1S9HA

Crystal structure of adeno-associated virus type 2 rep40
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
268
structure length
268
Chain Sequence
b'AGMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rep 40 protein
publication title Crystal Structure of the SF3 Helicase from Adeno-Associated Virus Type 2
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
total genus 72
structure length 268
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1s9hA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9hA02
4S2EA 4NCNA 5AJXA 2ZAOA 3IPYA 1NMXA 1DG3A 1A1VA 2FG5A 5KSYA 3EG5A 5JWHA 2N46A 3CF2A 5DHAA 5LD2B 2DFTA 5TXGA 5LB4A 2EFHB 1N25A 1W44A 3IPXA 2FSFA 4B3CA 2Q6TA 1G64A 4DEXA 4KSCA 1A7JA 4JBXA 3H1TA 2A5YB 5F9FA 5KO2A 5JJKA 4OYHA 1KDOA 1GRNA 3MWJA 3P4XA 4C0SA 2IWHA 1P2VA 4D26A 2BEKA 1DAIA 2FH5B 3GJ7A 4IDOA 4N3NA 1OIWA 4NCJA 2Z0MA 4LWZA 3H0KA 1XJQA 4LCBA 1FP7A 2QM8A 4D4MA 2EFDB 1Q21A 4Q9LA 5C18A 4DT1A 1G3IA 4AURA 1G7SA 1SQ5A 4WZ6A 4E5UA 3UATA 5EE9A 4JYCA 3T06B 4DCTA 5FOUA 1G5PA 2E1RA 3JZAA 3AF3A 3DKVA 1XEXA 3AVYA 3P27A 2GJSA 5KDOA 5LB2A 2YVUA 3KQHA 4GP6A 2BV3A 3RANA 4HUQA 3I92A 4TTPA 1UKEA 2L0XA 1S9HA 1GNPA 2J7KA 1R2QA 4DKXA 4BE7B 4DCVA 3C15C 1P6XA 2QAGC 2FN4A 3IEVA 4BEBA 3SI7A 4IDHA 1TF7A 1T3LA 3NBYC 1LFDB 4Q1FA 1VDZA 5C1BA 3U4QB 3HWSA 1OH6A 1TEXA 3FHCB 4L5BA 1DPFA 1VCOA 4PAQA 4HATA 4BLOA 3BGWA 5FUVA 3GLFB 3KTAA 2ZRAA 1D6JA 1E98A 1W0KD 4JL6A 5DSZA 2OCAA 4B71A 5TDHA 3NIBA 1G6OA 3RWMB 1GL9B 3PIRA 2VLIA 3CKLA 3I32A 3DHWC 2GEUA 2GXUA 1L4YA 4TT3A 1B0UA 1P61B 4JSYA 3FVQA 3MJHA 3ZQ6A 2NG1A 1E9EA 2VA8A 2GXSA 3THYB 2REOA 2BM1A 3W5JA 5BYKA 4FN5A 1VCNA 3HU3A 5BW8A 2VP4A 3KQNA 3B85A 2PZEA 3L2OB 3QKUA 3TSWA 2XB4A 3I4LA 4QNMA 5FI0B 2VSXA 5CLQA 4HAYA 2BMEA 1G8YA 2RGXA 1TPZA 1NN1A 3SU8A 1NN3A 1W5TA 1E9SA 3EW9A 3CX7A 1KI6B 1MABA 5GADl 2IS2A 1U8ZA 1OB2A 2F3TA 5LDDC 1PVOA 4LUCA 3GJ4A 1WBBA 1LNZA 1MO6A 2BMJA 3SJCA 1T8UA 3O8BA 2JLQA 1P62B 4IDPA 4DCUA 2RCNA 4U02A 1AZTA 1U9IC 4NYIR 4X8OA 4BLQA 4LYJA 4NCKA 2IW3A 4JLVA 4Q4JB 3TE6A 1M7GA 2YOFA 3WNBA 3E2IA 4M1YA 2RHDA 2QBYB 2QY9A 2F43A 1HT1E 1NVVR 1Z0AA 2AN9A 4PQRA 2XJ9A 3LBNA 1F2TB 2X19A 3WHLA 2P6RA 2QEQA 4TYQA 2BC9A 2JCSA 4PFSA 4Q1CA 1SZPA 4XWKA 2J87A 1Z6AA 1AKEA 2ODEA 2RGNC 4TMTA 3IUYA 3EIQA 1YE8A 5FOTA 4XVQA 1UEJA 3Q5DA 2P5TB 3M0EA 1E94E 4II7A 1E2GA 4V0ME 1Z83A 5L3SA 4KYIB 4DSOA 3EASA 3IHLA 1NLZA 5GJWC 4BASA 2PT7A 3DVLA 2RAPA 2VF8A 4KBGA 1EFTA 4FMDB 1E9DA 5DO9A 2ZSBA 2I1QA 3QI2A 1R5OA 4OQNA 3FOZA 2J0UA 3I61A 2QTHA 1SGWA 1AS2A 1U90A 1SXJE 2VHQA 3TR0A 2WPDD 3W9YA 5JHHB 3RLFA 3C8UA 2QN6A 4XVRA 4BZPA 3SYKA 1X6VA 5H1YA 2WHXA 2ZS8A 4W5WA 5IRCD 2J41A 1QHXA 4EPRA 1FP6A 2DBYA 1RRFA 2XGJA 3CNOA 3FPAA 1N6PA 2QG6A 2QE7A 1QZXA 1GNQA 3VKWA 1IY0A 1PUJA 2G88A 3BFKA 4Q9HA 3VX3A 2IS6A 4D4LA 1QHIA 1T5IA 2O52A 3NC1C 3QF7A 3U3JA 3T1QA 4HDOB 2PJZA 4ZO4A 1NY6A 2WM9B 2XZLA 5CLLA 2O8EA 1JJVA 4BLSA 1T5LA 2GZHA 3R8FA 1E9FA 3LBIA 3EA5A 1F2UA 3PUYA 5D3MA 4P4TA 2J7PD 2AD5A 1DBSA 2YC4C 1I4TD 1DAEA 2AFIE 5FPKA 3Q9LA 1Z2CA 2D7CA 2GCOA 4B74A 4AKGA 4EPTA 1GKIA 3CRVA 2XTMA 2QPTA 2VHCA 3B2EA 4S35A 1N2CE 4NE2A 4U5XA 4ACBA 2IUUA 3LY5A 4BRWA 4QJ4A 4DVGA 4L9SA 1KI2A 4OK3A 3V4RA 1NIJA 1W47A 3REGA 4RD3A 4W5HA 1JNYA 5DI9A 4CEHB 1DG1G 1Z6GA 1SKYE 4Q1BA 2HJGA 1P9RA 5DIFA 3VR5A 2CCGA 2PBRA 3SJBA 2O8FA 3OZXA 3SBEA 1IY1A 1G19A 4A6XA 5SZKB 4AYTA 4C7OB 1ZD8A 2ZU6A 2ZI9A 4F93B 1M7HA 1X86B 4URYR 2IEYA 4PQYA 4Q4HA 3ZDQA 1TU4A 3PEVA 4EJSB 1OFIA 1Q1QA 2VQSA 1F6BA 2PX3A 4B76A 1VECA 4QM7A 3WRYC 5CJ2A 2O8BA 4C9BA 4Q00A 2Q21A 3QKRA 4NYMQ 2IT1A 5BYJA 5AJWA 3ETLA 4PQFA 3QQ5A 3GEEA 3B1WA 2J46A 4XTRA 5DHFA 1ZM9A 1Z5ZA 2WIBA 2YWGA 4US1R 1GTVA 4IDNA 3FE2A 2AXNA 3WHKA 3GEIA 4DDVA 2P6NA 1NI3A 4PSAA 3UMSA 1OXXK 2WTUA 3QEOA 4IVQA 1S1MA 2OCYC 5FL7D 5JRZA 3A6PC 3GMTA 3W5IA 5C2JB 1IXRC 1R0WA 2YKGA 4WZAE 2WWYA 4HLUC 1JJ7A 2Q9AA 3L0IB 4OK5A 1HT2E 4D2IA 3EIEA 5EP3A 1E4VA 4RCZA 3PFIA 3KQUA 4K81B 1NG1A 4MRSA 4ZPXA 4F38A 2OCPA 4H1UA 5BN4A 4G0NA 4NYJR 3RSLA 1C9KA 1NL3A 2PEZA 2UZIR 2GA8A 3CRQA 3PEUA 4M1KA 1E2FA 1EFRD 3UG7A 3R7WA 3GLHA 4NONA 1KSHA 4ZDJA 2NO0A 2J0VA 3RRMA 5AK0A 4MDEA 4A8JA 5IK2D 4PX9A 2ATVA 4HZUB 1E6CA 4C2TA 2MSCB 4OJKA 1KHTA 5J4VA 2IBMA 2P0EA 4KYUA 3ZVNA 2WPDA 2XJ4A 3OAAD 4IEIA 5JSZA 1OV4A 1W0JA 3I5YA 2WAXA 4IXMA 4WIAA 1K5GA 1T0HB 1KO4A 4C30A 3VTKA 4I1VA 3FB4A 4R2HA 1DO0A 1DVRA 3CPJB 2A7QA 4C0AC 2C9OA 2D4HA 1G7RA 5TB5A 3EC1A 4GBMA 4B73A 3B1VA 5J4KA 5G3ZA 3H84A 3IBYA 1XZPA 1RIFA 1YJ5A 1KDTA 2H1LA 2VHJA 1I4DD 2EWWA 5L3VA 1LTQA 3QXCA 5IF9A 3ADKA 2ATXA 4OKSA 1ZAKA 2CXXA 1D5CA 1GKYA 5BQ5A 2PH1A 4K46A 1XTIA 1Z6TA 4DRZA 3CONA 5JEDA 2PZFA 5JS7A 4NH0A 3K09A 2NQ2C 1XXHB 2XB2A 1KNXA 2ZRKA 3AKDA 2OUKA 4ITRC 4PZYA 3RRYA 2QT1A 1IBRA 3O47A 3IO3A 3K0CA 3IQWA 1RJ9B 1XTRA 2GESA 2MMGA 3GCGA 4BLRA 5EXSA 4DXAA 3TKLA 3SFZA 1JQJC 3KUDA 2RGEA 5AJVB 4A9AA 4D82A 5CB6A 3QXJA 3TGPA 2QGNA 1NRJB 1KTVA 1CRPA 2IS1A 1M34E 4FMBB 2WWGA 3SS8A 2DPXA 4HUTA 2GAAA 4YMVA 4BECA 1F48A 5H70A 2GXQA 1XD9A 2D3WA 1W4AA 2OSBA 1CBUA 1ZIOA 2WSSD 1KO5A 4OQLA 3UK6A 2P67A 2A5GA 5FBRB 2KI5A 1E2KA 2XTNA 