1TNSA

A novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MELWVSPKELANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel class of winged helix-turn-helix protein: the DNA-binding domain of Mu transposase.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Dna binding protein
molecule keywords MU-TRANSPOSASE
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1994-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tnsA00
1ULYA 2Y0MA 2ELHA 2IPQX 4ENKA 5E18F 2LKPA 5JR3A 4UXNA 3ZMSA 2ESHA 4AVPA 5D5UB 5E1ZB 3ISPA 4ESJA 2FMLA 1X3UA 4YG2F 2NNYA 1YO5C 4P9UA 5E17F 5LRRA 2L01A 2P5LC 3CJNA 1TW2A 6PAXA 4QLCU 1ZARA 3R61A 4ZZLA 4YIIA 3HHGA 1YTYA 3R4KA 3BJOA 2RC4A 5D5VB 3C3WA 5HOOA 3NEUA 3IKTA 1F4KA 4IRGA 2O61A 4MQ9F 5DD8A 1XGNA 1YFHA 4LLLA 1Z9CA 2CG4A 2XHKA 2KJBA 2VBZA 1K79A 1P4AA 1TW3A 1WRJA 1B6AA 3CUQC 5F1RA 2J5PA 3LQRA 1JHFA 2M45A 3R0JA 1PDNC 4LMYA 2ISYA 1S6LA 1FSHA 3HHHA 4A12A 3GFMA 1FWZA 1MDMB 1LEAA 3N97A 3WTTC 2LF7A 2EJRA 1CF7B 3RDIA 1U8RA 4ZZDA 2FF4A 1HW1A 1I5ZA 3IHUA 3E6DA 3L09A 3KP2A 2VODA 4MEYF 3K0LA 4CYDA 5EEGA 4KIGA 4IRIA 3M8FA 3HRSA 3RIRA 3WTWC 3W6KB 3LA3A 2UXNA 4RS8A 4TV7A 4GGGA 4E70A 2QBYB 3KEQA 4GYGA 3M1EA 3CO6C 4NHJA 2XAHA 3I64A 4OIRF 5ERIA 4L0ZB 2EV0A 1Z05A 4PGGA 1ZRCA 3L9FA 1LB2A 2KRFA 1IRGA 4EJOA 2RGVA 2A3SA 2O0YA 2VN2A 5BOXA 1T98A 4O5VA 3EYIA 2GIVA 2XAFA 2XVCA 4HF1A 3JW4A 4LD5A 1USSA 2M5WA 3Q9VA 4HF0A 4G7ZF 1AOYA 3I71A 3WGIA 1EH8A 2W25A 4LB5A 2COMA 2XKPA 2G9WA 5FGMA 5H20A 4WWCA 4UUVA 4L9NA 3WGHA 2VT3A 1RZ4A 3MWMA 1IN4A 4AWXB 1DPUA 5FFXA 4MTDA 5LEJA 5BMZA 2JPBA 1S7OA 4IVNA 1BIBA 1ZG1A 2YR2A 3J80K 4HOBA 4HDUA 5D5WB 2RV8A 2ZXJA 3BWGA 2BEOA 3I0TA 1V4RA 3P9IA 1J75A 4CICA 2VC0A 1BI2A 2OQRA 1R36A 1KU9A 3BJ6A 2ZMEB 1ZG5A 2XRNA 2EFOA 3N4MA 4ZH4F 5KK1A 1HW5A 2DW4A 4EM0B 5EEHA 2ETHA 2KIFA 2OBPA 2STWA 5E1XA 3LFKA 3JAMK 1JGSA 3FXQA 4LG0B 2J5OA 4ON0A 1FBUA 3KZZA 1P92A 2W24A 2HWVA 5BS6A 1HXDA 2XIGA 3R60A 3V7SA 3TQNA 4MNUA 2ZNZA 4I7HA 3KP4A 3ZMZA 1ZGAA 2LDUA 3DFGA 2STTA 4HX8A 3CO7C 2DBBA 3L7WA 4OIOF 1TNTA 1RUOA 2ZCWA 3O2PE 4RB1A 1R00A 1FLIA 1SFXA 1W7PD 5TJJA 3SFZA 3AAFA 1ODDA 1YW8A 2OZUA 2FBIA 5HVQC 4UV9A 3F8BA 2PBIA 5J8FA 4WXHA 3E6CC 1K78B 2M8EA 2H27A 2Y48A 4KN7X 3ML6A 4AIJA 4KT5C 2X0LA 3KP7A 3SZPA 2V1UA 5K5OA 3LA2A 3FZVA 1LDKB 2PFBA 3BZ6A 2ZBKA 1HSJA 1LQ1A 5HDGA 1WI9A 4A6DA 1K7AA 1DP7P 3ZPLA 3FHZA 3EQLF 4PCQA 2QBYA 4ZYDA 2XAQA 5ICCA 2MD5A 4OIQF 5D6FA 4OINF 5FFZA 3PQJA 1DPRA 5CJ9A 1TLHB 4U7BA 4ETSA 2YU3A 4A6EA 1OYWA 2RN7A 1ZG3A 3HSFA 3WTSC 3B02A 4EJVA 2V6CA 2G7HA 4L18B 5LBQA 2PN6A 2EA2A 3WTVC 4LLNA 3T0YA 2PEXA 1WSUA 1MGTA 5JHUA 4BHCA 3WTUC 3GFLA 3VOEA 3TDUC 2IRFG 2RNJA 1IUYA 2DI3A 5A2QK 2Q0OA 3GVAA 3RJPA 1XMKA 2EK5A 2EB7A 3HTSB 1XDUA 4IRHA 2IT0A 1FC3A 1BN5A 1YW9A 3F8MA 3RYRA 3D5LA 1A04A 1KQ0A 3I5UA 2BBYA 1F1ZA 2EFQA 4HV5A 2NNNA 3MQ0A 3SZTA 1JHHA 5LLQA 5H6RA 1G3WA 5JFRA 1U5TC 1TQIA 3BROA 5AIQA 1U3EM 2DO7A 3ZMTA 3RI4A 2L02A 2IW5A 3RYPA 2GXGA 3ZQ7A 4HYEA 3H3ZA 4RB3C 3RKYA 1PP8F 5HS8A 2IA2A 3J80Z 2E1NA 1O3QA 4JBAA 4MGRA 1U5TA 2F5EA 5ILVA 2DTRA 3LAJA 4M9XA 3QP6A 4ZYGA 4R1HA 4XBFA 1KU3A 1D3YA 3QPTA 5LEKA 5L3FA 3T1BA 5HLHA 4HF2A 3CLOA 1OPCA 3E5XA 5LRSA 3J81Z 1DUXC 2P7VB 1K78A 1LVAA 2RKHA 4B8XA 1I6XA 2MH9A 2PMUA 3REOA 4A2UA 4RAYA 3T5XA 2HR3A 2WV0A 3FMSA 4HAMA 2Z9OA 4RAZA 2H6BA 5L3CA 1YS7A 4CXFA 4AD9A 2HDCA 1W5TA 2VOOA 2JZYA 2L54A 2YX4A 1FBQA 3WODF 4YFNF 2CWEA 1BM9A 4EJWA 1IRFA 3FF5A 3WE3A 1ONVA 2D45A 1J2XA 1BC8C 1REPC 4M73A 4CHUA 4GO1A 3E5QA 2P6SA 3ECHA 4L0YB 2OD5A 4I0BA 2HYGD 5DD4A 1KU2A 1HBXG 1XGMA 3V8KA 2BGCA 4P55A 5FLXZ 2A07F 1LJ9A 1T6SA 3LQQA 2A68F 1XN7A 2HTJA 4CO8A 4N9HA 1TNSA 4BQAA 4Q48A 1T39A 2ZMEA 3F8FA 2HTSA 5LHGA 4OMYA 1FNNA 4HX4A 2F2EA 3BY6A 3DQVC 1FYLA 5DYMA 3EDPA 2LSOA 5L3GA 5ICGA 2QM3A 5HLGA 1KQ9A 1YG2A 2MA3A 2NRAC 2CYYA 5D5XB 1U6GA 4I2OA 1J7KA 1S3JA 3FXUA 5E1WA 5CVVA 2FNAA 5DUKA 1UCRA 4CDGA 1LDDA 3HUGA 1IZ1A 3D0SA 4WCGA 3KZYA 5K5RA 2DFIA 2FMYA 4PDKA 1J5YA 1XGOA 4UV8A 3ZMUA 4Y17A 4U7DA 4M6YA 5DV5A 2F5CA 3LSTA 1S8NA 2P5KA 1ZRDA 1EH7A 3GLXA 2O03A 1BI1A 1W4MA 2ZNYA 2ISZA 4CGZA 1LNWA 1L0OC 4A5NA 4LJZF 1TBXA 3GFIA 4KIFA 3ECOA 5LGNA 3KLOA 1SFUA 1R1UA 3FXRA 5AIPA 1HQCA 2HS5A 1O3RA 3R0AA 5FO5A 5JVTA 5IT3A 3BPVA 2HFHA 1MJAA 3L00A 2HKXA 3FWEA 1F9NA 1QQIA 3E6BA 2A6HF 3P7NA 2K4BA 3GO5A 3HIFA 2CO5A 1OR7A 3JTHA 2QYOA 1IN8A 2QQAA 3GFJA 2QZ8A 3C18A 5BPIA 3FM3A 2L4MA 1R5GA 2VOPA 1QZZA 3QP5A 4Y13A 4UVAA 3MFKA 3E3VA 3TKYA 3BP8A 3HTUA 3IRQA 2JRTA 4BAYA 2K4JA 3E97A 2W85A 3EETA 2ZJ2A 5ICEA 1DDNA 5JI6A 2BV6A 1AWCA 4KYWA 2YX7A 2CQKA 2E7XA 2QENA 4EM1A 5KVRA 5HLIA 3QPHA 1UB9A 5AONA 2V79A 3P9KA 2E7WA 3OV8A 5DEQA 1Z1DA 2DU9A 3Q9SA 4EM2A 4BNCA 1ZH5A 5FLXK 4I02A 3VODA 1ZAOA 4NB5A 1FP2A 2FSWA 3QAHA 1IXRC 4OU0A 2CFXA 2VBXA 3VB2A 3VFZA 2O3FA 1IAWA 1E17A 3QU3A 2PLYA 1W7PA 2HGCA 1IN5A 5D4RA 4CZZA 2R3SA 1ZHFA 1G6NA 5CYVA 1BBYA 1YLFA 3VEPA 2HEOA 5K1YA 3K2ZA 3DF8A 3DXJF 1TQPA 2UXXA 5E8GA 4G7OF 5J6XA 1H0MA 2GA1A 2VE9A 1CGPA 4PGHA 1U5TB 4G6QA 3H3UA 4M9ZA 3WE2A 2KIUA 1ZLJA 5K5QA 1W7PB 3GEZA 4MQVA 4JK1X 4HQMA 2OU2A 1FZPB 4BHPA 4O6JA 2ESNA 1ZRFA 2QUFA 5ED4A 5ICFA 2PJPA 3SQNA 3JSPA 2HQRA 4L5JA 4BYYA 2GXBA 3F8NA 4B09A 1S29A 1TQMA 3J81K 4UNOA 5CVRA 4F7ZA 1Q1HA 4KUMA 1HKQA 4MEXF 4ESFA 3MZHA 3K1MA 1FYMA 3F22A 4HQEA 2F5DA 2XV4S 1FBSA 2FE3A 3U9GA 4KICA 3ULQB 1I1SA 2FBHA 1IXSB 4IHTA 2CSOA 2CW0F 2LF8A 3HOSA 3JTGA 4HW0A 1ON2A 3MZYA 4I98B 4FX4A 4I0AA 4M72A 2FU4A 1J9IA 1IW7F 1J0RA 3O6BB 2GQQA 1YW7A 3V8JA 3IKVA 2Z3YA 3TO6A 1XCBA 3IWFA 3ERED 1SD5A 2YPRA 3BOQA 1G3YA 2GAUA 1I1GA 3KFWX 4NQWA 5LGTA 1BC7C 2P5VA 3KP5A 1G3SA 3O3KA 5A2QZ 1XSDA 1QBJA 4WK8F 3GF2A 2IP2A 2FXAA 3U1DA 2XUBA 1W5SA 1XGSA 3F23A 1O3TA 1YIOA 4Q4ZF 2VT2A 3WU1B 2XROA 4N9IA 1XCVA 3T8RA 4Q5SF 2H94A 5DDGA 2HKOA 1FPQA 5HS7A 2P4WA 4U88A 5DCMB 1XSXA 2DT5A 4RGRA 1YQAA 2WWYA 1R1VA 5D8KB 4I01A 5CVUA 2KIMA 4EQQA 2FNPA 4XLNF 2M30A 1ZLKA 2VBYA 1XMAA 5FD5A 1LEBA 3W6JB 2F5FA 2DAOA 4LB6B 4ESBA 3COAC 1FT9A 1MJBA 4WXDA 4L9VA 2WTEA 3HRMA 3V8LA 3WGGA 3RTRA 4RB2C 1FOKA 4LGWA 1BIAA 1XB4A 4LLGF 1HKTA 2OAZA 3KETA 1XSVA 3K1NA 2HOEA 3DEUA 4S05A 3V7RA 4BXUA 5D4SA 5HS9A 1PUEE 4RGUA 3RKWA 3WU0A 4HV6A 4L9TA 2DK5A 4GCVA 3M9AA 2P7CB 1RNLA 2CGPA 4P9FA 2R7FA 3Q5FA 2PMHA 1WKMA 2JT1A 3CDHA 5DCMA 4ASNA 4EV0A 2FQ3A 5HDNA 2C6YA 3ZN0A 2D2WA 3KP6A 2HZTA 4HZFA 4ZYEA 4LK0F 3K9TA 4U0VA 4YFXF 2VE8A 4RB0A 4BHBA 4WF2A 2NS0A 2IVMA 1MKMA 3HYIA 4KNYA 2RDPA 3H92A 2KKOA 4ENNA 2DQLA 2A6EF 2BYVE 1GXPA 2V9VA 2FRHA 1KA8A 2QLZA 5F64A 4A5MA 3E6MA 2E1CA 2GA2A 5LHHA 4D0PA 5CLSA 1FX7A 2QWWA 2ZKZA 2HYFA 2QQ9A 3C1DA 4R8HA 2ADUA 1B9NA 3S2WA 1RUNA 2GWRA 2D1HA 2P6TA 3LAPA 2R7DA 3WTZA 4A0ZA 1H9TA 2JSCA 3WTXC 4AIKA 3ROUA 1SD7A 1NHAA 1R23A 1J59A 1Z6TA 1O7LA 1IXCA 2HQNA 1SMYF 1QPMA 2MBFA 3EYYA 2X4HA 3QRFF 3E5UA 4HDVA 4OMZA 3I4PA 2PG4A 2V1XA 3HSRA 4DQ2A 1FY7A 5DCFA 1B1BA 5E8IA 3HRUA 1YYVA 3ABTA 1OMIA 3QOPA 5CVIA 5IT9Z 3JAMZ 4G6DA 3TO7A 2IA0A 3TOBA 1QNTA 1O3SA 2VBWA 4LFUA 4A0XA 3I53A 3GUDA 2M1BA 1IF1A 1O7FA 3KLNA 1YS6A 4UHTA 4U0YA 1CF7A 1IN6A 4UVCA 3V7CA 1MDMA 4GXOA 1FYKA 1FSEA 4HLXA 3ABUA 3FMQA 4XLPF 4GYIA 2DQRA 2Z99A 2AS5F 3R6SA 4Z2YA 4BH9A 3MAJA 2NYXA 1S7AA 4HX7A 3GYHX 1B9MA 2QVOA 3C7JA 5D6EA 4KN4X 1U78A 5IT9K 3M8EA 5J8CA 3MEXA 2K27A 4KFCA 1GVJA 3ZMDA 4RGSA 1Z7UA 4FHTA 2UZKA 3DP7A 4RGXA 2OQGA 2EFNA 1USTA 4M6XA 1C0WA 3GXOA 2DPDA 2ZFWA 2EV6A 1Z91A 3WG9A 1G4DA 2YSRA 1BI3A 3F6OA 1HKSA 3ZN1A 3T8TA 4OOIA 2Z5UA 3PQKA 1IN7A 1G3TA 1P4XA 2MC3A 1KQ8A 4N0BA 2JTVA 4G7HF 1EH6A 3ELKA 1FP1D 4LK1F 1ON1A 4KMUX 3IWZA 3NQOA 2W84A 5BQTA 3DPLC 3BJAA 2L4AA 1XD7A 2BE5F 3KEOA 3J7AO 1VTNC 1STZA 3CTAA 2Q8KA 3KE2A 4MHGA 4KIBA 3FMRA 4L5IA 2OZ6A 4DNCA 4KA4A 1WWXA 4EGYA 3FM5A 3F6VA 1T0FA 5L3DA 4YFKF 3BPXA 2EWNA 2D1VA 2B0LA 1RIOH 3GX4X 2A5YB 4EVIA 1PP7U 2VONA 2VXZA 3DKWA 2A69F 4LG0A 1SAXA 3G3ZA 1T2KA 4EMSA 1ZN2A 4S04A 2Z33A 1JE8A 5F6FA 3SHFA 1EV7A 4M9SA 4WX9A 4KDPA 1F5TA 1R22A 4ENMA 1BOAA 3TGNA 4EJTA 4OIPF 2XAJA 4M74A 3BDDA 2IA1A 3L2CA 2EFWA 2V1DA 1B4AA 3ZMVA 1E2XA 1D8JA 1UFMA 3V4GA 4IF4A 1D8KA 1R5HA 1KYWA 3I54A 2A61A 3SXYA 5FD6A 3ZP5A 3K69A 3HOTA 3MCZA 2IJLA 3I59A 2XASA 4ZYHA 3LWFA 3CUQA 1P6RA 1K6OA 5CVJA 2Q2EA 4YIFA 4XRFA 4WXCA 3U2RA 4A0YA 1ZREA 1LDJA 1Y0UA 3IRRA 1P2FA 2K7LA 1WQ2A 3PFIA 2TDXA 4O3MA 1MJ9A 4EGZA 2GZWA 1R7JA 1BI0A 5LGUA 2ZO4A 4HLYA 2W57A 5FB2A 2ACJA 2XKOA 3JSOA 3GZ6A 3EUHA 1HSTA 4G8XA 1KU7A 1V3FA 2QQBA 2DPUA 4UVBA 3G73A 3I58A 2K02A 4P5OA 2MLKA 1OYIA 2G7UA 1SFEA 2NAZA 4U0WA 3GWZA 4IPAA 4G9YA 1QO0D 2P8TA 1I27A 4IJAA 3HRTA 3F72A 3M7GA 3OOPA 3GW2A 1D5VA 5D8LB 5LHIA 4IHSA 2UWMA 3CUOA 2O8XA 4R79A 5ILSA 5HDKA 1GXQA 3IL2A 2EA4A 4ENJA 2FOKA 4I09A 2K86A 1OYYA 3FX3A 4G94A 3I59B 2Y75A 3F3XA 1H9GA 4AIHA 1OKRA 1MD0A 4QWQA 1L3LA 5DUIA 3IC7A 4MTEA 2XGXA 2M87A 4HBLA 1O57A 1Z6RA 2VC1A 3TO9A 4FX0A 1HW2A 2RVCA 1T38A 1KYZA 5L3EA 1UHWA 3B73A 2EFPA 1ZGJA 1KGSA 2DK8A 3CUQB 3RKXA 1SD6A 2EV5A 3NRVA 3LA7A 1JXSA 4Q47A 2FA5A 2RQPA 4JQFA 4L9JA 2KJCA 1TTYA 4XSZF 5TRDA 5E20A 5L3BA 1UHMA 1MZBA 3TDZC 4FT8A 3WTYC 3QU6A 2O6GE 4HA8A 4M71A 5ILUA 2AXLA 3RPUA 1ZYRF 4H0EA 4Y15A 1U2WA 1SMTA 1P4WA 2PI0A 3KP3A 1R1TA 4XSXF 1RI7A 2L3DA 2PQ8A 2FBKA 3F8CA 1BJAA 3RPQA 5BPDA 2MLGA 4K2EA 3P9CA 4KMFA 2XAGA 4PZJA 1GHCA 1B59A 2FEZA 2OA4A 2MH2A 2WC2A 3DV8A 3KCCA 4IXAA 5H6QA 3TOAA 2JPCA 2LNBA 4EJUA 2DLLA 1QZYA 3K1PA 3F21A 1QGPA 2H09A 3DPTA 1SD4A 3HSEA 4P96A 1XDSA 2H6CA 1R58A 3GZ5A
chains in the Genus database with same CATH superfamily
1ULYA 2Y0MA 2VKHA 2ELHA 2IPQX 4ENKA 2ZSIB 5E18F 2L7FP 2Z16A 2LKPA 5JR3A 1RESA 4UXNA 3ZMSA 2ESHA 3QYFA 4PSXA 4AVPA 5D5UB 3PNYA 5E1ZB 1YJ9I 3M1CA 4CCOA 3ISPA 2LP0A 4ESJA 5IP9J 2FMLA 1X3UA 4NUBA 4YG2F 1RKWA 2HVQA 3K6GA 2NNYA 2HOAA 1YO5C 4DYQA 1BR4A 4ITVA 4P9UA 5E17F 5LRRA 1RR8C 2L01A 3EUKL 1YOVB 3SEZA 3RSNA 2P5LC 3CJNA 1QVUA 4NDLA 2M0MA 1TW2A 6PAXA 1MMSA 4PFOA 1X19A 1VQ5I 4QLCU 1ZARA 3R61A 4ZZLA 3S93A 4YIIA 2CMPA 3TL4X 4S0HB 2LC2A 3HHGA 2DA1A 3QPLA 4I6ZA 1YTYA 3R4KA 3K4JA 4KT6A 3BJOA 3PNTA 1ETVA 1TWHJ 2RC4A 3OIQA 1Z7LA 3C3WA 5D5VB 5HOOA 2YU9J 1VQ8I 4C2TA 3NEUA 3H3VK 3IKTA 2R7VA 2KZGA 1F4KA 1HLVA 4IRGA 2O61A 4MQ9F 1SFOJ 3H0DA 3M07A 5DD8A 4OAZA 1XGNA 1YFHA 4LLLA 1Z9CA 1MNDA 2CG4A 4DZPA 2IGMA 2XHKA 2KJBA 2VBZA 3ZOBA 3KIOA 1K79A 5FKMA 4BEHB 1P4AA 1TW3A 2LD5A 2M3AA 1WRJA 2EZKA 1B6AA 3CUQC 4XLFA 5F1RA 3B6AA 1U9OA 2J5PA 3LQRA 2NVUB 1JHFA 2M45A 3Q0UA 3LMMA 3R0JA 1PDNC 3F9KA 4LMYA 5IYCJ 2ISYA 3KYCB 4FE4A 2B63J 1GV5A 3BQZA 1Y8RB 4IL6C 1WFXA 1S6LA 2IS2A 1G8XA 1LE8A 3HDDA 4D5CA 5J1YA 1VI0A 1FSHA 1IJWC 3HHHA 2WAQA 3A1YA 3S1MJ 1JUPA 2VJ4A 2IEKA 3CP2A 4A12A 2TRTA 2H8WA 3GTMJ 3GFMA 2E71A 1FWZA 1MDMB 1LEAA 1T08B 3N97A 4A3DJ 2DYSH 1BW6A 3WTTC 1D0XA 2LF7A 5M3MJ 2EJRA 2JUGA 4P1WA 1CF7B 1UELB 3RDIA 1U8RA 1BL0A 4ZZDA 2FF4A 1HW1A 1I5ZA 2OJED 1W0TA 4BXXJ 3IHUA 4RLQA 5J4YA 5M3FJ 3OS2A 2E2JJ 3GTJJ 2TCTA 3E6DA 3HPGA 3KP2A 3L09A 4MEYF 2VODA 3K0LA 4CYDA 2GLOA 1ZTRA 5EEGA 3S16J 1S5LC 2Z2SB 3M8FA 1V54H 4KIGA 4IRIA 3HRSA 3HM5A 3RIRA 3WTWC 3W6KB 3LA3A 1BJZA 2UXNA 4RS8A 3S1RJ 3IH4A 3K70D 4TV7A 4GGGA 4E70A 2QBYB 3KEQA 2DOAA 2VQLA 1TZLA 4GYGA 2QSHX 3ZRGA 1LKXA 1MIJA 1OCPA 5B3SH 3VYTB 3M1EA 3CO6C 2DYRH 4HSRA 4OWRB 4NHJA 2XAHA 3I3LA 3I64A 3G71I 2F4IA 4OIRF 5ERIA 4L0ZB 1B8IA 2KIQA 2EV0A 3G6EI 1Z05A 4PGGA 3ASNH 4BQOA 1TC3C 1OCTC 3L9FA 1LB2A 1ZRCA 3PSIA 2LVSA 2KRFA 3BCAA 3SDBA 1IRGA 3CDLA 4EJOA 2RGVA 5GADJ 3CCYA 4N4OB 1WGXA 2A3SA 2R5ZA 1IG7A 2O0YA 2VN2A 5BOXA 1T98A 2DMPA 3OYJA 1Y39A 4O5VA 1X1AA 2DXIA 3GMEA 2R7QA 3EYIA 3PJRA 1YX5A 4E7ZA 2GIVA 2XAFA 2XVCA 2OTJI 5DTDA 1Y1VJ 2QEXI 3GZNB 1YJNI 4HF1A 3BTLA 3JW4A 1PUFA 3CC4I 3HUGB 4LD5A 2XGDA 1USSA 3QPSA 2M5WA 3HGYA 3Q9VA 4HF0A 5DM6F 1Z77A 1VNDA 2RAEA 4G7ZF 