2M34A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m34A00
3D1NI 3BR6A 3HOVJ 4C2MJ 4IEJA 4UUTA 2DMPA 2FX0A 3BG5A 4BBRJ 3ZQFA 1MBGA 1MBHA 2JA7J 1AKHA 2L9RA 4GFBA 1WI3A 4A3BJ 2ID6A 2XB0X 3WHBA 3S2DJ 2DTZA 5FKOA 1TWHJ 4MFEA 1JKQC 5J3LA 3PM1A 3S1QJ 3IH3A 2Y0SN 3K7AJ 2JA5J 3BQZA 1IDYA 3FISA 5EG0B 1OCTC 1MBKA 1IUFA 2EH3A 3FK7A 2WB1N 1ORKA 1HLVA 2KT0A 1ETYA 4BKXA 4HNVA 5DTDA 4I6ZA 1QVTA 1X2NA 3LNQA 3K2AA 1U9NA 3RZDJ 1LFBA 1TWFJ 3BTJA 1MH3A 2DA1A 2GM4A 2ME0A 1W0TA 4ABZA 3LSJA 3HM5A 1APLC 1JJ8C 3S2HJ 4G12A 2EZHA 1VF9A 1QRYA 1UG2A 1NK2P 3RQIA 4D7NA 1H89C 2HDDA 3OOUA 1XC5A 5C44J 3LSRA 4A93J 1I6HJ 5FKKA 3O8HA 1ZR2A 3Q0VA 1B8IB 1P7JA 1HDDC 1IG7A 2EZIA 2H1KA 1JUSA 3HBLA 4M6VA 1FEXA 1AU7A 5E3MA 1TC3C 1S7EA 2MW8A 3IH4A 3HDDA 3L1PA 5F0FA 1ZTRA 4A3MJ 2DJNA 2R93J 5EF6A 4IHWA 2WAQN 4RDUA 2FQ4A 1B72B 5M3MJ 2IBDA 3HGGA 5K7FA 1ETOA 5M5YJ 2LD5A 4J19A 1F36A 2MG4A 4A69C 1DU0A 1ETXA 3JRGA 4S0HB 2LVSA 1ETQA 4JYKA 4IHXA 2VUMJ 1TWCJ 3GTPJ 1W0UA 3MN2A 3JRHA 3S14J 3BT9A 4MO7A 3TW7A 5EYRA 2XPWA 1H8AC 2XPUA 4X1EA 4C3JJ 5E3OA 1JUMA 4MIMA 1QVUA 1IGNA 1RPWA 1TWAJ 3OSGA 2AHQA 3JRAA 2Y31A 3BQYA 1B72A 1ZK8A 5E3LA 3GTMJ 4DZJA 5EEAA 3S1NJ 2E2HJ 1JUPA 2LR8A 5IYBJ 5IYDJ 4W1UA 1XG1A 3FKIJ 1K83J 3PO2J 5M5WJ 3HOXJ 3F0CA 2NVYJ 2HXOA 3M3YJ 2GBYA 2WV1A 3G1MA 4QTRA 3G1OA 4D5CA 1BL0A 2LFBA 5HODA 3CQZJ 1K61A 2DA2A 2XGEA 2M8GX 3Q3SA 4FE4A 2IAIA 1ETWA 4D7MA 1IRZA 1RKWA 1Y1WJ 4NDLA 2XGCA 4FCYA 2ECBA 3FIWA 3S15J 9ANTA 1H88C 1YRNB 3BTLA 1RR7A 3BR5A 3FK6A 3GTQJ 5FKNA 4A3JJ 3BTIA 1JT6A 2XB5A 5F27A 3E7LA 4XIDA 3TEDA 1T56A 3SDGA 5BNGA 2JA6J 1UHSA 5FLVA 5J1UA 3GTLJ 5F1JA 3BR2A 4AC0A 2NS8A 2R5ZA 5J1RA 3ZQLA 5FKLA 2N8GA 5FLMJ 3H3VK 1FIAA 1OJLA 1NTCA 1FIPA 2CQQA 2M9HA 5IYCJ 3HB9A 1JTXA 2Y9YA 2DA7A 4Y52J 1ITYA 5K7ZA 1FTZA 1EF4A 3GTGJ 4B1RA 2NVTJ 2DA3A 1Z0XA 3CDLA 2L7MP 4IHVA 1HOMA 2HOTA 3C2BA 2VI6A 1AHDP 3DCFA 2YU9J 2M34A 4D5FA 4A3DJ 4A3FJ 5C4XJ 4QIWN 2JWTA 1I3QJ 5K7HA 5EG0A 5C4JJ 2NS7A 4IHYA 1T33A 1JKRC 2Y30A 1VFCA 1POGA 3I4NJ 2CRGA 1I50J 3MVPA 2W48A 1O4XA 1OCPA 2ZB9A 3VPRA 2LK2A 2LKXA 1HCRA 2EZLA 2TRTA 5IP6A 2XPVA 2M0CA 2L0KA 4XRSA 1LE8B 1GV2A 3ZOBA 3ZQHA 3JRCA 4M3DA 2O7OA 2LP0A 3BG9A 4X6AJ 1JJ6C 4QSHA 3IV5A 3HOYJ 3S16J 1RETA 3RZOJ 2E19A 5IPAA 1B8IA 1RESA 3S17J 2QF7A 1JKPC 1A5JA 4M3EA 1ZKGA 4DYQA 5EDNA 3JRBA 3S1RJ 1IV6A 1U8BA 3QQAA 1U9OA 2OF7A 1GT0C 3ZQGA 1TWGJ 3O8GA 3OSFA 2FJ1A 3GTJJ 5EZHA 4CYCB 2JMWA 1MSFC 1IC8A 1LE8A 2DMQA 1FJLA 4MLOA 1ETVA 2CU7A 4FE7A 2DA6A 3TW6A 1G2HA 3S1MJ 2EBIA 4B3AA 1BW6A 3Q0WA 2ECCA 2K9NA 3QPLA 2HXIA 1WH5A 3TP3A 1Z77A 2DA5A 2O8KA 2AO9A 3A01B 3HOWJ 5IOZA 2EZKA 3G1LA 4A3GJ 4DZPA 5IP7J 4C3IJ 4V2FA 3IH2A 4A3EJ 2B63J 4CYCA 4FISA 2HOAA 3CMYA 5M3FJ 1RKTA 3BTCA 3BR0A 2DMUA 2YUSA 4W97A 1Q1VA 2ID3A 2HYJA 3HGYA 4M3FA 4C3HJ 2FD5A 5F04A 4BXXJ 4BBSJ 3JR9A 2I10A 2R92J 1BW5A 3JRIA 2JK3A 2NVXJ 5J1YA 2LTPA 3NARA 4XICA 2R5YB 5FJ8J 1D5YA 5EGOB 2QCOA 3A03A 1JKOC 3GTKJ 2E1OA 1GDTA 1ETKA 1X2MA 4JX5A 5JLXA 2X48A 5DS9A 3A01A 1GUUA 3RKQA 1VNDA 3HOUJ 2NOGA 2CUFA 1BA5A 2R7ZJ 1WH7A 2X6OA 2CJJA 2VPRA 2HOSA 3LOCA 2R0QC 3W6VA 2CQXA 3MKLA 1ZGWA 1PUFB 1WGXA 3CCYA 3BR3A 1JTYA 3OIOA 4XRSG 2G0EA 5GPCA 3QPSA 2HI3A 1IDZA 2TCTA 4I76A 2R5YA 1MSEC 4AYBN 5EGOA 1YRNA 5JLWA 2MSYA 3DEWA 4JP0A 2ELKA 3SFIA 2DN0A 4L5EA 4V2GA 2P81A 4Y7NJ 1HF0A 2JN6A 1BJZA 4DW6A 2O9LA 2PMZN 3SJMA 1GVDA 2VKVA 4M3GA 2E2IJ 1GV5A 4BY1J 2DMNA 5M5XJ 1SANA 1NK3P 1UMQA 5IOYA 1ENHA 3H0GJ 2MGQA 5GPAA 2DMTA 1PUFA 1IJWC 2JJ7A 3B6AA 4M3BA 3M4OJ 2K9QA 2K9SA 1X58A 5EZGA 5F0CA 4BY7J 5IP9J 4LOCA 1QPIA 2NVQJ 2GLOA 2D5VA 2E2JJ 3JRDA 2RAEA 3UKGA 2KDZA 2CUEA 1MBJA 2L7ZA 4DYCA 1SFOJ 3WHCA 2H8RA 3LSPA 2X9DA 3JREA 1ZR4A 1F43A 1VI0A 3A02A 4XK4A 1MH4A 4DYRA 2HQ5A 1A6IA 2LY9A 2LLKA 3LSGA 4UUSB 2L7FP 1P7IA 4AUXA 2XRLA 2DA4A 4FTHA 2EQRA 1Y1VJ 2Y9ZA 2K40A 1JT0A 3GTOJ 2OPTA 4A3CJ 3ZQCA 3GBGA 4RBOA 1MBEA 2Y2ZA 5E3NA 2XSDC 4B4CA 1LFUP 4A3LJ 2COBA 2ME6A 4EEFG 1AKHB 3HKZN 1HDPA 3JRFA 3HOZJ 2XGDA 1FTTA 1DU6A 1MNMC 5C3EJ 2IEKA 2YS9A 3Q0UA 1ZQ3P 4A3KJ 3I4MJ 1E3OC 4XRMA 1U78A 2JA8J 3PO3J 1OFCX 3NAUA 5F08A 5GP9A 1JGGA 3TP0A 4UUSA 4JX6A 1CQTA 2VKEA 1WPKA 1XS9A 2M2EA 3BG3A 4A3IJ 1MBFA 3B6CA 3ZQIA 5FKMA 3HEFA 4MFDA 5F0HA 1R9TJ 4JX4A 1WCMJ 3BR1A 2R5ZB
chains in the Genus database with same CATH superfamily
3K4MA 3D1NI 3PNTA 4JOMA 4OMZA 3LAJA 2EIMH 2ESNA 3BR6A 3HOVJ 2M5WA 3E6MA 4IEJA 4XKWA 3OR2C 3CJTB 4BBRJ 1TT0A 2KP6A 3H1CA 2M30A 1B1BA 3C18A 3CCVI 2JA7J 4LITA 4GFBA 1Z1DA 2LG4A 1GLNA 4CHUA 4Q5SF 1WI3A 5LRRA 3FBIB 2DOFA 3CCLI 1EH6A 1RUNA 1TWHJ 2CV0A 1JKQC 1IXSB 1S5LC 1FC3A 2H09A 2JA5J 5BQTA 3BQZA 1FBSA 2WADA 3ABUA 3COAC 2WY8Q 3MAJA 3BCBA 1U6GA 4BACA 2XAQA 3KP4A 2EH3A 2VXDA 2WB1N 1ORKA 2WTEA 2XF6A 3FK7A 3IUOA 4HPQA 1ZLKA 2KT0A 1ETYA 2QUFA 3CMMA 3P9CA 4YIRX 5DTDA 3WTXC 1KU3A 4DBQA 3BTJA 2ME0A 1FMWA 1W0TA 2VQHA 1LJ9A 1L0OC 4ZDPA 2P0WA 2IVMA 3HM5A 3BDDA 3VODA 1JJ8C 3S2HJ 2EZHA 4XLHA 4UVCA 1QRYA 1U0JA 1UG2A 3K4NA 4M9SA 4BYYA 2AXTC 3OYMA 1A35A 3GLLA 3RDIA 5IT3A 1ZELA 3EYYA 2L4AA 5HLTA 3W2WA 5LHGA 3I5UA 1G3TA 4G94A 2E36A 2KIUA 2O61A 2IPQX 4HF2A 4I99C 1AU7A 3IRQA 2VJ4A 3HSFA 2OZUA 1FYLA 4Y13A 1IF1A 1XGOA 2MW8A 3IH4A 1TQMA 3HDDA 2VT2A 3R61A 3ASOH 3DKYA 4ENNA 2MBFA 1ON2A 1EJ9A 1T08B 3K4LA 1ZTRA 3W6JB 4A3MJ 2HYGD 4PSXA 1D5VA 4N4NB 2LKPA 4XQFA 2WAQN 2FQ4A 4P96A 3EQLF 3DP7A 3CCQI 1YJWI 3H3ZA 2IBDA 2ZXJA 3R4KA 2UV1A 4KIFA 1YI2I 3PIPF 5M5YJ 2QM3A 1WFXA 4J19A 4ZC3A 1IW7F 4YIIA 4A69C 1N75A 1BC8C 5BMZA 4S0HB 4NHJA 2LVSA 1V54H 2VUMJ 3REOA 1Z7LA 3JRHA 2QSGX 1XGSA 2VQCA 3HRUA 4ZJZA 4LD5A 4KISA 4MO7A 4D0PA 5KAIC 3JW4A 4XSZF 4K2EA 2M1BA 2MC4A 1K4SA 5E3OA 4MEXF 1K6YA 2F48A 4U7BA 4F92B 2FOWA 5E1ZB 3JRAA 3CD6I 4PJNA 2BW3A 2W82A 4H4KC 3GTMJ 1W5SA 4DZJA 5LFAA 5LEKA 1OMIA 1WJFA 3OR1C 2H6BA 4II2A 2P5LC 3KEYA 5L3FA 1VQLI 1K83J 4RB1A 2ICWG 3M3YJ 5F1RA 4RS8A 2GBYA 2WV1A 2IJLA 4QTRA 3KPHA 4RAYA 1LB2A 4D5CA 3HTUA 2HFHA 3ESWB 1CF7B 2KRCA 2Z33A 5HLGA 3CQZJ 2FE3A 2QSHX 2XF7A 1YYVA 4HV6A 3MWMA 2M8GX 2HQAA 2RQPA 4XBFA 5ICCA 3QRFF 5ERIA 3RQ4A 3OYHA 1EV7A 4UNOA 2W57A 2A5YB 4XM3A 1ZG1A 5DUKA 9ANTA 2PMUA 4IKFA 3BG7A 1YRNB 3BTLA 1RR7A 3BR5A 3ZMSA 4HF0A 1J59A 2V6EA 2IS1A 3E7LA 3F8BA 1W1WE 1X3ZB 4EJVA 3OIQA 1EH8A 1EH7A 3BOQA 1MNEA 3T1BA 3BR2A 2YX4A 2R5ZA 2VB6A 5J1RA 2DPDA 3FXUA 1U5TB 4PUSA 3WGHA 4HDVA 3FMSA 1FIAA 2QQ9A 4N4OB 4PJMA 5E18F 1E0EA 1WZ2A 3LA3A 3M8FA 3BPXA 2CQQA 1V5FA 1W4MA 2V9PA 2HQRA 3HB9A 4Y52J 1VQ6I 3GTGJ 3GEZA 2ESHA 2PJRB 2CMPA 3U1DA 3V7CA 5D5UB 2XIGA 3WG9A 2DA3A 2NVTJ 3LSHA 1Z0XA 5J4YA 2R3SA 2L7MP 3HTSB 4IHVA 2BY2A 2F5FA 3DFGA 3KETA 1AHDP 2UWMA 4OIRF 3P9KA 1DPUA 2KJCA 3FBNB 4A3DJ 2OA4A 1MMNA 3A0HC 1I3QJ 2F5VA 1SFEA 2NS7A 1T33A 2F6CA 4XLCA 3FZVA 2CRGA 3M1CA 4AIJA 1K78B 2K3FA 2D1HA 3HPHA 2LMDA 3FXQA 2ZB9A 4YEJA 3VPRA 4E7JA 2EZLA 2TRTA 3CP2A 3LSTA 2HTJA 3VB2A 1BOAA 1WJEA 4XRSA 5TJJA 3SYTA 3ZOBA 4BAYA 2O8XA 3GUDA 4DJAA 2AXLA 2O7OA 1T98A 1RC9A 1VQ4I 1ZG3A 2J5PA 2JPBA 4BJ6C 3I4PA 3FKJA 2BY3A 1S8NA 4FX4A 1SAXA 1D0XA 2FMYA 3S17J 2LKSA 4ZYHA 4KNYA 3CDHA 1A5JA 2Y69H 4DYQA 5EDNA 4G7OF 1U8BA 1QPMA 1OCOH 1YHQI 2OF7A 1GT0C 4KIBA 5KAFC 5TRDA 2UXNA 2FJ1A 4B8XA 3BLYA 3MKWB 3DLLF 3KP7A 5JHFA 3L2WA 1K6OA 1IC8A 4KICA 3TGNA 2CU7A 1X4OA 1G2HA 4G7HF 3RKYA 3I56I 1BR2A 6PAXA 1Y6IA 3WTSC 1UHWA 2DYRH 1VZ0A 3QPLA 1JXSA 5HS9A 2ZXIA 3BROA 5AIPA 4A6EA 3MKZA 4CICA 3GXOA 4F93B 5D8KB 4C9YA 2QQ8A 4RGXA 4IX7A 4HG2A 3A01B 5IOZA 2HWVA 4DZPA 4U0WA 4V2FA 2EFOA 2KHMA 2XGXA 4PJ0C 5DDGA 4CYCA 4LK0F 2DMUA 4CDGA 1X1DA 1BC7C 2IW5A 1G3WA 3JR9A 2I10A 1BW5A 1WVRA 2L5QA 3NARA 5EGOB 4LK1F 3X2QH 3GTKJ 2M3AA 3FMQA 1FBUA 2VOOA 1X2MA 4JX5A 2X6WA 1R6RA 1OISA 5E20A 1W7PD 2Z9OA 3MZHA 4G6QA 3HIFA 1VNDA 3AKZA 2H8WA 2L02A 5FROA 2CUFA 4NNJA 4G7ZF 2DDBA 2IA1A 3SZTA 4JBAA 5D6EA 5DCMB 4NQWB 3W6KB 3L2RA 3OS0A 2EJRA 3GZ5A 2IS2A 1IN4A 1ZGWA 3KP6A 3FM3A 4LLGF 1JTYA 3FXLA 5GPCA 3QPSA 2X6YA 4GCVA 3GX4X 2HI3A 1FOXA 3AL0C 2RNJA 3TO9A 4FX0A 2MSYA 3DEWA 3IL2A 5FLXK 2ELKA 3IAM2 3SFIA 3M8EA 1YW9A 3AL0B 2BYVE 3AG4H 2DCEA 2P81A 4Q4ZF 1BJZA 4DW6A 2D45A 2PMZN 5K5QA 3V8KA 3V7SA 3OYAA 1T6SA 2E2IJ 3CJQB 2R7OA 4HX7A 2VL8A 2PBIA 4BY1J 1FSHA 3U21A 1X19A 1P92A 3G4SI 1IXRC 2P5VA 5HVQC 1HXDA 5M5XJ 3GFMA 3J81K 2W25A 3C2GA 4EJWA 4HQMA 2MLGA 2DMTA 1PUFA 3OYDA 1IO2A 2JJ7A 3B6AA 2GIZA 3BJAA 4L0YB 4MGRA 2K9QA 2MA3A 2K9SA 5BPIA 5DD4A 1FZPB 4WCGA 4IZZA 3RSNA 4J00A 2DFFA 3HRSA 4IRGA 2D5VA 2E2JJ 4ZH4F 2RAEA 1MBJA 4DYCA 3WHCA 3OS1A 3LSPA 4ZYEA 2VKDA 2X9DA 4F55A 1YOVB 2BZTA 4RM3A 2ZFWA 1VI0A 2ZSIB 3A02A 4IRIA 2LF7A 1Z05A 5IT9K 2KZGA 2LLKA 4UUSB 5B3SH 2L7FP 1P7IA 2XRLA 4Y3OA 2DODA 4FTHA 1H9GA 1MW7A 3LWFA 4J01A 3LAPA 1SFKA 3F23A 3ZQCA 3DXJF 5CKTA 2DOEA 3WU2C 