1S9HA

Crystal structure of adeno-associated virus type 2 rep40
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
268
structure length
268
Chain Sequence
AGMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the SF3 Helicase from Adeno-Associated Virus Type 2
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
molecule keywords Rep 40 protein
total genus 72
structure length 268
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1s9hA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9hA02
4KHZA 1EG7A 4OBEA 3QF7A 1KAOA 4LI0A 3NEYA 2BV3A 2NZ8A 2WSSA 2QP3A 3L0PA 3LXRA 2GCNA 1WBBA 1LTQA 2X8AA 2QZ4A 2GAOA 4QM7A 2W2VA 3BH6A 2QM8A 2O0HA 1P9WA 4B35A 1D9XA 4ITRC 2ZSDA 3B85A 4M8NE 4TYNA 2AN9A 2ZRJA 3MCAA 4RZXA 1GP2A 2F3RA 4JVLA 3DOEA 5L3RA 4HB4A 1UKVY 3A4LA 5IT5A 1W46A 1YU9A 4JLVA 4D4LA 4M1OA 3VX4A 1SVOA 2OUKA 3DO6A 1VKJA 4Q1AA 2ZRAA 4ARZA 4NCKA 2JJ2A 5F2EA 1IBRA 3KKQA 4QL3A 1XPUA 2OEPA 3BS4A 1BYUA 1KY3A 2Q3HA 3EXAA 1C9KA 3E1SA 1KYIA 2GXQA 1OB5A 2C77A 2ANCA 3A1TA 2IF0A 2R6CA 3JVVA 3Q5EA 3A1VA 4TL7A 3TAUA 5JECA 2BDTA 5GADl 1II9A 4U7DA 3LRPA 4B3DA 3U44B 1BYIA 3HU1A 4QC2A 1GIAA 1E69A 5GJVC 3SR0A 4Q1CA 4EDHA 3B6EA 1LVGA 2IYLD 4L16A 3AKYA 2CL7X 1GRNA 4U5XA 3THOA 1X8KA 3CZQA 2GHIA 1ZUIA 4KV9A 3KJGA 3CW2A 3THXB 3CF2A 2JLXA 1O87A 1E79A 3EC2A 4O25A 3ND9A 2ZAMA 2BKEA 3ZQ6A 2REOA 2BBSA 2V7QD 2R6FA 4W9MC 3P1JA 1SZPA 5KNCA 5KDOA 1QBKC 4HAVA 1U99A 1AQUA 1GKIA 1KI6A 2XB2A 1SXJB 3VKHA 5KNDA 2GESA 2IXGA 4Q4AB 2FFHA 4TLEA 5LD2B 1PUIA 2ODNA 3KTAA 4OHZA 2QT1A 4BFWA 2CMKA 4TMKA 2QROA 3LBNA 3AUYA 3T12A 3TLXA 1UAAA 4IVPA 2D2FA 4UNNA 3N70A 4D80A 2DFLA 1D2NA 4TLBA 1JR3E 3K70D 4TWZA 4CEJA 4EIWA 4ON9A 2BWJA 1WDTA 4JKIA 3CNLA 1M1YE 3VMFA 4A2QA 4AKHA 3KJEA 2HUPA 2WV9A 2GXSA 2R65A 4TMWA 2XEXA 3FHTA 5JI2E 2I3BA 1AQYA 1WF3A 2FWRA 4M1KA 1RKBA 3K09A 4PPNA 2DY1A 3QKSB 2O8BB 1MO5A 4NU0A 3AGQA 3WYGA 4RFSA 5C1BA 3AB3A 2YOHA 4B48A 2HJGA 1NLZA 4QGHA 1MR3F 1NN0A 1K5GA 4B3GA 521PA 3EASA 4Q9JA 3MJRA 3GLFB 2WWIA 4MGZR 1E9CA 3FMOB 1RRCA 2NO6A 1VPLA 3N2IA 4CYMA 3A4MA 5LDDC 1R10A 4IKEA 5EXTA 2FJUA 2XZOA 3RS5A 1G4UR 1G5PA 1G8FA 1ZNWA 5DH9A 2IYWA 1OFTA 3T61A 2FE4A 3FFAA 3PQCA 2MSEB 3SBEA 3IHLA 2O8DA 1EX6A 3ONWA 1TQDA 1KI7A 5JFGA 1NIJA 1YHNA 3W9YA 3AVOA 2OCBA 2G1KA 1KO5A 4LBWA 4B2LA 4CVNA 1JAHA 3H84A 2LCFA 4FMCF 3X1ZA 4DLWA 1FFHA 2QMUA 3GLFA 2VP0A 1RW4A 2IWHA 2VP4A 4TL8A 2JLQA 4UKDA 3LBIA 3I1FA 2ERYA 3B1WA 3K0AB 5TDHA 3QKRB 3I8SA 121PA 2XTNA 2A5YB 3SJBA 5J4KA 2RGBA 3SC3A 3KFVA 1Z07A 5EUQB 5G3ZA 2ONKA 4F93B 3U7FB 5E7JA 3QSYA 2WKQA 1KI2A 2PJZA 2CHGA 3NH6A 4D0LB 4N0EA 5FBQB 4LHXA 3U3OA 5DNYB 3EWSA 3IUYA 4WW0A 2ZM5A 2O52A 1AZSC 2C96A 5KSYA 1KNQA 1L7VC 4V0ME 5C4GB 4DB4A 4A0RA 3L82B 3CO5A 4A82A 4CEJB 3R9WA 2JIZA 3GJ3A 3MUFA 1G7TA 1KO7A 2FPKA 2IW3A 5FOXA 1KKLA 4URXR 1YZTA 1XJQA 2BKUA 2YWHA 3LY5A 4IXNA 2FG5A 2F55A 2VHQA 4HATA 5CIWA 2FOLA 3C14C 2HCJB 1R6BX 4Q1DA 2IHBA 4E07A 4P33A 5JEDA 4DLUA 1OT3A 3VR1A 4B75A 1ZM3A 5HE8A 4OQNA 4PHFA 4XD7A 3GLIB 