2LKSA

Ff11-60
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-processing factor 40 homolog A
publication title Cross-Validation of the Structure of a Transiently Formed and Low Populated FF Domain Folding Intermediate Determined by Relaxation Dispersion NMR and CS-Rosetta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2lksA00
2CQNA 2K85A 2KZGA 2DOEA 2L9VA 2DOFA 2JUCA 1UZCA 2E71A 4FQGA 2KFDA 2KIQA 2B7EA 2LKSA 2DODA 2KISA
chains in the Genus database with same CATH superfamily
3HL2A 3W6JB 2XUBA 4C3JJ 3CCRI 3JRIA 2XF5A 4IOAF 1YYVA 2DOFA 4A12A 5C44J 2W48A 4B47A 2PI0A 1E17A 1XGNA 4F91B 2WAQA 3I64A 2ZB9A 3G6EI 4ENJA 2QKLB 1MBJA 2Q0OA 3R6SA 5GAGJ 3LQRA 2Z33A 1ZLJA 1JE8A 2A3SA 3GVAA 2DYRH 1UZCA 2ZXWH 4LB5A 4XKVA 1EKEA 5FJ8J 3T1BA 3ONQA 2EZKA 2K9SA 2IW5A 1OCZH 1R22A 3TGNA 5LGTA 4XLAA 1IDYA 1ZKGA 1MNDA 1OJLA 4NBQA 3HSEA 2IEKA 3J81K 2FJ1A 2YUSA 1LUJB 4HNTA 1ZR2A 2AHQA 3I56I 4KJZA 4KT6A 3KX2A 3GW2A 1SANA 1SMYF 3DPTA 1U9NA 2DMQA 4V19K 3KP4A 2DMTA 4HLXA 3RPQA 1A6QA 2WTEA 3IL2A 1LVAA 4GRIA 4HYEA 4DNCA 1VQ4I 3SDGA 4CCLA 1G3SA 1GT0C 1BN5A 1IN4A 3QOPA 4JBAA 3S32A 2QQ8A 1B72A 2E7XA 2K02A 3J80Z 2M4KA 1APLC 2CV0A 2FE3A 4AU7A 1RETA 1J2XA 3OS1A 4L9VA 4XLCA 4FASD 1KU2A 2VUMJ 4PJNA 1WH7A 3FMRA 1WJDA 2OU2A 2ETHA 2HDCA 4HBLA 3A03A 3PNVA 1I1GA 2Z16A 2VODA 3M3YJ 2F4MB 2BXYA 1EH6A 1W1WE 2YX4A 1YJ9I 3IKVA 2FBHA 4Y17A 1MBHA 2VT2A 1O3RA 1B8IB 3DQVC 1H89C 2HPMA 1W7PB 4MFDA 2E2HJ 4BQQA 4A3MJ 1REPC 2FOKA 2X9DA 2WY7Q 2K9MA 3ASNH 1HBXG 1Y0NA 3JRAA 1K83J 2FNAA 4BXUA 2XAQA 1M1EB 1D0XA 4BKXA 1VQ7I 2X51A 3BQYA 2M87A 3PQJA 5M3FJ 1HW5A 4QPQA 2QSHX 4NB5A 2DPUA 4L5IA 1ZGJA 1XDUA 5BPDA 2WAFA 2QUFA 2ELHA 1C0WA 3GWZA 3DV8A 4KIGA 3BG9A 1K4TA 4R79A 2IS1A 2UXNA 3HHHA 2CUFA 4PFPA 3HOVJ 1ZYRF 3J7AY 2Y31A 4BHBA 2M34A 4M6XA 1MIJA 2L02A 2JVGA 3HZJA 5CVIA 3SHFA 1HW2A 1JUMA 4A3BJ 2RQPA 1MW7A 1FY7A 1ZQ3P 1K78B 1K4SA 3LSRA 3PM1A 3DKXA 3I4MJ 1SD4A 2JA5J 2MD0A 1AKHB 3KP6A 2L01A 2ISYA 2EH3A 5E8GA 5BS6A 2YU9J 2FD5A 3KETA 2LRDA 4W97A 2CMPA 4DJAA 3WE2A 3OYJA 3RKQA 3MD2A 4LJZF 4LLNA 4OIPF 5E3OA 1BM9A 3HJEA 4RS8A 4HX8A 2WBMA 4RMNA 2EFOA 2K40A 3H9GA 1S8NA 4PSXA 4M6YA 4EMSA 1L3LA 4XONA 5ICCA 5GPAA 3FF5A 2FBIA 2IVMA 3F6VA 4J19A 1OQYA 2LY9A 3OYNA 3K0LA 3MZHA 3KEOA 2QKMB 1GHCA 1HW1A 2EIJH 3G4SI 2F2EA 1FTZA 2X4HA 2B9SA 3ZN1A 1FP2A 2B7EA 3H5NA 2L4AA 1R6RA 2DK8A 3OYEA 1MMGA 3BCBA 2E1MB 2Y9YA 3BC8A 2G9WA 1FZPB 3NAUA 4XLPF 3F0CA 1B8IA 4BE0A 4G7ZF 3MZYA 3LSGA 3JTHA 1KZHA 1X4PA 4H4KC 4F93B 1LEBA 3H92A 2FNPA 3R61A 4OIOF 2E35A 5IOYA 1GVJA 1WQ2A 4EGZA 4HAMA 4V2FA 3MWMA 2HGCA 1KGSA 1WJCA 1ZN2A 5IPAA 2XHKA 1MMAA 2M30A 5D5VB 1VQOI 1X2MA 4ZDPA 4A2UA 1S3JA 2XAJA 2DT7B 2I10A 2HQAA 1WKMA 2F5EA 2ZXJA 1LPQA 1YE9A 2ZMEC 2OD5A 2KMUA 4D5CA 1HXDA 4D7MA 3GTLJ 4XOPA 3E6DA 3FXKA 3CCVI 1TWGJ 1SVMA 2P4WA 3BG7A 4HQEA 5FRMA 2XVCA 2BY3A 3E5QA 5D8LB 3K4KA 1KU9A 4EM2A 1XPXA 5E1ZB 5EYRA 2AS5F 3MEXA 3L9FA 1MBGA 4Z2YA 3IHUA 3Q0UA 3E6CC 4LLLA 1DGRM 4PSWA 2OTJI 3MVPA 3HB9A 3SFIA 1S7EA 2GOXB 4XKBA 3OS2A 4HX4A 1J7KA 3OL3A 3A01B 2HTJA 2W25A 1Y56A 4BE1A 2M0CA 3WHCA 2XRLA 2OQGA 4B3AA 4E7KA 1NG6A 2X6YA 4ITVA 5HNFA 3OWTA 2DA6A 1AKHA 3GTKJ 3GTOJ 2XF6A 3Q3SA 3DKYA 2H94A 5FD6A 4LLGF 2QQBA 1XTAA 2VBXA 3VSKA 4Q5SF 3AG4H 1JGSA 2DMPA 3BR2A 4FE7A 2DFFA 2XKOA 5EF6A 3QPTA 3CJTB 1HQCA 5IT9Z 4KN7X 2GZWA 1S72I 4C2UA 3ZQCA 2KZVA 2P6TA 2IS4A 5JHUA 3V42A 2DFIA 4PJ0C 1JT6A 2BW3B 2A6EF 4A3EJ 3LA2A 2R4GA 3RZOJ 2VQGA 4RGUA 4LMYA 3D1NI 1D3YA 4DBQA 2W84A 4XLFA 5B1AH 3H3ZA 4BDZA 1YO5C 3RDIA 3NQOA 2E19A 1W36C 3OYAA 1R71A 9ANTA 2CGPA 1R1UA 4G7OF 3S15J 2DJIA 1E2XA 3CJNA 4X0GA 2K9QA 1OYYA 2R7RA 5BPIA 4FX4A 4IO9F 4MEXF 2RVCA 2R7QA 1N25A 5K1YA 4IQ4A 2DK5A 2LDUA 2WY8Q 2M4GA 1TQIA 3V8LA 2AXTC 2ZMEB 3LQQA 4Y15A 1LFBA 1JHHA 3DTIA 4GO1A 5GAEJ 2DXIA 4IOCF 1VQ9I 4FQGA 3WU0A 1XGOA 3H1CA 3EETA 3MKLA 1VQ6I 1V5GA 5EEHA 3BG3A 2QEXI 3KIOA 4BE2A 2RAEA 1JGGA 3KEQA 2X6WA 2E34A 2KZGA 3ZRGA 3TEDA 3BJAA 3E97A 4XSZF 3CCEI 2PJRB 3OMYA 3CCUI 4WWCA 1AU7A 3FXQA 3FMQA 1DPUA 1D1BA 1EV7A 3CMYA 1FMWA 2LD5A 1VTNC 2KJBA 1ETQA 1YG2A 2HXOA 5ILVA 4A3FJ 2BGCA 4IJAA 1MD0A 2A07F 2OF7A 3PFIA 2L2OA 1W5SA 1GLNA 3HOYJ 4A3DJ 2RNGA 2Z1DA 3GZ5A 4ESBA 3JRCA 2ID6A 4HQMA 2CU7A 2Z3YA 3VYRB 1ERDA 2W85A 3GZ6A 4II3A 3BROA 5HOOA 1MJAA 3S17J 2CQNA 2ZBKA 4A3GJ 5J6XA 3LA7A 4OOIA 2MH2A 4U7BA 1KYWA 3BJ6A 1YW7A 1YS7A 4I7HA 2IS6A 3A01A 2L5QA 3H0GJ 1LQ1A 3MAJA 4AWXB 4HSRA 4IHVA 2NVUB 1MNEA 2EIKH 1G59A 2MC3A 2NVXJ 5C4XJ 1J9IA 3ERED 5JHFA 4G9YA 2OA4A 2CFOA 3DU5A 1P92A 4XRSA 3CF5F 4RAGA 4LG0B 3R0AA 2HYGD 3EUAA 4HV5A 3AAFA 1EH7A 1RR8C 1HKSA 1IN8A 2GXBA 4MTDA 3QRFF 3A2KA 5M5WJ 3L2VA 3GTJJ 5EZHA 2DQRA 2Q2EB 3I4PA 4LB6B 2BW3A 2VQCA 3ZMZA 2K27A 2A68F 1WJAA 5TISC 1S9HA 4C3HJ 3DXJF 2IP2A 3TP3A 3FMSA 4WXDA 1Y1VJ 3UKGA 2CH0A 4G6DA 1YIJI 5DEQA 4A93J 4CICA 3GF2A 4KMFA 3GUDA 1G3WA 1YW8A 1U6GA 3DPUA 2DW4A 4Q4ZF 4L18B 2DTRA 3C2BA 2ZMEA 3OL4A 4EQQA 2NVYJ 4KICA 2H8RA 3ZMDA 2PMZN 2V79A 3ESWB 4A6EA 1IC8A 1YRNA 4XK4A 2Y9ZA 3KP2A 1ACIA 2R5YB 2KJCA 1TZLA 3RYRA 5HDKA 3JREA 2WV0A 3EDPA 3K9TA 4EM1A 3D5SC 4LOCA 4L9NA 5CVJA 4M9ZA 4B1RA 2DA4A 3NWSA 5E3LA 2JUGA 2OPTA 1JHFA 5B66C 3CC4I 6PAXA 5JVGF 2PJRA 1KQ0A 3N05A 5A2QZ 2P8TA 4U87A 1DDNA 1D5YA 2GLOA 1IRZA 3GCMA 2M3AA 1BI0A 4KITB 3ABKH 3HIFA 3I55I 3GTGJ 3FM5A 3RKYA 4G94A 5DDGA 1YJWI 4X6AJ 2IT0A 3V4GA 1VZ0A 1MSEC 2OQRA 4AIDA 1QZZA 2ZFUA 4KDPA 1QGPA 4IF4A 4RM2A 1TW2A 1BJAA 2K4BA 2VE9A 4JQFA 1R7JA 1RESA 1T08B 2M9HA 2DA2A 2KRFA 4RLQA 4GGGA 3CMMA 3B02A 1G3YA 3HYIA 3C18A 2JSPA 4L0ZB 3GFLA 4ENKA 4JOMA 1V5EA 3W2AA 3HKZA 2QSGX 2LLKA 3TO9A 3I9V2 2Y69H 2X48A 2R7ZJ 1TQMA 2HVSA 2MYSA 2IJLA 1FIAA 2X1EA 1S6LA 4LG0A 3J7YJ 3RKXA 1D8JA 1QNTA 2PEXA 2DU9A 3GXOA 2LKPA 1YHQI 2K3PA 5FKNA 5HLIA 5TJJA 2WV1A 1DP7P 2VB6A 5CKTA 3RPUD 3TOBA 4C2MJ 1H0MA 5ED4A 3TKYA 3JAMK 1BA5A 3D5LA 3K4JA 1UAAA 4J00A 1S7AA 4OINF 2WWYA 1LE8B 3L2RA 1TNTA 1T0FC 1F36A 3V7SA 3KCCA 1TQPA 2EWNA 2ZKZA 1UMQA 3BCAA 3WHBA 4C3IJ 2P6SA 1Z05A 4FE4A 3IRQA 1G2HA 5FB2A 1IN6A 2ZSIB 1F5TA 1R9TJ 1ZGAA 1BC8C 1ZARA 1O3TA 4OMZA 1MGTA 2I8DA 2VONA 3Q0WA 1E3PA 3SZGA 1CGPA 2OAZA 2JQ7A 2LC2A 1NK3P 1NK2P 3ZQIA 2BOLA 3CMEI 