3PENA 2VP2A 3AF0A 4KXFB 4TTQA 4TWZA 5DE3A 1RPZA 3U3OA 3TH5A 2LCFA 1QBKC 4LHWA 2FFQA 1FNMA 2N1BA 2OESA 1RFLA 3GJ5A 4UXJA 3IHWA 1EG7A 1U81A 4Z51A 2J0SA 2IS4A 1FX0B 3HR7A 2QPOA 2FSHA 1EK0A 2BKUA 2FGKA 4D25A 2AFHE 3EPJA 1SVLA 3LV8A 4GMDA 3QKSA 4HLCA 4TLDA 5HZKA 4RFSA 1XNJA 1PJRA 3KX2A 3KKNA 1RYHA 2BM0A 1S8FA 1D2MA 1J7KA 1GVNB 1MR3F 4H1VA 3KB2A 5FTLA 1GRQA 3VNVA 4Q18A 4B6FA 3K70C 2NZ8A 2JATA 3MRSA 2RGAA 2WJHA 3P1JA 1W36C 3V00A 5K8IA 1XPRA 4QHSA 4A15A 1KY3A 1XFAA 2GBLA 5EE1A 4EPYA 4X8HA 4NKRA 1ZD1A 2GK6A 3T1TA 3RS7A 2O8DA 2B21A 4ON9A 1KK0A 3THWA 2GVZC 5H68A 4POAA 3WBKA 1P7CA 3BWDD 2ZRIA 1WE2A 4QNRA 2HDNB 2WZQA 4RD2A 3U60B 2GKSA 1KI9A 1E2IA 2BMFA 4NL4H 5KDDA 2W00A 3EZ2A 3MWYW 4LSGA 5K8TA 3SJAA 1ONBA 1TQ6A 1PV4A 2WJVA 4QGFA 1MO5A 1OJLA 3MWKA 2FFBA 3TJZA 4ZDKA 1W36B 4GOJA 2XAUA 2QZ4A 1RKBA 5G40A 3X2SA 5UKDA 4JBWA 2HXSA 1G41A 1EESA 2HF8A 2IXGA 5GJBA 5E7MA 2OAQ1 4OI1A 1MOZA 3NDBB 4Q7KA 3BBPA 3CPHA 4JSTA 2JIZA 4FW9A 5LBIA 4RD0A 4ASUD 3TBKA 2BIFA 4L16A 3BB3A 4US2R 1A2BA 2FU5C 2CE2X 4K8OA 3EX7C 4NP6A 1T8TA 1GUAA 2ZS7A 3R20A 5FI1B 4B3FX 2QP4A 5JFGA 1U8AA 3FGNA 4M8NE 2CBZA 1AKYA 2ANCA 1Z07A 2PJRA 4C0HA 1RVDA 5KHOC 3AF2A 3NH9A 1M1YE 1XD8A 4HYYA 4HSEA 4C0QC 1KAOA 2FX3A 3A37A 1II9A 4M22A 4LV8B 2Q0HA 2P6UA 2C77A 5FTKA 4RD1A 4JLAA 3WMGA 3A36A 1JQLB 2CLCX 5EE0A 2ZS9A 5KUTA 5L3QB 1VPLA 2IUTA 1E4YA 3PUVA 2W6JD 5BWMA 1NBMD 4JL5A 3O8RA 5G41A 3CRRA 4QG7A 3FYHA 1E1RD 4TSFD 5AJYA 1GSIA 2B7BA 2GJ9A 3KKQA 1E1QA 4NPHA 5JI3E 1P2TA 1LF5A 2C99A 1OIVA 3VKGA 3CF6R 1JBKA 4YLGA 2QSYA 1G20E 5IHPA 2ZEJA 1UAAA 1ZU5A 3B60A 1S4QA 2EFEB 3B1XA 4EAQA 1DADA 3FKSD 1GP2A 1OXUA 4Q7JB 2YOGA 4RD4A 1VG1A 3U3MA 3OIUA 3NTUA 3BFXA 4A0HA 3DO6A 5JCPA 4RZ2A 3CPEA 3LFUA 4Q21A 2FE4A 1FZQA 2DFKB 5K8LA 4JKIA 1FUKA 5CK4A 2V1UA 1KY2A 1R0XA 1XMVA 1Q22A 4JVNA 4Q19A 5FOXA 2LKDA 2B92A 1J8YF 5GJVC 1N6KA 4BFWA 1CJTC 4Q9JA 4L9WA 2HUPA 4QL3A 3A1UA 5TY0A 5P21A 2CNWA 3TUZC 2A30A 4MRPA 4KLNA 3M6AA 3CLVA 4RKFA 3W8RA 1G9XA 2O0KA 3KZ1E 3GFOA 4MKFA 2ZJBA 4EQ6A 4XD7D 3SZRA 1SXJA 4WZBE 1E2QA 2Z4RA 3SYLA 1KJYA 1Q0UA 2DHRA 4OJQA 4A6PA 1Q3HA 1P3JA 2F9MA 2QMHA 1IONA 1KK2A 2IHYA 2ZSFA 2CL7X 3BD9A 3THOA 4JLKA 4AG6A 2C2HA 3AP1A 4M53A 1G5TA 1NSFA 4HB4A 2BKEA 3M4YA 2AD1A 4GFDA 2DY1A 2RB4A 1U2RA 4NCHA 1VIYA 5FTNA 1UDWA 5E3HA 2YZ2A 4DCNA 3EPHA 3WNCA 1E9RA 3B6EA 3AP2A 3AUYA 3QEJA 1CR0A 5FUXA 3SBDA 1E9BA 1XEWY 5JHGB 3ZVLA 3A1WA 4ZIRA 1OSNA 4ABYA 3WY9A 2MSEB 4IHQA 5EP4A 2R44A 4N1AA 5E7IA 4V0KA 1O3YA 3I8SA 2V1XA 4M1OA 2KB0A 3CM0A 4A2PA 2ZE5A 2VYFA 2XOKD 1N5JA 4QBFA 4XSGA 4LJ6A 3N2EA 2ZRGA 1OH7A 4V0LA 1TF2A 1UJ2A 4Z1MA 3DOEA 2NO9A 2CVFA 2R6DA 2JAQA 4GP7A 1VMAA 3SFVA 4H9GA 1YU9A 4ZCMA 1P5ZB 2GJ8A 2XX3A 3P32A 5J4YA 3Q7PA 4FINA 3PUWA 1AQUA 1XPOA 4FWIB 4X8MA 5HPYB 1Z6XA 1JXMA 1ODFA 4Q5IA 4DC9A 2A5DA 5FTJA 5EE3A 1BMFD 5J47A 5HCIA 3D3QA 4BZQA 3J81k 3CZQA 3I72A 3X1DA 5JRJA 2YHSA 2ZI3A 4NYIQ 2JLYA 1G8FA 2FA9A 1XF9A 2ONJA 4AD8A 1GOTA 3ZS9A 1IM2A 1NJFA 4KFTA 2CMKA 3DZ8A 1CJUC 5J4HA 1YR8A 4CEIA 4JL8A 2NGRA 3WYGA 1D9XA 1NVVQ 4LJ4A 2CK3D 3C16C 2H8KA 2ZJ5A 1II8A 2LWIA 4TMZA 1TTTA 4JVSB 4KU4A 4ZV4A 2CEAA 3OE7D 2RGBA 1NJGA 2BDTA 4TMVA 4RJLA 4DHEA 3LLUA 4JJZA 1TL7C 2ZYTX 1PZNA 1YHNA 2D06A 1WBDA 4RY2A 4ZCLA 4MUBA 2QTFA 1U8YA 4OQFA 2J59A 1G3MA 2YWEA 4JS0A 4Z8YA 4KCGA 1Z3IX 2H18A 2CCJA 4UKDA 2P5SA 1US8B 2XEXA 3R8CA 1E79D 2XNSA 3IDQA 1YR9A 3EWSA 3IKJA 2WWWA 3KB1A 3EZ9A 2ZM5A 1J99A 1VG9B 1CXZA 2G1KA 3MD0A 2CJWB 4TYNA 3QF4A 1G291 1S3GA 2DWPA 4UNNA 4UQOA 4W7SA 4D0GA 2IWRA 2RGDA 2ONKA 2FPLA 1E2NA 2PZGA 1EFHA 2V8OA 821PA 4DUGA 2HF9A 5HKKD 2ZE8A 721PA 3A58B 3LQRA 3VKHA 2I1VB 1E0SA 2OFXA 2O8CA 2IYQA 1ZUHA 2Q9BA 1XTSA 1N3BA 2J0UB 2ZI6A 2ZSDA 3THXA 3KKOA 4IOJA 2H57A 2WOJA 4JKYA 2KJQA 2REXB 1ZNYA 4IKEA 3DM5A 4RFVA 1G21E 1ZCAA 4IFEA 4P31A 4Q66C 3W6NA 1ZMXA 3AH8A 1ZUIA 1W4BA 4FIDA 1P60A 2XOKA 4BLTA 1UFQA 2ZE6A 1NNEA 2PT5A 621PA 1W1WA 2A9KA 2NO6A 2V9PA 1GDDA 1GRRA 2O8EB 3U2QA 1HQCA 5FUWA 1N6IA 4HZIA 1OHHD 2HLDA 3GLIB 3AVXA 5JCZA 1CKEA 4YXWD 5DH9A 5DN6D 3OF5A 4OQXA 1JI0A 3RHFA 4W9MC 1CR2A 2DWQA 4RZ3A 3TSZA 4TLEA 5FBQB 1GWNA 2QAGB 1D2NA 2QI9C 1ZM4A 3RWOA 1W2GA 3GLGA 3KXIA 2JDID 3KKMA 1KI3A 1TAGA 4FCVA 4BLPA 3U7HB 1AGPA 5FPHA 4ZDWA 2JLSA 3BB1A 1LY1A 4QKQA 5EE5B 3QENA 2WKQA 4W5JA 2Z6VA 2ORVA 1XWIA 5EQTA 1VHTA 3H4MA 1E2PA 4FCWA 3TAHA 2ZUBA 4XSHA 2J0QA 2HYIC 2EW1A 3SNHA 4IVRA 2H5EA 1GILA 2PLFA 5F98A 1L2TA 1ZCBA 2CK3A 3WBJA 4PR0A 3QOFA 4IDQA 4MRNA 1YRAA 2DFLA 4EUNA 4KO8A 3K9NA 2BWJA 2QL6A 3BS4A 5EXXA 3A1SA 3FMFA 2VF7A 2J9RA 5JLJA 3ZGXA 4KFUA 4C2UA 4DB4A 1ZM7A 4PO1A 4Q4AA 4URXR 3Q72A 4BUJA 4Q1EA 3BJIC 4OK6A 4C0KA 3O8DA 1XDBA 4TTRA 5FBLB 1DE0A 4UJ5A 1Z2AA 4B48A 4TYYA 3K0AA 4NYJQ 3LNCA 4A8JC 2BOVA 2AK2A 5HCNA 1GL6A 2ZIAA 2FNAA 4JLBA 2GDJA 3SHWA 2OLJA 1JB1A 2E9SA 4JLNA 3AVUA 1KI1A 4LHYA 2IA5A 5BN3A 1QG2A 3AF1A 1XXHE 3MMPA 1JR6A 1CP2A 3KXLA 5E4FA 1NKSA 2OM2A 2JJ1D 3A1TA 4MGZR 3ND9A 5HE9A 4LX0A 4ARZA 1VIAA 1KSFX 3ZQJA 2NOAA 4PC7A 2XSZD 3AKCA 2CCKA 5HKKA 2C9CA 2ZSAA 4CF7A 1UBCA 2ANBA 1QHHB 3VHXA 2QTVB 1H8ED 4HAVA 4CZ2A 1CS4C 2WWHA 2W0MA 2ZRBA 3N5CA 3QJYA 4G5RA 5A4JA 2IHBA 