1TNSA

A novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MELWVSPKELANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MU-TRANSPOSASE
publication title A novel class of winged helix-turn-helix protein: the DNA-binding domain of Mu transposase.
pubmed doi rcsb
source organism Enterobacteria phage mu
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1994-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tnsA00
4ASNA 3GFLA 3U1DA 1I6XA 2JTVA 2JSCA 3ECOA 1R58A 3I4PA 1ZREA 3M7GA 5CVJA 4M74A 2BE5F 5LRSA 2W24A 1BM9A 4IF4A 4L9JA 1TW3A 3RYPA 3HSFA 2MC3A 2RVCA 4HV6A 3S2WA 1H9GA 1FYMA 4LG0B 1RI7A 3I64A 2VONA 3HSEA 1OYYA 3VFZA 3NRVA 1W4MA 2Q2EA 4JBAA 1IN7A 2FU4A 1LNWA 4P9UA 2NNNA 4I7HA 2XAHA 1J5YA 5DD4A 1ODDA 3IRQA 5BPDA 3MZHA 2XKPA 5L3GA 3GW2A 5D4RA 4OOIA 1K78B 3K0LA 2OAZA 5D5VB 4IHSA 1U5TB 4Y17A 5LBQA 2E7XA 4CDGA 2WC2A 2A61A 1L0OC 4AIHA 1G3TA 4I09A 3B73A 4KIGA 1B6AA 1I5ZA 4R79A 3WG9A 2FRHA 2HQRA 2FBKA 3DPLC 3R4KA 4MNUA 1TQIA 3K1MA 4WXCA 1UHWA 3E5XA 4WCGA 2ZKZA 3IL2A 1YIOA 2P8TA 1RUNA 1FPQA 2KKOA 5F64A 5HS7A 2L54A 2DTRA 3DV8A 2RC4A 5DD8A 3HOTA 3L2CA 3ZP5A 1ON1A 1WKMA 4RS8A 1GHCA 3K9TA 3REOA 5E1XA 2PBIA 3WE3A 3GX4X 3V7SA 2VE9A 4G6DA 5CVVA 2GA2A 2XKOA 3N4MA 5DCMA 2QQBA 2O6GE 1D3YA 3ZMZA 4H0EA 2YSRA 1KYWA 2MLKA 1XMAA 3LQQA 1GVJA 4A2UA 3O2PE 5ICFA 3GXOA 2A6HF 3V4GA 1QZYA 3WGHA 3LA3A 3J81K 2WWYA 5TJJA 1KYZA 2QBYB 1G3SA 1SMYF 3KE2A 3L9FA 3AAFA 5BS6A 2B0LA 4ESJA 1S8NA 4AIKA 1XGNA 5JI6A 3E6DA 4EJWA 3TDZC 3JW4A 2LKPA 3IWFA 1BOAA 2F5CA 3ULQB 1PP7U 3RIRA 3FXUA 2XROA 2DBBA 5L3CA 3E6MA 2D2WA 3MEXA 3ABUA 5J6XA 1TQMA 2XV4S 3BPXA 4HBLA 1SAXA 3EETA 2ISYA 2ZNZA 1MDMB 5HDGA 3GLXA 2FNPA 4EV0A 4ZZDA 1Q1HA 2HZTA 3P9CA 1U3EM 1HKQA 3MQ0A 3F23A 2NAZA 3GZ5A 5CVRA 1KU3A 3ABTA 2W84A 1O3SA 1PUEE 3JAMZ 2HS5A 4ENNA 2PG4A 2PLYA 3ZN0A 2Y75A 1CF7B 1P4AA 1XGOA 5EEGA 2IRFG 1BN5A 4LB6B 3H3UA 2BGCA 4OIQF 4HQEA 3KP3A 1W7PA 3CO6C 4BAYA 4EM2A 4KIFA 3KETA 4HDVA 2EV5A 5F1RA 2W57A 4P5OA 3WU0A 3FM3A 5AONA 2CQKA 4XLPF 1O7LA 4NB5A 3GF2A 1B9NA 4GO1A 6PAXA 3EUHA 1RZ4A 1XDSA 4EGZA 2HDCA 4KIBA 2FBIA 4IRIA 1TTYA 5HS9A 1TQPA 2V9VA 2ZMEA 1ZH5A 3PFIA 1BIAA 3HUGA 2VN2A 2EJRA 3I59A 4FT8A 3F8BA 3HTUA 3WTVC 1JE8A 5JVTA 3PQKA 1ZRFA 2YPRA 2DAOA 4HLYA 3F22A 5D6FA 4WF2A 3TOAA 3OV8A 4UNOA 3CUQC 2H6CA 2FA5A 1QBJA 3T8RA 4HF2A 1DPUA 1XMKA 3HRTA 1X3UA 1Y0UA 2EA4A 2GZWA 3NEUA 2J5PA 4BH9A 3O3KA 2CYYA 5JR3A 2R3SA 5HOOA 2K02A 4MEYF 4AVPA 3QPHA 3J80K 1R00A 2X4HA 1S3JA 5JHUA 3ECHA 4FX0A 2IA2A 2WV0A 3SHFA 5DV5A 4OU0A 2DPUA 4P96A 5FLXK 2ADUA 3HSRA 4KDPA 3WGGA 4A0XA 4R8HA 4E70A 4YIIA 3P9IA 4LLNA 2EB7A 1J75A 5CVUA 3ERED 2R7DA 2HOEA 1ULYA 3RJPA 4UV8A 2EFQA 4PGHA 3IRRA 2CWEA 2FMYA 1ZYRF 2DK5A 5HDNA 5TRDA 5DDGA 3EYYA 2P7CB 2QVOA 5FB2A 5LEJA 3LAPA 2ZFWA 2XAJA 2PEXA 5D5UB 2IPQX 3FZVA 1ZAOA 4PCQA 1XGSA 4N9HA 3V7CA 2EWNA 2QQ9A 3LFKA 5ICCA 1IN5A 5ERIA 5ILUA 2QYOA 2ETHA 5D8KB 1J59A 2L4AA 4WX9A 4L9VA 1OR7A 1MJ9A 2FE3A 2L02A 4IXAA 1BI2A 3BOQA 2COMA 3U2RA 4ENJA 3N97A 3SQNA 4U7BA 4GCVA 2IVMA 2V79A 2STWA 4LD5A 2A68F 3COAC 4UHTA 3F8MA 1FT9A 1O3QA 2HEOA 1Z9CA 3FMSA 2ZXJA 2VBXA 4D0PA 1C0WA 3MCZA 1BJAA 2VXZA 2P5KA 3WGIA 2HYGD 2M5WA 2PMHA 3DP7A 2GA1A 3HIFA 3HRSA 1OMIA 1G3WA 2ZO4A 5F6FA 1TNTA 1YTYA 1FY7A 4XBFA 3L09A 2ISZA 4KN7X 3V8JA 3BP8A 1SFUA 4UVCA 2ACJA 4YFKF 3ROUA 2IA0A 3QP5A 4A0YA 5HLHA 5A2QK 4G9YA 2V1UA 3QU3A 4OMZA 4N0BA 2OU2A 1OKRA 2JRTA 2VBWA 3KP6A 3LQRA 1MZBA 3R61A 4HQMA 1U2WA 2PI0A 3GFJA 2DQRA 3QAHA 3U9GA 4BHBA 3WTWC 2CSOA 3ISPA 5DCMB 1U78A 5CYVA 3T5XA 1XD7A 1IZ1A 5LLQA 3CO7C 3MWMA 3L00A 1OYIA 4P9FA 4ZYGA 4Q47A 1A04A 4HOBA 1IN6A 3SXYA 5ICEA 1DP7P 2L4MA 2P6TA 3RKWA 1R5GA 3CUOA 4U7DA 1J0RA 2OA4A 3IHUA 2DT5A 4WK8F 1UHMA 4YFXF 3MZYA 4KN4X 5BOXA 1RNLA 1FOKA 5J8FA 3F21A 2HQNA 3M1EA 1XSXA 3KLOA 3TQNA 3GYHX 1T2KA 3DKWA 1IXSB 5D4SA 3RDIA 3K1PA 4G7OF 1R5HA 1IRFA 2VT2A 2G7HA 4L18B 1ZGJA 2FXAA 5H20A 3BY6A 4XLNF 2OQRA 2V6CA 2VBYA 1KU9A 1TBXA 3VOEA 2OZ6A 4CYDA 1YS6A 3TKYA 2CW0F 5IT9K 5DUIA 2HWVA 3V8KA 2P5VA 1ZG1A 3D5LA 2VODA 2K7LA 1KQ8A 3DQVC 5H6RA 4LG0A 2Y0MA 4RAYA 4O3MA 5CLSA 4XSZF 5FGMA 4Q48A 1W7PD 4OMYA 2Z9OA 2XGXA 3ML6A 1W7PB 1EH8A 3WODF 1LDDA 2EV0A 3J81Z 3BDDA 2DQLA 2JT1A 2K86A 1BBYA 3DXJF 2DLLA 2M45A 2FBHA 3RPQA 3LA2A 2QWWA 3IWZA 1FP2A 1V4RA 4PGGA 4HX4A 2DI3A 4UVAA 5FFZA 5IT3A 5EEHA 3NQOA 1ZN2A 4EJOA 4QLCU 2NYXA 1QZZA 5E17F 1U5TA 2GIVA 3SFZA 4S04A 5FFXA 4JK1X 1KU7A 2DO7A 1BI3A 4K2EA 2ESNA 3I59B 1HW2A 4ETSA 1HXDA 1XN7A 4A6EA 1HSTA 2VC1A 2QQAA 3E97A 2OZUA 1ONVA 1J2XA 1ZG5A 5D8LB 4CHUA 1FBSA 3BJOA 4M72A 1LB2A 2XUBA 1USSA 3CTAA 2IA1A 3KEOA 1JHHA 3HTSB 3IKTA 4CXFA 2RDPA 3Q9VA 4IHTA 4PDKA 4ZH4F 2QLZA 4CZZA 1FSHA 2HGCA 3RI4A 2JPBA 5L3FA 1XDUA 4P55A 1JHFA 4EGYA 4RB3C 2W25A 2HTSA 1HBXG 4M9XA 3FWEA 1F4KA 3RTRA 3F72A 4EJUA 1Z91A 4WXHA 3B02A 3HHHA 2F5EA 3HHGA 3ZMVA 2FNAA 1T0FA 2STTA 5E8GA 3H92A 2LSOA 1L3LA 3ELKA 4ESFA 4Y13A 2OQGA 3V7RA 1LDKB 4U0VA 2EFWA 3OOPA 2H94A 1J9IA 4AD9A 2CO5A 4LK1F 4MTEA 4CO8A 4EM1A 1TLHB 2QBYA 1P6RA 3EDPA 2BYVE 2P4WA 3WTZA 2EFPA 2P6SA 3R0JA 3F6OA 1W5TA 1K6OA 2RKHA 1MKMA 1YW7A 2X0LA 3V8LA 1FZPB 1IXCA 2F5DA 3LAJA 2UWMA 3CJNA 1GXPA 1SFEA 3TGNA 3L7WA 4LFUA 1LEBA 1F9NA 2PJPA 4IPAA 3ZMSA 5LGNA 5E20A 2EA2A 2EFOA 1O57A 2FMLA 2YX7A 1MDMA 2Z33A 1DDNA 2A69F 5HS8A 4MQ9F 1QO0D 2VBZA 2XIGA 5BMZA 2KIMA 2O8XA 5FO5A 2FF4A 2D1HA 4G6QA 3F3XA 1MJBA 5LHHA 3SZPA 2C6YA 3J80Z 3R6SA 4HAMA 4BXUA 3K2ZA 3CLOA 2KRFA 5FLXZ 4L9TA 1FX7A 2PMUA 3DEUA 5D5XB 2XAFA 2AXLA 2WTEA 5LHGA 4EJVA 4ESBA 3E3VA 3I53A 1YQAA 2JZYA 2E7WA 3F8FA 1BI0A 2PN6A 2NS0A 3FXRA 4M73A 1AWCA 3FHZA 4HF0A 3KZZA 2A3SA 3KP2A 2UXXA 5BPIA 2XRNA 1IAWA 2RNJA 3FF5A 1MD0A 5E1WA 2CFXA 1JGSA 2BBYA 3ZMUA 3GUDA 1WSUA 2K27A 3M8EA 5KK1A 3QRFF 3BPVA 4HZFA 3BJAA 1SMTA 4LK0F 4UXNA 2FEZA 4G7HF 2MH2A 1E2XA 3T1BA 4IRHA 3T8TA 3H3ZA 3GWZA 1T98A 2IP2A 1XSVA 5KVRA 2YU3A 1G3YA 2ESHA 1R22A 3QPTA 5HDKA 1P4WA 2MA3A 2RQPA 4HW0A 4UV9A 2FSWA 5CVIA 5DUKA 2KIFA 4I02A 4A12A 1R36A 4U0YA 4MHGA 2K4BA 2LF8A 1LDJA 1SFXA 5L3BA 4O6JA 3RPUA 4MGRA 4HDUA 2GAUA 3TO9A 5LGUA 1FYKA 4KYWA 1WRJA 4Q5SF 2BV6A 4KUMA 1LJ9A 2DU9A 5H6QA 1PDNC 3GVAA 3GFIA 4OIPF 3I54A 4LLGF 2RGVA 4XSXF 2A6EF 1FC3A 1QNTA 4A6DA 4WXDA 1LQ1A 4EVIA 3IKVA 4OIOF 2J5OA 4ZZLA 3WU1B 4HA8A 4S05A 3F8NA 2CG4A 5ED4A 3I5UA 1YO5C 4I98B 2P7VB 3G3ZA 3D0SA 1FLIA 3TDUC 4I01A 2KIUA 3R60A 3K69A 4I0AA 2VC0A 1TW2A 3QOPA 4RAZA 4EMSA 5HVQC 4AWXB 2NRAC 5HLGA 4CGZA 4N9IA 1E17A 5A2QZ 4LB5A 4PZJA 1I1GA 3O6BB 1XGMA 5CJ9A 3C18A 1REPC 1YYVA 3JSPA 5ILSA 1LEAA 2HR3A 2A07F 3E5QA 1RIOH 2G9WA 4LMYA 2Y48A 3M8FA 3KFWX 4O5VA 4DNCA 5FD6A 4RGXA 1U8RA 3JTHA 1KA8A 3C1DA 4LLLA 1ZLKA 3BZ6A 3RYRA 1W5SA 3VODA 1MGTA 1Z1DA 5E18F 4KMFA 1P92A 2Q0OA 1F1ZA 2JPCA 1FP1D 4L5IA 4A5MA 1VTNC 2W85A 2CGPA 4GGGA 2O0YA 2ZJ2A 5LEKA 4B8XA 4UUVA 1WWXA 2RN7A 4NHJA 4MTDA 4HLXA 2ELHA 1P4XA 2F2EA 1WI9A 1R1VA 3T0YA 3RKYA 4A5NA 3LA7A 4WWCA 2D45A 4Z2YA 4L5JA 3WTXC 3JSOA 2D1VA 3CUQA 3KEQA 2L3DA 3KZYA 4GXOA 4M6XA 1SD6A 1PP8F 4RGRA 1T38A 1FSEA 4YFNF 2LF7A 4AIJA 3W6KB 1TNSA 1HKSA 1UFMA 5IT9Z 2GQQA 4FHTA 4EQQA 3KCCA 1WQ2A 3KLNA 2QZ8A 3HRUA 1CGPA 3KP7A 3W6JB 2UXNA 4G7ZF 4RGUA 2Z5UA 1YW9A 4KNYA 1ZG3A 1YFHA 2P5LC 1DPRA 2GXGA 1G6NA 1BIBA 3R0AA 4IRGA 1Z6TA 1F5TA 2ZBKA 3ZQ7A 2NNYA 1G4DA 3RKXA 1GXQA 2EFNA 2BEOA 3VB2A 3HYIA 2VOOA 2HKXA 1KQ9A 4DQ2A 4I2OA 4IVNA 1USTA 2YX4A 3JTGA 4RB2C 2HFHA 1IW7F 3DF8A 3LWFA 5AIQA 1BC8C 4M9SA 4BNCA 3KP5A 1QQIA 1K78A 4L0ZB 4RGSA 5E1ZB 4L9NA 3I0TA 4RB0A 1UB9A 1O7FA 4HYEA 1H9TA 3DFGA 1XB4A 2M1BA 3J7AO 1HKTA 5LGTA 3HRMA 4NQWA 2LDUA 2H09A 1IN8A 1U6GA 2ZMEB 2UZKA 1HW1A 1DUXC 5ICGA 4U88A 1K7AA 1STZA 1O3TA 1IXRC 2V1XA 4R1HA 2HTJA 2K4JA 2O03A 3GZ6A 1J7KA 2Z3YA 1YS7A 3E6CC 2A5YB 1YW8A 2HYFA 3K1NA 4G94A 4G8XA 5AIPA 2H27A 2EK5A 3TO7A 3TOBA 3PQJA 2QENA 2MLGA 2Q8KA 3EYIA 2IT0A 2O61A 1YG2A 2H6BA 3I71A 4KFCA 4BQAA 2FQ3A 1I27A 1IN4A 1HQCA 4KICA 4HF1A 3IC7A 5FD5A 5BQTA 4ZYHA 4EJTA 2QUFA 3KP4A 4FX4A 4MQVA 3QU6A 1SD7A 1K79A 3FMRA 2DW4A 2ZCWA 2RV8A 3GFMA 5LRRA 1P2FA 1S7OA 3JAMK 2KJCA 3M9AA 1BI1A 4MEXF 2L01A 3TO6A 4HX8A 3VEPA 3CDHA 1MJAA 4UVBA 4GYIA 3E6BA 4LJZF 2XHKA 2IJLA 1D8JA 4M71A 3BROA 3I58A 2M30A 4TV7A 1EH7A 1QGPA 1XSDA 3ZN1A 1OPCA 2E1NA 2DK8A 2G7UA 2QM3A 3GO5A 2XAGA 4OIRF 4ENKA 4BHCA 3WTUC 3QP6A 1IRGA 1EH6A 4B09A 1HW5A 3ZMDA 3GEZA 4F7ZA 1B9MA 4M9ZA 3FXQA 1ZRDA 4EM0B 2LNBA 4U0WA 4QWQA 2R7FA 3Q9SA 1KGSA 3MAJA 1Z6RA 3WTSC 4ON0A 4XRFA 4A0ZA 2PFBA 1LVAA 3Q5FA 2E1CA 5LHIA 1SD4A 1YLFA 2DFIA 2Z99A 4I0BA 1R23A 2MH9A 1FBQA 4BYYA 5D5WB 1FYLA 1SD5A 1FNNA 4CICA 3ZMTA 4BHPA 5E8IA 2IW5A 1S7AA 3MFKA 1HSJA 2XVCA 2PQ8A 3G73A 1ZGAA 4LGWA 4KA4A 1CF7A 1BC7C 2ZNYA 4ZYDA 1IF1A 1B4AA 3BWGA 2MBFA 1ZLJA 1KQ0A 3FMQA 1T39A 1S29A 4YG2F 2M8EA 5L3EA 4RB1A 2XAQA 2FOKA 1ZARA 2F5FA 1JXSA 2HKOA 5J8CA 5D6EA 3WTYC 1AOYA 1ZHFA 1KU2A 1QPMA 4KMUX 3BJ6A 2MD5A 5DYMA 1H0MA 4ZYEA 1ON2A 4Y15A 3SZTA 2EV6A 1Z7UA 2KJBA 1I1SA 3C7JA 1R1TA 5L3DA 3LSTA 1XCVA 5K5RA 1UCRA 2M87A 2OBPA 3E5UA 4ENMA 1B1BA 2O3FA 3EQLF 5K5QA 1R1UA 1O3RA 2XASA 4IJAA 1V3FA 4KT5C 1XCBA 3F6VA 1RUOA 1U5TC 4M6YA 3P9KA 4Q4ZF 1FBUA 4L0YB 2VOPA 5K1YA 2TDXA 2YR2A 1Z05A 5JFRA 1FWZA 1IUYA 3F8CA 1EV7A 3C3WA 2OD5A 4YIFA 3WE2A 1ZRCA 2DPDA 1S6LA 3WTTC 3FM5A 3P7NA 3HOSA 5DEQA 4JQFA 5ILVA 5DCFA 5HLIA 2GWRA 2VT3A 2V1DA 3CUQB 1D8KA 2GXBA 3DPTA 4HX7A 5K5OA 1T6SA 4HV5A 1NHAA 1OYWA 3ZPLA 1D5VA 2VE8A 1B59A 4GYGA 1R7JA 2AS5F 3FX3A 4OINF
chains in the Genus database with same CATH superfamily
4ASNA 4F55A 1B8IB 3GFLA 2VI6A 3U1DA 1I6XA 5IYCJ 2JTVA 2JSCA 3CC7I 3KZIC 1M1EB 4PSXA 1DU0A 2DJNA 1RKWA 3ECOA 1R58A 3I4PA 3G6EI 3M7GA 1ZREA 5CVJA 3S15J 4A3FJ 1IDZA 4XKWA 4M74A 2BE5F 5GAEJ 5LRSA 5IOZA 2W24A 1BM9A 4IF4A 4L9JA 2CV2A 1TW3A 4QPQA 3RYPA 1T0FC 3HSFA 3A4CA 2MC3A 2RVCA 4HV6A 3S2WA 1H9GA 2WB1N 4NC6A 1QVUA 3O8HA 1FYMA 4M3GA 1RI7A 4LG0B 3KYCB 3I64A 2JA6J 2VONA 3HSEA 3OYKA 1U0JA 1OYYA 2IGOA 4RM3A 2M4GA 3VFZA 3NRVA 1FJLA 1W4MA 1ETKA 1A6QA 2Q2EA 2V26A 4JBAA 2AQEA 5J47A 3OIOA 2KRHA 1IN7A 1NG6A 2FU4A 1LNWA 3GCMA 4Y52J 1MH3A 1VI0A 2NVUB 4P9UA 5EGOA 2NNNA 1H89C 5K7FA 4I7HA 2XAHA 1J5YA 5DD4A 1ODDA 3IRQA 2XF5A 2H8RA 2HVRA 3PO2J 5BPDA 2VUMJ 3MZHA 2XKPA 2XB5A 4IEJA 5L3GA 3GW2A 4A3CJ 4UUTA 5D4RA 2L2OA 4OOIA 2Y9ZA 1K78B 3OYCA 3K0LA 2GXAA 2MSYA 3G71I 3ZGKA 2OAZA 1JUMA 4DYCA 5D5VB 3ZQCA 1S72I 4IHSA 3AG4H 3S1RJ 1RC9A 1U5TB 2CQXA 4Y17A 4BE2A 2F5VA 5LBQA 2E7XA 3A01A 4CDGA 1YJNI 2ID6A 1TZLA 2WC2A 5CPRB 2A61A 2OV7A 1L0OC 5HNHA 4AIHA 1BW6A 5E3MA 2QF7A 4E6KG 2QEXI 2LH9A 1G3TA 1FMVA 2XDVA 3S3MA 4I09A 3B73A 4ANJA 2PMZN 4KIGA 1B6AA 1I5ZA 2B63J 1R9TJ 4R79A 3WG9A 2FRHA 2HQRA 2FBKA 3DPLC 3R4KA 4MNUA 2IS2A 1TQIA 2DOEA 5CQGA 1NH3A 5C4JJ 3K1MA 4WXCA 4CCKA 1UHWA 3E5XA 3F0CA 4WCGA 2ZKZA 3IL2A 1HDDC 3OYNA 1YIOA 4BU2A 3C2GA 2P8TA 1RUNA 1FPQA 2KKOA 3BTIA 2ME0A 5F64A 5HS7A 2R5ZB 2L54A 1D0YA 1R49A 2DTRA 3DV8A 2RC4A 5DD8A 1DU6A 3C2BA 3HOTA 2X51A 2CJJA 3L2CA 3ZP5A 2ELKA 3I4NJ 1HCRA 3ASNH 2JSPA 1ON1A 1WKMA 5KCMA 4RS8A 3MMYB 4JP0A 3TBIA 1GHCA 3K9TA 1MBEA 2A5WA 2M2EA 3REOA 5E1XA 2PBIA 2DA3A 3WE3A 3V7SA 3GX4X 2VE9A 2B9SA 4G6DA 4OAZA 3HXLA 1J09A 1TWHJ 5CVVA 2GA2A 2XKOA 3IAS2 1YITI 2KDOA 1LE8B 3N4MA 5DCMA 2N8GA 2QQBA 2O6GE 4PJLA 1Z21A 3FK6A 1D3YA 1JTXA 1XTAA 3ZMZA 3G4SI 4H0EA 2YSRA 1KYWA 3WG7H 2DODA 2MLKA 1XMAA 3CMAI 4DW6A 3E1SA 2LBFB 3LQQA 1GVJA 4A2UA 3O2PE 1V55H 5ICFA 3GXOA 3L2QA 4BS9A 3OYMA 2A6HF 1VQNI 4XOPA 3V4GA 1QZYA 3WGHA 3OYHA 3LA3A 3J81K 2DYRH 2WWYA 2EIKH 5TJJA 1KYZA 2XGCA 2QBYB 1G3SA 4YEJA 1SMYF 3KE2A 2XF7A 3L9FA 3AAFA 5BS6A 2B0LA 4D1QA 4ESJA 1S8NA 3S2HJ 5JLWA 3CMEI 2XC7A 4AIKA 1XGNA 3K4KA 4BEHA 4C3IJ 1WJEA 5H2FC 2CRGA 2ID3A 5JI6A 3E6DA 4EJWA 3VSLA 3TDZC 3JW4A 2LKPA 1S5LC 3IWFA 2BW3B 3AG3H 1BOAA 