3OMYA

Crystal structure of the ped208 tram n-terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
51
structure length
51
Chain Sequence
PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein traM
publication title Structural basis of cooperative DNA recognition by the plasmid conjugation factor, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 19
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3omyA00
4QPQA 4QPOA 1DP3A 3OMYA
chains in the Genus database with same CATH superfamily
2VC0A 2MG4A 4RM3A 2LG4A 1FP1D 2EPFA 1POGA 2XAUA 4LLNA 1X1DA 2DA2A 3QYFA 2DMTA 4PDKA 2EFQA 3KP4A 1FBQA 1YG2A 1U9OA 5M3MJ 1V5EA 1OPCA 1R4MB 1X3ZB 3WTZA 1SAUA 1TLHB 1WI9A 1Y0UA 1MBHA 1YS6A 3MCZA 3F23A 1J59A 4M6XA 1FJLA 1WH7A 3DTIA 5IPAA 1VQ9I 4ZTJA 4I6ZA 2W1OA 2K9NA 2JSCA 4BDZA 3S1QJ 2RREA 3QPTA 4EJUA 3VYUB 3PNVA 1B8IB 2ESNA 2VKDA 1UJ8A 1HLVA 4Q47A 1ZGJA 3N97A 5IYDJ 1IAWA 2F5FA 2HDWA 3NWSA 1LDDA 4CCLA 2BE5F 1FTZA 1BJZA 1TWAJ 3GZNB 4A3IJ 4KNYA 1Z0XA 1J9IA 4YELA 5BS6A 3FXLA 4DYRA 3JSOA 1VQ4I 2MD5A 1YRNA 2QBYB 5DCMA 5EG0B 2M3AA 4XLAA 1KQ0A 3ESWB 3GWZA 3PM1A 1A6IA 2DI3A 1RIOH 3KZYA 2HTJA 1O3RA 2VBYA 3LA2A 5IT9K 4IPAA 2DFHA 2XAGA 2P7CB 3JRCA 4XQFA 2GXAA 2H8RA 3TQNA 1KGSA 2VXZA 3S2WA 3HRMA 3IAM2 4B47A 4P55A 2COMA 1TC3C 1ZQ3P 1UCRA 3ECOA 1X4OA 2HVSA 2IA2A 2QZ8A 1GV5A 5F0FA 3WG7H 4AUXA 1V54H 5FLVA 1S8NA 2X85A 3KZIC 2CYYA 1GLNA 4WXHA 4QLCU 3DBHB 3OSGA 2YU9J 1GXPA 2CSOA 1EKEA 2PJPA 2X1DA 3HB9A 3TDZC 4LG0B 1RR8C 3BP8A 1YX3A 3L09A 2E1MC 2RC4A 3MN2A 1NG7A 5FRMA 1X1AA 3HSEA 2M4GA 3PSIA 4F91B 3ASOH 5LBQA 5B3SH 2M87A 2JN6A 2R7FA 2B7EA 2J5PA 2QM3A 4AYBA 1BA5A 4P5OA 1W36D 1QO0D 3HGYA 4CYDA 3O6BB 4CUGA 2PMUA 2CMPA 3AG4H 4KITB 1SD4A 2EFOA 4E7KA 3D5RC 2WB1N 3K6GA 4C30A 3BOQA 4YG2F 1P7JA 3ZRGA 3ZP5A 3FHNA 1VI0A 3HJEA 1SMYF 2E2JJ 2MW8A 3QOPA 2DA5A 2G0EA 1O57A 4BS9A 2E2IJ 3AL0C 2ME6A 2OCCH 4BQOA 5LEKA 3MKYB 1YIJI 1W36C 3GEZA 2A5YB 3KP6A 3RKWA 4JQFA 1XGMA 2M7AA 2V9KA 4EV0A 1NHAA 4HX4A 1FYKA 2VBXA 1OJLA 3KCCA 4M6VA 1BI0A 2W25A 1U5TB 4J01A 5DM7F 4U88A 3GTGJ 2ZKZA 4HZFA 4F52A 1LNWA 1XGOA 4M9ZA 5KNLA 4M71A 2K7LA 4BE1A 3WTYC 1PP8F 4EM2A 1IN8A 2HQ5A 2M0MA 1D5VA 4IRHA 2FE3A 4HA8A 2ZCWA 4DBRA 3K4KA 1KYWA 2M2EA 3QRFF 1T2KA 2IS4A 3CMYA 1FOYA 2HDDA 2QQBA 1HBXG 4XRSG 4UV8A 5L3CA 3ABKH 1RNLA 2YUSA 3RKXA 3E7LA 3IH4A 2QYOA 2AS5F 2DQRA 2Z1DA 3E1SA 1DU0A 4ZC3A 1U3EM 2FU4A 1QZZA 3GZ5A 4MTDA 2CW8A 4I2OA 2CFXA 2W82A 4MTEA 1NK3P 4LK1F 4BQNA 1WJFA 3H0DA 1KZHA 1F36A 4KFCA 3AAFA 3HTUA 1OR7C 5M3FJ 3IP4B 4BEHB 4OAYA 1LDKB 2RQPA 3WGGA 3DKWA 3OSFA 5DD4A 3LAPA 1DDNA 2DW4A 3ZMSA 3DTKA 3DU5A 4JX6A 4RB2C 2DMPA 2DA4A 4M6YA 4A2UA 2OQRA 4WXDA 4A69C 3S14J 5H6RA 1JJ6C 2JQ7A 5L3GA 4Y33A 1RZ4A 2B63J 3JRAA 3K4MA 2VXDA 3O2PE 1WJDA 4IO9F 3G1OA 3HRUA 4XONA 3A0HC 3S1RJ 5KHDA 1PUFA 1LB2A 1USTA 4TV7A 1MJAA 3CC4I 1B72B 3DLLF 1BW5A 5LLQA 3O8HA 4MFDA 4ZTFA 3TO6A 1T56A 1QZEA 2XB5A 3OYNA 5BOXA 3T8TA 2MYSA 2M4KA 4UVCA 1ZG5A 2Y9ZA 3CLQA 4I0BA 2CQKA 5HDNA 3BQYA 2UV1A 2NS7A 4IX7A 5EZHA 1SAXA 1I3AA 2JA2A 1SFXA 2K85A 5CLSA 3Q5FA 2EZHA 3CC2I 1YO5C 2FNPA 2LMDA 2ZXHA 5CKTA 5FD6A 2P0WA 3WTTC 3HXLA 4FX4A 4ZYEA 4U87A 3A2KA 4KDPA 3Q3SA 2E19A 1I3QJ 2ZJRF 2PG4A 1VF9A 2BHYA 2ADUA 4YFNF 3KYCB 4HW0A 3ZQLA 1NK2P 1YIOA 3RJPA 2DQLA 2HOSA 2GXGA 1U6GA 5FKMA 2R7ZJ 3JTGA 3DQVC 2ID3A 2A05A 3JR9A 5D8KB 2TCTA 1VQ7I 5E8GA 4EJOA 5L3FA 3G3ZA 1B1BA 1XPXA 1PYVA 3MFKA 4U0WA 3QWLA 3M7GA 2CH0A 3JAMZ 1Z05A 4EEFG 3CD6I 3CP8A 5CVVA 1H0MA 3BR0A 2DN0A 3R61A 1K4SA 3K0LA 1I39A 1VQMI 4Y7NJ 2X6WA 3HOUJ 1DGRM 3F9KA 2MC4A 1ON2A 2ZMEB 3GUDA 2R4GA 3B6CA 4LLGF 2AXLA 2NOGA 2X6XA 3FXOA 3WE2A 2LF8A 2XSJC 3HRTA 3FBNB 5ICFA 2UWMA 3LWFA 1ZGAA 2F4IA 4BKXA 4CYCB 3EYYA 3HM5A 2D1VA 4WK8F 3EPZA 4LLLA 4HX8A 4QPOA 1ZKGA 3L7WA 4NQWB 1GVJA 2QBYA 2EFPA 3RDIA 1CGPA 2GIZA 4W1UA 2C6YA 2CQXA 4XL9A 5IY5H 2PMHA 2OPTA 2EINH 2O0YA 2ISZA 3IH3A 3C2BA 3TW7A 1W5CC 2KQRA 4OWRB 1IC8A 2LR8A 5FLXZ 2K86A 2D1HA 3V8LA 2BZTA 3PNTA 2UZKA 4G7ZF 3TL4X 2E60A 2K9QA 3H5NA 1CF7B 1TW3A 2XGDA 1TP4A 2VOOA 2STWA 2KKOA 3KX2A 2CS3A 1ZREA 1UZCA 1MMNA 3BG5A 2QUFA 3IV5A 3MVPA 1T98A 4BHPA 1LVAA 3KFWX 4L9NA 3PJRA 3F3XA 3V4GA 1RKWA 1N25A 3N4MA 1FTTA 3CDHA 4XRMA 4OIPF 2RN7A 4PCQA 3KE2A 1LVKA 1TT0A 2NAZA 2E1CA 2EIKH 1N75A 3VYTB 1IF1A 2HXOA 4XLNF 5HS8A 1TTYA 4E7JA 3VYSB 5K7FA 2MLKA 3M8EA 1L3LA 4XKVA 3LFKA 4A6EA 3EUHC 2LDUA 3RKYA 5M5XJ 3FZVA 4LIUA 1J2XA 4JBAA 2CJJA 4FTHA 2ECCA 3SJMA 2MGQA 2HVQA 1EV7A 3OYMA 1E2XA 2L9VA 3ONQA 1U2WA 3I56I 4EJTA 3LMMA 3SFIA 3BR5A 3ZGKA 3OYJA 4ESBA 4Z6YA 2KRCA 2JK3A 4XLEA 4AU7A 1FZPB 4LOCA 1UFMA 3K4CA 4AVZA 1R6RA 4AWXB 2KP6A 4DNCA 3JREA 3K2AA 2HEOA 1Y8QB 3AFHA 1NTCA 2OZ6A 3ZMVA 2EZKA 1R71A 1JKQC 3QODA 4LITA 5HLGA 4AIHA 3S1NJ 2V9VA 3RPUD 3KP3A 5HS9A 4ETSA 1MH4A 3FKIJ 4AC0A 4GO1A 1RRJA 1IDYA 2LYCA 4FX0A 1HCRA 2KDZA 5IT3A 1JTXA 3G4SI 1O3TA 4EM0B 2IEKA 1O3SA 2EQRA 3V7CA 1FOKA 1R23A 3GBGA 1D8JA 3FMRA 3ML6A 5GTIC 2BGCA 4EGYA 4ENMA 2QQAA 1IRFA 4RAGA 5TISC 5J1YA 3HOXJ 1X1BA 4V19K 4BAYA 1YRNB 1RKTA 5DCMB 1O7FA 2W7NA 2K02A 1A35A 5K1YA 4P9FA 1HA8A 2FX0A 4XRFA 3NWTA 2EK5A 1KU9A 4HNTA 5GADJ 2Y30A 2LKXA 2AQEA 3ELKA 4XNFA 2OA4A 4L0ZB 1D0ZA 2H6BA 2LOOA 2EJRA 3BG7A 3Q9SA 1Y39A 3GFIA 2G7UA 2L01A 4LIVA 2QA4I 5LRRA 1R1UA 4E7LA 1WJEA 3ZPLA 1Z6RA 5GPAA 3WG9A 4CCJA 4XN3A 1HKTA 1A31A 3OYGA 2VODA 5M5YJ 2IAIA 5EGOA 1JT0A 3GFLA 3HSRA 5M5WJ 2RGVA 2BY2A 3FM3A 4YFKF 1G3SA 1VQ6I 3G73A 5IYCJ 4IHXA 1ZN2A 4BL0B 2EV6A 3H92A 4BBRJ 2JVGA 1RUNA 2W00A 4MHGA 3M4OJ 3BY6A 1YJWI 1K7AA 4L5IA 2K4BA 2KT0A 2K9MA 3MZHA 1O4XA 3BZCA 3S1MJ 3UKGA 2F5DA 1FNNA 2VJ4A 3KYLA 3MEXA 1EH6A 5J8CA 1WQ2A 1G3TA 3Q0VA 2A5WA 2V4JC 3V8JA 5HODA 2RNJA 1ZLJA 2LREA 3U9GA 4R1HA 4WWCA 4M73A 1Z7UA 1SC7A 3VPRA 1Q1HA 1FYMA 4IKFA 5JHUA 4A3GJ 5KK1A 1G2HA 4E4HA 3E97A 4Y3OA 2CU7A 2MC3A 2DYRH 2LH9A 4C3IJ 3FMQA 5CVIA 2Z5UA 3WGHA 2VUMJ 1WSUA 4UNOA 2XAHA 3R0JA 1I27A 3HBLA 2LNBA 3ZR8X 3L00A 3OIOA 3BZKA 4KA4A 1TL8A 3F8MA 3A02A 2IRFG 4B3XA 3OV8A 5LRSA 1UHSA 2VKEA 1G3WA 1ZYRF 4IQ4A 1UAAA 2BVLA 2W4SA 3FDYA 2DA1A 3RPQA 2FBHA 4BHCA 4UUSA 2HQAA 3VWBA 2DK5A 4UHTA 5J8FA 4HBLA 4GFBA 3L2UA 3OL4A 2FBKA 4ZYAA 2GWRA 1XCVA 2ZFUA 3OS1A 3M8JA 1ZAOA 2R5ZB 4B09A 3K4LA 4A12A 2DXIA 3F6OA 3HOWJ 2Y48A 2FNAA 4D5CA 1S7OA 4HOBA 2L7FP 1BBYA 5D6FA 2OCEA 4NC7A 4CGZA 3KP5A 2M9HA 4CSWA 2LC2A 2IS1A 1R1VA 5ED4A 1XSXA 5JHFA 2QCOA 1B9NA 3V7RA 2EV5A 2GAUA 5FLMJ 3HKZA 2KMUA 2VT2A 4HG2A 3HG9A 2QEXI 2WADA 5E17F 4HSRA 1R58A 4PK4A 4XSXF 2D5VA 1QZYA 2P5KA 4CDGA 4XMYA 2Z2SB 3DEEA 2GZWA 1XD7A 4FHTA 4UB6C 4CH7A 2H1KA 4J19A 5FRNA 5BMZA 1REPC 3B73A 4RA2A 2JVHA 4BQQA 1YJ9I 1P4AA 2HYJA 2QVOA 2R7OA 2DA7A 3DPLC 3F8NA 2DT5A 3ABMH 1IXSB 2VQHA 3HRSA 3LSJA 4G6DA 3OY9A 3OYFA 1JJ8C 1EJ9A 4F55A 3ZMTA 5C44J 1TQMA 3JAMK 4A3EJ 2G9WA 3BPXA 3OR1C 1PUFB 2Y0MA 2X0LA 3E6CC 2VQGA 4KICA 1DP3A 1Z67A 3V42A 3DWLE 4I98B 4R79A 1ZH5A 2HDCA 1QBJA 1ZARA 4JX4A 4HLYA 3H5AA 1SFOJ 1Y8RB 4FASD 3P9CA 1B6AA 4D7MA 3I59B 3LSKA 2JJ7A 3GXOA 1M1EB 1K61A 3PNYA 1U5TC 3PIOF 1J0RA 1I6XA 2BVMA 3G2BA 4NB5A 3GTJJ 4OIOF 1H8AC 2DCEA 4GYIA 2QQ9A 3DV8A 1MSEC 5ERIA 5FKKA 3HC7A 4A3JJ 1VQ8I 1MBJA 3CF2A 5F1JA 3K70D 1OYIA 5L3EA 2DJNA 2VPRA 3HHHA 3FIWA 2BEOA 5KAIC 4C3JJ 5FLXK 4HDVA 2QWWA 3DU6A 3NARA 2KL4A 5HDKA 3GTOJ 1XGNA 1IRGA 4N9HA 2MABA 1A6QA 1AKHA 4I7HA 2MA3A 4M9XA 4M3FA 3LSMA 1B4AA 1X3UA 2L4MA 5ICGA 3IL2A 5E3NA 2DTRA 3OWTA 4E70A 4YFXF 3K70C 1RPWA 2W84A 2ZXWH 4Y13A 4E7SA 5DD8A 3BWGA 3V7SA 3ISPA 1V55H 3BPVA 4CCMA 5JI6A 2CV1A 4ENKA 