3TBIA

Crystal structure of t4 gp33 bound to e. coli rnap beta-flap domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
AKLLDRQENGFIIEKMVEEFGMSYLEATTAFLEENSIPETQFAKFIPSGIIEKIQSEAIDENLLRPSVVRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of T4 gp33 bound to E. coli RNAP beta-flap domain
rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
molecule keywords RNA polymerase-associated protein Gp33
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16805 Trans_coact Phage late-transcription coactivator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tbiA00
3TBIA
chains in the Genus database with same CATH superfamily
4FX0A 2IA1A 1MNDA 4M9XA 4XRMA 4A3LJ 3F8CA 5L3EA 1POGA 2M87A 3ABMH 5LBQA 3L2RA 4IOCF 3R60A 2VJ5A 2CQKA 5L3DA 2PI0A 3DU5A 4B3AA 1ZH5A 1RUOA 4X0GA 2JTVA 2K9SA 2M4GA 2EZHA 2Z2SB 1U5TC 2IGMA 2JPBA 3QPHA 5IP6A 1FJLA 4BL0B 4B48A 1TNTA 4BXFA 1VQPI 2R7QA 2V1NA 2H09A 1Y8RB 3H1CA 1IW7F 3IL2A 1JHFA 4HAMA 5ICCA 1JGSA 1XSXA 1ZHFA 3TOBA 2JA8J 4ZZDA 1S7OA 3OL3A 4BJTA 2PJRB 3FXJA 3I4NJ 2XAGA 1R1UA 4RLFA 5DCMA 3E6MA 3H9QA 1AHDP 5EJCA 1KYWA 1L0OC 3C1DA 2CRGA 3EDPA 2P5VA 1OCZH 4NQWB 1GV5A 3K2ZA 2A6TA 1SFOJ 1LB2A 3FBNB 4F55A 2ZMEB 2O6GE 1J59A 1A04A 1V54H 4EM1A 1JGGA 2VOOA 3E5UA 5F64A 4ANJA 1QVTA 4RBOA 2X6OA 3CJQB 2NAZA 4Y33A 4IRHA 3KP4A 4I0BA 5FRMA 2UWMA 5M5XJ 3BJOA 3PM1A 3OYNA 4ASNA 2DFEA 1WRJA 2QUFA 4S04A 2GA1A 3IRQA 2FEZA 3OY9A 5KAIC 2FRHA 1I3QJ 3WU0A 4NQWA 3RJPA 2WADA 5DS9A 4A0ZA 3EYYA 3KCCA 3DXJF 4BY7J 4C2TA 3PUBA 4WWCA 4O6JA 3HRMA 4HOBA 4RB0A 2VUMJ 4HF1A 1HDPA 3QYEA 1XD7A 3ZMTA 4I76A 3TBIA 4DOZA 3HSRA 1QBJA 2PN6A 1RNLA 1IGNA 3GFMA 1BI3A 4YG2F 2KHMA 3CC2I 1EH7A 1JT6A 5BQTA 1UZCA 3TMOA 5K7FA 3ZPLA 2L54A 1DP7P 1LVKA 3AAFA 1T56A 2GBYA 1NHAA 2LK2A 2RAEA 3DEUA 4E7JA 3OS2A 3M4OJ 3BR5A 5BPDA 1B72A 2A69F 3FIWA 3CQZJ 1BM9A 3GO5A 1LQ1A 1QVUA 4ZH4F 3GTPJ 4JOMA 4KT6A 3NRVA 4FX4A 4IQJA 2N8GA 1P9QC 5KNLA 3HOYJ 2OUMA 2E1NA 3FHNA 4OAYA 4G6TB 2GXBA 1R4MB 2PX9A 1K6YA 4S05A 4CCMA 4UUTA 2NS8A 3AKZA 3ECOA 3J81Z 3ERMA 4CYDA 2IA0A 2QQAA 3KEQA 2VBYA 3MN2A 2GIZA 4KIBA 4PK4A 1G3SA 4YFXF 3MKWB 3NWSA 4LLNA 2MFZA 1ETYA 3T8RA 5J1YA 3KX2A 3JREA 2WV0A 4AVZA 3S1QJ 1FTTA 4XLCA 3KYCB 3T5XA 1AU7A 1YQAA 3CD6I 1ZG3A 4MLOA 1XSVA 3HIFA 1FZPB 4XLNF 4LFUA 2AHQA 1P4XA 2DQLA 3RDIA 1H0MA 2JQ7A 4AU7A 5JVGF 3BOQA 5LD2C 2QA4I 2P6TA 2XASA 4AIKA 4F91B 4D9JA 3GYHX 1JE8A 2XGDA 4LB6B 3FXQA 5LRRA 1MSFC 3JAMK 3ZN0A 2CGPA 3MD2A 3PQJA 5C3EJ 4CCLA 5HODA 3V8KA 1D0YA 2DQRA 2QF7A 5C44J 1S29A 2EV5A 2IVMA 1ZR2A 3KE2A 4XSXF 5DM6F 4ZDLA 3Q9SA 1Y0NA 2CUJA 2P7VB 5D4SA 2DAOA 1DUXC 1W36C 3K4LA 1DQUA 2KT0A 4MTDA 3CCJI 3IAS2 3ZQHA 1YG2A 2EIMH 2DCEA 5C4JJ 3NEUA 1PDNC 2ZMEA 3RKQA 1O3TA 4XLFA 3HEFA 5CYVA 1X1DA 3G6EI 3LA2A 5B1AH 3ABTA 3O3KA 4HSTA 4DYCA 2X51A 2ZJQF 2MYSA 1LE8A 2WC2A 2CWEA 2LKPA 4DBRA 2HKOA 1GXQA 3HTUA 2DA7A 3ZR8X 5HS8A 1Z0XA 2V9KA 3F72A 3J80K 2KPMA 3CCVI 4FETA 1BR1A 1YS6A 3F8NA 2KIUA 2JPCA 4E6KG 1XGSA 1OCRH 2XF5A 3NQOA 2HFHA 2ZXHA 4HQMA 3OYKA 2LH9A 4U0WA 4MHGA 4EATA 1KU9A 1E0EA 3ZP5A 2WY7Q 2IXSA 2KDOA 3J7YJ 4ENKA 4CO8A 1Q1HA 1Z05A 2XAUA 2R7SA 2O0YA 3CO7C 1X2NA 3GLLA 2XPVA 2GXGA 2DOAA 3ASOH 2LRDA 1FBSA 2KRHA 3CP8A 5DD8A 3V4GA 5FKMA 3I59A 4BJ6C 3ESWB 5FKKA 3LSJA 1ZRDA 1E2XA 2F5VA 2WWYA 1TW2A 2E35A 4MNUA 4D7NA 3FISA 4ZYEA 2VKDA 3O8GA 2JJ7A 3TEDA 4ITVA 2STTA 4OWRB 4HX4A 2DA6A 2F48A 3ASNH 1R22A 2R3SA 4IVNA 5D5VB 2HOEA 2HR3A 4AYBN 3PIOF 4ENJA 2NXNB 1SMTA 4D0PA 3BTLA 5DDGA 2L9SA 3F8MA 1U9NA 3A0HC 3K1MA 3JSPA 2KMUA 4U7DA 1XB4A 4KN7X 4DZPA 3WTUC 2DW4A 1I50J 2HQRA 1SVOA 3DTKA 3X2QH 1U2WA 2KL4A 5KHDA 3U1KA 4DW6A 5LEKA 2DFFA 3RSNA 1YRNB 3L9FA 1U3EM 4KYWA 3CJTB 3E7LA 2FOKA 3K10A 4AC0A 3COAC 2NRAC 2XSJC 4KICA 2OCCH 5J6XA 4A3IJ 5EZGA 4CH7A 2DU9A 1IRZA 2JRTA 4ZC3A 1BN5A 2MW8A 1HCRA 2IS6A 4GDFA 2E5ZA 4WK8F 2CYYA 3QODA 3DTEA 2L7MP 1Y39A 2H1KA 1T95A 3GMEA 5E1WA 5ERIA 1VQ4I 4XR6A 4GRIA 5BOXA 2A68F 2PMHA 2K5CA 2E1CA 1VZ0A 5GTHC 3IUOA 3ABUA 1XC5A 2Q2EB 1JKQC 1UHMA 3BLYA 3H5RA 4ZJZA 1QGPA 4ZDPA 4HQEA 3L2WA 3E0JB 1PUFB 5D5XB 1G3WA 2R7TA 3MZ8A 4HPQA 1H9GA 3MZYA 4A69C 3KP5A 1O7FA 1V3FA 3ABLH 1K83J 2ZSHB 3LQQA 1H8AC 1SD4A 3QWLA 1WJEA 3HPHA 3FHZA 3DBRB 3FWEA 1S3JA 4A93J 1IDYA 5J8FA 5KAFC 3IC7A 2GQQA 2HQ5A 2OPTA 3QP6A 4LLGF 3PO2J 5GAHJ 4HX7A 2DMQA 2R7WA 4IHTA 2HDCA 1G8XA 1UHSA 3H9JA 2W85A 5F1RA 2W48A 4BY1J 3CDLA 5E8IA 1IXSB 2F4OB 4R8HA 1SFKA 2JSPA 3AG4H 2FA5A 4NC6A 4QSHA 5D4RA 1SEUA 5FKOA 2DA2A 3LSKA 4BKXA 3BZCA 3EUHC 4M9ZA 1REPC 3G1OA 1WH5A 2LP0A 3ZMUA 2V9VA 2EB7A 3W2VA 1V4RA 4RGRA 3GTLJ 2LBFA 2KP6A 3M1CA 1STZA 2WAFA 4GYIA 2VE9A 2QENA 3CUQB 4Y13A 1B72B 2WAQA 2R7UA 4HRIA 1OYYA 1RRJA 1MMAA 3T0YA 4IHWA 1JKRC 3E6CC 2OBPA 4A5MA 2DLLA 4MEXF 1KA8A 1QU3A 2LY9A 3BJAA 5IT3A 1R6RA 3MEXA 2BXYA 5KVRA 3SDBA 3RI4A 3FK6A 4MTEA 3GEZA 1ZKGA 1Y1WJ 1OR7C 1HQCA 3IHUA 4A0YA 4YIRX 4XMYA 1S7AA 2EZKA 2H94A 3QP5A 5IP9J 1FNNA 2FBKA 4LD5A 5EGOB 2RKHA 5EYRA 1BIBA 3RKYA 4B3XA 4DYRA 3FK7A 1UHWA 1IG7A 1DPUA 3TDZC 1P6RA 2UXXA 2EIKH 2QWWA 2CW8A 2XB0X 2TDXA 3WGGA 2H8WA 6PAXA 3JRCA 4U87A 1FYMA 3S17J 2Y2ZA 5HDNA 1MMGA 3HRTA 1SVMA 4FHTA 1TW3A 2B9SA 2F6CA 1W7PB 1KONA 2NVUB 5LLQA 1S7EA 2G9WA 2XC7A 2UV1A 2OU2A 3HOXJ 2XSDC 2VODA 1B9MA 2Y9ZA 2RNJA 3PO3J 1IRFA 2AXTC 4E70A 3ZGKA 1T08B 2WB1A 4RAGA 5GPCA 5FLVA 2ACJA 3I5UA 3U1DA 3H5AA 3S14J 2QKMB 2IS2A 4QPQA 4KISA 4UHTA 4HA8A 2STWA 3S2WA 1R1VA 3ZRGA 3F9KA 5HLGA 4XRSA 2K86A 1QZZA 1J9IA 1UAAA 4M6YA 4MQ9F 1XDUA 2KZGA 3V7RA 2AQEA 3OYEA 1LFUP 1KU3A 3H3ZA 5ICFA 4XOTA 2HDWA 4GXOA 1WI9A 2FBHA 3L00A 1P7JA 1KU2A 1OCOH 3MQ0A 2D5VA 3BZKA 2A3SA 2HOTA 2ME0A 2HQNA 1WH7A 2IJLA 4KIGA 4WXHA 3F8FA 3Q5FA 1EF4A 1HKTA 4DBQA 4LB5A 1D0ZA 4Y15A 1QNTA 4BH9A 5M3MJ 4BE2A 3S1RJ 4IZZA 2VBWA 5IY5H 1QO0D 2FE3A 2FF4A 2QSFX 2LD5A 3ZMVA 3ZMSA 1HW2A 4LITA 2ZO4A 3VODA 1MH3A 1X1AA 3DPTA 3GUDA 1ON2A 2JMWA 2LG4A 3PIPF 5GP9A 4RAZA 1B9NA 5CLSA 1H9TA 4RA2A 3DBLB 2CS3A 2Z3YA 4E7ZA 3GTMJ 4AIDA 1FMVA 2B0LA 5D6EA 2HYFA 3DFGA 3NARA 5FLXZ 2IGOA 2HI3A 5IYDJ 1LEBA 3GXOA 1QRYA 1GT0C 1U6GA 4N4OB 3F22A 3D5RC 5FFZA 4BYYA 2XGXA 4C2UA 3TP0A 1ETVA 3LSGA 5FKNA 4XLEA 3OYGA 2NNYA 3BG6A 3DQVC 4W97A 1VNDA 4KMFA 2H27A 2O5RA 2DO7A 1HW5A 2DT7B 4PFPA 3PSIA 3FXUA 1ZELA 1ZAOA 5IYBJ 2RDPA 1WI3A 2G7HA 5KCMA 1HKSA 1N25A 5FGMA 3SFZA 4CCJA 1Y6IA 2F5CA 3HGGA 1LDKB 2V1XA 4RB2C 3FKIJ 3Q0UA 4BQOA 3DTIA 1YJWI 3BR2A 3TOAA 3OR1C 4W1UA 1JT0A 2WAQN 3GFLA 1DGRM 2HNHA 2CW0F 2OAZA 3V8JA 1HF0A 3LFUA 3CCQI 3KPHA 2DMTA 4M9SA 5CJ9A 1F43A 2LNBA 3ZQQA 2FNAA 5IPAA 2KIMA 5FB2A 4P5OA 3BG3A 3TQNA 1W7PA 2BY2A 1TQMA 1A6QA 2CG4A 2V79A 4A3MJ 1T6SA 3OSFA 4XOPA 4BQNA 1YW7A 1VTNC 4A0XA 1D1CA 2QQBA 2XRLA 2XGEA 3OYFA 3VDXA 4J00A 4HV6A 4IQ4A 1UB9A 2Q1ZB 3MMYB 3J80Z 5IOZA 2VQLA 1TBXA 4IRGA 4D1QA 2V7FA 2QKLB 3HTSB 1OISA 3ZQCA 3E6DA 1O3RA 2JA5J 1U78A 3GTOJ 2YSRA 2M45A 2QBYA 5LFAA 4PGHA 1U0JA 2MD5A 1KZHA 2EBIA 5E79C 2VBZA 4UB6C 2WB1N 4XKWA 4RGSA 4JX5A 2UUZA 3REOA 3IWZA 3WE3A 2HYGD 3W6JB 5J8CA 4A3KJ 1NK3P 2ETHA 1J09A 1QZYA 3B73A 4BNCA 4KNYA 4GYGA 3P9KA 1TQIA 4WXCA 2WV1A 4E4HA 2M34A 3LQRA 3BZ6A 2Q2EA 1X3UA 2WY8Q 5AIPA 3JRIA 4BQAA 2PJPA 1LFPA 5K7HA 2K3PA 4HNUA 1DGWY 1DU0A 3E3VA 3T8TA 2E2IJ 3I59B 2VC1A 2FX0A 2DFIA 4PSWA 3SXYA 2Z1DA 4CCOA 1ZRFA 4O3MA 3ROUA 3RPQA 4QWQA 4B4CA 5HVQC 3F23A 2EK5A 2XKPA 4NC8A 3GZ5A 5J1RA 1SFXA 3LSRA 1D8KA 5C4XJ 2ZXJA 2E1MB 5LRSA 5J4YA 1U5TA 4A3EJ 2GWRA 4R79A 3CUQC 3H0GJ 1JUSA 3A02A 5JI6A 3OOPA 2JK3A 1W4MA 4PJMA 4XRFA 2K9QA 3H0DA 4E7HA 3ZQFA 1B4AA 2X6WA 