1MBFA

Mouse c-myb dna-binding domain repeat 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbfA00
3OOUA 3ZQLA 5DS9A 4MFDA 2OF7A 3BR1A 3C2BA 5J1RA 2LD5A 1ITYA 1ZK8A 2XGCA 4MFEA 2M34A 1UG2A 2IAIA 1U8BA 2MSYA 1IDYA 2L9RA 3BQZA 5EG0B 2VI6A 5M3FJ 1BJZA 1QPIA 3S1NJ 4BBSJ 4UUTA 3BTCA 2R5YB 5FKMA 2IEKA 1JT6A 3BR3A 2H8RA 3HBLA 1MNMC 1HCRA 3GTOJ 1B8IB 4LOCA 5F04A 4D7MA 2DMPA 2NOGA 3Q0WA 3VPRA 1YRNA 1PUFB 4JX5A 2NVTJ 1IV6A 1ENHA 1P7JA 1NTCA 4ABZA 1NK2P 3JRHA 4A3EJ 5FLMJ 2Y31A 1RKTA 1MSEC 1WPKA 2MG4A 4A3LJ 4AC0A 1VF9A 4QTRA 3GTJJ 1W0UA 4QSHA 1FTTA 1TC3C 3WHBA 2JWTA 3GTLJ 3IH3A 3HOWJ 5JLWA 4UUSB 3QPSA 1X2NA 1OJLA 3FISA 1E3OC 1GUUA 2FD5A 4C3HJ 1WH5A 3B6CA 3G1OA 3JRDA 4V2FA 1LFUP 2R92J 5F08A 4FISA 3FK6A 2Y9ZA 2DMQA 2VUMJ 4DZPA 1JTXA 2HQ5A 2LP0A 1MBKA 4L5EA 2L7MP 3Q0VA 3BG3A 5IP6A 3A01B 2B63J 2DA1A 2FX0A 1HLVA 1I3QJ 3JRIA 3BR6A 3M4OJ 3HOZJ 3BT9A 2KT0A 3OIOA 3LNQA 1Z0XA 2KDZA 2DA6A 4M3DA 2LR8A 5FKKA 2JMWA 3LSRA 2K9SA 4FE7A 1HDPA 2QF7A 1ZTRA 2LVSA 2WV1A 4RDUA 5C44J 4IHVA 1MSFC 2I10A 5F1JA 1JKPC 4BY1J 3A03A 1JKRC 3JREA 1LE8A 1K61A 1IDZA 3O8GA 4GFBA 1IUFA 2E2JJ 1XC5A 2XGEA 1HF0A 3GTGJ 3HOYJ 1CQTA 3HB9A 2DTZA 1A5JA 1H89C 3BR2A 1XG1A 2VPRA 2LTPA 4QIWN 4A3FJ 1POGA 1ETKA 3H3VK 4DYQA 3IH2A 4Y7NJ 4MO7A 2M0CA 1AHDP 1D5YA 3S1QJ 4M3BA 4XRSG 4C2MJ 3HGYA 2O8KA 1EF4A 2DA5A 5M3MJ 3E7LA 2CQXA 3NARA 1UMQA 3CDLA 2Y2ZA 2M8GX 3RZOJ 4C3IJ 2LKXA 3K7AJ 3S14J 1S7EA 5HODA 2OPTA 1JT0A 2XPWA 3TW7A 4C3JJ 4JX4A 5GP9A 3LSGA 1MBJA 2M9HA 2MGQA 4CYCA 4EEFG 3HDDA 1I6HJ 3LSPA 3BQYA 3BTJA 5EDNA 1R9TJ 1GV5A 1H88C 2EH3A 5IYCJ 1VFCA 2JA7J 5F27A 3Q0UA 1O4XA 1F36A 3IV5A 4IHXA 2TRTA 4B3AA 4D5CA 2ID6A 2XSDC 2E2HJ 1BW5A 3M3YJ 5EGOB 4A69C 2W48A 2XB5A 1ETQA 2HDDA 2X9DA 1X2MA 3JRAA 5K7FA 1W0TA 4AUXA 1ZR4A 5FLVA 5E3LA 1FJLA 1ZQ3P 2RAEA 2Y30A 1HDDC 2E1OA 2COBA 3ZQGA 1X58A 5IP7J 5EZGA 2R5YA 1HOMA 1YRNB 1P7IA 2AHQA 1ETVA 3Q3SA 5IOZA 2N8GA 2HOTA 2Y0SN 3BTLA 1IGNA 4D5FA 1AU7A 4DW6A 1XS9A 2JA5J 4HNVA 2L7ZA 4DYCA 5F0CA 1JKOC 3BR0A 2GBYA 2DA2A 4A3GJ 2GLOA 1JKQC 3L1PA 1PUFA 4G12A 4A3IJ 2NVYJ 5FJ8J 1DU6A 3S17J 3JRGA 1B72A 2JA8J 5C4XJ 2HOAA 4X6AJ 4W1UA 3S2DJ 5E3NA 1VNDA 1WI3A 2NS8A 3LOCA 4AYBN 3ZQCA 1GT0C 2HOSA 3PO3J 1VI0A 1OCTC 1BW6A 3TEDA 3SDGA 4RBOA 2GM4A 2JN6A 1RPWA 4B1RA 5IOYA 4MIMA 4B4CA 1GVDA 5EZHA 1JJ6C 5IPAA 2CUFA 3ZQHA 1U78A 3S15J 2EBIA 1JGGA 1Y1VJ 1G2HA 2HYJA 2JA6J 1SANA 2K9QA 5E3OA 3DCFA 4M6VA 2ELKA 2WAQN 2QCOA 5EYRA 1AKHA 3S2HJ 1TWHJ 1A6IA 4X1EA 4MLOA 4I6ZA 1QRYA 1ORKA 9ANTA 2LFBA 4A3MJ 1JUPA 4IHYA 2DA7A 3MVPA 2FJ1A 1FTZA 2JJ7A 2ZB9A 1T56A 1LE8B 1FIAA 1JTYA 1MH4A 1FEXA 2G0EA 3PO2J 2E19A 4FTHA 2XGDA 5EF6A 2NVQJ 3FKIJ 3HOVJ 2DA4A 3HEFA 5M5WJ 3I4NJ 3BG5A 2WB1N 4A3BJ 1QVTA 5GPAA 3FIWA 3TP0A 3SFIA 2E2IJ 2DJNA 1IRZA 3O8HA 4J19A 3CQZJ 1MBEA 2R5ZA 2CUEA 4A93J 5JLXA 2EQRA 2R7ZJ 5GPCA 2ID3A 2YS9A 4IHWA 4V2GA 3TW6A 2CU7A 1ZKGA 3MN2A 1ETOA 4CYCB 1WH7A 2LY9A 4JX6A 1TWGJ 2DMTA 1ZR2A 2DA3A 3RKQA 3GTPJ 3G1LA 4XRSA 2Y9YA 4BBRJ 1RETA 3F0CA 1MBGA 4BY7J 5IP9J 1OFCX 4Y52J 5J3LA 1I50J 2HI3A 2NS7A 2ME0A 2K40A 1MBHA 5BNGA 1FIPA 1IC8A 4JP0A 4I76A 4FE4A 5EG0A 2FQ4A 2JK3A 5F0FA 3D1NI 5J1YA 3LSJA 5F0HA 3HM5A 3GTQJ 1BA5A 2TCTA 3JRBA 3NAUA 2K9NA 3BTIA 2ME6A 5IYBJ 2MW8A 1WCMJ 5M5YJ 5EGOA 1ETYA 2EZLA 4A3KJ 1B8IA 1T33A 4DYRA 5EEAA 2LK2A 3SJMA 3CCYA 2AO9A 3B6AA 3S1RJ 1GDTA 1ZGWA 1RKWA 2CRGA 4XIDA 2HXIA 3JR9A 1F43A 5C3EJ 1B72B 3GTKJ 4M3FA 3K2AA 3JRCA 5FKOA 3GTMJ 3DEWA 4BKXA 1UHSA 3S16J 1Z77A 4UUSA 5IYDJ 2XB0X 1JJ8C 1U9OA 1RESA 2XPVA 2D5VA 3WHCA 2X6OA 3ZOBA 3A02A 2ECBA 3S1MJ 4S0HB 2M2EA 3HKZN 1ETXA 3OSFA 2O7OA 3ZQFA 5FKNA 3ZQIA 1JUMA 3A01A 1U9NA 4W97A 1TWCJ 3FK7A 1DU0A 3PM1A 3HGGA 2DMUA 1AKHB 3TP3A 5M5XJ 4XICA 1MBFA 4A3DJ 3H0GJ 2VKVA 1TWAJ 3RZDJ 3JRFA 3QPLA 2P81A 2R0QC 3I4MJ 1Q1VA 1WGXA 2EZHA 2X48A 4M3GA 3UKGA 5K7ZA 4A3JJ 2EZIA 2YU9J 3HOXJ 3QQAA 2VKEA 1OCPA 1NK3P 2CJJA 1K83J 2IBDA 2PMZN 3HOUJ 1JUSA 5DTDA 4D7NA 5J1UA 5K7HA 3G1MA 3W6VA 4XRMA 1QVUA 2H1KA 2LLKA 3MKLA 2DMNA 1ETWA 4M3EA 2XRLA 2R5ZB 2EZKA 5E3MA 4FCYA 1IG7A 4BXXJ 2YUSA 1TWFJ 1APLC 4DZJA 1RR7A 4IEJA 1BL0A 1Y1WJ 3BR5A 1IJWC 3RQIA 3CMYA 2R93J 1GV2A 4NDLA 2CQQA 2L0KA 1MH3A 2XPUA 4XK4A 3BG9A 1H8AC 2HXOA 3GBGA 2O9LA 2L7FP 5FKLA 1SFOJ 2NVXJ 1LFBA 2ECCA 5C4JJ 4A3CJ 2DN0A 3IH4A 4JYKA 3OSGA
chains in the Genus database with same CATH superfamily
1DUXC 4WXCA 3OOUA 4C30A 1FP1D 2BGCA 5D8LB 2HPMA 3FM5A 2Z99A 3J81K 2HOEA 2JTVA 2FOKA 3U21A 1OLTA 1FPQA 4MFEA 4KIFA 2M34A 1T95A 1EKEA 2IAIA 4OOIA 1HXDA 5KCMA 2CS3A 2KIUA 3SXYA 2DQLA 1SVOA 3BQZA 3OV8A 5M3FJ 1BJZA 5KHDA 3S1NJ 1MMDA 2E34A 4HF2A 4BBSJ 1ODDA 4HYEA 2HDCA 3VYTB 4C2UA 2CUJA 4BQAA 3V42A 1BOAA 3H3UA 4CICA 4G7ZF 4CSWA 4XLNF 4YIFA 3GTOJ 5F04A 1KU3A 3DBHB 2ZKZA 3BJ6A 3HPHA 4CA0A 3VPRA 1FBSA 1X4OA 2QQBA 4JX5A 4PGHA 1IV6A 4IO9F 3CLOA 2DXIA 1KU9A 1NTCA 1XSVA 1Y56A 1WJ5A 4M9SA 3OYJA 3L2VA 3HRMA 1BOBA 1FX7A 4FHTA 3DPUA 4L0ZB 5GTIC 2XAHA 3WG7H 2EFWA 4L9NA 2CH0A 2MG4A 4ENJA 1MSEC 4E7SA 3GTJJ 2ZFWA 3H5RA 3W6JB 2VJ4A 3D5SC 3AAFA 5JLWA 2DFHA 2B9SA 3CUQA 1BIBA 1W5TA 3CC2I 3CCLI 1OJLA 3FISA 1E3OC 3ZPLA 2JPCA 2LNBA 3G1OA 3C3WA 3JRDA 1ZELA 4FASD 3HOTA 3FK6A 4HZFA 3SEZA 2DMQA 3GLLA 1A31A 3ZXSA 1XPXA 2NNYA 1P6RA 3KP2A 3P7NA 1Z67A 1S8NA 4B47A 1Z05A 3S3NA 1I3QJ 3CMMA 1KU2A 2K86A 1PDNC 2E1CA 2VOOA 2NOJB 3FMSA 4EJUA 2R7WA 4B8XA 4LFUA 2XDVA 4M3DA 3OIPA 5FKKA 4CUGA 4IQ4A 4IL6C 3PQKA 4XNFA 4KIBA 2ZNYA 3OYGA 2M45A 5FLXZ 2R7SA 4IPAA 1G3YA 2QF7A 4HA8A 2CGPA 3H5NA 2A3SA 3E6CC 2I10A 2HTSA 1JKPC 2P5VA 4HNUA 2PLYA 2V9PA 1WJAA 3P9CA 4GFBA 2K3FA 1YYVA 2E2JJ 1D3YA 3PJRA 5DUKA 4OINF 4AVPA 2E7WA 3GTGJ 3PNYA 1W5SA 3RKXA 3EUAA 3HB9A 1GXPA 1H89C 2LTPA 2O0YA 4ZC3A 3BJOA 5H6QA 3H3VK 4DYQA 3SDBA 3KE2A 2NYXA 5D6EA 1XMKA 3S1QJ 3FHNA 4M3BA 2EFOA 4LLGF 1G3SA 2O8KA 1JE8A 1Y0UA 5HLGA 2DA5A 3H9GA 3O2PE 5M3MJ 2LSOA 3CDLA 2Y2ZA 4C3IJ 2BE5F 3U9GA 4BQQA 4A12A 2WBMA 2VKDA 1QPMA 4AIJA 3S14J 4KT6A 2L5QA 2PFBA 1Z7LA 1REPC 1E0EA 2PG4A 2KIFA 4BJTA 1K6OA 1Z6TA 3R0JA 3BTJA 1H88C 2EH3A 2MBFA 1HC8A 5F27A 1I6XA 3Q0UA 4O5VA 1O4XA 1I27A 3VFZA 1L3LA 2IRFG 2EILH 2EK5A 1IO2A 2DJIA 4IHXA 2ZBKA 2E36A 5LRRA 2W85A 3I59B 3CF2A 5LLQA 4D5CA 3RJPA 2ID6A 3A1YA 2XSDC 1BC7C 2BVLA 2E2HJ 4KISA 3M3YJ 2VQHA 1IZ1A 2XB5A 1BR2A 1UHWA 1AWCA 2HDDA 3VODA 3IWFA 3V4GA 5K7FA 1Z9CA 1ZR4A 5FLVA 5E3LA 4IRGA 3OYNA 2XF6A 2RAEA 2Y30A 4M71A 3CUOA 3I54A 3FBIB 2WAEA 2BY3A 5KAIC 5EZGA 2R5YA 1P7IA 4HRIA 3OYMA 1SEUA 2HOTA 1R7JA 3BTLA 4HW0A 1IGNA 1ONVA 3FXRA 4D5FA 5HOOA 4RMNA 2L7ZA 3ABTA 2ZC2A 2V1NA 3A2KA 2DCEA 3BDDA 1W1WE 3ABUA 2HDWA 3L1PA 1RIOH 2XC7A 1PUFA 4RB2C 1W36D 3IC7A 5FJ8J 3MKYB 1V55H 2K27A 2L3DA 2V9KA 2HOAA 3ELKA 2L54A 1P2FA 1W5CC 3M8EA 1VNDA 3MAJA 2NS8A 5E3NA 2ZMEB 4AYBN 4BDYA 1LEBA 2P0WA 3CO6C 4ESFA 3L2CA 1BW6A 2GQQA 4BNCA 1RPWA 3DEUA 4B1RA 3K1MA 5EZHA 3ZCOA 1F4KA 3PQJA 5D4RA 3Q5FA 4PFOA 1U78A 2EBIA 1JGSA 1ZG3A 1J5YA 1G2HA 2NRAC 2HYJA 2M30A 1Z7UA 3AG3H 2P7VB 3LA3A 3I0TA 1VQLI 1PJRA 1BI1A 3SQNA 5E3OA 2HVSA 2CSOA 3DBRB 4HX8A 4LIVA 1DDNA 1NH3A 3TQNA 2KP6A 3T0YA 3RQ4A 4G6TB 2KMUA 1P92A 1XGSA 1ORKA 3IRRA 4F7ZA 2VQCA 3EYYA 3F22A 3EYIA 3QYFA 2DA7A 3RSNA 3E3VA 2FJ1A 1FTZA 3LSKA 1X3ZB 2WV0A 1FIAA 1FEXA 1V4RA 5E8GA 1C0WA 2RGVA 4FTHA 5EF6A 4ZYHA 1YI2I 1VQPI 2QVOA 5J8FA 3BROA 4AVZA 3I4NJ 3BG5A 3HYIA 1M1EB 4WXHA 4CCMA 3ZP5A 2WB1N 4HF0A 1IAWA 1QVTA 3I3LA 2E2IJ 3LFUA 3E5UA 4XLAA 4Q47A 3RKWA 2XASA 3RKYA 1IRZA 3TKYA 1XB4A 2IS6A 4MGRA 3O8HA 4J19A 2HEOA 4WWCA 3CQZJ 4UUVA 1X3WB 2R5ZA 1OCZH 2W7NA 3S93A 4A93J 2EQRA 1WQ2A 4I09A 4JK1X 5E1ZB 4S05A 4V2GA 2LOOA 3FBNB 2CU7A 5E79C 4HV6A 3FHZA 1IRGA 1HW2A 3PIOF 2FE3A 2V1UA 1E3HA 4JX6A 4P9FA 1VQOI 1JHHA 3N4MA 1ZR2A 3D5LA 1OR7C 4DOZA 2M5WA 5LD2C 4UY8I 2HQNA 3CZ6A 3CC4I 4BY7J 5BPIA 2Q1ZB 2OQRA 3CCMI 4AIKA 4NHJA 1ERDA 2VBYA 2HNHA 4DNCA 1OFCX 3I71A 5IT3A 1I50J 2L4AA 2Z3YA 1XCVA 5HS7A 3VSKA 4CCOA 2K9LA 1IC8A 2L4MA 1O3TA 4K2EA 1OCOH 1MGTA 2JK3A 3DLAA 4XSZF 4ZH4F 5IY5H 1BA5A 2HKOA 3H9QA 5LFAA 2K85A 4R79A 2OTLI 1E3PA 2KFDA 4HBLA 4XOPA 5D8KB 2Y0SA 2EZLA 2P8TA 2EJRA 1JHFA 2HVQA 1QQIA 1T33A 1S7OA 5CPRB 4BGDA 2GXBA 3SJMA 2YU3A 3J81Z 3CMAI 1RKWA 2DOAA 3H36A 2V7FA 2CRGA 2VOPA 4XIDA 4BACA 4MEXF 5JR3A 4FX4A 2CW7A 2Z16A 5JFRA 1YJ9I 3K4JA 2VL8A 2VKHA 2YSRA 3H9JA 2P4WA 3DEWA 2V6EA 1UHSA 3V7SA 1UZCA 1FMWA 3K4NA 4BE1A 2QA4I 2XB0X 1RESA 3K70C 2ACJA 1BN5A 1SC7A 2D5VA 3ZOBA 4A0XA 1DGRM 1HKTA 4L0YB 4R1HA 4NC8A 2XF7A 5D5WB 1DP7P 2V79A 3FZVA 3DTKA 4YIRX 2Y69H 4XKBA 3HHHA 3ZQIA 1JUMA 4NC7A 1P4WA 3ZN1A 1T98A 4I02A 2FQ3A 1R23A 4BEHB 3ISPA 5L3CA 5L3FA 3AL0C 2QLZA 1MBFA 5J47A 1KU7A 4B48A 4A3DJ 2O5RA 3H0GJ 3MZYA 2VKVA 3JTGA 2LF8A 4L9VA 3QPLA 2CFOA 2DK5A 2R0QC 1ZG1A 2F5DA 2A6TA 4F92B 4L9JA 4RM3A 