3OMYA

Crystal structure of the ped208 tram n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
51
structure length
51
Chain Sequence
b'PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein traM
publication title Structural basis of cooperative DNA recognition by the plasmid conjugation factor, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 19
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3omyA00
4QPOA 1DP3A 4QPQA 3OMYA
chains in the Genus database with same CATH superfamily
1J7KA 4HF0A 4BXFA 5LHGA 1JJ6C 3WU1B 2HDCA 3HOVJ 2XF6A 4XSZF 1YG2A 2ZSIB 2GQQA 2QENA 2JRMA 2R0QC 5L3FA 3GTLJ 2MW8A 5FB2A 1VNDA 3JRIA 3L2QA 4BKXA 2JUCA 4EV0A 1LNWA 4EQQA 2E5ZA 1ZYRF 1YITI 3ZOBA 4LG0A 4M73A 1USTA 1ZTRA 5GAHJ 3DKXA 4LD5A 2HKOA 1W7PB 2P5KA 3AAFA 4KT6A 1MBGA 1VI0A 1Y8RB 4W97A 2E5NA 5F64A 2CQNA 4CYDA 1RUNA 2HS5A 4HX7A 1IAWA 4L9VA 2EZKA 3HJEA 4HV5A 2QKLB 2NOJB 2IS1A 1MH4A 3H5RA 4M72A 3E5UA 3DLLF 3VDXA 1SD7A 3JTHA 4M71A 2A05A 3R61A 3QOPA 4DJAA 2P6SA 2KFDA 2ME6A 2M1BA 1G3TA 3ZQCA 4B48A 5IT9K 1KYWA 4L5JA 2R7RA 4J01A 1U8BA 1HOMA 4LK0F 4XICA 4NC6A 1ETOA 3HHGA 1RR8C 4N0BA 3G6EI 3ISPA 3LL7A 2LY2A 3GLXA 3OIOA 2R7FA 2B7EA 2P5LC 2WA0A 3RDIA 2DT5A 2G9WA 4A69C 2XHKA 1MSEC 1B72B 3A2KA 4MFEA 5HLIA 3OYEA 2M30A 3FKJA 2CW8A 3HZJA 2GIZA 2X48A 3HKZA 2XGDA 3K2AA 2CW7A 2D2WA 1KQ9A 2QGUA 2ZO4A 4XRFA 5HODA 3MD2A 1FTZA 3BTLA 4RBOA 4QPQA 1KU7A 1ZAOA 3FHNA 3L2WA 5LGUA 3K4MA 1SD6A 3PO2J 2XSJC 2VODA 3DKWA 2Z2SB 2EFQA 3V8KA 2DQRA 2M7BA 1X4OA 5H6QA 3RKWA 1SANA 1KZHA 3H0DA 4JK1X 1YJNI 4G7OF 4EJUA 1MJ9A 1H9GA 2LFBA 3AG1H 1MSFC 3EUHA 1G59A 3S32A 2KHMA 3J80K 1F5TA 4AIKA 4X6AJ 2ZSHB 3O6BB 4U7DA 1O7LA 3CJTB 5J8CA 4XKCA 1ZR2A 1U2WA 1QO0D 2K4JA 2Z16A 4ZC3A 4OAYA 3ABTA 1TWGJ 3HRSA 4I98B 2YU9J 2GA1A 4CCKA 1E17A 3VEPA 4BU2A 2JQ7A 3PJRA 3S2HJ 1HXDA 4GCVA 3Q0UA 4DQ2A 3WU0A 4I99C 3MZYA 1O57A 1VFCA 5D4RA 1G8XA 2LY1A 3HC7A 1SVMA 1NK2P 5FKLA 4BHCA 4XRMA 3E6MA 2CSOA 2W85A 4LG0B 4RB3C 1PJRA 3CCSI 2DMUA 3DLAA 2O61A 1WJ5A 2KJCA 4NB5A 4AYBN 1MBHA 3N97A 1UELB 3B6AA 4AWXB 2XF7A 4A6DA 1TWFJ 5B1AH 3M8EA 1A31A 1KONA 3RI4A 2Q8KA 1Z3YA 5IP7J 4BJ5C 1ETXA 2LREA 3E97A 4E4HA 2VXZA 2H8RA 3JRGA 4KICA 1R23A 4ZJZA 2VBWA 3DFGA 5FGMA 2NS7A 2QYOA 2UUZA 2ZB9A 3T5XA 1IN8A 4P9FA 2DA3A 3L09A 5HNFA 3QAHA 1SD4A 2LF7A 4Y15A 4A3LJ 1X1CA 1GXQA 3JAMK 2HEOA 1MGTA 2C6YA 2MBFA 2P7VB 2ZC2A 3H0GJ 2TRTA 2O6GE 3OYNA 2K40A 3ERED 3A0BC 1U3EM 4A3EJ 2OZ6A 5CQEA 3I4PA 1X4PA 4IHWA 3AG3H 1C0WA 3GTKJ 3KP5A 4HQEA 2HXOA 4XMYA 1NG6A 1SFUA 1XS9A 1I1SA 3N4MA 2HGCA 2ZXHA 3S1QJ 3OL3A 5BNGA 4F55A 3RJPA 3JR9A 2XAUA 2LP0A 2QSHX 4M6XA 3L1PA 4Y17A 1T95A 1JTXA 3IL2A 2XGCA 1E3HA 3IP4B 5CYVA 1IJWC 5FKKA 1LQ1A 3WG7H 3R4KA 2FEZA 4XLEA 2UZKA 1IXCA 4PGHA 3D1NI 1O3TA 4PSWA 1MDMA 3OYAA 3HSFA 2KRHA 2FUG2 3TBIA 2FE3A 4ZZLA 5IP6A 2LY9A 5HLHA 4G94A 1ZRCA 2RGVA 1YHQI 3SFZA 2W57A 1OISA 2CFOA 4XL9A 2VB6A 1TQPA 2K4BA 3BCBA 1YS6A 2BY3A 3GZNB 3F8NA 1U8RA 2JSCA 3SDGA 4BQOA 2FBHA 5EDNA 4EJVA 5IYDJ 5K7ZA 2IS2A 1XGOA 2ZKZA 4DZPA 2EIMH 1VQ5I 2V6EA 3D5RC 4JP0A 5LBQA 3IWZA 1H9TA 1FT9A 2DK5A 3C3WA 3F8MA 1R71A 2UXNA 4BEHA 1YOVB 2CQQA 3QYFA 3A01B 2VC1A 4HSRA 3GTMJ 1SMYF 4HF2A 2DA5A 2P7CB 4G9YA 4ZDLA 4C9YA 4ZDOA 1V5GA 4FHTA 4L18B 2D1HA 3CJRB 2RV8A 1XSVA 2KLOA 3QP5A 5FROA 2MA3A 3FK7A 4IHSA 3K7AJ 4LJZF 2DODA 3EYYA 2E1CA 3S14J 5EJCA 3HRTA 4XRSA 1R7JA 3ZMSA 2IVMA 5D5XB 3OYCA 3HSRA 5D8LB 2ADUA 1Y1WJ 1BOAA 1NK3P 1HDDC 2P81A 2I8DA 3CCUI 3WODF 2CYYA 4AU7A 1MH3A 3BQYA 4BY1J 2O8XA 5GADJ 2P0WA 4OIOF 1FP2A 5J8FA 2EQRA 2DFEA 2BVMA 3OIQA 1ZG3A 5CVJA 1N75A 2NXNB 3CCQI 2E2HJ 4FX0A 3SHFA 1MJAA 3KX2A 5FRNA 1HKSA 3H9JA 3JCUC 3K1NA 3DBRB 2YX4A 1BJAA 2OCCH 3LAPA 1ITYA 1CQTA 2H27A 3FXUA 1IZ1A 3KYDB 3S3NA 2EA4A 1RKTA 4FT8A 4CHUA 1OYYA 2AXTC 2CV2A 1DP3A 1K4SA 2AXLA 3BY6A 3VODA 5C4XJ 2N8GA 3CUQC 3ZMDA 3VSKA 5JVGF 3LSKA 3FISA 5JI6A 4M3BA 2LVSA 1UHSA 4UUSA 2PJRB 1EH6A 3TDUC 1GVJA 2XAHA 2K3FA 1RUOA 2CMPA 3WGHA 1H0MA 3KZIC 3N05A 1ZN2A 2NVQJ 1HSJA 3S3MA 4N4OB 2CQXA 2VBZA 5TRDA 3GF2A 4D0PA 1W5TA 1MDMB 4BS9A 3E6CC 4IRGA 3F6OA 1SMTA 3LSTA 1OYWA 4MNUA 1TBXA 2Z5UA 3CMEI 3CJNA 1R00A 4DNCA 1JUPA 2WAFA 1RIOH 3BROA 1XPXA 2CG4A 5DM6F 5J1YA 1FYKA 3FWEA 2OTLI 4PDKA 4AYBA 2EV5A 2DO7A 3CC4I 2WY8Q 3OV8A 3HOYJ 2M8EA 3S17J 3K4JA 4E7KA 1E2XA 2JJ7A 2NYXA 2QLZA 3BG3A 4G7ZF 1DDNA 1XMXA 5K5OA 1R6RA 3DF8A 1I39A 4Y4RA 2XAJA 3DQVC 1BOBA 1AHDP 2F5FA 2L5QA 3QPSA 2LH9A 3H3ZA 2HPMA 1D5VA 4KN7X 2CUFA 3HSEA 1STZA 2RAEA 3AFHA 5CKTA 4Q47A 2VKVA 2M34A 3EDPA 3FBIB 1KYZA 3GBGA 2KDOA 3Q9VA 5AIQA 4UVCA 5H2FC 4IO9F 1GDTA 5E17F 2X51A 3F8FA 3CUQB 1X3ZB 5JHFA 5ED4A 2KRCA 3H35A 3E6DA 1DP7P 1NHAA 1Z91A 1EKEA 5HDNA 4R8HA 5KCMA 4HZFA 4XSXF 1FMWA 2MYSA 2DDAA 4YIRX 1P4AA 2NOGA 3K70D 5F1RA 1ZQ3P 4A3CJ 3WHBA 3GYHX 2EFOA 5E8GA 5F08A 3WHCA 1OQYA 4HNVA 2F4MB 2LKXA 3I4MJ 1EV7A 5F0CA 3LSIA 2O8KA 1J75A 1Y0UA 1IN4A 1T2KA 1YLFA 2K27A 4PGGA 2QBYB 3I5UA 4DYRA 4ENNA 1Z77A 3VB2A 5BQTA 1FOYA 1Z05A 1VF9A 4B1RA 3BT9A 2LG4A 3FBNB 3JSPA 4LLNA 1I6HJ 4UUSB 2VKHA 1R1VA 4RGRA 3RTRA 4HNUA 1FEXA 2LKPA 2KQRA 3M9AA 5EZGA 1G4DA 2IRFG 3IH3A 2IBDA 3BTJA 3PUBA 2HYJA 1Q1HA 3NARA 3SZGA 1QHHD 2E7XA 4KIFA 3JRCA 3GTJJ 2COBA 2FQ3A 1QVTA 5EYRA 3OSFA 1APLC 1LFBA 3H1CA 2UWMA 2BZTA 1ZRDA 5JVTA 3E0JB 4V2FA 2Y9YA 3KCCA 3KLOA 4WCGA 2BV6A 3ASOH 3F72A 1MMSA 1W5CC 3EPZA 3CD6I 3LFUA 1ZGJA 3G1LA 1T8IA 3ZRGA 2XVCA 4IKFA 2DJNA 4I76A 1YW8A 2LRDA 2FNAA 1TT0A 2HKXA 5ICEA 2DFFA 2XASA 2ZNYA 1UZCA 3A0HC 5EF6A 2X6YA 3ZCOA 2EPFA 5BOXA 1OR7C 1U9OA 3I0TA 3QPTA 3G4SI 1MIJA 5JR3A 4KT5C 2H1LA 2EILH 4OU0A 2ZJRF 2QSGX 4XR6A 2XSDC 2VC0A 3HB9A 3WTZA 1U6GA 5JHUA 3RZOJ 3QQAA 3ML6A 4LMYA 2WAQA 1RNLA 5HDGA 4XOTA 2W7NA 1GUUA 3BG5A 1U5TB 4I0AA 4AD9A 3GTPJ 5CQGA 2EB7A 2LK2A 4PJNA 3V7RA 2A69F 4WK8F 1D1AA 2R7OA 3ROUA 2Y2ZA 4GDFA 1Z67A 3BZKA 5HNHA 5J1RA 2COMA 1XD7A 3J81Z 5HS9A 1ZLJA 4I09A 3GFMA 1FBQA 1T39A 3QODA 2QWWA 2YSRA 5M5WJ 4KYWA 5D5UB 1VQLI 4G12A 1IRFA 1V55H 1E3OC 2V4JC 3CCJI 2E1MB 2VJIA 2MD0A 4IEJA 3I59A 3T0YA 3MQ0A 4FCYA 2ID6A 1S7OA 4HLYA 2L7MP 3MZHA 4GGGA 2GA2A 2GXAA 1ETQA 1WH5A 2AHQA 4W1UA 1LEBA 1JI8A 3BR1A 1QBJA 3OYKA 1BW6A 1I50J 5EG0B 3HRMA 4NC7A 3AL0B 3VOEA 2E34A 1CF7A 2HZDA 2XUBA 4Z6YA 4F92B 3O2PE 5F0FA 3FM5A 2L01A 1T98A 3WTTC 3ZMVA 4Z2YA 1UB9A 2R5ZA 2XPWA 5ILVA 2LD5A 1PDNC 2DXIA 4L9TA 5J3LA 3DU6A 1B9MA 3CMYA 1YFHA 3LSGA 3FXQA 4XM3A 2CJJA 4AM3A 4HG2A 1WSUA 3COAC 4J19A 3TGNA 3W6JB 3TDZC 1X3WB 3WTUC 2LKSA 2EFPA 1W5SA 3OS1A 2F5CA 1GV2A 5IY5H 3CCLI 4L9JA 2KMUA 2EFWA 2MH2A 3E6BA 1S72I 3ZQQA 3HOWJ 2YS9A 2ZFUA 3H9GA 1BA5A 1BI3A 1B72A 2Q0OA 5AIPA 4BJTA 4OMYA 3B6CA 3DEUA 3TMOA 3TOAA 3F6VA 3Q3SA 3FF5A 1BR2A 5HDKA 3D0SA 1S6LA 1UG2A 2IGOA 5LD2C 1LDJA 2A5YB 4EM2A 1H8AC 2VQGA 3W6VA 2ME0A 4FTHA 4RAYA 4D5FA 3GLLA 3F8BA 1RESA 3FMQA 2M2EA 4XRSG 1PP8F 2GM4A 4NHJA 3S16J 4P96A 4C2TA 2E2IJ 2JA8J 4PJ0C 4XLHA 1IXRC 3LQRA 2P5VA 5HLTA 4P1WA 2VN2A 2BE5F 3PSFA 4WX9A 4DW6A 1P92A 1MZBA 3HEFA 2OUMA 3DCFA 4UV9A 2WADA 3OY9A 4M9ZA 4UVBA 2OBPA 3RIRA 4IQJA 1TQIA 3R6SA 1HKTA 4KDPA 4A93J 2WV0A 1ULYA 2CQKA 4MQVA 2DT7B 3VFZA 4XK4A 5J6XA 2RQPA 3J7AY 1X58A 1A6IA 2K85A 3I71A 5FKMA 1UAAA 3I59B 2XKOA 1BIBA 2DOAA 3JRBA 2IA1A 4C2UA 5D5VB 3A4CA 1OPCA 1R5ID 4LFUA 2H8WA 1U9NA 1FYMA 2E1NA 2OF7A 4B43A 4HPQA 4HEA2 1MBKA 3UR3C 2DOEA 3K4CA 4ESBA 2DU9A 1MNEA 3L2UA 1ONVA 2HU9A 4CYCA 1VQOI 3HL2A 1CF7B 2F4OB 1WVRA 5C44J 4KFCA 2A07F 3VYRB 9ANTA 2FRHA 3IAM2 3L9FA 3TL4X 2VL8A 4D1QA 2O03A 4IF4A 4XLPF 2HXIA 4ZTFA 1O3QA 