2ZI6A 3VQTA 5TVKA 5BYKA 1E9RA 1T91A 3K09C 1JALA 2XSZD 3CB4A 1KKMA 5JWHA 4KFSA 1FQJA 4II7A 4C7OA 2G0TA 4ZDKA 1NVXQ 3OEEA 1Z47A 5GJCA 3G0HA 1J99A 1GRRA 2EWWA 3S1AB 4MDEA 4DSUA 4PR0A 2OAP1 1KSFX 2JDIA 2O8FB 3D31A 1IHUA 4NMMA 2OBLA 1Z0DA 5JI3E 4HZUA 4DC9A 4IDQA 4NZYA 1CEEA 1N0WA 2BEKA 2J46A 4PC7A 4C9BA 2VYFA 1QHHA 4RZUA 3PEWA 1TQ4A 3WYAA 1NVUQ 2BBWA 1TUIA 2QE7D 4O2RA 1N6IA 1DAHA 1CBUA 1K6MA 4CRWB 1JR3A 3C5HA 4QM6A 3HDTA 4G5RA 1WMSA 3H2YA 2QPAA 4DWJA 1ETUA 2BM1A 5FTJA 2AXNA 1DAGA 2IL1A 1YR6A 5L3QA 5HZKA 3THYB 2D4HA 3EG5A 1XMSA 2JA1A 2IYVA 4KCGA 2XNDD 4G3XA 2NTYC 3TSZA 1TF7A 2ZRNA 3U4QB 4GL2A 4YXWA 5FUWA 3REFA 5DYGA 3QG1A 5DLQC 3T1QA 1UBEA 3K9NA 2OBNA 4GOJA 5HZHA 3OFND 1FUUA 1VCMA 1NL3A 2PZEA 3LFUA 4M53A 3DEFA 3CX6A 3SHFA 5J5CA 5E7MA 5CJPA 1T0JB 2PZGA 1A7JA 2P6NA 2QNRA 3C4JA 4PHTA 3THXA 5FL3A 1E2DA 2ZJYA 1W4BA 2PLRA 3LD9A 1ZNYA 3SS8A 4V02A 3SFVA 4UJ5A 1XTSA 4E5UA 2GDJA 2CHQA 2BC9A 4C0LA 1YVDA 1XB2A 4H1VA 3CRRA 1E2PA 2JCSA 3VU9A 2ZPTX 3IO5A 4ASUD 1N6PA 1E1QD 3LVRE 1G41A 1KK3A 2CE2X 2HCBA 2GCOA 4R9UC 4LHZA 2VP2A 1KI1A 4OQLA 4RD4A 2CLCX 5J4VA 2J59A 3MD0A 5B64A 2O8EB 1OHHD 5IRCD 2NG1A 3U7EB 1N2CE 1EWQA 1XXHA 4MDFA 1QG2A 2WMNB 1G291 3ZJYA 1VIAA 2QE7A 1FUKA 4DKXA 3RRMA 1SVSA 2BMEA 721PA 3CH4B 4G01B 4FCTA 4Z8YA 2B8TA 4OI0A 1KDRA 1T3SA 2DWPA 2VHTA 1E0JA 4IOMA 4TYYA 3MWYW 1E2JA 1COWD 4QOSA 2GBLC 1XMJA 4XWAA 3CPJB 4MRPA 2J41A 3BAFA 2C99A 3RHFA 1YR9A 1U0LA 4F4CA 3QKTA 2D3WA 5JLJA 4JIMA 3T1VA 2QBYB 2W00A 1XD8A 2KE5A 3GPLA 4IOLA 5JS8A 5DI3A 1S4QA 3LWNA 4W5HA 3SYNA 1OH8A 3VX3A 1E99A 2EFGA 1DAFA 4I1UA 4KU4A 4ACAA 1IJFA 1E4YA 1GFIA 3Q7QA 5HE9A 4IEEA 1ZAKA 1U81A 2ZI9A 3NKVA 2FGJA 3PCRB 4BFSA 2AK3A 1DO0A 2ZE8A 3U2QA 1XWIA 2RGXA 1IXRC 4L5BA 5FTNA 2E1RA 3GMTA 4RKFA 4FMCB 4JSYA 2JATA 1DG1G 3SZRA 3LA6A 1ZM7A 4D82A 1W0JA 1I2DA 2EFCB 2DCUA 4P0TA 3BFKA 3BGWA 3IIJA 2LWIA 3TBKA 5DE3A 4Q4HA 5EZ6B 4DSOA 5FBLB 5EQTA 3FMPB 1QHSA 3BD9A 1NIPA 1SXJA 5AJXA 3WP1B 4ZCMA 4M9QA 1FTNA 4GFDA 4ZPXA 1JI0A 2GZAA 3KXLA 1VG9B 2R9VA 1U2RA 1KJYA 1FMJA 1R0YA 4OJQA 1MH1A 1U98A 2HXYA 1DOAA 3F3YA 3SN6A 4FN5A 4A2PA 5JBQA 4TZ0A 2IX3A 5BWMA 2NQ2C 4RJLA 2EFEB 2R8RA 5L3VA 3VAAA 2GILA 3OE7D 3O47A 4D25A 4V0NA 5CITA 1NBME 4LYFA 2PCJA 5JZVA 2HXSA 1G3UA 1XCMA 3Q8XB 2J3EA 4BLOA 5KDLA 3GFTA 3CZPA 1OYYA 3BIFA 4NCIA 2C9YA 3QPWA 4NCNA 4LJ7A 4URYR 2G3YA 2V1UA 2GJ9A 3O8BA 4XTRA 2QPOA 4RZ3A 2LKDA 2ZYTX 4W5WA 4YC7A 4I99A 1G5TA 2CVHA 4F92B 1ANKA 4QGAA 1LB1B 1XMIA 1SXJD 2YV5A 4URUR 4CZ2A 4FMDF 4HAWA 1A4RA 1KY2A 3RS0A 4MUAA 4GOXA 3K70C 5D3QA 4MYTA 4CF7A 1XEXA 2J0SA 1FPMA 3U61B 4XVRA 3QXSA 1NVWQ 4FCWA 1GKUB 4ZDIA 2O8EA 2PEZA 2IS4A 2Z4SA 1IN7A 2CJWB 2ORVA 2ZE5A 2ZUCA 4TYQA 4TZ6A 4IVQA 2IUTA 3CF0A 2V54A 1GWNA 5JS7A 2GXUA 1P2VA 4EPTA 3CPHA 1ZNXA 3W6OA 4FXPA 1WA5A 1QHGA 4MITA 1T0HB 1EFTA 3I73A 4BE7B 4ZKDA 2ZJ2A 4Q4HB 3NC1C 5EE0A 4TSFA 1SHKA 3LXXA 4BFVA 3SQWA 2IS6A 1SVLA 1Z28A 3HPQA 4NDZA 4AD8A 3GJ5A 1B0UA 1DG3A 1L2TA 3FWYA 3LNCA 4TLCA 2PMKA 1YJ5A 3C41J 4IW3B 3R20A 2V1XA 4ZI2A 