1B59A 1XMAA 2ZXWH 2X48A 1WGXA 1FMVA 3ABMH 4NBQA 4XOTA 3QQAA 1N75A 2GAUA 1LB2A 2DLLA 4II2A 3LSHA 2HTJA 1R58A 2RC4A 4NNJA 2PMZA 4KMFA 1YX5A 2WA0A 3K69A 4D7NA 4A5MA 1YE9A 2STWA 3QOPA 3WU0A 1QVUA 1YJWI 4LB5A 4Y15A 4U88A 1QZYA 4BXXJ 1IG7A 2YUSA 4CCNA 4E7IA 4D9JA 1S6LA 3BR5A 1DQUA 3OYIA 2F5CA 3RQIA 3F23A 3CMYA 1GV2A 2CQQA 2L0KA 2XPUA 1WRJA 3K4LA 1H8AC 1FC3A 3GBGA 2M3AA 2O9LA 3BZKA 3GFJA 4XONA 2X6WA 1BBYA 4AM3A 3GO5A 4IF4A 1LFBA 2HWVA 5K1YA 2DQRA 3IKTA 4IRHA 3OSGA 5HNFA 3ZQLA 3AG1H 4UV9A 4HF1A 1UAAA 2H94A 2LD5A 3GYHX 2NXNB 2JZYA 2EB7A 2FA5A 1RZ4A 2MSYA 3I59A 5LHGA 1IDYA 2L9RA 2BHYA 2AQFA 4IZZA 2EV0A 2F5VA 4KMUX 2EFQA 4UUTA 2R5YB 1O3SA 4U0WA 4OWRB 2ETHA 3GF2A 3HRSA 2RQQA 2H8RA 1HCRA 3PIPF 3OS2A 1YW8A 3DXJF 3ROUA 4L18B 3B73A 2R7VA 3R0AA 1FLIA 1S3JA 2W57A 1YITI 2MC3A 3U1DA 2LREA 5H2FC 1PUFB 1P7JA 3O6BB 1K6YA 2LG4A 1U8RA 1K79A 3CJNA 4A3EJ 2Y31A 2CG4A 2DODA 3P9IA 5EJCA 4QTRA 1TNTA 2C6YA 4QSHA 2VQLA 4OIRF 4B44A 1TC3C 3HOWJ 3F9KA 4I0BA 2VE8A 2VJIA 1E17A 3OIQA 1IRFA 1D0ZA 1IN5A 1LDDA 4C3HJ 2PMHA 2ZMEA 1WH5A 3B6CA 3DU6A 3GWZA 3JW4A 3HUGA 4BL0B 1H9TA 4V2FA 1LFUP 1XCBA 1JTXA 1SMYF 2HQ5A 4QPOA 2FBIA 2M7AA 3K1NA 5DYMA 3Q0VA 1Q1HA 5IP6A 2KPMA 3A01B 2B63J 4M72A 3I58A 2ZXIA 2LBFA 1SD6A 3OIOA 4FT8A 4BS9A 2CQ7A 2KDZA 2J5PA 2XHKA 5BQTA 1DPRA 2PEXA 3HSFA 1R22A 2D2WA 2KLOA 2K9MA 3F8NA 1R4NB 1W36C 2JMWA 3GUDA 3RPQA 3DPTA 2FMLA 1S7AA 3GZ5A 3BOQA 1N78A 1ZTRA 2LVSA 2VB6A 1D0YA 1VQ9I 1ZHFA 4BY1J 3A03A 4LLNA 1K61A 3O8GA 3J7AY 1XC5A 4BE2A 5JI6A 1FOWA 3HOYJ 1CQTA 1V5EA 2CMPA 1XG1A 1XMXA 2VPRA 2XIGA 5FFZA 4QIWN 1G8XA 2KJBA 3VOEA 4A3FJ 4KFCA 2KIMA 3M07A 3ASOH 3VB2A 1N25A 2M0CA 4Y7NJ 1I1SA 5LRSA 1AHDP 1HA8A 5J6XA 4XRSG 4C2MJ 1WKMA 1Z1DA 2Z33A 2VE9A 1QNTA 3EQLF 1UMQA 2JRTA 1USSA 2CYYA 1Z91A 2O3FA 2LKXA 1SMTA 1STZA 1KONA 5CKTA 4RB1A 2VC0A 2IJLA 3I53A 3TW7A 4JX4A 5HLHA 3A0HC 3UNGC 2M9HA 3HDDA 4MHGA 3OYLA 3LSPA 2GA1A 2PI0A 2PJRB 2MLKA 4N0BA 1LJ9A 4OU0A 2EPFA 1F36A 4DJAA 3IV5A 4EQQA 2XF5A 1ZRCA 4CHUA 2EV5A 3K70D 2IS1A 1R6RA 1MMNA 2DK8A 3GZ6A 5FRNA 2HQAA 3OYFA 3L2RA 4BHPA 4KYWA 1QHHD 2BXYA 4AIDA 2E60A 4AUXA 4LMYA 4RB3C 1HDDC 1R71A 3A4CA 5CVJA 2J5OA 2COBA 2VLAA 1HOMA 1CGPA 1R00A 1YRNB 1SFEA 1ETVA 5L3EA 5IOZA 1E2XA 3PUBA 3CCJI 2YR2A 2Y0SN 5HS9A 2D1VA 4LG0B 1IW7F 1KQ8A 4DW6A 3S2WA 2Q2EA 1JKOC 2GBYA 2W4SA 4F3QA 2GLOA 1D8KA 2HU9A 1K4SA 4YFXF 3RPUA 1QZEA 5FO5A 1X1AA 3BJAA 4UV8A 2JA8J 3LA2A 3SYTA 4W1UA 5GAGJ 3LOCA 3F6VA 1GT0C 3CCSI 1OYIA 2X1CA 5DCMB 3TEDA 1ZG5A 1Y8RB 3TDUC 3CJRB 4B4CA 1OPCA 1ZLJA 3GEZA 2BEOA 4UXNA 2VT3A 3ZQHA 1K7AA 5LEJA 4E70A 3AFHA 3JTHA 2DDAA 2NVUB 2JA6J 3CDIA 3FKJA 1V5FA 2PBIA 4J00A 3GCMA 1SANA 3BC8A 4HQEA 2EA2A 3MQ0A 4XLCA 3WTTC 1Z3YA 1FZPB 4ENMA 3FXQA 1TQPA 4LK0F 3DCFA 4BEHA 2ELKA 2QCOA 2DOFA 2K4JA 4BYYA 2QYOA 3KLNA 1VQ8I 4MQVA 4XORA 3PFIA 4LD5A 9ANTA 4A3MJ 4HX4A 1JUPA 3GFIA 3HPGA 2CQNA 2ZB9A 1D1AA 4EJWA 2E7XA 2K02A 5LGUA 3NWSA 4HV5A 3PO2J 3ZR8X 2XUBA 2E1NA 5JVGF 2XGDA 1G3WA 1S5LC 1ZGJA 3T5XA 3QP5A 4G7OF 1A35A 1BJAA 4Y33A 1MJBA 3LWFA 3FIWA 2LRDA 2D1HA 2FBKA 2R7TA 4CCLA 2DJNA 1QHGA 1MBEA 2E71A 3I5UA 2MLGA 2CUEA 2CV1A 5JLXA 4ZTFA 2VODA 1WWXA 3DTIA 3SHFA 3HL2A 3DLLF 1KYWA 1YIJI 4O6JA 2RKHA 4IHWA 5E1XA 1S72I 3TW6A 1AOYA 1ZKGA 2VBWA 1D1BA 4IKFA 2AXLA 4UVCA 2FUG2 2GWRA 1FY7A 3F8BA 4CYCB 3ULQB 2X6XA 4RGUA 2KZGA 3L00A 3HHGA 5ICEA 4QWQA 3RYRA 4PK4A 5CVVA 2CQKA 3I64A 2Y9YA 5BS6A 1O7LA 1UCRA 3H5AA 5H6RA 2R7XA 3VSLA 4BBRJ 4EM1A 1MBGA 5ILUA 5CLSA 2H6BA 3L7WA 3U1KA 5KNLA 2L2OA 4XKWA 1ZRFA 1SAUA 3R4KA 5DV5A 3OYKA 1WFXA 2PX9A 2W84A 3V8JA 2COMA 3KZYA 4FE4A 1MW7A 1YHQI 4M9ZA 2V4JC 3ABKH 4XBFA 5TJJA 3HM5A 1F1ZA 5IYBJ 3BTIA 2ME6A 5M5YJ 3BCAA 2HVRA 4AU7A 4KA4A 2HQRA 2DU9A 2EINH 2OCEA 5EGOA 3G2BA 4RGSA 3FWEA 1FSHA 2LK2A 2JSCA 2A07F 2O8XA 3CCYA 4XSXF 4PFPA 3B6AA 3BPXA 2R7DA 1GDTA 2HS5A 3S3MA 4F91B 4CGZA 3OMYA 3WGHA 4F55A 4AD9A 4FETA 3KP6A 3WTSC 3JR9A 1F43A 1IXSB 4M3FA 3HUGB 2R7FA 3JRCA 4ENKA 1TL8A 3GTMJ 3RTRA 3E1SA 2EFNA 3SZTA 5HVQC 2JT1A 1JXSA 1R5GA 3CTAA 4MTDA 2ZO4A 5E8IA 3WGGA 1U9OA 3VYSB 3E6BA 3WHCA 4IHTA 3UR3C 1BR1A 4S0HB 4HLYA 1MMSA 2LBFB 2ZCWA 3GFLA 1CF7B 1UB9A 2O7OA 2H09A 1RC9A 1O7FA 2GXAA 3QODA 3A01A 1ZARA 4W97A 1BIAA 3K4BA 5DEQA 3PM1A 3EPZA 4FX0A 1AKHB 5CQGA 4XICA 1ZAOA 1GHCA 2Q0OA 2WAFA 3QU3A 2M0MA 3QWLA 1Y0NA 2P81A 3I4MJ 2HYGD 5CVUA 2OU2A 3IAM2 1DP3A 3FMQA 2CV2A 1Q1VA 2EZHA 4M3GA 2YU9J 4JBAA 2B0LA 1ZREA 2EZIA 4OIOF 2AS5F 4ZYDA 2CJJA 2OV7A 2X4HA 1K83J 1G6NA 2H27A 2LMDA 3J80K 3HOUJ 1WJFA 1MD0A 1J9IA 1JUSA 5DUIA 2RDPA 2ZXHA 1BI0A 2XV4S 2KISA 2V26A 1W7PD 2XKPA 4U0YA 1T39A 4NQWB 4UB6C 2LLKA 1UG0A 3MKLA 4DQ2A 4YFKF 2H1KA 3ZGKA 1ETWA 2HGCA 1N77A 3OOPA 3TGNA 4F93B 3C7JA 2GXGA 1YG2A 5ILSA 1PYVA 3TO6A 4FCYA 1RRJA 3K4MA 1TWFJ 2L9NA 2X85A 4IEJA 1VQ4I 4PZJA 2DYSH 1T0FA 3HJEA 1IJWC 2PJPA 4V19K 2GIVA 2IA0A 2ZJPF 3EUHC 3OR1C 4XK4A 3PSIA 5GAHJ 1LDJA 2HXOA 4PJJA 2ZJQF 2D45A 3W2WA 5FKLA 1EA3A 4ZTJA 1WSUA 4DBQA 1BI3A 4UVAA 2VQGA 2WC2A 2KRCA 4LB6B 2ECCA 4LK1F 4A3CJ 2R7OA 4LJZF 3IH4A 2PJRA 2WY8Q 3GZNB 4GDFA 2TDXA 5DS9A 1USTA 3WTYC 4MFDA 2OF7A 3BR1A 3C2BA 5H20A 5J1RA 4RAZA 4XKCA 2M4GA 1ZK8A 3G3ZA 2L9VA 1UG2A 1YW9A 4G9YA 1U8BA 1VQKI 3HTSB 5EG0B 2RNJA 3C18A 2VI6A 2CO5A 3KEYA 1ZGAA 1MKMA 4AIHA 3TL4X 2ZJ2A 1QPIA 2LF7A 2L02A 3OL3A 4YEJA 1YTYA 1LQ1A 5L3DA 2DFFA 4E7HA 4ON0A 3GW2A 4ZDLA 1KZHA 3HBLA 4ZDOA 3C2HA 4O3MA 2Q2EB 1B8IB 2H6CA 3JCUC 4LOCA 4D7MA 3ABLH 3F21A 2DMPA 2Z9OA 2NOGA 3IHUA 2L9SA 5A2QZ 1YRNA 1BR4A 2NVTJ 3X2QH 2NNNA 1ENHA 3K10A 4HDVA 4LG0A 4ZYAA 4ABZA 2Y0MA 4R8HA 2KL4A 3OYHA 5FB2A 2LY2A 5HDNA 1RKTA 2OBPA 4A3LJ 1I39A 5AIPA 4XQFA 4Z6YA 1W0UA 1TP4A 2FSWA 3VYUB 3GTLJ 2BOLA 3IH3A 2LY1A 4KUMA 3M1CA 4UUSB 4MNUA 2A68F 2FD5A 4GO1A 1HSJA 2KJCA 2OJED 3HKZA 3IP4B 3Q9SA 4XN3A 5DCMA 5F08A 4FISA 4XRFA 3WU2C 2R92J 1YJNI 2MH9A 2VN2A 2VUMJ 3CESA 3WGIA 1WJEA 1Y6IA 3M7GA 1MBKA 2L7MP 2JA2A 1QZZA 2ELJA 2QSFX 2QWWA 3BG3A 1OKRA 2DA1A 1EV7A 4DGWB 4BE0A 4NUBA 3NQOA 1LDKB 2KT0A 3DKXA 4CXFA 2FF4A 4I0AA 2IVMA 3TMOA 3LNQA 2CUZA 4QPQA 4PSXA 2V1XA 5EEGA 5HNHA 1D0XA 2KRHA 3GX4X 4OAYA 1OISA 2IGKA 4EM0B 5DD4A 1T08B 4RAYA 3LSRA 3ML6A 4FE7A 1LPQA 2L7KA 2DBBA 2WV1A 4RDUA 2FRHA 2BXZA 3WU1B 5E18F 4XLEA 1SD5A 3FM3A 3F3XA 2QBYA 3CP8A 1JKRC 5F1RA 1IUFA 1OMIA 2WTEA 3DEEA 4IRIA 3FF5A 2XGEA 5E20A 1HF0A 2XVCA 3IRQA 2DTZA 2F5FA 5TGTA 2DTRA 1T8IA 1J75A 1ETKA 1A04A 4N4NB 3VEPA 6PAXA 1D5YA 5CVIA 1HW1A 2VJJA 2HR3A 2HPIA 2ESHA 3HGYA 3GVAA 3ONQA 3SZPA 1EF4A 2CW0F 3E7LA 3RZOJ 2M8GX 3ZMUA 3F72A 1XGMA 2QQ9A 1QA6A 3K7AJ 1GXQA 3P5JA 4KITB 3EETA 3PNVA 1JT0A 2XPWA 4C3JJ 4IQJA 2OZ6A 3CF5F 2MGQA 4CYCA 4N9IA 4EEFG 5K5RA 4G7HF 1K78A 2A61A 1PP8F 1LUJB 5EDNA 1R9TJ 1B9NA 1GV5A 2RQPA 2VIXA 1O3QA 1FOXA 2ZNZA 3L9FA 1VFCA 4S04A 1V3FA 2JVGA 3CCQI 2O6GE 2JA7J 1XX5A 5KVRA 3M1EA 3N05A 3R60A 1XN7A 1V5GA 4P55A 1V54H 4B3AA 1IRXA 3OS1A 4DBRA 4CCKA 3K9TA 3CD6I 1KQ9A 3VWBA 5EGOB 4A69C 2W48A 5HLTA 4P9UA 2X9DA 3G4SI 4A0YA 2IXSA 1FJLA 2KQRA 4RGXA 1LKXA 1S29A 4GCVA 1MJ9A 3ZQGA 5L3BA 5IP7J 1XDUA 2AHQA 4HSTA 1XSXA 1B6AA 3Q3SA 3HIFA 1R1UA 2N8GA 2VONA 2JQ7A 1XS9A 3OYDA 3FXOA 3CJQB 5F0CA 3BR0A 5GADJ 2QKMB 3K2ZA 4A3GJ 1JKQC 1OCRH 4XN0A 2GOMA 4G12A 3L2QA 1YS7A 3CJTB 2NVYJ 1U5TC 1DU6A 3JRGA 5C4XJ 1EH8A 4AWXB 1LEAA 1XGNA 4UB8C 4XR6A 1YLFA 5CVRA 3JAMK 3ZQCA 2DT5A 4KDPA 2BVMA 4AYBA 4IOAF 1VI0A 1OCTC 4HX7A 5D5UB 3SDGA 2JN6A 4RS8A 5IOYA 1JJ6C 3ZQ7A 2XSJC 4ESJA 1O57A 2CUFA 3REOA 2RVCA 5DDGA 3TBIA 1NHAA 2EIKH 1JGGA 5BPDA 1WI9A 1G59A 2UXNA 1SAXA 2G9WA 1CF7A 5LHHA 4ZYEA 3AL0B 1YS6A 5B66C 1FT9A 4LIUA 1QBJA 4XM3A 1J09A 3CDHA 2H8WA 1DGWY 1IF1A 2MC4A 4G6DA 5EYRA 3BG7A 1AKHA 2E35A 1A6IA 1P4AA 4Y13A 3IWZA 3K4CA 4P5OA 1TQIA 4D1QA 3K4KA 3MD2A 3KCCA 3HRTA 3COAC 2LFBA 1VTNC 2FBHA 3T8TA 4IHYA 1QGPA 5LEKA 1ZRDA 3MVPA 4G94A 5LHIA 2WADA 3P9KA 4ETSA 1LE8B 1JTYA 2G0EA 1OYYA 2HYFA 2E19A 5TISC 1WHUA 2R7RA 2A6HF 2NVQJ 1WZ2A 4MEYF 3HOVJ 2DA4A 3HEFA 3QOEA 4UVBA 2Y75A 5D5XB 4A3BJ 1OYWA 1U6GA 2DPDA 3H35A 4II3A 3TP0A 2LDUA 5B1BH 5JHUA 3JSPA 2WWYA 1SFKA 1TLHB 2VBZA 4ENNA 4PUSA 3DKWA 4NQWA 5ERIA 4PJMA 1MDMB 3DTEA 4WCGA 4KICA 2K7LA 2FOWA 3MFKA 2JVHA 1TBXA 2A6EF 3OYCA 5GPCA 3WE3A 2YS9A 5HLIA 3LQQA 5F6FA 2MA3A 2FEZA 1JI8A 2OC6A 3AG4H 1XGOA 2HFHA 1WH7A 2P6SA 1NG6A 3RCOA 3J80Z 2EV6A 3DU5A 3Q9VA 2DMTA 3ZMVA 5A2QK 4A6DA 3RKQA 4M6YA 2E5ZA 4XRSA 2QZ8A 3MEXA 2DT6A 1RETA 3F0CA 2X0LA 3CC7I 5IP9J 3S8PA 1IUYA 1J0RA 4OMYA 5K5QA 4BAYA 1R36A 4RB0A 3ASNH 2QQAA 1FOYA 5BNGA 2XGXA 2DO7A 1FIPA 3LQRA 1GVJA 2OD5A 2X1EA 1B4AA 2F48A 4P1WA 3EUKL 5EG0A 2FQ4A 5F0FA 2VXDA 4MTEA 1WVRA 3FDYA 3D1NI 5J1YA 4HNTA 5F0HA 1SD4A 1VQ6I 3GTQJ 4HQMA 1UHMA 2BY0A 1FWZA 2TCTA 3BWGA 1KA8A 3NAUA 4KIGA 2K9NA 4I7HA 2MW8A 