1R4MB 1MBFA 2DA7A 5L3DA 4CCJA 2R5ZB 2AQFA 2CWEA 3NWTA 3ZGKA 4BHPA 3CUOA 2ZMEC 2QCOA 3ONQA 2IA2A 2EK5A 3OYJA 1Z21A 2XGXA 3ERMA 3CJQB 4WXCA 3BR0A 3TEDA 1Z0XA 4P55A 3OYDA 2V9VA 4UY8I 5LRSA 5JFRA 4XNFA 1LPQA 2ELJA 2XF5A 2YX7A 2TCTA 1JGSA 3RZDJ 4M9SA 2DLLA 2M3AA 2VJ4A 5HS8A 3HOSA 1K4TA 4Q48A 2R7VA 1QPMA 2M87A 2CUEA 2JWTA 4YFXF 2DA6A 3LA3A 4PSXA 4MLOA 3CP2A 1DPRA 2JRTA 4PFPA 5LGTA 4OMZA 5D8KB 5TJJA 1VQ4I 1XB4A 4L0ZB 1FMVA 3SFIA 5KK1A 1OCTC 3CP8A 3CCVI 2CQ7A 4HDUA 3O8HA 2HOEA 5DYMA 4AUXA 3U1DA 2DTZA 4WF2A 1YRNA 2DFHA 3RPQA 5FKNA 2M4KA 3FMSA 4S0HB 4Q5SF 4GRIA 1S9HA 3RPUA 1LFUP 1XGMA 3A02A 3J7ZI 4ZTJA 1VQKI 1Z3XA 3GXOA 2NAZA 3MCZA 3AG4H 2JSPA 2IXSA 3NRVA 1TLHB 4IRIA 2B63J 3IHUA 4DBRA 3OS0A 4YEJA 4ZH4F 1D0ZA 4ZYAA 2DJIA 2YPRA 3ESWB 3HUGB 4U0YA 5D6FA 2OJED 5B5EC 1QZYA 2EH3A 2GWRA 1ETVA 5C4JJ 1RZ4A 3DPUA 4HAMA 5J4YA 4IHTA 4A3MJ 5GTHC 1E0EA 3K4BA 1UCRA 2VBYA 5JLWA 3A01A 3JREA 3CQZJ 2FXAA 3ZMUA 2KL4A 2VKEA 4A3IJ 5K7HA 4I7HA 2D5VA 2XAFA 5KNLA 2ZXWH 4RB1A 3FZVA 4A3BJ 2L7ZA 4CYCB 1OCOH 3U21A 2MABA 1BL0A 2K9NA 1D8KA 3K70C 1TZLA 3KZZA 5CPRB 3R0JA 2AO9A 2OU2A 3M8FA 3ZQGA 2PMZA 1MNDA 3FKIJ 2VLAA 1R5HA 2ACJA 4O5VA 1MMAA 1TQMA 3WGIA 2F48A 4IQ4A 3GEZA 1FC3A 4YIFA 1T0FC 2M7AA 4BL0B 1GT0C 4F52A 4BQAA 1J09A 4FX4A 3D5SC 3H36A 3QOEA 1YIJI 1VTNC 2QUFA 1LDDA 3L2VA 2VJJA 2FSWA 4XIDA 3GUDA 2GXGA 3PNVA 1H88C 1I6XA 1D3YA 2R92J 2KISA 1V5EA 4CXFA 2PJRA 4ZDPA 2BXYA 4U87A 4RB0A 2VJ5A 5EEGA 3JRFA 2PX9A 2K9LA 4OWRB 4EJOA 4XLFA 1FZPB 1W36D 4ZYEA 1YRNB 2M9HA 3LSMA 4IL6C 4RDUA 2OTJI 2KKOA 3GCMA 4YRVA 2ELHA 5IT9Z 3W6KB 3J7AO 4M3FA 5LLQA 4AIHA 2L02A 1XC5A 4EEFG 1FIPA 2FMLA 1AU7A 3TW7A 4XLNF 1R5GA 3S8PA 1TWAJ 1ETWA 2CO5A 3DU5A 3M1EA 4AC0A 5C3EJ 3U2RA 1QQIA 1W7PD 3HXLA 4UHTA 5ICCA 4HV6A 5HS7A 2HI3A 1DU6A 2PN6A 3CO7C 1KU3A 1FOWA 1W1WE 1X2MA 1JKQC 4BACA 1WI3A 1P2FA 3G71I 2STTA 3SEQA 3KZYA 4RAZA 3T8TA 1JT0A 2EIJH 2NVTJ 3BJOA 5FFZA 2W82A 1YO5C 4S04A 4KUMA 2V1XA 4BGDA 2EIKH 4A0XA 3I55I 2Z33A 4BE2A 3MKZA 5FLMJ 3EETA 1IN7A 1FP1D 3EQLF 4MO7A 1U78A 1DGRM 4LG3A 1T08B 1HSTA 1RKWA 4QLCU 3F0CA 4GYIA 5IOYA 3TO7A 4A5NA 4M9XA 1MNMC 3W3CA 3OIPA 4QPOA 2VKDA 3CUQA 5CVIA 2W84A 3J80Z 3OYHA 2PEXA 3DBHB 1A04A 1DUXC 4A3GJ 1WCMJ 3ZMTA 1SFEA 2NVUB 5K5QA 4RGSA 3V42A 2FF4A 1D1CA 2XV4S 4NBQA 5B3SH 4E7SA 3BR2A 1D8JA 2R7QA 4QTRA 4GXOA 3OYIA 2F5DA 1G6NA 3KEYA 1ETKA 1KA8A 3BC8A 4FETA 3KETA 1EF4A 4Y7NJ 2DT6A 2WAQN 1S7AA 2ZXJA 3IH2A 2QBYA 2H94A 2RNGA 4ENMA 1MD0A 1BI0A 5LEJA 1KGSA 2Y0SA 4LGWA 4JYKA 2KZGA 1R9TJ 2L3DA 4UVAA 1TC3C 1B9NA 3SEZA 2FX0A 2FNPA 2FOKA 2K3PA 1FWZA 3GFJA 4I2OA 1XCVA 3SYTA 1WJBA 4M3DA 3A03A 4EM0B 2V1UA 1IO2A 4CSWA 2EV0A 3Q5FA 1ON2A 2HOAA 1B59A 2O9LA 2AS5F 2ISYA 3L2RA 2ZJPF 2K9SA 4EM1A 4RA2A 1ACIA 4PZJA 2L9VA 4A0YA 3E5QA 3KPHA 2DFIA 2XC7A 3DEEA 1IGNA 2R3SA 5E3MA 1TNSA 2VE9A 1YW7A 1SAXA 4C30A 4JX5A 4IOCF 2RN7A 3IH4A 5H20A 2BYVE 4II2A 5FD5A 3DTEA 2GLOA 1BM9A 3H3UA 4HBLA 3KYLA 3G3ZA 1JE8A 2JA2A 3HPGA 3CF5F 4CCOA 1AA7A 3S1RJ 3K69A 2OC6A 4UUTA 4HX8A 4GFBA 4BHBA 2WTEA 2RREA 2V9KA 3WTSC 2JTVA 3F22A 4X1EA 3OL4A 3IAS2 1HW2A 3Q9SA 3CTAA 4BBRJ 1USSA 5KAFC 1RI7A 2A6HF 2ELKA 3HOXJ 3FDYA 2F2EA 2QQBA 3WTYC 2P6TA 3HDDA 4E7LA 1SVLA 4RM2A 4ABZA 4XOPA 4E6KG 3OR1C 3VWBA 2MD5A 4UNOA 5FLXK 1U5TA 1Z6TA 3GMEA 4BAYA 4IXAA 4BNCA 4CCMA 3PUFA 1Z9CA 3DP7A 4UB8C 3S15J 1ORKA 4JX6A 5A2QK 2BW3A 4IOAF 1POGA 1HF0A 3WE2A 5M5XJ 2UXXA 2CV0A 4IHVA 2PMUA 3O8GA 2Y9ZA 3ZPLA 1MJBA 3DTKA 4OINF 1YQAA 2X6XA 3ELKA 5E1WA 3KEQA 2FD5A 3OMYA 4BXUA 2E19A 3J7YJ 1I5ZA 1YYVA 5J40A 3ABMH 4C3JJ 1JHHA 2DYSH 2RKHA 4LLLA 2E35A 2L4AA 3HG9A 1X1BA 2EA2A 4AIDA 5DS9A 3LSJA 2XPVA 4MGRA 2DQLA 1LJ9A 2FMYA 2Y69H 3RPUD 2DW4A 2RQQA 1A36A 3ZMZA 5EG0A 1N77A 5H6RA 3MAJA 1RPWA 3IRRA 2KP6A 2KT0A 3X2QH 5D5WB 1K61A 3EUKL 3ECHA 2K9MA 4V2GA 2LBFA 4B47A 2ZNZA 4MFDA 2BY1A 1K78B 2JMWA 1OR7A 1XTAA 2G7HA 2CFXA 3E3VA 1J59A 1T33A 2X1CA 5FD6A 2HTJA 5AONA 1F9NA 2HVSA 3DTIA 4BE1A 1N78A 3K4KA 4YELA 3WTVC 2CGPA 5CJ9A 2X4HA 1LKXA 4XLAA 4BYYA 1IN6A 3BQZA 4XBFA 2TDXA 1V54H 1WQ2A 4B44A 1FIAA 1J5YA 1S5LC 3PFIA 3MKWB 4X0GA 4ENKA 4BUPA 5F0HA 2K5CA 3BJAA 3SXYA 4EJTA 3W2VA 2WAEA 3QPLA 4KISA 3LWFA 1ODDA 2ZXIA 1OJLA 4A12A 2H09A 1FYLA 5FJ8J 2ICWG 3JW4A 2FOWA 1QZZA 2OD5A 1ZR4A 4A3DJ 2OQGA 2QZ8A 2P8TA 1GHCA 3JRAA 1B4AA 1D0YA 3CDHA 4PJMA 5TGTA 2IGNA 4RLFA 3GWZA 4DGWB 3OSGA 4HDVA 1YTYA 1FLIA 1EA3A 3OYGA 2L2OA 2DCEA 4Q4ZF 4IRHA 1S8NA 2EV6A 5J47A 3B73A 3D5LA 1UFMA 2BW3B 4D7NA 1KQ0A 4F93B 2QEXI 1TWCJ 3P9CA 4H4KC 3UNGC 1Z7LA 2MC3A 1KQ8A 2KIUA 5DUIA 3LQQA 4LB6B 3PIOF 1Z1DA 1LDKB 2GIVA 2MG4A 2XKPA 3PNTA 1Y0NA 2ECBA 3QU3A 4A0ZA 2XAGA 2Y75A 4MEXF 4RGXA 4WXHA 2V79A 3DPTA 4BBSJ 2MFZA 4XLCA 2F5EA 2DA2A 2QQ8A 3REOA 4EJWA 2FJ1A 2PFBA 1SEUA 3OYFA 2CH0A 1IN5A 2GXBA 3L7WA 1OFCX 1GVDA 2HYGD 2LBFB 1LEAA 2BOLA 2WV1A 4ZYHA 2OCEA 4C3HJ 3MKLA 1IRZA 3BLYA 2WC2A 5F6FA 4M3GA 3KLNA 1UHMA 2XROA 4FISA 3TOBA 1IC8A 2QF7A 2HOSA 3P9IA 5LEKA 4UUVA 1TNTA 3NWSA 3PM1A 4OIQF 1OCZH 1XSXA 2HQNA 3M1CA 4JX4A 3BPVA 3GX4X 2R5YA 3HBLA 5IT3A 2EFNA 3G1OA 2LC2A 2MLKA 4HYEA 6PAXA 3S93A 2L9SA 2W4SA 1VQ6I 1RRJA 1O3SA 1AKHA 4N9IA 2DA1A 3FXRA 3RQ4A 3FXJA 2E7WA 1R22A 2JK3A 2WB1N 3QYBA 3W2WA 1W36C 1G3YA 1OCCH 5DCMA 1QA6A 2JZYA 2DYRH 2L9NA 2PMZN 4DIQA 4YG2F 2LF8A 5D6EA 1X19A 3CESA 2VT2A 2STWA 3HOZJ 2IAIA 3ABLH 4Y3OA 2XIGA 3S1NJ 3WU2C 5FRMA 4OOIA 1FJLA 4BH9A 3DBLB 3DKYA 3U1KA 3QRFF 3K6GA 1R1TA 3CCEI 1GXPA 3I54A 1QPIA 1JKPC 2VOPA 2OZUA 3QP6A 3CCYA 3CDLA 3PNYA 4N9HA 4CO8A 4FASD 5EEAA 1JHFA 2HYFA 4WWCA 2A3SA 1VQ7I 4Y33A 1BBYA 4BE0A 2XDVA 1P7IA 4L5IA 5HOOA 1U0JA 1QGPA 2VPRA 2BVLA 2HFHA 4BDZA 2K9QA 2WWYA 1BI1A 3NQOA 3QYEA 3HUGA 3TKYA 2ZMEA 4MIMA 4NQWA 3FHZA 1YE9A 3TP3A 2VQHA 4G8XA 3OOPA 2CUZA 1YX5A 3ABUA 2VE8A 4BY7J 1WJFA 3OOUA 5BS6A 3RKYA 2RDPA 2HR3A 2QSFX 5E1ZB 3BG9A 3FIWA 4FE7A 2A6EF 2ZFWA 3BZ6A 3HIFA 4F7ZA 3M7GA 1AWCA 1XGNA 4N4NB 4XKWA 2DMQA 4P9UA 4HW0A 2I10A 4HA8A 3ZQFA 3G73A 3HYIA 4HX4A 4I01A 1ZRFA 4UXNA 1ON1A 1Z7UA 4GYGA 5CVRA 4S05A 2A61A 2XAQA 3RCOA 5IPAA 2LLKA 2X6WA 4YFKF 4M74A 2JA5J 1P6RA 1XCBA 2R7XA 1ZKGA 4QIWN 1R58A 3DPLC 4JQFA 2L7FP 1TP4A 2MH9A 4NNJA 2DAOA 2BHZA 1BC8C 4ASNA 5LRRA 4ZYDA 3NEUA 4A3KJ 1OYIA 5L3EA 2IA0A 3E5XA 2NNNA 3SQNA 1BC7C 2R5YB 3LNQA 3SJMA 1DQUA 4M3EA 1S7EA 3OYLA 2ID3A 3K4LA 5LHIA 5ICFA 1AKHB 1F43A 3FK6A 2ISZA 5M3FJ 3MN2A 1T56A 1WJEA 3ZN1A 5DTDA 3VYUB 4RGUA 1UJ8A 4RAFA 5DCMB 3F8CA 5EEHA 4I0BA 4XQFA 2B0LA 2R93J 1JUMA 5HLGA 2OPTA 1A5JA 1QHGA 4A6EA 1VQPI 2L4MA 3KP3A 3FX3A 4BQNA 1FTTA 2GOXB 2W00A 4V19K 4E7IA 1ZLKA 4KNYA 2VUMJ 3BG7A 1MKMA 4AVPA 5KVRA 1YX3A 2NNYA 1ZG1A 2ESNA 4CCNA 3OS2A 2VQLA 3V8JA 2KIMA 3WTWC 4J00A 2DA4A 1NH3A 5BPDA 4DBQA 1XGSA 4XKVA 2L0KA 5FKOA 3RKXA 2Z3YA 2EBIA 1WH7A 1DU0A 3PFYA 3K9TA 2L7KA 2XPUA 5EZHA 1GV5A 3M4OJ 4RLQA 4D9JA 3V8LA 3T8RA 4CA0A 3AG2H 3CCMI 2BGCA 3PL8A 1YJWI 3WE3A 1JUSA 2PBIA 5KAIC 3EUAA 3FXOA 2VQCA 2Y0SN 3I9V2 4ESJA 1BI2A 3LA7A 4QWQA 1YIOA 1P7JA 1IRXA 2W48A 4U88A 3HTSB 4MTDA 3DEWA 5DUKA 2HTSA 5J1UA 5IYCJ 2H1KA 2ZMEB 4NQWB 1F36A 2O3FA 3ABKH 3CCRI 2ZCWA 2ZBKA 3MKYB 4IX7A 2HOTA 2IS4A 1F1ZA 1B6AA 1T0FA 3F9KA 2M0MA 1HC8A 2CU7A 2IGKA 3Q0VA 3BCAA 1IW7F 2DDBA 2GBYA 3IC7A 2R7ZJ 1UMQA 1I27A 2DMNA 4OAZA 1WZ2A 3I56I 1XX5A 2LNBA 2ZJ2A 1LE8A 1R4NB 3KYCB 2MGQA 3MEXA 3CZ6A 1QNTA 2WB1A 1ZGAA 2A68F 2NVYJ 4OIRF 2R7TA 3HRUA 3BZCA 3T1BA 1ZGWA 1FPQA 3KP4A 1K79A 2DPDA 1AOYA 4FQGA 2PG4A 2E36A 1GLNA 3C7JA 1HA8A 1CGPA 1X1AA 1SFKA 3CO6C 5TISC 2AQEA 4I6ZA 3GTQJ 1WJCA 4F3QA 1IV6A 1IF1A 