2M34A

Nmr structure of the homeodomain transcription factor gbx1 from homo sapiens
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
b'SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein GBX-1
publication title NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2m34A00
3OSGA 3RZDJ 1NK3P 1MBKA 5IYDJ 5M3FJ 2VUMJ 5E3LA 2LVSA 1SANA 3HKZN 1MBHA 2R0QC 4A3JJ 1FEXA 1Y1VJ 5C44J 1JKPC 3FIWA 3VPRA 4D5CA 1JT0A 3FK6A 1GUUA 5F0HA 1OCPA 3BTCA 1WPKA 3RKQA 2DA7A 1UHSA 2Y9ZA 1X2NA 5J1UA 4MO7A 3OOUA 3GTJJ 5F08A 5FKLA 2O8KA 5K7ZA 5FKNA 4AC0A 4A3FJ 2CQXA 2DJNA 2MG4A 2HXOA 4C2MJ 2TRTA 2CUFA 2LR8A 1FIPA 5FJ8J 5IPAA 2DMPA 2LP0A 1AKHA 2ME6A 1FTTA 3M3YJ 4FISA 2X9DA 3JREA 1BL0A 3G1MA 4UUSB 3TW6A 4A3MJ 4FCYA 3K2AA 2L9RA 1JKOC 4QSHA 1X2MA 3RZOJ 2COBA 3TW7A 5IP6A 1ZKGA 2ME0A 1NK2P 2ECCA 3M4OJ 1HOMA 1A6IA 5C4JJ 5EZHA 2B63J 2G0EA 2IBDA 2CUEA 5E3MA 4EEFG 1U8BA 4C3HJ 1JKQC 4IHVA 2DA4A 1A5JA 4BY7J 2DMQA 3ZQLA 1I50J 1APLC 1MSFC 1JUPA 5F04A 5EF6A 4I6ZA 2XB5A 5EZGA 1ETVA 4MIMA 3ZQFA 1IG7A 5F0FA 2E19A 5FKOA 4C3IJ 5IP9J 5C3EJ 1I6HJ 3HGGA 1D5YA 2JA6J 2NOGA 1IGNA 3BR5A 2K40A 3JRHA 3DCFA 5GPCA 2FQ4A 1E3OC 1QPIA 5E3NA 1Z77A 3GTLJ 1I3QJ 1HDDC 1HCRA 1MNMC 3UKGA 9ANTA 1ORKA 1QVTA 3S1QJ 2R5YA 3SJMA 1GV2A 2XPVA 1ZTRA 3WHBA 1JTXA 1DU0A 1RPWA 3FISA 5FLMJ 1PUFB 3HOVJ 5IYCJ 4IHWA 1F36A 2W48A 2NVYJ 2VI6A 5J3LA 1B8IB 1YRNA 1XC5A 3S15J 1ENHA 2ELKA 2DA3A 3H3VK 1ETXA 2LTPA 2PMZN 3BT9A 1R9TJ 3Q3SA 1MH3A 4M3EA 3G1LA 2RAEA 2JA5J 3I4NJ 3NAUA 4RDUA 2FJ1A 2M2EA 4M3FA 2H8RA 1JT6A 1H88C 3GTOJ 2XGEA 1LFUP 4A3BJ 2DMTA 1LE8B 4Y7NJ 3QQAA 3BTLA 1VI0A 4NDLA 1TWGJ 5DS9A 3GBGA 3LNQA 4X1EA 3BQYA 4A3EJ 2GBYA 2K9QA 1BW6A 2Y2ZA 3PO2J 4A3GJ 3B6CA 3ZQGA 3S2HJ 4CYCB 1TC3C 4G12A 4FE4A 2X6OA 3JRFA 5F0CA 3BR6A 3TP3A 4D7NA 3HDDA 4IHXA 2QCOA 1AU7A 4GFBA 2NVTJ 5IOZA 2EZHA 4A3LJ 4XIDA 2CU7A 2VKVA 3QPLA 1UG2A 3JRBA 3MVPA 4B1RA 2R5ZA 2LKXA 4DYRA 2WV1A 2DA2A 4RBOA 2JWTA 3FKIJ 1IDZA 2LLKA 3BG9A 1QVUA 4UUSA 1UMQA 5F1JA 3H0GJ 3HBLA 3Q0VA 5EG0B 2EQRA 1FTZA 2E2JJ 2EZKA 2XPUA 3A01A 5C4XJ 2ZB9A 3S1RJ 3QPSA 1ZR4A 5FLVA 3TP0A 3HM5A 2O9LA 2EZIA 2XSDC 1VFCA 3BG3A 2GM4A 5IYBJ 1H89C 3IH4A 3HOXJ 4A69C 2R93J 1MH4A 1WI3A 1TWAJ 2LFBA 3JRGA 2Y9YA 2CQQA 3CCYA 4D7MA 3DEWA 4MFDA 1IDYA 4M6VA 4A3KJ 5HODA 1HDPA 1ETYA 2XGDA 3S16J 3NARA 1IRZA 4I76A 2E2HJ 1QRYA 1SFOJ 2AHQA 1ETWA 3IV5A 4DZJA 1AHDP 1ETQA 1IV6A 4QIWN 4W1UA 5GP9A 1OJLA 3B6AA 4LOCA 3GTKJ 2JN6A 1ETOA 3Q0WA 2HI3A 4JX5A 4BKXA 1HF0A 4AUXA 4IHYA 2DMNA 4QTRA 3OIOA 2HQ5A 4V2GA 1WH5A 2ID3A 1GT0C 1RR7A 4M3BA 5IP7J 1VNDA 5EYRA 2LD5A 2R7ZJ 3I4MJ 2R92J 2DA1A 4Y52J 3E7LA 3S14J 3HEFA 1ZK8A 5M5XJ 3GTGJ 5DTDA 5EEAA 4X6AJ 4A3DJ 5BNGA 1RESA 3ZQHA 1FJLA 2JK3A 4L5EA 2LK2A 2MGQA 4FE7A 4B4CA 2WB1N 1ZQ3P 2EBIA 2TCTA 2N8GA 3LSGA 1RETA 1B72B 2IEKA 2M0CA 4IEJA 1G2HA 3BR0A 2CJJA 5EGOA 5JLWA 2X48A 3GTQJ 4BXXJ 2HXIA 4UUTA 3HOYJ 1T33A 4W97A 2P81A 1Y1WJ 2D5VA 1F43A 5M5WJ 2NS8A 1LE8A 3A03A 3G1OA 1HLVA 3D1NI 2L7MP 3OSFA 2ID6A 3PO3J 1XG1A 1OFCX 1ZR2A 4CYCA 2Y0SN 2MW8A 1MBFA 4A93J 1Z0XA 2Y30A 4FTHA 1U78A 3BTJA 1JKRC 2DMUA 2JJ7A 2JA7J 2IAIA 1U9NA 3MN2A 5FKMA 3S2DJ 1WCMJ 1YRNB 2HOSA 1IC8A 3O8HA 3CQZJ 2L0KA 3JRAA 5K7HA 2FD5A 2KT0A 1JGGA 4J19A 1X58A 2AO9A 3BR2A 2GLOA 5EG0A 1IUFA 2NVQJ 5M5YJ 5IOYA 2OPTA 1K61A 2M8GX 1U9OA 3C2BA 4S0HB 3SDGA 1BJZA 2KDZA 1XS9A 5J1YA 2XRLA 2JA8J 1MBGA 4XRMA 2E1OA 3JR9A 1ZGWA 3HOZJ 2YU9J 2H1KA 4BBRJ 3JRIA 3JRCA 2E2IJ 3LOCA 4A3IJ 1W0TA 3GTMJ 3LSJA 3PM1A 1JUSA 3L1PA 5K7FA 2L7ZA 1K83J 2JMWA 1H8AC 2DA5A 3K7AJ 3BR1A 2NS7A 2R5ZB 1JJ6C 4BBSJ 2XPWA 3S1MJ 3IH2A 1AKHB 3S1NJ 1RKWA 4V2FA 3A01B 4JP0A 1WH7A 2K9SA 4BY1J 4M3GA 1TWCJ 2ECBA 2YS9A 4DYQA 1LFBA 2OF7A 1IJWC 2EH3A 4M3DA 4A3CJ 4B3AA 1Q1VA 2M34A 1GDTA 1DU6A 4DYCA 1NTCA 3A02A 1POGA 3MKLA 1P7JA 4XRSA 3S17J 2M9HA 2LY9A 5JLXA 1GV5A 5E3OA 4XRSG 2XGCA 1T56A 4D5FA 3JRDA 3HOUJ 2WAQN 1EF4A 3FK7A 3CMYA 4ABZA 3F0CA 2FX0A 3TEDA 4C3JJ 4MLOA 1B72A 4JYKA 1P7IA 1PUFA 1MBJA 1B8IA 1TWHJ 3SFIA 5F27A 3RQIA 2HDDA 1FIAA 1TWFJ 3BR3A 3WHCA 2O7OA 1O4XA 2EZLA 1W0UA 1JUMA 3BG5A 1ETKA 1JJ8C 5J1RA 5M3MJ 1OCTC 1RKTA 3CDLA 3HOWJ 3BTIA 3ZQCA 4AYBN 1ITYA 2I10A 1VF9A 1CQTA 2HOAA 2NVXJ 3GTPJ 4HNVA 2VKEA 3HB9A 5FKKA 2HOTA 2CRGA 3IH3A 4XK4A 3HGYA 2L7FP 1BA5A 3LSRA 3BQZA 2K9NA 2DTZA 1MBEA 1WGXA 1BW5A 2QF7A 2YUSA 4DW6A 2MSYA 5GPAA 2R5YB 1MSEC 5EDNA 3LSPA 1S7EA 4MFEA 4XICA 3ZOBA 1GVDA 2XB0X 4DZPA 2VPRA 3W6VA 5EGOB 1JTYA 3ZQIA 3O8GA 2Y31A 4JX4A 2DA6A 4JX6A 3Q0UA 2DN0A 2HYJA
chains in the Genus database with same CATH superfamily
2M7AA 1EJ9A 2HQAA 1FSEA 3ABMH 5B1AH 1TTYA 1BR2A 4A0YA 5IYDJ 2H09A 5LBQA 2M5WA 3HTUA 1ZN2A 2W84A 3AG4H 4E7IA 1FOYA 3H5AA 3TOAA 1VQ6I 5ICGA 5C44J 3FIWA 4ZTFA 5KHDA 2QWWA 2AS5F 4L9TA 2HKXA 3BTCA 1TT5B 1WPKA 2DA7A 2A05A 4UB6C 1FYLA 2KZGA 2P5VA 2L9NA 2DQRA 1IV8A 2A07F 1YJWI 3GTJJ 4A3FJ 4HLXA 1X19A 3CTAA 3NRVA 4C2MJ 2TRTA 3S3MA 2X6YA 4ENJA 1FIPA 2VKDA 5HDGA 4FASD 3KETA 4IX7A 3P5JA 2LP0A 3FMRA 1KONA 1TW3A 1IN8A 1STZA 4HEA2 2JRMA 4OAYA 1BL0A 2JSCA 1SFUA 3TW6A 4A3MJ 4G94A 4XONA 2HQRA 1H9GA 4FCYA 1MD0A 3GO5A 1Y56A 5TGTA 1X2MA 3TW7A 2K9LA 1KQ9A 3ZQ7A 5CVRA 2QA4I 1VQPI 1V54H 2J5PA 5E1ZB 3M4OJ 3ELKA 2CUEA 4MTDA 4IHVA 3PQKA 3KYCB 1CF7B 1P2FA 1QA6A 4AIHA 1JGSA 4QWQA 5K5OA 1WJDA 4IO9F 3OIPA 3IAS2 3F6OA 1K4TA 3PFIA 1APLC 1WJAA 4NB5A 1MSFC 2FNAA 3OYLA 1G8XA 4BAYA 5JVGF 1R71A 4PSXA 5EZGA 1ETVA 1VQ8I 1R1VA 1OCOH 5FKOA 1J5YA 5E79C 3V8KA 1BM9A 2IVMA 2V9PA 1FOWA 1D5YA 2V1XA 2LREA 1BOAA 3DF8A 3EUHC 1BOBA 4BJ5C 3RPQA 3DWLE 2X6XA 4XSZF 1A6QA 2XDVA 1Z77A 4ASNA 3OYIA 1YW8A 2E34A 3D5RC 1I3QJ 4HDVA 3CDHA 2DFHA 2R7FA 2VJ4A 2AXLA 1HCRA 2EFNA 3T5XA 4S05A 4Y4RA 9ANTA 3IRQA 2FE3A 3TKYA 3C18A 1W7PD 1GV2A 1TW2A 2BY2A 3CMMA 3H9GA 4BYYA 4ZJZA 1DU0A 1PUFB 3QWLA 2M7BA 1F36A 2W48A 2NVYJ 2VI6A 2DCEA 2IS6A 1OR7C 2PMZN 3BT9A 1R9TJ 1B59A 3NAUA 2M2EA 2RV8A 3K70C 3IRRA 2ESNA 4NQWA 5DD8A 5DD4A 1K6YA 2RQPA 4MQ9F 1LE8B 2NNNA 3BTLA 4NDLA 1TWGJ 1Z6RA 3BQYA 4A3EJ 5FLXZ 1I1SA 1I6XA 1B6AA 1TL8A 1DP7P 3PO2J 3F8NA 3B6CA 2KL4A 3DU5A 1YIOA 4JOMA 4FE4A 2L4MA 3UNGC 2X6OA 3K9TA 3JRFA 3OR2C 3BJ6A 3BR6A 5DYMA 3LSHA 3TP3A 2QCOA 2R7OA 1RIOH 5F1RA 4HZFA 1Z67A 2A6HF 5DEQA 1VTNC 3G71I 3QRFF 4KDPA 2ISYA 5HS9A 3GCMA 5A2QK 1YLFA 5LEJA 3WTSC 3OYNA 3FWEA 3TO7A 2CU7A 2FEZA 2GXBA 1X1DA 1KQ8A 1IN6A 4GXOA 3JRBA 3MVPA 4B1RA 2R5ZA 2LKXA 3PJRA 1VQ9I 1O3SA 2KP6A 4RB2C 1Z21A 1FMWA 3K1MA 3H0GJ 1TQIA 5CVVA 5H2FC 1REPC 3E5UA 2Z1DA 3FXKA 3CMAI 3BG7A 4HPQA 3QPSA 2KRFA 5FLVA 2A5YB 2O9LA 4XN0A 4IXAA 2XSDC 2Z99A 3BG3A 1ODDA 3EDPA 5AIQA 1ZLKA 2BEOA 3FXQA 3M8EA 4F92B 4A69C 3BROA 2EIMH 5ED4A 1CF7A 1MH4A 2A61A 2LFBA 5D4SA 2Y9YA 1U5TB 3NEUA 4C2UA 1D1BA 1B9NA 3C2GA 3QP6A 3RCOA 4A0XA 4ZDLA 1TQMA 4IOAF 1IDYA 5KNLA 4L0ZB 2F5DA 3M9AA 2BHZA 3GVAA 5HODA 5LEKA 2JUCA 4B8XA 1SFOJ 2VPLA 2IJLA 3BLYA 1ETWA 5LGNA 3PIOF 4EGZA 3IUOA 3ROUA 1ETQA 2VC0A 3WGGA 1IV6A 2WAQA 1FSHA 3S32A 5HS7A 5DV5A 3GFIA 4W1UA 1OJLA 3EUAA 4G7OF 2R7TA 3CP2A 1IZ1A 1ETOA 2ZXWH 2NOJB 2X1DA 3MKYB 4XLNF 1ZRFA 1HF0A 2UWMA 4ETSA 4IHYA 2DMNA 1ON2A 4Y13A 3R0AA 3OYGA 3GYHX 4HQMA 5IP7J 1YFHA 2BVLA 1D0YA 3GFLA 2R7ZJ 3CCVI 4Y52J 4KJZA 4BHPA 3VOEA 3CCQI 1MZBA 3CCSI 2VQCA 1XGSA 3MWMA 2OV7A 2QQ9A 3K4BA 5DTDA 5BNGA 1RESA 1R6RA 3TBIA 3SFZA 5EEAA 4HRIA 2H6CA 4J01A 4L5EA 1YE9A 2ELJA 4WF2A 3BJOA 1ZQ3P 2EBIA 1B72B 2EJRA 3BCAA 5BS6A 1YJNI 4IEJA 1G2HA 3ERED 5EGOA 3ZPLA 4BXXJ 4BJTA 3QODA 3DEEA 1FX7A 5FROA 2NS8A 1LE8A 4O3MA 3G1OA 2LSOA 2J5OA 2M4KA 3K4LA 3HTSB 1H0MA 2IT0A 3M07A 4KT5C 2MLKA 1OFCX 2L4AA 3QAHA 2KIQA 1K79A 2HPMA 1U78A 2L02A 2H94A 3BTJA 4ZYHA 1AOYA 2DBBA 2DPDA 2TDXA 2DMUA 2JJ7A 3CCLI 1U5TC 3G3ZA 1DDNA 1OCCH 4CYDA 1USTA 2DDAA 2VB6A 2OBPA 1UELB 3AL0B 1BR4A 3CCRI 2ZO4A 1DPRA 5ILUA 3WTYC 2V6EA 5DM6F 2KRCA 4P1WA 4CCOA 2P0WA 4ZH4F 2NVQJ 2ZJQF 1R58A 5L3FA 5M5YJ 4HG2A 2XHKA 2ZJ2A 1IXSB 3PNYA 3IC7A 3RKXA 2PFBA 4RB0A 3CCJI 2HQNA 5J1YA 2XRLA 4U0YA 2YR2A 1B4AA 3IKTA 3C2HA 4Q4ZF 2VN2A 2E1OA 3KFWX 3HOZJ 2YU9J 2PJPA 5LD2C 1U5TA 3OS1A 1DUXC 2E2IJ 3X2QH 2IPQX 4XBFA 4AU7A 2XAJA 1R7JA 2I8DA 3CUQB 1RZ4A 5L3DA 1W36C 3W6JB 5A2QZ 3RKYA 4M72A 3K7AJ 4UY8I 2NS7A 3PQJA 2QGUA 1SD6A 1LPQA 5LGUA 3RI4A 4XORA 4M6YA 4BU2A 2QSFX 2E36A 1FOXA 4N4NB 1RKWA 2RQQA 3KP6A 2OUMA 4PDKA 4KUMA 2KISA 2KHMA 1O57A 4B09A 1TWCJ 2ECBA 1X1PA 2YS9A 4DYQA 4EJWA 2DODA 3A0BC 5L3EA 3K4KA 2EH3A 2K4JA 3JSPA 1LKXA 1X4PA 1NTCA 3A02A 1POGA 3MKLA 3NWTA 2M9HA 4IHSA 2WADA 4XLPF 3TOBA 1YX3A 4I01A 2FBHA 3AG1H 3HOUJ 4A6DA 3L2UA 2QLZA 2DTRA 3FK7A 2ZMEB 3V7CA 5JHUA 4YG2F 1QU3A 4PJNA 3OYJA 1K7AA 4C3JJ 4RB3C 1B72A 2MABA 3AL0C 2D1VA 1WRJA 3EYYA 1B8IA 5F27A 4NNJA 3RQIA 3J81Z 1IRGA 3FBNB 3HUGB 4P9FA 2OZUA 2BHYA 2KDOA 1WJEA 3FXRA 5HS8A 5J1RA 1ZREA 2V6CA 4KA4A 