3TBIA

Crystal structure of t4 gp33 bound to e. coli rnap beta-flap domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
AKLLDRQENGFIIEKMVEEFGMSYLEATTAFLEENSIPETQFAKFIPSGIIEKIQSEAIDENLLRPSVVRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase-associated protein Gp33
publication title Crystal structure of T4 gp33 bound to E. coli RNAP beta-flap domain
rcsb
source organism Enterobacteria phage t4
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2011-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16805 Trans_coact Phage late-transcription coactivator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tbiA00
3TBIA
chains in the Genus database with same CATH superfamily
1JXSA 1OMIA 3IWFA 5FD5A 1MMNA 4XONA 3RSNA 3U21A 1KYZA 3S93A 5HLIA 3NAUA 4DZPA 2R7QA 2ZJRF 1IRZA 2V7FA 2ZC2A 1BW6A 1MMGA 1NHAA 4XSZF 4B3XA 4G6TB 4MEXF 1YFHA 4IOCF 1V5EA 2LH9A 3GFLA 5E1XA 5E1ZB 3JRFA 5ERIA 2RN7A 2WAQN 4C30A 4HRIA 4IEJA 1FC3A 4W97A 2ZB9A 4XLFA 5J1UA 2R7UA 1LKXA 1D1CA 5TJJA 3CMYA 3HBLA 2NAZA 3FM5A 3W2VA 5EDNA 1X2MA 2VQLA 2QENA 3BPVA 3O3KA 3KP4A 2MW8A 4ESFA 1LEAA 1Y1VJ 1YOVB 2WY8Q 2CQNA 3VDXA 3CCVI 1FTTA 1GVJA 4CXFA 3ROUA 3JRHA 3HDDA 3OYHA 1B9NA 1LQ1A 4IVNA 3O8GA 4AM3A 2F5VA 2Y30A 1H0MA 2JK3A 4UUTA 2ZO4A 4IQ4A 4NNJA 2K4JA 2X6XA 2L54A 2NRAC 3WE3A 1S7OA 2GLOA 3QOEA 2JSPA 3BR2A 4A3EJ 5L3FA 2PG4A 3KP5A 2CUFA 1R1TA 3FMSA 1L3LA 2FMYA 4DQ2A 4M3FA 1WVRA 1WJAA 4PJJA 1ETOA 5FFXA 4G7HF 4A0XA 4BXXJ 2FSWA 4Q47A 5JVGF 2C6YA 1P4AA 1O7FA 2L01A 1VQNI 1H89C 4PJNA 4RB0A 1XCVA 1B1BA 4F7ZA 3IRRA 1SMYF 1UJ8A 4KFCA 2W25A 3CUOA 3H1CA 3GTKJ 1ZREA 3HRTA 3JW4A 1BW5A 1G3WA 1STZA 4IF4A 3GCMA 1VQLI 1B59A 2BY0A 1Z3XA 3K70D 3ZOBA 2HU9A 3HL2A 3FZVA 3CCYA 2K7LA 4KYWA 1S6LA 1ZH5A 2GQQA 1BI1A 5FKLA 3IUOA 5J8FA 3S3NA 3WTWC 4M72A 3LAJA 2QEXI 1ON2A 1IO2A 3VFZA 1TL8A 5DM7F 1WQ2A 1VQKI 2R7FA 3BZKA 2Y0SA 2W4SA 1R58A 3FKIJ 3KEOA 1OCPA 5HLTA 2CQXA 2E60A 4E70A 2V1NA 4OIRF 2K9LA 2L7FP 3CDIA 2CSOA 4KIBA 1IUYA 2EIMH 1P2FA 3BCBA 3LFUA 1PJRA 5LGTA 3FHZA 3LSMA 2HZTA 4XBFA 2VJ5A 4WXHA 2RAEA 4F3QA 3FHNA 1R9TJ 5GP9A 3GZNB 1V5FA 3EYIA 2O7OA 2IT0A 3ZCOA 4S05A 3V8KA 2CW0F 2VONA 5GPCA 2WV0A 3ZMSA 2LKSA 4G94A 3O6BB 3CCRI 3HRUA 2RDPA 2ZXHA 1R49A 1XGSA 3HRMA 2DA3A 2LK2A 2XIGA 1MMAA 2RQPA 3DEWA 3SYTA 3VODA 4ENKA 4FX4A 1VQMI 1WJEA 3KZZA 1YRNB 3I4MJ 4I6ZA 4JP0A 4LIUA 5IT9Z 4ZDLA 3ZQLA 2DJIA 5IT9K 3I59B 4FCYA 3WTSC 3GO5A 3G3ZA 2R93J 1KQ0A 1D0XA 2P5KA 4I7HA 3KE2A 2ACJA 1A36A 3GW2A 2BY3A 2V1DA 2XAQA 5ICFA 1ITYA 2DW4A 1T08B 1Y8QB 5C4JJ 2X1EA 2Y9ZA 1VQ5I 5HLHA 3IV5A 1D1BA 2A5WA 1FSHA 5C4XJ 1D3YA 1YRNA 5B5EC 4FTHA 2W85A 1ZKGA 2WV1A 3BTCA 3LFKA 2Z3YA 4I98B 1LB2A 3S1RJ 4NC7A 3I59A 1Z3YA 4XLCA 4G12A 5HLGA 3OYIA 3OYMA 2VI6A 4ANJA 2H6CA 1SFUA 5LGNA 3CZ6A 5DEQA 3CCJI 1QZZA 1Z21A 1IW7F 4EMSA 1ETYA 1MNDA 3MWMA 1IDZA 3DBRB 1QHGA 3K4JA 1HW1A 2LRDA 1F5TA 1GUUA 1POGA 2XAJA 3GBGA 4BJ5C 4P55A 3W6KB 2LBFB 3RKQA 2VL8A 2DBBA 3S3OA 2VIXA 4P96A 2X6YA 3TMOA 1HKTA 3W3CA 2VQCA 4U7BA 3VYRB 1A6QA 4A6DA 1JGSA 3DFGA 1Q1VA 5TRDA 3AL0B 4NBQA 2BE5F 2DOAA 2Q0OA 3M8JA 2M9HA 2GA2A 1ZYRF 2ZJ2A 2H1KA 1MD0A 5H20A 4LLNA 2FX0A 2VE8A 3CF5F 4RB3C 5K7HA 4E7LA 4V19K 2LBFA 1LVAA 1IN7A 3V7RA 3RJPA 1YTYA 4DBQA 3KZYA 3K1MA 4Q4ZF 1BJAA 1Z6RA 1GLNA 4D5CA 4HDUA 2K02A 5LHGA 4XRSA 2XHKA 4M3DA 5ICGA 1P92A 2M3AA 2EFQA 3KZIC 4OIPF 1R7JA 2KDZA 1Y0UA 2JT1A 3GLXA 4U0YA 1XX5A 3DWLE 2VLAA 3QYFA 4QPOA 1JKRC 5ILVA 2DMUA 5F04A 4ZYHA 2LFBA 2XGEA 1VQ7I 1VFCA 2HS5A 2QKLB 2YR2A 3ABKH 1U2WA 1VQPI 2FF4A 4KNYA 1EH6A 1OCCH 5CVJA 5BOXA 4LMYA 2PFBA 2X48A 3RQIA 3WHCA 3GTQJ 5HDGA 5DDGA 4J00A 2V6EA 2HTJA 4OU0A 2W57A 1BR4A 1QRYA 1QZYA 2HPMA 3T8TA 3WGGA 4XQFA 2XASA 1ZAOA 4M9SA 1S29A 4FHTA 2JUGA 3CJNA 2W24A 4FT8A 1X3UA 3MQ0A 5J3LA 1PVEA 4UY8I 3EUHA 4I01A 2V79A 2YU3A 1AU7A 1GHCA 1O3SA 2RGVA 3RI4A 5F1RA 5LFAA 2O3FA 2YS9A 1TT0A 5EEGA 4JYKA 1MJ9A 4ITVA 4BHPA 5D5XB 1I3AA 4ZTFA 3ULQB 4L0YB 4CGZA 3HSRA 5D8LB 3SXYA 5CVVA 2GXAA 4HNVA 1WKMA 3F8BA 4OINF 1OCTC 4NC6A 2M4KA 1KONA 3CESA 1Z91A 4Y52J 3ZMZA 3HOUJ 4ZYEA 2VB6A 2DQRA 4XL9A 2O9LA 4HQEA 1E17A 3Q0VA 2PBIA 1YS6A 3VOEA 2VKEA 3DKXA 2R7WA 3LSTA 1XMKA 2ETHA 1K6OA 1MBHA 2FA5A 3F8FA 4UUSB 2ESNA 3TP0A 4EQQA 2F4OB 2NVUB 3RPUD 1BL0A 1RKWA 1IN6A 2QZ8A 4UVAA 4HBLA 5H6RA 3PUFA 3TDUC 5FRMA 3MKLA 1EF4A 2QSGX 2O8KA 4KN4X 2KQRA 2WC2A 3T5XA 5GADJ 1QO0D 2A6EF 2BV6A 3JRCA 3CC2I 3AFHA 1T39A 1XGOA 3H36A 2QCOA 2HI3A 3DPUA 4GGGA 1MBJA 3I53A 3QU6A 2ICWG 4UUSA 4D7MA 5IP9J 2KDOA 4HV6A 3SJMA 2JA8J 1X1CA 1FIAA 3L2CA 1HW5A 2E2HJ 2DFEA 1QPIA 1U9OA 3GTMJ 2IS2A 2VBZA 2HXOA 2EFOA 4BKXA 1ODDA 2CUZA 4HLYA 3GWZA 3F21A 4RLQA 3GVAA 1W4MA 3IWZA 4A3GJ 3C3WA 1BA5A 4C9YA 2NS8A 3ABUA 2Y0SN 3TL4X 1SMTA 2PEXA 3OWTA 4BHCA 3CCEI 1OYYA 2Z99A 2HEOA 2X4HA 4R1HA 3KYDB 2Q1ZB 2E35A 1Q1HA 2ZBKA 3LMMA 3GUDA 1WJCA 5HS9A 1WI9A 2HYJA 4HF0A 4YFNF 3E1SA 4F55A 3WU2C 3FK7A 1FOYA 2H09A 3L9FA 1AOYA 4CYDA 1HKQA 3S1MJ 4D1QA 3HEFA 1FMVA 2H8RA 4A93J 1TW3A 1GXQA 2CFXA 4LLLA 3FXUA 1R22A 4OIOF 3LA7A 3J80Z 3RIRA 2Y0MA 4UV9A 2QA4I 4Y33A 3J80K 1SC7A 1BJZA 3RKXA 3QRFF 3UKGA 2KP6A 1RC9A 5CKTA 1I39A 1H88C 3M3YJ 3PFIA 2OCCH 3F8CA 3FXOA 3BR0A 4XMYA 1OQYA 3BR5A 2CQ7A 1RI7A 1ZELA 2BOLA 3A1YA 1G2HA 1IXCA 5BPDA 5LHHA 2AXTC 2DK8A 3WU1B 2UUZA 3DV8A 1W36C 1SANA 1MZBA 5E3MA 2FQ4A 5FFZA 3J7YJ 1HDPA 1D5YA 1BBYA 5FLXZ 4CZCA 3AG3H 5FLXK 2ECBA 3KPHA 2H1LA 3B02A 4HW0A 1P9QC 4MEYF 4B4CA 5F0FA 1I1GA 2NNNA 2VKDA 3JR9A 2LR8A 5F0HA 1UAAA 1MMSA 1U8BA 3SZGA 1ENHA 5DV5A 1TWGJ 3W6VA 4C2MJ 3LSKA 3VSLA 2UV1A 2ZCWA 5AIPA 4F52A 1VQ9I 3CJRB 3KLNA 2VUMJ 1JUMA 2WB1A 3ERED 3C2GA 1FOXA 3CDHA 3PJRA 1D0YA 2W7NA 3ZN1A 2JA6J 1WHUA 3JTHA 3PO3J 1HSJA 3DBHB 5FGMA 2GA1A 1B72B 2P0WA 1BR2A 1I3QJ 2PJRB 3I5UA 2MBFA 4AUXA 3KX2A 3ZQGA 4KT5C 3HHHA 2QBYB 5EJCA 4A69C 3BJ6A 3I58A 2HYGD 1X4OA 5EEHA 2XRLA 4ZTJA 2CYYA 1TBXA 2D5VA 5BMZA 3BJAA 3BQZA 1IRFA 2A68F 1U5TC 3HUGB 1ZGWA 3ZMUA 1YE9A 1B72A 1PUEE 1WWXA 2PJRA 2RQQA 3FX3A 3V8LA 5JR3A 2IS6A 2ZXJA 3L00A 2QBYA 1IN4A 2RV8A 1DU6A 1W5TA 2KFDA 5JI6A 4XKBA 2STTA 5CQGA 4D0PA 2EPFA 5IY5H 3TGNA 4CSWA 3LSRA 1R23A 2DA1A 4HX7A 3HKZA 2HOAA 4OOIA 1QBJA 3I56I 3HUGA 5FKNA 4WXCA 3GTLJ 1S72I 1MW7A 2QYOA 2NXNB 2KRFA 1YITI 5F0CA 2DT7B 3GTOJ 3G71I 2HPIA 2BVMA 3LWFA 4A0ZA 1UG0A 4RLFA 3BG7A 4RM3A 2YPRA 2A6TA 1O3RA 3HM5A 3WGIA 1D8JA 3PQKA 3K4KA 3JRDA 4C2UA 3BOQA 4LOCA 2F5FA 2JPBA 3GXOA 1ZGJA 1XCBA 5J8CA 2QQ8A 1K83J 2A5YB 3JTGA 2KKOA 4I99C 5EZGA 2OA4A 1JTXA 4C3HJ 5LD2C 3IC7A 2IXSA 2PN6A 1H9TA 1O4XA 4AVPA 1RR7A 2LOOA 2DYSH 4G7ZF 1O3QA 1QPMA 2JPCA 3QP6A 2Z1DA 1NK2P 3HSEA 3DTEA 5L3CA 1UHWA 2DMTA 2FBHA 4PCQA 2F2EA 2L7KA 4YG2F 2WWYA 2E34A 4WXDA 2XB0X 4JX5A 4X1EA 1KQ8A 3PIOF 3P9CA 1BC8C 4ESBA 1BIAA 2KZVA 3QODA 4KDPA 4RBOA 2JJ7A 5EF6A 3BG6A 5IYCJ 1KA8A 5GTIC 1ZLKA 2DT5A 1V3FA 4I02A 2AS5F 3WTUC 3ZN0A 3MFKA 5DM6F 2M1BA 3EYYA 5HOOA 2E7WA 4BACA 1HSTA 1VNDA 3FWEA 4O6JA 3TO9A 1Z6TA 1FP2A 2L0KA 4HDVA 5JHUA 3CTAA 1E3OC 1VZ0A 3I3LA 4RAGA 3HG9A 2NVTJ 3MKWB 2L02A 2R5ZB 2Y2ZA 2IPQX 2RC4A 3CC4I 3PFYA 2XGCA 2B9SA 5TGTA 2W82A 3G1LA 2LKPA 2FEZA 1V55H 2OZUA 2QQAA 1T6SA 5E3NA 3L2VA 3IAM2 2W1OA 3DCFA 2HQAA 1IN5A 4AIKA 4C3IJ 2G0EA 3E6MA 1LFPA 2WBMA 4PFPA 4HZFA 1CGPA 5K1YA 1A31A 2NVXJ 1ULYA 4A3JJ 1TWFJ 2R5ZA 3KYLA 2MC4A 4U0WA 1X3WB 1Z0XA 4HEA2 2ZNZA 2AQFA 1TQMA 3TP3A 5J40A 3HOTA 1ZG1A 3NWTA 2HFHA 4MNUA 2VBYA 3HOSA 3BROA 3E6DA 4II2A 2E1CA 3RDIA 1J0RA 1T33A 3WGHA 3GZ5A 3H0GJ 3JRIA 2IJLA 2NVQJ 5D8KB 4CZZA 3EPZA 4NC8A 3I55I 2L9RA 2MG4A 3O2PE 2KHMA 