2ELJA 2L01A 2CSOA 4DIQA 4PCQA 1FYKA 1DGRM 3NWTA 3U1KA 1ERDA 1J0RA 2COBA 3HHHA 4U87A 3L00A 3HYIA 5KCMA 4S04A 2HZTA 1J75A 1MNMC 1SFXA 4HOBA 4LGWA 2IEKA 2ZKZA 1R5HA 2ZSHB 1GXQA 3OY9A 3I4MJ 3LSIA 4OINF 2NVUB 1E3OC 1U78A 4HF1A 4LB6B 2BEOA 2EFNA 3OYLA 1ON1A 4ZTJA 3KX2A 3JTHA 4DGWB 5GP9A 1XGMA 1S7OA 2OJED 4O5VA 3RCOA 3K4KA 3QP5A 5LGNA 4A3IJ 3CUOA 4DOZA 1MBFA 1PYVA 2X51A 4KT5C 2FBIA 3SZPA 3ZQIA 1O3SA 5HDGA 1FPQA 1R4MB 1VQ9I 5F0HA 4JX4A 3BPVA 1ODDA 3BR1A 2XVCA 2HGCA 1UZCA 4M9XA 2R5ZB 4D9JA 2EV5A 1A31A 4LJZF 2DMPA 3BG5A 1I1SA 2FQ3A 3FMRA 1MBGA 4MHGA 4MTEA 2L9RA 4Y15A 3IKTA 4P9UA 3A0BC 1LDDA 1XB4A 3GFJA 4QLCU 2ID6A 2XB0X 4KMFA 3TO7A 1MD0A 2DTZA 4EM0B 3OS2A 5FKOA 4UHTA 3R6SA 2GA1A 3U2RA 1QA6A 3S1QJ 4GXOA 2PG4A 2FBHA 1QNTA 4OMYA 3CF2A 3K7AJ 1YFHA 4LG0A 3FISA 1ONVA 4CYDA 1OCRH 2V9KA 2IRFG 4E70A 2VQLA 2LDUA 5TGTA 2KKOA 3DPLC 3K1PA 4HNVA 1X2NA 2D2WA 3LNQA 3RZDJ 1U9NA 1TWFJ 1YG2A 2EPFA 1G4DA 1WQ2A 2GM4A 1UELB 2MYSA 2K85A 4YIFA 1YLFA 4M74A 1MDMB 1QO0D 4HX4A 1R49A 2RKHA 2OCCH 4BUPA 3VFZA 3HKZA 2HDDA 1C0WA 1TQIA 3OOUA 5ILUA 4WX9A 3WTUC 5C44J 4A93J 2B9SA 1P9QC 2Z5UA 3LSMA 3O8HA 3JTGA 2DFEA 1SD7A 4A5MA 4IO9F 4CCLA 1IG7A 5CPRB 1F5TA 3CC7I 2FRHA 3KZZA 3HL2A 3CMAI 5E3MA 2GAUA 4PZJA 5EEGA 2F5EA 2JVGA 2QVOA 1S7EA 4RB3C 3E0JB 4UV8A 1YX3A 2Q0OA 2W24A 2GWRA 4WWCA 2PLYA 2IA2A 3ZMDA 2W4SA 4OIQF 2EA2A 5CVVA 3WU1B 2K4JA 3AG2H 4N9HA 1J5YA 2CV2A 2MD5A 4RGRA 5M3MJ 2UZKA 3S32A 3IHUA 2CW0F 2OUMA 3IC7A 3RPQA 4ZDLA 2L2OA 2EV6A 4QWQA 3G73A 4OU0A 1YJ9I 3ABTA 2H27A 3RIRA 2LY2A 1OPCA 1OQYA 1Z9CA 1K79A 2XDVA 2Y0SA 4JYKA 4IHXA 3GTPJ 1Y8RB 4IRHA 3LFUA 3MN2A 3BT9A 1D8JA 4I0BA 4ZTFA 4KFCA 4XONA 1F9NA 1H8AC 4C3JJ 1N77A 1QVUA 2DPUA 5F6FA 3C7JA 2AHQA 2Y31A 1Y8QB 3BQYA 4PSWA 1B72A 3ELKA 3CESA 2B7EA 3ZMZA 1GVJA 1YX5A 1Z21A 5IYBJ 4O6JA 4IOAF 2ETHA 1XG1A 1TT5B 3T5XA 2FEZA 4Z2YA 3JCUC 4Z6YA 2PMHA 1MMAA 2A61A 2ADUA 3PL8A 4E6KG 1TW2A 3CZ6A 4FASD 2O0YA 3G1OA 4QPQA 1LDKB 4BDZA 2CV1A 1FYMA 3GZ6A 2QYOA 1XD7A 2DA2A 1V4RA 2QA4I 2P5KA 2E1NA 2XGEA 5J4VA 3Q3SA 4FE4A 2IAIA 1QZYA 5JFRA 2QKLB 1ETWA 4D7MA 1RKWA 1Y1WJ 2FF4A 2QKMB 3PUBA 4XSXF 2ECBA 2BE5F 3S3NA 1H88C 5K5OA 3H9GA 3DU6A 2K86A 3GTQJ 1WI9A 2R7WA 3BTIA 5FFXA 3CUQA 3NWSA 3L2VA 3SDGA 5BNGA 1VQ5I 1UHSA 3K4BA 4ZYAA 4FT8A 4E7ZA 2QQAA 2NS8A 3WTVC 1SFUA 2QQBA 3HC7A 4LFUA 2R7QA 2KRFA 3OL3A 2N8GA 5FLMJ 1VQ7I 3H3VK 1TW3A 3WTYC 1FX7A 2Z16A 3SFZA 5BS6A 2K02A 1FIPA 3J7YJ 3DBHB 1MIJA 5IYCJ 1STZA 2Y9YA 1I39A 4O3MA 5JHUA 5K7ZA 1Y56A 1ITYA 1EF4A 3M7GA 4B1RA 3OYKA 4F91B 2HOTA 3F21A 1DPRA 2VODA 3DCFA 3E6CC 2GXBA 2XAGA 1YTYA 1IZ1A 2YU9J 2M34A 2V1DA 3E6BA 2DT5A 4D5FA 2JRMA 1QZZA 3KFWX 1YW7A 5D8LB 2Y48A 2M7BA 5C4JJ 2K5CA 2QGUA 4IHYA 2E1MC 4Y33A 1POGA 1KONA 1WHUA 2VBWA 3C1DA 3AG1H 1SVLA 3DU5A 1AWCA 4FHTA 2W48A 4RAGA 3SDBA 1WJAA 2EINH 2QBYA 1BBYA 2HVSA 2L0KA 4N0BA 5E8IA 5LD2C 1GV2A 2G7UA 4CCKA 1LE8B 1X3WB 1X1PA 3V8LA 1BM9A 4UVBA 2ELHA 2DTRA 3Q9VA 1Y0UA 3PQJA 4X6AJ 1W7PB 1XMKA 1JJ6C 4QSHA 4AVZA 5FLXZ 1LVKA 2MH9A 2V4JC 1RETA 2RVCA 2E19A 5IPAA 3F8NA 1B8IA 2AS5F 2QSFX 2QF7A 1I6XA 1S29A 1QBJA 3KP5A 1LEBA 3S1RJ 3CCJI 3KYDB 2KIFA 1FOWA 2RREA 4AVPA 3QQAA 1IV8A 5H6QA 1R36A 1TWGJ 3OOPA 4KMUX 3GTJJ 1PJRA 1B9NA 3K69A 2JMWA 3L9FA 2MC3A 3IP4B 3J81Z 3HSEA 1MSFC 1P4WA 2EK5A 4NB5A 1BI2A 3PFYA 3RPUA 2RQQA 3DPUA 1FJLA 3TW6A 1QZEA 2DA6A 2VBXA 3S1MJ 2EBIA 2BHZA 4UXNA 4KDPA 1VQOI 1ACIA 1BW6A 3CCSI 4OIOF 1XDUA 5E1WA 2QENA 2FOKA 2L3DA 5GAEJ 3ASNH 3C3WA 4E7HA 5LBQA 4ETSA 3V8JA 2AO9A 3LSKA 1KQ0A 3FWEA 1QGPA 4ESBA 3F22A 3G1LA 1F4KA 4IHTA 4I09A 4C3IJ 4AM3A 4BQQA 2Q8KA 3BCAA 2DOAA 4HNTA 5IT9Z 2MABA 1J2XA 2XUBA 4FISA 2HOAA 5A2QK 3ZQQA 3E6DA 5H20A 1SD4A 1J9IA 1R22A 2A68F 2YUSA 3R0JA 5GAHJ 4LG0B 1Q1VA 2BBYA 3M07A 3MMYB 4M3FA 4BH9A 4UV9A 2WWYA 3OIPA 1MKMA 3LA7A 1H0MA 2NVXJ 4XICA 2LTPA 2R5YB 4PJJA 1XMAA 2E60A 3OWTA 4B43A 5CVUA 2E1OA 4LLLA 1BJAA 4M6XA 2K9LA 1BR1A 3TDUC 2A07F 4HA8A 2X48A 2LNBA 2HPIA 4XMYA 3QOEA 1I27A 3ZQ7A 2PQ8A 2IXSA 1D1CA 3HOUJ 2ZXWH 3ISPA 2DT7B 4Q48A 1BA5A 2X6OA 2LF8A 2DAOA 2XKOA 4ZZDA 3SEQA 2IS6A 1DGWY 2VPRA 3W2AA 4P5OA 4BDYA 2R0QC 4BE0A 1XGNA 1PP8F 4Q47A 4IVNA 3J7ZI 2VASA 2K9MA 3GLXA 4HQEA 1UB9A 2HOEA 2K27A 5FRNA 5CJ9A 3KIOA 2F2EA 3CDIA 2Z3YA 2E7XA 3I53A 1IDZA 2TCTA 2BV6A 2L9NA 4HAMA 3TL4X 1MSEC 1WJCA 3HPGA 2L9VA 4AYBN 4E4HA 2PEXA 5HS8A 3LA2A 4L5EA 2LH9A 3LQRA 2M4GA 4BXFA 4Y7NJ 3K2ZA 5TISC 3VDXA 5DYMA 2O9LA 2HVRA 3SJMA 1YS6A 2DK5A 2H6CA 2R7TA 1G6NA 2EFPA 3DBRB 2DW4A 3WG7H 4L9NA 5KNLA 3CMEI 3L2QA 1KA8A 1NK3P 1UMQA 5IOYA 1ENHA 5GPAA 2A6TA 2IGMA 3BC8A 1HQCA 1DP7P 3FF5A 1ZLJA 3BZ6A 2DBBA 1G3SA 5D5XB 1X58A 5EZGA 1T0FA 2VT3A 3F8MA 5F0CA 1TTYA 4RLFA 2KQRA 4B3XA 4M6YA 1QHHD 2XAUA 4ON0A 1LEAA 2FSWA 5CLSA 3UKGA 3TO6A 1SFOJ 3DQVC 2H8RA 1WJBA 4HSRA 2XAFA 4WK8F 2HEOA 2RV8A 1ZR4A 3KEQA 2ZMEA 1ZH5A 4Y4RA 1F43A 2HNHA 2EFWA 4E7IA 5L3EA 1MH4A 3KLOA 1KU7A 5DM7F 2OAZA 2WAFA 2O6GE 4UUVA 3ZCOA 1USTA 2A6EF 4NC7A 4AUXA 3CCEI 1R5ID 2DA4A 3NEUA 3I59B 4PK4A 5CVRA 4L5IA 3LMMA 1YITI 4RM2A 1JT0A 3CJRB 3J80K 4R79A 3GBGA 4WXCA 1MBEA 3OYEA 2OZ6A 4DNCA 2ACJA 3WGGA 1LFUP 1FBQA 1S9HA 4MTDA 5HDNA 1HDPA 2GQQA 1YW8A 2R7VA 4HLXA 3BG6A 1FTTA 1DU6A 2O3FA 2OU2A 1D8KA 2GA2A 4HBLA 2YS9A 1FP1D 1D1AA 1F1ZA 4CSWA 4A3KJ 1ZQ3P 1Z3YA 2FMLA 4XRMA 3PO3J 4L9JA 5FFZA 2V7FA 2CUJA 1OFCX 3CUQC 3NAUA 4HLYA 1EA3A 3TP0A 1CQTA 4G8XA 1WPKA 1XS9A 1TBXA 3VSLA 2IA0A 2M2EA 4HEA2 3RJPA 2NRAC 4MNUA 3B6CA 4QPOA 3HEFA 4OWRB 4MFDA 4CCMA 2CQNA 2FD5A 3J7AY 1YE9A 2XRNA 5KK1A 3CCRI 3ULQB 1IN7A 1FNNA 4E7LA 5CYVA 2IT0A 3MZYA 3GCMA 4C2MJ 1OCCH 3CTAA 1HKQA 2FX0A 4UUTA 3ZGKA 1EKEA 3WE3A 5DUIA 3ZPLA 1MBHA 1YO5C 1AKHA 2YX7A 3K1MA 2CW8A 1PP7U 2W1OA 3HRTA 3ZRGA 3H3UA 4L9TA 3ROUA 3WHBA 4ASNA 4MFEA 1UJ8A 2Q2EA 3PM1A 1XCVA 5J3LA 5GAGJ 2VKHA 4HDUA 1VTNC 1O3TA 3F72A 3SHFA 1W5TA 2RGVA 3B73A 4A6DA 3CJNA 5ILVA 3K70C 3ERED 3BZKA 4E7SA 3CF5F 5K1YA 3MKYB 4AU7A 1MBKA 1IUFA 4BJ5C 4D1QA 2ZXHA 1X1CA 1HLVA 4U88A 2R7XA 1WSUA 2BOLA 3DTIA 4BKXA 5HLHA 1QVTA 5LHIA 1LFBA 2ZO4A 4HW0A 2ISYA 2LY1A 2DA1A 2Z2SB 2O03A 3FX3A 5AONA 4ABZA 1IXCA 1YIJI 1ZAOA 3GW2A 3UR3C 1VF9A 3SQNA 5DD8A 2UXXA 1H89C 1KQ8A 1Z67A 4IPAA 3LSRA 2JSCA 5FKKA 1B8IB 1P7JA 1HDDC 2EZIA 4A12A 2H1KA 4C30A 3HBLA 4OAYA 4LMYA 2E71A 1PUEE 1FEXA 3DTKA 1TC3C 2IGOA 3AFHA 3TOBA 5FD5A 1JGSA 3P7NA 3L1PA 2HDWA 3FXJA 3DPTA 1BI0A 5JVTA 5EF6A 2ZNYA 1HKTA 4IHWA 1E17A 4RDUA 1E2XA 2F4MB 1GXPA 2BW3B 3E1SA 1P4XA 3VYTB 3ABLH 1PDNC 1ETOA 2MLKA 2LD5A 2CQKA 2VN2A 3G71I 1OCZH 4ENJA 5CQGA 1OYYA 5L3GA 1ETXA 1X1AA 4RAFA 4A0ZA 3JRGA 1ZRDA 1BI1A 2BGCA 3PNVA 2VPLA 2E35A 2X1EA 3L7WA 1TWCJ 2V1UA 1JHFA 2KDOA 3KLNA 4IXAA 5B5EC 1W0UA 1OYIA 2WB1A 3DKXA 4YFKF 4HNUA 3TW7A 5EYRA 4AD9A 2XPUA 4X1EA 5DV5A 3KZIC 3R0AA 2M45A 3QODA 5JR3A 4ENKA 1JUMA 4GRIA 3VYUB 2YU3A 2NOJB 1TWAJ 4RB2C 2STWA 3CO6C 5JI6A 5E3LA 2NYXA 5EEAA 3S1NJ 2E2HJ 2LR8A 1MJAA 4RB0A 3A4CA 3G2BA 3KP3A 1R71A 5M5WJ 3GFIA 3HOXJ 3F0CA 1SAUA 2DI3A 5ICEA 4YELA 3HXLA 4G6TB 2UUZA 3JSOA 4CZCA 3G1MA 3QWLA 2VQGA 3OYNA 1FSEA 2LFBA 3T0YA 2JUGA 1KU9A 1NH3A 1K61A 3F8FA 3PJRA 2DXIA 3EUKL 2IGNA 1VQMI 2P7VB 1T38A 1T8IA 3U9GA 1LPQA 1IRZA 2CGPA 4HZFA 4HSTA 3H5NA 1RI7A 5H6RA 3S15J 2OTJI 3F3XA 2FUG2 2VE8A 2VIXA 3H9JA 5FKNA 4A3JJ 1JT6A 2XB5A 4B47A 3S2WA 4X0GA 1DDNA 2WAQA 1ZRCA 2JA6J 2XROA 5J1UA 3GTLJ 2RN7A 3IRRA 3ZQLA 1FY7A 1TNTA 3ECHA 4EATA 1RIOH 5EEHA 3OMYA 4OAZA 1CF7A 1OJLA 1NTCA 3HHGA 1PVEA 5A2QZ 2M9HA 1JTXA 2DA7A 1T0FC 1HA8A 1FTZA 1P6RA 5L3BA 4L18B 2WY7Q 5LEJA 3K1NA 1ZG5A 4XKVA 3C2BA 4DBRA 1IRXA 1XN7A 2WBMA 2HTSA 3TQNA 4BQNA 1A36A 2ZMEC 4A3FJ 2JWTA 5EG0A 3F8CA 1JKRC 2Y30A 3WGIA 1VFCA 3I4NJ 3DWLE 2DO7A 2FNPA 2V9VA 2QWWA 1I50J 3FDYA 3N05A 4GYIA 1HKSA 1U5TA 2ZJQF 1R1VA 4OOIA 3KEOA 1N25A 1AOYA 4EGZA 1OCPA 1HCRA 2LK2A 4AIKA 4MEYF 5AIQA 2X0LA 3UNGC 1QQIA 2P4WA 4DQ2A 3I0TA 2W84A 2XPVA 2M0CA 4P9FA 1VQNI 4GO1A 4ANJA 2LREA 4CA0A 3H5AA 4KITB 2VJIA 3O2PE 1ZGJA 3ZQHA 3S3MA 3JRCA 4M3DA 2GXAA 2E5ZA 3BG9A 1A04A 1UCRA 3AAFA 1KZHA 4IOCF 1RZ4A 3H9QA 3SXYA 4ZYDA 2FA5A 3HOYJ 2DLLA 3RZOJ 3Q9SA 2OV7A 2IP2A 1R4NB 2RC4A 1JKPC 4F3QA 1D3YA 4BXUA 4M3EA 2QZ8A 3JRBA 1FT9A 3WE2A 1BR4A 1U9OA 4P1WA 1Z3XA 1K78A 3H92A 2Z1DA 3ZQGA 3FM5A 3KZYA 3OSFA 4CYCB 3BP8A 4IQ4A 3WTTC 3EUHC 3K70D 4RA2A 2LBFA 4XORA 2DMQA 2IGKA 2W85A 1OR7A 4LG3A 2F4IA 4YRVA 2NS0A 3FHNA 4B3AA 3Q0WA 4NC6A 2JTVA 4WXDA 2ECCA 1KU2A 2K9NA 3HZJA 3T8TA 5HNHA 2KPMA 3PSIA 3DF8A 1WJDA 2HR3A 3BWGA 1WH5A 3HSRA 4EJOA 3T8RA 3S93A 3TP3A 3ZMUA 4L0ZB 1TP4A 3K9TA 2QEXI 3HOWJ 2EILH 4A3GJ 2M87A 3J7AO 2YSRA 1X1BA 3D5SC 3IH2A 4XRFA 3RKXA 5B66C 1GHCA 4IL6C 1UFMA 4EJTA 3CMYA 5M3FJ 1Z6RA 3BTCA 1ULYA 4W97A 4CCOA 3JAMK 2DK8A 2ID3A 4C3HJ 5F04A 3J80Z 5LHHA 2R92J 3JRIA 1Y0NA 