1MBFA

Mouse c-myb dna-binding domain repeat 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbfA00
3FKIJ 5F0HA 3HGGA 1ETWA 5JLXA 5GP9A 1OCPA 1FTTA 2O8KA 3GTMJ 3LSGA 2TCTA 5FKLA 1ZQ3P 3BG9A 4JX4A 1K83J 2M2EA 4B3AA 3O8HA 2B63J 1ETVA 1APLC 4RDUA 1ZR4A 5M3MJ 3TW7A 2DA1A 4CYCB 3HDDA 1JKRC 2CU7A 2ID3A 3TP3A 3S16J 2NVQJ 1LFBA 1JUPA 3TW6A 1VI0A 4FE4A 4BBRJ 5M5WJ 1NK3P 4M3FA 1I3QJ 5IYCJ 4EEFG 4AUXA 3H0GJ 2EZIA 2M8GX 4V2GA 1B72B 2XB5A 1K61A 1WH5A 2CQQA 2XB0X 3S2DJ 2GBYA 4I76A 2HOSA 3HEFA 2WAQN 3FISA 1IGNA 2PMZN 4A3CJ 3I4MJ 2LLKA 1ZTRA 3S14J 4FCYA 1HDDC 1FTZA 2LD5A 1DU6A 5M5XJ 3JRBA 1MBFA 2EQRA 2EZKA 1LE8A 1MSEC 3RZOJ 2DJNA 3FIWA 3ZOBA 1RR7A 3G1LA 1IUFA 3TP0A 1YRNA 4JX5A 2COBA 3Q0WA 1FIAA 3HOZJ 2M0CA 5F0CA 5M5YJ 4V2FA 2ID6A 2K9QA 4J19A 3K7AJ 3L1PA 3ZQHA 3E7LA 3W6VA 2E2JJ 3CQZJ 3S2HJ 2E2IJ 4HNVA 1X2NA 2NOGA 2DMUA 3HOYJ 4QSHA 2XGCA 2ZB9A 3O8GA 3LSRA 1E3OC 1ETOA 2JWTA 2QCOA 3BR2A 1GDTA 1Y1VJ 3OSGA 3I4NJ 2IEKA 3OIOA 3GTQJ 2YS9A 4BBSJ 3SJMA 4Y7NJ 4A3GJ 5IOYA 3G1OA 3F0CA 4A69C 3HBLA 1JKQC 5BNGA 4D5FA 2XPWA 4IHYA 2M34A 1DU0A 4CYCA 1X2MA 1IDYA 1LE8B 3OSFA 4FE7A 1ITYA 1RKTA 4L5EA 5IPAA 5EGOA 5M3FJ 5J3LA 4A3BJ 1SFOJ 1QVTA 2R93J 5IYBJ 2FQ4A 1JKPC 4M3DA 4M3EA 3FK7A 4BY1J 3WHBA 4XRSG 1MNMC 1TWAJ 2HQ5A 5E3MA 1BL0A 3A01B 4X6AJ 4M3GA 1IG7A 1Z77A 4D7MA 2R5YB 4UUSB 2P81A 4B1RA 1TWCJ 2MW8A 3K2AA 4ABZA 2CUEA 3GTKJ 2R5YA 4JP0A 2JJ7A 4MLOA 2TRTA 3HOXJ 3JR9A 5EG0B 5K7HA 3SFIA 2IBDA 2LP0A 3A02A 3JREA 3LOCA 3PM1A 2LKXA 3ZQLA 3Q3SA 1H89C 3M4OJ 4JYKA 1ETYA 5F08A 2X9DA 1ZKGA 3B6CA 5FKOA 1JJ6C 1I6HJ 2HYJA 5IP7J 4M3BA 1ENHA 1ZR2A 2JA5J 1RKWA 3DCFA 3NARA 2VKVA 5IYDJ 4JX6A 4IHVA 4BXXJ 3S1MJ 3LSJA 1RPWA 3DEWA 4A3LJ 4MIMA 2QF7A 1HF0A 1JT6A 2EZLA 5FKMA 2XGEA 3JRAA 2DMTA 3H3VK 2ELKA 5HODA 1SANA 2NS8A 1VFCA 1MH4A 2LTPA 2JA8J 4D7NA 1W0TA 5EDNA 2DA3A 3HM5A 3IH4A 1JGGA 3HB9A 2Y9YA 4BKXA 2X48A 5C4JJ 2MGQA 4IEJA 2NVXJ 4XICA 4Y52J 1IDZA 2DN0A 4XK4A 1AHDP 3A03A 2K40A 1P7IA 5EYRA 3ZQFA 5IOZA 1AKHB 5FLVA 2HOTA 2VPRA 3IV5A 1JKOC 2M9HA 2YU9J 2DMNA 2ME0A 9ANTA 1TC3C 2MG4A 3CDLA 2WB1N 2FD5A 2NVYJ 2L9RA 1ZGWA 2ME6A 2DTZA 5F1JA 3Q0UA 5FLMJ 1O4XA 1T33A 4A3MJ 5EF6A 3GTGJ 2HI3A 1YRNB 2HDDA 1IV6A 2LK2A 1GV2A 1F36A 2DMQA 2LY9A 2D5VA 4DZJA 1JUMA 2Y30A 4IHWA 2CQXA 2W48A 2IAIA 1OFCX 2L7MP 2WV1A 4QIWN 3QQAA 2O9LA 1VNDA 2JMWA 1XG1A 1HCRA 1HDPA 4A3IJ 1UG2A 1AKHA 1MBGA 3HKZN 1MBJA 4A93J 2Y2ZA 3HOWJ 1CQTA 4LOCA 3BTCA 3VPRA 1W0UA 3M3YJ 2KT0A 2EZHA 5C4XJ 3JRGA 2HOAA 3IH3A 3CCYA 3G1MA 1VF9A 5C3EJ 1H8AC 2FJ1A 3C2BA 4NDLA 1GT0C 3MKLA 1JUSA 2CRGA 4A3KJ 2DMPA 1ETKA 1BA5A 3BR5A 2CJJA 1P7JA 3BT9A 2E2HJ 5EEAA 5EGOB 3BQYA 1B72A 4DW6A 4MFDA 1IJWC 1JJ8C 4XIDA 5EZGA 4W1UA 1LFUP 1T56A 2G0EA 5C44J 1JTXA 3CMYA 2XRLA 3BR1A 3GBGA 4MFEA 3D1NI 1ETXA 4RBOA 3GTOJ 3QPSA 4IHXA 2XPVA 3BG5A 1IRZA 3S17J 3OOUA 5DTDA 5GPAA 3BR3A 1U9NA 3PO2J 2X6OA 1QPIA 2L7FP 3S1RJ 1ETQA 2K9NA 1WPKA 2GM4A 4D5CA 5F04A 3JRIA 2OF7A 1PUFA 2JA7J 3JRCA 5EZHA 4DYCA 5IP6A 5E3NA 3ZQCA 2MSYA 1WI3A 1GVDA 2R92J 2K9SA 2NVTJ 1OJLA 1XS9A 4S0HB 3JRHA 2R0QC 4W97A 1BJZA 1MBKA 3BG3A 3MVPA 5JLWA 1X58A 3MN2A 2I10A 4UUSA 1G2HA 2XSDC 1A5JA 3BR0A 2HXOA 1XC5A 2AO9A 1HOMA 2VKEA 1MBHA 2Y31A 2DA7A 3LNQA 3Q0VA 2R5ZB 2E19A 2ECCA 4MO7A 4XRMA 4B4CA 4AC0A 2EH3A 2XPUA 2R5ZA 2R7ZJ 2EBIA 3LSPA 2OPTA 2Y0SN 4A3EJ 1I50J 3JRFA 2CUFA 3RKQA 4DZPA 1A6IA 1U8BA 4G12A 2NS7A 1TWGJ 1OCTC 3IH2A 4BY7J 2E1OA 2AHQA 5F0FA 3WHCA 4UUTA 3RQIA 3B6AA 1BW5A 3A01A 1ZK8A 2LVSA 1FIPA 1NTCA 1TWHJ 1S7EA 4X1EA 4M6VA 5J1RA 3HGYA 1NK2P 3SDGA 3GTJJ 5FKNA 1JTYA 1Z0XA 5J1UA 2YUSA 1MSFC 2DA2A 3UKGA 3JRDA 2ECBA 5E3OA 5FJ8J 1PUFB 2VUMJ 3FK6A 1IC8A 3BTJA 5E3LA 1D5YA 2JA6J 1H88C 1HLVA 4AYBN 3RZDJ 5DS9A 1FEXA 3NAUA 2VI6A 3ZQGA 2JK3A 1QRYA 2N8GA 2LR8A 3TEDA 4A3JJ 1U78A 1R9TJ 1JT0A 4C3JJ 4GFBA 2H8RA 3GTLJ 4FTHA 1B8IA 2GLOA 1MH3A 1GUUA 1WGXA 1TWFJ 1MBEA 3S1NJ 2FX0A 1ORKA 1GV5A 2DA6A 2DA5A 1BW6A 5GPCA 2H1KA 1FJLA 2DA4A 2L0KA 2RAEA 1UMQA 2XGDA 1Q1VA 4DYRA 5J1YA 1EF4A 1F43A 3BQZA 2O7OA 1RETA 3HOVJ 1POGA 1WCMJ 4DYQA 5FKKA 3BR6A 4QTRA 3BTIA 2L7ZA 4C3HJ 1U9OA 5K7FA 3PO3J 3BTLA 5EG0A 3S1QJ 3HOUJ 1B8IB 4FISA 1RESA 3QPLA 5F27A 4XRSA 1QVUA 1AU7A 3S15J 4A3DJ 1UHSA 4I6ZA 2KDZA 4A3FJ 2JN6A 2LFBA 1Y1WJ 5IP9J 5K7ZA 3GTPJ 2HXIA 4C2MJ 1WH7A 2Y9ZA 3ZQIA 4C3IJ
chains in the Genus database with same CATH superfamily
3FKIJ 4BYYA 2XAHA 2OA4A 4LG0A 1BIBA 5ICCA 3AKZA 3ERED 3VYRB 3L7WA 5HLIA 2OD5A 3IRRA 3CCSI 1FTTA 3C18A 3C3WA 2HZDA 4DBQA 3LSGA 2R7UA 3I3LA 3H3UA 2CW7A 2EFOA 2ZXIA 2FNAA 4AIJA 1RRJA 2FBIA 4B8XA 3J7ZI 3TW7A 4V19K 3KX2A 1BR2A 1JKRC 2CU7A 2DOAA 4OINF 3TW6A 1VI0A 4M3FA 5IYCJ 2C6YA 2KFDA 3IKVA 3I58A 1TTYA 1Z91A 2EZIA 4V2GA 1P4WA 5JR3A 2E5ZA 2X51A 2XROA 1WJCA 1YIJI 3HEFA 4IL6C 3FISA 3CC2I 3LAJA 4A3CJ 2LLKA 1ONVA 5BS6A 3GCMA 3LWFA 3S14J 1REPC 4JK1X 1XCBA 3RZOJ 3V42A 2HNHA 3FIWA 4Z6YA 3G73A 1UJ8A 3FBNB 3TP0A 3LSTA 1KGSA 1KU3A 2M0CA 3GVAA 3K4CA 3CF2A 3QRFF 4V2FA 2LYCA 5LLQA 2F6CA 4WX9A 3K7AJ 5CQEA 5D5XB 3S2HJ 1MGTA 2E2IJ 4RB1A 4CHUA 2VN2A 4CCOA 4CCJA 3DV8A 4QSHA 5L3FA 3PJRA 3LSRA 3HOYJ 2G7UA 1QBJA 5KAIC 3GTQJ 4BBSJ 3SJMA 1QHGA 3FHNA 1LJ9A 5IT3A 1T2KA 1S6LA 1EH6A 1X1CA 1IW7F 4RB3C 4KIBA 1LE8B 1KQ8A 3KP7A 4BE2A 2A61A 3E6MA 1RKTA 2EFNA 4CCLA 1AOYA 2LG4A 2IVMA 4L9JA 1SFOJ 3AL0C 4CYDA 1QVTA 5IYBJ 4CZZA 2V7FA 2CV0A 3D5RC 1HBXG 1T38A 2HTSA 1I27A 2X1DA 3NRVA 3FK7A 4BY1J 3SZPA 3WTSC 4RAYA 5E20A 1A35A 1U3EM 1MNMC 4G7ZF 1Y56A 3CUQB 5E3MA 1FOWA 1R4NB 3KETA 3A01B 1O3SA 4Q4ZF 1HKSA 1BR4A 1IG7A 1DDNA 4QPOA 4LLGF 2IRFG 2P81A 4QLCU 1TWCJ 2MW8A 2CUZA 4ON0A 2CUEA 4G94A 1XGOA 2B7EA 3LQRA 4E7IA 2TRTA 2WAFA 2QENA 3CZ6A 2Q8KA 1H9TA 1P92A 4ENMA 2VOPA 3JREA 2DOFA 2FRHA 1WKMA 2P7VB 2XV4S 3DBHB 2CO5A 3HG9A 2IP2A 1U2WA 4HA8A 3JTHA 2DAOA 1ETYA 4JYKA 4R1HA 5F08A 3ZMUA 2IS6A 3I64A 1ZAOA 3B6CA 3KP4A 4IXAA 2L54A 2M3AA 1JJ6C 4M3BA 1YX5A 1VQKI 2QKMB 5IYDJ 2A6EF 1MIJA 2K3FA 3GMEA 2VPLA 3LSJA 1RPWA 3N97A 1RUNA 1S5LC 2VQCA 3RPUD 3PUBA 3WTVC 1JT6A 5AIQA 2XGEA 2VE8A 1R1TA 1X19A 3ISPA 1J75A 2CFOA 3BROA 3H3VK 3JTGA 3F72A 2NS8A 2JZYA 3G3ZA 4OIPF 1IAWA 4A0YA 1ZRFA 2ZFWA 4GYGA 1MH4A 3PFIA 3F8CA 3CMEI 1YI2I 4E7LA 3HM5A 2XAUA 2QQAA 4BQOA 1SEUA 5TISC 3MEXA 3NWSA 4K2EA 1JGGA 2JTVA 3VYUB 4UNOA 2UUZA 2Y9YA 1YO5C 3D5LA 5C4JJ 1XTAA 1D5VA 2YX4A 2NVXJ 4C2TA 3KYLA 4XICA 3E5XA 1AHDP 1S7AA 2VBYA 1QQIA 5J4VA 2VJ5A 2K40A 1P7IA 3FM5A 4MNUA 5IOZA 1SVMA 5FLVA 4NHJA 1WJAA 2XUBA 4ZTFA 3IV5A 4YG2F 1BOAA 4EV0A 1Z3XA 4AU7A 3S3OA 2DPDA 4ZDPA 2WB1N 2NVYJ 1K78B 4WXDA 2LNBA 2VL8A 3OYDA 1TQIA 1X4OA 3IAM2 4XKCA 4RB2C 3CJNA 3UR3C 1BI1A 2BXZA 4F3QA 3OV8A 1MJBA 3GTGJ 2HI3A 2EK5A 4YFKF 1IN8A 3KLOA 2BVLA 3MMYB 4GGGA 3KE2A 4LB6B 3K4NA 2DMQA 2ESNA 3QU3A 1JUMA 1LDJA 2L4AA 4BS9A 3ZQQA 3DPUA 4IKFA 3ZMVA 3AG2H 1DP7P 2IAIA 4RM3A 1C0WA 3VWBA 3QQAA 1DPUA 3W6JB 2RV8A 2JMWA 2DYSH 1HDPA 1LPQA 3HOWJ 2WADA 2P6TA 5L3GA 4LB5A 2W00A 1LEAA 1TW2A 3VPRA 1Z6TA 3PIPF 3P9IA 2ZJQF 1OCCH 1TW3A 2KT0A 4N4NB 3SYTA 2ICWG 2V9KA 4ZJZA 2Y48A 3K4BA 3CCYA 1H8AC 2KDOA 2NOJB 4UVAA 1JUSA 2CRGA 2RQPA 4HSRA 2DMPA 3F22A 1FWZA 1BI3A 1FOXA 1ETKA 2OJED 2QYOA 1B72A 3CD6I 1JJ8C 2V6CA 4HLXA 1G3TA 4CZCA 1TNSA 1KU7A 1K79A 2BGCA 3T5XA 2E60A 1FZPB 3FMQA 4MFEA 3D1NI 2VXZA 4KMFA 1O7LA 4PGGA 3D0SA 2EV6A 5GPAA 3BR3A 1JE8A 3I59A 1ETQA 1D1CA 3CESA 1IF1A 2O03A 3LA7A 3QPHA 4G6QA 2VQHA 2JSPA 2X6XA 2AQEA 4OAYA 5EZHA 2KLOA 4E7HA 1DGRM 2DPUA 2HFHA 1KZHA 2RNGA 2IGNA 1DPRA 2JRMA 2MSYA 3JSPA 1T8IA 1VQ9I 2HU9A 1IXSB 2Z1DA 2K9SA 4ZYEA 1SC7A 1OJLA 5DD8A 4A6DA 1Q1HA 2L7KA 4CCKA 1N77A 1OPCA 4HX7A 1YQAA 4XR6A 1FYLA 1PYVA 5JHUA 2MH9A 3MN2A 1G2HA 1HC8A 2EV0A 1MMNA 2RQQA 3MFKA 1XC5A 1R1VA 4OIOF 3WTXC 2VKEA 3L2CA 1YS7A 4I7HA 5B1AH 3BDDA 4LLLA 3Q0VA 3T0YA 2E19A 4PGHA 4MO7A 4XRMA 2VIXA 3F8FA 3FMRA 4I02A 3A2KA 3DBRB 2E34A 2Y0SN 5LHIA 4NC7A 4ZYHA 2HVSA 3W6KB 3BJOA 1I50J 2HKXA 3F8MA 1IN5A 2IA0A 1U8BA 1LEBA 1GLNA 4U7DA 3H1CA 2XAQA 5F0FA 5E79C 2MLKA 4P1WA 1E0EA 3BJ6A 1O57A 4PJNA 3J7AY 1PVEA 1ZK8A 3J80K 3DWLE 5L3BA 1T98A 3GTJJ 1VQOI 1UZCA 4YFNF 1JTYA 1Z0XA 3CJQB 2LBFB 4IZZA 1USSA 1PUFB 1IC8A 2DJIA 3ERMA 1D5YA 2RGVA 4OAZA 4BHCA 4M73A 1H88C 4IHTA 1WFXA 3RZDJ 2JVHA 3NAUA 1XGNA 4UVCA 2CS3A 4B48A 3IUOA 3ZQGA 2HWVA 3EUAA 3DEUA 5GTIC 4KNYA 4Y15A 2N8GA 4BXUA 2LR8A 4KN7X 1W5SA 2F4MB 2KQRA 4C3JJ 3HHGA 1VQNI 1FYKA 4FTHA 2GLOA 2YU3A 2MD0A 1HQCA 2FOWA 2ZSIB 1SAXA 3L9FA 2QWWA 2XAJA 4KT5C 3I0TA 3A0BC 4RM2A 4BJ6C 1BN5A 1ZLJA 2DA5A 1I39A 5GPCA 2BY1A 4RGSA 5D4SA 3N4MA 2XF6A 2P4WA 3OR1C 2IS4A 5J1YA 1EF4A 3ASNH 3C7JA 2MC3A 1GXPA 3WG9A 3PFYA 4XM3A 1IN7A 5L3EA 1YW7A 1OKRA 1IXCA 1AWCA 1WCMJ 1IV8A 1X3WB 1V4RA 2K02A 4DYQA 2ZNYA 3BR6A 4QTRA 1NHAA 4G8XA 1B9NA 3PO3J 3BTLA 1V55H 2Q1ZB 1UCRA 