2M34A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens
rcsb
source organism Homo sapiens
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m34A00
5E3MA 4A3DJ 2CUEA 3QQAA 2WAQN 2VKVA 2ID3A 2XPUA 4CYCA 2JA8J 3HOXJ 2R0QC 1Y1VJ 1CQTA 4QSHA 1P7JA 3BTLA 1ENHA 1JKPC 5M5WJ 3BR5A 2XPWA 4S0HB 5FKNA 2GBYA 2NS7A 3JRIA 3A01B 3A03A 2CQQA 5J1YA 4AC0A 1BW6A 3TW7A 1ORKA 4BKXA 3BR6A 4M3BA 3S17J 1JTXA 5EG0A 1PUFB 2LFBA 1I3QJ 2WV1A 3S1MJ 1MNMC 3S14J 1AKHB 1OCPA 2MSYA 4BBRJ 3BR0A 4JX4A 1W0UA 3A02A 2DA1A 3NAUA 4GFBA 3B6CA 3MN2A 3BTCA 2EH3A 4DZPA 2XGDA 2L7MP 4A3GJ 2O9LA 2L7ZA 2P81A 3LSJA 5F0FA 2HDDA 1BA5A 2DA2A 4I76A 4A69C 3HM5A 1IDYA 2DA7A 3A01A 4JP0A 1WGXA 1ETOA 1D5YA 4A3FJ 1X2NA 4IHVA 3BQZA 3RQIA 1QRYA 3GTLJ 4DYCA 1BW5A 1PUFA 1JT0A 3CMYA 5F0HA 1TWAJ 2LVSA 2HI3A 5F1JA 1ZKGA 2YS9A 5C3EJ 2NOGA 1IJWC 1X2MA 3PM1A 4LOCA 3NARA 5F08A 5IP9J 5DS9A 1B8IB 3JRHA 4Y7NJ 1Q1VA 2FX0A 3IH4A 2XSDC 1RESA 2ME6A 2DMQA 2DJNA 4MFEA 2LTPA 1UG2A 3GTPJ 4XIDA 3JRAA 4BY7J 3CQZJ 2YUSA 1U8BA 4JX6A 3LNQA 2LD5A 4I6ZA 2LKXA 2VKEA 4DYRA 1MBHA 5EEAA 2XRLA 1E3OC 9ANTA 5K7ZA 4C3JJ 1MBFA 4A3IJ 1K61A 3HDDA 2JJ7A 5IYDJ 1P7IA 1TWFJ 2R5YB 2X6OA 2IEKA 4JX5A 2CUFA 5FJ8J 3BG3A 1B72B 4DZJA 1B8IA 3MKLA 4XICA 1JJ6C 3ZQFA 2OF7A 1JKQC 1JUMA 2DA3A 1MH3A 3FKIJ 3LSRA 4L5EA 4IHYA 1HLVA 3Q0WA 4C3HJ 3Q0UA 2M0CA 3JRBA 2NS8A 1HF0A 1HDPA 1DU6A 3S2DJ 2EQRA 3RKQA 2HXIA 4M3EA 4MO7A 5FLMJ 5E3LA 1IRZA 1VNDA 5EYRA 5EGOB 2ECBA 1RKWA 1MBJA 3FIWA 1IUFA 1U9OA 2HOSA 2R92J 1RPWA 3WHCA 2ELKA 2K9QA 5EZGA 3HB9A 3O8HA 4W1UA 3GBGA 2R5YA 3HGYA 3JREA 3S1RJ 5C4XJ 1SFOJ 1MBKA 1HDDC 1B72A 4B3AA 2Y2ZA 4M3GA 1S7EA 3FK6A 2ZB9A 2WB1N 2COBA 4C3IJ 4V2FA 1WCMJ 1JUPA 3S15J 4MIMA 4XRMA 3I4MJ 3WHBA 1Z0XA 2XGEA 2VUMJ 2MG4A 4A3KJ 3S16J 3K7AJ 1VF9A 4M6VA 5K7FA 3ZQCA 4J19A 2L9RA 5EGOA 2HXOA 5GP9A 1JKOC 1RKTA 3GTMJ 1JT6A 2R5ZB 1T56A 5J1RA 3I4NJ 1BJZA 4FTHA 3D1NI 5EZHA 5EF6A 1Y1WJ 1G2HA 4XRSG 4RBOA 4D5CA 3HOZJ 2DTZA 2JN6A 3CCYA 3OOUA 4IHXA 1FEXA 1JKRC 1FTZA 1UMQA 2K9NA 4M3FA 4FE4A 1TWHJ 5GPAA 2HOAA 2CU7A 2KT0A 1AU7A 4FCYA 5J1UA 2LR8A 1QVUA 2E2JJ 3HGGA 1LFUP 4NDLA 4AUXA 2QF7A 1O4XA 2O8KA 1K83J 3BQYA 2GLOA 5IYBJ 1AHDP 3OSFA 1AKHA 1IDZA 2MGQA 2K40A 3HKZN 3IV5A 4EEFG 3TP0A 2R5ZA 2DMUA 1NK2P 1SANA 3S1NJ 2XPVA 3C2BA 2VI6A 1NK3P 1I6HJ 1FIAA 3RZDJ 1W0TA 2RAEA 4MFDA 2DMTA 1LE8B 1GV5A 4A3JJ 2OPTA 3HBLA 4XK4A 5F0CA 2H8RA 1A5JA 3OIOA 1NTCA 3Q3SA 2IAIA 3GTKJ 2NVQJ 3S1QJ 5E3NA 5K7HA 3RZOJ 2Y9YA 1F36A 3O8GA 3SDGA 5IP7J 1A6IA 3PO2J 2R93J 2AHQA 2XB0X 3G1LA 5IP6A 3BG5A 3L1PA 5FLVA 1JJ8C 4D7NA 2PMZN 3JRFA 4B1RA 4UUTA 1GUUA 2E19A 2VPRA 4D7MA 5M3MJ 2EZHA 4G12A 4HNVA 1LE8A 1LFBA 1YRNB 1XG1A 2L7FP 4B4CA 4A3CJ 5IPAA 2JMWA 3GTQJ 3MVPA 1H89C 4X6AJ 1XC5A 2NVTJ 3SFIA 1OJLA 3E7LA 2DN0A 5JLXA 1T33A 3GTGJ 3LOCA 2CQXA 1GV2A 2M9HA 3TP3A 3CDLA 2X9DA 4ABZA 1QPIA 2M2EA 1I50J 1APLC 3GTJJ 4C2MJ 1TC3C 2Y9ZA 1FIPA 2E2HJ 1U9NA 4A3MJ 3PO3J 2M8GX 2Y0SN 1U78A 3DEWA 2JWTA 3DCFA 3UKGA 3ZOBA 1EF4A 1YRNA 4JYKA 5FKLA 3G1OA 5IYCJ 2JA5J 1ETWA 2E1OA 2W48A 2GM4A 1ITYA 2MW8A 1IC8A 3H0GJ 3LSGA 2LP0A 3HOVJ 2LY9A 1GDTA 2DA6A 3ZQHA 4FE7A 3FK7A 3FISA 2ME0A 3W6VA 4A3LJ 2L0KA 2M34A 3IH3A 2YU9J 2CJJA 3BR2A 2Y30A 1FJLA 1OFCX 2N8GA 1RR7A 1WH5A 3ZQIA 4QIWN 1POGA 2ECCA 3M4OJ 3VPRA 3ZQLA 2NVYJ 2JA6J 1IGNA 2FQ4A 3QPLA 4X1EA 5DTDA 3GTOJ 2DA4A 5J3LA 1TWGJ 1MBGA 2IBDA 1Z77A 1ZK8A 4FISA 5HODA 1FTTA 1MSFC 5E3OA 4Y52J 4AYBN 4DW6A 1X58A 4DYQA 1GVDA 5C4JJ 1VI0A 2CRGA 2JK3A 5EDNA 1JGGA 5FKKA 3BR1A 3BR3A 1WH7A 5GPCA 2EZKA 3JRDA 2EBIA 2XGCA 5IOZA 2DMPA 2X48A 5JLWA 2D5VA 2TRTA 3JRGA 2HQ5A 5F27A 3F0CA 4QTRA 2K9SA 1H8AC 1F43A 1MSEC 1JTYA 1MBEA 4UUSB 1ZR2A 3BT9A 5BNGA 2JA7J 1ETYA 1RETA 2ID6A 5IOYA 4BXXJ 1UHSA 1JUSA 2LK2A 2B63J 1WI3A 3SJMA 3HOWJ 3HOYJ 3Q0VA 3K2AA 2FD5A 1WPKA 3M3YJ 3ZQGA 4RDUA 1ZTRA 2QCOA 3G1MA 5M3FJ 5C44J 4V2GA 2I10A 2O7OA 5FKOA 3OSGA 4A3BJ 1IG7A 2HOTA 2R7ZJ 1HCRA 2EZIA 2DMNA 4MLOA 1MH4A 2NVXJ 1QVTA 3H3VK 4UUSA 3LSPA 1ETXA 1ZR4A 4D5FA 2H1KA 3TEDA 1R9TJ 3JRCA 2G0EA 1GT0C 2KDZA 1IV6A 1ETKA 1ZQ3P 2FJ1A 3QPSA 3BTJA 4CYCB 1OCTC 3BTIA 3S2HJ 4BBSJ 4IEJA 1VFCA 5F04A 1HOMA 1BL0A 4BY1J 1DU0A 4W97A 3HOUJ 3TW6A 3B6AA 5M5XJ 4XRSA 3HEFA 4IHWA 2XB5A 3IH2A 1ZGWA 1TWCJ 2LLKA 4M3DA 2EZLA 5FKMA 2AO9A 2HYJA 4A93J 4A3EJ 1ETVA 5EG0B 2DA5A 3JR9A 2E2IJ 1ETQA 2Y31A 2TCTA 1XS9A 3BG9A 5M5YJ 1H88C
chains in the Genus database with same CATH superfamily
3AL0C 1P4WA 1U3EM 2CUEA 3I0TA 3QQAA 2LRDA 1XX5A 2ID3A 4HDVA 2VOPA 2JA8J 2BY0A 1MGTA 2R0QC 4Y33A 2Z9OA 3HRMA 2WAQA 1P7JA 4QSHA 1D1AA 2KDOA 2V26A 3BR5A 1UZCA 5JR3A 4UUVA 1YIJI 2GOXB 2FOWA 1K78B 1JI8A 4MNUA 5LHIA 3VB2A 3ZR8X 4BQAA 3L00A 1N75A 2CQQA 4C30A 1QHGA 2FBKA 2K3FA 1BW6A 3CJQB 3BR6A 3QP5A 4YIRX 4M3BA 4M74A 2R7DA 4M9XA 1JTXA 3S17J 2LY2A 2ZMEB 5D4RA 1XCVA 4HA8A 1WRJA 2O5RA 3S1MJ 2ZJ2A 2E7XA 3TOBA 3DF8A 2R7FA 2STWA 4BBRJ 3OL4A 3FXQA 3BR0A 3L7WA 3DKXA 1IAWA 1ODDA 3FMQA 4U0YA 1R4MB 3L2WA 2DA1A 3PNYA 3NAUA 1T0FA 4GFBA 1Q1HA 2W4SA 2R4GA 3EPZA 4KIBA 4OMZA 2VKDA 3E3VA 2EH3A 2R7WA 2HVQA 2DJIA 3P9KA 3IL2A 1IN5A 2KJBA 4X0GA 2HKOA 4HLYA 4A3GJ 3OS2A 4G6TB 2EFOA 2KIFA 4I76A 3L2UA 3HM5A 1IDYA 2O0YA 3A01A 1WGXA 4I2OA 3FWEA 2X6XA 2HZTA 4IHVA 2PI0A 3BQZA 3IUOA 3RQIA 5J6XA 2VQGA 2PJRB 1G6NA 2VODA 2BV6A 1QU3A 4CYDA 5CKTA 3ZQ7A 2LVSA 3CCJI 2HI3A 3GF2A 2W85A 2ELHA 1ZKGA 1R23A 3PM1A 4LOCA 2VT3A 3KZIC 4XLNF 3I56I 4UVAA 1FY7A 3F21A 4IHTA 3JRHA 1YI2I 4B44A 3IH4A 5J8FA 4EJUA 2ME6A 3DFGA 4JOMA 3ZMSA 4MFEA 4BJ5C 1UG2A 3C18A 3KP4A 3S3NA 4ZYGA 3MZYA 4IQJA 3S3MA 1EV7A 4KA4A 1LEBA 3LNQA 2D1HA 3E5UA 3K1PA 2ELJA 2V9PA 2M4GA 3SEZA 4RB3C 4GO1A 5GAHJ 4L5IA 5LGTA 1E3OC 2M1BA 5D8LB 2FUG2 4RGUA 4GRIA 1MBFA 3HDDA 1TWFJ 3J7YJ 4AIDA 2FNPA 4XICA 3F8FA 2LF7A 3FKIJ 3LSRA 3BLYA 1RI7A 4L5EA 2EWNA 4IRIA 2DLLA 3JRBA 3ZN1A 3OYCA 2HTJA 1DU6A 5CQGA 1W7PB 1D8JA 2ADUA 2BY2A 2HXIA 4M3EA 2OTLI 3QWLA 1FYLA 1WJDA 4E7IA 4YEJA 5CVIA 1QNTA 5HS9A 2XAUA 3GCMA 1MBJA 4PDKA 4BQOA 2GA2A 4LK0F 2HOSA 1C0WA 2LDUA 1RPWA 1S9HA 2IGOA 3D5LA 5CVVA 3NEUA 5ICEA 2IJLA 2EIMH 5HLHA 4BUPA 2MYSA 2Y48A 5LHGA 5HLIA 2FA5A 1A35A 2KPMA 2XF7A 3HB9A 3CC7I 2R5YA 2KRHA 3GBGA 4HAMA 5E79C 1MBKA 1HDDC 4L9JA 1KU2A 2ZBKA 3K1NA 4M3GA 1TP4A 3QPHA 1S7EA 2DQLA 3CC4I 1U2WA 4DBQA 2WB1N 2COBA 4V2FA 3FBNB 5LHHA 1WCMJ 4EATA 1JUPA 5LEJA 1K4SA 3S15J 3I4MJ 4U87A 4ZTJA 1Z0XA 2MG4A 4A3KJ 1ZGAA 4D0PA 3HRUA 1GVJA 3ZQCA 1OYIA 4J19A 1HC8A 3DBLB 3LSTA 2HXOA 3ASNH 2V79A 3E0JB 3KE2A 4EV0A 1LVKA 3M9AA 4D1QA 4FTHA 1Y1WJ 3D1NI 4LD5A 3V7RA 3WTSC 2QSFX 3U1KA 1G2HA 1YS7A 1D3YA 4RBOA 4PFPA 4XKVA 2DTZA 3HG9A 1QO0D 3ZP5A 3E5QA 3GZNB 2JSCA 1FEXA 1FTZA 1UMQA 4EMSA 3OR2C 3H0DA 4WXCA 2MH2A 4M3FA 5FFXA 4FE4A 4B43A 3FHZA 3QU6A 3RPUD 2FEZA 3MEXA 5L3DA 1AU7A 4FCYA 1L0OC 1TQIA 1ZLJA 2ZO4A 1SD7A 1X1CA 3G2BA 1W5TA 5ICFA 1CF7B 4E7HA 1R1UA 2ZSHB 3KP3A 5LRSA 3EETA 5HS7A 1K83J 3BQYA 5ILSA 1LDKB 2GLOA 2DODA 3VDXA 1S5LC 3AG4H 5HVQC 4E70A 3PUBA 4ZDPA 4EEFG 2YU3A 2DMUA 2E1MB 3GFMA 3R4KA 3N05A 4IXAA 4N0BA 2VI6A 3L2CA 3ZCOA 3F8CA 1W0TA 2M3AA 1S8NA 3I71A 3D5SC 5D5XB 5FRNA 2KHMA 1VQNI 1E0EA 2X51A 5F6FA 2ISZA 5K1YA 2X85A 2R7UA 1G3WA 3FXMA 1YLFA 2JSPA 2JRTA 5DCFA 2IXSA 2VJ4A 3LAJA 2Z1DA 3OYMA 1KA8A 3M1CA 3GTKJ 2NVQJ 3MAJA 3H5NA 5E3NA 2V9KA 3AFHA 4HV6A 2P6TA 1IZ1A 2XSJC 3G1LA 2A6TA 4P96A 2KP6A 3I54A 3C2GA 2F4IA 2HS5A 2PMZN 3JRFA 1FNNA 2UV1A 4Z6YA 2BW3A 3IHUA 1D0YA 2EJRA 5GTHC 1HXDA 1ZRDA 1YITI 4D7MA 2W25A 2EZHA 2WY7Q 2IPQX 1JHFA 4HNVA 4OINF 4G94A 4ETSA 2MA3A 2M0MA 3K70C 4EQQA 3GO5A 2KL4A 4MQVA 2F2EA 3E1SA 3MVPA 4HEA2 3DPLC 1GXQA 2DFIA 2ZCWA 2RREA 3DXJF 1OJLA 2I8DA 2DN0A 3ERMA 1W36D 4CDGA 2FBHA 3GTGJ 3H1CA 4IVNA 1PYVA 3VODA 4PZJA 1GV2A 2DTRA 2M9HA 3FZVA 3TP3A 5F1RA 3HL2A 4ABZA 3AKZA 1QPIA 1R1VA 2P4WA 4E7KA 3CC2I 1WSUA 1O3SA 3ABKH 2CH0A 1FIPA 2E2HJ 1U9NA 4A3MJ 5GADJ 1G8XA 3BOQA 1V5EA 2M8GX 3I9V2 2Y0SN 1R58A 2XAQA 2JWTA 3PIPF 3ZOBA 2QUFA 1YRNA 4UVCA 1FPQA 3G6EI 3WU1B 1TZLA 1BR1A 5FKLA 2L01A 4PJNA 2OQRA 2W48A 4ANJA 2DYSH 4F92B 4I99C 3A2KA 1ITYA 2ZSIB 2OU2A 3H0GJ 3F23A 3WTVC 4FE7A 4A5MA 3W6VA 2DQRA 3DKYA 3I59A 4PJMA 2PLYA 3IH3A 3SYTA 2CJJA 1FJLA 1RC9A 1RR7A 1KYWA 2JVGA 3ASOH 2VBXA 1LQ1A 2QZ8A 3KX2A 1YJ9I 2NVYJ 4KFCA 3V7CA 2FSWA 2KJCA 2FQ4A 3CCEI 1T6SA 3HHHA 3GTOJ 2MC3A 5DCMB 3BDDA 1TWGJ 2IBDA 5J8CA 1ZK8A 4FISA 1BI3A 1N25A 4XL9A 2JVHA 4OMYA 3BWGA 1VI0A 1H0MA 4OIQF 3CDIA 5FKKA 4CCJA 3RI4A 1X3UA 3BR3A 4WXHA 4XNFA 5GPCA 4J01A 1G59A 2A05A 4A0ZA 1VQ8I 3JRDA 3DPTA 5L3GA 2VE9A 2XGCA 2DMPA 2X48A 2EPFA 3MWMA 3MFKA 1IO2A 2E36A 2GA1A 2VBWA 1YE9A 5F27A 5F64A 4EM1A 1A31A 2L7KA 4ASNA 4UUSB 4KISA 1AWCA 2QSHX 2H8WA 4LITA 1ZR2A 3M8EA 2VQLA 2DXIA 4I98B 2JA7J 5LEKA 1G3TA 1RETA 2ID6A 4BAYA 2K02A 5DD4A 2BVMA 3OS1A 1WI3A 