1MBFA

Mouse c-myb dna-binding domain repeat 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbfA00
2NVQJ 4M6VA 4XRMA 3DEWA 2IAIA 1PUFA 3IV5A 2L9RA 2DA5A 1POGA 9ANTA 3HM5A 2Y0SN 3JRIA 2OF7A 3WHBA 5FKLA 3M4OJ 2R5ZA 2VKEA 2DMPA 4M3EA 1VF9A 4A69C 3B6CA 1ZGWA 3S1QJ 5E3NA 2XSDC 3OSFA 3CQZJ 4JX6A 4CYCB 1HF0A 5C4JJ 2LVSA 2JA6J 4C3JJ 1JT0A 2KT0A 2EZKA 4V2GA 2JA5J 4DZPA 2E2HJ 3BR5A 1WPKA 1K61A 2E19A 3D1NI 2JK3A 3BT9A 1IG7A 1OCPA 2R92J 3HGYA 5JLXA 3JREA 1B72B 3I4NJ 1EF4A 1JT6A 4JP0A 1SFOJ 2HOSA 5FLMJ 1QRYA 3SDGA 3LSGA 1UHSA 5F1JA 5FKKA 3LSRA 1ORKA 2ID6A 2OPTA 5EG0A 4FISA 1JJ6C 2DA7A 3LNQA 1ZK8A 1UG2A 3GTJJ 4XRSA 1X2MA 1NK3P 2R7ZJ 1H8AC 1HOMA 2ECCA 5DTDA 1ZQ3P 3S16J 2GM4A 2RAEA 3FISA 2HXOA 1IV6A 2VUMJ 3BTCA 2WB1N 5IOYA 1TWCJ 2L0KA 5IP7J 3GTKJ 2ZB9A 4I76A 3HEFA 1BA5A 4AYBN 3FK6A 1K83J 1APLC 2DTZA 2MW8A 4A3GJ 3M3YJ 4D5FA 3LSJA 2O7OA 1OFCX 1H89C 2O8KA 4MFDA 5EEAA 1JUSA 4XIDA 4M3BA 1FTZA 1WCMJ 3QPLA 3F0CA 4BY1J 3GTOJ 2E2JJ 2R5YB 4DYQA 2COBA 2JA8J 1ZKGA 4DW6A 3IH4A 2Y9YA 2K9NA 4IHYA 2DA6A 4C2MJ 4V2FA 3ZQHA 5IPAA 2Y9ZA 1G2HA 1JKOC 2XB0X 4JX5A 3K2AA 1GUUA 1IC8A 1MH4A 2EZIA 1D5YA 1B8IB 2EH3A 3TP3A 5C4XJ 1TC3C 3O8HA 3FKIJ 2NVXJ 5K7HA 1IGNA 1R9TJ 5K7FA 2L7ZA 1TWGJ 4G12A 3I4MJ 3BR1A 4L5EA 4C3IJ 3G1OA 1I6HJ 5M3MJ 1MBJA 3A02A 4DZJA 3BR2A 4X6AJ 1IUFA 5K7ZA 1TWHJ 1RESA 2LFBA 2TRTA 2L7MP 3GTGJ 2CRGA 3BR3A 1B8IA 5FKNA 3BG5A 3NAUA 1JJ8C 3BR0A 1HDPA 3HGGA 4B3AA 1P7JA 4W97A 4A3KJ 4M3GA 1MBFA 2JMWA 1LFBA 2DJNA 3IH2A 4NDLA 4BY7J 3QPSA 1HCRA 1TWFJ 1ZR2A 4MO7A 2ID3A 1AKHA 3MVPA 2X48A 2JN6A 5E3LA 4M3DA 1FTTA 2LLKA 3SFIA 3L1PA 1WI3A 4A3MJ 1U9OA 2XB5A 4A3LJ 1VFCA 2LP0A 2ELKA 5EGOB 2JJ7A 5GPAA 1VI0A 1XS9A 5E3OA 2KDZA 2FD5A 1X58A 4IEJA 2LK2A 3BTLA 1WGXA 5E3MA 1YRNA 2LD5A 2CU7A 1MSEC 5EGOA 1GDTA 2E1OA 2XGCA 1JGGA 1LE8A 1X2NA 4EEFG 5EDNA 1PUFB 1ETWA 5M3FJ 1UMQA 1I3QJ 4A3JJ 3CMYA 2TCTA 2HOTA 3S14J 1ETXA 5EF6A 3UKGA 2MSYA 2DA1A 4J19A 1JKRC 5BNGA 3TP0A 4LOCA 3RQIA 3JRBA 1JUMA 5M5WJ 1LE8B 3WHCA 3HOXJ 2PMZN 3BQZA 1FIAA 1MH3A 3Q3SA 4XRSG 5F0CA 4IHWA 3HOWJ 1OCTC 4A3IJ 2DA2A 2M2EA 4DYRA 3G1LA 4MFEA 1TWAJ 3SJMA 3IH3A 3JRHA 2HDDA 2XPWA 1CQTA 2JWTA 3RZDJ 1MSFC 1AU7A 5FKMA 1P7IA 3O8GA 2X9DA 4D7MA 5HODA 1LFUP 4S0HB 3HDDA 5C3EJ 5J1YA 2Y2ZA 1U78A 3HOVJ 5EYRA 3HOUJ 3BG3A 5J1UA 5IP6A 2LY9A 4BKXA 5F0FA 4D5CA 1JTYA 5GPCA 1QVUA 3PM1A 3BQYA 4DYCA 2NVTJ 1ETYA 1W0TA 1SANA 1DU0A 1RKWA 1IRZA 1U9NA 3G1MA 3RZOJ 3K7AJ 4UUTA 4X1EA 1H88C 2ME6A 4FTHA 3OOUA 1T56A 1GV5A 4UUSA 4IHXA 2O9LA 4A93J 5F08A 1OJLA 2K40A 3H3VK 2H8RA 4B4CA 2FQ4A 2CUEA 3JRDA 3QQAA 2FJ1A 3GTPJ 1XG1A 5IYBJ 4HNVA 1IDYA 2HOAA 3B6AA 2R93J 1FEXA 1ETVA 3JR9A 2XGDA 2VKVA 3A03A 2CQQA 3BTIA 1A6IA 2L7FP 3ZQIA 4RDUA 2H1KA 4JX4A 1RR7A 1YRNB 4MIMA 2WV1A 2IEKA 2GBYA 3MN2A 1FIPA 1BW6A 3A01B 2R5ZB 1HLVA 1Y1VJ 2HXIA 2AO9A 1WH7A 2YUSA 5FLVA 2NS8A 4UUSB 2M8GX 2DN0A 2EZLA 5IP9J 1F36A 5F04A 3W6VA 4BXXJ 2IBDA 1XC5A 4RBOA 1JTXA 2R5YA 5GP9A 2R0QC 2AHQA 1QVTA 2X6OA 1MBHA 2NOGA 1VNDA 2M9HA 2I10A 5FJ8J 4XICA 3TW7A 2LKXA 2Y31A 1BL0A 3LOCA 1MBGA 4BBSJ 4AC0A 4A3FJ 4D7NA 3ZQFA 1ENHA 2NS7A 4A3DJ 3RKQA 5M5YJ 4FE4A 2G0EA 2HYJA 3GTLJ 5J3LA 3GBGA 3JRGA 1ETKA 3CDLA 2CQXA 3Q0UA 3ZQLA 3Q0VA 1GT0C 5F0HA 1NK2P 3CCYA 2M34A 5EZGA 2JA7J 4A3EJ 1IJWC 4C3HJ 3BG9A 1ZR4A 1U8BA 5DS9A 1QPIA 1ETOA 3S2DJ 5IOZA 2ME0A 1MBKA 1AKHB 1O4XA 2HI3A 3VPRA 5FKOA 2DA4A 2WAQN 1RPWA 1BW5A 1JKPC 2XPUA 3S2HJ 3HB9A 2VI6A 1BJZA 3GTQJ 1AHDP 1MNMC 2XGEA 3S1NJ 1T33A 3JRFA 4ABZA 2DA3A 5M5XJ 1HDDC 3PO2J 3HOYJ 1ITYA 1NTCA 1Z0XA 2QCOA 3OIOA 4W1UA 2CJJA 1B72A 1FJLA 3A01A 3HKZN 3C2BA 1JKQC 2MG4A 5JLWA 2D5VA 3S17J 3FK7A 3GTMJ 4QTRA 4MLOA 3TEDA 1S7EA 3HOZJ 3ZOBA 2XPVA 4A3BJ 5C44J 2VPRA 2K9SA 4M3FA 4CYCA 2K9QA 5J1RA 3PO3J 3DCFA 2N8GA 3HBLA 2XRLA 2B63J 1W0UA 1RKTA 3E7LA 3BTJA 4JYKA 1GVDA 2MGQA 2DMUA 2DMQA 3ZQCA 5EZHA 1Z77A 1I50J 2W48A 4IHVA 3S1MJ 5F27A 4QIWN 3FIWA 4B1RA 2E2IJ 2DMTA 1A5JA 1ETQA 3MKLA 2GLOA 2YS9A 1GV2A 4FE7A 4Y7NJ 2M0CA 3S15J 4AUXA 1MBEA 1IDZA 3S1RJ 5IYCJ 2EQRA 3LSPA 3Q0WA 2NVYJ 3NARA 3BR6A 1WH5A 2EBIA 1Q1VA 3OSGA 4Y52J 5EG0B 2HQ5A 1Y1WJ 4GFBA 2FX0A 1E3OC 2LR8A 2QF7A 1RETA 4BBRJ 2DMNA 2ECBA 4I6ZA 2P81A 3ZQGA 2Y30A 1DU6A 3TW6A 2EZHA 4XK4A 3H0GJ 3JRCA 2LTPA 4QSHA 4A3CJ 1ZTRA 3JRAA 2YU9J 5IYDJ 4FCYA 1F43A 1JUPA 2CUFA
chains in the Genus database with same CATH superfamily
2P0WA 4M6VA 4GCVA 2P6TA 5HDKA 5J4VA 3F8CA 3VSKA 4C30A 3TBIA 1WJAA 3U2RA 1G6NA 4BQQA 3OYJA 2L9RA 3V4GA 2Y0SN 3JRIA 2OF7A 3AAFA 2JTVA 2XAFA 3BLYA 2A68F 4GYIA 4I7HA 3WHBA 3M4OJ 4EQQA 1ACIA 3WGIA 2ZKZA 1Z05A 1DP7P 3CJTB 3WU1B 2XSDC 3CQZJ 3AG4H 4CYCB 3FDYA 1HF0A 1N75A 1T39A 2COMA 1FMVA 1VQ6I 2KRCA 1FY7A 2EJRA 1WI9A 3X2QH 3BT9A 3HC7A 1ZG5A 1VQOI 2EA2A 2ZMEB 5JLXA 4B43A 4GDFA 3FXKA 1OR7A 2ICWG 2X6YA 4ENJA 4IXAA 3F8NA 1LVAA 1SD5A 3SDGA 3LSGA 4ZTJA 4E4HA 2QQBA 3LSRA 5A2QK 1ORKA 2XKPA 1QZYA 3CJRB 2L7KA 4G8XA 4IRHA 5CQEA 2V1NA 1JJ6C 5AIPA 2VT2A 4FETA 1ZK8A 3S2WA 2PX9A 2QKLB 4HSRA 1T0FA 5DTDA 2FBIA 1VQ8I 2PLYA 5B3SH 3GMEA 3W6KB 1IV6A 4DBRA 3LAJA 1T6SA 3BCBA 2RQPA 5IOYA 3BZ6A 1USTA 1LEBA 3GTKJ 1J09A 2CWEA 2ZB9A 2HU9A 3ECHA 1BA5A 1APLC 1ON1A 3EUHA 3LSTA 3F22A 2DTRA 1S7OA 1SFXA 3OY9A 4N9HA 2WBMA 4P9FA 2IW5A 4D5FA 3LSJA 2QM3A 2STWA 4IHSA 2MFZA 4XIDA 2AQFA 5F1RA 3HXLA 3KYLA 1TT0A 3KZZA 4BY1J 3HIFA 3A0HC 2OCCH 4CO8A 4U7DA 4OIPF 3ABMH 3QODA 2QSFX 3OR2C 4MTDA 2NOJB 2PQ8A 3ROUA 3L2QA 5HS9A 3R61A 1U3EM 2X6WA 4BJ6C 4ZDOA 2K9NA 2Y9YA 4Q48A 1XSDA 2DA6A 4IHYA 2IS2A 1LUJB 4MQVA 3DTIA 4XMYA 4L9NA 2Y9ZA 1BI1A 3CCQI 1IC8A 3REOA 4GRIA 4EGZA 1B8IB 4XLPF 2IS1A 1MMSA 2Q1ZB 2A6TA 1XGNA 1Z6TA 1TC3C 4EGYA 3HZJA 1YS7A 3K1PA 1K6OA 3FKIJ 3BROA 4MEYF 5K1YA 3JSOA 1BR4A 5LBQA 1KU9A 2O3FA 2HDCA 5K7FA 2HFHA 5LD2C 1TWGJ 1FT9A 2H6CA 3I4MJ 3BR1A 2G7HA 2CV2A 1MBJA 2XRNA 3RPUA 3BR2A 2QBYA 5IT3A 3FKJA 3FXMA 2TRTA 4XLHA 1TTYA 3T8TA 2L7MP 4IQJA 2CRGA 2A3SA 3P9IA 1W7PB 2F4MB 3FBIB 5L3CA 4XSZF 3F72A 4CUGA 1SD6A 2VBZA 2LDUA 3BR0A 3OYBA 3HTSB 2IVMA 4LIUA 4I2OA 4A3KJ 1QHGA 3FZVA 1S72I 1YHQI 2NAZA 4E6KG 5FFXA 3ZCOA 4D1QA 1HCRA 2DU9A 4OIOF 1DQUA 3CUQB 2XAGA 3P5JA 4HF0A 3RYRA 3WG7H 4UV9A 3AL0C 3DFGA 1FWZA 2CFOA 3K1MA 2JN6A 3EDPA 2JUGA 5E3LA 4V19K 1WI3A 4A3MJ 4O6JA 1K7AA 1GLNA 2HKXA 5DDGA 4A3LJ 3MKYB 4IL6C 1VFCA 2LP0A 2WAEA 2LF7A 5FO5A 5J47A 1VI0A 1XS9A 3QYBA 3JW4A 2ESHA 1KQ0A 1X58A 1T95A 3HSFA 2LK2A 4JBAA 3BTLA 1NH3A 2V1UA 1IXSB 4LG3A 2HTJA 1MSEC 2E1OA 5H2FC 1OYIA 2GA1A 2TDXA 1JGGA 1LE8A 1X2NA 3NEUA 4XOTA 3CMAI 2B7EA 1ETWA 1KU3A 2R7OA 5M3FJ 2K3FA 3DPUA 3J81Z 1LPQA 4UNOA 3CMYA 2TCTA 1ETXA 4LGWA 1JKRC 5DM6F 4UB8C 2FA5A 3EUHC 4LLLA 3OMYA 3ONQA 3RQIA 5FRNA 1BN5A 4LK1F 3FXJA 5M5WJ 3SYTA 1LE8B 3HOXJ 1BM9A 4UY8I 3V42A 2RN7A 1MH3A 5FD5A 3HOWJ 2RGVA 1X4OA 3S8PA 1J9IA 2OAZA 2VPLA 2AXTC 5L3DA 1RRJA 4MHGA 2XPWA 3J80Z 3RZDJ 3OS1A 3E6MA 4D7MA 1LFUP 4S0HB 5C3EJ 2CV1A 2FU4A 3GO5A 1W36C 5B1BH 3L9FA 2VQHA 3VYRB 2NXNB 5BQTA 3G6EI 2LY9A 3CJQB 3PM1A 1FPQA 2VKDA 3LSIA 3BQYA 1DPUA 3DEEA 5E79C 4EM1A 3FXRA 2IJLA 4B09A 4I0BA 3BZKA 4EJWA 4UUTA 2ELHA 2UXNA 1H9TA 4XKBA 2ME6A 4FTHA 3ZMDA 3IRQA 5FLXK 3V8JA 3ZN1A 3OYDA 2KKOA 1SC7A 3TMOA 1HXDA 2W84A 3OL3A 2K40A 2RREA 4MTEA 3RPUD 2PJRB 1LDJA 4F3QA 5D5WB 4ZYDA 2FQ4A 1K78B 4FX0A 1GXQA 4ZH4F 1G3YA 2XAQA 5IYBJ 1YJNI 4IRIA 1ZN2A 3H5NA 2PG4A 3B6AA 2R93J 3SZGA 3PQKA 2XGDA 3MZHA 2UXXA 2E1NA 3A03A 2CQQA 3Q9VA 2PBIA 2X0LA 1RR7A 5ICEA 1YRNB 3H92A 5HS7A 2ZNZA 3OL4A 4U0WA 2DXIA 1BW6A 2AO9A 4E7JA 4HX4A 2YUSA 5FLVA 2GIVA 3FMRA 2NS8A 4UUSB 1F36A 4GO1A 5F04A 4CSWA 5HNFA 1JTXA 5D8KB 1X1BA 4LB5A 2X6OA 4AU7A 1SD7A 1UAAA 1SFKA 2EIKH 1D0ZA 3K4JA 3TL4X 2NRAC 2DK5A 1VNDA 4R1HA 1Z7LA 2AXLA 1R71A 3LMMA 3TW7A 4XM3A 3BP8A 3VYUB 2Y31A 5E8IA 1MBGA 3K10A 4M72A 4Y3OA 1WSUA 1BC7C 2BZTA 4RLFA 3V8KA 2EFWA 3RKQA 1JHFA 2V9KA 2G0EA 1R6RA 2H1LA 3K1NA 4RM2A 4IO9F 2PFBA 2K27A 2X6XA 3CCYA 1IJWC 5KVRA 2RNGA 1LJ9A 3BG9A 4C3HJ 1U8BA 1QPIA 1YI2I 1DGRM 1VQLI 3MQ0A 1WJBA 4U7BA 3O2PE 4Y4RA 1AA7A 2HPIA 3SQNA 4OIRF 3ZMSA 1EH8A 2GIZA 5D6FA 4LB6B 3QRFF 5J6XA 2M45A 2DA4A 1F9NA 3H9JA 2WAQN 2ZC2A 1TBXA 2A61A 4E7LA 1BW5A 2XPUA 3HB9A 1YX5A 4XKCA 3QP6A 3K4LA 1ZLKA 3S1NJ 3H1CA 4ABZA 1XGOA 2M7BA 3E0JB 5M5XJ 1O3TA 1HDDC 3BC8A 1NTCA 3GEZA 4UVCA 4BEHA 2XROA 3HOYJ 4PFPA 5TRDA 3GUDA 1WRJA 1YLFA 5IT9Z 3CCLI 3A01A 3C2BA 3U1DA 4I02A 1R22A 5LGNA 2H09A 1YW9A 3HSRA 1K6YA 2CMPA 4NB5A 1BIBA 3TEDA 1FOWA 1S7EA 1HA8A 4B48A 1SVMA 2LMDA 2K9LA 5C44J 1P4AA 2V9PA 3IAS2 4CYCA 2K9QA 2MLGA 2EIMH 5IT9K 2E1MB 2JSCA 2CW8A 1W0UA 4AYBA 2ZXHA 3FMQA 1RKTA 2ZJRF 2UWMA 5DV5A 1X19A 5EZHA 1G4DA 1VTNC 5FD6A 3NQOA 1RR8C 2W48A 4IHVA 2R7XA 4XL9A 4N4OB 2HEOA 5F27A 1XSXA 3FIWA 3VOEA 2DQRA 1A5JA 1UHWA 1FSHA 1T38A 1ETQA 1C0WA 1Z67A 