3TBIA

Crystal structure of t4 gp33 bound to e. coli rnap beta-flap domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
AKLLDRQENGFIIEKMVEEFGMSYLEATTAFLEENSIPETQFAKFIPSGIIEKIQSEAIDENLLRPSVVRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase-associated protein Gp33
publication title Crystal structure of T4 gp33 bound to E. coli RNAP beta-flap domain
rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16805 Trans_coact Phage late-transcription coactivator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tbiA00
3TBIA
chains in the Genus database with same CATH superfamily
4S05A 3IKTA 3E3VA 3RYPA 5KHDA 3GTOJ 5D8KB 2TDXA 5BPDA 2OTJI 1EV7A 3LSKA 5D6FA 5DUKA 3M4OJ 3LSRA 3DBLB 1BR2A 5F0HA 5ERIA 2ICWG 1R5GA 1Z7UA 2LKPA 5C3EJ 2PBIA 1BI2A 4MTEA 4M9SA 3I0TA 3M8FA 5FKLA 2LY9A 3HRMA 2E1CA 4A0ZA 1VQMI 2E1NA 4G7HF 1R1VA 4UVBA 2DK5A 3FX3A 3MEXA 1TWFJ 4D0PA 3M7GA 4CCNA 1FMVA 4ZYGA 3CC7I 4IHXA 5ILUA 2RC4A 2V4JC 3Q0WA 1DQUA 3HUGA 1SFXA 3PSFA 4G6QA 3PIPF 3RKQA 2IPQX 2R7QA 2ZNZA 3HXLA 4ZDOA 2VIXA 5FLVA 3PO2J 3JRGA 4JBAA 1MSEC 4HOBA 4L9VA 1FEXA 4L5JA 4HF0A 2V1DA 2IA2A 2YX7A 1BM9A 5AONA 1DGWY 4BE2A 4AIDA 4UB8C 2K9MA 2VE9A 1ZH5A 4BXUA 4WCGA 3AL0B 3W2VA 3JTGA 1T08B 2GLOA 2VKDA 5KCMA 4Y52J 1QZEA 4PFPA 4B48A 4NQWB 3OS2A 1WKMA 3NWTA 2CV1A 4NB5A 2O6GE 1HXDA 4G8XA 4WX9A 4AIKA 1IRFA 3PFIA 4BXXJ 1WJBA 2KJCA 1XMKA 3T8RA 2CUJA 3HGYA 3A0BC 3K69A 1V4RA 2EINH 4XNFA 4Z2YA 1H9TA 1UG2A 1HCRA 1VQ6I 3UKGA 3K70C 2A3SA 1ETXA 1VQNI 1RUOA 5CVUA 2OF7A 1K4TA 5L3EA 1T0FA 1WH7A 2DMUA 3BPXA 4K2EA 2ESHA 1ZKGA 4KA4A 3RPQA 3CCJI 1J75A 5F64A 4BEHB 2CQ7A 3Q3SA 3MFKA 2B63J 3CDLA 3HRSA 4OMYA 5LHHA 3REOA 3COAC 4ZYEA 3F8BA 4WXHA 2WY8Q 1PVEA 3TO6A 4OIQF 2E35A 3HHGA 4A6DA 2Z3YA 3VEPA 2NRAC 1LJ9A 2E71A 5E1WA 1BC7C 1F5TA 4UVAA 3ZCOA 2VN2A 4G94A 2QBYB 2E36A 2JVHA 4YIIA 2XAHA 2P0WA 4I01A 1GVJA 2COBA 1G3YA 3WU1B 1UG0A 3FZVA 2WA0A 5EJCA 3LNQA 4KISA 2IAIA 4IPAA 3DBHB 3JAMK 4KYWA 1A04A 1U5TB 1H8AC 1W4MA 4MLOA 1S7AA 2K4JA 2CQKA 3CUQA 4O5VA 3AKZA 3GUDA 4IZZA 4V19K 3AL0C 2JSPA 1TW3A 3F9KA 3CMAI 1IRGA 3KP6A 3RCOA 3W6JB 5JVGF 3SYTA 2QSGX 3LMMA 4R8HA 2FU4A 3A2KA 1JJ6C 1R4NB 3M8EA 2EIMH 1Z05A 5DTDA 5AIQA 1IN7A 2EWNA 1JJ8C 2EV6A 4II3A 4JYKA 2I5UA 1RNLA 1TWGJ 3NEUA 1MNDA 1LFPA 3VSKA 3WU2C 5LLQA 1ZR4A 4KT6A 4XSZF 2NXNB 2JSCA 2E5NA 4Y15A 3JRCA 2F5DA 2VQHA 2KFDA 2BVMA 1MMSA 2M3AA 4LD5A 2XF7A 3K9TA 3MKZA 2FUG2 4Z6YA 1ZG3A 1XS9A 3ECHA 3KYDB 4HLXA 1MMGA 2L4MA 4IRIA 1Y0UA 5E17F 4OINF 4XRSG 4I02A 3SEZA 3OYLA 3ZOBA 3ZQGA 1LFUP 2OTLI 4IXAA 5IP9J 5HS8A 2FD5A 5L3FA 1LFBA 1YG2A 2YUSA 3HOVJ 2LK2A 1U0JA 2H6BA 4XIDA 2FA5A 1XMAA 1D1CA 1LDKB 2XKPA 2DJIA 4RLFA 2LNBA 1ENHA 1JGSA 1FP1D 2P6SA 1IC8A 1IRZA 3CF2A 4MO7A 4C3HJ 4NUBA 3JRBA 1R7JA 1RI7A 2ZJQF 1JKQC 2G0EA 3I64A 2VBZA 1MJBA 3QOPA 5L3GA 5F1JA 1XPXA 4HX7A 3J7YJ 3ZGKA 4FASD 1WVRA 2QQAA 4ASNA 3DPLC 3QYBA 1R5ID 4ZYDA 2LBFB 3ROUA 2FMYA 1XD7A 4WXDA 1F43A 2PN6A 1LEAA 3E97A 3K4JA 3OIPA 3QPLA 4L5EA 4YELA 3WE3A 3LSPA 2K7LA 5LGTA 1MKMA 2ACJA 2O3FA 1T98A 2W4SA 3HOYJ 4IOAF 1NK2P 2K9LA 3RZDJ 2CMPA 4ZYHA 4RA2A 4UHTA 5GP9A 2X1EA 2UZKA 3ABKH 4KIBA 1L3LA 2CQXA 4OMZA 1IUYA 3BG9A 1W36D 2DOEA 3FXJA 1B9NA 2K3FA 1MDMB 2D2WA 2XF5A 2GWRA 3Q0VA 1TWHJ 4ENMA 1BJAA 1HF0A 1GLNA 4U0VA 4BUPA 4F92B 3I9V2 4RM3A 3O3KA 5KK1A 4EEFG 3BG6A 2C6YA 3HRTA 4YEJA 1W1WE 3S8PA 3VDXA 3FM5A 1MBGA 4KT5C 3HIFA 5DCMA 2GIVA 2D45A 2XPUA 3T5XA 2F5EA 1W7PB 1I3AA 2NVUB 3ZR8X 4RDUA 4HLYA 2K4BA 2QQ8A 3QYFA 1XB4A 2F5VA 1F4KA 1U8BA 5EGOA 2M34A 4KMUX 4X1EA 3EUAA 4Q5SF 5GPCA 1PP8F 1OCOH 3H92A 1K7AA 2Z1DA 1YQAA 2BHZA 3L1PA 4BDYA 1WQ2A 2ZBKA 2MGQA 3L00A 1FOWA 4HAMA 1ACIA 1XGSA 2M7AA 3E6MA 3H5RA 3CD6I 5EEAA 2JA5J 1YS7A 2AQFA 2VT2A 5F0FA 2LSOA 3VSLA 4D5CA 5FRNA 3NQOA 3J7AO 3CP2A 2LF8A 3HSRA 4QWQA 3C3WA 4B09A 5LGUA 3HOWJ 1ZRDA 5F27A 4A0XA 3IV5A 4EGYA 3SHFA 2QVOA 3LWFA 5CYVA 2CQNA 2LKSA 3S3OA 3CMEI 3S15J 2R5YB 4IJAA 2HGCA 2BV6A 4HNVA 2CW8A 2ZKZA 3C2BA 3LA2A 2ZSIB 2PMZN 3RTRA 1MBKA 1UJ8A 2QQBA 5EF6A 2DA4A 2A68F 5IY5H 2WTEA 2MD5A 3OV8A 1K79A 2WC2A 1HKTA 1RIOH 2ESNA 2V1XA 1P2FA 5K5QA 1R4MB 1Z91A 1G3TA 2OZUA 1KU3A 5L3DA 1IXRC 2L01A 3TDUC 4L0ZB 3M07A 1WH5A 4PJ0C 4PJMA 1D0XA 3G1OA 4M9ZA 2VBXA 3F0CA 2HZTA 2AHQA 2ZFWA 3K10A 1SFOJ 4O3MA 2P7VB 1D5VA 3V7CA 3I59A 2M9HA 1V55H 2MD0A 3DKYA 1FBUA 1WSUA 3EYYA 5M3MJ 1I6HJ 2DODA 3T8TA 5TISC 2ZXWH 4BQOA 3Q9VA 3BLYA 1FJLA 1QO0D 3BDDA 4AD9A 2X48A 1ZHFA 3ZRGA 2OQRA 2PJPA 4JX5A 3GF2A 1OISA 1FX7A 2M30A 3TW6A 2DTZA 3P9KA 2VKHA 3W6VA 4AYBN 4PJLA 3G2BA 5D4RA 4U7DA 2CH0A 4E7HA 4S04A 2CYYA 3DTKA 2IXSA 1BOBA 1J2XA 2P5VA 5TRDA 2X9DA 3VFZA 2Z99A 1IAWA 4XLPF 3QYEA 2JPBA 4C3JJ 5BQTA 2H1LA 1I50J 4EJVA 1IXSB 2AXTC 1A6IA 2HPMA 1WGXA 4EGZA 5CQEA 2Y31A 4RGUA 5K7ZA 3JREA 2R7SA 4M3FA 3K2AA 3RPUA 3SEQA 5C4JJ 2JMWA 2LLKA 4HYEA 1VNDA 1JGGA 2RREA 2NOGA 5D5UB 4E7LA 2CSOA 5ILVA 1R36A 1T56A 4NNJA 3HUGB 1B1BA 1JHFA 2XB5A 4DYRA 2LTPA 2OQGA 3OY9A 3KZYA 2V9KA 4A3LJ 4CCMA 4F3QA 5HODA 1NG7A 1MGTA 3FBIB 1KZHA 2E19A 2EV0A 1HBXG 1SD5A 5KAIC 1TW2A 2L54A 1FLIA 2A05A 1VF9A 5H6QA 3OMYA 4BHCA 3LAJA 3GYHX 1OLTA 2JRMA 2R3SA 1QBJA 3OYKA 3FXRA 3KEOA 3HHHA 4A6EA 4L9TA 2LYCA 3PNYA 1X19A 4C9YA 3LSTA 2VQGA 1YYVA 1G3SA 1E17A 2EIKH 5GADJ 3QU3A 1TT0A 4D7NA 1SMYF 3DTEA 3S1NJ 5GAHJ 2O0YA 1XGMA 2KRFA 2E1MB 3BJ6A 2HOTA 2XV4S 3SJMA 1OQYA 1UB9A 2DYSH 5BS6A 3G71I 1P7IA 3CC4I 1RPWA 4IL6C 3ZP5A 2PEXA 2GM4A 1RRJA 1N78A 4DGWB 1USSA 2WAQA 4CO8A 4JK1X 2XASA 4ESFA 4HBLA 2QEXI 1X2MA 1IV8A 1WRJA 3VYTB 4BQAA 3G1LA 3FK7A 3LSIA 5CVIA 4L9JA 3GZ6A 2LG4A 5KVRA 2WAQN 5DYMA 2DDBA 3OYJA 4RLQA 3BTIA 3WTWC 1T95A 1RR8C 5J40A 3KYCB 2HPIA 2IGNA 4C2UA 3M9AA 2QM3A 3GTPJ 2AQEA 1FOYA 3LQRA 4X6AJ 3PUFA 5IOZA 3CCYA 3OYFA 2QF7A 3CUQB 4MFEA 4QPQA 5BNGA 4U87A 3NRVA 3BT9A 3OYNA 1XCBA 3OL4A 3HOZJ 4A3CJ 4PFOA 3D1NI 2BY3A 3KFWX 2ZMEA 1QU3A 2XAQA 3TP3A 4BDZA 1Z9CA 2QUFA 3A0HC 1W5CC 2J5OA 4CYCA 1ETOA 4Q4ZF 1QVTA 3MWMA 2KISA 1JUMA 1X1BA 2BHYA 1AWCA 1FSHA 2Y69H 5TGTA 1REPC 4FX0A 5K5OA 3D5RC 2DOAA 3FM3A 3SZPA 2IS6A 3WTUC 2X6WA 4A3JJ 3HOUJ 4FTHA 1O57A 2L3DA 3HG9A 3S93A 1MNEA 3X2QH 2KDZA 2WWYA 2E1MC 1QRYA 2CG4A 4BY7J 2VBWA 2IP2A 3KEYA 2GQQA 4KNYA 4A3GJ 4EJTA 3K0LA 1T0FC 4DJAA 4DBRA 1OKRA 5KAFC 1IO2A 3FMSA 1OCCH 4LB6B 5HS9A 3QP6A 4I0AA 3VB2A 2NNNA 1BA5A 3GCMA 3K4KA 2K86A 4UNOA 3C1DA 1LVKA 4U0YA 2QSHX 3OYEA 2VQCA 1V5GA 3IWFA 3L2WA 2R92J 4G6DA 3AG1H 4O6JA 5FFZA 4IOCF 1R6RA 1YW9A 4M6XA 1UELB 4MFDA 1K83J 3R60A 5LRRA 4KFCA 4LITA 1OCTC 3CJTB 3DU6A 1TWCJ 2NS0A 2GOXB 4XOPA 2ME0A 1KU7A 3IH3A 2RNJA 3ECOA 5ICCA 3OYCA 5F6FA 3CUQC 1ZQ3P 4C30A 5IP7J 3CF5F 3DP7A 5FKMA 4DIQA 1YHQI 4RGRA 3F72A 3CP8A 5JHFA 3BWGA 1IN8A 5E79C 4LMYA 1VQ9I 1XCVA 4AWXB 2HVSA 3KE2A 5F1RA 3GFIA 1SVMA 4I2OA 1FC3A 1I27A 1TNTA 3R0AA 2XPWA 1RR7A 4X0GA 2EB7A 3I3LA 3I56I 3HDDA 4E7SA 3KP2A 2DPUA 2L4AA 4NHJA 1B8IB 1JKRC 3S1RJ 3OOPA 1Z7LA 1M1EB 1YI2I 1S9HA 1ZAOA 3A01A 1O3RA 1KONA 4PUSA 1D1AA 2MABA 5JLWA 1EKEA 2A07F 1LVAA 5LRSA 1ZG5A 5DCFA 2DU9A 4CICA 3LL7A 5C44J 1S7OA 5J1UA 5F0CA 5D8LB 2Y9YA 5DCMB 4IF4A 2HYGD 5LGNA 4XSXF 2F2EA 2NVTJ 3HB9A 1NK3P 2MH2A 5FD5A 3ZQQA 4CH7A 5HLHA 1XG1A 2MG4A 4DNCA 2R5ZA 3S3NA 3E6BA 3HSFA 1BI0A 5EGOB 2CW0F 1ON1A 3DQVC 1EH6A 3KP4A 1SAUA 1F1ZA 1GV5A 2NS7A 2Z33A 2UUZA 2UXNA 2W7NA 2DQLA 2L7MP 3WG9A 3N97A 3WGGA 1R49A 3CUOA 1H88C 1X1DA 1V5FA 3QPHA 1LKXA 1G3WA 2DBBA 2YU9J 3WG7H 6PAXA 4BHBA 2V9PA 3LFKA 2ZB9A 1PP7U 1O3QA 5CLSA 1VQKI 1YITI 4GGGA 2FRHA 2K85A 1S7EA 2QQ9A 2OC6A 3ABTA 2HXOA 4ESBA 