4EATA 5FROA 3AG1H 3HGGA 3CO7C 3ROUA 4M3BA 1U2WA 4HEA2 4XOTA 3O8HA 3LSTA 4PJJA 3AL0B 2R5YA 3D5RC 4UB6C 1ULYA 5E3NA 1FEXA 3RYPA 3S2HJ 1A31A 1X3UA 3OSFA 1WRJA 4E7ZA 4U0YA 3BOQA 3I0TA 4N4NB 5BMZA 2ELKA 1A5JA 1E3HA 2E7WA 3IP4B 3KPHA 5L3GA 3MQ0A 3ISPA 1Y8QB 3ZQQA 2EILH 5F04A 2AQEA 2NS7A 4HZFA 4G7HF 1H9TA 1TWCJ 4BU2A 1OMIA 3DEEA 1P7JA 3OOPA 3E1SA 4HF1A 2Z9OA 1I1SA 1Y39A 1OCOH 5M5YJ 5F6FA 1TTYA 2DBBA 4I0BA 4Y52J 3KLOA 2OC6A 1UCRA 2XPUA 1FIPA 1GVDA 2QF7A 4LK0F 1I5ZA 2BHZA 4AIJA 2JA6J 4DZPA 3CCSI 2ESHA 4RAYA 1FOKA 1FBQA 3EUKL 1P2FA 3BPVA 1KA8A 4XNFA 1OYIA 1BR4A 1I6XA 5L3CA 5GTIC 3S3MA 2V6EA 3HEFA 2H8WA 2A69F 1IN5A 1IXCA 2M8GX 2DOAA 3BZ6A 4M72A 3HRUA 3ZXSA 2O5RA 2QWWA 4CCNA 4YFKF 3M8EA 1UB9A 1Z3XA 3IH3A 4C2TA 2XAGA 4HX7A 2A05A 3Q0VA 1UHMA 2JZYA 4RAZA 2BXZA 2R3SA 3KFWX 1ZLKA 2MD5A 2XSJC 2XB0X 4BY7J 3HRMA 4XIDA 3PJRA 3F23A 3L2QA 1I3QJ 1ON1A 2J5PA 4I0AA 1GXQA 5IT3A 4RBOA 5CVRA 2BY2A 2BV6A 2XDVA 1JKRC 1V4RA 2CV1A 3GX4X 3CJRB 4A3IJ 4HF2A 1U0JA 3MFKA 2O7OA 1MBKA 1X3ZB 3HG9A 5F08A 2FMYA 2HFHA 4IVNA 2ZJQF 2MFZA 1LE8A 1TWHJ 2J5OA 2DFEA 5K5RA 1Q1VA 2F4IA 5L3DA 2F5DA 3WTWC 2MW8A 4DYRA 1O3QA 2DA5A 2AQFA 2EFPA 2WAEA 1LNWA 4C30A 1AA7A 3QPHA 1K6YA 1SVLA 2HYJA 4B3XA 3E6BA 1BIBA 4A0ZA 4RGSA 3TDUC 4CCKA 2GBYA 4E7JA 2YPRA 2E60A 4E70A 3WU1B 2KIFA 3BQZA 3VWBA 4KUMA 2LVSA 2XSDC 3QU3A 3CD6I 4UNOA 2FXAA 2K5CA 1ENHA 4LITA 3DLAA 2W00A 4ABZA 1OCPA 3LOCA 4WF2A 2VPLA 1Z1DA 1QPMA 3L2CA 1P4AA 2L9NA 3ERMA 5CQGA 3S2WA 4DYCA 2ZC2A 3C3WA 5FKMA 4D5FA 4ZYDA 4E7HA 1ZREA 1QA6A 1FLIA 1R5HA 1I50J 2P0WA 3F8CA 4M3DA 3KEYA 3CUQC 4DQ2A 1N77A 1Z6RA 2ZXIA 1P9QC 3H9JA 4NDLA 4IPAA 2NNYA 1Y0UA 5FGMA 1Z67A 3BPXA 1TBXA 2RN7A 3RCOA 3WTZA 3OY9A 1ETXA 5F1RA 2ME0A 4CYDA 3ZMSA 3FXMA 3A0BC 1OLTA 3BTIA 2MGQA 3IV5A 2IA1A 2V1DA 4I09A 4LGWA 4GFBA 4Y7NJ 3I5UA 2JJ7A 4CO8A 1MMNA 5D6FA 3GTQJ 4I2OA 1G3TA 2NVTJ 3LSPA 1BBYA 1RC9A 1E3OC 4BH9A 4MLOA 2H09A 4RGXA 1FOXA 4LIUA 2CJJA 3ABUA 3KLNA 2PFBA 4PDKA 2PQ8A 4B09A 1JI8A 1U3EM 3KP5A 1X1PA 1JKQC 2NYXA 2FQ4A 3TP0A 3M1EA 3P9KA 1P7IA 4HG2A 3K4LA 4MIMA 3BJOA 5HLTA 2K9NA 3E3VA 1T0FA 1MMDA 4G6TB 4BBSJ 5IP9J 4AYBA 3X2QH 4EGYA 3CQZJ 2EQRA 2QGUA 4KISA 1SFOJ 1I6HJ 1SAXA 3SEQA 1BC7C 2XV4S 2Z5UA 3FHZA 2OZ6A 2P7CB 2D2WA 2BE5F 3VYSB 3LAPA 3RTRA 2NVQJ 1X2NA 2Y0SA 4C9YA 4F92B 5CYVA 2F4OB 3BY6A 5ICFA 3LFKA 1R00A 3HRSA 4ZJZA 2MLGA 3MKZA 1EJ9A 5C3EJ 3GFJA 1QHHD 1ZELA 5HLHA 3W6VA 2VKHA 1N75A 2JTVA 4CCMA 1TL8A 2F5CA 3K2AA 3FKIJ 3OR2C 1WI3A 3ZPLA 2M7BA 1GUUA 1Y6IA 3LWFA 3CUQB 3E0JB 1WHUA 4YRVA 2E1CA 1YFHA 2D1HA 1IV6A 4OIQF 1ZG1A 5EEGA 5EDNA 3G73A 4AUXA 4NC7A 3KYLA 4UVCA 2VI6A 4KN4X 4BXFA 2O9LA 5HS9A 2XPVA 4O6JA 2R0QC 3J7ZI 4M73A 1FOWA 3VPRA 1DUXC 3EYIA 3NRVA 1EA3A 1X58A 1OYWA 1R58A 2HOSA 4P1WA 2GIZA 4BDYA 2OBPA 3ZR8X 3TO6A 1IJWC 3RIRA 4D0PA 1TNSA 3O6BB 2IBDA 3F72A 3K1NA 3CUOA 1W7PD 3EPZA 3G1OA 2EA4A 3K69A 1XG1A 2NNNA 2VQLA 4HW0A 3BR0A 4OAZA 2BY0A 3KP3A 1H9GA 1J59A 4XRFA 1SEUA 2DDAA 4A3KJ 1QZEA 2LF7A 2VIXA 4XRSG 1USSA 2XAUA 4FTHA 1VFCA 4U88A 5J4VA 4CSWA 2IXSA 3PO3J 4CHUA 2M5WA 2HDWA 4N0BA 1UELB 3L2WA 1HLVA 5K7FA 1AHDP 4OU0A 2CRGA 3CP8A 4GCVA 2DAOA 4QSHA 4B4CA 4B48A 3H3VK 4N9HA 3HSFA 3P7NA 5J4YA 1PYVA 1W0UA 1R1VA 1X1DA 2MLKA 5AIPA 5HDGA 4TV7A 3KYDB 1T33A 1A04A 1F1ZA 2ZSHB 3QOEA 1V5FA 1RNLA 1IO2A 2GQQA 3LA3A 2V1XA 4WX9A 4M6VA 2ZXHA 1FPQA 1IAWA 5FFZA 3F8NA 5KAIC 5K7HA 1HKQA 1D8KA 3CCLI 4PK4A 2VOPA 1U9OA 2WC2A 2E1OA 1A6IA 2HOEA 3I59A 3OIOA 3REOA 3ZP5A 3TO7A 2EPFA 4YEJA 3VYUB 2MBFA 5GAHJ 3BZKA 2ACJA 2HKXA 4NC8A 1P4XA 4U7DA 2ID3A 4A3JJ 3CUQA 2FQ3A 4GXOA 1JT0A 4MQ9F 2QZ8A 1FNNA 5FLXZ 3HHGA 4A0XA 3IWFA 1HOMA 3LSIA 1R5GA 4ZYHA 4BXXJ 4RB1A 3HOXJ 3F8BA 4RB2C 5BOXA 1SC7A 1IGNA 1VQPI 3CP2A 3O2PE 3TBIA 1UFMA 5E20A 1KU3A 2COMA 2CW8A 2IA0A 3TL4X 2F5FA 3S3OA 1O3SA 1F43A 4ESJA 4G8XA 2H1KA 1YIOA 3CLQA 2GOMA 1FTTA 1YRNB 2YX7A 2M1BA 3OYCA 2UZKA 3K4CA 4CGZA 1J75A 2AXLA 3NEUA 2V9KA 1XMAA 4RB3C 1K79A 3VB2A 3S16J 3LSJA 2MG4A 5H2FC 4EJUA 2R7UA 5ILSA 2HNHA 1S29A 4KA4A 3ZQFA 2CG4A 3O3KA 4E6KG 3DU6A 4WXCA 1FJLA 2D45A 1NTCA 1UJ8A 1X1AA 2FSWA 2Y75A 1SAUA 2VBYA 2P5VA 3CDLA 1I3AA 3E6MA 4MFEA 4CXFA 5J1RA 1FOYA 4L0YB 2EIMH 4CCOA 4II2A 5LD2C 5H6RA 2CFXA 2XGEA 4XR6A 4AD9A 3FBIB 3WTXC 4A3LJ 1BW5A 3VOEA 1FBSA 3GLLA 3G1LA 2NOJB 3F22A 5LRRA 1LKXA 2W7NA 3TOAA 1JUPA 1JTYA 3K1MA 3B6CA 4Y13A 2LMDA 2Y0MA 1Z77A 3ZMUA 1WJFA 2HOTA 3C2GA 3U1KA 2EK5A 1SD7A 2ADUA 4IKFA 2V1NA 1T8IA 5DCMA 1GV5A 3TMOA 3CESA 5J1YA 3H5AA 3KZZA 4B8XA 4CDGA 4UUVA 2R5ZB 3CDIA 3PO2J 1BR2A 2L7MP 4EJWA 2LKSA 5ERIA 4KIBA 3S3NA 2DA1A 3EUHC 3G2BA 1DU6A 1XSXA 2EV5A 4JX5A 3SZTA 1IXRC 1YI2I 4IHWA 4DYQA 2BHYA 1R49A 2W24A 5FD5A 1ODDA 4BEHB 2OV7A 1A36A 2LY1A 2DO7A 2DTZA 2JRTA 3PL8A 1W4MA 1JJ8C 4G6QA 4EJTA 2UUZA 3OYKA 2FUG2 2XKPA 4FCYA 4G12A 1XGMA 1U5TC 3WTTC 2PBIA 4BYYA 2HZTA 1TW3A 4DIQA 1RRJA 3L00A 1V54H 1OFCX 3DFGA 3RQIA 5LHIA 1H8AC 1LDDA 3K70D 5EG0B 2HVRA 3QODA 2WA0A 3P9IA 3WGIA 3QYBA 2VLAA 3FWEA 2FU4A 1Y1WJ 1T2KA 1GXPA 2XGDA 4X1EA 1RUOA 2XIGA 3QYFA 1WGXA 2M45A 3J80K 4M9XA 1FT9A 2L7FP 1DU0A 1Z9CA 2BVMA 2YSRA 2JSCA 1Z0XA 5ILUA 1X1BA 3ABTA 1D0ZA 1MSFC 1T39A 2KKOA 3QP6A 1P6RA 1HF0A 2FMLA 1FP1D 3R4KA 1G6NA 5HS8A 3AFHA 1N78A 3FXOA 3HTSB 2WB1A 1R23A 3GFMA 2CQQA 3OYMA 3FHNA 3S1RJ 2NXNB 1LJ9A 2CV2A 1YITI 1P4WA 3ZMVA 3RKWA 1JUSA 4U0VA 2H6CA 1BOAA 5IYCJ 3CC2I 4WXHA 3GO5A 4ZH4F 1HDDC 5KAFC 2EZIA 3PUBA 3M8FA 4BNCA 2D1VA 5F64A 3CJQB 2DMUA 4WCGA 2L3DA 1B9NA 4IRHA 3VODA 3FXUA 1HA8A 4ZTJA 4HNUA 2LG4A 1EH8A 4A5MA 1RIOH 2HKOA 2X1CA 4EVIA 4AVZA 3FXJA 1WVRA 1JXSA 4E7SA 4YIRX 2HDDA 3FK6A 2OUMA 4I6ZA 4IX7A 5EGOB 4UUSA 3SFZA 2O6GE 2DFHA 3LMMA 4AM3A 3PNTA 1PDNC 4YIFA 2P5LC 4XORA 1W5CC 3IKTA 2IAIA 2R7XA 3D0SA 4N4OB 3ZQHA 1U5TB 1TC3C 5HNHA 1OPCA 1FYKA 1RKWA 2QENA 3ZGKA 2N8GA 3VFZA 2R5ZA 1IUFA 3N97A 1NG7A 1D1AA 1KYZA 3OR1C 4M3EA 4HDVA 2BZTA 2P81A 3M1CA 4KFCA 4ESFA 3KP7A 3U2RA 2LSOA 2Q1ZB 3WODF 3VDXA 5BNGA 2VBWA 4UV9A 2HWVA 4BEHA 1J09A 1R1TA 3IH2A 4L5JA 4UUTA 1V3FA 3Q5FA 2EV6A 2QLZA 2CSOA 2PG4A 1V55H 1LFUP 4RAFA 1MH4A 2K9LA 2K3FA 5AONA 2VT3A 3HOSA 4P96A 5ICEA 3JSPA 5HS7A 4AC0A 2L54A 2OZUA 2TRTA 5FO5A 1LDJA 1RUNA 3CMAI 4XKCA 5DM6F 5DS9A 3HPHA 