3E97A 3DWLE 1ETYA 3CCRI 3H0DA 3BP8A 4HAMA 4XMYA 1T6SA 3LSMA 1B8IA 1TT0A 4DYRA 3DF8A 4PJLA 4DIQA 3WG9A 2UWMA 2QUFA 2E1MC 2DFEA 2AO9A 3KEQA 2X6YA 1MMAA 3E6DA 3M9AA 4L5JA 4Q4ZF 3FXUA 4ZZLA 1ZYRF 3J7YJ 2JRMA 2HXIA 1U5TB 2FNAA 1B72B 3K2AA 1HKQA 1TNSA 5LGTA 2A69F 2R7UA 2MYSA 4Y4RA 2BW3B 3BLYA 1B1BA 1Z77A 1TQMA 4CH7A 4UUSA 1JJ8C 2UUZA 2XPVA 3S1MJ 3A02A 2F2EA 1QU3A 4FQGA 2ZXJA 4E7ZA 2VJ5A 2ZMEC 3HKZN 1YFHA 2DPUA 1X19A 5ICCA 2DDBA 5IT9K 1KGSA 3KZZA 2FU4A 3RYPA 1U9NA 2WAQA 1TWCJ 1HQCA 1DU0A 3OYBA 4Q48A 1RI7A 4ZZDA 1FYKA 1FBQA 5M5XJ 4E4HA 2QSHX 1VQMI 1BC8C 3RZDJ 3JRFA 3AKZA 2MABA 2OZUA 3HZJA 2ISZA 1X1PA 1KQ0A 2QBYB 5LBQA 3ZN0A 3SFZA 3BCBA 3ZMTA 4BUPA 3UKGA 2JUCA 2VBXA 5K7ZA 4A3JJ 1ZLKA 3L2UA 3HOXJ 3V8KA 1D1CA 3E5XA 1NK3P 2KRFA 4HG2A 2H1LA 3QYEA 4E7LA 4B3XA 3WE2A 2IBDA 5HS8A 2PMZN 2W25A 3V7CA 2EWNA 2I8DA 4IVNA 2IGOA 5K7HA 3LAJA 2P5KA 3G1MA 2KHMA 3H1CA 3F8FA 2DMNA 2MD0A 4M3EA 4NB5A 2EZKA 4OMZA 3HXLA 2EFPA 3WTWC 4DZJA 1RR7A 1BL0A 1Y1WJ 2BV6A 3J7AO 5B1AH 1K78B 2R93J 4BU2A 4E6KG 2BYVE 3EUHA 4HSRA 4EATA 3WTUC 3CCUI 1OR7A 2M8EA 3WODF 3CLQA 1X1DA 4XLHA 2VASA 5CYVA 1SFOJ 3AG2H 4EGYA 1SVMA 1T2KA 2DN0A 1R5HA 2ZJRF 1WJCA 4PCQA 1YOVB 1W7PB 2I5UA 3PSFA 2OUMA 3LMMA 1ITYA 2XGCA 2RN7A 1R1VA 4U87A 2BZTA 4RAFA 2G7UA 2XKOA 3TOBA 1X1CA 3G71I 2XAGA 4HEA2 4YELA 1VQ7I 5L3GA 4CO8A 1R4MB 2VC1A 1PVEA 2K3PA 3U2RA 2NS0A 3BTCA 1IN6A 5FKMA 4I99C 2IEKA 2Z2SB 3GMEA 3I9V2 3N97A 1JT6A 3BR3A 3QPTA 1MNMC 4KNYA 2ICWG 2V9VA 3M8JA 3KX2A 1R5ID 3Q0WA 4ZYGA 2E1MB 3CP2A 4UNOA 4OAZA 3E6MA 4H0EA 2PN6A 1NK2P 3F6OA 4KT5C 4ASNA 3JRHA 2GOXB 5FLMJ 2RNGA 3W6KB 4EV0A 1YO5C 3W2VA 1WPKA 2YPRA 2Z5UA 3KP4A 4AC0A 1VF9A 2ISYA 4BXFA 3CO7C 1FTTA 3WHBA 2JWTA 4Y3OA 3CUQC 3QPSA 1LNWA 2B7EA 1X2NA 2R7QA 1GUUA 3LSTA 4IHSA 4G8XA 3F8MA 5GTHC 4A2UA 1KYZA 4CZCA 2Y9ZA 4DZPA 3MMYB 4OIQF 2OTJI 3I55I 2LP0A 4L5EA 3DKYA 4KN4X 4BHBA 5K5OA 2XAQA 2FX0A 3VYRB 1HLVA 1VQ5I 4XLPF 3JRIA 4RLQA 3M8FA 3BR6A 2FXAA 4IJAA 4BDZA 3M4OJ 3HOZJ 3BT9A 5KK1A 1RR8C 1Z0XA 3D0SA 4RAGA 2R3SA 2DA6A 3DQVC 3KETA 4OIPF 2LR8A 5AIQA 3JAMZ 4LGWA 3KFWX 1F5TA 2QEXI 3BZCA 2IA2A 2K9SA 2QKLB 4KJZA 4EJVA 3LAPA 1HDPA 3HSRA 4YIIA 4BJ6C 1RNLA 4E7KA 1U2WA 2LC2A 5C44J 3MCZA 4IHVA 1MSFC 2DFIA 3L2WA 5F1JA 3ZMSA 2HKXA 1ACIA 4H4KC 3JREA 1LE8A 1H9GA 1HSTA 5ICFA 1IDZA 3FXKA 2XAJA 4BH9A 1K4TA 1SD7A 4I98B 2GIZA 4KN7X 2W24A 4EJOA 1A5JA 1Z21A 3BR2A 4CZZA 1YW7A 1POGA 2F5EA 2V1DA 1QO0D 1NG7A 4WF2A 3IH2A 2BHZA 3I4PA 4MO7A 5BOXA 2IPQX 2MFZA 1MJAA 5DD8A 1U0JA 2CV0A 2F4IA 2KKOA 1AA7A 1Z3XA 3DP7A 1MDMA 2IA1A 3W3CA 1UJ8A 2KDOA 1UELB 5J4YA 3FXJA 4IOCF 2CQXA 3NARA 3CCVI 4IXAA 2STTA 3B02A 4CDGA 3ZRGA 3RI4A 1R1TA 4U0VA 3TOAA 4Z2YA 1W4MA 4CYDA 1S7EA 3IKVA 5HODA 2OPTA 5GP9A 5FD6A 3LSGA 1MBJA 1HBXG 1I6HJ 3PL8A 5D4SA 3OYAA 1J59A 4JOMA 3BQYA 2CFXA 3TDZC 3RDIA 5IYCJ 3C2GA 4ITVA 4LG3A 2ZFUA 1XTAA 4B43A 5ED4A 3F8CA 1FP2A 4EVIA 4HDUA 1YQAA 2A5YB 2TRTA 1L0OC 1IXRC 1Z6RA 2FNPA 2ESNA 3HTUA 3JSOA 3R61A 5CQEA 2GA2A 1Y39A 3RIRA 1BW5A 5DM7F 3WTXC 2JPBA 4X0GA 1FYMA 1ETQA 1SVLA 3QRFF 3JRAA 1X2MA 5B5EC 1TZLA 2IP2A 4RM2A 1W0TA 3SEQA 4YRVA 2XROA 1ZQ3P 2QSGX 3LSIA 2VXZA 3ECHA 2E1OA 3O3KA 4ANJA 1OCCH 4EM2A 1X58A 5LGNA 2QM3A 1YIOA 2O03A 2EIMH 1S9HA 4YG2F 3KYDB 1HKSA 3QAHA 3KP5A 4RLFA 1GLNA 4N9HA 1AU7A 2JA5J 4GXOA 4HNVA 5D5VB 2VPLA 2K5CA 1FYLA 4DYCA 4U7BA 4MQ9F 2CW8A 2DA2A 3BY6A 3K1PA 4YFNF 4GRIA 3I56I 4RA2A 1YX3A 2MD5A 2K4BA 3OWTA 5JVTA 4A3IJ 4I2OA 3SZGA 1U5TA 2A05A 2DT7B 4E7JA 1B72A 3S17J 4PJNA 4X6AJ 3CUQB 4PJ0C 4C2TA 3S2DJ 1WI3A 3WTVC 2HOSA 3PO3J 3MKZA 5FLXK 2BW3A 4HOBA 4NC6A 1A6QA 4RBOA 2GM4A 4F52A 3MWMA 4MIMA 1GVDA 2VT2A 2ZSHB 5GAEJ 5IPAA 4PGGA 3OR2C 3S15J 4BHCA 1Y1VJ 1IN4A 3PFYA 2XRNA 3FXMA 1BI2A 3WTZA 2QENA 2F4MB 2K9QA 1LFPA 2EIJH 1MIJA 2M4KA 3E5QA 4M6VA 2WAQN 4WX9A 3S2HJ 1TWHJ 2IW5A 3DBLB 1PUEE 3QYBA 4JQFA 4X1EA 4MLOA 3T1BA 4I6ZA 1XSDA 1QRYA 2W00A 1X4PA 4M9XA 4BQOA 5BMZA 1VQNI 5AONA 2RV8A 3QU6A 4RGRA 2DAOA 2LKSA 2JJ7A 2NAZA 1T56A 2M7BA 2V6CA 3EDPA 2O61A 1MH4A 3VDXA 1U3EM 2IS4A 1LVKA 2EA4A 3KLOA 3CCEI 5IT9Z 3FKIJ 4ESBA 4HLXA 1MNEA 2OA4A 5JHFA 4WK8F 5M5WJ 5D6FA 4XL9A 5GPAA 4IX7A 3J7ZI 2F4OB 3SFIA 1SFXA 2X1DA 1P4XA 5FFXA 1XD7A 2LKPA 4EMSA 3T8RA 2XAFA 3CMEI 2BY1A 2HZTA 2KZVA 5TRDA 4BQNA 1G4DA 2R4GA 2UZKA 2R7ZJ 4GYGA 3OY9A 2W1OA 4C9YA 2ID3A 1Y8QB 3GLXA 2IS2A 2GZWA 1H0MA 4GGGA 1LVAA 4Y17A 2P7CB 3MN2A 3ERMA 1ETOA 1T0FC 1HW5A 4L5IA 2KIQA 2LY9A 2PMUA 3E0JB 4M74A 1TWGJ 5B3SH 3GTPJ 2DA3A 4EGZA 3GFMA 1MNDA 3G1LA 3KP7A 3MZ8A 3KYLA 5CJ9A 2UV1A 2JUGA 2E5NA 2Z1DA 4HPQA 2Y48A 4BXUA 3W2AA 1D8JA 3PNTA 1F9NA 2AQEA 3IL2A 1OQYA 3KZIC 3RPUD 2QGUA 4J01A 4Y52J 5J3LA 2HI3A 1W7PA 2NS7A 2YX4A 4N4OB 4U7DA 2ME0A 2JSPA 2K40A 3ESWB 1MBHA 1T38A 2IGMA 2MH2A 3BZ6A 3A0BC 4JP0A 3LL7A 2ADUA 2BY2A 2DW4A 4I76A 2Q8KA 1EH7A 3V7RA 3ERED 4A0ZA 5F64A 3OS0A 4ZJZA 1J2XA 3LSJA 3ECOA 4LITA 4L9TA 2QQ8A 3JRBA 1ON2A 2AXTC 1WCMJ 1FSEA 2ELHA 5HDGA 5J8CA 3TO7A 2W82A 3G73A 1XDSA 4A3KJ 3ZMZA 5EEHA 5EEAA 3TO9A 3NRVA 3C1DA 3OYEA 1MMGA 2WY7Q 3D5RC 3S1RJ 1ZGWA 2DYRH 3HG9A 2DI3A 5J40A 1BM9A 5E17F 5FROA 2HZDA 3OL4A 5C3EJ 3GTKJ 4Q5SF 5DM6F 5FKOA 3HOSA 3ZMDA 4PDKA 3NEUA 1DPUA 3QPHA 4BKXA 1TTYA 1X1BA 3FX3A 5FRMA 4QLCU 3S16J 1RUOA 1IV8A 4G6QA 5IYDJ 3ZQQA 5J4VA 2X6OA 4D0PA 2ECBA 2UXXA 3LA7A 1B9MA 3QP6A 4CCJA 2M2EA 2BBYA 1I5ZA 3S3OA 1ETXA 5ICGA 5HDKA 1ULYA 1WJBA 3IUOA 3OSFA 3ZQFA 4A6EA 4WXDA 5FKNA 3KIOA 1WJDA 1FNNA 3L09A 3KPHA 4BJ5C 4P96A 4M73A 4GYIA 2CWEA 3FK7A 1SFUA 3HSEA 3HGGA 4I01A 2DMUA 3LFKA 3TP3A 2OCCH 3DV8A 3GXOA 1TWAJ 1I3AA 1IN8A 2A5WA 3KYCB 2OAZA 1J7KA 1G3TA 1MZBA 1TW2A 2M1BA 2VKEA 1OCPA 2P5LC 3FMRA 1TT5B 2WB1A 1ZH5A 1FOKA 3V8LA 2G7HA 3IAS2 1EH6A 3H3ZA 1R49A 1IXCA 2FMYA 5DTDA 3G6EI 5J1UA 2XAUA 4A5NA 3FXLA 3W6VA 1VZ0A 3S32A 4XLFA 4XRMA 1PP7U 1ON1A 5E1WA 2L01A 1RUNA 2ZSIB 1A36A 2LYCA 3DFGA 3KEOA 2M87A 2XRLA 5FD5A 4ZDPA 2R5ZB 1IN7A 5ILVA 1I1GA 5E3MA 1APLC 3DPLC 4PSWA 2X51A 5FGMA 2RREA 3MZHA 4XKVA 4LLLA 1TW3A 2F6CA 2P6TA 3H92A 4B09A 4NDLA 5KAFC 2IGNA 3PUFA 4TV7A 1MH3A 3NWTA 3MKWB 3K0LA 3BG9A 2PQ8A 4UHTA 1X3UA 5DCFA 2IT0A 4EJTA 2L7FP 4M6XA 1FBUA 1O3RA 3HC7A 2LH9A 2OQGA 2DOEA 1ZN2A 2YX7A 3BPVA 2NVXJ 1UFMA 3K6GA 3BG6A 1EJ9A 5C4JJ 1D5VA 3R6SA 1P9QC 4JYKA 3KP3A 3HRUA
chains in the Genus database with same CATH topology
3OOUA 3ZQLA 5DS9A 4MFDA 2OF7A 3BR1A 3C2BA 5J1RA 2LD5A 1ITYA 1ZK8A 2XGCA 4MFEA 2M34A 1UG2A 2IAIA 1U8BA 2MSYA 1IDYA 2L9RA 3BQZA 5EG0B 2VI6A 5M3FJ 1BJZA 1QPIA 3S1NJ 4BBSJ 4UUTA 3BTCA 2R5YB 5FKMA 2IEKA 1JT6A 3BR3A 2H8RA 3HBLA 1MNMC 1HCRA 3GTOJ 1B8IB 4LOCA 5F04A 4D7MA 2DMPA 2NOGA 3Q0WA 3VPRA 1YRNA 1PUFB 4JX5A 2NVTJ 1IV6A 1ENHA 1P7JA 1NTCA 4ABZA 1NK2P 3JRHA 4A3EJ 5FLMJ 2Y31A 1RKTA 1MSEC 1WPKA 2MG4A 4A3LJ 4AC0A 1VF9A 4QTRA 3GTJJ 1W0UA 4QSHA 1FTTA 1TC3C 3WHBA 2JWTA 3GTLJ 3IH3A 3HOWJ 5JLWA 4UUSB 3QPSA 1X2NA 1OJLA 3FISA 1E3OC 1GUUA 2FD5A 4C3HJ 1WH5A 3B6CA 3G1OA 3JRDA 4V2FA 1LFUP 2R92J 5F08A 4FISA 3FK6A 2Y9ZA 2DMQA 2VUMJ 4DZPA 1JTXA 2HQ5A 2LP0A 1MBKA 4L5EA 2L7MP 3Q0VA 3BG3A 5IP6A 3A01B 2B63J 2DA1A 2FX0A 1HLVA 1I3QJ 3JRIA 3BR6A 3M4OJ 3HOZJ 3BT9A 2KT0A 3OIOA 3LNQA 1Z0XA 2KDZA 2DA6A 4M3DA 2LR8A 5FKKA 2JMWA 3LSRA 2K9SA 4FE7A 1HDPA 2QF7A 1ZTRA 2LVSA 2WV1A 4RDUA 5C44J 4IHVA 1MSFC 2I10A 5F1JA 1JKPC 4BY1J 3A03A 1JKRC 3JREA 1LE8A 1K61A 1IDZA 3O8GA 4GFBA 1IUFA 2E2JJ 1XC5A 2XGEA 1HF0A 3GTGJ 3HOYJ 1CQTA 3HB9A 2DTZA 1A5JA 1H89C 3BR2A 1XG1A 2VPRA 2LTPA 4QIWN 4A3FJ 1POGA 1ETKA 3H3VK 4DYQA 3IH2A 4Y7NJ 4MO7A 2M0CA 1AHDP 1D5YA 3S1QJ 4M3BA 4XRSG 4C2MJ 3HGYA 2O8KA 1EF4A 2DA5A 5M3MJ 3E7LA 2CQXA 3NARA 1UMQA 3CDLA 2Y2ZA 2M8GX 3RZOJ 4C3IJ 2LKXA 3K7AJ 3S14J 1S7EA 5HODA 2OPTA 1JT0A 2XPWA 3TW7A 4C3JJ 4JX4A 5GP9A 3LSGA 1MBJA 2M9HA 2MGQA 4CYCA 4EEFG 3HDDA 1I6HJ 3LSPA 3BQYA 3BTJA 5EDNA 1R9TJ 1GV5A 1H88C 2EH3A 5IYCJ 1VFCA 2JA7J 5F27A 3Q0UA 1O4XA 1F36A 3IV5A 4IHXA 2TRTA 4B3AA 4D5CA 2ID6A 2XSDC 2E2HJ 1BW5A 3M3YJ 5EGOB 4A69C 2W48A 2XB5A 1ETQA 2HDDA 2X9DA 1X2MA 3JRAA 5K7FA 1W0TA 4AUXA 1ZR4A 5FLVA 5E3LA 1FJLA 1ZQ3P 2RAEA 2Y30A 1HDDC 2E1OA 2COBA 3ZQGA 1X58A 5IP7J 5EZGA 2R5YA 1HOMA 1YRNB 1P7IA 2AHQA 1ETVA 3Q3SA 5IOZA 2N8GA 2HOTA 2Y0SN 3BTLA 1IGNA 4D5FA 1AU7A 4DW6A 1XS9A 2JA5J 4HNVA 2L7ZA 4DYCA 5F0CA 1JKOC 3BR0A 2GBYA 2DA2A 4A3GJ 2GLOA 1JKQC 3L1PA 1PUFA 4G12A 4A3IJ 2NVYJ 5FJ8J 1DU6A 3S17J 3JRGA 1B72A 2JA8J 5C4XJ 2HOAA 4X6AJ 4W1UA 3S2DJ 5E3NA 1VNDA 1WI3A 2NS8A 3LOCA 4AYBN 3ZQCA 1GT0C 2HOSA 3PO3J 1VI0A 1OCTC 1BW6A 3TEDA 3SDGA 4RBOA 2GM4A 2JN6A 1RPWA 4B1RA 5IOYA 4MIMA 4B4CA 1GVDA 5EZHA 1JJ6C 5IPAA 2CUFA 3ZQHA 1U78A 3S15J 2EBIA 1JGGA 1Y1VJ 1G2HA 2HYJA 2JA6J 1SANA 2K9QA 5E3OA 3DCFA 4M6VA 2ELKA 2WAQN 2QCOA 5EYRA 1AKHA 3S2HJ 1TWHJ 1A6IA 4X1EA 4MLOA 4I6ZA 1QRYA 