3K9TA 4ZZLA 1QVUA 2DYRH 2AQFA 4XRSA 3G4SI 4A3DJ 1DUXC 4I6ZA 4A3FJ 4DNCA 3L2QA 1NG6A 2HXIA 1WH7A 1M1EB 4EGZA 5J40A 1QA6A 3HTUA 4KFCA 1ETWA 4EQQA 2R7XA 4HF2A 1GVJA 2G7HA 4QWQA 2DK8A 3BZ6A 3GTMJ 5DCFA 3F8NA 2JSCA 2TCTA 3LSMA 4YELA 5D6EA 3I56I 1ZQ3P 1Z05A 3O2PE 2J5OA 3O8HA 2B63J 3VOEA 3RKXA 4HX8A 2NYXA 3ZN1A 1MNDA 5BPDA 3ULQB 1FLIA 2DA1A 1PJRA 3U1KA 2BW3A 2CW0F 2NVQJ 1LFBA 4BBRJ 2ZMEB 1PDNC 2WAEA 3HXLA 3H0GJ 4AUXA 2BBYA 4S04A 2GIZA 4BEHA 3CP2A 2JPBA 4F93B 3S3MA 2XB5A 1WH5A 2R3SA 2Z33A 2XB0X 2R7TA 5D8KB 2IJLA 2OAZA 3SDBA 3AL0B 4MTEA 5LRSA 2E1MC 2XGXA 2XKOA 3GUDA 1IGNA 4EJTA 4I09A 2PMZN 2FSWA 2E35A 5CVRA 2MABA 1ZTRA 3E6BA 4NC6A 4FCYA 1HDDC 2LD5A 1BC8C 5M5XJ 1LE8A 4BHPA 4AWXB 1P9QC 5IT9K 4E7JA 5CJ9A 4LIUA 4I99C 4WK8F 3G1LA 1WJDA 1IUFA 2XF5A 4EATA 2HEOA 3MZHA 5KVRA 2KRHA 1JI8A 4XSZF 5CVIA 2COBA 2F5FA 3HTSB 3HOZJ 5F0CA 5HS7A 3VSKA 4A6EA 2GXBA 3W2WA 5E1XA 4P96A 3MQ0A 4HG2A 4U0WA 4MQ9F 3L1PA 1ZH5A 3W6VA 4M74A 3F6OA 1WJFA 1YLFA 2FU4A 2NOGA 4FASD 4HNVA 4KISA 2XGCA 2ZB9A 4RB0A 5CVJA 3FXMA 1ETOA 5E1WA 2R7SA 3CCLI 3BJAA 2Z9OA 3R6SA 2CQKA 2EPFA 4R8HA 2J5PA 3RPUA 4O3MA 3ABUA 2KKOA 2QGUA 2ZJPF 1CF7B 5DV5A 2HVRA 1T6SA 4A69C 4UVBA 1JKQC 5BNGA 4D5FA 3LQQA 2STTA 3U1DA 1W4MA 1B1BA 1WJBA 4WXHA 1R22A 2ZO4A 5F6FA 4FQGA 1XGMA 1YS6A 1RZ4A 5ED4A 2UXNA 4KYWA 3ZR8X 3OYHA 1W36C 3OSFA 4FE7A 5IPAA 5FD5A 5EGOA 5J3LA 5L3DA 4XQFA 5LFAA 4N9HA 2DFFA 4OWRB 3G6EI 2FQ4A 1OYYA 2ZJ2A 5IY5H 2F5EA 4ZTJA 3J80Z 5J4YA 2OU2A 1TWAJ 2HQ5A 2WC2A 1XGSA 1BL0A 4KITB 1JHFA 2CWEA 5TRDA 2F5DA 1PP7U 1RC9A 2GOMA 2R7QA 3KZIC 4UUSB 3OYNA 3ROUA 2E5NA 1LNWA 1PUEE 2PMUA 1I1SA 2CH0A 1FBQA 1OR7C 2VKDA 2JJ7A 4MLOA 2V1NA 3HOXJ 3HPHA 4C2UA 5ILUA 3LMMA 2LP0A 2M0MA 2OUMA 4M9SA 3M1CA 4E6KG 1ON1A 1S9HA 2LKXA 1H89C 2R4GA 3M4OJ 4KN4X 5E18F 1I3AA 4RAFA 4IRGA 5GAHJ 1T0FA 4BAYA 1FSHA 1SD7A 3OIPA 2HYJA 2JA5J 1RKWA 1YYVA 2VKVA 3GZ6A 3SEZA 4BXXJ 2P8TA 3PQKA 2W24A 2QLZA 2VBWA 4MIMA 2XAFA 3V7RA 1HF0A 3FM3A 1CF7A 2EZLA 5FKMA 4CDGA 2CW8A 1LDDA 1EA3A 3H3ZA 5D8LB 2W57A 2XC7A 1W1WE 1EJ9A 4RS8A 1R6RA 5HODA 4KA4A 4PUSA 1YOVB 1LDKB 1VFCA 4GYIA 2ZFUA 4D7NA 3ZMSA 2A5WA 4PCQA 1BBYA 3ESWB 2VONA 3CCQI 3EUHA 4RAGA 2X48A 5FB2A 3Q9SA 1SMYF 2M1BA 1YX3A 1OISA 2H6CA 2XIGA 4E7SA 5B5EC 2D2WA 2DN0A 2UV1A 3ZPLA 4EJWA 3ABLH 4PK4A 5EYRA 5FRNA 4BJTA 1SD6A 2HOTA 1HXDA 1W7PD 4LIVA 3BZCA 2M9HA 2A69F 2YU9J 9ANTA 2XAGA 1OYIA 2EFQA 4UXNA 1N75A 2E71A 2DTZA 2W84A 2QBYB 4EJUA 4G7HF 3EYIA 5AONA 3GFIA 3E5UA 1Y39A 2E7XA 5ICGA 5HDGA 3DQVC 3H9GA 4XLFA 1SFUA 1BR1A 2HDDA 4U0YA 3H92A 4JQFA 2VE9A 2FA5A 4KIFA 3H5NA 1K4TA 1E2XA 1GV2A 1N25A 2DT6A 3IC7A 3J81Z 4XN3A 4EM0B 2CFXA 4XKVA 2DW4A 2FBHA 4QIWN 2B9SA 3CC4I 2MBFA 3I54A 4E7KA 2DLLA 1HCRA 4A3IJ 3F23A 4YRVA 1AKHA 2HYGD 4HOBA 4PZJA 1CQTA 4LOCA 4U0VA 3RQ4A 5B3SH 1EV7A 3CP8A 4BL0B 2KRFA 5FLXZ 3ECHA 2KPMA 5B66C 1V5FA 2AXTC 2LRDA 3G1MA 5C3EJ 2FJ1A 3DKYA 2F4OB 2Z16A 3WTUC 2KIMA 2P5LC 2CYYA 4HQEA 1CGPA 3BR5A 3K4JA 3BT9A 5EGOB 1XMAA 4U87A 4DW6A 1XDSA 1IJWC 1W7PB 2XVCA 1IN4A 2E1NA 5EZGA 2GAUA 2BYVE 1T56A 1MDMB 3QYFA 3K70C 5HNHA 3ZRGA 1EKEA 3L00A 3TGNA 3GTOJ 4RBOA 2PFBA 4XLHA 3GW2A 1IN6A 1IRZA 3S17J 4BHBA 3I53A 1ZHFA 3GF2A 3J81K 3FXUA 1ON2A 2HQNA 2K9NA 3HPGA 3JAMZ 5F04A 1PUFA 2BE5F 1SD5A 2EB7A 2JA7J 4DGWB 3JRCA 5HLTA 1B6AA 4DYCA 2IGMA 2B0LA 5IP6A 1S7OA 1K6OA 3ZMZA 3V7SA 3KEQA 2R92J 3J7AO 2H09A 3KP5A 2NVTJ 3RYRA 2M4GA 4U88A 1DP3A 4XKWA 5D4RA 3E1SA 2RVCA 3JW4A 3I55I 4DJAA 3OYLA 3A0HC 1J59A 3MVPA 3BWGA 3ZXSA 3OY9A 2PJPA 1A5JA 2AO9A 5AIPA 4YIRX 2CGPA 3TOAA 3B02A 4L18B 4Q5SF 2ELHA 1J5YA 1VQ6I 2Y31A 2GZWA 2LBFA 1B9MA 2R5ZB 2ECCA 3CCEI 3HRUA 4H4KC 4AC0A 1JGSA 1KYZA 2EH3A 4XN0A 3LSPA 6PAXA 2O8XA 2GIVA 2V6EA 4X0GA 3EUHC 2MH2A 4MTDA 4N9IA 3RKQA 4DZPA 2LKSA 1L0OC 1SVLA 2EA2A 2NS7A 4G12A 4NUBA 5HNFA 1TWGJ 4EJVA 1D3YA 2OCEA 3IH2A 5HS8A 1NH3A 2E1OA 4IRIA 1OMIA 5D5UB 1FX7A 3WHCA 2PBIA 1KQ9A 3FBIB 3QWLA 4B47A 1HW1A 3A01A 2LVSA 3N05A 2GA2A 3QODA 2OV7A 4M6VA 4NC8A 5B1BH 1J7KA 2QQ8A 5DM7F 2Y0MA 2IW5A 3RPQA 3SDGA 5HOOA 1T95A 4RLFA 1ZLKA 2WAQA 4Y3OA 4B44A 2DQLA 5J1UA 4B3XA 2DA2A 5TGTA 2QSHX 3FXKA 3BTJA 5E3LA 3BOQA 5JI6A 2E1MB 1EH7A 1FOKA 4OU0A 4AYBN 5L3CA 1VQLI 1S72I 3ECOA 4WXCA 5BPIA 1R5HA 4LJZF 3RKWA 2FBKA 2MFZA 1G3YA 5ILVA 1R23A 1TNTA 4XKBA 1QRYA 1ZGAA 2LF7A 3RTRA 1U5TB 3TEDA 3SXYA 2GXGA 2H94A 1J0RA 2KIQA 2JA2A 2RN7A 2EIKH 4L5JA 2KL4A 2D45A 1B8IA 2YR2A 1MH3A 3K4LA 4PFPA 3JSOA 1S3JA 2R7DA 1MBEA 4L0YB 1FP2A 2K86A 3DPTA 2DA6A 5H6RA 4DOZA 2UWMA 3SZTA 3BCBA 2PX9A 3W2AA 1BW6A 2H1KA 2RAEA 3F9KA 3CJRB 1UMQA 1KA8A 4C30A 2XGDA 3NWTA 1Q1VA 1FBSA 3OL4A 4PDKA 3DEEA 3BQZA 2O7OA 2HZTA 1R36A 2DO7A 3FWEA 1RETA 5JVGF 2L02A 1QU3A 1POGA 2PLYA 4EGYA 1R00A 1N78A 3EUKL 5FKKA 3DF8A 1P4XA 2L7ZA 4C3HJ 4PJMA 1U9OA 2K4BA 4M9XA 5K7FA 5LGTA 2HQAA 3LFKA 3CO6C 2EIJH 2QVOA 3QPLA 1Z1DA 3H9QA 3O3KA 2M8EA 1AU7A 3S15J 2KDZA 4UUVA 5IP9J 2HR3A 5K7ZA 4XOTA 2Y9ZA 4BU2A 4HPQA 4HDVA 2O0YA 5F0HA 4XL9A 1AA7A 4G6TB 3EYYA 2PEXA 3K1MA 2K27A 5LEKA 3BG9A 2M2EA 1WI9A 2K7LA 3GFLA 4RDUA 1G3WA 1ZR4A 1IO2A 1H9GA 5M3MJ 3KZYA 4CYCB 2JUCA 3S16J 3TP3A 2FMYA 2HKOA 4F91B 1JUPA 4NQWB 4OOIA 1VQPI 4XLAA 3CF5F 1FSEA 1NK3P 1I3QJ 1TZLA 4EEFG 3C2GA 3OYKA 4XONA 3K69A 1VQMI 2LY1A 2ZXWH 3OYAA 4G7OF 4ZYGA 2V26A 5BOXA 1K61A 3K1NA 5FRMA 3C2HA 4JBAA 4XORA 3Q5FA 5FLXK 3K6GA 4I76A 4O5VA 2HOSA 2HS5A 1XMXA 3IRQA 4XNFA 4A12A 4ZDOA 4L5IA 3I4MJ 4HW0A 4HNUA 3BLYA 2HPMA 2ISZA 3GYHX 1DU6A 3M8EA 2ZBKA 2EQRA 3HSRA 2EZKA 1D0XA 4ESFA 2DJNA 4ANJA 2K85A 3BC8A 2ZKZA 4CCMA 1FC3A 2CG4A 1LB2A 5ICFA 3O6BB 2L9NA 2P5KA 3PQJA 4FHTA 3B73A 3KLNA 4XMYA 1FIAA 5E8GA 3TKYA 1YFHA 2VT3A 2ID6A 3EDPA 4N4OB 3PIOF 5K5OA 1RI7A 1YTYA 1J9IA 3K1PA 1MJAA 1XN7A 3E7LA 1ZGJA 1FNNA 1X2NA 3CCJI 3H5RA 3O8GA 4ZZDA 2ZCWA 3MKYB 3KP2A 3T8RA 5FO5A 3BR2A 3U2RA 2LOOA 3E3VA 3R61A 1H0MA 1Y1VJ 3W2VA 3OSGA 3I4NJ 4MGRA 1BC7C 1G4DA 1SAUA 1BI2A 1W5CC 3PNYA 2VJ4A 4CH7A 3S8PA 1LVAA 2EIMH 1TBXA 3FXRA 3G1OA 1GHCA 1G6NA 4RA2A 3FXLA 3OYMA 2HOEA 2VODA 2WA0A 2JRTA 4NBQA 1USTA 3WTYC 2XPWA 2M34A 1DU0A 3HL2A 1X2MA 5EEHA 5GTHC 2HVQA 3J7YJ 3P9KA 4LFUA 3OYIA 2IPQX 3BG6A 4BXFA 2R93J 3DTEA 1JKPC 3IWFA 1WQ2A 1UHMA 4M3EA 3CLQA 2HDWA 4XRSG 2K3PA 4LLNA 4LD5A 3G71I 1X3ZB 3MAJA 4XRFA 5K1YA 2PJRB 2DCEA 1Z77A 2EINH 2A68F 2R5YB 4PJLA 4KMUX 3DLAA 2Z3YA 1YW9A 3GEZA 1D0YA 1S8NA 3K2AA 4HF0A 4YEJA 4ABZA 2R7VA 2R5YA 4JP0A 1XCVA 1RNLA 3AG3H 2A3SA 2V9VA 3E6CC 4Q48A 1IUYA 4XLEA 5DD4A 1XMKA 3DKXA 5K7HA 3SFIA 3GXOA 4BGDA 3A02A 3RIRA 2OQRA 4XOPA 2XKPA 2W1OA 3LOCA 3PM1A 1D1BA 2PMZA 3IHUA 1HKQA 3UNGC 1ZKGA 2F5CA 3BZKA 1KU2A 3JCUC 1XSDA 2JQ7A 2X6WA 5CPRB 2XRNA 1ENHA 1ZR2A 3H35A 3CDIA 3NARA 2NNYA 1JXSA 2TDXA 4JX6A 1F4KA 1QGPA 4M71A 4OIQF 1X1PA 3DEWA 2OC6A 4RGRA 4EMSA 3FZVA 3WU1B 2IA1A 4EJOA 5BQTA 4HNTA 4KDPA 2KZVA 3PNVA 2PI0A 2DFEA 1YG2A 2DMTA 4PJ0C 2WWYA 3M8FA 3GLXA 4L9NA 3GZ5A 2BXYA 2D1HA 3OYJA 3WGHA 2FOKA 2KISA 4KICA 2VXDA 1YJWI 3IWZA 3KYCB 3RDIA 1XB4A 3HB9A 4LK1F 4BKXA 2W4SA 2MGQA 2DQRA 3M9AA 2NVUB 4HRIA 4IEJA 1MNEA 5JVTA 1OCZH 4OIRF 2X4HA 4Y52J 3M8JA 4XK4A 3CUQC 4II2A 3ZQFA 3LA3A 4EVIA 2RC4A 1AKHB 3ASOH 4BQAA 5DCMA 2VPRA 3CMAI 5ERIA 3K4MA 1YHQI 1JKOC 2VKHA 4IHSA 3PUFA 1FMVA 1ZN2A 2DMNA 2ME0A 2DBBA 3ABKH 2OZ6A 1Y0UA 2L5QA 2BY3A 2O3FA 2Z2SB 3CDLA 3WTTC 3CCUI 2FD5A 3OS2A 4P5OA 2F2EA 2EILH 4M9ZA 5F1JA 5LHHA 4WWCA 2VJJA 1ZG1A 2IS1A 3GZNB 2EA4A 3TQNA 2K9MA 2Q0OA 4A3MJ 3V8LA 2PJRA 2F5VA 5EF6A 2W82A 1YRNB 3A4CA 4D0PA 2LK2A 5JFRA 1F36A 2D5VA 4DZJA 3ZP5A 5HLGA 1YE9A 2DDAA 4IHWA 2QZ8A 2L7MP 4L9VA 5CLSA 5IT9Z 2O9LA 2R7WA 4QPQA 4AM3A 3VEPA 2WTEA 1VNDA 1UELB 1XG1A 5EEGA 1UG2A 1MBGA 3HKZN 1MBJA 4KJZA 4A93J 2NXNB 4E7ZA 5HLHA 3T8TA 3L2WA 2IGKA 1W0UA 1ODDA 1G3SA 2EZHA 3W3CA 2ZXJA 3JRGA 3RKYA 4NB5A 1GXQA 1VF9A 4XLPF 1R1UA 3C2BA 2Z99A 1ZELA 1HW2A 3MKLA 2X6YA 2ACJA 2LF8A 4HLYA 3AAFA 1OLTA 1TP4A 1BA5A 2CJJA 1P7JA 1X1BA 3QPTA 3BQYA 2W7NA 3I4PA 1T08B 2JPCA 4MFDA 3H36A 4ZH4F 4DBRA 1U5TA 2BOLA 4W1UA 4BDYA 4IQ4A 1LFUP 1MMGA 2YSRA 2ZSHB 2LC2A 1P2FA 5C44J 1JTXA 2ELJA 3GBGA 1UAAA 3QPSA 4IHXA 2V1XA 3BG5A 3E6DA 3OOUA 3IKTA 2DXIA 2JT1A 1U9NA 3TMOA 3RYPA 2L7FP 4F92B 3S1RJ 1L3LA 1WRJA 3U9GA 2M5WA 4D5CA 3MCZA 1YJNI 2FE3A 2QQ9A 2H6BA 1YJ9I 3KYDB 1QZZA 4Y17A 5CVUA 3GX4X 3T1BA 3KCCA 1U0JA 1VQ7I 1BJAA 1GVDA 3E0JB 4A2UA 4ESBA 3SEQA 1XS9A 3MZ8A 4S0HB 5D5WB 3RJPA 2JVGA 3OS1A 1QZEA 1MBKA 3BG3A 4NQWA 1A04A 3H5AA 5JLWA 1MMDA 1X58A 2UXXA 4UUSA 2VT2A 2XSDC 1R7JA 5J6XA 3BR0A 4ZC3A 3OWTA 1UFMA 4G9YA 4BJ5C 1U6GA 3CDHA 1Y0NA 2DU9A 2QUFA 3HC7A 3KPHA 5E1ZB 4IOCF 4UY8I 3WTWC 1SFEA 3DPLC 2HQRA 2CV2A 3HOTA 2R5ZA 2R7ZJ 2EBIA 1W7PA 1R49A 2MA3A 1MZBA 2KIFA 2OPTA 2VJIA 2DK5A 3WE2A 4A3EJ 2CQ7A 4JOMA 3WU2C 2DT5A 4HQMA 4OMYA 