2F5CA 3ULQB 1IJWC 2X85A 1PP7U 2F4OB 3RIRA 3BZKA 2E34A 5FKNA 3FXUA 3DBRB 2XROA 2DBBA 1P9QC 4XR6A 3E6MA 5L3CA 4AM3A 3FIWA 4CCJA 2D2WA 2EH3A 3MEXA 3ABUA 5J6XA 4DYQA 1HF0A 1TQMA 2XV4S 1E0EA 2I10A 3HB9A 4B43A 4KITB 3BPXA 5GAGJ 5EEAA 4E7IA 4HBLA 1YRNA 1SAXA 3EETA 2ISYA 5GP9A 5B1BH 2ZNZA 2M0CA 1MDMB 5HDGA 2WV1A 2FD5A 2ZXWH 3GLXA 2FNPA 1ZQ3P 4EV0A 4ZZDA 1Y39A 3ZQLA 2LP0A 4GDFA 1WPKA 1Q1HA 1N25A 2CUZA 1IO2A 2CH0A 2HZTA 2KZVA 3P9CA 2VJIA 4MFDA 5B3SH 4IO9F 1U3EM 1HKQA 2HOTA 2IGKA 3GTOJ 3MQ0A 3F23A 2NAZA 3GZ5A 3DPUA 5CVRA 3GTLJ 1KU3A 3ABTA 1PUFB 2W84A 5TISC 1O3SA 1PUEE 3JAMZ 2HS5A 1R4NB 4ENNA 2PG4A 3HZJA 2PLYA 2XGDA 1X58A 2KRCA 3ZN0A 2Y75A 1CF7B 1P4AA 3OWTA 1XGOA 5EEGA 2IRFG 1BN5A 4X1EA 4LB6B 3H3UA 2BGCA 3K2AA 1R71A 3CCMI 2ELJA 4OIQF 3ZQIA 4HQEA 3KP3A 1W7PA 3CO6C 2CUEA 4NC7A 3ERMA 4BAYA 4EM2A 4KIFA 1NK2P 1TWAJ 2CW7A 3KETA 2R7RA 1LFPA 3Q0VA 2X6YA 4HDVA 4A3MJ 4V19K 2NVTJ 2EV5A 4XLEA 2W57A 3SEQA 5F1RA 2H8WA 4P5OA 3WU0A 2W7NA 3FM3A 1MBKA 3H0GJ 5AONA 1BR4A 2CQKA 4XLPF 1O7LA 4NB5A 3GF2A 1B9NA 4GO1A 6PAXA 3EUHA 5HODA 1RZ4A 3ONQA 1XDSA 2LKSA 3OIPA 4EGZA 4CZCA 2HDCA 1UJ8A 4KIBA 2FBIA 2LVSA 4XN3A 3RQ4A 1T33A 4IRIA 2EINH 1POGA 3BG5A 1TTYA 1QHHD 5HS9A 4XM3A 1IV6A 1TQPA 4PK4A 5IP9J 1JKOC 2V9VA 1DGRM 2VIXA 3HKZN 2ZMEA 3BC8A 1ZH5A 2LK2A 3PFIA 1ZR2A 1BIAA 3HUGA 4DOZA 2KZGA 3LSGA 3GTQJ 3BTCA 2VN2A 2EJRA 5TGTA 1OCTC 1LKXA 1VQ7I 4BDZA 3K4LA 3I59A 4FT8A 2OCEA 3OYJA 3GLLA 3F8BA 3HTUA 3MD2A 3WTVC 1JE8A 5JVTA 3CCVI 2XPVA 3HPGA 3PQKA 1ZRFA 2YPRA 2DAOA 2DJIA 3ESWB 4HLYA 3F22A 5D6FA 1ACIA 4WF2A 2DTZA 3BZCA 3TOAA 3OV8A 2DA1A 4UNOA 1SANA 2HXIA 1PVEA 2X1CA 2VASA 3IP4B 3CUQC 1MNDA 3HGYA 2H6CA 1Y1WJ 1WHUA 2FA5A 2JWTA 1SFOJ 1QBJA 2QSGX 3T8RA 2NOJB 1YIJI 4HF2A 1DPUA 2Y2ZA 1XMKA 1FTZA 3HRTA 1X3UA 4XKBA 1Y0UA 2EA4A 2GZWA 3NEUA 2R7SA 2J5PA 4BH9A 1ETOA 4A3KJ 3O3KA 5JHFA 2CYYA 5JR3A 2R3SA 5HOOA 1V5EA 3GTKJ 2EBIA 3HG9A 2K02A 3CC2I 4BJTA 1LUJB 4E7ZA 3H9JA 4BE1A 4MEYF 2HI3A 2IXSA 3HDDA 4AVPA 3QPHA 4XNFA 3M07A 1QU3A 2L7FP 3J80K 3LOCA 1R00A 2X4HA 1S3JA 5JHUA 1ETVA 2DMNA 3ECHA 4FX0A 1A6IA 2IA2A 2WV0A 3SHFA 4B4CA 5DV5A 4OU0A 4BXFA 2DPUA 3S14J 4P96A 5FLXK 2O7OA 5E3NA 4DBRA 2ADUA 3HSRA 4JOMA 2YUSA 5LFAA 2L9RA 4BXXJ 4KDPA 3WGGA 4A0XA 5J3LA 4R8HA 4E70A 2VQLA 1GV2A 4YIIA 2EZKA 3P9IA 3B6AA 3PIPF 3ABMH 4LLNA 2COBA 2EB7A 4RDUA 2XRLA 1WH5A 2M8GX 2NVQJ 1J75A 3H9GA 5M5YJ 3CZ6A 5CVUA 3CCQI 3MZ8A 3ERED 3S2DJ 2R7DA 2CQ7A 1K6YA 5CQEA 2HOEA 3MN2A 1ULYA 1Y8QB 3RJPA 2DMQA 4UV8A 2EFQA 3CJTB 4PGHA 3IRRA 2CWEA 4BY1J 3DBLB 4PFOA 1S9HA 3BR0A 2FMYA 4B1RA 1ZYRF 2DK5A 5HDNA 5TRDA 2ECBA 5DDGA 3EYYA 2P7CB 4QSHA 1NK3P 2QVOA 5FB2A 3U1KA 2NVXJ 5LEJA 3LAPA 2OJED 3LFUA 4BBSJ 1OCOH 2Z16A 2ZFWA 1F43A 2XAJA 3A03A 2PEXA 5D5UB 3BQYA 2IPQX 4RLFA 4HNVA 4BQQA 2KIQA 1VQLI 2GIZA 3FZVA 1ZAOA 2VPRA 2PX9A 4PCQA 4IKFA 5F0FA 1Y56A 1XGSA 4N9HA 3OIQA 4A3GJ 3V7CA 2EWNA 1BOBA 5F27A 2QQ9A 4DGWB 3LFKA 1MIJA 3K10A 4RLQA 1B72A 5ICCA 3AL0B 3PO3J 3FHNA 1IN5A 1T56A 2W00A 5EGOB 2Y30A 3CLQA 4PSWA 3KEYA 5ERIA 2Y0SN 1GT0C 4JX4A 3SYTA 2ZB9A 4LIVA 2QYOA 3O8GA 5ILUA 2ETHA 5D8KB 1J59A 2L4AA 3CC4I 4WX9A 4L9VA 1OR7A 1MJ9A 2FE3A 4N4OB 2L02A 1TC3C 2DFHA 1VZ0A 1BI2A 2M3AA 4IXAA 4B47A 4C3JJ 1WCMJ 3BOQA 2COMA 3U2RA 1T08B 3IAM2 4ENJA 3SQNA 3N97A 1LVKA 4A3IJ 3H5AA 3FXJA 4U7BA 2NVYJ 2L9VA 4GCVA 2M7BA 2IVMA 2V79A 4MIMA 3LNQA 2STWA 3QYEA 4LD5A 2A68F 3FXMA 4F3QA 3BG7A 4ZDLA 2P0WA 3COAC 4UHTA 1Z77A 3WHCA 4XRMA 4KISA 2V4JC 3F8MA 4NC8A 3UKGA 1FT9A 1O3QA 2HEOA 3A01B 2GM4A 2IGNA 4A93J 1Z9CA 5IOYA 2JUCA 4XLCA 3FMSA 2ZXJA 2VBXA 3ZOBA 5IP7J 4FCYA 4BBRJ 1X1PA 4D0PA 4DZJA 1C0WA 3MCZA 1BJAA 3A0HC 2VXZA 2P5KA 3WGIA 2HYGD 2M5WA 2PMHA 3DP7A 2GA1A 2DMTA 3HIFA 3HRSA 1OMIA 4D7NA 1G3WA 2ZO4A 5F6FA 2BY1A 2L7KA 4CYCB 2HDDA 1TNTA 2K9MA 1YTYA 3K4NA 1FY7A 4XBFA 1ETYA 2DDAA 1AKHA 3L09A 2ISZA 2H1KA 4KN7X 3NAUA 3V8JA 3BP8A 5KHDA 1SFUA 5EG0A 3D5RC 3QPSA 4Y3OA 4YELA 4UVCA 4PJNA 2ACJA 1Z3YA 4DJAA 2JQ7A 4YFKF 3ROUA 3JREA 2IA0A 3QP5A 1JJ8C 4A0YA 1BW5A 5HLHA 5A2QK 2EZIA 4G9YA 4E7SA 4XONA 3CCRI 2V1UA 3QU3A 1NG7A 4OMZA 3S8PA 3AG1H 2K3FA 4N0BA 2LOOA 2OU2A 5FJ8J 5DM7F 1OKRA 3AKZA 2JRTA 2VBWA 2O9LA 3KP6A 3LQRA 1MZBA 5IYBJ 3ZRGA 4XK4A 3R61A 4HQMA 1U2WA 2BY0A 2JRMA 2PI0A 3GFJA 2DQRA 2K9LA 3QAHA 2R0QC 3V42A 1ENHA 3U9GA 4BHBA 3WTWC 2HNHA 2CSOA 3ISPA 1I6HJ 3FXLA 1RESA 2BY3A 5DCMB 1SC7A 5CYVA 1U78A 2CU7A 2NOGA 1R4MB 1HLVA 3T5XA 2DFEA 4Y7NJ 1XD7A 1IZ1A 4LOCA 5LLQA 3CO7C 3MWMA 2VJJA 3L00A 4E4HA 1GLNA 1OYIA 4C30A 4P9FA 2AO9A 4IOAF 4ZYGA 5DM6F 2DA5A 3P5JA 4G6TB 4Q47A 4A3DJ 3LSPA 4QPOA 3DKYA 4ZJZA 4AVZA 1A04A 1X1AA 4HOBA 3CMYA 1WZ2A 1APLC 1IN6A 3SXYA 5ICEA 4XORA 2VLAA 1DP7P 2L4MA 1YI2I 2P6TA 2MABA 3RKWA 2W48A 1YOVB 4NQWB 1R5GA 3CUOA 4U7DA 4XOTA 2LTPA 4XKCA 3CF5F 2IS1A 2DOFA 1J0RA 2QGUA 3HOZJ 2OA4A 4Y4RA 3IHUA 1FTTA 2OF7A 1FIAA 2DT5A 4WK8F 1UHMA 3TMOA 1Z7LA 2P81A 2W1OA 4YFXF 3ZQHA 4BEHB 4RBOA 2WAQN 1CQTA 3MZYA 2RAEA 3HM5A 4KN4X 5BOXA 1GDTA 1RNLA 2XPUA 1FOKA 2H1LA 2L9NA 5J8FA 3F21A 3SDGA 2HQNA 3M1EA 1XSXA 2VKEA 1I39A 2ICWG 3KLOA 3TQNA 3JRDA 3GYHX 1T2KA 3DKWA 1IXSB 5D4SA 3RDIA 3K1PA 1MMSA 4G7OF 4RMNA 2K5CA 3QOEA 1R5HA 2AHQA 4A3EJ 1IRFA 3PM1A 2VT2A 2G7HA 4L18B 1ZGJA 2FXAA 3NWSA 5H20A 3BY6A 4XLAA 4XLNF 2B7EA 1YRNB 2OQRA 2V6CA 2VBYA 1KU9A 1TBXA 3VOEA 1TL8A 2OZ6A 4CYDA 1N77A 1YS6A 2ZSIB 3LSHA 1MMAA 3TKYA 4I76A 2OPTA 2CW0F 2GOMA 3G1LA 5IT9K 1JI8A 4ABZA 4KJZA 5E3LA 1MW7A 5DUIA 2HWVA 1HC8A 1V54H 3V8KA 4XQFA 2P5VA 1ZG1A 1UMQA 5KAFC 3D5LA 4JX5A 4LIUA 1FOXA 2EIJH 2VODA 2K7LA 1KQ8A 5K7HA 5GPAA 2R92J 2L5QA 3DQVC 5H6RA 3UNGC 2XSDC 4LG0A 2F4MB 2RREA 2Y0MA 4RAYA 2RNGA 2DT6A 4O3MA 5CLSA 3DEEA 4XSZF 4S0HB 1BR1A 5FGMA 3GTGJ 2V6EA 2E1MC 4MLOA 1W7PD 4Q48A 1D1BA 1FIPA 4OMYA 1A35A 1JKRC 4BL0B 3C2HA 5J40A 4PFPA 1DGWY 2Z9OA 4M3BA 1D1AA 4XIDA 2XGXA 5M5WJ 3ML6A 1W7PB 4RAFA 1EH8A 3NARA 4C2TA 1BR2A 3WODF 4F52A 1LDDA 2EV0A 3J81Z 3BDDA 2FUG2 2DQLA 2JT1A 2K86A 1EF4A 1BBYA 1XG1A 3DXJF 4CCMA 3TW7A 2DLLA 2M45A 1WJCA 2FBHA 4N4NB 3RPQA 2DCEA 4C2UA 3LA2A 2QWWA 3IWZA 1FP2A 2VPLA 4FQGA 4FASD 1V4RA 1JUSA 4HX4A 4PGGA 2WBMA 2LY2A 5DTDA 3OY9A 2DI3A 4UVAA 5FFZA 5IT3A 2DMUA 3DCFA 3NQOA 5EEHA 1ZN2A 5FLVA 1WJFA 4EJOA 3FXOA 4QLCU 3W6VA 2NYXA 1QZZA 5E17F 1U5TA 2GIVA 3SFZA 3S93A 3OS0A 3GTJJ 4S04A 1VQ8I 5FFXA 2GBYA 4JK1X 1KU7A 2DO7A 4DYRA 1BI3A 4CSWA 2OTJI 3HOWJ 2LLKA 4FISA 3OYFA 1ERDA 1A31A 4K2EA 1OCZH 4F93B 2ESNA 3I59B 3QWLA 1Y1VJ 3JR9A 1R6RA 1SAUA 4ZTJA 4HRIA 2ZJQF 1HW2A 4ETSA 4UB6C 1HXDA 1XN7A 4A6EA 1JKQC 1HSTA 2VC1A 2QQAA 2L0KA 5GAHJ 2QKMB 2D5VA 3E97A 2OZUA 3FKJA 1ONVA 2ZC2A 1J2XA 1MMNA 1ZG5A 3ABLH 3BTLA 5D8LB 1RKTA 1UAAA 4CHUA 1FBSA 3BJOA 5EJCA 2K9SA 4M72A 2KFDA 2DT7B 1JT0A 1LB2A 2XUBA 1USSA 3CTAA 2IA1A 3KEOA 2KDZA 2R5ZA 4BQOA 1JHHA 3PFYA 3HTSB 2VQGA 1VQOI 3IKTA 4U87A 4CXFA 2RDPA 3Q9VA 4IHTA 4PDKA 1XS9A 1MBGA 1O4XA 4ZH4F 2JK3A 2QLZA 4Y33A 4CZZA 4BGDA 2F6CA 2E60A 1FSHA 2HGCA 2R7UA 3RI4A 2BHZA 2JPBA 5L3FA 1XDUA 4P55A 2DA6A 3BCAA 1JHFA 1OJLA 2Y69H 4EGYA 4RB3C 2W25A 2HTSA 3I55I 1HBXG 4M9XA 3FWEA 3BR1A 1F4KA 5KNLA 4IHWA 3JRBA 3RTRA 3F72A 4ZDPA 4EJUA 3OYAA 1Z91A 4WXHA 3B02A 3HHHA 2F5EA 3OYIA 1IRXA 3HHGA 3ZMVA 2FNAA 3OS2A 4E7HA 3BR5A 4XN0A 1T0FA 2STTA 5E8GA 2E36A 5C44J 3H92A 2LSOA 2X6OA 2X1DA 1RR7A 1HA8A 1L3LA 3ELKA 3G1OA 2E2HJ 4ESFA 4NUBA 3KIOA 1D0ZA 4Y13A 2XPWA 2OQGA 3V7RA 2MFZA 3CCYA 1LDKB 3OOUA 4U0VA 2EFWA 3OOPA 2H94A 3KYDB 2JVHA 4AD9A 2LMDA 2CO5A 3OYEA 1YJ9I 3TL4X 1D1CA 4I99C 3TEDA 2GLOA 3PUBA 3LSRA 4LK1F 4MTEA 4CO8A 3QYFA 4EM1A 2JA8J 2KQRA 4JX6A 1TLHB 4XICA 2QBYA 3AL0C 2E1MB 1P6RA 3EDPA 2OCCH 2BYVE 2I8DA 2P4WA 3WTZA 2EFPA 2P6SA 3R0JA 3DKXA 2BXYA 3F6OA 4H4KC 5F08A 1W5TA 1DP3A 2E1OA 1K6OA 2RKHA 4X6AJ 1MKMA 1GUUA 1YW7A 1J9IA 2LY9A 2X0LA 3V8LA 2JUGA 2BW3A 1FZPB 1IXCA 2R7WA 1EKEA 3J7AY 2F5DA 3LAJA 2QSFX 2E5ZA 1X3WB 4M3EA 3RKQA 2UWMA 3CJNA 1GXPA 1XX5A 3VSKA 2WA0A 1SFEA 3TGNA 4BDYA 3L7WA 4LFUA 1LEBA 2WB1A 1F9NA 2PJPA 4CUGA 4IPAA 3ZMSA 5LGNA 3H5RA 5E20A 2DA7A 2EA2A 3BQZA 1WJAA 2EFOA 1O57A 3NWTA 2FMLA 4OAYA 4B48A 2YX7A 1X2NA 1MDMA 3L2WA 3M1CA 2Z33A 1PYVA 3CF2A 1DDNA 2DA4A 4BJ6C 2A69F 3HBLA 4YRVA 5HS8A 4MQ9F 1QO0D 2VBZA 2XIGA 2R5YA 4NNJA 5BMZA 4BQNA 1MH4A 3IUOA 4D9JA 3L2VA 3AFHA 1TP4A 2KIMA 3TW6A 4LITA 3CESA 2O8XA 1S7EA 1N75A 5FO5A 3ZQFA 1WJBA 1U8BA 2FF4A 2D1HA 5FRMA 4G6QA 5DS9A 4QTRA 2IEKA 1IG7A 1XMXA 3F3XA 1MJBA 5LHHA 5GPCA 5CKTA 3SZPA 1GV5A 2C6YA 3W2WA 3J80Z 1X1BA 1ZR4A 2X6XA 3R6SA 4C2MJ 4HAMA 4BXUA 2F4IA 1OQYA 3K2ZA 2LREA 3CLOA 2KRFA 5FLXZ 4W97A 4L9TA 4AIDA 2X9DA 1FX7A 2KT0A 1U9NA 2PMUA 3DEUA 1MNEA 5D5XB 2XAFA 5J1UA 4HNTA 3Q0WA 2AXLA 3DEWA 2M7AA 3FBNB 5BNGA 1Y8RB 2WTEA 5GTHC 5LHGA 4EJVA 2DA2A 3BG3A 4ESBA 2F48A 3E3VA 2JN6A 3GBGA 3I53A 3KYLA 1YQAA 2MW8A 2JZYA 2E7WA 3F8FA 5FRNA 1BI0A 2PN6A 3PJRA 2NS0A 1N78A 3FXRA 4HSTA 3L1PA 4A3BJ 2NS8A 3D5SC 4M73A 1AWCA 1OCPA 4JYKA 4C3HJ 3FHZA 3LL7A 4HF0A 2PMZA 5FKKA 3LSMA 3DTIA 4EATA 3KZZA 2A3SA 3KP2A 4YIRX 3ZQQA 2UXXA 5BPIA 2NS7A 1D0XA 2XRNA 1IAWA 2RNJA 3K70C 3FF5A 4BE0A 1MD0A 3FK7A 2CFXA 5E1WA 2KLOA 3I4MJ 3QQAA 4UY8I 2L7MP 1JGSA 4PUSA 4DIQA 1IV8A 2BBYA 4FTHA 2Y31A 3ZMUA 1OCCH 2KHMA 3GUDA 2FJ1A 1WSUA 1P7JA 2K27A 2Q2EB 1HDPA 3DLAA 3M8EA 3MKLA 3WHBA 1QRYA 3N05A 5KK1A 3QRFF 3BPVA 4HZFA 3JRGA 3B6CA 3I3LA 3BJAA 1SMTA 4LK0F 4UXNA 2FEZA 4B44A 2M34A 4G7HF 2MH2A 1E2XA 1X19A 4XLHA 2BOLA 1YHQI 3KPHA 3ASOH 1JJ6C 1FMWA 3T1BA 2LYCA 4A69C 4IRHA 3T8TA 3MKZA 1MMGA 3H3ZA 3GWZA 1T98A 2IP2A 1XSVA 5KVRA 2YU3A 1G3YA 4FE7A 2ESHA 3VYUB 3E7LA 3ABKH 1R22A 3QPTA 5HDKA 1P4WA 2MA3A 2RQPA 2XGEA 4HW0A 2FSWA 4UV9A 3IH2A 5CVIA 2KIFA 5DUKA 5FKOA 1RR8C 1RPWA 3A1YA 4MO7A 4I02A 1BL0A 4A12A 4D7MA 1W0UA 1R36A 4U0YA 4MHGA 3CCEI 2K4BA 2LF8A 4W1UA 1LDJA 1SFXA 1FOWA 5L3BA 2BY2A 5E3OA 4O6JA 2PJRA 3RPUA 4MGRA 2GAUA 3FKIJ 4HDUA 3OYGA 3TO9A 5LGUA 1VF9A 1FYKA 4XRSA 1WRJA 4KYWA 4Q5SF 5LD2C 2BV6A 4KUMA 1LJ9A 3MKWB 2DU9A 5H6QA 4CCNA 5M5XJ 1MBJA 2CUFA 1PDNC 1VQ4I 1K83J 2R7QA 1PJRA 1YX3A 3GVAA 3GFIA 4OIPF 3I54A 4LLGF 2RGVA 3RSNA 4XSXF 3H9QA 1TT5B 2A6EF 4IOCF 1FC3A 4OWRB 1QNTA 4A6DA 4WXDA 1QHGA 1E3OC 1Z67A 1LQ1A 4EVIA 2LC2A 4B3XA 3IKVA 4PJ0C 3U21A 3BLYA 1SEUA 2CMPA 4OIOF 2J5OA 4ZZLA 3WU1B 4HA8A 4S05A 3F8NA 4UB8C 2CG4A 5ED4A 3I5UA 1YO5C 4IQ4A 3CCUI 4I98B 2P7VB 3G3ZA 4GFBA 2V9KA 3D0SA 1FLIA 3MKYB 3JRHA 1JUPA 3TDUC 1KZHA 4Z6YA 4I01A 5F0CA 4F92B 4XKVA 1U9OA 2CV1A 2KIUA 5HNFA 3R60A 3K69A 4I0AA 2VC0A 4V2GA 1W5CC 4XMYA 1TW2A 3QOPA 4RAZA 5GADJ 4EMSA 4AWXB 1KONA 5HVQC 1X2MA 3H1CA 1UG2A 5HLGA 2NRAC 2V1NA 4CGZA 3L2RA 4N9IA 1E17A 5FKMA 2UV1A 5A2QZ 4LB5A 4KT6A 3BG6A 2BXZA 4PZJA 1I1GA 3O6BB 1XGMA 5CJ9A 3C18A 1TWCJ 1REPC 1YYVA 2Y9YA 3JSPA 5ILSA 1LEAA 3HPHA 1I3AA 2HR3A 2A07F 1T8IA 1G8XA 4QIWN 1ZGWA 3E5QA 2VKDA 1RIOH 1WI3A 2G9WA 4CCLA 3A0BC 2FOWA 4LMYA 2Y48A 3DTKA 3M8FA 3EUHC 2Q1ZB 3KFWX 4O5VA 3HL2A 4DNCA 5FD6A 4RGXA 4IX7A 1U8RA 4AYBA 2NXNB 3VYRB 2CV0A 3JTHA 3JRIA 1KA8A 2EPFA 3C1DA 4LLLA 1ZLKA 3BZ6A 1W5SA 3RYRA 3VODA 3K70D 4J00A 1MGTA 1Z1DA 3VPRA 5E18F 2OTLI 4KMFA 1P92A 3LMMA 3OS1A 2ZMEC 2Q0OA 2X48A 1X4PA 1F1ZA 2JPCA 2EIMH 1FP1D 1I3QJ 4L5IA 5B1AH 1ORKA 1H8AC 1X1DA 4A5MA 2W85A 1VTNC 1SFKA 2CGPA 3DWLE 2O0YA 4GGGA 2ZJ2A 5LEKA 2L7ZA 4B8XA 4UUVA 3S1MJ 1WWXA 1VQPI 3IV5A 4G12A 2RN7A 3IH4A 4NHJA 3BR2A 3FDYA 4MTDA 1OFCX 4XLFA 3ZR8X 2ZXHA 4BKXA 4HLXA 2ELHA 1SVOA 3BCBA 3Q3SA 5KAIC 1P4XA 1IC8A 2F2EA 4AUXA 1WI9A 1R1VA 3T0YA 4BY7J 3VYTB 5B66C 2I5UA 3RKYA 3ZQGA 4P1WA 4A5NA 1VNDA 2JA2A 4D5FA 4UUSA 3LA7A 3OR2C 1K61A 2DN0A 4WWCA 2D45A 3Q0UA 4Z2YA 4L5JA 3CDLA 2VJ5A 5GTIC 3WTXC 3JSOA 2D1VA 2R4GA 2E19A 3PSFA 5C4XJ 3CUQA 1MSEC 5IYDJ 3KEQA 5F04A 2R7OA 2L3DA 2VKHA 3KZYA 4GXOA 4RAGA 2HPMA 1MMDA 1W36D 4M6XA 3UR3C 1SD6A 5M3FJ 4NBQA 2KL4A 1PP8F 3K6GA 4RGRA 5J4VA 1T38A 1FSEA 