1S9HA

Crystal structure of adeno-associated virus type 2 rep40
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
268
structure length
268
Chain Sequence
b'AGMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rep 40 protein
publication title Crystal Structure of the SF3 Helicase from Adeno-Associated Virus Type 2
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
total genus 72
structure length 268
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1s9hA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9hA02
5JI2E 1XBTA 3ZIAD 4MRPA 4M8NE 2ZI9A 2CVFA 1G291 3W3AA 2P3SA 3K09A 2ORWA 4GZLA 1NY6A 1ESMA 2WSSA 5FTJA 1VKJA 2Q9CA 3TW8B 2C04A 4OQFA 2D06A 1P60A 3R9XA 3DVLA 2YKGA 1KO5A 3REFA 4AY2A 4JT2A 2JLSA 1XTRA 4M1MA 2XTMA 1SQ5A 1ANKA 5EE3A 3MAAC 3B5JA 3CF2A 3VNUA 2O0HA 1CJVC 1E9DA 1YQTA 3EA5A 2XNDD 3PEVA 1CS4C 4YMSA 2Z0MA 1ZRHA 4C0JA 1EWRA 4V02A 5JJLA 4OK3A 1FL9A 1YKSA 3MG9A 2FG5A 3IHLA 3BE4A 3P32A 2YWHA 1P9RA 4LPSA 1G8PA 3IIKA 1DTSA 3ZQJA 1XEXA 1DS6A 2DWOA 4KBGA 4Q9LA 3QBTA 4S2EA 2AXPA 1CKEA 3U44B 4IOKA 3AKYA 3RRZA 3LXRA 521PA 1KNQA 2KI5A 2CJWB 3ZS8A 4LX0A 4UNQA 4MA4A 3VR1A 1XU4A 1MH1A 4PAQA 4QBFA 2EWWA 4OYHA 1M7GA 1M2OB 2WWIA 2V1XA 4LV5B 4ITRC 5LBIA 2JLRA 5CIQA 1HE1C 4XSGA 3VR4A 3TQCA 1FUUA 2LKDA 3U4QA 3OE7A 4QJ5A 3AVWA 1FQKA 2QTVB 1KI9A 1X8LA 1QHYA 5FOXA 3GP8A 1R5BA 1WRBA 4EFMA 4FMCB 4LC1A 2RHDA 3RSOA 2BBSA 2Q3FA 4B2LA 1UBCA 3GLIB 3U61B 1QZXA 1VG8A 1ZM9A 3EPKA 3L0PA 2WM9B 1GVNB 1XTKA 1U94A 4Z8YA 3HYTA 1SXJC 5EZ6B 2FDCA 3CR7A 2DPXA 2ZSAA 4IVRA 3BH7A 5TARA 3GLIE 1E6CA 2HCBA 4QFMA 1ZM7A 4HAUA 3V9PA 3GEEA 2ZI5A 2V9PA 1Z0DA 3OIUA 1NSTA 1G8YA 4I1OA 4DDWA 1UDWA 1AM4D 4QGAA 3A6PC 2ERYA 2VHTA 4TT3D 2RCNA 3CRVA 4QL3A 2AK2A 1VPLA 4DXAA 3THWA 3CW2A 2QAGA 3GJ3A 4UJ3A 1G16A 1UDXA 4A2PA 2ORVA 4UXJA 2NZJA 3CWQA 2GZDA 3AUYA 3ZD7A 3SN6A 3QF7A 3O8CA 2ZRPA 3X1ZA 1N0WA 1ZIPA 4LBYA 3CH5A 3QXCA 2DFLA 4NZYA 2PEZA 1Z22A 5FUVA 3MRSA 2OT3B 2A78A 4BFZA 1T5IA 2ERXA 4XD7D 2ZANA 1XD9A 2GJAA 4LHVA 2XXAB 4JLAA 5FTNA 4QXAA 5EZ5A 2G6BA 4A0GA 4DCUA 2QM7A 4F92B 1Z0IA 1NVUQ 2C5LA 2RGCA 2J41A 4RZXA 4TL8A 3SEAA 4DVGA 5K8IA 2IBMA 2K5UA 1OHHA 2WOOA 3WRXC 2QP3A 1N6RA 3OIYA 4OK6A 4HB4A 4CVNA 2F3TA 3MJRA 1I2DA 3PUYA 1T91A 2FPLA 4LI0A 3CZQA 2R8RA 5DHAA 2ZUDA 4W9MC 3C14C 2GBLC 4B75A 1D9ZA 4V0KA 2ZJ2A 1U98A 2CNWA 2OO7A 2VHJA 4OKSA 4Q19A 3MLEA 721PA 2GJSA 3A36A 2XSZD 3I5XA 3LFUA 2RGBA 2BKUA 5B57C 3U44A 4RFVA 2PL3A 3IIJA 2NQ2C 2O8CB 4PANA 3T12A 1EFCA 3DO6A 4NP6A 2DB3A 2CJWA 2WWXA 4NCHA 1XB2A 3SZRA 1MRNA 3D7MA 5FBRB 1IQPA 4EDHA 1HE8B 1KY3A 1KI1A 3NBZC 4YXWA 5JCZA 4CT4B 4PC6A 4KBFA 2ZJAA 1A82A 1UEJA 4JYCA 1W47A 2OBMA 3TNFA 3SBDA 4ZIRB 3D8BA 5EE1A 5KSPA 1E9EA 2H5EA 2IW3A 1W4RA 4MGIR 1SVMA 4WXRA 1R0YA 3AVVA 3T5GA 4WZ6A 4BGDA 4URUR 3GLIA 1W36B 1J99A 4M53A 1JXMA 2QQ0A 2JJ8A 1G7SA 2J87A 2HUPA 2FGJA 4A0FA 1DPFA 2QQEA 3UK6A 4D6PA 2WWWA 2ZAOA 2ORIA 1G8HA 2FSHA 1FFHA 2I1QA 2ZU6A 1J8YF 2QE7D 3SFVA 4C9BA 4EJSC 2ODEA 2NGRA 2IYYA 3AF4A 4Y0VA 4QBGB 3HP1A 3ECCA 5IF9A 4TLBA 3X2SA 1Q21A 4BE7B 1D9XA 2GTPA 1N5JA 1OFTA 2WIAA 4XVRA 1JBKA 4Q5IA 1NN5A 4US2R 1GP2A 1BIFA 4AG6A 3NDBB 3SQXA 4G5GA 2WVJA 3CR8A 4IEEA 4N0EA 2BJVA 1WP9A 1G20E 5DO9A 2QENA 2XGJA 5F3WB 1P4SA 3LDAA 2ONKA 3NHBA 2ZRAA 1ZM4A 2YC2C 5H68A 1PLLA 2IS6A 2BOVA 5K8LA 4DKXA 3OEEA 2GILA 3Q7PA 1H8EA 5AUPB 2Q9AA 2RMKA 1TUIA 2QT0A 3B9PA 3QPVA 3ZZUA 4YDSA 1S9DA 1OYYA 2CHVA 2AD1A 2XXAA 2HV8A 1F2UB 1L2TA 5AK0A 5C4GB 4IFBA 1DAHA 2BJWA 2ZVQX 1QHNA 4NYMR 4PPGA 3BERA 3CF6R 2WIBA 4PHFA 1NRJB 5CJ2A 4TSFA 4PQRA 4Q4HB 1NLFA 2PZGA 121PA 1ZD9A 4M1KA 2WWHA 2IXEA 2VP4A 1CRPA 1FX0B 2YC4C 3BK7A 3B6EA 2HJGA 1LTQA 3NG1A 1Q3HA 5JWOA 4I81A 1Q1ZA 1KI2A 2ZI3A 5GJVC 1NKTA 4RD2A 1GG2A 1N6LA 4JSTA 4Q03A 5AWFC 2KBFA 2QL6A 4JMPA 4V0NA 1Z6GA 1IY0A 2D74A 3B1ZA 2IK8A 2Z4SA 2NO6A 1N6HA 2ZR0A 4O2RA 4U02A 4C0QC 2QMEA 3VMFA 4DSUA 3VR2A 5IK2A 4LJ4A 4C0AC 1NG1A 2ZXUA 1T4GA 1LW7A 3CX7A 4BLSA 4LYJA 5JEDA 5E95A 3CBQA 4JL5A 2WKQA 2OCAA 2VSFA 3LQRA 4HB0A 1NP6A 3G5UA 2O8CA 3TUZC 3DKPA 2RH5A 2GRJA 3QJYA 4RCZA 5H70A 3JVVA 2QBYB 1GNRA 4D26A 4ESHA 1GNPA 4JIMA 2J9RA 4F93B 4ZCIA 4D4LA 2CK3D 4G0NA 4TYQA 4M9XA 1RYFA 1P9WA 2CLSA 3GFTA 2BM1A 1DE0A 5FR1A 2XNSA 5J40A 4AWXA 4BFUA 3DEFA 3KKQA 2ZJZA 2FFHA 3LW8A 2ATVA 3C7KA 3ND9A 4IOMA 5A5GA 3ADCA 4UNPA 1GTVA 2ZM5A 2DFKB 3A4MA 3ZVMA 3GLGB 1ZUHA 1CTQA 2WJHA 2ZRBA 3K9GA 2FJUA 3K8YA 1P73A 4ZIRA 4LJYA 2YWEA 4JVSB 1QG4A 2VP2A 4PPQA 3WRYC 5FOVA 4Q7JB 4A0RA 5D3QA 2C77A 4EIWA 2VHQA 3GLGE 3ZLJA 4Q9JA 2W0SA 3TUIC 1VTKA 1TF2A 3WMEA 2JLZA 5TVKA 2VIIA 1NMZA 1XCGB 1W48A 3ZDQA 4O2LA 2VA8A 3WNCA 3T61A 4AK9A 1X86B 3L8YA 1F5NA 3KX2A 2WTUA 1YZLA 1QHSA 1XPUA 3QSYA 1Z3IX 2FEOA 3PG5A 5FOUA 1W2GA 5J4LA 2QMHA 1K5GA 4D0LB 3QKSB 1CU1A 5TV2A 4AG5A 3UG6A 4DDVA 2ZI6A 3F5FA 3KKMA 4A2WA 2ZR7A 3WNBA 3KJIA 1II9A 2ZSFA 3FMPB 3UMSA 1ETUA 2WJGA 3QIAA 2NZ8A 1UAAA 3GLFB 4JJKA 4A82A 4BFWA 1GDDA 2NTYC 3RRNA 3RYTC 1Z0AA 1NBMD 4Q1DA 1G9XA 3W6NA 4QGHA 4R71A 5J4VA 3EIHA 3MCAA 2ODNA 3GLFE 1TADA 1NLZA 1UEIA 3QOFA 1JR3D 4YMVA 3QPUA 3MWYW 4LOAA 4PTLA 4OBEA 2WJJA 1P2VA 4OL0A 2IS1A 2IYLD 