2JK3A 2CO5A 3RPUD 5FJ8J 1S7AA 3KCCA 2A69F 3IWFA 1RR8C 1R58A 3A03A 1NG6A 1JKOC 3OYJA 1Z6TA 1O3QA 1G8XA 4U7DA 1XDSA 1GDTA 1IN5A 4NUBA 2EB7A 2DT6A 3G6EI 4I02A 4PFPA 2E1CA 2JRTA 4RGUA 1UHMA 3SZGA 3HRMA 1HSTA 2CS3A 4PDKA 1GUUA 2CWEA 3A01A 3RKQA 2RNGA 4GYGA 3OYFA 2NOGA 4B44A 2STTA 1QU3A 1WH7A 4EM1A 1SC7A 3GWZA 4CXFA 1IUYA 1X4PA 5IY5H 5DCFA 3DEEA 2PFBA 1MNDA 2CQXA 3MKLA 1PUFB 1WGXA 3CCYA 3ZMVA 2IS4A 5D5VB 3OIOA 4XRSG 2G0EA 3BY6A 2XASA 1MMDA 3K4CA 4R8HA 3EDPA 2VONA 2LYCA 5EGOA 3E5UA 4KJZA 5JLWA 2PN6A 3CC4I 2FXAA 2JSPA 1IAWA 3ML6A 3HJEA 2KIMA 4BHBA 1USSA 3OYBA 1SMYF 1HF0A 4XL9A 1XPXA 1GVDA 2VKVA 2HKOA 5GADJ 4Y17A 1GV5A 3BZCA 1KQ9A 2E1MB 3WTZA 3CLOA 2XSJC 5DCMA 4NQWA 2A3SA 2LC2A 2CUZA 1U2WA 1TL8A 5HLIA 2HU9A 1V3FA 3E3VA 3H5RA 1IJWC 3QYFA 2W00A 4M3BA 4BJTA 4BE2A 2V79A 2CH0A 4UB8C 1BI3A 1HW1A 1RNLA 4BY7J 4XLEA 4LOCA 5KHDA 4MQ9F 2GLOA 3JRDA 3WU0A 4EQQA 2WV0A 1V5EA 4BS9A 2GZWA 2XV4S 1Q1HA 3F9KA 1MJBA 1XSVA 4KN7X 4DYRA 4ZYGA 2DU9A 4FETA 3DTEA 3A2KA 5B1BH 1HC8A 4PGGA 5KVRA 3LSGA 1XX5A 5H2FC 4A2UA 2DQLA 3MZ8A 2K40A 1LFPA 1TLHB 3JSPA 4M71A 2OPTA 2BXZA 4A3CJ 1UAAA 2RDPA 3VYSB 5DM6F 1D0YA 2XSDC 2AQEA 4XLNF 1A6QA 2NXNB 2OTLI 3H36A 2Q1ZB 3HKZN 2XGDA 3MD2A 5CVIA 2BXYA 4C2UA 4RMNA 2XAHA 1MMGA 2DFHA 3L2CA 3I54A 4IHSA 4XNFA 2ISZA 1DQUA 5E8GA 5F08A 4B48A 2VE9A 3PSFA 2PMZA 4JX6A 4UUSA 2VKEA 2ZC2A 3I9V2 1Z7UA 2MD0A 3BG3A 1N78A 2KFDA 4C2TA 1AA7A 5FKMA 3I58A 1T2KA 1R9TJ 1WCMJ 5LGTA 3RYRA 3PUFA 2XKPA 4BE1A 2VBZA 5E1XA 1M1EB 1HW5A 1SVMA 2KIQA 1LDJA 2M7AA 2YPRA 3ZQFA 2JPCA 1DUXC 2DJIA 4BEHA 2OD5A 2V1NA 4G6DA 2HQNA 2JUCA 4N9IA 3HOSA 3NRVA 5ICGA 2P7CB 4A3BJ 3CCMI 3GO5A 3ONQA 3GZNB 3E5QA 3S2DJ 5GTHC 3MCZA 4XR6A 5F64A 3BJ6A 1I3AA 4LLNA 3IH3A 2Y0SN 2ZJ2A 3EETA 1IDYA 3F6OA 1U5TC 5EG0B 2COMA 1R1TA 4E7KA 3ZXSA 1OCTC 1H9TA 2EFQA 4UVAA 1E3HA 1MGTA 2TDXA 3M9AA 5D4RA 4XKBA 4I6ZA 3DLAA 2GOXB 3K2AA 2HVQA 1MH3A 4PJLA 2VLAA 3H0DA 4I01A 3LSJA 5D6FA 3KP2A 1D0ZA 1APLC 5ILSA 4G12A 3QP6A 4EM2A 1NK2P 3RQIA 4D7NA 2F4OB 5EJCA 3ERMA 1I1GA 3O3KA 1XC5A 3N97A 1I6HJ 1ZR2A 3Q0VA 5GTIC 3DEUA 3FXMA 3LL7A 1ZGAA 5J8FA 4BNCA 1JUSA 2CFXA 3GFLA 4EMSA 4M6VA 2FBKA 3CO7C 3ECOA 4IQJA 1O3RA 1KGSA 2GIVA 1OLTA 3PIOF 3QAHA 2L54A 1BN5A 1OR7C 1W36C 2JVHA 5LGUA 3D5RC 2LBFB 2A5WA 5F0FA 1MDMA 2DJNA 2VOPA 2R93J 1T39A 3S3OA 2OBPA 5L3CA 3QU3A 2OC6A 1TZLA 2OCEA 5FGMA 3F6VA 4IJAA 1KYZA 1B72B 1B9MA 3ZP5A 2Y75A 4I7HA 1ZHFA 1X3UA 2R7FA 3HGGA 5K7FA 3DBLB 2HPMA 4EGYA 1F36A 2MG4A 4KUMA 1DU0A 2H94A 2L4MA 2XAJA 2F5DA 3DKWA 2CW7A 2KRHA 3ABMH 4M9ZA 3WODF 1HW2A 3QPHA 4XKCA 1ETQA 1LKXA 1Z91A 2I5UA 2CYYA 1FOYA 3D0SA 3S14J 2D1VA 2NAZA 2OQGA 2Z99A 1YS7A 2V26A 3OL4A 2QLZA 4II3A 2XPWA 4L9VA 1XCBA 2M0MA 1TQPA 1B59A 4MIMA 1IGNA 1G3YA 2FNAA 2B0LA 1RPWA 1T95A 4S05A 3OSGA 1RRJA 1VQKI 4NBQA 1BIAA 1ZK8A 2Y0MA 1J09A 4NC8A 4XOPA 5FO5A 3ZN0A 1R00A 3GMEA 5IYDJ 1JUPA 5J8CA 2DYSH 2HZDA 4W1UA 3CUQB 4PGHA 3FKIJ 2HDCA 3VOEA 5B1AH 1SD6A 3EUHA 3N4MA 2VJ5A 4CGZA 3PO2J 5E17F 2NVYJ 5CQEA 3P9IA 3S8PA 4ESJA 3RYPA 2HXOA 5HOOA 3PQKA 3GVAA 4G9YA 1P2FA 4AIDA 1BL0A 2ZBKA 4RAZA 1R23A 5HODA 2E34A 2L9SA 2VBYA 2PI0A 1JHHA 3V7RA 4JQFA 4WF2A 4LB5A 4OIPF 3V42A 2WA0A 2W7NA 1BOBA 2CG4A 2KL4A 4B09A 2JT1A 3DV8A 1ZYRF 4NDLA 2XGCA 2KISA 1S3JA 3FIWA 4FCYA 5ICFA 3ZN1A 4CH7A 2KJBA 3FK6A 2JZYA 4I0AA 2KLOA 4CUGA 4BQAA 3E97A 3I3LA 1IRFA 2P6TA 1B4AA 4V19K 5F27A 4XIDA 3TEDA 1T56A 3EPZA 1BIBA 5E79C 5FLVA 3Q5FA 5F1JA 3FHZA 1UG0A 3HUGA 4AC0A 1FOKA 1LNWA 5FKLA 4XN0A 3EYIA 4TV7A 1WWXA 4BHPA 2QBYB 1R1UA 1VQPI 5ED4A 2R7DA 4BQOA 3M1EA 3JAMZ 3I64A 2PJPA 4XLAA 2JA2A 4UY8I 1XMXA 3CDLA 1S6LA 2WC2A 1HOMA 1OYWA 1FP2A 2MFZA 2VI6A 4EJUA 3H35A 3VWBA 5DEQA 2A6HF 5C4XJ 4QIWN 2CQ7A 5K7HA 4BHCA 4HV5A 1IN6A 5CVJA 3PFIA 4YFNF 1U8RA 3MVPA 4YFXF 1O4XA 2ZNZA 2LKXA 3MEXA 3O6BB 2KMUA 5IP6A 2K3PA 4P55A 2VJJA 2I8DA 2DQRA 3MQ0A 2R7SA 4AIHA 2ZJRF 1IRGA 2BY1A 3ZR8X 3HOTA 4M72A 4EVIA 2LP0A 3OYGA 4LIUA 2OQRA 1VQ8I 3C2HA 3IV5A 3P5JA 5LLQA 4ENMA 3S16J 5D4SA 3G3ZA 1NG7A 3QU6A 1SEUA 1RESA 3OYIA 3CCUI 3IKVA 1R5GA 3L09A 2E5NA 1NHAA 1ZKGA 2DFIA 2KZVA 4A5NA 1IV6A 3QYEA 2LOOA 2J5OA 3W3CA 4MQVA 3VSKA 2E7WA 5J6XA 2BVMA 3O8GA 4CZZA 2R7RA 2ZJPF 2P8TA 5EZHA 1YIOA 4U0VA 1MJ9A 3V4GA 2AQFA 2A05A 5BOXA 1ZRFA 1LE8A 4CCJA 1QHGA 4MLOA 1ETVA 1LVAA 4FE7A 1V5GA 5J47A 3OYCA 3A1YA 2G9WA 3LFKA 2WAEA 4A0XA 2O5RA 3E5XA 2XC7A 1W7PA 4KA4A 2HXIA 3W2VA 1R7JA 2LRDA 2M8EA 3D5LA 4XOTA 1FMVA 2BY0A 2V6CA 2X1CA 3TOAA 3TBIA 2GOMA 3K6GA 4BEHB 1MZBA 1Z77A 2DA5A 4ITVA 4M73A 2O8KA 3EUAA 1O57A 1WRJA 2EZKA 5IP7J 1SD5A 1L3LA 3QYBA 1MMSA 3K0LA 5FB2A 4FQGA 4A3EJ 2B63J 1FLIA 1RKTA 2H1LA 1YQAA 3BR0A 2P6SA 4CO8A 1XSXA 3AG3H 2JQ7A 1FWZA 2HYJA 3HGYA 5HNFA 4BXXJ 4BBSJ 4XN3A 5J1YA 3KE2A 1O7LA 4JK1X 1D5YA 3RTRA 2QCOA 3IAS2 1CGPA 3GYHX 1W36D 1K7AA 3RI4A 4IF4A 2C6YA 1ETKA 3VEPA 4R1HA 4ZZLA 5JLXA 4KIGA 2VC0A 5DS9A 2EA4A 1P4AA 3MFKA 4ESFA 2VXZA 2R7ZJ 4RLQA 2CJJA 2XF5A 1DP3A 3RKWA 1K4TA 4BGDA 2HOSA 3LOCA 1OKRA 2PX9A 2F5CA 3PNYA 3W6VA 1ZREA 4U0YA 2X85A 3WTWC 4KYWA 3BR3A 5J40A 1ZN2A 1O7FA 5FRMA 1SMTA 2EIKH 3ABKH 1V55H 4I76A 2R5YA 1YJNI 4AWXB 2X6XA 3I55I 1YRNA 4JP0A 2K7LA 4I98B 2DN0A 4F52A 4HX8A 4V2GA 4KN4X 1REPC 3CP8A 5JVGF 2JN6A 1D1BA 2ZMEB 1TNSA 4M3GA 4BL0B 3I71A 5BPDA 1E3PA 1WKMA 2K4BA 2DMNA 1G59A 3QPTA 2BHYA 1SANA 3VYRB 4GDFA 5D5WB 3KYLA 2G7HA 2M4KA 2ZCWA 3H0GJ 2MGQA 4XLFA 1ZARA 2NNNA 3M4OJ 2CFOA 1HBXG 2PJRA 3K4JA 2HYFA 3M8JA 2XHKA 3CLQA 4LIVA 2EIJH 5IP9J 4HYEA 3FXKA 2V1XA 1QPIA 3L2UA 2NVQJ 2R7UA 5HDKA 3TKYA 2EV0A 4EV0A 4WXHA 2KDZA 2CUEA 2L7ZA 4YG2F 4GGGA 1JE8A 3JREA 2EWNA 1JI8A 2X1DA 5L3DA 2LSOA 4XK4A 1IN8A 1RUOA 1Y39A 1WJ5A 2HQ5A 1A6IA 2LY9A 2FU4A 4H0EA 3OV8A 3BJOA 3IWZA 2EQRA 2GXGA 5HS7A 1Y1VJ 2Y9ZA 2ZFUA 3LQQA 4PFOA 1J7KA 1KYWA 1LQ1A 3GTOJ 3SEZA 3R60A 3HG9A 2MH2A 1HSJA 1XSDA 2VC1A 4UB6C 4RBOA 1B6AA 3CC2I 1LUJB 3KYCB 4KT6A 4F7ZA 2R4GA 3GF2A 2Y2ZA 5E3NA 4HRIA 3NQOA 3TMOA 3FXRA 4B4CA 4ZDOA 4A3LJ 5FD6A 4L5JA 2ME6A 4EEFG 1AKHB 3JRFA 3HOZJ 4AYBA 5C3EJ 3ZMTA 4CCNA 3Q0UA 2HKXA 4A0YA 4BU2A 5LRSA 2HS5A 2JA8J 2NNYA 5K5RA 1SVOA 1JGGA 2L7KA 1W5CC 2Q2EB 1S72I 2X4HA 4RGSA 3B02A 2BVLA 1I5ZA 2YR2A 4I2OA 3I59A 4XLPF 2DDAA 3TDZC 3K10A 1XTAA 3FXOA 3QOPA 3HUGB 1U3EM
chains in the Genus database with same CATH topology
3D1NI 3BR6A 3HOVJ 4C2MJ 4IEJA 4UUTA 2DMPA 2FX0A 3BG5A 4BBRJ 3ZQFA 1MBGA 1MBHA 2JA7J 1AKHA 2L9RA 4GFBA 1WI3A 4A3BJ 2ID6A 2XB0X 3WHBA 3S2DJ 2DTZA 5FKOA 1TWHJ 4MFEA 1JKQC 5J3LA 3PM1A 3S1QJ 3IH3A 2Y0SN 3K7AJ 2JA5J 3BQZA 1IDYA 3FISA 5EG0B 1OCTC 1MBKA 1IUFA 2EH3A 3FK7A 2WB1N 1ORKA 1HLVA 2KT0A 1ETYA 4BKXA 4HNVA 5DTDA 4I6ZA 1QVTA 1X2NA 3LNQA 3K2AA 1U9NA 3RZDJ 1LFBA 1TWFJ 3BTJA 1MH3A 2DA1A 2GM4A 2ME0A 1W0TA 4ABZA 3LSJA 3HM5A 1APLC 1JJ8C 3S2HJ 4G12A 2EZHA 1VF9A 1QRYA 1UG2A 1NK2P 3RQIA 4D7NA 1H89C 2HDDA 3OOUA 1XC5A 5C44J 3LSRA 4A93J 1I6HJ 5FKKA 3O8HA 1ZR2A 3Q0VA 1B8IB 1P7JA 1HDDC 1IG7A 2EZIA 2H1KA 1JUSA 3HBLA 4M6VA 1FEXA 1AU7A 5E3MA 1TC3C 1S7EA 2MW8A 3IH4A 3HDDA 3L1PA 5F0FA 1ZTRA 4A3MJ 2DJNA 2R93J 5EF6A 4IHWA 2WAQN 4RDUA 2FQ4A 1B72B 5M3MJ 2IBDA 3HGGA 5K7FA 1ETOA 5M5YJ 2LD5A 4J19A 1F36A 2MG4A 4A69C 1DU0A 1ETXA 3JRGA 4S0HB 2LVSA 1ETQA 4JYKA 4IHXA 2VUMJ 1TWCJ 3GTPJ 1W0UA 3MN2A 3JRHA 3S14J 3BT9A 4MO7A 3TW7A 5EYRA 2XPWA 1H8AC 2XPUA 4X1EA 4C3JJ 5E3OA 1JUMA 4MIMA 1QVUA 1IGNA 1RPWA 1TWAJ 3OSGA 2AHQA 3JRAA 2Y31A 3BQYA 1B72A 1ZK8A 5E3LA 3GTMJ 4DZJA 5EEAA 3S1NJ 2E2HJ 1JUPA 2LR8A 5IYBJ 5IYDJ 4W1UA 1XG1A 3FKIJ 1K83J 3PO2J 5M5WJ 3HOXJ 3F0CA 2NVYJ 2HXOA 3M3YJ 2GBYA 2WV1A 3G1MA 4QTRA 3G1OA 4D5CA 1BL0A 2LFBA 5HODA 3CQZJ 1K61A 2DA2A 2XGEA 2M8GX 3Q3SA 4FE4A 2IAIA 1ETWA 4D7MA 1IRZA 1RKWA 1Y1WJ 4NDLA 2XGCA 4FCYA 2ECBA 3FIWA 3S15J 9ANTA 1H88C 1YRNB 3BTLA 1RR7A 3BR5A 3FK6A 3GTQJ 5FKNA 4A3JJ 3BTIA 1JT6A 2XB5A 5F27A 3E7LA 4XIDA 3TEDA 1T56A 3SDGA 5BNGA 2JA6J 1UHSA 5FLVA 5J1UA 3GTLJ 5F1JA 3BR2A 4AC0A 2NS8A 2R5ZA 5J1RA 3ZQLA 5FKLA 2N8GA 5FLMJ 3H3VK 1FIAA 1OJLA 1NTCA 1FIPA 2CQQA 2M9HA 5IYCJ 3HB9A 1JTXA 2Y9YA 2DA7A 4Y52J 1ITYA 5K7ZA 1FTZA 1EF4A 3GTGJ 4B1RA 2NVTJ 2DA3A 1Z0XA 3CDLA 2L7MP 4IHVA 1HOMA 2HOTA 3C2BA 2VI6A 1AHDP 3DCFA 2YU9J 2M34A 4D5FA 4A3DJ 4A3FJ 5C4XJ 4QIWN 2JWTA 1I3QJ 5K7HA 5EG0A 5C4JJ 2NS7A 4IHYA 1T33A 1JKRC 2Y30A 1VFCA 1POGA 3I4NJ 2CRGA 1I50J 3MVPA 2W48A 1O4XA 1OCPA 2ZB9A 3VPRA 2LK2A 2LKXA 1HCRA 2EZLA 2TRTA 5IP6A 2XPVA 2M0CA 2L0KA 4XRSA 1LE8B 1GV2A 3ZOBA 3ZQHA 3JRCA 4M3DA 2O7OA 2LP0A 3BG9A 4X6AJ 1JJ6C 4QSHA 3IV5A 3HOYJ 3S16J 1RETA 3RZOJ 2E19A 5IPAA 1B8IA 1RESA 3S17J 2QF7A 1JKPC 1A5JA 4M3EA 1ZKGA 4DYQA 5EDNA 3JRBA 3S1RJ 1IV6A 1U8BA 3QQAA 1U9OA 2OF7A 1GT0C 3ZQGA 1TWGJ 3O8GA 3OSFA 2FJ1A 3GTJJ 5EZHA 4CYCB 2JMWA 1MSFC 1IC8A 1LE8A 2DMQA 1FJLA 4MLOA 1ETVA 2CU7A 