1MBFA

Mouse c-myb dna-binding domain repeat 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
b'LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbfA00
1IGNA 5HODA 4JX5A 3UKGA 3JR9A 3HOVJ 1MH4A 2CUEA 3OOUA 2ME6A 2M9HA 3TEDA 3GTLJ 1FIPA 3OSGA 2Y31A 3VPRA 3FIWA 3S1QJ 1B72B 3Q3SA 2XGCA 1P7JA 3IH4A 4D5FA 2K9NA 3FISA 5FJ8J 4X6AJ 1BW6A 2DA1A 2ID6A 5C3EJ 2E2IJ 2L7FP 5JLWA 3JRGA 4A69C 2XB5A 3JRHA 3HEFA 4BBRJ 4M3DA 1D5YA 5DS9A 2O9LA 2E2HJ 4IHWA 1GV5A 3HBLA 3ZOBA 1YRNB 1JKPC 1RR7A 1Z0XA 5IOZA 3S17J 1IV6A 5EGOB 3OSFA 5IP9J 1QVUA 5IOYA 2DMNA 4FE7A 1HDDC 4A3FJ 3GTPJ 4A3BJ 3D1NI 1B72A 2R5ZB 2FQ4A 1MBGA 5EZGA 4V2GA 1H89C 1ETWA 4C3IJ 5F08A 1MH3A 4QTRA 2FD5A 1I3QJ 2CQXA 2I10A 1S7EA 3Q0WA 1X58A 2HXOA 3ZQCA 1JTXA 5K7ZA 2EBIA 3HDDA 4QIWN 1AU7A 1T33A 3S1RJ 4JP0A 3HOWJ 3BQZA 5J1YA 3F0CA 5IYDJ 2LY9A 2LFBA 3GTOJ 1MBHA 1IUFA 1YRNA 2QCOA 2HDDA 1VI0A 5EGOA 4J19A 3TP3A 4D7NA 5EG0B 1TWGJ 4AC0A 2DMPA 3HOZJ 2M34A 2LKXA 1IC8A 1Y1VJ 4FE4A 4M3GA 2R5ZA 5F0FA 5BNGA 2TRTA 2ME0A 1IDYA 5GP9A 3S2DJ 4IHYA 1JKOC 5IYBJ 1HCRA 3BG5A 2E19A 3ZQHA 1EF4A 1T56A 2IAIA 5JLXA 5GPCA 2IEKA 3CMYA 5FLVA 1OCPA 1BJZA 3Q0VA 1F43A 1OFCX 1WH7A 2XPUA 3BR0A 5E3OA 1AKHB 1RKTA 2DA5A 2ZB9A 4M3EA 1H88C 1AHDP 2NS7A 1B8IB 1W0TA 3RZOJ 4L5EA 2N8GA 2NVQJ 3PO3J 5EG0A 3FKIJ 4W1UA 3Q0UA 5FKOA 3LNQA 2HI3A 3CQZJ 4M3BA 4BXXJ 1FJLA 2E2JJ 3LSPA 2XRLA 2R5YB 3BR1A 4RDUA 4NDLA 2R7ZJ 1RETA 2EQRA 2YUSA 3HKZN 1LFBA 2EH3A 2Y2ZA 3JRDA 3H0GJ 1WGXA 2OPTA 1JKRC 2GM4A 2X6OA 3SFIA 4A3IJ 2GBYA 3QPLA 3K2AA 9ANTA 2DA2A 3NAUA 5FLMJ 3S14J 3W6VA 1JJ8C 1WCMJ 3IH2A 1AKHA 2WB1N 1JT6A 2G0EA 5FKMA 2K40A 4ABZA 1B8IA 1MSEC 5K7FA 1WPKA 1LFUP 3JRAA 1MNMC 3BR5A 4EEFG 3IV5A 5F04A 2HOTA 1U9OA 5M5WJ 4I6ZA 4MO7A 1Y1WJ 1TWHJ 5F0HA 1W0UA 4HNVA 3WHBA 2R5YA 2AO9A 5E3LA 1JTYA 1HDPA 1G2HA 3RZDJ 4D7MA 2GLOA 2WV1A 3JRCA 2L9RA 5DTDA 1UG2A 1ETXA 2RAEA 1MBKA 2EZKA 2DJNA 1POGA 2HXIA 4LOCA 1A6IA 2VUMJ 4C3HJ 1TWFJ 1P7IA 4AYBN 3MN2A 3CCYA 2K9SA 5FKKA 3TW7A 4DYQA 3C2BA 4QSHA 5FKNA 3ZQFA 1FEXA 3HOUJ 3M3YJ 3FK7A 4DZPA 1DU0A 3K7AJ 2Y30A 2VKEA 1IJWC 2XGEA 5GPAA 3JRFA 1ZKGA 1JUSA 2R0QC 1OCTC 3BR6A 1QVTA 2FJ1A 5J1UA 3CDLA 3BR3A 4A3DJ 1Z77A 2L0KA 5C4JJ 1ZR2A 1WI3A 4DW6A 3BG3A 1FTTA 2HYJA 2EZIA 2DN0A 2XPWA 4Y52J 1VF9A 3RQIA 1MBFA 3MKLA 1H8AC 3GTQJ 1TC3C 2MGQA 1VFCA 5J3LA 4FCYA 3BTIA 2B63J 2ECBA 1HOMA 5EEAA 3A02A 1LE8B 2E1OA 4RBOA 2VPRA 1GT0C 5IPAA 2NS8A 5C4XJ 5FKLA 2O7OA 2NOGA 3SJMA 2NVYJ 3G1MA 2DMQA 3ZQLA 1DU6A 1BL0A 1MSFC 4B1RA 3BTJA 3JREA 1JT0A 1ETYA 4IEJA 1GDTA 2LD5A 5E3NA 3H3VK 4D5CA 3S16J 4B4CA 4X1EA 4MIMA 3HGYA 3BTLA 4M6VA 1JUMA 2KT0A 1IRZA 3A03A 4BY7J 3ZQIA 1ZTRA 2DA7A 5C44J 1K61A 2Y0SN 1UMQA 4MFEA 4A3EJ 5M3FJ 3IH3A 1U9NA 3TP0A 2JA7J 1ETQA 2LK2A 4DYRA 1LE8A 1GUUA 1CQTA 3ZQGA 4IHXA 4I76A 1RKWA 4XRMA 2VI6A 4MFDA 1U8BA 2FX0A 3LSRA 1ZK8A 4FTHA 2PMZN 2LLKA 2CJJA 3GTMJ 1FIAA 3BR2A 1NTCA 2O8KA 2TCTA 2JMWA 3E7LA 1F36A 1IDZA 5EF6A 5F0CA 1ZGWA 1E3OC 2XPVA 3BG9A 4A3GJ 2JA5J 5IYCJ 4JX6A 2M2EA 3G1OA 3I4MJ 1RESA 2JN6A 3HB9A 1WH5A 2QF7A 1TWAJ 2LR8A 2XSDC 2EZLA 3B6AA 2VKVA 4A3KJ 2IBDA 3S15J 5E3MA 1XS9A 1PUFB 4MLOA 1VNDA 4FISA 4AUXA 2DMTA 3GTKJ 3GBGA 5IP6A 2DA3A 1Q1VA 1O4XA 1R9TJ 2KDZA 1I50J 3O8HA 1MBJA 3DEWA 3LSGA 3G1LA 1JJ6C 1NK3P 3M4OJ 1OJLA 1ETVA 1SFOJ 1ETKA 4XIDA 1A5JA 1APLC 3PO2J 3BT9A 1BA5A 2COBA 2R93J 4A3LJ 3BQYA 2MG4A 4DZJA 4DYCA 2Y9YA 4B3AA 2DA4A 5M5XJ 2MSYA 3B6CA 3FK6A 2JA8J 3HOYJ 2YU9J 1ITYA 3HOXJ 4W97A 2ELKA 4UUTA 4XICA 4A93J 1ORKA 2DA6A 4BKXA 4BBSJ 2OF7A 1PUFA 1QRYA 3JRBA 4V2FA 3TW6A 4CYCB 2K9QA 4BY1J 5K7HA 5M5YJ 3S1MJ 2DMUA 3BTCA 5EYRA 1ZQ3P 3GTJJ 2D5VA 4XRSA 1JKQC 3SDGA 1IG7A 2H1KA 1ZR4A 3O8GA 2Y9ZA 5IP7J 4UUSB 5F27A 1FTZA 2JWTA 4A3CJ 1XG1A 1U78A 2NVTJ 2XB0X 1GVDA 3A01B 2LTPA 3PM1A 1I6HJ 1X2MA 5EDNA 1BW5A 1JUPA 2R92J 1UHSA 2DTZA 2LP0A 1JGGA 4S0HB 2L7MP 2P81A 1HF0A 4Y7NJ 4JX4A 4JYKA 3QQAA 2YS9A 3DCFA 4A3MJ 4GFBA 3GTGJ 1K83J 2LVSA 3RKQA 2CRGA 4C2MJ 3HM5A 3NARA 3WHCA 3QPSA 2MW8A 2HOSA 2NVXJ 2HOAA 3HGGA 1QPIA 4CYCA 1TWCJ 4IHVA 2EZHA 1NK2P 2M8GX 3LOCA 2ID3A 1ENHA 2CQQA 3MVPA 2AHQA 2M0CA 4XRSG 4UUSA 2JJ7A 1MBEA 3LSJA 2H8RA 3S2HJ 2JK3A 3A01A 2L7ZA 2X9DA 1ETOA 2WAQN 3S1NJ 1X2NA 4G12A 1GV2A 1HLVA 3I4NJ 3L1PA 5EZHA 5M3MJ 3JRIA 2W48A 1SANA 2CU7A 1RPWA 2ECCA 1XC5A 2X48A 4M3FA 2JA6J 4C3JJ 2XGDA 5J1RA 4A3JJ 2HQ5A 4XK4A 5F1JA 2CUFA 3OIOA
chains in the Genus database with same CATH superfamily
2MLGA 3UKGA 3DBRB 4WXHA 1I1SA 1MH4A 4BEHB 2CO5A 3K0LA 2VASA 4M9SA 1NG6A 2Y31A 3D5RC 3VPRA 3FIWA 4JOMA 1B72B 3Q3SA 1WFXA 2ZC2A 1XSVA 1DPRA 3M7GA 1LJ9A 1VQ4I 2CV2A 1MJBA 2K9NA 3BJOA 3FISA 4X6AJ 1XCVA 2F48A 4IKFA 4P96A 4BDZA 4ZYHA 4IZZA 2DFHA 4HX4A 3ZPLA 2VJJA 3I3LA 3JRGA 1IZ1A 1K4SA 3LAPA 2XB5A 2XV4S 3FXUA 5E79C 3JRHA 1SC7A 4HF2A 4BBRJ 5GAEJ 4BQOA 1D5YA 1Y8RB 2O9LA 2E2HJ 2VOPA 3ASNH 1GV5A 4XLHA 1K79A 1RIOH 3HBLA 4HSRA 3ZOBA 3KZIC 3BROA 1VQOI 1NG7A 2AQEA 4MQ9F 4WWCA 4BUPA 5IP9J 4U7BA 1QVUA 3PUFA 4FE7A 3ZCOA 1FLIA 1YX5A 4A3BJ 3HSEA 3D1NI 1PJRA 4R79A 1MBGA 3M07A 4C3IJ 2L7KA 2DFFA 3CC7I 3S3OA 1LVAA 5FO5A 1ZH5A 4LB5A 2CQXA 1SD6A 2VBZA 3ZQQA 2OAZA 2AXLA 1WJFA 4NQWA 5K7ZA 4PFPA 1Z6RA 2EBIA 3MD2A 4XRFA 1YS6A 1MIJA 2A68F 4GCVA 4WF2A 4BJ6C 1J0RA 3BJ6A 3OR1C 1WJ5A 1Z05A 2PQ8A 3CZ6A 3FF5A 4M73A 2PG4A 2BHYA 2XDVA 2LY9A 3FMQA 3HHGA 2LFBA 3GZ5A 4B09A 3VWBA 2HTSA 4E6KG 5FRNA 4KN4X 2V6CA 1BI2A 4Y3OA 3WTZA 2IVMA 2QCOA 2HDDA 4XR6A 4J19A 3O3KA 2BVMA 1YFHA 1FOKA 3WODF 2DMPA 3HOZJ 2LKXA 4M71A 5K1YA 3L2CA 2WADA 2FMLA 2JRTA 5J4VA 2NNYA 1E17A 4MNUA 3MWMA 1IDYA 5GP9A 1IUYA 3DBLB 1XGNA 3I5UA 4IHYA 3MCZA 3EUHA 3I4PA 5IYBJ 1JKOC 2HKXA 3BG5A 2DTRA 1EF4A 1GXQA 1S29A 2OJED 2IGOA 1OCPA 1BJZA 2QEXI 2XGXA 3HTSB 5L3CA 1SFUA 4A0YA 2BYVE 3D5LA 4BE2A 2DA5A 2STWA 4HLYA 2WBMA 5JHFA 3CP2A 2DQLA 2XIGA 4GXOA 3WTXC 1W0TA 4UNOA 2N8GA 2KJCA 2NVQJ 2LH9A 1SMYF 2BY2A 4W1UA 3UNGC 3CJTB 5FKOA 3LNQA 4PSXA 2HI3A 2BY0A 2J5OA 4P1WA 5E1WA 4C30A 2HYGD 2RC4A 1EH6A 4CCLA 2K7LA 4KMFA 2A6EF 3DTIA 4KITB 1YG2A 5H20A 3EYYA 4HAMA 1RETA 2EQRA 1LFBA 2DODA 5L3EA 2Y2ZA 3JRDA 3REOA 4ZJZA 3IWZA 2V9KA 3K2ZA 1R5ID 3C3WA 3SFIA 2V26A 3K2AA 4A0ZA 4XLEA 4GYIA 3NAUA 3HL2A 2H94A 3S14J 5HVQC 1JJ8C 4RAGA 2EFQA 1R00A 3IH2A 2WB1N 1Z67A 4F7ZA 4MTEA 4HSTA 4JK1X 1LFUP 3S3NA 3BR5A 2WV0A 1IV8A 2XVCA 1V54H 1ZG5A 3ZN1A 4KIFA 1T0FC 1TWHJ 2MH9A 3CMAI 3ESWB 3IHUA 4ETSA 1G2HA 1N77A 3RZDJ 2XUBA 2VXDA 2HZTA 3NWTA 2WV1A 1UG2A 1ETXA 3LSHA 4Q48A 5ICFA 2EZKA 2K3PA 2VXZA 1VQLI 2DJNA 1DGRM 1YOVB 1POGA 3BC8A 4LOCA 2KISA 1A6IA 4C3HJ 3VYTB 1MNEA 3QP5A 2P7CB 2HOEA 3OYFA 2K9SA 5FKKA 3JSOA 1BJAA 3E3VA 4N0BA 1DP3A 3C2BA 3DQVC 1Z1DA 2E1CA 3NWSA 3E6DA 4Y13A 1QQIA 2BZTA 2LBFA 4Y33A 3U1DA 4DZPA 3BOQA 5B1BH 3MEXA 1UHWA 1KU9A 1ZKGA 4KJZA 2VE8A 3I64A 2L01A 4KT5C 3BR6A 4KFCA 3ABUA 3V8JA 5FFXA 3OL4A 1XSXA 5BS6A 5LGUA 4FT8A 4QLCU 2L4MA 1FTTA 2HQAA 2V1UA 1HW2A 2HVQA 1XX5A 3TGNA 3MKLA 2DT7B 3GFJA 1TC3C 2MGQA 3A0HC 2PJRA 4NB5A 2G7UA 2QKLB 4FCYA 3FHZA 1E0EA 3PFIA 2BBYA 3ECHA 1ONVA 1R4MB 3A02A 2QQ8A 1R5HA 2FNAA 2UV1A 4L5IA 1WJCA 1GT0C 1MKMA 2F4IA 2NS8A 4B47A 3OV8A 2NOGA 2H1LA 3SJMA 2RNGA 3GFIA 2CSOA 1J75A 2BE5F 1RR8C 3RKXA 2LMDA 1MSFC 3HOSA 4XL9A 2Q2EA 4B1RA 1V3FA 1S9HA 4AWXB 4P9UA 3OS2A 2Q1ZB 5CJ9A 4DQ2A 4IEJA 5AIPA 4B3XA 4LGWA 4HV6A 3H3VK 1BR2A 4B4CA 1AA7A 1SD5A 3LMMA 4AD9A 4UVCA 1S5LC 4HPQA 5LHIA 4CHUA 3OY9A 3AAFA 1W5SA 1D3YA 4UV8A 3G71I 3A03A 3KEYA 2C6YA 2GXGA 3CCQI 2QSGX 2PEXA 2ADUA 1K61A 3J80Z 1UMQA 1N25A 1OISA 3IH3A 4GGGA 1D0YA 3TP0A 3PIPF 2JA7J 1CQTA 4MEXF 3ZQGA 5L3DA 1Q1HA 5DYMA 1XMXA 3ROUA 1RKWA 4XRMA 2M87A 4XMYA 3L7WA 5ILUA 1SMTA 3FBNB 2K9LA 1B9NA 1WQ2A 3IP4B 1QBJA 2QQBA 3GYHX 1FIAA 2F5EA 1MGTA 2O8KA 2ZJRF 4AIJA 4E7SA 2JMWA 2DBBA 3E7LA 1XDSA 1GLNA 4OOIA 5H2FC 5EF6A 2XPVA 4ZYDA 3GW2A 2ZFUA 2FBKA 4K2EA 2JA5J 4LIUA 2HKOA 3K69A 5D8KB 3F8NA 4OWRB 2M7AA 2QM3A 2QF7A 2K85A 2DPDA 1O3TA 1TWAJ 2GOXB 1V5GA 2A5WA 4A3KJ 2I5UA 1NHAA 5GTHC 3DEEA 4MLOA 3L9FA 3RCOA 4ITVA 4I02A 1O3QA 5IP6A 2DA3A 3DWLE 3DU5A 4PJJA 1Z7LA 4EJOA 1CF7B 5CPRB 5JR3A 3F3XA 3EQLF 1X1CA 2H8WA 2QLZA 3HUGA 3V4GA 2KRHA 4CCNA 5A2QK 2HU9A 5AIQA 1ACIA 1TW3A 4UB8C 2MD0A 3BT9A 3DPUA 2IT0A 2F4MB 2OCEA 4EM0B 2ZBKA 2Y9YA 3H3ZA 2FF4A 1IXCA 2P5LC 1T8IA 5ICCA 3R6SA 3FK6A 3IUOA 1RI7A 2ZXHA 2FBHA 2IPQX 3HOXJ 1X3UA 2ELKA 1ORKA 3CCVI 1P2FA 3FXMA 1PUFA 2R7VA 1BBYA 4II3A 3B02A 4V2FA 4ZH4F 4F92B 2FRHA 1S72I 3R60A 3RYRA 2E34A 1HKTA 2DMUA 2D5VA 3OIQA 1Z3YA 1LKXA 3BZKA 1X1BA 1ZLJA 3SDGA 4QPOA 1ERDA 1IG7A 2MA3A 1ZR4A 2H1KA 3CCEI 5F27A 1R1UA 1WJAA 3ERMA 2NVTJ 2MD5A 1Y39A 2XB0X 1MJAA 3VYSB 2CH0A 4U0WA 3PM1A 1O7LA 1YI2I 1X2MA 1YQAA 4L18B 1JUPA 1X3ZB 4N4OB 2LP0A 1MZBA 4S0HB 2L7MP 3KIOA 3OYAA 5ICGA 1R58A 3U1KA 1DUXC 4L0YB 2VE9A 