4C2TA 2NMVA 1GUAA 4JL6A 1N6HA 2EVWX 4WAUA 2WWHA 3TR0A 3R9XA 3LX8A 4LOAA 4EKDA 1XEWY 1HA3A 3WYFA 3VR3A 3U6KA 1R5OA 2RMKA 3E5HA 3QUSA 4DB2A 3WMEA 3AP1A 4Q7KA 5FOVA 4B2IA 1AZTA 2IHYA 3I72A 2Q0HA 1SKYB 4BRWA 5TB5A 2YWEA 3ZVNA 2DB3A 2QMOA 4Q19A 3K0CA 5FBWB 3UWKA 2UVQA 3ZD6A 3NC0C 1KGDA 1TUEA 4CDGA 6Q21A 2QBYA 3WP0A 4D0NA 1OIVA 2GJ8A 4BZPA 3O8RA 4B2PA 3FHOA 1Z29A 1R8QA 1G6HA 2KSQA 3EPHA 4I4LA 4TQAA 5KNBA 5H1YA 1AGPA 1UPTA 1YQTA 3LLMA 2AKAB 1E9BA 2F7SA 3RS2A 1ZUNB 2RAPA 1OXSC 1XCGB 4Q7JB 5CK4A 4YMTA 5DN6D 4L9SA 5C18A 2C5LA 3K0FB 3FDIA 4M1MA 1G4AE 1WE2A 1W49A 2CNWD 3LVQE 2Y8EA 1OFHA 2BM0A 4HLDA 4IDNA 1GL9B 2VRWA 4PHGA 3W3ZB 2DFTA 1GDDA 1OKKA 4HZIA 5EE1A 1NJFA 3QXHA 1IN6A 3REGA 421PA 2ZUBA 2VEDA 2V9PA 4UQOA 3AEZA 3TQCA 3BE4A 2ZIAA 4JBYA 2ZRPA 3TH5A 3GLHB 2A7QA 4B74A 4MYCA 1X1SA 4ZCIA 2WWFA 2ZTSA 5F9HA 3IEVA 4NYIQ 4U00A 4DXAA 3LW8A 1MOZA 1WXQA 1EFRD 3D8BA 4NBSA 1NBMD 4RKEA 5JRZA 1KO4A 3KDSE 1T5IA 2QA5A 5GVSA 4Y0AA 1NVVQ 3TW8B 1W36D 1ZCBA 1ZNZA 2GK7A 4M1WA 1YR8A 2ZS8A 3QBVA 4NCHA 1SVMA 4HAYA 1EX7A 5EXXA 5FUXA 3U3MA 2DR3A 1Z8FA 1NY6A 1QHYA 2PT5A 4IVRA 1DAMA 1ESNA 2PMDA 4LWZA 4IHQA 1W2HA 5FR1A 3B1VA 3KZ1E 4EPXA 3MWKA 3TSWA 2C98A 4LHWA 2DPXA 4JSTA 3UPUA 2YNMA 2ATVA 2JGNA 1OH5A 3EPJA 5BN4A 3EC1A 3LBHA 2MMCA 3AP3A 1XPOA 4JLKA 4KYIB 1SULA 2XJ9A 4Z51A 3BERA 3JZAA 2B8WA 3B13B 4KITB 2UZ3A 2AL7A 4PQRA 1BO6A 1UEJA 2W2TA 1TAGA 2NIPA 2P2LA 4XD7D 4KSBA 4HDCA 4LCBA 5CB8A 1P73A 3I5YA 1Q1QA 1QVRA 4LPSA 3CRMA 3DMNA 2GZDA 3M4YA 2D7DA 2QTFA 1TU3A 1G3IA 1F48A 1S8FA 3SOPA 3P20A 2JDID 2F1JA 3TW4A 1NN3A 3QF4A 1NN1A 3RS4A 4MQBA 4BLQA 3ZGXA 4AG6A 3WBKA 1SHZA 1NG9A 2WSSD 4LK2A 3CM0A 1N5KA 4PANA 2DFNA 2BJWA 2IBMA 3ZZ0A 5FTLA 4BRUA 4IFEA 3T06B 1E98A 3WNBA 4A15A 2ZJ8A 1G8PA 3IBGA 4ABYA 1VTKA 2HYIC 3NBXX 1OE0A 4QNRA 1CR1A 1R5BA 3RSOA 2PZFA 4LC1A 4YQFA 3ZZUA 2GTPA 2C95A 2ATXA 4LBVA 4M0LA 4MYUA 4C3ZA 1IN4A 4MKGA 5FTMA 2OXRA 4BFYA 2R62A 1UKEA 4B3CA 3HU2A 3BORA 2V6JA 2X1VA 4UNSA 1CRPA 1G7SA 4XH9B 2JJ8A 3MG9A 3KX2A 1R0XA 1G7CA 1OXUA 4OQMA 2QAGC 1MO6A 2CCJA 1Z2AA 3OF5A 4LX0A 3CPEA 5JCPA 2J0UB 1FMLA 1Y63A 2J9RA 2J1LA 1W47A 1NF3A 1OFUX 4NE2A 2P5SA 2RCNA 1U94A 4OHXA 3TRFA 1KZGB 3GJ8A 1VCIA 4FCVA 2IUSA 2BBTA 3EA5A 2ONJA 2FU5C 1L4YA 4TMXA 2WWGA 2VP9A 1G7RA 2P3SA 3J81k 1ZUHA 4DLZA 3A1SA 2VA8A 2VH5R 1WQ1R 4XIGS 2EWVA 1US8A 4IRUB 4Q00A 1FX0A 4DIDA 3GLFE 3HR7A 5H8WA 4LSGA 5J40A 3FE2A 1YRAA 4TMTA 1PZNA 3ZS8A 4M4SA 2WSMA 4KXFB 4WZ6A 1I4DD 1VHLA 1NKSA 2OFWA 3BC1A 4MGKR 4DDVA 5KSZA 4JLAA 4M1TA 4BASA 3QPUA 4NYIR 3B7GA 3T35A 1M34E 5FR2A 1BH2A 5KHOC 2YHSA 1W1WA 4PZZA 1WCV1 1MABA 3FKSD 3QJYA 2C78A 2IA5A 3P4YA 4X8HA 4C0HA 1KAGA 3MWJA 3VTKA 1U90A 1M7GA 3QXJA 3QQ5A 3TMKA 2ZUDA 4A9AA 3UIEA 5JCZA 4HUQA 2V55B 2O0JA 4KO8A 1SVIA 4B76A 3QF4B 1OIWA 5F98A 1W7AA 5AUOB 3PFIA 1GTVA 4C0AC 1DBSA 2R6DA 3OIUA 3UWOA 2MMGA 1Q3TA 3CRQA 1KI9A 4AWXA 1UFQA 3IPYA 3CBQA 3HWSA 3PG5A 4LJYA 1OFIA 4C4PA 5EP2A 3KQLA 1HYQA 3F5FA 2XGJA 1CP2A 4LJ8A 1IXSB 2HLDD 1Z0IA 1W0KD 2C9CA 4IOJA 4C2UA 