1TNSA

A novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
76
structure length
76
Chain Sequence
MELWVSPKELANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel class of winged helix-turn-helix protein: the DNA-binding domain of Mu transposase.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Dna binding protein
molecule keywords MU-TRANSPOSASE
total genus 14
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1994-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tnsA00
2P6SA 2E1NA 5D5WB 4ENKA 2K4JA 2HR3A 4A6DA 4U0VA 4DNCA 4IRIA 2QWWA 2XKPA 2EK5A 2PI0A 1IN7A 1QBJA 4LD5A 3ABTA 4N9HA 3ULQB 1YQAA 2VN2A 3DF8A 2NAZA 2HKXA 4Q47A 1IN6A 1S6LA 2EA2A 3EDPA 4UUVA 3KLOA 4NQWA 4HAMA 2STTA 4WF2A 3ZMDA 2P4WA 2IT0A 5E20A 5HLHA 3NRVA 4KDPA 3MAJA 4EQQA 2Y48A 3HRSA 2RKHA 1WQ2A 2KJCA 1H9GA 2P5VA 3ZMZA 2HYGD 3E6BA 2O3FA 3C18A 5F64A 4YIIA 1BJAA 1KU2A 4NB5A 3IKVA 2YX4A 4CDGA 1R58A 3BROA 4KN7X 2IA0A 2CG4A 1R1UA 2OAZA 3RKXA 1ZG1A 4HF2A 2E7WA 4KMUX 3FZVA 1D5VA 1KQ8A 3I71A 4GGGA 4Q48A 2FBHA 2D45A 1W5TA 3BZ6A 2GQQA 4LMYA 3GXOA 2L3DA 1IRGA 1XN7A 2DLLA 1R5HA 3ELKA 3G3ZA 2ZKZA 5D4SA 2V6CA 3CJNA 1LJ9A 1PP8F 2XASA 2QUFA 2V1UA 4B09A 4FHTA 3V7RA 4L5IA 1SMTA 3WTXC 4Y15A 5FO5A 1K7AA 2ZXJA 3E5XA 2DQLA 3L9FA 3J80Z 1XGMA 3VEPA 1J2XA 3S2WA 5FGMA 2CFXA 4S04A 1B9MA 4OOIA 3WU0A 2H6CA 3SHFA 1LNWA 2BBYA 2DK5A 4HV5A 1XSDA 4KT5C 4HQEA 2M1BA 1LDJA 2QM3A 3LFKA 1AWCA 3HIFA 3OV8A 3HHGA 4RB2C 4YFKF 3KP7A 1L3LA 3RI4A 3E6CC 3FX3A 3MFKA 5CVRA 1B4AA 2FA5A 1K79A 2FBKA 3GVAA 1DPRA 1MKMA 5DV5A 4I02A 1WWXA 3WG9A 2EB7A 1G4DA 4HZFA 2IPQX 1V4RA 4RS8A 4U88A 2A07F 2GIVA 1QGPA 2K02A 3DQVC 2H6BA 1TQMA 1PDNC 2VBWA 1P4WA 2BGCA 1NHAA 1Z05A 4MTEA 3R0JA 5LHIA 4M9XA 1ZGJA 3WTWC 5D4RA 5DYMA 2AS5F 4OIOF 3BJAA 1G3YA 1FBQA 1ZRCA 1J0RA 3O3KA 3JAMZ 3DPTA 1MJ9A 5JI6A 5J8FA 4LB5A 1RUOA 4LLNA 1Y0UA 4KIBA 3VOEA 3VODA 4PGGA 4U7BA 4EJWA 1F4KA 1IXSB 4GCVA 4YFNF 1IZ1A 1Z91A 2YSRA 4HX4A 3DXJF 1I6XA 1FC3A 3HHHA 5TJJA 2HTSA 2Q2EA 3DFGA 2GZWA 1USTA 4CICA 3I4PA 3Q9VA 1F5TA 3QU3A 2HKOA 1R23A 3I5UA 3KP4A 1U3EM 4MEYF 2DPDA 1KU9A 4AIJA 5L3BA 3EUHA 1S7OA 5HVQC 1FBUA 4O3MA 3DP7A 1YS6A 2Q8KA 3LA2A 5E1WA 4A2UA 2G9WA 2K4BA 2FBIA 4UVBA 5F1RA 2F5DA 2M5WA 1GXPA 1XDUA 4OIQF 2EV0A 1C0WA 1RZ4A 1F9NA 4BHCA 2O8XA 5E17F 2VE9A 2FNPA 3BWGA 1R5GA 3JTGA 1OPCA 3JTHA 4CGZA 4HW0A 4M71A 4DQ2A 4EGZA 2OD5A 1UHMA 1U6GA 1U78A 5JR3A 2EFPA 3L7WA 2VT2A 4OINF 1MJBA 1HXDA 3HRUA 2W25A 1T6SA 3O6BB 5HS8A 1YTYA 4I01A 1TW2A 2EV6A 4OMZA 1ZLJA 3ERED 1E17A 5K5OA 1XGSA 5E1XA 4TV7A 4KIGA 3RDIA 4UXNA 4I98B 1T39A 4KNYA 2DBBA 3AAFA 5KVRA 3V4GA 4RB3C 3ZN0A 4I2OA 2WWYA 2P5KA 1EV7A 3GW2A 4G6QA 4G7OF 1FY7A 3FM3A 1JHFA 1J59A 3KP5A 2O6GE 1I1GA 1Q1HA 5BQTA 1J75A 1JGSA 2RGVA 2JPBA 4I0BA 1FP2A 3WU1B 2EWNA 1IRFA 2MD5A 2VXZA 3ECOA 2Z5UA 2ESNA 3F8CA 1SFUA 3K9TA 5LHHA 1ZG5A 1G3SA 3GUDA 2UXXA 4A6EA 3F6VA 1R00A 2RQPA 2LNBA 3PQKA 3ZPLA 1SD5A 3RPUA 1XDSA 3D0SA 1GVJA 2R3SA 3NEUA 4OIPF 1UFMA 1R7JA 2GXGA 4L9TA 2ZJ2A 1PP7U 2O0YA 1Z1DA 4KFCA 2Z9OA 1IN4A 3FM5A 1HKQA 3RJPA 4IF4A 5HDGA 1LDKB 1KU3A 4ZH4F 1Z7UA 5BPIA 4LFUA 5ICFA 5CYVA 3K1NA 2DI3A 5ILVA 4FX0A 1HW2A 2KIFA 4I0AA 1D3YA 1R36A 1ON2A 4U0YA 4EMSA 4G94A 1QPMA 2GXBA 3LSTA 2KIUA 2W85A 2FRHA 1ZYRF 5ICEA 1YW9A 3R60A 2W24A 1IXRC 5HDNA 1ZAOA 1RNLA 3GYHX 3C1DA 2QYOA 4D0PA 4XSXF 3HTUA 3WGGA 2G7UA 3TO7A 1KYWA 2VBZA 1GXQA 5ICCA 2A61A 4UV9A 1S3JA 2XRNA 3BJ6A 2OA4A 1I1SA 4XSZF 3EETA 5LEKA 1IN8A 1MGTA 4EM0B 2O61A 2W57A 4WCGA 3QPHA 5IT9Z 1I27A 3LWFA 2EV5A 5HLIA 4I09A 1XGOA 1FYKA 3I53A 1L0OC 2HGCA 3K69A 1WSUA 3KEOA 1U5TC 5K5QA 1FLIA 1O57A 3RKYA 3E97A 5J6XA 1YO5C 1P4AA 2F2EA 3WGIA 3DKWA 4AVPA 1BI2A 5DEQA 3F72A 5FLXK 2VC0A 2MH2A 1R1VA 2WC2A 2WV0A 1FWZA 4YFXF 3RPQA 3I0TA 5HLGA 5D5UB 3J80K 3GEZA 1DDNA 4FX4A 1K78A 3WE2A 4M9SA 2ESHA 2JSCA 3QOPA 1AOYA 1YS7A 2H94A 2X4HA 1SMYF 1ZHFA 5D8KB 1BIBA 4L0ZB 3GX4X 4AIKA 4ENNA 1P4XA 2L54A 5ILUA 1DUXC 3ZN1A 4Y13A 2P5LC 2VE8A 1OKRA 2HTJA 1U5TB 2VBYA 3I59A 2V79A 2K7LA 1HBXG 1WRJA 5HS9A 3WODF 1TNSA 1BC8C 2XUBA 4E70A 4UVCA 2BEOA 1UCRA 3M8FA 3KLNA 5DD4A 5H6QA 2ISZA 1W5SA 1WKMA 1BIAA 3K1MA 3KFWX 3CUQA 4P55A 2DT5A 3T5XA 3N4MA 1QO0D 5IT3A 3KZYA 3I64A 1ZLKA 4HA8A 2F5EA 3IL2A 5A2QK 3T0YA 4HQMA 2VBXA 3R4KA 4HF1A 5J8CA 2K86A 3P9KA 5JFRA 4HLYA 3HSFA 1ZREA 2HOEA 3ZMVA 1J9IA 4ON0A 5IT9K 3K1PA 4LGWA 1FT9A 4EGYA 4LK0F 1QNTA 1SD4A 5D5VB 1EH6A 3HOSA 4HDUA 2QZ8A 3JSOA 1B9NA 3RTRA 4Z2YA 5DCFA 1XGNA 4IRHA 2CYYA 3MQ0A 2DPUA 1D8KA 3KP3A 3E3VA 2M30A 4MEXF 1ODDA 2FNAA 1VTNC 2M45A 1XD7A 1XMKA 2DTRA 1XMAA 3V8JA 1G3WA 2LDUA 4M9ZA 3E6DA 2GA1A 3TO9A 5H20A 1RUNA 3I58A 4NHJA 1RI7A 3WTTC 3IWZA 4AIHA 3KETA 2LKPA 3HOTA 2IVMA 6PAXA 1S29A 1K78B 3BOQA 1RIOH 3F8NA 1REPC 2LF7A 1ZH5A 5BS6A 4P5OA 4L5JA 3J7AO 1FP1D 1Z6TA 4ZYEA 2YX7A 4BXUA 4ZYDA 1TTYA 4A0YA 1J7KA 2ZFWA 3P9IA 5JVTA 3H3UA 3HUGA 5BMZA 3ML6A 2HZTA 3TDZC 1BBYA 1ZG3A 2L01A 3F22A 3IRRA 4MHGA 1ULYA 3F23A 3RIRA 2X0LA 3E6MA 1FBSA 3KZZA 4WWCA 3SFZA 3JW4A 2WTEA 1BC7C 3GO5A 4KN4X 1QZYA 4G7ZF 5HDKA 2RVCA 1W7PB 3G73A 3QAHA 4OIRF 3BJOA 4QWQA 2J5PA 2BE5F 2RDPA 2HFHA 1K6OA 3HRTA 3W6JB 3MZYA 2D2WA 1BI1A 4A5NA 1B1BA 4GYGA 4ENMA 5ICGA 1MD0A 1IF1A 1FYMA 3DPLC 3F6OA 1G6NA 2OZ6A 3V7CA 5H6RA 1I5ZA 4HX7A 2A6EF 4MTDA 1LDDA 1E2XA 2CWEA 5CLSA 1P92A 1IN5A 2D1VA 5D6FA 4BYYA 3Q9SA 1X3UA 1OYWA 4RGSA 2PG4A 5FD5A 2MH9A 2A68F 2A6HF 1KGSA 1CGPA 3Q5FA 4B8XA 3FF5A 2XAJA 3NQOA 4R1HA 1UB9A 3F8MA 4UV8A 3VB2A 3IWFA 1TQPA 4HF0A 2QBYB 3T1BA 2YPRA 1HSTA 1O3QA 1KQ9A 1T98A 4XLNF 5ERIA 4EM2A 3RYPA 4Q5SF 3CO7C 4XBFA 1ZGAA 1Z9CA 2W84A 2AXLA 2Z3YA 4JK1X 2K27A 3PFIA 2HQNA 2IRFG 4P9UA 3F3XA 2FSWA 5FLXZ 3CUQC 2Y0MA 5CVJA 1ON1A 2E7XA 3QP6A 2VC1A 1IXCA 2EFQA 4BHPA 1OYYA 1YIOA 1O7LA 3LA7A 3VFZA 4LLLA 3BDDA 2OQGA 2XVCA 4RGRA 2XROA 2QQ9A 4ASNA 2DO7A 1FNNA 3WTVC 3U9GA 5D5XB 1B59A 1OR7A 4RB0A 4Y17A 3E5UA 2STWA 4HYEA 3HTSB 4N9IA 4RGUA 3RYRA 1D8JA 3H92A 2EFNA 2A69F 5LBQA 4LG0A 2Q0OA 3MCZA 4EJOA 1YG2A 2A5YB 2IA2A 4ESBA 2NNYA 4G8XA 2G7HA 3COAC 2L4MA 1H9TA 4A0XA 1KQ0A 2IA1A 4LLGF 3HSEA 2HDCA 5EEGA 1F1ZA 2XAQA 2YU3A 1ZRDA 4IXAA 2HYFA 1QQIA 2XAHA 1YW7A 3TGNA 1CF7B 4L9JA 3RKWA 5CVIA 2E1CA 1HKTA 4HLXA 1MZBA 4ETSA 2M8EA 3KP6A 2R7DA 3OOPA 3C3WA 3WTYC 3J81Z 4M73A 3DV8A 2YR2A 1BI3A 5AIPA 1LVAA 3GFMA 4HDVA 3FXUA 2PLYA 3SQNA 3DEUA 3HSRA 3BPXA 4A0ZA 4L0YB 2F5CA 1J5YA 2PMHA 2FMYA 5L3CA 1KYZA 1O7FA 2QBYA 1R22A 3QU6A 1R1TA 1HW1A 2ZCWA 4GXOA 1STZA 1FOKA 4KA4A 3K2ZA 4FT8A 4EV0A 4CYDA 2V1XA 4IVNA 2PFBA 4PGHA 5E8GA 3REOA 2IP2A 4YIFA 4KYWA 3GWZA 1SD7A 3U1DA 5LRRA 3TDUC 3R61A 1LEBA 1TW3A 3F8BA 2IW5A 3FMRA 3EYIA 2PEXA 1MDMA 4KUMA 2FF4A 2VT3A 3KCCA 2DK8A 4MNUA 1FZPB 4M72A 4IHSA 3IRQA 5LGUA 3SZTA 2VODA 4P96A 4UHTA 3CLOA 4QLCU 4M74A 1MDMB 2OU2A 1FSHA 1LEAA 5CVVA 4G6DA 2ACJA 3KEQA 1HQCA 2PN6A 3QRFF 3LQQA 4A12A 3QP5A 4HBLA 3W6KB 1V3FA 1TNTA 3CUQB 2LSOA 2PBIA 4R8HA 2MBFA 4JBAA 1JHHA 1SFXA 4OU0A 4M6XA 2M87A 4CZZA 3FXRA 2EA4A 3CUOA 5DCMB 2FEZA 4GO1A 1A04A 3HYIA 2H09A 3BPVA 5FFXA 2EFOA 2ZNZA 3T8RA 1IUYA 1B6AA 3P9CA 5L3DA 4G9YA 3V8KA 1O3SA 4HOBA 5FD6A 4F7ZA 1U8RA 3TOBA 2PQ8A 4ZYGA 1OYIA 1O3RA 2ADUA 1FSEA 2XKOA 3SXYA 2KJBA 4WXHA 3F21A 2DAOA 5BOXA 4YG2F 2HQRA 5DCMA 4CXFA 1T0FA 5AONA 3B02A 1CF7A 2KKOA 4KICA 1EH8A 4K2EA 1YLFA 3GFJA 4AD9A 3T8TA 4IPAA 3R0AA 4L9VA 1XCBA 3ZMSA 5FB2A 4KMFA 1ONVA 3M1EA 3JAMK 3M7GA 3CDHA 4S05A 1IAWA 3LA3A 3ZP5A 4CO8A 2ZBKA 5A2QZ 1T38A 2ELHA 2B0LA 2CO5A 5KK1A 2IJLA 5L3GA 3KE2A 1TBXA 3CO6C 5K1YA 1JXSA 5BPDA 1OMIA 2UXNA 5AIQA 3J81K 4WK8F 3WTSC 2CSOA 5F6FA 2HS5A 2CW0F 5HOOA 4G7HF 1XCVA 2ZNYA 4WXCA 2PMUA 3H3ZA 2RNJA 3R6SA 2MLKA 2DU9A 2FOKA 2ZMEB 2V1DA 2KIMA 4R79A 4BQAA 4RB1A 2NRAC 2GAUA 2MA3A 2J5OA 1JE8A 5DD8A 2Y75A 2BV6A 5E18F 2P7VB 4XLPF 5ILSA 2HEOA 1YFHA 3N97A 3ZMTA 5DUIA 3EQLF 5HS7A 3IC7A 4ESFA 2KRFA 2NYXA 1O3TA 2LF8A 4N0BA 2UWMA 3D5LA 4KIFA 2XAFA 4MGRA 4EJTA 3GF2A 5D6EA 1SD6A 5DUKA 3WTZA 5D8LB 4I7HA 2P6TA 4A5MA 5E8IA 4M6YA 4Q4ZF 4PZJA 2EJRA 4XRFA 1USSA 4H0EA 2QLZA 5K5RA 3TKYA 3I54A 2R7FA 1IW7F 2DFIA 3L2CA 1XSXA 1KA8A 4MQVA 2D1HA 3LAPA 3BY6A 3M9AA 3U2RA 3F8FA 2P8TA 1Z6RA 2QVOA 2RC4A 1BI0A 2ZO4A 2ETHA 3GLXA 2XIGA 1LQ1A 3LAJA 3EYYA 2FXAA 3LQRA 1PUEE 3GFIA 2NS0A 2C6YA 3GZ6A 2XGXA 2H27A 2P7CB 2CGPA 2QQBA 3FMQA 1G3TA 1KU7A 4O5VA 3TOAA 3ISPA 3KP2A 2L4AA 4UVAA 5LGTA 3L00A 3O2PE 1T2KA 1U5TA 3WGHA 2L02A 4AWXB 4L9NA 4BNCA 3L09A 5FFZA 4U7DA 4EM1A 4LG0B 2VONA 3JSPA 1WI9A 4RGXA 4EVIA 4WX9A 1DPUA 1FPQA 4LJZF 3GZ5A 2JTVA 4HV6A 4BAYA 3M8EA 1HKSA 1FYLA 3BP8A 2FMLA 3I59B 3ABUA 1UHWA 5LLQA 4MQ9F 3ZQ7A 1HW5A 1BM9A 1DP7P 2MLGA 2RN7A 1ZN2A 3TO6A 3HRMA 5CJ9A 2OZUA 3FWEA 3IKTA 4CHUA 3ECHA 1P6RA 1W7PA 2A3SA 2OBPA 4IRGA 4HX8A 3QPTA 1HSJA 2JRTA 2FQ3A 4ZZDA 5CVUA 3GFLA 2XAGA 4EJVA 1XB4A 1SFEA 3IHUA 4EJUA 1XSVA 1FX7A 1YYVA 5L3FA 1BN5A 4RAYA 5DDGA 1ZARA 2OQRA 4ZYHA 1SAXA 1P2FA 4GYIA 3MEXA 4L18B 2VOOA 1EH7A 4P9FA 5LGNA 1QZZA 1S7AA 1W7PD 1W4MA 5L3EA 4UNOA 2MC3A 3MZHA 2ISYA 1YW8A 5LHGA 3MWMA 4PDKA 2JPCA 3WTUC 2QQAA 2F5FA 1LB2A 4RAZA 2XV4S 2JZYA 5TRDA 2JT1A 3ROUA 5LRSA 2V9VA 5JHUA 3C7JA 3CTAA 3V7SA 5E1ZB 1BOAA 2DQRA 4LB6B 3WE3A 1MJAA 4ESJA 4JQFA 2COMA 1S8NA 4U0WA 1TLHB 2RV8A 2BYVE 2Z33A 4LK1F 3PQJA 5ED4A 2XHKA 4IJAA 2Z99A 3FHZA 2GWRA 3FXQA 3K0LA 3E5QA 2DW4A 2TDXA 2FE3A 3B73A 2FU4A 2UZKA 4IHTA 1TQIA 1U2WA 4O6JA 2EFWA 2GA2A 3V8LA 2HWVA 4BH9A 4BHBA 3SZPA 2O03A 5LEJA 1GHCA 4OMYA 4ZZLA 2CQKA 1H0MA 2PJPA 2NNNA 4PCQA 3TQNA 2VOPA 4ENJA 1ZRFA 3FMSA 2ZMEA 3P7NA 5EEHA 2QENA 4WXDA 3ZMUA
chains in the Genus database with same CATH superfamily
4AYBA 2P6SA 2E1NA 2E1MB 3H9QA 5D5WB 4RMNA 3FISA 2K4JA 2HR3A 3IP4B 4U0VA 4A6DA 4DNCA 4ENKA 4IRIA 2QWWA 2ME6A 5J4VA 2XKPA 2EK5A 2PI0A 1IN7A 4G6TB 1MBEA 4XM3A 1QBJA 1TP4A 3DCFA 4LD5A 3ABTA 1WI3A 1X2MA 3C2BA 4N9HA 3ULQB 1YQAA 4NC6A 2R92J 2PMZA 4BQQA 2VN2A 3ZQHA 4F55A 2DMNA 2NAZA 3DF8A 2HKXA 4Q47A 1IN6A 1S6LA 2EA2A 3EDPA 1G59A 1S72I 4UUVA 3KLOA 4NQWA 4HAMA 4A3BJ 2STTA 3HZJA 2R7WA 1MBJA 1V54H 1RKTA 2BXYA 3QWLA 4WF2A 3QPSA 3ZMDA 2P4WA 2BVMA 1GV2A 1ORKA 3HG9A 2EIJH 1OCOH 2IT0A 5E20A 2Z16A 5HLHA 3NRVA 4KDPA 3MAJA 3CJRB 4EQQA 1A6QA 2KIQA 2Y48A 3JRGA 3HRSA 1VQMI 2RKHA 3RZOJ 1WQ2A 2KJCA 2DN0A 1H9GA 2P5VA 4A93J 2HXIA 3ZMZA 2HYGD 5EF6A 1TC3C 1QHHD 1RR7A 3OYEA 2NVTJ 2BY0A 3E6BA 4BUPA 2O3FA 3C18A 2B9SA 1A31A 5F64A 1Y1VJ 5DTDA 4YIIA 3V42A 3I9V2 1BJAA 1KU2A 3A01B 4NB5A 1Y1WJ 3QYBA 2R7ZJ 3IKVA 3CD6I 2OC6A 1I39A 2YX4A 2DMTA 4IKFA 2HYJA 4JX6A 1MNEA 4CDGA 1R58A 1X1AA 2GOXB 3HOWJ 2CH0A 1D1CA 3BROA 3DBRB 4XOPA 4KN7X 2IA0A 3ZCOA 2CG4A 4D1QA 1R1UA 2OAZA 2BXZA 4DYCA 1LUJB 4FCYA 3RKXA 1ZG1A 4HF2A 2E7WA 4KMUX 3FZVA 3GTQJ 5IYDJ 4C2UA 5B66C 1D5VA 1KQ8A 3I71A 4GGGA 3A01A 4Q48A 3TMOA 2FBHA 2D45A 2JUCA 1W5TA 3BZ6A 2GQQA 2AHQA 2EZLA 4LMYA 1P7JA 3GXOA 2L3DA 1IRGA 1XN7A 1R6RA 1PJRA 2DLLA 3GMEA 1R5HA 4Y7NJ 2GBYA 2WV1A 2CFOA 3ELKA 3OYAA 3G3ZA 1OCCH 1MMNA 2ZKZA 5D4SA 2WAQN 4BGDA 2V6CA 1WPKA 3ZQIA 3CJNA 5B1BH 3HBLA 3D5SC 4KISA 1LJ9A 2A05A 1PP8F 2XASA 2ZXWH 3K7AJ 3K4KA 3HOVJ 1NK2P 5J1YA 3HGGA 5IOYA 2QUFA 2EIMH 2MG4A 4CCOA 2V1UA 3S1NJ 3JRDA 1W36C 2FJ1A 4B09A 1IV6A 2DTZA 2L7FP 4FHTA 4BS9A 1Z7LA 3V7RA 2HQ5A 4L5IA 1SMTA 1BR4A 4CYCA 3WTXC 4Y15A 1DGRM 5FO5A 3JRCA 1K7AA 2ZXJA 3E5XA 2DQLA 3L9FA 3HOUJ 3ZR8X 3J80Z 1XGMA 3VEPA 2Y31A 1J2XA 3S2WA 5FGMA 4V2FA 1AHDP 2CFXA 2I8DA 5HODA 4S04A 1B9MA 2W82A 3H5NA 3QPLA 4OOIA 2PX9A 3WU0A 2H6CA 1H89C 1AKHB 3SHFA 1LNWA 2BBYA 2DK5A 4HV5A 3RSNA 4E6KG 1XSDA 4KT5C 1U9OA 5E3NA 4LIUA 4HQEA 4RBOA 2M1BA 1LDJA 2QM3A 3LFKA 1AWCA 3HIFA 1WVRA 2V7FA 3OV8A 3GTPJ 3EUKL 4M6VA 4KT6A 4A3MJ 3CCVI 3HHGA 1V5EA 3OSGA 1JT0A 2DA2A 3VYTB 4RB2C 4YFKF 3KP7A 3CJQB 4IOAF 1A35A 4RAGA 1L3LA 3HKZA 3RI4A 2QSFX 3KYCB 3JRBA 3PJRA 4QIWN 3E6CC 3ZXSA 2GLOA 3FX3A 