3OMYA

Crystal structure of the ped208 tram n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
51
structure length
51
Chain Sequence
PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protein traM
publication title Structural basis of cooperative DNA recognition by the plasmid conjugation factor, TraM.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3omyA00
1DP3A 4QPQA 3OMYA 4QPOA
chains in the Genus database with same CATH superfamily
3HKZN 5ICEA 3TO7A 2DA6A 2NVYJ 4R79A 2LSOA 1DPUA 4HEA2 4CICA 4I0AA 1X3ZB 2BGCA 1FWZA 2W25A 3U9GA 5DUKA 2M7AA 4I99C 4XSXF 1T08B 5ED4A 3MKYB 3FHZA 3AG2H 5DYMA 1H89C 5FRNA 4OIQF 2CFOA 2G0EA 3CC2I 5E3MA 3KP5A 2R5ZA 1FSEA 2IS4A 5JFRA 3SDGA 1IUYA 5GAGJ 5FRMA 2FJ1A 5KHDA 1X3WB 2BEOA 1FP1D 3LAJA 4Q48A 3GTLJ 4HF1A 2GOXB 2AO9A 2M0CA 1O4XA 2I8DA 3JAMK 2R7SA 2F48A 2VXDA 1H88C 3OSGA 1SFUA 3FDYA 4X0GA 2K40A 3BJ6A 4EV0A 4XN0A 2NOJB 2XAJA 3RPUD 3BTIA 3JCUC 3OYMA 1XC5A 2ZJ2A 5DV5A 3J81Z 1LB2A 1QA6A 2VN2A 2LY2A 2ZJQF 1X19A 1WJDA 1LFPA 2A05A 5FFXA 1WRJA 3PUFA 2L4AA 2NYXA 2ECBA 3Q9SA 5JI6A 5E8IA 4CA0A 2O03A 3AG1H 4GFBA 4D1QA 3A4CA 2FQ4A 2COMA 1TQMA 1J59A 1TLHB 4J00A 4KA4A 2D1HA 5EJCA 4IQJA 4XONA 2LY9A 5AIQA 4YIFA 1HKTA 3GZNB 4PGHA 2A5YB 3L2CA 2IBDA 2KL4A 3MAJA 2HYFA 3BC8A 3LSGA 3GFJA 1EA3A 2L5QA 2LKXA 2Y31A 3TGNA 4ZZDA 3CMMA 3OYIA 3CP2A 4XLAA 4BE1A 5C44J 4I2OA 1VZ0A 5B1BH 1MBEA 2R7WA 4XQFA 3CMAI 1DGRM 1KU2A 4BEHB 3P9CA 1IN6A 4QTRA 4PJJA 1EKEA 3VEPA 2E1MC 4CYCB 1T98A 1S7OA 1BC7C 3F8FA 4E7IA 3S1MJ 1IRZA 4OMZA 1GXQA 3C2BA 2VXZA 1G4DA 1LKXA 1KQ0A 3OYNA 2H09A 3RDIA 2FOKA 1N25A 3DU6A 4OOIA 2XAQA 2XV4S 1PYVA 1JHHA 3CP8A 4G7OF 3ASNH 5HLGA 1TWAJ 1VTNC 2NNYA 1HA8A 3OYCA 4HPQA 1XD7A 3QPSA 1YI2I 2L7ZA 1IXRC 1WI3A 3VYSB 3GTGJ 3HRUA 2QZ8A 2KZGA 3FXKA 1W36D 1FZPB 2R7XA 4PJNA 2DT5A 3L1PA 2PG4A 3OS0A 1MBHA 4D5CA 1XGOA 3A1YA 5LHIA 4RDUA 3S14J 4IVNA 4RMNA 3RJPA 2VKHA 2X85A 5TGTA 5FROA 3RCOA 3K69A 4GRIA 1LVAA 1BOBA 4Q4ZF 2OV7A 4IKFA 3TO6A 3HSEA 4M72A 3ZR8X 2ME0A 3FXQA 5JLWA 1R71A 1BI1A 3MZYA 4PJ0C 5JLXA 4E6KG 1CF7B 3EYIA 3A2KA 3RPQA 1FBSA 3W6KB 3WGHA 3Q9VA 1R9TJ 2HVSA 3FIWA 2STTA 3BLYA 3LL7A 2Z2SB 3I55I 4IOCF 4UV8A 1B8IB 2FA5A 3W3CA 4BQOA 1OR7A 4CCKA 1V5GA 2DA2A 5E8GA 4LB5A 2EFOA 3QODA 4OAYA 2HQNA 5FLMJ 1ZLKA 1WH7A 4A12A 2L7FP 2VI6A 5CVIA 4XOTA 2BVMA 2Q2EA 3CCQI 4RB2C 2QGUA 3GZ6A 1OCCH 1OCOH 1B1BA 2ETHA 4HOBA 1VQOI 3SHFA 1PUFA 3VFZA 3GXOA 1YO5C 3FXLA 4YIIA 2DTZA 3BZCA 4A3JJ 1JJ8C 2HPMA 2PFBA 1YX5A 4ETSA 1XSDA 2XKOA 2JSCA 5D6EA 3CMEI 2E2JJ 4IQ4A 1HDDC 1BI2A 1JKQC 4LIUA 2R7UA 2ZXJA 2BHZA 3TO9A 4CXFA 2A3SA 3CQZJ 3C7JA 3KCCA 1X3UA 2HPIA 3CUQB 3E0JB 3I4PA 1WJCA 4CZZA 4NQWB 4FHTA 1A04A 4LG3A 1FLIA 4I09A 5CJ9A 1KZHA 3ZMDA 1ZREA 1YS6A 1ZG1A 3GF2A 3K7AJ 3WTWC 4OIOF 2V4JC 3EUAA 3LSJA 1BI3A 1RC9A 3ZMSA 1SD7A 2M3AA 4OIPF 4XK4A 1XPXA 5M5WJ 1MSEC 4GGGA 4IJAA 3J7AY 4BJTA 3R60A 2KJBA 5DD8A 2CFXA 3V42A 1VF9A 2R7VA 3ZQLA 3A02A 1T39A 1S5LC 1S6LA 3C18A 2Y75A 2BOLA 1PUEE 3CCLI 2KIQA 2XF5A 3BY6A 2HQRA 1LEBA 3GO5A 4QWQA 3SZPA 1XSVA 3MWMA 3J81K 3A03A 5KAIC 1BW6A 1R22A 3QPHA 1TT5B 4GO1A 4N0BA 2E7WA 4NNJA 2LFBA 4RS8A 2Y30A 3X2QH 4LOCA 3L2VA 3T5XA 2VBXA 2XPVA 1G3YA 3QYBA 2H6BA 4M6XA 3CCMI 4IRIA 2IRFG 4C2TA 1IXSB 3RKWA 4B47A 1OYYA 4PGGA 1NG6A 2RQPA 1SFEA 1D0XA 1K78B 2WB1N 3N97A 4UUSB 2WAQN 1HXDA 5E3OA 1SMTA 3F6VA 3FBNB 2HDWA 2W00A 3I4NJ 5J6XA 3K70C 1OQYA 3BTLA 1WH5A 2DOAA 1SD6A 4LGWA 1Y0NA 3SEQA 4HSTA 1IXCA 2DA3A 4BHBA 2ZJRF 1A6QA 1HKQA 3CDHA 3BPXA 3L9FA 3OYDA 5J1UA 1Z77A 5CVUA 3V7SA 4E7LA 3QOPA 1ETOA 1U9OA 5L3DA 4EJVA 2DO7A 2HR3A 3TQNA 1KYWA 4A3MJ 3BG5A 1RKWA 3O8HA 3GTPJ 2KDOA 4L0ZB 3PL8A 2ZMEC 5DCFA 2EB7A 3DEUA 1WQ2A 2TDXA 2CS3A 1R1VA 2L9NA 1OJLA 1J0RA 3VSKA 1B9NA 2WC2A 1T2KA 4Z2YA 3ZP5A 4XSZF 2K02A 1XDSA 2IGMA 1YFHA 3W2AA 3TL4X 3K4BA 1W5CC 3OIPA 2BXYA 3DLAA 3H1CA 4DW6A 3CTAA 2Y69H 3EUHA 4BAYA 4XKVA 4KN7X 4I76A 2AQEA 4KT6A 2HOSA 2K5CA 1YQAA 2OJED 1BIBA 3O6BB 4MEXF 2VT3A 3F0CA 4ESJA 5J40A 1TP4A 2PX9A 2NS7A 2PJRA 1LUJB 3TDZC 3SYTA 1X1DA 5EGOB 4I6ZA 1BIAA 1UHMA 5E17F 3ZMZA 2MLKA 1B6AA 4HA8A 4UV9A 2GQQA 4XRSA 2IAIA 2K9LA 1WHUA 4QPOA 1ZRFA 2MC4A 1ZR4A 4EM0B 2V9PA 1YRNB 3KEOA 1ETKA 5LGTA 2AS5F 5DM6F 1IRGA 3BROA 1MZBA 5IPAA 5HNHA 3S93A 2VC1A 4FTHA 4KDPA 4PSWA 2E35A 1WJFA 4F91B 4G8XA 2ISZA 4MEYF 3OYKA 1NTCA 2D5VA 3F72A 2H94A 3WTTC 1SMYF 1FOWA 2LYCA 2LP0A 1TC3C 1GLNA 3G6EI 5J1YA 4HNVA 1H8AC 1V5EA 5D8KB 4RGRA 3QP6A 1ETYA 1MDMA 4UY8I 1NHAA 3I5UA 5EG0B 3W6JB 2ZJPF 2QQBA 3S8PA 5GP9A 3TW7A 3MQ0A 4NC7A 2Y0SA 1AKHB 2M9HA 1W7PA 1CF7A 2VT2A 1QU3A 1HQCA 3DWLE 2OC6A 3S3OA 2LKPA 4DBQA 3J7ZI 1JI8A 2C6YA 5K7ZA 1MJAA 2XAHA 1TWGJ 1ZRDA 1R58A 2BV6A 2EZLA 1B8IA 1MGTA 3GTQJ 3CJQB 2X9DA 4F93B 4MTDA 2DA4A 3CCVI 1ZR2A 1ENHA 3EUKL 5F27A 2KT0A 2VIXA 4EVIA 2L54A 1FIPA 5FKLA 4LK0F 4XLEA 4ZJZA 3WTVC 5HLHA 3V8LA 3K2ZA 3ISPA 3MD2A 1AOYA 2EK5A 3DQVC 3U2RA 3OYLA 2DN0A 2HKOA 1ODDA 3E7LA 2GOMA 1SFOJ 4V19K 1Q1HA 1ZG5A 2H1LA 4YG2F 4P1WA 4ENJA 2JRTA 5H6QA 2JPCA 4NC6A 5ICFA 2R7QA 1YIOA 1O57A 5JHFA 4BXFA 1D1CA 3B6CA 1XS9A 1MBKA 2JUCA 2PI0A 4B1RA 3FHNA 4CZCA 5KAFC 4NQWA 2I10A 3FBIB 5GTHC 4D7NA 4RAYA 3KYLA 4L9TA 4IOAF 1X58A 3DLLF 2DPUA 1FP2A 1ZARA 4ON0A 5LHHA 2EIJH 5E3LA 1FOXA 3GTMJ 1Z91A 3F8BA 5HLTA 5HOOA 4CDGA 4LLGF 1MSFC 3ROUA 4IRGA 2FF4A 2WY8Q 3BR0A 3OWTA 3WU1B 3A0HC 4XM3A 2XHKA 5FKOA 4CCOA 2GXAA 3H0GJ 4RB3C 1TQIA 3H5AA 1GHCA 1UB9A 3S15J 2V9VA 3FISA 2RKHA 2NXNB 4KN4X 4EQQA 1QZYA 2Y9YA 4AIHA 1QPIA 1XGSA 4ZTJA 3ZN1A 1X1BA 1UFMA 3MCZA 5LRRA 2IS6A 2EV0A 2YX7A 2JN6A 2VB6A 2QKLB 2FUG2 5LEJA 2ZCWA 4HDUA 2HTSA 1S29A 2HVQA 2DTRA 3HEFA 4OMYA 2M34A 3KX2A 2LMDA 4Y33A 1DU0A 3CC7I 4YFNF 4A0XA 1X1PA 2Z5UA 3CCRI 4BGDA 3DV8A 2XSDC 1EF4A 4L18B 4DYRA 1X1AA 3PIPF 2PMZA 3CCEI 2EV6A 1VQ9I 4A3DJ 2BZTA 2Z3YA 2QVOA 4MO7A 1LVKA 1H0MA 2VJJA 1IC8A 3I59B 3ERED 1HW5A 3KPHA 2P6TA 2YU3A 3I9V2 4ZZLA 5LGNA 1KU7A 1SAXA 2HOTA 4R8HA 4LJZF 2MW8A 2VQHA 4BHPA 4N9HA 1HSTA 3C2HA 4AVPA 3F8MA 1F36A 3K10A 1JT6A 2A6HF 4ENMA 2XAFA 3HOUJ 3GBGA 1V4RA 3JRGA 1G59A 4KITB 1E3OC 3ECOA 3B6AA 3S2WA 2MSYA 1ZHFA 2F4MB 3W2WA 1OKRA 2O6GE 3H3UA 4NDLA 1X2NA 2KISA 2EFPA 2MFZA 1BI0A 1QVTA 5DEQA 2DFHA 3HOWJ 2ZMEB 3GVAA 3DEEA 4D5FA 2L9SA 2MG4A 3GLLA 2IXSA 2QEXI 2RNJA 1T6SA 5EGOA 4V2GA 3FMQA 5LD2C 4BJ5C 3ABLH 5F08A 4FETA 2ZSIB 3H0DA 2FRHA 5L3BA 5M3FJ 3CC4I 1H9TA 1FTZA 3BJAA 3WTYC 1ZKGA 3DTEA 3M8FA 2DOFA 4MGRA 1W36C 2CV2A 4HRIA 2W4SA 2M5WA 2QQ8A 5D5UB 1VQNI 3RKQA 5FFZA 2D1VA 1VI0A 2EA2A 2UV1A 1PUFB 2WTEA 2QA4I 3F6OA 4FE4A 4JQFA 3I53A 2V6CA 4EMSA 3HDDA 4M73A 1MBFA 3OIOA 3R0AA 2X0LA 5E1XA 1ETQA 1YS7A 5L3EA 2DYSH 4BY7J 2G7HA 2JT1A 2LTPA 1NG7A 1MD0A 2WY7Q 1Z05A 3BPVA 4UXNA 5LLQA 4C2UA 1J75A 2WAFA 1EH6A 3IAM2 3HKZA 3HTSB 3VWBA 3D5LA 5B5EC 2NAZA 4HAMA 1FOYA 4MFDA 2W57A 3MFKA 3SEZA 1KONA 2F5DA 2ECCA 3BR3A 1REPC 4YFXF 1QHHD 1W1WE 4G94A 2MYSA 4YRVA 5CVJA 5ILSA 1NK3P 5FGMA 3JRCA 5B66C 3H5RA 4KMUX 2R93J 1AWCA 3VYTB 3HOZJ 5KVRA 2BBYA 2E2IJ 1TNSA 2VOPA 3FXRA 2VONA 5E1WA 1SEUA 2DCEA 3GMEA 1I39A 2VPRA 2JPBA 5M5XJ 3SDBA 2X6OA 2E2HJ 2VQGA 2P7VB 4P55A 2DLLA 2FQ3A 2A61A 3ONQA 2HU9A 3IP4B 5ICCA 2W48A 1K61A 1FBUA 3L2UA 1MNEA 2Z1DA 2BY1A 2M8GX 1JHFA 4XLNF 3AG3H 3B73A 2HI3A 1Z21A 3H9GA 2H1KA 3I3LA 3ZOBA 1QVUA 1J9IA 5M3MJ 4IHTA 4W1UA 1IN5A 1AHDP 1DU6A 5E1ZB 4F55A 2L9RA 1Y8QB 3BQZA 3PQJA 3HGGA 3HL2A 3OS1A 1Y56A 2NS8A 1YOVB 4C9YA 1VQ6I 5EF6A 1YE9A 2ELJA 2XGEA 4DNCA 2YS9A 4A3CJ 4AD9A 1MJ9A 5HVQC 4N9IA 4PJLA 2W7NA 4PK4A 3HPGA 5HDGA 5D8LB 