3EC2A 4WBSA 1Z0KA 3U61B 1OPXA 3RC3A 4F4CA 1OT3A 2EWVA 5DYIA 3PG5A 1DAFA 3I73A 3QG1A 1MO4A 3UG6A 5JSZB 1G6HA 2Z83A 3QBVA 4TL7A 5D3QA 5AR1A 3K09C 3O8CA 3OIVA 3QE0A 5EXTA 5B64A 1UBFA 1N6NA 5TMPA 3K0CC 4DWJA 1OW3B 1BH2A 2P2LA 3R9XA 1HY3A 2B8WA 1T91A 3BXZA 2W2TA 4N0EA 1IN8A 1W0KA 3A1VA 3Q8XB 3QKTA 4M1TA 1GKUB 1XU4A 4B32A 2HXYA 2QAJA 2PMKA 4L4UA 3K0SA 1K8RA 1I2DA 3NDPA 3RDPA 1G8HA 4TMXA 3NHBA 2ZJYA 3REFA 2AXPA 4OHZA 4B44A 4KODA 1W4RA 2O0JA 4D81A 5A5GA 2A5FA 2Q3MA 1FMLA 4EFLA 2WJGA 4IRUB 3FKQA 2ZJZA 1AGRA 5HTKA 5FL3A 5B30A 1IJEA 2F1JA 4DSUA 2QMEA 3KJIA 3RAPR 5AUQA 1U99A 1NMYA 3CR7A 4LHXA 3GLFA 4L8GA 4UXIA 3KQKA 4LOAA 1TMKA 2CL0X 4JT2A 1N6RA 3MJRA 1ZRHA 2EFGA 1LV7A 5GJCA 2R9VA 4HLDA 2GBLC 1IN4A 1E69A 2RGCA 4HB0A 2CLDX 2XXAB 3THYA 1KSGA 2VIIA 3K9LA 3AF4A 4C3ZA 1KO7A 1NBME 3R9IA 4KLZA 3EZ6A 3TQFA 4EPWA 3KUCA 4D6PA 5FOVA 4KBFA 1ZNXA 3W8NA 3WNDA 3AUXA 4TL9A 2DYKA 4XTCS 1Z6YA 2IYLD 2OLKA 4F4JA 5F3WB 3UPUA 1X1SA 4XOIA 1M2OB 4J0QA 2ERYA 2QRZA 5CM9C 2GJKA 5DYGA 3HP1A 4F91B 3IIKA 2C9YA 1P75A 1T6NA 2ZRNA 3BC1A 1KI6A 4MQBA 3CO5A 4ESVA 2ERXA 1JR3D 4O0MA 1VKJA 2Q3FA 3DMDA 3KXKA 4XH9B 5AWFC 1IN5A 1GG2A 3CNNA 1Q1EA 2EFCB 2FPKA 5JWRA 1VCMA 3ADCA 3IIMA 4LV6A 4QHYA 1Y3AA 1KI7A 3EAQA 4TQUS 1ZNZA 3HU1A 4NCIA 1H8EA 2IC5A 5BXQC 2A78A 1R4AA 5LPNA 2YWHA 2GK7A 2OBLA 3AVTA 2XZPA 1FTSA 2ZANA 3BERA 3X1ZA 4LDJA 4Q4JA 2HCJB 3QSYA 4BEJA 4ZI3A 1G8PA 4A2QA 2QBYA 1COWD 1Z8FA 2ZJAA 5CITA 2BVNA 2RHMA 3NBFA 2EYUA 1F2TA 2VP6A 4A2WA 2HV8A 4QGAA 3LBHA 1XEWX 2CDNA 3NHAA 4Q1AA 3LA6A 5ELXA 1CJMA 3TNFA 4D4KA 1KMHB 1KYIA 3HYRA 1A82A 4LBWA 4PO9A 4RD6A 2QUZA 3RS4A 4AYXA 2ZQ5A 1W46A 1G3QA 2WWIA 1TQDA 2G83A 2ZETA 2WIAA 1LW7A 4B2LA 2ZRFA 3U44B 4CEJB 2GWHA 5JEEA 2J7PA 2GZAA 1IHUA 2FEOA 1ESNA 2YV5A 4C7OA 3LO5A 4Q4LA 4A0RA 1JEEA 4LRWA 4OL0A 3ICQB 2YWFA 2ZSEA 3PXGA 3FTQA 4WXRA 4YDHB 4PAOA 1NN5A 3DEFA 3SJZA 2JLRA 1FPMA 2G1JA 1XPUA 4R2IA 3PCRB 2WWXA 5FR1A 2ZITA 4MRRA 4UNPA 2VL7A 2A3RA 3GJ6A 1YZKA 4Q01A 1XMIA 3C7KA 4AG5A 1M6NA 1P9WA 3RVBA 2WJJA 4IOLA 2HJVA 2PL3A 4P4SB 5FBWB 1E96A 3VU9B 2JLVA 1HURA 3OIYA 4KVAA 2IL1A 2H7VA 4JLOA 4MYHA 5E7JA 5KOYA 1MKYA 2ZRCA 3CNLA 2R6AA 5CYOA 4JIMA 3GLGE 1SXJC 1F5NA 3H2YA 5B2ZA 3PITA 2ZAMA 1DELA 5FPSA 2RH5A 3X1YA 2QMUA 1Z06A 4A92A 4TMWA 2J45A 2R6CA 3BORA 1JPJA 1P2UA 2KSQA 2V7QD 4MYUA 2F3RA 2ZRHA 4Q9KA 2DWOA 2HYDA 4MYCA 4OI2A 4CEHA 2QQ0A 3PVSA 1DAGA 3WP0A 1HA3A 4BFVA 4AI6A 3BOSA 4PZZA 2Y8EA 2NIPA 2BCGY 4NU0A 5FL7A 1OKKD 2IYXA 2Q3HA 4GZLA 1E2MA 1T9HA 1IXZA 4WW0A 2IYUA 5DI3B 3OFND 3SHFA 4C0LA 4WOPA 4HAWA 4TLAA 1ZINA 4MGYR 4EJSA 2E87A 4M1WA 4JBYA 4MGIR 4DDTA 3C5HA 1XD2B 4PANA 1XBTA 4LHVA 2ZJOA 2WICA 5EXPA 4PC2A 4DLSA 1BO6A 1EFRA 4B6EA 1MT0A 4DLXA 3K0FA 1OF1A 1VTKA 3BRWD 3VMFA 4IOMA 4A4DA 4BFUA 1LF0A 1NLFA 3DMNA 3DOFA 3V9PA 4EIWA 3B13B 5IK2A 2AWNA 3QBTA 1ZD9A 5E95A 3E1SA 4B2PA 3VAAA 3K70B 3UXMA 3OAAA 4LPKA 2ZRPA 3PR1A 3QPVA 4BFTA 4DB2A 4JLJA 4BFYA 2IF2A 5F2EA 4XWOA 2JJ2D 2QROA 4UNQA 1N6HA 3D7MA 3F8TA 3OEHD 1AN0A 5JBQA 3AVPA 1GITA 2OILA 1WMSA 1PLJA 4OHVA 1CIPA 2WMOB 4DJTA 1CTQA 1RRPA 4NTZA 2B7CA 1D2EA 1XCPA 5EUMA 2KWIA 5FOWA 1RRCA 4EKDA 4URVR 1Z29A 3WRXC 1LVGA 2YNMA 3B82A 4LJ7A 2KBFA 4M9ZA 3KFVA 3S1AB 2OBMA 4HZUA 1NSTA 3K70D 3HYTA 3TK1A 1KDRA 1GL7A 1HH4A 8OHMA 4XVUA 1W36D 4BPBA 2XNDD 1GFIA 4JZKA 3RRNA 4KAXA 4Q48A 1M8PA 1RW4A 5CB8A 4LYFA 4IXNA 3ZVMA 4LJ8A 4DLWA 4OHXA 1CJVC 4V0OA 2AL7A 4ERNA 1H8HD 3CRW1 4PO8A 3R9WA 2EU8A 2QT0A 4C4PA 2QGZA 3GJ8A 3QVUA 4BFSA 5KNCA 2NMVA 4AKHA 4HDQB 1J70A 1XTJA 2VO1A 221PA 3CB4A 3QXSA 4BWYA 1GM5A 5C46F 1I2MA 1X8LA 2WSSA 3UWKA 3AP3A 4RZXA 4CEIB 2A5JA 1XMSA 2CHVA 2ODNA 3DDCA 2FZ4A 4IJMA 1II8B 5JJLA 3DPUA 1WP9A 2WBLC 3BAFA 4UNRA 1XXHA 1N5LA 4LJYA 1E2DA 1EFUA 3ONWA 4DLYA 1SVWA 5CIWA 1NP6A 1GAJA 3ZD6A 2I4IA 2AX4A 3VR2A 2V7QA 3G82C 4FMDF 1AA9A 1RJ9A 1YR6A 3TAUA 4TN1A 3B78A 2YINC 3GLFE 4O3MA 5EUQB 5JMTA 3BK7A 2GEDA 1N0VC 4ILEA 3G0HA 2GCPA 3L8YA 1QDEA 2R8RA 1QHSA 1OYWA 3IO5A 4M0LA 3GLIE 3OFNA 2JGNA 3X1WA 1ZVQA 1IN7A 3QXHA 1U0JA 4TYWA 1F60A 3B9PA 3SYNA 4R7ZA 2PLRA 1N5KA 3UIEA 2W6ID 4TL6A 1E2JA 4GOKA 1JPNA 2UZ3A 1RRGA 3EWAA 2WKPA 3QF4B 4NZYA 4QXAA 4BZXA 4Z8XA 1SHZA 1FX0A 2QRNA 4HEJA 2R6FA 1AM4D 1JALA 4M1MA 3GP8A 3MUFA 3I3SR 4DT1B 2GCNA 3LVQE 4B3XA 4U7DA 4DLZA 1MO3A 1YZLA 4QFMA 4YMSA 4DCSA 1U94A 1XEXB 5DLQC 1PUIA 3VX4A 3E70C 1A4RA 2BCJQ 4HUQB 3W34A 3JZMA 3LWNA 1MH1A 3WYAA 1UBGA 4MKIA 4CGZA 1ZUNB 4IOKA 5EZ5A 2D2EA 3NH6A 2O5VA 2X77A 2VH5R 4GT1A 4I1SA 4B34A 4GRAA 1P9NA 2W83A 3CX8A 1EWQA 2XTZA 1MRNA 4ASUA 4TLCA 3HPRA 3RS2A 2IYZA 1Q3TA 1CR1A 5DNYB 1Q1ZA 1XTQA 4QBIA 1KI4A 3KTAB 5TARA 1XCGB 5H8WA 1WQ1R 3MWLA 2H16A 1G4UR 2NO1A 3ICEA 1OXVA 1X3SA 2KBEA 3HDTA 4NMMA 4PC6A 1E0KA 3PV0A 2PCJA 3GFTA 4Y0VA 5TVKA 4GL2A 4GNKA 3CF0A 3DL0A 2QNRA 1S2MA 5KYKA 1R6BX 1G3UA 3NC0C 1ZU4A 1PLLA 2F9LA 4HLQB 1HEIA 4DBLC 2X2FA 3P26A 3UMFA 1AIPA 2JLXA 1HYQA 2W6JA 1NBMA 1NN0A 3SQXA 4QC2A 1NKTA 5JJIA 3MFYA 4OI4A 3RC8A 3AGQA 1OLOA 1DEKA 1E1RA 1N6OA 3L8ZA 3AEZA 3PUXA 4TSFA 4YC7A 3I8XA 1YKSA 1QHNA 4CDGA 1A2KC 2FOLA 2QSZA 3EPLA 4EPVA 1KJZA 1W2HA 1XMJA 2F1IA 1MABB 3F5FA 1CEEA 2PMDA 