3SJMA 2B63J 2QM3A 4GDFA 4Q48A 5E18F 3LA7A 1NHAA 3Q0VA 5ICGA 4GXOA 3GX4X 4BE2A 1FT9A 2K7LA 3KYDB 4B8XA 1YX3A 4KJZA 2QCOA 3EDPA 5C44J 3WTTC 5M3FJ 2I10A 1FOKA 1FSHA 2X1EA 4S04A 2BEOA 2CW0F 1ZG1A 4A3BJ 2E5ZA 2RNGA 1Y56A 3TDUC 4O3MA 1HCRA 2DMNA 4BE1A 2L2OA 1HW2A 2NVXJ 4Y15A 3T8RA 3F9KA 4XLCA 4XMYA 1ETXA 3U1DA 2NAZA 2CS3A 2OCCH 3JRCA 1R49A 2X6YA 4G9YA 1IV6A 2DOFA 2FJ1A 2PN6A 3PL8A 3K69A 3M8FA 2VXDA 3RYRA 2QLZA 3PQKA 2IS1A 4ZC3A 2FRHA 3CJRB 3R0JA 4XKBA 3P7NA 5D5VB 2NYXA 4FETA 1BL0A 4W97A 5HDGA 3HOUJ 2NRAC 3TW6A 4XRSA 3IH2A 2NXNB 1FBSA 3RIRA 2LY1A 2L4MA 4CZZA 1GXPA 1Z21A 3BJ6A 3TO9A 4RAZA 2AO9A 2HYJA 1WZ2A 1FX7A 1DP3A 1XB4A 2L02A 4WXDA 2Y31A 4R8HA 4PUSA 5FFZA 2F5VA 5HDNA 2JA6J 5M5YJ 1H88C 3RJPA 4OOIA 3SXYA 4A5NA 5FO5A 2K4JA 3DWLE 4CYCA 4ESFA 3QYFA 4JQFA 2JQ7A 2HPIA 3GLLA 1YX5A 3WG7H 4HRIA 1IXCA 1ENHA 4WF2A 1T95A 2BHZA 3BG7A 1DGWY 1O7LA 3P9IA 5M5WJ 3KEYA 2FNAA 5FKNA 2HYGD 3FBIB 3U2RA 3A01B 2F5EA 3A03A 3ECHA 1MZBA 1OCOH 4BNCA 2HTSA 1ORKA 3D0SA 2P8TA 1ZYRF 2L9NA 2VQHA 5EG0A 2CV2A 2V7FA 1GLNA 1SD5A 5L3CA 1PP7U 5KK1A 4PJLA 4DNCA 1QBJA 1KQ9A 4LJZF 4CH7A 1OISA 3FX3A 2LNBA 4L9NA 3LL7A 4I0BA 3A02A 5CVRA 4HX8A 2EFPA 3MN2A 2XDVA 2TDXA 4DZPA 3RKWA 4HZFA 2XKOA 3PSFA 2NNYA 2L7MP 2L7ZA 3LSJA 5F0FA 4CCLA 3CCLI 2HDDA 4AYBA 3KYCB 2DA2A 1D1BA 2ETHA 1FZPB 5HNHA 4A69C 5JHFA 4E7LA 1D5YA 1ETOA 2FE3A 3NRVA 1X2NA 2CO5A 2ESHA 1BI1A 2QYOA 3GTLJ 1BW5A 1YIOA 3PIOF 1FOWA 1FYKA 1FBQA 5FD5A 3VSLA 4N9HA 5C3EJ 1ZGJA 3CCMI 1X2MA 2GIVA 4E7ZA 3E6CC 3OIQA 1HSTA 3NARA 4I09A 2CSOA 3RTRA 1IXRC 3M7GA 2VC0A 2O8XA 4UHTA 2A61A 2JUGA 2FX0A 4MQ9F 4BE0A 3Q5FA 5E8GA 2F6CA 1TW3A 1RZ4A 4OAYA 2ISYA 1XGSA 4IOCF 4BY7J 3EUHC 4G7OF 2LYCA 1MD0A 2H09A 2E34A 2R3SA 2XIGA 2M8EA 2NVUB 2LD5A 1SFUA 1J59A 1IRGA 4CHUA 4PCQA 1BC8C 2OZUA 1MBHA 3S32A 2O3FA 1MNDA 2P7CB 1ACIA 2XRLA 1HW5A 3OOPA 1FLIA 1BBYA 4C3JJ 2L9VA 1K61A 4NQWA 4EJVA 2VIXA 2IA2A 2R5YB 3BP8A 2IEKA 2BXYA 2CUFA 2WC2A 3C7JA 3OS0A 3NWSA 2H6CA 4B3XA 2NNNA 1LDDA 2OF7A 3CP8A 3G3ZA 5KCMA 3RQ4A 1JKQC 1I1GA 3CZ6A 3Q0WA 3ERED 1HLVA 2GWRA 1P4AA 3EUAA 2NS8A 4B47A 2M5WA 2KIMA 2EIKH 3S2DJ 3OR1C 3HSRA 1KGSA 1IV8A 1W4MA 2EFNA 2Z2SB 2P5VA 5BQTA 3MZHA 1IRZA 2I5UA 1ON1A 2DYRH 1JXSA 3TL4X 1K4TA 3FIWA 1U9OA 2EINH 1LFPA 1U5TC 1S6LA 1BI0A 3GLXA 1WHUA 1XTAA 4KT5C 3B02A 2K9QA 4L9VA 4MEXF 5B3SH 3K9TA 2E5NA 3LAPA 5EZGA 3F8MA 3CTAA 5IT3A 3QAHA 3S1RJ 3JREA 2VOOA 3H92A 5ICCA 3HSEA 2R7SA 1SMYF 4BDYA 3KEOA 5BPIA 2R7TA 3GZ6A 2KRFA 1N77A 2QGUA 2QBYA 3IKTA 2IA0A 2HYFA 1ON2A 4MIMA 4WWCA 5TGTA 3CCSI 1OR7A 4AD9A 2XGEA 2VUMJ 3FDYA 2QA4I 5HOOA 2RDPA 4M6VA 5IY5H 4DOZA 3TBIA 1ZAOA 5EGOA 2HOEA 4H0EA 3FXOA 5GP9A 1JKOC 1RKTA 4HYEA 3O6BB 2Q0OA 1SD4A 5J1RA 1BIBA 2W82A 2VBZA 4UB6C 1R5HA 4D5CA 5K5OA 2UZKA 3HOZJ 2P0WA 3CCYA 1E2XA 2JN6A 4IHXA 3RCOA 3HPHA 1D8KA 4MEYF 2L9SA 2IS6A 3V8LA 2L5QA 2K9NA 2BZTA 4PJJA 1J09A 5GPAA 5BOXA 1IRXA 2CU7A 3DKWA 3DQVC 2LR8A 1QVUA 2G7HA 2DBBA 3HGGA 3BCAA 2BYVE 1LFUP 4UV8A 4NDLA 1R6RA 3WTWC 2O8KA 3CUQC 4NHJA 3BROA 5KVRA 1YS6A 2R7OA 1IDZA 2WA0A 2D2WA 2VKHA 2W84A 2R7QA 3HKZN 3LA2A 4EM0B 3ZRGA 1D0ZA 3GFIA 1V3FA 1GHCA 4RM2A 4OIPF 4O6JA 3GWZA 4XN3A 3C2BA 3S3OA 2BW3B 1R36A 1FIAA 3TMOA 4II3A 3JAMZ 3FM3A 1L3LA 2MFZA 3A1YA 1REPC 1XCBA 4G7ZF 4M73A 4AIJA 1MIJA 1PJRA 3VYTB 3HBLA 2H8RA 3LQRA 3Q9VA 3KLOA 1G3YA 4BYYA 3WGIA 3DLLF 3Q3SA 1UB9A 2IAIA 3V7SA 1DQUA 3S1QJ 2DFHA 4KMUX 1DGRM 2Y9YA 3DEUA 2BVLA 5IP7J 3CO6C 2W7NA 1MMGA 3O3KA 2R93J 2XB0X 3ONQA 5IP6A 1ZH5A 3BG5A 2G9WA 3L1PA 5FLVA 3TOAA 2CQ7A 1JJ8C 4D7NA 1UJ8A 5DM6F 2D45A 3SHFA 4IZZA 2IP2A 1FOXA 4UUTA 2UXNA 5CYVA 1ZRCA 1X19A 4RM3A 5M3MJ 4G12A 2XAJA 4F55A 3K4JA 1LE8A 4F3QA 4ZYDA 4YFXF 2FQ3A 1Z67A 3FXLA 3TDZC 1YRNB 4LIVA 4LLNA 3QPTA 4CCNA 2STTA 4V19K 3KIOA 1H89C 2E1CA 1FC3A 2NVTJ 3SFIA 3KP5A 2DFEA 3M07A 3HSFA 5JLXA 2EILH 3ZQQA 3I59B 3X2QH 1MDMA 1O3TA 1I6XA 3CLQA 4UVBA 4E6KG 2WBMA 4HX7A 1I50J 4HG2A 2QQAA 3ZMVA 2QVOA 4G6QA 4C2MJ 1TC3C 2GXBA 4YRVA 2DI3A 3OYLA 2VN2A 2VT2A 1H9TA 4EJWA 3PO3J 3G73A 4Q5SF 3JTGA 2OAZA 2MLGA 4Q4ZF 2J5PA 3SQNA 4CGZA 3I58A 3HJEA 1U78A 3GW2A 3W6KB 2HWVA 2L54A 4YIIA 3I55I 4CCOA 2RKHA 3G1OA 5IYCJ 2JA5J 2E1OA 3CUOA 1IN4A 2WAFA 1SEUA 1WJCA 2YX4A 3OIPA 1IC8A 3Q9SA 3ESWB 1Z1DA 2K3PA 1FOYA 5FRMA 2DA6A 3P5JA 1FWZA 4AIHA 3FK7A 5KHDA 3HOTA 1A36A 1Z7UA 4PK4A 2L0KA 2VB6A 5D4SA 2YU9J 1U8RA 4ITVA 1OFCX 2N8GA 4QIWN 2VONA 4C9YA 2AQFA 5D5WB 3EYIA 4KNYA 4U88A 3M4OJ 3G71I 3CMEI 5LD2C 3VPRA 3WTXC 1IGNA 4ZJZA 2YR2A 1MMDA 3QPLA 4IKFA 4KYWA 3MD2A 1K6YA 2DA4A 2LF8A 2WADA 5J3LA 5JVTA 4WCGA 1LPQA 4QPOA 1MSFC 2H1LA 4Y52J 4AYBN 5E20A 3R61A 4DIQA 1XDSA 3DTEA 1JGGA 2W00A 1SAUA 1WH7A 4BXFA 2AXLA 5JLWA 4ZZLA 1WJAA 2YSRA 5L3BA 4BGDA 2CW8A 1E3PA 1W5SA 3AAFA 2KLOA 1XMKA 3K4KA 3OYFA 4KUMA 2CV1A 4KDPA 2GXGA 5FD6A 2CG4A 3PNTA 3ULQB 3ZMZA 3DTIA 3SEQA 3I4PA 3CMMA 3K4BA 3FXJA 1YJWI 4HNUA 2DFFA 3HOWJ 2F5CA 3IWFA 1HW1A 1WWXA 3K2AA 1P92A 1T2KA 2FD5A 1WPKA 2WAEA 1IF1A 2DAOA 2M7BA 2RNJA 4XSZF 5B5EC 4RDUA 2XROA 1ZTRA 3BPVA 3G1MA 3CCUI 4V2GA 3FXRA 3HUGA 2L3DA 3LA3A 4XLFA 1ZHFA 5FKOA 1KQ0A 1QA6A 2HZDA 2M87A 1A04A 2HOTA 2EZIA 2MLKA 1O57A 3TKYA 4M6XA 3KLNA 3N4MA 2RVCA 5JI6A 4IHSA 3COAC 3DBRB 5DUIA 1VQMI 6PAXA 3TO7A 2IGKA 1ZR4A 1SMTA 1ZG5A 5DUKA 2VLAA 3JAMK 2KDZA 3KP6A 3HTSB 4RGRA 3QPSA 4CYCB 1YW8A 3VYUB 2CQKA 5L3FA 4IEJA 5F04A 3PJRA 5TRDA 1SVLA 2NOJB 1YG2A 3ML6A 1O3RA 2B9SA 3B6AA 5M5XJ 3HEFA 2X4HA 4HX4A 3QP6A 3FM5A 4DBRA 1HKSA 2VC1A 1WVRA 1X4PA 2EZLA 1VQ9I 1X1DA 3LFKA 3CD6I 1OYWA 5EG0B 1IN6A 2O61A 1EH6A 1TBXA 3PFIA 4XR6A 3WE2A 1FP1D 1I3AA 4XN0A 1SC7A 2AS5F 1PDNC 2DPUA 2G7UA 4A3DJ 2WAQN 3OYNA 2HPMA 1MNEA 1YTYA 3HOXJ 2ACJA 1OQYA 5HDKA 1Y1VJ 1VTNC 4RLFA 1HKTA 2QQ9A 2DT5A 3H9JA 4JBAA 3EQLF 3CF5F 1WKMA 1V54H 4GYIA 3GFJA 4I0AA 4LLLA 3GEZA 5J1YA 2Q2EA 5FROA 1WJBA 2M45A 4BKXA 2KISA 3SZGA 3DEEA 1S72I 3CCRI 4LG0A 1KU7A 1Y0UA 4ZZDA 3E6BA 1MNMC 2YX7A 4HF2A 2Y75A 4E4HA 1VZ0A 3PSIA 1OCPA 2MSYA 4A6DA 4N4OB 4QLCU 4IJAA 1OYYA 1Z9CA 3FKJA 1W0UA 5HS8A 2KZVA 3BTCA 3VEPA 3LSKA 1ONVA 3LQQA 3T8TA 3F6OA 1X1AA 2O9LA 1F9NA 5D6FA 1BA5A 1NG7A 3IC7A 3IRQA 1EJ9A 4EVIA 4A3FJ 2MBFA 1ZLKA 2IA1A 1QRYA 1RIOH 2IS4A 2OJED 3EUKL 4DYCA 2K9MA 1PUFA 1JT0A 1DPRA 5F0HA 1TWAJ 3AG3H 4XLHA 3FMRA 4NQWB 2A5YB 2YS9A 1A6QA 5F1JA 2O6GE 2PQ8A 5F08A 3HC7A 5IP9J 5GAGJ 2A5WA 1UAAA 1X4OA 4AVPA 2RQQA 4ZYAA 2DJNA 2M7AA 3A4CA 2LTPA 4AM3A 3GTPJ 3ZMUA 4XIDA 3OYAA 1G4DA 1FMVA 5KNLA 1HSJA 1BIAA 2YUSA 1U8BA 1OLTA 2XRNA 4JX6A 3ZGKA 4L0ZB 3RKXA 2VKEA 2P6SA 5DD8A 2VL8A 4EGZA 2UUZA 5J4VA 9ANTA 5K7ZA 2VJJA 3QRFF 4YFNF 4M72A 1WFXA 3H3UA 3QOPA 3E5XA 3CO7C 1ZRFA 4BU2A 1B8IA 3MKLA 4DJAA 3BCBA 4FQGA 1JUMA 2DA3A 1WQ2A 4HF1A 5LGUA 1XGOA 4IHYA 1RRJA 1UHMA 2QBYB 3Q0UA 3VYRB 4EGYA 1HF0A 2KZGA 1HDPA 1X3ZB 2OC6A 2GZWA 2Z16A 4DGWB 2X1CA 4II2A 4U7DA 1STZA 5FLMJ 2DOAA 5E3LA 1N78A 1Y39A 2GIZA 1VQPI 1FBUA 3W2AA 2LMDA 5EGOB 1QZEA 2ECBA 1RKWA 2R92J 1FP2A 3LSMA 4M6YA 1R71A 4U0VA 4BEHA 2LBFA 3QOEA 1SD6A 1RNLA 2DT7B 1B59A 4OU0A 3J7ZI 3OMYA 2RC4A 3E6MA 2QKMB 1EKEA 3JW4A 1B72A 4B3AA 1S7AA 2Y2ZA 3H9QA 3I64A 1AOYA 4XKCA 3FK6A 2ZB9A 4B09A 3AL0B 4C3IJ 5FB2A 2JT1A 4XRMA 2WB1A 1ZREA 2PG4A 3H5AA 3H9GA 4HOBA 3IRRA 4ZDLA 4PFOA 2GAUA 1VF9A 2B0LA 5K7FA 3D5RC 4P9UA 2VBYA 1PUEE 4K2EA 4XONA 2JA2A 3GTMJ 3OWTA 3MZ8A 4LLGF 3I4NJ 1BJZA 4F7ZA 4RMNA 5ILVA 5HLTA 4XORA 4XRSG 2V1NA 2HNHA 4KICA 4EJTA 1YW7A 1S3JA 4FX0A 4CCMA 2RGVA 2VJIA 1BR4A 4RAYA 2ZNZA 4U0WA 4ZDOA 4IL6C 2HOAA 3PFYA 3WGGA 1YOVB 5J1UA 2F4OB 2LREA 1E17A 4S05A 4AIKA 3OYDA 5BMZA 5EEGA 2QF7A 3MMYB 3P9CA 5GTIC 2ICWG 5IYBJ 4ENKA 2WTEA 5K5RA 3BG6A 1ZARA 1MJAA 3PNVA 3J7AO 3IV5A 3TP0A 2F5FA 2R5ZA 2FMLA 1NK2P 1Z3XA 2XPVA 1B1BA 2W57A 1T98A 4HV5A 4LFUA 2HVRA 1TW2A 3ZN0A 1I39A 1VQLI 3G4SI 4XLAA 5LBQA 1D5VA 4P9FA 2RAEA 3K4LA 5IT9Z 3R6SA 2DMTA 1T38A 1LE8B 1T39A 3WTUC 1ERDA 1GV5A 1YYVA 3CP2A 3V8KA 2DK5A 4A3JJ 4XK4A 5F0CA 2DPDA 1B6AA 1Y8RB 2EB7A 2XF5A 4F93B 4AWXB 3ELKA 2XKPA 1J2XA 1WI9A 2K85A 4E7JA 1B4AA 1UFMA 5K7HA 3JSOA 3RZOJ 5KAIC 1F36A 3SDGA 2BBYA 1A6IA 3IAM2 3PO2J 1MDMB 1IUYA 4XBFA 4RGSA 3CLOA 1W1WE 2V4JC 4F91B 4ZYEA 1F1ZA 2NS0A 2E7WA 1RUNA 3QODA 1RUOA 3ZXSA 4B1RA 3K2ZA 1LUJB 4CSWA 2MC4A 2MD0A 2E19A 2VPRA 4H4KC 2V1UA 1JHHA 2K27A 1LKXA 1LFBA 2CFXA 2DOEA 1LNWA 2BY3A 3DV8A 5EJCA 3E6DA 4P1WA 3CMAI 4PJ0C 2L7FP 1TLHB 4A3CJ 5IPAA 1W36C 3GTQJ 5KAFC 5DYMA 1KQ8A 3V8JA 2ESNA 3K70D 4XQFA 2FOKA 4LG3A 2P5KA 3BZ6A 4L5JA 4L0YB 1QHHD 4HSTA 1T33A 3J81Z 1NG6A 1XSDA 3EUHA 1R1TA 2VJ5A 3GUDA 3E97A 1E3HA 2CQXA 3JCUC 3K10A 3R60A 4LGWA 3W2VA 1T0FC 1B9MA 5H2FC 3KETA 2IW5A 3R0AA 4Y17A 2DW4A 5D5UB 5JHUA 1TTYA 3F3XA 3IAS2 3F72A 4LIUA 2CV0A 2IRFG 4M9ZA 2AXTC 2Y0MA 4EJOA 2PBIA 1D0XA 2WY8Q 3ABUA 5K5QA 3UKGA 3O2PE 