4GRIA 3MFKA 1IC8A 5CPRB 4DBRA 2R7RA 4OAZA 4XR6A 5CVRA 1FJLA 1B4AA 3O8HA 2FA5A 3IUOA 1K79A 4A3KJ 2FBKA 2NS7A 2CJJA 3HDDA 3JRIA 3GVAA 1DPRA 1MKMA 5DV5A 1K6YA 4I02A 1XX5A 1WWXA 2CV1A 3WG9A 2EB7A 1G4DA 4G12A 3OYIA 1V5FA 3A2KA 1Z0XA 2BOLA 4HZFA 3TP3A 4DYRA 3VPRA 3UKGA 2EILH 2JA8J 3BZCA 5DM6F 2IPQX 3W2WA 5EEAA 1V4RA 4RS8A 2DA3A 2X6OA 4U88A 2A07F 2GIVA 1QGPA 2K02A 3DQVC 1TQMA 2H6BA 1PDNC 2F4OB 3ASOH 2VBWA 1DP3A 2XPVA 1P4WA 2BGCA 1NHAA 1MMSA 1Z05A 3KYDB 2XPWA 2KDOA 4MTEA 3R0JA 4AUXA 5LHIA 4M9XA 1ZGJA 1YE9A 2EZHA 2P81A 3G4SI 3S14J 4BDYA 3WTWC 5D4RA 4S0HB 2V4JC 5DYMA 2AS5F 4OIOF 3AG4H 3BJAA 2KQRA 2IAIA 1G3YA 1BR1A 2HI3A 1FBQA 2JK3A 1ZRCA 5EZGA 1J0RA 4XIDA 3O3KA 3JAMZ 3DPTA 1MJ9A 5JI6A 5J8FA 4F52A 4HNTA 1RUOA 4DGWB 4LB5A 4LLNA 1Y0UA 4KIBA 1X3WB 3VOEA 3VODA 4E7ZA 3JRHA 4PGGA 1X1PA 1UMQA 4YRVA 4U7BA 1QA6A 1DQUA 1WCMJ 4ANJA 4EJWA 1F4KA 2QSHX 2RAEA 1IXSB 4GCVA 2K9MA 2ZFUA 1TT5B 3OS0A 1TWFJ 4YFNF 1PVEA 1IZ1A 3AG1H 3G1MA 1Z91A 2YSRA 4HX4A 3DXJF 2V1NA 2XB0X 1I6XA 3PSIA 4XNFA 2CQ7A 1FC3A 3HHHA 3JCUC 1TL8A 3CC4I 5TJJA 5M3MJ 2HTSA 2Q2EA 3DFGA 2GZWA 1USTA 1IG7A 2JWTA 4CICA 3U21A 3I4PA 2JA6J 2ZC2A 1ZGWA 1IDZA 2MYSA 1GT0C 3BG3A 3Q9VA 1R5ID 1F5TA 3QU3A 3F0CA 2HKOA 1R23A 3I5UA 3SZGA 3KP4A 2R7UA 4LG3A 1U3EM 4MEYF 2DPDA 3ZQQA 2CQNA 1KU9A 2UV1A 5LD2C 2VPRA 1BW6A 1POGA 5L3BA 4AIJA 3EUHA 1S7OA 5HVQC 1FBUA 4O3MA 3DP7A 1YS6A 2Q8KA 3LA2A 5E1WA 4A2UA 2P0WA 2G9WA 2K4BA 3RQ4A 4IX7A 2FBIA 3ASNH 4UVBA 2NVXJ 2DXIA 5F1RA 2JA7J 2F5DA 2M5WA 1ZR2A 1GXPA 2FUG2 1XDUA 4OIQF 1TWGJ 1OCZH 4BEHA 5GAHJ 2EV0A 3IH4A 1PUFB 2YU9J 1C0WA 5C3EJ 2ZJRF 1RZ4A 1F9NA 2KRHA 4BHCA 3DEWA 4NUBA 2O8XA 5E17F 2VE9A 4BJ5C 2FNPA 3BWGA 3KZIC 4A3FJ 2HVSA 1R5GA 3JTGA 3CP8A 1OPCA 3JTHA 4CGZA 1R71A 3L2RA 5H2FC 4HW0A 4QPOA 4M71A 2ELJA 1Y0NA 4DQ2A 4EGZA 2OD5A 3IH2A 3ZOBA 2ZSIB 2VJJA 2LBFA 1UHMA 2AQEA 1WFXA 1U6GA 1U78A 5JR3A 2EFPA 3S2HJ 3L7WA 2VT2A 4OINF 1MJBA 3LSKA 1HXDA 4JX5A 1XC5A 3HRUA 2W25A 1T6SA 3O6BB 5HS8A 1YTYA 4NC8A 1K83J 4I01A 2ECCA 3PO2J 4AM3A 2LP0A 1TW2A 2EV6A 4OMZA 3BQYA 1ZLJA 4C9YA 5JLWA 3C2GA 2H8RA 3ERED 5GPCA 1QHGA 1E17A 3A4CA 3WU2C 5K5OA 2DT6A 1XGSA 3I4NJ 5E1XA 4TV7A 5GAGJ 3OYKA 2UUZA 4KIGA 3RDIA 4UXNA 4I98B 1T39A 2M9HA 2R5YB 4KNYA 2DBBA 3BG6A 4A3IJ 3AAFA 1ZQ3P 2CUFA 5KVRA 3V4GA 4RB3C 3ZN0A 1VZ0A 3C2HA 4I2OA 2M34A 2WWYA 2P5KA 1EV7A 3GW2A 4G6QA 4G7OF 2BY3A 2ZXHA 3LMMA 4EATA 1FY7A 3FM3A 2ZMEC 1JHFA 3CDIA 4NDLA 1J59A 1VF9A 2VI6A 1ACIA 2NXNB 3HPHA 3KP5A 1WJCA 2O6GE 1I1GA 1Q1HA 2G0EA 5BQTA 3H3VK 1J75A 4CH7A 1JGSA 2R7OA 2RGVA 4CSWA 2JPBA 2IBDA 1FP2A 4I0BA 3FXJA 3WU1B 4FASD 2WAEA 2EWNA 2XC7A 1IRFA 2V9PA 2MD5A 1WGXA 1X2NA 2VXZA 2L9VA 3MKLA 1O4XA 3ECOA 2Z5UA 1EKEA 2ESNA 3F8CA 4XLEA 1SFUA 4HSRA 3K9TA 5LHHA 3IAS2 1ZG5A 1G3SA 3OL3A 2DMPA 3GUDA 2UXXA 1D1AA 3CMAI 3TP0A 4A6EA 3F6VA 1R00A 2RQPA 2EQRA 2LNBA 3PQKA 4PSWA 3L2WA 3HGYA 3BCBA 1RPWA 3ZPLA 4UB8C 1ETQA 1SD5A 5IPAA 3RPUA 1XDSA 1OCPA 3D0SA 3OMYA 4DZJA 1GVJA 2R3SA 3NEUA 3UR3C 4OIPF 1UFMA 5FROA 1UG2A 1R7JA 2GXGA 4L9TA 2ZJ2A 1PP7U 2O0YA 2MC4A 2XGCA 4HNVA 1Z1DA 3HC7A 2Z9OA 4KFCA 1OFCX 1IN4A 2X1EA 5M5XJ 5EGOA 3OYBA 3FM5A 2X6WA 1FTZA 1YJ9I 3MZ8A 1HKQA 3OYLA 2L7KA 3BR5A 3RJPA 2KT0A 4IF4A 5HDGA 3BG7A 1LDKB 1KU3A 4ZH4F 2JVHA 1Z7UA 5J1RA 3FBIB 2VLAA 5BPIA 1NG6A 2R4GA 4LFUA 4RM3A 3GLLA 5ICFA 2XF7A 4J00A 3GTKJ 2A5WA 5CYVA 2E2IJ 3GTMJ 3K1NA 2LD5A 1A36A 2DI3A 5ILVA 4FX0A 3ZQGA 1HW2A 1YRNA 2KIFA 1SFOJ 3BG5A 4I0AA 1D3YA 1R36A 3HOXJ 4D9JA 1ON2A 4U0YA 2DDBA 4EMSA 2ZSHB 4E4HA 2Q2EB 4M3EA 3I4MJ 4G94A 1QPMA 2GXBA 4M3FA 2R0QC 3LSTA 2KIUA 2W85A 4BY7J 2FRHA 3FXOA 1T33A 1MNMC 1ZYRF 3HKZN 3FKIJ 5ICEA 2YS9A 1YW9A 3R60A 3IV5A 2W24A 1IXRC 2L7ZA 5HDNA 1ZAOA 1RNLA 3GYHX 3C1DA 5EGOB 2QYOA 2GIZA 4D0PA 4XSXF 2JA5J 3HOYJ 3B6AA 4B44A 3HTUA 3WGGA 2G7UA 3TO7A 3FK6A 1IJWC 5C4JJ 3K4MA 1V5GA 1KYWA 2VBZA 3PUBA 2HPIA 2CRGA 4RM2A 4F93B 1JJ6C 2YUSA 1GXQA 3L2VA 5ICCA 5CKTA 1SAUA 3A0HC 4XN0A 2A61A 4DYQA 2Y0SA 5IY5H 4UV9A 3P5JA 1S3JA 2QKMB 3QOEA 3W6VA 2XRNA 3BJ6A 2OA4A 1I1SA 4XSZF 3EETA 3MD2A 4UB6C 4Y33A 5LEKA 1YI2I 1E0EA 2BVLA 1IN8A 1MGTA 3S16J 2E5ZA 4XMYA 3VYSB 1QVUA 4XN3A 4EM0B 2O61A 2W57A 4WCGA 3QPHA 5IT9Z 1K61A 3G2BA 3ONQA 3D1NI 1I27A 3LWFA 2EV5A 5HLIA 3W2AA 4I09A 9ANTA 1ZTRA 1UAAA 1XGOA 1Z67A 4E7LA 2VKVA 1FYKA 3BR2A 1WJAA 3I53A 2DYRH 3CC7I 2IS6A 1L0OC 3PNTA 2HGCA 4RLFA 3H36A 4HEA2 3NARA 2DA1A 1BOBA 3K69A 3KEOA 1U5TC 2R5YA 1WSUA 5K5QA 1FLIA 1O57A 4PUSA 2DOFA 3AKZA 2GOMA 3RKYA 2GXAA 3OYGA 3E97A 5J6XA 3DEEA 1YO5C 1P4AA 3LL7A 3DKYA 3CCEI 4IQJA 4DBQA 2EBIA 2KHMA 2QA4I 2R5ZA 4DW6A 3M3YJ 2F2EA 3WGIA 4BXXJ 4QSHA 3DKWA 1VQOI 2OPTA 2CQQA 4AVPA 1BI2A 5DEQA 3F72A 2K9LA 5IYBJ 5FLXK 2VC0A 2MH2A 1R1VA 1K4TA 2WC2A 2M3AA 1FWZA 2WV0A 4YFXF 2XRLA 1RETA 4ZTJA 4IHWA 1YOVB 2VASA 3RPQA 3CMEI 3I0TA 4BJTA 5HLGA 2CV2A 1WJBA 5D5UB 3J80K 3K4CA 3PSFA 2LKXA 5GAEJ 4OWRB 3GEZA 1LFUP 3EPZA 1DDNA 4C3JJ 4FX4A 1K78A 3WE2A 5BNGA 1SEUA 2W00A 4M9SA 2Y9ZA 3PNYA 2ESHA 2JSCA 3QOPA 5CQGA 2M0MA 3KIOA 4AYBN 4V2GA 1AOYA 4JP0A 1DGWY 1YS7A 2H94A 3QQAA 4A3DJ 2X4HA 1SMYF 1ZHFA 4ABZA 5D8KB 2WB1A 1BIBA 5F1JA 4XK4A 3RKQA 3GX4X 4ENNA 4AIKA 4L0ZB 1P4XA 2L54A 5ILUA 1DUXC 2M8GX 3ZN1A 2LRDA 4Y13A 2P5LC 2KL4A 1YRNB 2DA5A 2DODA 4L5EA 4IEJA 2VE8A 4BEHB 1PUFA 1OKRA 1FIPA 2HTJA 1U5TB 2VBYA 2R7VA 3I59A 4CCNA 2WY8Q 3K4JA 2V79A 2JJ7A 2VL8A 4H4KC 2FX0A 4B47A 2K7LA 2DA4A 1HBXG 2DYSH 1WRJA 2F5VA 2Y2ZA 1DU6A 5HS9A 2VJ4A 2IGKA 3WODF 1UHSA 1TNSA 3H9GA 1BC8C 2XUBA 4E70A 3OYNA 5FKKA 4UVCA 3OR2C 2BEOA 3OIOA 1UCRA 3M8FA 1XG1A 3KLNA 1LFBA 5DD4A 1EF4A 3AFHA 5H6QA 2ISZA 1W5SA 3K6GA 2CUJA 1WKMA 2QSGX 1BIAA 2W48A 1W0TA 2ME0A 3K1MA 4BE0A 4BE2A 3KX2A 2HVRA 2B63J 3KFWX 1G2HA 3CUQA 2O8KA 3H9JA 1E3OC 4P55A 2DT5A 2WAFA 3H0GJ 2E1OA 3T5XA 3N4MA 1QO0D 5JVGF 3ERMA 5IT3A 4CYCB 3O8GA 4Y52J 3KZYA 3I64A 2LBFB 1ZLKA 4I76A 2WADA 4AU7A 3H0DA 2VIXA 3BR6A 4YELA 3CCMI 4HA8A 4XQFA 2F5EA 3IL2A 1FMWA 1B72A 5A2QK 3VWBA 1Z3XA 3T0YA 4HQMA 2VBXA 3R4KA 1SVMA 4HF1A 5J8CA 2X6XA 3RCOA 2K86A 1ETVA 3P9KA 5JFRA 3BR3A 4HLYA 1JUSA 3W2VA 2HQAA 4BE1A 3HSFA 1BW5A 1ZREA 2JRMA 2W7NA 1SANA 1WH5A 3F9KA 2L9RA 4AC0A 2HOEA 3ZMVA 2OV7A 1J9IA 2TCTA 3LNQA 4ON0A 1YJWI 5IT9K 1QZEA 2ZXIA 3K1PA 4LGWA 4XLFA 1D0XA 1FT9A 1IRXA 4EGYA 4ZJZA 3K70D 3OY9A 1U8BA 4LK0F 1QNTA 2DFEA 1SD4A 5D5VB 5FKLA 4P1WA 1EH6A 3WHCA 3HOSA 4HDUA 1MMGA 3VYRB 2QZ8A 3JSOA 2IS1A 3GZNB 2LTPA 1JKPC 1JT6A 2L9SA 3OYFA 1HDDC 1B9NA 3RTRA 3BG9A 1WJFA 4Z2YA 5DCFA 3OIPA 2BW3B 4GDFA 1XGNA 2LR8A 4IRHA 4M3GA 2CYYA 3S8PA 2V6EA 1G8XA 3MQ0A 2DPUA 3W3CA 4E7HA 1D8KA 2HU9A 3KP3A 3E3VA 2VPLA 3GTJJ 1SVOA 2EINH 2M30A 1IRZA 4MEXF 4PJMA 1ODDA 1IGNA 2HOTA 1NH3A 2FNAA 1X4OA 1FMVA 4BU2A 2CV0A 4FE4A 3OYCA 3DU6A 1VTNC 3ZQLA 1M1EB 1MW7A 1MMAA 2M45A 2XF6A 1XD7A 4ZTFA 1XMKA 1Z21A 2DTRA 4C2MJ 4OAYA 1UELB 2OUMA 1AA7A 2F48A 1JI8A 2ECBA 1XMAA 2K5CA 3V8JA 4C2TA 1G3WA 2LDUA 5K7HA 4M9ZA 3E6DA 2GA1A 1Q1VA 2XDVA 1RESA 3TO9A 3G1OA 2E19A 5H20A 2L9NA 1RUNA 3I58A 4NHJA 2R7QA 1RI7A 2HZDA 3WTTC 3IWZA 1OCTC 2LKPA 4AIHA 3KETA 3BR0A 3MKZA 4XLCA 1EJ9A 4C30A 2M4GA 3I56I 3HOTA 4ZDPA 3OS1A 2IVMA 3ABLH 6PAXA 1SFKA 4XKWA 3K10A 4I6ZA 1FIAA 1B8IA 1S29A 1K78B 3BOQA 4XICA 1RIOH 2LG4A 3I3LA 3VYUB 3F8NA 1U9NA 1REPC 2LF7A 4YIRX 3K70C 1ITYA 1ZH5A 5BS6A 4P5OA 2EPFA 4L5JA 3JRAA 2W1OA 3S32A 1MH3A 1NTCA 1FP1D 3J7AO 1Z6TA 2VKDA 2YX7A 3VSKA 4ZYEA 4KITB 2DMUA 2CMPA 4BL0B 4RLQA 1MSEC 3B6CA 4BXUA 3CZ6A 4ZYDA 1TTYA 4A0YA 3U1KA 2IGOA 1IUFA 1J7KA 2ZFWA 4YEJA 3P9IA 5JVTA 2VKHA 3FHNA 3H3UA 3HUGA 2QCOA 5BMZA 3ML6A 3HB9A 3OWTA 2HZTA 3TDZC 1FOXA 1BBYA 1I6HJ 1ZG3A 2L01A 3F22A 3IRRA 3DTEA 4MHGA 2WBMA 1D0YA 1ULYA 3F23A 5GTIC 3SDBA 3RIRA 2K40A 2X0LA 3GTOJ 3ZQCA 2F4MB 1FBSA 3E6MA 3KZZA 4WWCA 3SFZA 3JW4A 2WTEA 1BC7C 4Z6YA 3GO5A 3OYHA 4KN4X 1AKHA 2LREA 2X1CA 4PK4A 2EZIA 1IV8A 1S9HA 3FKJA 1QZYA 4G7ZF 5HDKA 2JUGA 2RVCA 1W7PB 3G73A 3QAHA 1JGGA 4OIRF 3BJOA 4QWQA 2IEKA 2J5PA 1YHQI 2BE5F 2VQCA 2RDPA 2HFHA 1K6OA 1MBGA 3HRTA 3W6JB 4QTRA 2RNGA 1MNDA 2X85A 4CUGA 5K7FA 3MZYA 2D2WA 3SEQA 1BI1A 4A5NA 1B1BA 4GYGA 5ICGA 4ENMA 1MD0A 3TBIA 4RA2A 1IF1A 1FYMA 3DPLC 2QQ8A 3F6OA 1VQ5I 1G6NA 2OZ6A 3V7CA 2KDZA 5H6RA 1MBFA 1I5ZA 2COBA 4HX7A 2A6EF 3GBGA 3BTJA 4MTDA 3BZKA 4HSTA 1LDDA 2LMDA 1E2XA 2CWEA 3EUHC 1P92A 1IN5A 2D1VA 5CLSA 5D6FA 1QU3A 3H1CA 5IP9J 3KYLA 4BYYA 3Q9SA 2IGMA 1X3UA 1OYWA 1W5CC 4RGSA 2PG4A 1MBHA 5FD5A 2MH9A 1HLVA 2A68F 4CCKA 2A6HF 1KGSA 3LSIA 1H8AC 3BTCA 4XKVA 1CGPA 3Q5FA 1TZLA 4B8XA 1P9QC 2MFZA 3FF5A 2X51A 2XAJA 3DBHB 2Z1DA 3NQOA 4R1HA 2IS4A 2M4KA 2TRTA 1UB9A 3F8MA 4BQNA 4BBSJ 4UV8A 3VB2A 1UZCA 3IWFA 1TQPA 4HF0A 4XRSG 3M1CA 2QBYB 3T1BA 2YPRA 1HSTA 2QKLB 1O3QA 1KQ9A 4ZC3A 1T98A 4XL9A 2L5QA 4XLNF 3DPUA 5ERIA 4B4CA 4EM2A 5FJ8J 3RYPA 4Q5SF 2JMWA 3MVPA 3CO7C 4XBFA 2XAUA 1ZGAA 1T08B 1Z9CA 2OF7A 2W84A 2HNHA 2AXLA 4PJ0C 2Z3YA 4JK1X 2K27A 3PFIA 2HQNA 2RQQA 2IRFG 2HOAA 4P9UA 4UUTA 3F3XA 2FSWA 5FLXZ 3CUQC 1TWCJ 2A6TA 2Y0MA 5CVJA 1ON1A 2E7XA 2NS8A 3AL0B 3QP6A 2O5RA 3OR1C 3MKWB 4DJAA 2VC1A 5JLXA 1IXCA 2EFQA 2O9LA 4BHPA 1OYYA 2N8GA 1RC9A 1YIOA 1O7LA 2PJRB 3LA7A 3VFZA 4LLLA 1LKXA 4F92B 3BDDA 2OQGA 1RR8C 4BXFA 5E3MA 1ETWA 2XVCA 1UJ8A 5FLVA 4RGRA 2XROA 3A02A 1B8IB 4JYKA 2M0CA 2QQ9A 4ASNA 1D0ZA 4N4OB 2D5VA 2NOJB 5FRMA 2DO7A 2Y69H 1IO2A 1FNNA 1FEXA 1AU7A 3WTVC 3BTIA 3U9GA 1HA8A 1N25A 3CCSI 4UUSA 3SYTA 5D5XB 1B59A 1OR7A 4RB0A 4ZDOA 4Y17A 3E5UA 5DM7F 3RZDJ 2STWA 4HYEA 1I3AA 2R7XA 3HTSB 4XORA 4N9IA 2VKEA 4RGUA 3RYRA 1D8JA 4J19A 1WJ5A 3DKXA 3H92A 3ZQFA 5B3SH 2Q1ZB 2EFNA 2A69F 5LBQA 1X1DA 4LG0A 1I3QJ 2Q0OA 3SDGA 2GM4A 2KLOA 2ID3A 3MCZA 5F0HA 1GV5A 4EJOA 3HL2A 3S1MJ 3AG3H 4II2A 2HOSA 1YG2A 2A5YB 2HDDA 2IA2A 4ESBA 1MH4A 4JOMA 1MBKA 2NNYA 3S3NA 3D5RC 1D5YA 4G8XA 2G7HA 5HNFA 3COAC 2L4MA 1H9TA 4A0XA 1JKQC 1KQ0A 2IA1A 5E3LA 1W0UA 4LLGF 2OCEA 1S5LC 3HSEA 2HDCA 3SEZA 1F36A 5KAFC 5EEGA 1F1ZA 2XAQA 2YU3A 1ZRDA 4IXAA 2HYFA 1QQIA 2XAHA 1YW7A 2XB5A 4C3IJ 3TGNA 1CF7B 4L9JA 3RKWA 1VQLI 2EH3A 5CVIA 4KJZA 3CF5F 2E1CA 1HKTA 4HLXA 2F6CA 1JTXA 1RKWA 1MZBA 4ETSA 2M8EA 2V9KA 1VQPI 3KP6A 3Q0UA 1MSFC 3S2DJ 2R7DA 1X1CA 3OOPA 1WHUA 3LSJA 1YX5A 3C3WA 3WTYC 3J81Z 3FK7A 4M73A 4X6AJ 3DV8A 2VUMJ 2YR2A 3CCJI 1BI3A 2NVYJ 4CCLA 4A3CJ 5HLTA 3HOZJ 4IOCF 5AIPA 3LSGA 1LVAA 3GFMA 5FKNA 4HDVA 1BA5A 1ETYA 4PFPA 2M2EA 3FXUA 2MSYA 2E2HJ 2PLYA 1RRJA 4BKXA 2DA7A 3SQNA 2F4IA 3DEUA 3LFUA 2R5ZB 3HSRA 2E36A 3BPXA 4A0ZA 1R9TJ 4L0YB 2F5CA 4CA0A 2OTJI 4XKBA 1J5YA 2PMHA 5F08A 1FOWA 2FMYA 5IP7J 5L3CA 2LY9A 2XGDA 4IHXA 1KYZA 1O7FA 2ELKA 5KHDA 2QBYA 1BJZA 1R22A 2X6YA 3QU6A 3VSLA 1R1TA 1X19A 2FD5A 2JA2A 4HG2A 1HW1A 3HJEA 2ZCWA 4GXOA 1H88C 4J01A 1CQTA 1ERDA 1STZA 2DJNA 1FOKA 4KA4A 3K2ZA 4FT8A 1IDYA 4EV0A 2JSPA 2LKSA 1ZELA 3S1RJ 5DS9A 4MFDA 4CYDA 5F0FA 3PIOF 1PYVA 2V1XA 4IVNA 1Z77A 2PFBA 4PGHA 4XONA 5E8GA 3L2QA 1VQKI 3PO3J 5GPAA 3REOA 4CCMA 5IYCJ 2IP2A 3QYFA 2DFFA 4YIFA 1LE8A 4KYWA 3GWZA 1SD7A 2KPMA 3H35A 3U1DA 1XPXA 4RAFA 5LRRA 1WJEA 5EDNA 3TDUC 3R61A 1LEBA 1TW3A 3F8BA 2IW5A 3FMRA 5TGTA 1TT0A 3TEDA 3EYIA 2XPUA 3HUGB 2OTLI 2PEXA 1MDMA 1Y56A 2FF4A 2AQFA 2VT3A 4FISA 3KCCA 4KUMA 2HDWA 2DK8A 3FBNB 4X0GA 1WH7A 4MNUA 2K3FA 4FETA 3BC8A 2LK2A 2PMZN 1FZPB 4M72A 4IHSA 3IRQA 5LGUA 3S17J 4MIMA 2IS2A 3SZTA 2VODA 4P96A 5KNLA 4UHTA 1JTYA 3CLOA 4QLCU 4M74A 1MDMB 3QYEA 2OU2A 3J7YJ 3NWTA 1FSHA 2AO9A 1LEAA 5CVVA 4G6DA 2H8WA 2ACJA 3CJTB 3KEQA 1HQCA 2MD0A 4B1RA 4PSXA 5B5EC 2PN6A 2JQ7A 3QRFF 2K3PA 1ENHA 3LQQA 4A12A 3QP5A 4HBLA 1UG0A 2R7SA 3W6KB 1V3FA 1TNTA 4XRSA 1LVKA 2W4SA 4BY1J 2DCEA 3CUQB 2LSOA 2PBIA 2CW7A 3CCRI 4R8HA 2MBFA 4JBAA 3S93A 3G6EI 3JRFA 3PNVA 5K7ZA 3FXKA 4DZPA 1JHHA 1VQNI 1SFXA 4OU0A 2KZGA 4FE7A 3CCQI 2HVQA 4M6XA 2M87A 4CZZA 1B72B 4B3XA 2MW8A 3FXRA 3K2AA 2EA4A 1F43A 3CUOA 5DCMB 3IAM2 