4JYKA 4EVIA 3GTGJ 2DLLA 4AM3A 4HX7A 3VOEA 2CRGA 3DPLC 1MMDA 2CWEA 3NARA 2MFZA 2HOSA 3E6BA 3OYEA 2W82A 3L2VA 1R1TA 1VQ9I 4AYBA 2IGNA 3T1BA 4BNCA 5KK1A 3BCBA 1IRXA 2EV6A 2EWNA 2CMPA 3OYLA 3JAMK 3LOCA 2ID3A 1U5TC 4XKVA 2RVCA 2PBIA 4BQQA 2CQQA 3MVPA 3TO9A 3CUQC 4XRSG 1VQKI 4EMSA 2RV8A 1U0JA 3FXQA 1IAWA 1MBEA 2DK8A 2HGCA 2L9VA 2L7ZA 1JHHA 3V7CA 1W7PB 3EPZA 4ENKA 3L1PA 3I59B 5EZHA 5M3MJ 1XD7A 1WWXA 3G2BA 4BHBA 1XC5A 5JVTA 3WU2C 1UHMA 3K70C 4A3JJ 1R5GA 2Z33A 1IW7F 4ZDLA 4PJMA 2XROA 2BW3B 4XK4A 5F1JA 2ZJQF 1BI1A 3SZGA 2OD5A 4JX5A 1K78A 4RAZA 3TEDA 2CUEA 3OOUA 2ME6A 2CGPA 2GIVA 2NS0A 2A07F 3S1QJ 1YS7A 2QYOA 3RI4A 1F5TA 4L9NA 4A6EA 3BPXA 3BZCA 4CDGA 2X1DA 4E7LA 1OR7A 1FBQA 2ID6A 5DV5A 5C3EJ 2CV1A 1XB4A 3AL0C 3K4CA 3F22A 3TQNA 4E7IA 5LD2C 5CVUA 3RJPA 3OYKA 5BPIA 4XORA 1DQUA 3AG4H 4F52A 2VB6A 3B73A 4A2UA 3H9GA 3LQRA 4NC7A 5KCMA 1JKPC 3Q9SA 2QBYB 4II2A 4L9TA 5E1XA 1VQMI 2Y75A 3BP8A 4XN0A 4BEHA 2DMNA 3GX4X 1GVJA 3M8FA 2FUG2 1B72A 2R5ZB 2R7XA 5EZGA 1ETWA 1VZ0A 3FHNA 1T39A 3F8FA 2FD5A 1BM9A 2I10A 4N9HA 1PP8F 2KDOA 3Q0WA 2HXOA 3H35A 1AU7A 2L9NA 3V42A 1EA3A 1T33A 5FB2A 2HEOA 1LFPA 2R7SA 2IW5A 3HRMA 2K9MA 3GMEA 3K4KA 5J1YA 2OUMA 4D0PA 3F0CA 5IYDJ 2LC2A 2EFPA 3GTOJ 4PGGA 2B0LA 4GDFA 1IUFA 4C9YA 3WGGA 4RM2A 4G7ZF 1O3RA 3H5RA 3HRTA 2F6CA 4H0EA 1VI0A 5EG0B 2XF7A 4AC0A 1IC8A 2EA4A 4FE4A 2E36A 2VBYA 1VQNI 2QQAA 1KYZA 2EJRA 4AIDA 2ZNZA 3W3CA 2HDWA 1R4NB 2ME0A 2ACJA 2D45A 4EATA 5DM6F 1IXRC 2VN2A 1HCRA 3GZNB 1GHCA 2KKOA 2LKSA 2Y69H 2IAIA 5JLXA 5DM7F 1QHGA 2LG4A 3CMYA 2STTA 1TQIA 3IC7A 2XPUA 1FWZA 5E3OA 3GEZA 3GWZA 2VIXA 4GO1A 2P5VA 2ZB9A 1NH3A 4XKBA 3RZOJ 5FRMA 2M3AA 1G3TA 1KZHA 1TTYA 3PO3J 1I3AA 2QUFA 4RGSA 3FKIJ 2M5WA 5HS8A 1ZG1A 1BN5A 3BPVA 1RZ4A 3CQZJ 4UB6C 2VJIA 2A61A 1V55H 4IOAF 2R7DA 3HTUA 2KP6A 2R5YB 2H6CA 3BR1A 5DD8A 3EYIA 5D6EA 3CCLI 2RQPA 2IJLA 3W6KB 5LRSA 3TO7A 4G7OF 3LSKA 3CESA 2DQRA 1QZZA 1WGXA 5GADJ 2HVRA 2PMHA 4A3IJ 3VSLA 1TT0A 4BDYA 1K6YA 4IVNA 4QWQA 1RRJA 1MDMB 2A3SA 4LLLA 2W1OA 1VQ5I 1T0FA 3W6VA 3VSKA 2YX7A 2MBFA 1OMIA 1S6LA 1ZRCA 3KYDB 5FKMA 2K40A 4ABZA 2YU3A 3HG9A 4B48A 5K7FA 3D5SC 5J4YA 3D0SA 4EEFG 4BH9A 2O0YA 3MZYA 4G9YA 3TKYA 4IL6C 1J5YA 4PUSA 2RGVA 1Z21A 5M5WJ 2VQGA 4IOCF 4A5MA 5EEHA 1PUEE 4HNVA 3ZMSA 4D7MA 2BXYA 3JRCA 4IHSA 2GZWA 2MYSA 1QA6A 2WAQA 2VUMJ 4HBLA 2XC7A 4LJZF 2W85A 2HFHA 3MN2A 4ZDOA 2OV7A 1O7FA 1RNLA 3JCUC 2MABA 2WA0A 3ZQFA 3IRQA 3EUAA 4HV5A 2V1XA 1A35A 3P7NA 1KA8A 1FYMA 3K7AJ 2VKEA 1IJWC 1IN4A 4BS9A 3C2GA 3PNYA 3K1PA 3VYUB 5GPAA 5HLTA 4M9XA 3JRFA 2VL8A 2F5FA 2KIMA 2OU2A 3A2KA 1S8NA 3KP4A 4ZTJA 3LWFA 3WTTC 2R0QC 1OCTC 1QVTA 3FXRA 5J1UA 4S05A 3BR3A 5FLXZ 2FOKA 1W1WE 4XLAA 2L0KA 2Z3YA 3S8PA 1TZLA 2XSJC 5C4JJ 4KICA 2IS2A 3BG3A 2ZO4A 1XGSA 4IQJA 1FMWA 2V1DA 1FC3A 3RQIA 2FSWA 4XNFA 1R6RA 5ICEA 3HXLA 3HJEA 2XASA 2GAUA 4U0VA 5EEAA 4C2TA 2FOWA 1YW9A 4PDKA 3P9IA 1LE8B 2E1OA 2VQCA 2VPRA 4RBOA 5IPAA 5FKLA 2XAGA 4UV9A 4B8XA 1D5VA 2VBXA 3LSIA 1F4KA 4CO8A 5HNHA 2UXNA 1BL0A 1R7JA 1JE8A 1LPQA 1TT5B 3OYHA 4IF4A 3BTJA 3JREA 4EV0A 1F1ZA 1GDTA 5E3NA 3N4MA 4BE1A 2X6XA 1YJ9I 1FP1D 2VQLA 5ILVA 2KIQA 4KIGA 4X1EA 3MZ8A 4MIMA 3GXOA 3JTGA 3KPHA 5B5EC 4M6VA 1JUMA 4CCMA 1TBXA 2FE3A 2KT0A 2OQRA 2R7FA 2LOOA 3RYPA 5CVVA 3S93A 1FZPB 2Y0SN 4ESJA 4A3EJ 3C2HA 3K10A 3ZRGA 5DEQA 4BE0A 1LEBA 2EB7A 3F8MA 2Q8KA 5DCMB 1OLTA 4CUGA 1YITI 4MFDA 4RB2C 3TO6A 3FMSA 2FBIA 2P6SA 3UR3C 2DAOA 2FX0A 3HSRA 4HX8A 2Z16A 5HDGA 2PMZN 2JVHA 2VJ4A 4Z6YA 2CJJA 3SDBA 3BR2A 4MEYF 2OQGA 4M72A 5H6RA 2TCTA 4NHJA 1MMSA 1F36A 4U0YA 5D5VB 5F0CA 1JXSA 3BG9A 4HG2A 3VODA 3QPHA 4JQFA 4A3GJ 1Y0NA 5KVRA 3G1OA 3LA2A 3MMYB 2YR2A 3KE2A 1FSHA 2EIJH 1WH5A 3A1YA 5DD4A 2LR8A 2XSDC 2EZLA 1DPUA 2K02A 3B6AA 1JI8A 3GCMA 4HZFA 3K6GA 2GA2A 3L2QA 1VNDA 2XRNA 5DUKA 4FISA 3BG6A 2DMTA 2JPBA 2EINH 3DPTA 3CTAA 4BU2A 3BCAA 1UJ8A 4AIKA 1FYLA 2KDZA 2G7HA 4EQQA 3QYFA 5HOOA 2NNNA 3J80K 4UXNA 5JFRA 2XF5A 4WXCA 1NK3P 2LF7A 2TDXA 4XIDA 1A5JA 1APLC 1ZREA 3RDIA 4I01A 3EUKL 3GUDA 3ZP5A 4DBQA 1XTAA 3PQJA 2GXBA 1Z7UA 4BXFA 3SZTA 4O3MA 4PSWA 4C2UA 2MG4A 3K4LA 2DA4A 2K5CA 5M5XJ 2MSYA 3RPUA 3ZMZA 1TQMA 2DCEA 3CJRB 3CCJI 2FMYA 1ITYA 2AXTC 3N05A 3DXJF 4XICA 5J8CA 1HW5A 2O3FA 4BKXA 2HPMA 1MMAA 3ML6A 2MLKA 2RDPA 4HNTA 4LK0F 3JRBA 3TW6A 2KZGA 1ZRDA 2K9QA 5M5YJ 3S1MJ 3U21A 3BTCA 1USTA 1D8JA 3TOAA 3WU1B 2WB1A 4XRSA 1CF7A 2YPRA 4LMYA 3MFKA 1K7AA 3O8GA 5F6FA 4BJ5C 4UUSB 2Y9ZA 2CQ7A 1U78A 5KHDA 2V7FA 1C0WA 3A01B 2D2WA 4HDUA 4Q4ZF 4FHTA 2EIKH 4G6QA 5LHHA 2VKDA 1BIAA 2R92J 1UHSA 4AIHA 1KQ8A 4M9ZA 1JGGA 2KPMA 3S2WA 3DP7A 4ZDPA 2KRFA 4Y7NJ 4JX4A 4HQEA 3QQAA 4A3MJ 5D5UB 1U5TA 3RKQA 2ESHA 1BC8C 4IHTA 3OYNA 4MGRA 4PZJA 1CGPA 3WE3A 3WHCA 2NVXJ 3E6MA 1QPIA 3SEQA 5B3SH 2KQRA 3SZPA 1NK2P 2HZDA 2M8GX 1SD7A 3HSFA 2UUZA 2DI3A 4UVAA 1W5CC 2JJ7A 4I98B 4XONA 1YJNI 2H8RA 3TL4X 3CCRI 1ETOA 1QNTA 1X2NA 1U2WA 4XSXF 1HLVA 4PJLA 2L9SA 3JRIA 2ZXJA 4PFOA 1HW1A 3HPGA 3BG7A 1JHFA 5K5QA 2CU7A 2HDCA 1J7KA 1RC9A 2ZNYA 2L2OA 4Q5SF 4OIPF 1E3PA 5LEJA 3ZN0A 2CUFA 3KP5A 1B9MA 3WG9A 5K5RA 1YW7A 5HODA 3JR9A 3HOVJ 1XMKA 2DJIA 1WVRA 5E8GA 1G3YA 3LL7A 3PFYA 4PJNA 2VC0A 2ZMEC 4M6YA 2V4JC 5J6XA 5FJ8J 4DGWB 1ZELA 1YTYA 2DA1A 4DJAA 1OCCH 1W7PA 1WHUA 2E2IJ 2L7FP 1WKMA 2JT1A 4XSZF 5HS9A 5JLWA 1DGWY 3I59A 4GYGA 1A6QA 4BJTA 2B7EA 4Z2YA 1MW7A 4EJVA 3NQOA 5IY5H 3I56I 2BW3A 5CVRA 3J7AO 2VLAA 4U88A 1YRNB 2JPCA 1FBSA 2UZKA 3J7ZI 5IOZA 1IV6A 5EGOB 2CW8A 3SFZA 2DDBA 2ZSHB 3K1MA 2LRDA 4AU7A 2CG4A 1KGSA 3CCSI 2DPUA 1U5TB 4XLNF 4A3FJ 2IS6A 2HVSA 1Y56A 3L09A 3QU6A 3IRRA 4LG0B 2BXZA 2EV0A 3CUQB 3PJRA 3FDYA 2HNHA 2JRMA 4LK1F 4FASD 3ZR8X 2A6HF 2XAFA 5F08A 1GXPA 4QTRA 1LDDA 2A5YB 4FX0A 2WY7Q 1X58A 4YIIA 3OYIA 4CGZA 1JTXA 1B4AA 2CW0F 2W4SA 2CS3A 3HRUA 1DDNA 2KMUA 4JP0A 3JW4A 4J01A 4I09A 3JSPA 4R1HA 2ZJPF 3DF8A 5E18F 2ESNA 3BQZA 3LQQA 4PJ0C 5EEGA 2E5NA 1XPXA 1KQ9A 2FQ3A 2R7OA 3M8JA 4NC8A 1R22A 1UB9A 1XSDA 3CDHA 1MBHA 1EKEA 3FZVA 3RIRA 1BR1A 1LQ1A 2E7WA 2EV5A 4JBAA 2QBYA 4FETA 1OYWA 3TP3A 4D7NA 1KU7A 3BWGA 2ZFWA 4RLFA 3H1CA 3MQ0A 3HIFA 4XN3A 3W2AA 3A4CA 2K3FA 2EA2A 2M0MA 2Z5UA 4M3GA 2RNJA 5F0FA 4E70A 2R5ZA 4CCOA 1O57A 2TRTA 3IKVA 4IJAA 2R7RA 3CJQB 5D4RA 3MZHA 3AL0B 4OU0A 5D4SA 3ZQHA 4RM3A 1T56A 1IF1A 5H6QA 1Z3XA 1QGPA 2IEKA 1FYKA 1JGSA 4E7HA 3VFZA 4UY8I 1F43A 1OFCX 2JSCA 2KZVA 2PN6A 3S32A 1AKHB 2OTJI 1QHHD 2WTEA 4R8HA 2P6TA 4M3EA 3K1NA 3L2RA 1B8IB 2WY8Q 2L54A 1AHDP 3ZMVA 3MKWB 1RUNA 4WCGA 1VQPI 5EG0A 1K6OA 1ON2A 5D6FA 4CCJA 4HNUA 2EFWA 1HKSA 3PNVA 2M4KA 4BXXJ 4HW0A 1BC7C 3DFGA 5FROA 2E2JJ 2ZCWA 4RDUA 1IN6A 2X6YA 1FNNA 2BHZA 2P8TA 4NDLA 3HKZN 3I58A 1UAAA 2P4WA 3ZQ7A 2EH3A 3OR2C 4Y15A 3H0GJ 2DFEA 2GM4A 2X6OA 3FXOA 2ELHA 3M9AA 1Z9CA 3I54A 5HDNA 4X0GA 9ANTA 3ZMUA 2DA2A 5L3GA 1Y0UA 5TJJA 4BGDA 4ZYEA 3QYBA 2PX9A 2VQHA 2R3SA 3E1SA 1W36D 5JVGF 4P9FA 3BDDA 1WPKA 1MNMC 3H5NA 5BPDA 3CF2A 3EDPA 3QP6A 2F2EA 4IRGA 5F04A 5IT9K 2HOTA 3K4JA 4A12A 1T95A 2JZYA 5KAIC 2NXNB 4I6ZA 4ON0A 2GWRA 2HPIA 2EPFA 1Y1WJ 3WHBA 2R5YA 2AO9A 5E3LA 1JTYA 1MNDA 3AG3H 1HDPA 3I9V2 2XAUA 2WWYA 2Z9OA 2WC2A 3CC2I 2GLOA 2E60A 4UHTA 3M1CA 2RAEA 4L0ZB 2HQNA 2V9PA 2W57A 4OAZA 3PSFA 1OCZH 2Z2SB 2Z1DA 3W2VA 1R49A 4RB0A 2CFOA 4KMUX 2YX4A 3V8LA 1MDMA 2DXIA 4E4HA 1TWFJ 3TOBA 2ZXIA 4CYDA 2VJ5A 4KN7X 4EGZA 3FXJA 4J00A 2D1HA 3RTRA 2Q0OA 1USSA 3IAM2 1HXDA 5FKNA 3WE2A 1FEXA 3ABKH 4ZZDA 3M3YJ 3FK7A 4EM2A 3FM3A 2ETHA 3VB2A 1A04A 2RQQA 2QA4I 2Y30A 1H9TA 2XGEA 3LFUA 1STZA 5F64A 5LHGA 3KLOA 4OIRF 3K4NA 5HNFA 2FJ1A 3RSNA 1ZRFA 3CDLA 2OZ6A 1AWCA 1Z77A 2UXXA 4RGUA 2EILH 4IRHA 4DW6A 1Z91A 2M45A 2HYJA 2EZIA 4UVBA 2IGMA 2A05A 2H6BA 1X4PA 3OS0A 2CQKA 4BHPA 1H8AC 2NVUB 3F6OA 2JSPA 3GTQJ 2LY1A 1R1VA 2HS5A 4A5NA 2BV6A 4OMZA 1BI0A 4CCKA 3BTIA 1VFCA 1OYYA 2B63J 2VC1A 3F72A 2X1EA 1HOMA 5LBQA 3DKYA 1D0ZA 5C4XJ 2JUGA 3E5UA 5JI6A 3KYLA 1ON1A 3HRSA 2NVYJ 1R36A 3OMYA 4XOPA 4U7DA 4FX4A 2DMQA 3ZQLA 2CQNA 1DU6A 3BZ6A 3SHFA 5IT9Z 3KP2A 3P9CA 2M4GA 1JT0A 2FA5A 4CZCA 5TISC 1ETYA 4DBRA 3H3UA 1B1BA 3I53A 1D1CA 4XQFA 5TRDA 2PI0A 2R7TA 4IPAA 1ZGAA 3W6JB 5FD6A 3R4KA 2LNBA 5BMZA 3HC7A 1FPQA 3HGYA 3T8TA 1HBXG 2BEOA 1D8KA 1J59A 3BTLA 4DIQA 2CUJA 3U9GA 1HSTA 1IRZA 1E2XA 5E8IA 5D5XB 1QPMA 4MHGA 2DA7A 3CJNA 5FLXK 4BL0B 1T08B 5LGTA 2M8EA 4U87A 3OYBA 2O03A 1U9NA 3F8BA 1ETQA 1LE8A 3CD6I 1GUUA 3TBIA 3T5XA 3F21A 4LD5A 3HOTA 3ELKA 3WG7H 3NRVA 2BVLA 3QWLA 5CVJA 4I76A 2VI6A 1FOWA 1U8BA 1PYVA 3OYCA 1IXSB 1LEAA 1X1DA 1ZK8A 3PSIA 2F5VA 3LSRA 4FTHA 2Z99A 4G8XA 3GTMJ 3T8RA 1VQ7I 4LB6B 3G73A 2Y0MA 2LY2A 1HSJA 1IDZA 4E7JA 3ZMTA 1ZGWA 3KEQA 2R7WA 2K86A 4YIFA 5IYCJ 4LLNA 3WTVC 2M2EA 3P5JA 4V19K 3I4MJ 1RESA 5E1ZB 2E71A 1V5EA 2JN6A 1J9IA 1PDNC 1N78A 2QSFX 2VKVA 2VPLA 1IN7A 5E3MA 1F9NA 