3CC7I 1Z21A 2P4WA 3KP3A 2MLKA 2LY1A 1CF7A 3BJ6A 1GV2A 1KU2A 2NVUB 2M0CA 2LRDA 3S15J 2WC2A 3CLOA 1GHCA 3S1RJ 1IN6A 1IDZA 4UHTA 2EQRA 3PUBA 4KFCA 4GYGA 3PQJA 5ILUA 5EG0B 1ZELA 1R49A 2HQ5A 2FX0A 5LGUA 1E3OC 2HS5A 3ZMZA 2DMNA 2ECBA 4I6ZA 5DCMB 4BH9A 4KUMA 5E20A 2XDVA 2F5VA 5BOXA 1Q1HA 4CCMA 1DGWY 2FRHA 1WJCA 3VEPA 1VQ7I 2LTPA 1D3YA 1RC9A 3WGHA 1X3ZB 1ZTRA 3JRAA 1TLHB 4FCYA 3DBRB 5D4RA 1F43A 3L2WA 1YTYA 5JVGF 3DKWA 5JFRA 3ZP5A 4E7HA 3OYCA 2P5VA 3QOPA 1VQKI 2K4BA 2BEOA 2DA5A 3ASNH 5B66C 2VBXA 2A05A 2R5ZA 3OS0A 4E7KA 1VF9A 1X1AA 1U8RA 2DFIA 3KX2A 3ULQB 3LAPA 3E6CC 1IW7F 2R7WA 1OCZH 5C4JJ 2LVSA 3JTHA 3KE2A 3QU3A 4YFXF 3CCSI 4PSWA 2X1DA 4A2UA 4C3JJ 3JAMZ 2KJBA 4IZZA 5E8GA 2PJPA 3PNYA 5D5XB 2BY3A 4HX7A 2KIFA 4BYYA 2MD5A 3U21A 2LH9A 4ETSA 4PJLA 3BR5A 1WPKA 4XORA 2E19A 3HHHA 4HPQA 2KIUA 1IG7A 1TW2A 4XRFA 4NQWA 1EH6A 2Z9OA 2R92J 2BE5F 3HGYA 1H9GA 3ERMA 3JREA 3EPZA 1B72B 1U5TA 4JP0A 2LKSA 1SVOA 3CMEI 3KETA 5FLMJ 2VLAA 3OIQA 4XKVA 5F1JA 1QNTA 5FKKA 1WWXA 2A5WA 3R0JA 3OYNA 5EG0A 2FMYA 3PSIA 4FISA 3K0LA 4ZJZA 1RUOA 3W2AA 2IGOA 1SMTA 2LKPA 2QQAA 3IP4B 4CCNA 3LNQA 4ESBA 3GZ5A 1IRGA 3EUAA 2R7ZJ 1Z6RA 2R7FA 2ECCA 2JVGA 1MNDA 3DTEA 2JZYA 2FE3A 3QP5A 4CZZA 5FGMA 1ZAOA 2NNNA 4O5VA 4CICA 1D1CA 2E60A 2W7NA 1L3LA 2Z5UA 2RAEA 4M74A 3MKWB 1HSJA 1ZRFA 2L9SA 2BXYA 1Z9CA 5HLHA 1OISA 3GFJA 3BTCA 2EA4A 4IOAF 1MJ9A 1TWCJ 1LDKB 1W36D 2FBKA 1XGSA 4I76A 5KK1A 3FK6A 1K83J 3SDBA 2Z2SB 3CDIA 2MW8A 4A3GJ 4YG2F 2PN6A 3V8LA 2JSPA 2ZXWH 4UB6C 2O7OA 1OFCX 1J75A 2O8KA 4MFDA 3MKZA 3OYGA 1JUSA 2FOKA 2XF6A 3IWZA 2LF8A 4K2EA 2MYSA 4M3BA 4RAGA 4KIFA 2XGXA 3F0CA 3KPHA 1KYWA 2F6CA 3IHUA 4OWRB 2BW3B 3ERED 3HKZA 3J7AY 3GYHX 2COBA 2JA8J 1IRFA 4LFUA 4BHCA 4EM2A 1PYVA 3CC4I 3ZQHA 3DXJF 3EQLF 5IPAA 2HPMA 2QZ8A 2ISYA 5CVIA 2CGPA 4G7OF 4JX5A 3K2AA 4XONA 2DCEA 4ZZLA 2EZIA 2QA4I 4BEHB 5C4XJ 3PIOF 1TNSA 2KHMA 3F21A 1VQMI 4U88A 4AVZA 5K7HA 2CYYA 1R9TJ 2QGUA 3KP6A 3B02A 1HSTA 4RGSA 1WHUA 3M8FA 2QQ8A 1OLTA 4C3IJ 1A36A 1ON2A 1FP2A 1N78A 5E17F 3IC7A 3WE2A 2L5QA 3BDDA 2Z16A 3H5AA 5HDNA 1RESA 1V3FA 5GTIC 1IF1A 2F2EA 2D1HA 3L7WA 3SEZA 2DOFA 4OU0A 1HDPA 1P7JA 4PJ0C 1I39A 2IGKA 3JTGA 3KEQA 2M4GA 1AOYA 5J8FA 1LFBA 3CCJI 1Y39A 4NDLA 4NBQA 2GWRA 4LK0F 3A0BC 1YE9A 3OYHA 1HW5A 2X48A 2L02A 1FBUA 2G7UA 1FTTA 3SFIA 1E17A 4RAZA 4FASD 3KLNA 3BCAA 1OMIA 2IS6A 3IKVA 2DLLA 1B4AA 1S6LA 1X3UA 2M87A 2WV0A 3M9AA 2FQ3A 3DKXA 2P8TA 1UJ8A 3MD2A 2KDZA 1XGMA 2M0MA 3K9TA 1K4SA 1HBXG 1WGXA 1R4MB 4KNYA 1YRNA 1CGPA 1R1UA 2XAUA 2BHYA 2R7DA 4HDVA 1T8IA 2E1CA 4A6EA 1A35A 5EDNA 3VWBA 1MW7A 2XAJA 5CVUA 2DFFA 3FHNA 1I3QJ 4A3JJ 2A07F 3S14J 4X0GA 1FYMA 2DA1A 4J19A 2MH9A 3QOEA 4Z2YA 1XSVA 4F91B 5BNGA 3TP0A 1K78A 2E35A 5ERIA 1G3WA 3DU6A 4E7IA 4QPQA 3G3ZA 3PSFA 1G3SA 2I5UA 3ZQ7A 5EJCA 4ON0A 2ISZA 4KICA 3R6SA 4XLNF 1J7KA 5F0CA 3HTUA 5KHDA 4MFEA 3FMSA 5HS8A 3JRHA 3BJOA 3LL7A 4ANJA 1P7IA 2LBFA 5CYVA 2X9DA 5HODA 3HDDA 5L3FA 4P9UA 4M9XA 1LEAA 2IA0A 2YX7A 1U78A 2H6BA 2W82A 2JRMA 3BG3A 1P6RA 2WY7Q 5J1UA 2R7QA 2HQAA 2OZ6A 1TQPA 4TV7A 1F4KA 3S3NA 4BKXA 3FF5A 3W2WA 2P7VB 1JTYA 2BVMA 2V79A 2R7RA 3OYLA 4KT6A 1W0TA 1SANA 1DU0A 1ZLJA 3DF8A 3KZIC 3EETA 3KYCB 1QZEA 1YW8A 2F48A 3F9KA 3RZOJ 3K7AJ 5ICCA 2Q8KA 1QQIA 4X1EA 3KCCA 1BIAA 2QYOA 2OZUA 4IPAA 1T56A 1GV5A 3I4PA 4IHXA 3DKYA 4F52A 3LWFA 2O9LA 1LNWA 2DYSH 2MC4A 2VJ4A 2J5OA 3K4BA 4M9SA 1S3JA 3G73A 4CA0A 1ZARA 4XLFA 3G71I 4AIDA 2VKHA 2HOAA 2VOPA 4C2TA 2DK8A 2DJIA 2A69F 3Q9SA 3WU0A 1P4XA 1BR1A 1FEXA 2YR2A 1Y0NA 2DI3A 3BTIA 4PK4A 4JX4A 3OYAA 1K79A 4HBLA 1XTAA 4QWQA 1R5ID 2Y0MA 2K5CA 3A1YA 2QSHX 5KAFC 1FYKA 1WH7A 3BG7A 1S7AA 2QUFA 3BOQA 1O3QA 2V26A 2IBDA 5CKTA 1D0XA 4EM0B 4BE0A 3OYFA 2R0QC 1IAWA 1JXSA 4LIVA 4EJOA 4XQFA 2LY2A 4G9YA 3M1EA 4F92B 6PAXA 3DTKA 5LHHA 1LQ1A 3PFYA 1MMAA 2NOGA 4HV6A 5DD4A 1EV7A 2CO5A 2GZWA 2IPQX 3IWFA 4XICA 5FJ8J 3HHGA 4WX9A 1O3RA 3CUQA 3GXOA 1Z7UA 4AIJA 1BL0A 3SZPA 2VOOA 4A3FJ 4D7NA 4P55A 4YIRX 5M5YJ 3IAM2 4FE4A 1KU7A 3VB2A 1ULYA 3AG2H 5J3LA 2DDBA 1GVJA 1P4WA 1ETKA 3GVAA 2ETHA 2VC0A 5F0HA 4WK8F 2M34A 1PUEE 3ZMVA 4CCLA 4A3EJ 3CUQC 3RYPA 1ETOA 3AL0B 1TZLA 2XV4S 2ME0A 1MBKA 5KAIC 1A31A 2ZO4A 2CQNA 5ILSA 5FKOA 2QBYB 2L4AA 3ABTA 2EINH 2VBWA 3WG9A 2WADA 4M6YA 5HLIA 1BJZA 1AHDP 1IZ1A 2C6YA 4G6TB 3OR1C 2XGEA 1SAUA 1DUXC 4A0XA 3HYIA 2W4SA 2WY8Q 3K4NA 5ICGA 1Z0XA 1I1GA 2VJ5A 5F6FA 2J5PA 4YRVA 2M5WA 2K86A 2HYFA 1L0OC 1O7LA 3I53A 4BACA 1JKQC 2MG4A 2NS0A 4A5MA 3ESWB 3FHZA 1FZPB 1WKMA 2D5VA 3FK7A 4I01A 5E1ZB 3S17J 4GXOA 4AIHA 1SMYF 4P5OA 3HOZJ 2WA0A 2XPVA 2W85A 4A3BJ 3K70D 2K9SA 2OCEA 4HX8A 5J1RA 4B8XA 2HVSA 3DLAA 2B63J 5JHUA 2GOXB 1U0JA 1LDDA 2X51A 2MGQA 4WXHA 3W2VA 1D5VA 3RJPA 1Z77A 1I50J 3ZR8X 1UHMA 2ZSIB 3H35A 4XKWA 3ZMUA 4M73A 4G7ZF 4L5JA 2KL4A 4B1RA 4BAYA 2E2IJ 3TO7A 2DT7B 3H3ZA 3IUOA 5KCMA 4O3MA 3MKLA 3E3VA 2GLOA 4FE7A 2OC6A 1KQ8A 4P1WA 3CCEI 3PL8A 3EYYA 2CS3A 3LSHA 3RKYA 2QEXI 2NVYJ 3BR6A 3RPQA 2H8WA 3OSGA 5D5VB 4CHUA 2M3AA 5DM7F 4BBRJ 3RI4A 2ADUA 5D5UB 2YX4A 2Y30A 1DU6A 4HW0A 3I3LA 1LKXA 2EZHA 3H0GJ 4M71A 3BG6A 2PI0A 4QSHA 5ILVA 3I5UA 2Q2EA 4ESJA 4BGDA 2YU9J 3KZYA 2IP2A 1NHAA 2EV5A 4C2UA 3ZQQA 4LLNA 3IV5A 2XUBA 3F8FA 3Q5FA 4BXFA 1OCRH 1POGA 1HC8A 3HM5A 4XLCA 5FKLA 5HNHA 4PJMA 1PP8F 2OU2A 4XN0A 4U0YA 1YO5C 4OOIA 1USSA 2VONA 1UZCA 2P5KA 1BI0A 2AQEA 2VE8A 4BDYA 5E3NA 4G7HF 4JX6A 1VQ9I 2VBYA 1Z91A 3TKYA 5LFAA 2EZKA 4V2GA 3L2CA 2JA5J 4DZPA 4BE2A 2E2HJ 2DDAA 1K61A 3D1NI 3CCUI 2JK3A 5LEJA 3HL2A 4Y13A 4HLXA 1OCPA 1XDSA 1MJAA 2HYGD 3F3XA 3I4NJ 2BXZA 1JT6A 4PFOA 3ECOA 1QRYA 3ZGKA 5D4SA 1W7PA 3S93A 3D5RC 5F64A 1W4MA 2DA7A 5DD8A 1UG2A 4RGRA 4XRSA 4IVNA 3DLLF 2GXBA 1SVLA 1H8AC 1HOMA 2F5CA 2A5YB 4HAMA 5HVQC 4UV8A 4D0PA 2YSRA 1UB9A 2O03A 5D6EA 1ZQ3P 2E5ZA 2KISA 3CTAA 5TGTA 3GWZA 3K70C 2GM4A 4LMYA 2EFPA 3DBHB 4B3XA 3FISA 2CW7A 2HXOA 4GGGA 4A6DA 2PMUA 2DPUA 2A6EF 1RI7A 1MD0A 4RM3A 1XMAA 4IF4A 1X3WB 1NG7A 3LQQA 1HW1A 4XOPA 3HEFA 4AYBN 4M9ZA 2GXGA 3DEUA 4IRGA 4BQOA 2XIGA 4NQWB 5CJ9A 4A12A 3L09A 3HRTA 3DWLE 1FOYA 2X1CA 4N0BA 5GAEJ 2VXZA 1H89C 3SZTA 3F8MA 5EEAA 5DYMA 5EEGA 1WCMJ 3H9QA 4IQ4A 4RB1A 1MJBA 3WTZA 3GTOJ 4NC8A 4WF2A 3AG3H 1B9MA 4DYQA 2Z33A 5FFZA 3IH4A 5CLSA 4XNFA 2KIMA 4OINF 1KYZA 4CCJA 2XC7A 1ZRCA 5K5QA 1ZG1A 5CVJA 3J80K 1HKTA 2DQLA 4J01A 1M1EB 1MH4A 1FLIA 4RLQA 3WTUC 4XR6A 1YFHA 1O7FA 1HKSA 3DP7A 1Z3YA 1BC8C 4MGRA 4ZYHA 3CCMI 4G12A 4L5EA 4RA2A 1I6HJ 5M3MJ 4DZJA 1YITI 5CQGA 1IUFA 2PJRA 1TWHJ 1STZA 1TW3A 2L3DA 1BI2A 3D0SA 2Y75A 3GTGJ 5K5RA 2RKHA 4LG0B 2VQGA 3M7GA 4N9IA 5FKNA 2GA2A 3VDXA 2HVRA 2VXDA 3W3CA 3NWTA 3K4KA 3LFUA 4DOZA 3QYEA 1JJ8C 3CF2A 3HGGA 2L54A 3VYSB 1IV8A 3CO7C 4W97A 2WAFA 4YFKF 5ED4A 1MBFA 1V55H 5H6RA 2ZFUA 3R60A 4HQMA 3IH2A 1U5TC 2ZMEA 3QPSA 4BY7J 1TWFJ 1V54H 4CYDA 4Q47A 4MO7A 1J59A 1B9NA 2ID3A 4FHTA 3MVPA 1RIOH 2BHZA 2WWYA 5L3BA 1PDNC 1O57A 1REPC 1ONVA 1XMXA 2XB5A 3L00A 3U9GA 1YIOA 2ELKA 4IOCF 1V5FA 1ZGJA 3N4MA 3CP8A 5HDGA 5EGOB 2JJ7A 4ZTFA 4QLCU 2XHKA 2FD5A 4RGUA 1Y56A 1FOXA 5E3MA 1G59A 1RNLA 4MQ9F 4N4NB 4Y15A 1IN4A 2CU7A 5EGOA 1GDTA 2ZXJA 4IHTA 2XGCA 1J0RA 4BNCA 3KEYA 3T1BA 1VQ4I 2VC1A 1MZBA 1WJ5A 2M30A 3OV8A 3PNVA 1UMQA 4HV5A 3HRMA 2MBFA 4PDKA 2D2WA 4LOCA 1LB2A 3V7RA 1T08B 2JT1A 1XB4A 3FXOA 2PMZN 3PFIA 2GQQA 1EKEA 3NWSA 5A2QZ 1FIAA 3Q3SA 4XRSG 4A3IJ 2CUZA 2M2EA 1KONA 4PZJA 3SJMA 2H27A 2ZSHB 3IH3A 4BDZA 2FUG2 2HDDA 1X1PA 1W1WE 2JWTA 1QGPA 3D5SC 3H3UA 3VFZA 1MSFC 5FKMA 1WQ2A 2R7UA 2V6CA 2Y2ZA 3BPXA 3WTWC 2CV0A 1R5HA 1FMWA 3HOVJ 3QYFA 3TDUC 5EYRA 3HOUJ 1R4NB 2UZKA 1S5LC 4G6QA 2OQRA 4PCQA 1I6XA 4LJZF 4D5CA 5GPCA 3V7SA 4DYCA 3OS2A 1ETYA 3C2HA 4WCGA 5EEHA 1RKWA 3N05A 3J7AO 1U9NA 3G1MA 3GW2A 2VQCA 2P7CB 4HDUA 2DO7A 1H88C 1FC3A 2ZFWA 2OTLI 2F4IA 2EPFA 5AIQA 3OOUA 1ZREA 2QQ9A 4UUSA 1OKRA 4DQ2A 4HOBA 4IJAA 5J4YA 4II3A 1IN5A 2LC2A 1OJLA 2FMLA 3H3VK 4AWXB 1YX3A 1Y8QB 2O8XA 1W5SA 3I55I 3H0DA 2H8RA 4B4CA 3HG9A 5JVTA 2HQNA 2CUEA 3HJEA 3JRDA 3GTPJ 3S3OA 2DAOA 4II2A 1IDYA 5CVRA 1MMGA 4AIKA 1ETVA 1MDMB 1AWCA 3JR9A 4EV0A 3PNTA 2KJCA 3L2UA 2MD0A 3ZQIA 4AD9A 4KIGA 3WODF 3I59A 4JQFA 1WJDA 3FXUA 5DCMA 2IEKA 3MN2A 5BS6A 2EFNA 2R5ZB 4CH7A 5JI6A 2BOLA 2JRTA 2RV8A 2JPBA 1V5EA 3TOBA 2WB1A 2M8GX 4BXXJ 5IP9J 3W6VA 3E6BA 3M07A 3BZCA 3HPHA 4F55A 4RBOA 1P9QC 1V5GA 1IN8A 4RB0A 2L01A 3DPLC 4B47A 2HTSA 3QU6A 1WFXA 2M9HA 2W24A 2I10A 3LQRA 1OPCA 4HF2A 2RNJA 1IXCA 1ZHFA 1D1BA 5LLQA 3LOCA 3SXYA 4BBSJ 1F5TA 4HZFA 2Y48A 3K69A 2W1OA 2DT6A 2NS7A 4A3DJ 1BI3A 1KZHA 1EH7A 1FX7A 2HYJA 2ZMEC 4WXCA 2JVHA 2VL8A 3GTLJ 3GBGA 2HGCA 3JRGA 2CQXA 2H94A 3Q0UA 2ESNA 3Q0VA 3CCRI 3KP4A 1V4RA 4RB3C 5EZGA 1NK2P 2JA7J 4OMZA 1S29A 4YFNF 4HLYA 2O61A 5DUKA 1ZR4A 2CUJA 3S2DJ 5IOZA 4OAYA 1MGTA 3CMMA 2EB7A 3HPGA 