3P5JA 2ZNYA 5JR3A 5JVTA 1DPUA 3ZMZA 2MLKA 3BTJA 2Y2ZA 2FE3A 3FISA 3Q0UA 5CKTA 2K02A 1QZYA 2G7HA 1QNTA 1BN5A 3QU6A 1YJNI 2JA8J 2HKOA 1R23A 3JSPA 4YFKF 1A5JA 3WHCA 4AIJA 3KLNA 2E2IJ 1MBEA 4QSHA 1JTYA 2IEKA 2ID6A 4NDLA 4P96A 5HDKA 2X85A 1UAAA 1T38A 3AFHA 3QAHA 1XDUA 5CJ9A 3GTKJ 1I39A 1W7PD 5H20A 1MH4A 2FNAA 4PSWA 4A3EJ 1ZELA 2EA2A 2PMHA 2DA5A 1H89C 4RGXA 4P55A 3IUOA 4FQGA 5EEHA 2AO9A 2EZKA 1YX3A 3I59B 3GTMJ 1OYIA 1RETA 2HOSA 2DA3A 2EZIA 3KZZA 4NC8A 5HLIA 2N8GA 4CZCA 2ADUA 3FXLA 5FB2A 1VQ8I 2IS4A 4MGRA 4FX4A 4B8XA 2QZ8A 3PFYA 4XM3A 4EV0A 1J0RA 1G2HA 4A5NA 3BR2A 4LB5A 2EFWA 1P4WA 2XGEA 1W5TA 2EFPA 1EF4A 2JJ7A 1QHHD 4EVIA 3CCEI 3BR0A 3UR3C 1BL0A 3TBIA 2QLZA 4L5IA 2CFXA 5ICFA 2IGOA 1X3WB 1EH8A 2DYRH 3HBLA 1J5YA 2WV0A 1JUSA 3PL8A 3T0YA 1Y0NA 3ESWB 1B6AA 4W97A 2R7TA 1ON2A 1VQLI 2FOKA 2HQNA 3S16J 4N9IA 1XN7A 2XPVA 2ETHA 3OSGA 4I98B 1RUNA 2KL4A 1QPIA 1OPCA 4ZDLA 2HFHA 1S72I 3H0DA 2LMDA 2P5KA 1POGA 1XMXA 1ZG1A 4IHTA 3IWZA 3ZPLA 3BR5A 3WTZA 5ED4A 1JTXA 4BS9A 2LRDA 1R22A 4BL0B 2CV0A 2VJJA 4Y3OA 4BYYA 3OYDA 1JE8A 3EQLF 5IT9Z 5L3BA 3B73A 3IH2A 3H5NA 1ETKA 1EJ9A 2KIUA 2DTRA 4C2MJ 3O6BB 3TEDA 4A0YA 2H8RA 1UCRA 1YW7A 1BIAA 2GOMA 1IUFA 1XDSA 3FMRA 4Y33A 1KQ9A 4CHUA 1S5LC 1OFCX 4ENKA 4YFNF 1FZPB 2ECCA 2L9RA 2L7ZA 4U0WA 2V1NA 5FFXA 4FE7A 1GHCA 3IRRA 5LEJA 5J6XA 3LAPA 5IT9K 1ZYRF 1ODDA 2K9SA 2M8EA 3G4SI 4UUVA 1WI3A 1SAXA 3I55I 1D3YA 5H2FC 2BGCA 2BEOA 1IDYA 1R00A 2F4MB 3AG2H 3CCRI 1JXSA 5DUIA 3RDIA 3HRUA 4IQJA 1BI3A 5FLMJ 1OR7C 3PNTA 1JUPA 3WGHA 3C18A 2PX9A 2M0MA 1AOYA 2O61A 3R0JA 1HDPA 3A4CA 3FDYA 3GMEA 4XRMA 3JRFA 3K4MA 3OIQA 4AC0A 2JVGA 3BCAA 1X3UA 1F36A 4F93B 3CMYA 2DCEA 3GLLA 3RKWA 2BY0A 4BNCA 1JT0A 2Q1ZB 2EILH 1BW6A 2M7BA 3H36A 2V26A 3IKVA 3PQKA 2KHMA 4UUTA 4D7MA 3WTSC 1FTZA 4GCVA 2FNPA 4YG2F 5FLXZ 2Y9ZA 1B59A 2W24A 2EA4A 1N75A 2DT6A 4HSRA 4LJZF 2FBIA 4OU0A 2L9SA 4AIHA 2A5WA 4I6ZA 3PNVA 3FHNA 3O8GA 3IP4B 1AA7A 2M45A 4PJJA 5CVRA 1Z6TA 2AXLA 2AS5F 3WE2A 1CGPA 4A3KJ 4J01A 3IL2A 4XQFA 2MC4A 3D5LA 3FXUA 1V5EA 2XAJA 1LQ1A 1OJLA 1Z6RA 3E5XA 3JSOA 5FLXK 2WB1A 1TZLA 4IO9F 3L7WA 4A3MJ 1E3PA 4E70A 3CCQI 3SXYA 4B3XA 4HQEA 4Y17A 2VUMJ 1AU7A 5DM6F 4E7IA 1HW2A 2ZMEB 3J80Z 3KP5A 1Q1VA 3GWZA 1TBXA 4ZJZA 3TL4X 4EMSA 2O7OA 5D5XB 4CCOA 1VFCA 4KITB 2DA1A 4CYCB 2WB1N 1FBSA 4IHSA 4I09A 4NC7A 1QHGA 2DT5A 4ZTFA 1BR1A 2IS2A 2FJ1A 1ITYA 2JRTA 1SD4A 3WTXC 2STWA 1FBQA 1P92A 2O5RA 5B66C 3MVPA 1ZREA 3OYAA 1R9TJ 2Y48A 2JUGA 3BY6A 5HNFA 1P7JA 4A3DJ 2STTA 2QA4I 3J80K 2BW3B 3R6SA 3F23A 5E8GA 2G7UA 1J09A 3OWTA 5FKKA 4AUXA 2PMZA 1DU6A 3CCVI 2CQQA 3LSJA 4N9HA 2Y75A 2FSWA 2BE5F 3KP7A 4ANJA 3DCFA 4B4CA 5HLGA 2R7WA 5FO5A 4B47A 1PUFA 2M1BA 3H9JA 4R1HA 5DV5A 1OCPA 4HX4A 4BBRJ 1Y39A 3BTLA 2KDOA 1APLC 4JX4A 4QLCU 2GA1A 3J81Z 1TC3C 4LLLA 3ERED 1E0EA 1ZLJA 5IT3A 2EZLA 1LB2A 3WODF 3CLQA 3QRFF 1UMQA 4BJ6C 3OIOA 3IAM2 4E6KG 1LE8A 2XAGA 3H5AA 4YRVA 4I7HA 2XSJC 3MCZA 3CMMA 2XAFA 5EZGA 3U21A 2CUZA 2YX4A 1JKPC 3B6CA 4Y7NJ 2YS9A 4MNUA 1FT9A 3I71A 4B1RA 2ISZA 2NVYJ 4MTDA 1UFMA 2W25A 2WAEA 3S2WA 2OPTA 3J81K 2L5QA 2ZMEC 2ZO4A 1E3OC 4PDKA 1RC9A 4IEJA 1HW1A 2BOLA 3ZQFA 5JI6A 5FRMA 2OV7A 3QPSA 1LDDA 3G3ZA 3S32A 1TT5B 2MFZA 1E3HA 4CYDA 3E5UA 5LHGA 2M8GX 2HOAA 1O7LA 4RM2A 3OL3A 4RAYA 2NOJB 1S6LA 1N77A 1B72A 4AYBA 1N25A 3K4BA 2XHKA 1OCRH 4M3EA 2GXAA 2EV5A 4LIUA 1OR7A 1HSJA 1Y56A 2RDPA 3K4CA 5DS9A 2M0CA 2XKOA 1TP4A 1JT6A 1USTA 4IHWA 2W57A 3F8NA 3S14J 2K9NA 1IF1A 3CO7C 3DKWA 3DLLF 4IHYA 4JP0A 3A01B 2F4IA 1YE9A 3MKYB 3DF8A 3A1YA 4GDFA 4HZFA 1VQ4I 2F5CA 3FXOA 4U7BA 5LBQA 2TRTA 5H6RA 3I4MJ 2HDDA 2JWTA 2VJ4A 5EYRA 2P4WA 4CA0A 5IYBJ 1V3FA 2CUFA 2VASA 2NYXA 2KZGA 1P6RA 3MD2A 1D0YA 1KGSA 3P7NA 4DQ2A 1K4SA 4LG0A 3GW2A 2R5ZB 4LOCA 1TLHB 1U5TA 5B1BH 1T6SA 4JQFA 4JX6A 2KKOA 2LY1A 3FF5A 4HG2A 2BXZA 5IPAA 3QP5A 2BY2A 3F8FA 1LUJB 1XC5A 2VL8A 4UY8I 2BBYA 1HKSA 3MMYB 1P9QC 3FK6A 4G7OF 5B5EC 3HC7A 2UV1A 1TL8A 3P9CA 4HQMA 2CS3A 4G6TB 4GO1A 3JRAA 2PQ8A 3FKIJ 2Q0OA 3FWEA 2A69F 1XSDA 2F4OB 1WZ2A 4AVPA 3F3XA 2G9WA 2RAEA 2QKMB 2ECBA 2MBFA 3CDIA 3U1DA 4XLEA 1E2XA 3LFUA 1YTYA 3S2HJ 3K70D 2GXBA 3TKYA 2L2OA 4MIMA 3CQZJ 2CW7A 2QENA 2WBMA 4PZJA 2H8WA 1PDNC 3OYMA 3IAS2 4ZC3A 3ZQCA 1X2NA 3L2UA 2DPDA 3BG3A 2DFIA 3SZGA 1IZ1A 1T39A 2X0LA 1RKWA 2EFNA 1Y1VJ 2VE8A 2LH9A 1YJWI 4RAFA 3S1MJ 2CFOA 4G7ZF 4I0BA 2PG4A 3KCCA 2CUEA 1FMWA 4HV6A 1HDDC 2QCOA 1VQPI 4RAZA 2E60A 3IHUA 4OIPF 5FGMA 3PQJA 4OOIA 4KMFA 2XAUA 3RKXA 4WWCA 3ONQA 2L9NA 2XRNA 3L9FA 4FCYA 2PI0A 4XR6A 4XKWA 1D1BA 2VKVA 4XN0A 2BZTA 2X6OA 1MMNA 3LOCA 3L2QA 5K5RA 1IN6A 1MBFA 4RB0A 2MA3A 3F8CA 1QVUA 3ZMSA 4MQVA 3GVAA 3TO7A 2R7FA 4DYQA 3KPHA 2OU2A 3CLOA 1L0OC 1MDMA 2BXYA 2JZYA 2L0KA 4MQ9F 2CGPA 5KNLA 2XDVA 4A3FJ 4DZJA 2WAFA 2F5FA 4LK0F 2OCCH 1DP7P 2RVCA 2PJRA 1UHMA 3Q5FA 1YW8A 2UXXA 3H0GJ 4XBFA 4J19A 1Y1WJ 2LDUA 2QSFX 1W36C 1WJCA 2P8TA 1H9GA 3CCUI 2JA7J 1J9IA 3VYRB 1QPMA 2CWEA 3EPZA 3TGNA 3E0JB 1T2KA 2FMLA 3OS0A 3E5QA 3I53A 2DFEA 3BOQA 5BMZA 1CF7A 1Y6IA 3CESA 1FIPA 2DO7A 3CJQB 2OAZA 4HRIA 2QYOA 3ULQB 4PK4A 4RB2C 3HZJA 3V8LA 3ZMDA 4ETSA 3GTQJ 2OZ6A 4RMNA 5FKNA 2ZXHA 5LEKA 2QWWA 2LFBA 4A3BJ 2HU9A 2LF7A 4L9NA 1PJRA 3WGIA 3E1SA 2V6EA 2NS8A 2ELKA 3R61A 1D8KA 3GEZA 2DK8A 2RV8A 2ZC2A 2A61A 1U78A 1LEBA 2KRHA 2KRCA 2ME6A 2RNGA 5E1XA 5ICGA 2P81A 3M1CA 3E6CC 4XLFA 3O8HA 2CO5A 2KPMA 3SZTA 4UV9A 1MD0A 3OR2C 2RKHA 4FISA 2FEZA 4KIFA 1VQ5I 3RQ4A 4XLHA 3RPUD 1ETWA 4UUSA 3BG7A 2F48A 5HVQC 2LVSA 3TP0A 3F22A 5L3CA 2PFBA 3SDBA 4UV8A 2B0LA 3LSGA 5E3MA 5E3OA 2ZXIA 4FT8A 4H4KC 4UXNA 2KLOA 4E7JA 3K1NA 3GBGA 4EATA 4OAZA 1UHSA 4XORA 2LC2A 1X1AA 5J1RA 3OYIA 3HOSA 2QKLB 3ISPA 3BG5A 5J8FA 3FHZA 2HKXA 3ABUA 4L0YB 1WPKA 2ZXJA 2ZSHB 3I54A 5CVJA 4F55A 4IQ4A 4N4NB 1X1CA 2MYSA 2XB0X 4ENJA 3RZOJ 2B9SA 1K78A 1WJEA 4OIOF 4XOTA 2OD5A 2DAOA 4NC6A 3OYHA 1NTCA 3W2WA 2VB6A 5K7HA 1J7KA 1U8RA 4RBOA 4M73A 4CSWA 2HQ5A 1FY7A 3N05A 1K6YA 2FX0A 2O8KA 3EYIA 4A2UA 3HTSB 3L2VA 3I4PA 2DA6A 3L2CA 4G9YA 3FXQA 2LKXA 2YR2A 4XKBA 2DW4A 2Z5UA 2K5CA 3ABMH 2VOPA 2HTJA 3GTLJ 1ONVA 3B6AA 4KUMA 3J7ZI 2RN7A 5M5XJ 4W1UA 1ULYA 1YIOA 4KIGA 1IN4A 1RKTA 5FD6A 1GDTA 2ZCWA 4IHVA 1GV2A 4KDPA 4P9FA 1BJZA 3DLAA 2NAZA 5M3FJ 2JTVA 3M3YJ 1DU0A 2HQRA 2HXIA 3PO3J 3LQQA 1ORKA 4AU7A 3GXOA 2RQQA 2KIMA 2DJNA 4JOMA 1SVLA 3JCUC 4KN7X 2XVCA 4LK1F 5HOOA 2V1UA 1X4OA 1HSTA 1H0MA 3DU5A 3BTCA 2VT3A 2DA7A 2HVQA 5EG0A 3QWLA 1BBYA 3K7AJ 2R7ZJ 3JR9A 2DMTA 4E7ZA 3K6GA 4BAYA 2MLGA 1PUFB 2E7WA 1KU2A 5JLXA 1HLVA 3ZQLA 3HPHA 3MZ8A 5JHUA 3BZCA 3VPRA 2XUBA 1FYLA 1I6XA 1LPQA 2M2EA 3F8MA 2R7VA 2A6HF 3VYSB 1R58A 2J5PA 1J59A 3F6OA 5IP6A 1STZA 3MZHA 1LE8B 2HTSA 2XGXA 3G1MA 1BIBA 4A12A 4FE4A 3GLXA 1ZGJA 4S0HB 1DGRM 2RQPA 3BJOA 5DM7F 1U2WA 2R93J 3DEWA 2EK5A 4ZTJA 2NNYA 1YOVB 2PLYA 1SFEA 2KMUA 2TCTA 3JRDA 2BYVE 4GYGA 1EH7A 1Y8QB 1NH3A 1Z77A 2FQ4A 3WU0A 4LG3A 5ICEA 3FXKA 4FETA 1HW5A 2PMUA 2HR3A 1QGPA 2A5YB 2W48A 4II2A 2VKEA 4IRGA 1FOXA 1DUXC 2VXZA 2DT7B 2I10A 2Y0SA 1B72B 5F08A 1FYMA 1RZ4A 4V2FA 1WFXA 3CDHA 5K1YA 2FBKA 3BZ6A 3TW7A 3FIWA 3A03A 3JAMZ 2O03A 3F6VA 1IW7F 5J47A 4M6VA 2R7XA 1Z21A 2Y0SN 4XKCA 1X4PA 2O8XA 3QOEA 4HNUA 1IN5A 4MEXF 4CCLA 1LNWA 4OAYA 2HYJA 2O9LA 3HSEA 3KX2A 4FHTA 1BOAA 3VYUB 3BR6A 1V54H 2CJJA 1HOMA 2WV1A 3GFMA 3TQNA 3HOTA 3IC7A 2ZJ2A 1FSEA 4LG0B 3BP8A 2NVXJ 4EJWA 2R4GA 1VQOI 2A6TA 3H3VK 5HDGA 3GZNB 5D5VB 2IGMA 3W6KB 3HM5A 2CV2A 4BY1J 5J4VA 3H35A 1YLFA 1XGNA 2R7OA 3ASOH 5TJJA 4V2GA 4Y4RA 4LLNA 2DQRA 3R4KA 4IRHA 2E7XA 3ZMTA 4HNTA 2VPLA 5BPIA 3ZN0A 2DMNA 