3W2VA 3LSKA 4P96A 4PFPA 1RKTA 2CFOA 3B73A 3SYTA 4XNFA 4A6EA 2EA4A 2ADUA 4UNOA 1VF9A 4A5NA 1KYWA 2EWNA 1Q1HA 3DU6A 2A68F 2DJIA 1N78A 2DFFA 2VJ5A 4U88A 2O0YA 2PQ8A 4XK4A 4LK0F 1VQOI 2HYGD 1O3RA 2C6YA 2K9NA 4IRIA 3TO9A 3ABUA 1ACIA 2JTVA 4F55A 1UCRA 3HRSA 3CC4I 4MFEA 1Y8QB 1TT0A 2GA1A 2R7DA 1E17A 1GVJA 3W6VA 3VODA 4OMYA 2GIVA 3L2CA 4ESJA 4CH7A 3FMSA 2Y31A 1P6RA 3IKVA 4JX6A 2DN0A 2HYJA 3OSGA 3RZDJ 2XF6A 2K3FA 1QZEA 1MBKA 4OAZA 4EM1A 2VUMJ 3RPUD 2LVSA 1SANA 1TZLA 3HKZN 4OIRF 1LEBA 2R0QC 2M1BA 1QNTA 1ZAOA 1ZELA 1Y1VJ 2MD5A 1HKSA 2OQRA 3VPRA 1VZ0A 1ZG3A 1TQPA 4D5CA 4RGSA 1JT0A 3WE2A 2LBFB 3SZTA 1OCPA 3L09A 1D8JA 2XAHA 3IAM2 5J1UA 2O03A 4MO7A 2VQHA 2VT3A 2X85A 3CUQA 4B47A 2Y0MA 3OOUA 4BL0B 5F08A 4I99C 2ZMEC 3K69A 3JAMZ 2DJNA 3RPUA 3HSRA 2MG4A 5JFRA 2LR8A 1YW9A 5FJ8J 1P4XA 2EV6A 2ACJA 2JRTA 4XR6A 1FTTA 4DBQA 4E70A 1ZG5A 4LG0A 4QPOA 1X1AA 2UXXA 2XIGA 3OOPA 2WAFA 3G1MA 4UUSB 4E7KA 3A0HC 2UXNA 3CJRB 2HU9A 2DK5A 2L9RA 3F72A 1WWXA 3VSLA 2ESHA 2ZSIB 4NUBA 1ZKGA 2Q8KA 2GIZA 3M7GA 1A6IA 2DLLA 4Z2YA 5C4JJ 2ETHA 1V3FA 1MMGA 3S93A 1U8BA 5E1XA 1S5LC 1JKQC 4OMZA 3PNTA 2DA4A 1RUOA 2E5ZA 3U21A 4L18B 3OYEA 1YTYA 2EA2A 2PEXA 2KLOA 2DPUA 4M6XA 1IXRC 1HSTA 1DGWY 2EV5A 5H20A 5BPDA 1O3TA 3I54A 1FY7A 5F04A 4FETA 1ZRCA 1W5SA 1XSDA 3ZQFA 2JT1A 1IG7A 3HUGA 3W6KB 2VJIA 2E19A 2FRHA 2IGKA 3E3VA 4PFOA 4HF2A 4G6TB 3I53A 2NOGA 1IGNA 3MKZA 3BR5A 2K40A 4ZYEA 2LC2A 4DQ2A 1I1GA 4U7DA 2FQ4A 3I0TA 2RN7A 1QPIA 2Q1ZB 2IGOA 1X3UA 1F1ZA 2P7CB 3UKGA 2ZBKA 4M9ZA 4WWCA 1I5ZA 1ORKA 1QVTA 4BQAA 4LD5A 3S1QJ 1BI1A 3DTEA 1OQYA 2HZDA 1FP2A 2P5KA 3ZMZA 3CCMI 3WHBA 1JTXA 3HPHA 1NG6A 2JPCA 3KLNA 1RPWA 5HNFA 2RNJA 3FISA 5FLMJ 3KIOA 3E6CC 3HXLA 2VBZA 3J7AO 2STWA 3S15J 1S9HA 5TRDA 1J75A 1SFKA 3H3VK 1ETXA 2LTPA 5TJJA 3HOSA 1K6OA 1D0ZA 4M3EA 2BOLA 3G1LA 4N0BA 1PP7U 2MA3A 4RDUA 3CJTB 2FJ1A 2Q0OA 3LFUA 1JT6A 2R7QA 3FM3A 4EQQA 1KQ0A 5DCMB 1HW2A 4A3BJ 3LSTA 1IUYA 2ZKZA 3QQAA 4Y7NJ 4YIIA 3LNQA 4JQFA 3NWSA 5DS9A 3GBGA 1G6NA 4X1EA 2XAQA 2VASA 2WV0A 3DEUA 3WG7H 3FM5A 2K9QA 4PGGA 1T08B 3BJAA 1A04A 1X3ZB 3KCCA 1FYMA 4RM3A 1TC3C 4G12A 3S3NA 2ZNZA 3Q5FA 4ZC3A 5F0CA 1HBXG 3KEYA 3T0YA 4D7NA 3HDDA 4HLYA 2IW5A 3LSMA 3OWTA 2L5QA 1T2KA 1AU7A 4GFBA 2NVTJ 3G6EI 2H8WA 3EETA 3AFHA 2ZFWA 3ABLH 3L2VA 4BJ6C 2MD0A 2EZHA 4BE1A 2YPRA 3LSIA 1YI2I 3QPLA 5HOOA 4YRVA 2IS1A 1UG0A 5CYVA 2DOEA 4HSRA 4DYRA 5HNHA 1OPCA 2DA2A 1FT9A 2JWTA 4RBOA 3FKIJ 2HVSA 2D45A 1QVUA 3ERMA 4UUSA 1UJ8A 2HVQA 4EATA 1V5FA 3Q0VA 4EJUA 2F4MB 2EQRA 1FTZA 2ZSHB 3J7ZI 1F4KA 2Z2SB 5J4YA 3A01A 5C4XJ 2BY0A 3ASNH 1EH7A 4MHGA 1ZH5A 2NNYA 2EINH 1ZR4A 3TP0A 1LFPA 2LDUA 4KN7X 4RA2A 2EZIA 5KAFC 3E5XA 1D8KA 1R4MB 3CDIA 4BEHA 3IH4A 2QQAA 5EEGA 2R93J 3GWZA 3RQ4A 1Y0NA 4A5MA 2ICWG 3HHHA 2CQQA 1G4DA 4D7MA 2HDWA 4CGZA 1WJFA 2H1LA 4LFUA 5TISC 3L2QA 2F5CA 2Z5UA 5JVTA 4EGYA 4A3KJ 1CGPA 4L0YB 1OYIA 1QHHD 1R1UA 2QKMB 2XGDA 4II2A 3S16J 1HA8A 4KN4X 5CJ9A 4RGRA 1V5GA 1BI0A 1D1AA 4G6DA 4DZJA 3RYRA 4RAZA 2QQBA 3CF2A 4R1HA 2VXZA 4GCVA 5ERIA 3KEQA 3WGIA 4IQJA 4I02A 3DTIA 3B6AA 2E1NA 2RGVA 4JK1X 4LOCA 4RAFA 1YS7A 2DT7B 3REOA 3Q0WA 4JX5A 4BKXA 1S7OA 2E7XA 4O5VA 4WXHA 2XVCA 3OIOA 2QSGX 2ID3A 2BW3B 2RC4A 3I59A 2L54A 2FA5A 4BDZA 1M1EB 2LNBA 2K3PA 3DFGA 1T39A 4OINF 2V1UA 1TP4A 5J47A 1P4WA 2IP2A 5FD6A 3GZNB 3GXOA 1FJLA 2LK2A 2MGQA 1Z3XA 4FE7A 4AYBA 5GTHC 3CCUI 2STTA 3LSGA 1RETA 1OYYA 3FDYA 1SVOA 4PJ0C 1R22A 2XGXA 3RSNA 1X1BA 2HXIA 3HOYJ 1DGRM 2DFEA 5M5WJ 4BH9A 1VQNI 1FYKA 2OCEA 3A03A 4A0ZA 3D1NI 2L7MP 3EUHA 2B7EA 4O6JA 5D6FA 2ID6A 2L9VA 3F23A 3E97A 2L01A 2HVRA 2KPMA 4X0GA 1MBFA 3HC7A 3BZKA 4A93J 1Z0XA 2W85A 1SC7A 2E1MB 3BZCA 4BNCA 1VQMI 2CUJA 1SAUA 3K70D 3JTGA 5D5WB 2F5VA 4AM3A 2HTJA 3MEXA 5HLGA 3C1DA 2JA7J 3TDUC 4ITVA 4EM2A 1WCMJ 1YRNB 1UHMA 1XN7A 1IC8A 4XLHA 5E20A 2R4GA 3FX3A 5DCFA 2RKHA 3JRAA 3WODF 5K7HA 2CG4A 2LKPA 4G8XA 5IT9K 2W57A 3SHFA 2X1EA 2L3DA 2AO9A 1O7LA 3SZPA 1MMSA 1OR7A 3MCZA 1RR8C 2KRHA 2LY1A 4KITB 4NC6A 3E6MA 5IOYA 4E7LA 2HEOA 1K61A 3IL2A 4U7BA 4EMSA 3MZYA 2CW7A 3R6SA 3G73A 4B48A 1N77A 5B1BH 4XLCA 2KDZA 1XS9A 2OQGA 5L3GA 2P6TA 1I39A 1XDUA 4RB1A 1FLIA 4XRMA 2Y75A 4RM2A 3V8JA 3VYRB 5EJCA 3ONQA 1WZ2A 3VEPA 3JRCA 1OKRA 2GZWA 1YYVA 4NHJA 3HRTA 3LOCA 2V1NA 4A3IJ 3W2WA 2IGMA 1H8AC 1XSXA 2DA5A 5ICEA 2DO7A 3ZGKA 1ZRDA 3W2AA 4XRFA 4EM0B 1QHGA 4G9YA 4MTEA 3TO6A 4BBSJ 5D5VB 2VE9A 1PVEA 5B5EC 1AKHB 4R8HA 3S1NJ 4KYWA 2IS4A 1MJAA 3ULQB 2QVOA 4I2OA 3J81K 1FOKA 1BI2A 3B02A 3I58A 4CA0A 1LFBA 3JTHA 4KT6A 3FHZA 1R5GA 4HF1A 4UB8C 2JVHA 2V9VA 1YQAA 4L9NA 4KNYA 1GDTA 1DU6A 2BW3A 2W24A 4DYCA 5L3BA 3P9KA 3S17J 4PCQA 4GGGA 2E1MC 5JLXA 4C30A 5LGTA 4IKFA 4GYIA 2KMUA 2XGCA 3TDZC 1K78B 4D5FA 3KP2A 1HKQA 5GADJ 2WAQN 2KKOA 3M1CA 2XKOA 3CMYA 4NC7A 3ML6A 1W4MA 3F0CA 4ABZA 2FX0A 2YX7A 2ELHA 1P7IA 3AG3H 1MBJA 2WWYA 1PUFA 1XDSA 2WY7Q 2IA2A 2XKPA 4BXUA 1X1CA 2EB7A 4C2TA 2NVUB 2E1CA 4OWRB 3BR3A 1JUMA 4UUVA 4XL9A 5D5UB 3K4JA 4NC8A 1LUJB 2PN6A 1JJ8C 1Z7UA 5M3MJ 2GXGA 4KICA 1Y6IA 1U2WA 3PUFA 5IY5H 3OS0A 2NVXJ 3S8PA 3GTPJ 4HNVA 3KYLA 2VKEA 4I09A 3HG9A 4G6QA 2VODA 2GOMA 2MH2A 2HOTA 2W82A 2CRGA 2DT5A 2FMLA 3CC7I 2HGCA 2L7FP 4ENKA 1SEUA 1BA5A 1X4OA 3MKWB 1S7AA 2CQKA 2Q2EB 4EJTA 1SD7A 1WVRA 4DW6A 2MSYA 2DT6A 3EUKL 3SXYA 3DLAA 2MYSA 2R5YB 3QP5A 2CV0A 3LSPA 2PMUA 5H6QA 3LA2A 5LHGA 2OC6A 1HSJA 2HOEA 3H9JA 2XB0X 2P5LC 4NBQA 2VPRA 3OYDA 3JAMK 3VYUB 1XB4A 5FFZA 3DTKA 2V1DA 3Q0UA 4DIQA 3L9FA 4QLCU 3J7YJ 2ISZA 3K1PA 4ZTJA 2LF7A 2XAUA 4A3JJ 4FHTA 1OCZH 1FEXA 1VQ4I 1NG7A 2HFHA 4IRHA 1KU7A 3FK6A 2BZTA 2GAUA 1GUUA 2V79A 5F0HA 4OIPF 1KA8A 2CO5A 4GRIA 2Y9ZA 1QBJA 1X2NA 2COMA 2A5WA 3DQVC 3V7RA 2FF4A 1IW7F 3PSIA 4TV7A 1LQ1A 5K7ZA 4N9IA 3MZHA 3WTWC 2EK5A 1J9IA 3D5SC 5FGMA 5J8CA 1JHHA 3VFZA 2CUFA 3SEZA 5H6RA 4E4HA 3WTTC 3LAJA 1AKHA 4M9XA 5IT9Z 1Z91A 1Z1DA 3QU3A 3L2RA 3M3YJ 1XMXA 3FXJA 3JREA 2AXTC 3I5UA 3UR3C 4IJAA 4Y15A 4H0EA 2GA2A 5D5XB 2EIKH 2ZXJA 3F22A 3K2AA 3T1BA 1WSUA 3LFKA 1JKOC 2A6EF 4QSHA 3RZOJ 4LB5A 2COBA 4V19K 1UHWA 5IP6A 3AKZA 2BE5F 1NK2P 2DAOA 2ECCA 2YU3A 5JI6A 5LLQA 4G7HF 2LMDA 2B63J 1BIAA 3D5LA 3LL7A 2IBDA 5E3MA 3L2WA 4EEFG 2OCCH 4L9VA 4N9HA 2CV2A 2DXIA 1LVAA 3KPHA 4HX8A 1JI8A 3V7SA 4J00A 4PZJA 3ZMUA 2XRNA 4DBRA 3HSEA 4IF4A 3PIPF 4IQ4A 4HX4A 3ZQLA 4G7ZF 5F6FA 2E7WA 4AIDA 5BQTA 1D0XA 1XD7A 3QPHA 3H92A 3A4CA 1VQKI 4B3XA 2M0MA 3R60A 5F0FA 2H27A 1P9QC 2E35A 1HQCA 3WTXC 2P7VB 5IP9J 4BDYA 2EPFA 2JA6J 3MQ0A 1Z9CA 2JPBA 1H9TA 5ILSA 3ZMSA 3MMYB 1FBSA 5GPCA 1R36A 2LKSA 4AIJA 2DQLA 2CH0A 2WB1A 3DKYA 5E3NA 1WI9A 2O3FA 1EH6A 3LA7A 3F8CA 3E6DA 3P9IA 3JSOA 3CLOA 2EV0A 2CGPA 5GAHJ 2Q2EA 1S29A 3KEOA 1IN7A 4M9SA 2R5YA 1SD5A 3HZJA 1A36A 4F93B 2OU2A 4CZZA 4GO1A 4L5IA 3FXOA 5LHHA 2DU9A 2KZVA 4F3QA 1GLNA 5J3LA 3F8MA 3ZRGA 1R5ID 1XGMA 3CP8A 2QZ8A 1PJRA 2Y0SA 1BC8C 2ELKA 2DA3A 2CFXA 2I5UA 3Q3SA 1MH3A 3K10A 2DI3A 2JA5J 4M3FA 3ABKH 5KCMA 5GAGJ 1H88C 2XGEA 3HRUA 2F48A 3GF2A 4BQQA 4M71A 2DMTA 2HKOA 2VIXA 3LMMA 3SZGA 2EFWA 4BACA 1V4RA 2CW0F 2BYVE 3FXMA 2EFOA 2F5EA 4A3GJ 3ZQGA 2F4OB 2OJED 2OA4A 3S2HJ 3HJEA 2V4JC 1KZHA 1E2XA 4I0BA 4U0VA 1Y39A 3KLOA 4UVCA 1KU3A 3MD2A 1L3LA 4CCLA 4MGRA 4LG3A 2XUBA 5IOZA 2BBYA 1B9MA 3CMEI 4A3LJ 4XIDA 4HBLA 2NXNB 3EQLF 4XN3A 5B3SH 3H35A 1UG2A 2JZYA 4M73A 2DYRH 4HSTA 3PUBA 1IDZA 4FX0A 1WJCA 4LMYA 5KK1A 5F1JA 5EG0B 4I98B 3OR1C 4LIUA 1J0RA 1NHAA 2KFDA 2E2JJ 4BXFA 5F64A 2MH9A 4MNUA 4LB6B 2W25A 3PNVA 3PFYA 1WKMA 1UZCA 2VOPA 3FXLA 4KIBA 1J7KA 3HM5A 1F9NA 3M8JA 3ABTA 4F7ZA 1XMAA 1VFCA 4DJAA 2MC3A 2UUZA 4XOTA 3I9V2 4CXFA 4BE0A 4FQGA 2H6BA 1YIJI 3JRGA 3U2RA 2VKHA 3CCYA 2F4IA 1B1BA 1HC8A 2R7WA 3EPZA 3DEWA 2VQGA 2WAEA 3E1SA 2XC7A 3MZ8A 3F8FA 4ZZDA 2ZMEA 1RNLA 2HYFA 2M8EA 4ENNA 1HXDA 3O6BB 2X6WA 1F5TA 1BJAA 3NARA 3K4CA 2E2HJ 1E3PA 2FMYA 3HPGA 1MGTA 3OS2A 1EV7A 3OYFA 4EJVA 3R0JA 1AHDP 4IL6C 3R4KA 3D0SA 1IF1A 4QIWN 1USSA 2V7FA 2X0LA 2QEXI 2JN6A 3BCBA 2RREA 2CYYA 3GEZA 4AUXA 1XGNA 4QTRA 4PUSA 2HQ5A 2WBMA 1WH5A 3K6GA 1QPMA 1GT0C 3L00A 2NAZA 4Y33A 3CESA 4M3BA 3GZ6A 1VNDA 5EYRA 1U0JA 2FQ3A 2DYSH 5J4VA 3DBHB 4A12A 2LD5A 2DA1A 3VWBA 2PBIA 3E7LA 1GXQA 4E6KG 3S14J 1Y0UA 2EIJH 2K9MA 5ICFA 5M5XJ 3GTGJ 4CHUA 1QZYA 2FOKA 4A3DJ 1BIBA 3ZQHA 5EEHA 1MKMA 1T0FC 1XPXA 3J7AY 3CD6I 3WE3A 3DBRB 3M1EA 2ZJPF 2IEKA 4CO8A 4XLFA 3BR0A 2CJJA 5K5QA 3F3XA 2DW4A 2X48A 3GTQJ 3IWZA 3KZZA 2LYCA 4UUTA 3SEQA 1T33A 2P4WA 1MDMB 1Y1WJ 2AQFA 1KYZA 2F2EA 4ANJA 3WU0A 1FNNA 2JQ7A 3QOPA 2O6GE 2X4HA 4IZZA 3OSFA 3TMOA 1G3TA 3I71A 3OYMA 2HWVA 3OYHA 2AQEA 1XG1A 1QZZA 3GFJA 1G59A 3PO3J 1OYWA 1ZR2A 2M87A 4BQOA 3OMYA 2MW8A 2JUGA 3OYAA 1L0OC 1MJBA 1XX5A 2Y30A 2LBFA 1LB2A 4DNCA 1JKRC 2CQNA 2K5CA 3DXJF 1G3YA 1FP1D 2IAIA 1U9NA 3C7JA 3MN2A 4HAMA 3OL3A 5FKMA 2HZTA 3S2DJ 2ZXHA 