3EIHA 1AZSC 1NVXQ 2H92A 4TT3D 1NF3A 3TQCA 4I1UA 1G16A 5KTYA 1KJWA 2OV2A 2Q9CA 3FKSA 4CT4B 3GJ3A 4MDFA 3ZLJA 2IX3A 4FXPA 2WWFA 1UM8A 2CHQA 3CX6A 1G17A 2ZYUX 1N6LA 5JWOA 1KK3A 4WVFA 5L3QA 4WXPA 3TMKA 2FEMA 2IYSA 4AK9A 1XTKA 2J3EA 1KO8A 2ZYVX 2ZJ2A 1QHGA 4UXHA 1ZBDA 3SC3A 3T12A 5LD2C 1XX6A 2ORIA 4Q03A 4AKIA 1KSJA 4GZMA 4DIEA 2F43B 2IXFA 3U7GA 1P2SA 1NVWQ 2B6HA 3GD7A 4HDCA 5IDVA 4TZ6A 3P4YA 4C0BA 5TV2A 3T1OA 1DAKA 4ARZB 4BRUA 3BH7A 2ZI4A 4ZKDA 2G77B 1N0UA 4XD7A 2DR3A 1Z0FA 2OE2A 1E99A 5FTMA 4G01B 5CK5A 1SULA 1E2HA 1CLUA 3L0PA 4FMCF 1W4CA 2PX0A 1KDPA 4KVGA 3A4LA 5CYPA 5L3SB 2OFWA 3NXSA 4HI0E 3CZPA 4V0NA 3PJRA 3I1FA 1JR3E 3LH5A 1KGDA 1KZ7B 2GILA 3PQCA 4DDUA 1DARA 3D8BA 2FWRA 3V4FA 4DSTA 4NBSA 1AJEA 5FBVB 5AJZA 3DM9B 2F6RA 4PPQA 2HT6A 1UDXA 1KZGB 1OXSC 1TEVA 4LBVA 1JAIA 2WV9A 3UWOA 2QP9X 3ECCA 1XJ0A 3A4MA 3BH0A 3LDAA 2UKDA 4HB3A 4TQ9A 3WMFA 4JLDA 1E2LA 1Q12A 3JVVA 5A0FA 4PSVA 2FFAA 2NO7A 3ADDA 2F1RA 2ZPTX 3D6TB 1HTWA 1V5WA 1ANKA 3NBZC 1F2UB 1M74A 5D3MB 2OT3B 3UKDA 4Q1DA 4YMTA 3VFDA 2HCBA 4MA4A 3TW4A 1VG8A 3OIWA 2GCOB 2ZRJA 1HUQA 2ZYWX 4TZ0A 4QHTA 2K5UA 2C04A 2OCBA 1BMFA 3AVQA 1G8GA 4OQMA 4A1FA 4AC9A 4IEEA 3MLEA 4JJKA 2BJWA 1RYFA 1ZJ6A 3NEYA 2H17A 2DCUA 2Z43A 3C41J 5KNDA 2PEYA 3ZZTA 4TYPA 2QE7D 3MGCA 2O8FB 4KFSA 4LHZA 4JYBA 4QGGA 3TIFA 4E03A 1YZNA 4NHOA 2HEIA 2B8TA 4Q4HB 4HB2A 3HJNA 3AKEA 4JLPA 3FHOA 3ZJYA 1JECA 1KK1A 3RS5A 1W7AA 1V43A 121PA 3CWZA 2O8BB 1Y63A 2ZR0A 3QKRB 3OE7A 1IOZA 2DFNA 4F4IA 1Z22A 3F0TA 1R10A 1TF5A 2JJ8A 3GJ0A 3U3KA 2ZU0C 4DSNA 2QU8A 3VR4A 4GOXA 2GEVA 2QM7A 4RSGA 1VYUA 4CRWB 2VEDA 4JVMA 1XP8A 1NG9A 3FWYA 3U7EB 1E79A 1YZGA 4IVPA 4KHZA 2WAYA 1SVKA 1CF4A 1O87A 3QXXA 3ND8A 1WXQA 4GDFA 4A0GA 2V4ZA 1TX4B 1KMQA 2GZDA 1II0A 3T5DA 3ZIAD 3K1JA 1ZIPA 3WYFA 1ZP6A 4LYAA 4G3XA 5CDFA 3K9HA 4EFNA 1SVIA 2C8VA 2ZJ8A 3T35A 1OH8A 2C96A 3TVTA 1BOFA 2X1VA 5JECA 1HE1C 5JI2E 2V55B 1F3OA 3Q5EA 4TQAA 3R7WB 3GLHB 3I62A 1C4OA 4PHGA 4A8JB 1TNDA 4LV5B 4LI0A 2FFHA 4U00A 1QRAA 1ZW6A 3T1VA 3TW8B 2V54A 2W0SA 3IIJA 1US8A 2G6BA 4P32A 1S0UA 3ADBA 2D7DA 2BBWA 3HR8A 1JEDA 3CBQA 2VPPA 1FMJA 4M9SA 1YRBA 2XITA 2KE5A 3B1ZA 2CVHA 2CJWA 2AK3A 4F7WA 2QMOA 5SZHB 5KU1A 2IYTA 1S3SA 3W3AA 4KJZA 4QOSA 1R5NA 1KKLA 3SE0A 3QIAA 4G5SA 3MAAC 1BKDR 1OHHA 1DTSA 2FV8A 4Z54A 4YXWA 4US0R 4QJ5A 1Z0IA 1XEFA 5DN6A 5HE8A 2JA1A 2OEPA 4P33A 4AY2A 1E0AA 1K6MA 1OXTA 1FTNA 3F3YA 1W0JD 1N0WA 3OEED 4O25A 2JEOA 2JDIA 4AYWA 1LB1B 1NLYA 3FMPB 4I81A 1IY2A 4B75A 2VRWA 3IEUA 2QPAA 1Q44A 3U4QA 2VSFA 3U3RA 1TADA 2VHTA 4F92B 3M1IA 3EZFA 3L0SA 1EX7A 1NIPA 2IF0A 3CH5A 3EA0A 1ZC3A 4B3DA 1WB9A 2AR7A 2YOHA 5FR2A 1OB5A 4KITB 1UEIA 1ZM3A 4M2LA 3GLIA 3BE4A 3FFBA 5C4MA 4HAXA 3AGPA 4EJSC 4DLRA 2OZEA 3TSOA 1FOEB 1DAHA 3EXAA 4UJ3A 2QAGA 1KAGA 5JS8A 4ACAA 3U5ZB 5GVRA 3B1YA 3QKSB 5GVSA 4XWAA 4TMKA 3FMOB 1S1CA 4RFSB 3ZZUA 1BS1A 3C14C 4LK2A 4Q47A 3I5XA 3SQWA 4DLVA 3FDIA 4PC3A 1VHLA 3RABA 2I3BA 4QJ3A 1Q57A 5FUYA 3IGFA 4B35A 4LPSA 1OYYA 3QNUA 2C95A 4M9XA 5L3RA 1G7CA 3ZIAA 2JJ1A 4L15A 2BBTA 2R65A 1JXOA 1AK2A 2O8DB 1SVSA 3U6KA 4CIDA 2G0TA 1KOFA 2XSZA 3RNLA 1YZQA 3HU2A 3THWB 2OFOA 2YJTD 3G5UA 1Z08A 1FQJA 1QVRA 3IILA 2EYQA 3K0FB 3SN6A 4AWXA 5KDLA 2IYVA 2NZJA 4PHTA 4WAUA 2BHRA 2CHGA 3RS0A 4B33A 2AKYA 2GRJA 2ZR7A 3AB3A 4RZUA 2D2FA 1J8MF 1HQYE 4R9UC 4MKHA 2IK8A 2ZUCA 4B2IA 1IAQA 1R5BA 2VHUA 1XJCA 4JVLA 1FUUA 2JLUA 3DZDA 1YVDA 5FFMA 3RS3A 3QPWA 3CUEF 4LZZA 3W90A 2ECKA 4CYMA 4CVNA 2JLWA 2IYRA 3TRFA 2G9NA 2F55A 1ZM2A 1HE8B 4FWTA 1EGAA 3VHLB 4AKEA 5B58C 1G5RA 3KJGA 5CM8B 1U9IA 2W58A 1I4LD 1FFHA 1QHHA 2ZTSA 2J1LA 4PHFA 1G4AE 1TUIA 2IUSA 3AVOA 4B3BA 5HZHA 5AUPB 5B57C 2ZREA 2AKAB 1L4UA 3K0EA 2JLZA 4GMXA 3W6OA 4QM6A 5IT5A 2G3YA 3KFXA 5J4LA 1QVAA 5AUNB 2FDCA 4FCTA 3CIOA 4PHHA 1OFUX 4LC0A 1TU3A 5AUOB 1DOAA 3ASZA 3OEEA 1E32A 4QBGB 4D0LB 2ZI5A 2G0NA 3LQQA 1FW6A 1WRBA 3LRPA 3NG1A 2CE7A 2BJVA 521PA 3GEHA 4XIGS 2GAOA 1E3MA 3ASYA 1EFCA 4YDSA 4CT5A 1LS1A 4E07A 4ZI2A 1Z47A 2JIZD 2RGNA 3N2IA 3ZZ0A 3ZD7A 1T4GA 4GI7A 3QY0A 2QA5A 3GPLA 3TR5A 2AHOA 3C5CA 4M4SA 4FMCB 4OHWA 2CLSA 1ZNWA 4PAMA 2MSDB 3EARA 4R98A 2WJIA 2IXEA 1YR7A 2ZRLA 4Q9IA 4E22A 3FFAA 5EP1A 5KPDA 3T15A 2BBOA 4FI3C 2ZR9A 2VP9A 1IXSB 1UKZA 1UPTA 4PZLA 1R7RA 5L8VA 2FJUA 3GJXC 4URUR 3KL4A 1JAHA 4JLMA 5C4GB 2FMXA 1Q20A 2RKOA 1BIFA 3AVVA 5HR5A 4DDWA 4BQSA 5KSZA 3T61A 2QENA 3N70A 4M9QA 4EFMA 4KFRA 4PTLA 3B5JA 3IBGA 2QP3A 1AS3A 3BIFA 1EXMA 1OIXA 2OXRA 5CIQA 1SKQA 3LVRE 4DLUA 1BYIA 3CWQA 4URZR 2NPIA 1N5IA 1SHKA 4KI0A 1E1QD 4YMWA 2ZE7A 1JR3A 1RE0A 2X8AA 2JASA 4PXAA 1QHYA 5KNBA 1IJFA 2AWOA 1E0JA 3MCAA 1KKMA 5FPYA 3W6PA 3WMEA 2GETA 4OBEA 3GFPA 4RVCA 4A0FA 3ZVRA 4EQ6B 3AQ4A 2XXAA 1SXJB 4MKGA 3SDZA 2IYWA 1RC8A 2ZVQX 2RGGA 4N0DA 1XZQA 4D4JA 4DIDA 1M7BA 2ODWA 5DISB 4URWR 1W5SA 3LW7A 3LLMA 4MGKR 3RSOA 2X2EA 3LW8A 4DEYA 2BEJA 4PPFA 4LY6A 1W48A 2ODBA 2FPMA 1BYUA 2QORA 5SZIA 1E2EA 1COWA 4P0TA 4B43A 2OBNA 2WKRA 3UANA 4PSKA 1QG4A 1UADA 2CNWD 5EZ6B 4LC1A 4NYMR 3CW2A 4R71A 4ZIRB 5CDFE 1T3SA 2QQEA 5G53C 4JMPA 1VYVA 5KPJA 3E5HA 2OHFA 4I1OA 4MUAA 2D62A 2BBSA 1SXJD 3CRMA 2GHIA 1CRQA 4EPXA 3EPKA 1KO1A 3B8HA 