3OMYA

Crystal structure of the ped208 tram n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
51
structure length
51
Chain Sequence
PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cooperative DNA recognition by the plasmid conjugation factor, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Protein traM
total genus 19
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3omyA00
1DP3A 3OMYA 4QPOA 4QPQA
chains in the Genus database with same CATH superfamily
5D5WB 2ZMEA 2EFPA 2VODA 2P5LC 3ISPA 2W7NA 1HF0A 4CUGA 4DJAA 5FKKA 2X1CA 2ZO4A 2DU9A 1PUFB 2X51A 4CDGA 1D5VA 3VYUB 1ETYA 2IEKA 4G94A 4RB3C 3OY9A 1H89C 2K5CA 2RV8A 4S05A 4XLCA 3I0TA 1JGGA 2XB0X 3EUKL 2X0LA 5FKLA 4EM2A 2ZBKA 4KN7X 2GA1A 1NH3A 4XSXF 2ZMEC 1MGTA 5F0FA 2X4HA 2IS2A 3O3KA 4Q5SF 1Z0XA 5ICEA 3T1BA 4II2A 4E7IA 2R7TA 1FBQA 2V7FA 3KZZA 4PJLA 5FLMJ 2LTPA 1SVLA 4ZC3A 1DDNA 1K4TA 3HOVJ 4AU7A 3GFLA 1FOKA 1ZREA 3ZQQA 5FGMA 3K4JA 4JBAA 3IRRA 5FKNA 3G1LA 4E7ZA 1LDDA 3GWZA 2VE8A 3K9TA 3BG9A 4BU2A 1MKMA 1LDKB 2L01A 2M3AA 2QWWA 2Z33A 3K4LA 3T5XA 5HDKA 2CJJA 4HNUA 5K7HA 1G4DA 3QU6A 1BR4A 3NEUA 1MBJA 4IL6C 1Y0UA 5FJ8J 2R5ZB 4ZDLA 3CJQB 3WGHA 1MNEA 3K1MA 4FASD 4M72A 1BIAA 2OA4A 3FXKA 2VC0A 3OOPA 4P9FA 4NNJA 2M1BA 3FK6A 1DGWY 3MKLA 4HF1A 2GOXB 2F5FA 3VSKA 3E3VA 4M3EA 4F93B 1QO0D 3JTGA 3G71I 1GVJA 3HOYJ 2DTRA 3F6VA 1EH6A 2UXNA 4L5IA 4UUVA 3IP4B 3HKZN 3K6GA 3FMSA 4II3A 2PJRB 3ZQCA 1WI9A 2P8TA 4IO9F 3EYYA 4D7MA 2CYYA 1QU3A 5IT9K 5FO5A 5LHIA 4JX6A 3QYBA 3OYLA 3E6BA 9ANTA 3DTEA 3E6DA 1MH4A 2ACJA 1J75A 2XGDA 1FJLA 5LEJA 2E35A 2QENA 3P9KA 3BROA 4F91B 2CFOA 1B8IA 2BXYA 3DPUA 2IGOA 2L9VA 2RNGA 4CCKA 2DN0A 2M34A 4HOBA 3EETA 1GXQA 2VJ4A 2CSOA 1E3PA 3MZHA 2RN7A 2MFZA 3SFIA 2P81A 3ZGKA 5EEGA 3JRGA 5BMZA 1T8IA 2R0QC 3CD6I 1HDDC 2F5EA 4QWQA 4U0WA 3BC8A 4IHTA 2HOSA 4PZJA 4A0YA 1O7LA 3C18A 3LA3A 1WI3A 3RKYA 1TT0A 5KNLA 1YI2I 5FD6A 2FBKA 2W84A 4I7HA 5E3NA 4WF2A 2OTLI 2XASA 2VUMJ 1IG7A 1USSA 4OAYA 1ZAOA 3ECHA 5HS8A 2V1XA 1PVEA 1OYWA 2BYVE 4WXDA 3PNTA 4D9JA 5HLGA 3DEWA 1O4XA 2DJNA 4G7ZF 4I02A 1D1CA 2D1HA 1BC7C 3HUGA 2FE3A 3CCRI 1GDTA 2XAUA 2BHYA 1SD6A 2M8GX 2QQ8A 1A04A 1U5TC 1I27A 2VIXA 2UWMA 2HYFA 3PIOF 2EQRA 4C3IJ 3VB2A 2HZTA 2O03A 1D0ZA 4UNOA 3RDIA 4UUTA 1FX7A 3AG2H 3MMYB 1Z6TA 4LG0B 2CW8A 2I5UA 3HRSA 4CO8A 3F6OA 2CMPA 2NVXJ 1VNDA 2ME0A 2Y31A 3RI4A 5LEKA 1IN5A 1YX5A 2Q0OA 1K4SA 2QQAA 2PJRA 2QF7A 5D6EA 3I4MJ 4NC8A 1TWFJ 2VONA 5C4XJ 2G0EA 3W2WA 5F27A 1BL0A 4Y4RA 4H0EA 1A36A 2FOKA 1XSVA 3T0YA 4RMNA 3F8MA 4B44A 1IRGA 2XF5A 4LK0F 1J59A 1AKHB 1GV5A 4XR6A 1YITI 2ZXWH 1OISA 2VOOA 4A3EJ 3KCCA 3BR0A 3NWTA 4MNUA 3V7SA 4U87A 4RB2C 3GBGA 4UUSB 3SYTA 3IKTA 1LFPA 2J5PA 3P9IA 2G9WA 2JPCA 4XLEA 1YRNB 1IC8A 1MD0A 2EWNA 3I59B 4L0ZB 1D8KA 2BEOA 1RUNA 3CQZJ 1S8NA 2M7BA 5E8IA 2W85A 1K79A 1SFEA 2IA1A 2KIQA 2WC2A 5M5YJ 5IYCJ 1IN6A 2KJBA 4QSHA 5K7ZA 4XK4A 4C30A 4D7NA 1IDZA 3J7ZI 4CCLA 1UB9A 5CVIA 3R0JA 3DKXA 2G7UA 1P4XA 1MBHA 3C2BA 1RR8C 3A4CA 4RLFA 1X3ZB 2M45A 4RM2A 4F3QA 2Z16A 4BACA 3VODA 3MZ8A 2K9LA 3K2AA 4V19K 2GIZA 2VKHA 1TTYA 1QVTA 1ULYA 1XTAA 3T8RA 2ID3A 2F5CA 2YPRA 4PCQA 4GFBA 3H5RA 2W57A 2E19A 2R7UA 2VJ5A 2X6XA 2L54A 2HGCA 2M5WA 4G8XA 5E3MA 2RGVA 1G6NA 2HQAA 1G3TA 4YFXF 2BOLA 4B1RA 4FT8A 4XORA 1B72B 3DLLF 3ZMVA 2AXTC 3J81K 4BE0A 1TWHJ 4DNCA 5HDNA 4PJJA 1WGXA 4NC7A 3DLAA 4L18B 5F1RA 3ABTA 2R7DA 1Z91A 2QKLB 3LSMA 4BXFA 2Z2SB 4EJUA 3MKYB 2IT0A 3JREA 4ZJZA 2FXAA 1U5TB 3J80Z 1DPRA 1ZHFA 1D0YA 4YELA 4AYBA 3E5QA 2JPBA 1W7PB 3SDBA 4HX4A 1OR7C 1UELB 1BI2A 1N75A 1QVUA 3HSFA 1JUSA 2CH0A 2VBXA 1ZKGA 2OD5A 4G6DA 1R5HA 3DPTA 1F5TA 4KA4A 3VYSB 1T6SA 5K5RA 1B9NA 3BZ6A 2JSPA 1EA3A 2LY1A 1WHUA 4G9YA 2H6BA 4A3IJ 1BOBA 4FTHA 5DEQA 3LA7A 2DPUA 1FC3A 3BR5A 1XCVA 2LSOA 1F43A 1UG0A 3DEUA 1R49A 3Q5FA 1G3YA 1WJ5A 2V6EA 4DIQA 4LLLA 3DWLE 2LF7A 4EVIA 2JA5J 2O8KA 1JUMA 3MQ0A 1VQMI 1OFCX 3FXMA 1WJAA 4PJMA 1VQLI 2RC4A 3SFZA 2CW0F 4A3MJ 4KDPA 3S3OA 4BXXJ 2LYCA 1IZ1A 1SVMA 1U2WA 2Y69H 4B3XA 3ONQA 2XC7A 2E1CA 5KVRA 3LSJA 1ZGWA 4BQQA 3O2PE 1YFHA 1OCTC 2DMTA 3NRVA 2X1EA 4ABZA 1XPXA 4IOCF 4BJTA 3WG7H 1LE8A 2OZ6A 1I3QJ 1IF1A 1NHAA 4JYKA 1YS7A 2BXZA 2LC2A 1QZYA 2DOEA 3GUDA 2DDBA 1D1BA 4KUMA 4B4CA 1XMAA 1JTXA 3EUAA 2W1OA 2X6YA 4XN3A 1Z6RA 2ISYA 1NTCA 4G7OF 1LJ9A 1TQIA 1YLFA 4BXUA 2LBFA 2V1DA 1AKHA 3H36A 4IHXA 4BY1J 3HOUJ 3HTSB 2W25A 1YQAA 2NYXA 2RQQA 3J7YJ 4G6QA 2A07F 2IS1A 4P96A 4BQAA 3HBLA 1Y0NA 2KT0A 2GBYA 1LEBA 2A61A 5EJCA 5F04A 3IL2A 2DFFA 5DYMA 4XL9A 3A01A 2PQ8A 2AXLA 5D5VB 1B8IB 1Z67A 1BA5A 1FP2A 5CQEA 2KQRA 3OYHA 3S15J 1ZRFA 3HOSA 1UJ8A 1RESA 1SFUA 1YYVA 2K9SA 3RKXA 1E2XA 3VYTB 4PGGA 2FMLA 3ERED 2V1UA 1G3WA 5JHUA 1ON2A 2XAQA 2IA0A 2WAQA 2Q8KA 4B48A 1XS9A 2AQEA 1IRFA 4D5CA 5ERIA 1DU0A 4Y33A 1SAXA 2JA7J 4N9HA 5FD5A 4A2UA 5ILSA 3ABUA 2NS0A 1K83J 1ZRCA 3DF8A 5IYBJ 2M30A 2PLYA 1TC3C 2P5KA 3JRAA 2E71A 5J40A 2R7FA 5FFZA 4M9ZA 4R8HA 2K9QA 3QP5A 1JJ8C 5J1YA 1KGSA 4HPQA 4XRSA 3ZRGA 4XKBA 2BV6A 4AWXB 2XGEA 4UV8A 4J01A 2R7XA 3LQRA 4A3KJ 3I53A 3KP6A 5GP9A 2KZGA 3CF2A 1OCPA 1D0XA 2HWVA 1X58A 1ETVA 1WVRA 3TDZC 4WCGA 3L2RA 3F21A 1CF7A 1GXPA 4HRIA 1SANA 4BBSJ 2F2EA 1X1DA 4XLFA 1KA8A 1X4OA 1BW6A 1SAUA 3B6CA 5CVRA 1YW9A 5DCMB 5BPDA 1R71A 3QODA 5AIPA 3DKWA 3BPXA 4UVCA 4RAFA 4L9VA 4EMSA 1KU7A 3BTLA 2B7EA 3SEZA 4YFNF 1X1PA 3FXRA 2XAHA 3JSPA 2MLGA 2RAEA 1R4NB 4G6TB 1FYLA 2V9VA 3DBLB 2JSCA 1OLTA 3BG7A 2FSWA 1A6IA 3BY6A 4E4HA 1K78B 3AL0C 3JRFA 5BPIA 1RRJA 2KZVA 3F23A 1BI0A 3RPUD 1S5LC 4ZYEA 2BZTA 1TLHB 2JA6J 2L9NA 3OYMA 3RJPA 1TW2A 5JLXA 5FFXA 2KJCA 5F0HA 3S1MJ 3LFKA 3EPZA 2DK5A 4CA0A 4XLPF 1JT6A 3HSEA 1ZG5A 3RKQA 1UCRA 2DQLA 1VQ6I 3H1CA 3MFKA 2R93J 2VOPA 3D5SC 1YOVB 2GLOA 1SFOJ 3ROUA 1ZTRA 2ZC2A 2XHKA 3HPGA 3KZYA 4HDUA 3PJRA 4A3JJ 1ZR4A 4GDFA 3LWFA 2ESHA 3ESWB 2IVMA 4F55A 3S14J 5M5WJ 2ZFWA 4IPAA 4MFEA 3CUOA 2HTJA 4G12A 2HDDA 3IRQA 4IHVA 2BVMA 4R1HA 4IVNA 3BT9A 1HKQA 4UB8C 1B4AA 2DDAA 2HI3A 3F3XA 2VBZA 3L7WA 2H1LA 1JGSA 3M4OJ 1Y8QB 5GPAA 4UVAA 2H1KA 2DODA 2VL8A 3H9GA 2DI3A 2RVCA 3CUQC 3CLQA 4CCOA 3OS0A 1T38A 3VWBA 3RYPA 4XKVA 1TZLA 5EGOA 4HLYA 2KDOA 1WH5A 1G3SA 1Z3YA 3HB9A 4HF0A 5E1WA 4U0YA 4AYBN 3NQOA 4AUXA 4WWCA 1FZPB 2NRAC 5IOYA 4NB5A 4MFDA 3SEQA 4PJ0C 3FZVA 2CQXA 4ZZLA 5CVJA 4F7ZA 1X2MA 2LFBA 5EZHA 1R5GA 4PSXA 3ZMZA 2ISZA 1ETOA 5TRDA 3C7JA 4A0XA 4EGZA 3CP8A 4PSWA 1PP7U 3LSHA 3G1MA 4JX4A 1FIAA 3RSNA 4M3DA 1LVKA 3MEXA 3HDDA 3TL4X 5DD4A 2LDUA 2WWYA 1ZK8A 4M3FA 3JRIA 2CUEA 2Y9YA 3J7AO 2XF6A 1WQ2A 3NAUA 4XRSG 4M3GA 2IW5A 2RREA 2MGQA 5DTDA 3CC7I 1VF9A 5DM6F 1TL8A 3I58A 4NQWA 3IV5A 3RIRA 1APLC 2R7ZJ 1T39A 3V8KA 4WXHA 5B5EC 2EZHA 3OYGA 1OCOH 5HS9A 4FISA 5H2FC 2A6TA 5DM7F 1IN7A 2JMWA 3PQJA 4ASNA 1XMXA 2MA3A 4I76A 2VQCA 3B02A 2A6HF 2M7AA 1X1AA 3OS1A 5C3EJ 3L1PA 5GTIC 1GT0C 2EIJH 2W24A 3OWTA 4DBRA 5E18F 3CJRB 5HLIA 1O3RA 1Q1VA 2UXXA 3QYEA 2VBWA 3KP2A 4S0HB 5L3EA 2DT6A 4RGSA 2K4JA 3BOQA 3TW6A 2Z9OA 1YJ9I 4M71A 3WU2C 2X1DA 2Q2EA 3G73A 4QTRA 4DQ2A 1LFBA 3U2RA 1MBGA 2AHQA 3BR2A 5M5XJ 4DZPA 1YO5C 1DPUA 1TQPA 4UV9A 4EJWA 4CCJA 4XLHA 2GXAA 1IW7F 1ETXA 3DTKA 3LSPA 1HSTA 3WTTC 2Z3YA 3TKYA 5AIQA 1K61A 2ZB9A 2F5VA 2HR3A 2ADUA 4YRVA 1WH7A 4HQEA 2EV5A 1FY7A 2ICWG 2EV0A 1Z05A 2X48A 2VASA 3OSFA 1UZCA 2IAIA 1JTYA 2K02A 5BOXA 3WU1B 1UHWA 1T56A 1ZH5A 5KAFC 4Y17A 2W48A 2DA7A 4JK1X 1S7AA 1D1AA 4S04A 3KIOA 3HTUA 1W5CC 2E60A 4CCNA 3NARA 4YIRX 1U9NA 1D5YA 2BW3A 2Y2ZA 5L3CA 3JSOA 5DCFA 2YX7A 3KP7A 4E6KG 4RB0A 3QYFA 3CDLA 4IHWA 1DP7P 1J09A 1NK2P 