1ORKA 9ANTA 2LFBA 4A3MJ 1JUPA 4IHYA 2DA7A 3MVPA 2FJ1A 1FTZA 2JJ7A 2ZB9A 1T56A 1LE8B 1FIAA 1JTYA 1MH4A 1FEXA 2G0EA 3PO2J 2E19A 4FTHA 2XGDA 5EF6A 2NVQJ 3FKIJ 3HOVJ 2DA4A 3HEFA 5M5WJ 3I4NJ 3BG5A 2WB1N 4A3BJ 1QVTA 5GPAA 3FIWA 3TP0A 3SFIA 2E2IJ 2DJNA 1IRZA 3O8HA 4J19A 3CQZJ 1MBEA 2R5ZA 2CUEA 4A93J 5JLXA 2EQRA 2R7ZJ 5GPCA 2ID3A 2YS9A 4IHWA 4V2GA 3TW6A 2CU7A 1ZKGA 3MN2A 1ETOA 4CYCB 1WH7A 2LY9A 4JX6A 1TWGJ 2DMTA 1ZR2A 2DA3A 3RKQA 3GTPJ 3G1LA 4XRSA 2Y9YA 4BBRJ 1RETA 3F0CA 1MBGA 4BY7J 5IP9J 1OFCX 4Y52J 5J3LA 1I50J 2HI3A 2NS7A 2ME0A 2K40A 1MBHA 5BNGA 1FIPA 1IC8A 4JP0A 4I76A 4FE4A 5EG0A 2FQ4A 2JK3A 5F0FA 3D1NI 5J1YA 3LSJA 5F0HA 3HM5A 3GTQJ 1BA5A 2TCTA 3JRBA 3NAUA 2K9NA 3BTIA 2ME6A 5IYBJ 2MW8A 1WCMJ 5M5YJ 5EGOA 1ETYA 2EZLA 4A3KJ 1B8IA 1T33A 4DYRA 5EEAA 2LK2A 3SJMA 3CCYA 2AO9A 3B6AA 3S1RJ 1GDTA 1ZGWA 1RKWA 2CRGA 4XIDA 2HXIA 3JR9A 1F43A 5C3EJ 1B72B 3GTKJ 4M3FA 3K2AA 3JRCA 5FKOA 3GTMJ 3DEWA 4BKXA 1UHSA 3S16J 1Z77A 4UUSA 5IYDJ 2XB0X 1JJ8C 1U9OA 1RESA 2XPVA 2D5VA 3WHCA 2X6OA 3ZOBA 3A02A 2ECBA 3S1MJ 4S0HB 2M2EA 3HKZN 1ETXA 3OSFA 2O7OA 3ZQFA 5FKNA 3ZQIA 1JUMA 3A01A 1U9NA 4W97A 1TWCJ 3FK7A 1DU0A 3PM1A 3HGGA 2DMUA 1AKHB 3TP3A 5M5XJ 4XICA 1MBFA 4A3DJ 3H0GJ 2VKVA 1TWAJ 3RZDJ 3JRFA 3QPLA 2P81A 2R0QC 3I4MJ 1Q1VA 1WGXA 2EZHA 2X48A 4M3GA 3UKGA 5K7ZA 4A3JJ 2EZIA 2YU9J 3HOXJ 3QQAA 2VKEA 1OCPA 1NK3P 2CJJA 1K83J 2IBDA 2PMZN 3HOUJ 1JUSA 5DTDA 4D7NA 5J1UA 5K7HA 3G1MA 3W6VA 4XRMA 1QVUA 2H1KA 2LLKA 3MKLA 2DMNA 1ETWA 4M3EA 2XRLA 2R5ZB 2EZKA 5E3MA 4FCYA 1IG7A 4BXXJ 2YUSA 1TWFJ 1APLC 4DZJA 1RR7A 4IEJA 1BL0A 1Y1WJ 3BR5A 1IJWC 3RQIA 3CMYA 2R93J 1GV2A 4NDLA 2CQQA 2L0KA 1MH3A 2XPUA 4XK4A 3BG9A 1H8AC 2HXOA 3GBGA 2O9LA 2L7FP 5FKLA 1SFOJ 2NVXJ 1LFBA 2ECCA 5C4JJ 4A3CJ 2DN0A 3IH4A 4JYKA 3OSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOU A;  3ZQL A;  5DS9 A;  4MFD A;  2OF7 A;  3BR1 A;  3C2B A;  5J1R A;  2LD5 A;  1ITY A;  1ZK8 A;  2XGC A;  4MFE A;  2M34 A;  1UG2 A;  2IAI A;  1U8B A;  2MSY A;  1IDY A;  2L9R A;  3BQZ A;  5EG0 B;  2VI6 A;  5M3F J;  1BJZ A;  1QPI A;  3S1N J;  4BBS J;  4UUT A;  3BTC A;  2R5Y B;  5FKM A;  2IEK A;  1JT6 A;  3BR3 A;  2H8R A;  3HBL A;  1MNM C;  1HCR A;  3GTO J;  1B8I B;  4LOC A;  5F04 A;  4D7M A;  2DMP A;  2NOG A;  3Q0W A;  3VPR A;  1YRN A;  1PUF B;  4JX5 A;  2NVT J;  1IV6 A;  1ENH A;  1P7J A;  1NTC A;  4ABZ A;  1NK2 P;  3JRH A;  4A3E J;  5FLM J;  2Y31 A;  1RKT A;  1MSE C;  1WPK A;  2MG4 A;  4A3L J;  4AC0 A;  1VF9 A;  4QTR A;  3GTJ J;  1W0U A;  4QSH A;  1FTT A;  1TC3 C;  3WHB A;  2JWT A;  3GTL J;  3IH3 A;  3HOW J;  5JLW A;  4UUS B;  3QPS A;  1X2N A;  1OJL A;  3FIS A;  1E3O C;  1GUU A;  2FD5 A;  4C3H J;  1WH5 A;  3B6C A;  3G1O A;  3JRD A;  4V2F A;  1LFU P;  2R92 J;  5F08 A;  4FIS A;  3FK6 A;  2Y9Z A;  2DMQ A;  2VUM J;  4DZP A;  1JTX A;  2HQ5 A;  2LP0 A;  1MBK A;  4L5E A;  2L7M P;  3Q0V A;  3BG3 A;  5IP6 A;  3A01 B;  2B63 J;  2DA1 A;  2FX0 A;  1HLV A;  1I3Q J;  3JRI A;  3BR6 A;  3M4O J;  3HOZ J;  3BT9 A;  2KT0 A;  3OIO A;  3LNQ A;  1Z0X A;  2KDZ A;  2DA6 A;  4M3D A;  2LR8 A;  5FKK A;  2JMW A;  3LSR A;  2K9S A;  4FE7 A;  1HDP A;  2QF7 A;  1ZTR A;  2LVS A;  2WV1 A;  4RDU A;  5C44 J;  4IHV A;  1MSF C;  2I10 A;  5F1J A;  1JKP C;  4BY1 J;  3A03 A;  1JKR C;  3JRE A;  1LE8 A;  1K61 A;  1IDZ A;  3O8G A;  4GFB A;  1IUF A;  2E2J J;  1XC5 A;  2XGE A;  1HF0 A;  3GTG J;  3HOY J;  1CQT A;  3HB9 A;  2DTZ A;  1A5J A;  1H89 C;  3BR2 A;  1XG1 A;  2VPR A;  2LTP A;  4QIW N;  4A3F J;  1POG A;  1ETK A;  3H3V K;  4DYQ A;  3IH2 A;  4Y7N J;  4MO7 A;  2M0C A;  1AHD P;  1D5Y A;  3S1Q J;  4M3B A;  4XRS G;  4C2M J;  3HGY A;  2O8K A;  1EF4 A;  2DA5 A;  5M3M J;  3E7L A;  2CQX A;  3NAR A;  1UMQ A;  3CDL A;  2Y2Z A;  2M8G X;  3RZO J;  4C3I J;  2LKX A;  3K7A J;  3S14 J;  1S7E A;  5HOD A;  2OPT A;  1JT0 A;  2XPW A;  3TW7 A;  4C3J J;  4JX4 A;  5GP9 A;  3LSG A;  1MBJ A;  2M9H A;  2MGQ A;  4CYC A;  4EEF G;  3HDD A;  1I6H J;  3LSP A;  3BQY A;  3BTJ A;  5EDN A;  1R9T J;  1GV5 A;  1H88 C;  2EH3 A;  5IYC J;  1VFC A;  2JA7 J;  5F27 A;  3Q0U A;  1O4X A;  1F36 A;  3IV5 A;  4IHX A;  2TRT A;  4B3A A;  4D5C A;  2ID6 A;  2XSD C;  2E2H J;  1BW5 A;  3M3Y J;  5EGO B;  4A69 C;  2W48 A;  2XB5 A;  1ETQ A;  2HDD A;  2X9D A;  1X2M A;  3JRA A;  5K7F A;  1W0T A;  4AUX A;  1ZR4 A;  5FLV A;  5E3L A;  1FJL A;  1ZQ3 P;  2RAE A;  2Y30 A;  1HDD C;  2E1O A;  2COB A;  3ZQG A;  1X58 A;  5IP7 J;  5EZG A;  2R5Y A;  1HOM A;  1YRN B;  1P7I A;  2AHQ A;  1ETV A;  3Q3S A;  5IOZ A;  2N8G A;  2HOT A;  2Y0S N;  3BTL A;  1IGN A;  4D5F A;  1AU7 A;  4DW6 A;  1XS9 A;  2JA5 J;  4HNV A;  2L7Z A;  4DYC A;  5F0C A;  1JKO C;  3BR0 A;  2GBY A;  2DA2 A;  4A3G J;  2GLO A;  1JKQ C;  3L1P A;  1PUF A;  4G12 A;  4A3I J;  2NVY J;  5FJ8 J;  1DU6 A;  3S17 J;  3JRG A;  1B72 A;  2JA8 J;  5C4X J;  2HOA A;  4X6A J;  4W1U A;  3S2D J;  5E3N A;  1VND A;  1WI3 A;  2NS8 A;  3LOC A;  4AYB N;  3ZQC A;  1GT0 C;  2HOS A;  3PO3 J;  1VI0 A;  1OCT C;  1BW6 A;  3TED A;  3SDG A;  4RBO A;  2GM4 A;  2JN6 A;  1RPW A;  4B1R A;  5IOY A;  4MIM A;  4B4C A;  1GVD A;  5EZH A;  1JJ6 C;  5IPA A;  2CUF A;  3ZQH A;  1U78 A;  3S15 J;  2EBI A;  1JGG A;  1Y1V J;  1G2H A;  2HYJ A;  2JA6 J;  1SAN A;  2K9Q A;  5E3O A;  3DCF A;  4M6V A;  2ELK A;  2WAQ N;  2QCO A;  5EYR A;  1AKH A;  3S2H J;  1TWH J;  1A6I A;  4X1E A;  4MLO A;  4I6Z A;  1QRY A;  1ORK A;  9ANT A;  2LFB A;  4A3M J;  1JUP A;  4IHY A;  2DA7 A;  3MVP A;  2FJ1 A;  1FTZ A;  2JJ7 A;  2ZB9 A;  1T56 A;  1LE8 B;  1FIA A;  1JTY A;  1MH4 A;  1FEX A;  2G0E A;  3PO2 J;  2E19 A;  4FTH A;  2XGD A;  5EF6 A;  2NVQ J;  3FKI J;  3HOV J;  2DA4 A;  3HEF A;  5M5W J;  3I4N J;  3BG5 A;  2WB1 N;  4A3B J;  1QVT A;  5GPA A;  3FIW A;  3TP0 A;  3SFI A;  2E2I J;  2DJN A;  1IRZ A;  3O8H A;  4J19 A;  3CQZ J;  1MBE A;  2R5Z A;  2CUE A;  4A93 J;  5JLX A;  2EQR A;  2R7Z J;  5GPC A;  2ID3 A;  2YS9 A;  4IHW A;  4V2G A;  3TW6 A;  2CU7 A;  1ZKG A;  3MN2 A;  1ETO A;  4CYC B;  1WH7 A;  2LY9 A;  4JX6 A;  1TWG J;  2DMT A;  1ZR2 A;  2DA3 A;  3RKQ A;  3GTP J;  3G1L A;  4XRS A;  2Y9Y A;  4BBR J;  1RET A;  3F0C A;  1MBG A;  4BY7 J;  5IP9 J;  1OFC X;  4Y52 J;  5J3L A;  1I50 J;  2HI3 A;  2NS7 A;  2ME0 A;  2K40 A;  1MBH A;  5BNG A;  1FIP A;  1IC8 A;  4JP0 A;  4I76 A;  4FE4 A;  5EG0 A;  2FQ4 A;  2JK3 A;  5F0F A;  3D1N I;  5J1Y A;  3LSJ A;  5F0H A;  3HM5 A;  3GTQ J;  1BA5 A;  2TCT A;  3JRB A;  3NAU A;  2K9N A;  3BTI A;  2ME6 A;  5IYB J;  2MW8 A;  1WCM J;  5M5Y J;  5EGO A;  1ETY A;  2EZL A;  4A3K J;  1B8I A;  1T33 A;  4DYR A;  5EEA A;  2LK2 A;  3SJM A;  3CCY A;  2AO9 A;  3B6A A;  3S1R J;  1GDT A;  1ZGW A;  1RKW A;  2CRG A;  4XID A;  2HXI A;  3JR9 A;  1F43 A;  5C3E J;  1B72 B;  3GTK J;  4M3F A;  3K2A A;  3JRC A;  5FKO A;  3GTM J;  3DEW A;  4BKX A;  1UHS A;  3S16 J;  1Z77 A;  4UUS A;  5IYD J;  2XB0 X;  1JJ8 C;  1U9O A;  1RES A;  2XPV A;  2D5V A;  3WHC A;  2X6O A;  3ZOB A;  3A02 A;  2ECB A;  3S1M J;  4S0H B;  2M2E A;  3HKZ N;  1ETX A;  3OSF A;  2O7O A;  3ZQF A;  5FKN A;  3ZQI A;  1JUM A;  3A01 A;  1U9N A;  4W97 A;  1TWC J;  3FK7 A;  1DU0 A;  3PM1 A;  3HGG A;  2DMU A;  1AKH B;  3TP3 A;  5M5X J;  4XIC A;  1MBF A;  4A3D J;  3H0G J;  2VKV A;  1TWA J;  3RZD J;  3JRF A;  3QPL A;  2P81 A;  2R0Q C;  3I4M J;  1Q1V A;  1WGX A;  2EZH A;  2X48 A;  4M3G A;  3UKG A;  5K7Z A;  4A3J J;  2EZI A;  2YU9 J;  3HOX J;  3QQA A;  2VKE A;  1OCP A;  1NK3 P;  2CJJ A;  1K83 J;  2IBD A;  2PMZ N;  3HOU J;  1JUS A;  5DTD A;  4D7N A;  5J1U A;  5K7H A;  3G1M A;  3W6V A;  4XRM A;  1QVU A;  2H1K A;  2LLK A;  3MKL A;  2DMN A;  1ETW A;  4M3E A;  2XRL A;  2R5Z B;  2EZK A;  5E3M A;  4FCY A;  1IG7 A;  4BXX J;  2YUS A;  1TWF J;  1APL C;  4DZJ A;  1RR7 A;  4IEJ A;  1BL0 A;  1Y1W J;  3BR5 A;  1IJW C;  3RQI A;  3CMY A;  2R93 J;  1GV2 A;  4NDL A;  2CQQ A;  2L0K A;  1MH3 A;  2XPU A;  4XK4 A;  3BG9 A;  1H8A C;  2HXO A;  3GBG A;  2O9L A;  2L7F P;  5FKL A;  1SFO J;  2NVX J;  1LFB A;  2ECC A;  5C4J J;  4A3C J;  2DN0 A;  3IH4 A;  4JYK A;  3OSG A; 
#chains in the Genus database with same CATH topology