4FE7A 2DA6A 3TW6A 1G2HA 3S1MJ 2EBIA 4B3AA 1BW6A 3Q0WA 2ECCA 2K9NA 3QPLA 2HXIA 1WH5A 3TP3A 1Z77A 2DA5A 2O8KA 2AO9A 3A01B 3HOWJ 5IOZA 2EZKA 3G1LA 4A3GJ 4DZPA 5IP7J 4C3IJ 4V2FA 3IH2A 4A3EJ 2B63J 4CYCA 4FISA 2HOAA 3CMYA 5M3FJ 1RKTA 3BTCA 3BR0A 2DMUA 2YUSA 4W97A 1Q1VA 2ID3A 2HYJA 3HGYA 4M3FA 4C3HJ 2FD5A 5F04A 4BXXJ 4BBSJ 3JR9A 2I10A 2R92J 1BW5A 3JRIA 2JK3A 2NVXJ 5J1YA 2LTPA 3NARA 4XICA 2R5YB 5FJ8J 1D5YA 5EGOB 2QCOA 3A03A 1JKOC 3GTKJ 2E1OA 1GDTA 1ETKA 1X2MA 4JX5A 5JLXA 2X48A 5DS9A 3A01A 1GUUA 3RKQA 1VNDA 3HOUJ 2NOGA 2CUFA 1BA5A 2R7ZJ 1WH7A 2X6OA 2CJJA 2VPRA 2HOSA 3LOCA 2R0QC 3W6VA 2CQXA 3MKLA 1ZGWA 1PUFB 1WGXA 3CCYA 3BR3A 1JTYA 3OIOA 4XRSG 2G0EA 5GPCA 3QPSA 2HI3A 1IDZA 2TCTA 4I76A 2R5YA 1MSEC 4AYBN 5EGOA 1YRNA 5JLWA 2MSYA 3DEWA 4JP0A 2ELKA 3SFIA 2DN0A 4L5EA 4V2GA 2P81A 4Y7NJ 1HF0A 2JN6A 1BJZA 4DW6A 2O9LA 2PMZN 3SJMA 1GVDA 2VKVA 4M3GA 2E2IJ 1GV5A 4BY1J 2DMNA 5M5XJ 1SANA 1NK3P 1UMQA 5IOYA 1ENHA 3H0GJ 2MGQA 5GPAA 2DMTA 1PUFA 1IJWC 2JJ7A 3B6AA 4M3BA 3M4OJ 2K9QA 2K9SA 1X58A 5EZGA 5F0CA 4BY7J 5IP9J 4LOCA 1QPIA 2NVQJ 2GLOA 2D5VA 2E2JJ 3JRDA 2RAEA 3UKGA 2KDZA 2CUEA 1MBJA 2L7ZA 4DYCA 1SFOJ 3WHCA 2H8RA 3LSPA 2X9DA 3JREA 1ZR4A 1F43A 1VI0A 3A02A 4XK4A 1MH4A 4DYRA 2HQ5A 1A6IA 2LY9A 2LLKA 3LSGA 4UUSB 2L7FP 1P7IA 4AUXA 2XRLA 2DA4A 4FTHA 2EQRA 1Y1VJ 2Y9ZA 2K40A 1JT0A 3GTOJ 2OPTA 4A3CJ 3ZQCA 3GBGA 4RBOA 1MBEA 2Y2ZA 5E3NA 2XSDC 4B4CA 1LFUP 4A3LJ 2COBA 2ME6A 4EEFG 1AKHB 3HKZN 1HDPA 3JRFA 3HOZJ 2XGDA 1FTTA 1DU6A 1MNMC 5C3EJ 2IEKA 2YS9A 3Q0UA 1ZQ3P 4A3KJ 3I4MJ 1E3OC 4XRMA 1U78A 2JA8J 3PO3J 1OFCX 3NAUA 5F08A 5GP9A 1JGGA 3TP0A 4UUSA 4JX6A 1CQTA 2VKEA 1WPKA 1XS9A 2M2EA 3BG3A 4A3IJ 1MBFA 3B6CA 3ZQIA 5FKMA 3HEFA 4MFDA 5F0HA 1R9TJ 4JX4A 1WCMJ 3BR1A 2R5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1N I;  3BR6 A;  3HOV J;  4C2M J;  4IEJ A;  4UUT A;  2DMP A;  2FX0 A;  3BG5 A;  4BBR J;  3ZQF A;  1MBG A;  1MBH A;  2JA7 J;  1AKH A;  2L9R A;  4GFB A;  1WI3 A;  4A3B J;  2ID6 A;  2XB0 X;  3WHB A;  3S2D J;  2DTZ A;  5FKO A;  1TWH J;  4MFE A;  1JKQ C;  5J3L A;  3PM1 A;  3S1Q J;  3IH3 A;  2Y0S N;  3K7A J;  2JA5 J;  3BQZ A;  1IDY A;  3FIS A;  5EG0 B;  1OCT C;  1MBK A;  1IUF A;  2EH3 A;  3FK7 A;  2WB1 N;  1ORK A;  1HLV A;  2KT0 A;  1ETY A;  4BKX A;  4HNV A;  5DTD A;  4I6Z A;  1QVT A;  1X2N A;  3LNQ A;  3K2A A;  1U9N A;  3RZD J;  1LFB A;  1TWF J;  3BTJ A;  1MH3 A;  2DA1 A;  2GM4 A;  2ME0 A;  1W0T A;  4ABZ A;  3LSJ A;  3HM5 A;  1APL C;  1JJ8 C;  3S2H J;  4G12 A;  2EZH A;  1VF9 A;  1QRY A;  1UG2 A;  1NK2 P;  3RQI A;  4D7N A;  1H89 C;  2HDD A;  3OOU A;  1XC5 A;  5C44 J;  3LSR A;  4A93 J;  1I6H J;  5FKK A;  3O8H A;  1ZR2 A;  3Q0V A;  1B8I B;  1P7J A;  1HDD C;  1IG7 A;  2EZI A;  2H1K A;  1JUS A;  3HBL A;  4M6V A;  1FEX A;  1AU7 A;  5E3M A;  1TC3 C;  1S7E A;  2MW8 A;  3IH4 A;  3HDD A;  3L1P A;  5F0F A;  1ZTR A;  4A3M J;  2DJN A;  2R93 J;  5EF6 A;  4IHW A;  2WAQ N;  4RDU A;  2FQ4 A;  1B72 B;  5M3M J;  2IBD A;  3HGG A;  5K7F A;  1ETO A;  5M5Y J;  2LD5 A;  4J19 A;  1F36 A;  2MG4 A;  4A69 C;  1DU0 A;  1ETX A;  3JRG A;  4S0H B;  2LVS A;  1ETQ A;  4JYK A;  4IHX A;  2VUM J;  1TWC J;  3GTP J;  1W0U A;  3MN2 A;  3JRH A;  3S14 J;  3BT9 A;  4MO7 A;  3TW7 A;  5EYR A;  2XPW A;  1H8A C;  2XPU A;  4X1E A;  4C3J J;  5E3O A;  1JUM A;  4MIM A;  1QVU A;  1IGN A;  1RPW A;  1TWA J;  3OSG A;  2AHQ A;  3JRA A;  2Y31 A;  3BQY A;  1B72 A;  1ZK8 A;  5E3L A;  3GTM J;  4DZJ A;  5EEA A;  3S1N J;  2E2H J;  1JUP A;  2LR8 A;  5IYB J;  5IYD J;  4W1U A;  1XG1 A;  3FKI J;  1K83 J;  3PO2 J;  5M5W J;  3HOX J;  3F0C A;  2NVY J;  2HXO A;  3M3Y J;  2GBY A;  2WV1 A;  3G1M A;  4QTR A;  3G1O A;  4D5C A;  1BL0 A;  2LFB A;  5HOD A;  3CQZ J;  1K61 A;  2DA2 A;  2XGE A;  2M8G X;  3Q3S A;  4FE4 A;  2IAI A;  1ETW A;  4D7M A;  1IRZ A;  1RKW A;  1Y1W J;  4NDL A;  2XGC A;  4FCY A;  2ECB A;  3FIW A;  3S15 J;  9ANT A;  1H88 C;  1YRN B;  3BTL A;  1RR7 A;  3BR5 A;  3FK6 A;  3GTQ J;  5FKN A;  4A3J J;  3BTI A;  1JT6 A;  2XB5 A;  5F27 A;  3E7L A;  4XID A;  3TED A;  1T56 A;  3SDG A;  5BNG A;  2JA6 J;  1UHS A;  5FLV A;  5J1U A;  3GTL J;  5F1J A;  3BR2 A;  4AC0 A;  2NS8 A;  2R5Z A;  5J1R A;  3ZQL A;  5FKL A;  2N8G A;  5FLM J;  3H3V K;  1FIA A;  1OJL A;  1NTC A;  1FIP A;  2CQQ A;  2M9H A;  5IYC J;  3HB9 A;  1JTX A;  2Y9Y A;  2DA7 A;  4Y52 J;  1ITY A;  5K7Z A;  1FTZ A;  1EF4 A;  3GTG J;  4B1R A;  2NVT J;  2DA3 A;  1Z0X A;  3CDL A;  2L7M P;  4IHV A;  1HOM A;  2HOT A;  3C2B A;  2VI6 A;  1AHD P;  3DCF A;  2YU9 J;  2M34 A;  4D5F A;  4A3D J;  4A3F J;  5C4X J;  4QIW N;  2JWT A;  1I3Q J;  5K7H A;  5EG0 A;  5C4J J;  2NS7 A;  4IHY A;  1T33 A;  1JKR C;  2Y30 A;  1VFC A;  1POG A;  3I4N J;  2CRG A;  1I50 J;  3MVP A;  2W48 A;  1O4X A;  1OCP A;  2ZB9 A;  3VPR A;  2LK2 A;  2LKX A;  1HCR A;  2EZL A;  2TRT A;  5IP6 A;  2XPV A;  2M0C A;  2L0K A;  4XRS A;  1LE8 B;  1GV2 A;  3ZOB A;  3ZQH A;  3JRC A;  4M3D A;  2O7O A;  2LP0 A;  3BG9 A;  4X6A J;  1JJ6 C;  4QSH A;  3IV5 A;  3HOY J;  3S16 J;  1RET A;  3RZO J;  2E19 A;  5IPA A;  1B8I A;  1RES A;  3S17 J;  2QF7 A;  1JKP C;  1A5J A;  4M3E A;  1ZKG A;  4DYQ A;  5EDN A;  3JRB A;  3S1R J;  1IV6 A;  1U8B A;  3QQA A;  1U9O A;  2OF7 A;  1GT0 C;  3ZQG A;  1TWG J;  3O8G A;  3OSF A;  2FJ1 A;  3GTJ J;  5EZH A;  4CYC B;  2JMW A;  1MSF C;  1IC8 A;  1LE8 A;  2DMQ A;  1FJL A;  4MLO A;  1ETV A;  2CU7 A;  4FE7 A;  2DA6 A;  3TW6 A;  1G2H A;  3S1M J;  2EBI A;  4B3A A;  1BW6 A;  3Q0W A;  2ECC A;  2K9N A;  3QPL A;  2HXI A;  1WH5 A;  3TP3 A;  1Z77 A;  2DA5 A;  2O8K A;  2AO9 A;  3A01 B;  3HOW J;  5IOZ A;  2EZK A;  3G1L A;  4A3G J;  4DZP A;  5IP7 J;  4C3I J;  4V2F A;  3IH2 A;  4A3E J;  2B63 J;  4CYC A;  4FIS A;  2HOA A;  3CMY A;  5M3F J;  1RKT A;  3BTC A;  3BR0 A;  2DMU A;  2YUS A;  4W97 A;  1Q1V A;  2ID3 A;  2HYJ A;  3HGY A;  4M3F A;  4C3H J;  2FD5 A;  5F04 A;  4BXX J;  4BBS J;  3JR9 A;  2I10 A;  2R92 J;  1BW5 A;  3JRI A;  2JK3 A;  2NVX J;  5J1Y A;  2LTP A;  3NAR A;  4XIC A;  2R5Y B;  5FJ8 J;  1D5Y A;  5EGO B;  2QCO A;  3A03 A;  1JKO C;  3GTK J;  2E1O A;  1GDT A;  1ETK A;  1X2M A;  4JX5 A;  5JLX A;  2X48 A;  5DS9 A;  3A01 A;  1GUU A;  3RKQ A;  1VND A;  3HOU J;  2NOG A;  2CUF A;  1BA5 A;  2R7Z J;  1WH7 A;  2X6O A;  2CJJ A;  2VPR A;  2HOS A;  3LOC A;  2R0Q C;  3W6V A;  2CQX A;  3MKL A;  1ZGW A;  1PUF B;  1WGX A;  3CCY A;  3BR3 A;  1JTY A;  3OIO A;  4XRS G;  2G0E A;  5GPC A;  3QPS A;  2HI3 A;  1IDZ A;  2TCT A;  4I76 A;  2R5Y A;  1MSE C;  4AYB N;  5EGO A;  1YRN A;  5JLW A;  2MSY A;  3DEW A;  4JP0 A;  2ELK A;  3SFI A;  2DN0 A;  4L5E A;  4V2G A;  2P81 A;  4Y7N J;  1HF0 A;  2JN6 A;  1BJZ A;  4DW6 A;  2O9L A;  2PMZ N;  3SJM A;  1GVD A;  2VKV A;  4M3G A;  2E2I J;  1GV5 A;  4BY1 J;  2DMN A;  5M5X J;  1SAN A;  1NK3 P;  1UMQ A;  5IOY A;  1ENH A;  3H0G J;  2MGQ A;  5GPA A;  2DMT A;  1PUF A;  1IJW C;  2JJ7 A;  3B6A A;  4M3B A;  3M4O J;  2K9Q A;  2K9S A;  1X58 A;  5EZG A;  5F0C A;  4BY7 J;  5IP9 J;  4LOC A;  1QPI A;  2NVQ J;  2GLO A;  2D5V A;  2E2J J;  3JRD A;  2RAE A;  3UKG A;  2KDZ A;  2CUE A;  1MBJ A;  2L7Z A;  4DYC A;  1SFO J;  3WHC A;  2H8R A;  3LSP A;  2X9D A;  3JRE A;  1ZR4 A;  1F43 A;  1VI0 A;  3A02 A;  4XK4 A;  1MH4 A;  4DYR A;  2HQ5 A;  1A6I A;  2LY9 A;  2LLK A;  3LSG A;  4UUS B;  2L7F P;  1P7I A;  4AUX A;  2XRL A;  2DA4 A;  4FTH A;  2EQR A;  1Y1V J;  2Y9Z A;  2K40 A;  1JT0 A;  3GTO J;  2OPT A;  4A3C J;  3ZQC A;  3GBG A;  4RBO A;  1MBE A;  2Y2Z A;  5E3N A;  2XSD C;  4B4C A;  1LFU P;  4A3L J;  2COB A;  2ME6 A;  4EEF G;  1AKH B;  3HKZ N;  1HDP A;  3JRF A;  3HOZ J;  2XGD A;  1FTT A;  1DU6 A;  1MNM C;  5C3E J;  2IEK A;  2YS9 A;  3Q0U A;  1ZQ3 P;  4A3K J;  3I4M J;  1E3O C;  4XRM A;  1U78 A;  2JA8 J;  3PO3 J;  1OFC X;  3NAU A;  5F08 A;  5GP9 A;  1JGG A;  3TP0 A;  4UUS A;  4JX6 A;  1CQT A;  2VKE A;  1WPK A;  1XS9 A;  2M2E A;  3BG3 A;  4A3I J;  1MBF A;  3B6C A;  3ZQI A;  5FKM A;  3HEF A;  4MFD A;  5F0H A;  1R9T J;  4JX4 A;  1WCM J;  3BR1 A;  2R5Z B; 
#chains in the Genus database with same CATH topology