5L3GA 2CQKA 4JX6A 3Q3SA 1QQIA 1DDNA 4JQFA 3VEPA 2DCEA 2ZKZA 2FNAA 1KU3A 1E3PA 3KIOA 1WPKA 1KZHA 3HOZJ 2XUBA 1FYLA 3TBIA 3CMMA 3K7AJ 3UNGC 3E3VA 2HQRA 4XLEA 3CCSI 1P4WA 2EZLA 2XAHA 2CV0A 4L9TA 1ZARA 1T98A 5J47A 4AWXB 3BG5A 4ZDOA 2WTEA 4IHTA 4H0EA 2BYVE 3NQOA 1S7AA 2EJRA 2HZDA 4QLCU 3CUQC 2LY2A 2ZFWA 1XGNA 2DOEA 4ON0A 4Q48A 3KCCA 1QZEA 2IRFG 4EATA 4AU7A 2BVLA 5FB2A 1J9IA 5J1RA 4E7JA 1JT0A 1TZLA 4NDLA 1VTNC 4BQQA 2GM4A 2EFWA 1K4SA 1TTYA 1X1BA 2QGUA 2XF5A 2XV4S 1USTA 2R7DA 1HW2A 3TOBA 2G7HA 1J5YA 2HQNA 1FIPA 5LHIA 2ESHA 3G2BA 1SD7A 4DYRA 2V1UA 3I64A 1F43A 3LSPA 4KT6A 3SDBA 2V26A 4CCNA 1IAWA 3FBNB 4FE4A 1MJBA 1LE8B 2AXLA 2HXIA 2QVOA 4UVCA 5FKKA 3BPXA 3F22A 2CRGA 4UV8A 5J4VA 2P5LC 4KIGA 2WB1N 3G6EI 1QA6A 2ISYA 2Q2EB 5FRNA 4RDUA 2KMUA 1MMDA 1DPRA 4LD5A 3V4GA 5KCMA 2KJBA 1M1EB 1K79A 3I4PA 2MLKA 1TQPA 4L9NA 5GAHJ 1U78A 3C2BA 3L09A 4L9JA 2N8GA 4D9JA 2IS4A 1CF7B 1XMAA 4F91B 2BW3B 2XROA 1LE8A 1I5ZA 4EM1A 1HBXG 3V7CA 1PUFB 1JHHA 1X58A 5F08A 4WCGA 1W0UA 1EH8A 2O61A 2FNPA 4D7NA 1E2XA 2K3FA 2Q2EA 3FXRA 1E3HA 1AWCA 4F92B 2NS0A 2A07F 5L3EA 4OAYA 1Z1DA 4CDGA 1ETXA 2W48A 4BXFA 1IV6A 3M4OJ 2DPUA 3ABMH 3W6JB 3LQQA 1T95A 3ZPLA 2CV1A 1HLVA 3NWSA 2FQ3A 3K1PA 1CF7A 1K4TA 2LMDA 3PSFA 1R4MB 2BW3A 3QP5A 4MFEA 3JRAA 4A3FJ 1JJ6C 2IVMA 1UMQA 1XG1A 4ZJZA 4JX4A 2MFZA 3E7LA 1RESA 3WODF 3SFZA 3VYUB 2ME0A 1OYWA 5FJ8J 1PUFA 3C18A 4IRIA 4IOAF 3R6SA 3RYPA 2QQBA 1FY7A 3Q0UA 4RGXA 4A12A 4RB1A 4XM3A 5BS6A 3OIQA 5HNFA 2CS3A 2R7RA 2DA6A 4Y17A 1UCRA 2FUG2 2QF7A 4MGRA 4PJMA 4PZJA 3LA2A 3DLAA 2ELJA 1F4KA 3P9KA 3QPLA 2M2EA 1MIJA 4GYIA 2IGNA 1TW2A 5F64A 1YQAA 4LB5A 3HOWJ 4LJZF 1DGRM 2YX4A 3QOPA 1ZR2A 1MGTA 2DMNA 2DYRH 2X51A 3CCMI 2F5EA 2L7MP 3Q5FA 3M07A 2L9SA 3CC7I 2WAEA 3M1EA 2A05A 2H27A 1KGSA 3OS2A 3K4MA 5FLVA 1O7LA 4OWRB 5B3SH 1OYIA 4HF1A 3HSFA 5IPAA 3WTZA 4GRIA 2F5CA 5ILUA 2DU9A 1XS9A 9ANTA 2BY1A 2E2IJ 4E7IA 2M45A 2R3SA 1WZ2A 1FOKA 2NNYA 2BGCA 3ABTA 3REOA 2QQ9A 2JRTA 5ED4A 2KPMA 4YRVA 4U87A 4EJOA 2JRMA 4PGHA 4XKCA 1TNSA 4YFXF 4XLHA 3MZHA 1QHHD 5DTDA 3E5UA 3TKYA 1ZGAA 3BC8A 3CDLA 4ENJA 2LY1A 4HOBA 4E7SA 3WHBA 4WX9A 1YJNI 2G7UA 1CQTA 2EV0A 3DTIA 3P7NA 2KIMA 3CMAI 4X6AJ 3EDPA 1HKSA 2LDUA 2LSOA 1FYKA 1OISA 3JRBA 4D5FA 1IGNA 1G3SA 2VJIA 2VXDA 4LGWA 4AIHA 3KFWX 4LG3A 1JHFA 2LNBA 2KIQA 2OQRA 2RREA 4KICA 1YS7A 5C44J 3U2RA 3Q9VA 2XRNA 2IS1A 4HQMA 5M3MJ 2HOTA 1H8AC 1AKHB 3M8FA 5J6XA 1FTZA 2AHQA 3W2AA 4XLPF 3OYGA 1WJDA 3DKWA 4IX7A 2BHYA 1OLTA 1YI2I 3CO7C 1BI3A 2R7VA 2K3PA 3K4CA 3LQRA 3M1CA 2Q8KA 3CCLI 1W7PB 4I2OA 2XPUA 5D6FA 2Y75A 2R7ZJ 6PAXA 1MH4A 2JUCA 1TC3C 5KK1A 3JRGA 1W1WE 2ID6A 2DK5A 2HYFA 3KLOA 2G9WA 2M0CA 1AKHA 2HVQA 3C2HA 3U9GA 1JGGA 2B63J 2DO7A 5J4YA 2M8EA 2M0MA 1O3TA 2RNJA 3LSGA 4CCMA 4BY7J 5E8GA 2DODA 2XAFA 4V2GA 1T0FC 1W7PA 2GXBA 1F36A 3M8EA 3HPHA 3QU3A 5F1JA 1IJWC 3BP8A 1XN7A 2XDVA 2WADA 2DXIA 2Y9YA 1Y1WJ 3IAS2 1Z7UA 3LAPA 2VE9A 1B6AA 1UB9A 3DP7A 3RKYA 3OV8A 2M7BA 1R36A 2VN2A 3W2WA 3ML6A 3H9JA 3OYEA 4EGYA 4U0VA 1GV5A 3VSKA 3NRVA 2LY9A 1MBGA 5IOZA 3ZQQA 1NTCA 4HAMA 2DA2A 1MSFC 1ONVA 1SAUA 4QIWN 1PYVA 3ZP5A 3H5RA 1LVKA 1XMXA 2XVCA 4YELA 1U5TB 3K10A 1YO5C 2HOSA 2XPWA 3CJTB 5DD4A 3F6VA 1XTAA 2R4GA 2HOEA 4RAFA 4P9UA 2OAZA 4ENNA 1RR8C 4A3LJ 2OTLI 2OUMA 2IGMA 3OYAA 1G59A 5LBQA 2EB7A 3OSFA 4EM0B 1OPCA 3K0LA 2DFHA 2V9KA 4A3MJ 2M4GA 3DBLB 4XIDA 4ESJA 2K40A 4PFOA 3E97A 1YW8A 2Z33A 4XLAA 1XD7A 4XOTA 1ZTRA 2K9SA 2L9NA 1XDSA 1U5TA 3BZ6A 3LNQA 4KN7X 2L7ZA 2HDDA 1S7EA 4V2FA 3JSPA 4LB6B 3TEDA 2KRCA 2R7OA 4B09A 3HYIA 5E8IA 4IL6C 4IO9F 4IHYA 1WRJA 4HNUA 2CUJA 5AIQA 3PO2J 1Z05A 4FETA 5AONA 2TCTA 4H4KC 2V4JC 4BJTA 1USSA 2Y69H 3M7GA 3FXQA 4KMUX 4A5NA 1R4NB 3HHGA 4BDZA 2YSRA 3D5RC 3OYJA 1FSEA 2HDWA 4W1UA 2HWVA 4XSXF 2JZYA 3VYSB 3V42A 3DU6A 5FROA 2COBA 3B73A 2BXZA 4A6EA 2EIKH 1JKPC 3OS0A 3IKTA 2A6HF 2P7VB 2LF8A 1WH7A 5CVIA 3G73A 4A3KJ 4LITA 2M87A 2PLYA 4LG0B 1MKMA 2CV2A 1BR1A 1YG2A 3PQJA 2HQ5A 3H9GA 4A0YA 3LOCA 4CCJA 2VC1A 3CP8A 3BR1A 1DUXC 1YYVA 2O03A 4AIDA 2L4AA 5GTHC 2H8WA 2HVRA 1Z9CA 2P5VA 3UR3C 1ZN2A 5CVRA 4IHWA 1BIBA 2Z5UA 2I10A 3E6BA 1EJ9A 2Y31A 4X0GA 1XPXA 2XKOA 3OL3A 3K69A 3NARA 3OOPA 1OR7C 1TP4A 4LG0A 4XICA 1I50J 3P9IA 1JJ8C 4J01A 4MQVA 1DP3A 3LSJA 2IEKA 1BI0A 4HSTA 4EM2A 2DN0A 2PMZA 2OQGA 2IW5A 4Y4RA 2CWEA 2DLLA 3VB2A 3H0DA 2M30A 1FBUA 5K7FA 4IHSA 3ZXSA 1APLC 1JUSA 1I27A 3S32A 5GAGJ 3LSHA 2NS7A 2MD5A 3S15J 2K9QA 2A3SA 1GV2A 3V7SA 5M5YJ 1MDMB 4HV5A 3HOVJ 3Q0WA 5KAFC 4PUSA 2OU2A 3BWGA 5CLSA 4UB8C 2VC0A 4HF2A 2L3DA 2GIZA 1JT6A 4ZDPA 4B8XA 4BBRJ 3BR6A 4B1RA 3ABLH 3PNYA 5E20A 3S2HJ 1N75A 1WJBA 3ZMVA 1ZRDA 1LPQA 1P6RA 2DTZA 3CP2A 3OOUA 1XSXA 3H92A 2Z9OA 3FKJA 1P7JA 1MDMA 1R5GA 2E2JJ 5J1YA 1FLIA 3S3MA 2CMPA 2LG4A 3HGYA 4XNFA 5L3DA 4CUGA 4MTDA 2B0LA 2HTSA 3DPLC 4ZZLA 4XLNF 3B6CA 3OYLA 2ZMEC 1HF0A 4CYCB 4BXUA 2O0YA 2P6TA 4U7DA 4I09A 1DGWY 5EG0B 4EJTA 4XRFA 3K2AA 2CUEA 3RCOA 2K27A 3GTJJ 5BPIA 3S1NJ 1O57A 1MBKA 4XORA 5B66C 3ECHA 4BQOA 1ZG5A 1IRGA 3CMEI 4E7HA 3I9V2 1Y6IA 1IUFA 3S1QJ 2ZNYA 5E79C 2EA4A 3AKZA 1GDTA 1U0JA 2NOGA 5K7ZA 3G4SI 3HB9A 3GX4X 3VPRA 4HLXA 2P81A 1XSVA 4IRHA 1A5JA 4L5EA 2DT6A 1VQ8I 4CYCA 4WF2A 4L0ZB 2K9NA 2VJ4A 3CUQB 3LL7A 1X3ZB 2ECCA 5KNLA 5EG0A 2XC7A 3RKWA 3OY9A 3EUAA 1D8KA 4AIJA 1WJ5A 5LRRA 3WG9A 2CGPA 3DQVC 3GF2A 4XN0A 3MZYA 2FU4A 1I6HJ 4G6QA 1XSDA 1Z67A 1ZG3A 3QQAA 2DDBA 5FO5A 2FJ1A 2KLOA 1FP1D 2R7XA 1NK3P 4DYQA 2VPLA 3CUQA 3OIOA 4OIQF 2M34A 3TO7A 2IA0A 3CLOA 1KYWA 1IN8A 1WCMJ 1GT0C 3BZCA 3SQNA 4BE1A 1X2NA 3S14J 1TLHB 4N4NB 1S9HA 2GAUA 1IZ1A 2CU7A 1YW9A 2PMUA 5M3FJ 1YX5A 2R7SA 3HZJA 4EV0A 1UELB 3L2QA 3PIPF 1J59A 3RZDJ 2YX7A 4NB5A 2UZKA 1R5ID 4B44A 1N77A 5FD6A 2MABA 3HGGA 3MCZA 3ZQFA 1OCRH 2EIJH 3CLQA 3MMYB 3BDDA 1HC8A 1JTYA 2OV7A 1VQ4I 2EWNA 3QPSA 5HS8A 2IA2A 2QLZA 3A03A 5FKMA 3U1KA 3MVPA 4A3CJ 1LDJA 4HSRA 4NUBA 3IHUA 4IZZA 1N78A 1RPWA 3P5JA 2ELKA 3R0JA 5KAIC 1D1AA 3Q9SA 2EK5A 4UHTA 3ZQCA 3FXKA 1YW7A 4ZYAA 3DPTA 3RYRA 2P8TA 3OYNA 2MYSA 5E3LA 1TQIA 2B7EA 2BEOA 3J7AO 5D4SA 2MSYA 3BCAA 3PUBA 1MJAA 1YX3A 1N25A 1TWAJ 3GFJA 4BBSJ 1FZPB 1HOMA 4NQWB 5BQTA 5JFRA 1A04A 5K5OA 3D1NI 2OZ6A 2QSFX 2KISA 2XGDA 1NG7A 1ETKA 1UHMA 1SVLA 2ZSHB 4DBRA 1TT5B 3BJOA 4GO1A 5ILSA 5HNHA 2L4MA 2XSJC 5HVQC 2CJJA 4IRGA 1A35A 2HKOA 1ZLJA 4DGWB 4DZJA 2E36A 3GTPJ 2X6OA 1IXRC 2TRTA 1TNTA 3A0HC 3DXJF 3FM3A 1HCRA 2QWWA 4GFBA 1W5SA 2X6WA 1LDDA 3ESWB 4NQWA 3J81Z 4CO8A 5B1AH 3TW6A 2PI0A 3J81K 2E5ZA 2RKHA 5DCFA 1RUNA 4UXNA 3WTXC 4PJLA 5HDKA 1U6GA 1X19A 1EV7A 1ZRCA 1QVUA 1FPQA 2VT2A 4UUVA 2OD5A 3PL8A 2PJPA 3FIWA 3SZPA 3F9KA 3WE2A 2JVGA 2FRHA 4L18B 2CO5A 4M6XA 3FDYA 5GAEJ 1LUJB 3ECOA 5F27A 2P6SA 1K61A 2MA3A 1DP7P 3GYHX 2OJED 4BDYA 1YJWI 4RGRA 2X9DA 2Z2SB 4J19A 1OJLA 2GOXB 4KISA 2JVHA 4HA8A 1YHQI 1MNEA 1W5CC 1W0TA 3OYKA 3H3VK 2X0LA 4KJZA 5E18F 1SAXA 1ERDA 4N4OB 1BM9A 5A2QZ 3OYBA 5A2QK 3OMYA 1UFMA 3FISA 3K4BA 4DNCA 1TWHJ 3FMRA 3IH3A 4RGSA 2R7TA 3BR3A 3FXJA 1MBFA 3IP4B 4L5IA 2OPTA 4MO7A 2R92J 5D5WB 2CW7A 2HDCA 4PJ0C 1ON1A 4A5MA 2WY7Q 4Y13A 3HRSA 1Z77A 3ERMA 3G1MA 1B9MA 1JKQC 1P7IA 2E1MC 1F1ZA 4JBAA 2K85A 4LK1F 5BNGA 5FLMJ 1YIOA 3HJEA 4UNOA 3DEUA 5DS9A 4HX4A 1UHSA 5FKOA 4MLOA 2LYCA 4S0HB 2LD5A 3ONQA 1W36D 3OR1C 4CICA 2STWA 3RQ4A 3ZQ7A 3ZQIA 2PMZN 4XR6A 3KEQA 2D45A 4C2TA 1W7PD 3GLLA 3K4NA 3MN2A 3OYCA 2K4BA 3SFIA 1RZ4A 2P7CB 1X1DA 2D1HA 1BN5A 3FF5A 1FMWA 1K6YA 2BZTA 3FK6A 5GPAA 3EUKL 2WAFA 4PGGA 4XKVA 3V8JA 3I4NJ 2V9PA 2MD0A 4EJVA 1T2KA 2JTVA 4BUPA 2H94A 1ZHFA 4A3IJ 1ORKA 3K2ZA 2DFIA 3OL4A 1SEUA 