1AKHB 1NG6A 2HI3A 1X1CA 3GLXA 3VPRA 1Z1DA 2DODA 4LITA 5J40A 1IXRC 3WGGA 1R23A 1RPWA 4P96A 3SEQA 1JKPC 4B44A 3PIPF 3S2HJ 4RGXA 3CCVI 2W25A 2VI6A 3LSMA 1OQYA 2OV7A 3D5LA 1I27A 4DIQA 3GTQJ 1MNMC 1UG0A 4L9TA 3P7NA 1T33A 2A6HF 2Y0SA 2DA3A 3PO2J 2UV1A 1P92A 1ITYA 2CG4A 2KLOA 3C18A 4ESFA 3F23A 3C3WA 3RIRA 3OIOA 3T8RA 3IRRA 2CJJA 1FJLA 4H4KC 1YG2A 3ZMTA 2IGNA 2HDWA 2Z1DA 2OUMA 1X4PA 2BV6A 1JHHA 2HOEA 1TL8A 4Q4ZF 3F8BA 2KPMA 3BJAA 3LSKA 3H36A 3K6GA 2R7SA 2PEXA 2ZCWA 3QAHA 2VPRA 2DBBA 3AG1H 3LA7A 2VE9A 2E34A 1ERDA 4WWCA 4E7SA 2HZDA 3HBLA 3L2RA 2E7XA 3CLQA 3E7LA 4JYKA 4CCOA 1GVDA 2DMUA 3ZQCA 4EJVA 4ENNA 3ASOH 1FBQA 1H0MA 1MMDA 3DPTA 1SEUA 3S1MJ 3ZXSA 3HUGA 2DMTA 4ASNA 4YIIA 1UFMA 2OTJI 2G9WA 2Q2EB 2LSOA 2QWWA 4UUVA 2K9MA 4Y7NJ 4EJTA 4I98B 3I64A 2OD5A 1MBEA 3CD6I 3J81K 4PSXA 2BY2A 1XX5A 5IYCJ 1DDNA 2HZTA 3WTYC 3LSPA 3AFHA 3GFMA 4S04A 4DGWB 4PUSA 4ENKA 1ZYRF 2EBIA 1Q1VA 2K02A 4L5IA 1N77A 3FXQA 4ZYEA 3TQNA 5KNLA 1Y1WJ 4GFBA 3S32A 4OIQF 3NRVA 1FNNA 1RETA 2QF7A 2X4HA 4NUBA 3RKXA 3MCZA 2P81A 4YELA 3ZQGA 1SFUA 3TW6A 1PP7U 2KRHA 3N97A 3JRCA 4XK4A 4HQEA 2YU3A 3OYEA 3UNGC 4HF1A 1T0FC 5E1XA 4L9VA 3V7CA 3ELKA 4A3CJ 3TOAA 3HRSA 1YIJI 2EV0A 1FOKA 1JUPA 3KP7A 1EJ9A 2NVQJ 2EV6A 4XRMA 2MC3A 2O0YA 3DEWA 5E1WA 1R58A 2IAIA 2VJIA 2RVCA 1YJWI 1PUFA 2RDPA 3DBLB 3L2VA 2E5NA 2K85A 5ICFA 2LBFB 9ANTA 5AONA 4LD5A 2M7AA 2V6EA 2VT3A 2LREA 2VKEA 2DMPA 4M3EA 3TDZC 2E7WA 2DPDA 5LHGA 2F5DA 4A69C 3RDIA 1XCBA 2L9VA 3B6CA 2LNBA 3FBNB 2KP6A 4ZDLA 4BL0B 1ZGWA 3EYIA 1E3HA 4I99C 3OSFA 3S1QJ 1FP1D 1IUYA 3IL2A 5HLGA 2JA6J 1OR7C 1Y6IA 1R1VA 4KITB 3GFLA 1JT0A 1JGSA 1YQAA 1TQMA 2KT0A 4ZDPA 1BOBA 1BOAA 1ZH5A 3O6BB 1HKQA 2VN2A 2KZGA 3I58A 3M8JA 3UR3C 1QO0D 2KZVA 2CQKA 5DUIA 4KN4X 1HW2A 2WAQA 4M6XA 2MH2A 2BGCA 3COAC 4YIFA 1EF4A 3GFIA 1TQIA 1KGSA 4F93B 2FXAA 5JHFA 3RTRA 4NHJA 1SFOJ 2FNAA 2HOSA 5CPRB 1MNEA 1UHSA 2M1BA 4FT8A 1YJ9I 3K4CA 2ID6A 2EFOA 2OPTA 3K2ZA 4BQAA 2V1XA 3C2GA 2KRFA 4PGHA 3GTJJ 1MDMA 1X2MA 3GF2A 1NK3P 4HSTA 2K7LA 4Y33A 3S16J 2E71A 5DEQA 3ABKH 4EJUA 1SD4A 2QENA 1R5GA 1S8NA 3HUGB 3IKTA 3HSEA 1RZ4A 2VUMJ 1P2FA 2M4KA 3GLLA 5LEKA 3OIPA 2WB1N 2QVOA 4I0AA 4BUPA 3CDHA 3E5XA 1EA3A 2FSWA 2L0KA 3QWLA 5IP7J 2BVLA 3WTXC 1E0EA 4HRIA 3BY6A 1N25A 3RKWA 4XLAA 2BBYA 2JA2A 1YYVA 2FBHA 2LOOA 2DTZA 4H0EA 2ACJA 3M3YJ 3ABLH 3MFKA 1R1TA 1MKMA 2CH0A 3CF5F 4NC6A 4KT5C 4EMSA 1T2KA 4KYWA 2IA1A 1QPMA 2F4OB 4BU2A 3ZPLA 1E2XA 1FTZA 5IY5H 3QPLA 1B59A 4UXNA 2EIJH 4RS8A 4HYEA 1VZ0A 2EILH 4U0VA 3KEOA 2E2JJ 2R5YB 1W7PD 3LA3A 4R8HA 1ZKGA 2ZBKA 4DW6A 5GTHC 5K5OA 4C2MJ 3LFKA 4V2FA 1G2HA 1JKOC 2XB0X 1GUUA 3RQ4A 5GAHJ 1D5YA 1I5ZA 4S05A 2EH3A 3TP3A 2HKOA 1SAXA 3O8HA 2KQRA 2O5RA 4XSXF 3I54A 2NVXJ 1E3PA 2XF7A 2EWNA 4DJAA 4Z6YA 2BW3A 2ZJPF 1IGNA 5HLTA 2L7ZA 1S9HA 2RC4A 4XLEA 1OYWA 3G1OA 3W6JB 3A02A 4CZCA 4X6AJ 4WXDA 3M1CA 4EVIA 5K7ZA 3U1KA 1JI8A 2LFBA 4E70A 1XDUA 3G4SI 3BR3A 2K3PA 1B8IA 5GADJ 2WTEA 2KDOA 3BG5A 3HOSA 3NAUA 3T0YA 1PJRA 4IKFA 4NNJA 4B3AA 1Y8RB 5BMZA 3P9CA 4M3GA 2BY0A 4LG0A 2JMWA 2DJNA 4BS9A 4Q5SF 4ZZDA 2Z3YA 4UVAA 3FXLA 4CXFA 2AS5F 2VQLA 3GX4X 1ZR2A 2V7FA 1AKHA 1SFEA 4M3DA 2LLKA 5HOOA 3L1PA 1IO2A 1U9OA 3CESA 4AVPA 3E97A 2ZXIA 3FM5A 4MNUA 3MMYB 3HOTA 2XVCA 3I56I 5GPAA 4HG2A 4ENMA 2VIXA 5E3OA 5J8CA 1J2XA 5DCFA 4IEJA 4E7ZA 3DV8A 2MA3A 5FB2A 3I59B 2IXSA 2LD5A 2CQ7A 4EEFG 3DU5A 2HVQA 2YPRA 1PUFB 2EK5A 2D45A 1LFPA 3T5XA 3VODA 4KMFA 2XAHA 1FYLA 2HOTA 4FQGA 1A04A 4BQNA 5EF6A 3J7YJ 3UKGA 2MSYA 3I9V2 1O3SA 5FRMA 3JRBA 1PVEA 3LA2A 4NC7A 1JUMA 3DQVC 4MEXF 3WHCA 5GAGJ 2KMUA 3BQZA 2DT5A 4RMNA 4IHWA 2P5LC 1OCTC 1OCOH 1B6AA 1HQCA 2DA2A 2E1MC 4DYRA 3G1LA 2F5FA 1TWAJ 2HNHA 3TO6A 4IX7A 1RUNA 2Q0OA 1OCCH 4RAYA 1CQTA 3WTVC 3MZ8A 1AU7A 3O8GA 3VSLA 3FM3A 1UCRA 5J1YA 2FF4A 3R4KA 2VASA 1I1SA 1T98A 1WVRA 3KLOA 2FEZA 2BY1A 2L4MA 5IP6A 1J5YA 1YW7A 1R00A 5F0FA 1D0YA 1QVUA 2R4GA 1Z3XA 3GZNB 1U6GA 2NVTJ 5BPDA 4BHBA 2VODA 3E1SA 4KN7X 2FOWA 1IRZA 4OAZA 2V1DA 4J00A 1BR2A 2MABA 3GZ6A 3E5UA 2VB6A 3SFZA 5B5EC 1KQ9A 3B73A 1X1DA 5L3EA 1W5TA 4A93J 5F08A 1YOVB 1XN7A 4UVBA 2OQGA 4DNCA 2JUCA 1FSEA 4ZYAA 2L2OA 1ZRDA 2GXAA 3QQAA 2FJ1A 2XF5A 3H5RA 4OMYA 1XG1A 3GCMA 4HNVA 2GOMA 2W00A 1CF7B 1U2WA 2VJJA 2ZJQF 2VKVA 4RB2C 1OYYA 1JE8A 2F5EA 2QLZA 1A6IA 2L7FP 2V9VA 4RDUA 1LVKA 2H1KA 4MIMA 3ISPA 3E6DA 2WV1A 2GBYA 5JR3A 1FIPA 3A01B 3G2BA 2QSGX 1HLVA 1Y1VJ 2HXIA 4KJZA 4D9JA 5LHIA 2E36A 2DN0A 2EZLA 4XBFA 3OYIA 1VQPI 2K4JA 4HEA2 2CSOA 3A4CA 2DOEA 5L3GA 4BJTA 1G3TA 1XC5A 3PJRA 3WE3A 2QKMB 2V4JC 3CZ6A 3I71A 5GP9A 5H6QA 2AHQA 3WU2C 2R5YA 1GXPA 1QVTA 4CCKA 4ZYGA 3ML6A 4HA8A 1MBHA 1ZGAA 3JCUC 5D8LB 3MZYA 2I8DA 3JSPA 3OYMA 1UELB 4G6DA 5LGTA 1G8XA 2LKXA 4RAFA 3RCOA 2KFDA 2HR3A 3M8EA 3OOPA 3TO9A 3MAJA 4AC0A 3VYTB 4F7ZA 4YEJA 3F6OA 3ZQFA 5FROA 1ENHA 5E18F 2OA4A 4Y17A 5TISC 3E5QA 1K4TA 3J7ZI 2IRFG 1W5CC 2BYVE 4KIBA 4BXUA 1WZ2A 3CDLA 4L9JA 3ZQLA 4CDGA 1GT0C 4U87A 3BPVA 4PJJA 1U5TB 2DW4A 2DOAA 3R0AA 4QPOA 2CW0F 5FLXZ 2IGMA 5DS9A 3QPHA 1QHHD 3ZRGA 3WTSC 3O3KA 1O4XA 1BJAA 3TGNA 2RQQA 1D1AA 3CJNA 4KMUX 2HQRA 5TJJA 4BJ5C 2JQ7A 3OYKA 1QBJA 3F6VA 2P6SA 2X1EA 4AM3A 5BPIA 5LRSA 5B1AH 1IN7A 2R7TA 3BWGA 2ELJA 3KFWX 1I3AA 2KIQA 3C1DA 4JOMA 3JRFA 2IS4A 2Y69H 4BE1A 1ODDA 5CVVA 2QCOA 4W1UA 3SHFA 2NNYA 3PUFA 4C9YA 3S3MA 2DFHA 2XKOA 4HNUA 1B72A 2R7VA 3KYDB 3HKZN 2ZNYA 3KIOA 1ZG3A 4KDPA 2UUZA 3RSNA 3ZN0A 5JLWA 1FBSA 4A0YA 1BBYA 2W57A 4BHPA 4MLOA 4EATA 4QTRA 3GTMJ 1F1ZA 4R79A 1MIJA 4DBQA 3ZOBA 1Y0UA 2XSJC 3CO6C 3C7JA 4M3FA 1D8JA 3PO3J 3DCFA 2N8GA 2OJED 4FX4A 1TP4A 2XRLA 3CP2A 4PJNA 2IT0A 3P9KA 1D8KA 2LYCA 3BTJA 3QPTA 2JPCA 3KP5A 3FWEA 2DMQA 4JK1X 4XN3A 5H20A 4L0ZB 1A6QA 4A0ZA 1WJFA 1XCVA 1KA8A 1QA6A 2DFEA 1QU3A 2CFXA 4CGZA 2PMHA 4ITVA 4LLGF 3MEXA 3FX3A 2NYXA 1MMNA 5LRRA 2EFQA 4QIWN 1VQNI 3CC2I 2X85A 3I0TA 1R36A 4G94A 1IRXA 4HNTA 2GAUA 4L0YB 2YS9A 3A2KA 4L18B 2D1VA 4AUXA 1B1BA 3WTTC 4I09A 2L9NA 3K4MA 1R7JA 3Q0WA 3NARA 1YS6A 2ZJ2A 2HWVA 2IA2A 1WH5A 4ZC3A 2DYRH 4A5NA 2M8EA 4Y52J 2OBPA 2XASA 1XD7A 3MWMA 2LR8A 2O6GE 4KISA 3KP2A 1XPXA 1TNTA 1DP3A 1DPRA 1WJEA 1VQ5I 2STTA 3OWTA 2R3SA 3CUOA 2Z99A 4KA4A 1XMKA 2FNPA 3ABUA 3EUKL 3JAMK 2B9SA 3H9GA 1QZZA 2B0LA 2PMZA 4PGGA 3AKZA 1TT5B 5IYDJ 2LG4A 3HRUA 2CUFA
chains in the Genus database with same CATH topology
2NVQJ 4M6VA 4XRMA 3DEWA 2IAIA 1PUFA 3IV5A 2L9RA 2DA5A 1POGA 9ANTA 3HM5A 2Y0SN 3JRIA 2OF7A 3WHBA 5FKLA 3M4OJ 2R5ZA 2VKEA 2DMPA 4M3EA 1VF9A 4A69C 3B6CA 1ZGWA 3S1QJ 5E3NA 2XSDC 3OSFA 3CQZJ 4JX6A 4CYCB 1HF0A 5C4JJ 2LVSA 2JA6J 4C3JJ 1JT0A 2KT0A 2EZKA 4V2GA 2JA5J 4DZPA 2E2HJ 3BR5A 1WPKA 1K61A 2E19A 3D1NI 2JK3A 3BT9A 1IG7A 1OCPA 2R92J 3HGYA 5JLXA 3JREA 1B72B 3I4NJ 1EF4A 1JT6A 4JP0A 1SFOJ 2HOSA 5FLMJ 1QRYA 3SDGA 3LSGA 1UHSA 5F1JA 5FKKA 3LSRA 1ORKA 2ID6A 2OPTA 5EG0A 4FISA 1JJ6C 2DA7A 3LNQA 1ZK8A 1UG2A 3GTJJ 4XRSA 1X2MA 1NK3P 2R7ZJ 1H8AC 1HOMA 2ECCA 5DTDA 1ZQ3P 3S16J 2GM4A 2RAEA 3FISA 2HXOA 1IV6A 2VUMJ 3BTCA 2WB1N 5IOYA 1TWCJ 2L0KA 5IP7J 3GTKJ 2ZB9A 4I76A 3HEFA 1BA5A 4AYBN 3FK6A 1K83J 1APLC 2DTZA 2MW8A 4A3GJ 3M3YJ 4D5FA 3LSJA 2O7OA 1OFCX 1H89C 2O8KA 4MFDA 5EEAA 1JUSA 4XIDA 4M3BA 1FTZA 1WCMJ 3QPLA 3F0CA 4BY1J 3GTOJ 2E2JJ 2R5YB 4DYQA 2COBA 2JA8J 1ZKGA 4DW6A 3IH4A 2Y9YA 2K9NA 4IHYA 2DA6A 4C2MJ 4V2FA 3ZQHA 5IPAA 2Y9ZA 1G2HA 1JKOC 2XB0X 4JX5A 3K2AA 1GUUA 1IC8A 1MH4A 2EZIA 1D5YA 1B8IB 2EH3A 3TP3A 5C4XJ 1TC3C 3O8HA 3FKIJ 2NVXJ 5K7HA 1IGNA 1R9TJ 5K7FA 2L7ZA 1TWGJ 4G12A 3I4MJ 3BR1A 4L5EA 4C3IJ 3G1OA 1I6HJ 5M3MJ 1MBJA 3A02A 4DZJA 3BR2A 4X6AJ 1IUFA 5K7ZA 1TWHJ 1RESA 2LFBA 2TRTA 2L7MP 3GTGJ 2CRGA 3BR3A 1B8IA 5FKNA 3BG5A 3NAUA 1JJ8C 3BR0A 1HDPA 3HGGA 4B3AA 1P7JA 4W97A 4A3KJ 4M3GA 1MBFA 2JMWA 1LFBA 2DJNA 3IH2A 4NDLA 4BY7J 3QPSA 1HCRA 1TWFJ 1ZR2A 4MO7A 2ID3A 1AKHA 3MVPA 2X48A 2JN6A 5E3LA 4M3DA 1FTTA 2LLKA 3SFIA 3L1PA 1WI3A 4A3MJ 1U9OA 2XB5A 4A3LJ 1VFCA 2LP0A 2ELKA 5EGOB 2JJ7A 5GPAA 1VI0A 1XS9A 5E3OA 2KDZA 2FD5A 1X58A 4IEJA 2LK2A 3BTLA 1WGXA 5E3MA 1YRNA 2LD5A 2CU7A 1MSEC 5EGOA 1GDTA 2E1OA 2XGCA 1JGGA 1LE8A 1X2NA 4EEFG 5EDNA 1PUFB 1ETWA 5M3FJ 1UMQA 1I3QJ 4A3JJ 3CMYA 2TCTA 2HOTA 3S14J 1ETXA 5EF6A 3UKGA 2MSYA 2DA1A 4J19A 1JKRC 5BNGA 3TP0A 4LOCA 3RQIA 3JRBA 1JUMA 5M5WJ 1LE8B 3WHCA 3HOXJ 2PMZN 3BQZA 1FIAA 1MH3A 3Q3SA 4XRSG 5F0CA 4IHWA 3HOWJ 1OCTC 4A3IJ 2DA2A 2M2EA 4DYRA 3G1LA 4MFEA 1TWAJ 3SJMA 3IH3A 3JRHA 2HDDA 2XPWA 1CQTA 2JWTA 3RZDJ 1MSFC 1AU7A 5FKMA 1P7IA 3O8GA 2X9DA 4D7MA 5HODA 1LFUP 4S0HB 3HDDA 5C3EJ 5J1YA 2Y2ZA 1U78A 3HOVJ 5EYRA 3HOUJ 3BG3A 5J1UA 5IP6A 2LY9A 4BKXA 5F0FA 4D5CA 1JTYA 5GPCA 1QVUA 3PM1A 3BQYA 4DYCA 2NVTJ 1ETYA 1W0TA 1SANA 1DU0A 1RKWA 1IRZA 1U9NA 3G1MA 3RZOJ 3K7AJ 4UUTA 4X1EA 1H88C 2ME6A 4FTHA 3OOUA 1T56A 1GV5A 4UUSA 