1VQNI 3H5NA 2VPLA 3EUHC 1XMAA 2YU3A 4BDYA 2EINH 4IJAA 3CDIA 3LOCA 3BR3A 5L3CA 1BN5A 2Z99A 4Y13A 3A1YA 4U0WA 2WY7Q 3MFKA 2KIQA 1P4WA 1NTCA 3VSLA 4O3MA 3BWGA 1Y6IA 2W25A 1JT6A 5E1XA 2E71A 2LMDA 3GTOJ 3IWFA 1HLVA 2K02A 2XB5A 1S29A 1MBEA 3BP8A 1B8IA 3P7NA 1N25A 2X0LA 3IUOA 2HQ5A 1X1PA 3WG9A 4E7HA 1IDZA 2KZVA 2IT0A 2IW5A 2PQ8A 3GFIA 3BDDA 5B66C 1W0TA 1ENHA 1XN7A 4KMFA 1SFXA 3PO3J 1Q1VA 4MTEA 1LUJB 5E18F 2J5PA 1ERDA 3ZQHA 2M45A 2FQ4A 4ANJA 1BR1A 3TP0A 4CUGA 4KMUX 5FLVA 2BEOA 4DYCA 2HPIA 4I02A 4DYQA 2H6BA 3GFLA 1Y56A 2CUJA 3P5JA 2Z1DA 5K5RA 1Y1VJ 2IGMA 3E7LA 3ECOA 2W1OA 3F3XA 2BXZA 1FOXA 1R36A 4EATA 3OYMA 1EH8A 3CMAI 3S1MJ 2D45A 1MMNA 2OAZA 1MMDA 1ZK8A 2IPQX 2X6OA 4DOZA 5HVQC 3K1PA 1FY7A 1WKMA 2E1OA 2JUGA 4PUSA 2A6TA 1OKRA 3RSNA 3LSRA 3ZN0A 1LE8B 1LVKA 3M3YJ 4A3FJ 5GPCA 3GZ6A 4BXXJ 3GVAA 2O0YA 4CH7A 2DI3A 1JKRC 3I64A 1X3UA 1FBSA 2X85A 4PJLA 3H3VK 1HDPA 4KN4X 4R79A 1QRYA 2V1DA 1BR4A 2V6CA 4XORA 1TL8A 2CS3A 1MBJA 4A3JJ 1MMGA 4LITA 4IZZA 1H89C 2KDZA 4U0VA 4BQQA 5E3LA 3MVPA 4G6TB 4IVNA 3H5AA 1SVOA 1X2NA 5ILUA 4IHXA 1YI2I 2Y31A 5DD8A 4EMSA 1QU3A 1VZ0A 1V5FA 2VBXA 3H9QA 4ITVA 3FMRA 3CF2A 1JXSA 1SD5A 2JA6J 4RM3A 3L2CA 5CLSA 3O3KA 1V3FA 5K7FA 5GP9A 3ZQ7A 3GO5A 2XGEA 3FXMA 3RYPA 2L54A 2RC4A 1WFXA 2ZJQF 1FX7A 2VIXA 4B4CA 3HGYA 3KIOA 1WWXA 2HWVA 1TTYA 3LA2A 4C3IJ 1SC7A 1K78A 1B8IB 3BR5A 2KJBA 2QQAA 4KJZA 2KPMA 3BOQA 2IJLA 2R7DA 2GOMA 3WTXC 4CGZA 1ETYA 4CICA 3KP2A 2ECCA 1W0UA 1BIAA 4G7HF 2FU4A 1B1BA 2GAUA 4JBAA 5BMZA 3K4NA 1IUFA 3JAMZ 3FXKA 2R7SA 5KHDA 3TQNA 1K6OA 3JSOA 4B8XA 2YUSA 3V7SA 3ZQLA 1FBUA 2Q2EA 1P4XA 3KP7A 5E79C 2NRAC 4R1HA 3HHHA 4L5EA 2O5RA 3EYIA 3DXJF 3VYSB 2EWNA 5E8IA 1OCRH 4HSTA 4XN3A 2CV1A 2UV1A 2BY0A 4L9NA 1FNNA 3HPHA 4IHYA 1J9IA 2Q1ZB 2LTPA 2V9PA 2XRNA 4H0EA 1QVUA 1D0XA 1YW9A 5K1YA 4HRIA 3CLQA 3RKQA 3BR6A 3J81K 4DZJA 4FE4A 1G3WA 1YJ9I 2BY2A 3M8JA 1PUFA 3K1MA 5ILSA 3LAJA 4ETSA 1O7FA 1L3LA 4HQMA 4D7MA 2M4GA 4L0YB 5DEQA 2VI6A 3I58A 5JLXA 5CVUA 1LFPA 3C18A 4Y52J 4ENJA 4PFOA 4BEHB 1J0RA 1HKQA 2PJPA 2XRLA 5L3GA 1T38A 4B3XA 2DMTA 5E3NA 2VASA 4AVZA 2VXDA 2PI0A 3K0LA 2LYCA 3LMMA 4B09A 1ZG5A 3TW6A 2BHYA 4E70A 1EJ9A 4K2EA 2G0EA 3G1MA 2I5UA 5E20A 3ZQIA 1R49A 4CZZA 2EZLA 4GO1A 5LFAA 1F4KA 2CW0F 2EJRA 2EZHA 3M07A 2KIFA 4M6YA 3BG6A 1YS7A 4ON0A 3OYBA 2K86A 4RS8A 4CCLA 2HDDA 2R4GA 3I4NJ 2Y0MA 5CVVA 3BTCA 1KU9A 2FBKA 1XG1A 2IS6A 2V26A 1OMIA 2F6CA 3C2HA 3HOTA 1PVEA 2ETHA 1W4MA 2E60A 2HDWA 2HVQA 2W24A 4WXDA 2OA4A 5GAGJ 2G7UA 2IP2A 1U5TC 3NAUA 3U9GA 3JRDA 2FBIA 1XDUA 3LSPA 2PMHA 4YIIA 2JN6A 5FFXA 4YFNF 1OCPA 4P5OA 2R7WA 3I53A 1KU2A 2LDUA 2Q2EB 2NS8A 4B3AA 1HBXG 4KIBA 3KE2A 3ZR8X 3PQJA 1MW7A 1BW5A 1WJDA 1TWHJ 5F04A 4CDGA 3S2WA 4ZYGA 2JA7J 1IRGA 1S3JA 4EVIA 1ZH5A 1XMKA 3ZXSA 1D1BA 1Y8QB 1Y39A 4KA4A 3RQIA 2E1MC 1VQ8I 4KIGA 5ICGA 3KFWX 2D1VA 1G2HA 1SAUA 1ZELA 1ZHFA 2K7LA 4XN0A 5GAEJ 3S3OA 3TO9A 5FO5A 1FSEA 5IP9J 1T6SA 1IG7A 3DWLE 5DV5A 3ULQB 1D5YA 4LB5A 3GTGJ 4D5CA 3OR2C 5LGNA 5B1BH 3C2BA 3AL0C 5BPIA 1PUFB 3F23A 1V4RA 1WRJA 3C2GA 4OIPF 1QZEA 3QWLA 4UB6C 1HW5A 1J2XA 4ZZDA 4LK1F 3HGGA 2Y30A 3CLOA 5M5YJ 2PLYA 2QVOA 3JTGA 5L3BA 3CC7I 4CZCA 5DD4A 1WPKA 3K2ZA 1M1EB 3R60A 3WGGA 3IKTA 2X1EA 3IKVA 3OWTA 3VYTB 1WJAA 3MMYB 3MWMA 5IOZA 1K6YA 1WHUA 2JVHA 2L9RA 2M5WA 3H92A 2E2JJ 3G2BA 4RMNA 3QU6A 3V4GA 2HQAA 4HF1A 4XKBA 3S2DJ 1XDSA 1WGXA 4NC8A 1IDYA 3F21A 1I3QJ 3IV5A 4LLGF 2VT3A 3HTUA 3V7CA 1XSDA 3SDBA 4HLXA 4QSHA 3TO6A 5EGOA 3R0AA 2B9SA 1PUEE 3SZTA 1LVAA 4LIUA 3UKGA 5GPAA 3SZPA 1X1DA 3BPXA 1UHWA 4C2MJ 3PIPF 5DM7F 2QM3A 5ERIA 3FM3A 2MSYA 3HKZN 1ZREA 4RB2C 3JRHA 1PP7U 3HM5A 1VQ9I 2XB0X 4KITB 1NG7A 4MEYF 4U7BA 3W2AA 2HZTA 2LSOA 5M3MJ 2DOFA 3LFKA 4E7ZA 5FLXZ 1HCRA 5E3OA 2FA5A 3B02A 3BJ6A 4PJJA 2O7OA 1EH7A 3C1DA 3IRQA 2LOOA 2QA4I 1IXSB 1HW1A 4EGZA 5A2QZ 2J5OA 5DDGA 2JPBA 1A35A 1Z6RA 2DMPA 4HNTA 1FOKA 4O6JA 3AKZA 1P9QC 1JTYA 2V1NA 4F91B 5J4VA 4EGYA 3I3LA 1W7PA 2DN0A 2VOOA 3VPRA 3PSIA 3LSHA 1ZARA 2A5WA 3KEOA 2YR2A 2CRGA 4E7JA 4LIVA 2JPCA 2HVRA 2JT1A 2HQRA 2RNJA 4NDLA 2Y48A 5F1JA 3PQKA 2DTRA 1JGGA 1SFOJ 2NS0A 4M6VA 2F5VA 1PYVA 2EZIA 3GW2A 1DGWY 2JVGA 5D4SA 2GZWA 2X9DA 1O3RA 4MQ9F 5LHHA 1G3SA 3L00A 1L0OC 1R1UA 4A2UA 1BJZA 3E1SA 2OV7A 2MC4A 1I3AA 1REPC 3BTIA 1K7AA 1FSHA 5GTIC 1K83J 1RC9A 3K10A 3CMMA 4TV7A 3P9KA 3RYRA 1I1GA 2X1DA 4BJ6C 1O4XA 2R7UA 2F4IA 3HOUJ 2LR8A 2DBBA 1DPUA 4II3A 2NVXJ 3MZ8A 2DPUA 1UG0A 2M8GX 4MHGA 4RAGA 2H6CA 4G6QA 3KP6A 4PCQA 2V7FA 2Z9OA 1A6QA 2P4WA 2IEKA 2OQRA 4UV8A 1VQMI 2QQ9A 3FXLA 1OLTA 2QKMB 3ZP5A 1JJ8C 4IPAA 4PK4A 3QPHA 4AIJA 4LOCA 5DCFA 3ASNH 3DV8A 1E3PA 1LB2A 4JOMA 4NUBA 5IYBJ 1WI9A 2BBYA 1JKOC 2ESHA 4G6DA 4ESFA 2DK8A 1HQCA 3CC2I 1IUYA 5EGOB 2WBMA 4XONA 4A5MA 2M0CA 4HOBA 1RR7A 2VONA 2KRFA 1RETA 2HNHA 3Q0WA 1IV8A 1TT5B 2MLGA 3GZ5A 2RVCA 5F27A 1TW2A 1TW3A
chains in the Genus database with same CATH topology
4BXFA 3L2RA 2XF6A 4XR6A 2ZSIB 3A1YA 3DEEA 2WY7Q 2XC7A 4C30A 3VSLA 2WAQA 1Y6IA 4XOTA 2W7NA 3L2QA 4II2A 3DTEA 5CQGA 4PJNA 3KYLA 2E5ZA 1D1AA 2JA2A 2R7OA 3HPGA 5HNHA 4CCOA 1AA7A 3DKXA 2OC6A 4KT6A 2RREA 2V9KA 3IUOA 4E7HA 2KZVA 2E5NA 3QODA 3OL4A 3IAS2 3FDYA 2QKLB 2NOJB 2IS1A 3H5RA 3VDXA 2V4JC 2E1MB 2VJIA 4E7LA 2MD0A 4DJAA 4RM2A 1ERDA 4XOPA 4E6KG 3OR1C 3VWBA 4B48A 1BR1A 4ANJA 4CUGA 2R7RA 4J01A 2HPIA 4CCMA 1JI8A 3LL7A 2LY2A 3OYKA 2WA0A 1Y56A 2CUJA 2BW3A 2Z1DA 4NC7A 3AL0B 2IGMA 2HZDA 2CV0A 2W1OA 4F92B 3A2KA 4EATA 3OYMA 3OYEA 3FKJA 2CW8A 1MMNA 3DTKA 1MMDA 3HKZA 2CW7A 2X6XA 4DOZA 3MD2A 5HVQC 3OMYA 2DXIA 4QPQA 2JUGA 4PUSA 2A6TA 3DU6A 3FHNA 3L2WA 3RSNA 3K4MA 3LSGA 1LVKA 3HG9A 2XSJC 1X1BA 4XM3A 2Z2SB 4HG2A 4CH7A 2M7BA 1X4OA 3RPUD 3H0DA 2RQQA 2X85A 3OS1A 4PJLA 1N77A 4R79A 2KMUA 2KP6A 1BR4A 4XORA 3ZQQA 2ZFUA 3H9GA 2CS3A 3EUKL 2K9MA 2LBFA 4BJTA 3TMOA 1MMGA 4LITA 4B47A 4IZZA 1G59A 3S32A 2KHMA 4BQQA 2ZSHB 1BR2A 4G6TB 3H5AA 2IGOA 5LD2C 2X1CA 2VQGA 4XKCA 2HVSA 2Z16A 4ZC3A 1QU3A 4OAYA 3DTIA 1VZ0A 4BE1A 1N78A 1V5FA 3H9QA 4ITVA 3K4KA 4YELA 4CCKA 3CF2A 4BU2A 3PJRA 1LKXA 4XLAA 4RM3A 4C2TA 4XLHA 5HLTA 4P1WA 1G8XA 2LY1A 3HC7A 3PSFA 4B44A 2OUMA 1WFXA 3MKWB 4X0GA 2VIXA 2WADA 4BUPA 3OY9A 1PJRA 2K5CA 3DLAA 3W2VA 2WAEA 1WJ5A 4KISA 4IQJA 1UELB 2ZXIA 4KJZA 2KPMA 2XF7A 2GOMA 1KONA 1Z3YA 2DT7B 4BJ5C 2LREA 4E4HA 3K4NA 3J7AY 2VXZA 2R7SA 5KHDA 4ZJZA 1UAAA 1D0YA 2UUZA 2DOAA 4PJMA 5TGTA 2IGNA 4C2UA 3A4CA 5HNFA 4RLFA 4DGWB 1EA3A 3OYGA 1X1CA 2L2OA 2O5RA 2DCEA 4B43A 4HPQA 4HEA2 3VYSB 3UR3C 3OYNA 3K4CA 4HSTA 4XN3A 1MNEA 2BW3B 3D5LA 4F93B 3L2UA 2HU9A 2CV1A 2UV1A 5CQEA 3HL2A 4H4KC 3UNGC 1X4PA 1Z7LA 3HPHA 3VYRB 2Q1ZB 3IAM2 1D0XA 3TL4X 2VL8A 4D1QA 4ZTFA 4HRIA 1LDKB 4XMYA 1NG6A 4CCJA 3PNTA 2AQFA 2ZXHA 3NWTA 3OL3A 3ZGKA 4F55A 3M8JA 3ONQA 2XAUA 3OYJA 1Z21A 3DPTA 3CJQB 2MFZA 4XLCA 1T95A 3OYDA 3IP4B 2M4GA 4XNFA 1LFPA 2ELJA 4XLEA 2XF5A 4PSWA 4PFOA 3OYAA 2KRHA 2M3AA 2FUG2 2VJ4A 3OYFA 3HOSA 2CH0A 3TBIA 2R7VA 4BEHB 4PSXA 4B3XA 2LBFB 4MLOA 2BOLA 2CFOA 4XL9A 2VASA 2VB6A 3BCBA 4AVZA 3CP2A 4PFPA 2VXDA 2LYCA 3LMMA 3BLYA 4BQOA 1FMVA 2IS2A 3CP8A 3NWSA 2V6EA 3M1CA 5LFAA 3D5RC 2M4KA 3BG6A 3OYBA 4CCLA 2LC2A 3S93A 2L9SA 1S9HA 2R4GA 2W4SA 4GRIA 4BEHA 3QYFA 4HSRA 3RQ4A 3QYBA 4ZTJA 1W36C 3W2WA 4ZDLA 1Z3XA 2V26A 4C9YA 2IS6A 2F6CA 4ZDOA 1V5GA 3C2HA 3HOTA 3CJRB 2JSPA 2IXSA 2KLOA 5FROA 2E60A 2HDWA 2L9NA 2HVQA 4DIQA 4DBRA 3OS0A 4YEJA 1X19A 1D0ZA 4ZYAA 3CESA 2DJIA 3HUGB 4Y3OA 5FRMA 3OYCA 3DPUA 3DKYA 4P5OA 3K6GA 2R7WA 2I8DA 4AU7A 2Q2EB 1E0EA 3K4BA 3ZR8X 1MW7A 2P0WA 3PNYA 4FASD 