1KZ7B 3BJIC 2BCGY 3UANA 1TPZA 3Q72A 5FOSA 2ZUCA 1VG1A 5HKKA 1OXSC 1BYUA 2V4ZA 1F2UA 1SHKA 4C2TA 1M6NA 4YMUA 3C5HA 3MGCA 4LC0A 3NHAA 4JL6A 1E9FA 1XEFA 3IO5A 2J0VA 4QJ4A 1CP2A 4Q4HA 4A6XA 3JVUA 1J2JA 4M1WA 3UMRA 4EFLA 2PCLA 4TMKA 2V54A 1FX0A 4GOKA 4B71A 4K8OA 3MWKA 2C98A 5KOYA 3PJRA 1Q3TA 2OAP1 1E99A 2ZS9A 3P20A 2GK6A 1E98A 2OFXA 4C30A 3I72A 1N3BA 4QGGA 2AX4A 3GEIA 2AXNA 1YRAA 3AB3A 2YZ2A 2WKPA 1IAQA 3ZJYA 5EXPA 1JJ7A 1EFTA 2NO0A 3NH6A 4B74A 2FFAA 5KYKA 4NE2A 1TTTA 5LD2B 5HTKA 3IBGA 4YMWA 2JJ2D 3AVPA 1A1VA 1VCOA 2A5GA 3K9HA 2HF9A 1GOTA 3OAAD 1W4AA 3K53A 2HXYA 3R7WB 2FPMA 2ZI7A 3HU2A 1Z08A 2QAGC 2B7CA 5KSOA 1KKLA 2EFEB 4QNMA 2QPOA 1NG9A 1L4UA 2J7PD 1EFUA 3D31A 2OHFA 2W58A 4RFSB 2GDJA 2H92A 1ZMXA 2OCBA 3CH4B 4CYMA 4DSNA 1Q57A 4S35A 1KI3A 4AKGA 4G1UC 2FMXA 1RJ9B 3TJZA 1E1QD 2HT6A 2UKDA 2QBYA 5FFMA 3FE2A 2QGNA 3LRPA 1D2MA 3OFNA 3FWYA 4Q7LA 1XX6A 1LV7A 2HYDA 4LK2A 4BLOA 2YVUA 1OXVA 4JLOA 1KO7A 3FB4A 4FN5A 4IRUB 2AD5A 2VRWA 2ZI4A 3ZS9A 1S4QA 3GLGA 4KJZA 1XDBA 3KB2A 3ICQB 4DLRA 1DELA 2GAAA 3R8CA 4DJTA 1AN0A 4MGKR 1JR6A 4LY6A 4IW3B 4B43A 5BXQC 2JGNA 2UZIR 5EE5B 1BS1A 4L16A 4RY2A 1KAGA 3QI2A 2AKAB 1UBFA 3N2EA 2OSBA 2G77B 2GCOB 3UWKA 4ZKDA 2WWFA 3DL0A 3NDPA 4B3XA 3BH0A 5FPKA 1GM5A 1KOFA 4BFYA 4O3MA 3PUVA 1L8QA 2GEVA 3CPJB 1W5TA 1HYQA 3ZGXA 1UBEA 4DSTA 3Q3JB 3C5CA 4B32A 1N6PA 3GLFA 3TSZA 2W2XA 4TTPA 1E2PA 1S1MA 2BV3A 5JEEA 1GAJA 4Z8XA 1OH7A 1HTWA 4PSVA 3TSWA 4CEJB 4P3YA 5AUNB 3B1YA 1CR4A 2AN9A 3TW4A 4UNRA 5CB8A 1EFRD 1GIAA 1MO4A 5DYGA 1IXSB 1S0UA 1ZC4A 2J1LA 4Q02A 3LD9A 1YU9A 5CJPA 3TVDA 3VR3A 3RRMA 4FWIB 2P0EA 4P4SB 4QRHA 4Z1MA 4LHZA 1YVDA 4OQMA 1RKBA 4URWR 3C15C 1G6OA 3U6KA 1COWA 1SVIA 3AP3A 3N2IA 4JSYA 1E2KA 1SVSA 3NEJA 4FCVA 5EXTA 2MMCA 3DDCA 4ZKEA 3R8FA 2CXXA 4FXPA 1OE0A 2CCJA 3E1SA 2VLIA 4DLZA 1WA5A 3W90A 1P5ZB 3U3JA 1W44A 1ZINA 2QG6A 2W00A 2IC5A 3U6BA 4Q7MB 5D3MB 4PQYA 4RJLA 2JDIA 5CDFE 4G5SA 2YNMA 3MMPA 2MSEB 2WSSD 3FMFA 2XAUA 4IDOA 4L5BA 3VR5A 4DEXA 3GCGA 3K0FB 4NONA 3ADDA 2HXSA 4HI0E 1B23P 1GL7A 4HUTA 3AVUA 3WYAA 2KJQA 1E2LA 4E22A 2TMKA 2VP6A 1W1WA 1NIPA 3KJHA 4TN1A 3R7WA 1E0KA 3GJ5A 1M74A 2C9CA 4F7WA 4TL7A 2B21A 2WBLC 2XITA 4FMDB 3K70D 3TK1A 4LHXA 1S3GA 1H8HA 5FUYA 5C1BA 2WKRA 4PAOA 4RFSA 4DLYA 3T1TA 1KHTA 2IYZA 2VQSA 3T5DA 1Z6TA 4Q1EA 1LFDB 2GXSA 1E69A 1JXOA 1RJ9A 5J5CA 1F6BA 4TQUS 4U7DA 2BCJQ 3DM5A 3O47A 1X6VA 3CF0A 4DUGA 3M4YA 2CLDX 1I4TD 1KTVA 4RZ2A 4KITB 4F4CA 1E2QA 3QEOA 1UKYA 1ZNYA 4X8LA 1M1YE 2G88A 4KLZA 4HLDA 4QC2A 3B8HA 2CLCX 4HYYA 4PSAA 5EXXA 4GOXA 4I99A 1XF9A 3CRQA 4M21A 4QHYA 4XTRA 3WMGA 1G18A 4C0KA 4YC7A 2XZLA 1ELOA 4JT4A 3OE7D 3WNDA 1HV8A 1S2MA 4B48A 1Q44A 2G1JA 2NO7A 2G9NA 3MSXA 4MYHA 4QKQA 3KJGA 2VBCA 4NCNA 1MO3A 1KGDA 2D4HA 2XJ4A 3B78A 3T06B 3PR1A 4LHWA 3IEVA 1BH2A 2Z43A 4Q18A 2I1VB 2GCOA 4EQ6B 5BN5A 1JPJA 3TIFA 5AJVB 1AS3A 2YOFA 4TTQA 4V0ME 3SU8A 5FBVB 2ZUBA 2OILA 2XB4A 4LJAA 1IXZA 4TLCA 2IA5A 1DG1G 1Z2AA 1ZCAA 1EWQA 1Z0KA 4B6FA 1WXQA 5AJYA 4PC3A 1S8FA 2YYZA 2RHMA 3HJNA 2OXCA 3LVRE 3KL4A 1Y3AA 3A1UA 1E2IA 4CEJA 1FTSA 3EASA 1LS6A 3FFAA 3LWNA 4L9SA 4JLNA 2JIZA 2IL1A 1KK0A 1PLKA 4AYWA 5E3HA 5J4HA 3B1VA 4P32A 1VHLA 4Q21A 1R2QA 4P4SA 5P21A 4ASUA 1X8JA 3M1IA 1N5IA 4BZQA 2G3YA 4OI4A 4M1TA 1RE0A 1XJ0A 2R6GA 4J0QA 1QHGA 4P4TA 3KKPA 4GP7A 4GRAA 4MKGA 5DN6A 1VG9B 4TWZA 3NVAA 3O8DA 2P6UA 4YDHB 4BLPA 5E7IA 1U99A 2R9VA 2W6JA 4OHXA 4TQAA 3IIMA 1TQ4A 1VIAA 2NIPA 5CDFA 4NYIQ 4A1FA 1W36C 4BEBA 1E0JA 2NO1A 2R62A 4TLAA 3TSOA 2IYRA 2CHQA 3A1WA 3A1SA 4G5QA 5H1YA 1BO6A 5D3MA 3SYLA 2YHSA 4A0HA 4BEJA 5BW8A 3EX7C 3NWJA 2W83A 4N3NA 1VCIA 1OHHD 4CW7A 2XEXA 2C03A 4FI3C 4MGYR 3K0FA 1UM8A 2QSZA 5FPTA 4B35A 3LH5A 2F55A 2GJ8A 1KDOA 5G41A 4B34A 2ZE5A 5SZKB 3ZQ6A 3LBNA 2GCPA 4BLTA 4D2IA 4ZI3A 3I1FA 4GZMA 2VTKA 4M9ZA 3ZH9B 2EU8A 4DLUA 4LYFA 2AWNA 1UPTA 2CNWD 4D4JA 1T9HA 2LWIA 1WDTA 2OEPA 2Z83A 3EG5A 4KCGA 1IXRC 1Q1QA 3T35A 1TNDA 3BRWD 5FH9A 1PZNA 1Z6AA 3SNHA 3PIRA 4V0OA 1YZNA 1G7CA 3M6AA 1ZC3A 1XTJA 1F48A 3OHMA 3D6TB 1NNEA 1B0UA 2DY1A 2VF8A 1V5WA 3ZVRA 3IPYA 1NI3A 4EUNA 2ZRIA 3LA6A 4XIGS 2XNDA 2XX3A 1XWIA 2PMKA 1IN5A 1NN3A 2MSCB 3L0IB 1IY2A 1G5TA 4YXWD 1E4VA 3EZ7A 2O52A 4YLGA 1XMSA 3HPRA 3FKSA 4LV6A 4R2HA 4KHZA 4B76A 4B3GA 5TY0A 2JLXA 2XJ9A 1CR1A 1KO1A 1ZM2A 1FNNA 3ADBA 1W0JA 4MKFA 4JLBA 4V0MA 621PA 1WCV1 4IVPA 3RSLA 1Z07A 4EQ6A 1C1YA 3KDSE 4Q9KA 3R9WA 3E70C 2VH5R 4DDUA 2QU8A 3U7FB 1XEWY 3CPEA 1AKYA 3W9YA 2BBOA 221PA 3FPAA 4KODA 3GPLA 1QRAA 3ZVNA 1F3OA 1P2UA 2FA9A 3O8BA 3KJEA 2PJZA 3GJ8A 4OQLA 2F1IA 2ZRHA 5L3QB 2Q3MA 3RNLA 1KDPA 1Z06A 2CCGA 2JJ1A 4A6PA 4TYWA 1N2CE 4Z51A 1NVWQ 1M8PA 5HZHA 4G5OA 3CRW1 5KTYA 1G5RA 1L7VC 1E9AA 1H65A 2CE2X 1EFHA 2XTZA 4B3BA 4HLCA 4R2IA 2VHUA 2ZROA 4JVLA 1QVAA 3EA0A 4RD3A 5BYKA 3NBXX 2H8KA 2WWYA 1II8B 3LBHA 3ETLA 1AKEA 2ZIAA 3B60A 1HQCA 1BMFA 3AKCA 3OEED 3RC3A 5E7MA 4BASA 2PX0A 5L3VA 1H8ED 2PT7A 5HCIA 2PX3A 1LNZA 4BFXA 4EAQA 3SI7A 1S1CA 2ZRJA 4V03A 4NYJQ 1XTQA 4GBMA 2AWOA 4NMMA 2X19A 2IXGA 3MWJA 4ZDKA 2EYUA 4TT3A 4A92A 1KY2A 3OF5A 2B92A 5JBQA 1A7JA 2SHKA 1JEEA 2OFOA 3K0AB 2XOKA 2KBEA 4JBWA 4ACBA 2HYIC 1E96A 4C7OB 1NKSA 