2XB5A 3A1YA 2MBFA 3IHUA 5HVQC 2EV6A 5CJ9A 1O3QA 1E17A 2E7WA 1J5YA 2MD0A 1FYMA 6PAXA 1XG1A 1KYWA 5HNFA 2LR8A 5DUKA 4Q48A 1FSEA 3CCMI 1BI1A 1F9NA 3AG4H 1ZN2A 2E1MB 3ZR8X 3GVAA 1KU9A 2BBYA 3M07A 2CS3A 3ZQGA 2H94A 4N4NB 2DW4A 2L9RA 4L9TA 1R6RA 4HEA2 2D5VA 3ZPLA 3FM3A 5BQTA 4MQ9F 3BCBA 3WGGA 5CYVA 1BM9A 5E17F 1MDMA 4RAZA 1VQPI 3ECOA 2HOAA 3F8BA 1WSUA 2HZDA 1YW8A 2LY9A 4LIVA 2D45A 4E70A 1LPQA 4UXNA 3LSTA 2HS5A 2MH2A 3LMMA 3MWMA 2D2WA 4BYYA 4UB6C 2KPMA 2WB1N 5ICFA 1T95A 1KU3A 3I71A 3VSLA 4WX9A 1B59A 4UUSA 1I6XA 3F72A 2W4SA 3EDPA 4LIUA 4HBLA 3K1NA 5LHHA 2KRHA 3C2HA 1FTZA 2KIUA 1GHCA 1P92A 2B9SA 2OTJI 4QLCU 2K9NA 3JAMK 1JHHA 1QA6A 1Y56A 2OC6A 4L9NA 4IX7A 3JRCA 2B63J 1R1VA 3BPVA 1KQ8A 2XVCA 1V55H 1V3FA 5H20A 4EV0A 2ETHA 3AG1H 1AA7A 3N4MA 4J00A 1ETWA 5LRRA 2DMPA 4NQWB 2O6GE 3CC4I 1V5EA 3ZQLA 3GYHX 1DU6A 3CP2A 4OIOF 1R4MB 2I8DA 4XONA 1W0UA 2RQPA 4L0YB 1IO2A 5K1YA 3K4BA 4RAGA 5LGNA 4KJZA 1A5JA 2XUBA 5J1UA 1MNDA 2PN6A 1XGMA 1ETKA 3O8GA 1R7JA 2EILH 5JVTA 3FXJA 1MJ9A 2XKPA 4CYDA 2F48A 1VFCA 3DV8A 1X3UA 3BCAA 3OL4A 2EFOA 2ZNYA 3HYIA 5EZGA 1CGPA 5IP6A 2BY3A 2WV0A 1Z1DA 4HZFA 2HU9A 3GLXA 3HXLA 2L3DA 1QQIA 4GCVA 2NXNB 2MC4A 2DA5A 2QBYA 2VC1A 4MTEA 2CUFA 2LOOA 3O6BB 2E2JJ 3H0GJ 1FYKA 2A6EF 1KYZA 1MMNA 2PG4A 1U5TA 1MW7A 1W1WE 4XKCA 4AVPA 2P0WA 5BNGA 2R5YB 2GIVA 4MEYF 2EINH 1Y8RB 5LHGA 2STWA 1R5ID 3D1NI 2DMQA 1YHQI 3E6MA 1VTNC 3QPLA 2DOAA 1V5GA 2V9PA 1L0OC 2Y0SA 1S3JA 3ZQ7A 2ID6A 4BBRJ 3PO3J 2HDWA 3ABKH 2FUG2 2BW3B 2V6CA 3FF5A 4MIMA 3GEZA 2V79A 3W6KB 1AWCA 4QPQA 1HOMA 2R92J 2JK3A 1T2KA 4E7HA 2HXIA 4DYCA 3TMOA 1JT0A 4J19A 3BQZA 3V8JA 4PFOA 2NS8A 4OMZA 5EEHA 5E8GA 1FP1D 1IAWA 1B9MA 1TW3A 2TDXA 4QIWN 3KLNA 2DA1A 5C4JJ 2FRHA 4B8XA 3E0JB 3GTOJ 3EUHA 4C9YA 2EA4A 4PUSA 3ZN1A 5TISC 3RQIA 4IKFA 2FQ3A 3S32A 1I39A 3BQYA 4W97A 5CLSA 3CCEI 1JXSA 3I59A 2KRFA 3HOZJ 3CO6C 3S16J 3SZGA 3IUOA 1X19A 3DP7A 4CH7A 1XDUA 4LMYA 3RPQA 2VJJA 1IN4A 1GV2A 2IRFG 2WTEA 4A3LJ 1W4MA 3K7AJ 2L7MP 5EEAA 2JVGA 1BJAA 1F4KA 3BLYA 1RNLA 4HSTA 4MGRA 3S93A 1WFXA 1XMKA 3K4MA 3X2QH 4XLNF 3ABLH 3K2ZA 2EH3A 3CC2I 2AO9A 1DP3A 1Q1HA 1B72A 2Y9ZA 5CVVA 3OYEA 2NVQJ 5HODA 4PGHA 5K5OA 4CYCA 5JR3A 2IXSA 2EBIA 4ZDOA 2WV1A 4JP0A 1L3LA 2OCEA 4N0BA 5JFRA 4XNFA 4HF2A 3RTRA 2X6OA 3CUQB 2ELKA 3VEPA 3U9GA 4FX4A 3GFMA 1XB4A 2LLKA 2R7WA 1ZGJA 2X6WA 4BY7J 1W7PA 4OMYA 1WZ2A 1IXCA 4UHTA 1F36A 1H0MA 3UR3C 3I54A 2E7XA 2JUCA 3OYDA 4XLAA 4CSWA 1U0JA 3GZ5A 2K7LA 3VYRB 1OCZH 1S7OA 2B0LA 3RYRA 3ZQFA 3ML6A 1VQ5I 2QQBA 3WTYC 1ERDA 2R7SA 3MKZA 1FLIA 3VDXA 5KCMA 2E5ZA 1MBKA 1LE8B 2KDZA 4LLNA 1KQ9A 3N05A 2EZIA 4LJZF 1HQCA 5LGTA 4A3DJ 2DBBA 3OOUA 2EPFA 4L5EA 2EK5A 1R36A 4BUPA 2Y0SN 2LKPA 2OZUA 3B73A 3IAM2 3Q0VA 4X1EA 4JOMA 1KONA 4FE7A 4IJAA 3GX4X 4I6ZA 4KT5C 1W0TA 2N8GA 5GADJ 3TGNA 3J7AY 1P4AA 3AAFA 2VN2A 5D6FA 3JAMZ 1JKRC 2BY0A 1XN7A 4M6XA 4G7HF 5LFAA 5GAGJ 3PSFA 4ESBA 3UKGA 4IHYA 4F92B 2TCTA 3DBRB 5IYDJ 1POGA 2Y0MA 5C44J 3KETA 3OYNA 3QPTA 3SHFA 4A93J 1P7IA 3H3VK 3WTZA 4KYWA 3DTIA 4BL0B 5K5QA 4RBOA 5DV5A 2YX4A 4HX7A 4QPOA 3RKWA 5D5UB 2MLKA 4BQNA 4RM3A 3GZNB 3DFGA 2YU9J 3LAPA 4OWRB 2K85A 2V4JC 4LGWA 5ED4A 4BE1A 4R79A 2UV1A 1K7AA 1GVDA 2CWEA 2DJIA 1YX3A 3SZTA 2CGPA 4LB5A 2QBYB 1EF4A 3WTVC 3IAS2 2L5QA 1ITYA 5HLHA 3JR9A 4M9SA 2QM3A 2A3SA 3L2QA 1D8JA 3FKIJ 1XD7A 4L5JA 1H9GA 2L4AA 1MZBA 5FKOA 2ZXJA 5F0CA 1VQ8I 5J8FA 2BHZA 5IT9Z 4AC0A 5D4RA 1T98A 3F8CA 2DT5A 4XBFA 2OAZA 1HW5A 2E1MC 2LP0A 5IPAA 2VE9A 2IPQX 1REPC 2DA2A 3G4SI 3K4NA 3KEQA 2ZFUA 4C3JJ 3OYAA 2LVSA 1I50J 4V2GA 2QGUA 4M73A 5GAHJ 2WB1A 4XMYA 1RPWA 4CZCA 3KYCB 2KLOA 1QHGA 1N77A 1VQKI 4OIRF 4B43A 2V9KA 1TBXA 2OF7A 1U6GA 3ZMUA 4EM1A 4RA2A 1IDYA 4Y15A 1U78A 1FPQA 2H8RA 1FMWA 3M9AA 3OR1C 5K7FA 5LRSA 5H6QA 1CF7B 1Y1VJ 3A02A 2XRLA 4LFUA 1PP8F 2WY7Q 3N97A 1XSDA 2O5RA 4I98B 5M3MJ 4X0GA 4LITA 5IT3A 5EG0B 5GAEJ 3FXUA 3DBHB 3I3LA 3L09A 3D5LA 1MNMC 3P9CA 1ZR2A 1ZG1A 2GZWA 2XRNA 4E7JA 1USTA 3K4CA 4CYCB 4XKWA 3KP3A 2DYRH 3M8EA 1AHDP 2EB7A 3HIFA 4AD9A 2CRGA 2DFIA 4TV7A 1P7JA 1BC8C 1LFUP 4N9IA 1FMVA 4KMFA 3PQKA 3KP4A 3CCLI 4IZZA 4KFCA 4FQGA 1ZG3A 1R58A 4YEJA 5KAIC 3TO6A 2HQNA 1S29A 2DK8A 3BZKA 3TO9A 1IUFA 3MN2A 1QZEA 4Y7NJ 1R9TJ 2DO7A 4YIFA 3R4KA 3K69A 4IQ4A 3GFIA 1LQ1A 5B1AH 1N78A 3LL7A 3M1EA 2KRCA 3ASOH 3LNQA 1XCBA 4AIDA 2P6TA 3VFZA 5J47A 3HHHA 1RI7A 1A6QA 3IH2A 3QOEA 1TQMA 1BJZA 3C3WA 2DPDA 3S1RJ 4I0AA 3AKZA 3V42A 2OJED 5JHFA 4YIIA 5KK1A 2QKMB 4BQOA 1J7KA 3IWFA 4IRGA 3G6EI 4KISA 1VZ0A 5HNHA 5JI6A 3I56I 1EKEA 2NOGA 2GQQA 1Z7UA 4HA8A 3W3CA 3TW7A 1V4RA 4YG2F 4IOAF 2JT1A 3H0DA 3CMMA 3QU3A 3F8FA 2GAUA 2GXGA 1RIOH 5FLXK 1HKTA 2Y30A 1QZZA 1ETQA 4AIKA 1H88C 4IEJA 3R6SA 4KMUX 1LEAA 3LOCA 4DYQA 1FEXA 1P6RA 4BGDA 3OYFA 3OIQA 1RKTA 1Y6IA 2FBHA 5DD8A 3OV8A 3V4GA 2BY1A 2ESNA 1JUPA 2MD5A 2VKDA 4A3FJ 2KP6A 2CQ7A 2NVYJ 2VXZA 3GXOA 4ZTJA 1SFXA 2LK2A 3LSRA 3JRBA 3GLLA 5FRNA 3EQLF 1S9HA 2DOFA 5CVUA 2DTZA 1P4WA 3HOWJ 1JKPC 3TEDA 1FTTA 2YSRA 2M2EA 2M4GA 4HG2A 4DYRA 3MZYA 3FHZA 3QOPA 3K70C 1MSFC 2JA2A 4PDKA 4A0ZA 4AIJA 2KL4A 5B3SH 2Q1ZB 2M8EA 4JX5A 4O3MA 4RB1A 1WJDA 4I99C 2NOJB 2LBFB 4BH9A 3PIPF 5FLVA 3CESA 2L9SA 3CO7C 3FHNA 2FNAA 3HG9A 2DA4A 1FNNA 3DKYA 4CCMA 3K1PA 5ICCA 1E0EA 3G3ZA 3J80K 2HVSA 2V26A 1T0FC 1ORKA 1DGRM 4BDZA 3ABMH 1G2HA 3V7RA 1W7PD 1OCRH 1OQYA 1HW1A 2BGCA 3F22A 5LD2C 1SC7A 2O8XA 5D8LB 1O57A 3QPHA 2E2HJ 3WTSC 1XGSA 4ENKA 4GRIA 1ZRDA 4D0PA 2VI6A 3WG9A 2FX0A 3BR6A 3K70D 1UHSA 1ZLJA 2RDPA 2CUZA 4I09A 2XPUA 2ZKZA 4Q4ZF 2LH9A 3GMEA 3LQQA 4Y3OA 4IXAA 3SQNA 2AS5F 4ANJA 5M3FJ 2W00A 2ZNZA 1JHFA 2IGKA 4Z2YA 3BJAA 2NVUB 5LBQA 2EFNA 4PK4A 2L7FP 4UY8I 3QWLA 1RC9A 1WJEA 3LSIA 1XGNA 3TDUC 2X9DA 5ICGA 3H9JA 3U1KA 1DUXC 3OYCA 3W6JB 2PMZA 1OJLA 2DAOA 1QGPA 3PL8A 3CJTB 4C3HJ 1YJNI 3HGGA 2HXOA 2STTA 3I4NJ 2OQGA 4O5VA 4EGYA 3W2AA 4EEFG 3BP8A 3HEFA 4YFKF 3FMRA 2CQKA 2E34A 4GYIA 4OOIA 2HEOA 2R4GA 4LK1F 3V7CA 1FOXA 2WAEA 3F0CA 2FJ1A 4A3GJ 2A69F 3IC7A 1UAAA 3S3NA 5IP9J 5E3LA 2XSDC 1T08B 3HC7A 3M1CA 3COAC 3OSGA 3W6VA 4IRIA 2JJ7A 4HX8A 4CICA 1IN8A 3CF5F 3BTCA 2QEXI 1YTYA 1S72I 5F64A 3Q3SA 2QCOA 1F1ZA 3M8JA 3PM1A 4BHPA 1SD4A 5D8KB 4HSRA 4I2OA 3CZ6A 3OYJA 2XAFA 4A5MA 1M1EB 3FX3A 1K78A 2VT2A 3MD2A 3MCZA 2LKXA 2HVQA 2R7VA 2QLZA 3GTPJ 2K86A 3O8HA 3TP0A 4OIPF 4ZZDA 1OMIA 2VJIA 5J3LA 1G8XA 2MYSA 4F52A 2I10A 4C2UA 3QAHA 2WADA 4U88A 2HKOA 3WTUC 2NS7A 2HTSA 3CMEI 5L3DA 2CV1A 3C2GA 4D1QA 2GOMA 2YU3A 4RDUA 2ECCA 2IGNA 5LGUA 5FLXZ 1FBSA 3FISA 1NG7A 4RLQA 2IA2A 3C1DA 3OIPA 4A3CJ 1Y1WJ 3E5XA 1P2FA 3A0BC 3KEOA 4EJTA 1MMSA 1TWGJ 3GTMJ 1SVOA 1MJAA 3WHCA 2FA5A 4MO7A 4NUBA 2FBIA 2OPTA 3CMYA 4HNVA 3JTHA 4HQMA 4FX0A 4P5OA 1JJ6C 3K10A 2CQQA 3KP5A 2DYSH 4AVZA 1MDMB 2XAGA 1IXRC 2M4KA 4FETA 4GGGA 1J0RA 3BJ6A 3D5RC 4LG3A 4ZYDA 1I3AA 2F5DA 2M9HA 3BJOA 2IS4A 4KT6A 2VQLA 5AONA 5LLQA 1A35A 3VPRA 2WAQN 3OIOA 2O0YA 4IHSA 3CDHA 3CCJI 3WE2A 3PFYA 1HC8A 3IH3A 3G1OA 2VXDA 1BI3A 3BZCA 2P7CB 1ACIA 4CHUA 4DGWB 2DFHA 1E3HA 1HLVA 1OKRA 3TBIA 3AG3H 5J1RA 3GZ6A 2KISA 3E6CC 4XRFA 2K27A 4HV5A 3GTGJ 2PI0A 4GO1A 5E20A 4P55A 3HJEA 2EZLA 3I64A 4FHTA 2K3FA 1I1SA 1J2XA 3PSIA 3A0HC 3B6AA 4ZDPA 3UNGC 3H5AA 1BIBA 3HM5A 2BY2A 1VQ7I 1CQTA 1QRYA 3JRDA 3U21A 2XGCA 4XM3A 4HNTA 1YJWI 1VQ9I 3Q0WA 3RCOA 1ON1A 4HLXA 2F4IA 1BBYA 1X4PA 1VQNI 1HKSA 2CV0A 3OYKA 2HKXA 3T8TA 5TGTA 4OAZA 2PMUA 3SXYA 1FOYA 2KIMA 1YE9A 2ELHA 2FMYA 3HUGB 2RKHA 2PFBA 3S17J 2O61A 1D3YA 2H6CA 5E1ZB 2H27A 3HRUA 4DBQA 1U8BA 2CW7A 5CKTA 2LREA 3CLOA 3KFWX 3RQ4A 2M87A 2KMUA 