2DA6A 1W1WE 3PL8A 2FEZA 4GO1A 1A04A 3HYIA 5EG0B 2H09A 3BPVA 5FFXA 5FKMA 5J3LA 4AIDA 3WHBA 2EFOA 2ZNZA 1EA3A 2DDAA 2DOEA 3T8RA 1IUYA 1B6AA 3K4NA 3P9CA 1T8IA 5L3DA 4G9YA 3V8KA 1O3SA 3DBLB 4HOBA 3J7AY 4II3A 5FD6A 3IH3A 4F7ZA 1U8RA 3TOBA 1E3HA 2PQ8A 2CU7A 4ZYGA 2H1LA 3NAUA 4XOTA 5GADJ 1OYIA 3CQZJ 1O3RA 1I50J 4DIQA 2ADUA 1FSEA 2XKOA 3SXYA 4BQOA 1BL0A 2KJBA 4FTHA 4WXHA 3F21A 2V26A 5E3OA 3S3MA 4Y3OA 2DAOA 5BOXA 4YG2F 2HQRA 5DCMA 4CXFA 1ETXA 2R93J 4MLOA 3CCYA 1T0FA 5AONA 3B02A 1CF7A 4PFOA 2KKOA 4KICA 1EH8A 4K2EA 2M7AA 3LSRA 1MMDA 2BY2A 1YLFA 2BHYA 3UNGC 3GFJA 3HM5A 1HCRA 1S7EA 2FOWA 4M3BA 1YITI 1X58A 2E5NA 3FDYA 4AD9A 3CESA 4D7MA 3T8TA 4IPAA 3RQIA 4IO9F 3DLAA 1LPQA 3R0AA 4L9VA 3OYJA 3BT9A 4HNUA 1VFCA 1XCBA 3ZMSA 5FB2A 4KMFA 1ONVA 3M1EA 3JAMK 2Y30A 3M7GA 3CDHA 5IP6A 5F04A 4ZDLA 3TW7A 4S05A 4A3LJ 1IAWA 3GCMA 4V19K 3S3OA 3LA3A 2RREA 3ZP5A 2LFBA 3DWLE 4CO8A 2ZBKA 3M8JA 2E60A 4C3HJ 5A2QZ 5F0CA 1XTAA 1T38A 2ELHA 2B0LA 3BTLA 2CO5A 2E71A 3CLQA 5KK1A 2IJLA 3CC2I 1X4PA 4RDUA 5L3GA 3KE2A 4IL6C 1TBXA 3CO6C 2E1MC 5K1YA 2NVQJ 1JXSA 1APLC 3HEFA 5BPDA 1OMIA 2UXNA 5AIQA 3J81K 1WJDA 4WK8F 3WTSC 5FLMJ 2MABA 2MGQA 2CSOA 1JKOC 5F6FA 4B43A 4IHYA 2HS5A 2CW0F 5HOOA 4G7HF 3E0JB 3S1QJ 1XCVA 2ZNYA 4WXCA 2PMUA 3H3ZA 2Z2SB 5EG0A 3I55I 1ETOA 3RPUD 1N75A 2RNJA 1SC7A 2O7OA 4UUSB 3LSPA 3R6SA 4F3QA 4GFBA 1J09A 2MLKA 4F91B 2DU9A 3HPGA 5J47A 1GLNA 2LY2A 4HRIA 2DT7B 1E3PA 2FOKA 2ZMEB 2V1DA 2KIMA 4R79A 1U0JA 4MFEA 4BQAA 4RB1A 2NRAC 2OCCH 2GAUA 2MA3A 4DOZA 2J5OA 4A3JJ 3OYMA 3OIQA 3ABMH 1N77A 1VI0A 3WG7H 3FXLA 1JE8A 5DD8A 1SVLA 2DJIA 2Y75A 2BV6A 5E18F 2P7VB 4XLPF 1YX3A 3OSFA 5ILSA 2HEOA 1OLTA 1R4NB 1YFHA 3N97A 3ZMTA 1KZHA 2R7TA 5DUIA 3EQLF 5HS7A 1ZKGA 3IC7A 4A3EJ 3L2UA 4ESFA 5F27A 3A1YA 4Y4RA 4I99C 2KRFA 2NYXA 2KP6A 4XLAA 1O3TA 1Y6IA 2LF8A 4N0BA 2UWMA 1Y39A 2CUEA 5GP9A 1KONA 3D5LA 4KIFA 2XAFA 1GUUA 4MGRA 5CQEA 3VDXA 1LFPA 2CW8A 1V55H 4EJTA 3GF2A 2CS3A 5D6EA 1SD6A 5DUKA 3WTZA 3ABKH 3NWSA 5D8LB 4XRMA 5EZHA 4I7HA 2P6TA 4A5MA 5E8IA 3AL0C 4AVZA 4M6YA 4Q4ZF 1NK3P 2E35A 3CDLA 4PZJA 2E2JJ 2EJRA 4XRFA 5J40A 1USSA 1XMXA 2XGEA 3OS2A 4H0EA 2QLZA 5K5RA 3TKYA 4NQWB 3ZRGA 3I54A 2R7FA 3DTIA 1IW7F 3JR9A 2ZJPF 4CZCA 2DFIA 3A03A 1Z3YA 1XSXA 3L2CA 1KA8A 4MQVA 1FTTA 5C44J 2JVGA 2D1HA 3LAPA 3BY6A 3M9AA 4QPQA 2KMUA 3U2RA 2AXTC 2P8TA 3F8FA 3J7ZI 1Z6RA 3CCUI 1OQYA 2ID6A 1GDTA 2QVOA 4JX4A 2RC4A 1BI0A 2X1DA 5HNHA 2ZO4A 4W1UA 2ZJQF 2DOAA 5IOZA 2FQ4A 4NBQA 2ETHA 2BW3A 3GLXA 2XIGA 5J1UA 1QPIA 1LQ1A 2Y9YA 3AG2H 3LAJA 1DU0A 4PJNA 3EYYA 3M4OJ 2FXAA 3Q0VA 2QGUA 3LQRA 1PUEE 1HDPA 3GFIA 4U87A 3S15J 2NS0A 2C6YA 3M07A 1ZK8A 3GZ6A 2XGXA 2BHZA 1JJ8C 2WB1N 3PIPF 2H27A 3G1LA 4IHVA 2VJ5A 1JUPA 3X2QH 3FXMA 4IQ4A 2P7CB 2CGPA 3CF2A 3ESWB 2QQBA 2L0KA 1T0FC 3FMQA 1VQ7I 1G3TA 1KU7A 1P7IA 4O5VA 3GTLJ 5B1AH 4E7SA 3TOAA 3ISPA 4NC7A 4E7KA 3KP2A 2L4AA 4UVAA 3GTGJ 5LGTA 3L00A 3O2PE 1T2KA 1U5TA 2LY1A 3WGHA 2L02A 2I10A 3MN2A 3OL4A 4AWXB 4L9NA 4BNCA 3L09A 2E34A 5FFZA 4U7DA 2X9DA 4B3AA 4EM1A 1JKRC 4LG0B 3CP2A 3LSHA 3TW6A 2VONA 1W36D 2LVSA 4BBRJ 3JSPA 1WI9A 2BZTA 4RGXA 4EVIA 4IZZA 4WX9A 4D5FA 2CQXA 1DPUA 1FPQA 2KISA 3N05A 4LJZF 3GZ5A 2EIKH 2JTVA 2PJRA 4HV6A 4BAYA 3M8EA 1HKSA 1FYLA 1T95A 2IGNA 2KZVA 2FMLA 3BP8A 3I59B 3ABUA 2L2OA 1UHWA 4D7NA 1D1BA 1ETKA 1Y8QB 5LLQA 4MQ9F 2VQLA 3OOUA 3ZQ7A 1HW5A 1BM9A 1DP7P 2MLGA 2VXDA 2RN7A 2CUZA 1HF0A 2M7BA 1A5JA 1ZN2A 1XS9A 3TO6A 3HRMA 2LC2A 5CJ9A 2OZUA 3FWEA 1OISA 3IKTA 4CHUA 2XSDC 2DMQA 5EYRA 4E7IA 3ECHA 1P6RA 1QRYA 5M5YJ 1W7PA 2A3SA 4LIVA 5FKOA 5KAIC 2OBPA 4IRGA 3MKYB 3CMYA 4HX8A 5M3FJ 4X1EA 2IXSA 4FQGA 1VQ8I 5KCMA 3QPTA 1HSJA 4D5CA 3LOCA 2JRTA 2FQ3A 1HOMA 4ZZDA 5CVUA 3GFLA 2JN6A 1WZ2A 2L7MP 2XAGA 4LOCA 4E7JA 2VB6A 2VJIA 4EJVA 1XB4A 3JREA 1SFEA 3IHUA 4EJUA 1VQ6I 3Q3SA 3G71I 1XSVA 2EZKA 1FX7A 1YYVA 2HXOA 3PUFA 5L3FA 1BN5A 4RAYA 5DDGA 1ZARA 4B48A 2OQRA 3BQZA 1TWHJ 4ZYHA 1BR2A 1SAXA 4A69C 1P2FA 4GYIA 3MEXA 4L18B 1MIJA 2WA0A 3KEYA 2VOOA 1EH7A 4P9FA 3OYDA 4PJJA 4M3DA 5LGNA 1X1BA 1YIJI 1QZZA 1S7AA 1W7PD 1W4MA 5L3EA 4UNOA 2MC3A 1ZR4A 2HPMA 2XF5A 3SFIA 3MZHA 3E1SA 3L1PA 2ISYA 1NG7A 1X3ZB 4XLHA 1YW8A 1R4MB 3Q0WA 5LHGA 1TWAJ 3MWMA 3PM1A 1N78A 4PDKA 3FIWA 2JPCA 3WTUC 2QQAA 2F5FA 2KFDA 2LOOA 1K4SA 1VQ9I 1T56A 1LB2A 4RAZA 4NNJA 2XV4S 3CCLI 2JZYA 2X48A 2OJED 5TRDA 2JT1A 3DTKA 3ROUA 4XKCA 5LRSA 3EUAA 4BACA 1VQ4I 2I5UA 2QEXI 2LLKA 2V9VA 3C7JA 5JHUA 3CTAA 3DU5A 3V7SA 2B7EA 5E1ZB 2NVUB 1BOAA 3QODA 1QVTA 2DQRA 4LB6B 3WE3A 3BCAA 1MJAA 5FRNA 2WY7Q 1LE8B 4ESJA 4A3GJ 3BR1A 2VQHA 3BLYA 4ZYAA 4JQFA 2COMA 2LH9A 3CMMA 1S8NA 2ZB9A 3KPHA 4U0WA 4HPQA 2H1KA 3SJMA 2ICWG 3H5RA 4N4NB 4UY8I 5J4YA 1TLHB 2RV8A 2BYVE 2Z33A 4LK1F 3PQJA 5TISC 1Y8RB 2BY1A 3PFYA 1OCRH 2LYCA 4PJLA 1VNDA 5E79C 3TL4X 5JHFA 1A6IA 5ED4A 3E7LA 2XHKA 3HXLA 4IJAA 2Z99A 4EEFG 3FHZA 1R49A 2K9QA 2GWRA 4MO7A 3FXQA 2XSJC 1JUMA 3K0LA 4BJ6C 3E5QA 2NOGA 2DW4A 3ZGKA 2WAQA 2TDXA 2FE3A 3B73A 2FU4A 3LSMA 5EJCA 4LITA 4CCJA 1FOYA 3K4LA 2UZKA 4IHTA 1U2WA 1TQIA 5LFAA 1OJLA 2KRCA 2QF7A 4O6JA 2EFWA 5C4XJ 2GA2A 3V8LA 2HWVA 4BH9A 5GTHC 4BHBA 5M5WJ 2K85A 3SZPA 4BDZA 1HC8A 2O03A 3K4BA 2VQGA 5LEJA 1GHCA 4OMYA 2Y0SN 4ZZLA 4W97A 2CQKA 1H0MA 3A0BC 2PJPA 3DLLF 4ITVA 2NNNA 3MMYB 1YJNI 4PCQA 3TQNA 2DFHA 2VOPA 4ENJA 1GVDA 2K9NA 1ZRFA 3FMSA 2ZMEA 2K9SA 3P7NA 5EEHA 2QENA 4WXDA 1OR7C 3ZMUA 3H5AA
chains in the Genus database with same CATH topology
2P6SA 2E1NA 5D5WB 4ENKA 2K4JA 2HR3A 4A6DA 4U0VA 4DNCA 4IRIA 2QWWA 2XKPA 2EK5A 2PI0A 1IN7A 1QBJA 4LD5A 3ABTA 4N9HA 3ULQB 1YQAA 2VN2A 3DF8A 2NAZA 2HKXA 4Q47A 1IN6A 1S6LA 2EA2A 3EDPA 4UUVA 3KLOA 4NQWA 4HAMA 2STTA 4WF2A 3ZMDA 2P4WA 2IT0A 5E20A 5HLHA 3NRVA 4KDPA 3MAJA 4EQQA 2Y48A 3HRSA 2RKHA 1WQ2A 2KJCA 1H9GA 2P5VA 3ZMZA 2HYGD 3E6BA 2O3FA 3C18A 5F64A 4YIIA 1BJAA 1KU2A 4NB5A 3IKVA 2YX4A 4CDGA 1R58A 3BROA 4KN7X 2IA0A 2CG4A 1R1UA 2OAZA 3RKXA 1ZG1A 4HF2A 2E7WA 4KMUX 3FZVA 1D5VA 1KQ8A 3I71A 4GGGA 4Q48A 2FBHA 2D45A 1W5TA 3BZ6A 2GQQA 4LMYA 3GXOA 2L3DA 1IRGA 1XN7A 2DLLA 1R5HA 3ELKA 3G3ZA 2ZKZA 5D4SA 2V6CA 3CJNA 1LJ9A 1PP8F 2XASA 2QUFA 2V1UA 4B09A 4FHTA 3V7RA 4L5IA 1SMTA 3WTXC 4Y15A 5FO5A 1K7AA 2ZXJA 3E5XA 2DQLA 3L9FA 3J80Z 1XGMA 3VEPA 1J2XA 3S2WA 5FGMA 2CFXA 4S04A 1B9MA 4OOIA 3WU0A 2H6CA 3SHFA 1LNWA 2BBYA 2DK5A 4HV5A 1XSDA 4KT5C 4HQEA 2M1BA 1LDJA 2QM3A 3LFKA 1AWCA 3HIFA 3OV8A 3HHGA 4RB2C 4YFKF 3KP7A 1L3LA 3RI4A 3E6CC 3FX3A 3MFKA 5CVRA 1B4AA 2FA5A 1K79A 2FBKA 3GVAA 1DPRA 1MKMA 5DV5A 4I02A 1WWXA 3WG9A 2EB7A 1G4DA 4HZFA 2IPQX 1V4RA 4RS8A 4U88A 2A07F 2GIVA 1QGPA 2K02A 3DQVC 2H6BA 1TQMA 1PDNC 2VBWA 1P4WA 2BGCA 1NHAA 1Z05A 4MTEA 3R0JA 5LHIA 4M9XA 1ZGJA 3WTWC 5D4RA 5DYMA 2AS5F 4OIOF 3BJAA 1G3YA 1FBQA 1ZRCA 1J0RA 3O3KA 3JAMZ 3DPTA 1MJ9A 5JI6A 5J8FA 4LB5A 1RUOA 4LLNA 1Y0UA 4KIBA 3VOEA 3VODA 4PGGA 4U7BA 4EJWA 1F4KA 1IXSB 4GCVA 4YFNF 1IZ1A 1Z91A 2YSRA 4HX4A 3DXJF 1I6XA 1FC3A 3HHHA 5TJJA 2HTSA 2Q2EA 3DFGA 2GZWA 1USTA 4CICA 3I4PA 3Q9VA 1F5TA 3QU3A 2HKOA 1R23A 3I5UA 3KP4A 1U3EM 4MEYF 2DPDA 1KU9A 4AIJA 5L3BA 3EUHA 1S7OA 5HVQC 1FBUA 4O3MA 3DP7A 1YS6A 2Q8KA 3LA2A 5E1WA 4A2UA 2G9WA 2K4BA 2FBIA 4UVBA 5F1RA 2F5DA 2M5WA 1GXPA 1XDUA 4OIQF 2EV0A 1C0WA 1RZ4A 1F9NA 4BHCA 2O8XA 5E17F 2VE9A 2FNPA 3BWGA 1R5GA 3JTGA 1OPCA 3JTHA 4CGZA 4HW0A 4M71A 4DQ2A 4EGZA 2OD5A 1UHMA 1U6GA 1U78A 5JR3A 2EFPA 3L7WA 2VT2A 4OINF 1MJBA 1HXDA 3HRUA 2W25A 1T6SA 3O6BB 5HS8A 1YTYA 4I01A 1TW2A 2EV6A 4OMZA 1ZLJA 3ERED 1E17A 5K5OA 1XGSA 5E1XA 4TV7A 4KIGA 3RDIA 4UXNA 4I98B 1T39A 4KNYA 2DBBA 3AAFA 5KVRA 3V4GA 4RB3C 3ZN0A 4I2OA 2WWYA 2P5KA 1EV7A 3GW2A 4G6QA 4G7OF 1FY7A 3FM3A 1JHFA 1J59A 3KP5A 2O6GE 1I1GA 1Q1HA 5BQTA 1J75A 1JGSA 2RGVA 2JPBA 4I0BA 1FP2A 3WU1B 2EWNA 1IRFA 2MD5A 2VXZA 3ECOA 2Z5UA 2ESNA 3F8CA 1SFUA 3K9TA 5LHHA 1ZG5A 1G3SA 3GUDA 2UXXA 4A6EA 3F6VA 1R00A 2RQPA 2LNBA 3PQKA 3ZPLA 1SD5A 3RPUA 1XDSA 3D0SA 1GVJA 2R3SA 3NEUA 4OIPF 1UFMA 1R7JA 2GXGA 4L9TA 2ZJ2A 1PP7U 2O0YA 1Z1DA 4KFCA 2Z9OA 1IN4A 3FM5A 1HKQA 3RJPA 4IF4A 5HDGA 1LDKB 1KU3A 4ZH4F 1Z7UA 5BPIA 4LFUA 5ICFA 5CYVA 3K1NA 2DI3A 5ILVA 4FX0A 1HW2A 2KIFA 4I0AA 1D3YA 1R36A 1ON2A 4U0YA 4EMSA 4G94A 1QPMA 2GXBA 3LSTA 2KIUA 2W85A 2FRHA 1ZYRF 5ICEA 1YW9A 3R60A 2W24A 1IXRC 5HDNA 1ZAOA 1RNLA 3GYHX 3C1DA 2QYOA 4D0PA 4XSXF 3HTUA 3WGGA 2G7UA 3TO7A 1KYWA 2VBZA 1GXQA 5ICCA 2A61A 4UV9A 1S3JA 2XRNA 3BJ6A 2OA4A 1I1SA 4XSZF 3EETA 5LEKA 1IN8A 1MGTA 4EM0B 2O61A 2W57A 4WCGA 3QPHA 5IT9Z 1I27A 3LWFA 2EV5A 5HLIA 4I09A 1XGOA 1FYKA 3I53A 1L0OC 2HGCA 3K69A 1WSUA 3KEOA 1U5TC 5K5QA 1FLIA 1O57A 3RKYA 3E97A 5J6XA 1YO5C 1P4AA 2F2EA 3WGIA 3DKWA 4AVPA 1BI2A 5DEQA 3F72A 5FLXK 2VC0A 2MH2A 1R1VA 2WC2A 2WV0A 1FWZA 4YFXF 3RPQA 3I0TA 5HLGA 5D5UB 3J80K 3GEZA 1DDNA 4FX4A 1K78A 3WE2A 4M9SA 2ESHA 2JSCA 3QOPA 1AOYA 1YS7A 2H94A 2X4HA 1SMYF 1ZHFA 5D8KB 1BIBA 4L0ZB 3GX4X 4AIKA 4ENNA 1P4XA 2L54A 5ILUA 1DUXC 3ZN1A 4Y13A 2P5LC 2VE8A 1OKRA 2HTJA 1U5TB 2VBYA 3I59A 2V79A 2K7LA 1HBXG 1WRJA 5HS9A 3WODF 1TNSA 1BC8C 2XUBA 4E70A 4UVCA 2BEOA 1UCRA 3M8FA 3KLNA 5DD4A 5H6QA 2ISZA 1W5SA 1WKMA 1BIAA 3K1MA 3KFWX 3CUQA 4P55A 2DT5A 3T5XA 3N4MA 1QO0D 5IT3A 3KZYA 3I64A 1ZLKA 4HA8A 2F5EA 3IL2A 5A2QK 3T0YA 4HQMA 2VBXA 3R4KA 4HF1A 5J8CA 2K86A 3P9KA 5JFRA 4HLYA 3HSFA 1ZREA 2HOEA 3ZMVA 1J9IA 4ON0A 5IT9K 3K1PA 4LGWA 1FT9A 4EGYA 4LK0F 1QNTA 1SD4A 5D5VB 1EH6A 3HOSA 4HDUA 2QZ8A 3JSOA 1B9NA 3RTRA 4Z2YA 5DCFA 1XGNA 4IRHA 2CYYA 3MQ0A 2DPUA 1D8KA 3KP3A 3E3VA 2M30A 4MEXF 1ODDA 2FNAA 1VTNC 2M45A 1XD7A 1XMKA 2DTRA 1XMAA 3V8JA 1G3WA 2LDUA 4M9ZA 3E6DA 2GA1A 3TO9A 5H20A 1RUNA 3I58A 4NHJA 1RI7A 3WTTC 3IWZA 4AIHA 3KETA 2LKPA 3HOTA 2IVMA 6PAXA 1S29A 1K78B 3BOQA 1RIOH 3F8NA 1REPC 2LF7A 1ZH5A 5BS6A 4P5OA 4L5JA 3J7AO 1FP1D 1Z6TA 4ZYEA 2YX7A 4BXUA 4ZYDA 1TTYA 4A0YA 1J7KA 2ZFWA 3P9IA 5JVTA 3H3UA 3HUGA 5BMZA 3ML6A 2HZTA 3TDZC 1BBYA 1ZG3A 2L01A 3F22A 3IRRA 4MHGA 1ULYA 3F23A 3RIRA 2X0LA 3E6MA 1FBSA 3KZZA 4WWCA 3SFZA 3JW4A 2WTEA 1BC7C 3GO5A 4KN4X 1QZYA 4G7ZF 5HDKA 2RVCA 1W7PB 3G73A 3QAHA 4OIRF 3BJOA 4QWQA 2J5PA 2BE5F 2RDPA 2HFHA 1K6OA 3HRTA 3W6JB 3MZYA 2D2WA 1BI1A 4A5NA 1B1BA 4GYGA 4ENMA 5ICGA 1MD0A 1IF1A 1FYMA 3DPLC 3F6OA 1G6NA 2OZ6A 3V7CA 5H6RA 1I5ZA 4HX7A 2A6EF 4MTDA 1LDDA 1E2XA 2CWEA 5CLSA 1P92A 1IN5A 2D1VA 5D6FA 4BYYA 3Q9SA 1X3UA 1OYWA 4RGSA 2PG4A 5FD5A 2MH9A 2A68F 2A6HF 1KGSA 1CGPA 3Q5FA 4B8XA 3FF5A 2XAJA 3NQOA 4R1HA 1UB9A 3F8MA 4UV8A 3VB2A 3IWFA 1TQPA 4HF0A 2QBYB 3T1BA 2YPRA 1HSTA 1O3QA 1KQ9A 1T98A 4XLNF 5ERIA 4EM2A 3RYPA 4Q5SF 3CO7C 4XBFA 1ZGAA 1Z9CA 2W84A 2AXLA 2Z3YA 4JK1X 2K27A 3PFIA 2HQNA 2IRFG 4P9UA 3F3XA 2FSWA 5FLXZ 3CUQC 2Y0MA 5CVJA 1ON1A 2E7XA 3QP6A 2VC1A 1IXCA 2EFQA 4BHPA 1OYYA 1YIOA 1O7LA 3LA7A 3VFZA 4LLLA 3BDDA 2OQGA 2XVCA 4RGRA 2XROA 2QQ9A 4ASNA 2DO7A 1FNNA 3WTVC 3U9GA 5D5XB 1B59A 1OR7A 4RB0A 4Y17A 3E5UA 2STWA 4HYEA 3HTSB 4N9IA 4RGUA 3RYRA 1D8JA 3H92A 2EFNA 2A69F 5LBQA 4LG0A 2Q0OA 3MCZA 4EJOA 1YG2A 2A5YB 2IA2A 4ESBA 2NNYA 4G8XA 2G7HA 3COAC 2L4MA 1H9TA 4A0XA 1KQ0A 2IA1A 4LLGF 3HSEA 2HDCA 5EEGA 1F1ZA 2XAQA 2YU3A 1ZRDA 4IXAA 2HYFA 1QQIA 2XAHA 1YW7A 3TGNA 1CF7B 4L9JA 3RKWA 5CVIA 2E1CA 1HKTA 4HLXA 1MZBA 4ETSA 2M8EA 3KP6A 2R7DA 3OOPA 3C3WA 3WTYC 3J81Z 4M73A 3DV8A 2YR2A 1BI3A 5AIPA 1LVAA 3GFMA 4HDVA 3FXUA 2PLYA 3SQNA 3DEUA 3HSRA 3BPXA 4A0ZA 4L0YB 2F5CA 1J5YA 2PMHA 2FMYA 5L3CA 1KYZA 1O7FA 2QBYA 1R22A 3QU6A 1R1TA 1HW1A 2ZCWA 4GXOA 1STZA 1FOKA 4KA4A 3K2ZA 4FT8A 4EV0A 4CYDA 2V1XA 4IVNA 2PFBA 4PGHA 5E8GA 3REOA 2IP2A 4YIFA 4KYWA 3GWZA 1SD7A 3U1DA 5LRRA 3TDUC 3R61A 1LEBA 1TW3A 3F8BA 2IW5A 3FMRA 3EYIA 2PEXA 1MDMA 4KUMA 2FF4A 2VT3A 3KCCA 2DK8A 4MNUA 1FZPB 4M72A 4IHSA 3IRQA 5LGUA 3SZTA 2VODA 4P96A 4UHTA 3CLOA 4QLCU 4M74A 1MDMB 2OU2A 1FSHA 1LEAA 5CVVA 4G6DA 2ACJA 3KEQA 1HQCA 2PN6A 3QRFF 3LQQA 4A12A 3QP5A 4HBLA 3W6KB 