1HSJA 1KQ9A 3BG5A 5E79C 2DLLA 2PN6A 2ZFWA 2E5ZA 2L0KA 5EG0A 4ZYAA 4FT8A 1GDTA 1LDKB 1IV8A 3QWLA 4LFUA 2DJNA 4GYIA 4BS9A 1A35A 2VJIA 2XGCA 2YS9A 3OIPA 1XCBA 4D9JA 1ONVA 5HLGA 2LH9A 4L5EA 3BR1A 2ICWG 4RA2A 1XSDA 4BQAA 5FLVA 2JT1A 3NARA 4Z6YA 1RZ4A 4CH7A 4HLYA 3ZOBA 3ELKA 2O3FA 4ENMA 3HSRA 3GYHX 1I27A 1PVEA 2JRMA 2P5KA 5E8IA 5LEJA 4U0WA 4DOZA 1B6AA 3V8JA 3SZPA 4OIRF 4XBFA 2OCEA 3E7LA 5E18F 3BLYA 1MH3A 3M7GA 3DBLB 3HBLA 1LB2A 1E0EA 2GM4A 5J47A 3PIPF 3CCJI 3CDHA 3JRFA 3HOWJ 1JKOC 3AG2H 5ICGA 3A4CA 4DW6A 3PSFA 1VQNI 3JRHA 3CC7I 2IGNA 2YU3A 2ZJ2A 3BTLA 5D8KB 2RGVA 2BBYA 1VQMI 5IY5H 4ZTFA 3W2VA 4GYGA 5L3FA 3W6KB 4PJLA 1SD5A 2PX9A 4ETSA 4P5OA 1VQLI 1OCCH 1Z6TA 2V9VA 3SDBA 3HPGA 4ZYEA 4S04A 1VQ8I 2LBFA 3EUHA 4AIHA 2P7VB 2RNJA 3S93A 3OOUA 1ZRDA 4A0YA 4BQNA 2JPBA 1SFUA 2FEZA 3OIQA 4EM0B 5EGOA 3C7JA 3B73A 5DD4A 4P9FA 4CUGA 2KIMA 1IXSB 2EZLA 2XAHA 1K61A 3H35A 3K6GA 4JK1X 5LHGA 1OR7C 3V7RA 1B59A 5E17F 1U5TA 3LL7A 1KU7A 4FX0A 2EFQA 3CCYA 4HNVA 2JN6A 5DV5A 3OYIA 2CUJA 3DCFA 2JUCA 3BDDA 4IXAA 4L9JA 1X19A 3ZQLA 3TW6A 1AWCA 2BYVE 1ORKA 2ELJA 3DWLE 1CQTA 2JA2A 2WAQN 3WGGA 3KZYA 5B3SH 5EJCA 1PP8F 1UHSA 2NS8A 4XM3A 2ZCWA 1LEAA 2X0LA 4BBRJ 1O7FA 1WJBA 1HDPA 2LYCA 1YW9A 3PFYA 2OJED 4RM3A 4RB0A 3RI4A 2VASA 5GADJ 2RKHA 4R1HA 4D1QA 5JLXA 2VKVA 3T5XA 1DGWY 5GP9A 3BR6A 3NWTA 3F3XA 2VBZA 1DP3A 2QSFX 5IT9K 4YIIA 2VJ4A 4V2GA 1X3WB 3ASOH 1J5YA 3EYYA 2MH9A 2GA2A 2L9SA 2X6XA 4P9UA 3JRDA 3OYGA 4K2EA 3CO6C 3IC7A 5E1WA 2PLYA 3P5JA 1IZ1A 2X1DA 4PCQA 1B9MA 4NUBA 3GTPJ 2XROA 1R36A 1KONA 2V6CA 3S1MJ 3S1NJ 3LSKA 1OISA 4UY8I 2CW0F 5FLXK 3W2WA 4N9IA 3V8KA 4DGWB 3DLLF 1ETYA 2IPQX 2KDOA 1IUYA 4FISA 4B43A 2ZO4A 4ON0A 3DF8A 2NS0A 4I01A 1IF1A 3G71I 3H0DA 2QM3A 1IDZA 1B4AA 1B1BA 2HQRA 4HDUA 4JX6A 4IHYA 4HF0A 1FMVA 1W0TA 2V26A 3FM3A 2FRHA 4NQWB 1U8BA 5L3BA 4HV6A 2GWRA 3TDZC 4YFXF 4ASNA 1FWZA 4CA0A 4BL0B 5J8CA 3HTUA 3UR3C 3BZCA 3H9QA 3PQKA 4CYCB 3Q9SA 2X6OA 5D4SA 1IRGA 1YTYA 1DPRA 1XD7A 2R7OA 2A6HF 2K4JA 3A02A 2MA3A 3TW7A 1TT0A 2CUEA 4IHXA 5D6EA 1YOVB 3CZ6A 1HKTA 1SD6A 4B44A 3IAS2 5F0CA 1VI0A 2LREA 1AOYA 3FX3A 1QPIA 3KE2A 2ZJPF 2QA4I 1YX3A 5KNLA 3I54A 2FBKA 2B0LA 4F3QA 2DODA 5F27A 4J01A 4M3GA 1R5ID 2E1MC 3E5XA 5CJ9A 3MKYB 3SYTA 1HC8A 3HGYA 4ENNA 3LAJA 4FHTA 4PGGA 2OTLI 1PP7U 2B63J 2ESNA 4LG3A 1YX5A 5GPCA 2BEOA 2EV0A 1S5LC 3HOZJ 4MQVA 1WJEA 2VPRA 5LGNA 1KQ8A 4BAYA 2BY1A 3FBNB 2R7VA 4PZJA 5GTHC 2IGMA 1WWXA 1ZGWA 1BIAA 3DKWA 5F0HA 1H88C 3L09A 2HVQA 3DBRB 5CQEA 4GDFA 3BTCA 2G7UA 3PNYA 1BR1A 4EJOA 3ABLH 2BVLA 2HQNA 4AYBN 3RQ4A 2RV8A 3I59B 4F52A 2E1NA 2PMUA 3OSGA 2TCTA 2HS5A 3ECOA 1YJNI 1BJZA 2EFWA 3P9CA 3JAMZ 1WSUA 4UB8C 1DQUA 3W3CA 2QBYB 3AG3H 3GFIA 1TT5B 3WG9A 2EZHA 1MKMA 2Y0SN 2UV1A 2MABA 3K2ZA 4A5NA 5B5EC 3M8JA 3F9KA 1Z91A 3COAC 1SFEA 2QQAA 2R7DA 1NHAA 1MBFA 1OKRA 4QLCU 2HZDA 1FC3A 4QPOA 4XSXF 3BTJA 4Q48A 1BI2A 2JA7J 1XDSA 3GZNB 3GTMJ 2JK3A 4I02A 2Z99A 1SFKA 2EFNA 1JJ6C 1D5VA 1QZYA 1FSHA 3H5RA 2X85A 3SJMA 2PJPA 3BWGA 3S2DJ 2HOAA 4QWQA 2CYYA 4ANJA 1YLFA 2DT5A 4NQWA 4JP0A 1OR7A 1VNDA 4DZJA 2H27A 4IRIA 3ZQ7A 1UG2A 4MNUA 5H6QA 5IOZA 2GA1A 1IW7F 1MJ9A 3IH4A 5K5QA 3MMYB 4CYCA 4KYWA 4IHSA 1WFXA 5K5OA 3K70C 4NHJA 2DDBA 1QRYA 1W7PA 2IGKA 2R7SA 2HI3A 5A2QK 2KP6A 2F6CA 3PSIA 4XKWA 2FOWA 3S8PA 4IQJA 4BQOA 2DCEA 3F21A 4UHTA 3PIOF 3JRBA 4HOBA 2GIVA 4I76A 2IRFG 2CQXA 3WE3A 1Z7UA 3DP7A 3JR9A 1LFPA 4Y4RA 2LR8A 5KK1A 2UWMA 1Z7LA 4E7LA 1D0YA 5CPRB 2ECCA 4EEFG 5AIQA 2COBA 1VF9A 3BG6A 3BT9A 1D1CA 1T56A 2LFBA 1S7OA 2UXXA 4XLEA 4OAYA 5DCMB 2DOEA 3M4OJ 1Y8RB 4RDUA 1EF4A 3PUFA 3RJPA 3IAM2 2VXZA 2RREA 2LTPA 2R92J 2KQRA 3JRGA 1UG0A 4NNJA 2ISZA 2KLOA 4ZC3A 5M3MJ 2M2EA 1ZG3A 2LP0A 3J7AO 3RZDJ 1X1CA 2L7KA 5EZGA 2O61A 1YQAA 2W57A 5H20A 4EV0A 3J81Z 3HC7A 4MGRA 1K78A 2QYOA 3GEZA 1T6SA 1I39A 4UVBA 3OYHA 2XRNA 3DTEA 4ZZLA 3QP5A 2R7WA 3I4NJ 3BR3A 3HOTA 3QAHA 3SXYA 1U8RA 3R0JA 3L1PA 3DTKA 1QVUA 5FKOA 3V7CA 3VEPA 2EINH 1RPWA 2RQQA 2QBYA 4AVPA 4NC6A 2QCOA 3K4MA 2R7FA 3WU2C 3OYDA 2GXGA 3HOUJ 5J40A 4HA8A 3E5UA 2HU9A 3C2HA 3H3UA 2KDZA 3SEZA 1USTA 2RC4A 5FRNA 2CO5A 5J8FA 4IRGA 1PJRA 5LHHA 2KIUA 3FKJA 3ML6A 3WTSC 2JVHA 2NAZA 5FKKA 5LFAA 1ETWA 1TLHB 2EJRA 1O7LA 2VQHA 2L7ZA 3G3ZA 3OV8A 3LSMA 3KYCB 4BGDA 4XICA 2I5UA 4BJ5C 5C4JJ 1XCVA 2VC1A 3L2UA 1R4NB 2GAUA 1PUFB 1ZAOA 2KPMA 4OMYA 2VE8A 1Z21A 2O8KA 2MC4A 1ZK8A 2V1UA 1T98A 2CW7A 4L9TA 2EBIA 1JTXA 3I71A 2CWEA 4F7ZA 1O4XA 3LSHA 2KFDA 4WK8F 1MMSA 1O57A 5F1JA 1XMKA 2QQ9A 5FKLA 4Q47A 4MEYF 4ZDOA 4M71A 1XSVA 3JW4A 2TDXA 4DBRA 2V7FA 5JR3A 3OS0A 5DM7F 1WZ2A 1Q1HA 3RSNA 2C6YA 3LNQA 1ITYA 5CVUA 1UHWA 4QIWN 5CLSA 2VN2A 2QVOA 1CF7B 4BACA 1SFXA 2G7HA 5HODA 1BI3A 4KT5C 2CS3A 1MDMB 3CTAA 4UUSB 2DA3A 3U1DA 1WH5A 3FXRA 5F0FA 3M9AA 4O3MA 4M74A 1R4MB 3BR5A 3ULQB 1QU3A 1G4DA 2IGOA 1FYLA 2G0EA 2EB7A 4CZZA 5CVVA 2LF8A 3K4BA 3H36A 3VYTB 3OYFA 3N4MA 2K85A 2A61A 2IA2A 2Y2ZA 3MCZA 2A6TA 2Q8KA 4A6DA 4BUPA 1XN7A 4BHPA 3DEWA 5JVTA 1ZRCA 3S1QJ 1VQ5I 2VJ5A 1IRXA 4PJMA 2IS2A 4PGHA 5BQTA 2E2JJ 2AO9A 3ZQGA 2K7LA 2DYSH 4BY1J 2ZJRF 4S05A 2VKEA 5DCFA 5TRDA 2K86A 3AKZA 2EA2A 2KRCA 4P55A 4XLNF 3F8MA 1IG7A 4XN3A 3HDDA 4O5VA 4IZZA 3O8GA 4M3FA 3WG7H 4F55A 1TWAJ 2HTSA 4CZCA 3B6AA 1WCMJ 1BL0A 2DA7A 2R7TA 4YFNF 2H1LA 2KRHA 4I98B 2CUZA 2E36A 4YG2F 4JX4A 1QBJA 2XB5A 1FBUA 3F8FA 5E3MA 4D7NA 3WTUC 1BW6A 4XL9A 3IWZA 3EQLF 2M8EA 2ECBA 2VOOA 3T8TA 5LGUA 2DN0A 3JCUC 5TGTA 3JTGA 2ZNYA 3HUGB 1IN7A 3KZIC 3WTVC 4EJVA 5JLWA 2VC0A 1WI9A 2MSYA 3U9GA 3QQAA 3OYLA 3VSLA 1YS6A 3WTYC 3SQNA 4S0HB 4UV8A 5D5WB 5D5XB 5IYDJ 2PMZA 2E5NA 2JPCA 2FA5A 2Y48A 2FF4A 4HRIA 2H6BA 3GMEA 1XC5A 5LEKA 1PUFA 3JSOA 5LRSA 1G8XA 1POGA 2VKDA 1QHGA 5LLQA 2A5YB 2KL4A 2WADA 4JYKA 2DT6A 2L4MA 2XAFA 4XRMA 3M07A 2LKXA 1MZBA 5JFRA 1MJBA 3I53A 2VL8A 2HEOA 5IP6A 5E1XA 5D5UB 2JA8J 2E2IJ 3MKWB 3ECHA 2LK2A 2PMHA 3FZVA 4CCJA 3CCQI 1ZRFA 2WB1N 5DTDA 3OYBA 3QPLA 2E71A 2LBFB 2KIQA 2XASA 2L9RA 1CF7A 2VJJA 1BI1A 3HXLA 1XB4A 2F48A 4KIFA 1SVOA 4XN0A 2V9PA 4A69C 5HDNA 1MDMA 1RKTA 3MZ8A 1HCRA 1ZH5A 5DD8A 3DBHB 4IL6C 1QVTA 4XQFA 2GXAA 1ZTRA 4Y3OA 2M0MA 2LOOA 2XGXA 3F6OA 5KCMA 2KHMA 4MO7A 1Z3YA 4LK1F 1BOBA 3DPLC 3AL0C 2YR2A 4E4HA 1ETKA 