2B7EA 1K4TA 2Z9OA 1Z6TA 2M87A 4F3QA 1TW2A 1WJ5A 2NOGA 3K4CA 3MKWB 2I5UA 2KQRA 3B02A 5EZGA 3L7WA 3PNTA 4CO8A 2HVRA 2OF7A 1MH4A 5JVGF 1BW5A 3VOEA 3ZMVA 1WZ2A 1WJAA 1EV7A 2Y0MA 3GYHX 2RREA 2RC4A 4FT8A 3EPZA 4U7DA 2A6TA 4ZH4F 3LFUA 4CGZA 1FC3A 1DGWY 2VASA 3CCJI 4PCQA 3GTOJ 2CV1A 2XRNA 3NWTA 2DODA 2VKDA 2EJRA 3BTJA 2K9QA 5F0CA 3WU0A 2EWNA 2G7UA 1O3QA 1YTYA 1FT9A 2R92J 1IV6A 4DYQA 3I59A 2OZUA 3BR2A 3M7GA 3CCSI 5J1RA 3ABUA 2W85A 3MVPA 3RSNA 3HHHA 2PJRB 1YX3A 1BJZA 4XLFA 1P2FA 2FXAA 2JK3A 5EEHA 2XAGA 4FQGA 3U1KA 3RYRA 3DEWA 3E5QA 2DA7A 2LREA 1D5VA 2F5EA 4KIGA 3WU2C 3N4MA 3HSRA 4L5JA 5F1JA 4P9FA 2TRTA 4A0YA 1P6RA 4CCMA 3H36A 2GXGA 1XX5A 4U0VA 3ZQQA 4B8XA 2IA2A 4KUMA 4U0WA 5K5RA 4IHSA 2X1DA 2PJPA 4Q47A 2CQXA 2LK2A 5DCMB 1VFCA 1DP7P 2NVUB 1Y8RB 1F43A 1MDMB 2YSRA 2DAOA 3NEUA 5LFAA 2ZMEA 4IHVA 2GXBA 2XIGA 2V1XA 3OYFA 2IS2A 1W7PB 4AIDA 1USTA 2K9MA 3LA7A 1U5TC 2Z33A 2EBIA 5L3GA 4RB0A 1R4MB 2CRGA 2QYOA 2FBKA 1D1AA 1IRXA 3QU6A 1U0JA 1E0EA 1P9QC 3O2PE 2HXOA 1UJ8A 4WCGA 4KFCA 4XIDA 2HQAA 1IGNA 1T56A 1W4MA 5KNLA 1XMXA 2DK8A 2BHYA 2P81A 4B4CA 3RZOJ 4IO9F 1VQPI 1E3HA 1G3TA 3GWZA 2VE8A 5L3CA 4R1HA 3F3XA 1A31A 3MMYB 1R4NB 3E6BA 5EZHA 4BU2A 4GYIA 4LD5A 2XC7A 3S3NA 1HF0A 3E6MA 3JRIA 2DPDA 2L01A 2QQAA 2G9WA 1HCRA 3GZ5A 4JBAA 4HF0A 1MNDA 3E1SA 1KGSA 1BN5A 5HS8A 4KNYA 3KYDB 4I0BA 4E70A 4WX9A 1XGNA 4RAGA 1V54H 3PFIA 4M3GA 2MLGA 1ETXA 4IEJA 3BCBA 3DKYA 5F0HA 3E6CC 5JVTA 1E3PA 2RN7A 1IF1A 5GAHJ 4CUGA 3PO2J 5EYRA 3TP3A 3IH3A 2OZ6A 1IO2A 3HOYJ 2ZNYA 5KCMA 2HOEA 3R61A 1MNMC 1Y1WJ 5IYCJ 3E97A 5H2FC 1SFXA 3M1CA 3VSLA 1OPCA 4B3XA 1J2XA 1D0ZA 3G1LA 4M9ZA 2EFWA 2RAEA 4EM2A 3NRVA 4A3KJ 2IP2A 4DGWB 4OWRB 2HDDA 3WTSC 2GIVA 4KMFA 2HFHA 3NWSA 1ONVA 1B9MA 3LA2A 4XLCA 2EA4A 1JUPA 4C3HJ 2OCCH 5DD4A 2XF6A 2YU9J 4O6JA 2DU9A 1RNLA 3K4MA 3FXOA 3LSHA 2B0LA 2VE9A 2LBFA 2OQRA 4RB1A 1KU3A 5EDNA 4UHTA 2KZVA 5BNGA 5AIPA 2PLYA 4QIWN 4AIKA 2VQLA 3COAC 1YW9A 1FMWA 2K85A 1ETVA 3I54A 2JRMA 3QPTA 2DI3A 5GADJ 5K7FA 5IYBJ 5FKKA 1Y1VJ 2OTJI 2ZBKA 1APLC 2CU7A 4XLHA 3IV5A 3SJMA 3I4MJ 3VYRB 2DQRA 3AG4H 4BKXA 3Q5FA 1FTTA 1L0OC 4IHXA 2VLAA 4XKCA 1MMNA 2R7DA 3KE2A 3WODF 1Z6RA 3QYEA 4KYWA 2WB1A 3HOSA 1A5JA 2WAQA 1TT0A 3WTUC 3V8KA 4Y15A 5J4VA 4M3DA 2IS1A 1EH7A 2X4HA 3RIRA 1GUUA 4ZC3A 2CYYA 2H6CA 1SVMA 4HNTA 2KP6A 2HGCA 2JVHA 4MNUA 3OOUA 1I3AA 2VJIA 4RGSA 2VOOA 2LH9A 4M71A 5DS9A 3FXMA 1WCMJ 4OINF 2W1OA 4JX5A 2F2EA 4NC8A 4BE2A 4WXHA 4S04A 3PSFA 2ZB9A 2L2OA 4LMYA 4EJWA 1R5ID 4RAFA 3K1MA 3WG7H 3JREA 1P4AA 4NBQA 3RPUA 4E7KA 3FKIJ 1TWCJ 3AL0C 4Y3OA 2YX4A 1BR4A 3KP2A 5CPRB 4AVZA 4ENKA 1DQUA 2M45A 4E4HA 5M5YJ 2V79A 1S7EA 2E1MB 2EZKA 2JJ7A 4HX4A 1YJWI 2F4IA 4HQMA 2DOEA 2P0WA 1AU7A 2KHMA 1NK2P 3LWFA 2FSWA 4G6TB 1RR7A 3L00A 3HRSA 4HLXA 3BR1A 2QKMB 3J7YJ 2HS5A 4KT5C 1I5ZA 3KFWX 1IDYA 1Y39A 1LDJA 3ULQB 4UB8C 3HGYA 3GFLA 3S16J 4BY1J 2DFEA 1VQLI 2QLZA 3CCYA 3HZJA 1V5FA 2ACJA 4XKBA 2IEKA 1Y6IA 1PP8F 3LFKA 4BUPA 1ULYA 3GX4X 2LOOA 2JUGA 2LG4A 2PN6A 1R1TA 2ADUA 3SZTA 3HB9A 5DCMA 3RI4A 3QQAA 3BZKA 4CCLA 3GEZA 1MH3A 1WI9A 4JK1X 4A93J 2Z16A 4U7BA 4B43A 4J01A 3PIOF 1FOKA 1YYVA 2M1BA 4F92B 3K0LA 2JA6J 1TNTA 5LGUA 2CG4A 3HBLA 3OL4A 3VDXA 3Q0WA 2Y2ZA 3D0SA 2UXXA 3SFIA 4QLCU 2ID6A 2KJCA 3LAPA 2UZKA 3HXLA 5GPCA 4HDVA 1LNWA 5DDGA 1VQKI 4M6VA 4EGZA 1T33A 1D3YA 2KLOA 3I0TA 4XRFA 2DJIA 1YG2A 2A6EF 2DFIA 3WTXC 4II3A 3JSOA 2XB5A 1JKPC 3P7NA 1FYLA 3UR3C 2GM4A 1TZLA 1G6NA 1WFXA 2ZFUA 1HLVA 2H27A 2M30A 2M4KA 2JMWA 5FO5A 3TBIA 4X6AJ 3DFGA 3H35A 5J47A 2UXNA 1UHSA 1W0UA 4CH7A 2BYVE 1R36A 5CVRA 1N77A 4HX7A 1JTYA 1S8NA 2L3DA 4ITVA 1A35A 2F6CA 2VUMJ 5IT9Z 2KRHA 2OCEA 2Q0OA 2PQ8A 4PSXA 3SXYA 3ZQFA 4M9SA 3HC7A 1E17A 4B3AA 2VC0A 4LB6B 2KKOA 4Y52J 1MJBA 1G3WA 1ZTRA 2OA4A 3S2DJ 3BG6A 2GA1A 2VL8A 2X1EA 3CZ6A 2JA7J 1B72B 4G7ZF 2MABA 2LKSA 2QWWA 1YITI 2EZHA 3EQLF 5F1RA 1QBJA 3QRFF 2BY0A 2Z99A 2DDBA 2FBIA 2IVMA 3ELKA 3REOA 3KZZA 1JKOC 3AAFA 1SAUA 3ABTA 3KP4A 1UMQA 1V55H 1MMSA 3CF5F 1VNDA 4ZYGA 4E7HA 2LR8A 1D8JA 2WAEA 5E18F 3FX3A 4O5VA 1RIOH 2CSOA 2CGPA 2CUFA 3M4OJ 4MHGA 1YJ9I 3UKGA 3FMSA 2QSHX 1JE8A 2YUSA 4A69C 1ZELA 2E1OA 2X51A 1C0WA 4N4NB 3ZGKA 1GXPA 9ANTA 4BE0A 3PM1A 4TV7A 1S9HA 2ZSHB 3ZCOA 4NHJA 4QPQA 2UWMA 1OCRH 5BQTA 3A0BC 4U88A 5A2QZ 1J7KA 1JUSA 2VODA 3QPLA 2O9LA 2XF7A 3G71I 3FWEA 3K4NA 1XDUA 4ZYHA 3G4SI 1T38A 2AHQA 2CWEA 1GVDA 4RBOA 4M9XA 4XL9A 4BDZA 3U1DA 2OBPA 4GXOA 1JGSA 2H8RA 2FX0A 1POGA 3HYIA 1STZA 2MA3A 4ESFA 3CO7C 3SQNA 5D5XB 1D0YA 2QUFA 2FMLA 1OFCX 1QGPA 4EATA 4JX6A 2LNBA 4HLYA 3CF2A 5TJJA 1VQ8I 3F8CA 1LE8A 2IW5A 2CUJA 2VBZA 5TISC 1WKMA 3ERMA 1P7JA 3FZVA 1XMKA 3C1DA 3ZMUA 3J80Z 1R6RA 4CSWA 2F4OB 3DF8A 1BR1A 3H92A 1NH3A 2RQQA 3ABMH 2DYRH 4C30A 2XKPA 5FKNA 3Q0VA 4A3FJ 4NB5A 2XROA 3BZ6A 3VB2A 1P4XA 2QSFX 3TDUC 3K1PA 1L3LA 3FF5A 1VQ7I 2O61A 2OPTA 2LRDA 1JTXA 2V6EA 3PSIA 3GFMA 4DBRA 4M6YA 4PUSA 5BPIA 1WPKA 4KIBA 2P4WA 4H4KC 5E79C 1YLFA 4IZZA 1Z3YA 2E5ZA 1I6HJ 2HDCA 3RYPA 1IW7F 5K7HA 2HNHA 1JGGA 1B4AA 3K9TA 1R7JA 5KK1A 2VPLA 1FX7A 3HTUA 3R4KA 4S05A 2DMUA 3K4KA 3TP0A 4L9JA 2O8XA 1X1CA 4UNOA 2EZIA 4LG0A 1MMAA 4XMYA 3GTKJ 1K6YA 1U2WA 2PEXA 3NQOA 3A01A 3CLQA 1IRFA 2MD0A 2R7OA 3KLNA 2PBIA 1T8IA 2ME6A 3SFZA 4WXCA 1UCRA 1GV2A 4IXAA 4YFKF 5FJ8J 1Z1DA 4A6DA 3F22A 4M3BA 2E34A 3IWFA 2KIFA 3G2BA 1S72I 4XRMA 3P9IA 1TQPA 2D45A 3CDLA 2V26A 3HOTA 4A3BJ 2GIZA 3E3VA 1XSXA 5CVVA 2ZC2A 1FMVA 3TMOA 4Y4RA 1IAWA 3HSFA 3ESWB 2BY3A 4XNFA 4XN3A 5B3SH 2DMTA 3V8JA 1RESA 2LLKA 3K1NA 5LRSA 4AYBN 4XRSG 4OIRF 3IH4A 3WE3A 1FPQA 4IPAA 4RLQA 2DMNA 3OYEA 1FBQA 1UHWA 1S3JA 3KP7A 1ITYA 3MEXA 4AYBA 5EEAA 4AM3A 2X1CA 1IJWC 4RAZA 2CW8A 2HYGD 3H5NA 3CUQC 3OR2C 2RV8A 1U5TA 3ZQHA 5LHGA 2E1CA 1ZGWA 1IV8A 4HBLA 4ENNA 2AXTC 3IKTA 4JYKA 3HPHA 5IT9K 2O7OA 1O7FA 3FXJA 5J4YA 2ESHA 2R5YB 4D0PA 2P5KA 1P4WA 4A3EJ 2HYJA 2ZXWH 3CUOA 3WGIA 2OQGA 3TOBA 1DDNA 1ON2A 4AWXB 2HZTA 2XAUA 1ZAOA 2ZXIA 3BCAA 3BG9A 3KEYA 1WGXA 2J5OA 4JP0A 1SVLA 1B72A 1Z7UA 2YR2A 4HQEA 2MBFA 5IY5H 2A07F 5K1YA 2LBFB 4ZTFA 3V7RA 3K2AA 3R6SA 2XGXA 4AIJA 3CJTB 2ZKZA 4F7ZA 4S0HB 1LDKB 3WHCA 2O5RA 3CLOA 4G9YA 1LFBA 4I7HA 3FM3A 3LQRA 4ZDLA 2BW3A 4XORA 3T8RA 1HW1A 2DQLA 1JKRC 3BT9A 5EEGA 3W6VA 3OIQA 1PP7U 3S1QJ 2NVQJ 1FEXA 1TBXA 1GVJA 2EIMH 1TTYA 2DMPA 4IX7A 2AQFA 1RKTA 2P8TA 3IKVA 2DBBA 4QSHA 3T0YA 4AC0A 2CQ7A 4JOMA 2QBYB 1OCPA 2XPWA 1QHGA 2DDAA 4P96A 3CDIA 4DYCA 1LFUP 2D2WA 5IP9J 5A2QK 2B63J 3HG9A 4C3JJ 3ZRGA 2IT0A 1RI7A 1BA5A 2DFFA 2V9KA 6PAXA 2ZXHA 2VKEA 1P92A 5FLVA 3T8TA 1XN7A 4FE7A 3JRHA 3CCUI 2H8WA 1RETA 3G3ZA 2M0MA 2K9SA 1G8XA 3KLOA 1HW2A 2HZDA 2DT7B 4PZJA 3BQYA 2M4GA 1TWHJ 5HNFA 2IJLA 3LNQA 1OCTC 1K83J 5D4SA 1WVRA 2QCOA 1QRYA 4HZFA 4UUTA 4DZJA 3ZQIA 3M8EA 2R7TA 4HW0A 1AA7A 4BHCA 3BG3A 3KEQA 1BR2A 5E20A 2LF8A 1SD5A 3HOXJ 3WE2A 4NUBA 1W7PD 1I6XA 2FE3A 2JA2A 3J80K 5ICGA 5JHUA 2O0YA 1T0FC 4GDFA 1HBXG 3SZGA 4L5EA 4G12A 3WTZA 5FKMA 4BQQA 5E3NA 3FKJA 5K5QA 3DBHB 1KU9A 3E6DA 1I3QJ 1ZH5A 3ZQGA 4RGUA 2IA1A 4JX4A 4DJAA 3DP7A 5DM7F 1XB4A 1GDTA 1F4KA 4Z6YA 2Y48A 2M8EA 1XG1A 3QWLA 1R1UA 3VYUB 2L0KA 3OOPA 4HG2A 4YIRX 2K27A 1BC8C 1D5YA 3F9KA 4L5IA 3GFIA 3E5XA 4IRHA 1I1SA 1DUXC 2CMPA 1K6OA 3DBLB 2HOAA 3G1MA 2R7RA 2HEOA 3DPLC 1RUOA 3L2WA 1R49A 1V3FA 2JVGA 2OUMA 1XCVA 5FD5A 1N78A 1B59A 2JWTA 3IRQA 3O3KA 4LLLA 4DQ2A 2CQKA 3CESA 2ISYA 5D5WB 2V1NA 2X6XA 3HRMA 1A6IA 3IC7A 2STWA 2R7ZJ 4AUXA 3MZHA 2R0QC 1PDNC 2E19A 3PFYA 2K9NA 3GLXA 3IHUA 1Y0UA 1WJBA 2EFQA 5H6RA 5FLXZ 1LDDA 2E60A 2N8GA 2CQNA 2E71A 1CQTA 