1V3FA 1TNTA 3CUQB 2LSOA 2PBIA 4R8HA 2MBFA 4JBAA 1JHHA 1SFXA 4OU0A 4M6XA 2M87A 4CZZA 3FXRA 2EA4A 3CUOA 5DCMB 2FEZA 4GO1A 1A04A 3HYIA 2H09A 3BPVA 5FFXA 2EFOA 2ZNZA 3T8RA 1IUYA 1B6AA 3P9CA 5L3DA 4G9YA 3V8KA 1O3SA 4HOBA 5FD6A 4F7ZA 1U8RA 3TOBA 2PQ8A 4ZYGA 1OYIA 1O3RA 2ADUA 1FSEA 2XKOA 3SXYA 2KJBA 4WXHA 3F21A 2DAOA 5BOXA 4YG2F 2HQRA 5DCMA 4CXFA 1T0FA 5AONA 3B02A 1CF7A 2KKOA 4KICA 1EH8A 4K2EA 1YLFA 3GFJA 4AD9A 3T8TA 4IPAA 3R0AA 4L9VA 1XCBA 3ZMSA 5FB2A 4KMFA 1ONVA 3M1EA 3JAMK 3M7GA 3CDHA 4S05A 1IAWA 3LA3A 3ZP5A 4CO8A 2ZBKA 5A2QZ 1T38A 2ELHA 2B0LA 2CO5A 5KK1A 2IJLA 5L3GA 3KE2A 1TBXA 3CO6C 5K1YA 1JXSA 5BPDA 1OMIA 2UXNA 5AIQA 3J81K 4WK8F 3WTSC 2CSOA 5F6FA 2HS5A 2CW0F 5HOOA 4G7HF 1XCVA 2ZNYA 4WXCA 2PMUA 3H3ZA 2RNJA 3R6SA 2MLKA 2DU9A 2FOKA 2ZMEB 2V1DA 2KIMA 4R79A 4BQAA 4RB1A 2NRAC 2GAUA 2MA3A 2J5OA 1JE8A 5DD8A 2Y75A 2BV6A 5E18F 2P7VB 4XLPF 5ILSA 2HEOA 1YFHA 3N97A 3ZMTA 5DUIA 3EQLF 5HS7A 3IC7A 4ESFA 2KRFA 2NYXA 1O3TA 2LF8A 4N0BA 2UWMA 3D5LA 4KIFA 2XAFA 4MGRA 4EJTA 3GF2A 5D6EA 1SD6A 5DUKA 3WTZA 5D8LB 4I7HA 2P6TA 4A5MA 5E8IA 4M6YA 4Q4ZF 4PZJA 2EJRA 4XRFA 1USSA 4H0EA 2QLZA 5K5RA 3TKYA 3I54A 2R7FA 1IW7F 2DFIA 3L2CA 1XSXA 1KA8A 4MQVA 2D1HA 3LAPA 3BY6A 3M9AA 3U2RA 3F8FA 2P8TA 1Z6RA 2QVOA 2RC4A 1BI0A 2ZO4A 2ETHA 3GLXA 2XIGA 1LQ1A 3LAJA 3EYYA 2FXAA 3LQRA 1PUEE 3GFIA 2NS0A 2C6YA 3GZ6A 2XGXA 2H27A 2P7CB 2CGPA 2QQBA 3FMQA 1G3TA 1KU7A 4O5VA 3TOAA 3ISPA 3KP2A 2L4AA 4UVAA 5LGTA 3L00A 3O2PE 1T2KA 1U5TA 3WGHA 2L02A 4AWXB 4L9NA 4BNCA 3L09A 5FFZA 4U7DA 4EM1A 4LG0B 2VONA 3JSPA 1WI9A 4RGXA 4EVIA 4WX9A 1DPUA 1FPQA 4LJZF 3GZ5A 2JTVA 4HV6A 4BAYA 3M8EA 1HKSA 1FYLA 3BP8A 2FMLA 3I59B 3ABUA 1UHWA 5LLQA 4MQ9F 3ZQ7A 1HW5A 1BM9A 1DP7P 2MLGA 2RN7A 1ZN2A 3TO6A 3HRMA 5CJ9A 2OZUA 3FWEA 3IKTA 4CHUA 3ECHA 1P6RA 1W7PA 2A3SA 2OBPA 4IRGA 4HX8A 3QPTA 1HSJA 2JRTA 2FQ3A 4ZZDA 5CVUA 3GFLA 2XAGA 4EJVA 1XB4A 1SFEA 3IHUA 4EJUA 1XSVA 1FX7A 1YYVA 5L3FA 1BN5A 4RAYA 5DDGA 1ZARA 2OQRA 4ZYHA 1SAXA 1P2FA 4GYIA 3MEXA 4L18B 2VOOA 1EH7A 4P9FA 5LGNA 1QZZA 1S7AA 1W7PD 1W4MA 5L3EA 4UNOA 2MC3A 3MZHA 2ISYA 1YW8A 5LHGA 3MWMA 4PDKA 2JPCA 3WTUC 2QQAA 2F5FA 1LB2A 4RAZA 2XV4S 2JZYA 5TRDA 2JT1A 3ROUA 5LRSA 2V9VA 5JHUA 3C7JA 3CTAA 3V7SA 5E1ZB 1BOAA 2DQRA 4LB6B 3WE3A 1MJAA 4ESJA 4JQFA 2COMA 1S8NA 4U0WA 1TLHB 2RV8A 2BYVE 2Z33A 4LK1F 3PQJA 5ED4A 2XHKA 4IJAA 2Z99A 3FHZA 2GWRA 3FXQA 3K0LA 3E5QA 2DW4A 2TDXA 2FE3A 3B73A 2FU4A 2UZKA 4IHTA 1TQIA 1U2WA 4O6JA 2EFWA 2GA2A 3V8LA 2HWVA 4BH9A 4BHBA 3SZPA 2O03A 5LEJA 1GHCA 4OMYA 4ZZLA 2CQKA 1H0MA 2PJPA 2NNNA 4PCQA 3TQNA 2VOPA 4ENJA 1ZRFA 3FMSA 2ZMEA 3P7NA 5EEHA 2QENA 4WXDA 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6S A;  2E1N A;  5D5W B;  4ENK A;  2K4J A;  2HR3 A;  4A6D A;  4U0V A;  4DNC A;  4IRI A;  2QWW A;  2XKP A;  2EK5 A;  2PI0 A;  1IN7 A;  1QBJ A;  4LD5 A;  3ABT A;  4N9H A;  3ULQ B;  1YQA A;  2VN2 A;  3DF8 A;  2NAZ A;  2HKX A;  4Q47 A;  1IN6 A;  1S6L A;  2EA2 A;  3EDP A;  4UUV A;  3KLO A;  4NQW A;  4HAM A;  2STT A;  4WF2 A;  3ZMD A;  2P4W A;  2IT0 A;  5E20 A;  5HLH A;  3NRV A;  4KDP A;  3MAJ A;  4EQQ A;  2Y48 A;  3HRS A;  2RKH A;  1WQ2 A;  2KJC A;  1H9G A;  2P5V A;  3ZMZ A;  2HYG D;  3E6B A;  2O3F A;  3C18 A;  5F64 A;  4YII A;  1BJA A;  1KU2 A;  4NB5 A;  3IKV A;  2YX4 A;  4CDG A;  1R58 A;  3BRO A;  4KN7 X;  2IA0 A;  2CG4 A;  1R1U A;  2OAZ A;  3RKX A;  1ZG1 A;  4HF2 A;  2E7W A;  4KMU X;  3FZV A;  1D5V A;  1KQ8 A;  3I71 A;  4GGG A;  4Q48 A;  2FBH A;  2D45 A;  1W5T A;  3BZ6 A;  2GQQ A;  4LMY A;  3GXO A;  2L3D A;  1IRG A;  1XN7 A;  2DLL A;  1R5H A;  3ELK A;  3G3Z A;  2ZKZ A;  5D4S A;  2V6C A;  3CJN A;  1LJ9 A;  1PP8 F;  2XAS A;  2QUF A;  2V1U A;  4B09 A;  4FHT A;  3V7R A;  4L5I A;  1SMT A;  3WTX C;  4Y15 A;  5FO5 A;  1K7A A;  2ZXJ A;  3E5X A;  2DQL A;  3L9F A;  3J80 Z;  1XGM A;  3VEP A;  1J2X A;  3S2W A;  5FGM A;  2CFX A;  4S04 A;  1B9M A;  4OOI A;  3WU0 A;  2H6C A;  3SHF A;  1LNW A;  2BBY A;  2DK5 A;  4HV5 A;  1XSD A;  4KT5 C;  4HQE A;  2M1B A;  1LDJ A;  2QM3 A;  3LFK A;  1AWC A;  3HIF A;  3OV8 A;  3HHG A;  4RB2 C;  4YFK F;  3KP7 A;  1L3L A;  3RI4 A;  3E6C C;  3FX3 A;  3MFK A;  5CVR A;  1B4A A;  2FA5 A;  1K79 A;  2FBK A;  3GVA A;  1DPR A;  1MKM A;  5DV5 A;  4I02 A;  1WWX A;  3WG9 A;  2EB7 A;  1G4D A;  4HZF A;  2IPQ X;  1V4R A;  4RS8 A;  4U88 A;  2A07 F;  2GIV A;  1QGP A;  2K02 A;  3DQV C;  2H6B A;  1TQM A;  1PDN C;  2VBW A;  1P4W A;  2BGC A;  1NHA A;  1Z05 A;  4MTE A;  3R0J A;  5LHI A;  4M9X A;  1ZGJ A;  3WTW C;  5D4R A;  5DYM A;  2AS5 F;  4OIO F;  3BJA A;  1G3Y A;  1FBQ A;  1ZRC A;  1J0R A;  3O3K A;  3JAM Z;  3DPT A;  1MJ9 A;  5JI6 A;  5J8F A;  4LB5 A;  1RUO A;  4LLN A;  1Y0U A;  4KIB A;  3VOE A;  3VOD A;  4PGG A;  4U7B A;  4EJW A;  1F4K A;  1IXS B;  4GCV A;  4YFN F;  1IZ1 A;  1Z91 A;  2YSR A;  4HX4 A;  3DXJ F;  1I6X A;  1FC3 A;  3HHH A;  5TJJ A;  2HTS A;  2Q2E A;  3DFG A;  2GZW A;  1UST A;  4CIC A;  3I4P A;  3Q9V A;  1F5T A;  3QU3 A;  2HKO A;  1R23 A;  3I5U A;  3KP4 A;  1U3E M;  4MEY F;  2DPD A;  1KU9 A;  4AIJ A;  5L3B A;  3EUH A;  1S7O A;  5HVQ C;  1FBU A;  4O3M A;  3DP7 A;  1YS6 A;  2Q8K A;  3LA2 A;  5E1W A;  4A2U A;  2G9W A;  2K4B A;  2FBI A;  4UVB A;  5F1R A;  2F5D A;  2M5W A;  1GXP A;  1XDU A;  4OIQ F;  2EV0 A;  1C0W A;  1RZ4 A;  1F9N A;  4BHC A;  2O8X A;  5E17 F;  2VE9 A;  2FNP A;  3BWG A;  1R5G A;  3JTG A;  1OPC A;  3JTH A;  4CGZ A;  4HW0 A;  4M71 A;  4DQ2 A;  4EGZ A;  2OD5 A;  1UHM A;  1U6G A;  1U78 A;  5JR3 A;  2EFP A;  3L7W A;  2VT2 A;  4OIN F;  1MJB A;  1HXD A;  3HRU A;  2W25 A;  1T6S A;  3O6B B;  5HS8 A;  1YTY A;  4I01 A;  1TW2 A;  2EV6 A;  4OMZ A;  1ZLJ A;  3ERE D;  1E17 A;  5K5O A;  1XGS A;  5E1X A;  4TV7 A;  4KIG A;  3RDI A;  4UXN A;  4I98 B;  1T39 A;  4KNY A;  2DBB A;  3AAF A;  5KVR A;  3V4G A;  4RB3 C;  3ZN0 A;  4I2O A;  2WWY A;  2P5K A;  1EV7 A;  3GW2 A;  4G6Q A;  4G7O F;  1FY7 A;  3FM3 A;  1JHF A;  1J59 A;  3KP5 A;  2O6G E;  1I1G A;  1Q1H A;  5BQT A;  1J75 A;  1JGS A;  2RGV A;  2JPB A;  4I0B A;  1FP2 A;  3WU1 B;  2EWN A;  1IRF A;  2MD5 A;  2VXZ A;  3ECO A;  2Z5U A;  2ESN A;  3F8C A;  1SFU A;  3K9T A;  5LHH A;  1ZG5 A;  1G3S A;  3GUD A;  2UXX A;  4A6E A;  3F6V A;  1R00 A;  2RQP A;  2LNB A;  3PQK A;  3ZPL A;  1SD5 A;  3RPU A;  1XDS A;  3D0S A;  1GVJ A;  2R3S A;  3NEU A;  4OIP F;  1UFM A;  1R7J A;  2GXG A;  4L9T A;  2ZJ2 A;  1PP7 U;  2O0Y A;  1Z1D A;  4KFC A;  2Z9O A;  1IN4 A;  3FM5 A;  1HKQ A;  3RJP A;  4IF4 A;  5HDG A;  1LDK B;  1KU3 A;  4ZH4 F;  1Z7U A;  5BPI A;  4LFU A;  5ICF A;  5CYV A;  3K1N A;  2DI3 A;  5ILV A;  4FX0 A;  1HW2 A;  2KIF A;  4I0A A;  1D3Y A;  1R36 A;  1ON2 A;  4U0Y A;  4EMS A;  4G94 A;  1QPM A;  2GXB A;  3LST A;  2KIU A;  2W85 A;  2FRH A;  1ZYR F;  5ICE A;  1YW9 A;  3R60 A;  2W24 A;  1IXR C;  5HDN A;  1ZAO A;  1RNL A;  3GYH X;  3C1D A;  2QYO A;  4D0P A;  4XSX F;  3HTU A;  3WGG A;  2G7U A;  3TO7 A;  1KYW A;  2VBZ A;  1GXQ A;  5ICC A;  2A61 A;  4UV9 A;  1S3J A;  2XRN A;  3BJ6 A;  2OA4 A;  1I1S A;  4XSZ F;  3EET A;  5LEK A;  1IN8 A;  1MGT A;  4EM0 B;  2O61 A;  2W57 A;  4WCG A;  3QPH A;  5IT9 Z;  1I27 A;  3LWF A;  2EV5 A;  5HLI A;  4I09 A;  1XGO A;  1FYK A;  3I53 A;  1L0O C;  2HGC A;  3K69 A;  1WSU A;  3KEO A;  1U5T C;  5K5Q A;  1FLI A;  1O57 A;  3RKY A;  3E97 A;  5J6X A;  1YO5 C;  1P4A A;  2F2E A;  3WGI A;  3DKW A;  4AVP A;  1BI2 A;  5DEQ A;  3F72 A;  5FLX K;  2VC0 A;  2MH2 A;  1R1V A;  2WC2 A;  2WV0 A;  1FWZ A;  4YFX F;  3RPQ A;  3I0T A;  5HLG A;  5D5U B;  3J80 K;  3GEZ A;  1DDN A;  4FX4 A;  1K78 A;  3WE2 A;  4M9S A;  2ESH A;  2JSC A;  3QOP A;  1AOY A;  1YS7 A;  2H94 A;  2X4H A;  1SMY F;  1ZHF A;  5D8K B;  1BIB A;  4L0Z B;  3GX4 X;  4AIK A;  4ENN A;  1P4X A;  2L54 A;  5ILU A;  1DUX C;  3ZN1 A;  4Y13 A;  2P5L C;  2VE8 A;  1OKR A;  2HTJ A;  1U5T B;  2VBY A;  3I59 A;  2V79 A;  2K7L A;  1HBX G;  1WRJ A;  5HS9 A;  3WOD F;  1TNS A;  1BC8 C;  2XUB A;  4E70 A;  4UVC A;  2BEO A;  1UCR A;  3M8F A;  3KLN A;  5DD4 A;  5H6Q A;  2ISZ A;  1W5S A;  1WKM A;  1BIA A;  3K1M A;  3KFW X;  3CUQ A;  4P55 A;  2DT5 A;  3T5X A;  3N4M A;  1QO0 D;  5IT3 A;  3KZY A;  3I64 A;  1ZLK A;  4HA8 A;  2F5E A;  3IL2 A;  5A2Q K;  3T0Y A;  4HQM A;  2VBX A;  3R4K A;  4HF1 A;  5J8C A;  2K86 A;  3P9K A;  5JFR A;  4HLY A;  3HSF A;  1ZRE A;  2HOE A;  3ZMV A;  1J9I A;  4ON0 A;  5IT9 K;  3K1P A;  4LGW A;  1FT9 A;  4EGY A;  4LK0 F;  1QNT A;  1SD4 A;  5D5V B;  1EH6 A;  3HOS A;  4HDU A;  2QZ8 A;  3JSO A;  1B9N A;  3RTR A;  4Z2Y A;  5DCF A;  1XGN A;  4IRH A;  2CYY A;  3MQ0 A;  2DPU A;  1D8K A;  3KP3 A;  3E3V A;  2M30 A;  4MEX F;  1ODD A;  2FNA A;  1VTN C;  2M45 A;  1XD7 A;  1XMK A;  2DTR A;  1XMA A;  3V8J A;  1G3W A;  2LDU A;  4M9Z A;  3E6D A;  2GA1 A;  3TO9 A;  5H20 A;  1RUN A;  3I58 A;  4NHJ A;  1RI7 A;  3WTT C;  3IWZ A;  4AIH A;  3KET A;  2LKP A;  3HOT A;  2IVM A;  6PAX A;  1S29 A;  1K78 B;  3BOQ A;  1RIO H;  3F8N A;  1REP C;  2LF7 A;  1ZH5 A;  5BS6 A;  4P5O A;  4L5J A;  3J7A O;  1FP1 D;  1Z6T A;  4ZYE A;  2YX7 A;  4BXU A;  4ZYD A;  1TTY A;  4A0Y A;  1J7K A;  2ZFW A;  3P9I A;  5JVT A;  3H3U A;  3HUG A;  5BMZ A;  3ML6 A;  2HZT A;  3TDZ C;  1BBY A;  1ZG3 A;  2L01 A;  3F22 A;  3IRR A;  4MHG A;  1ULY A;  3F23 A;  3RIR A;  2X0L A;  3E6M A;  1FBS A;  3KZZ A;  4WWC A;  3SFZ A;  3JW4 A;  2WTE A;  1BC7 C;  3GO5 A;  4KN4 X;  1QZY A;  4G7Z F;  5HDK A;  2RVC A;  1W7P B;  3G73 A;  3QAH A;  4OIR F;  3BJO A;  4QWQ A;  2J5P A;  2BE5 F;  2RDP A;  2HFH A;  1K6O A;  3HRT A;  3W6J B;  3MZY A;  2D2W A;  1BI1 A;  4A5N A;  1B1B A;  4GYG A;  4ENM A;  5ICG A;  1MD0 A;  1IF1 A;  1FYM A;  3DPL C;  3F6O A;  1G6N A;  2OZ6 A;  3V7C A;  5H6R A;  1I5Z A;  4HX7 A;  2A6E F;  4MTD A;  1LDD A;  1E2X A;  2CWE A;  5CLS A;  1P92 A;  1IN5 A;  2D1V A;  5D6F A;  4BYY A;  3Q9S A;  1X3U A;  1OYW A;  4RGS A;  2PG4 A;  5FD5 A;  2MH9 A;  2A68 F;  2A6H F;  1KGS A;  1CGP A;  3Q5F A;  4B8X A;  3FF5 A;  2XAJ A;  3NQO A;  4R1H A;  1UB9 A;  3F8M A;  4UV8 A;  3VB2 A;  3IWF A;  1TQP A;  4HF0 A;  2QBY B;  3T1B A;  2YPR A;  1HST A;  1O3Q A;  1KQ9 A;  1T98 A;  4XLN F;  5ERI A;  4EM2 A;  3RYP A;  4Q5S F;  3CO7 C;  4XBF A;  1ZGA A;  1Z9C A;  2W84 A;  2AXL A;  2Z3Y A;  4JK1 X;  2K27 A;  3PFI A;  2HQN A;  2IRF G;  4P9U A;  3F3X A;  2FSW A;  5FLX Z;  3CUQ C;  2Y0M A;  5CVJ A;  1ON1 A;  2E7X A;  3QP6 A;  2VC1 A;  1IXC A;  2EFQ A;  4BHP A;  1OYY A;  1YIO A;  1O7L A;  3LA7 A;  3VFZ A;  4LLL A;  3BDD A;  2OQG A;  2XVC A;  4RGR A;  2XRO A;  2QQ9 A;  4ASN A;  2DO7 A;  1FNN A;  3WTV C;  3U9G A;  5D5X B;  1B59 A;  1OR7 A;  4RB0 A;  4Y17 A;  3E5U A;  2STW A;  4HYE A;  3HTS B;  4N9I A;  4RGU A;  3RYR A;  1D8J A;  3H92 A;  2EFN A;  2A69 F;  5LBQ A;  4LG0 A;  2Q0O A;  3MCZ A;  4EJO A;  1YG2 A;  2A5Y B;  2IA2 A;  4ESB A;  2NNY A;  4G8X A;  2G7H A;  3COA C;  2L4M A;  1H9T A;  4A0X A;  1KQ0 A;  2IA1 A;  4LLG F;  3HSE A;  2HDC A;  5EEG A;  1F1Z A;  2XAQ A;  2YU3 A;  1ZRD A;  4IXA A;  2HYF A;  1QQI A;  2XAH A;  1YW7 A;  3TGN A;  1CF7 B;  4L9J A;  3RKW A;  5CVI A;  2E1C A;  1HKT A;  4HLX A;  1MZB A;  4ETS A;  2M8E A;  3KP6 A;  2R7D A;  3OOP A;  3C3W A;  3WTY C;  3J81 Z;  4M73 A;  3DV8 A;  2YR2 A;  1BI3 A;  5AIP A;  1LVA A;  3GFM A;  4HDV A;  3FXU A;  2PLY A;  3SQN A;  3DEU A;  3HSR A;  3BPX A;  4A0Z A;  4L0Y B;  2F5C A;  1J5Y A;  2PMH A;  2FMY A;  5L3C A;  1KYZ A;  1O7F A;  2QBY A;  1R22 A;  3QU6 A;  1R1T A;  1HW1 A;  2ZCW A;  4GXO A;  1STZ A;  1FOK A;  4KA4 A;  3K2Z A;  4FT8 A;  4EV0 A;  4CYD A;  2V1X A;  4IVN A;  2PFB A;  4PGH A;  5E8G A;  3REO A;  2IP2 A;  4YIF A;  4KYW A;  3GWZ A;  1SD7 A;  3U1D