2R7UA 3ZP5A 1IRXA 3O8HA 5GAEJ 2WY8Q 3CQZJ 2L0KA 3GLXA 2FD5A 2IA1A 4HQEA 2KIUA 1JGGA 1P92A 1WJ5A 1X58A 1ZGAA 1DPUA 4F52A 2FXAA 2VBXA 3QPTA 4NQWB 2KJBA 5EG0A 3P7NA 4FX4A 3ECOA 3KP5A 3LWFA 1JE8A 2PI0A 1W7PB 4H4KC 5LRSA 3M8FA 3A1YA 3IWFA 2YSRA 3SDGA 5E17F 1BJZA 3CC2I 4YFNF 2VQLA 1ZARA 3HYIA 1MBGA 3U9GA 3OYCA 3JR9A 1T98A 3BPXA 4BS9A 4DOZA 3JRIA 3AG2H 1ZYRF 2HTSA 4BUPA 4RAGA 3GTMJ 4Q5SF 2MC4A 2IA0A 4M74A 1JUSA 4XM3A 5K7FA 2L7ZA 2XV4S 1K83J 2R7VA 1X3WB 3G2BA 3BR1A 2BGCA 2R5ZB 4YELA 4R79A 1WHUA 1LJ9A 2RDPA 1R5HA 2R7RA 2XPWA 3S1MJ 1QO0D 1ZHFA 1KU2A 5BOXA 1D5VA 3QYBA 2M4GA 4HOBA 1YO5C 4V2FA 1I3AA 1ZLJA 3JCUC 4WK8F 1S3JA 1J09A 4C9YA 2K9SA 1HW1A 4M3GA 5IT3A 1VQ5I 4ZDPA 3LQRA 2K86A 3FKJA 3O3KA 3GX4X 2FNPA 4LK1F 4M3DA 4A3CJ 5FB2A 1R23A 3I4PA 4UV9A 1Q1VA 2M34A 1FMVA 4ENMA 1U8RA 2GOXB 2M3AA 1T8IA 4BHCA 2LOOA 4LITA 4ESFA 5E8IA 4XRSA 4KIFA 3BY6A 2NS0A 1GV5A 1O7FA 4XRSG 1Z05A 1T56A 5FRNA 3BP8A 4HX7A 5CPRB 3DPUA 1EF4A 2G7UA 3NQOA 5J40A 3TEDA 1UAAA 4PJLA 1PUEE 4JYKA 2KJCA 1MMDA 2LRDA 3F8BA 4E7JA 1TWHJ 3SFIA 4HYEA 2O61A 5D6EA 4XSXF 1OMIA 4ZYDA 4UHTA 2G9WA 2R3SA 1MDMA 2CSOA 2XF5A 5AIPA 2O7OA 1UB9A 2EZLA 4U87A 4EVIA 1W0UA 2D2WA 3BG5A 1ETKA 1P4AA 1T6SA 3K2ZA 5DCMA 4MQVA 1OCTC 2HDCA 2LH9A 4BQNA 3KE2A 3CDLA 1HW5A 3K1NA 1EKEA 4AYBN 1ITYA 3ZMDA 2I10A 3KX2A 4UXNA 4Y3OA 5KAIC 2DOFA 2PMZA 4BGDA 3G4SI 5FKKA 5L3CA 3CO6C 3LSRA 1D3YA 1UFMA 1EH8A 3BQZA 1G3WA 1N25A 2JSPA 1WGXA 4S04A 1BW5A 2ZJRF 3BOQA 1V55H 2QF7A 1YOVB 4WXDA 1S7EA 2BV6A 2YX4A 1BR1A 4XICA 3ZOBA 3ZCOA 1GVDA 5CKTA 1JTYA 5EGOB 5BPIA 3ZQIA 2VOOA 5FRMA 4RLQA 4WCGA 5HLHA 1NK3P 3H36A 1LNWA 1XSVA 1W7PA 1J59A 1OISA 2HNHA 4AD9A 2V9KA 5M3FJ 4Q47A 4XMYA 3OL4A 5E3LA 4YIRX 1SAXA 1PP8F 4HNTA 3O2PE 3I55I 1MBHA 4HF0A 3SDBA 2IGNA 5ICCA 1JKPC 4II3A 1W5TA 1SVMA 1BN5A 2VBYA 4OOIA 3RKQA 2CV1A 1UHSA 2BY3A 1MNEA 4PJJA 1PDNC 3VDXA 2EFPA 1MJ9A 1O3QA 5FKLA 2O8KA 4L5JA 3N4MA 5FKNA 1RC9A 1WFXA 2DDBA 4AC0A 4D9JA 4KMFA 2WC2A 3COAC 2CQXA 1SMTA 1SVLA 2HXOA 5CVJA 2HPIA 2W1OA 5IPAA 2DMPA 2VT2A 2ME6A 4UVAA 2QYOA 4FISA 2X9DA 3T8RA 3J80K 3MFKA 5LHIA 4XOPA 2CUZA 4RAYA 4CICA 4ESBA 4UVBA 2QKLB 4AWXB 3LA3A 2K27A 3RDIA 3OY9A 1W1WE 3VSKA 1SFXA 1D1CA 2ME0A 5HLIA 2NRAC 2DFIA 2ZXIA 2B0LA 4KMUX 1HOMA 2D1HA 3FHNA 5EZHA 2GQQA 2VBWA 2G0EA 3AAFA 2P8TA 1NH3A 4N4OB 1W5CC 3QYFA 4C3HJ 2WTEA 1TNSA 2Y69H 1A5JA 4BY7J 2L7KA 3V4GA 2DMQA 1YS6A 1ULYA 1YG2A 1BC7C 2ZNYA 3Q9VA 2LY2A 1I50J 1RUNA 1ZGJA 4E7HA 3A2KA 1JUPA 2UZKA 4OU0A 5EF6A 4GYGA 3PL8A 1TBXA 1SFEA 2XB5A 4I6ZA 3DKXA 4PJMA 4MIMA 5AONA 4IVNA 4BHBA 1FPQA 4C3IJ 2EILH 5C3EJ 1I6HJ 3HGGA 1MNDA 4Q48A 4YFXF 2XROA 4QPQA 2O8XA 3JRHA 3DCFA 1R4NB 1SD4A 1OLTA 1E3OC 2F6CA 3RYPA 3GTLJ 2RNGA 3I3LA 1HDDC 2UV1A 1MNMC 2L9SA 4MEXF 3S2WA 3ZR8X 3QU6A 4ZDOA 1LDKB 4X6AJ 5E18F 3SJMA 2A6TA 4RGXA 2XPVA 1ZTRA 5K5RA 1HKTA 1T95A 3OYBA 2FBIA 1GXPA 2LG4A 4OIQF 3HOVJ 5IYCJ 1E0EA 4IHWA 1B8IB 1YRNA 5J8FA 2MLGA 1XC5A 1ENHA 4XKWA 4CCJA 3RIRA 5FFXA 1KGSA 5DUIA 2GWRA 4UV8A 3DKWA 4LLNA 2LF8A 2RAEA 3I4NJ 2VC1A 1IAWA 2H8RA 3CCEI 4WXCA 3GTOJ 3ISPA 5JHFA 1LFUP 3E5QA 3HHGA 4IRGA 1Z7LA 4XKCA 4RGUA 2XSJC 1VI0A 2DOAA 4RMNA 2GBYA 3HL2A 1FC3A 1BW6A 1YX5A 3BG6A 2Y2ZA 2QQ8A 3K4NA 3I64A 4CYCB 3EYIA 3TGNA 1IRFA 4I7HA 4YEJA 5JR3A 4AIKA 4IHXA 1TNTA 5CVIA 3WGHA 2IS2A 2XAGA 4PGHA 3DBLB 2VLAA 1S6LA 1BI3A 3N97A 1LEAA 1ON1A 2VKVA 3KYDB 3CJNA 2ZCWA 5KVRA 2OTJI 2Z3YA 4XLAA 4XLEA 4KISA 2WV1A 2ZFUA 2LLKA 3BG9A 1UMQA 4ZZLA 3ZMVA 2K02A 3HBLA 3KZIC 5E1WA 4BE2A 2EZKA 3WTVC 2XPUA 5HDNA 1A31A 2ZB9A 3S1RJ 3V42A 2E71A 3FMQA 1FBUA 1Z3YA 3DP7A 3K4MA 4IHTA 2GXAA 1VQ7I 1W36D 4XKVA 2GM4A 3E0JB 5IYBJ 1H89C 1KU9A 3F9KA 3HOXJ 2CQ7A 1EA3A 3LQQA 1WI3A 1TWAJ 2QM3A 2E60A 5CVUA 1K78A 3HSFA 4CCNA 3ZMTA 3GLLA 5LFAA 4PK4A 4MFDA 4M6VA 4YIFA 1JXSA 1IN5A 3CF5F 1HDPA 1ETYA 1IRZA 4RLFA 4I76A 5E8GA 1ZG1A 1QRYA 4LG0B 3RJPA 2QBYB 1LDDA 2AHQA 5K1YA 2PX9A 1MIJA 3J80Z 3BZ6A 3IV5A 2ZC2A 4KIGA 3RTRA 4E7ZA 5GP9A 1IXCA 1G3SA 1YHQI 3C3WA 1R00A 3GTKJ 4HV6A 4B44A 1U3EM 1WJBA 3F6VA 2R7XA 2HI3A 5CQGA 3DV8A 2W7NA 4V2GA 5LRRA 4CCMA 1QQIA 1RR7A 5DUKA 1C0WA 3I4MJ 2R92J 4P55A 3N05A 3HEFA 4JBAA 1ZK8A 2Y48A 4I0AA 2KIFA 3V8LA 2FOWA 3BPVA 2JK3A 4CUGA 3IP4B 4B4CA 1FBQA 2WB1N 1E3HA 2TCTA 2N8GA 5HLTA 3DPTA 2M0CA 3I56I 1R1TA 2E5NA 1XMKA 3FXUA 1XTAA 5GTIC 4P5OA 5JLWA 1MMAA 4W97A 2P81A 5D4RA 3H5RA 2D5VA 1F43A 5DM7F 4IOCF 3E6BA 1FZPB 1HLVA 2FUG2 2OD5A 2DK8A 1Y8RB 1DQUA 2R7SA 2CWEA 3FF5A 4CYCA 1K4SA 1AWCA 2Y0SN 2WA0A 5ILVA 4FTHA 3TQNA 1TLHB 3QYEA 1XCBA 3CUQC 2XF7A 3U1KA 1FWZA 3U1DA 3W3CA 2VL8A 3HKZA 3VB2A 2VE8A 2PJRB 2HOSA 4P9UA 3H3ZA 2CS3A 2VXDA 4LIVA 2HS5A 2NYXA 1IO2A 2HR3A 2KT0A 1S8NA 4J19A 4A2UA 4L9JA 1N75A 4CCKA 1WQ2A 3BR2A 4D1QA 2GLOA 2FSWA 1IUFA 3T8TA 2OZ6A 4LJZF 3CJQB 2OPTA 1JHFA 2Z9OA 2M8GX 1QGPA 1SMYF 5HVQC 6PAXA 3K0LA 1U9OA 2CW8A 3C2BA 3H9QA 5FO5A 1BBYA 4HDUA 2PLYA 2KQRA 2Z33A 2F5FA 4S0HB 4AVPA 2EFQA 3WG9A 1YJ9I 3P9CA 2KIMA 2JA8J 3H0DA 2RVCA 3BC8A 2O5RA 4F91B 4CDGA 1ZGWA 5CQEA 3R61A 4LLLA 2H1KA 4BBRJ 5FD5A 1A35A 2OTLI 2M45A 4HW0A 2MFZA 3ZN0A 1W0TA 3LSJA 3PM1A 3H1CA 2PMHA 3L1PA 1DP3A 2JMWA 4FT8A 2FU4A 5B66C 3HOTA 4XQFA 5HDKA 3MAJA 3CUOA 1JJ6C 2IRFG 4PSWA 3BWGA 3GMEA 4LGWA 4D0PA 1IN4A 2QBYA 2XAFA 3WU1B 3S3OA 3IH2A 3LAPA 4WX9A 3FZVA 2M30A 3H5NA 4E7SA 3GW2A 3HIFA 3SQNA 2FBKA 4MEYF 3ZXSA 2IXSA 3A01B 4HNUA 3CO7C 4JP0A 1WH7A 3L7WA 3WTUC 3CZ6A 1VQLI 1RRJA 4BY1J 1U6GA 4ZYGA 1ONVA 3RKWA 1Z6TA 1ERDA 3ZQQA 2OF7A 1IJWC 3FBIB 3DLLF 4B3AA 1PYVA 2W00A 4BEHB 3ESWB 1LVKA 1RI7A 1P7JA 2K7LA 1MMNA 1XGOA 3ASOH 3KZYA 2LY9A 1J2XA 4HA8A 3GZ5A 1YITI 5E3OA 2V26A 3JW4A 3OYKA 5DDGA 3TL4X 3JRDA 4GDFA 1S72I 1XCVA 3DPLC 4Z6YA 2K4BA 5J6XA 2G7HA 4MLOA 1I27A 3VYSB 1R49A 3IHUA 5D8KB 2BVMA 2X1CA 4YFKF 1T38A 1MW7A 3CLQA 2BXYA 4ZYAA 2HDDA 4HV5A 1YW7A 1FIAA 1TWFJ 4EJOA 2P6SA 3WHCA 3GUDA 2BY1A 2VONA 4B43A 1O4XA 4Y17A 3ZN1A 2A69F 4AVZA 2VJJA 2JA2A 3WTZA 3VYTB 4IPAA 2QENA 1LDJA 5BMZA 2OAZA 3HRMA 2XASA 3BTIA 3ZQCA 4KFCA 3HOWJ 2X51A 5CLSA 5FLXK 2MBFA 2HOAA 3I59B 3OV8A 4RS8A 4U0WA 4XKBA 1CQTA 3F21A 4LLGF 3HB9A 3IH3A 3BDDA 3HGYA 2W4SA 3OIQA 1OCRH 2CMPA 3GFMA 2DTZA 4CSWA 4DGWB 1MBEA 2PG4A 2YUSA 2PJRA 4ON0A 5GPAA 4OIOF 2JVGA 2QUFA 1MSEC 5EDNA 3KP7A 3Q9SA 3H3UA 3ECHA 1V5EA 2B9SA 4CZCA 2K85A 1AA7A 4EV0A 2Z16A 4K2EA 2A3SA 3PSFA 3QOEA 4DZPA 1GHCA 1T0FA 2L2OA 2QSHX 3WU2C 3KP4A 3O8GA 4JX4A 2DA6A 2BXZA 5D8LB 3KP3A
chains in the Genus database with same CATH topology
3OSGA 3RZDJ 1NK3P 1MBKA 5IYDJ 5M3FJ 2VUMJ 5E3LA 2LVSA 1SANA 3HKZN 1MBHA 2R0QC 4A3JJ 1FEXA 1Y1VJ 5C44J 1JKPC 3FIWA 3VPRA 4D5CA 1JT0A 3FK6A 1GUUA 5F0HA 1OCPA 3BTCA 1WPKA 3RKQA 2DA7A 1UHSA 2Y9ZA 1X2NA 5J1UA 4MO7A 3OOUA 3GTJJ 5F08A 5FKLA 2O8KA 5K7ZA 5FKNA 4AC0A 4A3FJ 2CQXA 2DJNA 2MG4A 2HXOA 4C2MJ 2TRTA 2CUFA 2LR8A 1FIPA 5FJ8J 5IPAA 2DMPA 2LP0A 1AKHA 2ME6A 1FTTA 3M3YJ 4FISA 2X9DA 3JREA 1BL0A 3G1MA 4UUSB 3TW6A 4A3MJ 4FCYA 3K2AA 2L9RA 1JKOC 4QSHA 1X2MA 3RZOJ 2COBA 3TW7A 5IP6A 1ZKGA 2ME0A 1NK2P 2ECCA 3M4OJ 1HOMA 1A6IA 5C4JJ 5EZHA 2B63J 2G0EA 2IBDA 2CUEA 5E3MA 4EEFG 1U8BA 4C3HJ 1JKQC 4IHVA 2DA4A 1A5JA 4BY7J 2DMQA 3ZQLA 1I50J 1APLC 1MSFC 1JUPA 5F04A 5EF6A 4I6ZA 2XB5A 5EZGA 1ETVA 4MIMA 3ZQFA 1IG7A 5F0FA 2E19A 5FKOA 4C3IJ 5IP9J 5C3EJ 1I6HJ 3HGGA 1D5YA 2JA6J 2NOGA 1IGNA 3BR5A 2K40A 3JRHA 3DCFA 5GPCA 2FQ4A 1E3OC 1QPIA 5E3NA 1Z77A 3GTLJ 1I3QJ 1HDDC 1HCRA 1MNMC 3UKGA 9ANTA 1ORKA 1QVTA 3S1QJ 2R5YA 3SJMA 1GV2A 2XPVA 1ZTRA 3WHBA 1JTXA 1DU0A 1RPWA 3FISA 5FLMJ 1PUFB 3HOVJ 5IYCJ 4IHWA 1F36A 2W48A 2NVYJ 2VI6A 5J3LA 1B8IB 1YRNA 1XC5A 3S15J 1ENHA 2ELKA 2DA3A 3H3VK 1ETXA 2LTPA 2PMZN 3BT9A 1R9TJ 3Q3SA 1MH3A 4M3EA 3G1LA 2RAEA 2JA5J 3I4NJ 3NAUA 4RDUA 2FJ1A 2M2EA 4M3FA 2H8RA 1JT6A 1H88C 3GTOJ 2XGEA 1LFUP 4A3BJ 2DMTA 1LE8B 4Y7NJ 3QQAA 3BTLA 1VI0A 4NDLA 1TWGJ 5DS9A 3GBGA 3LNQA 4X1EA 3BQYA 4A3EJ 2GBYA 2K9QA 1BW6A 2Y2ZA 3PO2J 4A3GJ 3B6CA 3ZQGA 3S2HJ 4CYCB 1TC3C 4G12A 4FE4A 2X6OA 3JRFA 5F0CA 3BR6A 3TP3A 4D7NA 3HDDA 4IHXA 2QCOA 1AU7A 4GFBA 2NVTJ 5IOZA 2EZHA 4A3LJ 4XIDA 2CU7A 2VKVA 3QPLA 1UG2A 3JRBA 3MVPA 4B1RA 2R5ZA 2LKXA 4DYRA 2WV1A 2DA2A 4RBOA 2JWTA 3FKIJ 1IDZA 2LLKA 3BG9A 1QVUA 4UUSA 1UMQA 5F1JA 3H0GJ 3HBLA 3Q0VA 5EG0B 2EQRA 1FTZA 2E2JJ 2EZKA 2XPUA 3A01A 5C4XJ 2ZB9A 3S1RJ 3QPSA 1ZR4A 5FLVA 3TP0A 3HM5A 2O9LA 2EZIA 2XSDC 1VFCA 3BG3A 2GM4A 5IYBJ 1H89C 3IH4A 3HOXJ 4A69C 2R93J 1MH4A 1WI3A 1TWAJ 2LFBA 3JRGA 2Y9YA 2CQQA 3CCYA 4D7MA 3DEWA 4MFDA 1IDYA 4M6VA 4A3KJ 5HODA 1HDPA 1ETYA 2XGDA 3S16J 3NARA 1IRZA 4I76A 2E2HJ 1QRYA 1SFOJ 2AHQA 1ETWA 3IV5A 4DZJA 1AHDP 1ETQA 1IV6A 4QIWN 4W1UA 5GP9A 1OJLA 3B6AA 4LOCA 3GTKJ 2JN6A 1ETOA 3Q0WA 2HI3A 4JX5A 4BKXA 1HF0A 4AUXA 4IHYA 2DMNA 4QTRA 3OIOA 2HQ5A 4V2GA 1WH5A 2ID3A 1GT0C 1RR7A 4M3BA 5IP7J 1VNDA 