1JI8A 3BTLA 2LVSA 4O5VA 3PM1A 5DD8A 2P4WA 1FWZA 3CCQI 3A02A 3WTYC 3AAFA 2IA1A 1IV8A 1OFCX 4RAYA 2JA7J 3OS1A 3S8PA 1DPUA 1C0WA 1UG2A 4BE0A 2ISZA 4PDKA 1X1PA 2K86A 2KIFA 4HG2A 1Z7LA 3OYFA 1LDKB 2X1DA 1LEBA 3HKZN 5IP6A 2E1OA 5DUKA 4BGDA 4OAZA 3MD2A 1A6IA 4Y7NJ 1Y39A 3SEZA 3MAJA 1S3JA 1SFOJ 2QSHX 5KHDA 2E1NA 2GWRA 4A2UA 4PK4A 4XRMA 2ZJQF 3E0JB 2KZGA 1ETQA 4CHUA 3K6GA 2HGCA 2KT0A 3ZQHA 4QTRA 4M3GA 4AYBA 1RIOH 1B4AA 1AA7A 3BTIA 4DIQA 3GTGJ 3OIPA 1T0FA 1FBQA 1FEXA 1LFUP 1XDUA 1H9GA 4I0AA 3K1NA 4CA0A 2PQ8A 2EQRA 3OR2C 5EEAA 4M3BA 2BXYA 2F5DA 3WU0A 1JUPA 4ENMA 4NHJA 2ZFUA 1LJ9A 5B1BH 1QVTA 5HS7A 2LP0A 2EA2A 3FXLA 3BG9A 2CH0A 4RB2C 4B47A 1IF1A 2DJNA 3B6AA 3JSOA 3OYDA 1NH3A 4QSHA 2IAIA 2JSCA 4EJUA 2VQHA 2COMA 5JHFA 4FISA 5D6EA 2XPVA 1AHDP 4FE7A 4M6YA 1T8IA 5E1WA 2VASA 3D5SC 4GXOA 1WI3A 3A01B 4LFUA 4RS8A 4ASNA 5EZHA 1OKRA 4MHGA 3MKZA 4FQGA 1SVOA 3JREA 4E7KA 3KP3A 2VBWA 5ICEA 3PNVA 1VQ6I 4QWQA 4PSXA 2ID3A 1OCOH 2VQGA 2DDAA 4MQ9F 4KITB 2O8XA 3ZR8X 1S5LC 2L9VA 3MZ8A 3KP7A 4E7ZA 5KVRA 1U3EM 4S04A 2VT3A 4LIVA 1FT9A 1MNMC 1Y0NA 3AG4H 4L9VA 3M9AA 3QYBA 1G8XA 3EQLF 2GXGA 1SVMA 5LEKA 2PX9A 2EILH 3A01A 4IQJA 4JK1X 1T56A 4OMZA 4ABZA 2UXNA 1QU3A 2FBKA 3SEQA 2EV5A 1ZR4A 5EGOB 4K2EA 1X1AA 1K7AA 2QM3A 4GCVA 5LGUA 1QNTA 2J5PA 2VJJA 1FJLA 2DA7A 2F48A 4L5JA 5M5WJ 3HOYJ 2L5QA 2QUFA 4B3AA 3DF8A 4GYGA 3GMEA 3HPGA 4B43A 3CJQB 4CCOA 1BOBA 2I5UA 2KRHA 3ISPA 2W00A 4BY1J 3S2DJ 2E5NA 3H3ZA 1TWCJ 3J7AY 3FXMA 1J09A 2ELHA 2FMLA 2XF7A 3E6CC 1F9NA 1SFEA 4P5OA 3BQYA 2JA5J 2VOOA 2NVYJ 3BY6A 1SD4A 3JCUC 5EGOA 1IC8A 1BC7C 3R60A 2JA2A 2K9MA 4II3A 4BE2A 2D1VA 3JAMZ 3TQNA 3J7ZI 2K5CA 1WH5A 3JAMK 1WFXA 2LC2A 3ZMTA 5IYDJ 1IRXA 4MTEA 2IGOA 1EKEA 4G9YA 4M6VA 4ZH4F 1PDNC 4M74A 5CJ9A 3LA3A 1KU9A 4CCKA 4IHVA 5HDNA 3MEXA 1ETVA 2V6CA 2DOFA 2HNHA 2TDXA 3ELKA 3CO6C 2XKPA 4BQNA 4I76A 1JE8A 4RMNA 3EETA 5D5VB 4G6DA 2VBXA 4XK4A 2WA0A 3KEYA 4Z2YA 1RUOA 4BYYA 4AC0A 3HTSB 1OR7A 2VXZA 4WWCA 3FMQA 3C1DA 2J5OA 4DW6A 3T8RA 4XN3A 2X85A 4BS9A 2EINH 3HTUA 4YFKF 5K5QA 4G8XA 2XB5A 3DU5A 2FOKA 2ZJPF 1ZRFA 1DU0A 3IRQA 1K78B 4ZC3A 2YUSA 1D5VA 2DFFA 4M73A 5L3BA 2BY2A 1HQCA 1ZQ3P 1WGXA 3IKVA 2MH2A 5CVUA 5DYMA 4HNTA 1MSEC 1X4PA 2L2OA 3H5AA 3SDGA 4KMFA 5CYVA 2WAQA 1D0ZA 2DTRA 3F8NA 4E6KG 2RVCA 4GDFA 5D5UB 2MH9A 3F8MA 2ADUA 3ZGKA 4BJ6C 4JOMA 2ZMEB 1RRJA 3CCUI 4KA4A 2DPDA 4BH9A 5DCMB 1R1UA 4A3BJ 1R6RA 2EBIA 4E4HA 1T38A 3SHFA 4OMYA 3AL0C 2DMPA 2VKHA 1K78A 3QPHA 4BHBA 1FOWA 4HYEA 3N97A 1OCZH 2OC6A 2O6GE 1LFBA 2DMQA 4EEFG 2AO9A 3IH4A 5JLWA 1XC5A 1YLFA 2MLGA 5E3OA 5JLXA 3BTJA 1KU2A 4IJAA 1G3TA 3PSIA 2NYXA 2JWTA 1L0OC 1LNWA 1FNNA 3LSIA 3GFIA 2E7XA 2ZMEA 2Y48A 2GZWA 2FBIA 5DCMA 2JMWA 1VQOI 2LLKA 4HX8A 3GZ6A 3K4LA 3F0CA 1IG7A 1P4XA 4IKFA 3CQZJ 3K70C 3D0SA 3H35A 2UXXA 3S17J 5E17F 1J2XA 2CG4A 4BL0B 4DYCA 2EZKA 3T0YA 5H6QA 1BI2A 4BAYA 1Y56A 3EUHC 3C7JA 3F72A 4RA2A 4BNCA 1BOAA 1J75A 2DA4A 1E0EA 1SD5A 5TISC 3U1DA 4ETSA 1QGPA 2V9VA 3DEEA 5C3EJ 4N9IA 4IHXA 4CCLA 4AD9A 3I0TA 3RZOJ 3ASOH 1KQ9A 3PNTA 4P1WA 1I1SA 2LKXA 1FBSA 1SD6A 2H6BA 2FE3A 1MH3A 3TO6A 1NG6A 3L2RA 2IP2A 2ZSIB 1V4RA 3NEUA 4I0BA 5LRSA 3KETA 2O5RA 4RM2A 3L7WA 3CD6I 3F3XA 3A4CA 4XOPA 2ME6A 3RTRA 3HOXJ 3F23A 1J7KA 2R5YB 2IBDA 2CFOA 5LEJA 2V1XA 3SZTA 2FXAA 1B8IB 1ZK8A 1V54H 2EV6A 2CQQA 1ETWA 2QKMB 4M71A 3H5NA 1KU7A 4FASD 4LK0F 1PP7U 1YIJI 5EYRA 1DQUA 5IOYA 2M8GX 1PP8F 2LF7A 1GXPA 2PMHA 4YEJA 5IYBJ 4YIFA 2LREA 3OSGA 2BBYA 3GFMA 2VKVA 3IH2A 2EFNA 2DQLA 2XAUA 2I8DA 2OBPA 3S2WA 4AYBN 2E19A 2R5YA 2M7AA 3KP2A 5DUIA 2ZXIA 2M5WA 4ZYDA 1B8IA 2XAGA 2FD5A 3ZRGA 3A2KA 3CF2A 3E5XA 3R0AA 4RAZA 3TOAA 4EGZA 4UB6C 1IDYA 3COAC 3L1PA 1U9NA 4EJWA 4BU2A 2IGKA 1SFXA 4EVIA 2F4MB 4F93B 5F6FA 4YIIA 4Y15A 1U8RA 1IXSB 1UZCA 2GOMA 4Z6YA 4ZYGA 2JQ7A 4BEHB 3FBIB 1REPC 1HA8A 4MFDA 3TDZC 2KJCA 2F6CA 4TV7A 1HXDA 3BLYA 5CQEA 4LLGF 3DKYA 4M9XA 5CPRB 3RPQA 5H2FC 1R1VA 1G3YA 3BG3A 1Y8RB 2W84A 4U88A 4B48A 2VOPA 3VWBA 3L2UA 3N4MA 1RETA 2FOWA 4XRSG 2KL4A 3QYEA 1GVDA 4DOZA 2EFPA 2A61A 2BHZA 2F4IA 1V5GA 3ASNH 5ICCA 2DI3A 4BEHA 3WTVC 1R71A 4XKWA 4BQAA 4AVZA 2HKXA 3QPTA 2KIUA 2XSDC 5M5XJ 1ACIA 4IPAA 1R5HA 2LTPA 4QPQA 1WJFA 3BT9A 1R00A 3AG2H 3DLLF 3O8HA 1YJ9I 3RPUA 4PSWA 1XB4A 3GEZA 5JVTA 2GIVA 2ZXWH 3L2WA 4R8HA 3HIFA 3H3UA 4N9HA 5IT3A 4Q5SF 2OTJI 2VODA 1XGMA 3I71A 4P9FA 2EH3A 2CW8A 2EZIA 4M3EA 3TW7A 3VYTB 3A0BC 3N05A 2E71A 3S16J 4DJAA 1RNLA 3DTKA 4IXAA 3WG7H 5D4RA 2XF6A 2VPRA 1G6NA 2MGQA 3G1OA 5LLQA 4ZZDA 3HC7A 1EH7A 3R4KA 1SFKA 2XGXA 3R61A 2MC3A 3QAHA 3WTTC 2Z16A 3H9QA 2UWMA 1VF9A 4UVBA 4FX0A 5IP7J 2GBYA 3F6OA 3MKYB 5K5RA 3D5LA 1FX7A 4HPQA 4G7OF 2E1MB 3HXLA 1EA3A 3E5QA 3ZMDA 4C3JJ 4WK8F 4N0BA 2HVSA 1JKOC 2D2WA 2A69F 2JN6A 3I54A 1I6XA 2EZHA 2OF7A 4MIMA 2R0QC 3KYCB 4A3DJ 1RKTA 2RNGA 1VI0A 4KUMA 3K9TA 2YU9J 2DAOA 3QWLA 2NOJB 1HDDC 2DA5A 1WSUA 3AG1H 1FYMA 1MBEA 3X2QH 4R79A 3IL2A 2X1CA 5HODA 3T1BA 4KIFA 2AQEA 1G4DA 1S8NA 3KP6A 2OCEA 4Y3OA 4CH7A 4YIRX 4M9ZA 4O3MA 4RGUA 2HR3A
chains in the Genus database with same CATH topology
3OL4A 1JI8A 3SZGA 1MMNA 4XONA 3RSNA 3U21A 3LSKA 2HVQA 3C2HA 3S93A 3VSLA 2UV1A 2R7QA 4F52A 3CJRB 2M0MA 2V7FA 2WB1A 1MMGA 3C2GA 3LSGA 4CCMA 3PJRA 1D0YA 2W7NA 3OS1A 4B3XA 4G6TB 3S8PA 1T0FC 2P0WA 1BR2A 4BE0A 3HPHA 1V5EA 2LH9A 4HG2A 1Z7LA 3OYFA 2XDVA 1LDKB 2WADA 2X1DA 2DXIA 2PJRB 4C30A 4HRIA 3IAS2 3KX2A 4BGDA 4OAZA 4XLFA 3MD2A 2R7UA 1LKXA 1D1CA 2M7BA 3SEZA 3W2WA 3H9JA 3OYEA 3W2VA 5KHDA 3VSKA 1X4OA 2VQLA 4PK4A 3ZQQA 4ZTJA 3E0JB 1SAUA 2WY8Q 1PYVA 3VDXA 3H5RA 1LVKA 3K6GA 3OYHA 4AYBA 4YELA 3HUGB 1AA7A 3K10A 4DIQA 3OIPA 1YE9A 2F5VA 2R4GA 4CA0A 3OR2C 2PJRA 4IQ4A 2OUMA 2IGMA 4NNJA 2RQQA 3OYAA 2X6XA 1G59A 2IS6A 2ZFUA 3QOEA 2JSPA 2V9KA 4XKBA 2M4GA 2CH0A 5CQGA 4PFOA 4B47A 4CSWA 4XLAA 3OYDA 1WJAA 3HKZA 4PJJA 4XOTA 2L9NA 2VQHA 4PJNA 5JHFA 1MW7A 2DT7B 2HPIA 2BVMA 2VASA 3D5SC 1UG0A 2KRCA 2R7OA 4RLFA 3BG7A 4RM3A 3MKZA 2A6TA 4E7KA 3PNVA 3K4KA 4PSXA 2VQGA 4C2UA 4KITB 4HNUA 3ZR8X 2CUJA 1Z3XA 4FETA 4E7ZA 3K70D 4H4KC 2HU9A 3HL2A 2V4JC 4LIVA 4BJTA 4BDZA 3D5RC 5LD2C 3OYJA 2HDWA 2IXSA 3IUOA 3QYBA 3S3NA 1G8XA 3VYSB 3V42A 3DU6A 2LOOA 5FROA 4IQJA 2Y0SA 2W4SA 2Z1DA 3OS0A 1QU3A 3DTEA 5HLTA 2E60A 3SEQA 2L7KA 1X1AA 2V1NA 2K9LA 2VJJA 4LITA 2KZVA 3BCBA 3LFUA 3QODA 1PJRA 2CV2A 3BG6A 1BR1A 2L5QA 3LSMA 3H9GA 4CCJA 3HPGA 2VJ5A 4B43A 3CJQB 3CP8A 4CCOA 1BOBA 2KRHA 4F3QA 3FHNA 1V5FA 2W00A 3ZCOA 2E5NA 3J7AY 2HVRA 3UR3C 1J09A 2XF7A 4P5OA 4X0GA 5HOOA 4BACA 3OL3A 2ZXHA 2JA2A 2K9MA 4II3A 1OR7C 4BE2A 1MMAA 2K5CA 3SYTA 1VZ0A 1WFXA 2LC2A 3I3LA 1WJEA 1IRXA 3HG9A 4J01A 1DP3A 4LIUA 3MKWB 2IGOA 4HSTA 4ZDLA 2DJIA 4CCKA 3PFYA 5TGTA 2W82A 2PMZA 2HNHA 1D0XA 4Y4RA 4BQNA 3H0DA 3ZXSA 4RMNA 3L2VA 3IAM2 2W1OA 3S32A 2WA0A 2HQAA 3KEYA 3LSHA 2X1EA 1LFPA 2VXZA 1D1BA 2A5WA 2WBMA 4PFPA 4PUSA 4XN3A 3KYLA 2MC4A 2X85A 4BS9A 4NC7A 4ZDPA 1Z3YA 4HEA2 4XLCA 2AQFA 3DU5A 3PNYA 3OYIA 1N75A 3OYMA 1WJBA 4ANJA 3HOTA 3NWTA 3CP2A 3CZ6A 3OOUA 3HOSA 4II2A 4ZC3A 1Z21A 1MNDA 3FKJA 1QHGA 3K4JA 4HNTA 1X4PA 2L2OA 2LRDA 2CMPA 2LG4A 3H5AA 3EPZA 3GBGA 4BJ5C 3S3MA 4XNFA 4CUGA 4NC8A 2WAQA 1D0ZA 4E6KG 2LBFB 2VL8A 3S3OA 2VIXA 3DPLC 3OYLA 2X6YA 3TMOA 2KHMA 3ZGKA 4BJ6C 4JOMA 3W3CA 2VQCA 4U7BA 3VYRB 4JQFA 2DCEA 1DGWY 1R6RA 4E4HA 3RCOA 3AL0C 2VKHA 3AL0B 4XORA 2DOAA 3M8JA 4BQOA 3TBIA 3CMMA 3I9V2 4E7HA 2OC6A 1Y6IA 3UNGC 4XLEA 3AKZA 1U0JA 2CV0A 4E7LA 2LBFA 3PSIA 4ZDOA 2DT6A 3LSIA 4DBQA 2HZDA 2LY2A 2VJ4A 2XC7A 3LL7A 5KNLA 1GLNA 3OY9A 3EUAA 3K4LA 4EATA 4AU7A 1WJ5A 2BVLA 4IKFA 