3LA7A 1FC3A 1OYYA 2IW5A 4RLQA 4XKWA 3TKYA 3IWZA 2O6GE 2WY8Q 1E17A 3QOEA 4I09A 1HC8A 1W7PA 1Y56A 2XKPA 4RAZA 5TGTA 3F22A 3S16J 1OCRH 3MAJA 3CUOA 4UB8C 1FOWA 1IRZA 5K5OA 2OU2A 1TNSA 3MZ8A 2L9NA 1YYVA 3LOCA 3DP7A 3I4MJ 3OYAA 4YIFA 4ZZLA 2F5VA 1U0JA 2DAOA 3J7YJ 2JMWA 3KEYA 4CCNA 1MZBA 1SANA 1ON1A 2CUFA 2MH9A 4HV6A 5CJ9A 2O5RA 4BY7J 4S0HB 3MKZA 1Y0NA 3HEFA 5GAEJ 3U21A 5KAFC 2HOTA 3A01A 1MDMA 5JLWA 2IVMA 2HYGD 1KU2A 4LK0F 2RNGA 4M74A 4EGZA 3CUQC 2EV0A 2VB6A 2A3SA 1JHFA 2F6CA 3QPLA 3N05A 3RZOJ 3CJNA 4Y15A 3OYIA 2BXZA 4UXNA 1MBFA 1UELB 5FROA 4FE4A 3CO7C 1ENHA 4DZPA 2Q2EB 4RGRA 2P6TA 3DKYA 4XIDA 1N77A 1LFBA 2VL8A 3LNQA 3L2QA 2XIGA 3SEZA 1EA3A 4PSXA 2FMYA 2OQGA 2FF4A 3LSIA 2Y31A 3E5QA 2BW3A 5K5RA 2IGOA 1OCPA 1YOVB 3QQAA 3WODF 3SDBA 4D5FA 2I10A 4XOTA 2K4JA 4PJLA 3BC8A 2UUZA 2L3DA 3W2VA 4PJNA 1PDNC 2H8WA 2KIUA 2GOMA 5FKOA 4BBSJ 1S5LC 2ICWG 2OBPA 4A0ZA 2ZMEC 3S17J 5JLXA 4XKCA 2HKXA 2PJRA 2W85A 3I4NJ 1MMAA 1TW2A 1AOYA 2VLAA 4U0YA 1N78A 1JTYA 1S3JA 1T08B 2XUBA 2AO9A 1T38A 4CZCA 3MD2A 3GTPJ 1P4XA 4N4OB 1IDZA 1JUMA 3I0TA 4KMUX 1X2NA 1FLIA 1XMKA 2XVCA 1XN7A 1K78A 2AHQA 2F4OB 1LEAA 1RI7A 3IRRA 1I5ZA 2R5ZA 3WHCA 2YS9A 4L9JA 2DOAA 2V7FA 1LEBA 3ZXSA 3MKLA 2HXIA 5FGMA 3FMSA 4XKBA 4MFEA 4A6DA 4IOAF 5DYMA 6PAXA 5DUKA 2STTA 3OYKA 4G6TB 4EVIA 5E79C 1EH7A 4G9YA 1WCMJ 1GXQA 1BL0A 3QYEA 3F0CA 2O7OA 3TO7A 3C2GA 4EQQA 2CQ7A 1ZELA 4NC6A 5GAHJ 1Z9CA 3F72A 4G8XA 5ICCA 2ELJA 2V1NA 4ZH4F 5J4YA 4IHTA 2NVQJ 3OS2A 1D0XA 1U8BA 4B43A 1QPMA 3OYBA 2X9DA 5EGOB 2IS6A 2VIXA 4G7OF 2KPMA 3OYEA 1XG1A 3JRHA 3V8KA 4IXAA 5CQGA 2FRHA 1OISA 2P5LC 3CCEI 3SEQA 3HOZJ 3GCMA 1P9QC 3FXUA 1WZ2A 1VFCA 1D0YA 3IUOA 1BM9A 2WAQN 2KHMA 3M1CA 1FPQA 5F08A 4YRVA 2NNNA 1W0TA 2ID6A 4CO8A 3ROUA 1S72I 2QKMB 2E34A 4Q48A 2L9RA 2WAFA 4CCKA 2M8GX 3TMOA 4B8XA 2YX7A 4F93B 3IH2A 3CZ6A 5FFXA 1QU3A 2ELHA 2PMZN 3OOPA 3DF8A 3TP3A 3J81Z 1D5YA 2FD5A 2HFHA 2GLOA 5F6FA 5FO5A 4A3DJ 3H3ZA 1B9MA 4YEJA 3QU3A 3RZDJ 2NOJB 3I59A 4QWQA 1ZGWA 3K7AJ 3CDIA 2Y69H 2DDAA 1S7EA 2DFFA 5E3MA 1XC5A 3EETA 4HQMA 3DPUA 2HOAA 2LY9A 1VZ0A 3GX4X 5HLHA 3AKZA 1TWGJ 3R6SA 4DYCA 4BY1J 4HF1A 3HUGA 4Y17A 3BCAA 2BBYA 2W57A 2XROA 2R7SA 5JR3A 1ZR2A 3CMMA 2V1UA 3JRIA 3ERED 4UUSB 3OYCA 1W5SA 1HKQA 3S32A 4BJ5C 5J1RA 1UG0A 5IP7J 3PUBA 5D5WB 3SFZA 5BNGA 5J40A 4IRGA 1VQKI 2WV0A 3J80Z 5HLIA 3JRBA 1LDJA 2DYSH 5J6XA 4CXFA 1K83J 1MGTA 5LFAA 4XRSA 4YIRX 3CCRI 4BDYA 3HGGA 5LHGA 1SVMA 5H6QA 1DU6A 3L1PA 1QPIA 3TOAA 1FYLA 2XASA 4QSHA 1IW7F 3BCBA 2OZUA 1ZTRA 2RKHA 4PJJA 4PFOA 1YW8A 5EEHA 5HNFA 3H3VK 3CCUI 5CVRA 1MD0A 2LLKA 2ZBKA 3CQZJ 2R5YA 5LGTA 3SXYA 2COBA 5D4RA 1S9HA 3DEWA 3QYBA 5D8LB 2DU9A 2XGXA 1G4DA 4GCVA 2E7XA 1FWZA 3FM5A 5AIQA 4O3MA 2BYVE 2RV8A 1TBXA 5A2QZ 2L02A 3PL8A 5ILUA 3K1PA 1ETVA 2PFBA 3LFUA 5L3BA 2E2HJ 2HR3A 3BJAA 3SDGA 4ENJA 3KPHA 5K7ZA 1V5FA 3LSHA 1AHDP 3M9AA 1JKRC 2DK8A 2M0CA 2ZSIB 3GFJA 2K9SA 3VSLA 4G6QA 1IV8A 3RKQA 2ZJPF 2LTPA 4B44A 2CFOA 5E18F 3R0AA 4BYYA 3GTLJ 2Q2EA 1OQYA 1QVTA 2KRHA 4LJZF 2LKPA 1MJBA 2DA3A 5E1ZB 3E3VA 1MKMA 4B3AA 2X4HA 3G1MA 1F4KA 3K1NA 2E36A 3GFMA 1R5GA 1ERDA 1OMIA 3W6JB 4BACA 2FXAA 2YX4A 2GBYA 4IHSA 2KISA 1K79A 1ZR4A 4KISA 3G71I 1R5HA 2P6SA 3L2VA 4KUMA 1WI3A 3UR3C 1HSJA 1Z7LA 2V1XA 2KDOA 3RSNA 2XV4S 3SZPA 2JPBA 4PZJA 1HSTA 2HVRA 2K5CA 2DO7A 4UV9A 1ZK8A 2I5UA 3HPGA 3HYIA 3T1BA 4XORA 2VBWA 2R7XA 2EFNA 4AYBN 1AKHB 2ME0A 1IUFA 3HHGA 3I55I 2L7MP 2VE8A 1T8IA 1E3HA 4OIRF 1BR1A 1STZA 2DOFA 4HNUA 3TP0A 4IZZA 3BJOA 1R7JA 1P4WA 3FBIB 4M3EA 3BDDA 3H36A 2W24A 3LSRA 5H2FC 4A3KJ 3WTXC 2MFZA 3W2WA 2DPUA 2OC6A 1D8KA 5J4VA 3REOA 1YJNI 4HNVA 5J3LA 3BTIA 3Q9VA 2BOLA 3H35A 4CZZA 4IHVA 2E35A 1BI1A 2VE9A 4V2GA 3KLOA 4XLFA 1PVEA 5D5VB 2L2OA 5CVUA 1BIBA 1W7PB 3CCYA 2VJJA 1BJAA 2HWVA 4OMYA 2XB0X 5FB2A 3WU1B 2ZNZA 1LJ9A 2PBIA 4RDUA 2L4AA 3FF5A 1WVRA 1SEUA 2YR2A 3KYDB 2QKLB 2IGNA 1FX7A 2XF6A 2X51A 4OMZA 3GTKJ 4KYWA 2ACJA 3A4CA 3F6VA 2BY1A 3BR6A 1XMXA 5L3DA 2R7WA 1XSDA 4AD9A 4J00A 5K5QA 5B1AH 3OIQA 1K6OA 2P81A 4ZYHA 4P9UA 4GDFA 3D0SA 3HSFA 3B02A 3JCUC 1KYZA 1TT5B 3PQJA 5HLTA 4DQ2A 2O61A 1HW1A 5CQEA 2HOEA 3W6VA 3K4NA 3A01B 2IP2A 2WY7Q 1MDMB 2LSOA 5GTHC 5HOOA 2IS2A 4L18B 3TEDA 3S3MA 4EM1A 3RYRA 2IT0A 1X4PA 2Q1ZB 2Z3YA 4M3GA 2OD5A 1I50J 3L2WA 4RAYA 3TOBA 1OFCX 1QRYA 5K7HA 1VQOI 4M3DA 4BH9A 3K4BA 3F8FA 1VQ5I 4LB6B 3ULQB 1W0UA 5LHHA 2RVCA 3ZQHA 2HTSA 2M7BA 3RCOA 4ZJZA 3IRQA 3ZCOA 4KN4X 4ON0A 2CQQA 2IPQX 2JPCA 1RESA 2KFDA 1TNTA 2LVSA 2XAQA 1BI2A 2HZTA 4XICA 3QP5A 5DEQA 1IRXA 3BTJA 1F1ZA 1RR7A 1YTYA 3HL2A 5IYBJ 5TRDA 1F43A 2KZGA 2R7QA 2BW3B 3E6BA 3MKWB 1ETWA 3X2QH 2NYXA 2ISYA 1MIJA 3ZN1A 4XLPF 1GT0C 4UY8I 1OCZH 5EJCA 4UUTA 1DPRA 2VPLA 4ZDPA 1BC7C 3ABTA 5D6EA 2JZYA 4L0YB 1G3YA 4RB3C 2PJRB 2K3FA 3J7AY 1EH8A 3H5RA 4C3HJ 1YI2I 1OKRA 2JUGA 2V79A 4N4NB 4BNCA 2DLLA 4D9JA 1MJ9A 4BQAA 3I5UA 2LK2A 3CCMI 4HX7A 5CVJA 3CF5F 5LD2C 1WFXA 5LGNA 3I3LA 1K78B 4P96A 1TWHJ 3QP6A 2QGUA 3C3WA 4F3QA 2P7VB 4GRIA 3CCLI 1W4MA 3FISA 2V1DA 1APLC 4XOPA 1P6RA 3FK6A 3J81K 4BXUA 2WWYA 5IP9J 1JUSA 2HQRA 4ASNA 1JI8A 3P7NA 3H3UA 1Z21A 2Y0SA 4PGGA 2PEXA 2XHKA 4E7IA 2XRLA 3GMEA 4RMNA 3WTUC 2NS0A 2BHZA 5C4XJ 4QIWN 3GW2A 1OLTA 1YE9A 4AM3A 1H9GA 1JE8A 2KIMA 2XPUA 3CDLA 3MMYB 2CV0A 1UMQA 2HPIA 2FOWA 2WAEA 3HTSB 5TJJA 2X1EA 4PGHA 3I71A 3E5UA 2HQNA 3GO5A 4HSTA 1T0FA 3FXJA 3JRFA 3M8FA 4HLXA 5IOYA 2IGMA 1LFUP 1GHCA 3BLYA 1D1AA 5E3OA 5E8IA 1MBEA 1SFEA 2KIFA 2LY1A 3TBIA 2GM4A 2QLZA 3CCQI 4B4CA 2O03A 3MQ0A 4RM2A 4CHUA 5FJ8J 2OAZA 2DMUA 2PX9A 3EUKL 1Y1VJ 1DUXC 2HPMA 3CCJI 2FSWA 2JSPA 1YW9A 2YPRA 2VKVA 3IAS2 2VN2A 3RQ4A 3CJQB 5E3LA 5DV5A 3J7AO 1VTNC 2O8XA 3ZMUA 1QHHD 4FT8A 2BXYA 1MNEA 4MLOA 1ETKA 4RGXA 2L0KA 3LSGA 1GVDA 2CRGA 3SYTA 3IC7A 5E1WA 5D5UB 1OCTC 5A2QK 4RB1A 4L5EA 1S29A 1J75A 2CO5A 2UXXA 4ESFA 2Z33A 5IOZA 1D3YA 4FE7A 3VYRB 1OR7A 1UHWA 1XTAA 3HUGB 2JTVA 4WXCA 4HPQA 4UVBA 4D7NA 2OV7A 3JW4A 1BOBA 1HF0A 2R7TA 2IJLA 3A1YA 4G12A 4CA0A 1LE8A 1JGSA 3FKJA 1OYWA 2ZSHB 2XPVA 3DEUA 1X19A 2X6YA 4MO7A 3FXRA 2IA0A 2VASA 3HOTA 1WJBA 2NVTJ 2OTJI 1MBGA 2Z99A 1HW5A 2A6EF 3FXMA 3SQNA 5HVQC 3CCVI 1ITYA 3HOSA 4MEYF 1JKOC 3CP2A 1XX5A 1QA6A 1DPUA 4YIIA 5IP6A 4XR6A 3WTVC 3VDXA 1LQ1A 2JUCA 1IGNA 1IUYA 1MBKA 1X3WB 2JRMA 3QPHA 2DT6A 2CW7A 5EZGA 4EATA 3OS0A 3J7ZI 3S2DJ 5FFZA 2K40A 2JT1A 2R5YB 1PUEE 2FBIA 4BGDA 3PFIA 4E7ZA 5JFRA 4U7DA 3B6AA 4L9TA 3H9QA 1AWCA 2FJ1A 1PP7U 1ZHFA 3MWMA 1JT6A 2A07F 3BR2A 3FK7A 1R22A 4O6JA 1IV6A 1IXRC 1TQPA 2LFBA 4L5JA 2UXNA 2NVXJ 4Y52J 5FKNA 1R49A 2FOKA 2ZB9A 5EF6A 3BR1A 1ONVA 2KZVA 3P9KA 1W5TA 3VEPA 3FHZA 1Q1VA 3D5LA 5LHIA 1X2MA 3EUAA 4P1WA 1CQTA 3LQRA 4HV5A 2DMNA 3GYHX 2ECBA 4UVAA 3KIOA 1ETQA 1Z3YA 2Y9YA 4BHBA 3E5XA 2XPWA 3FWEA 4A5MA 4Q5SF 2V26A 2A6TA 2PI0A 1IO2A 1SD5A 2OJED 3QAHA 3BTLA 3OMYA 4MNUA 4BE0A 4HF2A 2B9SA 5F0HA 4DBQA 2NS8A 1JHHA 3VOEA 3BT9A 1LFPA 5E1XA 2E5NA 2WA0A 3K1MA 2EA2A 1FIAA 3UNGC 3KLNA 2E71A 3DCFA 3BTCA 4NHJA 2DJIA 3DTEA 2V6CA 4BXXJ 2H6CA 1FY7A 3LQQA 1VNDA 2MH2A 4JYKA 5C4JJ 5B1BH 4U7BA 1V3FA 3O8GA 1H89C 1AU7A 1O7LA 4MQVA 3L2RA 2XSDC 1LPQA 1I6HJ 1QHGA 4FQGA 1J09A 4KN7X 3L9FA 2H27A 1NH3A 3BR3A 2IBDA 3ZOBA 1G8XA 4JOMA 4KMFA 2XC7A 3GTMJ 1MMDA 4WX9A 3RQIA 3S3NA 2LBFA 2QENA 1ZRFA 2KJBA 5DTDA 4LB5A 1LKXA 1FOXA 1T0FC 2ZO4A 1GDTA 2K3PA 1W1WE 4RBOA 2R7VA 1IXCA 2OUMA 2QF7A 2V9PA 5F04A 3BG9A 2XF5A 1KONA 2EWNA 2WBMA 4I01A 1K4TA 3TGNA 4IVNA 1YHQI 4IEJA 3FXKA 2HZDA 4GXOA 2XKOA 2Y75A 3EYIA 1XGSA 2FA5A 1GV2A 1WHUA 3I9V2 1I1SA 3EUHA 1BN5A 2N8GA 2L7KA 