4IHXA 2O9LA 4A93J 5F08A 1OJLA 2K40A 3H3VK 2H8RA 4B4CA 2FQ4A 2CUEA 3JRDA 3QQAA 2FJ1A 3GTPJ 1XG1A 5IYBJ 4HNVA 1IDYA 2HOAA 3B6AA 2R93J 1FEXA 1ETVA 3JR9A 2XGDA 2VKVA 3A03A 2CQQA 3BTIA 1A6IA 2L7FP 3ZQIA 4RDUA 2H1KA 4JX4A 1RR7A 1YRNB 4MIMA 2WV1A 2IEKA 2GBYA 3MN2A 1FIPA 1BW6A 3A01B 2R5ZB 1HLVA 1Y1VJ 2HXIA 2AO9A 1WH7A 2YUSA 5FLVA 2NS8A 4UUSB 2M8GX 2DN0A 2EZLA 5IP9J 1F36A 5F04A 3W6VA 4BXXJ 2IBDA 1XC5A 4RBOA 1JTXA 2R5YA 5GP9A 2R0QC 2AHQA 1QVTA 2X6OA 1MBHA 2NOGA 1VNDA 2M9HA 2I10A 5FJ8J 4XICA 3TW7A 2LKXA 2Y31A 1BL0A 3LOCA 1MBGA 4BBSJ 4AC0A 4A3FJ 4D7NA 3ZQFA 1ENHA 2NS7A 4A3DJ 3RKQA 5M5YJ 4FE4A 2G0EA 2HYJA 3GTLJ 5J3LA 3GBGA 3JRGA 1ETKA 3CDLA 2CQXA 3Q0UA 3ZQLA 3Q0VA 1GT0C 5F0HA 1NK2P 3CCYA 2M34A 5EZGA 2JA7J 4A3EJ 1IJWC 4C3HJ 3BG9A 1ZR4A 1U8BA 5DS9A 1QPIA 1ETOA 3S2DJ 5IOZA 2ME0A 1MBKA 1AKHB 1O4XA 2HI3A 3VPRA 5FKOA 2DA4A 2WAQN 1RPWA 1BW5A 1JKPC 2XPUA 3S2HJ 3HB9A 2VI6A 1BJZA 3GTQJ 1AHDP 1MNMC 2XGEA 3S1NJ 1T33A 3JRFA 4ABZA 2DA3A 5M5XJ 1HDDC 3PO2J 3HOYJ 1ITYA 1NTCA 1Z0XA 2QCOA 3OIOA 4W1UA 2CJJA 1B72A 1FJLA 3A01A 3HKZN 3C2BA 1JKQC 2MG4A 5JLWA 2D5VA 3S17J 3FK7A 3GTMJ 4QTRA 4MLOA 3TEDA 1S7EA 3HOZJ 3ZOBA 2XPVA 4A3BJ 5C44J 2VPRA 2K9SA 4M3FA 4CYCA 2K9QA 5J1RA 3PO3J 3DCFA 2N8GA 3HBLA 2XRLA 2B63J 1W0UA 1RKTA 3E7LA 3BTJA 4JYKA 1GVDA 2MGQA 2DMUA 2DMQA 3ZQCA 5EZHA 1Z77A 1I50J 2W48A 4IHVA 3S1MJ 5F27A 4QIWN 3FIWA 4B1RA 2E2IJ 2DMTA 1A5JA 1ETQA 3MKLA 2GLOA 2YS9A 1GV2A 4FE7A 4Y7NJ 2M0CA 3S15J 4AUXA 1MBEA 1IDZA 3S1RJ 5IYCJ 2EQRA 3LSPA 3Q0WA 2NVYJ 3NARA 3BR6A 1WH5A 2EBIA 1Q1VA 3OSGA 4Y52J 5EG0B 2HQ5A 1Y1WJ 4GFBA 2FX0A 1E3OC 2LR8A 2QF7A 1RETA 4BBRJ 2DMNA 2ECBA 4I6ZA 2P81A 3ZQGA 2Y30A 1DU6A 3TW6A 2EZHA 4XK4A 3H0GJ 3JRCA 2LTPA 4QSHA 4A3CJ 1ZTRA 3JRAA 2YU9J 5IYDJ 4FCYA 1F43A 1JUPA 2CUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ J;  4M6V A;  4XRM A;  3DEW A;  2IAI A;  1PUF A;  3IV5 A;  2L9R A;  2DA5 A;  1POG A;  9ANT A;  3HM5 A;  2Y0S N;  3JRI A;  2OF7 A;  3WHB A;  5FKL A;  3M4O J;  2R5Z A;  2VKE A;  2DMP A;  4M3E A;  1VF9 A;  4A69 C;  3B6C A;  1ZGW A;  3S1Q J;  5E3N A;  2XSD C;  3OSF A;  3CQZ J;  4JX6 A;  4CYC B;  1HF0 A;  5C4J J;  2LVS A;  2JA6 J;  4C3J J;  1JT0 A;  2KT0 A;  2EZK A;  4V2G A;  2JA5 J;  4DZP A;  2E2H J;  3BR5 A;  1WPK A;  1K61 A;  2E19 A;  3D1N I;  2JK3 A;  3BT9 A;  1IG7 A;  1OCP A;  2R92 J;  3HGY A;  5JLX A;  3JRE A;  1B72 B;  3I4N J;  1EF4 A;  1JT6 A;  4JP0 A;  1SFO J;  2HOS A;  5FLM J;  1QRY A;  3SDG A;  3LSG A;  1UHS A;  5F1J A;  5FKK A;  3LSR A;  1ORK A;  2ID6 A;  2OPT A;  5EG0 A;  4FIS A;  1JJ6 C;  2DA7 A;  3LNQ A;  1ZK8 A;  1UG2 A;  3GTJ J;  4XRS A;  1X2M A;  1NK3 P;  2R7Z J;  1H8A C;  1HOM A;  2ECC A;  5DTD A;  1ZQ3 P;  3S16 J;  2GM4 A;  2RAE A;  3FIS A;  2HXO A;  1IV6 A;  2VUM J;  3BTC A;  2WB1 N;  5IOY A;  1TWC J;  2L0K A;  5IP7 J;  3GTK J;  2ZB9 A;  4I76 A;  3HEF A;  1BA5 A;  4AYB N;  3FK6 A;  1K83 J;  1APL C;  2DTZ A;  2MW8 A;  4A3G J;  3M3Y J;  4D5F A;  3LSJ A;  2O7O A;  1OFC X;  1H89 C;  2O8K A;  4MFD A;  5EEA A;  1JUS A;  4XID A;  4M3B A;  1FTZ A;  1WCM J;  3QPL A;  3F0C A;  4BY1 J;  3GTO J;  2E2J J;  2R5Y B;  4DYQ A;  2COB A;  2JA8 J;  1ZKG A;  4DW6 A;  3IH4 A;  2Y9Y A;  2K9N A;  4IHY A;  2DA6 A;  4C2M J;  4V2F A;  3ZQH A;  5IPA A;  2Y9Z A;  1G2H A;  1JKO C;  2XB0 X;  4JX5 A;  3K2A A;  1GUU A;  1IC8 A;  1MH4 A;  2EZI A;  1D5Y A;  1B8I B;  2EH3 A;  3TP3 A;  5C4X J;  1TC3 C;  3O8H A;  3FKI J;  2NVX J;  5K7H A;  1IGN A;  1R9T J;  5K7F A;  2L7Z A;  1TWG J;  4G12 A;  3I4M J;  3BR1 A;  4L5E A;  4C3I J;  3G1O A;  1I6H J;  5M3M J;  1MBJ A;  3A02 A;  4DZJ A;  3BR2 A;  4X6A J;  1IUF A;  5K7Z A;  1TWH J;  1RES A;  2LFB A;  2TRT A;  2L7M P;  3GTG J;  2CRG A;  3BR3 A;  1B8I A;  5FKN A;  3BG5 A;  3NAU A;  1JJ8 C;  3BR0 A;  1HDP A;  3HGG A;  4B3A A;  1P7J A;  4W97 A;  4A3K J;  4M3G A;  1MBF A;  2JMW A;  1LFB A;  2DJN A;  3IH2 A;  4NDL A;  4BY7 J;  3QPS A;  1HCR A;  1TWF J;  1ZR2 A;  4MO7 A;  2ID3 A;  1AKH A;  3MVP A;  2X48 A;  2JN6 A;  5E3L A;  4M3D A;  1FTT A;  2LLK A;  3SFI A;  3L1P A;  1WI3 A;  4A3M J;  1U9O A;  2XB5 A;  4A3L J;  1VFC A;  2LP0 A;  2ELK A;  5EGO B;  2JJ7 A;  5GPA A;  1VI0 A;  1XS9 A;  5E3O A;  2KDZ A;  2FD5 A;  1X58 A;  4IEJ A;  2LK2 A;  3BTL A;  1WGX A;  5E3M A;  1YRN A;  2LD5 A;  2CU7 A;  1MSE C;  5EGO A;  1GDT A;  2E1O A;  2XGC A;  1JGG A;  1LE8 A;  1X2N A;  4EEF G;  5EDN A;  1PUF B;  1ETW A;  5M3F J;  1UMQ A;  1I3Q J;  4A3J J;  3CMY A;  2TCT A;  2HOT A;  3S14 J;  1ETX A;  5EF6 A;  3UKG A;  2MSY A;  2DA1 A;  4J19 A;  1JKR C;  5BNG A;  3TP0 A;  4LOC A;  3RQI A;  3JRB A;  1JUM A;  5M5W J;  1LE8 B;  3WHC A;  3HOX J;  2PMZ N;  3BQZ A;  1FIA A;  1MH3 A;  3Q3S A;  4XRS G;  5F0C A;  4IHW A;  3HOW J;  1OCT C;  4A3I J;  2DA2 A;  2M2E A;  4DYR A;  3G1L A;  4MFE A;  1TWA J;  3SJM A;  3IH3 A;  3JRH A;  2HDD A;  2XPW A;  1CQT A;  2JWT A;  3RZD J;  1MSF C;  1AU7 A;  5FKM A;  1P7I A;  3O8G A;  2X9D A;  4D7M A;  5HOD A;  1LFU P;  4S0H B;  3HDD A;  5C3E J;  5J1Y A;  2Y2Z A;  1U78 A;  3HOV J;  5EYR A;  3HOU J;  3BG3 A;  5J1U A;  5IP6 A;  2LY9 A;  4BKX A;  5F0F A;  4D5C A;  1JTY A;  5GPC A;  1QVU A;  3PM1 A;  3BQY A;  4DYC A;  2NVT J;  1ETY A;  1W0T A;  1SAN A;  1DU0 A;  1RKW A;  1IRZ A;  1U9N A;  3G1M A;  3RZO J;  3K7A J;  4UUT A;  4X1E A;  1H88 C;  2ME6 A;  4FTH A;  3OOU A;  1T56 A;  1GV5 A;  4UUS A;  4IHX A;  2O9L A;  4A93 J;  5F08 A;  1OJL A;  2K40 A;  3H3V K;  2H8R A;  4B4C A;  2FQ4 A;  2CUE A;  3JRD A;  3QQA A;  2FJ1 A;  3GTP J;  1XG1 A;  5IYB J;  4HNV A;  1IDY A;  2HOA A;  3B6A A;  2R93 J;  1FEX A;  1ETV A;  3JR9 A;  2XGD A;  2VKV A;  3A03 A;  2CQQ A;  3BTI A;  1A6I A;  2L7F P;  3ZQI A;  4RDU A;  2H1K A;  4JX4 A;  1RR7 A;  1YRN B;  4MIM A;  2WV1 A;  2IEK A;  2GBY A;  3MN2 A;  1FIP A;  1BW6 A;  3A01 B;  2R5Z B;  1HLV A;  1Y1V J;  2HXI A;  2AO9 A;  1WH7 A;  2YUS A;  5FLV A;  2NS8 A;  4UUS B;  2M8G X;  2DN0 A;  2EZL A;  5IP9 J;  1F36 A;  5F04 A;  3W6V A;  4BXX J;  2IBD A;  1XC5 A;  4RBO A;  1JTX A;  2R5Y A;  5GP9 A;  2R0Q C;  2AHQ A;  1QVT A;  2X6O A;  1MBH A;  2NOG A;  1VND A;  2M9H A;  2I10 A;  5FJ8 J;  4XIC A;  3TW7 A;  2LKX A;  2Y31 A;  1BL0 A;  3LOC A;  1MBG A;  4BBS J;  4AC0 A;  4A3F J;  4D7N A;  3ZQF A;  1ENH A;  2NS7 A;  4A3D J;  3RKQ A;  5M5Y J;  4FE4 A;  2G0E A;  2HYJ A;  3GTL J;  5J3L A;  3GBG A;  3JRG A;  1ETK A;  3CDL A;  2CQX A;  3Q0U A;  3ZQL A;  3Q0V A;  1GT0 C;  5F0H A;  1NK2 P;  3CCY A;  2M34 A;  5EZG A;  2JA7 J;  4A3E J;  1IJW C;  4C3H J;  3BG9 A;  1ZR4 A;  1U8B A;  5DS9 A;  1QPI A;  1ETO A;  3S2D J;  5IOZ A;  2ME0 A;  1MBK A;  1AKH B;  1O4X A;  2HI3 A;  3VPR A;  5FKO A;  2DA4 A;  2WAQ N;  1RPW A;  1BW5 A;  1JKP C;  2XPU A;  3S2H J;  3HB9 A;  2VI6 A;  1BJZ A;  3GTQ J;  1AHD P;  1MNM C;  2XGE A;  3S1N J;  1T33 A;  3JRF A;  4ABZ A;  2DA3 A;  5M5X J;  1HDD C;  3PO2 J;  3HOY J;  1ITY A;  1NTC A;  1Z0X A;  2QCO A;  3OIO A;  4W1U A;  2CJJ A;  1B72 A;  1FJL A;  3A01 A;  3HKZ N;  3C2B A;  1JKQ C;  2MG4 A;  5JLW A;  2D5V A;  3S17 J;  3FK7 A;  3GTM J;  4QTR A;  4MLO A;  3TED A;  1S7E A;  3HOZ J;  3ZOB A;  2XPV A;  4A3B J;  5C44 J;  2VPR A;  2K9S A;  4M3F A;  4CYC A;  2K9Q A;  5J1R A;  3PO3 J;  3DCF A;  2N8G A;  3HBL A;  2XRL A;  2B63 J;  1W0U A;  1RKT A;  3E7L A;  3BTJ A;  4JYK A;  1GVD A;  2MGQ A;  2DMU A;  2DMQ A;  3ZQC A;  5EZH A;  1Z77 A;  1I50 J;  2W48 A;  4IHV A;  3S1M J;  5F27 A;  4QIW N;  3FIW A;  4B1R A;  2E2I J;  2DMT A;  1A5J A;  1ETQ A;  3MKL A;  2GLO A;  2YS9 A;  1GV2 A;  4FE7 A;  4Y7N J;  2M0C A;  3S15 J;  4AUX A;  1MBE A;  1IDZ A;  3S1R J;  5IYC J;  2EQR A;  3LSP A;  3Q0W A;  2NVY J;  3NAR A;  3BR6 A;  1WH5 A;  2EBI A;  1Q1V A;  3OSG A;  4Y52 J;  5EG0 B;  2HQ5 A;  1Y1W J;  4GFB A;  2FX0 A;  1E3O C;  2LR8 A;  2QF7 A;  1RET A;  4BBR J;  2DMN A;  2ECB A;  4I6Z A;  2P81 A;  3ZQG A;  2Y30 A;  1DU6 A;  3TW6 A;  2EZH A;  4XK4 A;  3H0G J;  3JRC A;  2LTP A;  4QSH A;  4A3C J;  1ZTR A;  3JRA A;  2YU9 J;  5IYD J;  4FCY A;  1F43 A;  1JUP A;  2CUF A; 
#chains in the Genus database with same CATH topology