3I0TA 3WGHA 2LF8A 1XS9A 4IXAA 1WZ2A 2E1NA 5GAHJ 2VONA 4FQGA 5HS7A 1WJEA 1X4OA 4EJWA 1ZYRF 4N4NB 3ONQA 3GBGA 4I2OA 4BYYA 3KYCB 4O5VA 5DCMA 4Y17A 3X2QH 3MAJA 3TDUC 3O8HA 2DFIA 2H09A 1PVEA 3LSGA 1OCRH 3QODA 1JJ6C 3M4OJ 1ETVA 1B6AA 2BGCA 4A0XA 3FXKA 1OR7C 5E20A 4YIRX 3PO2J 1BA5A 2COBA 3F9KA 4L5JA 4WK8F 2CUZA 3FX3A 3C18A 3HPHA 1IO2A 4DZJA 3L00A 4B3AA 3B6CA 1YJWI 2YU9J 3U2RA 4W97A 4UUTA 3WGIA 4A93J 4HYEA 2DA6A 2KIFA 2OF7A 2K27A 3DBHB 3AFHA 3BJAA 2BY3A 3ECOA 1ODDA 5EJCA 3H0DA 2X6WA 2X51A 3AG2H 1FOXA 3HZJA 1FSEA 4CYCB 3G4SI 1LB2A 3TDZC 2O8XA 1FX7A 2GXAA 1P92A 3GTJJ 4CICA 1OKRA 4P5OA 2COMA 3KZZA 4RAYA 1JKQC 3T0YA 2PMUA 1YIJI 2R7UA 5IP7J 5DUIA 1FTZA 4A3CJ 1XG1A 4RLQA 2PLYA 3ZXSA 1GVDA 2LTPA 4A6DA 1VQ8I 1QZYA 1XGOA 3ZGKA 2LREA 1BW5A 1ZG3A 1LVKA 4HEA2 3KCCA 1I39A 4EM1A 2P81A 4I99C 2R4GA 3VYRB 4ZTFA 1H9GA 2VT3A 3RQ4A 4ESFA 3DCFA 2YS9A 2DK5A 4GFBA 3DKWA 2RKHA 3OYJA 4IQ4A 4DOZA 5FFZA 1G3SA 5D5WB 1XDUA 2EK5A 2IA1A 2W84A 2L5QA 3QPSA 2X1CA 5DDGA 1G6NA 4D1QA 1TW2A 3OL3A 3OIPA 1ZHFA 2E1MB 3ABLH 2W00A 1TWCJ 1TLHB 2E7XA 4TV7A 5CLSA 4IHVA 2EZHA 2ISZA 1TNTA 2GOMA 2ELJA 2KIUA 1ENHA 2P0WA 2MC4A 4PCQA 2AHQA 4B44A 4UUSA 1YE9A 2KL4A 2IS1A 3S2HJ 2JK3A 3HHHA 2CYYA 4XLCA 4Q47A 3A01A 2X9DA 4S04A 4RGXA 5LGNA 3S1NJ 1P4AA 4IX7A 1U8RA 1SD4A 1ZAOA 1P9QC 2DDAA 4KIBA 4WX9A 1G4DA 3I4NJ 1X1PA 4LG3A 4Y4RA 1BR4A 1KYWA 1SANA 1L3LA 2HR3A 3LA7A 1RPWA 4OAYA 4M3FA 2IS4A 2CV0A 4ENJA 2CW7A 1RUOA 2JA6J 4C3JJ 5LEKA 4BAYA 2ZMEA 2PFBA 3F6VA 3CLQA 3F23A 1UFMA 1FOYA 1IGNA 1TNSA 4ESBA 5JHUA 2M9HA 3R0AA 2EIMH 3GTLJ 1FIPA 2KHMA 3OSGA 2KRCA 4BACA 1X1AA 2I8DA 1MMGA 2X0LA 4XKWA 2XGCA 1P7JA 3IH4A 4KNYA 4D5FA 2R7QA 4G7HF 1FP2A 1BW6A 3ZMDA 4NQWB 1YLFA 1X19A 3QOEA 5IT3A 3CMMA 1XN7A 2XAHA 2E1MC 1U6GA 2MH2A 4A69C 1SFEA 3HEFA 4M3DA 4E7KA 2VT2A 1I27A 5DS9A 3L2UA 3E5XA 4IHWA 2JQ7A 1B59A 3OWTA 4YRVA 1TQPA 2FU4A 3SEZA 1UZCA 1RR7A 4PK4A 4CA0A 1Z0XA 3S17J 3AKZA 1K4TA 3QPTA 1V4RA 2LKPA 2V9VA 4XM3A 3OSFA 2Y0SA 4IRIA 5IOYA 3OOPA 2ZXWH 1HDDC 4OINF 3GTPJ 2A6TA 5HLHA 3QYEA 2FQ4A 1H89C 2V1NA 4V2GA 3QRFF 2IXSA 3PQKA 1MH3A 2HQRA 1I3QJ 1SAXA 3FWEA 1WJDA 4LIVA 1S7EA 3RKYA 3ZQCA 2PMZA 2O5RA 5ILSA 4RMNA 1VQ6I 4CXFA 3HDDA 4QIWN 2JA2A 1LDJA 1G8XA 3GFLA 4KUMA 3S1RJ 4BXUA 3I55I 3HOWJ 2WAEA 2OTLI 1PP7U 5LLQA 1IN5A 3VEPA 4ZZLA 4RA2A 2GIZA 3L2WA 1LDKB 1YRNA 3PIOF 2DOEA 5AONA 5EGOA 3LAJA 1TL8A 5GAGJ 5DCFA 1TWGJ 3DEUA 1L0OC 2G9WA 4KT6A 2M34A 1Y1VJ 2ZMEB 4LG0A 3CUQA 2LSOA 4AVPA 3WU0A 5BNGA 2IA0A 1IRFA 3V7RA 5LRRA 3KETA 4YFKF 3LA3A 1EH7A 4BQNA 5HLGA 3GLLA 1WJBA 3CF5F 5J40A 3S2DJ 1MD0A 1YX3A 2V79A 1I1GA 2E19A 3V7SA 3CCMI 2P5KA 4XLFA 5GPCA 2PJPA 5FLVA 3AG1H 3SQNA 2HYFA 2WAFA 3J7AY 1V5FA 1D1AA 3Q0VA 5B1AH 1R71A 1P6RA 3O2PE 1WH7A 3SXYA 1J2XA 3BR0A 4M74A 3DLLF 6PAXA 1G59A 1RKTA 1H88C 4H4KC 2ISYA 2NS7A 3FXLA 3FM5A 3EUHC 2Y48A 4ZC3A 4L9VA 4D9JA 1T6SA 4L5EA 2D1VA 4EGYA 4RAFA 3GVAA 3K4MA 1KU2A 3Q0UA 1SVOA 5KAFC 4M3BA 4GRIA 2VODA 3H9QA 2HTJA 1SAUA 2LDUA 3H92A 1FJLA 1KU3A 3CUOA 3LSPA 2XRLA 1YO5C 1DP7P 3V8KA 2R7ZJ 3FBIB 2YUSA 3A0BC 2BOLA 3H36A 3OS1A 4BHCA 4EJTA 3CDIA 4NUBA 5E17F 3K4BA 2YSRA 1OPCA 2E5ZA 2DT6A 2OPTA 1JKRC 4YELA 3CC4I 1QU3A 1T38A 2GBYA 3QPLA 2QENA 2M7BA 5CQGA 2O6GE 1Y6IA 2CFXA 2DU9A 3IL2A 5FLMJ 3CO7C 3E6CC 1I6XA 1UCRA 1O3SA 4RGRA 1WCMJ 1AKHA 4MTDA 1D1BA 1FY7A 1JT6A 1OQYA 2G0EA 1B8IA 2LBFB 1MSEC 5KNLA 2M30A 3JRAA 5GTIC 1XCBA 2ZJ2A 2VKHA 3OYGA 3IV5A 3G3ZA 3ABTA 3I71A 2OA4A 1BIBA 1U9OA 3HYIA 1SEUA 3BY6A 3ISPA 2GA1A 3H5AA 4MO7A 5F0HA 3ASOH 1W0UA 3PL8A 5TGTA 1OCOH 1HC8A 1U3EM 1HQCA 2L9RA 5DTDA 5LFAA 1MBKA 3M8EA 5CKTA 4YFXF 4ENMA 1S7AA 2DW4A 2HXIA 5J47A 3C7JA 1ZLKA 3DLAA 2PJRB 1REPC 3QOPA 5L3FA 4AVZA 1P7IA 4HOBA 4I7HA 3GFMA 4AYBN 3CCYA 4I0AA 3TW7A 3ABMH 4DYQA 4QSHA 3HOUJ 1G3WA 4QPQA 2QGUA 2HWVA 2M1BA 2GQQA 3FMRA 5CQEA 1HA8A 2DYRH 1P4XA 1DU0A 3KZYA 1QO0D 3KEOA 2Q2EB 3J81K 4L9JA 2V6EA 1J09A 1JUSA 3M1EA 3BLYA 2OBPA 4YG2F 5FGMA 4A3DJ 1ZR2A 1WI3A 1W36C 2XPWA 2DN0A 4Y52J 1VF9A 1BOAA 1MBFA 3MKYB 1T98A 1D0XA 2DOAA 1ZARA 2K4BA 3IAS2 5J3LA 1A31A 2ECBA 2FEZA 4RS8A 5ERIA 2KJBA 4LLGF 3ULQB 1WSUA 2XKPA 4O6JA 2O7OA 2H27A 3KP7A 2QQ9A 4WXDA 3S3MA 2F5CA 4G6DA 3G1MA 5F1RA 3VDXA 4XKCA 4F93B 1R23A 1MMNA 1SVLA 1Y8QB 2IA2A 1ZGJA 1Z6TA 2LD5A 3QAHA 2NOJB 1LUJB 4D5CA 2MC3A 4HLXA 3S16J 2QSHX 5J8FA 3C1DA 3WTWC 2BY1A 1EH8A 1YYVA 3PNTA 1A36A 2AQFA 5K5OA 2EFOA 4HF0A 4RB3C 3OYMA 2L02A 2XF6A 3Q9VA 4XOTA 2J5PA 2VOOA 3IKTA 2XHKA 1E3HA 1EJ9A 4BY7J 4F55A 3ZQIA 1KQ0A 2DO7A 1ZTRA 3GF2A 2XAJA 1UG0A 4NBQA 5C44J 4MFEA 2ICWG 4F91B 5M3FJ 5A2QZ 4OIOF 4KA4A 2LK2A 4DYRA 5HDKA 1BOBA 4IHXA 4OIQF 1S7OA 4E7ZA 1XGMA 3QU3A 2OC6A 1I5ZA 3FKJA 3IWFA 3HUGB 4YFNF 2LLKA 4EJUA 1NTCA 2P7VB 3J81Z 1FBUA 1E3OC 2NRAC 2JTVA 3P9KA 3TMOA 2W7NA 4JX6A 1SVMA 3RPUD 2KFDA 5L3BA 2EFNA 3DTEA 3HB9A 4LFUA 2QKMB 2IBDA 3EETA 3GO5A 4OMYA 3S15J 3J7YJ 3CMEI 4P55A 4MQVA 1PUFB 3ERED 4AUXA 3WTUC 3GTKJ 4ANJA 3WTYC 4BQAA 4ASNA 2DOFA 1Q1VA 1IRGA 2L3DA 1R9TJ 1O4XA 1I50J 1N75A 4LITA 1UELB 1MBJA 3DU6A 3DEWA 5FD5A 2DYSH 2JUCA 3E5QA 1S3JA 3G1LA 1VTNC 1OJLA 1SFOJ 1ETKA 1QZEA 3W2WA 4RB1A 2NAZA 2UWMA 2QVOA 1SFXA 3KX2A 1ULYA 2ZKZA 1FT9A 3R0JA 1P4WA 2RN7A 2L4AA 2R93J 1BI3A 3G6EI 3BQYA 4A3LJ 4DYCA 4HDVA 3RKWA 3MKZA 5D8LB 3HKZA 2W25A 4IO9F 2JA8J 3HOYJ 2ZSIB 4YEJA 5B66C 4HF1A 1X3WB 3JTHA 3JAMZ 4CZZA 1W4MA 4N9IA 4BBSJ 3CLOA 1QRYA 2JVGA 1LNWA 4KDPA 4ZYAA 4DNCA 1YW8A 4G6TB 4BY1J 5K7HA 1IN8A 4HQMA 5EYRA 1T2KA 1ZQ3P 3K70D 2LYCA 4PGHA 4KISA 3LFKA 2KLOA 3O6BB 5ED4A 2JWTA 1WRJA 4ZYGA 3KLNA 2RREA 4F3QA 4XBFA 1YHQI 3WTSC 1FMVA 1I6HJ 3LSTA 4CH7A 5EDNA 1W5TA 3GZ6A 3CCUI 3DKXA 2DTZA 1XMAA 3KP3A 3SYTA 1HF0A 2A69F 3E0JB 3N97A 4ENNA 3H9JA 1K83J 1AOYA 2LVSA 2K4JA 3OYDA 1OYIA 4C2MJ 2FNPA 3HM5A 2QWWA 2IRFG 3GLXA 4NNJA 3Q5FA 4B43A 4HRIA 3COAC 2W24A 2MW8A 2B9SA 1K78B 2OCCH 2HOAA 2XAQA 1HKQA 3F8CA 2OZUA 3PUBA 2E35A 3HGGA 4G94A 4CYCA 4KYWA 2AS5F 2QZ8A 3CP8A 2XKOA 1SFKA 1WI9A 3DTKA 2VBWA 5CYVA 3R61A 4M6XA 3CO6C 1YIOA 2NYXA 4XLPF 2M0CA 2FXAA 3LSJA 1W7PD 1H0MA 2F4OB 3RPQA 2WAQN 4CSWA 5BOXA 1TP4A 2IGKA 3E97A 4G12A 1GV2A 1EV7A 4HA8A 2DT5A 1KONA 2IP2A 1ZN2A 2W48A 5HLIA 2ECCA 2X48A 1M1EB 4I0BA 4NC6A 4UUVA 3NEUA 1MJ9A 2XGDA 3K9TA 2X4HA 2F5DA 3DV8A 5J1RA 2HQ5A 2O61A 3LSMA 3KFWX 5BQTA 2X85A 5CVIA 3KP6A 3OIOA
chains in the Genus database with same CATH topology
1IGNA 5HODA 4JX5A 3UKGA 3JR9A 3HOVJ 1MH4A 2CUEA 3OOUA 2ME6A 2M9HA 3TEDA 3GTLJ 1FIPA 3OSGA 2Y31A 3VPRA 3FIWA 3S1QJ 1B72B 3Q3SA 2XGCA 1P7JA 3IH4A 4D5FA 2K9NA 3FISA 5FJ8J 4X6AJ 1BW6A 2DA1A 2ID6A 5C3EJ 2E2IJ 2L7FP 5JLWA 3JRGA 4A69C 2XB5A 3JRHA 3HEFA 4BBRJ 4M3DA 1D5YA 5DS9A 2O9LA 2E2HJ 4IHWA 1GV5A 3HBLA 3ZOBA 1YRNB 1JKPC 1RR7A 1Z0XA 5IOZA 3S17J 1IV6A 5EGOB 3OSFA 5IP9J 1QVUA 5IOYA 2DMNA 4FE7A 1HDDC 4A3FJ 3GTPJ 4A3BJ 3D1NI 1B72A 2R5ZB 2FQ4A 1MBGA 5EZGA 4V2GA 1H89C 1ETWA 4C3IJ 5F08A 1MH3A 4QTRA 2FD5A 1I3QJ 2CQXA 2I10A 1S7EA 3Q0WA 1X58A 2HXOA 3ZQCA 1JTXA 5K7ZA 2EBIA 3HDDA 4QIWN 1AU7A 1T33A 3S1RJ 4JP0A 3HOWJ 3BQZA 5J1YA 3F0CA 5IYDJ 2LY9A 2LFBA 3GTOJ 1MBHA 1IUFA 1YRNA 2QCOA 2HDDA 1VI0A 5EGOA 4J19A 3TP3A 4D7NA 5EG0B 1TWGJ 4AC0A 2DMPA 3HOZJ 2M34A 2LKXA 1IC8A 1Y1VJ 4FE4A 4M3GA 2R5ZA 5F0FA 5BNGA 2TRTA 2ME0A 1IDYA 5GP9A 3S2DJ 4IHYA 1JKOC 5IYBJ 1HCRA 3BG5A 2E19A 3ZQHA 1EF4A 1T56A 2IAIA 5JLXA 5GPCA 2IEKA 3CMYA 5FLVA 1OCPA 1BJZA 3Q0VA 1F43A 1OFCX 1WH7A 2XPUA 3BR0A 5E3OA 1AKHB 1RKTA 2DA5A 2ZB9A 4M3EA 1H88C 1AHDP 2NS7A 1B8IB 1W0TA 3RZOJ 4L5EA 2N8GA 2NVQJ 3PO3J 5EG0A 3FKIJ 4W1UA 3Q0UA 5FKOA 3LNQA 2HI3A 3CQZJ 4M3BA 4BXXJ 1FJLA 2E2JJ 3LSPA 2XRLA 2R5YB 3BR1A 4RDUA 4NDLA 2R7ZJ 1RETA 2EQRA 2YUSA 3HKZN 1LFBA 2EH3A 2Y2ZA 3JRDA 3H0GJ 1WGXA 2OPTA 1JKRC 2GM4A 2X6OA 3SFIA 4A3IJ 2GBYA 3QPLA 3K2AA 9ANTA 2DA2A 3NAUA 5FLMJ 3S14J 3W6VA 1JJ8C 1WCMJ 3IH2A 1AKHA 2WB1N 1JT6A 2G0EA 5FKMA 2K40A 4ABZA 1B8IA 1MSEC 5K7FA 1WPKA 1LFUP 3JRAA 1MNMC 3BR5A 4EEFG 3IV5A 5F04A 2HOTA 1U9OA 5M5WJ 4I6ZA 4MO7A 1Y1WJ 1TWHJ 5F0HA 1W0UA 4HNVA 3WHBA 2R5YA 2AO9A 5E3LA 1JTYA 1HDPA 1G2HA 3RZDJ 4D7MA 2GLOA 2WV1A 3JRCA 2L9RA 5DTDA 1UG2A 1ETXA 2RAEA 1MBKA 2EZKA 2DJNA 1POGA 2HXIA 4LOCA 1A6IA 2VUMJ 4C3HJ 1TWFJ 1P7IA 4AYBN 3MN2A 3CCYA 2K9SA 5FKKA 3TW7A 4DYQA 3C2BA 4QSHA 5FKNA 3ZQFA 1FEXA 3HOUJ 3M3YJ 3FK7A 4DZPA 1DU0A 3K7AJ 2Y30A 2VKEA 1IJWC 2XGEA 5GPAA 3JRFA 1ZKGA 1JUSA 2R0QC 1OCTC 3BR6A 1QVTA 2FJ1A 5J1UA 3CDLA 3BR3A 4A3DJ 1Z77A 2L0KA 5C4JJ 1ZR2A 1WI3A 4DW6A 3BG3A 1FTTA 2HYJA 2EZIA 2DN0A 2XPWA 4Y52J 1VF9A 3RQIA 1MBFA 3MKLA 1H8AC 3GTQJ 1TC3C 2MGQA 1VFCA 5J3LA 4FCYA 3BTIA 2B63J 2ECBA 1HOMA 5EEAA 3A02A 1LE8B 2E1OA 4RBOA 2VPRA 1GT0C 5IPAA 2NS8A 5C4XJ 5FKLA 2O7OA 2NOGA 3SJMA 2NVYJ 3G1MA 2DMQA 3ZQLA 1DU6A 1BL0A 1MSFC 4B1RA 3BTJA 3JREA 1JT0A 1ETYA 