3M1EA 5IOZA 5BMZA 2HQ5A 1IUFA 4C2MJ 2WADA 3S1NJ 1W5TA 4EJTA 1OCZH 2R7FA 3BOQA 2CUEA 1IZ1A 3CJNA 3I56I 2R3SA 5C4JJ 2FMYA 1ERDA 2W82A 2EPFA 4C3IJ 2HWVA 1HOMA 2FU4A 4XKWA 2M7BA 3WG9A 2KFDA 3G1OA 2XSJC 1XTAA 2QF7A 5K5OA 3LQQA 3QU3A 1HSJA 1UZCA 4KJZA 1BBYA 1QZZA 1QQIA 5C3EJ 1I50J 4LK1F 1EJ9A 5HODA 3BJOA 3HJEA 4L9NA 2BE5F 2KIUA 1YJNI 1YIJI 4MQVA 1H9GA 1LEAA 2BY2A 5ERIA 1SANA 3TEDA 1O3TA 1XCBA 2CQQA 2ZO4A 3FK6A 2KRCA 4ABZA 3LMMA 1O3SA 1Q1VA 3HRTA 2R5YA 3D5SC 4A2UA 4DOZA 4EM1A 4KISA 5FB2A 1WSUA 1T95A 2GWRA 3JRAA 2VJ5A 3QOEA 3M8JA 2JZYA 2K4BA 2V1UA 2XGDA 2CW7A 4L0YB 1VQMI 5GTIC 3MKZA 3OR1C 2KMUA 3BG7A 3DPTA 2GAUA 1F5TA 4HX8A 1FJLA 2FNPA 3OV8A 3WGGA 1X4PA 4ASNA 3OYHA 4HV5A 3D1NI 1U8RA 4RM3A 4B44A 5HDKA 3MZ8A 3KP6A 1OYWA 5LEKA 3HHGA 4HNUA 2CH0A 2E7XA 4DIQA 2QSGX 3ZMTA 3LSTA 4BACA 4IHWA 4BQAA 2IPQX 1MMDA 4PFPA 2QQ9A 4EJUA 2V1DA 5F6FA 2LVSA 5HS7A 1IG7A 3AKZA 4N4OB 4UUVA 2QENA 3BTCA 1UG0A 1MMGA 4EGYA 1Z3XA 3JRFA 3GTJJ 2F5FA 3CMYA 1LE8B 1ORKA 2QBYA 1TL8A 4IF4A 2JSPA 2HKXA 4E7ZA 1EH8A 5AONA 4BS9A 5BPDA 3OS2A 2CW0F 2MC3A 4D9JA 3T1BA 1CGPA 2BXZA 3FMRA 4MQ9F 2X6YA 1YHQI 2XB0X 5IP6A 2Y9ZA 3PJRA 4LITA 5J3LA 2XASA 2P7CB 1U6GA 3EYYA 5D5VB 1DP3A 2LDUA 3RKXA 5ILVA 4HF2A 1D1BA 4BXXJ 3TOAA 1X4OA 3PUBA 3P5JA 1WJEA 2YPRA 3JR9A 4A3GJ 3DPUA 1HC8A 5F0FA 4IL6C 4E7JA 3JRBA 3KZIC 4LFUA 3C3WA 4ZYEA 1BOAA 1ZYRF 1I27A 1A36A 4LIVA 3DKXA 2XRLA 1D8KA 2TCTA 1FSHA 3Q3SA 4RM2A 3DCFA 2LF7A 3AFHA 2KPMA 2PMUA 3V4GA 2OTLI 4I01A 3PNVA 4WF2A 1IDZA 4U0YA 4BEHA 1RZ4A 2WBMA 3S3MA 3BWGA 2WWYA 3KP3A 3JW4A 5TRDA 1RR8C 2JA8J 1R00A 1SD4A 2X6WA 4CYCA 4LG0B 5C4XJ 3Q0UA 4BBSJ 3A01B 1Z9CA 2IGKA 4MIMA 3H3VK 3O8GA 2A69F 3LSRA 3P9KA 2FOWA 1K7AA 2RDPA 1MW7A 2DK5A 1FIAA 5HLIA 2M2EA 3BP8A 4P9UA 3CD6I 1VQ5I 4KIFA 2WV0A 1OR7C 3ZXSA 2IA0A 1GV5A 4G6QA 5CLSA 1LPQA 5CYVA 3R0JA 3ZPLA 5FD6A 2FEZA 3GCMA 3RQ4A 4CCJA 4M74A 3FK7A 1OLTA 3TKYA 1BL0A 3ZQCA 2F5CA 2VKVA 2NS0A 3F8NA 1KQ8A 3OYGA 2WV1A 4BJ6C 1JJ6C 3IUOA 3OYAA 2Q1ZB 2GZWA 4A6EA 1MBJA 2W84A 2O8KA 1TWFJ 2MGQA 1Z7LA 1BM9A 2KDZA 4WK8F 1PVEA 4II2A 2P5LC 2Y0SN 1QPMA 1J5YA 1SVOA 4FISA 1UELB 2JA5J 3S32A 1S7AA 2CJJA 3C2GA 1OISA 3EDPA 2ELKA 2AXLA 5FLXK 1LQ1A 2E36A 3HUGB 2DT6A 1RPWA 2UUZA 2O3FA 1O7LA 5J8CA 1YW8A 4U87A 1KA8A 5D6FA 2L7MP 3FXUA 4BH9A 2JTVA 1U5TB 4G6DA 2LD5A 2DXIA 4B48A 4V2FA 2LC2A 4YELA 4BQNA 2CUZA 3G73A 1RUNA 3LA3A 2CV0A 5IP7J 1QNTA 4RLFA 3NAUA 3K4JA 1R23A 3OSFA 2DJNA 2ZFWA 4E7SA 5J8FA 4I98B 3E5UA 1ZG3A 3GW2A 1KQ9A 4EJOA 3HIFA 1GT0C 4OAZA 2R5ZB 1KYZA 2JQ7A 4ZDOA 2EQRA 4HSRA 4BYYA 4PJMA 1ON1A 1ETWA 2VBWA 4AU7A 2EV5A 2RGVA 3BDDA 2GBYA 4XBFA 3CO6C 3RKYA 5IYDJ 4PFOA 2A68F 5HS9A 1E2XA 3BR6A 3QP5A 3LSKA 2XDVA 4FX0A 3RQIA 4K2EA 4MLOA 4W97A 3JAMZ 2R4GA 1WWXA 4Y13A 2V7FA 1XGMA 2BW3B 3LSIA 3UNGC 5GAEJ 3V7CA 4H0EA 4ESBA 2K7LA 1ZN2A 4XLPF 3VODA 2EFNA 5DUIA 4BL0B 1ZGAA 5LBQA 1R5HA 3DBRB 2J5PA 2K4JA 2WA0A 3DTKA 1PJRA 1IN8A 3H9QA 1I1GA 2VJ4A 3CUQA 3W2VA 4CCNA 2K86A 5BS6A 2K3FA 2RVCA 1U9NA 2K3PA 2COBA 1ACIA 1G3SA 3LOCA 4OU0A 4J19A 1G2HA 3OYJA 4FCYA 4IHYA 1MKMA 2MD5A 4CHUA 3M9AA 3HOVJ 3PO3J 2ESNA 3ASOH 5IT3A 3LSPA 4B09A 5B1AH 4MFEA 1K4SA 1MBGA 3H3ZA 1M1EB 4ANJA 3JRDA 3MN2A 3KETA 3J7AO 4BNCA 3RTRA 1W5SA 3JSPA 4A5NA 3PNYA 3K70D 1IN7A 2BVLA 1ZLJA 4FX4A 4UVBA 2E5NA 2EIKH 2FBHA 2MH9A 4UVAA 1USSA 3I71A 3KIOA 3IRRA 3I64A 3TW6A 3F21A 3MKLA 2QM3A 5L3FA 3JTGA 3CJRB 4RA2A 4Y7NJ 1FNNA 2VBYA 4WXDA 2W24A 3KYCB 4EEFG 2FD5A 3GUDA 2LY1A 3L09A 4DZPA 4A3LJ 4O3MA 4L9VA 4D7MA 2VQCA 2DMQA 4A5MA 1U8BA 2RNGA 1RRJA 3K6GA 2XPUA 4BBRJ 3IH2A 3QYFA 3IL2A 2DA1A 3IAS2 2L7KA 2PMZN 3EUHC 3I58A 5CQEA 2IGNA 3WHBA 4LLNA 3OL3A 4A3IJ 1JUMA 1K78A 1FY7A 5CKTA 3HM5A 4UUSA 4I02A 4P5OA 3IWZA 4XR6A 3LSMA 1ZGJA 1JXSA 2L02A 2ID3A 2ICWG 3S2HJ 1IN4A 1OMIA 3EETA 4ZDPA 1U3EM 1XMAA 4MTEA 2ELHA 2KIMA 2XGCA 2OAZA 2L4MA 1FYMA 5HDNA 3QAHA 2P5VA 2IGOA 2L9VA 1VQ4I 3F23A 3M07A 4BXUA 2HXIA 1LJ9A 2B9SA 3H9JA 1MIJA 2OD5A 1X2MA 4RGXA 4KICA 3VPRA 4Q5SF 1QO0D 2HTJA 5DTDA 3DXJF 2XUBA 5IOYA 1O3RA 3BR5A 2XVCA 3OMYA 2EH3A 1J09A 3KZYA 2KRFA 4UB6C 2NNNA 5F64A 3L2QA 1JT0A 3JTHA 4Y17A 1SFKA 5ILUA 5JR3A 5F04A 4WWCA 4F52A 5BOXA 1FYKA 1UAAA 3S17J 1R5GA 3AL0B 1F9NA 3OYBA 4BDYA 4M3EA 1UG2A 4GCVA 3DKWA 1Z67A 3ZQ7A 1BJAA 3NARA 2NVTJ 1Z0XA 4YEJA 1T0FA 4G7HF 1TW3A 3PQKA 2DW4A 3FM5A 3L2RA 1QZEA 1F1ZA 2ZNZA 2FNAA 2X48A 4XOPA 3M3YJ 2DA5A 1DPRA 4PDKA 2E1NA 3K4LA 2GA2A 1N75A 3OY9A 2GLOA 4XICA 3N05A 1YRNA 1YW7A 2A5WA 1U78A 3DTIA 1OYIA 2PMHA 3ZN0A 4A0ZA 1K79A 4FASD 2NRAC 3U21A 4GYGA 3S1RJ 1P7IA 4ZYDA 4X1EA 4ZYAA 3ML6A 4HV6A 5H20A 3DU5A 2NVXJ 2MH2A 1ZK8A 3ABKH 1HDPA 2Q2EB 4UVCA 1HKSA 2EINH 3HUGA 1ZRCA 5CQGA 3D5RC 2CO5A 5EG0A 3ECHA 4M3FA 1SC7A 3RZDJ 1AKHA 1ZQ3P 2OU2A 1W0TA 2Q8KA 5GPAA 5D4RA 4HYEA 2EILH 2P6SA 4CYDA 2F5VA
chains in the Genus database with same CATH topology
2VJIA 4R79A 2LH9A 4HEA2 3CESA 2WY8Q 2W1OA 2V1NA 2X6XA 4NC8A 3OWTA 4BE2A 2M7AA 3MKYB 3PSFA 4XM3A 4CCOA 2L2OA 5FRNA 2CFOA 3H5AA 3PFYA 2IS4A 1WJBA 4E7KA 2E60A 3AL0C 4Y3OA 1BR4A 5CPRB 4AVZA 5FRMA 1DQUA 5KHDA 4E4HA 2WADA 4ZTJA 1X1BA 2IS6A 2E1MB 2GOXB 2F4IA 2VB6A 2QKLB 2FUG2 2I8DA 2P0WA 2R7SA 2KHMA 1ERDA 2VXDA 2W82A 2HVQA 4G6TB 3KX2A 3FDYA 2QKMB 4XKWA 4Y33A 4X0GA 2M7BA 4XN0A 4BGDA 2NOJB 1X1AA 2XSJC 3RPUD 2PMZA 3OYMA 4KJZA 1V5FA 1LVKA 4XKBA 2LY2A 1Y6IA 1X19A 1WJDA 2VJJA 1LFPA 4BUPA 2LOOA 2JUGA 2LG4A 3I9V2 4CCLA 4CA0A 2Z16A 2VQHA 4U7BA 4B43A 4D1QA 3A4CA 3C2HA 4J01A 3K10A 2KRCA 4F92B 3LMMA 4J00A 3GBGA 1G59A 4IQJA 4XONA 3D5SC 3OL4A 3VDXA 4KITB 4DOZA 2KL4A 3HXLA 4KISA 3W2WA 3BC8A 2KLOA 2DJIA 3LSGA 1T95A 2MFZA 2VJ5A 3QOEA 3M8JA 4II3A 1EA3A 2L5QA 3UR3C 2CW7A 1TZLA 3MKZA 3OR1C 3DEEA 3DPTA 3CMMA 1WFXA 2KMUA 2ZFUA 3BG7A 2M4KA 3CP2A 2L9SA 4XLAA 3TBIA 4BE1A 3H35A 2IXSA 4CH7A 1VZ0A 1X4PA 3OYHA 1N77A 2R7WA 4XQFA 4ITVA 1DGRM 4RM3A 4B44A 4BEHB 2F6CA 2KRHA 5LD2C 4PSXA 4BJ5C 4HNUA 3HC7A 2CH0A 4PJJA 4DIQA 2E1MC 4BACA 4FETA 2ZSIB 1MMDA 4PFPA 3H0DA 4E7IA 3BG6A 2VL8A 2X1EA 3CZ6A 3AKZA 4N4OB 2VXZA 2MABA 1UG0A 1LKXA 3DTEA 1MMGA 1W36C 3OYNA 1Z3XA 2CV2A 4HRIA 2W4SA 3DU6A 1SAUA 2JSPA 1PYVA 4E7ZA 3CP8A 4BS9A 3OS2A 4E7HA 4D9JA 2UV1A 2X6YA 1HA8A 2WAEA 3OYCA 4HPQA 4JQFA 4LITA 3PJRA 3VYSB 1DP3A 1W36D 2R7XA 1D1BA 4PJNA 1X4OA 1ZELA 2X51A 3PUBA 1WJEA 3OS0A 4N4NB 3ZGKA 3A1YA 3DPUA 1NG7A 2WY7Q 4BE0A 4E7JA 4RMNA 1S9HA 4C2UA 2ZSHB 3ZCOA 2VKHA 2X85A 5TGTA 5FROA 3RCOA 2WAFA 3IAM2 4GRIA 3HKZA 4QPQA 2UWMA 3VWBA 3D5LA 1BOBA 4LIVA 3DKXA 2OV7A 4IKFA 3ZR8X 3SEZA 4RM2A 1KONA 4E6KG 1QHHD 2XF7A 3A2KA 3AFHA 2KPMA 3K4NA 2MYSA 4YRVA 3PNVA 4BEHA 2HVSA 2WBMA 4XL9A 3H5RA 3S3MA 4BDZA 3VYTB 3BLYA 3LL7A 2Z2SB 2X6WA 2DCEA 2IGKA 3W3CA 4BQOA 1D0YA 3SDBA 2VQGA 1V5GA 4CCKA 1MW7A 3ONQA 3QODA 4EATA 2HU9A 3IP4B 4OAYA 3CF2A 3L2UA 1MNEA 2Z1DA 2CUJA 1OR7C 3ZXSA 4XOTA 2BVMA 1Z21A 3H9GA 3I3LA 3RQ4A 4CCJA 1OLTA 1R6RA 4CSWA 3OYGA 4BJ6C 1BR1A 2RQQA 3IUOA 2HPMA 3OYAA 4C30A 1YX5A 4F55A 2Q1ZB 4IQ4A 3HL2A 1Z7LA 4LIUA 3OS1A 2R7UA 1Y56A 4C9YA 4II2A 1YE9A 2ELJA 2LRDA 1UELB 5HVQC 4PJLA 2HPIA 3S32A 4PK4A 3HPGA 3PSIA 3E0JB 2W7NA 2V6EA 3C2GA 4DBRA 4PUSA 1WJCA 4NQWB 3HUGB 4IZZA 2DT6A 4H4KC 1Z3YA 2E5ZA 4LG3A 2UUZA 4F3QA 4U87A 3K4CA 1WJ5A 3MKWB 2KQRA 2HVRA 2DXIA 3PNTA 2V4JC 3EUAA 4B48A 2HNHA 2LC2A 2M3AA 4YELA 4BQNA 2VPLA 2CUZA 3K4KA 1WJAA 2CV0A 4RLFA 3J7AY 4BJTA 1X1CA 2RREA 3K4JA 3V42A 3EPZA 4E7SA 1MMAA 2A6TA 4XMYA 2R7VA 1K6YA 3LFUA 2MD0A 2R7OA 1DGWY 2VASA 2BOLA 2CV1A 4OAZA 2XF5A 3NWTA 4ZDOA 2VKDA 4HSRA 4PJMA 4NNJA 4AU7A 