2CG4A 3L2UA 2HDCA 3ZMTA 2QSGX 3TP3A 1OYIA 1EV7A 3ERMA 3ZCOA 2K4BA 1UFMA 2Q2EB 4XN0A 2FEZA 4LLGF 3CCSI 4E7SA 3DEEA 1AU7A 5GTHC 3S2WA 5KHDA 3S1NJ 2CQNA 2VPLA 1IRXA 1FIPA 3LSGA 1YRNA 1KU2A 3TQNA 2F4MB 1O3SA 5H6RA 5JLWA 2H8WA 3A01B 2L2OA 4MLOA 2MC3A 2K40A 3DU6A 2KKOA 3FK7A 3M7GA 3FBNB 3FXQA 1MBEA 4ENNA 2PMZN 2BE5F 3HHGA 3DU5A 4HAMA 3JRHA 4ZTFA 1H9TA 4BNCA 2OBPA 2DQRA 2JRMA 2WY8Q 3OS2A 4BAYA 2X85A 4HYEA 2HYJA 3MVPA 1LKXA 2Y48A 4HDVA 1MH3A 1W36C 4AIHA 3RZOJ 3CMAI 1FOWA 4I0BA 3RZDJ 2VLAA 1BN5A 1ZQ3P 2MW8A 4BEHA 1UHMA 2E36A 3KEYA 4EM0B 4XRMA 4BS9A 3ZP5A 3JCUC 2JUGA 3DQVC 2F6CA 3L9FA 4A69C 2EJRA 2JN6A 2YUSA 4B09A 3BR1A 2XROA 3M8FA 3CCQI 2JZYA 4RS8A 3S3MA 4C2TA 4RGRA 5ILUA 2EA2A 1SFKA 1V5FA 1BW5A 3LAJA 4RAYA 1HSJA 2YS9A 2LY2A 4KICA 1Z77A 3E97A 4CZZA 3GTQJ 3PFIA 2E5NA 4BDYA 4X6AJ 2P7VB 2QSFX 3BR3A 2AQFA 1OCCH 4NBQA 1SD7A 5D4SA 2O7OA 4PJNA 2CV2A 5IOZA 2XV4S 4I01A 1JKOC 2VKVA 3Q0UA 1BR2A 1W5SA 3Q9VA 2L7KA 1IUYA 4D5FA 5HS7A 1JE8A 1Z21A 4A12A 2MG4A 1ENHA 2JVHA 1S6LA 1HW2A 1LVAA 3FWEA 3HRTA 3L2WA 1VQOI 2IS6A 3CCUI 4RGUA 4ESFA 2L7ZA 2XGXA 4ZYHA 2OU2A 1ZGAA 1IXSB 2TRTA 2XAJA 4LD5A 3WTXC 5L3GA 5DUIA 1U9OA 2M0CA 3U1DA 1UG2A 1FWZA 2WBMA 4IQJA 3M3YJ 2JWTA 3G2BA 5A2QK 2NAZA 3K4KA 1YIJI 3BTJA 3OYIA 2XPWA 5JVGF 3EUHC 3IKVA 5FB2A 2ZCWA 3ASNH 3H35A 2VB6A 3H9QA 3DXJF 4U7BA 3CCVI 3SDGA 1R22A 3NWSA 1WJBA 3ULQB 3AL0B 3LFUA 2VBYA 3HRMA 4MHGA 3H5NA 3OL3A 2EIKH 2Z5UA 3DCFA 3E1SA 2E2IJ 2CO5A 1NG6A 3BG6A 4UVBA 4U0VA 4XOTA 2FF4A 2K3PA 5E79C 1W5TA 1MIJA 2EFWA 1S7EA 4Y13A 1YIOA 1GLNA 2XF7A 3BTIA 4OIQF 1IV8A 4LOCA 3SZPA 3WODF 3KE2A 2R7RA 3BDDA 1FSHA 3I55I 1YW7A 1R00A 4DOZA 4BE2A 4WXCA 3HGYA 5F1JA 1XSXA 3A03A 4NHJA 1IJWC 4ZH4F 4KNYA 4BJ6C 1QBJA 1T33A 1R23A 2DA3A 4IF4A 2Y75A 3KYLA 2FOWA 2R7QA 3KX2A 5EGOB 2BVLA 1O3TA 3GTKJ 2QSHX 2E1OA 2DLLA 2EFQA 2Z99A 3PNYA 1Z7LA 2LD5A 1E3OC 3EYIA 2HNHA 3FDYA 2A5WA 1OPCA 4W1UA 1KZHA 2CUJA 2R3SA 1A31A 2FQ4A 3OR2C 1MSEC 4H4KC 1IV6A 1B1BA 3CCYA 4NDLA 1IGNA 1QHHD 2FU4A 3GF2A 4HV6A 2JQ7A 5F6FA 4L9JA 1BOAA 1ONVA 1SD5A 4ENMA 3RPUA 2DMNA 4ZYAA 3VOEA 4IRHA 2COMA 1P9QC 5FKMA 2COBA 3LA2A 1J9IA 3KLOA 3HPHA 4BHBA 4M9XA 1HXDA 3WU0A 2ZJRF 1MBFA 1HBXG 2PX9A 3FM5A 1RZ4A 2FD5A 2IP2A 5ILVA 2HOEA 1FT9A 1W36D 2QVOA 1WCMJ 3PNVA 4E7KA 1V54H 3HSRA 1Y39A 5EG0A 3H3ZA 4XQFA 3S2DJ 1I1GA 3D0SA 2QA4I 2HQRA 3ELKA 4HW0A 1YG2A 1XX5A 4BEHB 3V8LA 4M3BA 4BKXA 1TNTA 2EZKA 2MH9A 1OYYA 4ITVA 1I5ZA 4ZYGA 2D1VA 3HKZA 5FROA 3FXLA 1EH8A 1PUEE 2ZJ2A 1PDNC 4FCYA 1XGOA 1STZA 3GW2A 1LNWA 3W2VA 4C2MJ 2GWRA 5EYRA 3FBIB 5B66C 3GTLJ 1SMTA 1WJFA 4XIDA 2QYOA 1R1UA 3H92A 3AFHA 4M6YA 2HYGD 3FMQA 1TT5B 1HDPA 4B47A 4MQVA 4EJVA 1U3EM 2HPMA 4MEXF 2C6YA 4XICA 3MAJA 3CJNA 3KYDB 2KFDA 3E7LA 2HFHA 2UUZA 4BJ5C 2MSYA 1IRZA 4Y52J 2LF8A 5CQGA 1HCRA 2NVTJ 5IY5H 2OUMA 2DA6A 1GUUA 1LUJB 3PO2J 5EF6A 1EH7A 2GXBA 2Z1DA 5DCMA 1O7FA 1SMYF 1I6HJ 4M74A 2JRTA 2EIMH 1QNTA 2P5VA 4DW6A 4N4OB 3IH4A 3J81Z 3ZN0A 4KIFA 2ELJA 1ZYRF 1LDJA 2ZJPF 5A2QZ 4O6JA 2A05A 3K0LA 1RUOA 2MABA 2DXIA 2VQGA 3GCMA 2ZSHB 3A2KA 4KN4X 1UMQA 4GYGA 3HZJA 1X1BA 1HA8A 1ZARA 2XIGA 4LB6B 2HVRA 2R7OA 1WRJA 3BWGA 3SJMA 2CU7A 2RNJA 2ZSIB 3PUBA 3PUFA 2VPRA 2VT3A 3P5JA 3L2VA 3GO5A 3DPLC 3GFJA 2ZJQF 1MMDA 4ETSA 5HLTA 2QUFA 2DCEA 1AOYA 5E3OA 3L2CA 2LNBA 3ZXSA 1JI8A 5TJJA 1TNSA 2QQ9A 1XDSA 1X3WB 1T0FA 1R1TA 2LKSA 2E1NA 1JKQC 2YR2A 1WKMA 1ODDA 5L3BA 1K6YA 2G7HA 3WE3A 1RETA 4GXOA 3F9KA 3R60A 3WHBA 5J6XA 4CGZA 3S1QJ 2PMHA 5D5XB 2F4OB 2GA2A 3IWZA 2OV7A 3LSKA 3KPHA 2P6SA 3OMYA 2ZXIA 1TWCJ 4Z6YA 4WK8F 2XSJC 3BG5A 3Q9SA 1VQ4I 2DFEA 4ESJA 4P1WA 2R5ZA 1ZELA 5L3FA 4FE4A 1EJ9A 1BR1A 2NNNA 5HOOA 3TOAA 3ZMDA 1WWXA 4DZJA 4BHCA 2L0KA 4XSZF 2LRDA 1TP4A 3OYBA 5BS6A 2DMUA 1G59A 2R5YA 2FNPA 2LG4A 3FIWA 1KQ0A 1X2NA 4EQQA 4E7LA 2UZKA 4M6VA 1NK3P 5J4VA 5B1BH 3QP6A 1MMGA 3F8NA 3CTAA 3FKJA 3TOBA 3H3UA 2XDVA 3S8PA 2H09A 5DS9A 2NNYA 1PJRA 2HOTA 2L4MA 4P9UA 1TWAJ 2JTVA 3I9V2 2ZMEB 2PEXA 2WAFA 2A5YB 4OU0A 5IP7J 1FBUA 1DQUA 4K2EA 5CPRB 4CXFA 1PUFA 1QPMA 3JW4A 2A68F 4ENJA 1N25A 3HL2A 4OINF 1B6AA 4ON0A 4PFPA 3FXOA 3ZQHA 2J5OA 4EJOA 2HQ5A 5E1XA 3ZOBA 2P4WA 3S2HJ 1X1CA 3WTWC 1MMAA 2PBIA 3R0AA 1PYVA 2DT7B 4B3AA 2XKOA 2IGMA 1OR7A 4NC6A 2KHMA 2CFXA 2ZXHA 3ZQIA 2QZ8A 1WPKA 2GM4A 3CDIA 4A6DA 2ME6A 3TO7A 2L02A 3GTJJ 2VQHA 3R61A 3P7NA 3QQAA 4KIGA 1RR7A 3I4PA 3QPSA 2W82A 4KITB 4JQFA 2IJLA 2OCCH 4Q47A 3QRFF 2IBDA 1SEUA 1MJBA 5FRMA 4A6EA 2V1NA 3L00A 4KIBA 3HOTA 5J4YA 2K9MA 1ZLKA 1LB2A 4MTDA 3MKWB 1C0WA 3BG3A 4EATA 3I5UA 4A5NA 2O3FA 1WJCA 5F08A 2XPVA 3WGIA 2M0MA 5GPCA 1H8AC 1XC5A 3CUQA 3E5UA 4LG0A 1U8RA 3ZMSA 4U7DA 1Z3XA 2O9LA 2OQRA 4AM3A 2ECBA 1K6OA 4RGXA 1VI0A 1Z9CA 2WA0A 5J8CA 1YS6A 5EDNA 2LMDA 2PJPA 2HPIA 1RKWA 3REOA 2KIFA 1QPIA 2VKEA 3HOXJ 5HDGA 4A3BJ 4XOPA 4V2FA 5DDGA 2JA8J 3KZIC
chains in the Genus database with same CATH topology
3PSFA 4CA0A 2W7NA 4CUGA 4F92B 4DJAA 3ZCOA 2Q2EB 2X1CA 4XN0A 2X51A 3OYNA 3VYUB 3D5SC 4E7SA 3DEEA 3OY9A 2K5CA 3DTIA 4BL0B 4XLCA 3HPGA 3EUKL 3PJRA 5KHDA 4QPOA 4F55A 2VPLA 1IRXA 3LSGA 2IS2A 4BQNA 4RM3A 4II2A 4E7IA 2R7TA 4OWRB 2V7FA 2BVMA 4PJLA 2L2OA 2V4JC 4MLOA 4BE1A 4ZC3A 4R79A 3DU6A 4AU7A 2UV1A 3FBNB 3ZQQA 2DJIA 1YX3A 3K4JA 4ZTFA 3DU5A 2VL8A 3H9GA 3OS2A 2WY8Q 3IAS2 2L5QA 2X85A 4CCOA 3OS0A 3VWBA 4E7ZA 1LKXA 4XKVA 4BU2A 1TZLA 1LDKB 2M3AA 3L2QA 3K4LA 4HNUA 1W36C 2KDOA 1Z3YA 1BR4A 2VLAA 4BEHA 3KEYA 3CJQB 4ZDLA 3SEQA 4BS9A 2E1MC 1MNEA 4FASD 3K4NA 2JUGA 3DQVC 2ZFUA 3OYAA 2F6CA 4NNJA 4PSXA 1DGWY 2GOXB 3VSKA 4F93B 2WB1A 4XMYA 3CP8A 4PSWA 4CZCA 3S3MA 3LSHA 4C2TA 2KLOA 1QHGA 1N77A 1SFKA 3RSNA 1V5FA 2V9KA 4B43A 3IP4B 1LVKA 3K6GA 4II3A 2PJRB 2LY2A 3TL4X 1QU3A 1FMWA 2E5NA 3OR1C 4BDYA 3QYBA 3OYLA 2AQFA 2WY7Q 3DTEA 4PJNA 2CV2A 2O5RA 2XF6A 4X0GA 4LITA 4F91B 2RREA 1BR2A 2CFOA 2L7KA 3DPUA 2IGOA 2RNGA 4CCKA 3I3LA 1Z21A 3D5LA 2JVHA 2VJ4A 4E7JA 3L2WA 3K4CA 4XKWA 2IS6A 2MFZA 3OYGA 3ZGKA 2A6TA 3BC8A 1FMVA 2VQCA 4IZZA 1TT0A 5KNLA 2WBMA 2M7AA 4IQJA 1X1AA 3OS1A 3G2BA 3OWTA 4DBRA 3K4KA 3OYIA 3CJRB 4OAYA 4YEJA 3EUHC 3QYEA 3H35A 2VB6A 2DT6A 3H9QA 3PNTA 4D9JA 4U7BA 3NWSA 1D1CA 2X1DA 1WJBA 3AL0B 3LFUA 4IQ4A 3H5NA 2XAUA 1N78A 3OL3A 3LL7A 2KRCA 3E1SA 2VIXA 2UWMA 1NG6A 4CCJA 4XLHA 3BG6A 4XOTA 2K3PA 3DTKA 3QOEA 1D0ZA 3MMYB 2CW8A 1GLNA 3AKZA 2XF7A 2CMPA 3V42A 2F5VA 5JHFA 4YRVA 2QKMB 4BQOA 2R7RA 1YX5A 4KISA 1VZ0A 4DOZA 5HNHA 4BE2A 2PJRA 4NC8A 2VASA 3W3CA 4BJ6C 3W2WA 4Y4RA 3H0DA 3KYLA 3CMMA 4RMNA 2R7QA 3KX2A 2BVLA 4B44A 2XF5A 1D1AA 3PNYA 4XR6A 1Z7LA 2HNHA 3FDYA 2E60A 4CCNA 2A5WA 2CUJA 2BW3A 3NWTA 4E6KG 4U87A 4BGDA 3GBGA 3SYTA 3OIQA 3OR2C 3QYFA 4H4KC 1Y6IA 3OYFA 1LFPA 1J09A 1QHHD 2VKDA 4XLEA 2KP6A 3A1YA 2VXZA 4ZTJA 5HVQC 4ZYAA 1P9QC 2MD0A 5FRNA 1S9HA 2M7BA 5HNFA 3HPHA 3K70C 2M4GA 4HG2A 2E1MB 2JA2A 4C30A 3ZR8X 2CS3A 4CCLA 2KL4A 3DKXA 4N4NB 1W36D 2Q1ZB 1R6RA 3A4CA 4HEA2 1WJDA 3PNVA 4RLFA 4E7KA 4RM2A 2NOJB 2LBFB 4F3QA 2Z16A 4BACA 4XQFA 3CESA 2L9SA 2K9LA 3BCBA 3FHNA 3HG9A 2VKHA 3DKYA 4CCMA 4BEHB 1E0EA 3H5RA 2HVSA 2V26A 2R7UA 1T0FC 2VJ5A 4ITVA 1DGRM 3HKZA 2HZDA 2X6XA 5FROA 4BDZA 4LIVA 2HQAA 2BOLA 4XORA 3LMMA 5LD2C 4BE0A 3W2VA 2KPMA 1T95A 4PJJA 3VSLA 3FBIB 4NC7A 4GRIA 4LIUA 1WJFA 2W4SA 3DLAA 3AFHA 2QKLB 2KRHA 3LSMA 2Z2SB 3C2HA 4BXFA 3MKYB 3K70D 4B47A 4ZJZA 2CUZA 2HPMA 2LH9A 4Y3OA 1Y56A 2OC6A 1D0YA 4YELA 4AYBA 4IX7A 4ANJA 2W00A 3SDBA 1OR7C 1UELB 2UUZA 4BJ5C 1N75A 2IGKA 2CH0A 5CQGA 3DPTA 2OUMA 1AA7A 4J00A 4PK4A 4NQWB 3VYSB 1WJEA 3LSIA 2Z1DA 3H9JA 1V5EA 1EA3A 2JSPA 