1TNSA

A novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MELWVSPKELANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MU-TRANSPOSASE
publication title A novel class of winged helix-turn-helix protein: the DNA-binding domain of Mu transposase.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Dna binding protein
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1994-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tnsA00
1OPCA 2Z5UA 3J80Z 1VTNC 5D5WB 3D5LA 4IVNA 3ABUA 4KT5C 4RGUA 4JK1X 1H9TA 2FBKA 1RI7A 2VODA 5HS9A 3KP6A 1KQ9A 2QQ9A 3BJAA 5DYMA 1BI2A 1G3SA 1TTYA 4KICA 2CGPA 2ZXJA 4Y15A 2V6CA 4KN4X 4UHTA 1IZ1A 2PN6A 1HKTA 3I54A 4HLYA 1YYVA 2H6CA 4IJAA 3RIRA 2P8TA 3M8FA 2V1UA 2XAJA 1Z9CA 2P5VA 3V7CA 4CICA 2H94A 3F8FA 4FT8A 4OMZA 4L0YB 2O61A 4U7BA 1U2WA 3I64A 5HS7A 1RZ4A 5E1ZB 2KIFA 1ZG1A 3GZ6A 2E7WA 2VC1A 4S05A 4S04A 3LAJA 4AIHA 2OAZA 4U0VA 3JTGA 3RPQA 3FHZA 4F7ZA 4A12A 3RPUA 1ZRCA 2PG4A 1XMKA 3CUQA 3DEUA 4AIJA 4LK1F 2VE9A 3KP5A 2XASA 1OYIA 1XB4A 3M8EA 2JTVA 2DO7A 4Q48A 4HYEA 1EH7A 1SFEA 1RIOH 2KJCA 2AXLA 4HX8A 5LHHA 3G73A 2M30A 1W4MA 1W7PD 5DUIA 2XUBA 1SD7A 4M73A 1Z1DA 2OQRA 1O57A 1IRGA 2DQRA 5LRSA 2HTJA 1F4KA 3KZYA 2HS5A 3SHFA 3HSEA 2B0LA 2FE3A 3F3XA 4UXNA 3IKVA 2EFOA 2RNJA 3RI4A 3V8KA 3FXQA 1DUXC 2J5PA 2EV5A 2A61A 1XGNA 4ZYDA 2W85A 5LHGA 5FGMA 3J81Z 3VB2A 4KA4A 3CUQC 2OZ6A 4PDKA 2P6TA 2F5CA 4R8HA 2VBZA 3GF2A 3MFKA 1IAWA 3E6DA 5CJ9A 2PLYA 2MD5A 1V4RA 4KMUX 1WQ2A 2DI3A 3GXOA 4A5MA 3E5XA 2F5FA 1TNSA 2DQLA 3H3ZA 3AAFA 3ZPLA 5KK1A 4PGHA 4PGGA 2CO5A 2E1CA 2O8XA 4I0AA 4EQQA 1BN5A 3RDIA 2CW0F 2VBWA 1R22A 1D3YA 1Y0UA 3KEOA 3K1PA 1D8JA 4LLLA 2ZFWA 2W57A 1S7OA 2RV8A 2Y75A 4G8XA 4EMSA 5ERIA 2LKPA 3GWZA 4I01A 1GVJA 4BYYA 1J0RA 1YS6A 2UXNA 3QU6A 2A6HF 1O7FA 1O3TA 1HSJA 3CO6C 2O0YA 2IP2A 4G7ZF 5J8FA 1SMTA 1ZLJA 2XHKA 5F1RA 5ILUA 3I59B 4OIOF 3REOA 1J75A 4P9UA 2CG4A 2ZJ2A 3CDHA 3GW2A 2LF7A 2OD5A 4MQVA 2D2WA 4ENJA 2HDCA 4RGSA 2FBHA 3HRSA 4MNUA 2EFWA 2IJLA 3O6BB 2P6SA 3F8CA 1QGPA 3PQKA 3FX3A 1W7PB 4AD9A 1DP7P 1XCVA 4YIIA 1LDKB 3LSTA 5E1WA 3DF8A 1P4WA 2JPCA 5ICCA 3SZTA 2W24A 3RKWA 3ULQB 1U3EM 2QQBA 2HKXA 5ICEA 3DPTA 2JPBA 5A2QZ 1C0WA 2UZKA 4UVAA 3R6SA 2EA4A 2ZKZA 3HHGA 1FYMA 4ESJA 3K9TA 3RKYA 2PFBA 4MEXF 4ZYEA 5BS6A 1MJBA 5LGTA 2IA1A 4BAYA 2V79A 2VC0A 1LEAA 2EV0A 2A69F 2VBYA 1KU9A 2HYGD 3C1DA 3MCZA 4MEYF 2M87A 3WU1B 5D5XB 2VOOA 3L9FA 4KYWA 3IC7A 3WU0A 4LG0B 1BI0A 5FLXK 4EM1A 5CYVA 1WKMA 5ICFA 1AWCA 2F2EA 2QVOA 3D0SA 5HDKA 5ICGA 3KP7A 2A07F 3DFGA 4M72A 4XBFA 1W5SA 3MQ0A 4XLNF 4L9TA 1TNTA 4IRIA 4OIQF 2MBFA 4G94A 4EM2A 1L0OC 3F6VA 4A0ZA 2MLKA 5D6FA 2Z99A 5CVIA 1LB2A 4RB3C 4LGWA 4L9JA 1R36A 1B4AA 1NHAA 3BWGA 4HBLA 3TO7A 4QWQA 3ZP5A 1KQ0A 4WXHA 1KYWA 3WTTC 4BQAA 5LEKA 1IN7A 4A6DA 5HOOA 2ELHA 2QM3A 4G7HF 3IRRA 1UCRA 1I5ZA 2HOEA 3WG9A 3IWFA 4K2EA 5ED4A 4HDUA 3TDUC 5FB2A 5K5RA 5L3FA 2A68F 2P5LC 1USSA 2VE8A 2GAUA 4A0YA 1XGMA 5JI6A 4AWXB 1MDMA 2RDPA 2QWWA 1FBQA 4EM0B 1RUOA 4OIPF 1JGSA 1U5TB 5LEJA 1S29A 1YW9A 3JW4A 1MJAA 1J59A 3DV8A 1IXCA 1ZREA 1FC3A 4LJZF 3T1BA 1BIAA 4I98B 2JSCA 4RGRA 2W25A 3GO5A 2ETHA 2XVCA 1GHCA 1U78A 4KUMA 5CVVA 1TW2A 1SFUA 4RGXA 5EEGA 1J5YA 4JQFA 2GXGA 1D5VA 1IF1A 5HLHA 2RKHA 2DFIA 2A5YB 1HW2A 3WTYC 3KE2A 1JHHA 4M74A 1O3QA 3CJNA 3BPVA 1OR7A 2RN7A 1ON1A 3QRFF 5F6FA 2MA3A 4P96A 3IL2A 4OU0A 1DPUA 1S3JA 2GA2A 2FRHA 1ZGJA 4ASNA 3J7AO 2KKOA 1R58A 2Z33A 2QQAA 2DLLA 3N97A 2QENA 4IF4A 4UUVA 5JR3A 1FLIA 4IPAA 2ZCWA 4EJTA 1WRJA 5LGUA 4CO8A 2HYFA 1GXPA 2YR2A 3GX4X 2XKOA 4KIFA 4YG2F 2M8EA 1YS7A 3F8MA 2MH9A 1YG2A 1XDSA 5D4SA 1E17A 2L01A 4U0WA 5IT9K 4U0YA 1ZGAA 3WTXC 2FNPA 3HRTA 1HKQA 2EB7A 3EYYA 2ZMEB 2Z9OA 1BI1A 5FO5A 5H20A 5HLGA 1CGPA 3EYIA 3TO9A 3PFIA 2KRFA 2D1VA 2K27A 2BV6A 3HOSA 4KFCA 2L02A 1KU3A 3GFJA 2COMA 4EJOA 3K1NA 2L4MA 3LFKA 4EJWA 2GZWA 2LF8A 3SFZA 2RQPA 4HW0A 2FQ3A 3RJPA 1XGOA 4LMYA 2MC3A 4FX0A 1FBUA 4BHPA 3NRVA 5FD6A 1OMIA 2IRFG 5KVRA 3L7WA 2FBIA 1QZYA 3VEPA 2CFXA 2XGXA 2H6BA 5J6XA 3SQNA 2KJBA 4LD5A 1ZN2A 3QU3A 3I53A 3K1MA 3GFLA 1R1TA 2CSOA 1FY7A 4P55A 2KIUA 4G7OF 3K2ZA 5D6EA 3ZQ7A 3E3VA 3IRQA 1K79A 3O2PE 3JAMK 2DBBA 3ECHA 2DT5A 4ON0A 1IUYA 4LK0F 3CTAA 2YSRA 3E6MA 1R00A 1O7LA 2ESHA 2ZNYA 1YW7A 3IKTA 3MEXA 4BHBA 3HRUA 3R61A 2Z3YA 1QBJA 1IW7F 4EVIA 1B6AA 4MQ9F 3KP2A 4ENKA 2XKPA 1YIOA 1IN5A 4QLCU 2E1NA 1G3TA 4HDVA 2V1DA 1FOKA 1LJ9A 3MAJA 4RS8A 2A3SA 1ODDA 3Q9SA 5DCMA 2ISYA 2BYVE 4RB2C 2WC2A 3BROA 5TRDA 3W6JB 4HF1A 4ZYGA 4M9SA 1K78B 4MHGA 3WTWC 4O3MA 5D5UB 5E8IA 4GCVA 1KA8A 2OU2A 2H27A 5TJJA 1FYKA 3C18A 1O3RA 4A2UA 1FX7A 3Q9VA 4GXOA 2K86A 3WE2A 1SD6A 5DD4A 5FLXZ 1P6RA 4HAMA 5E20A 1IN4A 1CF7A 3U2RA 4HOBA 2G7HA 5L3BA 1KGSA 2IW5A 1K6OA 2XAFA 1YW8A 4GGGA 5DV5A 2H09A 1ZHFA 2EK5A 3RYRA 3V4GA 3V8LA 1HSTA 2XAGA 4P5OA 3DPLC 3KCCA 4B8XA 5DCFA 5LBQA 1SAXA 4AVPA 3WE3A 1USTA 1FP1D 3K0LA 2PMUA 5CLSA 1G6NA 2LSOA 2P4WA 1I6XA 1DPRA 4UV8A 5JVTA 3EETA 4RAYA 2EFQA 2A6EF 2NYXA 3HYIA 1W5TA 3V8JA 5EEHA 1TQMA 2STWA 2CYYA 2QBYA 1LDDA 3FXUA 2PQ8A 3CUQB 2DK8A 3KETA 3TDZC 3I0TA 5AONA 2XAQA 2GIVA 1MJ9A 3ZN1A 3ZMDA 1G4DA 1XMAA 3BDDA 4L5JA 2G7UA 1ZLKA 1XDUA 3ECOA 2ZO4A 3IHUA 3FM5A 1LDJA 4L9NA 5J8CA 2VN2A 4I2OA 2K02A 4DNCA 2M1BA 3P9IA 5E17F 3LAPA 5K1YA 1J7KA 1FT9A 4FHTA 5DEQA 2IA2A 3SXYA 3KFWX 4HF0A 1QQIA 3U9GA 4O6JA 3HRMA 3CUOA 1L3LA 3J81K 1WI9A 4WXDA 3GFMA 3T8RA 3HSRA 4M6YA 2STTA 1BJAA 1XN7A 3BP8A 2FNAA 4KMFA 4UVCA 2J5OA 3RKXA 5E8GA 3M9AA 1TW3A 2P5KA 2L54A 4UVBA 3QP5A 4CDGA 3ZMSA 4A0XA 1ZG3A 4GYGA 1G3WA 4ESBA 4NHJA 4CYDA 1LNWA 5L3GA 5HLIA 3QPHA 4G6DA 2K4JA 5DD8A 1ZARA 1P2FA 2XAHA 1ZRDA 5IT9Z 2QLZA 1J9IA 1TQPA 4L18B 3GEZA 2R7DA 4WK8F 4RB0A 4Y13A 3MZYA 2XROA 1HW5A 5BPDA 1P4AA 2BE5F 4U7DA 1FYLA 3QPTA 4HX7A 4MTDA 4YFXF 1XGSA 3CO7C 4ETSA 3WTZA 2DPUA 4LB6B 3E97A 4OINF 3GLXA 3ZN0A 2RC4A 2RVCA 5K5OA 1OKRA 2OBPA 2QZ8A 2PJPA 3KLNA 3ZMTA 3FF5A 2HTSA 1Z6RA 3JSPA 1A04A 2NAZA 1REPC 1S8NA 2FSWA 3VOEA 1FZPB 4KIGA 3ROUA 1TLHB 2QUFA 4E70A 2UXXA 5D4RA 2O6GE 3GZ5A 4WF2A 3P9CA 2QBYB 4XRFA 2PEXA 4IHTA 1S6LA 5L3EA 4A5NA 3U1DA 1Q1HA 5FFXA 1B9NA 3R60A 2EFPA 5IT3A 4LLGF 4KNYA 3EUHA 2JRTA 5DUKA 3JAMZ 3HTUA 3LA2A 2W84A 2XV4S 4IHSA 3T5XA 4CHUA 3LA7A 4N0BA 1R1UA 2PMHA 5BPIA 3B02A 5HDNA 1YLFA 3F6OA 3DQVC 2P7VB 1BM9A 4B09A 3LQRA 4HQMA 2VONA 1XSVA 1H9GA 2BGCA 4BHCA 3GFIA 3BJOA 4BXUA 3CLOA 1WSUA 3JTHA 2NS0A 1UHWA 1FSEA 2BEOA 1T0FA 2ZNZA 2PI0A 2R7FA 4PCQA 1KU2A 5CVRA 3G3ZA 1BOAA 3F23A 5HS8A 2F5EA 1KU7A 5JHUA 1T6SA 3BJ6A 3WGHA 2XIGA 2G9WA 2VXZA 2DU9A 2O03A 2FXAA 2NRAC 1FP2A 3E6BA 3FMRA 4KN7X 4UV9A 1YO5C 4O5VA 2EJRA 1FPQA 1QZZA 3DXJF 3L2CA 5HDGA 4XSZF 4M6XA 4Q4ZF 1OYYA 2GWRA 2QYOA 2MH2A 2FF4A 1YFHA 4R1HA 1ZAOA 1PP7U 3VODA 2HWVA 1BBYA 1U6GA 4N9HA 2Q0OA 1T98A 4Z2YA 3WTVC 3TQNA 1SD5A 2LNBA 2R3SA 5D8KB 4M9XA 2GQQA 5FFZA 3JSOA 3BY6A 5DDGA 3C7JA 1PP8F 1B59A 4G9YA 3P9KA 5D8LB 1BC7C 1B1BA 1K7AA 1J2XA 3I59A 2X0LA 1LQ1A 2C6YA 1SFXA 4YIFA 1MDMB 6PAXA 2YX4A 2HKOA 3QOPA 3LWFA 4ENMA 4FX4A 2OZUA 1W7PA 3PQJA 2RGVA 2HQNA 5HVQC 2ISZA 3GYHX 1ON2A 5L3CA 3H3UA 3SZPA 3T8TA 2NNYA 1BC8C 1B9MA 1ZG5A 1IN6A 4M71A 3O3KA 1EV7A 2CQKA 1STZA 3MWMA 4DQ2A 5F64A 3R4KA 5H6QA 1RUNA 3F8BA 1I27A 4D0PA 3RYPA 2VT3A 1U8RA 5JFRA 1EH8A 3HSFA 4I09A 2OA4A 3DP7A 1X3UA 4KIBA 4EV0A 3BZ6A 1LEBA 3H92A 3TO6A 3V7SA 1T38A 3R0AA 1MZBA 2HQRA 2K7LA 2EA2A 1Z05A 2MLGA 3HHHA 3J80K 1XSDA 3KLOA 4HV6A 1OYWA 4MGRA 2BBYA 1TBXA 3NQOA 3GUDA 4L9VA 4LG0A 3F8NA 2EFNA 2F5DA 2TDXA 4ESFA 4OOIA 1HKSA 5AIQA 3FMSA 4HF2A 4HQEA 1ZH5A 4L0ZB 3OV8A 1HBXG 1GXQA 3W6KB 3ELKA 4BH9A 3FMQA 4L5IA 3QP6A 1XD7A 2O3FA 3HUGA 1F9NA 4HZFA 1F1ZA 3WODF 3T0YA 1R7JA 4OMYA 4N9IA 4EGZA 3HOTA 1O3SA 4ZZDA 1QNTA 4GO1A 3DKWA 1PUEE 4RB1A 1HQCA 2D45A 5E1XA 4EJUA 4YFKF 3IWZA 1HW1A 5LGNA 3HTSB 1FNNA 3BOQA 1UB9A 2HEOA 2HFHA 3BPXA 1IXSB 2Y0MA 4WWCA 2FEZA 1Z6TA 4ZYHA 4EJVA 5K5QA 4EGYA 1LVAA 3TKYA 2HZTA 1IXRC 1YQAA 2OQGA 3N4MA 2ACJA 1R23A 1DDNA 1EH6A 3TGNA 1UFMA 2D1HA 1IRFA 1U5TA 5ILVA 4LB5A 4IRHA 4I0BA 3FZVA 2FA5A 3EDPA 1BI3A 5CVJA 2JZYA 2P7CB 1I1GA 3M1EA 3ZMZA 2L3DA 5ILSA 3MZHA 4LFUA 3FXRA 4ENNA 4I7HA 1KQ8A 2M45A 4IXAA 1H0MA 4HLXA 5CVUA 5BOXA 3FWEA 1MGTA 1P4XA 3LQQA 1P92A 3ABTA 4WXCA 4YFNF 5LRRA 4WX9A 1Z7UA 3KEQA 2HGCA 4XLPF 3WTUC 1S7AA 2DAOA 3L09A 3COAC 2V1XA 1SMYF 1R5GA 1FSHA 2Q8KA 1U5TC 5D5VB 5DCMB 4KDPA 3C3WA 2WWYA 3I5UA 2PBIA 4UNOA 3WTSC 2K4BA 3VFZA 2GA1A 2E7XA 5BQTA 2VT2A 3S2WA 2L4AA 2ZBKA 3L00A 2V9VA 3E6CC 4TV7A 3I71A 1QPMA 1AOYA 1IN8A 2ZMEA 3ML6A 4I02A 3GVAA 3F72A 2FU4A 3M7GA 2VOPA 1PDNC 2LDUA 4GYIA 1F5TA 1CF7B 1BIBA 3E5UA 3KZZA 1TQIA 2FMLA 2IA0A 5LLQA 2WV0A 4BNCA 1JXSA 3E5QA 4U88A 1V3FA 2CWEA 4HV5A 4HX4A 1R1VA 3P7NA 2EV6A 3FM3A 3F22A 1G3YA 1ONVA 4IRGA 4RAZA 1ZRFA 4OIRF 4G6QA 3Q5FA 1KYZA 2M5WA 4LLNA 5FD5A 1FBSA 2FOKA 5BMZA 3K69A 3ISPA 2Y48A 1XSXA 1HXDA 2FMYA 1E2XA 4CXFA 2KIMA 1RNLA 3LA3A 3F21A 2DTRA 4M9ZA 2ADUA 5LHIA 1I1SA 4XSXF 2IPQX 4ZH4F 3QAHA 3OOPA 1ULYA 3TOAA 2GXBA 2ESNA 3I4PA 3RTRA 2YX7A 4PZJA 4Q5SF 3WGGA 1Z91A 3ZMVA 2AS5F 2YU3A 1XCBA 3KP4A 4CZZA 5AIPA 4JBAA 1MD0A 5A2QK 1WWXA 4ZZLA 3TOBA 2DW4A 2IVMA 3WGIA 5E18F 2JT1A 3EQLF 3HIFA 2UWMA 4NQWA 1MKMA 4WCGA 4CGZA 3V7RA 2DK5A 4Q47A 4NB5A 1FWZA 5L3DA 4A6EA 1R5HA 3R0JA 1ZYRF 3NEUA 1JE8A 2DPDA 3I58A 4HA8A 4R79A 4P9FA 2HR3A 2Q2EA 1UHMA 1SD4A 2IT0A 1D8KA 1QO0D 2YPRA 3ERED 1K78A 3B73A 5H6RA 3KP3A 1T2KA 2VBXA 2NNNA 4H0EA 4Y17A 4MTEA 1T39A 2EWNA 4AIKA 2WTEA 1JHFA 3ZMUA 2X4HA 1YTYA 2XRNA
chains in the Genus database with same CATH superfamily
1OPCA 2V26A 2Z5UA 3J80Z 2R5YA 1VTNC 2XGCA 2IS2A 5D5WB 1X4PA 3D5LA 4IVNA 2IBDA 3JR9A 2AO9A 3ABUA 2HPIA 4KT5C 4U87A 1E3PA 4B47A 1APLC 2JMWA 3I4NJ 1MMAA 4RGUA 4H4KC 2Y9YA 3NAUA 4JK1X 1G8XA 1H9TA 5JHFA 4IOCF 2FBKA 1RI7A 1R49A 3ERMA 1WCMJ 2VODA 5HS9A 3KP6A 3CD6I 1V5GA 1KQ9A 3BQZA 2LOOA 2QQ9A 2F4MB 1N77A 3BJAA 5DYMA 3S3MA 1BI2A 1G3SA 2VKDA 5TISC 1TTYA 4KICA 4PJJA 2VXDA 3WG7H 2CGPA 2ZXJA 4Y15A 2YU9J 2V6CA 3TMOA 4KN4X 4UHTA 3MN2A 1JKRC 5H2FC 1NG6A 1IZ1A 5F0FA 2PN6A 5EF6A 1HKTA 3I54A 3PFYA 3VSKA 1BL0A 5C3EJ 1YYVA 4HLYA 2H6CA 2M4GA 3DTKA 4IJAA 3RIRA 2P8TA 3M8FA 2V1UA 2XAJA 1Z9CA 1G59A 2P5VA 2NS7A 3V7CA 2K3FA 1Y56A 3G71I 4CICA 2H94A 1JKQC 3F8FA 4FT8A 2EZHA 2IGNA 2MGQA 4OMZA 4L0YB 2O61A 2BY2A 2DA2A 5IOYA 4U7BA 4E7KA 1U2WA 2VQHA 5K7FA 5GPCA 3I64A 5HS7A 3BLYA 3P5JA 1RZ4A 5E1ZB 3MMYB 2KIFA 1ZG1A 3GZ6A 3U1KA 2E7WA 2LC2A 2VC1A 5KHDA 5GPAA 4CCMA 4S05A 3JREA 4S04A 3LAJA 3I56I 4AIHA 2OAZA 4U0VA 1IRZA 2EPFA 3JTGA 5FKNA 3RPQA 2M8GX 1IRXA 3FHZA 4F7ZA 4A12A 4M3BA 2XB0X 3N05A 3RPUA 3CCSI 4A3CJ 1ZRCA 2PG4A 1XMKA 4FE7A 1FEXA 3CUQA 1D0XA 4MFDA 3Q0WA 3DEUA 2M9HA 2XGDA 3H5NA 4C30A 4AIJA 3LSPA 2KIQA 4LK1F 2VE9A 1B8IA 3WHBA 3KP5A 1FTZA 2XASA 1OYIA 4S0HB 1VQ8I 5EDNA 1XB4A 1ORKA 3M8EA 2JTVA 1Z0XA 2DO7A 1PVEA 4Q48A 4HYEA 4JX5A 4PFPA 1EH7A 1NG7A 1SFEA 4M3EA 2KJCA 3BG6A 1RIOH 2AXLA 4HX8A 5LHHA 5HNFA 3LMMA 4C3JJ 3G73A 2M30A 1W4MA 1W7PD 5DUIA 2XUBA 2ME6A 1SD7A 3K4LA 4M73A 3K10A 4CCKA 1Z1DA 3UR3C 1EF4A 2OQRA 1O57A 1IRGA 1JUPA 2DQRA 5DM6F 1FIAA 4X1EA 5LRSA 2E5NA 2KISA 2HTJA 1F4KA 3KZYA 3HEFA 3PO3J 2HS5A 1MIJA 3HSEA 2B0LA 2FE3A 3SHFA 2QSGX 2DOAA 3F3XA 4UXNA 3X2QH 3IKVA 4ZDLA 2DOEA 4BBRJ 2EFOA 2H8WA 4RMNA 4NQWB 2RNJA 3RI4A 3V8KA 3FXQA 2LKXA 2X51A 2WA0A 1QVTA 3HKZN 1DUXC 3BR3A 2J5PA 2IAIA 2EV5A 1PUFB 1FOWA 4XOPA 2OF7A 1NTCA 2KT0A 4PJLA 2A61A 1XGNA 2GLOA 3BG7A 1JTXA 4ZYDA 2W85A 5LHGA 5FGMA 1IGNA 1GT0C 3J81Z 4IX7A 3GTOJ 3VB2A 4KA4A 3CUQC 1LFUP 4JYKA 1MBJA 2CU7A 1QRYA 3VDXA 1ZR2A 3QWLA 3BR1A 3H3VK 2OZ6A 2LRDA 4PDKA 2P6TA 2F5CA 4R8HA 2VBZA 1ZQ3P 3GF2A 4IHVA 3MFKA 1YX3A 1IAWA 3HBLA 5F0HA 3E6DA 5F1JA 5CJ9A 4XL9A 3OYLA 1U0JA 4BJTA 2PLYA 2M3AA 5M5WJ 1PYVA 2WAEA 2MD5A 4V2FA 1V4RA 4KMUX 1WQ2A 4HEA2 2DI3A 