1A6IA 3RCOA 2PQ8A 1UB9A 2ZC2A 2GOXB 2MD5A 4FX0A 3GLLA 2AHQA 3RQIA 3WTZA 1KQ0A 4Y33A 4ASNA 3QU6A 2G9WA 3FX3A 5CVVA 5CQGA 1HA8A 2KJBA 4XLNF 1TWHJ 1NTCA 2LH9A 3KZZA 3OYCA 5J1RA 3HGYA 1NK2P 3MKZA 2V4JC 3SQNA 2FQ3A 5EJCA 2LREA 5DCMB 2X1CA 2YUSA 1MSFC 1RUOA 1I6XA 3UKGA 1XDUA 5E3OA 2ZMEC 5FJ8J 2VUMJ 3FK6A 3TDUC 1QHHD 2K4JA 3E5QA 3CCRI 1HLVA 5FFXA 1WJEA 3NQOA 1Z9CA 1FEXA 5KCMA 2VI6A 5H20A 3LSKA 3FHZA 2AXLA 2QSFX 3VSLA 5J47A 3M07A 1ERDA 4HEA2 3K2ZA 1E3PA 1VTNC 1IRFA 1MD0A 5ICEA 3CUQA 1R9TJ 4MEYF 4IO9F 1JT0A 1I5ZA 1ACIA 1Z3YA 4GFBA 2COMA 2L01A 2VC0A 2H8RA 4EM1A 3F21A 2VC1A 4ITVA 4UB6C 5F64A 5KNLA 3GTLJ 2ISYA 4AD9A 2Y0SA 5FROA 1WGXA 1TWFJ 3VYTB 1ULYA 3HZJA 1ORKA 2DODA 2Q2EA 3FKJA 2O6GE 1V5GA 1K7AA 2BY0A 2LSOA 1FJLA 1F5TA 3SHFA 3MZYA 3SZGA 4A0XA 4LMYA 4DYRA 1F43A 3CUOA 3HUGB 1T39A 3COAC 3HOVJ 2BW3B 1A31A 1DGWY 1UG0A 1XSVA 2WB1A 1J2XA 1U5TC 3D5SC 5CYVA 3JAMK 3BTIA 4XSXF 2QA4I 1LKXA 2YPRA 1QNTA 4RAZA 2BY2A 1TLHB 1BIAA 2A5YB 3DXJF 5FFZA 3HOUJ 1B8IB 3P7NA 4FISA 3V8KA 1ZARA 4ENNA 5F27A 1JHHA 2JN6A 2LFBA 2R7OA 4CICA 3QAHA 4II3A 2Z5UA 5GAEJ 3CO7C 3WE3A 4C3IJ 2XDVA 3HGGA 2LKPA 4BNCA 3MD2A 5JLXA 5GP9A 3HJEA 3PL8A 3WU0A 2OTJI 1OCPA 2BVMA 2LMDA 2O8KA 2JUGA 2DFHA 5FKLA 3K4KA 4JX4A 1K83J 3DTIA 4ZDLA 4B3AA 4PFOA 1K6YA 1X4PA 1ETVA 2BEOA 4LGWA 1APLC 3HRMA 3VYSB 3L09A 4M6YA 5DYMA 3HDDA 2ID3A 3QP5A 4M6XA 3TBIA 3KEOA 4TV7A 3MKWB 4A5NA 3CCVI 4FE4A 5M5WJ 1WSUA 1R71A 2IXSA 3AFHA 3ZN0A 4AYBA 4L0ZB 1SVOA 2A6HF 2M8GX 2VQLA 1B72B 3TO7A 2CQQA 3G2BA 4D9JA 2Q2EB 4HSTA 1VQ8I 1FMWA 1O7FA 2CUJA 3S2DJ 2GBYA 5TJJA 2BHZA 3M1EA 2FUG2 2WAQN 3QP6A 4ENKA 1IXRC 4UV8A 2VQGA 5DUKA 3VFZA 2OBPA 1FTZA 2STWA 1F1ZA 3JRBA 1MBFA 2I5UA 1MSEC 5LHGA 4UB8C 4IPAA 3ZOBA 2V9PA 4GCVA 1RR7A 3EPZA 3TL4X 4BUPA 4OMZA 1YRNA 2F4IA 3Q0WA 3H9JA 4JX5A 1VZ0A 1U8RA 5M5YJ 2K9QA 4F7ZA 4MEXF 2NNNA 4J19A 2FMLA 3LFUA 3ZQHA 2LY2A 3TO9A 2KMUA 3P5JA 3S93A 2E2JJ 3CQZJ 1FT9A 1BI0A 1TL8A 1K78A 3WODF 3HRSA 2DMUA 1E17A 4HV6A 2Y69H 4P9UA 5FD6A 1B4AA 2DT7B 4WF2A 1E3OC 2EV5A 2JWTA 4B43A 2QCOA 4CCNA 1GDTA 2GQQA 3HYIA 2M4KA 2IEKA 3OIOA 2YS9A 3OYEA 1D1AA 1HKTA 4Y7NJ 2L9VA 2CV1A 1WWXA 4A3GJ 5IOYA 3F0CA 3GWZA 2L9SA 1TQPA 3HRTA 3HBLA 3OS0A 3NEUA 4HAMA 1BOBA 2XHKA 4A0ZA 2QM3A 3DBLB 4IHYA 1FP1D 1LQ1A 4CYCA 1IDYA 4ETSA 3DKWA 1ITYA 4L5EA 3LSHA 5M3FJ 2V1UA 1I1GA 1QO0D 1P6RA 4A3BJ 5LEJA 5KK1A 5ILSA 4M3DA 3IP4B 3CLOA 1Z21A 2E36A 4IF4A 4ZYDA 3WHBA 4CA0A 3TDZC 1LFPA 2PG4A 4X6AJ 4EM2A 4HZFA 3DP7A 4HDUA 4M3GA 4D7MA 4YFXF 2GWRA 2PN6A 4AVZA 4LK0F 3H0DA 3OYFA 4Y4RA 4P55A 4Q47A 4B1RA 3L2RA 4N0BA 3GTKJ 2V79A 5LGNA 4CSWA 3OYGA 2A07F 3VDXA 4AIDA 5EG0B 3JR9A 1W5TA 2IBDA 3EQLF 1ZRDA 3PSFA 4G6DA 3MWMA 4ZYAA 2OTLI 2QQBA 3FMSA 3ZQLA 3Q3SA 4P9FA 4M72A 1A6QA 2D1VA 3X2QH 3F6VA 2VOOA 2X9DA 3QOPA 3LL7A 5FKOA 2IT0A 4I01A 1OYWA 4LG0B 1I6HJ 1YIOA 2RKHA 5HVQC 4CXFA 2M30A 5IP7J 4KIGA 1RR8C 1MDMA 2BHYA 3FXOA 3DCFA 3VODA 4IJAA 3HSFA 3LSIA 2NS0A 4IHVA 1YITI 1R5ID 3ELKA 5LRRA 4B09A 3S1MJ 4A3LJ 3WGIA 1Y8QB 2QF7A 2WY8Q 1KU9A 3CMMA 4E4HA 2L3DA 4E70A 4J01A 1HSJA 2P5VA 1OR7A 3R4KA 3WGGA 5LBQA 3JRAA 2O61A 2ELKA 1TT5B 1FOYA 1SANA 1OCOH 1V54H 1X1AA 2A6TA 2HYFA 3R0JA 1XPXA 2RREA 2LTPA 2RDPA 3RSNA 4IX7A 2JA8J 2EFWA 2E7WA 1W0TA 5EDNA 2DA3A 5E17F 3IH4A 1O3TA 3Q9VA 4O6JA 3GO5A 2X1EA 1MKMA 4Y13A 4I2OA 4PSXA 1O3QA 1R5GA 4GDFA 1R4MB 5J8FA 1IDZA 1TQMA 1G8XA 2W85A 3K10A 3A03A 2F48A 2VBXA 5DEQA 3OYBA 1J09A 5BMZA 2BZTA 2QSGX 2P6SA 1LUJB 3KIOA 3S32A 2OQGA 1UHWA 3KFWX 3ONQA 3KEYA 1TC3C 1F9NA 2MG4A 2R7FA 1LVKA 1MJ9A 3REOA 3I9V2 4RGUA 4GXOA 4XLCA 2L9RA 5KAFC 1ZGWA 3BP8A 1WJ5A 4CO8A 1KONA 2ME6A 1D8JA 2HGCA 3ABMH 1Z67A 3Q0UA 5FLMJ 3ML6A 1O4XA 4BEHB 1T33A 3P9CA 1FPQA 1G59A 2XSJC 4UHTA 1SFKA 4CUGA 1IV6A 1ZYRF 2CMPA 2LY9A 1R58A 2E1CA 2CQNA 5D5VB 2Y30A 2VASA 1MMSA 1ZG5A 3ZMTA 2K9LA 4IRHA 5E8IA 5JHFA 2AS5F 4RLQA 2CQXA 1KYWA 2W48A 1OFCX 3FF5A 2WV1A 2ZXHA 4PSWA 1VQ5I 1P4AA 3GFJA 3R60A 3SFZA 2MC4A 2Y2ZA 4DIQA 4LITA 5H2FC 2FEZA 1Z7LA 2HPIA 2VB6A 3BTCA 3CTAA 3HUGA 3M3YJ 2A05A 2GXAA 4U7BA 4HV5A 3K0LA 3DLLF 3FXJA 4FX4A 5C4XJ 5CKTA 1O3RA 1ZG3A 1FY7A 2HOAA 3IH3A 1EH8A 2DI3A 4NDLA 1Z6RA 3HSEA 1GT0C 2P0WA 2LDUA 1D0ZA 4A3KJ 4FT8A 4KUMA 2E2HJ 5EEAA 2BV6A 3LAPA 3E97A 3K70D 3HKZA 5FGMA 4XIDA 1PP8F 1STZA 2FXAA 4BQQA 3ZGKA 4FETA 2G0EA 4F55A 1IRGA 3OMYA 2DFIA 3CMYA 3V7CA 2XRLA 3BR1A 2KP6A 1FYMA 1ETXA 1MMAA 3L2UA 2XPVA 5DTDA 2IS2A 4UV9A 4S05A 1V3FA 1WVRA 2M87A 3PO2J 2X6OA 1QPIA 2NAZA 2M7AA 1BM9A 1WPKA 2GM4A 3JRIA 2OF7A 2QBYA 4GRIA 2KZGA 2KJCA 2W25A 4BE1A 2DOEA 1K4SA 5HS9A 3ABTA 2X85A 2VLAA 2L4MA 5D6FA 3ZMDA 4AVPA 5E3NA 3ZQ7A 4HF1A 4ESJA 3OOPA 3ZQCA 1WI3A 3BCAA 3AG4H 2ZJRF 3S2WA 1XD7A 3TO6A 3KP3A 4IOAF 2EWNA 2ETHA 3GFMA 3JRHA 4BDZA 1RIOH 2R0QC 4W97A 2KIUA 3U21A 4BH9A 2MYSA 4IQJA 5K5RA 1BJZA 3L2VA 1WHUA 2EJRA 3C1DA 4RGXA 4R79A 2RNJA 4MQVA 2I10A 3TOBA 2HXOA 2IA2A 4IVNA 4GO1A 3CJTB 3V4GA 3ZCOA 1HOMA 2XASA 1MW7A 1MBHA 4YIIA 2DA7A 3FXQA 4HBLA 5F1RA 3LNQA 4H0EA 1YW8A 5A2QZ 2H1LA 4B4CA 2ZNZA 3CC7I 2XPUA 4ENJA 2WBMA 3FDYA 1HSTA 1A36A 5GADJ 3HHHA 3LA2A 3V8JA 2QEXI 5K5QA 3A1YA 4RMNA 3JRFA 2CUFA 4MHGA 4AIKA 1E3HA 2ZMEA 3BY6A 1OCTC 3S3NA 2NRAC 3IAS2 1IZ1A 4BY7J 2DDBA 5HDKA 3AG1H 4UUTA 4XBFA 3B6AA 2M7BA 1Z7UA 4PJJA 1BW5A 3I5UA 1ZREA 2I8DA 2KRCA 5DUIA 3IL2A 2M45A 2P7CB 1FIPA 1S7EA 1Y6IA 2O5RA 3DFGA 3QOEA 4KT6A 2ESHA 4I98B 3EETA 4X1EA 4BQNA 2OZUA 2UZKA 4BE0A 5FKNA 1S29A 4L9TA 1VQ4I 4I0BA 3F3XA 1V5EA 5LGUA 3WG7H 3JRDA 1NG7A 2ECBA 3R0AA 2PMHA 1FBUA 1OQYA 4I0AA 1ZRCA 2JA6J 3I59B 3QYEA 1T0FC 4F52A 1XX5A 1W36D 4WCGA 5DS9A 1X3UA 2FF4A 2V1DA 3DTKA 2R7RA 5GAGJ 2KHMA 3BPXA 4A5MA 2JK3A 1XSXA 2EFPA 3PNTA 5DDGA 2FNPA 2IGOA 5HDNA 5A2QK 3PSIA 2ADUA 2K5CA 1OCRH 2GA1A 3RI4A 4DQ2A 3HOSA 2DTRA 4HYEA 3BG7A 4A3JJ 1U78A 1HW5A 2VBZA 2Y75A 2HDCA 5DM6F 3OL3A 2WY7Q 1IRXA 4J00A 2L2OA 3QYBA 3HIFA 1D8KA 2X0LA 4D1QA 1GUUA 3OR2C 1SFXA 3S1NJ 2FX0A 2OCCH 1QZYA 1GV5A 5H6QA 1Y8RB 2H27A 4LG3A 3DU5A 2DA4A 2L0KA 5KHDA 1B59A 2HTJA 1DQUA 3BPVA 2CSOA 3VB2A 1WZ2A 3DU6A 2YX7A 4YIFA 4C9YA 4BACA 3CCMI 1QPMA 3KP6A 4Z2YA 4CGZA 1SD4A 2H8WA 1SMTA 1TT0A 2XF7A 5EG0A 3S1QJ 2WV0A 4HX4A 3M7GA 3I71A 1RESA 2QKLB 1X1DA 2MLGA 1UHSA 3F8BA 4AIHA 5LD2C 1Y1WJ 5J8CA 3OIQA 3GTPJ 4C2MJ 3ZQIA 4NNJA
chains in the Genus database with same CATH topology
3FKIJ 5F0HA 3HGGA 1ETWA 5JLXA 5GP9A 1OCPA 1FTTA 2O8KA 3GTMJ 3LSGA 2TCTA 5FKLA 1ZQ3P 3BG9A 4JX4A 1K83J 2M2EA 4B3AA 3O8HA 2B63J 1ETVA 1APLC 4RDUA 1ZR4A 5M3MJ 3TW7A 2DA1A 4CYCB 3HDDA 1JKRC 2CU7A 2ID3A 3TP3A 3S16J 2NVQJ 1LFBA 1JUPA 3TW6A 1VI0A 4FE4A 4BBRJ 5M5WJ 1NK3P 4M3FA 1I3QJ 5IYCJ 4EEFG 4AUXA 3H0GJ 2EZIA 2M8GX 4V2GA 1B72B 2XB5A 1K61A 1WH5A 2CQQA 2XB0X 3S2DJ 2GBYA 4I76A 2HOSA 3HEFA 2WAQN 3FISA 1IGNA 2PMZN 4A3CJ 3I4MJ 2LLKA 1ZTRA 3S14J 4FCYA 1HDDC 1FTZA 2LD5A 1DU6A 5M5XJ 3JRBA 1MBFA 2EQRA 2EZKA 1LE8A 1MSEC 3RZOJ 2DJNA 3FIWA 3ZOBA 1RR7A 3G1LA 1IUFA 3TP0A 1YRNA 4JX5A 2COBA 3Q0WA 1FIAA 3HOZJ 2M0CA 5F0CA 5M5YJ 4V2FA 2ID6A 2K9QA 4J19A 3K7AJ 3L1PA 3ZQHA 3E7LA 3W6VA 2E2JJ 3CQZJ 3S2HJ 2E2IJ 4HNVA 1X2NA 2NOGA 2DMUA 3HOYJ 4QSHA 2XGCA 2ZB9A 3O8GA 3LSRA 1E3OC 1ETOA 2JWTA 2QCOA 3BR2A 1GDTA 1Y1VJ 3OSGA 3I4NJ 2IEKA 3OIOA 3GTQJ 2YS9A 4BBSJ 3SJMA 4Y7NJ 4A3GJ 5IOYA 3G1OA 3F0CA 4A69C 3HBLA 1JKQC 5BNGA 4D5FA 2XPWA 4IHYA 2M34A 1DU0A 4CYCA 1X2MA 1IDYA 1LE8B 3OSFA 4FE7A 1ITYA 1RKTA 4L5EA 5IPAA 5EGOA 5M3FJ 5J3LA 4A3BJ 1SFOJ 1QVTA 2R93J 5IYBJ 2FQ4A 1JKPC 4M3DA 4M3EA 3FK7A 4BY1J 3WHBA 4XRSG 1MNMC 1TWAJ 2HQ5A 5E3MA 1BL0A 3A01B 4X6AJ 4M3GA 1IG7A 1Z77A 4D7MA 2R5YB 4UUSB 2P81A 4B1RA 1TWCJ 2MW8A 3K2AA 4ABZA 2CUEA 3GTKJ 2R5YA 4JP0A 2JJ7A 4MLOA 2TRTA 3HOXJ 3JR9A 5EG0B 5K7HA 3SFIA 2IBDA 2LP0A 3A02A 3JREA 3LOCA 3PM1A 2LKXA 3ZQLA 3Q3SA 1H89C 3M4OJ 4JYKA 1ETYA 5F08A 2X9DA 1ZKGA 3B6CA 5FKOA 1JJ6C 1I6HJ 2HYJA 5IP7J 4M3BA 1ENHA 1ZR2A 2JA5J 1RKWA 3DCFA 3NARA 2VKVA 5IYDJ 4JX6A 4IHVA 4BXXJ 3S1MJ 3LSJA 1RPWA 3DEWA 4A3LJ 4MIMA 2QF7A 1HF0A 1JT6A 2EZLA 5FKMA 2XGEA 3JRAA 2DMTA 3H3VK 2ELKA 5HODA 1SANA 2NS8A 1VFCA 1MH4A 2LTPA 2JA8J 4D7NA 1W0TA 5EDNA 2DA3A 3HM5A 3IH4A 1JGGA 3HB9A 2Y9YA 4BKXA 2X48A 5C4JJ 2MGQA 4IEJA 2NVXJ 4XICA 4Y52J 1IDZA 2DN0A 4XK4A 1AHDP 3A03A 2K40A 1P7IA 5EYRA 3ZQFA 5IOZA 1AKHB 5FLVA 2HOTA 2VPRA 3IV5A 1JKOC 2M9HA 2YU9J 2DMNA 2ME0A 9ANTA 1TC3C 2MG4A 3CDLA 2WB1N 2FD5A 2NVYJ 2L9RA 1ZGWA 2ME6A 2DTZA 5F1JA 3Q0UA 5FLMJ 1O4XA 1T33A 4A3MJ 5EF6A 3GTGJ 2HI3A 1YRNB 2HDDA 1IV6A 2LK2A 1GV2A 1F36A 2DMQA 2LY9A 2D5VA 4DZJA 1JUMA 2Y30A 4IHWA 2CQXA 2W48A 2IAIA 1OFCX 2L7MP 2WV1A 4QIWN 3QQAA 2O9LA 1VNDA 2JMWA 1XG1A 1HCRA 1HDPA 4A3IJ 1UG2A 1AKHA 1MBGA 3HKZN 1MBJA 4A93J 2Y2ZA 3HOWJ 1CQTA 4LOCA 3BTCA 3VPRA 1W0UA 3M3YJ 2KT0A 2EZHA 5C4XJ 3JRGA 2HOAA 3IH3A 3CCYA 