4LV6A 1EXMA 3QEJA 5FPHA 3HJNA 5LB4A 3T5DA 2OFOA 4NYMR 3RWMB 4Z8XA 1G64A 4BEBA 4QHSA 3W34A 4D81A 4PTLA 2YJTD 3W8RA 1F2TA 4OYHA 5IHPA 1Z6YA 2CNWA 1CU1A 2GVDC 2UZIR 5HCIA 5SZHB 5K8TA 4B3FX 3EA0A 4P4UA 1VYVA 3MMPA 2XJ4A 4GBMA 4OK3A 4QG7A 4A8JA 1E2LA 1FW6A 1E0AA 1HQYE 5FOWA 1Z22A 2NO7A 4B44A 5FBVB 1X3SA 1I2MA 1RVDA 1E4VA 3GJ4A 1N6OA 4K46A 1Q1BA 2I4IA 3CX8A 5JJLA 3SE0A 4MGYR 4HLQB 2A78A 4TTQA 3KUDA 1D2MA 3B9PA 3V4RA 3Q72A 4CEIB 1CXZA 2Q9CA 2NPFA 3IIMA 1SKQA 5HTKA 1ESMA 4QBGB 1DAEA 3DOFA 3HYTA 4LY6A 5FPYA 1JJ7A 1U9IC 2IF2A 2N46A 2RKOA 3B1XA 4B33A 4ZIRB 3F8TA 1Q22A 1DADA 3I3SR 4JYCA 2FFBA 3CKLA 1AKYA 3DMDA 2WOOA 4I1SA 5CYOA 4HZUB 4YLGA 2ZU0C 2DYKA 4WA7A 3WXMA 1KDPA 5K8IA 5TV2A 3GLHA 2A9KA 2CL0X 8OHMA 2K5UA 5CM8B 2GAAA 3AF4A 2FZ4A 3SJCA 4DLTA 4OK5A 3CX7A 2JASA 4TT3D 2G0NA 1NMXA 3CNNA 2VTKA 1UM8A 1F5NA 3K1JA 2OESA 3EAQA 3IEUA 1C1YA 1F2TB 3WNDA 2HJVA 2Q9AA 2X77A 1YZGA 2WJIA 4LJ4A 3D6TB 4M1YA 4P4SA 3ADKA 4QXAA 3GLIA 3B8HA 3H86A 1T3LA 2JJ1A 4TN1A 2CCGA 4TTPA 4V03A 4PSVA 5SZJA 5JJKA 5GJWC 4PZYA 4D4MA 4YMVA 2ODWA 1RC8A 2C03A 3LH5A 2J7PD 2FMXA 1E2IA 2FFAA 4HB2A 1PLKA 3HYRA 3OZXA 1U8ZA 5AWFC 2ORWA 5JMTA 2WTUA 1GM5A 4M9SA 1ZD8A 1AN0A 4BLPA 4OHVA 2P65A 1AGRA 3T34A 3D7MA 4FD2A 1W2GA 4FIDA 4DDUA 2G6BA 2OAQ1 4Q47A 3OEED 4G1UC 1KK1A 4RZ2A 3AVWA 2A2ZA 5J47A 1E96A 1E1RA 5KSOA 3FHCB 1N0VC 5G41A 1N6NA 3U3JA 3FMFA 4ACBA 4E09A 4RVCA 1N25A 5FH9A 4ERNA 3BXZA 3FYHA 3CIOA 2AFIE 3DKPA 4M1SA 5EE5B 4Q02A 5G3YA 4US1R 4X8MA 5KO2A 3E2IA 2A3RA 5FI1B 1JR3D 4NYJR 2YINC 4B43A 3VKGA 1F2UA 5L8VA 3FMIA 3MJHA 4DCSA 2CL6X 2HF8A 4RY2A 5EXPA 2IUUA 3U4QA 3A1UA 2YWFA 2BMJA 2WOJA 5A5GA 4NHOA 2QMEA 5KTYA 1FTSA 4NONA 4C0KA 2YWGA 4I1VA 2BVNA 1E9DA 3KQUA 5CB6A 4OQXA 1S3SA 3DZ8A 4KSCA 1NP6A 1ZRHA 4US0R 1KSGA 2YOGA 5FTKA 1PJRA 4PAOA 2F6RA 1SXJC 3EIHA 3GJ7A 3DDCA 1XD9A 5LD2C 4K81B 4LRWA 3U5ZB 2OO7A 2XZPA 1JPNA 5JRJA 2QAGB 3AVXA 3P32A 4RSGA 2IYQA 3BB1A 5KOYA 1II8A 1W44A 1C4OA 1CJVC 1KI3A 3OIWA 2Q3MA 1VYTA 1NG1A 1E2KA 4Q9HA 1Q1ZA 1JEEA 1EFRA 1D5CA 1RJ9B 3B78A 3IO3A 3LV8A 3A4NA 3QVVA 4JBWA 4F7WA 3QKUA 4YMSA 5JSZA 1XTIA 2D74A 4GSYA 2ZSFA 2Z43A 4HSEA 5FL7D 4B6FA 3W6PA 4LYHA 4G5OA 4P32A 2QPTA 3NHBA 1W5SA 3FFBA 1VIYA 1JBKA 3WMFA 1LY1A 3GD7A 1ZBDA 2H57A 3WMGA 3ZZTA 3DPUA 1XXHE 3QE0A 3M1IA 4MYHA 3NTUA 1T6NA 3I8XA 4Q9LA 4MRRA 5EJEA 2HEIA 1Z0FA 4B71A 1XCPA 3V00A 1YE8A 2ZANA 5CK5A 1G8HA 1QRAA 4Q4AA 2ANBA 5H68A 5IDVA 1JPJA 3SEAA 1DPFA 1DEKA 3BFXA 4GT1A 4BFUA 2ZRKA 3AF0A 3PEVA 1IY0A 2VSOA 4IXMA 2OHFA 2H7VA 3GP8A 1DAKA 2D2EA 3OESA 1T9HA 2XXAB 3TIFA 3AVPA 4DLVA 1PV4A 4B3BA 2EFDB 1S9HA 1RZ3A 3NDBB 3UMSA 5HCNA 3QI2A 2F1IA 3SQXA 1JXOA 2HLDA 3EARA 2ZYVX 4NTZA 4D6PA 3KKPA 2IYRA 4I1OA 5DYIA 4Z54A 5HKKA 1CJUC 1HEIA 1LF0A 3ZD7A 2QL6A 2VL7A 1U0HC 3FB4A 4EPYA 2B7BA 1AJEA 4QBIA 3IHWA 5IK2A 2ZEJA 1G16A 1AKEA 2AK2A 2W0MA 2WWXA 4A8JB 2F9MA 4R71A 3ND8A 1UDWA 3A6PC 5J4HA 2VP6A 3AM1A 2FSHA 1KSHA 2IYXA 1S9DA 4EJSA 1IN5A 2ZI3A 5FBRB 1P3JA 1ZIPA 3KJIA 4CEHA 4N1AA 5L3QB 3THYA 2WJVA 