3EC1A 1OXXK 5A4JA 3PEUA 4E09A 4TL9A 4D0GA 2QN6A 4CDGA 4FINA 4HAZA 1MABB 3EPHA 4FMCF 4GSYA 3V4FA 3EARA 1PV4A 5FBWB 1CEEA 1E94E 2ZREA 1XNJA 4I1VA 3B9QA 2JLUA 1FNMA 3N70A 2Q3HA 5EP4A 3ZZTA 4DZZA 5IT5A 4DWJA 3PVSA 4M1OA 1KK3A 2BMDA 4AYTA 4IXMA 3RWOA 4Q00A 3K0SA 3Q9LA 5TDHA 1RZ3A 2F3RA 4O25A 2QMOA 1G3QA 3H84A 2Q0HA 5IRCD 3L0OA 4LHYA 4WXPA 5IK2D 1D8TA 2PCJA 5KPJA 3SOPA 2O8BB 3ONWA 1XCMA 1XMJA 3SQWA 3LV8A 2O8EB 5KDDA 3BH6A 3FGNA 2EFCB 1GWNA 1NF3A 2FE4A 1DAFA 2ZS7A 4UQOA 2QTFA 4OK5A 4ZPXA 2EVWX 3VHLB 4HLUC 5HE8A 4K46A 2WPDA 1U81A 2FZLA 4QHTA 2Q9BA 4PXAA 2RB4A 1SZPA 2GWHA 2WZQA 2J45A 4IDPA 4UJ5A 1IN6A 3MD0A 2V6IA 1E79A 4DSOA 3A4LA 1W0KD 4MITA 5FL7D 1TF7A 4JLMA 3ASZA 4XWKA 2FFBA 1IM2A 2IS4A 1Z5ZA 1BYIA 4MRSA 2DHRA 2V1UA 3FDIA 1C4OA 1E1RD 2I3BA 3GJ7A 3R20A 3SE0A 4JS0A 2XB2A 2HEIA 2OE2A 3VAAA 2ZYTX 4ABYA 4WOPA 5LD2C 1R5OA 2GNOA 1OXUA 3KQHA 2O8FB 1E2NA 3AVYA 1SKYB 1CXZA 3EZ6A 1E2HA 3AVQA 4ZO4A 3OEHD 1CR2A 4DDTA 2BC9A 3UXMA 5L3QA 2V7QA 4URYR 1SKYE 1SXJD 5DI9A 3U3OA 1G64A 1U8YA 2OESA 4MYUA 4NYJR 2WOJA 4DC9A 4CIDA 1TQDA 4Q48A 2P6RA 2B6HA 5DE3A 3KKOA 3A8TA 4X8MA 5F2EA 3TR0A 2O8DB 1G4AE 1G5PA 2VP5A 1II8A 3A58B 3Q85A 1KJWA 1G19A 3KFXA 4DB2A 4C2UA 4KFUA 1AS0A 2QE7A 5DYIA 2D3WA 2WAYA 4B2PA 2AKYA 2A3RA 1KI6B 2NO9A 2FNAA 3FKQA 4IVQA 1CJUC 1AK2A 4RSGA 5HE9A 5JECA 3KQNA 1R8SA 2QUZA 4IFEA 4UXIA 2WJVA 5HKKD 1WB9A 1DAGA 1JB1A 2FH5B 1JI0A 5CIWA 5LDDC 2IHBA 3LQQA 2RAPA 1G21E 2R65A 1VHTA 2W6ID 2WMNB 3QE0A 2JEOA 3CUEF 1TU4A 4PC1A 1XD8A 3K0AA 3TGPA 2REXB 2F9MA 4C7OA 1TF5A 5L3RA 2QNRA 4ARZB 4U5XA 2GESA 1Q0UA 2OCYC 4LPKA 3AQ4A 1YZTA 4PHTA 1NBME 5KDLA 3VTKA 3IDQA 1U2RA 1MABA 1SVKA 2R6CA 2IYQA 8OHMA 3LX8A 2J3EA 5EUMA 1ZYUA 2O0JA 3AVOA 4IXNA 1XTIA 1ZAKA 5FTKA 1KK2A 2B8WA 3CB4A 1OT3A 4KU4A 5JRJA 2LKCA 3B82A 1RRFA 2DYKA 4ZDWA 2EQBA 1IOZA 2GEUA 421PA 5KNCA 3BBPA 4PO9A 4CF7A 4OHWA 2D2FA 2JLVA 1DVRA 4DLXA 4D4MA 1FTNA 4RZUA 1Q20A 4F4IA 4JLVA 2L0XA 1Z8FA 1US8B 3FVQA 4HAWA 5FBQB 2O8BA 5AJXA 2J5XA 2KSQA 3B13B 3S1AB 3NXSA 1SVLA 2RGDA 2PLRA 3VHXA 2EFGA 2R2AA 3VQTA 4BRUA 2O8EA 1E9BA 1P6XA 1RW4A 1T3HA 2JLWA 4A2QA 3BIFA 2JAQA 2BWJA 3BFKA 4A9AA 4TMWA 3OFND 3THYB 3PITA 3PV0A 1O3YA 4E07A 3QPWA 3U60B 2P65A 2C9OA 1QHHB 3PFIA 1IN7A 4ESVA 4MUAA 5AJWA 1OV4A 1RRPA 1ONBA 1ZUIA 5KNDA 1HH4A 2GZAA 4E5UA 1FW6A 4JLKA 3QG5A 4DIDA 1EG7A 4OHVA 1G1MA 2XTNA 4JLJA 2AFHE 2ZAMA 1G7TA 3I61A 3THXB 2GJ9A 3GJ0A 4WAUA 1KK1A 3NC0C 3G82C 3OESA 1EXMA 1U0JA 1KDRA 3W3ZB 1GFIA 1KO8A 2OZEA 2O8FA 1DEKA 1Z6YA 3L2OB 3QXJA 4HUQB 3SJBA 4H1VA 5AUQA 3AF0A 3IQXA 1N6NA 3I5YA 1E3MA 3IPXA 4DT1B 3Q8XB 4DB4A 1OKKA 4TMTA 2DWQA 4BZXA 4HDOB 3VX4A 3U7HB 3DMDA 3FHTA 4DRZA 2H16A 1W7AA 1A2KC 1KNXA 1Z83A 3KQLA 4PC2A 2CL7X 2GJKA 1KJYA 2QZ4A 4YMTA 3DOFA 3RS3A 4MDFA 3RDPA 2O8DA 1T3LA 5FBLB 1JNYA 1IJFA 1CIPA 4ZCMA 5TMPA 4NHOA 3SYNA 2ZYWX 3B85A 3IKJA 4FMBB 5FOTA 2CDNA 2F1RA 4B47A 1CJTC 2GA8A 2ZTSA 4FIDA 4F38A 4DLVA 5BWMA 5CITA 2VP0A 1KI7A 4RD6A 1QF9A 4OQNA 1KI6A 3KQUA 4Z1MD 2WJIA 1AZSC 5KNBA 2VPPA 3C16C 3QKRB 4QG7A 4TTRA 5CYPA 3GMTA 1KAOA 1NBMA 3BFXA 4WA7A 4I4LA 5LB4A 1SULA 1Q22A 4OJQA 4B73A 1OLOA 1IN4A 4ARZA 2D62A 1RC8A 4ERNA 3SFZA 5EQTA 821PA 1KKMA 2AR7A 3QXSA 2ZEJA 5G3ZA 1W2HA 2PJRA 2MMGA 2ZSBA 4BRWA 3EZ9A 4XOIA 1AGRA 2NPFA 1OFUX 3RAPR 1YZKA 2YWFA 2G83A 2ZRCA 4R7ZA 1ZNXA 4NBSA 5GJWC 4EPXA 1NVXQ 2IEYA 1NVVQ 4IOLA 2J0UB 3F3YA 1FOEB 4NTZA 2CBZA 1OFHA 1D6JA 1DO0A 1T6NA 1HT2E 2OBLA 1E9RA 2X1VA 1RRGA 2GETA 4L4UA 2ONJA 4D4KA 1CR0A 1E9SA 1LS1A 1CF4A 2A5YB 1T8UA 1US8A 2VHCA 3Q5DA 4Q7KA 4W5WA 1RVDA 1G7RA 2PBRA 4B3FX 1XZQA 4Q4JB 1OW3B 4WIAA 3S1AA 2KB0A 1HQYE 4EPWA 5JJKA 1K5DA 3PQCA 4LSGA 3MJHA 4KI0A 1A2BA 1EGAA 2J59A 1N25A 3TE6A 4U00A 2BEKA 3BS4A 1G17A 4BFVA 1E2GA 4TMVA 4DUGD 2ZJBA 3M0EA 2DWPA 1OXTA 2QORA 3THYA 4IEIA 4Q01A 4W5HA 5BYJA 2P67A 2JJ2A 1QHHA 1PUIA 2AL7A 4D25A 4M9QA 1D5CA 1SVOA 4RD1A 3P27A 2BKEA 2JLQA 3QKTA 5EP3A 1G3UA 2I4IA 2BM0A 1KSGA 1E2FA 4POAA 4EFNA 3JZMA 3LLMA 3A1TA 2E9SA 5EUQB 1NSFA 2PLFA 2CEAA 2J7PA 3SYKA 4DCVA 1J70A 1GKUB 4HLUA 1JAIA 4TMZA 3VNVA 4NL4H 3WP1B 4C0LA 1XRJA 2QAJA 3KTAB 3KXKA 1OYWA 1R8QA 1EX7A 3LBIA 3TRFA 3RHFA 3THXA 4M1SA 4W5JA 3OIWA 3ADKA 3P4YA 4BQSA 3L8ZA 5ELXA 4DIEA 2QP9X 5KO2A 3AP2A 1Q12A 3U3KA 4GP6A 2R6DA 4JZKA 4OQXA 5JS7A 3I32A 2PZFA 3CRRA 5FR2A 4EKDA 4HUQA 2A5DA 5B64A 2QGZA 3U5ZB 3HPQA 2FSFA 3W34A 1QDEA 2N46A 4DT1A 2AK3A 2YV5A 3AVXA 1KJZA 4LJ7A 4MH0R 1VDZA 5KSYA 2OXRA 3LLUA 4D80A 4B3CA 2ZJOA 3J81k 1ZU4A 1UF9A 3IQWA 4IKEA 4P4UA 4XWAA 3AGPA 5E4FA 4P31A 4ACAA 2CHGA 1G3IA 3QUSA 2IYSA 1FMLA 1OSNA 1Z0JA 2JIZD 2WWGA 2HLDA 4Q1BA 3FYHA 3K0EA 4IOJA 4HAXA 1KZGB 4RD4A 2RGAA 5CLLA 3GLHB 4PR0A 3ZD6A 4K81B 2IWHA 2V8OA 3U3MA 2RGXA 3IGFA 4GNKA 1R4AA 3QKRA 1XFAA 5DN6D 2J7KA 5C4MA 4CRWB 2ZR9A 5JWRA 3AKEA 3GLHE 3T34A 4D81A 2W6JD 3W8RA 2GZHA 3EIEA 1SGWA 3GJ6A 4HDQB 4LJ9A 4R9UC 5HZKA 1VIYA 1R5NA 2BBTA 3LXXA 5GVRA 2YJTD 3QEJA 4PHHA 1U0HC 2B7BA 5BQ5A 1TL7C 1A5TA 2VSXA 1GKYA 3AUXA 2GEDA 3B2EA 3DKVA 4N1AA 4TZ6A 3NKVA 3RWMB 2EFHB 2N42A 3NBFA 2ANCA 2IX3A 1U8AA 1BKDR 1S3SA 2Q21A 4US0R 3FTQA 1NN0A 1OIXA 4IJMA 4X8HA 5DSZA 2FX3A 1Z2CA 