4CYCA 4YFNF 3HKZA 2LF7A 2EILH 2HOSA 3SZGA 4I6ZA 4E7LA 1B8IA 4AIJA 2LRDA 3PUFA 1TNSA 3W6KB 3QODA 1HKSA 1UFMA 4E7JA 5IT9Z 3EPZA 4HPQA 3VDXA 1AHDP 2GQQA 4FHTA 4EQQA 3KCCA 1WQ2A 2JVGA 3KLNA 2LY1A 2QZ8A 3HRUA 1IUFA 3OR1C 1CGPA 3CCSI 3KP7A 3W6JB 2UXNA 3TP0A 2DXIA 4G7ZF 3DU6A 4RGUA 3OL4A 4ZDOA 2Z5UA 2LD5A 1YW9A 3OSGA 4KNYA 1A5JA 1ZG3A 4BACA 4HNUA 5J4YA 1XC5A 1YFHA 1R5ID 2MYSA 2P5LC 2QSHX 4M6VA 4GRIA 1DPRA 3OMYA 3CMMA 2GXGA 1G6NA 3BG9A 1BIBA 3R0AA 4IRGA 5F1JA 1MBFA 1Z6TA 1F5TA 2ZBKA 2IAIA 2KMUA 3ZQ7A 4ITVA 2NNYA 1G4DA 5FKLA 3RKXA 3BR6A 1GXQA 2EFNA 3S16J 2V7FA 2BEOA 3VB2A 3HYIA 4M3DA 2WAEA 4E7KA 2JA7J 2VOOA 2HKXA 1KQ9A 5FROA 4PJJA 4DQ2A 2ECCA 4I2OA 4IVNA 2VXDA 1USTA 2YX4A 3HOYJ 3JTGA 3A2KA 3HOXJ 4RB2C 2HFHA 1IW7F 3DF8A 3BT9A 2HVSA 1MBHA 3RZOJ 2HDWA 3LWFA 5AIQA 3S3OA 1BC8C 2M9HA 4M9SA 4BNCA 3KP5A 1D5YA 2WY7Q 1NTCA 1QQIA 1K78A 4L0ZB 4RGSA 3K4BA 5E1ZB 1A36A 2TRTA 4L9NA 3I0TA 1JTYA 1UG0A 1UB9A 4RB0A 3RQIA 2E2JJ 3OYDA 1O7FA 1ZTRA 4HYEA 2LFBA 1H9TA 3DFGA 1XB4A 2M1BA 2MD0A 3J7AO 1HKTA 1XPXA 2ZSHB 5LGTA 3HRMA 4NQWA 4X0GA 3G2BA 3RCOA 3H0DA 2LDUA 2H09A 1IN8A 2XSJC 2Z2SB 1U6GA 2ZMEB 2UZKA 3SJMA 1LFUP 1G59A 3F9KA 1HW1A 4FE4A 1DUXC 3HUGB 4DZPA 5ICGA 4U88A 1K7AA 3H36A 2DMPA 1OR7C 1STZA 4IHXA 2ZFUA 3H5NA 1O3TA 4EEFG 1IXRC 2V1XA 4R1HA 2HTJA 2K4JA 2O03A 5HLTA 1ETWA 2IGMA 1BA5A 5IY5H 3GZ6A 2A05A 3SFIA 1J7KA 3PNTA 2Z3YA 3K7AJ 1EA3A 1YS7A 3E6CC 2A5YB 1YW8A 2HYFA 3K1NA 4G94A 4G8XA 1ZKGA 3JRCA 2R7TA 1Z0XA 5AIPA 2H27A 2EK5A 4AU7A 2LKXA 2E2IJ 3TO7A 1X3ZB 3TOBA 3PQJA 4CH7A 2QENA 2E5NA 3AG2H 1WFXA 3OYLA 3CP2A 2MLGA 2Q8KA 3EYIA 2IT0A 2O61A 1YG2A 2H6BA 3I71A 4KFCA 4BQAA 2FQ3A 2R93J 1I27A 1IN4A 1HQCA 4KICA 4ZC3A 5IP6A 1X4OA 2HYJA 4A3JJ 4HF1A 3IC7A 5FD5A 2K40A 5BQTA 4AC0A 4ZYHA 2M4KA 2R5YB 2QUFA 4EJTA 3KP4A 2KPMA 4AYBN 4FX4A 4MQVA 2GOXB 3QU6A 3GZNB 2ZJRF 1SD7A 3FISA 1VQMI 4B3AA 1K79A 3FMRA 1Q1VA 2DW4A 2ZCWA 2CUJA 2QQ8A 2HVQA 2OC6A 1TWGJ 2RV8A 3GFMA 9ANTA 4V2FA 3KX2A 1P2FA 5LRRA 1S7OA 2KP6A 4RA2A 2Y0SA 1V5FA 3JAMK 2KJCA 1QA6A 5JLXA 1RETA 2ME6A 3M9AA 1BI1A 1LE8A 4MEXF 3QYBA 2BZTA 2L01A 1I50J 4BUPA 1W1WE 3GTMJ 3TO6A 4HX8A 3VEPA 4L5EA 3CDHA 1MJAA 3CD6I 4UVBA 4GYIA 3SEZA 3E6BA 2UUZA 1E3HA 2XF6A 3M8JA 4LJZF 5FLMJ 5J1RA 5E79C 3J7YJ 2XHKA 1WJ5A 2LBFA 2IJLA 1D8JA 4M71A 3BROA 3PNYA 3G1MA 3I58A 2M30A 2AXTC 4TV7A 1E3PA 1EH7A 2LG4A 1LFBA 1QGPA 1XSDA 3FXKA 5EZHA 3ZN1A 1OPCA 1MNMC 5EDNA 2E1NA 2DK8A 2G7UA 2QM3A 3FBIB 3LSIA 1TWFJ 2A6TA 3GO5A 3K4CA 2XAGA 4OIRF 2CW8A 4ENKA 4BHCA 2MGQA 3WTUC 2ZXIA 2K9NA 3QP6A 1IRGA 1EH6A 3OL3A 4B09A 1HW5A 1Z3XA 1OISA 2WY8Q 3ZMDA 2MC4A 3GEZA 4F7ZA 1B9MA 3J7ZI 4M9ZA 3FXQA 1ZRDA 1X1CA 4EM0B 3RZDJ 1K4SA 3K4MA 2LNBA 4U0WA 2KISA 4IZZA 1VQ9I 4QWQA 3JRAA 2R7FA 1SVLA 2FX0A 3Q9SA 1WJDA 1KGSA 3MAJA 5EZGA 1TT0A 2E71A 2VQCA 2HXOA 4PJMA 1JT6A 1Z6RA 3WTSC 1VQKI 2LR8A 2HQAA 4XRFA 4ON0A 4XRSG 4A0ZA 1GVDA 3S1NJ 2DYSH 2PFBA 4HEA2 3CQZJ 1LVAA 3Q5FA 2E1CA 3WU2C 2E35A 1WVRA 3E0JB 4FETA 1SD4A 5LHIA 1YJWI 1YLFA 2JMWA 2DFIA 4J19A 2Z99A 1B72B 4I0BA 1QPIA 3IH3A 3DBHB 1R23A 2MH9A 1FBQA 1Y0NA 2VB6A 3HEFA 4BYYA 5D5WB 4C9YA 1FYLA 2K9QA 5EF6A 1JKPC 2M0MA 1SD5A 5K7ZA 3HOVJ 2JA5J 1YX5A 4D5CA 3HC7A 3RPUD 5IPAA 1ETQA 2WADA 3VWBA 1MSFC 1BJZA 1FNNA 5EYRA 4BJ5C 4CICA 1PUFA 5F0HA 3ZMTA 4BHPA 1WH7A 1P7IA 2IW5A 5E8IA 4CCOA 1S7AA 2FQ4A 3MFKA 2PJRB 1HSJA 2XVCA 2EZHA 3LSKA 2PQ8A 3G73A 2EZLA 2IS4A 1ZGAA 4LGWA 1ETXA 3TP3A 4KA4A 2XAUA 1CF7A 3W2AA 1BC7C 2ZNYA 1ZELA 4ZYDA 1IF1A 3PSIA 2OUMA 1B4AA 3BWGA 3DTEA 2DDBA 2G0EA 3EUKL 2MBFA 1ZLJA 1QVTA 1KQ0A 3FMQA 1IGNA 5M3MJ 1T39A 1S29A 2K85A 2M8EA 2VQHA 4YG2F 1QZEA 1H88C 2JJ7A 2Z1DA 5L3EA 4RB1A 2BHYA 2XAQA 3ZXSA 2FOKA 1AKHB 2DOAA 1ZARA 3HJEA 2F5FA 1JXSA 3A02A 2HKOA 2WAQA 4II3A 5D6EA 5J8CA 5EG0B 1ZHFA 3WTYC 5JVGF 1AOYA 1KU2A 1QPMA 4ZYAA 4KMUX 3S1QJ 3LSJA 3H35A 3BJ6A 2CFOA 2MD5A 3BTJA 5DYMA 2VL8A 2R7ZJ 1H0MA 4ZYEA 1ON2A 1FEXA 1AA7A 1AU7A 2VKVA 4XL9A 4Y15A 3SZTA 2EV6A 1Z7UA 2KJBA 3M4OJ 4HG2A 4IQJA 2R7XA 1I1SA 3C7JA 5C3EJ 1R1TA 5L3DA 1WGXA 3OYBA 2TCTA 4F91B 3CCLI 2HZDA 3ZCOA 3LSTA 1T95A 2CS3A 1UELB 1IRZA 4CA0A 1XCVA 5K5RA 1UCRA 2M87A 1G2HA 4IHYA 2OBPA 2HPIA 3PNVA 3E5UA 1LPQA 3M3YJ 1YE9A 4MFEA 4ENMA 1B1BA 3PL8A 1VFCA 2R7VA 1UHSA 2O3FA 3EQLF 5K5QA 2MG4A 1R1UA 1O3RA 3GTPJ 4LG3A 2ZJPF 2IS6A 2XASA 4IJAA 1SVMA 3CJRB 3BR3A 1W0TA 1V3FA 4A3LJ 2CQQA 3W3CA 2K3PA 4KT5C 1XCBA 1DQUA 3F6VA 1RUOA 1U5TC 4ZTFA 3L2UA 2X6WA 1VQ6I 2O5RA 3JCUC 3CDIA 2O8KA 2V9PA 4M6YA 3P9KA 4DBQA 4Q4ZF 1FBUA 2HOAA 3W2VA 2HQ5A 4L0YB 4II2A 2BVMA 2VOPA 5B5EC 1Y6IA 2DFFA 5K1YA 2TDXA 2QA4I 2RQQA 3CP8A 2YR2A 3PIOF 4IHVA 1HOMA 2QCOA 3CCJI 2L9SA 1RRJA 1Z05A 5JFRA 1FWZA 3S32A 1IUYA 4J01A 4IL6C 1IDYA 2IBDA 3K4JA 3S17J 1K4TA 1JGGA 3F8CA 1VQ5I 1W36C 4NDLA 4M3FA 2AQFA 1EV7A 3C3WA 2VJ4A 2OD5A 2W4SA 2W82A 2YU9J 4YIFA 2YS9A 2CQNA 3WE2A 3X2QH 1ZRCA 2DPDA 1S6LA 3DLLF 3WTTC 2HU9A 3FM5A 3P7NA 3HOSA 3H3VK 5DEQA 4RM2A 2X1EA 1FOYA 4JQFA 5ILVA 1ITYA 5DCFA 5HLIA 5J1YA 1OCRH 1OLTA 1ZK8A 2GWRA 2QKLB 2XB0X 4UUSB 2WAFA 1UZCA 3VYSB 2VT3A 3QPLA 2V1DA 1EJ9A 3CUQB 2BVLA 3EUAA 1D8KA 3I9V2 2EQRA 2GXBA 3I56I 3DPTA 4HX7A 3OSFA 5K5OA 1T6SA 3JRFA 3S3NA 3D1NI 4HV5A 1NHAA 3HOUJ 1OYWA 3ZPLA 1D5VA 2VE8A 1B59A 1F36A 3CJQB 3MVPA 1V5GA 3SDBA 4GYGA 3DU5A 4HSRA 3HGGA 1R7JA 2AS5F 3FX3A 3GMEA 4OINF
chains in the Genus database with same CATH topology
4ASNA 3GFLA 3U1DA 1I6XA 2JTVA 2JSCA 3ECOA 1R58A 3I4PA 1ZREA 3M7GA 5CVJA 4M74A 2BE5F 5LRSA 2W24A 1BM9A 4IF4A 4L9JA 1TW3A 3RYPA 3HSFA 2MC3A 2RVCA 4HV6A 3S2WA 1H9GA 1FYMA 4LG0B 1RI7A 3I64A 2VONA 3HSEA 1OYYA 3VFZA 3NRVA 1W4MA 2Q2EA 4JBAA 1IN7A 2FU4A 1LNWA 4P9UA 2NNNA 4I7HA 2XAHA 1J5YA 5DD4A 1ODDA 3IRQA 5BPDA 3MZHA 2XKPA 5L3GA 3GW2A 5D4RA 4OOIA 1K78B 3K0LA 2OAZA 5D5VB 4IHSA 1U5TB 4Y17A 5LBQA 2E7XA 4CDGA 2WC2A 2A61A 1L0OC 4AIHA 1G3TA 4I09A 3B73A 4KIGA 1B6AA 1I5ZA 4R79A 3WG9A 2FRHA 2HQRA 2FBKA 3DPLC 3R4KA 4MNUA 1TQIA 3K1MA 4WXCA 1UHWA 3E5XA 4WCGA 2ZKZA 3IL2A 1YIOA 2P8TA 1RUNA 1FPQA 2KKOA 5F64A 5HS7A 2L54A 2DTRA 3DV8A 2RC4A 5DD8A 3HOTA 3L2CA 3ZP5A 1ON1A 1WKMA 4RS8A 1GHCA 3K9TA 3REOA 5E1XA 2PBIA 3WE3A 3GX4X 3V7SA 2VE9A 4G6DA 5CVVA 2GA2A 2XKOA 3N4MA 5DCMA 2QQBA 2O6GE 1D3YA 3ZMZA 4H0EA 2YSRA 1KYWA 2MLKA 1XMAA 3LQQA 1GVJA 4A2UA 3O2PE 5ICFA 3GXOA 2A6HF 3V4GA 1QZYA 3WGHA 3LA3A 3J81K 2WWYA 5TJJA 1KYZA 2QBYB 1G3SA 1SMYF 3KE2A 3L9FA 3AAFA 5BS6A 2B0LA 4ESJA 1S8NA 4AIKA 1XGNA 5JI6A 3E6DA 4EJWA 3TDZC 3JW4A 2LKPA 3IWFA 1BOAA 2F5CA 3ULQB 1PP7U 3RIRA 3FXUA 2XROA 2DBBA 5L3CA 3E6MA 2D2WA 3MEXA 3ABUA 5J6XA 1TQMA 2XV4S 3BPXA 4HBLA 1SAXA 3EETA 2ISYA 2ZNZA 1MDMB 5HDGA 3GLXA 2FNPA 4EV0A 4ZZDA 1Q1HA 2HZTA 3P9CA 1U3EM 1HKQA 3MQ0A 3F23A 2NAZA 3GZ5A 5CVRA 1KU3A 3ABTA 2W84A 1O3SA 1PUEE 3JAMZ 2HS5A 4ENNA 2PG4A 2PLYA 3ZN0A 2Y75A 1CF7B 1P4AA 1XGOA 5EEGA 2IRFG 1BN5A 4LB6B 3H3UA 2BGCA 4OIQF 4HQEA 3KP3A 1W7PA 3CO6C 4BAYA 4EM2A 4KIFA 3KETA 4HDVA 2EV5A 5F1RA 2W57A 4P5OA 3WU0A 3FM3A 5AONA 2CQKA 4XLPF 1O7LA 4NB5A 3GF2A 1B9NA 4GO1A 6PAXA 3EUHA 1RZ4A 1XDSA 4EGZA 2HDCA 4KIBA 2FBIA 4IRIA 1TTYA 5HS9A 1TQPA 2V9VA 2ZMEA 1ZH5A 3PFIA 1BIAA 3HUGA 2VN2A 2EJRA 3I59A 4FT8A 3F8BA 3HTUA 3WTVC 1JE8A 5JVTA 3PQKA 1ZRFA 2YPRA 2DAOA 4HLYA 3F22A 5D6FA 4WF2A 3TOAA 3OV8A 4UNOA 3CUQC 2H6CA 2FA5A 1QBJA 3T8RA 4HF2A 1DPUA 1XMKA 3HRTA 1X3UA 1Y0UA 2EA4A 2GZWA 3NEUA 2J5PA 4BH9A 3O3KA 2CYYA 5JR3A 2R3SA 5HOOA 2K02A 4MEYF 4AVPA 3QPHA 3J80K 1R00A 2X4HA 1S3JA 5JHUA 3ECHA 4FX0A 2IA2A 2WV0A 3SHFA 5DV5A 4OU0A 2DPUA 4P96A 5FLXK 2ADUA 3HSRA 4KDPA 3WGGA 4A0XA 4R8HA 4E70A 4YIIA 3P9IA 4LLNA 2EB7A 1J75A 5CVUA 3ERED 2R7DA 2HOEA 1ULYA 3RJPA 4UV8A 2EFQA 4PGHA 3IRRA 2CWEA 2FMYA 1ZYRF 2DK5A 5HDNA 5TRDA 5DDGA 3EYYA 2P7CB 2QVOA 5FB2A 5LEJA 3LAPA 2ZFWA 2XAJA 2PEXA 5D5UB 2IPQX 3FZVA 1ZAOA 4PCQA 1XGSA 4N9HA 3V7CA 2EWNA 2QQ9A 3LFKA 5ICCA 1IN5A 5ERIA 5ILUA 2QYOA 2ETHA 5D8KB 1J59A 2L4AA 4WX9A 4L9VA 1OR7A 1MJ9A 2FE3A 2L02A 4IXAA 1BI2A 3BOQA 2COMA 3U2RA 4ENJA 3N97A 3SQNA 4U7BA 4GCVA 2IVMA 2V79A 2STWA 4LD5A 2A68F 3COAC 4UHTA 3F8MA 1FT9A 1O3QA 2HEOA 1Z9CA 3FMSA 2ZXJA 2VBXA 4D0PA 1C0WA 3MCZA 1BJAA 2VXZA 2P5KA 3WGIA 2HYGD 2M5WA 2PMHA 3DP7A 2GA1A 3HIFA 3HRSA 1OMIA 1G3WA 2ZO4A 5F6FA 1TNTA 1YTYA 1FY7A 4XBFA 3L09A 2ISZA 4KN7X 3V8JA 3BP8A 1SFUA 4UVCA 2ACJA 4YFKF 3ROUA 2IA0A 3QP5A 4A0YA 5HLHA 5A2QK 4G9YA 2V1UA 3QU3A 4OMZA 4N0BA 2OU2A 1OKRA 2JRTA 2VBWA 3KP6A 3LQRA 1MZBA 3R61A 4HQMA 1U2WA 2PI0A 3GFJA 2DQRA 3QAHA 3U9GA 4BHBA 3WTWC 2CSOA 3ISPA 5DCMB 1U78A 5CYVA 3T5XA 1XD7A 1IZ1A 5LLQA 3CO7C 3MWMA 3L00A 1OYIA 4P9FA 4ZYGA 4Q47A 1A04A 4HOBA 1IN6A 3SXYA 5ICEA 1DP7P 2L4MA 2P6TA 3RKWA 1R5GA 3CUOA 4U7DA 1J0RA 2OA4A 3IHUA 2DT5A 4WK8F 1UHMA 4YFXF 3MZYA 4KN4X 5BOXA 1RNLA 1FOKA 5J8FA 3F21A 2HQNA 3M1EA 1XSXA 3KLOA 3TQNA 3GYHX 1T2KA 3DKWA 1IXSB 5D4SA 3RDIA 3K1PA 4G7OF 1R5HA 1IRFA 2VT2A 2G7HA 4L18B 1ZGJA 2FXAA 5H20A 3BY6A 4XLNF 2OQRA 2V6CA 2VBYA 1KU9A 1TBXA 3VOEA 2OZ6A 4CYDA 1YS6A 3TKYA 2CW0F 5IT9K 5DUIA 2HWVA 3V8KA 2P5VA 1ZG1A 3D5LA 2VODA 2K7LA 1KQ8A 3DQVC 5H6RA 4LG0A 2Y0MA 4RAYA 4O3MA 5CLSA 4XSZF 5FGMA 4Q48A 1W7PD 4OMYA 2Z9OA 2XGXA 3ML6A 1W7PB 1EH8A 3WODF 1LDDA 2EV0A 3J81Z 3BDDA 2DQLA 2JT1A 2K86A 1BBYA 3DXJF 2DLLA 2M45A 2FBHA 3RPQA 3LA2A 2QWWA 3IWZA 1FP2A 1V4RA 4PGGA 4HX4A 2DI3A 4UVAA 5FFZA 5IT3A 5EEHA 3NQOA 1ZN2A 4EJOA 4QLCU 2NYXA 1QZZA 5E17F 1U5TA 2GIVA 3SFZA 4S04A 5FFXA 4JK1X 1KU7A 2DO7A 1BI3A 4K2EA 2ESNA 3I59B 1HW2A 4ETSA 1HXDA 1XN7A 4A6EA 1HSTA 2VC1A 2QQAA 3E97A 2OZUA 1ONVA 1J2XA 1ZG5A 5D8LB 4CHUA 1FBSA 3BJOA 4M72A 1LB2A 2XUBA 1USSA 3CTAA 2IA1A 3KEOA 1JHHA 3HTSB 3IKTA 4CXFA 2RDPA 3Q9VA 4IHTA 4PDKA 4ZH4F 2QLZA 4CZZA 1FSHA 2HGCA 3RI4A 2JPBA 5L3FA 1XDUA 4P55A 1JHFA 4EGYA 4RB3C 2W25A 2HTSA 1HBXG 4M9XA 3FWEA 1F4KA 3RTRA 3F72A 4EJUA 1Z91A 4WXHA 3B02A 3HHHA 2F5EA 3HHGA 3ZMVA 2FNAA 1T0FA 2STTA 5E8GA 3H92A 2LSOA 1L3LA 3ELKA 4ESFA 4Y13A 2OQGA 3V7RA 1LDKB 4U0VA 2EFWA 3OOPA 2H94A 1J9IA 4AD9A 2CO5A 4LK1F 4MTEA 4CO8A 4EM1A 1TLHB 2QBYA 1P6RA 3EDPA 2BYVE 2P4WA 3WTZA 2EFPA 2P6SA 3R0JA 3F6OA 1W5TA 1K6OA 2RKHA 1MKMA 1YW7A 2X0LA 3V8LA 1FZPB 1IXCA 2F5DA 3LAJA 2UWMA 3CJNA 1GXPA 1SFEA 3TGNA 3L7WA 4LFUA 1LEBA 1F9NA 2PJPA 4IPAA 3ZMSA 5LGNA 5E20A 2EA2A 2EFOA 1O57A 2FMLA 2YX7A 1MDMA 2Z33A 1DDNA 2A69F 5HS8A 4MQ9F 1QO0D 2VBZA 2XIGA 5BMZA 2KIMA 2O8XA 5FO5A 2FF4A 2D1HA 4G6QA 3F3XA 1MJBA 5LHHA 3SZPA 2C6YA 3J80Z 3R6SA 4HAMA 4BXUA 3K2ZA 3CLOA 2KRFA 5FLXZ 4L9TA 1FX7A 2PMUA 3DEUA 5D5XB 2XAFA 2AXLA 2WTEA 5LHGA 4EJVA 4ESBA 3E3VA 3I53A 1YQAA 2JZYA 2E7WA 3F8FA 1BI0A 2PN6A 2NS0A 3FXRA 4M73A 1AWCA 3FHZA 4HF0A 3KZZA 2A3SA 3KP2A 2UXXA 5BPIA 2XRNA 1IAWA 2RNJA 3FF5A 1MD0A 5E1WA 2CFXA 1JGSA 2BBYA 3ZMUA 3GUDA 1WSUA 2K27A 3M8EA 5KK1A 3QRFF 3BPVA 4HZFA 3BJAA 1SMTA 4LK0F 4UXNA 2FEZA 4G7HF 2MH2A 1E2XA 3T1BA 4IRHA 3T8TA 3H3ZA 3GWZA 1T98A 2IP2A 1XSVA 5KVRA 2YU3A 1G3YA 2ESHA 1R22A 3QPTA 5HDKA 1P4WA 2MA3A 2RQPA 4HW0A 4UV9A 2FSWA 5CVIA 5DUKA 2KIFA 4I02A 4A12A 1R36A 4U0YA 4MHGA 2K4BA 2LF8A 1LDJA 1SFXA 5L3BA 4O6JA 3RPUA 4MGRA 4HDUA 2GAUA 3TO9A 5LGUA 1FYKA 4KYWA 1WRJA 4Q5SF 2BV6A 4KUMA 1LJ9A 2DU9A 5H6QA 1PDNC 3GVAA 3GFIA 4OIPF 3I54A 4LLGF 2RGVA 4XSXF 2A6EF 1FC3A 1QNTA 4A6DA 4WXDA 1LQ1A 4EVIA 3IKVA 4OIOF 2J5OA 4ZZLA 3WU1B 4HA8A 4S05A 3F8NA 2CG4A 5ED4A 3I5UA 1YO5C 4I98B 2P7VB 3G3ZA 3D0SA 1FLIA 3TDUC 4I01A 2KIUA 3R60A 3K69A 4I0AA 2VC0A 1TW2A 3QOPA 4RAZA 4EMSA 5HVQC 4AWXB 2NRAC 5HLGA 4CGZA 4N9IA 1E17A 5A2QZ 4LB5A 4PZJA 1I1GA 3O6BB 1XGMA 5CJ9A 3C18A 1REPC 1YYVA 3JSPA 5ILSA 1LEAA 2HR3A 2A07F 3E5QA 1RIOH 2G9WA 4LMYA 2Y48A 3M8FA 3KFWX 4O5VA 4DNCA 5FD6A 4RGXA 1U8RA 3JTHA 1KA8A 3C1DA 4LLLA 1ZLKA 3BZ6A 3RYRA 1W5SA 3VODA 1MGTA 1Z1DA 5E18F 4KMFA 1P92A 2Q0OA 1F1ZA 2JPCA 1FP1D 4L5IA 4A5MA 1VTNC 2W85A 2CGPA 4GGGA 2O0YA 2ZJ2A 5LEKA 4B8XA 4UUVA 