 2P0W A;  4M6V A;  4GCV A;  2P6T A;  5HDK A;  5J4V A;  3F8C A;  3VSK A;  4C30 A;  3TBI A;  1WJA A;  3U2R A;  1G6N A;  4BQQ A;  3OYJ A;  2L9R A;  3V4G A;  2Y0S N;  3JRI A;  2OF7 A;  3AAF A;  2JTV A;  2XAF A;  3BLY A;  2A68 F;  4GYI A;  4I7H A;  3WHB A;  3M4O J;  4EQQ A;  1ACI A;  3WGI A;  2ZKZ A;  1Z05 A;  1DP7 P;  3CJT B;  3WU1 B;  2XSD C;  3CQZ J;  3AG4 H;  4CYC B;  3FDY A;  1HF0 A;  1N75 A;  1T39 A;  2COM A;  1FMV A;  1VQ6 I;  2KRC A;  1FY7 A;  2EJR A;  1WI9 A;  3X2Q H;  3BT9 A;  3HC7 A;  1ZG5 A;  1VQO I;  2EA2 A;  2ZME B;  5JLX A;  4B43 A;  4GDF A;  3FXK A;  1OR7 A;  2ICW G;  2X6Y A;  4ENJ A;  4IXA A;  3F8N A;  1LVA A;  1SD5 A;  3SDG A;  3LSG A;  4ZTJ A;  4E4H A;  2QQB A;  3LSR A;  5A2Q K;  1ORK A;  2XKP A;  1QZY A;  3CJR B;  2L7K A;  4G8X A;  4IRH A;  5CQE A;  2V1N A;  1JJ6 C;  5AIP A;  2VT2 A;  4FET A;  1ZK8 A;  3S2W A;  2PX9 A;  2QKL B;  4HSR A;  1T0F A;  5DTD A;  2FBI A;  1VQ8 I;  2PLY A;  5B3S H;  3GME A;  3W6K B;  1IV6 A;  4DBR A;  3LAJ A;  1T6S A;  3BCB A;  2RQP A;  5IOY A;  3BZ6 A;  1UST A;  1LEB A;  3GTK J;  1J09 A;  2CWE A;  2ZB9 A;  2HU9 A;  3ECH A;  1BA5 A;  1APL C;  1ON1 A;  3EUH A;  3LST A;  3F22 A;  2DTR A;  1S7O A;  1SFX A;  3OY9 A;  4N9H A;  2WBM A;  4P9F A;  2IW5 A;  4D5F A;  3LSJ A;  2QM3 A;  2STW A;  4IHS A;  2MFZ A;  4XID A;  2AQF A;  5F1R A;  3HXL A;  3KYL A;  1TT0 A;  3KZZ A;  4BY1 J;  3HIF A;  3A0H C;  2OCC H;  4CO8 A;  4U7D A;  4OIP F;  3ABM H;  3QOD A;  2QSF X;  3OR2 C;  4MTD A;  2NOJ B;  2PQ8 A;  3ROU A;  3L2Q A;  5HS9 A;  3R61 A;  1U3E M;  2X6W A;  4BJ6 C;  4ZDO A;  2K9N A;  2Y9Y A;  4Q48 A;  1XSD A;  2DA6 A;  4IHY A;  2IS2 A;  1LUJ B;  4MQV A;  3DTI A;  4XMY A;  4L9N A;  2Y9Z A;  1BI1 A;  3CCQ I;  1IC8 A;  3REO A;  4GRI A;  4EGZ A;  1B8I B;  4XLP F;  2IS1 A;  1MMS A;  2Q1Z B;  2A6T A;  1XGN A;  1Z6T A;  1TC3 C;  4EGY A;  3HZJ A;  1YS7 A;  3K1P A;  1K6O A;  3FKI J;  3BRO A;  4MEY F;  5K1Y A;  3JSO A;  1BR4 A;  5LBQ A;  1KU9 A;  2O3F A;  2HDC A;  5K7F A;  2HFH A;  5LD2 C;  1TWG J;  1FT9 A;  2H6C A;  3I4M J;  3BR1 A;  2G7H A;  2CV2 A;  1MBJ A;  2XRN A;  3RPU A;  3BR2 A;  2QBY A;  5IT3 A;  3FKJ A;  3FXM A;  2TRT A;  4XLH A;  1TTY A;  3T8T A;  2L7M P;  4IQJ A;  2CRG A;  2A3S A;  3P9I A;  1W7P B;  2F4M B;  3FBI B;  5L3C A;  4XSZ F;  3F72 A;  4CUG A;  1SD6 A;  2VBZ A;  2LDU A;  3BR0 A;  3OYB A;  3HTS B;  2IVM A;  4LIU A;  4I2O A;  4A3K J;  1QHG A;  3FZV A;  1S72 I;  1YHQ I;  2NAZ A;  4E6K G;  5FFX A;  3ZCO A;  4D1Q A;  1HCR A;  2DU9 A;  4OIO F;  1DQU A;  3CUQ B;  2XAG A;  3P5J A;  4HF0 A;  3RYR A;  3WG7 H;  4UV9 A;  3AL0 C;  3DFG A;  1FWZ A;  2CFO A;  3K1M A;  2JN6 A;  3EDP A;  2JUG A;  5E3L A;  4V19 K;  1WI3 A;  4A3M J;  4O6J A;  1K7A A;  1GLN A;  2HKX A;  5DDG A;  4A3L J;  3MKY B;  4IL6 C;  1VFC A;  2LP0 A;  2WAE A;  2LF7 A;  5FO5 A;  5J47 A;  1VI0 A;  1XS9 A;  3QYB A;  3JW4 A;  2ESH A;  1KQ0 A;  1X58 A;  1T95 A;  3HSF A;  2LK2 A;  4JBA A;  3BTL A;  1NH3 A;  2V1U A;  1IXS B;  4LG3 A;  2HTJ A;  1MSE C;  2E1O A;  5H2F C;  1OYI A;  2GA1 A;  2TDX A;  1JGG A;  1LE8 A;  1X2N A;  3NEU A;  4XOT A;  3CMA I;  2B7E A;  1ETW A;  1KU3 A;  2R7O A;  5M3F J;  2K3F A;  3DPU A;  3J81 Z;  1LPQ A;  4UNO A;  3CMY A;  2TCT A;  1ETX A;  4LGW A;  1JKR C;  5DM6 F;  4UB8 C;  2FA5 A;  3EUH C;  4LLL A;  3OMY A;  3ONQ A;  3RQI A;  5FRN A;  1BN5 A;  4LK1 F;  3FXJ A;  5M5W J;  3SYT A;  1LE8 B;  3HOX J;  1BM9 A;  4UY8 I;  3V42 A;  2RN7 A;  1MH3 A;  5FD5 A;  3HOW J;  2RGV A;  1X4O A;  3S8P A;  1J9I A;  2OAZ A;  2VPL A;  2AXT C;  5L3D A;  1RRJ A;  4MHG A;  2XPW A;  3J80 Z;  3RZD J;  3OS1 A;  3E6M A;  4D7M A;  1LFU P;  4S0H B;  5C3E J;  2CV1 A;  2FU4 A;  3GO5 A;  1W36 C;  5B1B H;  3L9F A;  2VQH A;  3VYR B;  2NXN B;  5BQT A;  3G6E I;  2LY9 A;  3CJQ B;  3PM1 A;  1FPQ A;  2VKD A;  3LSI A;  3BQY A;  1DPU A;  3DEE A;  5E79 C;  4EM1 A;  3FXR A;  2IJL A;  4B09 A;  4I0B A;  3BZK A;  4EJW A;  4UUT A;  2ELH A;  2UXN A;  1H9T A;  4XKB A;  2ME6 A;  4FTH A;  3ZMD A;  3IRQ A;  5FLX K;  3V8J A;  3ZN1 A;  3OYD A;  2KKO A;  1SC7 A;  3TMO A;  1HXD A;  2W84 A;  3OL3 A;  2K40 A;  2RRE A;  4MTE A;  3RPU D;  2PJR B;  1LDJ A;  4F3Q A;  5D5W B;  4ZYD A;  2FQ4 A;  1K78 B;  4FX0 A;  1GXQ A;  4ZH4 F;  1G3Y A;  2XAQ A;  5IYB J;  1YJN I;  4IRI A;  1ZN2 A;  3H5N A;  2PG4 A;  3B6A A;  2R93 J;  3SZG A;  3PQK A;  2XGD A;  3MZH A;  2UXX A;  2E1N A;  3A03 A;  2CQQ A;  3Q9V A;  2PBI A;  2X0L A;  1RR7 A;  5ICE A;  1YRN B;  3H92 A;  5HS7 A;  2ZNZ A;  3OL4 A;  4U0W A;  2DXI A;  1BW6 A;  2AO9 A;  4E7J A;  4HX4 A;  2YUS A;  5FLV A;  2GIV A;  3FMR A;  2NS8 A;  4UUS B;  1F36 A;  4GO1 A;  5F04 A;  4CSW A;  5HNF A;  1JTX A;  5D8K B;  1X1B A;  4LB5 A;  2X6O A;  4AU7 A;  1SD7 A;  1UAA A;  1SFK A;  2EIK H;  1D0Z A;  3K4J A;  3TL4 X;  2NRA C;  2DK5 A;  1VND A;  4R1H A;  1Z7L A;  2AXL A;  1R71 A;  3LMM A;  3TW7 A;  4XM3 A;  3BP8 A;  3VYU B;  2Y31 A;  5E8I A;  1MBG A;  3K10 A;  4M72 A;  4Y3O A;  1WSU A;  1BC7 C;  2BZT A;  4RLF A;  3V8K A;  2EFW A;  3RKQ A;  1JHF A;  2V9K A;  2G0E A;  1R6R A;  2H1L A;  3K1N A;  4RM2 A;  4IO9 F;  2PFB A;  2K27 A;  2X6X A;  3CCY A;  1IJW C;  5KVR A;  2RNG A;  1LJ9 A;  3BG9 A;  4C3H J;  1U8B A;  1QPI A;  1YI2 I;  1DGR M;  1VQL I;  3MQ0 A;  1WJB A;  4U7B A;  3O2P E;  4Y4R A;  1AA7 A;  2HPI A;  3SQN A;  4OIR F;  3ZMS A;  1EH8 A;  2GIZ A;  5D6F A;  4LB6 B;  3QRF F;  5J6X A;  2M45 A;  2DA4 A;  1F9N A;  3H9J A;  2WAQ N;  2ZC2 A;  1TBX A;  2A61 A;  4E7L A;  1BW5 A;  2XPU A;  3HB9 A;  1YX5 A;  4XKC A;  3QP6 A;  3K4L A;  1ZLK A;  3S1N J;  3H1C A;  4ABZ A;  1XGO A;  2M7B A;  3E0J B;  5M5X J;  1O3T A;  1HDD C;  3BC8 A;  1NTC A;  3GEZ A;  4UVC A;  4BEH A;  2XRO A;  3HOY J;  4PFP A;  5TRD A;  3GUD A;  1WRJ A;  1YLF A;  5IT9 Z;  3CCL I;  3A01 A;  3C2B A;  3U1D A;  4I02 A;  1R22 A;  5LGN A;  2H09 A;  1YW9 A;  3HSR A;  1K6Y A;  2CMP A;  4NB5 A;  1BIB A;  3TED A;  1FOW A;  1S7E A;  1HA8 A;  4B48 A;  1SVM A;  2LMD A;  2K9L A;  5C44 J;  1P4A A;  2V9P A;  3IAS 2;  4CYC A;  2K9Q A;  2MLG A;  2EIM H;  5IT9 K;  2E1M B;  2JSC A;  2CW8 A;  1W0U A;  4AYB A;  2ZXH A;  3FMQ A;  1RKT A;  2ZJR F;  2UWM A;  5DV5 A;  1X19 A;  5EZH A;  1G4D A;  1VTN C;  5FD6 A;  3NQO A;  1RR8 C;  2W48 A;  4IHV A;  2R7X A;  4XL9 A;  4N4O B;  2HEO A;  5F27 A;  1XSX A;  3FIW A;  3VOE A;  2DQR A;  1A5J A;  1UHW A;  1FSH A;  1T38 A;  1ETQ A;  1C0W A;  1Z67 A;  3CC7 I;  1Z21 A;  2P4W A;  3KP3 A;  2MLK A;  2LY1 A;  1CF7 A;  3BJ6 A;  1GV2 A;  1KU2 A;  2NVU B;  2M0C A;  2LRD A;  3S15 J;  2WC2 A;  3CLO A;  1GHC A;  3S1R J;  1IN6 A;  1IDZ A;  4UHT A;  2EQR A;  3PUB A;  4KFC A;  4GYG A;  3PQJ A;  5ILU A;  5EG0 B;  1ZEL A;  1R49 A;  2HQ5 A;  2FX0 A;  5LGU A;  1E3O C;  2HS5 A;  3ZMZ A;  2DMN A;  2ECB A;  4I6Z A;  5DCM B;  4BH9 A;  4KUM A;  5E20 A;  2XDV A;  2F5V A;  5BOX A;  1Q1H A;  4CCM A;  1DGW Y;  2FRH A;  1WJC A;  3VEP A;  1VQ7 I;  2LTP A;  1D3Y A;  1RC9 A;  3WGH A;  1X3Z B;  1ZTR A;  3JRA A;  1TLH B;  4FCY A;  3DBR B;  5D4R A;  1F43 A;  3L2W A;  1YTY A;  5JVG F;  3DKW A;  5JFR A;  3ZP5 A;  4E7H A;  3OYC A;  2P5V A;  3QOP A;  1VQK I;  2K4B A;  2BEO A;  2DA5 A;  3ASN H;  5B66 C;  2VBX A;  2A05 A;  2R5Z A;  3OS0 A;  4E7K A;  1VF9 A;  1X1A A;  1U8R A;  2DFI A;  3KX2 A;  3ULQ B;  3LAP A;  3E6C C;  1IW7 F;  2R7W A;  1OCZ H;  5C4J J;  2LVS A;  3JTH A;  3KE2 A;  3QU3 A;  4YFX F;  3CCS I;  4PSW A;  2X1D A;  4A2U A;  4C3J J;  3JAM Z;  2KJB A;  4IZZ A;  5E8G A;  2PJP A;  3PNY A;  5D5X B;  2BY3 A;  4HX7 A;  2KIF A;  4BYY A;  2MD5 A;  3U21 A;  2LH9 A;  4ETS A;  4PJL A;  3BR5 A;  1WPK A;  4XOR A;  2E19 A;  3HHH A;  4HPQ A;  2KIU A;  1IG7 A;  1TW2 A;  4XRF A;  4NQW A;  1EH6 A;  2Z9O A;  2R92 J;  2BE5 F;  3HGY A;  1H9G A;  3ERM A;  3JRE A;  3EPZ A;  1B72 B;  1U5T A;  4JP0 A;  2LKS A;  1SVO A;  3CME I;  3KET A;  5FLM J;  2VLA A;  3OIQ A;  4XKV A;  5F1J A;  1QNT A;  5FKK A;  1WWX A;  2A5W A;  3R0J A;  3OYN A;  5EG0 A;  2FMY A;  3PSI A;  4FIS A;  3K0L A;  4ZJZ A;  1RUO A;  3W2A A;  2IGO A;  1SMT A;  2LKP A;  2QQA A;  3IP4 B;  4CCN A;  3LNQ A;  4ESB A;  3GZ5 A;  1IRG A;  3EUA A;  2R7Z J;  1Z6R A;  2R7F A;  2ECC A;  2JVG A;  1MND A;  3DTE A;  2JZY A;  2FE3 A;  3QP5 A;  4CZZ A;  5FGM A;  1ZAO A;  2NNN A;  4O5V A;  4CIC A;  1D1C A;  2E60 A;  2W7N A;  1L3L A;  2Z5U A;  2RAE A;  4M74 A;  3MKW B;  1HSJ A;  1ZRF A;  2L9S A;  2BXY A;  1Z9C A;  5HLH A;  1OIS A;  3GFJ A;  3BTC A;  2EA4 A;  4IOA F;  1MJ9 A;  1TWC J;  1LDK B;  1W36 D;  2FBK A;  1XGS A;  4I76 A;  5KK1 A;  3FK6 A;  1K83 J;  3SDB A;  2Z2S B;  3CDI A;  2MW8 A;  4A3G J;  4YG2 F;  2PN6 A;  3V8L A;  2JSP A;  2ZXW H;  4UB6 C;  2O7O A;  1OFC X;  1J75 A;  2O8K A;  4MFD A;  3MKZ A;  3OYG A;  1JUS A;  2FOK A;  2XF6 A;  3IWZ A;  2LF8 A;  4K2E A;  2MYS A;  4M3B A;  4RAG A;  4KIF A;  2XGX A;  3F0C A;  3KPH A;  1KYW A;  2F6C A;  3IHU A;  4OWR B;  2BW3 B;  3ERE D;  3HKZ A;  3J7A Y;  3GYH X;  2COB A;  2JA8 J;  1IRF A;  4LFU A;  4BHC A;  4EM2 A;  1PYV A;  3CC4 I;  3ZQH A;  3DXJ F;  3EQL F;  5IPA A;  2HPM A;  2QZ8 A;  2ISY A;  5CVI A;  2CGP