A;  5LRR A;  3TDU C;  3R61 A;  1LEB A;  1TW3 A;  3F8B A;  2IW5 A;  3FMR A;  3EYI A;  2PEX A;  1MDM A;  4KUM A;  2FF4 A;  2VT3 A;  3KCC A;  2DK8 A;  4MNU A;  1FZP B;  4M72 A;  4IHS A;  3IRQ A;  5LGU A;  3SZT A;  2VOD A;  4P96 A;  4UHT A;  3CLO A;  4QLC U;  4M74 A;  1MDM B;  2OU2 A;  1FSH A;  1LEA A;  5CVV A;  4G6D A;  2ACJ A;  3KEQ A;  1HQC A;  2PN6 A;  3QRF F;  3LQQ A;  4A12 A;  3QP5 A;  4HBL A;  3W6K B;  1V3F A;  1TNT A;  3CUQ B;  2LSO A;  2PBI A;  4R8H A;  2MBF A;  4JBA A;  1JHH A;  1SFX A;  4OU0 A;  4M6X A;  2M87 A;  4CZZ A;  3FXR A;  2EA4 A;  3CUO A;  5DCM B;  2FEZ A;  4GO1 A;  1A04 A;  3HYI A;  2H09 A;  3BPV A;  5FFX A;  2EFO A;  2ZNZ A;  3T8R A;  1IUY A;  1B6A A;  3P9C A;  5L3D A;  4G9Y A;  3V8K A;  1O3S A;  4HOB A;  5FD6 A;  4F7Z A;  1U8R A;  3TOB A;  2PQ8 A;  4ZYG A;  1OYI A;  1O3R A;  2ADU A;  1FSE A;  2XKO A;  3SXY A;  2KJB A;  4WXH A;  3F21 A;  2DAO A;  5BOX A;  4YG2 F;  2HQR A;  5DCM A;  4CXF A;  1T0F A;  5AON A;  3B02 A;  1CF7 A;  2KKO A;  4KIC A;  1EH8 A;  4K2E A;  1YLF A;  3GFJ A;  4AD9 A;  3T8T A;  4IPA A;  3R0A A;  4L9V A;  1XCB A;  3ZMS A;  5FB2 A;  4KMF A;  1ONV A;  3M1E A;  3JAM K;  3M7G A;  3CDH A;  4S05 A;  1IAW A;  3LA3 A;  3ZP5 A;  4CO8 A;  2ZBK A;  5A2Q Z;  1T38 A;  2ELH A;  2B0L A;  2CO5 A;  5KK1 A;  2IJL A;  5L3G A;  3KE2 A;  1TBX A;  3CO6 C;  5K1Y A;  1JXS A;  5BPD A;  1OMI A;  2UXN A;  5AIQ A;  3J81 K;  4WK8 F;  3WTS C;  2CSO A;  5F6F A;  2HS5 A;  2CW0 F;  5HOO A;  4G7H F;  1XCV A;  2ZNY A;  4WXC A;  2PMU A;  3H3Z A;  2RNJ A;  3R6S A;  2MLK A;  2DU9 A;  2FOK A;  2ZME B;  2V1D A;  2KIM A;  4R79 A;  4BQA A;  4RB1 A;  2NRA C;  2GAU A;  2MA3 A;  2J5O A;  1JE8 A;  5DD8 A;  2Y75 A;  2BV6 A;  5E18 F;  2P7V B;  4XLP F;  5ILS A;  2HEO A;  1YFH A;  3N97 A;  3ZMT A;  5DUI A;  3EQL F;  5HS7 A;  3IC7 A;  4ESF A;  2KRF A;  2NYX A;  1O3T A;  2LF8 A;  4N0B A;  2UWM A;  3D5L A;  4KIF A;  2XAF A;  4MGR A;  4EJT A;  3GF2 A;  5D6E A;  1SD6 A;  5DUK A;  3WTZ A;  5D8L B;  4I7H A;  2P6T A;  4A5M A;  5E8I A;  4M6Y A;  4Q4Z F;  4PZJ A;  2EJR A;  4XRF A;  1USS A;  4H0E A;  2QLZ A;  5K5R A;  3TKY A;  3I54 A;  2R7F A;  1IW7 F;  2DFI A;  3L2C A;  1XSX A;  1KA8 A;  4MQV A;  2D1H A;  3LAP A;  3BY6 A;  3M9A A;  3U2R A;  3F8F A;  2P8T A;  1Z6R A;  2QVO A;  2RC4 A;  1BI0 A;  2ZO4 A;  2ETH A;  3GLX A;  2XIG A;  1LQ1 A;  3LAJ A;  3EYY A;  2FXA A;  3LQR A;  1PUE E;  3GFI A;  2NS0 A;  2C6Y A;  3GZ6 A;  2XGX A;  2H27 A;  2P7C B;  2CGP A;  2QQB A;  3FMQ A;  1G3T A;  1KU7 A;  4O5V A;  3TOA A;  3ISP A;  3KP2 A;  2L4A A;  4UVA A;  5LGT A;  3L00 A;  3O2P E;  1T2K A;  1U5T A;  3WGH A;  2L02 A;  4AWX B;  4L9N A;  4BNC A;  3L09 A;  5FFZ A;  4U7D A;  4EM1 A;  4LG0 B;  2VON A;  3JSP A;  1WI9 A;  4RGX A;  4EVI A;  4WX9 A;  1DPU A;  1FPQ A;  4LJZ F;  3GZ5 A;  2JTV A;  4HV6 A;  4BAY A;  3M8E A;  1HKS A;  1FYL A;  3BP8 A;  2FML A;  3I59 B;  3ABU A;  1UHW A;  5LLQ A;  4MQ9 F;  3ZQ7 A;  1HW5 A;  1BM9 A;  1DP7 P;  2MLG A;  2RN7 A;  1ZN2 A;  3TO6 A;  3HRM A;  5CJ9 A;  2OZU A;  3FWE A;  3IKT A;  4CHU A;  3ECH A;  1P6R A;  1W7P A;  2A3S A;  2OBP A;  4IRG A;  4HX8 A;  3QPT A;  1HSJ A;  2JRT A;  2FQ3 A;  4ZZD A;  5CVU A;  3GFL A;  2XAG A;  4EJV A;  1XB4 A;  1SFE A;  3IHU A;  4EJU A;  1XSV A;  1FX7 A;  1YYV A;  5L3F A;  1BN5 A;  4RAY A;  5DDG A;  1ZAR A;  2OQR A;  4ZYH A;  1SAX A;  1P2F A;  4GYI A;  3MEX A;  4L18 B;  2VOO A;  1EH7 A;  4P9F A;  5LGN A;  1QZZ A;  1S7A A;  1W7P D;  1W4M A;  5L3E A;  4UNO A;  2MC3 A;  3MZH A;  2ISY A;  1YW8 A;  5LHG A;  3MWM A;  4PDK A;  2JPC A;  3WTU C;  2QQA A;  2F5F A;  1LB2 A;  4RAZ A;  2XV4 S;  2JZY A;  5TRD A;  2JT1 A;  3ROU A;  5LRS A;  2V9V A;  5JHU A;  3C7J A;  3CTA A;  3V7S A;  5E1Z B;  1BOA A;  2DQR A;  4LB6 B;  3WE3 A;  1MJA A;  4ESJ A;  4JQF A;  2COM A;  1S8N A;  4U0W A;  1TLH B;  2RV8 A;  2BYV E;  2Z33 A;  4LK1 F;  3PQJ A;  5ED4 A;  2XHK A;  4IJA A;  2Z99 A;  3FHZ A;  2GWR A;  3FXQ A;  3K0L A;  3E5Q A;  2DW4 A;  2TDX A;  2FE3 A;  3B73 A;  2FU4 A;  2UZK A;  4IHT A;  1TQI A;  1U2W A;  4O6J A;  2EFW A;  2GA2 A;  3V8L A;  2HWV A;  4BH9 A;  4BHB A;  3SZP A;  2O03 A;  5LEJ A;  1GHC A;  4OMY A;  4ZZL A;  2CQK A;  1H0M A;  2PJP A;  2NNN A;  4PCQ A;  3TQN A;  2VOP A;  4ENJ A;  1ZRF A;  3FMS A;  2ZME A;  3P7N A;  5EEH A;  2QEN A;  4WXD A;  3ZMU A; 
#chains in the Genus database with same CATH topology
 4AYB A;  2P6S A;  2E1N A;  2E1M B;  3H9Q A;  5D5W B;  4RMN A;  3FIS A;  2K4J A;  2HR3 A;  3IP4 B;  4U0V A;  4A6D A;  4DNC A;  4ENK A;  4IRI A;  2QWW A;  2ME6 A;  5J4V A;  2XKP A;  2EK5 A;  2PI0 A;  1IN7 A;  4G6T B;  1MBE A;  4XM3 A;  1QBJ A;  1TP4 A;  3DCF A;  4LD5 A;  3ABT A;  1WI3 A;  1X2M A;  3C2B A;  4N9H A;  3ULQ B;  1YQA A;  4NC6 A;  2R92 J;  2PMZ A;  4BQQ A;  2VN2 A;  3ZQH A;  4F55 A;  2DMN A;  2NAZ A;  3DF8 A;  2HKX A;  4Q47 A;  1IN6 A;  1S6L A;  2EA2 A;  3EDP A;  1G59 A;  1S72 I;  4UUV A;  3KLO A;  4NQW A;  4HAM A;  4A3B J;  2STT A;  3HZJ A;  2R7W A;  1MBJ A;  1V54 H;  1RKT A;  2BXY A;  3QWL A;  4WF2 A;  3QPS A;  3ZMD A;  2P4W A;  2BVM A;  1GV2 A;  1ORK A;  3HG9 A;  2EIJ H;  1OCO H;  2IT0 A;  5E20 A;  2Z16 A;  5HLH A;  3NRV A;  4KDP A;  3MAJ A;  3CJR B;  4EQQ A;  1A6Q A;  2KIQ A;  2Y48 A;  3JRG A;  3HRS A;  1VQM I;  2RKH A;  3RZO J;  1WQ2 A;  2KJC A;  2DN0 A;  1H9G A;  2P5V A;  4A93 J;  2HXI A;  3ZMZ A;  2HYG D;  5EF6 A;  1TC3 C;  1QHH D;  1RR7 A;  3OYE A;  2NVT J;  2BY0 A;  3E6B A;  4BUP A;  2O3F A;  3C18 A;  2B9S A;  1A31 A;  5F64 A;  1Y1V J;  5DTD A;  4YII A;  3V42 A;  3I9V 2;  1BJA A;  1KU2 A;  3A01 B;  4NB5 A;  1Y1W J;  3QYB A;  2R7Z J;  3IKV A;  3CD6 I;  2OC6 A;  1I39 A;  2YX4 A;  2DMT A;  4IKF A;  2HYJ A;  4JX6 A;  1MNE A;  4CDG A;  1R58 A;  1X1A A;  2GOX B;  3HOW J;  2CH0 A;  1D1C A;  3BRO A;  3DBR B;  4XOP A;  4KN7 X;  2IA0 A;  3ZCO A;  2CG4 A;  4D1Q A;  1R1U A;  2OAZ A;  2BXZ A;  4DYC A;  1LUJ B;  4FCY A;  3RKX A;  1ZG1 A;  4HF2 A;  2E7W A;  4KMU X;  3FZV A;  3GTQ J;  5IYD J;  4C2U A;  5B66 C;  1D5V A;  1KQ8 A;  3I71 A;  4GGG A;  3A01 A;  4Q48 A;  3TMO A;  2FBH A;  2D45 A;  2JUC A;  1W5T A;  3BZ6 A;  2GQQ A;  2AHQ A;  2EZL A;  4LMY A;  1P7J A;  3GXO A;  2L3D A;  1IRG A;  1XN7 A;  1R6R A;  1PJR A;  2DLL A;  3GME A;  1R5H A;  4Y7N J;  2GBY A;  2WV1 A;  2CFO A;  3ELK A;  3OYA A;  3G3Z A;  1OCC H;  1MMN A;  2ZKZ A;  5D4S A;  2WAQ N;  4BGD A;  2V6C A;  1WPK A;  3ZQI A;  3CJN A;  5B1B H;  3HBL A;  3D5S C;  4KIS A;  1LJ9 A;  2A05 A;  1PP8 F;  2XAS A;  2ZXW H;  3K7A J;  3K4K A;  3HOV J;  1NK2 P;  5J1Y A;  3HGG A;  5IOY A;  2QUF A;  2EIM H;  2MG4 A;  4CCO A;  2V1U A;  3S1N J;  3JRD A;  1W36 C;  2FJ1 A;  4B09 A;  1IV6 A;  2DTZ A;  2L7F P;  4FHT A;  4BS9 A;  1Z7L A;  3V7R A;  2HQ5 A;  4L5I A;  1SMT A;  1BR4 A;  4CYC A;  3WTX C;  4Y15 A;  1DGR M;  5FO5 A;  3JRC A;  1K7A A;  2ZXJ A;  3E5X A;  2DQL A;  3L9F A;  3HOU J;  3ZR8 X;  3J80 Z;  1XGM A;  3VEP A;  2Y31 A;  1J2X A;  3S2W A;  5FGM A;  4V2F A;  1AHD P;  2CFX A;  2I8D A;  5HOD A;  4S04 A;  1B9M A;  2W82 A;  3H5N A;  3QPL A;  4OOI A;  2PX9 A;  3WU0 A;  2H6C A;  1H89 C;  1AKH B;  3SHF A;  1LNW A;  2BBY A;  2DK5 A;  4HV5 A;  3RSN A;  4E6K G;  1XSD A;  4KT5 C;  1U9O A;  5E3N A;  4LIU A;  4HQE A;  4RBO A;  2M1B A;  1LDJ A;  2QM3 A;  3LFK A;  1AWC A;  3HIF A;  1WVR A;  2V7F A;  3OV8 A;  3GTP J;  3EUK L;  4M6V A;  4KT6 A;  4A3M J;  3CCV I;  3HHG A;  1V5E A;  3OSG A;  1JT0 A;  2DA2 A;  3VYT B;  4RB2 C;  4YFK F;  3KP7 A;  3CJQ B;  4IOA F;  1A35 A;  4RAG A;  1L3L A;  3HKZ A;  3RI4 A;  2QSF X;  3KYC B;  3JRB A;  3PJR A;  4QIW N;  3E6C C;  3ZXS A;  2GLO A;  3FX3 A;  4GRI A;  3MFK A;  1IC8 A;  5CPR B;  4DBR A;  2R7R A;  4OAZ A;  4XR6 A;  5CVR A;  1FJL A;  1B4A A;  3O8H A;  2FA5 A;  3IUO A;  1K79 A;  4A3K J;  2FBK A;  2NS7 A;  2CJJ A;  3HDD A;  3JRI A;  3GVA A;  1DPR A;  1MKM A;  5DV5 A;  1K6Y A;  4I02 A;  1XX5 A;  1WWX A;  2CV1 A;  3WG9 A;  2EB7 A;  1G4D A;  4G12 A;  3OYI A;  1V5F A;  3A2K A;  1Z0X A;  2BOL A;  4HZF A;  3TP3 A;  4DYR A;  3VPR A;  3UKG A;  2EIL H;  2JA8 J;  3BZC A;  5DM6 F;  2IPQ X;  3W2W A;  5EEA A;  1V4R A;  4RS8 A;  2DA3 A;  2X6O A;  4U88 A;  2A07 F;  2GIV A;  1QGP A;  2K02 A;  3DQV C;  1TQM A;  2H6B A;  1PDN C;  2F4O B;  3ASO H;  2VBW A;  1DP3 A;  2XPV A;  1P4W A;  2BGC A;  1NHA A;  1MMS A;  1Z05 A;  3KYD B;  2XPW A;  2KDO A;  4MTE A;  3R0J A;  4AUX A;  5LHI A;  4M9X A;  1ZGJ A;  1YE9 A;  2EZH A;  2P81 A;  3G4S I;  3S14 J;  4BDY A;  3WTW C;  5D4R A;  4S0H B;  2V4J C;  5DYM A;  2AS5 F;  4OIO F;  3AG4 H;  3BJA A;  2KQR A;  2IAI A;  1G3Y A;  1BR1 A;  2HI3 A;  1FBQ A;  2JK3 A;  1ZRC A;  5EZG A;  1J0R A;  4XID A;  3O3K A;  3JAM Z;  3DPT A;  1MJ9 A;  5JI6 A;  5J8F A;  4F52 A;  4HNT A;  1RUO A;  4DGW B;  4LB5 A;  4LLN A;  1Y0U A;  4KIB A;  1X3W B;  3VOE A;  3VOD A;  4E7Z A;  3JRH A;  4PGG A;  1X1P A;  1UMQ A;  4YRV A;  4U7B A;  1QA6 A;  1DQU A;  1WCM J;  4ANJ A;  4EJW A;  1F4K A;  2QSH X;  2RAE A;  1IXS B;  4GCV A;  2K9M A;  2ZFU A;  1TT5 B;  3OS0 A;  1TWF J;  4YFN F;  1PVE A;  1IZ1 A;  3AG1 H;  3G1M A;  1Z91 A;  2YSR A;  4HX4 A;  3DXJ F;  2V1N A;  2XB0 X;  1I6X A;  3PSI A;  4XNF A;  2CQ7 A;  1FC3 A;  3HHH A;  3JCU C;  1TL8 A;  3CC4 I;  5TJJ A;  5M3M J;  2HTS A;  2Q2E A;  3DFG A;  2GZW A;  1UST A;  1IG7 A;  2JWT A;  4CIC A;  3U21 A;  3I4P A;  2JA6 J;  2ZC2 A;  1ZGW A;  1IDZ A;  2MYS A;  1GT0 C;  3BG3 A;  3Q9V A;  1R5I D;  1F5T A;  3QU3 A;  3F0C A;  2HKO A;  1R23 A;  3I5U A;  3SZG A;  3KP4 A;  2R7U A;  4LG3 A;  1U3E M;  4MEY F;  2DPD A;  3ZQQ A;  2CQN A;  1KU9 A;  2UV1 A;  5LD2 C;  2VPR A;  1BW6 A;  1POG A;  5L3B A;  4AIJ A;  3EUH A;  1S7O A;  5HVQ C;  1FBU A;  4O3M A;  3DP7 A;  1YS6 A;  2Q8K A;  3LA2 A;  5E1W A;  4A2U A;  2P0W A;  2G9W A;  2K4B A;  3RQ4 A;  4IX7 A;  2FBI A;  3ASN H;  4UVB A;  2NVX J;  2DXI A;  5F1R A;  2JA7 J;  2F5D A;  2M5W A;  1ZR2 A;  1GXP A;  2FUG 2;  1XDU A;  4OIQ F;  1TWG J;  1OCZ H;  4BEH A;  5GAH J;  2EV0 A;  3IH4 A;  1PUF B;  2YU9 J;  1C0W A;  5C3E J;  2ZJR F;  1RZ4 A;  1F9N A;  2KRH A;  4BHC A;  3DEW A;  4NUB A;  2O8X A;  5E17 F;  2VE9 A;  4BJ5 C;  2FNP A;  3BWG A;  3KZI C;  4A3F J;  2HVS A;  1R5G A;  3JTG A;  3CP8 A;  1OPC A;  3JTH A;  4CGZ A;  1R71 A;  3L2R A;  5H2F C;  4HW0 A;  4QPO A;  4M71 A;  2ELJ A;  1Y0N A;  4DQ2 A;  4EGZ A;  2OD5 A;  3IH2 A;  3ZOB A;  2ZSI B;  2VJJ A;  2LBF A;  1UHM A;  2AQE A;  1WFX A;  1U6G A;  1U78 A;  5JR3 A;  2EFP A;  3S2H J;  3L7W A;  2VT2 A;  4OIN F;  1MJB A;  3LSK A;  1HXD A;  4JX5 A;  1XC5 A;  3HRU A;  2W25 A;  1T6S A;  3O6B B;  5HS8 A;  1YTY A;  4NC8 A;  1K83 J;  4I01 A;  2ECC A;  3PO2 J;  4AM3 A;  2LP0 A;  1TW2 A;  2EV6 A;  4OMZ A;  3BQY A;  1ZLJ A;  4C9Y A;  5JLW A;  3C2G A;  2H8R A;  3ERE D;  5GPC A;  1QHG A;  1E17 A;  3A4C A;  3WU2 C;  5K5O A;  2DT6 A;  1XGS A;  3I4N J;  5E1X A;  4TV7 A;  5GAG J;  3OYK A;  2UUZ A;  4KIG A;  3RDI A;  4UXN A;  4I98 B;  1T39 A;  2M9H A;  2R5Y B;  4KNY A;  2DBB A;  3BG6 A;  4A3I J;  3AAF A;  1ZQ3 P;  2CUF A;  5KVR A;  3V4G A;  4RB3 C;  3ZN0 A;  1VZ0 A;  3C2H A;  4I2O A;  2M34 A;  2WWY A;  2P5K A;  1EV7 A;  3GW2 A;  4G6Q A;  4G7O F;  2BY3 A;  2ZXH A;  3LMM A;  4EAT A;  1FY7 A;  3FM3 A;  2ZME C;  1JHF A;  3CDI A;  4NDL A;  1J59 A;  1VF9 A;  2VI6 A;  1ACI A;  2NXN B;  3HPH A;  3KP5 A;  1WJC A;  2O6G E;  1I1G A;  1Q1H A;  2G0E A;  5BQT A;  3H3V K;  1J75 A;  4CH7 A;  1JGS A;  2R7O A;  2RGV A;  4CSW A;  2JPB A;  2IBD A;  1FP2 A;  4I0B A;  3FXJ A;  3WU1 B;  4FAS D;  2WAE A;  2EWN A;  2XC7 A;  1IRF A;  2V9P A;  2MD5 A;  1WGX A;  