIF A;  5K1Y A;  4M9X A;  2P5K A;  4L5J A;  4RB1 A;  3CUQ C;  2O8X A;  5DD4 A;  3FHZ A;  2XAQ A;  3IWF A;  3CUQ B;  3KP7 A;  4EM1 A;  4HW0 A;  5HLH A;  4RB2 C;  3REO A;  2CFX A;  4L0Z B;  2K86 A;  2EK5 A;  3DP7 A;  5BMZ A;  3C7J A;  1U78 A;  3N97 A;  4M6Y A;  4L18 B;  4UV9 A;  1I27 A;  2P8T A;  4EGZ A;  4RAY A;  4LLL A;  3KP2 A;  2GIV A;  1KQ9 A;  2FA5 A;  2DAO A;  3WE2 A;  1W5S A;  4KUM A;  1XB4 A;  1YLF A;  3ZMU A;  3TDU C;  4HYE A;  5ICG A;  3LST A;  1ZRE A;  3HRM A;  3KET A;  5JVT A;  4G7O F;  3C1D A;  3F8M A;  2AS5 F;  5LRR A;  5J6X A;  4BHP A;  4ZZD A;  3GFJ A;  1MZB A;  1J75 A;  3ABT A;  5FGM A;  4UVB A;  1ZHF A;  4BYY A;  4U7D A;  4CHU A;  1GXQ A;  3D5L A;  1Y0U A;  3MZY A;  4Q4Z F;  3IHU A;  2RV8 A;  2HWV A;  2QM3 A;  2VBW A;  2VBZ A;  3WTX C;  3MWM A;  5K5O A;  1Z9C A;  2BBY A;  3T0Y A;  4ENK A;  5J8F A;  3WGI A;  4HDU A;  2L54 A;  5FD6 A;  5TJJ A;  1G6N A;  2K7L A;  3MCZ A;  2F5F A;  4R8H A;  3I5U A;  2EV6 A;  2PEX A;  2BE5 F;  4OIO F;  4B09 A;  3DV8 A;  1OKR A;  3U9G A;  4AIH A;  1ON1 A;  3HOT A;  4F7Z A;  1FBS A;  1HQC A;  1NHA A;  3O2P E;  1U8R A;  3W6K B;  1PDN C;  3FXR A;  2HGC A;  1WRJ A;  5DDG A;  4OMZ A;  1T6S A;  2H09 A;  3QPH A;  1BC7 C;  3KZY A;  1FYK A;  1T98 A;  3G3Z A;  2COM A;  2XVC A;  3QAH A;  4HOB A;  3TO6 A;  3TQN A;  3NEU A;  4Y17 A;  3SZP A;  3IWZ A;  5D5U B;  3K9T A;  1O3R A;  2K27 A;  1RI7 A;  1I6X A;  1OMI A;  3P9K A;  4RB0 A;  1YG2 A;  2DO7 A;  3R6S A;  1SD7 A;  2VBY A;  4CIC A;  4ENM A;  3I59 B;  4LD5 A;  5E20 A;  2RQP A;  1LDJ A;  1BBY A;  1W7P D;  2HYF A;  4XSZ F;  3HHH A;  2OD5 A;  1WI9 A;  5DYM A;  3EET A;  1XGN A;  3L09 A;  5D4R A;  1TNS A;  2YU3 A;  4ETS A;  1T0F A;  3LWF A;  3IL2 A;  3P9C A;  5CVV A;  4BXU A;  2DQL A;  3RKX A;  4KNY A;  1UHM A;  4HBL A;  1R5G A;  4CYD A;  1YW7 A;  2PBI A;  3I71 A;  4LFU A;  3VOE A;  1BI1 A;  2D1H A;  1QZY A;  1FWZ A;  4MEX F;  2ZCW A;  3ML6 A;  2LF7 A;  3RIR A;  2HQR A;  1LDK B;  3V8L A;  2VE9 A;  1O57 A;  3F72 A;  2VOP A;  4H0E A;  2M45 A;  3ISP A;  1P6R A;  5D4S A;  4WF2 A;  1J2X A;  1MDM A;  3GXO A;  3HRU A;  3TDZ C;  2RC4 A;  1KU2 A;  3AAF A;  4EJW A;  2VON A;  2BGC A;  1FPQ A;  2HS5 A;  5L3G A;  3WGH A;  5LHG A;  2E7W A;  4G7H F;  1ZAR A;  1IRG A;  2ESN A;  3SQN A;  1RZ4 A;  3FM3 A;  1SFX A;  3CUQ A;  2Q8K A;  3JTH A;  3RDI A;  1IAW A;  4U0Y A;  3D0S A;  4XLP F;  1FP2 A;  1WQ2 A;  1PUE E;  5E8G A;  1RIO H;  4HQM A;  2HYG D;  3TO9 A;  5D6E A;  2CG4 A;  4WXC A;  1L3L A;  2Z3Y A;  2EFP A;  3HRT A;  1ODD A;  3ROU A;  3E6C C;  4DNC A;  4ZZL A;  3ZP5 A;  2Q2E A;  1Z6T A;  3QU3 A;  2QEN A;  3B73 A;  4Y13 A;  2JRT A;  1XGO A;  5ED4 A;  3WE3 A;  3MZH A;  4LMY A;  3L2C A;  4IRI A;  1W7P A;  1XGM A;  2P6T A;  3WU0 A;  4L9J A;  3DQV C;  1H9G A;  3HHG A;  4CO8 A;  1S7A A;  2GQQ A;  2W57 A;  1EH6 A;  3QP6 A;  1KU3 A;  2IA2 A;  2A07 F;  2XUB A;  2IP2 A;  5BQT A;  1Z91 A;  1FSE A;  4MHG A;  5K5R A;  2P5L C;  1KU7 A;  2JPC A;  2WC2 A;  3VFZ A;  4U88 A;  4BAY A;  6PAX A;  3T8R A;  2WWY A;  3FXQ A;  4HX4 A;  4AWX B;  1FT9 A;  1TQP A;  1I5Z A;  3COA C;  2ZFW A;  3HRS A;  4PZJ A;  2X0L A;  1KQ0 A;  1UCR A;  2VBX A;  4WX9 A;  4UV8 A;  4LG0 B;  3ZQ7 A;  1E17 A;  2WTE A;  2XKO A;  1YQA A;  1BOA A;  5E1Z B;  3GLX A;  4M74 A;  4MGR A;  2KRF A;  3LA2 A;  4GYG A;  2DI3 A;  3H92 A;  4ZYH A;  2STW A;  5D5V B;  1W5T A;  5BS6 A;  2MA3 A;  4BNC A;  4Q48 A;  4XBF A;  2HR3 A;  2AXL A;  5AON A;  5ICF A;  5L3F A;  1EV7 A;  3R0A A;  3GEZ A;  1FYL A;  2ZO4 A;  4IF4 A;  2ZNZ A;  2FSW A;  5F6F A;  1H9T A;  2H94 A;  1XCV A;  3ERE D;  1CF7 B;  4LK0 F;  4IXA A;  1O7F A;  5IT9 Z;  4QWQ A;  2NS0 A;  3BDD A;  4YFN F;  1ZYR F;  2FOK A;  2J5O A;  1G3W A;  5D8L B;  1U2W A;  3I59 A;  3K1P A;  5J8C A;  1ZGJ A;  3CDH A;  1IXR C;  5CLS A;  2YX4 A;  4RS8 A;  3H3U A;  4OIQ F;  3B02 A;  2PFB A;  3K1M A;  1LDD A;  3LQR A;  2HQN A;  1B59 A;  2A6H F;  4EM0 B;  1MJA A;  4PDK A;  4OIP F;  4RGS A;  1BM9 A;  2ZME B;  2A68 F;  2PN6 A;  1HW5 A;  2EB7 A;  4P96 A;  1P4A A;  2V6C A;  4KN7 X;  4R79 A;  2LSO A;  4AIJ A;  2HZT A;  4MEY F;  2V1U A;  1UST A;  1YS6 A;  3FWE A;  3WGG A;  5HDN A;  3E3V A;  3M8E A;  2DPU A;  2HOE A;  4YIF A;  1UHW A;  4G9Y A;  2LKP A;  2BEO A;  1MJ9 A;  2OQG A;  1B9M A;  3LAJ A;  3FM5 A;  3V8J A;  1BI3 A;  2ETH A;  2XAH A;  2OZ6 A;  1V3F A;  3MQ0 A;  2FBI A;  3HYI A;  2XHK A;  3KP3 A;  3LA3 A;  1KU9 A;  3V4G A;  1IF1 A;  3DEU A;  3BJO A;  4KN4 X;  4UVA A;  2LDU A;  3E6D A;  3RI4 A;  4HF0 A;  1LNW A;  4QLC U;  2NYX A;  4P9U A;  2YSR A;  3DKW A;  1BJA A;  5FD5 A;  1MGT A;  4CXF A;  2EFW A;  1ZRD A;  4K2E A;  5CVU A;  2MH9 A;  3F8N A;  3GO5 A;  4WXD A;  2RNJ A;  3FMS A;  1OYY A;  1JGS A;  1TW3 A;  2A61 A;  4I01 A;  2DK5 A;  3V7C A;  1DUX C;  2H6B A;  2RGV A;  1T39 A;  1ZAO A;  3CO7 C;  2VC0 A;  5JFR A;  1R1T A;  2MD5 A;  1I1G A;  4OMY A;  3OOP A;  1ZG1 A;  2EA2 A;  1YYV A;  1ZLK A;  4FX0 A;  4A0Y A;  4ESB A;  3BZ6 A;  2MLG A;  3FX3 A;  3PFI A;  2QQ9 A;  4G94 A;  1LVA A;  4MQ9 F;  3Q9S A;  2GXG A;  2FML A;  2W25 A;  1QZZ A;  5FLX Z; 
#chains in the Genus database with same CATH topology