2X4HA 1WWXA 3MKLA 2VBYA 4HX8A 5J3LA 1WCMJ 3ABLH 2OUMA 5K7FA 1FYKA 2V79A 2Z16A 1X1PA 5LFAA 2H1KA 2HS5A 4BACA 5DD8A 1D5YA 1MSFC 2L02A 1G8XA 4XKVA 3BROA 1OYYA 2KZVA 4RAGA 3EUHC 4XICA 2GXGA 2IA0A 2LREA 1ZGAA 1AKHA 2JPCA 1FP2A 2HVRA 4CUGA 4XLAA 2OBPA 4M72A 3V8KA 4C3IJ 4N0BA 4ON0A 2VI6A 3AAFA 2ID3A 2VC0A 1R1TA 4BH9A 1G59A 1O4XA 1MMDA 1WJAA 2H09A 1D8JA 4XONA 3C2GA 1I1GA 2M4GA 1NG6A 1BC8C 3H9GA 4Q47A 2P5LC 1JI8A 1TWAJ 3RKYA 4N4OB 2LP0A 5M5YJ 1WJFA 3KLOA 2Q2EA 4XLNF 2EFOA 2D1HA 2R7RA 4ZH4F 3OOUA 1BW5A 3HPGA 2EFQA 4PJNA 1U9OA 1O3SA 4GYIA 1IGNA 2ZJPF 3C7JA 2LOOA 1U5TC 2VOOA 3LA7A 3DWLE 3L09A 2LR8A 4EM1A 4CXFA 3F21A 3U9GA 4A5MA 1KYZA 3CJRB 3DBRB 4RB3C 3W3CA 1ETVA 2DMQA 2VXDA 5GAGJ 4M3BA 1W0UA 2DN0A 4HF1A 3SFZA 4WF2A 4M6YA 2EBIA 3M8JA 2DXIA 1SFUA 1YRNA 3ZQHA 2M4KA 3KIOA 1TQIA 3G73A 3PIOF 2H27A 3QODA 4CCKA 2VLAA 1ETQA 3BR3A 3HKZA 1ZTRA 2EQRA 3KYLA 1SD7A 3D5SC 3V4GA 2WADA 1B8IA 3GFLA 5E20A 3TOBA 1QA6A 4QIWN 2VODA 2BY1A 2DA2A 5HS7A 4BHPA 3HKZN 2PJRB 3T1BA 2E5ZA 2P6TA 4IVNA 2X6XA 4CDGA 2V7FA 1T33A 3ZMUA 4A3IJ 1IV6A 2DFFA 1MH3A 1GVDA 3GFJA 5JFRA 4XRSA 2FQ3A 2VJIA 3NAUA 2FF4A 2K9QA 2IA1A 3VWBA 2MC3A 1NHAA 3GX4X 1MMAA 3ASNH 3QPTA 1IRXA 1SD6A 3EDPA 5IOYA 1SFKA 2V6CA 3VODA 1CF7B 3ML6A 2DI3A 2B7EA 2DFHA 4P5OA 3IH4A 3SDGA 1I3QJ 4MHGA 4A93J 4Y13A 4YIFA 3FBNB 3LSHA 4DW6A 1BI1A 3K1PA 2D1VA 4XMYA 4BE1A 2X51A 1ERDA 5GTHC 3BQYA 2GA2A 4J00A 1JHHA 4GRIA 1UZCA 1P4AA 2ZJRF 2HOEA 1S8NA 4EJUA 2XC7A 1YO5C 4IKFA 3I4NJ 2HDWA 3VOEA 2K40A 2K27A 1X3ZB 3C2HA 4GFBA 3H9QA 4I99C 1MJAA 5ILSA 2IVMA 2L9VA 2XSDC 4BQNA 4NQWA 4ZYAA 3BJAA 3O2PE 4RS8A 5FJ8J 3JRIA 5F04A 4EQQA 2OJED 4QPOA 3BR1A 2GIZA 4B3AA 2OCEA 3WTTC 2KT0A 3DXJF 4F91B 5FROA 4ZDPA 2UWMA 1SEUA 4UUSB 1FWZA 1SMTA 2FOWA 4XRFA 3ZQIA 4ESJA 2RGVA 2ISYA 4LLGF 1MBHA 2GAUA 1EA3A 4PGGA 2MH9A 2ELJA 3WTVC 2YU3A 3HTUA 2D5VA 1I5ZA 1MNMC 1WJ5A 3SFIA 3EUHA 2L7KA 3AG3H 1Z67A 4HPQA 1XSVA 1GT0C 1T8IA 4XL9A 4IX7A 1BR4A 2X1DA 3M1EA 3B02A 4BEHA 4KICA 5J8CA 1ZRCA 2W00A 1OCZH 2Y0MA 4LFUA 1TQPA 3KETA 1U3EM 3RI4A 5DEQA 1YJ9I 3H3UA 1OYWA 5EEGA 2JA6J 1K78B 3K4LA 1ZK8A 3J7AY 2E2JJ 4M74A 1MW7A 3TO9A 1DP3A 2Y30A 3RQIA 4P1WA 2XGDA 1Z0XA 3FKJA 4D5FA 2QBYA 1IG7A 4AVZA 3GO5A 4B43A 4I76A 3DEUA 1YX5A 4EM0B 3TMOA 1IJWC 5C4XJ 3ERMA 1RESA 1GXQA 1I1SA 2DLLA 4PCQA 5GPAA 1SVOA 2KQRA 1GUUA 3MZYA 5FKOA 2DOFA 3JW4A 1MIJA 4P9UA 4E4HA 5GAEJ 1PUEE 3CO6C 3JRHA 2MSYA 3IRQA 3V42A 2KP6A 1VI0A 2FXAA 3NARA 1O7FA 4WK8F 5B3SH 4LGWA 3BQZA 3QQAA 4TV7A 1P4XA 3S17J 2I8DA 3OS1A 2COMA 5BOXA 4DZPA 2L7FP 4YFXF 1B9MA 3ZN1A 4BJTA 4KJZA 4HF2A 1FOKA 1MBJA 4M3GA 1S3JA 3KP3A 1JKOC 5EG0B 5HNHA 5B1AH 3S1QJ 2ELHA 3SQNA 3MQ0A 1FTTA 1YFHA 2GZWA 5IYDJ 3A02A 4R79A 4M3DA 1ZN2A 3U1KA 3HL2A 1ZARA 4YIRX 2YSRA 2BVLA 5D4SA 1ETYA 4AM3A 4ZZDA 2KIQA 3D0SA 3BZKA 2V9VA 4C2TA 2F6CA 5AIPA 4HEA2 3HEFA 4D9JA 2EH3A 2XF6A 2JT1A 4DYCA 3CC2I 1S29A 2XIGA 1HQCA 3HJEA 2CRGA 4XLCA 1B4AA 3ZQ7A 2JK3A 3PJRA 4QTRA 3CCLI 3CJNA 3CCSI 2HDCA 3KEQA 3CTAA 2HYFA 1G4DA 5CQGA 2E1OA 2M87A 4WXCA 4XN3A 2KIFA 4BGDA 1W5SA 1MZBA 1XX5A 1Q1HA 3V7SA 3TDZC 4B44A 4NBQA 4DOZA 4RGSA 2DMPA 2EIJH 3RYRA 3JTHA 3H3ZA 3OYGA 1U6GA 1VQ7I 1KQ0A 2H94A 3RJPA 5IYCJ 1WHUA 2VC1A 3RSNA 5HDNA 5EZHA 4M71A 4HDVA 2LBFA 3FXMA 2R7UA 3MAJA 1ZLKA 1Z3XA 3ZMVA 2Z2SB 2JN6A 3U2RA 1XSXA 4HSTA 3GZ5A 4CZZA 1Y8RB 1KU9A 2VQLA 3CZ6A 4OWRB 4Q48A 1FPQA 5E18F 3EUKL 5E1ZB 4MEYF 2IBDA 3BC8A 3G6EI 4BJ5C 1TQMA 2H6CA 2R7DA 1F9NA 1AHDP 3I5UA 2HWVA 3ELKA 2HZDA 3K1MA 1R5HA 1R71A 4BE0A 5J1YA 1XGOA 1A6QA 1XTAA 2X6YA 1MJ9A 2DDAA 2ZFUA 3OYBA 1TNSA 1UHWA 5LD2C 2MW8A 1K61A 1Z1DA 1ZGWA 3S3MA 1W0TA 5A2QZ 1X58A 2W84A 3DTIA 3GTJJ 1GXPA 3LSMA 4CGZA 3DPUA 4PSXA 4OIRF 4CCJA 4UB6C 1K6OA 4XK4A 5D5WB 5E3LA 3DV8A 2E34A 4F52A 3ZXSA 2LY2A 5M5WJ 4A69C 3H1CA 1FIAA 3MN2A 2K3PA 1HA8A 2E2HJ 2HI3A 1W7PA 2OA4A 3KZIC 3E6DA 4F7ZA 3EETA 4EJOA 2IRFG 2KJBA 3PUBA 3WTYC 2IS1A 1TTYA 5E8IA 2VPRA 5A2QK 2HEOA 5DD4A 2HNHA 1ZR2A 1HKQA 1C0WA 1Z3YA 1OMIA 3WHBA 3S2DJ 2HQAA 2VJ5A 3DPTA 4UVCA 3BPVA 2M5WA 5J4YA 2W1OA 3MKWB 3Q9SA 2WY7Q 9ANTA 1A35A 1SANA 3I58A 4H0EA 1CQTA 1O3TA 2BW3A 4D1QA 3HYIA 3K4NA 5D6EA 3GTGJ 1AKHB 3PSIA 3N4MA 1ZRFA 4BXFA 3OR1C 3V7RA 4ENNA 1PYVA 1KQ8A 4HW0A 1YS6A 4EM2A 5GTIC 3HOXJ 5HLTA 1HC8A 3BCBA 2R5YA 2JQ7A 1DPRA 2X1CA 4PGHA 3DFGA 3NWSA 4KN4X 1QQIA 4BQQA 3DKXA 2W82A 3P9IA 4LIVA 2GBYA 3HGGA 2Q2EB 2LD5A 5EDNA 3E7LA 4ITVA 2R0QC 3LA3A 4BU2A 4G12A 3UNGC 1VZ0A 2XRLA 1FNNA 1KYWA 3W2AA 2IGKA 2JUCA 2P7CB 1D0ZA 4ZZLA 5CVVA 2EJRA 2Z9OA 3OSFA 2YPRA 4HA8A 1WI9A 2IJLA 2Q8KA 3V8JA 3L2RA 3CCMI 2VONA 1IDZA 3DEEA 4M9XA 3K2ZA 3PM1A 5CPRB 2A6EF 4DBQA 5E3NA 1WJDA 3AG4H 4ABZA 4BKXA 4RB1A 1YIJI 2IW5A 1A31A 1G6NA 2QGUA 4HV5A 1KA8A 3TOAA 1IXCA 2EPFA 1DDNA 5LHIA 1SC7A 1YRNB 2NVQJ 2XGCA 3FMQA 2CU7A 5DDGA 2IT0A 2JA2A 1QZZA 4E7KA 4HDUA 2FBHA 2EZHA 1U9NA 1LDJA 4U88A 1A36A 1R1UA 4L18B 4BBSJ 3RIRA 4GXOA 2XROA 1VTNC 2W85A
chains in the Genus database with same CATH topology
1E0EA 5KHDA 2OUMA 4BJ6C 3IAM2 2Z16A 3LSKA 4DGWB 4E6KG 5LFAA 2WAQA 1N78A 3H5AA 4YRVA 4BACA 2XSJC 1BR2A 3CMMA 1G8XA 3U21A 2CUZA 4XKVA 3VYTB 2KZVA 3EUHC 3LSIA 2LREA 2LG4A 2HVRA 2WAEA 4CUGA 3OYJA 4XLAA 2L5QA 4RLQA 5FRMA 2BOLA 1T95A 2HPIA 2OV7A 2IGNA 4C2UA 3S32A 2AQEA 2MFZA 4CCNA 1G59A 1MMDA 1FMVA 1WJAA 4RM2A 3OYFA 3OL3A 4J00A 4QPQA 4XONA 2V4JC 4U87A 3OYNA 3C2GA 2M4GA 2NOJB 3OL4A 1DQUA 1NG6A 1N77A 3PSFA 4PFOA 1QU3A 2R7QA 3H9GA 3HXLA 3K4BA 4AYBA 4ZDOA 2VIXA 4N4OB 4BDZA 1JI8A 1WJFA 4LIUA 1Y56A 3K4CA 2R7RA 3OOUA 4BE2A 1DGWY 1X1BA 2K9MA 3HPGA 4PJNA 5TGTA 3AL0B 3W2VA 3D5RC 2F4IA 1YE9A 2DOAA 3MKYB 2IS6A 2X6WA 3A1YA 2LOOA 2VKDA 5KCMA 4PFPA 3DWLE 4U7BA 4B48A 4NQWB 3HG9A 3S93A 1MNEA 3OS2A 2E1MC 2VJ4A 3NWTA 2CV1A 4CA0A 2VASA 3MD2A 3CJRB 1D0YA 3W3CA 1WJBA 3KEYA 2VXDA 2CUJA 1T0FC 4DJAA 4DBRA 4JQFA 4XNFA 3M8JA 2DXIA 2M4KA 2LY1A 4HG2A 3K70C 3QODA 4CCKA 2VLAA 3HKZA 3KYLA 3K4KA 2VL8A 1LVKA 3D5SC 2WADA 3OYEA 2VQCA 1V5GA 3MMYB 1P9QC 3L2WA 3HC7A 4BEHB 2UV1A 1R6RA 1UELB 2CS3A 4G6TB 2PJRB 2E5ZA 2X6XA 2V7FA 4LITA 3DU6A 2WY8Q 2GOXB 4XOPA 2QKMB 4XLEA 3LFUA 2VJIA 3OYCA 3K70D 3VWBA 2L2OA 4C30A 3ZCOA 2CW7A 2WBMA 1MMAA 3OYMA 2JVHA 3IAS2 1IRXA 4ZC3A 4DIQA 2P0WA 1SFKA 1UG0A 3CP8A 5JHFA 2WA0A 3L2UA 4KISA 3SZGA 2HVSA 4MLOA 4P5OA 3AKZA 4IZZA 3AL0C 2JSPA 3F9KA 3FBNB 2LH9A 3LSHA 3RCOA 3SYTA 3LMMA 4XMYA 4X0GA 2X51A 4BE1A 1ERDA 2CFOA 3A2KA 3I3LA 4E7SA 4GRIA 1FMWA 2XC7A 1Z7LA 4II3A 4IKFA 2HDWA 2E60A 3C2HA 1S9HA 3H9QA 1KONA 4PUSA 1MNDA 1LFPA 1D1AA 2XAUA 3VSKA 2MABA 4KT6A 4BQNA 2E5NA 3ONQA 2VQHA 2L9NA 2BVMA 4ZYAA 4XR6A 4XKWA 1D1BA 2M3AA 3LL7A 4XN0A 2XF7A 4QPOA 1MMNA 3L2QA 3MKZA 4F91B 2FUG2 5FROA 4ZDPA 3ZQQA 4CH7A 2UWMA 1MMGA 3S3NA 1EA3A 2ELJA 3DQVC 3SEZA 3OYLA 1SAUA 1WJ5A 2L7KA 2UUZA 4HPQA 2W7NA 1X1DA 1V5FA 1U0JA 1LKXA 4XL9A 4IX7A 1BR4A 1D1CA 1LDKB 2X1DA 2DJIA 4RLFA 5KNLA 2XDVA 4BEHA 3CF2A 4NUBA 2WAFA 2W00A 2PJRA 2OC6A 3ZGKA 4FASD 3DPLC 3QYBA 1W36C 1WJCA 3K4LA 5CKTA 2LBFB 3J7AY 1MW7A 1DP3A 3K4JA 3OIPA 4YELA 3VYRB 4P1WA 3EPZA 3FKJA 4AVZA 3E0JB 4B43A 3OS0A 2W4SA 1YX5A 3TMOA 1Y6IA 2X85A 1UAAA 3CESA 2K9LA 3CJQB 2KQRA 2CMPA 3AFHA 4HRIA 2X1EA 4PSWA 4PK4A 1ZELA 4E4HA 3V42A 2KP6A 4RMNA 2ZXHA 1W36D 3IUOA 2XF5A 1YX3A 2HU9A 1PJRA 3E1SA 4NC8A 2V6EA 2I8DA 4CZCA 1GLNA 4F92B 4BUPA 3OS1A 3I9V2 2IS4A 2KRHA 2KRCA 4RM3A 2RNGA 4BJTA 4KJZA 3BG6A 3PFYA 4XM3A 3M1CA 4XLFA 2KPMA 4YEJA 3S8PA 3VDXA 5HNHA 3OR2C 1QHHD 3RQ4A 4XLHA 4R79A 3RPUD 3UR3C 3BG7A 3HL2A 3TBIA 3ZR8X 3QYFA 2IGOA 5HVQC 2BVLA 2F5VA 3EUAA 3PL8A 4C2TA 2F6CA 4HEA2 3SDBA 2Z1DA 4D9JA 2R7TA 2XF6A 4BDYA 3LSGA 2M7AA 2ZXIA 3H5RA 4H4KC 2KLOA 4XLCA 4E7JA 3PJRA 2AQFA 3GBGA 4EATA 4OAZA 4XORA 3VSLA 2LC2A 5FRNA 1X1AA 2KL4A 5CQGA 3OYIA 4ZDLA 3CP2A 4XN3A 3HOSA 3H0DA 2QKLB 4BGDA 4B44A 4DOZA 2ZSHB 4F55A 4IQ4A 4N4NB 3OYGA 1X1CA 4BS9A 2MYSA 2LRDA 4BL0B 2CV0A 2VJJA 4Y3OA 3RSNA 3OYDA 3S3OA 1WJEA 4XOTA 2LBFA 2R7UA 3OYHA 1Z3XA 3W2WA 2VB6A 2Z2SB 2CW8A 3H5NA 4HSTA 2ZSIB 4CSWA 3RTRA 3N05A 1K6YA 2VQLA 3CZ6A 4OWRB 3L2VA 3EUKL 2GOMA 4Y33A 3BC8A 4XKBA 4BJ5C 2K5CA 2V1NA 2HZDA 4PJMA 1D0XA 4BE0A 3K10A 2X6YA 3DLAA 2ZFUA 3OYBA 2MD0A 3DKYA 5LD2C 3S3MA 4AU7A 4IQJA 3DTIA 2RQQA 1OR7C 3LSMA 3PNTA 4JOMA 5HOOA 2M0MA 1X4OA 3DPUA 4PSXA 4BQOA 4CCJA 3DU5A 2HVQA 4F52A 3ZXSA 3A4CA 2LY2A 3BLYA 3FDYA 3K4MA 4E7ZA 3K6GA 2K3PA 3OIQA 1HA8A 3ZRGA 2JVGA 3BCAA 4F93B 3HPHA 2DCEA 3PUBA 2IS1A 2Q1ZB 2M7BA 2V26A 2R7VA 3VYSB 2KHMA 2HNHA 2VKHA 1Z3YA 3G2BA 4PJLA 2CH0A 4E7HA 3DTKA 2HQAA 2VJ5A 3DPTA 2IXSA 1BOBA 1N75A 2DT6A 4HSRA 2W1OA 3MKWB 3QYEA 2L9SA 2WY7Q 1DGRM 2A5WA 2BW3A 4D1QA 3K4NA 3PNVA 3FHNA 3IP4B 3PSIA 1AA7A 4PJJA 4ZTJA 2HPMA 2KMUA 5CQEA 4J01A 4BXFA 4XQFA 3OR1C 2MC4A 2R7SA 1PYVA 3D5LA 1V5EA 4LG3A 3SEQA 5HLTA 4FETA 3BCBA 2RREA 4E7LA 2WB1A 1TZLA 2X1CA 4II2A 3NWSA 4NNJA 3HUGB 4B3XA 2VXZA 3OY9A 2DT7B 4E7IA 2Y0SA 4BQQA 3DKXA 2W82A 2V9KA 4LIVA 4CCMA 4F3QA 1WFXA 1NG7A 4ZJZA 3TL4X 2Q2EB 3FBIB 4CCOA 4ITVA 4KITB 4BU2A 4NC7A 1QHGA 3UNGC 3OMYA 1VZ0A 1BR1A 4ZTFA 2IS2A 3W2AA 2IGKA 1OLTA 1D0ZA 2R7XA 1Z21A 4XKCA 1X4PA 3QOEA 3OYKA 4HNUA 2O5RA 4CCLA 3OYAA 4OAYA 2JUGA 5HNFA 3L2RA 3DEEA 3KX2A 2LYCA 3PNYA 5CPRB 3VYUB 1X19A 4C9YA 4DBQA 2BW3B 2VQGA 1WJDA 1J09A 3OWTA 3HOTA 2PMZA 1TT0A 3DTEA 2R4GA 2A6TA 2E1MB 4ANJA 2IGMA 2R7WA 2CV2A 4B47A 2JA2A 3H35A 4E7KA 2R7OA 3H9JA 4Y4RA 2KDOA 4HNTA 2VPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBI A; 
#chains in the Genus database with same CATH topology
 4S05 A;  3IKT A;  3E3V A;  3RYP A;  5KHD A;  3GTO J;  5D8K B;  2TDX A;  5BPD A;  2OTJ I;  1EV7 A;  3LSK A;  5D6F A;  5DUK A;  3M4O J;  3LSR A;  3DBL B;  1BR2 A;  5F0H A;  5ERI A;  2ICW G;  1R5G A;  1Z7U A;  2LKP A;  5C3E J;  2PBI A;  1BI2 A;  4MTE A;  4M9S A;  3I0T A;  3M8F A;  5FKL A;  2LY9 A;  3HRM A;  2E1C A;  4A0Z A;  1VQM I;  2E1N A;  4G7H F;  1R1V A;  4UVB A;  2DK5 A;  3FX3 A;  3MEX A;  1TWF J;  4D0P A;  3M7G A;  4CCN A;  1FMV A;  4ZYG A;  3CC7 I;  4IHX A;  5ILU A;  2RC4 A;  2V4J C;  3Q0W A;  1DQU A;  3HUG A;  1SFX A;  3PSF A;  4G6Q A;  3PIP F;  3RKQ A;  2IPQ X;  2R7Q A;  2ZNZ A;  3HXL A;  4ZDO A;  2VIX A;  5FLV A;  3PO2 J;  3JRG A;  4JBA A;  1MSE C;  4HOB A;  4L9V A;  1FEX A;  4L5J A;  4HF0 A;  2V1D A;  2IA2 A;  2YX7 A;  1BM9 A;  5AON A;  1DGW Y;  4BE2 A;  4AID A;  4UB8 C;  2K9M A;  2VE9 A;  1ZH5 A;  4BXU A;  4WCG A;  3AL0 B;  3W2V A;  3JTG A;  1T08 B;  2GLO A;  2VKD A;  5KCM A;  4Y52 J;  1QZE A;  4PFP A;  4B48 A;  4NQW B;  3OS2 A;  1WKM A;  3NWT A;  2CV1 A;  4NB5 A;  2O6G E;  1HXD A;  4G8X A;  4WX9 A;  4AIK A;  1IRF A;  3PFI A;  4BXX J;  1WJB A;  2KJC A;  1XMK A;  3T8R A;  2CUJ A;  3HGY A;  3A0B C;  3K69 A;  1V4R A;  2EIN H;  4XNF A;  4Z2Y A;  1H9T A;  1UG2 A;  1HCR A;  1VQ6 I;  3UKG A;  3K70 C;  2A3S A;  1ETX A;  1VQN I;  1RUO A;  5CVU A;  2OF7 A;  1K4T A;  5L3E A;  1T0F A;  1WH7 A;  2DMU A;  3BPX A;  4K2E A;  2ESH A;  1ZKG A;  4KA4 A;  3RPQ A;  3CCJ I;  1J75 A;  5F64 A;  4BEH B;  2CQ7 A;  3Q3S A;  3MFK A;  2B63 J;  3CDL A;  3HRS A;  4OMY A;  5LHH A;  3REO A;  3COA C;  4ZYE A;  3F8B A;  4WXH A;  2WY8 Q;  1PVE A;  3TO6 A;  4OIQ F;  2E35 A;  3HHG A;  4A6D A;  2Z3Y A;  3VEP A;  2NRA C;  1LJ9 A;  2E71 A;  5E1W A;  1BC7 C;  1F5T A;  4UVA A;  3ZCO A;  2VN2 A;  4G94 A;  2QBY B;  2E36 A;  2JVH A;  4YII A;  2XAH A;  2P0W A;  4I01 A;  1GVJ A;  2COB A;  1G3Y A;  3WU1 B;  1UG0 A;  3FZV A;  2WA0 A;  5EJC A;  3LNQ A;  4KIS A;  2IAI A;  4IPA A;  3DBH B;  3JAM K;  4KYW A;  1A04 A;  1U5T B;  1H8A C;  1W4M A;  4MLO A;  1S7A A;  2K4J A;  2CQK A;  3CUQ A;  4O5V A;  3AKZ A;  3GUD A;  4IZZ A;  4V19 K;  3AL0 C;  2JSP A;  1TW3 A;  3F9K A;  3CMA I;  1IRG A;  3KP6 A;  3RCO A;  3W6J B;  5JVG F;  3SYT A;  2QSG X;  3LMM A;  4R8H A;  2FU4 A;  3A2K A;  1JJ6 C;  1R4N B;  3M8E A;  2EIM H;  1Z05 A;  5DTD A;  5AIQ A;  1IN7 A;  2EWN A;  1JJ8 C;  2EV6 A;  4II3 A;  4JYK A;  2I5U A;  1RNL A;  1TWG J;  3NEU A;  1MND A;  1LFP A;  3VSK A;  3WU2 C;  5LLQ A;  1ZR4 A;  4KT6 A;  4XSZ F;  2NXN B;  2JSC A;  2E5N A;  4Y15 A;  3JRC A;  2F5D A;  2VQH A;  2KFD A;  2BVM A;  1MMS A;  2M3A A;  4LD5 A;  2XF7 A;  3K9T A;  3MKZ A;  2FUG 2;  4Z6Y A;  1ZG3 A;  1XS9 A;  3ECH A;  3KYD B;  4HLX A;  1MMG A;  2L4M A;  4IRI A;  1Y0U A;  5E17 F;  4OIN F;  4XRS G;  4I02 A;  3SEZ A;  3OYL A;  3ZOB A;  3ZQG A;  1LFU P;  2OTL I;  4IXA A;  5IP9 J;  5HS8 A;  2FD5 A;  5L3F A;  1LFB A;  1YG2 A;  2YUS A;  3HOV J;  2LK2 A;  1U0J A;  2H6B A;  4XID A;  2FA5 A;  1XMA A;  1D1C A;  1LDK B;  2XKP A;  2DJI A;  4RLF A;  2LNB A;  1ENH A;  1JGS A;  1FP1 D;  2P6S A;  1IC8 A;  1IRZ A;  3CF2 A;  4MO7 A;  4C3H J;  4NUB A;  3JRB A;  1R7J A;  1RI7 A;  2ZJQ F;  1JKQ C;  2G0E A;  3I64 A;  2VBZ A;  1MJB A;  3QOP A;  5L3G A;  5F1J A;  1XPX A;  4HX7 A;  3J7Y J;  3ZGK A;  4FAS D;  1WVR A;  2QQA A;  4ASN A;  3DPL C;  3QYB A;  1R5I D;  4ZYD A;  2LBF B;  3ROU A;  2FMY A;  1XD7 A;  4WXD A;  1F43 A;  2PN6 A;  1LEA A;  3E97 A;  3K4J A;  3OIP A;  3QPL A;  4L5E A;  4YEL A;  3WE3 A;  3LSP A;  2K7L A;  5LGT A;  1MKM A;  2ACJ A;  2O3F A;  1T98 A;  2W4S A;  3HOY J;  4IOA F;  1NK2 P;  2K9L A;  3RZD J;  2CMP A;  4ZYH A;  4RA2 A;  4UHT A;  5GP9 A;  2X1E A;  2UZK A;  3ABK H;  4KIB A;  1L3L A;  2CQX A;  4OMZ A;  1IUY A;  3BG9 A;  1W36 D;  2DOE A;  3FXJ A;  1B9N A;  2K3F A;  1MDM B;  2D2W A;  2XF5 A;  2GWR A;  3Q0V A;  1TWH J;  4ENM A;  1BJA A;  1HF0 A;  1GLN A;  4U0V A;  4BUP A;  4F92 B;  3I9V 2;  4RM3 A;  3O3K A;  5KK1 A;  4EEF G;  3BG6 A;  2C6Y A;  3HRT A;  4YEJ A;  1W1W E;  3S8P A;  3VDX A;  3FM5 A;  1MBG A;  4KT5 C;  3HIF A;  5DCM A;  2GIV A;  2D45 A;  2XPU A;  3T5X A;  2F5E A;  1W7P B;  1I3A A;  2NVU B;  3ZR8 X;  4RDU A;  4HLY A;  2K4B A;  2QQ8 A;  3QYF A;  1XB4 A;  2F5V A;  1F4K A;  1U8B A;  5EGO A;  2M34 A;  4KMU X;  4X1E A;  3EUA A;  4Q5S F;  5GPC A;  1PP8 F;  1OCO H;  3H92 A;  1K7A A;  2Z1D A;  1YQA A;  2BHZ A;  3L1P A;  4BDY A;  1WQ2 A;  2ZBK A;  2MGQ A;  3L00 A;  1FOW A;  4HAM A;  1ACI A;  1XGS A;  2M7A A;  3E6M A;  3H5R A;  3CD6 I;  5EEA A;  2JA5 J;  1YS7 A;  2AQF A;  2VT2 A;  5F0F A;  2LSO A;  3VSL A;  4D5C A;  5FRN A;  3NQO A;  3J7A O;  3CP2 A;  2LF8 A;  3HSR A;  4QWQ A;  3C3W A;  4B09 A;  5LGU A;  3HOW J;  1ZRD A;  5F27 A;  4A0X A;  3IV5 A;  4EGY A;  3SHF A;  2QVO A;  3LWF A;  5CYV A;  2CQN A;  2LKS A;  3S3O A;  3CME I;  3S15 J;  2R5Y B;  4IJA A;  2HGC A;  2BV6 A;  4HNV A;  2CW8 A;  2ZKZ A;  3C2B A;  3LA2 A;  2ZSI B;  2PMZ N;  3RTR A;  1MBK A;  1UJ8 A;  2QQB A;  5EF6 A;  2DA4 A;  2A68 F;  5IY5 H;  2WTE A;  2MD5 A;  3OV8 A;  1K79 A;  2WC2 A;  1HKT A;  1RIO H;  2ESN A;  2V1X A;  1P2F A;  5K5Q A;  1R4M B;  1Z91 A;  1G3T A;  2OZU A;  1KU3 A;  5L3D A;  1IXR C;  2L01 A;  3TDU C;  4L0Z B;  3M07 A;  1WH5 A;  4PJ0 C;  4PJM A;  1D0X A;  3G1O A;  4M9Z A;  2VBX A;  3F0C A;  2HZT A;  2AHQ A;  2ZFW A;  3K10 A;  1SFO J;  4O3M A;  2P7V B;  1D5V A;  3V7C A;  3I59 A;  2M9H A;  1V55 H;  2MD0 A;  3DKY A;  1FBU A;  1WSU