1IN5A 2RNGA 1W7PD 2HXIA 1IUYA 3K4JA 5FFXA 2E71A 3R4KA 3LSMA 2MH9A 1ETQA 2QGUA 2L01A 2LOOA 3CTAA 5EEGA 3S32A 1BL0A 3WTYC 2HYJA 5HNHA 4FASD 2OF7A 3M07A 1R71A 2ZCWA 4ZYDA 5HOOA 1TLHB 3JTGA 2HKXA 5AIQA 1LFBA 1WJCA 3G1MA 2EPFA 4FE7A 4CXFA 2GM4A 4BGDA 3S15J 3HPGA 2VIXA 2LSOA 2QLZA 5HLIA 1G3YA 2H1LA 2EQRA 3F8BA 2F5FA 3FMSA 1Y56A 3KLOA 2V6EA 4XLAA 2E2JJ 1P2FA 4J01A 3HKZN 4FE4A 4QIWN 3S1MJ 5J1UA 5EG0A 1ULYA 1K6OA 1R5GA 2PMUA 4MQVA 5BMZA 3BPVA 1XX5A 1EV7A 4D5FA 3LFKA 3HKZA 3F0CA 4LG0B 4ZZLA 2NVYJ 1ETXA 1GV2A 1YITI 2VBXA 4HG2A 2PQ8A 1AWCA 1ZRCA 4IKFA 4PGGA 2DODA 1I6HJ 1T39A 3WHBA 3LMMA 2Y0SN 2DYSH 3V7CA 3VEPA 1YW8A 2GZWA 4JQFA 1GVJA 3K4BA 2DMNA 5GPAA 3D5LA 3BCBA 2ZBKA 3PSFA 3QAHA 1Q1VA 1C0WA 2I8DA 2Y69H 1FOXA 3IKTA 4BDYA 2BE5F 1UELB 3WG7H 4IRIA 1XMKA 2VONA 3TP3A 2FQ3A 1JUMA 2QSGX 3C2HA 1DP3A 3EUKL 1IN8A 1JHHA 1TT0A 4EJUA 3E5QA 5DV5A 1MIJA 3OMYA 4XN0A 2MC4A 4OINF 3QPLA 2DT5A 1R9TJ 2KJCA 2NOGA 2M1BA 4V2FA 2XRNA 4CYCB 2O61A 4Q48A 3CO6C 3QRFF 5EEHA 2W00A 2LREA 4BU2A 4YFNF 3DKWA 1WFXA 1Z67A 2H6BA 3OR2C 3CESA 1K78A 5L3FA 3WTSC 2EFOA 3CMEI 2LR8A 3OYCA 3SZTA 2ZSIB 2BVMA 2RN7A 5J3LA 3FMRA 2K3FA 4MFEA 2XHKA 4GGGA 1XDSA 4XLPF 4G9YA 1P4WA 2YUSA 5FO5A 1U9OA 3V42A 1W0TA 4QLCU 4JK1X 3N4MA 1VQ7I 2HGCA 3UKGA 3GX4X 2PEXA 1YW9A 4O5VA 2P8TA 3LL7A 1K4SA 4I2OA 2DJNA 1X2MA 3QYBA 3FKJA 2A05A 1IRXA 4P55A 4UV9A 2Y48A 2ZXWH 4BHPA 1DU6A 3M8EA 2HOSA 1OCPA 2K9NA 3Q3SA 2DTRA 2DK5A 3BG5A 3I71A 2LC2A 3OWTA 3ZCOA 3I54A 4C30A 2ICWG 4LG3A 1ZG1A 1AKHA 2VC0A 3E6BA 1RUNA 2MSYA 2A6EF 2L02A 3KP6A 5F08A 4LK1F 3GVAA 3HM5A 1K4TA 2LKSA 1ZQ3P 5E3NA 1SVLA 3TO9A 2LF7A 4PJNA 3SZPA 5J47A 1MMNA 1SD5A 2E7WA 2VKEA 1JKPC 2XF7A 2WTEA 2NS7A 3S8PA 2XV4S 2L3DA 3SHFA 1A6IA 1IDZA 1SAUA 3JRGA 4ZDOA 1S6LA 5H2FC 1BI1A 3K4KA 1G6NA 2W7NA 5M5YJ 1KU7A 5F04A 1J2XA 1BI2A 4LLLA 2ME6A 2JRMA 3HGYA 4A2UA 3DPLC 4UXNA 2MH2A 5FROA 3CZ6A 1R7JA 1T0FC 4F93B 4YFKF 3I4MJ 1WHUA 5E8GA 4XIDA 4MO7A 4XN3A 3G71I 3OOUA 3I58A 1R4NB 4LIVA 4NB5A 2R0QC 1OQYA 2E5NA 3BR6A 2P6SA 5L3GA 4R1HA 1D3YA 4G12A 2L7ZA 2R7ZJ 3S2DJ 1HLVA 3GFIA 2X1EA 3OIQA 3BR1A 3HRUA 2LF8A 2X0LA 2FQ4A 1Z21A 1FWZA 1EH8A 3QU6A 5F0FA 5E20A 5CKTA 4L9NA 4I01A 3I55I 1MGTA 1ZLJA 2P4WA 2X1CA 4X1EA 3CC7I 3IH3A 4EVIA 2CJJA 2V26A 5JR3A 1K7AA 5B3SH 1ETWA 2Q0OA 1G4DA 5D8LB 3NAUA 4BXUA 2HTSA 3LSTA 4AIHA 2O8KA 3H92A 4M72A 1JI8A 2A6HF 4E7SA 5K5QA 2K4BA 3RZOJ 1OCCH 2HVRA 3TL4X 1MJ9A 2DDAA 4CYCA 2LBFB 3JAMZ 3KP2A 5L3BA 1PJRA 3ZQIA 2FMLA 2W24A 4I7HA 5TISC 4C3HJ 2ZJPF 2O9LA 2RREA 3ZQ7A 2E34A 2K02A 1HC8A 2MABA 3WE2A 1H88C 4KA4A 4D7MA 1M1EB 4LK0F 2EFWA 1VF9A 2F4MB 5D8KB 5LGUA 3S1NJ 1TT5B 3OYMA 1LDDA 3M8JA 5CPRB 5K1YA 4TV7A 1YLFA 2MLGA 3F3XA 4LOCA 5KK1A 2VQHA 3WTWC 2OA4A 1XN7A 4I99C 1MDMA 2Z9OA 5DCFA 4AM3A 2YPRA 3CCUI 2W25A 3HUGA 2Z5UA 3AG2H 2NVXJ 3SQNA 1I1GA 3C18A 5HLHA 2ID3A 3CF5F 1D5YA 3I0TA 4IXAA 2CW7A 4GFBA 1VFCA 3HOWJ 2IAIA 4A3JJ 2KRCA 3KEYA 3G1LA 2FNPA 1LPQA 2W57A 2I5UA 3A03A 5DD4A 3B02A 2VOPA 1W1WE 1MBHA 3KFWX 5ED4A 3CP2A 4B8XA 4MGRA 4J19A 3VOEA 2KRFA 1FSEA 2IPQX 2DBBA 2VN2A 4B44A 1AA7A 5CVVA 3CJRB 2V1DA 5B1BH 1MDMB 2DJIA 1YRNA 2IEKA 3NWTA 4Y4RA 5JLXA 4C3JJ 3JRDA 3BTIA 3IP4B 4UVAA 3OYAA 4BBRJ 3L2CA 2P81A 3I3LA 3M3YJ 2AS5F 1Z3YA 1IO2A 2YU9J 4XLHA 3RZDJ 3PNTA 3G2BA 4OU0A 2EV0A 2O03A 2DPDA 1UCRA 4B1RA 1YX5A 4B47A 5ILVA 3S3OA 4HEA2 4HLXA 1DDNA 1IN7A 3HZJA 3WTZA 2CFXA 4EV0A 3LA3A 1SD7A 2VJIA 1YOVB 2M5WA 1TZLA 3OYJA 1CF7B 2EIJH 5TJJA 4BE1A 4L18B 4ENMA 2DA1A 3HHGA 1MW7A 4FT8A 3J7ZI 3ZQLA 3K1PA 4IO9F 2Y0SA 2LMDA 4KIFA 4GCVA 3JW4A 3CDHA 1GUUA 4RB1A 1R49A 4M71A 3U2RA 2HPMA 1E17A 1JKOC 1OR7A 2HEOA 1LNWA 4G94A 2IW5A 4K2EA 2OTJI 1O57A 3C3WA 2M8EA 4PJ0C 2VPRA 3B6AA 4S0HB 1J7KA 1KQ9A 4BS9A 1PP8F 2GXAA 2B63J 2IS1A 2L9NA 1FBUA 2VQCA 4L9JA 3A0BC 4OIRF 9ANTA 3LSIA 2XB5A 3CCSI 1VQNI 4F92B 3AG1H 2XF6A 3L7WA 4M3BA 5DTDA 3I64A 1YTYA 3I9V2 4LMYA 4M73A 1UFMA 2RGVA 2COMA 4H4KC 2H8RA 1CGPA 1ITYA 4YIIA 1D1AA 1YS7A 3BTJA 3ZMDA 2V9PA 4Q47A 4KUMA 1T38A 1R00A 2RV8A 3DEWA 3WU2C 2XROA 1B59A 3DF8A 2W1OA 2RQQA 3WTTC 3S2HJ 1XTAA 2M7BA 2X1DA 2E1OA 2ZB9A 2BOLA 2K9LA 3MAJA 2DPUA 4IOAF 3EUHA 2CUFA 3TO7A 3D0SA 1QPMA 1T98A 4CZZA 1X1BA 3UNGC 2WAEA 4X6AJ 3HHHA 4E7IA 4JP0A 3K4MA 2LY2A 4BJ5C 1IXRC 2BY0A 4HSRA 5JHFA 3CLOA 2LYCA 1FLIA 1TWAJ 1MSEC 2YS9A 1G2HA 2F5DA 2QQ8A 1ENHA 4F52A 2XAJA 2PBIA 4L5IA 1ZN2A 1S5LC 1YIOA 3PUFA 4ENNA 1FYLA 2DT6A 1XS9A 1JJ6C 3DWLE 1MH4A 1WWXA 1T33A 4I6ZA 2PFBA 4H0EA 3FM5A 4A3CJ 2X4HA 3DEEA 1WVRA 3M8FA 2GOXB 2B7EA 3ZXSA 5JHUA 4KT5C 1VQKI 1RETA 3IRRA 3BG9A 2BHZA 3ISPA 3QYFA 1ZGJA 3L1PA 1O4XA 1PUEE 2M30A 3K70C 3R6SA 3SDGA 5LEJA 1GDTA 2E19A 2DTZA 2R7RA 1E3HA 1Z77A 3AL0B 2CQQA 1TWGJ 1FIPA 3DBHB 1ZTRA 2ECCA 5DCMB 4ETSA 1YFHA 3AL0C 2EFPA 3CF2A 4KITB 1VQ6I 2CUEA 1X19A 4BHCA 1XGNA 1OCTC 3SZGA 1PVEA 2M2EA 5HS9A 3MVPA 3GZ6A 2EH3A 4RGUA 4XICA 2CUZA 4XKCA 2ECBA 2V4JC 2BV6A 4IHVA 2KJBA 4WXDA 1FPQA 3MWMA 3TW6A 3TGNA 3CCYA 1FMWA 4A3BJ 4HW0A 3BDDA 1YX3A 3CMMA 4Y7NJ 5F0HA 4MFDA 2DA3A 4LJZF 1MNEA 2ZFWA 3KP3A 1OKRA 2DMUA 1E3OC 3S3NA 5CVJA 1UJ8A 1SC7A 2OZUA 5LGNA 1BA5A 2OJED 4DYQA 5L3CA 1VQMI 1IAWA 1BW5A 3WTXC 5BPIA 3BY6A 4Q5SF 1WCMJ 5DUIA 3QPTA 1MBKA 3A4CA 3CMAI 4IHSA 2JSCA 5EF6A 3OYBA 4PFOA 3SEQA 2FD5A 1D0XA 1XGOA 2L0KA 2JA6J 2P5KA 3BR0A 5JVTA 5EGOA 2HPIA 3G73A 2CV1A 2FSWA 4Z2YA 5A2QK 1K78B 2OTLI 3H35A 1Z91A 4IX7A 3D1NI 2PMZN 1ETOA 2EFQA 3DLLF 2M8GX 3HOZJ 3U9GA 4KN4X 5H6RA 4AYBA 3VPRA 2VJ4A 4B09A 4BUPA 4PCQA 2JA7J 4WX9A 4LIUA 1U8BA 4HDUA 3OS1A 2I10A 1MMDA 2DA5A 1IV8A 4RMNA 2NVQJ 4HF2A 5LHIA 1R5ID 1UG0A 2ZNYA 4WF2A 1K61A 2L4MA 4Y52J 2ISZA 1KQ8A 4XRSG 2MLKA 1MBGA 2KISA 1X1PA 3VB2A 4ABZA 4V2GA 1BJZA 2NYXA 1S9HA 3HB9A 1XG1A 3RQ4A 4BEHA 4PJLA 4BDZA 1P4AA 2O8XA 4CUGA 2D1VA 1VQ9I 1JTYA 3CDIA 5FLMJ 2FMYA 1QQIA 3QOPA 4M3FA 3A2KA 1MBFA 2VE8A 2ADUA 1TWFJ 3J7AO 3DKYA 2C6YA 1D5VA 2Y31A 4BAYA 1USTA 4EQQA 2OCEA 2HU9A 3HRSA 2HS5A 3BP8A 4AUXA 4KFCA 1QPIA 4AD9A 1T0FA 4KMUX 3AFHA 1R36A 3H9GA 4U0YA 3KZIC 4RB3C 4PDKA 1YE9A 3LSHA 1TWCJ 4BHBA 4DIQA 1YYVA 3F21A 3H3UA 2BHYA 2GLOA 5ICGA 3HXLA 3JTHA 4EJOA 3BG7A 2R5ZB 4G6QA 3HSFA 2CU7A 1O7LA 4AIJA 1N75A 1HOMA 2AO9A 1IC8A 3K70D 1ZR4A 2VLAA 3GTQJ 5JLWA 3RCOA 1FY7A 5E3LA 3CUQA 2A5WA 1PYVA 2GA2A 1FT9A 1ONVA 2CMPA 5EZHA 1NH3A 2CQ7A 5E3OA 2FOWA 3DP7A 3MKLA 2HVQA 4P9UA 4RM3A 4II3A 2UZKA 1N78A 1BI0A 3C7JA 2BW3A 4RLQA 2X48A 2XKOA 2JUCA 2O7OA 2LVSA 3LA7A 2A07F 1WPKA 5FLXK 4YRVA 4CICA 5E17F 2R7DA 2Y75A 2WBMA 3B6CA 3IAM2 2KKOA 2L2OA 5LGTA 1MJAA 1JUPA 4Q4ZF 5IYCJ 1ACIA 2L9VA 4FCYA 2LLKA 1FBQA 1MKMA 1LEAA 1Z6TA 4UB8C 1W5CC 4JBAA 2GIVA 1X3ZB 2WA0A 3LAPA 4LGWA 3J81K 4BBSJ 4A6DA 1MMSA 3DLAA 3O6BB 3KETA 2L5QA 1FYKA 4A6EA 4XQFA 4EEFG 4NHJA 1RIOH 4ZTFA 1WKMA 3P5JA 3BWGA 2GOMA 1I39A 3FF5A 3VYSB 4E7LA 5EDNA 2JVGA 2V1UA 2ZFUA 2KLOA 4EM0B 5ILUA 2LY1A 1BOBA 1SMYF 1ERDA 1HXDA 5F6FA 1R1TA 4DNCA 1BJAA 4UY8I 2XAHA 2KDZA 2XPUA 5ILSA 5BS6A 1EA3A 4AVPA 4B43A 3LAJA 3KYLA 1USSA 3BJ6A 3I4PA 1JTXA 2LKXA 2VXDA 3K1NA 2JA2A 3O2PE 2HZTA 1FOWA 5CVRA 4NC7A 1OYWA 4UUSA 4L9TA 3E5XA 2XGCA 2BYVE 4EJVA 1NG6A 2ELHA 1AKHB 3HOUJ 3BROA 3GCMA 4G7OF 3T1BA 2FU4A 1R5HA 5E1XA 5FD5A 2DK8A 2K4JA 5GAEJ 4EM2A 2KIFA 4PJJA 4GO1A 3MKZA 3DCFA 2BZTA 5DUKA 2DYRH 4OIQF 1A5JA 3ECHA 4M3EA 2L9RA 5CQGA 2ZMEC 4L5JA 2VQGA 2G7UA 3M7GA 2L7FP 3WU1B 3W2AA 3SYTA 3PNYA 4M74A 1VQOI 1B1BA 5EG0B 1NG7A 3OS0A 1TC3C 5CVIA 1YJ9I 4G8XA 3G3ZA 1HW1A 1RPWA 4JYKA 2EFNA 5D5UB 2BY3A 2W84A 4PSXA 1YO5C 2QBYB 3WTVC 1V5EA 5IT9K 3W3CA 4C9YA 2X85A 4QPOA 3PL8A 