 3K4M A;  3D1N I;  3PNT A;  4JOM A;  4OMZ A;  3LAJ A;  2EIM H;  2ESN A;  3BR6 A;  3HOV J;  2M5W A;  3E6M A;  4IEJ A;  4XKW A;  3OR2 C;  3CJT B;  4BBR J;  1TT0 A;  2KP6 A;  3H1C A;  2M30 A;  1B1B A;  3C18 A;  3CCV I;  2JA7 J;  4LIT A;  4GFB A;  1Z1D A;  2LG4 A;  1GLN A;  4CHU A;  4Q5S F;  1WI3 A;  5LRR A;  3FBI B;  2DOF A;  3CCL I;  1EH6 A;  1RUN A;  1TWH J;  2CV0 A;  1JKQ C;  1IXS B;  1S5L C;  1FC3 A;  2H09 A;  2JA5 J;  5BQT A;  3BQZ A;  1FBS A;  2WAD A;  3ABU A;  3COA C;  2WY8 Q;  3MAJ A;  3BCB A;  1U6G A;  4BAC A;  2XAQ A;  3KP4 A;  2EH3 A;  2VXD A;  2WB1 N;  1ORK A;  2WTE A;  2XF6 A;  3FK7 A;  3IUO A;  4HPQ A;  1ZLK A;  2KT0 A;  1ETY A;  2QUF A;  3CMM A;  3P9C A;  4YIR X;  5DTD A;  3WTX C;  1KU3 A;  4DBQ A;  3BTJ A;  2ME0 A;  1FMW A;  1W0T A;  2VQH A;  1LJ9 A;  1L0O C;  4ZDP A;  2P0W A;  2IVM A;  3HM5 A;  3BDD A;  3VOD A;  1JJ8 C;  3S2H J;  2EZH A;  4XLH A;  4UVC A;  1QRY A;  1U0J A;  1UG2 A;  3K4N A;  4M9S A;  4BYY A;  2AXT C;  3OYM A;  1A35 A;  3GLL A;  3RDI A;  5IT3 A;  1ZEL A;  3EYY A;  2L4A A;  5HLT A;  3W2W A;  5LHG A;  3I5U A;  1G3T A;  4G94 A;  2E36 A;  2KIU A;  2O61 A;  2IPQ X;  4HF2 A;  4I99 C;  1AU7 A;  3IRQ A;  2VJ4 A;  3HSF A;  2OZU A;  1FYL A;  4Y13 A;  1IF1 A;  1XGO A;  2MW8 A;  3IH4 A;  1TQM A;  3HDD A;  2VT2 A;  3R61 A;  3ASO H;  3DKY A;  4ENN A;  2MBF A;  1ON2 A;  1EJ9 A;  1T08 B;  3K4L A;  1ZTR A;  3W6J B;  4A3M J;  2HYG D;  4PSX A;  1D5V A;  4N4N B;  2LKP A;  4XQF A;  2WAQ N;  2FQ4 A;  4P96 A;  3EQL F;  3DP7 A;  3CCQ I;  1YJW I;  3H3Z A;  2IBD A;  2ZXJ A;  3R4K A;  2UV1 A;  4KIF A;  1YI2 I;  3PIP F;  5M5Y J;  2QM3 A;  1WFX A;  4J19 A;  4ZC3 A;  1IW7 F;  4YII A;  4A69 C;  1N75 A;  1BC8 C;  5BMZ A;  4S0H B;  4NHJ A;  2LVS A;  1V54 H;  2VUM J;  3REO A;  1Z7L A;  3JRH A;  2QSG X;  1XGS A;  2VQC A;  3HRU A;  4ZJZ A;  4LD5 A;  4KIS A;  4MO7 A;  4D0P A;  5KAI C;  3JW4 A;  4XSZ F;  4K2E A;  2M1B A;  2MC4 A;  1K4S A;  5E3O A;  4MEX F;  1K6Y A;  2F48 A;  4U7B A;  4F92 B;  2FOW A;  5E1Z B;  3JRA A;  3CD6 I;  4PJN A;  2BW3 A;  2W82 A;  4H4K C;  3GTM J;  1W5S A;  4DZJ A;  5LFA A;  5LEK A;  1OMI A;  1WJF A;  3OR1 C;  2H6B A;  4II2 A;  2P5L C;  3KEY A;  5L3F A;  1VQL I;  1K83 J;  4RB1 A;  2ICW G;  3M3Y J;  5F1R A;  4RS8 A;  2GBY A;  2WV1 A;  2IJL A;  4QTR A;  3KPH A;  4RAY A;  1LB2 A;  4D5C A;  3HTU A;  2HFH A;  3ESW B;  1CF7 B;  2KRC A;  2Z33 A;  5HLG A;  3CQZ J;  2FE3 A;  2QSH X;  2XF7 A;  1YYV A;  4HV6 A;  3MWM A;  2M8G X;  2HQA A;  2RQP A;  4XBF A;  5ICC A;  3QRF F;  5ERI A;  3RQ4 A;  3OYH A;  1EV7 A;  4UNO A;  2W57 A;  2A5Y B;  4XM3 A;  1ZG1 A;  5DUK A;  9ANT A;  2PMU A;  4IKF A;  3BG7 A;  1YRN B;  3BTL A;  1RR7 A;  3BR5 A;  3ZMS A;  4HF0 A;  1J59 A;  2V6E A;  2IS1 A;  3E7L A;  3F8B A;  1W1W E;  1X3Z B;  4EJV A;  3OIQ A;  1EH8 A;  1EH7 A;  3BOQ A;  1MNE A;  3T1B A;  3BR2 A;  2YX4 A;  2R5Z A;  2VB6 A;  5J1R A;  2DPD A;  3FXU A;  1U5T B;  4PUS A;  3WGH A;  4HDV A;  3FMS A;  1FIA A;  2QQ9 A;  4N4O B;  4PJM A;  5E18 F;  1E0E A;  1WZ2 A;  3LA3 A;  3M8F A;  3BPX A;  2CQQ A;  1V5F A;  1W4M A;  2V9P A;  2HQR A;  3HB9 A;  4Y52 J;  1VQ6 I;  3GTG J;  3GEZ A;  2ESH A;  2PJR B;  2CMP A;  3U1D A;  3V7C A;  5D5U B;  2XIG A;  3WG9 A;  2DA3 A;  2NVT J;  3LSH A;  1Z0X A;  5J4Y A;  2R3S A;  2L7M P;  3HTS B;  4IHV A;  2BY2 A;  2F5F A;  3DFG A;  3KET A;  1AHD P;  2UWM A;  4OIR F;  3P9K A;  1DPU A;  2KJC A;  3FBN B;  4A3D J;  2OA4 A;  1MMN A;  3A0H C;  1I3Q J;  2F5V A;  1SFE A;  2NS7 A;  1T33 A;  2F6C A;  4XLC A;  3FZV A;  2CRG A;  3M1C A;  4AIJ A;  1K78 B;  2K3F A;  2D1H A;  3HPH A;  2LMD A;  3FXQ A;  2ZB9 A;  4YEJ A;  3VPR A;  4E7J A;  2EZL A;  2TRT A;  3CP2 A;  3LST A;  2HTJ A;  3VB2 A;  1BOA A;  1WJE A;  4XRS A;  5TJJ A;  3SYT A;  3ZOB A;  4BAY A;  2O8X A;  3GUD A;  4DJA A;  2AXL A;  2O7O A;  1T98 A;  1RC9 A;  1VQ4 I;  1ZG3 A;  2J5P A;  2JPB A;  4BJ6 C;  3I4P A;  3FKJ A;  2BY3 A;  1S8N A;  4FX4 A;  1SAX A;  1D0X A;  2FMY A;  3S17 J;  2LKS A;  4ZYH A;  4KNY A;  3CDH A;  1A5J A;  2Y69 H;  4DYQ A;  5EDN A;  4G7O F;  1U8B A;  1QPM A;  1OCO H;  1YHQ I;  2OF7 A;  1GT0 C;  4KIB A;  5KAF C;  5TRD A;  2UXN A;  2FJ1 A;  4B8X A;  3BLY A;  3MKW B;  3DLL F;  3KP7 A;  5JHF A;  3L2W A;  1K6O A;  1IC8 A;  4KIC A;  3TGN A;  2CU7 A;  1X4O A;  1G2H A;  4G7H F;  3RKY A;  3I56 I;  1BR2 A;  6PAX A;  1Y6I A;  3WTS C;  1UHW A;  2DYR H;  1VZ0 A;  3QPL A;  1JXS A;  5HS9 A;  2ZXI A;  3BRO A;  5AIP A;  4A6E A;  3MKZ A;  4CIC A;  3GXO A;  4F93 B;  5D8K B;  4C9Y A;  2QQ8 A;  4RGX A;  4IX7 A;  4HG2 A;  3A01 B;  5IOZ A;  2HWV A;  4DZP A;  4U0W A;  4V2F A;  2EFO A;  2KHM A;  2XGX A;  4PJ0 C;  5DDG A;  4CYC A;  4LK0 F;  2DMU A;  4CDG A;  1X1D A;  1BC7 C;  2IW5 A;  1G3W A;  3JR9 A;  2I10 A;  1BW5 A;  1WVR A;  2L5Q A;  3NAR A;  5EGO B;  4LK1 F;  3X2Q H;  3GTK J;  2M3A A;  3FMQ A;  1FBU A;  2VOO A;  1X2M A;  4JX5 A;  2X6W A;  1R6R A;  1OIS A;  5E20 A;  1W7P D;  2Z9O A;  3MZH A;  4G6Q A;  3HIF A;  1VND A;  3AKZ A;  2H8W A;  2L02 A;  5FRO A;  2CUF A;  4NNJ A;  4G7Z F;  2DDB A;  2IA1 A;  3SZT A;  4JBA A;  5D6E A;  5DCM B;  4NQW B;  3W6K B;  3L2R A;  3OS0 A;  2EJR A;  3GZ5 A;  2IS2 A;  1IN4 A;  1ZGW A;  3KP6 A;  3FM3 A;  4LLG F;  1JTY A;  3FXL A;  5GPC A;  3QPS A;  2X6Y A;  4GCV A;  3GX4 X;  2HI3 A;  1FOX A;  3AL0 C;  2RNJ A;  3TO9 A;  4FX0 A;  2MSY A;  3DEW A;  3IL2 A;  5FLX K;  2ELK A;  3IAM 2;  3SFI A;  3M8E A;  1YW9 A;  3AL0 B;  2BYV E;  3AG4 H;  2DCE A;  2P81 A;  4Q4Z F;  1BJZ A;  4DW6 A;  2D45 A;  2PMZ N;  5K5Q A;  3V8K A;  3V7S A;  3OYA A;  1T6S A;  2E2I J;  3CJQ B;  2R7O A;  4HX7 A;  2VL8 A;  2PBI A;  4BY1 J;  1FSH A;  3U21 A;  1X19 A;  1P92 A;  3G4S I;  1IXR C;  2P5V A;  5HVQ C;  1HXD A;  5M5X J;  3GFM A;  3J81 K;  2W25 A;  3C2G A;  4EJW A;  4HQM A;  2MLG A;  2DMT A;  1PUF A;  3OYD A;  1IO2 A;  2JJ7 A;  3B6A A;  2GIZ A;  3BJA A;  4L0Y B;  4MGR A;  2K9Q A;  2MA3 A;  2K9S A;  5BPI A;  5DD4 A;  1FZP B;  4WCG A;  4IZZ A;  3RSN A;  4J00 A;  2DFF A;  3HRS A;  4IRG A;  2D5V A;  2E2J J;  4ZH4 F;  2RAE A;  1MBJ A;  4DYC A;  3WHC A;  3OS1 A;  3LSP A;  4ZYE A;  2VKD A;  2X9D A;  4F55 A;  1YOV B;  2BZT A;  4RM3 A;  2ZFW A;  1VI0 A;  2ZSI B;  3A02 A;  4IRI A;  2LF7 A;  1Z05 A;  5IT9 K;  2KZG A;  2LLK A;  4UUS B;  5B3S H;  2L7F P;  1P7I A;  2XRL A;  4Y3O A;  2DOD A;  4FTH A;  1H9G A;  1MW7 A;  3LWF A;  4J01 A;  3LAP A;  1SFK A;  3F23 A;  3ZQC A;  3DXJ F;  5CKT A;  2DOE A;  3WU2 C;  2ELJ A;  2L01 A;  2CSO A;  4DIQ A;  4PCQ A;  1FYK A;  1DGR M;  3NWT A;  3U1K A;  1ERD A;  1J0R A;  2COB A;  3HHH A;  4U87 A;  3L00 A;  3HYI A;  5KCM A;  4S04 A;  2HZT A;  1J75 A;  1MNM C;  1SFX A;  4HOB A;  4LGW A;  2IEK A;  2ZKZ A;  1R5H A;  2ZSH B;  1GXQ A;  3OY9 A;  3I4M J;  3LSI A;  4OIN F;  2NVU B;  1E3O C;  1U78 A;  4HF1 A;  4LB6 B;  2BEO A;  2EFN A;  3OYL A;  1ON1 A;  4ZTJ A;  3KX2 A;  3JTH A;  4DGW B;  5GP9 A;  1XGM A;  1S7O A;  2OJE D;  4O5V A;  3RCO A;  3K4K A;  3QP5 A;  5LGN A;  4A3I J;  3CUO A;  4DOZ A;  1MBF A;  1PYV A;  2X51 A;  4KT5 C;  2FBI A;  3SZP A;  3ZQI A;  1O3S A;  5HDG A;  1FPQ A;  1R4M B;  1VQ9 I;  5F0H A;  4JX4 A;  3BPV A;  1ODD A;  3BR1 A;  2XVC A;  2HGC A;  1UZC A;  4M9X A;  2R5Z B;  4D9J A;  2EV5 A;  1A31 A;  4LJZ F;  2DMP A;  3BG5 A;  1I1S A;  2FQ3 A;  3FMR A;  1MBG A;  4MHG A;  4MTE A;  2L9R A;  4Y15 A;  3IKT A;  4P9U A;  3A0B C;  1LDD A;  1XB4 A;  3GFJ A;  4QLC U;  2ID6 A;  2XB0 X;  4KMF A;  3TO7 A;  1MD0 A;  2DTZ A;  4EM0 B;  3OS2 A;  5FKO A;  4UHT A;  3R6S A;  2GA1 A;  3U2R A;  1QA6 A;  3S1Q J;  4GXO A;  2PG4 A;  2FBH A;  1QNT A;  4OMY A;  3CF2 A;  3K7A J;  1YFH A;  4LG0 A;  3FIS A;  1ONV A;  4CYD A;  1OCR H;  2V9K A;  2IRF G;  4E70 A;  2VQL A;  2LDU A;  5TGT A;  2KKO A;  3DPL C;  3K1P A;  4HNV A;  1X2N A;  2D2W A;  3LNQ A;  3RZD J;  1U9N A;  1TWF J;  1YG2 A;  2EPF A;  1G4D A;  1WQ2 A;  2GM4 A;  1UEL B;  2MYS A;  2K85 A;  4YIF A;  1YLF A;  4M74 A;  1MDM B;  1QO0 D;  4HX4 A;  1R49 A;  2RKH A;  2OCC H;  4BUP A;  3VFZ A;  3HKZ A;  2HDD A;  1C0W A;  1TQI A;  3OOU A;  5ILU A;  4WX9 A;  3WTU C;  5C44 J;  4A93 J;  2B9S A;  1P9Q C;  2Z5U A;  3LSM A;  3O8H A;  3JTG A;  2DFE A;  1SD7 A;  4A5M A;  4IO9 F;  4CCL A;  1IG7 A;  5CPR B;  1F5T A;  3CC7 I;  2FRH A;  3KZZ A;  3HL2 A;  3CMA I;  5E3M A;  2GAU A;  4PZJ A;  5EEG A;  2F5E A;  2JVG A;  2QVO A;  1S7E A;  4RB3 C;  3E0J B;  4UV8 A;  1YX3 A;  2Q0O A;  2W24 A;  2GWR A;  4WWC A;  2PLY A;  2IA2 A;  3ZMD A;  2W4S A;  4OIQ F;  2EA2 A;  5CVV A;  3WU1 B;  2K4J A;  3AG2 H;  4N9H A;  1J5Y A;  2CV2 A;  2MD5 A;  4RGR A;  5M3M J;  2UZK A;  3S32 A;  3IHU A;  2CW0 F;  2OUM A;  3IC7 A;  3RPQ A;  4ZDL A;  2L2O A;  2EV6 A;  4QWQ A;  3G73 A;  4OU0 A;  1YJ9 I;  3ABT A;  2H27 A;  3RIR A;  2LY2 A;  1OPC A;  1OQY A;  1Z9C A;  1K79 A;  2XDV A;  2Y0S A;  4JYK A;  4IHX A;  3GTP J;  1Y8R B;  4IRH A;  3LFU A;  3MN2 A;  3BT9 A;  1D8J A;  4I0B A;  4ZTF A;  4KFC A;  4XON A;  1F9N A;  1H8A C;  4C3J J;  1N77 A;  1QVU A;  2DPU A;  5F6F A;  3C7J A;  2AHQ A;  2Y31 A;  1Y8Q B;  3BQY A;  4PSW A;  1B72 A;  3ELK A;  3CES A;  