1UJ8A 1AOYA 4LIUA 3I71A 4A3EJ 3WGIA 3LSPA 3FBIB 2ZFUA 1FTTA 1EH8A 2W25A 4LB5A 2COMA 1ZGWA 2XKPA 4E6KG 1JJ8C 4W1UA 1BR1A 3UNGC 1JUSA 2G9WA 5FGMA 3NAUA 5H20A 4WWCA 3K4LA 4UUVA 4L9NA 3WGHA 2VT3A 3A2KA 1WJFA 1RZ4A 3MWMA 1IN4A 4AWXB 1DPUA 5FFXA 3TBIA 4Y4RA 4D7MA 4MTDA 4Z6YA 2DMUA 1D1CA 4XLEA 5LEJA 4F52A 5BMZA 2OCEA 2JPBA 1S7OA 4RM3A 2IGOA 2M4KA 4IVNA 1BIBA 3HJEA 1ZG1A 2YR2A 2DDBA 3J80K 2NVYJ 1MH4A 2X85A 5FKKA 4D9JA 4HOBA 4D5FA 4HDUA 5D5WB 2RV8A 4XL9A 2ZXJA 1JI8A 3BWGA 2BEOA 2VJ5A 1V4RA 3I0TA 3P9IA 1E0EA 1J75A 2ID3A 4CCJA 3G2BA 4CICA 2VC0A 1BI2A 4QSHA 2OQRA 1R36A 1UHSA 2L9VA 1KU9A 5FROA 4BE0A 3BJ6A 4JX5A 2EPFA 5J1UA 4CYCB 4XLCA 3K4NA 2A6TA 4F3QA 2ZMEB 1ZG5A 2XRNA 2EFOA 4B48A 3OSGA 4J00A 3AL0C 1TWAJ 4MO7A 3N4MA 3CCEI 2VUMJ 3KYLA 4ZH4F 3P5JA 5KK1A 1HW5A 4BE2A 4E7HA 2DW4A 2VXDA 2JA5J 3UR3C 2GBYA 4EM0B 1VQ6I 5EG0A 4IOCF 1WHUA 5EEHA 2E1MB 3I9V2 1D1AA 2ETHA 2KIFA 1GLNA 2OBPA 5E1XA 3CMYA 2STWA 3LFKA 3JAMK 1JGSA 3FXQA 4LG0B 1HDDC 2J5OA 4ON0A 3FISA 4XLAA 1FBUA 4XKCA 4HEA2 3KZZA 4N4NB 1P92A 2HI3A 2W24A 2HWVA 5BS6A 4CCMA 1HXDA 2XIGA 3R60A 3V7SA 3TQNA 4ZDPA 4MNUA 1MMDA 3FHNA 5E79C 3UKGA 1PVEA 1FIPA 1XG1A 2KQRA 2PX9A 3DWLE 3ZQFA 2ZNZA 4I7HA 3KP4A 5GAGJ 1IUFA 3RKQA 2JK3A 3HKZN 3ZMZA 1ZGAA 4FE7A 2LDUA 3DFGA 2STTA 3BTJA 1ACIA 4HX8A 3CO7C 1ZELA 2DBBA 2CW8A 3FXOA 3L7WA 3ZR8X 3WHCA 5LFAA 4OIOF 1TNTA 3C2BA 1RUOA 2ZCWA 3LNQA 3O2PE 3SYTA 1OQYA 4RB1A 2VPLA 2ZJPF 1R00A 1FLIA 1SFXA 2HDDA 5C4XJ 1W7PD 5TJJA 3SFZA 3AAFA 1ODDA 1YW8A 2OZUA 5IOZA 5HNHA 4UUSA 2FBIA 3CJTB 1GVDA 5HVQC 4UV9A 2KRCA 1JKPC 3VWBA 3F8BA 1VQ9I 2PBIA 2M0CA 3JRBA 3GCMA 5EZHA 5J8FA 4WXHA 3E6CC 1K78B 2M8EA 3DCFA 1QA6A 4U87A 4X0GA 2H27A 2Y48A 4KN7X 4CH7A 3ML6A 4YELA 4BEHA 2QCOA 1ITYA 5GTIC 4AIJA 4KT5C 2X0LA 3KP7A 2V7FA 2FQ4A 3SZPA 3C2GA 2V1UA 5K5OA 3LA2A 3ZCOA 1B72B 2L2OA 1I6HJ 3FZVA 1AU7A 1LDKB 3K2AA 2PFBA 4MIMA 3BZ6A 4FASD 2ZBKA 2LKXA 3OYEA 2LYCA 1DGRM 3OYLA 1HSJA 3BR6A 3KPHA 1NTCA 1LQ1A 3D1NI 5HDGA 1R9TJ 1GUUA 4E7LA 3OYCA 2GXAA 1WI9A 2W48A 4A6DA 1VF9A 3BTCA 1K7AA 1DP7P 1OCZH 3ZPLA 3FHZA 3EQLF 5B1BH 1D5YA 1U9NA 4PCQA 2QBYA 4ZYDA 4JX6A 2XAQA 2RNGA 3VPRA 5ICCA 2MD5A 4MLOA 3H9GA 4XLHA 3GTQJ 4OIQF 2FJ1A 1VQKI 5D6FA 4EATA 4OINF 1EKEA 5FFZA 3PQJA 2BHZA 3JRCA 1DPRA 5CJ9A 1TLHB 4U7BA 4ETSA 2YU3A 2W82A 1MBEA 3L2WA 4A6EA 5FLMJ 1N25A 1OYWA 4XONA 2RN7A 3HG9A 1ZG3A 3H9JA 1VQNI 3HSFA 3WTSC 1AA7A 1NG7A 3B02A 4EJVA 2V6CA 2BHYA 2G7HA 4L18B 5LBQA 2XB0X 4NC8A 3OS0A 2PN6A 2EA2A 2QKLB 3WTVC 4LLNA 3T0YA 1TWGJ 1P7IA 2V9KA 2PEXA 1WSUA 3GTKJ 1MGTA 2W4SA 4L5EA 2XF7A 3J7AY 4BUPA 2K9QA 2BY2A 5JHUA 4BHCA 2DT7B 1OFCX 2XF5A 3SEQA 3WTUC 3FK6A 3GFLA 3VOEA 4M3DA 4ZC3A 3TDUC 2IRFG 3CESA 1OLTA 2K5CA 2W00A 2RNJA 1IUYA 2DI3A 5A2QK 3OS1A 2Q0OA 2R7OA 4BQQA 3GVAA 3RJPA 3ZQCA 1XMKA 2EK5A 2EB7A 3K4BA 4F55A 4B43A 3HTSB 1XDUA 4V19K 4IRHA 2IT0A 1FC3A 1X3ZB 2JA8J 1ZKGA 1BN5A 1YW9A 3F8MA 3RYRA 3BG7A 3D5LA 2JRMA 1A04A 1KQ0A 2E19A 3I5UA 2BBYA 3HC7A 3CLQA 3A01A 1F1ZA 2EFQA 4HV5A 4PFPA 3QYBA 2NNNA 2OCCH 5TISC 3MQ0A 3SZTA 1Y8QB 1E3HA 1JHHA 5EEAA 4IKFA 5LLQA 2I5UA 1G3WA 3DBHB 5H6RA 5JFRA 1U5TC 2R5YA 1TQIA 3BROA 5AIQA 2XRLA 1IGNA 1E3PA 4Y52J 5IOYA 2E36A 1U3EM 4FCYA 3S3OA 4AYBN 2DO7A 3BQYA 3JR9A 3A4CA 3ZMTA 3RI4A 5F0CA 4BKXA 2L02A 2IW5A 3RYPA 2NS7A 2X48A 3S8PA 4IHWA 2GXGA 3ZQ7A 3RPUD 4HYEA 1ENHA 3OYFA 3H3ZA 4RB3C 4ZDLA 3RKYA 2ELJA 3W3CA 2KFDA 1PP8F 1V5EA 5FKOA 1YJWI 1MMNA 3S32A 5HS8A 3CCLI 2IA2A 5M5WJ 3J80Z 2E1NA 4MFEA 1O3QA 4JBAA 2CQ7A 4MGRA 1U5TA 2F5EA 3S1NJ 5ILVA 3WHBA 3ZGKA 2HVSA 2DTRA 4IO9F 1K61A 4GDFA 2Y9ZA 3TP0A 2LK2A 3LAJA 4M9XA 3QP6A 1TL8A 4ZYGA 1IO2A 3I4MJ 4R1HA 4XBFA 1KU3A 1D3YA 4DYRA 3QPTA 2LREA 5LEKA 5L3FA 2AQFA 3T1BA 5HLHA 4HF2A 2DOEA 3WG7H 1T33A 3CLOA 1OPCA 3E5XA 4AC0A 1X4PA 2XDVA 5B66C 5LRSA 4XKBA 3J81Z 3MKZA 3LFUA 2IS4A 1MBJA 4B1RA 2X6YA 3PM1A 1DUXC 3GTLJ 1ETKA 3B6CA 2P7VB 1K78A 1LVAA 2RKHA 4B8XA 2JWTA 1I6XA 3BCBA 3QODA 4J19A 1A6IA 2ID6A 3FKIJ 1XPXA 2MH9A 4UUTA 2O8KA 4CCNA 4XMYA 4AYBA 4C3JJ 4F91B 2PMUA 3REOA 4A2UA 4RAYA 3T5XA 5JVGF 2HR3A 5IP6A 2R5YB 2WV0A 4BL0B 1JKQC 3FMSA 4IHVA 3C2HA 4HAMA 3L1PA 4HG2A 5FJ8J 2EZIA 2Z9OA 4RAZA 1JGGA 2H6BA 3G1MA 1VQ4I 5L3CA 1YS7A 4UUSB 1GV2A 4CXFA 4AD9A 2HDCA 1W5TA 2VOOA 3ZQHA 3OYNA 4W97A 3CCQI 2JZYA 2L54A 2YX4A 1FBQA 1EA3A 2L9SA 3WODF 1EJ9A 3DPUA 2Y30A 3BR1A 3ABKH 2LRDA 4YFNF 2G0EA 3BG9A 4PSWA 2LY9A 2CWEA 1DU0A 1BM9A 1ZK8A 4EJWA 4FTHA 2MW8A 2E2HJ 1IRFA 2GM4A 3FF5A 3WE3A 1ONVA 2D45A 1J2XA 2EIKH 1AHDP 1BC8C 1Q1VA 3OYAA 1REPC 4M73A 4CHUA 4GO1A 3VYSB 2LKSA 1ZQ3P 3E5QA 2HQAA 2IAIA 2Q1ZB 2JN6A 2P6SA 1MBGA 1NH3A 3ECHA 4L0YB 2OD5A 4BJTA 2DODA 4I0BA 5K7HA 3I55I 2HYGD 5DD4A 1K6YA 2Y69H 2A5WA 1Z67A 4PUSA 1MH3A 1KU2A 5HNFA 1HBXG 1XGMA 3V8KA 1QZEA 2BGCA 4P55A 5FLXZ 3BR3A 2A07F 3TEDA 1LJ9A 1T6SA 3LQQA 2A68F 2ZXWH 1XN7A 2HTJA 1X3WB 2VKDA 4CO8A 4C9YA 3CF2A 2OC6A 4N9HA 1HF0A 2CV0A 5KHDA 4EEFG 4RBOA 1TNSA 2I8DA 4BXFA 4BQAA 4Q48A 3RQIA 3HKZA 3OIPA 1T39A 2ZMEA 3HOWJ 3F8FA 3M3YJ 2CQQA 2HTSA 3NWTA 4V2FA 5LHGA 4OMYA 1FNNA 4HX4A 2F2EA 3BY6A 3DQVC 1FYLA 5DYMA 3EDPA 4BY7J 2LSOA 5L3GA 5ICGA 5C44J 5H2FC 3A02A 2QM3A 1TWCJ 5HLGA 3W2AA 1KQ9A 1YG2A 2MA3A 2NRAC 2WADA 2CYYA 3FK7A 5D5XB 3CCMI 2BVLA 1U6GA 4I2OA 1ORKA 1J7KA 1S3JA 3BG6A 3FXUA 5E1WA 3OY9A 4IZZA 4FQGA 5CVVA 2IXSA 2FNAA 5DUKA 2ZMEC 1ETQA 1UCRA 2OV7A 3KX2A 3LSKA 1LDDA 4CDGA 5EZGA 3HUGA 4F92B 1IZ1A 3D0SA 4WCGA 2HVRA 3KZYA 5K5RA 2DFIA 3OYBA 2BVMA 2FMYA 2Y9YA 4PDKA 5DM7F 2OUMA 2HOSA 1J5YA 1XGOA 4PJ0C 4UV8A 4AVZA 3ZMUA 4Y17A 2DA3A 2V4JC 4J01A 1A36A 4U7DA 2R7WA 4ZTFA 4M6YA 5DV5A 4M3GA 4KITB 2F5CA 3S2HJ 2E1OA 3LSTA 2NOGA 2R5ZB 1S8NA 2P5KA 1ZRDA 1EH7A 3L2VA 1G59A 1MNEA 5FKLA 3GLXA 2O03A 4G6TB 1BI1A 2MSYA 2L9NA 1W4MA 1H89C 2ZNYA 2ISZA 4CGZA 3MVPA 3PO3J 3CCVI 4M3BA 1W1WE 1A6QA 1LNWA 1L0OC 2VASA 4A5NA 3JRIA 4LJZF 1TBXA 2ECCA 2HDWA 3CMEI 3OOUA 2EQRA 2CUEA 3GFIA 3MN2A 4KIFA 3ECOA 5LGNA 1Z3XA 2YUSA 3KLOA 5KAIC 1V5GA 1SFUA 1R1UA 3FXRA 5AIPA 5DS9A 2BXYA 2R7TA 4XICA 1HQCA 2HS5A 1LUJB 1O3RA 2DJNA 3R0AA 5FO5A 5JVTA 5IT3A 3BPVA 2VQCA 2HFHA 1MJAA 2RREA 3L00A 2HKXA 4A69C 3FWEA 1F9NA 1QQIA 3BR2A 3DLAA 3E6BA 2A6HF 3H0GJ 4I99C 3P7NA 1WJCA 2VKEA 2K4BA 3GO5A 3HIFA 2CO5A 1OR7A 3JTHA 1N78A 2QYOA 2M7AA 2MYSA 4B3XA 2K9LA 2MD0A 1SANA 2CUJA 3OYMA 1IN8A 5E3OA 2QQAA 1Z3YA 2I10A 3PSFA 3GFJA 2X6WA 2QZ8A 3C18A 5BPIA 3FM3A 2NVQJ 2L4MA 1R5GA 2WY8Q 3OYKA 2VOPA 1QZZA 3QP5A 3HBLA 2BW3B 4UVAA 2X1DA 2EIMH 4Y13A 3MFKA 3E3VA 3H5NA 3TKYA 3BP8A 3M8JA 3HTUA 3IRQA 1VFCA 2JRTA 4BAYA 1IRZA 1A5JA 2LTPA 1IDZA 1F43A 4OAYA 4E7KA 3ZQQA 2K4JA 3E97A 3CMAI 4A3MJ 3CP8A 3LL7A 2W85A 3EETA 2ZJ2A 5ICEA 1DDNA 2COBA 5JLXA 5JI6A 2WAFA 2BV6A 1AWCA 4KYWA 2YX7A 2CQKA 2E7XA 3HEFA 2H1KA 4XN0A 1XX5A 3PNVA 2PMZN 5EF6A 2QENA 1LE8B 4EM1A 5KVRA 4ANJA 5HLIA 2ME0A 3JREA 3QPHA 1UB9A 3CQZJ 5AONA 2V79A 5FLVA 3P9KA 2E7WA 3IH3A 1BW5A 1I3QJ 4XK4A 3OV8A 5DEQA 9ANTA 2E35A 4Y7NJ 1Z1DA 2V1NA 2LY1A 2DU9A 1N75A 1VQMI 3Q9SA 1JKOC 4EM2A 4BNCA 1ZH5A 5FLXK 4I02A 3VODA 4A3GJ 3GTOJ 1W5CC 1ZAOA 1XTAA 4NB5A 1FOYA 1FP2A 2FSWA 1WJDA 3QAHA 5LD2C 1IXRC 3OWTA 4OU0A 2CFXA 2VBXA 1R4MB 3VB2A 4PJMA 3VFZA 5B5EC 3ASOH 2O3FA 1IAWA 1E17A 3QU3A 2NOJB 2PLYA 2HPMA 2OPTA 1W7PA 2HGCA 2DDAA 1IN5A 4CZZA 5D4RA 2R3SA 1ZHFA 1G6NA 3JCUC 2R4GA 4YIRX 4LITA 2DTZA 4RAFA 2R0QC 5CYVA 4XM3A 4RA2A 1YIJI 1BBYA 1YLFA 3Q0VA 3VEPA 1QPIA 2L5QA 2HEOA 5F04A 5K1YA 3ERMA 3K2ZA 3DF8A 3DXJF 4XN3A 1FMWA 4B4CA 2DCEA 2EH3A 1TQPA 2UXXA 3IH2A 5E8GA 4G7OF 1B8IB 2BY3A 5J6XA 1H0MA 3LSIA 3OYDA 3OYGA 2GA1A 1QVTA 2ZJQF 2VE9A 1CGPA 2ECBA 3LSGA 4PGHA 3CD6I 2VB6A 1U5TB 2XSJC 3O8GA 4G6QA 5JLWA 3H3UA 4M9ZA 3WE2A 2KIUA 1ZLJA 4C30A 5K5QA 1W7PB 3GEZA 2JA2A 4MQVA 4JK1X 4HQMA 2OU2A 1FZPB 1I3AA 4BHPA 2XAUA 4O6JA 2ESNA 3M4OJ 1ZRFA 2QUFA 5ED4A 2EIJH 4UY8I 5ICFA 2PJPA 3K4KA 1A31A 3CJQB 3SQNA 3JSPA 1HCRA 1B72A 5KNLA 1JT0A 2E34A 2VIXA 2HQRA 1AKHB 2NVXJ 4L5JA 2XF6A 5KAFC 4BYYA 1DU6A 4CA0A 2GXBA 2ZXHA 3RQ4A 3F8NA 4B09A 2X9DA 1S29A 1TQMA 3J81K 4UNOA 5CVRA 3S3NA 4F7ZA 1T8IA 2HYJA 1E3OC 4IEJA 2JJ7A 1R5ID 1YITI 4BBRJ 1Q1HA 4KUMA 5J4VA 3CF5F 1HKQA 3G4SI 1X1PA 4MEXF 4ESFA 3MZHA 1Y0NA 4II2A 1NK3P 1XC5A 3K1MA 1FYMA 3F22A 4DW6A 4A3BJ 2KMUA 4I76A 2X1EA 4HQEA 4QPQA 4A3LJ 2F5DA 5BNGA 2XV4S 4CCKA 1FBSA 2FE3A 3U9GA 4KICA 3F0CA 3ULQB 1I1SA 2FBHA 5IPAA 3BTIA 2H1LA 1IXSB 3DU6A 4IHTA 1RPWA 2CSOA 2CW0F 1FTZA 2LF8A 2VQHA 4XKVA 3HOSA 4F93B 3JTGA 2CV1A 2WY7Q 5M5YJ 2F6CA 2V9PA 1FOXA 1X1BA 1ETOA 3AKZA 4HW0A 2CV2A 1ON2A 2DT6A 5EG0B 3MZYA 4I98B 1WZ2A 3FKJA 4FX4A 4I0AA 5HLTA 4M72A 4NC7A 2FU4A 1FMVA 1MMGA 2O7OA 4LIVA 5GP9A 3DLLF 3HOYJ 1J9IA 1MNMC 1WCMJ 3CMMA 3LSHA 1IW7F 2F4MB 1J0RA 3O6BB 2GQQA 1YW7A 3V8JA 2FD5A 3IKVA 2Z3YA 3TO6A 1XCBA 3IWFA 3ERED 1SD5A 2WA0A 2YPRA 5IY5H 4ZJZA 5C3EJ 3BOQA 1G3YA 4HRIA 2GAUA 1I1GA 3O8HA 1R49A 3KFWX 4NQWA 5LGTA 1BC7C 4HPQA 2R7SA 2KISA 3JRDA 2P5VA 4E4HA 3KP5A 1G3SA 2B7EA 3ONQA 3O3KA 5A2QZ 1XSDA 1QBJA 2L0KA 4WK8F 2R7UA 3GF2A 1K83J 2IP2A 2FXAA 2K85A 4JP0A 5HODA 3U1DA 2XUBA 1W5SA 3OIOA 1XGSA 3S14J 1KZHA 1JUMA 1F36A 2KP6A 3SZGA 3F23A 1O3TA 1YIOA 4Q4ZF 2VT2A 2UV1A 3WU1B 2XROA 4N9IA 1XCVA 3T8RA 4Q5SF 3IAS2 2H94A 3QYEA 5DDGA 2HKOA 5K7ZA 1FPQA 5HS7A 2MFZA 2F4OB 2CU7A 2P4WA 2DA7A 2X51A 4U88A 3TW6A 3EUAA 5DCMB 3S1QJ 1XSXA 2DT5A 1WJ5A 3G1OA 4HSTA 1OJLA 4RGRA 1J09A 2EINH 2M34A 1YQAA 2WWYA 1R1VA 5D8KB 1U8BA 1W0UA 4I01A 3VSLA 5EGOA 5CVUA 3OR2C 1VQPI 3S2DJ 2KIMA 4BACA 2Z1DA 4Y33A 4EQQA 1X1DA 4IQJA 2FNPA 4YRVA 2ICWG 3WU2C 1T95A 2HQ5A 4XLNF 2M30A 1JKRC 1ZLKA 2VBYA 3E7LA 1XMAA 2DJIA 1UMQA 5FD5A 4ZDOA 1HDPA 5GTHC 1LEBA 3W6JB 2F5FA 2DAOA 2K9SA 4LB6B 4ESBA 3COAC 1FT9A 2AQEA 1MJBA 4WXDA 3FXJA 4L9VA 2WTEA 3HRMA 3V8LA 1QHHD 4PJNA 3WGGA 3RTRA 2JQ7A 5C4JJ 2PJRB 3H9QA 4RB2C 3A03A 1FOKA 3JRHA 4LGWA 2EZLA 1BIAA 1XB4A 2DFFA 4LLGF 1HKTA 3KEYA 2Q2EB 1ETXA 4C2MJ 4BS9A 2OAZA 3GLLA 3IP4B 4DIQA 3KETA 1XSVA 4CYCA 3K1NA 2KZVA 2WB1A 2HOEA 3DEUA 2ME6A 3VYUB 4S05A 4CSWA 3V7RA 2E5ZA 3D5RC 2ZJRF 2X1CA 4BXUA 5D4SA 3DTEA 4XRSG 4C2UA 5HS9A 1WH5A 1R71A 1PUEE 2HXIA 4RGUA 1TT0A 2V26A 3RKWA 1OCCH 2EBIA 3WU0A 4HV6A 1ERDA 2DMTA 4L9TA 2DK5A 3DTIA 4GCVA 3M9AA 4LOCA 2XPUA 2P7CB 1RNLA 3VSKA 3JRFA 5B1AH 3GTGJ 1MBKA 2CGPA 4P9FA 5EDNA 3HXLA 4IOAF 1JT6A 4GRIA 1UZCA 2R7FA 3Q5FA 4G12A 3GBGA 3K7AJ 2DFHA 2JA7J 2PMHA 1WKMA 2JT1A 4JX4A 1PJRA 1KONA 1FEXA 3CDHA 3RZDJ 3HPHA 3MKLA 5DCMA 3OYHA 3BG3A 4CCLA 4ASNA 4EV0A 2LOOA 2FQ3A 4UB6C 5HDNA 2C6YA 4QIWN 3ZN0A 2W7NA 2D2WA 3TW7A 3KP6A 2HZTA 2R92J 4HZFA 4ZYEA 4E7IA 3ABLH 3PIPF 4LK0F 3DEEA 3IAM2 3K9TA 4C3HJ 2AHQA 4U0VA 4YFXF 1YRNA 2VE8A 4ABZA 1I50J 4M3EA 3BG5A 4RB0A 4B3AA 4BHBA 3K70C 4WF2A 2IS1A 2NS0A 2IVMA 5FRNA 1MKMA 3W2VA 2NVTJ 1BA5A 3HYIA 4KNYA 1SFKA 2RDPA 4V2GA 3H92A 2KKOA 4ENNA 3Q0WA 5F1JA 1AKHA 2MGQA 2DQLA 3CC2I 2A6EF 2BYVE 1GXPA 2V9VA 5CKTA 2P81A 1S7EA 1VZ0A 2ZC2A 2JA6J 1TT5B 2FRHA 3MMYB 3JRGA 1RETA 1IDYA 1KA8A 2QLZA 5F64A 4A5MA 3E6MA 2E1CA 1PUFB 2BY1A 1JTYA 2GA2A 2RQQA 3RCOA 2PMZA 5LHHA 4D0PA 5CLSA 2GIZA 2WAQN 1FX7A 2LBFA 2QWWA 2W1OA 2CJJA 2ZKZA 2HYFA 2QQ9A 3C1DA 2WBMA 2K9MA 3I4NJ 4R8HA 2ADUA 1B9NA 3S2WA 1RUNA 2CUZA 3BR0A 3BLYA 4BU2A 4XOPA 2BOLA 2D1HA 2GWRA 2P6TA 3LAPA 3L2RA 2NXNB 2R7DA 3WTZA 4A0ZA 2WAEA 1H9TA 2JSCA 3WTXC 4AIKA 3ROUA 1SD7A 2LY2A 2ZXIA 1X58A 4DGWB 1NHAA 1R23A 1J59A 1Z6TA 1O7LA 1IXCA 2HQNA 2DA4A 1SMYF 1QPMA 2MBFA 3AG4H 2X4HA 3EYYA 1LFPA 4QTRA 3QRFF 3E5UA 4HDVA 4XORA 4OMZA 3CCRI 3S17J 3I4PA 2HNHA 2PG4A 2V1XA 3HSRA 4DQ2A 2JSPA 1FY7A 5DCFA 1W36C 1B1BA 5E8IA 2MABA 3CC7I 4BDZA 3SJMA 3HRUA 1YYVA 3ABTA 2OTLI 3A01B 1OMIA 3CCSI 3QOPA 1FOWA 1BR2A 5CVIA 1WJBA 3BR5A 4XRMA 2IBDA 3JAMZ 5IT9Z 2FUG2 2N8GA 4G6DA 4AU7A 3TO7A 2IA0A 2HPIA 3TOBA 1QNTA 1DGWY 1Y6IA 1P7JA 1O3SA 2VBWA 3TP3A 4LFUA 5J40A 4A0XA 