5EEAA 4A5NA 2V6CA 1IJWC 3FXRA 3WGIA 4I98B 3VYRB 3G4SI 2Y0MA 3JRFA 3OYIA 2XAFA 1QZEA 1FP2A 3BQZA 3D5SC 3R0JA 3W6KB 2Z16A 1V5GA 5D6FA 1I3AA 2DOEA 4EGZA 4BXXJ 1J0RA 3WODF 3LOCA 1R23A 2NS0A 1Z9CA 2HOAA 2QM3A 1Z7UA 5TGTA 5GTIC 1F4KA 1FSHA 1VQLI 1GVDA 5K5OA 5HNFA 1WJBA 4LG0A 3IWFA 2K85A 3ONQA 2ZJ2A 3RKXA 1OFCX 1YIJI 1A35A 3HG9A 3A01A 1FP1D 4DZJA 3PQKA 3FXOA 3JSOA 3ELKA 1B8IB 2PLYA 4BQQA 4EGYA 5JFRA 3JRAA 2GAUA 1EH6A 2QEXI 1APLC 3P9IA 4OMYA 3C2GA 5FKLA 3EQLF 3F6VA 1OMIA 3OYHA 1BR2A 2LTPA 1HA8A 3GTGJ 1NK2P 3WHCA 4YIFA 5F1JA 2L4AA 1FIAA 2VT3A 4HX8A 1WJDA 2QSHX 1IN4A 2JVHA 4KJZA 2ZC2A 1EJ9A 4DQ2A 3M1EA 3HBLA 4I09A 2AQFA 1I6XA 2D1HA 3FDYA 5CQEA 4QTRA 2D2WA 4AWXB 2EA4A 1MNMC 1Z6RA 2ZNZA 3HL2A 1P7IA 3DKXA 2IP2A 1WJ5A 1ZGAA 2Y30A 3SJMA 3BCAA 4UNOA 3E1SA 2F2EA 1BBYA 2CQXA 5IP7J 4E7KA 3DU6A 3FZVA 4IJAA 2FBIA 4CZCA 2HVSA 1U8RA 5D5WB 5A2QZ 1PUFA 4F7ZA 3OIPA 1B6AA 3CJNA 1HBXG 1DPRA 2M7AA 1IF1A 1UMQA 3VSLA 1XCBA 3Q0WA 3SFIA 5J4VA 1MJBA 3V8LA 2RC4A 3ZN1A 5TRDA 1T8IA 3KLNA 4CCNA 2Q8KA 5GADJ 2IRFG 1G59A 2HZDA 3GBGA 4IL6C 1ETKA 1F36A 1HSJA 1RESA 3CCEI 3LSPA 5FD6A 4Y17A 2PG4A 2JUGA 3S93A 5LHGA 4Z6YA 3K69A 5GAGJ 2M9HA 1X4OA 1XMXA 3BQYA 1O3QA 2E1MC 2DOFA 3A1YA 3RPUD 4I02A 4C2MJ 2ESNA 4RAYA 4RDUA 1MZBA 3I56I 2O3FA 4EMSA 2BY1A 3O8HA 2XUBA 1FOKA 3L2VA 2KIQA 3BR3A 1HKQA 1ZYRF 2E36A 3KP7A 1RC9A 2ID6A 2YU3A 1EKEA 3KEOA 3S3MA 5HS7A 4HLYA 2R92J 2VT2A 3FM3A 2VB6A 1W5SA 3JCUC 4ESFA 1F9NA 1OPCA 5DM7F 2W82A 1BW6A 1WQ2A 3K6GA 1ZGWA 3BT9A 5E1ZB 1OLTA 2P0WA 2E7XA 3OYDA 3HYIA 1QHHD 1QHGA 4HV5A 4ESJA 3KZYA 3JRHA 2EZIA 3QPSA 3OL4A 1RR8C 3H36A 3N05A 3L09A 3BPXA 3VYTB 1IUFA 2JT1A 2QCOA 2CV0A 2X6YA 2CSOA 2VKHA 3HUGB 2IT0A 1P92A 2M0CA 3OYLA 4IF4A 1X4PA 1G3TA 2R4GA 4P96A 4CGZA 4HZFA 3KZZA 3PNVA 4FISA 2TCTA 2HDDA 4U0VA 3P7NA 1SFEA 3EYIA 2R7FA 2M4KA 5AONA 3N97A 2UXNA 3HSEA 4JX6A 3FBIB 4PUSA 1ZARA 2EA2A 4M6VA 1KYZA 2XDVA 2ZXIA 3R0AA 2KQRA 2OQRA 4A3DJ 4RAFA 4XBFA 2MD0A 4DGWB 5ICEA 1E3PA 3F6OA 5E18F 5FRNA 2F4IA 3CUOA 2CQNA 1D8JA 3GW2A 4CA0A 4G6DA 4CDGA 2MGQA 2TRTA 2EJRA 2LDUA 3GLXA 3HDDA 5K7ZA 3BC8A 3K9TA 5J40A 1WZ2A 3R61A 4OAZA 1HDDC 2FJ1A 2EZLA 1WSUA 3VWBA 2JWTA 1X1CA 1RI7A 2A5YB 1LJ9A 2PJRA 2M0MA 1Z3XA 2K27A 2RQPA 1S8NA 5H6QA 4P9FA 3RYRA 2BVLA 3RKWA 2EWNA 3GTKJ 3HC7A 3WG9A 1A36A 1D1BA 4IHXA 1LUJB 2ESHA 2QVOA 1CQTA 1J75A 2MG4A 1I5ZA 4XKBA 2Z33A 3CCRI 4HYEA 2MA3A 2CH0A 1U5TB 1OYIA 3VYUB 4BEHB 3FXLA 2A61A 3FXMA 3HJEA 4ZYAA 5H20A 3IH2A 1V55H 4L5EA 1GXPA 4FTHA 3W2WA 2OV7A 2BXZA 2COBA 3L2QA 3VFZA 4XK4A 4UVCA 4OIOF 3ML6A 1VQ5I 4D5CA 2ISYA 2R5YB 4U7BA 2Z99A 3P9CA 3DPUA 4FQGA 1F5TA 4HBLA 1XMAA 2CO5A 5DYMA 4G7HF 2M3AA 1XCVA 5LHHA 4EJTA 3FXKA 1WGXA 5B66C 4XL9A 3K0LA 5M3FJ 1RZ4A 1TNSA 1ZK8A 1ODDA 3U21A 3MKYB 2J5OA 1YJNI 4RGXA 1TP4A 5CVUA 1BOAA 2EINH 3K4NA 1LVAA 3OIOA 4BACA 1GHCA 2VPLA 2PMZA 3ULQB 2JZYA 4XKVA 3K7AJ 4M6XA 5HDGA 1O3SA 1VI0A 2R5YA 3Q0VA 1W5TA 3EETA 4UV8A 4CHUA 3JRBA 2BBYA 2RVCA 5B5EC 1SANA 3WGHA 2K9MA 2IGKA 3BTCA 3RPUA 2G0EA 1H89C 5K5RA 2YX4A 4OMZA 4ON0A 1LE8B 4G7ZF 2R7VA 4F3QA 1W0UA 5IT9Z 2OZ6A 1IN6A 4MIMA 1FC3A 3V7SA 3CCLI 2XPWA 2ELKA 3ZOBA 4HF0A 3E97A 5HDKA 4L0ZB 4A3GJ 3LWFA 2F5EA 4L9VA 2OD5A 1L3LA 2VASA 4EJWA 3CC4I 1TQPA 3PJRA 4NNJA 2EV6A 4A3FJ 2OQGA 2JN6A 2E60A 1XGMA 1QA6A 2XAQA 3LNQA 3I53A 5DEQA 3PFYA 4OOIA 3ZMZA 4ESBA 3QU3A 2XVCA 2R7XA 4HNVA 1CF7A 2IA2A 3GZNB 2L7KA 4U88A 2VXZA 4ZYGA 5IOYA 3FMQA 2NNNA 1XSDA 2YX7A 4N4NB 2HQAA 5BNGA 2MC3A 1FX7A 4HNTA 2IS4A 3QQAA 4II2A 2W4SA 3K2AA 1J5YA 1HSTA 1N77A 2VI6A 1IV6A 3OSGA 2CFOA 4XM3A 2P5LC 2QQ9A 1MBEA 1X3WB 3IV5A 1Y0UA 2R93J 3AG3H 4CSWA 2BEOA 3A01B 3IH4A 3QOEA 1FTZA 2H6CA 1B8IA 3GFJA 2VL8A 3MZHA 3CLQA 4ZTJA 2VJJA 3HOSA 1Z1DA 1T2KA 2YR2A 3CMYA 2LFBA 2FXAA 1JXSA 1I27A 2DN0A 4M3DA 1FEXA 3MCZA 1OJLA 3S16J 1WJFA 1GLNA 4ZYHA 4L0YB 2IGNA 4XSZF 2HXOA 4OIPF 2X9DA 2OC6A 3PFIA 3RYPA 1ZLKA 3W6VA 3JR9A 1VQ8I 1IZ1A 3HOVJ 1FOYA 1RKTA 1SAXA 3ERED 4HDVA 3C2BA 2J5PA 2Y9YA 4UUSB 3FX3A 5F27A 1TTYA 1TWHJ 1X58A 2AXLA 3M9AA 3L2UA 2ZKZA 1WJAA 2X6XA 1ON1A 1LKXA 1Y1VJ 1SD6A 3RTRA 4N9HA 2XIGA 3ZQGA 3H5NA 4MEYF 1A31A 2CV2A 1NTCA 3KYDB 3RIRA 2ZJRF 3GF2A 3UR3C 3GTJJ 1F1ZA 3TDUC 3TKYA 4JX4A 3Q9VA 2HTJA 2R7OA 2VKVA 2QZ8A 4WCGA 4IHYA 1RKWA 2EILH 5F0CA 3EUAA 4NBQA 4YELA 2FUG2 3HOTA 4CCKA 1ZG5A 4UVBA 2IBDA 1BIAA 3VSKA 4DJAA 1BC8C 1UG2A 3RQIA 2QYOA 3H3VK 3K4CA 2ELJA 1I1SA 4M3GA 4IPAA 3CCMI 1YHQI 1IRGA 2BW3B 3OV8A 1AOYA 4Y3OA 2NOJB 1W36D 2DA4A 4NDLA 1SFUA 1PP7U 1S72I 4N0BA 3EPZA 1BR4A 2KFDA 1ZREA 4KDPA 4P1WA 2DFHA 4N9IA 2DMPA 2DI3A 1K79A 2NVTJ 4NUBA 4C3IJ 5E3MA 2HWVA 3J7AY 2BGCA 4BE0A 4I0AA 2DXIA 4PZJA 4XNFA 5M5WJ 4A12A 5FJ8J 1IXCA 5HLTA 2MBFA 1RR7A 2K7LA 3IKVA 1YI2I 3SEZA 3GWZA 1XPXA 4YEJA 1V5FA 3TW7A 1ORKA 1KGSA 3ABKH 2E2HJ 3KIOA 1Y8QB 4XORA 4UUVA 3MFKA 1BC7C 4V19K 3TO6A 3DV8A 1KQ0A 2KZVA 2P7CB 2DDBA 4RS8A 1MD0A 2K40A 4IEJA 2D45A 1R58A 1TL8A 4XONA 4RM2A 1JJ8C 1Z7LA 2R5ZA 1LDJA 1MBJA
chains in the Genus database with same CATH topology
1WJBA 1MNDA 3ONQA 4DBQA 3HG9A 3L2RA 1D0ZA 2VJ5A 3CP2A 3DU5A 4BE2A 4X0GA 4IZZA 4BQQA 4B44A 1AA7A 2M4GA 4LITA 2Z2SB 3CJRB 2IGMA 3C2GA 1X1AA 2DJIA 3DPTA 4BL0B 4B48A 3OYHA 1BR2A 3NWTA 4Y4RA 4BXFA 1HA8A 2LG4A 2R7QA 2V1NA 2CS3A 3IP4B 4E7ZA 3OYAA 1FMVA 1WJDA 3I3LA 1Z3YA 2JVHA 4XLHA 4KJZA 2IGOA 3PNTA 4BJTA 3OL3A 3G2BA 2PJRB 4N4OB 2AQFA 3D5RC 4RLFA 3H9QA 4C2UA 3FDYA 5CQEA 3LSGA 4XLEA 3OYGA 3HL2A 1YX5A 3BG6A 3DKXA 3DQVC 4NQWB 4B47A 1WJ5A 2O5RA 3S3OA 4HEA2 3BCAA 2DT7B 4PFPA 2A6TA 3E1SA 3PSIA 1ZELA 2VJIA 4E7KA 3DU6A 3FBNB 1TZLA 4F55A 5KCMA 3OYJA 4CZCA 4BE1A 2HVSA 4CCJA 1Y6IA 3OIPA 4ANJA 1MW7A 2M7AA 1LDKB 3VSLA 3CJQB 4Y33A 2Y0SA 4BQOA 5FRMA 2UWMA 3DTIA 2HPMA 3OR1C 3OYNA 4CCNA 1DGRM 1G59A 2HNHA 2HZDA 3GBGA 3OY9A 3LFUA 2WADA 4C2TA 2JUGA 3PUBA 3S93A 4BS9A 2IS1A 2L9NA 3ZQQA 2VQCA 4P5OA 1X4OA 3LSIA 2E1MC 3QYEA 4F92B 3A1YA 3RPUD 4XOPA 4BQNA 2XF6A 1D1CA 3TBIA 4DOZA 3OYFA 3VDXA 4J00A 4IQ4A 3I9V2 2KHMA 2Q1ZB 3MMYB 3L2VA 2VQLA 3TMOA 4D1QA 2V7FA 4H4KC 2QKLB 1LVKA 1D1AA 3S3MA 4E7JA 3OS2A 2W1OA 2RQQA 2VB6A 4JOMA 2M7BA 2X1DA 5LFAA 2BOLA 2K9LA 4KT6A 4IQJA 1U0JA 2W82A 1P9QC 5KNLA 2OUMA 3K6GA 3FHNA 4OAYA 4G6TB 1OLTA 1X1BA 2P0WA 1K6YA 3UNGC 2WAEA 3OYDA 1QHHD 1QHGA 4E7IA 4BJ5C 3K4MA 2LY2A 4CCMA 4HSRA 3AKZA 5JHFA 4XKWA 2LYCA 3OL4A 3N05A 3VYTB 4F52A 2UUZA 2CV0A 2X6YA 2VKHA 3HUGB 1J09A 3OYLA 4PK4A 3MKWB 1X4PA 3NWSA 2R4GA 2MFZA 3PNVA 2DT6A 3KX2A 3DWLE 4E4HA 2M4KA 4AVZA 4XLCA 2WY8Q 3FBIB 4PUSA 1LFPA 2K3PA 4MLOA 1DGWY 4HNUA 3DEEA 2GOXB 2XDVA 2ZXIA 2KQRA 2MD0A 3ZXSA 4DGWB 4AU7A 5LD2C 5FRNA 4PSWA 2Z1DA 4CCOA 2F4IA 4F91B 4D9JA 5HVQC 3QYFA 4CA0A 4NC8A 3MD2A 3K70C 2E1MB 3BC8A 4R79A 4CCLA 4OAZA 1D0YA 2R7RA 4PJMA 3VWBA 1X1CA 4ZDLA 3AL0B 3H0DA 4E7HA 2CUJA 2X6WA 2RNGA 1W36C 3K4JA 3K4LA 1DQUA 2PJRA 2M0MA 3AL0C 1Z3XA 3IAS2 3CF2A 3LSMA 4KITB 2LOOA 1X19A 2BVLA 3S32A 2DCEA 5HNHA 4FASD 3HC7A 3SZGA 5HOOA 1D1BA 4XLFA 1X1DA 4HSTA 2X51A 2CUZA 2MYSA 4XKCA 1WJCA 4XKBA 4DBRA 4BGDA 3HPGA 2VIXA 2CH0A 3VYUB 2V4JC 4BEHB 3ZR8X 2V9KA 2KPMA 1Y56A 1FMWA 4FETA 2V6EA 4XLAA 1BR1A 4J01A 4ZYAA 4E6KG 1YX3A 3CMMA 2XF5A 3W2WA 2ZXHA 2OV7A 2LH9A 3OYKA 1MNEA 3L2QA 4EATA 1E0EA 3HKZA 2WY7Q 2IXSA 2KDOA 4U7BA 3DPUA 2XAUA 3S3NA 4HG2A 2R7SA 2DOAA 4IKFA 2LRDA 2KRHA 2M3AA 3CP8A 4BJ6C 2F5VA 3LMMA 4XL9A 3U21A 3MKYB 3A4CA 2VKDA 3K4NA 4BACA 3OYBA 4PFOA 4ITVA 4JQFA 3K4BA 4OWRB 3SEQA 2VPLA 1D0XA 3D5LA 3BCBA 2PMZA 3PSFA 2HPIA 2CV1A 2I8DA 4XKVA 3H35A 4IX7A 4BDYA 1UELB 2L9SA 4AYBA 4BUPA 2VJ4A 2KMUA 