4HAZA 3KQLA 2OAP1 2N42A 3PUZA 4HAUA 4YONB 5FPTA 2OXCA 1C1YA 3P20A 2BMDA 4E09A 4B3GA 3A8TA 1MV5A 1NMZA 2UVQA 1P73A 1SKYB 1G1MA 3QVVA 1E9AA 2WOOA 3DKPA 1G7TA 4V03A 5KSOA 4C0JA 3AM1A 4LGMA 4Q7MB 2P3SA 4WA7A 2ZRMA 3FHTA 1FQKA 1L8QA 4FD2A 4D80A 2FZLA 1A5TA 4HLUA 3Q85A 4B47A 1Z28A 3VR1A 1KMHA 1X8KA 1YZUA 3VQTA 2EVWX 4MITA 1GZSA 2VTKA 1Z0JA 2GNOA 1ELOA 2VP0A 4PPGA 1D8TA 3ZH9B 4OHYA 2FSGA 3WP1B 4Q7LA 4Z1MD 3U7FB 4Y0AA 1PLKA 1J90A 2ZRDA 3RRZA 1KI8A 5EJEA 3U44A 1S96A 3OESA 4CEJA 3WXMA 1R8SA 2RMKA 1VG0B 4QGHA 1G3RA 1R8QA 4UNSA 4ZKEA 2W2XA 2YC2C 3TUIC 2HT1A 4I4LA 1CU1A 4RCYA 4CW7A 3AKYA 4EDHA 2C98A 1OH5A 3PEWA 1YQTA 3C4JA 4OI0A 2OG2A 3AV0B 4DZZA 4X8LA 5KSPA 1P4SA 4G5OA 1P72A 3SOPA 3TUJC 2GVDC 1XRJA 4ZDIA 4KV9A 3BFVA 5FH9A 3CH4B 3IQXA 1OKKA 1SVOA 2IYYA 2NTYC 2F1HA 4P4SA 3T5GA 2GXAA 2ORWA 3VU9A 4A36A 4A82A 1UKVY 4BGDA 3LXXA 1RZ3A 2ASEA 1KIMA 1S9DA 1LS6A 1EWRA 1W49A 1X1RA 1HV8A 3HPQA 3L43A 2ZI7A 3LAWA 1U0LA 3A4NA 2TMKA 3LX8A 1G18A 2C78A 3MG9A 3JVUA 5F9HA 2WJYA 4P4UA 1DO2A 2O8CB 1Q1BA 4YQFA 1NVUQ 4AIIA 1VCIA 4V0MA 4PPNA 3UMRA 1DAMA 1GIAA 3VR6A 1WF3A 4LJ5A 3X1XA 2J5XA 1TQ4A 2Z5FA 1ZYUA 4O2LA 3OHMA 1B23P 2REBA 3Q7QA 1NY5A 3QPUA 1DS6A 1T3HA 4G5GA 3THXB 1Z63A 2FSIA 1FL9A 4YMUA 1J2JA 2GF9A 2GJAA 5DI3A 3ZYCA 2JJ2A 1H65A 1SVMA 1OE0A 1Z0DA 1U0HC 2ZROA 3NKVA 5CJPA 4GSYA 1R0ZA 1CR4A 2VSOA 4LBYA 4P3YA 3OEHA 3KJHA 4O2RA 3B7GA 1XD2A 2WSMA 5DGXA 3BB4A 3D31A 2EQBA 3CR8A 1CULC 1AS0A 3W3ZB 3ZS8A 421PA 2SHKA 1FNNA 1IN6A 3AVWA 4DUGD 3GQBA 4Q02A 1T0JB 4BFZA 5BN5A 2C5LA 1CJKC 3BH6A 1YZTA 4JT4A 6Q21A 4MRVA 2O0HA 3SR0A 2WVJA 3NVAA 1D9ZA 4KSBA 2XNDA 1MRSA 3LXRA 2IEZA 3GLGB 1UBEA 4ESHA 5EP2A 2R2AA 4MYTA 2NPFA 2FGJA 3L0OA 1H8HA 1AQYA 1KNQA 2P65A 4QRHA 4RKEA 2R62A 3KKPA 2D74A 5J40A 3GLHE 3MSXA 2R6GA 4LYHA 3NEJA 4ZCIA 5J5CA 2ZUDA 1TQ2A 3K53A 4I99A 1WA5A 5K8UA 5SZJA 2XZOA 3KDSE 5FOSA 1OFHA 1VYTA 4XJXA 3K9GA 4PC1A 1ZC4A 4G5QA 1E9CA 5G3YA 3B9QA 1GNRA 3LX5A 3H86A 3NBXX 2HLDD 1L7VC 4BFXA 5JZVA 3S1AA 4D0NA 1ETUA 2MMCA 1UKYA 2LKCA 2GF0A 3RYTC 2F7SA 2YYZA 2V3CC 3VNUA 1X8JA 3LD9A 4Q4AB 3U6BA 1QF9A 1EX6A 2VBCA 2VP5A 2ZVPX 2V6IA 1WDTA 4IW3B 2OO7A 5ANRB 3SEAA 2V6JA 4NDZA 2CL6X 2C03A 3NWJA 3QUSA 2DB3A 2FF7A 2WMNB 1XB2A 1ESMA 1OFTA 1UF9A 3EZ7A 1XCMA 3QG5A 4LJAA 4M21A 5M04A 3K0AB 4TL8A 2ZXUA 3KJEA 4LBZA 1WCV1 4DLTA 4V02A 4GPTA 3TLXA 3L82B 4TLBA 3Q3JB 3T34A 3TVDA 2A2ZA 2W2VA 4LJ9A 4M1SA 1TUEA 3PEYA 2W6IA 2Z4SA 4G1UC 4QBHA 3VR3A 1K5DA 3FMIA 2GTPA 1U98A 4IFBA 1R0YA 4MH0R 1IQPA 2PCLA 3K8YA
chains in the Genus database with same CATH superfamily
3BD6A 3EZNA 3UC9A 3EG5A 3M5PA 3ITEA 1IM5A 5C3UA 1TVKA 5CRIA 4LJKA 5KO2A 2BZ1A 2UZ0A 5AVSA 3P4XA 4C0SA 1TC3C 1ZJYA 2BEKA 3ZIDA 4F12A 2H2WA 3D3EA 3H5OA 1QGZA 2CYAA 5DCWA 4DT1A 1SQ5A 3R5XA 2R85A 3ZMZA 2G67A 3UXYA 4C5BA 4O4HA 2EJTA 5KOHB 3HSYA 1U1IA 2FN4A 4DA4A 1LE8A 1TF7A 1FJGB 3ZNQA 4GZ6A 3DWLE 5IKEA 1XD7A 5IC5A 3EEOA 3N8GA 5T5QA 4Y9UA 3Q6IA 5LOVF 3U7QB 2BM1A 1USUA 4QRIA 1VCNA 3HU3A 5IZCC 3FWEA 2P6TA 4BE4A 3TSWA 4OXYA 2VSXA 2VT3A 3Q9UA 1RBZA 3SU8A 3PNQA 4P3PA 3DYIA 4RH3A 3QAHA 1ZYRF 3Q8MA 4PGHA 2PT9A 2BMJA 2X6OA 3RB8A 2IV2X 4COKA 1WJGA 4DCUA 2BVMA 2XZDA 1TO2E 3E0JB 4BLQA 2R79A 3LA3A 2PMHA 1JG2A 3W2EA 4QOIA 1NVVR 3GGJA 2Z30A 2X15A 4JR2A 4OBBA 4Z4EA 2XF5A 3MCUA 2JQ7A 5BV0A 1F17A 2FBIA 2GOXB 1TQPA 3N2KB 1P33A 4JOMA 1QRYA 4MV5A 3HRMA 4BASA 5DO9A 2J6HA 1TXGA 2CHFA 4WCFC 1HC7A 5REQB 2VNKA 4IQFA 3ACCA 5KHLB 3H3VK 2QNIA 1Z7GA 1QCCA 2K9MA 2VXOA 4RF3A 1KKUA 4XUDA 3KPHA 1XU9A 1QZXA 2A9VA 4OX9B 1T5IA 2WTEA 2BELA 4RU1A 1TDJA 4N5NA 4ZO4A 5JZ9A 2J5BA 3WGYA 3ZQCA 1QIKA 4CCKA 4L6AA 2XUDA 4KXQA 4Z0NA 1H23A 3U49A 3WL7A 3DDHA 1EBUA 3CRVA 4BNCA 3BJRA 2IUUA 4XLAA 3PI6A 1KI2A 1ORIA 3U4MA 5CFOA 3OJCA 3H8JA 3WU0A 4PXSA 2O8FA 3L8FA 2VKVA 1LQ2A 3S3NA 1X86B 3CINA 5HMMA 2FN7A 1R74A 3WJ7A 5PGMA 4ZK6A 4QG3A 4R1UA 1FMFA 5ES3A 1A7UA 1M76A 4ZODA 4LMAA 2ZOSA 2YWGA 3FE2A 4PV7A 2JJMA 3NAGA 2DMTA 5SY4A 1SHUX 3H1PA 3CUVA 3IQHX 1VIVA 5FL7D 1PZXA 2A35A 4EYOA 2GAFA 2YX1A 3GCXA 3ONDA 2M0CA 1ZZEA 5BSFA 1E4VA 3FBIB 1LBQA 2EBHX 1EVKA 1ZRMA 1VP9A 3T5AA 4OB7A 2NZUG 2PX6A 4IJVA 4ZDJA 3TG8A 1K7XB 3GBSA 4PX9A 3MGGA 1AURA 3DBIA 5JSZA 3HNPA 4GM4A 3AOEA 2X7HA 5HNKA 4OHPA 3HKEB 1FLDA 3BJZA 4HOBA 4LWPA 4GPD1 2C9OA 4XL9A 1G7RA 5TB5A 4MLPA 3GVXA 1RIFA 1I4DD 1L4KA 3QXCA 1CZLA 1R0LA 2ATXA 4IGAA 4CMGA 2WQZA 2DK5A 1UP6A 2ESHA 2PSJA 5AJTA 3NR2A 2ZRKA 2OUKA 1TI7A 2W43A 5TMEA 4O4JA 1YRLA 2XASA 3O47A 4GYJA 4ZK2A 4NDNE 2NU7A 2X0NA 3PFKA 1CRPA 1KTVA 5K2MA 1TA4A 1XLWA 1MB9A 2GXQA 1UBOS 1E2KA 1ODCA 4KXFB 2LH9A 4OOEA 4UXJA 1RFLA 2P1DA 2QPOA 1SVLA 4FFRA 3DCIA 3ZDBA 4EJFA 4B6FA 1A9XA 3JR3A 3BXXA 4CKEB 3GDGA 2ZJ1A 3MINB 4ON9A 3WBKA 1YMVA 1WE2A 2ZUWA 4AZVA 3L2RA 3C2BA 4LSGA 2X6QA 3KS9A 2ZJFA 2OP1A 4QGFA 5DGDA 4C4ZA 3FFXA 1NVGA 2IXGA 3DHVA 3P2IA 4KG7A 3TNJA 2JIZA 4ILKA 1L9KA 2BR4A 1REQB 4LDZA 2FU5C 2WG2A 1Y1RA 1GUAA 4DWVA 1MEJA 3LKDA 1PSDA 4M8NE 3P9PA 1U5BA 2JRTA 2XC7A 1XD8A 5ESXA 2W7NA 1II9A 2IP1A 1RPWA 4M22A 2QR2A 3ZXSA 2MSYA 3A36A 4IFTA 2JFGA 4XK4A 1DB3A 2EOAA 4N41A 2OO5A 4A27A 3MT9A 3ED5A 5JI3E 2Z4TA 4WV3A 5DPMA 1XRNA 