 3U21 A;  2PI0 A;  5C4X J;  1HA8 A;  4RAZ A;  4N4N B;  1U5T C;  3HOX J;  2FBH A;  4UNO A;  1WJ5 A;  2K40 A;  3F8C A;  1U3E M;  5LLQ A;  1MMG A;  4C2M J;  3MFK A;  5FFX A;  1O3T A;  2JJ7 A;  2HDC A;  3LSP A;  1U5T B;  5TRD A;  4MLO A;  2G9W A;  2R5Y A;  1Z7L A;  4MNU A;  3AFH A;  1PP8 F;  2KDO A;  3EYI A;  1CQT A;  4GO1 A;  4CCO A;  4O6J A;  3ZQL A;  2TDX A;  1N78 A;  2XGX A;  3H36 A;  1T38 A;  3RZO J;  1VI0 A;  1TW2 A;  5C4J J;  2DA4 A;  3GTM J;  2ECC A;  2V9K A;  3GVA A;  3HUG A;  5DD8 A;  1RET A;  1DU0 A;  4AVP A;  3S2H J;  2UUZ A;  4KIC A;  5DM7 F;  4RDU A;  2CRG A;  3QPS A;  3BJA A;  2BV6 A;  1XCB A;  2WY7 Q;  3E5Q A;  3V7S A;  4M9Z A;  2DA5 A;  3A2K A;  5B1B H;  1BI0 A;  2L9R A;  4RLQ A;  3BZC A;  3HJE A;  1FLI A;  3DF8 A;  1JJ6 C;  1R71 A;  4LG0 A;  3I54 A;  2L7M P;  4BHC A;  2OCE A;  1REP C;  2X1C A;  2XGC A;  5DCF A;  3WG9 A;  3GTQ J;  4RM3 A;  3SEQ A;  3HTU A;  1O4X A;  2W7N A;  3D5S C;  3ULQ B;  1JUP A;  3OYF A;  4IQJ A;  5GAE J;  1OCO H;  2R0Q C;  1V4R A;  5D8K B;  1X1D A;  2LP0 A;  2PMZ A;  3FXO A;  4GXO A;  4ON0 A;  3ZCO A;  4J00 A;  3VOD A;  4E7S A;  3KFW X;  5IP6 A;  5JVG F;  3DEW A;  1QBJ A;  2FJ1 A;  5DV5 A;  5LFA A;  2VXZ A;  1HOM A;  2D5V A;  2YU9 J;  4CZZ A;  1DP7 P;  5B3S H;  2XRO A;  1IN8 A;  4A5M A;  3JAM K;  4AID A;  3QPL A;  3OYC A;  1C0W A;  1TLH B;  4BH9 A;  1K4T A;  2R92 J;  1XDU A;  3LSH A;  3HOZ J;  2DOE A;  1R1V A;  5LHI A;  2LY2 A;  3MKL A;  3J80 Z;  3HIF A;  2IS2 A;  1LKX A;  5LEJ A;  2P7C B;  2GXB A;  2V26 A;  3K1N A;  1MMD A;  2P4W A;  3LL7 A;  2EV0 A;  3KZZ A;  4CYC A;  4RGU A;  1J09 A;  2OJE D;  2OTJ I;  3E6M A;  1BW6 A;  1G8X A;  1ZN2 A;  2CJJ A;  2O03 A;  1KON A;  3HXL A;  2OTL I;  5DEQ A;  3CJQ B;  1RR7 A;  2Y30 A;  4ESF A;  4L5I A;  3HOU J;  3WU2 C;  3GX4 X;  4U0W A;  2W00 A;  5CVI A;  1WJE A;  2KJB A;  2Y0S A;  3W6J B;  1OCC H;  2GOM A;  5IT3 A;  1MMN A;  1Z05 A;  2EZH A;  4LB5 A;  3M1C A;  1AKH B;  1ERD A;  1OCZ H;  4XKV A;  3U2R A;  4B48 A;  5AIQ A;  1TTY A;  2K3F A;  1K78 B;  2DU9 A;  3A02 A;  4PSX A;  1W0T A;  3EQL F;  1HBX G;  2Y31 A;  1D0Z A;  1SAN A;  4LK1 F;  1MMA A;  1TWF J;  1Z21 A;  3LSG A;  3G71 I;  2QBY B;  1MNE A;  3GZ5 A;  4HG2 A;  5ILU A;  2LKS A;  4GFB A;  3HOY J;  3NAU A;  5HVQ C;  3V7R A;  4A3E J;  4UY8 I;  3J7A Y;  1R58 A;  3ZQF A;  4IJA A;  3FIS A;  1DDN A;  4I09 A;  1N25 A;  3CJR B;  4A3K J;  5D5X B;  2F2E A;  2BY1 A;  4NUB A;  3WTZ A;  2FX0 A;  4G12 A;  3LQQ A;  1B72 A;  1TBX A;  4KT6 A;  2EZI A;  4HEA 2;  5H6R A;  1YO5 C;  4LGW A;  5CKT A;  1IV6 A;  5BNG A;  3PSI A;  3SZG A;  2UV1 A;  3VSL A;  4WWC A;  2L4M A;  1IW7 F;  3DKY A;  3WTW C;  2MGQ A;  2KRH A;  1QVU A;  4A2U A;  4KMF A;  2PQ8 A;  2Y69 H;  2XPV A;  3R0J A;  1SMY F;  2DTR A;  1D0X A;  2LF8 A;  3ZMS A;  3ECO A;  4DOZ A;  2R7R A;  2IGK A;  4BE0 A;  5FKM A;  2MBF A;  3Q5F A;  2X51 A;  3E5X A;  2E35 A;  1R7J A;  4DBQ A;  3IC7 A;  5HS9 A;  1OLT A;  2GA1 A;  2K9M A;  1Y8R B;  4XLC A;  5HLG A;  3F23 A;  2DW4 A;  3DPT A;  4IX7 A;  3AG3 H;  2PMU A;  4AU7 A;  4C2T A;  1YI2 I;  1S7O A;  3HG9 A;  3JCU C;  1F4K A;  4ENN A;  2JUG A;  3DTE A;  3HTS B;  2R7X A;  3O8H A;  1SAX A;  2P7V B;  2P81 A;  2E34 A;  2RAE A;  5FFZ A;  5IOZ A;  3CUO A;  1G4D A;  3HGG A;  3DBH B;  2CMP A;  3QYF A;  4Z2Y A;  1KGS A;  2ZSI B;  1W1W E;  2E7X A;  2VLA A;  2E1C A;  2YS9 A;  4BY7 J;  2ICW G;  3NWT A;  2DTZ A;  2CQ7 A;  1E3P A;  1JUS A;  3FMQ A;  2QA4 I;  4IHS A;  1AA7 A;  1Q1H A;  2FE3 A;  3BPV A;  3FBI B;  1P7I A;  4GRI A;  5CPR B;  3JRA A;  1BA5 A;  3LSJ A;  2E1M C;  3MMY B;  3HZJ A;  3K0L A;  1IZ1 A;  2TRT A;  3BP8 A;  3DLA A;  4HAM A;  3OYL A;  3KE2 A;  5DCM B;  3S15 J;  2K3P A;  2M8E A;  4Y33 A;  2P5V A;  2HXI A;  3ABK H;  4ZTJ A;  1IO2 A;  4LB6 B;  2M30 A;  5LGN A;  3Q9V A;  4GCV A;  2Y0S N;  3KCC A;  2CH0 A;  3ABU A;  4I7H A;  1QO0 D;  3BQZ A;  2HI3 A;  2CS3 A;  3MN2 A;  1JJ8 C;  5F0H A;  1X3Z B;  1R1U A;  5FKN A;  1VQ5 I;  4L9V A;  1K83 J;  3FZV A;  2DCE A;  3LA7 A;  4D1Q A;  4EJT A;  2YPR A;  4OOI A;  2HKO A;  1KQ8 A;  1ZRC A;  4HSR A;  3ELK A;  4QPO A;  3A01 B;  3OYN A;  4HA8 A;  1O3Q A;  2E2H J;  1ETY A;  3WG7 H;  3S8P A;  4HQE A;  4M71 A;  2QWW A;  4KA4 A;  2CO5 A;  2M34 A;  5LHH A;  4KYW A;  3L2R A;  2Y0M A;  3BZK A;  4MFE A;  5JR3 A;  1JXS A;  1Y0N A;  4Y15 A;  2BW3 B;  3OSG A;  3H9Q A;  1RUO A;  1E0E A;  1BC8 C;  1N75 A;  4S05 A;  3OIP A;  1TL8 A;  4A3L J;  2R7U A;  1MBJ A;  1STZ A;  2WAQ N;  3O3K A;  1BOB A;  2DA7 A;  1VQP I;  1MBH A;  1IJW C;  2JT1 A;  1FNN A;  2V9V A;  4M9S A;  1RUN A;  3GTG J;  5E18 F;  3TKY A;  4YIR X;  2IS6 A;  2GZW A;  1Y56 A;  2M0C A;  5ICE A;  2DPD A;  1UZC A;  3SDB A;  5ILV A;  2Z5U A;  1FMV A;  2WV0 A;  2RN7 A;  3F0C A;  3HC7 A;  3E6B A;  3WTS C;  1LQ1 A;  4NQW A;  2ELH A;  2X4H A;  1TT0 A;  2RNG A;  3RKW A;  2IRF G;  1RES A;  2JPB A;  1Z3Y A;  1J59 A;  3CMY A;  2OUM A;  2ESH A;  2LR8 A;  4EM2 A;  2V6E A;  3KEQ A;  2LY9 A;  4YFX F;  3I3L A;  2VOD A;  3JW4 A;  1U5T A;  4P9F A;  3I53 A;  5FLM J;  4BL0 B;  2GLO A;  5A2Q Z;  3Q0W A;  2D2W A;  3F8B A;  3S2D J;  1G3Y A;  5L3C A;  4M3E A;  5EG0 B;  4A3G J;  2F5V A;  3HSE A;  2VAS A;  1OYW A;  5KVR A;  1UHS A;  2VE8 A;  2M1B A;  3CCY A;  2Y9Y A;  1ETO A;  3B6A A;  2F4M B;  2XIG A;  1ZG5 A;  4CGZ A;  2DT6 A;  3CLQ A;  4ENJ A;  3T1B A;  2FNA A;  2KRC A;  1HSJ A;  3BR1 A;  4KDP A;  2DOF A;  2OAZ A;  2Y48 A;  3DPL C;  5K7Z A;  3O6B B;  3L00 A;  4E6K G;  4XKW A;  4P5O A;  1P92 A;  2DJI A;  1T2K A;  2JA2 A;  3S14 J;  4QSH A;  4LG3 A;  4XOT A;  2KIS A;  1Z3X A;  1W4M A;  3W6V A;  3K69 A;  4M73 A;  2HOS A;  3BR6 A;  1XS9 A;  2VKE A;  4RA2 A;  1LB2 A;  3BOQ A;  2KFD A;  4NB5 A;  3BCB A;  3FBN B;  3HSR A;  3I55 I;  3OY9 A;  3BQY A;  4HV5 A;  2ISY A;  2QCO A;  5IYD J;  5LGU A;  1OR7 C;  2QQA A;  3RKQ A;  2NS8 A;  3J80 K;  1G3S A;  1OQY A;  3ZPL A;  3TP3 A;  3BTC A;  3HL2 A;  1YW8 A;  3L2V A;  2EIM H;  1F36 A;  3K4J A;  3K4B A;  2K85 A;  4UUS A;  2HTJ A;  1QQI A;  5IPA A;  1VQK I;  2D45 A;  1YOV B;  4A12 A;  3TL4 X;  1QNT A;  4LLG F;  5JI6 A;  2CWE A;  1KYW A;  3JRH A;  1ON2 A;  2QQ8 A;  4XRS A;  3H5R A;  4A6D A;  4JX5 A;  2IPQ X;  2FMY A;  4S04 A;  4A0X A;  4RM2 A;  3LAP A;  2V1D A;  4I0A A;  3KLN A;  5ICC A;  2ME0 A;  1W36 C;  3J7Z I;  1YTY A;  3ECH A;  2XRN A;  3CQZ J;  2VKD A;  3C18 A;  1Z0X A;  2JZY A;  3KYD B;  5CVJ A;  2IBD A;  2ZME C;  1OFC X;  2F5C A;  3BWG A;  2UXN A;  4C2U A;  3E7L A;  4L9T A;  2RKH A;  3QOP A;  3PNV A;  2E1O A;  3PQK A;  4TV7 A;  2O3F A;  1DPU A;  2H6C