5EYRA 2LD5A 2R7ZJ 3I4MJ 2R92J 2DA1A 4Y52J 3E7LA 3S14J 3HEFA 1ZK8A 5M5XJ 3GTGJ 5DTDA 5EEAA 4X6AJ 4A3DJ 5BNGA 1RESA 3ZQHA 1FJLA 2JK3A 4L5EA 2LK2A 2MGQA 4FE7A 4B4CA 2WB1N 1ZQ3P 2EBIA 2TCTA 2N8GA 3LSGA 1RETA 1B72B 2IEKA 2M0CA 4IEJA 1G2HA 3BR0A 2CJJA 5EGOA 5JLWA 2X48A 3GTQJ 4BXXJ 2HXIA 4UUTA 3HOYJ 1T33A 4W97A 2P81A 1Y1WJ 2D5VA 1F43A 5M5WJ 2NS8A 1LE8A 3A03A 3G1OA 1HLVA 3D1NI 2L7MP 3OSFA 2ID6A 3PO3J 1XG1A 1OFCX 1ZR2A 4CYCA 2Y0SN 2MW8A 1MBFA 4A93J 1Z0XA 2Y30A 4FTHA 1U78A 3BTJA 1JKRC 2DMUA 2JJ7A 2JA7J 2IAIA 1U9NA 3MN2A 5FKMA 3S2DJ 1WCMJ 1YRNB 2HOSA 1IC8A 3O8HA 3CQZJ 2L0KA 3JRAA 5K7HA 2FD5A 2KT0A 1JGGA 4J19A 1X58A 2AO9A 3BR2A 2GLOA 5EG0A 1IUFA 2NVQJ 5M5YJ 5IOYA 2OPTA 1K61A 2M8GX 1U9OA 3C2BA 4S0HB 3SDGA 1BJZA 2KDZA 1XS9A 5J1YA 2XRLA 2JA8J 1MBGA 4XRMA 2E1OA 3JR9A 1ZGWA 3HOZJ 2YU9J 2H1KA 4BBRJ 3JRIA 3JRCA 2E2IJ 3LOCA 4A3IJ 1W0TA 3GTMJ 3LSJA 3PM1A 1JUSA 3L1PA 5K7FA 2L7ZA 1K83J 2JMWA 1H8AC 2DA5A 3K7AJ 3BR1A 2NS7A 2R5ZB 1JJ6C 4BBSJ 2XPWA 3S1MJ 3IH2A 1AKHB 3S1NJ 1RKWA 4V2FA 3A01B 4JP0A 1WH7A 2K9SA 4BY1J 4M3GA 1TWCJ 2ECBA 2YS9A 4DYQA 1LFBA 2OF7A 1IJWC 2EH3A 4M3DA 4A3CJ 4B3AA 1Q1VA 2M34A 1GDTA 1DU6A 4DYCA 1NTCA 3A02A 1POGA 3MKLA 1P7JA 4XRSA 3S17J 2M9HA 2LY9A 5JLXA 1GV5A 5E3OA 4XRSG 2XGCA 1T56A 4D5FA 3JRDA 3HOUJ 2WAQN 1EF4A 3FK7A 3CMYA 4ABZA 3F0CA 2FX0A 3TEDA 4C3JJ 4MLOA 1B72A 4JYKA 1P7IA 1PUFA 1MBJA 1B8IA 1TWHJ 3SFIA 5F27A 3RQIA 2HDDA 1FIAA 1TWFJ 3BR3A 3WHCA 2O7OA 1O4XA 2EZLA 1W0UA 1JUMA 3BG5A 1ETKA 1JJ8C 5J1RA 5M3MJ 1OCTC 1RKTA 3CDLA 3HOWJ 3BTIA 3ZQCA 4AYBN 1ITYA 2I10A 1VF9A 1CQTA 2HOAA 2NVXJ 3GTPJ 4HNVA 2VKEA 3HB9A 5FKKA 2HOTA 2CRGA 3IH3A 4XK4A 3HGYA 2L7FP 1BA5A 3LSRA 3BQZA 2K9NA 2DTZA 1MBEA 1WGXA 1BW5A 2QF7A 2YUSA 4DW6A 2MSYA 5GPAA 2R5YB 1MSEC 5EDNA 3LSPA 1S7EA 4MFEA 4XICA 3ZOBA 1GVDA 2XB0X 4DZPA 2VPRA 3W6VA 5EGOB 1JTYA 3ZQIA 3O8GA 2Y31A 4JX4A 2DA6A 4JX6A 3Q0UA 2DN0A 2HYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSG A;  3RZD J;  1NK3 P;  1MBK A;  5IYD J;  5M3F J;  2VUM J;  5E3L A;  2LVS A;  1SAN A;  3HKZ N;  1MBH A;  2R0Q C;  4A3J J;  1FEX A;  1Y1V J;  5C44 J;  1JKP C;  3FIW A;  3VPR A;  4D5C A;  1JT0 A;  3FK6 A;  1GUU A;  5F0H A;  1OCP A;  3BTC A;  1WPK A;  3RKQ A;  2DA7 A;  1UHS A;  2Y9Z A;  1X2N A;  5J1U A;  4MO7 A;  3OOU A;  3GTJ J;  5F08 A;  5FKL A;  2O8K A;  5K7Z A;  5FKN A;  4AC0 A;  4A3F J;  2CQX A;  2DJN A;  2MG4 A;  2HXO A;  4C2M J;  2TRT A;  2CUF A;  2LR8 A;  1FIP A;  5FJ8 J;  5IPA A;  2DMP A;  2LP0 A;  1AKH A;  2ME6 A;  1FTT A;  3M3Y J;  4FIS A;  2X9D A;  3JRE A;  1BL0 A;  3G1M A;  4UUS B;  3TW6 A;  4A3M J;  4FCY A;  3K2A A;  2L9R A;  1JKO C;  4QSH A;  1X2M A;  3RZO J;  2COB A;  3TW7 A;  5IP6 A;  1ZKG A;  2ME0 A;  1NK2 P;  2ECC A;  3M4O J;  1HOM A;  1A6I A;  5C4J J;  5EZH A;  2B63 J;  2G0E A;  2IBD A;  2CUE A;  5E3M A;  4EEF G;  1U8B A;  4C3H J;  1JKQ C;  4IHV A;  2DA4 A;  1A5J A;  4BY7 J;  2DMQ A;  3ZQL A;  1I50 J;  1APL C;  1MSF C;  1JUP A;  5F04 A;  5EF6 A;  4I6Z A;  2XB5 A;  5EZG A;  1ETV A;  4MIM A;  3ZQF A;  1IG7 A;  5F0F A;  2E19 A;  5FKO A;  4C3I J;  5IP9 J;  5C3E J;  1I6H J;  3HGG A;  1D5Y A;  2JA6 J;  2NOG A;  1IGN A;  3BR5 A;  2K40 A;  3JRH A;  3DCF A;  5GPC A;  2FQ4 A;  1E3O C;  1QPI A;  5E3N A;  1Z77 A;  3GTL J;  1I3Q J;  1HDD C;  1HCR A;  1MNM C;  3UKG A;  9ANT A;  1ORK A;  1QVT A;  3S1Q J;  2R5Y A;  3SJM A;  1GV2 A;  2XPV A;  1ZTR A;  3WHB A;  1JTX A;  1DU0 A;  1RPW A;  3FIS A;  5FLM J;  1PUF B;  3HOV J;  5IYC J;  4IHW A;  1F36 A;  2W48 A;  2NVY J;  2VI6 A;  5J3L A;  1B8I B;  1YRN A;  1XC5 A;  3S15 J;  1ENH A;  2ELK A;  2DA3 A;  3H3V K;  1ETX A;  2LTP A;  2PMZ N;  3BT9 A;  1R9T J;  3Q3S A;  1MH3 A;  4M3E A;  3G1L A;  2RAE A;  2JA5 J;  3I4N J;  3NAU A;  4RDU A;  2FJ1 A;  2M2E A;  4M3F A;  2H8R A;  1JT6 A;  1H88 C;  3GTO J;  2XGE A;  1LFU P;  4A3B J;  2DMT A;  1LE8 B;  4Y7N J;  3QQA A;  3BTL A;  1VI0 A;  4NDL A;  1TWG J;  5DS9 A;  3GBG A;  3LNQ A;  4X1E A;  3BQY A;  4A3E J;  2GBY A;  2K9Q A;  1BW6 A;  2Y2Z A;  3PO2 J;  4A3G J;  3B6C A;  3ZQG A;  3S2H J;  4CYC B;  1TC3 C;  4G12 A;  4FE4 A;  2X6O A;  3JRF A;  5F0C A;  3BR6 A;  3TP3 A;  4D7N A;  3HDD A;  4IHX A;  2QCO A;  1AU7 A;  4GFB A;  2NVT J;  5IOZ A;  2EZH A;  4A3L J;  4XID A;  2CU7 A;  2VKV A;  3QPL A;  1UG2 A;  3JRB A;  3MVP A;  4B1R A;  2R5Z A;  2LKX A;  4DYR A;  2WV1 A;  2DA2 A;  4RBO A;  2JWT A;  3FKI J;  1IDZ A;  2LLK A;  3BG9 A;  1QVU A;  4UUS A;  1UMQ A;  5F1J A;  3H0G J;  3HBL A;  3Q0V A;  5EG0 B;  2EQR A;  1FTZ A;  2E2J J;  2EZK A;  2XPU A;  3A01 A;  5C4X J;  2ZB9 A;  3S1R J;  3QPS A;  1ZR4 A;  5FLV A;  3TP0 A;  3HM5 A;  2O9L A;  2EZI A;  2XSD C;  1VFC A;  3BG3 A;  2GM4 A;  5IYB J;  1H89 C;  3IH4 A;  3HOX J;  4A69 C;  2R93 J;  1MH4 A;  1WI3 A;  1TWA J;  2LFB A;  3JRG A;  2Y9Y A;  2CQQ A;  3CCY A;  4D7M A;  3DEW A;  4MFD A;  1IDY A;  4M6V A;  4A3K J;  5HOD A;  1HDP A;  1ETY A;  2XGD A;  3S16 J;  3NAR A;  1IRZ A;  4I76 A;  2E2H J;  1QRY A;  1SFO J;  2AHQ A;  1ETW A;  3IV5 A;  4DZJ A;  1AHD P;  1ETQ A;  1IV6 A;  4QIW N;  4W1U A;  5GP9 A;  1OJL A;  3B6A A;  4LOC A;  3GTK J;  2JN6 A;  1ETO A;  3Q0W A;  2HI3 A;  4JX5 A;  4BKX A;  1HF0 A;  4AUX A;  4IHY A;  2DMN A;  4QTR A;  3OIO A;  2HQ5 A;  4V2G A;  1WH5 A;  2ID3 A;  1GT0 C;  1RR7 A;  4M3B A;  5IP7 J;  1VND A;  5EYR A;  2LD5 A;  2R7Z J;  3I4M J;  2R92 J;  2DA1 A;  4Y52 J;  3E7L A;  3S14 J;  3HEF A;  1ZK8 A;  5M5X J;  3GTG J;  5DTD A;  5EEA A;  4X6A J;  4A3D J;  5BNG A;  1RES A;  3ZQH A;  1FJL A;  2JK3 A;  4L5E A;  2LK2 A;  2MGQ A;  4FE7 A;  4B4C A;  2WB1 N;  1ZQ3 P;  2EBI A;  2TCT A;  2N8G A;  3LSG A;  1RET A;  1B72 B;  2IEK A;  2M0C A;  4IEJ A;  1G2H A;  3BR0 A;  2CJJ A;  5EGO A;  5JLW A;  2X48 A;  3GTQ J;  4BXX J;  2HXI A;  4UUT A;  3HOY J;  1T33 A;  4W97 A;  2P81 A;  1Y1W J;  2D5V A;  1F43 A;  5M5W J;  2NS8 A;  1LE8 A;  3A03 A;  3G1O A;  1HLV A;  3D1N I;  2L7M P;  3OSF A;  2ID6 A;  3PO3 J;  1XG1 A;  1OFC X;  1ZR2 A;  4CYC A;  2Y0S N;  2MW8 A;  1MBF A;  4A93 J;  1Z0X A;  2Y30 A;  4FTH A;  1U78 A;  3BTJ A;  1JKR C;  2DMU A;  2JJ7 A;  2JA7 J;  2IAI A;  1U9N A;  3MN2 A;  5FKM A;  3S2D J;  1WCM J;  1YRN B;  2HOS A;  1IC8 A;  3O8H A;  3CQZ J;  2L0K A;  3JRA A;  5K7H A;  2FD5 A;  2KT0 A;  1JGG A;  4J19 A;  1X58 A;  2AO9 A;  3BR2 A;  2GLO A;  5EG0 A;  1IUF A;  2NVQ J;  5M5Y J;  5IOY A;  2OPT A;  1K61 A;  2M8G X;  1U9O A;  3C2B A;  4S0H B;  3SDG A;  1BJZ A;  2KDZ A;  1XS9 A;  5J1Y A;  2XRL A;  2JA8 J;  1MBG A;  4XRM A;  2E1O A;  3JR9 A;  1ZGW A;  3HOZ J;  2YU9 J;  2H1K A;  4BBR J;  3JRI A;  3JRC A;  2E2I J;  3LOC A;  4A3I J;  1W0T A;  3GTM J;  3LSJ A;  3PM1 A;  1JUS A;  3L1P A;  5K7F A;  2L7Z A;  1K83 J;  2JMW A;  1H8A C;  2DA5 A;  3K7A J;  3BR1 A;  2NS7 A;  2R5Z B;  1JJ6 C;  4BBS J;  2XPW A;  3S1M J;  3IH2 A;  1AKH B;  3S1N J;  1RKW A;  4V2F A;  3A01 B;  4JP0 A;  1WH7 A;  2K9S A;  4BY1 J;  4M3G A;  1TWC J;  2ECB A;  2YS9 A;  4DYQ A;  1LFB A;  2OF7 A;  1IJW C;  2EH3 A;  4M3D A;  4A3C J;  4B3A A;  1Q1V A;  2M34 A;  1GDT A;  1DU6 A;  4DYC A;  1NTC A;  3A02 A;  1POG A;  3MKL A;  1P7J A;  4XRS A;  3S17 J;  2M9H A;  2LY9 A;  5JLX A;  1GV5 A;  5E3O A;  4XRS G;  2XGC A;  1T56 A;  4D5F A;  3JRD A;  3HOU J;  2WAQ N;  1EF4 A;  3FK7 A;  3CMY A;  4ABZ A;  3F0C A;  2FX0 A;  3TED A;  4C3J J;  4MLO A;  1B72 A;  4JYK A;  1P7I A;  1PUF A;  1MBJ A;  1B8I A;  1TWH J;  3SFI A;  5F27 A;  3RQI A;  2HDD A;  1FIA A;  1TWF J;  3BR3 A;  3WHC A;  2O7O A;  1O4X A;  2EZL A;  1W0U A;  1JUM A;  3BG5 A;  1ETK A;  1JJ8 C;  5J1R A;  5M3M J;  1OCT C;  1RKT A;  3CDL A;  3HOW J;  3BTI A;  3ZQC A;  4AYB N;  1ITY A;  2I10 A;  1VF9 A;  1CQT A;  2HOA A;  2NVX J;  3GTP J;  4HNV A;  2VKE A;  3HB9 A;  5FKK A;  2HOT A;  2CRG A;  3IH3 A;  4XK4 A;  3HGY A;  2L7F P;  1BA5 A;  3LSR A;  3BQZ A;  2K9N A;  2DTZ A;  1MBE A;  1WGX A;  1BW5 A;  2QF7 A;  2YUS A;  4DW6 A;  2MSY A;  5GPA A;  2R5Y B;  1MSE C;  5EDN A;  3LSP A;  1S7E A;  4MFE A;  4XIC A;  3ZOB A;  1GVD A;  2XB0 X;  4DZP A;  2VPR A;  3W6V A;  5EGO B;  1JTY A;  3ZQI A;  3O8G A;  2Y31 A;  4JX4 A;  2DA6 A;  4JX6 A;  3Q0U A;  2DN0 A;  2HYJ A; 
#chains in the Genus database with same CATH topology