1U2PA 1K5PA 4HAOA 2W2LA 5JLXA 4EYQA 4ES6A 2ROQA 5DRYA 4A0HA 4JKIA 3MTIA 2YDXA 2B92A 3JASA 4FLFA 2ACKA 4MRPA 1HOTA 1G9XA 4R0VA 4ENVA 3QIVA 5KOIA 1VI6A 3J7AO 3QWFA 1JT2A 4ND7A 2IHYA 1SCJA 4M53A 1NSFA 4D0PA 2BKEA 3B3AA 2X5NA 5AVQA 3WNCA 3QEJA 4G0QA 3ABIA 1R49A 1LSJA 2AI3A 4AJNA 2KB0A 5K7SA 2J4FA 2W98A 2GN4A 1RC0A 3PLRA 3RIEA 4BJ5C 5F0FA 4RAGA 3RVDA 2VYQA 3H2ZA 2VJAA 1VA4A 4OMCA 3W77A 5EJIA 3O1IC 2I8LA 2WU8A 2A5DA 3ZBQA 4FBGA 1JYSA 2ZI3A 4CQMD 4B8XA 4OLJA 3FPCA 4A3JJ 3QVSA 1IRIA 1QRDA 1ESCA 3WYGA 1SQ0A 2CK3D 1ADGA 4IMJB 4JJ4A 5BQPA 1QKKA 1VL8A 1BI1A 4JX5A 3MLAA 1GAQA 2J59A 1G3MA 2JGAA 2I5UA 3DFGA 5CFNA 1QMGA 2Q49A 5DWVA 4AJIA 1E79D 4IKPA 3O26A 3A2LA 1PJSA 2IOYA 2H1VA 1JYEA 2LDBA 1E2NA 2F90A 1SUDA 5A0TA 4NS4A 4M37A 2Z99A 1UDCA 4H4KC 4KK4A 1OX5A 3A9RA 1HLFA 1IN1A 2RB5A 5I7RA 4RE5A 1XCJA 1P60A 1R5ID 4LG0B 1T2VA 2ZKLA 4ENKA 4Q4CA 4EOGA 2B5VA 3M3PA 5C7OO 2Q1UA 2JJ7A 1OT5A 3DOUA 3VDXA 3RWOA 1ORDA 5ITZA 5BVHB 3WDLA 2V03A 4YALA 1E2PA 5JR3A 2PLFA 4E70A 1XWWA 1QGED 4HGZA 3KG2A 1JT0A 4XASA 2Y1GA 3JAKA 2Q27A 3GRCA 3ZGXA 4Q4AA 5KTRA 3WLQA 4ZZ3A 4PCAA 4OQQA 5T4EA 4FGSA 4TYYA 1L7EA 1EB8A 5IF3A 3UH0A 1GL6A 2FNAA 2IP4A 2FZVA 1GZ7A 3PQ8A 3N0VA 4FT4A 3ZQJA 2CCKA 4YRLA 1GT0C 1UBCA 1G60A 5AW5A 4P54A 3LAPA 1KJ9A 3FF1A 5DT9A 2RQPA 5EYRA 1OT3A 2WYVA 3QBVA 1C30B 3X1MA 2YIDA 5BOXA 4LLGF 3R9XA 1SBTA 2HOSA 4GE3A 1TECE 2XUAA 1SPBS 5FXMA 2P9EA 4NPAA 1QHHD 3J81K 3O93A 3GT3A 4TMXA 3NHBA 1DOZA 4WCFB 5C5CA 3DO5A 3F0CA 2WJGA 2WD8A 3L2CA 3QKIA 4KGZA 3S1NJ 2FW9A 2I2BA 2Z8XA 1U8TA 2QMEA 3KJIA 3ZK8A 2H0AA 2GCIA 1VJGA 1NFQA 2QLFA 1GKKA 2EFGA 1LV7A 2R9VA 1DUVG 1IN4A 3S8YA 1R1TA 4HPQA 4V0RA 2QQFA 1Z6PA 3PJDA 5F5XA 1X7YB 2L02A 1ZNXA 4KBFA 3LK7A 1NRIA 4MO9A 3TI7A 4OL9A 4XOIA 4MICA 2ERYA 5CM9C 4F91B 1P75A 4HNQA 1ENHA 3D8NA 1WNTA 1BOBA 4O5AA 1Y3AA 5GV8A 4U7WA 1KAEA 1QM5A 5HIIA 4I8XA 2QTMA 3AVTA 1PD0A 1A50B 2VDJA 5FWDA 5JCXA 2HNAA 1MIOB 3AQIA 2O2JA 1KYVA 2Z2YA 3IQGX 3LA6A 1LI4A 4LBWA 3RS4A 1MA0A 4MQLA 1F0PA 1NUPA 1GG8A 4U6SA 4ARAA 1EFPA 1R4ZA 4QGSA 4BFCA 1G63A 1E5TA 2XAJA 3L1JA 3ZGYA 1IHUA 3QOEA 3TDNA 5HIAA 2A6PA 4UUQA 2PTGA 2WHPA 3L7JA 3LYAA 4KQMA 4J0CA 1X1QA 2OCXA 4ZCTA 5IU6A 3BL6A 3GJ6A 2W2PA 3OTIA 2CSXA 5K8VA 4K9KA 5CVRA 1MKYA 4NQZA 3K96A 3PQ5A 2J9YB 3EY9A 4WXMA 1BHO1 2BI8A 3ZGZA 3EIFA 1RP1A 2PUFA 4ZCSA 1ZY2A 1XVAA 4RGYA 1TMGE 4MGYR 1Z5UA 2RH8A 2VK2A 3DTYA 4UBKA 5EXPA 4PX3A 3GQBB 3T99A 3WIDA 1LF0A 5C81A 1BXGB 3IWZA 3S14J 3SZLA 4BFYA 1A72A 1M2FA 4G9YA 4XWOA 2XGXA 1H0MA 3O4IA 4UUVA 3X0DA 1MLDA 2O2DA 1IEVA 2VBFA 5T3YA 3MS2A 5E1OA 1A1SA 5A3SA 1USGA 3K70D 2CMHA 4ENUA 1F2DA 4OHXA 3EGDB 2OA4A 2P7VB 1H8HD 4ERNA 2VAVA 4EA9A 2R7NA 1J70A 1ZLJA 4B9EA 2BYTA 2IE0A 3DV2A 4Q6BA 3DE1X 2VEOA 5D2CA 1YR6A 3TAUA 1ETOA 4UVGA 5TJHA 2VBZA 2GEDA 1A7KA 4MNUA 3OZUA 3LMKA 2G40A 1QGUA 4PE5B 1CW2B 1WCYA 2R7UA 4FR2A 3KJQA 4TL6A 1IHPA 3JD2A 3GP8A 3MUFA 4DBQA 1Z7BA 3HCBA 2JH8A 4EQQA 1I4EB 1YZLA 1AQIA 3IB3A 2Q7OE 4HUQB 1U3GA 1LC3A 2AQKA 3DULA 1XKQA 2ZPAA 1ONPA 3EDCA 3R0QA 1LK5A 1FRZA 2HQ1A 1Q14A 1KBZA 1G4UR 2JT1A 3L2VA 4REQA 3VR6H 2W2KB 4G36A 2OCDA 2MD0A 2PKEA 2PXHA 1U7WA 4HWTA 2W71A 1AIPA 3C6YA 1T9CA 1OLOA 1E1RA 1B15A 3FA2A 1NA5A 1E1KA 3HYNA 4EPVA 3NAMA 4XWWA 3CJTB 2GVNA 2FUCA 3LLCA 5GINE 2XWJI 1GXSB 4E30A 3FKSA 1IC6A 2A9JA 2WWFA 3L1HA 1KK3A 1RAEA 1OCTC 2OV1A 2C7QA 2IYSA 2J3EA 3QELB 3T12A 3IDAA 3OPVA 2PKQP 2I80A 4AKIA 2H4ZA 2IXFA 4BO7A 4TZ6A 2AJCA 5CNJA 2H1FA 4IHJB 2Y0EA 3OP1A 4J2OA 5CK5A 2GBPA 1JGSA 5KS2A 2Q1ZB 4Z1OA 2QVGA 4CKCB 1R3DA 1RR6A 3JQGA 3I83A 3ECOA 1HYEA 2E1OA 5A5EA 5C8VA 3QEMB 2ATIA 1KZGB 1TEVA 3LDAA 1P7VA 4TQ9A 3V32A 4DCMA 4P2BA 6CHYA 4PLHA 3NBZC 3ABLH 1SUEA 3MIZA 4OLBA 3M3YJ 1C4XA 2GN1A 3BROA 3GZNA 2K5UA 4QHTA 2C04A 2OCBA 3W9UA 4M98A 3F6BX 2ZT5A 2Z43A 4QXPA 3MGCA 4Y3UA 4IY1A 4HB2A 1MD9A 2FRXA 1QLWA 1K7YA 2R25B 4O1MA 1OMOA 3KL2A 2O8BB 1AVTA 1NR5A 2P2ZA 2R84A 3GGGA 5JH7A 3WQBA 3U3KA 4P3XA 3VR4A 5EFOA 2QM7A 3T5MA 2Q5IA 1I2CA 3DYVA 2CUKA 2R7DA 1AQLA 3CUWA 3ESCA 2ZIUB 5E3NA 4MQFB 1BGXT 2MA3A 4X7RA 3WYFA 4LYAA 3EODA 1GPDG 1OH8A 1L0BA 2C96A 1CVRA 3FOWA 2XPVA 1Q0ZA 3DE3X 1ACIA 2IAIA 1AUPA 2G5CA 2FFHA 3LTEA 1J0CA 2CUNA 4YMLA 1US8A 3VAYA 3G9XA 4DYHA 1YUMA 1J56A 5KU1A 2ZSIA 3KHKA 3E9NA 2B94A 1Z0IA 3PICA 4AY2A 2GHRA 3MJFA 1FTWA 3G1OA 1N3YA 2B4RO 2EFPA 3E15A 4B75A 3V9AA 4RLSA 1J9IA 4ZVUA 1IDZA 1TZCA 3CH5A 3HH8A 4B3DA 2CUZA 4MI6A 1QNLA 5THKA 2PIDA 2I76A 4TMKA 5B7NA 4L72A 4M72A 4UZSA 4C4AA 3IGFA 2C95A 2JRCA 2ZJ6A 1DIAA 2H9YA 3A9UA 2JD0A 1QB8A 2VKHA 2CD7A 2OFOA 1PQWA 2YJTD 3KYBA 4CI0B 4DR6B 5KDLA 1HQKA 4UM9B 4OIQF 3S1MJ 3UMJA 4E2XA 4X85A 1NW9B 2Q6LA 1YVDA 2POQX 5HUJA 3W78A 3O94A 2OZLB 4PIMA 2C7VA 3FTPA 1J8DA 1X42A 1I4LD 3VMMA 2QTVA 3D59A 3FTNA 3U19A 1BC5A 3LZ6A 4J01A 2WU4A 2WZCA 4H08A 1LD3A 3BBLA 4CM7A 3HDVA 5KYWA 3BEDA 3X1JA 4KKXB 1W9MA 3ASZA 2IE8A 3BVPA 3WQQA 1O2DA 2FW1A 1E3MA 2Y92A 3A9TA 4U7JA 4ZOEA 3AW9A 1OOEA 4OYRA 3N2IA 3ZD7A 1PI3A 4LNUB 4DSZA 3EMBA 1X74A 4OHWA 5HFJA 4EVRA 2BBOA 2FJPA 1JPVA 3OG9A 1EE1A 3ZMTA 4RB3C 1OTYA 2HVRA 3F2VA 3QM1A 1THZA 2XTJA 1EXMA 3W06A 1B9MA 4B82A 4AWBA 4UOEA 3QOXA 3LOCA 1YRQA 