1IN8A 2R7VA 3A0HC 5LFAA 3S8PA 4PGHA 3MKYB 1ETWA 2Y0SA 2GM4A 2MW8A 4BQQA 5ED4A 2ZFWA 3CF2A 2LY9A 2W24A 3ZQHA 3H5RA 1K79A 2ME0A 3FHNA 4A3LJ 2HVSA 3VWBA 1DP7P 4RB0A 1O3QA 2Y30A 2Z3YA 3ZQIA 4D9JA 2K5CA 4BACA 3RDIA 2A07F 2PJPA 3AG2H 2EV5A 1POGA 4RGXA 4ENJA 4PSWA 2XVCA 1U5TA 1U6GA 4QPQA 1HQCA 1PVEA 3J7AY 2VQCA 3BPXA 4N4NB 3REOA 3BZKA 4X1EA 4MTDA 1F4KA 1MBGA 1R7JA 1Z77A 5HODA 2EV0A 3K4MA 4G6DA 1FTTA 2FBIA 2XAHA 3V42A 4DW6A 1R5GA 4DYQA 5C4JJ 2CRGA 5EDNA 4A2UA 3WODF 3HUGB 1Y6IA 3BR1A 3ROUA 2A6HF 2ZXJA 1KU3A 2EZKA 4XSXF 2EA4A 1YHQI 4U7BA 2M4KA 2KKOA 2TRTA 3OV8A 1TQMA 4MGRA 3UR3C 2QEXI 3F0CA 4OIRF 1BOBA 2K9SA 4QTRA 2P5LC 1JTYA 4R1HA 1XGMA 1TNSA 1I27A 3OYIA 3BT9A 5BNGA 4NBQA 1BN5A 1KYZA 2XV4S 1ETYA 3LWFA 1UHSA 3MCZA 1UG0A 4ZH4F 2FF4A 3HOYJ 1LJ9A 4NC8A 3VYSB 3M3YJ 3ZQGA 3VFZA 2DT6A 2OV7A 4FHTA 4KITB 5B1AH 3W3CA 1YJNI 4JK1X 2F5DA 4BXUA 1B9NA 2R7ZJ 2Z5UA 2H27A 4MLOA 1S29A 4P5OA 4KT6A 3CUQA 1QVTA 1R5ID 3FXUA 5AIPA 2BGCA 2CUZA 4D5FA 4C2UA 2G0EA 1GT0C 3ECOA 1ETKA 1FSEA 1ZQ3P 4OIOF 5BPDA 5IT9K 2CQNA 5DDGA 1UHWA 1OCTC 2XAGA 1MMSA 4UXNA 3HHGA 4RB2C 4BBSJ 1VFCA 1HOMA 1Z7LA 2DO7A 2QWWA 3GXOA 3VOEA 1LDJA 1DU0A 3PUFA 4BY1J 2XC7A 4BQNA 3RPQA 4IHWA 1R4NB 2EV6A 2XB5A 4ZTFA 1ZGWA 1TWCJ 2LLKA 3LSHA 1J9IA 5FLXZ 2Q2EB 2OTJI 4M3DA 4QWQA 4A93J 1ETVA 3BJAA 1BR2A 4LG0B 2LSOA 3HIFA 2E2IJ 2JUCA 4ZYHA 1XS9A 3BG9A 2KMUA 5AIQA 5E3MA 2PMUA 3I53A 1ZG3A 2VKVA 3L09A 2XPUA 2LOOA 1CQTA 2JPCA 2ZMEC 3BTLA 2B7EA 3BJOA 1U0JA 2HGCA 2XHKA 1JKPC 3OYKA 1ZELA 1X1PA 3BY6A 2XPWA 4S0HB 2ZXIA 3CJTB 2GBYA 2NS7A 3JRIA 4RAFA 4AC0A 3J81K 1H9GA 2XGXA 3TW7A 1XSXA 2KQRA 1JE8A 3KPHA 5E1XA 1PUFB 1IN7A 2RV8A 1VQKI 2LFBA 2Q1ZB 4I02A 2KFDA 1I3QJ 1KONA 2WV1A 2V1DA 4NNJA 4BDZA 2K86A 4RA2A 3S14J 1AKHB 1Y0NA 2PEXA 1XMXA 4JX4A 3ABLH 2IGNA 2XF6A 2CW7A 3DPUA 3B6CA 3F8BA 1TL8A 1XSVA 2XGDA 3BZCA 1V5FA 1AA7A 4YG2F 2F48A 2P81A 1YW9A 2QQ8A 1IW7F 2R7XA 1JGSA 1VQ7I 3CCQI 1CGPA 1K78A 3W2WA 2DA7A 4JP0A 2K9LA 3TGNA 4CA0A 2EK5A 2D1VA 1BI2A 2LH9A 4OWRB 4J00A 2ZMEA 3CMYA 4LMYA 1T08B 2MABA 5EEHA 1WJ5A 2K4BA 2KIUA 2H94A 5CVUA 3FXKA 2NOGA 1IJWC 3KCCA 1P6RA 4XRFA 2UWMA 3U21A 2FXAA 1V5GA 2CGPA 5DS9A 3KP2A 4I01A 1B8IB 4CXFA 4Y7NJ 1Q1VA 2H6BA 4IQ4A 2XSDC 5JFRA 1RESA 4Q47A 3FMSA 2DMQA 1XPXA 5H6QA 2CYYA 2IGMA 1RR8C 3CJNA 3U9GA 1M1EB 2GXAA 1VQ4I 3RSNA 5DM7F 1T8IA 3JRAA 3F6VA 3W6JB 4Y13A 3CQZJ 4XLEA 2GQQA 3WTZA 3DBHB 4KMFA 4ENNA 4I6ZA 2LKXA 4DYRA 2JZYA 3FF5A 2GOMA 3HPGA 5EEAA 2PJRA 1QQIA 1DUXC 2L4AA 1LVAA 2QSGX 3GZ5A 4HSRA 4BEHB 1Y8QB 2LBFB 4UB8C 3TO6A 3GYHX 4A3IJ 4IRGA 2JJ7A 5IYDJ 2CMPA 4FASD 1P7IA 2QKLB 2X6WA 2XAFA 4RAGA 2X6OA 4JX5A 1WJFA 2CFOA 5FJ8J 4M9SA 4BHCA 1USTA 3BG3A 4BS9A 4DZJA 1B72B 3K4CA 1JJ6C 1O7FA 4HQEA 2P7VB 2EA2A 3ZQFA 4A0XA 1MH3A 2ZKZA 3DU5A 1UELB 4NC7A 4Z2YA 5AONA 4C3HJ 2M0CA 4KN4X 1YFHA 3C2HA 3BC8A 3VSKA 2XUBA 2F4MB 4RS8A 2EQRA 3RKQA 1V4RA 4MO7A 4NC6A 1XD7A 4IOAF 1VNDA 5EYRA 3CDHA 1J5YA 1IUFA 1J0RA 1Z6TA 3WHCA 2E60A 4KIFA 5H6RA 4O5VA 4PSXA 1K7AA 4UY8I 3MKWB 1BJAA 2ELKA 3ZMDA 2HR3A 1XMAA 2LC2A 3O8HA 4W1UA 3HGYA 3KEQA 5C4XJ 3IKVA 1SFOJ 3C3WA 1YO5C 2JPBA 1SFKA 2HQNA 4CZCA 3H35A 3QYBA 2O03A 2Z33A 4BL0B 4HBLA 3HOSA 1SFXA 1WJEA 1W7PA 3WHBA 1TNTA 5FLXK 1Z91A 3S2WA 4LB6B 2V9VA 3C1DA 4BH9A 3S16J 5LRRA 3K7AJ 1V55H 1J75A 4L18B 5HLGA 3F8NA 2WWYA 2BY1A 2L9RA 1HBXG 1W5CC 3ZMTA 2HQRA 4OAZA 1JT6A 5J4YA 2R5ZB 1T56A 3L2QA 4ENMA 5L3EA 2EFQA 5EZHA 5EF6A 5ERIA 3NWTA 4KN7X 1DPUA 3LSIA 1QZYA 4CO8A 3RYPA 3F22A 2VPLA 3MKZA 3OOUA 1IXSB 5E1ZB 3SZPA 1JKRC 5J40A 4UV9A 3J80Z 1J7KA 5LLQA 2MD5A 1TWHJ 4DQ2A 2KT0A 3M1EA 3OYEA 3KYLA 1USSA 2WV0A 2DCEA 3AG1H 2E2JJ 2E1MC 4TV7A 4GYGA 2V6CA 1MJBA 1XGNA 4AUXA 1O4XA 2IT0A 1TQPA 5DEQA 3SZTA 2ZXWH 2KRCA 3H3ZA 3KZZA 4CUGA 5GAEJ 4G7HF 3HYIA 1AHDP 1OCCH 3OSFA 2LG4A 1AKHA 4BHPA 3KFWX 4HF0A 4GGGA 2MGQA 5ILUA 2BOLA 3OL3A 2K40A 4M71A 1QPMA 3KP7A 1XDUA 2ZFUA 3LMMA 1SANA 2HQAA 5A2QZ 3S1NJ 2UXXA 3SDBA 1HA8A 4BJTA 1NK3P 3HKZA 2R7RA 1I6HJ 4XM3A 2RQPA 2W1OA 3RZDJ 4YIFA 3DU6A 2IVMA 5D6EA 4MFDA 3ABTA 4N9IA 4BHBA 3OYJA 3L2VA 4RLQA 4FX4A 1X3WB 2OPTA 2V6EA 3OYHA 1EH7A 4ON0A 3B73A 2V1XA 1A5JA 3OIOA 1CF7A 1IRFA 1NTCA 1ZN2A 1VQ5I 2OBPA 1OCRH 4IO9F 4HPQA 3IP4B 2EIJH 5TJJA 3V4GA 4CCKA 4EM2A 1MMNA 2J5OA 4LB5A 4Y3OA 3O8GA 1VQ6I 1I1SA 2AHQA 2X1DA 1P9QC 3MQ0A 2X0LA 1S7OA 1QZZA 2ZJQF 4NB5A 2RN7A 2E35A 1KU9A 2JTVA 1HKQA 2LKSA 2PMHA 2PFBA 3WGHA 1D1CA 1LB2A 1OKRA 3GVAA 1GUUA 4IPAA 1BOAA 1Z3YA 2OZ6A 5CLSA 4KIGA 5CPRB 3L2RA 2ZJPF 1XG1A 4B4CA 5CJ9A 3L9FA 4RB1A 2JMWA 2Y69H 2ZC2A 3OYBA 3ISPA 4PGGA 2Q8KA 4X6AJ 2CUJA 3OYGA 1XC5A 4B48A 3K6GA 1VQOI 3E7LA 1BC7C 1OMIA 3TQNA 3LOCA 5FGMA 4A12A 2JRMA 4CICA 1YQAA 3CDLA 1X1BA 5E8IA 2X9DA 2M2EA 2ZJRF 1OPCA 3HRSA 2A3SA 2HDCA 3T1BA 1APLC 5B66C 3GTJJ 5B1BH 1U5TB 4AU7A 2BHYA 4FT8A 4IF4A 3OY9A 2CWEA 2Y9ZA 3K1MA 3I5UA 3WE3A 4I7HA 5J47A 1MJ9A 3HTUA 2COMA 3EYYA 2M30A 1TT5B 4HQMA 4WX9A 1SAXA 2OUMA 3DEWA 5DV5A 3DCFA 2PX9A 4Y4RA 1EF4A 2BXZA 4JYKA 1EA3A 2DDAA 1F5TA 2QQBA 2C6YA 5TISC 3WU0A 5HNFA 3LSGA 2LP0A 3HOVJ 4BJ6C 1GDTA 5BS6A 4R79A 3FISA 5E17F 3QYEA 1MMAA 3DTKA 2M34A 2KIQA 4IX7A 2DU9A 2OA4A 3BR2A 3KZYA 4XKWA 4E7SA 2E1NA 1WH5A 2AQEA 2A6EF 3K0LA 2MH9A 2ECCA 4A0YA 3WTYC 5JVGF 1TT0A 2A68F 1P2FA 2ZXHA 3ZQLA 4UNOA 1MW7A 2HFHA 3WU2C 5DTDA 5CVJA 3HRTA 1XN7A 2E71A 2XASA 2HU9A 2VE8A 3A0BC 5E3OA 1X58A 1GVDA 4ESBA 1KZHA 2JK3A 4HNTA 3GMEA 2OQGA 3SFZA 5H20A 3JTHA 4XOTA 2QENA 3UNGC 2EBIA 5IOZA 4HLXA 4AVZA 2D5VA 3JRGA 2HQ5A 3M8JA 3CUQB 4NUBA 1H8AC 1F43A 1MSEC 1MBEA 2VXZA 2HKXA 5LGNA 4IRHA 3T5XA 3CCVI 4MTEA 2YPRA 4YELA 5D8KB 2FMYA 5IOYA 4BXXJ 4YFKF 1P4XA 3J80K 1JUSA 1Z6RA 2LK2A 4XLPF 1EH8A 3JSPA 2HDWA 5DCMA 3NQOA 3RPUA 1DDNA 2A69F 4HW0A 4ESJA 1UCRA 4C2TA 1R22A 4G8XA 2O7OA 4L9TA 4MHGA 2LKPA 3OSGA 4P55A 1IG7A 3DP7A 2OCEA 3N97A 3IWZA 4HDUA 1MH4A 5A2QK 1PP8F 4GCVA 3T0YA 4UUSA 3H3VK 1ULYA 3I3LA 3WG9A 4F52A 3LSPA 2ZNYA 2PMZA 2H1KA 3TEDA 1FMWA 1R9TJ 2BE5F 1OCZH 1FYMA 5E1WA 3DLAA 2VASA 3BTJA 3ZPLA 3S93A 3BTIA 1SVOA 3LFUA 1OR7C 3S2HJ 3PQJA 3GFLA 2EFWA 1NH3A 1SFEA 5CQEA 1QGPA 3HZJA 1W7PD 2OD5A 1MKMA 3CESA 1SVMA 1I5ZA 1BM9A 4WK8F 3HXLA 1Z05A 3RKYA 2DDBA 5FKMA 4A6EA 2DK8A 4A3EJ 1R00A 1LEAA 1K6OA 2DA5A 3H36A 3K4NA 3QU3A 2FU4A 3JR9A 2HEOA 4LK1F 1G3SA 1ETQA 2IS2A 2TCTA 3ABMH 4XOPA 2Z99A
chains in the Genus database with same CATH topology
5E3MA 4A3DJ 2CUEA 3QQAA 2WAQN 2VKVA 2ID3A 2XPUA 4CYCA 2JA8J 3HOXJ 2R0QC 1Y1VJ 1CQTA 4QSHA 1P7JA 3BTLA 1ENHA 1JKPC 5M5WJ 3BR5A 2XPWA 4S0HB 5FKNA 2GBYA 2NS7A 3JRIA 3A01B 3A03A 2CQQA 5J1YA 4AC0A 1BW6A 3TW7A 1ORKA 4BKXA 3BR6A 4M3BA 3S17J 1JTXA 5EG0A 1PUFB 2LFBA 1I3QJ 2WV1A 3S1MJ 1MNMC 3S14J 1AKHB 1OCPA 2MSYA 4BBRJ 3BR0A 4JX4A 1W0UA 3A02A 2DA1A 3NAUA 4GFBA 3B6CA 3MN2A 3BTCA 2EH3A 4DZPA 2XGDA 2L7MP 4A3GJ 2O9LA 2L7ZA 2P81A 3LSJA 5F0FA 2HDDA 1BA5A 2DA2A 4I76A 4A69C 3HM5A 1IDYA 2DA7A 3A01A 4JP0A 1WGXA 1ETOA 1D5YA 4A3FJ 1X2NA 4IHVA 3BQZA 3RQIA 1QRYA 3GTLJ 4DYCA 1BW5A 1PUFA 1JT0A 3CMYA 5F0HA 1TWAJ 2LVSA 2HI3A 5F1JA 1ZKGA 2YS9A 5C3EJ 2NOGA 1IJWC 1X2MA 3PM1A 4LOCA 3NARA 5F08A 5IP9J 5DS9A 1B8IB 3JRHA 4Y7NJ 1Q1VA 2FX0A 3IH4A 2XSDC 1RESA 2ME6A 2DMQA 2DJNA 4MFEA 2LTPA 1UG2A 3GTPJ 4XIDA 3JRAA 4BY7J 3CQZJ 2YUSA 1U8BA 4JX6A 3LNQA 2LD5A 4I6ZA 2LKXA 2VKEA 4DYRA 1MBHA 5EEAA 2XRLA 1E3OC 9ANTA 5K7ZA 4C3JJ 1MBFA 4A3IJ 1K61A 3HDDA 2JJ7A 5IYDJ 1P7IA 1TWFJ 2R5YB 2X6OA 2IEKA 4JX5A 2CUFA 5FJ8J 3BG3A 1B72B 4DZJA 1B8IA 3MKLA 4XICA 1JJ6C 3ZQFA 2OF7A 1JKQC 1JUMA 2DA3A 1MH3A 3FKIJ 3LSRA 4L5EA 4IHYA 1HLVA 3Q0WA 4C3HJ 3Q0UA 2M0CA 3JRBA 2NS8A 1HF0A 1HDPA 1DU6A 3S2DJ 2EQRA 3RKQA 2HXIA 4M3EA 4MO7A 5FLMJ 5E3LA 1IRZA 1VNDA 5EYRA 5EGOB 2ECBA 1RKWA 1MBJA 3FIWA 1IUFA 1U9OA 2HOSA 2R92J 1RPWA 3WHCA 2ELKA 2K9QA 5EZGA 3HB9A 3O8HA 4W1UA 3GBGA 2R5YA 3HGYA 3JREA 3S1RJ 5C4XJ 1SFOJ 1MBKA 1HDDC 1B72A 4B3AA 2Y2ZA 4M3GA 1S7EA 3FK6A 2ZB9A 2WB1N 2COBA 4C3IJ 4V2FA 1WCMJ 1JUPA 3S15J 4MIMA 4XRMA 3I4MJ 3WHBA 1Z0XA 2XGEA 2VUMJ 2MG4A 4A3KJ 3S16J 3K7AJ 1VF9A 4M6VA 5K7FA 3ZQCA 4J19A 2L9RA 5EGOA 2HXOA 5GP9A 1JKOC 1RKTA 3GTMJ 1JT6A 2R5ZB 1T56A 5J1RA 3I4NJ 1BJZA 4FTHA 3D1NI 5EZHA 5EF6A 1Y1WJ 1G2HA 4XRSG 4RBOA 4D5CA 3HOZJ 2DTZA 2JN6A 3CCYA 3OOUA 4IHXA 1FEXA 1JKRC 1FTZA 1UMQA 2K9NA 4M3FA 4FE4A 1TWHJ 5GPAA 2HOAA 2CU7A 2KT0A 1AU7A 4FCYA 5J1UA 2LR8A 1QVUA 2E2JJ 3HGGA 1LFUP 4NDLA 4AUXA 2QF7A 1O4XA 2O8KA 1K83J 3BQYA 2GLOA 5IYBJ 1AHDP 3OSFA 1AKHA 1IDZA 2MGQA 2K40A 3HKZN 3IV5A 4EEFG 3TP0A 2R5ZA 2DMUA 1NK2P 1SANA 3S1NJ 2XPVA 3C2BA 2VI6A 1NK3P 1I6HJ 1FIAA 3RZDJ 1W0TA 2RAEA 4MFDA 2DMTA 1LE8B 1GV5A 4A3JJ 2OPTA 3HBLA 4XK4A 5F0CA 2H8RA 1A5JA 3OIOA 1NTCA 3Q3SA 2IAIA 3GTKJ 2NVQJ 3S1QJ 5E3NA 5K7HA 3RZOJ 2Y9YA 1F36A 3O8GA 3SDGA 5IP7J 1A6IA 3PO2J 2R93J 2AHQA 2XB0X 