3K70C 4E7JA 1TZLA 2M3AA 3H35A 3DQVC 4BQQA 4XN0A 3DWLE 1X1BA 4BL0B 2XF5A 2VLAA 3QYFA 4QPOA 1Y56A 3EUHC 2QKLB 3G2BA 1E0EA 2KLOA 2R7XA 3DEEA 2VPLA 4KT6A 3SDBA 2V26A 4CCNA 4CCLA 3FBNB 4J00A 3PNTA 4P1WA 2V6EA 1BR4A 4BE1A 2HPMA 1NG6A 4N4NB 3L2RA 1S9HA 4XQFA 2ZSIB 1YX5A 2O5RA 4RM2A 2R7SA 1UELB 3L2QA 2JUGA 3A4CA 4XOPA 3RTRA 2Q2EB 5FRNA 2CFOA 4B44A 2KMUA 1N77A 1MMDA 2MABA 5KCMA 3MMYB 2QKMB 5LFAA 2OV7A 3H5NA 1TT0A 4D9JA 4FASD 2IS4A 4F91B 4ITVA 2BW3B 1DQUA 4ZTFA 4YEJA 2LREA 4HSRA 4NUBA 4IZZA 1N78A 2XAUA 1D1AA 2I8DA 4ZYAA 2M4KA 1KONA 2M7AA 3DPTA 3CESA 4F92B 2VB6A 2ZXIA 4XL9A 3OYNA 2MYSA 4OAYA 3ZRGA 3A2KA 3BCAA 3CF2A 3DKXA 3PUBA 4BXFA 2R7WA 1YX3A 1T95A 2CV1A 3NWSA 3PSFA 4NQWB 4BU2A 2BW3A 2IGKA 4ZJZA 4F93B 2MFZA 3VYUB 3RPUD 2GOMA 4BEHB 1NG7A 3FBIB 1HA8A 5FRMA 4XM3A 2ZSHB 4DBRA 5HNHA 2F6CA 3OIQA 5HNFA 2CS3A 2R7RA 2XSJC 5HVQC 3BLYA 2FUG2 2KQRA 4PJMA 3DKYA 5CQEA 4DGWB 5CPRB 3DLAA 2ELJA 2IGNA 3AFHA 4B48A 3VWBA 3L2UA 1DGRM 2X6WA 3DPUA 2KL4A 3QYEA 2X51A 2KDOA 2E5ZA 4DOZA 1X1CA 4PJLA 2L9SA 2F4IA 2WAEA 1V5GA 1X19A 4BEHA 4XKWA 4AVZA 2IS2A 3OS2A 3K4MA 4QPQA 3PL8A 1WJFA 4OWRB 3F9KA 2JVGA 3FDYA 4PSWA 2CUZA 4RLQA 4GRIA 3L2WA 4C9YA 4BDYA 3TL4X 3OWTA 4E7IA 2Z2SB 2GOXB 4KISA 2JVHA 2CW8A 1MNEA 3VYTB 3OYKA 3N05A 4KJZA 4DJAA 2KPMA 2Q1ZB 4YRVA 4U87A 3DTKA 3LMMA 1ERDA 4XKCA 4N4OB 1WJCA 3OYBA 2XF6A 3E1SA 4XLHA 4F55A 3OMYA 1QHHD 3HC7A 3K4BA 2R7TA 1SFKA 3BC8A 4D1QA 1FMVA 3IP4B 2LY1A 2Z16A 3H9QA 4E7SA 2CW7A 2UWMA 2WY7Q 3DTIA 4Y33A 3MKYB 3D5LA 4HPQA 2E1MC 2KP6A 2VJIA 2E1MB 2VXDA 3HXLA 1EA3A 5CKTA 2HVSA 4LG3A 4XMYA 2RREA 4MLOA 2LYCA 1ZELA 2BOLA 2RNGA 3ONQA 3A1YA 3OR1C 1W36D 2IS1A 3RQ4A 4XR6A 2NOJB 2UUZA 4C2TA 3K4NA 3OYCA 3W2AA 1W36C 3OYGA 1WJDA 1X1DA 4R79A 4IX7A 1OLTA 2X1CA 1FMWA 4CZCA 1K6YA 2R7VA 2K3PA 3K4CA 2AQEA 3M1CA 4Y3OA 4CH7A 3EUKL 2WAFA 1P9QC 4XKVA 2MD0A 2VKDA 4BUPA 1UAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TBI A; 
#chains in the Genus database with same CATH topology
 1JXS A;  1OMI A;  3IWF A;  5FD5 A;  1MMN A;  4XON A;  3RSN A;  3U21 A;  1KYZ A;  3S93 A;  5HLI A;  3NAU A;  4DZP A;  2R7Q A;  2ZJR F;  1IRZ A;  2V7F A;  2ZC2 A;  1BW6 A;  1MMG A;  1NHA A;  4XSZ F;  4B3X A;  4G6T B;  4MEX F;  1YFH A;  4IOC F;  1V5E A;  2LH9 A;  3GFL A;  5E1X A;  5E1Z B;  3JRF A;  5ERI A;  2RN7 A;  2WAQ N;  4C30 A;  4HRI A;  4IEJ A;  1FC3 A;  4W97 A;  2ZB9 A;  4XLF A;  5J1U A;  2R7U A;  1LKX A;  1D1C A;  5TJJ A;  3CMY A;  3HBL A;  2NAZ A;  3FM5 A;  3W2V A;  5EDN A;  1X2M A;  2VQL A;  2QEN A;  3BPV A;  3O3K A;  3KP4 A;  2MW8 A;  4ESF A;  1LEA A;  1Y1V J;  1YOV B;  2WY8 Q;  2CQN A;  3VDX A;  3CCV I;  1FTT A;  1GVJ A;  4CXF A;  3ROU A;  3JRH A;  3HDD A;  3OYH A;  1B9N A;  1LQ1 A;  4IVN A;  3O8G A;  4AM3 A;  2F5V A;  2Y30 A;  1H0M A;  2JK3 A;  4UUT A;  2ZO4 A;  4IQ4 A;  4NNJ A;  2K4J A;  2X6X A;  2L54 A;  2NRA C;  3WE3 A;  1S7O A;  2GLO A;  3QOE A;  2JSP A;  3BR2 A;  4A3E J;  5L3F A;  2PG4 A;  3KP5 A;  2CUF A;  1R1T A;  3FMS A;  1L3L A;  2FMY A;  4DQ2 A;  4M3F A;  1WVR A;  1WJA A;  4PJJ A;  1ETO A;  5FFX A;  4G7H F;  4A0X A;  4BXX J;  2FSW A;  4Q47 A;  5JVG F;  2C6Y A;  1P4A A;  1O7F A;  2L01 A;  1VQN I;  1H89 C;  4PJN A;  4RB0 A;  1XCV A;  1B1B A;  4F7Z A;  3IRR A;  1SMY F;  1UJ8 A;  4KFC A;  2W25 A;  3CUO A;  3H1C A;  3GTK J;  1ZRE A;  3HRT A;  3JW4 A;  1BW5 A;  1G3W A;  1STZ A;  4IF4 A;  3GCM A;  1VQL I;  1B59 A;  2BY0 A;  1Z3X A;  3K70 D;  3ZOB A;  2HU9 A;  3HL2 A;  3FZV A;  3CCY A;  2K7L A;  4KYW A;  1S6L A;  1ZH5 A;  2GQQ A;  1BI1 A;  5FKL A;  3IUO A;  5J8F A;  3S3N A;  3WTW C;  4M72 A;  3LAJ A;  2QEX I;  1ON2 A;  1IO2 A;  3VFZ A;  1TL8 A;  5DM7 F;  1WQ2 A;  1VQK I;  2R7F A;  3BZK A;  2Y0S A;  2W4S A;  1R58 A;  3FKI J;  3KEO A;  1OCP A;  5HLT A;  2CQX A;  2E60 A;  4E70 A;  2V1N A;  4OIR F;  2K9L A;  2L7F P;  3CDI A;  2CSO A;  4KIB A;  1IUY A;  2EIM H;  1P2F A;  3BCB A;  3LFU A;  1PJR A;  5LGT A;  3FHZ A;  3LSM A;  2HZT A;  4XBF A;  2VJ5 A;  4WXH A;  2RAE A;  4F3Q A;  3FHN A;  1R9T J;  5GP9 A;  3GZN B;  1V5F A;  3EYI A;  2O7O A;  2IT0 A;  3ZCO A;  4S05 A;  3V8K A;  2CW0 F;  2VON A;  5GPC A;  2WV0 A;  3ZMS A;  2LKS A;  4G94 A;  3O6B B;  3CCR I;  3HRU A;  2RDP A;  2ZXH A;  1R49 A;  1XGS A;  3HRM A;  2DA3 A;  2LK2 A;  2XIG A;  1MMA A;  2RQP A;  3DEW A;  3SYT A;  3VOD A;  4ENK A;  4FX4 A;  1VQM I;  1WJE A;  3KZZ A;  1YRN B;  3I4M J;  4I6Z A;  4JP0 A;  4LIU A;  5IT9 Z;  4ZDL A;  3ZQL A;  2DJI A;  5IT9 K;  3I59 B;  4FCY A;  3WTS C;  3GO5 A;  3G3Z A;  2R93 J;  1KQ0 A;  1D0X A;  2P5K A;  4I7H A;  3KE2 A;  2ACJ A;  1A36 A;  3GW2 A;  2BY3 A;  2V1D A;  2XAQ A;  5ICF A;  1ITY A;  2DW4 A;  1T08 B;  1Y8Q B;  5C4J J;  2X1E A;  2Y9Z A;  1VQ5 I;  5HLH A;  3IV5 A;  1D1B A;  2A5W A;  1FSH A;  5C4X J;  1D3Y A;  1YRN A;  5B5E C;  4FTH A;  2W85 A;  1ZKG A;  2WV1 A;  3BTC A;  3LFK A;  2Z3Y A;  4I98 B;  1LB2 A;  3S1R J;  4NC7 A;  3I59 A;  1Z3Y A;  4XLC A;  4G12 A;  5HLG A;  3OYI A;  3OYM A;  2VI6 A;  4ANJ A;  2H6C A;  1SFU A;  5LGN A;  3CZ6 A;  5DEQ A;  3CCJ I;  1QZZ A;  1Z21 A;  1IW7 F;  4EMS A;  1ETY A;  1MND A;  3MWM A;  1IDZ A;  3DBR B;  1QHG A;  3K4J A;  1HW1 A;  2LRD A;  1F5T A;  1GUU A;  1POG A;  2XAJ A;  3GBG A;  4BJ5 C;  4P55 A;  3W6K B;  2LBF B;  3RKQ A;  2VL8 A;  2DBB A;  3S3O A;  2VIX A;  4P96 A;  2X6Y A;  3TMO A;  1HKT A;  3W3C A;  2VQC A;  4U7B A;  3VYR B;  1A6Q A;  4A6D A;  1JGS A;  3DFG A;  1Q1V A;  5TRD A;  3AL0 B;  4NBQ A;  2BE5 F;  2DOA A;  2Q0O A;  3M8J A;  2M9H A;  2GA2 A;  1ZYR F;  2ZJ2 A;  2H1K A;  1MD0 A;  5H20 A;  4LLN A;  2FX0 A;  2VE8 A;  3CF5 F;  4RB3 C;  5K7H A;  4E7L A;  4V19 K;  2LBF A;  1LVA A;  1IN7 A;  3V7R A;  3RJP A;  1YTY A;  4DBQ A;  3KZY A;  3K1M A;  4Q4Z F;  1BJA A;  1Z6R A;  1GLN A;  4D5C A;  4HDU A;  2K02 A;  5LHG A;  4XRS A;  2XHK A;  4M3D A;  5ICG A;  1P92 A;  2M3A A;  2EFQ A;  3KZI C;  4OIP F;  1R7J A;  2KDZ A;  1Y0U A;  2JT1 A;  3GLX A;  4U0Y A;  1XX5 A;  3DWL E;  2VLA A;  3QYF A;  4QPO A;  1JKR C;  5ILV A;  2DMU A;  5F04 A;  4ZYH A;  2LFB A;  2XGE A;  1VQ7 I;  1VFC A;  2HS5 A;  2QKL B;  2YR2 A;  3ABK H;  1U2W A;  1VQP I;  2FF4 A;  4KNY A;  1EH6 A;  1OCC H;  5CVJ A;  5BOX A;  4LMY A;  2PFB A;  2X48 A;  3RQI A;  3WHC A;  3GTQ J;  5HDG A;  5DDG A;  4J00 A;  2V6E A;  2HTJ A;  4OU0 A;  2W57 A;  1BR4 A;  1QRY A;  1QZY A;  2HPM A;  3T8T A;  3WGG A;  4XQF A;  2XAS A;  1ZAO A;  4M9S A;  1S29 A;  4FHT A;  2JUG A;  3CJN A;  2W24 A;  4FT8 A;  1X3U A;  3MQ0 A;  5J3L A;  1PVE A;  4UY8 I;  3EUH A;  4I01 A;  2V79 A;  2YU3 A;  1AU7 A;  1GHC A;  1O3S A;  2RGV A;  3RI4 A;  5F1R A;  5LFA A;  2O3F A;  2YS9 A;  1TT0 A;  5EEG A;  4JYK A;  1MJ9 A;  4ITV A;  4BHP A;  5D5X B;  1I3A A;  4ZTF A;  3ULQ B;  4L0Y B;  4CGZ A;  3HSR A;  5D8L B;  3SXY A;  5CVV A;  2GXA A;  4HNV A;  1WKM A;  3F8B A;  4OIN F;  1OCT C;  4NC6 A;  2M4K A;  1KON A;  3CES A;  1Z91 A;  4Y52 J;  3ZMZ A;  3HOU J;  4ZYE A;  2VB6 A;  2DQR A;  4XL9 A;  2O9L A;  4HQE A;  1E17 A;  3Q0V A;  2PBI A;  1YS6 A;  3VOE A;  2VKE A;  3DKX A;  2R7W A;  3LST A;  1XMK A;  2ETH A;  1K6O A;  1MBH A;  2FA5 A;  3F8F A;  4UUS B;  2ESN A;  3TP0 A;  4EQQ A;  2F4O B;  2NVU B;  3RPU D;  1BL0 A;  1RKW A;  1IN6 A;  2QZ8 A;  4UVA A;  4HBL A;  5H6R A;  3PUF A;  3TDU C;  5FRM A;  3MKL A;  1EF4 A;  2QSG X;  2O8K A;  4KN4 X;  2KQR A;  2WC2 A;  3T5X A;  5GAD J;  1QO0 D;  2A6E F;  2BV6 A;  3JRC A;  3CC2 I;  3AFH A;  