1WWXA 2RN7A 4NHJA 4MTDA 4HLXA 2ELHA 1P4XA 2F2EA 1WI9A 1R1VA 3T0YA 3RKYA 4A5NA 3LA7A 4WWCA 2D45A 4Z2YA 4L5JA 3WTXC 3JSOA 2D1VA 3CUQA 3KEQA 2L3DA 3KZYA 4GXOA 4M6XA 1SD6A 1PP8F 4RGRA 1T38A 1FSEA 4YFNF 2LF7A 4AIJA 3W6KB 1TNSA 1HKSA 1UFMA 5IT9Z 2GQQA 4FHTA 4EQQA 3KCCA 1WQ2A 3KLNA 2QZ8A 3HRUA 1CGPA 3KP7A 3W6JB 2UXNA 4G7ZF 4RGUA 2Z5UA 1YW9A 4KNYA 1ZG3A 1YFHA 2P5LC 1DPRA 2GXGA 1G6NA 1BIBA 3R0AA 4IRGA 1Z6TA 1F5TA 2ZBKA 3ZQ7A 2NNYA 1G4DA 3RKXA 1GXQA 2EFNA 2BEOA 3VB2A 3HYIA 2VOOA 2HKXA 1KQ9A 4DQ2A 4I2OA 4IVNA 1USTA 2YX4A 3JTGA 4RB2C 2HFHA 1IW7F 3DF8A 3LWFA 5AIQA 1BC8C 4M9SA 4BNCA 3KP5A 1QQIA 1K78A 4L0ZB 4RGSA 5E1ZB 4L9NA 3I0TA 4RB0A 1UB9A 1O7FA 4HYEA 1H9TA 3DFGA 1XB4A 2M1BA 3J7AO 1HKTA 5LGTA 3HRMA 4NQWA 2LDUA 2H09A 1IN8A 1U6GA 2ZMEB 2UZKA 1HW1A 1DUXC 5ICGA 4U88A 1K7AA 1STZA 1O3TA 1IXRC 2V1XA 4R1HA 2HTJA 2K4JA 2O03A 3GZ6A 1J7KA 2Z3YA 1YS7A 3E6CC 2A5YB 1YW8A 2HYFA 3K1NA 4G94A 4G8XA 5AIPA 2H27A 2EK5A 3TO7A 3TOBA 3PQJA 2QENA 2MLGA 2Q8KA 3EYIA 2IT0A 2O61A 1YG2A 2H6BA 3I71A 4KFCA 4BQAA 2FQ3A 1I27A 1IN4A 1HQCA 4KICA 4HF1A 3IC7A 5FD5A 5BQTA 4ZYHA 4EJTA 2QUFA 3KP4A 4FX4A 4MQVA 3QU6A 1SD7A 1K79A 3FMRA 2DW4A 2ZCWA 2RV8A 3GFMA 5LRRA 1P2FA 1S7OA 3JAMK 2KJCA 3M9AA 1BI1A 4MEXF 2L01A 3TO6A 4HX8A 3VEPA 3CDHA 1MJAA 4UVBA 4GYIA 3E6BA 4LJZF 2XHKA 2IJLA 1D8JA 4M71A 3BROA 3I58A 2M30A 4TV7A 1EH7A 1QGPA 1XSDA 3ZN1A 1OPCA 2E1NA 2DK8A 2G7UA 2QM3A 3GO5A 2XAGA 4OIRF 4ENKA 4BHCA 3WTUC 3QP6A 1IRGA 1EH6A 4B09A 1HW5A 3ZMDA 3GEZA 4F7ZA 1B9MA 4M9ZA 3FXQA 1ZRDA 4EM0B 2LNBA 4U0WA 4QWQA 2R7FA 3Q9SA 1KGSA 3MAJA 1Z6RA 3WTSC 4ON0A 4XRFA 4A0ZA 2PFBA 1LVAA 3Q5FA 2E1CA 5LHIA 1SD4A 1YLFA 2DFIA 2Z99A 4I0BA 1R23A 2MH9A 1FBQA 4BYYA 5D5WB 1FYLA 1SD5A 1FNNA 4CICA 3ZMTA 4BHPA 5E8IA 2IW5A 1S7AA 3MFKA 1HSJA 2XVCA 2PQ8A 3G73A 1ZGAA 4LGWA 4KA4A 1CF7A 1BC7C 2ZNYA 4ZYDA 1IF1A 1B4AA 3BWGA 2MBFA 1ZLJA 1KQ0A 3FMQA 1T39A 1S29A 4YG2F 2M8EA 5L3EA 4RB1A 2XAQA 2FOKA 1ZARA 2F5FA 1JXSA 2HKOA 5J8CA 5D6EA 3WTYC 1AOYA 1ZHFA 1KU2A 1QPMA 4KMUX 3BJ6A 2MD5A 5DYMA 1H0MA 4ZYEA 1ON2A 4Y15A 3SZTA 2EV6A 1Z7UA 2KJBA 1I1SA 3C7JA 1R1TA 5L3DA 3LSTA 1XCVA 5K5RA 1UCRA 2M87A 2OBPA 3E5UA 4ENMA 1B1BA 2O3FA 3EQLF 5K5QA 1R1UA 1O3RA 2XASA 4IJAA 1V3FA 4KT5C 1XCBA 3F6VA 1RUOA 1U5TC 4M6YA 3P9KA 4Q4ZF 1FBUA 4L0YB 2VOPA 5K1YA 2TDXA 2YR2A 1Z05A 5JFRA 1FWZA 1IUYA 3F8CA 1EV7A 3C3WA 2OD5A 4YIFA 3WE2A 1ZRCA 2DPDA 1S6LA 3WTTC 3FM5A 3P7NA 3HOSA 5DEQA 4JQFA 5ILVA 5DCFA 5HLIA 2GWRA 2VT3A 2V1DA 3CUQB 1D8KA 2GXBA 3DPTA 4HX7A 5K5OA 1T6SA 4HV5A 1NHAA 1OYWA 3ZPLA 1D5VA 2VE8A 1B59A 4GYGA 1R7JA 2AS5F 3FX3A 4OINF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASN A;  3GFL A;  3U1D A;  1I6X A;  2JTV A;  2JSC A;  3ECO A;  1R58 A;  3I4P A;  1ZRE A;  3M7G A;  5CVJ A;  4M74 A;  2BE5 F;  5LRS A;  2W24 A;  1BM9 A;  4IF4 A;  4L9J A;  1TW3 A;  3RYP A;  3HSF A;  2MC3 A;  2RVC A;  4HV6 A;  3S2W A;  1H9G A;  1FYM A;  4LG0 B;  1RI7 A;  3I64 A;  2VON A;  3HSE A;  1OYY A;  3VFZ A;  3NRV A;  1W4M A;  2Q2E A;  4JBA A;  1IN7 A;  2FU4 A;  1LNW A;  4P9U A;  2NNN A;  4I7H A;  2XAH A;  1J5Y A;  5DD4 A;  1ODD A;  3IRQ A;  5BPD A;  3MZH A;  2XKP A;  5L3G A;  3GW2 A;  5D4R A;  4OOI A;  1K78 B;  3K0L A;  2OAZ A;  5D5V B;  4IHS A;  1U5T B;  4Y17 A;  5LBQ A;  2E7X A;  4CDG A;  2WC2 A;  2A61 A;  1L0O C;  4AIH A;  1G3T A;  4I09 A;  3B73 A;  4KIG A;  1B6A A;  1I5Z A;  4R79 A;  3WG9 A;  2FRH A;  2HQR A;  2FBK A;  3DPL C;  3R4K A;  4MNU A;  1TQI A;  3K1M A;  4WXC A;  1UHW A;  3E5X A;  4WCG A;  2ZKZ A;  3IL2 A;  1YIO A;  2P8T A;  1RUN A;  1FPQ A;  2KKO A;  5F64 A;  5HS7 A;  2L54 A;  2DTR A;  3DV8 A;  2RC4 A;  5DD8 A;  3HOT A;  3L2C A;  3ZP5 A;  1ON1 A;  1WKM A;  4RS8 A;  1GHC A;  3K9T A;  3REO A;  5E1X A;  2PBI A;  3WE3 A;  3GX4 X;  3V7S A;  2VE9 A;  4G6D A;  5CVV A;  2GA2 A;  2XKO A;  3N4M A;  5DCM A;  2QQB A;  2O6G E;  1D3Y A;  3ZMZ A;  4H0E A;  2YSR A;  1KYW A;  2MLK A;  1XMA A;  3LQQ A;  1GVJ A;  4A2U A;  3O2P E;  5ICF A;  3GXO A;  2A6H F;  3V4G A;  1QZY A;  3WGH A;  3LA3 A;  3J81 K;  2WWY A;  5TJJ A;  1KYZ A;  2QBY B;  1G3S A;  1SMY F;  3KE2 A;  3L9F A;  3AAF A;  5BS6 A;  2B0L A;  4ESJ A;  1S8N A;  4AIK A;  1XGN A;  5JI6 A;  3E6D A;  4EJW A;  3TDZ C;  3JW4 A;  2LKP A;  3IWF A;  1BOA A;  2F5C A;  3ULQ B;  1PP7 U;  3RIR A;  3FXU A;  2XRO A;  2DBB A;  5L3C A;  3E6M A;  2D2W A;  3MEX A;  3ABU A;  5J6X A;  1TQM A;  2XV4 S;  3BPX A;  4HBL A;  1SAX A;  3EET A;  2ISY A;  2ZNZ A;  1MDM B;  5HDG A;  3GLX A;  2FNP A;  4EV0 A;  4ZZD A;  1Q1H A;  2HZT A;  3P9C A;  1U3E M;  1HKQ A;  3MQ0 A;  3F23 A;  2NAZ A;  3GZ5 A;  5CVR A;  1KU3 A;  3ABT A;  2W84 A;  1O3S A;  1PUE E;  3JAM Z;  2HS5 A;  4ENN A;  2PG4 A;  2PLY A;  3ZN0 A;  2Y75 A;  1CF7 B;  1P4A A;  1XGO A;  5EEG A;  2IRF G;  1BN5 A;  4LB6 B;  3H3U A;  2BGC A;  4OIQ F;  4HQE A;  3KP3 A;  1W7P A;  3CO6 C;  4BAY A;  4EM2 A;  4KIF A;  3KET A;  4HDV A;  2EV5 A;  5F1R A;  2W57 A;  4P5O A;  3WU0 A;  3FM3 A;  5AON A;  2CQK A;  4XLP F;  1O7L A;  4NB5 A;  3GF2 A;  1B9N A;  4GO1 A;  6PAX A;  3EUH A;  1RZ4 A;  1XDS A;  4EGZ A;  2HDC A;  4KIB A;  2FBI A;  4IRI A;  1TTY A;  5HS9 A;  1TQP A;  2V9V A;  2ZME A;  1ZH5 A;  3PFI A;  1BIA A;  3HUG A;  2VN2 A;  2EJR A;  3I59 A;  4FT8 A;  3F8B A;  3HTU A;  3WTV C;  1JE8 A;  5JVT A;  3PQK A;  1ZRF A;  2YPR A;  2DAO A;  4HLY A;  3F22 A;  5D6F A;  4WF2 A;  3TOA A;  3OV8 A;  4UNO A;  3CUQ C;  2H6C A;  2FA5 A;  1QBJ A;  3T8R A;  4HF2 A;  1DPU A;  1XMK A;  3HRT A;  1X3U A;  1Y0U A;  2EA4 A;  2GZW A;  3NEU A;  2J5P A;  4BH9 A;  3O3K A;  2CYY A;  5JR3 A;  2R3S A;  5HOO A;  2K02 A;  4MEY F;  4AVP A;  3QPH A;  3J80 K;  1R00 A;  2X4H A;  1S3J A;  5JHU A;  3ECH A;  4FX0 A;  2IA2 A;  2WV0 A;  3SHF A;  5DV5 A;  4OU0 A;  2DPU A;  4P96 A;  5FLX K;  2ADU A;  3HSR A;  4KDP A;  3WGG A;  4A0X A;  4R8H A;  4E70 A;  4YII A;  3P9I A;  4LLN A;  2EB7 A;  1J75 A;  5CVU A;  3ERE D;  2R7D A;  2HOE A;  1ULY A;  3RJP A;  4UV8 A;  2EFQ A;  4PGH A;  3IRR A;  2CWE A;  2FMY A;  1ZYR F;  2DK5 A;  5HDN A;  5TRD A;  5DDG A;  3EYY A;  2P7C B;  2QVO A;  5FB2 A;  5LEJ A;  3LAP A;  2ZFW A;  2XAJ A;  2PEX A;  5D5U B;  2IPQ X;  3FZV A;  1ZAO A;  4PCQ A;  1XGS A;  4N9H A;  3V7C A;  2EWN A;  2QQ9 A;  3LFK A;  5ICC A;  1IN5 A;  5ERI A;  5ILU A;  2QYO A;  2ETH A;  5D8K B;  1J59 A;  2L4A A;  4WX9 A;  4L9V A;  1OR7 A;  1MJ9 A;  2FE3 A;  2L02 A;  4IXA A;  1BI2 A;  3BOQ A;  2COM A;  3U2R A;  4ENJ A;  3N97 A;  3SQN A;  4U7B A;  4GCV A;  2IVM A;  2V79 A;  2STW A;  4LD5 A;  2A68 F;  3COA C;  4UHT A;  3F8M A;  1FT9 A;  1O3Q A;  2HEO A;  1Z9C A;  3FMS A;  2ZXJ A;  2VBX A;  4D0P A;  1C0W A;  3MCZ A;  1BJA A;  2VXZ A;  2P5K A;  3WGI A;  2HYG D;  2M5W A;  2PMH A;  3DP7 A;  2GA1 A;  3HIF A;  3HRS A;  1OMI A;  1G3W A;  2ZO4 A;  5F6F A;  1TNT A;  1YTY A;  1FY7 A;  4XBF A;  3L09 A;  2ISZ A;  4KN7 X;  3V8J A;  3BP8 A;  1SFU A;  4UVC A;  2ACJ A;  4YFK F;  3ROU A;  2IA0 A;  3QP5 A;  4A0Y A;  5HLH A;  5A2Q K;  4G9Y A;  2V1U A;  3QU3 A;  4OMZ A;  4N0B A;  2OU2 A;  1OKR A;  2JRT A;  2VBW A;  3KP6 A;  3LQR A;  1MZB A;  3R61 A;  4HQM A;  1U2W A;  2PI0 A;  3GFJ A;  2DQR A;  3QAH A;  3U9G A;  4BHB A;  3WTW C;  2CSO A;  3ISP A;  5DCM B;  1U78 A;  5CYV A;  3T5X A;  1XD7 A;  1IZ1 A;  5LLQ A;  3CO7 C;  3MWM A;  3L00 A;  1OYI A;  4P9F A;  4ZYG A;  4Q47 A;  1A04 A;  4HOB A;  1IN6 A;  3SXY A;  5ICE A;  1DP7 P;  2L4M A;  2P6T A;  3RKW A;  1R5G A;  3CUO A;  4U7D A;  1J0R A;  2OA4 A;  3IHU A;  2DT5 A;  4WK8 F;  1UHM A;  4YFX F;  3MZY A;  4KN4 X;  5BOX A;  1RNL A;  1FOK A;  5J8F A;  3F21 A;  2HQN A;  3M1E A;  1XSX A;  3KLO A;  3TQN A;  3GYH X;  1T2K A;  3DKW A;  1IXS B;  5D4S A;  3RDI A;  3K1P A;  4G7O F;  1R5H A;  1IRF A;  2VT2 A;  2G7H A;  4L18 B;  1ZGJ A;  2FXA A;  5H20 A;  3BY6 A;  4XLN F;  2OQR A;  2V6C A;  2VBY A;  1KU9 A;  1TBX A;  3VOE A;  2OZ6 A;  4CYD A;  1YS6 A;  3TKY A;  2CW0 F;  5IT9 K;  5DUI A;  2HWV A;  3V8K A;  2P5V A;  1ZG1 A;  3D5L A;  2VOD A;  2K7L A;  1KQ8 A;  3DQV C;  5H6R A;  4LG0 A;  2Y0M A;  4RAY A;  4O3M A;  5CLS A;  4XSZ F;  5FGM A;  4Q48 A;  1W7P D;  4OMY A;  2Z9O A;  2XGX A;  3ML6 A;  1W7P B;  1EH8 A;  3WOD F;  1LDD A;  2EV0 A;  3J81 Z;  3BDD A;  2DQL A;  2JT1 A;  2K86 A;  1BBY A;  3DXJ F;  2DLL A;  2M45 A;  2FBH A;  3RPQ A;  3LA2 A;  2QWW A;  3IWZ A;  1FP2 A;  1V4R A;  4PGG A;  4HX4 A;  2DI3 A;  4UVA A;  5FFZ A;  5IT3 A;  5EEH A;  3NQO A;  1ZN2 A;  4EJO A;  4QLC U;  2NYX A;  1QZZ A;  5E17 F;  1U5T A;  2GIV A;  3SFZ A;  4S04 A;  5FFX A;  4JK1 X;  1KU7 A;  2DO7 A;  1BI3 A;  4K2E A;  2ESN A;  3I59 B;  1HW2 A;  4ETS A;  1HXD A;  1XN7 A;  4A6E A;  1HST A;  2VC1 A;  2QQA A;  3E97 A;  2OZU A;  1ONV A;  1J2X A;  1ZG5 A;  5D8L B;  4CHU A;  1FBS A;  3BJO A;  4M72 A;  1LB2 A;  2XUB A;  1USS A;  3CTA A;  2IA1 A;  3KEO A;  1JHH A;  3HTS B;  3IKT A;  4CXF A;  2RDP A;  3Q9V A;  4IHT A;  4PDK A;  4ZH4 F;  2QLZ A;  4CZZ A;  1FSH A;  2HGC A;  3RI4 A;  2JPB A;  5L3F A;  1XDU A;  4P55 A;  1JHF A;  4EGY A;  4RB3 C;  2W25 A;  2HTS A;  1HBX G;  4M9X A;  3FWE A;  1F4K A;  3RTR A;  3F72 A;  4EJU A;  1Z91 A;  4WXH A;  3B02 A;  3HHH A;  2F5E A;  3HHG A;  3ZMV A;  2FNA A;  1T0F A;  2STT A;  5E8G A;  3H92 A;  2LSO A;  1L3L A;  3ELK A;  4ESF A;  4Y13 A;  2OQG A;  3V7R A;  1LDK B;  4U0V A;  2EFW A;  3OOP A;  2H94 A;  1J9I A;  4AD9 A;  2CO5 A;  4LK1 F;  4MTE A;  4CO8 A;  4EM1 A;  1TLH B;  2QBY A;  1P6R A;  3EDP A;  2BYV E;  2P4W A;  3WTZ A;  2EFP A;  2P6S A;  3R0J A;  3F6O A;  1W5T A;  1K6O A;  2RKH A;  1MKM A;  1YW7 A;  2X0L A;  3V8L A;  1FZP B;  1IXC A;  2F5D A;  3LAJ A;  2UWM A;  3CJN A;  1GXP A;  1SFE A;  3TGN A;  3L7W A;  4LFU A;  1LEB A;  1F9N A;  2PJP A;  4IPA A;  3ZMS A;  5LGN A;  5E20 A;  2EA2 A;  2EFO A;  1O57 A;  2FML A;  2YX7 A;  1MDM A;  2Z33 A;  1DDN A;  2A69 F;  5HS8 A;  4MQ9 F;  1QO0 D;  2VBZ A;  2XIG A;  5BMZ A;  2KIM A;  2O8X A;  5FO5 A;  2FF4 A;  2D1H A;  4G6Q A;  3F3X A;  1MJB A;  5LHH A;  3SZP A;  2C6Y A;  3J80 Z;  3R6S A;  4HAM A;  4BXU A;  3K2Z A;  3CLO A;  2KRF A;  5FLX Z;  4L9T A;  1FX7 A;  2PMU A;  3DEU A;  5D5X B;  2XAF A;  2AXL A;  2WTE A;  5LHG A;  4EJV A;  4ESB A;  3E3V A;  3I53 A;  1YQA A;  2JZY A;  2E7W A;  3F8F A;  1BI0 A;  2PN6 A;  2NS0 A;  3FXR A;  4M73 A;  1AWC A;  3FHZ A;  4HF0 A;  3KZZ A;  2A3S A;  3KP2 A;  2UXX A;  5BPI A;  2XRN A;  1IAW A;  2RNJ A;  3FF5 A;  1MD0 A;  5E1W A;  2CFX A;  1JGS A;  2BBY A;  3ZMU A;  3GUD A;  1WSU A;  2K27 A;  3M8E A;  5KK1 A;  3QRF F;  3BPV A;  4HZF A;  3BJA A;  1SMT A;  4LK0 F;  4UXN A;  2FEZ A;  4G7H F;  2MH2 A;  1E2X A;  3T1B A;  4IRH A;  3T8T A;  3H3Z A;  3GWZ A;  1T98 A;  2IP2 A;  1XSV A;  5KVR A;  2YU3 A;  1G3Y A;  2ESH A;  1R22 A;  3QPT A;  5HDK A;  1P4W A;  2MA3 A;  2RQP A;  4HW0 A;  4UV9 A;  2FSW A;  5CVI A;  5DUK A;  2KIF A;  4I02 A;  4A12 A;  1R36 A;  4U0Y A;  4MHG A;  2K4B A;  2LF8 A;  1LDJ A;  1SFX A;  5L3B A;  4O6J A;  3RPU A;  4MGR A;  4HDU A;  2GAU A;  3TO9 A;  5LGU A;  1FYK A;  4KYW A;  1WRJ A;  4Q5S F;  2BV6 A;  4KUM A;  1LJ9 A;  2DU9 A;  5H6Q A;  1PDN C;  3GVA A;  3GFI A;  4OIP F;  3I54 A;  4LLG F;  2RGV A;  4XSX F;  2A6E F;  1FC3 A;  1QNT A;  4A6D A;  4WXD A;  1LQ1 A;  4EVI A;  3IKV A;  4OIO F;  2J5O A;  4ZZL A;  3WU1 B;  4HA8 A;  4S05 A;  3F8N A;  2CG4 A;  5ED4 A;  3I5U A;  1YO5 C;  4I98 B;  2P7V B;  3G3Z A;  3D0S A;  1FLI A;  3TDU C;  4I01 A;  2KIU A;  3R60 A;  3K69 A;  4I0A A;  2VC0 A;  1TW2 A;  3QOP A;  4RAZ A;  4EMS A;  5HVQ C;  4AWX B;  2NRA C;  5HLG A;  4CGZ A;  4N9I A;  1E17 A;  5A2Q Z;  4LB5 A;  4PZJ A;  1I1G A;  3O6B B;  1XGM A;  5CJ9 A;  