2IUUA 2F1HA 3KQKA 2J0UA 1T3SA 2OFWA 4WBSA 1G6HA 2REOA 1R10A 3X1DA 2QRZA 5DI3B 1R6BX 1CJKC 2OUKA 2PZEA 3T1QA 2CL0X 5L3SB 4Q4JA 3SR0A 4LDJA 4ON9A 4Q4LA 3QXHA 3RS5A 2XZOA 4GMDA 1P3JA 5FOWA 1VECA 1LF5A 1TEXA 1Z29A 3CPHA 1IN8A 1HURA 2J46A 2IT1A 3QKUA 3AM1A 1G3MA 1P61B 1QVRA 3RABA 3EPLA 4B6EA 4C0SA 2ZE6A 2QPAA 3FHOA 1AGPA 4Q9HA 1HT1E 4CT5A 4OJKA 2PEYA 3NTUA 4HSEA 2RGEA 2F9LA 5CM8B 4HDCA 2H17A 4DCNA 4AI6A 2W2TA 3T1OA 5EE0A 2ZRNA 2VO1A 1X3SA 4LWZA 2PMDA 2W2VA 3WP0A 4GOJA 4BLRA 2ZRFA 3B7GA 3FKSD 2BMJA 1MR3F 3K9LA 4HAYA 4JLDA 3ICEA 1JECA 2AHOA 3KTAA 2ZYUX 4QGFA 1CRQA 3FMOB 3NIBA 4PQFA 2C2HA 2C96A 5LB2A 1RFLA 4HB3A 2F1JA 2QRNA 2GAOA 1GUAA 1W0JD 2ZRMA 2OG2A 3RS7A 3UWOA 1T5LA 4MKIA 2FN4A 4KYUA 3FOZA 5DGXA 5DISB 3CNOA 1II0A 3GJ4A 1OH5A 1DAEA 1P72A 4KYIB 2REBA 4P33A 2MSDB 1TQ2A 3AV0B 3G0HA 3SHFA 2WAXA 4B3DA 3BAFA 2IXFA 4HAVA 2JJ1D 4GL2A 4MRVA 3ZIAA 2QY9A 4H9GA 4FMDF 2QP4A 3DHWC 4A8JB 1XJCA 2HJVA 4EPRA 1U90A 5KU1A 3V4RA 1U9IA 1LVGA 1ZU5A 4Q66C 4XVQA 3RC8A 4WZAE 4PPNA 2X77A 4FWTA 3RS2A 2IS2A 3D3QA 1AZTA 2G0TA 2ODWA 1IJEA 1LY1A 3OIVA 3T1VA 2QTHA 1N6IA 4MGZR 5C46F 4LJ8A 1N6KA 4MRRA 1BMFD 1RYHA 1OF1A 3X1YA 2E87A 3QY0A 3GLHA 1VCMA 4OI2A 3CNLA 1OIWA 2C95A 3EZFA 4M22A 2GXAA 3ZYCA 3EW9A 4F4JA 1WBDA 2ZJ8A 4NDZA 4DLWA 4Q4AB 3SC3A 3GFOA 3LAWA 4BZPA 4PAMA 3VX3A 3BOSA 1W5SA 2ZRLA 5DNYB 1HA3A 3MFYA 4A36A 2XOKD 2KWIA 4IDQA 4KAXA 1CULC 2ZETA 5E7JA 1OH8A 4LCBA 3ZZ0A 2B8TA 1TU3A 2C8VA 3EC2A 3CNNA 3EWAA 3P1JA 1GSIA 3V00A 4KV9A 4AKIA 2DBYA 4XVUA 3KXLA 1RIFA 5DLQC 3F8TA 4URXR 4II7A 1NMYA 1TQ6A 2X2FA 2GXQA 4HZIA 2FSIA 4NCKA 5G3YA 3X1WA 4B2IA 5JHGB 1CJMA 1JQJC 1KI8A 3NEYA 1ZW6A 5FUXA 3I3SR 3L43A 4BUJA 3W6PA 1ZD1A 3WHLA 2ZQ5A 2LCFA 4AD8A 1QHXA 1JQLB 1FMJA 2ODBA 3CO5A 1ESNA 3N5CA 1E0SA 5DI3A 4XWOA 1OB2A 1KMHB 3UMFA 3DM9B 3W6OA 4TYPA 5L3SA 1ZP6A 1GRRA 1S96A 1V43A 1XP8A 2JLYA 4NCIA 3RS4A 5JFGA 1ZVQA 2NPIA 4MYTA 4QM7A 2A2ZA 5G53C 4XTCS 3TBKA 3BWDD 5FPHA 2E1RA 1T8TA 2GF0A 1ZBDA 1GL6A 2IEZA 4WW0A 3RLFA 2WJYA 1G8FA 3NBYC 1GL9B 1KI4A 2FOLA 4NYIR 4DCSA 1AQYA 4NYMQ 1FPMA 4URZR 2G0NA 3IUYA 3WYGA 2QMUA 2WICA 1T0JB 5FUWA 3U3RA 4W7SA 5EJEA 2OBNA 1Z0FA 2WPDD 1TAGA 4GT1A 4JVNA 1HUQA 2FGKA 3IBYA 4RKFA 3TVTA 5F9HA 1KSFX 5JSZB 1E79D 4GFDA 1MO6A 1F60A 4LJ5A 1E32A 1HEIA 4M9SA 1XPOA 1DAIA 1DADA 4OI1A 3HDTA 4TSFD 2DCUA 4ZCLA 1DAKA 1JJVA 4GDFA 3BXZA 2VSOA 3AVTA 3AP1A 4RVCA 5DIFA 3WYFA 3R9IA 1KSJA 1LB1B 1W4BA 2BIFA 3AEZA 3REGA 3WBKA 5K8TA 3QF4B 3EPJA 4ZI2A 4DHEA 2EFDB 4KFTA 1VYTA 1DARA 4XD7A 1W49A 2GHIA 4AC9A 2BDTA 3W8NA 2G1KA 1GKIA 1E2EA 3WXMA 5GJCA 2RGNA 2BMEA 2V7QD 2FWRA 1G8GA 2ECKA 3QQ5A 4XSHA 1XCPA 5J4YA 5SZHB 1YR8A 5HPYB 4A8JA 5BN3A 4Q9IA 3Q5EA 3H1TA 3TKLA 3KXIA 1AJEA 2VP9A 4AKEA 3IILA 4TLDA 4DLSA 4RCYA 1ZUNB 2VL7A 3BD9A 4TL6A 5FTLA 4OHYA 3VKGA 3PCRB 3TAUA 3U7GA 1YZGA 1OPXA 2FFQA 2Y8EA 4FCTA 1YZQA 4I1SA 4PHGA 2ZITA 3EZ2A 4UNNA 1UKZA 2KE5A 4D0NA 3KUCA 1QHIA 4LBWA 3UKDA 3SJCA 1PVOA 1ODFA 5CK4A 4H1UA 3TLXA 2GK7A 2IHYA 1G41A 3UPUA 4N0DA 1SXJB 3BB3A 1FP6A 3E5HA 4PX9A 3PXGA 1P7CA 4Q4AA 4OI0A 4NH0A 2ZYVX 2EW1A 4PO8A 1WMSA 1L4YA 4NPHA 5LPNA 1E4YA 2XSZA 2YOGA 3VR6A 4AURA 1SXJE 1YR7A 4Z54A 3CZPA 2YINC 4FW9A 4D82A 4CZ2A 4AYXA 2R44A 1RPZA 2GVDC 3HR8A 1XTSA 3E2IA 5CM9C 3L82B 4C3ZA 3LX5A 3PENA 2N1BA 2FV8A 4LBVA 4FCWA 5IHPA 4BLQA 5J4KA 5JZVA 2GXUA 4QBIA 1S9HA 5SZJA 1W36D 4PZZA 1DOAA 4UXHA 2FPKA 3GFPA 5EXSA 1QBKC 2D7DA 5AR1A 1A4RA 1NN1A 1OH6A 2H57A 2QROA 2GKSA 3K0CA 2HF8A 2OM2A 4L15A 4MRNA 1FP7A 1R0WA 1KMHA 3QG1A 2CCKA 1ZM3A 1SHZA 1OJLA 2IF0A 1FUKA 5JWHA 1CBUA 1YZUA 2ZPTX 4WVFA 4PPFA 4LYAA 1WQ1R 3IHWA 3MUFA 4RKEA 1UADA 4KVGA 3FMIA 1ZIOA 5A0FA 3NC1C 1AS2A 1XXHB 4X8OA 5B58C 1JAHA 2QM8A 2HT1A 4LUCA 4PC7A 3GJXC 1CLUA 1N0UA 4MQBA 5JS8A 3NH9A 3CIOA 2FU5C 4KO8A 2FZ4A 1XXHE 2F6RA 2BMFA 1XMVA 1EX6A 3L0SA 3PUWA 5SZIA 2R6AA 3I73A 1LF0A 2CVHA 2JASA 5TB5A 5JSZA 1P9NA 1GNQA 2CMKA 2OLJA 2H7VA 4M2LA 2V6JA 4HLQB 3PEYA 1OFIA 1K8RA 4M1YA 4ZDJA 1YE8A 3B1WA 1XMIA 5HCNA 5AUOB 5CK5A 2ZJ5A 2PT5A 2IUSA 4JVMA 1UFQA 1GRQA 2A9KA 1E2DA 4Q1FA 1SKQA 4QBHA 3AH8A 4IDHA 4LZZA 3UG7A 1GILA 2ASEA 2V3CC 4OHZA 5J47A 4LBZA 1VYVA 4A4DA 4DCTA 1JR3E 2BBWA 3ASYA 3HWSA 3QF4A 2FF7A 2NMVA 2IYUA 3QVUA 2QPTA 3K9NA 4LYHA 4DEYA 2DR3A 2C78A 2IWRA 1G4UR 2QSYA 1W0KA 1YR9A 5FL7A 1I2MA 3QVVA 4G5RA 5KHOC 1OKKD 5FPYA 1DO2A 2IYTA 4QJ3A 3K09C 2ZJYA 4LV8B 2ZU0C 3U2QA 4B33A 1DBSA 1NL3A 2HCJB 1WE2A 1E1RA 1YR6A 5HR5A 2DFTA 2H1LA 3BB1A 1DAMA 1N5KA 4NCJA 4IDNA 5G40A 5DHFA 4GPTA 2HDNB 5CLQA 5AJZA 1NLYA 1D2NA 4F91B 4NU0A 3AF1A 5CB6A 1E9CA 3B1XA 3BFVA 5B2ZA 1KSHA 1U8ZA 1YHNA 4CGZA 2OCPA 3AGQA 4EPVA 5GJBA 1BOFA 4JJZA 1YJ5A 3OEHA 3WY9A 2GCNA 2F43B 3K70C 2YOHA 1SXJA 5EP1A 2WSMA 3X1XA 4QM6A 3CX6A 4RD0A 4XH9B 1D2EA 4JBYA 2J0QA 3MWLA 3HU1A 4EJSB 4Q1CA 1M7BA 3RANA 1M34E 1KIMA 4EPYA 4LRWA 4CEIB 1J8MF 3F0TA 3QENA 3I62A 3H86A 1E2JA 2RGGA 2C99A 4JYBA 4ILEA 2CK3A 1IY1A 4LJ6A 5JI3E 3W5IA 1X1RA 3RRYA 2ZVPX 4KVAA 1Z47A 5FI0B 1K6MA 2CL6X 4YONB 2QA5A 4US1R 4EPTA 1MT0A 2IYXA 2QEQA 3I92A 3SS8A 1KDTA 3OZXA 3TUJC 5B30A 1N6OA 1ZJ6A 2W6IA 2Z6VA 1J90A 3C8UA 5IDVA 3BC1A 2A7QA 3UATA 4I1UA 3JZAA 