3I53A 3GUDA 1UAAA 2M1BA 1U0JA 1D0YA 1IF1A 4DBRA 4CZCA 1O7FA 3KLNA 1YS6A 2K40A 4UHTA 5GAEJ 4M6VA 4U0YA 4HNVA 1CF7A 5JHFA 2NS8A 4Y3OA 1IN6A 4UVCA 1Z21A 4NBQA 4RMNA 3QWLA 3V7CA 4B44A 1MDMA 4GXOA 3ZQIA 3FXLA 1FYKA 4DBQA 1FSEA 1BOBA 1HA8A 4HLXA 3ABUA 3FMQA 2O9LA 4XLPF 1SVLA 2QSFX 4GYIA 2DQRA 2Z99A 2CH0A 2CRGA 5IYDJ 3A0BC 1YX3A 2VJJA 2AS5F 3IV5A 3R6SA 3N05A 4Z2YA 2LMDA 2LLKA 4BH9A 3MAJA 4PJJA 1R6RA 1S7AA 2NYXA 4PJLA 4HX7A 2BXZA 1Y1WJ 1XS9A 4ZTJA 4B47A 2M4GA 3GYHX 3DKYA 1B9MA 2WV1A 3NWSA 3CDIA 2QVOA 3ZQGA 3C7JA 5D6EA 3PUBA 4KN4X 2L7KA 1U78A 4IHYA 2QQ8A 5IT9K 4BJ5C 3M8EA 2AO9A 5J8CA 3MEXA 2K27A 1TP4A 4KFCA 2LH9A 2YS9A 1GVJA 4XKWA 3ZMDA 3MD2A 4RGSA 1Z7UA 2ZSHB 5GPCA 4JYKA 1WJAA 2HXOA 4FHTA 2K3FA 3L2UA 2UZKA 3DP7A 4DJAA 2F48A 2K3PA 3ABMH 4RGXA 2OQGA 4H4KC 2EFNA 1USTA 4M6XA 1C0WA 3GXOA 2DPDA 2ZFWA 2EV6A 2LBFB 2P0WA 3S3MA 1Z91A 3WG9A 1FIAA 2R7RA 3LSMA 1RR7A 1G4DA 3PUFA 3FXMA 4PK4A 2YSRA 4HNUA 3A0HC 2QA4I 2UUZA 1BI3A 3F6OA 1HKSA 3OL3A 3PO2J 1W36D 3DBRB 3J7ZI 3DTKA 1QRYA 2JMWA 3E0JB 3ZN1A 3H1CA 3T8TA 1MW7A 4OOIA 2Z5UA 4GFBA 3PQKA 1IN7A 4FETA 1G3TA 4RM2A 4BBSJ 1P4XA 2MC3A 1T0FC 4A3KJ 1KQ8A 3I56I 4N0BA 2JTVA 4BDYA 4G7HF 1OCOH 1EH6A 4IX7A 3ELKA 1FP1D 5IP7J 2XB5A 4LK1F 4A93J 1MSEC 1ETYA 1ON1A 4KMUX 1M1EB 2VQGA 3IWZA 3AG1H 3NQOA 3L2QA 2W84A 2E2IJ 5BQTA 1MSFC 4BE1A 3DPLC 3GTPJ 3BJAA 3KYDB 2L4AA 2QSGX 1XD7A 2BE5F 3V42A 3LSJA 3KEOA 3J7AO 1VTNC 2DOFA 1STZA 3CTAA 2Q8KA 3ZXSA 4E7SA 5E3NA 3MKWB 1EF4A 1WPKA 2QGUA 3KE2A 2M9HA 5E3MA 4MHGA 4KIBA 4XR6A 3FMRA 3MKYB 4L5IA 3OR1C 2CS3A 5TGTA 2DMQA 2OZ6A 2DMNA 4DNCA 1WWXA 4KA4A 2XGCA 4EGYA 3FM5A 1IV8A 3F6VA 1T0FA 2JVHA 3VDXA 5L3DA 2LFBA 2VJIA 4AUXA 4YFKF 4ZYAA 3BPXA 4KJZA 1UG2A 3JRAA 2EWNA 1APLC 4D1QA 2D1VA 2B0LA 1RIOH 3PIOF 3GX4X 1O4XA 2BW3A 5F27A 2A5YB 2Y0SN 1GT0C 5EYRA 2BY0A 5IYBJ 4EVIA 2L7MP 1PP7U 2HOTA 2VONA 2Y0SA 2VXZA 1A35A 3H36A 3PFYA 2MC4A 3BC8A 1ZR4A 3DKWA 2A69F 4LG0A 2E5NA 1SAXA 3G3ZA 1T2KA 4EMSA 1IV6A 1OCRH 3LOCA 1HOMA 1ZN2A 3AFHA 4E7JA 3K4CA 4S04A 2F5VA 2Z33A 1P9QC 1JE8A 3QOEA 5F6FA 3SHFA 1EV7A 1X4OA 4M9SA 2DN0A 1ZR2A 4WX9A 4KDPA 3RZOJ 1F5TA 2M2EA 1YRNB 1R22A 2EILH 1ETWA 5K7FA 4ENMA 1BOAA 3TGNA 4EJTA 2KL4A 4OIPF 1WI3A 2XAJA 4M74A 4YEJA 3BDDA 2IA1A 2ZB9A 3L2CA 2EFWA 2V1DA 1B4AA 2JVGA 1NK2P 3ZMVA 1E2XA 1HC8A 1D8JA 1UFMA 3V4GA 2L7ZA 1YE9A 2HZDA 4IF4A 1D8KA 3HB9A 1R5HA 2PJRA 2R7XA 1KYWA 3I54A 2A61A 3W2WA 2QF7A 3SXYA 5FD6A 3ZP5A 3K69A 2KDZA 3HOTA 3AL0B 3MCZA 1QHGA 3CJRB 2IJLA 3I59A 2XASA 2ELKA 4ZYHA 3LWFA 3CUQA 1P6RA 1K6OA 5CVJA 5CQEA 1YI2I 2L9RA 2R93J 2VL8A 2WB1N 1GDTA 2Q2EA 4YIFA 4XRFA 3SFIA 4WXCA 3HZJA 3U2RA 4IHXA 4A0YA 1ZREA 1RC9A 1LDJA 2GOXB 1Y0UA 2K9NA 3IRRA 3OL4A 1P2FA 2K7LA 1JJ6C 1K4SA 1WQ2A 2FX0A 3PFIA 2B9SA 2OF7A 2TDXA 4O3MA 1SAUA 3FBNB 1MJ9A 1POGA 4EGZA 5FRMA 1TWFJ 1R7JA 2GZWA 1BI0A 1X2NA 2DA6A 2KT0A 4MFDA 3BZCA 5LGUA 4DZJA 1D1BA 2ZO4A 4HLYA 2W57A 5FB2A 5F0HA 4BGDA 2ACJA 3X2QH 2DFEA 2XKOA 1RRJA 3JSOA 3GZ6A 2X6OA 3EUHA 1G2HA 3EPZA 1HSTA 4G8XA 1KU7A 2XGEA 1V3FA 2QQBA 4FISA 2DPUA 3D5SC 4RAGA 4UVBA 3G73A 3I58A 2K02A 4P5OA 5EGOB 2MLKA 2VI6A 1SEUA 1OYIA 3TMOA 2G7UA 2MG4A 1MBHA 1DQUA 1SFEA 3VYRB 2NAZA 3Q3SA 4U0WA 2M7BA 3GWZA 2E60A 1R4NB 4IPAA 4BJ6C 2VPRA 4A3JJ 3U21A 1SVOA 4XOTA 4G9YA 1QO0D 3PL8A 2LG4A 4A3FJ 4X6AJ 1CQTA 2P8TA 1VQ7I 3HOVJ 3NARA 1I39A 1I27A 4IJAA 3HRTA 3F72A 3M7GA 1WH7A 3OOPA 5FKNA 1YHQI 5J3LA 3GW2A 1D5VA 4XIDA 1OISA 3QQAA 4X1EA 5D8LB 2KDOA 5LHIA 1K4TA 1SVMA 3IUOA 4IHSA 2UWMA 3CUOA 2O8XA 1OR7C 4DOZA 4R79A 5ILSA 2JUCA 4XNFA 5HDKA 1IC8A 4JOMA 1GXQA 1LFUP 2DA5A 3IL2A 3LSRA 1VQOI 2CQNA 2EA4A 4ENJA 2FOKA 4I09A 2K86A 5M5XJ 1OYYA 3FX3A 1X2MA 3OYIA 4G94A 4KISA 1PYVA 1WVRA 3I59B 4RLFA 2Y75A 3F3XA 1H9GA 4AIHA 4LG3A 1OKRA 1MD0A 4QWQA 1L3LA 4NQWB 4IQ4A 1S72I 3DBLB 5DUIA 4CUGA 3IC7A 4QPOA 3S15J 4MTEA 2XGXA 2M87A 5F08A 4HBLA 1O57A 1Z6RA 2VC1A 3TO9A 5F0FA 4FX0A 3U1KA 3CZ6A 5CPRB 1HW2A 2RVCA 1T38A 1KYZA 5L3EA 1UHWA 3FXKA 2Y2ZA 2XPWA 3B73A 2EFPA 5J1RA 1D0ZA 1ZGJA 2VLAA 2XC7A 1KGSA 1X1CA 2DK8A 2HU9A 1LFBA 3CUQB 2FOWA 3RKXA 3G1LA 1SD6A 2EV5A 3NRVA 3ESWB 3LA7A 1MMAA 3AG2H 4UB8C 1JXSA 1LPQA 3BZKA 2KHMA 4BY1J 2IGNA 2KRHA 4D7NA 3J7YJ 4Q47A 1FJLA 2FA5A 2RQPA 4JQFA 2KLOA 4BQNA 3FIWA 4L9JA 3CCJI 1QU3A 3DU5A 2KJCA 2CW7A 4M3FA 4AIDA 1DP3A 1TTYA 4XSZF 5TRDA 1N77A 1UG0A 3H5AA 2VKVA 5E20A 5L3BA 1UHMA 4NNJA 3HL2A 1T56A 4HNTA 5CQGA 2QKMB 1MZBA 3TDZC 1IRXA 3HOXJ 2BZTA 3OMYA 4DYCA 4FT8A 2CFOA 3DEWA 3K4MA 3WTYC 3QU6A 1V55H 3E1SA 2O6GE 3MZ8A 4HA8A 2V6EA 2IGKA 1Y56A 3BT9A 4XRSA 1V5FA 4M71A 2R7ZJ 5ILUA 2CUFA 2AXLA 3RPUA 3KZIC 1ZYRF 4H0EA 2E1MC 3H5RA 1RKTA 4Y15A 3HGGA 2O5RA 1Z0XA 2M8GX 1U2WA 3DKXA 1SMTA 1P4WA 2PI0A 3KP3A 5KCMA 1R1TA 1XMXA 1H88C 2LR8A 4XSXF 4RDUA 1RI7A 2L3DA 2PQ8A 2FBKA 4XQFA 2H8RA 4A3CJ 3F8CA 1S9HA 1BJAA 3RPQA 3FDYA 5E3LA 5BPDA 2MLGA 4K2EA 4AM3A 4A3IJ 3P9CA 2D5VA 1NG6A 4II3A 2Y31A 5J47A 2A05A 3AG3H 4NC6A 2GOMA 1SC7A 1VQLI 2AXTC 4KMFA 2XAGA 3CCUI 4PZJA 3HOZJ 1GHCA 5GPAA 1B59A 2FEZA 2OA4A 2MH2A 2WC2A 3DV8A 2X6XA 5EJCA 1MBFA 3KCCA 4IXAA 5H6QA 3W6VA 2XSDC 3SDGA 2EZHA 3TOAA 2CQXA 2JPCA 5GAHJ 1WJEA 1JTXA 2LNBA 4EJUA 2DLLA 1QZYA 3K1PA 3F21A 1QGPA 2DA2A 2H09A 3EUHC 3HOUJ 3DPTA 2IS6A 1SD4A 4C3IJ 1H8AC 3HSEA 3ZQLA 3H35A 1LVKA 4P96A 1XDSA 2H6CA 1R58A 2XPVA 3GZ5A 3OSFA 2KPMA 3K10A
chains in the Genus database with same CATH topology
1ULYA 2Y0MA 2ELHA 2IPQX 4ENKA 5E18F 2LKPA 5JR3A 4UXNA 3ZMSA 2ESHA 4AVPA 5D5UB 5E1ZB 3ISPA 4ESJA 2FMLA 1X3UA 4YG2F 2NNYA 1YO5C 4P9UA 5E17F 5LRRA 2L01A 2P5LC 3CJNA 1TW2A 6PAXA 4QLCU 1ZARA 3R61A 4ZZLA 4YIIA 3HHGA 1YTYA 3R4KA 3BJOA 2RC4A 5D5VB 3C3WA 5HOOA 3NEUA 3IKTA 1F4KA 4IRGA 2O61A 4MQ9F 5DD8A 1XGNA 1YFHA 4LLLA 1Z9CA 2CG4A 2XHKA 2KJBA 2VBZA 1K79A 1P4AA 1TW3A 1WRJA 1B6AA 3CUQC 5F1RA 2J5PA 3LQRA 1JHFA 2M45A 3R0JA 1PDNC 4LMYA 2ISYA 1S6LA 1FSHA 3HHHA 4A12A 3GFMA 1FWZA 1MDMB 1LEAA 3N97A 3WTTC 2LF7A 2EJRA 1CF7B 3RDIA 1U8RA 4ZZDA 2FF4A 1HW1A 1I5ZA 3IHUA 3E6DA 3L09A 3KP2A 2VODA 4MEYF 3K0LA 4CYDA 5EEGA 4KIGA 4IRIA 3M8FA 3HRSA 3RIRA 3WTWC 3W6KB 3LA3A 2UXNA 4RS8A 4TV7A 4GGGA 4E70A 2QBYB 3KEQA 4GYGA 3M1EA 3CO6C 4NHJA 2XAHA 3I64A 4OIRF 5ERIA 4L0ZB 2EV0A 1Z05A 4PGGA 1ZRCA 3L9FA 1LB2A 2KRFA 1IRGA 4EJOA 2RGVA 2A3SA 2O0YA 2VN2A 5BOXA 1T98A 4O5VA 3EYIA 2GIVA 2XAFA 2XVCA 4HF1A 3JW4A 4LD5A 1USSA 2M5WA 3Q9VA 4HF0A 4G7ZF 1AOYA 3I71A 3WGIA 1EH8A 2W25A 4LB5A 2COMA 2XKPA 2G9WA 5FGMA 5H20A 4WWCA 4UUVA 4L9NA 3WGHA 2VT3A 1RZ4A 3MWMA 1IN4A 4AWXB 1DPUA 5FFXA 4MTDA 5LEJA 5BMZA 2JPBA 1S7OA 4IVNA 1BIBA 1ZG1A 2YR2A 3J80K 4HOBA 4HDUA 5D5WB 2RV8A 2ZXJA 3BWGA 2BEOA 3I0TA 1V4RA 3P9IA 1J75A 4CICA 2VC0A 1BI2A 2OQRA 1R36A 1KU9A 3BJ6A 2ZMEB 1ZG5A 2XRNA 2EFOA 3N4MA 4ZH4F 5KK1A 1HW5A 2DW4A 4EM0B 5EEHA 2ETHA 2KIFA 2OBPA 2STWA 5E1XA 3LFKA 3JAMK 1JGSA 3FXQA 4LG0B 2J5OA 4ON0A 1FBUA 3KZZA 1P92A 2W24A 2HWVA 5BS6A 1HXDA 2XIGA 3R60A 3V7SA 3TQNA 4MNUA 2ZNZA 4I7HA 3KP4A 3ZMZA 1ZGAA 2LDUA 3DFGA 2STTA 4HX8A 3CO7C 2DBBA 3L7WA 4OIOF 1TNTA 1RUOA 2ZCWA 3O2PE 4RB1A 1R00A 1FLIA 1SFXA 1W7PD 5TJJA 3SFZA 3AAFA 1ODDA 1YW8A 2OZUA 2FBIA 5HVQC 4UV9A 3F8BA 2PBIA 5J8FA 4WXHA 3E6CC 1K78B 2M8EA 2H27A 2Y48A 4KN7X 3ML6A 4AIJA 4KT5C 2X0LA 3KP7A 3SZPA 2V1UA 5K5OA 3LA2A 3FZVA 1LDKB 2PFBA 3BZ6A 2ZBKA 1HSJA 1LQ1A 5HDGA 1WI9A 4A6DA 1K7AA 1DP7P 3ZPLA 3FHZA 3EQLF 4PCQA 2QBYA 4ZYDA 2XAQA 5ICCA 2MD5A 4OIQF 5D6FA 4OINF 5FFZA 3PQJA 1DPRA 5CJ9A 1TLHB 4U7BA 4ETSA 2YU3A 4A6EA 1OYWA 2RN7A 1ZG3A 3HSFA 3WTSC 3B02A 4EJVA 2V6CA 2G7HA 4L18B 5LBQA 2PN6A 2EA2A 3WTVC 4LLNA 3T0YA 2PEXA 1WSUA 1MGTA 5JHUA 4BHCA 3WTUC 3GFLA 3VOEA 3TDUC 2IRFG 2RNJA 1IUYA 2DI3A 5A2QK 2Q0OA 3GVAA 3RJPA 1XMKA 2EK5A 2EB7A 3HTSB 1XDUA 4IRHA 2IT0A 1FC3A 1BN5A 1YW9A 3F8MA 3RYRA 3D5LA 1A04A 1KQ0A 3I5UA 2BBYA 1F1ZA 2EFQA 4HV5A 2NNNA 3MQ0A 3SZTA 1JHHA 5LLQA 5H6RA 1G3WA 5JFRA 1U5TC 1TQIA 3BROA 5AIQA 1U3EM 2DO7A 3ZMTA 3RI4A 2L02A 2IW5A 3RYPA 2GXGA 3ZQ7A 4HYEA 3H3ZA 4RB3C 3RKYA 1PP8F 5HS8A 2IA2A 3J80Z 2E1NA 1O3QA 4JBAA 4MGRA 1U5TA 2F5EA 5ILVA 2DTRA 3LAJA 4M9XA 3QP6A 4ZYGA 4R1HA 4XBFA 1KU3A 1D3YA 3QPTA 5LEKA 5L3FA 3T1BA 5HLHA 4HF2A 3CLOA 1OPCA 3E5XA 5LRSA 3J81Z 1DUXC 2P7VB 1K78A 1LVAA 2RKHA 4B8XA 1I6XA 2MH9A 2PMUA 3REOA 4A2UA 4RAYA 3T5XA 2HR3A 2WV0A 3FMSA 4HAMA 2Z9OA 4RAZA 2H6BA 5L3CA 1YS7A 4CXFA 4AD9A 2HDCA 1W5TA 2VOOA 2JZYA 2L54A 2YX4A 1FBQA 3WODF 4YFNF 2CWEA 1BM9A 4EJWA 1IRFA 3FF5A 3WE3A 1ONVA 2D45A 1J2XA 1BC8C 1REPC 4M73A 4CHUA 4GO1A 3E5QA 2P6SA 3ECHA 4L0YB 2OD5A 4I0BA 2HYGD 5DD4A 1KU2A 1HBXG 1XGMA 3V8KA 2BGCA 4P55A 5FLXZ 2A07F 1LJ9A 1T6SA 3LQQA 2A68F 1XN7A 2HTJA 4CO8A 4N9HA 1TNSA 4BQAA 4Q48A 1T39A 2ZMEA 3F8FA 2HTSA 5LHGA 4OMYA 1FNNA 4HX4A 2F2EA 3BY6A 3DQVC 1FYLA 5DYMA 3EDPA 2LSOA 5L3GA 5ICGA 2QM3A 5HLGA 1KQ9A 1YG2A 2MA3A 2NRAC 2CYYA 5D5XB 1U6GA 4I2OA 1J7KA 1S3JA 3FXUA 5E1WA 5CVVA 2FNAA 5DUKA 1UCRA 4CDGA 1LDDA 3HUGA 1IZ1A 3D0SA 4WCGA 3KZYA 5K5RA 2DFIA 2FMYA 4PDKA 1J5YA 1XGOA 4UV8A 3ZMUA 4Y17A 4U7DA 4M6YA 5DV5A 2F5CA 3LSTA 1S8NA 2P5KA 1ZRDA 1EH7A 3GLXA 2O03A 1BI1A 1W4MA 2ZNYA 2ISZA 4CGZA 1LNWA 1L0OC 4A5NA 4LJZF 1TBXA 3GFIA 4KIFA 3ECOA 5LGNA 3KLOA 1SFUA 1R1UA 3FXRA 5AIPA 1HQCA 2HS5A 1O3RA 3R0AA 5FO5A 5JVTA 5IT3A 3BPVA 2HFHA 1MJAA 3L00A 2HKXA 3FWEA 1F9NA 1QQIA 3E6BA 2A6HF 3P7NA 2K4BA 3GO5A 3HIFA 2CO5A 1OR7A 3JTHA 2QYOA 1IN8A 2QQAA 3GFJA 2QZ8A 3C18A 5BPIA 3FM3A 2L4MA 1R5GA 2VOPA 1QZZA 3QP5A 4Y13A 4UVAA 3MFKA 3E3VA 3TKYA 3BP8A 3HTUA 3IRQA 2JRTA 4BAYA 2K4JA 3E97A 2W85A 3EETA 2ZJ2A 5ICEA 1DDNA 5JI6A 2BV6A 1AWCA 4KYWA 2YX7A 2CQKA 2E7XA 2QENA 4EM1A 5KVRA 5HLIA 3QPHA 1UB9A 5AONA 2V79A 3P9KA 2E7WA 3OV8A 5DEQA 1Z1DA 2DU9A 3Q9SA 4EM2A 4BNCA 1ZH5A 5FLXK 4I02A 3VODA 1ZAOA 4NB5A 1FP2A 2FSWA 3QAHA 1IXRC 4OU0A 2CFXA 2VBXA 3VB2A 3VFZA 2O3FA 1IAWA 1E17A 3QU3A 2PLYA 1W7PA 2HGCA 1IN5A 5D4RA 4CZZA 2R3SA 1ZHFA 1G6NA 5CYVA 1BBYA 1YLFA 3VEPA 2HEOA 5K1YA 3K2ZA 3DF8A 3DXJF 1TQPA 2UXXA 5E8GA 4G7OF 5J6XA 1H0MA 2GA1A 2VE9A 1CGPA 4PGHA 1U5TB 4G6QA 3H3UA 4M9ZA 3WE2A 2KIUA 1ZLJA 5K5QA 1W7PB 3GEZA 4MQVA 4JK1X 4HQMA 2OU2A 1FZPB 4BHPA 4O6JA 2ESNA 1ZRFA 2QUFA 5ED4A 5ICFA 2PJPA 3SQNA 3JSPA 2HQRA 4L5JA 4BYYA 2GXBA 3F8NA 4B09A 1S29A 1TQMA 3J81K 4UNOA 5CVRA 4F7ZA 1Q1HA 4KUMA 1HKQA 4MEXF 4ESFA 3MZHA 3K1MA 1FYMA 3F22A 4HQEA 2F5DA 2XV4S 1FBSA 2FE3A 3U9GA 4KICA 3ULQB 1I1SA 2FBHA 1IXSB 4IHTA 2CSOA 2CW0F 2LF8A 3HOSA 3JTGA 4HW0A 1ON2A 3MZYA 4I98B 4FX4A 4I0AA 4M72A 2FU4A 1J9IA 1IW7F 1J0RA 3O6BB 2GQQA 1YW7A 3V8JA 3IKVA 2Z3YA 3TO6A 1XCBA 3IWFA 3ERED 1SD5A 2YPRA 3BOQA 1G3YA 2GAUA 1I1GA 3KFWX 4NQWA 5LGTA 1BC7C 2P5VA 3KP5A 1G3SA 3O3KA 5A2QZ 1XSDA 1QBJA 4WK8F 3GF2A 2IP2A 2FXAA 3U1DA 2XUBA 1W5SA 1XGSA 3F23A 1O3TA 1YIOA 4Q4ZF 2VT2A 3WU1B 2XROA 4N9IA 1XCVA 3T8RA 4Q5SF 2H94A 5DDGA 2HKOA 1FPQA 5HS7A 2P4WA 4U88A 5DCMB 1XSXA 2DT5A 4RGRA 1YQAA 2WWYA 1R1VA 5D8KB 4I01A 5CVUA 2KIMA 4EQQA 2FNPA 4XLNF 2M30A 1ZLKA 2VBYA 1XMAA 5FD5A 1LEBA 3W6JB 2F5FA 2DAOA 4LB6B 4ESBA 3COAC 1FT9A 1MJBA 4WXDA 4L9VA 2WTEA 3HRMA 3V8LA 3WGGA 3RTRA 4RB2C 1FOKA 4LGWA 1BIAA 1XB4A 4LLGF 1HKTA 2OAZA 3KETA 1XSVA 3K1NA 2HOEA 3DEUA 4S05A 3V7RA 4BXUA 5D4SA 5HS9A 1PUEE 4RGUA 3RKWA 3WU0A 4HV6A 4L9TA 2DK5A 4GCVA 3M9AA 2P7CB 1RNLA 2CGPA 4P9FA 2R7FA 3Q5FA 2PMHA 1WKMA 2JT1A 3CDHA 5DCMA 4ASNA 4EV0A 2FQ3A 5HDNA 2C6YA 3ZN0A 2D2WA 3KP6A 2HZTA 4HZFA 4ZYEA 4LK0F 3K9TA 4U0VA 4YFXF 2VE8A 4RB0A 4BHBA 4WF2A 2NS0A 2IVMA 1MKMA 3HYIA 4KNYA 2RDPA 3H92A 2KKOA 4ENNA 2DQLA 2A6EF 2BYVE 1GXPA 2V9VA 2FRHA 1KA8A 2QLZA 5F64A 4A5MA 3E6MA 2E1CA 2GA2A 5LHHA 4D0PA 5CLSA 1FX7A 2QWWA 2ZKZA 2HYFA 2QQ9A 3C1DA 4R8HA 2ADUA 1B9NA 3S2WA 1RUNA 2GWRA 2D1HA 2P6TA 3LAPA 2R7DA 3WTZA 4A0ZA 1H9TA 2JSCA 3WTXC 4AIKA 3ROUA 1SD7A 1NHAA 1R23A 1J59A 1Z6TA 1O7LA 1IXCA 2HQNA 1SMYF 1QPMA 2MBFA 3EYYA 2X4HA 3QRFF 3E5UA 4HDVA 