3C18 A;  1REP C;  1YYV A;  3JSP A;  5ILS A;  1LEA A;  2HR3 A;  2A07 F;  3E5Q A;  1RIO H;  2G9W A;  4LMY A;  2Y48 A;  3M8F A;  3KFW X;  4O5V A;  4DNC A;  5FD6 A;  4RGX A;  1U8R A;  3JTH A;  1KA8 A;  3C1D A;  4LLL A;  1ZLK A;  3BZ6 A;  3RYR A;  1W5S A;  3VOD A;  1MGT A;  1Z1D A;  5E18 F;  4KMF A;  1P92 A;  2Q0O A;  1F1Z A;  2JPC A;  1FP1 D;  4L5I A;  4A5M A;  1VTN C;  2W85 A;  2CGP A;  4GGG A;  2O0Y A;  2ZJ2 A;  5LEK A;  4B8X A;  4UUV A;  1WWX A;  2RN7 A;  4NHJ A;  4MTD A;  4HLX A;  2ELH A;  1P4X A;  2F2E A;  1WI9 A;  1R1V A;  3T0Y A;  3RKY A;  4A5N A;  3LA7 A;  4WWC A;  2D45 A;  4Z2Y A;  4L5J A;  3WTX C;  3JSO A;  2D1V A;  3CUQ A;  3KEQ A;  2L3D A;  3KZY A;  4GXO A;  4M6X A;  1SD6 A;  1PP8 F;  4RGR A;  1T38 A;  1FSE A;  4YFN F;  2LF7 A;  4AIJ A;  3W6K B;  1TNS A;  1HKS A;  1UFM A;  5IT9 Z;  2GQQ A;  4FHT A;  4EQQ A;  3KCC A;  1WQ2 A;  3KLN A;  2QZ8 A;  3HRU A;  1CGP A;  3KP7 A;  3W6J B;  2UXN A;  4G7Z F;  4RGU A;  2Z5U A;  1YW9 A;  4KNY A;  1ZG3 A;  1YFH A;  2P5L C;  1DPR A;  2GXG A;  1G6N A;  1BIB A;  3R0A A;  4IRG A;  1Z6T A;  1F5T A;  2ZBK A;  3ZQ7 A;  2NNY A;  1G4D A;  3RKX A;  1GXQ A;  2EFN A;  2BEO A;  3VB2 A;  3HYI A;  2VOO A;  2HKX A;  1KQ9 A;  4DQ2 A;  4I2O A;  4IVN A;  1UST A;  2YX4 A;  3JTG A;  4RB2 C;  2HFH A;  1IW7 F;  3DF8 A;  3LWF A;  5AIQ A;  1BC8 C;  4M9S A;  4BNC A;  3KP5 A;  1QQI A;  1K78 A;  4L0Z B;  4RGS A;  5E1Z B;  4L9N A;  3I0T A;  4RB0 A;  1UB9 A;  1O7F A;  4HYE A;  1H9T A;  3DFG A;  1XB4 A;  2M1B A;  3J7A O;  1HKT A;  5LGT A;  3HRM A;  4NQW A;  2LDU A;  2H09 A;  1IN8 A;  1U6G A;  2ZME B;  2UZK A;  1HW1 A;  1DUX C;  5ICG A;  4U88 A;  1K7A A;  1STZ A;  1O3T A;  1IXR C;  2V1X A;  4R1H A;  2HTJ A;  2K4J A;  2O03 A;  3GZ6 A;  1J7K A;  2Z3Y A;  1YS7 A;  3E6C C;  2A5Y B;  1YW8 A;  2HYF A;  3K1N A;  4G94 A;  4G8X A;  5AIP A;  2H27 A;  2EK5 A;  3TO7 A;  3TOB A;  3PQJ A;  2QEN A;  2MLG A;  2Q8K A;  3EYI A;  2IT0 A;  2O61 A;  1YG2 A;  2H6B A;  3I71 A;  4KFC A;  4BQA A;  2FQ3 A;  1I27 A;  1IN4 A;  1HQC A;  4KIC A;  4HF1 A;  3IC7 A;  5FD5 A;  5BQT A;  4ZYH A;  4EJT A;  2QUF A;  3KP4 A;  4FX4 A;  4MQV A;  3QU6 A;  1SD7 A;  1K79 A;  3FMR A;  2DW4 A;  2ZCW A;  2RV8 A;  3GFM A;  5LRR A;  1P2F A;  1S7O A;  3JAM K;  2KJC A;  3M9A A;  1BI1 A;  4MEX F;  2L01 A;  3TO6 A;  4HX8 A;  3VEP A;  3CDH A;  1MJA A;  4UVB A;  4GYI A;  3E6B A;  4LJZ F;  2XHK A;  2IJL A;  1D8J A;  4M71 A;  3BRO A;  3I58 A;  2M30 A;  4TV7 A;  1EH7 A;  1QGP A;  1XSD A;  3ZN1 A;  1OPC A;  2E1N A;  2DK8 A;  2G7U A;  2QM3 A;  3GO5 A;  2XAG A;  4OIR F;  4ENK A;  4BHC A;  3WTU C;  3QP6 A;  1IRG A;  1EH6 A;  4B09 A;  1HW5 A;  3ZMD A;  3GEZ A;  4F7Z A;  1B9M A;  4M9Z A;  3FXQ A;  1ZRD A;  4EM0 B;  2LNB A;  4U0W A;  4QWQ A;  2R7F A;  3Q9S A;  1KGS A;  3MAJ A;  1Z6R A;  3WTS C;  4ON0 A;  4XRF A;  4A0Z A;  2PFB A;  1LVA A;  3Q5F A;  2E1C A;  5LHI A;  1SD4 A;  1YLF A;  2DFI A;  2Z99 A;  4I0B A;  1R23 A;  2MH9 A;  1FBQ A;  4BYY A;  5D5W B;  1FYL A;  1SD5 A;  1FNN A;  4CIC A;  3ZMT A;  4BHP A;  5E8I A;  2IW5 A;  1S7A A;  3MFK A;  1HSJ A;  2XVC A;  2PQ8 A;  3G73 A;  1ZGA A;  4LGW A;  4KA4 A;  1CF7 A;  1BC7 C;  2ZNY A;  4ZYD A;  1IF1 A;  1B4A A;  3BWG A;  2MBF A;  1ZLJ A;  1KQ0 A;  3FMQ A;  1T39 A;  1S29 A;  4YG2 F;  2M8E A;  5L3E A;  4RB1 A;  2XAQ A;  2FOK A;  1ZAR A;  2F5F A;  1JXS A;  2HKO A;  5J8C A;  5D6E A;  3WTY C;  1AOY A;  1ZHF A;  1KU2 A;  1QPM A;  4KMU X;  3BJ6 A;  2MD5 A;  5DYM A;  1H0M A;  4ZYE A;  1ON2 A;  4Y15 A;  3SZT A;  2EV6 A;  1Z7U A;  2KJB A;  1I1S A;  3C7J A;  1R1T A;  5L3D A;  3LST A;  1XCV A;  5K5R A;  1UCR A;  2M87 A;  2OBP A;  3E5U A;  4ENM A;  1B1B A;  2O3F A;  3EQL F;  5K5Q A;  1R1U A;  1O3R A;  2XAS A;  4IJA A;  1V3F A;  4KT5 C;  1XCB A;  3F6V A;  1RUO A;  1U5T C;  4M6Y A;  3P9K A;  4Q4Z F;  1FBU A;  4L0Y B;  2VOP A;  5K1Y A;  2TDX A;  2YR2 A;  1Z05 A;  5JFR A;  1FWZ A;  1IUY A;  3F8C A;  1EV7 A;  3C3W A;  2OD5 A;  4YIF A;  3WE2 A;  1ZRC A;  2DPD A;  1S6L A;  3WTT C;  3FM5 A;  3P7N A;  3HOS A;  5DEQ A;  4JQF A;  5ILV A;  5DCF A;  5HLI A;  2GWR A;  2VT3 A;  2V1D A;  3CUQ B;  1D8K A;  2GXB A;  3DPT A;  4HX7 A;  5K5O A;  1T6S A;  4HV5 A;  1NHA A;  1OYW A;  3ZPL A;  1D5V A;  2VE8 A;  1B59 A;  4GYG A;  1R7J A;  2AS5 F;  3FX3 A;  4OIN F; 
#chains in the Genus database with same CATH topology
 4ASN A;  4F55 A;  1B8I B;  3GFL A;  2VI6 A;  3U1D A;  1I6X A;  5IYC J;  2JTV A;  2JSC A;  3CC7 I;  3KZI C;  1M1E B;  4PSX A;  1DU0 A;  2DJN A;  1RKW A;  3ECO A;  1R58 A;  3I4P A;  3G6E I;  3M7G A;  1ZRE A;  5CVJ A;  3S15 J;  4A3F J;  1IDZ A;  4XKW A;  4M74 A;  2BE5 F;  5GAE J;  5LRS A;  5IOZ A;  2W24 A;  1BM9 A;  4IF4 A;  4L9J A;  2CV2 A;  1TW3 A;  4QPQ A;  3RYP A;  1T0F C;  3HSF A;  3A4C A;  2MC3 A;  2RVC A;  4HV6 A;  3S2W A;  1H9G A;  2WB1 N;  4NC6 A;  1QVU A;  3O8H A;  1FYM A;  4M3G A;  1RI7 A;  4LG0 B;  3KYC B;  3I64 A;  2JA6 J;  2VON A;  3HSE A;  3OYK A;  1U0J A;  1OYY A;  2IGO A;  4RM3 A;  2M4G A;  3VFZ A;  3NRV A;  1FJL A;  1W4M A;  1ETK A;  1A6Q A;  2Q2E A;  2V26 A;  4JBA A;  2AQE A;  5J47 A;  3OIO A;  2KRH A;  1IN7 A;  1NG6 A;  2FU4 A;  1LNW A;  3GCM A;  4Y52 J;  1MH3 A;  1VI0 A;  2NVU B;  4P9U A;  5EGO A;  2NNN A;  1H89 C;  5K7F A;  4I7H A;  2XAH A;  1J5Y A;  5DD4 A;  1ODD A;  3IRQ A;  2XF5 A;  2H8R A;  2HVR A;  3PO2 J;  5BPD A;  2VUM J;  3MZH A;  2XKP A;  2XB5 A;  4IEJ A;  5L3G A;  3GW2 A;  4A3C J;  4UUT A;  5D4R A;  2L2O A;  4OOI A;  2Y9Z A;  1K78 B;  3OYC A;  3K0L A;  2GXA A;  2MSY A;  3G71 I;  3ZGK A;  2OAZ A;  1JUM A;  4DYC A;  5D5V B;  3ZQC A;  1S72 I;  4IHS A;  3AG4 H;  3S1R J;  1RC9 A;  1U5T B;  2CQX A;  4Y17 A;  4BE2 A;  2F5V A;  5LBQ A;  2E7X A;  3A01 A;  4CDG A;  1YJN I;  2ID6 A;  1TZL A;  2WC2 A;  5CPR B;  2A61 A;  2OV7 A;  1L0O C;  5HNH A;  4AIH A;  1BW6 A;  5E3M A;  2QF7 A;  4E6K G;  2QEX I;  2LH9 A;  1G3T A;  1FMV A;  2XDV A;  3S3M A;  4I09 A;  3B73 A;  4ANJ A;  2PMZ N;  4KIG A;  1B6A A;  1I5Z A;  2B63 J;  1R9T J;  4R79 A;  3WG9 A;  2FRH A;  2HQR A;  2FBK A;  3DPL C;  3R4K A;  4MNU A;  2IS2 A;  1TQI A;  2DOE A;  5CQG A;  1NH3 A;  5C4J J;  3K1M A;  4WXC A;  4CCK A;  1UHW A;  3E5X A;  3F0C A;  4WCG A;  2ZKZ A;  3IL2 A;  1HDD C;  3OYN A;  1YIO A;  4BU2 A;  3C2G A;  2P8T A;  1RUN A;  1FPQ A;  2KKO A;  3BTI A;  2ME0 A;  5F64 A;  5HS7 A;  2R5Z B;  2L54 A;  1D0Y A;  1R49 A;  2DTR A;  3DV8 A;  2RC4 A;  5DD8 A;  1DU6 A;  3C2B A;  3HOT A;  2X51 A;  2CJJ A;  3L2C A;  3ZP5 A;  2ELK A;  3I4N J;  1HCR A;  3ASN H;  2JSP A;  1ON1 A;  1WKM A;  5KCM A;  4RS8 A;  3MMY B;  4JP0 A;  3TBI A;  1GHC A;  3K9T A;  1MBE A;  2A5W A;  2M2E A;  3REO A;  5E1X A;  2PBI A;  2DA3 A;  3WE3 A;  3V7S A;  3GX4 X;  2VE9 A;  2B9S A;  4G6D A;  4OAZ A;  3HXL A;  1J09 A;  1TWH J;  5CVV A;  2GA2 A;  2XKO A;  3IAS 2;  1YIT I;  2KDO A;  1LE8 B;  3N4M A;  5DCM A;  2N8G A;  2QQB A;  2O6G E;  4PJL A;  1Z21 A;  3FK6 A;  1D3Y A;  1JTX A;  1XTA A;  3ZMZ A;  3G4S I;  4H0E A;  2YSR A;  1KYW A;  3WG7 H;  2DOD A;  2MLK A;  1XMA A;  3CMA I;  4DW6 A;  3E1S A;  2LBF B;  3LQQ A;  1GVJ A;  4A2U A;  3O2P E;  1V55 H;  5ICF A;  3GXO A;  3L2Q A;  4BS9 A;  3OYM A;  2A6H F;  1VQN I;  4XOP A;  3V4G A;  1QZY A;  3WGH A;  3OYH A;  3LA3 A;  3J81 K;  2DYR H;  2WWY A;  2EIK H;  5TJJ A;  1KYZ A;  2XGC A;  2QBY B;  1G3S A;  4YEJ A;  1SMY F;  3KE2 A;  2XF7 A;  3L9F A;  3AAF A;  5BS6 A;  2B0L A;  4D1Q A;  4ESJ A;  1S8N A;  3S2H J;  5JLW A;  3CME I;  2XC7 A;  4AIK A;  1XGN A;  3K4K A;  4BEH A;  4C3I J;  1WJE A;  5H2F C;  2CRG A;  2ID3 A;  5JI6 A;  3E6D A;  4EJW A;  3VSL A;  3TDZ C;  3JW4 A;  2LKP A;  1S5L C;  3IWF A;  2BW3 B;  3AG3 H;  1BOA A;  2F5C A;  3ULQ B;  1IJW C;  2X85 A;  1PP7 U;  2F4O B;  3RIR A;  3BZK A;  2E34 A;  5FKN A;  3FXU A;  3DBR B;  2XRO A;  2DBB A;  1P9Q C;  4XR6 A;  3E6M A;  5L3C A;  4AM3 A;  3FIW A;  4CCJ A;  2D2W A;  2EH3 A;  3MEX A;  3ABU A;  5J6X A;  4DYQ A;  1HF0 A;  1TQM A;  2XV4 S;  1E0E A;  2I10 A;  3HB9 A;  4B43 A;  4KIT B;  3BPX A;  5GAG J;  5EEA A;  4E7I A;  4HBL A;  1YRN A;  1SAX A;  3EET A;  2ISY A;  5GP9 A;  5B1B H;  2ZNZ A;  2M0C A;  1MDM B;  5HDG A;  2WV1 A;  2FD5 A;  2ZXW H;  3GLX A;  2FNP A;  1ZQ3 P;  4EV0 A;  4ZZD A;  1Y39 A;  3ZQL A;  2LP0 A;  4GDF A;  1WPK A;  1Q1H A;  1N25 A;  2CUZ A;  1IO2 A;  2CH0 A;  2HZT A;  2KZV A;  3P9C A;  2VJI A;  4MFD A;  5B3S H;  4IO9 F;  1U3E M;  1HKQ A;  2HOT A;  2IGK A;  3GTO J;  3MQ0 A;  3F23 A;  2NAZ A;  3GZ5 A;  3DPU A;  5CVR A;  3GTL J;  1KU3 A;  3ABT A;  1PUF B;  2W84 A;  5TIS C;  1O3S A;  1PUE E;  3JAM Z;  2HS5 A;  1R4N B;  4ENN A;  2PG4 A;  3HZJ A;  2PLY A;  2XGD A;  1X58 A;  2KRC A;  3ZN0 A;  2Y75 A;  1CF7 B;  1P4A A;  3OWT A;  1XGO A;  5EEG A;  2IRF G;  1BN5 A;  4X1E A;  4LB6 B;  3H3U A;  2BGC A;  3K2A A;  1R71 A;  3CCM I;  2ELJ A;  4OIQ F;  3ZQI A;  4HQE A;  3KP3 A;  1W7P A;  3CO6 C;  2CUE A;  4NC7 A;  3ERM A;  4BAY A;  4EM2 A;  4KIF A;  1NK2 P;  1TWA J;  2CW7 A;  3KET A;  2R7R A;  1LFP A;  3Q0V A;  2X6Y A;  4HDV A;  4A3M J;  4V19 K;  2NVT J;  2EV5 A;  4XLE A;  2W57 A;  3SEQ A;  5F1R A;  2H8W A;  4P5O A;  3WU0 A;  2W7N A;  3FM3 A;  1MBK A;  3H0G J;  5AON A;  1BR4 A;  2CQK A;  4XLP F;  1O7L A;  4NB5 A;  3GF2 A;  1B9N A;  4GO1 A;  6PAX A;  3EUH A;  5HOD A;  1RZ4 A;  3ONQ A;  1XDS A;  2LKS A;  3OIP A;  4EGZ A;  4CZC A;  2HDC A;  1UJ8 A;  4KIB A;  2FBI A;  2LVS A;  4XN3 A;  3RQ4 A;  1T33 A;  4IRI A;  2EIN H;  1POG A;  3BG5 A;  1TTY A;  1QHH D;  5HS9 A;  4XM3 A;  1IV6 A;  1TQP A;  4PK4 A;  5IP9 J;  1JKO C;  2V9V A;  1DGR M;  2VIX A;  3HKZ N;  2ZME A;  3BC8 A;  1ZH5 A;  2LK2 A;  3PFI A;  1ZR2 A;  1BIA A;  3HUG A;  4DOZ A;  2KZG A;  3LSG A;  3GTQ J;  3BTC A;  2VN2 A;  2EJR A;  5TGT A;  1OCT C;  1LKX A;  1VQ7 I;  4BDZ A;  3K4L A;  3I59 A;  4FT8 A;  2OCE A;  3OYJ A;  3GLL A;  3F8B A;  3HTU A;  3MD2 A;  3WTV C;  1JE8 A;  5JVT A;  3CCV I;  2XPV A;  3HPG A;  3PQK A;  1ZRF A;  2YPR A;  2DAO A;  2DJI A;  3ESW B;  4HLY A;  3F22 A;  5D6F A;  1ACI A;  4WF2 A;  2DTZ A;  3BZC A;  3TOA A;  3OV8 A;  2DA1 A;  4UNO A;  1SAN A;  2HXI A;  1PVE A;  2X1C A;  2VAS A;  3IP4 B;  3CUQ C;  1MND A;  3HGY A;  2H6C A;  1Y1W J;  1WHU A;  2FA5 A;  2JWT A;  1SFO J;  1QBJ A;  2QSG X;  3T8R A;  2NOJ B;  1YIJ I;  4HF2 A;  1DPU A;  2Y2Z A;  1XMK A;  1FTZ A;  3HRT A;  1X3U A;  4XKB A;  1Y0U A;  2EA4 A;  2GZW A;  3NEU A;  2R7S A;  2J5P A;  4BH9 A;  1ETO A;  4A3K J;  3O3K A;  5JHF A;  2CYY A;  5JR3 A;  2R3S A;  5HOO A;  1V5E A;  3GTK J;  2EBI A;  3HG9 A;  2K02 A;  3CC2 I;  4BJT A;  1LUJ B;  4E7Z A;  3H9J A;  4BE1 A;  4MEY F;  2HI3 A;  2IXS A;  3HDD A;  4AVP A;  3QPH A;  4XNF A;  3M07 A;  1QU3 A;  2L7F P;  3J80 K;  3LOC A;  1R00 A;  2X4H A;  1S3J A;  5JHU A;  1ETV A;  2DMN A;  3ECH A;  4FX0 A;  1A6I A;  2IA2 A;  2WV0 A;  3SHF A;  4B4C A;  5DV5 A;  4OU0 A;  4BXF A;  2DPU A;  3S14 J;  4P96 A;  5FLX K;  2O7O A;  5E3N A;  4DBR A;  2ADU A;  3HSR A;  4JOM A;  2YUS A;  5LFA A;  2L9R A;  4BXX J;  4KDP A;  3WGG A;  4A0X A;  5J3L A;  4R8H A;  4E70 A;  2VQL A;  1GV2 A;  4YII A;  2EZK A;  3P9I A;  3B6A A;  3PIP F;  3ABM H;  4LLN A;  2COB A;  2EB7 A;  4RDU A;  2XRL A;  1WH5 A;  2M8G X;  2NVQ J;  1J75 A;  3H9G A;  5M5Y J;  3CZ6 A;  5CVU A;  3CCQ I;  3MZ8 A;  3ERE D;  3S2D J;  2R7D A;  2CQ7 A;  1K6Y A;  5CQE A;  2HOE A;  3MN2 A;  1ULY A;  1Y8Q B;  3RJP A;  2DMQ A;  4UV8 A;  2EFQ A;  3CJT B;  4PGH A;  3IRR A;  2CWE A;  4BY1 J;  3DBL B;  4PFO A;  1S9H A;  3BR0 A;  2FMY A;  4B1R A;  1ZYR F;  2DK5 A;  5HDN A;  5TRD A;  2ECB A;  5DDG A;  