4Y4RA 2P8TA 3QPSA 3H0GJ 2CUZA 2AXTC 1WWXA 2QQ8A 3BQZA 4AIDA 2TDXA 4F7ZA 4BU2A 3WU2C 2EZIA 2VJIA 1JXSA 3OYDA 3COAC 3EQLF 2I8DA 2Y0SN 4C9YA 1KU3A 1X58A 3GVAA 3WHBA 4LMYA 4AVPA 2QSFX 4EJVA 4QPQA 3HKZN 1XB4A 2HGCA 2VJ5A 2XAFA 2KRFA 3GLXA 3MZYA 3CJTB 3JRDA 3GF2A 1RC9A 3M07A 5DDGA 3JTHA 4IL6C 5DCFA 2BV6A 2RAEA 3LSPA 3IKTA 1SVLA 2V6EA 4HDUA 3ZQQA 1R00A 1FT9A 4LG3A 1BW6A 1KA8A 4I99C 2M5WA 4I02A 1Z1DA 4ABZA 3CESA 2HS5A 1SFUA 3VB2A 3ZMZA 2R0QC 4RLFA 1UG2A 3HPHA 2VC1A 2DTZA 2XDVA 4KIBA 1TWFJ 4L9VA 5JVTA 1F9NA 1JUPA 1R1TA 2A61A 2NRAC 4GYGA 2ZXIA 2F48A 1HXDA 5CPRB 2EIMH 3RPUA 1W7PD 3PUFA 5F0CA 1SD6A 5LGUA 1X1CA 3S93A 2RDPA 3U1KA 2K9LA 2VQLA 1QGPA 3JRGA 1FMVA 4XSZF 3W3CA 2QSGX 2BY3A 3C7JA 1ZRDA 2YSRA 2VI6A 4A5NA 4CCOA 4RS8A 3LL7A 3VFZA 1YFHA 3S15J 4HF0A 1WKMA 1RUOA 4C2MJ 1E3PA 1V5GA 4UUVA 1YQAA 4LD5A 5HDGA 1OCCH 4KT5C 3TO9A 3PIPF 1R36A 2R3SA 2MD0A 5FKLA 4D0PA 2WV1A 4U0VA 3CUQB 1Z77A 3PFYA 4X6AJ 2NNYA 3HOVJ 4IJAA 2OTLI 1TWCJ 2KIQA 1J5YA 4XLCA 5H20A 1QNTA 2NVYJ 2F5CA 4HAMA 4KIGA 2ZFWA 2EH3A 5BPDA 5EYRA 4MIMA 1MNDA 4V2FA 2CV2A 4LGWA 2AQFA 1B59A 4HYEA 4NC8A 1H88C 2E1MB 3VSKA 2ZNYA 1XS9A 3CO6C 5CYVA 4I0AA 1U8RA 2X6OA 2DODA 4G7HF 3E0JB 1ETOA 1F5TA 1ACIA 3ASNH 5C3EJ 1O3QA 2CW0F 2R92J 4PSWA 1HW2A 2DFIA 2B0LA 3E6MA 2JWTA 4BXFA 4ENNA 1VQNI 1YS7A 2NXNB 1SMTA 4NDLA 2JA7J 3CCSI 2H94A 1R9TJ 3DPTA 1DGWY 5GAGJ 3U2RA 4IQJA 4LFUA 4G94A 3WTSC 1BI3A 1L0OC 5F64A 4KT6A 1B8IA 4X0GA 4PUSA 3AL0B 1FP2A 3DFGA 2CUJA 2IGKA 1X1PA 1MSFC 5F1RA 3DBLB 2IXSA 3JSPA 5ILVA 3C2HA 3KETA 2Z9OA 1T33A 1FSEA 2R93J 1NG6A 4R8HA 4DOZA 4NBQA 2OF7A 2FMLA 3S8PA 3KEQA 1ORKA 1IN4A 2Q0OA 2O9LA 3PO2J 2DDBA 1Z3XA 2M1BA 4RB0A 1WH5A 5EG0A 1H9TA 2R7UA 3BROA 4JP0A 4MGRA 1UB9A 2JRTA 2XRNA 1Y1WJ 1A04A 3QU6A 3OOUA 4IHWA 1XSVA 2A69F 2D2WA 2PQ8A 1TZLA 4E6KG 2M30A 3P5JA 2A68F 3ABUA 3T8RA 3LSTA 3ZMDA 2L7ZA 3AG3H 3D5SC 1AA7A 3HIFA 3SZGA 2MLGA 3T0YA 4K2EA 3ERMA 2NVUB 4OINF 3KP2A 3I58A 1HOMA 1ZRCA 3ZN0A 3K4JA 4C2TA 4EMSA 2ZXJA 2L5QA 2MSYA 4A0XA 4GGGA 5JVGF 1K6YA 3K69A 4EJWA 4LG0A 3CTAA 5EDNA 3EDPA 2GOXB 5LEJA 3GLLA 2CUEA 3TW6A 1ZLKA 3SHFA 2E1OA 1D1CA 3F8BA 4QTRA 1LE8B 2E1NA 4IHYA 3A0BC 1D1BA 2G7HA 1GUUA 2FUG2 4RGUA 3GZ6A 4PFPA 1SVOA 4DJAA 4S05A 4A3MJ 1XCBA 5B66C 1T39A 3U1DA 4ESJA 1BC8C 2DA6A 4II2A 3CMAI 4XN0A 2PLYA 1IN5A 4BJ6C 3RIRA 3AG2H 3D1NI 2ETHA 3F8CA 2VT3A 5IT9Z 2MBFA 3OYLA 3L2CA 1S7AA 1WJCA 3FXQA 3ZQGA 4OAZA 5KCMA 1MNMC 4D1QA 3Q0WA 2Y2ZA 1BR2A 4MQ9F 1C0WA 4KIFA 4BUPA 1TQIA 4ZDLA 1HKSA 5AONA 4H0EA 2F4MB 1YX5A 2WTEA 3CC7I 1U5TA 4ZZDA 3KZZA 2HI3A 2LF7A 4OOIA 4C2UA 1YLFA 3WGIA 3I53A 1KQ9A 1G6NA 4ANJA 2VONA 3M1EA 2EILH 4JK1X 4ZYDA 5ILSA 3FX3A 1ODDA 5DS9A 2HYFA 2IA1A 1VQLI 3ABLH 3PQKA 4XLHA 2XF7A 3DBRB 4I76A 1A5JA 3KEOA 5KVRA 4IRIA 4M3BA 2LY2A 4NUBA 4A3BJ 4PJMA 3OR2C 2ESHA 1KQ8A 5B5EC 1G59A 2DBBA 4BE2A 2FQ3A 4E7HA 2JA5J 1MH3A 2L9SA 3R4KA 1ZG1A 1WGXA 2EA4A 2EB7A 2DOEA 1ZG3A 4BEHA 2GXBA 2EBIA 1U78A 1P92A 9ANTA 4NNJA 1J7KA 3IWFA 4A0YA 3CJRB 4HQEA 2VKHA 1E3OC 4N9IA 3ZQIA 2PN6A 3NQOA 3S2HJ 4F92B 4A3CJ 2X1CA 3NAUA 2HKOA 3T5XA 3P9IA 3AG1H 3I64A 2KJCA 1ETYA 2XGEA 5GPCA 2QSHX 1WJAA 4DGWB 4XBFA 5GP9A 2GA1A 1U9NA 5ICEA 1IJWC 1QQIA 4W97A 4DIQA 2HU9A 4ITVA 1B72A 2CG4A 1IN6A 2M8EA 3PO3J 3IHUA 4AIKA 3HZJA 2Q8KA 2WB1A 2YU3A 4BJTA 3LAJA 2W48A 1XDUA 3IKVA 2CWEA 4FETA 3DLAA 1HQCA 2E7WA 4HRIA 4Z2YA 2LBFB 3CUQA 5E20A 2EFWA 2P5VA 2ELKA 2O3FA 1VQPI 2XAJA 2EZLA 2DMQA 1V4RA 4XK4A 2F5EA 3ECHA 4WF2A 4FCYA 2FEZA 1YW7A 3M3YJ 2LP0A 3BJ6A 1IZ1A 2A6HF 2X48A 1A36A 3OYHA 3LA3A 1YITI 1FBSA 1FEXA 4M9SA 2M45A 2TRTA 3C18A 3PSFA 2E5ZA 4ZYGA 2R7DA 5HNHA 2ZC2A 3HOYJ 1MMGA 1P7IA 1R4NB 3E6DA 1FSHA 3BZ6A 3K9TA 5J47A 3KP7A 3Q0UA 4KJZA 3VODA 4CICA 1JGGA 4A3LJ 1OCOH 2ZJQF 3H9GA 3I4PA 1FBUA 2VBZA 4WCGA 3BG6A 3CLOA 2R7RA 3DXJF 1XDSA 4A93J 4JX5A 4DZJA 3ZQ7A 4RAFA 1Z6TA 1IN7A 5J1UA 5F27A 3TDUC 4AIJA 1Y6IA 1BOAA 4DW6A 3BG3A 2L54A 2GIVA 4DYQA 3CMEI 4XM3A 2H1LA 1R5ID 2ZMEA 4OIQF 5EEGA 2K27A 1HDDC 3GTQJ 1I1GA 5DUIA 1UHMA 2BY0A 3H9JA 4H4KC 1T95A 4CYCA 3WE3A 4PJ0C 1RETA 1E0EA 3WTWC 3J80K 3R60A 3OIPA 1WRJA 2XGCA 4II3A 1JKPC 2ZJ2A 1FMWA 4NQWA 4OU0A 5AIPA 3RYPA 4X1EA 2WC2A 3C1DA 1XMAA 1HDPA 4IF4A 1Z91A 1WPKA 5BQTA 4Q4ZF 2CGPA 3K2ZA 2RQQA 1PJRA 2WAQA 3ZQCA 3OL3A 2FQ4A 3O3KA 3HDDA 1WJ5A 1USSA 1CF7A 2O8KA 3SZTA 2F2EA 3I54A 3W2AA 3WU0A 4B1RA 3RTRA 1EF4A 2GA2A 1FIPA 5FD5A 2PMZA 2VOPA 3K10A 1DP7P 2Z16A 2EIJH 4MEXF 1KU7A 3NEUA 3RI4A 1IG7A 1SD7A 2LRDA 3F21A 2HNHA 3DKXA 5EEAA 3ZQFA 1P2FA 1SFKA 4M72A 1MW7A 1T6SA 3NRVA 4O5VA 2JA8J 1BR4A 4RGSA 3S3OA 1ETXA 4B48A 4IOCF 1QVUA 5BPIA 2KLOA 2LD5A 1ULYA 3G1LA 4N0BA 2GQQA 3G6EI 1DQUA 2DFEA 2DPDA 2DT7B 4HEA2 5D4SA 2J5OA 2LKSA 2CQNA 3A03A 4A3FJ 5D5XB 1S6LA 4FISA 1MMSA 3H1CA 2JA6J 2D45A 1LUJB 5DM6F 1BIAA 2M34A 2H09A 4S04A 3W6KB 4ZDOA 5HS7A 2P4WA 2VQCA
chains in the Genus database with same CATH topology
2V4JC 4BU2A 2ZSIB 2VJIA 4RM3A 3OYDA 2LG4A 2I8DA 2LREA 3VSLA 4C9YA 2XAUA 1X1DA 3QYFA 4B44A 2CFOA 4IKFA 4QPQA 4E4HA 4Y3OA 2VJ5A 1V5EA 2LH9A 1SAUA 2KRHA 3DTIA 4ZTJA 3ZR8X 2W1OA 1ERDA 4BDZA 2RREA 4BACA 3VYUB 3PNVA 4B3XA 4KISA 2V6EA 2VKDA 3ZQQA 4LG3A 4IQ4A 3L2VA 1UAAA 3UR3C 2BVLA 2W4SA 3CESA 1Z7LA 2HDWA 3NWSA 4CCLA 3FDYA 2KDOA 3RSNA 3VWBA 2HQAA 4RLFA 3HPHA 4YELA 2XDVA 2HVRA 2K5CA 3L2UA 3OL4A 4ZYAA 3HPGA 2ZFUA 2ZXIA 3M8JA 4XORA 3OS1A 2R7XA 2M3AA 4XLAA 5CPRB 3K4LA 2DXIA 1X1CA 3S93A 2K9LA 2VQLA 1BR1A 4HNUA 4IZZA 1FMVA 3W3CA 3FBIB 4XQFA 4CCOA 4NC7A 2VXZA 2MFZA 3W2WA 4CSWA 2OC6A 2LC2A 3LL7A 3IAM2 4B47A 2IS1A 5JHFA 2BOLA 3H35A 3HKZA 1V5GA 1X4OA 2KMUA 4HG2A 2HVSA 3HG9A 2WADA 4XLFA 4HSRA 2MD0A 2L2OA 2X85A 4PK4A 1GLNA 3PFYA 2VJJA 4XMYA 2Z2SB 3DEEA 2X1DA 4CH7A 4XLCA 2QKLB 2IGNA 5FRNA 2XF6A 2X51A 2JVHA 4BQQA 3A4CA 1YX3A 2R7OA 2E1MC 3DPLC 1NG7A 5FRMA 2R7WA 1X1AA 2M4GA 4J00A 2VQHA 3OY9A 1MNDA 3OIQA 3OYFA 2CV2A 2AQFA 3PSIA 4F55A 4F91B 4NC8A 2E1MB 3VSKA 5HLTA 3OR1C 5CQEA 4AYBA 3K4NA 4P5OA 1W36D 2VQGA 2WY7Q 1DP3A 3E0JB 5HOOA 2IS2A 4CUGA 3S3MA 2CMPA 3V42A 3DWLE 4KITB 4PSWA 1X4PA 2Q1ZB 4R79A 4E7KA 3D5RC 3K6GA 4C30A 4BXFA 3ZRGA 3FHNA 3L2WA 3H5AA 4FASD 3DPTA 1DGWY 4BS9A 4IQJA 3AL0C 3K4BA 3LSKA 4BQOA 3MKYB 1W36C 3PNYA 2BVMA 3G2BA 4KT6A 4JQFA 2M7AA 2V9KA 4X0GA 4PUSA 3AL0B 2M7BA 3RCOA 2DCEA 4ZJZA 2CUJA 2IGKA 3ZCOA 4J01A 2IXSA 3HC7A 3CF2A 3C2HA 3K70D 1NG6A 4DOZA 4F52A 4BE1A 3S8PA 5KNLA 1IRXA 3DU6A 2KL4A 1Z3XA 2M0MA 2MABA 3HL2A 2R7UA 2R7QA 3LSMA 4DBRA 2BW3B 3K4KA 3MKWB 2IS4A 3OOUA 3OWTA 3K70C 1TZLA 4E6KG 2VPLA 4E7SA 4ZDPA 2Z1DA 3E1SA 4CCMA 2PJRB 4ZC3A 2CV1A 3D5SC 3J7AY 1AA7A 2CW8A 3H5RA 2W82A 2JUGA 4N4NB 4RLQA 4XKWA 3SZGA 4BQNA 1WJFA 3H0DA 2WY8Q 4D9JA 1OR7C 3IP4B 3QOEA 4BEHB 4OAYA 3K4JA 1LDKB 4C2TA 1Y56A 2L5QA 5TGTA 5LD2C 1K6YA 1WFXA 3I3LA 3DTKA 3DU5A 2GOXB 2L9NA 4F3QA 4GRIA 1D1CA 3OYAA 2F5VA 4Y33A 1U0JA 3KEYA 4CCNA 1D1BA 4XOPA 3K4MA 2VXDA 3MKZA 2O5RA 1WJDA 2FUG2 1JI8A 4PFPA 4XONA 3U21A 1Z21A 2Y0SA 4DJAA 5KHDA 4E7IA 4RMNA 4II2A 1OLTA 4XN0A 2RNGA 1YE9A 4ZTFA 4BJ6C 3OYNA 2MYSA 2M4KA 2VB6A 3MMYB 2CV0A 2F6CA 2HPIA 2WAEA 3N05A 3OYLA 2X1EA 3OYIA 1UELB 5FROA 2UV1A 4HSTA 4IX7A 1WJCA 4OAZA 5KCMA 2JA2A 4D1QA 2Q2EB 1BR2A 4BUPA 2IGMA 4ZDLA 1YX5A 2ZXHA 1D1AA 3BLYA 3DKYA 5CKTA 2P0WA 3HXLA 3TBIA 2LY1A 4U87A 3A2KA 4C2UA 1N77A 4RM2A 2VL8A 3L2QA 3SEZA 1EA3A 3EUKL 4PSXA 4ANJA 3DQVC 3LSIA 2HPMA 2BW3A 2IGOA 2JSPA 3SDBA 4XLHA 2XF7A 3IAS2 4XOTA 3RQ4A 1PYVA 3CJQB 3BC8A 2UUZA 4PJLA 3W2VA 4PJNA 2LY2A 4NUBA 2GOMA 2CH0A 4PJMA 3CP8A 3OR2C 1QHHD 4XKCA 2PJRA 