3G1MA 1VF9A 5C3EJ 1H8AC 2FJ1A 3C2BA 4NDLA 1GT0C 3MKLA 1JUSA 2CRGA 4A3KJ 2DMPA 1ETKA 1BA5A 3BR5A 2CJJA 1P7JA 3BT9A 2E2HJ 5EEAA 5EGOB 3BQYA 1B72A 4DW6A 4MFDA 1IJWC 1JJ8C 4XIDA 5EZGA 4W1UA 1LFUP 1T56A 2G0EA 5C44J 1JTXA 3CMYA 2XRLA 3BR1A 3GBGA 4MFEA 3D1NI 1ETXA 4RBOA 3GTOJ 3QPSA 4IHXA 2XPVA 3BG5A 1IRZA 3S17J 3OOUA 5DTDA 5GPAA 3BR3A 1U9NA 3PO2J 2X6OA 1QPIA 2L7FP 3S1RJ 1ETQA 2K9NA 1WPKA 2GM4A 4D5CA 5F04A 3JRIA 2OF7A 1PUFA 2JA7J 3JRCA 5EZHA 4DYCA 5IP6A 5E3NA 3ZQCA 2MSYA 1WI3A 1GVDA 2R92J 2K9SA 2NVTJ 1OJLA 1XS9A 4S0HB 3JRHA 2R0QC 4W97A 1BJZA 1MBKA 3BG3A 3MVPA 5JLWA 1X58A 3MN2A 2I10A 4UUSA 1G2HA 2XSDC 1A5JA 3BR0A 2HXOA 1XC5A 2AO9A 1HOMA 2VKEA 1MBHA 2Y31A 2DA7A 3LNQA 3Q0VA 2R5ZB 2E19A 2ECCA 4MO7A 4XRMA 4B4CA 4AC0A 2EH3A 2XPUA 2R5ZA 2R7ZJ 2EBIA 3LSPA 2OPTA 2Y0SN 4A3EJ 1I50J 3JRFA 2CUFA 3RKQA 4DZPA 1A6IA 1U8BA 4G12A 2NS7A 1TWGJ 1OCTC 3IH2A 4BY7J 2E1OA 2AHQA 5F0FA 3WHCA 4UUTA 3RQIA 3B6AA 1BW5A 3A01A 1ZK8A 2LVSA 1FIPA 1NTCA 1TWHJ 1S7EA 4X1EA 4M6VA 5J1RA 3HGYA 1NK2P 3SDGA 3GTJJ 5FKNA 1JTYA 1Z0XA 5J1UA 2YUSA 1MSFC 2DA2A 3UKGA 3JRDA 2ECBA 5E3OA 5FJ8J 1PUFB 2VUMJ 3FK6A 1IC8A 3BTJA 5E3LA 1D5YA 2JA6J 1H88C 1HLVA 4AYBN 3RZDJ 5DS9A 1FEXA 3NAUA 2VI6A 3ZQGA 2JK3A 1QRYA 2N8GA 2LR8A 3TEDA 4A3JJ 1U78A 1R9TJ 1JT0A 4C3JJ 4GFBA 2H8RA 3GTLJ 4FTHA 1B8IA 2GLOA 1MH3A 1GUUA 1WGXA 1TWFJ 1MBEA 3S1NJ 2FX0A 1ORKA 1GV5A 2DA6A 2DA5A 1BW6A 5GPCA 2H1KA 1FJLA 2DA4A 2L0KA 2RAEA 1UMQA 2XGDA 1Q1VA 4DYRA 5J1YA 1EF4A 1F43A 3BQZA 2O7OA 1RETA 3HOVJ 1POGA 1WCMJ 4DYQA 5FKKA 3BR6A 4QTRA 3BTIA 2L7ZA 4C3HJ 1U9OA 5K7FA 3PO3J 3BTLA 5EG0A 3S1QJ 3HOUJ 1B8IB 4FISA 1RESA 3QPLA 5F27A 4XRSA 1QVUA 1AU7A 3S15J 4A3DJ 1UHSA 4I6ZA 2KDZA 4A3FJ 2JN6A 2LFBA 1Y1WJ 5IP9J 5K7ZA 3GTPJ 2HXIA 4C2MJ 1WH7A 2Y9ZA 3ZQIA 4C3IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI J;  5F0H A;  3HGG A;  1ETW A;  5JLX A;  5GP9 A;  1OCP A;  1FTT A;  2O8K A;  3GTM J;  3LSG A;  2TCT A;  5FKL A;  1ZQ3 P;  3BG9 A;  4JX4 A;  1K83 J;  2M2E A;  4B3A A;  3O8H A;  2B63 J;  1ETV A;  1APL C;  4RDU A;  1ZR4 A;  5M3M J;  3TW7 A;  2DA1 A;  4CYC B;  3HDD A;  1JKR C;  2CU7 A;  2ID3 A;  3TP3 A;  3S16 J;  2NVQ J;  1LFB A;  1JUP A;  3TW6 A;  1VI0 A;  4FE4 A;  4BBR J;  5M5W J;  1NK3 P;  4M3F A;  1I3Q J;  5IYC J;  4EEF G;  4AUX A;  3H0G J;  2EZI A;  2M8G X;  4V2G A;  1B72 B;  2XB5 A;  1K61 A;  1WH5 A;  2CQQ A;  2XB0 X;  3S2D J;  2GBY A;  4I76 A;  2HOS A;  3HEF A;  2WAQ N;  3FIS A;  1IGN A;  2PMZ N;  4A3C J;  3I4M J;  2LLK A;  1ZTR A;  3S14 J;  4FCY A;  1HDD C;  1FTZ A;  2LD5 A;  1DU6 A;  5M5X J;  3JRB A;  1MBF A;  2EQR A;  2EZK A;  1LE8 A;  1MSE C;  3RZO J;  2DJN A;  3FIW A;  3ZOB A;  1RR7 A;  3G1L A;  1IUF A;  3TP0 A;  1YRN A;  4JX5 A;  2COB A;  3Q0W A;  1FIA A;  3HOZ J;  2M0C A;  5F0C A;  5M5Y J;  4V2F A;  2ID6 A;  2K9Q A;  4J19 A;  3K7A J;  3L1P A;  3ZQH A;  3E7L A;  3W6V A;  2E2J J;  3CQZ J;  3S2H J;  2E2I J;  4HNV A;  1X2N A;  2NOG A;  2DMU A;  3HOY J;  4QSH A;  2XGC A;  2ZB9 A;  3O8G A;  3LSR A;  1E3O C;  1ETO A;  2JWT A;  2QCO A;  3BR2 A;  1GDT A;  1Y1V J;  3OSG A;  3I4N J;  2IEK A;  3OIO A;  3GTQ J;  2YS9 A;  4BBS J;  3SJM A;  4Y7N J;  4A3G J;  5IOY A;  3G1O A;  3F0C A;  4A69 C;  3HBL A;  1JKQ C;  5BNG A;  4D5F A;  2XPW A;  4IHY A;  2M34 A;  1DU0 A;  4CYC A;  1X2M A;  1IDY A;  1LE8 B;  3OSF A;  4FE7 A;  1ITY A;  1RKT A;  4L5E A;  5IPA A;  5EGO A;  5M3F J;  5J3L A;  4A3B J;  1SFO J;  1QVT A;  2R93 J;  5IYB J;  2FQ4 A;  1JKP C;  4M3D A;  4M3E A;  3FK7 A;  4BY1 J;  3WHB A;  4XRS G;  1MNM C;  1TWA J;  2HQ5 A;  5E3M A;  1BL0 A;  3A01 B;  4X6A J;  4M3G A;  1IG7 A;  1Z77 A;  4D7M A;  2R5Y B;  4UUS B;  2P81 A;  4B1R A;  1TWC J;  2MW8 A;  3K2A A;  4ABZ A;  2CUE A;  3GTK J;  2R5Y A;  4JP0 A;  2JJ7 A;  4MLO A;  2TRT A;  3HOX J;  3JR9 A;  5EG0 B;  5K7H A;  3SFI A;  2IBD A;  2LP0 A;  3A02 A;  3JRE A;  3LOC A;  3PM1 A;  2LKX A;  3ZQL A;  3Q3S A;  1H89 C;  3M4O J;  4JYK A;  1ETY A;  5F08 A;  2X9D A;  1ZKG A;  3B6C A;  5FKO A;  1JJ6 C;  1I6H J;  2HYJ A;  5IP7 J;  4M3B A;  1ENH A;  1ZR2 A;  2JA5 J;  1RKW A;  3DCF A;  3NAR A;  2VKV A;  5IYD J;  4JX6 A;  4IHV A;  4BXX J;  3S1M J;  3LSJ A;  1RPW A;  3DEW A;  4A3L J;  4MIM A;  2QF7 A;  1HF0 A;  1JT6 A;  2EZL A;  5FKM A;  2XGE A;  3JRA A;  2DMT A;  3H3V K;  2ELK A;  5HOD A;  1SAN A;  2NS8 A;  1VFC A;  1MH4 A;  2LTP A;  2JA8 J;  4D7N A;  1W0T A;  5EDN A;  2DA3 A;  3HM5 A;  3IH4 A;  1JGG A;  3HB9 A;  2Y9Y A;  4BKX A;  2X48 A;  5C4J J;  2MGQ A;  4IEJ A;  2NVX J;  4XIC A;  4Y52 J;  1IDZ A;  2DN0 A;  4XK4 A;  1AHD P;  3A03 A;  2K40 A;  1P7I A;  5EYR A;  3ZQF A;  5IOZ A;  1AKH B;  5FLV A;  2HOT A;  2VPR A;  3IV5 A;  1JKO C;  2M9H A;  2YU9 J;  2DMN A;  2ME0 A;  9ANT A;  1TC3 C;  2MG4 A;  3CDL A;  2WB1 N;  2FD5 A;  2NVY J;  2L9R A;  1ZGW A;  2ME6 A;  2DTZ A;  5F1J A;  3Q0U A;  5FLM J;  1O4X A;  1T33 A;  4A3M J;  5EF6 A;  3GTG J;  2HI3 A;  1YRN B;  2HDD A;  1IV6 A;  2LK2 A;  1GV2 A;  1F36 A;  2DMQ A;  2LY9 A;  2D5V A;  4DZJ A;  1JUM A;  2Y30 A;  4IHW A;  2CQX A;  2W48 A;  2IAI A;  1OFC X;  2L7M P;  2WV1 A;  4QIW N;  3QQA A;  2O9L A;  1VND A;  2JMW A;  1XG1 A;  1HCR A;  1HDP A;  4A3I J;  1UG2 A;  1AKH A;  1MBG A;  3HKZ N;  1MBJ A;  4A93 J;  2Y2Z A;  3HOW J;  1CQT A;  4LOC A;  3BTC A;  3VPR A;  1W0U A;  3M3Y J;  2KT0 A;  2EZH A;  5C4X J;  3JRG A;  2HOA A;  3IH3 A;  3CCY A;  3G1M A;  1VF9 A;  5C3E J;  1H8A C;  2FJ1 A;  3C2B A;  4NDL A;  1GT0 C;  3MKL A;  1JUS A;  2CRG A;  4A3K J;  2DMP A;  1ETK A;  1BA5 A;  3BR5 A;  2CJJ A;  1P7J A;  3BT9 A;  2E2H J;  5EEA A;  5EGO B;  3BQY A;  1B72 A;  4DW6 A;  4MFD A;  1IJW C;  1JJ8 C;  4XID A;  5EZG A;  4W1U A;  1LFU P;  1T56 A;  2G0E A;  5C44 J;  1JTX A;  3CMY A;  2XRL A;  3BR1 A;  3GBG A;  4MFE A;  3D1N I;  1ETX A;  4RBO A;  3GTO J;  3QPS A;  4IHX A;  2XPV A;  3BG5 A;  1IRZ A;  3S17 J;  3OOU A;  5DTD A;  5GPA A;  3BR3 A;  1U9N A;  3PO2 J;  2X6O A;  1QPI A;  2L7F P;  3S1R J;  1ETQ A;  2K9N A;  1WPK A;  2GM4 A;  4D5C A;  5F04 A;  3JRI A;  2OF7 A;  1PUF A;  2JA7 J;  3JRC A;  5EZH A;  4DYC A;  5IP6 A;  5E3N A;  3ZQC A;  2MSY A;  1WI3 A;  1GVD A;  2R92 J;  2K9S A;  2NVT J;  1OJL A;  1XS9 A;  4S0H B;  3JRH A;  2R0Q C;  4W97 A;  1BJZ A;  1MBK A;  3BG3 A;  3MVP A;  5JLW A;  1X58 A;  3MN2 A;  2I10 A;  4UUS A;  1G2H A;  2XSD C;  1A5J A;  3BR0 A;  2HXO A;  1XC5 A;  2AO9 A;  1HOM A;  2VKE A;  1MBH A;  2Y31 A;  2DA7 A;  3LNQ A;  3Q0V A;  2R5Z B;  2E19 A;  2ECC A;  4MO7 A;  4XRM A;  4B4C A;  4AC0 A;  2EH3 A;  2XPU A;  2R5Z A;  2R7Z J;  2EBI A;  3LSP A;  2OPT A;  2Y0S N;  4A3E J;  1I50 J;  3JRF A;  2CUF A;  3RKQ A;  4DZP A;  1A6I A;  1U8B A;  4G12 A;  2NS7 A;  1TWG J;  1OCT C;  3IH2 A;  4BY7 J;  2E1O A;  2AHQ A;  5F0F A;  3WHC A;  4UUT A;  3RQI A;  3B6A A;  1BW5 A;  3A01 A;  1ZK8 A;  2LVS A;  1FIP A;  1NTC A;  1TWH J;  1S7E A;  4X1E A;  4M6V A;  5J1R A;  3HGY A;  1NK2 P;  3SDG A;  3GTJ J;  5FKN A;  1JTY A;  1Z0X A;  5J1U A;  2YUS A;  1MSF C;  2DA2 A;  3UKG A;  3JRD A;  2ECB A;  5E3O A;  5FJ8 J;  1PUF B;  2VUM J;  3FK6 A;  1IC8 A;  3BTJ A;  5E3L A;  1D5Y A;  2JA6 J;  1H88 C;  1HLV A;  4AYB N;  3RZD J;  5DS9 A;  1FEX A;  3NAU A;  2VI6 A;  3ZQG A;  2JK3 A;  1QRY A;  2N8G A;  2LR8 A;  3TED A;  4A3J J;  1U78 A;  1R9T J;  1JT0 A;  4C3J J;  4GFB A;  2H8R A;  3GTL J;  4FTH A;  1B8I A;  2GLO A;  1MH3 A;  1GUU A;  1WGX A;  1TWF J;  1MBE A;  3S1N J;  2FX0 A;  1ORK A;  1GV5 A;  2DA6 A;  2DA5 A;  1BW6 A;  5GPC A;  2H1K A;  1FJL A;  2DA4 A;  2L0K A;  2RAE A;  1UMQ A;  2XGD A;  1Q1V A;  4DYR A;  5J1Y A;  1EF4 A;  1F43 A;  3BQZ A;  2O7O A;  1RET A;  3HOV J;  1POG A;  1WCM J;  4DYQ A;  5FKK A;  3BR6 A;  4QTR A;  3BTI A;  2L7Z A;  4C3H J;  1U9O A;  5K7F A;  3PO3 J;  3BTL A;  5EG0 A;  3S1Q J;  3HOU J;  1B8I B;  4FIS A;  1RES A;  3QPL A;  5F27 A;  4XRS A;  1QVU A;  1AU7 A;  3S15 J;  4A3D J;  1UHS A;  4I6Z A;  2KDZ A;  4A3F J;  2JN6 A;  2LFB A;  1Y1W J;  5IP9 J;  5K7Z A;  3GTP J;  2HXI A;  4C2M J;  1WH7 A;  2Y9Z A;  3ZQI A;  4C3I J; 
#chains in the Genus database with same CATH topology