4IEJA 1GDTA 2LD5A 5E3NA 3H3VK 4D5CA 3S16J 4B4CA 4X1EA 4MIMA 3HGYA 3BTLA 4M6VA 1JUMA 2KT0A 1IRZA 3A03A 4BY7J 3ZQIA 1ZTRA 2DA7A 5C44J 1K61A 2Y0SN 1UMQA 4MFEA 4A3EJ 5M3FJ 3IH3A 1U9NA 3TP0A 2JA7J 1ETQA 2LK2A 4DYRA 1LE8A 1GUUA 1CQTA 3ZQGA 4IHXA 4I76A 1RKWA 4XRMA 2VI6A 4MFDA 1U8BA 2FX0A 3LSRA 1ZK8A 4FTHA 2PMZN 2LLKA 2CJJA 3GTMJ 1FIAA 3BR2A 1NTCA 2O8KA 2TCTA 2JMWA 3E7LA 1F36A 1IDZA 5EF6A 5F0CA 1ZGWA 1E3OC 2XPVA 3BG9A 4A3GJ 2JA5J 5IYCJ 4JX6A 2M2EA 3G1OA 3I4MJ 1RESA 2JN6A 3HB9A 1WH5A 2QF7A 1TWAJ 2LR8A 2XSDC 2EZLA 3B6AA 2VKVA 4A3KJ 2IBDA 3S15J 5E3MA 1XS9A 1PUFB 4MLOA 1VNDA 4FISA 4AUXA 2DMTA 3GTKJ 3GBGA 5IP6A 2DA3A 1Q1VA 1O4XA 1R9TJ 2KDZA 1I50J 3O8HA 1MBJA 3DEWA 3LSGA 3G1LA 1JJ6C 1NK3P 3M4OJ 1OJLA 1ETVA 1SFOJ 1ETKA 4XIDA 1A5JA 1APLC 3PO2J 3BT9A 1BA5A 2COBA 2R93J 4A3LJ 3BQYA 2MG4A 4DZJA 4DYCA 2Y9YA 4B3AA 2DA4A 5M5XJ 2MSYA 3B6CA 3FK6A 2JA8J 3HOYJ 2YU9J 1ITYA 3HOXJ 4W97A 2ELKA 4UUTA 4XICA 4A93J 1ORKA 2DA6A 4BKXA 4BBSJ 2OF7A 1PUFA 1QRYA 3JRBA 4V2FA 3TW6A 4CYCB 2K9QA 4BY1J 5K7HA 5M5YJ 3S1MJ 2DMUA 3BTCA 5EYRA 1ZQ3P 3GTJJ 2D5VA 4XRSA 1JKQC 3SDGA 1IG7A 2H1KA 1ZR4A 3O8GA 2Y9ZA 5IP7J 4UUSB 5F27A 1FTZA 2JWTA 4A3CJ 1XG1A 1U78A 2NVTJ 2XB0X 1GVDA 3A01B 2LTPA 3PM1A 1I6HJ 1X2MA 5EDNA 1BW5A 1JUPA 2R92J 1UHSA 2DTZA 2LP0A 1JGGA 4S0HB 2L7MP 2P81A 1HF0A 4Y7NJ 4JX4A 4JYKA 3QQAA 2YS9A 3DCFA 4A3MJ 4GFBA 3GTGJ 1K83J 2LVSA 3RKQA 2CRGA 4C2MJ 3HM5A 3NARA 3WHCA 3QPSA 2MW8A 2HOSA 2NVXJ 2HOAA 3HGGA 1QPIA 4CYCA 1TWCJ 4IHVA 2EZHA 1NK2P 2M8GX 3LOCA 2ID3A 1ENHA 2CQQA 3MVPA 2AHQA 2M0CA 4XRSG 4UUSA 2JJ7A 1MBEA 3LSJA 2H8RA 3S2HJ 2JK3A 3A01A 2L7ZA 2X9DA 1ETOA 2WAQN 3S1NJ 1X2NA 4G12A 1GV2A 1HLVA 3I4NJ 3L1PA 5EZHA 5M3MJ 3JRIA 2W48A 1SANA 2CU7A 1RPWA 2ECCA 1XC5A 2X48A 4M3FA 2JA6J 4C3JJ 2XGDA 5J1RA 4A3JJ 2HQ5A 4XK4A 5F1JA 2CUFA 3OIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGN A;  5HOD A;  4JX5 A;  3UKG A;  3JR9 A;  3HOV J;  1MH4 A;  2CUE A;  3OOU A;  2ME6 A;  2M9H A;  3TED A;  3GTL J;  1FIP A;  3OSG A;  2Y31 A;  3VPR A;  3FIW A;  3S1Q J;  1B72 B;  3Q3S A;  2XGC A;  1P7J A;  3IH4 A;  4D5F A;  2K9N A;  3FIS A;  5FJ8 J;  4X6A J;  1BW6 A;  2DA1 A;  2ID6 A;  5C3E J;  2E2I J;  2L7F P;  5JLW A;  3JRG A;  4A69 C;  2XB5 A;  3JRH A;  3HEF A;  4BBR J;  4M3D A;  1D5Y A;  5DS9 A;  2O9L A;  2E2H J;  4IHW A;  1GV5 A;  3HBL A;  3ZOB A;  1YRN B;  1JKP C;  1RR7 A;  1Z0X A;  5IOZ A;  3S17 J;  1IV6 A;  5EGO B;  3OSF A;  5IP9 J;  1QVU A;  5IOY A;  2DMN A;  4FE7 A;  1HDD C;  4A3F J;  3GTP J;  4A3B J;  3D1N I;  1B72 A;  2R5Z B;  2FQ4 A;  1MBG A;  5EZG A;  4V2G A;  1H89 C;  1ETW A;  4C3I J;  5F08 A;  1MH3 A;  4QTR A;  2FD5 A;  1I3Q J;  2CQX A;  2I10 A;  1S7E A;  3Q0W A;  1X58 A;  2HXO A;  3ZQC A;  1JTX A;  5K7Z A;  2EBI A;  3HDD A;  4QIW N;  1AU7 A;  1T33 A;  3S1R J;  4JP0 A;  3HOW J;  3BQZ A;  5J1Y A;  3F0C A;  5IYD J;  2LY9 A;  2LFB A;  3GTO J;  1MBH A;  1IUF A;  1YRN A;  2QCO A;  2HDD A;  1VI0 A;  5EGO A;  4J19 A;  3TP3 A;  4D7N A;  5EG0 B;  1TWG J;  4AC0 A;  2DMP A;  3HOZ J;  2M34 A;  2LKX A;  1IC8 A;  1Y1V J;  4FE4 A;  4M3G A;  2R5Z A;  5F0F A;  5BNG A;  2TRT A;  2ME0 A;  1IDY A;  5GP9 A;  3S2D J;  4IHY A;  1JKO C;  5IYB J;  1HCR A;  3BG5 A;  2E19 A;  3ZQH A;  1EF4 A;  1T56 A;  2IAI A;  5JLX A;  5GPC A;  2IEK A;  3CMY A;  5FLV A;  1OCP A;  1BJZ A;  3Q0V A;  1F43 A;  1OFC X;  1WH7 A;  2XPU A;  3BR0 A;  5E3O A;  1AKH B;  1RKT A;  2DA5 A;  2ZB9 A;  4M3E A;  1H88 C;  1AHD P;  2NS7 A;  1B8I B;  1W0T A;  3RZO J;  4L5E A;  2N8G A;  2NVQ J;  3PO3 J;  5EG0 A;  3FKI J;  4W1U A;  3Q0U A;  5FKO A;  3LNQ A;  2HI3 A;  3CQZ J;  4M3B A;  4BXX J;  1FJL A;  2E2J J;  3LSP A;  2XRL A;  2R5Y B;  3BR1 A;  4RDU A;  4NDL A;  2R7Z J;  1RET A;  2EQR A;  2YUS A;  3HKZ N;  1LFB A;  2EH3 A;  2Y2Z A;  3JRD A;  3H0G J;  1WGX A;  2OPT A;  1JKR C;  2GM4 A;  2X6O A;  3SFI A;  4A3I J;  2GBY A;  3QPL A;  3K2A A;  9ANT A;  2DA2 A;  3NAU A;  5FLM J;  3S14 J;  3W6V A;  1JJ8 C;  1WCM J;  3IH2 A;  1AKH A;  2WB1 N;  1JT6 A;  2G0E A;  5FKM A;  2K40 A;  4ABZ A;  1B8I A;  1MSE C;  5K7F A;  1WPK A;  1LFU P;  3JRA A;  1MNM C;  3BR5 A;  4EEF G;  3IV5 A;  5F04 A;  2HOT A;  1U9O A;  5M5W J;  4I6Z A;  4MO7 A;  1Y1W J;  1TWH J;  5F0H A;  1W0U A;  4HNV A;  3WHB A;  2R5Y A;  2AO9 A;  5E3L A;  1JTY A;  1HDP A;  1G2H A;  3RZD J;  4D7M A;  2GLO A;  2WV1 A;  3JRC A;  2L9R A;  5DTD A;  1UG2 A;  1ETX A;  2RAE A;  1MBK A;  2EZK A;  2DJN A;  1POG A;  2HXI A;  4LOC A;  1A6I A;  2VUM J;  4C3H J;  1TWF J;  1P7I A;  4AYB N;  3MN2 A;  3CCY A;  2K9S A;  5FKK A;  3TW7 A;  4DYQ A;  3C2B A;  4QSH A;  5FKN A;  3ZQF A;  1FEX A;  3HOU J;  3M3Y J;  3FK7 A;  4DZP A;  1DU0 A;  3K7A J;  2Y30 A;  2VKE A;  1IJW C;  2XGE A;  5GPA A;  3JRF A;  1ZKG A;  1JUS A;  2R0Q C;  1OCT C;  3BR6 A;  1QVT A;  2FJ1 A;  5J1U A;  3CDL A;  3BR3 A;  4A3D J;  1Z77 A;  2L0K A;  5C4J J;  1ZR2 A;  1WI3 A;  4DW6 A;  3BG3 A;  1FTT A;  2HYJ A;  2EZI A;  2DN0 A;  2XPW A;  4Y52 J;  1VF9 A;  3RQI A;  1MBF A;  3MKL A;  1H8A C;  3GTQ J;  1TC3 C;  2MGQ A;  1VFC A;  5J3L A;  4FCY A;  3BTI A;  2B63 J;  2ECB A;  1HOM A;  5EEA A;  3A02 A;  1LE8 B;  2E1O A;  4RBO A;  2VPR A;  1GT0 C;  5IPA A;  2NS8 A;  5C4X J;  5FKL A;  2O7O A;  2NOG A;  3SJM A;  2NVY J;  3G1M A;  2DMQ A;  3ZQL A;  1DU6 A;  1BL0 A;  1MSF C;  4B1R A;  3BTJ A;  3JRE A;  1JT0 A;  1ETY A;  4IEJ A;  1GDT A;  2LD5 A;  5E3N A;  3H3V K;  4D5C A;  3S16 J;  4B4C A;  4X1E A;  4MIM A;  3HGY A;  3BTL A;  4M6V A;  1JUM A;  2KT0 A;  1IRZ A;  3A03 A;  4BY7 J;  3ZQI A;  1ZTR A;  2DA7 A;  5C44 J;  1K61 A;  2Y0S N;  1UMQ A;  4MFE A;  4A3E J;  5M3F J;  3IH3 A;  1U9N A;  3TP0 A;  2JA7 J;  1ETQ A;  2LK2 A;  4DYR A;  1LE8 A;  1GUU A;  1CQT A;  3ZQG A;  4IHX A;  4I76 A;  1RKW A;  4XRM A;  2VI6 A;  4MFD A;  1U8B A;  2FX0 A;  3LSR A;  1ZK8 A;  4FTH A;  2PMZ N;  2LLK A;  2CJJ A;  3GTM J;  1FIA A;  3BR2 A;  1NTC A;  2O8K A;  2TCT A;  2JMW A;  3E7L A;  1F36 A;  1IDZ A;  5EF6 A;  5F0C A;  1ZGW A;  1E3O C;  2XPV A;  3BG9 A;  4A3G J;  2JA5 J;  5IYC J;  4JX6 A;  2M2E A;  3G1O A;  3I4M J;  1RES A;  2JN6 A;  3HB9 A;  1WH5 A;  2QF7 A;  1TWA J;  2LR8 A;  2XSD C;  2EZL A;  3B6A A;  2VKV A;  4A3K J;  2IBD A;  3S15 J;  5E3M A;  1XS9 A;  1PUF B;  4MLO A;  1VND A;  4FIS A;  4AUX A;  2DMT A;  3GTK J;  3GBG A;  5IP6 A;  2DA3 A;  1Q1V A;  1O4X A;  1R9T J;  2KDZ A;  1I50 J;  3O8H A;  1MBJ A;  3DEW A;  3LSG A;  3G1L A;  1JJ6 C;  1NK3 P;  3M4O J;  1OJL A;  1ETV A;  1SFO J;  1ETK A;  4XID A;  1A5J A;  1APL C;  3PO2 J;  3BT9 A;  1BA5 A;  2COB A;  2R93 J;  4A3L J;  3BQY A;  2MG4 A;  4DZJ A;  4DYC A;  2Y9Y A;  4B3A A;  2DA4 A;  5M5X J;  2MSY A;  3B6C A;  3FK6 A;  2JA8 J;  3HOY J;  2YU9 J;  1ITY A;  3HOX J;  4W97 A;  2ELK A;  4UUT A;  4XIC A;  4A93 J;  1ORK A;  2DA6 A;  4BKX A;  4BBS J;  2OF7 A;  1PUF A;  1QRY A;  3JRB A;  4V2F A;  3TW6 A;  4CYC B;  2K9Q A;  4BY1 J;  5K7H A;  5M5Y J;  3S1M J;  2DMU A;  3BTC A;  5EYR A;  1ZQ3 P;  3GTJ J;  2D5V A;  4XRS A;  1JKQ C;  3SDG A;  1IG7 A;  2H1K A;  1ZR4 A;  3O8G A;  2Y9Z A;  5IP7 J;  4UUS B;  5F27 A;  1FTZ A;  2JWT A;  4A3C J;  1XG1 A;  1U78 A;  2NVT J;  2XB0 X;  1GVD A;  3A01 B;  2LTP A;  3PM1 A;  1I6H J;  1X2M A;  5EDN A;  1BW5 A;  1JUP A;  2R92 J;  1UHS A;  2DTZ A;  2LP0 A;  1JGG A;  4S0H B;  2L7M P;  2P81 A;  1HF0 A;  4Y7N J;  4JX4 A;  4JYK A;  3QQA A;  2YS9 A;  3DCF A;  4A3M J;  4GFB A;  3GTG J;  1K83 J;  2LVS A;  3RKQ A;  2CRG A;  4C2M J;  3HM5 A;  3NAR A;  3WHC A;  3QPS A;  2MW8 A;  2HOS A;  2NVX J;  2HOA A;  3HGG A;  1QPI A;  4CYC A;  1TWC J;  4IHV A;  2EZH A;  1NK2 P;  2M8G X;  3LOC A;  2ID3 A;  1ENH A;  2CQQ A;  3MVP A;  2AHQ A;  2M0C A;  4XRS G;  4UUS A;  2JJ7 A;  1MBE A;  3LSJ A;  2H8R A;  3S2H J;  2JK3 A;  3A01 A;  2L7Z A;  2X9D A;  1ETO A;  2WAQ N;  3S1N J;  1X2N A;  4G12 A;  1GV2 A;  1HLV A;  3I4N J;  3L1P A;  5EZH A;  5M3M J;  3JRI A;  2W48 A;  1SAN A;  2CU7 A;  1RPW A;  2ECC A;  1XC5 A;  2X48 A;  4M3F A;  2JA6 J;  4C3J J;  2XGD A;  5J1R A;  4A3J J;  2HQ5 A;  4XK4 A;  5F1J A;  2CUF A;  3OIO A; 
#chains in the Genus database with same CATH topology