3GXOA 4A5MA 3E5XA 5C4JJ 1WJFA 2WY7Q 2F5FA 3PUFA 2XF5A 1TNSA 2DQLA 3H3ZA 1IG7A 2DA3A 4CCOA 4XLHA 3AAFA 3ZPLA 3BTJA 3DLLF 1RKWA 1OCTC 5KK1A 2BXYA 2M2EA 4V19K 4PGHA 2PJRA 1LUJB 4PGGA 2CO5A 2K9MA 2E1CA 4FQGA 2O8XA 4I0AA 1VQNI 2CMPA 2K5CA 4EQQA 1BN5A 3RDIA 2CW0F 2VBWA 3S1RJ 1R22A 3QOEA 5E79C 1TL8A 1D3YA 1Y0UA 1B72B 2LYCA 5GAHJ 3S1MJ 4B4CA 3KEOA 3K1PA 3L2WA 1D8JA 4LLLA 2VPLA 2B9SA 2ZFWA 4QSHA 2W57A 1S7OA 2RV8A 3TEDA 2Y75A 1D1AA 4G8XA 4EMSA 2OV7A 5ERIA 3K4KA 2E2HJ 2WAQN 2LKPA 3GWZA 4I01A 1GVJA 1ENHA 3S14J 4BYYA 1J0RA 1YS6A 2UXNA 3QU6A 2A6HF 5IOZA 2XPWA 1A5JA 1O7FA 1V5FA 1O3TA 2ZJRF 2M4KA 2NXNB 1HSJA 3ZQLA 3H36A 1H89C 1MH3A 3CO6C 2L9VA 2O0YA 2IP2A 4G7ZF 5J8FA 4UB6C 1SMTA 4F55A 2ZXWH 1ZLJA 2XHKA 4C3HJ 3FKIJ 1A31A 2JA2A 5F1RA 3RQIA 5ILUA 3QYFA 2K9NA 3S93A 3I59B 4OIOF 5EYRA 2ZJPF 2DT7B 3S15J 2ME0A 3REOA 4P9UA 4E7JA 1J75A 2F4IA 2CV2A 2CG4A 2ZJ2A 2LY1A 3CDHA 1Z3YA 3GW2A 2LF7A 2OD5A 4MQVA 3A01A 2D2WA 4C2TA 1RR8C 4A3GJ 4ENJA 3K70D 2HDCA 4RGSA 2FBHA 3HRSA 4MNUA 2HVSA 2EFWA 2IJLA 3O6BB 3G2BA 4RM3A 2P6SA 3F8CA 1QGPA 1NK2P 3VWBA 3PQKA 3FX3A 1W7PB 5J1UA 4AD9A 4PJMA 1DP7P 2PMZN 2VPRA 1XCVA 4YIIA 4C9YA 1LKXA 3OIQA 1LDKB 3LSTA 4I6ZA 3DTEA 5E1WA 3DF8A 1P4WA 5KNLA 2BW3A 1T8IA 2E5ZA 2JPCA 4XIDA 5ICCA 1N78A 1U8BA 4NDLA 3BG3A 2XAUA 1X2MA 2W24A 3SZTA 1GV5A 1Z67A 3CCUI 3JRBA 1IUFA 3RKWA 3ULQB 1YI2I 2NS8A 1U3EM 2HQ5A 1TWFJ 2QQBA 2HKXA 1DU0A 5ICEA 1XPXA 2QQ8A 3DPTA 1Z3XA 2JPBA 5A2QZ 3BG5A 2PX9A 3BCAA 2JUGA 1U9OA 1VF9A 2L5QA 2MYSA 4CCJA 2LD5A 5EEAA 1C0WA 3EUKL 1W0UA 2UZKA 4UVAA 2MSYA 2NOGA 3R6SA 4BUPA 4C2MJ 4F52A 2ZKZA 2EA4A 1HDPA 2EH3A 3HHGA 2M34A 1RKTA 3MD2A 5M3MJ 2IXSA 1FYMA 4ESJA 3K9TA 3BR6A 3RKYA 3TBIA 3G4SI 2PFBA 3NWSA 2K85A 4MEXF 1FTTA 4ZYEA 4CH7A 2XC7A 5BS6A 1MJBA 3BZCA 3OL3A 3DBRB 2LG4A 5LGTA 2IA1A 4BAYA 2V79A 3CMAI 2VC0A 2QSHX 1LEAA 5M5XJ 3IV5A 2OC6A 1K4SA 4F91B 4DBRA 3DWLE 2EV0A 2L7FP 5B5EC 2BVMA 1RC9A 2A69F 2VBYA 1ETOA 1KU9A 2HYGD 3C1DA 3FBNB 3MCZA 4C2UA 4MEYF 2M87A 1AHDP 4RA2A 3WU1B 2M7BA 5D5XB 1HDDC 2VOOA 3I4MJ 3L9FA 1MBGA 3BTIA 4KYWA 1ZKGA 3HGYA 2HVRA 3IC7A 3WU0A 4LG0B 1BI0A 5FLXK 2R7XA 4EM1A 1Y1WJ 2DJNA 1ITYA 1UG0A 3OYBA 5CYVA 1DP3A 1W1WE 2ID3A 1WKMA 5ICFA 2KZVA 1AWCA 1YITI 2F2EA 2QVOA 3D0SA 5HDKA 4LIUA 5ICGA 3KP7A 1MBFA 2A07F 3DFGA 3F0CA 4M72A 4QPOA 4XBFA 1W5SA 3H0DA 3MQ0A 4XLNF 2BHYA 4L9TA 3AKZA 2VJJA 1K83J 1TNTA 2ZXIA 5KCMA 3CCLI 3IP4B 2W7NA 1IC8A 4IRIA 4OIQF 1RPWA 2MBFA 3LSHA 4G94A 2RREA 4EM2A 1L0OC 3F6VA 4A0ZA 4DYRA 2MLKA 4IHXA 5D6FA 2Z99A 5CVIA 3OY9A 1VI0A 1LB2A 3CC4I 3LSKA 2LR8A 4UUSB 1YOVB 3W2WA 4IEJA 2E60A 4RB3C 4LGWA 4L9JA 5J4YA 1R36A 2HYJA 1B4AA 1NHAA 1A36A 3BWGA 4HBLA 3TO7A 4BJ5C 4QWQA 3ZP5A 1KQ0A 4WXHA 1KYWA 3WTTC 4BQAA 4XOTA 1T33A 5DM7F 4J00A 1VQ7I 4UB8C 5LEKA 1IN7A 4A6DA 5HOOA 2ELHA 2ZFUA 2QM3A 1QZEA 3SFIA 4G7HF 1WJAA 2K40A 4BY7J 2F5VA 5C44J 4N4OB 1UCRA 3IRRA 4FCYA 1I5ZA 2HOEA 2P0WA 3WG9A 1JKOC 3IWFA 4K2EA 3Q3SA 5ED4A 3GTMJ 4HDUA 3TDUC 5FB2A 5K5RA 2HNHA 1MNDA 5L3FA 2A5WA 2A68F 2P5LC 1ERDA 1USSA 3ZRGA 3G1MA 2VE8A 4ZTJA 2GAUA 4A0YA 4HSTA 1XGMA 5JI6A 4AWXB 1MDMA 2R7ZJ 2RDPA 2Y2ZA 4CSWA 2QWWA 1FBQA 2R7RA 4HNTA 3ZQIA 4EM0B 1RUOA 1JTYA 4OAZA 4OIPF 1JGSA 1U5TB 1JI8A 2X6YA 3S1QJ 5LEJA 1S29A 4IQJA 1YW9A 3ASNH 2KDOA 1XC5A 1ACIA 4KITB 3JW4A 4XN0A 1MJAA 3HB9A 1J59A 3DV8A 1IXCA 1ZREA 3JCUC 4DJAA 1Y1VJ 3OSFA 1FC3A 4LJZF 1Y6IA 4BBSJ 3RKQA 2HDDA 1ZK8A 3T1BA 1BIAA 4FETA 4I98B 2JSCA 4RGRA 2W25A 3GO5A 5DS9A 2VQGA 2ETHA 4JOMA 5EZHA 2QSFX 2XVCA 3BTCA 4C3IJ 1GHCA 2KLOA 3OS1A 1U78A 4XRMA 4KUMA 5CVVA 1TW2A 2DA6A 2L9RA 1SFUA 4RGXA 5EEGA 3SZGA 5EGOA 1DGWY 1J5YA 1OISA 4JQFA 2GXGA 1D5VA 1IF1A 5HLHA 4RBOA 2BW3B 2RKHA 2Y30A 1P9QC 3G1OA 2DFIA 3JRGA 3QYEA 4A3DJ 1TT5B 2A5YB 2IGKA 1HW2A 4KISA 3WTYC 5FKKA 1WFXA 4DZPA 1UJ8A 3KE2A 3UNGC 3C2GA 4D7MA 4GFBA 1JHHA 4ABZA 4M74A 1O3QA 3CJNA 2VJIA 3DPUA 3BPVA 1OR7A 2M0MA 2RN7A 3SEZA 1ON1A 3QRFF 5F6FA 1YRNB 2MA3A 4P96A 3IL2A 4OU0A 1DPUA 1S3JA 2GA2A 2VLAA 2FRHA 2AXTC 2X1CA 1ZGJA 2W82A 4ASNA 3NWTA 2OTLI 3J7AO 2KKOA 1R58A 2WV1A 3CCEI 2DMNA 2Z33A 2QQAA 1I3QJ 2DLLA 3N97A 3HG9A 2QENA 2WY8Q 4IF4A 4UUVA 5JR3A 1FLIA 4IPAA 2ZCWA 4NC7A 4EJTA 1WRJA 1WZ2A 5LGUA 1QHGA 4CO8A 4XLEA 2HYFA 1GXPA 4BDYA 2R7VA 2YR2A 4PSXA 3GX4X 3PL8A 2XKOA 1YIJI 4KIFA 1VQOI 3BT9A 4YG2F 4ZC3A 1G2HA 4NNJA 2M8EA 1LFPA 1YS7A 3F8MA 2MH9A 1YG2A 1XDSA 5D4SA 1E17A 2L01A 1HLVA 2MG4A 3K4CA 3OYCA 5F27A 4NC6A 2BY0A 4U0WA 5E3LA 5IT9K 2DCEA 2JJ7A 2CJJA 1SFKA 4U0YA 5B3SH 1FOYA 1ZGAA 3WTXC 2FNPA 3HRTA 2R92J 3M1CA 3CP2A 2E1MB 1HKQA 3PNTA 2QKMB 3HPHA 2EB7A 3EYYA 1T56A 3VYUB 3V42A 2ZMEB 2GM4A 2Z9OA 5GAEJ 4F92B 1BI1A 2QKLB 2JSPA 5FO5A 3CESA 5H20A 2MD0A 1OR7C 5HLGA 1CGPA 3J7YJ 3EYIA 3TO9A 1I3AA 3PFIA 4E7SA 3GLLA 5FLVA 1E3HA 4BU2A 5GTIC 2KRFA 2D1VA 2K27A 1GVDA 1VQLI 2BV6A 3DCFA 5J1YA 4CYCB 3HOSA 4KFCA 2L02A 1OCPA 2HOSA 1KU3A 3CCYA 3CJQB 3GFJA 2JN6A 2COMA 2KPMA 3TL4X 2E19A 3PUBA 3L2UA 2HXOA 4EJOA 3K1NA 2L7KA 2L4MA 3LFKA 4EJWA 2GZWA 1FIPA 4W1UA 2LF8A 2EILH 3SFZA 2CH0A 2RQPA 4IQ4A 1OCCH 4HW0A 2FQ3A 1XG1A 3RJPA 1XGOA 4LMYA 3K7AJ 5FKMA 2MC3A 2CW8A 2XSDC 4FX0A 3BC8A 1FBUA 4BHPA 3NRVA 5FD6A 1OMIA 2IRFG 5KVRA 3L7WA 2FBIA 1JUMA 1QZYA 3LL7A 3VEPA 1LE8A 5E3MA 3FK6A 2Y0SA 2ZXHA 4YEJA 2CFXA 2XGXA 2H6BA 3VPRA 3HGGA 5J6XA 3SQNA 2KJBA 2Z1DA 4LD5A 3HC7A 1ZN2A 3QU3A 1BR4A 2KRCA 3I53A 3K1MA 2MFZA 3GFLA 3PNYA 2A05A 2JA7J 1R1TA 2CSOA 3MVPA 3OYDA 1FY7A 4P55A 2KIUA 4E6KG 4G7OF 3RSNA 3K2ZA 5D6EA 3ZQ7A 3LSRA 3E3VA 3RPUD 3IRQA 1K79A 2LBFA 3O2PE 3JAMK 3CMYA 2DBBA 3ECHA 2DT5A 3SYTA 4ON0A 1IUYA 3KYLA 4HNVA 4MFEA 1OCOH 1MSEC 4LK0F 1XX5A 3CTAA 1WPKA 1FMVA 2YSRA 4D7NA 2DFEA 3E6MA 1SFOJ 1X2NA 4B3XA 3OWTA 4LITA 3AL0C 3E7LA 1R00A 2V9PA 2V7FA 3OMYA 4QTRA 1MMSA 1O7LA 2ESHA 2ZNYA 1YW7A 3IKTA 3MEXA 3RCOA 4BHBA 3HRUA 2Z2SB 3W6VA 3GTJJ 4A3LJ 3EPZA 3R61A 2Z3YA 3D1NI 1YJWI 1QBJA 1X4OA 4XKVA 4HSRA 1IW7F 1LPQA 4EVIA 3I55I 1B6AA 4MQ9F 5EGOB 3KP2A 4ENKA 3FXLA 4BE1A 2XKPA 1AU7A 1VFCA 1N25A 3HOZJ 1YIOA 4PUSA 1IN5A 4QLCU 2E1NA 5EG0B 1G3TA 4HDVA 2LY2A 2V1DA 1FOKA 2ZB9A 1LJ9A 3MAJA 4RS8A 2A3SA 2KMUA 1ODDA 4AC0A 3Q9SA 2Q2EB 4Y7NJ 3FXMA 5DCMA 4IHWA 1LFBA 2ISYA 3O8HA 2BYVE 2VIXA 4RB2C 1H8AC 2X48A 2WC2A 2KL4A 3BROA 3TW7A 5TRDA 1EA3A 3W6JB 4HF1A 4BL0B 4ZYGA 4M9SA 2CUFA 3OIOA 4MHGA 3WTWC 1K78B 2V6EA 2PMZA 2EZKA 4PK4A 4O3MA 3FISA 5D5UB 5E8IA 1AA7A 4GCVA 1KA8A 2OU2A 2H27A 5FROA 3C2BA 5TJJA 1QA6A 1FYKA 3L2RA 3C18A 3RZOJ 2R5YB 3HJEA 4AU7A 2ZC2A 1WVRA 1O3RA 3ZCOA 2K9QA 1EKEA 1ZTRA 4A2UA 1O4XA 5C4XJ 1FX7A 2XPVA 3A02A 3Q9VA 4GXOA 4BEHA 2ELJA 3HOWJ 4NUBA 2K86A 1UZCA 2QEXI 3WE2A 1SD6A 2BOLA 1VQMI 1K4TA 1EJ9A 4DBQA 5DD4A 2DODA 2CS3A 3FK7A 3H0GJ 5FLXZ 1P6RA 4XNFA 4HAMA 2XRLA 3OOUA 4Y3OA 1I50J 5E20A 2CV1A 1IN4A 1CF7A 3U2RA 3DLAA 2DT6A 4HOBA 3CCQI 2G7HA 1OFCX 5L3BA 1KGSA 2IW5A 2FOWA 4JX6A 3ZGKA 1K6OA 2XAFA 3O8GA 3CF2A 1YW8A 4GGGA 5DV5A 5GTHC 3KX2A 2H09A 1ZHFA 4A3JJ 1T95A 2EK5A 3RYRA 3V4GA 3V8LA 1HSTA 1WJCA 3MKZA 5EJCA 3Q0VA 4AIDA 2XAGA 4P5OA 4XLAA 3M8JA 3ASOH 3K4NA 3DPLC 3KCCA 4B8XA 5DCFA 5LBQA 1SAXA 5GAGJ 1UMQA 3GTPJ 4AVPA 3CCMI 2IGOA 3WE3A 3JRHA 4XR6A 1USTA 2RAEA 1FP1D 3K0LA 2PMUA 4E7IA 5CLSA 1G6NA 5DTDA 2LSOA 2P4WA 4B44A 1I6XA 1H88C 3G6EI 1DPRA 3CDLA 4UV8A 2B63J 3LSJA 3EETA 4RAYA 2EFQA 5JVTA 2A6EF 2NYXA 2JUCA 3FDYA 3HYIA 1W5TA 3V8JA 3VYRB 4LIVA 5EEHA 1TQMA 5CPRB 2STWA 5J4VA 2CYYA 2KZGA 2QBYA 1LDDA 3FXUA 4RAFA 1LE8B 3H9JA 2PQ8A 5E3NA 4RDUA 2DOFA 2DK8A 3CUQB 2JWTA 3KETA 2FQ4A 3I9V2 4IZZA 4XMYA 3TDZC 4II2A 3I0TA 5AONA 2XAQA 2GIVA 3OIPA 1MJ9A 3ZOBA 3ZN1A 4UY8I 2LKSA 3ZMDA 1G4DA 1XMAA 3BDDA 4DGWB 3VYSB 4L5JA 3SDBA 2G7UA 3DU5A 3GCMA 1ZLKA 2R4GA 4D9JA 1B8IB 1XDUA 3ECOA 3HPGA 2ZO4A 3IHUA 2R5ZA 2V9KA 3OYNA 1YE9A 3ONQA 4CUGA 3FM5A 1LDJA 4XONA 4A69C 2VQCA 4L9NA 5J8CA 1AKHA 2VN2A 4I2OA 4MIMA 2K02A 3S1NJ 4DNCA 4ZDOA 4XM3A 2M1BA 3AG4H 3P9IA 4XKBA 1FJLA 5E17F 2XGEA 3LAPA 5K1YA 2R7WA 5HODA 1J7KA 4DYCA 1FT9A 2YS9A 4ZDPA 1MMNA 4FHTA 5DEQA 2IA2A 3W2VA 4B1RA 3S17J 5IP9J 3SXYA 3LFUA 1BR2A 3IH4A 3KFWX 4HF0A 3S3OA 2H1LA 4GRIA 1QQIA 5FRNA 2JA5J 2O8KA 1HOMA 1VQ9I 3KEYA 1NK3P 3CLQA 3HDDA 4IL6C 3U9GA 4O6JA 3HRMA 1DU6A 3CUOA 1L3LA 3J81K 2L9SA 3LSIA 1WI9A 2HU9A 4WXDA 3GFMA 3M07A 3T8RA 3HSRA 4M6YA 5J47A 4XICA 3A1YA 3LSMA 3JRIA 3FXOA 1BJAA 1XN7A 2STTA 1JJ6C 3BP8A 1D1CA 4ZTFA 2FNAA 2WB1N 4KMFA 2KHMA 2E71A 3J7AY 4UVCA 3ZQGA 2J5OA 2H1KA 2D5VA 2JVHA 2OJED 3RKXA 5E8GA 3OYAA 1TP4A 3M9AA 1TW3A 2P5KA 2L54A 4UVBA 3A2KA 3QP5A 4CDGA 5IYCJ 3ZMSA 4A0XA 1ZG3A 4GYGA 1G3WA 2RQQA 3FKJA 4ESBA 1ZR4A 4NHJA 4CYDA 1LNWA 5L3GA 5HLIA 3A0HC 3QPHA 4G6DA 2K4JA 5DD8A 1ZARA 1SVOA 2XAHA 1P2FA 2OCEA 2CRGA 2V4JC 1WGXA 1ZRDA 1X3WB 5B1AH 4FISA 1YX5A 2VJ4A 2QLZA 4ITVA 5IT9Z 1J9IA 3MKWB 3CJTB 1TQPA 4L18B 1Y0NA 3GEZA 2R7DA 1BOBA 1UAAA 2VI6A 4WK8F 4RB0A 2CQXA 4Y13A 1ETYA 2PJRB 2DYRH 1IO2A 3DEWA 3MZYA 2I8DA 3BR0A 4V2GA 3TP0A 1HW5A 2XROA 5BPDA 2BVLA 2DYSH 1P4AA 4GDFA 4CA0A 2KDZA 2BE5F 2IGMA 2DA1A 4U7DA 1FYLA 3RQ4A 3K6GA 3QPTA 4HX7A 4CCNA 2ECCA 4MTDA 1NH3A 4YFXF 4D5CA 1XGSA 3MKLA 3CO7C 2CUEA 9ANTA 4ETSA 1R4MB 3ABKH 3WTZA 4FASD 2DPUA 4LB6B 3E97A 4OINF 3GLXA 3ZN0A 1ZELA 2RC4A 2RVCA 3VSLA 5K5OA 5M5YJ 2X1EA 1OKRA 2OBPA 3H9GA 4RLFA 3AG2H 2HZDA 2QZ8A 4LG3A 2PJPA 5GP9A 3KLNA 2AQFA 3ZMTA 1OLTA 2ID6A 3FF5A 1WI3A 2HTSA 3PSIA 3OS0A 4BQNA 3M3YJ 1Z6RA 3K4BA 2CQ7A 2ZSHB 3JSPA 3HOVJ 1A04A 2NAZA 1REPC 2WAFA 3LNQA 3AG1H 1S8NA 2FSWA 3VOEA 4G12A 1FZPB 4KIGA 3ZQHA 2L0KA 3ROUA 5E3OA 3CMEI 3OYFA 5FJ8J 3L1PA 2L9NA 1TLHB 3ESWB 1Q1VA 2QUFA 4E70A 4RAGA 2UXXA 5D4RA 2O6GE 3A01B 5JLWA 3GZ5A 1LVKA 1E3OC 4WF2A 4AYBN 1VQ4I 3NARA 3P9CA 4HG2A 2QBYB 4XRFA 2PEXA 4IHTA 3ZXSA 1S6LA 2DMQA 4A5NA 4XKCA 3U1DA 5L3EA 1MSFC 1X1BA 1Q1HA 4L5EA 2E35A 5FFXA 3IAS2 1B9NA 3PM1A 3R60A 4EATA 4PFOA 1SVLA 2EFPA 1JKPC 5IT3A 4LLGF 4KNYA 3EUHA 2VKEA 2JRTA 1ZGWA 4AVZA 5DUKA 3JAMZ 2Z16A 2XF6A 3GTGJ 3HTUA 3LA2A 2W84A 2XV4S 2LREA 1K61A 2P81A 1W36C 2R7SA 4IHSA 2LK2A 2DFFA 3T5XA 4CHUA 2QGUA 3LA7A 2BZTA 5IYDJ 4N0BA 1R1UA 1JGGA 4NBQA 2PMHA 1HCRA 5BPIA 2RNGA 3B02A 5HDNA 3GMEA 1YLFA 3F6OA 3A4CA 4ZJZA 3DQVC 2P7VB 1BM9A 2CUJA 4B09A 3M4OJ 2XPUA 3LQRA 1BW5A 2VUMJ 2I10A 4HQMA 2N8GA 2VONA 1XSVA 3KIOA 2L2OA 1H9GA 2BGCA 4BHCA 3GFIA 3BJOA 3CJRB 2QCOA 2FD5A 4BXUA 3CLOA 1WSUA 2X85A 3CQZJ 3JTHA 4RM2A 4FE4A 2NS0A 1UHWA 1FSEA 4B48A 2JA6J 2BEOA 1T0FA 2ZNZA 2ZJQF 2PI0A 1VZ0A 2O5RA 2R7FA 4PCQA 1V55H 2O9LA 1SAUA 1KU2A 5CVRA 3G3ZA 1BOAA 3H5RA 3OL4A 3DEEA 3F23A 2GBYA 5HS8A 3D5SC 2E36A 2F5EA 2FJ1A 5KAFC 4HRIA 2NVXJ 1KU7A 5JHUA 1WJDA 1T6SA 1SEUA 3BJ6A 2E2IJ 3WGHA 4QPQA 2ZSIB 3HXLA 4E7ZA 1D0YA 2XIGA 4I76A 2EZIA 4KJZA 1RR7A 4ANJA 3EUHC 2G9WA 5KAIC 5FLMJ 2VXZA 2DU9A 2O03A 2FXAA 2NRAC 3CDIA 1FP2A 3E6BA 3HKZA 3FMRA 4KN7X 4UV9A 1YO5C 4O5VA 2HOAA 4YELA 3HM5A 3KYCB 2EJRA 2VL8A 2QF7A 1PJRA 1FPQA 4BJ6C 5M3FJ 1ETWA 1D0ZA 3BR2A 1QZZA 3DXJF 1RRJA 4ZYAA 1B72A 3FHNA 2Q1ZB 2DMPA 3L2CA 1R5ID 5IPAA 3QYBA 3F9KA 5HDGA 2VKVA 3QPSA 4XSZF 4PJ0C 4M6XA 3ZQCA 4Q4ZF 1OYYA 4BQOA 2GWRA 1F36A 2HI3A 2QYOA 4X0GA 2MH2A 2FF4A 1YFHA 4R1HA 1ZAOA 3DTIA 1PP7U 2R7UA 3VODA 4DYQA 2LH9A 2HWVA 1BBYA 1U6GA 2UUZA 4N9HA 2Q0OA 1T98A 4I99C 1S7EA 4Z2YA 2CW7A 3WTVC 1TZLA 2KP6A 1OCZH 2M0CA 3TQNA 3CCJI 3AFHA 1SD5A 2ELKA 2LNBA 5IP7J 2R3SA 5D8KB 3A0BC 2GQQA 4M9XA 1T0FC 3BG9A 1MMDA 5FFZA 3JSOA 1D1BA 3BY6A 3MKYB 4MLOA 1TWAJ 2DTZA 4PSWA 1WJEA 3DBLB 5DDGA 1ETKA 3C7JA 3IH3A 3OYEA 1PP8F 1B59A 1VNDA 4G9YA 1GV2A 3P9KA 5D8LB 4BKXA 1BC7C 1B1BA 3JRCA 3DU6A 1MBEA 1K7AA 2JVGA 1X1DA 1E0EA 1J2XA 1MBHA 4PJNA 1JJ8C 3I59A 3KPHA 2R7QA 3H9QA 2R0QC 5FRMA 2EQRA 2X0LA 1IDYA 1LQ1A 2C6YA 1SFXA 4YIFA 1MDMB 6PAXA 3QODA 2NVQJ 1I39A 2R7OA 2AQEA 1KZHA 2OCCH 3JRFA 3UKGA 2YX4A 2XDVA 2HKOA 3S8PA 3TP3A 3QOPA 1MBKA 3LWFA 4ENMA 4FX4A 2OZUA 3HL2A 