4OMZA 3I4PA 2PG4A 2V1XA 3HSRA 4DQ2A 1FY7A 5DCFA 1B1BA 5E8IA 3HRUA 1YYVA 3ABTA 1OMIA 3QOPA 5CVIA 5IT9Z 3JAMZ 4G6DA 3TO7A 2IA0A 3TOBA 1QNTA 1O3SA 2VBWA 4LFUA 4A0XA 3I53A 3GUDA 2M1BA 1IF1A 1O7FA 3KLNA 1YS6A 4UHTA 4U0YA 1CF7A 1IN6A 4UVCA 3V7CA 1MDMA 4GXOA 1FYKA 1FSEA 4HLXA 3ABUA 3FMQA 4XLPF 4GYIA 2DQRA 2Z99A 2AS5F 3R6SA 4Z2YA 4BH9A 3MAJA 2NYXA 1S7AA 4HX7A 3GYHX 1B9MA 2QVOA 3C7JA 5D6EA 4KN4X 1U78A 5IT9K 3M8EA 5J8CA 3MEXA 2K27A 4KFCA 1GVJA 3ZMDA 4RGSA 1Z7UA 4FHTA 2UZKA 3DP7A 4RGXA 2OQGA 2EFNA 1USTA 4M6XA 1C0WA 3GXOA 2DPDA 2ZFWA 2EV6A 1Z91A 3WG9A 1G4DA 2YSRA 1BI3A 3F6OA 1HKSA 3ZN1A 3T8TA 4OOIA 2Z5UA 3PQKA 1IN7A 1G3TA 1P4XA 2MC3A 1KQ8A 4N0BA 2JTVA 4G7HF 1EH6A 3ELKA 1FP1D 4LK1F 1ON1A 4KMUX 3IWZA 3NQOA 2W84A 5BQTA 3DPLC 3BJAA 2L4AA 1XD7A 2BE5F 3KEOA 3J7AO 1VTNC 1STZA 3CTAA 2Q8KA 3KE2A 4MHGA 4KIBA 3FMRA 4L5IA 2OZ6A 4DNCA 4KA4A 1WWXA 4EGYA 3FM5A 3F6VA 1T0FA 5L3DA 4YFKF 3BPXA 2EWNA 2D1VA 2B0LA 1RIOH 3GX4X 2A5YB 4EVIA 1PP7U 2VONA 2VXZA 3DKWA 2A69F 4LG0A 1SAXA 3G3ZA 1T2KA 4EMSA 1ZN2A 4S04A 2Z33A 1JE8A 5F6FA 3SHFA 1EV7A 4M9SA 4WX9A 4KDPA 1F5TA 1R22A 4ENMA 1BOAA 3TGNA 4EJTA 4OIPF 2XAJA 4M74A 3BDDA 2IA1A 3L2CA 2EFWA 2V1DA 1B4AA 3ZMVA 1E2XA 1D8JA 1UFMA 3V4GA 4IF4A 1D8KA 1R5HA 1KYWA 3I54A 2A61A 3SXYA 5FD6A 3ZP5A 3K69A 3HOTA 3MCZA 2IJLA 3I59A 2XASA 4ZYHA 3LWFA 3CUQA 1P6RA 1K6OA 5CVJA 2Q2EA 4YIFA 4XRFA 4WXCA 3U2RA 4A0YA 1ZREA 1LDJA 1Y0UA 3IRRA 1P2FA 2K7LA 1WQ2A 3PFIA 2TDXA 4O3MA 1MJ9A 4EGZA 2GZWA 1R7JA 1BI0A 5LGUA 2ZO4A 4HLYA 2W57A 5FB2A 2ACJA 2XKOA 3JSOA 3GZ6A 3EUHA 1HSTA 4G8XA 1KU7A 1V3FA 2QQBA 2DPUA 4UVBA 3G73A 3I58A 2K02A 4P5OA 2MLKA 1OYIA 2G7UA 1SFEA 2NAZA 4U0WA 3GWZA 4IPAA 4G9YA 1QO0D 2P8TA 1I27A 4IJAA 3HRTA 3F72A 3M7GA 3OOPA 3GW2A 1D5VA 5D8LB 5LHIA 4IHSA 2UWMA 3CUOA 2O8XA 4R79A 5ILSA 5HDKA 1GXQA 3IL2A 2EA4A 4ENJA 2FOKA 4I09A 2K86A 1OYYA 3FX3A 4G94A 3I59B 2Y75A 3F3XA 1H9GA 4AIHA 1OKRA 1MD0A 4QWQA 1L3LA 5DUIA 3IC7A 4MTEA 2XGXA 2M87A 4HBLA 1O57A 1Z6RA 2VC1A 3TO9A 4FX0A 1HW2A 2RVCA 1T38A 1KYZA 5L3EA 1UHWA 3B73A 2EFPA 1ZGJA 1KGSA 2DK8A 3CUQB 3RKXA 1SD6A 2EV5A 3NRVA 3LA7A 1JXSA 4Q47A 2FA5A 2RQPA 4JQFA 4L9JA 2KJCA 1TTYA 4XSZF 5TRDA 5E20A 5L3BA 1UHMA 1MZBA 3TDZC 4FT8A 3WTYC 3QU6A 2O6GE 4HA8A 4M71A 5ILUA 2AXLA 3RPUA 1ZYRF 4H0EA 4Y15A 1U2WA 1SMTA 1P4WA 2PI0A 3KP3A 1R1TA 4XSXF 1RI7A 2L3DA 2PQ8A 2FBKA 3F8CA 1BJAA 3RPQA 5BPDA 2MLGA 4K2EA 3P9CA 4KMFA 2XAGA 4PZJA 1GHCA 1B59A 2FEZA 2OA4A 2MH2A 2WC2A 3DV8A 3KCCA 4IXAA 5H6QA 3TOAA 2JPCA 2LNBA 4EJUA 2DLLA 1QZYA 3K1PA 3F21A 1QGPA 2H09A 3DPTA 1SD4A 3HSEA 4P96A 1XDSA 2H6CA 1R58A 3GZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULY A;  2Y0M A;  2ELH A;  2IPQ X;  4ENK A;  5E18 F;  2LKP A;  5JR3 A;  4UXN A;  3ZMS A;  2ESH A;  4AVP A;  5D5U B;  5E1Z B;  3ISP A;  4ESJ A;  2FML A;  1X3U A;  4YG2 F;  2NNY A;  1YO5 C;  4P9U A;  5E17 F;  5LRR A;  2L01 A;  2P5L C;  3CJN A;  1TW2 A;  6PAX A;  4QLC U;  1ZAR A;  3R61 A;  4ZZL A;  4YII A;  3HHG A;  1YTY A;  3R4K A;  3BJO A;  2RC4 A;  5D5V B;  3C3W A;  5HOO A;  3NEU A;  3IKT A;  1F4K A;  4IRG A;  2O61 A;  4MQ9 F;  5DD8 A;  1XGN A;  1YFH A;  4LLL A;  1Z9C A;  2CG4 A;  2XHK A;  2KJB A;  2VBZ A;  1K79 A;  1P4A A;  1TW3 A;  1WRJ A;  1B6A A;  3CUQ C;  5F1R A;  2J5P A;  3LQR A;  1JHF A;  2M45 A;  3R0J A;  1PDN C;  4LMY A;  2ISY A;  1S6L A;  1FSH A;  3HHH A;  4A12 A;  3GFM A;  1FWZ A;  1MDM B;  1LEA A;  3N97 A;  3WTT C;  2LF7 A;  2EJR A;  1CF7 B;  3RDI A;  1U8R A;  4ZZD A;  2FF4 A;  1HW1 A;  1I5Z A;  3IHU A;  3E6D A;  3L09 A;  3KP2 A;  2VOD A;  4MEY F;  3K0L A;  4CYD A;  5EEG A;  4KIG A;  4IRI A;  3M8F A;  3HRS A;  3RIR A;  3WTW C;  3W6K B;  3LA3 A;  2UXN A;  4RS8 A;  4TV7 A;  4GGG A;  4E70 A;  2QBY B;  3KEQ A;  4GYG A;  3M1E A;  3CO6 C;  4NHJ A;  2XAH A;  3I64 A;  4OIR F;  5ERI A;  4L0Z B;  2EV0 A;  1Z05 A;  4PGG A;  1ZRC A;  3L9F A;  1LB2 A;  2KRF A;  1IRG A;  4EJO A;  2RGV A;  2A3S A;  2O0Y A;  2VN2 A;  5BOX A;  1T98 A;  4O5V A;  3EYI A;  2GIV A;  2XAF A;  2XVC A;  4HF1 A;  3JW4 A;  4LD5 A;  1USS A;  2M5W A;  3Q9V A;  4HF0 A;  4G7Z F;  1AOY A;  3I71 A;  3WGI A;  1EH8 A;  2W25 A;  4LB5 A;  2COM A;  2XKP A;  2G9W A;  5FGM A;  5H20 A;  4WWC A;  4UUV A;  4L9N A;  3WGH A;  2VT3 A;  1RZ4 A;  3MWM A;  1IN4 A;  4AWX B;  1DPU A;  5FFX A;  4MTD A;  5LEJ A;  5BMZ A;  2JPB A;  1S7O A;  4IVN A;  1BIB A;  1ZG1 A;  2YR2 A;  3J80 K;  4HOB A;  4HDU A;  5D5W B;  2RV8 A;  2ZXJ A;  3BWG A;  2BEO A;  3I0T A;  1V4R A;  3P9I A;  1J75 A;  4CIC A;  2VC0 A;  1BI2 A;  2OQR A;  1R36 A;  1KU9 A;  3BJ6 A;  2ZME B;  1ZG5 A;  2XRN A;  2EFO A;  3N4M A;  4ZH4 F;  5KK1 A;  1HW5 A;  2DW4 A;  4EM0 B;  5EEH A;  2ETH A;  2KIF A;  2OBP A;  2STW A;  5E1X A;  3LFK A;  3JAM K;  1JGS A;  3FXQ A;  4LG0 B;  2J5O A;  4ON0 A;  1FBU A;  3KZZ A;  1P92 A;  2W24 A;  2HWV A;  5BS6 A;  1HXD A;  2XIG A;  3R60 A;  3V7S A;  3TQN A;  4MNU A;  2ZNZ A;  4I7H A;  3KP4 A;  3ZMZ A;  1ZGA A;  2LDU A;  3DFG A;  2STT A;  4HX8 A;  3CO7 C;  2DBB A;  3L7W A;  4OIO F;  1TNT A;  1RUO A;  2ZCW A;  3O2P E;  4RB1 A;  1R00 A;  1FLI A;  1SFX A;  1W7P D;  5TJJ A;  3SFZ A;  3AAF A;  1ODD A;  1YW8 A;  2OZU A;  2FBI A;  5HVQ C;  4UV9 A;  3F8B A;  2PBI A;  5J8F A;  4WXH A;  3E6C C;  1K78 B;  2M8E A;  2H27 A;  2Y48 A;  4KN7 X;  3ML6 A;  4AIJ A;  4KT5 C;  2X0L A;  3KP7 A;  3SZP A;  2V1U A;  5K5O A;  3LA2 A;  3FZV A;  1LDK B;  2PFB A;  3BZ6 A;  2ZBK A;  1HSJ A;  1LQ1 A;  5HDG A;  1WI9 A;  4A6D A;  1K7A A;  1DP7 P;  3ZPL A;  3FHZ A;  3EQL F;  4PCQ A;  2QBY A;  4ZYD A;  2XAQ A;  5ICC A;  2MD5 A;  4OIQ F;  5D6F A;  4OIN F;  5FFZ A;  3PQJ A;  1DPR A;  5CJ9 A;  1TLH B;  4U7B A;  4ETS A;  2YU3 A;  4A6E A;  1OYW A;  2RN7 A;  1ZG3 A;  3HSF A;  3WTS C;  3B02 A;  4EJV A;  2V6C A;  2G7H A;  4L18 B;  5LBQ A;  2PN6 A;  2EA2 A;  3WTV C;  4LLN A;  3T0Y A;  2PEX A;  1WSU A;  1MGT A;  5JHU A;  4BHC A;  3WTU C;  3GFL A;  3VOE A;  3TDU C;  2IRF G;  2RNJ A;  1IUY A;  2DI3 A;  5A2Q K;  2Q0O A;  3GVA A;  3RJP A;  1XMK A;  2EK5 A;  2EB7 A;  3HTS B;  1XDU A;  4IRH A;  2IT0 A;  1FC3 A;  1BN5 A;  1YW9 A;  3F8M A;  3RYR A;  3D5L A;  1A04 A;  1KQ0 A;  3I5U A;  2BBY A;  1F1Z A;  2EFQ A;  4HV5 A;  2NNN A;  3MQ0 A;  3SZT A;  1JHH A;  5LLQ A;  5H6R A;  1G3W A;  5JFR A;  1U5T C;  1TQI A;  3BRO A;  5AIQ A;  1U3E M;  2DO7 A;  3ZMT A;  3RI4 A;  2L02 A;  2IW5 A;  3RYP A;  2GXG A;  3ZQ7 A;  4HYE A;  3H3Z A;  4RB3 C;  3RKY A;  1PP8 F;  5HS8 A;  2IA2 A;  3J80 Z;  2E1N A;  1O3Q A;  4JBA A;  4MGR A;  1U5T A;  2F5E A;  5ILV A;  2DTR A;  3LAJ A;  4M9X A;  3QP6 A;  4ZYG A;  4R1H A;  4XBF A;  1KU3 A;  1D3Y A;  3QPT A;  5LEK A;  5L3F A;  3T1B A;  5HLH A;  4HF2 A;  3CLO A;  1OPC A;  3E5X A;  5LRS A;  3J81 Z;  1DUX C;  2P7V B;  1K78 A;  1LVA A;  2RKH A;  4B8X A;  1I6X A;  2MH9 A;  2PMU A;  3REO A;  4A2U A;  4RAY A;  3T5X A;  2HR3 A;  2WV0 A;  3FMS A;  4HAM A;  2Z9O A;  4RAZ A;  2H6B A;  5L3C A;  1YS7 A;  4CXF A;  4AD9 A;  2HDC A;  1W5T A;  2VOO A;  2JZY A;  2L54 A;  2YX4 A;  1FBQ A;  3WOD F;  4YFN F;  2CWE A;  1BM9 A;  4EJW A;  1IRF A;  3FF5 A;  3WE3 A;  1ONV A;  2D45 A;  1J2X A;  1BC8 C;  1REP C;  4M73 A;  4CHU A;  4GO1 A;  3E5Q A;  2P6S A;  3ECH A;  4L0Y B;  2OD5 A;  4I0B A;  2HYG D;  5DD4 A;  1KU2 A;  1HBX G;  1XGM A;  3V8K A;  2BGC A;  4P55 A;  5FLX Z;  2A07 F;  1LJ9 A;  1T6S A;  3LQQ A;  2A68 F;  1XN7 A;  2HTJ A;  4CO8 A;  4N9H A;  1TNS A;  4BQA A;  4Q48 A;  1T39 A;  2ZME A;  3F8F A;  2HTS A;  5LHG A;  4OMY A;  1FNN A;  4HX4 A;  2F2E A;  3BY6 A;  3DQV C;  1FYL A;  5DYM A;  3EDP A;  2LSO A;  5L3G A;  5ICG A;  2QM3 A;  5HLG A;  1KQ9 A;  1YG2 A;  2MA3 A;  2NRA C;  2CYY A;  5D5X B;  1U6G A;  4I2O A;  1J7K A;  1S3J A;  3FXU A;  5E1W A;  5CVV A;  2FNA A;  5DUK A;  1UCR A;  4CDG A;  1LDD A;  3HUG A;  1IZ1 A;  3D0S A;  4WCG A;  3KZY A;  5K5R A;  2DFI A;  2FMY A;  4PDK A;  1J5Y A;  1XGO A;  4UV8 A;  3ZMU A;  4Y17 A;  4U7D A;  4M6Y A;  5DV5 A;  2F5C A;  3LST A;  1S8N A;  2P5K A;  1ZRD A;  1EH7 A;  3GLX A;  2O03 A;  1BI1 A;  1W4M A;  2ZNY A;  2ISZ A;  4CGZ A;  1LNW A;  1L0O C;  4A5N A;  4LJZ F;  1TBX A;  3GFI A;  4KIF A;  3ECO A;  5LGN A;  3KLO A;  1SFU A;  1R1U A;  3FXR A;  5AIP A;  1HQC A;  2HS5 A;  1O3R A;  3R0A A;  5FO5 A;  5JVT A;  5IT3 A;  3BPV A;  2HFH A;  1MJA A;  3L00 A;  2HKX A;  3FWE A;  1F9N A;  1QQI A;  3E6B A;  2A6H F;  3P7N A;  2K4B A;  3GO5 A;  3HIF A;  2CO5 A;  1OR7 A;  3JTH A;  2QYO A;  1IN8 A;  2QQA A;  3GFJ A;  2QZ8 A;  3C18 A;  5BPI A;  3FM3 A;  2L4M A;  1R5G A;  2VOP A;  1QZZ A;  3QP5 A;  4Y13 A;  4UVA A;  3MFK A;  3E3V A;  3TKY A;  3BP8 A;  3HTU A;  3IRQ A;  2JRT A;  4BAY A;  2K4J A;  3E97 A;  2W85 A;  3EET A;  2ZJ2 A;  5ICE A;  1DDN A;  5JI6 A;  2BV6 A;  1AWC A;  4KYW A;  2YX7 A;  2CQK A;  2E7X A;  2QEN A;  4EM1 A;  5KVR A;  5HLI A;  3QPH A;  1UB9 A;  5AON A;  2V79 A;  3P9K A;  2E7W A;  3OV8 A;  5DEQ A;  1Z1D A;  2DU9 A;  3Q9S A;  4EM2 A;  4BNC A;  1ZH5 A;  5FLX K;  4I02 A;  3VOD A;  1ZAO A;  4NB5 A;  1FP2 A;  2FSW A;  3QAH A;  1IXR C;  4OU0 A;  2CFX A;  2VBX A;  3VB2 A;  3VFZ A;  2O3F A;  1IAW A;  1E17 A;  3QU3 A;  2PLY A;  1W7P A;  2HGC A;  1IN5 A;  5D4R A;  4CZZ A;  2R3S A;  1ZHF A;  1G6N A;  5CYV A;  1BBY A;  1YLF A;  3VEP A;  2HEO A;  5K1Y A;  3K2Z A;  3DF8 A;  3DXJ F;  1TQP A;  2UXX A;  5E8G A;  4G7O F;  5J6X A;  1H0M A;  2GA1 A;  2VE9 A;  1CGP A;  4PGH A;  1U5T B;  4G6Q A;  3H3U A;  4M9Z A;  3WE2 A;  2KIU A;  1ZLJ A;  5K5Q A;  1W7P B;  3GEZ A;  4MQV A;  4JK1 X;  4HQM A;  2OU2 A;  1FZP B;  4BHP A;  4O6J A;  2ESN A;  1ZRF A;  2QUF A;  5ED4 A;  5ICF A;  2PJP A;  3SQN A;  3JSP A;  2HQR A;  4L5J A;  4BYY A;  2GXB A;  3F8N A;  4B09 A;  1S29 A;  1TQM A;  3J81 K;  4UNO A;  5CVR A;  4F7Z A;  1Q1H A;  4KUM A;  1HKQ A;  4MEX F;  4ESF A;  3MZH A;  3K1M A;  1FYM A;  3F22 A;  4HQE A;  2F5D A;  2XV4 S;  1FBS A;  2FE3 A;  3U9G A;  4KIC A;  3ULQ B;  1I1S A;  2FBH A;  1IXS B;  4IHT A;  2CSO A;  2CW0 F;  2LF8 A;  3HOS A;  3JTG A;  4HW0 A;  1ON2 A;  3MZY A;  4I98 B;  4FX4 A;  4I0A A;  4M72 A;  2FU4 A;  1J9I A;  1IW7 F;  1J0R A;  3O6B B;  2GQQ A;  1YW7 A;  3V8J A;  3IKV A;  2Z3Y A;  3TO6 A;  1XCB A;  3IWF A;  3ERE D;  1SD5 A;  2YPR A;  3BOQ A;  1G3Y A;  2GAU A;  1I1G A;  3KFW X;  4NQW A;  5LGT A;  1BC7 C;  2P5V A;  3KP5 A;  1G3S A;  3O3K A;  5A2Q Z;  1XSD A;  1QBJ A;  4WK8 F;  3GF2 A;  2IP2 A;  2FXA A;  3U1D A;  2XUB A;  1W5S A;  1XGS A;  3F23 A;  1O3T A;  1YIO A;  4Q4Z F;  2VT2 A;  3WU1 B;  2XRO A;  4N9I A;  1XCV A;  3T8R A;  4Q5S F;  2H94 A;  5DDG A;  2HKO A;  1FPQ A;  5HS7 A;  2P4W A;  4U88 A;  5DCM B;  1XSX A;  2DT5 A;  4RGR A;  1YQA A;  2WWY A;  1R1V A;  5D8K B;  4I01 A;  5CVU A;  2KIM A;  4EQQ A;  2FNP A;  4XLN F;  2M30 A;  1ZLK A;  2VBY A;  1XMA A;  5FD5 A;  1LEB A;  3W6J B;  2F5F A;  2DAO A;  4LB6 B;  4ESB A;  3COA C;  1FT9 A;  1MJB A;  4WXD A;  4L9V A;  2WTE A;  3HRM A;  3V8L A;  3WGG A;  3RTR A;  4RB2 C;  1FOK A;  4LGW A;  1BIA A;  1XB4 A;  4LLG F;  1HKT A;  2OAZ A;  3KET A;  1XSV A;  3K1N A;  2HOE A;  3DEU A;  4S05 A;  3V7R A;  4BXU A;  5D4S A;  5HS9 A;  1PUE E;  4RGU A;  3RKW A;  3WU0 A;  4HV6 A;  4L9T A;  2DK5 A;  4GCV A;  3M9A A;  2P7C B;  1RNL A;  2CGP A;  4P9F A;  2R7F A;  3Q5F A;  2PMH A;  1WKM A;  2JT1 A;  3CDH A;  5DCM A;  4ASN A;  4EV0 A;  2FQ3 A;  5HDN A;  2C6Y A;  3ZN0 A;  2D2W A;  3KP6 A;  2HZT A;  4HZF A;  4ZYE A;  4LK0 F;  3K9T A;  4U0V A;  4YFX F;  2VE8 A;  4RB0 A;  4BHB A;  4WF2 A;  2NS0 A;  2IVM A;  1MKM A;  3HYI A;  4KNY A;  2RDP A;  3H92 A;  2KKO A;  4ENN A;  2DQL A;  2A6E F;  2BYV E;  1GXP A;  2V9V A;  2FRH A;  1KA8 