1RR7A 1WJ5A 2L9VA 4E7IA 1XS9A 3FISA 5J1UA 3BP8A 5FLMJ 3WGHA 4M9SA 1XGSA 1FSEA 5JI6A 3FXLA 4KMUX 1PUEE 5LBQA 3QPSA 2O0YA 5DUIA 3Q9VA 3CCMI 3ABMH 4RGRA 1XMXA 1W36D 4MHGA 1SMTA 4BHCA 2DMNA 2ZNZA 5L3EA 5EEAA 3HKZN 2JWTA 5B1BH 1QO0D 1FX7A 2HQ5A 1F9NA 2STTA 5DUKA 1U78A 3U21A 3I58A 1VQKI 5K7ZA 4ZYGA 1TWFJ 3FDYA 4PUSA 3S14J 2NOGA 4ZZDA 2HR3A 1STZA 1HSTA 3HRTA 2KISA 2ME6A 2XC7A 3CLOA 2HYFA 1ON2A 3K4NA 3LFUA 4IHTA 2CQKA 4I99C 3RPUA 3QYEA 3R60A 1T38A 4A3CJ 5D4RA 1T95A 3HUGA 3FK7A 4RLFA 2XF7A 2OCCH 2Q2EA 4PFOA 5HVQC 1K7AA 2HXIA 4LD5A 4IEJA 5IYBJ 3MN2A 3A1YA 4HPQA 1ZG5A 4LIVA 3UNGC 4OWRB 1JKPC 1K6OA 2O8XA 3GLXA 3T8RA 3ZN0A 1B72B 2R93J 3GBGA 1L0OC 1XX5A 4R8HA 2M7AA 4YELA 5KVRA 2W1OA 3CF2A 2W4SA 3T0YA 4BJ6C 1X4OA 2O03A 1ETOA 3G1MA 2NRAC 4H0EA 4UXNA 2D5VA 3K10A 2F5VA 3FIWA 4UVAA 2CQ7A 1MBEA 1FYMA 2V4JC 2A5WA 4MTEA 2HPIA 2VXDA 3IRRA 3TQNA 3I3LA 5M5XJ 1OCRH 4QTRA 3L7WA 2W82A 5IP7J 1NH3A 1MNMC 3QU6A 5KHDA 4KNYA 2DPDA 1TP4A 1WPKA 1RI7A 2DI3A 2FX0A 2LNBA 1ETVA 2KT0A 3K7AJ 4ZDLA 2LY2A 1J0RA 1ZR4A 4HSTA 2XPWA 3A0HC 3ZCOA 2Z2SB 3IUOA 5FFXA 1IRFA 3DEUA 4FETA 2RDPA 1GV2A 5J3LA 2Y30A 5DYMA 4XMYA 3HM5A 4AIKA 4Y33A 3C1DA 3ZMTA 4BJTA 2STWA 2DQLA 1OCTC 1ZHFA 4W1UA 2JMWA 1F4KA 1LVKA 4XLHA 1W5TA 3K1PA 1QQIA
chains in the Genus database with same CATH topology
2CQNA 2K85A 2KZGA 2DOEA 2L9VA 2DOFA 2JUCA 1UZCA 2E71A 4FQGA 2KFDA 2KIQA 2B7EA 2LKSA 2DODA 2KISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQN A;  2K85 A;  2KZG A;  2DOE A;  2L9V A;  2DOF A;  2JUC A;  1UZC A;  2E71 A;  4FQG A;  2KFD A;  2KIQ A;  2B7E A;  2LKS A;  2DOD A;  2KIS A; 
#chains in the Genus database with same CATH topology
 3HL2 A;  3W6J B;  2XUB A;  4C3J J;  3CCR I;  3JRI A;  2XF5 A;  4IOA F;  1YYV A;  2DOF A;  4A12 A;  5C44 J;  2W48 A;  4B47 A;  2PI0 A;  1E17 A;  1XGN A;  4F91 B;  2WAQ A;  3I64 A;  2ZB9 A;  3G6E I;  4ENJ A;  2QKL B;  1MBJ A;  2Q0O A;  3R6S A;  5GAG J;  3LQR A;  2Z33 A;  1ZLJ A;  1JE8 A;  2A3S A;  3GVA A;  2DYR H;  1UZC A;  2ZXW H;  4LB5 A;  4XKV A;  1EKE A;  5FJ8 J;  3T1B A;  3ONQ A;  2EZK A;  2K9S A;  2IW5 A;  1OCZ H;  1R22 A;  3TGN A;  5LGT A;  4XLA A;  1IDY A;  1ZKG A;  1MND A;  1OJL A;  4NBQ A;  3HSE A;  2IEK A;  3J81 K;  2FJ1 A;  2YUS A;  1LUJ B;  4HNT A;  1ZR2 A;  2AHQ A;  3I56 I;  4KJZ A;  4KT6 A;  3KX2 A;  3GW2 A;  1SAN A;  1SMY F;  3DPT A;  1U9N A;  2DMQ A;  4V19 K;  3KP4 A;  2DMT A;  4HLX A;  3RPQ A;  1A6Q A;  2WTE A;  3IL2 A;  1LVA A;  4GRI A;  4HYE A;  4DNC A;  1VQ4 I;  3SDG A;  4CCL A;  1G3S A;  1GT0 C;  1BN5 A;  1IN4 A;  3QOP A;  4JBA A;  3S32 A;  2QQ8 A;  1B72 A;  2E7X A;  2K02 A;  3J80 Z;  2M4K A;  1APL C;  2CV0 A;  2FE3 A;  4AU7 A;  1RET A;  1J2X A;  3OS1 A;  4L9V A;  4XLC A;  4FAS D;  1KU2 A;  2VUM J;  4PJN A;  1WH7 A;  3FMR A;  1WJD A;  2OU2 A;  2ETH A;  2HDC A;  4HBL A;  3A03 A;  3PNV A;  1I1G A;  2Z16 A;  2VOD A;  3M3Y J;  2F4M B;  2BXY A;  1EH6 A;  1W1W E;  2YX4 A;  1YJ9 I;  3IKV A;  2FBH A;  4Y17 A;  1MBH A;  2VT2 A;  1O3R A;  1B8I B;  3DQV C;  1H89 C;  2HPM A;  1W7P B;  4MFD A;  2E2H J;  4BQQ A;  4A3M J;  1REP C;  2FOK A;  2X9D A;  2WY7 Q;  2K9M A;  3ASN H;  1HBX G;  1Y0N A;  3JRA A;  1K83 J;  2FNA A;  4BXU A;  2XAQ A;  1M1E B;  1D0X A;  4BKX A;  1VQ7 I;  2X51 A;  3BQY A;  2M87 A;  3PQJ A;  5M3F J;  1HW5 A;  4QPQ A;  2QSH X;  4NB5 A;  2DPU A;  4L5I A;  1ZGJ A;  1XDU A;  5BPD A;  2WAF A;  2QUF A;  2ELH A;  1C0W A;  3GWZ A;  3DV8 A;  4KIG A;  3BG9 A;  1K4T A;  4R79 A;  2IS1 A;  2UXN A;  3HHH A;  2CUF A;  4PFP A;  3HOV J;  1ZYR F;  3J7A Y;  2Y31 A;  4BHB A;  2M34 A;  4M6X A;  1MIJ A;  2L02 A;  2JVG A;  3HZJ A;  5CVI A;  3SHF A;  1HW2 A;  1JUM A;  4A3B J;  2RQP A;  1MW7 A;  1FY7 A;  1ZQ3 P;  1K78 B;  1K4S A;  3LSR A;  3PM1 A;  3DKX A;  3I4M J;  1SD4 A;  2JA5 J;  2MD0 A;  1AKH B;  3KP6 A;  2L01 A;  2ISY A;  2EH3 A;  5E8G A;  5BS6 A;  2YU9 J;  2FD5 A;  3KET A;  2LRD A;  4W97 A;  2CMP A;  4DJA A;  3WE2 A;  3OYJ A;  3RKQ A;  3MD2 A;  4LJZ F;  4LLN A;  4OIP F;  5E3O A;  1BM9 A;  3HJE A;  4RS8 A;  4HX8 A;  2WBM A;  4RMN A;  2EFO A;  2K40 A;  3H9G A;  1S8N A;  4PSX A;  4M6Y A;  4EMS A;  1L3L A;  4XON A;  5ICC A;  5GPA A;  3FF5 A;  2FBI A;  2IVM A;  3F6V A;  4J19 A;  1OQY A;  2LY9 A;  3OYN A;  3K0L A;  3MZH A;  3KEO A;  2QKM B;  1GHC A;  1HW1 A;  2EIJ H;  3G4S I;  2F2E A;  1FTZ A;  2X4H A;  2B9S A;  3ZN1 A;  1FP2 A;  2B7E A;  3H5N A;  2L4A A;  1R6R A;  2DK8 A;  3OYE A;  1MMG A;  3BCB A;  2E1M B;  2Y9Y A;  3BC8 A;  2G9W A;  1FZP B;  3NAU A;  4XLP F;  3F0C A;  1B8I A;  4BE0 A;  4G7Z F;  3MZY A;  3LSG A;  3JTH A;  1KZH A;  1X4P A;  4H4K C;  4F93 B;  1LEB A;  3H92 A;  2FNP A;  3R61 A;  4OIO F;  2E35 A;  5IOY A;  1GVJ A;  1WQ2 A;  4EGZ A;  4HAM A;  4V2F A;  3MWM A;  2HGC A;  1KGS A;  1WJC A;  1ZN2 A;  5IPA A;  2XHK A;  1MMA A;  2M30 A;  5D5V B;  1VQO I;  1X2M A;  4ZDP A;  4A2U A;  1S3J A;  2XAJ A;  2DT7 B;  2I10 A;  2HQA A;  1WKM A;  2F5E A;  2ZXJ A;  1LPQ A;  1YE9 A;  2ZME C;  2OD5 A;  2KMU A;  4D5C A;  1HXD A;  4D7M A;  3GTL J;  4XOP A;  3E6D A;  3FXK A;  3CCV I;  1TWG J;  1SVM A;  2P4W A;  3BG7 A;  4HQE A;  5FRM A;  2XVC A;  2BY3 A;  3E5Q A;  5D8L B;  3K4K A;  1KU9 A;  4EM2 A;  1XPX A;  5E1Z B;  5EYR A;  2AS5 F;  3MEX A;  3L9F A;  1MBG A;  4Z2Y A;  3IHU A;  3Q0U A;  3E6C C;  4LLL A;  1DGR M;  4PSW A;  2OTJ I;  3MVP A;  3HB9 A;  3SFI A;  1S7E A;  2GOX B;  4XKB A;  3OS2 A;  4HX4 A;  1J7K A;  3OL3 A;  3A01 B;  2HTJ A;  2W25 A;  1Y56 A;  4BE1 A;  2M0C A;  3WHC A;  2XRL A;  2OQG A;  4B3A A;  4E7K A;  1NG6 A;  2X6Y A;  4ITV A;  5HNF A;  3OWT A;  2DA6 A;  1AKH A;  3GTK J;  3GTO J;  2XF6 A;  3Q3S A;  3DKY A;  2H94 A;  5FD6 A;  4LLG F;  2QQB A;  1XTA A;  2VBX A;  3VSK A;  4Q5S F;  3AG4 H;  1JGS A;  2DMP A;  3BR2 A;  4FE7 A;  2DFF A;  2XKO A;  5EF6 A;  3QPT A;  3CJT B;  1HQC A;  5IT9 Z;  4KN7 X;  2GZW A;  1S72 I;  4C2U A;  3ZQC A;  2KZV A;  2P6T A;  2IS4 A;  5JHU A;  3V42 A;  2DFI A;  4PJ0 C;  1JT6 A;  2BW3 B;  2A6E F;  4A3E J;  3LA2 A;  2R4G A;  3RZO J;  2VQG A;  4RGU A;  4LMY A;  3D1N I;  1D3Y A;  4DBQ A;  2W84 A;  