3G2BA 3L2VA 2V26A 3HOTA 4PFOA 3RSNA 3QYBA 2PJRB 1YX3A 4XLFA 3LSKA 2XDVA 1FMVA 4C2TA 3TMOA 4MLOA 4Y4RA 2R4GA 4B47A 4XNFA 4XN3A 2LREA 1NG6A 2V7FA 1D0XA 2BW3B 3LSIA 3UNGC 4BL0B 3FBNB 4CCMA 2WA0A 3DTKA 1PJRA 2HDWA 2W00A 3ZQQA 3H9QA 2VJ4A 3W2VA 4CCNA 3K70C 4RLQA 2DOAA 3OYEA 2X1DA 2K3PA 3SEQA 4HSTA 3OYJA 4AYBA 3OYDA 2X1CA 5LFAA 2CW8A 3H5NA 3OR2C 4E7LA 4ANJA 3OYFA 2IS2A 2KDOA 3RTRA 3HPHA 2K9MA 3PNYA 3K70D 3PL8A 2BVLA 2E5NA 1D1AA 1IRXA 2CS3A 1U0JA 2L9NA 1E0EA 3VSKA 3CJRB 1P9QC 2XAUA 2ZXIA 3BCAA 2IGMA 3KEYA 3W2AA 3TL4X 2HQAA 2LY1A 3K4BA 3OIPA 3DLAA 5KNLA 4XKVA 2AQEA 2VQCA 4KT6A 2K5CA 2RNGA 3K6GA 2LBFB 4ZTFA 3QYFA 3MMYB 3IAS2 4BU2A 2PJRA 2L7KA 3S3NA 2XC7A 3SYTA 1X1DA 3EUHC 1LDKB 5CQEA 2O5RA 2IGNA 3OL3A 1MNDA 3E1SA 2K9LA 4QPOA 2MC4A 4ZDLA 2BW3A 4XORA 5CKTA 4P5OA 4XR6A 3LSMA 3OIQA 5HNHA 3S93A 4PSWA 1WJFA 4ZDPA 4F91B 4IX7A 3BCBA 3DKYA 3OYKA 2AQFA 3OYIA 4JOMA 2LYCA 2IGOA 1GLNA 1QHGA 4CUGA 1V5EA 3H9JA 3HG9A 3ZRGA 5KCMA 3S8PA 2V9KA 2ZXHA 4NC7A 2Y0SA 3OMYA 3M1CA 3VSLA 1QU3A 1J09A 3DWLE 4B3XA 1D0ZA 2M0MA 2OC6A 1G8XA 3S3OA 3L2QA 2HZDA 4DBQA 1JI8A 4DGWB 2DT7B 4OWRB 1SFKA 2M4GA 5HNFA 4F52A 1UAAA 3NWSA 4XLCA 3AL0B 3CJQB 2XF6A 4F93B 3OYBA 4BDYA 1AA7A 2R7TA 1BR2A 3EUKL 3K4MA 4YEJA 3LSHA 4NUBA 2LBFA 2VIXA 3L2RA 2JA2A 2KZVA 4XOPA 4XLEA 4ZJZA 2VQLA 1T0FC 1FMWA 3MD2A 3DQVC 3OYLA 3SZGA 3K4LA 4BQQA 1N75A 3OY9A 3FKJA 2GOMA 3N05A 2A5WA 4XLHA 3DTIA 4P1WA 4DJAA 3VYRB 4FASD 3U21A 2VLAA 4XKCA 2R7QA 4ZYAA 5JHFA 4BXFA 1D1CA 1MMNA 3VYUB 3DU5A 4HG2A 3FHNA 3F9KA 3QYEA 4CZCA 2Q2EB 2WB1A 3HOSA 2WAQA 1TT0A 3FBIB 2CMPA 5CQGA 3D5RC 2IS1A 3KYLA 2R7RA 3DPLC 3L2WA 4ZC3A 4HNTA 2KP6A 2JVGA 2OUMA 1N78A 2JVHA 5HLTA 5HOOA 2F5VA 3OOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP3 A;  4QPQ A;  3OMY A;  4QPO A; 
#chains in the Genus database with same CATH topology
 3HKZ N;  5ICE A;  3TO7 A;  2DA6 A;  2NVY J;  4R79 A;  2LSO A;  1DPU A;  4HEA 2;  4CIC A;  4I0A A;  1X3Z B;  2BGC A;  1FWZ A;  2W25 A;  3U9G A;  5DUK A;  2M7A A;  4I99 C;  4XSX F;  1T08 B;  5ED4 A;  3MKY B;  3FHZ A;  3AG2 H;  5DYM A;  1H89 C;  5FRN A;  4OIQ F;  2CFO A;  2G0E A;  3CC2 I;  5E3M A;  3KP5 A;  2R5Z A;  1FSE A;  2IS4 A;  5JFR A;  3SDG A;  1IUY A;  5GAG J;  5FRM A;  2FJ1 A;  5KHD A;  1X3W B;  2BEO A;  1FP1 D;  3LAJ A;  4Q48 A;  3GTL J;  4HF1 A;  2GOX B;  2AO9 A;  2M0C A;  1O4X A;  2I8D A;  3JAM K;  2R7S A;  2F48 A;  2VXD A;  1H88 C;  3OSG A;  1SFU A;  3FDY A;  4X0G A;  2K40 A;  3BJ6 A;  4EV0 A;  4XN0 A;  2NOJ B;  2XAJ A;  3RPU D;  3BTI A;  3JCU C;  3OYM A;  1XC5 A;  2ZJ2 A;  5DV5 A;  3J81 Z;  1LB2 A;  1QA6 A;  2VN2 A;  2LY2 A;  2ZJQ F;  1X19 A;  1WJD A;  1LFP A;  2A05 A;  5FFX A;  1WRJ A;  3PUF A;  2L4A A;  2NYX A;  2ECB A;  3Q9S A;  5JI6 A;  5E8I A;  4CA0 A;  2O03 A;  3AG1 H;  4GFB A;  4D1Q A;  3A4C A;  2FQ4 A;  2COM A;  1TQM A;  1J59 A;  1TLH B;  4J00 A;  4KA4 A;  2D1H A;  5EJC A;  4IQJ A;  4XON A;  2LY9 A;  5AIQ A;  4YIF A;  1HKT A;  3GZN B;  4PGH A;  2A5Y B;  3L2C A;  2IBD A;  2KL4 A;  3MAJ A;  2HYF A;  3BC8 A;  3LSG A;  3GFJ A;  1EA3 A;  2L5Q A;  2LKX A;  2Y31 A;  3TGN A;  4ZZD A;  3CMM A;  3OYI A;  3CP2 A;  4XLA A;  4BE1 A;  5C44 J;  4I2O A;  1VZ0 A;  5B1B H;  1MBE A;  2R7W A;  4XQF A;  3CMA I;  1DGR M;  1KU2 A;  4BEH B;  3P9C A;  1IN6 A;  4QTR A;  4PJJ A;  1EKE A;  3VEP A;  2E1M C;  4CYC B;  1T98 A;  1S7O A;  1BC7 C;  3F8F A;  4E7I A;  3S1M J;  1IRZ A;  4OMZ A;  1GXQ A;  3C2B A;  2VXZ A;  1G4D A;  1LKX A;  1KQ0 A;  3OYN A;  2H09 A;  3RDI A;  2FOK A;  1N25 A;  3DU6 A;  4OOI A;  2XAQ A;  2XV4 S;  1PYV A;  1JHH A;  3CP8 A;  4G7O F;  3ASN H;  5HLG A;  1TWA J;  1VTN C;  2NNY A;  1HA8 A;  3OYC A;  4HPQ A;  1XD7 A;  3QPS A;  1YI2 I;  2L7Z A;  1IXR C;  1WI3 A;  3VYS B;  3GTG J;  3HRU A;  2QZ8 A;  2KZG A;  3FXK A;  1W36 D;  1FZP B;  2R7X A;  4PJN A;  2DT5 A;  3L1P A;  2PG4 A;  3OS0 A;  1MBH A;  4D5C A;  1XGO A;  3A1Y A;  5LHI A;  4RDU A;  3S14 J;  4IVN A;  4RMN A;  3RJP A;  2VKH A;  2X85 A;  5TGT A;  5FRO A;  3RCO A;  3K69 A;  4GRI A;  1LVA A;  1BOB A;  4Q4Z F;  2OV7 A;  4IKF A;  3TO6 A;  3HSE A;  4M72 A;  3ZR8 X;  2ME0 A;  3FXQ A;  5JLW A;  1R71 A;  1BI1 A;  3MZY A;  4PJ0 C;  5JLX A;  4E6K G;  1CF7 B;  3EYI A;  3A2K A;  3RPQ A;  1FBS A;  3W6K B;  3WGH A;  3Q9V A;  1R9T J;  2HVS A;  3FIW A;  2STT A;  3BLY A;  3LL7 A;  2Z2S B;  3I55 I;  4IOC F;  4UV8 A;  1B8I B;  2FA5 A;  3W3C A;  4BQO A;  1OR7 A;  4CCK A;  1V5G A;  2DA2 A;  5E8G A;  4LB5 A;  2EFO A;  3QOD A;  4OAY A;  2HQN A;  5FLM J;  1ZLK A;  1WH7 A;  4A12 A;  2L7F P;  2VI6 A;  5CVI A;  4XOT A;  2BVM A;  2Q2E A;  3CCQ I;  4RB2 C;  2QGU A;  3GZ6 A;  1OCC H;  1OCO H;  1B1B A;  2ETH A;  4HOB A;  1VQO I;  3SHF A;  1PUF A;  3VFZ A;  3GXO A;  1YO5 C;  3FXL A;  4YII A;  2DTZ A;  3BZC A;  4A3J J;  1JJ8 C;  2HPM A;  2PFB A;  1YX5 A;  4ETS A;  1XSD A;  2XKO A;  2JSC A;  5D6E A;  3CME I;  2E2J J;  4IQ4 A;  1HDD C;  1BI2 A;  1JKQ C;  4LIU A;  2R7U A;  2ZXJ A;  2BHZ A;  3TO9 A;  4CXF A;  2A3S A;  3CQZ J;  3C7J A;  3KCC A;  1X3U A;  2HPI A;  3CUQ B;  3E0J B;  3I4P A;  1WJC A;  4CZZ A;  4NQW B;  4FHT A;  1A04 A;  4LG3 A;  1FLI A;  4I09 A;  5CJ9 A;  1KZH A;  3ZMD A;  1ZRE A;  1YS6 A;  1ZG1 A;  3GF2 A;  3K7A J;  3WTW C;  4OIO F;  2V4J C;  3EUA A;  3LSJ A;  1BI3 A;  1RC9 A;  3ZMS A;  1SD7 A;  2M3A A;  4OIP F;  4XK4 A;  1XPX A;  5M5W J;  1MSE C;  4GGG A;  4IJA A;  3J7A Y;  4BJT A;  3R60 A;  2KJB A;  5DD8 A;  2CFX A;  3V42 A;  1VF9 A;  2R7V A;  3ZQL A;  3A02 A;  1T39 A;  1S5L C;  1S6L A;  3C18 A;  2Y75 A;  2BOL A;  1PUE E;  3CCL I;  2KIQ A;  2XF5 A;  3BY6 A;  2HQR A;  1LEB A;  3GO5 A;  4QWQ A;  3SZP A;  1XSV A;  3MWM A;  3J81 K;  3A03 A;  5KAI C;  1BW6 A;  1R22 A;  3QPH A;  1TT5 B;  4GO1 A;  4N0B A;  2E7W A;  4NNJ A;  2LFB A;  4RS8 A;  2Y30 A;  3X2Q H;  4LOC A;  3L2V A;  3T5X A;  2VBX A;  2XPV A;  1G3Y A;  3QYB A;  2H6B A;  4M6X A;  3CCM I;  4IRI A;  2IRF G;  4C2T A;  1IXS B;  3RKW A;  4B47 A;  1OYY A;  4PGG A;  1NG6 A;  2RQP A;  1SFE A;  1D0X A;  1K78 B;  2WB1 N;  3N97 A;  4UUS B;  2WAQ N;  1HXD A;  5E3O A;  1SMT A;  3F6V A;  3FBN B;  2HDW A;  2W00 A;  3I4N J;  5J6X A;  3K70 C;  1OQY A;  3BTL A;  1WH5 A;  2DOA A;  1SD6 A;  4LGW A;  1Y0N A;  3SEQ A;  4HST A;  1IXC A;  2DA3 A;  4BHB A;  2ZJR F;  1A6Q A;  1HKQ A;  3CDH A;  3BPX A;  3L9F A;  3OYD A;  5J1U A;  1Z77 A;  5CVU A;  3V7S A;  4E7L A;  3QOP A;  1ETO A;  1U9O A;  5L3D A;  4EJV A;  2DO7 A;  2HR3 A;  3TQN A;  1KYW A;  4A3M J;  3BG5 A;  1RKW A;  3O8H A;  3GTP J;  2KDO A;  4L0Z B;  3PL8 A;  2ZME C;  5DCF A;  2EB7 A;  3DEU A;  1WQ2 A;  2TDX A;  2CS3 A;  1R1V A;  2L9N A;  1OJL A;  1J0R A;  3VSK A;  1B9N A;  2WC2 A;  1T2K A;  4Z2Y A;  3ZP5 A;  4XSZ F;  2K02 A;  1XDS A;  2IGM A;  1YFH A;  3W2A A;  3TL4 X;  3K4B A;  1W5C C;  3OIP A;  2BXY A;  3DLA A;  3H1C A;  4DW6 A;  3CTA A;  2Y69 H;  3EUH A;  4BAY A;  4XKV A;  4KN7 X;  4I76 A;  2AQE A;  4KT6 A;  2HOS A;  2K5C A;  1YQA A;  2OJE D;  1BIB A;  3O6B B;  4MEX F;  2VT3 A;  3F0C A;  4ESJ A;  5J40 A;  1TP4 A;  2PX9 A;  2NS7 A;  2PJR A;  1LUJ B;  3TDZ C;  3SYT A;  1X1D A;  5EGO B;  4I6Z A;  1BIA A;  1UHM A;  5E17 F;  3ZMZ A;  2MLK A;  1B6A A;  4HA8 A;  4UV9 A;  2GQQ A;  4XRS A;  2IAI A;  2K9L A;  1WHU A;  4QPO A;  1ZRF A;  2MC4 A;  1ZR4 A;  4EM0 B;  2V9P A;  1YRN B;  3KEO A;  1ETK A;  5LGT A;  2AS5 F;  5DM6 F;  1IRG A;  3BRO A;  1MZB A;  