2ZRCA 3I62A 2CXXA 3HP1A 3LQRA 1P4SA 3JVUA 4XOIA 2ZU6A 2V7QA 4IEIA 2O8DB 2ZETA 1IQPA 3C8UA 1UEIA 2BCJQ 1W36B 4POAA 2PJRA 1E2EA 3ETLA 2PH1A 1U8YA 1DVRA 3GJXC 5D3MB 4XWKA 1JEDA 4WXPA 3THWB 1CR0A 2KB0A 2H18A 5C2JB 1TADA 4AIIA 4JVNA 4K8OA 1LS6A 3BB3A 4KODA 2FV8A 1GNRA 2ZJAA 3NEJA 5AR1A 1NN5A 1R0WA 1ZW6A 4R98A 2W83A 4IFBA 4TQ9A 2XTZA 3PUWA 5E7IA 3RS3A 1T3HA 3Q9LA 1HT2E 3L2OB 3ZQJA 4ZIRA 1GL6A 2OXCA 3HPRA 3HR8A 3VNUA 4A1FA 5J4LA 4RD1A 4GZMA 4XSGA 1KOFA 2CE7A 2KBFA 5UKDA 2IYTA 3TSOA 4BLRA 2A5DA 5IK2D 4PC3A 2O8CB 4GPTA 2G83A 4LBYA 3GFPA 1Z6XA 2PL3A 2V4ZA 4HEJA 1Q12A 5HPYB 2QGZA 3KJHA 4QNMA 1GITA 3IDQA 1CS4C 1E9EA 3X1XA 4AKEA 4RD3A 4KJZA 4U02A 1F60A 3EPLA 2GA8A 2NPIA 3MRSA 1FOEB 3VR5A 1IM2A 3NDPA 4X8LA 1M8PA 2C9OA 1AA9A 2WM9B 1LNZA 4OQFA 3U7HB 5EP3A 4KFUA 1ZIOA 4D4JA 4AURA 3WBJA 3G5UA 4C0QC 3FKSA 1LS1A 3L0IB 1Y3AA 3I4LA 1BIFA 4JLOA 4H1UA 4J0QA 3IILA 2ZS9A 3WY9A 2FGKA 3KQHA 1ZVQA 2ZSBA 2PT7A 3I61A 3RNLA 1ZJ6A 1VMAA 1E9AA 2DFKB 3CWZA 4LJAA 4DLRA 2AWOA 1AS3A 2ZE7A 5DI3B 3UG7A 4F38A 4KLZA 1GKYA 4Q1BA 2AX4A 1QZXA 3WRYC 1KK0A 4TYWA 1JR6A 2VBCA 3W5IA 4BUJA 4TLDA 4B3XA 1JQLB 2QRZA 4E22A 1IXZA 1E1QA 3DL0A 221PA 3TVTA 1XU4A 4B47A 1QHXA 1Q44A 2WAXA 4Q18A 4CIDA 5BN3A 4Q5IA 4DCVA 2WJGA 1BMFD 1MV5A 3A37A 1M2OB 1G5RA 1L4UA 5FUYA 4C0SA 5EP1A 3RWOA 2EYUA 2ZS7A 2A5FA 4MRVA 3Q85A 5DHAA 4WZAE 4FWIB 5LB2A 4C0JA 2ZRFA 3W8NA 3L8YA 1YRBA 4DHEA 2BIFA 2GNOA 1SXJE 1VYUA 5C46F 4BZQA 1MABB 5E95A 1ZD1A 4LYJA 1Z06A 1LV7A 2KWIA 2KI5A 4HB3A 3T1TA 1OW3B 4XVQA 2NZJA 2QP9X 2ZE6A 4MRNA 1DELA 2IS2A 4Y0VA 3SJAA 1XTQA 2OLJA 2IXFA 4KVAA 1FP6A 2FN4A 1X6VA 4JBXA 5JHGB 4KBGA 4DLYA 4V0KA 3ZYCA 4S2EA 1G3RA 4FW9A 5FUVA 1P2UA 3ZVRA 3B82A 4LV5B 4RD0A 2BJVA 4W5JA 3LLUA 3A36A 1J7KA 4PAMA 3GLGE 5GVRA 2KBEA 1V5WA 3CF6R 2WIAA 4O2LA 5G53C 4A92A 1J2JA 1X86B 4JLDA 4LJ6A 4DCUA 4FINA 4QKQA 4NYMQ 4W7SA 3GLGB 1J70A 1O3YA 1XBTA 2Z5FA 2JLYA 2RGCA 4IDOA 2VHJA 1M7HA 2CDNA 2ZITA 5DIFA 2Q21A 1QVAA 3VFDA 4M9XA 1XMVA 1PLJA 4XSHA 4QFMA 4BFTA 3ZS9A 1KZ7B 1TQ2A 3IQXA 1HE1C 1OSNA 1GVNB 3KTAB 3PJRA 1KK2A 1VG0B 1P5ZB 621PA 1W48A 3AVVA 4A2WA 1M7BA 2BCGY 3H4MA 3NBFA 4DCNA 3ICQB 4G5GA 2ZROA 3ICEA 4GI7A 1N3BA 2ZJBA 3KKOA 3B5JA 4L4UA 2V8OA 4A6XA 3AGPA 1QHHB 2XTMA 5BN5A 2ZRDA 4HDOB 1MKYA 3QBTA 3GFOA 2ZRHA 5AK0A 1RRGA 1U8AA 2O8FA 1GILA 4A0HA 3R7WB 4OI4A 2YOFA 4PQFA 1E6CA 1HV8A 5AJWA 1E32A 1G8YA 4XTCS 1BOFA 1G3MA 1NSFA 4FMBB 4DZZA 1LW7A 3KB1A 1E2FA 3I5XA 1VECA 4RD6A 4F91B 3IQWA 3NIBA 4IOKA 4RCYA 5TXGA 3K0FA 4G5QA 1YZLA 3FVQA 3N5CA 1YZQA 4DDWA 2VLIA 1UKZA 1OF1A 4DEYA 2GJSA 1DAIA 2EFHB 1XX6A 2DHRA 3IPXA 4TQUS 3PUYA 3TKLA 2LKCA 2QMHA 4NKRA 5KUTA 1YKSA 1FL9A 4D26A 3IBYA 2ODBA 2R44A 2JLRA 1N5IA 1P61B 1P7CA 2OSBA 1E0KA 1VDZA 4BFXA 1ZM2A 1XDBA 4WXRA 2Q6TA 3RANA 2F1HA 5BXQC 1ONBA 2WPDA 3SU8A 4JYBA 3ECCA 2CVFA 4MGIR 2AHOA 2OCAA 3CRW1 4AC9A 3O8CA 2VO1A 1W36C 1UJ2A 1OH6A 2W6ID 4S35A 4TYPA 4UXJA 4YONB 2QORA 5CYPA 2J87A 1SVWA 3LX5A 1Z83A 4EUNA 2N42A 3P27A 3OAAA 3TUZC 4XWOA 1XZQA 4WZBE 2RGDA 1IY1A 