 2MLG A;  3UKG A;  3DBR B;  4WXH A;  1I1S A;  1MH4 A;  4BEH B;  2CO5 A;  3K0L A;  2VAS A;  4M9S A;  1NG6 A;  2Y31 A;  3D5R C;  3VPR A;  3FIW A;  4JOM A;  1B72 B;  3Q3S A;  1WFX A;  2ZC2 A;  1XSV A;  1DPR A;  3M7G A;  1LJ9 A;  1VQ4 I;  2CV2 A;  1MJB A;  2K9N A;  3BJO A;  3FIS A;  4X6A J;  1XCV A;  2F48 A;  4IKF A;  4P96 A;  4BDZ A;  4ZYH A;  4IZZ A;  2DFH A;  4HX4 A;  3ZPL A;  2VJJ A;  3I3L A;  3JRG A;  1IZ1 A;  1K4S A;  3LAP A;  2XB5 A;  2XV4 S;  3FXU A;  5E79 C;  3JRH A;  1SC7 A;  4HF2 A;  4BBR J;  5GAE J;  4BQO A;  1D5Y A;  1Y8R B;  2O9L A;  2E2H J;  2VOP A;  3ASN H;  1GV5 A;  4XLH A;  1K79 A;  1RIO H;  3HBL A;  4HSR A;  3ZOB A;  3KZI C;  3BRO A;  1VQO I;  1NG7 A;  2AQE A;  4MQ9 F;  4WWC A;  4BUP A;  5IP9 J;  4U7B A;  1QVU A;  3PUF A;  4FE7 A;  3ZCO A;  1FLI A;  1YX5 A;  4A3B J;  3HSE A;  3D1N I;  1PJR A;  4R79 A;  1MBG A;  3M07 A;  4C3I J;  2L7K A;  2DFF A;  3CC7 I;  3S3O A;  1LVA A;  5FO5 A;  1ZH5 A;  4LB5 A;  2CQX A;  1SD6 A;  2VBZ A;  3ZQQ A;  2OAZ A;  2AXL A;  1WJF A;  4NQW A;  5K7Z A;  4PFP A;  1Z6R A;  2EBI A;  3MD2 A;  4XRF A;  1YS6 A;  1MIJ A;  2A68 F;  4GCV A;  4WF2 A;  4BJ6 C;  1J0R A;  3BJ6 A;  3OR1 C;  1WJ5 A;  1Z05 A;  2PQ8 A;  3CZ6 A;  3FF5 A;  4M73 A;  2PG4 A;  2BHY A;  2XDV A;  2LY9 A;  3FMQ A;  3HHG A;  2LFB A;  3GZ5 A;  4B09 A;  3VWB A;  2HTS A;  4E6K G;  5FRN A;  4KN4 X;  2V6C A;  1BI2 A;  4Y3O A;  3WTZ A;  2IVM A;  2QCO A;  2HDD A;  4XR6 A;  4J19 A;  3O3K A;  2BVM A;  1YFH A;  1FOK A;  3WOD F;  2DMP A;  3HOZ J;  2LKX A;  4M71 A;  5K1Y A;  3L2C A;  2WAD A;  2FML A;  2JRT A;  5J4V A;  2NNY A;  1E17 A;  4MNU A;  3MWM A;  1IDY A;  5GP9 A;  1IUY A;  3DBL B;  1XGN A;  3I5U A;  4IHY A;  3MCZ A;  3EUH A;  3I4P A;  5IYB J;  1JKO C;  2HKX A;  3BG5 A;  2DTR A;  1EF4 A;  1GXQ A;  1S29 A;  2OJE D;  2IGO A;  1OCP A;  1BJZ A;  2QEX I;  2XGX A;  3HTS B;  5L3C A;  1SFU A;  4A0Y A;  2BYV E;  3D5L A;  4BE2 A;  2DA5 A;  2STW A;  4HLY A;  2WBM A;  5JHF A;  3CP2 A;  2DQL A;  2XIG A;  4GXO A;  3WTX C;  1W0T A;  4UNO A;  2N8G A;  2KJC A;  2NVQ J;  2LH9 A;  1SMY F;  2BY2 A;  4W1U A;  3UNG C;  3CJT B;  5FKO A;  3LNQ A;  4PSX A;  2HI3 A;  2BY0 A;  2J5O A;  4P1W A;  5E1W A;  4C30 A;  2HYG D;  2RC4 A;  1EH6 A;  4CCL A;  2K7L A;  4KMF A;  2A6E F;  3DTI A;  4KIT B;  1YG2 A;  5H20 A;  3EYY A;  4HAM A;  1RET A;  2EQR A;  1LFB A;  2DOD A;  5L3E A;  2Y2Z A;  3JRD A;  3REO A;  4ZJZ A;  3IWZ A;  2V9K A;  3K2Z A;  1R5I D;  3C3W A;  3SFI A;  2V26 A;  3K2A A;  4A0Z A;  4XLE A;  4GYI A;  3NAU A;  3HL2 A;  2H94 A;  3S14 J;  5HVQ C;  1JJ8 C;  4RAG A;  2EFQ A;  1R00 A;  3IH2 A;  2WB1 N;  1Z67 A;  4F7Z A;  4MTE A;  4HST A;  4JK1 X;  1LFU P;  3S3N A;  3BR5 A;  2WV0 A;  1IV8 A;  2XVC A;  1V54 H;  1ZG5 A;  3ZN1 A;  4KIF A;  1T0F C;  1TWH J;  2MH9 A;  3CMA I;  3ESW B;  3IHU A;  4ETS A;  1G2H A;  1N77 A;  3RZD J;  2XUB A;  2VXD A;  2HZT A;  3NWT A;  2WV1 A;  1UG2 A;  1ETX A;  3LSH A;  4Q48 A;  5ICF A;  2EZK A;  2K3P A;  2VXZ A;  1VQL I;  2DJN A;  1DGR M;  1YOV B;  1POG A;  3BC8 A;  4LOC A;  2KIS A;  1A6I A;  4C3H J;  3VYT B;  1MNE A;  3QP5 A;  2P7C B;  2HOE A;  3OYF A;  2K9S A;  5FKK A;  3JSO A;  1BJA A;  3E3V A;  4N0B A;  1DP3 A;  3C2B A;  3DQV C;  1Z1D A;  2E1C A;  3NWS A;  3E6D A;  4Y13 A;  1QQI A;  2BZT A;  2LBF A;  4Y33 A;  3U1D A;  4DZP A;  3BOQ A;  5B1B H;  3MEX A;  1UHW A;  1KU9 A;  1ZKG A;  4KJZ A;  2VE8 A;  3I64 A;  2L01 A;  4KT5 C;  3BR6 A;  4KFC A;  3ABU A;  3V8J A;  5FFX A;  3OL4 A;  1XSX A;  5BS6 A;  5LGU A;  4FT8 A;  4QLC U;  2L4M A;  1FTT A;  2HQA A;  2V1U A;  1HW2 A;  2HVQ A;  1XX5 A;  3TGN A;  3MKL A;  2DT7 B;  3GFJ A;  1TC3 C;  2MGQ A;  3A0H C;  2PJR A;  4NB5 A;  2G7U A;  2QKL B;  4FCY A;  3FHZ A;  1E0E A;  3PFI A;  2BBY A;  3ECH A;  1ONV A;  1R4M B;  3A02 A;  2QQ8 A;  1R5H A;  2FNA A;  2UV1 A;  4L5I A;  1WJC A;  1GT0 C;  1MKM A;  2F4I A;  2NS8 A;  4B47 A;  3OV8 A;  2NOG A;  2H1L A;  3SJM A;  2RNG A;  3GFI A;  2CSO A;  1J75 A;  2BE5 F;  1RR8 C;  3RKX A;  2LMD A;  1MSF C;  3HOS A;  4XL9 A;  2Q2E A;  4B1R A;  1V3F A;  1S9H A;  4AWX B;  4P9U A;  3OS2 A;  2Q1Z B;  5CJ9 A;  4DQ2 A;  4IEJ A;  5AIP A;  4B3X A;  4LGW A;  4HV6 A;  3H3V K;  1BR2 A;  4B4C A;  1AA7 A;  1SD5 A;  3LMM A;  4AD9 A;  4UVC A;  1S5L C;  4HPQ A;  5LHI A;  4CHU A;  3OY9 A;  3AAF A;  1W5S A;  1D3Y A;  4UV8 A;  3G71 I;  3A03 A;  3KEY A;  2C6Y A;  2GXG A;  3CCQ I;  2QSG X;  2PEX A;  2ADU A;  1K61 A;  3J80 Z;  1UMQ A;  1N25 A;  1OIS A;  3IH3 A;  4GGG A;  1D0Y A;  3TP0 A;  3PIP F;  2JA7 J;  1CQT A;  4MEX F;  3ZQG A;  5L3D A;  1Q1H A;  5DYM A;  1XMX A;  3ROU A;  1RKW A;  4XRM A;  2M87 A;  4XMY A;  3L7W A;  5ILU A;  1SMT A;  3FBN B;  2K9L A;  1B9N A;  1WQ2 A;  3IP4 B;  1QBJ A;  2QQB A;  3GYH X;  1FIA A;  2F5E A;  1MGT A;  2O8K A;  2ZJR F;  4AIJ A;  4E7S A;  2JMW A;  2DBB A;  3E7L A;  1XDS A;  1GLN A;  4OOI A;  5H2F C;  5EF6 A;  2XPV A;  4ZYD A;  3GW2 A;  2ZFU A;  2FBK A;  4K2E A;  2JA5 J;  4LIU A;  2HKO A;  3K69 A;  5D8K B;  3F8N A;  4OWR B;  2M7A A;  2QM3 A;  2QF7 A;  2K85 A;  2DPD A;  1O3T A;  1TWA J;  2GOX B;  1V5G A;  2A5W A;  4A3K J;  2I5U A;  1NHA A;  5GTH C;  3DEE A;  4MLO A;  3L9F A;  3RCO A;  4ITV A;  4I02 A;  1O3Q A;  5IP6 A;  2DA3 A;  3DWL E;  3DU5 A;  4PJJ A;  1Z7L A;  4EJO A;  1CF7 B;  5CPR B;  5JR3 A;  3F3X A;  3EQL F;  1X1C A;  2H8W A;  2QLZ A;  3HUG A;  3V4G A;  2KRH A;  4CCN A;  5A2Q K;  2HU9 A;  5AIQ A;  1ACI A;  1TW3 A;  4UB8 C;  2MD0 A;  3BT9 A;  3DPU A;  2IT0 A;  2F4M B;  2OCE A;  4EM0 B;  2ZBK A;  2Y9Y A;  3H3Z A;  2FF4 A;  1IXC A;  2P5L C;  1T8I A;  5ICC A;  3R6S A;  3FK6 A;  3IUO A;  1RI7 A;  2ZXH A;  2FBH A;  2IPQ X;  3HOX J;  1X3U A;  2ELK A;  1ORK A;  3CCV I;  1P2F A;  3FXM A;  1PUF A;  2R7V A;  1BBY A;  4II3 A;  3B02 A;  4V2F A;  4ZH4 F;  4F92 B;  2FRH A;  1S72 I;  3R60 A;  3RYR A;  2E34 A;  1HKT A;  2DMU A;  2D5V A;  3OIQ A;  1Z3Y A;  1LKX A;  3BZK A;  1X1B A;  1ZLJ A;  3SDG A;  4QPO A;  1ERD A;  1IG7 A;  2MA3 A;  1ZR4 A;  2H1K A;  3CCE I;  5F27 A;  1R1U A;  1WJA A;  3ERM A;  2NVT J;  2MD5 A;  1Y39 A;  2XB0 X;  1MJA A;  3VYS B;  2CH0 A;  4U0W A;  3PM1 A;  1O7L A;  1YI2 I;  1X2M A;  1YQA A;  4L18 B;  1JUP A;  1X3Z B;  4N4O B;  2LP0 A;  1MZB A;  4S0H B;  2L7M P;  3KIO A;  3OYA A;  5ICG A;  1R58 A;  3U1K A;  1DUX C;  4L0Y B;  2VE9 A;  4JYK A;  4EVI A;  3GTG J;  2DLL A;  4AM3 A;  4HX7 A;  3VOE A;  2CRG A;  3DPL C;  1MMD A;  2CWE A;  3NAR A;  2MFZ A;  2HOS A;  3E6B A;  3OYE A;  2W82 A;  3L2V A;  1R1T A;  1VQ9 I;  4AYB A;  2IGN A;  3T1B A;  4BNC A;  5KK1 A;  3BCB A;  1IRX A;  2EV6 A;  2EWN A;  2CMP A;  3OYL A;  3JAM K;  3LOC A;  2ID3 A;  1U5T C;  4XKV A;  2RVC A;  2PBI A;  4BQQ A;  2CQQ A;  3MVP A;  3TO9 A;  3CUQ C;  4XRS G;  1VQK I;  4EMS A;  2RV8 A;  1U0J A;  3FXQ A;  1IAW A;  1MBE A;  2DK8 A;  2HGC A;  2L9V A;  2L7Z A;  1JHH A;  3V7C A;  1W7P B;  3EPZ A;  4ENK A;  3L1P A;  3I59 B;  5EZH A;  5M3M J;  1XD7 A;  1WWX A;  3G2B A;  4BHB A;  1XC5 A;  5JVT A;  3WU2 C;  1UHM A;  3K70 C;  4A3J J;  1R5G A;  2Z33 A;  1IW7 F;  4ZDL A;  4PJM A;  2XRO A;  2BW3 B;  4XK4 A;  5F1J A;  2ZJQ F;  1BI1 A;  3SZG A;  2OD5 A;  4JX5 A;  1K78 A;  4RAZ A;  3TED A;  2CUE A;  3OOU A;  2ME6 A;  2CGP A;  2GIV A;  2NS0 A;  2A07 F;  3S1Q J;  1YS7 A;  2QYO A;  3RI4 A;  1F5T A;  4L9N A;  4A6E A;  3BPX A;  3BZC A;  4CDG A;  2X1D A;  4E7L A;  1OR7 A;  1FBQ A;  2ID6 A;  5DV5 A;  5C3E J;  2CV1 A;  1XB4 A;  3AL0 C;  3K4C A;  3F22 A;  3TQN A;  4E7I A;  5LD2 C;  5CVU A;  3RJP A;  3OYK A;  5BPI A;  4XOR A;  1DQU A;  3AG4 H;  4F52 A;  2VB6 A;  3B73 A;  4A2U A;  3H9G A;  3LQR A;  4NC7 A;  5KCM A;  1JKP C;  3Q9S A;  2QBY B;  4II2 A;  4L9T A;  5E1X A;  1VQM I;  2Y75 A;  3BP8 A;  4XN0 A;  4BEH A;  2DMN A;  3GX4 X;  1GVJ A;  3M8F A;  2FUG 2;  1B72 A;  2R5Z B;  2R7X A;  5EZG A;  1ETW A;  1VZ0 A;  3FHN A;  1T39 A;  3F8F A;  2FD5 A;  1BM9 A;  2I10 A;  4N9H A;  1PP8 F;  2KDO A;  3Q0W A;  2HXO A;  3H35 A;  1AU7 A;  2L9N A;  3V42 A;  1EA3 A;  1T33 A;  5FB2 A;  2HEO A;  1LFP A;  2R7S A;  2IW5 A;  3HRM A;  2K9M A;  3GME A;  3K4K A;  5J1Y A;  2OUM A;  4D0P A;  3F0C A;  5IYD J;  2LC2 A;  2EFP A;  3GTO J;  4PGG A;  2B0L A;  4GDF A;  1IUF A;  4C9Y A;  3WGG A;  4RM2 A;  4G7Z F;  1O3R A;  3H5R A;  3HRT A;  2F6C A;  4H0E A;  1VI0 A;  5EG0 B;  2XF7 A;  4AC0 A;  1IC8 A;  2EA4 A;  4FE4 A;  2E36 A;  2VBY A;  1VQN I;  2QQA A;  1KYZ A;  2EJR A;  4AID A;  2ZNZ A;  3W3C A;  2HDW A;  1R4N B;  2ME0 A;  2ACJ A;  2D45 A;  4EAT A;  5DM6 F;  1IXR C;  2VN2 A;  1HCR A;  3GZN B;  1GHC A;  2KKO A;  2LKS A;  2Y69 H;  2IAI A;  5JLX A;  5DM7 F;  1QHG A;  2LG4 A;  3CMY A;  2STT A;  1TQI A;  3IC7 A;  2XPU A;  1FWZ A;  5E3O A;  3GEZ A;  3GWZ A;  2VIX A;  4GO1 A;  2P5V A;  2ZB9 A;  1NH3 A;  4XKB A;  3RZO J;  5FRM A;  2M3A A;  1G3T A;  1KZH A;  1TTY A;  3PO3 J;  1I3A A;  2QUF A;  4RGS A;  3FKI J;  2M5W A;  5HS8 A;  1ZG1 A;  1BN5 A;  3BPV A;  1RZ4 A;  3CQZ J;  4UB6 C;  2VJI A;  2A61 A;  1V55 H;  4IOA F;  2R7D A;  3HTU A;  2KP6 A;  2R5Y B;  2H6C A;  3BR1 A;  5DD8 A;  