4LIUA 3C2HA 1DP3A 3OS1A 2K9MA 2IGKA 3EUKL 1MMDA 4RMNA 3DTKA 1TT0A 2KL4A 1UG0A 5KHDA 3RSNA 2R7VA 3OMYA 4F3QA 4XN0A 2MC4A 3K10A 4BEHA 2XSJC 1S9HA 3RQ4A 4PJLA 4CH7A 4BDZA 4ZC3A 2IS6A 4CUGA 2VASA 2E5ZA 3QODA 3DTEA 3A2KA 2W00A 2LREA 3PJRA 4NNJA 4BU2A 1T95A 3OR2C 1WFXA 3CESA 2E60A 4XR6A 4GRIA 3DKYA 2K5CA 3PFYA 1VZ0A 3OYCA 3IUOA 2ZSIB 2BVMA 2Q2EB 2HU9A 2R7XA 3BLYA 3H5RA 4ZJZA 4ZDPA 2L7KA 2VXZA 3L2WA 3E0JB 3AFHA 4N4NB 2R7TA 2HQAA 3H9GA 3V42A 4HNTA 1YE9A 3LSHA 4HPQA 2IS4A 4II2A 2W4SA 4DIQA 2ZSHB 1N77A 1WJEA 3HPHA 3HXLA 3BG7A 3LL7A 2CFOA 3QYBA 4XM3A 3FKJA 1IRXA 1N75A 3K70D 4CSWA 2VLAA 3RCOA 3QOEA 2R7WA 2LC2A 3OWTA 1G8XA 2A5WA 3H9JA 1PYVA 3ZCOA 4C30A 2CMPA 4LG3A 2VL8A 4ZTJA 2VJJA 3HOSA 2HVQA 4RM3A 4II3A 1N78A 1SFKA 2JSPA 2BW3A 4RLQA 3LSKA 3EUHC 1WJFA 1GLNA 3W2VA 2IGNA 4PJNA 4YRVA 1MMNA 2OC6A 2XF7A 3S8PA 2WBMA 2LBFA 3IAM2 2KP6A 2L2OA 3M1CA 1SAUA 4ZDOA 2WAFA 3K4KA 2W7NA 2WA0A 3L2UA 2WAQA 2R7UA 1WJAA 2X6XA 4HRIA 3DPLC 1LKXA 1MMAA 3DLAA 3CZ6A 5FROA 1T0FC 4F93B 2L5QA 3RTRA 4XN3A 4XQFA 3H5NA 1QU3A 4ZTFA 2CV2A 3VYSB 2GOMA 1R6RA 4E7LA 3SDBA 2JVGA 2ZFUA 2KLOA 3OOUA 3UR3C 4LIVA 1OR7C 2LY1A 1BOBA 1ERDA 2E5NA 4XMYA 2R7OA 3EUAA 4YELA 2FUG2 1EA3A 4B43A 3KYLA 2X1EA 3OIQA 3HOTA 4CCKA 2VXDA 2JA2A 3VSKA 4B3XA 4DJAA 4NC7A 1Z21A 1NG6A 2CW8A 5CKTA 3K4CA 2ELJA 2X1CA 4U87A 1MMGA 2V26A 2F6CA 1KONA 2BW3B 4PJJA 3MKZA 4Y3OA 2NOJB 2XC7A 1W36D 2UV1A 3EPZA 1BR4A 4P1WA 5CQGA 1JI8A 2VQGA 4E7SA 3W2AA 4NUBA 3SYTA 3PNYA 3ZGKA 2HVRA 3J7AY 3TL4X 2WB1A 2LBFB 4BE0A 3OS0A 1NG7A 4XNFA 2DXIA 1PJRA 3H5AA 2RREA 2QKMB 4PSXA 1V5EA 2IS2A 5HLTA 2MABA 4QPQA 3W3CA 4C9YA 4KISA 2X85A 4QPOA 3PL8A 3SEZA 3ZRGA 3F9KA 4YEJA 1V5FA 3VYRB 4XORA 3OYIA 3D5SC 3OYMA 5CPRB 3M8JA 1UAAA 2Z16A 1V5GA 2VQHA 2KZVA 2AQEA 3OYEA 4XONA 4XOTA 4RM2A 2HDWA 5TGTA 2CW7A 1Z7LA 2KRCA 3KEYA 5HNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBI A; 
#chains in the Genus database with same CATH topology
 4FX0 A;  2IA1 A;  1MND A;  4M9X A;  4XRM A;  4A3L J;  3F8C A;  5L3E A;  1POG A;  2M87 A;  3ABM H;  5LBQ A;  3L2R A;  4IOC F;  3R60 A;  2VJ5 A;  2CQK A;  5L3D A;  2PI0 A;  3DU5 A;  4B3A A;  1ZH5 A;  1RUO A;  4X0G A;  2JTV A;  2K9S A;  2M4G A;  2EZH A;  2Z2S B;  1U5T C;  2IGM A;  2JPB A;  3QPH A;  5IP6 A;  1FJL A;  4BL0 B;  4B48 A;  1TNT A;  4BXF A;  1VQP I;  2R7Q A;  2V1N A;  2H09 A;  1Y8R B;  3H1C A;  1IW7 F;  3IL2 A;  1JHF A;  4HAM A;  5ICC A;  1JGS A;  1XSX A;  1ZHF A;  3TOB A;  2JA8 J;  4ZZD A;  1S7O A;  3OL3 A;  4BJT A;  2PJR B;  3FXJ A;  3I4N J;  2XAG A;  1R1U A;  4RLF A;  5DCM A;  3E6M A;  3H9Q A;  1AHD P;  5EJC A;  1KYW A;  1L0O C;  3C1D A;  2CRG A;  3EDP A;  2P5V A;  1OCZ H;  4NQW B;  1GV5 A;  3K2Z A;  2A6T A;  1SFO J;  1LB2 A;  3FBN B;  4F55 A;  2ZME B;  2O6G E;  1J59 A;  1A04 A;  1V54 H;  4EM1 A;  1JGG A;  2VOO A;  3E5U A;  5F64 A;  4ANJ A;  1QVT A;  4RBO A;  2X6O A;  3CJQ B;  2NAZ A;  4Y33 A;  4IRH A;  3KP4 A;  4I0B A;  5FRM A;  2UWM A;  5M5X J;  3BJO A;  3PM1 A;  3OYN A;  4ASN A;  2DFE A;  1WRJ A;  2QUF A;  4S04 A;  2GA1 A;  3IRQ A;  2FEZ A;  3OY9 A;  5KAI C;  2FRH A;  1I3Q J;  3WU0 A;  4NQW A;  3RJP A;  2WAD A;  5DS9 A;  4A0Z A;  3EYY A;  3KCC A;  3DXJ F;  4BY7 J;  4C2T A;  3PUB A;  4WWC A;  4O6J A;  3HRM A;  4HOB A;  4RB0 A;  2VUM J;  4HF1 A;  1HDP A;  3QYE A;  1XD7 A;  3ZMT A;  4I76 A;  3TBI A;  4DOZ A;  3HSR A;  1QBJ A;  2PN6 A;  1RNL A;  1IGN A;  3GFM A;  1BI3 A;  4YG2 F;  2KHM A;  3CC2 I;  1EH7 A;  1JT6 A;  5BQT A;  1UZC A;  3TMO A;  5K7F A;  3ZPL A;  2L54 A;  1DP7 P;  1LVK A;  3AAF A;  1T56 A;  2GBY A;  1NHA A;  2LK2 A;  2RAE A;  3DEU A;  4E7J A;  3OS2 A;  3M4O J;  3BR5 A;  5BPD A;  1B72 A;  2A69 F;  3FIW A;  3CQZ J;  1BM9 A;  3GO5 A;  1LQ1 A;  1QVU A;  4ZH4 F;  3GTP J;  4JOM A;  4KT6 A;  3NRV A;  4FX4 A;  4IQJ A;  2N8G A;  1P9Q C;  5KNL A;  3HOY J;  2OUM A;  2E1N A;  3FHN A;  4OAY A;  4G6T B;  2GXB A;  1R4M B;  2PX9 A;  1K6Y A;  4S05 A;  4CCM A;  4UUT A;  2NS8 A;  3AKZ A;  3ECO A;  3J81 Z;  3ERM A;  4CYD A;  2IA0 A;  2QQA A;  3KEQ A;  2VBY A;  3MN2 A;  2GIZ A;  4KIB A;  4PK4 A;  1G3S A;  4YFX F;  3MKW B;  3NWS A;  4LLN A;  2MFZ A;  1ETY A;  3T8R A;  5J1Y A;  3KX2 A;  3JRE A;  2WV0 A;  4AVZ A;  3S1Q J;  1FTT A;  4XLC A;  3KYC B;  3T5X A;  1AU7 A;  1YQA A;  3CD6 I;  1ZG3 A;  4MLO A;  1XSV A;  3HIF A;  1FZP B;  4XLN F;  4LFU A;  2AHQ A;  1P4X A;  2DQL A;  3RDI A;  1H0M A;  2JQ7 A;  4AU7 A;  5JVG F;  3BOQ A;  5LD2 C;  2QA4 I;  2P6T A;  2XAS A;  4AIK A;  4F91 B;  4D9J A;  3GYH X;  1JE8 A;  2XGD A;  4LB6 B;  3FXQ A;  5LRR A;  1MSF C;  3JAM K;  3ZN0 A;  2CGP A;  3MD2 A;  3PQJ A;  5C3E J;  4CCL A;  5HOD A;  3V8K A;  1D0Y A;  2DQR A;  2QF7 A;  5C44 J;  1S29 A;  2EV5 A;  2IVM A;  1ZR2 A;  3KE2 A;  4XSX F;  5DM6 F;  4ZDL A;  3Q9S A;  1Y0N A;  2CUJ A;  2P7V B;  5D4S A;  2DAO A;  1DUX C;  1W36 C;  3K4L A;  1DQU A;  2KT0 A;  4MTD A;  3CCJ I;  3IAS 2;  3ZQH A;  1YG2 A;  2EIM H;  2DCE A;  5C4J J;  3NEU A;  1PDN C;  2ZME A;  3RKQ A;  1O3T A;  4XLF A;  3HEF A;  5CYV A;  1X1D A;  3G6E I;  3LA2 A;  5B1A H;  3ABT A;  3O3K A;  4HST A;  4DYC A;  2X51 A;  2ZJQ F;  2MYS A;  1LE8 A;  2WC2 A;  2CWE A;  2LKP A;  4DBR A;  2HKO A;  1GXQ A;  3HTU A;  2DA7 A;  3ZR8 X;  5HS8 A;  1Z0X A;  2V9K A;  3F72 A;  3J80 K;  2KPM A;  3CCV I;  4FET A;  1BR1 A;  1YS6 A;  3F8N A;  2KIU A;  2JPC A;  4E6K G;  1XGS A;  1OCR H;  2XF5 A;  3NQO A;  2HFH A;  2ZXH A;  4HQM A;  3OYK A;  2LH9 A;  4U0W A;  4MHG A;  4EAT A;  1KU9 A;  1E0E A;  3ZP5 A;  2WY7 Q;  2IXS A;  2KDO A;  3J7Y J;  4ENK A;  4CO8 A;  1Q1H A;  1Z05 A;  2XAU A;  2R7S A;  2O0Y A;  3CO7 C;  1X2N A;  3GLL A;  2XPV A;  2GXG A;  2DOA A;  3ASO H;  2LRD A;  1FBS A;  2KRH A;  3CP8 A;  5DD8 A;  3V4G A;  5FKM A;  3I59 A;  4BJ6 C;  3ESW B;  5FKK A;  3LSJ A;  1ZRD A;  1E2X A;  2F5V A;  2WWY A;  1TW2 A;  2E35 A;  4MNU A;  4D7N A;  3FIS A;  4ZYE A;  2VKD A;  3O8G A;  2JJ7 A;  3TED A;  4ITV A;  2STT A;  4OWR B;  4HX4 A;  2DA6 A;  2F48 A;  3ASN H;  1R22 A;  2R3S A;  4IVN A;  5D5V B;  2HOE A;  2HR3 A;  4AYB N;  3PIO F;  4ENJ A;  2NXN B;  1SMT A;  4D0P A;  3BTL A;  5DDG A;  2L9S A;  3F8M A;  1U9N A;  3A0H C;  3K1M A;  3JSP A;  2KMU A;  4U7D A;  1XB4 A;  4KN7 X;  4DZP A;  3WTU C;  2DW4 A;  1I50 J;  2HQR A;  1SVO A;  3DTK A;  3X2Q H;  1U2W A;  2KL4 A;  5KHD A;  3U1K A;  4DW6 A;  5LEK A;  2DFF A;  3RSN A;  1YRN B;  3L9F A;  1U3E M;  4KYW A;  3CJT B;  3E7L A;  2FOK A;  3K10 A;  4AC0 A;  3COA C;  2NRA C;  2XSJ C;  4KIC A;  2OCC H;  5J6X A;  4A3I J;  5EZG A;  4CH7 A;  2DU9 A;  1IRZ A;  2JRT A;  4ZC3 A;  1BN5 A;  2MW8 A;  1HCR A;  2IS6 A;  4GDF A;  2E5Z A;  4WK8 F;  2CYY A;  3QOD A;  3DTE A;  2L7M P;  1Y39 A;  2H1K A;  1T95 A;  3GME A;  5E1W A;  5ERI A;  1VQ4 I;  4XR6 A;  4GRI A;  5BOX A;  2A68 F;  2PMH A;  2K5C A;  2E1C A;  1VZ0 A;  5GTH C;  3IUO A;  3ABU A;  1XC5 A;  2Q2E B;  1JKQ C;  1UHM A;  3BLY A;  3H5R A;  4ZJZ A;  1QGP A;  4ZDP A;  4HQE A;  3L2W A;  3E0J B;  1PUF B;  5D5X B;  1G3W A;  2R7T A;  3MZ8 A;  4HPQ A;  1H9G A;  3MZY A;  4A69 C;  3KP5 A;  1O7F A;  1V3F A;  3ABL H;  1K83 J;  2ZSH B;  3LQQ A;  1H8A C;  1SD4 A;  3QWL A;  1WJE A;  3HPH A;  3FHZ A;  3DBR B;  3FWE A;  1S3J A;  4A93 J;  1IDY A;  5J8F A;  5KAF C;  3IC7 A;  2GQQ A;  2HQ5 A;  2OPT A;  3QP6 A;  4LLG F;  3PO2 J;  5GAH J;  4HX7 A;  2DMQ A;  2R7W A;  4IHT A;  2HDC A;  1G8X A;  1UHS A;  3H9J A;  2W85 A;  5F1R A;  