5IPA A;  5HNH A;  3S93 A;  2VC1 A;  4FTH A;  4KDP A;  4PSW A;  2E35 A;  1WJF A;  4F91 B;  4G8X A;  2ISZ A;  4MEY F;  3OYK A;  1NTC A;  2D5V A;  3F72 A;  2H94 A;  3WTT C;  1SMY F;  1FOW A;  2LYC A;  2LP0 A;  1TC3 C;  1GLN A;  3G6E I;  5J1Y A;  4HNV A;  1H8A C;  1V5E A;  5D8K B;  4RGR A;  3QP6 A;  1ETY A;  1MDM A;  4UY8 I;  1NHA A;  3I5U A;  5EG0 B;  3W6J B;  2ZJP F;  2QQB A;  3S8P A;  5GP9 A;  3TW7 A;  3MQ0 A;  4NC7 A;  2Y0S A;  1AKH B;  2M9H A;  1W7P A;  1CF7 A;  2VT2 A;  1QU3 A;  1HQC A;  3DWL E;  2OC6 A;  3S3O A;  2LKP A;  4DBQ A;  3J7Z I;  1JI8 A;  2C6Y A;  5K7Z A;  1MJA A;  2XAH A;  1TWG J;  1ZRD A;  1R58 A;  2BV6 A;  2EZL A;  1B8I A;  1MGT A;  3GTQ J;  3CJQ B;  2X9D A;  4F93 B;  4MTD A;  2DA4 A;  3CCV I;  1ZR2 A;  1ENH A;  3EUK L;  5F27 A;  2KT0 A;  2VIX A;  4EVI A;  2L54 A;  1FIP A;  5FKL A;  4LK0 F;  4XLE A;  4ZJZ A;  3WTV C;  5HLH A;  3V8L A;  3K2Z A;  3ISP A;  3MD2 A;  1AOY A;  2EK5 A;  3DQV C;  3U2R A;  3OYL A;  2DN0 A;  2HKO A;  1ODD A;  3E7L A;  2GOM A;  1SFO J;  4V19 K;  1Q1H A;  1ZG5 A;  2H1L A;  4YG2 F;  4P1W A;  4ENJ A;  2JRT A;  5H6Q A;  2JPC A;  4NC6 A;  5ICF A;  2R7Q A;  1YIO A;  1O57 A;  5JHF A;  4BXF A;  1D1C A;  3B6C A;  1XS9 A;  1MBK A;  2JUC A;  2PI0 A;  4B1R A;  3FHN A;  4CZC A;  5KAF C;  4NQW A;  2I10 A;  3FBI B;  5GTH C;  4D7N A;  4RAY A;  3KYL A;  4L9T A;  4IOA F;  1X58 A;  3DLL F;  2DPU A;  1FP2 A;  1ZAR A;  4ON0 A;  5LHH A;  2EIJ H;  5E3L A;  1FOX A;  3GTM J;  1Z91 A;  3F8B A;  5HLT A;  5HOO A;  4CDG A;  4LLG F;  1MSF C;  3ROU A;  4IRG A;  2FF4 A;  2WY8 Q;  3BR0 A;  3OWT A;  3WU1 B;  3A0H C;  4XM3 A;  2XHK A;  5FKO A;  4CCO A;  2GXA A;  3H0G J;  4RB3 C;  1TQI A;  3H5A A;  1GHC A;  1UB9 A;  3S15 J;  2V9V A;  3FIS A;  2RKH A;  2NXN B;  4KN4 X;  4EQQ A;  1QZY A;  2Y9Y A;  4AIH A;  1QPI A;  1XGS A;  4ZTJ A;  3ZN1 A;  1X1B A;  1UFM A;  3MCZ A;  5LRR A;  2IS6 A;  2EV0 A;  2YX7 A;  2JN6 A;  2VB6 A;  2QKL B;  2FUG 2;  5LEJ A;  2ZCW A;  4HDU A;  2HTS A;  1S29 A;  2HVQ A;  2DTR A;  3HEF A;  4OMY A;  2M34 A;  3KX2 A;  2LMD A;  4Y33 A;  1DU0 A;  3CC7 I;  4YFN F;  4A0X A;  1X1P A;  2Z5U A;  3CCR I;  4BGD A;  3DV8 A;  2XSD C;  1EF4 A;  4L18 B;  4DYR A;  1X1A A;  3PIP F;  2PMZ A;  3CCE I;  2EV6 A;  1VQ9 I;  4A3D J;  2BZT A;  2Z3Y A;  2QVO A;  4MO7 A;  1LVK A;  1H0M A;  2VJJ A;  1IC8 A;  3I59 B;  3ERE D;  1HW5 A;  3KPH A;  2P6T A;  2YU3 A;  3I9V 2;  4ZZL A;  5LGN A;  1KU7 A;  1SAX A;  2HOT A;  4R8H A;  4LJZ F;  2MW8 A;  2VQH A;  4BHP A;  4N9H A;  1HST A;  3C2H A;  4AVP A;  3F8M A;  1F36 A;  3K10 A;  1JT6 A;  2A6H F;  4ENM A;  2XAF A;  3HOU J;  3GBG A;  1V4R A;  3JRG A;  1G59 A;  4KIT B;  1E3O C;  3ECO A;  3B6A A;  3S2W A;  2MSY A;  1ZHF A;  2F4M B;  3W2W A;  1OKR A;  2O6G E;  3H3U A;  4NDL A;  1X2N A;  2KIS A;  2EFP A;  2MFZ A;  1BI0 A;  1QVT A;  5DEQ A;  2DFH A;  3HOW J;  2ZME B;  3GVA A;  3DEE A;  4D5F A;  2L9S A;  2MG4 A;  3GLL A;  2IXS A;  2QEX I;  2RNJ A;  1T6S A;  5EGO A;  4V2G A;  3FMQ A;  5LD2 C;  4BJ5 C;  3ABL H;  5F08 A;  4FET A;  2ZSI B;  3H0D A;  2FRH A;  5L3B A;  5M3F J;  3CC4 I;  1H9T A;  1FTZ A;  3BJA A;  3WTY C;  1ZKG A;  3DTE A;  3M8F A;  2DOF A;  4MGR A;  1W36 C;  2CV2 A;  4HRI A;  2W4S A;  2M5W A;  2QQ8 A;  5D5U B;  1VQN I;  3RKQ A;  5FFZ A;  2D1V A;  1VI0 A;  2EA2 A;  2UV1 A;  1PUF B;  2WTE A;  2QA4 I;  3F6O A;  4FE4 A;  4JQF A;  3I53 A;  2V6C A;  4EMS A;  3HDD A;  4M73 A;  1MBF A;  3OIO A;  3R0A A;  2X0L A;  5E1X A;  1ETQ A;  1YS7 A;  5L3E A;  2DYS H;  4BY7 J;  2G7H A;  2JT1 A;  2LTP A;  1NG7 A;  1MD0 A;  2WY7 Q;  1Z05 A;  3BPV A;  4UXN A;  5LLQ A;  4C2U A;  1J75 A;  2WAF A;  1EH6 A;  3IAM 2;  3HKZ A;  3HTS B;  3VWB A;  3D5L A;  5B5E C;  2NAZ A;  4HAM A;  1FOY A;  4MFD A;  2W57 A;  3MFK A;  3SEZ A;  1KON A;  2F5D A;  2ECC A;  3BR3 A;  1REP C;  4YFX F;  1QHH D;  1W1W E;  4G94 A;  2MYS A;  4YRV A;  5CVJ A;  5ILS A;  1NK3 P;  5FGM A;  3JRC A;  5B66 C;  3H5R A;  4KMU X;  2R93 J;  1AWC A;  3VYT B;  3HOZ J;  5KVR A;  2BBY A;  2E2I J;  1TNS A;  2VOP A;  3FXR A;  2VON A;  5E1W A;  1SEU A;  2DCE A;  3GME A;  1I39 A;  2VPR A;  2JPB A;  5M5X J;  3SDB A;  2X6O A;  2E2H J;  2VQG A;  2P7V B;  4P55 A;  2DLL A;  2FQ3 A;  2A61 A;  3ONQ A;  2HU9 A;  3IP4 B;  5ICC A;  2W48 A;  1K61 A;  1FBU A;  3L2U A;  1MNE A;  2Z1D A;  2BY1 A;  2M8G X;  1JHF A;  4XLN F;  3AG3 H;  3B73 A;  2HI3 A;  1Z21 A;  3H9G A;  2H1K A;  3I3L A;  3ZOB A;  1QVU A;  1J9I A;  5M3M J;  4IHT A;  4W1U A;  1IN5 A;  1AHD P;  1DU6 A;  5E1Z B;  4F55 A;  2L9R A;  1Y8Q B;  3BQZ A;  3PQJ A;  3HGG A;  3HL2 A;  3OS1 A;  1Y56 A;  2NS8 A;  1YOV B;  4C9Y A;  1VQ6 I;  5EF6 A;  1YE9 A;  2ELJ A;  2XGE A;  4DNC A;  2YS9 A;  4A3C J;  4AD9 A;  1MJ9 A;  5HVQ C;  4N9I A;  4PJL A;  2W7N A;  4PK4 A;  3HPG A;  5HDG A;  5D8L B;  2B7E A;  1K4T A;  2Z9O A;  1Z6T A;  2M87 A;  4F3Q A;  1TW2 A;  1WJ5 A;  2NOG A;  3K4C A;  3MKW B;  2I5U A;  2KQR A;  3B02 A;  5EZG A;  3L7W A;  3PNT A;  4CO8 A;  2HVR A;  2OF7 A;  1MH4 A;  5JVG F;  1BW5 A;  3VOE A;  3ZMV A;  1WZ2 A;  1WJA A;  1EV7 A;  2Y0M A;  3GYH X;  2RRE A;  2RC4 A;  4FT8 A;  3EPZ A;  4U7D A;  2A6T A;  4ZH4 F;  3LFU A;  4CGZ A;  1FC3 A;  1DGW Y;  2VAS A;  3CCJ I;  4PCQ A;  3GTO J;  2CV1 A;  2XRN A;  3NWT A;  2DOD A;  2VKD A;  2EJR A;  3BTJ A;  2K9Q A;  5F0C A;  3WU0 A;  2EWN A;  2G7U A;  1O3Q A;  1YTY A;  1FT9 A;  2R92 J;  1IV6 A;  4DYQ A;  3I59 A;  2OZU A;  3BR2 A;  3M7G A;  3CCS I;  5J1R A;  3ABU A;  2W85 A;  3MVP A;  3RSN A;  3HHH A;  2PJR B;  1YX3 A;  1BJZ A;  4XLF A;  1P2F A;  2FXA A;  2JK3 A;  5EEH A;  2XAG A;  4FQG A;  3U1K A;  3RYR A;  3DEW A;  3E5Q A;  2DA7 A;  2LRE A;  1D5V A;  2F5E A;  4KIG A;  3WU2 C;  3N4M A;  3HSR A;  4L5J A;  5F1J A;  4P9F A;  2TRT A;  4A0Y A;  1P6R A;  4CCM A;  3H36 A;  2GXG A;  1XX5 A;  4U0V A;  3ZQQ A;  4B8X A;  2IA2 A;  4KUM A;  4U0W A;  5K5R A;  4IHS A;  2X1D A;  2PJP A;  4Q47 A;  2CQX A;  2LK2 A;  5DCM B;  1VFC A;  1DP7 P;  2NVU B;  1Y8R B;  1F43 A;  1MDM B;  2YSR A;  2DAO A;  3NEU A;  5LFA A;  2ZME A;  4IHV A;  2GXB A;  2XIG A;  2V1X A;  3OYF A;  2IS2 A;  1W7P B;  4AID A;  1UST A;  2K9M A;  3LA7 A;  1U5T C;  2Z33 A;  2EBI A;  5L3G A;  4RB0 A;  1R4M B;  2CRG A;  2QYO A;  2FBK A;  1D1A A;  1IRX A;  3QU6 A;  1U0J A;  1E0E A;  1P9Q C;  3O2P E;  2HXO A;  1UJ8 A;  4WCG A;  4KFC A;  4XID A;  2HQA A;  1IGN A;  1T56 A;  1W4M A;  5KNL A;  1XMX A;  2DK8 A;  2BHY A;  2P81 A;  4B4C A;  3RZO J;  4IO9 F;  1VQP I;  1E3H A;  1G3T A;  3GWZ A;  2VE8 A;  5L3C A;  4R1H A;  3F3X A;  1A31 A;  3MMY B;  1R4N B;  3E6B A;  5EZH A;  4BU2 A;  4GYI A;  4LD5 A;  2XC7 A;  3S3N A;  1HF0 A;  3E6M A;  3JRI A;  2DPD A;  2L01 A;  2QQA A;  2G9W A;  1HCR A;  3GZ5 A;  4JBA A;  4HF0 A;  1MND A;  3E1S A;  1KGS A;  1BN5 A;  5HS8 A;  4KNY A;  3KYD B;  4I0B A;  4E70 A;  4WX9 A;  1XGN A;  4RAG A;  1V54 H;  3PFI A;  4M3G A;  2MLG A;  1ETX A;  4IEJ A;  3BCB A;  3DKY A;  5F0H A;  3E6C C;  5JVT A;  1E3P A;  2RN7 A;  1IF1 A;  5GAH J;  4CUG A;  3PO2 J;  5EYR A;  3TP3 A;  3IH3 A;  2OZ6 A;  1IO2 A;  3HOY J;  2ZNY A;  5KCM A;  2HOE A;  3R61 A;  1MNM C;  1Y1W J;  5IYC J;  3E97 A;  5H2F C;  1SFX A;  3M1C A;  3VSL A;  1OPC A;  4B3X A;  1J2X A;  1D0Z A;  3G1L A;  4M9Z A;  2EFW A;  2RAE A;  4EM2 A;  3NRV A;  4A3K J;  2IP2 A;  4DGW B;  4OWR B;  2HDD A;  3WTS C;  2GIV A;  4KMF A;  2HFH A;  3NWS A;  