1WJDA 2KL4A 4Y33A 4BE0A 2BVMA 3ZXSA 1D1BA 3OIQA 5KNLA 1N75A 2E1MC 2XDVA 3KX2A 5HOOA 1U0JA 5FRNA 3H9JA 3U21A 2MABA 2BVLA 4BDZA 1SAUA 1ZELA 3K70C 1TZLA 4XN0A 3S3OA 5CPRB 3S3NA 3QYEA 3DWLE 2CV2A 1YE9A 1DP3A 2PMZA 1MNDA 2VQHA 2VLAA 2CUZA 1YX5A 3VSKA 3LSKA 3OR2C 1WJFA 3OOUA 1MMAA 3AL0C 2PJRB 4IQ4A 3C2GA 2CMPA 3N05A 3S3MA 4N4NB 1T0FC 4N4OB 4XKWA 2M7AA 4BL0B 4CZCA 4BS9A 4F52A 2X1EA 3OWTA 3VYTB 1WJAA 1J09A 3MMYB 1K6YA 3D5SC 3QOEA 2JVHA 3G2BA 3RCOA 4RMNA 3L2VA 2WAFA 2VJJA 2X6WA 2HQAA 4XKBA 4AYBA 2R7XA 4NC8A 4JQFA 3DPLC 2WY8Q 3PNVA 4NNJA 3SDBA 3K4JA 4E7KA 1V5EA 2PJRA 4ZDPA 4U87A 2VJ5A 4LIUA 4OWRB 2K9LA 1X1DA 1R6RA 4XLFA 4Y4RA 1W36D 3DQVC 1DQUA 1BOBA 3LSMA 3OYLA 2L5QA 2LH9A 3W2AA 4KITB 4YRVA 1NG7A 4U7BA 2HPMA 3K4LA 4E7ZA 3AFHA 5CKTA 4PJJA 1WJEA 3S8PA 2LOOA 3VYUB 3FBIB 3DU5A 3GBGA 4XQFA 1QHGA 2KDOA 4BQNA 2X51A 3HXLA 4HNTA 2GOXB 2W00A 4E7IA 3AKZA 1P9QC 5JHFA 2V1NA 3BG7A 4F91B 1YX3A 2KRCA 3I3LA 3H35A 4CCNA 3OS2A 2VQLA 3PSIA 3LSHA 4BACA 4J00A 2A5WA 3SEQA 4DBQA 4XKVA 4E7JA 4LIVA 5KCMA 2HVRA 1FMWA 2MYSA 2W82A 3PFYA 2L7KA 4BGDA 4RLQA 2F5VA 4D9JA 3K70D 1PYVA 4BE2A 4CA0A 1DGWY 3MKZA 3PL8A 2JVGA 1DGRM 3LSIA 4LG3A 3EUAA 2VQCA 3I9V2 3E1SA 2OV7A 2MC4A 3W3CA 1IRXA 3OIPA 4QPOA 2VKDA 3OYHA 4NQWB 3K10A 2LG4A 3CMMA 3FBNB 3MKYB 4IX7A 2X1DA 2IS4A 3V42A 4BJ6C 1D1CA 2R7UA 2VKHA 2F4IA 3F9KA 2M0MA 3RTRA 4II3A 2IGKA 4HNUA 4E7SA 3BCAA 2KQRA 1UG0A 2R7QA 3OYIA 3KEYA 3BC8A 3PUBA 4FETA 3SZGA 1QHHD 4OAZA 2V7FA 3CZ6A 2WB1A 2UWMA 2DT6A 1OLTA 2QKMB 3E0JB 2R7TA 2RNGA 4PK4A 2Y0SA 4JOMA 4NUBA 3EPZA 3LFUA 3ZRGA 1GLNA 3SEZA 1HA8A 2WBMA 4IKFA 4XONA 2K3PA 2LRDA 1TT0A 1X1AA 3SYTA 1SFKA 1WJBA 2AQEA 1WJCA 4F3QA 2VPLA 3H5NA 2HNHA 3EUHC 4CSWA 2X6YA 4BDYA 3ZCOA 1OR7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPO A;  1DP3 A;  4QPQ A;  3OMY A; 
#chains in the Genus database with same CATH topology
 1J7K A;  4HF0 A;  4BXF A;  5LHG A;  1JJ6 C;  3WU1 B;  2HDC A;  3HOV J;  2XF6 A;  4XSZ F;  1YG2 A;  2ZSI B;  2GQQ A;  2QEN A;  2JRM A;  2R0Q C;  5L3F A;  3GTL J;  2MW8 A;  5FB2 A;  1VND A;  3JRI A;  3L2Q A;  4BKX A;  2JUC A;  4EV0 A;  1LNW A;  4EQQ A;  2E5Z A;  1ZYR F;  1YIT I;  3ZOB A;  4LG0 A;  4M73 A;  1UST A;  1ZTR A;  5GAH J;  3DKX A;  4LD5 A;  2HKO A;  1W7P B;  2P5K A;  3AAF A;  4KT6 A;  1MBG A;  1VI0 A;  1Y8R B;  4W97 A;  2E5N A;  5F64 A;  2CQN A;  4CYD A;  1RUN A;  2HS5 A;  4HX7 A;  1IAW A;  4L9V A;  2EZK A;  3HJE A;  4HV5 A;  2QKL B;  2NOJ B;  2IS1 A;  1MH4 A;  3H5R A;  4M72 A;  3E5U A;  3DLL F;  3VDX A;  1SD7 A;  3JTH A;  4M71 A;  2A05 A;  3R61 A;  3QOP A;  4DJA A;  2P6S A;  2KFD A;  2ME6 A;  2M1B A;  1G3T A;  3ZQC A;  4B48 A;  5IT9 K;  1KYW A;  4L5J A;  2R7R A;  4J01 A;  1U8B A;  1HOM A;  4LK0 F;  4XIC A;  4NC6 A;  1ETO A;  3HHG A;  1RR8 C;  4N0B A;  3G6E I;  3ISP A;  3LL7 A;  2LY2 A;  3GLX A;  3OIO A;  2R7F A;  2B7E A;  2P5L C;  2WA0 A;  3RDI A;  2DT5 A;  2G9W A;  4A69 C;  2XHK A;  1MSE C;  1B72 B;  3A2K A;  4MFE A;  5HLI A;  3OYE A;  2M30 A;  3FKJ A;  2CW8 A;  3HZJ A;  2GIZ A;  2X48 A;  3HKZ A;  2XGD A;  3K2A A;  2CW7 A;  2D2W A;  1KQ9 A;  2QGU A;  2ZO4 A;  4XRF A;  5HOD A;  3MD2 A;  1FTZ A;  3BTL A;  4RBO A;  4QPQ A;  1KU7 A;  1ZAO A;  3FHN A;  3L2W A;  5LGU A;  3K4M A;  1SD6 A;  3PO2 J;  2XSJ C;  2VOD A;  3DKW A;  2Z2S B;  2EFQ A;  3V8K A;  2DQR A;  2M7B A;  1X4O A;  5H6Q A;  3RKW A;  1SAN A;  1KZH A;  3H0D A;  4JK1 X;  1YJN I;  4G7O F;  4EJU A;  1MJ9 A;  1H9G A;  2LFB A;  3AG1 H;  1MSF C;  3EUH A;  1G59 A;  3S32 A;  2KHM A;  3J80 K;  1F5T A;  4AIK A;  4X6A J;  2ZSH B;  3O6B B;  4U7D A;  1O7L A;  3CJT B;  5J8C A;  4XKC A;  1ZR2 A;  1U2W A;  1QO0 D;  2K4J A;  2Z16 A;  4ZC3 A;  4OAY A;  3ABT A;  1TWG J;  3HRS A;  4I98 B;  2YU9 J;  2GA1 A;  4CCK A;  1E17 A;  3VEP A;  4BU2 A;  2JQ7 A;  3PJR A;  3S2H J;  1HXD A;  4GCV A;  3Q0U A;  4DQ2 A;  3WU0 A;  4I99 C;  3MZY A;  1O57 A;  1VFC A;  5D4R A;  1G8X A;  2LY1 A;  3HC7 A;  1SVM A;  1NK2 P;  5FKL A;  4BHC A;  4XRM A;  3E6M A;  2CSO A;  2W85 A;  4LG0 B;  4RB3 C;  1PJR A;  3CCS I;  2DMU A;  3DLA A;  2O61 A;  1WJ5 A;  2KJC A;  4NB5 A;  4AYB N;  1MBH A;  3N97 A;  1UEL B;  3B6A A;  4AWX B;  2XF7 A;  4A6D A;  1TWF J;  5B1A H;  3M8E A;  1A31 A;  1KON A;  3RI4 A;  2Q8K A;  1Z3Y A;  5IP7 J;  4BJ5 C;  1ETX A;  2LRE A;  3E97 A;  4E4H A;  2VXZ A;  2H8R A;  3JRG A;  4KIC A;  1R23 A;  4ZJZ A;  2VBW A;  3DFG A;  5FGM A;  2NS7 A;  2QYO A;  2UUZ A;  2ZB9 A;  3T5X A;  1IN8 A;  4P9F A;  2DA3 A;  3L09 A;  5HNF A;  3QAH A;  1SD4 A;  2LF7 A;  4Y15 A;  4A3L J;  1X1C A;  1GXQ A;  3JAM K;  2HEO A;  1MGT A;  2C6Y A;  2MBF A;  2P7V B;  2ZC2 A;  3H0G J;  2TRT A;  2O6G E;  3OYN A;  2K40 A;  3ERE D;  3A0B C;  1U3E M;  4A3E J;  2OZ6 A;  5CQE A;  3I4P A;  1X4P A;  4IHW A;  3AG3 H;  1C0W A;  3GTK J;  3KP5 A;  4HQE A;  2HXO A;  4XMY A;  1NG6 A;  1SFU A;  1XS9 A;  1I1S A;  3N4M A;  2HGC A;  2ZXH A;  3S1Q J;  3OL3 A;  5BNG A;  4F55 A;  3RJP A;  3JR9 A;  2XAU A;  2LP0 A;  2QSH X;  4M6X A;  3L1P A;  4Y17 A;  1T95 A;  1JTX A;  3IL2 A;  2XGC A;  1E3H A;  3IP4 B;  5CYV A;  1IJW C;  5FKK A;  1LQ1 A;  3WG7 H;  3R4K A;  2FEZ A;  4XLE A;  2UZK A;  1IXC A;  4PGH A;  3D1N I;  1O3T A;  4PSW A;  1MDM A;  3OYA A;  3HSF A;  2KRH A;  2FUG 2;  3TBI A;  2FE3 A;  4ZZL A;  5IP6 A;  2LY9 A;  5HLH A;  4G94 A;  1ZRC A;  2RGV A;  1YHQ I;  3SFZ A;  2W57 A;  1OIS A;  2CFO A;  4XL9 A;  2VB6 A;  1TQP A;  2K4B A;  3BCB A;  1YS6 A;  2BY3 A;  3GZN B;  3F8N A;  1U8R A;  2JSC A;  3SDG A;  4BQO A;  2FBH A;  5EDN A;  4EJV A;  5IYD J;  5K7Z A;  2IS2 A;  1XGO A;  2ZKZ A;  4DZP A;  2EIM H;  1VQ5 I;  2V6E A;  3D5R C;  4JP0 A;  5LBQ A;  3IWZ A;  1H9T A;  1FT9 A;  2DK5 A;  3C3W A;  3F8M A;  1R71 A;  2UXN A;  4BEH A;  1YOV B;  2CQQ A;  3QYF A;  3A01 B;  2VC1 A;  4HSR A;  3GTM J;  1SMY F;  4HF2 A;  2DA5 A;  2P7C B;  4G9Y A;  4ZDL A;  4C9Y A;  4ZDO A;  1V5G A;  4FHT A;  4L18 B;  2D1H A;  3CJR B;  2RV8 A;  1XSV A;  2KLO A;  3QP5 A;  5FRO A;  2MA3 A;  3FK7 A;  4IHS A;  3K7A J;  4LJZ F;  2DOD A;  3EYY A;  2E1C A;  3S14 J;  5EJC A;  3HRT A;  4XRS A;  1R7J A;  3ZMS A;  2IVM A;  5D5X B;  3OYC A;  3HSR A;  5D8L B;  2ADU A;  1Y1W J;  1BOA A;  1NK3 P;  1HDD C;  2P81 A;  2I8D A;  3CCU I;  3WOD F;  2CYY A;  4AU7 A;  1MH3 A;  3BQY A;  4BY1 J;  2O8X A;  5GAD J;  2P0W A;  4OIO F;  1FP2 A;  5J8F A;  2EQR A;  2DFE A;  2BVM A;  3OIQ A;  1ZG3 A;  5CVJ A;  1N75 A;  2NXN B;  3CCQ I;  2E2H J;  4FX0 A;  3SHF A;  1MJA A;  3KX2 A;  5FRN A;  1HKS A;  3H9J A;  3JCU C;  3K1N A;  3DBR B;  2YX4 A;  1BJA A;  2OCC H;  3LAP A;  1ITY A;  1CQT A;  2H27 A;  3FXU A;  1IZ1 A;  3KYD B;  3S3N A;  2EA4 A;  1RKT A;  4FT8 A;  4CHU A;  1OYY A;  2AXT C;  2CV2 A;  1DP3 A;  1K4S A;  2AXL A;  3BY6 A;  3VOD A;  5C4X J;  2N8G A;  3CUQ C;  3ZMD A;  3VSK A;  5JVG F;  3LSK A;  3FIS A;  5JI6 A;  4M3B A;  2LVS A;  1UHS A;  4UUS A;  2PJR B;  1EH6 A;  3TDU C;  1GVJ A;  2XAH A;  2K3F A;  1RUO A;  2CMP A;  3WGH A;  1H0M A;  3KZI C;  3N05 A;  1ZN2 A;  2NVQ J;  1HSJ A;  3S3M A;  4N4O B;  2CQX A;  2VBZ A;  5TRD A;  3GF2 A;  4D0P A;  1W5T A;  1MDM B;  4BS9 A;  3E6C C;  4IRG A;  3F6O A;  1SMT A;  3LST A;  1OYW A;  4MNU A;  1TBX A;  2Z5U A;  3CME I;  3CJN A;  1R00 A;  4DNC A;  1JUP A;  2WAF A;  1RIO H;  3BRO A;  1XPX A;  2CG4 A;  5DM6 F;  5J1Y A;  1FYK A;  3FWE A;  2OTL I;  4PDK A;  4AYB A;  2EV5 A;  2DO7 A;  3CC4 I;  2WY8 Q;  