1G59A 1MMAA 1MNEA 2X6WA 4MLOA 2VLAA 4BE2A 1DGRM 3F9KA 1N78A 2MC4A 4E7HA 3LSGA 2L9SA 3SYTA 2R4GA 4CZCA 2X6XA 3MD2A 4BEHA 2XSJC 4N4OB 3FBNB 2UWMA 4NNJA 2F4IA 3CJRB 3VYRB 2VKHA 3EPZA 3HUGB 4QPOA 4NQWB 4F92B 4HPQA 2X1CA 2OV7A 2DOAA 2V7FA 1BOBA 2R7TA 4XL9A 3A1YA 4CA0A 3FKJA 3ZXSA 2ZSHB 4XKBA 1X19A 1WJAA 2KQRA 4OWRB 4DGWB 2X6YA 3OYKA 2VASA 3HOTA 3PNTA 1WJBA 4G6TB 3TL4X 2E60A 3H5NA 4DIQA 2HU9A 4ITVA 5HVQC 3HOSA 3QYEA 3KX2A 3CP2A 2CS3A 3C2GA 2WB1A 1MMNA 1ZELA 4BJTA 4XR6A 3VDXA 2ELJA 2V1NA 4FETA 3DLAA 3PJRA 2DT6A 2CW7A 4HRIA 2LBFB 4EATA 3OS0A 3OS2A 1D0XA 4B43A 3OYBA 2IS6A 2VIXA 4BGDA 4E7ZA 2KPMA 3OYEA 1LVKA 1TT0A 5CQGA 1N75A 3H9QA 3VYTB 3OYHA 4E7JA 3VYSB 4XKVA 3EUHC 3PSFA 2E5ZA 3SEQA 5HNHA 1P9QC 4LIUA 1MMGA 1D0YA 3IUOA 2KHMA 3M1CA 2HVQA 4YRVA 3OYMA 2KZVA 3ONQA 4KJZA 2QKMB 3D5LA 3LMMA 3H9GA 2WAFA 4CCKA 3BG6A 3TMOA 3ZGKA 3EUAA 4P1WA 4F93B 3OYJA 3CZ6A 2R7RA 1QU3A 2KRCA 4XLEA 4AU7A 3K4CA 1Z3YA 4AVZA 1R6RA 2KP6A 4YEJA 1Y6IA 2NOJB 3AFHA 2V26A 2A6TA 4XM3A 3QODA 4LITA 3OMYA 3RPUD 4BE0A 3DPUA 1VZ0A 2LYCA 4DBQA 3H9JA 4H4KC 1T95A 3AKZA 1LFPA 1E0EA 2E5NA 2WA0A 3BCAA 3OIPA 4II3A 1FMWA 3UNGC 3GBGA 2R7SA 3CMMA 2DJIA 3OYCA 3S32A 3DTEA 1X1BA 4BJ5C 1UG0A 3PUBA 2RQQA 4U7BA 1PJRA 2WAQA 2W7NA 3OL3A 3L2RA 4BDYA 1HA8A 5LFAA 4HNTA 3NWTA 1WJ5A 1QHGA 2AQEA 1J09A 4XNFA 3W2AA 1D0ZA 3RTRA 2PMZA 2LOOA 3BCBA 1G8XA 3BG7A 3K10A 4JOMA 4PJJA 4PFOA 2Z16A 4LIVA 2XC7A 1MMDA 1WJEA 5HNFA 4E7LA 4CCJA 3S3NA 2LBFA 4XN3A 2LRDA 2HNHA 3OYGA 3DKXA 1SFKA 1LKXA 1MW7A 1T0FC 1BR4A 2K3PA 3S3OA 4B48A 4BL0B 1S9HA 3QYBA 2KLOA 2R7VA 2OUMA 1DQUA 1KONA 2XF5A 2DT7B 2WBMA 2JVGA 4HEA2 2W00A 3PL8A 2HZDA 2K9MA 3LFUA 3I9V2 2VJ4A 1V5FA 2L7KA 4Y4RA 3KYLA 3LSHA 2CUZA 4ZDOA 2VQCA 2A5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPQ A;  4QPO A;  1DP3 A;  3OMY A; 
#chains in the Genus database with same CATH topology
 2VC0 A;  2MG4 A;  4RM3 A;  2LG4 A;  1FP1 D;  2EPF A;  1POG A;  2XAU A;  4LLN A;  1X1D A;  2DA2 A;  3QYF A;  2DMT A;  4PDK A;  2EFQ A;  3KP4 A;  1FBQ A;  1YG2 A;  1U9O A;  5M3M J;  1V5E A;  1OPC A;  1R4M B;  1X3Z B;  3WTZ A;  1SAU A;  1TLH B;  1WI9 A;  1Y0U A;  1MBH A;  1YS6 A;  3MCZ A;  3F23 A;  1J59 A;  4M6X A;  1FJL A;  1WH7 A;  3DTI A;  5IPA A;  1VQ9 I;  4ZTJ A;  4I6Z A;  2W1O A;  2K9N A;  2JSC A;  4BDZ A;  3S1Q J;  2RRE A;  3QPT A;  4EJU A;  3VYU B;  3PNV A;  1B8I B;  2ESN A;  2VKD A;  1UJ8 A;  1HLV A;  4Q47 A;  1ZGJ A;  3N97 A;  5IYD J;  1IAW A;  2F5F A;  2HDW A;  3NWS A;  1LDD A;  4CCL A;  2BE5 F;  1FTZ A;  1BJZ A;  1TWA J;  3GZN B;  4A3I J;  4KNY A;  1Z0X A;  1J9I A;  4YEL A;  5BS6 A;  3FXL A;  4DYR A;  3JSO A;  1VQ4 I;  2MD5 A;  1YRN A;  2QBY B;  5DCM A;  5EG0 B;  2M3A A;  4XLA A;  1KQ0 A;  3ESW B;  3GWZ A;  3PM1 A;  1A6I A;  2DI3 A;  1RIO H;  3KZY A;  2HTJ A;  1O3R A;  2VBY A;  3LA2 A;  5IT9 K;  4IPA A;  2DFH A;  2XAG A;  2P7C B;  3JRC A;  4XQF A;  2GXA A;  2H8R A;  3TQN A;  1KGS A;  2VXZ A;  3S2W A;  3HRM A;  3IAM 2;  4B47 A;  4P55 A;  2COM A;  1TC3 C;  1ZQ3 P;  1UCR A;  3ECO A;  1X4O A;  2HVS A;  2IA2 A;  2QZ8 A;  1GV5 A;  5F0F A;  3WG7 H;  4AUX A;  1V54 H;  5FLV A;  1S8N A;  2X85 A;  3KZI C;  2CYY A;  1GLN A;  4WXH A;  4QLC U;  3DBH B;  3OSG A;  2YU9 J;  1GXP A;  2CSO A;  1EKE A;  2PJP A;  2X1D A;  3HB9 A;  3TDZ C;  4LG0 B;  1RR8 C;  3BP8 A;  1YX3 A;  3L09 A;  2E1M C;  2RC4 A;  3MN2 A;  1NG7 A;  5FRM A;  1X1A A;  3HSE A;  2M4G A;  3PSI A;  4F91 B;  3ASO H;  5LBQ A;  5B3S H;  2M87 A;  2JN6 A;  2R7F A;  2B7E A;  2J5P A;  2QM3 A;  4AYB A;  1BA5 A;  4P5O A;  1W36 D;  1QO0 D;  3HGY A;  4CYD A;  3O6B B;  4CUG A;  2PMU A;  2CMP A;  3AG4 H;  4KIT B;  1SD4 A;  2EFO A;  4E7K A;  3D5R C;  2WB1 N;  3K6G A;  4C30 A;  3BOQ A;  4YG2 F;  1P7J A;  3ZRG A;  3ZP5 A;  3FHN A;  1VI0 A;  3HJE A;  1SMY F;  2E2J J;  2MW8 A;  3QOP A;  2DA5 A;  2G0E A;  1O57 A;  4BS9 A;  2E2I J;  3AL0 C;  2ME6 A;  2OCC H;  4BQO A;  5LEK A;  3MKY B;  1YIJ I;  1W36 C;  3GEZ A;  2A5Y B;  3KP6 A;  3RKW A;  4JQF A;  1XGM A;  2M7A A;  2V9K A;  4EV0 A;  1NHA A;  4HX4 A;  1FYK A;  2VBX A;  1OJL A;  3KCC A;  4M6V A;  1BI0 A;  2W25 A;  1U5T B;  4J01 A;  5DM7 F;  4U88 A;  3GTG J;  2ZKZ A;  4HZF A;  4F52 A;  1LNW A;  1XGO A;  4M9Z A;  5KNL A;  4M71 A;  2K7L A;  4BE1 A;  3WTY C;  1PP8 F;  4EM2 A;  1IN8 A;  2HQ5 A;  2M0M A;  1D5V A;  4IRH A;  2FE3 A;  4HA8 A;  2ZCW A;  4DBR A;  3K4K A;  1KYW A;  2M2E A;  3QRF F;  1T2K A;  2IS4 A;  3CMY A;  1FOY A;  2HDD A;  2QQB A;  1HBX G;  4XRS G;  4UV8 A;  5L3C A;  3ABK H;  1RNL A;  2YUS A;  3RKX A;  3E7L A;  3IH4 A;  2QYO A;  2AS5 F;  2DQR A;  2Z1D A;  3E1S A;  1DU0 A;  4ZC3 A;  1U3E M;  2FU4 A;  1QZZ A;  3GZ5 A;  4MTD A;  2CW8 A;  4I2O A;  2CFX A;  2W82 A;  4MTE A;  1NK3 P;  4LK1 F;  4BQN A;  1WJF A;  3H0D A;  1KZH A;  1F36 A;  4KFC A;  3AAF A;  3HTU A;  1OR7 C;  5M3F J;  3IP4 B;  4BEH B;  4OAY A;  1LDK B;  2RQP A;  3WGG A;  3DKW A;  3OSF A;  5DD4 A;  3LAP A;  1DDN A;  2DW4 A;  3ZMS A;  3DTK A;  3DU5 A;  4JX6 A;  4RB2 C;  2DMP A;  2DA4 A;  4M6Y A;  4A2U A;  2OQR A;  4WXD A;  4A69 C;  3S14 J;  5H6R A;  1JJ6 C;  2JQ7 A;  5L3G A;  4Y33 A;  1RZ4 A;  2B63 J;  3JRA A;  3K4M A;  2VXD A;  3O2P E;  1WJD A;  4IO9 F;  3G1O A;  3HRU A;  4XON A;  3A0H C;  3S1R J;  5KHD A;  1PUF A;  1LB2 A;  1UST A;  4TV7 A;  1MJA A;  3CC4 I;  1B72 B;  3DLL F;  1BW5 A;  5LLQ A;  3O8H A;  4MFD A;  4ZTF A;  3TO6 A;  1T56 A;  1QZE A;  2XB5 A;  3OYN A;  5BOX A;  3T8T A;  2MYS A;  2M4K A;  4UVC A;  1ZG5 A;  2Y9Z A;  3CLQ A;  4I0B A;  2CQK A;  5HDN A;  3BQY A;  2UV1 A;  2NS7 A;  4IX7 A;  5EZH A;  1SAX A;  1I3A A;  2JA2 A;  1SFX A;  2K85 A;  5CLS A;  3Q5F A;  2EZH A;  3CC2 I;  1YO5 C;  2FNP A;  2LMD A;  2ZXH A;  5CKT A;  5FD6 A;  2P0W A;  3WTT C;  3HXL A;  4FX4 A;  4ZYE A;  4U87 A;  3A2K A;  4KDP A;  3Q3S A;  2E19 A;  1I3Q J;  2ZJR F;  2PG4 A;  1VF9 A;  2BHY A;  2ADU A;  4YFN F;  3KYC B;  4HW0 A;  3ZQL A;  1NK2 P;  1YIO A;  3RJP A;  2DQL A;  2HOS A;  2GXG A;  1U6G A;  5FKM A;  2R7Z J;  3JTG A;  3DQV C;  2ID3 A;  2A05 A;  3JR9 A;  5D8K B;  2TCT A;  1VQ7 I;  5E8G A;  4EJO A;  5L3F A;  3G3Z A;  1B1B A;  1XPX A;  1PYV A;  3MFK A;  4U0W A;  3QWL A;  3M7G A;  2CH0 A;  3JAM Z;  1Z05 A;  4EEF G;  3CD6 I;  3CP8 A;  5CVV A;  1H0M A;  3BR0 A;  2DN0 A;  3R61 A;  1K4S A;  3K0L A;  1I39 A;  1VQM I;  4Y7N J;  2X6W A;  3HOU J;  1DGR M;  3F9K A;  2MC4 A;  1ON2 A;  2ZME B;  3GUD A;  2R4G A;  3B6C A;  4LLG F;  2AXL A;  2NOG A;  2X6X A;  3FXO A;  3WE2 A;  2LF8 A;  2XSJ C;  3HRT A;  3FBN B;  5ICF A;  2UWM A;  3LWF A;  1ZGA A;  2F4I A;  4BKX A;  4CYC B;  3EYY A;  3HM5 A;  2D1V A;  4WK8 F;  3EPZ A;  4LLL A;  4HX8 A;  4QPO A;  1ZKG A;  3L7W A;  4NQW B;  1GVJ A;  2QBY A;  2EFP A;  3RDI A;  1CGP A;  2GIZ A;  4W1U A;  2C6Y A;  2CQX A;  4XL9 A;  5IY5 H;  2PMH A;  2OPT A;  2EIN H;  2O0Y A;  2ISZ A;  3IH3 A;  3C2B A;  3TW7 A;  1W5C C;  2KQR A;  4OWR B;  1IC8 A;  2LR8 A;  5FLX Z;  2K86 A;  2D1H A;  3V8L A;  2BZT A;  3PNT A;  2UZK A;  4G7Z F;  3TL4 X;  2E60 A;  2K9Q A;  3H5N A;  1CF7 B;  1TW3 A;  2XGD A;  1TP4 A;  2VOO A;  2STW A;  2KKO A;  3KX2 A;  2CS3 A;  1ZRE A;  1UZC A;  1MMN A;  3BG5 A;  2QUF A;  3IV5 A;  3MVP A;  1T98 A;  4BHP A;  1LVA A;  3KFW X;  4L9N A;  3PJR A;  3F3X A;  3V4G A;  1RKW A;  1N25 A;  3N4M A;  1FTT A;  3CDH A;  4XRM A;  4OIP F;  2RN7 A;  4PCQ A;  3KE2 A;  1LVK A;  1TT0 A;  2NAZ A;  2E1C A;  