2B7E A;  3ZMZ A;  1GVJ A;  1YX5 A;  1Z21 A;  5IYB J;  4O6J A;  4IOA F;  2ETH A;  1XG1 A;  1TT5 B;  3T5X A;  2FEZ A;  4Z2Y A;  3JCU C;  4Z6Y A;  2PMH A;  1MMA A;  2A61 A;  2ADU A;  3PL8 A;  4E6K G;  1TW2 A;  3CZ6 A;  4FAS D;  2O0Y A;  3G1O A;  4QPQ A;  1LDK B;  4BDZ A;  2CV1 A;  1FYM A;  3GZ6 A;  2QYO A;  1XD7 A;  2DA2 A;  1V4R A;  2QA4 I;  2P5K A;  2E1N A;  2XGE A;  5J4V A;  3Q3S A;  4FE4 A;  2IAI A;  1QZY A;  5JFR A;  2QKL B;  1ETW A;  4D7M A;  1RKW A;  1Y1W J;  2FF4 A;  2QKM B;  3PUB A;  4XSX F;  2ECB A;  2BE5 F;  3S3N A;  1H88 C;  5K5O A;  3H9G A;  3DU6 A;  2K86 A;  3GTQ J;  1WI9 A;  2R7W A;  3BTI A;  5FFX A;  3CUQ A;  3NWS A;  3L2V A;  3SDG A;  5BNG A;  1VQ5 I;  1UHS A;  3K4B A;  4ZYA A;  4FT8 A;  4E7Z A;  2QQA A;  2NS8 A;  3WTV C;  1SFU A;  2QQB A;  3HC7 A;  4LFU A;  2R7Q A;  2KRF A;  3OL3 A;  2N8G A;  5FLM J;  1VQ7 I;  3H3V K;  1TW3 A;  3WTY C;  1FX7 A;  2Z16 A;  3SFZ A;  5BS6 A;  2K02 A;  1FIP A;  3J7Y J;  3DBH B;  1MIJ A;  5IYC J;  1STZ A;  2Y9Y A;  1I39 A;  4O3M A;  5JHU A;  5K7Z A;  1Y56 A;  1ITY A;  1EF4 A;  3M7G A;  4B1R A;  3OYK A;  4F91 B;  2HOT A;  3F21 A;  1DPR A;  2VOD A;  3DCF A;  3E6C C;  2GXB A;  2XAG A;  1YTY A;  1IZ1 A;  2YU9 J;  2M34 A;  2V1D A;  3E6B A;  2DT5 A;  4D5F A;  2JRM A;  1QZZ A;  3KFW X;  1YW7 A;  5D8L B;  2Y48 A;  2M7B A;  5C4J J;  2K5C A;  2QGU A;  4IHY A;  2E1M C;  4Y33 A;  1POG A;  1KON A;  1WHU A;  2VBW A;  3C1D A;  3AG1 H;  1SVL A;  3DU5 A;  1AWC A;  4FHT A;  2W48 A;  4RAG A;  3SDB A;  1WJA A;  2EIN H;  2QBY A;  1BBY A;  2HVS A;  2L0K A;  4N0B A;  5E8I A;  5LD2 C;  1GV2 A;  2G7U A;  4CCK A;  1LE8 B;  1X3W B;  1X1P A;  3V8L A;  1BM9 A;  4UVB A;  2ELH A;  2DTR A;  3Q9V A;  1Y0U A;  3PQJ A;  4X6A J;  1W7P B;  1XMK A;  1JJ6 C;  4QSH A;  4AVZ A;  5FLX Z;  1LVK A;  2MH9 A;  2V4J C;  1RET A;  2RVC A;  2E19 A;  5IPA A;  3F8N A;  1B8I A;  2AS5 F;  2QSF X;  2QF7 A;  1I6X A;  1S29 A;  1QBJ A;  3KP5 A;  1LEB A;  3S1R J;  3CCJ I;  3KYD B;  2KIF A;  1FOW A;  2RRE A;  4AVP A;  3QQA A;  1IV8 A;  5H6Q A;  1R36 A;  1TWG J;  3OOP A;  4KMU X;  3GTJ J;  1PJR A;  1B9N A;  3K69 A;  2JMW A;  3L9F A;  2MC3 A;  3IP4 B;  3J81 Z;  3HSE A;  1MSF C;  1P4W A;  2EK5 A;  4NB5 A;  1BI2 A;  3PFY A;  3RPU A;  2RQQ A;  3DPU A;  1FJL A;  3TW6 A;  1QZE A;  2DA6 A;  2VBX A;  3S1M J;  2EBI A;  2BHZ A;  4UXN A;  4KDP A;  1VQO I;  1ACI A;  1BW6 A;  3CCS I;  4OIO F;  1XDU A;  5E1W A;  2QEN A;  2FOK A;  2L3D A;  5GAE J;  3ASN H;  3C3W A;  4E7H A;  5LBQ A;  4ETS A;  3V8J A;  2AO9 A;  3LSK A;  1KQ0 A;  3FWE A;  1QGP A;  4ESB A;  3F22 A;  3G1L A;  1F4K A;  4IHT A;  4I09 A;  4C3I J;  4AM3 A;  4BQQ A;  2Q8K A;  3BCA A;  2DOA A;  4HNT A;  5IT9 Z;  2MAB A;  1J2X A;  2XUB A;  4FIS A;  2HOA A;  5A2Q K;  3ZQQ A;  3E6D A;  5H20 A;  1SD4 A;  1J9I A;  1R22 A;  2A68 F;  2YUS A;  3R0J A;  5GAH J;  4LG0 B;  1Q1V A;  2BBY A;  3M07 A;  3MMY B;  4M3F A;  4BH9 A;  4UV9 A;  2WWY A;  3OIP A;  1MKM A;  3LA7 A;  1H0M A;  2NVX J;  4XIC A;  2LTP A;  2R5Y B;  4PJJ A;  1XMA A;  2E60 A;  3OWT A;  4B43 A;  5CVU A;  2E1O A;  4LLL A;  1BJA A;  4M6X A;  2K9L A;  1BR1 A;  3TDU C;  2A07 F;  4HA8 A;  2X48 A;  2LNB A;  2HPI A;  4XMY A;  3QOE A;  1I27 A;  3ZQ7 A;  2PQ8 A;  2IXS A;  1D1C A;  3HOU J;  2ZXW H;  3ISP A;  2DT7 B;  4Q48 A;  1BA5 A;  2X6O A;  2LF8 A;  2DAO A;  2XKO A;  4ZZD A;  3SEQ A;  2IS6 A;  1DGW Y;  2VPR A;  3W2A A;  4P5O A;  4BDY A;  2R0Q C;  4BE0 A;  1XGN A;  1PP8 F;  4Q47 A;  4IVN A;  3J7Z I;  2VAS A;  2K9M A;  3GLX A;  4HQE A;  1UB9 A;  2HOE A;  2K27 A;  5FRN A;  5CJ9 A;  3KIO A;  2F2E A;  3CDI A;  2Z3Y A;  2E7X A;  3I53 A;  1IDZ A;  2TCT A;  2BV6 A;  2L9N A;  4HAM A;  3TL4 X;  1MSE C;  1WJC A;  3HPG A;  2L9V A;  4AYB N;  4E4H A;  2PEX A;  5HS8 A;  3LA2 A;  4L5E A;  2LH9 A;  3LQR A;  2M4G A;  4BXF A;  4Y7N J;  3K2Z A;  5TIS C;  3VDX A;  5DYM A;  2O9L A;  2HVR A;  3SJM A;  1YS6 A;  2DK5 A;  2H6C A;  2R7T A;  1G6N A;  2EFP A;  3DBR B;  2DW4 A;  3WG7 H;  4L9N A;  5KNL A;  3CME I;  3L2Q A;  1KA8 A;  1NK3 P;  1UMQ A;  5IOY A;  1ENH A;  5GPA A;  2A6T A;  2IGM A;  3BC8 A;  1HQC A;  1DP7 P;  3FF5 A;  1ZLJ A;  3BZ6 A;  2DBB A;  1G3S A;  5D5X B;  1X58 A;  5EZG A;  1T0F A;  2VT3 A;  3F8M A;  5F0C A;  1TTY A;  4RLF A;  2KQR A;  4B3X A;  4M6Y A;  1QHH D;  2XAU A;  4ON0 A;  1LEA A;  2FSW A;  5CLS A;  3UKG A;  3TO6 A;  1SFO J;  3DQV C;  2H8R A;  1WJB A;  4HSR A;  2XAF A;  4WK8 F;  2HEO A;  2RV8 A;  1ZR4 A;  3KEQ A;  2ZME A;  1ZH5 A;  4Y4R A;  1F43 A;  2HNH A;  2EFW A;  4E7I A;  5L3E A;  1MH4 A;  3KLO A;  1KU7 A;  5DM7 F;  2OAZ A;  2WAF A;  2O6G E;  4UUV A;  3ZCO A;  1UST A;  2A6E F;  4NC7 A;  4AUX A;  3CCE I;  1R5I D;  2DA4 A;  3NEU A;  3I59 B;  4PK4 A;  5CVR A;  4L5I A;  3LMM A;  1YIT I;  4RM2 A;  1JT0 A;  3CJR B;  3J80 K;  4R79 A;  3GBG A;  4WXC A;  1MBE A;  3OYE A;  2OZ6 A;  4DNC A;  2ACJ A;  3WGG A;  1LFU P;  1FBQ A;  1S9H A;  4MTD A;  5HDN A;  1HDP A;  2GQQ A;  1YW8 A;  2R7V A;  4HLX A;  3BG6 A;  1FTT A;  1DU6 A;  2O3F A;  2OU2 A;  1D8K A;  2GA2 A;  4HBL A;  2YS9 A;  1FP1 D;  1D1A A;  1F1Z A;  4CSW A;  4A3K J;  1ZQ3 P;  1Z3Y A;  2FML A;  4XRM A;  3PO3 J;  4L9J A;  5FFZ A;  2V7F A;  2CUJ A;  1OFC X;  3CUQ C;  3NAU A;  4HLY A;  1EA3 A;  3TP0 A;  1CQT A;  4G8X A;  1WPK A;  1XS9 A;  1TBX A;  3VSL A;  2IA0 A;  2M2E A;  4HEA 2;  3RJP A;  2NRA C;  4MNU A;  3B6C A;  4QPO A;  3HEF A;  4OWR B;  4MFD A;  4CCM A;  2CQN A;  2FD5 A;  3J7A Y;  1YE9 A;  2XRN A;  5KK1 A;  3CCR I;  3ULQ B;  1IN7 A;  1FNN A;  4E7L A;  5CYV A;  2IT0 A;  3MZY A;  3GCM A;  4C2M J;  1OCC H;  3CTA A;  1HKQ A;  2FX0 A;  4UUT A;  3ZGK A;  1EKE A;  3WE3 A;  5DUI A;  3ZPL A;  1MBH A;  1YO5 C;  1AKH A;  2YX7 A;  3K1M A;  2CW8 A;  1PP7 U;  2W1O A;  3HRT A;  3ZRG A;  3H3U A;  4L9T A;  3ROU A;  3WHB A;  4ASN A;  4MFE A;  1UJ8 A;  2Q2E A;  3PM1 A;  1XCV A;  5J3L A;  5GAG J;  2VKH A;  4HDU A;  1VTN C;  1O3T A;  3F72 A;  3SHF A;  1W5T A;  2RGV A;  3B73 A;  4A6D A;  3CJN A;  5ILV A;  3K70 C;  3ERE D;  3BZK A;  4E7S A;  3CF5 F;  5K1Y A;  3MKY B;  4AU7 A;  1MBK A;  1IUF A;  4BJ5 C;  4D1Q A;  2ZXH A;  1X1C A;  1HLV A;  4U88 A;  2R7X A;  1WSU A;  2BOL A;  3DTI A;  4BKX A;  5HLH A;  1QVT A;  5LHI A;  1LFB A;  2ZO4 A;  4HW0 A;  2ISY A;  2LY1 A;  2DA1 A;  2Z2S B;  2O03 A;  3FX3 A;  5AON A;  4ABZ A;  1IXC A;  1YIJ I;  1ZAO A;  3GW2 A;  3UR3 C;  1VF9 A;  3SQN A;  5DD8 A;  2UXX A;  1H89 C;  1KQ8 A;  1Z67 A;  4IPA A;  3LSR A;  2JSC A;  5FKK A;  1B8I B;  1P7J A;  1HDD C;  2EZI A;  4A12 A;  2H1K A;  4C30 A;  3HBL A;  4OAY A;  4LMY A;  2E71 A;  1PUE E;  1FEX A;  3DTK A;  1TC3 C;  2IGO A;  3AFH A;  3TOB A;  5FD5 A;  1JGS A;  3P7N A;  3L1P A;  2HDW A;  3FXJ A;  3DPT A;  1BI0 A;  5JVT A;  5EF6 A;  2ZNY A;  1HKT A;  4IHW A;  1E17 A;  4RDU A;  1E2X A;  2F4M B;  1GXP A;  2BW3 B;  3E1S A;  1P4X A;  3VYT B;  3ABL H;  1PDN C;  1ETO A;  2MLK A;  2LD5 A;  2CQK A;  2VN2 A;  3G71 I;  1OCZ H;  4ENJ A;  5CQG A;  1OYY A;  5L3G A;  1ETX A;  1X1A A;  4RAF A;  4A0Z A;  3JRG A;  1ZRD A;  1BI1 A;  2BGC A;  3PNV A;  2VPL A;  2E35 A;  2X1E A;  3L7W A;  1TWC J;  2V1U A;  1JHF A;  2KDO A;  3KLN A;  4IXA A;  5B5E C;  1W0U A;  1OYI A;  2WB1 A;  3DKX A;  4YFK F;  4HNU A;  3TW7 A;  5EYR A;  4AD9 A;  2XPU A;  4X1E A;  5DV5 A;  3KZI C;  3R0A A;  2M45 A;  3QOD A;  5JR3 A;  4ENK A;  1JUM A;  4GRI A;  3VYU B;  2YU3 A;  2NOJ B;  1TWA J;  4RB2 C;  2STW A;  3CO6 C;  5JI6 A;  5E3L A;  2NYX A;  5EEA A;  3S1N J;  2E2H J;  2LR8 A;  1MJA A;  4RB0 A;  3A4C A;  3G2B A;  3KP3 A;  1R71 A;  5M5W J;  3GFI A;  3HOX J;  3F0C A;  1SAU A;  2DI3 A;  5ICE A;  4YEL A;  3HXL A;  4G6T B;  2UUZ A;  3JSO A;  4CZC A;  3G1M A;  3QWL A;  2VQG A;  3OYN A;  1FSE A;  2LFB A;  3T0Y A;  2JUG A;  1KU9 A;  1NH3 A;  1K61 A;  3F8F A;  3PJR A;  2DXI A;  3EUK L;  2IGN A;  1VQM I;  2P7V B;  1T38 A;  1T8I A;  3U9G A;  1LPQ A;  1IRZ A;  2CGP A;  4HZF A;  4HST A;  3H5N A;  1RI7 A;  5H6R A;  3S15 J;  2OTJ I;  3F3X A;  2FUG 2;  2VE8 A;  2VIX A;  3H9J A;  5FKN A;  4A3J J;  1JT6 A;  2XB5 A;  4B47 A;  3S2W A;  4X0G A;  1DDN A;  2WAQ A;  1ZRC A;  2JA6 J;  2XRO A;  5J1U A;  3GTL J;  2RN7 A;  3IRR A;  3ZQL A;  1FY7 A;  1TNT A;  3ECH A;  4EAT A;  1RIO H;  5EEH A;  3OMY A;  4OAZ A;  1CF7 A;  1OJL A;  1NTC A;  3HHG A;  1PVE A;  5A2Q Z;  2M9H A;  1JTX A;  2DA7 A;  1T0F C;  1HA8 A;  1FTZ A;  1P6R A;  5L3B A;  4L18 B;  2WY7 Q;  5LEJ A;  3K1N A;  1ZG5 A;  4XKV A;  3C2B A;  4DBR A;  1IRX A;  1XN7 A;  2WBM A;  2HTS A;  3TQN A;  4BQN A;  1A36 A;  2ZME C;  4A3F J;  2JWT A;  