A;  3EYY A;  5M3M J;  1I6H J;  2DOD A;  3T8T A;  5TIS C;  2ZXW H;  4BQO A;  3Q9V A;  3BLY A;  1FJL A;  1QO0 D;  3BDD A;  4AD9 A;  2X48 A;  1ZHF A;  3ZRG A;  2OQR A;  2PJP A;  4JX5 A;  3GF2 A;  1OIS A;  1FX7 A;  2M30 A;  3TW6 A;  2DTZ A;  3P9K A;  2VKH A;  3W6V A;  4AYB N;  4PJL A;  3G2B A;  5D4R A;  4U7D A;  2CH0 A;  4E7H A;  4S04 A;  2CYY A;  3DTK A;  2IXS A;  1BOB A;  1J2X A;  2P5V A;  5TRD A;  2X9D A;  3VFZ A;  2Z99 A;  1IAW A;  4XLP F;  3QYE A;  2JPB A;  4C3J J;  5BQT A;  2H1L A;  1I50 J;  4EJV A;  1IXS B;  2AXT C;  1A6I A;  2HPM A;  1WGX A;  4EGZ A;  5CQE A;  2Y31 A;  4RGU A;  5K7Z A;  3JRE A;  2R7S A;  4M3F A;  3K2A A;  3RPU A;  3SEQ A;  5C4J J;  2JMW A;  2LLK A;  4HYE A;  1VND A;  1JGG A;  2RRE A;  2NOG A;  5D5U B;  4E7L A;  2CSO A;  5ILV A;  1R36 A;  1T56 A;  4NNJ A;  3HUG B;  1B1B A;  1JHF A;  2XB5 A;  4DYR A;  2LTP A;  2OQG A;  3OY9 A;  3KZY A;  2V9K A;  4A3L J;  4CCM A;  4F3Q A;  5HOD A;  1NG7 A;  1MGT A;  3FBI B;  1KZH A;  2E19 A;  2EV0 A;  1HBX G;  1SD5 A;  5KAI C;  1TW2 A;  2L54 A;  1FLI A;  2A05 A;  1VF9 A;  5H6Q A;  3OMY A;  4BHC A;  3LAJ A;  3GYH X;  1OLT A;  2JRM A;  2R3S A;  1QBJ A;  3OYK A;  3FXR A;  3KEO A;  3HHH A;  4A6E A;  4L9T A;  2LYC A;  3PNY A;  1X19 A;  4C9Y A;  3LST A;  2VQG A;  1YYV A;  1G3S A;  1E17 A;  2EIK H;  5GAD J;  3QU3 A;  1TT0 A;  4D7N A;  1SMY F;  3DTE A;  3S1N J;  5GAH J;  2O0Y A;  1XGM A;  2KRF A;  2E1M B;  3BJ6 A;  2HOT A;  2XV4 S;  3SJM A;  1OQY A;  1UB9 A;  2DYS H;  5BS6 A;  3G71 I;  1P7I A;  3CC4 I;  1RPW A;  4IL6 C;  3ZP5 A;  2PEX A;  2GM4 A;  1RRJ A;  1N78 A;  4DGW B;  1USS A;  2WAQ A;  4CO8 A;  4JK1 X;  2XAS A;  4ESF A;  4HBL A;  2QEX I;  1X2M A;  1IV8 A;  1WRJ A;  3VYT B;  4BQA A;  3G1L A;  3FK7 A;  3LSI A;  5CVI A;  4L9J A;  3GZ6 A;  2LG4 A;  5KVR A;  2WAQ N;  5DYM A;  2DDB A;  3OYJ A;  4RLQ A;  3BTI A;  3WTW C;  1T95 A;  1RR8 C;  5J40 A;  3KYC B;  2HPI A;  2IGN A;  4C2U A;  3M9A A;  2QM3 A;  3GTP J;  2AQE A;  1FOY A;  3LQR A;  4X6A J;  3PUF A;  5IOZ A;  3CCY A;  3OYF A;  2QF7 A;  3CUQ B;  4MFE A;  4QPQ A;  5BNG A;  4U87 A;  3NRV A;  3BT9 A;  3OYN A;  1XCB A;  3OL4 A;  3HOZ J;  4A3C J;  4PFO A;  3D1N I;  2BY3 A;  3KFW X;  2ZME A;  1QU3 A;  2XAQ A;  3TP3 A;  4BDZ A;  1Z9C A;  2QUF A;  3A0H C;  1W5C C;  2J5O A;  4CYC A;  1ETO A;  4Q4Z F;  1QVT A;  3MWM A;  2KIS A;  1JUM A;  1X1B A;  2BHY A;  1AWC A;  1FSH A;  2Y69 H;  5TGT A;  1REP C;  4FX0 A;  5K5O A;  3D5R C;  2DOA A;  3FM3 A;  3SZP A;  2IS6 A;  3WTU C;  2X6W A;  4A3J J;  3HOU J;  4FTH A;  1O57 A;  2L3D A;  3HG9 A;  3S93 A;  1MNE A;  3X2Q H;  2KDZ A;  2WWY A;  2E1M C;  1QRY A;  2CG4 A;  4BY7 J;  2VBW A;  2IP2 A;  3KEY A;  2GQQ A;  4KNY A;  4A3G J;  4EJT A;  3K0L A;  1T0F C;  4DJA A;  4DBR A;  1OKR A;  5KAF C;  1IO2 A;  3FMS A;  1OCC H;  4LB6 B;  5HS9 A;  3QP6 A;  4I0A A;  3VB2 A;  2NNN A;  1BA5 A;  3GCM A;  3K4K A;  2K86 A;  4UNO A;  3C1D A;  1LVK A;  4U0Y A;  2QSH X;  3OYE A;  2VQC A;  1V5G A;  3IWF A;  3L2W A;  2R92 J;  4G6D A;  3AG1 H;  4O6J A;  5FFZ A;  4IOC F;  1R6R A;  1YW9 A;  4M6X A;  1UEL B;  4MFD A;  1K83 J;  3R60 A;  5LRR A;  4KFC A;  4LIT A;  1OCT C;  3CJT B;  3DU6 A;  1TWC J;  2NS0 A;  2GOX B;  4XOP A;  2ME0 A;  1KU7 A;  3IH3 A;  2RNJ A;  3ECO A;  5ICC A;  3OYC A;  5F6F A;  3CUQ C;  1ZQ3 P;  4C30 A;  5IP7 J;  3CF5 F;  3DP7 A;  5FKM A;  4DIQ A;  1YHQ I;  4RGR A;  3F72 A;  3CP8 A;  5JHF A;  3BWG A;  1IN8 A;  5E79 C;  4LMY A;  1VQ9 I;  1XCV A;  4AWX B;  2HVS A;  3KE2 A;  5F1R A;  3GFI A;  1SVM A;  4I2O A;  1FC3 A;  1I27 A;  1TNT A;  3R0A A;  2XPW A;  1RR7 A;  4X0G A;  2EB7 A;  3I3L A;  3I56 I;  3HDD A;  4E7S A;  3KP2 A;  2DPU A;  2L4A A;  4NHJ A;  1B8I B;  1JKR C;  3S1R J;  3OOP A;  1Z7L A;  1M1E B;  1YI2 I;  1S9H A;  1ZAO A;  3A01 A;  1O3R A;  1KON A;  4PUS A;  1D1A A;  2MAB A;  5JLW A;  1EKE A;  2A07 F;  1LVA A;  5LRS A;  1ZG5 A;  5DCF A;  2DU9 A;  4CIC A;  3LL7 A;  5C44 J;  1S7O A;  5J1U A;  5F0C A;  5D8L B;  2Y9Y A;  5DCM B;  4IF4 A;  2HYG D;  5LGN A;  4XSX F;  2F2E A;  2NVT J;  3HB9 A;  1NK3 P;  2MH2 A;  5FD5 A;  3ZQQ A;  4CH7 A;  5HLH A;  1XG1 A;  2MG4 A;  4DNC A;  2R5Z A;  3S3N A;  3E6B A;  3HSF A;  1BI0 A;  5EGO B;  2CW0 F;  1ON1 A;  3DQV C;  1EH6 A;  3KP4 A;  1SAU A;  1F1Z A;  1GV5 A;  2NS7 A;  2Z33 A;  2UUZ A;  2UXN A;  2W7N A;  2DQL A;  2L7M P;  3WG9 A;  3N97 A;  3WGG A;  1R49 A;  3CUO A;  1H88 C;  1X1D A;  1V5F A;  3QPH A;  1LKX A;  1G3W A;  2DBB A;  2YU9 J;  3WG7 H;  6PAX A;  4BHB A;  2V9P A;  3LFK A;  2ZB9 A;  1PP7 U;  1O3Q A;  5CLS A;  1VQK I;  1YIT I;  4GGG A;  2FRH A;  2K85 A;  1S7E A;  2QQ9 A;  2OC6 A;  3ABT A;  2HXO A;  4ESB A;  3P5J A;  2ZNY A;  5JR3 A;  5JVT A;  1DPU A;  3ZMZ A;  2MLK A;  3BTJ A;  2Y2Z A;  2FE3 A;  3FIS A;  3Q0U A;  5CKT A;  2K02 A;  1QZY A;  2G7H A;  1QNT A;  1BN5 A;  3QU6 A;  1YJN I;  2JA8 J;  2HKO A;  1R23 A;  3JSP A;  4YFK F;  1A5J A;  3WHC A;  4AIJ A;  3KLN A;  2E2I J;  1MBE A;  4QSH A;  1JTY A;  2IEK A;  2ID6 A;  4NDL A;  4P96 A;  5HDK A;  2X85 A;  1UAA A;  1T38 A;  3AFH A;  3QAH A;  1XDU A;  5CJ9 A;  3GTK J;  1I39 A;  1W7P D;  5H20 A;  1MH4 A;  2FNA A;  4PSW A;  4A3E J;  1ZEL A;  2EA2 A;  2PMH A;  2DA5 A;  1H89 C;  4RGX A;  4P55 A;  3IUO A;  4FQG A;  5EEH A;  2AO9 A;  2EZK A;  1YX3 A;  3I59 B;  3GTM J;  1OYI A;  1RET A;  2HOS A;  2DA3 A;  2EZI A;  3KZZ A;  4NC8 A;  5HLI A;  2N8G A;  4CZC A;  2ADU A;  3FXL A;  5FB2 A;  1VQ8 I;  2IS4 A;  4MGR A;  4FX4 A;  4B8X A;  2QZ8 A;  3PFY A;  4XM3 A;  4EV0 A;  1J0R A;  1G2H A;  4A5N A;  3BR2 A;  4LB5 A;  2EFW A;  1P4W A;  2XGE A;  1W5T A;  2EFP A;  1EF4 A;  2JJ7 A;  1QHH D;  4EVI A;  3CCE I;  3BR0 A;  3UR3 C;  1BL0 A;  3TBI A;  2QLZ A;  4L5I A;  2CFX A;  5ICF A;  2IGO A;  1X3W B;  1EH8 A;  2DYR H;  3HBL A;  1J5Y A;  2WV0 A;  1JUS A;  3PL8 A;  3T0Y A;  1Y0N A;  3ESW B;  1B6A A;  4W97 A;  2R7T A;  1ON2 A;  1VQL I;  2FOK A;  2HQN A;  3S16 J;  4N9I A;  1XN7 A;  2XPV A;  2ETH A;  3OSG A;  4I98 B;  1RUN A;  2KL4 A;  1QPI A;  1OPC A;  4ZDL A;  2HFH A;  1S72 I;  3H0D A;  2LMD A;  2P5K A;  1POG A;  1XMX A;  1ZG1 A;  4IHT A;  3IWZ A;  3ZPL A;  3BR5 A;  3WTZ A;  5ED4 A;  1JTX A;  4BS9 A;  2LRD A;  1R22 A;  4BL0 B;  2CV0 A;  2VJJ A;  4Y3O A;  4BYY A;  3OYD A;  1JE8 A;  3EQL F;  5IT9 Z;  5L3B A;  3B73 A;  3IH2 A;  3H5N A;  1ETK A;  1EJ9 A;  2KIU A;  2DTR A;  4C2M J;  3O6B B;  3TED A;  4A0Y A;  2H8R A;  1UCR A;  1YW7 A;  1BIA A;  2GOM A;  1IUF A;  1XDS A;  3FMR A;  4Y33 A;  1KQ9 A;  4CHU A;  1S5L C;  1OFC X;  4ENK A;  4YFN F;  1FZP B;  2ECC A;  2L9R A;  2L7Z A;  4U0W A;  2V1N A;  5FFX A;  4FE7 A;  1GHC A;  3IRR A;  5LEJ A;  5J6X A;  3LAP A;  5IT9 K;  1ZYR F;  1ODD A;  2K9S A;  2M8E A;  3G4S I;  4UUV A;  1WI3 A;  1SAX A;  3I55 I;  1D3Y A;  5H2F C;  2BGC A;  2BEO A;  1IDY A;  1R00 A;  2F4M B;  3AG2 H;  3CCR I;  1JXS A;  5DUI A;  3RDI A;  3HRU A;  4IQJ A;  1BI3 A;  5FLM J;  1OR7 C;  3PNT A;  1JUP A;  3WGH A;  3C18 A;  2PX9 A;  2M0M A;  1AOY A;  2O61 A;  3R0J A;  1HDP A;  3A4C A;  3FDY A;  3GME A;  4XRM A;  3JRF A;  3K4M A;  3OIQ A;  4AC0 A;  2JVG A;  3BCA A;  1X3U A;  1F36 A;  4F93 B;  3CMY A;  2DCE A;  3GLL A;  3RKW A;  2BY0 A;  4BNC A;  1JT0 A;  2Q1Z B;  2EIL H;  1BW6 A;  2M7B A;  3H36 A;  2V26 A;  3IKV A;  3PQK A;  2KHM A;  4UUT A;  4D7M A;  3WTS C;  1FTZ A;  4GCV A;  2FNP A;  4YG2 F;  5FLX Z;  2Y9Z A;  1B59 A;  