2EIK H;  1N75 A;  3VYT B;  1IF1 A;  2HXO A;  4XLN F;  5HS8 A;  1TTY A;  4E7J A;  3VYS B;  5K7F A;  2MLK A;  3M8E A;  1L3L A;  4XKV A;  3LFK A;  4A6E A;  3EUH C;  2LDU A;  3RKY A;  5M5X J;  3FZV A;  4LIU A;  1J2X A;  4JBA A;  2CJJ A;  4FTH A;  2ECC A;  3SJM A;  2MGQ A;  2HVQ A;  1EV7 A;  3OYM A;  1E2X A;  2L9V A;  3ONQ A;  1U2W A;  3I56 I;  4EJT A;  3LMM A;  3SFI A;  3BR5 A;  3ZGK A;  3OYJ A;  4ESB A;  4Z6Y A;  2KRC A;  2JK3 A;  4XLE A;  4AU7 A;  1FZP B;  4LOC A;  1UFM A;  3K4C A;  4AVZ A;  1R6R A;  4AWX B;  2KP6 A;  4DNC A;  3JRE A;  3K2A A;  2HEO A;  1Y8Q B;  3AFH A;  1NTC A;  2OZ6 A;  3ZMV A;  2EZK A;  1R71 A;  1JKQ C;  3QOD A;  4LIT A;  5HLG A;  4AIH A;  3S1N J;  2V9V A;  3RPU D;  3KP3 A;  5HS9 A;  4ETS A;  1MH4 A;  3FKI J;  4AC0 A;  4GO1 A;  1RRJ A;  1IDY A;  2LYC A;  4FX0 A;  1HCR A;  2KDZ A;  5IT3 A;  1JTX A;  3G4S I;  1O3T A;  4EM0 B;  2IEK A;  1O3S A;  2EQR A;  3V7C A;  1FOK A;  1R23 A;  3GBG A;  1D8J A;  3FMR A;  3ML6 A;  5GTI C;  2BGC A;  4EGY A;  4ENM A;  2QQA A;  1IRF A;  4RAG A;  5TIS C;  5J1Y A;  3HOX J;  1X1B A;  4V19 K;  4BAY A;  1YRN B;  1RKT A;  5DCM B;  1O7F A;  2W7N A;  2K02 A;  1A35 A;  5K1Y A;  4P9F A;  1HA8 A;  2FX0 A;  4XRF A;  3NWT A;  2EK5 A;  1KU9 A;  4HNT A;  5GAD J;  2Y30 A;  2LKX A;  2AQE A;  3ELK A;  4XNF A;  2OA4 A;  4L0Z B;  1D0Z A;  2H6B A;  2LOO A;  2EJR A;  3BG7 A;  3Q9S A;  1Y39 A;  3GFI A;  2G7U A;  2L01 A;  4LIV A;  2QA4 I;  5LRR A;  1R1U A;  4E7L A;  1WJE A;  3ZPL A;  1Z6R A;  5GPA A;  3WG9 A;  4CCJ A;  4XN3 A;  1HKT A;  1A31 A;  3OYG A;  2VOD A;  5M5Y J;  2IAI A;  5EGO A;  1JT0 A;  3GFL A;  3HSR A;  5M5W J;  2RGV A;  2BY2 A;  3FM3 A;  4YFK F;  1G3S A;  1VQ6 I;  3G73 A;  5IYC J;  4IHX A;  1ZN2 A;  4BL0 B;  2EV6 A;  3H92 A;  4BBR J;  2JVG A;  1RUN A;  2W00 A;  4MHG A;  3M4O J;  3BY6 A;  1YJW I;  1K7A A;  4L5I A;  2K4B A;  2KT0 A;  2K9M A;  3MZH A;  1O4X A;  3BZC A;  3S1M J;  3UKG A;  2F5D A;  1FNN A;  2VJ4 A;  3KYL A;  3MEX A;  1EH6 A;  5J8C A;  1WQ2 A;  1G3T A;  3Q0V A;  2A5W A;  2V4J C;  3V8J A;  5HOD A;  2RNJ A;  1ZLJ A;  2LRE A;  3U9G A;  4R1H A;  4WWC A;  4M73 A;  1Z7U A;  1SC7 A;  3VPR A;  1Q1H A;  1FYM A;  4IKF A;  5JHU A;  4A3G J;  5KK1 A;  1G2H A;  4E4H A;  3E97 A;  4Y3O A;  2CU7 A;  2MC3 A;  2DYR H;  2LH9 A;  4C3I J;  3FMQ A;  5CVI A;  2Z5U A;  3WGH A;  2VUM J;  1WSU A;  4UNO A;  2XAH A;  3R0J A;  1I27 A;  3HBL A;  2LNB A;  3ZR8 X;  3L00 A;  3OIO A;  3BZK A;  4KA4 A;  1TL8 A;  3F8M A;  3A02 A;  2IRF G;  4B3X A;  3OV8 A;  5LRS A;  1UHS A;  2VKE A;  1G3W A;  1ZYR F;  4IQ4 A;  1UAA A;  2BVL A;  2W4S A;  3FDY A;  2DA1 A;  3RPQ A;  2FBH A;  4BHC A;  4UUS A;  2HQA A;  3VWB A;  2DK5 A;  4UHT A;  5J8F A;  4HBL A;  4GFB A;  3L2U A;  3OL4 A;  2FBK A;  4ZYA A;  2GWR A;  1XCV A;  2ZFU A;  3OS1 A;  3M8J A;  1ZAO A;  2R5Z B;  4B09 A;  3K4L A;  4A12 A;  2DXI A;  3F6O A;  3HOW J;  2Y48 A;  2FNA A;  4D5C A;  1S7O A;  4HOB A;  2L7F P;  1BBY A;  5D6F A;  2OCE A;  4NC7 A;  4CGZ A;  3KP5 A;  2M9H A;  4CSW A;  2LC2 A;  2IS1 A;  1R1V A;  5ED4 A;  1XSX A;  5JHF A;  2QCO A;  1B9N A;  3V7R A;  2EV5 A;  2GAU A;  5FLM J;  3HKZ A;  2KMU A;  2VT2 A;  4HG2 A;  3HG9 A;  2QEX I;  2WAD A;  5E17 F;  4HSR A;  1R58 A;  4PK4 A;  4XSX F;  2D5V A;  1QZY A;  2P5K A;  4CDG A;  4XMY A;  2Z2S B;  3DEE A;  2GZW A;  1XD7 A;  4FHT A;  4UB6 C;  4CH7 A;  2H1K A;  4J19 A;  5FRN A;  5BMZ A;  1REP C;  3B73 A;  4RA2 A;  2JVH A;  4BQQ A;  1YJ9 I;  1P4A A;  2HYJ A;  2QVO A;  2R7O A;  2DA7 A;  3DPL C;  3F8N A;  2DT5 A;  3ABM H;  1IXS B;  2VQH A;  3HRS A;  3LSJ A;  4G6D A;  3OY9 A;  3OYF A;  1JJ8 C;  1EJ9 A;  4F55 A;  3ZMT A;  5C44 J;  1TQM A;  3JAM K;  4A3E J;  2G9W A;  3BPX A;  3OR1 C;  1PUF B;  2Y0M A;  2X0L A;  3E6C C;  2VQG A;  4KIC A;  1DP3 A;  1Z67 A;  3V42 A;  3DWL E;  4I98 B;  4R79 A;  1ZH5 A;  2HDC A;  1QBJ A;  1ZAR A;  4JX4 A;  4HLY A;  3H5A A;  1SFO J;  1Y8R B;  4FAS D;  3P9C A;  1B6A A;  4D7M A;  3I59 B;  3LSK A;  2JJ7 A;  3GXO A;  1M1E B;  1K61 A;  3PNY A;  1U5T C;  3PIO F;  1J0R A;  1I6X A;  2BVM A;  3G2B A;  4NB5 A;  3GTJ J;  4OIO F;  1H8A C;  2DCE A;  4GYI A;  2QQ9 A;  3DV8 A;  1MSE C;  5ERI A;  5FKK A;  3HC7 A;  4A3J J;  1VQ8 I;  1MBJ A;  3CF2 A;  5F1J A;  3K70 D;  1OYI A;  5L3E A;  2DJN A;  2VPR A;  3HHH A;  3FIW A;  2BEO A;  5KAI C;  4C3J J;  5FLX K;  4HDV A;  2QWW A;  3DU6 A;  3NAR A;  2KL4 A;  5HDK A;  3GTO J;  1XGN A;  1IRG A;  4N9H A;  2MAB A;  1A6Q A;  1AKH A;  4I7H A;  2MA3 A;  4M9X A;  4M3F A;  3LSM A;  1B4A A;  1X3U A;  2L4M A;  5ICG A;  3IL2 A;  5E3N A;  2DTR A;  3OWT A;  4E70 A;  4YFX F;  3K70 C;  1RPW A;  2W84 A;  2ZXW H;  4Y13 A;  4E7S A;  5DD8 A;  3BWG A;  3V7S A;  3ISP A;  1V55 H;  3BPV A;  4CCM A;  5JI6 A;  2CV1 A;  4ENK A;  3LA7 A;  1FC3 A;  1OYY A;  2IW5 A;  4RLQ A;  4XKW A;  3TKY A;  3IWZ A;  2O6G E;  2WY8 Q;  1E17 A;  3QOE A;  4I09 A;  1HC8 A;  1W7P A;  1Y56 A;  2XKP A;  4RAZ A;  5TGT A;  3F22 A;  3S16 J;  1OCR H;  3MAJ A;  3CUO A;  4UB8 C;  1FOW A;  1IRZ A;  5K5O A;  2OU2 A;  1TNS A;  3MZ8 A;  2L9N A;  1YYV A;  3LOC A;  3DP7 A;  3I4M J;  3OYA A;  4YIF A;  4ZZL A;  2F5V A;  1U0J A;  2DAO A;  3J7Y J;  2JMW A;  3KEY A;  4CCN A;  1MZB A;  1SAN A;  1ON1 A;  2CUF A;  2MH9 A;  4HV6 A;  5CJ9 A;  2O5R A;  4BY7 J;  4S0H B;  3MKZ A;  1Y0N A;  3HEF A;  5GAE J;  3U21 A;  5KAF C;  2HOT A;  3A01 A;  1MDM A;  5JLW A;  2IVM A;  2HYG D;  1KU2 A;  4LK0 F;  2RNG A;  4M74 A;  4EGZ A;  3CUQ C;  2EV0 A;  2VB6 A;  2A3S A;  1JHF A;  2F6C A;  3QPL A;  3N05 A;  3RZO J;  3CJN A;  4Y15 A;  3OYI A;  2BXZ A;  4UXN A;  1MBF A;  1UEL B;  5FRO A;  4FE4 A;  3CO7 C;  1ENH A;  4DZP A;  2Q2E B;  4RGR A;  2P6T A;  3DKY A;  4XID A;  1N77 A;  1LFB A;  2VL8 A;  3LNQ A;  3L2Q A;  2XIG A;  3SEZ A;  1EA3 A;  4PSX A;  2FMY A;  2OQG A;  2FF4 A;  3LSI A;  2Y31 A;  3E5Q A;  2BW3 A;  5K5R A;  2IGO A;  1OCP A;  1YOV B;  3QQA A;  3WOD F;  3SDB A;  4D5F A;  2I10 A;  4XOT A;  2K4J A;  4PJL A;  3BC8 A;  2UUZ A;  2L3D A;  3W2V A;  4PJN A;  1PDN C;  2H8W A;  2KIU A;  2GOM A;  5FKO A;  4BBS J;  1S5L C;  2ICW G;  2OBP A;  4A0Z A;  2ZME C;  3S17 J;  5JLX A;  4XKC A;  2HKX A;  2PJR A;  2W85 A;  3I4N J;  1MMA A;  1TW2 A;  1AOY A;  2VLA A;  4U0Y A;  1N78 A;  1JTY A;  1S3J A;  1T08 B;  2XUB A;  2AO9 A;  1T38 A;  4CZC A;  3MD2 A;  3GTP J;  1P4X A;  4N4O B;  1IDZ A;  1JUM A;  3I0T A;  4KMU X;  1X2N A;  1FLI A;  1XMK A;  2XVC A;  1XN7 A;  1K78 A;  2AHQ A;  2F4O B;  1LEA A;  1RI7 A;  3IRR A;  1I5Z A;  2R5Z A;  3WHC A;  2YS9 A;  4L9J A;  2DOA A;  2V7F A;  1LEB A;  3ZXS A;  3MKL A;  2HXI A;  5FGM A;  3FMS A;  4XKB A;  4MFE A;  4A6D A;  4IOA F;  5DYM A;  6PAX A;  5DUK A;  2STT A;  3OYK A;  4G6T B;  4EVI A;  5E79 C;  1EH7 A;  4G9Y A;  1WCM J;  1GXQ A;  1BL0 A;  3QYE A;  3F0C A;  2O7O A;  3TO7 A;  3C2G A;  4EQQ A;  2CQ7 A;  1ZEL A;  4NC6 A;  5GAH J;  1Z9C A;  3F72 A;  4G8X A;  5ICC A;  2ELJ A;  2V1N A;  4ZH4 F;  5J4Y A;  4IHT A;  2NVQ J;  3OS2 A;  1D0X A;  1U8B A;  4B43 A;  1QPM A;  3OYB A;  2X9D A;  5EGO B;  2IS6 A;  2VIX A;  4G7O F;  2KPM A;  3OYE A;  1XG1 A;  3JRH A;  3V8K A;  4IXA A;  5CQG A;  2FRH A;  1OIS A;  2P5L C;  3CCE I;  3SEQ A;  3HOZ J;  3GCM A;  1P9Q C;  3FXU A;  1WZ2 A;  1VFC A;  1D0Y A;  3IUO A;  1BM9 A;  2WAQ N;  2KHM A;  3M1C A;  1FPQ A;  5F08 A;  4YRV A;  2NNN A;  1W0T A;  2ID6 A;  4CO8 A;  3ROU A;  1S72 