A;  5BPD A;  1IN5 A;  4F93 B;  3Q3S A;  5FB2 A;  4U0V A;  1IXS B;  1ETW A;  4N0B A;  3QU6 A;  3KYL A;  1XDS A;  3FDY A;  4BJ6 C;  3RPQ A;  1JHH A;  1P4X A;  2M87 A;  4HX8 A;  2BVL A;  4EJV A;  1ONV A;  4CCN A;  1B6A A;  2GA2 A;  3DXJ F;  3G73 A;  2OBP A;  4A5N A;  2WB1 A;  2VN2 A;  4HF2 A;  3CCV I;  4G7Z F;  3K70 C;  4YFK F;  2NVY J;  4NDL A;  2OA4 A;  4G6D A;  4LIV A;  2IA1 A;  1WSU A;  1XGS A;  3IH2 A;  1IUY A;  2K4J A;  5F1R A;  1QHG A;  3M07 A;  4JQF A;  1BR1 A;  2QYO A;  3V42 A;  2M9H A;  1IDY A;  2R7Z J;  3F6V A;  5HDG A;  3ONQ A;  5B1A H;  1POG A;  3JRG A;  2H27 A;  2ZJR F;  3RPU A;  1R00 A;  5D6F A;  4HF1 A;  3VYT B;  2Q0O A;  4PCQ A;  2BXY A;  5BPI A;  2BYV E;  2L7F P;  3ZQH A;  4ZYD A;  3LFK A;  3OYD A;  3S32 A;  1E3H A;  3KLO A;  4UHT A;  4R1H A;  5E17 F;  5TIS C;  2FEZ A;  3OYK A;  3I64 A;  1R9T J;  1QGP A;  3CF5 F;  3PJR A;  2Z99 A;  5JHU A;  3IRR A;  3KP6 A;  4JBA A;  2B7E A;  3X2Q H;  1ITY A;  1U9N A;  3F3X A;  1MDM B;  4X6A J;  1PYV A;  5GPC A;  3U1D A;  1MSE C;  4XQF A;  1AU7 A;  2X6X A;  2ADU A;  1DGR M;  4W97 A;  4RAF A;  2XDV A;  2XAF A;  2CFO A;  2R5Z B;  2W82 A;  5E1W A;  5LBQ A;  2WAE A;  2DT7 B;  3I0T A;  3PUB A;  2W85 A;  5EZG A;  2R7V A;  2ZBK A;  4WXH A;  3L2U A;  3GCM A;  3SYT A;  5FJ8 J;  1S6L A;  1SFO J;  4PGG A;  4O3M A;  2K02 A;  2KQR A;  2CYY A;  9ANT A;  2HZD A;  5H2F C;  1T95 A;  1ZH5 A;  1WI3 A;  2MG4 A;  2JTV A;  1R49 A;  5H6Q A;  4DZP A;  1HF0 A;  1LEB A;  2NXN B;  1RKW A;  2GOX B;  1SC7 A;  1SVM A;  3WHB A;  1SD5 A;  2A6E F;  1N77 A;  1X1P A;  1L0O C;  2DFE A;  4OU0 A;  4YII A;  2XRL A;  1LJ9 A;  3FXU A;  1DPR A;  4A6E A;  2V1X A;  4OIN F;  2QUF A;  2B0L A;  4JP0 A;  2LOO A;  4RBO A;  1DGW Y;  2O5R A;  1ZTR A;  2XGE A;  2Y9Z A;  2FBK A;  4ANJ A;  3MKZ A;  5DCM A;  1NG6 A;  3OL4 A;  3RTR A;  1FX7 A;  1U6G A;  1G2H A;  2PMH A;  1RR8 C;  2DN0 A;  3H3Z A;  4PGH A;  2Y2Z A;  5E8I A;  1MKM A;  2VJ4 A;  4C3H J;  2W1O A;  3T8T A;  2TCT A;  3KZI C;  3P9I A;  3R61 A;  3CC7 I;  4JX6 A;  3BTJ A;  1B1B A;  1X2M A;  3GZ6 A;  4AIK A;  4C9Y A;  2OZU A;  1X1A A;  2LBF A;  2OV7 A;  3NRV A;  3MEX A;  5EEG A;  3BTL A;  2LLK A;  3FMR A;  1SEU A;  3OIO A;  2G7H A;  3V8K A;  1D1C A;  1BIB A;  3KYC B;  2EQR A;  2Q2E B;  2V1N A;  2O6G E;  1IRF A;  2WB1 N;  2NNN A;  3GW2 A;  1E3O C;  4L0Y B;  1K6Y A;  1ZG3 A;  2HKX A;  4JYK A;  5GTH C;  2M4K A;  2QZ8 A;  3QPT A;  1OYI A;  1ZLJ A;  3IH3 A;  1H0M A;  1TC3 C;  1W36 D;  5EF6 A;  3FF5 A;  4KIG A;  2UZK A;  2KKO A;  1W7P B;  1MH3 A;  3OYG A;  3S2W A;  4EQQ A;  1HDD C;  4I98 B;  2C6Y A;  3LSK A;  3GLL A;  3GWZ A;  3ZN1 A;  4B3A A;  3DTK A;  3K10 A;  4AC0 A;  4BQA A;  2E2J J;  1FY7 A;  1RNL A;  3HSF A;  1YRN B;  2A3S A;  2FF4 A;  4N9I A;  1PP7 U;  4XLA A;  2ZXW H;  2DDB A;  2CQN A;  4EMS A;  1HKS A;  3NQO A;  4DYR A;  3F8F A;  3NWS A;  3G1L A;  4GGG A;  2HEO A;  3M9A A;  2MH2 A;  1JTX A;  3K70 D;  3F22 A;  3AL0 C;  2V7F A;  2FD5 A;  4XN0 A;  3VEP A;  1WWX A;  3RQ4 A;  1RPW A;  1FBU A;  3CCM I;  5A2Q K;  2NNY A;  1ETK A;  3AL0 B;  1VQ7 I;  4DZJ A;  1EA3 A;  4HNT A;  1GHC A;  1M1E B;  3OV8 A;  1XN7 A;  2CV0 A;  2KMU A;  2CUE A;  4WCG A;  4AD9 A;  4M6X A;  4E7J A;  5ILS A;  2IA0 A;  4HLX A;  4I99 C;  2GXA A;  3OYJ A;  1FZP B;  1JHF A;  5IT9 Z;  2DXI A;  5LGT A;  2ZNY A;  2R7T A;  3OS2 A;  1ZKG A;  1GVJ A;  1YIO A;  2LNB A;  3WTT C;  1V5G A;  4BAC A;  3HKZ A;  4B8X A;  3DFG A;  1D5V A;  3F6O A;  2NVQ J;  4II2 A;  4LJZ F;  2DOA A;  1Z1D A;  3AKZ A;  4W1U A;  2MD0 A;  3HEF A;  2K4B A;  2RQQ A;  2EWN A;  2IJL A;  5CVR A;  2XV4 S;  4QPQ A;  3CCQ I;  5KK1 A;  1HW1 A;  4FCY A;  2H8W A;  1KZH A;  2ZXJ A;  1K7A A;  3LSI A;  2F5D A;  4BE2 A;  5GAG J;  5K5Q A;  1IGN A;  3S1N J;  1XMA A;  3EUH C;  5L3B A;  4JOM A;  3L2Q A;  4HDV A;  2KJC A;  3P7N A;  2CU7 A;  1MBE A;  5E1X A;  5J1Y A;  1IDZ A;  3UR3 C;  1BW5 A;  3CD6 I;  4IPA A;  3T5X A;  5IOY A;  1H89 C;  1O7L A;  3JTG A;  2FU4 A;  2CGP A;  5H20 A;  2CUF A;  2XAJ A;  4RMN A;  3UNG C;  5GAH J;  2DFI A;  2HXO A;  1X3W B;  1D1B A;  5L3E A;  1B8I A;  1QA6 A;  1A6I A;  2IW5 A;  3QOE A;  1WJA A;  1ZEL A;  1XPX A;  3R60 A;  3GME A;  5CJ9 A;  4BQO A;  1XSX A;  2O0Y A;  3K2A A;  3KP5 A;  2W48 A;  4S0H B;  2W4S A;  4HX7 A;  2VL8 A;  1HXD A;  4XOP A;  4EGY A;  4I2O A;  5F1J A;  1IN7 A;  3EPZ A;  3MAJ A;  2RDP A;  3BPX A;  3S16 J;  1DU6 A;  2HVS A;  3OL3 A;  2VOO A;  4CCM A;  4IRG A;  3CCU I;  1F1Z A;  5LD2 C;  4OWR B;  5IT9 K;  5EEH A;  4YG2 F;  1W5C C;  2XF7 A;  4XLE A;  2BHZ A;  1OR7 A;  1J7K A;  3Q0V A;  5LRS A;  2ZJ2 A;  2R3S A;  3DKX A;  4FE7 A;  3CTA A;  1JKO C;  2CQK A;  2JQ7 A;  1D8J A;  5M3F J;  1CF7 A;  2X85 A;  3HOS A;  2XB5 A;  1X3U A;  3ZN0 A;  1BIA A;  4FX4 A;  1Y1W J;  2QLZ A;  2GAU A;  2VPL A;  2HU9 A;  4PSW A;  2JSC A;  3CME I;  4UVC A;  2L9N A;  1VQ4 I;  4O5V A;  2FQ4 A;  4I76 A;  3GFL A;  3GFI A;  1YS7 A;  2VB6 A;  4HZF A;  1P2F A;  3TOB A;  4CCL A;  3RKY A;  3BY6 A;  1ZGA A;  3CO6 C;  2O61 A;  5FKO A;  3ZQC A;  1WPK A;  2FOW A;  2MFZ A;  3J81 Z;  3OMY A;  3IRQ A;  1Z7U A;  1O3S A;  1QZE A;  2F5E A;  3W2V A;  1K6O A;  4MTD A;  4J01 A;  4L5E A;  3BG9 A;  5HLI A;  3FIW A;  3GF2 A;  1F5T A;  1NH3 A;  1YX3 A;  2HFH A;  2LFB A;  2YX7 A;  2ZME A;  4ZH4 F;  4HPQ A;  1R36 A;  5F64 A;  4WK8 F;  3S1Q J;  4C3J J;  3QYE A;  3M7G A;  1BR4 A;  2X1D A;  3ZQG A;  5M5W J;  1ETQ A;  3TW7 A;  1GV5 A;  3WOD F;  3KX2 A;  3CCR I;  4LOC A;  2XAS A;  4C3I J;  5LEK A;  4BBS J;  2LH9 A;  5JLW A;  4KFC A;  1TP4 A;  1XSV A;  2X9D A;  1ZR4 A;  3BG7 A;  3I4N J;  2RVC A;  4EV0 A;  2EV5 A;  1V5E A;  3PO2 J;  4G8X A;  2P6S A;  4U87 A;  1SFU A;  1Y1V J;  1VQ9 I;  3G6E I;  4BJT A;  1U9O A;  4XIC A;  2EFQ A;  4A3I J;  1T8I A;  2FRH A;  4JX4 A;  1SD4 A;  1X4P A;  4KIF A;  5D5W B;  1R5H A;  1S29 A;  2AQF A;  2ZFU A;  