5EG0 A;  3F8C A;  1JKR C;  2Y30 A;  3WGI A;  1VFC A;  3I4N J;  3DWL E;  2DO7 A;  2FNP A;  2V9V A;  2QWW A;  1I50 J;  3FDY A;  3N05 A;  4GYI A;  1HKS A;  1U5T A;  2ZJQ F;  1R1V A;  4OOI A;  3KEO A;  1N25 A;  1AOY A;  4EGZ A;  1OCP A;  1HCR A;  2LK2 A;  4AIK A;  4MEY F;  5AIQ A;  2X0L A;  3UNG C;  1QQI A;  2P4W A;  4DQ2 A;  3I0T A;  2W84 A;  2XPV A;  2M0C A;  4P9F A;  1VQN I;  4GO1 A;  4ANJ A;  2LRE A;  4CA0 A;  3H5A A;  4KIT B;  2VJI A;  3O2P E;  1ZGJ A;  3ZQH A;  3S3M A;  3JRC A;  4M3D A;  2GXA A;  2E5Z A;  3BG9 A;  1A04 A;  1UCR A;  3AAF A;  1KZH A;  4IOC F;  1RZ4 A;  3H9Q A;  3SXY A;  4ZYD A;  2FA5 A;  3HOY J;  2DLL A;  3RZO J;  3Q9S A;  2OV7 A;  2IP2 A;  1R4N B;  2RC4 A;  1JKP C;  4F3Q A;  1D3Y A;  4BXU A;  4M3E A;  2QZ8 A;  3JRB A;  1FT9 A;  3WE2 A;  1BR4 A;  1U9O A;  4P1W A;  1Z3X A;  1K78 A;  3H92 A;  2Z1D A;  3ZQG A;  3FM5 A;  3KZY A;  3OSF A;  4CYC B;  3BP8 A;  4IQ4 A;  3WTT C;  3EUH C;  3K70 D;  4RA2 A;  2LBF A;  4XOR A;  2DMQ A;  2IGK A;  2W85 A;  1OR7 A;  4LG3 A;  2F4I A;  4YRV A;  2NS0 A;  3FHN A;  4B3A A;  3Q0W A;  4NC6 A;  2JTV A;  4WXD A;  2ECC A;  1KU2 A;  2K9N A;  3HZJ A;  3T8T A;  5HNH A;  2KPM A;  3PSI A;  3DF8 A;  1WJD A;  2HR3 A;  3BWG A;  1WH5 A;  3HSR A;  4EJO A;  3T8R A;  3S93 A;  3TP3 A;  3ZMU A;  4L0Z B;  1TP4 A;  3K9T A;  2QEX I;  3HOW J;  2EIL H;  4A3G J;  2M87 A;  3J7A O;  2YSR A;  1X1B A;  3D5S C;  3IH2 A;  4XRF A;  3RKX A;  5B66 C;  1GHC A;  4IL6 C;  1UFM A;  4EJT A;  3CMY A;  5M3F J;  1Z6R A;  3BTC A;  1ULY A;  4W97 A;  4CCO A;  3JAM K;  2DK8 A;  2ID3 A;  4C3H J;  5F04 A;  3J80 Z;  5LHH A;  2R92 J;  3JRI A;  1Y0N A;  2JK3 A;  2CO5 A;  3RPU D;  5FJ8 J;  1S7A A;  3KCC A;  2A69 F;  3IWF A;  1RR8 C;  1R58 A;  3A03 A;  1NG6 A;  1JKO C;  3OYJ A;  1Z6T A;  1O3Q A;  1G8X A;  4U7D A;  1XDS A;  1GDT A;  1IN5 A;  4NUB A;  2EB7 A;  2DT6 A;  3G6E I;  4I02 A;  4PFP A;  2E1C A;  2JRT A;  4RGU A;  1UHM A;  3SZG A;  3HRM A;  1HST A;  2CS3 A;  4PDK A;  1GUU A;  2CWE A;  3A01 A;  3RKQ A;  2RNG A;  4GYG A;  3OYF A;  2NOG A;  4B44 A;  2STT A;  1QU3 A;  1WH7 A;  4EM1 A;  1SC7 A;  3GWZ A;  4CXF A;  1IUY A;  1X4P A;  5IY5 H;  5DCF A;  3DEE A;  2PFB A;  1MND A;  2CQX A;  3MKL A;  1PUF B;  1WGX A;  3CCY A;  3ZMV A;  2IS4 A;  5D5V B;  3OIO A;  4XRS G;  2G0E A;  3BY6 A;  2XAS A;  1MMD A;  3K4C A;  4R8H A;  3EDP A;  2VON A;  2LYC A;  5EGO A;  3E5U A;  4KJZ A;  5JLW A;  2PN6 A;  3CC4 I;  2FXA A;  2JSP A;  1IAW A;  3ML6 A;  3HJE A;  2KIM A;  4BHB A;  1USS A;  3OYB A;  1SMY F;  1HF0 A;  4XL9 A;  1XPX A;  1GVD A;  2VKV A;  2HKO A;  5GAD J;  4Y17 A;  1GV5 A;  3BZC A;  1KQ9 A;  2E1M B;  3WTZ A;  3CLO A;  2XSJ C;  5DCM A;  4NQW A;  2A3S A;  2LC2 A;  2CUZ A;  1U2W A;  1TL8 A;  5HLI A;  2HU9 A;  1V3F A;  3E3V A;  3H5R A;  1IJW C;  3QYF A;  2W00 A;  4M3B A;  4BJT A;  4BE2 A;  2V79 A;  2CH0 A;  4UB8 C;  1BI3 A;  1HW1 A;  1RNL A;  4BY7 J;  4XLE A;  4LOC A;  5KHD A;  4MQ9 F;  2GLO A;  3JRD A;  3WU0 A;  4EQQ A;  2WV0 A;  1V5E A;  4BS9 A;  2GZW A;  2XV4 S;  1Q1H A;  3F9K A;  1MJB A;  1XSV A;  4KN7 X;  4DYR A;  4ZYG A;  2DU9 A;  4FET A;  3DTE A;  3A2K A;  5B1B H;  1HC8 A;  4PGG A;  5KVR A;  3LSG A;  1XX5 A;  5H2F C;  4A2U A;  2DQL A;  3MZ8 A;  2K40 A;  1LFP A;  1TLH B;  3JSP A;  4M71 A;  2OPT A;  2BXZ A;  4A3C J;  1UAA A;  2RDP A;  3VYS B;  5DM6 F;  1D0Y A;  2XSD C;  2AQE A;  4XLN F;  1A6Q A;  2NXN B;  2OTL I;  3H36 A;  2Q1Z B;  3HKZ N;  2XGD A;  3MD2 A;  5CVI A;  2BXY A;  4C2U A;  4RMN A;  2XAH A;  1MMG A;  2DFH A;  3L2C A;  3I54 A;  4IHS A;  4XNF A;  2ISZ A;  1DQU A;  5E8G A;  5F08 A;  4B48 A;  2VE9 A;  3PSF A;  2PMZ A;  4JX6 A;  4UUS A;  2VKE A;  2ZC2 A;  3I9V 2;  1Z7U A;  2MD0 A;  3BG3 A;  1N78 A;  2KFD A;  4C2T A;  1AA7 A;  5FKM A;  3I58 A;  1T2K A;  1R9T J;  1WCM J;  5LGT A;  3RYR A;  3PUF A;  2XKP A;  4BE1 A;  2VBZ A;  5E1X A;  1M1E B;  1HW5 A;  1SVM A;  2KIQ A;  1LDJ A;  2M7A A;  2YPR A;  3ZQF A;  2JPC A;  1DUX C;  2DJI A;  4BEH A;  2OD5 A;  2V1N A;  4G6D A;  2HQN A;  2JUC A;  4N9I A;  3HOS A;  3NRV A;  5ICG A;  2P7C B;  4A3B J;  3CCM I;  3GO5 A;  3ONQ A;  3GZN B;  3E5Q A;  3S2D J;  5GTH C;  3MCZ A;  4XR6 A;  5F64 A;  3BJ6 A;  1I3A A;  4LLN A;  3IH3 A;  2Y0S N;  2ZJ2 A;  3EET A;  1IDY A;  3F6O A;  1U5T C;  5EG0 B;  2COM A;  1R1T A;  4E7K A;  3ZXS A;  1OCT C;  1H9T A;  2EFQ A;  4UVA A;  1E3H A;  1MGT A;  2TDX A;  3M9A A;  5D4R A;  4XKB A;  4I6Z A;  3DLA A;  2GOX B;  3K2A A;  2HVQ A;  1MH3 A;  4PJL A;  2VLA A;  3H0D A;  4I01 A;  3LSJ A;  5D6F A;  3KP2 A;  1D0Z A;  1APL C;  5ILS A;  4G12 A;  3QP6 A;  4EM2 A;  1NK2 P;  3RQI A;  4D7N A;  2F4O B;  5EJC A;  3ERM A;  1I1G A;  3O3K A;  1XC5 A;  3N97 A;  1I6H J;  1ZR2 A;  3Q0V A;  5GTI C;  3DEU A;  3FXM A;  3LL7 A;  1ZGA A;  5J8F A;  4BNC A;  1JUS A;  2CFX A;  3GFL A;  4EMS A;  4M6V A;  2FBK A;  3CO7 C;  3ECO A;  4IQJ A;  1O3R A;  1KGS A;  2GIV A;  1OLT A;  3PIO F;  3QAH A;  2L54 A;  1BN5 A;  1OR7 C;  1W36 C;  2JVH A;  5LGU A;  3D5R C;  2LBF B;  2A5W A;  5F0F A;  1MDM A;  2DJN A;  2VOP A;  2R93 J;  1T39 A;  3S3O A;  2OBP A;  5L3C A;  3QU3 A;  2OC6 A;  1TZL A;  2OCE A;  5FGM A;  3F6V A;  4IJA A;  1KYZ A;  1B72 B;  1B9M A;  3ZP5 A;  2Y75 A;  4I7H A;  1ZHF A;  1X3U A;  2R7F A;  3HGG A;  5K7F A;  3DBL B;  2HPM A;  4EGY A;  1F36 A;  2MG4 A;  4KUM A;  1DU0 A;  2H94 A;  2L4M A;  2XAJ A;  2F5D A;  3DKW A;  2CW7 A;  2KRH A;  3ABM H;  4M9Z A;  3WOD F;  1HW2 A;  3QPH A;  4XKC A;  1ETQ A;  1LKX A;  1Z91 A;  2I5U A;  2CYY A;  1FOY A;  3D0S A;  3S14 J;  2D1V A;  2NAZ A;  2OQG A;  2Z99 A;  1YS7 A;  2V26 A;  3OL4 A;  2QLZ A;  4II3 A;  2XPW A;  4L9V A;  1XCB A;  2M0M A;  1TQP A;  1B59 A;  4MIM A;  1IGN A;  1G3Y A;  2FNA A;  2B0L A;  1RPW A;  1T95 A;  4S05 A;  3OSG A;  1RRJ A;  1VQK I;  4NBQ A;  1BIA A;  1ZK8 A;  2Y0M A;  1J09 A;  4NC8 A;  4XOP A;  5FO5 A;  3ZN0 A;  1R00 A;  3GME A;  5IYD J;  1JUP A;  5J8C A;  2DYS H;  2HZD A;  4W1U A;  3CUQ B;  4PGH A;  3FKI J;  2HDC A;  3VOE A;  5B1A H;  1SD6 A;  3EUH A;  3N4M A;  2VJ5 A;  4CGZ A;  3PO2 J;  5E17 F;  2NVY J;  5CQE A;  3P9I A;  3S8P A;  4ESJ A;  3RYP A;  2HXO A;  5HOO A;  3PQK A;  3GVA A;  4G9Y A;  1P2F A;  4AID A;  1BL0 A;  2ZBK A;  4RAZ A;  1R23 A;  5HOD A;  2E34 A;  2L9S A;  2VBY A;  2PI0 A;  1JHH A;  3V7R A;  4JQF A;  4WF2 A;  4LB5 A;  4OIP F;  3V42 A;  2WA0 A;  2W7N A;  1BOB A;  2CG4 A;  2KL4 A;  4B09 A;  2JT1 A;  3DV8 A;  1ZYR F;  4NDL A;  2XGC A;  2KIS A;  1S3J A;  3FIW A;  4FCY A;  5ICF A;  3ZN1 A;  4CH7 A;  2KJB A;  3FK6 A;  2JZY A;  4I0A A;  2KLO A;  4CUG A;  4BQA A;  3E97 A;  3I3L A;  1IRF A;  2P6T A;  1B4A A;  4V19 K;  5F27 A;  4XID A;  3TED A;  1T56 A;  3EPZ A;  1BIB A;  5E79 C;  5FLV A;  3Q5F A;  5F1J A;  3FHZ A;  1UG0 A;  3HUG A;  4AC0 A;  1FOK A;  1LNW A;  5FKL A;  4XN0 A;  3EYI A;  4TV7 A;  1WWX A;  4BHP A;  2QBY B;  1R1U A;  1VQP I;  5ED4 A;  2R7D A;  4BQO A;  3M1E A;  3JAM Z;  3I64 A;  2PJP A;  4XLA A;  2JA2 A;  4UY8 I;  1XMX A;  3CDL A;  1S6L A;  2WC2 A;  1HOM A;  1OYW A;  1FP2 A;  2MFZ A;  2VI6 A;  4EJU A;  3H35 A;  3VWB A;  5DEQ A;  2A6H F;  5C4X J;  4QIW N;  2CQ7 A;  5K7H A;  4BHC A;  4HV5 A;  1IN6 A;  5CVJ A;  3PFI A;  4YFN F;  1U8R A;  3MVP A;  4YFX F;  1O4X A;  2ZNZ A;  2LKX A;  3MEX A;  3O6B B;  2KMU A;  5IP6 A;  2K3P A;  4P55 A;  2VJJ A;  2I8D A;  2DQR A;  3MQ0 A;  2R7S A;  4AIH A;  2ZJR F;  1IRG A;  2BY1 A;  3ZR8 X;  3HOT A;  4M72 A;  4EVI A;  2LP0 A;  3OYG A;  4LIU A;  2OQR A;  1VQ8 I;  3C2H A;  3IV5 A;  3P5J A;  5LLQ A;  4ENM A;  3S16 J;  5D4S A;  3G3Z A;  1NG7 A;  3QU6 A;  1SEU A;  1RES A;  3OYI A;  3CCU I;  3IKV A;  1R5G A;  3L09 A;  2E5N A;  1NHA A;  1ZKG A;  2DFI A;  2KZV A;  4A5N A;  1IV6 A;  3QYE A;  2LOO A;  2J5O A;  3W3C A;  4MQV A;  3VSK A;  2E7W A;  5J6X A;  2BVM A;  3O8G A;  4CZZ A;  2R7R A;  2ZJP F;  2P8T A;  5EZH A;  1YIO A;  4U0V A;  1MJ9 A;  3V4G A;  2AQF A;  2A05 A;  5BOX A;  1ZRF A;  1LE8 A;  4CCJ A;  1QHG A;  4MLO A;  1ETV A;  1LVA A;  4FE7 A;  1V5G A;  5J47 A;  3OYC A;  3A1Y A;  2G9W A;  3LFK A;  2WAE A;  4A0X A;  2O5R A;  3E5X A;  2XC7 A;  1W7P A;  4KA4 A;  2HXI A;  3W2V A;  1R7J A;  2LRD A;  2M8E A;  3D5L A;  4XOT A;  1FMV A;  2BY0 A;  2V6C A;  2X1C A;  3TOA A;  3TBI A;  2GOM A;  3K6G A;  4BEH B;  1MZB A;  1Z77 A;  2DA5 A;  4ITV A;  4M73 A;  2O8K A;  3EUA A;  1O57 A;  1WRJ A;  2EZK A;  5IP7 J;  1SD5 A;  1L3L A;  3QYB A;  1MMS A;  3K0L A;  5FB2 A;  4FQG A;  4A3E J;  2B63 J;  1FLI A;  1RKT A;  2H1L A;  1YQA A;  3BR0 A;  2P6S A;  4CO8 A;  1XSX A;  3AG3 H;  2JQ7 A;  1FWZ A;  2HYJ A;  3HGY A;  5HNF A;  4BXX J;  4BBS J;  4XN3 A;  5J1Y A;  3KE2 A;  1O7L A;  4JK1 X;  1D5Y A;  3RTR A;  2QCO A;  3IAS 2;  1CGP A;  3GYH X;  1W36 D;  1K7A A;  3RI4 A;  4IF4 A;  2C6Y A;  1ETK A;  3VEP A;  4R1H A;  4ZZL A;  5JLX A;  4KIG A;  2VC0 A;  5DS9 A;  2EA4 A;  1P4A A;  3MFK A;  4ESF A;  2VXZ A;  2R7Z J;  4RLQ A;  2CJJ A;  2XF5 A;  1DP3 A;  3RKW A;  1K4T A;  4BGD A;  2HOS A;  3LOC A;  1OKR A;  2PX9 A;  2F5C A;  3PNY A;  3W6V A;  1ZRE A;  4U0Y A;  2X85 A;  3WTW C;  4KYW A;  3BR3 A;  5J40 A;  1ZN2 A;  1O7F A;  5FRM A;  1SMT A;  2EIK H;  3ABK H;  1V55 H;  4I76 A;  2R5Y A;  1YJN I;  4AWX B;  2X6X A;  3I55 I;  1YRN A;  4JP0 A;  2K7L A;  4I98 B;  2DN0 A;  4F52 A;  4HX8 A;  4V2G A;  4KN4 X;  1REP C;  3CP8 A;  5JVG F;  2JN6 A;  1D1B A;  2ZME B;  1TNS A;  4M3G A;  4BL0 B;  3I71 A;  5BPD A;  1E3P A;  1WKM A;  2K4B A;  2DMN A;  1G59 A;  3QPT A;  2BHY A;  1SAN A;  3VYR B;  4GDF A;  5D5W B;  3KYL A;  2G7H A;  2M4K A;  2ZCW A;  3H0G J;  2MGQ A;  4XLF A;  1ZAR A;  2NNN A;  3M4O J;  2CFO A;  1HBX G;  2PJR A;  3K4J A;  2HYF A;  3M8J A;  2XHK A;  3CLQ A;  4LIV A;  2EIJ H;  5IP9 J;  4HYE A;  3FXK A;  2V1X A;  1QPI A;  3L2U A;  2NVQ J;  2R7U A;  5HDK A;  3TKY A;  2EV0 A;  4EV0 A;  4WXH A;  2KDZ A;  2CUE A;  2L7Z A;  4YG2 F;  4GGG A;  1JE8 A;  3JRE A;  2EWN A;  1JI8 A;  2X1D A;  5L3D A;  2LSO A;  4XK4 A;  1IN8 A;  1RUO A;  1Y39 A;  1WJ5 A;  2HQ5 A;  1A6I A;  2LY9 A;  2FU4 A;  4H0E A;  3OV8 A;  3BJO A;  3IWZ A;  2EQR A;  2GXG A;  5HS7 A;  1Y1V J;  2Y9Z A;  2ZFU A;  3LQQ A;  4PFO A;  1J7K A;  1KYW A;  1LQ1 A;  3GTO J;  3SEZ A;  3R60 A;  3HG9 A;  2MH2 A;  1HSJ A;  1XSD A;  2VC1 A;  4UB6 C;  4RBO A;  1B6A A;  3CC2 I;  1LUJ B;  3KYC B;  4KT6 A;  4F7Z A;  2R4G A;  3GF2 A;  2Y2Z A;  5E3N A;  4HRI A;  3NQO A;  3TMO A;  3FXR A;  4B4C A;  4ZDO A;  4A3L J;  5FD6 A;  4L5J A;  2ME6 A;  4EEF G;  1AKH B;  3JRF A;  3HOZ J;  4AYB A;  5C3E J;  3ZMT A;  4CCN A;  3Q0U A;  2HKX A;  4A0Y A;  4BU2 A;  5LRS A;  2HS5 A;  2JA8 J;  2NNY A;  5K5R A;  1SVO A;  1JGG A;  2L7K A;  1W5C C;  2Q2E B;  1S72 I;  2X4H A;  4RGS A;  3B02 A;  2BVL A;  1I5Z A;  2YR2 A;  4I2O A;  3I59 A;  4XLP F;  2DDA A;  3TDZ C;  3K10 A;  1XTA A;  3FXO A;  3QOP A;  3HUG B;  1U3E M; 
#chains in the Genus database with same CATH homology
 3D1N I;  3BR6 A;  3HOV J;  4C2M J;  4IEJ A;  4UUT A;  2DMP A;  2FX0 A;  3BG5 A;  4BBR J;  3ZQF A;  1MBG A;  1MBH A;  2JA7 J;  1AKH A;  2L9R A;  4GFB A;  1WI3 A;  4A3B J;  2ID6 A;  2XB0 X;  3WHB A;  3S2D J;  2DTZ A;  5FKO A;  1TWH J;  4MFE A;  1JKQ C;  5J3L A;  3PM1 A;  3S1Q J;  3IH3 A;  2Y0S N;  3K7A J;  2JA5 J;  3BQZ A;  1IDY A;  3FIS A;  5EG0 B;  1OCT C;  1MBK A;  1IUF A;  2EH3 A;  3FK7 A;  2WB1 N;  1ORK A;  1HLV A;  2KT0 A;  1ETY A;  4BKX A;  4HNV A;  5DTD A;  4I6Z A;  1QVT A;  1X2N A;  3LNQ A;  3K2A A;  1U9N A;  3RZD J;  1LFB A;  1TWF J;  3BTJ A;  1MH3 A;  2DA1 A;  2GM4 A;  2ME0 A;  1W0T A;  4ABZ A;  3LSJ A;  3HM5 A;  1APL C;  1JJ8 C;  3S2H J;  4G12 A;  2EZH A;  1VF9 A;  1QRY A;  1UG2 A;  1NK2 P;  3RQI A;  4D7N A;  1H89 C;  2HDD A;  3OOU A;  1XC5 A;  5C44 J;  3LSR A;  4A93 J;  1I6H J;  5FKK A;  3O8H A;  1ZR2 A;  3Q0V A;  1B8I B;  1P7J A;  1HDD C;  1IG7 A;  2EZI A;  2H1K A;  1JUS A;  3HBL A;  4M6V A;  1FEX A;  1AU7 A;  5E3M A;  1TC3 C;  1S7E A;  2MW8 A;  3IH4 A;  3HDD A;  3L1P A;  5F0F A;  1ZTR A;  4A3M J;  2DJN A;  2R93 J;  5EF6 A;  4IHW A;  2WAQ N;  4RDU A;  2FQ4 A;  1B72 B;  5M3M J;  2IBD A;  3HGG A;  5K7F A;  1ETO A;  5M5Y J;  2LD5 A;  4J19 A;  1F36 A;  2MG4 A;  4A69 C;  1DU0 A;  1ETX A;  3JRG A;  4S0H B;  2LVS A;  1ETQ A;  4JYK A;  4IHX A;  2VUM J;  1TWC J;  3GTP J;  1W0U A;  3MN2 A;  3JRH A;  3S14 J;  3BT9 A;  4MO7 A;  3TW7 A;  5EYR A;  2XPW A;  1H8A C;  2XPU A;  4X1E A;  4C3J J;  5E3O A;  1JUM A;  4MIM A;  1QVU A;  1IGN A;  1RPW A;  1TWA J;  3OSG A;  2AHQ A;  3JRA A;  2Y31 A;  3BQY A;  1B72 A;  1ZK8 A;  5E3L A;  3GTM J;  4DZJ A;  5EEA A;  3S1N J;  2E2H J;  1JUP A;  2LR8 A;  5IYB J;  5IYD J;  4W1U A;  1XG1 A;  3FKI J;  1K83 J;  3PO2 J;  5M5W J;  3HOX J;  3F0C A;  2NVY J;  2HXO A;  3M3Y J;  2GBY A;  2WV1 A;  3G1M A;  4QTR A;  3G1O A;  4D5C A;  1BL0 A;  2LFB A;  5HOD A;  3CQZ J;  1K61 A;  2DA2 A;  2XGE A;  2M8G X;  3Q3S A;  4FE4 A;  2IAI A;  1ETW A;  4D7M A;  1IRZ A;  1RKW A;  1Y1W J;  4NDL A;  2XGC A;  4FCY A;  2ECB A;  3FIW A;  3S15 J;  9ANT A;  1H88 C;  1YRN B;  3BTL A;  1RR7 A;  3BR5 A;  3FK6 A;  3GTQ J;  5FKN A;  4A3J J;  3BTI A;  1JT6 A;  2XB5 A;  5F27 A;  3E7L A;  4XID A;  3TED A;  1T56 A;  3SDG A;  5BNG A;  2JA6 J;  1UHS A;  5FLV A;  5J1U A;  3GTL J;  5F1J A;  3BR2 A;  4AC0 A;  2NS8 A;  2R5Z A;  5J1R A;  3ZQL A;  5FKL A;  2N8G A;  5FLM J;  3H3V K;  1FIA A;  1OJL A;  1NTC A;  1FIP A;  2CQQ A;  2M9H A;  5IYC J;  3HB9 A;  1JTX A;  2Y9Y A;  2DA7 A;  4Y52 J;  1ITY A;  5K7Z A;  1FTZ A;  1EF4 A;  3GTG J;  4B1R A;  2NVT J;  2DA3 A;  1Z0X A;  3CDL A;  2L7M P;  4IHV A;  1HOM A;  2HOT A;  3C2B A;  2VI6 A;  1AHD P;  3DCF A;  2YU9 J;  2M34 A;  4D5F A;  4A3D J;  4A3F J;  5C4X J;  4QIW N;  2JWT A;  1I3Q J;  5K7H A;  5EG0 A;  5C4J J;  2NS7 A;  4IHY A;  1T33 A;  1JKR C;  2Y30 A;  1VFC A;  1POG A;  3I4N J;  2CRG A;  1I50 J;  3MVP A;  2W48 A;  1O4X A;  1OCP A;  2ZB9 A;  3VPR A;  2LK2 A;  2LKX A;  1HCR A;  2EZL A;  2TRT A;  5IP6 A;  2XPV A;  2M0C A;  2L0K A;  4XRS A;  1LE8 B;  1GV2 A;  3ZOB A;  3ZQH A;  3JRC A;  4M3D A;  2O7O A;  2LP0 A;  3BG9 A;  4X6A J;  1JJ6 C;  4QSH A;  3IV5 A;  3HOY J;  3S16 J;  1RET A;  3RZO J;  2E19 A;  5IPA A;  1B8I A;  1RES A;  3S17 J;  2QF7 A;  1JKP C;  1A5J A;  4M3E A;  1ZKG A;  4DYQ A;  5EDN A;  3JRB A;  3S1R J;  1IV6 A;  1U8B A;  3QQA A;  1U9O A;  2OF7 A;  1GT0 C;  3ZQG A;  1TWG J;  3O8G A;  3OSF A;  2FJ1 A;  3GTJ J;  5EZH A;  4CYC B;  2JMW A;  1MSF C;  1IC8 A;  1LE8 A;  2DMQ A;  1FJL A;  4MLO A;  1ETV A;  2CU7 A;  4FE7 A;  2DA6 A;  3TW6 A;  1G2H A;  3S1M J;  2EBI A;  4B3A A;  1BW6 A;  3Q0W A;  2ECC A;  2K9N A;  3QPL A;  2HXI A;  1WH5 A;  3TP3 A;  1Z77 A;  2DA5 A;  2O8K A;  2AO9 A;  3A01 B;  3HOW J;  5IOZ A;  2EZK A;  3G1L A;  4A3G J;  4DZP A;  5IP7 J;  4C3I J;  4V2F A;  3IH2 A;  4A3E J;  2B63 J;  4CYC A;  4FIS A;  2HOA A;  3CMY A;  5M3F J;  1RKT A;  3BTC A;  3BR0 A;  2DMU A;  2YUS A;  4W97 A;  1Q1V A;  2ID3 A;  2HYJ A;  3HGY A;  4M3F A;  4C3H J;  2FD5 A;  5F04 A;  4BXX J;  4BBS J;  3JR9 A;  2I10 A;  2R92 J;  1BW5 A;  3JRI A;  2JK3 A;  2NVX J;  5J1Y A;  2LTP A;  3NAR A;  4XIC A;  2R5Y B;  5FJ8 J;  1D5Y A;  5EGO B;  2QCO A;  3A03 A;  1JKO C;  3GTK J;  2E1O A;  1GDT A;  1ETK A;  1X2M A;  4JX5 A;  5JLX A;  2X48 A;  5DS9 A;  3A01 A;  1GUU A;  3RKQ A;  1VND A;  3HOU J;  2NOG A;  2CUF A;  1BA5 A;  2R7Z J;  1WH7 A;  2X6O A;  2CJJ A;  2VPR A;  2HOS A;  3LOC A;  2R0Q C;  3W6V A;  2CQX A;  3MKL A;  1ZGW A;  1PUF B;  1WGX A;  3CCY A;  3BR3 A;  1JTY A;  3OIO A;  4XRS G;  2G0E A;  5GPC A;  3QPS A;  2HI3 A;  1IDZ A;  2TCT A;  4I76 A;  2R5Y A;  1MSE C;  4AYB N;  5EGO A;  1YRN A;  5JLW A;  2MSY A;  3DEW A;  4JP0 A;  2ELK A;  3SFI A;  2DN0 A;  4L5E A;  4V2G A;  2P81 A;  4Y7N J;  1HF0 A;  2JN6 A;  1BJZ A;  4DW6 A;  2O9L A;  2PMZ N;  3SJM A;  1GVD A;  2VKV A;  4M3G A;  2E2I J;  1GV5 A;  4BY1 J;  2DMN A;  5M5X J;  1SAN A;  1NK3 P;  1UMQ A;  5IOY A;  1ENH A;  3H0G J;  2MGQ A;  5GPA A;  2DMT A;  1PUF A;  1IJW C;  2JJ7 A;  3B6A A;  4M3B A;  3M4O J;  2K9Q A;  2K9S A;  1X58 A;  5EZG A;  5F0C A;  4BY7 J;  5IP9 J;  4LOC A;  1QPI A;  2NVQ J;  2GLO A;  2D5V A;  2E2J J;  3JRD A;  2RAE A;  3UKG A;  2KDZ A;  2CUE A;  1MBJ A;  2L7Z A;  4DYC A;  1SFO J;  3WHC A;  2H8R A;  3LSP A;  2X9D A;  3JRE A;  1ZR4 A;  1F43 A;  1VI0 A;  3A02 A;  4XK4 A;  1MH4 A;  4DYR A;  2HQ5 A;  1A6I A;  2LY9 A;  2LLK A;  3LSG A;  4UUS B;  2L7F P;  1P7I A;  4AUX A;  2XRL A;  2DA4 A;  4FTH A;  2EQR A;  1Y1V J;  2Y9Z A;  2K40 A;  1JT0 A;  3GTO J;  2OPT A;  4A3C J;  3ZQC A;  3GBG A;  4RBO A;  1MBE A;  2Y2Z A;  5E3N A;  2XSD C;  4B4C A;  1LFU P;  4A3L J;  2COB A;  2ME6 A;  4EEF G;  1AKH B;  3HKZ N;  1HDP A;  3JRF A;  3HOZ J;  2XGD A;  1FTT A;  1DU6 A;  1MNM C;  5C3E J;  2IEK A;  2YS9 A;  3Q0U A;  1ZQ3 P;  4A3K J;  3I4M J;  1E3O C;  4XRM A;  1U78 A;  2JA8 J;  3PO3 J;  1OFC X;  3NAU A;  5F08 A;  5GP9 A;  1JGG A;  3TP0 A;  4UUS A;  4JX6 A;  1CQT A;  2VKE A;  1WPK A;  1XS9 A;  2M2E A;  3BG3 A;  4A3I J;  1MBF A;  3B6C A;  3ZQI A;  5FKM A;  3HEF A;  4MFD A;  5F0H A;  1R9T J;  4JX4 A;  1WCM J;  3BR1 A;  2R5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...