1Y39A 1W7PA 2HVQA 3CZ6A 3PQJA 2RGVA 2WBMA 2HQNA 5HVQC 2ISZA 3GYHX 1ON2A 2WAQA 5L3CA 4Y52J 3H3UA 1XS9A 3SZPA 3T8TA 2NNYA 2DDBA 1BC8C 1B9MA 5BNGA 3PO2J 3OYMA 5J40A 2X6OA 1ZG5A 2EIJH 3WHCA 1IN6A 3BZKA 3CC7I 3GTLJ 2Y69H 4M71A 3O3KA 4DIQA 1EV7A 2CQKA 1STZA 3CP8A 3MWMA 4DQ2A 1DGRM 5F64A 1TC3C 3R4KA 5H6QA 1RUNA 3F8BA 1R4NB 3SJMA 1I27A 4D0PA 1SVMA 3RYPA 3GTKJ 1IV8A 2VT3A 1U8RA 5JFRA 1EH8A 2CUZA 3HSFA 4XORA 5CKTA 5HLTA 4I09A 3FXJA 3ZQFA 4DOZA 3RZDJ 2M7AA 5K7HA 3JRDA 4A3IJ 2OA4A 3DP7A 1X3UA 2OUMA 4KIBA 3S2HJ 4EV0A 3A03A 3BZ6A 1LEBA 3GZNB 4M3FA 3H92A 4BXXJ 3TO6A 3V7SA 2HDWA 1T38A 3R0AA 5IY5H 1MZBA 4YRVA 2HQRA 1U9NA 2K7LA 1IV6A 2EA2A 1Z05A 2MLGA 3HHHA 3J80K 3MZ8A 1XSDA 3KLOA 4OWRB 5IYBJ 1W0TA 2BY3A 4HV6A 1OYWA 4MGRA 3OYIA 2BBYA 3FXKA 1TBXA 2K9LA 3WU2C 3NQOA 3GUDA 4L9VA 4LG0A 3F8NA 4F93B 2EFNA 4BQQA 2F5DA 2MC4A 4XLFA 3OSGA 3S2DJ 2LMDA 2TDXA 4ESFA 1ETXA 4OOIA 1HKSA 3IUOA 5AIQA 3FMSA 2NVUB 3SEQA 5JVGF 4E7LA 4HF2A 3K2AA 4HQEA 1ZH5A 4L0ZB 3D5RC 3OV8A 1HBXG 1GXQA 3W6KB 1MH4A 1XMXA 3ELKA 4BH9A 3FMQA 4L5IA 3QP6A 1GDTA 5F0CA 3S32A 1XD7A 2O3FA 3HUGA 1F9NA 2DXIA 4HZFA 1F1ZA 3WODF 3PIOF 1Z7LA 5B66C 2Y0SN 3T0YA 1S72I 1R7JA 3PSFA 4OMYA 4N9IA 4EGZA 3HOTA 1P7JA 1OJLA 1Y8RB 2ICWG 1O3SA 2CV0A 3LOCA 4ZZDA 2LVSA 1QNTA 1VQ6I 1HF0A 4GO1A 3BQYA 3DKWA 1PUEE 4RB1A 1HQCA 1ETQA 3CCVI 4UUSA 2EIMH 2KQRA 1QPIA 2D45A 3QPLA 3JRAA 5E1XA 4EJUA 1WJ5A 4YFKF 3IWZA 1HW1A 5LGNA 3HTSB 3L2VA 1TWHJ 2WB1A 1BR1A 1I6HJ 3B6CA 2H8RA 3DKXA 3AL0B 1FNNA 1BJZA 3BOQA 1UB9A 2CQQA 2EBIA 2HEOA 3LSGA 5LD2C 4D5FA 2HFHA 3FIWA 4A3BJ 4FTHA 3BPXA 1K6YA 3IAM2 3U21A 1IXSB 3TW6A 2Y0MA 4WWCA 2FEZA 1Z6TA 4ZYHA 4BE0A 4EJVA 4II3A 1D5YA 2O7OA 3B6AA 5K5QA 4EGYA 3ZQQA 1LVAA 3TKYA 2HZTA 1POGA 1IXRC 1YQAA 2OPTA 1WH7A 1MMGA 2OQGA 4B3AA 3N4MA 2XSJC 3PNVA 2ACJA 2GOMA 2DN0A 1X19A 1R23A 1FOXA 5LFAA 1DDNA 1EH6A 3TGNA 1UFMA 1TWGJ 2D1HA 1FMWA 1IRFA 1U5TA 5ILVA 4LB5A 4IRHA 3K4JA 4I0BA 3FZVA 4G6TB 3CCRI 1A6IA 2KFDA 1TWCJ 4IOAF 1R71A 2FA5A 2R93J 3EDPA 4LOCA 4N4NB 1BI3A 3BTLA 4UUTA 5CVJA 2JZYA 2MW8A 4KT6A 2P7CB 1I1GA 3M1EA 3ZMZA 3H1CA 1WHUA 2L3DA 5ILSA 3MZHA 2LBFB 2K9SA 1QHHD 2DA5A 4LFUA 3FXRA 4Y33A 4ENNA 4I7HA 1KQ8A 3QQAA 2AHQA 1OQYA 1X58A 1R6RA 2M45A 3G1LA 1V5EA 2LTPA 5J3LA 3W3CA 2JRMA 4XRSG 4B43A 4IXAA 4AUXA 4XKWA 1H0MA 1UG2A 1WJBA 4IO9F 4HPQA 5TGTA 2IS1A 4HLXA 4JX4A 2R7TA 2KRHA 3EUAA 5CVUA 2JK3A 3IH2A 2CFOA 5BOXA 3FWEA 1JUSA 1A35A 1MGTA 1P4XA 3LQQA 1P92A 3ABTA 4J19A 3HOYJ 4BS9A 3OYGA 1CQTA 1X1PA 4WXCA 2HXIA 1MNMC 3OR2C 4YFNF 4HNUA 1UHSA 1YRNA 1T08B 5LRRA 4F3QA 4WX9A 1Z7UA 3KEQA 2HGCA 2NVYJ 4XLPF 2HQAA 3WTUC 1MNEA 2GOXB 1S7AA 4BACA 2DAOA 3K70C 3L09A 3COAC 2V1XA 1SMYF 4M3DA 1R5GA 1FSHA 2Q8KA 1BW6A 1U5TC 2B7EA 4AYBA 5D5VB 5DCMB 4A3MJ 4KDPA 3C3WA 2A6TA 1P7IA 2WWYA 1QVUA 1UELB 3BR5A 5F08A 4OAYA 3I5UA 1KONA 2JA8J 2PBIA 4QIWN 3K4MA 4P1WA 2E34A 4UNOA 4W97A 3WTSC 2IS4A 2K4BA 3VFZA 5FKOA 2GA1A 2FUG2 2E7XA 5BQTA 2JQ7A 3PIPF 2VT2A 3S2WA 2COBA 3CMMA 2L4AA 5IP6A 1YJNI 1XTAA 2E1OA 2ZBKA 3AG3H 3H35A 4BGDA 3L00A 1R9TJ 3HOUJ 2V9VA 3E6CC 2CQNA 4YIRX 4TV7A 3I71A 1QPMA 2Y31A 1AOYA 2NVTJ 1IJWC 4BEHB 1IN8A 1WH5A 2Y9ZA 2BHZA 2W1OA 2E2JJ 2ZMEA 3ML6A 4BY1J 2X9DA 5B1BH 4I02A 2TCTA 1J09A 3GBGA 4A3EJ 2GIZA 3L2QA 2G0EA 3ABMH 4IKFA 3GVAA 3F72A 2FU4A 2UV1A 5GADJ 2DMTA 1RETA 3M7GA 4DZJA 2VOPA 1PDNC 2DFHA 2LDUA 4GYIA 3ABLH 4E4HA 1F5TA 3KYDB 5FKLA 3HUGB 1CF7B 1F43A 2DJIA 1S9HA 2YUSA 1MW7A 1BIBA 1V54H 5CQGA 3E5UA 3KZZA 1TQIA 2FMLA 2IA0A 1Y8QB 5LLQA 1JT0A 3CF5F 1JT6A 2WV0A 4CYCA 2F6CA 3I3LA 2K3PA 2VJ5A 4BNCA 1JXSA 3E5QA 4JP0A 2X6XA 4U88A 1V3FA 4DW6A 2CWEA 2VASA 4X6AJ 2VKHA 3HOXJ 1QU3A 2DA7A 3DKYA 1R1VA 4HV5A 2I5UA 4HX4A 3P7NA 2EV6A 3FM3A 4XLCA 1M1EB 3F22A 1G3YA 2W00A 2X1DA 1ONVA 4IRGA 4D1QA 2L7ZA 3J7ZI 2W48A 4RAZA 2HOTA 1ZRFA 4OIRF 1Z77A 3GTQJ 4J01A 4G6QA 3CC2I 4XQFA 3Q5FA 1KYZA 2X6WA 5HNHA 1W36D 2M5WA 4BE2A 4XN3A 2BY1A 4LLNA 5FD5A 2W4SA 4M3GA 1YHQI 1FBSA 4CCLA 1A6QA 3E1SA 2ECBA 2FOKA 3DBHB 5BMZA 2LFBA 3K69A 2VQLA 4A93J 3ISPA 2Y48A 4Y4RA 1XSXA 1VQPI 1HXDA 2FMYA 1E2XA 3E0JB 4CXFA 2KIMA 1RNLA 3SDGA 5EZGA 4NC8A 2E1MC 3LA3A 3F21A 2DTRA 4M9ZA 2DA4A 2IEKA 2ADUA 5LHIA 4XRSA 2OTJI 1I1SA 4XSXF 1Z21A 2ZMEC 2IPQX 4ZH4F 1HA8A 1HC8A 3QAHA 2EINH 3OOPA 5CQEA 5JLXA 1ULYA 4MO7A 3TOAA 1DQUA 4AM3A 2GXBA 2ESNA 3Q0UA 3I4PA 3RTRA 3H5AA 3S16J 4A3KJ 2QA4I 2HPMA 2EIKH 4A3FJ 2YX7A 4PZJA 4M6VA 2MABA 1TT0A 4Q5SF 2LY9A 3WGGA 1Z91A 3ZMVA 2AS5F 2YU3A 2R5ZB 1XCBA 4Z6YA 1IDZA 3KP4A 2XB5A 4CZZA 1GLNA 3OS2A 5AIPA 1SANA 5J1RA 4JBAA 1MD0A 1RESA 1ETVA 5A2QK 1S5LC 4E7HA 1WWXA 1AKHB 4ZZLA 1N75A 3TOBA 2DW4A 2IVMA 3WGIA 4XK4A 1SC7A 5E18F 2JT1A 1BA5A 4BXFA 3VYTB 3EQLF 3HIFA 2UWMA 4NQWA 1MKMA 3ZR8X 4WCGA 3V7RA 4CGZA 2DK5A 3OYHA 4Q47A 2GXAA 2IS6A 4NB5A 1FWZA 5L3DA 4A6EA 1R5HA 2LLKA 3R0JA 3W2AA 3OYJA 1PUFA 1ZYRF 2DMUA 1YJ9I 3NEUA 1JE8A 2DDAA 3BCBA 2DPDA 4BDZA 1GUUA 3I58A 1VQ5I 4HA8A 4R79A 2WADA 5EG0A 4P9FA 2FX0A 2EZLA 1OCRH 3C2HA 2HR3A 2V1NA 1VQKI 2L7MP 2Q2EA 2F48A 1UHMA 5F04A 3OYKA 1SD4A 1X3ZB 2IT0A 1QO0D 1D8KA 3FBIB 5K7ZA 2YPRA 3ERED 1K78A 2F4OB 3B73A 2XF7A 3HZJA 5H6RA 3PJRA 4EEFG 2BXZA 1X1CA 4CZCA 3KP3A 1T2KA 2VBXA 2NNNA 4H0EA 4Y17A 2LP0A 4MTEA 1W5CC 1X1AA 1T39A 2TRTA 3S3NA 2EWNA 4AIKA 2WTEA 2NOJB 3OR1C 1JHFA 3KZIC 3ZMUA 2VB6A 2X4HA 1YTYA 2XRNA 4IHYA 4RLQA
chains in the Genus database with same CATH topology
1OPCA 2Z5UA 3J80Z 1VTNC 5D5WB 3D5LA 4IVNA 3ABUA 4KT5C 4RGUA 4JK1X 1H9TA 2FBKA 1RI7A 2VODA 5HS9A 3KP6A 1KQ9A 2QQ9A 3BJAA 5DYMA 1BI2A 1G3SA 1TTYA 4KICA 2CGPA 2ZXJA 4Y15A 2V6CA 4KN4X 4UHTA 1IZ1A 2PN6A 1HKTA 3I54A 4HLYA 1YYVA 2H6CA 4IJAA 3RIRA 2P8TA 3M8FA 2V1UA 2XAJA 1Z9CA 2P5VA 3V7CA 4CICA 2H94A 3F8FA 4FT8A 4OMZA 4L0YB 2O61A 4U7BA 1U2WA 3I64A 5HS7A 1RZ4A 5E1ZB 2KIFA 1ZG1A 3GZ6A 2E7WA 2VC1A 4S05A 4S04A 3LAJA 4AIHA 2OAZA 4U0VA 3JTGA 3RPQA 3FHZA 4F7ZA 4A12A 3RPUA 1ZRCA 2PG4A 1XMKA 3CUQA 3DEUA 4AIJA 4LK1F 2VE9A 3KP5A 2XASA 1OYIA 1XB4A 3M8EA 2JTVA 2DO7A 4Q48A 4HYEA 1EH7A 1SFEA 1RIOH 2KJCA 2AXLA 4HX8A 5LHHA 3G73A 2M30A 1W4MA 1W7PD 5DUIA 2XUBA 1SD7A 4M73A 1Z1DA 2OQRA 1O57A 1IRGA 2DQRA 5LRSA 2HTJA 1F4KA 3KZYA 2HS5A 3SHFA 3HSEA 2B0LA 2FE3A 3F3XA 4UXNA 3IKVA 2EFOA 2RNJA 3RI4A 3V8KA 3FXQA 1DUXC 2J5PA 2EV5A 2A61A 1XGNA 4ZYDA 2W85A 5LHGA 5FGMA 3J81Z 3VB2A 4KA4A 3CUQC 2OZ6A 4PDKA 2P6TA 2F5CA 4R8HA 2VBZA 3GF2A 3MFKA 1IAWA 3E6DA 5CJ9A 2PLYA 2MD5A 1V4RA 4KMUX 1WQ2A 2DI3A 3GXOA 4A5MA 3E5XA 2F5FA 1TNSA 2DQLA 3H3ZA 3AAFA 3ZPLA 5KK1A 4PGHA 4PGGA 2CO5A 2E1CA 2O8XA 4I0AA 4EQQA 1BN5A 3RDIA 2CW0F 2VBWA 1R22A 1D3YA 1Y0UA 3KEOA 3K1PA 1D8JA 4LLLA 2ZFWA 2W57A 1S7OA 2RV8A 2Y75A 4G8XA 4EMSA 5ERIA 2LKPA 3GWZA 4I01A 1GVJA 4BYYA 1J0RA 1YS6A 2UXNA 3QU6A 2A6HF 1O7FA 1O3TA 1HSJA 3CO6C 2O0YA 2IP2A 4G7ZF 5J8FA 1SMTA 1ZLJA 2XHKA 5F1RA 5ILUA 3I59B 4OIOF 3REOA 1J75A 4P9UA 2CG4A 2ZJ2A 3CDHA 3GW2A 2LF7A 2OD5A 4MQVA 2D2WA 4ENJA 2HDCA 4RGSA 2FBHA 3HRSA 4MNUA 2EFWA 2IJLA 3O6BB 2P6SA 3F8CA 1QGPA 3PQKA 3FX3A 1W7PB 4AD9A 1DP7P 1XCVA 4YIIA 1LDKB 3LSTA 5E1WA 3DF8A 1P4WA 2JPCA 5ICCA 3SZTA 2W24A 3RKWA 3ULQB 1U3EM 2QQBA 2HKXA 5ICEA 3DPTA 2JPBA 5A2QZ 1C0WA 2UZKA 4UVAA 3R6SA 2EA4A 2ZKZA 3HHGA 1FYMA 4ESJA 3K9TA 3RKYA 2PFBA 4MEXF 4ZYEA 5BS6A 1MJBA 5LGTA 2IA1A 4BAYA 2V79A 2VC0A 1LEAA 2EV0A 2A69F 2VBYA 1KU9A 2HYGD 3C1DA 3MCZA 4MEYF 2M87A 3WU1B 5D5XB 2VOOA 3L9FA 4KYWA 3IC7A 3WU0A 4LG0B 1BI0A 5FLXK 4EM1A 5CYVA 1WKMA 5ICFA 1AWCA 2F2EA 2QVOA 3D0SA 5HDKA 5ICGA 3KP7A 2A07F 3DFGA 4M72A 4XBFA 1W5SA 3MQ0A 4XLNF 4L9TA 1TNTA 4IRIA 4OIQF 2MBFA 4G94A 4EM2A 1L0OC 3F6VA 4A0ZA 2MLKA 5D6FA 2Z99A 5CVIA 1LB2A 4RB3C 4LGWA 4L9JA 1R36A 1B4AA 1NHAA 3BWGA 4HBLA 3TO7A 4QWQA 3ZP5A 1KQ0A 4WXHA 1KYWA 3WTTC 4BQAA 5LEKA 1IN7A 4A6DA 5HOOA 2ELHA 2QM3A 4G7HF 3IRRA 1UCRA 1I5ZA 2HOEA 3WG9A 3IWFA 4K2EA 5ED4A 4HDUA 3TDUC 5FB2A 5K5RA 5L3FA 2A68F 2P5LC 1USSA 2VE8A 2GAUA 4A0YA 1XGMA 5JI6A 4AWXB 1MDMA 2RDPA 2QWWA 1FBQA 4EM0B 1RUOA 4OIPF 1JGSA 1U5TB 5LEJA 1S29A 1YW9A 3JW4A 1MJAA 1J59A 3DV8A 1IXCA 1ZREA 1FC3A 4LJZF 3T1BA 1BIAA 4I98B 2JSCA 4RGRA 2W25A 3GO5A 2ETHA 2XVCA 1GHCA 1U78A 4KUMA 5CVVA 1TW2A 1SFUA 4RGXA 5EEGA 1J5YA 4JQFA 2GXGA 1D5VA 1IF1A 5HLHA 2RKHA 2DFIA 2A5YB 1HW2A 3WTYC 3KE2A 1JHHA 4M74A 1O3QA 3CJNA 3BPVA 1OR7A 2RN7A 1ON1A 3QRFF 5F6FA 2MA3A 4P96A 3IL2A 4OU0A 1DPUA 1S3JA 2GA2A 2FRHA 1ZGJA 4ASNA 3J7AO 2KKOA 1R58A 2Z33A 2QQAA 2DLLA 3N97A 2QENA 4IF4A 4UUVA 5JR3A 1FLIA 4IPAA 2ZCWA 4EJTA 1WRJA 5LGUA 4CO8A 2HYFA 1GXPA 2YR2A 3GX4X 2XKOA 4KIFA 4YG2F 2M8EA 1YS7A 3F8MA 2MH9A 1YG2A 1XDSA 5D4SA 1E17A 2L01A 4U0WA 5IT9K 4U0YA 1ZGAA 3WTXC 2FNPA 3HRTA 1HKQA 2EB7A 3EYYA 2ZMEB 2Z9OA 1BI1A 5FO5A 5H20A 5HLGA 1CGPA 3EYIA 3TO9A 3PFIA 2KRFA 2D1VA 2K27A 2BV6A 3HOSA 4KFCA 2L02A 1KU3A 3GFJA 2COMA 4EJOA 3K1NA 2L4MA 3LFKA 4EJWA 2GZWA 2LF8A 3SFZA 2RQPA 4HW0A 2FQ3A 3RJPA 1XGOA 4LMYA 2MC3A 4FX0A 1FBUA 4BHPA 3NRVA 5FD6A 1OMIA 2IRFG 5KVRA 3L7WA 2FBIA 1QZYA 3VEPA 2CFXA 2XGXA 2H6BA 5J6XA 3SQNA 2KJBA 4LD5A 1ZN2A 3QU3A 3I53A 3K1MA 3GFLA 1R1TA 2CSOA 1FY7A 4P55A 2KIUA 4G7OF 3K2ZA 5D6EA 3ZQ7A 3E3VA 3IRQA 1K79A 3O2PE 3JAMK 2DBBA 3ECHA 2DT5A 4ON0A 1IUYA 4LK0F 3CTAA 2YSRA 3E6MA 1R00A 1O7LA 2ESHA 2ZNYA 1YW7A 3IKTA 3MEXA 4BHBA 3HRUA 3R61A 2Z3YA 1QBJA 1IW7F 4EVIA 1B6AA 4MQ9F 3KP2A 4ENKA 2XKPA 1YIOA 1IN5A 4QLCU 2E1NA 1G3TA 4HDVA 2V1DA 1FOKA 1LJ9A 3MAJA 4RS8A 2A3SA 1ODDA 3Q9SA 5DCMA 2ISYA 2BYVE 4RB2C 2WC2A 3BROA 5TRDA 3W6JB 4HF1A 4ZYGA 4M9SA 1K78B 4MHGA 3WTWC 4O3MA 5D5UB 5E8IA 4GCVA 1KA8A 2OU2A 2H27A 5TJJA 1FYKA 3C18A 1O3RA 4A2UA 1FX7A 3Q9VA 4GXOA 2K86A 3WE2A 1SD6A 5DD4A 5FLXZ 1P6RA 4HAMA 5E20A 1IN4A 1CF7A 3U2RA 4HOBA 2G7HA 5L3BA 1KGSA 2IW5A 1K6OA 2XAFA 1YW8A 4GGGA 5DV5A 2H09A 1ZHFA 2EK5A 3RYRA 3V4GA 3V8LA 1HSTA 2XAGA 4P5OA 3DPLC 3KCCA 4B8XA 5DCFA 5LBQA 1SAXA 4AVPA 3WE3A 1USTA 1FP1D 3K0LA 2PMUA 5CLSA 1G6NA 2LSOA 2P4WA 1I6XA 1DPRA 4UV8A 5JVTA 3EETA 4RAYA 2EFQA 2A6EF 2NYXA 3HYIA 1W5TA 3V8JA 5EEHA 1TQMA 2STWA 2CYYA 2QBYA 1LDDA 3FXUA 2PQ8A 3CUQB 2DK8A 3KETA 3TDZC 3I0TA 5AONA 2XAQA 2GIVA 1MJ9A 3ZN1A 3ZMDA 1G4DA 1XMAA 3BDDA 4L5JA 2G7UA 1ZLKA 1XDUA 3ECOA 2ZO4A 3IHUA 3FM5A 1LDJA 4L9NA 5J8CA 2VN2A 4I2OA 2K02A 4DNCA 2M1BA 3P9IA 5E17F 3LAPA 5K1YA 1J7KA 1FT9A 4FHTA 5DEQA 2IA2A 3SXYA 3KFWX 4HF0A 1QQIA 3U9GA 4O6JA 3HRMA 3CUOA 1L3LA 3J81K 1WI9A 4WXDA 3GFMA 3T8RA 3HSRA 4M6YA 2STTA 1BJAA 1XN7A 3BP8A 2FNAA 4KMFA 4UVCA 2J5OA 3RKXA 5E8GA 3M9AA 1TW3A 2P5KA 2L54A 4UVBA 3QP5A 4CDGA 3ZMSA 4A0XA 1ZG3A 4GYGA 1G3WA 4ESBA 4NHJA 4CYDA 1LNWA 5L3GA 5HLIA 3QPHA 4G6DA 2K4JA 5DD8A 1ZARA 1P2FA 2XAHA 1ZRDA 5IT9Z 2QLZA 1J9IA 1TQPA 4L18B 3GEZA 2R7DA 4WK8F 4RB0A 4Y13A 3MZYA 2XROA 1HW5A 5BPDA 1P4AA 2BE5F 4U7DA 1FYLA 3QPTA 4HX7A 4MTDA 4YFXF 1XGSA 3CO7C 4ETSA 3WTZA 2DPUA 4LB6B 3E97A 4OINF 3GLXA 3ZN0A 2RC4A 2RVCA 5K5OA 1OKRA 2OBPA 2QZ8A 2PJPA 3KLNA 3ZMTA 3FF5A 2HTSA 1Z6RA 3JSPA 1A04A 2NAZA 1REPC 1S8NA 2FSWA 3VOEA 1FZPB 4KIGA 3ROUA 1TLHB 2QUFA 4E70A 2UXXA 5D4RA 2O6GE 3GZ5A 4WF2A 3P9CA 2QBYB 4XRFA 2PEXA 4IHTA 1S6LA 5L3EA 4A5NA 3U1DA 1Q1HA 5FFXA 1B9NA 3R60A 2EFPA 5IT3A 4LLGF 4KNYA 3EUHA 2JRTA 5DUKA 3JAMZ 3HTUA 3LA2A 2W84A 2XV4S 4IHSA 3T5XA 4CHUA 3LA7A 4N0BA 1R1UA 2PMHA 5BPIA 3B02A 5HDNA 1YLFA 3F6OA 3DQVC 2P7VB 1BM9A 4B09A 3LQRA 4HQMA 2VONA 1XSVA 1H9GA 2BGCA 4BHCA 3GFIA 3BJOA 4BXUA 3CLOA 1WSUA 3JTHA 2NS0A 1UHWA 1FSEA 2BEOA 1T0FA 2ZNZA 2PI0A 2R7FA 4PCQA 1KU2A 5CVRA 3G3ZA 1BOAA 3F23A 5HS8A 2F5EA 1KU7A 5JHUA 1T6SA 3BJ6A 3WGHA 2XIGA 2G9WA 2VXZA 2DU9A 2O03A 2FXAA 2NRAC 1FP2A 3E6BA 3FMRA 4KN7X 4UV9A 1YO5C 4O5VA 2EJRA 1FPQA 1QZZA 3DXJF 3L2CA 5HDGA 4XSZF 4M6XA 4Q4ZF 1OYYA 2GWRA 2QYOA 2MH2A 2FF4A 1YFHA 4R1HA 1ZAOA 1PP7U 3VODA 2HWVA 1BBYA 1U6GA 4N9HA 2Q0OA 1T98A 4Z2YA 3WTVC 3TQNA 1SD5A 2LNBA 2R3SA 5D8KB 4M9XA 2GQQA 5FFZA 3JSOA 3BY6A 