2W48 A;  4BY1 J;  3CDL A;  5E8I A;  1IXS B;  2F4O B;  4R8H A;  1SFK A;  2JSP A;  3AG4 H;  2FA5 A;  4NC6 A;  4QSH A;  5D4R A;  1SEU A;  5FKO A;  2DA2 A;  3LSK A;  4BKX A;  3BZC A;  3EUH C;  4M9Z A;  1REP C;  3G1O A;  1WH5 A;  2LP0 A;  3ZMU A;  2V9V A;  2EB7 A;  3W2V A;  1V4R A;  4RGR A;  3GTL J;  2LBF A;  2KP6 A;  3M1C A;  1STZ A;  2WAF A;  4GYI A;  2VE9 A;  2QEN A;  3CUQ B;  4Y13 A;  1B72 B;  2WAQ A;  2R7U A;  4HRI A;  1OYY A;  1RRJ A;  1MMA A;  3T0Y A;  4IHW A;  1JKR C;  3E6C C;  2OBP A;  4A5M A;  2DLL A;  4MEX F;  1KA8 A;  1QU3 A;  2LY9 A;  3BJA A;  5IT3 A;  1R6R A;  3MEX A;  2BXY A;  5KVR A;  3SDB A;  3RI4 A;  3FK6 A;  4MTE A;  3GEZ A;  1ZKG A;  1Y1W J;  1OR7 C;  1HQC A;  3IHU A;  4A0Y A;  4YIR X;  4XMY A;  1S7A A;  2EZK A;  2H94 A;  3QP5 A;  5IP9 J;  1FNN A;  2FBK A;  4LD5 A;  5EGO B;  2RKH A;  5EYR A;  1BIB A;  3RKY A;  4B3X A;  4DYR A;  3FK7 A;  1UHW A;  1IG7 A;  1DPU A;  3TDZ C;  1P6R A;  2UXX A;  2EIK H;  2QWW A;  2CW8 A;  2XB0 X;  2TDX A;  3WGG A;  2H8W A;  6PAX A;  3JRC A;  4U87 A;  1FYM A;  3S17 J;  2Y2Z A;  5HDN A;  1MMG A;  3HRT A;  1SVM A;  4FHT A;  1TW3 A;  2B9S A;  2F6C A;  1W7P B;  1KON A;  2NVU B;  5LLQ A;  1S7E A;  2G9W A;  2XC7 A;  2UV1 A;  2OU2 A;  3HOX J;  2XSD C;  2VOD A;  1B9M A;  2Y9Z A;  2RNJ A;  3PO3 J;  1IRF A;  2AXT C;  4E70 A;  3ZGK A;  1T08 B;  2WB1 A;  4RAG A;  5GPC A;  5FLV A;  2ACJ A;  3I5U A;  3U1D A;  3H5A A;  3S14 J;  2QKM B;  2IS2 A;  4QPQ A;  4KIS A;  4UHT A;  4HA8 A;  2STW A;  3S2W A;  1R1V A;  3ZRG A;  3F9K A;  5HLG A;  4XRS A;  2K86 A;  1QZZ A;  1J9I A;  1UAA A;  4M6Y A;  4MQ9 F;  1XDU A;  2KZG A;  3V7R A;  2AQE A;  3OYE A;  1LFU P;  1KU3 A;  3H3Z A;  5ICF A;  4XOT A;  2HDW A;  4GXO A;  1WI9 A;  2FBH A;  3L00 A;  1P7J A;  1KU2 A;  1OCO H;  3MQ0 A;  2D5V A;  3BZK A;  2A3S A;  2HOT A;  2ME0 A;  2HQN A;  1WH7 A;  2IJL A;  4KIG A;  4WXH A;  3F8F A;  3Q5F A;  1EF4 A;  1HKT A;  4DBQ A;  4LB5 A;  1D0Z A;  4Y15 A;  1QNT A;  4BH9 A;  5M3M J;  4BE2 A;  3S1R J;  4IZZ A;  2VBW A;  5IY5 H;  1QO0 D;  2FE3 A;  2FF4 A;  2QSF X;  2LD5 A;  3ZMV A;  3ZMS A;  1HW2 A;  4LIT A;  2ZO4 A;  3VOD A;  1MH3 A;  1X1A A;  3DPT A;  3GUD A;  1ON2 A;  2JMW A;  2LG4 A;  3PIP F;  5GP9 A;  4RAZ A;  1B9N A;  5CLS A;  1H9T A;  4RA2 A;  3DBL B;  2CS3 A;  2Z3Y A;  4E7Z A;  3GTM J;  4AID A;  1FMV A;  2B0L A;  5D6E A;  2HYF A;  3DFG A;  3NAR A;  5FLX Z;  2IGO A;  2HI3 A;  5IYD J;  1LEB A;  3GXO A;  1QRY A;  1GT0 C;  1U6G A;  4N4O B;  3F22 A;  3D5R C;  5FFZ A;  4BYY A;  2XGX A;  4C2U A;  3TP0 A;  1ETV A;  3LSG A;  5FKN A;  4XLE A;  3OYG A;  2NNY A;  3BG6 A;  3DQV C;  4W97 A;  1VND A;  4KMF A;  2H27 A;  2O5R A;  2DO7 A;  1HW5 A;  2DT7 B;  4PFP A;  3PSI A;  3FXU A;  1ZEL A;  1ZAO A;  5IYB J;  2RDP A;  1WI3 A;  2G7H A;  5KCM A;  1HKS A;  1N25 A;  5FGM A;  3SFZ A;  4CCJ A;  1Y6I A;  2F5C A;  3HGG A;  1LDK B;  2V1X A;  4RB2 C;  3FKI J;  3Q0U A;  4BQO A;  3DTI A;  1YJW I;  3BR2 A;  3TOA A;  3OR1 C;  4W1U A;  1JT0 A;  2WAQ N;  3GFL A;  1DGR M;  2HNH A;  2CW0 F;  2OAZ A;  3V8J A;  1HF0 A;  3LFU A;  3CCQ I;  3KPH A;  2DMT A;  4M9S A;  5CJ9 A;  1F43 A;  2LNB A;  3ZQQ A;  2FNA A;  5IPA A;  2KIM A;  5FB2 A;  4P5O A;  3BG3 A;  3TQN A;  1W7P A;  2BY2 A;  1TQM A;  1A6Q A;  2CG4 A;  2V79 A;  4A3M J;  1T6S A;  3OSF A;  4XOP A;  4BQN A;  1YW7 A;  1VTN C;  4A0X A;  1D1C A;  2QQB A;  2XRL A;  2XGE A;  3OYF A;  3VDX A;  4J00 A;  4HV6 A;  4IQ4 A;  1UB9 A;  2Q1Z B;  3MMY B;  3J80 Z;  5IOZ A;  2VQL A;  1TBX A;  4IRG A;  4D1Q A;  2V7F A;  2QKL B;  3HTS B;  1OIS A;  3ZQC A;  3E6D A;  1O3R A;  2JA5 J;  1U78 A;  3GTO J;  2YSR A;  2M45 A;  2QBY A;  5LFA A;  4PGH A;  1U0J A;  2MD5 A;  1KZH A;  2EBI A;  5E79 C;  2VBZ A;  4UB6 C;  2WB1 N;  4XKW A;  4RGS A;  4JX5 A;  2UUZ A;  3REO A;  3IWZ A;  3WE3 A;  2HYG D;  3W6J B;  5J8C A;  4A3K J;  1NK3 P;  2ETH A;  1J09 A;  1QZY A;  3B73 A;  4BNC A;  4KNY A;  4GYG A;  3P9K A;  1TQI A;  4WXC A;  2WV1 A;  4E4H A;  2M34 A;  3LQR A;  3BZ6 A;  2Q2E A;  1X3U A;  2WY8 Q;  5AIP A;  3JRI A;  4BQA A;  2PJP A;  1LFP A;  5K7H A;  2K3P A;  4HNU A;  1DGW Y;  1DU0 A;  3E3V A;  3T8T A;  2E2I J;  3I59 B;  2VC1 A;  2FX0 A;  2DFI A;  4PSW A;  3SXY A;  2Z1D A;  4CCO A;  1ZRF A;  4O3M A;  3ROU A;  3RPQ A;  4QWQ A;  4B4C A;  5HVQ C;  3F23 A;  2EK5 A;  2XKP A;  4NC8 A;  3GZ5 A;  5J1R A;  1SFX A;  3LSR A;  1D8K A;  5C4X J;  2ZXJ A;  2E1M B;  5LRS A;  5J4Y A;  1U5T A;  4A3E J;  2GWR A;  4R79 A;  3CUQ C;  3H0G J;  1JUS A;  3A02 A;  5JI6 A;  3OOP A;  2JK3 A;  1W4M A;  4PJM A;  4XRF A;  2K9Q A;  3H0D A;  4E7H A;  3ZQF A;  1B4A A;  2X6W A;  1IN5 A;  2RNG A;  1W7P D;  2HXI A;  1IUY A;  3K4J A;  5FFX A;  2E71 A;  3R4K A;  3LSM A;  2MH9 A;  1ETQ A;  2QGU A;  2L01 A;  2LOO A;  3CTA A;  5EEG A;  3S32 A;  1BL0 A;  3WTY C;  2HYJ A;  5HNH A;  4FAS D;  2OF7 A;  3M07 A;  1R71 A;  2ZCW A;  4ZYD A;  5HOO A;  1TLH B;  3JTG A;  2HKX A;  5AIQ A;  1LFB A;  1WJC A;  3G1M A;  2EPF A;  4FE7 A;  4CXF A;  2GM4 A;  4BGD A;  3S15 J;  3HPG A;  2VIX A;  2LSO A;  2QLZ A;  5HLI A;  1G3Y A;  2H1L A;  2EQR A;  3F8B A;  2F5F A;  3FMS A;  1Y56 A;  3KLO A;  2V6E A;  4XLA A;  2E2J J;  1P2F A;  4J01 A;  3HKZ N;  4FE4 A;  4QIW N;  3S1M J;  5J1U A;  5EG0 A;  1ULY A;  1K6O A;  1R5G A;  2PMU A;  4MQV A;  5BMZ A;  3BPV A;  1XX5 A;  1EV7 A;  4D5F A;  3LFK A;  3HKZ A;  3F0C A;  4LG0 B;  4ZZL A;  2NVY J;  1ETX A;  1GV2 A;  1YIT I;  2VBX A;  4HG2 A;  2PQ8 A;  1AWC A;  1ZRC A;  4IKF A;  4PGG A;  2DOD A;  1I6H J;  1T39 A;  3WHB A;  3LMM A;  2Y0S N;  2DYS H;  3V7C A;  3VEP A;  1YW8 A;  2GZW A;  4JQF A;  1GVJ A;  3K4B A;  2DMN A;  5GPA A;  3D5L A;  3BCB A;  2ZBK A;  3PSF A;  3QAH A;  1Q1V A;  1C0W A;  2I8D A;  2Y69 H;  1FOX A;  3IKT A;  4BDY A;  2BE5 F;  1UEL B;  3WG7 H;  4IRI A;  1XMK A;  2VON A;  3TP3 A;  2FQ3 A;  1JUM A;  2QSG X;  3C2H A;  1DP3 A;  3EUK L;  1IN8 A;  1JHH A;  1TT0 A;  4EJU A;  3E5Q A;  5DV5 A;  1MIJ A;  3OMY A;  4XN0 A;  2MC4 A;  4OIN F;  3QPL A;  2DT5 A;  1R9T J;  2KJC A;  2NOG A;  2M1B A;  4V2F A;  2XRN A;  4CYC B;  2O61 A;  4Q48 A;  3CO6 C;  3QRF F;  5EEH A;  2W00 A;  2LRE A;  4BU2 A;  4YFN F;  3DKW A;  1WFX A;  1Z67 A;  2H6B A;  3OR2 C;  3CES A;  1K78 A;  5L3F A;  3WTS C;  2EFO A;  3CME I;  2LR8 A;  3OYC A;  3SZT A;  2ZSI B;  2BVM A;  2RN7 A;  5J3L A;  3FMR A;  2K3F A;  4MFE A;  2XHK A;  4GGG A;  1XDS A;  4XLP F;  4G9Y A;  1P4W A;  2YUS A;  5FO5 A;  1U9O A;  3V42 A;  1W0T A;  4QLC U;  4JK1 X;  3N4M A;  1VQ7 I;  2HGC A;  3UKG A;  3GX4 X;  2PEX A;  1YW9 A;  4O5V A;  2P8T A;  3LL7 A;  1K4S A;  4I2O A;  2DJN A;  1X2M A;  3QYB A;  3FKJ A;  2A05 A;  1IRX A;  4P55 A;  4UV9 A;  2Y48 A;  2ZXW H;  4BHP A;  1DU6 A;  3M8E A;  2HOS A;  1OCP A;  2K9N A;  3Q3S A;  2DTR A;  2DK5 A;  3BG5 A;  3I71 A;  2LC2 A;  3OWT A;  3ZCO A;  3I54 A;  4C30 A;  2ICW G;  4LG3 A;  1ZG1 A;  1AKH A;  2VC0 A;  3E6B A;  1RUN A;  2MSY A;  2A6E F;  2L02 A;  3KP6 A;  5F08 A;  4LK1 F;  3GVA A;  3HM5 A;  1K4T A;  2LKS A;  1ZQ3 P;  5E3N A;  1SVL A;  3TO9 A;  2LF7 A;  4PJN A;  3SZP A;  5J47 A;  1MMN A;  1SD5 A;  2E7W A;  2VKE A;  1JKP C;  2XF7 A;  2WTE A;  2NS7 A;  3S8P A;  2XV4 S;  2L3D A;  3SHF A;  1A6I A;  1IDZ A;  1SAU A;  3JRG A;  4ZDO A;  1S6L A;  5H2F C;  1BI1 A;  3K4K A;  1G6N A;  2W7N A;  5M5Y J;  1KU7 A;  5F04 A;  1J2X A;  1BI2 A;  4LLL A;  2ME6 A;  2JRM A;  3HGY A;  4A2U A;  