 1DUX C;  4WXC A;  3OOU A;  4C30 A;  1FP1 D;  2BGC A;  5D8L B;  2HPM A;  3FM5 A;  2Z99 A;  3J81 K;  2HOE A;  2JTV A;  2FOK A;  3U21 A;  1OLT A;  1FPQ A;  4MFE A;  4KIF A;  2M34 A;  1T95 A;  1EKE A;  2IAI A;  4OOI A;  1HXD A;  5KCM A;  2CS3 A;  2KIU A;  3SXY A;  2DQL A;  1SVO A;  3BQZ A;  3OV8 A;  5M3F J;  1BJZ A;  5KHD A;  3S1N J;  1MMD A;  2E34 A;  4HF2 A;  4BBS J;  1ODD A;  4HYE A;  2HDC A;  3VYT B;  4C2U A;  2CUJ A;  4BQA A;  3V42 A;  1BOA A;  3H3U A;  4CIC A;  4G7Z F;  4CSW A;  4XLN F;  4YIF A;  3GTO J;  5F04 A;  1KU3 A;  3DBH B;  2ZKZ A;  3BJ6 A;  3HPH A;  4CA0 A;  3VPR A;  1FBS A;  1X4O A;  2QQB A;  4JX5 A;  4PGH A;  1IV6 A;  4IO9 F;  3CLO A;  2DXI A;  1KU9 A;  1NTC A;  1XSV A;  1Y56 A;  1WJ5 A;  4M9S A;  3OYJ A;  3L2V A;  3HRM A;  1BOB A;  1FX7 A;  4FHT A;  3DPU A;  4L0Z B;  5GTI C;  2XAH A;  3WG7 H;  2EFW A;  4L9N A;  2CH0 A;  2MG4 A;  4ENJ A;  1MSE C;  4E7S A;  3GTJ J;  2ZFW A;  3H5R A;  3W6J B;  2VJ4 A;  3D5S C;  3AAF A;  5JLW A;  2DFH A;  2B9S A;  3CUQ A;  1BIB A;  1W5T A;  3CC2 I;  3CCL I;  1OJL A;  3FIS A;  1E3O C;  3ZPL A;  2JPC A;  2LNB A;  3G1O A;  3C3W A;  3JRD A;  1ZEL A;  4FAS D;  3HOT A;  3FK6 A;  4HZF A;  3SEZ A;  2DMQ A;  3GLL A;  1A31 A;  3ZXS A;  1XPX A;  2NNY A;  1P6R A;  3KP2 A;  3P7N A;  1Z67 A;  1S8N A;  4B47 A;  1Z05 A;  3S3N A;  1I3Q J;  3CMM A;  1KU2 A;  2K86 A;  1PDN C;  2E1C A;  2VOO A;  2NOJ B;  3FMS A;  4EJU A;  2R7W A;  4B8X A;  4LFU A;  2XDV A;  4M3D A;  3OIP A;  5FKK A;  4CUG A;  4IQ4 A;  4IL6 C;  3PQK A;  4XNF A;  4KIB A;  2ZNY A;  3OYG A;  2M45 A;  5FLX Z;  2R7S A;  4IPA A;  1G3Y A;  2QF7 A;  4HA8 A;  2CGP A;  3H5N A;  2A3S A;  3E6C C;  2I10 A;  2HTS A;  1JKP C;  2P5V A;  4HNU A;  2PLY A;  2V9P A;  1WJA A;  3P9C A;  4GFB A;  2K3F A;  1YYV A;  2E2J J;  1D3Y A;  3PJR A;  5DUK A;  4OIN F;  4AVP A;  2E7W A;  3GTG J;  3PNY A;  1W5S A;  3RKX A;  3EUA A;  3HB9 A;  1GXP A;  1H89 C;  2LTP A;  2O0Y A;  4ZC3 A;  3BJO A;  5H6Q A;  3H3V K;  4DYQ A;  3SDB A;  3KE2 A;  2NYX A;  5D6E A;  1XMK A;  3S1Q J;  3FHN A;  4M3B A;  2EFO A;  4LLG F;  1G3S A;  2O8K A;  1JE8 A;  1Y0U A;  5HLG A;  2DA5 A;  3H9G A;  3O2P E;  5M3M J;  2LSO A;  3CDL A;  2Y2Z A;  4C3I J;  2BE5 F;  3U9G A;  4BQQ A;  4A12 A;  2WBM A;  2VKD A;  1QPM A;  4AIJ A;  3S14 J;  4KT6 A;  2L5Q A;  2PFB A;  1Z7L A;  1REP C;  1E0E A;  2PG4 A;  2KIF A;  4BJT A;  1K6O A;  1Z6T A;  3R0J A;  3BTJ A;  1H88 C;  2EH3 A;  2MBF A;  1HC8 A;  5F27 A;  1I6X A;  3Q0U A;  4O5V A;  1O4X A;  1I27 A;  3VFZ A;  1L3L A;  2IRF G;  2EIL H;  2EK5 A;  1IO2 A;  2DJI A;  4IHX A;  2ZBK A;  2E36 A;  5LRR A;  2W85 A;  3I59 B;  3CF2 A;  5LLQ A;  4D5C A;  3RJP A;  2ID6 A;  3A1Y A;  2XSD C;  1BC7 C;  2BVL A;  2E2H J;  4KIS A;  3M3Y J;  2VQH A;  1IZ1 A;  2XB5 A;  1BR2 A;  1UHW A;  1AWC A;  2HDD A;  3VOD A;  3IWF A;  3V4G A;  5K7F A;  1Z9C A;  1ZR4 A;  5FLV A;  5E3L A;  4IRG A;  3OYN A;  2XF6 A;  2RAE A;  2Y30 A;  4M71 A;  3CUO A;  3I54 A;  3FBI B;  2WAE A;  2BY3 A;  5KAI C;  5EZG A;  2R5Y A;  1P7I A;  4HRI A;  3OYM A;  1SEU A;  2HOT A;  1R7J A;  3BTL A;  4HW0 A;  1IGN A;  1ONV A;  3FXR A;  4D5F A;  5HOO A;  4RMN A;  2L7Z A;  3ABT A;  2ZC2 A;  2V1N A;  3A2K A;  2DCE A;  3BDD A;  1W1W E;  3ABU A;  2HDW A;  3L1P A;  1RIO H;  2XC7 A;  1PUF A;  4RB2 C;  1W36 D;  3IC7 A;  5FJ8 J;  3MKY B;  1V55 H;  2K27 A;  2L3D A;  2V9K A;  2HOA A;  3ELK A;  2L54 A;  1P2F A;  1W5C C;  3M8E A;  1VND A;  3MAJ A;  2NS8 A;  5E3N A;  2ZME B;  4AYB N;  4BDY A;  1LEB A;  2P0W A;  3CO6 C;  4ESF A;  3L2C A;  1BW6 A;  2GQQ A;  4BNC A;  1RPW A;  3DEU A;  4B1R A;  3K1M A;  5EZH A;  3ZCO A;  1F4K A;  3PQJ A;  5D4R A;  3Q5F A;  4PFO A;  1U78 A;  2EBI A;  1JGS A;  1ZG3 A;  1J5Y A;  1G2H A;  2NRA C;  2HYJ A;  2M30 A;  1Z7U A;  3AG3 H;  2P7V B;  3LA3 A;  3I0T A;  1VQL I;  1PJR A;  1BI1 A;  3SQN A;  5E3O A;  2HVS A;  2CSO A;  3DBR B;  4HX8 A;  4LIV A;  1DDN A;  1NH3 A;  3TQN A;  2KP6 A;  3T0Y A;  3RQ4 A;  4G6T B;  2KMU A;  1P92 A;  1XGS A;  1ORK A;  3IRR A;  4F7Z A;  2VQC A;  3EYY A;  3F22 A;  3EYI A;  3QYF A;  2DA7 A;  3RSN A;  3E3V A;  2FJ1 A;  1FTZ A;  3LSK A;  1X3Z B;  2WV0 A;  1FIA A;  1FEX A;  1V4R A;  5E8G A;  1C0W A;  2RGV A;  4FTH A;  5EF6 A;  4ZYH A;  1YI2 I;  1VQP I;  2QVO A;  5J8F A;  3BRO A;  4AVZ A;  3I4N J;  3BG5 A;  3HYI A;  1M1E B;  4WXH A;  4CCM A;  3ZP5 A;  2WB1 N;  4HF0 A;  1IAW A;  1QVT A;  3I3L A;  2E2I J;  3LFU A;  3E5U A;  4XLA A;  4Q47 A;  3RKW A;  2XAS A;  3RKY A;  1IRZ A;  3TKY A;  1XB4 A;  2IS6 A;  4MGR A;  3O8H A;  4J19 A;  2HEO A;  4WWC A;  3CQZ J;  4UUV A;  1X3W B;  2R5Z A;  1OCZ H;  2W7N A;  3S93 A;  4A93 J;  2EQR A;  1WQ2 A;  4I09 A;  4JK1 X;  5E1Z B;  4S05 A;  4V2G A;  2LOO A;  3FBN B;  2CU7 A;  5E79 C;  4HV6 A;  3FHZ A;  1IRG A;  1HW2 A;  3PIO F;  2FE3 A;  2V1U A;  1E3H A;  4JX6 A;  4P9F A;  1VQO I;  1JHH A;  3N4M A;  1ZR2 A;  3D5L A;  1OR7 C;  4DOZ A;  2M5W A;  5LD2 C;  4UY8 I;  2HQN A;  3CZ6 A;  3CC4 I;  4BY7 J;  5BPI A;  2Q1Z B;  2OQR A;  3CCM I;  4AIK A;  4NHJ A;  1ERD A;  2VBY A;  2HNH A;  4DNC A;  1OFC X;  3I71 A;  5IT3 A;  1I50 J;  2L4A A;  2Z3Y A;  1XCV A;  5HS7 A;  3VSK A;  4CCO A;  2K9L A;  1IC8 A;  2L4M A;  1O3T A;  4K2E A;  1OCO H;  1MGT A;  2JK3 A;  3DLA A;  4XSZ F;  4ZH4 F;  5IY5 H;  1BA5 A;  2HKO A;  3H9Q A;  5LFA A;  2K85 A;  4R79 A;  2OTL I;  1E3P A;  2KFD A;  4HBL A;  4XOP A;  5D8K B;  2Y0S A;  2EZL A;  2P8T A;  2EJR A;  1JHF A;  2HVQ A;  1QQI A;  1T33 A;  1S7O A;  5CPR B;  4BGD A;  2GXB A;  3SJM A;  2YU3 A;  3J81 Z;  3CMA I;  1RKW A;  2DOA A;  3H36 A;  2V7F A;  2CRG A;  2VOP A;  4XID A;  4BAC A;  4MEX F;  5JR3 A;  4FX4 A;  2CW7 A;  2Z16 A;  5JFR A;  1YJ9 I;  3K4J A;  2VL8 A;  2VKH A;  2YSR A;  3H9J A;  2P4W A;  3DEW A;  2V6E A;  1UHS A;  3V7S A;  1UZC A;  1FMW A;  3K4N A;  4BE1 A;  2QA4 I;  2XB0 X;  1RES A;  3K70 C;  2ACJ A;  1BN5 A;  1SC7 A;  2D5V A;  3ZOB A;  4A0X A;  1DGR M;  1HKT A;  4L0Y B;  4R1H A;  4NC8 A;  2XF7 A;  5D5W B;  1DP7 P;  2V79 A;  3FZV A;  3DTK A;  4YIR X;  2Y69 H;  4XKB A;  3HHH A;  3ZQI A;  1JUM A;  4NC7 A;  1P4W A;  3ZN1 A;  1T98 A;  4I02 A;  2FQ3 A;  1R23 A;  4BEH B;  3ISP A;  5L3C A;  5L3F A;  3AL0 C;  2QLZ A;  1MBF A;  5J47 A;  1KU7 A;  4B48 A;  4A3D J;  2O5R A;  3H0G J;  3MZY A;  2VKV A;  3JTG A;  2LF8 A;  4L9V A;  3QPL A;  2CFO A;  2DK5 A;  2R0Q C;  1ZG1 A;  2F5D A;  2A6T A;  4F92 B;  4L9J A;  4RM3 A;  1B59 A;  1XMA A;  2ZXW H;  2X48 A;  1WGX A;  1FMV A;  3ABM H;  4NBQ A;  4XOT A;  3QQA A;  1N75 A;  2GAU A;  1LB2 A;  2DLL A;  4II2 A;  3LSH A;  2HTJ A;  1R58 A;  2RC4 A;  4NNJ A;  2PMZ A;  4KMF A;  1YX5 A;  2WA0 A;  3K69 A;  4D7N A;  4A5M A;  1YE9 A;  2STW A;  3QOP A;  3WU0 A;  1QVU A;  1YJW I;  4LB5 A;  4Y15 A;  4U88 A;  1QZY A;  4BXX J;  1IG7 A;  2YUS A;  4CCN A;  4E7I A;  4D9J A;  1S6L A;  3BR5 A;  1DQU A;  3OYI A;  2F5C A;  3RQI A;  3F23 A;  3CMY A;  1GV2 A;  2CQQ A;  2L0K A;  2XPU A;  1WRJ A;  3K4L A;  1H8A C;  1FC3 A;  3GBG A;  2M3A A;  2O9L A;  3BZK A;  3GFJ A;  4XON A;  2X6W A;  1BBY A;  4AM3 A;  3GO5 A;  4IF4 A;  1LFB A;  2HWV A;  5K1Y A;  2DQR A;  3IKT A;  4IRH A;  3OSG A;  5HNF A;  3ZQL A;  3AG1 H;  4UV9 A;  4HF1 A;  1UAA A;  2H94 A;  2LD5 A;  3GYH X;  2NXN B;  2JZY A;  2EB7 A;  2FA5 A;  1RZ4 A;  2MSY A;  3I59 A;  5LHG A;  1IDY A;  2L9R A;  2BHY A;  2AQF A;  4IZZ A;  2EV0 A;  2F5V A;  4KMU X;  2EFQ A;  4UUT A;  2R5Y B;  1O3S A;  4U0W A;  4OWR B;  2ETH A;  3GF2 A;  3HRS A;  2RQQ A;  2H8R A;  1HCR A;  3PIP F;  3OS2 A;  1YW8 A;  3DXJ F;  3ROU A;  4L18 B;  3B73 A;  2R7V A;  3R0A A;  1FLI A;  1S3J A;  2W57 A;  1YIT I;  2MC3 A;  3U1D A;  2LRE A;  5H2F C;  1PUF B;  1P7J A;  3O6B B;  1K6Y A;  2LG4 A;  1U8R A;  1K79 A;  3CJN A;  4A3E J;  2Y31 A;  2CG4 A;  2DOD A;  3P9I A;  5EJC A;  4QTR A;  1TNT A;  2C6Y A;  4QSH A;  2VQL A;  4OIR F;  4B44 A;  1TC3 C;  3HOW J;  3F9K A;  4I0B A;  2VE8 A;  2VJI A;  1E17 A;  3OIQ A;  1IRF A;  1D0Z A;  1IN5 A;  1LDD A;  4C3H J;  2PMH A;  2ZME A;  1WH5 A;  3B6C A;  3DU6 A;  3GWZ A;  3JW4 A;  3HUG A;  4BL0 B;  1H9T A;  4V2F A;  1LFU P;  1XCB A;  1JTX A;  1SMY F;  2HQ5 A;  4QPO A;  2FBI A;  2M7A A;  3K1N A;  5DYM A;  3Q0V A;  1Q1H A;  5IP6 A;  2KPM A;  3A01 B;  2B63 J;  4M72 A;  3I58 A;  2ZXI A;  2LBF A;  1SD6 A;  3OIO A;  4FT8 A;  4BS9 A;  2CQ7 A;  2KDZ A;  2J5P A;  2XHK A;  5BQT A;  1DPR A;  2PEX A;  3HSF A;  1R22 A;  2D2W A;  2KLO A;  2K9M A;  3F8N A;  1R4N B;  1W36 C;  2JMW A;  3GUD A;  3RPQ A;  3DPT A;  2FML A;  1S7A A;  3GZ5 A;  3BOQ A;  1N78 A;  1ZTR A;  2LVS A;  2VB6 A;  1D0Y A;  1VQ9 I;  1ZHF A;  4BY1 J;  3A03 A;  4LLN A;  1K61 A;  3O8G A;  3J7A Y;  1XC5 A;  4BE2 A;  5JI6 A;  1FOW A;  3HOY J;  1CQT A;  1V5E A;  2CMP A;  1XG1 A;  1XMX A;  2VPR A;  2XIG A;  5FFZ A;  4QIW N;  1G8X A;  2KJB A;  3VOE A;  4A3F J;  4KFC A;  2KIM A;  3M07 A;  3ASO H;  3VB2 A;  1N25 A;  2M0C A;  4Y7N J;  1I1S A;  5LRS A;  1AHD P;  1HA8 A;  5J6X A;  4XRS G;  4C2M J;  1WKM A;  1Z1D A;  2Z33 A;  2VE9 A;  1QNT A;  3EQL F;  1UMQ A;  2JRT A;  1USS A;  2CYY A;  1Z91 A;  2O3F A;  