I;  2QKM B;  2E34 A;  4Q48 A;  2L9R A;  2WAF A;  4CCK A;  2M8G X;  3TMO A;  4B8X A;  2YX7 A;  4F93 B;  3IH2 A;  3CZ6 A;  5FFX A;  1QU3 A;  2ELH A;  2PMZ N;  3OOP A;  3DF8 A;  3TP3 A;  3J81 Z;  1D5Y A;  2FD5 A;  2HFH A;  2GLO A;  5F6F A;  5FO5 A;  4A3D J;  3H3Z A;  1B9M A;  4YEJ A;  3QU3 A;  3RZD J;  2NOJ B;  3I59 A;  4QWQ A;  1ZGW A;  3K7A J;  3CDI A;  2Y69 H;  2DDA A;  1S7E A;  2DFF A;  5E3M A;  1XC5 A;  3EET A;  4HQM A;  3DPU A;  2HOA A;  2LY9 A;  1VZ0 A;  3GX4 X;  5HLH A;  3AKZ A;  1TWG J;  3R6S A;  4DYC A;  4BY1 J;  4HF1 A;  3HUG A;  4Y17 A;  3BCA A;  2BBY A;  2W57 A;  2XRO A;  2R7S A;  5JR3 A;  1ZR2 A;  3CMM A;  2V1U A;  3JRI A;  3ERE D;  4UUS B;  3OYC A;  1W5S A;  1HKQ A;  3S32 A;  4BJ5 C;  5J1R A;  1UG0 A;  5IP7 J;  3PUB A;  5D5W B;  3SFZ A;  5BNG A;  5J40 A;  4IRG A;  1VQK I;  2WV0 A;  3J80 Z;  5HLI A;  3JRB A;  1LDJ A;  2DYS H;  5J6X A;  4CXF A;  1K83 J;  1MGT A;  5LFA A;  4XRS A;  4YIR X;  3CCR I;  4BDY A;  3HGG A;  5LHG A;  1SVM A;  5H6Q A;  1DU6 A;  3L1P A;  1QPI A;  3TOA A;  1FYL A;  2XAS A;  4QSH A;  1IW7 F;  3BCB A;  2OZU A;  1ZTR A;  2RKH A;  4PJJ A;  4PFO A;  1YW8 A;  5EEH A;  5HNF A;  3H3V K;  3CCU I;  5CVR A;  1MD0 A;  2LLK A;  2ZBK A;  3CQZ J;  2R5Y A;  5LGT A;  3SXY A;  2COB A;  5D4R A;  1S9H A;  3DEW A;  3QYB A;  5D8L B;  2DU9 A;  2XGX A;  1G4D A;  4GCV A;  2E7X A;  1FWZ A;  3FM5 A;  5AIQ A;  4O3M A;  2BYV E;  2RV8 A;  1TBX A;  5A2Q Z;  2L02 A;  3PL8 A;  5ILU A;  3K1P A;  1ETV A;  2PFB A;  3LFU A;  5L3B A;  2E2H J;  2HR3 A;  3BJA A;  3SDG A;  4ENJ A;  3KPH A;  5K7Z A;  1V5F A;  3LSH A;  1AHD P;  3M9A A;  1JKR C;  2DK8 A;  2M0C A;  2ZSI B;  3GFJ A;  2K9S A;  3VSL A;  4G6Q A;  1IV8 A;  3RKQ A;  2ZJP F;  2LTP A;  4B44 A;  2CFO A;  5E18 F;  3R0A A;  4BYY A;  3GTL J;  2Q2E A;  1OQY A;  1QVT A;  2KRH A;  4LJZ F;  2LKP A;  1MJB A;  2DA3 A;  5E1Z B;  3E3V A;  1MKM A;  4B3A A;  2X4H A;  3G1M A;  1F4K A;  3K1N A;  2E36 A;  3GFM A;  1R5G A;  1ERD A;  1OMI A;  3W6J B;  4BAC A;  2FXA A;  2YX4 A;  2GBY A;  4IHS A;  2KIS A;  1K79 A;  1ZR4 A;  4KIS A;  3G71 I;  1R5H A;  2P6S A;  3L2V A;  4KUM A;  1WI3 A;  3UR3 C;  1HSJ A;  1Z7L A;  2V1X A;  2KDO A;  3RSN A;  2XV4 S;  3SZP A;  2JPB A;  4PZJ A;  1HST A;  2HVR A;  2K5C A;  2DO7 A;  4UV9 A;  1ZK8 A;  2I5U A;  3HPG A;  3HYI A;  3T1B A;  4XOR A;  2VBW A;  2R7X A;  2EFN A;  4AYB N;  1AKH B;  2ME0 A;  1IUF A;  3HHG A;  3I55 I;  2L7M P;  2VE8 A;  1T8I A;  1E3H A;  4OIR F;  1BR1 A;  1STZ A;  2DOF A;  4HNU A;  3TP0 A;  4IZZ A;  3BJO A;  1R7J A;  1P4W A;  3FBI B;  4M3E A;  3BDD A;  3H36 A;  2W24 A;  3LSR A;  5H2F C;  4A3K J;  3WTX C;  2MFZ A;  3W2W A;  2DPU A;  2OC6 A;  1D8K A;  5J4V A;  3REO A;  1YJN I;  4HNV A;  5J3L A;  3BTI A;  3Q9V A;  2BOL A;  3H35 A;  4CZZ A;  4IHV A;  2E35 A;  1BI1 A;  2VE9 A;  4V2G A;  3KLO A;  4XLF A;  1PVE A;  5D5V B;  2L2O A;  5CVU A;  1BIB A;  1W7P B;  3CCY A;  2VJJ A;  1BJA A;  2HWV A;  4OMY A;  2XB0 X;  5FB2 A;  3WU1 B;  2ZNZ A;  1LJ9 A;  2PBI A;  4RDU A;  2L4A A;  3FF5 A;  1WVR A;  1SEU A;  2YR2 A;  3KYD B;  2QKL B;  2IGN A;  1FX7 A;  2XF6 A;  2X51 A;  4OMZ A;  3GTK J;  4KYW A;  2ACJ A;  3A4C A;  3F6V A;  2BY1 A;  3BR6 A;  1XMX A;  5L3D A;  2R7W A;  1XSD A;  4AD9 A;  4J00 A;  5K5Q A;  5B1A H;  3OIQ A;  1K6O A;  2P81 A;  4ZYH A;  4P9U A;  4GDF A;  3D0S A;  3HSF A;  3B02 A;  3JCU C;  1KYZ A;  1TT5 B;  3PQJ A;  5HLT A;  4DQ2 A;  2O61 A;  1HW1 A;  5CQE A;  2HOE A;  3W6V A;  3K4N A;  3A01 B;  2IP2 A;  2WY7 Q;  1MDM B;  2LSO A;  5GTH C;  5HOO A;  2IS2 A;  4L18 B;  3TED A;  3S3M A;  4EM1 A;  3RYR A;  2IT0 A;  1X4P A;  2Q1Z B;  2Z3Y A;  4M3G A;  2OD5 A;  1I50 J;  3L2W A;  4RAY A;  3TOB A;  1OFC X;  1QRY A;  5K7H A;  1VQO I;  4M3D A;  4BH9 A;  3K4B A;  3F8F A;  1VQ5 I;  4LB6 B;  3ULQ B;  1W0U A;  5LHH A;  2RVC A;  3ZQH A;  2HTS A;  2M7B A;  3RCO A;  4ZJZ A;  3IRQ A;  3ZCO A;  4KN4 X;  4ON0 A;  2CQQ A;  2IPQ X;  2JPC A;  1RES A;  2KFD A;  1TNT A;  2LVS A;  2XAQ A;  1BI2 A;  2HZT A;  4XIC A;  3QP5 A;  5DEQ A;  1IRX A;  3BTJ A;  1F1Z A;  1RR7 A;  1YTY A;  3HL2 A;  5IYB J;  5TRD A;  1F43 A;  2KZG A;  2R7Q A;  2BW3 B;  3E6B A;  3MKW B;  1ETW A;  3X2Q H;  2NYX A;  2ISY A;  1MIJ A;  3ZN1 A;  4XLP F;  1GT0 C;  4UY8 I;  1OCZ H;  5EJC A;  4UUT A;  1DPR A;  2VPL A;  4ZDP A;  1BC7 C;  3ABT A;  5D6E A;  2JZY A;  4L0Y B;  1G3Y A;  4RB3 C;  2PJR B;  2K3F A;  3J7A Y;  1EH8 A;  3H5R A;  4C3H J;  1YI2 I;  1OKR A;  2JUG A;  2V79 A;  4N4N B;  4BNC A;  2DLL A;  4D9J A;  1MJ9 A;  4BQA A;  3I5U A;  2LK2 A;  3CCM I;  4HX7 A;  5CVJ A;  3CF5 F;  5LD2 C;  1WFX A;  5LGN A;  3I3L A;  1K78 B;  4P96 A;  1TWH J;  3QP6 A;  2QGU A;  3C3W A;  4F3Q A;  2P7V B;  4GRI A;  3CCL I;  1W4M A;  3FIS A;  2V1D A;  1APL C;  4XOP A;  1P6R A;  3FK6 A;  3J81 K;  4BXU A;  2WWY A;  5IP9 J;  1JUS A;  2HQR A;  4ASN A;  1JI8 A;  3P7N A;  3H3U A;  1Z21 A;  2Y0S A;  4PGG A;  2PEX A;  2XHK A;  4E7I A;  2XRL A;  3GME A;  4RMN A;  3WTU C;  2NS0 A;  2BHZ A;  5C4X J;  4QIW N;  3GW2 A;  1OLT A;  1YE9 A;  4AM3 A;  1H9G A;  1JE8 A;  2KIM A;  2XPU A;  3CDL A;  3MMY B;  2CV0 A;  1UMQ A;  2HPI A;  2FOW A;  2WAE A;  3HTS B;  5TJJ A;  2X1E A;  4PGH A;  3I71 A;  3E5U A;  2HQN A;  3GO5 A;  4HST A;  1T0F A;  3FXJ A;  3JRF A;  3M8F A;  4HLX A;  5IOY A;  2IGM A;  1LFU P;  1GHC A;  3BLY A;  1D1A A;  5E3O A;  5E8I A;  1MBE A;  1SFE A;  2KIF A;  2LY1 A;  3TBI A;  2GM4 A;  2QLZ A;  3CCQ I;  4B4C A;  2O03 A;  3MQ0 A;  4RM2 A;  4CHU A;  5FJ8 J;  2OAZ A;  2DMU A;  2PX9 A;  3EUK L;  1Y1V J;  1DUX C;  2HPM A;  3CCJ I;  2FSW A;  2JSP A;  1YW9 A;  2YPR A;  2VKV A;  3IAS 2;  2VN2 A;  3RQ4 A;  3CJQ B;  5E3L A;  5DV5 A;  3J7A O;  1VTN C;  2O8X A;  3ZMU A;  1QHH D;  4FT8 A;  2BXY A;  1MNE A;  4MLO A;  1ETK A;  4RGX A;  2L0K A;  3LSG A;  1GVD A;  2CRG A;  3SYT A;  3IC7 A;  5E1W A;  5D5U B;  1OCT C;  5A2Q K;  4RB1 A;  4L5E A;  1S29 A;  1J75 A;  2CO5 A;  2UXX A;  4ESF A;  2Z33 A;  5IOZ A;  1D3Y A;  4FE7 A;  3VYR B;  1OR7 A;  1UHW A;  1XTA A;  3HUG B;  2JTV A;  4WXC A;  4HPQ A;  4UVB A;  4D7N A;  2OV7 A;  3JW4 A;  1BOB A;  1HF0 A;  2R7T A;  2IJL A;  3A1Y A;  4G12 A;  4CA0 A;  1LE8 A;  1JGS A;  3FKJ A;  1OYW A;  2ZSH B;  2XPV A;  3DEU A;  1X19 A;  2X6Y A;  4MO7 A;  3FXR A;  2IA0 A;  2VAS A;  3HOT A;  1WJB A;  2NVT J;  2OTJ I;  1MBG A;  2Z99 A;  1HW5 A;  2A6E F;  3FXM A;  3SQN A;  5HVQ C;  3CCV I;  1ITY A;  3HOS A;  4MEY F;  1JKO C;  3CP2 A;  1XX5 A;  1QA6 A;  1DPU A;  4YII A;  5IP6 A;  4XR6 A;  3WTV C;  3VDX A;  1LQ1 A;  2JUC A;  1IGN A;  1IUY A;  1MBK A;  1X3W B;  2JRM A;  3QPH A;  2DT6 A;  2CW7 A;  5EZG A;  4EAT A;  3OS0 A;  3J7Z I;  3S2D J;  5FFZ A;  2K40 A;  2JT1 A;  2R5Y B;  1PUE E;  2FBI A;  4BGD A;  3PFI A;  4E7Z A;  5JFR A;  4U7D A;  3B6A A;  4L9T A;  3H9Q A;  1AWC A;  2FJ1 A;  1PP7 U;  1ZHF A;  3MWM A;  1JT6 A;  2A07 F;  3BR2 A;  3FK7 A;  1R22 A;  4O6J A;  1IV6 A;  1IXR C;  1TQP A;  2LFB A;  4L5J A;  2UXN A;  2NVX J;  4Y52 J;  5FKN A;  1R49 A;  2FOK A;  2ZB9 A;  5EF6 A;  3BR1 A;  1ONV A;  2KZV A;  3P9K A;  1W5T A;  3VEP A;  3FHZ A;  1Q1V A;  3D5L A;  5LHI A;  1X2M A;  3EUA A;  4P1W A;  1CQT A;  3LQR A;  4HV5 A;  2DMN A;  3GYH X;  2ECB A;  4UVA A;  3KIO A;  1ETQ A;  1Z3Y A;  2Y9Y A;  4BHB A;  3E5X A;  2XPW A;  3FWE A;  4A5M A;  4Q5S F;  2V26 A;  2A6T A;  2PI0 A;  1IO2 A;  1SD5 A;  2OJE D;  3QAH A;  3BTL