A;  2QLZ A;  5F64 A;  4A5M A;  3E6M A;  2E1C A;  2GA2 A;  5LHH A;  4D0P A;  5CLS A;  1FX7 A;  2QWW A;  2ZKZ A;  2HYF A;  2QQ9 A;  3C1D A;  4R8H A;  2ADU A;  1B9N A;  3S2W A;  1RUN A;  2GWR A;  2D1H A;  2P6T A;  3LAP A;  2R7D A;  3WTZ A;  4A0Z A;  1H9T A;  2JSC A;  3WTX C;  4AIK A;  3ROU A;  1SD7 A;  1NHA A;  1R23 A;  1J59 A;  1Z6T A;  1O7L A;  1IXC A;  2HQN A;  1SMY F;  1QPM A;  2MBF A;  3EYY A;  2X4H A;  3QRF F;  3E5U A;  4HDV A;  4OMZ A;  3I4P A;  2PG4 A;  2V1X A;  3HSR A;  4DQ2 A;  1FY7 A;  5DCF A;  1B1B A;  5E8I A;  3HRU A;  1YYV A;  3ABT A;  1OMI A;  3QOP A;  5CVI A;  5IT9 Z;  3JAM Z;  4G6D A;  3TO7 A;  2IA0 A;  3TOB A;  1QNT A;  1O3S A;  2VBW A;  4LFU A;  4A0X A;  3I53 A;  3GUD A;  2M1B A;  1IF1 A;  1O7F A;  3KLN A;  1YS6 A;  4UHT A;  4U0Y A;  1CF7 A;  1IN6 A;  4UVC A;  3V7C A;  1MDM A;  4GXO A;  1FYK A;  1FSE A;  4HLX A;  3ABU A;  3FMQ A;  4XLP F;  4GYI A;  2DQR A;  2Z99 A;  2AS5 F;  3R6S A;  4Z2Y A;  4BH9 A;  3MAJ A;  2NYX A;  1S7A A;  4HX7 A;  3GYH X;  1B9M A;  2QVO A;  3C7J A;  5D6E A;  4KN4 X;  1U78 A;  5IT9 K;  3M8E A;  5J8C A;  3MEX A;  2K27 A;  4KFC A;  1GVJ A;  3ZMD A;  4RGS A;  1Z7U A;  4FHT A;  2UZK A;  3DP7 A;  4RGX A;  2OQG A;  2EFN A;  1UST A;  4M6X A;  1C0W A;  3GXO A;  2DPD A;  2ZFW A;  2EV6 A;  1Z91 A;  3WG9 A;  1G4D A;  2YSR A;  1BI3 A;  3F6O A;  1HKS A;  3ZN1 A;  3T8T A;  4OOI A;  2Z5U A;  3PQK A;  1IN7 A;  1G3T A;  1P4X A;  2MC3 A;  1KQ8 A;  4N0B A;  2JTV A;  4G7H F;  1EH6 A;  3ELK A;  1FP1 D;  4LK1 F;  1ON1 A;  4KMU X;  3IWZ A;  3NQO A;  2W84 A;  5BQT A;  3DPL C;  3BJA A;  2L4A A;  1XD7 A;  2BE5 F;  3KEO A;  3J7A O;  1VTN C;  1STZ A;  3CTA A;  2Q8K A;  3KE2 A;  4MHG A;  4KIB A;  3FMR A;  4L5I A;  2OZ6 A;  4DNC A;  4KA4 A;  1WWX A;  4EGY A;  3FM5 A;  3F6V A;  1T0F A;  5L3D A;  4YFK F;  3BPX A;  2EWN A;  2D1V A;  2B0L A;  1RIO H;  3GX4 X;  2A5Y B;  4EVI A;  1PP7 U;  2VON A;  2VXZ A;  3DKW A;  2A69 F;  4LG0 A;  1SAX A;  3G3Z A;  1T2K A;  4EMS A;  1ZN2 A;  4S04 A;  2Z33 A;  1JE8 A;  5F6F A;  3SHF A;  1EV7 A;  4M9S A;  4WX9 A;  4KDP A;  1F5T A;  1R22 A;  4ENM A;  1BOA A;  3TGN A;  4EJT A;  4OIP F;  2XAJ A;  4M74 A;  3BDD A;  2IA1 A;  3L2C A;  2EFW A;  2V1D A;  1B4A A;  3ZMV A;  1E2X A;  1D8J A;  1UFM A;  3V4G A;  4IF4 A;  1D8K A;  1R5H A;  1KYW A;  3I54 A;  2A61 A;  3SXY A;  5FD6 A;  3ZP5 A;  3K69 A;  3HOT A;  3MCZ A;  2IJL A;  3I59 A;  2XAS A;  4ZYH A;  3LWF A;  3CUQ A;  1P6R A;  1K6O A;  5CVJ A;  2Q2E A;  4YIF A;  4XRF A;  4WXC A;  3U2R A;  4A0Y A;  1ZRE A;  1LDJ A;  1Y0U A;  3IRR A;  1P2F A;  2K7L A;  1WQ2 A;  3PFI A;  2TDX A;  4O3M A;  1MJ9 A;  4EGZ A;  2GZW A;  1R7J A;  1BI0 A;  5LGU A;  2ZO4 A;  4HLY A;  2W57 A;  5FB2 A;  2ACJ A;  2XKO A;  3JSO A;  3GZ6 A;  3EUH A;  1HST A;  4G8X A;  1KU7 A;  1V3F A;  2QQB A;  2DPU A;  4UVB A;  3G73 A;  3I58 A;  2K02 A;  4P5O A;  2MLK A;  1OYI A;  2G7U A;  1SFE A;  2NAZ A;  4U0W A;  3GWZ A;  4IPA A;  4G9Y A;  1QO0 D;  2P8T A;  1I27 A;  4IJA A;  3HRT A;  3F72 A;  3M7G A;  3OOP A;  3GW2 A;  1D5V A;  5D8L B;  5LHI A;  4IHS A;  2UWM A;  3CUO A;  2O8X A;  4R79 A;  5ILS A;  5HDK A;  1GXQ A;  3IL2 A;  2EA4 A;  4ENJ A;  2FOK A;  4I09 A;  2K86 A;  1OYY A;  3FX3 A;  4G94 A;  3I59 B;  2Y75 A;  3F3X A;  1H9G A;  4AIH A;  1OKR A;  1MD0 A;  4QWQ A;  1L3L A;  5DUI A;  3IC7 A;  4MTE A;  2XGX A;  2M87 A;  4HBL A;  1O57 A;  1Z6R A;  2VC1 A;  3TO9 A;  4FX0 A;  1HW2 A;  2RVC A;  1T38 A;  1KYZ A;  5L3E A;  1UHW A;  3B73 A;  2EFP A;  1ZGJ A;  1KGS A;  2DK8 A;  3CUQ B;  3RKX A;  1SD6 A;  2EV5 A;  3NRV A;  3LA7 A;  1JXS A;  4Q47 A;  2FA5 A;  2RQP A;  4JQF A;  4L9J A;  2KJC A;  1TTY A;  4XSZ F;  5TRD A;  5E20 A;  5L3B A;  1UHM A;  1MZB A;  3TDZ C;  4FT8 A;  3WTY C;  3QU6 A;  2O6G E;  4HA8 A;  4M71 A;  5ILU A;  2AXL A;  3RPU A;  1ZYR F;  4H0E A;  4Y15 A;  1U2W A;  1SMT A;  1P4W A;  2PI0 A;  3KP3 A;  1R1T A;  4XSX F;  1RI7 A;  2L3D A;  2PQ8 A;  2FBK A;  3F8C A;  1BJA A;  3RPQ A;  5BPD A;  2MLG A;  4K2E A;  3P9C A;  4KMF A;  2XAG A;  4PZJ A;  1GHC A;  1B59 A;  2FEZ A;  2OA4 A;  2MH2 A;  2WC2 A;  3DV8 A;  3KCC A;  4IXA A;  5H6Q A;  3TOA A;  2JPC A;  2LNB A;  4EJU A;  2DLL A;  1QZY A;  3K1P A;  3F21 A;  1QGP A;  2H09 A;  3DPT A;  1SD4 A;  3HSE A;  4P96 A;  1XDS A;  2H6C A;  1R58 A;  3GZ5 A; 
#chains in the Genus database with same CATH topology
 1ULY A;  2Y0M A;  2VKH A;  2ELH A;  2IPQ X;  4ENK A;  2ZSI B;  5E18 F;  2L7F P;  2Z16 A;  2LKP A;  5JR3 A;  1RES A;  4UXN A;  3ZMS A;  2ESH A;  3QYF A;  4PSX A;  4AVP A;  5D5U B;  3PNY A;  5E1Z B;  1YJ9 I;  3M1C A;  4CCO A;  3ISP A;  2LP0 A;  4ESJ A;  5IP9 J;  2FML A;  1X3U A;  4NUB A;  4YG2 F;  1RKW A;  2HVQ A;  3K6G A;  2NNY A;  2HOA A;  1YO5 C;  4DYQ A;  1BR4 A;  4ITV A;  4P9U A;  5E17 F;  5LRR A;  1RR8 C;  2L01 A;  3EUK L;  1YOV B;  3SEZ A;  3RSN A;  2P5L C;  3CJN A;  1QVU A;  4NDL A;  2M0M A;  1TW2 A;  6PAX A;  1MMS A;  4PFO A;  1X19 A;  1VQ5 I;  4QLC U;  1ZAR A;  3R61 A;  4ZZL A;  3S93 A;  4YII A;  2CMP A;  3TL4 X;  4S0H B;  2LC2 A;  3HHG A;  2DA1 A;  3QPL A;  4I6Z A;  1YTY A;  3R4K A;  3K4J A;  4KT6 A;  3BJO A;  3PNT A;  1ETV A;  1TWH J;  2RC4 A;  3OIQ A;  1Z7L A;  3C3W A;  5D5V B;  5HOO A;  2YU9 J;  1VQ8 I;  4C2T A;  3NEU A;  3H3V K;  3IKT A;  2R7V A;  2KZG A;  1F4K A;  1HLV A;  4IRG A;  2O61 A;  4MQ9 F;  1SFO J;  3H0D A;  3M07 A;  5DD8 A;  4OAZ A;  1XGN A;  1YFH A;  4LLL A;  1Z9C A;  1MND A;  2CG4 A;  4DZP A;  2IGM A;  2XHK A;  2KJB A;  2VBZ A;  3ZOB A;  3KIO A;  1K79 A;  5FKM A;  4BEH B;  1P4A A;  1TW3 A;  2LD5 A;  2M3A A;  1WRJ A;  2EZK A;  1B6A A;  3CUQ C;  4XLF A;  5F1R A;  3B6A A;  1U9O A;  2J5P A;  3LQR A;  2NVU B;  1JHF A;  2M45 A;  3Q0U A;  3LMM A;  3R0J A;  1PDN C;  3F9K A;  4LMY A;  5IYC J;  2ISY A;  3KYC B;  4FE4 A;  2B63 J;  1GV5 A;  3BQZ A;  1Y8R B;  4IL6 C;  1WFX A;  1S6L A;  2IS2 A;  1G8X A;  1LE8 A;  3HDD A;  4D5C A;  5J1Y A;  1VI0 A;  1FSH A;  1IJW C;  3HHH A;  2WAQ A;  3A1Y A;  3S1M J;  1JUP A;  2VJ4 A;  2IEK A;  3CP2 A;  4A12 A;  2TRT A;  2H8W A;  3GTM J;  3GFM A;  2E71 A;  1FWZ A;  1MDM B;  1LEA A;  1T08 B;  3N97 A;  4A3D J;  2DYS H;  1BW6 A;  3WTT C;  1D0X A;  2LF7 A;  5M3M J;  2EJR A;  2JUG A;  4P1W A;  1CF7 B;  1UEL B;  3RDI A;  1U8R A;  1BL0 A;  4ZZD A;  2FF4 A;  1HW1 A;  1I5Z A;  2OJE D;  1W0T A;  4BXX J;  3IHU A;  4RLQ A;  5J4Y A;  5M3F J;  3OS2 A;  2E2J J;  3GTJ J;  2TCT A;  3E6D A;  3HPG A;  3KP2 A;  3L09 A;  4MEY F;  2VOD A;  3K0L A;  4CYD A;  2GLO A;  1ZTR A;  5EEG A;  3S16 J;  1S5L C;  2Z2S B;  3M8F A;  1V54 H;  4KIG A;  4IRI A;  3HRS A;  3HM5 A;  3RIR A;  3WTW C;  3W6K B;  3LA3 A;  1BJZ A;  2UXN A;  4RS8 A;  3S1R J;  3IH4 A;  3K70 D;  4TV7 A;  4GGG A;  4E70 A;  2QBY B;  3KEQ A;  2DOA A;  2VQL A;  1TZL A;  4GYG A;  2QSH X;  3ZRG A;  1LKX A;  1MIJ A;  1OCP A;  5B3S H;  3VYT B;  3M1E A;  3CO6 C;  2DYR H;  4HSR A;  4OWR B;  4NHJ A;  2XAH A;  3I3L A;  3I64 A;  3G71 I;  2F4I A;  4OIR F;  5ERI A;  4L0Z B;  1B8I A;  2KIQ A;  2EV0 A;  3G6E I;  1Z05 A;  4PGG A;  3ASN H;  4BQO A;  1TC3 C;  1OCT C;  3L9F A;  1LB2 A;  1ZRC A;  3PSI A;  2LVS A;  2KRF A;  3BCA A;  3SDB A;  1IRG A;  3CDL A;  4EJO A;  2RGV A;  5GAD J;  3CCY A;  4N4O B;  1WGX A;  2A3S A;  2R5Z A;  1IG7 A;  2O0Y A;  2VN2 A;  5BOX A;  1T98 A;  2DMP A;  3OYJ A;  1Y39 A;  4O5V A;  1X1A A;  2DXI A;  3GME A;  2R7Q A;  3EYI A;  3PJR A;  1YX5 A;  4E7Z A;  2GIV A;  2XAF A;  2XVC A;  2OTJ I;  5DTD A;  1Y1V J;  2QEX I;  3GZN B;  1YJN I;  4HF1 A;  3BTL A;  3JW4 A;  1PUF A;  3CC4 I;  3HUG B;  4LD5 A;  2XGD A;  1USS A;  3QPS A;  2M5W A;  3HGY A;  3Q9V A;  4HF0 A;  5DM6 F;  1Z77 A;  1VND A;  2RAE A;  4G7Z F;  1UJ8 A;  1AOY A;  4LIU A;  3I71 A;  4A3E J;  3WGI A;  3LSP A;  3FBI B;  2ZFU A;  1FTT A;  1EH8 A;  2W25 A;  4LB5 A;  2COM A;  1ZGW A;  2XKP A;  4E6K G;  1JJ8 C;  4W1U A;  1BR1 A;  3UNG C;  1JUS A;  2G9W A;  5FGM A;  3NAU A;  5H20 A;  4WWC A;  3K4L A;  4UUV A;  4L9N A;  3WGH A;  2VT3 A;  3A2K A;  1WJF A;  1RZ4 A;  3MWM A;  1IN4 A;  4AWX B;  1DPU A;  5FFX A;  3TBI A;  4Y4R A;  4D7M A;  4MTD A;  4Z6Y A;  2DMU A;  1D1C A;  4XLE A;  5LEJ A;  4F52 A;  5BMZ A;  2OCE A;  2JPB A;  1S7O A;  4RM3 A;  2IGO A;  2M4K A;  4IVN A;  1BIB A;  3HJE A;  1ZG1 A;  2YR2 A;  2DDB A;  3J80 K;  2NVY J;  1MH4 A;  2X85 A;  5FKK A;  4D9J A;  4HOB A;  4D5F A;  4HDU A;  5D5W B;  2RV8 A;  4XL9 A;  2ZXJ A;  1JI8 A;  3BWG A;  2BEO A;  2VJ5 A;  1V4R A;  3I0T A;  3P9I A;  1E0E A;  1J75 A;  2ID3 A;  4CCJ A;  3G2B A;  4CIC A;  2VC0 A;  1BI2 A;  4QSH A;  2OQR A;  1R36 A;  1UHS A;  2L9V A;  1KU9 A;  5FRO A;  4BE0 A;  3BJ6 A;  4JX5 A;  2EPF A;  5J1U A;  4CYC B;  4XLC A;  3K4N A;  2A6T A;  4F3Q A;  2ZME B;  1ZG5 A;  2XRN A;  2EFO A;  4B48 A;  3OSG A;  4J00 A;  3AL0 C;  1TWA J;  4MO7 A;  3N4M A;  3CCE I;  2VUM J;  3KYL A;  4ZH4 F;  3P5J A;  5KK1 A;  1HW5 A;  4BE2 A;  4E7H A;  2DW4 A;  2VXD A;  2JA5 J;  3UR3 C;  2GBY A;  4EM0 B;  1VQ6 I;  5EG0 A;  4IOC F;  1WHU A;  5EEH A;  2E1M B;  3I9V 2;  1D1A A;  2ETH A;  2KIF A;  1GLN A;  2OBP A;  5E1X A;  3CMY A;  2STW A;  3LFK A;  3JAM K;  1JGS A;  3FXQ A;  4LG0 B;  1HDD C;  2J5O A;  4ON0 A;  3FIS A;  4XLA A;  1FBU A;  4XKC A;  4HEA 2;  3KZZ A;  4N4N B;  1P92 A;  2HI3 A;  2W24 A;  2HWV A;  5BS6 A;  4CCM A;  1HXD A;  2XIG A;  3R60 A;  3V7S A;  3TQN A;  4ZDP A;  4MNU A;  1MMD A;  3FHN A;  5E79 C;  3UKG A;  1PVE A;  1FIP A;  1XG1 A;  2KQR A;  2PX9 A;  3DWL E;  3ZQF A;  2ZNZ A;  4I7H A;  3KP4 A;  5GAG J;  1IUF A;  3RKQ A;  2JK3 A;  3HKZ N;  3ZMZ A;  1ZGA A;  4FE7 A;  2LDU A;  3DFG A;  2STT A;  3BTJ A;  1ACI A;  4HX8 A;  3CO7 C;  1ZEL A;  2DBB A;  2CW8 A;  3FXO A;  3L7W A;  3ZR8 X;  3WHC A;  5LFA A;  4OIO F;  1TNT A;  3C2B A;  1RUO A;  2ZCW A;  3LNQ A;  3O2P E;  3SYT A;  1OQY A;  4RB1 A;  2VPL A;  2ZJP F;  1R00 A;  1FLI A;  1SFX A;  2HDD A;  5C4X J;  1W7P D;  5TJJ A;  3SFZ A;  3AAF A;  1ODD A;  1YW8 A;  2OZU A;  5IOZ A;  5HNH A;  4UUS A;  2FBI A;  3CJT B;  1GVD A;  5HVQ C;  4UV9 A;  2KRC A;  1JKP C;  3VWB A;  3F8B A;  1VQ9 I;  2PBI A;  2M0C A;  3JRB A;  3GCM A;  5EZH A;  5J8F A;  4WXH A;  3E6C C;  1K78 B;  2M8E A;  3DCF A;  1QA6 A;  4U87 A;  4X0G A;  2H27 A;  2Y48 A;  4KN7 X;  4CH7 A;  3ML6 A;  4YEL A;  4BEH A;  2QCO A;  1ITY A;  5GTI C;  4AIJ A;  4KT5 C;  2X0L A;  3KP7 A;  2V7F A;  2FQ4 A;  3SZP A;  3C2G A;  2V1U A;  5K5O A;  3LA2 A;  3ZCO A;  1B72 B;  2L2O A;  1I6H J;  3FZV A;  1AU7 A;  1LDK B;  3K2A A;  2PFB A;  4MIM A;  3BZ6 A;  4FAS D;  2ZBK A;  2LKX A;  3OYE A;  2LYC A;  1DGR M;  3OYL A;  1HSJ A;  3BR6 A;  3KPH A;  1NTC A;  1LQ1 A;  3D1N I;  5HDG A;  1R9T J;  1GUU A;  4E7L A;  3OYC A;  2GXA A;  1WI9 A;  2W48 A;  4A6D A;  1VF9 A;  3BTC A;  1K7A A;  1DP7 P;  1OCZ H;  3ZPL A;  3FHZ A;  3EQL F;  5B1B H;  1D5Y A;  1U9N A;  4PCQ A;  2QBY A;  4ZYD A;  4JX6 A;  2XAQ A;  2RNG A;  3VPR A;  5ICC A;  2MD5 A;  4MLO A;  3H9G A;  4XLH A;  3GTQ J;  4OIQ F;  2FJ1 A;  1VQK I;  5D6F A;  4EAT A;  4OIN F;  1EKE A;  5FFZ A;  3PQJ A;  2BHZ A;  3JRC A;  1DPR A;  5CJ9 A;  1TLH B;  4U7B A;  4ETS A;  2YU3 A;  2W82 A;  1MBE A;  3L2W A;  4A6E A;  5FLM J;  1N25 A;  1OYW A;  4XON A;  2RN7 A;  3HG9 A;  1ZG3 A;  3H9J A;  1VQN I;  3HSF A;  3WTS C;  1AA7 A;  1NG7 A;  3B02 A;  4EJV A;  2V6C A;  2BHY A;  2G7H A;  4L18 B;  5LBQ A;  2XB0 X;  4NC8 A;  3OS0 A;  2PN6 A;  2EA2 A;  2QKL B;  3WTV C;  4LLN A;  3T0Y A;  1TWG J;  1P7I A;  2V9K A;  2PEX A;  1WSU A;  3GTK J;  1MGT A;  2W4S A;  4L5E A;  2XF7 A;  3J7A Y;  4BUP A;  2K9Q A;  2BY2 A;  5JHU A;  4BHC A;  2DT7 