5DDGA 3C7JA 1PP8F 1B59A 4G9YA 3P9KA 5D8LB 1BC7C 1B1BA 1K7AA 1J2XA 3I59A 2X0LA 1LQ1A 2C6YA 1SFXA 4YIFA 1MDMB 6PAXA 2YX4A 2HKOA 3QOPA 3LWFA 4ENMA 4FX4A 2OZUA 1W7PA 3PQJA 2RGVA 2HQNA 5HVQC 2ISZA 3GYHX 1ON2A 5L3CA 3H3UA 3SZPA 3T8TA 2NNYA 1BC8C 1B9MA 1ZG5A 1IN6A 4M71A 3O3KA 1EV7A 2CQKA 1STZA 3MWMA 4DQ2A 5F64A 3R4KA 5H6QA 1RUNA 3F8BA 1I27A 4D0PA 3RYPA 2VT3A 1U8RA 5JFRA 1EH8A 3HSFA 4I09A 2OA4A 3DP7A 1X3UA 4KIBA 4EV0A 3BZ6A 1LEBA 3H92A 3TO6A 3V7SA 1T38A 3R0AA 1MZBA 2HQRA 2K7LA 2EA2A 1Z05A 2MLGA 3HHHA 3J80K 1XSDA 3KLOA 4HV6A 1OYWA 4MGRA 2BBYA 1TBXA 3NQOA 3GUDA 4L9VA 4LG0A 3F8NA 2EFNA 2F5DA 2TDXA 4ESFA 4OOIA 1HKSA 5AIQA 3FMSA 4HF2A 4HQEA 1ZH5A 4L0ZB 3OV8A 1HBXG 1GXQA 3W6KB 3ELKA 4BH9A 3FMQA 4L5IA 3QP6A 1XD7A 2O3FA 3HUGA 1F9NA 4HZFA 1F1ZA 3WODF 3T0YA 1R7JA 4OMYA 4N9IA 4EGZA 3HOTA 1O3SA 4ZZDA 1QNTA 4GO1A 3DKWA 1PUEE 4RB1A 1HQCA 2D45A 5E1XA 4EJUA 4YFKF 3IWZA 1HW1A 5LGNA 3HTSB 1FNNA 3BOQA 1UB9A 2HEOA 2HFHA 3BPXA 1IXSB 2Y0MA 4WWCA 2FEZA 1Z6TA 4ZYHA 4EJVA 5K5QA 4EGYA 1LVAA 3TKYA 2HZTA 1IXRC 1YQAA 2OQGA 3N4MA 2ACJA 1R23A 1DDNA 1EH6A 3TGNA 1UFMA 2D1HA 1IRFA 1U5TA 5ILVA 4LB5A 4IRHA 4I0BA 3FZVA 2FA5A 3EDPA 1BI3A 5CVJA 2JZYA 2P7CB 1I1GA 3M1EA 3ZMZA 2L3DA 5ILSA 3MZHA 4LFUA 3FXRA 4ENNA 4I7HA 1KQ8A 2M45A 4IXAA 1H0MA 4HLXA 5CVUA 5BOXA 3FWEA 1MGTA 1P4XA 3LQQA 1P92A 3ABTA 4WXCA 4YFNF 5LRRA 4WX9A 1Z7UA 3KEQA 2HGCA 4XLPF 3WTUC 1S7AA 2DAOA 3L09A 3COAC 2V1XA 1SMYF 1R5GA 1FSHA 2Q8KA 1U5TC 5D5VB 5DCMB 4KDPA 3C3WA 2WWYA 3I5UA 2PBIA 4UNOA 3WTSC 2K4BA 3VFZA 2GA1A 2E7XA 5BQTA 2VT2A 3S2WA 2L4AA 2ZBKA 3L00A 2V9VA 3E6CC 4TV7A 3I71A 1QPMA 1AOYA 1IN8A 2ZMEA 3ML6A 4I02A 3GVAA 3F72A 2FU4A 3M7GA 2VOPA 1PDNC 2LDUA 4GYIA 1F5TA 1CF7B 1BIBA 3E5UA 3KZZA 1TQIA 2FMLA 2IA0A 5LLQA 2WV0A 4BNCA 1JXSA 3E5QA 4U88A 1V3FA 2CWEA 4HV5A 4HX4A 1R1VA 3P7NA 2EV6A 3FM3A 3F22A 1G3YA 1ONVA 4IRGA 4RAZA 1ZRFA 4OIRF 4G6QA 3Q5FA 1KYZA 2M5WA 4LLNA 5FD5A 1FBSA 2FOKA 5BMZA 3K69A 3ISPA 2Y48A 1XSXA 1HXDA 2FMYA 1E2XA 4CXFA 2KIMA 1RNLA 3LA3A 3F21A 2DTRA 4M9ZA 2ADUA 5LHIA 1I1SA 4XSXF 2IPQX 4ZH4F 3QAHA 3OOPA 1ULYA 3TOAA 2GXBA 2ESNA 3I4PA 3RTRA 2YX7A 4PZJA 4Q5SF 3WGGA 1Z91A 3ZMVA 2AS5F 2YU3A 1XCBA 3KP4A 4CZZA 5AIPA 4JBAA 1MD0A 5A2QK 1WWXA 4ZZLA 3TOBA 2DW4A 2IVMA 3WGIA 5E18F 2JT1A 3EQLF 3HIFA 2UWMA 4NQWA 1MKMA 4WCGA 4CGZA 3V7RA 2DK5A 4Q47A 4NB5A 1FWZA 5L3DA 4A6EA 1R5HA 3R0JA 1ZYRF 3NEUA 1JE8A 2DPDA 3I58A 4HA8A 4R79A 4P9FA 2HR3A 2Q2EA 1UHMA 1SD4A 2IT0A 1D8KA 1QO0D 2YPRA 3ERED 1K78A 3B73A 5H6RA 3KP3A 1T2KA 2VBXA 2NNNA 4H0EA 4Y17A 4MTEA 1T39A 2EWNA 4AIKA 2WTEA 1JHFA 3ZMUA 2X4HA 1YTYA 2XRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPC A;  2Z5U A;  3J80 Z;  1VTN C;  5D5W B;  3D5L A;  4IVN A;  3ABU A;  4KT5 C;  4RGU A;  4JK1 X;  1H9T A;  2FBK A;  1RI7 A;  2VOD A;  5HS9 A;  3KP6 A;  1KQ9 A;  2QQ9 A;  3BJA A;  5DYM A;  1BI2 A;  1G3S A;  1TTY A;  4KIC A;  2CGP A;  2ZXJ A;  4Y15 A;  2V6C A;  4KN4 X;  4UHT A;  1IZ1 A;  2PN6 A;  1HKT A;  3I54 A;  4HLY A;  1YYV A;  2H6C A;  4IJA A;  3RIR A;  2P8T A;  3M8F A;  2V1U A;  2XAJ A;  1Z9C A;  2P5V A;  3V7C A;  4CIC A;  2H94 A;  3F8F A;  4FT8 A;  4OMZ A;  4L0Y B;  2O61 A;  4U7B A;  1U2W A;  3I64 A;  5HS7 A;  1RZ4 A;  5E1Z B;  2KIF A;  1ZG1 A;  3GZ6 A;  2E7W A;  2VC1 A;  4S05 A;  4S04 A;  3LAJ A;  4AIH A;  2OAZ A;  4U0V A;  3JTG A;  3RPQ A;  3FHZ A;  4F7Z A;  4A12 A;  3RPU A;  1ZRC A;  2PG4 A;  1XMK A;  3CUQ A;  3DEU A;  4AIJ A;  4LK1 F;  2VE9 A;  3KP5 A;  2XAS A;  1OYI A;  1XB4 A;  3M8E A;  2JTV A;  2DO7 A;  4Q48 A;  4HYE A;  1EH7 A;  1SFE A;  1RIO H;  2KJC A;  2AXL A;  4HX8 A;  5LHH A;  3G73 A;  2M30 A;  1W4M A;  1W7P D;  5DUI A;  2XUB A;  1SD7 A;  4M73 A;  1Z1D A;  2OQR A;  1O57 A;  1IRG A;  2DQR A;  5LRS A;  2HTJ A;  1F4K A;  3KZY A;  2HS5 A;  3SHF A;  3HSE A;  2B0L A;  2FE3 A;  3F3X A;  4UXN A;  3IKV A;  2EFO A;  2RNJ A;  3RI4 A;  3V8K A;  3FXQ A;  1DUX C;  2J5P A;  2EV5 A;  2A61 A;  1XGN A;  4ZYD A;  2W85 A;  5LHG A;  5FGM A;  3J81 Z;  3VB2 A;  4KA4 A;  3CUQ C;  2OZ6 A;  4PDK A;  2P6T A;  2F5C A;  4R8H A;  2VBZ A;  3GF2 A;  3MFK A;  1IAW A;  3E6D A;  5CJ9 A;  2PLY A;  2MD5 A;  1V4R A;  4KMU X;  1WQ2 A;  2DI3 A;  3GXO A;  4A5M A;  3E5X A;  2F5F A;  1TNS A;  2DQL A;  3H3Z A;  3AAF A;  3ZPL A;  5KK1 A;  4PGH A;  4PGG A;  2CO5 A;  2E1C A;  2O8X A;  4I0A A;  4EQQ A;  1BN5 A;  3RDI A;  2CW0 F;  2VBW A;  1R22 A;  1D3Y A;  1Y0U A;  3KEO A;  3K1P A;  1D8J A;  4LLL A;  2ZFW A;  2W57 A;  1S7O A;  2RV8 A;  2Y75 A;  4G8X A;  4EMS A;  5ERI A;  2LKP A;  3GWZ A;  4I01 A;  1GVJ A;  4BYY A;  1J0R A;  1YS6 A;  2UXN A;  3QU6 A;  2A6H F;  1O7F A;  1O3T A;  1HSJ A;  3CO6 C;  2O0Y A;  2IP2 A;  4G7Z F;  5J8F A;  1SMT A;  1ZLJ A;  2XHK A;  5F1R A;  5ILU A;  3I59 B;  4OIO F;  3REO A;  1J75 A;  4P9U A;  2CG4 A;  2ZJ2 A;  3CDH A;  3GW2 A;  2LF7 A;  2OD5 A;  4MQV A;  2D2W A;  4ENJ A;  2HDC A;  4RGS A;  2FBH A;  3HRS A;  4MNU A;  2EFW A;  2IJL A;  3O6B B;  2P6S A;  3F8C A;  1QGP A;  3PQK A;  3FX3 A;  1W7P B;  4AD9 A;  1DP7 P;  1XCV A;  4YII A;  1LDK B;  3LST A;  5E1W A;  3DF8 A;  1P4W A;  2JPC A;  5ICC A;  3SZT A;  2W24 A;  3RKW A;  3ULQ B;  1U3E M;  2QQB A;  2HKX A;  5ICE A;  3DPT A;  2JPB A;  5A2Q Z;  1C0W A;  2UZK A;  4UVA A;  3R6S A;  2EA4 A;  2ZKZ A;  3HHG A;  1FYM A;  4ESJ A;  3K9T A;  3RKY A;  2PFB A;  4MEX F;  4ZYE A;  5BS6 A;  1MJB A;  5LGT A;  2IA1 A;  4BAY A;  2V79 A;  2VC0 A;  1LEA A;  2EV0 A;  2A69 F;  2VBY A;  1KU9 A;  2HYG D;  3C1D A;  3MCZ A;  4MEY F;  2M87 A;  3WU1 B;  5D5X B;  2VOO A;  3L9F A;  4KYW A;  3IC7 A;  3WU0 A;  4LG0 B;  1BI0 A;  5FLX K;  4EM1 A;  5CYV A;  1WKM A;  5ICF A;  1AWC A;  2F2E A;  2QVO A;  3D0S A;  5HDK A;  5ICG A;  3KP7 A;  2A07 F;  3DFG A;  4M72 A;  4XBF A;  1W5S A;  3MQ0 A;  4XLN F;  4L9T A;  1TNT A;  4IRI A;  4OIQ F;  2MBF A;  4G94 A;  4EM2 A;  1L0O C;  3F6V A;  4A0Z A;  2MLK A;  5D6F A;  2Z99 A;  5CVI A;  1LB2 A;  4RB3 C;  4LGW A;  4L9J A;  1R36 A;  1B4A A;  1NHA A;  3BWG A;  4HBL A;  3TO7 A;  4QWQ A;  3ZP5 A;  1KQ0 A;  4WXH A;  1KYW A;  3WTT C;  4BQA A;  5LEK A;  1IN7 A;  4A6D A;  5HOO A;  2ELH A;  2QM3 A;  4G7H F;  3IRR A;  1UCR A;  1I5Z A;  2HOE A;  3WG9 A;  3IWF A;  4K2E A;  5ED4 A;  4HDU A;  3TDU C;  5FB2 A;  5K5R A;  5L3F A;  2A68 F;  2P5L C;  1USS A;  2VE8 A;  2GAU A;  4A0Y A;  1XGM A;  5JI6 A;  4AWX B;  1MDM A;  2RDP A;  2QWW A;  1FBQ A;  4EM0 B;  1RUO A;  4OIP F;  1JGS A;  1U5T B;  5LEJ A;  1S29 A;  1YW9 A;  3JW4 A;  1MJA A;  1J59 A;  3DV8 A;  1IXC A;  1ZRE A;  1FC3 A;  4LJZ F;  3T1B A;  1BIA A;  4I98 B;  2JSC A;  4RGR A;  2W25 A;  3GO5 A;  2ETH A;  2XVC A;  1GHC A;  1U78 A;  4KUM A;  5CVV A;  1TW2 A;  1SFU A;  4RGX A;  5EEG A;  1J5Y A;  4JQF A;  2GXG A;  1D5V A;  1IF1 A;  5HLH A;  2RKH A;  2DFI A;  2A5Y B;  1HW2 A;  3WTY C;  3KE2 A;  1JHH A;  4M74 A;  1O3Q A;  3CJN A;  3BPV A;  1OR7 A;  2RN7 A;  1ON1 A;  3QRF F;  5F6F A;  2MA3 A;  4P96 A;  3IL2 A;  4OU0 A;  1DPU A;  1S3J A;  2GA2 A;  2FRH A;  1ZGJ A;  4ASN A;  3J7A O;  2KKO A;  1R58 A;  2Z33 A;  2QQA A;  2DLL A;  3N97 A;  2QEN A;  4IF4 A;  4UUV A;  5JR3 A;  1FLI A;  4IPA A;  2ZCW A;  4EJT A;  1WRJ A;  5LGU A;  4CO8 A;  2HYF A;  1GXP A;  2YR2 A;  3GX4 X;  2XKO A;  4KIF A;  4YG2 F;  2M8E A;  1YS7 A;  3F8M A;  2MH9 A;  1YG2 A;  1XDS A;  5D4S A;  1E17 A;  2L01 A;  4U0W A;  5IT9 K;  4U0Y A;  1ZGA A;  3WTX C;  2FNP A;  3HRT A;  1HKQ A;  2EB7 A;  3EYY A;  2ZME B;  2Z9O A;  1BI1 A;  5FO5 A;  5H20 A;  5HLG A;  1CGP A;  3EYI A;  3TO9 A;  3PFI A;  2KRF A;  2D1V A;  2K27 A;  2BV6 A;  3HOS A;  4KFC A;  2L02 A;  1KU3 A;  3GFJ A;  2COM A;  4EJO A;  3K1N A;  2L4M A;  3LFK A;  4EJW A;  2GZW A;  2LF8 A;  3SFZ A;  2RQP A;  4HW0 A;  2FQ3 A;  3RJP A;  1XGO A;  4LMY A;  2MC3 A;  4FX0 A;  1FBU A;  4BHP A;  3NRV A;  5FD6 A;  1OMI A;  2IRF G;  5KVR A;  3L7W A;  2FBI A;  1QZY A;  3VEP A;  2CFX A;  2XGX A;  2H6B A;  5J6X A;  3SQN A;  2KJB A;  4LD5 A;  1ZN2 A;  3QU3 A;  3I53 A;  3K1M A;  3GFL A;  1R1T A;  2CSO A;  1FY7 A;  4P55 A;  2KIU A;  4G7O F;  3K2Z A;  5D6E A;  3ZQ7 A;  3E3V A;  3IRQ A;  1K79 A;  3O2P E;  3JAM K;  2DBB A;  3ECH A;  2DT5 A;  4ON0 A;  1IUY A;  4LK0 F;  3CTA A;  2YSR A;  3E6M A;  1R00 A;  1O7L A;  2ESH A;  2ZNY A;  1YW7 A;  3IKT A;  3MEX A;  4BHB A;  3HRU A;  3R61 A;  2Z3Y A;  1QBJ A;  1IW7 F;  4EVI A;  1B6A A;  4MQ9 F;  3KP2 A;  4ENK A;  2XKP A;  1YIO A;  1IN5 A;  4QLC U;  2E1N A;  1G3T A;  4HDV A;  2V1D A;  1FOK A;  1LJ9 A;  3MAJ A;  4RS8 A;  2A3S A;  1ODD A;  3Q9S A;  5DCM A;  2ISY A;  2BYV E;  4RB2 C;  2WC2 A;  3BRO A;  5TRD A;  3W6J B;  4HF1 A;  4ZYG A;  4M9S A;  1K78 B;  4MHG A;  3WTW C;  4O3M A;  5D5U B;  5E8I A;  4GCV A;  1KA8 A;  2OU2 A;  2H27 A;  5TJJ A;  1FYK A;  3C18 A;  1O3R A;  4A2U A;  1FX7 A;  3Q9V A;  4GXO A;  2K86 A;  3WE2 A;  1SD6 A;  5DD4 A;  5FLX Z;  1P6R A;  4HAM A;  5E20 A;  1IN4 A;  1CF7 A;  3U2R A;  4HOB A;  2G7H A;  5L3B A;  1KGS A;  2IW5 A;  1K6O A;  2XAF A;  1YW8 A;  4GGG A;  5DV5 A;  2H09 A;  1ZHF A;  2EK5 A;  3RYR A;  3V4G A;  3V8L A;  1HST A;  2XAG A;  4P5O A;  3DPL C;  3KCC A;  4B8X A;  5DCF A;  5LBQ A;  1SAX A;  4AVP A;  3WE3 A;  1UST A;  1FP1 D;  3K0L A;  2PMU A;  5CLS A;  1G6N A;  2LSO A;  2P4W A;  1I6X A;  1DPR A;  4UV8 A;  5JVT A;  3EET A;  4RAY A;  2EFQ A;  2A6E F;  2NYX A;  3HYI A;  1W5T A;  3V8J A;  5EEH A;  1TQM A;  2STW A;  2CYY A;  2QBY A;  1LDD A;  3FXU A;  2PQ8 A;  3CUQ B;  2DK8 A;  3KET A;  3TDZ C;  3I0T A;  5AON A;  2XAQ A;  2GIV A;  1MJ9 A;  3ZN1 A;  3ZMD A;  1G4D A;  1XMA A;  3BDD A;  4L5J A;  2G7U A;  1ZLK A;  1XDU A;  3ECO A;  2ZO4 A;  3IHU A;  3FM5 A;  1LDJ A;  4L9N A;  5J8C A;  2VN2 A;  4I2O A;  2K02 A;  4DNC A;  2M1B A;  3P9I A;  5E17 F;  3LAP A;  5K1Y A;  1J7K A;  1FT9 A;  4FHT A;  5DEQ A;  2IA2 A;  3SXY A;  3KFW X;  4HF0 A;  1QQI A;  3U9G A;  4O6J A;  3HRM A;  3CUO A;  1L3L A;  3J81 K;  1WI9 A;  4WXD A;  3GFM A;  3T8R A;  3HSR A;  4M6Y A;  2STT A;  1BJA A;  1XN7 A;  3BP8 A;  2FNA A;  4KMF A;  4UVC A;  2J5O A;  3RKX A;  5E8G A;  3M9A A;  1TW3 A;  2P5K A;  2L54 A;  4UVB A;  3QP5 A;  4CDG A;  3ZMS A;  4A0X A;  1ZG3 A;  4GYG A;  1G3W A;  4ESB A;  4NHJ A;  4CYD A;  1LNW A;  5L3G A;  5HLI A;  3QPH A;  4G6D A;  2K4J A;  5DD8 A;  1ZAR A;  1P2F A;  2XAH A;  1ZRD A;  5IT9 Z;  2QLZ A;  1J9I A;  1TQP A;  4L18 B;  3GEZ A;  2R7D A;  4WK8 F;  4RB0 A;  4Y13 A;  3MZY A;  2XRO A;  1HW5 A;  5BPD A;  1P4A A;  2BE5 F;  4U7D A;  1FYL A;  3QPT A;  4HX7 A;  4MTD A;  4YFX F;  1XGS A;  3CO7 C;  4ETS A;  3WTZ A;  2DPU A;  4LB6 B;  3E97 A;  4OIN F;  3GLX A;  3ZN0 A;  2RC4 A;  2RVC A;  5K5O A;  1OKR A;  2OBP A;  2QZ8 A;  2PJP A;  3KLN A;  3ZMT A;  3FF5 A;  2HTS A;  1Z6R A;  3JSP A;  1A04 A;  2NAZ A;  1REP C;  1S8N A;  2FSW A;  3VOE A;  1FZP B;  4KIG A;  3ROU A;  1TLH B;  2QUF A;  4E70 A;  2UXX A;  5D4R A;  2O6G E;  3GZ5 A;  4WF2 A;  3P9C A;  2QBY B;  4XRF A;  2PEX A;  4IHT A;  1S6L A;  5L3E A;  4A5N A;  3U1D A;  1Q1H A;  5FFX A;  1B9N A;  3R60 A;  2EFP A;  5IT3 A;  4LLG F;  4KNY A;  3EUH A;  2JRT A;  5DUK A;  3JAM Z;  3HTU A;  3LA2 A;  2W84 A;  2XV4 S;  4IHS A;  3T5X A;  4CHU A;  3LA7 A;  4N0B A;  1R1U A;  2PMH A;  5BPI A;  3B02 A;  5HDN A;  1YLF A;  3F6O A;  3DQV C;  2P7V B;  1BM9 A;  4B09 A;  3LQR A;  4HQM A;  2VON A;  1XSV A;  1H9G A;  2BGC A;  4BHC A;  3GFI A;  3BJO A;  4BXU A;  3CLO A;  1WSU A;  3JTH A;  2NS0 A;  1UHW A;  1FSE A;  2BEO A;  1T0F A;  2ZNZ A;  2PI0 A;  2R7F A;  4PCQ A;  1KU2 A;  5CVR A;  3G3Z A;  1BOA A;  3F23 A;  5HS8 A;  2F5E A;  1KU7 A;  5JHU A;  1T6S A;  3BJ6 A;  3WGH A;  2XIG A;  2G9W A;  2VXZ A;  