1X2N A;  2VXZ A;  2L9V A;  3MKL A;  1O4X A;  3ECO A;  2Z5U A;  1EKE A;  2ESN A;  3F8C A;  4XLE A;  1SFU A;  4HSR A;  3K9T A;  5LHH A;  3IAS 2;  1ZG5 A;  1G3S A;  3OL3 A;  2DMP A;  3GUD A;  2UXX A;  1D1A A;  3CMA I;  3TP0 A;  4A6E A;  3F6V A;  1R00 A;  2RQP A;  2EQR A;  2LNB A;  3PQK A;  4PSW A;  3L2W A;  3HGY A;  3BCB A;  1RPW A;  3ZPL A;  4UB8 C;  1ETQ A;  1SD5 A;  5IPA A;  3RPU A;  1XDS A;  1OCP A;  3D0S A;  3OMY A;  4DZJ A;  1GVJ A;  2R3S A;  3NEU A;  3UR3 C;  4OIP F;  1UFM A;  5FRO A;  1UG2 A;  1R7J A;  2GXG A;  4L9T A;  2ZJ2 A;  1PP7 U;  2O0Y A;  2MC4 A;  2XGC A;  4HNV A;  1Z1D A;  3HC7 A;  2Z9O A;  4KFC A;  1OFC X;  1IN4 A;  2X1E A;  5M5X J;  5EGO A;  3OYB A;  3FM5 A;  2X6W A;  1FTZ A;  1YJ9 I;  3MZ8 A;  1HKQ A;  3OYL A;  2L7K A;  3BR5 A;  3RJP A;  2KT0 A;  4IF4 A;  5HDG A;  3BG7 A;  1LDK B;  1KU3 A;  4ZH4 F;  2JVH A;  1Z7U A;  5J1R A;  3FBI B;  2VLA A;  5BPI A;  1NG6 A;  2R4G A;  4LFU A;  4RM3 A;  3GLL A;  5ICF A;  2XF7 A;  4J00 A;  3GTK J;  2A5W A;  5CYV A;  2E2I J;  3GTM J;  3K1N A;  2LD5 A;  1A36 A;  2DI3 A;  5ILV A;  4FX0 A;  3ZQG A;  1HW2 A;  1YRN A;  2KIF A;  1SFO J;  3BG5 A;  4I0A A;  1D3Y A;  1R36 A;  3HOX J;  4D9J A;  1ON2 A;  4U0Y A;  2DDB A;  4EMS A;  2ZSH B;  4E4H A;  2Q2E B;  4M3E A;  3I4M J;  4G94 A;  1QPM A;  2GXB A;  4M3F A;  2R0Q C;  3LST A;  2KIU A;  2W85 A;  4BY7 J;  2FRH A;  3FXO A;  1T33 A;  1MNM C;  1ZYR F;  3HKZ N;  3FKI J;  5ICE A;  2YS9 A;  1YW9 A;  3R60 A;  3IV5 A;  2W24 A;  1IXR C;  2L7Z A;  5HDN A;  1ZAO A;  1RNL A;  3GYH X;  3C1D A;  5EGO B;  2QYO A;  2GIZ A;  4D0P A;  4XSX F;  2JA5 J;  3HOY J;  3B6A A;  4B44 A;  3HTU A;  3WGG A;  2G7U A;  3TO7 A;  3FK6 A;  1IJW C;  5C4J J;  3K4M A;  1V5G A;  1KYW A;  2VBZ A;  3PUB A;  2HPI A;  2CRG A;  4RM2 A;  4F93 B;  1JJ6 C;  2YUS A;  1GXQ A;  3L2V A;  5ICC A;  5CKT A;  1SAU A;  3A0H C;  4XN0 A;  2A61 A;  4DYQ A;  2Y0S A;  5IY5 H;  4UV9 A;  3P5J A;  1S3J A;  2QKM B;  3QOE A;  3W6V A;  2XRN A;  3BJ6 A;  2OA4 A;  1I1S A;  4XSZ F;  3EET A;  3MD2 A;  4UB6 C;  4Y33 A;  5LEK A;  1YI2 I;  1E0E A;  2BVL A;  1IN8 A;  1MGT A;  3S16 J;  2E5Z A;  4XMY A;  3VYS B;  1QVU A;  4XN3 A;  4EM0 B;  2O61 A;  2W57 A;  4WCG A;  3QPH A;  5IT9 Z;  1K61 A;  3G2B A;  3ONQ A;  3D1N I;  1I27 A;  3LWF A;  2EV5 A;  5HLI A;  3W2A A;  4I09 A;  9ANT A;  1ZTR A;  1UAA A;  1XGO A;  1Z67 A;  4E7L A;  2VKV A;  1FYK A;  3BR2 A;  1WJA A;  3I53 A;  2DYR H;  3CC7 I;  2IS6 A;  1L0O C;  3PNT A;  2HGC A;  4RLF A;  3H36 A;  4HEA 2;  3NAR A;  2DA1 A;  1BOB A;  3K69 A;  3KEO A;  1U5T C;  2R5Y A;  1WSU A;  5K5Q A;  1FLI A;  1O57 A;  4PUS A;  2DOF A;  3AKZ A;  2GOM A;  3RKY A;  2GXA A;  3OYG A;  3E97 A;  5J6X A;  3DEE A;  1YO5 C;  1P4A A;  3LL7 A;  3DKY A;  3CCE I;  4IQJ A;  4DBQ A;  2EBI A;  2KHM A;  2QA4 I;  2R5Z A;  4DW6 A;  3M3Y J;  2F2E A;  3WGI A;  4BXX J;  4QSH A;  3DKW A;  1VQO I;  2OPT A;  2CQQ A;  4AVP A;  1BI2 A;  5DEQ A;  3F72 A;  2K9L A;  5IYB J;  5FLX K;  2VC0 A;  2MH2 A;  1R1V A;  1K4T A;  2WC2 A;  2M3A A;  1FWZ A;  2WV0 A;  4YFX F;  2XRL A;  1RET A;  4ZTJ A;  4IHW A;  1YOV B;  2VAS A;  3RPQ A;  3CME I;  3I0T A;  4BJT A;  5HLG A;  2CV2 A;  1WJB A;  5D5U B;  3J80 K;  3K4C A;  3PSF A;  2LKX A;  5GAE J;  4OWR B;  3GEZ A;  1LFU P;  3EPZ A;  1DDN A;  4C3J J;  4FX4 A;  1K78 A;  3WE2 A;  5BNG A;  1SEU A;  2W00 A;  4M9S A;  2Y9Z A;  3PNY A;  2ESH A;  2JSC A;  3QOP A;  5CQG A;  2M0M A;  3KIO A;  4AYB N;  4V2G A;  1AOY A;  4JP0 A;  1DGW Y;  1YS7 A;  2H94 A;  3QQA A;  4A3D J;  2X4H A;  1SMY F;  1ZHF A;  4ABZ A;  5D8K B;  2WB1 A;  1BIB A;  5F1J A;  4XK4 A;  3RKQ A;  3GX4 X;  4ENN A;  4AIK A;  4L0Z B;  1P4X A;  2L54 A;  5ILU A;  1DUX C;  2M8G X;  3ZN1 A;  2LRD A;  4Y13 A;  2P5L C;  2KL4 A;  1YRN B;  2DA5 A;  2DOD A;  4L5E A;  4IEJ A;  2VE8 A;  4BEH B;  1PUF A;  1OKR A;  1FIP A;  2HTJ A;  1U5T B;  2VBY A;  2R7V A;  3I59 A;  4CCN A;  2WY8 Q;  3K4J A;  2V79 A;  2JJ7 A;  2VL8 A;  4H4K C;  2FX0 A;  4B47 A;  2K7L A;  2DA4 A;  1HBX G;  2DYS H;  1WRJ A;  2F5V A;  2Y2Z A;  1DU6 A;  5HS9 A;  2VJ4 A;  2IGK A;  3WOD F;  1UHS A;  1TNS A;  3H9G A;  1BC8 C;  2XUB A;  4E70 A;  3OYN A;  5FKK A;  4UVC A;  3OR2 C;  2BEO A;  3OIO A;  1UCR A;  3M8F A;  1XG1 A;  3KLN A;  1LFB A;  5DD4 A;  1EF4 A;  3AFH A;  5H6Q A;  2ISZ A;  1W5S A;  3K6G A;  2CUJ A;  1WKM A;  2QSG X;  1BIA A;  2W48 A;  1W0T A;  2ME0 A;  3K1M A;  4BE0 A;  4BE2 A;  3KX2 A;  2HVR A;  2B63 J;  3KFW X;  1G2H A;  3CUQ A;  2O8K A;  3H9J A;  1E3O C;  4P55 A;  2DT5 A;  2WAF A;  3H0G J;  2E1O A;  3T5X A;  3N4M A;  1QO0 D;  5JVG F;  3ERM A;  5IT3 A;  4CYC B;  3O8G A;  4Y52 J;  3KZY A;  3I64 A;  2LBF B;  1ZLK A;  4I76 A;  2WAD A;  4AU7 A;  3H0D A;  2VIX A;  3BR6 A;  4YEL A;  3CCM I;  4HA8 A;  4XQF A;  2F5E A;  3IL2 A;  1FMW A;  1B72 A;  5A2Q K;  3VWB A;  1Z3X A;  3T0Y A;  4HQM A;  2VBX A;  3R4K A;  1SVM A;  4HF1 A;  5J8C A;  2X6X A;  3RCO A;  2K86 A;  1ETV A;  3P9K A;  5JFR A;  3BR3 A;  4HLY A;  1JUS A;  3W2V A;  2HQA A;  4BE1 A;  3HSF A;  1BW5 A;  1ZRE A;  2JRM A;  2W7N A;  1SAN A;  1WH5 A;  3F9K A;  2L9R A;  4AC0 A;  2HOE A;  3ZMV A;  2OV7 A;  1J9I A;  2TCT A;  3LNQ A;  4ON0 A;  1YJW I;  5IT9 K;  1QZE A;  2ZXI A;  3K1P A;  4LGW A;  4XLF A;  1D0X A;  1FT9 A;  1IRX A;  4EGY A;  4ZJZ A;  3K70 D;  3OY9 A;  1U8B A;  4LK0 F;  1QNT A;  2DFE A;  1SD4 A;  5D5V B;  5FKL A;  4P1W A;  1EH6 A;  3WHC A;  3HOS A;  4HDU A;  1MMG A;  3VYR B;  2QZ8 A;  3JSO A;  2IS1 A;  3GZN B;  2LTP A;  1JKP C;  1JT6 A;  2L9S A;  3OYF A;  1HDD C;  1B9N A;  3RTR A;  3BG9 A;  1WJF A;  4Z2Y A;  5DCF A;  3OIP A;  2BW3 B;  4GDF A;  1XGN A;  2LR8 A;  4IRH A;  4M3G A;  2CYY A;  3S8P A;  2V6E A;  1G8X A;  3MQ0 A;  2DPU A;  3W3C A;  4E7H A;  1D8K A;  2HU9 A;  3KP3 A;  3E3V A;  2VPL A;  3GTJ J;  1SVO A;  2EIN H;  2M30 A;  1IRZ A;  4MEX F;  4PJM A;  1ODD A;  1IGN A;  2HOT A;  1NH3 A;  2FNA A;  1X4O A;  1FMV A;  4BU2 A;  2CV0 A;  4FE4 A;  3OYC A;  3DU6 A;  1VTN C;  3ZQL A;  1M1E B;  1MW7 A;  1MMA A;  2M45 A;  2XF6 A;  1XD7 A;  4ZTF A;  1XMK A;  1Z21 A;  2DTR A;  4C2M J;  4OAY A;  1UEL B;  2OUM A;  1AA7 A;  2F48 A;  1JI8 A;  2ECB A;  1XMA A;  2K5C A;  3V8J A;  4C2T A;  1G3W A;  2LDU A;  5K7H A;  4M9Z A;  3E6D A;  2GA1 A;  1Q1V A;  2XDV A;  1RES A;  3TO9 A;  3G1O A;  2E19 A;  5H20 A;  2L9N A;  1RUN A;  3I58 A;  4NHJ A;  2R7Q A;  1RI7 A;  2HZD A;  3WTT C;  3IWZ A;  1OCT C;  2LKP A;  4AIH A;  3KET A;  3BR0 A;  3MKZ A;  4XLC A;  1EJ9 A;  4C30 A;  2M4G A;  3I56 I;  3HOT A;  4ZDP A;  3OS1 A;  2IVM A;  3ABL H;  6PAX A;  1SFK A;  4XKW A;  3K10 A;  4I6Z A;  1FIA A;  1B8I A;  1S29 A;  1K78 B;  3BOQ A;  4XIC A;  1RIO H;  2LG4 A;  3I3L A;  3VYU B;  3F8N A;  1U9N A;  1REP C;  2LF7 A;  4YIR X;  3K70 C;  1ITY A;  1ZH5 A;  5BS6 A;  4P5O A;  2EPF A;  4L5J A;  3JRA A;  2W1O A;  3S32 A;  1MH3 A;  1NTC A;  1FP1 D;  3J7A O;  1Z6T A;  2VKD A;  2YX7 A;  3VSK A;  4ZYE A;  4KIT B;  2DMU A;  2CMP A;  4BL0 B;  4RLQ A;  1MSE C;  3B6C A;  4BXU A;  3CZ6 A;  4ZYD A;  1TTY A;  4A0Y A;  3U1K A;  2IGO A;  1IUF A;  1J7K A;  2ZFW A;  4YEJ A;  3P9I A;  5JVT A;  2VKH A;  3FHN A;  3H3U A;  3HUG A;  2QCO A;  5BMZ A;  3ML6 A;  3HB9 A;  3OWT A;  2HZT A;  3TDZ C;  1FOX A;  1BBY A;  1I6H J;  1ZG3 A;  2L01 A;  3F22 A;  3IRR A;  3DTE A;  4MHG A;  2WBM A;  1D0Y A;  1ULY A;  3F23 A;  5GTI C;  3SDB A;  3RIR A;  2K40 A;  2X0L A;  3GTO J;  3ZQC A;  2F4M B;  1FBS A;  3E6M A;  3KZZ A;  4WWC A;  3SFZ A;  3JW4 A;  2WTE A;  1BC7 C;  4Z6Y A;  3GO5 A;  3OYH A;  4KN4 X;  1AKH A;  2LRE A;  2X1C A;  4PK4 A;  2EZI A;  1IV8 A;  1S9H A;  3FKJ A;  1QZY A;  4G7Z F;  5HDK A;  2JUG A;  2RVC A;  1W7P B;  3G73 A;  3QAH A;  1JGG A;  4OIR F;  3BJO A;  4QWQ A;  2IEK A;  2J5P A;  1YHQ I;  2BE5 F;  2VQC A;  2RDP A;  2HFH A;  1K6O A;  1MBG A;  3HRT A;  3W6J B;  4QTR A;  2RNG A;  1MND A;  2X85 A;  4CUG A;  5K7F A;  3MZY A;  2D2W A;  3SEQ A;  1BI1 A;  4A5N A;  1B1B A;  4GYG A;  5ICG A;  4ENM A;  1MD0 A;  3TBI A;  4RA2 A;  1IF1 A;  1FYM A;  3DPL C;  2QQ8 A;  3F6O A;  1VQ5 I;  1G6N A;  2OZ6 A;  3V7C A;  2KDZ A;  5H6R A;  1MBF A;  1I5Z A;  2COB A;  4HX7 A;  2A6E F;  3GBG A;  3BTJ A;  4MTD A;  3BZK A;  4HST A;  1LDD A;  2LMD A;  1E2X A;  2CWE A;  3EUH C;  1P92 A;  1IN5 A;  2D1V A;  5CLS A;  5D6F A;  1QU3 A;  3H1C A;  5IP9 J;  3KYL A;  4BYY A;  3Q9S A;  2IGM A;  1X3U A;  1OYW A;  1W5C C;  4RGS A;  2PG4 A;  1MBH A;  5FD5 A;  2MH9 A;  1HLV A;  2A68 F;  4CCK A;  2A6H F;  1KGS A;  3LSI A;  1H8A C;  3BTC A;  4XKV A;  1CGP A;  3Q5F A;  1TZL A;  4B8X A;  1P9Q C;  2MFZ A;  3FF5 A;  2X51 A;  2XAJ A;  3DBH B;  2Z1D A;  3NQO A;  4R1H A;  2IS4 A;  2M4K A;  2TRT A;  1UB9 A;  3F8M A;  4BQN A;  4BBS J;  4UV8 A;  3VB2 A;  1UZC A;  3IWF A;  1TQP A;  4HF0 A;  4XRS G;  3M1C A;  2QBY B;  3T1B A;  2YPR A;  1HST A;  2QKL B;  1O3Q A;  1KQ9 A;  4ZC3 A;  1T98 A;  4XL9 A;  2L5Q A;  4XLN F;  3DPU A;  5ERI A;  4B4C A;  4EM2 A;  5FJ8 J;  3RYP A;  4Q5S F;  2JMW A;  3MVP A;  3CO7 C;  4XBF A;  2XAU A;  1ZGA A;  1T08 B;  1Z9C A;  2OF7 A;  2W84 A;  2HNH A;  2AXL A;  4PJ0 C;  2Z3Y A;  4JK1 X;  2K27 A;  3PFI A;  2HQN A;  2RQQ A;  2IRF G;  2HOA A;  4P9U A;  4UUT A;  3F3X A;  2FSW A;  5FLX Z;  3CUQ C;  1TWC J;  2A6T A;  2Y0M A;  5CVJ A;  1ON1 A;  2E7X A;  2NS8 A;  3AL0 B;  3QP6 A;  2O5R A;  3OR1 C;  3MKW B;  4DJA A;  2VC1 A;  5JLX A;  1IXC A;  2EFQ A;  2O9L A;  4BHP A;  1OYY A;  2N8G A;  1RC9 A;  1YIO A;  1O7L A;  2PJR B;  3LA7 A;  3VFZ A;  4LLL A;  1LKX A;  4F92 B;  3BDD A;  2OQG A;  1RR8 C;  4BXF A;  5E3M A;  1ETW A;  2XVC A;  1UJ8 A;  5FLV A;  4RGR A;  2XRO A;  3A02 A;  1B8I B;  4JYK A;  2M0C A;  2QQ9 A;  4ASN A;  1D0Z A;  4N4O B;  2D5V A;  2NOJ B;  5FRM A;  2DO7 A;  2Y69 H;  1IO2 A;  1FNN A;  1FEX A;  1AU7 A;  3WTV C;  3BTI A;  3U9G A;  1HA8 A;  1N25 A;  3CCS I;  4UUS A;  3SYT A;  5D5X B;  1B59 A;  1OR7 A;  4RB0 A;  4ZDO A;  4Y17 A;  3E5U A;  5DM7 F;  3RZD J;  2STW A;  4HYE A;  1I3A A;  2R7X A;  3HTS B;  4XOR A;  4N9I A;  2VKE A;  4RGU A;  3RYR A;  1D8J A;  4J19 A;  1WJ5 A;  3DKX A;  3H92 A;  3ZQF A;  5B3S H;  2Q1Z B;  2EFN A;  2A69 F;  5LBQ A;  1X1D A;  4LG0 A;  1I3Q J;  2Q0O A;  3SDG A;  2GM4 A;  2KLO A;  2ID3 A;  3MCZ A;  5F0H A;  1GV5 A;  4EJO A;  3HL2 A;  3S1M J;  3AG3 H;  4II2 A;  2HOS A;  1YG2 A;  2A5Y B;  2HDD A;  2IA2 A;  4ESB A;  1MH4 A;  4JOM A;  1MBK A;  2NNY A;  3S3N A;  3D5R C;  1D5Y A;  4G8X A;  2G7H A;  5HNF A;  3COA C;  2L4M A;  1H9T A;  4A0X A;  1JKQ C;  1KQ0 A;  2IA1 A;  5E3L A;  1W0U A;  4LLG F;  2OCE A;  1S5L C;  3HSE A;  2HDC A;  3SEZ A;  1F36 A;  5KAF C;  5EEG A;  1F1Z A;  2XAQ A;  2YU3 A;  1ZRD A;  4IXA A;  2HYF A;  1QQI A;  2XAH A;  1YW7 A;  2XB5 A;  4C3I J;  3TGN A;  1CF7 B;  4L9J A;  3RKW A;  1VQL I;  2EH3 A;  5CVI A;  4KJZ A;  3CF5 F;  2E1C A;  1HKT A;  4HLX A;  2F6C A;  1JTX A;  1RKW A;  1MZB A;  4ETS A;  2M8E A;  2V9K A;  1VQP I;  3KP6 A;  3Q0U A;  1MSF C;  3S2D J;  2R7D A;  1X1C A;  3OOP A;  1WHU A;  3LSJ A;  1YX5 A;  3C3W A;  3WTY C;  3J81 Z;  3FK7 A;  4M73 A;  4X6A J;  3DV8 A;  2VUM J;  2YR2 A;  3CCJ I;  1BI3 A;  2NVY J;  4CCL A;  4A3C J;  5HLT A;  3HOZ J;  4IOC F;  5AIP A;  3LSG A;  1LVA A;  3GFM A;  5FKN A;  4HDV A;  1BA5 A;  1ETY A;  4PFP A;  2M2E A;  3FXU A;  2MSY A;  2E2H J;  2PLY A;  1RRJ A;  4BKX A;  2DA7 A;  3SQN A;  2F4I A;  3DEU A;  3LFU A;  2R5Z B;  3HSR A;  2E36 A;  3BPX A;  4A0Z A;  1R9T J;  4L0Y B;  2F5C A;  4CA0 A;  2OTJ I;  4XKB A;  1J5Y A;  2PMH A;  5F08 A;  1FOW A;  2FMY A;  5IP7 J;  5L3C A;  2LY9 A;  2XGD A;  4IHX A;  1KYZ A;  