A;  4G7O F;  4JX5 A;  3K2A A;  4XON A;  2DCE A;  4ZZL A;  2EZI A;  2QA4 I;  4BEH B;  5C4X J;  3PIO F;  1TNS A;  2KHM A;  3F21 A;  1VQM I;  4U88 A;  4AVZ A;  5K7H A;  2CYY A;  1R9T J;  2QGU A;  3KP6 A;  3B02 A;  1HST A;  4RGS A;  1WHU A;  3M8F A;  2QQ8 A;  1OLT A;  4C3I J;  1A36 A;  1ON2 A;  1FP2 A;  1N78 A;  5E17 F;  3IC7 A;  3WE2 A;  2L5Q A;  3BDD A;  2Z16 A;  3H5A A;  5HDN A;  1RES A;  1V3F A;  5GTI C;  1IF1 A;  2F2E A;  2D1H A;  3L7W A;  3SEZ A;  2DOF A;  4OU0 A;  1HDP A;  1P7J A;  4PJ0 C;  1I39 A;  2IGK A;  3JTG A;  3KEQ A;  2M4G A;  1AOY A;  5J8F A;  1LFB A;  3CCJ I;  1Y39 A;  4NDL A;  4NBQ A;  2GWR A;  4LK0 F;  3A0B C;  1YE9 A;  3OYH A;  1HW5 A;  2X48 A;  2L02 A;  1FBU A;  2G7U A;  1FTT A;  3SFI A;  1E17 A;  4RAZ A;  4FAS D;  3KLN A;  3BCA A;  1OMI A;  2IS6 A;  3IKV A;  2DLL A;  1B4A A;  1S6L A;  1X3U A;  2M87 A;  2WV0 A;  3M9A A;  2FQ3 A;  3DKX A;  2P8T A;  1UJ8 A;  3MD2 A;  2KDZ A;  1XGM A;  2M0M A;  3K9T A;  1K4S A;  1HBX G;  1WGX A;  1R4M B;  4KNY A;  1YRN A;  1CGP A;  1R1U A;  2XAU A;  2BHY A;  2R7D A;  4HDV A;  1T8I A;  2E1C A;  4A6E A;  1A35 A;  5EDN A;  3VWB A;  1MW7 A;  2XAJ A;  5CVU A;  2DFF A;  3FHN A;  1I3Q J;  4A3J J;  2A07 F;  3S14 J;  4X0G A;  1FYM A;  2DA1 A;  4J19 A;  2MH9 A;  3QOE A;  4Z2Y A;  1XSV A;  4F91 B;  5BNG A;  3TP0 A;  1K78 A;  2E35 A;  5ERI A;  1G3W A;  3DU6 A;  4E7I A;  4QPQ A;  3G3Z A;  3PSF A;  1G3S A;  2I5U A;  3ZQ7 A;  5EJC A;  4ON0 A;  2ISZ A;  4KIC A;  3R6S A;  4XLN F;  1J7K A;  5F0C A;  3HTU A;  5KHD A;  4MFE A;  3FMS A;  5HS8 A;  3JRH A;  3BJO A;  3LL7 A;  4ANJ A;  1P7I A;  2LBF A;  5CYV A;  2X9D A;  5HOD A;  3HDD A;  5L3F A;  4P9U A;  4M9X A;  1LEA A;  2IA0 A;  2YX7 A;  1U78 A;  2H6B A;  2W82 A;  2JRM A;  3BG3 A;  1P6R A;  2WY7 Q;  5J1U A;  2R7Q A;  2HQA A;  2OZ6 A;  1TQP A;  4TV7 A;  1F4K A;  3S3N A;  4BKX A;  3FF5 A;  3W2W A;  2P7V B;  1JTY A;  2BVM A;  2V79 A;  2R7R A;  3OYL A;  4KT6 A;  1W0T A;  1SAN A;  1DU0 A;  1ZLJ A;  3DF8 A;  3KZI C;  3EET A;  3KYC B;  1QZE A;  1YW8 A;  2F48 A;  3F9K A;  3RZO J;  3K7A J;  5ICC A;  2Q8K A;  1QQI A;  4X1E A;  3KCC A;  1BIA A;  2QYO A;  2OZU A;  4IPA A;  1T56 A;  1GV5 A;  3I4P A;  4IHX A;  3DKY A;  4F52 A;  3LWF A;  2O9L A;  1LNW A;  2DYS H;  2MC4 A;  2VJ4 A;  2J5O A;  3K4B A;  4M9S A;  1S3J A;  3G73 A;  4CA0 A;  1ZAR A;  4XLF A;  3G71 I;  4AID A;  2VKH A;  2HOA A;  2VOP A;  4C2T A;  2DK8 A;  2DJI A;  2A69 F;  3Q9S A;  3WU0 A;  1P4X A;  1BR1 A;  1FEX A;  2YR2 A;  1Y0N A;  2DI3 A;  3BTI A;  4PK4 A;  4JX4 A;  3OYA A;  1K79 A;  4HBL A;  1XTA A;  4QWQ A;  1R5I D;  2Y0M A;  2K5C A;  3A1Y A;  2QSH X;  5KAF C;  1FYK A;  1WH7 A;  3BG7 A;  1S7A A;  2QUF A;  3BOQ A;  1O3Q A;  2V26 A;  2IBD A;  5CKT A;  1D0X A;  4EM0 B;  4BE0 A;  3OYF A;  2R0Q C;  1IAW A;  1JXS A;  4LIV A;  4EJO A;  4XQF A;  2LY2 A;  4G9Y A;  3M1E A;  4F92 B;  6PAX A;  3DTK A;  5LHH A;  1LQ1 A;  3PFY A;  1MMA A;  2NOG A;  4HV6 A;  5DD4 A;  1EV7 A;  2CO5 A;  2GZW A;  2IPQ X;  3IWF A;  4XIC A;  5FJ8 J;  3HHG A;  4WX9 A;  1O3R A;  3CUQ A;  3GXO A;  1Z7U A;  4AIJ A;  1BL0 A;  3SZP A;  2VOO A;  4A3F J;  4D7N A;  4P55 A;  4YIR X;  5M5Y J;  3IAM 2;  4FE4 A;  1KU7 A;  3VB2 A;  1ULY A;  3AG2 H;  5J3L A;  2DDB A;  1GVJ A;  1P4W A;  1ETK A;  3GVA A;  2ETH A;  2VC0 A;  5F0H A;  4WK8 F;  2M34 A;  1PUE E;  3ZMV A;  4CCL A;  4A3E J;  3CUQ C;  3RYP A;  1ETO A;  3AL0 B;  1TZL A;  2XV4 S;  2ME0 A;  1MBK A;  5KAI C;  1A31 A;  2ZO4 A;  2CQN A;  5ILS A;  5FKO A;  2QBY B;  2L4A A;  3ABT A;  2EIN H;  2VBW A;  3WG9 A;  2WAD A;  4M6Y A;  5HLI A;  1BJZ A;  1AHD P;  1IZ1 A;  2C6Y A;  4G6T B;  3OR1 C;  2XGE A;  1SAU A;  1DUX C;  4A0X A;  3HYI A;  2W4S A;  2WY8 Q;  3K4N A;  5ICG A;  1Z0X A;  1I1G A;  2VJ5 A;  5F6F A;  2J5P A;  4YRV A;  2M5W A;  2K86 A;  2HYF A;  1L0O C;  1O7L A;  3I53 A;  4BAC A;  1JKQ C;  2MG4 A;  2NS0 A;  4A5M A;  3ESW B;  3FHZ A;  1FZP B;  1WKM A;  2D5V A;  3FK7 A;  4I01 A;  5E1Z B;  3S17 J;  4GXO A;  4AIH A;  1SMY F;  4P5O A;  3HOZ J;  2WA0 A;  2XPV A;  2W85 A;  4A3B J;  3K70 D;  2K9S A;  2OCE A;  4HX8 A;  5J1R A;  4B8X A;  2HVS A;  3DLA A;  2B63 J;  5JHU A;  2GOX B;  1U0J A;  1LDD A;  2X51 A;  2MGQ A;  4WXH A;  3W2V A;  1D5V A;  3RJP A;  1Z77 A;  1I50 J;  3ZR8 X;  1UHM A;  2ZSI B;  3H35 A;  4XKW A;  3ZMU A;  4M73 A;  4G7Z F;  4L5J A;  2KL4 A;  4B1R A;  4BAY A;  2E2I J;  3TO7 A;  2DT7 B;  3H3Z A;  3IUO A;  5KCM A;  4O3M A;  3MKL A;  3E3V A;  2GLO A;  4FE7 A;  2OC6 A;  1KQ8 A;  4P1W A;  3CCE I;  3PL8 A;  3EYY A;  2CS3 A;  3LSH A;  3RKY A;  2QEX I;  2NVY J;  3BR6 A;  3RPQ A;  2H8W A;  3OSG A;  5D5V B;  4CHU A;  2M3A A;  5DM7 F;  4BBR J;  3RI4 A;  2ADU A;  5D5U B;  2YX4 A;  2Y30 A;  1DU6 A;  4HW0 A;  3I3L A;  1LKX A;  2EZH A;  3H0G J;  4M71 A;  3BG6 A;  2PI0 A;  4QSH A;  5ILV A;  3I5U A;  2Q2E A;  4ESJ A;  4BGD A;  2YU9 J;  3KZY A;  2IP2 A;  1NHA A;  2EV5 A;  4C2U A;  3ZQQ A;  4LLN A;  3IV5 A;  2XUB A;  3F8F A;  3Q5F A;  4BXF A;  1OCR H;  1POG A;  1HC8 A;  3HM5 A;  4XLC A;  5FKL A;  5HNH A;  4PJM A;  1PP8 F;  2OU2 A;  4XN0 A;  4U0Y A;  1YO5 C;  4OOI A;  1USS A;  2VON A;  1UZC A;  2P5K A;  1BI0 A;  2AQE A;  2VE8 A;  4BDY A;  5E3N A;  4G7H F;  4JX6 A;  1VQ9 I;  2VBY A;  1Z91 A;  3TKY A;  5LFA A;  2EZK A;  4V2G A;  3L2C A;  2JA5 J;  4DZP A;  4BE2 A;  2E2H J;  2DDA A;  1K61 A;  3D1N I;  3CCU I;  2JK3 A;  5LEJ A;  3HL2 A;  4Y13 A;  4HLX A;  1OCP A;  1XDS A;  1MJA A;  2HYG D;  3F3X A;  3I4N J;  2BXZ A;  1JT6 A;  4PFO A;  3ECO A;  1QRY A;  3ZGK A;  5D4S A;  1W7P A;  3S93 A;  3D5R C;  5F64 A;  1W4M A;  2DA7 A;  5DD8 A;  1UG2 A;  4RGR A;  4XRS A;  4IVN A;  3DLL F;  2GXB A;  1SVL A;  1H8A C;  1HOM A;  2F5C A;  2A5Y B;  4HAM A;  5HVQ C;  4UV8 A;  4D0P A;  2YSR A;  1UB9 A;  2O03 A;  5D6E A;  1ZQ3 P;  2E5Z A;  2KIS A;  3CTA A;  5TGT A;  3GWZ A;  3K70 C;  2GM4 A;  4LMY A;  2EFP A;  3DBH B;  4B3X A;  3FIS A;  2CW7 A;  2HXO A;  4GGG A;  4A6D A;  2PMU A;  2DPU A;  2A6E F;  1RI7 A;  1MD0 A;  4RM3 A;  1XMA A;  4IF4 A;  1X3W B;  1NG7 A;  3LQQ A;  1HW1 A;  4XOP A;  3HEF A;  4AYB N;  4M9Z A;  2GXG A;  3DEU A;  4IRG A;  4BQO A;  2XIG A;  4NQW B;  5CJ9 A;  4A12 A;  3L09 A;  3HRT A;  3DWL E;  1FOY A;  2X1C A;  4N0B A;  5GAE J;  2VXZ A;  1H89 C;  3SZT A;  3F8M A;  5EEA A;  5DYM A;  5EEG A;  1WCM J;  3H9Q A;  4IQ4 A;  4RB1 A;  1MJB A;  3WTZ A;  3GTO J;  4NC8 A;  4WF2 A;  3AG3 H;  1B9M A;  4DYQ A;  2Z33 A;  5FFZ A;  3IH4 A;  5CLS A;  4XNF A;  2KIM A;  4OIN F;  1KYZ A;  4CCJ A;  2XC7 A;  1ZRC A;  5K5Q A;  1ZG1 A;  5CVJ A;  3J80 K;  1HKT A;  2DQL A;  4J01 A;  1M1E B;  1MH4 A;  1FLI A;  4RLQ A;  3WTU C;  4XR6 A;  1YFH A;  1O7F A;  1HKS A;  3DP7 A;  1Z3Y A;  1BC8 C;  4MGR A;  4ZYH A;  3CCM I;  4G12 A;  4L5E A;  4RA2 A;  1I6H J;  5M3M J;  4DZJ A;  1YIT I;  5CQG A;  1IUF A;  2PJR A;  1TWH J;  1STZ A;  1TW3 A;  2L3D A;  1BI2 A;  3D0S A;  2Y75 A;  3GTG J;  5K5R A;  2RKH A;  4LG0 B;  2VQG A;  3M7G A;  4N9I A;  5FKN A;  2GA2 A;  3VDX A;  2HVR A;  2VXD A;  3W3C A;  3NWT A;  3K4K A;  3LFU A;  4DOZ A;  3QYE A;  1JJ8 C;  3CF2 A;  3HGG A;  2L54 A;  3VYS B;  1IV8 A;  3CO7 C;  4W97 A;  2WAF A;  4YFK F;  5ED4 A;  1MBF A;  1V55 H;  5H6R A;  2ZFU A;  3R60 A;  4HQM A;  3IH2 A;  1U5T C;  2ZME A;  3QPS A;  4BY7 J;  1TWF J;  1V54 H;  4CYD A;  4Q47 A;  4MO7 A;  1J59 A;  1B9N A;  2ID3 A;  4FHT A;  3MVP A;  1RIO H;  2BHZ A;  2WWY A;  5L3B A;  1PDN C;  1O57 A;  1REP C;  1ONV A;  1XMX A;  2XB5 A;  3L00 A;  3U9G A;  1YIO A;  2ELK A;  4IOC F;  1V5F A;  1ZGJ A;  3N4M A;  3CP8 A;  5HDG A;  5EGO B;  2JJ7 A;  4ZTF A;  4QLC U;  2XHK A;  2FD5 A;  4RGU A;  1Y56 A;  1FOX A;  5E3M A;  1G59 A;  1RNL A;  4MQ9 F;  4N4N B;  4Y15 A;  1IN4 A;  2CU7 A;  5EGO A;  1GDT A;  2ZXJ A;  4IHT A;  2XGC A;  1J0R A;  4BNC A;  3KEY A;  3T1B A;  1VQ4 I;  2VC1 A;  1MZB A;  1WJ5 A;  2M30 A;  3OV8 A;  3PNV A;  1UMQ A;  4HV5 A;  3HRM A;  2MBF A;  4PDK A;  2D2W A;  4LOC A;  1LB2 A;  3V7R A;  1T08 B;  2JT1 A;  1XB4 A;  3FXO A;  2PMZ N;  3PFI A;  2GQQ A;  1EKE A;  3NWS A;  5A2Q Z;  1FIA A;  3Q3S A;  4XRS G;  4A3I J;  2CUZ A;  2M2E A;  1KON A;  4PZJ A;  3SJM A;  2H27 A;  2ZSH B;  3IH3 A;  4BDZ A;  2FUG 2;  2HDD A;  1X1P A;  1W1W E;  2JWT A;  1QGP A;  3D5S C;  3H3U A;  3VFZ A;  1MSF C;  5FKM A;  1WQ2 A;  2R7U A;  2V6C A;  2Y2Z A;  3BPX A;  3WTW C;  2CV0 A;  1R5H A;  1FMW A;  3HOV J;  3QYF A;  3TDU C;  5EYR A;  3HOU J;  1R4N B;  2UZK A;  1S5L C;  4G6Q A;  2OQR A;  4PCQ A;  1I6X A;  4LJZ F;  4D5C A;  5GPC A;  3V7S A;  4DYC A;  3OS2 A;  1ETY A;  3C2H A;  