2DU9 A;  2O03 A;  2FXA A;  2NRA C;  1FP2 A;  3E6B A;  3FMR A;  4KN7 X;  4UV9 A;  1YO5 C;  4O5V A;  2EJR A;  1FPQ A;  1QZZ A;  3DXJ F;  3L2C A;  5HDG A;  4XSZ F;  4M6X A;  4Q4Z F;  1OYY A;  2GWR A;  2QYO A;  2MH2 A;  2FF4 A;  1YFH A;  4R1H A;  1ZAO A;  1PP7 U;  3VOD A;  2HWV A;  1BBY A;  1U6G A;  4N9H A;  2Q0O A;  1T98 A;  4Z2Y A;  3WTV C;  3TQN A;  1SD5 A;  2LNB A;  2R3S A;  5D8K B;  4M9X A;  2GQQ A;  5FFZ A;  3JSO A;  3BY6 A;  5DDG A;  3C7J A;  1PP8 F;  1B59 A;  4G9Y A;  3P9K A;  5D8L B;  1BC7 C;  1B1B A;  1K7A A;  1J2X A;  3I59 A;  2X0L A;  1LQ1 A;  2C6Y A;  1SFX A;  4YIF A;  1MDM B;  6PAX A;  2YX4 A;  2HKO A;  3QOP A;  3LWF A;  4ENM A;  4FX4 A;  2OZU A;  1W7P A;  3PQJ A;  2RGV A;  2HQN A;  5HVQ C;  2ISZ A;  3GYH X;  1ON2 A;  5L3C A;  3H3U A;  3SZP A;  3T8T A;  2NNY A;  1BC8 C;  1B9M A;  1ZG5 A;  1IN6 A;  4M71 A;  3O3K A;  1EV7 A;  2CQK A;  1STZ A;  3MWM A;  4DQ2 A;  5F64 A;  3R4K A;  5H6Q A;  1RUN A;  3F8B A;  1I27 A;  4D0P A;  3RYP A;  2VT3 A;  1U8R A;  5JFR A;  1EH8 A;  3HSF A;  4I09 A;  2OA4 A;  3DP7 A;  1X3U A;  4KIB A;  4EV0 A;  3BZ6 A;  1LEB A;  3H92 A;  3TO6 A;  3V7S A;  1T38 A;  3R0A A;  1MZB A;  2HQR A;  2K7L A;  2EA2 A;  1Z05 A;  2MLG A;  3HHH A;  3J80 K;  1XSD A;  3KLO A;  4HV6 A;  1OYW A;  4MGR A;  2BBY A;  1TBX A;  3NQO A;  3GUD A;  4L9V A;  4LG0 A;  3F8N A;  2EFN A;  2F5D A;  2TDX A;  4ESF A;  4OOI A;  1HKS A;  5AIQ A;  3FMS A;  4HF2 A;  4HQE A;  1ZH5 A;  4L0Z B;  3OV8 A;  1HBX G;  1GXQ A;  3W6K B;  3ELK A;  4BH9 A;  3FMQ A;  4L5I A;  3QP6 A;  1XD7 A;  2O3F A;  3HUG A;  1F9N A;  4HZF A;  1F1Z A;  3WOD F;  3T0Y A;  1R7J A;  4OMY A;  4N9I A;  4EGZ A;  3HOT A;  1O3S A;  4ZZD A;  1QNT A;  4GO1 A;  3DKW A;  1PUE E;  4RB1 A;  1HQC A;  2D45 A;  5E1X A;  4EJU A;  4YFK F;  3IWZ A;  1HW1 A;  5LGN A;  3HTS B;  1FNN A;  3BOQ A;  1UB9 A;  2HEO A;  2HFH A;  3BPX A;  1IXS B;  2Y0M A;  4WWC A;  2FEZ A;  1Z6T A;  4ZYH A;  4EJV A;  5K5Q A;  4EGY A;  1LVA A;  3TKY A;  2HZT A;  1IXR C;  1YQA A;  2OQG A;  3N4M A;  2ACJ A;  1R23 A;  1DDN A;  1EH6 A;  3TGN A;  1UFM A;  2D1H A;  1IRF A;  1U5T A;  5ILV A;  4LB5 A;  4IRH A;  4I0B A;  3FZV A;  2FA5 A;  3EDP A;  1BI3 A;  5CVJ A;  2JZY A;  2P7C B;  1I1G A;  3M1E A;  3ZMZ A;  2L3D A;  5ILS A;  3MZH A;  4LFU A;  3FXR A;  4ENN A;  4I7H A;  1KQ8 A;  2M45 A;  4IXA A;  1H0M A;  4HLX A;  5CVU A;  5BOX A;  3FWE A;  1MGT A;  1P4X A;  3LQQ A;  1P92 A;  3ABT A;  4WXC A;  4YFN F;  5LRR A;  4WX9 A;  1Z7U A;  3KEQ A;  2HGC A;  4XLP F;  3WTU C;  1S7A A;  2DAO A;  3L09 A;  3COA C;  2V1X A;  1SMY F;  1R5G A;  1FSH A;  2Q8K A;  1U5T C;  5D5V B;  5DCM B;  4KDP A;  3C3W A;  2WWY A;  3I5U A;  2PBI A;  4UNO A;  3WTS C;  2K4B A;  3VFZ A;  2GA1 A;  2E7X A;  5BQT A;  2VT2 A;  3S2W A;  2L4A A;  2ZBK A;  3L00 A;  2V9V A;  3E6C C;  4TV7 A;  3I71 A;  1QPM A;  1AOY A;  1IN8 A;  2ZME A;  3ML6 A;  4I02 A;  3GVA A;  3F72 A;  2FU4 A;  3M7G A;  2VOP A;  1PDN C;  2LDU A;  4GYI A;  1F5T A;  1CF7 B;  1BIB A;  3E5U A;  3KZZ A;  1TQI A;  2FML A;  2IA0 A;  5LLQ A;  2WV0 A;  4BNC A;  1JXS A;  3E5Q A;  4U88 A;  1V3F A;  2CWE A;  4HV5 A;  4HX4 A;  1R1V A;  3P7N A;  2EV6 A;  3FM3 A;  3F22 A;  1G3Y A;  1ONV A;  4IRG A;  4RAZ A;  1ZRF A;  4OIR F;  4G6Q A;  3Q5F A;  1KYZ A;  2M5W A;  4LLN A;  5FD5 A;  1FBS A;  2FOK A;  5BMZ A;  3K69 A;  3ISP A;  2Y48 A;  1XSX A;  1HXD A;  2FMY A;  1E2X A;  4CXF A;  2KIM A;  1RNL A;  3LA3 A;  3F21 A;  2DTR A;  4M9Z A;  2ADU A;  5LHI A;  1I1S A;  4XSX F;  2IPQ X;  4ZH4 F;  3QAH A;  3OOP A;  1ULY A;  3TOA A;  2GXB A;  2ESN A;  3I4P A;  3RTR A;  2YX7 A;  4PZJ A;  4Q5S F;  3WGG A;  1Z91 A;  3ZMV A;  2AS5 F;  2YU3 A;  1XCB A;  3KP4 A;  4CZZ A;  5AIP A;  4JBA A;  1MD0 A;  5A2Q K;  1WWX A;  4ZZL A;  3TOB A;  2DW4 A;  2IVM A;  3WGI A;  5E18 F;  2JT1 A;  3EQL F;  3HIF A;  2UWM A;  4NQW A;  1MKM A;  4WCG A;  4CGZ A;  3V7R A;  2DK5 A;  4Q47 A;  4NB5 A;  1FWZ A;  5L3D A;  4A6E A;  1R5H A;  3R0J A;  1ZYR F;  3NEU A;  1JE8 A;  2DPD A;  3I58 A;  4HA8 A;  4R79 A;  4P9F A;  2HR3 A;  2Q2E A;  1UHM A;  1SD4 A;  2IT0 A;  1D8K A;  1QO0 D;  2YPR A;  3ERE D;  1K78 A;  3B73 A;  5H6R A;  3KP3 A;  1T2K A;  2VBX A;  2NNN A;  4H0E A;  4Y17 A;  4MTE A;  1T39 A;  2EWN A;  4AIK A;  2WTE A;  1JHF A;  3ZMU A;  2X4H A;  1YTY A;  2XRN A; 
#chains in the Genus database with same CATH topology
 1OPC A;  2V26 A;  2Z5U A;  3J80 Z;  2R5Y A;  1VTN C;  2XGC A;  2IS2 A;  5D5W B;  1X4P A;  3D5L A;  4IVN A;  2IBD A;  3JR9 A;  2AO9 A;  3ABU A;  2HPI A;  4KT5 C;  4U87 A;  1E3P A;  4B47 A;  1APL C;  2JMW A;  3I4N J;  1MMA A;  4RGU A;  4H4K C;  2Y9Y A;  3NAU A;  4JK1 X;  1G8X A;  1H9T A;  5JHF A;  4IOC F;  2FBK A;  1RI7 A;  1R49 A;  3ERM A;  1WCM J;  2VOD A;  5HS9 A;  3KP6 A;  3CD6 I;  1V5G A;  1KQ9 A;  3BQZ A;  2LOO A;  2QQ9 A;  2F4M B;  1N77 A;  3BJA A;  5DYM A;  3S3M A;  1BI2 A;  1G3S A;  2VKD A;  5TIS C;  1TTY A;  4KIC A;  4PJJ A;  2VXD A;  3WG7 H;  2CGP A;  2ZXJ A;  4Y15 A;  2YU9 J;  2V6C A;  3TMO A;  4KN4 X;  4UHT A;  3MN2 A;  1JKR C;  5H2F C;  1NG6 A;  1IZ1 A;  5F0F A;  2PN6 A;  5EF6 A;  1HKT A;  3I54 A;  3PFY A;  3VSK A;  1BL0 A;  5C3E J;  1YYV A;  4HLY A;  2H6C A;  2M4G A;  3DTK A;  4IJA A;  3RIR A;  2P8T A;  3M8F A;  2V1U A;  2XAJ A;  1Z9C A;  1G59 A;  2P5V A;  2NS7 A;  3V7C A;  2K3F A;  1Y56 A;  3G71 I;  4CIC A;  2H94 A;  1JKQ C;  3F8F A;  4FT8 A;  2EZH A;  2IGN A;  2MGQ A;  4OMZ A;  4L0Y B;  2O61 A;  2BY2 A;  2DA2 A;  5IOY A;  4U7B A;  4E7K A;  1U2W A;  2VQH A;  5K7F A;  5GPC A;  3I64 A;  5HS7 A;  3BLY A;  3P5J A;  1RZ4 A;  5E1Z B;  3MMY B;  2KIF A;  1ZG1 A;  3GZ6 A;  3U1K A;  2E7W A;  2LC2 A;  2VC1 A;  5KHD A;  5GPA A;  4CCM A;  4S05 A;  3JRE A;  4S04 A;  3LAJ A;  3I56 I;  4AIH A;  2OAZ A;  4U0V A;  1IRZ A;  2EPF A;  3JTG A;  5FKN A;  3RPQ A;  2M8G X;  1IRX A;  3FHZ A;  4F7Z A;  4A12 A;  4M3B A;  2XB0 X;  3N05 A;  3RPU A;  3CCS I;  4A3C J;  1ZRC A;  2PG4 A;  1XMK A;  4FE7 A;  1FEX A;  3CUQ A;  1D0X A;  4MFD A;  3Q0W A;  3DEU A;  2M9H A;  2XGD A;  3H5N A;  4C30 A;  4AIJ A;  3LSP A;  2KIQ A;  4LK1 F;  2VE9 A;  1B8I A;  3WHB A;  3KP5 A;  1FTZ A;  2XAS A;  1OYI A;  4S0H B;  1VQ8 I;  5EDN A;  1XB4 A;  1ORK A;  3M8E A;  2JTV A;  1Z0X A;  2DO7 A;  1PVE A;  4Q48 A;  4HYE A;  4JX5 A;  4PFP A;  1EH7 A;  1NG7 A;  1SFE A;  4M3E A;  2KJC A;  3BG6 A;  1RIO H;  2AXL A;  4HX8 A;  5LHH A;  5HNF A;  3LMM A;  4C3J J;  3G73 A;  2M30 A;  1W4M A;  1W7P D;  5DUI A;  2XUB A;  2ME6 A;  1SD7 A;  3K4L A;  4M73 A;  3K10 A;  4CCK A;  1Z1D A;  3UR3 C;  1EF4 A;  2OQR A;  1O57 A;  1IRG A;  1JUP A;  2DQR A;  5DM6 F;  1FIA A;  4X1E A;  5LRS A;  2E5N A;  2KIS A;  2HTJ A;  1F4K A;  3KZY A;  3HEF A;  3PO3 J;  2HS5 A;  1MIJ A;  3HSE A;  2B0L A;  2FE3 A;  3SHF A;  2QSG X;  2DOA A;  3F3X A;  4UXN A;  3X2Q H;  3IKV A;  4ZDL A;  2DOE A;  4BBR J;  2EFO A;  2H8W A;  4RMN A;  4NQW B;  2RNJ A;  3RI4 A;  3V8K A;  3FXQ A;  2LKX A;  2X51 A;  2WA0 A;  1QVT A;  3HKZ N;  1DUX C;  3BR3 A;  2J5P A;  2IAI A;  2EV5 A;  1PUF B;  1FOW A;  4XOP A;  2OF7 A;  1NTC A;  2KT0 A;  4PJL A;  2A61 A;  1XGN A;  2GLO A;  3BG7 A;  1JTX A;  4ZYD A;  2W85 A;  5LHG A;  5FGM A;  1IGN A;  1GT0 C;  3J81 Z;  4IX7 A;  3GTO J;  3VB2 A;  4KA4 A;  3CUQ C;  1LFU P;  4JYK A;  1MBJ A;  2CU7 A;  1QRY A;  3VDX A;  1ZR2 A;  3QWL A;  3BR1 A;  3H3V K;  2OZ6 A;  2LRD A;  4PDK A;  2P6T A;  2F5C A;  4R8H A;  2VBZ A;  1ZQ3 P;  3GF2 A;  4IHV A;  3MFK A;  1YX3 A;  1IAW A;  3HBL A;  5F0H A;  3E6D A;  5F1J A;  5CJ9 A;  4XL9 A;  3OYL A;  1U0J A;  4BJT A;  2PLY A;  2M3A A;  5M5W J;  1PYV A;  2WAE A;  2MD5 A;  4V2F A;  1V4R A;  4KMU X;  1WQ2 A;  4HEA 2;  2DI3 A;  3GXO A;  4A5M A;  3E5X A;  5C4J J;  1WJF A;  2WY7 Q;  2F5F A;  3PUF A;  2XF5 A;  1TNS A;  2DQL A;  3H3Z A;  1IG7 A;  2DA3 A;  4CCO A;  4XLH A;  3AAF A;  3ZPL A;  3BTJ A;  3DLL F;  1RKW A;  1OCT C;  5KK1 A;  2BXY A;  2M2E A;  4V19 K;  4PGH A;  2PJR A;  1LUJ B;  4PGG A;  2CO5 A;  2K9M A;  2E1C A;  4FQG A;  2O8X A;  4I0A A;  1VQN I;  2CMP A;  2K5C A;  4EQQ A;  1BN5 A;  3RDI A;  2CW0 F;  2VBW A;  3S1R J;  1R22 A;  3QOE A;  5E79 C;  1TL8 A;  1D3Y A;  1Y0U A;  1B72 B;  2LYC A;  5GAH J;  3S1M J;  4B4C A;  3KEO A;  3K1P A;  3L2W A;  1D8J A;  4LLL A;  2VPL A;  2B9S A;  2ZFW A;  4QSH A;  2W57 A;  1S7O A;  2RV8 A;  3TED A;  2Y75 A;  1D1A A;  4G8X A;  4EMS A;  2OV7 A;  5ERI A;  3K4K A;  2E2H J;  2WAQ N;  2LKP A;  3GWZ A;  4I01 A;  1GVJ A;  1ENH A;  3S14 J;  4BYY A;  1J0R A;  1YS6 A;  2UXN A;  3QU6 A;  2A6H F;  5IOZ A;  2XPW A;  1A5J A;  1O7F A;  1V5F A;  1O3T A;  2ZJR F;  2M4K A;  2NXN B;  1HSJ A;  3ZQL A;  3H36 A;  1H89 C;  1MH3 A;  3CO6 C;  2L9V A;  2O0Y A;  2IP2 A;  4G7Z F;  5J8F A;  4UB6 C;  1SMT A;  4F55 A;  2ZXW H;  1ZLJ A;  2XHK A;  4C3H J;  3FKI J;  1A31 A;  2JA2 A;  5F1R A;  3RQI A;  5ILU A;  3QYF A;  2K9N A;  3S93 A;  3I59 B;  4OIO F;  5EYR A;  2ZJP F;  2DT7 B;  3S15 J;  2ME0 A;  3REO A;  4P9U A;  4E7J A;  1J75 A;  2F4I A;  2CV2 A;  2CG4 A;  2ZJ2 A;  2LY1 A;  3CDH A;  1Z3Y A;  3GW2 A;  2LF7 A;  2OD5 A;  4MQV A;  3A01 A;  2D2W A;  4C2T A;  1RR8 C;  4A3G J;  4ENJ A;  3K70 D;  2HDC A;  4RGS A;  2FBH A;  3HRS A;  4MNU A;  2HVS A;  2EFW A;  2IJL A;  3O6B B;  3G2B A;  4RM3 A;  2P6S A;  3F8C A;  1QGP A;  1NK2 P;  3VWB A;  3PQK A;  3FX3 A;  1W7P B;  5J1U A;  4AD9 A;  4PJM A;  1DP7 P;  2PMZ N;  2VPR A;  1XCV A;  4YII A;  4C9Y A;  1LKX A;  3OIQ A;  1LDK B;  3LST A;  4I6Z A;  3DTE A;  5E1W A;  3DF8 A;  1P4W A;  5KNL A;  2BW3 A;  1T8I A;  2E5Z A;  2JPC A;  4XID A;  5ICC A;  1N78 A;  1U8B A;  4NDL A;  3BG3 A;  2XAU A;  1X2M A;  2W24 A;  3SZT A;  1GV5 A;  1Z67 A;  3CCU I;  3JRB A;  1IUF A;  3RKW A;  3ULQ B;  1YI2 I;  2NS8 A;  1U3E M;  2HQ5 A;  1TWF J;  2QQB A;  2HKX A;  1DU0 A;  5ICE A;  1XPX A;  2QQ8 A;  3DPT A;  1Z3X A;  2JPB A;  5A2Q Z;  3BG5 A;  2PX9 A;  3BCA A;  2JUG A;  1U9O A;  1VF9 A;  2L5Q A;  2MYS A;  4CCJ A;  2LD5 A;  5EEA A;  1C0W A;  3EUK L;  1W0U A;  2UZK A;  4UVA A;  2MSY A;  2NOG A;  3R6S A;  4BUP A;  4C2M J;  4F52 A;  2ZKZ A;  2EA4 A;  1HDP A;  2EH3 A;  3HHG A;  2M34 A;  1RKT A;  3MD2 A;  5M3M J;  2IXS A;  1FYM A;  4ESJ A;  3K9T A;  3BR6 A;  3RKY A;  3TBI A;  3G4S I;  2PFB A;  3NWS A;  2K85 A;  4MEX F;  1FTT A;  4ZYE A;  4CH7 A;  2XC7 A;  5BS6 A;  1MJB A;  3BZC A;  3OL3 A;  3DBR B;  2LG4 A;  5LGT A;  2IA1 A;  4BAY A;  2V79 A;  3CMA I;  2VC0 A;  2QSH X;  1LEA A;  5M5X J;  3IV5 A;  2OC6 A;  1K4S A;  4F91 B;  4DBR A;  3DWL E;  2EV0 A;  2L7F P;  5B5E C;  2BVM A;  1RC9 A;  2A69 F;  2VBY A;  1ETO A;  1KU9 A;  2HYG D;  3C1D A;  3FBN B;  3MCZ A;  4C2U A;  4MEY F;  2M87 A;  1AHD P;  4RA2 A;  3WU1 B;  2M7B A;  5D5X B;  1HDD C;  2VOO A;  3I4M J;  3L9F A;  1MBG A;  3BTI A;  4KYW A;  1ZKG A;  3HGY A;  2HVR A;  3IC7 A;  3WU0 A;  4LG0 B;  1BI0 A;  5FLX K;  2R7X A;  4EM1 A;  1Y1W J;  2DJN A;  1ITY A;  1UG0 A;  3OYB A;  5CYV A;  1DP3 A;  1W1W E;  2ID3 A;  1WKM A;  5ICF A;  2KZV A;  1AWC A;  1YIT I;  2F2E A;  2QVO A;  3D0S A;  5HDK A;  4LIU A;  5ICG A;  3KP7 A;  1MBF A;  2A07 F;  3DFG A;  3F0C A;  4M72 A;  4QPO A;  4XBF A;  1W5S A;  3H0D A;  3MQ0 A;  4XLN F;  2BHY A;  4L9T A;  3AKZ A;  2VJJ A;  1K83 J;  1TNT A;  2ZXI A;  5KCM A;  3CCL I;  3IP4 B;  2W7N A;  1IC8 A;  4IRI A;  4OIQ F;  1RPW A;  2MBF A;  3LSH A;  4G94 A;  2RRE A;  4EM2 A;  1L0O C;  3F6V A;  4A0Z A;  4DYR A;  2MLK A;  4IHX A;  5D6F A;  2Z99 A;  5CVI A;  3OY9 A;  1VI0 A;  1LB2 A;  3CC4 I;  3LSK A;  2LR8 A;  4UUS B;  1YOV B;  3W2W A;  4IEJ A;  2E60 A;  4RB3 C;  4LGW A;  4L9J A;  5J4Y