3OV8 A;  3HOY J;  2M8E A;  3S17 J;  3K4J A;  4E7K A;  1E2X A;  2JJ7 A;  2NYX A;  2QLZ A;  3BG3 A;  4G7Z F;  1DDN A;  1XMX A;  5K5O A;  1R6R A;  3DF8 A;  1I39 A;  4Y4R A;  2XAJ A;  3DQV C;  1BOB A;  1AHD P;  2F5F A;  2L5Q A;  3QPS A;  2LH9 A;  3H3Z A;  2HPM A;  1D5V A;  4KN7 X;  2CUF A;  3HSE A;  1STZ A;  2RAE A;  3AFH A;  5CKT A;  4Q47 A;  2VKV A;  2M34 A;  3EDP A;  3FBI B;  1KYZ A;  3GBG A;  2KDO A;  3Q9V A;  5AIQ A;  4UVC A;  5H2F C;  4IO9 F;  1GDT A;  5E17 F;  2X51 A;  3F8F A;  3CUQ B;  1X3Z B;  5JHF A;  5ED4 A;  2KRC A;  3H35 A;  3E6D A;  1DP7 P;  1NHA A;  1Z91 A;  1EKE A;  5HDN A;  4R8H A;  5KCM A;  4HZF A;  4XSX F;  1FMW A;  2MYS A;  2DDA A;  4YIR X;  1P4A A;  2NOG A;  3K70 D;  5F1R A;  1ZQ3 P;  4A3C J;  3WHB A;  3GYH X;  2EFO A;  5E8G A;  5F08 A;  3WHC A;  1OQY A;  4HNV A;  2F4M B;  2LKX A;  3I4M J;  1EV7 A;  5F0C A;  3LSI A;  2O8K A;  1J75 A;  1Y0U A;  1IN4 A;  1T2K A;  1YLF A;  2K27 A;  4PGG A;  2QBY B;  3I5U A;  4DYR A;  4ENN A;  1Z77 A;  3VB2 A;  5BQT A;  1FOY A;  1Z05 A;  1VF9 A;  4B1R A;  3BT9 A;  2LG4 A;  3FBN B;  3JSP A;  4LLN A;  1I6H J;  4UUS B;  2VKH A;  1R1V A;  4RGR A;  3RTR A;  4HNU A;  1FEX A;  2LKP A;  2KQR A;  3M9A A;  5EZG A;  1G4D A;  2IRF G;  3IH3 A;  2IBD A;  3BTJ A;  3PUB A;  2HYJ A;  1Q1H A;  3NAR A;  3SZG A;  1QHH D;  2E7X A;  4KIF A;  3JRC A;  3GTJ J;  2COB A;  2FQ3 A;  1QVT A;  5EYR A;  3OSF A;  1APL C;  1LFB A;  3H1C A;  2UWM A;  2BZT A;  1ZRD A;  5JVT A;  3E0J B;  4V2F A;  2Y9Y A;  3KCC A;  3KLO A;  4WCG A;  2BV6 A;  3ASO H;  3F72 A;  1MMS A;  1W5C C;  3EPZ A;  3CD6 I;  3LFU A;  1ZGJ A;  3G1L A;  1T8I A;  3ZRG A;  2XVC A;  4IKF A;  2DJN A;  4I76 A;  1YW8 A;  2LRD A;  2FNA A;  1TT0 A;  2HKX A;  5ICE A;  2DFF A;  2XAS A;  2ZNY A;  1UZC A;  3A0H C;  5EF6 A;  2X6Y A;  3ZCO A;  2EPF A;  5BOX A;  1OR7 C;  1U9O A;  3I0T A;  3QPT A;  3G4S I;  1MIJ A;  5JR3 A;  4KT5 C;  2H1L A;  2EIL H;  4OU0 A;  2ZJR F;  2QSG X;  4XR6 A;  2XSD C;  2VC0 A;  3HB9 A;  3WTZ A;  1U6G A;  5JHU A;  3RZO J;  3QQA A;  3ML6 A;  4LMY A;  2WAQ A;  1RNL A;  5HDG A;  4XOT A;  2W7N A;  1GUU A;  3BG5 A;  1U5T B;  4I0A A;  4AD9 A;  3GTP J;  5CQG A;  2EB7 A;  2LK2 A;  4PJN A;  3V7R A;  2A69 F;  4WK8 F;  1D1A A;  2R7O A;  3ROU A;  2Y2Z A;  4GDF A;  1Z67 A;  3BZK A;  5HNH A;  5J1R A;  2COM A;  1XD7 A;  3J81 Z;  5HS9 A;  1ZLJ A;  4I09 A;  3GFM A;  1FBQ A;  1T39 A;  3QOD A;  2QWW A;  2YSR A;  5M5W J;  4KYW A;  5D5U B;  1VQL I;  4G12 A;  1IRF A;  1V55 H;  1E3O C;  2V4J C;  3CCJ I;  2E1M B;  2VJI A;  2MD0 A;  4IEJ A;  3I59 A;  3T0Y A;  3MQ0 A;  4FCY A;  2ID6 A;  1S7O A;  4HLY A;  2L7M P;  3MZH A;  4GGG A;  2GA2 A;  2GXA A;  1ETQ A;  1WH5 A;  2AHQ A;  4W1U A;  1LEB A;  1JI8 A;  3BR1 A;  1QBJ A;  3OYK A;  1BW6 A;  1I50 J;  5EG0 B;  3HRM A;  4NC7 A;  3AL0 B;  3VOE A;  2E34 A;  1CF7 A;  2HZD A;  2XUB A;  4Z6Y A;  4F92 B;  3O2P E;  5F0F A;  3FM5 A;  2L01 A;  1T98 A;  3WTT C;  3ZMV A;  4Z2Y A;  1UB9 A;  2R5Z A;  2XPW A;  5ILV A;  2LD5 A;  1PDN C;  2DXI A;  4L9T A;  5J3L A;  3DU6 A;  1B9M A;  3CMY A;  1YFH A;  3LSG A;  3FXQ A;  4XM3 A;  2CJJ A;  4AM3 A;  4HG2 A;  1WSU A;  3COA C;  4J19 A;  3TGN A;  3W6J B;  3TDZ C;  1X3W B;  3WTU C;  2LKS A;  2EFP A;  1W5S A;  3OS1 A;  2F5C A;  1GV2 A;  5IY5 H;  3CCL I;  4L9J A;  2KMU A;  2EFW A;  2MH2 A;  3E6B A;  1S72 I;  3ZQQ A;  3HOW J;  2YS9 A;  2ZFU A;  3H9G A;  1BA5 A;  1BI3 A;  1B72 A;  2Q0O A;  5AIP A;  4BJT A;  4OMY A;  3B6C A;  3DEU A;  3TMO A;  3TOA A;  3F6V A;  3Q3S A;  3FF5 A;  1BR2 A;  5HDK A;  3D0S A;  1S6L A;  1UG2 A;  2IGO A;  5LD2 C;  1LDJ A;  2A5Y B;  4EM2 A;  1H8A C;  2VQG A;  3W6V A;  2ME0 A;  4FTH A;  4RAY A;  4D5F A;  3GLL A;  3F8B A;  1RES A;  3FMQ A;  2M2E A;  4XRS G;  1PP8 F;  2GM4 A;  4NHJ A;  3S16 J;  4P96 A;  4C2T A;  2E2I J;  2JA8 J;  4PJ0 C;  4XLH A;  1IXR C;  3LQR A;  2P5V A;  5HLT A;  4P1W A;  2VN2 A;  2BE5 F;  3PSF A;  4WX9 A;  4DW6 A;  1P92 A;  1MZB A;  3HEF A;  2OUM A;  3DCF A;  4UV9 A;  2WAD A;  3OY9 A;  4M9Z A;  4UVB A;  2OBP A;  3RIR A;  4IQJ A;  1TQI A;  3R6S A;  1HKT A;  4KDP A;  4A93 J;  2WV0 A;  1ULY A;  2CQK A;  4MQV A;  2DT7 B;  3VFZ A;  4XK4 A;  5J6X A;  2RQP A;  3J7A Y;  1X58 A;  1A6I A;  2K85 A;  3I71 A;  5FKM A;  1UAA A;  3I59 B;  2XKO A;  1BIB A;  2DOA A;  3JRB A;  2IA1 A;  4C2U A;  5D5V B;  3A4C A;  1OPC A;  1R5I D;  4LFU A;  2H8W A;  1U9N A;  1FYM A;  2E1N A;  2OF7 A;  4B43 A;  4HPQ A;  4HEA 2;  1MBK A;  3UR3 C;  2DOE A;  3K4C A;  4ESB A;  2DU9 A;  1MNE A;  3L2U A;  1ONV A;  2HU9 A;  4CYC A;  1VQO I;  3HL2 A;  1CF7 B;  2F4O B;  1WVR A;  5C44 J;  4KFC A;  2A07 F;  3VYR B;  9ANT A;  2FRH A;  3IAM 2;  3L9F A;  3TL4 X;  2VL8 A;  4D1Q A;  2O03 A;  4IF4 A;  4XLP F;  2HXI A;  4ZTF A;  1O3Q A;  1R4M B;  1MBF A;  2DA7 A;  5L3D A;  4CCJ A;  2R5Z B;  2AQF A;  2CWE A;  3NWT A;  3ZGK A;  4BHP A;  3CUO A;  2ZME C;  2QCO A;  3ONQ A;  2IA2 A;  2EK5 A;  3OYJ A;  1Z21 A;  2XGX A;  3ERM A;  3CJQ B;  4WXC A;  3BR0 A;  3TED A;  1Z0X A;  4P55 A;  3OYD A;  2V9V A;  4UY8 I;  5LRS A;  5JFR A;  4XNF A;  1LPQ A;  2ELJ A;  2XF5 A;  2YX7 A;  2TCT A;  1JGS A;  3RZD J;  4M9S A;  2DLL A;  2M3A A;  2VJ4 A;  5HS8 A;  3HOS A;  1K4T A;  4Q48 A;  2R7V A;  1QPM A;  2M87 A;  2CUE A;  2JWT A;  4YFX F;  2DA6 A;  3LA3 A;  4PSX A;  4MLO A;  3CP2 A;  1DPR A;  2JRT A;  4PFP A;  5LGT A;  4OMZ A;  5D8K B;  5TJJ A;  1VQ4 I;  1XB4 A;  4L0Z B;  1FMV A;  3SFI A;  5KK1 A;  1OCT C;  3CP8 A;  3CCV I;  2CQ7 A;  4HDU A;  3O8H A;  2HOE A;  5DYM A;  4AUX A;  3U1D A;  2DTZ A;  4WF2 A;  1YRN A;  2DFH A;  3RPQ A;  5FKN A;  2M4K A;  3FMS A;  4S0H B;  4Q5S F;  4GRI A;  1S9H A;  3RPU A;  1LFU P;  1XGM A;  3A02 A;  3J7Z I;  4ZTJ A;  1VQK I;  1Z3X A;  3GXO A;  2NAZ A;  3MCZ A;  3AG4 H;  2JSP A;  2IXS A;  3NRV A;  1TLH B;  4IRI A;  2B63 J;  3IHU A;  4DBR A;  3OS0 A;  4YEJ A;  4ZH4 F;  1D0Z A;  4ZYA A;  2DJI A;  2YPR A;  3ESW B;  3HUG B;  4U0Y A;  5D6F A;  2OJE D;  5B5E C;  1QZY A;  2EH3 A;  2GWR A;  1ETV A;  5C4J J;  1RZ4 A;  3DPU A;  4HAM A;  5J4Y A;  4IHT A;  4A3M J;  5GTH C;  1E0E A;  3K4B A;  1UCR A;  2VBY A;  5JLW A;  3A01 A;  3JRE A;  3CQZ J;  2FXA A;  3ZMU A;  2KL4 A;  2VKE A;  4A3I J;  5K7H A;  4I7H A;  2D5V A;  2XAF A;  5KNL A;  2ZXW H;  4RB1 A;  3FZV A;  4A3B J;  2L7Z A;  4CYC B;  1OCO H;  3U21 A;  2MAB A;  1BL0 A;  2K9N A;  1D8K A;  3K70 C;  1TZL A;  3KZZ A;  5CPR B;  3R0J A;  2AO9 A;  2OU2 A;  3M8F A;  3ZQG A;  2PMZ A;  1MND A;  3FKI J;  2VLA A;  1R5H A;  2ACJ A;  4O5V A;  1MMA A;  1TQM A;  3WGI A;  2F48 A;  4IQ4 A;  3GEZ A;  1FC3 A;  4YIF A;  1T0F C;  2M7A A;  4BL0 B;  1GT0 C;  4F52 A;  4BQA A;  1J09 A;  4FX4 A;  3D5S C;  3H36 A;  3QOE A;  1YIJ I;  1VTN C;  2QUF A;  1LDD A;  3L2V A;  2VJJ A;  2FSW A;  4XID A;  3GUD A;  2GXG A;  3PNV A;  1H88 C;  1I6X A;  1D3Y A;  2R92 J;  2KIS A;  1V5E A;  4CXF A;  2PJR A;  4ZDP A;  2BXY A;  4U87 A;  4RB0 A;  2VJ5 A;  5EEG A;  3JRF A;  2PX9 A;  2K9L A;  4OWR B;  4EJO A;  4XLF A;  1FZP B;  1W36 D;  4ZYE A;  1YRN B;  2M9H A;  3LSM A;  4IL6 C;  4RDU A;  2OTJ I;  2KKO A;  3GCM A;  4YRV A;  2ELH A;  5IT9 Z;  3W6K B;  3J7A O;  4M3F A;  5LLQ A;  4AIH A;  2L02 A;  1XC5 A;  4EEF G;  1FIP A;  2FML A;  1AU7 A;  3TW7 A;  4XLN F;  1R5G A;  3S8P A;  1TWA J;  1ETW A;  2CO5 A;  3DU5 A;  3M1E A;  4AC0 A;  5C3E J;  3U2R A;  1QQI A;  1W7P D;  3HXL A;  4UHT A;  