2Q1Z B;  4DJA A;  2GM4 A;  4GDF A;  1I1S A;  3TW6 A;  4BXF A;  4BE1 A;  2NS7 A;  2A69 F;  3K6G A;  3VSK A;  1VZ0 A;  1AOY A;  3J7A O;  4G6Q A;  1UAA A;  1OPC A;  2L3D A;  2PMZ N;  2XAG A;  1ZRF A;  3H3V K;  3M1E A;  4BHB A;  4I0B A;  1S3J A;  2ISZ A;  4A3F J;  1UFM A;  2CW0 F;  4XLF A;  3ESW B;  2BY2 A;  2ELK A;  4PUS A;  3OYM A;  2ZB9 A;  4AUX A;  2HOA A;  3BR3 A;  1D5Y A;  1BR2 A;  2DQR A;  1JT6 A;  3ZMZ A;  5HOO A;  5L3D A;  5ERI A;  4UB6 C;  3WTU C;  4BEH B;  4BDY A;  1VFC A;  2R7F A;  2CQX A;  1JKQ C;  3ZXS A;  1FC3 A;  2O8K A;  3M8F A;  3WU1 B;  1RRJ A;  4XSX F;  4U7B A;  3I9V 2;  4HV6 A;  4IHT A;  2F48 A;  1GXP A;  5HS8 A;  1FP1 D;  2L7K A;  2KZV A;  3EDP A;  3TO7 A;  4FT8 A;  2E1N A;  4UUV A;  2L02 A;  3W2A A;  4MTE A;  3C2G A;  3IKV A;  3IKT A;  4N9H A;  1AWC A;  3QRF F;  1WJC A;  1K61 A;  2XPW A;  2W24 A;  1FOK A;  4XRS G;  3OWT A;  2I5U A;  1VQL I;  5KHD A;  1EH8 A;  1XMK A;  2XF6 A;  5B66 C;  1WH5 A;  4HNV A;  1Y8Q B;  2J5P A;  4CA0 A;  2VKV A;  1JUM A;  1PUF A;  4B3X A;  3G1M A;  3GFM A;  2CW8 A;  3HM5 A;  3OR2 C;  1WFX A;  1VQ8 I;  3GTP J;  3DPU A;  3RYP A;  1I3A A;  3KP4 A;  1MW7 A;  1VTN C;  2VT2 A;  3R4K A;  1XTA A;  3CF2 A;  3E5U A;  1NK3 P;  5EYR A;  4HNU A;  2CUJ A;  3BRO A;  3W2W A;  2M7B A;  3SFZ A;  1QU3 A;  2DMQ A;  3BR5 A;  4OIR F;  3LSM A;  1QPM A;  1R23 A;  2MAB A;  3I4M J;  3K2Z A;  2OCC H;  1V54 H;  1MJB A;  4NHJ A;  2ZKZ A;  1MD0 A;  1FOX A;  4UXN A;  1TQM A;  3BR0 A;  5AIP A;  1R4N B;  3CCE I;  2PJP A;  2EJR A;  1HW2 A;  1LE8 A;  4EEF G;  5IP9 J;  3EYY A;  2JWT A;  4BBR J;  2QEX I;  1S72 I;  4ZDL A;  2PG4 A;  4F3Q A;  3TGN A;  3ZGK A;  2FNP A;  3SHF A;  3BJ6 A;  4ZYA A;  3LSR A;  1EKE A;  5HNF A;  2DT5 A;  5FLX K;  3GYH X;  2UWM A;  2R4G A;  3I4P A;  4M3F A;  5E3M A;  2E36 A;  3GTO J;  3QP5 A;  2ID3 A;  1V55 H;  4XL9 A;  3A4C A;  3BC8 A;  1SVO A;  4X0G A;  2L01 A;  1P7J A;  5EDN A;  3HPH A;  2UXX A;  4XRF A;  3K4L A;  4IVN A;  3TBI A;  4BXX J;  1D3Y A;  2K9N A;  1LEA A;  2R7Q A;  2F4I A;  1EH7 A;  1F9N A;  3OYA A;  2FQ3 A;  1SFE A;  3RPU D;  3AG1 H;  4E70 A;  2A5Y B;  1USS A;  4I02 A;  2Y75 A;  2QQB A;  2BVM A;  2Z9O A;  1FBQ A;  4M72 A;  2JA5 J;  1BL0 A;  1HST A;  3H9G A;  3ZMV A;  3C2H A;  1WVR A;  3FXM A;  4NC8 A;  2DBB A;  2R5Y B;  3ZQI A;  1B4A A;  3JRD A;  3RZD J;  1IN4 A;  4A0Z A;  3TOA A;  4XK4 A;  4CCK A;  3RJP A;  5DUK A;  5IY5 H;  2JA6 J;  4RGX A;  5FLV A;  4D0P A;  4E7L A;  1GDT A;  4H4K C;  4CCJ A;  1OCT C;  4RB3 C;  2EFN A;  4D5F A;  2H1K A;  1KA8 A;  1RC9 A;  3BG5 A;  2M5W A;  1YJW I;  2D1V A;  2KPM A;  1XD7 A;  5HNH A;  2L9S A;  1B9N A;  2GWR A;  2NAZ A;  4KMU X;  4P1W A;  4PJJ A;  1MBG A;  5HS7 A;  1MIJ A;  3PNT A;  2VT3 A;  5CYV A;  4FHT A;  2EA4 A;  2GIZ A;  1X19 A;  1BI2 A;  1R6R A;  4B4C A;  3VWB A;  5J3L A;  4DBR A;  2CUZ A;  1IXC A;  5J4Y A;  2MLK A;  3PQJ A;  2FUG 2;  2XSJ C;  4GYI A;  4YRV A;  2R7W A;  4P55 A;  1FYM A;  4C30 A;  2LYC A;  1D0Y A;  2ACJ A;  3IAS 2;  1JGG A;  1HKQ A;  4Y3O A;  1KYZ A;  3SEZ A;  3EUH A;  2NRA C;  4CZC A;  1R5I D;  1QRY A;  2JA8 J;  3L9F A;  2CSO A;  2XKP A;  5FKL A;  3HOW J;  1OCP A;  3PIP F;  1S8N A;  2DMN A;  5FO5 A;  4ZYE A;  3SZT A;  2M7A A;  3JSP A;  4Q47 A;  4OAZ A;  4DGW B;  2LVS A;  4ZYG A;  2QVO A;  1FTT A;  1T33 A;  1VF9 A;  2E71 A;  2OPT A;  1CGP A;  3SXY A;  2DK8 A;  5DS9 A;  2VUM J;  1FIA A;  2EFO A;  3GUD A;  3WTV C;  2KIM A;  3QQA A;  1VQN I;  3WTY C;  3RYR A;  4CYC B;  1ZK8 A;  2YR2 A;  3JAM Z;  4KT5 C;  1ULY A;  3VYU B;  2V79 A;  2EPF A;  4IOC F;  2IVM A;  4JK1 X;  3CJN A;  1GVD A;  1R22 A;  1TQI A;  2G7U A;  2HTS A;  3OSF A;  1WZ2 A;  2ZJQ F;  3ZMD A;  2R7O A;  4ITV A;  1UEL B;  4Q5S F;  1A35 A;  3I58 A;  4ZC3 A;  2E5Z A;  2VQC A;  3LMM A;  1K79 A;  5FRM A;  1I3Q J;  1LVK A;  1T0F C;  4NC7 A;  4ZJZ A;  3F21 A;  3J81 K;  5J1U A;  1Y6I A;  4FAS D;  1J0R A;  2STT A;  4F92 B;  4EJO A;  5EJC A;  2OU2 A;  2X6O A;  1YIT I;  1E2X A;  1J9I A;  1AKH A;  2Z33 A;  1BN5 A;  3CDI A;  5GTI C;  4D7N A;  3MKW B;  3C3W A;  1P4W A;  3VB2 A;  5K7H A;  3TP0 A;  4EJU A;  5FKK A;  3W3C A;  1K78 A;  3VYR B;  3ZMT A;  3SDG A;  4BJ5 C;  3S3O A;  1OJL A;  4XM3 A;  1GT0 C;  2O7O A;  2IT0 A;  3DLL F;  3JSO A;  2QBY A;  1YW9 A;  1A04 A;  5F08 A;  2KIU A;  1SD6 A;  4DQ2 A;  2L4A A;  3BR2 A;  4RGR A;  2PLY A;  1F43 A;  3L7W A;  2DMT A;  4FET A;  4EVI A;  1APL C;  1DQU A;  2FXA A;  4ASN A;  4ESJ A;  1ORK A;  1FSH A;  2MC3 A;  1IN6 A;  2DLL A;  2HVR A;  2EIN H;  3OIQ A;  3KEO A;  1TWG J;  3N4M A;  1UG2 A;  1P9Q C;  2K9Q A;  2VC1 A;  2W84 A;  4KIB A;  4XLN F;  1WJB A;  1B72 B;  4IHW A;  4J19 A;  1J5Y A;  1Z6R A;  1YFH A;  2YUS A;  4MQV A;  1SMT A;  3ZOB A;  1XSD A;  5DUI A;  3FK7 A;  4CDG A;  1XC5 A;  1FOW A;  4HLY A;  1TNT A;  1JE8 A;  1GUU A;  2R7D A;  4IRH A;  3HBL A;  3FKJ A;  3FXK A;  1UB9 A;  3E97 A;  4PJN A;  2OQR A;  3JRI A;  2VJJ A;  1WKM A;  1HKT A;  2AQE A;  3S3N A;  1PVE A;  1DP3 A;  2QKL B;  4M3B A;  3PM1 A;  2DFH A;  3CMA I;  2WAF A;  4LLN A;  5HDK A;  2MSY A;  3CLO A;  1D8K A;  1U0J A;  5BOX A;  1G3T A;  4L9N A;  1XX5 A;  2KIF A;  5K1Y A;  1EJ9 A;  1IUF A;  1UG0 A;  3FK6 A;  4M9X A;  4BUP A;  2P5K A;  2NVU B;  4IO9 F;  4L5J A;  4RB1 A;  1LUJ B;  1ZQ3 P;  2A6T A;  3CUQ C;  2O8X A;  2KL4 A;  5DD4 A;  5EGO B;  1IC8 A;  3FHZ A;  2ZSH B;  2NVT J;  1JKP C;  2XAQ A;  4RAG A;  3IWF A;  3IAM 2;  3CUQ B;  3KP7 A;  4EM1 A;  4HW0 A;  5HLH A;  4RB2 C;  3REO A;  4XON A;  3IUO A;  3N05 A;  2CFX A;  4NBQ A;  3VDX A;  1W0U A;  2K86 A;  4L0Z B;  2KDZ A;  2ECB A;  2EK5 A;  2DA1 A;  3DP7 A;  3A1Y A;  5BMZ A;  3C7J A;  4V2F A;  1U78 A;  1ZR2 A;  2VJI A;  3M8J A;  1A36 A;  3N97 A;  3BT9 A;  4M6Y A;  4L18 B;  4UV9 A;  4XN3 A;  2DA6 A;  1I27 A;  1WJD A;  3DBL B;  2P8T A;  1EF4 A;  4EGZ A;  1FOY A;  4RAY A;  4MO7 A;  4LLL A;  