3G1LA 5IP6A 3BG5A 3L1PA 5FLVA 1JJ8C 4D7NA 2PMZN 3JRFA 4B1RA 4UUTA 1GUUA 2E19A 2VPRA 4D7MA 5M3MJ 2EZHA 4G12A 4HNVA 1LE8A 1LFBA 1YRNB 1XG1A 2L7FP 4B4CA 4A3CJ 5IPAA 2JMWA 3GTQJ 3MVPA 1H89C 4X6AJ 1XC5A 2NVTJ 3SFIA 1OJLA 3E7LA 2DN0A 5JLXA 1T33A 3GTGJ 3LOCA 2CQXA 1GV2A 2M9HA 3TP3A 3CDLA 2X9DA 4ABZA 1QPIA 2M2EA 1I50J 1APLC 3GTJJ 4C2MJ 1TC3C 2Y9ZA 1FIPA 2E2HJ 1U9NA 4A3MJ 3PO3J 2M8GX 2Y0SN 1U78A 3DEWA 2JWTA 3DCFA 3UKGA 3ZOBA 1EF4A 1YRNA 4JYKA 5FKLA 3G1OA 5IYCJ 2JA5J 1ETWA 2E1OA 2W48A 2GM4A 1ITYA 2MW8A 1IC8A 3H0GJ 3LSGA 2LP0A 3HOVJ 2LY9A 1GDTA 2DA6A 3ZQHA 4FE7A 3FK7A 3FISA 2ME0A 3W6VA 4A3LJ 2L0KA 2M34A 3IH3A 2YU9J 2CJJA 3BR2A 2Y30A 1FJLA 1OFCX 2N8GA 1RR7A 1WH5A 3ZQIA 4QIWN 1POGA 2ECCA 3M4OJ 3VPRA 3ZQLA 2NVYJ 2JA6J 1IGNA 2FQ4A 3QPLA 4X1EA 5DTDA 3GTOJ 2DA4A 5J3LA 1TWGJ 1MBGA 2IBDA 1Z77A 1ZK8A 4FISA 5HODA 1FTTA 1MSFC 5E3OA 4Y52J 4AYBN 4DW6A 1X58A 4DYQA 1GVDA 5C4JJ 1VI0A 2CRGA 2JK3A 5EDNA 1JGGA 5FKKA 3BR1A 3BR3A 1WH7A 5GPCA 2EZKA 3JRDA 2EBIA 2XGCA 5IOZA 2DMPA 2X48A 5JLWA 2D5VA 2TRTA 3JRGA 2HQ5A 5F27A 3F0CA 4QTRA 2K9SA 1H8AC 1F43A 1MSEC 1JTYA 1MBEA 4UUSB 1ZR2A 3BT9A 5BNGA 2JA7J 1ETYA 1RETA 2ID6A 5IOYA 4BXXJ 1UHSA 1JUSA 2LK2A 2B63J 1WI3A 3SJMA 3HOWJ 3HOYJ 3Q0VA 3K2AA 2FD5A 1WPKA 3M3YJ 3ZQGA 4RDUA 1ZTRA 2QCOA 3G1MA 5M3FJ 5C44J 4V2GA 2I10A 2O7OA 5FKOA 3OSGA 4A3BJ 1IG7A 2HOTA 2R7ZJ 1HCRA 2EZIA 2DMNA 4MLOA 1MH4A 2NVXJ 1QVTA 3H3VK 4UUSA 3LSPA 1ETXA 1ZR4A 4D5FA 2H1KA 3TEDA 1R9TJ 3JRCA 2G0EA 1GT0C 2KDZA 1IV6A 1ETKA 1ZQ3P 2FJ1A 3QPSA 3BTJA 4CYCB 1OCTC 3BTIA 3S2HJ 4BBSJ 4IEJA 1VFCA 5F04A 1HOMA 1BL0A 4BY1J 1DU0A 4W97A 3HOUJ 3TW6A 3B6AA 5M5XJ 4XRSA 3HEFA 4IHWA 2XB5A 3IH2A 1ZGWA 1TWCJ 2LLKA 4M3DA 2EZLA 5FKMA 2AO9A 2HYJA 4A93J 4A3EJ 1ETVA 5EG0B 2DA5A 3JR9A 2E2IJ 1ETQA 2Y31A 2TCTA 1XS9A 3BG9A 5M5YJ 1H88C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3M A;  4A3D J;  2CUE A;  3QQA A;  2WAQ N;  2VKV A;  2ID3 A;  2XPU A;  4CYC A;  2JA8 J;  3HOX J;  2R0Q C;  1Y1V J;  1CQT A;  4QSH A;  1P7J A;  3BTL A;  1ENH A;  1JKP C;  5M5W J;  3BR5 A;  2XPW A;  4S0H B;  5FKN A;  2GBY A;  2NS7 A;  3JRI A;  3A01 B;  3A03 A;  2CQQ A;  5J1Y A;  4AC0 A;  1BW6 A;  3TW7 A;  1ORK A;  4BKX A;  3BR6 A;  4M3B A;  3S17 J;  1JTX A;  5EG0 A;  1PUF B;  2LFB A;  1I3Q J;  2WV1 A;  3S1M J;  1MNM C;  3S14 J;  1AKH B;  1OCP A;  2MSY A;  4BBR J;  3BR0 A;  4JX4 A;  1W0U A;  3A02 A;  2DA1 A;  3NAU A;  4GFB A;  3B6C A;  3MN2 A;  3BTC A;  2EH3 A;  4DZP A;  2XGD A;  2L7M P;  4A3G J;  2O9L A;  2L7Z A;  2P81 A;  3LSJ A;  5F0F A;  2HDD A;  1BA5 A;  2DA2 A;  4I76 A;  4A69 C;  3HM5 A;  1IDY A;  2DA7 A;  3A01 A;  4JP0 A;  1WGX A;  1ETO A;  1D5Y A;  4A3F J;  1X2N A;  4IHV A;  3BQZ A;  3RQI A;  1QRY A;  3GTL J;  4DYC A;  1BW5 A;  1PUF A;  1JT0 A;  3CMY A;  5F0H A;  1TWA J;  2LVS A;  2HI3 A;  5F1J A;  1ZKG A;  2YS9 A;  5C3E J;  2NOG A;  1IJW C;  1X2M A;  3PM1 A;  4LOC A;  3NAR A;  5F08 A;  5IP9 J;  5DS9 A;  1B8I B;  3JRH A;  4Y7N J;  1Q1V A;  2FX0 A;  3IH4 A;  2XSD C;  1RES A;  2ME6 A;  2DMQ A;  2DJN A;  4MFE A;  2LTP A;  1UG2 A;  3GTP J;  4XID A;  3JRA A;  4BY7 J;  3CQZ J;  2YUS A;  1U8B A;  4JX6 A;  3LNQ A;  2LD5 A;  4I6Z A;  2LKX A;  2VKE A;  4DYR A;  1MBH A;  5EEA A;  2XRL A;  1E3O C;  9ANT A;  5K7Z A;  4C3J J;  1MBF A;  4A3I J;  1K61 A;  3HDD A;  2JJ7 A;  5IYD J;  1P7I A;  1TWF J;  2R5Y B;  2X6O A;  2IEK A;  4JX5 A;  2CUF A;  5FJ8 J;  3BG3 A;  1B72 B;  4DZJ A;  1B8I A;  3MKL A;  4XIC A;  1JJ6 C;  3ZQF A;  2OF7 A;  1JKQ C;  1JUM A;  2DA3 A;  1MH3 A;  3FKI J;  3LSR A;  4L5E A;  4IHY A;  1HLV A;  3Q0W A;  4C3H J;  3Q0U A;  2M0C A;  3JRB A;  2NS8 A;  1HF0 A;  1HDP A;  1DU6 A;  3S2D J;  2EQR A;  3RKQ A;  2HXI A;  4M3E A;  4MO7 A;  5FLM J;  5E3L A;  1IRZ A;  1VND A;  5EYR A;  5EGO B;  2ECB A;  1RKW A;  1MBJ A;  3FIW A;  1IUF A;  1U9O A;  2HOS A;  2R92 J;  1RPW A;  3WHC A;  2ELK A;  2K9Q A;  5EZG A;  3HB9 A;  3O8H A;  4W1U A;  3GBG A;  2R5Y A;  3HGY A;  3JRE A;  3S1R J;  5C4X J;  1SFO J;  1MBK A;  1HDD C;  1B72 A;  4B3A A;  2Y2Z A;  4M3G A;  1S7E A;  3FK6 A;  2ZB9 A;  2WB1 N;  2COB A;  4C3I J;  4V2F A;  1WCM J;  1JUP A;  3S15 J;  4MIM A;  4XRM A;  3I4M J;  3WHB A;  1Z0X A;  2XGE A;  2VUM J;  2MG4 A;  4A3K J;  3S16 J;  3K7A J;  1VF9 A;  4M6V A;  5K7F A;  3ZQC A;  4J19 A;  2L9R A;  5EGO A;  2HXO A;  5GP9 A;  1JKO C;  1RKT A;  3GTM J;  1JT6 A;  2R5Z B;  1T56 A;  5J1R A;  3I4N J;  1BJZ A;  4FTH A;  3D1N I;  5EZH A;  5EF6 A;  1Y1W J;  1G2H A;  4XRS G;  4RBO A;  4D5C A;  3HOZ J;  2DTZ A;  2JN6 A;  3CCY A;  3OOU A;  4IHX A;  1FEX A;  1JKR C;  1FTZ A;  1UMQ A;  2K9N A;  4M3F A;  4FE4 A;  1TWH J;  5GPA A;  2HOA A;  2CU7 A;  2KT0 A;  1AU7 A;  4FCY A;  5J1U A;  2LR8 A;  1QVU A;  2E2J J;  3HGG A;  1LFU P;  4NDL A;  4AUX A;  2QF7 A;  1O4X A;  2O8K A;  1K83 J;  3BQY A;  2GLO A;  5IYB J;  1AHD P;  3OSF A;  1AKH A;  1IDZ A;  2MGQ A;  2K40 A;  3HKZ N;  3IV5 A;  4EEF G;  3TP0 A;  2R5Z A;  2DMU A;  1NK2 P;  1SAN A;  3S1N J;  2XPV A;  3C2B A;  2VI6 A;  1NK3 P;  1I6H J;  1FIA A;  3RZD J;  1W0T A;  2RAE A;  4MFD A;  2DMT A;  1LE8 B;  1GV5 A;  4A3J J;  2OPT A;  3HBL A;  4XK4 A;  5F0C A;  2H8R A;  1A5J A;  3OIO A;  1NTC A;  3Q3S A;  2IAI A;  3GTK J;  2NVQ J;  3S1Q J;  5E3N A;  5K7H A;  3RZO J;  2Y9Y A;  1F36 A;  3O8G A;  3SDG A;  5IP7 J;  1A6I A;  3PO2 J;  2R93 J;  2AHQ A;  2XB0 X;  3G1L A;  5IP6 A;  3BG5 A;  3L1P A;  5FLV A;  1JJ8 C;  4D7N A;  2PMZ N;  3JRF A;  4B1R A;  4UUT A;  1GUU A;  2E19 A;  2VPR A;  4D7M A;  5M3M J;  2EZH A;  4G12 A;  4HNV A;  1LE8 A;  1LFB A;  1YRN B;  1XG1 A;  2L7F P;  4B4C A;  4A3C J;  5IPA A;  2JMW A;  3GTQ J;  3MVP A;  1H89 C;  4X6A J;  1XC5 A;  2NVT J;  3SFI A;  1OJL A;  3E7L A;  2DN0 A;  5JLX A;  1T33 A;  3GTG J;  3LOC A;  2CQX A;  1GV2 A;  2M9H A;  3TP3 A;  3CDL A;  2X9D A;  4ABZ A;  1QPI A;  2M2E A;  1I50 J;  1APL C;  3GTJ J;  4C2M J;  1TC3 C;  2Y9Z A;  1FIP A;  2E2H J;  1U9N A;  4A3M J;  3PO3 J;  2M8G X;  2Y0S N;  1U78 A;  3DEW A;  2JWT A;  3DCF A;  3UKG A;  3ZOB A;  1EF4 A;  1YRN A;  4JYK A;  5FKL A;  3G1O A;  5IYC J;  2JA5 J;  1ETW A;  2E1O A;  2W48 A;  2GM4 A;  1ITY A;  2MW8 A;  1IC8 A;  3H0G J;  3LSG A;  2LP0 A;  3HOV J;  2LY9 A;  1GDT A;  2DA6 A;  3ZQH A;  4FE7 A;  3FK7 A;  3FIS A;  2ME0 A;  3W6V A;  4A3L J;  2L0K A;  2M34 A;  3IH3 A;  2YU9 J;  2CJJ A;  3BR2 A;  2Y30 A;  1FJL A;  1OFC X;  2N8G A;  1RR7 A;  1WH5 A;  3ZQI A;  4QIW N;  1POG A;  2ECC A;  3M4O J;  3VPR A;  3ZQL A;  2NVY J;  2JA6 J;  1IGN A;  2FQ4 A;  3QPL A;  4X1E A;  5DTD A;  3GTO J;  2DA4 A;  5J3L A;  1TWG J;  1MBG A;  2IBD A;  1Z77 A;  1ZK8 A;  4FIS A;  5HOD A;  1FTT A;  1MSF C;  5E3O A;  4Y52 J;  4AYB N;  4DW6 A;  1X58 A;  4DYQ A;  1GVD A;  5C4J J;  1VI0 A;  2CRG A;  2JK3 A;  5EDN A;  1JGG A;  5FKK A;  3BR1 A;  3BR3 A;  1WH7 A;  5GPC A;  2EZK A;  3JRD A;  2EBI A;  2XGC A;  5IOZ A;  2DMP A;  2X48 A;  5JLW A;  2D5V A;  2TRT A;  3JRG A;  2HQ5 A;  5F27 A;  3F0C A;  4QTR A;  2K9S A;  1H8A C;  1F43 A;  1MSE C;  1JTY A;  1MBE A;  4UUS B;  1ZR2 A;  3BT9 A;  5BNG A;  2JA7 J;  1ETY A;  1RET A;  2ID6 A;  5IOY A;  4BXX J;  1UHS A;  1JUS A;  2LK2 A;  2B63 J;  1WI3 A;  3SJM A;  3HOW J;  3HOY J;  3Q0V A;  3K2A A;  2FD5 A;  1WPK A;  3M3Y J;  3ZQG A;  4RDU A;  1ZTR A;  2QCO A;  3G1M A;  5M3F J;  5C44 J;  4V2G A;  2I10 A;  2O7O A;  5FKO A;  3OSG A;  4A3B J;  1IG7 A;  2HOT A;  2R7Z J;  1HCR A;  2EZI A;  2DMN A;  4MLO A;  1MH4 A;  2NVX J;  1QVT A;  3H3V K;  4UUS A;  3LSP A;  1ETX A;  1ZR4 A;  4D5F A;  2H1K A;  3TED A;  1R9T J;  3JRC A;  2G0E A;  1GT0 C;  2KDZ A;  1IV6 A;  1ETK A;  1ZQ3 P;  2FJ1 A;  3QPS A;  3BTJ A;  4CYC B;  1OCT C;  3BTI A;  3S2H J;  4BBS J;  4IEJ A;  1VFC A;  5F04 A;  1HOM A;  1BL0 A;  4BY1 J;  1DU0 A;  4W97 A;  3HOU J;  3TW6 A;  3B6A A;  5M5X J;  4XRS A;  3HEF A;  4IHW A;  2XB5 A;  3IH2 A;  1ZGW A;  1TWC J;  2LLK A;  4M3D A;  2EZL A;  5FKM A;  2AO9 A;  2HYJ A;  4A93 J;  4A3E J;  1ETV A;  5EG0 B;  2DA5 A;  3JR9 A;  2E2I J;  1ETQ A;  2Y31 A;  2TCT A;  1XS9 A;  3BG9 A;  5M5Y J;  1H88 C; 
#chains in the Genus database with same CATH topology