4WCG A;  5EEH A;  1RKW A;  3N05 A;  3J7A O;  1U9N A;  3G1M A;  3GW2 A;  2VQC A;  2P7C B;  4HDU A;  2DO7 A;  1H88 C;  1FC3 A;  2ZFW A;  2OTL I;  2F4I A;  2EPF A;  5AIQ A;  3OOU A;  1ZRE A;  2QQ9 A;  4UUS A;  1OKR A;  4DQ2 A;  4HOB A;  4IJA A;  5J4Y A;  4II3 A;  1IN5 A;  2LC2 A;  1OJL A;  2FML A;  3H3V K;  4AWX B;  1YX3 A;  1Y8Q B;  2O8X A;  1W5S A;  3I55 I;  3H0D A;  2H8R A;  4B4C A;  3HG9 A;  5JVT A;  2HQN A;  2CUE A;  3HJE A;  3JRD A;  3GTP J;  3S3O A;  2DAO A;  4II2 A;  1IDY A;  5CVR A;  1MMG A;  4AIK A;  1ETV A;  1MDM B;  1AWC A;  3JR9 A;  4EV0 A;  3PNT A;  2KJC A;  3L2U A;  2MD0 A;  3ZQI A;  4AD9 A;  4KIG A;  3WOD F;  3I59 A;  4JQF A;  1WJD A;  3FXU A;  5DCM A;  2IEK A;  3MN2 A;  5BS6 A;  2EFN A;  2R5Z B;  4CH7 A;  5JI6 A;  2BOL A;  2JRT A;  2RV8 A;  2JPB A;  1V5E A;  3TOB A;  2WB1 A;  2M8G X;  4BXX J;  5IP9 J;  3W6V A;  3E6B A;  3M07 A;  3BZC A;  3HPH A;  4F55 A;  4RBO A;  1P9Q C;  1V5G A;  1IN8 A;  4RB0 A;  2L01 A;  3DPL C;  4B47 A;  2HTS A;  3QU6 A;  1WFX A;  2M9H A;  2W24 A;  2I10 A;  3LQR A;  1OPC A;  4HF2 A;  2RNJ A;  1IXC A;  1ZHF A;  1D1B A;  5LLQ A;  3LOC A;  3SXY A;  4BBS J;  1F5T A;  4HZF A;  2Y48 A;  3K69 A;  2W1O A;  2DT6 A;  2NS7 A;  4A3D J;  1BI3 A;  1KZH A;  1EH7 A;  1FX7 A;  2HYJ A;  2ZME C;  4WXC A;  2JVH A;  2VL8 A;  3GTL J;  3GBG A;  2HGC A;  3JRG A;  2CQX A;  2H94 A;  3Q0U A;  2ESN A;  3Q0V A;  3CCR I;  3KP4 A;  1V4R A;  4RB3 C;  5EZG A;  1NK2 P;  2JA7 J;  4OMZ A;  1S29 A;  4YFN F;  4HLY A;  2O61 A;  5DUK A;  1ZR4 A;  2CUJ A;  3S2D J;  5IOZ A;  4OAY A;  1MGT A;  3CMM A;  2EB7 A;  3HPG A;  1AKH B;  1NG6 A;  2HI3 A;  1X1C A;  3GLX A;  3VPR A;  1Z1D A;  2DOD A;  4LIT A;  5J40 A;  1IXR C;  3WGG A;  1R23 A;  1RPW A;  4P96 A;  3SEQ A;  1JKP C;  4B44 A;  3PIP F;  3S2H J;  4RGX A;  3CCV I;  2W25 A;  2VI6 A;  3LSM A;  1OQY A;  2OV7 A;  3D5L A;  1I27 A;  4DIQ A;  3GTQ J;  1MNM C;  1UG0 A;  4L9T A;  3P7N A;  1T33 A;  2A6H F;  2Y0S A;  2DA3 A;  3PO2 J;  2UV1 A;  1P92 A;  1ITY A;  2CG4 A;  2KLO A;  3C18 A;  4ESF A;  3F23 A;  3C3W A;  3RIR A;  3OIO A;  3T8R A;  3IRR A;  2CJJ A;  1FJL A;  4H4K C;  1YG2 A;  3ZMT A;  2IGN A;  2HDW A;  2Z1D A;  2OUM A;  1X4P A;  2BV6 A;  1JHH A;  2HOE A;  1TL8 A;  4Q4Z F;  3F8B A;  2KPM A;  3BJA A;  3LSK A;  3H36 A;  3K6G A;  2R7S A;  2PEX A;  2ZCW A;  3QAH A;  2VPR A;  2DBB A;  3AG1 H;  3LA7 A;  2VE9 A;  2E34 A;  1ERD A;  4WWC A;  4E7S A;  2HZD A;  3HBL A;  3L2R A;  2E7X A;  3CLQ A;  3E7L A;  4JYK A;  4CCO A;  1GVD A;  2DMU A;  3ZQC A;  4EJV A;  4ENN A;  3ASO H;  1FBQ A;  1H0M A;  1MMD A;  3DPT A;  1SEU A;  3S1M J;  3ZXS A;  3HUG A;  2DMT A;  4ASN A;  4YII A;  1UFM A;  2OTJ I;  2G9W A;  2Q2E B;  2LSO A;  2QWW A;  4UUV A;  2K9M A;  4Y7N J;  4EJT A;  4I98 B;  3I64 A;  2OD5 A;  1MBE A;  3CD6 I;  3J81 K;  4PSX A;  2BY2 A;  1XX5 A;  5IYC J;  1DDN A;  2HZT A;  3WTY C;  3LSP A;  3AFH A;  3GFM A;  4S04 A;  4DGW B;  4PUS A;  4ENK A;  1ZYR F;  2EBI A;  1Q1V A;  2K02 A;  4L5I A;  1N77 A;  3FXQ A;  4ZYE A;  3TQN A;  5KNL A;  1Y1W J;  4GFB A;  3S32 A;  4OIQ F;  3NRV A;  1FNN A;  1RET A;  2QF7 A;  2X4H A;  4NUB A;  3RKX A;  3MCZ A;  2P81 A;  4YEL A;  3ZQG A;  1SFU A;  3TW6 A;  1PP7 U;  2KRH A;  3N97 A;  3JRC A;  4XK4 A;  4HQE A;  2YU3 A;  3OYE A;  3UNG C;  4HF1 A;  1T0F C;  5E1X A;  4L9V A;  3V7C A;  3ELK A;  4A3C J;  3TOA A;  3HRS A;  1YIJ I;  2EV0 A;  1FOK A;  1JUP A;  3KP7 A;  1EJ9 A;  2NVQ J;  2EV6 A;  4XRM A;  2MC3 A;  2O0Y A;  3DEW A;  5E1W A;  1R58 A;  2IAI A;  2VJI A;  2RVC A;  1YJW I;  1PUF A;  2RDP A;  3DBL B;  3L2V A;  2E5N A;  2K85 A;  5ICF A;  2LBF B;  9ANT A;  5AON A;  4LD5 A;  2M7A A;  2V6E A;  2VT3 A;  2LRE A;  2VKE A;  2DMP A;  4M3E A;  3TDZ C;  2E7W A;  2DPD A;  5LHG A;  2F5D A;  4A69 C;  3RDI A;  1XCB A;  2L9V A;  3B6C A;  2LNB A;  3FBN B;  2KP6 A;  4ZDL A;  4BL0 B;  1ZGW A;  3EYI A;  1E3H A;  4I99 C;  3OSF A;  3S1Q J;  1FP1 D;  1IUY A;  3IL2 A;  5HLG A;  2JA6 J;  1OR7 C;  1Y6I A;  1R1V A;  4KIT B;  3GFL A;  1JT0 A;  1JGS A;  1YQA A;  1TQM A;  2KT0 A;  4ZDP A;  1BOB A;  1BOA A;  1ZH5 A;  3O6B B;  1HKQ A;  2VN2 A;  2KZG A;  3I58 A;  3M8J A;  3UR3 C;  1QO0 D;  2KZV A;  2CQK A;  5DUI A;  4KN4 X;  1HW2 A;  2WAQ A;  4M6X A;  2MH2 A;  2BGC A;  3COA C;  4YIF A;  1EF4 A;  3GFI A;  1TQI A;  1KGS A;  4F93 B;  2FXA A;  5JHF A;  3RTR A;  4NHJ A;  1SFO J;  2FNA A;  2HOS A;  5CPR B;  1MNE A;  1UHS A;  2M1B A;  4FT8 A;  1YJ9 I;  3K4C A;  2ID6 A;  2EFO A;  2OPT A;  3K2Z A;  4BQA A;  2V1X A;  3C2G A;  2KRF A;  4PGH A;  3GTJ J;  1MDM A;  1X2M A;  3GF2 A;  1NK3 P;  4HST A;  2K7L A;  4Y33 A;  3S16 J;  2E71 A;  5DEQ A;  3ABK H;  4EJU A;  1SD4 A;  2QEN A;  1R5G A;  1S8N A;  3HUG B;  3IKT A;  3HSE A;  1RZ4 A;  2VUM J;  1P2F A;  2M4K A;  3GLL A;  5LEK A;  3OIP A;  2WB1 N;  2QVO A;  4I0A A;  4BUP A;  3CDH A;  3E5X A;  1EA3 A;  2FSW A;  2L0K A;  3QWL A;  5IP7 J;  2BVL A;  3WTX C;  1E0E A;  4HRI A;  3BY6 A;  1N25 A;  3RKW A;  4XLA A;  2BBY A;  2JA2 A;  1YYV A;  2FBH A;  2LOO A;  2DTZ A;  4H0E A;  2ACJ A;  3M3Y J;  3ABL H;  3MFK A;  1R1T A;  1MKM A;  2CH0 A;  3CF5 F;  4NC6 A;  4KT5 C;  4EMS A;  1T2K A;  4KYW A;  2IA1 A;  1QPM A;  2F4O B;  4BU2 A;  3ZPL A;  1E2X A;  1FTZ A;  5IY5 H;  3QPL A;  1B59 A;  4UXN A;  2EIJ H;  4RS8 A;  4HYE A;  1VZ0 A;  2EIL H;  4U0V A;  3KEO A;  2E2J J;  2R5Y B;  1W7P D;  3LA3 A;  4R8H A;  1ZKG A;  2ZBK A;  4DW6 A;  5GTH C;  5K5O A;  4C2M J;  3LFK A;  4V2F A;  1G2H A;  1JKO C;  2XB0 X;  1GUU A;  3RQ4 A;  5GAH J;  1D5Y A;  1I5Z A;  4S05 A;  2EH3 A;  3TP3 A;  2HKO A;  1SAX A;  3O8H A;  2KQR A;  2O5R A;  4XSX F;  3I54 A;  2NVX J;  1E3P A;  2XF7 A;  2EWN A;  4DJA A;  4Z6Y A;  2BW3 A;  2ZJP F;  1IGN A;  5HLT A;  2L7Z A;  1S9H A;  2RC4 A;  4XLE A;  1OYW A;  3G1O A;  3W6J B;  3A02 A;  4CZC A;  4X6A J;  4WXD A;  3M1C A;  4EVI A;  5K7Z A;  3U1K A;  1JI8 A;  2LFB A;  4E70 A;  1XDU A;  3G4S I;  3BR3 A;  2K3P A;  1B8I A;  5GAD J;  2WTE A;  2KDO A;  3BG5 A;  3HOS A;  3NAU A;  3T0Y A;  1PJR A;  4IKF A;  4NNJ A;  4B3A A;  1Y8R B;  5BMZ A;  3P9C A;  4M3G A;  2BY0 A;  4LG0 A;  2JMW A;  2DJN A;  4BS9 A;  4Q5S F;  4ZZD A;  2Z3Y A;  4UVA A;  3FXL A;  4CXF A;  2AS5 F;  2VQL A;  3GX4 X;  1ZR2 A;  2V7F A;  1AKH A;  1SFE A;  4M3D A;  2LLK A;  5HOO A;  3L1P A;  1IO2 A;  1U9O A;  3CES A;  4AVP A;  3E97 A;  2ZXI A;  3FM5 A;  4MNU A;  3MMY B;  3HOT A;  2XVC A;  3I56 I;  5GPA A;  4HG2 A;  4ENM A;  2VIX A;  5E3O A;  5J8C A;  1J2X A;  5DCF A;  4IEJ A;  4E7Z A;  3DV8 A;  2MA3 A;  5FB2 A;  3I59 B;  2IXS A;  2LD5 A;  2CQ7 A;  4EEF G;  3DU5 A;  2HVQ A;  2YPR A;  1PUF B;  2EK5 A;  2D45 A;  1LFP A;  3T5X A;  3VOD A;  4KMF A;  2XAH A;  1FYL A;  2HOT A;  4FQG A;  1A04 A;  4BQN A;  5EF6 A;  3J7Y J;  3UKG A;  2MSY A;  3I9V 2;  1O3S A;  5FRM A;  3JRB A;  1PVE A;  3LA2 A;  4NC7 A;  1JUM A;  3DQV C;  4MEX F;  3WHC A;  5GAG J;  2KMU A;  3BQZ A;  2DT5 A;  4RMN A;  4IHW A;  2P5L C;  1OCT C;  1OCO H;  1B6A A;  1HQC A;  2DA2 A;  2E1M C;  4DYR A;  3G1L A;  2F5F A;  1TWA J;  2HNH A;  3TO6 A;  4IX7 A;  1RUN A;  2Q0O A;  1OCC H;  4RAY A;  1CQT A;  3WTV C;  3MZ8 A;  1AU7 A;  3O8G A;  3VSL A;  3FM3 A;  1UCR A;  5J1Y A;  2FF4 A;  3R4K A;  2VAS A;  1I1S A;  1T98 A;  1WVR A;  3KLO A;  2FEZ A;  2BY1 A;  2L4M A;  5IP6 A;  1J5Y A;  1YW7 A;  1R00 A;  5F0F A;  1D0Y A;  1QVU A;  2R4G A;  1Z3X A;  3GZN B;  1U6G A;  2NVT J;  5BPD A;  4BHB A;  2VOD A;  3E1S A;  4KN7 X;  2FOW A;  1IRZ A;  4OAZ A;  2V1D A;  4J00 A;  1BR2 A;  2MAB A;  3GZ6 A;  3E5U A;  2VB6 A;  3SFZ A;  5B5E C;  1KQ9 A;  3B73 A;  1X1D A;  5L3E A;  1W5T A;  4A93 J;  5F08 A;  1YOV B;  1XN7 A;  4UVB A;  2OQG A;  4DNC A;  2JUC A;  1FSE A;  4ZYA A;  2L2O A;  1ZRD A;  2GXA A;  3QQA A;  2FJ1 A;  2XF5 A;  3H5R A;  4OMY A;  1XG1 A;  3GCM A;  4HNV A;  2GOM A;  2W00 A;  1CF7 B;  1U2W A;  2VJJ A;  2ZJQ F;  2VKV A;  4RB2 C;  1OYY A;  1JE8 A;  2F5E A;  2QLZ A;  1A6I A;  2L7F P;  2V9V A;  4RDU A;  1LVK A;  2H1K A;  4MIM A;  3ISP A;  3E6D A;  2WV1 A;  2GBY A;  5JR3 A;  1FIP A;  3A01 B;  3G2B A;  2QSG X;  1HLV A;  1Y1V J;  2HXI A;  4KJZ A;  4D9J A;  5LHI A;  2E36 A;  2DN0 A;  2EZL A;  4XBF A;  3OYI A;  1VQP I;  2K4J A;  4HEA 2;  2CSO A;  3A4C A;  2DOE A;  5L3G A;  4BJT A;  1G3T A;  1XC5 A;  3PJR A;  3WE3 A;  2QKM B;  2V4J C;  3CZ6 A;  3I71 A;  5GP9 A;  5H6Q A;  2AHQ A;  3WU2 C;  2R5Y A;  1GXP A;  1QVT A;  4CCK A;  4ZYG A;  3ML6 A;  4HA8 A;  1MBH A;  1ZGA A;  3JCU C;  5D8L B;  3MZY A;  2I8D A;  3JSP A;  3OYM A;  1UEL B;  4G6D A;  5LGT A;  1G8X A;  2LKX A;  4RAF A;  