3K4C A;  1MND A;  4D9J A;  3D5R C;  4A3C J;  3KP2 A;  2GIV A;  3HOV J;  1KQ9 A;  2FA5 A;  3A0H C;  3AG4 H;  1Z77 A;  1X2N A;  3LFU A;  4CSW A;  2L9V A;  1YHQ I;  2WBM A;  4DW6 A;  3A01 A;  2DAO A;  3WE2 A;  4XOR A;  2IAI A;  1W5S A;  2WV1 A;  4KUM A;  1FMW A;  1XB4 A;  1YLF A;  3SFI A;  3ZMU A;  2G0E A;  3TDU C;  4HYE A;  5ICG A;  3LST A;  1ZRE A;  4B1R A;  3HRM A;  3KET A;  5JVT A;  1YX5 A;  4G7O F;  3C1D A;  3F8M A;  3LNQ A;  2BW3 A;  4G6T B;  2AS5 F;  4LIT A;  3H35 A;  5LRR A;  1K4S A;  5J6X A;  3LOC A;  4BKX A;  4BHP A;  5KNL A;  4ZZD A;  3GFJ A;  1U8B A;  1MZB A;  1J75 A;  2COB A;  3ABT A;  1TWA J;  3B6C A;  5FGM A;  3K7A J;  4UVB A;  1ZHF A;  4BYY A;  1A5J A;  4U7D A;  2IGN A;  2QGU A;  4CHU A;  1GXQ A;  3D5L A;  1YJ9 I;  1Y0U A;  3MZY A;  3GBG A;  3UKG A;  4Q4Z F;  3IHU A;  2RV8 A;  2HWV A;  2QM3 A;  5B5E C;  2VBW A;  3C2B A;  2VBZ A;  3FXL A;  5DTD A;  2E5N A;  2XB0 X;  3WTX C;  5F04 A;  3MWM A;  5K5O A;  1Z9C A;  2BBY A;  3T0Y A;  1SFK A;  1YE9 A;  5J8F A;  2I8D A;  4ENK A;  3ZQQ A;  2HOT A;  4E7I A;  2LG4 A;  2E19 A;  2WA0 A;  3H1C A;  3WGI A;  4HDU A;  2L54 A;  5EG0 A;  5FD6 A;  5TJJ A;  1G6N A;  2K7L A;  2QSH X;  4E7Z A;  3MCZ A;  2F5F A;  4CUG A;  2KP6 A;  5M3M J;  2Z1D A;  4R8H A;  2K5C A;  2EV6 A;  1R4M B;  3I5U A;  5EZH A;  2PEX A;  3RCO A;  3Q0U A;  2BE5 F;  4OIO F;  4B09 A;  2EBI A;  1OKR A;  3DV8 A;  3U9G A;  4AIH A;  2LC2 A;  1ON1 A;  2IEK A;  2ME6 A;  3HOT A;  4F7Z A;  1FBS A;  1HQC A;  2KIQ A;  4M6V A;  1NHA A;  3O2P E;  1YJN I;  1U8R A;  4YEJ A;  3W6K B;  2AO9 A;  3K4M A;  3GTL J;  1X4O A;  1PDN C;  1TWH J;  1V5F A;  4M3G A;  2VPR A;  3FXR A;  2P0W A;  2HGC A;  1WRJ A;  5DDG A;  2XAU A;  4A3J J;  5M5X J;  4XKB A;  4OMZ A;  3JRC A;  1LFP A;  4IKF A;  1Q1V A;  1T6S A;  4PJM A;  5F0F A;  3PFY A;  3VYS B;  2LD5 A;  2H09 A;  3QPH A;  1BC7 C;  3KZY A;  1WJF A;  1FYK A;  1T98 A;  3G3Z A;  2COM A;  2XVC A;  3QAH A;  4F55 A;  4HOB A;  1Y39 A;  3TO6 A;  3TQN A;  3NEU A;  5C3E J;  2X1E A;  4X1E A;  1X1C A;  1AHD P;  4Y17 A;  3SZP A;  4UUS B;  3IWZ A;  5D5U B;  4HRI A;  3ABL H;  3K9T A;  1O3R A;  4PFP A;  3DCF A;  2K27 A;  1RI7 A;  1I6X A;  4PK4 A;  1OMI A;  3P9K A;  4RB0 A;  2KLO A;  1YG2 A;  2QKM B;  2DO7 A;  4II3 A;  3R6S A;  1SD7 A;  2VBY A;  3AG2 H;  4CIC A;  4ENM A;  4IHY A;  1LFB A;  3HDD A;  2NOG A;  4NNJ A;  3I59 B;  4LD5 A;  1ENH A;  5E20 A;  3TMO A;  3SJM A;  2RQP A;  5GAD J;  1LDJ A;  3JR9 A;  3E1S A;  3OYE A;  3FHN A;  3S1R J;  1BBY A;  1W7P D;  2L5Q A;  3KPH A;  1NK2 P;  2HYF A;  4XSZ F;  3HHH A;  2OD5 A;  1WI9 A;  4IOA F;  3DBR B;  5DYM A;  1HCR A;  3EET A;  4ZTF A;  1XGN A;  3QYB A;  2IS1 A;  1I39 A;  2E60 A;  2HVQ A;  2JSP A;  5DM6 F;  3L09 A;  1HLV A;  5D4R A;  1TNS A;  2YU3 A;  2XSD C;  3NAR A;  4ETS A;  1T0F A;  3LWF A;  1X1B A;  3OYH A;  3IL2 A;  3P9C A;  2JMW A;  3KIO A;  5CVV A;  1FJL A;  2DMU A;  3MZ8 A;  4BXU A;  5E3L A;  2DQL A;  3KEY A;  3O8G A;  5F27 A;  3RKX A;  4KNY A;  4V2G A;  3HKZ N;  3FXJ A;  5K7F A;  2DA3 A;  1UHM A;  2JK3 A;  2H1L A;  4HBL A;  5J47 A;  1R5G A;  1NG7 A;  4CYD A;  1YW7 A;  3QOD A;  2EIL H;  2PBI A;  3H0D A;  3I71 A;  4XRM A;  1G59 A;  4LFU A;  1MNM C;  4BY1 J;  3VOE A;  4A3B J;  1NTC A;  1BI1 A;  3CES A;  2D1H A;  1QZY A;  1FWZ A;  4NC6 A;  4MEX F;  2ZCW A;  2E2I J;  3ML6 A;  2LF7 A;  5HOD A;  4IHX A;  4Z6Y A;  3RIR A;  2HQR A;  3S17 J;  1JKR C;  1LDK B;  2WAQ A;  4KJZ A;  4BQN A;  3V8L A;  2VE9 A;  4QIW N;  2F4O B;  1O57 A;  3F72 A;  2BOL A;  3PNY A;  2X6W A;  2VOP A;  2VIX A;  3ABM H;  4H0E A;  3S93 A;  2M45 A;  1VND A;  4V19 K;  4A3D J;  3H5N A;  4IQ4 A;  3QWL A;  3ISP A;  1P6R A;  1T08 B;  4MFD A;  5D4S A;  1IG7 A;  4WF2 A;  4XMY A;  1UMQ A;  1J2X A;  1MDM A;  3MD2 A;  3GXO A;  3HRU A;  1FIP A;  3TDZ C;  2RC4 A;  1KU2 A;  3AAF A;  1GV2 A;  5JHF A;  1HDP A;  4EJW A;  2VON A;  2BGC A;  1FPQ A;  3F9K A;  2HS5 A;  2R5Z A;  5L3G A;  3WGH A;  2HYJ A;  3H5A A;  3DWL E;  5LHG A;  3J7Y J;  4OAY A;  4RLF A;  2E7W A;  3M3Y J;  3CDL A;  4G7H F;  1ZAR A;  1IRG A;  5EGO A;  2ESN A;  3SQN A;  1RZ4 A;  2IGO A;  3FM3 A;  1X58 A;  2VQH A;  3PL8 A;  1SFX A;  4E4H A;  3CUQ A;  5CQE A;  2HNH A;  2DJN A;  3OS0 A;  2Q8K A;  3L1P A;  3IH4 A;  3EUK L;  4PFO A;  3JTH A;  3RDI A;  3OYB A;  1IAW A;  3D0S A;  4XLP F;  4U0Y A;  1FP2 A;  1WQ2 A;  1PUE E;  4XID A;  5E8G A;  3VPR A;  3U1K A;  1RIO H;  4HQM A;  2VI6 A;  1TWC J;  4E7K A;  2HYG D;  3G2B A;  1VQM I;  3TO9 A;  2HQA A;  5D6E A;  1MBK A;  4EAT A;  2CG4 A;  2KT0 A;  4ABZ A;  3JRB A;  4WXC A;  1L3L A;  2E1M B;  2GBY A;  3ASN H;  2Z3Y A;  3CMM A;  3TED A;  2EFP A;  3DU5 A;  2A05 A;  3HRT A;  2PJR B;  3HPG A;  1ODD A;  1XG1 A;  2LBF B;  4N4O B;  2M4G A;  3ROU A;  3E6C C;  4DNC A;  4ZZL A;  3DU6 A;  3ZP5 A;  2BZT A;  3IP4 B;  2Q2E A;  1Z6T A;  3QU3 A;  2IXS A;  1VQO I;  2QEN A;  3B73 A;  4Y13 A;  2JRT A;  1XGO A;  5FRO A;  5ED4 A;  3S3M A;  2JN6 A;  3WE3 A;  3MZH A;  4LMY A;  3L2C A;  4IRI A;  2L7Z A;  4AM3 A;  1W7P A;  1XGM A;  2P6T A;  3WU0 A;  4L9J A;  5IP7 J;  2VJ5 A;  2EH3 A;  3DQV C;  1H9G A;  2I10 A;  3HHG A;  4CO8 A;  3CC4 I;  1S7A A;  2LMD A;  4Y4R A;  2GQQ A;  2W57 A;  3GTK J;  1EH6 A;  3QP6 A;  4BS9 A;  1Z67 A;  2VQG A;  1QHH D;  1YRN A;  1KU3 A;  2DOD A;  5GP9 A;  5M5Y J;  2CQQ A;  2IA2 A;  2M8G X;  2A07 F;  2XUB A;  2IP2 A;  3CP8 A;  1MSF C;  5BQT A;  4DYQ A;  1RKT A;  1Z91 A;  1FSE A;  4MHG A;  2M0M A;  5K5R A;  2B9S A;  2HPM A;  3CCL I;  2P5L C;  1T56 A;  1KU7 A;  2JPC A;  2NOJ B;  4IL6 C;  5GPA A;  2H8R A;  2WC2 A;  2QSF X;  1JT0 A;  5CQG A;  3VFZ A;  4U88 A;  4B44 A;  4BAY A;  6PAX A;  2MW8 A;  3K4N A;  5HLT A;  3T8R A;  2WWY A;  3FXQ A;  4M3D A;  2Z2S B;  5EEA A;  4HX4 A;  3CC2 I;  2BY3 A;  4AWX B;  2JUC A;  3PO3 J;  3DTI A;  2L0K A;  5E3N A;  1XMX A;  3G4S I;  1FT9 A;  1TQP