 3AL0 C;  1P4W A;  1U3E M;  2CUE A;  3I0T A;  3QQA A;  2LRD A;  1XX5 A;  2ID3 A;  4HDV A;  2VOP A;  2JA8 J;  2BY0 A;  1MGT A;  2R0Q C;  4Y33 A;  2Z9O A;  3HRM A;  2WAQ A;  1P7J A;  4QSH A;  1D1A A;  2KDO A;  2V26 A;  3BR5 A;  1UZC A;  5JR3 A;  4UUV A;  1YIJ I;  2GOX B;  2FOW A;  1K78 B;  1JI8 A;  4MNU A;  5LHI A;  3VB2 A;  3ZR8 X;  4BQA A;  3L00 A;  1N75 A;  2CQQ A;  4C30 A;  1QHG A;  2FBK A;  2K3F A;  1BW6 A;  3CJQ B;  3BR6 A;  3QP5 A;  4YIR X;  4M3B A;  4M74 A;  2R7D A;  4M9X A;  1JTX A;  3S17 J;  2LY2 A;  2ZME B;  5D4R A;  1XCV A;  4HA8 A;  1WRJ A;  2O5R A;  3S1M J;  2ZJ2 A;  2E7X A;  3TOB A;  3DF8 A;  2R7F A;  2STW A;  4BBR J;  3OL4 A;  3FXQ A;  3BR0 A;  3L7W A;  3DKX A;  1IAW A;  1ODD A;  3FMQ A;  4U0Y A;  1R4M B;  3L2W A;  2DA1 A;  3PNY A;  3NAU A;  1T0F A;  4GFB A;  1Q1H A;  2W4S A;  2R4G A;  3EPZ A;  4KIB A;  4OMZ A;  2VKD A;  3E3V A;  2EH3 A;  2R7W A;  2HVQ A;  2DJI A;  3P9K A;  3IL2 A;  1IN5 A;  2KJB A;  4X0G A;  2HKO A;  4HLY A;  4A3G J;  3OS2 A;  4G6T B;  2EFO A;  2KIF A;  4I76 A;  3L2U A;  3HM5 A;  1IDY A;  2O0Y A;  3A01 A;  1WGX A;  4I2O A;  3FWE A;  2X6X A;  2HZT A;  4IHV A;  2PI0 A;  3BQZ A;  3IUO A;  3RQI A;  5J6X A;  2VQG A;  2PJR B;  1G6N A;  2VOD A;  2BV6 A;  1QU3 A;  4CYD A;  5CKT A;  3ZQ7 A;  2LVS A;  3CCJ I;  2HI3 A;  3GF2 A;  2W85 A;  2ELH A;  1ZKG A;  1R23 A;  3PM1 A;  4LOC A;  2VT3 A;  3KZI C;  4XLN F;  3I56 I;  4UVA A;  1FY7 A;  3F21 A;  4IHT A;  3JRH A;  1YI2 I;  4B44 A;  3IH4 A;  5J8F A;  4EJU A;  2ME6 A;  3DFG A;  4JOM A;  3ZMS A;  4MFE A;  4BJ5 C;  1UG2 A;  3C18 A;  3KP4 A;  3S3N A;  4ZYG A;  3MZY A;  4IQJ A;  3S3M A;  1EV7 A;  4KA4 A;  1LEB A;  3LNQ A;  2D1H A;  3E5U A;  3K1P A;  2ELJ A;  2V9P A;  2M4G A;  3SEZ A;  4RB3 C;  4GO1 A;  5GAH J;  4L5I A;  5LGT A;  1E3O C;  2M1B A;  5D8L B;  2FUG 2;  4RGU A;  4GRI A;  1MBF A;  3HDD A;  1TWF J;  3J7Y J;  4AID A;  2FNP A;  4XIC A;  3F8F A;  2LF7 A;  3FKI J;  3LSR A;  3BLY A;  1RI7 A;  4L5E A;  2EWN A;  4IRI A;  2DLL A;  3JRB A;  3ZN1 A;  3OYC A;  2HTJ A;  1DU6 A;  5CQG A;  1W7P B;  1D8J A;  2ADU A;  2BY2 A;  2HXI A;  4M3E A;  2OTL I;  3QWL A;  1FYL A;  1WJD A;  4E7I A;  4YEJ A;  5CVI A;  1QNT A;  5HS9 A;  2XAU A;  3GCM A;  1MBJ A;  4PDK A;  4BQO A;  2GA2 A;  4LK0 F;  2HOS A;  1C0W A;  2LDU A;  1RPW A;  1S9H A;  2IGO A;  3D5L A;  5CVV A;  3NEU A;  5ICE A;  2IJL A;  2EIM H;  5HLH A;  4BUP A;  2MYS A;  2Y48 A;  5LHG A;  5HLI A;  2FA5 A;  1A35 A;  2KPM A;  2XF7 A;  3HB9 A;  3CC7 I;  2R5Y A;  2KRH A;  3GBG A;  4HAM A;  5E79 C;  1MBK A;  1HDD C;  4L9J A;  1KU2 A;  2ZBK A;  3K1N A;  4M3G A;  1TP4 A;  3QPH A;  1S7E A;  2DQL A;  3CC4 I;  1U2W A;  4DBQ A;  2WB1 N;  2COB A;  4V2F A;  3FBN B;  5LHH A;  1WCM J;  4EAT A;  1JUP A;  5LEJ A;  1K4S A;  3S15 J;  3I4M J;  4U87 A;  4ZTJ A;  1Z0X A;  2MG4 A;  4A3K J;  1ZGA A;  4D0P A;  3HRU A;  1GVJ A;  3ZQC A;  1OYI A;  4J19 A;  1HC8 A;  3DBL B;  3LST A;  2HXO A;  3ASN H;  2V79 A;  3E0J B;  3KE2 A;  4EV0 A;  1LVK A;  3M9A A;  4D1Q A;  4FTH A;  1Y1W J;  3D1N I;  4LD5 A;  3V7R A;  3WTS C;  2QSF X;  3U1K A;  1G2H A;  1YS7 A;  1D3Y A;  4RBO A;  4PFP A;  4XKV A;  2DTZ A;  3HG9 A;  1QO0 D;  3ZP5 A;  3E5Q A;  3GZN B;  2JSC A;  1FEX A;  1FTZ A;  1UMQ A;  4EMS A;  3OR2 C;  3H0D A;  4WXC A;  2MH2 A;  4M3F A;  5FFX A;  4FE4 A;  4B43 A;  3FHZ A;  3QU6 A;  3RPU D;  2FEZ A;  3MEX A;  5L3D A;  1AU7 A;  4FCY A;  1L0O C;  1TQI A;  1ZLJ A;  2ZO4 A;  1SD7 A;  1X1C A;  3G2B A;  1W5T A;  5ICF A;  1CF7 B;  4E7H A;  1R1U A;  2ZSH B;  3KP3 A;  5LRS A;  3EET A;  5HS7 A;  1K83 J;  3BQY A;  5ILS A;  1LDK B;  2GLO A;  2DOD A;  3VDX A;  1S5L C;  3AG4 H;  5HVQ C;  4E70 A;  3PUB A;  4ZDP A;  4EEF G;  2YU3 A;  2DMU A;  2E1M B;  3GFM A;  3R4K A;  3N05 A;  4IXA A;  4N0B A;  2VI6 A;  3L2C A;  3ZCO A;  3F8C A;  1W0T A;  2M3A A;  1S8N A;  3I71 A;  3D5S C;  5D5X B;  5FRN A;  2KHM A;  1VQN I;  1E0E A;  2X51 A;  5F6F A;  2ISZ A;  5K1Y A;  2X85 A;  2R7U A;  1G3W A;  3FXM A;  1YLF A;  2JSP A;  2JRT A;  5DCF A;  2IXS A;  2VJ4 A;  3LAJ A;  2Z1D A;  3OYM A;  1KA8 A;  3M1C A;  3GTK J;  2NVQ J;  3MAJ A;  3H5N A;  5E3N A;  2V9K A;  3AFH A;  4HV6 A;  2P6T A;  1IZ1 A;  2XSJ C;  3G1L A;  2A6T A;  4P96 A;  2KP6 A;  3I54 A;  3C2G A;  2F4I A;  2HS5 A;  2PMZ N;  3JRF A;  1FNN A;  2UV1 A;  4Z6Y A;  2BW3 A;  3IHU A;  1D0Y A;  2EJR A;  5GTH C;  1HXD A;  1ZRD A;  1YIT I;  4D7M A;  2W25 A;  2EZH A;  2WY7 Q;  2IPQ X;  1JHF A;  4HNV A;  4OIN F;  4G94 A;  4ETS A;  2MA3 A;  2M0M A;  3K70 C;  4EQQ A;  3GO5 A;  2KL4 A;  4MQV A;  2F2E A;  3E1S A;  3MVP A;  4HEA 2;  3DPL C;  1GXQ A;  2DFI A;  2ZCW A;  2RRE A;  3DXJ F;  1OJL A;  2I8D A;  2DN0 A;  3ERM A;  1W36 D;  4CDG A;  2FBH A;  3GTG J;  3H1C A;  4IVN A;  1PYV A;  3VOD A;  4PZJ A;  1GV2 A;  2DTR A;  2M9H A;  3FZV A;  3TP3 A;  5F1R A;  3HL2 A;  4ABZ A;  3AKZ A;  1QPI A;  1R1V A;  2P4W A;  4E7K A;  3CC2 I;  1WSU A;  1O3S A;  3ABK H;  2CH0 A;  1FIP A;  2E2H J;  1U9N A;  4A3M J;  5GAD J;  1G8X A;  3BOQ A;  1V5E A;  2M8G X;  3I9V 2;  2Y0S N;  1R58 A;  2XAQ A;  2JWT A;  3PIP F;  3ZOB A;  2QUF A;  1YRN A;  4UVC A;  1FPQ A;  3G6E I;  3WU1 B;  1TZL A;  1BR1 A;  5FKL A;  2L01 A;  4PJN A;  2OQR A;  2W48 A;  4ANJ A;  2DYS H;  4F92 B;  4I99 C;  3A2K A;  1ITY A;  2ZSI B;  2OU2 A;  3H0G J;  3F23 A;  3WTV C;  4FE7 A;  4A5M A;  3W6V A;  2DQR A;  3DKY A;  3I59 A;  4PJM A;  2PLY A;  3IH3 A;  3SYT A;  2CJJ A;  1FJL A;  1RC9 A;  1RR7 A;  1KYW A;  2JVG A;  3ASO H;  2VBX A;  1LQ1 A;  2QZ8 A;  3KX2 A;  1YJ9 I;  2NVY J;  4KFC A;  3V7C A;  2FSW A;  2KJC A;  2FQ4 A;  3CCE I;  1T6S A;  3HHH A;  3GTO J;  2MC3 A;  5DCM B;  3BDD A;  1TWG J;  2IBD A;  5J8C A;  1ZK8 A;  4FIS A;  1BI3 A;  1N25 A;  4XL9 A;  2JVH A;  4OMY A;  3BWG A;  1VI0 A;  1H0M A;  4OIQ F;  3CDI A;  5FKK A;  4CCJ A;  3RI4 A;  1X3U A;  3BR3 A;  4WXH A;  4XNF A;  5GPC A;  4J01 A;  1G59 A;  2A05 A;  4A0Z A;  1VQ8 I;  3JRD A;  3DPT A;  5L3G A;  2VE9 A;  2XGC A;  2DMP A;  2X48 A;  2EPF A;  3MWM A;  3MFK A;  1IO2 A;  2E36 A;  2GA1 A;  2VBW A;  1YE9 A;  5F27 A;  5F64 A;  4EM1 A;  1A31 A;  2L7K A;  4ASN A;  4UUS B;  4KIS A;  1AWC A;  2QSH X;  2H8W A;  4LIT A;  1ZR2 A;  3M8E A;  2VQL A;  2DXI A;  4I98 B;  2JA7 J;  5LEK A;  1G3T A;  1RET A;  2ID6 A;  4BAY A;  2K02 A;  5DD4 A;  2BVM A;  3OS1 A;  1WI3 A;  3SJM A;  2B63 J;  2QM3 A;  4GDF A;  4Q48 A;  5E18 F;  3LA7 A;  1NHA A;  3Q0V A;  5ICG A;  4GXO A;  3GX4 X;  4BE2 A;  1FT9 A;  2K7L A;  3KYD B;  4B8X A;  1YX3 A;  4KJZ A;  2QCO A;  3EDP A;  5C44 J;  3WTT C;  5M3F J;  2I10 A;  1FOK A;  1FSH A;  2X1E A;  4S04 A;  2BEO A;  2CW0 F;  1ZG1 A;  4A3B J;  2E5Z A;  2RNG A;  1Y56 A;  3TDU C;  4O3M A;  1HCR A;  2DMN A;  4BE1 A;  2L2O A;  1HW2 A;  2NVX J;  4Y15 A;  3T8R A;  3F9K A;  4XLC A;  4XMY A;  1ETX A;  3U1D A;  2NAZ A;  2CS3 A;  2OCC H;  3JRC A;  1R49 A;  2X6Y A;  4G9Y A;  1IV6 A;  2DOF A;  2FJ1 A;  2PN6 A;  3PL8 A;  3K69 A;  3M8F A;  2VXD A;  3RYR A;  2QLZ A;  3PQK A;  2IS1 A;  4ZC3 A;  2FRH A;  3CJR B;  3R0J A;  4XKB A;  3P7N A;  5D5V B;  2NYX A;  4FET A;  1BL0 A;  4W97 A;  5HDG A;  3HOU J;  2NRA C;  3TW6 A;  4XRS A;  3IH2 A;  2NXN B;  1FBS A;  3RIR A;  2LY1 A;  2L4M A;  4CZZ A;  1GXP A;  1Z21 A;  3BJ6 A;  3TO9 A;  4RAZ A;  2AO9 A;  2HYJ A;  1WZ2 A;  1FX7 A;  1DP3 A;  1XB4 A;  2L02 A;  4WXD A;  2Y31 A;  4R8H A;  4PUS A;  5FFZ A;  2F5V A;  5HDN A;  2JA6 J;  5M5Y J;  1H88 C;  3RJP A;  4OOI A;  3SXY A;  4A5N A;  5FO5 A;  2K4J A;  3DWL E;  4CYC A;  4ESF A;  3QYF A;  4JQF A;  2JQ7 A;  2HPI A;  3GLL A;  1YX5 A;  3WG7 H;  4HRI A;  1IXC A;  1ENH A;  4WF2 A;  1T95 A;  2BHZ A;  3BG7 A;  1DGW Y;  1O7L A;  3P9I A;  5M5W J;  3KEY A;  2FNA A;  5FKN A;  2HYG D;  3FBI B;  3U2R A;  3A01 B;  2F5E A;  3A03 A;  3ECH A;  1MZB A;  1OCO H;  4BNC A;  2HTS A;  1ORK A;  3D0S A;  2P8T A;  1ZYR F;  2L9N A;  2VQH A;  5EG0 A;  2CV2 A;  2V7F A;  1GLN A;  1SD5 A;  5L3C A;  1PP7 U;  5KK1 A;  4PJL A;  4DNC A;  1QBJ A;  1KQ9 A;  4LJZ F;  4CH7 A;  1OIS A;  3FX3 A;  2LNB A;  4L9N A;  3LL7 A;  4I0B A;  3A02 A;  5CVR A;  4HX8 A;  2EFP A;  3MN2 A;  2XDV A;  2TDX A;  4DZP A;  3RKW A;  4HZF A;  2XKO A;  3PSF A;  2NNY A;  2L7M P;  2L7Z A;  3LSJ A;  5F0F A;  4CCL A;  3CCL I;  2HDD A;  4AYB A;  3KYC B;  2DA2 A;  1D1B A;  2ETH A;  1FZP B;  5HNH A;  4A69 C;  5JHF A;  4E7L A;  1D5Y A;  1ETO A;  2FE3 A;  3NRV A;  1X2N A;  2CO5 A;  2ESH A;  1BI1 A;  2QYO A;  3GTL J;  1BW5 A;  1YIO A;  3PIO F;  1FOW A;  1FYK A;  1FBQ A;  5FD5 A;  3VSL A;  4N9H A;  5C3E J;  1ZGJ A;  3CCM I;  1X2M A;  2GIV A;  4E7Z A;  3E6C C;  3OIQ A;  1HST A;  3NAR A;  4I09 A;  2CSO A;  3RTR A;  1IXR C;  3M7G A;  2VC0 A;  2O8X A;  4UHT A;  2A61 A;  2JUG A;  2FX0 A;  4MQ9 F;  4BE0 A;  3Q5F A;  5E8G A;  2F6C A;  1TW3 A;  1RZ4 A;  4OAY A;  2ISY A;  1XGS A;  4IOC F;  4BY7 J;  3EUH C;  4G7O F;  2LYC A;  1MD0 A;  2H09 A;  2E34 A;  2R3S A;  2XIG A;  2M8E A;  2NVU B;  2LD5 A;  1SFU A;  1J59 A;  1IRG A;  4CHU A;  4PCQ A;  1BC8 C;  2OZU A;  1MBH A;  3S32 A;  2O3F A;  1MND A;  2P7C B;  