5ICC A;  4HV6 A;  5HS7 A;  2HI3 A;  1DU6 A;  2PN6 A;  3CO7 C;  1KU3 A;  1FOW A;  1W1W E;  1X2M A;  1JKQ C;  4BAC A;  1WI3 A;  1P2F A;  3G71 I;  2STT A;  3SEQ A;  3KZY A;  4RAZ A;  3T8T A;  1JT0 A;  2EIJ H;  2NVT J;  3BJO A;  5FFZ A;  2W82 A;  1YO5 C;  4S04 A;  4KUM A;  2V1X A;  4BGD A;  2EIK H;  4A0X A;  3I55 I;  2Z33 A;  4BE2 A;  3MKZ A;  5FLM J;  3EET A;  1IN7 A;  1FP1 D;  3EQL F;  4MO7 A;  1U78 A;  1DGR M;  4LG3 A;  1T08 B;  1HST A;  1RKW A;  4QLC U;  3F0C A;  4GYI A;  5IOY A;  3TO7 A;  4A5N A;  4M9X A;  1MNM C;  3W3C A;  3OIP A;  4QPO A;  2VKD A;  3CUQ A;  5CVI A;  2W84 A;  3J80 Z;  3OYH A;  2PEX A;  3DBH B;  1A04 A;  1DUX C;  4A3G J;  1WCM J;  3ZMT A;  1SFE A;  2NVU B;  5K5Q A;  4RGS A;  3V42 A;  2FF4 A;  1D1C A;  2XV4 S;  4NBQ A;  5B3S H;  4E7S A;  3BR2 A;  1D8J A;  2R7Q A;  4QTR A;  4GXO A;  3OYI A;  2F5D A;  1G6N A;  3KEY A;  1ETK A;  1KA8 A;  3BC8 A;  4FET A;  3KET A;  1EF4 A;  4Y7N J;  2DT6 A;  2WAQ N;  1S7A A;  2ZXJ A;  3IH2 A;  2QBY A;  2H94 A;  2RNG A;  4ENM A;  1MD0 A;  1BI0 A;  5LEJ A;  1KGS A;  2Y0S A;  4LGW A;  4JYK A;  2KZG A;  1R9T J;  2L3D A;  4UVA A;  1TC3 C;  1B9N A;  3SEZ A;  2FX0 A;  2FNP A;  2FOK A;  2K3P A;  1FWZ A;  3GFJ A;  4I2O A;  1XCV A;  3SYT A;  1WJB A;  4M3D A;  3A03 A;  4EM0 B;  2V1U A;  1IO2 A;  4CSW A;  2EV0 A;  3Q5F A;  1ON2 A;  2HOA A;  1B59 A;  2O9L A;  2AS5 F;  2ISY A;  3L2R A;  2ZJP F;  2K9S A;  4EM1 A;  4RA2 A;  1ACI A;  4PZJ A;  2L9V A;  4A0Y A;  3E5Q A;  3KPH A;  2DFI A;  2XC7 A;  3DEE A;  1IGN A;  2R3S A;  5E3M A;  1TNS A;  2VE9 A;  1YW7 A;  1SAX A;  4C30 A;  4JX5 A;  4IOC F;  2RN7 A;  3IH4 A;  5H20 A;  2BYV E;  4II2 A;  5FD5 A;  3DTE A;  2GLO A;  1BM9 A;  3H3U A;  4HBL A;  3KYL A;  3G3Z A;  1JE8 A;  2JA2 A;  3HPG A;  3CF5 F;  4CCO A;  1AA7 A;  3S1R J;  3K69 A;  2OC6 A;  4UUT A;  4HX8 A;  4GFB A;  4BHB A;  2WTE A;  2RRE A;  2V9K A;  3WTS C;  2JTV A;  3F22 A;  4X1E A;  3OL4 A;  3IAS 2;  1HW2 A;  3Q9S A;  3CTA A;  4BBR J;  1USS A;  5KAF C;  1RI7 A;  2A6H F;  2ELK A;  3HOX J;  3FDY A;  2F2E A;  2QQB A;  3WTY C;  2P6T A;  3HDD A;  4E7L A;  1SVL A;  4RM2 A;  4ABZ A;  4XOP A;  4E6K G;  3OR1 C;  3VWB A;  2MD5 A;  4UNO A;  5FLX K;  1U5T A;  1Z6T A;  3GME A;  4BAY A;  4IXA A;  4BNC A;  4CCM A;  3PUF A;  1Z9C A;  3DP7 A;  4UB8 C;  3S15 J;  1ORK A;  4JX6 A;  5A2Q K;  2BW3 A;  4IOA F;  1POG A;  1HF0 A;  3WE2 A;  5M5X J;  2UXX A;  2CV0 A;  4IHV A;  2PMU A;  3O8G A;  2Y9Z A;  3ZPL A;  1MJB A;  3DTK A;  4OIN F;  1YQA A;  2X6X A;  3ELK A;  5E1W A;  3KEQ A;  2FD5 A;  3OMY A;  4BXU A;  2E19 A;  3J7Y J;  1I5Z A;  1YYV A;  5J40 A;  3ABM H;  4C3J J;  1JHH A;  2DYS H;  2RKH A;  4LLL A;  2E35 A;  2L4A A;  3HG9 A;  1X1B A;  2EA2 A;  4AID A;  5DS9 A;  3LSJ A;  2XPV A;  4MGR A;  2DQL A;  1LJ9 A;  2FMY A;  2Y69 H;  3RPU D;  2DW4 A;  2RQQ A;  1A36 A;  3ZMZ A;  5EG0 A;  1N77 A;  5H6R A;  3MAJ A;  1RPW A;  3IRR A;  2KP6 A;  2KT0 A;  3X2Q H;  5D5W B;  1K61 A;  3EUK L;  3ECH A;  2K9M A;  4V2G A;  2LBF A;  4B47 A;  2ZNZ A;  4MFD A;  2BY1 A;  1K78 B;  2JMW A;  1OR7 A;  1XTA A;  2G7H A;  2CFX A;  3E3V A;  1J59 A;  1T33 A;  2X1C A;  5FD6 A;  2HTJ A;  5AON A;  1F9N A;  2HVS A;  3DTI A;  4BE1 A;  1N78 A;  3K4K A;  4YEL A;  3WTV C;  2CGP A;  5CJ9 A;  2X4H A;  1LKX A;  4XLA A;  4BYY A;  1IN6 A;  3BQZ A;  4XBF A;  2TDX A;  1V54 H;  1WQ2 A;  4B44 A;  1FIA A;  1J5Y A;  1S5L C;  3PFI A;  3MKW B;  4X0G A;  4ENK A;  4BUP A;  5F0H A;  2K5C A;  3BJA A;  3SXY A;  4EJT A;  3W2V A;  2WAE A;  3QPL A;  4KIS A;  3LWF A;  1ODD A;  2ZXI A;  1OJL A;  4A12 A;  2H09 A;  1FYL A;  5FJ8 J;  2ICW G;  3JW4 A;  2FOW A;  1QZZ A;  2OD5 A;  1ZR4 A;  4A3D J;  2OQG A;  2QZ8 A;  2P8T A;  1GHC A;  3JRA A;  1B4A A;  1D0Y A;  3CDH A;  4PJM A;  5TGT A;  2IGN A;  4RLF A;  3GWZ A;  4DGW B;  3OSG A;  4HDV A;  1YTY A;  1FLI A;  1EA3 A;  3OYG A;  2L2O A;  2DCE A;  4Q4Z F;  4IRH A;  1S8N A;  2EV6 A;  5J47 A;  3B73 A;  3D5L A;  1UFM A;  2BW3 B;  4D7N A;  1KQ0 A;  4F93 B;  2QEX I;  1TWC J;  3P9C A;  4H4K C;  3UNG C;  1Z7L A;  2MC3 A;  1KQ8 A;  2KIU A;  5DUI A;  3LQQ A;  4LB6 B;  3PIO F;  1Z1D A;  1LDK B;  2GIV A;  2MG4 A;  2XKP A;  3PNT A;  1Y0N A;  2ECB A;  3QU3 A;  4A0Z A;  2XAG A;  2Y75 A;  4MEX F;  4RGX A;  4WXH A;  2V79 A;  3DPT A;  4BBS J;  2MFZ A;  4XLC A;  2F5E A;  2DA2 A;  2QQ8 A;  3REO A;  4EJW A;  2FJ1 A;  2PFB A;  1SEU A;  3OYF A;  2CH0 A;  1IN5 A;  2GXB A;  3L7W A;  1OFC X;  1GVD A;  2HYG D;  2LBF B;  1LEA A;  2BOL A;  2WV1 A;  4ZYH A;  2OCE A;  4C3H J;  3MKL A;  1IRZ A;  3BLY A;  2WC2 A;  5F6F A;  4M3G A;  3KLN A;  1UHM A;  2XRO A;  4FIS A;  3TOB A;  1IC8 A;  2QF7 A;  2HOS A;  3P9I A;  5LEK A;  4UUV A;  1TNT A;  3NWS A;  3PM1 A;  4OIQ F;  1OCZ H;  1XSX A;  2HQN A;  3M1C A;  4JX4 A;  3BPV A;  3GX4 X;  2R5Y A;  3HBL A;  5IT3 A;  2EFN A;  3G1O A;  2LC2 A;  2MLK A;  4HYE A;  6PAX A;  3S93 A;  2L9S A;  2W4S A;  1VQ6 I;  1RRJ A;  1O3S A;  1AKH A;  4N9I A;  2DA1 A;  3FXR A;  3RQ4 A;  3FXJ A;  2E7W A;  1R22 A;  2JK3 A;  2WB1 N;  3QYB A;  3W2W A;  1W36 C;  1G3Y A;  1OCC H;  5DCM A;  1QA6 A;  2JZY A;  2DYR H;  2L9N A;  2PMZ N;  4DIQ A;  4YG2 F;  2LF8 A;  5D6E A;  1X19 A;  3CES A;  2VT2 A;  2STW A;  3HOZ J;  2IAI A;  3ABL H;  4Y3O A;  2XIG A;  3S1N J;  3WU2 C;  5FRM A;  4OOI A;  1FJL A;  4BH9 A;  3DBL B;  3DKY A;  3U1K A;  3QRF F;  3K6G A;  1R1T A;  3CCE I;  1GXP A;  3I54 A;  1QPI A;  1JKP C;  2VOP A;  2OZU A;  3QP6 A;  3CCY A;  3CDL A;  3PNY A;  4N9H A;  4CO8 A;  4FAS D;  5EEA A;  1JHF A;  2HYF A;  4WWC A;  2A3S A;  1VQ7 I;  4Y33 A;  1BBY A;  4BE0 A;  2XDV A;  1P7I A;  4L5I A;  5HOO A;  1U0J A;  1QGP A;  2VPR A;  2BVL A;  2HFH A;  4BDZ A;  2K9Q A;  2WWY A;  1BI1 A;  3NQO A;  3QYE A;  3HUG A;  3TKY A;  2ZME A;  4MIM A;  4NQW A;  3FHZ A;  1YE9 A;  3TP3 A;  2VQH A;  4G8X A;  3OOP A;  2CUZ A;  1YX5 A;  3ABU A;  2VE8 A;  4BY7 J;  1WJF A;  3OOU A;  5BS6 A;  3RKY A;  2RDP A;  2HR3 A;  2QSF X;  5E1Z B;  3BG9 A;  3FIW A;  4FE7 A;  2A6E F;  2ZFW A;  3BZ6 A;  3HIF A;  4F7Z A;  3M7G A;  1AWC A;  1XGN A;  4N4N B;  4XKW A;  2DMQ A;  4P9U A;  4HW0 A;  2I10 A;  4HA8 A;  3ZQF A;  3G73 A;  3HYI A;  4HX4 A;  4I01 A;  1ZRF A;  4UXN A;  1ON1 A;  1Z7U A;  4GYG A;  5CVR A;  4S05 A;  2A61 A;  2XAQ A;  3RCO A;  5IPA A;  2LLK A;  2X6W A;  4YFK F;  4M74 A;  2JA5 J;  1P6R A;  1XCB A;  2R7X A;  1ZKG A;  4QIW N;  1R58 A;  3DPL C;  4JQF A;  2L7F P;  1TP4 A;  2MH9 A;  4NNJ A;  2DAO A;  2BHZ A;  1BC8 C;  4ASN A;  5LRR A;  4ZYD A;  3NEU A;  4A3K J;  1OYI A;  5L3E A;  2IA0 A;  3E5X A;  2NNN A;  3SQN A;  1BC7 C;  2R5Y B;  3LNQ A;  3SJM A;  1DQU A;  4M3E A;  1S7E A;  3OYL A;  2ID3 A;  3K4L A;  5LHI A;  5ICF A;  1AKH B;  1F43 A;  3FK6 A;  2ISZ A;  5M3F J;  3MN2 A;  1T56 A;  1WJE A;  3ZN1 A;  5DTD A;  3VYU B;  4RGU A;  1UJ8 A;  4RAF A;  5DCM B;  3F8C A;  5EEH A;  4I0B A;  4XQF A;  2B0L A;  2R93 J;  1JUM A;  5HLG A;  2OPT A;  1A5J A;  1QHG A;  4A6E A;  1VQP I;  2L4M A;  3KP3 A;  3FX3 A;  4BQN A;  1FTT A;  2GOX B;  2W00 A;  4V19 K;  4E7I A;  1ZLK A;  4KNY A;  2VUM J;  3BG7 A;  1MKM A;  4AVP A;  5KVR A;  1YX3 A;  2NNY A;  1ZG1 A;  2ESN A;  4CCN A;  3OS2 A;  2VQL A;  3V8J A;  2KIM A;  3WTW C;  4J00 A;  2DA4 A;  1NH3 A;  5BPD A;  4DBQ A;  1XGS A;  4XKV A;  2L0K A;  5FKO A;  3RKX A;  2Z3Y A;  2EBI A;  1WH7 A;  1DU0 A;  3PFY A;  3K9T A;  2L7K A;  2XPU A;  5EZH