3EYI A;  5D6E A;  3CCL I;  2RQP A;  2IJL A;  3W6K B;  5LRS A;  3TO7 A;  4G7O F;  3LSK A;  3CES A;  2DQR A;  1QZZ A;  1WGX A;  5GAD J;  2HVR A;  2PMH A;  4A3I J;  3VSL A;  1TT0 A;  4BDY A;  1K6Y A;  4IVN A;  4QWQ A;  1RRJ A;  1MDM B;  2A3S A;  4LLL A;  2W1O A;  1VQ5 I;  1T0F A;  3W6V A;  3VSK A;  2YX7 A;  2MBF A;  1OMI A;  1S6L A;  1ZRC A;  3KYD B;  5FKM A;  2K40 A;  4ABZ A;  2YU3 A;  3HG9 A;  4B48 A;  5K7F A;  3D5S C;  5J4Y A;  3D0S A;  4EEF G;  4BH9 A;  2O0Y A;  3MZY A;  4G9Y A;  3TKY A;  4IL6 C;  1J5Y A;  4PUS A;  2RGV A;  1Z21 A;  5M5W J;  2VQG A;  4IOC F;  4A5M A;  5EEH A;  1PUE E;  4HNV A;  3ZMS A;  4D7M A;  2BXY A;  3JRC A;  4IHS A;  2GZW A;  2MYS A;  1QA6 A;  2WAQ A;  2VUM J;  4HBL A;  2XC7 A;  4LJZ F;  2W85 A;  2HFH A;  3MN2 A;  4ZDO A;  2OV7 A;  1O7F A;  1RNL A;  3JCU C;  2MAB A;  2WA0 A;  3ZQF A;  3IRQ A;  3EUA A;  4HV5 A;  2V1X A;  1A35 A;  3P7N A;  1KA8 A;  1FYM A;  3K7A J;  2VKE A;  1IJW C;  1IN4 A;  4BS9 A;  3C2G A;  3PNY A;  3K1P A;  3VYU B;  5GPA A;  5HLT A;  4M9X A;  3JRF A;  2VL8 A;  2F5F A;  2KIM A;  2OU2 A;  3A2K A;  1S8N A;  3KP4 A;  4ZTJ A;  3LWF A;  3WTT C;  2R0Q C;  1OCT C;  1QVT A;  3FXR A;  5J1U A;  4S05 A;  3BR3 A;  5FLX Z;  2FOK A;  1W1W E;  4XLA A;  2L0K A;  2Z3Y A;  3S8P A;  1TZL A;  2XSJ C;  5C4J J;  4KIC A;  2IS2 A;  3BG3 A;  2ZO4 A;  1XGS A;  4IQJ A;  1FMW A;  2V1D A;  1FC3 A;  3RQI A;  2FSW A;  4XNF A;  1R6R A;  5ICE A;  3HXL A;  3HJE A;  2XAS A;  2GAU A;  4U0V A;  5EEA A;  4C2T A;  2FOW A;  1YW9 A;  4PDK A;  3P9I A;  1LE8 B;  2E1O A;  2VQC A;  2VPR A;  4RBO A;  5IPA A;  5FKL A;  2XAG A;  4UV9 A;  4B8X A;  1D5V A;  2VBX A;  3LSI A;  1F4K A;  4CO8 A;  5HNH A;  2UXN A;  1BL0 A;  1R7J A;  1JE8 A;  1LPQ A;  1TT5 B;  3OYH A;  4IF4 A;  3BTJ A;  3JRE A;  4EV0 A;  1F1Z A;  1GDT A;  5E3N A;  3N4M A;  4BE1 A;  2X6X A;  1YJ9 I;  1FP1 D;  2VQL A;  5ILV A;  2KIQ A;  4KIG A;  4X1E A;  3MZ8 A;  4MIM A;  3GXO A;  3JTG A;  3KPH A;  5B5E C;  4M6V A;  1JUM A;  4CCM A;  1TBX A;  2FE3 A;  2KT0 A;  2OQR A;  2R7F A;  2LOO A;  3RYP A;  5CVV A;  3S93 A;  1FZP B;  2Y0S N;  4ESJ A;  4A3E J;  3C2H A;  3K10 A;  3ZRG A;  5DEQ A;  4BE0 A;  1LEB A;  2EB7 A;  3F8M A;  2Q8K A;  5DCM B;  1OLT A;  4CUG A;  1YIT I;  4MFD A;  4RB2 C;  3TO6 A;  3FMS A;  2FBI A;  2P6S A;  3UR3 C;  2DAO A;  2FX0 A;  3HSR A;  4HX8 A;  2Z16 A;  5HDG A;  2PMZ N;  2JVH A;  2VJ4 A;  4Z6Y A;  2CJJ A;  3SDB A;  3BR2 A;  4MEY F;  2OQG A;  4M72 A;  5H6R A;  2TCT A;  4NHJ A;  1MMS A;  1F36 A;  4U0Y A;  5D5V B;  5F0C A;  1JXS A;  3BG9 A;  4HG2 A;  3VOD A;  3QPH A;  4JQF A;  4A3G J;  1Y0N A;  5KVR A;  3G1O A;  3LA2 A;  3MMY B;  2YR2 A;  3KE2 A;  1FSH A;  2EIJ H;  1WH5 A;  3A1Y A;  5DD4 A;  2LR8 A;  2XSD C;  2EZL A;  1DPU A;  2K02 A;  3B6A A;  1JI8 A;  3GCM A;  4HZF A;  3K6G A;  2GA2 A;  3L2Q A;  1VND A;  2XRN A;  5DUK A;  4FIS A;  3BG6 A;  2DMT A;  2JPB A;  2EIN H;  3DPT A;  3CTA A;  4BU2 A;  3BCA A;  1UJ8 A;  4AIK A;  1FYL A;  2KDZ A;  2G7H A;  4EQQ A;  3QYF A;  5HOO A;  2NNN A;  3J80 K;  4UXN A;  5JFR A;  2XF5 A;  4WXC A;  1NK3 P;  2LF7 A;  2TDX A;  4XID A;  1A5J A;  1APL C;  1ZRE A;  3RDI A;  4I01 A;  3EUK L;  3GUD A;  3ZP5 A;  4DBQ A;  1XTA A;  3PQJ A;  2GXB A;  1Z7U A;  4BXF A;  3SZT A;  4O3M A;  4PSW A;  4C2U A;  2MG4 A;  3K4L A;  2DA4 A;  2K5C A;  5M5X J;  2MSY A;  3RPU A;  3ZMZ A;  1TQM A;  2DCE A;  3CJR B;  3CCJ I;  2FMY A;  1ITY A;  2AXT C;  3N05 A;  3DXJ F;  4XIC A;  5J8C A;  1HW5 A;  2O3F A;  4BKX A;  2HPM A;  1MMA A;  3ML6 A;  2MLK A;  2RDP A;  4HNT A;  4LK0 F;  3JRB A;  3TW6 A;  2KZG A;  1ZRD A;  2K9Q A;  5M5Y J;  3S1M J;  3U21 A;  3BTC A;  1UST A;  1D8J A;  3TOA A;  3WU1 B;  2WB1 A;  4XRS A;  1CF7 A;  2YPR A;  4LMY A;  3MFK A;  1K7A A;  3O8G A;  5F6F A;  4BJ5 C;  4UUS B;  2Y9Z A;  2CQ7 A;  1U78 A;  5KHD A;  2V7F A;  1C0W A;  3A01 B;  2D2W A;  4HDU A;  4Q4Z F;  4FHT A;  2EIK H;  4G6Q A;  5LHH A;  2VKD A;  1BIA A;  2R92 J;  1UHS A;  4AIH A;  1KQ8 A;  4M9Z A;  1JGG A;  2KPM A;  3S2W A;  3DP7 A;  4ZDP A;  2KRF A;  4Y7N J;  4JX4 A;  4HQE A;  3QQA A;  4A3M J;  5D5U B;  1U5T A;  3RKQ A;  2ESH A;  1BC8 C;  4IHT A;  3OYN A;  4MGR A;  4PZJ A;  1CGP A;  3WE3 A;  3WHC A;  2NVX J;  3E6M A;  1QPI A;  3SEQ A;  5B3S H;  2KQR A;  3SZP A;  1NK2 P;  2HZD A;  2M8G X;  1SD7 A;  3HSF A;  2UUZ A;  2DI3 A;  4UVA A;  1W5C C;  2JJ7 A;  4I98 B;  4XON A;  1YJN I;  2H8R A;  3TL4 X;  3CCR I;  1ETO A;  1QNT A;  1X2N A;  1U2W A;  4XSX F;  1HLV A;  4PJL A;  2L9S A;  3JRI A;  2ZXJ A;  4PFO A;  1HW1 A;  3HPG A;  3BG7 A;  1JHF A;  5K5Q A;  2CU7 A;  2HDC A;  1J7K A;  1RC9 A;  2ZNY A;  2L2O A;  4Q5S F;  4OIP F;  1E3P A;  5LEJ A;  3ZN0 A;  2CUF A;  3KP5 A;  1B9M A;  3WG9 A;  5K5R A;  1YW7 A;  5HOD A;  3JR9 A;  3HOV J;  1XMK A;  2DJI A;  1WVR A;  5E8G A;  1G3Y A;  3LL7 A;  3PFY A;  4PJN A;  2VC0 A;  2ZME C;  4M6Y A;  2V4J C;  5J6X A;  5FJ8 J;  4DGW B;  1ZEL A;  1YTY A;  2DA1 A;  4DJA A;  1OCC H;  1W7P A;  1WHU A;  2E2I J;  2L7F P;  1WKM A;  2JT1 A;  4XSZ F;  5HS9 A;  5JLW A;  1DGW Y;  3I59 A;  4GYG A;  1A6Q A;  4BJT A;  2B7E A;  4Z2Y A;  1MW7 A;  4EJV A;  3NQO A;  5IY5 H;  3I56 I;  2BW3 A;  5CVR A;  3J7A O;  2VLA A;  4U88 A;  1YRN B;  2JPC A;  1FBS A;  2UZK A;  3J7Z I;  5IOZ A;  1IV6 A;  5EGO B;  2CW8 A;  3SFZ A;  2DDB A;  2ZSH B;  3K1M A;  2LRD A;  4AU7 A;  2CG4 A;  1KGS A;  3CCS I;  2DPU A;  1U5T B;  4XLN F;  4A3F J;  2IS6 A;  2HVS A;  1Y56 A;  3L09 A;  3QU6 A;  3IRR A;  4LG0 B;  2BXZ A;  2EV0 A;  3CUQ B;  3PJR A;  3FDY A;  2HNH A;  2JRM A;  4LK1 F;  4FAS D;  3ZR8 X;  2A6H F;  2XAF A;  5F08 A;  1GXP A;  4QTR A;  1LDD A;  2A5Y B;  4FX0 A;  2WY7 Q;  1X58 A;  4YII A;  3OYI A;  4CGZ A;  1JTX A;  1B4A A;  2CW0 F;  2W4S A;  2CS3 A;  3HRU A;  1DDN A;  2KMU A;  4JP0 A;  3JW4 A;  4J01 A;  4I09 A;  3JSP A;  4R1H A;  2ZJP F;  3DF8 A;  5E18 F;  2ESN A;  3BQZ A;  3LQQ A;  4PJ0 C;  5EEG A;  2E5N A;  1XPX A;  1KQ9 A;  2FQ3 A;  2R7O A;  3M8J A;  4NC8 A;  1R22 A;  1UB9 A;  1XSD A;  3CDH A;  1MBH A;  1EKE A;  3FZV A;  3RIR A;  1BR1 A;  1LQ1 A;  2E7W A;  2EV5 A;  4JBA A;  2QBY A;  4FET A;  1OYW A;  3TP3 A;  4D7N A;  1KU7 A;  3BWG A;  2ZFW A;  4RLF A;  3H1C A;  3MQ0 A;  3HIF A;  4XN3 A;  3W2A A;  3A4C A;  2K3F A;  2EA2 A;  2M0M A;  2Z5U A;  4M3G A;  2RNJ A;  5F0F A;  4E70 A;  2R5Z A;  4CCO A;  1O57 A;  2TRT A;  3IKV A;  4IJA A;  2R7R A;  3CJQ B;  5D4R A;  3MZH A;  3AL0 B;  4OU0 A;  5D4S A;  3ZQH A;  4RM3 A;  1T56 A;  1IF1 A;  5H6Q A;  1Z3X A;  1QGP A;  2IEK A;  1FYK A;  1JGS A;  4E7H A;  3VFZ A;  4UY8 I;  1F43 A;  1OFC X;  2JSC A;  2KZV A;  2PN6 A;  3S32 A;  1AKH B;  2OTJ I;  1QHH D;  2WTE A;  4R8H A;  2P6T A;  4M3E A;  3K1N A;  3L2R A;  1B8I B;  2WY8 Q;  2L54 A;  1AHD P;  3ZMV A;  3MKW B;  1RUN A;  4WCG A;  1VQP I;  5EG0 A;  1K6O A;  1ON2 A;  5D6F A;  4CCJ A;  4HNU A;  2EFW A;  1HKS A;  3PNV A;  2M4K A;  4BXX J;  4HW0 A;  1BC7 C;  3DFG A;  5FRO A;  2E2J J;  2ZCW A;  4RDU A;  1IN6 A;  2X6Y A;  1FNN A;  2BHZ A;  2P8T A;  4NDL A;  3HKZ N;  3I58 A;  1UAA A;  2P4W A;  3ZQ7 A;  2EH3 A;  3OR2 C;  4Y15 A;  3H0G J;  2DFE A;  2GM4 A;  2X6O A;  3FXO A;  2ELH A;  3M9A A;  1Z9C A;  3I54 A;  5HDN A;  4X0G A;  9ANT A;  3ZMU A;  2DA2 A;  5L3G A;  1Y0U A;  5TJJ A;  4BGD A;  4ZYE A;  3QYB A;  2PX9 A;  2VQH A;  2R3S A;  3E1S A;  1W36 D;  5JVG F;  4P9F A;  3BDD A;  1WPK A;  1MNM C;  3H5N A;  5BPD A;  3CF2 A;  3EDP A;  3QP6 A;  2F2E A;  4IRG A;  5F04 A;  5IT9 K;  2HOT A;  3K4J A;  4A12 A;  1T95 A;  2JZY A;  5KAI C;  2NXN B;  4I6Z A;  4ON0 A;  2GWR A;  2HPI A;  2EPF A;  1Y1W J;  3WHB A;  2R5Y A;  2AO9 A;  5E3L A;  1JTY A;  1MND A;  3AG3 H;  1HDP A;  3I9V 2;  2XAU A;  2WWY A;  2Z9O A;  2WC2 A;  3CC2 I;  2GLO A;  2E60 A;  4UHT A;  3M1C A;  2RAE A;  4L0Z B;  2HQN A;  2V9P A;  2W57 A;  4OAZ A;  3PSF A;  1OCZ H;  2Z2S B;  2Z1D A;  3W2V A;  1R49 A;  4RB0 A;  2CFO A;  4KMU X;  2YX4 A;  3V8L A;  1MDM A;  2DXI A;  4E4H A;  1TWF J;  3TOB A;  2ZXI A;  4CYD A;  2VJ5 A;  4KN7 X;  4EGZ A;  3FXJ A;  4J00 A;  2D1H A;  3RTR A;  2Q0O A;  1USS A;  3IAM 2;  1HXD A;  5FKN A;  3WE2 A;  1FEX A;  3ABK H;  4ZZD A;  3M3Y J;  3FK7 A;  4EM2 A;  3FM3 A;  2ETH A;  3VB2 A;  1A04 A;  2RQQ A;  2QA4 I;  2Y30 A;  1H9T A;  2XGE A;  3LFU A;  1STZ A;  5F64 A;  5LHG A;  3KLO A;  4OIR F;  3K4N A;  5HNF A;  2FJ1 A;  3RSN A;  1ZRF A;  3CDL A;  2OZ6 A;  1AWC A;  1Z77 A;  2UXX A;  4RGU A;  2EIL H;  4IRH A;  4DW6 A;  1Z91 A;  2M45 A;  2HYJ A;  2EZI A;  4UVB A;  2IGM A;  2A05 A;  2H6B A;  1X4P A;  3OS0 A;  2CQK A;  4BHP A;  1H8A C;  2NVU