4XLF A;  5B1A H;  3H3Z A;  4BDZ A;  1YO5 C;  3RDI A;  3NQO A;  2E19 A;  1W36 C;  3OYA A;  1R71 A;  9ANT A;  2CGP A;  1R1U A;  4G7O F;  3S15 J;  2DJI A;  1E2X A;  3CJN A;  4X0G A;  2K9Q A;  1OYY A;  2R7R A;  5BPI A;  4FX4 A;  4IO9 F;  4MEX F;  2RVC A;  2R7Q A;  1N25 A;  5K1Y A;  4IQ4 A;  2DK5 A;  2LDU A;  2WY8 Q;  2M4G A;  1TQI A;  3V8L A;  2AXT C;  2ZME B;  3LQQ A;  4Y15 A;  1LFB A;  1JHH A;  3DTI A;  4GO1 A;  5GAE J;  2DXI A;  4IOC F;  1VQ9 I;  4FQG A;  3WU0 A;  1XGO A;  3H1C A;  3EET A;  3MKL A;  1VQ6 I;  1V5G A;  5EEH A;  3BG3 A;  2QEX I;  3KIO A;  4BE2 A;  2RAE A;  1JGG A;  3KEQ A;  2X6W A;  2E34 A;  2KZG A;  3ZRG A;  3TED A;  3BJA A;  3E97 A;  4XSZ F;  3CCE I;  2PJR B;  3OMY A;  3CCU I;  4WWC A;  1AU7 A;  3FXQ A;  3FMQ A;  1DPU A;  1D1B A;  1EV7 A;  3CMY A;  1FMW A;  2LD5 A;  1VTN C;  2KJB A;  1ETQ A;  1YG2 A;  2HXO A;  5ILV A;  4A3F J;  2BGC A;  4IJA A;  1MD0 A;  2A07 F;  2OF7 A;  3PFI A;  2L2O A;  1W5S A;  1GLN A;  3HOY J;  4A3D J;  2RNG A;  2Z1D A;  3GZ5 A;  4ESB A;  3JRC A;  2ID6 A;  4HQM A;  2CU7 A;  2Z3Y A;  3VYR B;  1ERD A;  2W85 A;  3GZ6 A;  4II3 A;  3BRO A;  5HOO A;  1MJA A;  3S17 J;  2CQN A;  2ZBK A;  4A3G J;  5J6X A;  3LA7 A;  4OOI A;  2MH2 A;  4U7B A;  1KYW A;  3BJ6 A;  1YW7 A;  1YS7 A;  4I7H A;  2IS6 A;  3A01 A;  2L5Q A;  3H0G J;  1LQ1 A;  3MAJ A;  4AWX B;  4HSR A;  4IHV A;  2NVU B;  1MNE A;  2EIK H;  1G59 A;  2MC3 A;  2NVX J;  5C4X J;  1J9I A;  3ERE D;  5JHF A;  4G9Y A;  2OA4 A;  2CFO A;  3DU5 A;  1P92 A;  4XRS A;  3CF5 F;  4RAG A;  4LG0 B;  3R0A A;  2HYG D;  3EUA A;  4HV5 A;  3AAF A;  1EH7 A;  1RR8 C;  1HKS A;  1IN8 A;  2GXB A;  4MTD A;  3QRF F;  3A2K A;  5M5W J;  3L2V A;  3GTJ J;  5EZH A;  2DQR A;  2Q2E B;  3I4P A;  4LB6 B;  2BW3 A;  2VQC A;  3ZMZ A;  2K27 A;  2A68 F;  1WJA A;  5TIS C;  1S9H A;  4C3H J;  3DXJ F;  2IP2 A;  3TP3 A;  3FMS A;  4WXD A;  1Y1V J;  3UKG A;  2CH0 A;  4G6D A;  1YIJ I;  5DEQ A;  4A93 J;  4CIC A;  3GF2 A;  4KMF A;  3GUD A;  1G3W A;  1YW8 A;  1U6G A;  3DPU A;  2DW4 A;  4Q4Z F;  4L18 B;  2DTR A;  3C2B A;  2ZME A;  3OL4 A;  4EQQ A;  2NVY J;  4KIC A;  2H8R A;  3ZMD A;  2PMZ N;  2V79 A;  3ESW B;  4A6E A;  1IC8 A;  1YRN A;  4XK4 A;  2Y9Z A;  3KP2 A;  1ACI A;  2R5Y B;  2KJC A;  1TZL A;  3RYR A;  5HDK A;  3JRE A;  2WV0 A;  3EDP A;  3K9T A;  4EM1 A;  3D5S C;  4LOC A;  4L9N A;  5CVJ A;  4M9Z A;  4B1R A;  2DA4 A;  3NWS A;  5E3L A;  2JUG A;  2OPT A;  1JHF A;  5B66 C;  3CC4 I;  6PAX A;  5JVG F;  2PJR A;  1KQ0 A;  3N05 A;  5A2Q Z;  2P8T A;  4U87 A;  1DDN A;  1D5Y A;  2GLO A;  1IRZ A;  3GCM A;  2M3A A;  1BI0 A;  4KIT B;  3ABK H;  3HIF A;  3I55 I;  3GTG J;  3FM5 A;  3RKY A;  4G94 A;  5DDG A;  1YJW I;  4X6A J;  2IT0 A;  3V4G A;  1VZ0 A;  1MSE C;  2OQR A;  4AID A;  1QZZ A;  2ZFU A;  4KDP A;  1QGP A;  4IF4 A;  4RM2 A;  1TW2 A;  1BJA A;  2K4B A;  2VE9 A;  4JQF A;  1R7J A;  1RES A;  1T08 B;  2M9H A;  2DA2 A;  2KRF A;  4RLQ A;  4GGG A;  3CMM A;  3B02 A;  1G3Y A;  3HYI A;  3C18 A;  2JSP A;  4L0Z B;  3GFL A;  4ENK A;  4JOM A;  1V5E A;  3W2A A;  3HKZ A;  2QSG X;  2LLK A;  3TO9 A;  3I9V 2;  2Y69 H;  2X48 A;  2R7Z J;  1TQM A;  2HVS A;  2MYS A;  2IJL A;  1FIA A;  2X1E A;  1S6L A;  4LG0 A;  3J7Y J;  3RKX A;  1D8J A;  1QNT A;  2PEX A;  2DU9 A;  3GXO A;  2LKP A;  1YHQ I;  2K3P A;  5FKN A;  5HLI A;  5TJJ A;  2WV1 A;  1DP7 P;  2VB6 A;  5CKT A;  3RPU D;  3TOB A;  4C2M J;  1H0M A;  5ED4 A;  3TKY A;  3JAM K;  1BA5 A;  3D5L A;  3K4J A;  1UAA A;  4J00 A;  1S7A A;  4OIN F;  2WWY A;  1LE8 B;  3L2R A;  1TNT A;  1T0F C;  1F36 A;  3V7S A;  3KCC A;  1TQP A;  2EWN A;  2ZKZ A;  1UMQ A;  3BCA A;  3WHB A;  4C3I J;  2P6S A;  1Z05 A;  4FE4 A;  3IRQ A;  1G2H A;  5FB2 A;  1IN6 A;  2ZSI B;  1F5T A;  1R9T J;  1ZGA A;  1BC8 C;  1ZAR A;  1O3T A;  4OMZ A;  1MGT A;  2I8D A;  2VON A;  3Q0W A;  1E3P A;  3SZG A;  1CGP A;  2OAZ A;  2JQ7 A;  2LC2 A;  1NK3 P;  1NK2 P;  3ZQI A;  2BOL A;  3CME I;  4EAT A;  5FRO A;  3AG1 H;  3HGG A;  3CO7 C;  3ROU A;  4M3B A;  1U2W A;  4HEA 2;  4XOT A;  3O8H A;  3LST A;  4PJJ A;  3AL0 B;  2R5Y A;  3D5R C;  4UB6 C;  1ULY A;  5E3N A;  1FEX A;  3RYP A;  3S2H J;  1A31 A;  1X3U A;  3OSF A;  1WRJ A;  4E7Z A;  4U0Y A;  3BOQ A;  3I0T A;  4N4N B;  5BMZ A;  2ELK A;  1A5J A;  1E3H A;  2E7W A;  3IP4 B;  3KPH A;  5L3G A;  3MQ0 A;  3ISP A;  1Y8Q B;  3ZQQ A;  2EIL H;  5F04 A;  2AQE A;  2NS7 A;  4HZF A;  4G7H F;  1H9T A;  1TWC J;  4BU2 A;  1OMI A;  3DEE A;  1P7J A;  3OOP A;  3E1S A;  4HF1 A;  2Z9O A;  1I1S A;  1Y39 A;  1OCO H;  5M5Y J;  5F6F A;  1TTY A;  2DBB A;  4I0B A;  4Y52 J;  3KLO A;  2OC6 A;  1UCR A;  2XPU A;  1FIP A;  1GVD A;  2QF7 A;  4LK0 F;  1I5Z A;  2BHZ A;  4AIJ A;  2JA6 J;  4DZP A;  3CCS I;  2ESH A;  4RAY A;  1FOK A;  1FBQ A;  3EUK L;  1P2F A;  3BPV A;  1KA8 A;  4XNF A;  1OYI A;  1BR4 A;  1I6X A;  5L3C A;  5GTI C;  3S3M A;  2V6E A;  3HEF A;  2H8W A;  2A69 F;  1IN5 A;  1IXC A;  2M8G X;  2DOA A;  3BZ6 A;  4M72 A;  3HRU A;  3ZXS A;  2O5R A;  2QWW A;  4CCN A;  4YFK F;  3M8E A;  1UB9 A;  1Z3X A;  3IH3 A;  4C2T A;  2XAG A;  4HX7 A;  2A05 A;  3Q0V A;  1UHM A;  2JZY A;  4RAZ A;  2BXZ A;  2R3S A;  3KFW X;  1ZLK A;  2MD5 A;  2XSJ C;  2XB0 X;  4BY7 J;  3HRM A;  4XID A;  3PJR A;  3F23 A;  3L2Q A;  1I3Q J;  1ON1 A;  2J5P A;  4I0A A;  1GXQ A;  5IT3 A;  4RBO A;  5CVR A;  2BY2 A;  2BV6 A;  2XDV A;  1JKR C;  1V4R A;  2CV1 A;  3GX4 X;  3CJR B;  4A3I J;  4HF2 A;  1U0J A;  3MFK A;  2O7O A;  1MBK A;  1X3Z B;  3HG9 A;  5F08 A;  2FMY A;  2HFH A;  4IVN A;  2ZJQ F;  2MFZ A;  1LE8 A;  1TWH J;  2J5O A;  2DFE A;  5K5R A;  1Q1V A;  2F4I A;  5L3D A;  2F5D A;  3WTW C;  2MW8 A;  4DYR A;  1O3Q A;  2DA5 A;  2AQF A;  2EFP A;  2WAE A;  1LNW A;  4C30 A;  1AA7 A;  3QPH A;  1K6Y A;  1SVL A;  2HYJ A;  4B3X A;  3E6B A;  1BIB A;  4A0Z A;  4RGS A;  3TDU C;  4CCK A;  2GBY A;  4E7J A;  2YPR A;  2E60 A;  4E70 A;  3WU1 B;  2KIF A;  3BQZ A;  3VWB A;  4KUM A;  2LVS A;  2XSD C;  3QU3 A;  3CD6 I;  4UNO A;  2FXA A;  2K5C A;  1ENH A;  4LIT A;  3DLA A;  2W00 A;  4ABZ A;  1OCP A;  3LOC A;  4WF2 A;  2VPL A;  1Z1D A;  1QPM