5FL3A 1G3RA 1U9IC 4UNSA 5L8VA 3LVQE 3PUZA 4JL8A 3ND8A 1F2TB 2ZRGA 3FHCB 2H18A 3A4NA 2NG1A 3I8SA 2ZE8A 2QI9C 1WBBA 4A15A 2XZPA 3THOA 2ZRKA 1XXHA 4PO1A 2O0KA 1O87A 5F9FA 4O0MA 4QOSA 5JLJA 3BORA 2P5TB 5M04A 2DFNA 3K1JA 1NJGA 2ZSEA 4KXFB 4KLNA 2C9YA 1JALA 4KFRA 3CX8A 1XD2B 3GQBA 1J7KA 1GRNA 2BVNA 2FEMA 5JJIA 1ZD8A 2WV9A 3VU9B 4B44A 4V0LA 1TMKA 5KPDA 4BFTA 4TYNA 3I4LA 4M4SA 3DMNA 2J0SA 1COWD 2GBLA 4WZBE 1WF3A 3EAQA 4TMXA 3SDZA 2P5SA 2GF9A 4HB2A 2D2EA 2VYFA 1X8KA 4C0BA 1OB5A 5CYOA 1MO5A 4CEHB 1P75A 3T15A 4BPBA 1N0VC 1HY3A 1JR3A 1AIPA 2BHRA 4P0TA 3SJZA 2UVQA 2W0MA 4Q1AA 3WMFA 1JEDA 4HZUB 1PUJA 2X2EA 3HU3A 4IHQA 2JDID 1Q1BA 2JCSA 3W5JA 4MDEA 1UKVY 5FPSA 3DOEA 3QNUA 5BN4A 2JA1A 2ZE7A 2ZS8A 4BFSA 1ZNZA 3LY5A 4KSBA 2BEJA 2O5VA 4KSCA 1TUEA 2OLKA 1TX4B 4MKHA 4M0LA 3AF3A 2A5JA 2A5FA 1MKYA 4E03A 3A1VA 2Q6TA 3H2YA 5H8WA 3BGWA 3CM0A 5TXGA 1OIVA 2ANBA 1MRSA 3EWSA 3HYRA 5GADl 2D7CA 5UKDA 3HR7A 1ZCBA 3EXAA 5JMTA 5KSZA 1H8HD 1NY5A 1X1SA 2X8AA 3CONA 2ZSDA 2GVZC 4QHSA 1SVWA 2A30A 2P6NA 4DBLC 4JKIA 1EK0A 2HLDD 3TR5A 3CLVA 2IF2A 3DZDA 3QKSA 3TH5A 3P4XA 4BECA 1Z6XA 1XEWX 1EESA 2QT1A 2ZRDA 2F43A 4G3XA 3PEWA 4HATA 3KUDA 3WHKA 2Z4RA 4L9WA 4TLEA 3OAAA 1MOZA 1FZQA 1JPNA 3IEUA 4FD2A 1XZPA 3SBEA 1NIJA 4TYYA 2JATA 1UJ2A 4R98A 4EJSA 3WBJA 3GD7A 3DPUA 1NJFA 4AIIA 3QXXA 5FI1B 3K70B 1VMAA 4RZ3A 5C2JB 4CEIA 3VKHA 2AFIE 1Q1EA 4Y0AA 1XEXB 2WMOB 4GI7A 1UKEA 1E1QA 1KMQA 1QG2A 2IUTA 1U0LA 3KKNA 3QBVA 1P2TA 2V55B 4PFSA 3KZ1E 4MYCA 5KDOA 1PLJA 4UKDA 4AKHA 2RGNC 2RKOA 2YWGA 4Q47A 3FFBA 2EWVA 3H4MA 1DG3A 2OV2A 2EYQA 1M7HA 1VG0B 6Q21A 3BB4A 3VFDA 4A8JC 3O8RA 1R0XA 2Z5FA 3ZVLA 3VKWA 3U4QB 1TEVA 1F2TA 1GZSA 2IYWA 3I8XA 4JBXA 1P62B 1W46A 3U7EB 4G01B 4L8GA 5EE9A 3A37A 4PSKA 1VYUA 1E0AA 1C9KA 3C4JA 2OAQ1 1XPRA 1MV5A 3RVBA 1XD2A 2WHXA 1YRBA 1Z28A 4XJXA 1I4LD 4ZDIA 3GEHA 4TZ0A 3LNCA 4ASUD 1IBRA 1NMXA 3SJAA 3VU9A 3CWZA 3LW7A 3TAHA 1AA9A 3C41J 4DLTA 5ANRB 5F98A 4LGMA 4YQFA 2NOAA 2P2LA 3AKDA 1GITA 1R0ZA 1AQUA 2VF7A 5FTMA 3TMKA 2VEDA 1NVVR 3EIQA 1ZNWA 4JKYA 1W4CA 5EP2A 1IONA 4URVR 1I4DD 4CEHA 5GVSA 3THWB 3RS0A 2QAGB 3LO5A 4GMXA 1EFRA 5C18A 4ZV4A 3CRMA 4QNRA 2ATXA 3IO3A 1E2MA 1VCNA 1XJQA 4JLPA 1PJRA 4C4PA 1P2SA 2PH1A 4PZYA 3DZ8A 5JHHB 5DH9A 4HZUA 3TQFA 5JRZA 3SHWA 4C0HA 2FSGA 3Q7QA 2R6FA 5JCPA 2UZ3A 3AF2A 1RRCA 3K0CC 3KFVA 1KO4A 1N5LA 3P26A 4BWYA 1Z63A 1R7RA 1Y63A 4NKRA 4HEJA 4TQ9A 3PUXA 1IHUA 1T0HB 3UIEA 3H0KA 4KFSA 2IYVA 5KUTA 1FQJA 4PZLA 3CKLA 2F7SA 1KYIA 2CE7A 3KB1A 5K8UA 1UBGA 4MUBA
chains in the Genus database with same CATH superfamily
4M9UA 5BWLA 4MV9A 5EA2A 3H8SA 1RM3A 3EDPA 1E7RA 2EW2A 3VUEA 1JIVA 3NRBA 3EEBA 5HKLA 2YKGA 3OQ6A 3EZGA 1L7NA 2A14A 4MLOA 1D09A 1WJCA 1Z37A 4WXDA 4U7JA 3DLTA 3GLUA 3BE4A 1XTBA 1LSOA 3U7QA 1I24A 4HJXA 3TZHA 1UWKA 3AKYA 3RRZA 3LXRA 3ZS8A 5AOVA 4H18A 3UHFA 5B3KA 4FYWA 3S16J 4OYHA 5HRCA 4MVJP 1VRWA 4HDSA 3K20A 2LKDA 3P52A 5ESRA 3H8WA 2N9UA 1A5SB 4ETMA 4P1ZA 4DGWB 3RJTA 2FFJA 5IY5H 4QX6A 3J7ZI 4OXRA 3EEOA 1F0NA 4J0GA 4YJ2A 2RCNA 4JYKA 1IPHA 3KSUA 3THWA 1AN9A 3H2IA 4LOJA 1LDMA 4ENPA 3BXFA 3I9MA 4LBYA 2O2HA 5K3AA 5K5EA 4M88A 4DGQA 3JYPA 1Z0ZA 4MNUA 4HV6A 2G6BA 1NUSA 5AONA 1Z0IA 2C7GA 2FOIA 4ENWA 5K8IA 2K5UA 1C7JA 2QP3A 3TW8A 4CVNA 1GTL1 1WKMA 2P6TA 4LFUA 1GD1O 2FU4A 1H05A 2NVBA 3WDSA 2AOVA 3Q10A 1BHO1 2HPAA 3U44A 1MG5A 1WPQA 4NP6A 4DR7B 2MYNA 1L5WA 2AB0A 1BFDA 1C5KA 3DHNA 1KAEA 3IMEA 3NBZC 4YXWA 1LDEA 4CT4B 4EA7A 2ZJAA 3PFGA 3KQVA 1A1SA 3SBDA 1TTPB 3BYZA 4BE0A 5KSPA 4B84A 1FTGA 1BKYA 1J99A 1EQAA 5I7HA 2HUPA 3VZCA 2GCEA 2AEJA 1FFHA 2ODEA 2ZXIA 2EP7A 3X2SA 1VPVA 4LVNA 1PK7A 1GADO 4QUDA 3NBKA 2XZDA 1VF9A 2WVJA 3CR8A 3DOUA 5DO9A 2PUGA 1G20E 1WDKA 4CL8A 4C4XA 2ONKA 1XFDA 2PGAA 3NHPA 3JQFA 2PMWB 3AR5A 2PZAA 1WLSA 2WHYA 1QHNA 4KVZA 1I39A 4TYMA 2RHCA 1K3UB 4PHFA 3OM8A 1PP4A 4LG3A 2IXEA 1SG9A 2Q8QA 1CRPA 3CMCO 3IBFA 2CUZA 5HNHA 1JGTA 1SHJA 1PBNA 1QZ3A 1Y5RA 4Z86A 3NEPX 1M9NA 1SUBA 4FXOA 2X9DA 4O2RA 2ZR0A 2P2DA 5JY6A 2XT6A 2RI1A 1Q0HA 3BC8A 1GG8A 1U5TA 4XB2A 2GHQA 2OCAA 3QWLA 5H70A 4ZCIA 4I99C 4G0NA 2NZUG 5J40A 4AWXA 1KYXA 4JU8A 1GTVA 1H2FA 5JY1A 4DIOA 2CJPA 2H0RA 4WEQA 4ZTFA 4ZYVA 1BGWA 3HJFA 5JD6A 2D4AA 2QN3A 1NVBA 1WVIA 4XM1A 2WTUA 2O7SA 1XPUA 2BTOA 4OLAA 4AG5A 3ZP5A 3K10A 1NYQA 1M6WA 4A82A 3G2QA 1BAPA 1CV2A 5J4VA 2R7QA 4K9MA 2L01A 5AM4A 1UEIA 3JPYA 5DNEA 4FZ3A 3RIHA 3DD5A 3ZHCA 4K2HA 1JG6A 2XF8A 3H6GA 4YJFA 2OQGA 3H3UA 3KP3A 3L4SO 4YMUA 4R3WA 1TK2A 2J0VA 4Q4HA 3UQZA 1NM5A 5JOQA 1E99A 3LCVB 1OCOH 4C30A 3AUSA 1XVVA 1SKAA 1YJ8A 3ZJYA 3G0GA 3WZLA 4B74A 4MJ7A 5KYKA 3A27A 3G6WA 5JBIA 4CNQA 3HVKA 4RFSB 5AHRA 1K89A 1RJ9B 2HSGA 4YCLA 1FDSA 2CBXA 1RAFA 2YY7A 4D3SA 2OQIA 3RVOA 2I71A 4GR9A 1OXVA 1LVAA 4G5HA 3NBUA 1KDYA 3DBLA 1X70A 3HDVA 3JSOA 4MX8A 4IW3B 3VO9A 1C1XB 3EDYA 3D5TA 4NC7A 5ALQA 3NAGA 4FETA 5LA6B 2DMQA 3UWKA 3FFWA 4ABTA 4LJKA 4HYTA 3K4KA 5K6RA 4PK4A 4KAFA 3N2LA 1W5TA 3ZGXA 3DDHA 1JQAA 2DPUA 3EVTA 2B36A 2G08A 3VFZA 1RQPA 4HV4A 4P3YA 4J2OA 3EIOA 4UNRA 4OIOF 1MO4A 3Q6IA 2R8ZA 2AEMA 2DA7A 4FWIB 3ZWVA 3BILA 3KSBC 1JKXA 4OIPF 2OK7A 1NNUA 2V96A 4E15A 1RPWA 3R8FA 1A8IA 