B;  3F6O A;  2JSP A;  3GTQ J;  2LY1 A;  1R1V A;  2HS5 A;  4A5N A;  2BV6 A;  4OMZ A;  1BI0 A;  4CCK A;  3BTI A;  1VFC A;  1OYY A;  2B63 J;  2VC1 A;  3F72 A;  2X1E A;  1HOM A;  5LBQ A;  3DKY A;  1D0Z A;  5C4X J;  2JUG A;  3E5U A;  5JI6 A;  3KYL A;  1ON1 A;  3HRS A;  2NVY J;  1R36 A;  3OMY A;  4XOP A;  4U7D A;  4FX4 A;  2DMQ A;  3ZQL A;  2CQN A;  1DU6 A;  3BZ6 A;  3SHF A;  5IT9 Z;  3KP2 A;  3P9C A;  2M4G A;  1JT0 A;  2FA5 A;  4CZC A;  5TIS C;  1ETY A;  4DBR A;  3H3U A;  1B1B A;  3I53 A;  1D1C A;  4XQF A;  5TRD A;  2PI0 A;  2R7T A;  4IPA A;  1ZGA A;  3W6J B;  5FD6 A;  3R4K A;  2LNB A;  5BMZ A;  3HC7 A;  1FPQ A;  3HGY A;  3T8T A;  1HBX G;  2BEO A;  1D8K A;  1J59 A;  3BTL A;  4DIQ A;  2CUJ A;  3U9G A;  1HST A;  1IRZ A;  1E2X A;  5E8I A;  5D5X B;  1QPM A;  4MHG A;  2DA7 A;  3CJN A;  5FLX K;  4BL0 B;  1T08 B;  5LGT A;  2M8E A;  4U87 A;  3OYB A;  2O03 A;  1U9N A;  3F8B A;  1ETQ A;  1LE8 A;  3CD6 I;  1GUU A;  3TBI A;  3T5X A;  3F21 A;  4LD5 A;  3HOT A;  3ELK A;  3WG7 H;  3NRV A;  2BVL A;  3QWL A;  5CVJ A;  4I76 A;  2VI6 A;  1FOW A;  1U8B A;  1PYV A;  3OYC A;  1IXS B;  1LEA A;  1X1D A;  1ZK8 A;  3PSI A;  2F5V A;  3LSR A;  4FTH A;  2Z99 A;  4G8X A;  3GTM J;  3T8R A;  1VQ7 I;  4LB6 B;  3G73 A;  2Y0M A;  2LY2 A;  1HSJ A;  1IDZ A;  4E7J A;  3ZMT A;  1ZGW A;  3KEQ A;  2R7W A;  2K86 A;  4YIF A;  5IYC J;  4LLN A;  3WTV C;  2M2E A;  3P5J A;  4V19 K;  3I4M J;  1RES A;  5E1Z B;  2E71 A;  1V5E A;  2JN6 A;  1J9I A;  1PDN C;  1N78 A;  2QSF X;  2VKV A;  2VPL A;  1IN7 A;  5E3M A;  1F9N A;  3I0T A;  3WGH A;  2LF8 A;  1XS9 A;  4IXA A;  1WZ2 A;  2E1N A;  5GAH J;  2VON A;  4FQG A;  5HS7 A;  1WJE A;  1X4O A;  4EJW A;  1ZYR F;  4N4N B;  3ONQ A;  3GBG A;  4I2O A;  4BYY A;  3KYC B;  4O5V A;  5DCM A;  4Y17 A;  3X2Q H;  3MAJ A;  3TDU C;  3O8H A;  2DFI A;  2H09 A;  1PVE A;  3LSG A;  1OCR H;  3QOD A;  1JJ6 C;  3M4O J;  1ETV A;  1B6A A;  2BGC A;  4A0X A;  3FXK A;  1OR7 C;  5E20 A;  4YIR X;  3PO2 J;  1BA5 A;  2COB A;  3F9K A;  4L5J A;  4WK8 F;  2CUZ A;  3FX3 A;  3C18 A;  3HPH A;  1IO2 A;  4DZJ A;  3L00 A;  4B3A A;  3B6C A;  1YJW I;  2YU9 J;  3U2R A;  4W97 A;  4UUT A;  3WGI A;  4A93 J;  4HYE A;  2DA6 A;  2KIF A;  2OF7 A;  2K27 A;  3DBH B;  3AFH A;  3BJA A;  2BY3 A;  3ECO A;  1ODD A;  5EJC A;  3H0D A;  2X6W A;  2X51 A;  3AG2 H;  1FOX A;  3HZJ A;  1FSE A;  4CYC B;  3G4S I;  1LB2 A;  3TDZ C;  2O8X A;  1FX7 A;  2GXA A;  1P92 A;  3GTJ J;  4CIC A;  1OKR A;  4P5O A;  2COM A;  3KZZ A;  4RAY A;  1JKQ C;  3T0Y A;  2PMU A;  1YIJ I;  2R7U A;  5IP7 J;  5DUI A;  1FTZ A;  4A3C J;  1XG1 A;  4RLQ A;  2PLY A;  3ZXS A;  1GVD A;  2LTP A;  4A6D A;  1VQ8 I;  1QZY A;  1XGO A;  3ZGK A;  2LRE A;  1BW5 A;  1ZG3 A;  1LVK A;  4HEA 2;  3KCC A;  1I39 A;  4EM1 A;  2P81 A;  4I99 C;  2R4G A;  3VYR B;  4ZTF A;  1H9G A;  2VT3 A;  3RQ4 A;  4ESF A;  3DCF A;  2YS9 A;  2DK5 A;  4GFB A;  3DKW A;  2RKH A;  3OYJ A;  4IQ4 A;  4DOZ A;  5FFZ A;  1G3S A;  5D5W B;  1XDU A;  2EK5 A;  2IA1 A;  2W84 A;  2L5Q A;  3QPS A;  2X1C A;  5DDG A;  1G6N A;  4D1Q A;  1TW2 A;  3OL3 A;  3OIP A;  1ZHF A;  2E1M B;  3ABL H;  2W00 A;  1TWC J;  1TLH B;  2E7X A;  4TV7 A;  5CLS A;  4IHV A;  2EZH A;  2ISZ A;  1TNT A;  2GOM A;  2ELJ A;  2KIU A;  1ENH A;  2P0W A;  2MC4 A;  4PCQ A;  2AHQ A;  4B44 A;  4UUS A;  1YE9 A;  2KL4 A;  2IS1 A;  3S2H J;  2JK3 A;  3HHH A;  2CYY A;  4XLC A;  4Q47 A;  3A01 A;  2X9D A;  4S04 A;  4RGX A;  5LGN A;  3S1N J;  1P4A A;  4IX7 A;  1U8R A;  1SD4 A;  1ZAO A;  1P9Q C;  2DDA A;  4KIB A;  4WX9 A;  1G4D A;  3I4N J;  1X1P A;  4LG3 A;  4Y4R A;  1BR4 A;  1KYW A;  1SAN A;  1L3L A;  2HR3 A;  3LA7 A;  1RPW A;  4OAY A;  4M3F A;  2IS4 A;  2CV0 A;  4ENJ A;  2CW7 A;  1RUO A;  2JA6 J;  4C3J J;  5LEK A;  4BAY A;  2ZME A;  2PFB A;  3F6V A;  3CLQ A;  3F23 A;  1UFM A;  1FOY A;  1IGN A;  1TNS A;  4ESB A;  5JHU A;  2M9H A;  3R0A A;  2EIM H;  3GTL J;  1FIP A;  2KHM A;  3OSG A;  2KRC A;  4BAC A;  1X1A A;  2I8D A;  1MMG A;  2X0L A;  4XKW A;  2XGC A;  1P7J A;  3IH4 A;  4KNY A;  4D5F A;  2R7Q A;  4G7H F;  1FP2 A;  1BW6 A;  3ZMD A;  4NQW B;  1YLF A;  1X19 A;  3QOE A;  5IT3 A;  3CMM A;  1XN7 A;  2XAH A;  2E1M C;  1U6G A;  2MH2 A;  4A69 C;  1SFE A;  3HEF A;  4M3D A;  4E7K A;  2VT2 A;  1I27 A;  5DS9 A;  3L2U A;  3E5X A;  4IHW A;  2JQ7 A;  1B59 A;  3OWT A;  4YRV A;  1TQP A;  2FU4 A;  3SEZ A;  1UZC A;  1RR7 A;  4PK4 A;  4CA0 A;  1Z0X A;  3S17 J;  3AKZ A;  1K4T A;  3QPT A;  1V4R A;  2LKP A;  2V9V A;  4XM3 A;  3OSF A;  2Y0S A;  4IRI A;  5IOY A;  3OOP A;  2ZXW H;  1HDD C;  4OIN F;  3GTP J;  2A6T A;  5HLH A;  3QYE A;  2FQ4 A;  1H89 C;  2V1N A;  4V2G A;  3QRF F;  2IXS A;  3PQK A;  1MH3 A;  2HQR A;  1I3Q J;  1SAX A;  3FWE A;  1WJD A;  4LIV A;  1S7E A;  3RKY A;  3ZQC A;  2PMZ A;  2O5R A;  5ILS A;  4RMN A;  1VQ6 I;  4CXF A;  3HDD A;  4QIW N;  2JA2 A;  1LDJ A;  1G8X A;  3GFL A;  4KUM A;  3S1R J;  4BXU A;  3I55 I;  3HOW J;  2WAE A;  2OTL I;  1PP7 U;  5LLQ A;  1IN5 A;  3VEP A;  4ZZL A;  4RA2 A;  2GIZ A;  3L2W A;  1LDK B;  1YRN A;  3PIO F;  2DOE A;  5AON A;  5EGO A;  3LAJ A;  1TL8 A;  5GAG J;  5DCF A;  1TWG J;  3DEU A;  1L0O C;  2G9W A;  4KT6 A;  2M34 A;  1Y1V J;  2ZME B;  4LG0 A;  3CUQ A;  2LSO A;  4AVP A;  3WU0 A;  5BNG A;  2IA0 A;  1IRF A;  3V7R A;  5LRR A;  3KET A;  4YFK F;  3LA3 A;  1EH7 A;  4BQN A;  5HLG A;  3GLL A;  1WJB A;  3CF5 F;  5J40 A;  3S2D J;  1MD0 A;  1YX3 A;  2V79 A;  1I1G A;  2E19 A;  3V7S A;  3CCM I;  2P5K A;  4XLF A;  5GPC A;  2PJP A;  5FLV A;  3AG1 H;  3SQN A;  2HYF A;  2WAF A;  3J7A Y;  1V5F A;  1D1A A;  3Q0V A;  5B1A H;  1R71 A;  1P6R A;  3O2P E;  1WH7 A;  3SXY A;  1J2X A;  3BR0 A;  4M74 A;  3DLL F;  6PAX A;  1G59 A;  1RKT A;  1H88 C;  4H4K C;  2ISY A;  2NS7 A;  3FXL A;  3FM5 A;  3EUH C;  2Y48 A;  4ZC3 A;  4L9V A;  4D9J A;  1T6S A;  4L5E A;  2D1V A;  4EGY A;  4RAF A;  3GVA A;  3K4M A;  1KU2 A;  3Q0U A;  1SVO A;  5KAF C;  4M3B A;  4GRI A;  2VOD A;  3H9Q A;  2HTJ A;  1SAU A;  2LDU A;  3H92 A;  1FJL A;  1KU3 A;  3CUO A;  3LSP A;  2XRL A;  1YO5 C;  1DP7 P;  3V8K A;  2R7Z J;  3FBI B;  2YUS A;  3A0B C;  2BOL A;  3H36 A;  3OS1 A;  4BHC A;  4EJT A;  3CDI A;  4NUB A;  5E17 F;  3K4B A;  2YSR A;  1OPC A;  2E5Z A;  2DT6 A;  2OPT A;  1JKR C;  4YEL A;  3CC4 I;  1QU3 A;  1T38 A;  2GBY A;  3QPL A;  2QEN A;  2M7B A;  5CQG A;  2O6G E;  1Y6I A;  2CFX A;  2DU9 A;  3IL2 A;  5FLM J;  3CO7 C;  3E6C C;  1I6X A;  1UCR A;  1O3S A;  4RGR A;  1WCM J;  1AKH A;  4MTD A;  1D1B A;  1FY7 A;  1JT6 A;  1OQY A;  2G0E A;  1B8I A;  2LBF B;  1MSE C;  5KNL A;  2M30 A;  3JRA A;  5GTI C;  1XCB A;  2ZJ2 A;  2VKH A;  3OYG A;  3IV5 A;  3G3Z A;  3ABT A;  3I71 A;  2OA4 A;  1BIB A;  1U9O A;  3HYI A;  1SEU A;  3BY6 A;  3ISP A;  2GA1 A;  3H5A A;  4MO7 A;  5F0H A;  3ASO H;  1W0U A;  3PL8 A;  5TGT A;  1OCO H;  1HC8 A;  1U3E M;  1HQC A;  2L9R A;  5DTD A;  5LFA A;  1MBK A;  3M8E A;  5CKT A;  4YFX F;  4ENM A;  1S7A A;  2DW4 A;  2HXI A;  5J47 A;  3C7J A;  1ZLK A;  3DLA A;  2PJR B;  1REP C;  3QOP A;  5L3F A;  4AVZ A;  1P7I A;  4HOB A;  4I7H A;  3GFM A;  4AYB N;  3CCY A;  4I0A A;  3TW7 A;  3ABM H;  4DYQ A;  4QSH A;  3HOU J;  1G3W A;  4QPQ A;  2QGU A;  2HWV A;  2M1B A;  2GQQ A;  3FMR A;  5CQE A;  1HA8 A;  2DYR H;  1P4X A;  1DU0 A;  3KZY A;  1QO0 D;  3KEO A;  2Q2E B;  3J81 K;  4L9J A;  2V6E A;  1J09 A;  1JUS A;  3M1E A;  3BLY A;  2OBP A;  4YG2 F;  5FGM A;  4A3D J;  1ZR2 A;  1WI3 A;  1W36 C;  2XPW A;  2DN0 A;  4Y52 J;  1VF9 A;  1BOA A;  1MBF A;  3MKY B;  1T98 A;  1D0X A;  2DOA A;  1ZAR A;  2K4B A;  3IAS 2;  5J3L A;  1A31 A;  2ECB A;  2FEZ A;  4RS8 A;  5ERI A;  2KJB A;  4LLG F;  3ULQ B;  1WSU A;  2XKP A;  4O6J A;  2O7O A;  2H27 A;  3KP7 A;  2QQ9 A;  4WXD A;  3S3M A;  2F5C A;  4G6D A;  3G1M A;  5F1R A;  3VDX A;  4XKC A;  4F93 B;  1R23 A;  1MMN A;  1SVL A;  1Y8Q B;  2IA2 A;  1ZGJ A;  1Z6T A;  2LD5 A;  3QAH A;  2NOJ B;  1LUJ B;  4D5C A;  2MC3 A;  4HLX A;  3S16 J;  2QSH X;  5J8F A;  3C1D A;  3WTW C;  2BY1 A;  1EH8 A;  1YYV A;  3PNT A;  1A36 A;  2AQF A;  5K5O A;  2EFO A;  4HF0 A;  4RB3 C;  3OYM A;  2L02 A;  2XF6 A;  3Q9V A;  4XOT A;  2J5P A;  2VOO A;  3IKT A;  2XHK A;  1E3H A;  1EJ9 A;  4BY7 J;  4F55 A;  3ZQI A;  1KQ0 A;  2DO7 A;  1ZTR A;  3GF2 A;  2XAJ A;  1UG0 A;  4NBQ A;  5C44 J;  4MFE A;  2ICW G;  4F91 B;  5M3F J;  5A2Q Z;  4OIO F;  4KA4 A;  2LK2 A;  4DYR A;  5HDK A;  1BOB A;  4IHX A;  4OIQ F;  1S7O A;  4E7Z A;  1XGM A;  3QU3 A;  2OC6 A;  1I5Z A;  3FKJ A;  3IWF A;  3HUG B;  4YFN F;  2LLK A;  4EJU A;  1NTC A;  2P7V B;  3J81 Z;  1FBU A;  1E3O C;  2NRA C;  2JTV A;  