A;  3L2C A;  1P4A A;  2L9N A;  3ERM A;  5CQG A;  3S2W A;  4DYC A;  2ZC2 A;  3C3W A;  5FKM A;  4D5F A;  4ZYD A;  4E7H A;  1ZRE A;  1QA6 A;  1FLI A;  1R5H A;  1I50 J;  2P0W A;  3F8C A;  4M3D A;  3KEY A;  3CUQ C;  4DQ2 A;  1N77 A;  1Z6R A;  2ZXI A;  1P9Q C;  3H9J A;  4NDL A;  4IPA A;  2NNY A;  1Y0U A;  5FGM A;  1Z67 A;  3BPX A;  1TBX A;  2RN7 A;  3RCO A;  3WTZ A;  3OY9 A;  1ETX A;  5F1R A;  2ME0 A;  4CYD A;  3ZMS A;  3FXM A;  3A0B C;  1OLT A;  3BTI A;  2MGQ A;  3IV5 A;  2IA1 A;  2V1D A;  4I09 A;  4LGW A;  4GFB A;  4Y7N J;  3I5U A;  2JJ7 A;  4CO8 A;  1MMN A;  5D6F A;  3GTQ J;  4I2O A;  1G3T A;  2NVT J;  3LSP A;  1BBY A;  1RC9 A;  1E3O C;  4BH9 A;  4MLO A;  2H09 A;  4RGX A;  1FOX A;  4LIU A;  2CJJ A;  3ABU A;  3KLN A;  2PFB A;  4PDK A;  2PQ8 A;  4B09 A;  1JI8 A;  1U3E M;  3KP5 A;  1X1P A;  1JKQ C;  2NYX A;  2FQ4 A;  3TP0 A;  3M1E A;  3P9K A;  1P7I A;  4HG2 A;  3K4L A;  4MIM A;  3BJO A;  5HLT A;  2K9N A;  3E3V A;  1T0F A;  1MMD A;  4G6T B;  4BBS J;  5IP9 J;  4AYB A;  3X2Q H;  4EGY A;  3CQZ J;  2EQR A;  2QGU A;  4KIS A;  1SFO J;  1I6H J;  1SAX A;  3SEQ A;  1BC7 C;  2XV4 S;  2Z5U A;  3FHZ A;  2OZ6 A;  2P7C B;  2D2W A;  2BE5 F;  3VYS B;  3LAP A;  3RTR A;  2NVQ J;  1X2N A;  2Y0S A;  4C9Y A;  4F92 B;  5CYV A;  2F4O B;  3BY6 A;  5ICF A;  3LFK A;  1R00 A;  3HRS A;  4ZJZ A;  2MLG A;  3MKZ A;  1EJ9 A;  5C3E J;  3GFJ A;  1QHH D;  1ZEL A;  5HLH A;  3W6V A;  2VKH A;  1N75 A;  2JTV A;  4CCM A;  1TL8 A;  2F5C A;  3K2A A;  3FKI J;  3OR2 C;  1WI3 A;  3ZPL A;  2M7B A;  1GUU A;  1Y6I A;  3LWF A;  3CUQ B;  3E0J B;  1WHU A;  4YRV A;  2E1C A;  1YFH A;  2D1H A;  1IV6 A;  4OIQ F;  1ZG1 A;  5EEG A;  5EDN A;  3G73 A;  4AUX A;  4NC7 A;  3KYL A;  4UVC A;  2VI6 A;  4KN4 X;  4BXF A;  2O9L A;  5HS9 A;  2XPV A;  4O6J A;  2R0Q C;  3J7Z I;  4M73 A;  1FOW A;  3VPR A;  1DUX C;  3EYI A;  3NRV A;  1EA3 A;  1X58 A;  1OYW A;  1R58 A;  2HOS A;  4P1W A;  2GIZ A;  4BDY A;  2OBP A;  3ZR8 X;  3TO6 A;  1IJW C;  3RIR A;  4D0P A;  1TNS A;  3O6B B;  2IBD A;  3F72 A;  3K1N A;  3CUO A;  1W7P D;  3EPZ A;  3G1O A;  2EA4 A;  3K69 A;  1XG1 A;  2NNN A;  2VQL A;  4HW0 A;  3BR0 A;  4OAZ A;  2BY0 A;  3KP3 A;  1H9G A;  1J59 A;  4XRF A;  1SEU A;  2DDA A;  4A3K J;  1QZE A;  2LF7 A;  2VIX A;  4XRS G;  1USS A;  2XAU A;  4FTH A;  1VFC A;  4U88 A;  5J4V A;  4CSW A;  2IXS A;  3PO3 J;  4CHU A;  2M5W A;  2HDW A;  4N0B A;  1UEL B;  3L2W A;  1HLV A;  5K7F A;  1AHD P;  4OU0 A;  2CRG A;  3CP8 A;  4GCV A;  2DAO A;  4QSH A;  4B4C A;  4B48 A;  3H3V K;  4N9H A;  3HSF A;  3P7N A;  5J4Y A;  1PYV A;  1W0U A;  1R1V A;  1X1D A;  2MLK A;  5AIP A;  5HDG A;  4TV7 A;  3KYD B;  1T33 A;  1A04 A;  1F1Z A;  2ZSH B;  3QOE A;  1V5F A;  1RNL A;  1IO2 A;  2GQQ A;  3LA3 A;  2V1X A;  4WX9 A;  4M6V A;  2ZXH A;  1FPQ A;  1IAW A;  5FFZ A;  3F8N A;  5KAI C;  5K7H A;  1HKQ A;  1D8K A;  3CCL I;  4PK4 A;  2VOP A;  1U9O A;  2WC2 A;  2E1O A;  1A6I A;  2HOE A;  3I59 A;  3OIO A;  3REO A;  3ZP5 A;  3TO7 A;  2EPF A;  4YEJ A;  3VYU B;  2MBF A;  5GAH J;  3BZK A;  2ACJ A;  2HKX A;  4NC8 A;  1P4X A;  4U7D A;  2ID3 A;  4A3J J;  3CUQ A;  2FQ3 A;  4GXO A;  1JT0 A;  4MQ9 F;  2QZ8 A;  1FNN A;  5FLX Z;  3HHG A;  4A0X A;  3IWF A;  1HOM A;  3LSI A;  1R5G A;  4ZYH A;  4BXX J;  4RB1 A;  3HOX J;  3F8B A;  4RB2 C;  5BOX A;  1SC7 A;  1IGN A;  1VQP I;  3CP2 A;  3O2P E;  3TBI A;  1UFM A;  5E20 A;  1KU3 A;  2COM A;  2CW8 A;  2IA0 A;  3TL4 X;  2F5F A;  3S3O A;  1O3S A;  1F43 A;  4ESJ A;  4G8X A;  2H1K A;  1YIO A;  3CLQ A;  2GOM A;  1FTT A;  1YRN B;  2YX7 A;  2M1B A;  3OYC A;  2UZK A;  3K4C A;  4CGZ A;  1J75 A;  2AXL A;  3NEU A;  2V9K A;  1XMA A;  4RB3 C;  1K79 A;  3VB2 A;  3S16 J;  3LSJ A;  2MG4 A;  5H2F C;  4EJU A;  2R7U A;  5ILS A;  2HNH A;  1S29 A;  4KA4 A;  3ZQF A;  2CG4 A;  3O3K A;  4E6K G;  3DU6 A;  4WXC A;  1FJL A;  2D45 A;  1NTC A;  1UJ8 A;  1X1A A;  2FSW A;  2Y75 A;  1SAU A;  2VBY A;  2P5V A;  3CDL A;  1I3A A;  3E6M A;  4MFE A;  4CXF A;  5J1R A;  1FOY A;  4L0Y B;  2EIM H;  4CCO A;  4II2 A;  5LD2 C;  5H6R A;  2CFX A;  2XGE A;  4XR6 A;  4AD9 A;  3FBI B;  3WTX C;  4A3L J;  1BW5 A;  3VOE A;  1FBS A;  3GLL A;  3G1L A;  2NOJ B;  3F22 A;  5LRR A;  1LKX A;  2W7N A;  3TOA A;  1JUP A;  1JTY A;  3K1M A;  3B6C A;  4Y13 A;  2LMD A;  2Y0M A;  1Z77 A;  3ZMU A;  1WJF A;  2HOT A;  3C2G A;  3U1K A;  2EK5 A;  1SD7 A;  2ADU A;  4IKF A;  2V1N A;  1T8I A;  5DCM A;  1GV5 A;  3TMO A;  3CES A;  5J1Y A;  3H5A A;  3KZZ A;  4B8X A;  4CDG A;  4UUV A;  2R5Z B;  3CDI A;  3PO2 J;  1BR2 A;  2L7M P;  4EJW A;  2LKS A;  5ERI A;  4KIB A;  3S3N A;  2DA1 A;  3EUH C;  3G2B A;  1DU6 A;  1XSX A;  2EV5 A;  4JX5 A;  3SZT A;  1IXR C;  1YI2 I;  4IHW A;  4DYQ A;  2BHY A;  1R49 A;  2W24 A;  5FD5 A;  1ODD A;  4BEH B;  2OV7 A;  1A36 A;  2LY1 A;  2DO7 A;  2DTZ A;  2JRT A;  3PL8 A;  1W4M A;  1JJ8 C;  4G6Q A;  4EJT A;  2UUZ A;  3OYK A;  2FUG 2;  2XKP A;  4FCY A;  4G12 A;  1XGM A;  1U5T C;  3WTT C;  2PBI A;  4BYY A;  2HZT A;  1TW3 A;  4DIQ A;  1RRJ A;  3L00 A;  1V54 H;  1OFC X;  3DFG A;  3RQI A;  5LHI A;  1H8A C;  1LDD A;  3K70 D;  5EG0 B;  2HVR A;  3QOD A;  2WA0 A;  3P9I A;  3WGI A;  3QYB A;  2VLA A;  3FWE A;  2FU4 A;  1Y1W J;  1T2K A;  1GXP A;  2XGD A;  4X1E A;  1RUO A;  2XIG A;  3QYF A;  1WGX A;  2M45 A;  3J80 K;  4M9X A;  1FT9 A;  2L7F P;  1DU0 A;  1Z9C A;  2BVM A;  2YSR A;  2JSC A;  1Z0X A;  5ILU A;  1X1B A;  3ABT A;  1D0Z A;  1MSF C;  1T39 A;  2KKO A;  3QP6 A;  1P6R A;  1HF0 A;  2FML A;  1FP1 D;  3R4K A;  1G6N A;  5HS8 A;  3AFH A;  1N78 A;  3FXO A;  3HTS B;  2WB1 A;  1R23 A;  3GFM A;  2CQQ A;  3OYM A;  3FHN A;  3S1R J;  2NXN B;  1LJ9 A;  2CV2 A;  1YIT I;  1P4W A;  3ZMV A;  3RKW A;  1JUS A;  4U0V A;  2H6C A;  1BOA A;  5IYC J;  3CC2 I;  4WXH A;  3GO5 A;  4ZH4 F;  1HDD C;  5KAF C;  2EZI A;  3PUB A;  3M8F A;  4BNC A;  2D1V A;  5F64 A;  3CJQ B;  2DMU A;  4WCG A;  2L3D A;  1B9N A;  4IRH A;  3VOD A;  3FXU A;  1HA8 A;  4ZTJ A;  4HNU A;  2LG4 A;  1EH8 A;  4A5M A;  1RIO H;  2HKO A;  2X1C A;  4EVI A;  4AVZ A;  3FXJ A;  1WVR A;  1JXS A;  4E7S A;  4YIR X;  2HDD