A;  1I5Z A;  3COA C;  2ZFW A;  2ZC2 A;  3HUG B;  2LKX A;  2EZK A;  3PUF A;  3E0J B;  3HRS A;  4PZJ A;  4HST A;  3OOU A;  4E7H A;  2JA7 J;  4ZDO A;  1IV8 A;  2X0L A;  2HPI A;  2K9L A;  1S5L C;  1LPQ A;  2X6Y A;  1KQ0 A;  1UCR A;  2AHQ A;  2VBX A;  1A31 A;  3ZR8 X;  1LFU P;  4WX9 A;  2EZL A;  5F0C A;  4IEJ A;  4UV8 A;  3G1O A;  4MIM A;  4LG0 B;  3ZQ7 A;  2VXD A;  2DA2 A;  2DFF A;  2KHM A;  2EIK H;  1E17 A;  2WTE A;  2XKO A;  1YQA A;  1BOA A;  5E1Z B;  3GLX A;  4PJ0 C;  4M74 A;  4MGR A;  2KRF A;  2QSG X;  3LA2 A;  4GYG A;  2DI3 A;  2X48 A;  3H92 A;  4A93 J;  2DYR H;  4ZYH A;  2M3A A;  3ERM A;  1FEX A;  1I6H J;  2STW A;  5D5V B;  4D7M A;  1W5T A;  5BS6 A;  2RRE A;  2F6C A;  5JLX A;  2MA3 A;  2DDA A;  4BNC A;  1I50 J;  4XLH A;  4Q48 A;  1MMS A;  3M4O J;  4XBF A;  1B8I B;  4I6Z A;  2MC4 A;  2HR3 A;  2AXL A;  5AON A;  5ICF A;  1HC8 A;  4A69 C;  3P5J A;  5L3F A;  1EV7 A;  1A6Q A;  3BLY A;  2V4J C;  3R0A A;  3GEZ A;  1FYL A;  2ZO4 A;  4IF4 A;  2HDW A;  2ZNZ A;  1D1A A;  5TGT A;  2IS4 A;  3PIO F;  3K4K A;  2V9P A;  2FSW A;  3ASO H;  3GZN B;  5F6F A;  1H9T A;  3A03 A;  4FQG A;  2H94 A;  2XC7 A;  4PJL A;  1XCV A;  2A5W A;  3ERE D;  1CF7 B;  4LK0 F;  4KIT B;  2PX9 A;  3HB9 A;  1S9H A;  4IXA A;  4XKC A;  1O7F A;  1WGX A;  4BU2 A;  4QWQ A;  2NS0 A;  3BDD A;  4YFN F;  1ZYR F;  2FOK A;  2J5O A;  4F91 B;  5KAF C;  1G3W A;  2ELJ A;  1IRZ A;  5D8L B;  1U2W A;  3I59 A;  3OR1 C;  3HGY A;  3BCA A;  3H0G J;  3K1P A;  5J8C A;  1ZGJ A;  3CDH A;  1IXR C;  5CLS A;  3JRE A;  4D5C A;  2YX4 A;  4RS8 A;  3H3U A;  4OIQ F;  3B02 A;  4AYB A;  2PFB A;  3K1M A;  2JVH A;  1LDD A;  3LQR A;  3WHC A;  2HQN A;  1B59 A;  3S1M J;  2A6H F;  4EM0 B;  4DIQ A;  1MJA A;  4PDK A;  3L2W A;  4IHV A;  3OS1 A;  4A3M J;  1H88 C;  2CV2 A;  4OIP F;  4BDZ A;  1ACI A;  4RGS A;  1BM9 A;  2ZME B;  2A68 F;  4UB8 C;  1OIS A;  5J4V A;  3ZRG A;  5E79 C;  3IV5 A;  2WAD A;  2PN6 A;  1OCR H;  1JTY A;  1HW5 A;  2EB7 A;  4LIU A;  4P96 A;  1P4A A;  2V6C A;  4KN7 X;  4R79 A;  2LSO A;  4AIJ A;  2HZT A;  4MEY F;  2V1U A;  1GLN A;  3MVP A;  1UST A;  1YS6 A;  2JVG A;  3FWE A;  3WGG A;  2MYS A;  5HDN A;  3E3V A;  3M8E A;  3MKY B;  1JI8 A;  2BHY A;  2DPU A;  5J40 A;  2K9S A;  2HOE A;  2Z16 A;  4YIF A;  1MH4 A;  5KAI C;  1UHW A;  4G9Y A;  2LKP A;  4CH7 A;  2BEO A;  1MJ9 A;  2OQG A;  2LRD A;  1B9M A;  2IGM A;  3LAJ A;  3FM5 A;  3V8J A;  1BI3 A;  2ETH A;  4XNF A;  2OF7 A;  2XAH A;  3CJT B;  2M2E A;  2OZ6 A;  1V3F A;  3MQ0 A;  3CCS I;  4Y52 J;  3BG6 A;  4YEL A;  2FBI A;  2ZXH A;  3HYI A;  2XHK A;  3KP3 A;  1QPI A;  4FE4 A;  1TZL A;  2ZXI A;  4BEH A;  1H8A C;  1S7E A;  2VQL A;  3LA3 A;  1KU9 A;  1IRX A;  3V4G A;  1IF1 A;  3GTJ J;  3DEU A;  1ETV A;  4F52 A;  1ZGW A;  3BJO A;  4KN4 X;  3PSF A;  4UVA A;  5KCM A;  2NVX J;  2LDU A;  3E6D A;  3RI4 A;  2BY0 A;  2R93 J;  4HF0 A;  2B63 J;  1SAU A;  1PJR A;  2LRE A;  1LNW A;  2EIJ H;  2NYX A;  2XF5 A;  4QLC U;  2R7S A;  2VKH A;  2XPU A;  3RSN A;  4P9U A;  5C44 J;  2KZG A;  2YSR A;  3DKW A;  4IZZ A;  1BJA A;  4ZDP A;  3EUA A;  3H9J A;  1MGT A;  5FD5 A;  4CXF A;  2EFW A;  1PUF B;  1ZRD A;  2CW7 A;  4K2E A;  5CVU A;  2HQ5 A;  3JRF A;  2MH9 A;  3BG3 A;  4AVZ A;  3OYI A;  3F8N A;  4FIS A;  2HDD A;  4B47 A;  1WHU A;  3GO5 A;  4KIS A;  2LTP A;  4WXD A;  4AYB N;  2RNJ A;  3FMS A;  4QTR A;  1OYY A;  1FTZ A;  2OC6 A;  2DYS H;  2N8G A;  3CP2 A;  1JGS A;  1TW3 A;  4UUT A;  2A61 A;  2DMP A;  4I01 A;  2ID6 A;  2DK5 A;  3A0B C;  3I56 I;  3V7C A;  3D1N I;  1MBF A;  1ETX A;  1QVT A;  1TT5 B;  1DUX C;  5IYB J;  5FRN A;  4FTH A;  3CZ6 A;  2PJR A;  2H6B A;  2RGV A;  1LE8 B;  1BJZ A;  1T39 A;  1ZAO A;  5IYC J;  3BTI A;  3CO7 C;  2VC0 A;  2JRM A;  5JFR A;  3FKI J;  3CCJ I;  1R1T A;  1YIJ I;  2MD5 A;  2WY8 Q;  1I1G A;  2CV1 A;  4OMY A;  3OOP A;  2BXZ A;  3RQI A;  4XR6 A;  4B43 A;  4DYC A;  2AXT C;  1ZG1 A;  1WH7 A;  2EA2 A;  1SVL A;  2ZJP F;  1YYV A;  4BQQ A;  1ZLK A;  4FX0 A;  4A0Y A;  1UJ8 A;  4ESB A;  3BZ6 A;  5E3O A;  2O9L A;  2MLG A;  3FX3 A;  3PFI A;  4BGD A;  2QQ9 A;  2LK2 A;  5J1R A;  4G94 A;  1WCM J;  3DEE A;  1LVA A;  4MQ9 F;  2LY1 A;  2XGD A;  3Q9S A;  4Y7N J;  2GXG A;  2L2O A;  2QF7 A;  2FML A;  1VQ6 I;  2W25 A;  1QZZ A;  4NQW B;  5FLX Z; 
#chains in the Genus database with same CATH homology
 2PI0 A;  4RAZ A;  1U5T C;  2FBH A;  4UNO A;  3F8C A;  1U3E M;  5LLQ A;  3MFK A;  5FFX A;  1O3T A;  2HDC A;  1U5T B;  5TRD A;  2G9W A;  4MNU A;  1PP8 F;  3EYI A;  4GO1 A;  4O6J A;  2TDX A;  2XGX A;  1T38 A;  1TW2 A;  3GVA A;  3HUG A;  5DD8 A;  4AVP A;  4KIC A;  3BJA A;  2BV6 A;  1XCB A;  3E5Q A;  3V7S A;  4M9Z A;  1BI0 A;  1FLI A;  3DF8 A;  4LG0 A;  3I54 A;  4BHC A;  1REP C;  5DCF A;  3WG9 A;  3HTU A;  3ULQ B;  1V4R A;  5D8K B;  4GXO A;  4ON0 A;  3VOD A;  3KFW X;  1QBJ A;  5DV5 A;  2VXZ A;  4CZZ A;  1DP7 P;  2XRO A;  1IN8 A;  4A5M A;  3JAM K;  1C0W A;  1TLH B;  4BH9 A;  1XDU A;  5LHI A;  1R1V A;  3J80 Z;  3HIF A;  5LEJ A;  2P7C B;  2GXB A;  3K1N A;  2P4W A;  2EV0 A;  3KZZ A;  4RGU A;  3E6M A;  1ZN2 A;  2O03 A;  5DEQ A;  4ESF A;  4L5I A;  3GX4 X;  4U0W A;  5CVI A;  2KJB A;  3W6J B;  5IT3 A;  1Z05 A;  4LB5 A;  3U2R A;  5AIQ A;  1TTY A;  1K78 B;  2DU9 A;  3EQL F;  1HBX G;  2QBY B;  4LK1 F;  3GZ5 A;  5ILU A;  5HVQ C;  3V7R A;  1R58 A;  4IJA A;  1DDN A;  4I09 A;  5D5X B;  2F2E A;  3WTZ A;  3LQQ A;  1TBX A;  5H6R A;  1YO5 C;  4LGW A;  4WWC A;  2L4M A;  1IW7 F;  3WTW C;  4A2U A;  4KMF A;  2PQ8 A;  3R0J A;  1SMY F;  2DTR A;  2LF8 A;  3ZMS A;  3ECO A;  2MBF A;  3Q5F A;  3E5X A;  1R7J A;  3IC7 A;  5HS9 A;  2GA1 A;  5HLG A;  3F23 A;  2DW4 A;  3DPT A;  2PMU A;  1S7O A;  1F4K A;  4ENN A;  3HTS B;  1SAX A;  2P7V B;  5FFZ A;  3CUO A;  1G4D A;  4Z2Y A;  1KGS A;  2E7X A;  2E1C A;  3FMQ A;  4IHS A;  1Q1H A;  2FE3 A;  3BPV A;  3K0L A;  1IZ1 A;  3BP8 A;  4HAM A;  