4CT5A 2PEYA 3NHAA 2QI9C 3F0TA 3PEYA 4LV8B 1S3GA 2QSYA 3BBPA 2HT1A 1Q0UA 4JLMA 4ZDWA 1GNQA 3C16C 4HI0E 3VR4A 3AUXA 4YDSA 1E9FA 4OHYA 3MAAC 1NMYA 4Q66C 4DJTA 5JHHB 3ZVMA 3RSLA 1Z0JA 2HF9A 2QTHA 1YZNA 3SJZA 3K9HA 4QGGA 1R5NA 1Z63A 1CKEA 5AJVB 4E03A 5C4MA 4OHWA 3BJIC 5JJIA 4M9ZA 1XTKA 1UKYA 4N3NA 1F6BA 2FSIA 3UK6A 4JT4A 4ZV4A 3WHKA 3T5GA 2W0SA 4Q01A 4EFNA 2BOVA 4O3MA 1TEXA 1EFUA 2GF0A 1QDEA 2J7PA 4DDTA 2RGNC 1KO1A 1PUJA 2YYZA 1X8JA 2QRNA 2ZAOA 2QT0A 2IEZA 3DKVA 4EPRA 2IXEA 5EUMA 1GSIA 2YZ2A 2ORIA 2PBRA 1RE0A 3S1AA 2OV2A 3EWAA 2YKGA 1WBDA 3OHMA 1US8B 2OCPA 1KSJA 1PLLA 4HUTA 4JMPA 2G1JA 5B30A 4RFSB 2GWHA 1XJ0A 5KU1A 3A8TA 3SYLA 3QKSA 2O8BA 5IF9A 4RD2A 3CR7A 2GRJA 2G88A 2IYSA 4R2IA 4JKYA 1HURA 4EPWA 3B9QA 1OLOA 1NMZA 2ZVPX 3KUCA 4JLPA 4QGFA 1P75A 3KKNA 3QXCA 2OLKA 2VHCA 4HAXA 4RFVA 1ZD9A 3NWJA 4URZR 4WBSA 3TUJC 3SI7A 2QG6A 3PUZA 1CULC 3DZDA 4CEIA 1Z0AA 1W0JD 5TY0A 1G6OA 1TU4A 1ZU4A 2FF7A 4AYWA 1BS1A 4Q9IA 3TGPA 3QEOA 3QNUA 1GG2A 1ELOA 4MKHA 4GMXA 4IJMA 4BZXA 4GNKA 4MH0R 3CNOA 3EIEA 1F2UB 5SZIA 5TARA 2ZI5A 2ZRBA 1E2QA 1ZMXA 2D62A 2QENA 5SZKB 4JLJA 1SVKA 4TMVA 2ZRLA 4DIEA 3RRZA 1G17A 3KXKA 3OIVA 4PPGA 1OB2A 2H5EA 3RYTC 2AD5A 1S1MA 1P72A 2CCKA 4UJ3A 4A4DA 5M04A 2GKSA 4A0FA 1RFLA 4Z1MA 2REXB 4YDHB 1PVOA 4JJKA 4M2LA 2ODEA 3FGNA 4R2HA 4AYTA 1A82A 2ERXA 1KTVA 2DBYA 4B73A 3BB4A 2ZYWX 5CLQA 2AFHE 1DE0A 1VG1A 4GP6A 4TT3A 3U44A 1UADA 1VCNA 3C15C 4GP7A 3T1OA 2FFQA 2IYUA 1NJGA 1P9NA 1ZU5A 1XTRA 4TMZA 5DSZA 1XD2A 2ECKA 4PHHA 3V9PA 3ZVLA 3ADDA 1G18A 2XZLA 1E3MA 1TPZA 1OYWA 5D3MA 2NO9A 1IAQA 2GK6A 3RS7A 5KYKA 3ASYA 2V3CC 3GCGA 4OI2A 2FH5B 3TAHA 4M21A 2J0VA 1ZINA 3BH7A 3NBYC 1QG4A 1YZUA 4LC0A 1R4AA 4DRZA 2QM7A 4AY2A 5EZ5A 2F43B 5AUNB 3AQ4A 1OXTA 3TR5A 4F4JA 1EFCA 1II0A 1K8RA 1P2TA 2BBOA 3KKMA 4GOKA 4KLNA 1HE8B 3GLIE 3UXMA 4URVR 3LDAA 5BYJA 1KHTA 2NGRA 3K9GA 3PVSA 5DN6A 3RVBA 1W5TA 2ZQ5A 5AJYA 5KDDA 4JL8A 4TLAA 2JLZA 1D6JA 2EW1A 2JJ2D 2WVJA 4KBFA 1E2NA 2CBZA 1NSTA 3U3RA 4GRAA 1TEVA 5H70A 3FKQA 5KPJA 3M0EA 2HDNB 1E0SA 1FQKA 2EQBA 4HLUC 1GL7A 1KDTA 4JL5A 4KFRA 4O0MA 3SFZA 1GAJA 1Z6AA 4HAUA 1UBGA 2WZQA 2CHVA 2ZRGA 3TUIC 4PFSA 1GRQA 1TMKA 4PAQA 1EK0A 2IYYA 3UG6A 1M74A 3Q5DA 2TMKA 2SHKA 4LDJA 1CIPA 2X19A 2QU8A 3LQQA 3PITA 1SGWA 4WOPA 1QF9A 1A2BA 2ZSAA 4ZDJA 4F4IA 1WB9A 5CDFE 1R0ZA 1KJWA 1I4LD 1QHIA 2AR7A 4NYJQ 4P31A 5EE9A 4NL4H 4EJSC 2WWWA 5AUQA 2PX3A 2CLSA 2QSZA 2N1BA 3OEHA 4IDPA 3X1YA 4GMDA 4Q9KA 2ZRMA 2E87A 1N6KA 3O8DA 2ASEA 2Z6VA 3BRWD 4MA4A 1IOZA 2IK8A 2C04A 3CONA 2F1RA 3B1ZA 1G20E 3AV0B 3T15A 2O0KA 4KVGA 3IGFA 2W6JA 4P4SB 2ZJZA 2P6UA 3A58B 3GQBA 2ZR9A 1JXMA 5JSZB 3B2EA 3AVYA 4WVFA 5CDFA 3BWDD 3TE6A 4BFZA 5K8LA 2GETA 4Q21A 3SYKA 4XVUA 2G77B 2VHUA 3Q7PA 5DI9A 4EPVA 4YXWD 3AKDA 4NCJA 1HY3A 2Q9BA 1E2MA 3MGCA 2WPDD 2OM2A 1II8B 2GCOB 3VR2A 1RIFA 3R7WA 1P62B 1V43A 1OH7A 4OK6A 1CRQA 1XJCA 2KJQA 1M6NA 3THWA 3L8ZA 2OG2A 3PV0A 4L9WA 4ZKEA 3KQKA 4HYYA 2IC5A 3M6AA 3OEHD 4AI6A 2OFXA 2QY9A 1SKYE 1YZKA 4PZLA 4Q1FA 4JLNA 5AJZA 3V4FA 