A;  1R36 A;  2HYJ A;  1B4A A;  1NHA A;  1A36 A;  3BWG A;  4HBL A;  3TO7 A;  4BJ5 C;  4QWQ A;  3ZP5 A;  1KQ0 A;  4WXH A;  1KYW A;  3WTT C;  4BQA A;  4XOT A;  1T33 A;  5DM7 F;  4J00 A;  1VQ7 I;  4UB8 C;  5LEK A;  1IN7 A;  4A6D A;  5HOO A;  2ELH A;  2ZFU A;  2QM3 A;  1QZE A;  3SFI A;  4G7H F;  1WJA A;  2K40 A;  4BY7 J;  2F5V A;  5C44 J;  4N4O B;  1UCR A;  3IRR A;  4FCY A;  1I5Z A;  2HOE A;  2P0W A;  3WG9 A;  1JKO C;  3IWF A;  4K2E A;  3Q3S A;  5ED4 A;  3GTM J;  4HDU A;  3TDU C;  5FB2 A;  5K5R A;  2HNH A;  1MND A;  5L3F A;  2A5W A;  2A68 F;  2P5L C;  1ERD A;  1USS A;  3ZRG A;  3G1M A;  2VE8 A;  4ZTJ A;  2GAU A;  4A0Y A;  4HST A;  1XGM A;  5JI6 A;  4AWX B;  1MDM A;  2R7Z J;  2RDP A;  2Y2Z A;  4CSW A;  2QWW A;  1FBQ A;  2R7R A;  4HNT A;  3ZQI A;  4EM0 B;  1RUO A;  1JTY A;  4OAZ A;  4OIP F;  1JGS A;  1U5T B;  1JI8 A;  2X6Y A;  3S1Q J;  5LEJ A;  1S29 A;  4IQJ A;  1YW9 A;  3ASN H;  2KDO A;  1XC5 A;  1ACI A;  4KIT B;  3JW4 A;  4XN0 A;  1MJA A;  3HB9 A;  1J59 A;  3DV8 A;  1IXC A;  1ZRE A;  3JCU C;  4DJA A;  1Y1V J;  3OSF A;  1FC3 A;  4LJZ F;  1Y6I A;  4BBS J;  3RKQ A;  2HDD A;  1ZK8 A;  3T1B A;  1BIA A;  4FET A;  4I98 B;  2JSC A;  4RGR A;  2W25 A;  3GO5 A;  5DS9 A;  2VQG A;  2ETH A;  4JOM A;  5EZH A;  2QSF X;  2XVC A;  3BTC A;  4C3I J;  1GHC A;  2KLO A;  3OS1 A;  1U78 A;  4XRM A;  4KUM A;  5CVV A;  1TW2 A;  2DA6 A;  2L9R A;  1SFU A;  4RGX A;  5EEG A;  3SZG A;  5EGO A;  1DGW Y;  1J5Y A;  1OIS A;  4JQF A;  2GXG A;  1D5V A;  1IF1 A;  5HLH A;  4RBO A;  2BW3 B;  2RKH A;  2Y30 A;  1P9Q C;  3G1O A;  2DFI A;  3JRG A;  3QYE A;  4A3D J;  1TT5 B;  2A5Y B;  2IGK A;  1HW2 A;  4KIS A;  3WTY C;  5FKK A;  1WFX A;  4DZP A;  1UJ8 A;  3KE2 A;  3UNG C;  3C2G A;  4D7M A;  4GFB A;  1JHH A;  4ABZ A;  4M74 A;  1O3Q A;  3CJN A;  2VJI A;  3DPU A;  3BPV A;  1OR7 A;  2M0M A;  2RN7 A;  3SEZ A;  1ON1 A;  3QRF F;  5F6F A;  1YRN B;  2MA3 A;  4P96 A;  3IL2 A;  4OU0 A;  1DPU A;  1S3J A;  2GA2 A;  2VLA A;  2FRH A;  2AXT C;  2X1C A;  1ZGJ A;  2W82 A;  4ASN A;  3NWT A;  2OTL I;  3J7A O;  2KKO A;  1R58 A;  2WV1 A;  3CCE I;  2DMN A;  2Z33 A;  2QQA A;  1I3Q J;  2DLL A;  3N97 A;  3HG9 A;  2QEN A;  2WY8 Q;  4IF4 A;  4UUV A;  5JR3 A;  1FLI A;  4IPA A;  2ZCW A;  4NC7 A;  4EJT A;  1WRJ A;  1WZ2 A;  5LGU A;  1QHG A;  4CO8 A;  4XLE A;  2HYF A;  1GXP A;  4BDY A;  2R7V A;  2YR2 A;  4PSX A;  3GX4 X;  3PL8 A;  2XKO A;  1YIJ I;  4KIF A;  1VQO I;  3BT9 A;  4YG2 F;  4ZC3 A;  1G2H A;  4NNJ A;  2M8E A;  1LFP A;  1YS7 A;  3F8M A;  2MH9 A;  1YG2 A;  1XDS A;  5D4S A;  1E17 A;  2L01 A;  1HLV A;  2MG4 A;  3K4C A;  3OYC A;  5F27 A;  4NC6 A;  2BY0 A;  4U0W A;  5E3L A;  5IT9 K;  2DCE A;  2JJ7 A;  2CJJ A;  1SFK A;  4U0Y A;  5B3S H;  1FOY A;  1ZGA A;  3WTX C;  2FNP A;  3HRT A;  2R92 J;  3M1C A;  3CP2 A;  2E1M B;  1HKQ A;  3PNT A;  2QKM B;  3HPH A;  2EB7 A;  3EYY A;  1T56 A;  3VYU B;  3V42 A;  2ZME B;  2GM4 A;  2Z9O A;  5GAE J;  4F92 B;  1BI1 A;  2QKL B;  2JSP A;  5FO5 A;  3CES A;  5H20 A;  2MD0 A;  1OR7 C;  5HLG A;  1CGP A;  3J7Y J;  3EYI A;  3TO9 A;  1I3A A;  3PFI A;  4E7S A;  3GLL A;  5FLV A;  1E3H A;  4BU2 A;  5GTI C;  2KRF A;  2D1V A;  2K27 A;  1GVD A;  1VQL I;  2BV6 A;  3DCF A;  5J1Y A;  4CYC B;  3HOS A;  4KFC A;  2L02 A;  1OCP A;  2HOS A;  1KU3 A;  3CCY A;  3CJQ B;  3GFJ A;  2JN6 A;  2COM A;  2KPM A;  3TL4 X;  2E19 A;  3PUB A;  3L2U A;  2HXO A;  4EJO A;  3K1N A;  2L7K A;  2L4M A;  3LFK A;  4EJW A;  2GZW A;  1FIP A;  4W1U A;  2LF8 A;  2EIL H;  3SFZ A;  2CH0 A;  2RQP A;  4IQ4 A;  1OCC H;  4HW0 A;  2FQ3 A;  1XG1 A;  3RJP A;  1XGO A;  4LMY A;  3K7A J;  5FKM A;  2MC3 A;  2CW8 A;  2XSD C;  4FX0 A;  3BC8 A;  1FBU A;  4BHP A;  3NRV A;  5FD6 A;  1OMI A;  2IRF G;  5KVR A;  3L7W A;  2FBI A;  1JUM A;  1QZY A;  3LL7 A;  3VEP A;  1LE8 A;  5E3M A;  3FK6 A;  2Y0S A;  2ZXH A;  4YEJ A;  2CFX A;  2XGX A;  2H6B A;  3VPR A;  3HGG A;  5J6X A;  3SQN A;  2KJB A;  2Z1D A;  4LD5 A;  3HC7 A;  1ZN2 A;  3QU3 A;  1BR4 A;  2KRC A;  3I53 A;  3K1M A;  2MFZ A;  3GFL A;  3PNY A;  2A05 A;  2JA7 J;  1R1T A;  2CSO A;  3MVP A;  3OYD A;  1FY7 A;  4P55 A;  2KIU A;  4E6K G;  4G7O F;  3RSN A;  3K2Z A;  5D6E A;  3ZQ7 A;  3LSR A;  3E3V A;  3RPU D;  3IRQ A;  1K79 A;  2LBF A;  3O2P E;  3JAM K;  3CMY A;  2DBB A;  3ECH A;  2DT5 A;  3SYT A;  4ON0 A;  1IUY A;  3KYL A;  4HNV A;  4MFE A;  1OCO H;  1MSE C;  4LK0 F;  1XX5 A;  3CTA A;  1WPK A;  1FMV A;  2YSR A;  4D7N A;  2DFE A;  3E6M A;  1SFO J;  1X2N A;  4B3X A;  3OWT A;  4LIT A;  3AL0 C;  3E7L A;  1R00 A;  2V9P A;  2V7F A;  3OMY A;  4QTR A;  1MMS A;  1O7L A;  2ESH A;  2ZNY A;  1YW7 A;  3IKT A;  3MEX A;  3RCO A;  4BHB A;  3HRU A;  2Z2S B;  3W6V A;  3GTJ J;  4A3L J;  3EPZ A;  3R61 A;  2Z3Y A;  3D1N I;  1YJW I;  1QBJ A;  1X4O A;  4XKV A;  4HSR A;  1IW7 F;  1LPQ A;  4EVI A;  3I55 I;  1B6A A;  4MQ9 F;  5EGO B;  3KP2 A;  4ENK A;  3FXL A;  4BE1 A;  2XKP A;  1AU7 A;  1VFC A;  1N25 A;  3HOZ J;  1YIO A;  4PUS A;  1IN5 A;  4QLC U;  2E1N A;  5EG0 B;  1G3T A;  4HDV A;  2LY2 A;  2V1D A;  1FOK A;  2ZB9 A;  1LJ9 A;  3MAJ A;  4RS8 A;  2A3S A;  2KMU A;  1ODD A;  4AC0 A;  3Q9S A;  2Q2E B;  4Y7N J;  3FXM A;  5DCM A;  4IHW A;  1LFB A;  2ISY A;  3O8H A;  2BYV E;  2VIX A;  4RB2 C;  1H8A C;  2X48 A;  2WC2 A;  2KL4 A;  3BRO A;  3TW7 A;  5TRD A;  1EA3 A;  3W6J B;  4HF1 A;  4BL0 B;  4ZYG A;  4M9S A;  2CUF A;  3OIO A;  4MHG A;  3WTW C;  1K78 B;  2V6E A;  2PMZ A;  2EZK A;  4PK4 A;  4O3M A;  3FIS A;  5D5U B;  5E8I A;  1AA7 A;  4GCV A;  1KA8 A;  2OU2 A;  2H27 A;  5FRO A;  3C2B A;  5TJJ A;  1QA6 A;  1FYK A;  3L2R A;  3C18 A;  3RZO J;  2R5Y B;  3HJE A;  4AU7 A;  2ZC2 A;  1WVR A;  1O3R A;  3ZCO A;  2K9Q A;  1EKE A;  1ZTR A;  4A2U A;  1O4X A;  5C4X J;  1FX7 A;  2XPV A;  3A02 A;  3Q9V A;  4GXO A;  4BEH A;  2ELJ A;  3HOW J;  4NUB A;  2K86 A;  1UZC A;  2QEX I;  3WE2 A;  1SD6 A;  2BOL A;  1VQM I;  1K4T A;  1EJ9 A;  4DBQ A;  5DD4 A;  2DOD A;  2CS3 A;  3FK7 A;  3H0G J;  5FLX Z;  1P6R A;  4XNF A;  4HAM A;  2XRL A;  3OOU A;  4Y3O A;  1I50 J;  5E20 A;  2CV1 A;  1IN4 A;  1CF7 A;  3U2R A;  3DLA A;  2DT6 A;  4HOB A;  3CCQ I;  2G7H A;  1OFC X;  5L3B A;  1KGS A;  2IW5 A;  2FOW A;  4JX6 A;  3ZGK A;  1K6O A;  2XAF A;  3O8G A;  3CF2 A;  1YW8 A;  4GGG A;  5DV5 A;  5GTH C;  3KX2 A;  2H09 A;  1ZHF A;  4A3J J;  1T95 A;  2EK5 A;  3RYR A;  3V4G A;  3V8L A;  1HST A;  1WJC A;  3MKZ A;  5EJC A;  3Q0V A;  4AID A;  2XAG A;  4P5O A;  4XLA A;  3M8J A;  3ASO H;  3K4N A;  3DPL C;  3KCC A;  4B8X A;  5DCF A;  5LBQ A;  1SAX A;  5GAG J;  1UMQ A;  3GTP J;  4AVP A;  3CCM I;  2IGO A;  3WE3 A;  3JRH A;  4XR6 A;  1UST A;  2RAE A;  1FP1 D;  3K0L A;  2PMU A;  4E7I A;  5CLS A;  1G6N A;  5DTD A;  2LSO A;  2P4W A;  4B44 A;  1I6X A;  1H88 C;  3G6E I;  1DPR A;  3CDL A;  4UV8 A;  2B63 J;  3LSJ A;  3EET A;  4RAY A;  2EFQ A;  5JVT A;  2A6E F;  2NYX A;  2JUC A;  3FDY A;  3HYI A;  1W5T A;  3V8J A;  3VYR B;  4LIV A;  5EEH A;  1TQM A;  5CPR B;  2STW A;  5J4V A;  2CYY A;  2KZG A;  2QBY A;  1LDD A;  3FXU A;  4RAF A;  1LE8 B;  3H9J A;  2PQ8 A;  5E3N A;  4RDU A;  2DOF A;  2DK8 A;  3CUQ B;  2JWT A;  3KET A;  2FQ4 A;  3I9V 2;  4IZZ A;  4XMY A;  3TDZ C;  4II2 A;  3I0T A;  5AON A;  2XAQ A;  2GIV A;  3OIP A;  1MJ9 A;  3ZOB A;  3ZN1 A;  4UY8 I;  2LKS A;  3ZMD A;  1G4D A;  1XMA A;  3BDD A;  4DGW B;  3VYS B;  4L5J A;  3SDB A;  2G7U A;  3DU5 A;  3GCM A;  1ZLK A;  2R4G A;  4D9J A;  1B8I B;  1XDU A;  3ECO A;  3HPG A;  2ZO4 A;  3IHU A;  2R5Z A;  2V9K A;  3OYN A;  1YE9 A;  3ONQ A;  4CUG A;  3FM5 A;  1LDJ A;  4XON A;  4A69 C;  2VQC A;  4L9N A;  5J8C A;  1AKH A;  2VN2 A;  4I2O A;  4MIM A;  2K02 A;  3S1N J;  4DNC A;  4ZDO A;  4XM3 A;  2M1B A;  3AG4 H;  3P9I A;  4XKB A;  1FJL A;  5E17 F;  2XGE A;  3LAP A;  5K1Y A;  2R7W A;  5HOD A;  1J7K A;  4DYC A;  1FT9 A;  2YS9 A;  4ZDP A;  1MMN A;  4FHT A;  5DEQ A;  2IA2 A;  3W2V A;  4B1R A;  3S17 J;  5IP9 J;  3SXY A;  3LFU A;  1BR2 A;  3IH4 A;  3KFW X;  4HF0 A;  3S3O A;  2H1L A;  4GRI A;  1QQI A;  5FRN A;  2JA5 J;  2O8K A;  1HOM A;  1VQ9 I;  3KEY A;  1NK3 P;  3CLQ A;  3HDD A;  4IL6 C;  3U9G A;  4O6J A;  3HRM A;  1DU6 A;  3CUO A;  1L3L A;  3J81 K;  2L9S A;  3LSI A;  1WI9 A;  2HU9 A;  4WXD A;  3GFM A;  3M07 A;  3T8R A;  3HSR A;  4M6Y A;  5J47 A;  4XIC A;  3A1Y A;  3LSM A;  3JRI A;  3FXO A;  1BJA A;  1XN7 A;  2STT A;  1JJ6 C;  3BP8 A;  1D1C A;  4ZTF A;  2FNA A;  2WB1 N;  4KMF A;  2KHM A;  2E71 A;  3J7A Y;  4UVC A;  3ZQG A;  2J5O A;  2H1K A;  2D5V A;  2JVH A;  2OJE D;  3RKX A;  5E8G A;  3OYA A;  1TP4 A;  3M9A A;  1TW3 A;  2P5K A;  2L54 A;  4UVB A;  3A2K A;  3QP5 A;  4CDG A;  5IYC J;  3ZMS A;  4A0X A;  1ZG3 A;  4GYG A;  1G3W A;  2RQQ A;  3FKJ A;  4ESB A;  1ZR4 A;  4NHJ A;  4CYD A;  1LNW A;  5L3G A;  5HLI A;  3A0H C;  3QPH A;  4G6D A;  2K4J A;  5DD8 A;  1ZAR A;  1SVO A;  2XAH A;  1P2F A;  2OCE A;  2CRG A;  2V4J C;  1WGX A;  1ZRD A;  1X3W B;  5B1A H;  4FIS A;  1YX5 A;  2VJ4 A;  2QLZ A;  4ITV A;  5IT9 Z;  1J9I A;  3MKW B;  3CJT B;  1TQP A;  4L18 B;  1Y0N A;  3GEZ A;  2R7D A;  1BOB A;  1UAA A;  2VI6 A;  4WK8 F;  4RB0 A;  2CQX A;  4Y13 A;  1ETY A;  2PJR B;  2DYR H;  1IO2 A;  3DEW A;  3MZY A;  2I8D A;  3BR0 A;  4V2G A;  3TP0 A;  1HW5 A;  2XRO A;  5BPD A;  2BVL A;  2DYS H;  1P4A A;  4GDF A;  4CA0 A;  2KDZ A;  2BE5 F;  2IGM A;  2DA1 A;  4U7D A;  1FYL A;  3RQ4 A;  3K6G A;  3QPT A;  4HX7 A;  4CCN A;  2ECC A;  4MTD A;  1NH3 A;  4YFX F;  4D5C A;  1XGS A;  3MKL A;  3CO7 C;  2CUE A;  9ANT A;  4ETS A;  1R4M B;  3ABK H;  3WTZ A;  4FAS D;  2DPU A;  4LB6 B;  3E97 A;  4OIN F;  3GLX A;  3ZN0 A;  1ZEL A;  2RC4 A;  2RVC A;  3VSL A;  5K5O A;  5M5Y J;  2X1E A;  1OKR A;  2OBP A;  3H9G A;  4RLF A;  3AG2 H;  2HZD A;  2QZ8 A;  4LG3 A;  2PJP A;  5GP9 A;  3KLN A;  2AQF A;  3ZMT A;  1OLT A;  2ID6 A;  3FF5 A;  1WI3 A;  2HTS A;  3PSI A;  3OS0 A;  4BQN A;  3M3Y J;  1Z6R A;  3K4B A;  2CQ7 A;  2ZSH B;  3JSP A;  3HOV J;  1A04 A;  2NAZ A;  1REP C;  2WAF A;  3LNQ A;  3AG1 H;  1S8N A;  2FSW A;  3VOE A;  4G12 A;  1FZP B;  4KIG A;  3ZQH A;  2L0K A;  3ROU A;  5E3O A;  3CME I;  3OYF A;  5FJ8 J;  3L1P A;  2L9N A;  1TLH B;  3ESW B;  1Q1V A;  2QUF A;  4E70 A;  4RAG A;  2UXX A;  5D4R A;  2O6G E;  3A01 B;  5JLW A;  3GZ5 A;  1LVK A;  1E3O C;  4WF2 A;  4AYB N;  1VQ4 I;  3NAR A;  3P9C A;  4HG2 A;  2QBY B;  4XRF A;  2PEX A;  4IHT A;  3ZXS A;  1S6L A;  2DMQ A;  4A5N A;  4XKC A;  3U1D A;  5L3E A;  1MSF C;  1X1B A;  1Q1H A;  4L5E A;  2E35 A;  5FFX A;  3IAS 2;  1B9N A;  3PM1 A;  3R60 A;  4EAT A;  4PFO A;  1SVL A;  2EFP A;  1JKP C;  5IT3 A;  4LLG F;  4KNY A;  3EUH A;  2VKE A;  2JRT A;  1ZGW A;  4AVZ A;  5DUK A;  3JAM Z;  2Z16 A;  2XF6 A;  3GTG J;  3HTU A;  3LA2 A;  2W84 A;  2XV4 S;  2LRE A;  1K61 A;  2P81 A;  1W36 C;  2R7S A;  4IHS A;  2LK2 A;  2DFF A;  3T5X A;  4CHU A;  2QGU A;  3LA7 A;  2BZT A;  5IYD J;  4N0B A;  1R1U A;  1JGG A;  4NBQ A;  2PMH A;  1HCR A;  5BPI A;  2RNG A;  3B02 A;  5HDN A;  3GME A;  1YLF A;  3F6O A;  3A4C A;  4ZJZ A;  3DQV C;  2P7V B;  1BM9 A;  2CUJ A;  4B09 A;  3M4O J;  2XPU A;  3LQR A;  1BW5 A;  2VUM J;  2I10 A;  4HQM A;  2N8G A;  2VON A;  1XSV A;  3KIO A;  2L2O A;  1H9G A;  2BGC A;  4BHC A;  3GFI A;  3BJO A;  3CJR B;  2QCO A;  2FD5 A;  4BXU A;  3CLO A;  1WSU A;  2X85 A;  3CQZ J;  3JTH A;  4RM2 A;  4FE4 A;  2NS0 A;  1UHW A;  1FSE A;  4B48 A;  2JA6 J;  2BEO A;  1T0F A;  2ZNZ A;  2ZJQ F;  2PI0 A;  1VZ0 A;  2O5R A;  2R7F A;  4PCQ A;  1V55 H;  2O9L A;  1SAU A;  1KU2 A;  5CVR A;  3G3Z A;  1BOA A;  3H5R A;  3OL4 A;  3DEE A;  3F23 A;  2GBY A;  5HS8 A;  3D5S C;  