2W24 A;  2EA4 A;  1N75 A;  2DT6 A;  4HSR A;  4LJZ F;  2FBI A;  4OU0 A;  2L9S A;  4AIH A;  2A5W A;  4I6Z A;  3PNV A;  3FHN A;  3O8G A;  3IP4 B;  1AA7 A;  2M45 A;  4PJJ A;  5CVR A;  1Z6T A;  2AXL A;  2AS5 F;  3WE2 A;  1CGP A;  4A3K J;  4J01 A;  3IL2 A;  4XQF A;  2MC4 A;  3D5L A;  3FXU A;  1V5E A;  2XAJ A;  1LQ1 A;  1OJL A;  1Z6R A;  3E5X A;  3JSO A;  5FLX K;  2WB1 A;  1TZL A;  4IO9 F;  3L7W A;  4A3M J;  1E3P A;  4E70 A;  3CCQ I;  3SXY A;  4B3X A;  4HQE A;  4Y17 A;  2VUM J;  1AU7 A;  5DM6 F;  4E7I A;  1HW2 A;  2ZME B;  3J80 Z;  3KP5 A;  1Q1V A;  3GWZ A;  1TBX A;  4ZJZ A;  3TL4 X;  4EMS A;  2O7O A;  5D5X B;  4CCO A;  1VFC A;  4KIT B;  2DA1 A;  4CYC B;  2WB1 N;  1FBS A;  4IHS A;  4I09 A;  4NC7 A;  1QHG A;  2DT5 A;  4ZTF A;  1BR1 A;  2IS2 A;  2FJ1 A;  1ITY A;  2JRT A;  1SD4 A;  3WTX C;  2STW A;  1FBQ A;  1P92 A;  2O5R A;  5B66 C;  3MVP A;  1ZRE A;  3OYA A;  1R9T J;  2Y48 A;  2JUG A;  3BY6 A;  5HNF A;  1P7J A;  4A3D J;  2STT A;  2QA4 I;  3J80 K;  2BW3 B;  3R6S A;  3F23 A;  5E8G A;  2G7U A;  1J09 A;  3OWT A;  5FKK A;  4AUX A;  2PMZ A;  1DU6 A;  3CCV I;  2CQQ A;  3LSJ A;  4N9H A;  2Y75 A;  2FSW A;  2BE5 F;  3KP7 A;  4ANJ A;  3DCF A;  4B4C A;  5HLG A;  2R7W A;  5FO5 A;  4B47 A;  1PUF A;  2M1B A;  3H9J A;  4R1H A;  5DV5 A;  1OCP A;  4HX4 A;  4BBR J;  1Y39 A;  3BTL A;  2KDO A;  1APL C;  4JX4 A;  4QLC U;  2GA1 A;  3J81 Z;  1TC3 C;  4LLL A;  3ERE D;  1E0E A;  1ZLJ A;  5IT3 A;  2EZL A;  1LB2 A;  3WOD F;  3CLQ A;  3QRF F;  1UMQ A;  4BJ6 C;  3OIO A;  3IAM 2;  4E6K G;  1LE8 A;  2XAG A;  3H5A A;  4YRV A;  4I7H A;  2XSJ C;  3MCZ A;  3CMM A;  2XAF A;  5EZG A;  3U21 A;  2CUZ A;  2YX4 A;  1JKP C;  3B6C A;  4Y7N J;  2YS9 A;  4MNU A;  1FT9 A;  3I71 A;  4B1R A;  2ISZ A;  2NVY J;  4MTD A;  1UFM A;  2W25 A;  2WAE A;  3S2W A;  2OPT A;  3J81 K;  2L5Q A;  2ZME C;  2ZO4 A;  1E3O C;  4PDK A;  1RC9 A;  4IEJ A;  1HW1 A;  2BOL A;  3ZQF A;  5JI6 A;  5FRM A;  2OV7 A;  3QPS A;  1LDD A;  3G3Z A;  3S32 A;  1TT5 B;  2MFZ A;  1E3H A;  4CYD A;  3E5U A;  5LHG A;  2M8G X;  2HOA A;  1O7L A;  4RM2 A;  3OL3 A;  4RAY A;  2NOJ B;  1S6L A;  1N77 A;  1B72 A;  4AYB A;  1N25 A;  3K4B A;  2XHK A;  1OCR H;  4M3E A;  2GXA A;  2EV5 A;  4LIU A;  1OR7 A;  1HSJ A;  1Y56 A;  2RDP A;  3K4C A;  5DS9 A;  2M0C A;  2XKO A;  1TP4 A;  1JT6 A;  1UST A;  4IHW A;  2W57 A;  3F8N A;  3S14 J;  2K9N A;  1IF1 A;  3CO7 C;  3DKW A;  3DLL F;  4IHY A;  4JP0 A;  3A01 B;  2F4I A;  1YE9 A;  3MKY B;  3DF8 A;  3A1Y A;  4GDF A;  4HZF A;  1VQ4 I;  2F5C A;  3FXO A;  4U7B A;  5LBQ A;  2TRT A;  5H6R A;  3I4M J;  2HDD A;  2JWT A;  2VJ4 A;  5EYR A;  2P4W A;  4CA0 A;  5IYB J;  1V3F A;  2CUF A;  2VAS A;  2NYX A;  2KZG A;  1P6R A;  3MD2 A;  1D0Y A;  1KGS A;  3P7N A;  4DQ2 A;  1K4S A;  4LG0 A;  3GW2 A;  2R5Z B;  4LOC A;  1TLH B;  1U5T A;  5B1B H;  1T6S A;  4JQF A;  4JX6 A;  2KKO A;  2LY1 A;  3FF5 A;  4HG2 A;  2BXZ A;  5IPA A;  3QP5 A;  2BY2 A;  3F8F A;  1LUJ B;  1XC5 A;  2VL8 A;  4UY8 I;  2BBY A;  1HKS A;  3MMY B;  1P9Q C;  3FK6 A;  4G7O F;  5B5E C;  3HC7 A;  2UV1 A;  1TL8 A;  3P9C A;  4HQM A;  2CS3 A;  4G6T B;  4GO1 A;  3JRA A;  2PQ8 A;  3FKI J;  2Q0O A;  3FWE A;  2A69 F;  1XSD A;  2F4O B;  1WZ2 A;  4AVP A;  3F3X A;  2G9W A;  2RAE A;  2QKM B;  2ECB A;  2MBF A;  3CDI A;  3U1D A;  4XLE A;  1E2X A;  3LFU A;  1YTY A;  3S2H J;  3K70 D;  2GXB A;  3TKY A;  2L2O A;  4MIM A;  3CQZ J;  2CW7 A;  2QEN A;  2WBM A;  4PZJ A;  2H8W A;  1PDN C;  3OYM A;  3IAS 2;  4ZC3 A;  3ZQC A;  1X2N A;  3L2U A;  2DPD A;  3BG3 A;  2DFI A;  3SZG A;  1IZ1 A;  1T39 A;  2X0L A;  1RKW A;  2EFN A;  1Y1V J;  2VE8 A;  2LH9 A;  1YJW I;  4RAF A;  3S1M J;  2CFO A;  4G7Z F;  4I0B A;  2PG4 A;  3KCC A;  2CUE A;  1FMW A;  4HV6 A;  1HDD C;  2QCO A;  1VQP I;  4RAZ A;  2E60 A;  3IHU A;  4OIP F;  5FGM A;  3PQJ A;  4OOI A;  4KMF A;  2XAU A;  3RKX A;  4WWC A;  3ONQ A;  2L9N A;  2XRN A;  3L9F A;  4FCY A;  2PI0 A;  4XR6 A;  4XKW A;  1D1B A;  2VKV A;  4XN0 A;  2BZT A;  2X6O A;  1MMN A;  3LOC A;  3L2Q A;  5K5R A;  1IN6 A;  1MBF A;  4RB0 A;  2MA3 A;  3F8C A;  1QVU A;  3ZMS A;  4MQV A;  3GVA A;  3TO7 A;  2R7F A;  4DYQ A;  3KPH A;  2OU2 A;  3CLO A;  1L0O C;  1MDM A;  2BXY A;  2JZY A;  2L0K A;  4MQ9 F;  2CGP A;  5KNL A;  2XDV A;  4A3F J;  4DZJ A;  2WAF A;  2F5F A;  4LK0 F;  2OCC H;  1DP7 P;  2RVC A;  2PJR A;  1UHM A;  3Q5F A;  1YW8 A;  2UXX A;  3H0G J;  4XBF A;  4J19 A;  1Y1W J;  2LDU A;  2QSF X;  1W36 C;  1WJC A;  2P8T A;  1H9G A;  3CCU I;  2JA7 J;  1J9I A;  3VYR B;  1QPM A;  2CWE A;  3EPZ A;  3TGN A;  3E0J B;  1T2K A;  2FML A;  3OS0 A;  3E5Q A;  3I53 A;  2DFE A;  3BOQ A;  5BMZ A;  1CF7 A;  1Y6I A;  3CES A;  1FIP A;  2DO7 A;  3CJQ B;  2OAZ A;  4HRI A;  2QYO A;  3ULQ B;  4PK4 A;  4RB2 C;  3HZJ A;  3V8L A;  3ZMD A;  4ETS A;  3GTQ J;  2OZ6 A;  4RMN A;  5FKN A;  2ZXH A;  5LEK A;  2QWW A;  2LFB A;  4A3B J;  2HU9 A;  2LF7 A;  4L9N A;  1PJR A;  3WGI A;  3E1S A;  2V6E A;  2NS8 A;  2ELK A;  3R61 A;  1D8K A;  3GEZ A;  2DK8 A;  2RV8 A;  2ZC2 A;  2A61 A;  1U78 A;  1LEB A;  2KRH A;  2KRC A;  2ME6 A;  2RNG A;  5E1X A;  5ICG A;  2P81 A;  3M1C A;  3E6C C;  4XLF A;  3O8H A;  2CO5 A;  2KPM A;  3SZT A;  4UV9 A;  1MD0 A;  3OR2 C;  2RKH A;  4FIS A;  2FEZ A;  4KIF A;  1VQ5 I;  3RQ4 A;  4XLH A;  3RPU D;  1ETW A;  4UUS A;  3BG7 A;  2F48 A;  5HVQ C;  2LVS A;  3TP0 A;  3F22 A;  5L3C A;  2PFB A;  3SDB A;  4UV8 A;  2B0L A;  3LSG A;  5E3M A;  5E3O A;  2ZXI A;  4FT8 A;  4H4K C;  4UXN A;  2KLO A;  4E7J A;  3K1N A;  3GBG A;  4EAT A;  4OAZ A;  1UHS A;  4XOR A;  2LC2 A;  1X1A A;  5J1R A;  3OYI A;  3HOS A;  2QKL B;  3ISP A;  3BG5 A;  5J8F A;  3FHZ A;  2HKX A;  3ABU A;  4L0Y B;  1WPK A;  2ZXJ A;  2ZSH B;  3I54 A;  5CVJ A;  4F55 A;  4IQ4 A;  4N4N B;  1X1C A;  2MYS A;  2XB0 X;  4ENJ A;  3RZO J;  2B9S A;  1K78 A;  1WJE A;  4OIO F;  4XOT A;  2OD5 A;  2DAO A;  4NC6 A;  3OYH A;  1NTC A;  3W2W A;  2VB6 A;  5K7H A;  1J7K A;  1U8R A;  4RBO A;  4M73 A;  4CSW A;  2HQ5 A;  1FY7 A;  3N05 A;  1K6Y A;  2FX0 A;  2O8K A;  3EYI A;  4A2U A;  3HTS B;  3L2V A;  3I4P A;  2DA6 A;  3L2C A;  4G9Y A;  3FXQ A;  2LKX A;  2YR2 A;  4XKB A;  2DW4 A;  2Z5U A;  2K5C A;  3ABM H;  2VOP A;  2HTJ A;  3GTL J;  1ONV A;  3B6A A;  4KUM A;  3J7Z I;  2RN7 A;  5M5X J;  4W1U A;  1ULY A;  1YIO A;  4KIG A;  1IN4 A;  1RKT A;  5FD6 A;  1GDT A;  2ZCW A;  4IHV A;  1GV2 A;  4KDP A;  4P9F A;  1BJZ A;  3DLA A;  2NAZ A;  5M3F J;  2JTV A;  3M3Y J;  1DU0 A;  2HQR A;  2HXI A;  3PO3 J;  3LQQ A;  1ORK A;  4AU7 A;  3GXO A;  2RQQ A;  2KIM A;  2DJN A;  4JOM A;  1SVL A;  3JCU C;  4KN7 X;  2XVC A;  4LK1 F;  5HOO A;  2V1U A;  1X4O A;  1HST A;  1H0M A;  3DU5 A;  3BTC A;  2VT3 A;  2DA7 A;  2HVQ A;  5EG0 A;  3QWL A;  1BBY A;  3K7A J;  2R7Z J;  3JR9 A;  2DMT A;  4E7Z A;  3K6G A;  4BAY A;  2MLG A;  1PUF B;  2E7W A;  1KU2 A;  5JLX A;  1HLV A;  3ZQL A;  3HPH A;  3MZ8 A;  5JHU A;  3BZC A;  3VPR A;  2XUB A;  1FYL A;  1I6X A;  1LPQ A;  2M2E A;  3F8M A;  2R7V A;  2A6H F;  3VYS B;  1R58 A;  2J5P A;  1J59 A;  3F6O A;  5IP6 A;  1STZ A;  3MZH A;  1LE8 B;  2HTS A;  2XGX A;  3G1M A;  1BIB A;  4A12 A;  4FE4 A;  3GLX A;  1ZGJ A;  4S0H B;  1DGR M;  2RQP A;  3BJO A;  5DM7 F;  1U2W A;  2R93 J;  3DEW A;  2EK5 A;  4ZTJ A;  2NNY A;  1YOV B;  2PLY A;  1SFE A;  2KMU A;  2TCT A;  3JRD A;  2BYV E;  4GYG A;  1EH7 A;  1Y8Q B;  1NH3 A;  1Z77 A;  2FQ4 A;  3WU0 A;  4LG3 A;  5ICE