3KE2 A;  5DCM B;  2M8E A;  2P5V A;  4LB6 B;  2M30 A;  5LGN A;  3Q9V A;  4GCV A;  3KCC A;  3ABU A;  4I7H A;  1QO0 D;  1R1U A;  4L9V A;  3FZV A;  4EJT A;  3LA7 A;  2YPR A;  4OOI A;  2HKO A;  1KQ8 A;  1ZRC A;  3ELK A;  4HA8 A;  1O3Q A;  4HQE A;  4M71 A;  2QWW A;  4KA4 A;  2CO5 A;  5LHH A;  4KYW A;  2Y0M A;  5JR3 A;  1JXS A;  4Y15 A;  1RUO A;  1BC8 C;  4S05 A;  1STZ A;  3O3K A;  2JT1 A;  1FNN A;  2V9V A;  4M9S A;  1RUN A;  5E18 F;  3TKY A;  2GZW A;  5ICE A;  2DPD A;  5ILV A;  2Z5U A;  2WV0 A;  2RN7 A;  3E6B A;  3WTS C;  1LQ1 A;  4NQW A;  2ELH A;  2X4H A;  3RKW A;  2IRF G;  2JPB A;  1J59 A;  2ESH A;  4EM2 A;  3KEQ A;  4YFX F;  2VOD A;  3JW4 A;  1U5T A;  4P9F A;  3I53 A;  5A2Q Z;  2D2W A;  3F8B A;  1G3Y A;  5L3C A;  3HSE A;  1OYW A;  5KVR A;  2VE8 A;  2M1B A;  2XIG A;  1ZG5 A;  4CGZ A;  4ENJ A;  3T1B A;  2FNA A;  1HSJ A;  4KDP A;  2OAZ A;  2Y48 A;  3DPL C;  3O6B B;  3L00 A;  4P5O A;  1P92 A;  1T2K A;  1W4M A;  3K69 A;  4M73 A;  1LB2 A;  3BOQ A;  4NB5 A;  3HSR A;  4HV5 A;  2ISY A;  5LGU A;  2QQA A;  3J80 K;  1G3S A;  3ZPL A;  1YW8 A;  2HTJ A;  1QQI A;  2D45 A;  4A12 A;  1QNT A;  4LLG F;  5JI6 A;  2CWE A;  1KYW A;  1ON2 A;  4A6D A;  2IPQ X;  2FMY A;  4S04 A;  4A0X A;  3LAP A;  2V1D A;  4I0A A;  3KLN A;  5ICC A;  1YTY A;  3ECH A;  2XRN A;  3C18 A;  2JZY A;  5CVJ A;  2F5C A;  3BWG A;  2UXN A;  4L9T A;  2RKH A;  3QOP A;  3PQK A;  4TV7 A;  2O3F A;  1DPU A;  2H6C A;  5BPD A;  1IN5 A;  5FB2 A;  4U0V A;  1IXS B;  4N0B A;  3QU6 A;  1XDS A;  3RPQ A;  1JHH A;  1P4X A;  2M87 A;  4HX8 A;  4EJV A;  1ONV A;  1B6A A;  2GA2 A;  3DXJ F;  3G73 A;  2OBP A;  4A5N A;  2VN2 A;  4HF2 A;  4G7Z F;  4YFK F;  2OA4 A;  4G6D A;  2IA1 A;  1WSU A;  1XGS A;  1IUY A;  2K4J A;  5F1R A;  4JQF A;  2QYO A;  3F6V A;  5HDG A;  2H27 A;  3RPU A;  1R00 A;  5D6F A;  4HF1 A;  2Q0O A;  4PCQ A;  5BPI A;  2BYV E;  4ZYD A;  3LFK A;  3KLO A;  4UHT A;  4R1H A;  5E17 F;  2FEZ A;  3I64 A;  1QGP A;  2Z99 A;  5JHU A;  3IRR A;  3KP6 A;  4JBA A;  3F3X A;  1MDM B;  3U1D A;  2ADU A;  2XAF A;  5E1W A;  5LBQ A;  3I0T A;  2W85 A;  2ZBK A;  4WXH A;  1S6L A;  4PGG A;  4O3M A;  2K02 A;  2CYY A;  1ZH5 A;  2JTV A;  5H6Q A;  1LEB A;  1SD5 A;  2A6E F;  1L0O C;  4YII A;  4OU0 A;  1LJ9 A;  3FXU A;  1DPR A;  4A6E A;  2V1X A;  4OIN F;  2QUF A;  2B0L A;  2FBK A;  5DCM A;  3RTR A;  1FX7 A;  1U6G A;  2PMH A;  3H3Z A;  5E8I A;  4PGH A;  1MKM A;  3T8T A;  3R61 A;  3P9I A;  1B1B A;  3GZ6 A;  4AIK A;  2OZU A;  3NRV A;  3MEX A;  5EEG A;  3FMR A;  2G7H A;  3V8K A;  1BIB A;  2O6G E;  1IRF A;  2NNN A;  3GW2 A;  4L0Y B;  1ZG3 A;  2HKX A;  2QZ8 A;  3QPT A;  1OYI A;  1ZLJ A;  1H0M A;  3FF5 A;  4KIG A;  2UZK A;  2KKO A;  1W7P B;  2C6Y A;  3S2W A;  4EQQ A;  4I98 B;  3GWZ A;  3ZN1 A;  4BQA A;  1FY7 A;  1RNL A;  3HSF A;  2A3S A;  2FF4 A;  4N9I A;  1PP7 U;  4EMS A;  1HKS A;  3NQO A;  3F8F A;  4GGG A;  2HEO A;  3M9A A;  2MH2 A;  3F22 A;  3VEP A;  1WWX A;  1FBU A;  5A2Q K;  2NNY A;  1GHC A;  3OV8 A;  1XN7 A;  4WCG A;  4AD9 A;  4M6X A;  5ILS A;  2IA0 A;  4HLX A;  1FZP B;  1JHF A;  5LGT A;  2ZNY A;  1GVJ A;  1YIO A;  2LNB A;  3WTT C;  4B8X A;  3DFG A;  1D5V A;  3F6O A;  4LJZ F;  1Z1D A;  2K4B A;  2EWN A;  2IJL A;  5CVR A;  2XV4 S;  5KK1 A;  1HW1 A;  2ZXJ A;  1K7A A;  2F5D A;  5K5Q A;  1XMA A;  4HDV A;  5L3B A;  2KJC A;  3P7N A;  5E1X A;  4IPA A;  3T5X A;  1O7L A;  3JTG A;  2FU4 A;  2CGP A;  5H20 A;  2XAJ A;  2DFI A;  5L3E A;  2IW5 A;  3R60 A;  5CJ9 A;  1XSX A;  2O0Y A;  3KP5 A;  4HX7 A;  4EGY A;  1HXD A;  4I2O A;  1IN7 A;  3MAJ A;  2RDP A;  3BPX A;  2VOO A;  4IRG A;  1F1Z A;  5IT9 K;  5EEH A;  4YG2 F;  1OR7 A;  1J7K A;  5LRS A;  2ZJ2 A;  2R3S A;  3CTA A;  1D8J A;  2CQK A;  1CF7 A;  3HOS A;  1X3U A;  3ZN0 A;  1BIA A;  4FX4 A;  2QLZ A;  2GAU A;  2JSC A;  4UVC A;  4O5V A;  3GFI A;  3GFL A;  1YS7 A;  4HZF A;  1P2F A;  3TOB A;  3RKY A;  3BY6 A;  1ZGA A;  3CO6 C;  2O61 A;  3J81 Z;  3IRQ A;  1Z7U A;  1O3S A;  2F5E A;  1K6O A;  4MTD A;  5HLI A;  3GF2 A;  1F5T A;  2HFH A;  2YX7 A;  2ZME A;  4ZH4 F;  1R36 A;  5F64 A;  4WK8 F;  3M7G A;  3WOD F;  2XAS A;  5LEK A;  4KFC A;  1XSV A;  2RVC A;  4EV0 A;  2EV5 A;  4G8X A;  2P6S A;  1SFU A;  2EFQ A;  2FRH A;  1SD4 A;  4KIF A;  5D5W B;  1R5H A;  1S29 A;  1I1S A;  2A69 F;  1AOY A;  3J7A O;  4G6Q A;  1OPC A;  2L3D A;  2XAG A;  1ZRF A;  3M1E A;  4BHB A;  4I0B A;  1S3J A;  2ISZ A;  1UFM A;  2CW0 F;  2DQR A;  3ZMZ A;  5HOO A;  5L3D A;  5ERI A;  3WTU C;  2R7F A;  1FC3 A;  3M8F A;  3WU1 B;  4XSX F;  4U7B A;  4HV6 A;  4IHT A;  1GXP A;  5HS8 A;  1FP1 D;  3EDP A;  3TO7 A;  4FT8 A;  2E1N A;  4UUV A;  2L02 A;  4MTE A;  3IKV A;  3IKT A;  4N9H A;  1AWC A;  3QRF F;  2W24 A;  1FOK A;  1EH8 A;  1XMK A;  2J5P A;  3GFM A;  3RYP A;  3KP4 A;  1VTN C;  2VT2 A;  3R4K A;  3E5U A;  3BRO A;  3SFZ A;  4OIR F;  1QPM A;  1R23 A;  3K2Z A;  1MJB A;  4NHJ A;  2ZKZ A;  1MD0 A;  4UXN A;  1TQM A;  5AIP A;  2PJP A;  2EJR A;  1HW2 A;  3EYY A;  2PG4 A;  3TGN A;  2FNP A;  3SHF A;  3BJ6 A;  2DT5 A;  5FLX K;  3GYH X;  2UWM A;  3I4P A;  3QP5 A;  2L01 A;  2UXX A;  4XRF A;  4IVN A;  1D3Y A;  1LEA A;  1EH7 A;  1F9N A;  2FQ3 A;  1SFE A;  4E70 A;  2A5Y B;  1USS A;  4I02 A;  2Y75 A;  2QQB A;  2Z9O A;  1FBQ A;  4M72 A;  1HST A;  3ZMV A;  2DBB A;  1B4A A;  1IN4 A;  4A0Z A;  3TOA A;  3RJP A;  5DUK A;  4RGX A;  4D0P A;  4RB3 C;  2EFN A;  1KA8 A;  2M5W A;  2D1V A;  1XD7 A;  1B9N A;  2GWR A;  2NAZ A;  4KMU X;  5HS7 A;  2VT3 A;  5CYV A;  4FHT A;  2EA4 A;  1BI2 A;  1IXC A;  2MLK A;  3PQJ A;  4GYI A;  4P55 A;  1FYM A;  2ACJ A;  1HKQ A;  1KYZ A;  3EUH A;  2NRA C;  3L9F A;  2CSO A;  2XKP A;  1S8N A;  5FO5 A;  4ZYE A;  3SZT A;  3JSP A;  4Q47 A;  4ZYG A;  2QVO A;  1CGP A;  3SXY A;  2DK8 A;  2EFO A;  3GUD A;  3WTV C;  2KIM A;  3WTY C;  3RYR A;  2YR2 A;  3JAM Z;  4KT5 C;  1ULY A;  2V79 A;  2IVM A;  4JK1 X;  3CJN A;  