 2M7A A;  1EJ9 A;  2HQA A;  1FSE A;  3ABM H;  5B1A H;  1TTY A;  1BR2 A;  4A0Y A;  5IYD J;  2H09 A;  5LBQ A;  2M5W A;  3HTU A;  1ZN2 A;  2W84 A;  3AG4 H;  4E7I A;  1FOY A;  3H5A A;  3TOA A;  1VQ6 I;  5ICG A;  5C44 J;  3FIW A;  4ZTF A;  5KHD A;  2QWW A;  2AS5 F;  4L9T A;  2HKX A;  3BTC A;  1TT5 B;  1WPK A;  2DA7 A;  2A05 A;  4UB6 C;  1FYL A;  2KZG A;  2P5V A;  2L9N A;  2DQR A;  1IV8 A;  2A07 F;  1YJW I;  3GTJ J;  4A3F J;  4HLX A;  1X19 A;  3CTA A;  3NRV A;  4C2M J;  2TRT A;  3S3M A;  2X6Y A;  4ENJ A;  1FIP A;  2VKD A;  5HDG A;  4FAS D;  3KET A;  4IX7 A;  3P5J A;  2LP0 A;  3FMR A;  1KON A;  1TW3 A;  1IN8 A;  1STZ A;  4HEA 2;  2JRM A;  4OAY A;  1BL0 A;  2JSC A;  1SFU A;  3TW6 A;  4A3M J;  4G94 A;  4XON A;  2HQR A;  1H9G A;  4FCY A;  1MD0 A;  3GO5 A;  1Y56 A;  5TGT A;  1X2M A;  3TW7 A;  2K9L A;  1KQ9 A;  3ZQ7 A;  5CVR A;  2QA4 I;  1VQP I;  1V54 H;  2J5P A;  5E1Z B;  3M4O J;  3ELK A;  2CUE A;  4MTD A;  4IHV A;  3PQK A;  3KYC B;  1CF7 B;  1P2F A;  1QA6 A;  4AIH A;  1JGS A;  4QWQ A;  5K5O A;  1WJD A;  4IO9 F;  3OIP A;  3IAS 2;  3F6O A;  1K4T A;  3PFI A;  1APL C;  1WJA A;  4NB5 A;  1MSF C;  2FNA A;  3OYL A;  1G8X A;  4BAY A;  5JVG F;  1R71 A;  4PSX A;  5EZG A;  1ETV A;  1VQ8 I;  1R1V A;  1OCO H;  5FKO A;  1J5Y A;  5E79 C;  3V8K A;  1BM9 A;  2IVM A;  2V9P A;  1FOW A;  1D5Y A;  2V1X A;  2LRE A;  1BOA A;  3DF8 A;  3EUH C;  1BOB A;  4BJ5 C;  3RPQ A;  3DWL E;  2X6X A;  4XSZ F;  1A6Q A;  2XDV A;  1Z77 A;  4ASN A;  3OYI A;  1YW8 A;  2E34 A;  3D5R C;  1I3Q J;  4HDV A;  3CDH A;  2DFH A;  2R7F A;  2VJ4 A;  2AXL A;  1HCR A;  2EFN A;  3T5X A;  4S05 A;  4Y4R A;  9ANT A;  3IRQ A;  2FE3 A;  3TKY A;  3C18 A;  1W7P D;  1GV2 A;  1TW2 A;  2BY2 A;  3CMM A;  3H9G A;  4BYY A;  4ZJZ A;  1DU0 A;  1PUF B;  3QWL A;  2M7B A;  1F36 A;  2W48 A;  2NVY J;  2VI6 A;  2DCE A;  2IS6 A;  1OR7 C;  2PMZ N;  3BT9 A;  1R9T J;  1B59 A;  3NAU A;  2M2E A;  2RV8 A;  3K70 C;  3IRR A;  2ESN A;  4NQW A;  5DD8 A;  5DD4 A;  1K6Y A;  2RQP A;  4MQ9 F;  1LE8 B;  2NNN A;  3BTL A;  4NDL A;  1TWG J;  1Z6R A;  3BQY A;  4A3E J;  5FLX Z;  1I1S A;  1I6X A;  1B6A A;  1TL8 A;  1DP7 P;  3PO2 J;  3F8N A;  3B6C A;  2KL4 A;  3DU5 A;  1YIO A;  4JOM A;  4FE4 A;  2L4M A;  3UNG C;  2X6O A;  3K9T A;  3JRF A;  3OR2 C;  3BJ6 A;  3BR6 A;  5DYM A;  3LSH A;  3TP3 A;  2QCO A;  2R7O A;  1RIO H;  5F1R A;  4HZF A;  1Z67 A;  2A6H F;  5DEQ A;  1VTN C;  3G71 I;  3QRF F;  4KDP A;  2ISY A;  5HS9 A;  3GCM A;  5A2Q K;  1YLF A;  5LEJ A;  3WTS C;  3OYN A;  3FWE A;  3TO7 A;  2CU7 A;  2FEZ A;  2GXB A;  1X1D A;  1KQ8 A;  1IN6 A;  4GXO A;  3JRB A;  3MVP A;  4B1R A;  2R5Z A;  2LKX A;  3PJR A;  1VQ9 I;  1O3S A;  2KP6 A;  4RB2 C;  1Z21 A;  1FMW A;  3K1M A;  3H0G J;  1TQI A;  5CVV A;  5H2F C;  1REP C;  3E5U A;  2Z1D A;  3FXK A;  3CMA I;  3BG7 A;  4HPQ A;  3QPS A;  2KRF A;  5FLV A;  2A5Y B;  2O9L A;  4XN0 A;  4IXA A;  2XSD C;  2Z99 A;  3BG3 A;  1ODD A;  3EDP A;  5AIQ A;  1ZLK A;  2BEO A;  3FXQ A;  3M8E A;  4F92 B;  4A69 C;  3BRO A;  2EIM H;  5ED4 A;  1CF7 A;  1MH4 A;  2A61 A;  2LFB A;  5D4S A;  2Y9Y A;  1U5T B;  3NEU A;  4C2U A;  1D1B A;  1B9N A;  3C2G A;  3QP6 A;  3RCO A;  4A0X A;  4ZDL A;  1TQM A;  4IOA F;  1IDY A;  5KNL A;  4L0Z B;  2F5D A;  3M9A A;  2BHZ A;  3GVA A;  5HOD A;  5LEK A;  2JUC A;  4B8X A;  1SFO J;  2VPL A;  2IJL A;  3BLY A;  1ETW A;  5LGN A;  3PIO F;  4EGZ A;  3IUO A;  3ROU A;  1ETQ A;  2VC0 A;  3WGG A;  1IV6 A;  2WAQ A;  1FSH A;  3S32 A;  5HS7 A;  5DV5 A;  3GFI A;  4W1U A;  1OJL A;  3EUA A;  4G7O F;  2R7T A;  3CP2 A;  1IZ1 A;  1ETO A;  2ZXW H;  2NOJ B;  2X1D A;  3MKY B;  4XLN F;  1ZRF A;  1HF0 A;  2UWM A;  4ETS A;  4IHY A;  2DMN A;  1ON2 A;  4Y13 A;  3R0A A;  3OYG A;  3GYH X;  4HQM A;  5IP7 J;  1YFH A;  2BVL A;  1D0Y A;  3GFL A;  2R7Z J;  3CCV I;  4Y52 J;  4KJZ A;  4BHP A;  3VOE A;  3CCQ I;  1MZB A;  3CCS I;  2VQC A;  1XGS A;  3MWM A;  2OV7 A;  2QQ9 A;  3K4B A;  5DTD A;  5BNG A;  1RES A;  1R6R A;  3TBI A;  3SFZ A;  5EEA A;  4HRI A;  2H6C A;  4J01 A;  4L5E A;  1YE9 A;  2ELJ A;  4WF2 A;  3BJO A;  1ZQ3 P;  2EBI A;  1B72 B;  2EJR A;  3BCA A;  5BS6 A;  1YJN I;  4IEJ A;  1G2H A;  3ERE D;  5EGO A;  3ZPL A;  4BXX J;  4BJT A;  3QOD A;  3DEE A;  1FX7 A;  5FRO A;  2NS8 A;  1LE8 A;  4O3M A;  3G1O A;  2LSO A;  2J5O A;  2M4K A;  3K4L A;  3HTS B;  1H0M A;  2IT0 A;  3M07 A;  4KT5 C;  2MLK A;  1OFC X;  2L4A A;  3QAH A;  2KIQ A;  1K79 A;  2HPM A;  1U78 A;  2L02 A;  2H94 A;  3BTJ A;  4ZYH A;  1AOY A;  2DBB A;  2DPD A;  2TDX A;  2DMU A;  2JJ7 A;  3CCL I;  1U5T C;  3G3Z A;  1DDN A;  1OCC H;  4CYD A;  1UST A;  2DDA A;  2VB6 A;  2OBP A;  1UEL B;  3AL0 B;  1BR4 A;  3CCR I;  2ZO4 A;  1DPR A;  5ILU A;  3WTY C;  2V6E A;  5DM6 F;  2KRC A;  4P1W A;  4CCO A;  2P0W A;  4ZH4 F;  2NVQ J;  2ZJQ F;  1R58 A;  5L3F A;  5M5Y J;  4HG2 A;  2XHK A;  2ZJ2 A;  1IXS B;  3PNY A;  3IC7 A;  3RKX A;  2PFB A;  4RB0 A;  3CCJ I;  2HQN A;  5J1Y A;  2XRL A;  4U0Y A;  2YR2 A;  1B4A A;  3IKT A;  3C2H A;  4Q4Z F;  2VN2 A;  2E1O A;  3KFW X;  3HOZ J;  2YU9 J;  2PJP A;  5LD2 C;  1U5T A;  3OS1 A;  1DUX C;  2E2I J;  3X2Q H;  2IPQ X;  4XBF A;  4AU7 A;  2XAJ A;  1R7J A;  2I8D A;  3CUQ B;  1RZ4 A;  5L3D A;  1W36 C;  3W6J B;  5A2Q Z;  3RKY A;  4M72 A;  3K7A J;  4UY8 I;  2NS7 A;  3PQJ A;  2QGU A;  1SD6 A;  1LPQ A;  5LGU A;  3RI4 A;  4XOR A;  4M6Y A;  4BU2 A;  2QSF X;  2E36 A;  1FOX A;  4N4N B;  1RKW A;  2RQQ A;  3KP6 A;  2OUM A;  4PDK A;  4KUM A;  2KIS A;  2KHM A;  1O57 A;  4B09 A;  1TWC J;  2ECB A;  1X1P A;  2YS9 A;  4DYQ A;  4EJW A;  2DOD A;  3A0B C;  5L3E A;  3K4K A;  2EH3 A;  2K4J A;  3JSP A;  1LKX A;  1X4P A;  1NTC A;  3A02 A;  1POG A;  3MKL A;  3NWT A;  2M9H A;  4IHS A;  2WAD A;  4XLP F;  3TOB A;  1YX3 A;  4I01 A;  2FBH A;  3AG1 H;  3HOU J;  4A6D A;  3L2U A;  2QLZ A;  2DTR A;  3FK7 A;  2ZME B;  3V7C A;  5JHU A;  4YG2 F;  1QU3 A;  4PJN A;  3OYJ A;  1K7A A;  4C3J J;  4RB3 C;  1B72 A;  2MAB A;  3AL0 C;  2D1V A;  1WRJ A;  3EYY A;  1B8I A;  5F27 A;  4NNJ A;  3RQI A;  3J81 Z;  1IRG A;  3FBN B;  3HUG B;  4P9F A;  2OZU A;  2BHY A;  2KDO A;  1WJE A;  3FXR A;  5HS8 A;  5J1R A;  1ZRE A;  2V6C A;  4KA4 A;  3W2V A;  3LSK A;  4P96 A;  4PFP A;  1RKT A;  2CFO A;  3B73 A;  3SYT A;  4XNF A;  4A6E A;  2EA4 A;  2ADU A;  4UNO A;  1VF9 A;  4A5N A;  1KYW A;  2EWN A;  1Q1H A;  3DU6 A;  2A68 F;  2DJI A;  1N78 A;  2DFF A;  2VJ5 A;  4U88 A;  2O0Y A;  2PQ8 A;  4XK4 A;  4LK0 F;  1VQO I;  2HYG D;  1O3R A;  2C6Y A;  2K9N A;  4IRI A;  3TO9 A;  3ABU A;  1ACI A;  2JTV A;  4F55 A;  1UCR A;  3HRS A;  3CC4 I;  4MFE A;  1Y8Q B;  1TT0 A;  2GA1 A;  2R7D A;  1E17 A;  1GVJ A;  3W6V A;  3VOD A;  4OMY A;  2GIV A;  3L2C A;  4ESJ A;  4CH7 A;  3FMS A;  2Y31 A;  1P6R A;  3IKV A;  4JX6 A;  2DN0 A;  2HYJ A;  3OSG A;  3RZD J;  2XF6 A;  2K3F A;  1QZE A;  1MBK A;  4OAZ A;  4EM1 A;  2VUM J;  3RPU D;  2LVS A;  1SAN A;  1TZL A;  3HKZ N;  4OIR F;  1LEB A;  2R0Q C;  2M1B A;  1QNT A;  1ZAO A;  1ZEL A;  1Y1V J;  2MD5 A;  1HKS A;  2OQR A;  3VPR A;  1VZ0 A;  1ZG3 A;  1TQP A;  4D5C A;  4RGS A;  1JT0 A;  3WE2 A;  2LBF B;  3SZT A;  1OCP A;  3L09 A;  1D8J A;  2XAH A;  3IAM 2;  5J1U A;  2O03 A;  4MO7 A;  2VQH A;  2VT3 A;  2X85 A;  3CUQ A;  4B47 A;  2Y0M A;  3OOU A;  4BL0 B;  5F08 A;  4I99 C;  2ZME C;  3K69 A;  3JAM Z;  2DJN A;  3RPU A;  3HSR A;  2MG4 A;  5JFR A;  2LR8 A;  1YW9 A;  5FJ8 J;  1P4X A;  2EV6 A;  2ACJ A;  2JRT A;  4XR6 A;  1FTT A;  4DBQ A;  4E70 A;  1ZG5 A;  4LG0 A;  4QPO A;  1X1A A;  2UXX A;  2XIG A;  3OOP A;  2WAF A;  3G1M A;  4UUS B;  4E7K A;  3A0H C;  2UXN A;  3CJR B;  2HU9 A;  2DK5 A;  2L9R A;  3F72 A;  1WWX A;  3VSL A;  2ESH A;  2ZSI B;  4NUB A;  1ZKG A;  2Q8K A;  2GIZ A;  3M7G A;  1A6I A;  2DLL A;  4Z2Y A;  5C4J J;  2ETH A;  1V3F A;  1MMG A;  3S93 A;  1U8B A;  5E1X A;  1S5L C;  1JKQ C;  4OMZ A;  3PNT A;  2DA4 A;  1RUO A;  2E5Z A;  3U21 A;  4L18 B;  3OYE A;  1YTY A;  2EA2 A;  2PEX A;  2KLO A;  2DPU A;  4M6X A;  1IXR C;  1HST A;  1DGW Y;  2EV5 A;  5H20 A;  5BPD A;  1O3T A;  3I54 A;  1FY7 A;  5F04 A;  4FET A;  1ZRC A;  1W5S A;  1XSD A;  3ZQF A;  2JT1 A;  1IG7 A;  3HUG A;  3W6K B;  2VJI A;  2E19 A;  2FRH A;  2IGK A;  3E3V A;  4PFO A;  4HF2 A;  4G6T B;  3I53 A;  2NOG A;  1IGN A;  3MKZ A;  3BR5 A;  2K40 A;  4ZYE A;  2LC2 A;  4DQ2 A;  1I1G A;  4U7D A;  2FQ4 A;  3I0T A;  2RN7 A;  1QPI A;  2Q1Z B;  2IGO A;  1X3U A;  1F1Z A;  2P7C B;  3UKG A;  2ZBK A;  4M9Z A;  4WWC A;  1I5Z A;  1ORK A;  1QVT A;  4BQA A;  4LD5 A;  3S1Q J;  1BI1 A;  3DTE A;  1OQY A;  2HZD A;  1FP2 A;  2P5K A;  3ZMZ A;  3CCM I;  3WHB A;  1JTX A;  3HPH A;  1NG6 A;  2JPC A;  3KLN A;  1RPW A;  5HNF A;  2RNJ A;  3FIS A;  5FLM J;  3KIO A;  3E6C C;  3HXL A;  2VBZ A;  3J7A O;  2STW A;  3S15 J;  1S9H A;  5TRD A;  1J75 A;  1SFK A;  3H3V K;  1ETX A;  2LTP A;  5TJJ A;  3HOS A;  1K6O A;  1D0Z A;  4M3E A;  2BOL A;  3G1L A;  4N0B A;  1PP7 U;  2MA3 A;  4RDU A;  3CJT B;  2FJ1 A;  2Q0O A;  3LFU A;  1JT6 A;  2R7Q A;  3FM3 A;  4EQQ A;  1KQ0 A;  5DCM B;  1HW2 