2LY1A 2PMZA 3OYCA 3CP2A 1BOBA 2I8DA 4XONA 3PL8A 3W2AA 3K4BA 4KJZA 4N4OB 2ELJA 1MNDA 1UG0A 2R4GA 2WAEA 1WJ5A 2MABA 2VQGA 2DXIA 2ZSHB 2V6EA 3BCAA 3OL4A 4DIQA 3A2KA 3DWLE 1UAAA 3S3NA 1X1BA 1HA8A 3HC7A 2HU9A 3M1CA 2HVRA 3HXLA 2R7OA 2ZSIB 3PUBA 2MC4A 1WJAA 4PJMA 3L2VA 3DPLC 3S3OA 2LOOA 2LYCA 2XC7A 4B3XA 3ONQA 1MMDA 5HLTA 1MMNA 3M8JA 2DCEA 1MW7A 3ZXSA 4XKCA 1JI8A 2P0WA 4HSRA 4BQQA 3CZ6A 3OYJA 2X1EA 3MD2A 4BJTA 2HVQA 2R7VA 1K6YA 2DOAA 1V5GA 2Y0SA 3F9KA 2HDWA 2FUG2 2BW3B 2LC2A 2OV7A 2VJIA 3LSKA 1D1BA 1G8XA 2MYSA 3OMYA 4F52A 2ZXIA 4C2UA 3EUAA 2W1OA 2WADA 2X6YA 2XSJC 4XN3A 4E7HA 4P1WA 3TMOA 2CV1A 3C2GA 1ZELA 2LBFA 4D1QA 2GOMA 4PFOA 2IGNA 1BR1A 5HOOA 1NG7A 2RQQA 4RLQA 3OIPA 2IS1A 2LRDA 3E0JB 3OYBA 4C9YA 1G59A 4PUSA 2LG4A 4IKFA 4XL9A 3S32A 4E7LA 5CQEA 2KQRA 3OYHA 4NUBA 3HOSA 1MMGA 3FKJA 3SZGA 3IUOA 1X19A 4CH7A 4P5OA 2VJJA 2XDVA 3S8PA 3K10A 3VYTB 1PJRA 4AVZA 4B48A 2WAQA 2AQEA 2JVGA 2M4KA 3BLYA 3S93A 4HSTA 1WFXA 4FETA 3I9V2 3K4MA 4Y33A 2WAFA 3D5RC 4LG3A 1DP3A 1DQUA 2IS4A 5CPRB 4KT6A 2VQLA 3OYEA 3HL2A 4ZDOA 2IXSA 4PFPA 3PFYA 4XNFA 2VXDA 4HPQA 3RTRA 1X1CA 1MMAA 1PYVA 2DT7B 4DGWB 3ZRGA 2IGMA 4XKBA 2R7XA 4J01A 3TBIA 2KHMA 2R7WA 2X6WA 2ZXHA 3CF2A 3UR3C 1D0XA 2VQHA 3OYDA 4XLAA 4CSWA 3L2RA 1U0JA 2W82A 4KITB 4JQFA 3PSIA 4HRIA 3VYRB 4ZDPA 1X1DA 4XLFA 3UNGC 1X4OA 5FRMA 1SAUA 3H5AA 2V1NA 3HOTA 1ERDA 2R7SA 3MKZA 3QODA 3VDXA 5KCMA 2E5ZA 2K9MA 3U21A 4HNTA 4XM3A 3N05A 3MKWB 3RCOA 2F4IA 4EATA 1X4PA 3SEZA 3OOUA 1WJCA 2CV0A 3OYKA 2M0MA 4G6TB 4BUPA 5TGTA 4OAZA 3IAM2 1Z3XA 1OLTA 3BG7A 4JOMA 1YE9A 1KONA 4E4HA 2WA0A 3AL0C 3HUGB 2KZVA 3RPUD 2HPIA 3J7AY 2L9NA 4XOPA 4DBQA 3OYMA 2CW7A 5CKTA 2LREA 3RQ4A 3L2UA 4QPQA 2KMUA 5LFAA 3EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP3 A;  3OMY A;  4QPO A;  4QPQ A; 
#chains in the Genus database with same CATH topology
 5D5W B;  2ZME A;  2EFP A;  2VOD A;  2P5L C;  3ISP A;  2W7N A;  1HF0 A;  4CUG A;  4DJA A;  5FKK A;  2X1C A;  2ZO4 A;  2DU9 A;  1PUF B;  2X51 A;  4CDG A;  1D5V A;  3VYU B;  1ETY A;  2IEK A;  4G94 A;  4RB3 C;  3OY9 A;  1H89 C;  2K5C A;  2RV8 A;  4S05 A;  4XLC A;  3I0T A;  1JGG A;  2XB0 X;  3EUK L;  2X0L A;  5FKL A;  4EM2 A;  2ZBK A;  4KN7 X;  2GA1 A;  1NH3 A;  4XSX F;  2ZME C;  1MGT A;  5F0F A;  2X4H A;  2IS2 A;  3O3K A;  4Q5S F;  1Z0X A;  5ICE A;  3T1B A;  4II2 A;  4E7I A;  2R7T A;  1FBQ A;  2V7F A;  3KZZ A;  4PJL A;  5FLM J;  2LTP A;  1SVL A;  4ZC3 A;  1DDN A;  1K4T A;  3HOV J;  4AU7 A;  3GFL A;  1FOK A;  1ZRE A;  3ZQQ A;  5FGM A;  3K4J A;  4JBA A;  3IRR A;  5FKN A;  3G1L A;  4E7Z A;  1LDD A;  3GWZ A;  2VE8 A;  3K9T A;  3BG9 A;  4BU2 A;  1MKM A;  1LDK B;  2L01 A;  2M3A A;  2QWW A;  2Z33 A;  3K4L A;  3T5X A;  5HDK A;  2CJJ A;  4HNU A;  5K7H A;  1G4D A;  3QU6 A;  1BR4 A;  3NEU A;  1MBJ A;  4IL6 C;  1Y0U A;  5FJ8 J;  2R5Z B;  4ZDL A;  3CJQ B;  3WGH A;  1MNE A;  3K1M A;  4FAS D;  4M72 A;  1BIA A;  2OA4 A;  3FXK A;  2VC0 A;  3OOP A;  4P9F A;  4NNJ A;  2M1B A;  3FK6 A;  1DGW Y;  3MKL A;  4HF1 A;  2GOX B;  2F5F A;  3VSK A;  3E3V A;  4M3E A;  4F93 B;  1QO0 D;  3JTG A;  3G71 I;  1GVJ A;  3HOY J;  2DTR A;  3F6V A;  1EH6 A;  2UXN A;  4L5I A;  4UUV A;  3IP4 B;  3HKZ N;  3K6G A;  3FMS A;  4II3 A;  2PJR B;  3ZQC A;  1WI9 A;  2P8T A;  4IO9 F;  3EYY A;  4D7M A;  2CYY A;  1QU3 A;  5IT9 K;  5FO5 A;  5LHI A;  4JX6 A;  3QYB A;  3OYL A;  3E6B A;  9ANT A;  3DTE A;  3E6D A;  1MH4 A;  2ACJ A;  1J75 A;  2XGD A;  1FJL A;  5LEJ A;  2E35 A;  2QEN A;  3P9K A;  3BRO A;  4F91 B;  2CFO A;  1B8I A;  2BXY A;  3DPU A;  2IGO A;  2L9V A;  2RNG A;  4CCK A;  2DN0 A;  2M34 A;  4HOB A;  3EET A;  1GXQ A;  2VJ4 A;  2CSO A;  1E3P A;  3MZH A;  2RN7 A;  2MFZ A;  3SFI A;  2P81 A;  3ZGK A;  5EEG A;  3JRG A;  5BMZ A;  1T8I A;  2R0Q C;  3CD6 I;  1HDD C;  2F5E A;  4QWQ A;  4U0W A;  3BC8 A;  4IHT A;  2HOS A;  4PZJ A;  4A0Y A;  1O7L A;  3C18 A;  3LA3 A;  1WI3 A;  3RKY A;  1TT0 A;  5KNL A;  1YI2 I;  5FD6 A;  2FBK A;  2W84 A;  4I7H A;  5E3N A;  4WF2 A;  2OTL I;  2XAS A;  2VUM J;  1IG7 A;  1USS A;  4OAY A;  1ZAO A;  3ECH A;  5HS8 A;  2V1X A;  1PVE A;  1OYW A;  2BYV E;  4WXD A;  3PNT A;  4D9J A;  5HLG A;  3DEW A;  1O4X A;  2DJN A;  4G7Z F;  4I02 A;  1D1C A;  2D1H A;  1BC7 C;  3HUG A;  2FE3 A;  3CCR I;  1GDT A;  2XAU A;  2BHY A;  1SD6 A;  2M8G X;  2QQ8 A;  1A04 A;  1U5T C;  1I27 A;  2VIX A;  2UWM A;  2HYF A;  3PIO F;  2EQR A;  4C3I J;  3VB2 A;  2HZT A;  2O03 A;  1D0Z A;  4UNO A;  3RDI A;  4UUT A;  1FX7 A;  3AG2 H;  3MMY B;  1Z6T A;  4LG0 B;  2CW8 A;  2I5U A;  3HRS A;  4CO8 A;  3F6O A;  2CMP A;  2NVX J;  1VND A;  2ME0 A;  2Y31 A;  3RI4 A;  5LEK A;  1IN5 A;  1YX5 A;  2Q0O A;  1K4S A;  2QQA A;  2PJR A;  2QF7 A;  5D6E A;  3I4M J;  4NC8 A;  1TWF J;  2VON A;  5C4X J;  2G0E A;  3W2W A;  5F27 A;  1BL0 A;  4Y4R A;  4H0E A;  1A36 A;  2FOK A;  1XSV A;  3T0Y A;  4RMN A;  3F8M A;  4B44 A;  1IRG A;  2XF5 A;  4LK0 F;  1J59 A;  1AKH B;  1GV5 A;  4XR6 A;  1YIT I;  2ZXW H;  1OIS A;  2VOO A;  4A3E J;  3KCC A;  3BR0 A;  3NWT A;  4MNU A;  3V7S A;  4U87 A;  4RB2 C;  3GBG A;  4UUS B;  3SYT A;  3IKT A;  1LFP A;  2J5P A;  3P9I A;  2G9W A;  2JPC A;  4XLE A;  1YRN B;  1IC8 A;  1MD0 A;  2EWN A;  3I59 B;  4L0Z B;  1D8K A;  2BEO A;  1RUN A;  3CQZ J;  1S8N A;  2M7B A;  5E8I A;  2W85 A;  1K79 A;  1SFE A;  2IA1 A;  2KIQ A;  2WC2 A;  5M5Y J;  5IYC J;  1IN6 A;  2KJB A;  4QSH A;  5K7Z A;  4XK4 A;  4C30 A;  4D7N A;  1IDZ A;  3J7Z I;  4CCL A;  1UB9 A;  5CVI A;  3R0J A;  3DKX A;  2G7U A;  1P4X A;  1MBH A;  3C2B A;  1RR8 C;  3A4C A;  4RLF A;  1X3Z B;  2M45 A;  4RM2 A;  4F3Q A;  2Z16 A;  4BAC A;  3VOD A;  3MZ8 A;  2K9L A;  3K2A A;  4V19 K;  2GIZ A;  2VKH A;  1TTY A;  1QVT A;  1ULY A;  1XTA A;  3T8R A;  2ID3 A;  2F5C A;  2YPR A;  4PCQ A;  4GFB A;  3H5R A;  2W57 A;  2E19 A;  2R7U A;  2VJ5 A;  2X6X A;  2L54 A;  2HGC A;  2M5W A;  4G8X A;  5E3M A;  2RGV A;  1G6N A;  2HQA A;  1G3T A;  4YFX F;  2BOL A;  4B1R A;  4FT8 A;  4XOR A;  1B72 B;  3DLL F;  3ZMV A;  2AXT C;  3J81 K;  4BE0 A;  1TWH J;  4DNC A;  5HDN A;  4PJJ A;  1WGX A;  4NC7 A;  3DLA A;  4L18 B;  5F1R A;  3ABT A;  2R7D A;  1Z91 A;  2QKL B;  3LSM A;  4BXF A;  2Z2S B;  4EJU A;  3MKY B;  2IT0 A;  3JRE A;  4ZJZ A;  2FXA A;  1U5T B;  3J80 Z;  1DPR A;  1ZHF A;  1D0Y A;  4YEL A;  4AYB A;  3E5Q A;  2JPB A;  1W7P B;  3SDB A;  4HX4 A;  1OR7 C;  1UEL B;  1BI2 A;  1N75 A;  1QVU A;  3HSF A;  1JUS A;  2CH0 A;  2VBX A;  1ZKG A;  2OD5 A;  4G6D A;  1R5H A;  3DPT A;  1F5T A;  4KA4 A;  3VYS B;  1T6S A;  5K5R A;  1B9N A;  3BZ6 A;  2JSP A;  1EA3 A;  2LY1 A;  1WHU A;  4G9Y A;  2H6B A;  4A3I J;  1BOB A;  4FTH A;  5DEQ A;  3LA7 A;  2DPU A;  1FC3 A;  3BR5 A;  1XCV A;  2LSO A;  1F43 A;  1UG0 A;  3DEU A;  1R49 A;  3Q5F A;  1G3Y A;  1WJ5 A;  2V6E A;  4DIQ A;  4LLL A;  3DWL E;  2LF7 A;  4EVI A;  2JA5 J;  2O8K A;  1JUM A;  3MQ0 A;  1VQM I;  1OFC X;  3FXM A;  1WJA A;  4PJM A;  1VQL I;  2RC4 A;  3SFZ A;  2CW0 F;  4A3M J;  4KDP A;  3S3O A;  4BXX J;  2LYC A;  1IZ1 A;  1SVM A;  1U2W A;  2Y69 H;  4B3X A;  3ONQ A;  2XC7 A;  2E1C A;  5KVR A;  3LSJ A;  1ZGW A;  4BQQ A;  3O2P E;  1YFH A;  1OCT C;  2DMT A;  3NRV A;  2X1E A;  4ABZ A;  1XPX A;  4IOC F;  4BJT A;  3WG7 H;  1LE8 A;  2OZ6 A;  1I3Q J;  1IF1 A;  1NHA A;  4JYK A;  1YS7 A;  2BXZ A;  2LC2 A;  1QZY A;  2DOE A;  3GUD A;  2DDB A;  1D1B A;  4KUM A;  4B4C A;  1XMA A;  1JTX A;  3EUA A;  2W1O