A;  3OMY A;  4MNU A;  4BE0 A;  4HF2 A;  2B9S A;  5F0H A;  4DBQ A;  2NS8 A;  1JHH A;  3VOE A;  3BT9 A;  1LFP A;  5E1X A;  2E5N A;  2WA0 A;  3K1M A;  2EA2 A;  1FIA A;  3UNG C;  3KLN A;  2E71 A;  3DCF A;  3BTC A;  4NHJ A;  2DJI A;  3DTE A;  2V6C A;  4BXX J;  2H6C A;  1FY7 A;  3LQQ A;  1VND A;  2MH2 A;  4JYK A;  5C4J J;  5B1B H;  4U7B A;  1V3F A;  3O8G A;  1H89 C;  1AU7 A;  1O7L A;  4MQV A;  3L2R A;  2XSD C;  1LPQ A;  1I6H J;  1QHG A;  4FQG A;  1J09 A;  4KN7 X;  3L9F A;  2H27 A;  1NH3 A;  3BR3 A;  2IBD A;  3ZOB A;  1G8X A;  4JOM A;  4KMF A;  2XC7 A;  3GTM J;  1MMD A;  4WX9 A;  3RQI A;  3S3N A;  2LBF A;  2QEN A;  1ZRF A;  2KJB A;  5DTD A;  4LB5 A;  1LKX A;  1FOX A;  1T0F C;  2ZO4 A;  1GDT A;  2K3P A;  1W1W E;  4RBO A;  2R7V A;  1IXC A;  2OUM A;  2QF7 A;  2V9P A;  5F04 A;  3BG9 A;  2XF5 A;  1KON A;  2EWN A;  2WBM A;  4I01 A;  1K4T A;  3TGN A;  4IVN A;  1YHQ I;  4IEJ A;  3FXK A;  2HZD A;  4GXO A;  2XKO A;  2Y75 A;  3EYI A;  1XGS A;  2FA5 A;  1GV2 A;  1WHU A;  3I9V 2;  1I1S A;  3EUH A;  1BN5 A;  2N8G A;  2L7K A;  4Y4R A;  2P8T A;  3QPS A;  3H0G J;  2CUZ A;  2AXT C;  1WWX A;  2QQ8 A;  3BQZ A;  4AID A;  2TDX A;  4F7Z A;  4BU2 A;  3WU2 C;  2EZI A;  2VJI A;  1JXS A;  3OYD A;  3COA C;  3EQL F;  2I8D A;  2Y0S N;  4C9Y A;  1KU3 A;  1X58 A;  3GVA A;  3WHB A;  4LMY A;  4AVP A;  2QSF X;  4EJV A;  4QPQ A;  3HKZ N;  1XB4 A;  2HGC A;  2VJ5 A;  2XAF A;  2KRF A;  3GLX A;  3MZY A;  3CJT B;  3JRD A;  3GF2 A;  1RC9 A;  3M07 A;  5DDG A;  3JTH A;  4IL6 C;  5DCF A;  2BV6 A;  2RAE A;  3LSP A;  3IKT A;  1SVL A;  2V6E A;  4HDU A;  3ZQQ A;  1R00 A;  1FT9 A;  4LG3 A;  1BW6 A;  1KA8 A;  4I99 C;  2M5W A;  4I02 A;  1Z1D A;  4ABZ A;  3CES A;  2HS5 A;  1SFU A;  3VB2 A;  3ZMZ A;  2R0Q C;  4RLF A;  1UG2 A;  3HPH A;  2VC1 A;  2DTZ A;  2XDV A;  4KIB A;  1TWF J;  4L9V A;  5JVT A;  1F9N A;  1JUP A;  1R1T A;  2A61 A;  2NRA C;  4GYG A;  2ZXI A;  2F48 A;  1HXD A;  5CPR B;  2EIM H;  3RPU A;  1W7P D;  3PUF A;  5F0C A;  1SD6 A;  5LGU A;  1X1C A;  3S93 A;  2RDP A;  3U1K A;  2K9L A;  2VQL A;  1QGP A;  3JRG A;  1FMV A;  4XSZ F;  3W3C A;  2QSG X;  2BY3 A;  3C7J A;  1ZRD A;  2YSR A;  2VI6 A;  4A5N A;  4CCO A;  4RS8 A;  3LL7 A;  3VFZ A;  1YFH A;  3S15 J;  4HF0 A;  1WKM A;  1RUO A;  4C2M J;  1E3P A;  1V5G A;  4UUV A;  1YQA A;  4LD5 A;  5HDG A;  1OCC H;  4KT5 C;  3TO9 A;  3PIP F;  1R36 A;  2R3S A;  2MD0 A;  5FKL A;  4D0P A;  2WV1 A;  4U0V A;  3CUQ B;  1Z77 A;  3PFY A;  4X6A J;  2NNY A;  3HOV J;  4IJA A;  2OTL I;  1TWC J;  2KIQ A;  1J5Y A;  4XLC A;  5H20 A;  1QNT A;  2NVY J;  2F5C A;  4HAM A;  4KIG A;  2ZFW A;  2EH3 A;  5BPD A;  5EYR A;  4MIM A;  1MND A;  4V2F A;  2CV2 A;  4LGW A;  2AQF A;  1B59 A;  4HYE A;  4NC8 A;  1H88 C;  2E1M B;  3VSK A;  2ZNY A;  1XS9 A;  3CO6 C;  5CYV A;  4I0A A;  1U8R A;  2X6O A;  2DOD A;  4G7H F;  3E0J B;  1ETO A;  1F5T A;  1ACI A;  3ASN H;  5C3E J;  1O3Q A;  2CW0 F;  2R92 J;  4PSW A;  1HW2 A;  2DFI A;  2B0L A;  3E6M A;  2JWT A;  4BXF A;  4ENN A;  1VQN I;  1YS7 A;  2NXN B;  1SMT A;  4NDL A;  2JA7 J;  3CCS I;  2H94 A;  1R9T J;  3DPT A;  1DGW Y;  5GAG J;  3U2R A;  4IQJ A;  4LFU A;  4G94 A;  3WTS C;  1BI3 A;  1L0O C;  5F64 A;  4KT6 A;  1B8I A;  4X0G A;  4PUS A;  3AL0 B;  1FP2 A;  3DFG A;  2CUJ A;  2IGK A;  1X1P A;  1MSF C;  5F1R A;  3DBL B;  2IXS A;  3JSP A;  5ILV A;  3C2H A;  3KET A;  2Z9O A;  1T33 A;  1FSE A;  2R93 J;  1NG6 A;  4R8H A;  4DOZ A;  4NBQ A;  2OF7 A;  2FML A;  3S8P A;  3KEQ A;  1ORK A;  1IN4 A;  2Q0O A;  2O9L A;  3PO2 J;  2DDB A;  1Z3X A;  2M1B A;  4RB0 A;  1WH5 A;  5EG0 A;  1H9T A;  2R7U A;  3BRO A;  4JP0 A;  4MGR A;  1UB9 A;  2JRT A;  2XRN A;  1Y1W J;  1A04 A;  3QU6 A;  3OOU A;  4IHW A;  1XSV A;  2A69 F;  2D2W A;  2PQ8 A;  1TZL A;  4E6K G;  2M30 A;  3P5J A;  2A68 F;  3ABU A;  3T8R A;  3LST A;  3ZMD A;  2L7Z A;  3AG3 H;  3D5S C;  1AA7 A;  3HIF A;  3SZG A;  2MLG A;  3T0Y A;  4K2E A;  3ERM A;  2NVU B;  4OIN F;  3KP2 A;  3I58 A;  1HOM A;  1ZRC A;  3ZN0 A;  3K4J A;  4C2T A;  4EMS A;  2ZXJ A;  2L5Q A;  2MSY A;  4A0X A;  4GGG A;  5JVG F;  1K6Y A;  3K69 A;  4EJW A;  4LG0 A;  3CTA A;  5EDN A;  3EDP A;  2GOX B;  5LEJ A;  3GLL A;  2CUE A;  3TW6 A;  1ZLK A;  3SHF A;  2E1O A;  1D1C A;  3F8B A;  4QTR A;  1LE8 B;  2E1N A;  4IHY A;  3A0B C;  1D1B A;  2G7H A;  1GUU A;  2FUG 2;  4RGU A;  3GZ6 A;  4PFP A;  1SVO A;  4DJA A;  4S05 A;  4A3M J;  1XCB A;  5B66 C;  1T39 A;  3U1D A;  4ESJ A;  1BC8 C;  2DA6 A;  4II2 A;  3CMA I;  4XN0 A;  2PLY A;  1IN5 A;  4BJ6 C;  3RIR A;  3AG2 H;  3D1N I;  2ETH A;  3F8C A;  2VT3 A;  5IT9 Z;  2MBF A;  3OYL A;  3L2C A;  1S7A A;  1WJC A;  3FXQ A;  3ZQG A;  4OAZ A;  5KCM A;  1MNM C;  4D1Q A;  3Q0W A;  2Y2Z A;  1BR2 A;  4MQ9 F;  1C0W A;  4KIF A;  4BUP A;  1TQI A;  4ZDL A;  1HKS A;  5AON A;  4H0E A;  2F4M B;  1YX5 A;  2WTE A;  3CC7 I;  1U5T A;  4ZZD A;  3KZZ A;  2HI3 A;  2LF7 A;  4OOI A;  4C2U A;  1YLF A;  3WGI A;  3I53 A;  1KQ9 A;  1G6N A;  4ANJ A;  2VON A;  3M1E A;  2EIL H;  4JK1 X;  4ZYD A;  5ILS A;  3FX3 A;  1ODD A;  5DS9 A;  2HYF A;  2IA1 A;  1VQL I;  3ABL H;  3PQK A;  4XLH A;  2XF7 A;  3DBR B;  4I76 A;  1A5J A;  3KEO A;  5KVR A;  4IRI A;  4M3B A;  2LY2 A;  4NUB A;  4A3B J;  4PJM A;  3OR2 C;  2ESH A;  1KQ8 A;  5B5E C;  1G59 A;  2DBB A;  4BE2 A;  2FQ3 A;  4E7H A;  2JA5 J;  1MH3 A;  2L9S A;  3R4K A;  1ZG1 A;  1WGX A;  2EA4 A;  2EB7 A;  2DOE A;  1ZG3 A;  4BEH A;  2GXB A;  2EBI A;  1U78 A;  1P92 A;  9ANT A;  4NNJ A;  1J7K A;  3IWF A;  4A0Y A;  3CJR B;  4HQE A;  2VKH A;  1E3O C;  4N9I A;  3ZQI A;  2PN6 A;  3NQO A;  3S2H J;  4F92 B;  4A3C J;  2X1C A;  3NAU A;  2HKO A;  3T5X A;  3P9I A;  3AG1 H;  3I64 A;  2KJC A;  1ETY A;  2XGE A;  5GPC A;  2QSH X;  1WJA A;  4DGW B;  4XBF A;  5GP9 A;  2GA1 A;  1U9N A;  5ICE A;  1IJW C;  1QQI A;  4W97 A;  4DIQ A;  2HU9 A;  4ITV A;  1B72 A;  2CG4 A;  1IN6 A;  2M8E A;  3PO3 J;  3IHU A;  4AIK A;  3HZJ A;  2Q8K A;  2WB1 A;  2YU3 A;  4BJT A;  3LAJ A;  2W48 A;  1XDU A;  3IKV A;  2CWE A;  4FET A;  3DLA A;  1HQC A;  2E7W A;  4HRI A;  4Z2Y A;  2LBF B;  3CUQ A;  5E20 A;  2EFW A;  2P5V A;  2ELK A;  2O3F A;  1VQP I;  2XAJ A;  2EZL A;  2DMQ A;  1V4R A;  4XK4 A;  2F5E A;  3ECH A;  4WF2 A;  4FCY A;  2FEZ A;  1YW7 A;  3M3Y J;  2LP0 A;  3BJ6 A;  1IZ1 A;  2A6H F;  2X48 A;  1A36 A;  3OYH A;  3LA3 A;  1YIT I;  1FBS A;  1FEX A;  4M9S A;  2M45 A;  2TRT A;  3C18 A;  3PSF A;  2E5Z A;  4ZYG A;  2R7D A;  5HNH A;  2ZC2 A;  3HOY J;  1MMG A;  1P7I A;  1R4N B;  3E6D A;  1FSH A;  3BZ6 A;  3K9T A;  5J47 A;  3KP7 A;  3Q0U A;  4KJZ A;  3VOD A;  4CIC A;  1JGG A;  4A3L J;  1OCO H;  2ZJQ F;  3H9G A;  3I4P A;  1FBU A;  2VBZ A;  4WCG A;  3BG6 A;  3CLO A;  2R7R A;  3DXJ F;  1XDS A;  4A93 J;  4JX5 A;  4DZJ A;  3ZQ7 A;  4RAF A;  1Z6T A;  1IN7 A;  5J1U A;  5F27 A;  3TDU C;  4AIJ A;  1Y6I A;  1BOA A;  4DW6 A;  3BG3 A;  2L54 A;  2GIV A;  4DYQ A;  3CME I;  4XM3 A;  2H1L A;  1R5I D;  2ZME A;  4OIQ F;  5EEG A;  2K27 A;  1HDD C;  3GTQ J;  1I1G A;  5DUI A;  1UHM A;  2BY0 A;  3H9J A;  4H4K C;  1T95 A;  4CYC A;  3WE3 A;  4PJ0 C;  1RET A;  1E0E A;  3WTW C;  3J80 K;  3R60 A;  3OIP A;  1WRJ A;  2XGC A;  4II3 A;  1JKP C;  2ZJ2 A;  1FMW A;  4NQW A;  4OU0 A;  5AIP A;  3RYP A;  4X1E A;  2WC2 A;  3C1D A;  1XMA A;  1HDP A;  4IF4 A;  1Z91 A;  1WPK A;  5BQT A;  4Q4Z F;  2CGP A;  3K2Z A;  2RQQ A;  1PJR A;  2WAQ A;  3ZQC A;  3OL3 A;  2FQ4 A;  3O3K A;  3HDD A;  1WJ5 A;  1USS A;  1CF7 A;  2O8K A;  3SZT A;  2F2E A;  3I54 A;  3W2A A;  3WU0 A;  4B1R A;  3RTR A;  1EF4 A;  2GA2 A;  1FIP A;  5FD5 A;  2PMZ A;  2VOP A;  3K10 A;  1DP7 P;  2Z16 A;  2EIJ H;  4MEX F;  1KU7 A;  3NEU A;  3RI4 A;  1IG7 A;  1SD7 A;  2LRD A;  3F21 A;  2HNH A;  3DKX A;  5EEA A;  3ZQF A;  1P2F A;  1SFK A;  4M72 A;  1MW7 A;  1T6S A;  3NRV A;  4O5V A;  2JA8 J;  1BR4 A;  4RGS A;  3S3O A;  1ETX A;  4B48 A;  4IOC F;  1QVU A;  5BPI A;  2KLO A;  2LD5 A;  1ULY A;  3G1L A;  4N0B A;  2GQQ A;  3G6E I;  1DQU A;  2DFE A;  2DPD A;  2DT7 B;  4HEA 2;  5D4S A;  2J5O A;  2LKS A;  2CQN A;  3A03 A;  4A3F J;  5D5X B;  1S6L A;  4FIS A;  1MMS A;  3H1C A;  2JA6 J;  2D45 A;  1LUJ B;  5DM6 F;  1BIA A;  2M34 A;  2H09 A;  4S04 A;  3W6K B;  4ZDO A;  5HS7 A;  2P4W A;  2VQC A; 