A;  4A3B J;  3LST A;  1IUY A;  2ZKZ A;  3QQA A;  4Y7N J;  4YII A;  3LNQ A;  4JQF A;  3NWS A;  5DS9 A;  3GBG A;  1G6N A;  4X1E A;  2XAQ A;  2VAS A;  2WV0 A;  3DEU A;  3WG7 H;  3FM5 A;  2K9Q A;  4PGG A;  1T08 B;  3BJA A;  1A04 A;  1X3Z B;  3KCC A;  1FYM A;  4RM3 A;  1TC3 C;  4G12 A;  3S3N A;  2ZNZ A;  3Q5F A;  4ZC3 A;  5F0C A;  1HBX G;  3KEY A;  3T0Y A;  4D7N A;  3HDD A;  4HLY A;  2IW5 A;  3LSM A;  3OWT A;  2L5Q A;  1T2K A;  1AU7 A;  4GFB A;  2NVT J;  3G6E I;  2H8W A;  3EET A;  3AFH A;  2ZFW A;  3ABL H;  3L2V A;  4BJ6 C;  2MD0 A;  2EZH A;  4BE1 A;  2YPR A;  3LSI A;  1YI2 I;  3QPL A;  5HOO A;  4YRV A;  2IS1 A;  1UG0 A;  5CYV A;  2DOE A;  4HSR A;  4DYR A;  5HNH A;  1OPC A;  2DA2 A;  1FT9 A;  2JWT A;  4RBO A;  3FKI J;  2HVS A;  2D45 A;  1QVU A;  3ERM A;  4UUS A;  1UJ8 A;  2HVQ A;  4EAT A;  1V5F A;  3Q0V A;  4EJU A;  2F4M B;  2EQR A;  1FTZ A;  2ZSH B;  3J7Z I;  1F4K A;  2Z2S B;  5J4Y A;  3A01 A;  5C4X J;  2BY0 A;  3ASN H;  1EH7 A;  4MHG A;  1ZH5 A;  2NNY A;  2EIN H;  1ZR4 A;  3TP0 A;  1LFP A;  2LDU A;  4KN7 X;  4RA2 A;  2EZI A;  5KAF C;  3E5X A;  1D8K A;  1R4M B;  3CDI A;  4BEH A;  3IH4 A;  2QQA A;  5EEG A;  2R93 J;  3GWZ A;  3RQ4 A;  1Y0N A;  4A5M A;  2ICW G;  3HHH A;  2CQQ A;  1G4D A;  4D7M A;  2HDW A;  4CGZ A;  1WJF A;  2H1L A;  4LFU A;  5TIS C;  3L2Q A;  2F5C A;  2Z5U A;  5JVT A;  4EGY A;  4A3K J;  1CGP A;  4L0Y B;  1OYI A;  1QHH D;  1R1U A;  2QKM B;  2XGD A;  4II2 A;  3S16 J;  1HA8 A;  4KN4 X;  5CJ9 A;  4RGR A;  1V5G A;  1BI0 A;  1D1A A;  4G6D A;  4DZJ A;  3RYR A;  4RAZ A;  2QQB A;  3CF2 A;  4R1H A;  2VXZ A;  4GCV A;  5ERI A;  3KEQ A;  3WGI A;  4IQJ A;  4I02 A;  3DTI A;  3B6A A;  2E1N A;  2RGV A;  4JK1 X;  4LOC A;  4RAF A;  1YS7 A;  2DT7 B;  3REO A;  3Q0W A;  4JX5 A;  4BKX A;  1S7O A;  2E7X A;  4O5V A;  4WXH A;  2XVC A;  3OIO A;  2QSG X;  2ID3 A;  2BW3 B;  2RC4 A;  3I59 A;  2L54 A;  2FA5 A;  4BDZ A;  1M1E B;  2LNB A;  2K3P A;  3DFG A;  1T39 A;  4OIN F;  2V1U A;  1TP4 A;  5J47 A;  1P4W A;  2IP2 A;  5FD6 A;  3GZN B;  3GXO A;  1FJL A;  2LK2 A;  2MGQ A;  1Z3X A;  4FE7 A;  4AYB A;  5GTH C;  3CCU I;  2STT A;  3LSG A;  1RET A;  1OYY A;  3FDY A;  1SVO A;  4PJ0 C;  1R22 A;  2XGX A;  3RSN A;  1X1B A;  2HXI A;  3HOY J;  1DGR M;  2DFE A;  5M5W J;  4BH9 A;  1VQN I;  1FYK A;  2OCE A;  3A03 A;  4A0Z A;  3D1N I;  2L7M P;  3EUH A;  2B7E A;  4O6J A;  5D6F A;  2ID6 A;  2L9V A;  3F23 A;  3E97 A;  2L01 A;  2HVR A;  2KPM A;  4X0G A;  1MBF A;  3HC7 A;  3BZK A;  4A93 J;  1Z0X A;  2W85 A;  1SC7 A;  2E1M B;  3BZC A;  4BNC A;  1VQM I;  2CUJ A;  1SAU A;  3K70 D;  3JTG A;  5D5W B;  2F5V A;  4AM3 A;  2HTJ A;  3MEX A;  5HLG A;  3C1D A;  2JA7 J;  3TDU C;  4ITV A;  4EM2 A;  1WCM J;  1YRN B;  1UHM A;  1XN7 A;  1IC8 A;  4XLH A;  5E20 A;  2R4G A;  3FX3 A;  5DCF A;  2RKH A;  3JRA A;  3WOD F;  5K7H A;  2CG4 A;  2LKP A;  4G8X A;  5IT9 K;  2W57 A;  3SHF A;  2X1E A;  2L3D A;  2AO9 A;  1O7L A;  3SZP A;  1MMS A;  1OR7 A;  3MCZ A;  1RR8 C;  2KRH A;  2LY1 A;  4KIT B;  4NC6 A;  3E6M A;  5IOY A;  4E7L A;  2HEO A;  1K61 A;  3IL2 A;  4U7B A;  4EMS A;  3MZY A;  2CW7 A;  3R6S A;  3G73 A;  4B48 A;  1N77 A;  5B1B H;  4XLC A;  2KDZ A;  1XS9 A;  2OQG A;  5L3G A;  2P6T A;  1I39 A;  1XDU A;  4RB1 A;  1FLI A;  4XRM A;  2Y75 A;  4RM2 A;  3V8J A;  3VYR B;  5EJC A;  3ONQ A;  1WZ2 A;  3VEP A;  3JRC A;  1OKR A;  2GZW A;  1YYV A;  4NHJ A;  3HRT A;  3LOC A;  2V1N A;  4A3I J;  3W2W A;  2IGM A;  1H8A C;  1XSX A;  2DA5 A;  5ICE A;  2DO7 A;  3ZGK A;  1ZRD A;  3W2A A;  4XRF A;  4EM0 B;  1QHG A;  4G9Y A;  4MTE A;  3TO6 A;  4BBS J;  5D5V B;  2VE9 A;  1PVE A;  5B5E C;  1AKH B;  4R8H A;  3S1N J;  4KYW A;  2IS4 A;  1MJA A;  3ULQ B;  2QVO A;  4I2O A;  3J81 K;  1FOK A;  1BI2 A;  3B02 A;  3I58 A;  4CA0 A;  1LFB A;  3JTH A;  4KT6 A;  3FHZ A;  1R5G A;  4HF1 A;  4UB8 C;  2JVH A;  2V9V A;  1YQA A;  4L9N A;  4KNY A;  1GDT A;  1DU6 A;  2BW3 A;  2W24 A;  4DYC A;  5L3B A;  3P9K A;  3S17 J;  4PCQ A;  4GGG A;  2E1M C;  5JLX A;  4C30 A;  5LGT A;  4IKF A;  4GYI A;  2KMU A;  2XGC A;  3TDZ C;  1K78 B;  4D5F A;  3KP2 A;  1HKQ A;  5GAD J;  2WAQ N;  2KKO A;  3M1C A;  2XKO A;  3CMY A;  4NC7 A;  3ML6 A;  1W4M A;  3F0C A;  4ABZ A;  2FX0 A;  2YX7 A;  2ELH A;  1P7I A;  3AG3 H;  1MBJ A;  2WWY A;  1PUF A;  1XDS A;  2WY7 Q;  2IA2 A;  2XKP A;  4BXU A;  1X1C A;  2EB7 A;  4C2T A;  2NVU B;  2E1C A;  4OWR B;  3BR3 A;  1JUM A;  4UUV A;  4XL9 A;  5D5U B;  3K4J A;  4NC8 A;  1LUJ B;  2PN6 A;  1JJ8 C;  1Z7U A;  5M3M J;  2GXG A;  4KIC A;  1Y6I A;  1U2W A;  3PUF A;  5IY5 H;  3OS0 A;  2NVX J;  3S8P A;  3GTP J;  4HNV A;  3KYL A;  2VKE A;  4I09 A;  3HG9 A;  4G6Q A;  2VOD A;  2GOM A;  2MH2 A;  2HOT A;  2W82 A;  2CRG A;  2DT5 A;  2FML A;  3CC7 I;  2HGC A;  2L7F P;  4ENK A;  1SEU A;  1BA5 A;  1X4O A;  3MKW B;  1S7A A;  2CQK A;  2Q2E B;  4EJT A;  1SD7 A;  1WVR A;  4DW6 A;  2MSY A;  2DT6 A;  3EUK L;  3SXY A;  3DLA A;  2MYS A;  2R5Y B;  3QP5 A;  2CV0 A;  3LSP A;  2PMU A;  5H6Q A;  3LA2 A;  5LHG A;  2OC6 A;  1HSJ A;  2HOE A;  3H9J A;  2XB0 X;  2P5L C;  4NBQ A;  2VPR A;  3OYD A;  3JAM K;  3VYU B;  1XB4 A;  5FFZ A;  3DTK A;  2V1D A;  3Q0U A;  4DIQ A;  3L9F A;  4QLC U;  3J7Y J;  2ISZ A;  3K1P A;  4ZTJ A;  2LF7 A;  2XAU A;  4A3J J;  4FHT A;  1OCZ H;  1FEX A;  1VQ4 I;  1NG7 A;  2HFH A;  4IRH A;  1KU7 A;  3FK6 A;  2BZT A;  2GAU A;  1GUU A;  2V79 A;  5F0H A;  4OIP F;  1KA8 A;  2CO5 A;  4GRI A;  2Y9Z A;  1QBJ A;  1X2N A;  2COM A;  2A5W A;  3DQV C;  3V7R A;  2FF4 A;  1IW7 F;  3PSI A;  4TV7 A;  1LQ1 A;  5K7Z A;  4N9I A;  3MZH A;  3WTW C;  2EK5 A;  1J9I A;  3D5S C;  5FGM A;  5J8C A;  1JHH A;  3VFZ A;  2CUF A;  3SEZ A;  5H6R A;  4E4H A;  3WTT C;  3LAJ A;  1AKH A;  4M9X A;  5IT9 Z;  1Z91 A;  1Z1D A;  3QU3 A;  3L2R A;  3M3Y J;  1XMX A;  3FXJ A;  3JRE A;  2AXT C;  3I5U A;  3UR3 C;  4IJA A;  4Y15 A;  4H0E A;  2GA2 A;  5D5X B;  2EIK H;  2ZXJ A;  3F22 A;  3K2A A;  3T1B A;  1WSU A;  3LFK A;  1JKO C;  2A6E F;  4QSH A;  3RZO J;  4LB5 A;  2COB A;  4V19 K;  1UHW A;  5IP6 A;  3AKZ A;  2BE5 F;  1NK2 P;  2DAO A;  2ECC A;  2YU3 A;  5JI6 A;  5LLQ A;  4G7H F;  2LMD A;  2B63 J;  1BIA A;  3D5L A;  3LL7 A;  2IBD A;  5E3M A;  3L2W A;  4EEF G;  2OCC H;  4L9V A;  4N9H A;  2CV2 A;  2DXI A;  1LVA A;  3KPH A;  4HX8 A;  1JI8 A;  3V7S A;  4J00 A;  4PZJ A;  3ZMU A;  2XRN A;  4DBR A;  3HSE A;  4IF4 A;  3PIP F;  4IQ4 A;  4HX4 A;  3ZQL A;  4G7Z F;  5F6F A;  2E7W A;  4AID A;  5BQT A;  1D0X A;  1XD7 A;  3QPH A;  3H92 A;  3A4C A;  1VQK I;  4B3X A;  2M0M A;  3R60 A;  5F0F A;  2H27 A;  1P9Q C;  2E35 A;  1HQC A;  3WTX C;  2P7V B;  5IP9 J;  4BDY A;  2EPF A;  2JA6 J;  3MQ0 A;  1Z9C A;  2JPB A;  1H9T A;  5ILS A;  3ZMS A;  3MMY B;  1FBS A;  5GPC A;  1R36 A;  2LKS A;  4AIJ A;  2DQL A;  2CH0 A;  2WB1 A;  3DKY A;  5E3N A;  1WI9 A;  2O3F A;  1EH6 A;  3LA7 A;  3F8C A;  3E6D A;  3P9I A;  3JSO A;  3CLO A;  2EV0 A;  2CGP A;  5GAH J;  2Q2E A;  1S29 A;  3KEO A;  1IN7 A;  4M9S A;  2R5Y A;  1SD5 A;  3HZJ A;  1A36 A;  4F93 B;  2OU2 A;  4CZZ A;  4GO1 A;  4L5I A;  3FXO A;  5LHH A;  2DU9 A;  2KZV A;  4F3Q A;  1GLN A;  5J3L A;  3F8M A;  3ZRG A;  1R5I D;  1XGM A;  3CP8 A;  2QZ8 A;  1PJR A;  2Y0S A;  1BC8 C;  2ELK A;  2DA3 A;  2CFX A;  2I5U A;  3Q3S A;  1MH3 A;  3K10 A;  2DI3 A;  2JA5 J;  4M3F A;  3ABK H;  5KCM A;  5GAG J;  1H88 C;  2XGE A;  3HRU A;  2F48 A;  3GF2 A;  4BQQ A;  4M71 A;  2DMT A;  2HKO A;  2VIX A;  3LMM A;  3SZG A;  2EFW A;  4BAC A;  1V4R A;  2CW0 F;  2BYV E;  3FXM A;  2EFO A;  2F5E A;  4A3G J;  3ZQG A;  2F4O B;  2OJE D;  2OA4 A;  3S2H J;  3HJE A;  2V4J C;  1KZH A;  1E2X A;  4I0B A;  4U0V A;  1Y39 A;  3KLO A;  4UVC A;  1KU3 A;  3MD2 A;  1L3L A;  4CCL A;  4MGR A;  4LG3 A;  2XUB A;  5IOZ A;  2BBY A;  1B9M A;  3CME I;  4A3L J;  4XID A;  4HBL A;  2NXN B;  3EQL F;  4XN3 A;  5B3S H;  3H35 A;  1UG2 A;  2JZY A;  4M73 A;  2DYR H;  4HST A;  3PUB A;  1IDZ A;  4FX0 A;  1WJC A;  4LMY A;  5KK1 A;  5F1J A;  5EG0 B;  4I98 B;  3OR1 C;  4LIU A;  1J0R A;  1NHA A;  2KFD A;  2E2J J;  4BXF A;  5F64 A;  2MH9 A;  4MNU A;  4LB6 B;  2W25 A;  3PNV A;  3PFY A;  1WKM A;  1UZC A;  2VOP A;  3FXL A;  4KIB A;  1J7K A;  3HM5 A;  1F9N A;  3M8J A;  3ABT A;  4F7Z A;  1XMA A;  1VFC A;  4DJA A;  2MC3 A;  2UUZ A;  4XOT A;  3I9V 2;  4CXF A;  4BE0 A;  4FQG A;  2H6B A;  1YIJ I;  3JRG A;  3U2R A;  2VKH A;  3CCY A;  2F4I A;  1B1B A;  1HC8 A;  2R7W A;  3EPZ A;  3DEW A;  2VQG A;  2WAE A;  3E1S A;  2XC7 A;  3MZ8 A;  3F8F A;  4ZZD A;  2ZME A;  1RNL A;  2HYF A;  2M8E A;  4ENN A;  1HXD A;  3O6B B;  2X6W A;  1F5T A;  1BJA A;  3NAR A;  3K4C A;  