A;  2X6Y A;  4XN3 A;  1Z6R A;  2ISY A;  1NTC A;  4G7O F;  1LJ9 A;  1TQI A;  1YLF A;  4BXU A;  2LBF A;  2V1D A;  1AKH A;  3H36 A;  4IHX A;  4BY1 J;  3HOU J;  3HTS B;  2W25 A;  1YQA A;  2NYX A;  2RQQ A;  3J7Y J;  4G6Q A;  2A07 F;  2IS1 A;  4P96 A;  4BQA A;  3HBL A;  1Y0N A;  2KT0 A;  2GBY A;  1LEB A;  2A61 A;  5EJC A;  5F04 A;  3IL2 A;  2DFF A;  5DYM A;  4XL9 A;  3A01 A;  2PQ8 A;  2AXL A;  5D5V B;  1B8I B;  1Z67 A;  1BA5 A;  1FP2 A;  5CQE A;  2KQR A;  3OYH A;  3S15 J;  1ZRF A;  3HOS A;  1UJ8 A;  1RES A;  1SFU A;  1YYV A;  2K9S A;  3RKX A;  1E2X A;  3VYT B;  4PGG A;  2FML A;  3ERE D;  2V1U A;  1G3W A;  5JHU A;  1ON2 A;  2XAQ A;  2IA0 A;  2WAQ A;  2Q8K A;  4B48 A;  1XS9 A;  2AQE A;  1IRF A;  4D5C A;  5ERI A;  1DU0 A;  4Y33 A;  1SAX A;  2JA7 J;  4N9H A;  5FD5 A;  4A2U A;  5ILS A;  3ABU A;  2NS0 A;  1K83 J;  1ZRC A;  3DF8 A;  5IYB J;  2M30 A;  2PLY A;  1TC3 C;  2P5K A;  3JRA A;  2E71 A;  5J40 A;  2R7F A;  5FFZ A;  4M9Z A;  4R8H A;  2K9Q A;  3QP5 A;  1JJ8 C;  5J1Y A;  1KGS A;  4HPQ A;  4XRS A;  3ZRG A;  4XKB A;  2BV6 A;  4AWX B;  2XGE A;  4UV8 A;  4J01 A;  2R7X A;  3LQR A;  4A3K J;  3I53 A;  3KP6 A;  5GP9 A;  2KZG A;  3CF2 A;  1OCP A;  1D0X A;  2HWV A;  1X58 A;  1ETV A;  1WVR A;  3TDZ C;  4WCG A;  3L2R A;  3F21 A;  1CF7 A;  1GXP A;  4HRI A;  1SAN A;  4BBS J;  2F2E A;  1X1D A;  4XLF A;  1KA8 A;  1X4O A;  1BW6 A;  1SAU A;  3B6C A;  5CVR A;  1YW9 A;  5DCM B;  5BPD A;  1R71 A;  3QOD A;  5AIP A;  3DKW A;  3BPX A;  4UVC A;  4RAF A;  4L9V A;  4EMS A;  1KU7 A;  3BTL A;  2B7E A;  3SEZ A;  4YFN F;  1X1P A;  3FXR A;  2XAH A;  3JSP A;  2MLG A;  2RAE A;  1R4N B;  4G6T B;  1FYL A;  2V9V A;  3DBL B;  2JSC A;  1OLT A;  3BG7 A;  2FSW A;  1A6I A;  3BY6 A;  4E4H A;  1K78 B;  3AL0 C;  3JRF A;  5BPI A;  1RRJ A;  2KZV A;  3F23 A;  1BI0 A;  3RPU D;  1S5L C;  4ZYE A;  2BZT A;  1TLH B;  2JA6 J;  2L9N A;  3OYM A;  3RJP A;  1TW2 A;  5JLX A;  5FFX A;  2KJC A;  5F0H A;  3S1M J;  3LFK A;  3EPZ A;  2DK5 A;  4CA0 A;  4XLP F;  1JT6 A;  3HSE A;  1ZG5 A;  3RKQ A;  1UCR A;  2DQL A;  1VQ6 I;  3H1C A;  3MFK A;  2R93 J;  2VOP A;  3D5S C;  1YOV B;  2GLO A;  1SFO J;  3ROU A;  1ZTR A;  2ZC2 A;  2XHK A;  3HPG A;  3KZY A;  4HDU A;  3PJR A;  4A3J J;  1ZR4 A;  4GDF A;  3LWF A;  2ESH A;  3ESW B;  2IVM A;  4F55 A;  3S14 J;  5M5W J;  2ZFW A;  4IPA A;  4MFE A;  3CUO A;  2HTJ A;  4G12 A;  2HDD A;  3IRQ A;  4IHV A;  2BVM A;  4R1H A;  4IVN A;  3BT9 A;  1HKQ A;  4UB8 C;  1B4A A;  2DDA A;  2HI3 A;  3F3X A;  2VBZ A;  3L7W A;  2H1L A;  1JGS A;  3M4O J;  1Y8Q B;  5GPA A;  4UVA A;  2H1K A;  2DOD A;  2VL8 A;  3H9G A;  2DI3 A;  2RVC A;  3CUQ C;  3CLQ A;  4CCO A;  3OS0 A;  1T38 A;  3VWB A;  3RYP A;  4XKV A;  1TZL A;  5EGO A;  4HLY A;  2KDO A;  1WH5 A;  1G3S A;  1Z3Y A;  3HB9 A;  4HF0 A;  5E1W A;  4U0Y A;  4AYB N;  3NQO A;  4AUX A;  4WWC A;  1FZP B;  2NRA C;  5IOY A;  4NB5 A;  4MFD A;  3SEQ A;  4PJ0 C;  3FZV A;  2CQX A;  4ZZL A;  5CVJ A;  4F7Z A;  1X2M A;  2LFB A;  5EZH A;  1R5G A;  4PSX A;  3ZMZ A;  2ISZ A;  1ETO A;  5TRD A;  3C7J A;  4A0X A;  4EGZ A;  3CP8 A;  4PSW A;  1PP7 U;  3LSH A;  3G1M A;  4JX4 A;  1FIA A;  3RSN A;  4M3D A;  1LVK A;  3MEX A;  3HDD A;  3TL4 X;  5DD4 A;  2LDU A;  2WWY A;  1ZK8 A;  4M3F A;  3JRI A;  2CUE A;  2Y9Y A;  3J7A O;  2XF6 A;  1WQ2 A;  3NAU A;  4XRS G;  4M3G A;  2IW5 A;  2RRE A;  2MGQ A;  5DTD A;  3CC7 I;  1VF9 A;  5DM6 F;  1TL8 A;  3I58 A;  4NQW A;  3IV5 A;  3RIR A;  1APL C;  2R7Z J;  1T39 A;  3V8K A;  4WXH A;  5B5E C;  2EZH A;  3OYG A;  1OCO H;  5HS9 A;  4FIS A;  5H2F C;  2A6T A;  5DM7 F;  1IN7 A;  2JMW A;  3PQJ A;  4ASN A;  1XMX A;  2MA3 A;  4I76 A;  2VQC A;  3B02 A;  2A6H F;  2M7A A;  1X1A A;  3OS1 A;  5C3E J;  3L1P A;  5GTI C;  1GT0 C;  2EIJ H;  2W24 A;  3OWT A;  4DBR A;  5E18 F;  3CJR B;  5HLI A;  1O3R A;  1Q1V A;  2UXX A;  3QYE A;  2VBW A;  3KP2 A;  4S0H B;  5L3E A;  2DT6 A;  4RGS A;  2K4J A;  3BOQ A;  3TW6 A;  2Z9O A;  1YJ9 I;  4M71 A;  3WU2 C;  2X1D A;  2Q2E A;  3G73 A;  4QTR A;  4DQ2 A;  1LFB A;  3U2R A;  1MBG A;  2AHQ A;  3BR2 A;  5M5X J;  4DZP A;  1YO5 C;  1DPU A;  1TQP A;  4UV9 A;  4EJW A;  4CCJ A;  4XLH A;  2GXA A;  1IW7 F;  1ETX A;  3DTK A;  3LSP A;  1HST A;  3WTT C;  2Z3Y A;  3TKY A;  5AIQ A;  1K61 A;  2ZB9 A;  2F5V A;  2HR3 A;  2ADU A;  4YRV A;  1WH7 A;  4HQE A;  2EV5 A;  1FY7 A;  2ICW G;  2EV0 A;  1Z05 A;  2X48 A;  2VAS A;  3OSF A;  1UZC A;  2IAI A;  1JTY A;  2K02 A;  5BOX A;  3WU1 B;  1UHW A;  1T56 A;  1ZH5 A;  5KAF C;  4Y17 A;  2W48 A;  2DA7 A;  4JK1 X;  1S7A A;  1D1A A;  4S04 A;  3KIO A;  3HTU A;  1W5C C;  2E60 A;  4CCN A;  3NAR A;  4YIR X;  1U9N A;  1D5Y A;  2BW3 A;  2Y2Z A;  5L3C A;  3JSO A;  5DCF A;  2YX7 A;  3KP7 A;  4E6K G;  4RB0 A;  3QYF A;  3CDL A;  4IHW A;  1DP7 P;  1J09 A;  1NK2 P;  2XB5 A;  3A1Y A;  2MBF A;  3IHU A;  5HVQ C;  2EV6 A;  5CJ9 A;  1O3Q A;  1E17 A;  2E7W A;  1J5Y A;  2MD0 A;  1FYM A;  6PAX A;  1XG1 A;  1KYW A;  5HNF A;  2LR8 A;  5DUK A;  4Q48 A;  1FSE A;  3CCM I;  1BI1 A;  1F9N A;  3AG4 H;  1ZN2 A;  2E1M B;  3ZR8 X;  3GVA A;  1KU9 A;  2BBY A;  3M07 A;  2CS3 A;  3ZQG A;  2H94 A;  4N4N B;  2DW4 A;  2L9R A;  4L9T A;  1R6R A;  4HEA 2;  2D5V A;  3ZPL A;  3FM3 A;  5BQT A;  4MQ9 F;  3BCB A;  3WGG A;  5CYV A;  1BM9 A;  5E17 F;  1MDM A;  4RAZ A;  1VQP I;  3ECO A;  2HOA A;  3F8B A;  1WSU A;  2HZD A;  1YW8 A;  2LY9 A;  4LIV A;  2D45 A;  4E70 A;  1LPQ A;  4UXN A;  3LST A;  2HS5 A;  2MH2 A;  3LMM A;  3MWM A;  2D2W A;  4BYY A;  4UB6 C;  2KPM A;  2WB1 N;  5ICF A;  1T95 A;  1KU3 A;  3I71 A;  3VSL A;  4WX9 A;  1B59 A;  4UUS A;  1I6X A;  3F72 A;  2W4S A;  3EDP A;  4LIU A;  4HBL A;  3K1N A;  5LHH A;  2KRH A;  3C2H A;  1FTZ A;  2KIU A;  1GHC A;  1P92 A;  2B9S A;  2OTJ I;  4QLC U;  2K9N A;  3JAM K;  1JHH A;  1QA6 A;  1Y56 A;  2OC6 A;  4L9N A;  4IX7 A;  3JRC A;  2B63 J;  1R1V A;  3BPV A;  1KQ8 A;  2XVC A;  1V55 H;  1V3F A;  5H20 A;  4EV0 A;  2ETH A;  3AG1 H;  1AA7 A;  3N4M A;  4J00 A;  1ETW A;  5LRR A;  2DMP A;  4NQW B;  2O6G E;  3CC4 I;  1V5E A;  3ZQL A;  3GYH X;  1DU6 A;  3CP2 A;  4OIO F;  1R4M B;  2I8D A;  4XON A;  1W0U A;  2RQP A;  4L0Y B;  1IO2 A;  5K1Y A;  3K4B A;  4RAG A;  5LGN A;  4KJZ A;  1A5J A;  2XUB A;  5J1U A;  1MND A;  2PN6 A;  1XGM A;  1ETK A;  3O8G A;  1R7J A;  2EIL H;  5JVT A;  3FXJ A;  1MJ9 A;  2XKP A;  4CYD A;  2F48 A;  1VFC A;  3DV8 A;  1X3U A;  3BCA A;  3OL4 A;  2EFO A;  2ZNY A;  3HYI A;  5EZG A;  1CGP A;  5IP6 A;  2BY3 A;  2WV0 A;  1Z1D A;  4HZF A;  2HU9 A;  3GLX A;  3HXL A;  2L3D A;  1QQI A;  4GCV A;  2NXN B;  2MC4 A;  2DA5 A;  2QBY A;  2VC1 A;  4MTE A;  2CUF A;  2LOO A;  3O6B B;  2E2J J;  3H0G J;  1FYK A;  2A6E F;  1KYZ A;  1MMN A;  2PG4 A;  1U5T A;  1MW7 A;  1W1W E;  4XKC A;  4AVP A;  2P0W A;  5BNG A;  2R5Y B;  2GIV A;  4MEY F;  2EIN H;  1Y8R B;  5LHG A;  2STW A;  1R5I D;  3D1N I;  2DMQ A;  1YHQ I;  3E6M A;  1VTN C;  3QPL A;  2DOA A;  1V5G A;  2V9P A;  1L0O C;  2Y0S A;  1S3J A;  3ZQ7 A;  2ID6 A;  4BBR J;  3PO3 J;  2HDW A;  3ABK H;  2FUG 2;  2BW3 B;  2V6C A;  3FF5 A;  4MIM A;  3GEZ A;  2V79 A;  3W6K B;  1AWC A;  4QPQ A;  1HOM A;  2R92 J;  2JK3 A;  1T2K A;  4E7H A;  2HXI A;  4DYC A;  3TMO A;  1JT0 A;  4J19 A;  3BQZ A;  3V8J A;  4PFO A;  2NS8 A;  4OMZ A;  5EEH A;  5E8G A;  1FP1 D;  1IAW A;  1B9M A;  1TW3 A;  2TDX A;  4QIW N;  3KLN A;  2DA1 A;  5C4J J;  2FRH A;  4B8X A;  3E0J B;  