4OL0A 3U6BA 1W0KA 3AP2A 3HU3A 3SHWA 5FPTA 4D4KA 2FSFA 3CUEF 3EW9A 5FL7A 2Z83A 4D0GA 1OJLA 2JIZD 3ZLJA 1S2MA 3WHLA 4GDFA 4DUGD 4JJZA 1ZM9A 3N2EA 1Q21A 4B6EA 3RC8A 3UATA 3AF2A 4UNQA 4LHVA 3P26A 1R7RA 1RYHA 3ZIAA 3K0EA 2GEUA 4PQYA 1P60A 2PCLA 1TTTA 5HR5A 1OKKD 1AIPA 1BKDR 3AVQA 2XITA 4Q4JA 3FOZA 1CLUA 3KQNA 1OHHA 1OPXA 1GZSA 5DHFA 2GEDA 3ASZA 3NBZC 4DLXA 3BFVA 1XEWX 2B7CA 3PUXA 4Q7MB 4LPKA 2R6GA 3EIQA 4TSFD 1XEXB 2FX3A 2NOAA 3ZDQA 3CRVA 1I4TD 4TTRA 3ZH9B 3QY0A 2V6IA 2OE2A 4YMWA 5EE3A 1E94E 2OCYC 4Q03A 1IY2A 1Z2CA 4BEJA 2B6HA 2NO1A 1AS0A 3QKRA 4DT1B 2BHRA 2H8KA 3K9LA 5FPKA 3K70B 1KI8A 2PX0A 1XD2B 2XXAA 3PEUA 2GF9A 2WBLC 3AKCA 1N6RA 2QTVB 2XX3A 2VSXA 3EZFA 2P0EA 4Q48A 4UNPA 3IKJA 4UXIA 2UKDA 2YC2C 3K8YA 3TJZA 3VR6A 4BECA 1XTJA 2RHDA 1KJZA 1NBMA 4MRSA 1S96A 1EWRA 4P4TA 2QQ0A 3RLFA 5ELXA 1GOTA 3L43A 4DLSA 1VHTA 2EU8A 2WIBA 1TQ6A 3DM5A 5CLLA 5KSPA 2AXPA 3VHLB 1D8TA 3GEEA 4JVMA 5FOSA 4LHYA 1JAIA 4LBZA 5B2ZA 5JWOA 1WRBA 4KFTA 2WHXA 3ZIAD 3EX7C 4QBFA 2JEOA 4MUBA 2XNDA 1T4GA 1OIXA 2XSZA 1N6LA 2FSGA 4DUGA 3MWLA 4Z1MD 3H1TA 1MO3A 3RRYA 4OI1A 1FNMA 4HLCA 2RB4A 1AS2A 1E9SA 1HUQA 1QHNA 2B21A 2OILA 4FMDB 4TL9A 2ZI7A 4G5SA 2XOKD 4A36A 4V0MA 1HQCA 3UANA 3WNCA 2FA9A 3X1WA 5J4YA 3K0SA 3W3AA 2HT6A 2FZLA 5LBIA 5E3HA 4L8GA 3MLEA 4ZCLA 3SDZA 5L3SB 4V0OA 1IJEA 3NH9A 2CK3D 1YR7A 4BQSA 1B23P 3GLGA 2Z4RA 4AK9A 1J90A 4CGZA 2MSCB 1JNYA 5FPSA 1W4RA 2FNAA 5K8UA 4ESHA 3QPVA 2P67A 4A6PA 4PO1A 1JJVA 1ZYUA 2F9LA 3PIRA 4OKSA 5BW8A 4JT2A 4KAXA 1IONA 5L3SA 1U0JA 1T8TA 5E4FA 3TVDA 1EGAA 4HDQB 1XPRA 1DS6A 1NVVR 1T8UA 1NKTA 3UKDA 2WWYA 4Q7LA 3E70C 3CWQA 3K0AA 1R2QA 2P5TB 3PUVA 2REBA 1KMQA 1G21E 2EYQA 1TNDA 2GZHA 3H0KA 3SBDA 1TX4B 4X8OA 2WKPA 2ZYUX 3FPAA 1H8HA 2WMOB 4BLTA 1BMFA 3ADBA 3OFNA 1G9XA 2CJWA 4OJKA 4US2R 4JLBA 5DISB 4D2IA 2VF8A 3BOSA 2Q3FA 3K0CC 2JLUA 5FFMA 2FDCA 2W6JD 3CLVA 4H9GA 2E9SA 1XXHB 1H65A 3LW7A 4ILEA 2JJ1D 3QG5A 1U9IA 4PC1A 4DCTA 2FPMA 3KFXA 1Z0KA 1XZPA 1R8SA 2VQSA 5GJBA 3U60B 2RHMA 4HLUA 1UBCA 5G40A 1WP9A 3R9IA 4EQ6B 2FEMA 4CW7A 3KL4A 2GJAA 4QJ4A 2XOKA 4EQ6A 5F9FA 2CLDX 4AG5A 4QJ3A 1Z6TA 1W4CA 1J8YF 1OXXK 1Z5ZA 2D7CA 5EP4A 4DBLC 1CR4A 2GJKA 1E2GA 4QBHA 1T5LA 3RDPA 4PC2A 1E79D 4GZLA 1FNNA 3GJ0A 5AUPB 1D2EA 3U3KA 3DM9B 4B32A 1P9RA 1A2KC 2NO0A 4BPBA 4URWR 5CJ2A 4B34A 4EJSB 1NLFA 4Q4JB 4LJ5A 2ZI4A 2YVUA 1Z6GA 2JAQA 2QN6A 5F3WB 3VNVA 1JQJC 2A5JA 2BMFA 1Q1EA 2GBLA 3VHXA 4AKGA 5LPNA 1HTWA 4NP6A 1COWA 2P6RA 1FX0B 4HAZA 4FWTA 1N5LA 2WKRA 1FZQA 5JEEA 3UMFA 1DO2A 1MO4A 3L0SA 3AVUA 2O8CA 1G8GA 5A4JA 3B60A 2OBMA 1ZM4A 3UMRA 2HV8A 2FEOA 4KI0A 2F3TA 1E1RD 3W6NA 2JLSA 4KYUA 2C8VA 2ZVQX 4UXHA 4M22A 1ZC4A 1LF5A 2DWOA 4I81A 2ZXUA 3GEIA 1CJKC 1JECA 1UDXA 4ASUA 4LGMA 821PA 3NXSA 5FOUA 3IIKA 1N5JA 1MRSA 3W5JA 2I1VB 1Z08A 3VKWA 2QGNA 4LUCA 4DVGA 2PLFA 1KI4A 1Q20A 1CTQA 3C5CA 4IDHA 3TNFA 2VPPA 2H1LA 2X2EA 3KB2A 3BH0A 3QXXA 4MKFA 2QAJA 2RGEA 2XNSA 4WIAA 4V0LA 2AKYA 4LZZA 3G82C 2JLWA 3NVAA 4ESVA 1ODFA 3MFYA 1H8ED 4PSAA 2R6AA 1CJTC 1KIMA 