3DPL C;  4UXN A;  2MH2 A;  5FRO A;  3CZ6 A;  1R7J A;  1T0F C;  4F93 B;  4YFK F;  3I4M J;  1WHU A;  5E8G A;  4XID A;  4MO7 A;  4XN3 A;  3G71 I;  3OOU A;  3I58 A;  1R4N B;  4LIV A;  4NB5 A;  2R0Q C;  1OQY A;  2E5N A;  3BR6 A;  2P6S A;  5L3G A;  4R1H A;  1D3Y A;  4G12 A;  2L7Z A;  2R7Z J;  3S2D J;  1HLV A;  3GFI A;  2X1E A;  3OIQ A;  3BR1 A;  3HRU A;  2LF8 A;  2X0L A;  2FQ4 A;  1Z21 A;  1FWZ A;  1EH8 A;  3QU6 A;  5F0F A;  5E20 A;  5CKT A;  4L9N A;  4I01 A;  3I55 I;  1MGT A;  1ZLJ A;  2P4W A;  2X1C A;  4X1E A;  3CC7 I;  3IH3 A;  4EVI A;  2CJJ A;  2V26 A;  5JR3 A;  1K7A A;  5B3S H;  1ETW A;  2Q0O A;  1G4D A;  5D8L B;  3NAU A;  4BXU A;  2HTS A;  3LST A;  4AIH A;  2O8K A;  3H92 A;  4M72 A;  1JI8 A;  2A6H F;  4E7S A;  5K5Q A;  2K4B A;  3RZO J;  1OCC H;  2HVR A;  3TL4 X;  1MJ9 A;  2DDA A;  4CYC A;  2LBF B;  3JAM Z;  3KP2 A;  5L3B A;  1PJR A;  3ZQI A;  2FML A;  2W24 A;  4I7H A;  5TIS C;  4C3H J;  2ZJP F;  2O9L A;  2RRE A;  3ZQ7 A;  2E34 A;  2K02 A;  1HC8 A;  2MAB A;  3WE2 A;  1H88 C;  4KA4 A;  4D7M A;  1M1E B;  4LK0 F;  2EFW A;  1VF9 A;  2F4M B;  5D8K B;  5LGU A;  3S1N J;  1TT5 B;  3OYM A;  1LDD A;  3M8J A;  5CPR B;  5K1Y A;  4TV7 A;  1YLF A;  2MLG A;  3F3X A;  4LOC A;  5KK1 A;  2VQH A;  3WTW C;  2OA4 A;  1XN7 A;  4I99 C;  1MDM A;  2Z9O A;  5DCF A;  4AM3 A;  2YPR A;  3CCU I;  2W25 A;  3HUG A;  2Z5U A;  3AG2 H;  2NVX J;  3SQN A;  1I1G A;  3C18 A;  5HLH A;  2ID3 A;  3CF5 F;  1D5Y A;  3I0T A;  4IXA A;  2CW7 A;  4GFB A;  1VFC A;  3HOW J;  2IAI A;  4A3J J;  2KRC A;  3KEY A;  3G1L A;  2FNP A;  1LPQ A;  2W57 A;  2I5U A;  3A03 A;  5DD4 A;  3B02 A;  2VOP A;  1W1W E;  1MBH A;  3KFW X;  5ED4 A;  3CP2 A;  4B8X A;  4MGR A;  4J19 A;  3VOE A;  2KRF A;  1FSE A;  2IPQ X;  2DBB A;  2VN2 A;  4B44 A;  1AA7 A;  5CVV A;  3CJR B;  2V1D A;  5B1B H;  1MDM B;  2DJI A;  1YRN A;  2IEK A;  3NWT A;  4Y4R A;  5JLX A;  4C3J J;  3JRD A;  3BTI A;  3IP4 B;  4UVA A;  3OYA A;  4BBR J;  3L2C A;  2P81 A;  3I3L A;  3M3Y J;  2AS5 F;  1Z3Y A;  1IO2 A;  2YU9 J;  4XLH A;  3RZD J;  3PNT A;  3G2B A;  4OU0 A;  2EV0 A;  2O03 A;  2DPD A;  1UCR A;  4B1R A;  1YX5 A;  4B47 A;  5ILV A;  3S3O A;  4HEA 2;  4HLX A;  1DDN A;  1IN7 A;  3HZJ A;  3WTZ A;  2CFX A;  4EV0 A;  3LA3 A;  1SD7 A;  2VJI A;  1YOV B;  2M5W A;  1TZL A;  3OYJ A;  1CF7 B;  2EIJ H;  5TJJ A;  4BE1 A;  4L18 B;  4ENM A;  2DA1 A;  3HHG A;  1MW7 A;  4FT8 A;  3J7Z I;  3ZQL A;  3K1P A;  4IO9 F;  2Y0S A;  2LMD A;  4KIF A;  4GCV A;  3JW4 A;  3CDH A;  1GUU A;  4RB1 A;  1R49 A;  4M71 A;  3U2R A;  2HPM A;  1E17 A;  1JKO C;  1OR7 A;  2HEO A;  1LNW A;  4G94 A;  2IW5 A;  4K2E A;  2OTJ I;  1O57 A;  3C3W A;  2M8E A;  4PJ0 C;  2VPR A;  3B6A A;  4S0H B;  1J7K A;  1KQ9 A;  4BS9 A;  1PP8 F;  2GXA A;  2B63 J;  2IS1 A;  2L9N A;  1FBU A;  2VQC A;  4L9J A;  3A0B C;  4OIR F;  9ANT A;  3LSI A;  2XB5 A;  3CCS I;  1VQN I;  4F92 B;  3AG1 H;  2XF6 A;  3L7W A;  4M3B A;  5DTD A;  3I64 A;  1YTY A;  3I9V 2;  4LMY A;  4M73 A;  1UFM A;  2RGV A;  2COM A;  4H4K C;  2H8R A;  1CGP A;  1ITY A;  4YII A;  1D1A A;  1YS7 A;  3BTJ A;  3ZMD A;  2V9P A;  4Q47 A;  4KUM A;  1T38 A;  1R00 A;  2RV8 A;  3DEW A;  3WU2 C;  2XRO A;  1B59 A;  3DF8 A;  2W1O A;  2RQQ A;  3WTT C;  3S2H J;  1XTA A;  2M7B A;  2X1D A;  2E1O A;  2ZB9 A;  2BOL A;  2K9L A;  3MAJ A;  2DPU A;  4IOA F;  3EUH A;  2CUF A;  3TO7 A;  3D0S A;  1QPM A;  1T98 A;  4CZZ A;  1X1B A;  3UNG C;  2WAE A;  4X6A J;  3HHH A;  4E7I A;  4JP0 A;  3K4M A;  2LY2 A;  4BJ5 C;  1IXR C;  2BY0 A;  4HSR A;  5JHF A;  3CLO A;  2LYC A;  1FLI A;  1TWA J;  1MSE C;  2YS9 A;  1G2H A;  2F5D A;  2QQ8 A;  1ENH A;  4F52 A;  2XAJ A;  2PBI A;  4L5I A;  1ZN2 A;  1S5L C;  1YIO A;  3PUF A;  4ENN A;  1FYL A;  2DT6 A;  1XS9 A;  1JJ6 C;  3DWL E;  1MH4 A;  1WWX A;  1T33 A;  4I6Z A;  2PFB A;  4H0E A;  3FM5 A;  4A3C J;  2X4H A;  3DEE A;  1WVR A;  3M8F A;  2GOX B;  2B7E A;  3ZXS A;  5JHU A;  4KT5 C;  1VQK I;  1RET A;  3IRR A;  3BG9 A;  2BHZ A;  3ISP A;  3QYF A;  1ZGJ A;  3L1P A;  1O4X A;  1PUE E;  2M30 A;  3K70 C;  3R6S A;  3SDG A;  5LEJ A;  1GDT A;  2E19 A;  2DTZ A;  2R7R A;  1E3H A;  1Z77 A;  3AL0 B;  2CQQ A;  1TWG J;  1FIP A;  3DBH B;  1ZTR A;  2ECC A;  5DCM B;  4ETS A;  1YFH A;  3AL0 C;  2EFP A;  3CF2 A;  4KIT B;  1VQ6 I;  2CUE A;  1X19 A;  4BHC A;  1XGN A;  1OCT C;  3SZG A;  1PVE A;  2M2E A;  5HS9 A;  3MVP A;  3GZ6 A;  2EH3 A;  4RGU A;  4XIC A;  2CUZ A;  4XKC A;  2ECB A;  2V4J C;  2BV6 A;  4IHV A;  2KJB A;  4WXD A;  1FPQ A;  3MWM A;  3TW6 A;  3TGN A;  3CCY A;  1FMW A;  4A3B J;  4HW0 A;  3BDD A;  1YX3 A;  3CMM A;  4Y7N J;  5F0H A;  4MFD A;  2DA3 A;  4LJZ F;  1MNE A;  2ZFW A;  3KP3 A;  1OKR A;  2DMU A;  1E3O C;  3S3N A;  5CVJ A;  1UJ8 A;  1SC7 A;  2OZU A;  5LGN A;  1BA5 A;  2OJE D;  4DYQ A;  5L3C A;  1VQM I;  1IAW A;  1BW5 A;  3WTX C;  5BPI A;  3BY6 A;  4Q5S F;  1WCM J;  5DUI A;  3QPT A;  1MBK A;  3A4C A;  3CMA I;  4IHS A;  2JSC A;  5EF6 A;  3OYB A;  4PFO A;  3SEQ A;  2FD5 A;  1D0X A;  1XGO A;  2L0K A;  2JA6 J;  2P5K A;  3BR0 A;  5JVT A;  5EGO A;  2HPI A;  3G73 A;  2CV1 A;  2FSW A;  4Z2Y A;  5A2Q K;  1K78 B;  2OTL I;  3H35 A;  1Z91 A;  4IX7 A;  3D1N I;  2PMZ N;  1ETO A;  2EFQ A;  3DLL F;  2M8G X;  3HOZ J;  3U9G A;  4KN4 X;  5H6R A;  4AYB A;  3VPR A;  2VJ4 A;  4B09 A;  4BUP A;  4PCQ A;  2JA7 J;  4WX9 A;  4LIU A;  1U8B A;  4HDU A;  3OS1 A;  2I10 A;  1MMD A;  2DA5 A;  1IV8 A;  4RMN A;  2NVQ J;  4HF2 A;  5LHI A;  1R5I D;  1UG0 A;  2ZNY A;  4WF2 A;  1K61 A;  2L4M A;  4Y52 J;  2ISZ A;  1KQ8 A;  4XRS G;  2MLK A;  1MBG A;  2KIS A;  1X1P A;  3VB2 A;  4ABZ A;  4V2G A;  1BJZ A;  2NYX A;  1S9H A;  3HB9 A;  1XG1 A;  3RQ4 A;  4BEH A;  4PJL A;  4BDZ A;  1P4A A;  2O8X A;  4CUG A;  2D1V A;  1VQ9 I;  1JTY A;  3CDI A;  5FLM J;  2FMY A;  1QQI A;  3QOP A;  4M3F A;  3A2K A;  1MBF A;  2VE8 A;  2ADU A;  1TWF J;  3J7A O;  3DKY A;  2C6Y A;  1D5V A;  2Y31 A;  4BAY A;  1UST A;  4EQQ A;  2OCE A;  2HU9 A;  3HRS A;  2HS5 A;  3BP8 A;  4AUX A;  4KFC A;  1QPI A;  4AD9 A;  1T0F A;  4KMU X;  3AFH A;  1R36 A;  3H9G A;  4U0Y A;  3KZI C;  4RB3 C;  4PDK A;  1YE9 A;  3LSH A;  1TWC J;  4BHB A;  4DIQ A;  1YYV A;  3F21 A;  3H3U A;  2BHY A;  2GLO A;  5ICG A;  3HXL A;  3JTH A;  4EJO A;  3BG7 A;  2R5Z B;  4G6Q A;  3HSF A;  2CU7 A;  1O7L A;  4AIJ A;  1N75 A;  1HOM A;  2AO9 A;  1IC8 A;  3K70 D;  1ZR4 A;  2VLA A;  3GTQ J;  5JLW A;  3RCO A;  1FY7 A;  5E3L A;  3CUQ A;  2A5W A;  1PYV A;  2GA2 A;  1FT9 A;  1ONV A;  2CMP A;  5EZH A;  1NH3 A;  2CQ7 A;  5E3O A;  2FOW A;  3DP7 A;  3MKL A;  2HVQ A;  4P9U A;  4RM3 A;  4II3 A;  2UZK A;  1N78 A;  1BI0 A;  3C7J A;  2BW3 A;  4RLQ A;  2X48 A;  2XKO A;  2JUC A;  2O7O A;  2LVS A;  3LA7 A;  2A07 F;  1WPK A;  5FLX K;  4YRV A;  4CIC A;  5E17 F;  2R7D A;  2Y75 A;  2WBM A;  3B6C A;  3IAM 2;  2KKO A;  2L2O A;  5LGT A;  1MJA A;  1JUP A;  4Q4Z F;  5IYC J;  1ACI A;  2L9V A;  4FCY A;  2LLK A;  1FBQ A;  1MKM A;  1LEA A;  1Z6T A;  4UB8 C;  1W5C C;  4JBA A;  2GIV A;  1X3Z B;  2WA0 A;  3LAP A;  4LGW A;  3J81 K;  4BBS J;  4A6D A;  1MMS A;  3DLA A;  3O6B B;  3KET A;  2L5Q A;  1FYK A;  4A6E A;  4XQF A;  4EEF G;  4NHJ A;  1RIO H;  4ZTF A;  1WKM A;  3P5J A;  3BWG A;  2GOM A;  1I39 A;  3FF5 A;  3VYS B;  4E7L A;  5EDN A;  2JVG A;  2V1U A;  2ZFU A;  2KLO A;  4EM0 B;  5ILU A;  2LY1 A;  1BOB A;  1SMY F;  1ERD A;  1HXD A;  5F6F A;  1R1T A;  4DNC A;  1BJA A;  4UY8 I;  2XAH