3EYY A;  2P7C B;  4QSH A;  1NK3 P;  2QVO A;  5FB2 A;  3U1K A;  2NVX J;  5LEJ A;  3LAP A;  2OJE D;  3LFU A;  4BBS J;  1OCO H;  2Z16 A;  2ZFW A;  1F43 A;  2XAJ A;  3A03 A;  2PEX A;  5D5U B;  3BQY A;  2IPQ X;  4RLF A;  4HNV A;  4BQQ A;  2KIQ A;  1VQL I;  2GIZ A;  3FZV A;  1ZAO A;  2VPR A;  2PX9 A;  4PCQ A;  4IKF A;  5F0F A;  1Y56 A;  1XGS A;  4N9H A;  3OIQ A;  4A3G J;  3V7C A;  2EWN A;  1BOB A;  5F27 A;  2QQ9 A;  4DGW B;  3LFK A;  1MIJ A;  3K10 A;  4RLQ A;  1B72 A;  5ICC A;  3AL0 B;  3PO3 J;  3FHN A;  1IN5 A;  1T56 A;  2W00 A;  5EGO B;  2Y30 A;  3CLQ A;  4PSW A;  3KEY A;  5ERI A;  2Y0S N;  1GT0 C;  4JX4 A;  3SYT A;  2ZB9 A;  4LIV A;  2QYO A;  3O8G A;  5ILU A;  2ETH A;  5D8K B;  1J59 A;  2L4A A;  3CC4 I;  4WX9 A;  4L9V A;  1OR7 A;  1MJ9 A;  2FE3 A;  4N4O B;  2L02 A;  1TC3 C;  2DFH A;  1VZ0 A;  1BI2 A;  2M3A A;  4IXA A;  4B47 A;  4C3J J;  1WCM J;  3BOQ A;  2COM A;  3U2R A;  1T08 B;  3IAM 2;  4ENJ A;  3SQN A;  3N97 A;  1LVK A;  4A3I J;  3H5A A;  3FXJ A;  4U7B A;  2NVY J;  2L9V A;  4GCV A;  2M7B A;  2IVM A;  2V79 A;  4MIM A;  3LNQ A;  2STW A;  3QYE A;  4LD5 A;  2A68 F;  3FXM A;  4F3Q A;  3BG7 A;  4ZDL A;  2P0W A;  3COA C;  4UHT A;  1Z77 A;  3WHC A;  4XRM A;  4KIS A;  2V4J C;  3F8M A;  4NC8 A;  3UKG A;  1FT9 A;  1O3Q A;  2HEO A;  3A01 B;  2GM4 A;  2IGN A;  4A93 J;  1Z9C A;  5IOY A;  2JUC A;  4XLC A;  3FMS A;  2ZXJ A;  2VBX A;  3ZOB A;  5IP7 J;  4FCY A;  4BBR J;  1X1P A;  4D0P A;  4DZJ A;  1C0W A;  3MCZ A;  1BJA A;  3A0H C;  2VXZ A;  2P5K A;  3WGI A;  2HYG D;  2M5W A;  2PMH A;  3DP7 A;  2GA1 A;  2DMT A;  3HIF A;  3HRS A;  1OMI A;  4D7N A;  1G3W A;  2ZO4 A;  5F6F A;  2BY1 A;  2L7K A;  4CYC B;  2HDD A;  1TNT A;  2K9M A;  1YTY A;  3K4N A;  1FY7 A;  4XBF A;  1ETY A;  2DDA A;  1AKH A;  3L09 A;  2ISZ A;  2H1K A;  4KN7 X;  3NAU A;  3V8J A;  3BP8 A;  5KHD A;  1SFU A;  5EG0 A;  3D5R C;  3QPS A;  4Y3O A;  4YEL A;  4UVC A;  4PJN A;  2ACJ A;  1Z3Y A;  4DJA A;  2JQ7 A;  4YFK F;  3ROU A;  3JRE A;  2IA0 A;  3QP5 A;  1JJ8 C;  4A0Y A;  1BW5 A;  5HLH A;  5A2Q K;  2EZI A;  4G9Y A;  4E7S A;  4XON A;  3CCR I;  2V1U A;  3QU3 A;  1NG7 A;  4OMZ A;  3S8P A;  3AG1 H;  2K3F A;  4N0B A;  2LOO A;  2OU2 A;  5FJ8 J;  5DM7 F;  1OKR A;  3AKZ A;  2JRT A;  2VBW A;  2O9L A;  3KP6 A;  3LQR A;  1MZB A;  5IYB J;  3ZRG A;  4XK4 A;  3R61 A;  4HQM A;  1U2W A;  2BY0 A;  2JRM A;  2PI0 A;  3GFJ A;  2DQR A;  2K9L A;  3QAH A;  2R0Q C;  3V42 A;  1ENH A;  3U9G A;  4BHB A;  3WTW C;  2HNH A;  2CSO A;  3ISP A;  1I6H J;  3FXL A;  1RES A;  2BY3 A;  5DCM B;  1SC7 A;  5CYV A;  1U78 A;  2CU7 A;  2NOG A;  1R4M B;  1HLV A;  3T5X A;  2DFE A;  4Y7N J;  1XD7 A;  1IZ1 A;  4LOC A;  5LLQ A;  3CO7 C;  3MWM A;  2VJJ A;  3L00 A;  4E4H A;  1GLN A;  1OYI A;  4C30 A;  4P9F A;  2AO9 A;  4IOA F;  4ZYG A;  5DM6 F;  2DA5 A;  3P5J A;  4G6T B;  4Q47 A;  4A3D J;  3LSP A;  4QPO A;  3DKY A;  4ZJZ A;  4AVZ A;  1A04 A;  1X1A A;  4HOB A;  3CMY A;  1WZ2 A;  1APL C;  1IN6 A;  3SXY A;  5ICE A;  4XOR A;  2VLA A;  1DP7 P;  2L4M A;  1YI2 I;  2P6T A;  2MAB A;  3RKW A;  2W48 A;  1YOV B;  4NQW B;  1R5G A;  3CUO A;  4U7D A;  4XOT A;  2LTP A;  4XKC A;  3CF5 F;  2IS1 A;  2DOF A;  1J0R A;  2QGU A;  3HOZ J;  2OA4 A;  4Y4R A;  3IHU A;  1FTT A;  2OF7 A;  1FIA A;  2DT5 A;  4WK8 F;  1UHM A;  3TMO A;  1Z7L A;  2P81 A;  2W1O A;  4YFX F;  3ZQH A;  4BEH B;  4RBO A;  2WAQ N;  1CQT A;  3MZY A;  2RAE A;  3HM5 A;  4KN4 X;  5BOX A;  1GDT A;  1RNL A;  2XPU A;  1FOK A;  2H1L A;  2L9N A;  5J8F A;  3F21 A;  3SDG A;  2HQN A;  3M1E A;  1XSX A;  2VKE A;  1I39 A;  2ICW G;  3KLO A;  3TQN A;  3JRD A;  3GYH X;  1T2K A;  3DKW A;  1IXS B;  5D4S A;  3RDI A;  3K1P A;  1MMS A;  4G7O F;  4RMN A;  2K5C A;  3QOE A;  1R5H A;  2AHQ A;  4A3E J;  1IRF A;  3PM1 A;  2VT2 A;  2G7H A;  4L18 B;  1ZGJ A;  2FXA A;  3NWS A;  5H20 A;  3BY6 A;  4XLA A;  4XLN F;  2B7E A;  1YRN B;  2OQR A;  2V6C A;  2VBY A;  1KU9 A;  1TBX A;  3VOE A;  1TL8 A;  2OZ6 A;  4CYD A;  1N77 A;  1YS6 A;  2ZSI B;  3LSH A;  1MMA A;  3TKY A;  4I76 A;  2OPT A;  2CW0 F;  2GOM A;  3G1L A;  5IT9 K;  1JI8 A;  4ABZ A;  4KJZ A;  5E3L A;  1MW7 A;  5DUI A;  2HWV A;  1HC8 A;  1V54 H;  3V8K A;  4XQF A;  2P5V A;  1ZG1 A;  1UMQ A;  5KAF C;  3D5L A;  4JX5 A;  4LIU A;  1FOX A;  2EIJ H;  2VOD A;  2K7L A;  1KQ8 A;  5K7H A;  5GPA A;  2R92 J;  2L5Q A;  3DQV C;  5H6R A;  3UNG C;  2XSD C;  4LG0 A;  2F4M B;  2RRE A;  2Y0M A;  4RAY A;  2RNG A;  2DT6 A;  4O3M A;  5CLS A;  3DEE A;  4XSZ F;  4S0H B;  1BR1 A;  5FGM A;  3GTG J;  2V6E A;  2E1M C;  4MLO A;  1W7P D;  4Q48 A;  1D1B A;  1FIP A;  4OMY A;  1A35 A;  1JKR C;  4BL0 B;  3C2H A;  5J40 A;  4PFP A;  1DGW Y;  2Z9O A;  4M3B A;  1D1A A;  4XID A;  2XGX A;  5M5W J;  3ML6 A;  1W7P B;  4RAF A;  1EH8 A;  3NAR A;  4C2T A;  1BR2 A;  3WOD F;  4F52 A;  1LDD A;  2EV0 A;  3J81 Z;  3BDD A;  2FUG 2;  2DQL A;  2JT1 A;  2K86 A;  1EF4 A;  1BBY A;  1XG1 A;  3DXJ F;  4CCM A;  3TW7 A;  2DLL A;  2M45 A;  1WJC A;  2FBH A;  4N4N B;  3RPQ A;  2DCE A;  4C2U A;  3LA2 A;  2QWW A;  3IWZ A;  1FP2 A;  2VPL A;  4FQG A;  4FAS D;  1V4R A;  1JUS A;  4HX4 A;  4PGG A;  2WBM A;  2LY2 A;  5DTD A;  3OY9 A;  2DI3 A;  4UVA A;  5FFZ A;  5IT3 A;  2DMU A;  3DCF A;  3NQO A;  5EEH A;  1ZN2 A;  5FLV A;  1WJF A;  4EJO A;  3FXO A;  4QLC U;  3W6V A;  2NYX A;  1QZZ A;  5E17 F;  1U5T A;  2GIV A;  3SFZ A;  3S93 A;  3OS0 A;  3GTJ J;  4S04 A;  1VQ8 I;  5FFX A;  2GBY A;  4JK1 X;  1KU7 A;  2DO7 A;  4DYR A;  1BI3 A;  4CSW A;  2OTJ I;  3HOW J;  2LLK A;  4FIS A;  3OYF A;  1ERD A;  1A31 A;  4K2E A;  1OCZ H;  4F93 B;  2ESN A;  3I59 B;  3QWL A;  1Y1V J;  3JR9 A;  1R6R A;  1SAU A;  4ZTJ A;  4HRI A;  2ZJQ F;  1HW2 A;  4ETS A;  4UB6 C;  1HXD A;  1XN7 A;  4A6E A;  1JKQ C;  1HST A;  2VC1 A;  2QQA A;  2L0K A;  5GAH J;  2QKM B;  2D5V A;  3E97 A;  2OZU A;  3FKJ A;  1ONV A;  2ZC2 A;  1J2X A;  1MMN A;  1ZG5 A;  3ABL H;  3BTL A;  5D8L B;  1RKT A;  1UAA A;  4CHU A;  1FBS A;  3BJO A;  5EJC A;  2K9S A;  4M72 A;  2KFD A;  2DT7 B;  1JT0 A;  1LB2 A;  2XUB A;  1USS A;  3CTA A;  2IA1 A;  3KEO A;  2KDZ A;  2R5Z A;  4BQO A;  1JHH A;  3PFY A;  3HTS B;  2VQG A;  1VQO I;  3IKT A;  4U87 A;  4CXF A;  2RDP A;  3Q9V A;  4IHT A;  4PDK A;  1XS9 A;  1MBG A;  1O4X A;  4ZH4 F;  2JK3 A;  2QLZ A;  4Y33 A;  4CZZ A;  4BGD A;  2F6C A;  2E60 A;  1FSH A;  2HGC A;  2R7U A;  3RI4 A;  2BHZ A;  2JPB A;  5L3F A;  1XDU A;  4P55 A;  2DA6 A;  3BCA A;  1JHF A;  1OJL A;  2Y69 H;  4EGY A;  4RB3 C;  2W25 A;  2HTS A;  3I55 I;  1HBX G;  4M9X A;  3FWE A;  3BR1 A;  1F4K A;  5KNL A;  4IHW A;  3JRB A;  3RTR A;  3F72 A;  4ZDP A;  4EJU A;  3OYA A;  1Z91 A;  4WXH A;  3B02 A;  3HHH A;  2F5E A;  3OYI A;  1IRX A;  3HHG A;  3ZMV A;  2FNA A;  3OS2 A;  4E7H A;  3BR5 A;  4XN0 A;  1T0F A;  2STT A;  5E8G A;  2E36 A;  5C44 J;  3H92 A;  2LSO A;  2X6O A;  2X1D A;  1RR7 A;  1HA8 A;  1L3L A;  3ELK A;  3G1O A;  2E2H J;  4ESF A;  4NUB A;  3KIO A;  1D0Z A;  4Y13 A;  2XPW A;  2OQG A;  3V7R A;  2MFZ A;  3CCY A;  1LDK B;  3OOU A;  4U0V A;  2EFW A;  3OOP A;  2H94 A;  3KYD B;  2JVH A;  4AD9 A;  2LMD A;  2CO5 A;  3OYE A;  1YJ9 I;  3TL4 X;  1D1C A;  4I99 C;  3TED A;  2GLO A;  3PUB A;  3LSR A;  4LK1 F;  4MTE A;  4CO8 A;  3QYF A;  4EM1 A;  2JA8 J;  2KQR A;  4JX6 A;  1TLH B;  4XIC A;  2QBY A;  3AL0 C;  2E1M B;  1P6R A;  3EDP A;  2OCC H;  2BYV E;  2I8D A;  2P4W A;  3WTZ A;  2EFP A;  2P6S A;  3R0J A;  3DKX A;  2BXY A;  3F6O A;  4H4K C;  5F08 A;  1W5T A;  1DP3 A;  2E1O A;  1K6O A;  2RKH A;  4X6A J;  1MKM A;  1GUU A;  1YW7 A;  1J9I A;  2LY9 A;  2X0L A;  3V8L A;  2JUG A;  2BW3 A;  1FZP B;  1IXC A;  2R7W A;  1EKE A;  3J7A Y;  2F5D A;  3LAJ A;  2QSF X;  2E5Z A;  1X3W B;  4M3E A;  3RKQ A;  2UWM A;  3CJN A;  1GXP A;  1XX5 A;  3VSK A;  2WA0 A;  1SFE A;  3TGN A;  4BDY A;  3L7W A;  4LFU A;  1LEB A;  2WB1 A;  1F9N A;  2PJP A;  4CUG A;  4IPA A;  3ZMS A;  5LGN A;  3H5R A;  5E20 A;  2DA7 A;  2EA2 A;  3BQZ A;  1WJA A;  2EFO A;  1O57 A;  3NWT A;  2FML A;  4OAY A;  4B48 A;  2YX7 A;  1X2N A;  1MDM A;  3L2W A;  3M1C A;  2Z33 A;  1PYV A;  3CF2 A;  1DDN A;  2DA4 A;  4BJ6 C;  2A69 F;  3HBL A;  4YRV A;  5HS8 A;  4MQ9 F;  1QO0 D;  2VBZ A;  2XIG A;  2R5Y A;  4NNJ A;  5BMZ A;  4BQN A;  1MH4 A;  3IUO A;  4D9J A;  3L2V A;  3AFH A;  1TP4 A;  2KIM A;  3TW6 A;  4LIT A;  3CES A;  2O8X A;  1S7E A;  1N75 A;  5FO5 A;  3ZQF A;  1WJB A;  1U8B A;  2FF4 A;  2D1H A;  5FRM A;  4G6Q A;  5DS9 A;  4QTR A;  2IEK A;  1IG7 A;  1XMX A;  3F3X A;  1MJB A;  5LHH A;  5GPC A;  5CKT A;  3SZP A;  1GV5 A;  2C6Y A;  3W2W A;  3J80 Z;  1X1B A;  1ZR4 A;  2X6X A;  3R6S A;  4C2M J;  4HAM A;  4BXU A;  2F4I A;  1OQY A;  3K2Z A;  2LRE A;  3CLO A;  2KRF A;  5FLX Z;  4W97 A;  4L9T A;  4AID A;  2X9D A;  1FX7 A;  2KT0 A;  1U9N A;  2PMU A;  3DEU A;  1MNE A;  5D5X B;  2XAF A;  5J1U A;  4HNT A;  3Q0W A;  2AXL A;  3DEW A;  2M7A A;  3FBN B;  5BNG A;  1Y8R B;  2WTE A;  5GTH C;  5LHG A;  4EJV A;  2DA2 A;  3BG3 A;  4ESB A;  2F48 A;  3E3V A;  2JN6 A;  3GBG A;  3I53 A;  3KYL A;  1YQA A;  2MW8 A;  2JZY A;  2E7W A;  3F8F A;  5FRN A;  1BI0 A;  2PN6 A;  3PJR A;  2NS0 A;  1N78 A;  3FXR A;  4HST A;  3L1P A;  4A3B J;  2NS8 A;  3D5S C;  4M73 A;  1AWC A;  1OCP A;  4JYK A;  4C3H J;  3FHZ A;  3LL7 A;  4HF0 A;  2PMZ A;  5FKK A;  3LSM A;  3DTI A;  4EAT A;  3KZZ A;  2A3S A;  3KP2 A;  4YIR X;  3ZQQ A;  2UXX A;  5BPI A;  2NS7 A;  1D0X A;  2XRN A;  1IAW A;  2RNJ A;  3K70 C;  3FF5 A;  4BE0 A;  1MD0 A;  3FK7 A;  2CFX A;  5E1W A;  2KLO A;  3I4M J;  3QQA A;  4UY8 I;  2L7M P;  1JGS A;  4PUS A;  4DIQ A;  1IV8 A;  2BBY A;  4FTH A;  2Y31 A;  3ZMU A;  1OCC H;  2KHM A;  3GUD A;  2FJ1 A;  1WSU A;  1P7J A;  2K27 A;  2Q2E B;  1HDP A;  3DLA A;  3M8E A;  3MKL A;  3WHB A;  1QRY A;  3N05 A;  5KK1 A;  3QRF F;  3BPV A;  4HZF A;  3JRG A;  3B6C A;  3I3L A;  3BJA A;  1SMT A;  4LK0 F;  4UXN A;  2FEZ A;  4B44 A;  2M34 A;  4G7H F;  2MH2 A;  1E2X A;  1X19 A;  4XLH A;  2BOL A;  1YHQ I;  3KPH A;  3ASO H;  1JJ6 C;  1FMW A;  3T1B A;  2LYC A;  4A69 C;  4IRH A;  3T8T A;  3MKZ A;  1MMG A;  3H3Z A;  3GWZ A;  1T98 A;  2IP2 A;  1XSV A;  5KVR A;  2YU3 A;  1G3Y A;  4FE7 A;  2ESH A;  3VYU B;  3E7L A;  3ABK H;  1R22 A;  3QPT A;  5HDK A;  1P4W A;  2MA3 A;  2RQP A;  2XGE A;  4HW0 A;  2FSW A;  4UV9 A;  3IH2 A;  5CVI A;  2KIF A;  5DUK A;  5FKO A;  1RR8 C;  1RPW A;  3A1Y A;  4MO7 A;  4I02 A;  1BL0 A;  4A12 A;  4D7M A;  1W0U A;  1R36 A;  4U0Y A;  4MHG A;  3CCE I;  2K4B A;  2LF8 A;  4W1U A;  1LDJ A;  1SFX A;  1FOW A;  5L3B A;  2BY2 A;  5E3O A;  4O6J A;  2PJR A;  3RPU A;  4MGR A;  2GAU A;  3FKI J;  4HDU A;  3OYG A;  3TO9 A;  5LGU A;  1VF9 A;  1FYK A;  4XRS A;  1WRJ A;  4KYW A;  4Q5S F;  5LD2 C;  2BV6 A;  4KUM A;  1LJ9 A;  3MKW B;  2DU9 A;  5H6Q A;  4CCN A;  5M5X J;  1MBJ A;  2CUF A;  1PDN C;  1VQ4 I;  1K83 J;  2R7Q A;  1PJR A;  1YX3 A;  3GVA A;  3GFI A;  4OIP F;  3I54 A;  4LLG F;  2RGV A;  3RSN A;  4XSX F;  3H9Q A;  1TT5 B;  2A6E F;  4IOC F;  1FC3 A;  4OWR B;  1QNT A;  4A6D A;  4WXD A;  1QHG A;  1E3O C;  1Z67 A;  1LQ1 A;  4EVI A;  2LC2 A;  4B3X A;  3IKV A;  4PJ0 C;  3U21 A;  3BLY A;  1SEU A;  2CMP A;  4OIO F;  2J5O A;  4ZZL A;  3WU1 B;  4HA8 A;  4S05 A;  3F8N A;  4UB8 C;  2CG4 A;  5ED4 A;  3I5U A;  1YO5 C;  4IQ4 A;  3CCU I;  4I98 B;  2P7V B;  3G3Z A;  4GFB A;  2V9K A;  3D0S A;  1FLI A;  3MKY B;  3JRH A;  1JUP A;  3TDU C;  1KZH A;  4Z6Y A;  4I01 A;  5F0C A;  4F92 B;  4XKV A;  1U9O A;  2CV1 A;  2KIU A;  5HNF A;  3R60 A;  3K69 A;  4I0A A;  2VC0 A;  4V2G A;  1W5C C;  4XMY A;  1TW2 A;  3QOP A;  4RAZ A;  5GAD J;  4EMS A;  4AWX