A;  3FK6 A;  2OUM A;  4I6Z A;  4IX7 A;  5EGO B;  4UUS A;  3SFZ A;  2O6G E;  2DFH A;  3LMM A;  4AM3 A;  3PNT A;  1PDN C;  4YIF A;  2P5L C;  4XOR A;  1W5C C;  3IKT A;  2IAI A;  2R7X A;  3D0S A;  4N4O B;  3ZQH A;  1U5T B;  1TC3 C;  5HNH A;  1OPC A;  1FYK A;  1RKW A;  2QEN A;  3ZGK A;  2N8G A;  3VFZ A;  2R5Z A;  1IUF A;  3N97 A;  1NG7 A;  1D1A A;  1KYZ A;  3OR1 C;  4M3E A;  4HDV A;  2BZT A;  2P81 A;  3M1C A;  4KFC A;  4ESF A;  3KP7 A;  3U2R A;  2LSO A;  2Q1Z B;  3WOD F;  3VDX A;  5BNG A;  2VBW A;  4UV9 A;  2HWV A;  4BEH A;  1J09 A;  1R1T A;  3IH2 A;  4L5J A;  4UUT A;  1V3F A;  3Q5F A;  2EV6 A;  2QLZ A;  2CSO A;  2PG4 A;  1V55 H;  1LFU P;  4RAF A;  1MH4 A;  2K9L A;  2K3F A;  5AON A;  2VT3 A;  3HOS A;  4P96 A;  5ICE A;  3JSP A;  5HS7 A;  4AC0 A;  2L54 A;  2OZU A;  2TRT A;  5FO5 A;  1LDJ A;  1RUN A;  3CMA I;  4XKC A;  5DM6 F;  5DS9 A;  3HPH A;  1HSJ A;  1KQ9 A;  3BG5 A;  5E79 C;  2DLL A;  2PN6 A;  2ZFW A;  2E5Z A;  2L0K A;  5EG0 A;  4ZYA A;  4FT8 A;  1GDT A;  1LDK B;  1IV8 A;  3QWL A;  4LFU A;  2DJN A;  4GYI A;  4BS9 A;  1A35 A;  2VJI A;  2XGC A;  2YS9 A;  3OIP A;  1XCB A;  4D9J A;  1ONV A;  5HLG A;  2LH9 A;  4L5E A;  3BR1 A;  2ICW G;  4RA2 A;  1XSD A;  4BQA A;  5FLV A;  2JT1 A;  3NAR A;  4Z6Y A;  1RZ4 A;  4CH7 A;  4HLY A;  3ZOB A;  3ELK A;  2O3F A;  4ENM A;  3HSR A;  3GYH X;  1I27 A;  1PVE A;  2JRM A;  2P5K A;  5E8I A;  5LEJ A;  4U0W A;  4DOZ A;  1B6A A;  3V8J A;  3SZP A;  4OIR F;  4XBF A;  2OCE A;  3E7L A;  5E18 F;  3BLY A;  1MH3 A;  3M7G A;  3DBL B;  3HBL A;  1LB2 A;  1E0E A;  2GM4 A;  5J47 A;  3PIP F;  3CCJ I;  3CDH A;  3JRF A;  3HOW J;  1JKO C;  3AG2 H;  5ICG A;  3A4C A;  4DW6 A;  3PSF A;  1VQN I;  3JRH A;  3CC7 I;  2IGN A;  2YU3 A;  2ZJ2 A;  3BTL A;  5D8K B;  2RGV A;  2BBY A;  1VQM I;  5IY5 H;  4ZTF A;  3W2V A;  4GYG A;  5L3F A;  3W6K B;  4PJL A;  1SD5 A;  2PX9 A;  4ETS A;  4P5O A;  1VQL I;  1OCC H;  1Z6T A;  2V9V A;  3SDB A;  3HPG A;  4ZYE A;  4S04 A;  1VQ8 I;  2LBF A;  3EUH A;  4AIH A;  2P7V B;  2RNJ A;  3S93 A;  3OOU A;  1ZRD A;  4A0Y A;  4BQN A;  2JPB A;  1SFU A;  2FEZ A;  3OIQ A;  4EM0 B;  5EGO A;  3C7J A;  3B73 A;  5DD4 A;  4P9F A;  4CUG A;  2KIM A;  1IXS B;  2EZL A;  2XAH A;  1K61 A;  3H35 A;  3K6G A;  4JK1 X;  5LHG A;  1OR7 C;  3V7R A;  1B59 A;  5E17 F;  1U5T A;  3LL7 A;  1KU7 A;  4FX0 A;  2EFQ A;  3CCY A;  4HNV A;  2JN6 A;  5DV5 A;  3OYI A;  2CUJ A;  3DCF A;  2JUC A;  3BDD A;  4IXA A;  4L9J A;  1X19 A;  3ZQL A;  3TW6 A;  1AWC A;  2BYV E;  1ORK A;  2ELJ A;  3DWL E;  1CQT A;  2JA2 A;  2WAQ N;  3WGG A;  3KZY A;  5B3S H;  5EJC A;  1PP8 F;  1UHS A;  2NS8 A;  4XM3 A;  2ZCW A;  1LEA A;  2X0L A;  4BBR J;  1O7F A;  1WJB A;  1HDP A;  2LYC A;  1YW9 A;  3PFY A;  2OJE D;  4RM3 A;  4RB0 A;  3RI4 A;  2VAS A;  5GAD J;  2RKH A;  4R1H A;  4D1Q A;  5JLX A;  2VKV A;  3T5X A;  1DGW Y;  5GP9 A;  3BR6 A;  3NWT A;  3F3X A;  2VBZ A;  1DP3 A;  2QSF X;  5IT9 K;  4YII A;  2VJ4 A;  4V2G A;  1X3W B;  3ASO H;  1J5Y A;  3EYY A;  2MH9 A;  2GA2 A;  2L9S A;  2X6X A;  4P9U A;  3JRD A;  3OYG A;  4K2E A;  3CO6 C;  3IC7 A;  5E1W A;  2PLY A;  3P5J A;  1IZ1 A;  2X1D A;  4PCQ A;  1B9M A;  4NUB A;  3GTP J;  2XRO A;  1R36 A;  1KON A;  2V6C A;  3S1M J;  3S1N J;  3LSK A;  1OIS A;  4UY8 I;  2CW0 F;  5FLX K;  3W2W A;  4N9I A;  3V8K A;  4DGW B;  3DLL F;  1ETY A;  2IPQ X;  2KDO A;  1IUY A;  4FIS A;  4B43 A;  2ZO4 A;  4ON0 A;  3DF8 A;  2NS0 A;  4I01 A;  1IF1 A;  3G71 I;  3H0D A;  2QM3 A;  1IDZ A;  1B4A A;  1B1B A;  2HQR A;  4HDU A;  4JX6 A;  4IHY A;  4HF0 A;  1FMV A;  1W0T A;  2V26 A;  3FM3 A;  2FRH A;  4NQW B;  1U8B A;  5L3B A;  4HV6 A;  2GWR A;  3TDZ C;  4YFX F;  4ASN A;  1FWZ A;  4CA0 A;  4BL0 B;  5J8C A;  3HTU A;  3UR3 C;  3BZC A;  3H9Q A;  3PQK A;  4CYC B;  3Q9S A;  2X6O A;  5D4S A;  1IRG A;  1YTY A;  1DPR A;  1XD7 A;  2R7O A;  2A6H F;  2K4J A;  3A02 A;  2MA3 A;  3TW7 A;  1TT0 A;  2CUE A;  4IHX A;  5D6E A;  1YOV B;  3CZ6 A;  1HKT A;  1SD6 A;  4B44 A;  3IAS 2;  5F0C A;  1VI0 A;  2LRE A;  1AOY A;  3FX3 A;  1QPI A;  3KE2 A;  2ZJP F;  2QA4 I;  1YX3 A;  5KNL A;  3I54 A;  2FBK A;  2B0L A;  4F3Q A;  2DOD A;  5F27 A;  4J01 A;  4M3G A;  1R5I D;  2E1M C;  3E5X A;  5CJ9 A;  3MKY B;  3SYT A;  1HC8 A;  3HGY A;  4ENN A;  3LAJ A;  4FHT A;  4PGG A;  2OTL I;  1PP7 U;  2B63 J;  2ESN A;  4LG3 A;  1YX5 A;  5GPC A;  2BEO A;  2EV0 A;  1S5L C;  3HOZ J;  4MQV A;  1WJE A;  2VPR A;  5LGN A;  1KQ8 A;  4BAY A;  2BY1 A;  3FBN B;  2R7V A;  4PZJ A;  5GTH C;  2IGM A;  1WWX A;  1ZGW A;  1BIA A;  3DKW A;  5F0H A;  1H88 C;  3L09 A;  2HVQ A;  3DBR B;  5CQE A;  4GDF A;  3BTC A;  2G7U A;  3PNY A;  1BR1 A;  4EJO A;  3ABL H;  2BVL A;  2HQN A;  4AYB N;  3RQ4 A;  2RV8 A;  3I59 B;  4F52 A;  2E1N A;  2PMU A;  3OSG A;  2TCT A;  2HS5 A;  3ECO A;  1YJN I;  1BJZ A;  2EFW A;  3P9C A;  3JAM Z;  1WSU A;  4UB8 C;  1DQU A;  3W3C A;  2QBY B;  3AG3 H;  3GFI A;  1TT5 B;  3WG9 A;  2EZH A;  1MKM A;  2Y0S N;  2UV1 A;  2MAB A;  3K2Z A;  4A5N A;  5B5E C;  3M8J A;  3F9K A;  1Z91 A;  3COA C;  1SFE A;  2QQA A;  2R7D A;  1NHA A;  1MBF A;  1OKR A;  4QLC U;  2HZD A;  1FC3 A;  4QPO A;  4XSX F;  3BTJ A;  4Q48 A;  1BI2 A;  2JA7 J;  1XDS A;  3GZN B;  3GTM J;  2JK3 A;  4I02 A;  2Z99 A;  1SFK A;  2EFN A;  1JJ6 C;  1D5V A;  1QZY A;  1FSH A;  3H5R A;  2X85 A;  3SJM A;  2PJP A;  3BWG A;  3S2D J;  2HOA A;  4QWQ A;  2CYY A;  4ANJ A;  1YLF A;  2DT5 A;  4NQW A;  4JP0 A;  1OR7 A;  1VND A;  4DZJ A;  2H27 A;  4IRI A;  3ZQ7 A;  1UG2 A;  4MNU A;  5H6Q A;  5IOZ A;  2GA1 A;  1IW7 F;  1MJ9 A;  3IH4 A;  5K5Q A;  3MMY B;  4CYC A;  4KYW A;  4IHS A;  1WFX A;  5K5O A;  3K70 C;  4NHJ A;  2DDB A;  1QRY A;  1W7P A;  2IGK A;  2R7S A;  2HI3 A;  5A2Q K;  2KP6 A;  2F6C A;  3PSI A;  4XKW A;  2FOW A;  3S8P A;  4IQJ A;  4BQO A;  2DCE A;  3F21 A;  4UHT A;  3PIO F;  3JRB A;  4HOB A;  2GIV A;  4I76 A;  2IRF G;  2CQX A;  3WE3 A;  1Z7U A;  3DP7 A;  3JR9 A;  1LFP A;  4Y4R A;  2LR8 A;  5KK1 A;  2UWM A;  1Z7L A;  4E7L A;  1D0Y A;  5CPR B;  2ECC A;  4EEF G;  5AIQ A;  2COB A;  1VF9 A;  3BG6 A;  3BT9 A;  1D1C A;  1T56 A;  