A;  2KDZ A;  2XPU A;  5ILS A;  5BS6 A;  1EA3 A;  4AVP A;  4B43 A;  3LAJ A;  3KYL A;  1USS A;  3BJ6 A;  3I4P A;  1JTX A;  2LKX A;  2VXD A;  3K1N A;  2JA2 A;  3O2P E;  2HZT A;  1FOW A;  5CVR A;  4NC7 A;  1OYW A;  4UUS A;  4L9T A;  3E5X A;  2XGC A;  2BYV E;  4EJV A;  1NG6 A;  2ELH A;  1AKH B;  3HOU J;  3BRO A;  3GCM A;  4G7O F;  3T1B A;  2FU4 A;  1R5H A;  5E1X A;  5FD5 A;  2DK8 A;  2K4J A;  5GAE J;  4EM2 A;  2KIF A;  4PJJ A;  4GO1 A;  3MKZ A;  3DCF A;  2BZT A;  5DUK A;  2DYR H;  4OIQ F;  1A5J A;  3ECH A;  4M3E A;  2L9R A;  5CQG A;  2ZME C;  4L5J A;  2VQG A;  2G7U A;  3M7G A;  2L7F P;  3WU1 B;  3W2A A;  3SYT A;  3PNY A;  4M74 A;  1VQO I;  1B1B A;  5EG0 B;  1NG7 A;  3OS0 A;  1TC3 C;  5CVI A;  1YJ9 I;  4G8X A;  3G3Z A;  1HW1 A;  1RPW A;  4JYK A;  2EFN A;  5D5U B;  2BY3 A;  2W84 A;  4PSX A;  1YO5 C;  2QBY B;  3WTV C;  1V5E A;  5IT9 K;  3W3C A;  4C9Y A;  2X85 A;  4QPO A;  3PL8 A;  5EEA A;  4A5N A;  2V6C A;  1IJW C;  3FXR A;  3WGI A;  4I98 B;  3VYR B;  3G4S I;  2Y0M A;  3JRF A;  3OYI A;  2XAF A;  1QZE A;  1FP2 A;  3BQZ A;  3D5S C;  3R0J A;  3W6K B;  2Z16 A;  1V5G A;  5D6F A;  1I3A A;  2DOE A;  4EGZ A;  4BXX J;  1J0R A;  3WOD F;  3LOC A;  1R23 A;  2NS0 A;  1Z9C A;  2HOA A;  2QM3 A;  1Z7U A;  5TGT A;  5GTI C;  1F4K A;  1FSH A;  1VQL I;  1GVD A;  5K5O A;  5HNF A;  1WJB A;  4LG0 A;  3IWF A;  2K85 A;  3ONQ A;  2ZJ2 A;  3RKX A;  1OFC X;  1YIJ I;  1A35 A;  3HG9 A;  3A01 A;  1FP1 D;  4DZJ A;  3PQK A;  3FXO A;  3JSO A;  3ELK A;  1B8I B;  2PLY A;  4BQQ A;  4EGY A;  5JFR A;  3JRA A;  2GAU A;  1EH6 A;  2QEX I;  1APL C;  3P9I A;  4OMY A;  3C2G A;  5FKL A;  3EQL F;  3F6V A;  1OMI A;  3OYH A;  1BR2 A;  2LTP A;  1HA8 A;  3GTG J;  1NK2 P;  3WHC A;  4YIF A;  5F1J A;  2L4A A;  1FIA A;  2VT3 A;  4HX8 A;  1WJD A;  2QSH X;  1IN4 A;  2JVH A;  4KJZ A;  2ZC2 A;  1EJ9 A;  4DQ2 A;  3M1E A;  3HBL A;  4I09 A;  2AQF A;  1I6X A;  2D1H A;  3FDY A;  5CQE A;  4QTR A;  2D2W A;  4AWX B;  2EA4 A;  1MNM C;  1Z6R A;  2ZNZ A;  3HL2 A;  1P7I A;  3DKX A;  2IP2 A;  1WJ5 A;  1ZGA A;  2Y30 A;  3SJM A;  3BCA A;  4UNO A;  3E1S A;  2F2E A;  1BBY A;  2CQX A;  5IP7 J;  4E7K A;  3DU6 A;  3FZV A;  4IJA A;  2FBI A;  4CZC A;  2HVS A;  1U8R A;  5D5W B;  5A2Q Z;  1PUF A;  4F7Z A;  3OIP A;  1B6A A;  3CJN A;  1HBX G;  1DPR A;  2M7A A;  1IF1 A;  1UMQ A;  3VSL A;  1XCB A;  3Q0W A;  3SFI A;  5J4V A;  1MJB A;  3V8L A;  2RC4 A;  3ZN1 A;  5TRD A;  1T8I A;  3KLN A;  4CCN A;  2Q8K A;  5GAD J;  2IRF G;  1G59 A;  2HZD A;  3GBG A;  4IL6 C;  1ETK A;  1F36 A;  1HSJ A;  1RES A;  3CCE I;  3LSP A;  5FD6 A;  4Y17 A;  2PG4 A;  2JUG A;  3S93 A;  5LHG A;  4Z6Y A;  3K69 A;  5GAG J;  2M9H A;  1X4O A;  1XMX A;  3BQY A;  1O3Q A;  2E1M C;  2DOF A;  3A1Y A;  3RPU D;  4I02 A;  4C2M J;  2ESN A;  4RAY A;  4RDU A;  1MZB A;  3I56 I;  2O3F A;  4EMS A;  2BY1 A;  3O8H A;  2XUB A;  1FOK A;  3L2V A;  2KIQ A;  3BR3 A;  1HKQ A;  1ZYR F;  2E36 A;  3KP7 A;  1RC9 A;  2ID6 A;  2YU3 A;  1EKE A;  3KEO A;  3S3M A;  5HS7 A;  4HLY A;  2R92 J;  2VT2 A;  3FM3 A;  2VB6 A;  1W5S A;  3JCU C;  4ESF A;  1F9N A;  1OPC A;  5DM7 F;  2W82 A;  1BW6 A;  1WQ2 A;  3K6G A;  1ZGW A;  3BT9 A;  5E1Z B;  1OLT A;  2P0W A;  2E7X A;  3OYD A;  3HYI A;  1QHH D;  1QHG A;  4HV5 A;  4ESJ A;  3KZY A;  3JRH A;  2EZI A;  3QPS A;  3OL4 A;  1RR8 C;  3H36 A;  3N05 A;  3L09 A;  3BPX A;  3VYT B;  1IUF A;  2JT1 A;  2QCO A;  2CV0 A;  2X6Y A;  2CSO A;  2VKH A;  3HUG B;  2IT0 A;  1P92 A;  2M0C A;  3OYL A;  4IF4 A;  1X4P A;  1G3T A;  2R4G A;  4P96 A;  4CGZ A;  4HZF A;  3KZZ A;  3PNV A;  4FIS A;  2TCT A;  2HDD A;  4U0V A;  3P7N A;  1SFE A;  3EYI A;  2R7F A;  2M4K A;  5AON A;  3N97 A;  2UXN A;  3HSE A;  4JX6 A;  3FBI B;  4PUS A;  1ZAR A;  2EA2 A;  4M6V A;  1KYZ A;  2XDV A;  2ZXI A;  3R0A A;  2KQR A;  2OQR A;  4A3D J;  4RAF A;  4XBF A;  2MD0 A;  4DGW B;  5ICE A;  1E3P A;  3F6O A;  5E18 F;  5FRN A;  2F4I A;  3CUO A;  2CQN A;  1D8J A;  3GW2 A;  4CA0 A;  4G6D A;  4CDG A;  2MGQ A;  2TRT A;  2EJR A;  2LDU A;  3GLX A;  3HDD A;  5K7Z A;  3BC8 A;  3K9T A;  5J40 A;  1WZ2 A;  3R61 A;  4OAZ A;  1HDD C;  2FJ1 A;  2EZL A;  1WSU A;  3VWB A;  2JWT A;  1X1C A;  1RI7 A;  2A5Y B;  1LJ9 A;  2PJR A;  2M0M A;  1Z3X A;  2K27 A;  2RQP A;  1S8N A;  5H6Q A;  4P9F A;  3RYR A;  2BVL A;  3RKW A;  2EWN A;  3GTK J;  3HC7 A;  3WG9 A;  1A36 A;  1D1B A;  4IHX A;  1LUJ B;  2ESH A;  2QVO A;  1CQT A;  1J75 A;  2MG4 A;  1I5Z A;  4XKB A;  2Z33 A;  3CCR I;  4HYE A;  2MA3 A;  2CH0 A;  1U5T B;  1OYI A;  3VYU B;  4BEH B;  3FXL A;  2A61 A;  3FXM A;  3HJE A;  4ZYA A;  5H20 A;  3IH2 A;  1V55 H;  4L5E A;  1GXP A;  4FTH A;  3W2W A;  2OV7 A;  2BXZ A;  2COB A;  3L2Q A;  3VFZ A;  4XK4 A;  4UVC A;  4OIO F;  3ML6 A;  1VQ5 I;  4D5C A;  2ISY A;  2R5Y B;  4U7B A;  2Z99 A;  3P9C A;  3DPU A;  4FQG A;  1F5T A;  4HBL A;  1XMA A;  2CO5 A;  5DYM A;  4G7H F;  2M3A A;  1XCV A;  5LHH A;  4EJT A;  3FXK A;  1WGX A;  5B66 C;  4XL9 A;  3K0L A;  5M3F J;  1RZ4 A;  1TNS A;  1ZK8 A;  1ODD A;  3U21 A;  3MKY B;  2J5O A;  1YJN I;  4RGX A;  1TP4 A;  5CVU A;  1BOA A;  2EIN H;  3K4N A;  1LVA A;  3OIO A;  4BAC A;  1GHC A;  2VPL A;  2PMZ A;  3ULQ B;  2JZY A;  4XKV A;  3K7A J;  4M6X A;  5HDG A;  1O3S A;  1VI0 A;  2R5Y A;  3Q0V A;  1W5T A;  3EET A;  4UV8 A;  4CHU A;  3JRB A;  2BBY A;  2RVC A;  5B5E C;  1SAN A;  3WGH A;  2K9M A;  2IGK A;  3BTC A;  3RPU A;  2G0E A;  1H89 C;  5K5R A;  2YX4 A;  4OMZ A;  4ON0 A;  1LE8 B;  4G7Z F;  2R7V A;  4F3Q A;  1W0U A;  5IT9 Z;  2OZ6 A;  1IN6 A;  4MIM A;  1FC3 A;  3V7S A;  3CCL I;  2XPW A;  2ELK A;  3ZOB A;  4HF0 A;  3E97 A;  5HDK A;  4L0Z B;  4A3G J;  3LWF A;  2F5E A;  4L9V A;  2OD5 A;  1L3L A;  2VAS A;  4EJW A;  3CC4 I;  1TQP A;  3PJR A;  4NNJ A;  2EV6 A;  4A3F J;  2OQG A;  2JN6 A;  2E60 A;  1XGM A;  1QA6 A;  2XAQ A;  3LNQ A;  3I53 A;  5DEQ A;  3PFY A;  4OOI A;  3ZMZ A;  4ESB A;  3QU3 A;  2XVC A;  2R7X A;  4HNV A;  1CF7 A;  2IA2 A;  3GZN B;  2L7K A;  4U88 A;  2VXZ A;  4ZYG A;  5IOY A;  3FMQ A;  2NNN A;  1XSD A;  2YX7 A;  4N4N B;  2HQA A;  5BNG A;  2MC3 A;  1FX7 A;  4HNT A;  2IS4 A;  3QQA A;  4II2 A;  2W4S A;  3K2A A;  1J5Y A;  1HST A;  1N77 A;  2VI6 A;  1IV6 A;  3OSG A;  2CFO A;  4XM3 A;  2P5L C;  2QQ9 A;  1MBE A;  1X3W B;  3IV5 A;  1Y0U A;  2R93 J;  3AG3 H;  4CSW A;  2BEO A;  3A01 B;  3IH4 A;  3QOE A;  1FTZ A;  2H6C A;  1B8I A;  3GFJ A;  2VL8 A;  3MZH A;  3CLQ A;  4ZTJ A;  2VJJ A;  3HOS A;  1Z1D A;  1T2K A;  2YR2 A;  3CMY A;  2LFB A;  2FXA A;  1JXS A;  1I27 A;  2DN0 A;  4M3D A;  1FEX A;  3MCZ A;  1OJL A;  3S16 J;  1WJF A;  1GLN A;  4ZYH A;  4L0Y B;  2IGN A;  4XSZ F;  2HXO A;  4OIP F;  2X9D A;  2OC6 A;  3PFI A;  3RYP A;  1ZLK A;  3W6V A;  3JR9 A;  1VQ8 I;  1IZ1 A;  3HOV J;  1FOY A;  1RKT A;  1SAX A;  3ERE D;  4HDV A;  3C2B A;  2J5P A;  2Y9Y A;  4UUS B;  3FX3 A;  5F27 A;  1TTY A;  1TWH J;  1X58 A;  2AXL A;  3M9A A;  3L2U A;  2ZKZ A;  1WJA A;  2X6X A;  1ON1 A;  1LKX A;  1Y1V J;  1SD6 A;  3RTR A;  4N9H A;  2XIG A;  3ZQG A;  3H5N A;  4MEY F;  1A31 A;  2CV2 A;  1NTC A;  3KYD B;  3RIR A;  2ZJR F;  3GF2 A;  3UR3 C;  3GTJ J;  1F1Z A;  3TDU C;  3TKY A;  4JX4 A;  3Q9V A;  2HTJ A;  2R7O A;  2VKV A;  2QZ8 A;  4WCG A;  4IHY A;  1RKW A;  2EIL H;  5F0C A;  3EUA A;  4NBQ A;  4YEL A;  2FUG 2;  3HOT A;  4CCK A;  1ZG5 A;  4UVB A;  2IBD A;  1BIA A;  3VSK A;  4DJA A;  1BC8 C;  1UG2 A;  3RQI A;  2QYO A;  3H3V K;  3K4C A;  2ELJ A;  1I1S A;  4M3G A;  4IPA A;  3CCM I;  1YHQ I;  1IRG A;  2BW3 B;  3OV8 A;  1AOY A;  4Y3O A;  2NOJ B;  1W36 D;  2DA4 A;  4NDL A;  1SFU A;  1PP7 U;  1S72 I;  4N0B A;  3EPZ A;  1BR4 A;  2KFD A;  1ZRE A;  4KDP A;  4P1W A;  2DFH A;  4N9I A;  2DMP A;  2DI3 A;  1K79 A;  2NVT J;  4NUB A;  4C3I J;  5E3M A;  2HWV A;  3J7A Y;  2BGC A;  4BE0 A;  4I0A A;  2DXI A;  4PZJ A;  4XNF A;  5M5W J;  4A12 A;  5FJ8 J;  1IXC A;  5HLT A;  2MBF A;  1RR7 A;  2K7L A;  3IKV A;  1YI2 I;  3SEZ A;  3GWZ A;  1XPX A;  4YEJ A;  1V5F A;  3TW7 A;  1ORK A;  1KGS A;  3ABK H;  2E2H J;  3KIO A;  1Y8Q B;  4XOR A;  4UUV A;  3MFK A;  1BC7 C;  4V19 K;  3TO6 A;  3DV8 A;  1KQ0 A;  2KZV A;  2P7C B;  2DDB A;  4RS8 A;  1MD0 A;  2K40 A;  4IEJ A;  2D45 A;  1R58 A;  1TL8 A;  4XON A;  4RM2 A;  1JJ8 C;  1Z7L A;  2R5Z A;  1LDJ A;  1MBJ A; 