 3FKI J;  4BYY A;  2XAH A;  2OA4 A;  4LG0 A;  1BIB A;  5ICC A;  3AKZ A;  3ERE D;  3VYR B;  3L7W A;  5HLI A;  2OD5 A;  3IRR A;  3CCS I;  1FTT A;  3C18 A;  3C3W A;  2HZD A;  4DBQ A;  3LSG A;  2R7U A;  3I3L A;  3H3U A;  2CW7 A;  2EFO A;  2ZXI A;  2FNA A;  4AIJ A;  1RRJ A;  2FBI A;  4B8X A;  3J7Z I;  3TW7 A;  4V19 K;  3KX2 A;  1BR2 A;  1JKR C;  2CU7 A;  2DOA A;  4OIN F;  3TW6 A;  1VI0 A;  4M3F A;  5IYC J;  2C6Y A;  2KFD A;  3IKV A;  3I58 A;  1TTY A;  1Z91 A;  2EZI A;  4V2G A;  1P4W A;  5JR3 A;  2E5Z A;  2X51 A;  2XRO A;  1WJC A;  1YIJ I;  3HEF A;  4IL6 C;  3FIS A;  3CC2 I;  3LAJ A;  4A3C J;  2LLK A;  1ONV A;  5BS6 A;  3GCM A;  3LWF A;  3S14 J;  1REP C;  4JK1 X;  1XCB A;  3RZO J;  3V42 A;  2HNH A;  3FIW A;  4Z6Y A;  3G73 A;  1UJ8 A;  3FBN B;  3TP0 A;  3LST A;  1KGS A;  1KU3 A;  2M0C A;  3GVA A;  3K4C A;  3CF2 A;  3QRF F;  4V2F A;  2LYC A;  5LLQ A;  2F6C A;  4WX9 A;  3K7A J;  5CQE A;  5D5X B;  3S2H J;  1MGT A;  2E2I J;  4RB1 A;  4CHU A;  2VN2 A;  4CCO A;  4CCJ A;  3DV8 A;  4QSH A;  5L3F A;  3PJR A;  3LSR A;  3HOY J;  2G7U A;  1QBJ A;  5KAI C;  3GTQ J;  4BBS J;  3SJM A;  1QHG A;  3FHN A;  1LJ9 A;  5IT3 A;  1T2K A;  1S6L A;  1EH6 A;  1X1C A;  1IW7 F;  4RB3 C;  4KIB A;  1LE8 B;  1KQ8 A;  3KP7 A;  4BE2 A;  2A61 A;  3E6M A;  1RKT A;  2EFN A;  4CCL A;  1AOY A;  2LG4 A;  2IVM A;  4L9J A;  1SFO J;  3AL0 C;  4CYD A;  1QVT A;  5IYB J;  4CZZ A;  2V7F A;  2CV0 A;  3D5R C;  1HBX G;  1T38 A;  2HTS A;  1I27 A;  2X1D A;  3NRV A;  3FK7 A;  4BY1 J;  3SZP A;  3WTS C;  4RAY A;  5E20 A;  1A35 A;  1U3E M;  1MNM C;  4G7Z F;  1Y56 A;  3CUQ B;  5E3M A;  1FOW A;  1R4N B;  3KET A;  3A01 B;  1O3S A;  4Q4Z F;  1HKS A;  1BR4 A;  1IG7 A;  1DDN A;  4QPO A;  4LLG F;  2IRF G;  2P81 A;  4QLC U;  1TWC J;  2MW8 A;  2CUZ A;  4ON0 A;  2CUE A;  4G94 A;  1XGO A;  2B7E A;  3LQR A;  4E7I A;  2TRT A;  2WAF A;  2QEN A;  3CZ6 A;  2Q8K A;  1H9T A;  1P92 A;  4ENM A;  2VOP A;  3JRE A;  2DOF A;  2FRH A;  1WKM A;  2P7V B;  2XV4 S;  3DBH B;  2CO5 A;  3HG9 A;  2IP2 A;  1U2W A;  4HA8 A;  3JTH A;  2DAO A;  1ETY A;  4JYK A;  4R1H A;  5F08 A;  3ZMU A;  2IS6 A;  3I64 A;  1ZAO A;  3B6C A;  3KP4 A;  4IXA A;  2L54 A;  2M3A A;  1JJ6 C;  4M3B A;  1YX5 A;  1VQK I;  2QKM B;  5IYD J;  2A6E F;  1MIJ A;  2K3F A;  3GME A;  2VPL A;  3LSJ A;  1RPW A;  3N97 A;  1RUN A;  1S5L C;  2VQC A;  3RPU D;  3PUB A;  3WTV C;  1JT6 A;  5AIQ A;  2XGE A;  2VE8 A;  1R1T A;  1X19 A;  3ISP A;  1J75 A;  2CFO A;  3BRO A;  3H3V K;  3JTG A;  3F72 A;  2NS8 A;  2JZY A;  3G3Z A;  4OIP F;  1IAW A;  4A0Y A;  1ZRF A;  2ZFW A;  4GYG A;  1MH4 A;  3PFI A;  3F8C A;  3CME I;  1YI2 I;  4E7L A;  3HM5 A;  2XAU A;  2QQA A;  4BQO A;  1SEU A;  5TIS C;  3MEX A;  3NWS A;  4K2E A;  1JGG A;  2JTV A;  3VYU B;  4UNO A;  2UUZ A;  2Y9Y A;  1YO5 C;  3D5L A;  5C4J J;  1XTA A;  1D5V A;  2YX4 A;  2NVX J;  4C2T A;  3KYL A;  4XIC A;  3E5X A;  1AHD P;  1S7A A;  2VBY A;  1QQI A;  5J4V A;  2VJ5 A;  2K40 A;  1P7I A;  3FM5 A;  4MNU A;  5IOZ A;  1SVM A;  5FLV A;  4NHJ A;  1WJA A;  2XUB A;  4ZTF A;  3IV5 A;  4YG2 F;  1BOA A;  4EV0 A;  1Z3X A;  4AU7 A;  3S3O A;  2DPD A;  4ZDP A;  2WB1 N;  2NVY J;  1K78 B;  4WXD A;  2LNB A;  2VL8 A;  3OYD A;  1TQI A;  1X4O A;  3IAM 2;  4XKC A;  4RB2 C;  3CJN A;  3UR3 C;  1BI1 A;  2BXZ A;  4F3Q A;  3OV8 A;  1MJB A;  3GTG J;  2HI3 A;  2EK5 A;  4YFK F;  1IN8 A;  3KLO A;  2BVL A;  3MMY B;  4GGG A;  3KE2 A;  4LB6 B;  3K4N A;  2DMQ A;  2ESN A;  3QU3 A;  1JUM A;  1LDJ A;  2L4A A;  4BS9 A;  3ZQQ A;  3DPU A;  4IKF A;  3ZMV A;  3AG2 H;  1DP7 P;  2IAI A;  4RM3 A;  1C0W A;  3VWB A;  3QQA A;  1DPU A;  3W6J B;  2RV8 A;  2JMW A;  2DYS H;  1HDP A;  1LPQ A;  3HOW J;  2WAD A;  2P6T A;  5L3G A;  4LB5 A;  2W00 A;  1LEA A;  1TW2 A;  3VPR A;  1Z6T A;  3PIP F;  3P9I A;  2ZJQ F;  1OCC H;  1TW3 A;  2KT0 A;  4N4N B;  3SYT A;  2ICW G;  2V9K A;  4ZJZ A;  2Y48 A;  3K4B A;  3CCY A;  1H8A C;  2KDO A;  2NOJ B;  4UVA A;  1JUS A;  2CRG A;  2RQP A;  4HSR A;  2DMP A;  3F22 A;  1FWZ A;  1BI3 A;  1FOX A;  1ETK A;  2OJE D;  2QYO A;  1B72 A;  3CD6 I;  1JJ8 C;  2V6C A;  4HLX A;  1G3T A;  4CZC A;  1TNS A;  1KU7 A;  1K79 A;  2BGC A;  3T5X A;  2E60 A;  1FZP B;  3FMQ A;  4MFE A;  3D1N I;  2VXZ A;  4KMF A;  1O7L A;  4PGG A;  3D0S A;  2EV6 A;  5GPA A;  3BR3 A;  1JE8 A;  3I59 A;  1ETQ A;  1D1C A;  3CES A;  1IF1 A;  2O03 A;  3LA7 A;  3QPH A;  4G6Q A;  2VQH A;  2JSP A;  2X6X A;  2AQE A;  4OAY A;  5EZH A;  2KLO A;  4E7H A;  1DGR M;  2DPU A;  2HFH A;  1KZH A;  2RNG A;  2IGN A;  1DPR A;  2JRM A;  2MSY A;  3JSP A;  1T8I A;  1VQ9 I;  2HU9 A;  1IXS B;  2Z1D A;  2K9S A;  4ZYE A;  1SC7 A;  1OJL A;  5DD8 A;  4A6D A;  1Q1H A;  2L7K A;  4CCK A;  1N77 A;  1OPC A;  4HX7 A;  1YQA A;  4XR6 A;  1FYL A;  1PYV A;  5JHU A;  2MH9 A;  3MN2 A;  1G2H A;  1HC8 A;  2EV0 A;  1MMN A;  2RQQ A;  3MFK A;  1XC5 A;  1R1V A;  4OIO F;  3WTX C;  2VKE A;  3L2C A;  1YS7 A;  4I7H A;  5B1A H;  3BDD A;  4LLL A;  3Q0V A;  3T0Y A;  2E19 A;  4PGH A;  4MO7 A;  4XRM A;  2VIX A;  3F8F A;  3FMR A;  4I02 A;  3A2K A;  3DBR B;  2E34 A;  2Y0S N;  5LHI A;  4NC7 A;  4ZYH A;  2HVS A;  3W6K B;  3BJO A;  1I50 J;  2HKX A;  3F8M A;  1IN5 A;  2IA0 A;  1U8B A;  1LEB A;  1GLN A;  4U7D A;  3H1C A;  2XAQ A;  5F0F A;  5E79 C;  2MLK A;  4P1W A;  1E0E A;  3BJ6 A;  1O57 A;  4PJN A;  3J7A Y;  1PVE A;  1ZK8 A;  3J80 K;  3DWL E;  5L3B A;  1T98 A;  3GTJ J;  1VQO I;  1UZC A;  4YFN F;  1JTY A;  1Z0X A;  3CJQ B;  2LBF B;  4IZZ A;  1USS A;  1PUF B;  1IC8 A;  2DJI A;  3ERM A;  1D5Y A;  2RGV A;  4OAZ A;  4BHC A;  4M73 A;  1H88 C;  4IHT A;  1WFX A;  3RZD J;  2JVH A;  3NAU A;  1XGN A;  4UVC A;  2CS3 A;  4B48 A;  3IUO A;  3ZQG A;  2HWV A;  3EUA A;  3DEU A;  5GTI C;  4KNY A;  4Y15 A;  2N8G A;  4BXU A;  2LR8 A;  4KN7 X;  1W5S A;  2F4M B;  2KQR A;  4C3J J;  3HHG A;  1VQN I;  1FYK A;  4FTH A;  2GLO A;  2YU3 A;  2MD0 A;  1HQC A;  2FOW A;  2ZSI B;  1SAX A;  3L9F A;  2QWW A;  2XAJ A;  4KT5 C;  3I0T A;  3A0B C;  4RM2 A;  4BJ6 C;  1BN5 A;  1ZLJ A;  2DA5 A;  1I39 A;  5GPC A;  2BY1 A;  4RGS A;  5D4S A;  3N4M A;  2XF6 A;  2P4W A;  3OR1 C;  2IS4 A;  5J1Y A;  1EF4 A;  3ASN H;  3C7J A;  2MC3 A;  1GXP A;  3WG9 A;  3PFY A;  4XM3 A;  1IN7 A;  5L3E A;  1YW7 A;  1OKR A;  1IXC A;  1AWC A;  1WCM J;  1IV8 A;  1X3W B;  1V4R A;  2K02 A;  4DYQ A;  2ZNY A;  3BR6 A;  4QTR A;  1NHA A;  4G8X A;  1B9N A;  3PO3 J;  3BTL A;  1V55 H;  2Q1Z B;  1UCR A;  3K9T A;  4ZZL A;  1QVU A;  2DYR H;  2AQF A;  4XRS A;  3G4S I;  4A3D J;  1DUX C;  4I6Z A;  4A3F J;  4DNC A;  3L2Q A;  1NG6 A;  2HXI A;  1WH7 A;  1M1E B;  4EGZ A;  5J40 A;  1QA6 A;  3HTU A;  4KFC A;  1ETW A;  4EQQ A;  2R7X A;  4HF2 A;  1GVJ A;  2G7H A;  4QWQ A;  2DK8 A;  3BZ6 A;  3GTM J;  5DCF A;  3F8N A;  2JSC A;  2TCT A;  3LSM A;  4YEL A;  5D6E A;  3I56 I;  1ZQ3 P;  1Z05 A;  3O2P E;  2J5O A;  3O8H A;  2B63 J;  3VOE A;  3RKX A;  4HX8 A;  2NYX A;  3ZN1 A;  1MND A;  5BPD A;  3ULQ B;  1FLI A;  2DA1 A;  1PJR A;  3U1K A;  2BW3 A;  2CW0 F;  2NVQ J;  1LFB A;  4BBR J;  2ZME B;  1PDN C;  2WAE A;  3HXL A;  3H0G J;  4AUX A;  2BBY A;  4S04 A;  2GIZ A;  4BEH A;  3CP2 A;  2JPB A;  4F93 B;  3S3M A;  2XB5 A;  1WH5 A;  2R3S A;  2Z33 A;  2XB0 X;  2R7T A;  5D8K B;  2IJL A;  2OAZ A;  3SDB A;  3AL0 B;  4MTE A;  5LRS A;  2E1M C;  2XGX A;  2XKO A;  3GUD A;  1IGN A;  4EJT A;  4I09 A;  2PMZ N;  2FSW A;  2E35 A;  5CVR A;  2MAB A;  1ZTR A;  3E6B A;  4NC6 A;  4FCY A;  1HDD C;  2LD5 A;  1BC8 C;  5M5X J;  1LE8 A;  4BHP A;  4AWX B;  1P9Q C;  5IT9 K;  4E7J A;  5CJ9 A;  4LIU A;  4I99 C;  4WK8 F;  3G1L A;  1WJD A;  1IUF A;  2XF5 A;  4EAT A;  2HEO A;  3MZH A;  5KVR A;  2KRH A;  1JI8 A;  4XSZ F;  5CVI A;  2COB A;  2F5F A;  3HTS B;  3HOZ J;  5F0C A;  5HS7 A;  3VSK A;  4A6E A;  2GXB A;  3W2W A;  5E1X A;  4P96 A;  3MQ0 A;  4HG2 A;  4U0W A;  4MQ9 F;  3L1P A;  1ZH5 A;  3W6V A;  4M74 A;  3F6O A;  1WJF A;  1YLF A;  2FU4 A;  2NOG A;  4FAS D;  4HNV A;  4KIS A;  2XGC A;  2ZB9 A;  4RB0 A;  5CVJ A;  3FXM A;  1ETO A;  5E1W A;  2R7S A;  3CCL I;  3BJA A;  2Z9O A;  3R6S A;  2CQK A;  2EPF A;  4R8H A;  2J5P A;  3RPU A;  4O3M A;  3ABU A;  2KKO A;  2QGU A;  2ZJP F;  1CF7 B;  5DV5 A;  2HVR A;  1T6S A;  4A69 C;  4UVB A;  1JKQ C;  5BNG A;  4D5F A;  3LQQ A;  2STT A;  3U1D A;  1W4M A;  1B1B A;  1WJB A;  4WXH A;  1R22 A;  2ZO4 A;  5F6F A;  4FQG A;  1XGM A;  1YS6 A;  1RZ4 A;  5ED4 A;  2UXN A;  4KYW A;  3ZR8 X;  3OYH A;  1W36 C;  3OSF A;  4FE7 A;  5IPA A;  5FD5 A;  5EGO A;  5J3L A;  5L3D A;  4XQF A;  5LFA A;  4N9H A;  2DFF A;  4OWR B;  3G6E I;  2FQ4 A;  1OYY A;  2ZJ2 A;  5IY5 H;  2F5E A;  4ZTJ A;  3J80 Z;  5J4Y A;  2OU2 A;  1TWA J;  2HQ5 A;  2WC2 A;  1XGS A;  1BL0 A;  4KIT B;  1JHF A;  2CWE A;  5TRD A;  2F5D A;  1PP7 U;  1RC9 A;  2GOM A;  2R7Q A;  3KZI C;  4UUS B;  3OYN A;  3ROU A;  2E5N A;  1LNW A;  1PUE E;  2PMU A;  1I1S A;  2CH0 A;  1FBQ A;  1OR7 C;  2VKD A;  2JJ7 A;  4MLO A;  2V1N A;  3HOX J;  3HPH A;  4C2U A;  5ILU A;  3LMM A;  2LP0 A;  2M0M A;  2OUM A;  4M9S A;  3M1C A;  4E6K G;  1ON1 A;  1S9H A;  2LKX A;  1H89 C;  2R4G A;  3M4O J;  4KN4 X;  5E18 