A;  1GV5 A;  3M4O J;  4RLQ A;  4D9J A;  3V8L A;  3T8R A;  4CA0 A;  3AG2 H;  3CCM I;  2BGC A;  3PL8 A;  1YJW I;  3WE3 A;  1JUS A;  2PBI A;  5KAI C;  3EUA A;  3FXO A;  2VQC A;  2Y0S N;  3I9V 2;  4ESJ A;  1BI2 A;  3LA7 A;  4QWQ A;  1YIO A;  1P7J A;  1IRX A;  2W48 A;  4U88 A;  3HTS B;  4MTD A;  3DEW A;  5DUK A;  2HTS A;  5J1U A;  5IYC J;  2H1K A;  2ZME B;  4NQW B;  1F36 A;  2O3F A;  3ABK H;  3CCR I;  2ZCW A;  2ZBK A;  3MKY B;  4IX7 A;  2HOT A;  2IS4 A;  1F1Z A;  1B6A A;  1T0F A;  3F9K A;  2M0M A;  1HC8 A;  2CU7 A;  2IGK A;  3Q0V A;  3BCA A;  1IW7 F;  2DDB A;  2GBY A;  3IC7 A;  2R7Z J;  1UMQ A;  1I27 A;  2DMN A;  4OAZ A;  1WZ2 A;  3I56 I;  1XX5 A;  2LNB A;  2ZJ2 A;  1LE8 A;  1R4N B;  3KYC B;  2MGQ A;  3MEX A;  3CZ6 A;  1QNT A;  2WB1 A;  1ZGA A;  2A68 F;  2NVY J;  4OIR F;  2R7T A;  3HRU A;  3BZC A;  3T1B A;  1ZGW A;  1FPQ A;  3KP4 A;  1K79 A;  2DPD A;  1AOY A;  4FQG A;  2PG4 A;  2E36 A;  1GLN A;  3C7J A;  1HA8 A;  1CGP A;  1X1A A;  1SFK A;  3CO6 C;  5TIS C;  2AQE A;  4I6Z A;  3GTQ J;  1WJC A;  4F3Q A;  1IV6 A;  1IF1 A;  1VQN I;  3H5N A;  2VPL A;  3EUH C;  1XMA A;  2YU3 A;  4BDY A;  2EIN H;  4IJA A;  3CDI A;  3LOC A;  3BR3 A;  5L3C A;  1BN5 A;  2Z99 A;  4Y13 A;  3A1Y A;  4U0W A;  2WY7 Q;  3MFK A;  2KIQ A;  1P4W A;  1NTC A;  3VSL A;  4O3M A;  3BWG A;  1Y6I A;  2W25 A;  1JT6 A;  5E1X A;  2E71 A;  2LMD A;  3GTO J;  3IWF A;  1HLV A;  2K02 A;  2XB5 A;  1S29 A;  1MBE A;  3BP8 A;  1B8I A;  3P7N A;  1N25 A;  2X0L A;  3IUO A;  2HQ5 A;  1X1P A;  3WG9 A;  4E7H A;  1IDZ A;  2KZV A;  2IT0 A;  2IW5 A;  2PQ8 A;  3GFI A;  3BDD A;  5B66 C;  1W0T A;  1ENH A;  1XN7 A;  4KMF A;  1SFX A;  3PO3 J;  1Q1V A;  4MTE A;  1LUJ B;  5E18 F;  2J5P A;  1ERD A;  3ZQH A;  2M45 A;  2FQ4 A;  4ANJ A;  1BR1 A;  3TP0 A;  4CUG A;  4KMU X;  5FLV A;  2BEO A;  4DYC A;  2HPI A;  4I02 A;  4DYQ A;  2H6B A;  3GFL A;  1Y56 A;  2CUJ A;  3P5J A;  2Z1D A;  5K5R A;  1Y1V J;  2IGM A;  3E7L A;  3ECO A;  2W1O A;  3F3X A;  2BXZ A;  1FOX A;  1R36 A;  4EAT A;  3OYM A;  1EH8 A;  3CMA I;  3S1M J;  2D45 A;  1MMN A;  2OAZ A;  1MMD A;  1ZK8 A;  2IPQ X;  2X6O A;  4DOZ A;  5HVQ C;  3K1P A;  1FY7 A;  1WKM A;  2E1O A;  2JUG A;  4PUS A;  2A6T A;  1OKR A;  3RSN A;  3LSR A;  3ZN0 A;  1LE8 B;  1LVK A;  3M3Y J;  4A3F J;  5GPC A;  3GZ6 A;  4BXX J;  3GVA A;  2O0Y A;  4CH7 A;  2DI3 A;  1JKR C;  3I64 A;  1X3U A;  1FBS A;  2X85 A;  4PJL A;  3H3V K;  1HDP A;  4KN4 X;  4R79 A;  1QRY A;  2V1D A;  1BR4 A;  2V6C A;  4XOR A;  1TL8 A;  2CS3 A;  1MBJ A;  4A3J J;  1MMG A;  4LIT A;  4IZZ A;  1H89 C;  2KDZ A;  4U0V A;  4BQQ A;  5E3L A;  3MVP A;  4G6T B;  4IVN A;  3H5A A;  1SVO A;  1X2N A;  5ILU A;  4IHX A;  1YI2 I;  2Y31 A;  5DD8 A;  4EMS A;  1QU3 A;  1VZ0 A;  1V5F A;  2VBX A;  3H9Q A;  4ITV A;  3FMR A;  3CF2 A;  1JXS A;  1SD5 A;  2JA6 J;  4RM3 A;  3L2C A;  5CLS A;  3O3K A;  1V3F A;  5K7F A;  5GP9 A;  3ZQ7 A;  3GO5 A;  2XGE A;  3FXM A;  3RYP A;  2L54 A;  2RC4 A;  1WFX A;  2ZJQ F;  1FX7 A;  2VIX A;  4B4C A;  3HGY A;  3KIO A;  1WWX A;  2HWV A;  1TTY A;  3LA2 A;  4C3I J;  1SC7 A;  1K78 A;  1B8I B;  3BR5 A;  2KJB A;  2QQA A;  4KJZ A;  2KPM A;  3BOQ A;  2IJL A;  2R7D A;  2GOM A;  3WTX C;  4CGZ A;  1ETY A;  4CIC A;  3KP2 A;  2ECC A;  1W0U A;  1BIA A;  4G7H F;  2FU4 A;  1B1B A;  2GAU A;  4JBA A;  5BMZ A;  3K4N A;  1IUF A;  3JAM Z;  3FXK A;  2R7S A;  5KHD A;  3TQN A;  1K6O A;  3JSO A;  4B8X A;  2YUS A;  3V7S A;  3ZQL A;  1FBU A;  2Q2E A;  1P4X A;  3KP7 A;  5E79 C;  2NRA C;  4R1H A;  3HHH A;  4L5E A;  2O5R A;  3EYI A;  3DXJ F;  3VYS B;  2EWN A;  5E8I A;  1OCR H;  4HST A;  4XN3 A;  2CV1 A;  2UV1 A;  2BY0 A;  4L9N A;  1FNN A;  3HPH A;  4IHY A;  1J9I A;  2Q1Z B;  2LTP A;  2V9P A;  2XRN A;  4H0E A;  1QVU A;  1D0X A;  1YW9 A;  5K1Y A;  4HRI A;  3CLQ A;  3RKQ A;  3BR6 A;  3J81 K;  4DZJ A;  4FE4 A;  1G3W A;  1YJ9 I;  2BY2 A;  3M8J A;  1PUF A;  3K1M A;  5ILS A;  3LAJ A;  4ETS A;  1O7F A;  1L3L A;  4HQM A;  4D7M A;  2M4G A;  4L0Y B;  5DEQ A;  2VI6 A;  3I58 A;  5JLX A;  5CVU A;  1LFP A;  3C18 A;  4Y52 J;  4ENJ A;  4PFO A;  4BEH B;  1J0R A;  1HKQ A;  2PJP A;  2XRL A;  5L3G A;  1T38 A;  4B3X A;  2DMT A;  5E3N A;  2VAS A;  4AVZ A;  2VXD A;  2PI0 A;  3K0L A;  2LYC A;  3LMM A;  4B09 A;  1ZG5 A;  3TW6 A;  2BHY A;  4E70 A;  1EJ9 A;  4K2E A;  2G0E A;  3G1M A;  2I5U A;  5E20 A;  3ZQI A;  1R49 A;  4CZZ A;  2EZL A;  4GO1 A;  5LFA A;  1F4K A;  2CW0 F;  2EJR A;  2EZH A;  3M07 A;  2KIF A;  4M6Y A;  3BG6 A;  1YS7 A;  4ON0 A;  3OYB A;  2K86 A;  4RS8 A;  4CCL A;  2HDD A;  2R4G A;  3I4N J;  2Y0M A;  5CVV A;  3BTC A;  1KU9 A;  2FBK A;  1XG1 A;  2IS6 A;  2V26 A;  1OMI A;  2F6C A;  3C2H A;  3HOT A;  1PVE A;  2ETH A;  1W4M A;  2E60 A;  2HDW A;  2HVQ A;  2W24 A;  4WXD A;  2OA4 A;  5GAG J;  2G7U A;  2IP2 A;  1U5T C;  3NAU A;  3U9G A;  3JRD A;  2FBI A;  1XDU A;  3LSP A;  2PMH A;  4YII A;  2JN6 A;  5FFX A;  4YFN F;  1OCP A;  4P5O A;  2R7W A;  3I53 A;  1KU2 A;  2LDU A;  2Q2E B;  2NS8 A;  4B3A A;  1HBX G;  4KIB A;  3KE2 A;  3ZR8 X;  3PQJ A;  1MW7 A;  1BW5 A;  1WJD A;  1TWH J;  5F04 A;  4CDG A;  3S2W A;  4ZYG A;  2JA7 J;  1IRG A;  1S3J A;  4EVI A;  1ZH5 A;  1XMK A;  3ZXS A;  1D1B A;  1Y8Q B;  1Y39 A;  4KA4 A;  3RQI A;  2E1M C;  1VQ8 I;  4KIG A;  5ICG A;  3KFW X;  2D1V A;  1G2H A;  1SAU A;  1ZEL A;  1ZHF A;  2K7L A;  4XN0 A;  5GAE J;  3S3O A;  3TO9 A;  5FO5 A;  1FSE A;  5IP9 J;  1T6S A;  1IG7 A;  3DWL E;  5DV5 A;  3ULQ B;  1D5Y A;  4LB5 A;  3GTG J;  4D5C A;  3OR2 C;  5LGN A;  5B1B H;  3C2B A;  3AL0 C;  5BPI A;  1PUF B;  3F23 A;  1V4R A;  1WRJ A;  3C2G A;  4OIP F;  1QZE A;  3QWL A;  4UB6 C;  1HW5 A;  1J2X A;  4ZZD A;  4LK1 F;  3HGG A;  2Y30 A;  3CLO A;  5M5Y J;  2PLY A;  2QVO A;  3JTG A;  5L3B A;  3CC7 I;  4CZC A;  5DD4 A;  1WPK A;  3K2Z A;  1M1E B;  3R60 A;  3WGG A;  3IKT A;  2X1E A;  3IKV A;  3OWT A;  3VYT B;  1WJA A;  3MMY B;  3MWM A;  5IOZ A;  1K6Y A;  1WHU A;  2JVH A;  2L9R A;  2M5W A;  3H92 A;  2E2J J;  3G2B A;  4RMN A;  3QU6 A;  3V4G A;  2HQA A;  4HF1 A;  4XKB A;  3S2D J;  1XDS A;  1WGX A;  4NC8 A;  1IDY A;  3F21 A;  1I3Q J;  3IV5 A;  4LLG F;  2VT3 A;  3HTU A;  3V7C A;  1XSD A;  3SDB A;  4HLX A;  4QSH A;  3TO6 A;  5EGO A;  3R0A A;  2B9S A;  1PUE E;  3SZT A;  1LVA A;  4LIU A;  3UKG A;  5GPA A;  3SZP A;  1X1D A;  3BPX A;  1UHW A;  4C2M J;  3PIP F;  5DM7 F;  2QM3 A;  5ERI A;  3FM3 A;  2MSY A;  3HKZ N;  1ZRE A;  4RB2 C;  3JRH A;  1PP7 U;  3HM5 A;  1VQ9 I;  2XB0 X;  4KIT B;  1NG7 A;  4MEY F;  4U7B A;  3W2A A;  2HZT A;  2LSO A;  5M3M J;  2DOF A;  3LFK A;  4E7Z A;  5FLX Z;  1HCR A;  5E3O A;  2FA5 A;  3B02 A;  3BJ6 A;  4PJJ A;  2O7O A;  1EH7 A;  3C1D A;  3IRQ A;  2LOO A;  2QA4 I;  1IXS B;  1HW1 A;  4EGZ A;  5A2Q Z;  2J5O A;  5DDG A;  2JPB A;  1A35 A;  1Z6R A;  2DMP A;  4HNT A;  1FOK A;  4O6J A;  3AKZ A;  1P9Q C;  1JTY A;  2V1N A;  4F91 B;  5J4V A;  4EGY A;  3I3L A;  1W7P A;  2DN0 A;  2VOO A;  3VPR A;  3PSI A;  3LSH A;  1ZAR A;  2A5W A;  3KEO A;  2YR2 A;  2CRG A;  4E7J A;  4LIV A;  2JPC A;  2HVR A;  2JT1 A;  2HQR A;  2RNJ A;  4NDL A;  2Y48 A;  5F1J A;  3PQK A;  2DTR A;  1JGG A;  1SFO J;  2NS0 A;  4M6V A;  2F5V A;  1PYV A;  2EZI A;  3GW2 A;  1DGW Y;  2JVG A;  5D4S A;  2GZW A;  2X9D A;  1O3R A;  4MQ9 F;  5LHH A;  1G3S A;  3L00 A;  1L0O C;  1R1U A;  4A2U A;  1BJZ A;  3E1S A;  2OV7 A;  2MC4 A;  1I3A A;  1REP C;  3BTI A;  1K7A A;  1FSH A;  5GTI C;  1K83 J;  1RC9 A;  3K10 A;  3CMM A;  4TV7 A;  3P9K A;  3RYR A;  1I1G A;  2X1D A;  4BJ6 C;  1O4X A;  2R7U A;  2F4I A;  3HOU J;  2LR8 A;  2DBB A;  1DPU A;  4II3 A;  2NVX J;  3MZ8 A;  2DPU A;  1UG0 A;  2M8G X;  4MHG A;  4RAG A;  2H6C A;  4G6Q A;  3KP6 A;  4PCQ A;  2V7F A;  2Z9O A;  1A6Q A;  2P4W A;  2IEK A;  2OQR A;  4UV8 A;  1VQM I;  2QQ9 A;  3FXL A;  1OLT A;  2QKM B;  3ZP5 A;  1JJ8 C;  4IPA A;  4PK4 A;  3QPH A;  4AIJ A;  4LOC A;  5DCF A;  3ASN H;  3DV8 A;  1E3P A;  1LB2 A;  4JOM A;  4NUB A;  5IYB J;  1WI9 A;  2BBY A;  1JKO C;  2ESH A;  4G6D A;  4ESF A;  2DK8 A;  1HQC A;  3CC2 I;  1IUY A;  5EGO B;  2WBM A;  4XON A;  4A5M A;  2M0C A;  4HOB A;  1RR7 A;  2VON A;  2KRF A;  1RET A;  2HNH A;  3Q0W A;  1IV8 A;  1TT5 B;  2MLG A;  3GZ5 A;  2RVC A;  5F27 A;  1TW2 A;  1TW3 A; 