1O7F A;  2ELK A;  5KHD A;  2QBY A;  1BJZ A;  1R22 A;  2X6Y A;  3QU6 A;  3VSL A;  1R1T A;  1X19 A;  2FD5 A;  2JA2 A;  4HG2 A;  1HW1 A;  3HJE A;  2ZCW A;  4GXO A;  1H88 C;  4J01 A;  1CQT A;  1ERD A;  1STZ A;  2DJN A;  1FOK A;  4KA4 A;  3K2Z A;  4FT8 A;  1IDY A;  4EV0 A;  2JSP A;  2LKS A;  1ZEL A;  3S1R J;  5DS9 A;  4MFD A;  4CYD A;  5F0F A;  3PIO F;  1PYV A;  2V1X A;  4IVN A;  1Z77 A;  2PFB A;  4PGH A;  4XON A;  5E8G A;  3L2Q A;  1VQK I;  3PO3 J;  5GPA A;  3REO A;  4CCM A;  5IYC J;  2IP2 A;  3QYF A;  2DFF A;  4YIF A;  1LE8 A;  4KYW A;  3GWZ A;  1SD7 A;  2KPM A;  3H35 A;  3U1D A;  1XPX A;  4RAF A;  5LRR A;  1WJE A;  5EDN A;  3TDU C;  3R61 A;  1LEB A;  1TW3 A;  3F8B A;  2IW5 A;  3FMR A;  5TGT A;  1TT0 A;  3TED A;  3EYI A;  2XPU A;  3HUG B;  2OTL I;  2PEX A;  1MDM A;  1Y56 A;  2FF4 A;  2AQF A;  2VT3 A;  4FIS A;  3KCC A;  4KUM A;  2HDW A;  2DK8 A;  3FBN B;  4X0G A;  1WH7 A;  4MNU A;  2K3F A;  4FET A;  3BC8 A;  2LK2 A;  2PMZ N;  1FZP B;  4M72 A;  4IHS A;  3IRQ A;  5LGU A;  3S17 J;  4MIM A;  2IS2 A;  3SZT A;  2VOD A;  4P96 A;  5KNL A;  4UHT A;  1JTY A;  3CLO A;  4QLC U;  4M74 A;  1MDM B;  3QYE A;  2OU2 A;  3J7Y J;  3NWT A;  1FSH A;  2AO9 A;  1LEA A;  5CVV A;  4G6D A;  2H8W A;  2ACJ A;  3CJT B;  3KEQ A;  1HQC A;  2MD0 A;  4B1R A;  4PSX A;  5B5E C;  2PN6 A;  2JQ7 A;  3QRF F;  2K3P A;  1ENH A;  3LQQ A;  4A12 A;  3QP5 A;  4HBL A;  1UG0 A;  2R7S A;  3W6K B;  1V3F A;  1TNT A;  4XRS A;  1LVK A;  2W4S A;  4BY1 J;  2DCE A;  3CUQ B;  2LSO A;  2PBI A;  2CW7 A;  3CCR I;  4R8H A;  2MBF A;  4JBA A;  3S93 A;  3G6E I;  3JRF A;  3PNV A;  5K7Z A;  3FXK A;  4DZP A;  1JHH A;  1VQN I;  1SFX A;  4OU0 A;  2KZG A;  4FE7 A;  3CCQ I;  2HVQ A;  4M6X A;  2M87 A;  4CZZ A;  1B72 B;  4B3X A;  2MW8 A;  3FXR A;  3K2A A;  2EA4 A;  1F43 A;  3CUO A;  5DCM B;  3IAM 2;  2DA6 A;  1W1W E;  3PL8 A;  2FEZ A;  4GO1 A;  1A04 A;  3HYI A;  5EG0 B;  2H09 A;  3BPV A;  5FFX A;  5FKM A;  5J3L A;  4AID A;  3WHB A;  2EFO A;  2ZNZ A;  1EA3 A;  2DDA A;  2DOE A;  3T8R A;  1IUY A;  1B6A A;  3K4N A;  3P9C A;  1T8I A;  5L3D A;  4G9Y A;  3V8K A;  1O3S A;  3DBL B;  4HOB A;  3J7A Y;  4II3 A;  5FD6 A;  3IH3 A;  4F7Z A;  1U8R A;  3TOB A;  1E3H A;  2PQ8 A;  2CU7 A;  4ZYG A;  2H1L A;  3NAU A;  4XOT A;  5GAD J;  1OYI A;  3CQZ J;  1O3R A;  1I50 J;  4DIQ A;  2ADU A;  1FSE A;  2XKO A;  3SXY A;  4BQO A;  1BL0 A;  2KJB A;  4FTH A;  4WXH A;  3F21 A;  2V26 A;  5E3O A;  3S3M A;  4Y3O A;  2DAO A;  5BOX A;  4YG2 F;  2HQR A;  5DCM A;  4CXF A;  1ETX A;  2R93 J;  4MLO A;  3CCY A;  1T0F A;  5AON A;  3B02 A;  1CF7 A;  4PFO A;  2KKO A;  4KIC A;  1EH8 A;  4K2E A;  2M7A A;  3LSR A;  1MMD A;  2BY2 A;  1YLF A;  2BHY A;  3UNG C;  3GFJ A;  3HM5 A;  1HCR A;  1S7E A;  2FOW A;  4M3B A;  1YIT I;  1X58 A;  2E5N A;  3FDY A;  4AD9 A;  3CES A;  4D7M A;  3T8T A;  4IPA A;  3RQI A;  4IO9 F;  3DLA A;  1LPQ A;  3R0A A;  4L9V A;  3OYJ A;  3BT9 A;  4HNU A;  1VFC A;  1XCB A;  3ZMS A;  5FB2 A;  4KMF A;  1ONV A;  3M1E A;  3JAM K;  2Y30 A;  3M7G A;  3CDH A;  5IP6 A;  5F04 A;  4ZDL A;  3TW7 A;  4S05 A;  4A3L J;  1IAW A;  3GCM A;  4V19 K;  3S3O A;  3LA3 A;  2RRE A;  3ZP5 A;  2LFB A;  3DWL E;  4CO8 A;  2ZBK A;  3M8J A;  2E60 A;  4C3H J;  5A2Q Z;  5F0C A;  1XTA A;  1T38 A;  2ELH A;  2B0L A;  3BTL A;  2CO5 A;  2E71 A;  3CLQ A;  5KK1 A;  2IJL A;  3CC2 I;  1X4P A;  4RDU A;  5L3G A;  3KE2 A;  4IL6 C;  1TBX A;  3CO6 C;  2E1M C;  5K1Y A;  2NVQ J;  1JXS A;  1APL C;  3HEF A;  5BPD A;  1OMI A;  2UXN A;  5AIQ A;  3J81 K;  1WJD A;  4WK8 F;  3WTS C;  5FLM J;  2MAB A;  2MGQ A;  2CSO A;  1JKO C;  5F6F A;  4B43 A;  4IHY A;  2HS5 A;  2CW0 F;  5HOO A;  4G7H F;  3E0J B;  3S1Q J;  1XCV A;  2ZNY A;  4WXC A;  2PMU A;  3H3Z A;  2Z2S B;  5EG0 A;  3I55 I;  1ETO A;  3RPU D;  1N75 A;  2RNJ A;  1SC7 A;  2O7O A;  4UUS B;  3LSP A;  3R6S A;  4F3Q A;  4GFB A;  1J09 A;  2MLK A;  4F91 B;  2DU9 A;  3HPG A;  5J47 A;  1GLN A;  2LY2 A;  4HRI A;  2DT7 B;  1E3P A;  2FOK A;  2ZME B;  2V1D A;  2KIM A;  4R79 A;  1U0J A;  4MFE A;  4BQA A;  4RB1 A;  2NRA C;  2OCC H;  2GAU A;  2MA3 A;  4DOZ A;  2J5O A;  4A3J J;  3OYM A;  3OIQ A;  3ABM H;  1N77 A;  1VI0 A;  3WG7 H;  3FXL A;  1JE8 A;  5DD8 A;  1SVL A;  2DJI A;  2Y75 A;  2BV6 A;  5E18 F;  2P7V B;  4XLP F;  1YX3 A;  3OSF A;  5ILS A;  2HEO A;  1OLT A;  1R4N B;  1YFH A;  3N97 A;  3ZMT A;  1KZH A;  2R7T A;  5DUI A;  3EQL F;  5HS7 A;  1ZKG A;  3IC7 A;  4A3E J;  3L2U A;  4ESF A;  5F27 A;  3A1Y A;  4Y4R A;  4I99 C;  2KRF A;  2NYX A;  2KP6 A;  4XLA A;  1O3T A;  1Y6I A;  2LF8 A;  4N0B A;  2UWM A;  1Y39 A;  2CUE A;  5GP9 A;  1KON A;  3D5L A;  4KIF A;  2XAF A;  1GUU A;  4MGR A;  5CQE A;  3VDX A;  1LFP A;  2CW8 A;  1V55 H;  4EJT A;  3GF2 A;  2CS3 A;  5D6E A;  1SD6 A;  5DUK A;  3WTZ A;  3ABK H;  3NWS A;  5D8L B;  4XRM A;  5EZH A;  4I7H A;  2P6T A;  4A5M A;  5E8I A;  3AL0 C;  4AVZ A;  4M6Y A;  4Q4Z F;  1NK3 P;  2E35 A;  3CDL A;  4PZJ A;  2E2J J;  2EJR A;  4XRF A;  5J40 A;  1USS A;  1XMX A;  2XGE A;  3OS2 A;  4H0E A;  2QLZ A;  5K5R A;  3TKY A;  4NQW B;  3ZRG A;  3I54 A;  2R7F A;  3DTI A;  1IW7 F;  3JR9 A;  2ZJP F;  4CZC A;  2DFI A;  3A03 A;  1Z3Y A;  1XSX A;  3L2C A;  1KA8 A;  4MQV A;  1FTT A;  5C44 J;  2JVG A;  2D1H A;  3LAP A;  3BY6 A;  3M9A A;  4QPQ A;  2KMU A;  3U2R A;  2AXT C;  2P8T A;  3F8F A;  3J7Z I;  1Z6R A;  3CCU I;  1OQY A;  2ID6 A;  1GDT A;  2QVO A;  4JX4 A;  2RC4 A;  1BI0 A;  2X1D A;  5HNH A;  2ZO4 A;  4W1U A;  2ZJQ F;  2DOA A;  5IOZ A;  2FQ4 A;  4NBQ A;  2ETH A;  2BW3 A;  3GLX A;  2XIG A;  5J1U A;  1QPI A;  1LQ1 A;  2Y9Y A;  3AG2 H;  3LAJ A;  1DU0 A;  4PJN A;  3EYY A;  3M4O J;  2FXA A;  3Q0V A;  2QGU A;  3LQR A;  1PUE E;  1HDP A;  3GFI A;  4U87 A;  3S15 J;  2NS0 A;  2C6Y A;  3M07 A;  1ZK8 A;  3GZ6 A;  2XGX A;  2BHZ A;  1JJ8 C;  2WB1 N;  3PIP F;  2H27 A;  3G1L A;  4IHV A;  2VJ5 A;  1JUP A;  3X2Q H;  3FXM A;  4IQ4 A;  2P7C B;  2CGP A;  3CF2 A;  3ESW B;  2QQB A;  2L0K A;  1T0F C;  3FMQ A;  1VQ7 I;  1G3T A;  1KU7 A;  1P7I A;  4O5V A;  3GTL J;  5B1A H;  4E7S A;  3TOA A;  3ISP A;  4NC7 A;  4E7K A;  3KP2 A;  2L4A A;  4UVA A;  3GTG J;  5LGT A;  3L00 A;  3O2P E;  1T2K A;  1U5T A;  2LY1 A;  3WGH A;  2L02 A;  2I10 A;  3MN2 A;  3OL4 A;  4AWX B;  4L9N A;  4BNC A;  3L09 A;  2E34 A;  5FFZ A;  4U7D A;  2X9D A;  4B3A A;  4EM1 A;  1JKR C;  4LG0 B;  3CP2 A;  3LSH A;  3TW6 A;  2VON A;  1W36 D;  2LVS A;  4BBR J;  3JSP A;  1WI9 A;  2BZT A;  4RGX A;  4EVI A;  4IZZ A;  4WX9 A;  4D5F A;  2CQX A;  1DPU A;  1FPQ A;  2KIS A;  3N05 A;  4LJZ F;  3GZ5 A;  2EIK H;  2JTV A;  2PJR A;  4HV6 A;  4BAY A;  3M8E A;  1HKS A;  1FYL A;  1T95 A;  2IGN A;  2KZV A;  2FML A;  3BP8 A;  3I59 B;  3ABU A;  2L2O A;  1UHW A;  4D7N A;  1D1B A;  1ETK A;  1Y8Q B;  5LLQ A;  4MQ9 F;  2VQL A;  3OOU A;  3ZQ7 A;  1HW5 A;  1BM9 A;  1DP7 P;  2MLG A;  2VXD A;  2RN7 A;  2CUZ A;  1HF0 A;  2M7B A;  1A5J A;  1ZN2 A;  1XS9 A;  3TO6 A;  3HRM A;  2LC2 A;  5CJ9 A;  2OZU A;  3FWE A;  1OIS A;  3IKT A;  4CHU A;  2XSD C;  2DMQ A;  5EYR A;  4E7I A;  3ECH A;  1P6R A;  1QRY A;  5M5Y J;  1W7P A;  2A3S A;  4LIV A;  5FKO A;  5KAI C;  2OBP A;  4IRG A;  3MKY B;  3CMY A;  4HX8 A;  5M3F J;  4X1E A;  2IXS A;  4FQG A;  1VQ8 I;  5KCM A;  3QPT A;  1HSJ A;  4D5C A;  3LOC A;  2JRT A;  2FQ3 A;  1HOM A;  4ZZD A;  5CVU A;  3GFL A;  2JN6 A;  1WZ2 A;  2L7M P;  2XAG A;  4LOC A;  4E7J A;  2VB6 A;  2VJI A;  4EJV A;  1XB4 A;  3JRE A;  1SFE A;  3IHU A;  4EJU A;  1VQ6 I;  3Q3S A;  3G71 I;  1XSV A;  2EZK A;  1FX7 A;  1YYV A;  2HXO A;  3PUF A;  5L3F A;  1BN5 A;  4RAY A;  5DDG A;  1ZAR A;  4B48 A;  2OQR A;  3BQZ A;  1TWH J;  4ZYH A;  1BR2 A;  1SAX A;  4A69 C;  1P2F A;  4GYI A;  3MEX A;  4L18 B;  1MIJ A;  2WA0 A;  3KEY A;  2VOO A;  1EH7 A;  4P9F A;  3OYD A;  4PJJ A;  4M3D A;  5LGN A;  1X1B A;  1YIJ I;  1QZZ A;  1S7A A;  1W7P D;  1W4M A;  5L3E A;  4UNO A;  2MC3 A;  1ZR4 A;  2HPM A;  2XF5 A;  3SFI A;  3MZH A;  3E1S A;  3L1P A;  2ISY A;  1NG7 A;  1X3Z B;  4XLH A;  1YW8 A;  1R4M B;  3Q0W A;  5LHG A;  1TWA J;  3MWM A;  3PM1 A;  1N78 A;  4PDK A;  3FIW A;  2JPC A;  3WTU C;  2QQA A;  2F5F A;  2KFD A;  2LOO A;  1K4S A;  1VQ9 I;  1T56 A;  1LB2 A;  4RAZ A;  4NNJ A;  2XV4 S;  3CCL I;  2JZY A;  2X48 A;  2OJE D;  5TRD A;  2JT1 A;  3DTK A;  3ROU A;  4XKC A;  5LRS A;  3EUA A;  4BAC A;  1VQ4 I;  2I5U A;  2QEX I;  2LLK A;  2V9V A;  3C7J A;  5JHU A;  3CTA A;  3DU5 A;  3V7S A;  2B7E A;  5E1Z B;  2NVU B;  1BOA A;  3QOD A;  1QVT A;  2DQR A;  4LB6 B;  3WE3 A;  3BCA A;  1MJA A;  5FRN A;  2WY7 Q;  1LE8 B;  4ESJ A;  4A3G J;  3BR1 A;  2VQH A;  3BLY A;  4ZYA A;  4JQF A;  2COM A;  2LH9 A;  3CMM A;  1S8N A;  2ZB9 A;  3KPH A;  4U0W A;  4HPQ A;  2H1K A;  3SJM A;  2ICW G;  3H5R A;  4N4N B;  4UY8 I;  5J4Y A;  1TLH B;  2RV8 A;  2BYV E;  2Z33 A;  4LK1 F;  3PQJ A;  5TIS C;  1Y8R B;  2BY1 A;  3PFY A;  1OCR H;  2LYC A;  4PJL A;  1VND A;  5E79 C;  3TL4 X;  5JHF A;  1A6I A;  5ED4 A;  3E7L A;  2XHK A;  3HXL A;  4IJA A;  2Z99 A;  4EEF G;  3FHZ A;  1R49 A;  2K9Q A;  2GWR A;  4MO7 A;  3FXQ A;  2XSJ C;  1JUM A;  3K0L A;  4BJ6 C;  3E5Q A;  2NOG A;  2DW4 A;  3ZGK A;  2WAQ A;  2TDX A;  2FE3 A;  3B73 A;  2FU4 A;  3LSM A;  5EJC A;  4LIT A;  4CCJ A;  1FOY A;  3K4L A;  2UZK A;  4IHT A;  1U2W A;  1TQI A;  5LFA A;  1OJL A;  2KRC A;  2QF7 A;  4O6J A;  2EFW A;  5C4X J;  2GA2 A;  3V8L A;  2HWV A;  4BH9 A;  5GTH C;  4BHB A;  5M5W J;  2K85 A;  3SZP A;  4BDZ A;  1HC8 A;  2O03 A;  3K4B A;  2VQG A;  5LEJ A;  1GHC A;  4OMY A;  2Y0S N;  4ZZL A;  4W97 A;  2CQK A;  1H0M A;  3A0B C;  2PJP A;  3DLL F;  4ITV A;  2NNN A;  3MMY B;  1YJN I;  4PCQ A;  3TQN A;  2DFH A;  2VOP A;  4ENJ A;  1GVD A;  2K9N A;  1ZRF A;  3FMS A;  2ZME A;  2K9S A;  3P7N A;  5EEH A;  2QEN A;  4WXD A;  1OR7 C;  3ZMU A;  3H5A A; 
#chains in the Genus database with same CATH homology
 2P6S A;  2E1N A;  5D5W B;  4ENK A;  2K4J A;  2HR3 A;  4A6D A;  4U0V A;  4DNC A;  4IRI A;  2QWW A;  2XKP A;  2EK5 A;  2PI0 A;  1IN7 A;  1QBJ A;  4LD5 A;  3ABT A;  4N9H A;  3ULQ B;  1YQA A;  2VN2 A;  3DF8 A;  2NAZ A;  2HKX A;  4Q47 A;  1IN6 A;  1S6L A;  2EA2 A;  3EDP A;  4UUV A;  3KLO A;  4NQW A;  4HAM A;  2STT A;  4WF2 A;  3ZMD A;  2P4W A;  2IT0 A;  5E20 A;  5HLH A;  3NRV A;  4KDP A;  3MAJ A;  4EQQ A;  2Y48 A;  3HRS A;  2RKH A;  1WQ2 A;  2KJC A;  1H9G A;  2P5V A;  3ZMZ A;  2HYG D;  3E6B A;  2O3F A;  3C18 A;  5F64 A;  4YII A;  1BJA A;  1KU2 A;  4NB5 A;  3IKV A;  2YX4 A;  4CDG A;  1R58 A;  3BRO A;  4KN7 X;  2IA0 A;  2CG4 A;  1R1U A;  2OAZ A;  3RKX A;  1ZG1 A;  4HF2 A;  2E7W A;  4KMU X;  3FZV A;  1D5V A;  1KQ8 A;  3I71 A;  4GGG A;  4Q48 A;  2FBH A;  2D45 A;  1W5T A;  3BZ6 A;  2GQQ A;  4LMY A;  3GXO A;  2L3D A;  1IRG A;  1XN7 A;  2DLL A;  1R5H A;  3ELK A;  3G3Z A;  2ZKZ A;  5D4S A;  2V6C A;  3CJN A;  1LJ9 A;  1PP8 F;  2XAS A;  2QUF A;  2V1U A;  4B09 A;  4FHT A;  3V7R A;  4L5I A;  1SMT A;  3WTX C;  4Y15 A;  5FO5 A;  1K7A A;  2ZXJ A;  3E5X A;  2DQL A;  3L9F A;  3J80 Z;  1XGM A;  3VEP A;  1J2X A;  3S2W A;  5FGM A;  2CFX A;  4S04 A;  1B9M A;  4OOI A;  3WU0 A;  2H6C A;  3SHF A;  1LNW A;  2BBY A;  2DK5 A;  4HV5 A;  1XSD A;  4KT5 C;  4HQE A;  2M1B A;  1LDJ A;  2QM3 A;  3LFK A;  1AWC A;  3HIF A;  3OV8 A;  3HHG A;  4RB2 C;  4YFK F;  3KP7 A;  1L3L A;  3RI4 A;  3E6C C;  3FX3 A;  3MFK A;  5CVR A;  1B4A A;  2FA5 A;  1K79 A;  2FBK A;  3GVA A;  1DPR A;  1MKM A;  5DV5 A;  4I02 A;  1WWX A;  3WG9 A;  2EB7 A;  1G4D A;  4HZF A;  2IPQ X;  1V4R A;  4RS8 A;  4U88 A;  2A07 F;  2GIV A;  1QGP A;  2K02 A;  3DQV C;  2H6B A;  1TQM A;  1PDN C;  2VBW A;  