F;  1I3A A;  4RAF A;  4IRG A;  5GAH J;  1T0F A;  4BAY A;  1FSH A;  1SD7 A;  3OIP A;  2HYJ A;  2JA5 J;  1RKW A;  1YYV A;  2VKV A;  3GZ6 A;  3SEZ A;  4BXX J;  2P8T A;  3PQK A;  2W24 A;  2QLZ A;  2VBW A;  4MIM A;  2XAF A;  3V7R A;  1HF0 A;  3FM3 A;  1CF7 A;  2EZL A;  5FKM A;  4CDG A;  2CW8 A;  1LDD A;  1EA3 A;  3H3Z A;  5D8L B;  2W57 A;  2XC7 A;  1W1W E;  1EJ9 A;  4RS8 A;  1R6R A;  5HOD A;  4KA4 A;  4PUS A;  1YOV B;  1LDK B;  1VFC A;  4GYI A;  2ZFU A;  4D7N A;  3ZMS A;  2A5W A;  4PCQ A;  1BBY A;  3ESW B;  2VON A;  3CCQ I;  3EUH A;  4RAG A;  2X48 A;  5FB2 A;  3Q9S A;  1SMY F;  2M1B A;  1YX3 A;  1OIS A;  2H6C A;  2XIG A;  4E7S A;  5B5E C;  2D2W A;  2DN0 A;  2UV1 A;  3ZPL A;  4EJW A;  3ABL H;  4PK4 A;  5EYR A;  5FRN A;  4BJT A;  1SD6 A;  2HOT A;  1HXD A;  1W7P D;  4LIV A;  3BZC A;  2M9H A;  2A69 F;  2YU9 J;  9ANT A;  2XAG A;  1OYI A;  2EFQ A;  4UXN A;  1N75 A;  2E71 A;  2DTZ A;  2W84 A;  2QBY B;  4EJU A;  4G7H F;  3EYI A;  5AON A;  3GFI A;  3E5U A;  1Y39 A;  2E7X A;  5ICG A;  5HDG A;  3DQV C;  3H9G A;  4XLF A;  1SFU A;  1BR1 A;  2HDD A;  4U0Y A;  3H92 A;  4JQF A;  2VE9 A;  2FA5 A;  4KIF A;  3H5N A;  1K4T A;  1E2X A;  1GV2 A;  1N25 A;  2DT6 A;  3IC7 A;  3J81 Z;  4XN3 A;  4EM0 B;  2CFX A;  4XKV A;  2DW4 A;  2FBH A;  4QIW N;  2B9S A;  3CC4 I;  2MBF A;  3I54 A;  4E7K A;  2DLL A;  1HCR A;  4A3I J;  3F23 A;  4YRV A;  1AKH A;  2HYG D;  4HOB A;  4PZJ A;  1CQT A;  4LOC A;  4U0V A;  3RQ4 A;  5B3S H;  1EV7 A;  3CP8 A;  4BL0 B;  2KRF A;  5FLX Z;  3ECH A;  2KPM A;  5B66 C;  1V5F A;  2AXT C;  2LRD A;  3G1M A;  5C3E J;  2FJ1 A;  3DKY A;  2F4O B;  2Z16 A;  3WTU C;  2KIM A;  2P5L C;  2CYY A;  4HQE A;  1CGP A;  3BR5 A;  3K4J A;  3BT9 A;  5EGO B;  1XMA A;  4U87 A;  4DW6 A;  1XDS A;  1IJW C;  1W7P B;  2XVC A;  1IN4 A;  2E1N A;  5EZG A;  2GAU A;  2BYV E;  1T56 A;  1MDM B;  3QYF A;  3K70 C;  5HNH A;  3ZRG A;  1EKE A;  3L00 A;  3TGN A;  3GTO J;  4RBO A;  2PFB A;  4XLH A;  3GW2 A;  1IN6 A;  1IRZ A;  3S17 J;  4BHB A;  3I53 A;  1ZHF A;  3GF2 A;  3J81 K;  3FXU A;  1ON2 A;  2HQN A;  2K9N A;  3HPG A;  3JAM Z;  5F04 A;  1PUF A;  2BE5 F;  1SD5 A;  2EB7 A;  2JA7 J;  4DGW B;  3JRC A;  5HLT A;  1B6A A;  4DYC A;  2IGM A;  2B0L A;  5IP6 A;  1S7O A;  1K6O A;  3ZMZ A;  3V7S A;  3KEQ A;  2R92 J;  3J7A O;  2H09 A;  3KP5 A;  2NVT J;  3RYR A;  2M4G A;  4U88 A;  1DP3 A;  4XKW A;  5D4R A;  3E1S A;  2RVC A;  3JW4 A;  3I55 I;  4DJA A;  3OYL A;  3A0H C;  1J59 A;  3MVP A;  3BWG A;  3ZXS A;  3OY9 A;  2PJP A;  1A5J A;  2AO9 A;  5AIP A;  4YIR X;  2CGP A;  3TOA A;  3B02 A;  4L18 B;  4Q5S F;  2ELH A;  1J5Y A;  1VQ6 I;  2Y31 A;  2GZW A;  2LBF A;  1B9M A;  2R5Z B;  2ECC A;  3CCE I;  3HRU A;  4H4K C;  4AC0 A;  1JGS A;  1KYZ A;  2EH3 A;  4XN0 A;  3LSP A;  6PAX A;  2O8X A;  2GIV A;  2V6E A;  4X0G A;  3EUH C;  2MH2 A;  4MTD A;  4N9I A;  3RKQ A;  4DZP A;  2LKS A;  1L0O C;  1SVL A;  2EA2 A;  2NS7 A;  4G12 A;  4NUB A;  5HNF A;  1TWG J;  4EJV A;  1D3Y A;  2OCE A;  3IH2 A;  5HS8 A;  1NH3 A;  2E1O A;  4IRI A;  1OMI A;  5D5U B;  1FX7 A;  3WHC A;  2PBI A;  1KQ9 A;  3FBI B;  3QWL A;  4B47 A;  1HW1 A;  3A01 A;  2LVS A;  3N05 A;  2GA2 A;  3QOD A;  2OV7 A;  4M6V A;  4NC8 A;  5B1B H;  1J7K A;  2QQ8 A;  5DM7 F;  2Y0M A;  2IW5 A;  3RPQ A;  3SDG A;  5HOO A;  1T95 A;  4RLF A;  1ZLK A;  2WAQ A;  4Y3O A;  4B44 A;  2DQL A;  5J1U A;  4B3X A;  2DA2 A;  5TGT A;  2QSH X;  3FXK A;  3BTJ A;  5E3L A;  3BOQ A;  5JI6 A;  2E1M B;  1EH7 A;  1FOK A;  4OU0 A;  4AYB N;  5L3C A;  1VQL I;  1S72 I;  3ECO A;  4WXC A;  5BPI A;  1R5H A;  4LJZ F;  3RKW A;  2FBK A;  2MFZ A;  1G3Y A;  5ILV A;  1R23 A;  1TNT A;  4XKB A;  1QRY A;  1ZGA A;  2LF7 A;  3RTR A;  1U5T B;  3TED A;  3SXY A;  2GXG A;  2H94 A;  1J0R A;  2KIQ A;  2JA2 A;  2RN7 A;  2EIK H;  4L5J A;  2KL4 A;  2D45 A;  1B8I A;  2YR2 A;  1MH3 A;  3K4L A;  4PFP A;  3JSO A;  1S3J A;  2R7D A;  1MBE A;  4L0Y B;  1FP2 A;  2K86 A;  3DPT A;  2DA6 A;  5H6R A;  4DOZ A;  2UWM A;  3SZT A;  3BCB A;  2PX9 A;  3W2A A;  1BW6 A;  2H1K A;  2RAE A;  3F9K A;  3CJR B;  1UMQ A;  1KA8 A;  4C30 A;  2XGD A;  3NWT A;  1Q1V A;  1FBS A;  3OL4 A;  4PDK A;  3DEE A;  3BQZ A;  2O7O A;  2HZT A;  1R36 A;  2DO7 A;  3FWE A;  1RET A;  5JVG F;  2L02 A;  1QU3 A;  1POG A;  2PLY A;  4EGY A;  1R00 A;  1N78 A;  3EUK L;  5FKK A;  3DF8 A;  1P4X A;  2L7Z A;  4C3H J;  4PJM A;  1U9O A;  2K4B A;  4M9X A;  5K7F A;  5LGT A;  2HQA A;  3LFK A;  3CO6 C;  2EIJ H;  2QVO A;  3QPL A;  1Z1D A;  3H9Q A;  3O3K A;  2M8E A;  1AU7 A;  3S15 J;  2KDZ A;  4UUV A;  5IP9 J;  2HR3 A;  5K7Z A;  4XOT A;  2Y9Z A;  4BU2 A;  4HPQ A;  4HDV A;  2O0Y A;  5F0H A;  4XL9 A;  1AA7 A;  4G6T B;  3EYY A;  2PEX A;  3K1M A;  2K27 A;  5LEK A;  3BG9 A;  2M2E A;  1WI9 A;  2K7L A;  3GFL A;  4RDU A;  1G3W A;  1ZR4 A;  1IO2 A;  1H9G A;  5M3M J;  3KZY A;  4CYC B;  2JUC A;  3S16 J;  3TP3 A;  2FMY A;  2HKO A;  4F91 B;  1JUP A;  4NQW B;  4OOI A;  1VQP I;  4XLA A;  3CF5 F;  1FSE A;  1NK3 P;  1I3Q J;  1TZL A;  4EEF G;  3C2G A;  3OYK A;  4XON A;  3K69 A;  1VQM I;  2LY1 A;  2ZXW H;  3OYA A;  4G7O F;  4ZYG A;  2V26 A;  5BOX A;  1K61 A;  3K1N A;  5FRM A;  3C2H A;  4JBA A;  4XOR A;  3Q5F A;  5FLX K;  3K6G A;  4I76 A;  4O5V A;  2HOS A;  2HS5 A;  1XMX A;  3IRQ A;  4XNF A;  4A12 A;  4ZDO A;  4L5I A;  3I4M J;  4HW0 A;  4HNU A;  3BLY A;  2HPM A;  2ISZ A;  3GYH X;  1DU6 A;  3M8E A;  2ZBK A;  2EQR A;  3HSR A;  2EZK A;  1D0X A;  4ESF A;  2DJN A;  4ANJ A;  2K85 A;  3BC8 A;  2ZKZ A;  4CCM A;  1FC3 A;  2CG4 A;  1LB2 A;  5ICF A;  3O6B B;  2L9N A;  2P5K A;  3PQJ A;  4FHT A;  3B73 A;  3KLN A;  4XMY A;  1FIA A;  5E8G A;  3TKY A;  1YFH A;  2VT3 A;  2ID6 A;  3EDP A;  4N4O B;  3PIO F;  5K5O A;  1RI7 A;  1YTY A;  1J9I A;  3K1P A;  1MJA A;  1XN7 A;  3E7L A;  1ZGJ A;  1FNN A;  1X2N A;  3CCJ I;  3H5R A;  3O8G A;  4ZZD A;  2ZCW A;  3MKY B;  3KP2 A;  3T8R A;  5FO5 A;  3BR2 A;  3U2R A;  2LOO A;  3E3V A;  3R61 A;  1H0M A;  1Y1V J;  3W2V A;  3OSG A;  3I4N J;  4MGR A;  1BC7 C;  1G4D A;  1SAU A;  1BI2 A;  1W5C C;  3PNY A;  2VJ4 A;  4CH7 A;  3S8P A;  1LVA A;  2EIM H;  1TBX A;  3FXR A;  3G1O A;  1GHC A;  1G6N A;  4RA2 A;  3FXL A;  3OYM A;  2HOE A;  2VOD A;  2WA0 A;  2JRT A;  4NBQ A;  1UST A;  3WTY C;  2XPW A;  2M34 A;  1DU0 A;  3HL2 A;  1X2M A;  5EEH A;  5GTH C;  2HVQ A;  3J7Y J;  3P9K A;  4LFU A;  3OYI A;  2IPQ X;  3BG6 A;  4BXF A;  2R93 J;  3DTE A;  1JKP C;  3IWF A;  1WQ2 A;  1UHM A;  4M3E A;  3CLQ A;  2HDW A;  4XRS G;  2K3P A;  4LLN A;  4LD5 A;  3G71 I;  1X3Z B;  3MAJ A;  4XRF A;  5K1Y A;  2PJR B;  2DCE A;  1Z77 A;  2EIN H;  2A68 F;  2R5Y B;  4PJL A;  4KMU X;  3DLA A;  2Z3Y A;  1YW9 A;  3GEZ A;  1D0Y A;  1S8N A;  3K2A A;  4HF0 A;  4YEJ A;  4ABZ A;  2R7V A;  2R5Y A;  4JP0 A;  1XCV A;  1RNL A;  3AG3 H;  2A3S A;  2V9V A;  3E6C C;  4Q48 A;  1IUY A;  4XLE A;  5DD4 A;  1XMK A;  3DKX A;  5K7H A;  3SFI A;  3GXO A;  4BGD A;  3A02 A;  3RIR A;  2OQR A;  4XOP A;  2XKP A;  2W1O A;  3LOC A;  3PM1 A;  1D1B A;  2PMZ A;  3IHU A;  1HKQ A;  3UNG C;  1ZKG A;  2F5C A;  3BZK A;  1KU2 A;  3JCU C;  1XSD A;  2JQ7 A;  2X6W A;  5CPR B;  2XRN A;  1ENH A;  1ZR2 A;  3H35 A;  3CDI A;  3NAR A;  2NNY A;  1JXS A;  2TDX A;  4JX6 A;  1F4K A;  1QGP A;  4M71 A;  4OIQ F;  1X1P A;  3DEW A;  2OC6 A;  4RGR A;  4EMS A;  3FZV A;  3WU1 B;  2IA1 A;  4EJO A;  5BQT A;  4HNT A;  4KDP A;  2KZV A;  3PNV A;  2PI0 A;  2DFE A;  1YG2 A;  2DMT A;  4PJ0 C;  2WWY A;  3M8F A;  3GLX A;  4L9N A;  3GZ5 A;  2BXY A;  2D1H A;  3OYJ A;  3WGH A;  2FOK A;  2KIS A;  4KIC A;  2VXD A;  1YJW I;  3IWZ A;  3KYC B;  3RDI A;  1XB4 A;  3HB9 A;  4LK1 F;  4BKX A;  2W4S A;  2MGQ A;  2DQR A;  3M9A A;  2NVU B;  4HRI A;  4IEJ A;  1MNE A;  5JVT A;  1OCZ H;  4OIR F;  2X4H A;  4Y52 J;  3M8J A;  4XK4 A;  3CUQ C;  4II2 A;  3ZQF A;  3LA3 A;  4EVI A;  2RC4 A;  1AKH B;  3ASO H;  4BQA A;  5DCM A;  2VPR A;  3CMA I;  5ERI A;  3K4M A;  1YHQ I;  1JKO C;  2VKH A;  4IHS A;  3PUF A;  1FMV A;  1ZN2 A;  2DMN A;  2ME0 A;  2DBB A;  3ABK H;  2OZ6 A;  1Y0U A;  2L5Q A;  2BY3 A;  2O3F A;  2Z2S B;  3CDL A;  3WTT C;  3CCU I;  2FD5 A;  3OS2 A;  4P5O A;  2F2E A;  2EIL H;  4M9Z A;  5F1J A;  5LHH A;  4WWC A;  2VJJ A;  1ZG1 A;  2IS1 A;  3GZN B;  2EA4 A;  3TQN A;  2K9M A;  2Q0O A;  4A3M J;  3V8L A;  2PJR A;  2F5V A;  5EF6 A;  2W82 A;  1YRN B;  3A4C A;  4D0P A;  2LK2 A;  5JFR A;  1F36 A;  2D5V A;  4DZJ A;  3ZP5 A;  5HLG A;  1YE9 A;  2DDA A;  4IHW A;  2QZ8 A;  2L7M P;  4L9V A;  5CLS A;  5IT9 Z;  2O9L A;  2R7W A;  4QPQ A;  4AM3 A;  3VEP A;  2WTE A;  1VND A;  1UEL B;  1XG1 A;  5EEG A;  