1T39 A;  1XGO A;  3H36 A;  2QCO A;  2HI3 A;  3DPU A;  4GGG A;  1MBJ A;  3I53 A;  3QU6 A;  2ICW G;  4UUS A;  4D7M A;  5IP9 J;  2KDO A;  4HV6 A;  3SJM A;  2JA8 J;  1X1C A;  1FIA A;  3L2C A;  1HW5 A;  2E2H J;  2DFE A;  1QPI A;  1U9O A;  3GTM J;  2IS2 A;  2VBZ A;  2HXO A;  2EFO A;  4BKX A;  1ODD A;  2CUZ A;  4HLY A;  3GWZ A;  3F21 A;  4RLQ A;  3GVA A;  1W4M A;  3IWZ A;  4A3G J;  3C3W A;  1BA5 A;  4C9Y A;  2NS8 A;  3ABU A;  2Y0S N;  3TL4 X;  1SMT A;  2PEX A;  3OWT A;  4BHC A;  3CCE I;  1OYY A;  2Z99 A;  2HEO A;  2X4H A;  4R1H A;  3KYD B;  2Q1Z B;  2E35 A;  1Q1H A;  2ZBK A;  3LMM A;  3GUD A;  1WJC A;  5HS9 A;  1WI9 A;  2HYJ A;  4HF0 A;  4YFN F;  3E1S A;  4F55 A;  3WU2 C;  3FK7 A;  1FOY A;  2H09 A;  3L9F A;  1AOY A;  4CYD A;  1HKQ A;  3S1M J;  4D1Q A;  3HEF A;  1FMV A;  2H8R A;  4A93 J;  1TW3 A;  1GXQ A;  2CFX A;  4LLL A;  3FXU A;  1R22 A;  4OIO F;  3LA7 A;  3J80 Z;  3RIR A;  2Y0M A;  4UV9 A;  2QA4 I;  4Y33 A;  3J80 K;  1SC7 A;  1BJZ A;  3RKX A;  3QRF F;  3UKG A;  2KP6 A;  1RC9 A;  5CKT A;  1I39 A;  1H88 C;  3M3Y J;  3PFI A;  2OCC H;  3F8C A;  3FXO A;  3BR0 A;  4XMY A;  1OQY A;  3BR5 A;  2CQ7 A;  1RI7 A;  1ZEL A;  2BOL A;  3A1Y A;  1G2H A;  1IXC A;  5BPD A;  5LHH A;  2AXT C;  2DK8 A;  3WU1 B;  2UUZ A;  3DV8 A;  1W36 C;  1SAN A;  1MZB A;  5E3M A;  2FQ4 A;  5FFZ A;  3J7Y J;  1HDP A;  1D5Y A;  1BBY A;  5FLX Z;  4CZC A;  3AG3 H;  5FLX K;  2ECB A;  3KPH A;  2H1L A;  3B02 A;  4HW0 A;  1P9Q C;  4MEY F;  4B4C A;  5F0F A;  1I1G A;  2NNN A;  2VKD A;  3JR9 A;  2LR8 A;  5F0H A;  1UAA A;  1MMS A;  1U8B A;  3SZG A;  1ENH A;  5DV5 A;  1TWG J;  3W6V A;  4C2M J;  3LSK A;  3VSL A;  2UV1 A;  2ZCW A;  5AIP A;  4F52 A;  1VQ9 I;  3CJR B;  3KLN A;  2VUM J;  1JUM A;  2WB1 A;  3ERE D;  3C2G A;  1FOX A;  3CDH A;  3PJR A;  1D0Y A;  2W7N A;  3ZN1 A;  2JA6 J;  1WHU A;  3JTH A;  3PO3 J;  1HSJ A;  3DBH B;  5FGM A;  2GA1 A;  1B72 B;  2P0W A;  1BR2 A;  1I3Q J;  2PJR B;  3I5U A;  2MBF A;  4AUX A;  3KX2 A;  3ZQG A;  4KT5 C;  3HHH A;  2QBY B;  5EJC A;  4A69 C;  3BJ6 A;  3I58 A;  2HYG D;  1X4O A;  5EEH A;  2XRL A;  4ZTJ A;  2CYY A;  1TBX A;  2D5V A;  5BMZ A;  3BJA A;  3BQZ A;  1IRF A;  2A68 F;  1U5T C;  3HUG B;  1ZGW A;  3ZMU A;  1YE9 A;  1B72 A;  1PUE E;  1WWX A;  2PJR A;  2RQQ A;  3FX3 A;  3V8L A;  5JR3 A;  2IS6 A;  2ZXJ A;  3L00 A;  2QBY A;  1IN4 A;  2RV8 A;  1DU6 A;  1W5T A;  2KFD A;  5JI6 A;  4XKB A;  2STT A;  5CQG A;  4D0P A;  2EPF A;  5IY5 H;  3TGN A;  4CSW A;  3LSR A;  1R23 A;  2DA1 A;  4HX7 A;  3HKZ A;  2HOA A;  4OOI A;  1QBJ A;  3I56 I;  3HUG A;  5FKN A;  4WXC A;  3GTL J;  1S72 I;  1MW7 A;  2QYO A;  2NXN B;  2KRF A;  1YIT I;  5F0C A;  2DT7 B;  3GTO J;  3G71 I;  2HPI A;  2BVM A;  3LWF A;  4A0Z A;  1UG0 A;  4RLF A;  3BG7 A;  4RM3 A;  2YPR A;  2A6T A;  1O3R A;  3HM5 A;  3WGI A;  1D8J A;  3PQK A;  3K4K A;  3JRD A;  4C2U A;  3BOQ A;  4LOC A;  2F5F A;  2JPB A;  3GXO A;  1ZGJ A;  1XCB A;  5J8C A;  2QQ8 A;  1K83 J;  2A5Y B;  3JTG A;  2KKO A;  4I99 C;  5EZG A;  2OA4 A;  1JTX A;  4C3H J;  5LD2 C;  3IC7 A;  2IXS A;  2PN6 A;  1H9T A;  1O4X A;  4AVP A;  1RR7 A;  2LOO A;  2DYS H;  4G7Z F;  1O3Q A;  1QPM A;  2JPC A;  3QP6 A;  2Z1D A;  1NK2 P;  3HSE A;  3DTE A;  5L3C A;  1UHW A;  2DMT A;  2FBH A;  4PCQ A;  2F2E A;  2L7K A;  4YG2 F;  2WWY A;  2E34 A;  4WXD A;  2XB0 X;  4JX5 A;  4X1E A;  1KQ8 A;  3PIO F;  3P9C A;  1BC8 C;  4ESB A;  1BIA A;  2KZV A;  3QOD A;  4KDP A;  4RBO A;  2JJ7 A;  5EF6 A;  3BG6 A;  5IYC J;  1KA8 A;  5GTI C;  1ZLK A;  2DT5 A;  1V3F A;  4I02 A;  2AS5 F;  3WTU C;  3ZN0 A;  3MFK A;  5DM6 F;  2M1B A;  3EYY A;  5HOO A;  2E7W A;  4BAC A;  1HST A;  1VND A;  3FWE A;  4O6J A;  3TO9 A;  1Z6T A;  1FP2 A;  2L0K A;  4HDV A;  5JHU A;  3CTA A;  1E3O C;  1VZ0 A;  3I3L A;  4RAG A;  3HG9 A;  2NVT J;  3MKW B;  2L02 A;  2R5Z B;  2Y2Z A;  2IPQ X;  2RC4 A;  3CC4 I;  3PFY A;  2XGC A;  2B9S A;  5TGT A;  2W82 A;  3G1L A;  2LKP A;  2FEZ A;  1V55 H;  2OZU A;  2QQA A;  1T6S A;  5E3N A;  3L2V A;  3IAM 2;  2W1O A;  3DCF A;  2HQA A;  1IN5 A;  4AIK A;  4C3I J;  2G0E A;  3E6M A;  1LFP A;  2WBM A;  4PFP A;  4HZF A;  1CGP A;  5K1Y A;  1A31 A;  2NVX J;  1ULY A;  4A3J J;  1TWF J;  2R5Z A;  3KYL A;  2MC4 A;  4U0W A;  1X3W B;  1Z0X A;  4HEA 2;  2ZNZ A;  2AQF A;  1TQM A;  3TP3 A;  5J40 A;  3HOT A;  1ZG1 A;  3NWT A;  2HFH A;  4MNU A;  2VBY A;  3HOS A;  3BRO A;  3E6D A;  4II2 A;  2E1C A;  3RDI A;  1J0R A;  1T33 A;  3WGH A;  3GZ5 A;  3H0G J;  3JRI A;  2IJL A;  2NVQ J;  5D8K B;  4CZZ A;  3EPZ A;  4NC8 A;  3I55 I;  2L9R A;  2MG4 A;  3O2P E;  2KHM A;  5L3G A;  2CQK A;  4JX6 A;  3Q3S A;  1QQI A;  1DDN A;  4JQF A;  3VEP A;  2DCE A;  2ZKZ A;  2FNA A;  1KU3 A;  1E3P A;  3KIO A;  1WPK A;  1KZH A;  3HOZ J;  2XUB A;  1FYL A;  3TBI A;  3CMM A;  3K7A J;  3UNG C;  3E3V A;  2HQR A;  4XLE A;  3CCS I;  1P4W A;  2EZL A;  2XAH A;  2CV0 A;  4L9T A;  1ZAR A;  1T98 A;  5J47 A;  4AWX B;  3BG5 A;  4ZDO A;  2WTE A;  4IHT A;  4H0E A;  2BYV E;  3NQO A;  1S7A A;  2EJR A;  2HZD A;  4QLC U;  3CUQ C;  2LY2 A;  2ZFW A;  1XGN A;  2DOE A;  4ON0 A;  4Q48 A;  3KCC A;  1QZE A;  2IRF G;  4EAT A;  4AU7 A;  2BVL A;  5FB2 A;  1J9I A;  5J1R A;  4E7J A;  1JT0 A;  1TZL A;  4NDL A;  1VTN C;  4BQQ A;  2GM4 A;  2EFW A;  1K4S A;  1TTY A;  1X1B A;  2QGU A;  2XF5 A;  2XV4 S;  1UST A;  2R7D A;  1HW2 A;  3TOB A;  2G7H A;  1J5Y A;  2HQN A;  1FIP A;  5LHI A;  2ESH A;  3G2B A;  1SD7 A;  4DYR A;  2V1U A;  3I64 A;  1F43 A;  3LSP A;  4KT6 A;  3SDB A;  2V26 A;  4CCN A;  1IAW A;  3FBN B;  4FE4 A;  1MJB A;  1LE8 B;  2AXL A;  2HXI A;  2QVO A;  4UVC A;  5FKK A;  3BPX A;  3F22 A;  2CRG A;  4UV8 A;  5J4V A;  2P5L C;  4KIG A;  2WB1 N;  3G6E I;  1QA6 A;  2ISY A;  2Q2E B;  5FRN A;  4RDU A;  2KMU A;  1MMD A;  1DPR A;  4LD5 A;  3V4G A;  5KCM A;  2KJB A;  1M1E B;  1K79 A;  3I4P A;  2MLK A;  1TQP A;  4L9N A;  5GAH J;  1U78 A;  3C2B A;  3L09 A;  4L9J A;  2N8G A;  4D9J A;  2IS4 A;  1CF7 B;  1XMA A;  4F91 B;  2BW3 B;  2XRO A;  1LE8 A;  1I5Z A;  4EM1 A;  1HBX G;  3V7C A;  1PUF B;  1JHH A;  1X58 A;  5F08 A;  4WCG A;  1W0U A;  1EH8 A;  2O61 A;  2FNP A;  4D7N A;  1E2X A;  2K3F A;  2Q2E A;  3FXR A;  1E3H A;  1AWC A;  4F92 B;  2NS0 A;  2A07 F;  5L3E A;  4OAY A;  1Z1D A;  4CDG A;  1ETX A;  2W48 A;  4BXF A;  1IV6 A;  3M4O J;  2DPU A;  3ABM H;  3W6J B;  3LQQ A;  1T95 A;  3ZPL A;  2CV1 A;  1HLV A;  3NWS A;  2FQ3 A;  3K1P A;  1CF7 A;  1K4T A;  2LMD A;  3PSF A;  1R4M B;  2BW3 A;  3QP5 A;  4MFE A;  3JRA A;  4A3F J;  1JJ6 C;  2IVM A;  1UMQ A;  1XG1 A;  4ZJZ A;  4JX4 A;  2MFZ A;  3E7L A;  1RES A;  3WOD F;  3SFZ A;  3VYU B;  2ME0 A;  1OYW A;  5FJ8 J;  1PUF A;  3C18 A;  4IRI A;  4IOA F;  3R6S A;  3RYP A;  2QQB A;  1FY7 A;  3Q0U A;  4RGX A;  4A12 A;  4RB1 A;  4XM3 A;  5BS6 A;  3OIQ A;  5HNF A;  2CS3 A;  2R7R A;  2DA6 A;  4Y17 A;  1UCR A;  2FUG 2;  2QF7 A;  4MGR A;  4PJM A;  4PZJ A;  3LA2 A;  3DLA A;  2ELJ A;  1F4K A;  3P9K A;  3QPL A;  2M2E A;  1MIJ A;  4GYI A;  2IGN A;  1TW2 A;  5F64 A;  1YQA A;  4LB5 A;  3HOW J;  4LJZ F;  1DGR M;  2YX4 A;  3QOP A;  1ZR2 A;  1MGT A;  2DMN A;  2DYR H;  2X51 A;  3CCM I;  2F5E A;  2L7M P;  3Q5F A;  3M07 A;  2L9S A;  3CC7 I;  2WAE A;  3M1E A;  2A05 A;  2H27 A;  1KGS A;  3OS2 A;  3K4M A;  5FLV A;  1O7L A;  4OWR B;  5B3S H;  1OYI A;  4HF1 A;  3HSF A;  5IPA A;  3WTZ A;  4GRI A;  2F5C A;  5ILU A;  2DU9 A;  1XS9 A;  9ANT A;  2BY1 A;  2E2I J;  