1ONV A;  1B9M A;  3LA2 A;  4XLC A;  2EA4 A;  1JUP A;  4C3H J;  2OCC H;  5DD4 A;  2XF6 A;  2YU9 J;  4O6J A;  2DU9 A;  1RNL A;  3K4M A;  3FXO A;  3LSH A;  2B0L A;  2VE9 A;  2LBF A;  2OQR A;  4RB1 A;  1KU3 A;  5EDN A;  4UHT A;  2KZV A;  5BNG A;  5AIP A;  2PLY A;  4QIW N;  4AIK A;  2VQL A;  3COA C;  1YW9 A;  1FMW A;  2K85 A;  1ETV A;  3I54 A;  2JRM A;  3QPT A;  2DI3 A;  5GAD J;  5K7F A;  5IYB J;  5FKK A;  1Y1V J;  2OTJ I;  2ZBK A;  1APL C;  2CU7 A;  4XLH A;  3IV5 A;  3SJM A;  3I4M J;  3VYR B;  2DQR A;  3AG4 H;  4BKX A;  3Q5F A;  1FTT A;  1L0O C;  4IHX A;  2VLA A;  4XKC A;  1MMN A;  2R7D A;  3KE2 A;  3WOD F;  1Z6R A;  3QYE A;  4KYW A;  2WB1 A;  3HOS A;  1A5J A;  2WAQ A;  1TT0 A;  3WTU C;  3V8K A;  4Y15 A;  5J4V A;  4M3D A;  2IS1 A;  1EH7 A;  2X4H A;  3RIR A;  1GUU A;  4ZC3 A;  2CYY A;  2H6C A;  1SVM A;  4HNT A;  2KP6 A;  2HGC A;  2JVH A;  4MNU A;  3OOU A;  1I3A A;  2VJI A;  4RGS A;  2VOO A;  2LH9 A;  4M71 A;  5DS9 A;  3FXM A;  1WCM J;  4OIN F;  2W1O A;  4JX5 A;  2F2E A;  4NC8 A;  4BE2 A;  4WXH A;  4S04 A;  3PSF A;  2ZB9 A;  2L2O A;  4LMY A;  4EJW A;  1R5I D;  4RAF A;  3K1M A;  3WG7 H;  3JRE A;  1P4A A;  4NBQ A;  3RPU A;  4E7K A;  3FKI J;  1TWC J;  3AL0 C;  4Y3O A;  2YX4 A;  1BR4 A;  3KP2 A;  5CPR B;  4AVZ A;  4ENK A;  1DQU A;  2M45 A;  4E4H A;  5M5Y J;  2V79 A;  1S7E A;  2E1M B;  2EZK A;  2JJ7 A;  4HX4 A;  1YJW I;  2F4I A;  4HQM A;  2DOE A;  2P0W A;  1AU7 A;  2KHM A;  1NK2 P;  3LWF A;  2FSW A;  4G6T B;  1RR7 A;  3L00 A;  3HRS A;  4HLX A;  3BR1 A;  2QKM B;  3J7Y J;  2HS5 A;  4KT5 C;  1I5Z A;  3KFW X;  1IDY A;  1Y39 A;  1LDJ A;  3ULQ B;  4UB8 C;  3HGY A;  3GFL A;  3S16 J;  4BY1 J;  2DFE A;  1VQL I;  2QLZ A;  3CCY A;  3HZJ A;  1V5F A;  2ACJ A;  4XKB A;  2IEK A;  1Y6I A;  1PP8 F;  3LFK A;  4BUP A;  1ULY A;  3GX4 X;  2LOO A;  2JUG A;  2LG4 A;  2PN6 A;  1R1T A;  2ADU A;  3SZT A;  3HB9 A;  5DCM A;  3RI4 A;  3QQA A;  3BZK A;  4CCL A;  3GEZ A;  1MH3 A;  1WI9 A;  4JK1 X;  4A93 J;  2Z16 A;  4U7B A;  4B43 A;  4J01 A;  3PIO F;  1FOK A;  1YYV A;  2M1B A;  4F92 B;  3K0L A;  2JA6 J;  1TNT A;  5LGU A;  2CG4 A;  3HBL A;  3OL4 A;  3VDX A;  3Q0W A;  2Y2Z A;  3D0S A;  2UXX A;  3SFI A;  4QLC U;  2ID6 A;  2KJC A;  3LAP A;  2UZK A;  3HXL A;  5GPC A;  4HDV A;  1LNW A;  5DDG A;  1VQK I;  4M6V A;  4EGZ A;  1T33 A;  1D3Y A;  2KLO A;  3I0T A;  4XRF A;  2DJI A;  1YG2 A;  2A6E F;  2DFI A;  3WTX C;  4II3 A;  3JSO A;  2XB5 A;  1JKP C;  3P7N A;  1FYL A;  3UR3 C;  2GM4 A;  1TZL A;  1G6N A;  1WFX A;  2ZFU A;  1HLV A;  2H27 A;  2M30 A;  2M4K A;  2JMW A;  5FO5 A;  3TBI A;  4X6A J;  3DFG A;  3H35 A;  5J47 A;  2UXN A;  1UHS A;  1W0U A;  4CH7 A;  2BYV E;  1R36 A;  5CVR A;  1N77 A;  4HX7 A;  1JTY A;  1S8N A;  2L3D A;  4ITV A;  1A35 A;  2F6C A;  2VUM J;  5IT9 Z;  2KRH A;  2OCE A;  2Q0O A;  2PQ8 A;  4PSX A;  3SXY A;  3ZQF A;  4M9S A;  3HC7 A;  1E17 A;  4B3A A;  2VC0 A;  4LB6 B;  2KKO A;  4Y52 J;  1MJB A;  1G3W A;  1ZTR A;  2OA4 A;  3S2D J;  3BG6 A;  2GA1 A;  2VL8 A;  2X1E A;  3CZ6 A;  2JA7 J;  1B72 B;  4G7Z F;  2MAB A;  2LKS A;  2QWW A;  1YIT I;  2EZH A;  3EQL F;  5F1R A;  1QBJ A;  3QRF F;  2BY0 A;  2Z99 A;  2DDB A;  2FBI A;  2IVM A;  3ELK A;  3REO A;  3KZZ A;  1JKO C;  3AAF A;  1SAU A;  3ABT A;  3KP4 A;  1UMQ A;  1V55 H;  1MMS A;  3CF5 F;  1VND A;  4ZYG A;  4E7H A;  2LR8 A;  1D8J A;  2WAE A;  5E18 F;  3FX3 A;  4O5V A;  1RIO H;  2CSO A;  2CGP A;  2CUF A;  3M4O J;  4MHG A;  1YJ9 I;  3UKG A;  3FMS A;  2QSH X;  1JE8 A;  2YUS A;  4A69 C;  1ZEL A;  2E1O A;  2X51 A;  1C0W A;  4N4N B;  3ZGK A;  1GXP A;  9ANT A;  4BE0 A;  3PM1 A;  4TV7 A;  1S9H A;  2ZSH B;  3ZCO A;  4NHJ A;  4QPQ A;  2UWM A;  1OCR H;  5BQT A;  3A0B C;  4U88 A;  5A2Q Z;  1J7K A;  1JUS A;  2VOD A;  3QPL A;  2O9L A;  2XF7 A;  3G71 I;  3FWE A;  3K4N A;  1XDU A;  4ZYH A;  3G4S I;  1T38 A;  2AHQ A;  2CWE A;  1GVD A;  4RBO A;  4M9X A;  4XL9 A;  4BDZ A;  3U1D A;  2OBP A;  4GXO A;  1JGS A;  2H8R A;  2FX0 A;  1POG A;  3HYI A;  1STZ A;  2MA3 A;  4ESF A;  3CO7 C;  3SQN A;  5D5X B;  1D0Y A;  2QUF A;  2FML A;  1OFC X;  1QGP A;  4EAT A;  4JX6 A;  2LNB A;  4HLY A;  3CF2 A;  5TJJ A;  1VQ8 I;  3F8C A;  1LE8 A;  2IW5 A;  2CUJ A;  2VBZ A;  5TIS C;  1WKM A;  3ERM A;  1P7J A;  3FZV A;  1XMK A;  3C1D A;  3ZMU A;  3J80 Z;  1R6R A;  4CSW A;  2F4O B;  3DF8 A;  1BR1 A;  3H92 A;  1NH3 A;  2RQQ A;  3ABM H;  2DYR H;  4C30 A;  2XKP A;  5FKN A;  3Q0V A;  4A3F J;  4NB5 A;  2XRO A;  3BZ6 A;  3VB2 A;  1P4X A;  2QSF X;  3TDU C;  3K1P A;  1L3L A;  3FF5 A;  1VQ7 I;  2O61 A;  2OPT A;  2LRD A;  1JTX A;  2V6E A;  3PSI A;  3GFM A;  4DBR A;  4M6Y A;  4PUS A;  5BPI A;  1WPK A;  4KIB A;  2P4W A;  4H4K C;  5E79 C;  1YLF A;  4IZZ A;  1Z3Y A;  2E5Z A;  1I6H J;  2HDC A;  3RYP A;  1IW7 F;  5K7H A;  2HNH A;  1JGG A;  1B4A A;  3K9T A;  1R7J A;  5KK1 A;  2VPL A;  1FX7 A;  3HTU A;  3R4K A;  4S05 A;  2DMU A;  3K4K A;  3TP0 A;  4L9J A;  2O8X A;  1X1C A;  4UNO A;  2EZI A;  4LG0 A;  1MMA A;  4XMY A;  3GTK J;  1K6Y A;  1U2W A;  2PEX A;  3NQO A;  3A01 A;  3CLQ A;  1IRF A;  2MD0 A;  2R7O A;  3KLN A;  2PBI A;  1T8I A;  2ME6 A;  3SFZ A;  4WXC A;  1UCR A;  1GV2 A;  4IXA A;  4YFK F;  5FJ8 J;  1Z1D A;  4A6D A;  3F22 A;  4M3B A;  2E34 A;  3IWF A;  2KIF A;  3G2B A;  1S72 I;  4XRM A;  3P9I A;  1TQP A;  2D45 A;  3CDL A;  2V26 A;  3HOT A;  4A3B J;  2GIZ A;  3E3V A;  1XSX A;  5CVV A;  2ZC2 A;  1FMV A;  3TMO A;  4Y4R A;  1IAW A;  3HSF A;  3ESW B;  2BY3 A;  4XNF A;  4XN3 A;  5B3S H;  2DMT A;  3V8J A;  1RES A;  2LLK A;  3K1N A;  5LRS A;  4AYB N;  4XRS G;  4OIR F;  3IH4 A;  3WE3 A;  1FPQ A;  4IPA A;  4RLQ A;  2DMN A;  3OYE A;  1FBQ A;  1UHW A;  1S3J A;  3KP7 A;  1ITY A;  3MEX A;  4AYB A;  5EEA A;  4AM3 A;  2X1C A;  1IJW C;  4RAZ A;  2CW8 A;  2HYG D;  3H5N A;  3CUQ C;  3OR2 C;  2RV8 A;  1U5T A;  3ZQH A;  5LHG A;  2E1C A;  1ZGW A;  1IV8 A;  4HBL A;  4ENN A;  2AXT C;  3IKT A;  4JYK A;  3HPH A;  5IT9 K;  2O7O A;  1O7F A;  3FXJ A;  5J4Y A;  2ESH A;  2R5Y B;  4D0P A;  2P5K A;  1P4W A;  4A3E J;  2HYJ A;  2ZXW H;  3CUO A;  3WGI A;  2OQG A;  3TOB A;  1DDN A;  1ON2 A;  4AWX B;  2HZT A;  2XAU A;  1ZAO A;  2ZXI A;  3BCA A;  3BG9 A;  3KEY A;  1WGX A;  2J5O A;  4JP0 A;  1SVL A;  1B72 A;  1Z7U A;  2YR2 A;  4HQE A;  2MBF A;  5IY5 H;  2A07 F;  5K1Y A;  2LBF B;  4ZTF A;  3V7R A;  3K2A A;  3R6S A;  2XGX A;  4AIJ A;  3CJT B;  2ZKZ A;  4F7Z A;  4S0H B;  1LDK B;  3WHC A;  2O5R A;  3CLO A;  4G9Y A;  1LFB A;  4I7H A;  3FM3 A;  3LQR A;  4ZDL A;  2BW3 A;  4XOR A;  3T8R A;  1HW1 A;  2DQL A;  1JKR C;  3BT9 A;  5EEG A;  3W6V A;  3OIQ A;  1PP7 U;  3S1Q J;  2NVQ J;  1FEX A;  1TBX A;  1GVJ A;  2EIM H;  1TTY A;  2DMP A;  4IX7 A;  2AQF A;  1RKT A;  2P8T A;  3IKV A;  2DBB A;  4QSH A;  3T0Y A;  4AC0 A;  2CQ7 A;  4JOM A;  2QBY B;  1OCP A;  2XPW A;  1QHG A;  2DDA A;  4P96 A;  3CDI A;  4DYC A;  1LFU P;  2D2W A;  5IP9 J;  5A2Q K;  2B63 J;  3HG9 A;  4C3J J;  3ZRG A;  2IT0 A;  1RI7 A;  1BA5 A;  2DFF A;  2V9K A;  6PAX A;  2ZXH A;  2VKE A;  1P92 A;  5FLV A;  3T8T A;  1XN7 A;  4FE7 A;  3JRH A;  3CCU I;  2H8W A;  1RET A;  3G3Z A;  2M0M A;  2K9S A;  1G8X A;  3KLO A;  1HW2 A;  2HZD A;  2DT7 B;  4PZJ A;  3BQY A;  2M4G A;  1TWH J;  5HNF A;  2IJL A;  3LNQ A;  1OCT C;  1K83 J;  5D4S A;  1WVR A;  2QCO A;  1QRY A;  4HZF A;  4UUT A;  4DZJ A;  3ZQI A;  3M8E A;  2R7T A;  4HW0 A;  1AA7 A;  4BHC A;  