B;  1OFC X;  2XF5 A;  3SEQ A;  3WTU C;  3FK6 A;  3GFL A;  3VOE A;  4M3D A;  4ZC3 A;  3TDU C;  2IRF G;  3CES A;  1OLT A;  2K5C A;  2W00 A;  2RNJ A;  1IUY A;  2DI3 A;  5A2Q K;  3OS1 A;  2Q0O A;  2R7O A;  4BQQ A;  3GVA A;  3RJP A;  3ZQC A;  1XMK A;  2EK5 A;  2EB7 A;  3K4B A;  4F55 A;  4B43 A;  3HTS B;  1XDU A;  4V19 K;  4IRH A;  2IT0 A;  1FC3 A;  1X3Z B;  2JA8 J;  1ZKG A;  1BN5 A;  1YW9 A;  3F8M A;  3RYR A;  3BG7 A;  3D5L A;  2JRM A;  1A04 A;  1KQ0 A;  2E19 A;  3I5U A;  2BBY A;  3HC7 A;  3CLQ A;  3A01 A;  1F1Z A;  2EFQ A;  4HV5 A;  4PFP A;  3QYB A;  2NNN A;  2OCC H;  5TIS C;  3MQ0 A;  3SZT A;  1Y8Q B;  1E3H A;  1JHH A;  5EEA A;  4IKF A;  5LLQ A;  2I5U A;  1G3W A;  3DBH B;  5H6R A;  5JFR A;  1U5T C;  2R5Y A;  1TQI A;  3BRO A;  5AIQ A;  2XRL A;  1IGN A;  1E3P A;  4Y52 J;  5IOY A;  2E36 A;  1U3E M;  4FCY A;  3S3O A;  4AYB N;  2DO7 A;  3BQY A;  3JR9 A;  3A4C A;  3ZMT A;  3RI4 A;  5F0C A;  4BKX A;  2L02 A;  2IW5 A;  3RYP A;  2NS7 A;  2X48 A;  3S8P A;  4IHW A;  2GXG A;  3ZQ7 A;  3RPU D;  4HYE A;  1ENH A;  3OYF A;  3H3Z A;  4RB3 C;  4ZDL A;  3RKY A;  2ELJ A;  3W3C A;  2KFD A;  1PP8 F;  1V5E A;  5FKO A;  1YJW I;  1MMN A;  3S32 A;  5HS8 A;  3CCL I;  2IA2 A;  5M5W J;  3J80 Z;  2E1N A;  4MFE A;  1O3Q A;  4JBA A;  2CQ7 A;  4MGR A;  1U5T A;  2F5E A;  3S1N J;  5ILV A;  3WHB A;  3ZGK A;  2HVS A;  2DTR A;  4IO9 F;  1K61 A;  4GDF A;  2Y9Z A;  3TP0 A;  2LK2 A;  3LAJ A;  4M9X A;  3QP6 A;  1TL8 A;  4ZYG A;  1IO2 A;  3I4M J;  4R1H A;  4XBF A;  1KU3 A;  1D3Y A;  4DYR A;  3QPT A;  2LRE A;  5LEK A;  5L3F A;  2AQF A;  3T1B A;  5HLH A;  4HF2 A;  2DOE A;  3WG7 H;  1T33 A;  3CLO A;  1OPC A;  3E5X A;  4AC0 A;  1X4P A;  2XDV A;  5B66 C;  5LRS A;  4XKB A;  3J81 Z;  3MKZ A;  3LFU A;  2IS4 A;  1MBJ A;  4B1R A;  2X6Y A;  3PM1 A;  1DUX C;  3GTL J;  1ETK A;  3B6C A;  2P7V B;  1K78 A;  1LVA A;  2RKH A;  4B8X A;  2JWT A;  1I6X A;  3BCB A;  3QOD A;  4J19 A;  1A6I A;  2ID6 A;  3FKI J;  1XPX A;  2MH9 A;  4UUT A;  2O8K A;  4CCN A;  4XMY A;  4AYB A;  4C3J J;  4F91 B;  2PMU A;  3REO A;  4A2U A;  4RAY A;  3T5X A;  5JVG F;  2HR3 A;  5IP6 A;  2R5Y B;  2WV0 A;  4BL0 B;  1JKQ C;  3FMS A;  4IHV A;  3C2H A;  4HAM A;  3L1P A;  4HG2 A;  5FJ8 J;  2EZI A;  2Z9O A;  4RAZ A;  1JGG A;  2H6B A;  3G1M A;  1VQ4 I;  5L3C A;  1YS7 A;  4UUS B;  1GV2 A;  4CXF A;  4AD9 A;  2HDC A;  1W5T A;  2VOO A;  3ZQH A;  3OYN A;  4W97 A;  3CCQ I;  2JZY A;  2L54 A;  2YX4 A;  1FBQ A;  1EA3 A;  2L9S A;  3WOD F;  1EJ9 A;  3DPU A;  2Y30 A;  3BR1 A;  3ABK H;  2LRD A;  4YFN F;  2G0E A;  3BG9 A;  4PSW A;  2LY9 A;  2CWE A;  1DU0 A;  1BM9 A;  1ZK8 A;  4EJW A;  4FTH A;  2MW8 A;  2E2H J;  1IRF A;  2GM4 A;  3FF5 A;  3WE3 A;  1ONV A;  2D45 A;  1J2X A;  2EIK H;  1AHD P;  1BC8 C;  1Q1V A;  3OYA A;  1REP C;  4M73 A;  4CHU A;  4GO1 A;  3VYS B;  2LKS A;  1ZQ3 P;  3E5Q A;  2HQA A;  2IAI A;  2Q1Z B;  2JN6 A;  2P6S A;  1MBG A;  1NH3 A;  3ECH A;  4L0Y B;  2OD5 A;  4BJT A;  2DOD A;  4I0B A;  5K7H A;  3I55 I;  2HYG D;  5DD4 A;  1K6Y A;  2Y69 H;  2A5W A;  1Z67 A;  4PUS A;  1MH3 A;  1KU2 A;  5HNF A;  1HBX G;  1XGM A;  3V8K A;  1QZE A;  2BGC A;  4P55 A;  5FLX Z;  3BR3 A;  2A07 F;  3TED A;  1LJ9 A;  1T6S A;  3LQQ A;  2A68 F;  2ZXW H;  1XN7 A;  2HTJ A;  1X3W B;  2VKD A;  4CO8 A;  4C9Y A;  3CF2 A;  2OC6 A;  4N9H A;  1HF0 A;  2CV0 A;  5KHD A;  4EEF G;  4RBO A;  1TNS A;  2I8D A;  4BXF A;  4BQA A;  4Q48 A;  3RQI A;  3HKZ A;  3OIP A;  1T39 A;  2ZME A;  3HOW J;  3F8F A;  3M3Y J;  2CQQ A;  2HTS A;  3NWT A;  4V2F A;  5LHG A;  4OMY A;  1FNN A;  4HX4 A;  2F2E A;  3BY6 A;  3DQV C;  1FYL A;  5DYM A;  3EDP A;  4BY7 J;  2LSO A;  5L3G A;  5ICG A;  5C44 J;  5H2F C;  3A02 A;  2QM3 A;  1TWC J;  5HLG A;  3W2A A;  1KQ9 A;  1YG2 A;  2MA3 A;  2NRA C;  2WAD A;  2CYY A;  3FK7 A;  5D5X B;  3CCM I;  2BVL A;  1U6G A;  4I2O A;  1ORK A;  1J7K A;  1S3J A;  3BG6 A;  3FXU A;  5E1W A;  3OY9 A;  4IZZ A;  4FQG A;  5CVV A;  2IXS A;  2FNA A;  5DUK A;  2ZME C;  1ETQ A;  1UCR A;  2OV7 A;  3KX2 A;  3LSK A;  1LDD A;  4CDG A;  5EZG A;  3HUG A;  4F92 B;  1IZ1 A;  3D0S A;  4WCG A;  2HVR A;  3KZY A;  5K5R A;  2DFI A;  3OYB A;  2BVM A;  2FMY A;  2Y9Y A;  4PDK A;  5DM7 F;  2OUM A;  2HOS A;  1J5Y A;  1XGO A;  4PJ0 C;  4UV8 A;  4AVZ A;  3ZMU A;  4Y17 A;  2DA3 A;  2V4J C;  4J01 A;  1A36 A;  4U7D A;  2R7W A;  4ZTF A;  4M6Y A;  5DV5 A;  4M3G A;  4KIT B;  2F5C A;  3S2H J;  2E1O A;  3LST A;  2NOG A;  2R5Z B;  1S8N A;  2P5K A;  1ZRD A;  1EH7 A;  3L2V A;  1G59 A;  1MNE A;  5FKL A;  3GLX A;  2O03 A;  4G6T B;  1BI1 A;  2MSY A;  2L9N A;  1W4M A;  1H89 C;  2ZNY A;  2ISZ A;  4CGZ A;  3MVP A;  3PO3 J;  3CCV I;  4M3B A;  1W1W E;  1A6Q A;  1LNW A;  1L0O C;  2VAS A;  4A5N A;  3JRI A;  4LJZ F;  1TBX A;  2ECC A;  2HDW A;  3CME I;  3OOU A;  2EQR A;  2CUE A;  3GFI A;  3MN2 A;  4KIF A;  3ECO A;  5LGN A;  1Z3X A;  2YUS A;  3KLO A;  5KAI C;  1V5G A;  1SFU A;  1R1U A;  3FXR A;  5AIP A;  5DS9 A;  2BXY A;  2R7T A;  4XIC A;  1HQC A;  2HS5 A;  1LUJ B;  1O3R A;  2DJN A;  3R0A A;  5FO5 A;  5JVT A;  5IT3 A;  3BPV A;  2VQC A;  2HFH A;  1MJA A;  2RRE A;  3L00 A;  2HKX A;  4A69 C;  3FWE A;  1F9N A;  1QQI A;  3BR2 A;  3DLA A;  3E6B A;  2A6H F;  3H0G J;  4I99 C;  3P7N A;  1WJC A;  2VKE A;  2K4B A;  3GO5 A;  3HIF A;  2CO5 A;  1OR7 A;  3JTH A;  1N78 A;  2QYO A;  2M7A A;  2MYS A;  4B3X A;  2K9L A;  2MD0 A;  1SAN A;  2CUJ A;  3OYM A;  1IN8 A;  5E3O A;  2QQA A;  1Z3Y A;  2I10 A;  3PSF A;  3GFJ A;  2X6W A;  2QZ8 A;  3C18 A;  5BPI A;  3FM3 A;  2NVQ J;  2L4M A;  1R5G A;  2WY8 Q;  3OYK A;  2VOP A;  1QZZ A;  3QP5 A;  3HBL A;  2BW3 B;  4UVA A;  2X1D A;  2EIM H;  4Y13 A;  3MFK A;  3E3V A;  3H5N A;  3TKY A;  3BP8 A;  3M8J A;  3HTU A;  3IRQ A;  1VFC A;  2JRT A;  4BAY A;  1IRZ A;  1A5J A;  2LTP A;  1IDZ A;  1F43 A;  4OAY A;  4E7K A;  3ZQQ A;  2K4J A;  3E97 A;  3CMA I;  4A3M J;  3CP8 A;  3LL7 A;  2W85 A;  3EET A;  2ZJ2 A;  5ICE A;  1DDN A;  2COB A;  5JLX A;  5JI6 A;  2WAF A;  2BV6 A;  1AWC A;  4KYW A;  2YX7 A;  2CQK A;  2E7X A;  3HEF A;  2H1K A;  4XN0 A;  1XX5 A;  3PNV A;  2PMZ N;  5EF6 A;  2QEN A;  1LE8 B;  4EM1 A;  5KVR A;  4ANJ A;  5HLI A;  2ME0 A;  3JRE A;  3QPH A;  1UB9 A;  3CQZ J;  5AON A;  2V79 A;  5FLV A;  3P9K A;  2E7W A;  3IH3 A;  1BW5 A;  1I3Q J;  4XK4 A;  3OV8 A;  5DEQ A;  9ANT A;  2E35 A;  4Y7N J;  1Z1D A;  2V1N A;  2LY1 A;  2DU9 A;  1N75 A;  1VQM I;  3Q9S A;  1JKO C;  4EM2 A;  4BNC A;  1ZH5 A;  5FLX K;  4I02 A;  3VOD A;  4A3G J;  3GTO J;  1W5C C;  1ZAO A;  1XTA A;  4NB5 A;  1FOY A;  1FP2 A;  2FSW A;  1WJD A;  3QAH A;  5LD2 C;  1IXR C;  3OWT A;  4OU0 A;  2CFX A;  2VBX A;  1R4M B;  3VB2 A;  4PJM A;  3VFZ A;  5B5E C;  3ASO H;  2O3F A;  1IAW A;  1E17 A;  3QU3 A;  2NOJ B;  2PLY A;  2HPM A;  2OPT A;  1W7P A;  2HGC A;  2DDA A;  1IN5 A;  4CZZ A;  5D4R A;  2R3S A;  1ZHF A;  1G6N A;  3JCU C;  2R4G A;  4YIR X;  4LIT A;  2DTZ A;  4RAF A;  2R0Q C;  5CYV A;  4XM3 A;  4RA2 A;  1YIJ I;  1BBY A;  1YLF A;  3Q0V A;  3VEP A;  1QPI A;  2L5Q A;  2HEO A;  5F04 A;  5K1Y A;  3ERM A;  3K2Z A;  3DF8 A;  3DXJ F;  4XN3 A;  1FMW A;  4B4C A;  2DCE A;  2EH3 A;  1TQP A;  2UXX A;  3IH2 A;  5E8G A;  4G7O F;  1B8I B;  2BY3 A;  5J6X A;  1H0M A;  3LSI A;  3OYD A;  3OYG A;  2GA1 A;  1QVT A;  2ZJQ F;  2VE9 A;  1CGP A;  2ECB A;  3LSG A;  4PGH A;  3CD6 I;  2VB6 A;  1U5T B;  2XSJ C;  3O8G A;  4G6Q A;  5JLW A;  3H3U A;  4M9Z A;  3WE2 A;  2KIU A;  1ZLJ A;  4C30 A;  5K5Q A;  1W7P B;  3GEZ A;  2JA2 A;  4MQV A;  4JK1 X;  4HQM A;  2OU2 A;  1FZP B;  1I3A A;  4BHP A;  2XAU A;  4O6J A;  2ESN A;  3M4O J;  1ZRF A;  2QUF A;  5ED4 A;  2EIJ H;  4UY8 I;  5ICF A;  2PJP A;  3K4K A;  1A31 A;  3CJQ B;  3SQN A;  3JSP A;  1HCR A;  1B72 A;  5KNL A;  1JT0 A;  2E34 A;  2VIX A;  2HQR A;  1AKH B;  2NVX J;  4L5J A;  2XF6 A;  5KAF C;  4BYY A;  1DU6 A;  4CA0 A;  2GXB A;  2ZXH A;  3RQ4 A;  3F8N A;  4B09 A;  2X9D A;  1S29 A;  1TQM A;  3J81 K;  4UNO A;  5CVR A;  3S3N A;  4F7Z A;  1T8I A;  2HYJ A;  1E3O C;  4IEJ A;  2JJ7 A;  1R5I D;  1YIT I;  4BBR J;  1Q1H A;  4KUM A;  5J4V A;  3CF5 F;  1HKQ A;  3G4S I;  1X1P A;  4MEX F;  4ESF A;  3MZH A;  1Y0N A;  4II2 A;  1NK3 P;  1XC5 A;  3K1M A;  1FYM A;  3F22 A;  4DW6 A;  4A3B J;  2KMU A;  4I76 A;  2X1E A;  4HQE A;  4QPQ A;  4A3L J;  2F5D A;  5BNG A;  2XV4 S;  4CCK A;  1FBS A;  2FE3 A;  3U9G A;  4KIC A;  3F0C A;  3ULQ B;  1I1S A;  2FBH A;  5IPA A;  3BTI A;  2H1L A;  1IXS B;  3DU6 A;  4IHT A;  1RPW A;  2CSO A;  2CW0 F;  1FTZ A;  2LF8 A;  2VQH A;  4XKV A;  3HOS A;  4F93 B;  3JTG A;  2CV1 A;  2WY7 Q;  5M5Y J;  2F6C A;  2V9P A;  1FOX A;  1X1B A;  1ETO A;  3AKZ A;  4HW0 A;  2CV2 A;  1ON2 A;  2DT6 A;  5EG0 B;  3MZY A;  4I98 B;  1WZ2 A;  3FKJ A;  4FX4 A;  4I0A A;  5HLT A;  4M72 A;  4NC7 A;  2FU4 A;  1FMV A;  1MMG A;  2O7O A;  4LIV A;  5GP9 A;  3DLL F;  3HOY J;  1J9I A;  1MNM C;  1WCM J;  3CMM A;  3LSH A;  1IW7 F;  2F4M B;  1J0R A;  3O6B B;  2GQQ A;  1YW7 A;  3V8J A;  2FD5 A;  3IKV A;  2Z3Y A;  3TO6 A;  1XCB A;  3IWF A;  3ERE D;  1SD5 A;  2WA0 A;  2YPR A;  5IY5 H;  4ZJZ A;  5C3E J;  3BOQ A;  1G3Y A;  4HRI A;  2GAU A;  1I1G A;  3O8H A;  1R49 A;  3KFW X;  4NQW A;  5LGT A;  1BC7 C;  4HPQ A;  2R7S A;  2KIS A;  3JRD A;  2P5V A;  4E4H A;  3KP5 A;  1G3S A;  2B7E A;  3ONQ A;  3O3K A;  5A2Q Z;  1XSD A;  1QBJ A;  2L0K A;  4WK8 F;  2R7U A;  3GF2 A;  1K83 J;  2IP2 A;  2FXA A;  2K85 A;  4JP0 A;  5HOD A;  3U1D A;  2XUB A;  1W5S A;  3OIO A;  1XGS A;  3S14 J;  1KZH A;  1JUM A;  1F36 A;  2KP6 A;  3SZG A;  3F23 A;  1O3T A;  1YIO A;  4Q4Z F;  2VT2 A;  2UV1 A;  3WU1 B;  2XRO A;  4N9I A;  1XCV A;  3T8R A;  4Q5S F;  3IAS 2;  2H94 A;  3QYE A;  5DDG A;  2HKO A;  5K7Z A;  1FPQ A;  5HS7 A;  2MFZ A;  2F4O B;  2CU7 A;  2P4W A;  2DA7 A;  2X51 A;  4U88 A;  3TW6 A;  3EUA A;  5DCM B;  3S1Q J;  1XSX A;  2DT5 A;  1WJ5 A;  3G1O A;  4HST A;  1OJL A;  4RGR A;  1J09 A;  2EIN H;  2M34 A;  1YQA A;  2WWY A;  1R1V A;  5D8K B;  1U8B A;  1W0U A;  4I01 A;  3VSL A;  5EGO A;  5CVU A;  3OR2 C;  1VQP I;  3S2D J;  2KIM A;  4BAC A;  2Z1D A;  4Y33 A;  4EQQ A;  1X1D A;  4IQJ A;  2FNP A;  4YRV A;  2ICW G;  3WU2 C;  1T95 A;  2HQ5 A;  4XLN F;  2M30 A;  1JKR C;  1ZLK A;  2VBY A;  3E7L A;  1XMA A;  2DJI A;  1UMQ A;  5FD5 A;  4ZDO A;  1HDP A;  5GTH C;  1LEB A;  3W6J B;  2F5F A;  2DAO A;  2K9S A;  4LB6 B;  4ESB A;  3COA C;  1FT9 A;  2AQE A;  1MJB A;  4WXD A;  3FXJ A;  4L9V A;  2WTE A;  3HRM A;  3V8L A;  1QHH D;  4PJN A;  3WGG A;  3RTR A;  2JQ7 A;  5C4J J;  2PJR B;  3H9Q A;  4RB2 C;  3A03 A;  1FOK A;  3JRH A;  4LGW A;  2EZL A;  1BIA A;  1XB4 A;  2DFF A;  4LLG F;  1HKT A;  3KEY A;  2Q2E B;  1ETX A;  4C2M J;  4BS9 A;  2OAZ A;  3GLL A;  3IP4 B;  4DIQ A;  3KET A;  1XSV A;  4CYC A;  3K1N A;  2KZV A;  2WB1 A;  2HOE A;  3DEU A;  2ME6 A;  3VYU B;  4S05 A;  4CSW A;  3V7R A;  2E5Z A;  3D5R C;  2ZJR F;  2X1C A;  4BXU A;  5D4S A;  3DTE A;  4XRS G;  4C2U A;  5HS9 A;  1WH5 A;  1R71 A;  1PUE E;  2HXI A;  4RGU A;  1TT0 A;  2V26 A;  3RKW A;  1OCC H;  2EBI A;  3WU0 A;  4HV6 A;  1ERD A;  2DMT A;  4L9T A;  2DK5 A;  3DTI A;  4GCV A;  3M9A A;  4LOC A;  2XPU A;  2P7C B;  1RNL A;  3VSK A;  3JRF A;  5B1A H;  3GTG J;  1MBK A;  2CGP A;  4P9F A;  5EDN A;  3HXL A;  4IOA F;  1JT6 A;  4GRI A;  1UZC A;  2R7F A;  3Q5F A;  4G12 A;  3GBG A;  3K7A J;  2DFH A;  2JA7 J;  2PMH A;  1WKM A;  2JT1 A;  4JX4 A;  1PJR A;  1KON A;  1FEX A;  3CDH A;  3RZD J;  3HPH A;  3MKL A;  5DCM A;  3OYH A;  3BG3 A;  4CCL A;  4ASN A;  4EV0 A;  2LOO A;  2FQ3 A;  4UB6 C;  5HDN A;  2C6Y A;  4QIW N;  3ZN0 A;  2W7N A;  2D2W A;  3TW7 A;  