1SHKA 5H59A 3W6PA 2FWAA 4N9QA 3SY8A 4A0FA 2I2AA 2HB6A 3FNEA 1XZQA 2WNSA 1AOXA 1M7BA 2VCYA 2XUZA 4JP0A 2X2EA 1PS9A 3NRVA 4QDUA 1M5UA 2KRHA 4IX7A 3O83A 3L01A 5BNFA 3PQJA 2JCXA 1CGPA 4UM5A 4CG3A 4GXRA 4TWIA 4ZZLA 1Y0BA 4PSCA 2XAGA 2R92J 3B8HA 4EM0B 4HADA 1O95D 4LDAA 3CZ6A 4BNHA 4GYYA 1WSWA 1Q6YA 2NSDA 1GUBA 3MOSA 2J3DA 4LGMA 1XE3A 1PDVA 2YVKA 2ZXJA 4Q9NA 1IJBA 1A5TA 3DV0B 3VQTA 1PVVA 1EJ2A 2WVHA 4OMDA 4MSUA 3ADPA 2AR0A 3JWHA 1KQOA 3BJMA 3RRZA 1Q74A 3N5KA 1FQWA 3VBEA 1QR6A 4RJJA 5EKXA 1GCAA 2I4MA 5IJXA 4L6CA 5LA6B 1JDPA 5EHQA 2PI0A 5AOAA 2OB1A 4YDQA 4TKZA 3ZEAA 2PRYA 2G4CA 4GRDA 1SCDA 2NVWA 5BSMA 5NLLA 2B4AA 2ORWA 9ATCA 4MZXA 3C3CA 4BGDA 4CN8A 1RZ3A 3ZJTA 2JB9A 1T1IA 3B5IA 4YQFA 3EXG2 3EFHA 3CCQI 2DTZA 1ETWA 1Q84A 3TXXA 2FSIA 1FL9A 1NQOA 3C8MA 3EGVA 1ITYA 1B41A 1C0KA 1AA7A 1OUMA 4MYSA 2KJCA 1NLUA 1GU7A 4JEHA 2FWBA 1T0JB 2PQ0A 3FJYA 1NYRA 1HNNA 1RLTA 2O0HA 4DC0A 5MF6A 2VJKA 1K4MA 3JAWA 3W2GA 3IP4B 4BQFA 5EWJB 4ZI5A 1NLMA 2O2SA 2D74A 4D96A 1OLUA 3K53A 4OHBA 1YQWA 3PGA1 1X13A 2HLDD 4JOSA 2QCOA 2LKCA 4J29A 1Q15A 2F7SA 4QU9A 4UREA 4NDZA 2FQ3A 2VB6A 1NNUA 4I4TB 3K0AB 3KJEA 4LBZA 1IZ8A 2VDPB 3G79A 3PHHA 3AX6A 2W2VA 2YHBA 2K3PA 2H2IA 5FBZA 2MLGA 5EVJA 1Y6IA 5AVRA 3V7UA 3CF5F 4D46A 4HDRA 5F21A 1OCZH 2P5VA 5TXGA 1HKTA 3FK7A 1W44A 2FSFA 2UU9B 2WF7A 2EFWA 2VHVA 4OYHA 3EMDA 3MWJA 3F5QA 4N3NA 4QOEA 1OKRA 1TYAE 5JC1A 2P6OA 1MAHA 1X94A 1ISHA 2OBYA 4PLGA 1LBTA 3LPCA 1UZNA 1BL0A 5F73A 1MB0A 1JE8A 3VTAA 1GNPA 3ZC3A 4BE7B 3QY9A 1SFRA 4B6RA 3S8MA 3C15C 1IQ0A 2QAGC 3C45A 3NBYC 4RIFA 1RETA 1TEXA 1DPFA 1YRNA 4ENTA 5DSZA 3CISA 5IULC 1UOEA 5BV2P 3HABA 4M99A 4ZTBA 3FNBA 2DQYA 4F7ZA 3KQNA 3KSBC 3BEOA 4UZFA 4IRHA 1UT6A 3ICWA 5A6VA 3G2BA 2RGXA 1XCVA 1NN3A 2NUPB 3VH4A 2V4UA 5E17F 2JPCA 2H4FA 3ZGOA 5LDDC 4KQXA 3BXEA 2N3ZA 1NQAO 3ICPA 4IRGA 2RCNA 3ENZA 5INTA 1NH3A 4M1YA 1V37A 1RABA 2PQMA 3LNTA 5IXSA 3SWWA 3TLKA 1MJ9A 2SKEA 3Q5DA 4II7A 4KYIB 4DSOA 4L18B 2BEWB 2IEKA 1E9DA 5BNWA 1FDRA 3HFRA 5BUSA 2J0UA 2MH2A 2BISA 5ELLA 1JE1A 2VFAA 4BZPA 5H1YA 3DHEA 5KNLA 2BE9A 3MKYB 2QMQA 2XYQA 5TSDA 4I0AA 1PUJA 2QJRA 1NV9A 1QHIA 4HDOB 2PJZA 1I7DA 5T4FA 1QFXA 4P83A 10MHA 1L1EA 5BORA 4WEQA 3DCNA 5D3MA 2FZEA 4FBLA 2H11A 2QW8A 1DKMA 4EPTA 2X4DA 3JQPA 3LY5A 4QJ4A 3AC0A 2GPSA 1P1RA 3QV2A 4CEHB 2HGSA 2IXDA 2Z1NA 5CDUA 5I9IA 3HMKA 2O61A 3WODF 1KQNA 1TU4A 1IOVA 1Z38A 4L57A 2VTBA 3QQ5A 2J46A 1NATA 1KY4A 2OORA 4QECA 3L1VA 5CW1A 4KACA 4J0DA 2P6NA 3ZV4A 3O73A 1JMKC 4PCQA 1UAYA 4OJMX 2D5AA 4HEHA 2UXBB 3L0IB 4O5OA 5AW8A 4Y2RA 2Y48A 2GLTA 4H1UA 5KX5A 1E7WA 4P5PA 5JAUA 1CR6A 5JNVA 4DV2B 3CFYA 5AO9A 3AERA 3EMKA 3CEJA 4LEIA 1YFLA 4DR1B 4Z9BA 4WIAA 3GLTA 3DMFA 1OZAA 1KDZA 4I1VA 1VMEA 4IIDA 4I3FA 1GFWA 3ZU3A 3R0ZA 1BCRA 5GIOE 2E2IJ 5G3ZA 1QS0B 4DCJA 3N2GB 3E2MA 1V5EA 2J9FA 3KYCA 4EMBA 3D6MA 5FEMA 1PWYE 3BTIA 1JQJC 4IIFA 2HJHA 5KAFC 1U0NA 3TZBA 4ZVQA 4EY7A 5D6FA 1SURA 2X8BA 1PFWA 2P67A 5DE3A 4XM3A 1RPZA 4NDLA 4AVYA 1JDBC 2YJZA 4HLCA 3BAZA 3TW6A 4UD6A 4K8RB 3E9ZA 4M1EA 3K4CA 4V3CA 1FFCA 5ESDA 1XPRA 3N8KA 3ER8A 4X6YA 1X9HA 2ME6A 1SOWA 4EUSA 4QNRA 1E2IA 2BMFA 5KDDA 2JBAA 4DCCA 1W36B 3MTAA 5G40A 1MH3A 1L7NA 1Y33E 2O48X 7REQB 4RH1A 5J2TA 4FW9A 4ZD6A 4L16A 5HKAA 3RSZA 3R20A 2YVLA 3TXAA 1M83A 5K6TA 3RSHA 4G0WA 3IEIA 1EJBA 1JLSA 3WTCA 1TK9A 4YGXB 2VQEB 2C77A 2FLVA 4FX5A 1IATA 3SC2B 3NRCA 3GWGA 1DJPA 2VT6A 5CTJA 4NUBA 1Y7IA 5BWMA 5M34A 3KD3A 4L5JA 2M7BA 2XNKA 1BZYA 3OZAA 4EW1A 1SKUA 1DDGA 1R9GA 5KCMA 2C2OA 1Z4KA 1VE5A 4IJ6A 4CZCA 2R7XA 3DO6A 3LFUA 2PA3A 3CPEA 3G59A 4HEA2 3ANXA 2HPVA 3EIOA 1K8XB 4N4AA 1CJTC 1ZSYA 3MGKA 2ID7A 4FYMA 2X85A 3H0EA 2XKAA 2D4AA 3W1WA 2ZJBA 3W6JB 3ONFA 2AEMA 3ZUPA 1CY8A 3P96A 1JFTA 2ZUUA 3ZYZA 3OF3A 4AG6A 4S2UA 1FOKA 4PICA 3ABZA 1SIWA 4EY3A 1UDWA 4RMGA 1IDOA 1Q2UA 2YZ2A 3C7TA 4DCNA 1CIVA 4B4CA 3FSEA 3THSA 2FMLA 4F21A 4S0HB 2XLCA 3PUIA 3AY3A 2AFIA 2W4QA 2RH9B 4YIRX 3L7OA 1YE9A 3ZMSA 1P5ZB 2C0QA 1W30A 4OU0A 2AG0A 1KXJA 2DAPA 2GOMA 1JFRA 2EKDA 4DC9A 4WFKA 4JA0A 1Y8QB 4X0GA 1ADJA 4ALIA 4FYVA 2BHYA 1JL3A 2YHSA 1PR6A 3LP5A 2D5IA 5JZSA 5BSUA 3ENWA 1I3NA 2O05A 1LU9A 1PR0A 1CJUC 2ZUVA 3MJSA 3AYXB 1SHLA 3T3NA 1LI7A 1LPBB 1BHQ1 2FEZA 3V8KA 3EXIB 4MUBA 1VJ1A 4AJ2A 2P5SA 4QFDA 4M83A 4UCFA 4QUBA 4AMVA 2FOXA 1WSDA 5AK6A 4L1KA 4UQOA 7ADHA 2LTAA 4W7SA 1QVVA 3A6LA 2FRVA 1PUXA 721PA 1KL7A 3EVAA 3D7NA 1JHMA 4NH4A 1XZHA 3C1UA 1OAOA 1N3BA 4ZVVA 1TLFA 4L4YA 5TGTA 4IH1A 3KKOA 2H57A 3S1LA 3LYLA 2QV0A 4FEEA 4IKEA 4HPXB 1G21E 3GG9A 4NQWA 3R3YA 1OREA 3AV3A 3LDHA 1DC6A 4AICA 1TIBA 2V9PA 1HNZB 3E81A 1T6ZA 1N6IA 2OC4A 4IKFA 5DP2A 1M2VA 4PJJA 2QAGB 2HNBA 5HS8A 1ETHA 3R9KA 1VA5A 3KXIA 4D5FA 4G81A 4DGSA 2VPXA 4B0PA 2Z6VA 2J0QA 1P17A 1WS6A 4PR0A 5LHHA 1SO8A 4XKCA 2QVOA 4KWTA 3BS4A 1DX9A 1KZ6A 5HK8A 1K4SA 4OGGA 5CXQA 3O8DA 3OETA 1DE0A 2V7VA 3TLZA 2Y1OA 4ON0A 3V8BA 4YJKA 1MVLA 2HN9A 5BN3A 2HLPA 4XYBA 4OHFA 1WMBA 4E5SA 4FHFA 4ZU1X 3O8QA 4MPPA 1LEBA 1V7QA 1OLSA 5ED0A 3CLUC 4WEOA 3VTFA 1GGHA 5EHXA 1ONSA 5DD4A 1IM8A 5AKXA 3A6KA 2A7XA 5J3JA 2JGRA 3DEAA 1SOUA 3SQOA 1E1CA 3DDOA 3VZSA 4W9RA 1O9HA 4RMHA 1EM6A 1FP2A 4IEJA 3MTGA 