3R41A 4ECAA 1CDOA 4WGGA 3RI3A 3PHIA 2YNMA 1MIJA 3HBJA 3BN3A 4CQMD 4L5BA 2ICWG 3GCGA 4ZWNA 5T6MA 2O1WA 1IIBA 5B1YA 1SCKA 3DZCA 1ONVA 1CUUA 4MWEA 3LPNA 3INRA 3FNIA 2R7AA 4J1TA 3RWBA 3UTCA 2NTJA 1KHTA 4MPRA 1E69A 2J9XB 1E3HA 2G9QA 2Y4NA 4IMRA 2IHUA 3BG9A 3R7DA 4KITB 2E1PA 4F4CA 2FFRA 1M1YE 2NU7A 4HLDA 4XYMA 1AGYA 2CLCX 2KIUA 4J19A 2I0FA 1G18A 4PNPA 3F0CA 5A2QK 3HGYA 2V4UA 4MCIA 2I1VB 2J33A 1RBYA 4MUKA 3H1CA 2VIXA 5DLPA 3ENWA 1VKNA 1Q5PA 4I02A 3CUTA 5F04A 1TA0A 2H7XA 1GCIA 5D7NA 3SICE 1VMKA 1U4SA 1E2IA 2ZKLA 4NXMB 4YRFA 3AHCA 4D3DA 5J4HA 1YB5A 2ADMA 3B1VA 3ECHA 2V5VA 2E60A 4C87A 3ETNA 3R09A 4WDQA 4M3BA 2WWVD 1DINA 4U7WA 4GRAA 4TMYA 5E1OA 5B1AH 2H2FA 4OHXA 1C0PA 4DIKA 2OP1A 2NIPA 1Z16A 1KJ8A 4Q12A 2YHSA 1RIIA 2R7MA 2Y30A 3ENZA 2QN7A 2HL6A 1PJCA 2ZE5A 1E92A 4GZMA 2FMKA 5JASA 2IQIA 3VJRA 1QH9A 4MR9A 5KTPA 5AVXA 1J8FA 3BRWD 4N0QA 3MZ0A 1ZY2A 2ZT7A 1V5WA 5REQA 5I6DA 3WQRA 3LT5A 2GBGA 3NHMA 4FFWA 1IN5A 5AVVA 1OAOC 3TGLA 1FDOA 5AK3A 5B4VA 1FSHA 3CNBA 3QU3A 1FNNA 3C3PA 3LPDA 4WACA 2HRRA 1QCYA 1V3VA 1P5HA 3R9WA 2J3QA 5D8KB 3CPEA 3J7AC 2JQ7A 3UW3A 1XROA 4KR6A 3MIZA 3R6LA 4Z51A 1WY5A 4AZ3A 3QMVA 4LMAA 3ILHA 1BSVA 2ID9A 1QVAA 1THZA 3KYJB 1P0PA 4JP1A 8MHTA 3LO8A 2IELA 1Q1AA 3L9XA 3NVMB 4P55A 1NVKA 4AZ0A 2H4HA 1XTQA 4D4GA 2R7ZJ 4GR4A 2JKVA 5D2CA 2IP2A 4MQUA 4QT0A 1TAQA 3B9QA 2VUSA 2IPNA 1UP7A 2FRVA 1RCFA 4ZVPA 2TRTA 1ECLA 1QCZA 2D0OB 5HDGA 3QVSA 4P54A 4R5HA 2XTAA 3NNSA 3Q6NA 3SC4A 2XUPA 2XNHA 1U3TA 5BR7A 4LWOA 3DF7A 1TF7A 1P0FA 1P33A 2IS4A 4MRSA 1KEUA 3R20A 5L3ZA 3PDCA 1T13A 3UC9A 4X3CA 1R5OA 3EOZA 4DZJA 1JE8A 4D9KA 1RXIA 5HQ3A 3CCCA 1G64A 1H6DA 3OJOA 2R8BA 4QUJA 4X8MA 4WD3A 4CV3A 2VP5A 4NAVA 1KKUA 1SWWA 2WV1A 2WAYA 1KI6B 5IJZA 4BYGA 4UD2A 2HYGD 4RSGA 1WB9A 2V5AA 2IHBA 3QV2A 2MR5A 4EHIA 2HQNA 1AY0A 1JEAA 4LPKA 1YZTA 4PX5A 5F7JA 8OHMA 1VQ1A 1PT7A 2HLHA 1S02A 4KU4A 2DYKA 2D2FA 2R5YB 1EGMB 4URFA 3TPCA 4M3EA 3SFTA 4BRUA 3A4TA 3T9DA 3BIFA 4A2QA 2JAQA 3AT1A 3MD2A 3OFND 2GTIA 4ZYXA 4ESVA 2NADA 4WN3A 2O8XA 3AETB 4ZH4F 1D0YA 4E5UA 3E58A 4I6GA 1G1MA 1W9HA 2GJ9A 3HRKA 3G82C 4BAGA 4P1WA 3EH2A 3L46A 1A76A 2OZEA 2XB8A 1O0SA 4FGKA 4Z3OA 3NTXA 3U48A 1E20A 3ZNPA 3MPOA 1SELA 1KNXA 5TGDA 2E49A 2ZIXA 4LOHA 4MB2A 3EFOB 3TRIA 4B47A 3G8BA 2X51A 1WABA 2XCOA 3M2TA 3AL3A 3IAM2 4TTRA 4ZQBA 4TTTS 4WA7A 1Y3HA 2YCLA 1H4TA 1K97A 2FE1A 6ABPA 1C14A 4G7OF 3V2HA 2IDZA 1N8SA 3I9LA 2Z2JA 3ZMVA 3BJZA 3LU1A 5D8LB 2SKDA 4H0EA 1NVVQ 2J0UB 1DO0A 4WLUA 2VXZA 5C4JJ 4ZYYA 4JUIA 4Q7KA 5DOVA 4QTUB 1XZQA 1EH5A 2O54A 3BCRA 4U2EA 2NO5A 1A2BA 5EWJB 4A3FJ 2DFVA 3FNQA 4PZ0A 3ITNA 1XTZA 1E2GA 3FNHA 2EBIA 4ZQFA 3W5UA 1IK4A 3JYLA 4Q01A 1HW5A 5E2AA 1JLLB 5G1OA 3SYKA 4F2PA 3BJ6A 1J39A 1XRJA 1W6UA 5CDHA 1LW6E 5FO5A 3JVDA 1T5TA 3LI2A 2IGTA 1F8FA 2X1CA 5KO2A 1D1TA 1J4AA 1S2IA 1J23A 4C4AA 2Y9ZA 4GP6A 5MFZA 4O4IA 3G8YA 5KVCA 2BE5F 4EKDA 4GFBA 3G13A 4O4HA 4BQOA 4LJ7A 5C8YA 3CQZJ 4L72A 2Z30A 1RJDA 4H3SA 4TKZA 4ZD6A 1UF9A 5HDKA 3HNOA 1XN4A 2AH5A 4IVNA 3EHDA 5GOTA 4QXMA 4LJLA 2GYYA 2WWGA 4I19A 2PXAA 4IICA 3IXMA 3WTVC 1PWYE 1IGNA 2DVMA 1WHSB 1MB2A 2XMRA 4PR0A 4M7PA 1R4AA 1CIJA 4B8WA 1RLTA 1AU9A 4D81A 2WHEA 2EJTA 1GV5A 4MGRA 3DUFB 1XALA 1GXPA 2HIGA 1A5TA 2FY8A 3B2EA 3FPHA 1BN5A 3RI4A 2NNWB 5TMBA 1OIXA 5B4UA 3F7TA 4UVDA 3N97A 4K6GA 2REOA 4HYEA 4Y1FA 3CDIA 2M6RA 1GFSA 4WN9B 1YB2A 3C7JA 3L2VA 3RSFA 1JQEA 4CR6A 3RKWA 4XGRA 5FOWA 1IBSA 1TEXA 1IN8A 3WGMA 4JHXA 5IANA 2L7MP 2R25B 2IOYA 2ZIZA 2PSHA 1KOLA 2F9LA 2MYUA 2RK4A 3INNA 1Y8RA 1RAHA 2W2VA 5L4NA 3GFRA 3C2HA 1Y37A 3BWGA 2CNBA 3HKBB 3Q0UA 2R6JA 3QMMA 2WFLA 2F1JA 5AIAA 2ZRMA 3FKIJ 4MKIA 1MU0A 4EGAA 4X1KB 5M29A 2QVCA 3SPXA 3G49A 8LDHA 3G0HA 4MB6A 4IPTA 3RSNA 1LFUP 3GCZA 4NENB 1U90A 3VDXA 3TLKA 4NNOA 1DOZA 3ANSA 3OIVA 1I1QB 4Y6PA 5AYVA 4CIXA 3BMQB 2AXEA 1RYHA 2E87A 2VK4A 4F4JA 4Q3OA 3W8EA 1RHUA 3LAWA 4BZPA 1JTEA 4CM6A 1V1RB 3DWIA 2HK9A 2HOQA 3NDIA 3A05A 3EC2A 1GR0A 4JUDX 3UKOA 1GSIA 3OKCA 1NMYA 1SRRA 3RT1A 2IZ0A 1WEKA 1HYHA 3BHMA 1ZD1A 2ZQ5A 4EL0A 2Q29A 5FLEX 1JQLB 4XIDA 3N2KB 3FHJA 1VFCA 1JF8A 3KTDA 2XCLA 4MYTA 3M1CA 2C3YA 4CBVA 4MKXA 4MCJA 2PAAA 3TINA 4IZOA 1DTWB 2WJYA 4NYMQ 3OJFA 1WCIA 1QKKA 4GLBA 1RMTA 1TAGA 1JH9A 2FGKA 5F9HA 3D7SA 3I5AA 5IVDA 1TCAA 4DNOA 1YULA 3HVRA 5CB0A 1AQLA 4RA6A 2VWHA 4LHEA 4JELA 1I0IA 2QF7A 3R60A 3PYMA 2VKEA 4I5GA 2HYFA 3W4JA 3L4JA 4OUDB 4XSHA 4DCJA 3HSEA 5BW6B 3TKLA 1PI3A 2VP9A 4RCYA 3KZCA 3B3JA 3U81A 1P92A 2PEXA 1BQ4A 3NW9A 4F06A 1XYYA 4CUKA 4CIWA 3KR0A 3ZHRA 4AIHA 4ALIA 2XT0A 1HSOA 1YK1A 5H83A 3VPGA 4NH0A 4F46A 3ETDA 3L82B 3G2NA 1ENZA 1R4MA 3AB8A 3FETA 3HMQA 4BU2A 1F3LA 3AL0C 4L15A 5JNTA 1FP7A 4MWZA 4BO0A 4RDCA 5ETJA 3DTTA 5JWHA 2HSZA 4PPFA 5JANA 4R0NA 1LNSA 2A1TS 3NC1C 4KQJA 1FSPA 3EZNA 5HFAA 1QNTA 1MN6A 2F6RA 5EMJA 2I8LA 4MR8B 1NK2P 3NETA 2QJWA 4UTPA 3V34A 2H7VA 2VN8A 3P0FA 4TLLB 3V8JA 1UFQA 3DGEC 2A9KA 3ZC3A 5J47A 3I0TA 3TWOA 4K0RA 2VRCA 4OYLA 2CSXA 2NXWA 4HEA2 5FLKA 4G5RA 4DBQA 1TA9A 4B3IA 4X6YA 2DLLA 4Z7OB 1DBSA 1WXDA 1YR6A 2F5EA 1DAMA 3I2YX 3LQYA 4NCJA 4IDNA 4M83A 3C7DB 3BGIA 5G40A 4GPTA 3H7AA 5DKFA 5AJZA 1VQNI 3GEBA 1PT8A 1VJTA 3ZWDA 