A;  3FXK A;  4FET A;  1HW5 A;  2PMU A;  2HR3 A;  1QGP A;  2A5Y B;  2W48 A;  4II2 A;  2VKE A;  4IRG A;  1FOX A;  1DUX C;  2VXZ A;  2DT7 B;  2I10 A;  2Y0S A;  1B72 B;  5F08 A;  1FYM A;  1RZ4 A;  4V2F A;  1WFX A;  3CDH A;  5K1Y A;  2FBK A;  3BZ6 A;  3TW7 A;  3FIW A;  3A03 A;  3JAM Z;  2O03 A;  3F6V A;  1IW7 F;  5J47 A;  4M6V A;  2R7X A;  1Z21 A;  2Y0S N;  4XKC A;  1X4P A;  2O8X A;  3QOE A;  4HNU A;  1IN5 A;  4MEX F;  4CCL A;  1LNW A;  4OAY A;  2HYJ A;  2O9L A;  3HSE A;  3KX2 A;  4FHT A;  1BOA A;  3VYU B;  3BR6 A;  1V54 H;  2CJJ A;  1HOM A;  2WV1 A;  3GFM A;  3TQN A;  3HOT A;  3IC7 A;  2ZJ2 A;  1FSE A;  4LG0 B;  3BP8 A;  2NVX J;  4EJW A;  2R4G A;  1VQO I;  2A6T A;  3H3V K;  5HDG A;  3GZN B;  5D5V B;  2IGM A;  3W6K B;  3HM5 A;  2CV2 A;  4BY1 J;  5J4V A;  3H35 A;  1YLF A;  1XGN A;  2R7O A;  3ASO H;  5TJJ A;  4V2G A;  4Y4R A;  4LLN A;  2DQR A;  3R4K A;  4IRH A;  2E7X A;  3ZMT A;  4HNT A;  2VPL A;  5BPI A;  3ZN0 A;  2DMN A;  2X4H A;  1WWX A;  3MKL A;  2VBY A;  4HX8 A;  5J3L A;  1WCM J;  3ABL H;  2OUM A;  5K7F A;  1FYK A;  2V79 A;  2Z16 A;  1X1P A;  5LFA A;  2H1K A;  2HS5 A;  4BAC A;  5DD8 A;  1D5Y A;  1MSF C;  2L02 A;  1G8X A;  4XKV A;  3BRO A;  1OYY A;  2KZV A;  4RAG A;  3EUH C;  4XIC A;  2GXG A;  2IA0 A;  2LRE A;  1ZGA A;  1AKH A;  2JPC A;  1FP2 A;  2HVR A;  4CUG A;  4XLA A;  2OBP A;  4M72 A;  3V8K A;  4C3I J;  4N0B A;  4ON0 A;  2VI6 A;  3AAF A;  2ID3 A;  2VC0 A;  1R1T A;  4BH9 A;  1G59 A;  1O4X A;  1MMD A;  1WJA A;  2H09 A;  1D8J A;  4XON A;  3C2G A;  1I1G A;  2M4G A;  1NG6 A;  1BC8 C;  3H9G A;  4Q47 A;  2P5L C;  1JI8 A;  1TWA J;  3RKY A;  4N4O B;  2LP0 A;  5M5Y J;  1WJF A;  3KLO A;  2Q2E A;  4XLN F;  2EFO A;  2D1H A;  2R7R A;  4ZH4 F;  3OOU A;  1BW5 A;  3HPG A;  2EFQ A;  4PJN A;  1U9O A;  1O3S A;  4GYI A;  1IGN A;  2ZJP F;  3C7J A;  2LOO A;  1U5T C;  2VOO A;  3LA7 A;  3DWL E;  3L09 A;  2LR8 A;  4EM1 A;  4CXF A;  3F21 A;  3U9G A;  4A5M A;  1KYZ A;  3CJR B;  3DBR B;  4RB3 C;  3W3C A;  1ETV A;  2DMQ A;  2VXD A;  5GAG J;  4M3B A;  1W0U A;  2DN0 A;  4HF1 A;  3SFZ A;  4WF2 A;  4M6Y A;  2EBI A;  3M8J A;  2DXI A;  1SFU A;  1YRN A;  3ZQH A;  2M4K A;  3KIO A;  1TQI A;  3G73 A;  3PIO F;  2H27 A;  3QOD A;  4CCK A;  2VLA A;  1ETQ A;  3BR3 A;  3HKZ A;  1ZTR A;  2EQR A;  3KYL A;  1SD7 A;  3D5S C;  3V4G A;  2WAD A;  1B8I A;  3GFL A;  5E20 A;  3TOB A;  1QA6 A;  4QIW N;  2VOD A;  2BY1 A;  2DA2 A;  5HS7 A;  4BHP A;  3HKZ N;  2PJR B;  3T1B A;  2E5Z A;  2P6T A;  4IVN A;  2X6X A;  4CDG A;  2V7F A;  1T33 A;  3ZMU A;  4A3I J;  1IV6 A;  2DFF A;  1MH3 A;  1GVD A;  3GFJ A;  5JFR A;  4XRS A;  2FQ3 A;  2VJI A;  3NAU A;  2FF4 A;  2K9Q A;  2IA1 A;  3VWB A;  2MC3 A;  1NHA A;  3GX4 X;  1MMA A;  3ASN H;  3QPT A;  1IRX A;  1SD6 A;  3EDP A;  5IOY A;  1SFK A;  2V6C A;  3VOD A;  1CF7 B;  3ML6 A;  2DI3 A;  2B7E A;  2DFH A;  4P5O A;  3IH4 A;  3SDG A;  1I3Q J;  4MHG A;  4A93 J;  4Y13 A;  4YIF A;  3FBN B;  3LSH A;  4DW6 A;  1BI1 A;  3K1P A;  2D1V A;  4XMY A;  4BE1 A;  2X51 A;  1ERD A;  5GTH C;  3BQY A;  2GA2 A;  4J00 A;  1JHH A;  4GRI A;  1UZC A;  1P4A A;  2ZJR F;  2HOE A;  1S8N A;  4EJU A;  2XC7 A;  1YO5 C;  4IKF A;  3I4N J;  2HDW A;  3VOE A;  2K40 A;  2K27 A;  1X3Z B;  3C2H A;  4GFB A;  3H9Q A;  4I99 C;  1MJA A;  5ILS A;  2IVM A;  2L9V A;  2XSD C;  4BQN A;  4NQW A;  4ZYA A;  3BJA A;  3O2P E;  4RS8 A;  5FJ8 J;  3JRI A;  5F04 A;  4EQQ A;  2OJE D;  4QPO A;  3BR1 A;  2GIZ A;  4B3A A;  2OCE A;  3WTT C;  2KT0 A;  3DXJ F;  4F91 B;  5FRO A;  4ZDP A;  2UWM A;  1SEU A;  4UUS B;  1FWZ A;  1SMT A;  2FOW A;  4XRF A;  3ZQI A;  4ESJ A;  2RGV A;  2ISY A;  4LLG F;  1MBH A;  2GAU A;  1EA3 A;  4PGG A;  2MH9 A;  2ELJ A;  3WTV C;  2YU3 A;  3HTU A;  2D5V A;  1I5Z A;  1MNM C;  1WJ5 A;  3SFI A;  3EUH A;  2L7K A;  3AG3 H;  1Z67 A;  4HPQ A;  1XSV A;  1GT0 C;  1T8I A;  4XL9 A;  4IX7 A;  1BR4 A;  2X1D A;  3M1E A;  3B02 A;  4BEH A;  4KIC A;  5J8C A;  1ZRC A;  2W00 A;  1OCZ H;  2Y0M A;  4LFU A;  1TQP A;  3KET A;  1U3E M;  3RI4 A;  5DEQ A;  1YJ9 I;  3H3U A;  1OYW A;  5EEG A;  2JA6 J;  1K78 B;  3K4L A;  1ZK8 A;  3J7A Y;  2E2J J;  4M74 A;  1MW7 A;  3TO9 A;  1DP3 A;  2Y30 A;  3RQI A;  4P1W A;  2XGD A;  1Z0X A;  3FKJ A;  4D5F A;  2QBY A;  1IG7 A;  4AVZ A;  3GO5 A;  4B43 A;  4I76 A;  3DEU A;  1YX5 A;  4EM0 B;  3TMO A;  1IJW C;  5C4X J;  3ERM A;  1RES A;  1GXQ A;  1I1S A;  2DLL A;  4PCQ A;  5GPA A;  1SVO A;  2KQR A;  1GUU A;  3MZY A;  5FKO A;  2DOF A;  3JW4 A;  1MIJ A;  4P9U A;  4E4H A;  5GAE J;  1PUE E;  3CO6 C;  3JRH A;  2MSY A;  3IRQ A;  3V42 A;  2KP6 A;  1VI0 A;  2FXA A;  3NAR A;  1O7F A;  4WK8 F;  5B3S H;  4LGW A;  3BQZ A;  3QQA A;  4TV7 A;  1P4X A;  3S17 J;  2I8D A;  3OS1 A;  2COM A;  5BOX A;  4DZP A;  2L7F P;  4YFX F;  1B9M A;  3ZN1 A;  4BJT A;  4KJZ A;  4HF2 A;  1FOK A;  1MBJ A;  4M3G A;  1S3J A;  3KP3 A;  1JKO C;  5EG0 B;  5HNH A;  5B1A H;  3S1Q J;  2ELH A;  3SQN A;  3MQ0 A;  1FTT A;  1YFH A;  2GZW A;  5IYD J;  3A02 A;  4R79 A;  4M3D A;  1ZN2 A;  3U1K A;  3HL2 A;  1ZAR A;  4YIR X;  2YSR A;  2BVL A;  5D4S A;  1ETY A;  4AM3 A;  4ZZD A;  2KIQ A;  3D0S A;  3BZK A;  2V9V A;  4C2T A;  2F6C A;  5AIP A;  4HEA 2;  3HEF A;  4D9J A;  2EH3 A;  2XF6 A;  2JT1 A;  4DYC A;  3CC2 I;  1S29 A;  2XIG A;  1HQC A;  3HJE A;  2CRG A;  4XLC A;  1B4A A;  3ZQ7 A;  2JK3 A;  3PJR A;  4QTR A;  3CCL I;  3CJN A;  3CCS I;  2HDC A;  3KEQ A;  3CTA A;  2HYF A;  1G4D A;  5CQG A;  2E1O A;  2M87 A;  4WXC A;  4XN3 A;  2KIF A;  4BGD A;  1W5S A;  1MZB A;  1XX5 A;  1Q1H A;  3V7S A;  3TDZ C;  4B44 A;  4NBQ A;  4DOZ A;  4RGS A;  2DMP A;  2EIJ H;  3RYR A;  3JTH A;  3H3Z A;  3OYG A;  1U6G A;  1VQ7 I;  1KQ0 A;  2H94 A;  3RJP A;  5IYC J;  1WHU A;  2VC1 A;  3RSN A;  5HDN A;  5EZH A;  4M71 A;  4HDV A;  2LBF A;  3FXM A;  2R7U A;  3MAJ A;  1ZLK A;  1Z3X A;  3ZMV A;  2Z2S B;  2JN6 A;  3U2R A;  1XSX A;  4HST A;  3GZ5 A;  4CZZ A;  1Y8R B;  1KU9 A;  2VQL A;  3CZ6 A;  4OWR B;  4Q48 A;  1FPQ A;  5E18 F;  3EUK L;  5E1Z B;  4MEY F;  2IBD A;  3BC8 A;  3G6E I;  4BJ5 C;  1TQM A;  2H6C A;  2R7D A;  1F9N A;  1AHD P;  3I5U A;  2HWV A;  3ELK A;  2HZD A;  3K1M A;  1R5H A;  1R71 A;  4BE0 A;  5J1Y A;  1XGO A;  1A6Q A;  1XTA A;  2X6Y A;  1MJ9 A;  2DDA A;  2ZFU A;  3OYB A;  1TNS A;  1UHW A;  5LD2 C;  2MW8 A;  1K61 A;  1Z1D A;  1ZGW A;  3S3M A;  1W0T A;  5A2Q Z;  1X58 A;  2W84 A;  3DTI A;  3GTJ J;  1GXP A;  3LSM A;  4CGZ A;  3DPU A;  4PSX A;  4OIR F;  4CCJ A;  4UB6 C;  1K6O A;  4XK4 A;  5D5W B;  5E3L A;  3DV8 A;  2E34 A;  4F52 A;  3ZXS A;  2LY2 A;  5M5W J;  4A69 C;  3H1C A;  1FIA A;  3MN2 A;  2K3P A;  1HA8 A;  2E2H J;  2HI3 A;  1W7P A;  2OA4 A;  3KZI C;  3E6D A;  4F7Z A;  3EET A;  4EJO A;  2IRF G;  2KJB A;  3PUB A;  3WTY C;  2IS1 A;  1TTY A;  5E8I A;  2VPR A;  5A2Q K;  2HEO A;  5DD4 A;  2HNH A;  1ZR2 A;  1HKQ A;  1C0W A;  1Z3Y A;  1OMI A;  3WHB A;  3S2D J;  2HQA A;  2VJ5 A;  3DPT A;  4UVC A;  3BPV A;  2M5W A;  5J4Y A;  2W1O A;  3MKW B;  3Q9S A;  2WY7 Q;  9ANT A;  1A35 A;  1SAN A;  3I58 A;  4H0E A;  1CQT A;  1O3T A;  2BW3 A;  4D1Q A;  3HYI A;  3K4N A;  5D6E A;  3GTG J;  1AKH B;  3PSI A;  3N4M A;  1ZRF A;  4BXF A;  3OR1 C;  3V7R A;  4ENN A;  1PYV A;  1KQ8 A;  4HW0 A;  1YS6 A;  4EM2 A;  5GTI C;  3HOX J;  5HLT A;  1HC8 A;  3BCB A;  2R5Y A;  2JQ7 A;  1DPR A;  2X1C A;  4PGH A;  3DFG A;  3NWS A;  4KN4 X;  1QQI A;  4BQQ A;  3DKX A;  2W82 A;  3P9I A;  4LIV A;  2GBY A;  3HGG A;  2Q2E B;  2LD5 A;  5EDN A;  3E7L A;  4ITV A;  2R0Q C;  3LA3 A;  4BU2 A;  4G12 A;  3UNG C;  1VZ0 A;  2XRL A;  1FNN A;  1KYW A;  3W2A A;  2IGK A;  2JUC A;  2P7C B;  1D0Z A;  4ZZL A;  5CVV A;  2EJR A;  2Z9O A;  3OSF A;  2YPR A;  4HA8 A;  1WI9 A;  2IJL A;  2Q8K A;  3V8J A;  3L2R A;  3CCM I;  2VON A;  1IDZ A;  3DEE A;  4M9X A;  3K2Z A;  3PM1 A;  5CPR B;  2A6E F;  4DBQ A;  5E3N A;  1WJD A;  3AG4 H;  4ABZ A;  4BKX A;  4RB1 A;  1YIJ I;  2IW5 A;  1A31 A;  1G6N A;  2QGU A;  4HV5 A;  1KA8 A;  3TOA A;  1IXC A;  2EPF A;  1DDN A;  5LHI A;  1SC7 A;  1YRN B;  2NVQ J;  2XGC A;  3FMQ A;  2CU7 A;  5DDG A;  2IT0 A;  2JA2 A;  1QZZ A;  4E7K A;  4HDU A;  2FBH A;  2EZH A;  1U9N A;  1LDJ A;  4U88 A;  1A36 A;  1R1U A;  4L18 B;  4BBS J;  3RIR A;  4GXO A;  2XRO A;  1VTN C;  2W85 A; 