3P9K A;  3TMO A;  2W7N A;  4JX6 A;  1SVM A;  3RPU D;  2KFD A;  5L3B A;  2EFN A;  3DTE A;  3HB9 A;  4LFU A;  2QKM B;  2IBD A;  3EET A;  3GO5 A;  4OMY A;  3S15 J;  3J7Y J;  3CME I;  4P55 A;  4MQV A;  1PUF B;  3ERE D;  4AUX A;  3WTU C;  3GTK J;  4ANJ A;  3WTY C;  4BQA A;  4ASN A;  2DOF A;  1Q1V A;  1IRG A;  2L3D A;  1R9T J;  1O4X A;  1I50 J;  1N75 A;  4LIT A;  1UEL B;  1MBJ A;  3DU6 A;  3DEW A;  5FD5 A;  2DYS H;  2JUC A;  3E5Q A;  1S3J A;  3G1L A;  1VTN C;  1OJL A;  1SFO J;  1ETK A;  1QZE A;  3W2W A;  4RB1 A;  2NAZ A;  2UWM A;  2QVO A;  1SFX A;  3KX2 A;  1ULY A;  2ZKZ A;  1FT9 A;  3R0J A;  1P4W A;  2RN7 A;  2L4A A;  2R93 J;  1BI3 A;  3G6E I;  3BQY A;  4A3L J;  4DYC A;  4HDV A;  3RKW A;  3MKZ A;  5D8L B;  3HKZ A;  2W25 A;  4IO9 F;  2JA8 J;  3HOY J;  2ZSI B;  4YEJ A;  5B66 C;  4HF1 A;  1X3W B;  3JTH A;  3JAM Z;  4CZZ A;  1W4M A;  4N9I A;  4BBS J;  3CLO A;  1QRY A;  2JVG A;  1LNW A;  4KDP A;  4ZYA A;  4DNC A;  1YW8 A;  4G6T B;  4BY1 J;  5K7H A;  1IN8 A;  4HQM A;  5EYR A;  1T2K A;  1ZQ3 P;  3K70 D;  2LYC A;  4PGH A;  4KIS A;  3LFK A;  2KLO A;  3O6B B;  5ED4 A;  2JWT A;  1WRJ A;  4ZYG A;  3KLN A;  2RRE A;  4F3Q A;  4XBF A;  1YHQ I;  3WTS C;  1FMV A;  1I6H J;  3LST A;  4CH7 A;  5EDN A;  1W5T A;  3GZ6 A;  3CCU I;  3DKX A;  2DTZ A;  1XMA A;  3KP3 A;  3SYT A;  1HF0 A;  2A69 F;  3E0J B;  3N97 A;  4ENN A;  3H9J A;  1K83 J;  1AOY A;  2LVS A;  2K4J A;  3OYD A;  1OYI A;  4C2M J;  2FNP A;  3HM5 A;  2QWW A;  2IRF G;  3GLX A;  4NNJ A;  3Q5F A;  4B43 A;  4HRI A;  3COA C;  2W24 A;  2MW8 A;  2B9S A;  1K78 B;  2OCC H;  2HOA A;  2XAQ A;  1HKQ A;  3F8C A;  2OZU A;  3PUB A;  2E35 A;  3HGG A;  4G94 A;  4CYC A;  4KYW A;  2AS5 F;  2QZ8 A;  3CP8 A;  2XKO A;  1SFK A;  1WI9 A;  3DTK A;  2VBW A;  5CYV A;  3R61 A;  4M6X A;  3CO6 C;  1YIO A;  2NYX A;  4XLP F;  2M0C A;  2FXA A;  3LSJ A;  1W7P D;  1H0M A;  2F4O B;  3RPQ A;  2WAQ N;  4CSW A;  5BOX A;  1TP4 A;  2IGK A;  3E97 A;  4G12 A;  1GV2 A;  1EV7 A;  4HA8 A;  2DT5 A;  1KON A;  2IP2 A;  1ZN2 A;  2W48 A;  5HLI A;  2ECC A;  2X48 A;  1M1E B;  4I0B A;  4NC6 A;  4UUV A;  3NEU A;  1MJ9 A;  2XGD A;  3K9T A;  2X4H A;  2F5D A;  3DV8 A;  5J1R A;  2HQ5 A;  2O61 A;  3LSM A;  3KFW X;  5BQT A;  2X85 A;  5CVI A;  3KP6 A;  3OIO A; 
#chains in the Genus database with same CATH homology
 1IGN A;  5HOD A;  4JX5 A;  3UKG A;  3JR9 A;  3HOV J;  1MH4 A;  2CUE A;  3OOU A;  2ME6 A;  2M9H A;  3TED A;  3GTL J;  1FIP A;  3OSG A;  2Y31 A;  3VPR A;  3FIW A;  3S1Q J;  1B72 B;  3Q3S A;  2XGC A;  1P7J A;  3IH4 A;  4D5F A;  2K9N A;  3FIS A;  5FJ8 J;  4X6A J;  1BW6 A;  2DA1 A;  2ID6 A;  5C3E J;  2E2I J;  2L7F P;  5JLW A;  3JRG A;  4A69 C;  2XB5 A;  3JRH A;  3HEF A;  4BBR J;  4M3D A;  1D5Y A;  5DS9 A;  2O9L A;  2E2H J;  4IHW A;  1GV5 A;  3HBL A;  3ZOB A;  1YRN B;  1JKP C;  1RR7 A;  1Z0X A;  5IOZ A;  3S17 J;  1IV6 A;  5EGO B;  3OSF A;  5IP9 J;  1QVU A;  5IOY A;  2DMN A;  4FE7 A;  1HDD C;  4A3F J;  3GTP J;  4A3B J;  3D1N I;  1B72 A;  2R5Z B;  2FQ4 A;  1MBG A;  5EZG A;  4V2G A;  1H89 C;  1ETW A;  4C3I J;  5F08 A;  1MH3 A;  4QTR A;  2FD5 A;  1I3Q J;  2CQX A;  2I10 A;  1S7E A;  3Q0W A;  1X58 A;  2HXO A;  3ZQC A;  1JTX A;  5K7Z A;  2EBI A;  3HDD A;  4QIW N;  1AU7 A;  1T33 A;  3S1R J;  4JP0 A;  3HOW J;  3BQZ A;  5J1Y A;  3F0C A;  5IYD J;  2LY9 A;  2LFB A;  3GTO J;  1MBH A;  1IUF A;  1YRN A;  2QCO A;  2HDD A;  1VI0 A;  5EGO A;  4J19 A;  3TP3 A;  4D7N A;  5EG0 B;  1TWG J;  4AC0 A;  2DMP A;  3HOZ J;  2M34 A;  2LKX A;  1IC8 A;  1Y1V J;  4FE4 A;  4M3G A;  2R5Z A;  5F0F A;  5BNG A;  2TRT A;  2ME0 A;  1IDY A;  5GP9 A;  3S2D J;  4IHY A;  1JKO C;  5IYB J;  1HCR A;  3BG5 A;  2E19 A;  3ZQH A;  1EF4 A;  1T56 A;  2IAI A;  5JLX A;  5GPC A;  2IEK A;  3CMY A;  5FLV A;  1OCP A;  1BJZ A;  3Q0V A;  1F43 A;  1OFC X;  1WH7 A;  2XPU A;  3BR0 A;  5E3O A;  1AKH B;  1RKT A;  2DA5 A;  2ZB9 A;  4M3E A;  1H88 C;  1AHD P;  2NS7 A;  1B8I B;  1W0T A;  3RZO J;  4L5E A;  2N8G A;  2NVQ J;  3PO3 J;  5EG0 A;  3FKI J;  4W1U A;  3Q0U A;  5FKO A;  3LNQ A;  2HI3 A;  3CQZ J;  4M3B A;  4BXX J;  1FJL A;  2E2J J;  3LSP A;  2XRL A;  2R5Y B;  3BR1 A;  4RDU A;  4NDL A;  2R7Z J;  1RET A;  2EQR A;  2YUS A;  3HKZ N;  1LFB A;  2EH3 A;  2Y2Z A;  3JRD A;  3H0G J;  1WGX A;  2OPT A;  1JKR C;  2GM4 A;  2X6O A;  3SFI A;  4A3I J;  2GBY A;  3QPL A;  3K2A A;  9ANT A;  2DA2 A;  3NAU A;  5FLM J;  3S14 J;  3W6V A;  1JJ8 C;  1WCM J;  3IH2 A;  1AKH A;  2WB1 N;  1JT6 A;  2G0E A;  5FKM A;  2K40 A;  4ABZ A;  1B8I A;  1MSE C;  5K7F A;  1WPK A;  1LFU P;  3JRA A;  1MNM C;  3BR5 A;  4EEF G;  3IV5 A;  5F04 A;  2HOT A;  1U9O A;  5M5W J;  4I6Z A;  4MO7 A;  1Y1W J;  1TWH J;  5F0H A;  1W0U A;  4HNV A;  3WHB A;  2R5Y A;  2AO9 A;  5E3L A;  1JTY A;  1HDP A;  1G2H A;  3RZD J;  4D7M A;  2GLO A;  2WV1 A;  3JRC A;  2L9R A;  5DTD A;  1UG2 A;  1ETX A;  2RAE A;  1MBK A;  2EZK A;  2DJN A;  1POG A;  2HXI A;  4LOC A;  1A6I A;  2VUM J;  4C3H J;  1TWF J;  1P7I A;  4AYB N;  3MN2 A;  3CCY A;  2K9S A;  5FKK A;  3TW7 A;  4DYQ A;  3C2B A;  4QSH A;  5FKN A;  3ZQF A;  1FEX A;  3HOU J;  3M3Y J;  3FK7 A;  4DZP A;  1DU0 A;  3K7A J;  2Y30 A;  2VKE A;  1IJW C;  2XGE A;  5GPA A;  3JRF A;  1ZKG A;  1JUS A;  2R0Q C;  1OCT C;  3BR6 A;  1QVT A;  2FJ1 A;  5J1U A;  3CDL A;  3BR3 A;  4A3D J;  1Z77 A;  2L0K A;  5C4J J;  1ZR2 A;  1WI3 A;  4DW6 A;  3BG3 A;  1FTT A;  2HYJ A;  2EZI A;  2DN0 A;  2XPW A;  4Y52 J;  1VF9 A;  3RQI A;  1MBF A;  3MKL A;  1H8A C;  3GTQ J;  1TC3 C;  2MGQ A;  1VFC A;  5J3L A;  4FCY A;  3BTI A;  2B63 J;  2ECB A;  1HOM A;  5EEA A;  3A02 A;  1LE8 B;  2E1O A;  4RBO A;  2VPR A;  1GT0 C;  5IPA A;  2NS8 A;  5C4X J;  5FKL A;  2O7O A;  2NOG A;  3SJM A;  2NVY J;  3G1M A;  2DMQ A;  3ZQL A;  1DU6 A;  1BL0 A;  1MSF C;  4B1R A;  3BTJ A;  3JRE A;  1JT0 A;  1ETY A;  4IEJ A;  1GDT A;  2LD5 A;  5E3N A;  3H3V K;  4D5C A;  3S16 J;  4B4C A;  4X1E A;  4MIM A;  3HGY A;  3BTL A;  4M6V A;  1JUM A;  2KT0 A;  1IRZ A;  3A03 A;  4BY7 J;  3ZQI A;  1ZTR A;  2DA7 A;  5C44 J;  1K61 A;  2Y0S N;  1UMQ A;  4MFE A;  4A3E J;  5M3F J;  3IH3 A;  1U9N A;  3TP0 A;  2JA7 J;  1ETQ A;  2LK2 A;  4DYR A;  1LE8 A;  1GUU A;  1CQT A;  3ZQG A;  4IHX A;  4I76 A;  1RKW A;  4XRM A;  2VI6 A;  4MFD A;  1U8B A;  2FX0 A;  3LSR A;  1ZK8 A;  4FTH A;  2PMZ N;  2LLK A;  2CJJ A;  3GTM J;  1FIA A;  3BR2 A;  1NTC A;  2O8K A;  2TCT A;  2JMW A;  3E7L A;  1F36 A;  1IDZ A;  5EF6 A;  5F0C A;  1ZGW A;  1E3O C;  2XPV A;  3BG9 A;  4A3G J;  2JA5 J;  5IYC J;  4JX6 A;  2M2E A;  3G1O A;  3I4M J;  1RES A;  2JN6 A;  3HB9 A;  1WH5 A;  2QF7 A;  1TWA J;  2LR8 A;  2XSD C;  2EZL A;  3B6A A;  2VKV A;  4A3K J;  2IBD A;  3S15 J;  5E3M A;  1XS9 A;  1PUF B;  4MLO A;  1VND A;  4FIS A;  4AUX A;  2DMT A;  3GTK J;  3GBG A;  5IP6 A;  2DA3 A;  1Q1V A;  1O4X A;  1R9T J;  2KDZ A;  1I50 J;  3O8H A;  1MBJ A;  3DEW A;  3LSG A;  3G1L A;  1JJ6 C;  1NK3 P;  3M4O J;  1OJL A;  1ETV A;  1SFO J;  1ETK A;  4XID A;  1A5J A;  1APL C;  3PO2 J;  3BT9 A;  1BA5 A;  2COB A;  2R93 J;  4A3L J;  3BQY A;  2MG4 A;  4DZJ A;  4DYC A;  2Y9Y A;  4B3A A;  2DA4 A;  5M5X J;  2MSY A;  3B6C A;  3FK6 A;  2JA8 J;  3HOY J;  2YU9 J;  1ITY A;  3HOX J;  4W97 A;  2ELK A;  4UUT A;  4XIC A;  4A93 J;  1ORK A;  2DA6 A;  4BKX A;  4BBS J;  2OF7 A;  1PUF A;  1QRY A;  3JRB A;  4V2F A;  3TW6 A;  4CYC B;  2K9Q A;  4BY1 J;  5K7H A;  5M5Y J;  3S1M J;  2DMU A;  3BTC A;  5EYR A;  1ZQ3 P;  3GTJ J;  2D5V A;  4XRS A;  1JKQ C;  3SDG A;  1IG7 A;  2H1K A;  1ZR4 A;  3O8G A;  2Y9Z A;  5IP7 J;  4UUS B;  5F27 A;  1FTZ A;  2JWT A;  4A3C J;  1XG1 A;  1U78 A;  2NVT J;  2XB0 X;  1GVD A;  3A01 B;  2LTP A;  3PM1 A;  1I6H J;  1X2M A;  5EDN A;  1BW5 A;  1JUP A;  2R92 J;  1UHS A;  2DTZ A;  2LP0 A;  1JGG A;  4S0H B;  2L7M P;  2P81 A;  1HF0 A;  4Y7N J;  4JX4 A;  4JYK A;  3QQA A;  2YS9 A;  3DCF A;  4A3M J;  4GFB A;  3GTG J;  1K83 J;  2LVS A;  3RKQ A;  2CRG A;  4C2M J;  3HM5 A;  3NAR A;  3WHC A;  3QPS A;  2MW8 A;  2HOS A;  2NVX J;  2HOA A;  3HGG A;  1QPI A;  4CYC A;  1TWC J;  4IHV A;  2EZH A;  1NK2 P;  2M8G X;  3LOC A;  2ID3 A;  1ENH A;  2CQQ A;  3MVP A;  2AHQ A;  2M0C A;  4XRS G;  4UUS A;  2JJ7 A;  1MBE A;  3LSJ A;  2H8R A;  3S2H J;  2JK3 A;  3A01 A;  2L7Z A;  2X9D A;  1ETO A;  2WAQ N;  3S1N J;  1X2N A;  4G12 A;  1GV2 A;  1HLV A;  3I4N J;  3L1P A;  5EZH A;  5M3M J;  3JRI A;  2W48 A;  1SAN A;  2CU7 A;  1RPW A;  2ECC A;  1XC5 A;  2X48 A;  4M3F A;  2JA6 J;  4C3J J;  2XGD A;  5J1R A;  4A3J J;  2HQ5 A;  4XK4 A;  5F1J A;  2CUF A;  3OIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...