4RKQA 2FHSA 2F43B 4A6EA 5EP1A 4QM6A 4ZAGA 3HU1A 2CXOA 3OTOB 4AN4A 1HNXB 5AH0A 3AI2A 4P5OA 1YQUA 2HSDA 4EYGA 3A04A 1VI5A 3WGHA 1NURA 2CF5A 1ZKMA 3I05A 3QRWA 1ZRFA 3L7CA 3LP5A 1X1RA 3RRYA 4BV8A 3IUPA 1Z47A 1K6MA 2QA5A 3ZY2A 1QYDA 3S2IA 3GHYA 4BXOA 3F9IA 4UE3S 3GGDA 2H63A 3BY6A 2JB9A 1R4NB 2IOFK 2PLAA 4FQ5A 4AIJA 2FEMA 3EXHC 5LLSA 3MS4A 1USSA 5KPDA 5TGZA 1WPGA 2JGIA 4WSOA 1QZEA 1HNZB 1MH9A 4ZTUB 1FLVA 3DMNA 2GBLA 1Y3FE 3A9CA 2F59A 4A26A 4B1FA 3RPUA 2GN0A 4R6WA 1VLLA 1B9MA 4B9AA 3HB4X 4NZOA 4C4OA 1LD3A 4ARUA 3ANTA 1ZNZA 3LY5A 4KSBA 3S44A 3PXEA 2WG1A 1S8NA 4FWBA 1R1VA 2E19A 1MKYA 9LDBA 1XTPA 1OIVA 5ILSA 1E5TA 3BT9A 2QGUA 3HYRA 2D7CA 3WZMA 4ZT3A 4OHFA 1QKJA 2I65A 3Q11A 4K28A 4EG1A 1NU8A 2FXAA 4RMGA 1XAHA 2ZRDA 3E3LA 4JBLA 4RKRA 3JQQA 2B9EA 3OFVA 5FGMA 2OBBA 1IRZA 4YCBA 4GWLA 4BL0B 4KK4A 4XIIA 1PLJA 3VYTB 4UKDA 4JI3B 3EXG1 1RAIA 1RADA 2ZJQF 2H85A 2XUAA 4RGXA 3F72A 1FVHA 4G37A 2ZNZA 3ZHQA 4I3FA 5LQJA 4NDAA 4RHEA 1C9KA 4W5NA 4TWJA 1XPRA 1D0ZA 3QFRA 3GP5A 5EGNA 1NMXA 4ZZIA 1AA9A 3C41J 5F98A 3LKZA 1D6NA 4JBNA 4LGMA 4YQFA 4CCNA 5LEKA 3E6DA 5CA1A 4XK4A 4X5OA 1UFKA 2R47A 3N0WA 5M7EA 2ME6A 4PZYA 2ALJA 5DH9A 4YQYA 1CDDA 5I9BA 1CZKA 1TMYA 3W7BA 3H0KA 1R74A 3O4FA 2I80A 4RIHA 1KA9H 1IWPB 1YQXA 5BSUA 4C4SA 3ELBA 2G4CA 4Q3DA 3K09A 4GZLA 4ZMRA 3EUHA 2C04A 4WI1A 1ZCFA 4XB1A 2P6PA 1E9DA 4C0JA 1EIWA 2YU3A 4V02A 1PFGA 2NU6B 3FY4A 3CIFA 1E58A 4X97A 3ICWA 3NHYA 3QBTA 2O23A 2OD2A 2W2LA 2EA2A 2DA4A 3G5MA 1QU2A 5LP6A 4QTTB 5IAAA 2XUJA 3TN7A 4N6OA 1GNTA 3SSMA 2YJ6A 3ZCTA 3KP7A 4JMLA 3D3WB 2AOUA 3TAXA 2GN1A 2MSYA 1VG8A 4H7HA 2UXDB 3L0PA 5CA0A 4MTCA 3STVA 2PYDA 4Y6SA 3GLIE 4O2AA 4QFMA 2F8LA 3TDMA 1ZG3A 1Z5NA 3CRVA 4AFNA 3AUKA 4G97A 4WOBA 5LYYA 3UK2A 2ZW9A 2LKXA 1QLWA 4WKPA 1M8GA 3JYHA 3KWFA 5F0HA 1ZIPA 4ZVOA 3QXCA 2IRFG 4LE2A 1EZ1A 4BMPB 3UFBA 3FRJA 1XPJA 3E3MA 2V5UA 3A02A 2IBMA 2WOOA 4NZMA 3ET5A 3OIYA 2PMEA 1T91A 3CZQA 5FNZA 5I8ZA 1AF4A 5LR6A 1Y81A 1QR2A 3D59A 5K6TA 4KA4A 4WV3A 1BS9A 3FW1A 3H17A 2VJ4A 3ZN0A 3AFNA 2VC2B 1H5QA 1FY2A 1BXZA 3G0OA 2WWXA 4A8HA 5D87A 2XPWA 2R00C 3ENKA 4J0FA 1E5DA 1WY7A 3E9RA 5DX0A 4HGRA 4WDRA 1RWKA 4HGYA 1V45E 4MGIR 5ERIA 2W48A 4U0JA 1PX2A 2PXCA 4AZVA 2DYSH 5KTSA 3K4HA 4NBNA 1LDYA 1NP3A 3H1PA 3ERMA 2NGRA 3L0ZA 4PCAA 1ZNQO 1K2VN 2V58A 3GEDA 5A1JA 5LQKA 3ZGOA 4NZ9A 1IVSA 4YNBA 4X66B 2G4LA 4IH1A 4A3JJ 3RD5A 2KRFA 2KJBA 2PG3A 2XXAA 1I30A 3FK7A 5AK0A 1AO0A 3AEQA 3H92A 2JFNA 5BUZA 4DIUA 4ZP1A 3KKKA 1T1RA 4ZV9A 2QZ8A 3IT0A 1NOIA 1CNEA 2FWBA 5DS9A 2HLNA 2V1DA 4CFSA 1L6IA 1JTVA 2XECA 3UWMA 3M8EA 2XMGA 2FPIA 4CMHA 3KEOA 1NG1A 1PD1A 3ZE9A 4LYJA 2X6XA 2IVMA 5D5VB 1W30A 2Q2EB 5U4XA 1SOVA 4JOMA 1EU1A 1R1TA 4TYQA 2YMLA 1OPRA 1TLFA 4XUEA 5NULA 4BE4A 4A23A 3W4IA 3GTPJ 5FOVA 2Q8KA 2AGVA 2Z2YA 2FQ4A 3CCMI 1WWKA 2XRNA 3LC1O 3T61A 4Y15A 2P7IA 1PUFB 3A6KA 1L4MA 1T2CA 5BNZA 2JRLA 3AEUB 3VNBA 4K3VA 2P6MA 3KP2A 3PXCX 2O3SA 3EG9B 4JJKA 2HRCA 2IU0A 3ONFA 3JQ8B 5DGHA 1IZYA 5E1XA 4D8VA 2KIMA 5EYRA 2HI0A 3OC6A 4IUBS 5EGSA 2Q1UA 1TQPA 4I9NA 4ZI7B 2H6EA 4TPKA 2R7NA 4XDHA 2QTTA 1XGSA 1J2JA 4M1WA 4D44A 1JKRC 1WUKS 4ZRMA 2WFZA 4JITA 5DEQA 3LZCA 1J8DA 3U21A 1IC6A 1V4NA 2C2YA 2YRFA 4IHJF 4XCQA 4HKTA 3HCBA 2PS3A 4N4NB 4HEA6 4RTOA 5FBKA 1XNRB 4LXHA 2FYTA 1UJ5A 4RHTA 4PLPA 3C70A 3HPGA 5HDQA 3OO1A 4EAAA 3S6JA 1Z4IA 3FE2A 1U7TA 1XAGA 2Y1DA 2AG1A 1W73A 1DHRA 2O7VA 1LWOA 2JAUA 4FX2A 1PKEA 1IZ0A 3OKFA 4Z3DA 2ECQA 1NXOA 4MGKR 4S1VA 3QOEA 5BRJA 1BS1A 2WA1A 4EFKA 2G67A 3TXXA 1MZPA 5DCYA 5FPKA 4BFYA 2P9FA 1QRDA 2O14A 2IOHA 3K30A 2KRCA 4UUSB 3CCLI 1JUPA 4RHYA 2RNGA 2JVHA 4Q02A 1JPUA 4QQNA 1DP7P 3S2FA 1GHCA 1BTOA 1DV2A 4ENSA 2HADA 2SKCA 2WWTA 4R01A 2FUNB 1WA5A 1N8KA 1FYWA 1GTSA 4Z0PA 4Q7MB 1KEEB 5HF9A 4HUTA 3KLMX 2CL5A 1NIPA 5EJMA 4KPYA 1L4EA 3M2PA 3D6VA 1YITI 2H1KA 4FMDB 2J3KA 4ESBA 2NVTJ 1YKFA 3NWPA 5BV7A 1F6BA 4TQUS 3JQFC 4PM4A 3N3AC 1H6CA 4YDRA 4MYSA 1I4TD 3BM5A 2ATIA 1IJWC 2OAZA 2CT8A 1HSTA 4FEAA 3QVKA 4BNKA 2G88A 4GOXA 3EDCA 2SCUB 2JI8A 1PFUA 3LUJA 2Y27A 4RENA 4FSDA 4U0VA 2G9NA 5K99A 3CWCA 3GLQA 3PI6A 3H3FA 2GOMA 1JZSA 1I9CA 3PUIA 4R5MA 1JR4A 5HK9A 1Z91A 2H5JA 1Z2AA 4XX0A 4YCNA 3ESDA 3IT2A 5IG2A 1J5PA 3E2PA 3DOHA 5IN5A 5EMKA 4FFNA 2G3YA 3H7IA 2KISA 1WVGA 3O4IA 1UKCA 3PP8A 1LEHA 2QXTA 4CLXA 3JAKB 1IV8A 3FIWA 1W36C 4A1FA 3DBHB 1B2RA 2B3TA 3R4CA 2J48A 3A1SA 2HCRA 1SUIA 2X6QA 3CLUD 2QSZA 5FPTA 4YCSA 4D2IA 3W6KB 2VTKA 4MO9A 3FTDA 1T9HA 2OEPA 3AUFA 1TNDA 4OLHA 3NM5A 1G7CA 5FKKA 1FU8A 2Z3YA 3FI0A 2CVZA 1Y1SA 2DY1A 4BACA 4FHFA 3ED1A 2ZIGA 1GVJA 2ZRIA 1PEDA 3EAFA 4DQXA 2XNDA 3IVMA 3ZJUA 3HPRA 4WA8A 1TO6A 5KCZA 4WBNA 4E7JA 2MYTA 3KUUA 4EI9A 3ADBA 1THTA 5FJ8J 4KGVA 3EZLA 2YR2A 5CFMA 2ENWA 2RI0A 3BREA 1Q83A 1RMYA 2BFDA 5DK6A 4TLMB 4A6PA 4B8ZA 3BXEA 1WNTA 3HUGB 3KLBA 4G4JA 1PYVA 4KLRA 2EZKA 3HCDA 2H8KA 4PG4A 4CCAA 1Y0UA 1H8ED 2PX3A 1LNZA 1K6OA 4C1BA 5GP1A 3MCVA 1BI3A 1U5AA 2ZRJA 4V03A 3RCOA 4JFAA 3UOWA 2QN6A 4TUYB 2C61A 3B89A 5E3IA 1N0IA 1XNJA 1SAXA 3PPIA 3EE6A 2DOEA 4M1OA 4EJUA 1X2MA 4EY6A 4IXMA 3MJSA 2FR8C 2XYVA 5EINA 4LVUA 2GFHA 5IC6A 3A2MA 4IHXA 1ZSNA 1NYRA 5KDDA 1NF3A 1JGSA 2FW6A 