#chains in the Genus database with same CATH homology
 1E0E A;  5KHD A;  2OUM A;  4BJ6 C;  3IAM 2;  2Z16 A;  3LSK A;  4DGW B;  4E6K G;  5LFA A;  2WAQ A;  1N78 A;  3H5A A;  4YRV A;  4BAC A;  2XSJ C;  1BR2 A;  3CMM A;  1G8X A;  3U21 A;  2CUZ A;  4XKV A;  3VYT B;  2KZV A;  3EUH C;  3LSI A;  2LRE A;  2LG4 A;  2HVR A;  2WAE A;  4CUG A;  3OYJ A;  4XLA A;  2L5Q A;  4RLQ A;  5FRM A;  2BOL A;  1T95 A;  2HPI A;  2OV7 A;  2IGN A;  4C2U A;  3S32 A;  2AQE A;  2MFZ A;  4CCN A;  1G59 A;  1MMD A;  1FMV A;  1WJA A;  4RM2 A;  3OYF A;  3OL3 A;  4J00 A;  4QPQ A;  4XON A;  2V4J C;  4U87 A;  3OYN A;  3C2G A;  2M4G A;  2NOJ B;  3OL4 A;  1DQU A;  1NG6 A;  1N77 A;  3PSF A;  4PFO A;  1QU3 A;  2R7Q A;  3H9G A;  3HXL A;  3K4B A;  4AYB A;  4ZDO A;  2VIX A;  4N4O B;  4BDZ A;  1JI8 A;  1WJF A;  4LIU A;  1Y56 A;  3K4C A;  2R7R A;  3OOU A;  4BE2 A;  1DGW Y;  1X1B A;  2K9M A;  3HPG A;  4PJN A;  5TGT A;  3AL0 B;  3W2V A;  3D5R C;  2F4I A;  1YE9 A;  2DOA A;  3MKY B;  2IS6 A;  2X6W A;  3A1Y A;  2LOO A;  2VKD A;  5KCM A;  4PFP A;  3DWL E;  4U7B A;  4B48 A;  4NQW B;  3HG9 A;  3S93 A;  1MNE A;  3OS2 A;  2E1M C;  2VJ4 A;  3NWT A;  2CV1 A;  4CA0 A;  2VAS A;  3MD2 A;  3CJR B;  1D0Y A;  3W3C A;  1WJB A;  3KEY A;  2VXD A;  2CUJ A;  1T0F C;  4DJA A;  4DBR A;  4JQF A;  4XNF A;  3M8J A;  2DXI A;  2M4K A;  2LY1 A;  4HG2 A;  3K70 C;  3QOD A;  4CCK A;  2VLA A;  3HKZ A;  3KYL A;  3K4K A;  2VL8 A;  1LVK A;  3D5S C;  2WAD A;  3OYE A;  2VQC A;  1V5G A;  3MMY B;  1P9Q C;  3L2W A;  3HC7 A;  4BEH B;  2UV1 A;  1R6R A;  1UEL B;  2CS3 A;  4G6T B;  2PJR B;  2E5Z A;  2X6X A;  2V7F A;  4LIT A;  3DU6 A;  2WY8 Q;  2GOX B;  4XOP A;  2QKM B;  4XLE A;  3LFU A;  2VJI A;  3OYC A;  3K70 D;  3VWB A;  2L2O A;  4C30 A;  3ZCO A;  2CW7 A;  2WBM A;  1MMA A;  3OYM A;  2JVH A;  3IAS 2;  1IRX A;  4ZC3 A;  4DIQ A;  2P0W A;  1SFK A;  1UG0 A;  3CP8 A;  5JHF A;  2WA0 A;  3L2U A;  4KIS A;  3SZG A;  2HVS A;  4MLO A;  4P5O A;  3AKZ A;  4IZZ A;  3AL0 C;  2JSP A;  3F9K A;  3FBN B;  2LH9 A;  3LSH A;  3RCO A;  3SYT A;  3LMM A;  4XMY A;  4X0G A;  2X51 A;  4BE1 A;  1ERD A;  2CFO A;  3A2K A;  3I3L A;  4E7S A;  4GRI A;  1FMW A;  2XC7 A;  1Z7L A;  4II3 A;  4IKF A;  2HDW A;  2E60 A;  3C2H A;  1S9H A;  3H9Q A;  1KON A;  4PUS A;  1MND A;  1LFP A;  1D1A A;  2XAU A;  3VSK A;  2MAB A;  4KT6 A;  4BQN A;  2E5N A;  3ONQ A;  2VQH A;  2L9N A;  2BVM A;  4ZYA A;  4XR6 A;  4XKW A;  1D1B A;  2M3A A;  3LL7 A;  4XN0 A;  2XF7 A;  4QPO A;  1MMN A;  3L2Q A;  3MKZ A;  4F91 B;  2FUG 2;  5FRO A;  4ZDP A;  3ZQQ A;  4CH7 A;  2UWM A;  1MMG A;  3S3N A;  1EA3 A;  2ELJ A;  3DQV C;  3SEZ A;  3OYL A;  1SAU A;  1WJ5 A;  2L7K A;  2UUZ A;  4HPQ A;  2W7N A;  1X1D A;  1V5F A;  1U0J A;  1LKX A;  4XL9 A;  4IX7 A;  1BR4 A;  1D1C A;  1LDK B;  2X1D A;  2DJI A;  4RLF A;  5KNL A;  2XDV A;  4BEH A;  3CF2 A;  4NUB A;  2WAF A;  2W00 A;  2PJR A;  2OC6 A;  3ZGK A;  4FAS D;  3DPL C;  3QYB A;  1W36 C;  1WJC A;  3K4L A;  5CKT A;  2LBF B;  3J7A Y;  1MW7 A;  1DP3 A;  3K4J A;  3OIP A;  4YEL A;  3VYR B;  4P1W A;  3EPZ A;  3FKJ A;  4AVZ A;  3E0J B;  4B43 A;  3OS0 A;  2W4S A;  1YX5 A;  3TMO A;  1Y6I A;  2X85 A;  1UAA A;  3CES A;  2K9L A;  3CJQ B;  2KQR A;  2CMP A;  3AFH A;  4HRI A;  2X1E A;  4PSW A;  4PK4 A;  1ZEL A;  4E4H A;  3V42 A;  2KP6 A;  4RMN A;  2ZXH A;  1W36 D;  3IUO A;  2XF5 A;  1YX3 A;  2HU9 A;  1PJR A;  3E1S A;  4NC8 A;  2V6E A;  2I8D A;  4CZC A;  1GLN A;  4F92 B;  4BUP A;  3OS1 A;  3I9V 2;  2IS4 A;  2KRH A;  2KRC A;  4RM3 A;  2RNG A;  4BJT A;  4KJZ A;  3BG6 A;  3PFY A;  4XM3 A;  3M1C A;  4XLF A;  2KPM A;  4YEJ A;  3S8P A;  3VDX A;  5HNH A;  3OR2 C;  1QHH D;  3RQ4 A;  4XLH A;  4R79 A;  3RPU D;  3UR3 C;  3BG7 A;  3HL2 A;  3TBI A;  3ZR8 X;  3QYF A;  2IGO A;  5HVQ C;  2BVL A;  2F5V A;  3EUA A;  3PL8 A;  4C2T A;  2F6C A;  4HEA 2;  3SDB A;  2Z1D A;  4D9J A;  2R7T A;  2XF6 A;  4BDY A;  3LSG A;  2M7A A;  2ZXI A;  3H5R A;  4H4K C;  2KLO A;  4XLC A;  4E7J A;  3PJR A;  2AQF A;  3GBG A;  4EAT A;  4OAZ A;  4XOR A;  3VSL A;  2LC2 A;  5FRN A;  1X1A A;  2KL4 A;  5CQG A;  3OYI A;  4ZDL A;  3CP2 A;  4XN3 A;  3HOS A;  3H0D A;  2QKL B;  4BGD A;  4B44 A;  4DOZ A;  2ZSH B;  4F55 A;  4IQ4 A;  4N4N B;  3OYG A;  1X1C A;  4BS9 A;  2MYS A;  2LRD A;  4BL0 B;  2CV0 A;  2VJJ A;  4Y3O A;  3RSN A;  3OYD A;  3S3O A;  1WJE A;  4XOT A;  2LBF A;  2R7U A;  3OYH A;  1Z3X A;  3W2W A;  2VB6 A;  2Z2S B;  2CW8 A;  3H5N A;  4HST A;  2ZSI B;  4CSW A;  3RTR A;  3N05 A;  1K6Y A;  2VQL A;  3CZ6 A;  4OWR B;  3L2V A;  3EUK L;  2GOM A;  4Y33 A;  3BC8 A;  4XKB A;  4BJ5 C;  2K5C A;  2V1N A;  2HZD A;  4PJM A;  1D0X A;  4BE0 A;  3K10 A;  2X6Y A;  3DLA A;  2ZFU A;  3OYB A;  2MD0 A;  3DKY A;  5LD2 C;  3S3M A;  4AU7 A;  4IQJ A;  3DTI A;  2RQQ A;  1OR7 C;  3LSM A;  3PNT A;  4JOM A;  5HOO A;  2M0M A;  1X4O A;  3DPU A;  4PSX A;  4BQO A;  4CCJ A;  3DU5 A;  2HVQ A;  4F52 A;  3ZXS A;  3A4C A;  2LY2 A;  3BLY A;  3FDY A;  3K4M A;  4E7Z A;  3K6G A;  2K3P A;  3OIQ A;  1HA8 A;  3ZRG A;  2JVG A;  3BCA A;  4F93 B;  3HPH A;  2DCE A;  3PUB A;  2IS1 A;  2Q1Z B;  2M7B A;  2V26 A;  2R7V A;  3VYS B;  2KHM A;  2HNH A;  2VKH A;  1Z3Y A;  3G2B A;  4PJL A;  2CH0 A;  4E7H A;  3DTK A;  2HQA A;  2VJ5 A;  3DPT A;  2IXS A;  1BOB A;  1N75 A;  2DT6 A;  4HSR A;  2W1O A;  3MKW B;  3QYE A;  2L9S A;  2WY7 Q;  1DGR M;  2A5W A;  2BW3 A;  4D1Q A;  3K4N A;  3PNV A;  3FHN A;  3IP4 B;  3PSI A;  1AA7 A;  4PJJ A;  4ZTJ A;  2HPM A;  2KMU A;  5CQE A;  4J01 A;  4BXF A;  4XQF A;  3OR1 C;  2MC4 A;  2R7S A;  1PYV A;  3D5L A;  1V5E A;  4LG3 A;  3SEQ A;  5HLT A;  4FET A;  3BCB A;  2RRE A;  4E7L A;  2WB1 A;  1TZL A;  2X1C A;  4II2 A;  3NWS A;  4NNJ A;  3HUG B;  4B3X A;  2VXZ A;  3OY9 A;  2DT7 B;  4E7I A;  2Y0S A;  4BQQ A;  3DKX A;  2W82 A;  2V9K A;  4LIV A;  4CCM A;  4F3Q A;  1WFX A;  1NG7 A;  4ZJZ A;  3TL4 X;  2Q2E B;  3FBI B;  4CCO A;  4ITV A;  4KIT B;  4BU2 A;  4NC7 A;  1QHG A;  3UNG C;  3OMY A;  1VZ0 A;  1BR1 A;  4ZTF A;  2IS2 A;  3W2A A;  2IGK A;  1OLT A;  1D0Z A;  2R7X A;  1Z21 A;  4XKC A;  1X4P A;  3QOE A;  3OYK A;  4HNU A;  2O5R A;  4CCL A;  3OYA A;  4OAY A;  2JUG A;  5HNF A;  3L2R A;  3DEE A;  3KX2 A;  2LYC A;  3PNY A;  5CPR B;  3VYU B;  1X19 A;  4C9Y A;  4DBQ A;  2BW3 B;  2VQG A;  1WJD A;  1J09 A;  3OWT A;  3HOT A;  2PMZ A;  1TT0 A;  3DTE A;  2R4G A;  2A6T A;  2E1M B;  4ANJ A;  2IGM A;  2R7W A;  2CV2 A;  4B47 A;  2JA2 A;  3H35 A;  4E7K A;  2R7O A;  3H9J A;  4Y4R A;  2KDO A;  4HNT A;  2VPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...