1UG2 A;  1MBG A;  3HKZ N;  1MBJ A;  4KJZ A;  4A93 J;  2NXN B;  4E7Z A;  5HLH A;  3T8T A;  3L2W A;  2IGK A;  1W0U A;  1ODD A;  1G3S A;  2EZH A;  3W3C A;  2ZXJ A;  3JRG A;  3RKY A;  4NB5 A;  1GXQ A;  1VF9 A;  4XLP F;  1R1U A;  3C2B A;  2Z99 A;  1ZEL A;  1HW2 A;  3MKL A;  2X6Y A;  2ACJ A;  2LF8 A;  4HLY A;  3AAF A;  1OLT A;  1TP4 A;  1BA5 A;  2CJJ A;  1P7J A;  1X1B A;  3QPT A;  3BQY A;  2W7N A;  3I4P A;  1T08 B;  2JPC A;  4MFD A;  3H36 A;  4ZH4 F;  4DBR A;  1U5T A;  2BOL A;  4W1U A;  4BDY A;  4IQ4 A;  1LFU P;  1MMG A;  2YSR A;  2ZSH B;  2LC2 A;  1P2F A;  5C44 J;  1JTX A;  2ELJ A;  3GBG A;  1UAA A;  3QPS A;  4IHX A;  2V1X A;  3BG5 A;  3E6D A;  3OOU A;  3IKT A;  2DXI A;  2JT1 A;  1U9N A;  3TMO A;  3RYP A;  2L7F P;  4F92 B;  3S1R J;  1L3L A;  1WRJ A;  3U9G A;  2M5W A;  4D5C A;  3MCZ A;  1YJN I;  2FE3 A;  2QQ9 A;  2H6B A;  1YJ9 I;  3KYD B;  1QZZ A;  4Y17 A;  5CVU A;  3GX4 X;  3T1B A;  3KCC A;  1U0J A;  1VQ7 I;  1BJA A;  1GVD A;  3E0J B;  4A2U A;  4ESB A;  3SEQ A;  1XS9 A;  3MZ8 A;  4S0H B;  5D5W B;  3RJP A;  2JVG A;  3OS1 A;  1QZE A;  1MBK A;  3BG3 A;  4NQW A;  1A04 A;  3H5A A;  5JLW A;  1MMD A;  1X58 A;  2UXX A;  4UUS A;  2VT2 A;  2XSD C;  1R7J A;  5J6X A;  3BR0 A;  4ZC3 A;  3OWT A;  1UFM A;  4G9Y A;  4BJ5 C;  1U6G A;  3CDH A;  1Y0N A;  2DU9 A;  2QUF A;  3HC7 A;  3KPH A;  5E1Z B;  4IOC F;  4UY8 I;  3WTW C;  1SFE A;  3DPL C;  2HQR A;  2CV2 A;  3HOT A;  2R5Z A;  2R7Z J;  2EBI A;  1W7P A;  1R49 A;  2MA3 A;  1MZB A;  2KIF A;  2OPT A;  2VJI A;  2DK5 A;  3WE2 A;  4A3E J;  2CQ7 A;  4JOM A;  3WU2 C;  2DT5 A;  4HQM A;  4OMY A;  1A6I A;  3RCO A;  2PQ8 A;  1UB9 A;  2ZC2 A;  2GOX B;  2MD5 A;  4FX0 A;  3GLL A;  2AHQ A;  3RQI A;  3WTZ A;  1KQ0 A;  4Y33 A;  4ASN A;  3QU6 A;  2G9W A;  3FX3 A;  5CVV A;  5CQG A;  1HA8 A;  2KJB A;  4XLN F;  1TWH J;  1NTC A;  2LH9 A;  3KZZ A;  3OYC A;  5J1R A;  3HGY A;  1NK2 P;  3MKZ A;  2V4J C;  3SQN A;  2FQ3 A;  5EJC A;  2LRE A;  5DCM B;  2X1C A;  2YUS A;  1MSF C;  1RUO A;  1I6X A;  3UKG A;  1XDU A;  5E3O A;  2ZME C;  5FJ8 J;  2VUM J;  3FK6 A;  3TDU C;  1QHH D;  2K4J A;  3E5Q A;  3CCR I;  1HLV A;  5FFX A;  1WJE A;  3NQO A;  1Z9C A;  1FEX A;  5KCM A;  2VI6 A;  5H20 A;  3LSK A;  3FHZ A;  2AXL A;  2QSF X;  3VSL A;  5J47 A;  3M07 A;  1ERD A;  4HEA 2;  3K2Z A;  1E3P A;  1VTN C;  1IRF A;  1MD0 A;  5ICE A;  3CUQ A;  1R9T J;  4MEY F;  4IO9 F;  1JT0 A;  1I5Z A;  1ACI A;  1Z3Y A;  4GFB A;  2COM A;  2L01 A;  2VC0 A;  2H8R A;  4EM1 A;  3F21 A;  2VC1 A;  4ITV A;  4UB6 C;  5F64 A;  5KNL A;  3GTL J;  2ISY A;  4AD9 A;  2Y0S A;  5FRO A;  1WGX A;  1TWF J;  3VYT B;  1ULY A;  3HZJ A;  1ORK A;  2DOD A;  2Q2E A;  3FKJ A;  2O6G E;  1V5G A;  1K7A A;  2BY0 A;  2LSO A;  1FJL A;  1F5T A;  3SHF A;  3MZY A;  3SZG A;  4A0X A;  4LMY A;  4DYR A;  1F43 A;  3CUO A;  3HUG B;  1T39 A;  3COA C;  3HOV J;  2BW3 B;  1A31 A;  1DGW Y;  1UG0 A;  1XSV A;  2WB1 A;  1J2X A;  1U5T C;  3D5S C;  5CYV A;  3JAM K;  3BTI A;  4XSX F;  2QA4 I;  1LKX A;  2YPR A;  1QNT A;  4RAZ A;  2BY2 A;  1TLH B;  1BIA A;  2A5Y B;  3DXJ F;  5FFZ A;  3HOU J;  1B8I B;  3P7N A;  4FIS A;  3V8K A;  1ZAR A;  4ENN A;  5F27 A;  1JHH A;  2JN6 A;  2LFB A;  2R7O A;  4CIC A;  3QAH A;  4II3 A;  2Z5U A;  5GAE J;  3CO7 C;  3WE3 A;  4C3I J;  2XDV A;  3HGG A;  2LKP A;  4BNC A;  3MD2 A;  5JLX A;  5GP9 A;  3HJE A;  3PL8 A;  3WU0 A;  2OTJ I;  1OCP A;  2BVM A;  2LMD A;  2O8K A;  2JUG A;  2DFH A;  5FKL A;  3K4K A;  4JX4 A;  1K83 J;  3DTI A;  4ZDL A;  4B3A A;  4PFO A;  1K6Y A;  1X4P A;  1ETV A;  2BEO A;  4LGW A;  1APL C;  3HRM A;  3VYS B;  3L09 A;  4M6Y A;  5DYM A;  3HDD A;  2ID3 A;  3QP5 A;  4M6X A;  3TBI A;  3KEO A;  4TV7 A;  3MKW B;  4A5N A;  3CCV I;  4FE4 A;  5M5W J;  1WSU A;  1R71 A;  2IXS A;  3AFH A;  3ZN0 A;  4AYB A;  4L0Z B;  1SVO A;  2A6H F;  2M8G X;  2VQL A;  1B72 B;  3TO7 A;  2CQQ A;  3G2B A;  4D9J A;  2Q2E B;  4HST A;  1VQ8 I;  1FMW A;  1O7F A;  2CUJ A;  3S2D J;  2GBY A;  5TJJ A;  2BHZ A;  3M1E A;  2FUG 2;  2WAQ N;  3QP6 A;  4ENK A;  1IXR C;  4UV8 A;  2VQG A;  5DUK A;  3VFZ A;  2OBP A;  1FTZ A;  2STW A;  1F1Z A;  3JRB A;  1MBF A;  2I5U A;  1MSE C;  5LHG A;  4UB8 C;  4IPA A;  3ZOB A;  2V9P A;  4GCV A;  1RR7 A;  3EPZ A;  3TL4 X;  4BUP A;  4OMZ A;  1YRN A;  2F4I A;  3Q0W A;  3H9J A;  4JX5 A;  1VZ0 A;  1U8R A;  5M5Y J;  2K9Q A;  4F7Z A;  4MEX F;  2NNN A;  4J19 A;  2FML A;  3LFU A;  3ZQH A;  2LY2 A;  3TO9 A;  2KMU A;  3P5J A;  3S93 A;  2E2J J;  3CQZ J;  1FT9 A;  1BI0 A;  1TL8 A;  1K78 A;  3WOD F;  3HRS A;  2DMU A;  1E17 A;  4HV6 A;  2Y69 H;  4P9U A;  5FD6 A;  1B4A A;  2DT7 B;  4WF2 A;  1E3O C;  2EV5 A;  2JWT A;  4B43 A;  2QCO A;  4CCN A;  1GDT A;  2GQQ A;  3HYI A;  2M4K A;  2IEK A;  3OIO A;  2YS9 A;  3OYE A;  1D1A A;  1HKT A;  4Y7N J;  2L9V A;  2CV1 A;  1WWX A;  4A3G J;  5IOY A;  3F0C A;  3GWZ A;  2L9S A;  1TQP A;  3HRT A;  3HBL A;  3OS0 A;  3NEU A;  4HAM A;  1BOB A;  2XHK A;  4A0Z A;  2QM3 A;  3DBL B;  4IHY A;  1FP1 D;  1LQ1 A;  4CYC A;  1IDY A;  4ETS A;  3DKW A;  1ITY A;  4L5E A;  3LSH A;  5M3F J;  2V1U A;  1I1G A;  1QO0 D;  1P6R A;  4A3B J;  5LEJ A;  5KK1 A;  5ILS A;  4M3D A;  3IP4 B;  3CLO A;  1Z21 A;  2E36 A;  4IF4 A;  4ZYD A;  3WHB A;  4CA0 A;  3TDZ C;  1LFP A;  2PG4 A;  4X6A J;  4EM2 A;  4HZF A;  3DP7 A;  4HDU A;  4M3G A;  4D7M A;  4YFX F;  2GWR A;  2PN6 A;  4AVZ A;  4LK0 F;  3H0D A;  3OYF A;  4Y4R A;  4P55 A;  4Q47 A;  4B1R A;  3L2R A;  4N0B A;  3GTK J;  2V79 A;  5LGN A;  4CSW A;  3OYG A;  2A07 F;  3VDX A;  4AID A;  5EG0 B;  3JR9 A;  1W5T A;  2IBD A;  3EQL F;  1ZRD A;  3PSF A;  4G6D A;  3MWM A;  4ZYA A;  2OTL I;  2QQB A;  3FMS A;  3ZQL A;  3Q3S A;  4P9F A;  4M72 A;  1A6Q A;  2D1V A;  3X2Q H;  3F6V A;  2VOO A;  2X9D A;  3QOP A;  3LL7 A;  5FKO A;  2IT0 A;  4I01 A;  1OYW A;  4LG0 B;  1I6H J;  1YIO A;  2RKH A;  5HVQ C;  4CXF A;  2M30 A;  5IP7 J;  4KIG A;  1RR8 C;  1MDM A;  2BHY A;  3FXO A;  3DCF A;  3VOD A;  4IJA A;  3HSF A;  3LSI A;  2NS0 A;  4IHV A;  1YIT I;  1R5I D;  3ELK A;  5LRR A;  4B09 A;  3S1M J;  4A3L J;  3WGI A;  1Y8Q B;  2QF7 A;  2WY8 Q;  1KU9 A;  3CMM A;  4E4H A;  2L3D A;  4E70 A;  4J01 A;  1HSJ A;  2P5V A;  1OR7 A;  3R4K A;  3WGG A;  5LBQ A;  3JRA A;  2O61 A;  2ELK A;  1TT5 B;  1FOY A;  1SAN A;  1OCO H;  1V54 H;  1X1A A;  2A6T A;  2HYF A;  3R0J A;  1XPX A;  2RRE A;  2LTP A;  2RDP A;  3RSN A;  4IX7 A;  2JA8 J;  2EFW A;  2E7W A;  1W0T A;  5EDN A;  2DA3 A;  5E17 F;  3IH4 A;  1O3T A;  3Q9V A;  4O6J A;  3GO5 A;  2X1E A;  1MKM A;  4Y13 A;  4I2O A;  4PSX A;  1O3Q A;  1R5G A;  4GDF A;  1R4M B;  5J8F A;  1IDZ A;  1TQM A;  1G8X A;  2W85 A;  3K10 A;  3A03 A;  2F48 A;  2VBX A;  5DEQ A;  3OYB A;  1J09 A;  5BMZ A;  2BZT A;  2QSG X;  2P6S A;  1LUJ B;  3KIO A;  3S32 A;  2OQG A;  1UHW A;  3KFW X;  3ONQ A;  3KEY A;  1TC3 C;  1F9N A;  2MG4 A;  2R7F A;  1LVK A;  1MJ9 A;  3REO A;  3I9V 2;  4RGU A;  4GXO A;  4XLC A;  2L9R A;  5KAF C;  1ZGW A;  3BP8 A;  1WJ5 A;  4CO8 A;  1KON A;  2ME6 A;  1D8J A;  2HGC A;  3ABM H;  1Z67 A;  3Q0U A;  5FLM J;  3ML6 A;  1O4X A;  4BEH B;  1T33 A;  3P9C A;  1FPQ A;  1G59 A;  2XSJ C;  4UHT A;  1SFK A;  4CUG A;  1IV6 A;  1ZYR F;  2CMP A;  2LY9 A;  1R58 A;  2E1C A;  2CQN A;  5D5V B;  2Y30 A;  2VAS A;  1MMS A;  1ZG5 A;  3ZMT A;  2K9L A;  4IRH A;  5E8I A;  5JHF A;  2AS5 F;  4RLQ A;  2CQX A;  1KYW A;  2W48 A;  1OFC X;  3FF5 A;  2WV1 A;  2ZXH A;  4PSW A;  1VQ5 I;  1P4A A;  3GFJ A;  3R60 A;  3SFZ A;  2MC4 A;  2Y2Z A;  4DIQ A;  4LIT A;  5H2F C;  2FEZ A;  1Z7L A;  2HPI A;  2VB6 A;  3BTC A;  3CTA A;  3HUG A;  3M3Y J;  2A05 A;  2GXA A;  4U7B A;  4HV5 A;  3K0L A;  3DLL F;  3FXJ A;  4FX4 A;  5C4X J;  5CKT A;  1O3R A;  1ZG3 A;  1FY7 A;  2HOA A;  3IH3 A;  1EH8 A;  2DI3 A;  4NDL A;  1Z6R A;  3HSE A;  1GT0 C;  2P0W A;  2LDU A;  1D0Z A;  4A3K J;  4FT8 A;  4KUM A;  2E2H J;  5EEA A;  2BV6 A;  3LAP A;  3E97 A;  3K70 D;  3HKZ A;  5FGM A;  4XID A;  1PP8 F;  1STZ A;  2FXA A;  4BQQ A;  3ZGK A;  4FET A;  2G0E A;  4F55 A;  1IRG A;  3OMY A;  2DFI A;  3CMY A;  3V7C A;  2XRL A;  3BR1 A;  2KP6 A;  1FYM A;  1ETX A;  1MMA A;  3L2U A;  2XPV A;  5DTD A;  2IS2 A;  4UV9 A;  4S05 A;  1V3F A;  1WVR A;  2M87 A;  3PO2 J;  2X6O A;  1QPI A;  2NAZ A;  2M7A A;  1BM9 A;  1WPK A;  2GM4 A;  3JRI A;  2OF7 A;  2QBY A;  4GRI A;  2KZG A;  2KJC A;  2W25 A;  4BE1 A;  2DOE A;  1K4S A;  5HS9 A;  3ABT A;  2X85 A;  2VLA A;  2L4M A;  5D6F A;  3ZMD A;  4AVP A;  5E3N A;  3ZQ7 A;  4HF1 A;  4ESJ A;  3OOP A;  3ZQC A;  1WI3 A;  3BCA A;  3AG4 H;  2ZJR F;  3S2W A;  1XD7 A;  3TO6 A;  3KP3 A;  4IOA F;  2EWN A;  