2E2H J;  1E3P A;  2FMY A;  3HPG A;  1MGT A;  3OS2 A;  1EV7 A;  3OYF A;  4EJV A;  3R0J A;  1AHD P;  4IL6 C;  3R4K A;  3D0S A;  1IF1 A;  4QIW N;  1USS A;  2V7F A;  2X0L A;  2QEX I;  2JN6 A;  3BCB A;  2RRE A;  2CYY A;  3GEZ A;  4AUX A;  1XGN A;  4QTR A;  4PUS A;  2HQ5 A;  2WBM A;  1WH5 A;  3K6G A;  1QPM A;  1GT0 C;  3L00 A;  2NAZ A;  4Y33 A;  3CES A;  4M3B A;  3GZ6 A;  1VND A;  5EYR A;  1U0J A;  2FQ3 A;  2DYS H;  5J4V A;  3DBH B;  4A12 A;  2LD5 A;  2DA1 A;  3VWB A;  2PBI A;  3E7L A;  1GXQ A;  4E6K G;  3S14 J;  1Y0U A;  2EIJ H;  2K9M A;  5ICF A;  5M5X J;  3GTG J;  4CHU A;  1QZY A;  2FOK A;  4A3D J;  1BIB A;  3ZQH A;  5EEH A;  1MKM A;  1T0F C;  1XPX A;  3J7A Y;  3CD6 I;  3WE3 A;  3DBR B;  3M1E A;  2ZJP F;  2IEK A;  4CO8 A;  4XLF A;  3BR0 A;  2CJJ A;  5K5Q A;  3F3X A;  2DW4 A;  2X48 A;  3GTQ J;  3IWZ A;  3KZZ A;  2LYC A;  4UUT A;  3SEQ A;  1T33 A;  2P4W A;  1MDM B;  1Y1W J;  2AQF A;  1KYZ A;  2F2E A;  4ANJ A;  3WU0 A;  1FNN A;  2JQ7 A;  3QOP A;  2O6G E;  2X4H A;  4IZZ A;  3OSF A;  3TMO A;  1G3T A;  3I71 A;  3OYM A;  2HWV A;  3OYH A;  2AQE A;  1XG1 A;  1QZZ A;  3GFJ A;  1G59 A;  3PO3 J;  1OYW A;  1ZR2 A;  2M87 A;  4BQO A;  3OMY A;  2MW8 A;  2JUG A;  3OYA A;  1L0O C;  1MJB A;  1XX5 A;  2Y30 A;  2LBF A;  1LB2 A;  4DNC A;  1JKR C;  2CQN A;  2K5C A;  3DXJ F;  1G3Y A;  1FP1 D;  2IAI A;  1U9N A;  3C7J A;  3MN2 A;  4HAM A;  3OL3 A;  5FKM A;  2HZT A;  3S2D J;  2ZXH A;  2R7U A;  3ZP5 A;  1IRX A;  3O8H A;  5GAE J;  2WY8 Q;  3CQZ J;  2L0K A;  3GLX A;  2FD5 A;  2IA1 A;  4HQE A;  2KIU A;  1JGG A;  1P92 A;  1WJ5 A;  1X58 A;  1ZGA A;  1DPU A;  4F52 A;  2FXA A;  2VBX A;  3QPT A;  4NQW B;  2KJB A;  5EG0 A;  3P7N A;  4FX4 A;  3ECO A;  3KP5 A;  3LWF A;  1JE8 A;  2PI0 A;  1W7P B;  4H4K C;  5LRS A;  3M8F A;  3A1Y A;  3IWF A;  2YSR A;  3SDG A;  5E17 F;  1BJZ A;  3CC2 I;  4YFN F;  2VQL A;  1ZAR A;  3HYI A;  1MBG A;  3U9G A;  3OYC A;  3JR9 A;  1T98 A;  3BPX A;  4BS9 A;  4DOZ A;  3JRI A;  3AG2 H;  1ZYR F;  2HTS A;  4BUP A;  4RAG A;  3GTM J;  4Q5S F;  2MC4 A;  2IA0 A;  4M74 A;  1JUS A;  4XM3 A;  5K7F A;  2L7Z A;  2XV4 S;  1K83 J;  2R7V A;  1X3W B;  3G2B A;  3BR1 A;  2BGC A;  2R5Z B;  4YEL A;  4R79 A;  1WHU A;  1LJ9 A;  2RDP A;  1R5H A;  2R7R A;  2XPW A;  3S1M J;  1QO0 D;  1ZHF A;  1KU2 A;  5BOX A;  1D5V A;  3QYB A;  2M4G A;  4HOB A;  1YO5 C;  4V2F A;  1I3A A;  1ZLJ A;  3JCU C;  4WK8 F;  1S3J A;  1J09 A;  4C9Y A;  2K9S A;  1HW1 A;  4M3G A;  5IT3 A;  1VQ5 I;  4ZDP A;  3LQR A;  2K86 A;  3FKJ A;  3O3K A;  3GX4 X;  2FNP A;  4LK1 F;  4M3D A;  4A3C J;  5FB2 A;  1R23 A;  3I4P A;  4UV9 A;  1Q1V A;  2M34 A;  1FMV A;  4ENM A;  1U8R A;  2GOX B;  2M3A A;  1T8I A;  4BHC A;  2LOO A;  4LIT A;  4ESF A;  5E8I A;  4XRS A;  4KIF A;  3BY6 A;  2NS0 A;  1GV5 A;  1O7F A;  4XRS G;  1Z05 A;  1T56 A;  5FRN A;  3BP8 A;  4HX7 A;  5CPR B;  3DPU A;  1EF4 A;  2G7U A;  3NQO A;  5J40 A;  3TED A;  1UAA A;  4PJL A;  1PUE E;  4JYK A;  2KJC A;  1MMD A;  2LRD A;  3F8B A;  4E7J A;  1TWH J;  3SFI A;  4HYE A;  2O61 A;  5D6E A;  4XSX F;  1OMI A;  4ZYD A;  4UHT A;  2G9W A;  2R3S A;  1MDM A;  2CSO A;  2XF5 A;  5AIP A;  2O7O A;  1UB9 A;  2EZL A;  4U87 A;  4EVI A;  1W0U A;  2D2W A;  3BG5 A;  1ETK A;  1P4A A;  1T6S A;  3K2Z A;  5DCM A;  4MQV A;  1OCT C;  2HDC A;  2LH9 A;  4BQN A;  3KE2 A;  3CDL A;  1HW5 A;  3K1N A;  1EKE A;  4AYB N;  1ITY A;  3ZMD A;  2I10 A;  3KX2 A;  4UXN A;  4Y3O A;  5KAI C;  2DOF A;  2PMZ A;  4BGD A;  3G4S I;  5FKK A;  5L3C A;  3CO6 C;  3LSR A;  1D3Y A;  1UFM A;  1EH8 A;  3BQZ A;  1G3W A;  1N25 A;  2JSP A;  1WGX A;  4S04 A;  1BW5 A;  2ZJR F;  3BOQ A;  1V55 H;  2QF7 A;  1YOV B;  4WXD A;  1S7E A;  2BV6 A;  2YX4 A;  1BR1 A;  4XIC A;  3ZOB A;  3ZCO A;  1GVD A;  5CKT A;  1JTY A;  5EGO B;  5BPI A;  3ZQI A;  2VOO A;  5FRM A;  4RLQ A;  4WCG A;  5HLH A;  1NK3 P;  3H36 A;  1LNW A;  1XSV A;  1W7P A;  1J59 A;  1OIS A;  2HNH A;  4AD9 A;  2V9K A;  5M3F J;  4Q47 A;  4XMY A;  3OL4 A;  5E3L A;  4YIR X;  1SAX A;  1PP8 F;  4HNT A;  3O2P E;  3I55 I;  1MBH A;  4HF0 A;  3SDB A;  2IGN A;  5ICC A;  1JKP C;  4II3 A;  1W5T A;  1SVM A;  1BN5 A;  2VBY A;  4OOI A;  3RKQ A;  2CV1 A;  1UHS A;  2BY3 A;  1MNE A;  4PJJ A;  1PDN C;  3VDX A;  2EFP A;  1MJ9 A;  1O3Q A;  5FKL A;  2O8K A;  4L5J A;  3N4M A;  5FKN A;  1RC9 A;  1WFX A;  2DDB A;  4AC0 A;  4D9J A;  4KMF A;  2WC2 A;  3COA C;  2CQX A;  1SMT A;  1SVL A;  2HXO A;  5CVJ A;  2HPI A;  2W1O A;  5IPA A;  2DMP A;  2VT2 A;  2ME6 A;  4UVA A;  2QYO A;  4FIS A;  2X9D A;  3T8R A;  3J80 K;  3MFK A;  5LHI A;  4XOP A;  2CUZ A;  4RAY A;  4CIC A;  4ESB A;  4UVB A;  2QKL B;  4AWX B;  3LA3 A;  2K27 A;  3RDI A;  3OY9 A;  1W1W E;  3VSK A;  1SFX A;  1D1C A;  2ME0 A;  5HLI A;  2NRA C;  2DFI A;  2ZXI A;  2B0L A;  4KMU X;  1HOM A;  2D1H A;  3FHN A;  5EZH A;  2GQQ A;  2VBW A;  2G0E A;  3AAF A;  2P8T A;  1NH3 A;  4N4O B;  1W5C C;  3QYF A;  4C3H J;  2WTE A;  1TNS A;  2Y69 H;  1A5J A;  4BY7 J;  2L7K A;  3V4G A;  2DMQ A;  1YS6 A;  1ULY A;  1YG2 A;  1BC7 C;  2ZNY A;  3Q9V A;  2LY2 A;  1I50 J;  1RUN A;  1ZGJ A;  4E7H A;  3A2K A;  1JUP A;  2UZK A;  4OU0 A;  5EF6 A;  4GYG A;  3PL8 A;  1TBX A;  1SFE A;  2XB5 A;  4I6Z A;  3DKX A;  4PJM A;  4MIM A;  5AON A;  4IVN A;  4BHB A;  1FPQ A;  4C3I J;  2EIL H;  5C3E J;  1I6H J;  3HGG A;  1MND A;  4Q48 A;  4YFX F;  2XRO A;  4QPQ A;  2O8X A;  3JRH A;  3DCF A;  1R4N B;  1SD4 A;  1OLT A;  1E3O C;  2F6C A;  3RYP A;  3GTL J;  2RNG A;  3I3L A;  1HDD C;  2UV1 A;  1MNM C;  2L9S A;  4MEX F;  3S2W A;  3ZR8 X;  3QU6 A;  4ZDO A;  1LDK B;  4X6A J;  5E18 F;  3SJM A;  2A6T A;  4RGX A;  2XPV A;  1ZTR A;  5K5R A;  1HKT A;  1T95 A;  3OYB A;  2FBI A;  1GXP A;  2LG4 A;  4OIQ F;  3HOV J;  5IYC J;  1E0E A;  4IHW A;  1B8I B;  1YRN A;  5J8F A;  2MLG A;  1XC5 A;  1ENH A;  4XKW A;  4CCJ A;  3RIR A;  5FFX A;  1KGS A;  5DUI A;  2GWR A;  4UV8 A;  3DKW A;  4LLN A;  2LF8 A;  2RAE A;  3I4N J;  2VC1 A;  1IAW A;  2H8R A;  3CCE I;  4WXC A;  3GTO J;  3ISP A;  5JHF A;  1LFU P;  3E5Q A;  3HHG A;  4IRG A;  1Z7L A;  4XKC A;  4RGU A;  2XSJ C;  1VI0 A;  2DOA A;  4RMN A;  2GBY A;  3HL2 A;  1FC3 A;  1BW6 A;  1YX5 A;  3BG6 A;  2Y2Z A;  2QQ8 A;  3K4N A;  3I64 A;  4CYC B;  3EYI A;  3TGN A;  1IRF A;  4I7H A;  4YEJ A;  5JR3 A;  4AIK A;  4IHX A;  1TNT A;  5CVI A;  3WGH A;  2IS2 A;  2XAG A;  4PGH A;  3DBL B;  2VLA A;  1S6L A;  1BI3 A;  3N97 A;  1LEA A;  1ON1 A;  2VKV A;  3KYD B;  3CJN A;  2ZCW A;  5KVR A;  2OTJ I;  2Z3Y A;  4XLA A;  4XLE A;  4KIS A;  2WV1 A;  2ZFU A;  2LLK A;  3BG9 A;  1UMQ A;  4ZZL A;  3ZMV A;  2K02 A;  3HBL A;  3KZI C;  5E1W A;  4BE2 A;  2EZK A;  3WTV C;  2XPU A;  5HDN A;  1A31 A;  2ZB9 A;  3S1R J;  3V42 A;  2E71 A;  3FMQ A;  1FBU A;  1Z3Y A;  3DP7 A;  3K4M A;  4IHT A;  2GXA A;  1VQ7 I;  1W36 D;  4XKV A;  2GM4 A;  3E0J B;  5IYB J;  1H89 C;  1KU9 A;  3F9K A;  3HOX J;  2CQ7 A;  1EA3 A;  3LQQ A;  1WI3 A;  1TWA J;  2QM3 A;  2E60 A;  5CVU A;  1K78 A;  3HSF A;  4CCN A;  3ZMT A;  3GLL A;  5LFA A;  4PK4 A;  4MFD A;  4M6V A;  4YIF A;  1JXS A;  1IN5 A;  3CF5 F;  1HDP A;  1ETY A;  1IRZ A;  4RLF A;  4I76 A;  5E8G A;  1ZG1 A;  1QRY A;  4LG0 B;  3RJP A;  2QBY B;  1LDD A;  2AHQ A;  5K1Y A;  2PX9 A;  1MIJ A;  3J80 Z;  3BZ6 A;  3IV5 A;  2ZC2 A;  4KIG A;  3RTR A;  4E7Z A;  5GP9 A;  1IXC A;  1G3S A;  1YHQ I;  3C3W A;  1R00 A;  3GTK J;  4HV6 A;  4B44 A;  1U3E M;  1WJB A;  3F6V A;  2R7X A;  2HI3 A;  5CQG A;  3DV8 A;  2W7N A;  4V2G A;  5LRR A;  4CCM A;  1QQI A;  1RR7 A;  5DUK A;  1C0W A;  3I4M J;  2R92 J;  4P55 A;  3N05 A;  3HEF A;  4JBA A;  1ZK8 A;  2Y48 A;  4I0A A;  2KIF A;  3V8L A;  2FOW A;  3BPV A;  2JK3 A;  4CUG A;  3IP4 B;  4B4C A;  1FBQ A;  2WB1 N;  1E3H A;  2TCT A;  2N8G A;  5HLT A;  3DPT A;  2M0C A;  3I56 I;  1R1T A;  2E5N A;  1XMK A;  3FXU A;  1XTA A;  5GTI C;  4P5O A;  5JLW A;  1MMA A;  4W97 A;  2P81 A;  5D4R A;  3H5R A;  2D5V A;  1F43 A;  5DM7 F;  4IOC F;  3E6B A;  1FZP B;  1HLV A;  2FUG 2;  2OD5 A;  2DK8 A;  1Y8R B;  1DQU A;  2R7S A;  2CWE A;  3FF5 A;  4CYC A;  1K4S A;  1AWC A;  2Y0S N;  2WA0 A;  5ILV A;  4FTH A;  3TQN A;  1TLH B;  3QYE A;  1XCB A;  3CUQ C;  2XF7 A;  3U1K A;  1FWZ A;  3U1D A;  3W3C A;  2VL8 A;  3HKZ A;  3VB2 A;  2VE8 A;  2PJR B;  2HOS A;  4P9U A;  3H3Z A;  2CS3 A;  2VXD A;  4LIV A;  2HS5 A;  2NYX A;  1IO2 A;  2HR3 A;  2KT0 A;  1S8N A;  4J19 A;  4A2U A;  4L9J A;  1N75 A;  4CCK A;  1WQ2 A;  3BR2 A;  4D1Q A;  2GLO A;  2FSW A;  1IUF A;  3T8T A;  2OZ6 A;  4LJZ F;  3CJQ B;  2OPT A;  1JHF A;  2Z9O A;  2M8G X;  1QGP A;  1SMY F;  5HVQ C;  6PAX A;  3K0L A;  1U9O A;  2CW8 A;  3C2B