1P4W A;  2BGC A;  1NHA A;  1Z05 A;  4MTE A;  3R0J A;  5LHI A;  4M9X A;  1ZGJ A;  3WTW C;  5D4R A;  5DYM A;  2AS5 F;  4OIO F;  3BJA A;  1G3Y A;  1FBQ A;  1ZRC A;  1J0R A;  3O3K A;  3JAM Z;  3DPT A;  1MJ9 A;  5JI6 A;  5J8F A;  4LB5 A;  1RUO A;  4LLN A;  1Y0U A;  4KIB A;  3VOE A;  3VOD A;  4PGG A;  4U7B A;  4EJW A;  1F4K A;  1IXS B;  4GCV A;  4YFN F;  1IZ1 A;  1Z91 A;  2YSR A;  4HX4 A;  3DXJ F;  1I6X A;  1FC3 A;  3HHH A;  5TJJ A;  2HTS A;  2Q2E A;  3DFG A;  2GZW A;  1UST A;  4CIC A;  3I4P A;  3Q9V A;  1F5T A;  3QU3 A;  2HKO A;  1R23 A;  3I5U A;  3KP4 A;  1U3E M;  4MEY F;  2DPD A;  1KU9 A;  4AIJ A;  5L3B A;  3EUH A;  1S7O A;  5HVQ C;  1FBU A;  4O3M A;  3DP7 A;  1YS6 A;  2Q8K A;  3LA2 A;  5E1W A;  4A2U A;  2G9W A;  2K4B A;  2FBI A;  4UVB A;  5F1R A;  2F5D A;  2M5W A;  1GXP A;  1XDU A;  4OIQ F;  2EV0 A;  1C0W A;  1RZ4 A;  1F9N A;  4BHC A;  2O8X A;  5E17 F;  2VE9 A;  2FNP A;  3BWG A;  1R5G A;  3JTG A;  1OPC A;  3JTH A;  4CGZ A;  4HW0 A;  4M71 A;  4DQ2 A;  4EGZ A;  2OD5 A;  1UHM A;  1U6G A;  1U78 A;  5JR3 A;  2EFP A;  3L7W A;  2VT2 A;  4OIN F;  1MJB A;  1HXD A;  3HRU A;  2W25 A;  1T6S A;  3O6B B;  5HS8 A;  1YTY A;  4I01 A;  1TW2 A;  2EV6 A;  4OMZ A;  1ZLJ A;  3ERE D;  1E17 A;  5K5O A;  1XGS A;  5E1X A;  4TV7 A;  4KIG A;  3RDI A;  4UXN A;  4I98 B;  1T39 A;  4KNY A;  2DBB A;  3AAF A;  5KVR A;  3V4G A;  4RB3 C;  3ZN0 A;  4I2O A;  2WWY A;  2P5K A;  1EV7 A;  3GW2 A;  4G6Q A;  4G7O F;  1FY7 A;  3FM3 A;  1JHF A;  1J59 A;  3KP5 A;  2O6G E;  1I1G A;  1Q1H A;  5BQT A;  1J75 A;  1JGS A;  2RGV A;  2JPB A;  4I0B A;  1FP2 A;  3WU1 B;  2EWN A;  1IRF A;  2MD5 A;  2VXZ A;  3ECO A;  2Z5U A;  2ESN A;  3F8C A;  1SFU A;  3K9T A;  5LHH A;  1ZG5 A;  1G3S A;  3GUD A;  2UXX A;  4A6E A;  3F6V A;  1R00 A;  2RQP A;  2LNB A;  3PQK A;  3ZPL A;  1SD5 A;  3RPU A;  1XDS A;  3D0S A;  1GVJ A;  2R3S A;  3NEU A;  4OIP F;  1UFM A;  1R7J A;  2GXG A;  4L9T A;  2ZJ2 A;  1PP7 U;  2O0Y A;  1Z1D A;  4KFC A;  2Z9O A;  1IN4 A;  3FM5 A;  1HKQ A;  3RJP A;  4IF4 A;  5HDG A;  1LDK B;  1KU3 A;  4ZH4 F;  1Z7U A;  5BPI A;  4LFU A;  5ICF A;  5CYV A;  3K1N A;  2DI3 A;  5ILV A;  4FX0 A;  1HW2 A;  2KIF A;  4I0A A;  1D3Y A;  1R36 A;  1ON2 A;  4U0Y A;  4EMS A;  4G94 A;  1QPM A;  2GXB A;  3LST A;  2KIU A;  2W85 A;  2FRH A;  1ZYR F;  5ICE A;  1YW9 A;  3R60 A;  2W24 A;  1IXR C;  5HDN A;  1ZAO A;  1RNL A;  3GYH X;  3C1D A;  2QYO A;  4D0P A;  4XSX F;  3HTU A;  3WGG A;  2G7U A;  3TO7 A;  1KYW A;  2VBZ A;  1GXQ A;  5ICC A;  2A61 A;  4UV9 A;  1S3J A;  2XRN A;  3BJ6 A;  2OA4 A;  1I1S A;  4XSZ F;  3EET A;  5LEK A;  1IN8 A;  1MGT A;  4EM0 B;  2O61 A;  2W57 A;  4WCG A;  3QPH A;  5IT9 Z;  1I27 A;  3LWF A;  2EV5 A;  5HLI A;  4I09 A;  1XGO A;  1FYK A;  3I53 A;  1L0O C;  2HGC A;  3K69 A;  1WSU A;  3KEO A;  1U5T C;  5K5Q A;  1FLI A;  1O57 A;  3RKY A;  3E97 A;  5J6X A;  1YO5 C;  1P4A A;  2F2E A;  3WGI A;  3DKW A;  4AVP A;  1BI2 A;  5DEQ A;  3F72 A;  5FLX K;  2VC0 A;  2MH2 A;  1R1V A;  2WC2 A;  2WV0 A;  1FWZ A;  4YFX F;  3RPQ A;  3I0T A;  5HLG A;  5D5U B;  3J80 K;  3GEZ A;  1DDN A;  4FX4 A;  1K78 A;  3WE2 A;  4M9S A;  2ESH A;  2JSC A;  3QOP A;  1AOY A;  1YS7 A;  2H94 A;  2X4H A;  1SMY F;  1ZHF A;  5D8K B;  1BIB A;  4L0Z B;  3GX4 X;  4AIK A;  4ENN A;  1P4X A;  2L54 A;  5ILU A;  1DUX C;  3ZN1 A;  4Y13 A;  2P5L C;  2VE8 A;  1OKR A;  2HTJ A;  1U5T B;  2VBY A;  3I59 A;  2V79 A;  2K7L A;  1HBX G;  1WRJ A;  5HS9 A;  3WOD F;  1TNS A;  1BC8 C;  2XUB A;  4E70 A;  4UVC A;  2BEO A;  1UCR A;  3M8F A;  3KLN A;  5DD4 A;  5H6Q A;  2ISZ A;  1W5S A;  1WKM A;  1BIA A;  3K1M A;  3KFW X;  3CUQ A;  4P55 A;  2DT5 A;  3T5X A;  3N4M A;  1QO0 D;  5IT3 A;  3KZY A;  3I64 A;  1ZLK A;  4HA8 A;  2F5E A;  3IL2 A;  5A2Q K;  3T0Y A;  4HQM A;  2VBX A;  3R4K A;  4HF1 A;  5J8C A;  2K86 A;  3P9K A;  5JFR A;  4HLY A;  3HSF A;  1ZRE A;  2HOE A;  3ZMV A;  1J9I A;  4ON0 A;  5IT9 K;  3K1P A;  4LGW A;  1FT9 A;  4EGY A;  4LK0 F;  1QNT A;  1SD4 A;  5D5V B;  1EH6 A;  3HOS A;  4HDU A;  2QZ8 A;  3JSO A;  1B9N A;  3RTR A;  4Z2Y A;  5DCF A;  1XGN A;  4IRH A;  2CYY A;  3MQ0 A;  2DPU A;  1D8K A;  3KP3 A;  3E3V A;  2M30 A;  4MEX F;  1ODD A;  2FNA A;  1VTN C;  2M45 A;  1XD7 A;  1XMK A;  2DTR A;  1XMA A;  3V8J A;  1G3W A;  2LDU A;  4M9Z A;  3E6D A;  2GA1 A;  3TO9 A;  5H20 A;  1RUN A;  3I58 A;  4NHJ A;  1RI7 A;  3WTT C;  3IWZ A;  4AIH A;  3KET A;  2LKP A;  3HOT A;  2IVM A;  6PAX A;  1S29 A;  1K78 B;  3BOQ A;  1RIO H;  3F8N A;  1REP C;  2LF7 A;  1ZH5 A;  5BS6 A;  4P5O A;  4L5J A;  3J7A O;  1FP1 D;  1Z6T A;  4ZYE A;  2YX7 A;  4BXU A;  4ZYD A;  1TTY A;  4A0Y A;  1J7K A;  2ZFW A;  3P9I A;  5JVT A;  3H3U A;  3HUG A;  5BMZ A;  3ML6 A;  2HZT A;  3TDZ C;  1BBY A;  1ZG3 A;  2L01 A;  3F22 A;  3IRR A;  4MHG A;  1ULY A;  3F23 A;  3RIR A;  2X0L A;  3E6M A;  1FBS A;  3KZZ A;  4WWC A;  3SFZ A;  3JW4 A;  2WTE A;  1BC7 C;  3GO5 A;  4KN4 X;  1QZY A;  4G7Z F;  5HDK A;  2RVC A;  1W7P B;  3G73 A;  3QAH A;  4OIR F;  3BJO A;  4QWQ A;  2J5P A;  2BE5 F;  2RDP A;  2HFH A;  1K6O A;  3HRT A;  3W6J B;  3MZY A;  2D2W A;  1BI1 A;  4A5N A;  1B1B A;  4GYG A;  4ENM A;  5ICG A;  1MD0 A;  1IF1 A;  1FYM A;  3DPL C;  3F6O A;  1G6N A;  2OZ6 A;  3V7C A;  5H6R A;  1I5Z A;  4HX7 A;  2A6E F;  4MTD A;  1LDD A;  1E2X A;  2CWE A;  5CLS A;  1P92 A;  1IN5 A;  2D1V A;  5D6F A;  4BYY A;  3Q9S A;  1X3U A;  1OYW A;  4RGS A;  2PG4 A;  5FD5 A;  2MH9 A;  2A68 F;  2A6H F;  1KGS A;  1CGP A;  3Q5F A;  4B8X A;  3FF5 A;  2XAJ A;  3NQO A;  4R1H A;  1UB9 A;  3F8M A;  4UV8 A;  3VB2 A;  3IWF A;  1TQP A;  4HF0 A;  2QBY B;  3T1B A;  2YPR A;  1HST A;  1O3Q A;  1KQ9 A;  1T98 A;  4XLN F;  5ERI A;  4EM2 A;  3RYP A;  4Q5S F;  3CO7 C;  4XBF A;  1ZGA A;  1Z9C A;  2W84 A;  2AXL A;  2Z3Y A;  4JK1 X;  2K27 A;  3PFI A;  2HQN A;  2IRF G;  4P9U A;  3F3X A;  2FSW A;  5FLX Z;  3CUQ C;  2Y0M A;  5CVJ A;  1ON1 A;  2E7X A;  3QP6 A;  2VC1 A;  1IXC A;  2EFQ A;  4BHP A;  1OYY A;  1YIO A;  1O7L A;  3LA7 A;  3VFZ A;  4LLL A;  3BDD A;  2OQG A;  2XVC A;  4RGR A;  2XRO A;  2QQ9 A;  4ASN A;  2DO7 A;  1FNN A;  3WTV C;  3U9G A;  5D5X B;  1B59 A;  1OR7 A;  4RB0 A;  4Y17 A;  3E5U A;  2STW A;  4HYE A;  3HTS B;  4N9I A;  4RGU A;  3RYR A;  1D8J A;  3H92 A;  2EFN A;  2A69 F;  5LBQ A;  4LG0 A;  2Q0O A;  3MCZ A;  4EJO A;  1YG2 A;  2A5Y B;  2IA2 A;  4ESB A;  2NNY A;  4G8X A;  2G7H A;  3COA C;  2L4M A;  1H9T A;  4A0X A;  1KQ0 A;  2IA1 A;  4LLG F;  3HSE A;  2HDC A;  5EEG A;  1F1Z A;  2XAQ A;  2YU3 A;  1ZRD A;  4IXA A;  2HYF A;  1QQI A;  2XAH A;  1YW7 A;  3TGN A;  1CF7 B;  4L9J A;  3RKW A;  5CVI A;  2E1C A;  1HKT A;  4HLX A;  1MZB A;  4ETS A;  2M8E A;  3KP6 A;  2R7D A;  3OOP A;  3C3W A;  3WTY C;  3J81 Z;  4M73 A;  3DV8 A;  2YR2 A;  1BI3 A;  5AIP A;  1LVA A;  3GFM A;  4HDV A;  3FXU A;  2PLY A;  3SQN A;  3DEU A;  3HSR A;  3BPX A;  4A0Z A;  4L0Y B;  2F5C A;  1J5Y A;  2PMH A;  2FMY A;  5L3C A;  1KYZ A;  1O7F A;  2QBY A;  1R22 A;  3QU6 A;  1R1T A;  1HW1 A;  2ZCW A;  4GXO A;  1STZ A;  1FOK A;  4KA4 A;  3K2Z A;  4FT8 A;  4EV0 A;  4CYD A;  2V1X A;  4IVN A;  2PFB A;  4PGH A;  5E8G A;  3REO A;  2IP2 A;  4YIF A;  4KYW A;  3GWZ A;  1SD7 A;  3U1D A;  5LRR A;  3TDU C;  3R61 A;  1LEB A;  1TW3 A;  3F8B A;  2IW5 A;  3FMR A;  3EYI A;  2PEX A;  1MDM A;  4KUM A;  2FF4 A;  2VT3 A;  3KCC A;  2DK8 A;  4MNU A;  1FZP B;  4M72 A;  4IHS A;  3IRQ A;  5LGU A;  3SZT A;  2VOD A;  4P96 A;  4UHT A;  3CLO A;  4QLC U;  4M74 A;  1MDM B;  2OU2 A;  1FSH A;  1LEA A;  5CVV A;  4G6D A;  2ACJ A;  3KEQ A;  1HQC A;  2PN6 A;  3QRF F;  3LQQ A;  4A12 A;  3QP5 A;  4HBL A;  3W6K B;  1V3F A;  1TNT A;  3CUQ B;  2LSO A;  2PBI A;  4R8H A;  2MBF A;  4JBA A;  1JHH A;  1SFX A;  4OU0 A;  4M6X A;  2M87 A;  4CZZ A;  3FXR A;  2EA4 A;  3CUO A;  5DCM B;  2FEZ A;  4GO1 A;  1A04 A;  3HYI A;  2H09 A;  3BPV A;  5FFX A;  2EFO A;  2ZNZ A;  3T8R A;  1IUY A;  1B6A A;  3P9C A;  5L3D A;  4G9Y A;  3V8K A;  1O3S A;  4HOB A;  5FD6 A;  4F7Z A;  1U8R A;  3TOB A;  2PQ8 A;  4ZYG A;  1OYI A;  1O3R A;  2ADU A;  1FSE A;  2XKO A;  3SXY A;  2KJB A;  4WXH A;  3F21 A;  2DAO A;  5BOX A;  4YG2 F;  2HQR A;  5DCM A;  4CXF A;  1T0F A;  5AON A;  3B02 A;  1CF7 A;  2KKO A;  4KIC A;  1EH8 A;  4K2E A;  1YLF A;  3GFJ A;  4AD9 A;  3T8T A;  4IPA A;  3R0A A;  4L9V A;  1XCB A;  3ZMS A;  5FB2 A;  4KMF A;  1ONV A;  3M1E A;  3JAM K;  3M7G A;  3CDH A;  4S05 A;  1IAW A;  3LA3 A;  3ZP5 A;  4CO8 A;  2ZBK A;  5A2Q Z;  1T38 A;  2ELH A;  2B0L A;  2CO5 A;  5KK1 A;  2IJL A;  5L3G A;  3KE2 A;  1TBX A;  3CO6 C;  5K1Y A;  1JXS A;  5BPD A;  1OMI A;  2UXN A;  5AIQ A;  3J81 K;  4WK8 F;  3WTS C;  2CSO A;  5F6F A;  2HS5 A;  2CW0 F;  5HOO A;  4G7H F;  1XCV A;  2ZNY A;  4WXC A;  2PMU A;  3H3Z A;  2RNJ A;  3R6S A;  2MLK A;  2DU9 A;  2FOK A;  2ZME B;  2V1D A;  2KIM A;  4R79 A;  4BQA A;  4RB1 A;  2NRA C;  2GAU A;  2MA3 A;  2J5O A;  1JE8 A;  5DD8 A;  2Y75 A;  2BV6 A;  5E18 F;  2P7V B;  4XLP F;  5ILS A;  2HEO A;  1YFH A;  3N97 A;  3ZMT A;  5DUI A;  3EQL F;  5HS7 A;  3IC7 A;  4ESF A;  2KRF A;  2NYX A;  1O3T A;  2LF8 A;  4N0B A;  2UWM A;  3D5L A;  4KIF A;  2XAF A;  4MGR A;  4EJT A;  3GF2 A;  5D6E A;  1SD6 A;  5DUK A;  3WTZ A;  5D8L B;  4I7H A;  2P6T A;  4A5M A;  5E8I A;  4M6Y A;  4Q4Z F;  4PZJ A;  2EJR A;  4XRF A;  1USS A;  4H0E A;  2QLZ A;  5K5R A;  3TKY A;  3I54 A;  2R7F A;  1IW7 F;  2DFI A;  3L2C A;  1XSX A;  1KA8 A;  4MQV A;  2D1H A;  3LAP A;  3BY6 A;  3M9A A;  3U2R A;  3F8F A;  2P8T A;  1Z6R A;  2QVO A;  2RC4 A;  1BI0 A;  2ZO4 A;  2ETH A;  3GLX A;  2XIG A;  1LQ1 A;  3LAJ A;  3EYY A;  2FXA A;  3LQR A;  1PUE E;  3GFI A;  2NS0 A;  2C6Y A;  3GZ6 A;  2XGX A;  2H27 A;  2P7C B;  2CGP A;  2QQB A;  3FMQ A;  1G3T A;  1KU7 A;  4O5V A;  3TOA A;  3ISP A;  3KP2 A;  2L4A A;  4UVA A;  5LGT A;  3L00 A;  3O2P E;  1T2K A;  1U5T A;  3WGH A;  2L02 A;  4AWX B;  4L9N A;  4BNC A;  3L09 A;  5FFZ A;  4U7D A;  4EM1 A;  4LG0 B;  2VON A;  3JSP A;  1WI9 A;  4RGX A;  4EVI A;  4WX9 A;  1DPU A;  1FPQ A;  4LJZ F;  3GZ5 A;  2JTV A;  4HV6 A;  4BAY A;  3M8E A;  1HKS A;  1FYL A;  3BP8 A;  2FML A;  3I59 B;  3ABU A;  1UHW A;  5LLQ A;  4MQ9 F;  3ZQ7 A;  1HW5 A;  1BM9 A;  1DP7 P;  2MLG A;  2RN7 A;  1ZN2 A;  3TO6 A;  3HRM A;  5CJ9 A;  2OZU A;  3FWE A;  3IKT A;  4CHU A;  3ECH A;  1P6R A;  1W7P A;  2A3S A;  2OBP A;  4IRG A;  4HX8 A;  3QPT A;  1HSJ A;  2JRT A;  2FQ3 A;  4ZZD A;  5CVU A;  3GFL A;  2XAG A;  4EJV A;  1XB4 A;  1SFE A;  3IHU A;  4EJU A;  1XSV A;  1FX7 A;  1YYV A;  5L3F A;  1BN5 A;  4RAY A;  5DDG A;  1ZAR A;  2OQR A;  4ZYH A;  1SAX A;  1P2F A;  4GYI A;  3MEX A;  4L18 B;  2VOO A;  1EH7 A;  4P9F A;  5LGN A;  1QZZ A;  1S7A A;  1W7P D;  1W4M A;  5L3E A;  4UNO A;  2MC3 A;  3MZH A;  2ISY A;  1YW8 A;  5LHG A;  3MWM A;  4PDK A;  2JPC A;  3WTU C;  2QQA A;  2F5F A;  1LB2 A;  4RAZ A;  2XV4 S;  2JZY A;  5TRD A;  2JT1 A;  3ROU A;  5LRS A;  2V9V A;  5JHU A;  3C7J A;  3CTA A;  3V7S A;  5E1Z B;  1BOA A;  2DQR A;  4LB6 B;  3WE3 A;  1MJA A;  4ESJ A;  4JQF A;  2COM A;  1S8N A;  4U0W A;  1TLH B;  2RV8 A;  2BYV E;  2Z33 A;  4LK1 F;  3PQJ A;  5ED4 A;  2XHK A;  4IJA A;  2Z99 A;  3FHZ A;  2GWR A;  3FXQ A;  3K0L A;  3E5Q A;  2DW4 A;  2TDX A;  2FE3 A;  3B73 A;  2FU4 A;  2UZK A;  4IHT A;  1TQI A;  1U2W A;  4O6J A;  2EFW A;  2GA2 A;  3V8L A;  2HWV A;  4BH9 A;  4BHB A;  3SZP A;  2O03 A;  5LEJ A;  1GHC A;  4OMY A;  4ZZL A;  2CQK A;  1H0M A;  2PJP A;  2NNN A;  4PCQ A;  3TQN A;  2VOP A;  4ENJ A;  1ZRF A;  3FMS A;  2ZME A;  3P7N A;  5EEH A;  2QEN A;  4WXD A;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...