3BG3 A;  3KEQ A;  1BR2 A;  5E20 A;  2LF8 A;  1SD5 A;  3HOX J;  3WE2 A;  4NUB A;  1W7P D;  1I6X A;  2FE3 A;  2JA2 A;  3J80 K;  5ICG A;  5JHU A;  2O0Y A;  1T0F C;  4GDF A;  1HBX G;  3SZG A;  4L5E A;  4G12 A;  3WTZ A;  5FKM A;  4BQQ A;  5E3N A;  3FKJ A;  5K5Q A;  3DBH B;  1KU9 A;  3E6D A;  1I3Q J;  1ZH5 A;  3ZQG A;  4RGU A;  2IA1 A;  4JX4 A;  4DJA A;  3DP7 A;  5DM7 F;  1XB4 A;  1GDT A;  1F4K A;  4Z6Y A;  2Y48 A;  2M8E A;  1XG1 A;  3QWL A;  1R1U A;  3VYU B;  2L0K A;  3OOP A;  4HG2 A;  4YIR X;  2K27 A;  1BC8 C;  1D5Y A;  3F9K A;  4L5I A;  3GFI A;  3E5X A;  4IRH A;  1I1S A;  1DUX C;  2CMP A;  1K6O A;  3DBL B;  2HOA A;  3G1M A;  2R7R A;  2HEO A;  3DPL C;  1RUO A;  3L2W A;  1R49 A;  1V3F A;  2JVG A;  2OUM A;  1XCV A;  5FD5 A;  1N78 A;  1B59 A;  2JWT A;  3IRQ A;  3O3K A;  4LLL A;  4DQ2 A;  2CQK A;  3CES A;  2ISY A;  5D5W B;  2V1N A;  2X6X A;  3HRM A;  1A6I A;  3IC7 A;  2STW A;  2R7Z J;  4AUX A;  3MZH A;  2R0Q C;  1PDN C;  2E19 A;  3PFY A;  2K9N A;  3GLX A;  3IHU A;  1Y0U A;  1WJB A;  2EFQ A;  5H6R A;  5FLX Z;  1LDD A;  2E60 A;  2N8G A;  2CQN A;  2E71 A;  1CQT A;  3M1E A;  5IOZ A;  5BMZ A;  2HQ5 A;  1IUF A;  4C2M J;  2WAD A;  3S1N J;  1W5T A;  4EJT A;  1OCZ H;  2R7F A;  3BOQ A;  2CUE A;  1IZ1 A;  3CJN A;  3I56 I;  2R3S A;  5C4J J;  2FMY A;  1ERD A;  2W82 A;  2EPF A;  4C3I J;  2HWV A;  1HOM A;  2FU4 A;  4XKW A;  2M7B A;  3WG9 A;  2KFD A;  3G1O A;  2XSJ C;  1XTA A;  2QF7 A;  5K5O A;  3LQQ A;  3QU3 A;  1HSJ A;  1UZC A;  4KJZ A;  1BBY A;  1QZZ A;  1QQI A;  5C3E J;  1I50 J;  4LK1 F;  1EJ9 A;  5HOD A;  3BJO A;  3HJE A;  4L9N A;  2BE5 F;  2KIU A;  1YJN I;  1YIJ I;  4MQV A;  1H9G A;  1LEA A;  2BY2 A;  5ERI A;  1SAN A;  3TED A;  1O3T A;  1XCB A;  2CQQ A;  2ZO4 A;  3FK6 A;  2KRC A;  4ABZ A;  3LMM A;  1O3S A;  1Q1V A;  3HRT A;  2R5Y A;  3D5S C;  4A2U A;  4DOZ A;  4EM1 A;  4KIS A;  5FB2 A;  1WSU A;  1T95 A;  2GWR A;  3JRA A;  2VJ5 A;  3QOE A;  3M8J A;  2JZY A;  2K4B A;  2V1U A;  2XGD A;  2CW7 A;  4L0Y B;  1VQM I;  5GTI C;  3MKZ A;  3OR1 C;  2KMU A;  3BG7 A;  3DPT A;  2GAU A;  1F5T A;  4HX8 A;  1FJL A;  2FNP A;  3OV8 A;  3WGG A;  1X4P A;  4ASN A;  3OYH A;  4HV5 A;  3D1N I;  1U8R A;  4RM3 A;  4B44 A;  5HDK A;  3MZ8 A;  3KP6 A;  1OYW A;  5LEK A;  3HHG A;  4HNU A;  2CH0 A;  2E7X A;  4DIQ A;  2QSG X;  3ZMT A;  3LST A;  4BAC A;  4IHW A;  4BQA A;  2IPQ X;  1MMD A;  4PFP A;  2QQ9 A;  4EJU A;  2V1D A;  5F6F A;  2LVS A;  5HS7 A;  1IG7 A;  3AKZ A;  4N4O B;  4UUV A;  2QEN A;  3BTC A;  1UG0 A;  1MMG A;  4EGY A;  1Z3X A;  3JRF A;  3GTJ J;  2F5F A;  3CMY A;  1LE8 B;  1ORK A;  2QBY A;  1TL8 A;  4IF4 A;  2JSP A;  2HKX A;  4E7Z A;  1EH8 A;  5AON A;  4BS9 A;  5BPD A;  3OS2 A;  2CW0 F;  2MC3 A;  4D9J A;  3T1B A;  1CGP A;  2BXZ A;  3FMR A;  4MQ9 F;  2X6Y A;  1YHQ I;  2XB0 X;  5IP6 A;  2Y9Z A;  3PJR A;  4LIT A;  5J3L A;  2XAS A;  2P7C B;  1U6G A;  3EYY A;  5D5V B;  1DP3 A;  2LDU A;  3RKX A;  5ILV A;  4HF2 A;  1D1B A;  4BXX J;  3TOA A;  1X4O A;  3PUB A;  3P5J A;  1WJE A;  2YPR A;  3JR9 A;  4A3G J;  3DPU A;  1HC8 A;  5F0F A;  4IL6 C;  4E7J A;  3JRB A;  3KZI C;  4LFU A;  3C3W A;  4ZYE A;  1BOA A;  1ZYR F;  1I27 A;  1A36 A;  4LIV A;  3DKX A;  2XRL A;  1D8K A;  2TCT A;  1FSH A;  3Q3S A;  4RM2 A;  3DCF A;  2LF7 A;  3AFH A;  2KPM A;  2PMU A;  3V4G A;  2OTL I;  4I01 A;  3PNV A;  4WF2 A;  1IDZ A;  4U0Y A;  4BEH A;  1RZ4 A;  2WBM A;  3S3M A;  3BWG A;  2WWY A;  3KP3 A;  3JW4 A;  5TRD A;  1RR8 C;  2JA8 J;  1R00 A;  1SD4 A;  2X6W A;  4CYC A;  4LG0 B;  5C4X J;  3Q0U A;  4BBS J;  3A01 B;  1Z9C A;  2IGK A;  4MIM A;  3H3V K;  3O8G A;  2A69 F;  3LSR A;  3P9K A;  2FOW A;  1K7A A;  2RDP A;  1MW7 A;  2DK5 A;  1FIA A;  5HLI A;  2M2E A;  3BP8 A;  4P9U A;  3CD6 I;  1VQ5 I;  4KIF A;  2WV0 A;  1OR7 C;  3ZXS A;  2IA0 A;  1GV5 A;  4G6Q A;  5CLS A;  1LPQ A;  5CYV A;  3R0J A;  3ZPL A;  5FD6 A;  2FEZ A;  3GCM A;  3RQ4 A;  4CCJ A;  4M74 A;  3FK7 A;  1OLT A;  3TKY A;  1BL0 A;  3ZQC A;  2F5C A;  2VKV A;  2NS0 A;  3F8N A;  1KQ8 A;  3OYG A;  2WV1 A;  4BJ6 C;  1JJ6 C;  3IUO A;  3OYA A;  2Q1Z B;  2GZW A;  4A6E A;  1MBJ A;  2W84 A;  2O8K A;  1TWF J;  2MGQ A;  1Z7L A;  1BM9 A;  2KDZ A;  4WK8 F;  1PVE A;  4II2 A;  2P5L C;  2Y0S N;  1QPM A;  1J5Y A;  1SVO A;  4FIS A;  1UEL B;  2JA5 J;  3S32 A;  1S7A A;  2CJJ A;  3C2G A;  1OIS A;  3EDP A;  2ELK A;  2AXL A;  5FLX K;  1LQ1 A;  2E36 A;  3HUG B;  2DT6 A;  1RPW A;  2UUZ A;  2O3F A;  1O7L A;  5J8C A;  1YW8 A;  4U87 A;  1KA8 A;  5D6F A;  2L7M P;  3FXU A;  4BH9 A;  2JTV A;  1U5T B;  4G6D A;  2LD5 A;  2DXI A;  4B48 A;  4V2F A;  2LC2 A;  4YEL A;  4BQN A;  2CUZ A;  3G73 A;  1RUN A;  3LA3 A;  2CV0 A;  5IP7 J;  1QNT A;  4RLF A;  3NAU A;  3K4J A;  1R23 A;  3OSF A;  2DJN A;  2ZFW A;  4E7S A;  5J8F A;  4I98 B;  3E5U A;  1ZG3 A;  3GW2 A;  1KQ9 A;  4EJO A;  3HIF A;  1GT0 C;  4OAZ A;  2R5Z B;  1KYZ A;  2JQ7 A;  4ZDO A;  2EQR A;  4HSR A;  4BYY A;  4PJM A;  1ON1 A;  1ETW A;  2VBW A;  4AU7 A;  2EV5 A;  2RGV A;  3BDD A;  2GBY A;  4XBF A;  3CO6 C;  3RKY A;  5IYD J;  4PFO A;  2A68 F;  5HS9 A;  1E2X A;  3BR6 A;  3QP5 A;  3LSK A;  2XDV A;  4FX0 A;  3RQI A;  4K2E A;  4MLO A;  4W97 A;  3JAM Z;  2R4G A;  1WWX A;  4Y13 A;  2V7F A;  1XGM A;  2BW3 B;  3LSI A;  3UNG C;  5GAE J;  3V7C A;  4H0E A;  4ESB A;  2K7L A;  1ZN2 A;  4XLP F;  3VOD A;  2EFN A;  5DUI A;  4BL0 B;  1ZGA A;  5LBQ A;  1R5H A;  3DBR B;  2J5P A;  2K4J A;  2WA0 A;  3DTK A;  1PJR A;  1IN8 A;  3H9Q A;  1I1G A;  2VJ4 A;  3CUQ A;  3W2V A;  4CCN A;  2K86 A;  5BS6 A;  2K3F A;  2RVC A;  1U9N A;  2K3P A;  2COB A;  1ACI A;  1G3S A;  3LOC A;  4OU0 A;  4J19 A;  1G2H A;  3OYJ A;  4FCY A;  4IHY A;  1MKM A;  2MD5 A;  4CHU A;  3M9A A;  3HOV J;  3PO3 J;  2ESN A;  3ASO H;  5IT3 A;  3LSP A;  4B09 A;  5B1A H;  4MFE A;  1K4S A;  1MBG A;  3H3Z A;  1M1E B;  4ANJ A;  3JRD A;  3MN2 A;  3KET A;  3J7A O;  4BNC A;  3RTR A;  1W5S A;  3JSP A;  4A5N A;  3PNY A;  3K70 D;  1IN7 A;  2BVL A;  1ZLJ A;  4FX4 A;  4UVB A;  2E5N A;  2EIK H;  2FBH A;  2MH9 A;  4UVA A;  1USS A;  3I71 A;  3KIO A;  3IRR A;  3I64 A;  3TW6 A;  3F21 A;  3MKL A;  2QM3 A;  5L3F A;  3JTG A;  3CJR B;  4RA2 A;  4Y7N J;  1FNN A;  2VBY A;  4WXD A;  2W24 A;  3KYC B;  4EEF G;  2FD5 A;  3GUD A;  2LY1 A;  3L09 A;  4DZP A;  4A3L J;  4O3M A;  4L9V A;  4D7M A;  2VQC A;  2DMQ A;  4A5M A;  1U8B A;  2RNG A;  1RRJ A;  3K6G A;  2XPU A;  4BBR J;  3IH2 A;  3QYF A;  3IL2 A;  2DA1 A;  3IAS 2;  2L7K A;  2PMZ N;  3EUH C;  3I58 A;  5CQE A;  2IGN A;  3WHB A;  4LLN A;  3OL3 A;  4A3I J;  1JUM A;  1K78 A;  1FY7 A;  5CKT A;  3HM5 A;  4UUS A;  4I02 A;  4P5O A;  3IWZ A;  4XR6 A;  3LSM A;  1ZGJ A;  1JXS A;  2L02 A;  2ID3 A;  2ICW G;  3S2H J;  1IN4 A;  1OMI A;  3EET A;  4ZDP A;  1U3E M;  1XMA A;  4MTE A;  2ELH A;  2KIM A;  2XGC A;  2OAZ A;  2L4M A;  1FYM A;  5HDN A;  3QAH A;  2P5V A;  2IGO A;  2L9V A;  1VQ4 I;  3F23 A;  3M07 A;  4BXU A;  2HXI A;  1LJ9 A;  2B9S A;  3H9J A;  1MIJ A;  2OD5 A;  1X2M A;  4RGX A;  4KIC A;  3VPR A;  4Q5S F;  1QO0 D;  2HTJ A;  5DTD A;  3DXJ F;  2XUB A;  5IOY A;  1O3R A;  3BR5 A;  2XVC A;  3OMY A;  2EH3 A;  1J09 A;  3KZY A;  2KRF A;  4UB6 C;  2NNN A;  5F64 A;  3L2Q A;  1JT0 A;  3JTH A;  4Y17 A;  1SFK A;  5ILU A;  5JR3 A;  5F04 A;  4WWC A;  4F52 A;  5BOX A;  1FYK A;  1UAA A;  3S17 J;  1R5G A;  3AL0 B;  1F9N A;  3OYB A;  4BDY A;  4M3E A;  1UG2 A;  4GCV A;  3DKW A;  1Z67 A;  3ZQ7 A;  1BJA A;  3NAR A;  2NVT J;  1Z0X A;  4YEJ A;  1T0F A;  4G7H F;  1TW3 A;  3PQK A;  2DW4 A;  3FM5 A;  3L2R A;  1QZE A;  1F1Z A;  2ZNZ A;  2FNA A;  2X48 A;  4XOP A;  3M3Y J;  2DA5 A;  1DPR A;  4PDK A;  2E1N A;  3K4L A;  2GA2 A;  1N75 A;  3OY9 A;  2GLO A;  4XIC A;  3N05 A;  1YRN A;  1YW7 A;  2A5W A;  1U78 A;  3DTI A;  1OYI A;  2PMH A;  3ZN0 A;  4A0Z A;  1K79 A;  4FAS D;  2NRA C;  3U21 A;  4GYG A;  3S1R J;  1P7I A;  4ZYD A;  4X1E A;  4ZYA A;  3ML6 A;  4HV6 A;  5H20 A;  3DU5 A;  2NVX J;  2MH2 A;  1ZK8 A;  3ABK H;  1HDP A;  2Q2E B;  4UVC A;  1HKS A;  2EIN H;  3HUG A;  1ZRC A;  5CQG A;  3D5R C;  2CO5 A;  5EG0 A;  3ECH A;  4M3F A;  1SC7 A;  3RZD J;  1AKH A;  1ZQ3 P;  2OU2 A;  1W0T A;  2Q8K A;  5GPA A;  5D4R A;  4HYE A;  2EIL H;  2P6S A;  4CYD A;  2F5V A; 