A;  3H9Q A;  5FO5 A;  1BBY A;  4HDU A;  2PLY A;  2KQR A;  2Z33 A;  2F5F A;  4S0H B;  4AVP A;  2EFQ A;  3WG9 A;  1YJ9 I;  3P9C A;  2KIM A;  2JA8 J;  3H0D A;  2RVC A;  3BC8 A;  2O5R A;  4F91 B;  4CDG A;  1ZGW A;  5CQE A;  3R61 A;  4LLL A;  2H1K A;  4BBR J;  5FD5 A;  1A35 A;  2OTL I;  2M45 A;  4HW0 A;  2MFZ A;  3ZN0 A;  1W0T A;  3LSJ A;  3PM1 A;  3H1C A;  2PMH A;  3L1P A;  1DP3 A;  2JMW A;  4FT8 A;  2FU4 A;  5B66 C;  3HOT A;  4XQF A;  5HDK A;  3MAJ A;  3CUO A;  1JJ6 C;  2IRF G;  4PSW A;  3BWG A;  3GME A;  4LGW A;  4D0P A;  1IN4 A;  2QBY A;  2XAF A;  3WU1 B;  3S3O A;  3IH2 A;  3LAP A;  4WX9 A;  3FZV A;  2M30 A;  3H5N A;  4E7S A;  3GW2 A;  3HIF A;  3SQN A;  2FBK A;  4MEY F;  3ZXS A;  2IXS A;  3A01 B;  4HNU A;  3CO7 C;  4JP0 A;  1WH7 A;  3L7W A;  3WTU C;  3CZ6 A;  1VQL I;  1RRJ A;  4BY1 J;  1U6G A;  4ZYG A;  1ONV A;  3RKW A;  1Z6T A;  1ERD A;  3ZQQ A;  2OF7 A;  1IJW C;  3FBI B;  3DLL F;  4B3A A;  1PYV A;  2W00 A;  4BEH B;  3ESW B;  1LVK A;  1RI7 A;  1P7J A;  2K7L A;  1MMN A;  1XGO A;  3ASO H;  3KZY A;  2LY9 A;  1J2X A;  4HA8 A;  3GZ5 A;  1YIT I;  5E3O A;  2V26 A;  3JW4 A;  3OYK A;  5DDG A;  3TL4 X;  3JRD A;  4GDF A;  1S72 I;  1XCV A;  3DPL C;  4Z6Y A;  2K4B A;  5J6X A;  2G7H A;  4MLO A;  1I27 A;  3VYS B;  1R49 A;  3IHU A;  5D8K B;  2BVM A;  2X1C A;  4YFK F;  1T38 A;  1MW7 A;  3CLQ A;  2BXY A;  4ZYA A;  2HDD A;  4HV5 A;  1YW7 A;  1FIA A;  1TWF J;  4EJO A;  2P6S A;  3WHC A;  3GUD A;  2BY1 A;  2VON A;  4B43 A;  1O4X A;  4Y17 A;  3ZN1 A;  2A69 F;  4AVZ A;  2VJJ A;  2JA2 A;  3WTZ A;  3VYT B;  4IPA A;  2QEN A;  1LDJ A;  5BMZ A;  2OAZ A;  3HRM A;  2XAS A;  3BTI A;  3ZQC A;  4KFC A;  3HOW J;  2X51 A;  5CLS A;  5FLX K;  2MBF A;  2HOA A;  3I59 B;  3OV8 A;  4RS8 A;  4U0W A;  4XKB A;  1CQT A;  3F21 A;  4LLG F;  3HB9 A;  3IH3 A;  3BDD A;  3HGY A;  2W4S A;  3OIQ A;  1OCR H;  2CMP A;  3GFM A;  2DTZ A;  4CSW A;  4DGW B;  1MBE A;  2PG4 A;  2YUS A;  2PJR A;  4ON0 A;  5GPA A;  4OIO F;  2JVG A;  2QUF A;  1MSE C;  5EDN A;  3KP7 A;  3Q9S A;  3H3U A;  3ECH A;  1V5E A;  2B9S A;  4CZC A;  2K85 A;  1AA7 A;  4EV0 A;  2Z16 A;  4K2E A;  2A3S A;  3PSF A;  3QOE A;  4DZP A;  1GHC A;  1T0F A;  2L2O A;  2QSH X;  3WU2 C;  3KP4 A;  3O8G A;  4JX4 A;  2DA6 A;  2BXZ A;  5D8L B;  3KP3 A; 
#chains in the Genus database with same CATH homology
 3OSG A;  3RZD J;  1NK3 P;  1MBK A;  5IYD J;  5M3F J;  2VUM J;  5E3L A;  2LVS A;  1SAN A;  3HKZ N;  1MBH A;  2R0Q C;  4A3J J;  1FEX A;  1Y1V J;  5C44 J;  1JKP C;  3FIW A;  3VPR A;  4D5C A;  1JT0 A;  3FK6 A;  1GUU A;  5F0H A;  1OCP A;  3BTC A;  1WPK A;  3RKQ A;  2DA7 A;  1UHS A;  2Y9Z A;  1X2N A;  5J1U A;  4MO7 A;  3OOU A;  3GTJ J;  5F08 A;  5FKL A;  2O8K A;  5K7Z A;  5FKN A;  4AC0 A;  4A3F J;  2CQX A;  2DJN A;  2MG4 A;  2HXO A;  4C2M J;  2TRT A;  2CUF A;  2LR8 A;  1FIP A;  5FJ8 J;  5IPA A;  2DMP A;  2LP0 A;  1AKH A;  2ME6 A;  1FTT A;  3M3Y J;  4FIS A;  2X9D A;  3JRE A;  1BL0 A;  3G1M A;  4UUS B;  3TW6 A;  4A3M J;  4FCY A;  3K2A A;  2L9R A;  1JKO C;  4QSH A;  1X2M A;  3RZO J;  2COB A;  3TW7 A;  5IP6 A;  1ZKG A;  2ME0 A;  1NK2 P;  2ECC A;  3M4O J;  1HOM A;  1A6I A;  5C4J J;  5EZH A;  2B63 J;  2G0E A;  2IBD A;  2CUE A;  5E3M A;  4EEF G;  1U8B A;  4C3H J;  1JKQ C;  4IHV A;  2DA4 A;  1A5J A;  4BY7 J;  2DMQ A;  3ZQL A;  1I50 J;  1APL C;  1MSF C;  1JUP A;  5F04 A;  5EF6 A;  4I6Z A;  2XB5 A;  5EZG A;  1ETV A;  4MIM A;  3ZQF A;  1IG7 A;  5F0F A;  2E19 A;  5FKO A;  4C3I J;  5IP9 J;  5C3E J;  1I6H J;  3HGG A;  1D5Y A;  2JA6 J;  2NOG A;  1IGN A;  3BR5 A;  2K40 A;  3JRH A;  3DCF A;  5GPC A;  2FQ4 A;  1E3O C;  1QPI A;  5E3N A;  1Z77 A;  3GTL J;  1I3Q J;  1HDD C;  1HCR A;  1MNM C;  3UKG A;  9ANT A;  1ORK A;  1QVT A;  3S1Q J;  2R5Y A;  3SJM A;  1GV2 A;  2XPV A;  1ZTR A;  3WHB A;  1JTX A;  1DU0 A;  1RPW A;  3FIS A;  5FLM J;  1PUF B;  3HOV J;  5IYC J;  4IHW A;  1F36 A;  2W48 A;  2NVY J;  2VI6 A;  5J3L A;  1B8I B;  1YRN A;  1XC5 A;  3S15 J;  1ENH A;  2ELK A;  2DA3 A;  3H3V K;  1ETX A;  2LTP A;  2PMZ N;  3BT9 A;  1R9T J;  3Q3S A;  1MH3 A;  4M3E A;  3G1L A;  2RAE A;  2JA5 J;  3I4N J;  3NAU A;  4RDU A;  2FJ1 A;  2M2E A;  4M3F A;  2H8R A;  1JT6 A;  1H88 C;  3GTO J;  2XGE A;  1LFU P;  4A3B J;  2DMT A;  1LE8 B;  4Y7N J;  3QQA A;  3BTL A;  1VI0 A;  4NDL A;  1TWG J;  5DS9 A;  3GBG A;  3LNQ A;  4X1E A;  3BQY A;  4A3E J;  2GBY A;  2K9Q A;  1BW6 A;  2Y2Z A;  3PO2 J;  4A3G J;  3B6C A;  3ZQG A;  3S2H J;  4CYC B;  1TC3 C;  4G12 A;  4FE4 A;  2X6O A;  3JRF A;  5F0C A;  3BR6 A;  3TP3 A;  4D7N A;  3HDD A;  4IHX A;  2QCO A;  1AU7 A;  4GFB A;  2NVT J;  5IOZ A;  2EZH A;  4A3L J;  4XID A;  2CU7 A;  2VKV A;  3QPL A;  1UG2 A;  3JRB A;  3MVP A;  4B1R A;  2R5Z A;  2LKX A;  4DYR A;  2WV1 A;  2DA2 A;  4RBO A;  2JWT A;  3FKI J;  1IDZ A;  2LLK A;  3BG9 A;  1QVU A;  4UUS A;  1UMQ A;  5F1J A;  3H0G J;  3HBL A;  3Q0V A;  5EG0 B;  2EQR A;  1FTZ A;  2E2J J;  2EZK A;  2XPU A;  3A01 A;  5C4X J;  2ZB9 A;  3S1R J;  3QPS A;  1ZR4 A;  5FLV A;  3TP0 A;  3HM5 A;  2O9L A;  2EZI A;  2XSD C;  1VFC A;  3BG3 A;  2GM4 A;  5IYB J;  1H89 C;  3IH4 A;  3HOX J;  4A69 C;  2R93 J;  1MH4 A;  1WI3 A;  1TWA J;  2LFB A;  3JRG A;  2Y9Y A;  2CQQ A;  3CCY A;  4D7M A;  3DEW A;  4MFD A;  1IDY A;  4M6V A;  4A3K J;  5HOD A;  1HDP A;  1ETY A;  2XGD A;  3S16 J;  3NAR A;  1IRZ A;  4I76 A;  2E2H J;  1QRY A;  1SFO J;  2AHQ A;  1ETW A;  3IV5 A;  4DZJ A;  1AHD P;  1ETQ A;  1IV6 A;  4QIW N;  4W1U A;  5GP9 A;  1OJL A;  3B6A A;  4LOC A;  3GTK J;  2JN6 A;  1ETO A;  3Q0W A;  2HI3 A;  4JX5 A;  4BKX A;  1HF0 A;  4AUX A;  4IHY A;  2DMN A;  4QTR A;  3OIO A;  2HQ5 A;  4V2G A;  1WH5 A;  2ID3 A;  1GT0 C;  1RR7 A;  4M3B A;  5IP7 J;  1VND A;  5EYR A;  2LD5 A;  2R7Z J;  3I4M J;  2R92 J;  2DA1 A;  4Y52 J;  3E7L A;  3S14 J;  3HEF A;  1ZK8 A;  5M5X J;  3GTG J;  5DTD A;  5EEA A;  4X6A J;  4A3D J;  5BNG A;  1RES A;  3ZQH A;  1FJL A;  2JK3 A;  4L5E A;  2LK2 A;  2MGQ A;  4FE7 A;  4B4C A;  2WB1 N;  1ZQ3 P;  2EBI A;  2TCT A;  2N8G A;  3LSG A;  1RET A;  1B72 B;  2IEK A;  2M0C A;  4IEJ A;  1G2H A;  3BR0 A;  2CJJ A;  5EGO A;  5JLW A;  2X48 A;  3GTQ J;  4BXX J;  2HXI A;  4UUT A;  3HOY J;  1T33 A;  4W97 A;  2P81 A;  1Y1W J;  2D5V A;  1F43 A;  5M5W J;  2NS8 A;  1LE8 A;  3A03 A;  3G1O A;  1HLV A;  3D1N I;  2L7M P;  3OSF A;  2ID6 A;  3PO3 J;  1XG1 A;  1OFC X;  1ZR2 A;  4CYC A;  2Y0S N;  2MW8 A;  1MBF A;  4A93 J;  1Z0X A;  2Y30 A;  4FTH A;  1U78 A;  3BTJ A;  1JKR C;  2DMU A;  2JJ7 A;  2JA7 J;  2IAI A;  1U9N A;  3MN2 A;  5FKM A;  3S2D J;  1WCM J;  1YRN B;  2HOS A;  1IC8 A;  3O8H A;  3CQZ J;  2L0K A;  3JRA A;  5K7H A;  2FD5 A;  2KT0 A;  1JGG A;  4J19 A;  1X58 A;  2AO9 A;  3BR2 A;  2GLO A;  5EG0 A;  1IUF A;  2NVQ J;  5M5Y J;  5IOY A;  2OPT A;  1K61 A;  2M8G X;  1U9O A;  3C2B A;  4S0H B;  3SDG A;  1BJZ A;  2KDZ A;  1XS9 A;  5J1Y A;  2XRL A;  2JA8 J;  1MBG A;  4XRM A;  2E1O A;  3JR9 A;  1ZGW A;  3HOZ J;  2YU9 J;  2H1K A;  4BBR J;  3JRI A;  3JRC A;  2E2I J;  3LOC A;  4A3I J;  1W0T A;  3GTM J;  3LSJ A;  3PM1 A;  1JUS A;  3L1P A;  5K7F A;  2L7Z A;  1K83 J;  2JMW A;  1H8A C;  2DA5 A;  3K7A J;  3BR1 A;  2NS7 A;  2R5Z B;  1JJ6 C;  4BBS J;  2XPW A;  3S1M J;  3IH2 A;  1AKH B;  3S1N J;  1RKW A;  4V2F A;  3A01 B;  4JP0 A;  1WH7 A;  2K9S A;  4BY1 J;  4M3G A;  1TWC J;  2ECB A;  2YS9 A;  4DYQ A;  1LFB A;  2OF7 A;  1IJW C;  2EH3 A;  4M3D A;  4A3C J;  4B3A A;  1Q1V A;  2M34 A;  1GDT A;  1DU6 A;  4DYC A;  1NTC A;  3A02 A;  1POG A;  3MKL A;  1P7J A;  4XRS A;  3S17 J;  2M9H A;  2LY9 A;  5JLX A;  1GV5 A;  5E3O A;  4XRS G;  2XGC A;  1T56 A;  4D5F A;  3JRD A;  3HOU J;  2WAQ N;  1EF4 A;  3FK7 A;  3CMY A;  4ABZ A;  3F0C A;  2FX0 A;  3TED A;  4C3J J;  4MLO A;  1B72 A;  4JYK A;  1P7I A;  1PUF A;  1MBJ A;  1B8I A;  1TWH J;  3SFI A;  5F27 A;  3RQI A;  2HDD A;  1FIA A;  1TWF J;  3BR3 A;  3WHC A;  2O7O A;  1O4X A;  2EZL A;  1W0U A;  1JUM A;  3BG5 A;  1ETK A;  1JJ8 C;  5J1R A;  5M3M J;  1OCT C;  1RKT A;  3CDL A;  3HOW J;  3BTI A;  3ZQC A;  4AYB N;  1ITY A;  2I10 A;  1VF9 A;  1CQT A;  2HOA A;  2NVX J;  3GTP J;  4HNV A;  2VKE A;  3HB9 A;  5FKK A;  2HOT A;  2CRG A;  3IH3 A;  4XK4 A;  3HGY A;  2L7F P;  1BA5 A;  3LSR A;  3BQZ A;  2K9N A;  2DTZ A;  1MBE A;  1WGX A;  1BW5 A;  2QF7 A;  2YUS A;  4DW6 A;  2MSY A;  5GPA A;  2R5Y B;  1MSE C;  5EDN A;  3LSP A;  1S7E A;  4MFE A;  4XIC A;  3ZOB A;  1GVD A;  2XB0 X;  4DZP A;  2VPR A;  3W6V A;  5EGO B;  1JTY A;  3ZQI A;  3O8G A;  2Y31 A;  4JX4 A;  2DA6 A;  4JX6 A;  3Q0U A;  2DN0 A;  2HYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...