4E7I A;  2M45 A;  2R3S A;  1WZ2 A;  1FOK A;  2NNY A;  2BGC A;  3ABT A;  3REO A;  2QQ9 A;  2JRT A;  5ED4 A;  2KPM A;  4YRV A;  4U87 A;  4EJO A;  2JRM A;  4PGH A;  4XKC A;  1TNS A;  4YFX F;  4XLH A;  3MZH A;  1QHH D;  5DTD A;  3E5U A;  3TKY A;  1ZGA A;  3BC8 A;  3CDL A;  4ENJ A;  2LY1 A;  4HOB A;  4E7S A;  3WHB A;  4WX9 A;  1YJN I;  2G7U A;  1CQT A;  2EV0 A;  3DTI A;  3P7N A;  2KIM A;  3CMA I;  4X6A J;  3EDP A;  1HKS A;  2LDU A;  2LSO A;  1FYK A;  1OIS A;  3JRB A;  4D5F A;  1IGN A;  1G3S A;  2VJI A;  2VXD A;  4LGW A;  4AIH A;  3KFW X;  4LG3 A;  1JHF A;  2LNB A;  2KIQ A;  2OQR A;  2RRE A;  4KIC A;  1YS7 A;  5C44 J;  3U2R A;  3Q9V A;  2XRN A;  2IS1 A;  4HQM A;  5M3M J;  2HOT A;  1H8A C;  1AKH B;  3M8F A;  5J6X A;  1FTZ A;  2AHQ A;  3W2A A;  4XLP F;  3OYG A;  1WJD A;  3DKW A;  4IX7 A;  2BHY A;  1OLT A;  1YI2 I;  3CO7 C;  1BI3 A;  2R7V A;  2K3P A;  3K4C A;  3LQR A;  3M1C A;  2Q8K A;  3CCL I;  1W7P B;  4I2O A;  2XPU A;  5D6F A;  2Y75 A;  2R7Z J;  6PAX A;  1MH4 A;  2JUC A;  1TC3 C;  5KK1 A;  3JRG A;  1W1W E;  2ID6 A;  2DK5 A;  2HYF A;  3KLO A;  2G9W A;  2M0C A;  1AKH A;  2HVQ A;  3C2H A;  3U9G A;  1JGG A;  2B63 J;  2DO7 A;  5J4Y A;  2M8E A;  2M0M A;  1O3T A;  2RNJ A;  3LSG A;  4CCM A;  4BY7 J;  5E8G A;  2DOD A;  2XAF A;  4V2G A;  1T0F C;  1W7P A;  2GXB A;  1F36 A;  3M8E A;  3HPH A;  3QU3 A;  5F1J A;  1IJW C;  3BP8 A;  1XN7 A;  2XDV A;  2WAD A;  2DXI A;  2Y9Y A;  1Y1W J;  3IAS 2;  1Z7U A;  3LAP A;  2VE9 A;  1B6A A;  1UB9 A;  3DP7 A;  3RKY A;  3OV8 A;  2M7B A;  1R36 A;  2VN2 A;  3W2W A;  3ML6 A;  3H9J A;  3OYE A;  4EGY A;  4U0V A;  1GV5 A;  3VSK A;  3NRV A;  2LY9 A;  1MBG A;  5IOZ A;  3ZQQ A;  1NTC A;  4HAM A;  2DA2 A;  1MSF C;  1ONV A;  1SAU A;  4QIW N;  1PYV A;  3ZP5 A;  3H5R A;  1LVK A;  1XMX A;  2XVC A;  4YEL A;  1U5T B;  3K10 A;  1YO5 C;  2HOS A;  2XPW A;  3CJT B;  5DD4 A;  3F6V A;  1XTA A;  2R4G A;  2HOE A;  4RAF A;  4P9U A;  2OAZ A;  4ENN A;  1RR8 C;  4A3L J;  2OTL I;  2OUM A;  2IGM A;  3OYA A;  1G59 A;  5LBQ A;  2EB7 A;  3OSF A;  4EM0 B;  1OPC A;  3K0L A;  2DFH A;  2V9K A;  4A3M J;  2M4G A;  3DBL B;  4XID A;  4ESJ A;  2K40 A;  4PFO A;  3E97 A;  1YW8 A;  2Z33 A;  4XLA A;  1XD7 A;  4XOT A;  1ZTR A;  2K9S A;  2L9N A;  1XDS A;  1U5T A;  3BZ6 A;  3LNQ A;  4KN7 X;  2L7Z A;  2HDD A;  1S7E A;  4V2F A;  3JSP A;  4LB6 B;  3TED A;  2KRC A;  2R7O A;  4B09 A;  3HYI A;  5E8I A;  4IL6 C;  4IO9 F;  4IHY A;  1WRJ A;  4HNU A;  2CUJ A;  5AIQ A;  3PO2 J;  1Z05 A;  4FET A;  5AON A;  2TCT A;  4H4K C;  2V4J C;  4BJT A;  1USS A;  2Y69 H;  3M7G A;  3FXQ A;  4KMU X;  4A5N A;  1R4N B;  3HHG A;  4BDZ A;  2YSR A;  3D5R C;  3OYJ A;  1FSE A;  2HDW A;  4W1U A;  2HWV A;  4XSX F;  2JZY A;  3VYS B;  3V42 A;  3DU6 A;  5FRO A;  2COB A;  3B73 A;  2BXZ A;  4A6E A;  2EIK H;  1JKP C;  3OS0 A;  3IKT A;  2A6H F;  2P7V B;  2LF8 A;  1WH7 A;  5CVI A;  3G73 A;  4A3K J;  4LIT A;  2M87 A;  2PLY A;  4LG0 B;  1MKM A;  2CV2 A;  1BR1 A;  1YG2 A;  3PQJ A;  2HQ5 A;  3H9G A;  4A0Y A;  3LOC A;  4CCJ A;  2VC1 A;  3CP8 A;  3BR1 A;  1DUX C;  1YYV A;  2O03 A;  4AID A;  2L4A A;  5GTH C;  2H8W A;  2HVR A;  1Z9C A;  2P5V A;  3UR3 C;  1ZN2 A;  5CVR A;  4IHW A;  1BIB A;  2Z5U A;  2I10 A;  3E6B A;  1EJ9 A;  2Y31 A;  4X0G A;  1XPX A;  2XKO A;  3OL3 A;  3K69 A;  3NAR A;  3OOP A;  1OR7 C;  1TP4 A;  4LG0 A;  4XIC A;  1I50 J;  3P9I A;  1JJ8 C;  4J01 A;  4MQV A;  1DP3 A;  3LSJ A;  2IEK A;  1BI0 A;  4HST A;  4EM2 A;  2DN0 A;  2PMZ A;  2OQG A;  2IW5 A;  4Y4R A;  2CWE A;  2DLL A;  3VB2 A;  3H0D A;  2M30 A;  1FBU A;  5K7F A;  4IHS A;  3ZXS A;  1APL C;  1JUS A;  1I27 A;  3S32 A;  5GAG J;  3LSH A;  2NS7 A;  2MD5 A;  3S15 J;  2K9Q A;  2A3S A;  1GV2 A;  3V7S A;  5M5Y J;  1MDM B;  4HV5 A;  3HOV J;  3Q0W A;  5KAF C;  4PUS A;  2OU2 A;  3BWG A;  5CLS A;  4UB8 C;  2VC0 A;  4HF2 A;  2L3D A;  2GIZ A;  1JT6 A;  4ZDP A;  4B8X A;  4BBR J;  3BR6 A;  4B1R A;  3ABL H;  3PNY A;  5E20 A;  3S2H J;  1N75 A;  1WJB A;  3ZMV A;  1ZRD A;  1LPQ A;  1P6R A;  2DTZ A;  3CP2 A;  3OOU A;  1XSX A;  3H92 A;  2Z9O A;  3FKJ A;  1P7J A;  1MDM A;  1R5G A;  2E2J J;  5J1Y A;  1FLI A;  3S3M A;  2CMP A;  2LG4 A;  3HGY A;  4XNF A;  5L3D A;  4CUG A;  4MTD A;  2B0L A;  2HTS A;  3DPL C;  4ZZL A;  4XLN F;  3B6C A;  3OYL A;  2ZME C;  1HF0 A;  4CYC B;  4BXU A;  2O0Y A;  2P6T A;  4U7D A;  4I09 A;  1DGW Y;  5EG0 B;  4EJT A;  4XRF A;  3K2A A;  2CUE A;  3RCO A;  2K27 A;  3GTJ J;  5BPI A;  3S1N J;  1O57 A;  1MBK A;  4XOR A;  5B66 C;  3ECH A;  4BQO A;  1ZG5 A;  1IRG A;  3CME I;  4E7H A;  3I9V 2;  1Y6I A;  1IUF A;  3S1Q J;  2ZNY A;  5E79 C;  2EA4 A;  3AKZ A;  1GDT A;  1U0J A;  2NOG A;  5K7Z A;  3G4S I;  3HB9 A;  3GX4 X;  3VPR A;  4HLX A;  2P81 A;  1XSV A;  4IRH A;  1A5J A;  4L5E A;  2DT6 A;  1VQ8 I;  4CYC A;  4WF2 A;  4L0Z B;  2K9N A;  2VJ4 A;  3CUQ B;  3LL7 A;  1X3Z B;  2ECC A;  5KNL A;  5EG0 A;  2XC7 A;  3RKW A;  3OY9 A;  3EUA A;  1D8K A;  4AIJ A;  1WJ5 A;  5LRR A;  3WG9 A;  2CGP A;  3DQV C;  3GF2 A;  4XN0 A;  3MZY A;  2FU4 A;  1I6H J;  4G6Q A;  1XSD A;  1Z67 A;  1ZG3 A;  3QQA A;  2DDB A;  5FO5 A;  2FJ1 A;  2KLO A;  1FP1 D;  2R7X A;  1NK3 P;  4DYQ A;  2VPL A;  3CUQ A;  3OIO A;  4OIQ F;  2M34 A;  3TO7 A;  2IA0 A;  3CLO A;  1KYW A;  1IN8 A;  1WCM J;  1GT0 C;  3BZC A;  3SQN A;  4BE1 A;  1X2N A;  3S14 J;  1TLH B;  4N4N B;  1S9H A;  2GAU A;  1IZ1 A;  2CU7 A;  1YW9 A;  2PMU A;  5M3F J;  1YX5 A;  2R7S A;  3HZJ A;  4EV0 A;  1UEL B;  3L2Q A;  3PIP F;  1J59 A;  3RZD J;  2YX7 A;  4NB5 A;  2UZK A;  1R5I D;  4B44 A;  1N77 A;  5FD6 A;  2MAB A;  3HGG A;  3MCZ A;  3ZQF A;  1OCR H;  2EIJ H;  3CLQ A;  3MMY B;  3BDD A;  1HC8 A;  1JTY A;  2OV7 A;  1VQ4 I;  2EWN A;  3QPS A;  5HS8 A;  2IA2 A;  2QLZ A;  3A03 A;  5FKM A;  3U1K A;  3MVP A;  4A3C J;  1LDJ A;  4HSR A;  4NUB A;  3IHU A;  4IZZ A;  1N78 A;  1RPW A;  3P5J A;  2ELK A;  3R0J A;  5KAI C;  1D1A A;  3Q9S A;  2EK5 A;  4UHT A;  3ZQC A;  3FXK A;  1YW7 A;  4ZYA A;  3DPT A;  3RYR A;  2P8T A;  3OYN A;  2MYS A;  5E3L A;  1TQI A;  2B7E A;  2BEO A;  3J7A O;  5D4S A;  2MSY A;  3BCA A;  3PUB A;  1MJA A;  1YX3 A;  1N25 A;  1TWA J;  3GFJ A;  4BBS J;  1FZP B;  1HOM A;  4NQW B;  5BQT A;  5JFR A;  1A04 A;  5K5O A;  3D1N I;  2OZ6 A;  2QSF X;  2KIS A;  2XGD A;  1NG7 A;  1ETK A;  1UHM A;  1SVL A;  2ZSH B;  4DBR A;  1TT5 B;  3BJO A;  4GO1 A;  5ILS A;  5HNH A;  2L4M A;  2XSJ C;  5HVQ C;  2CJJ A;  4IRG A;  1A35 A;  2HKO A;  1ZLJ A;  4DGW B;  4DZJ A;  2E36 A;  3GTP J;  2X6O A;  1IXR C;  2TRT A;  1TNT A;  3A0H C;  3DXJ F;  3FM3 A;  1HCR A;  2QWW A;  4GFB A;  1W5S A;  2X6W A;  1LDD A;  3ESW B;  4NQW A;  3J81 Z;  4CO8 A;  5B1A H;  3TW6 A;  2PI0 A;  3J81 K;  2E5Z A;  2RKH A;  5DCF A;  1RUN A;  4UXN A;  3WTX C;  4PJL A;  5HDK A;  1U6G A;  1X19 A;  1EV7 A;  1ZRC A;  1QVU A;  1FPQ A;  2VT2 A;  4UUV A;  2OD5 A;  3PL8 A;  2PJP A;  3FIW A;  3SZP A;  3F9K A;  3WE2 A;  2JVG A;  2FRH A;  4L18 B;  2CO5 A;  4M6X A;  3FDY A;  5GAE J;  1LUJ B;  3ECO A;  5F27 A;  2P6S A;  1K61 A;  2MA3 A;  1DP7 P;  3GYH X;  2OJE D;  4BDY A;  1YJW I;  4RGR A;  2X9D A;  2Z2S B;  4J19 A;  1OJL A;  2GOX B;  4KIS A;  2JVH A;  4HA8 A;  1YHQ I;  1MNE A;  1W5C C;  1W0T A;  3OYK A;  3H3V K;  2X0L A;  4KJZ A;  5E18 F;  1SAX A;  1ERD A;  4N4O B;  1BM9 A;  5A2Q Z;  3OYB A;  5A2Q K;  3OMY A;  1UFM A;  3FIS A;  3K4B A;  4DNC A;  1TWH J;  3FMR A;  3IH3 A;  4RGS A;  2R7T