2ETH A;  3GFM A;  3JRH A;  4BDZ A;  1RIO H;  2R0Q C;  4W97 A;  2KIU A;  3U21 A;  4BH9 A;  2MYS A;  4IQJ A;  5K5R A;  1BJZ A;  3L2V A;  1WHU A;  2EJR A;  3C1D A;  4RGX A;  4R79 A;  2RNJ A;  4MQV A;  2I10 A;  3TOB A;  2HXO A;  2IA2 A;  4IVN A;  4GO1 A;  3CJT B;  3V4G A;  3ZCO A;  1HOM A;  2XAS A;  1MW7 A;  1MBH A;  4YII A;  2DA7 A;  3FXQ A;  4HBL A;  5F1R A;  3LNQ A;  4H0E A;  1YW8 A;  5A2Q Z;  2H1L A;  4B4C A;  2ZNZ A;  3CC7 I;  2XPU A;  4ENJ A;  2WBM A;  3FDY A;  1HST A;  1A36 A;  5GAD J;  3HHH A;  3LA2 A;  3V8J A;  2QEX I;  5K5Q A;  3A1Y A;  4RMN A;  3JRF A;  2CUF A;  4MHG A;  4AIK A;  1E3H A;  2ZME A;  3BY6 A;  1OCT C;  3S3N A;  2NRA C;  3IAS 2;  1IZ1 A;  4BY7 J;  2DDB A;  5HDK A;  3AG1 H;  4UUT A;  4XBF A;  3B6A A;  2M7B A;  1Z7U A;  4PJJ A;  1BW5 A;  3I5U A;  1ZRE A;  2I8D A;  2KRC A;  5DUI A;  3IL2 A;  2M45 A;  2P7C B;  1FIP A;  1S7E A;  1Y6I A;  2O5R A;  3DFG A;  3QOE A;  4KT6 A;  2ESH A;  4I98 B;  3EET A;  4X1E A;  4BQN A;  2OZU A;  2UZK A;  4BE0 A;  5FKN A;  1S29 A;  4L9T A;  1VQ4 I;  4I0B A;  3F3X A;  1V5E A;  5LGU A;  3WG7 H;  3JRD A;  1NG7 A;  2ECB A;  3R0A A;  2PMH A;  1FBU A;  1OQY A;  4I0A A;  1ZRC A;  2JA6 J;  3I59 B;  3QYE A;  1T0F C;  4F52 A;  1XX5 A;  1W36 D;  4WCG A;  5DS9 A;  1X3U A;  2FF4 A;  2V1D A;  3DTK A;  2R7R A;  5GAG J;  2KHM A;  3BPX A;  4A5M A;  2JK3 A;  1XSX A;  2EFP A;  3PNT A;  5DDG A;  2FNP A;  2IGO A;  5HDN A;  5A2Q K;  3PSI A;  2ADU A;  2K5C A;  1OCR H;  2GA1 A;  3RI4 A;  4DQ2 A;  3HOS A;  2DTR A;  4HYE A;  3BG7 A;  4A3J J;  1U78 A;  1HW5 A;  2VBZ A;  2Y75 A;  2HDC A;  5DM6 F;  3OL3 A;  2WY7 Q;  1IRX A;  4J00 A;  2L2O A;  3QYB A;  3HIF A;  1D8K A;  2X0L A;  4D1Q A;  1GUU A;  3OR2 C;  1SFX A;  3S1N J;  2FX0 A;  2OCC H;  1QZY A;  1GV5 A;  5H6Q A;  1Y8R B;  2H27 A;  4LG3 A;  3DU5 A;  2DA4 A;  2L0K A;  5KHD A;  1B59 A;  2HTJ A;  1DQU A;  3BPV A;  2CSO A;  3VB2 A;  1WZ2 A;  3DU6 A;  2YX7 A;  4YIF A;  4C9Y A;  4BAC A;  3CCM I;  1QPM A;  3KP6 A;  4Z2Y A;  4CGZ A;  1SD4 A;  2H8W A;  1SMT A;  1TT0 A;  2XF7 A;  5EG0 A;  3S1Q J;  2WV0 A;  4HX4 A;  3M7G A;  3I71 A;  1RES A;  2QKL B;  1X1D A;  2MLG A;  1UHS A;  3F8B A;  4AIH A;  5LD2 C;  1Y1W J;  5J8C A;  3OIQ A;  3GTP J;  4C2M J;  3ZQI A;  4NNJ A; 
#chains in the Genus database with same CATH homology
 3FKI J;  5F0H A;  3HGG A;  1ETW A;  5JLX A;  5GP9 A;  1OCP A;  1FTT A;  2O8K A;  3GTM J;  3LSG A;  2TCT A;  5FKL A;  1ZQ3 P;  3BG9 A;  4JX4 A;  1K83 J;  2M2E A;  4B3A A;  3O8H A;  2B63 J;  1ETV A;  1APL C;  4RDU A;  1ZR4 A;  5M3M J;  3TW7 A;  2DA1 A;  4CYC B;  3HDD A;  1JKR C;  2CU7 A;  2ID3 A;  3TP3 A;  3S16 J;  2NVQ J;  1LFB A;  1JUP A;  3TW6 A;  1VI0 A;  4FE4 A;  4BBR J;  5M5W J;  1NK3 P;  4M3F A;  1I3Q J;  5IYC J;  4EEF G;  4AUX A;  3H0G J;  2EZI A;  2M8G X;  4V2G A;  1B72 B;  2XB5 A;  1K61 A;  1WH5 A;  2CQQ A;  2XB0 X;  3S2D J;  2GBY A;  4I76 A;  2HOS A;  3HEF A;  2WAQ N;  3FIS A;  1IGN A;  2PMZ N;  4A3C J;  3I4M J;  2LLK A;  1ZTR A;  3S14 J;  4FCY A;  1HDD C;  1FTZ A;  2LD5 A;  1DU6 A;  5M5X J;  3JRB A;  1MBF A;  2EQR A;  2EZK A;  1LE8 A;  1MSE C;  3RZO J;  2DJN A;  3FIW A;  3ZOB A;  1RR7 A;  3G1L A;  1IUF A;  3TP0 A;  1YRN A;  4JX5 A;  2COB A;  3Q0W A;  1FIA A;  3HOZ J;  2M0C A;  5F0C A;  5M5Y J;  4V2F A;  2ID6 A;  2K9Q A;  4J19 A;  3K7A J;  3L1P A;  3ZQH A;  3E7L A;  3W6V A;  2E2J J;  3CQZ J;  3S2H J;  2E2I J;  4HNV A;  1X2N A;  2NOG A;  2DMU A;  3HOY J;  4QSH A;  2XGC A;  2ZB9 A;  3O8G A;  3LSR A;  1E3O C;  1ETO A;  2JWT A;  2QCO A;  3BR2 A;  1GDT A;  1Y1V J;  3OSG A;  3I4N J;  2IEK A;  3OIO A;  3GTQ J;  2YS9 A;  4BBS J;  3SJM A;  4Y7N J;  4A3G J;  5IOY A;  3G1O A;  3F0C A;  4A69 C;  3HBL A;  1JKQ C;  5BNG A;  4D5F A;  2XPW A;  4IHY A;  2M34 A;  1DU0 A;  4CYC A;  1X2M A;  1IDY A;  1LE8 B;  3OSF A;  4FE7 A;  1ITY A;  1RKT A;  4L5E A;  5IPA A;  5EGO A;  5M3F J;  5J3L A;  4A3B J;  1SFO J;  1QVT A;  2R93 J;  5IYB J;  2FQ4 A;  1JKP C;  4M3D A;  4M3E A;  3FK7 A;  4BY1 J;  3WHB A;  4XRS G;  1MNM C;  1TWA J;  2HQ5 A;  5E3M A;  1BL0 A;  3A01 B;  4X6A J;  4M3G A;  1IG7 A;  1Z77 A;  4D7M A;  2R5Y B;  4UUS B;  2P81 A;  4B1R A;  1TWC J;  2MW8 A;  3K2A A;  4ABZ A;  2CUE A;  3GTK J;  2R5Y A;  4JP0 A;  2JJ7 A;  4MLO A;  2TRT A;  3HOX J;  3JR9 A;  5EG0 B;  5K7H A;  3SFI A;  2IBD A;  2LP0 A;  3A02 A;  3JRE A;  3LOC A;  3PM1 A;  2LKX A;  3ZQL A;  3Q3S A;  1H89 C;  3M4O J;  4JYK A;  1ETY A;  5F08 A;  2X9D A;  1ZKG A;  3B6C A;  5FKO A;  1JJ6 C;  1I6H J;  2HYJ A;  5IP7 J;  4M3B A;  1ENH A;  1ZR2 A;  2JA5 J;  1RKW A;  3DCF A;  3NAR A;  2VKV A;  5IYD J;  4JX6 A;  4IHV A;  4BXX J;  3S1M J;  3LSJ A;  1RPW A;  3DEW A;  4A3L J;  4MIM A;  2QF7 A;  1HF0 A;  1JT6 A;  2EZL A;  5FKM A;  2XGE A;  3JRA A;  2DMT A;  3H3V K;  2ELK A;  5HOD A;  1SAN A;  2NS8 A;  1VFC A;  1MH4 A;  2LTP A;  2JA8 J;  4D7N A;  1W0T A;  5EDN A;  2DA3 A;  3HM5 A;  3IH4 A;  1JGG A;  3HB9 A;  2Y9Y A;  4BKX A;  2X48 A;  5C4J J;  2MGQ A;  4IEJ A;  2NVX J;  4XIC A;  4Y52 J;  1IDZ A;  2DN0 A;  4XK4 A;  1AHD P;  3A03 A;  2K40 A;  1P7I A;  5EYR A;  3ZQF A;  5IOZ A;  1AKH B;  5FLV A;  2HOT A;  2VPR A;  3IV5 A;  1JKO C;  2M9H A;  2YU9 J;  2DMN A;  2ME0 A;  9ANT A;  1TC3 C;  2MG4 A;  3CDL A;  2WB1 N;  2FD5 A;  2NVY J;  2L9R A;  1ZGW A;  2ME6 A;  2DTZ A;  5F1J A;  3Q0U A;  5FLM J;  1O4X A;  1T33 A;  4A3M J;  5EF6 A;  3GTG J;  2HI3 A;  1YRN B;  2HDD A;  1IV6 A;  2LK2 A;  1GV2 A;  1F36 A;  2DMQ A;  2LY9 A;  2D5V A;  4DZJ A;  1JUM A;  2Y30 A;  4IHW A;  2CQX A;  2W48 A;  2IAI A;  1OFC X;  2L7M P;  2WV1 A;  4QIW N;  3QQA A;  2O9L A;  1VND A;  2JMW A;  1XG1 A;  1HCR A;  1HDP A;  4A3I J;  1UG2 A;  1AKH A;  1MBG A;  3HKZ N;  1MBJ A;  4A93 J;  2Y2Z A;  3HOW J;  1CQT A;  4LOC A;  3BTC A;  3VPR A;  1W0U A;  3M3Y J;  2KT0 A;  2EZH A;  5C4X J;  3JRG A;  2HOA A;  3IH3 A;  3CCY A;  3G1M A;  1VF9 A;  5C3E J;  1H8A C;  2FJ1 A;  3C2B A;  4NDL A;  1GT0 C;  3MKL A;  1JUS A;  2CRG A;  4A3K J;  2DMP A;  1ETK A;  1BA5 A;  3BR5 A;  2CJJ A;  1P7J A;  3BT9 A;  2E2H J;  5EEA A;  5EGO B;  3BQY A;  1B72 A;  4DW6 A;  4MFD A;  1IJW C;  1JJ8 C;  4XID A;  5EZG A;  4W1U A;  1LFU P;  1T56 A;  2G0E A;  5C44 J;  1JTX A;  3CMY A;  2XRL A;  3BR1 A;  3GBG A;  4MFE A;  3D1N I;  1ETX A;  4RBO A;  3GTO J;  3QPS A;  4IHX A;  2XPV A;  3BG5 A;  1IRZ A;  3S17 J;  3OOU A;  5DTD A;  5GPA A;  3BR3 A;  1U9N A;  3PO2 J;  2X6O A;  1QPI A;  2L7F P;  3S1R J;  1ETQ A;  2K9N A;  1WPK A;  2GM4 A;  4D5C A;  5F04 A;  3JRI A;  2OF7 A;  1PUF A;  2JA7 J;  3JRC A;  5EZH A;  4DYC A;  5IP6 A;  5E3N A;  3ZQC A;  2MSY A;  1WI3 A;  1GVD A;  2R92 J;  2K9S A;  2NVT J;  1OJL A;  1XS9 A;  4S0H B;  3JRH A;  2R0Q C;  4W97 A;  1BJZ A;  1MBK A;  3BG3 A;  3MVP A;  5JLW A;  1X58 A;  3MN2 A;  2I10 A;  4UUS A;  1G2H A;  2XSD C;  1A5J A;  3BR0 A;  2HXO A;  1XC5 A;  2AO9 A;  1HOM A;  2VKE A;  1MBH A;  2Y31 A;  2DA7 A;  3LNQ A;  3Q0V A;  2R5Z B;  2E19 A;  2ECC A;  4MO7 A;  4XRM A;  4B4C A;  4AC0 A;  2EH3 A;  2XPU A;  2R5Z A;  2R7Z J;  2EBI A;  3LSP A;  2OPT A;  2Y0S N;  4A3E J;  1I50 J;  3JRF A;  2CUF A;  3RKQ A;  4DZP A;  1A6I A;  1U8B A;  4G12 A;  2NS7 A;  1TWG J;  1OCT C;  3IH2 A;  4BY7 J;  2E1O A;  2AHQ A;  5F0F A;  3WHC A;  4UUT A;  3RQI A;  3B6A A;  1BW5 A;  3A01 A;  1ZK8 A;  2LVS A;  1FIP A;  1NTC A;  1TWH J;  1S7E A;  4X1E A;  4M6V A;  5J1R A;  3HGY A;  1NK2 P;  3SDG A;  3GTJ J;  5FKN A;  1JTY A;  1Z0X A;  5J1U A;  2YUS A;  1MSF C;  2DA2 A;  3UKG A;  3JRD A;  2ECB A;  5E3O A;  5FJ8 J;  1PUF B;  2VUM J;  3FK6 A;  1IC8 A;  3BTJ A;  5E3L A;  1D5Y A;  2JA6 J;  1H88 C;  1HLV A;  4AYB N;  3RZD J;  5DS9 A;  1FEX A;  3NAU A;  2VI6 A;  3ZQG A;  2JK3 A;  1QRY A;  2N8G A;  2LR8 A;  3TED A;  4A3J J;  1U78 A;  1R9T J;  1JT0 A;  4C3J J;  4GFB A;  2H8R A;  3GTL J;  4FTH A;  1B8I A;  2GLO A;  1MH3 A;  1GUU A;  1WGX A;  1TWF J;  1MBE A;  3S1N J;  2FX0 A;  1ORK A;  1GV5 A;  2DA6 A;  2DA5 A;  1BW6 A;  5GPC A;  2H1K A;  1FJL A;  2DA4 A;  2L0K A;  2RAE A;  1UMQ A;  2XGD A;  1Q1V A;  4DYR A;  5J1Y A;  1EF4 A;  1F43 A;  3BQZ A;  2O7O A;  1RET A;  3HOV J;  1POG A;  1WCM J;  4DYQ A;  5FKK A;  3BR6 A;  4QTR A;  3BTI A;  2L7Z A;  4C3H J;  1U9O A;  5K7F A;  3PO3 J;  3BTL A;  5EG0 A;  3S1Q J;  3HOU J;  1B8I B;  4FIS A;  1RES A;  3QPL A;  5F27 A;  4XRS A;  1QVU A;  1AU7 A;  3S15 J;  4A3D J;  1UHS A;  4I6Z A;  2KDZ A;  4A3F J;  2JN6 A;  2LFB A;  1Y1W J;  5IP9 J;  5K7Z A;  3GTP J;  2HXI A;  4C2M J;  1WH7 A;  2Y9Z A;  3ZQI A;  4C3I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...