B;  1KON A;  5HVQ C;  1X2M A;  3H1C A;  1UG2 A;  5HLG A;  2NRA C;  2V1N A;  4CGZ A;  3L2R A;  4N9I A;  1E17 A;  5FKM A;  2UV1 A;  5A2Q Z;  4LB5 A;  4KT6 A;  3BG6 A;  2BXZ A;  4PZJ A;  1I1G A;  3O6B B;  1XGM A;  5CJ9 A;  3C18 A;  1TWC J;  1REP C;  1YYV A;  2Y9Y A;  3JSP A;  5ILS A;  1LEA A;  3HPH A;  1I3A A;  2HR3 A;  2A07 F;  1T8I A;  1G8X A;  4QIW N;  1ZGW A;  3E5Q A;  2VKD A;  1RIO H;  1WI3 A;  2G9W A;  4CCL A;  3A0B C;  2FOW A;  4LMY A;  2Y48 A;  3DTK A;  3M8F A;  3EUH C;  2Q1Z B;  3KFW X;  4O5V A;  3HL2 A;  4DNC A;  5FD6 A;  4RGX A;  4IX7 A;  1U8R A;  4AYB A;  2NXN B;  3VYR B;  2CV0 A;  3JTH A;  3JRI A;  1KA8 A;  2EPF A;  3C1D A;  4LLL A;  1ZLK A;  3BZ6 A;  1W5S A;  3RYR A;  3VOD A;  3K70 D;  4J00 A;  1MGT A;  1Z1D A;  3VPR A;  5E18 F;  2OTL I;  4KMF A;  1P92 A;  3LMM A;  3OS1 A;  2ZME C;  2Q0O A;  2X48 A;  1X4P A;  1F1Z A;  2JPC A;  2EIM H;  1FP1 D;  1I3Q J;  4L5I A;  5B1A H;  1ORK A;  1H8A C;  1X1D A;  4A5M A;  2W85 A;  1VTN C;  1SFK A;  2CGP A;  3DWL E;  2O0Y A;  4GGG A;  2ZJ2 A;  5LEK A;  2L7Z A;  4B8X A;  4UUV A;  3S1M J;  1WWX A;  1VQP I;  3IV5 A;  4G12 A;  2RN7 A;  3IH4 A;  4NHJ A;  3BR2 A;  3FDY A;  4MTD A;  1OFC X;  4XLF A;  3ZR8 X;  2ZXH A;  4BKX A;  4HLX A;  2ELH A;  1SVO A;  3BCB A;  3Q3S A;  5KAI C;  1P4X A;  1IC8 A;  2F2E A;  4AUX A;  1WI9 A;  1R1V A;  3T0Y A;  4BY7 J;  3VYT B;  5B66 C;  2I5U A;  3RKY A;  3ZQG A;  4P1W A;  4A5N A;  1VND A;  2JA2 A;  4D5F A;  4UUS A;  3LA7 A;  3OR2 C;  1K61 A;  2DN0 A;  4WWC A;  2D45 A;  3Q0U A;  4Z2Y A;  4L5J A;  3CDL A;  2VJ5 A;  5GTI C;  3WTX C;  3JSO A;  2D1V A;  2R4G A;  2E19 A;  3PSF A;  5C4X J;  3CUQ A;  1MSE C;  5IYD J;  3KEQ A;  5F04 A;  2R7O A;  2L3D A;  2VKH A;  3KZY A;  4GXO A;  4RAG A;  2HPM A;  1MMD A;  1W36 D;  4M6X A;  3UR3 C;  1SD6 A;  5M3F J;  4NBQ A;  2KL4 A;  1PP8 F;  3K6G A;  4RGR A;  5J4V A;  1T38 A;  1FSE A;  4CYC A;  4YFN F;  3HKZ A;  2LF7 A;  2EIL H;  2HOS A;  3SZG A;  4I6Z A;  4E7L A;  1B8I A;  4AIJ A;  2LRD A;  3PUF A;  1TNS A;  3W6K B;  3QOD A;  1HKS A;  1UFM A;  4E7J A;  5IT9 Z;  3EPZ A;  4HPQ A;  3VDX A;  1AHD P;  2GQQ A;  4FHT A;  4EQQ A;  3KCC A;  1WQ2 A;  2JVG A;  3KLN A;  2LY1 A;  2QZ8 A;  3HRU A;  1IUF A;  3OR1 C;  1CGP A;  3CCS I;  3KP7 A;  3W6J B;  2UXN A;  3TP0 A;  2DXI A;  4G7Z F;  3DU6 A;  4RGU A;  3OL4 A;  4ZDO A;  2Z5U A;  2LD5 A;  1YW9 A;  3OSG A;  4KNY A;  1A5J A;  1ZG3 A;  4BAC A;  4HNU A;  5J4Y A;  1XC5 A;  1YFH A;  1R5I D;  2MYS A;  2P5L C;  2QSH X;  4M6V A;  4GRI A;  1DPR A;  3OMY A;  3CMM A;  2GXG A;  1G6N A;  3BG9 A;  1BIB A;  3R0A A;  4IRG A;  5F1J A;  1MBF A;  1Z6T A;  1F5T A;  2ZBK A;  2IAI A;  2KMU A;  3ZQ7 A;  4ITV A;  2NNY A;  1G4D A;  5FKL A;  3RKX A;  3BR6 A;  1GXQ A;  2EFN A;  3S16 J;  2V7F A;  2BEO A;  3VB2 A;  3HYI A;  4M3D A;  2WAE A;  4E7K A;  2JA7 J;  2VOO A;  2HKX A;  1KQ9 A;  5FRO A;  4PJJ A;  4DQ2 A;  2ECC A;  4I2O A;  4IVN A;  2VXD A;  1UST A;  2YX4 A;  3HOY J;  3JTG A;  3A2K A;  3HOX J;  4RB2 C;  2HFH A;  1IW7 F;  3DF8 A;  3BT9 A;  2HVS A;  1MBH A;  3RZO J;  2HDW A;  3LWF A;  5AIQ A;  3S3O A;  1BC8 C;  2M9H A;  4M9S A;  4BNC A;  3KP5 A;  1D5Y A;  2WY7 Q;  1NTC A;  1QQI A;  1K78 A;  4L0Z B;  4RGS A;  3K4B A;  5E1Z B;  1A36 A;  2TRT A;  4L9N A;  3I0T A;  1JTY A;  1UG0 A;  1UB9 A;  4RB0 A;  3RQI A;  2E2J J;  3OYD A;  1O7F A;  1ZTR A;  4HYE A;  2LFB A;  1H9T A;  3DFG A;  1XB4 A;  2M1B A;  2MD0 A;  3J7A O;  1HKT A;  1XPX A;  2ZSH B;  5LGT A;  3HRM A;  4NQW A;  4X0G A;  3G2B A;  3RCO A;  3H0D A;  2LDU A;  2H09 A;  1IN8 A;  2XSJ C;  2Z2S B;  1U6G A;  2ZME B;  2UZK A;  3SJM A;  1LFU P;  1G59 A;  3F9K A;  1HW1 A;  4FE4 A;  1DUX C;  3HUG B;  4DZP A;  5ICG A;  4U88 A;  1K7A A;  3H36 A;  2DMP A;  1OR7 C;  1STZ A;  4IHX A;  2ZFU A;  3H5N A;  1O3T A;  4EEF G;  1IXR C;  2V1X A;  4R1H A;  2HTJ A;  2K4J A;  2O03 A;  5HLT A;  1ETW A;  2IGM A;  1BA5 A;  5IY5 H;  3GZ6 A;  2A05 A;  3SFI A;  1J7K A;  3PNT A;  2Z3Y A;  3K7A J;  1EA3 A;  1YS7 A;  3E6C C;  2A5Y B;  1YW8 A;  2HYF A;  3K1N A;  4G94 A;  4G8X A;  1ZKG A;  3JRC A;  2R7T A;  1Z0X A;  5AIP A;  2H27 A;  2EK5 A;  4AU7 A;  2LKX A;  2E2I J;  3TO7 A;  1X3Z B;  3TOB A;  3PQJ A;  4CH7 A;  2QEN A;  2E5N A;  3AG2 H;  1WFX A;  3OYL A;  3CP2 A;  2MLG A;  2Q8K A;  3EYI A;  2IT0 A;  2O61 A;  1YG2 A;  2H6B A;  3I71 A;  4KFC A;  4BQA A;  2FQ3 A;  2R93 J;  1I27 A;  1IN4 A;  1HQC A;  4KIC A;  4ZC3 A;  5IP6 A;  1X4O A;  2HYJ A;  4A3J J;  4HF1 A;  3IC7 A;  5FD5 A;  2K40 A;  5BQT A;  4AC0 A;  4ZYH A;  2M4K A;  2R5Y B;  2QUF A;  4EJT A;  3KP4 A;  2KPM A;  4AYB N;  4FX4 A;  4MQV A;  2GOX B;  3QU6 A;  3GZN B;  2ZJR F;  1SD7 A;  3FIS A;  1VQM I;  4B3A A;  1K79 A;  3FMR A;  1Q1V A;  2DW4 A;  2ZCW A;  2CUJ A;  2QQ8 A;  2HVQ A;  2OC6 A;  1TWG J;  2RV8 A;  3GFM A;  9ANT A;  4V2F A;  3KX2 A;  1P2F A;  5LRR A;  1S7O A;  2KP6 A;  4RA2 A;  2Y0S A;  1V5F A;  3JAM K;  2KJC A;  1QA6 A;  5JLX A;  1RET A;  2ME6 A;  3M9A A;  1BI1 A;  1LE8 A;  4MEX F;  3QYB A;  2BZT A;  2L01 A;  1I50 J;  4BUP A;  1W1W E;  3GTM J;  3TO6 A;  4HX8 A;  3VEP A;  4L5E A;  3CDH A;  1MJA A;  3CD6 I;  4UVB A;  4GYI A;  3SEZ A;  3E6B A;  2UUZ A;  1E3H A;  2XF6 A;  3M8J A;  4LJZ F;  5FLM J;  5J1R A;  5E79 C;  3J7Y J;  2XHK A;  1WJ5 A;  2LBF A;  2IJL A;  1D8J A;  4M71 A;  3BRO A;  3PNY A;  3G1M A;  3I58 A;  2M30 A;  2AXT C;  4TV7 A;  1E3P A;  1EH7 A;  2LG4 A;  1LFB A;  1QGP A;  1XSD A;  3FXK A;  5EZH A;  3ZN1 A;  1OPC A;  1MNM C;  5EDN A;  2E1N A;  2DK8 A;  2G7U A;  2QM3 A;  3FBI B;  3LSI A;  1TWF J;  2A6T A;  3GO5 A;  3K4C A;  2XAG A;  4OIR F;  2CW8 A;  4ENK A;  4BHC A;  2MGQ A;  3WTU C;  2ZXI A;  2K9N A;  3QP6 A;  1IRG A;  1EH6 A;  3OL3 A;  4B09 A;  1HW5 A;  1Z3X A;  1OIS A;  2WY8 Q;  3ZMD A;  2MC4 A;  3GEZ A;  4F7Z A;  1B9M A;  3J7Z I;  4M9Z A;  3FXQ A;  1ZRD A;  1X1C A;  4EM0 B;  3RZD J;  1K4S A;  3K4M A;  2LNB A;  4U0W A;  2KIS A;  4IZZ A;  1VQ9 I;  4QWQ A;  3JRA A;  2R7F A;  1SVL A;  2FX0 A;  3Q9S A;  1WJD A;  1KGS A;  3MAJ A;  5EZG A;  1TT0 A;  2E71 A;  2VQC A;  2HXO A;  4PJM A;  1JT6 A;  1Z6R A;  3WTS C;  1VQK I;  2LR8 A;  2HQA A;  4XRF A;  4ON0 A;  4XRS G;  4A0Z A;  1GVD A;  3S1N J;  2DYS H;  2PFB A;  4HEA 2;  3CQZ J;  1LVA A;  3Q5F A;  2E1C A;  3WU2 C;  2E35 A;  1WVR A;  3E0J B;  4FET A;  1SD4 A;  5LHI A;  1YJW I;  1YLF A;  2JMW A;  2DFI A;  4J19 A;  2Z99 A;  1B72 B;  4I0B A;  1QPI A;  3IH3 A;  3DBH B;  1R23 A;  2MH9 A;  1FBQ A;  1Y0N A;  2VB6 A;  3HEF A;  4BYY A;  5D5W B;  4C9Y A;  1FYL A;  2K9Q A;  5EF6 A;  1JKP C;  2M0M A;  1SD5 A;  5K7Z A;  3HOV J;  2JA5 J;  1YX5 A;  4D5C A;  3HC7 A;  3RPU D;  5IPA A;  1ETQ A;  2WAD A;  3VWB A;  1MSF C;  1BJZ A;  1FNN A;  5EYR A;  4BJ5 C;  4CIC A;  1PUF A;  5F0H A;  3ZMT A;  4BHP A;  1WH7 A;  1P7I A;  2IW5 A;  5E8I A;  4CCO A;  1S7A A;  2FQ4 A;  3MFK A;  2PJR B;  1HSJ A;  2XVC A;  2EZH A;  3LSK A;  2PQ8 A;  3G73 A;  2EZL A;  2IS4 A;  1ZGA A;  4LGW A;  1ETX A;  3TP3 A;  4KA4 A;  2XAU A;  1CF7 A;  3W2A A;  1BC7 C;  2ZNY A;  1ZEL A;  4ZYD A;  1IF1 A;  3PSI A;  2OUM A;  1B4A A;  3BWG A;  3DTE A;  2DDB A;  2G0E A;  3EUK L;  2MBF A;  1ZLJ A;  1QVT A;  1KQ0 A;  3FMQ A;  1IGN A;  5M3M J;  1T39 A;  1S29 A;  2K85 A;  2M8E A;  2VQH A;  4YG2 F;  1QZE A;  1H88 C;  2JJ7 A;  2Z1D A;  5L3E A;  4RB1 A;  2BHY A;  2XAQ A;  3ZXS A;  2FOK A;  1AKH B;  2DOA A;  1ZAR A;  3HJE A;  2F5F A;  1JXS A;  3A02 A;  2HKO A;  2WAQ A;  4II3 A;  5D6E A;  5J8C A;  5EG0 B;  1ZHF A;  3WTY C;  5JVG F;  1AOY A;  1KU2 A;  1QPM A;  4ZYA A;  4KMU X;  3S1Q J;  3LSJ A;  3H35 A;  3BJ6 A;  2CFO A;  2MD5 A;  3BTJ A;  5DYM A;  2VL8 A;  2R7Z J;  1H0M A;  4ZYE A;  1ON2 A;  1FEX A;  1AA7 A;  1AU7 A;  2VKV A;  4XL9 A;  4Y15 A;  3SZT A;  2EV6 A;  1Z7U A;  2KJB A;  3M4O J;  4HG2 A;  4IQJ A;  2R7X A;  1I1S A;  3C7J A;  5C3E J;  1R1T A;  5L3D A;  1WGX A;  3OYB A;  2TCT A;  4F91 B;  3CCL I;  2HZD A;  3ZCO A;  3LST A;  1T95 A;  2CS3 A;  1UEL B;  1IRZ A;  4CA0 A;  1XCV A;  5K5R A;  1UCR A;  2M87 A;  1G2H A;  4IHY A;  2OBP A;  2HPI A;  3PNV A;  3E5U A;  1LPQ A;  3M3Y J;  1YE9 A;  4MFE A;  4ENM A;  1B1B A;  3PL8 A;  1VFC A;  2R7V A;  1UHS A;  2O3F A;  3EQL F;  5K5Q A;  2MG4 A;  1R1U A;  1O3R A;  3GTP J;  4LG3 A;  2ZJP F;  2IS6 A;  2XAS A;  4IJA A;  1SVM A;  3CJR B;  3BR3 A;  1W0T A;  1V3F A;  4A3L J;  2CQQ A;  3W3C A;  2K3P A;  4KT5 C;  1XCB A;  1DQU A;  3F6V A;  1RUO A;  1U5T C;  4ZTF A;  3L2U A;  2X6W A;  1VQ6 I;  2O5R A;  3JCU C;  3CDI A;  2O8K A;  2V9P A;  4M6Y A;  3P9K A;  4DBQ A;  4Q4Z F;  1FBU A;  2HOA A;  3W2V A;  2HQ5 A;  4L0Y B;  4II2 A;  2BVM A;  2VOP A;  5B5E C;  1Y6I A;  2DFF A;  5K1Y A;  2TDX A;  2QA4 I;  2RQQ A;  3CP8 A;  2YR2 A;  3PIO F;  4IHV A;  1HOM A;  2QCO A;  3CCJ I;  2L9S A;  1RRJ A;  1Z05 A;  5JFR A;  1FWZ A;  3S32 A;  1IUY A;  4J01 A;  4IL6 C;  1IDY A;  2IBD A;  3K4J A;  3S17 J;  1K4T A;  1JGG A;  3F8C A;  1VQ5 I;  1W36 C;  4NDL A;  4M3F A;  2AQF A;  1EV7 A;  3C3W A;  2VJ4 A;  2OD5 A;  2W4S A;  2W82 A;  2YU9 J;  4YIF A;  2YS9 A;  2CQN A;  3WE2 A;  3X2Q H;  1ZRC A;  2DPD A;  1S6L A;  3DLL F;  3WTT C;  2HU9 A;  3FM5 A;  3P7N A;  3HOS A;  3H3V K;  5DEQ A;  4RM2 A;  2X1E A;  1FOY A;  4JQF A;  5ILV A;  1ITY A;  5DCF A;  5HLI A;  5J1Y A;  1OCR H;  1OLT A;  1ZK8 A;  2GWR A;  2QKL B;  2XB0 X;  4UUS B;  2WAF A;  1UZC A;  3VYS B;  2VT3 A;  3QPL A;  2V1D A;  1EJ9 A;  3CUQ B;  2BVL A;  3EUA A;  1D8K A;  3I9V 2;  2EQR A;  2GXB A;  3I56 I;  3DPT A;  4HX7 A;  3OSF A;  5K5O A;  1T6S A;  3JRF A;  3S3N A;  3D1N I;  4HV5 A;  1NHA A;  3HOU J;  1OYW A;  3ZPL A;  1D5V A;  2VE8 A;  1B59 A;  1F36 A;  3CJQ B;  3MVP A;  1V5G A;  3SDB A;  4GYG A;  3DU5 A;  4HSR A;  3HGG A;  1R7J A;  2AS5 F;  3FX3 A;  3GME A;  4OIN F; 
#chains in the Genus database with same CATH homology
 4ASN A;  3GFL A;  3U1D A;  1I6X A;  2JTV A;  2JSC A;  3ECO A;  1R58 A;  3I4P A;  1ZRE A;  3M7G A;  5CVJ A;  4M74 A;  2BE5 F;  5LRS A;  2W24 A;  1BM9 A;  4IF4 A;  4L9J A;  1TW3 A;  3RYP A;  3HSF A;  2MC3 A;  2RVC A;  4HV6 A;  3S2W A;  1H9G A;  1FYM A;  4LG0 B;  1RI7 A;  3I64 A;  2VON A;  3HSE A;  1OYY A;  3VFZ A;  3NRV A;  1W4M A;  2Q2E A;  4JBA A;  1IN7 A;  2FU4 A;  1LNW A;  4P9U A;  2NNN A;  4I7H A;  2XAH A;  1J5Y A;  5DD4 A;  1ODD A;  3IRQ A;  5BPD A;  3MZH A;  2XKP A;  5L3G A;  3GW2 A;  5D4R A;  4OOI A;  1K78 B;  3K0L A;  2OAZ A;  5D5V B;  4IHS A;  1U5T B;  4Y17 A;  5LBQ A;  2E7X A;  4CDG A;  2WC2 A;  2A61 A;  1L0O C;  4AIH A;  1G3T A;  4I09 A;  3B73 A;  4KIG A;  1B6A A;  1I5Z A;  4R79 A;  3WG9 A;  2FRH A;  2HQR A;  2FBK A;  3DPL C;  3R4K A;  4MNU A;  1TQI A;  3K1M A;  4WXC A;  1UHW A;  3E5X A;  4WCG A;  2ZKZ A;  3IL2 A;  1YIO A;  2P8T A;  1RUN A;  1FPQ A;  2KKO A;  5F64 A;  5HS7 A;  2L54 A;  2DTR A;  3DV8 A;  2RC4 A;  5DD8 A;  3HOT A;  3L2C A;  3ZP5 A;  1ON1 A;  1WKM A;  4RS8 A;  1GHC A;  3K9T A;  3REO A;  5E1X A;  2PBI A;  3WE3 A;  3GX4 X;  3V7S A;  2VE9 A;  4G6D A;  5CVV A;  2GA2 A;  2XKO A;  3N4M A;  5DCM A;  2QQB A;  2O6G E;  1D3Y A;  3ZMZ A;  4H0E A;  2YSR A;  1KYW A;  2MLK A;  1XMA A;  3LQQ A;  1GVJ A;  4A2U A;  3O2P E;  5ICF A;  3GXO A;  2A6H F;  3V4G A;  1QZY A;  3WGH A;  3LA3 A;  3J81 K;  2WWY A;  5TJJ A;  1KYZ A;  2QBY B;  1G3S A;  1SMY F;  3KE2 A;  3L9F A;  3AAF A;  5BS6 A;  2B0L A;  4ESJ A;  1S8N A;  4AIK A;  1XGN A;  5JI6 A;  3E6D A;  4EJW A;  3TDZ C;  3JW4 A;  2LKP A;  3IWF A;  1BOA A;  2F5C A;  3ULQ B;  1PP7 U;  3RIR A;  3FXU A;  2XRO A;  2DBB A;  5L3C A;  3E6M A;  2D2W A;  3MEX A;  3ABU A;  5J6X A;  1TQM A;  2XV4 