1ORKA 1MIOA 2CFRA 3EH1A 3LTNC 4H0FA 1J1IA 5E4TA 2A84A 2ZCJA 3CLSC 1VPTA 1XI2A 2I3BA 3SE0A 2HEIA 1Y5MA 3K2QA 5ICFA 2AVDA 3MWDB 1X1BA 2I8DA 1SKYE 1BVYF 1QO0A 4NYJR 3OHSX 2I2CA 4NEGA 1LU9A 3D6HA 1CQPA 2RAFA 1KJWA 1P9QC 1YL7A 2RHRA 1Y98A 4RTPA 4IVQA 5HUQA 1AK2A 3P2KA 1R8SA 3WQBA 1JB1A 4DXHA 2C97A 4E1AA 1LI4A 4CSWA 1BW9B 2GESA 5JCXA 4WBXC 2X48A 1R0RE 3VTKA 2DT6A 2IYQA 3ITKA 3W9UA 1ZCJA 1ZYUA 4IXNA 5HMLA 1ZAKA 3TBIA 3IALA 2LRDA 3RVRA 3HXOA 3I9V1 3FVQA 4AVZA 4ARBA 2ZB3A 2JG3A 3GTKJ 3S1AB 1P7PA 3ZTWA 3R1IA 3WB0A 1G59A 1JUDA 3O4VA 1AF7A 4E07A 1UPUA 4J1SA 4JEUA 1ZUIA 1AHIA 2W82A 5FULA 4GSKA 3GJQA 1KDRA 4FGSA 5HJ5A 2CNLA 1G2PA 3Q8XB 1JDZA 3WV4A 2C8JA 4OHCA 2L0KA 2ORED 1JIKA 2X22A 3EXIA 3RDPA 3GLRA 3H2BA 1NOJA 4EHDA 4DPMA 1W85A 4RD6A 2O7NA 2HWVA 1AOXA 4N40A 3AFGA 3JS5A 1NBMA 3O4GA 1N7HA 2IYFA 2XMBA 1S2LA 2ACKA 3R7BA 2VQEB 3TQRA 5HKBA 1XLUA 2PKWA 1J8QA 2B4RO 1UMCA 1NVXQ 4UFOA 4JP8A 2X0LA 1M2HA 4D4KA 1XHEA 1RRGA 2GETA 1P45A 2XDQA 4G89A 4JEMA 1OW3B 5FPPA 3BLYA 2KB0A 2P2YA 3I04M 4CQMB 4YECA 4IOCF 5JLXA 3NALA 2CF6A 2EBHX 1JT9A 4IEIA 3RQIA 4Z2AA 3V5NA 1CQIA 4KIJA 4B5KA 5EUQB 4DCVA 3C6QA 4QU9A 3FGZA 4N18A 3KXKA 3AESB 4AZSA 1OFCX 2WUEA 4BQSA 3T38A 3UJ9A 1VBMA 4I9HA 2OPTA 3LUDA 2DUUA 2FSFA 1BZYA 2O3UA 1NI4B 4LRUA 3IVRA 4UB6C 3L6RA 2G82A 1UT5A 1PJTA 2ZJOA 4WT7A 2BTQA 3K6RA 3AJ9A 3BULA 3ZCOA 3AGPA 2MBFA 4P31A 1Q16A 3DV8A 3QUSA 1GPJA 3I6BA 4BHTA 1Z0XA 4EBFA 4KFCA 1PT6A 5G4KA 3IAS6 3K4NA 4IIVA 1N1GA 3U3MA 4EGYA 2Z3ZA 2WV0A 2GZHA 1HK7A 3LXXA 2R48A 2NT3A 2CQQA 1TL7C 4ZCQA 1LTHR 4CM8B 4KLAA 5FWDA 1FIPA 1FMWA 1USWA 1XZLA 1Y6GA 1YRHA 4IJMA 5JSUA 2FX3A 5JPDA 3OIOA 4YWHA 1BXGB 1JXAA 4WTOA 1ENYA 1RWBA 1AWCA 3SWWA 3D8NA 3M1LA 3LHFA 4F8EA 1BXRB 4C5BA 4CQJA 4X20B 3H2KA 1H8AC 3SIRA 4L0ZB 4IO1A 1AHHA 4IRGA 3PHBE 4DNFA 1K27A 4MVJF 1QVRA 4PTYA 3ZJTA 2C4HA 4B6EA 4IKOA 2QPAA 3QMPA 1NC3A 3UB2A 5IVKA 4HN9A 3T7RA 4MQ9F 3ZGYA 1M83A 4BLRA 1MR3F 3ICEA 5B1DA 1D8AA 1CRQA 3CHYA 2E85A 3KWJA 1TT5B 2QRNA 4KXNA 2X0FA 1K0UA 5I01A 1AK1A 3VZPA 7ADHA 1WLYA 4HNQA 4HQFA 4HAVA 3FA2A 1JI8A 4MRVA 2Q50A 4H9GA 5KU1A 2Z09A 3RC8A 1AMUA 4R3NA 2X0JA 2OG1A 3GMSA 4ITUA 4BHBA 2UUZA 3UV7A 4DOMA 4UUNA 2WAFA 5TRDA 5KVVA 4PLCA 4LCBA 4ECEA 3RTAA 2C8VA 2RH4A 4PCVA 3D2CA 2L9SA 4I5EA 2XB6A 4HZIA 5G3YA 3JD2A 4DG5A 2VPXA 4TQGA 4YY3B 4BMSA 3PGXA 2EERA 3AR3A 1WJEA 4HF2A 4EJ2A 3RC9A 1PR9A 3HOTA 5JFGA 2NPIA 5TRTA 4DBVO 1M67A 1AC5A 3C39A 1ZBDA 1VQ6I 1WZNA 3RLFA 4H7FA 3UGJA 4FLFA 2W7TA 1RTTA 3ODGA 2YX4A 2QXUA 2JGFA 4FYMA 4KI7A 1CUXA 1M33A 3H9BA 3WK5A 4WPGA 4MHTA 3V4VB 2FMIA 4LSWA 2M9HA 4CQNA 3GUUA 5JPCA 5DSXA 1MPXA 3RVPA 3SSNA 4KFTA 5EHQA 2Z9CA 3EFEA 2HR3A 5GJCA 4QYXA 2GJ4A 4GQBA 5SZHB 2JGEA 1CQJB 3GO5A 1A3CA 3ANMA 3UQYS 5FTLA 5LIPA 2JZNA 3N76A 5DRTA 2GPTA 2PH3A 3BG5A 1NVDA 1PR3A 3CC4I 1Z2PX 4N0DA 2CVPA 3TJRA 3M4JA 4NPHA 3R7AA 4HTFA 5K7HA 1DZIA 2R44A 3T3DA 1WTCA 4L9VA 2OC9A 3E48A 1Z4PX 1UBOS 2GXUA 1M8JA 3EFHA 2AZMA 3OEWA 3GFPA 4C6RA 3QOXA 4ZQIA 3BZCA 2FPPA 5CBPA 3PT9A 3KVVA 5KNCD 2QX7A 2JCYA 4WLEA 1RLIA 3WGQA 4L9AA 3QG1A 1BH6A 2ZJ1A 2IF0A 1FUKA 1YZUA 3CSUA 4DMGA 1XL1A 5CGZA 4KRYA 4RKEA 3EF3A 1DWUA 5KOHB 1Z6RA 4ZDOA 1HW2A 3ZR4B 4C08A 4YACA 2GM3A 3AW9A 1FFXA 1SMKA 1L7XA 1NX9A 3WLEA 1BDJA 4N3CA 5K05A 1U7DA 1SA0B 3REQA 3OQHA 1UDRA 3HTUA 1E1CA 3OOJA 4IV8A 4JUAA 1XC7A 4QBHA 3CLOA 3JTMA 3UG7A 1A8QA 1FYEA 1JJ6C 3H3JA 2L82A 2WT4A 4FFPA 3GX4X 1VQ8I 3U2QA 3PF9A 1DKOA 3OVMA 4QUBA 4ZN6A 1ZONA 1FX1A 5HS7A 3OKPA 2OAEA 1U8ZA 1Q7BA 2OCPA 2IOQA 4JJZA 4KIGA 1QV6A 2YOHA 4U7HA 2BE7A 2GQ0A 2YWXA 3CX6A 4D45A 2J0QA 5KQRA 4YJGA 3VBEA 4PYRA 1PD0A 4BJ5A 5DV9A 2OGSA 4WNIA 2K7LA 2G28A 3GI1A 2OHXA 1IY1A 5FUBA 2PKXA 2CLEB 3I92A 3UATA 3CTAA 3G23A 2IH4A 1ULTA 1YGPA 3C3JA 2P6OA 3AL0B 2C8LA 4A15A 5F9FA 1O87A 4PZJA 5IZ4A 1J7KA 4WZBB 4AX4A 1TMKA 3I4LA 1ZO8A 1P0QA 4TMXA 1T9GS 5C32A 5T4FA 3CO7C 2EJVA 4BO4A 3C7AA 2JCSA 1UKVY 1YQ9A 3LF2A 1LBQA 3FM9A 2VH1A 2ON6A 5IPAA 3A1VA 1JDSA 1R9TJ 2QY6A 3EN0A 3B6IA 2W2PA 3KDPA 3QFFA 2OXFA 1B1BA 3DZDA 3F6SA 2QJOA 1XZPA 2O1XA 2KZGA 1UJ2A 1VZ0A 1N77A 4R69A 4RZ3A 2GIZA 4ALMA 1ZUD1 1Q0QA 5A7FA 4ZU1X 5KDOA 5CQGA 1OT5A 1JU4A 3DB1A 1WIWA 5C5CA 1HDGO 5JD5A 4F1WA 1SURA 3I9JA 3L41A 4L2IB 4QPJC 1O95C 5FI5A 4CL3A 3CJTA 1T8YA 3DBVO 4JBXA 4FX4A 3ONQA 2FEWB 4G01B 3L7BA 2B94A 5EE9A 3RS8A 3PGVA 3KO8A 3L8CA 1T1SA 4MVJD 2JGDB 1I2AA 5L4LA 3VU9A 5EEGA 2YN0A 1V71A 2CDRA 4GWKA 1I3QJ 2PUEA 5HF8A 4WADA 5J58A 2JCGA 2V7XA 2FSSA 1LUAA 1TYCA 5EESA 3M7GA 1RC9A 1E2MA 2QV7A 3MYRA 4DFDA 1TMGE 2IZ5A 2RAVA 3DH0A 4REQB 2O0LA 4DV1B 3DTVA 4GXTA 3QVJA 1R7RA 2VYVA 4KFSA 5ICCA 2CE7A 2XD4A 2VTBB 1X9IA 2A9OA 1YC2A 2VWQA 2HW8A 3RK1A 5HOOA 6REQA 1ORHA 1SH7A 4H7DA 3RU7A 1D07A 1FF9A 4WGFA 2GNAA 2JLSA 1U1GA 4MS1A 3A6HA 3EA5A 3EZXA 2ZULA 4RSHA 1WV0A 4OK3A 1ECJA 3P0HA 3FGPA 2OD9A 4CKXA 3ZI4A 3ZQJA 1DS6A 4YRRA 3Q0IA 1WM1A 4I9FA 3L84A 3CJQA 4JENA 1UOEA 3PF8A 3LA7A 1JV2B 2B78A 4AKSA 1PJ4A 3VSLA 4JP0A 1JDTA 3FR8A 2XVMA 1GHTA 3TQCA 2V65A 3GBPA 3OE7A 3RSCA 2QTVB 1KI9A 4LKOA 5G0UA 2QX8A 1UJMA 3EPKA 2J5BA 1P6RA 1AUVA 2DPXA 1CUJA 5KYXB 3GEEA 4M0KA 2AYZA 2V9PA 1KBQA 3UMCA 4ZC3A