2LKX A;  1SMT A;  1STZ A;  1KON A;  5CKT A;  4RB1 A;  2VC0 A;  2IJL A;  3I53 A;  3TW7 A;  4JX4 A;  5HLH A;  3A0H C;  3UNG C;  2M9H A;  3HDD A;  4MHG A;  3OYL A;  3LSP A;  2GA1 A;  2PI0 A;  2PJR B;  2MLK A;  4N0B A;  1LJ9 A;  4OU0 A;  2EPF A;  1F36 A;  4DJA A;  3IV5 A;  4EQQ A;  2XF5 A;  1ZRC A;  4CHU A;  2EV5 A;  3K70 D;  2IS1 A;  1R6R A;  1MMN A;  2DK8 A;  3GZ6 A;  5FRN A;  2HQA A;  3OYF A;  3L2R A;  4BHP A;  4KYW A;  1QHH D;  2BXY A;  4AID A;  2E60 A;  4AUX A;  4LMY A;  4RB3 C;  1HDD C;  1R71 A;  3A4C A;  5CVJ A;  2J5O A;  2COB A;  2VLA A;  1HOM A;  1CGP A;  1R00 A;  1YRN B;  1SFE A;  1ETV A;  5L3E A;  5IOZ A;  1E2X A;  3PUB A;  3CCJ I;  2YR2 A;  2Y0S N;  5HS9 A;  2D1V A;  4LG0 B;  1IW7 F;  1KQ8 A;  4DW6 A;  3S2W A;  2Q2E A;  1JKO C;  2GBY A;  2W4S A;  4F3Q A;  2GLO A;  1D8K A;  2HU9 A;  1K4S A;  4YFX F;  3RPU A;  1QZE A;  5FO5 A;  1X1A A;  3BJA A;  4UV8 A;  2JA8 J;  3LA2 A;  3SYT A;  4W1U A;  5GAG J;  3LOC A;  3F6V A;  1GT0 C;  3CCS I;  1OYI A;  2X1C A;  5DCM B;  3TED A;  1ZG5 A;  1Y8R B;  3TDU C;  3CJR B;  4B4C A;  1OPC A;  1ZLJ A;  3GEZ A;  2BEO A;  4UXN A;  2VT3 A;  3ZQH A;  1K7A A;  5LEJ A;  4E70 A;  3AFH A;  3JTH A;  2DDA A;  2NVU B;  2JA6 J;  3CDI A;  3FKJ A;  1V5F A;  2PBI A;  4J00 A;  3GCM A;  1SAN A;  3BC8 A;  4HQE A;  2EA2 A;  3MQ0 A;  4XLC A;  3WTT C;  1Z3Y A;  1FZP B;  4ENM A;  3FXQ A;  1TQP A;  4LK0 F;  3DCF A;  4BEH A;  2ELK A;  2QCO A;  2DOF A;  2K4J A;  4BYY A;  2QYO A;  3KLN A;  1VQ8 I;  4MQV A;  4XOR A;  3PFI A;  4LD5 A;  9ANT A;  4A3M J;  4HX4 A;  1JUP A;  3GFI A;  3HPG A;  2CQN A;  2ZB9 A;  1D1A A;  4EJW A;  2E7X A;  2K02 A;  5LGU A;  3NWS A;  4HV5 A;  3PO2 J;  3ZR8 X;  2XUB A;  2E1N A;  5JVG F;  2XGD A;  1G3W A;  1S5L C;  1ZGJ A;  3T5X A;  3QP5 A;  4G7O F;  1A35 A;  1BJA A;  4Y33 A;  1MJB A;  3LWF A;  3FIW A;  2LRD A;  2D1H A;  2FBK A;  2R7T A;  4CCL A;  2DJN A;  1QHG A;  1MBE A;  2E71 A;  3I5U A;  2MLG A;  2CUE A;  2CV1 A;  5JLX A;  4ZTF A;  2VOD A;  1WWX A;  3DTI A;  3SHF A;  3HL2 A;  3DLL F;  1KYW A;  1YIJ I;  4O6J A;  2RKH A;  4IHW A;  5E1X A;  1S72 I;  3TW6 A;  1AOY A;  1ZKG A;  2VBW A;  1D1B A;  4IKF A;  2AXL A;  4UVC A;  2FUG 2;  2GWR A;  1FY7 A;  3F8B A;  4CYC B;  3ULQ B;  2X6X A;  4RGU A;  2KZG A;  3L00 A;  3HHG A;  5ICE A;  4QWQ A;  3RYR A;  4PK4 A;  5CVV A;  2CQK A;  3I64 A;  2Y9Y A;  5BS6 A;  1O7L A;  1UCR A;  3H5A A;  5H6R A;  2R7X A;  3VSL A;  4BBR J;  4EM1 A;  1MBG A;  5ILU A;  5CLS A;  2H6B A;  3L7W A;  3U1K A;  5KNL A;  2L2O A;  4XKW A;  1ZRF A;  1SAU A;  3R4K A;  5DV5 A;  3OYK A;  1WFX A;  2PX9 A;  2W84 A;  3V8J A;  2COM A;  3KZY A;  4FE4 A;  1MW7 A;  1YHQ I;  4M9Z A;  2V4J C;  3ABK H;  4XBF A;  5TJJ A;  3HM5 A;  1F1Z A;  5IYB J;  3BTI A;  2ME6 A;  5M5Y J;  3BCA A;  2HVR A;  4AU7 A;  4KA4 A;  2HQR A;  2DU9 A;  2EIN H;  2OCE A;  5EGO A;  3G2B A;  4RGS A;  3FWE A;  1FSH A;  2LK2 A;  2JSC A;  2A07 F;  2O8X A;  3CCY A;  4XSX F;  4PFP A;  3B6A A;  3BPX A;  2R7D A;  1GDT A;  2HS5 A;  3S3M A;  4F91 B;  4CGZ A;  3OMY A;  3WGH A;  4F55 A;  4AD9 A;  4FET A;  3KP6 A;  3WTS C;  3JR9 A;  1F43 A;  1IXS B;  4M3F A;  3HUG B;  2R7F A;  3JRC A;  4ENK A;  1TL8 A;  3GTM J;  3RTR A;  3E1S A;  2EFN A;  3SZT A;  5HVQ C;  2JT1 A;  1JXS A;  1R5G A;  3CTA A;  4MTD A;  2ZO4 A;  5E8I A;  3WGG A;  1U9O A;  3VYS B;  3E6B A;  3WHC A;  4IHT A;  3UR3 C;  1BR1 A;  4S0H B;  4HLY A;  1MMS A;  2LBF B;  2ZCW A;  3GFL A;  1CF7 B;  1UB9 A;  2O7O A;  2H09 A;  1RC9 A;  1O7F A;  2GXA A;  3QOD A;  3A01 A;  1ZAR A;  4W97 A;  1BIA A;  3K4B A;  5DEQ A;  3PM1 A;  3EPZ A;  4FX0 A;  1AKH B;  5CQG A;  4XIC A;  1ZAO A;  1GHC A;  2Q0O A;  2WAF A;  3QU3 A;  2M0M A;  3QWL A;  1Y0N A;  2P81 A;  3I4M J;  2HYG D;  5CVU A;  2OU2 A;  3IAM 2;  1DP3 A;  3FMQ A;  2CV2 A;  1Q1V A;  2EZH A;  4M3G A;  2YU9 J;  4JBA A;  2B0L A;  1ZRE A;  2EZI A;  4OIO F;  2AS5 F;  4ZYD A;  2CJJ A;  2OV7 A;  2X4H A;  1K83 J;  1G6N A;  2H27 A;  2LMD A;  3J80 K;  3HOU J;  1WJF A;  1MD0 A;  1J9I A;  1JUS A;  5DUI A;  2RDP A;  2ZXH A;  1BI0 A;  2XV4 S;  2KIS A;  2V26 A;  1W7P D;  2XKP A;  4U0Y A;  1T39 A;  4NQW B;  4UB6 C;  2LLK A;  1UG0 A;  3MKL A;  4DQ2 A;  4YFK F;  2H1K A;  3ZGK A;  1ETW A;  2HGC A;  1N77 A;  3OOP A;  3TGN A;  4F93 B;  3C7J A;  2GXG A;  1YG2 A;  5ILS A;  1PYV A;  3TO6 A;  4FCY A;  1RRJ A;  3K4M A;  1TWF J;  2L9N A;  2X85 A;  4IEJ A;  1VQ4 I;  4PZJ A;  2DYS H;  1T0F A;  3HJE A;  1IJW C;  2PJP A;  4V19 K;  2GIV A;  2IA0 A;  2ZJP F;  3EUH C;  3OR1 C;  4XK4 A;  3PSI A;  5GAH J;  1LDJ A;  2HXO A;  4PJJ A;  2ZJQ F;  2D45 A;  3W2W A;  5FKL A;  1EA3 A;  4ZTJ A;  1WSU A;  4DBQ A;  1BI3 A;  4UVA A;  2VQG A;  2WC2 A;  2KRC A;  4LB6 B;  2ECC A;  4LK1 F;  4A3C J;  2R7O A;  4LJZ F;  3IH4 A;  2PJR A;  2WY8 Q;  3GZN B;  4GDF A;  2TDX A;  5DS9 A;  1UST A;  3WTY C;  4MFD A;  2OF7 A;  3BR1 A;  3C2B A;  5H20 A;  5J1R A;  4RAZ A;  4XKC A;  2M4G A;  1ZK8 A;  3G3Z A;  2L9V A;  1UG2 A;  1YW9 A;  4G9Y A;  1U8B A;  1VQK I;  3HTS B;  5EG0 B;  2RNJ A;  3C18 A;  2VI6 A;  2CO5 A;  3KEY A;  1ZGA A;  1MKM A;  4AIH A;  3TL4 X;  2ZJ2 A;  1QPI A;  2LF7 A;  2L02 A;  3OL3 A;  4YEJ A;  1YTY A;  1LQ1 A;  5L3D A;  2DFF A;  4E7H A;  4ON0 A;  3GW2 A;  4ZDL A;  1KZH A;  3HBL A;  4ZDO A;  3C2H A;  4O3M A;  2Q2E B;  1B8I B;  2H6C A;  3JCU C;  4LOC A;  4D7M A;  3ABL H;  3F21 A;  2DMP A;  2Z9O A;  2NOG A;  3IHU A;  2L9S A;  5A2Q Z;  1YRN A;  1BR4 A;  2NVT J;  3X2Q H;  2NNN A;  1ENH A;  3K10 A;  4HDV A;  4LG0 A;  4ZYA A;  4ABZ A;  2Y0M A;  4R8H A;  2KL4 A;  3OYH A;  5FB2 A;  2LY2 A;  5HDN A;  1RKT A;  2OBP A;  4A3L J;  1I39 A;  5AIP A;  4XQF A;  4Z6Y A;  1W0U A;  1TP4 A;  2FSW A;  3VYU B;  3GTL J;  2BOL A;  3IH3 A;  2LY1 A;  4KUM A;  3M1C A;  4UUS B;  4MNU A;  2A68 F;  2FD5 A;  4GO1 A;  1HSJ A;  2KJC A;  2OJE D;  3HKZ A;  3IP4 B;  3Q9S A;  4XN3 A;  5DCM A;  5F08 A;  4FIS A;  4XRF A;  3WU2 C;  2R92 J;  1YJN I;  2MH9 A;  2VN2 A;  2VUM J;  3CES A;  3WGI A;  1WJE A;  1Y6I A;  3M7G A;  1MBK A;  2L7M P;  2JA2 A;  1QZZ A;  2ELJ A;  2QSF X;  2QWW A;  3BG3 A;  1OKR A;  2DA1 A;  1EV7 A;  4DGW B;  4BE0 A;  4NUB A;  3NQO A;  1LDK B;  2KT0 A;  3DKX A;  4CXF A;  2FF4 A;  4I0A A;  2IVM A;  3TMO A;  3LNQ A;  2CUZ A;  4QPQ A;  4PSX A;  2V1X A;  5EEG A;  5HNH A;  1D0X A;  2KRH A;  3GX4 X;  4OAY A;  1OIS A;  2IGK A;  4EM0 B;  5DD4 A;  1T08 B;  4RAY A;  3LSR A;  3ML6 A;  4FE7 A;  1LPQ A;  2L7K A;  2DBB A;  2WV1 A;  4RDU A;  2FRH A;  2BXZ A;  3WU1 B;  5E18 F;  4XLE A;  1SD5 A;  3FM3 A;  3F3X A;  2QBY A;  3CP8 A;  1JKR C;  5F1R A;  1IUF A;  1OMI A;  2WTE A;  3DEE A;  4IRI A;  3FF5 A;  2XGE A;  5E20 A;  1HF0 A;  2XVC A;  3IRQ A;  2DTZ A;  2F5F A;  5TGT A;  2DTR A;  1T8I A;  1J75 A;  1ETK A;  1A04 A;  4N4N B;  3VEP A;  6PAX A;  1D5Y A;  5CVI A;  1HW1 A;  2VJJ A;  2HR3 A;  2HPI A;  2ESH A;  3HGY A;  3GVA A;  3ONQ A;  3SZP A;  1EF4 A;  2CW0 F;  3E7L A;  3RZO J;  2M8G X;  3ZMU A;  3F72 A;  1XGM A;  2QQ9 A;  1QA6 A;  3K7A J;  1GXQ A;  3P5J A;  4KIT B;  3EET A;  3PNV A;  1JT0 A;  2XPW A;  4C3J J;  4IQJ A;  2OZ6 A;  3CF5 F;  2MGQ A;  4CYC A;  4N9I A;  4EEF G;  5K5R A;  4G7H F;  1K78 A;  2A61 A;  1PP8 F;  1LUJ B;  5EDN A;  1R9T J;  1B9N A;  1GV5 A;  2RQP A;  2VIX A;  1O3Q A;  1FOX A;  2ZNZ A;  3L9F A;  1VFC A;  4S04 A;  1V3F A;  2JVG A;  3CCQ I;  2O6G E;  2JA7 J;  1XX5 A;  5KVR A;  3M1E A;  3N05 A;  3R60 A;  1XN7 A;  1V5G A;  4P55 A;  1V54 H;  4B3A A;  1IRX A;  3OS1 A;  4DBR A;  4CCK A;  3K9T A;  3CD6 I;  1KQ9 A;  3VWB A;  5EGO B;  4A69 C;  2W48 A;  5HLT A;  4P9U A;  2X9D A;  3G4S I;  4A0Y A;  2IXS A;  1FJL A;  2KQR A;  4RGX A;  1LKX A;  1S29 A;  4GCV A;  1MJ9 A;  3ZQG A;  5L3B A;  5IP7 J;  1XDU A;  2AHQ A;  4HST A;  1XSX A;  1B6A A;  3Q3S A;  3HIF A;  1R1U A;  2N8G A;  2VON A;  2JQ7 A;  1XS9 A;  3OYD A;  3FXO A;  3CJQ B;  5F0C A;  3BR0 A;  5GAD J;  2QKM B;  3K2Z A;  4A3G J;  1JKQ C;  1OCR H;  4XN0 A;  2GOM A;  4G12 A;  3L2Q A;  1YS7 A;  3CJT B;  2NVY J;  1U5T C;  1DU6 A;  3JRG A;  5C4X J;  1EH8 A;  4AWX B;  1LEA A;  1XGN A;  4UB8 C;  4XR6 A;  1YLF A;  5CVR A;  3JAM K;  3ZQC A;  2DT5 A;  4KDP A;  2BVM A;  4AYB A;  4IOA F;  1VI0 A;  1OCT C;  4HX7 A;  5D5U B;  3SDG A;  2JN6 A;  4RS8 A;  5IOY A;  1JJ6 C;  3ZQ7 A;  2XSJ C;  4ESJ A;  1O57 A;  2CUF A;  3REO A;  2RVC A;  5DDG A;  3TBI A;  1NHA A;  2EIK H;  1JGG A;  5BPD A;  1WI9 A;  1G59 A;  2UXN A;  1SAX A;  2G9W A;  1CF7 A;  5LHH A;  4ZYE A;  3AL0 B;  1YS6 A;  5B66 C;  1FT9 A;  4LIU A;  1QBJ A;  4XM3 A;  1J09 A;  3CDH A;  2H8W A;  1DGW Y;  1IF1 A;  