3GTO J;  3EUH A;  4C9Y A;  2EA4 A;  4PUS A;  3ZN1 A;  5TIS C;  3RQI A;  4IKF A;  2FQ3 A;  3S32 A;  1I39 A;  3BQY A;  4W97 A;  5CLS A;  3CCE I;  1JXS A;  3I59 A;  2KRF A;  3HOZ J;  3CO6 C;  3S16 J;  3SZG A;  3IUO A;  1X19 A;  3DP7 A;  4CH7 A;  1XDU A;  4LMY A;  3RPQ A;  2VJJ A;  1IN4 A;  1GV2 A;  2IRF G;  2WTE A;  4A3L J;  1W4M A;  3K7A J;  2L7M P;  5EEA A;  2JVG A;  1BJA A;  1F4K A;  3BLY A;  1RNL A;  4HST A;  4MGR A;  3S93 A;  1WFX A;  1XMK A;  3K4M A;  3X2Q H;  4XLN F;  3ABL H;  3K2Z A;  2EH3 A;  3CC2 I;  2AO9 A;  1DP3 A;  1Q1H A;  1B72 A;  2Y9Z A;  5CVV A;  3OYE A;  2NVQ J;  5HOD A;  4PGH A;  5K5O A;  4CYC A;  5JR3 A;  2IXS A;  2EBI A;  4ZDO A;  2WV1 A;  4JP0 A;  1L3L A;  2OCE A;  4N0B A;  5JFR A;  4XNF A;  4HF2 A;  3RTR A;  2X6O A;  3CUQ B;  2ELK A;  3VEP A;  3U9G A;  4FX4 A;  3GFM A;  1XB4 A;  2LLK A;  2R7W A;  1ZGJ A;  2X6W A;  4BY7 J;  1W7P A;  4OMY A;  1WZ2 A;  1IXC A;  4UHT A;  1F36 A;  1H0M A;  3UR3 C;  3I54 A;  2E7X A;  2JUC A;  3OYD A;  4XLA A;  4CSW A;  1U0J A;  3GZ5 A;  2K7L A;  3VYR B;  1OCZ H;  1S7O A;  2B0L A;  3RYR A;  3ZQF A;  3ML6 A;  1VQ5 I;  2QQB A;  3WTY C;  1ERD A;  2R7S A;  3MKZ A;  1FLI A;  3VDX A;  5KCM A;  2E5Z A;  1MBK A;  1LE8 B;  2KDZ A;  4LLN A;  1KQ9 A;  3N05 A;  2EZI A;  4LJZ F;  1HQC A;  5LGT A;  4A3D J;  2DBB A;  3OOU A;  2EPF A;  4L5E A;  2EK5 A;  1R36 A;  4BUP A;  2Y0S N;  2LKP A;  2OZU A;  3B73 A;  3IAM 2;  3Q0V A;  4X1E A;  4JOM A;  1KON A;  4FE7 A;  4IJA A;  3GX4 X;  4I6Z A;  4KT5 C;  1W0T A;  2N8G A;  5GAD J;  3TGN A;  3J7A Y;  1P4A A;  3AAF A;  2VN2 A;  5D6F A;  3JAM Z;  1JKR C;  2BY0 A;  1XN7 A;  4M6X A;  4G7H F;  5LFA A;  5GAG J;  3PSF A;  4ESB A;  3UKG A;  4IHY A;  4F92 B;  2TCT A;  3DBR B;  5IYD J;  1POG A;  2Y0M A;  5C44 J;  3KET A;  3OYN A;  3QPT A;  3SHF A;  4A93 J;  1P7I A;  3H3V K;  3WTZ A;  4KYW A;  3DTI A;  4BL0 B;  5K5Q A;  4RBO A;  5DV5 A;  2YX4 A;  4HX7 A;  4QPO A;  3RKW A;  5D5U B;  2MLK A;  4BQN A;  4RM3 A;  3GZN B;  3DFG A;  2YU9 J;  3LAP A;  4OWR B;  2K85 A;  2V4J C;  4LGW A;  5ED4 A;  4BE1 A;  4R79 A;  2UV1 A;  1K7A A;  1GVD A;  2CWE A;  2DJI A;  1YX3 A;  3SZT A;  2CGP A;  4LB5 A;  2QBY B;  1EF4 A;  3WTV C;  3IAS 2;  2L5Q A;  1ITY A;  5HLH A;  3JR9 A;  4M9S A;  2QM3 A;  2A3S A;  3L2Q A;  1D8J A;  3FKI J;  1XD7 A;  4L5J A;  1H9G A;  2L4A A;  1MZB A;  5FKO A;  2ZXJ A;  5F0C A;  1VQ8 I;  5J8F A;  2BHZ A;  5IT9 Z;  4AC0 A;  5D4R A;  1T98 A;  3F8C A;  2DT5 A;  4XBF A;  2OAZ A;  1HW5 A;  2E1M C;  2LP0 A;  5IPA A;  2VE9 A;  2IPQ X;  1REP C;  2DA2 A;  3G4S I;  3K4N A;  3KEQ A;  2ZFU A;  4C3J J;  3OYA A;  2LVS A;  1I50 J;  4V2G A;  2QGU A;  4M73 A;  5GAH J;  2WB1 A;  4XMY A;  1RPW A;  4CZC A;  3KYC B;  2KLO A;  1QHG A;  1N77 A;  1VQK I;  4OIR F;  4B43 A;  2V9K A;  1TBX A;  2OF7 A;  1U6G A;  3ZMU A;  4EM1 A;  4RA2 A;  1IDY A;  4Y15 A;  1U78 A;  1FPQ A;  2H8R A;  1FMW A;  3M9A A;  3OR1 C;  5K7F A;  5LRS A;  5H6Q A;  1CF7 B;  1Y1V J;  3A02 A;  2XRL A;  4LFU A;  1PP8 F;  2WY7 Q;  3N97 A;  1XSD A;  2O5R A;  4I98 B;  5M3M J;  4X0G A;  4LIT A;  5IT3 A;  5EG0 B;  5GAE J;  3FXU A;  3DBH B;  3I3L A;  3L09 A;  3D5L A;  1MNM C;  3P9C A;  1ZR2 A;  1ZG1 A;  2GZW A;  2XRN A;  4E7J A;  1UST A;  3K4C A;  4CYC B;  4XKW A;  3KP3 A;  2DYR H;  3M8E A;  1AHD P;  2EB7 A;  3HIF A;  4AD9 A;  2CRG A;  2DFI A;  4TV7 A;  1P7J A;  1BC8 C;  1LFU P;  4N9I A;  1FMV A;  4KMF A;  3PQK A;  3KP4 A;  3CCL I;  4IZZ A;  4KFC A;  4FQG A;  1ZG3 A;  1R58 A;  4YEJ A;  5KAI C;  3TO6 A;  2HQN A;  1S29 A;  2DK8 A;  3BZK A;  3TO9 A;  1IUF A;  3MN2 A;  1QZE A;  4Y7N J;  1R9T J;  2DO7 A;  4YIF A;  3R4K A;  3K69 A;  4IQ4 A;  3GFI A;  1LQ1 A;  5B1A H;  1N78 A;  3LL7 A;  3M1E A;  2KRC A;  3ASO H;  3LNQ A;  1XCB A;  4AID A;  2P6T A;  3VFZ A;  5J47 A;  3HHH A;  1RI7 A;  1A6Q A;  3IH2 A;  3QOE A;  1TQM A;  1BJZ A;  3C3W A;  2DPD A;  3S1R J;  4I0A A;  3AKZ A;  3V42 A;  2OJE D;  5JHF A;  4YII A;  5KK1 A;  2QKM B;  4BQO A;  1J7K A;  3IWF A;  4IRG A;  3G6E I;  4KIS A;  1VZ0 A;  5HNH A;  5JI6 A;  3I56 I;  1EKE A;  2NOG A;  2GQQ A;  1Z7U A;  4HA8 A;  3W3C A;  3TW7 A;  1V4R A;  4YG2 F;  4IOA F;  2JT1 A;  3H0D A;  3CMM A;  3QU3 A;  3F8F A;  2GAU A;  2GXG A;  1RIO H;  5FLX K;  1HKT A;  2Y30 A;  1QZZ A;  1ETQ A;  4AIK A;  1H88 C;  4IEJ A;  3R6S A;  4KMU X;  1LEA A;  3LOC A;  4DYQ A;  1FEX A;  1P6R A;  4BGD A;  3OYF A;  3OIQ A;  1RKT A;  1Y6I A;  2FBH A;  5DD8 A;  3OV8 A;  3V4G A;  2BY1 A;  2ESN A;  1JUP A;  2MD5 A;  2VKD A;  4A3F J;  2KP6 A;  2CQ7 A;  2NVY J;  2VXZ A;  3GXO A;  4ZTJ A;  1SFX A;  2LK2 A;  3LSR A;  3JRB A;  3GLL A;  5FRN A;  3EQL F;  1S9H A;  2DOF A;  5CVU A;  2DTZ A;  1P4W A;  3HOW J;  1JKP C;  3TED A;  1FTT A;  2YSR A;  2M2E A;  2M4G A;  4HG2 A;  4DYR A;  3MZY A;  3FHZ A;  3QOP A;  3K70 C;  1MSF C;  2JA2 A;  4PDK A;  4A0Z A;  4AIJ A;  2KL4 A;  5B3S H;  2Q1Z B;  2M8E A;  4JX5 A;  4O3M A;  4RB1 A;  1WJD A;  4I99 C;  2NOJ B;  2LBF B;  4BH9 A;  3PIP F;  5FLV A;  3CES A;  2L9S A;  3CO7 C;  3FHN A;  2FNA A;  3HG9 A;  2DA4 A;  1FNN A;  3DKY A;  4CCM A;  3K1P A;  5ICC A;  1E0E A;  3G3Z A;  3J80 K;  2HVS A;  2V26 A;  1T0F C;  1ORK A;  1DGR M;  4BDZ A;  3ABM H;  1G2H A;  3V7R A;  1W7P D;  1OCR H;  1OQY A;  1HW1 A;  2BGC A;  3F22 A;  5LD2 C;  1SC7 A;  2O8X A;  5D8L B;  1O57 A;  3QPH A;  2E2H J;  3WTS C;  1XGS A;  4ENK A;  4GRI A;  1ZRD A;  4D0P A;  2VI6 A;  3WG9 A;  2FX0 A;  3BR6 A;  3K70 D;  1UHS A;  1ZLJ A;  2RDP A;  2CUZ A;  4I09 A;  2XPU A;  2ZKZ A;  4Q4Z F;  2LH9 A;  3GME A;  3LQQ A;  4Y3O A;  4IXA A;  3SQN A;  2AS5 F;  4ANJ A;  5M3F J;  2W00 A;  2ZNZ A;  1JHF A;  2IGK A;  4Z2Y A;  3BJA A;  2NVU B;  5LBQ A;  2EFN A;  4PK4 A;  2L7F P;  4UY8 I;  3QWL A;  1RC9 A;  1WJE A;  3LSI A;  1XGN A;  3TDU C;  2X9D A;  5ICG A;  3H9J A;  3U1K A;  1DUX C;  3OYC A;  3W6J B;  2PMZ A;  1OJL A;  2DAO A;  1QGP A;  3PL8 A;  3CJT B;  4C3H J;  1YJN I;  3HGG A;  2HXO A;  2STT A;  3I4N J;  2OQG A;  4O5V A;  4EGY A;  3W2A A;  4EEF G;  3BP8 A;  3HEF A;  4YFK F;  3FMR A;  2CQK A;  2E34 A;  4GYI A;  4OOI A;  2HEO A;  2R4G A;  4LK1 F;  3V7C A;  1FOX A;  2WAE A;  3F0C A;  2FJ1 A;  4A3G J;  2A69 F;  3IC7 A;  1UAA A;  3S3N A;  5IP9 J;  5E3L A;  2XSD C;  1T08 B;  3HC7 A;  3M1C A;  3COA C;  3OSG A;  3W6V A;  4IRI A;  2JJ7 A;  4HX8 A;  4CIC A;  1IN8 A;  3CF5 F;  3BTC A;  2QEX I;  1YTY A;  1S72 I;  5F64 A;  3Q3S A;  2QCO A;  1F1Z A;  3M8J A;  3PM1 A;  4BHP A;  1SD4 A;  5D8K B;  4HSR A;  4I2O A;  3CZ6 A;  3OYJ A;  2XAF A;  4A5M A;  1M1E B;  3FX3 A;  1K78 A;  2VT2 A;  3MD2 A;  3MCZ A;  2LKX A;  2HVQ A;  2R7V A;  2QLZ A;  3GTP J;  2K86 A;  3O8H A;  3TP0 A;  4OIP F;  4ZZD A;  1OMI A;  2VJI A;  5J3L A;  1G8X A;  2MYS A;  4F52 A;  2I10 A;  4C2U A;  3QAH A;  2WAD A;  4U88 A;  2HKO A;  3WTU C;  2NS7 A;  2HTS A;  3CME I;  5L3D A;  2CV1 A;  3C2G A;  4D1Q A;  2GOM A;  2YU3 A;  4RDU A;  2ECC A;  2IGN A;  5LGU A;  5FLX Z;  1FBS A;  3FIS A;  1NG7 A;  4RLQ A;  2IA2 A;  3C1D A;  3OIP A;  4A3C J;  1Y1W J;  3E5X A;  1P2F A;  3A0B C;  3KEO A;  4EJT A;  1MMS A;  1TWG J;  3GTM J;  1SVO A;  1MJA A;  3WHC A;  2FA5 A;  4MO7 A;  4NUB A;  2FBI A;  2OPT A;  3CMY A;  4HNV A;  3JTH A;  4HQM A;  4FX0 A;  4P5O A;  1JJ6 C;  3K10 A;  2CQQ A;  3KP5 A;  2DYS H;  4AVZ A;  1MDM B;  2XAG A;  1IXR C;  2M4K A;  4FET A;  4GGG A;  1J0R A;  3BJ6 A;  3D5R C;  