1ACI A;  2XRL A;  1HW5 A;  3OOP A;  1FLI A;  1BBY A;  4C3J J;  2L9V A;  1K61 A;  4NQW A;  4EJV A;  2VIX A;  2IA2 A;  2R5Y B;  3BP8 A;  2IEK A;  2BXY A;  2CUF A;  2WC2 A;  3C7J A;  3OS0 A;  3NWS A;  2H6C A;  4B3X A;  2NNN A;  1LDD A;  2OF7 A;  3CP8 A;  3G3Z A;  5KCM A;  3RQ4 A;  1JKQ C;  1I1G A;  3CZ6 A;  3Q0W A;  3ERE D;  1HLV A;  2GWR A;  1P4A A;  3EUA A;  2NS8 A;  4B47 A;  2M5W A;  2KIM A;  2EIK H;  3S2D J;  3OR1 C;  3HSR A;  1KGS A;  1IV8 A;  1W4M A;  2EFN A;  2Z2S B;  2P5V A;  5BQT A;  3MZH A;  1IRZ A;  2I5U A;  1ON1 A;  2DYR H;  1JXS A;  3TL4 X;  1K4T A;  3FIW A;  1U9O A;  2EIN H;  1LFP A;  1U5T C;  1S6L A;  1BI0 A;  3GLX A;  1WHU A;  1XTA A;  4KT5 C;  3B02 A;  2K9Q A;  4L9V A;  4MEX F;  5B3S H;  3K9T A;  2E5N A;  3LAP A;  5EZG A;  3F8M A;  3CTA A;  5IT3 A;  3QAH A;  3S1R J;  3JRE A;  2VOO A;  3H92 A;  5ICC A;  3HSE A;  2R7S A;  1SMY F;  4BDY A;  3KEO A;  5BPI A;  2R7T A;  3GZ6 A;  2KRF A;  1N77 A;  2QGU A;  2QBY A;  3IKT A;  2IA0 A;  2HYF A;  1ON2 A;  4MIM A;  4WWC A;  5TGT A;  3CCS I;  1OR7 A;  4AD9 A;  2XGE A;  2VUM J;  3FDY A;  2QA4 I;  5HOO A;  2RDP A;  4M6V A;  5IY5 H;  4DOZ A;  3TBI A;  1ZAO A;  5EGO A;  2HOE A;  4H0E A;  3FXO A;  5GP9 A;  1JKO C;  1RKT A;  4HYE A;  3O6B B;  2Q0O A;  1SD4 A;  5J1R A;  1BIB A;  2W82 A;  2VBZ A;  4UB6 C;  1R5H A;  4D5C A;  5K5O A;  2UZK A;  3HOZ J;  2P0W A;  3CCY A;  1E2X A;  2JN6 A;  4IHX A;  3RCO A;  3HPH A;  1D8K A;  4MEY F;  2L9S A;  2IS6 A;  3V8L A;  2L5Q A;  2K9N A;  2BZT A;  4PJJ A;  1J09 A;  5GPA A;  5BOX A;  1IRX A;  2CU7 A;  3DKW A;  3DQV C;  2LR8 A;  1QVU A;  2G7H A;  2DBB A;  3HGG A;  3BCA A;  2BYV E;  1LFU P;  4UV8 A;  4NDL A;  1R6R A;  3WTW C;  2O8K A;  3CUQ C;  4NHJ A;  3BRO A;  5KVR A;  1YS6 A;  2R7O A;  1IDZ A;  2WA0 A;  2D2W A;  2VKH A;  2W84 A;  2R7Q A;  3HKZ N;  3LA2 A;  4EM0 B;  3ZRG A;  1D0Z A;  3GFI A;  1V3F A;  1GHC A;  4RM2 A;  4OIP F;  4O6J A;  3GWZ A;  4XN3 A;  3C2B A;  3S3O A;  2BW3 B;  1R36 A;  1FIA A;  3TMO A;  4II3 A;  3JAM Z;  3FM3 A;  1L3L A;  2MFZ A;  3A1Y A;  1REP C;  1XCB A;  4G7Z F;  4M73 A;  4AIJ A;  1MIJ A;  1PJR A;  3VYT B;  3HBL A;  2H8R A;  3LQR A;  3Q9V A;  3KLO A;  1G3Y A;  4BYY A;  3WGI A;  3DLL F;  3Q3S A;  1UB9 A;  2IAI A;  3V7S A;  1DQU A;  3S1Q J;  2DFH A;  4KMU X;  1DGR M;  2Y9Y A;  3DEU A;  2BVL A;  5IP7 J;  3CO6 C;  2W7N A;  1MMG A;  3O3K A;  2R93 J;  2XB0 X;  3ONQ A;  5IP6 A;  1ZH5 A;  3BG5 A;  2G9W A;  3L1P A;  5FLV A;  3TOA A;  2CQ7 A;  1JJ8 C;  4D7N A;  1UJ8 A;  5DM6 F;  2D45 A;  3SHF A;  4IZZ A;  2IP2 A;  1FOX A;  4UUT A;  2UXN A;  5CYV A;  1ZRC A;  1X19 A;  4RM3 A;  5M3M J;  4G12 A;  2XAJ A;  4F55 A;  3K4J A;  1LE8 A;  4F3Q A;  4ZYD A;  4YFX F;  2FQ3 A;  1Z67 A;  3FXL A;  3TDZ C;  1YRN B;  4LIV A;  4LLN A;  3QPT A;  4CCN A;  2STT A;  4V19 K;  3KIO A;  1H89 C;  2E1C A;  1FC3 A;  2NVT J;  3SFI A;  3KP5 A;  2DFE A;  3M07 A;  3HSF A;  5JLX A;  2EIL H;  3ZQQ A;  3I59 B;  3X2Q H;  1MDM A;  1O3T A;  1I6X A;  3CLQ A;  4UVB A;  4E6K G;  2WBM A;  4HX7 A;  1I50 J;  4HG2 A;  2QQA A;  3ZMV A;  2QVO A;  4G6Q A;  4C2M J;  1TC3 C;  2GXB A;  4YRV A;  2DI3 A;  3OYL A;  2VN2 A;  2VT2 A;  1H9T A;  4EJW A;  3PO3 J;  3G73 A;  4Q5S F;  3JTG A;  2OAZ A;  2MLG A;  4Q4Z F;  2J5P A;  3SQN A;  4CGZ A;  3I58 A;  3HJE A;  1U78 A;  3GW2 A;  3W6K B;  2HWV A;  2L54 A;  4YII A;  3I55 I;  4CCO A;  2RKH A;  3G1O A;  5IYC J;  2JA5 J;  2E1O A;  3CUO A;  1IN4 A;  2WAF A;  1SEU A;  1WJC A;  2YX4 A;  3OIP A;  1IC8 A;  3Q9S A;  3ESW B;  1Z1D A;  2K3P A;  1FOY A;  5FRM A;  2DA6 A;  3P5J A;  1FWZ A;  4AIH A;  3FK7 A;  5KHD A;  3HOT A;  1A36 A;  1Z7U A;  4PK4 A;  2L0K A;  2VB6 A;  5D4S A;  2YU9 J;  1U8R A;  4ITV A;  1OFC X;  2N8G A;  4QIW N;  2VON A;  4C9Y A;  2AQF A;  5D5W B;  3EYI A;  4KNY A;  4U88 A;  3M4O J;  3G71 I;  3CME I;  5LD2 C;  3VPR A;  3WTX C;  1IGN A;  4ZJZ A;  2YR2 A;  1MMD A;  3QPL A;  4IKF A;  4KYW A;  3MD2 A;  1K6Y A;  2DA4 A;  2LF8 A;  2WAD A;  5J3L A;  5JVT A;  4WCG A;  1LPQ A;  4QPO A;  1MSF C;  2H1L A;  4Y52 J;  4AYB N;  5E20 A;  3R61 A;  4DIQ A;  1XDS A;  3DTE A;  1JGG A;  2W00 A;  1SAU A;  1WH7 A;  4BXF A;  2AXL A;  5JLW A;  4ZZL A;  1WJA A;  2YSR A;  5L3B A;  4BGD A;  2CW8 A;  1E3P A;  1W5S A;  3AAF A;  2KLO A;  1XMK A;  3K4K A;  3OYF A;  4KUM A;  2CV1 A;  4KDP A;  2GXG A;  5FD6 A;  2CG4 A;  3PNT A;  3ULQ B;  3ZMZ A;  3DTI A;  3SEQ A;  3I4P A;  3CMM A;  3K4B A;  3FXJ A;  1YJW I;  4HNU A;  2DFF A;  3HOW J;  2F5C A;  3IWF A;  1HW1 A;  1WWX A;  3K2A A;  1P92 A;  1T2K A;  2FD5 A;  1WPK A;  2WAE A;  1IF1 A;  2DAO A;  2M7B A;  2RNJ A;  4XSZ F;  5B5E C;  4RDU A;  2XRO A;  1ZTR A;  3BPV A;  3G1M A;  3CCU I;  4V2G A;  3FXR A;  3HUG A;  2L3D A;  3LA3 A;  4XLF A;  1ZHF A;  5FKO A;  1KQ0 A;  1QA6 A;  2HZD A;  2M87 A;  1A04 A;  2HOT A;  2EZI A;  2MLK A;  1O57 A;  3TKY A;  4M6X A;  3KLN A;  3N4M A;  2RVC A;  5JI6 A;  4IHS A;  3COA C;  3DBR B;  5DUI A;  1VQM I;  6PAX A;  3TO7 A;  2IGK A;  1ZR4 A;  1SMT A;  1ZG5 A;  5DUK A;  2VLA A;  3JAM K;  2KDZ A;  3KP6 A;  3HTS B;  4RGR A;  3QPS A;  4CYC B;  1YW8 A;  3VYU B;  2CQK A;  5L3F A;  4IEJ A;  5F04 A;  3PJR A;  5TRD A;  1SVL A;  2NOJ B;  1YG2 A;  3ML6 A;  1O3R A;  2B9S A;  3B6A A;  5M5X J;  3HEF A;  2X4H A;  4HX4 A;  3QP6 A;  3FM5 A;  4DBR A;  1HKS A;  2VC1 A;  1WVR A;  1X4P A;  2EZL A;  1VQ9 I;  1X1D A;  3LFK A;  3CD6 I;  1OYW A;  5EG0 B;  1IN6 A;  2O61 A;  1EH6 A;  1TBX A;  3PFI A;  4XR6 A;  3WE2 A;  1FP1 D;  1I3A A;  4XN0 A;  1SC7 A;  2AS5 F;  1PDN C;  2DPU A;  2G7U A;  4A3D J;  2WAQ N;  3OYN A;  2HPM A;  1MNE A;  1YTY A;  3HOX J;  2ACJ A;  1OQY A;  5HDK A;  1Y1V J;  1VTN C;  4RLF A;  1HKT A;  2QQ9 A;  2DT5 A;  3H9J A;  4JBA A;  3EQL F;  3CF5 F;  1WKM A;  1V54 H;  4GYI A;  3GFJ A;  4I0A A;  4LLL A;  3GEZ A;  5J1Y A;  2Q2E A;  5FRO A;  1WJB A;  2M45 A;  4BKX A;  2KIS A;  3SZG A;  3DEE A;  1S72 I;  3CCR I;  4LG0 A;  1KU7 A;  1Y0U A;  4ZZD A;  3E6B A;  1MNM C;  2YX7 A;  4HF2 A;  2Y75 A;  4E4H A;  1VZ0 A;  3PSI A;  1OCP A;  2MSY A;  4A6D A;  4N4O B;  4QLC U;  4IJA A;  1OYY A;  1Z9C A;  3FKJ A;  1W0U A;  5HS8 A;  2KZV A;  3BTC A;  3VEP A;  3LSK A;  1ONV A;  3LQQ A;  3T8T A;  3F6O A;  1X1A A;  2O9L A;  1F9N A;  5D6F A;  1BA5 A;  1NG7 A;  3IC7 A;  3IRQ A;  1EJ9 A;  4EVI A;  4A3F J;  2MBF A;  1ZLK A;  2IA1 A;  1QRY A;  1RIO H;  2IS4 A;  2OJE D;  3EUK L;  4DYC A;  2K9M A;  1PUF A;  1JT0 A;  1DPR A;  5F0H A;  1TWA J;  3AG3 H;  4XLH A;  3FMR A;  4NQW B;  2A5Y B;  2YS9 A;  1A6Q A;  5F1J A;  2O6G E;  2PQ8 A;  5F08 A;  3HC7 A;  5IP9 J;  5GAG J;  2A5W A;  1UAA A;  1X4O A;  4AVP A;  2RQQ A;  4ZYA A;  2DJN A;  2M7A A;  3A4C A;  2LTP A;  4AM3 A;  3GTP J;  3ZMU A;  4XID A;  3OYA A;  1G4D A;  1FMV A;  5KNL A;  1HSJ A;  1BIA A;  2YUS A;  1U8B A;  1OLT A;  2XRN A;  4JX6 A;  3ZGK A;  4L0Z B;  3RKX A;  2VKE A;  2P6S A;  5DD8 A;  2VL8 A;  4EGZ A;  2UUZ A;  5J4V A;  9ANT A;  5K7Z A;  2VJJ A;  3QRF F;  4YFN F;  4M72 A;  1WFX A;  3H3U A;  3QOP A;  3E5X A;  3CO7 C;  1ZRF A;  4BU2 A;  1B8I A;  3MKL A;  4DJA A;  3BCB A;  4FQG A;  1JUM A;  2DA3 A;  1WQ2 A;  4HF1 A;  5LGU A;  1XGO A;  4IHY A;  1RRJ A;  1UHM A;  2QBY B;  3Q0U A;  3VYR B;  4EGY A;  1HF0 A;  2KZG A;  1HDP A;  1X3Z B;  2OC6 A;  2GZW A;  2Z16 A;  4DGW B;  2X1C A;  4II2 A;  4U7D A;  1STZ A;  5FLM J;  2DOA A;  5E3L A;  1N78 A;  1Y39 A;  2GIZ A;  1VQP I;  1FBU A;  3W2A A;  2LMD A;  5EGO B;  1QZE A;  2ECB A;  1RKW A;  2R92 J;  1FP2 A;  3LSM A;  4M6Y A;  1R71 A;  4U0V A;  4BEH A;  2LBF A;  3QOE A;  1SD6 A;  1RNL A;  2DT7 B;  1B59 A;  4OU0 A;  3J7Z I;  3OMY A;  2RC4 A;  3E6M A;  2QKM B;  1EKE A;  3JW4 A;  1B72 A;  4B3A A;  1S7A A;  2Y2Z A;  3H9Q A;  3I64 A;  1AOY A;  4XKC A;  3FK6 A;  2ZB9 A;  4B09 A;  3AL0 B;  4C3I J;  5FB2 A;  2JT1 A;  4XRM A;  2WB1 A;  1ZRE A;  2PG4 A;  3H5A A;  3H9G A;  4HOB A;  3IRR A;  4ZDL A;  4PFO A;  2GAU A;  1VF9 A;  2B0L A;  5K7F A;  3D5R C;  4P9U A;  2VBY A;  1PUE E;  4K2E A;  4XON A;  2JA2 A;  3GTM J;  3OWT A;  3MZ8 A;  4LLG F;  3I4N J;  1BJZ A;  4F7Z A;  4RMN A;  5ILV A;  5HLT A;  4XOR A;  4XRS G;  2V1N A;  2HNH A;  4KIC A;  4EJT A;  1YW7 A;  1S3J A;  4FX0 A;  4CCM A;  2RGV A;  2VJI A;  1BR4 A;  4RAY A;  2ZNZ A;  4U0W A;  4ZDO A;  4IL6 C;  2HOA A;  3PFY A;  3WGG A;  1YOV B;  5J1U A;  2F4O B;  2LRE A;  1E17 A;  4S05 A;  4AIK A;  3OYD A;  5BMZ A;  5EEG A;  2QF7 A;  3MMY B;  3P9C A;  5GTI C;  2ICW G;  5IYB J;  4ENK A;  2WTE A;  5K5R A;  3BG6 A;  1ZAR A;  1MJA A;  3PNV A;  3J7A O;  3IV5 A;  3TP0 A;  2F5F A;  2R5Z A;  2FML A;  1NK2 