3KP6 A;  2HZT A;  2R92 J;  4HZF A;  4ZYE A;  4E7I A;  3ABL H;  3PIP F;  4LK0 F;  3DEE A;  3IAM 2;  3K9T A;  4C3H J;  2AHQ A;  4U0V A;  4YFX F;  1YRN A;  2VE8 A;  4ABZ A;  1I50 J;  4M3E A;  3BG5 A;  4RB0 A;  4B3A A;  4BHB A;  3K70 C;  4WF2 A;  2IS1 A;  2NS0 A;  2IVM A;  5FRN A;  1MKM A;  3W2V A;  2NVT J;  1BA5 A;  3HYI A;  4KNY A;  1SFK A;  2RDP A;  4V2G A;  3H92 A;  2KKO A;  4ENN A;  3Q0W A;  5F1J A;  1AKH A;  2MGQ A;  2DQL A;  3CC2 I;  2A6E F;  2BYV E;  1GXP A;  2V9V A;  5CKT A;  2P81 A;  1S7E A;  1VZ0 A;  2ZC2 A;  2JA6 J;  1TT5 B;  2FRH A;  3MMY B;  3JRG A;  1RET A;  1IDY A;  1KA8 A;  2QLZ A;  5F64 A;  4A5M A;  3E6M A;  2E1C A;  1PUF B;  2BY1 A;  1JTY A;  2GA2 A;  2RQQ A;  3RCO A;  2PMZ A;  5LHH A;  4D0P A;  5CLS A;  2GIZ A;  2WAQ N;  1FX7 A;  2LBF A;  2QWW A;  2W1O A;  2CJJ A;  2ZKZ A;  2HYF A;  2QQ9 A;  3C1D A;  2WBM A;  2K9M A;  3I4N J;  4R8H A;  2ADU A;  1B9N A;  3S2W A;  1RUN A;  2CUZ A;  3BR0 A;  3BLY A;  4BU2 A;  4XOP A;  2BOL A;  2D1H A;  2GWR A;  2P6T A;  3LAP A;  3L2R A;  2NXN B;  2R7D A;  3WTZ A;  4A0Z A;  2WAE A;  1H9T A;  2JSC A;  3WTX C;  4AIK A;  3ROU A;  1SD7 A;  2LY2 A;  2ZXI A;  1X58 A;  4DGW B;  1NHA A;  1R23 A;  1J59 A;  1Z6T A;  1O7L A;  1IXC A;  2HQN A;  2DA4 A;  1SMY F;  1QPM A;  2MBF A;  3AG4 H;  2X4H A;  3EYY A;  1LFP A;  4QTR A;  3QRF F;  3E5U A;  4HDV A;  4XOR A;  4OMZ A;  3CCR I;  3S17 J;  3I4P A;  2HNH A;  2PG4 A;  2V1X A;  3HSR A;  4DQ2 A;  2JSP A;  1FY7 A;  5DCF A;  1W36 C;  1B1B A;  5E8I A;  2MAB A;  3CC7 I;  4BDZ A;  3SJM A;  3HRU A;  1YYV A;  3ABT A;  2OTL I;  3A01 B;  1OMI A;  3CCS I;  3QOP A;  1FOW A;  1BR2 A;  5CVI A;  1WJB A;  3BR5 A;  4XRM A;  2IBD A;  3JAM Z;  5IT9 Z;  2FUG 2;  2N8G A;  4G6D A;  4AU7 A;  3TO7 A;  2IA0 A;  2HPI A;  3TOB A;  1QNT A;  1DGW Y;  1Y6I A;  1P7J A;  1O3S A;  2VBW A;  3TP3 A;  4LFU A;  5J40 A;  4A0X A;  3I53 A;  3GUD A;  1UAA A;  2M1B A;  1U0J A;  1D0Y A;  1IF1 A;  4DBR A;  4CZC A;  1O7F A;  3KLN A;  1YS6 A;  2K40 A;  4UHT A;  5GAE J;  4M6V A;  4U0Y A;  4HNV A;  1CF7 A;  5JHF A;  2NS8 A;  4Y3O A;  1IN6 A;  4UVC A;  1Z21 A;  4NBQ A;  4RMN A;  3QWL A;  3V7C A;  4B44 A;  1MDM A;  4GXO A;  3ZQI A;  3FXL A;  1FYK A;  4DBQ A;  1FSE A;  1BOB A;  1HA8 A;  4HLX A;  3ABU A;  3FMQ A;  2O9L A;  4XLP F;  1SVL A;  2QSF X;  4GYI A;  2DQR A;  2Z99 A;  2CH0 A;  2CRG A;  5IYD J;  3A0B C;  1YX3 A;  2VJJ A;  2AS5 F;  3IV5 A;  3R6S A;  3N05 A;  4Z2Y A;  2LMD A;  2LLK A;  4BH9 A;  3MAJ A;  4PJJ A;  1R6R A;  1S7A A;  2NYX A;  4PJL A;  4HX7 A;  2BXZ A;  1Y1W J;  1XS9 A;  4ZTJ A;  4B47 A;  2M4G A;  3GYH X;  3DKY A;  1B9M A;  2WV1 A;  3NWS A;  3CDI A;  2QVO A;  3ZQG A;  3C7J A;  5D6E A;  3PUB A;  4KN4 X;  2L7K A;  1U78 A;  4IHY A;  2QQ8 A;  5IT9 K;  4BJ5 C;  3M8E A;  2AO9 A;  5J8C A;  3MEX A;  2K27 A;  1TP4 A;  4KFC A;  2LH9 A;  2YS9 A;  1GVJ A;  4XKW A;  3ZMD A;  3MD2 A;  4RGS A;  1Z7U A;  2ZSH B;  5GPC A;  4JYK A;  1WJA A;  2HXO A;  4FHT A;  2K3F A;  3L2U A;  2UZK A;  3DP7 A;  4DJA A;  2F48 A;  2K3P A;  3ABM H;  4RGX A;  2OQG A;  4H4K C;  2EFN A;  1UST A;  4M6X A;  1C0W A;  3GXO A;  2DPD A;  2ZFW A;  2EV6 A;  2LBF B;  2P0W A;  3S3M A;  1Z91 A;  3WG9 A;  1FIA A;  2R7R A;  3LSM A;  1RR7 A;  1G4D A;  3PUF A;  3FXM A;  4PK4 A;  2YSR A;  4HNU A;  3A0H C;  2QA4 I;  2UUZ A;  1BI3 A;  3F6O A;  1HKS A;  3OL3 A;  3PO2 J;  1W36 D;  3DBR B;  3J7Z I;  3DTK A;  1QRY A;  2JMW A;  3E0J B;  3ZN1 A;  3H1C A;  3T8T A;  1MW7 A;  4OOI A;  2Z5U A;  4GFB A;  3PQK A;  1IN7 A;  4FET A;  1G3T A;  4RM2 A;  4BBS J;  1P4X A;  2MC3 A;  1T0F C;  4A3K J;  1KQ8 A;  3I56 I;  4N0B A;  2JTV A;  4BDY A;  4G7H F;  1OCO H;  1EH6 A;  4IX7 A;  3ELK A;  1FP1 D;  5IP7 J;  2XB5 A;  4LK1 F;  4A93 J;  1MSE C;  1ETY A;  1ON1 A;  4KMU X;  1M1E B;  2VQG A;  3IWZ A;  3AG1 H;  3NQO A;  3L2Q A;  2W84 A;  2E2I J;  5BQT A;  1MSF C;  4BE1 A;  3DPL C;  3GTP J;  3BJA A;  3KYD B;  2L4A A;  2QSG X;  1XD7 A;  2BE5 F;  3V42 A;  3LSJ A;  3KEO A;  3J7A O;  1VTN C;  2DOF A;  1STZ A;  3CTA A;  2Q8K A;  3ZXS A;  4E7S A;  5E3N A;  3MKW B;  1EF4 A;  1WPK A;  2QGU A;  3KE2 A;  2M9H A;  5E3M A;  4MHG A;  4KIB A;  4XR6 A;  3FMR A;  3MKY B;  4L5I A;  3OR1 C;  2CS3 A;  5TGT A;  2DMQ A;  2OZ6 A;  2DMN A;  4DNC A;  1WWX A;  4KA4 A;  2XGC A;  4EGY A;  3FM5 A;  1IV8 A;  3F6V A;  1T0F A;  2JVH A;  3VDX A;  5L3D A;  2LFB A;  2VJI A;  4AUX A;  4YFK F;  4ZYA A;  3BPX A;  4KJZ A;  1UG2 A;  3JRA A;  2EWN A;  1APL C;  4D1Q A;  2D1V A;  2B0L A;  1RIO H;  3PIO F;  3GX4 X;  1O4X A;  2BW3 A;  5F27 A;  2A5Y B;  2Y0S N;  1GT0 C;  5EYR A;  2BY0 A;  5IYB J;  4EVI A;  2L7M P;  1PP7 U;  2HOT A;  2VON A;  2Y0S A;  2VXZ A;  1A35 A;  3H36 A;  3PFY A;  2MC4 A;  3BC8 A;  1ZR4 A;  3DKW A;  2A69 F;  4LG0 A;  2E5N A;  1SAX A;  3G3Z A;  1T2K A;  4EMS A;  1IV6 A;  1OCR H;  3LOC A;  1HOM A;  1ZN2 A;  3AFH A;  4E7J A;  3K4C A;  4S04 A;  2F5V A;  2Z33 A;  1P9Q C;  1JE8 A;  3QOE A;  5F6F A;  3SHF A;  1EV7 A;  1X4O A;  4M9S A;  2DN0 A;  1ZR2 A;  4WX9 A;  4KDP A;  3RZO J;  1F5T A;  2M2E A;  1YRN B;  1R22 A;  2EIL H;  1ETW A;  5K7F A;  4ENM A;  1BOA A;  3TGN A;  4EJT A;  2KL4 A;  4OIP F;  1WI3 A;  2XAJ A;  4M74 A;  4YEJ A;  3BDD A;  2IA1 A;  2ZB9 A;  3L2C A;  2EFW A;  2V1D A;  1B4A A;  2JVG A;  1NK2 P;  3ZMV A;  1E2X A;  1HC8 A;  1D8J A;  1UFM A;  3V4G A;  2L7Z A;  1YE9 A;  2HZD A;  4IF4 A;  1D8K A;  3HB9 A;  1R5H A;  2PJR A;  2R7X A;  1KYW A;  3I54 A;  2A61 A;  3W2W A;  2QF7 A;  3SXY A;  5FD6 A;  3ZP5 A;  3K69 A;  2KDZ A;  3HOT A;  3AL0 B;  3MCZ A;  1QHG A;  3CJR B;  2IJL A;  3I59 A;  2XAS A;  2ELK A;  4ZYH A;  3LWF A;  3CUQ A;  1P6R A;  1K6O A;  5CVJ A;  5CQE A;  1YI2 I;  2L9R A;  2R93 J;  2VL8 A;  2WB1 N;  1GDT A;  2Q2E A;  4YIF A;  4XRF A;  3SFI A;  4WXC A;  3HZJ A;  3U2R A;  4IHX A;  4A0Y A;  1ZRE A;  1RC9 A;  1LDJ A;  2GOX B;  1Y0U A;  2K9N A;  3IRR A;  3OL4 A;  1P2F A;  2K7L A;  1JJ6 C;  1K4S A;  1WQ2 A;  2FX0 A;  3PFI A;  2B9S A;  2OF7 A;  2TDX A;  4O3M A;  1SAU A;  3FBN B;  1MJ9 A;  1POG A;  4EGZ A;  5FRM A;  1TWF J;  1R7J A;  2GZW A;  1BI0 A;  1X2N A;  2DA6 A;  2KT0 A;  4MFD A;  3BZC A;  5LGU A;  4DZJ A;  1D1B A;  2ZO4 A;  4HLY A;  2W57 A;  5FB2 A;  5F0H A;  4BGD A;  2ACJ A;  3X2Q H;  2DFE A;  2XKO A;  1RRJ A;  3JSO A;  3GZ6 A;  2X6O A;  3EUH A;  1G2H A;  3EPZ A;  1HST A;  4G8X A;  1KU7 A;  2XGE A;  1V3F A;  2QQB A;  4FIS A;  2DPU A;  3D5S C;  4RAG A;  4UVB A;  3G73 A;  3I58 A;  2K02 A;  4P5O A;  5EGO B;  2MLK A;  2VI6 A;  1SEU A;  1OYI A;  3TMO A;  2G7U A;  2MG4 A;  1MBH A;  1DQU A;  1SFE A;  3VYR B;  2NAZ A;  3Q3S A;  4U0W A;  2M7B A;  3GWZ A;  2E60 A;  1R4N B;  4IPA A;  4BJ6 C;  2VPR A;  4A3J J;  3U21 A;  1SVO A;  4XOT A;  4G9Y A;  1QO0 D;  3PL8 A;  2LG4 A;  4A3F J;  4X6A J;  1CQT A;  2P8T A;  1VQ7 I;  3HOV J;  3NAR A;  1I39 A;  1I27 A;  4IJA A;  3HRT A;  3F72 A;  3M7G A;  1WH7 A;  3OOP A;  5FKN A;  1YHQ I;  5J3L A;  3GW2 A;  1D5V A;  4XID A;  1OIS A;  3QQA A;  4X1E A;  5D8L B;  2KDO A;  5LHI A;  1K4T A;  1SVM A;  3IUO A;  4IHS A;  2UWM A;  3CUO A;  2O8X A;  1OR7 C;  4DOZ A;  4R79 A;  5ILS A;  2JUC A;  4XNF A;  5HDK A;  1IC8 A;  4JOM A;  1GXQ A;  1LFU P;  2DA5 A;  3IL2 A;  3LSR A;  1VQO I;  2CQN A;  2EA4 A;  4ENJ A;  2FOK A;  4I09 A;  2K86 A;  5M5X J;  1OYY A;  3FX3 A;  1X2M A;  3OYI A;  4G94 A;  4KIS A;  1PYV A;  1WVR A;  3I59 B;  4RLF A;  2Y75 A;  3F3X A;  1H9G A;  4AIH A;  4LG3 A;  1OKR A;  1MD0 A;  4QWQ A;  1L3L A;  4NQW B;  4IQ4 A;  1S72 I;  3DBL B;  5DUI A;  4CUG A;  3IC7 A;  4QPO A;  3S15 J;  4MTE A;  2XGX A;  2M87 A;  5F08 A;  4HBL A;  1O57 A;  1Z6R A;  2VC1 A;  3TO9 A;  5F0F A;  4FX0 A;  3U1K A;  3CZ6 A;  5CPR B;  1HW2 A;  2RVC A;  1T38 A;  1KYZ A;  5L3E A;  1UHW A;  3FXK A;  2Y2Z A;  2XPW A;  3B73 A;  2EFP A;  5J1R A;  1D0Z A;  1ZGJ A;  2VLA A;  2XC7 A;  1KGS A;  1X1C A;  2DK8 A;  2HU9 A;  1LFB A;  3CUQ B;  2FOW A;  3RKX A;  3G1L A;  1SD6 A;  2EV5 A;  3NRV A;  3ESW B;  3LA7 A;  1MMA A;  3AG2 H;  4UB8 C;  1JXS A;  1LPQ A;  3BZK A;  2KHM A;  4BY1 J;  2IGN A;  2KRH A;  4D7N A;  3J7Y J;  4Q47 A;  1FJL A;  2FA5 A;  2RQP A;  4JQF A;  2KLO A;  4BQN A;  3FIW A;  4L9J A;  3CCJ I;  1QU3 A;  3DU5 A;  2KJC A;  2CW7 A;  4M3F A;  4AID A;  1DP3 A;  1TTY A;  4XSZ F;  5TRD A;  1N77 A;  1UG0 A;  3H5A A;  2VKV A;  5E20 A;  5L3B A;  1UHM A;  4NNJ A;  3HL2 A;  1T56 A;  4HNT A;  5CQG A;  2QKM B;  1MZB A;  3TDZ C;  1IRX A;  3HOX J;  2BZT A;  3OMY A;  4DYC A;  4FT8 A;  2CFO A;  3DEW A;  3K4M A;  3WTY C;  3QU6 A;  1V55 H;  3E1S A;  2O6G E;  3MZ8 A;  4HA8 A;  2V6E A;  2IGK A;  1Y56 A;  3BT9 A;  4XRS A;  1V5F A;  4M71 A;  2R7Z J;  5ILU A;  2CUF A;  2AXL A;  3RPU A;  3KZI C;  1ZYR F;  4H0E A;  2E1M C;  3H5R A;  1RKT A;  4Y15 A;  3HGG A;  2O5R A;  1Z0X A;  2M8G X;  1U2W A;  3DKX A;  1SMT A;  1P4W A;  2PI0 A;  3KP3 A;  5KCM A;  1R1T A;  1XMX A;  1H88 C;  2LR8 A;  4XSX F;  4RDU A;  1RI7 A;  2L3D A;  2PQ8 A;  2FBK A;  4XQF A;  2H8R A;  4A3C J;  3F8C A;  1S9H A;  1BJA A;  3RPQ A;  3FDY A;  5E3L A;  5BPD A;  2MLG A;  4K2E A;  4AM3 A;  4A3I J;  3P9C A;  2D5V A;  1NG6 A;  4II3 A;  2Y31 A;  5J47 A;  2A05 A;  3AG3 H;  4NC6 A;  2GOM A;  1SC7 A;  1VQL I;  2AXT C;  4KMF A;  2XAG A;  3CCU I;  4PZJ A;  3HOZ J;  1GHC A;  5GPA A;  1B59 A;  2FEZ A;  2OA4 A;  2MH2 A;  2WC2 A;  3DV8 A;  2X6X A;  5EJC A;  1MBF A;  3KCC A;  4IXA A;  5H6Q A;  3W6V A;  2XSD C;  3SDG A;  2EZH A;  3TOA A;  2CQX A;  2JPC A;  5GAH J;  1WJE A;  1JTX A;  2LNB A;  4EJU A;  2DLL A;  1QZY A;  3K1P A;  3F21 A;  1QGP A;  2DA2 A;  2H09 A;  3EUH C;  3HOU J;  3DPT A;  2IS6 A;  1SD4 A;  4C3I J;  1H8A C;  3HSE A;  3ZQL A;  3H35 A;  1LVK A;  4P96 A;  1XDS A;  2H6C A;  1R58 A;  2XPV A;  3GZ5 A;  3OSF A;  2KPM A;  3K10 A; 
#chains in the Genus database with same CATH homology
 1ULY A;  2Y0M A;  2ELH A;  2IPQ X;  4ENK A;  5E18 F;  2LKP A;  5JR3 A;  4UXN A;  3ZMS A;  2ESH A;  4AVP A;  5D5U B;  5E1Z B;  3ISP A;  4ESJ A;  2FML A;  1X3U A;  4YG2 F;  2NNY A;  1YO5 C;  4P9U A;  5E17 F;  5LRR A;  2L01 A;  2P5L C;  3CJN A;  1TW2 A;  6PAX A;  4QLC U;  1ZAR A;  3R61 A;  4ZZL A;  4YII A;  3HHG A;  1YTY A;  3R4K A;  3BJO A;  2RC4 A;  5D5V B;  3C3W A;  5HOO A;  3NEU A;  3IKT A;  1F4K A;  4IRG A;  2O61 A;  4MQ9 F;  5DD8 A;  1XGN A;  1YFH A;  4LLL A;  1Z9C A;  2CG4 A;  2XHK A;  2KJB A;  2VBZ A;  1K79 A;  1P4A A;  1TW3 A;  1WRJ A;  1B6A A;  3CUQ C;  5F1R A;  2J5P A;  3LQR A;  1JHF A;  2M45 A;  3R0J A;  1PDN C;  4LMY A;  2ISY A;  1S6L A;  1FSH A;  3HHH A;  4A12 A;  3GFM A;  1FWZ A;  1MDM B;  1LEA A;  3N97 A;  3WTT C;  2LF7 A;  2EJR A;  1CF7 B;  3RDI A;  1U8R A;  4ZZD A;  2FF4 A;  1HW1 A;  1I5Z A;  3IHU A;  3E6D A;  3L09 A;  3KP2 A;  2VOD A;  4MEY F;  3K0L A;  4CYD A;  5EEG A;  4KIG A;  4IRI A;  3M8F A;  3HRS A;  3RIR A;  3WTW C;  3W6K B;  3LA3 A;  2UXN A;  4RS8 A;  4TV7 A;  4GGG A;  4E70 A;  2QBY B;  3KEQ A;  4GYG A;  3M1E A;  3CO6 C;  4NHJ A;  2XAH A;  3I64 A;  4OIR F;  5ERI A;  4L0Z B;  2EV0 A;  1Z05 A;  4PGG A;  1ZRC A;  3L9F A;  1LB2 A;  2KRF A;  1IRG A;  4EJO A;  2RGV A;  2A3S A;  2O0Y A;  2VN2 A;  5BOX A;  1T98 A;  4O5V A;  3EYI A;  2GIV A;  2XAF A;  2XVC A;  4HF1 A;  3JW4 A;  4LD5 A;  1USS A;  2M5W A;  3Q9V A;  4HF0 A;  4G7Z F;  1AOY A;  3I71 A;  3WGI A;  1EH8 A;  2W25 A;  4LB5 A;  2COM A;  2XKP A;  2G9W A;  5FGM A;  5H20 A;  4WWC A;  4UUV A;  4L9N A;  3WGH A;  2VT3 A;  1RZ4 A;  3MWM A;  1IN4 A;  4AWX B;  1DPU A;  5FFX A;  4MTD A;  5LEJ A;  5BMZ A;  2JPB A;  1S7O A;  4IVN A;  1BIB A;  1ZG1 A;  2YR2 A;  3J80 K;  