2MC4 A;  4G6D A;  5EYR A;  3BG7 A;  1AKH A;  2E35 A;  1A6I A;  1P4A A;  4Y13 A;  3IWZ A;  3K4C A;  4P5O A;  1TQI A;  4D1Q A;  3K4K A;  3MD2 A;  3KCC A;  3HRT A;  3COA C;  2LFB A;  1VTN C;  2FBH A;  3T8T A;  4IHY A;  1QGP A;  5LEK A;  1ZRD A;  3MVP A;  4G94 A;  5LHI A;  2WAD A;  3P9K A;  4ETS A;  1LE8 B;  1JTY A;  2G0E A;  1OYY A;  2HYF A;  2E19 A;  5TIS C;  1WHU A;  2R7R A;  2A6H F;  2NVQ J;  1WZ2 A;  4MEY F;  3HOV J;  2DA4 A;  3HEF A;  3QOE A;  4UVB A;  2Y75 A;  5D5X B;  4A3B J;  1OYW A;  1U6G A;  2DPD A;  3H35 A;  4II3 A;  3TP0 A;  2LDU A;  5B1B H;  5JHU A;  3JSP A;  2WWY A;  1SFK A;  1TLH B;  2VBZ A;  4ENN A;  4PUS A;  3DKW A;  4NQW A;  5ERI A;  4PJM A;  1MDM B;  3DTE A;  4WCG A;  4KIC A;  2K7L A;  2FOW A;  3MFK A;  2JVH A;  1TBX A;  2A6E F;  3OYC A;  5GPC A;  3WE3 A;  2YS9 A;  5HLI A;  3LQQ A;  5F6F A;  2MA3 A;  2FEZ A;  1JI8 A;  2OC6 A;  3AG4 H;  1XGO A;  2HFH A;  1WH7 A;  2P6S A;  1NG6 A;  3RCO A;  3J80 Z;  2EV6 A;  3DU5 A;  3Q9V A;  2DMT A;  3ZMV A;  5A2Q K;  4A6D A;  3RKQ A;  4M6Y A;  2E5Z A;  4XRS A;  2QZ8 A;  3MEX A;  2DT6 A;  1RET A;  3F0C A;  2X0L A;  3CC7 I;  5IP9 J;  3S8P A;  1IUY A;  1J0R A;  4OMY A;  5K5Q A;  4BAY A;  1R36 A;  4RB0 A;  3ASN H;  2QQA A;  1FOY A;  5BNG A;  2XGX A;  2DO7 A;  1FIP A;  3LQR A;  1GVJ A;  2OD5 A;  2X1E A;  1B4A A;  2F48 A;  4P1W A;  3EUK L;  5EG0 A;  2FQ4 A;  5F0F A;  2VXD A;  4MTE A;  1WVR A;  3FDY A;  3D1N I;  5J1Y A;  4HNT A;  5F0H A;  1SD4 A;  1VQ6 I;  3GTQ J;  4HQM A;  1UHM A;  2BY0 A;  1FWZ A;  2TCT A;  3BWG A;  1KA8 A;  3NAU A;  4KIG A;  2K9N A;  4I7H A;  2MW8 A;  3E97 A;  3DWL E;  1ETY A;  3CCR I;  3H0D A;  3BP8 A;  4HAM A;  4XMY A;  1T6S A;  3LSM A;  1B8I A;  1TT0 A;  4DYR A;  3DF8 A;  4PJL A;  4DIQ A;  3WG9 A;  2UWM A;  2QUF A;  2E1M C;  2DFE A;  2AO9 A;  3KEQ A;  2X6Y A;  1MMA A;  3E6D A;  3M9A A;  4L5J A;  4Q4Z F;  3FXU A;  4ZZL A;  1ZYR F;  3J7Y J;  2JRM A;  2HXI A;  1U5T B;  2FNA A;  1B72 B;  3K2A A;  1HKQ A;  1TNS A;  5LGT A;  2A69 F;  2R7U A;  2MYS A;  4Y4R A;  2BW3 B;  3BLY A;  1B1B A;  1Z77 A;  1TQM A;  4CH7 A;  4UUS A;  1JJ8 C;  2UUZ A;  2XPV A;  3S1M J;  3A02 A;  2F2E A;  1QU3 A;  4FQG A;  2ZXJ A;  4E7Z A;  2VJ5 A;  2ZME C;  3HKZ N;  1YFH A;  2DPU A;  1X19 A;  5ICC A;  2DDB A;  5IT9 K;  1KGS A;  3KZZ A;  2FU4 A;  3RYP A;  1U9N A;  2WAQ A;  1TWC J;  1HQC A;  1DU0 A;  3OYB A;  4Q48 A;  1RI7 A;  4ZZD A;  1FYK A;  1FBQ A;  5M5X J;  4E4H A;  2QSH X;  1VQM I;  1BC8 C;  3RZD J;  3JRF A;  3AKZ A;  2MAB A;  2OZU A;  3HZJ A;  2ISZ A;  1X1P A;  1KQ0 A;  2QBY B;  5LBQ A;  3ZN0 A;  3SFZ A;  3BCB A;  3ZMT A;  4BUP A;  3UKG A;  2JUC A;  2VBX A;  5K7Z A;  4A3J J;  1ZLK A;  3L2U A;  3HOX J;  3V8K A;  1D1C A;  3E5X A;  1NK3 P;  2KRF A;  4HG2 A;  2H1L A;  3QYE A;  4E7L A;  4B3X A;  3WE2 A;  2IBD A;  5HS8 A;  2PMZ N;  2W25 A;  3V7C A;  2EWN A;  2I8D A;  4IVN A;  2IGO A;  5K7H A;  3LAJ A;  2P5K A;  3G1M A;  2KHM A;  3H1C A;  3F8F A;  2DMN A;  2MD0 A;  4M3E A;  4NB5 A;  2EZK A;  4OMZ A;  3HXL A;  2EFP A;  3WTW C;  4DZJ A;  1RR7 A;  1BL0 A;  1Y1W J;  2BV6 A;  3J7A O;  5B1A H;  1K78 B;  2R93 J;  4BU2 A;  4E6K G;  2BYV E;  3EUH A;  4HSR A;  4EAT A;  3WTU C;  3CCU I;  1OR7 A;  2M8E A;  3WOD F;  3CLQ A;  1X1D A;  4XLH A;  2VAS A;  5CYV A;  1SFO J;  3AG2 H;  4EGY A;  1SVM A;  1T2K A;  2DN0 A;  1R5H A;  2ZJR F;  1WJC A;  4PCQ A;  1YOV B;  1W7P B;  2I5U A;  3PSF A;  2OUM A;  3LMM A;  1ITY A;  2XGC A;  2RN7 A;  1R1V A;  4U87 A;  2BZT A;  4RAF A;  2G7U A;  2XKO A;  3TOB A;  1X1C A;  3G71 I;  2XAG A;  4HEA 2;  4YEL A;  1VQ7 I;  5L3G A;  4CO8 A;  1R4M B;  2VC1 A;  1PVE A;  2K3P A;  3U2R A;  2NS0 A;  3BTC A;  1IN6 A;  5FKM A;  4I99 C;  2IEK A;  2Z2S B;  3GME A;  3I9V 2;  3N97 A;  1JT6 A;  3BR3 A;  3QPT A;  1MNM C;  4KNY A;  2ICW G;  2V9V A;  3M8J A;  3KX2 A;  1R5I D;  3Q0W A;  4ZYG A;  2E1M B;  3CP2 A;  4UNO A;  4OAZ A;  3E6M A;  4H0E A;  2PN6 A;  1NK2 P;  3F6O A;  4KT5 C;  4ASN A;  3JRH A;  2GOX B;  5FLM J;  2RNG A;  3W6K B;  4EV0 A;  1YO5 C;  3W2V A;  1WPK A;  2YPR A;  2Z5U A;  3KP4 A;  4AC0 A;  1VF9 A;  2ISY A;  4BXF A;  3CO7 C;  1FTT A;  3WHB A;  2JWT A;  4Y3O A;  3CUQ C;  3QPS A;  1LNW A;  2B7E A;  1X2N A;  2R7Q A;  1GUU A;  3LST A;  4IHS A;  4G8X A;  3F8M A;  5GTH C;  4A2U A;  1KYZ A;  4CZC A;  2Y9Z A;  4DZP A;  3MMY B;  4OIQ F;  2OTJ I;  3I55 I;  2LP0 A;  4L5E A;  3DKY A;  4KN4 X;  4BHB A;  5K5O A;  2XAQ A;  2FX0 A;  3VYR B;  1HLV A;  1VQ5 I;  4XLP F;  3JRI A;  4RLQ A;  3M8F A;  3BR6 A;  2FXA A;  4IJA A;  4BDZ A;  3M4O J;  3HOZ J;  3BT9 A;  5KK1 A;  1RR8 C;  1Z0X A;  3D0S A;  4RAG A;  2R3S A;  2DA6 A;  3DQV C;  3KET A;  4OIP F;  2LR8 A;  5AIQ A;  3JAM Z;  4LGW A;  3KFW X;  1F5T A;  2QEX I;  3BZC A;  2IA2 A;  2K9S A;  2QKL B;  4KJZ A;  4EJV A;  3LAP A;  1HDP A;  3HSR A;  4YII A;  4BJ6 C;  1RNL A;  4E7K A;  1U2W A;  2LC2 A;  5C44 J;  3MCZ A;  4IHV A;  1MSF C;  2DFI A;  3L2W A;  5F1J A;  3ZMS A;  2HKX A;  1ACI A;  4H4K C;  3JRE A;  1LE8 A;  1H9G A;  1HST A;  5ICF A;  1IDZ A;  3FXK A;  2XAJ A;  4BH9 A;  1K4T A;  1SD7 A;  4I98 B;  2GIZ A;  4KN7 X;  2W24 A;  4EJO A;  1A5J A;  1Z21 A;  3BR2 A;  4CZZ A;  1YW7 A;  1POG A;  2F5E A;  2V1D A;  1QO0 D;  1NG7 A;  4WF2 A;  3IH2 A;  2BHZ A;  3I4P A;  4MO7 A;  5BOX A;  2IPQ X;  2MFZ A;  1MJA A;  5DD8 A;  1U0J A;  2CV0 A;  2F4I A;  2KKO A;  1AA7 A;  1Z3X A;  3DP7 A;  1MDM A;  2IA1 A;  3W3C A;  1UJ8 A;  2KDO A;  1UEL B;  5J4Y A;  3FXJ A;  4IOC F;  2CQX A;  3NAR A;  3CCV I;  4IXA A;  2STT A;  3B02 A;  4CDG A;  3ZRG A;  3RI4 A;  1R1T A;  4U0V A;  3TOA A;  4Z2Y A;  1W4M A;  4CYD A;  1S7E A;  3IKV A;  5HOD A;  2OPT A;  5GP9 A;  5FD6 A;  3LSG A;  1MBJ A;  1HBX G;  1I6H J;  3PL8 A;  5D4S A;  3OYA A;  1J59 A;  4JOM A;  3BQY A;  2CFX A;  3TDZ C;  3RDI A;  5IYC J;  3C2G A;  4ITV A;  4LG3 A;  2ZFU A;  1XTA A;  4B43 A;  5ED4 A;  3F8C A;  1FP2 A;  4EVI A;  4HDU A;  1YQA A;  2A5Y B;  2TRT A;  1L0O C;  1IXR C;  1Z6R A;  2FNP A;  2ESN A;  3HTU A;  3JSO A;  3R61 A;  5CQE A;  2GA2 A;  1Y39 A;  3RIR A;  1BW5 A;  5DM7 F;  3WTX C;  2JPB A;  4X0G A;  1FYM A;  1ETQ A;  1SVL A;  3QRF F;  3JRA A;  1X2M A;  5B5E C;  1TZL A;  2IP2 A;  4RM2 A;  1W0T A;  3SEQ A;  4YRV A;  2XRO A;  1ZQ3 P;  2QSG X;  3LSI A;  2VXZ A;  3ECH A;  2E1O A;  3O3K A;  4ANJ A;  1OCC H;  4EM2 A;  1X58 A;  5LGN A;  2QM3 A;  1YIO A;  2O03 A;  2EIM H;  1S9H A;  4YG2 F;  3KYD B;  1HKS A;  3QAH A;  3KP5 A;  4RLF A;  1GLN A;  4N9H A;  1AU7 A;  2JA5 J;  4GXO A;  4HNV A;  5D5V B;  2VPL A;  2K5C A;  1FYL A;  4DYC A;  4U7B A;  4MQ9 F;  2CW8 A;  2DA2 A;  3BY6 A;  3K1P A;  4YFN F;  4GRI A;  3I56 I;  4RA2 A;  1YX3 A;  2MD5 A;  2K4B A;  3OWT A;  5JVT A;  4A3I J;  4I2O A;  3SZG A;  1U5T A;  2A05 A;  2DT7 B;  4E7J A;  1B72 A;  3S17 J;  4PJN A;  4X6A J;  3CUQ B;  4PJ0 C;  4C2T A;  3S2D J;  1WI3 A;  3WTV C;  2HOS A;  3PO3 J;  3MKZ A;  5FLX K;  2BW3 A;  4HOB A;  4NC6 A;  1A6Q A;  4RBO A;  2GM4 A;  4F52 A;  3MWM A;  4MIM A;  1GVD A;  2VT2 A;  2ZSH B;  5GAE J;  5IPA A;  4PGG A;  3OR2 C;  3S15 J;  4BHC A;  1Y1V J;  1IN4 A;  3PFY A;  2XRN A;  3FXM A;  1BI2 A;  3WTZ A;  2QEN A;  2F4M B;  2K9Q A;  1LFP A;  2EIJ H;  1MIJ A;  2M4K A;  3E5Q A;  4M6V A;  2WAQ N;  4WX9 A;  3S2H J;  1TWH J;  2IW5 A;  3DBL B;  1PUE E;  3QYB A;  4JQF A;  4X1E A;  4MLO A;  3T1B A;  4I6Z A;  1XSD A;  1QRY A;  2W00 A;  1X4P A;  4M9X A;  4BQO A;  5BMZ A;  1VQN I;  5AON A;  2RV8 A;  3QU6 A;  4RGR A;  2DAO A;  2LKS A;  2JJ7 A;  2NAZ A;  1T56 A;  2M7B A;  2V6C A;  3EDP A;  2O61 A;  1MH4 A;  3VDX A;  1U3E M;  2IS4 A;  1LVK A;  2EA4 A;  3KLO A;  3CCE I;  5IT9 Z;  3FKI J;  4ESB A;  4HLX A;  1MNE A;  2OA4 A;  5JHF A;  4WK8 F;  5M5W J;  5D6F A;  4XL9 A;  5GPA A;  4IX7 A;  3J7Z I;  2F4O B;  3SFI A;  1SFX A;  2X1D A;  1P4X A;  5FFX A;  1XD7 A;  2LKP A;  4EMS A;  3T8R A;  2XAF A;  3CME I;  2BY1 A;  2HZT A;  2KZV A;  5TRD A;  4BQN A;  1G4D A;  2R4G A;  2UZK A;  2R7Z J;  4GYG A;  3OY9 A;  2W1O A;  4C9Y A;  2ID3 A;  1Y8Q B;  3GLX A;  2IS2 A;  2GZW A;  1H0M A;  4GGG A;  1LVA A;  4Y17 A;  2P7C B;  3MN2 A;  3ERM A;  1ETO A;  1T0F C;  1HW5 A;  4L5I A;  2KIQ A;  2LY9 A;  2PMU A;  3E0J B;  4M74 A;  1TWG J;  5B3S H;  3GTP J;  2DA3 A;  4EGZ A;  3GFM A;  1MND A;  3G1L A;  3KP7 A;  3MZ8 A;  3KYL A;  5CJ9 A;  2UV1 A;  2JUG A;  2E5N A;  2Z1D A;  4HPQ A;  2Y48 A;  4BXU A;  3W2A A;  1D8J A;  3PNT A;  1F9N A;  2AQE A;  3IL2 A;  1OQY A;  3KZI C;  3RPU D;  2QGU A;  4J01 A;  4Y52 J;  5J3L A;  2HI3 A;  1W7P A;  2NS7 A;  2YX4 A;  4N4O B;  4U7D A;  2ME0 A;  2JSP A;  