#chains in the Genus database with same CATH homology
 2V4J C;  4BU2 A;  2ZSI B;  2VJI A;  4RM3 A;  3OYD A;  2LG4 A;  2I8D A;  2LRE A;  3VSL A;  4C9Y A;  2XAU A;  1X1D A;  3QYF A;  4B44 A;  2CFO A;  4IKF A;  4QPQ A;  4E4H A;  4Y3O A;  2VJ5 A;  1V5E A;  2LH9 A;  1SAU A;  2KRH A;  3DTI A;  4ZTJ A;  3ZR8 X;  2W1O A;  1ERD A;  4BDZ A;  2RRE A;  4BAC A;  3VYU B;  3PNV A;  4B3X A;  4KIS A;  2V6E A;  2VKD A;  3ZQQ A;  4LG3 A;  4IQ4 A;  3L2V A;  1UAA A;  3UR3 C;  2BVL A;  2W4S A;  3CES A;  1Z7L A;  2HDW A;  3NWS A;  4CCL A;  3FDY A;  2KDO A;  3RSN A;  3VWB A;  2HQA A;  4RLF A;  3HPH A;  4YEL A;  2XDV A;  2HVR A;  2K5C A;  3L2U A;  3OL4 A;  4ZYA A;  3HPG A;  2ZFU A;  2ZXI A;  3M8J A;  4XOR A;  3OS1 A;  2R7X A;  2M3A A;  4XLA A;  5CPR B;  3K4L A;  2DXI A;  1X1C A;  3S93 A;  2K9L A;  2VQL A;  1BR1 A;  4HNU A;  4IZZ A;  1FMV A;  3W3C A;  3FBI B;  4XQF A;  4CCO A;  4NC7 A;  2VXZ A;  2MFZ A;  3W2W A;  4CSW A;  2OC6 A;  2LC2 A;  3LL7 A;  3IAM 2;  4B47 A;  2IS1 A;  5JHF A;  2BOL A;  3H35 A;  3HKZ A;  1V5G A;  1X4O A;  2KMU A;  4HG2 A;  2HVS A;  3HG9 A;  2WAD A;  4XLF A;  4HSR A;  2MD0 A;  2L2O A;  2X85 A;  4PK4 A;  1GLN A;  3PFY A;  2VJJ A;  4XMY A;  2Z2S B;  3DEE A;  2X1D A;  4CH7 A;  4XLC A;  2QKL B;  2IGN A;  5FRN A;  2XF6 A;  2X51 A;  2JVH A;  4BQQ A;  3A4C A;  1YX3 A;  2R7O A;  2E1M C;  3DPL C;  1NG7 A;  5FRM A;  2R7W A;  1X1A A;  2M4G A;  4J00 A;  2VQH A;  3OY9 A;  1MND A;  3OIQ A;  3OYF A;  2CV2 A;  2AQF A;  3PSI A;  4F55 A;  4F91 B;  4NC8 A;  2E1M B;  3VSK A;  5HLT A;  3OR1 C;  5CQE A;  4AYB A;  3K4N A;  4P5O A;  1W36 D;  2VQG A;  2WY7 Q;  1DP3 A;  3E0J B;  5HOO A;  2IS2 A;  4CUG A;  3S3M A;  2CMP A;  3V42 A;  3DWL E;  4KIT B;  4PSW A;  1X4P A;  2Q1Z B;  4R79 A;  4E7K A;  3D5R C;  3K6G A;  4C30 A;  4BXF A;  3ZRG A;  3FHN A;  3L2W A;  3H5A A;  4FAS D;  3DPT A;  1DGW Y;  4BS9 A;  4IQJ A;  3AL0 C;  3K4B A;  3LSK A;  4BQO A;  3MKY B;  1W36 C;  3PNY A;  2BVM A;  3G2B A;  4KT6 A;  4JQF A;  2M7A A;  2V9K A;  4X0G A;  4PUS A;  3AL0 B;  2M7B A;  3RCO A;  2DCE A;  4ZJZ A;  2CUJ A;  2IGK A;  3ZCO A;  4J01 A;  2IXS A;  3HC7 A;  3CF2 A;  3C2H A;  3K70 D;  1NG6 A;  4DOZ A;  4F52 A;  4BE1 A;  3S8P A;  5KNL A;  1IRX A;  3DU6 A;  2KL4 A;  1Z3X A;  2M0M A;  2MAB A;  3HL2 A;  2R7U A;  2R7Q A;  3LSM A;  4DBR A;  2BW3 B;  3K4K A;  3MKW B;  2IS4 A;  3OOU A;  3OWT A;  3K70 C;  1TZL A;  4E6K G;  2VPL A;  4E7S A;  4ZDP A;  2Z1D A;  3E1S A;  4CCM A;  2PJR B;  4ZC3 A;  2CV1 A;  3D5S C;  3J7A Y;  1AA7 A;  2CW8 A;  3H5R A;  2W82 A;  2JUG A;  4N4N B;  4RLQ A;  4XKW A;  3SZG A;  4BQN A;  1WJF A;  3H0D A;  2WY8 Q;  4D9J A;  1OR7 C;  3IP4 B;  3QOE A;  4BEH B;  4OAY A;  3K4J A;  1LDK B;  4C2T A;  1Y56 A;  2L5Q A;  5TGT A;  5LD2 C;  1K6Y A;  1WFX A;  3I3L A;  3DTK A;  3DU5 A;  2GOX B;  2L9N A;  4F3Q A;  4GRI A;  1D1C A;  3OYA A;  2F5V A;  4Y33 A;  1U0J A;  3KEY A;  4CCN A;  1D1B A;  4XOP A;  3K4M A;  2VXD A;  3MKZ A;  2O5R A;  1WJD A;  2FUG 2;  1JI8 A;  4PFP A;  4XON A;  3U21 A;  1Z21 A;  2Y0S A;  4DJA A;  5KHD A;  4E7I A;  4RMN A;  4II2 A;  1OLT A;  4XN0 A;  2RNG A;  1YE9 A;  4ZTF A;  4BJ6 C;  3OYN A;  2MYS A;  2M4K A;  2VB6 A;  3MMY B;  2CV0 A;  2F6C A;  2HPI A;  2WAE A;  3N05 A;  3OYL A;  2X1E A;  3OYI A;  1UEL B;  5FRO A;  2UV1 A;  4HST A;  4IX7 A;  1WJC A;  4OAZ A;  5KCM A;  2JA2 A;  4D1Q A;  2Q2E B;  1BR2 A;  4BUP A;  2IGM A;  4ZDL A;  1YX5 A;  2ZXH A;  1D1A A;  3BLY A;  3DKY A;  5CKT A;  2P0W A;  3HXL A;  3TBI A;  2LY1 A;  4U87 A;  3A2K A;  4C2U A;  1N77 A;  4RM2 A;  2VL8 A;  3L2Q A;  3SEZ A;  1EA3 A;  3EUK L;  4PSX A;  4ANJ A;  3DQV C;  3LSI A;  2HPM A;  2BW3 A;  2IGO A;  2JSP A;  3SDB A;  4XLH A;  2XF7 A;  3IAS 2;  4XOT A;  3RQ4 A;  1PYV A;  3CJQ B;  3BC8 A;  2UUZ A;  4PJL A;  3W2V A;  4PJN A;  2LY2 A;  4NUB A;  2GOM A;  2CH0 A;  4PJM A;  3CP8 A;  3OR2 C;  1QHH D;  4XKC A;  2PJR A;  1G59 A;  1MMA A;  1MNE A;  2X6W A;  4MLO A;  2VLA A;  4BE2 A;  1DGR M;  3F9K A;  1N78 A;  2MC4 A;  4E7H A;  3LSG A;  2L9S A;  3SYT A;  2R4G A;  4CZC A;  2X6X A;  3MD2 A;  4BEH A;  2XSJ C;  4N4O B;  3FBN B;  2UWM A;  4NNJ A;  2F4I A;  3CJR B;  3VYR B;  2VKH A;  3EPZ A;  3HUG B;  4QPO A;  4NQW B;  4F92 B;  4HPQ A;  2X1C A;  2OV7 A;  2DOA A;  2V7F A;  1BOB A;  2R7T A;  4XL9 A;  3A1Y A;  4CA0 A;  3FKJ A;  3ZXS A;  2ZSH B;  4XKB A;  1X19 A;  1WJA A;  2KQR A;  4OWR B;  4DGW B;  2X6Y A;  3OYK A;  2VAS A;  3HOT A;  3PNT A;  1WJB A;  4G6T B;  3TL4 X;  2E60 A;  3H5N A;  4DIQ A;  2HU9 A;  4ITV A;  5HVQ C;  3HOS A;  3QYE A;  3KX2 A;  3CP2 A;  2CS3 A;  3C2G A;  2WB1 A;  1MMN A;  1ZEL A;  4BJT A;  4XR6 A;  3VDX A;  2ELJ A;  2V1N A;  4FET A;  3DLA A;  3PJR A;  2DT6 A;  2CW7 A;  4HRI A;  2LBF B;  4EAT A;  3OS0 A;  3OS2 A;  1D0X A;  4B43 A;  3OYB A;  2IS6 A;  2VIX A;  4BGD A;  4E7Z A;  2KPM A;  3OYE A;  1LVK A;  1TT0 A;  5CQG A;  1N75 A;  3H9Q A;  3VYT B;  3OYH A;  4E7J A;  3VYS B;  4XKV A;  3EUH C;  3PSF A;  2E5Z A;  3SEQ A;  5HNH A;  1P9Q C;  4LIU A;  1MMG A;  1D0Y A;  3IUO A;  2KHM A;  3M1C A;  2HVQ A;  4YRV A;  3OYM A;  2KZV A;  3ONQ A;  4KJZ A;  2QKM B;  3D5L A;  3LMM A;  3H9G A;  2WAF A;  4CCK A;  3BG6 A;  3TMO A;  3ZGK A;  3EUA A;  4P1W A;  4F93 B;  3OYJ A;  3CZ6 A;  2R7R A;  1QU3 A;  2KRC A;  4XLE A;  4AU7 A;  3K4C A;  1Z3Y A;  4AVZ A;  1R6R A;  2KP6 A;  4YEJ A;  1Y6I A;  2NOJ B;  3AFH A;  2V26 A;  2A6T A;  4XM3 A;  3QOD A;  4LIT A;  3OMY A;  3RPU D;  4BE0 A;  3DPU A;  1VZ0 A;  2LYC A;  4DBQ A;  3H9J A;  4H4K C;  1T95 A;  3AKZ A;  1LFP A;  1E0E A;  2E5N A;  2WA0 A;  3BCA A;  3OIP A;  4II3 A;  1FMW A;  3UNG C;  3GBG A;  2R7S A;  3CMM A;  2DJI A;  3OYC A;  3S32 A;  3DTE A;  1X1B A;  4BJ5 C;  1UG0 A;  3PUB A;  2RQQ A;  4U7B A;  1PJR A;  2WAQ A;  2W7N A;  3OL3 A;  3L2R A;  4BDY A;  1HA8 A;  5LFA A;  4HNT A;  3NWT A;  1WJ5 A;  1QHG A;  2AQE A;  1J09 A;  4XNF A;  3W2A A;  1D0Z A;  3RTR A;  2PMZ A;  2LOO A;  3BCB A;  1G8X A;  3BG7 A;  3K10 A;  4JOM A;  4PJJ A;  4PFO A;  2Z16 A;  4LIV A;  2XC7 A;  1MMD A;  1WJE A;  5HNF A;  4E7L A;  4CCJ A;  3S3N A;  2LBF A;  4XN3 A;  2LRD A;  2HNH A;  3OYG A;  3DKX A;  1SFK A;  1LKX A;  1MW7 A;  1T0F C;  1BR4 A;  2K3P A;  3S3O A;  4B48 A;  4BL0 B;  1S9H A;  3QYB A;  2KLO A;  2R7V A;  2OUM A;  1DQU A;  1KON A;  2XF5 A;  2DT7 B;  2WBM A;  2JVG A;  4HEA 2;  2W00 A;  3PL8 A;  2HZD A;  2K9M A;  3LFU A;  3I9V 2;  2VJ4 A;  1V5F A;  2L7K A;  4Y4R A;  3KYL A;  3LSH A;  2CUZ A;  4ZDO A;  2VQC A;  2A5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...