1R22 A;  1TQI A;  2G7U A;  2HTS A;  3ZMD A;  4Q5S F;  3I58 A;  1K79 A;  3F21 A;  3J81 K;  1J0R A;  2STT A;  4EJO A;  2OU2 A;  1E2X A;  1J9I A;  2Z33 A;  1BN5 A;  3C3W A;  1P4W A;  3VB2 A;  4EJU A;  1K78 A;  3ZMT A;  2IT0 A;  3JSO A;  2QBY A;  1YW9 A;  1A04 A;  2KIU A;  1SD6 A;  4DQ2 A;  2L4A A;  4RGR A;  2PLY A;  3L7W A;  4EVI A;  2FXA A;  4ASN A;  4ESJ A;  1FSH A;  2MC3 A;  1IN6 A;  2DLL A;  3KEO A;  3N4M A;  2VC1 A;  2W84 A;  4KIB A;  4XLN F;  1J5Y A;  1Z6R A;  1YFH A;  4MQV A;  1SMT A;  1XSD A;  5DUI A;  4CDG A;  4HLY A;  1JE8 A;  1TNT A;  2R7D A;  4IRH A;  1UB9 A;  3E97 A;  2OQR A;  1WKM A;  1HKT A;  4LLN A;  5HDK A;  3CLO A;  1D8K A;  5BOX A;  1G3T A;  4L9N A;  2KIF A;  5K1Y A;  4M9X A;  2P5K A;  4L5J A;  4RB1 A;  3CUQ C;  2O8X A;  5DD4 A;  3FHZ A;  2XAQ A;  3IWF A;  3CUQ B;  3KP7 A;  4EM1 A;  4HW0 A;  5HLH A;  4RB2 C;  3REO A;  2CFX A;  4L0Z B;  2K86 A;  2EK5 A;  3DP7 A;  5BMZ A;  3C7J A;  1U78 A;  3N97 A;  4M6Y A;  4L18 B;  4UV9 A;  1I27 A;  2P8T A;  4EGZ A;  4RAY A;  4LLL A;  3KP2 A;  2GIV A;  1KQ9 A;  2FA5 A;  2DAO A;  3WE2 A;  1W5S A;  4KUM A;  1XB4 A;  1YLF A;  3ZMU A;  3TDU C;  4HYE A;  5ICG A;  3LST A;  1ZRE A;  3HRM A;  3KET A;  5JVT A;  4G7O F;  3C1D A;  3F8M A;  2AS5 F;  5LRR A;  5J6X A;  4BHP A;  4ZZD A;  3GFJ A;  1MZB A;  1J75 A;  3ABT A;  5FGM A;  4UVB A;  1ZHF A;  4BYY A;  4U7D A;  4CHU A;  1GXQ A;  3D5L A;  1Y0U A;  3MZY A;  4Q4Z F;  3IHU A;  2RV8 A;  2HWV A;  2QM3 A;  2VBW A;  2VBZ A;  3WTX C;  3MWM A;  5K5O A;  1Z9C A;  2BBY A;  3T0Y A;  4ENK A;  5J8F A;  3WGI A;  4HDU A;  2L54 A;  5FD6 A;  5TJJ A;  1G6N A;  2K7L A;  3MCZ A;  2F5F A;  4R8H A;  3I5U A;  2EV6 A;  2PEX A;  2BE5 F;  4OIO F;  4B09 A;  3DV8 A;  1OKR A;  3U9G A;  4AIH A;  1ON1 A;  3HOT A;  4F7Z A;  1FBS A;  1HQC A;  1NHA A;  3O2P E;  1U8R A;  3W6K B;  1PDN C;  3FXR A;  2HGC A;  1WRJ A;  5DDG A;  4OMZ A;  1T6S A;  2H09 A;  3QPH A;  1BC7 C;  3KZY A;  1FYK A;  1T98 A;  3G3Z A;  2COM A;  2XVC A;  3QAH A;  4HOB A;  3TO6 A;  3TQN A;  3NEU A;  4Y17 A;  3SZP A;  3IWZ A;  5D5U B;  3K9T A;  1O3R A;  2K27 A;  1RI7 A;  1I6X A;  1OMI A;  3P9K A;  4RB0 A;  1YG2 A;  2DO7 A;  3R6S A;  1SD7 A;  2VBY A;  4CIC A;  4ENM A;  3I59 B;  4LD5 A;  5E20 A;  2RQP A;  1LDJ A;  1BBY A;  1W7P D;  2HYF A;  4XSZ F;  3HHH A;  2OD5 A;  1WI9 A;  5DYM A;  3EET A;  1XGN A;  3L09 A;  5D4R A;  1TNS A;  2YU3 A;  4ETS A;  1T0F A;  3LWF A;  3IL2 A;  3P9C A;  5CVV A;  4BXU A;  2DQL A;  3RKX A;  4KNY A;  1UHM A;  4HBL A;  1R5G A;  4CYD A;  1YW7 A;  2PBI A;  3I71 A;  4LFU A;  3VOE A;  1BI1 A;  2D1H A;  1QZY A;  1FWZ A;  4MEX F;  2ZCW A;  3ML6 A;  2LF7 A;  3RIR A;  2HQR A;  1LDK B;  3V8L A;  2VE9 A;  1O57 A;  3F72 A;  2VOP A;  4H0E A;  2M45 A;  3ISP A;  1P6R A;  5D4S A;  4WF2 A;  1J2X A;  1MDM A;  3GXO A;  3HRU A;  3TDZ C;  2RC4 A;  1KU2 A;  3AAF A;  4EJW A;  2VON A;  2BGC A;  1FPQ A;  2HS5 A;  5L3G A;  3WGH A;  5LHG A;  2E7W A;  4G7H F;  1ZAR A;  1IRG A;  2ESN A;  3SQN A;  1RZ4 A;  3FM3 A;  1SFX A;  3CUQ A;  2Q8K A;  3JTH A;  3RDI A;  1IAW A;  4U0Y A;  3D0S A;  4XLP F;  1FP2 A;  1WQ2 A;  1PUE E;  5E8G A;  1RIO H;  4HQM A;  2HYG D;  3TO9 A;  5D6E A;  2CG4 A;  4WXC A;  1L3L A;  2Z3Y A;  2EFP A;  3HRT A;  1ODD A;  3ROU A;  3E6C C;  4DNC A;  4ZZL A;  3ZP5 A;  2Q2E A;  1Z6T A;  3QU3 A;  2QEN A;  3B73 A;  4Y13 A;  2JRT A;  1XGO A;  5ED4 A;  3WE3 A;  3MZH A;  4LMY A;  3L2C A;  4IRI A;  1W7P A;  1XGM A;  2P6T A;  3WU0 A;  4L9J A;  3DQV C;  1H9G A;  3HHG A;  4CO8 A;  1S7A A;  2GQQ A;  2W57 A;  1EH6 A;  3QP6 A;  1KU3 A;  2IA2 A;  2A07 F;  2XUB A;  2IP2 A;  5BQT A;  1Z91 A;  1FSE A;  4MHG A;  5K5R A;  2P5L C;  1KU7 A;  2JPC A;  2WC2 A;  3VFZ A;  4U88 A;  4BAY A;  6PAX A;  3T8R A;  2WWY A;  3FXQ A;  4HX4 A;  4AWX B;  1FT9 A;  1TQP A;  1I5Z A;  3COA C;  2ZFW A;  3HRS A;  4PZJ A;  2X0L A;  1KQ0 A;  1UCR A;  2VBX A;  4WX9 A;  4UV8 A;  4LG0 B;  3ZQ7 A;  1E17 A;  2WTE A;  2XKO A;  1YQA A;  1BOA A;  5E1Z B;  3GLX A;  4M74 A;  4MGR A;  2KRF A;  3LA2 A;  4GYG A;  2DI3 A;  3H92 A;  4ZYH A;  2STW A;  5D5V B;  1W5T A;  5BS6 A;  2MA3 A;  4BNC A;  4Q48 A;  4XBF A;  2HR3 A;  2AXL A;  5AON A;  5ICF A;  5L3F A;  1EV7 A;  3R0A A;  3GEZ A;  1FYL A;  2ZO4 A;  4IF4 A;  2ZNZ A;  2FSW A;  5F6F A;  1H9T A;  2H94 A;  1XCV A;  3ERE D;  1CF7 B;  4LK0 F;  4IXA A;  1O7F A;  5IT9 Z;  4QWQ A;  2NS0 A;  3BDD A;  4YFN F;  1ZYR F;  2FOK A;  2J5O A;  1G3W A;  5D8L B;  1U2W A;  3I59 A;  3K1P A;  5J8C A;  1ZGJ A;  3CDH A;  1IXR C;  5CLS A;  2YX4 A;  4RS8 A;  3H3U A;  4OIQ F;  3B02 A;  2PFB A;  3K1M A;  1LDD A;  3LQR A;  2HQN A;  1B59 A;  2A6H F;  4EM0 B;  1MJA A;  4PDK A;  4OIP F;  4RGS A;  1BM9 A;  2ZME B;  2A68 F;  2PN6 A;  1HW5 A;  2EB7 A;  4P96 A;  1P4A A;  2V6C A;  4KN7 X;  4R79 A;  2LSO A;  4AIJ A;  2HZT A;  4MEY F;  2V1U A;  1UST A;  1YS6 A;  3FWE A;  3WGG A;  5HDN A;  3E3V A;  3M8E A;  2DPU A;  2HOE A;  4YIF A;  1UHW A;  4G9Y A;  2LKP A;  2BEO A;  1MJ9 A;  2OQG A;  1B9M A;  3LAJ A;  3FM5 A;  3V8J A;  1BI3 A;  2ETH A;  2XAH A;  2OZ6 A;  1V3F A;  3MQ0 A;  2FBI A;  3HYI A;  2XHK A;  3KP3 A;  3LA3 A;  1KU9 A;  3V4G A;  1IF1 A;  3DEU A;  3BJO A;  4KN4 X;  4UVA A;  2LDU A;  3E6D A;  3RI4 A;  4HF0 A;  1LNW A;  4QLC U;  2NYX A;  4P9U A;  2YSR A;  3DKW A;  1BJA A;  5FD5 A;  1MGT A;  4CXF A;  2EFW A;  1ZRD A;  4K2E A;  5CVU A;  2MH9 A;  3F8N A;  3GO5 A;  4WXD A;  2RNJ A;  3FMS A;  1OYY A;  1JGS A;  1TW3 A;  2A61 A;  4I01 A;  2DK5 A;  3V7C A;  1DUX C;  2H6B A;  2RGV A;  1T39 A;  1ZAO A;  3CO7 C;  2VC0 A;  5JFR A;  1R1T A;  2MD5 A;  1I1G A;  4OMY A;  3OOP A;  1ZG1 A;  2EA2 A;  1YYV A;  1ZLK A;  4FX0 A;  4A0Y A;  4ESB A;  3BZ6 A;  2MLG A;  3FX3 A;  3PFI A;  2QQ9 A;  4G94 A;  1LVA A;  4MQ9 F;  3Q9S A;  2GXG A;  2FML A;  2W25 A;  1QZZ A;  5FLX Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...