#chains in the Genus database with same CATH homology
 1WJB A;  1MND A;  3ONQ A;  4DBQ A;  3HG9 A;  3L2R A;  1D0Z A;  2VJ5 A;  3CP2 A;  3DU5 A;  4BE2 A;  4X0G A;  4IZZ A;  4BQQ A;  4B44 A;  1AA7 A;  2M4G A;  4LIT A;  2Z2S B;  3CJR B;  2IGM A;  3C2G A;  1X1A A;  2DJI A;  3DPT A;  4BL0 B;  4B48 A;  3OYH A;  1BR2 A;  3NWT A;  4Y4R A;  4BXF A;  1HA8 A;  2LG4 A;  2R7Q A;  2V1N A;  2CS3 A;  3IP4 B;  4E7Z A;  3OYA A;  1FMV A;  1WJD A;  3I3L A;  1Z3Y A;  2JVH A;  4XLH A;  4KJZ A;  2IGO A;  3PNT A;  4BJT A;  3OL3 A;  3G2B A;  2PJR B;  4N4O B;  2AQF A;  3D5R C;  4RLF A;  3H9Q A;  4C2U A;  3FDY A;  5CQE A;  3LSG A;  4XLE A;  3OYG A;  3HL2 A;  1YX5 A;  3BG6 A;  3DKX A;  3DQV C;  4NQW B;  4B47 A;  1WJ5 A;  2O5R A;  3S3O A;  4HEA 2;  3BCA A;  2DT7 B;  4PFP A;  2A6T A;  3E1S A;  3PSI A;  1ZEL A;  2VJI A;  4E7K A;  3DU6 A;  3FBN B;  1TZL A;  4F55 A;  5KCM A;  3OYJ A;  4CZC A;  4BE1 A;  2HVS A;  4CCJ A;  1Y6I A;  3OIP A;  4ANJ A;  1MW7 A;  2M7A A;  1LDK B;  3VSL A;  3CJQ B;  4Y33 A;  2Y0S A;  4BQO A;  5FRM A;  2UWM A;  3DTI A;  2HPM A;  3OR1 C;  3OYN A;  4CCN A;  1DGR M;  1G59 A;  2HNH A;  2HZD A;  3GBG A;  3OY9 A;  3LFU A;  2WAD A;  4C2T A;  2JUG A;  3PUB A;  3S93 A;  4BS9 A;  2IS1 A;  2L9N A;  3ZQQ A;  2VQC A;  4P5O A;  1X4O A;  3LSI A;  2E1M C;  3QYE A;  4F92 B;  3A1Y A;  3RPU D;  4XOP A;  4BQN A;  2XF6 A;  1D1C A;  3TBI A;  4DOZ A;  3OYF A;  3VDX A;  4J00 A;  4IQ4 A;  3I9V 2;  2KHM A;  2Q1Z B;  3MMY B;  3L2V A;  2VQL A;  3TMO A;  4D1Q A;  2V7F A;  4H4K C;  2QKL B;  1LVK A;  1D1A A;  3S3M A;  4E7J A;  3OS2 A;  2W1O A;  2RQQ A;  2VB6 A;  4JOM A;  2M7B A;  2X1D A;  5LFA A;  2BOL A;  2K9L A;  4KT6 A;  4IQJ A;  1U0J A;  2W82 A;  1P9Q C;  5KNL A;  2OUM A;  3K6G A;  3FHN A;  4OAY A;  4G6T B;  1OLT A;  1X1B A;  2P0W A;  1K6Y A;  3UNG C;  2WAE A;  3OYD A;  1QHH D;  1QHG A;  4E7I A;  4BJ5 C;  3K4M A;  2LY2 A;  4CCM A;  4HSR A;  3AKZ A;  5JHF A;  4XKW A;  2LYC A;  3OL4 A;  3N05 A;  3VYT B;  4F52 A;  2UUZ A;  2CV0 A;  2X6Y A;  2VKH A;  3HUG B;  1J09 A;  3OYL A;  4PK4 A;  3MKW B;  1X4P A;  3NWS A;  2R4G A;  2MFZ A;  3PNV A;  2DT6 A;  3KX2 A;  3DWL E;  4E4H A;  2M4K A;  4AVZ A;  4XLC A;  2WY8 Q;  3FBI B;  4PUS A;  1LFP A;  2K3P A;  4MLO A;  1DGW Y;  4HNU A;  3DEE A;  2GOX B;  2XDV A;  2ZXI A;  2KQR A;  2MD0 A;  3ZXS A;  4DGW B;  4AU7 A;  5LD2 C;  5FRN A;  4PSW A;  2Z1D A;  4CCO A;  2F4I A;  4F91 B;  4D9J A;  5HVQ C;  3QYF A;  4CA0 A;  4NC8 A;  3MD2 A;  3K70 C;  2E1M B;  3BC8 A;  4R79 A;  4CCL A;  4OAZ A;  1D0Y A;  2R7R A;  4PJM A;  3VWB A;  1X1C A;  4ZDL A;  3AL0 B;  3H0D A;  4E7H A;  2CUJ A;  2X6W A;  2RNG A;  1W36 C;  3K4J A;  3K4L A;  1DQU A;  2PJR A;  2M0M A;  3AL0 C;  1Z3X A;  3IAS 2;  3CF2 A;  3LSM A;  4KIT B;  2LOO A;  1X19 A;  2BVL A;  3S32 A;  2DCE A;  5HNH A;  4FAS D;  3HC7 A;  3SZG A;  5HOO A;  1D1B A;  4XLF A;  1X1D A;  4HST A;  2X51 A;  2CUZ A;  2MYS A;  4XKC A;  1WJC A;  4XKB A;  4DBR A;  4BGD A;  3HPG A;  2VIX A;  2CH0 A;  3VYU B;  2V4J C;  4BEH B;  3ZR8 X;  2V9K A;  2KPM A;  1Y56 A;  1FMW A;  4FET A;  2V6E A;  4XLA A;  1BR1 A;  4J01 A;  4ZYA A;  4E6K G;  1YX3 A;  3CMM A;  2XF5 A;  3W2W A;  2ZXH A;  2OV7 A;  2LH9 A;  3OYK A;  1MNE A;  3L2Q A;  4EAT A;  1E0E A;  3HKZ A;  2WY7 Q;  2IXS A;  2KDO A;  4U7B A;  3DPU A;  2XAU A;  3S3N A;  4HG2 A;  2R7S A;  2DOA A;  4IKF A;  2LRD A;  2KRH A;  2M3A A;  3CP8 A;  4BJ6 C;  2F5V A;  3LMM A;  4XL9 A;  3U21 A;  3MKY B;  3A4C A;  2VKD A;  3K4N A;  4BAC A;  3OYB A;  4PFO A;  4ITV A;  4JQF A;  3K4B A;  4OWR B;  3SEQ A;  2VPL A;  1D0X A;  3D5L A;  3BCB A;  2PMZ A;  3PSF A;  2HPI A;  2CV1 A;  2I8D A;  4XKV A;  3H35 A;  4IX7 A;  4BDY A;  1UEL B;  2L9S A;  4AYB A;  4BUP A;  2VJ4 A;  2KMU A;  4LIU A;  3C2H A;  1DP3 A;  3OS1 A;  2K9M A;  2IGK A;  3EUK L;  1MMD A;  4RMN A;  3DTK A;  1TT0 A;  2KL4 A;  1UG0 A;  5KHD A;  3RSN A;  2R7V A;  3OMY A;  4F3Q A;  4XN0 A;  2MC4 A;  3K10 A;  4BEH A;  2XSJ C;  1S9H A;  3RQ4 A;  4PJL A;  4CH7 A;  4BDZ A;  4ZC3 A;  2IS6 A;  4CUG A;  2VAS A;  2E5Z A;  3QOD A;  3DTE A;  3A2K A;  2W00 A;  2LRE A;  3PJR A;  4NNJ A;  4BU2 A;  1T95 A;  3OR2 C;  1WFX A;  3CES A;  2E60 A;  4XR6 A;  4GRI A;  3DKY A;  2K5C A;  3PFY A;  1VZ0 A;  3OYC A;  3IUO A;  2ZSI B;  2BVM A;  2Q2E B;  2HU9 A;  2R7X A;  3BLY A;  3H5R A;  4ZJZ A;  4ZDP A;  2L7K A;  2VXZ A;  3L2W A;  3E0J B;  3AFH A;  4N4N B;  2R7T A;  2HQA A;  3H9G A;  3V42 A;  4HNT A;  1YE9 A;  3LSH A;  4HPQ A;  2IS4 A;  4II2 A;  2W4S A;  4DIQ A;  2ZSH B;  1N77 A;  1WJE A;  3HPH A;  3HXL A;  3BG7 A;  3LL7 A;  2CFO A;  3QYB A;  4XM3 A;  3FKJ A;  1IRX A;  1N75 A;  3K70 D;  4CSW A;  2VLA A;  3RCO A;  3QOE A;  2R7W A;  2LC2 A;  3OWT A;  1G8X A;  2A5W A;  3H9J A;  1PYV A;  3ZCO A;  4C30 A;  2CMP A;  4LG3 A;  2VL8 A;  4ZTJ A;  2VJJ A;  3HOS A;  2HVQ A;  4RM3 A;  4II3 A;  1N78 A;  1SFK A;  2JSP A;  2BW3 A;  4RLQ A;  3LSK A;  3EUH C;  1WJF A;  1GLN A;  3W2V A;  2IGN A;  4PJN A;  4YRV A;  1MMN A;  2OC6 A;  2XF7 A;  3S8P A;  2WBM A;  2LBF A;  3IAM 2;  2KP6 A;  2L2O A;  3M1C A;  1SAU A;  4ZDO A;  2WAF A;  3K4K A;  2W7N A;  2WA0 A;  3L2U A;  2WAQ A;  2R7U A;  1WJA A;  2X6X A;  4HRI A;  3DPL C;  1LKX A;  1MMA A;  3DLA A;  3CZ6 A;  5FRO A;  1T0F C;  4F93 B;  2L5Q A;  3RTR A;  4XN3 A;  4XQF A;  3H5N A;  1QU3 A;  4ZTF A;  2CV2 A;  3VYS B;  2GOM A;  1R6R A;  4E7L A;  3SDB A;  2JVG A;  2ZFU A;  2KLO A;  3OOU A;  3UR3 C;  4LIV A;  1OR7 C;  2LY1 A;  1BOB A;  1ERD A;  2E5N A;  4XMY A;  2R7O A;  3EUA A;  4YEL A;  2FUG 2;  1EA3 A;  4B43 A;  3KYL A;  2X1E A;  3OIQ A;  3HOT A;  4CCK A;  2VXD A;  2JA2 A;  3VSK A;  4B3X A;  4DJA A;  4NC7 A;  1Z21 A;  1NG6 A;  2CW8 A;  5CKT A;  3K4C A;  2ELJ A;  2X1C A;  4U87 A;  1MMG A;  2V26 A;  2F6C A;  1KON A;  2BW3 B;  4PJJ A;  3MKZ A;  4Y3O A;  2NOJ B;  2XC7 A;  1W36 D;  2UV1 A;  3EPZ A;  1BR4 A;  4P1W A;  5CQG A;  1JI8 A;  2VQG A;  4E7S A;  3W2A A;  4NUB A;  3SYT A;  3PNY A;  3ZGK A;  2HVR A;  3J7A Y;  3TL4 X;  2WB1 A;  2LBF B;  4BE0 A;  3OS0 A;  1NG7 A;  4XNF A;  2DXI A;  1PJR A;  3H5A A;  2RRE A;  2QKM B;  4PSX A;  1V5E A;  2IS2 A;  5HLT A;  2MAB A;  4QPQ A;  3W3C A;  4C9Y A;  4KIS A;  2X85 A;  4QPO A;  3PL8 A;  3SEZ A;  3ZRG A;  3F9K A;  4YEJ A;  1V5F A;  3VYR B;  4XOR A;  3OYI A;  3D5S C;  3OYM A;  5CPR B;  3M8J A;  1UAA A;  2Z16 A;  1V5G A;  2VQH A;  2KZV A;  2AQE A;  3OYE A;  4XON A;  4XOT A;  4RM2 A;  2HDW A;  5TGT A;  2CW7 A;  1Z7L A;  2KRC A;  3KEY A;  5HNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...