3RCO A;  2KFD A;  2HR3 A;  3M8E A;  3OOP A;  3TO9 A;  3MAJ A;  4AC0 A;  3VYT B;  4F7Z A;  4YEJ A;  3F6O A;  3ZQF A;  5FRO A;  1ENH A;  5E18 F;  2OA4 A;  4Y17 A;  5TIS C;  3E5Q A;  1K4T A;  3J7Z I;  2IRF G;  1W5C C;  2BYV E;  4KIB A;  4BXU A;  1WZ2 A;  3CDL A;  4L9J A;  3ZQL A;  4CDG A;  1GT0 C;  4U87 A;  3BPV A;  4PJJ A;  1U5T B;  2DW4 A;  2DOA A;  3R0A A;  4QPO A;  2CW0 F;  5FLX Z;  2IGM A;  5DS9 A;  3QPH A;  1QHH D;  3ZRG A;  3WTS C;  3O3K A;  1O4X A;  1BJA A;  3TGN A;  2RQQ A;  1D1A A;  3CJN A;  4KMU X;  2HQR A;  5TJJ A;  4BJ5 C;  2JQ7 A;  3OYK A;  1QBJ A;  3F6V A;  2P6S A;  2X1E A;  4AM3 A;  5BPI A;  5LRS A;  5B1A H;  1IN7 A;  2R7T A;  3BWG A;  2ELJ A;  3KFW X;  1I3A A;  2KIQ A;  3C1D A;  4JOM A;  3JRF A;  2IS4 A;  2Y69 H;  4BE1 A;  1ODD A;  5CVV A;  2QCO A;  4W1U A;  3SHF A;  2NNY A;  3PUF A;  4C9Y A;  3S3M A;  2DFH A;  2XKO A;  4HNU A;  1B72 A;  2R7V A;  3KYD B;  3HKZ N;  2ZNY A;  3KIO A;  1ZG3 A;  4KDP A;  2UUZ A;  3RSN A;  3ZN0 A;  5JLW A;  1FBS A;  4A0Y A;  1BBY A;  2W57 A;  4BHP A;  4MLO A;  4EAT A;  4QTR A;  3GTM J;  1F1Z A;  4R79 A;  1MIJ A;  4DBQ A;  3ZOB A;  1Y0U A;  2XSJ C;  3CO6 C;  3C7J A;  4M3F A;  1D8J A;  3PO3 J;  3DCF A;  2N8G A;  2OJE D;  4FX4 A;  1TP4 A;  2XRL A;  3CP2 A;  4PJN A;  2IT0 A;  3P9K A;  1D8K A;  2LYC A;  3BTJ A;  3QPT A;  2JPC A;  3KP5 A;  3FWE A;  2DMQ A;  4JK1 X;  4XN3 A;  5H20 A;  4L0Z B;  1A6Q A;  4A0Z A;  1WJF A;  1XCV A;  1KA8 A;  1QA6 A;  2DFE A;  1QU3 A;  2CFX A;  4CGZ A;  2PMH A;  4ITV A;  4LLG F;  3MEX A;  3FX3 A;  2NYX A;  1MMN A;  5LRR A;  2EFQ A;  4QIW N;  1VQN I;  3CC2 I;  2X85 A;  3I0T A;  1R36 A;  4G94 A;  1IRX A;  4HNT A;  2GAU A;  4L0Y B;  2YS9 A;  3A2K A;  4L18 B;  2D1V A;  4AUX A;  1B1B A;  3WTT C;  4I09 A;  2L9N A;  3K4M A;  1R7J A;  3Q0W A;  3NAR A;  1YS6 A;  2ZJ2 A;  2HWV A;  2IA2 A;  1WH5 A;  4ZC3 A;  2DYR H;  4A5N A;  2M8E A;  4Y52 J;  2OBP A;  2XAS A;  1XD7 A;  3MWM A;  2LR8 A;  2O6G E;  4KIS A;  3KP2 A;  1XPX A;  1TNT A;  1DP3 A;  1DPR A;  1WJE A;  1VQ5 I;  2STT A;  3OWT A;  2R3S A;  3CUO A;  2Z99 A;  4KA4 A;  1XMK A;  2FNP A;  3ABU A;  3EUK L;  3JAM K;  2B9S A;  3H9G A;  1QZZ A;  2B0L A;  2PMZ A;  4PGG A;  3AKZ A;  1TT5 B;  5IYD J;  2LG4 A;  3HRU A;  2CUF A; 
#chains in the Genus database with same CATH homology
 2NVQ J;  4M6V A;  4XRM A;  3DEW A;  2IAI A;  1PUF A;  3IV5 A;  2L9R A;  2DA5 A;  1POG A;  9ANT A;  3HM5 A;  2Y0S N;  3JRI A;  2OF7 A;  3WHB A;  5FKL A;  3M4O J;  2R5Z A;  2VKE A;  2DMP A;  4M3E A;  1VF9 A;  4A69 C;  3B6C A;  1ZGW A;  3S1Q J;  5E3N A;  2XSD C;  3OSF A;  3CQZ J;  4JX6 A;  4CYC B;  1HF0 A;  5C4J J;  2LVS A;  2JA6 J;  4C3J J;  1JT0 A;  2KT0 A;  2EZK A;  4V2G A;  2JA5 J;  4DZP A;  2E2H J;  3BR5 A;  1WPK A;  1K61 A;  2E19 A;  3D1N I;  2JK3 A;  3BT9 A;  1IG7 A;  1OCP A;  2R92 J;  3HGY A;  5JLX A;  3JRE A;  1B72 B;  3I4N J;  1EF4 A;  1JT6 A;  4JP0 A;  1SFO J;  2HOS A;  5FLM J;  1QRY A;  3SDG A;  3LSG A;  1UHS A;  5F1J A;  5FKK A;  3LSR A;  1ORK A;  2ID6 A;  2OPT A;  5EG0 A;  4FIS A;  1JJ6 C;  2DA7 A;  3LNQ A;  1ZK8 A;  1UG2 A;  3GTJ J;  4XRS A;  1X2M A;  1NK3 P;  2R7Z J;  1H8A C;  1HOM A;  2ECC A;  5DTD A;  1ZQ3 P;  3S16 J;  2GM4 A;  2RAE A;  3FIS A;  2HXO A;  1IV6 A;  2VUM J;  3BTC A;  2WB1 N;  5IOY A;  1TWC J;  2L0K A;  5IP7 J;  3GTK J;  2ZB9 A;  4I76 A;  3HEF A;  1BA5 A;  4AYB N;  3FK6 A;  1K83 J;  1APL C;  2DTZ A;  2MW8 A;  4A3G J;  3M3Y J;  4D5F A;  3LSJ A;  2O7O A;  1OFC X;  1H89 C;  2O8K A;  4MFD A;  5EEA A;  1JUS A;  4XID A;  4M3B A;  1FTZ A;  1WCM J;  3QPL A;  3F0C A;  4BY1 J;  3GTO J;  2E2J J;  2R5Y B;  4DYQ A;  2COB A;  2JA8 J;  1ZKG A;  4DW6 A;  3IH4 A;  2Y9Y A;  2K9N A;  4IHY A;  2DA6 A;  4C2M J;  4V2F A;  3ZQH A;  5IPA A;  2Y9Z A;  1G2H A;  1JKO C;  2XB0 X;  4JX5 A;  3K2A A;  1GUU A;  1IC8 A;  1MH4 A;  2EZI A;  1D5Y A;  1B8I B;  2EH3 A;  3TP3 A;  5C4X J;  1TC3 C;  3O8H A;  3FKI J;  2NVX J;  5K7H A;  1IGN A;  1R9T J;  5K7F A;  2L7Z A;  1TWG J;  4G12 A;  3I4M J;  3BR1 A;  4L5E A;  4C3I J;  3G1O A;  1I6H J;  5M3M J;  1MBJ A;  3A02 A;  4DZJ A;  3BR2 A;  4X6A J;  1IUF A;  5K7Z A;  1TWH J;  1RES A;  2LFB A;  2TRT A;  2L7M P;  3GTG J;  2CRG A;  3BR3 A;  1B8I A;  5FKN A;  3BG5 A;  3NAU A;  1JJ8 C;  3BR0 A;  1HDP A;  3HGG A;  4B3A A;  1P7J A;  4W97 A;  4A3K J;  4M3G A;  1MBF A;  2JMW A;  1LFB A;  2DJN A;  3IH2 A;  4NDL A;  4BY7 J;  3QPS A;  1HCR A;  1TWF J;  1ZR2 A;  4MO7 A;  2ID3 A;  1AKH A;  3MVP A;  2X48 A;  2JN6 A;  5E3L A;  4M3D A;  1FTT A;  2LLK A;  3SFI A;  3L1P A;  1WI3 A;  4A3M J;  1U9O A;  2XB5 A;  4A3L J;  1VFC A;  2LP0 A;  2ELK A;  5EGO B;  2JJ7 A;  5GPA A;  1VI0 A;  1XS9 A;  5E3O A;  2KDZ A;  2FD5 A;  1X58 A;  4IEJ A;  2LK2 A;  3BTL A;  1WGX A;  5E3M A;  1YRN A;  2LD5 A;  2CU7 A;  1MSE C;  5EGO A;  1GDT A;  2E1O A;  2XGC A;  1JGG A;  1LE8 A;  1X2N A;  4EEF G;  5EDN A;  1PUF B;  1ETW A;  5M3F J;  1UMQ A;  1I3Q J;  4A3J J;  3CMY A;  2TCT A;  2HOT A;  3S14 J;  1ETX A;  5EF6 A;  3UKG A;  2MSY A;  2DA1 A;  4J19 A;  1JKR C;  5BNG A;  3TP0 A;  4LOC A;  3RQI A;  3JRB A;  1JUM A;  5M5W J;  1LE8 B;  3WHC A;  3HOX J;  2PMZ N;  3BQZ A;  1FIA A;  1MH3 A;  3Q3S A;  4XRS G;  5F0C A;  4IHW A;  3HOW J;  1OCT C;  4A3I J;  2DA2 A;  2M2E A;  4DYR A;  3G1L A;  4MFE A;  1TWA J;  3SJM A;  3IH3 A;  3JRH A;  2HDD A;  2XPW A;  1CQT A;  2JWT A;  3RZD J;  1MSF C;  1AU7 A;  5FKM A;  1P7I A;  3O8G A;  2X9D A;  4D7M A;  5HOD A;  1LFU P;  4S0H B;  3HDD A;  5C3E J;  5J1Y A;  2Y2Z A;  1U78 A;  3HOV J;  5EYR A;  3HOU J;  3BG3 A;  5J1U A;  5IP6 A;  2LY9 A;  4BKX A;  5F0F A;  4D5C A;  1JTY A;  5GPC A;  1QVU A;  3PM1 A;  3BQY A;  4DYC A;  2NVT J;  1ETY A;  1W0T A;  1SAN A;  1DU0 A;  1RKW A;  1IRZ A;  1U9N A;  3G1M A;  3RZO J;  3K7A J;  4UUT A;  4X1E A;  1H88 C;  2ME6 A;  4FTH A;  3OOU A;  1T56 A;  1GV5 A;  4UUS A;  4IHX A;  2O9L A;  4A93 J;  5F08 A;  1OJL A;  2K40 A;  3H3V K;  2H8R A;  4B4C A;  2FQ4 A;  2CUE A;  3JRD A;  3QQA A;  2FJ1 A;  3GTP J;  1XG1 A;  5IYB J;  4HNV A;  1IDY A;  2HOA A;  3B6A A;  2R93 J;  1FEX A;  1ETV A;  3JR9 A;  2XGD A;  2VKV A;  3A03 A;  2CQQ A;  3BTI A;  1A6I A;  2L7F P;  3ZQI A;  4RDU A;  2H1K A;  4JX4 A;  1RR7 A;  1YRN B;  4MIM A;  2WV1 A;  2IEK A;  2GBY A;  3MN2 A;  1FIP A;  1BW6 A;  3A01 B;  2R5Z B;  1HLV A;  1Y1V J;  2HXI A;  2AO9 A;  1WH7 A;  2YUS A;  5FLV A;  2NS8 A;  4UUS B;  2M8G X;  2DN0 A;  2EZL A;  5IP9 J;  1F36 A;  5F04 A;  3W6V A;  4BXX J;  2IBD A;  1XC5 A;  4RBO A;  1JTX A;  2R5Y A;  5GP9 A;  2R0Q C;  2AHQ A;  1QVT A;  2X6O A;  1MBH A;  2NOG A;  1VND A;  2M9H A;  2I10 A;  5FJ8 J;  4XIC A;  3TW7 A;  2LKX A;  2Y31 A;  1BL0 A;  3LOC A;  1MBG A;  4BBS J;  4AC0 A;  4A3F J;  4D7N A;  3ZQF A;  1ENH A;  2NS7 A;  4A3D J;  3RKQ A;  5M5Y J;  4FE4 A;  2G0E A;  2HYJ A;  3GTL J;  5J3L A;  3GBG A;  3JRG A;  1ETK A;  3CDL A;  2CQX A;  3Q0U A;  3ZQL A;  3Q0V A;  1GT0 C;  5F0H A;  1NK2 P;  3CCY A;  2M34 A;  5EZG A;  2JA7 J;  4A3E J;  1IJW C;  4C3H J;  3BG9 A;  1ZR4 A;  1U8B A;  5DS9 A;  1QPI A;  1ETO A;  3S2D J;  5IOZ A;  2ME0 A;  1MBK A;  1AKH B;  1O4X A;  2HI3 A;  3VPR A;  5FKO A;  2DA4 A;  2WAQ N;  1RPW A;  1BW5 A;  1JKP C;  2XPU A;  3S2H J;  3HB9 A;  2VI6 A;  1BJZ A;  3GTQ J;  1AHD P;  1MNM C;  2XGE A;  3S1N J;  1T33 A;  3JRF A;  4ABZ A;  2DA3 A;  5M5X J;  1HDD C;  3PO2 J;  3HOY J;  1ITY A;  1NTC A;  1Z0X A;  2QCO A;  3OIO A;  4W1U A;  2CJJ A;  1B72 A;  1FJL A;  3A01 A;  3HKZ N;  3C2B A;  1JKQ C;  2MG4 A;  5JLW A;  2D5V A;  3S17 J;  3FK7 A;  3GTM J;  4QTR A;  4MLO A;  3TED A;  1S7E A;  3HOZ J;  3ZOB A;  2XPV A;  4A3B J;  5C44 J;  2VPR A;  2K9S A;  4M3F A;  4CYC A;  2K9Q A;  5J1R A;  3PO3 J;  3DCF A;  2N8G A;  3HBL A;  2XRL A;  2B63 J;  1W0U A;  1RKT A;  3E7L A;  3BTJ A;  4JYK A;  1GVD A;  2MGQ A;  2DMU A;  2DMQ A;  3ZQC A;  5EZH A;  1Z77 A;  1I50 J;  2W48 A;  4IHV A;  3S1M J;  5F27 A;  4QIW N;  3FIW A;  4B1R A;  2E2I J;  2DMT A;  1A5J A;  1ETQ A;  3MKL A;  2GLO A;  2YS9 A;  1GV2 A;  4FE7 A;  4Y7N J;  2M0C A;  3S15 J;  4AUX A;  1MBE A;  1IDZ A;  3S1R J;  5IYC J;  2EQR A;  3LSP A;  3Q0W A;  2NVY J;  3NAR A;  3BR6 A;  1WH5 A;  2EBI A;  1Q1V A;  3OSG A;  4Y52 J;  5EG0 B;  2HQ5 A;  1Y1W J;  4GFB A;  2FX0 A;  1E3O C;  2LR8 A;  2QF7 A;  1RET A;  4BBR J;  2DMN A;  2ECB A;  4I6Z A;  2P81 A;  3ZQG A;  2Y30 A;  1DU6 A;  3TW6 A;  2EZH A;  4XK4 A;  3H0G J;  3JRC A;  2LTP A;  4QSH A;  4A3C J;  1ZTR A;  3JRA A;  2YU9 J;  5IYD J;  4FCY A;  1F43 A;  1JUP A;  2CUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...