A;  3BR3 A;  3FXJ A;  1MBF A;  3IP4 B;  4L5I A;  2OPT A;  4MO7 A;  2R92 J;  5D5W B;  2CW7 A;  2HDC A;  4PJ0 C;  1ON1 A;  4A5M A;  2WY7 Q;  4Y13 A;  3HRS A;  1Z77 A;  3ERM A;  3G1M A;  1B9M A;  1JKQ C;  1P7I A;  2E1M C;  1F1Z A;  4JBA A;  2K85 A;  4LK1 F;  5BNG A;  5FLM J;  1YIO A;  3HJE A;  4UNO A;  3DEU A;  5DS9 A;  4HX4 A;  1UHS A;  5FKO A;  4MLO A;  2LYC A;  4S0H B;  2LD5 A;  3ONQ A;  1W36 D;  3OR1 C;  4CIC A;  2STW A;  3RQ4 A;  3ZQ7 A;  3ZQI A;  2PMZ N;  4XR6 A;  3KEQ A;  2D45 A;  4C2T A;  1W7P D;  3GLL A;  3K4N A;  3MN2 A;  3OYC A;  2K4B A;  3SFI A;  1RZ4 A;  2P7C B;  1X1D A;  2D1H A;  1BN5 A;  3FF5 A;  1FMW A;  1K6Y A;  2BZT A;  3FK6 A;  5GPA A;  3EUK L;  2WAF A;  4PGG A;  4XKV A;  3V8J A;  3I4N J;  2V9P A;  2MD0 A;  4EJV A;  1T2K A;  2JTV A;  4BUP A;  2H94 A;  1ZHF A;  4A3I J;  1ORK A;  3K2Z A;  2DFI A;  3OL4 A;  1SEU A;  1JI8 A;  3BTL A;  2LVS A;  4O5V A;  3PM1 A;  5DD8 A;  2P4W A;  1FWZ A;  3CCQ I;  3A02 A;  3WTY C;  3AAF A;  2IA1 A;  1IV8 A;  1OFC X;  4RAY A;  2JA7 J;  3OS1 A;  3S8P A;  1DPU A;  1C0W A;  1UG2 A;  4BE0 A;  2ISZ A;  4PDK A;  1X1P A;  2K86 A;  2KIF A;  4HG2 A;  1Z7L A;  3OYF A;  1LDK B;  2X1D A;  1LEB A;  3HKZ N;  5IP6 A;  2E1O A;  5DUK A;  4BGD A;  4OAZ A;  3MD2 A;  1A6I A;  4Y7N J;  1Y39 A;  3SEZ A;  3MAJ A;  1S3J A;  1SFO J;  2QSH X;  5KHD A;  2E1N A;  2GWR A;  4A2U A;  4PK4 A;  4XRM A;  2ZJQ F;  3E0J B;  2KZG A;  1ETQ A;  4CHU A;  3K6G A;  2HGC A;  2KT0 A;  3ZQH A;  4QTR A;  4M3G A;  4AYB A;  1RIO H;  1B4A A;  1AA7 A;  3BTI A;  4DIQ A;  3GTG J;  3OIP A;  1T0F A;  1FBQ A;  1FEX A;  1LFU P;  1XDU A;  1H9G A;  4I0A A;  3K1N A;  4CA0 A;  2PQ8 A;  2EQR A;  3OR2 C;  5EEA A;  4M3B A;  2BXY A;  2F5D A;  3WU0 A;  1JUP A;  4ENM A;  4NHJ A;  2ZFU A;  1LJ9 A;  5B1B H;  1QVT A;  5HS7 A;  2LP0 A;  2EA2 A;  3FXL A;  3BG9 A;  2CH0 A;  4RB2 C;  4B47 A;  1IF1 A;  2DJN A;  3B6A A;  3JSO A;  3OYD A;  1NH3 A;  4QSH A;  2IAI A;  2JSC A;  4EJU A;  2VQH A;  2COM A;  5JHF A;  4FIS A;  5D6E A;  2XPV A;  1AHD P;  4FE7 A;  4M6Y A;  1T8I A;  5E1W A;  2VAS A;  3D5S C;  4GXO A;  1WI3 A;  3A01 B;  4LFU A;  4RS8 A;  4ASN A;  5EZH A;  1OKR A;  4MHG A;  3MKZ A;  4FQG A;  1SVO A;  3JRE A;  4E7K A;  3KP3 A;  2VBW A;  5ICE A;  3PNV A;  1VQ6 I;  4QWQ A;  4PSX A;  2ID3 A;  1OCO H;  2VQG A;  2DDA A;  4MQ9 F;  4KIT B;  2O8X A;  3ZR8 X;  1S5L C;  2L9V A;  3MZ8 A;  3KP7 A;  4E7Z A;  5KVR A;  1U3E M;  4S04 A;  2VT3 A;  4LIV A;  1FT9 A;  1MNM C;  1Y0N A;  3AG4 H;  4L9V A;  3M9A A;  3QYB A;  1G8X A;  3EQL F;  2GXG A;  1SVM A;  5LEK A;  2PX9 A;  2EIL H;  3A01 A;  4IQJ A;  4JK1 X;  1T56 A;  4OMZ A;  4ABZ A;  2UXN A;  1QU3 A;  2FBK A;  3SEQ A;  2EV5 A;  1ZR4 A;  5EGO B;  4K2E A;  1X1A A;  1K7A A;  2QM3 A;  4GCV A;  5LGU A;  1QNT A;  2J5P A;  2VJJ A;  1FJL A;  2DA7 A;  2F48 A;  4L5J A;  5M5W J;  3HOY J;  2L5Q A;  2QUF A;  4B3A A;  3DF8 A;  4GYG A;  3GME A;  3HPG A;  4B43 A;  3CJQ B;  4CCO A;  1BOB A;  2I5U A;  2KRH A;  3ISP A;  2W00 A;  4BY1 J;  3S2D J;  2E5N A;  3H3Z A;  1TWC J;  3J7A Y;  3FXM A;  1J09 A;  2ELH A;  2FML A;  2XF7 A;  3E6C C;  1F9N A;  1SFE A;  4P5O A;  3BQY A;  2JA5 J;  2VOO A;  2NVY J;  3BY6 A;  1SD4 A;  3JCU C;  5EGO A;  1IC8 A;  1BC7 C;  3R60 A;  2JA2 A;  2K9M A;  4II3 A;  4BE2 A;  2D1V A;  3JAM Z;  3TQN A;  3J7Z I;  2K5C A;  1WH5 A;  3JAM K;  1WFX A;  2LC2 A;  3ZMT A;  5IYD J;  1IRX A;  4MTE A;  2IGO A;  1EKE A;  4G9Y A;  4M6V A;  4ZH4 F;  1PDN C;  4M74 A;  5CJ9 A;  3LA3 A;  1KU9 A;  4CCK A;  4IHV A;  5HDN A;  3MEX A;  1ETV A;  2V6C A;  2DOF A;  2HNH A;  2TDX A;  3ELK A;  3CO6 C;  2XKP A;  4BQN A;  4I76 A;  1JE8 A;  4RMN A;  3EET A;  5D5V B;  4G6D A;  2VBX A;  4XK4 A;  2WA0 A;  3KEY A;  4Z2Y A;  1RUO A;  4BYY A;  4AC0 A;  3HTS B;  1OR7 A;  2VXZ A;  4WWC A;  3FMQ A;  3C1D A;  2J5O A;  4DW6 A;  3T8R A;  4XN3 A;  2X85 A;  4BS9 A;  2EIN H;  3HTU A;  4YFK F;  5K5Q A;  4G8X A;  2XB5 A;  3DU5 A;  2FOK A;  2ZJP F;  1ZRF A;  1DU0 A;  3IRQ A;  1K78 B;  4ZC3 A;  2YUS A;  1D5V A;  2DFF A;  4M73 A;  5L3B A;  2BY2 A;  1HQC A;  1ZQ3 P;  1WGX A;  3IKV A;  2MH2 A;  5CVU A;  5DYM A;  4HNT A;  1MSE C;  1X4P A;  2L2O A;  3H5A A;  3SDG A;  4KMF A;  5CYV A;  2WAQ A;  1D0Z A;  2DTR A;  3F8N A;  4E6K G;  2RVC A;  4GDF A;  5D5U B;  2MH9 A;  3F8M A;  2ADU A;  3ZGK A;  4BJ6 C;  4JOM A;  2ZME B;  1RRJ A;  3CCU I;  4KA4 A;  2DPD A;  4BH9 A;  5DCM B;  1R1U A;  4A3B J;  1R6R A;  2EBI A;  4E4H A;  1T38 A;  3SHF A;  4OMY A;  3AL0 C;  2DMP A;  2VKH A;  1K78 A;  3QPH A;  4BHB A;  1FOW A;  4HYE A;  3N97 A;  1OCZ H;  2OC6 A;  2O6G E;  1LFB A;  2DMQ A;  4EEF G;  2AO9 A;  3IH4 A;  5JLW A;  1XC5 A;  1YLF A;  2MLG A;  5E3O A;  5JLX A;  3BTJ A;  1KU2 A;  4IJA A;  1G3T A;  3PSI A;  2NYX A;  2JWT A;  1L0O C;  1LNW A;  1FNN A;  3LSI A;  3GFI A;  2E7X A;  2ZME A;  2Y48 A;  2GZW A;  2FBI A;  5DCM A;  2JMW A;  1VQO I;  2LLK A;  4HX8 A;  3GZ6 A;  3K4L A;  3F0C A;  1IG7 A;  1P4X A;  4IKF A;  3CQZ J;  3K70 C;  3D0S A;  3H35 A;  2UXX A;  3S17 J;  5E17 F;  1J2X A;  2CG4 A;  4BL0 B;  4DYC A;  2EZK A;  3T0Y A;  5H6Q A;  1BI2 A;  4BAY A;  1Y56 A;  3EUH C;  3C7J A;  3F72 A;  4RA2 A;  4BNC A;  1BOA A;  1J75 A;  2DA4 A;  1E0E A;  1SD5 A;  5TIS C;  3U1D A;  4ETS A;  1QGP A;  2V9V A;  3DEE A;  5C3E J;  4N9I A;  4IHX A;  4CCL A;  4AD9 A;  3I0T A;  3RZO J;  3ASO H;  1KQ9 A;  3PNT A;  4P1W A;  1I1S A;  2LKX A;  1FBS A;  1SD6 A;  2H6B A;  2FE3 A;  1MH3 A;  3TO6 A;  1NG6 A;  3L2R A;  2IP2 A;  2ZSI B;  1V4R A;  3NEU A;  4I0B A;  5LRS A;  3KET A;  2O5R A;  4RM2 A;  3L7W A;  3CD6 I;  3F3X A;  3A4C A;  4XOP A;  2ME6 A;  3RTR A;  3HOX J;  3F23 A;  1J7K A;  2R5Y B;  2IBD A;  2CFO A;  5LEJ A;  2V1X A;  3SZT A;  2FXA A;  1B8I B;  1ZK8 A;  1V54 H;  2EV6 A;  2CQQ A;  1ETW A;  2QKM B;  4M71 A;  3H5N A;  1KU7 A;  4FAS D;  4LK0 F;  1PP7 U;  1YIJ I;  5EYR A;  1DQU A;  5IOY A;  2M8G X;  1PP8 F;  2LF7 A;  1GXP A;  2PMH A;  4YEJ A;  5IYB J;  4YIF A;  2LRE A;  3OSG A;  2BBY A;  3GFM A;  2VKV A;  3IH2 A;  2EFN A;  2DQL A;  2XAU A;  2I8D A;  2OBP A;  3S2W A;  4AYB N;  2E19 A;  2R5Y A;  2M7A A;  3KP2 A;  5DUI A;  2ZXI A;  2M5W A;  4ZYD A;  1B8I A;  2XAG A;  2FD5 A;  3ZRG A;  3A2K A;  3CF2 A;  3E5X A;  3R0A A;  4RAZ A;  3TOA A;  4EGZ A;  4UB6 C;  1IDY A;  3COA C;  3L1P A;  1U9N A;  4EJW A;  4BU2 A;  2IGK A;  1SFX A;  4EVI A;  2F4M B;  4F93 B;  5F6F A;  4YII A;  4Y15 A;  1U8R A;  1IXS B;  1UZC A;  2GOM A;  4Z6Y A;  4ZYG A;  2JQ7 A;  4BEH B;  3FBI B;  1REP C;  1HA8 A;  4MFD A;  3TDZ C;  2KJC A;  2F6C A;  4TV7 A;  1HXD A;  3BLY A;  5CQE A;  4LLG F;  3DKY A;  4M9X A;  5CPR B;  3RPQ A;  5H2F C;  1R1V A;  1G3Y A;  3BG3 A;  1Y8R B;  2W84 A;  4U88 A;  4B48 A;  2VOP A;  3VWB A;  3L2U A;  3N4M A;  1RET A;  2FOW A;  4XRS G;  2KL4 A;  3QYE A;  1GVD A;  4DOZ A;  2EFP A;  2A61 A;  2BHZ A;  2F4I A;  1V5G A;  3ASN H;  5ICC A;  2DI3 A;  4BEH A;  3WTV C;  1R71 A;  4XKW A;  4BQA A;  4AVZ A;  2HKX A;  3QPT A;  2KIU A;  2XSD C;  5M5X J;  1ACI A;  4IPA A;  1R5H A;  2LTP A;  4QPQ A;  1WJF A;  3BT9 A;  1R00 A;  3AG2 H;  3DLL F;  3O8H A;  1YJ9 I;  3RPU A;  4PSW A;  1XB4 A;  3GEZ A;  5JVT A;  2GIV A;  2ZXW H;  3L2W A;  4R8H A;  3HIF A;  3H3U A;  4N9H A;  5IT3 A;  4Q5S F;  2OTJ I;  2VOD A;  1XGM A;  3I71 A;  4P9F A;  2EH3 A;  2CW8 A;  2EZI A;  4M3E A;  3TW7 A;  3VYT B;  3A0B C;  3N05 A;  2E71 A;  3S16 J;  4DJA A;  1RNL A;  3DTK A;  4IXA A;  3WG7 H;  5D4R A;  2XF6 A;  2VPR A;  1G6N A;  2MGQ A;  3G1O A;  5LLQ A;  4ZZD A;  3HC7 A;  1EH7 A;  3R4K A;  1SFK A;  2XGX A;  3R61 A;  2MC3 A;  3QAH A;  3WTT C;  2Z16 A;  3H9Q A;  2UWM A;  1VF9 A;  4UVB A;  4FX0 A;  5IP7 J;  2GBY A;  3F6O A;  3MKY B;  5K5R A;  3D5L A;  1FX7 A;  4HPQ A;  4G7O F;  2E1M B;  3HXL A;  1EA3 A;  3E5Q A;  3ZMD A;  4C3J J;  4WK8 F;  4N0B A;  2HVS A;  1JKO C;  2D2W A;  2A69 F;  2JN6 A;  3I54 A;  1I6X A;  2EZH A;  2OF7 A;  4MIM A;  2R0Q C;  3KYC B;  4A3D J;  1RKT A;  2RNG A;  1VI0 A;  4KUM A;  3K9T A;  2YU9 J;  2DAO A;  3QWL A;  2NOJ B;  1HDD C;  2DA5 A;  1WSU A;  3AG1 H;  1FYM A;  1MBE A;  3X2Q H;  4R79 A;  3IL2 A;  2X1C A;  5HOD A;  3T1B A;  4KIF A;  2AQE A;  1G4D A;  1S8N A;  3KP6 A;  2OCE A;  4Y3O A;  4CH7 A;  4YIR X;  4M9Z A;  4O3M A;  4RGU A;  2HR3 A; 