4LG3 A;  4ZYD A;  1I3A A;  2F5D A;  2M9H A;  3BJO A;  2IS4 A;  4KT6 A;  2VQL A;  5AON A;  5LLQ A;  1A35 A;  3VPR A;  2WAQ N;  3OIO A;  2O0Y A;  4IHS A;  3CDH A;  3CCJ I;  3WE2 A;  3PFY A;  1HC8 A;  3IH3 A;  3G1O A;  2VXD A;  1BI3 A;  3BZC A;  2P7C B;  1ACI A;  4CHU A;  4DGW B;  2DFH A;  1E3H A;  1HLV A;  1OKR A;  3TBI A;  3AG3 H;  5J1R A;  3GZ6 A;  2KIS A;  3E6C C;  4XRF A;  2K27 A;  4HV5 A;  3GTG J;  2PI0 A;  4GO1 A;  5E20 A;  4P55 A;  3HJE A;  2EZL A;  3I64 A;  4FHT A;  2K3F A;  1I1S A;  1J2X A;  3PSI A;  3A0H C;  3B6A A;  4ZDP A;  3UNG C;  3H5A A;  1BIB A;  3HM5 A;  2BY2 A;  1VQ7 I;  1CQT A;  1QRY A;  3JRD A;  3U21 A;  2XGC A;  4XM3 A;  4HNT A;  1YJW I;  1VQ9 I;  3Q0W A;  3RCO A;  1ON1 A;  4HLX A;  2F4I A;  1BBY A;  1X4P A;  1VQN I;  1HKS A;  2CV0 A;  3OYK A;  2HKX A;  3T8T A;  5TGT A;  4OAZ A;  2PMU A;  3SXY A;  1FOY A;  2KIM A;  1YE9 A;  2ELH A;  2FMY A;  3HUG B;  2RKH A;  2PFB A;  3S17 J;  2O61 A;  1D3Y A;  2H6C A;  5E1Z B;  2H27 A;  3HRU A;  4DBQ A;  1U8B A;  2CW7 A;  5CKT A;  2LRE A;  3CLO A;  3KFW X;  3RQ4 A;  2M87 A;  2KMU A;  2CG4 A;  3L2U A;  2HDC A;  3ZMT A;  2QSG X;  3TP3 A;  1OYI A;  1EV7 A;  3ERM A;  3ZCO A;  2K4B A;  1UFM A;  2Q2E B;  4XN0 A;  2FEZ A;  4LLG F;  3CCS I;  4E7S A;  3DEE A;  1AU7 A;  5GTH C;  3S2W A;  5KHD A;  3S1N J;  2CQN A;  2VPL A;  1IRX A;  1FIP A;  3LSG A;  1YRN A;  1KU2 A;  3TQN A;  2F4M B;  1O3S A;  5H6R A;  5JLW A;  2H8W A;  3A01 B;  2L2O A;  4MLO A;  2MC3 A;  2K40 A;  3DU6 A;  2KKO A;  3FK7 A;  3M7G A;  3FBN B;  3FXQ A;  1MBE A;  4ENN A;  2PMZ N;  2BE5 F;  3HHG A;  3DU5 A;  4HAM A;  3JRH A;  4ZTF A;  1H9T A;  4BNC A;  2OBP A;  2DQR A;  2JRM A;  2WY8 Q;  3OS2 A;  4BAY A;  2X85 A;  4HYE A;  2HYJ A;  3MVP A;  1LKX A;  2Y48 A;  4HDV A;  1MH3 A;  1W36 C;  4AIH A;  3RZO J;  3CMA I;  1FOW A;  4I0B A;  3RZD J;  2VLA A;  1BN5 A;  1ZQ3 P;  2MW8 A;  4BEH A;  1UHM A;  2E36 A;  3KEY A;  4EM0 B;  4XRM A;  4BS9 A;  3ZP5 A;  3JCU C;  2JUG A;  3DQV C;  2F6C A;  3L9F A;  4A69 C;  2EJR A;  2JN6 A;  2YUS A;  4B09 A;  3BR1 A;  2XRO A;  3M8F A;  3CCQ I;  2JZY A;  4RS8 A;  3S3M A;  4C2T A;  4RGR A;  5ILU A;  2EA2 A;  1SFK A;  1V5F A;  1BW5 A;  3LAJ A;  4RAY A;  1HSJ A;  2YS9 A;  2LY2 A;  4KIC A;  1Z77 A;  3E97 A;  4CZZ A;  3GTQ J;  3PFI A;  2E5N A;  4BDY A;  4X6A J;  2P7V B;  2QSF X;  3BR3 A;  2AQF A;  1OCC H;  4NBQ A;  1SD7 A;  5D4S A;  2O7O A;  4PJN A;  2CV2 A;  5IOZ A;  2XV4 S;  4I01 A;  1JKO C;  2VKV A;  3Q0U A;  1BR2 A;  1W5S A;  3Q9V A;  2L7K A;  1IUY A;  4D5F A;  5HS7 A;  1JE8 A;  1Z21 A;  4A12 A;  2MG4 A;  1ENH A;  2JVH A;  1S6L A;  1HW2 A;  1LVA A;  3FWE A;  3HRT A;  3L2W A;  1VQO I;  2IS6 A;  3CCU I;  4RGU A;  4ESF A;  2L7Z A;  2XGX A;  4ZYH A;  2OU2 A;  1ZGA A;  1IXS B;  2TRT A;  2XAJ A;  4LD5 A;  3WTX C;  5L3G A;  5DUI A;  1U9O A;  2M0C A;  3U1D A;  1UG2 A;  1FWZ A;  2WBM A;  4IQJ A;  3M3Y J;  2JWT A;  3G2B A;  5A2Q K;  2NAZ A;  3K4K A;  1YIJ I;  3BTJ A;  3OYI A;  2XPW A;  5JVG F;  3EUH C;  3IKV A;  5FB2 A;  2ZCW A;  3ASN H;  3H35 A;  2VB6 A;  3H9Q A;  3DXJ F;  4U7B A;  3CCV I;  3SDG A;  1R22 A;  3NWS A;  1WJB A;  3ULQ B;  3AL0 B;  3LFU A;  2VBY A;  3HRM A;  4MHG A;  3H5N A;  3OL3 A;  2EIK H;  2Z5U A;  3DCF A;  3E1S A;  2E2I J;  2CO5 A;  1NG6 A;  3BG6 A;  4UVB A;  4U0V A;  4XOT A;  2FF4 A;  2K3P A;  5E79 C;  1W5T A;  1MIJ A;  2EFW A;  1S7E A;  4Y13 A;  1YIO A;  1GLN A;  2XF7 A;  3BTI A;  4OIQ F;  1IV8 A;  4LOC A;  3SZP A;  3WOD F;  3KE2 A;  2R7R A;  3BDD A;  1FSH A;  3I55 I;  1YW7 A;  1R00 A;  4DOZ A;  4BE2 A;  4WXC A;  3HGY A;  5F1J A;  1XSX A;  3A03 A;  4NHJ A;  1IJW C;  4ZH4 F;  4KNY A;  4BJ6 C;  1QBJ A;  1T33 A;  1R23 A;  2DA3 A;  4IF4 A;  2Y75 A;  3KYL A;  2FOW A;  2R7Q A;  3KX2 A;  5EGO B;  2BVL A;  1O3T A;  3GTK J;  2QSH X;  2E1O A;  2DLL A;  2EFQ A;  2Z99 A;  3PNY A;  1Z7L A;  2LD5 A;  1E3O C;  3EYI A;  2HNH A;  3FDY A;  2A5W A;  1OPC A;  4W1U A;  1KZH A;  2CUJ A;  2R3S A;  1A31 A;  2FQ4 A;  3OR2 C;  1MSE C;  4H4K C;  1IV6 A;  1B1B A;  3CCY A;  4NDL A;  1IGN A;  1QHH D;  2FU4 A;  3GF2 A;  4HV6 A;  2JQ7 A;  5F6F A;  4L9J A;  1BOA A;  1ONV A;  1SD5 A;  4ENM A;  3RPU A;  2DMN A;  4ZYA A;  3VOE A;  4IRH A;  2COM A;  1P9Q C;  5FKM A;  2COB A;  3LA2 A;  1J9I A;  3KLO A;  3HPH A;  4BHB A;  4M9X A;  1HXD A;  3WU0 A;  2ZJR F;  1MBF A;  1HBX G;  2PX9 A;  3FM5 A;  1RZ4 A;  2FD5 A;  2IP2 A;  5ILV A;  2HOE A;  1FT9 A;  1W36 D;  2QVO A;  1WCM J;  3PNV A;  4E7K A;  1V54 H;  3HSR A;  1Y39 A;  5EG0 A;  3H3Z A;  4XQF A;  3S2D J;  1I1G A;  3D0S A;  2QA4 I;  2HQR A;  3ELK A;  4HW0 A;  1YG2 A;  1XX5 A;  4BEH B;  3V8L A;  4M3B A;  4BKX A;  1TNT A;  2EZK A;  2MH9 A;  1OYY A;  4ITV A;  1I5Z A;  4ZYG A;  2D1V A;  3HKZ A;  5FRO A;  3FXL A;  1EH8 A;  1PUE E;  2ZJ2 A;  1PDN C;  4FCY A;  1XGO A;  1STZ A;  3GW2 A;  1LNW A;  3W2V A;  4C2M J;  2GWR A;  5EYR A;  3FBI B;  5B66 C;  3GTL J;  1SMT A;  1WJF A;  4XID A;  2QYO A;  1R1U A;  3H92 A;  3AFH A;  4M6Y A;  2HYG D;  3FMQ A;  1TT5 B;  1HDP A;  4B47 A;  4MQV A;  4EJV A;  1U3E M;  2HPM A;  4MEX F;  2C6Y A;  4XIC A;  3MAJ A;  3CJN A;  3KYD B;  2KFD A;  3E7L A;  2HFH A;  2UUZ A;  4BJ5 C;  2MSY A;  1IRZ A;  4Y52 J;  2LF8 A;  5CQG A;  1HCR A;  2NVT J;  5IY5 H;  2OUM A;  2DA6 A;  1GUU A;  1LUJ B;  3PO2 J;  5EF6 A;  1EH7 A;  2GXB A;  2Z1D A;  5DCM A;  1O7F A;  1SMY F;  1I6H J;  4M74 A;  2JRT A;  2EIM H;  1QNT A;  2P5V A;  4DW6 A;  4N4O B;  3IH4 A;  3J81 Z;  3ZN0 A;  4KIF A;  2ELJ A;  1ZYR F;  1LDJ A;  2ZJP F;  5A2Q Z;  4O6J A;  2A05 A;  3K0L A;  1RUO A;  2MAB A;  2DXI A;  2VQG A;  3GCM A;  2ZSH B;  3A2K A;  4KN4 X;  1UMQ A;  4GYG A;  3HZJ A;  1X1B A;  1HA8 A;  1ZAR A;  2XIG A;  4LB6 B;  2HVR A;  2R7O A;  1WRJ A;  3BWG A;  3SJM A;  2CU7 A;  2RNJ A;  2ZSI B;  3PUB A;  3PUF A;  2VPR A;  2VT3 A;  3P5J A;  3L2V A;  3GO5 A;  3DPL C;  3GFJ A;  2ZJQ F;  1MMD A;  4ETS A;  5HLT A;  2QUF A;  2DCE A;  1AOY A;  5E3O A;  3L2C A;  2LNB A;  3ZXS A;  1JI8 A;  5TJJ A;  1TNS A;  2QQ9 A;  1XDS A;  1X3W B;  1T0F A;  1R1T A;  2LKS A;  2E1N A;  1JKQ C;  2YR2 A;  1WKM A;  1ODD A;  5L3B A;  1K6Y A;  2G7H A;  3WE3 A;  1RET A;  4GXO A;  3F9K A;  3R60 A;  3WHB A;  5J6X A;  4CGZ A;  3S1Q J;  2PMH A;  5D5X B;  2F4O B;  2GA2 A;  3IWZ A;  2OV7 A;  3LSK A;  3KPH A;  2P6S A;  3OMY A;  2ZXI A;  1TWC J;  4Z6Y A;  4WK8 F;  2XSJ C;  3BG5 A;  3Q9S A;  1VQ4 I;  2DFE A;  4ESJ A;  4P1W A;  2R5Z A;  1ZEL A;  5L3F A;  4FE4 A;  1EJ9 A;  1BR1 A;  2NNN A;  5HOO A;  3TOA A;  3ZMD A;  1WWX A;  4DZJ A;  4BHC A;  2L0K A;  4XSZ F;  2LRD A;  1TP4 A;  3OYB A;  5BS6 A;  2DMU A;  1G59 A;  2R5Y A;  2FNP A;  2LG4 A;  3FIW A;  1KQ0 A;  1X2N A;  4EQQ A;  4E7L A;  2UZK A;  4M6V A;  1NK3 P;  5J4V A;  5B1B H;  3QP6 A;  1MMG A;  3F8N A;  3CTA A;  3FKJ A;  3TOB A;  3H3U A;  2XDV A;  3S8P A;  2H09 A;  5DS9 A;  2NNY A;  1PJR A;  2HOT A;  2L4M A;  4P9U A;  1TWA J;  2JTV A;  3I9V 2;  2ZME B;  2PEX A;  2WAF A;  2A5Y B;  4OU0 A;  5IP7 J;  1FBU A;  1DQU A;  4K2E A;  5CPR B;  4CXF A;  1PUF A;  1QPM A;  3JW4 A;  2A68 F;  4ENJ A;  1N25 A;  3HL2 A;  4OIN F;  1B6A A;  4ON0 A;  4PFP A;  3FXO A;  3ZQH A;  2J5O A;  4EJO A;  2HQ5 A;  5E1X A;  3ZOB A;  2P4W A;  3S2H J;  1X1C A;  3WTW C;  1MMA A;  2PBI A;  3R0A A;  1PYV A;  2DT7 B;  4B3A A;  2XKO A;  2IGM A;  1OR7 A;  4NC6 A;  2KHM A;  2CFX A;  2ZXH A;  3ZQI A;  2QZ8 A;  1WPK A;  2GM4 A;  3CDI A;  4A6D A;  2ME6 A;  3TO7 A;  2L02 A;  3GTJ J;  2VQH A;  3R61 A;  3P7N A;  3QQA A;  4KIG A;  1RR7 A;  3I4P A;  3QPS A;  2W82 A;  4KIT B;  4JQF A;  2IJL A;  2OCC H;  4Q47 A;  3QRF F;  2IBD A;  1SEU A;  1MJB A;  5FRM A;  4A6E A;  2V1N A;  3L00 A;  4KIB A;  3HOT A;  5J4Y A;  2K9M A;  1ZLK A;  1LB2 A;  4MTD A;  3MKW B;  1C0W A;  3BG3 A;  4EAT A;  3I5U A;  4A5N A;  2O3F A;  1WJC A;  5F08 A;  2XPV A;  3WGI A;  2M0M A;  5GPC A;  1H8A C;  1XC5 A;  3CUQ A;  3E5U A;  4LG0 A;  1U8R A;  3ZMS A;  4U7D A;  1Z3X A;  2O9L A;  2OQR A;  4AM3 A;  2ECB A;  1K6O A;  4RGX A;  1VI0 A;  1Z9C A;  2WA0 A;  5J8C A;  1YS6 A;  5EDN A;  2LMD A;  2PJP A;  2HPI A;  1RKW A;  3REO A;  2KIF A;  1QPI A;  2VKE A;  3HOX J;  5HDG A;  4A3B J;  4XOP A;  4V2F A;  5DDG A;  2JA8 J;  3KZI C; 