P;  1Z3X A;  2XPV A;  1B1B A;  2W57 A;  1T98 A;  4HV5 A;  4LFU A;  2HVR A;  1TW2 A;  3ZN0 A;  1I39 A;  1VQL I;  3G4S I;  4XLA A;  5LBQ A;  1D5V A;  4P9F A;  2RAE A;  3K4L A;  5IT9 Z;  3R6S A;  2DMT A;  1T38 A;  1LE8 B;  1T39 A;  3WTU C;  1ERD A;  1GV5 A;  1YYV A;  3CP2 A;  3V8K A;  2DK5 A;  4A3J J;  4XK4 A;  5F0C A;  2DPD A;  1B6A A;  1Y8R B;  2EB7 A;  2XF5 A;  4F93 B;  4AWX B;  3ELK A;  2XKP A;  1J2X A;  1WI9 A;  2K85 A;  4E7J A;  1B4A A;  1UFM A;  5K7H A;  3JSO A;  3RZO J;  5KAI C;  1F36 A;  3SDG A;  2BBY A;  1A6I A;  3IAM 2;  3PO2 J;  1MDM B;  1IUY A;  4XBF A;  4RGS A;  3CLO A;  1W1W E;  2V4J C;  4F91 B;  4ZYE A;  1F1Z A;  2NS0 A;  2E7W A;  1RUN A;  3QOD A;  1RUO A;  3ZXS A;  4B1R A;  3K2Z A;  1LUJ B;  4CSW A;  2MC4 A;  2MD0 A;  2E19 A;  2VPR A;  4H4K C;  2V1U A;  1JHH A;  2K27 A;  1LKX A;  1LFB A;  2CFX A;  2DOE A;  1LNW A;  2BY3 A;  3DV8 A;  5EJC A;  3E6D A;  4P1W A;  3CMA I;  4PJ0 C;  2L7F P;  1TLH B;  4A3C J;  5IPA A;  1W36 C;  3GTQ J;  5KAF C;  5DYM A;  1KQ8 A;  3V8J A;  2ESN A;  3K70 D;  4XQF A;  2FOK A;  4LG3 A;  2P5K A;  3BZ6 A;  4L5J A;  4L0Y B;  1QHH D;  4HST A;  1T33 A;  3J81 Z;  1NG6 A;  1XSD A;  3EUH A;  1R1T A;  2VJ5 A;  3GUD A;  3E97 A;  1E3H A;  2CQX A;  3JCU C;  3K10 A;  3R60 A;  4LGW A;  3W2V A;  1T0F C;  1B9M A;  5H2F C;  3KET A;  2IW5 A;  3R0A A;  4Y17 A;  2DW4 A;  5D5U B;  5JHU A;  1TTY A;  3F3X A;  3IAS 2;  3F72 A;  4LIU A;  2CV0 A;  2IRF G;  4M9Z A;  2AXT C;  2Y0M A;  4EJO A;  2PBI A;  1D0X A;  2WY8 Q;  3ABU A;  5K5Q A;  3UKG A;  3O2P E;  1IN8 A;  2R7V A;  3A0H C;  5LFA A;  3S8P A;  4PGH A;  3MKY B;  1ETW A;  2Y0S A;  2GM4 A;  2MW8 A;  4BQQ A;  5ED4 A;  2ZFW A;  3CF2 A;  2LY9 A;  2W24 A;  3ZQH A;  3H5R A;  1K79 A;  2ME0 A;  3FHN A;  4A3L J;  2HVS A;  3VWB A;  1DP7 P;  4RB0 A;  1O3Q A;  2Y30 A;  2Z3Y A;  3ZQI A;  4D9J A;  2K5C A;  4BAC A;  3RDI A;  2A07 F;  2PJP A;  3AG2 H;  2EV5 A;  1POG A;  4RGX A;  4ENJ A;  4PSW A;  2XVC A;  1U5T A;  1U6G A;  4QPQ A;  1HQC A;  1PVE A;  3J7A Y;  2VQC A;  3BPX A;  4N4N B;  3REO A;  3BZK A;  4X1E A;  4MTD A;  1F4K A;  1MBG A;  1R7J A;  1Z77 A;  5HOD A;  2EV0 A;  3K4M A;  4G6D A;  1FTT A;  2FBI A;  2XAH A;  3V42 A;  4DW6 A;  1R5G A;  4DYQ A;  5C4J J;  2CRG A;  5EDN A;  4A2U A;  3WOD F;  3HUG B;  1Y6I A;  3BR1 A;  3ROU A;  2A6H F;  2ZXJ A;  1KU3 A;  2EZK A;  4XSX F;  2EA4 A;  1YHQ I;  4U7B A;  2M4K A;  2KKO A;  2TRT A;  3OV8 A;  1TQM A;  4MGR A;  3UR3 C;  2QEX I;  3F0C A;  4OIR F;  1BOB A;  2K9S A;  4QTR A;  2P5L C;  1JTY A;  4R1H A;  1XGM A;  1TNS A;  1I27 A;  3OYI A;  3BT9 A;  5BNG A;  4NBQ A;  1BN5 A;  1KYZ A;  2XV4 S;  1ETY A;  3LWF A;  1UHS A;  3MCZ A;  1UG0 A;  4ZH4 F;  2FF4 A;  3HOY J;  1LJ9 A;  4NC8 A;  3VYS B;  3M3Y J;  3ZQG A;  3VFZ A;  2DT6 A;  2OV7 A;  4FHT A;  4KIT B;  5B1A H;  3W3C A;  1YJN I;  4JK1 X;  2F5D A;  4BXU A;  1B9N A;  2R7Z J;  2Z5U A;  2H27 A;  4MLO A;  1S29 A;  4P5O A;  4KT6 A;  3CUQ A;  1QVT A;  1R5I D;  3FXU A;  5AIP A;  2BGC A;  2CUZ A;  4D5F A;  4C2U A;  2G0E A;  1GT0 C;  3ECO A;  1ETK A;  1FSE A;  1ZQ3 P;  4OIO F;  5BPD A;  5IT9 K;  2CQN A;  5DDG A;  1UHW A;  1OCT C;  2XAG A;  1MMS A;  4UXN A;  3HHG A;  4RB2 C;  4BBS J;  1VFC A;  1HOM A;  1Z7L A;  2DO7 A;  2QWW A;  3GXO A;  3VOE A;  1LDJ A;  1DU0 A;  3PUF A;  4BY1 J;  2XC7 A;  4BQN A;  3RPQ A;  4IHW A;  1R4N B;  2EV6 A;  2XB5 A;  4ZTF A;  1ZGW A;  1TWC J;  2LLK A;  3LSH A;  1J9I A;  5FLX Z;  2Q2E B;  2OTJ I;  4M3D A;  4QWQ A;  4A93 J;  1ETV A;  3BJA A;  1BR2 A;  4LG0 B;  2LSO A;  3HIF A;  2E2I J;  2JUC A;  4ZYH A;  1XS9 A;  3BG9 A;  2KMU A;  5AIQ A;  5E3M A;  2PMU A;  3I53 A;  1ZG3 A;  2VKV A;  3L09 A;  2XPU A;  2LOO A;  1CQT A;  2JPC A;  2ZME C;  3BTL A;  2B7E A;  3BJO A;  1U0J A;  2HGC A;  2XHK A;  1JKP C;  3OYK A;  1ZEL A;  1X1P A;  3BY6 A;  2XPW A;  4S0H B;  2ZXI A;  3CJT B;  2GBY A;  2NS7 A;  3JRI A;  4RAF A;  4AC0 A;  3J81 K;  1H9G A;  2XGX A;  3TW7 A;  1XSX A;  2KQR A;  1JE8 A;  3KPH A;  5E1X A;  1PUF B;  1IN7 A;  2RV8 A;  1VQK I;  2LFB A;  2Q1Z B;  4I02 A;  2KFD A;  1I3Q J;  1KON A;  2WV1 A;  2V1D A;  4NNJ A;  4BDZ A;  2K86 A;  4RA2 A;  3S14 J;  1AKH B;  1Y0N A;  2PEX A;  1XMX A;  4JX4 A;  3ABL H;  2IGN A;  2XF6 A;  2CW7 A;  3DPU A;  3B6C A;  3F8B A;  1TL8 A;  1XSV A;  2XGD A;  3BZC A;  1V5F A;  1AA7 A;  4YG2 F;  2F48 A;  2P81 A;  1YW9 A;  2QQ8 A;  1IW7 F;  2R7X A;  1JGS A;  1VQ7 I;  3CCQ I;  1CGP A;  1K78 A;  3W2W A;  2DA7 A;  4JP0 A;  2K9L A;  3TGN A;  4CA0 A;  2EK5 A;  2D1V A;  1BI2 A;  2LH9 A;  4OWR B;  4J00 A;  2ZME A;  3CMY A;  4LMY A;  1T08 B;  2MAB A;  5EEH A;  1WJ5 A;  2K4B A;  2KIU A;  2H94 A;  5CVU A;  3FXK A;  2NOG A;  1IJW C;  3KCC A;  1P6R A;  4XRF A;  2UWM A;  3U21 A;  2FXA A;  1V5G A;  2CGP A;  5DS9 A;  3KP2 A;  4I01 A;  1B8I B;  4CXF A;  4Y7N J;  1Q1V A;  2H6B A;  4IQ4 A;  2XSD C;  5JFR A;  1RES A;  4Q47 A;  3FMS A;  2DMQ A;  1XPX A;  5H6Q A;  2CYY A;  2IGM A;  1RR8 C;  3CJN A;  3U9G A;  1M1E B;  2GXA A;  1VQ4 I;  3RSN A;  5DM7 F;  1T8I A;  3JRA A;  3F6V A;  3W6J B;  4Y13 A;  3CQZ J;  4XLE A;  2GQQ A;  3WTZ A;  3DBH B;  4KMF A;  4ENN A;  4I6Z A;  2LKX A;  4DYR A;  2JZY A;  3FF5 A;  2GOM A;  3HPG A;  5EEA A;  2PJR A;  1QQI A;  1DUX C;  2L4A A;  1LVA A;  2QSG X;  3GZ5 A;  4HSR A;  4BEH B;  1Y8Q B;  2LBF B;  4UB8 C;  3TO6 A;  3GYH X;  4A3I J;  4IRG A;  2JJ7 A;  5IYD J;  2CMP A;  4FAS D;  1P7I A;  2QKL B;  2X6W A;  2XAF A;  4RAG A;  2X6O A;  4JX5 A;  1WJF A;  2CFO A;  5FJ8 J;  4M9S A;  4BHC A;  1UST A;  3BG3 A;  4BS9 A;  4DZJ A;  1B72 B;  3K4C A;  1JJ6 C;  1O7F A;  4HQE A;  2P7V B;  2EA2 A;  3ZQF A;  4A0X A;  1MH3 A;  2ZKZ A;  3DU5 A;  1UEL B;  4NC7 A;  4Z2Y A;  5AON A;  4C3H J;  2M0C A;  4KN4 X;  1YFH A;  3C2H A;  3BC8 A;  3VSK A;  2XUB A;  2F4M B;  4RS8 A;  2EQR A;  3RKQ A;  1V4R A;  4MO7 A;  4NC6 A;  1XD7 A;  4IOA F;  1VND A;  5EYR A;  3CDH A;  1J5Y A;  1IUF A;  1J0R A;  1Z6T A;  3WHC A;  2E60 A;  4KIF A;  5H6R A;  4O5V A;  4PSX A;  1K7A A;  4UY8 I;  3MKW B;  1BJA A;  2ELK A;  3ZMD A;  2HR3 A;  1XMA A;  2LC2 A;  3O8H A;  4W1U A;  3HGY A;  3KEQ A;  5C4X J;  3IKV A;  1SFO J;  3C3W A;  1YO5 C;  2JPB A;  1SFK A;  2HQN A;  4CZC A;  3H35 A;  3QYB A;  2O03 A;  2Z33 A;  4BL0 B;  4HBL A;  3HOS A;  1SFX A;  1WJE A;  1W7P A;  3WHB A;  1TNT A;  5FLX K;  1Z91 A;  3S2W A;  4LB6 B;  2V9V A;  3C1D A;  4BH9 A;  3S16 J;  5LRR A;  3K7A J;  1V55 H;  1J75 A;  4L18 B;  5HLG A;  3F8N A;  2WWY A;  2BY1 A;  2L9R A;  1HBX G;  1W5C C;  3ZMT A;  2HQR A;  4OAZ A;  1JT6 A;  5J4Y A;  2R5Z B;  1T56 A;  3L2Q A;  4ENM A;  5L3E A;  2EFQ A;  5EZH A;  5EF6 A;  5ERI A;  3NWT A;  4KN7 X;  1DPU A;  3LSI A;  1QZY A;  4CO8 A;  3RYP A;  3F22 A;  2VPL A;  3MKZ A;  3OOU A;  1IXS B;  5E1Z B;  3SZP A;  1JKR C;  5J40 A;  4UV9 A;  3J80 Z;  1J7K A;  5LLQ A;  2MD5 A;  1TWH J;  4DQ2 A;  2KT0 A;  3M1E A;  3OYE A;  3KYL A;  1USS A;  2WV0 A;  2DCE A;  3AG1 H;  2E2J J;  2E1M C;  4TV7 A;  4GYG A;  2V6C A;  1MJB A;  1XGN A;  4AUX A;  1O4X A;  2IT0 A;  1TQP A;  5DEQ A;  3SZT A;  2ZXW H;  2KRC A;  3H3Z A;  3KZZ A;  4CUG A;  5GAE J;  4G7H F;  3HYI A;  1AHD P;  1OCC H;  3OSF A;  2LG4 A;  1AKH A;  4BHP A;  3KFW X;  4HF0 A;  4GGG A;  2MGQ A;  5ILU A;  2BOL A;  3OL3 A;  2K40 A;  4M71 A;  1QPM A;  3KP7 A;  1XDU A;  2ZFU A;  3LMM A;  1SAN A;  2HQA A;  5A2Q Z;  3S1N J;  2UXX A;  3SDB A;  1HA8 A;  4BJT A;  1NK3 P;  3HKZ A;  2R7R A;  1I6H J;  4XM3 A;  2RQP A;  2W1O A;  3RZD J;  4YIF A;  3DU6 A;  2IVM A;  5D6E A;  4MFD A;  3ABT A;  4N9I A;  4BHB A;  3OYJ A;  3L2V A;  4RLQ A;  4FX4 A;  1X3W B;  2OPT A;  2V6E A;  3OYH A;  1EH7 A;  4ON0 A;  3B73 A;  2V1X A;  1A5J A;  3OIO A;  1CF7 A;  1IRF A;  1NTC A;  1ZN2 A;  1VQ5 I;  2OBP A;  1OCR H;  4IO9 F;  4HPQ A;  3IP4 B;  2EIJ H;  5TJJ A;  3V4G A;  4CCK A;  4EM2 A;  1MMN A;  2J5O A;  4LB5 A;  4Y3O A;  3O8G A;  1VQ6 I;  1I1S A;  2AHQ A;  2X1D A;  1P9Q C;  3MQ0 A;  2X0L A;  1S7O A;  1QZZ A;  2ZJQ F;  4NB5 A;  2RN7 A;  2E35 A;  1KU9 A;  2JTV A;  1HKQ A;  2LKS A;  2PMH A;  2PFB A;  3WGH A;  1D1C A;  1LB2 A;  1OKR A;  3GVA A;  1GUU A;  4IPA A;  1BOA A;  1Z3Y A;  2OZ6 A;  5CLS A;  4KIG A;  5CPR B;  3L2R A;  2ZJP F;  1XG1 A;  4B4C A;  5CJ9 A;  3L9F A;  4RB1 A;  2JMW A;  2Y69 H;  2ZC2 A;  3OYB A;  3ISP A;  4PGG A;  2Q8K A;  4X6A J;  2CUJ A;  3OYG A;  1XC5 A;  4B48 A;  3K6G A;  1VQO I;  3E7L A;  1BC7 C;  1OMI A;  3TQN A;  3LOC A;  5FGM A;  4A12 A;  2JRM A;  4CIC A;  1YQA A;  3CDL A;  1X1B A;  5E8I A;  2X9D A;  2M2E A;  2ZJR F;  1OPC A;  3HRS A;  2A3S A;  2HDC A;  3T1B A;  1APL