2E36 A;  2F5E A;  2FJ1 A;  5KAF C;  4HRI A;  2NVX J;  1KU7 A;  5JHU A;  1WJD A;  1T6S A;  1SEU A;  3BJ6 A;  2E2I J;  3WGH A;  4QPQ A;  2ZSI B;  3HXL A;  4E7Z A;  1D0Y A;  2XIG A;  4I76 A;  2EZI A;  4KJZ A;  1RR7 A;  4ANJ A;  3EUH C;  2G9W A;  5KAI C;  5FLM J;  2VXZ A;  2DU9 A;  2O03 A;  2FXA A;  2NRA C;  3CDI A;  1FP2 A;  3E6B A;  3HKZ A;  3FMR A;  4KN7 X;  4UV9 A;  1YO5 C;  4O5V A;  2HOA A;  4YEL A;  3HM5 A;  3KYC B;  2EJR A;  2VL8 A;  2QF7 A;  1PJR A;  1FPQ A;  4BJ6 C;  5M3F J;  1ETW A;  1D0Z A;  3BR2 A;  1QZZ A;  3DXJ F;  1RRJ A;  4ZYA A;  1B72 A;  3FHN A;  2Q1Z B;  2DMP A;  3L2C A;  1R5I D;  5IPA A;  3QYB A;  3F9K A;  5HDG A;  2VKV A;  3QPS A;  4XSZ F;  4PJ0 C;  4M6X A;  3ZQC A;  4Q4Z F;  1OYY A;  4BQO A;  2GWR A;  1F36 A;  2HI3 A;  2QYO A;  4X0G A;  2MH2 A;  2FF4 A;  1YFH A;  4R1H A;  1ZAO A;  3DTI A;  1PP7 U;  2R7U A;  3VOD A;  4DYQ A;  2LH9 A;  2HWV A;  1BBY A;  1U6G A;  2UUZ A;  4N9H A;  2Q0O A;  1T98 A;  4I99 C;  1S7E A;  4Z2Y A;  2CW7 A;  3WTV C;  1TZL A;  2KP6 A;  1OCZ H;  2M0C A;  3TQN A;  3CCJ I;  3AFH A;  1SD5 A;  2ELK A;  2LNB A;  5IP7 J;  2R3S A;  5D8K B;  3A0B C;  2GQQ A;  4M9X A;  1T0F C;  3BG9 A;  1MMD A;  5FFZ A;  3JSO A;  1D1B A;  3BY6 A;  3MKY B;  4MLO A;  1TWA J;  2DTZ A;  4PSW A;  1WJE A;  3DBL B;  5DDG A;  1ETK A;  3C7J A;  3IH3 A;  3OYE A;  1PP8 F;  1B59 A;  1VND A;  4G9Y A;  1GV2 A;  3P9K A;  5D8L B;  4BKX A;  1BC7 C;  1B1B A;  3JRC A;  3DU6 A;  1MBE A;  1K7A A;  2JVG A;  1X1D A;  1E0E A;  1J2X A;  1MBH A;  4PJN A;  1JJ8 C;  3I59 A;  3KPH A;  2R7Q A;  3H9Q A;  2R0Q C;  5FRM A;  2EQR A;  2X0L A;  1IDY A;  1LQ1 A;  2C6Y A;  1SFX A;  4YIF A;  1MDM B;  6PAX A;  3QOD A;  2NVQ J;  1I39 A;  2R7O A;  2AQE A;  1KZH A;  2OCC H;  3JRF A;  3UKG A;  2YX4 A;  2XDV A;  2HKO A;  3S8P A;  3TP3 A;  3QOP A;  1MBK A;  3LWF A;  4ENM A;  4FX4 A;  2OZU A;  3HL2 A;  1Y39 A;  1W7P A;  2HVQ A;  3CZ6 A;  3PQJ A;  2RGV A;  2WBM A;  2HQN A;  5HVQ C;  2ISZ A;  3GYH X;  1ON2 A;  2WAQ A;  5L3C A;  4Y52 J;  3H3U A;  1XS9 A;  3SZP A;  3T8T A;  2NNY A;  2DDB A;  1BC8 C;  1B9M A;  5BNG A;  3PO2 J;  3OYM A;  5J40 A;  2X6O A;  1ZG5 A;  2EIJ H;  3WHC A;  1IN6 A;  3BZK A;  3CC7 I;  3GTL J;  2Y69 H;  4M71 A;  3O3K A;  4DIQ A;  1EV7 A;  2CQK A;  1STZ A;  3CP8 A;  3MWM A;  4DQ2 A;  1DGR M;  5F64 A;  1TC3 C;  3R4K A;  5H6Q A;  1RUN A;  3F8B A;  1R4N B;  3SJM A;  1I27 A;  4D0P A;  1SVM A;  3RYP A;  3GTK J;  1IV8 A;  2VT3 A;  1U8R A;  5JFR A;  1EH8 A;  2CUZ A;  3HSF A;  4XOR A;  5CKT A;  5HLT A;  4I09 A;  3FXJ A;  3ZQF A;  4DOZ A;  3RZD J;  2M7A A;  5K7H A;  3JRD A;  4A3I J;  2OA4 A;  3DP7 A;  1X3U A;  2OUM A;  4KIB A;  3S2H J;  4EV0 A;  3A03 A;  3BZ6 A;  1LEB A;  3GZN B;  4M3F A;  3H92 A;  4BXX J;  3TO6 A;  3V7S A;  2HDW A;  1T38 A;  3R0A A;  5IY5 H;  1MZB A;  4YRV A;  2HQR A;  1U9N A;  2K7L A;  1IV6 A;  2EA2 A;  1Z05 A;  2MLG A;  3HHH A;  3J80 K;  3MZ8 A;  1XSD A;  3KLO A;  4OWR B;  5IYB J;  1W0T A;  2BY3 A;  4HV6 A;  1OYW A;  4MGR A;  3OYI A;  2BBY A;  3FXK A;  1TBX A;  2K9L A;  3WU2 C;  3NQO A;  3GUD A;  4L9V A;  4LG0 A;  3F8N A;  4F93 B;  2EFN A;  4BQQ A;  2F5D A;  2MC4 A;  4XLF A;  3OSG A;  3S2D J;  2LMD A;  2TDX A;  4ESF A;  1ETX A;  4OOI A;  1HKS A;  3IUO A;  5AIQ A;  3FMS A;  2NVU B;  3SEQ A;  5JVG F;  4E7L A;  4HF2 A;  3K2A A;  4HQE A;  1ZH5 A;  4L0Z B;  3D5R C;  3OV8 A;  1HBX G;  1GXQ A;  3W6K B;  1MH4 A;  1XMX A;  3ELK A;  4BH9 A;  3FMQ A;  4L5I A;  3QP6 A;  1GDT A;  5F0C A;  3S32 A;  1XD7 A;  2O3F A;  3HUG A;  1F9N A;  2DXI A;  4HZF A;  1F1Z A;  3WOD F;  3PIO F;  1Z7L A;  5B66 C;  2Y0S N;  3T0Y A;  1S72 I;  1R7J A;  3PSF A;  4OMY A;  4N9I A;  4EGZ A;  3HOT A;  1P7J A;  1OJL A;  1Y8R B;  2ICW G;  1O3S A;  2CV0 A;  3LOC A;  4ZZD A;  2LVS A;  1QNT A;  1VQ6 I;  1HF0 A;  4GO1 A;  3BQY A;  3DKW A;  1PUE E;  4RB1 A;  1HQC A;  1ETQ A;  3CCV I;  4UUS A;  2EIM H;  2KQR A;  1QPI A;  2D45 A;  3QPL A;  3JRA A;  5E1X A;  4EJU A;  1WJ5 A;  4YFK F;  3IWZ A;  1HW1 A;  5LGN A;  3HTS B;  3L2V A;  1TWH J;  2WB1 A;  1BR1 A;  1I6H J;  3B6C A;  2H8R A;  3DKX A;  3AL0 B;  1FNN A;  1BJZ A;  3BOQ A;  1UB9 A;  2CQQ A;  2EBI A;  2HEO A;  3LSG A;  5LD2 C;  4D5F A;  2HFH A;  3FIW A;  4A3B J;  4FTH A;  3BPX A;  1K6Y A;  3IAM 2;  3U21 A;  1IXS B;  3TW6 A;  2Y0M A;  4WWC A;  2FEZ A;  1Z6T A;  4ZYH A;  4BE0 A;  4EJV A;  4II3 A;  1D5Y A;  2O7O A;  3B6A A;  5K5Q A;  4EGY A;  3ZQQ A;  1LVA A;  3TKY A;  2HZT A;  1POG A;  1IXR C;  1YQA A;  2OPT A;  1WH7 A;  1MMG A;  2OQG A;  4B3A A;  3N4M A;  2XSJ C;  3PNV A;  2ACJ A;  2GOM A;  2DN0 A;  1X19 A;  1R23 A;  1FOX A;  5LFA A;  1DDN A;  1EH6 A;  3TGN A;  1UFM A;  1TWG J;  2D1H A;  1FMW A;  1IRF A;  1U5T A;  5ILV A;  4LB5 A;  4IRH A;  3K4J A;  4I0B A;  3FZV A;  4G6T B;  3CCR I;  1A6I A;  2KFD A;  1TWC J;  4IOA F;  1R71 A;  2FA5 A;  2R93 J;  3EDP A;  4LOC A;  4N4N B;  1BI3 A;  3BTL A;  4UUT A;  5CVJ A;  2JZY A;  2MW8 A;  4KT6 A;  2P7C B;  1I1G A;  3M1E A;  3ZMZ A;  3H1C A;  1WHU A;  2L3D A;  5ILS A;  3MZH A;  2LBF B;  2K9S A;  1QHH D;  2DA5 A;  4LFU A;  3FXR A;  4Y33 A;  4ENN A;  4I7H A;  1KQ8 A;  3QQA A;  2AHQ A;  1OQY A;  1X58 A;  1R6R A;  2M45 A;  3G1L A;  1V5E A;  2LTP A;  5J3L A;  3W3C A;  2JRM A;  4XRS G;  4B43 A;  4IXA A;  4AUX A;  4XKW A;  1H0M A;  1UG2 A;  1WJB A;  4IO9 F;  4HPQ A;  5TGT A;  2IS1 A;  4HLX A;  4JX4 A;  2R7T A;  2KRH A;  3EUA A;  5CVU A;  2JK3 A;  3IH2 A;  2CFO A;  5BOX A;  3FWE A;  1JUS A;  1A35 A;  1MGT A;  1P4X A;  3LQQ A;  1P92 A;  3ABT A;  4J19 A;  3HOY J;  4BS9 A;  3OYG A;  1CQT A;  1X1P A;  4WXC A;  2HXI A;  1MNM C;  3OR2 C;  4YFN F;  4HNU A;  1UHS A;  1YRN A;  1T08 B;  5LRR A;  4F3Q A;  4WX9 A;  1Z7U A;  3KEQ A;  2HGC A;  2NVY J;  4XLP F;  2HQA A;  3WTU C;  1MNE A;  2GOX B;  1S7A A;  4BAC A;  2DAO A;  3K70 C;  3L09 A;  3COA C;  2V1X A;  1SMY F;  4M3D A;  1R5G A;  1FSH A;  2Q8K A;  1BW6 A;  1U5T C;  2B7E A;  4AYB A;  5D5V B;  5DCM B;  4A3M J;  4KDP A;  3C3W A;  2A6T A;  1P7I A;  2WWY A;  1QVU A;  1UEL B;  3BR5 A;  5F08 A;  4OAY A;  3I5U A;  1KON A;  2JA8 J;  2PBI A;  4QIW N;  3K4M A;  4P1W A;  2E34 A;  4UNO A;  4W97 A;  3WTS C;  2IS4 A;  2K4B A;  3VFZ A;  5FKO A;  2GA1 A;  2FUG 2;  2E7X A;  5BQT A;  2JQ7 A;  3PIP F;  2VT2 A;  3S2W A;  2COB A;  3CMM A;  2L4A A;  5IP6 A;  1YJN I;  1XTA A;  2E1O A;  2ZBK A;  3AG3 H;  3H35 A;  4BGD A;  3L00 A;  1R9T J;  3HOU J;  2V9V A;  3E6C C;  2CQN A;  4YIR X;  4TV7 A;  3I71 A;  1QPM A;  2Y31 A;  1AOY A;  2NVT J;  1IJW C;  4BEH B;  1IN8 A;  1WH5 A;  2Y9Z A;  2BHZ A;  2W1O A;  2E2J J;  2ZME A;  3ML6 A;  4BY1 J;  2X9D A;  5B1B H;  4I02 A;  2TCT A;  1J09 A;  3GBG A;  4A3E J;  2GIZ A;  3L2Q A;  2G0E A;  3ABM H;  4IKF A;  3GVA A;  3F72 A;  2FU4 A;  2UV1 A;  5GAD J;  2DMT A;  1RET A;  3M7G A;  4DZJ A;  2VOP A;  1PDN C;  2DFH A;  2LDU A;  4GYI A;  3ABL H;  4E4H A;  1F5T A;  3KYD B;  5FKL A;  3HUG B;  1CF7 B;  1F43 A;  2DJI A;  1S9H A;  2YUS A;  1MW7 A;  1BIB A;  1V54 H;  5CQG A;  3E5U A;  3KZZ A;  1TQI A;  2FML A;  2IA0 A;  1Y8Q B;  5LLQ A;  1JT0 A;  3CF5 F;  1JT6 A;  2WV0 A;  4CYC A;  2F6C A;  3I3L A;  2K3P A;  2VJ5 A;  4BNC A;  1JXS A;  3E5Q A;  4JP0 A;  2X6X A;  4U88 A;  1V3F A;  4DW6 A;  2CWE A;  2VAS A;  4X6A J;  2VKH A;  3HOX J;  1QU3 A;  2DA7 A;  3DKY A;  1R1V A;  4HV5 A;  2I5U A;  4HX4 A;  3P7N A;  2EV6 A;  3FM3 A;  4XLC A;  1M1E B;  3F22 A;  1G3Y A;  2W00 A;  2X1D A;  1ONV A;  4IRG A;  4D1Q A;  2L7Z A;  3J7Z I;  2W48 A;  4RAZ A;  2HOT A;  1ZRF A;  4OIR F;  1Z77 A;  3GTQ J;  4J01 A;  4G6Q A;  3CC2 I;  4XQF A;  3Q5F A;  1KYZ A;  2X6W A;  5HNH A;  1W36 D;  2M5W A;  4BE2 A;  4XN3 A;  2BY1 A;  4LLN A;  5FD5 A;  2W4S A;  4M3G A;  1YHQ I;  1FBS A;  4CCL A;  1A6Q A;  3E1S A;  2ECB A;  2FOK A;  3DBH B;  5BMZ A;  2LFB A;  3K69 A;  2VQL A;  4A93 J;  3ISP A;  2Y48 A;  4Y4R A;  1XSX A;  1VQP I;  1HXD A;  2FMY A;  1E2X A;  3E0J B;  4CXF A;  2KIM A;  1RNL A;  3SDG A;  5EZG A;  4NC8 A;  2E1M C;  3LA3 A;  3F21 A;  2DTR A;  4M9Z A;  2DA4 A;  2IEK A;  2ADU A;  5LHI A;  4XRS A;  2OTJ I;  1I1S A;  4XSX F;  1Z21 A;  2ZME C;  2IPQ X;  4ZH4 F;  1HA8 A;  1HC8 A;  3QAH A;  2EIN H;  3OOP A;  5CQE A;  5JLX A;  1ULY A;  4MO7 A;  3TOA A;  1DQU A;  4AM3 A;  2GXB A;  2ESN A;  3Q0U A;  3I4P A;  3RTR A;  3H5A A;  3S16 J;  4A3K J;  2QA4 I;  2HPM A;  2EIK H;  4A3F J;  2YX7 A;  4PZJ A;  4M6V A;  2MAB A;  1TT0 A;  4Q5S F;  2LY9 A;  3WGG A;  1Z91 A;  3ZMV A;  2AS5 F;  2YU3 A;  2R5Z B;  1XCB A;  4Z6Y A;  1IDZ A;  3KP4 A;  2XB5 A;  4CZZ A;  1GLN A;  3OS2 A;  5AIP A;  1SAN A;  5J1R A;  4JBA A;  1MD0 A;  1RES A;  1ETV A;  5A2Q K;  1S5L C;  4E7H A;  1WWX A;  1AKH B;  4ZZL A;  1N75 A;  3TOB A;  2DW4 A;  2IVM A;  3WGI A;  4XK4 A;  1SC7 A;  5E18 F;  2JT1 A;  1BA5 A;  4BXF A;  3VYT B;  3EQL F;  3HIF A;  2UWM A;  4NQW A;  1MKM A;  3ZR8 X;  4WCG A;  3V7R A;  4CGZ A;  2DK5 A;  3OYH A;  4Q47 A;  2GXA A;  2IS6 A;  4NB5 A;  1FWZ A;  5L3D A;  4A6E A;  1R5H A;  2LLK A;  3R0J A;  3W2A A;  3OYJ A;  1PUF A;  1ZYR F;  2DMU A;  1YJ9 I;  3NEU A;  1JE8 A;  2DDA A;  3BCB A;  2DPD A;  4BDZ A;  1GUU A;  3I58 A;  1VQ5 I;  4HA8 A;  4R79 A;  2WAD A;  5EG0 A;  4P9F A;  2FX0 A;  2EZL A;  1OCR H;  3C2H A;  2HR3 A;  2V1N A;  1VQK I;  2L7M P;  2Q2E A;  2F48 A;  1UHM A;  5F04 A;  3OYK A;  1SD4 A;  1X3Z B;  2IT0 A;  1QO0 D;  1D8K A;  3FBI B;  5K7Z A;  2YPR A;  3ERE D;  1K78 A;  2F4O B;  3B73 A;  2XF7 A;  3HZJ A;  5H6R A;  3PJR A;  4EEF G;  2BXZ A;  1X1C A;  4CZC A;  3KP3 A;  1T2K A;  2VBX A;  2NNN A;  4H0E A;  4Y17 A;  2LP0 A;  4MTE A;  1W5C C;  1X1A A;  1T39 A;  2TRT A;  3S3N A;  2EWN A;  4AIK A;  2WTE A;  2NOJ B;  3OR1 C;  1JHF A;  3KZI C;  3ZMU A;  2VB6 A;  2X4H A;  1YTY A;  2XRN A;  4IHY A;  4RLQ A; 
#chains in the Genus database with same CATH homology
 1OPC A;  2Z5U A;  3J80 Z;  1VTN C;  5D5W B;  3D5L A;  4IVN A;  3ABU A;  4KT5 C;  4RGU A;  4JK1 X;  1H9T A;  2FBK A;  1RI7 A;  2VOD A;  5HS9 A;  3KP6 A;  1KQ9 A;  2QQ9 A;  3BJA A;  5DYM A;  1BI2 A;  1G3S A;  1TTY A;  4KIC A;  2CGP A;  2ZXJ A;  4Y15 A;  2V6C A;  4KN4 X;  4UHT A;  1IZ1 A;  2PN6 A;  1HKT A;  3I54 A;  4HLY A;  1YYV A;  2H6C A;  4IJA A;  3RIR A;  2P8T A;  3M8F A;  2V1U A;  2XAJ A;  1Z9C A;  2P5V A;  3V7C A;  4CIC A;  2H94 A;  3F8F A;  4FT8 A;  4OMZ A;  4L0Y B;  2O61 A;  4U7B A;  1U2W A;  3I64 A;  5HS7 A;  1RZ4 A;  5E1Z B;  2KIF A;  1ZG1 A;  3GZ6 A;  2E7W A;  2VC1 A;  4S05 A;  4S04 A;  3LAJ A;  4AIH A;  2OAZ A;  4U0V A;  3JTG A;  3RPQ A;  3FHZ A;  4F7Z A;  4A12 A;  3RPU A;  1ZRC A;  2PG4 A;  1XMK A;  3CUQ A;  3DEU A;  4AIJ A;  4LK1 F;  2VE9 A;  3KP5 A;  2XAS A;  1OYI A;  1XB4 A;  3M8E A;  2JTV A;  2DO7 A;  4Q48 A;  4HYE A;  1EH7 A;  1SFE A;  1RIO H;  2KJC A;  2AXL A;  4HX8 A;  5LHH A;  3G73 A;  2M30 A;  1W4M A;  1W7P D;  5DUI A;  2XUB A;  1SD7 A;  4M73 A;  1Z1D A;  2OQR A;  1O57 A;  1IRG A;  2DQR A;  5LRS A;  2HTJ A;  1F4K A;  3KZY A;  2HS5 A;  3SHF A;  3HSE A;  2B0L A;  2FE3 A;  3F3X A;  4UXN A;  3IKV A;  2EFO A;  2RNJ A;  3RI4 A;  3V8K A;  3FXQ A;  1DUX C;  2J5P A;  2EV5 A;  2A61 A;  1XGN A;  4ZYD A;  2W85 A;  5LHG A;  5FGM A;  3J81 Z;  3VB2 A;  4KA4 A;  3CUQ C;  2OZ6 A;  4PDK A;  2P6T A;  2F5C A;  4R8H A;  2VBZ A;  3GF2 A;  3MFK A;  1IAW A;  3E6D A;  5CJ9 A;  2PLY A;  2MD5 A;  1V4R A;  4KMU X;  1WQ2 A;  2DI3 A;  3GXO A;  4A5M A;  3E5X A;  2F5F A;  1TNS A;  2DQL A;  3H3Z A;  3AAF A;  3ZPL A;  5KK1 A;  4PGH A;  4PGG A;  2CO5 A;  2E1C A;  2O8X A;  4I0A A;  4EQQ A;  1BN5 A;  3RDI A;  2CW0 F;  2VBW A;  1R22 A;  1D3Y A;  