#chains in the Genus database with same CATH homology
 3OL4 A;  1JI8 A;  3SZG A;  1MMN A;  4XON A;  3RSN A;  3U21 A;  3LSK A;  2HVQ A;  3C2H A;  3S93 A;  3VSL A;  2UV1 A;  2R7Q A;  4F52 A;  3CJR B;  2M0M A;  2V7F A;  2WB1 A;  1MMG A;  3C2G A;  3LSG A;  4CCM A;  3PJR A;  1D0Y A;  2W7N A;  3OS1 A;  4B3X A;  4G6T B;  3S8P A;  1T0F C;  2P0W A;  1BR2 A;  4BE0 A;  3HPH A;  1V5E A;  2LH9 A;  4HG2 A;  1Z7L A;  3OYF A;  2XDV A;  1LDK B;  2WAD A;  2X1D A;  2DXI A;  2PJR B;  4C30 A;  4HRI A;  3IAS 2;  3KX2 A;  4BGD A;  4OAZ A;  4XLF A;  3MD2 A;  2R7U A;  1LKX A;  1D1C A;  2M7B A;  3SEZ A;  3W2W A;  3H9J A;  3OYE A;  3W2V A;  5KHD A;  3VSK A;  1X4O A;  2VQL A;  4PK4 A;  3ZQQ A;  4ZTJ A;  3E0J B;  1SAU A;  2WY8 Q;  1PYV A;  3VDX A;  3H5R A;  1LVK A;  3K6G A;  3OYH A;  4AYB A;  4YEL A;  3HUG B;  1AA7 A;  3K10 A;  4DIQ A;  3OIP A;  1YE9 A;  2F5V A;  2R4G A;  4CA0 A;  3OR2 C;  2PJR A;  4IQ4 A;  2OUM A;  2IGM A;  4NNJ A;  2RQQ A;  3OYA A;  2X6X A;  1G59 A;  2IS6 A;  2ZFU A;  3QOE A;  2JSP A;  2V9K A;  4XKB A;  2M4G A;  2CH0 A;  5CQG A;  4PFO A;  4B47 A;  4CSW A;  4XLA A;  3OYD A;  1WJA A;  3HKZ A;  4PJJ A;  4XOT A;  2L9N A;  2VQH A;  4PJN A;  5JHF A;  1MW7 A;  2DT7 B;  2HPI A;  2BVM A;  2VAS A;  3D5S C;  1UG0 A;  2KRC A;  2R7O A;  4RLF A;  3BG7 A;  4RM3 A;  3MKZ A;  2A6T A;  4E7K A;  3PNV A;  3K4K A;  4PSX A;  2VQG A;  4C2U A;  4KIT B;  4HNU A;  3ZR8 X;  2CUJ A;  1Z3X A;  4FET A;  4E7Z A;  3K70 D;  4H4K C;  2HU9 A;  3HL2 A;  2V4J C;  4LIV A;  4BJT A;  4BDZ A;  3D5R C;  5LD2 C;  3OYJ A;  2HDW A;  2IXS A;  3IUO A;  3QYB A;  3S3N A;  1G8X A;  3VYS B;  3V42 A;  3DU6 A;  2LOO A;  5FRO A;  4IQJ A;  2Y0S A;  2W4S A;  2Z1D A;  3OS0 A;  1QU3 A;  3DTE A;  5HLT A;  2E60 A;  3SEQ A;  2L7K A;  1X1A A;  2V1N A;  2K9L A;  2VJJ A;  4LIT A;  2KZV A;  3BCB A;  3LFU A;  3QOD A;  1PJR A;  2CV2 A;  3BG6 A;  1BR1 A;  2L5Q A;  3LSM A;  3H9G A;  4CCJ A;  3HPG A;  2VJ5 A;  4B43 A;  3CJQ B;  3CP8 A;  4CCO A;  1BOB A;  2KRH A;  4F3Q A;  3FHN A;  1V5F A;  2W00 A;  3ZCO A;  2E5N A;  3J7A Y;  2HVR A;  3UR3 C;  1J09 A;  2XF7 A;  4P5O A;  4X0G A;  5HOO A;  4BAC A;  3OL3 A;  2ZXH A;  2JA2 A;  2K9M A;  4II3 A;  1OR7 C;  4BE2 A;  1MMA A;  2K5C A;  3SYT A;  1VZ0 A;  1WFX A;  2LC2 A;  3I3L A;  1WJE A;  1IRX A;  3HG9 A;  4J01 A;  1DP3 A;  4LIU A;  3MKW B;  2IGO A;  4HST A;  4ZDL A;  2DJI A;  4CCK A;  3PFY A;  5TGT A;  2W82 A;  2PMZ A;  2HNH A;  1D0X A;  4Y4R A;  4BQN A;  3H0D A;  3ZXS A;  4RMN A;  3L2V A;  3IAM 2;  2W1O A;  3S32 A;  2WA0 A;  2HQA A;  3KEY A;  3LSH A;  2X1E A;  1LFP A;  2VXZ A;  1D1B A;  2A5W A;  2WBM A;  4PFP A;  4PUS A;  4XN3 A;  3KYL A;  2MC4 A;  2X85 A;  4BS9 A;  4NC7 A;  4ZDP A;  1Z3Y A;  4HEA 2;  4XLC A;  2AQF A;  3DU5 A;  3PNY A;  3OYI A;  1N75 A;  3OYM A;  1WJB A;  4ANJ A;  3HOT A;  3NWT A;  3CP2 A;  3CZ6 A;  3OOU A;  3HOS A;  4II2 A;  4ZC3 A;  1Z21 A;  1MND A;  3FKJ A;  1QHG A;  3K4J A;  4HNT A;  1X4P A;  2L2O A;  2LRD A;  2CMP A;  2LG4 A;  3H5A A;  3EPZ A;  3GBG A;  4BJ5 C;  3S3M A;  4XNF A;  4CUG A;  4NC8 A;  2WAQ A;  1D0Z A;  4E6K G;  2LBF B;  2VL8 A;  3S3O A;  2VIX A;  3DPL C;  3OYL A;  2X6Y A;  3TMO A;  2KHM A;  3ZGK A;  4BJ6 C;  4JOM A;  3W3C A;  2VQC A;  4U7B A;  3VYR B;  4JQF A;  2DCE A;  1DGW Y;  1R6R A;  4E4H A;  3RCO A;  3AL0 C;  2VKH A;  3AL0 B;  4XOR A;  2DOA A;  3M8J A;  4BQO A;  3TBI A;  3CMM A;  3I9V 2;  4E7H A;  2OC6 A;  1Y6I A;  3UNG C;  4XLE A;  3AKZ A;  1U0J A;  2CV0 A;  4E7L A;  2LBF A;  3PSI A;  4ZDO A;  2DT6 A;  3LSI A;  4DBQ A;  2HZD A;  2LY2 A;  2VJ4 A;  2XC7 A;  3LL7 A;  5KNL A;  1GLN A;  3OY9 A;  3EUA A;  3K4L A;  4EAT A;  4AU7 A;  1WJ5 A;  2BVL A;  4IKF A;  3K70 C;  4E7J A;  1TZL A;  2M3A A;  3H35 A;  3DQV C;  4BQQ A;  4XN0 A;  3DWL E;  1X1B A;  4BL0 B;  2XF5 A;  2VLA A;  3QYF A;  4QPO A;  1Y56 A;  3EUH C;  2QKL B;  3G2B A;  1E0E A;  2KLO A;  2R7X A;  3DEE A;  2VPL A;  4KT6 A;  3SDB A;  2V26 A;  4CCN A;  4CCL A;  3FBN B;  4J00 A;  3PNT A;  4P1W A;  2V6E A;  1BR4 A;  4BE1 A;  2HPM A;  1NG6 A;  4N4N B;  3L2R A;  1S9H A;  4XQF A;  2ZSI B;  1YX5 A;  2O5R A;  4RM2 A;  2R7S A;  1UEL B;  3L2Q A;  2JUG A;  3A4C A;  4XOP A;  3RTR A;  2Q2E B;  5FRN A;  2CFO A;  4B44 A;  2KMU A;  1N77 A;  1MMD A;  2MAB A;  5KCM A;  3MMY B;  2QKM B;  5LFA A;  2OV7 A;  3H5N A;  1TT0 A;  4D9J A;  4FAS D;  2IS4 A;  4F91 B;  4ITV A;  2BW3 B;  1DQU A;  4ZTF A;  4YEJ A;  2LRE A;  4HSR A;  4NUB A;  4IZZ A;  1N78 A;  2XAU A;  1D1A A;  2I8D A;  4ZYA A;  2M4K A;  1KON A;  2M7A A;  3DPT A;  3CES A;  4F92 B;  2VB6 A;  2ZXI A;  4XL9 A;  3OYN A;  2MYS A;  4OAY A;  3ZRG A;  3A2K A;  3BCA A;  3CF2 A;  3DKX A;  3PUB A;  4BXF A;  2R7W A;  1YX3 A;  1T95 A;  2CV1 A;  3NWS A;  3PSF A;  4NQW B;  4BU2 A;  2BW3 A;  2IGK A;  4ZJZ A;  4F93 B;  2MFZ A;  3VYU B;  3RPU D;  2GOM A;  4BEH B;  1NG7 A;  3FBI B;  1HA8 A;  5FRM A;  4XM3 A;  2ZSH B;  4DBR A;  5HNH A;  2F6C A;  3OIQ A;  5HNF A;  2CS3 A;  2R7R A;  2XSJ C;  5HVQ C;  3BLY A;  2FUG 2;  2KQR A;  4PJM A;  3DKY A;  5CQE A;  4DGW B;  5CPR B;  3DLA A;  2ELJ A;  2IGN A;  3AFH A;  4B48 A;  3VWB A;  3L2U A;  1DGR M;  2X6W A;  3DPU A;  2KL4 A;  3QYE A;  2X51 A;  2KDO A;  2E5Z A;  4DOZ A;  1X1C A;  4PJL A;  2L9S A;  2F4I A;  2WAE A;  1V5G A;  1X19 A;  4BEH A;  4XKW A;  4AVZ A;  2IS2 A;  3OS2 A;  3K4M A;  4QPQ A;  3PL8 A;  1WJF A;  4OWR B;  3F9K A;  2JVG A;  3FDY A;  4PSW A;  2CUZ A;  4RLQ A;  4GRI A;  3L2W A;  4C9Y A;  4BDY A;  3TL4 X;  3OWT A;  4E7I A;  2Z2S B;  2GOX B;  4KIS A;  2JVH A;  2CW8 A;  1MNE A;  3VYT B;  3OYK A;  3N05 A;  4KJZ A;  4DJA A;  2KPM A;  2Q1Z B;  4YRV A;  4U87 A;  3DTK A;  3LMM A;  1ERD A;  4XKC A;  4N4O B;  1WJC A;  3OYB A;  2XF6 A;  3E1S A;  4XLH A;  4F55 A;  3OMY A;  1QHH D;  3HC7 A;  3K4B A;  2R7T A;  1SFK A;  3BC8 A;  4D1Q A;  1FMV A;  3IP4 B;  2LY1 A;  2Z16 A;  3H9Q A;  4E7S A;  2CW7 A;  2UWM A;  2WY7 Q;  3DTI A;  4Y33 A;  3MKY B;  3D5L A;  4HPQ A;  2E1M C;  2KP6 A;  2VJI A;  2E1M B;  2VXD A;  3HXL A;  1EA3 A;  5CKT A;  2HVS A;  4LG3 A;  4XMY A;  2RRE A;  4MLO A;  2LYC A;  1ZEL A;  2BOL A;  2RNG A;  3ONQ A;  3A1Y A;  3OR1 C;  1W36 D;  2IS1 A;  3RQ4 A;  4XR6 A;  2NOJ B;  2UUZ A;  4C2T A;  3K4N A;  3OYC A;  3W2A A;  1W36 C;  3OYG A;  1WJD A;  1X1D A;  4R79 A;  4IX7 A;  1OLT A;  2X1C A;  1FMW A;  4CZC A;  1K6Y A;  2R7V A;  2K3P A;  3K4C A;  2AQE A;  3M1C A;  4Y3O A;  4CH7 A;  3EUK L;  2WAF A;  1P9Q C;  4XKV A;  2MD0 A;  2VKD A;  4BUP A;  1UAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...