C;  5B66 C;  3GTJ J;  5B1B H;  1U5T B;  4AU7 A;  2BHY A;  4FT8 A;  4IF4 A;  3OY9 A;  2CWE A;  2Y9Z A;  3K1M A;  3I5U A;  3WE3 A;  4I7H A;  5J47 A;  1MJ9 A;  3HTU A;  2COM A;  3EYY A;  2M30 A;  1TT5 B;  4HQM A;  4WX9 A;  1SAX A;  2OUM A;  3DEW A;  5DV5 A;  3DCF A;  2PX9 A;  4Y4R A;  1EF4 A;  2BXZ A;  4JYK A;  1EA3 A;  2DDA A;  1F5T A;  2QQB A;  2C6Y A;  5TIS C;  3WU0 A;  5HNF A;  3LSG A;  2LP0 A;  3HOV J;  4BJ6 C;  1GDT A;  5BS6 A;  4R79 A;  3FIS A;  5E17 F;  3QYE A;  1MMA A;  3DTK A;  2M34 A;  2KIQ A;  4IX7 A;  2DU9 A;  2OA4 A;  3BR2 A;  3KZY A;  4XKW A;  4E7S A;  2E1N A;  1WH5 A;  2AQE A;  2A6E F;  3K0L A;  2MH9 A;  2ECC A;  4A0Y A;  3WTY C;  5JVG F;  1TT0 A;  2A68 F;  1P2F A;  2ZXH A;  3ZQL A;  4UNO A;  1MW7 A;  2HFH A;  3WU2 C;  5DTD A;  5CVJ A;  3HRT A;  1XN7 A;  2E71 A;  2XAS A;  2HU9 A;  2VE8 A;  3A0B C;  5E3O A;  1X58 A;  1GVD A;  4ESB A;  1KZH A;  2JK3 A;  4HNT A;  3GME A;  2OQG A;  3SFZ A;  5H20 A;  3JTH A;  4XOT A;  2QEN A;  3UNG C;  2EBI A;  5IOZ A;  4HLX A;  4AVZ A;  2D5V A;  3JRG A;  2HQ5 A;  3M8J A;  3CUQ B;  4NUB A;  1H8A C;  1F43 A;  1MSE C;  1MBE A;  2VXZ A;  2HKX A;  5LGN A;  4IRH A;  3T5X A;  3CCV I;  4MTE A;  2YPR A;  4YEL A;  5D8K B;  2FMY A;  5IOY A;  4BXX J;  4YFK F;  1P4X A;  3J80 K;  1JUS A;  1Z6R A;  2LK2 A;  4XLP F;  1EH8 A;  3JSP A;  2HDW A;  5DCM A;  3NQO A;  3RPU A;  1DDN A;  2A69 F;  4HW0 A;  4ESJ A;  1UCR A;  4C2T A;  1R22 A;  4G8X A;  2O7O A;  4L9T A;  4MHG A;  2LKP A;  3OSG A;  4P55 A;  1IG7 A;  3DP7 A;  2OCE A;  3N97 A;  3IWZ A;  4HDU A;  1MH4 A;  5A2Q K;  1PP8 F;  4GCV A;  3T0Y A;  4UUS A;  3H3V K;  1ULY A;  3I3L A;  3WG9 A;  4F52 A;  3LSP A;  2ZNY A;  2PMZ A;  2H1K A;  3TED A;  1FMW A;  1R9T J;  2BE5 F;  1OCZ H;  1FYM A;  5E1W A;  3DLA A;  2VAS A;  3BTJ A;  3ZPL A;  3S93 A;  3BTI A;  1SVO A;  3LFU A;  1OR7 C;  3S2H J;  3PQJ A;  3GFL A;  2EFW A;  1NH3 A;  1SFE A;  5CQE A;  1QGP A;  3HZJ A;  1W7P D;  2OD5 A;  1MKM A;  3CES A;  1SVM A;  1I5Z A;  1BM9 A;  4WK8 F;  3HXL A;  1Z05 A;  3RKY A;  2DDB A;  5FKM A;  4A6E A;  2DK8 A;  4A3E J;  1R00 A;  1LEA A;  1K6O A;  2DA5 A;  3H36 A;  3K4N A;  3QU3 A;  2FU4 A;  3JR9 A;  2HEO A;  4LK1 F;  1G3S A;  1ETQ A;  2IS2 A;  2TCT A;  3ABM H;  4XOP A;  2Z99 A; 
#chains in the Genus database with same CATH homology
 5E3M A;  4A3D J;  2CUE A;  3QQA A;  2WAQ N;  2VKV A;  2ID3 A;  2XPU A;  4CYC A;  2JA8 J;  3HOX J;  2R0Q C;  1Y1V J;  1CQT A;  4QSH A;  1P7J A;  3BTL A;  1ENH A;  1JKP C;  5M5W J;  3BR5 A;  2XPW A;  4S0H B;  5FKN A;  2GBY A;  2NS7 A;  3JRI A;  3A01 B;  3A03 A;  2CQQ A;  5J1Y A;  4AC0 A;  1BW6 A;  3TW7 A;  1ORK A;  4BKX A;  3BR6 A;  4M3B A;  3S17 J;  1JTX A;  5EG0 A;  1PUF B;  2LFB A;  1I3Q J;  2WV1 A;  3S1M J;  1MNM C;  3S14 J;  1AKH B;  1OCP A;  2MSY A;  4BBR J;  3BR0 A;  4JX4 A;  1W0U A;  3A02 A;  2DA1 A;  3NAU A;  4GFB A;  3B6C A;  3MN2 A;  3BTC A;  2EH3 A;  4DZP A;  2XGD A;  2L7M P;  4A3G J;  2O9L A;  2L7Z A;  2P81 A;  3LSJ A;  5F0F A;  2HDD A;  1BA5 A;  2DA2 A;  4I76 A;  4A69 C;  3HM5 A;  1IDY A;  2DA7 A;  3A01 A;  4JP0 A;  1WGX A;  1ETO A;  1D5Y A;  4A3F J;  1X2N A;  4IHV A;  3BQZ A;  3RQI A;  1QRY A;  3GTL J;  4DYC A;  1BW5 A;  1PUF A;  1JT0 A;  3CMY A;  5F0H A;  1TWA J;  2LVS A;  2HI3 A;  5F1J A;  1ZKG A;  2YS9 A;  5C3E J;  2NOG A;  1IJW C;  1X2M A;  3PM1 A;  4LOC A;  3NAR A;  5F08 A;  5IP9 J;  5DS9 A;  1B8I B;  3JRH A;  4Y7N J;  1Q1V A;  2FX0 A;  3IH4 A;  2XSD C;  1RES A;  2ME6 A;  2DMQ A;  2DJN A;  4MFE A;  2LTP A;  1UG2 A;  3GTP J;  4XID A;  3JRA A;  4BY7 J;  3CQZ J;  2YUS A;  1U8B A;  4JX6 A;  3LNQ A;  2LD5 A;  4I6Z A;  2LKX A;  2VKE A;  4DYR A;  1MBH A;  5EEA A;  2XRL A;  1E3O C;  9ANT A;  5K7Z A;  4C3J J;  1MBF A;  4A3I J;  1K61 A;  3HDD A;  2JJ7 A;  5IYD J;  1P7I A;  1TWF J;  2R5Y B;  2X6O A;  2IEK A;  4JX5 A;  2CUF A;  5FJ8 J;  3BG3 A;  1B72 B;  4DZJ A;  1B8I A;  3MKL A;  4XIC A;  1JJ6 C;  3ZQF A;  2OF7 A;  1JKQ C;  1JUM A;  2DA3 A;  1MH3 A;  3FKI J;  3LSR A;  4L5E A;  4IHY A;  1HLV A;  3Q0W A;  4C3H J;  3Q0U A;  2M0C A;  3JRB A;  2NS8 A;  1HF0 A;  1HDP A;  1DU6 A;  3S2D J;  2EQR A;  3RKQ A;  2HXI A;  4M3E A;  4MO7 A;  5FLM J;  5E3L A;  1IRZ A;  1VND A;  5EYR A;  5EGO B;  2ECB A;  1RKW A;  1MBJ A;  3FIW A;  1IUF A;  1U9O A;  2HOS A;  2R92 J;  1RPW A;  3WHC A;  2ELK A;  2K9Q A;  5EZG A;  3HB9 A;  3O8H A;  4W1U A;  3GBG A;  2R5Y A;  3HGY A;  3JRE A;  3S1R J;  5C4X J;  1SFO J;  1MBK A;  1HDD C;  1B72 A;  4B3A A;  2Y2Z A;  4M3G A;  1S7E A;  3FK6 A;  2ZB9 A;  2WB1 N;  2COB A;  4C3I J;  4V2F A;  1WCM J;  1JUP A;  3S15 J;  4MIM A;  4XRM A;  3I4M J;  3WHB A;  1Z0X A;  2XGE A;  2VUM J;  2MG4 A;  4A3K J;  3S16 J;  3K7A J;  1VF9 A;  4M6V A;  5K7F A;  3ZQC A;  4J19 A;  2L9R A;  5EGO A;  2HXO A;  5GP9 A;  1JKO C;  1RKT A;  3GTM J;  1JT6 A;  2R5Z B;  1T56 A;  5J1R A;  3I4N J;  1BJZ A;  4FTH A;  3D1N I;  5EZH A;  5EF6 A;  1Y1W J;  1G2H A;  4XRS G;  4RBO A;  4D5C A;  3HOZ J;  2DTZ A;  2JN6 A;  3CCY A;  3OOU A;  4IHX A;  1FEX A;  1JKR C;  1FTZ A;  1UMQ A;  2K9N A;  4M3F A;  4FE4 A;  1TWH J;  5GPA A;  2HOA A;  2CU7 A;  2KT0 A;  1AU7 A;  4FCY A;  5J1U A;  2LR8 A;  1QVU A;  2E2J J;  3HGG A;  1LFU P;  4NDL A;  4AUX A;  2QF7 A;  1O4X A;  2O8K A;  1K83 J;  3BQY A;  2GLO A;  5IYB J;  1AHD P;  3OSF A;  1AKH A;  1IDZ A;  2MGQ A;  2K40 A;  3HKZ N;  3IV5 A;  4EEF G;  3TP0 A;  2R5Z A;  2DMU A;  1NK2 P;  1SAN A;  3S1N J;  2XPV A;  3C2B A;  2VI6 A;  1NK3 P;  1I6H J;  1FIA A;  3RZD J;  1W0T A;  2RAE A;  4MFD A;  2DMT A;  1LE8 B;  1GV5 A;  4A3J J;  2OPT A;  3HBL A;  4XK4 A;  5F0C A;  2H8R A;  1A5J A;  3OIO A;  1NTC A;  3Q3S A;  2IAI A;  3GTK J;  2NVQ J;  3S1Q J;  5E3N A;  5K7H A;  3RZO J;  2Y9Y A;  1F36 A;  3O8G A;  3SDG A;  5IP7 J;  1A6I A;  3PO2 J;  2R93 J;  2AHQ A;  2XB0 X;  3G1L A;  5IP6 A;  3BG5 A;  3L1P A;  5FLV A;  1JJ8 C;  4D7N A;  2PMZ N;  3JRF A;  4B1R A;  4UUT A;  1GUU A;  2E19 A;  2VPR A;  4D7M A;  5M3M J;  2EZH A;  4G12 A;  4HNV A;  1LE8 A;  1LFB A;  1YRN B;  1XG1 A;  2L7F P;  4B4C A;  4A3C J;  5IPA A;  2JMW A;  3GTQ J;  3MVP A;  1H89 C;  4X6A J;  1XC5 A;  2NVT J;  3SFI A;  1OJL A;  3E7L A;  2DN0 A;  5JLX A;  1T33 A;  3GTG J;  3LOC A;  2CQX A;  1GV2 A;  2M9H A;  3TP3 A;  3CDL A;  2X9D A;  4ABZ A;  1QPI A;  2M2E A;  1I50 J;  1APL C;  3GTJ J;  4C2M J;  1TC3 C;  2Y9Z A;  1FIP A;  2E2H J;  1U9N A;  4A3M J;  3PO3 J;  2M8G X;  2Y0S N;  1U78 A;  3DEW A;  2JWT A;  3DCF A;  3UKG A;  3ZOB A;  1EF4 A;  1YRN A;  4JYK A;  5FKL A;  3G1O A;  5IYC J;  2JA5 J;  1ETW A;  2E1O A;  2W48 A;  2GM4 A;  1ITY A;  2MW8 A;  1IC8 A;  3H0G J;  3LSG A;  2LP0 A;  3HOV J;  2LY9 A;  1GDT A;  2DA6 A;  3ZQH A;  4FE7 A;  3FK7 A;  3FIS A;  2ME0 A;  3W6V A;  4A3L J;  2L0K A;  2M34 A;  3IH3 A;  2YU9 J;  2CJJ A;  3BR2 A;  2Y30 A;  1FJL A;  1OFC X;  2N8G A;  1RR7 A;  1WH5 A;  3ZQI A;  4QIW N;  1POG A;  2ECC A;  3M4O J;  3VPR A;  3ZQL A;  2NVY J;  2JA6 J;  1IGN A;  2FQ4 A;  3QPL A;  4X1E A;  5DTD A;  3GTO J;  2DA4 A;  5J3L A;  1TWG J;  1MBG A;  2IBD A;  1Z77 A;  1ZK8 A;  4FIS A;  5HOD A;  1FTT A;  1MSF C;  5E3O A;  4Y52 J;  4AYB N;  4DW6 A;  1X58 A;  4DYQ A;  1GVD A;  5C4J J;  1VI0 A;  2CRG A;  2JK3 A;  5EDN A;  1JGG A;  5FKK A;  3BR1 A;  3BR3 A;  1WH7 A;  5GPC A;  2EZK A;  3JRD A;  2EBI A;  2XGC A;  5IOZ A;  2DMP A;  2X48 A;  5JLW A;  2D5V A;  2TRT A;  3JRG A;  2HQ5 A;  5F27 A;  3F0C A;  4QTR A;  2K9S A;  1H8A C;  1F43 A;  1MSE C;  1JTY A;  1MBE A;  4UUS B;  1ZR2 A;  3BT9 A;  5BNG A;  2JA7 J;  1ETY A;  1RET A;  2ID6 A;  5IOY A;  4BXX J;  1UHS A;  1JUS A;  2LK2 A;  2B63 J;  1WI3 A;  3SJM A;  3HOW J;  3HOY J;  3Q0V A;  3K2A A;  2FD5 A;  1WPK A;  3M3Y J;  3ZQG A;  4RDU A;  1ZTR A;  2QCO A;  3G1M A;  5M3F J;  5C44 J;  4V2G A;  2I10 A;  2O7O A;  5FKO A;  3OSG A;  4A3B J;  1IG7 A;  2HOT A;  2R7Z J;  1HCR A;  2EZI A;  2DMN A;  4MLO A;  1MH4 A;  2NVX J;  1QVT A;  3H3V K;  4UUS A;  3LSP A;  1ETX A;  1ZR4 A;  4D5F A;  2H1K A;  3TED A;  1R9T J;  3JRC A;  2G0E A;  1GT0 C;  2KDZ A;  1IV6 A;  1ETK A;  1ZQ3 P;  2FJ1 A;  3QPS A;  3BTJ A;  4CYC B;  1OCT C;  3BTI A;  3S2H J;  4BBS J;  4IEJ A;  1VFC A;  5F04 A;  1HOM A;  1BL0 A;  4BY1 J;  1DU0 A;  4W97 A;  3HOU J;  3TW6 A;  3B6A A;  5M5X J;  4XRS A;  3HEF A;  4IHW A;  2XB5 A;  3IH2 A;  1ZGW A;  1TWC J;  2LLK A;  4M3D A;  2EZL A;  5FKM A;  2AO9 A;  2HYJ A;  4A93 J;  4A3E J;  1ETV A;  5EG0 B;  2DA5 A;  3JR9 A;  2E2I J;  1ETQ A;  2Y31 A;  2TCT A;  1XS9 A;  3BG9 A;  5M5Y J;  1H88 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...