2K40 A;  3ESW B;  1MBH A;  1T38 A;  2IGM A;  2MH2 A;  3BZ6 A;  3A0B C;  4JP0 A;  3LL7 A;  2ADU A;  2BY2 A;  2DW4 A;  4I76 A;  2Q8K A;  1EH7 A;  3V7R A;  3ERE D;  4A0Z A;  5F64 A;  3OS0 A;  4ZJZ A;  1J2X A;  3LSJ A;  3ECO A;  4LIT A;  4L9T A;  2QQ8 A;  3JRB A;  1ON2 A;  2AXT C;  1WCM J;  1FSE A;  2ELH A;  5HDG A;  5J8C A;  3TO7 A;  2W82 A;  3G73 A;  1XDS A;  4A3K J;  3ZMZ A;  5EEH A;  5EEA A;  3TO9 A;  3NRV A;  3C1D A;  3OYE A;  1MMG A;  2WY7 Q;  3D5R C;  3S1R J;  1ZGW A;  2DYR H;  3HG9 A;  2DI3 A;  5J40 A;  1BM9 A;  5E17 F;  5FRO A;  2HZD A;  3OL4 A;  5C3E J;  3GTK J;  4Q5S F;  5DM6 F;  5FKO A;  3HOS A;  3ZMD A;  4PDK A;  3NEU A;  1DPU A;  3QPH A;  4BKX A;  1TTY A;  1X1B A;  3FX3 A;  5FRM A;  4QLC U;  3S16 J;  1RUO A;  1IV8 A;  4G6Q A;  5IYD J;  3ZQQ A;  5J4V A;  2X6O A;  4D0P A;  2ECB A;  2UXX A;  3LA7 A;  1B9M A;  3QP6 A;  4CCJ A;  2M2E A;  2BBY A;  1I5Z A;  3S3O A;  1ETX A;  5ICG A;  5HDK A;  1ULY A;  1WJB A;  3IUO A;  3OSF A;  3ZQF A;  4A6E A;  4WXD A;  5FKN A;  3KIO A;  1WJD A;  1FNN A;  3L09 A;  3KPH A;  4BJ5 C;  4P96 A;  4M73 A;  4GYI A;  2CWE A;  3FK7 A;  1SFU A;  3HSE A;  3HGG A;  4I01 A;  2DMU A;  3LFK A;  3TP3 A;  2OCC H;  3DV8 A;  3GXO A;  1TWA J;  1I3A A;  1IN8 A;  2A5W A;  3KYC B;  2OAZ A;  1J7K A;  1G3T A;  1MZB A;  1TW2 A;  2M1B A;  2VKE A;  1OCP A;  2P5L C;  3FMR A;  1TT5 B;  2WB1 A;  1ZH5 A;  1FOK A;  3V8L A;  2G7H A;  3IAS 2;  1EH6 A;  3H3Z A;  1R49 A;  1IXC A;  2FMY A;  5DTD A;  3G6E I;  5J1U A;  2XAU A;  4A5N A;  3FXL A;  3W6V A;  1VZ0 A;  3S32 A;  4XLF A;  4XRM A;  1PP7 U;  1ON1 A;  5E1W A;  2L01 A;  1RUN A;  2ZSI B;  1A36 A;  2LYC A;  3DFG A;  3KEO A;  2M87 A;  2XRL A;  5FD5 A;  4ZDP A;  2R5Z B;  1IN7 A;  5ILV A;  1I1G A;  5E3M A;  1APL C;  3DPL C;  4PSW A;  2X51 A;  5FGM A;  2RRE A;  3MZH A;  4XKV A;  4LLL A;  1TW3 A;  2F6C A;  2P6T A;  3H92 A;  4B09 A;  4NDL A;  5KAF C;  2IGN A;  3PUF A;  4TV7 A;  1MH3 A;  3NWT A;  3MKW B;  3K0L A;  3BG9 A;  2PQ8 A;  4UHT A;  1X3U A;  5DCF A;  2IT0 A;  4EJT A;  2L7F P;  4M6X A;  1FBU A;  1O3R A;  3HC7 A;  2LH9 A;  2OQG A;  2DOE A;  1ZN2 A;  2YX7 A;  3BPV A;  2NVX J;  1UFM A;  3K6G A;  3BG6 A;  1EJ9 A;  5C4J J;  1D5V A;  3R6S A;  1P9Q C;  4JYK A;  3KP3 A;  3HRU A; 
#chains in the Genus database with same CATH homology
 3OOU A;  3ZQL A;  5DS9 A;  4MFD A;  2OF7 A;  3BR1 A;  3C2B A;  5J1R A;  2LD5 A;  1ITY A;  1ZK8 A;  2XGC A;  4MFE A;  2M34 A;  1UG2 A;  2IAI A;  1U8B A;  2MSY A;  1IDY A;  2L9R A;  3BQZ A;  5EG0 B;  2VI6 A;  5M3F J;  1BJZ A;  1QPI A;  3S1N J;  4BBS J;  4UUT A;  3BTC A;  2R5Y B;  5FKM A;  2IEK A;  1JT6 A;  3BR3 A;  2H8R A;  3HBL A;  1MNM C;  1HCR A;  3GTO J;  1B8I B;  4LOC A;  5F04 A;  4D7M A;  2DMP A;  2NOG A;  3Q0W A;  3VPR A;  1YRN A;  1PUF B;  4JX5 A;  2NVT J;  1IV6 A;  1ENH A;  1P7J A;  1NTC A;  4ABZ A;  1NK2 P;  3JRH A;  4A3E J;  5FLM J;  2Y31 A;  1RKT A;  1MSE C;  1WPK A;  2MG4 A;  4A3L J;  4AC0 A;  1VF9 A;  4QTR A;  3GTJ J;  1W0U A;  4QSH A;  1FTT A;  1TC3 C;  3WHB A;  2JWT A;  3GTL J;  3IH3 A;  3HOW J;  5JLW A;  4UUS B;  3QPS A;  1X2N A;  1OJL A;  3FIS A;  1E3O C;  1GUU A;  2FD5 A;  4C3H J;  1WH5 A;  3B6C A;  3G1O A;  3JRD A;  4V2F A;  1LFU P;  2R92 J;  5F08 A;  4FIS A;  3FK6 A;  2Y9Z A;  2DMQ A;  2VUM J;  4DZP A;  1JTX A;  2HQ5 A;  2LP0 A;  1MBK A;  4L5E A;  2L7M P;  3Q0V A;  3BG3 A;  5IP6 A;  3A01 B;  2B63 J;  2DA1 A;  2FX0 A;  1HLV A;  1I3Q J;  3JRI A;  3BR6 A;  3M4O J;  3HOZ J;  3BT9 A;  2KT0 A;  3OIO A;  3LNQ A;  1Z0X A;  2KDZ A;  2DA6 A;  4M3D A;  2LR8 A;  5FKK A;  2JMW A;  3LSR A;  2K9S A;  4FE7 A;  1HDP A;  2QF7 A;  1ZTR A;  2LVS A;  2WV1 A;  4RDU A;  5C44 J;  4IHV A;  1MSF C;  2I10 A;  5F1J A;  1JKP C;  4BY1 J;  3A03 A;  1JKR C;  3JRE A;  1LE8 A;  1K61 A;  1IDZ A;  3O8G A;  4GFB A;  1IUF A;  2E2J J;  1XC5 A;  2XGE A;  1HF0 A;  3GTG J;  3HOY J;  1CQT A;  3HB9 A;  2DTZ A;  1A5J A;  1H89 C;  3BR2 A;  1XG1 A;  2VPR A;  2LTP A;  4QIW N;  4A3F J;  1POG A;  1ETK A;  3H3V K;  4DYQ A;  3IH2 A;  4Y7N J;  4MO7 A;  2M0C A;  1AHD P;  1D5Y A;  3S1Q J;  4M3B A;  4XRS G;  4C2M J;  3HGY A;  2O8K A;  1EF4 A;  2DA5 A;  5M3M J;  3E7L A;  2CQX A;  3NAR A;  1UMQ A;  3CDL A;  2Y2Z A;  2M8G X;  3RZO J;  4C3I J;  2LKX A;  3K7A J;  3S14 J;  1S7E A;  5HOD A;  2OPT A;  1JT0 A;  2XPW A;  3TW7 A;  4C3J J;  4JX4 A;  5GP9 A;  3LSG A;  1MBJ A;  2M9H A;  2MGQ A;  4CYC A;  4EEF G;  3HDD A;  1I6H J;  3LSP A;  3BQY A;  3BTJ A;  5EDN A;  1R9T J;  1GV5 A;  1H88 C;  2EH3 A;  5IYC J;  1VFC A;  2JA7 J;  5F27 A;  3Q0U A;  1O4X A;  1F36 A;  3IV5 A;  4IHX A;  2TRT A;  4B3A A;  4D5C A;  2ID6 A;  2XSD C;  2E2H J;  1BW5 A;  3M3Y J;  5EGO B;  4A69 C;  2W48 A;  2XB5 A;  1ETQ A;  2HDD A;  2X9D A;  1X2M A;  3JRA A;  5K7F A;  1W0T A;  4AUX A;  1ZR4 A;  5FLV A;  5E3L A;  1FJL A;  1ZQ3 P;  2RAE A;  2Y30 A;  1HDD C;  2E1O A;  2COB A;  3ZQG A;  1X58 A;  5IP7 J;  5EZG A;  2R5Y A;  1HOM A;  1YRN B;  1P7I A;  2AHQ A;  1ETV A;  3Q3S A;  5IOZ A;  2N8G A;  2HOT A;  2Y0S N;  3BTL A;  1IGN A;  4D5F A;  1AU7 A;  4DW6 A;  1XS9 A;  2JA5 J;  4HNV A;  2L7Z A;  4DYC A;  5F0C A;  1JKO C;  3BR0 A;  2GBY A;  2DA2 A;  4A3G J;  2GLO A;  1JKQ C;  3L1P A;  1PUF A;  4G12 A;  4A3I J;  2NVY J;  5FJ8 J;  1DU6 A;  3S17 J;  3JRG A;  1B72 A;  2JA8 J;  5C4X J;  2HOA A;  4X6A J;  4W1U A;  3S2D J;  5E3N A;  1VND A;  1WI3 A;  2NS8 A;  3LOC A;  4AYB N;  3ZQC A;  1GT0 C;  2HOS A;  3PO3 J;  1VI0 A;  1OCT C;  1BW6 A;  3TED A;  3SDG A;  4RBO A;  2GM4 A;  2JN6 A;  1RPW A;  4B1R A;  5IOY A;  4MIM A;  4B4C A;  1GVD A;  5EZH A;  1JJ6 C;  5IPA A;  2CUF A;  3ZQH A;  1U78 A;  3S15 J;  2EBI A;  1JGG A;  1Y1V J;  1G2H A;  2HYJ A;  2JA6 J;  1SAN A;  2K9Q A;  5E3O A;  3DCF A;  4M6V A;  2ELK A;  2WAQ N;  2QCO A;  5EYR A;  1AKH A;  3S2H J;  1TWH J;  1A6I A;  4X1E A;  4MLO A;  4I6Z A;  1QRY A;  1ORK A;  9ANT A;  2LFB A;  4A3M J;  1JUP A;  4IHY A;  2DA7 A;  3MVP A;  2FJ1 A;  1FTZ A;  2JJ7 A;  2ZB9 A;  1T56 A;  1LE8 B;  1FIA A;  1JTY A;  1MH4 A;  1FEX A;  2G0E A;  3PO2 J;  2E19 A;  4FTH A;  2XGD A;  5EF6 A;  2NVQ J;  3FKI J;  3HOV J;  2DA4 A;  3HEF A;  5M5W J;  3I4N J;  3BG5 A;  2WB1 N;  4A3B J;  1QVT A;  5GPA A;  3FIW A;  3TP0 A;  3SFI A;  2E2I J;  2DJN A;  1IRZ A;  3O8H A;  4J19 A;  3CQZ J;  1MBE A;  2R5Z A;  2CUE A;  4A93 J;  5JLX A;  2EQR A;  2R7Z J;  5GPC A;  2ID3 A;  2YS9 A;  4IHW A;  4V2G A;  3TW6 A;  2CU7 A;  1ZKG A;  3MN2 A;  1ETO A;  4CYC B;  1WH7 A;  2LY9 A;  4JX6 A;  1TWG J;  2DMT A;  1ZR2 A;  2DA3 A;  3RKQ A;  3GTP J;  3G1L A;  4XRS A;  2Y9Y A;  4BBR J;  1RET A;  3F0C A;  1MBG A;  4BY7 J;  5IP9 J;  1OFC X;  4Y52 J;  5J3L A;  1I50 J;  2HI3 A;  2NS7 A;  2ME0 A;  2K40 A;  1MBH A;  5BNG A;  1FIP A;  1IC8 A;  4JP0 A;  4I76 A;  4FE4 A;  5EG0 A;  2FQ4 A;  2JK3 A;  5F0F A;  3D1N I;  5J1Y A;  3LSJ A;  5F0H A;  3HM5 A;  3GTQ J;  1BA5 A;  2TCT A;  3JRB A;  3NAU A;  2K9N A;  3BTI A;  2ME6 A;  5IYB J;  2MW8 A;  1WCM J;  5M5Y J;  5EGO A;  1ETY A;  2EZL A;  4A3K J;  1B8I A;  1T33 A;  4DYR A;  5EEA A;  2LK2 A;  3SJM A;  3CCY A;  2AO9 A;  3B6A A;  3S1R J;  1GDT A;  1ZGW A;  1RKW A;  2CRG A;  4XID A;  2HXI A;  3JR9 A;  1F43 A;  5C3E J;  1B72 B;  3GTK J;  4M3F A;  3K2A A;  3JRC A;  5FKO A;  3GTM J;  3DEW A;  4BKX A;  1UHS A;  3S16 J;  1Z77 A;  4UUS A;  5IYD J;  2XB0 X;  1JJ8 C;  1U9O A;  1RES A;  2XPV A;  2D5V A;  3WHC A;  2X6O A;  3ZOB A;  3A02 A;  2ECB A;  3S1M J;  4S0H B;  2M2E A;  3HKZ N;  1ETX A;  3OSF A;  2O7O A;  3ZQF A;  5FKN A;  3ZQI A;  1JUM A;  3A01 A;  1U9N A;  4W97 A;  1TWC J;  3FK7 A;  1DU0 A;  3PM1 A;  3HGG A;  2DMU A;  1AKH B;  3TP3 A;  5M5X J;  4XIC A;  1MBF A;  4A3D J;  3H0G J;  2VKV A;  1TWA J;  3RZD J;  3JRF A;  3QPL A;  2P81 A;  2R0Q C;  3I4M J;  1Q1V A;  1WGX A;  2EZH A;  2X48 A;  4M3G A;  3UKG A;  5K7Z A;  4A3J J;  2EZI A;  2YU9 J;  3HOX J;  3QQA A;  2VKE A;  1OCP A;  1NK3 P;  2CJJ A;  1K83 J;  2IBD A;  2PMZ N;  3HOU J;  1JUS A;  5DTD A;  4D7N A;  5J1U A;  5K7H A;  3G1M A;  3W6V A;  4XRM A;  1QVU A;  2H1K A;  2LLK A;  3MKL A;  2DMN A;  1ETW A;  4M3E A;  2XRL A;  2R5Z B;  2EZK A;  5E3M A;  4FCY A;  1IG7 A;  4BXX J;  2YUS A;  1TWF J;  1APL C;  4DZJ A;  1RR7 A;  4IEJ A;  1BL0 A;  1Y1W J;  3BR5 A;  1IJW C;  3RQI A;  3CMY A;  2R93 J;  1GV2 A;  4NDL A;  2CQQ A;  2L0K A;  1MH3 A;  2XPU A;  4XK4 A;  3BG9 A;  1H8A C;  2HXO A;  3GBG A;  2O9L A;  2L7F P;  5FKL A;  1SFO J;  2NVX J;  1LFB A;  2ECC A;  5C4J J;  4A3C J;  2DN0 A;  3IH4 A;  4JYK A;  3OSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...