2LFB A;  1S7O A;  2UXX A;  4XLE A;  4OAY A;  5DCM B;  2DOE A;  3M4O J;  1Y8R B;  4RDU A;  1EF4 A;  3PUF A;  3RJP A;  3IAM 2;  2VXZ A;  2RRE A;  2LTP A;  2R92 J;  2KQR A;  3JRG A;  1UG0 A;  4NNJ A;  2ISZ A;  2KLO A;  4ZC3 A;  5M3M J;  2M2E A;  1ZG3 A;  2LP0 A;  3J7A O;  3RZD J;  1X1C A;  2L7K A;  5EZG A;  2O61 A;  1YQA A;  2W57 A;  5H20 A;  4EV0 A;  3J81 Z;  3HC7 A;  4MGR A;  1K78 A;  2QYO A;  3GEZ A;  1T6S A;  1I39 A;  4UVB A;  3OYH A;  2XRN A;  3DTE A;  4ZZL A;  3QP5 A;  2R7W A;  3I4N J;  3BR3 A;  3HOT A;  3QAH A;  3SXY A;  1U8R A;  3R0J A;  3L1P A;  3DTK A;  1QVU A;  5FKO A;  3V7C A;  3VEP A;  2EIN H;  1RPW A;  2RQQ A;  2QBY A;  4AVP A;  4NC6 A;  2QCO A;  3K4M A;  2R7F A;  3WU2 C;  3OYD A;  2GXG A;  3HOU J;  5J40 A;  4HA8 A;  3E5U A;  2HU9 A;  3C2H A;  3H3U A;  2KDZ A;  3SEZ A;  1UST A;  2RC4 A;  5FRN A;  2CO5 A;  5J8F A;  4IRG A;  1PJR A;  5LHH A;  2KIU A;  3FKJ A;  3ML6 A;  3WTS C;  2JVH A;  2NAZ A;  5FKK A;  5LFA A;  1ETW A;  1TLH B;  2EJR A;  1O7L A;  2VQH A;  2L7Z A;  3G3Z A;  3OV8 A;  3LSM A;  3KYC B;  4BGD A;  4XIC A;  2I5U A;  4BJ5 C;  5C4J J;  1XCV A;  2VC1 A;  3L2U A;  1R4N B;  2GAU A;  1PUF B;  1ZAO A;  2KPM A;  4OMY A;  2VE8 A;  1Z21 A;  2O8K A;  2MC4 A;  1ZK8 A;  2V1U A;  1T98 A;  2CW7 A;  4L9T A;  2EBI A;  1JTX A;  3I71 A;  2CWE A;  4F7Z A;  1O4X A;  3LSH A;  2KFD A;  4WK8 F;  1MMS A;  1O57 A;  5F1J A;  1XMK A;  2QQ9 A;  5FKL A;  4Q47 A;  4MEY F;  4ZDO A;  4M71 A;  1XSV A;  3JW4 A;  2TDX A;  4DBR A;  2V7F A;  5JR3 A;  3OS0 A;  5DM7 F;  1WZ2 A;  1Q1H A;  3RSN A;  2C6Y A;  3LNQ A;  1ITY A;  5CVU A;  1UHW A;  4QIW N;  5CLS A;  2VN2 A;  2QVO A;  1CF7 B;  4BAC A;  1SFX A;  2G7H A;  5HOD A;  1BI3 A;  4KT5 C;  2CS3 A;  1MDM B;  3CTA A;  4UUS B;  2DA3 A;  3U1D A;  1WH5 A;  3FXR A;  5F0F A;  3M9A A;  4O3M A;  4M74 A;  1R4M B;  3BR5 A;  3ULQ B;  1QU3 A;  1G4D A;  2IGO A;  1FYL A;  2G0E A;  2EB7 A;  4CZZ A;  5CVV A;  2LF8 A;  3K4B A;  3H36 A;  3VYT B;  3OYF A;  3N4M A;  2K85 A;  2A61 A;  2IA2 A;  2Y2Z A;  3MCZ A;  2A6T A;  2Q8K A;  4A6D A;  4BUP A;  1XN7 A;  4BHP A;  3DEW A;  5JVT A;  1ZRC A;  3S1Q J;  1VQ5 I;  2VJ5 A;  1IRX A;  4PJM A;  2IS2 A;  4PGH A;  5BQT A;  2E2J J;  2AO9 A;  3ZQG A;  2K7L A;  2DYS H;  4BY1 J;  2ZJR F;  4S05 A;  2VKE A;  5DCF A;  5TRD A;  2K86 A;  3AKZ A;  2EA2 A;  2KRC A;  4P55 A;  4XLN F;  3F8M A;  1IG7 A;  4XN3 A;  3HDD A;  4O5V A;  4IZZ A;  3O8G A;  4M3F A;  3WG7 H;  4F55 A;  1TWA J;  2HTS A;  4CZC A;  3B6A A;  1WCM J;  1BL0 A;  2DA7 A;  2R7T A;  4YFN F;  2H1L A;  2KRH A;  4I98 B;  2CUZ A;  2E36 A;  4YG2 F;  4JX4 A;  1QBJ A;  2XB5 A;  1FBU A;  3F8F A;  5E3M A;  4D7N A;  3WTU C;  1BW6 A;  4XL9 A;  3IWZ A;  3EQL F;  2M8E A;  2ECB A;  2VOO A;  3T8T A;  5LGU A;  2DN0 A;  3JCU C;  5TGT A;  3JTG A;  2ZNY A;  3HUG B;  1IN7 A;  3KZI C;  3WTV C;  4EJV A;  5JLW A;  2VC0 A;  1WI9 A;  2MSY A;  3U9G A;  3QQA A;  3OYL A;  3VSL A;  1YS6 A;  3WTY C;  3SQN A;  4S0H B;  4UV8 A;  5D5W B;  5D5X B;  5IYD J;  2PMZ A;  2E5N A;  2JPC A;  2FA5 A;  2Y48 A;  2FF4 A;  4HRI A;  2H6B A;  3GME A;  1XC5 A;  5LEK A;  1PUF A;  3JSO A;  5LRS A;  1G8X A;  1POG A;  2VKD A;  1QHG A;  5LLQ A;  2A5Y B;  2KL4 A;  2WAD A;  4JYK A;  2DT6 A;  2L4M A;  2XAF A;  4XRM A;  3M07 A;  2LKX A;  1MZB A;  5JFR A;  1MJB A;  3I53 A;  2VL8 A;  2HEO A;  5IP6 A;  5E1X A;  5D5U B;  2JA8 J;  2E2I J;  3MKW B;  3ECH A;  2LK2 A;  2PMH A;  3FZV A;  4CCJ A;  3CCQ I;  1ZRF A;  2WB1 N;  5DTD A;  3OYB A;  3QPL A;  2E71 A;  2LBF B;  2KIQ A;  2XAS A;  2L9R A;  1CF7 A;  2VJJ A;  1BI1 A;  3HXL A;  1XB4 A;  2F48 A;  4KIF A;  1SVO A;  4XN0 A;  2V9P A;  4A69 C;  5HDN A;  1MDM A;  1RKT A;  3MZ8 A;  1HCR A;  1ZH5 A;  5DD8 A;  3DBH B;  4IL6 C;  1QVT A;  4XQF A;  2GXA A;  1ZTR A;  4Y3O A;  2M0M A;  2LOO A;  2XGX A;  3F6O A;  5KCM A;  2KHM A;  4MO7 A;  1Z3Y A;  4LK1 F;  1BOB A;  3DPL C;  3AL0 C;  2YR2 A;  4E4H A;  1ETK A;  1RR7 A;  1WJ5 A;  2L9V A;  4E7I A;  1XS9 A;  3FIS A;  5J1U A;  3BP8 A;  5FLM J;  3WGH A;  4M9S A;  1XGS A;  1FSE A;  5JI6 A;  3FXL A;  4KMU X;  1PUE E;  5LBQ A;  3QPS A;  2O0Y A;  5DUI A;  3Q9V A;  3CCM I;  3ABM H;  4RGR A;  1XMX A;  1W36 D;  4MHG A;  1SMT A;  4BHC A;  2DMN A;  2ZNZ A;  5L3E A;  5EEA A;  3HKZ N;  2JWT A;  5B1B H;  1QO0 D;  1FX7 A;  2HQ5 A;  1F9N A;  2STT A;  5DUK A;  1U78 A;  3U21 A;  3I58 A;  1VQK I;  5K7Z A;  4ZYG A;  1TWF J;  3FDY A;  4PUS A;  3S14 J;  2NOG A;  4ZZD A;  2HR3 A;  1STZ A;  1HST A;  3HRT A;  2KIS A;  2ME6 A;  2XC7 A;  3CLO A;  2HYF A;  1ON2 A;  3K4N A;  3LFU A;  4IHT A;  2CQK A;  4I99 C;  3RPU A;  3QYE A;  3R60 A;  1T38 A;  4A3C J;  5D4R A;  1T95 A;  3HUG A;  3FK7 A;  4RLF A;  2XF7 A;  2OCC H;  2Q2E A;  4PFO A;  5HVQ C;  1K7A A;  2HXI A;  4LD5 A;  4IEJ A;  5IYB J;  3MN2 A;  3A1Y A;  4HPQ A;  1ZG5 A;  4LIV A;  3UNG C;  4OWR B;  1JKP C;  1K6O A;  2O8X A;  3GLX A;  3T8R A;  3ZN0 A;  1B72 B;  2R93 J;  3GBG A;  1L0O C;  1XX5 A;  4R8H A;  2M7A A;  4YEL A;  5KVR A;  2W1O A;  3CF2 A;  2W4S A;  3T0Y A;  4BJ6 C;  1X4O A;  2O03 A;  1ETO A;  3G1M A;  2NRA C;  4H0E A;  4UXN A;  2D5V A;  3K10 A;  2F5V A;  3FIW A;  4UVA A;  2CQ7 A;  1MBE A;  1FYM A;  2V4J C;  2A5W A;  4MTE A;  2HPI A;  2VXD A;  3IRR A;  3TQN A;  3I3L A;  5M5X J;  1OCR H;  4QTR A;  3L7W A;  2W82 A;  5IP7 J;  1NH3 A;  1MNM C;  3QU6 A;  5KHD A;  4KNY A;  2DPD A;  1TP4 A;  1WPK A;  1RI7 A;  2DI3 A;  2FX0 A;  2LNB A;  1ETV A;  2KT0 A;  3K7A J;  4ZDL A;  2LY2 A;  1J0R A;  1ZR4 A;  4HST A;  2XPW A;  3A0H C;  3ZCO A;  2Z2S B;  3IUO A;  5FFX A;  1IRF A;  3DEU A;  4FET A;  2RDP A;  1GV2 A;  5J3L A;  2Y30 A;  5DYM A;  4XMY A;  3HM5 A;  4AIK A;  4Y33 A;  3C1D A;  3ZMT A;  4BJT A;  2STW A;  2DQL A;  1OCT C;  1ZHF A;  4W1U A;  2JMW A;  1F4K A;  1LVK A;  4XLH A;  1W5T A;  3K1P A;  1QQI A; 
#chains in the Genus database with same CATH homology
 2CQN A;  2K85 A;  2KZG A;  2DOE A;  2L9V A;  2DOF A;  2JUC A;  1UZC A;  2E71 A;  4FQG A;  2KFD A;  2KIQ A;  2B7E A;  2LKS A;  2DOD A;  2KIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...