3DKWA 2QVYX 3QKTA 3B9BA 1RFGE 3MJVA 1GFSA 3DLPX 1LRKA 3F7TA 1XCBA 1WMAA 3GFQA 3KSDO 1VRWA 1YQGA 4N5MA 3LRTA 1TU0A 1WZIA 5L3BA 1IPFA 5JNTA 3FKJA 5A1TA 4LLNA 1KH2A 1AV7A 1NMYA 4KQIA 4Z53A 1R9TJ 1ZH4A 2GBLC 4NBUA 3DLBA 3M4NA 4C3ZA 5E6UA 4EPWA 4D3DA 1QP4A 3IV9A 2X6XA 1T3ZA 3QX8A 1XKLA 1I1HA 5LDGA 4EGCB 5AVUA 3E1GA 2C9YA 4KAFA 4X54A 3K31A 2EFCB 1H2FA 2ZZKA 1WEKA 1FU7A 3A03A 1FSGA 2MU1A 4DY6A 3ZD9A 2L19A 3A6DA 1QQTA 3O74A 3UN1A 2I6TA 3FMQA 2HMUA 3LLVA 1CJMA 1X1BA 4BJ6A 1IDYA 4LE0A 1FLVA 4C6SA 4XQ9A 1IK4A 4B2LA 4QWQA 1SB9A 3BR3A 4MIOA 3LO5A 4PNPA 1T35A 3ZK7A 1YX3A 5M29A 3C7JA 1DRWA 4CG2A 3MTJA 2BEOA 4H7KA 5EQFA 2DR2A 2W1OA 4TYMA 3C2GA 5BT9A 4I9NA 2AOTB 2VHXA 3E3AA 4JITA 1HURA 1NZJA 4KVAA 2IL1A 4JLOA 3ONNA 4JJ7A 3CNLA 1DLIA 3PTZA 1EBBA 1WY5A 3ZE8A 3O9ZA 3KJXA 1G1AA 4Y1RB 5CP8A 4Q9KA 5E20A 1JZQA 2G6TA 2IYXA 5B6IA 2IYUA 1WQ2A 5B3KA 1U28A 1JDBB 4EJSA 1Z5WA 2IV7A 2GPWA 1EFRA 4GGGA 4RAZA 1T8IA 3ESDA 3HEAA 1WXDA 4QARA 2PUDA 2P4UA 5FI3A 2ZYAA 4HGOA 4EL5A 4FETA 2A9FA 3IUEA 1N6HA 3NS7A 1T1EA 3AIKA 3OEHD 4JBLA 3P0HA 3TB4A 3ABKH 3TFQA 4DJTA 4AY6A 4YJDA 4NTZA 3L6RA 1PQYA 4X45A 5FOWA 3PEEA 1ZKDA 2AOWA 1ATZA 4KAJA 5T57A 2IXAA 1D2AA 1FRQA 4HS4A 3HUDA 5M5WJ 1ECPA 1T3TA 4INAA 1AKRA 2ZJPF 2DJNA 1UXIA 4LYFA 4IXNA 4IGIA 5AH0A 5BVGB 4BXXJ 3T4UA 2ZSJA 2RK3A 2AB0A 5GZ6A 4HHEA 3DDCA 2DPGA 2O57A 1YDWA 5JJLA 4RNDB 3W5SA 3A1DA 3WQRA 2XRZA 2BP7A 2QRQA 1QK4A 5EUQB 5JJ5A 1N0VC 3M89A 3ZI0A 4J9UE 1IXCA 2R8RA 4M0LA 3BL5A 4HNAB 3LHIA 4BBRJ 3QXHA 4H3HB 2WV7A 2RGYA 5JY6A 2VAWA 4B3XA 2PN1A 2VPTA 1ZEJA 5ALGA 4RM3A 1Z0SA 4JC8A 1RTKA 4UDNA 2W6QA 3F6VA 5CNMA 3VBCA 1KJ8A 2Q6VA 5IN4A 3V8QA 1YHQI 3EULA 4LDNA 2AZMA 2WVAA 4XORA 3IP6A 3ZOKA 4JXXA 1VSUA 2ZCJA 1HEYA 4B46A 3RKUA 2E35A 3A01A 3JRFA 4P5EA 1QP7A 3GFTA 5FX2A 4JHXA 1YDHA 2W6MA 4BMVA 3IHKA 1J8FA 3EQ9A 1YSCA 4ZO7A 3IRRA 2BDUA 2ZJ3A 2P5YA 5JJIA 5FORA 4CKZA 4S0XA 5BNTA 3LPNA 1JQAA 1CEEA 3L46A 3MUOA 1JJAA 4TT3D 2H7XA 1OBCA 5A3VA 4B3SB 4B6JA 5EWMB 1UMDA 4OHUA 1EJ0A 4C29A 3TEJA 1BDMA 3ZWYA 5E0OA 4UTXA 2VNHA 2GBIA 2OAZA 1VPEA 4UTNA 4KNYA 4GZMA 3LQFA 1B2RA 1RZRA 4BWGA 3TOAA 4LS3A 4I66A 1JLLB 1S2NA 3HKDA 1E2HA 4C6RA 2WF6A 3A31A 4XVHA 3LA7A 4A3FJ 4R05A 5AIPA 1GHTA 4QOHA 2VH1A 3OQ1A 5A9RA 3GPCA 1QPBA 3PQCA 1BCSA 1OZGA 1T4DA 3WYEA 2B82A 2J9XB 5AW9A 3HV2A 4ZDOA 1O94D 5HHTA 4JB8A 4GEKA 4ND8B 3QODA 3LCMA 1PL0A 2IGKA 1HKUA 3VFDA 4RV5A 1W85A 4MVJA 3T7TA 4BMNA 1QNTA 4OSOA 1K8QA 1TJ5A 4OQMA 2CGEA 4ND4A 3CNHA 1YQ9A 1PKEA 2QKYA 2QE7D 3TSCA 1M3SA 1JHFA 2HEOA 4EHAA 3HCPA 3UJAA 4CM9D 4LXUA 4X1OA 3GA0A 2ZR0A 3F0TA 2JJ8A 3PTAA 2RKBA 3AIIA 4GOXA 5J1RA 2GEVA 5BSHA 4I9HA 1RQLA 4NJEA 1WXQA 4DQKA 1TM1E 3K1JA 5CDFA 1RDFA 3K9HA 2RC6A 1F3OA 5JAMA 4HDSA 3TW8B 4EY4A 2W0SA 3ADBA 1C1XA 3W8DA 3JRNA 4HTFB 4FW8A 4ER3A 5LYYA 5DCLA 5JARA 2M1ZA 2JFUA 1JR2A 4L5AA 2XMZA 1ETKA 4OFXA 4J6EA 1FLAA 2YPRA 1Y3DE 1NLYA 3OCJA 3ZE9A 3IEUA 4FP9A 4C2BA 3VSEA 2V7UA 1KXZA 4TWRA 4TM7A 5KAMA 1WH5A 2QRKA 3HPGA 4H0EA 4JWKA 2GBFA 2R5WA 3GLIA 4HAXA 2DGDA 5E9JA 3AB7A 3ZN1A 1CV2A 1S2OA 2V65A 1QX3A 3D4IA 1VKOA 3N8DA 1HF3A 1JQEA 5KAIC 2D2FA 4BNLA 1R5BA 5FFMA 2LOOA 3F73A 5K7ZA 1DKLA 2XWPA 3F9RA 1NP3A 3LT2A 3U37A 4DR3B 2FPIB 4QUAA 1C0PA 1Z13A 4H0NA 3OZIA 5AI8A 4Z7NB 4KNWA 5D51S 4F2HA 4BNUA 2HU9A 4K9PA 2XF8A 1P4GA 1T0UA 1ZD3A 1FW6A 2TDXA 2AG6A 5L4LA 3RK1A 2I55A 3UMMA 1EFCA 5LCXA 3B52X 2OK8A 5DHRA 3BGOS 4UHBA 3EE6A 3ZZ0A 4CM4A 4ZVSA 1VQMI 4PAMA 3EARA 4MB2A 4R98A 2IXEA 3AEQA 5C1OA 5EP1A 3S7TA 4XDYA 3B70A 3HRHA 5T64A 2E7XA 3LX4A 3VO8A 5GWXA 4DDWA 3TIIA 4M6YA 2L4AA 1KBOA 3IBGA 5K6RA 3NV9A 2OXRA 1SKQA 4BZZA 4FR0A 5B6JA 1F20A 4YMWA 2UYCA 4QELA 4HQMA 3A9VA 1NU6A 2AWOA 3JQ7A 2LIPA 1NNSA 4DKJA 1RC8A 2ZVQX 2RGGA 4EGSA 4CV2A 5DISB 4BMZA 2BGRA 4QUDA 2CD9A 2BEJA 2R8PA 4PPFA 1T1JA 3PKIA 2QORA 4XJVA 1COWA 4HFRA 4P0TA 4BLUA 2IQIA 4A1OA 1XZDA 1M6VB 2W22A 1SQSA 2L7FP 4R84A 1FDOA 3KV1A 5DZSA 1YU6A 5ALXA 3P20A 1OPCA 2VI5A 5H9VA 4EFDA 4UDYX 4D44A 2ORED 3ZU4A 1NMQA 3TLJA 3RFUA 2JGIA 4BWVA 2EZLA 3Q85A 1Z91A 4LG3A 2RCYA 4DW6A 3WTVC 4D56A 5LBUA 1Z0JA 3E9RA 2Y0BA 3I55I 4HZGA 4KSYA 1E7SA 2K7LA 1V48A 1OBFO 2RMKA 3BJAA 4YWJA 2HQRA 1I27A 3O91A 4G1BA 4DZZA 3SGLA 2ADOA 1WJBA 4G5OA 4Y17A 4QVIA 3BG5A 3R3ZA 3LXXA 2VUTA 1FIPA 3RPUA 3V2UA 5J1TB 3KTOA 2AZDA 3D4LA 2RBGA 3BMNB 1DO2A 1XU7A 3HN7A 4MDHA 1YQQA 4ABZA 5AIAA 2E34A 1VFNA 3L9WA 1WV1A 1H65A 4GSYA 4LBYA 4O2RA 1DTEA 5CEEA 2P90A 4ZYGA 1WVMA 4LYYA 1QANA 3PC2A 5DCFA 3OCXA 5T4BA 3IUOA 2UYHA 3ROKA 2XNDA 4H0FA 2FPRA 2PT6A 2V0GA 3C5VA 2AFHB 5J40A 2VPQA 1Z7WA 3IP5A 1OFHA 1I8TA 1B43A 4KUMA 2DFFA 4YRMA 2VCEA 3AB8A 1GLGA 1MOSA 1ARZA 1NBAA 3S1QJ 1OCEA 1U7HA 2KS6A 2E2WA 1DHTA 1G3WA 1OX6A 5B2FA 3Q3GE 4N5LA 2XZTA 5M04A 2O5CA 3CH6A 2XIGA 5DMHA 3T41A 4DLTA 5T67A 3L82B 4DR7B 3HUGB 1ILWA 2R00C 5SICE 1LLDA 1IQPA 1DJLA 2W82A 4E7JA 1UP7A 4EHKA 3ONVA 1SXGA 3D2AA 2N46A 3OFSA 2PAFA 3V4PB 4QO7A 2Q6TA 1G64A 3V97A 1F1ZA 2EJBA 4X6UA 3RODA 3TWOA 4L4ZA 1DAIA 1Z26A 1EQUA 1UMBA 2NVUB 4P0PB 5FOUA 2BGIA 1LQTA 1N8TA 2ACWA 5KDOA 2AG5A 4DLPA 3MQ0A 3RANA 1R2QA 3HOZJ 4N7JA 4OB8A 2VASA 2B2NA 4JJEA 5F1YA 5K05A 5SYMA 5IAEA