#chains in the Genus database with same CATH homology
 2VJI A;  4R79 A;  2LH9 A;  4HEA 2;  3CES A;  2WY8 Q;  2W1O A;  2V1N A;  2X6X A;  4NC8 A;  3OWT A;  4BE2 A;  2M7A A;  3MKY B;  3PSF A;  4XM3 A;  4CCO A;  2L2O A;  5FRN A;  2CFO A;  3H5A A;  3PFY A;  2IS4 A;  1WJB A;  4E7K A;  2E60 A;  3AL0 C;  4Y3O A;  1BR4 A;  5CPR B;  4AVZ A;  5FRM A;  1DQU A;  5KHD A;  4E4H A;  2WAD A;  4ZTJ A;  1X1B A;  2IS6 A;  2E1M B;  2GOX B;  2F4I A;  2VB6 A;  2QKL B;  2FUG 2;  2I8D A;  2P0W A;  2R7S A;  2KHM A;  1ERD A;  2VXD A;  2W82 A;  2HVQ A;  4G6T B;  3KX2 A;  3FDY A;  2QKM B;  4XKW A;  4Y33 A;  4X0G A;  2M7B A;  4XN0 A;  4BGD A;  2NOJ B;  1X1A A;  2XSJ C;  3RPU D;  2PMZ A;  3OYM A;  4KJZ A;  1V5F A;  1LVK A;  4XKB A;  2LY2 A;  1Y6I A;  1X19 A;  1WJD A;  2VJJ A;  1LFP A;  4BUP A;  2LOO A;  2JUG A;  2LG4 A;  3I9V 2;  4CCL A;  4CA0 A;  2Z16 A;  2VQH A;  4U7B A;  4B43 A;  4D1Q A;  3A4C A;  3C2H A;  4J01 A;  3K10 A;  2KRC A;  4F92 B;  3LMM A;  4J00 A;  3GBG A;  1G59 A;  4IQJ A;  4XON A;  3D5S C;  3OL4 A;  3VDX A;  4KIT B;  4DOZ A;  2KL4 A;  3HXL A;  4KIS A;  3W2W A;  3BC8 A;  2KLO A;  2DJI A;  3LSG A;  1T95 A;  2MFZ A;  2VJ5 A;  3QOE A;  3M8J A;  4II3 A;  1EA3 A;  2L5Q A;  3UR3 C;  2CW7 A;  1TZL A;  3MKZ A;  3OR1 C;  3DEE A;  3DPT A;  3CMM A;  1WFX A;  2KMU A;  2ZFU A;  3BG7 A;  2M4K A;  3CP2 A;  2L9S A;  4XLA A;  3TBI A;  4BE1 A;  3H35 A;  2IXS A;  4CH7 A;  1VZ0 A;  1X4P A;  3OYH A;  1N77 A;  2R7W A;  4XQF A;  4ITV A;  1DGR M;  4RM3 A;  4B44 A;  4BEH B;  2F6C A;  2KRH A;  5LD2 C;  4PSX A;  4BJ5 C;  4HNU A;  3HC7 A;  2CH0 A;  4PJJ A;  4DIQ A;  2E1M C;  4BAC A;  4FET A;  2ZSI B;  1MMD A;  4PFP A;  3H0D A;  4E7I A;  3BG6 A;  2VL8 A;  2X1E A;  3CZ6 A;  3AKZ A;  4N4O B;  2VXZ A;  2MAB A;  1UG0 A;  1LKX A;  3DTE A;  1MMG A;  1W36 C;  3OYN A;  1Z3X A;  2CV2 A;  4HRI A;  2W4S A;  3DU6 A;  1SAU A;  2JSP A;  1PYV A;  4E7Z A;  3CP8 A;  4BS9 A;  3OS2 A;  4E7H A;  4D9J A;  2UV1 A;  2X6Y A;  1HA8 A;  2WAE A;  3OYC A;  4HPQ A;  4JQF A;  4LIT A;  3PJR A;  3VYS B;  1DP3 A;  1W36 D;  2R7X A;  1D1B A;  4PJN A;  1X4O A;  1ZEL A;  2X51 A;  3PUB A;  1WJE A;  3OS0 A;  4N4N B;  3ZGK A;  3A1Y A;  3DPU A;  1NG7 A;  2WY7 Q;  4BE0 A;  4E7J A;  4RMN A;  1S9H A;  4C2U A;  2ZSH B;  3ZCO A;  2VKH A;  2X85 A;  5TGT A;  5FRO A;  3RCO A;  2WAF A;  3IAM 2;  4GRI A;  3HKZ A;  4QPQ A;  2UWM A;  3VWB A;  3D5L A;  1BOB A;  4LIV A;  3DKX A;  2OV7 A;  4IKF A;  3ZR8 X;  3SEZ A;  4RM2 A;  1KON A;  4E6K G;  1QHH D;  2XF7 A;  3A2K A;  3AFH A;  2KPM A;  3K4N A;  2MYS A;  4YRV A;  3PNV A;  4BEH A;  2HVS A;  2WBM A;  4XL9 A;  3H5R A;  3S3M A;  4BDZ A;  3VYT B;  3BLY A;  3LL7 A;  2Z2S B;  2X6W A;  2DCE A;  2IGK A;  3W3C A;  4BQO A;  1D0Y A;  3SDB A;  2VQG A;  1V5G A;  4CCK A;  1MW7 A;  3ONQ A;  3QOD A;  4EAT A;  2HU9 A;  3IP4 B;  4OAY A;  3CF2 A;  3L2U A;  1MNE A;  2Z1D A;  2CUJ A;  1OR7 C;  3ZXS A;  4XOT A;  2BVM A;  1Z21 A;  3H9G A;  3I3L A;  3RQ4 A;  4CCJ A;  1OLT A;  1R6R A;  4CSW A;  3OYG A;  4BJ6 C;  1BR1 A;  2RQQ A;  3IUO A;  2HPM A;  3OYA A;  4C30 A;  1YX5 A;  4F55 A;  2Q1Z B;  4IQ4 A;  3HL2 A;  1Z7L A;  4LIU A;  3OS1 A;  2R7U A;  1Y56 A;  4C9Y A;  4II2 A;  1YE9 A;  2ELJ A;  2LRD A;  1UEL B;  5HVQ C;  4PJL A;  2HPI A;  3S32 A;  4PK4 A;  3HPG A;  3PSI A;  3E0J B;  2W7N A;  2V6E A;  3C2G A;  4DBR A;  4PUS A;  1WJC A;  4NQW B;  3HUG B;  4IZZ A;  2DT6 A;  4H4K C;  1Z3Y A;  2E5Z A;  4LG3 A;  2UUZ A;  4F3Q A;  4U87 A;  3K4C A;  1WJ5 A;  3MKW B;  2KQR A;  2HVR A;  2DXI A;  3PNT A;  2V4J C;  3EUA A;  4B48 A;  2HNH A;  2LC2 A;  2M3A A;  4YEL A;  4BQN A;  2VPL A;  2CUZ A;  3K4K A;  1WJA A;  2CV0 A;  4RLF A;  3J7A Y;  4BJT A;  1X1C A;  2RRE A;  3K4J A;  3V42 A;  3EPZ A;  4E7S A;  1MMA A;  2A6T A;  4XMY A;  2R7V A;  1K6Y A;  3LFU A;  2MD0 A;  2R7O A;  1DGW Y;  2VAS A;  2BOL A;  2CV1 A;  4OAZ A;  2XF5 A;  3NWT A;  4ZDO A;  2VKD A;  4HSR A;  4PJM A;  4NNJ A;  4AU7 A;  3G2B A;  3L2V A;  2V26 A;  3HOT A;  4PFO A;  3RSN A;  3QYB A;  2PJR B;  1YX3 A;  4XLF A;  3LSK A;  2XDV A;  1FMV A;  4C2T A;  3TMO A;  4MLO A;  4Y4R A;  2R4G A;  4B47 A;  4XNF A;  4XN3 A;  2LRE A;  1NG6 A;  2V7F A;  1D0X A;  2BW3 B;  3LSI A;  3UNG C;  4BL0 B;  3FBN B;  4CCM A;  2WA0 A;  3DTK A;  1PJR A;  2HDW A;  2W00 A;  3ZQQ A;  3H9Q A;  2VJ4 A;  3W2V A;  4CCN A;  3K70 C;  4RLQ A;  2DOA A;  3OYE A;  2X1D A;  2K3P A;  3SEQ A;  4HST A;  3OYJ A;  4AYB A;  3OYD A;  2X1C A;  5LFA A;  2CW8 A;  3H5N A;  3OR2 C;  4E7L A;  4ANJ A;  3OYF A;  2IS2 A;  2KDO A;  3RTR A;  3HPH A;  2K9M A;  3PNY A;  3K70 D;  3PL8 A;  2BVL A;  2E5N A;  1D1A A;  1IRX A;  2CS3 A;  1U0J A;  2L9N A;  1E0E A;  3VSK A;  3CJR B;  1P9Q C;  2XAU A;  2ZXI A;  3BCA A;  2IGM A;  3KEY A;  3W2A A;  3TL4 X;  2HQA A;  2LY1 A;  3K4B A;  3OIP A;  3DLA A;  5KNL A;  4XKV A;  2AQE A;  2VQC A;  4KT6 A;  2K5C A;  2RNG A;  3K6G A;  2LBF B;  4ZTF A;  3QYF A;  3MMY B;  3IAS 2;  4BU2 A;  2PJR A;  2L7K A;  3S3N A;  2XC7 A;  3SYT A;  1X1D A;  3EUH C;  1LDK B;  5CQE A;  2O5R A;  2IGN A;  3OL3 A;  1MND A;  3E1S A;  2K9L A;  4QPO A;  2MC4 A;  4ZDL A;  2BW3 A;  4XOR A;  5CKT A;  4P5O A;  4XR6 A;  3LSM A;  3OIQ A;  5HNH A;  3S93 A;  4PSW A;  1WJF A;  4ZDP A;  4F91 B;  4IX7 A;  3BCB A;  3DKY A;  3OYK A;  2AQF A;  3OYI A;  4JOM A;  2LYC A;  2IGO A;  1GLN A;  1QHG A;  4CUG A;  1V5E A;  3H9J A;  3HG9 A;  3ZRG A;  5KCM A;  3S8P A;  2V9K A;  2ZXH A;  4NC7 A;  2Y0S A;  3OMY A;  3M1C A;  3VSL A;  1QU3 A;  1J09 A;  3DWL E;  4B3X A;  1D0Z A;  2M0M A;  2OC6 A;  1G8X A;  3S3O A;  3L2Q A;  2HZD A;  4DBQ A;  1JI8 A;  4DGW B;  2DT7 B;  4OWR B;  1SFK A;  2M4G A;  5HNF A;  4F52 A;  1UAA A;  3NWS A;  4XLC A;  3AL0 B;  3CJQ B;  2XF6 A;  4F93 B;  3OYB A;  4BDY A;  1AA7 A;  2R7T A;  1BR2 A;  3EUK L;  3K4M A;  4YEJ A;  3LSH A;  4NUB A;  2LBF A;  2VIX A;  3L2R A;  2JA2 A;  2KZV A;  4XOP A;  4XLE A;  4ZJZ A;  2VQL A;  1T0F C;  1FMW A;  3MD2 A;  3DQV C;  3OYL A;  3SZG A;  3K4L A;  4BQQ A;  1N75 A;  3OY9 A;  3FKJ A;  2GOM A;  3N05 A;  2A5W A;  4XLH A;  3DTI A;  4P1W A;  4DJA A;  3VYR B;  4FAS D;  3U21 A;  2VLA A;  4XKC A;  2R7Q A;  4ZYA A;  5JHF A;  4BXF A;  1D1C A;  1MMN A;  3VYU B;  3DU5 A;  4HG2 A;  3FHN A;  3F9K A;  3QYE A;  4CZC A;  2Q2E B;  2WB1 A;  3HOS A;  2WAQ A;  1TT0 A;  3FBI B;  2CMP A;  5CQG A;  3D5R C;  2IS1 A;  3KYL A;  2R7R A;  3DPL C;  3L2W A;  4ZC3 A;  4HNT A;  2KP6 A;  2JVG A;  2OUM A;  1N78 A;  2JVH A;  5HLT A;  5HOO A;  2F5V A;  3OOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...