S;  3BPX A;  4HBL A;  1SAX A;  3EET A;  2ISY A;  2ZNZ A;  1MDM B;  5HDG A;  3GLX A;  2FNP A;  4EV0 A;  4ZZD A;  1Q1H A;  2HZT A;  3P9C A;  1U3E M;  1HKQ A;  3MQ0 A;  3F23 A;  2NAZ A;  3GZ5 A;  5CVR A;  1KU3 A;  3ABT A;  2W84 A;  1O3S A;  1PUE E;  3JAM Z;  2HS5 A;  4ENN A;  2PG4 A;  2PLY A;  3ZN0 A;  2Y75 A;  1CF7 B;  1P4A A;  1XGO A;  5EEG A;  2IRF G;  1BN5 A;  4LB6 B;  3H3U A;  2BGC A;  4OIQ F;  4HQE A;  3KP3 A;  1W7P A;  3CO6 C;  4BAY A;  4EM2 A;  4KIF A;  3KET A;  4HDV A;  2EV5 A;  5F1R A;  2W57 A;  4P5O A;  3WU0 A;  3FM3 A;  5AON A;  2CQK A;  4XLP F;  1O7L A;  4NB5 A;  3GF2 A;  1B9N A;  4GO1 A;  6PAX A;  3EUH A;  1RZ4 A;  1XDS A;  4EGZ A;  2HDC A;  4KIB A;  2FBI A;  4IRI A;  1TTY A;  5HS9 A;  1TQP A;  2V9V A;  2ZME A;  1ZH5 A;  3PFI A;  1BIA A;  3HUG A;  2VN2 A;  2EJR A;  3I59 A;  4FT8 A;  3F8B A;  3HTU A;  3WTV C;  1JE8 A;  5JVT A;  3PQK A;  1ZRF A;  2YPR A;  2DAO A;  4HLY A;  3F22 A;  5D6F A;  4WF2 A;  3TOA A;  3OV8 A;  4UNO A;  3CUQ C;  2H6C A;  2FA5 A;  1QBJ A;  3T8R A;  4HF2 A;  1DPU A;  1XMK A;  3HRT A;  1X3U A;  1Y0U A;  2EA4 A;  2GZW A;  3NEU A;  2J5P A;  4BH9 A;  3O3K A;  2CYY A;  5JR3 A;  2R3S A;  5HOO A;  2K02 A;  4MEY F;  4AVP A;  3QPH A;  3J80 K;  1R00 A;  2X4H A;  1S3J A;  5JHU A;  3ECH A;  4FX0 A;  2IA2 A;  2WV0 A;  3SHF A;  5DV5 A;  4OU0 A;  2DPU A;  4P96 A;  5FLX K;  2ADU A;  3HSR A;  4KDP A;  3WGG A;  4A0X A;  4R8H A;  4E70 A;  4YII A;  3P9I A;  4LLN A;  2EB7 A;  1J75 A;  5CVU A;  3ERE D;  2R7D A;  2HOE A;  1ULY A;  3RJP A;  4UV8 A;  2EFQ A;  4PGH A;  3IRR A;  2CWE A;  2FMY A;  1ZYR F;  2DK5 A;  5HDN A;  5TRD A;  5DDG A;  3EYY A;  2P7C B;  2QVO A;  5FB2 A;  5LEJ A;  3LAP A;  2ZFW A;  2XAJ A;  2PEX A;  5D5U B;  2IPQ X;  3FZV A;  1ZAO A;  4PCQ A;  1XGS A;  4N9H A;  3V7C A;  2EWN A;  2QQ9 A;  3LFK A;  5ICC A;  1IN5 A;  5ERI A;  5ILU A;  2QYO A;  2ETH A;  5D8K B;  1J59 A;  2L4A A;  4WX9 A;  4L9V A;  1OR7 A;  1MJ9 A;  2FE3 A;  2L02 A;  4IXA A;  1BI2 A;  3BOQ A;  2COM A;  3U2R A;  4ENJ A;  3N97 A;  3SQN A;  4U7B A;  4GCV A;  2IVM A;  2V79 A;  2STW A;  4LD5 A;  2A68 F;  3COA C;  4UHT A;  3F8M A;  1FT9 A;  1O3Q A;  2HEO A;  1Z9C A;  3FMS A;  2ZXJ A;  2VBX A;  4D0P A;  1C0W A;  3MCZ A;  1BJA A;  2VXZ A;  2P5K A;  3WGI A;  2HYG D;  2M5W A;  2PMH A;  3DP7 A;  2GA1 A;  3HIF A;  3HRS A;  1OMI A;  1G3W A;  2ZO4 A;  5F6F A;  1TNT A;  1YTY A;  1FY7 A;  4XBF A;  3L09 A;  2ISZ A;  4KN7 X;  3V8J A;  3BP8 A;  1SFU A;  4UVC A;  2ACJ A;  4YFK F;  3ROU A;  2IA0 A;  3QP5 A;  4A0Y A;  5HLH A;  5A2Q K;  4G9Y A;  2V1U A;  3QU3 A;  4OMZ A;  4N0B A;  2OU2 A;  1OKR A;  2JRT A;  2VBW A;  3KP6 A;  3LQR A;  1MZB A;  3R61 A;  4HQM A;  1U2W A;  2PI0 A;  3GFJ A;  2DQR A;  3QAH A;  3U9G A;  4BHB A;  3WTW C;  2CSO A;  3ISP A;  5DCM B;  1U78 A;  5CYV A;  3T5X A;  1XD7 A;  1IZ1 A;  5LLQ A;  3CO7 C;  3MWM A;  3L00 A;  1OYI A;  4P9F A;  4ZYG A;  4Q47 A;  1A04 A;  4HOB A;  1IN6 A;  3SXY A;  5ICE A;  1DP7 P;  2L4M A;  2P6T A;  3RKW A;  1R5G A;  3CUO A;  4U7D A;  1J0R A;  2OA4 A;  3IHU A;  2DT5 A;  4WK8 F;  1UHM A;  4YFX F;  3MZY A;  4KN4 X;  5BOX A;  1RNL A;  1FOK A;  5J8F A;  3F21 A;  2HQN A;  3M1E A;  1XSX A;  3KLO A;  3TQN A;  3GYH X;  1T2K A;  3DKW A;  1IXS B;  5D4S A;  3RDI A;  3K1P A;  4G7O F;  1R5H A;  1IRF A;  2VT2 A;  2G7H A;  4L18 B;  1ZGJ A;  2FXA A;  5H20 A;  3BY6 A;  4XLN F;  2OQR A;  2V6C A;  2VBY A;  1KU9 A;  1TBX A;  3VOE A;  2OZ6 A;  4CYD A;  1YS6 A;  3TKY A;  2CW0 F;  5IT9 K;  5DUI A;  2HWV A;  3V8K A;  2P5V A;  1ZG1 A;  3D5L A;  2VOD A;  2K7L A;  1KQ8 A;  3DQV C;  5H6R A;  4LG0 A;  2Y0M A;  4RAY A;  4O3M A;  5CLS A;  4XSZ F;  5FGM A;  4Q48 A;  1W7P D;  4OMY A;  2Z9O A;  2XGX A;  3ML6 A;  1W7P B;  1EH8 A;  3WOD F;  1LDD A;  2EV0 A;  3J81 Z;  3BDD A;  2DQL A;  2JT1 A;  2K86 A;  1BBY A;  3DXJ F;  2DLL A;  2M45 A;  2FBH A;  3RPQ A;  3LA2 A;  2QWW A;  3IWZ A;  1FP2 A;  1V4R A;  4PGG A;  4HX4 A;  2DI3 A;  4UVA A;  5FFZ A;  5IT3 A;  5EEH A;  3NQO A;  1ZN2 A;  4EJO A;  4QLC U;  2NYX A;  1QZZ A;  5E17 F;  1U5T A;  2GIV A;  3SFZ A;  4S04 A;  5FFX A;  4JK1 X;  1KU7 A;  2DO7 A;  1BI3 A;  4K2E A;  2ESN A;  3I59 B;  1HW2 A;  4ETS A;  1HXD A;  1XN7 A;  4A6E A;  1HST A;  2VC1 A;  2QQA A;  3E97 A;  2OZU A;  1ONV A;  1J2X A;  1ZG5 A;  5D8L B;  4CHU A;  1FBS A;  3BJO A;  4M72 A;  1LB2 A;  2XUB A;  1USS A;  3CTA A;  2IA1 A;  3KEO A;  1JHH A;  3HTS B;  3IKT A;  4CXF A;  2RDP A;  3Q9V A;  4IHT A;  4PDK A;  4ZH4 F;  2QLZ A;  4CZZ A;  1FSH A;  2HGC A;  3RI4 A;  2JPB A;  5L3F A;  1XDU A;  4P55 A;  1JHF A;  4EGY A;  4RB3 C;  2W25 A;  2HTS A;  1HBX G;  4M9X A;  3FWE A;  1F4K A;  3RTR A;  3F72 A;  4EJU A;  1Z91 A;  4WXH A;  3B02 A;  3HHH A;  2F5E A;  3HHG A;  3ZMV A;  2FNA A;  1T0F A;  2STT A;  5E8G A;  3H92 A;  2LSO A;  1L3L A;  3ELK A;  4ESF A;  4Y13 A;  2OQG A;  3V7R A;  1LDK B;  4U0V A;  2EFW A;  3OOP A;  2H94 A;  1J9I A;  4AD9 A;  2CO5 A;  4LK1 F;  4MTE A;  4CO8 A;  4EM1 A;  1TLH B;  2QBY A;  1P6R A;  3EDP A;  2BYV E;  2P4W A;  3WTZ A;  2EFP A;  2P6S A;  3R0J A;  3F6O A;  1W5T A;  1K6O A;  2RKH A;  1MKM A;  1YW7 A;  2X0L A;  3V8L A;  1FZP B;  1IXC A;  2F5D A;  3LAJ A;  2UWM A;  3CJN A;  1GXP A;  1SFE A;  3TGN A;  3L7W A;  4LFU A;  1LEB A;  1F9N A;  2PJP A;  4IPA A;  3ZMS A;  5LGN A;  5E20 A;  2EA2 A;  2EFO A;  1O57 A;  2FML A;  2YX7 A;  1MDM A;  2Z33 A;  1DDN A;  2A69 F;  5HS8 A;  4MQ9 F;  1QO0 D;  2VBZ A;  2XIG A;  5BMZ A;  2KIM A;  2O8X A;  5FO5 A;  2FF4 A;  2D1H A;  4G6Q A;  3F3X A;  1MJB A;  5LHH A;  3SZP A;  2C6Y A;  3J80 Z;  3R6S A;  4HAM A;  4BXU A;  3K2Z A;  3CLO A;  2KRF A;  5FLX Z;  4L9T A;  1FX7 A;  2PMU A;  3DEU A;  5D5X B;  2XAF A;  2AXL A;  2WTE A;  5LHG A;  4EJV A;  4ESB A;  3E3V A;  3I53 A;  1YQA A;  2JZY A;  2E7W A;  3F8F A;  1BI0 A;  2PN6 A;  2NS0 A;  3FXR A;  4M73 A;  1AWC A;  3FHZ A;  4HF0 A;  3KZZ A;  2A3S A;  3KP2 A;  2UXX A;  5BPI A;  2XRN A;  1IAW A;  2RNJ A;  3FF5 A;  1MD0 A;  5E1W A;  2CFX A;  1JGS A;  2BBY A;  3ZMU A;  3GUD A;  1WSU A;  2K27 A;  3M8E A;  5KK1 A;  3QRF F;  3BPV A;  4HZF A;  3BJA A;  1SMT A;  4LK0 F;  4UXN A;  2FEZ A;  4G7H F;  2MH2 A;  1E2X A;  3T1B A;  4IRH A;  3T8T A;  3H3Z A;  3GWZ A;  1T98 A;  2IP2 A;  1XSV A;  5KVR A;  2YU3 A;  1G3Y A;  2ESH A;  1R22 A;  3QPT A;  5HDK A;  1P4W A;  2MA3 A;  2RQP A;  4HW0 A;  4UV9 A;  2FSW A;  5CVI A;  5DUK A;  2KIF A;  4I02 A;  4A12 A;  1R36 A;  4U0Y A;  4MHG A;  2K4B A;  2LF8 A;  1LDJ A;  1SFX A;  5L3B A;  4O6J A;  3RPU A;  4MGR A;  4HDU A;  2GAU A;  3TO9 A;  5LGU A;  1FYK A;  4KYW A;  1WRJ A;  4Q5S F;  2BV6 A;  4KUM A;  1LJ9 A;  2DU9 A;  5H6Q A;  1PDN C;  3GVA A;  3GFI A;  4OIP F;  3I54 A;  4LLG F;  2RGV A;  4XSX F;  2A6E F;  1FC3 A;  1QNT A;  4A6D A;  4WXD A;  1LQ1 A;  4EVI A;  3IKV A;  4OIO F;  2J5O A;  4ZZL A;  3WU1 B;  4HA8 A;  4S05 A;  3F8N A;  2CG4 A;  5ED4 A;  3I5U A;  1YO5 C;  4I98 B;  2P7V B;  3G3Z A;  3D0S A;  1FLI A;  3TDU C;  4I01 A;  2KIU A;  3R60 A;  3K69 A;  4I0A A;  2VC0 A;  1TW2 A;  3QOP A;  4RAZ A;  4EMS A;  5HVQ C;  4AWX B;  2NRA C;  5HLG A;  4CGZ A;  4N9I A;  1E17 A;  5A2Q Z;  4LB5 A;  4PZJ A;  1I1G A;  3O6B B;  1XGM A;  5CJ9 A;  3C18 A;  1REP C;  1YYV A;  3JSP A;  5ILS A;  1LEA A;  2HR3 A;  2A07 F;  3E5Q A;  1RIO H;  2G9W A;  4LMY A;  2Y48 A;  3M8F A;  3KFW X;  4O5V A;  4DNC A;  5FD6 A;  4RGX A;  1U8R A;  3JTH A;  1KA8 A;  3C1D A;  4LLL A;  1ZLK A;  3BZ6 A;  3RYR A;  1W5S A;  3VOD A;  1MGT A;  1Z1D A;  5E18 F;  4KMF A;  1P92 A;  2Q0O A;  1F1Z A;  2JPC A;  1FP1 D;  4L5I A;  4A5M A;  1VTN C;  2W85 A;  2CGP A;  4GGG A;  2O0Y A;  2ZJ2 A;  5LEK A;  4B8X A;  4UUV A;  1WWX A;  2RN7 A;  4NHJ A;  4MTD A;  4HLX A;  2ELH A;  1P4X A;  2F2E A;  1WI9 A;  1R1V A;  3T0Y A;  3RKY A;  4A5N A;  3LA7 A;  4WWC A;  2D45 A;  4Z2Y A;  4L5J A;  3WTX C;  3JSO A;  2D1V A;  3CUQ A;  3KEQ A;  2L3D A;  3KZY A;  4GXO A;  4M6X A;  1SD6 A;  1PP8 F;  4RGR A;  1T38 A;  1FSE A;  4YFN F;  2LF7 A;  4AIJ A;  3W6K B;  1TNS A;  1HKS A;  1UFM A;  5IT9 Z;  2GQQ A;  4FHT A;  4EQQ A;  3KCC A;  1WQ2 A;  3KLN A;  2QZ8 A;  3HRU A;  1CGP A;  3KP7 A;  3W6J B;  2UXN A;  4G7Z F;  4RGU A;  2Z5U A;  1YW9 A;  4KNY A;  1ZG3 A;  1YFH A;  2P5L C;  1DPR A;  2GXG A;  1G6N A;  1BIB A;  3R0A A;  4IRG A;  1Z6T A;  1F5T A;  2ZBK A;  3ZQ7 A;  2NNY A;  1G4D A;  3RKX A;  1GXQ A;  2EFN A;  2BEO A;  3VB2 A;  3HYI A;  2VOO A;  2HKX A;  1KQ9 A;  4DQ2 A;  4I2O A;  4IVN A;  1UST A;  2YX4 A;  3JTG A;  4RB2 C;  2HFH A;  1IW7 F;  3DF8 A;  3LWF A;  5AIQ A;  1BC8 C;  4M9S A;  4BNC A;  3KP5 A;  1QQI A;  1K78 A;  4L0Z B;  4RGS A;  5E1Z B;  4L9N A;  3I0T A;  4RB0 A;  1UB9 A;  1O7F A;  4HYE A;  1H9T A;  3DFG A;  1XB4 A;  2M1B A;  3J7A O;  1HKT A;  5LGT A;  3HRM A;  4NQW A;  2LDU A;  2H09 A;  1IN8 A;  1U6G A;  2ZME B;  2UZK A;  1HW1 A;  1DUX C;  5ICG A;  4U88 A;  1K7A A;  1STZ A;  1O3T A;  1IXR C;  2V1X A;  4R1H A;  2HTJ A;  2K4J A;  2O03 A;  3GZ6 A;  1J7K A;  2Z3Y A;  1YS7 A;  3E6C C;  2A5Y B;  1YW8 A;  2HYF A;  3K1N A;  4G94 A;  4G8X A;  5AIP A;  2H27 A;  2EK5 A;  3TO7 A;  3TOB A;  3PQJ A;  2QEN A;  2MLG A;  2Q8K A;  3EYI A;  2IT0 A;  2O61 A;  1YG2 A;  2H6B A;  3I71 A;  4KFC A;  4BQA A;  2FQ3 A;  1I27 A;  1IN4 A;  1HQC A;  4KIC A;  4HF1 A;  3IC7 A;  5FD5 A;  5BQT A;  4ZYH A;  4EJT A;  2QUF A;  3KP4 A;  4FX4 A;  4MQV A;  3QU6 A;  1SD7 A;  1K79 A;  3FMR A;  2DW4 A;  2ZCW A;  2RV8 A;  3GFM A;  5LRR A;  1P2F A;  1S7O A;  3JAM K;  2KJC A;  3M9A A;  1BI1 A;  4MEX F;  2L01 A;  3TO6 A;  4HX8 A;  3VEP A;  3CDH A;  1MJA A;  4UVB A;  4GYI A;  3E6B A;  4LJZ F;  2XHK A;  2IJL A;  1D8J A;  4M71 A;  3BRO A;  3I58 A;  2M30 A;  4TV7 A;  1EH7 A;  1QGP A;  1XSD A;  3ZN1 A;  1OPC A;  2E1N A;  2DK8 A;  2G7U A;  2QM3 A;  3GO5 A;  2XAG A;  4OIR F;  4ENK A;  4BHC A;  3WTU C;  3QP6 A;  1IRG A;  1EH6 A;  4B09 A;  1HW5 A;  3ZMD A;  3GEZ A;  4F7Z A;  1B9M A;  4M9Z A;  3FXQ A;  1ZRD A;  4EM0 B;  2LNB A;  4U0W A;  4QWQ A;  2R7F A;  3Q9S A;  1KGS A;  3MAJ A;  1Z6R A;  3WTS C;  4ON0 A;  4XRF A;  4A0Z A;  2PFB A;  1LVA A;  3Q5F A;  2E1C A;  5LHI A;  1SD4 A;  1YLF A;  2DFI A;  2Z99 A;  4I0B A;  1R23 A;  2MH9 A;  1FBQ A;  4BYY A;  5D5W B;  1FYL A;  1SD5 A;  1FNN A;  4CIC A;  3ZMT A;  4BHP A;  5E8I A;  2IW5 A;  1S7A A;  3MFK A;  1HSJ A;  2XVC A;  2PQ8 A;  3G73 A;  1ZGA A;  4LGW A;  4KA4 A;  1CF7 A;  1BC7 C;  2ZNY A;  4ZYD A;  1IF1 A;  1B4A A;  3BWG A;  2MBF A;  1ZLJ A;  1KQ0 A;  3FMQ A;  1T39 A;  1S29 A;  4YG2 F;  2M8E A;  5L3E A;  4RB1 A;  2XAQ A;  2FOK A;  1ZAR A;  2F5F A;  1JXS A;  2HKO A;  5J8C A;  5D6E A;  3WTY C;  1AOY A;  1ZHF A;  1KU2 A;  1QPM A;  4KMU X;  3BJ6 A;  2MD5 A;  5DYM A;  1H0M A;  4ZYE A;  1ON2 A;  4Y15 A;  3SZT A;  2EV6 A;  1Z7U A;  2KJB A;  1I1S A;  3C7J A;  1R1T A;  5L3D A;  3LST A;  1XCV A;  5K5R A;  1UCR A;  2M87 A;  2OBP A;  3E5U A;  4ENM A;  1B1B A;  2O3F A;  3EQL F;  5K5Q A;  1R1U A;  1O3R A;  2XAS A;  4IJA A;  1V3F A;  4KT5 C;  1XCB A;  3F6V A;  1RUO A;  1U5T C;  4M6Y A;  3P9K A;  4Q4Z F;  1FBU A;  4L0Y B;  2VOP A;  5K1Y A;  2TDX A;  2YR2 A;  1Z05 A;  5JFR A;  1FWZ A;  1IUY A;  3F8C A;  1EV7 A;  3C3W A;  2OD5 A;  4YIF A;  3WE2 A;  1ZRC A;  2DPD A;  1S6L A;  3WTT C;  3FM5 A;  3P7N A;  3HOS A;  5DEQ A;  4JQF A;  5ILV A;  5DCF A;  5HLI A;  2GWR A;  2VT3 A;  2V1D A;  3CUQ B;  1D8K A;  2GXB A;  3DPT A;  4HX7 A;  5K5O A;  1T6S A;  4HV5 A;  1NHA A;  1OYW A;  3ZPL A;  1D5V A;  2VE8 A;  1B59 A;  4GYG A;  1R7J A;  2AS5 F;  3FX3 A;  4OIN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...