#chains in the Genus database with same CATH homology
 4BXF A;  3L2R A;  2XF6 A;  4XR6 A;  2ZSI B;  3A1Y A;  3DEE A;  2WY7 Q;  2XC7 A;  4C30 A;  3VSL A;  2WAQ A;  1Y6I A;  4XOT A;  2W7N A;  3L2Q A;  4II2 A;  3DTE A;  5CQG A;  4PJN A;  3KYL A;  2E5Z A;  1D1A A;  2JA2 A;  2R7O A;  3HPG A;  5HNH A;  4CCO A;  1AA7 A;  3DKX A;  2OC6 A;  4KT6 A;  2RRE A;  2V9K A;  3IUO A;  4E7H A;  2KZV A;  2E5N A;  3QOD A;  3OL4 A;  3IAS 2;  3FDY A;  2QKL B;  2NOJ B;  2IS1 A;  3H5R A;  3VDX A;  2V4J C;  2E1M B;  2VJI A;  4E7L A;  2MD0 A;  4DJA A;  4RM2 A;  1ERD A;  4XOP A;  4E6K G;  3OR1 C;  3VWB A;  4B48 A;  1BR1 A;  4ANJ A;  4CUG A;  2R7R A;  4J01 A;  2HPI A;  4CCM A;  1JI8 A;  3LL7 A;  2LY2 A;  3OYK A;  2WA0 A;  1Y56 A;  2CUJ A;  2BW3 A;  2Z1D A;  4NC7 A;  3AL0 B;  2IGM A;  2HZD A;  2CV0 A;  2W1O A;  4F92 B;  3A2K A;  4EAT A;  3OYM A;  3OYE A;  3FKJ A;  2CW8 A;  1MMN A;  3DTK A;  1MMD A;  3HKZ A;  2CW7 A;  2X6X A;  4DOZ A;  3MD2 A;  5HVQ C;  3OMY A;  2DXI A;  4QPQ A;  2JUG A;  4PUS A;  2A6T A;  3DU6 A;  3FHN A;  3L2W A;  3RSN A;  3K4M A;  3LSG A;  1LVK A;  3HG9 A;  2XSJ C;  1X1B A;  4XM3 A;  2Z2S B;  4HG2 A;  4CH7 A;  2M7B A;  1X4O A;  3RPU D;  3H0D A;  2RQQ A;  2X85 A;  3OS1 A;  4PJL A;  1N77 A;  4R79 A;  2KMU A;  2KP6 A;  1BR4 A;  4XOR A;  3ZQQ A;  2ZFU A;  3H9G A;  2CS3 A;  3EUK L;  2K9M A;  2LBF A;  4BJT A;  3TMO A;  1MMG A;  4LIT A;  4B47 A;  4IZZ A;  1G59 A;  3S32 A;  2KHM A;  4BQQ A;  2ZSH B;  1BR2 A;  4G6T B;  3H5A A;  2IGO A;  5LD2 C;  2X1C A;  2VQG A;  4XKC A;  2HVS A;  2Z16 A;  4ZC3 A;  1QU3 A;  4OAY A;  3DTI A;  1VZ0 A;  4BE1 A;  1N78 A;  1V5F A;  3H9Q A;  4ITV A;  3K4K A;  4YEL A;  4CCK A;  3CF2 A;  4BU2 A;  3PJR A;  1LKX A;  4XLA A;  4RM3 A;  4C2T A;  4XLH A;  5HLT A;  4P1W A;  1G8X A;  2LY1 A;  3HC7 A;  3PSF A;  4B44 A;  2OUM A;  1WFX A;  3MKW B;  4X0G A;  2VIX A;  2WAD A;  4BUP A;  3OY9 A;  1PJR A;  2K5C A;  3DLA A;  3W2V A;  2WAE A;  1WJ5 A;  4KIS A;  4IQJ A;  1UEL B;  2ZXI A;  4KJZ A;  2KPM A;  2XF7 A;  2GOM A;  1KON A;  1Z3Y A;  2DT7 B;  4BJ5 C;  2LRE A;  4E4H A;  3K4N A;  3J7A Y;  2VXZ A;  2R7S A;  5KHD A;  4ZJZ A;  1UAA A;  1D0Y A;  2UUZ A;  2DOA A;  4PJM A;  5TGT A;  2IGN A;  4C2U A;  3A4C A;  5HNF A;  4RLF A;  4DGW B;  1EA3 A;  3OYG A;  1X1C A;  2L2O A;  2O5R A;  2DCE A;  4B43 A;  4HPQ A;  4HEA 2;  3VYS B;  3UR3 C;  3OYN A;  3K4C A;  4HST A;  4XN3 A;  1MNE A;  2BW3 B;  3D5L A;  4F93 B;  3L2U A;  2HU9 A;  2CV1 A;  2UV1 A;  5CQE A;  3HL2 A;  4H4K C;  3UNG C;  1X4P A;  1Z7L A;  3HPH A;  3VYR B;  2Q1Z B;  3IAM 2;  1D0X A;  3TL4 X;  2VL8 A;  4D1Q A;  4ZTF A;  4HRI A;  1LDK B;  4XMY A;  1NG6 A;  4CCJ A;  3PNT A;  2AQF A;  2ZXH A;  3NWT A;  3OL3 A;  3ZGK A;  4F55 A;  3M8J A;  3ONQ A;  2XAU A;  3OYJ A;  1Z21 A;  3DPT A;  3CJQ B;  2MFZ A;  4XLC A;  1T95 A;  3OYD A;  3IP4 B;  2M4G A;  4XNF A;  1LFP A;  2ELJ A;  4XLE A;  2XF5 A;  4PSW A;  4PFO A;  3OYA A;  2KRH A;  2M3A A;  2FUG 2;  2VJ4 A;  3OYF A;  3HOS A;  2CH0 A;  3TBI A;  2R7V A;  4BEH B;  4PSX A;  4B3X A;  2LBF B;  4MLO A;  2BOL A;  2CFO A;  4XL9 A;  2VAS A;  2VB6 A;  3BCB A;  4AVZ A;  3CP2 A;  4PFP A;  2VXD A;  2LYC A;  3LMM A;  3BLY A;  4BQO A;  1FMV A;  2IS2 A;  3CP8 A;  3NWS A;  2V6E A;  3M1C A;  5LFA A;  3D5R C;  2M4K A;  3BG6 A;  3OYB A;  4CCL A;  2LC2 A;  3S93 A;  2L9S A;  1S9H A;  2R4G A;  2W4S A;  4GRI A;  4BEH A;  3QYF A;  4HSR A;  3RQ4 A;  3QYB A;  4ZTJ A;  1W36 C;  3W2W A;  4ZDL A;  1Z3X A;  2V26 A;  4C9Y A;  2IS6 A;  2F6C A;  4ZDO A;  1V5G A;  3C2H A;  3HOT A;  3CJR B;  2JSP A;  2IXS A;  2KLO A;  5FRO A;  2E60 A;  2HDW A;  2L9N A;  2HVQ A;  4DIQ A;  4DBR A;  3OS0 A;  4YEJ A;  1X19 A;  1D0Z A;  4ZYA A;  3CES A;  2DJI A;  3HUG B;  4Y3O A;  5FRM A;  3OYC A;  3DPU A;  3DKY A;  4P5O A;  3K6G A;  2R7W A;  2I8D A;  4AU7 A;  2Q2E B;  1E0E A;  3K4B A;  3ZR8 X;  1MW7 A;  2P0W A;  3PNY A;  4FAS D;  1WJD A;  2KL4 A;  4Y33 A;  4BE0 A;  2BVM A;  3ZXS A;  1D1B A;  3OIQ A;  5KNL A;  1N75 A;  2E1M C;  2XDV A;  3KX2 A;  5HOO A;  1U0J A;  5FRN A;  3H9J A;  3U21 A;  2MAB A;  2BVL A;  4BDZ A;  1SAU A;  1ZEL A;  3K70 C;  1TZL A;  4XN0 A;  3S3O A;  5CPR B;  3S3N A;  3QYE A;  3DWL E;  2CV2 A;  1YE9 A;  1DP3 A;  2PMZ A;  1MND A;  2VQH A;  2VLA A;  2CUZ A;  1YX5 A;  3VSK A;  3LSK A;  3OR2 C;  1WJF A;  3OOU A;  1MMA A;  3AL0 C;  2PJR B;  4IQ4 A;  3C2G A;  2CMP A;  3N05 A;  3S3M A;  4N4N B;  1T0F C;  4N4O B;  4XKW A;  2M7A A;  4BL0 B;  4CZC A;  4BS9 A;  4F52 A;  2X1E A;  3OWT A;  3VYT B;  1WJA A;  1J09 A;  3MMY B;  1K6Y A;  3D5S C;  3QOE A;  2JVH A;  3G2B A;  3RCO A;  4RMN A;  3L2V A;  2WAF A;  2VJJ A;  2X6W A;  2HQA A;  4XKB A;  4AYB A;  2R7X A;  4NC8 A;  4JQF A;  3DPL C;  2WY8 Q;  3PNV A;  4NNJ A;  3SDB A;  3K4J A;  4E7K A;  1V5E A;  2PJR A;  4ZDP A;  4U87 A;  2VJ5 A;  4LIU A;  4OWR B;  2K9L A;  1X1D A;  1R6R A;  4XLF A;  4Y4R A;  1W36 D;  3DQV C;  1DQU A;  1BOB A;  3LSM A;  3OYL A;  2L5Q A;  2LH9 A;  3W2A A;  4KIT B;  4YRV A;  1NG7 A;  4U7B A;  2HPM A;  3K4L A;  4E7Z A;  3AFH A;  5CKT A;  4PJJ A;  1WJE A;  3S8P A;  2LOO A;  3VYU B;  3FBI B;  3DU5 A;  3GBG A;  4XQF A;  1QHG A;  2KDO A;  4BQN A;  2X51 A;  3HXL A;  4HNT A;  2GOX B;  2W00 A;  4E7I A;  3AKZ A;  1P9Q C;  5JHF A;  2V1N A;  3BG7 A;  4F91 B;  1YX3 A;  2KRC A;  3I3L A;  3H35 A;  4CCN A;  3OS2 A;  2VQL A;  3PSI A;  3LSH A;  4BAC A;  4J00 A;  2A5W A;  3SEQ A;  4DBQ A;  4XKV A;  4E7J A;  4LIV A;  5KCM A;  2HVR A;  1FMW A;  2MYS A;  2W82 A;  3PFY A;  2L7K A;  4BGD A;  4RLQ A;  2F5V A;  4D9J A;  3K70 D;  1PYV A;  4BE2 A;  4CA0 A;  1DGW Y;  3MKZ A;  3PL8 A;  2JVG A;  1DGR M;  3LSI A;  4LG3 A;  3EUA A;  2VQC A;  3I9V 2;  3E1S A;  2OV7 A;  2MC4 A;  3W3C A;  1IRX A;  3OIP A;  4QPO A;  2VKD A;  3OYH A;  4NQW B;  3K10 A;  2LG4 A;  3CMM A;  3FBN B;  3MKY B;  4IX7 A;  2X1D A;  2IS4 A;  3V42 A;  4BJ6 C;  1D1C A;  2R7U A;  2VKH A;  2F4I A;  3F9K A;  2M0M A;  3RTR A;  4II3 A;  2IGK A;  4HNU A;  4E7S A;  3BCA A;  2KQR A;  1UG0 A;  2R7Q A;  3OYI A;  3KEY A;  3BC8 A;  3PUB A;  4FET A;  3SZG A;  1QHH D;  4OAZ A;  2V7F A;  3CZ6 A;  2WB1 A;  2UWM A;  2DT6 A;  1OLT A;  2QKM B;  3E0J B;  2R7T A;  2RNG A;  4PK4 A;  2Y0S A;  4JOM A;  4NUB A;  3EPZ A;  3LFU A;  3ZRG A;  1GLN A;  3SEZ A;  1HA8 A;  2WBM A;  4IKF A;  4XON A;  2K3P A;  2LRD A;  1TT0 A;  1X1A A;  3SYT A;  1SFK A;  1WJB A;  2AQE A;  1WJC A;  4F3Q A;  2VPL A;  3H5N A;  2HNH A;  3EUH C;  4CSW A;  2X6Y A;  4BDY A;  3ZCO A;  1OR7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...