1Y0U A;  3KEO A;  3K1P A;  1D8J A;  4LLL A;  2ZFW A;  2W57 A;  1S7O A;  2RV8 A;  2Y75 A;  4G8X A;  4EMS A;  5ERI A;  2LKP A;  3GWZ A;  4I01 A;  1GVJ A;  4BYY A;  1J0R A;  1YS6 A;  2UXN A;  3QU6 A;  2A6H F;  1O7F A;  1O3T A;  1HSJ A;  3CO6 C;  2O0Y A;  2IP2 A;  4G7Z F;  5J8F A;  1SMT A;  1ZLJ A;  2XHK A;  5F1R A;  5ILU A;  3I59 B;  4OIO F;  3REO A;  1J75 A;  4P9U A;  2CG4 A;  2ZJ2 A;  3CDH A;  3GW2 A;  2LF7 A;  2OD5 A;  4MQV A;  2D2W A;  4ENJ A;  2HDC A;  4RGS A;  2FBH A;  3HRS A;  4MNU A;  2EFW A;  2IJL A;  3O6B B;  2P6S A;  3F8C A;  1QGP A;  3PQK A;  3FX3 A;  1W7P B;  4AD9 A;  1DP7 P;  1XCV A;  4YII A;  1LDK B;  3LST A;  5E1W A;  3DF8 A;  1P4W A;  2JPC A;  5ICC A;  3SZT A;  2W24 A;  3RKW A;  3ULQ B;  1U3E M;  2QQB A;  2HKX A;  5ICE A;  3DPT A;  2JPB A;  5A2Q Z;  1C0W A;  2UZK A;  4UVA A;  3R6S A;  2EA4 A;  2ZKZ A;  3HHG A;  1FYM A;  4ESJ A;  3K9T A;  3RKY A;  2PFB A;  4MEX F;  4ZYE A;  5BS6 A;  1MJB A;  5LGT A;  2IA1 A;  4BAY A;  2V79 A;  2VC0 A;  1LEA A;  2EV0 A;  2A69 F;  2VBY A;  1KU9 A;  2HYG D;  3C1D A;  3MCZ A;  4MEY F;  2M87 A;  3WU1 B;  5D5X B;  2VOO A;  3L9F A;  4KYW A;  3IC7 A;  3WU0 A;  4LG0 B;  1BI0 A;  5FLX K;  4EM1 A;  5CYV A;  1WKM A;  5ICF A;  1AWC A;  2F2E A;  2QVO A;  3D0S A;  5HDK A;  5ICG A;  3KP7 A;  2A07 F;  3DFG A;  4M72 A;  4XBF A;  1W5S A;  3MQ0 A;  4XLN F;  4L9T A;  1TNT A;  4IRI A;  4OIQ F;  2MBF A;  4G94 A;  4EM2 A;  1L0O C;  3F6V A;  4A0Z A;  2MLK A;  5D6F A;  2Z99 A;  5CVI A;  1LB2 A;  4RB3 C;  4LGW A;  4L9J A;  1R36 A;  1B4A A;  1NHA A;  3BWG A;  4HBL A;  3TO7 A;  4QWQ A;  3ZP5 A;  1KQ0 A;  4WXH A;  1KYW A;  3WTT C;  4BQA A;  5LEK A;  1IN7 A;  4A6D A;  5HOO A;  2ELH A;  2QM3 A;  4G7H F;  3IRR A;  1UCR A;  1I5Z A;  2HOE A;  3WG9 A;  3IWF A;  4K2E A;  5ED4 A;  4HDU A;  3TDU C;  5FB2 A;  5K5R A;  5L3F A;  2A68 F;  2P5L C;  1USS A;  2VE8 A;  2GAU A;  4A0Y A;  1XGM A;  5JI6 A;  4AWX B;  1MDM A;  2RDP A;  2QWW A;  1FBQ A;  4EM0 B;  1RUO A;  4OIP F;  1JGS A;  1U5T B;  5LEJ A;  1S29 A;  1YW9 A;  3JW4 A;  1MJA A;  1J59 A;  3DV8 A;  1IXC A;  1ZRE A;  1FC3 A;  4LJZ F;  3T1B A;  1BIA A;  4I98 B;  2JSC A;  4RGR A;  2W25 A;  3GO5 A;  2ETH A;  2XVC A;  1GHC A;  1U78 A;  4KUM A;  5CVV A;  1TW2 A;  1SFU A;  4RGX A;  5EEG A;  1J5Y A;  4JQF A;  2GXG A;  1D5V A;  1IF1 A;  5HLH A;  2RKH A;  2DFI A;  2A5Y B;  1HW2 A;  3WTY C;  3KE2 A;  1JHH A;  4M74 A;  1O3Q A;  3CJN A;  3BPV A;  1OR7 A;  2RN7 A;  1ON1 A;  3QRF F;  5F6F A;  2MA3 A;  4P96 A;  3IL2 A;  4OU0 A;  1DPU A;  1S3J A;  2GA2 A;  2FRH A;  1ZGJ A;  4ASN A;  3J7A O;  2KKO A;  1R58 A;  2Z33 A;  2QQA A;  2DLL A;  3N97 A;  2QEN A;  4IF4 A;  4UUV A;  5JR3 A;  1FLI A;  4IPA A;  2ZCW A;  4EJT A;  1WRJ A;  5LGU A;  4CO8 A;  2HYF A;  1GXP A;  2YR2 A;  3GX4 X;  2XKO A;  4KIF A;  4YG2 F;  2M8E A;  1YS7 A;  3F8M A;  2MH9 A;  1YG2 A;  1XDS A;  5D4S A;  1E17 A;  2L01 A;  4U0W A;  5IT9 K;  4U0Y A;  1ZGA A;  3WTX C;  2FNP A;  3HRT A;  1HKQ A;  2EB7 A;  3EYY A;  2ZME B;  2Z9O A;  1BI1 A;  5FO5 A;  5H20 A;  5HLG A;  1CGP A;  3EYI A;  3TO9 A;  3PFI A;  2KRF A;  2D1V A;  2K27 A;  2BV6 A;  3HOS A;  4KFC A;  2L02 A;  1KU3 A;  3GFJ A;  2COM A;  4EJO A;  3K1N A;  2L4M A;  3LFK A;  4EJW A;  2GZW A;  2LF8 A;  3SFZ A;  2RQP A;  4HW0 A;  2FQ3 A;  3RJP A;  1XGO A;  4LMY A;  2MC3 A;  4FX0 A;  1FBU A;  4BHP A;  3NRV A;  5FD6 A;  1OMI A;  2IRF G;  5KVR A;  3L7W A;  2FBI A;  1QZY A;  3VEP A;  2CFX A;  2XGX A;  2H6B A;  5J6X A;  3SQN A;  2KJB A;  4LD5 A;  1ZN2 A;  3QU3 A;  3I53 A;  3K1M A;  3GFL A;  1R1T A;  2CSO A;  1FY7 A;  4P55 A;  2KIU A;  4G7O F;  3K2Z A;  5D6E A;  3ZQ7 A;  3E3V A;  3IRQ A;  1K79 A;  3O2P E;  3JAM K;  2DBB A;  3ECH A;  2DT5 A;  4ON0 A;  1IUY A;  4LK0 F;  3CTA A;  2YSR A;  3E6M A;  1R00 A;  1O7L A;  2ESH A;  2ZNY A;  1YW7 A;  3IKT A;  3MEX A;  4BHB A;  3HRU A;  3R61 A;  2Z3Y A;  1QBJ A;  1IW7 F;  4EVI A;  1B6A A;  4MQ9 F;  3KP2 A;  4ENK A;  2XKP A;  1YIO A;  1IN5 A;  4QLC U;  2E1N A;  1G3T A;  4HDV A;  2V1D A;  1FOK A;  1LJ9 A;  3MAJ A;  4RS8 A;  2A3S A;  1ODD A;  3Q9S A;  5DCM A;  2ISY A;  2BYV E;  4RB2 C;  2WC2 A;  3BRO A;  5TRD A;  3W6J B;  4HF1 A;  4ZYG A;  4M9S A;  1K78 B;  4MHG A;  3WTW C;  4O3M A;  5D5U B;  5E8I A;  4GCV A;  1KA8 A;  2OU2 A;  2H27 A;  5TJJ A;  1FYK A;  3C18 A;  1O3R A;  4A2U A;  1FX7 A;  3Q9V A;  4GXO A;  2K86 A;  3WE2 A;  1SD6 A;  5DD4 A;  5FLX Z;  1P6R A;  4HAM A;  5E20 A;  1IN4 A;  1CF7 A;  3U2R A;  4HOB A;  2G7H A;  5L3B A;  1KGS A;  2IW5 A;  1K6O A;  2XAF A;  1YW8 A;  4GGG A;  5DV5 A;  2H09 A;  1ZHF A;  2EK5 A;  3RYR A;  3V4G A;  3V8L A;  1HST A;  2XAG A;  4P5O A;  3DPL C;  3KCC A;  4B8X A;  5DCF A;  5LBQ A;  1SAX A;  4AVP A;  3WE3 A;  1UST A;  1FP1 D;  3K0L A;  2PMU A;  5CLS A;  1G6N A;  2LSO A;  2P4W A;  1I6X A;  1DPR A;  4UV8 A;  5JVT A;  3EET A;  4RAY A;  2EFQ A;  2A6E F;  2NYX A;  3HYI A;  1W5T A;  3V8J A;  5EEH A;  1TQM A;  2STW A;  2CYY A;  2QBY A;  1LDD A;  3FXU A;  2PQ8 A;  3CUQ B;  2DK8 A;  3KET A;  3TDZ C;  3I0T A;  5AON A;  2XAQ A;  2GIV A;  1MJ9 A;  3ZN1 A;  3ZMD A;  1G4D A;  1XMA A;  3BDD A;  4L5J A;  2G7U A;  1ZLK A;  1XDU A;  3ECO A;  2ZO4 A;  3IHU A;  3FM5 A;  1LDJ A;  4L9N A;  5J8C A;  2VN2 A;  4I2O A;  2K02 A;  4DNC A;  2M1B A;  3P9I A;  5E17 F;  3LAP A;  5K1Y A;  1J7K A;  1FT9 A;  4FHT A;  5DEQ A;  2IA2 A;  3SXY A;  3KFW X;  4HF0 A;  1QQI A;  3U9G A;  4O6J A;  3HRM A;  3CUO A;  1L3L A;  3J81 K;  1WI9 A;  4WXD A;  3GFM A;  3T8R A;  3HSR A;  4M6Y A;  2STT A;  1BJA A;  1XN7 A;  3BP8 A;  2FNA A;  4KMF A;  4UVC A;  2J5O A;  3RKX A;  5E8G A;  3M9A A;  1TW3 A;  2P5K A;  2L54 A;  4UVB A;  3QP5 A;  4CDG A;  3ZMS A;  4A0X A;  1ZG3 A;  4GYG A;  1G3W A;  4ESB A;  4NHJ A;  4CYD A;  1LNW A;  5L3G A;  5HLI A;  3QPH A;  4G6D A;  2K4J A;  5DD8 A;  1ZAR A;  1P2F A;  2XAH A;  1ZRD A;  5IT9 Z;  2QLZ A;  1J9I A;  1TQP A;  4L18 B;  3GEZ A;  2R7D A;  4WK8 F;  4RB0 A;  4Y13 A;  3MZY A;  2XRO A;  1HW5 A;  5BPD A;  1P4A A;  2BE5 F;  4U7D A;  1FYL A;  3QPT A;  4HX7 A;  4MTD A;  4YFX F;  1XGS A;  3CO7 C;  4ETS A;  3WTZ A;  2DPU A;  4LB6 B;  3E97 A;  4OIN F;  3GLX A;  3ZN0 A;  2RC4 A;  2RVC A;  5K5O A;  1OKR A;  2OBP A;  2QZ8 A;  2PJP A;  3KLN A;  3ZMT A;  3FF5 A;  2HTS A;  1Z6R A;  3JSP A;  1A04 A;  2NAZ A;  1REP C;  1S8N A;  2FSW A;  3VOE A;  1FZP B;  4KIG A;  3ROU A;  1TLH B;  2QUF A;  4E70 A;  2UXX A;  5D4R A;  2O6G E;  3GZ5 A;  4WF2 A;  3P9C A;  2QBY B;  4XRF A;  2PEX A;  4IHT A;  1S6L A;  5L3E A;  4A5N A;  3U1D A;  1Q1H A;  5FFX A;  1B9N A;  3R60 A;  2EFP A;  5IT3 A;  4LLG F;  4KNY A;  3EUH A;  2JRT A;  5DUK A;  3JAM Z;  3HTU A;  3LA2 A;  2W84 A;  2XV4 S;  4IHS A;  3T5X A;  4CHU A;  3LA7 A;  4N0B A;  1R1U A;  2PMH A;  5BPI A;  3B02 A;  5HDN A;  1YLF A;  3F6O A;  3DQV C;  2P7V B;  1BM9 A;  4B09 A;  3LQR A;  4HQM A;  2VON A;  1XSV A;  1H9G A;  2BGC A;  4BHC A;  3GFI A;  3BJO A;  4BXU A;  3CLO A;  1WSU A;  3JTH A;  2NS0 A;  1UHW A;  1FSE A;  2BEO A;  1T0F A;  2ZNZ A;  2PI0 A;  2R7F A;  4PCQ A;  1KU2 A;  5CVR A;  3G3Z A;  1BOA A;  3F23 A;  5HS8 A;  2F5E A;  1KU7 A;  5JHU A;  1T6S A;  3BJ6 A;  3WGH A;  2XIG A;  2G9W A;  2VXZ A;  2DU9 A;  2O03 A;  2FXA A;  2NRA C;  1FP2 A;  3E6B A;  3FMR A;  4KN7 X;  4UV9 A;  1YO5 C;  4O5V A;  2EJR A;  1FPQ A;  1QZZ A;  3DXJ F;  3L2C A;  5HDG A;  4XSZ F;  4M6X A;  4Q4Z F;  1OYY A;  2GWR A;  2QYO A;  2MH2 A;  2FF4 A;  1YFH A;  4R1H A;  1ZAO A;  1PP7 U;  3VOD A;  2HWV A;  1BBY A;  1U6G A;  4N9H A;  2Q0O A;  1T98 A;  4Z2Y A;  3WTV C;  3TQN A;  1SD5 A;  2LNB A;  2R3S A;  5D8K B;  4M9X A;  2GQQ A;  5FFZ A;  3JSO A;  3BY6 A;  5DDG A;  3C7J A;  1PP8 F;  1B59 A;  4G9Y A;  3P9K A;  5D8L B;  1BC7 C;  1B1B A;  1K7A A;  1J2X A;  3I59 A;  2X0L A;  1LQ1 A;  2C6Y A;  1SFX A;  4YIF A;  1MDM B;  6PAX A;  2YX4 A;  2HKO A;  3QOP A;  3LWF A;  4ENM A;  4FX4 A;  2OZU A;  1W7P A;  3PQJ A;  2RGV A;  2HQN A;  5HVQ C;  2ISZ A;  3GYH X;  1ON2 A;  5L3C A;  3H3U A;  3SZP A;  3T8T A;  2NNY A;  1BC8 C;  1B9M A;  1ZG5 A;  1IN6 A;  4M71 A;  3O3K A;  1EV7 A;  2CQK A;  1STZ A;  3MWM A;  4DQ2 A;  5F64 A;  3R4K A;  5H6Q A;  1RUN A;  3F8B A;  1I27 A;  4D0P A;  3RYP A;  2VT3 A;  1U8R A;  5JFR A;  1EH8 A;  3HSF A;  4I09 A;  2OA4 A;  3DP7 A;  1X3U A;  4KIB A;  4EV0 A;  3BZ6 A;  1LEB A;  3H92 A;  3TO6 A;  3V7S A;  1T38 A;  3R0A A;  1MZB A;  2HQR A;  2K7L A;  2EA2 A;  1Z05 A;  2MLG A;  3HHH A;  3J80 K;  1XSD A;  3KLO A;  4HV6 A;  1OYW A;  4MGR A;  2BBY A;  1TBX A;  3NQO A;  3GUD A;  4L9V A;  4LG0 A;  3F8N A;  2EFN A;  2F5D A;  2TDX A;  4ESF A;  4OOI A;  1HKS A;  5AIQ A;  3FMS A;  4HF2 A;  4HQE A;  1ZH5 A;  4L0Z B;  3OV8 A;  1HBX G;  1GXQ A;  3W6K B;  3ELK A;  4BH9 A;  3FMQ A;  4L5I A;  3QP6 A;  1XD7 A;  2O3F A;  3HUG A;  1F9N A;  4HZF A;  1F1Z A;  3WOD F;  3T0Y A;  1R7J A;  4OMY A;  4N9I A;  4EGZ A;  3HOT A;  1O3S A;  4ZZD A;  1QNT A;  4GO1 A;  3DKW A;  1PUE E;  4RB1 A;  1HQC A;  2D45 A;  5E1X A;  4EJU A;  4YFK F;  3IWZ A;  1HW1 A;  5LGN A;  3HTS B;  1FNN A;  3BOQ A;  1UB9 A;  2HEO A;  2HFH A;  3BPX A;  1IXS B;  2Y0M A;  4WWC A;  2FEZ A;  1Z6T A;  4ZYH A;  4EJV A;  5K5Q A;  4EGY A;  1LVA A;  3TKY A;  2HZT A;  1IXR C;  1YQA A;  2OQG A;  3N4M A;  2ACJ A;  1R23 A;  1DDN A;  1EH6 A;  3TGN A;  1UFM A;  2D1H A;  1IRF A;  1U5T A;  5ILV A;  4LB5 A;  4IRH A;  4I0B A;  3FZV A;  2FA5 A;  3EDP A;  1BI3 A;  5CVJ A;  2JZY A;  2P7C B;  1I1G A;  3M1E A;  3ZMZ A;  2L3D A;  5ILS A;  3MZH A;  4LFU A;  3FXR A;  4ENN A;  4I7H A;  1KQ8 A;  2M45 A;  4IXA A;  1H0M A;  4HLX A;  5CVU A;  5BOX A;  3FWE A;  1MGT A;  1P4X A;  3LQQ A;  1P92 A;  3ABT A;  4WXC A;  4YFN F;  5LRR A;  4WX9 A;  1Z7U A;  3KEQ A;  2HGC A;  4XLP F;  3WTU C;  1S7A A;  2DAO A;  3L09 A;  3COA C;  2V1X A;  1SMY F;  1R5G A;  1FSH A;  2Q8K A;  1U5T C;  5D5V B;  5DCM B;  4KDP A;  3C3W A;  2WWY A;  3I5U A;  2PBI A;  4UNO A;  3WTS C;  2K4B A;  3VFZ A;  2GA1 A;  2E7X A;  5BQT A;  2VT2 A;  3S2W A;  2L4A A;  2ZBK A;  3L00 A;  2V9V A;  3E6C C;  4TV7 A;  3I71 A;  1QPM A;  1AOY A;  1IN8 A;  2ZME A;  3ML6 A;  4I02 A;  3GVA A;  3F72 A;  2FU4 A;  3M7G A;  2VOP A;  1PDN C;  2LDU A;  4GYI A;  1F5T A;  1CF7 B;  1BIB A;  3E5U A;  3KZZ A;  1TQI A;  2FML A;  2IA0 A;  5LLQ A;  2WV0 A;  4BNC A;  1JXS A;  3E5Q A;  4U88 A;  1V3F A;  2CWE A;  4HV5 A;  4HX4 A;  1R1V A;  3P7N A;  2EV6 A;  3FM3 A;  3F22 A;  1G3Y A;  1ONV A;  4IRG A;  4RAZ A;  1ZRF A;  4OIR F;  4G6Q A;  3Q5F A;  1KYZ A;  2M5W A;  4LLN A;  5FD5 A;  1FBS A;  2FOK A;  5BMZ A;  3K69 A;  3ISP A;  2Y48 A;  1XSX A;  1HXD A;  2FMY A;  1E2X A;  4CXF A;  2KIM A;  1RNL A;  3LA3 A;  3F21 A;  2DTR A;  4M9Z A;  2ADU A;  5LHI A;  1I1S A;  4XSX F;  2IPQ X;  4ZH4 F;  3QAH A;  3OOP A;  1ULY A;  3TOA A;  2GXB A;  2ESN A;  3I4P A;  3RTR A;  2YX7 A;  4PZJ A;  4Q5S F;  3WGG A;  1Z91 A;  3ZMV A;  2AS5 F;  2YU3 A;  1XCB A;  3KP4 A;  4CZZ A;  5AIP A;  4JBA A;  1MD0 A;  5A2Q K;  1WWX A;  4ZZL A;  3TOB A;  2DW4 A;  2IVM A;  3WGI A;  5E18 F;  2JT1 A;  3EQL F;  3HIF A;  2UWM A;  4NQW A;  1MKM A;  4WCG A;  4CGZ A;  3V7R A;  2DK5 A;  4Q47 A;  4NB5 A;  1FWZ A;  5L3D A;  4A6E A;  1R5H A;  3R0J A;  1ZYR F;  3NEU A;  1JE8 A;  2DPD A;  3I58 A;  4HA8 A;  4R79 A;  4P9F A;  2HR3 A;  2Q2E A;  1UHM A;  1SD4 A;  2IT0 A;  1D8K A;  1QO0 D;  2YPR A;  3ERE D;  1K78 A;  3B73 A;  5H6R A;  3KP3 A;  1T2K A;  2VBX A;  2NNN A;  4H0E A;  4Y17 A;  4MTE A;  1T39 A;  2EWN A;  4AIK A;  2WTE A;  1JHF A;  3ZMU A;  2X4H A;  1YTY A;  2XRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...