4HOB A;  4HDU A;  5D5W B;  2RV8 A;  2ZXJ A;  3BWG A;  2BEO A;  3I0T A;  1V4R A;  3P9I A;  1J75 A;  4CIC A;  2VC0 A;  1BI2 A;  2OQR A;  1R36 A;  1KU9 A;  3BJ6 A;  2ZME B;  1ZG5 A;  2XRN A;  2EFO A;  3N4M A;  4ZH4 F;  5KK1 A;  1HW5 A;  2DW4 A;  4EM0 B;  5EEH A;  2ETH A;  2KIF A;  2OBP A;  2STW A;  5E1X A;  3LFK A;  3JAM K;  1JGS A;  3FXQ A;  4LG0 B;  2J5O A;  4ON0 A;  1FBU A;  3KZZ A;  1P92 A;  2W24 A;  2HWV A;  5BS6 A;  1HXD A;  2XIG A;  3R60 A;  3V7S A;  3TQN A;  4MNU A;  2ZNZ A;  4I7H A;  3KP4 A;  3ZMZ A;  1ZGA A;  2LDU A;  3DFG A;  2STT A;  4HX8 A;  3CO7 C;  2DBB A;  3L7W A;  4OIO F;  1TNT A;  1RUO A;  2ZCW A;  3O2P E;  4RB1 A;  1R00 A;  1FLI A;  1SFX A;  1W7P D;  5TJJ A;  3SFZ A;  3AAF A;  1ODD A;  1YW8 A;  2OZU A;  2FBI A;  5HVQ C;  4UV9 A;  3F8B A;  2PBI A;  5J8F A;  4WXH A;  3E6C C;  1K78 B;  2M8E A;  2H27 A;  2Y48 A;  4KN7 X;  3ML6 A;  4AIJ A;  4KT5 C;  2X0L A;  3KP7 A;  3SZP A;  2V1U A;  5K5O A;  3LA2 A;  3FZV A;  1LDK B;  2PFB A;  3BZ6 A;  2ZBK A;  1HSJ A;  1LQ1 A;  5HDG A;  1WI9 A;  4A6D A;  1K7A A;  1DP7 P;  3ZPL A;  3FHZ A;  3EQL F;  4PCQ A;  2QBY A;  4ZYD A;  2XAQ A;  5ICC A;  2MD5 A;  4OIQ F;  5D6F A;  4OIN F;  5FFZ A;  3PQJ A;  1DPR A;  5CJ9 A;  1TLH B;  4U7B A;  4ETS A;  2YU3 A;  4A6E A;  1OYW A;  2RN7 A;  1ZG3 A;  3HSF A;  3WTS C;  3B02 A;  4EJV A;  2V6C A;  2G7H A;  4L18 B;  5LBQ A;  2PN6 A;  2EA2 A;  3WTV C;  4LLN A;  3T0Y A;  2PEX A;  1WSU A;  1MGT A;  5JHU A;  4BHC A;  3WTU C;  3GFL A;  3VOE A;  3TDU C;  2IRF G;  2RNJ A;  1IUY A;  2DI3 A;  5A2Q K;  2Q0O A;  3GVA A;  3RJP A;  1XMK A;  2EK5 A;  2EB7 A;  3HTS B;  1XDU A;  4IRH A;  2IT0 A;  1FC3 A;  1BN5 A;  1YW9 A;  3F8M A;  3RYR A;  3D5L A;  1A04 A;  1KQ0 A;  3I5U A;  2BBY A;  1F1Z A;  2EFQ A;  4HV5 A;  2NNN A;  3MQ0 A;  3SZT A;  1JHH A;  5LLQ A;  5H6R A;  1G3W A;  5JFR A;  1U5T C;  1TQI A;  3BRO A;  5AIQ A;  1U3E M;  2DO7 A;  3ZMT A;  3RI4 A;  2L02 A;  2IW5 A;  3RYP A;  2GXG A;  3ZQ7 A;  4HYE A;  3H3Z A;  4RB3 C;  3RKY A;  1PP8 F;  5HS8 A;  2IA2 A;  3J80 Z;  2E1N A;  1O3Q A;  4JBA A;  4MGR A;  1U5T A;  2F5E A;  5ILV A;  2DTR A;  3LAJ A;  4M9X A;  3QP6 A;  4ZYG A;  4R1H A;  4XBF A;  1KU3 A;  1D3Y A;  3QPT A;  5LEK A;  5L3F A;  3T1B A;  5HLH A;  4HF2 A;  3CLO A;  1OPC A;  3E5X A;  5LRS A;  3J81 Z;  1DUX C;  2P7V B;  1K78 A;  1LVA A;  2RKH A;  4B8X A;  1I6X A;  2MH9 A;  2PMU A;  3REO A;  4A2U A;  4RAY A;  3T5X A;  2HR3 A;  2WV0 A;  3FMS A;  4HAM A;  2Z9O A;  4RAZ A;  2H6B A;  5L3C A;  1YS7 A;  4CXF A;  4AD9 A;  2HDC A;  1W5T A;  2VOO A;  2JZY A;  2L54 A;  2YX4 A;  1FBQ A;  3WOD F;  4YFN F;  2CWE A;  1BM9 A;  4EJW A;  1IRF A;  3FF5 A;  3WE3 A;  1ONV A;  2D45 A;  1J2X A;  1BC8 C;  1REP C;  4M73 A;  4CHU A;  4GO1 A;  3E5Q A;  2P6S A;  3ECH A;  4L0Y B;  2OD5 A;  4I0B A;  2HYG D;  5DD4 A;  1KU2 A;  1HBX G;  1XGM A;  3V8K A;  2BGC A;  4P55 A;  5FLX Z;  2A07 F;  1LJ9 A;  1T6S A;  3LQQ A;  2A68 F;  1XN7 A;  2HTJ A;  4CO8 A;  4N9H A;  1TNS A;  4BQA A;  4Q48 A;  1T39 A;  2ZME A;  3F8F A;  2HTS A;  5LHG A;  4OMY A;  1FNN A;  4HX4 A;  2F2E A;  3BY6 A;  3DQV C;  1FYL A;  5DYM A;  3EDP A;  2LSO A;  5L3G A;  5ICG A;  2QM3 A;  5HLG A;  1KQ9 A;  1YG2 A;  2MA3 A;  2NRA C;  2CYY A;  5D5X B;  1U6G A;  4I2O A;  1J7K A;  1S3J A;  3FXU A;  5E1W A;  5CVV A;  2FNA A;  5DUK A;  1UCR A;  4CDG A;  1LDD A;  3HUG A;  1IZ1 A;  3D0S A;  4WCG A;  3KZY A;  5K5R A;  2DFI A;  2FMY A;  4PDK A;  1J5Y A;  1XGO A;  4UV8 A;  3ZMU A;  4Y17 A;  4U7D A;  4M6Y A;  5DV5 A;  2F5C A;  3LST A;  1S8N A;  2P5K A;  1ZRD A;  1EH7 A;  3GLX A;  2O03 A;  1BI1 A;  1W4M A;  2ZNY A;  2ISZ A;  4CGZ A;  1LNW A;  1L0O C;  4A5N A;  4LJZ F;  1TBX A;  3GFI A;  4KIF A;  3ECO A;  5LGN A;  3KLO A;  1SFU A;  1R1U A;  3FXR A;  5AIP A;  1HQC A;  2HS5 A;  1O3R A;  3R0A A;  5FO5 A;  5JVT A;  5IT3 A;  3BPV A;  2HFH A;  1MJA A;  3L00 A;  2HKX A;  3FWE A;  1F9N A;  1QQI A;  3E6B A;  2A6H F;  3P7N A;  2K4B A;  3GO5 A;  3HIF A;  2CO5 A;  1OR7 A;  3JTH A;  2QYO A;  1IN8 A;  2QQA A;  3GFJ A;  2QZ8 A;  3C18 A;  5BPI A;  3FM3 A;  2L4M A;  1R5G A;  2VOP A;  1QZZ A;  3QP5 A;  4Y13 A;  4UVA A;  3MFK A;  3E3V A;  3TKY A;  3BP8 A;  3HTU A;  3IRQ A;  2JRT A;  4BAY A;  2K4J A;  3E97 A;  2W85 A;  3EET A;  2ZJ2 A;  5ICE A;  1DDN A;  5JI6 A;  2BV6 A;  1AWC A;  4KYW A;  2YX7 A;  2CQK A;  2E7X A;  2QEN A;  4EM1 A;  5KVR A;  5HLI A;  3QPH A;  1UB9 A;  5AON A;  2V79 A;  3P9K A;  2E7W A;  3OV8 A;  5DEQ A;  1Z1D A;  2DU9 A;  3Q9S A;  4EM2 A;  4BNC A;  1ZH5 A;  5FLX K;  4I02 A;  3VOD A;  1ZAO A;  4NB5 A;  1FP2 A;  2FSW A;  3QAH A;  1IXR C;  4OU0 A;  2CFX A;  2VBX A;  3VB2 A;  3VFZ A;  2O3F A;  1IAW A;  1E17 A;  3QU3 A;  2PLY A;  1W7P A;  2HGC A;  1IN5 A;  5D4R A;  4CZZ A;  2R3S A;  1ZHF A;  1G6N A;  5CYV A;  1BBY A;  1YLF A;  3VEP A;  2HEO A;  5K1Y A;  3K2Z A;  3DF8 A;  3DXJ F;  1TQP A;  2UXX A;  5E8G A;  4G7O F;  5J6X A;  1H0M A;  2GA1 A;  2VE9 A;  1CGP A;  4PGH A;  1U5T B;  4G6Q A;  3H3U A;  4M9Z A;  3WE2 A;  2KIU A;  1ZLJ A;  5K5Q A;  1W7P B;  3GEZ A;  4MQV A;  4JK1 X;  4HQM A;  2OU2 A;  1FZP B;  4BHP A;  4O6J A;  2ESN A;  1ZRF A;  2QUF A;  5ED4 A;  5ICF A;  2PJP A;  3SQN A;  3JSP A;  2HQR A;  4L5J A;  4BYY A;  2GXB A;  3F8N A;  4B09 A;  1S29 A;  1TQM A;  3J81 K;  4UNO A;  5CVR A;  4F7Z A;  1Q1H A;  4KUM A;  1HKQ A;  4MEX F;  4ESF A;  3MZH A;  3K1M A;  1FYM A;  3F22 A;  4HQE A;  2F5D A;  2XV4 S;  1FBS A;  2FE3 A;  3U9G A;  4KIC A;  3ULQ B;  1I1S A;  2FBH A;  1IXS B;  4IHT A;  2CSO A;  2CW0 F;  2LF8 A;  3HOS A;  3JTG A;  4HW0 A;  1ON2 A;  3MZY A;  4I98 B;  4FX4 A;  4I0A A;  4M72 A;  2FU4 A;  1J9I A;  1IW7 F;  1J0R A;  3O6B B;  2GQQ A;  1YW7 A;  3V8J A;  3IKV A;  2Z3Y A;  3TO6 A;  1XCB A;  3IWF A;  3ERE D;  1SD5 A;  2YPR A;  3BOQ A;  1G3Y A;  2GAU A;  1I1G A;  3KFW X;  4NQW A;  5LGT A;  1BC7 C;  2P5V A;  3KP5 A;  1G3S A;  3O3K A;  5A2Q Z;  1XSD A;  1QBJ A;  4WK8 F;  3GF2 A;  2IP2 A;  2FXA A;  3U1D A;  2XUB A;  1W5S A;  1XGS A;  3F23 A;  1O3T A;  1YIO A;  4Q4Z F;  2VT2 A;  3WU1 B;  2XRO A;  4N9I A;  1XCV A;  3T8R A;  4Q5S F;  2H94 A;  5DDG A;  2HKO A;  1FPQ A;  5HS7 A;  2P4W A;  4U88 A;  5DCM B;  1XSX A;  2DT5 A;  4RGR A;  1YQA A;  2WWY A;  1R1V A;  5D8K B;  4I01 A;  5CVU A;  2KIM A;  4EQQ A;  2FNP A;  4XLN F;  2M30 A;  1ZLK A;  2VBY A;  1XMA A;  5FD5 A;  1LEB A;  3W6J B;  2F5F A;  2DAO A;  4LB6 B;  4ESB A;  3COA C;  1FT9 A;  1MJB A;  4WXD A;  4L9V A;  2WTE A;  3HRM A;  3V8L A;  3WGG A;  3RTR A;  4RB2 C;  1FOK A;  4LGW A;  1BIA A;  1XB4 A;  4LLG F;  1HKT A;  2OAZ A;  3KET A;  1XSV A;  3K1N A;  2HOE A;  3DEU A;  4S05 A;  3V7R A;  4BXU A;  5D4S A;  5HS9 A;  1PUE E;  4RGU A;  3RKW A;  3WU0 A;  4HV6 A;  4L9T A;  2DK5 A;  4GCV A;  3M9A A;  2P7C B;  1RNL A;  2CGP A;  4P9F A;  2R7F A;  3Q5F A;  2PMH A;  1WKM A;  2JT1 A;  3CDH A;  5DCM A;  4ASN A;  4EV0 A;  2FQ3 A;  5HDN A;  2C6Y A;  3ZN0 A;  2D2W A;  3KP6 A;  2HZT A;  4HZF A;  4ZYE A;  4LK0 F;  3K9T A;  4U0V A;  4YFX F;  2VE8 A;  4RB0 A;  4BHB A;  4WF2 A;  2NS0 A;  2IVM A;  1MKM A;  3HYI A;  4KNY A;  2RDP A;  3H92 A;  2KKO A;  4ENN A;  2DQL A;  2A6E F;  2BYV E;  1GXP A;  2V9V A;  2FRH A;  1KA8 A;  2QLZ A;  5F64 A;  4A5M A;  3E6M A;  2E1C A;  2GA2 A;  5LHH A;  4D0P A;  5CLS A;  1FX7 A;  2QWW A;  2ZKZ A;  2HYF A;  2QQ9 A;  3C1D A;  4R8H A;  2ADU A;  1B9N A;  3S2W A;  1RUN A;  2GWR A;  2D1H A;  2P6T A;  3LAP A;  2R7D A;  3WTZ A;  4A0Z A;  1H9T A;  2JSC A;  3WTX C;  4AIK A;  3ROU A;  1SD7 A;  1NHA A;  1R23 A;  1J59 A;  1Z6T A;  1O7L A;  1IXC A;  2HQN A;  1SMY F;  1QPM A;  2MBF A;  3EYY A;  2X4H A;  3QRF F;  3E5U A;  4HDV A;  4OMZ A;  3I4P A;  2PG4 A;  2V1X A;  3HSR A;  4DQ2 A;  1FY7 A;  5DCF A;  1B1B A;  5E8I A;  3HRU A;  1YYV A;  3ABT A;  1OMI A;  3QOP A;  5CVI A;  5IT9 Z;  3JAM Z;  4G6D A;  3TO7 A;  2IA0 A;  3TOB A;  1QNT A;  1O3S A;  2VBW A;  4LFU A;  4A0X A;  3I53 A;  3GUD A;  2M1B A;  1IF1 A;  1O7F A;  3KLN A;  1YS6 A;  4UHT A;  4U0Y A;  1CF7 A;  1IN6 A;  4UVC A;  3V7C A;  1MDM A;  4GXO A;  1FYK A;  1FSE A;  4HLX A;  3ABU A;  3FMQ A;  4XLP F;  4GYI A;  2DQR A;  2Z99 A;  2AS5 F;  3R6S A;  4Z2Y A;  4BH9 A;  3MAJ A;  2NYX A;  1S7A A;  4HX7 A;  3GYH X;  1B9M A;  2QVO A;  3C7J A;  5D6E A;  4KN4 X;  1U78 A;  5IT9 K;  3M8E A;  5J8C A;  3MEX A;  2K27 A;  4KFC A;  1GVJ A;  3ZMD A;  4RGS A;  1Z7U A;  4FHT A;  2UZK A;  3DP7 A;  4RGX A;  2OQG A;  2EFN A;  1UST A;  4M6X A;  1C0W A;  3GXO A;  2DPD A;  2ZFW A;  2EV6 A;  1Z91 A;  3WG9 A;  1G4D A;  2YSR A;  1BI3 A;  3F6O A;  1HKS A;  3ZN1 A;  3T8T A;  4OOI A;  2Z5U A;  3PQK A;  1IN7 A;  1G3T A;  1P4X A;  2MC3 A;  1KQ8 A;  4N0B A;  2JTV A;  4G7H F;  1EH6 A;  3ELK A;  1FP1 D;  4LK1 F;  1ON1 A;  4KMU X;  3IWZ A;  3NQO A;  2W84 A;  5BQT A;  3DPL C;  3BJA A;  2L4A A;  1XD7 A;  2BE5 F;  3KEO A;  3J7A O;  1VTN C;  1STZ A;  3CTA A;  2Q8K A;  3KE2 A;  4MHG A;  4KIB A;  3FMR A;  4L5I A;  2OZ6 A;  4DNC A;  4KA4 A;  1WWX A;  4EGY A;  3FM5 A;  3F6V A;  1T0F A;  5L3D A;  4YFK F;  3BPX A;  2EWN A;  2D1V A;  2B0L A;  1RIO H;  3GX4 X;  2A5Y B;  4EVI A;  1PP7 U;  2VON A;  2VXZ A;  3DKW A;  2A69 F;  4LG0 A;  1SAX A;  3G3Z A;  1T2K A;  4EMS A;  1ZN2 A;  4S04 A;  2Z33 A;  1JE8 A;  5F6F A;  3SHF A;  1EV7 A;  4M9S A;  4WX9 A;  4KDP A;  1F5T A;  1R22 A;  4ENM A;  1BOA A;  3TGN A;  4EJT A;  4OIP F;  2XAJ A;  4M74 A;  3BDD A;  2IA1 A;  3L2C A;  2EFW A;  2V1D A;  1B4A A;  3ZMV A;  1E2X A;  1D8J A;  1UFM A;  3V4G A;  4IF4 A;  1D8K A;  1R5H A;  1KYW A;  3I54 A;  2A61 A;  3SXY A;  5FD6 A;  3ZP5 A;  3K69 A;  3HOT A;  3MCZ A;  2IJL A;  3I59 A;  2XAS A;  4ZYH A;  3LWF A;  3CUQ A;  1P6R A;  1K6O A;  5CVJ A;  2Q2E A;  4YIF A;  4XRF A;  4WXC A;  3U2R A;  4A0Y A;  1ZRE A;  1LDJ A;  1Y0U A;  3IRR A;  1P2F A;  2K7L A;  1WQ2 A;  3PFI A;  2TDX A;  4O3M A;  1MJ9 A;  4EGZ A;  2GZW A;  1R7J A;  1BI0 A;  5LGU A;  2ZO4 A;  4HLY A;  2W57 A;  5FB2 A;  2ACJ A;  2XKO A;  3JSO A;  3GZ6 A;  3EUH A;  1HST A;  4G8X A;  1KU7 A;  1V3F A;  2QQB A;  2DPU A;  4UVB A;  3G73 A;  3I58 A;  2K02 A;  4P5O A;  2MLK A;  1OYI A;  2G7U A;  1SFE A;  2NAZ A;  4U0W A;  3GWZ A;  4IPA A;  4G9Y A;  1QO0 D;  2P8T A;  1I27 A;  4IJA A;  3HRT A;  3F72 A;  3M7G A;  3OOP A;  3GW2 A;  1D5V A;  5D8L B;  5LHI A;  4IHS A;  2UWM A;  3CUO A;  2O8X A;  4R79 A;  5ILS A;  5HDK A;  1GXQ A;  3IL2 A;  2EA4 A;  4ENJ A;  2FOK A;  4I09 A;  2K86 A;  1OYY A;  3FX3 A;  4G94 A;  3I59 B;  2Y75 A;  3F3X A;  1H9G A;  4AIH A;  1OKR A;  1MD0 A;  4QWQ A;  1L3L A;  5DUI A;  3IC7 A;  4MTE A;  2XGX A;  2M87 A;  4HBL A;  1O57 A;  1Z6R A;  2VC1 A;  3TO9 A;  4FX0 A;  1HW2 A;  2RVC A;  1T38 A;  1KYZ A;  5L3E A;  1UHW A;  3B73 A;  2EFP A;  1ZGJ A;  1KGS A;  2DK8 A;  3CUQ B;  3RKX A;  1SD6 A;  2EV5 A;  3NRV A;  3LA7 A;  1JXS A;  4Q47 A;  2FA5 A;  2RQP A;  4JQF A;  4L9J A;  2KJC A;  1TTY A;  4XSZ F;  5TRD A;  5E20 A;  5L3B A;  1UHM A;  1MZB A;  3TDZ C;  4FT8 A;  3WTY C;  3QU6 A;  2O6G E;  4HA8 A;  4M71 A;  5ILU A;  2AXL A;  3RPU A;  1ZYR F;  4H0E A;  4Y15 A;  1U2W A;  1SMT A;  1P4W A;  2PI0 A;  3KP3 A;  1R1T A;  4XSX F;  1RI7 A;  2L3D A;  2PQ8 A;  2FBK A;  3F8C A;  1BJA A;  3RPQ A;  5BPD A;  2MLG A;  4K2E A;  3P9C A;  4KMF A;  2XAG A;  4PZJ A;  1GHC A;  1B59 A;  2FEZ A;  2OA4 A;  2MH2 A;  2WC2 A;  3DV8 A;  3KCC A;  4IXA A;  5H6Q A;  3TOA A;  2JPC A;  2LNB A;  4EJU A;  2DLL A;  1QZY A;  3K1P A;  3F21 A;  1QGP A;  2H09 A;  3DPT A;  1SD4 A;  3HSE A;  4P96 A;  1XDS A;  2H6C A;  1R58 A;  3GZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...