#chains in the Genus database with same CATH homology
 3PSF A;  4CA0 A;  2W7N A;  4CUG A;  4F92 B;  4DJA A;  3ZCO A;  2Q2E B;  2X1C A;  4XN0 A;  2X51 A;  3OYN A;  3VYU B;  3D5S C;  4E7S A;  3DEE A;  3OY9 A;  2K5C A;  3DTI A;  4BL0 B;  4XLC A;  3HPG A;  3EUK L;  3PJR A;  5KHD A;  4QPO A;  4F55 A;  2VPL A;  1IRX A;  3LSG A;  2IS2 A;  4BQN A;  4RM3 A;  4II2 A;  4E7I A;  2R7T A;  4OWR B;  2V7F A;  2BVM A;  4PJL A;  2L2O A;  2V4J C;  4MLO A;  4BE1 A;  4ZC3 A;  4R79 A;  3DU6 A;  4AU7 A;  2UV1 A;  3FBN B;  3ZQQ A;  2DJI A;  1YX3 A;  3K4J A;  4ZTF A;  3DU5 A;  2VL8 A;  3H9G A;  3OS2 A;  2WY8 Q;  3IAS 2;  2L5Q A;  2X85 A;  4CCO A;  3OS0 A;  3VWB A;  4E7Z A;  1LKX A;  4XKV A;  4BU2 A;  1TZL A;  1LDK B;  2M3A A;  3L2Q A;  3K4L A;  4HNU A;  1W36 C;  2KDO A;  1Z3Y A;  1BR4 A;  2VLA A;  4BEH A;  3KEY A;  3CJQ B;  4ZDL A;  3SEQ A;  4BS9 A;  2E1M C;  1MNE A;  4FAS D;  3K4N A;  2JUG A;  3DQV C;  2ZFU A;  3OYA A;  2F6C A;  4NNJ A;  4PSX A;  1DGW Y;  2GOX B;  3VSK A;  4F93 B;  2WB1 A;  4XMY A;  3CP8 A;  4PSW A;  4CZC A;  3S3M A;  3LSH A;  4C2T A;  2KLO A;  1QHG A;  1N77 A;  1SFK A;  3RSN A;  1V5F A;  2V9K A;  4B43 A;  3IP4 B;  1LVK A;  3K6G A;  4II3 A;  2PJR B;  2LY2 A;  3TL4 X;  1QU3 A;  1FMW A;  2E5N A;  3OR1 C;  4BDY A;  3QYB A;  3OYL A;  2AQF A;  2WY7 Q;  3DTE A;  4PJN A;  2CV2 A;  2O5R A;  2XF6 A;  4X0G A;  4LIT A;  4F91 B;  2RRE A;  1BR2 A;  2CFO A;  2L7K A;  3DPU A;  2IGO A;  2RNG A;  4CCK A;  3I3L A;  1Z21 A;  3D5L A;  2JVH A;  2VJ4 A;  4E7J A;  3L2W A;  3K4C A;  4XKW A;  2IS6 A;  2MFZ A;  3OYG A;  3ZGK A;  2A6T A;  3BC8 A;  1FMV A;  2VQC A;  4IZZ A;  1TT0 A;  5KNL A;  2WBM A;  2M7A A;  4IQJ A;  1X1A A;  3OS1 A;  3G2B A;  3OWT A;  4DBR A;  3K4K A;  3OYI A;  3CJR B;  4OAY A;  4YEJ A;  3EUH C;  3QYE A;  3H35 A;  2VB6 A;  2DT6 A;  3H9Q A;  3PNT A;  4D9J A;  4U7B A;  3NWS A;  1D1C A;  2X1D A;  1WJB A;  3AL0 B;  3LFU A;  4IQ4 A;  3H5N A;  2XAU A;  1N78 A;  3OL3 A;  3LL7 A;  2KRC A;  3E1S A;  2VIX A;  2UWM A;  1NG6 A;  4CCJ A;  4XLH A;  3BG6 A;  4XOT A;  2K3P A;  3DTK A;  3QOE A;  1D0Z A;  3MMY B;  2CW8 A;  1GLN A;  3AKZ A;  2XF7 A;  2CMP A;  3V42 A;  2F5V A;  5JHF A;  4YRV A;  2QKM B;  4BQO A;  2R7R A;  1YX5 A;  4KIS A;  1VZ0 A;  4DOZ A;  5HNH A;  4BE2 A;  2PJR A;  4NC8 A;  2VAS A;  3W3C A;  4BJ6 C;  3W2W A;  4Y4R A;  3H0D A;  3KYL A;  3CMM A;  4RMN A;  2R7Q A;  3KX2 A;  2BVL A;  4B44 A;  2XF5 A;  1D1A A;  3PNY A;  4XR6 A;  1Z7L A;  2HNH A;  3FDY A;  2E60 A;  4CCN A;  2A5W A;  2CUJ A;  2BW3 A;  3NWT A;  4E6K G;  4U87 A;  4BGD A;  3GBG A;  3SYT A;  3OIQ A;  3OR2 C;  3QYF A;  4H4K C;  1Y6I A;  3OYF A;  1LFP A;  1J09 A;  1QHH D;  2VKD A;  4XLE A;  2KP6 A;  3A1Y A;  2VXZ A;  4ZTJ A;  5HVQ C;  4ZYA A;  1P9Q C;  2MD0 A;  5FRN A;  1S9H A;  2M7B A;  5HNF A;  3HPH A;  3K70 C;  2M4G A;  4HG2 A;  2E1M B;  2JA2 A;  4C30 A;  3ZR8 X;  2CS3 A;  4CCL A;  2KL4 A;  3DKX A;  4N4N B;  1W36 D;  2Q1Z B;  1R6R A;  3A4C A;  4HEA 2;  1WJD A;  3PNV A;  4RLF A;  4E7K A;  4RM2 A;  2NOJ B;  2LBF B;  4F3Q A;  2Z16 A;  4BAC A;  4XQF A;  3CES A;  2L9S A;  2K9L A;  3BCB A;  3FHN A;  3HG9 A;  2VKH A;  3DKY A;  4CCM A;  4BEH B;  1E0E A;  3H5R A;  2HVS A;  2V26 A;  2R7U A;  1T0F C;  2VJ5 A;  4ITV A;  1DGR M;  3HKZ A;  2HZD A;  2X6X A;  5FRO A;  4BDZ A;  4LIV A;  2HQA A;  2BOL A;  4XOR A;  3LMM A;  5LD2 C;  4BE0 A;  3W2V A;  2KPM A;  1T95 A;  4PJJ A;  3VSL A;  3FBI B;  4NC7 A;  4GRI A;  4LIU A;  1WJF A;  2W4S A;  3DLA A;  3AFH A;  2QKL B;  2KRH A;  3LSM A;  2Z2S B;  3C2H A;  4BXF A;  3MKY B;  3K70 D;  4B47 A;  4ZJZ A;  2CUZ A;  2HPM A;  2LH9 A;  4Y3O A;  1Y56 A;  2OC6 A;  1D0Y A;  4YEL A;  4AYB A;  4IX7 A;  4ANJ A;  2W00 A;  3SDB A;  1OR7 C;  1UEL B;  2UUZ A;  4BJ5 C;  1N75 A;  2IGK A;  2CH0 A;  5CQG A;  3DPT A;  2OUM A;  1AA7 A;  4J00 A;  4PK4 A;  4NQW B;  3VYS B;  1WJE A;  3LSI A;  2Z1D A;  3H9J A;  1V5E A;  1EA3 A;  2JSP A;  2LY1 A;  2PMZ A;  3OYC A;  3CP2 A;  1BOB A;  2I8D A;  4XON A;  3PL8 A;  3W2A A;  3K4B A;  4KJZ A;  4N4O B;  2ELJ A;  1MND A;  1UG0 A;  2R4G A;  2WAE A;  1WJ5 A;  2MAB A;  2VQG A;  2DXI A;  2ZSH B;  2V6E A;  3BCA A;  3OL4 A;  4DIQ A;  3A2K A;  3DWL E;  1UAA A;  3S3N A;  1X1B A;  1HA8 A;  3HC7 A;  2HU9 A;  3M1C A;  2HVR A;  3HXL A;  2R7O A;  2ZSI B;  3PUB A;  2MC4 A;  1WJA A;  4PJM A;  3L2V A;  3DPL C;  3S3O A;  2LOO A;  2LYC A;  2XC7 A;  4B3X A;  3ONQ A;  1MMD A;  5HLT A;  1MMN A;  3M8J A;  2DCE A;  1MW7 A;  3ZXS A;  4XKC A;  1JI8 A;  2P0W A;  4HSR A;  4BQQ A;  3CZ6 A;  3OYJ A;  2X1E A;  3MD2 A;  4BJT A;  2HVQ A;  2R7V A;  1K6Y A;  2DOA A;  1V5G A;  2Y0S A;  3F9K A;  2HDW A;  2FUG 2;  2BW3 B;  2LC2 A;  2OV7 A;  2VJI A;  3LSK A;  1D1B A;  1G8X A;  2MYS A;  3OMY A;  4F52 A;  2ZXI A;  4C2U A;  3EUA A;  2W1O A;  2WAD A;  2X6Y A;  2XSJ C;  4XN3 A;  4E7H A;  4P1W A;  3TMO A;  2CV1 A;  3C2G A;  1ZEL A;  2LBF A;  4D1Q A;  2GOM A;  4PFO A;  2IGN A;  1BR1 A;  5HOO A;  1NG7 A;  2RQQ A;  4RLQ A;  3OIP A;  2IS1 A;  2LRD A;  3E0J B;  3OYB A;  4C9Y A;  1G59 A;  4PUS A;  2LG4 A;  4IKF A;  4XL9 A;  3S32 A;  4E7L A;  5CQE A;  2KQR A;  3OYH A;  4NUB A;  3HOS A;  1MMG A;  3FKJ A;  3SZG A;  3IUO A;  1X19 A;  4CH7 A;  4P5O A;  2VJJ A;  2XDV A;  3S8P A;  3K10 A;  3VYT B;  1PJR A;  4AVZ A;  4B48 A;  2WAQ A;  2AQE A;  2JVG A;  2M4K A;  3BLY A;  3S93 A;  4HST A;  1WFX A;  4FET A;  3I9V 2;  3K4M A;  4Y33 A;  2WAF A;  3D5R C;  4LG3 A;  1DP3 A;  1DQU A;  2IS4 A;  5CPR B;  4KT6 A;  2VQL A;  3OYE A;  3HL2 A;  4ZDO A;  2IXS A;  4PFP A;  3PFY A;  4XNF A;  2VXD A;  4HPQ A;  3RTR A;  1X1C A;  1MMA A;  1PYV A;  2DT7 B;  4DGW B;  3ZRG A;  2IGM A;  4XKB A;  2R7X A;  4J01 A;  3TBI A;  2KHM A;  2R7W A;  2X6W A;  2ZXH A;  3CF2 A;  3UR3 C;  1D0X A;  2VQH A;  3OYD A;  4XLA A;  4CSW A;  3L2R A;  1U0J A;  2W82 A;  4KIT B;  4JQF A;  3PSI A;  4HRI A;  3VYR B;  4ZDP A;  1X1D A;  4XLF A;  3UNG C;  1X4O A;  5FRM A;  1SAU A;  3H5A A;  2V1N A;  3HOT A;  1ERD A;  2R7S A;  3MKZ A;  3QOD A;  3VDX A;  5KCM A;  2E5Z A;  2K9M A;  3U21 A;  4HNT A;  4XM3 A;  3N05 A;  3MKW B;  3RCO A;  2F4I A;  4EAT A;  1X4P A;  3SEZ A;  3OOU A;  1WJC A;  2CV0 A;  3OYK A;  2M0M A;  4G6T B;  4BUP A;  5TGT A;  4OAZ A;  3IAM 2;  1Z3X A;  1OLT A;  3BG7 A;  4JOM A;  1YE9 A;  1KON A;  4E4H A;  2WA0 A;  3AL0 C;  3HUG B;  2KZV A;  3RPU D;  2HPI A;  3J7A Y;  2L9N A;  4XOP A;  4DBQ A;  3OYM A;  2CW7 A;  5CKT A;  2LRE A;  3RQ4 A;  3L2U A;  4QPQ A;  2KMU A;  5LFA A;  3EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...