2VP5A 4QRHA 1X8LA 3RAPR 1XEFA 3JZMA 2J7KA 1EFHA 2J5XA 2XB4A 4A8JC 4ARZB 5JWRA 2GVZC 1NRJB 4CEHB 3X2SA 2IT1A 3OAAD 1A5TA 1X1RA 2ZR0A 3KXIA 3EZ9A 1FP7A 3AF1A 3W90A 1NNEA 1XNJA 1VCOA 5EXSA 3BK7A 3TQFA 1EESA 1RYFA 1DTSA 5DGXA 2QAGA 3VU9B 1SQ5A 4HUQB 5CM9C 3EZ2A 1N0UA 4JZKA 3SNHA 2ZJOA 4JS0A 4LYAA 2H16A 4QHTA 2IWRA 1XP8A 2MSDB 3EZ6A 5B58C 4FI3C 1MT0A 3X1DA 3B1YA 2WAYA 4A0GA 4EAQA 4LJ9A 4BGDA 4AKIA 3OIYA 2XAUA 2BMDA 3LAWA 3P4XA 4HB0A 3DVLA 2CEAA 3GEHA 1TF5A 1KNXA 2IEYA 2J45A 2RGAA 5FI0B 2D06A 4BWYA 3NG1A 1HH4A 1A1VA 2BEJA 1GNPA 4JVSB 1G3QA 4Q4LA 4EFLA 2RGGA 3R8CA 2YC4C 1LFDB 1TF2A 3AH8A 3GJ6A 1G19A 1RRPA 2RH5A 2ZR7A 1J8MF 5A0FA 1KDOA 2W58A 1RPZA 2WICA 4PPQA 2W2XA 4PSKA 1Z3IX 5KPDA 2VSFA 3C7KA 3RRNA 2OZEA 4RCZA 3QIAA 2GXAA 2H17A 3AVTA 2J0QA 4PO9A 2F43A 2B92A 4DEXA 2H92A 2GEVA 1H8EA 3OE7A 2WJHA 4QHYA 4C30A 2W6IA 2WJJA 4DSTA 1TL7C 4C0BA 1XRJA 4YMUA 1HT1E 1DARA 1S0UA 1KMHA 2L0XA 2O5VA 5HKKD 1NI3A 1P6XA 2I1QA 2J0UA 1CJMA 2ZSEA 4PX9A 1RJ9A 4UNRA 5TMPA 4PC6A 3RABA 1G1MA 3QENA 1ZP6A 3AF3A 3LO5A 3R8FA 1AM4D 2A5GA 3I32A 3L0OA 4NH0A 1VG8A 1L8QA 5DO9A 4C7OB 1KO8A 3PENA 4MKIA 2CK3A 3ADCA 2C2HA 1Q3HA 3DHWC 1CR2A 2VIIA 2DWQA 4N0DA 5FOTA 1H8HD 4PO8A 2R2AA 1KMHB 2HYDA 3FTQA 4ZI3A 4L15A 1ZC3A 2QEQA 4QJ5A 1K5DA 1AK2A 5B57C 1IN8A 1S1CA 2IYZA 2ZJ5A 3PXGA 5BQ5A 1E2HA 2ZRIA 2FPLA 2A30A 3U7GA 1OV4A 4TL6A 3AKEA 4Q1EA 5P21A 1CF4A 1XFAA 1Q57A 4PXAA 5CIQA 1MRNA 3TK1A 3RC3A 2QQEA 2RGNA 3MSXA 4G0NA 3K53A 4CT4B 1JB1A 4R7ZA 4AYXA 5ANRB 2X2FA 3A1WA 1ZCAA 1KI6B 2GCPA 2QP4A 3D3QA 3I92A 3QVUA 1NLYA 1UBFA 1XF9A 1F3OA 1OXVA 2AWNA 3PR1A 3EZ7A 2G9NA 3EPKA 4P3YA 4DT1A 2JLVA 2VF7A 3GLHE 2ZREA 3WRXC 4NPHA 4EFMA 1D9ZA 2OT3B 1UF9A 2IS1A 2WJYA 4ZO4A 4PPFA 4DSNA 3CR8A 1W4AA 3QOFA 4XJXA 2QUZA 4BLSA 1NY5A 1RRFA 2Z0MA 1P2SA 3Q3JB 3CH5A 2AD1A
chains in the Genus database with same CATH superfamily
2VJPA 2XVZA 4P35A 2O3QA 2K9QA 5B1BH 1MGPA 1T2VA 1W8IA 4KHZA 3H0DA 3T9AA 1GZ5A 3V48A 1YC2A 3HVJA 1KAOA 4X1YA 3V4ZA 2AZMA 2OD7A 3AXSA 3ED5A 1YC5A 2AJTA 2P81A 4YWHA 3TLKA 2YXEA 1LEBA 3E81A 5CNIA 1USVA 3EIWA 1ZZGA 2E2JJ 3BH6A 4W9NC 3VOAA 1P9WA 4QM7A 3EGWA 3I28A 2H1IA 3BA6A 1KGSA 1EM8A 1NW6A 3LU1A 1IVNA 2AN9A 3MCAA 1OROA 3EZXA 2HBQA 4RZXA 3H5TA 2D0OB 5L3RA 4PNHA 1UKVY 4PX2A 4XQEA 3ZWOA 4QO7A 3ZX4A 4D4LA 2IKSA 4R3NA 1PWEA 1N36B 2ZRAA 3DD1A 4X93A 4MX8A 5HFNA 1SKUA 3EVGA 2GPAA 4PF1A 2FPGA 4CL0A 1H5NA 1RXVA 1E1CB 2WV0A 2DXIA 2EFJA 2OQIA 1SJ9A 2PD3A 4YP9A 2RKBA 3B2QA 3D64A 3LF1A 1Q1AA 2BHZA 3BTSA 1OYVA 1XPUA 3KS9A 1P2BA 1X1BA 1WNFA 4INPA 4CKEB 3TP0A 3IAAA 4MP8A 4K9QA 2JL1A 5MFZA 4F60A 1PZXA 3A1TA 4TL7A 5BNIA 2V7GA 3A1VA 1UBNA 1H6DA 1EDBA 3L02A 3OTQA 4DA0A 3RYRA 4U7DA 1P0CA 1SBHA 4IYRA 3Q8KA 1WQ3A 1BYIA 4F3YA 4CETA 3PGJA 1CB0A 3CVYA 3AY0A 1MKMA 3PHIA 1PJSA 1FMWA 4MR7A 2J3IA 4CWAA 3LAPA 3QJGA 4WZBA 1EWTA 3HVRA 2WB1A 4LLLA 3UCEA 3K20A 3AR3A 3THOA 3CINA 5JLAA 1X8KA 1AUVA 4LXHA 1VLQA 1NX9A 5DBFA 4U0WA 1EVJA 1ONVA 2EK5A 1OX4A 2GHIA 4IMPA 4KV9A 5B3JA 4LDNA 1YQDA 3VR6H 3QVWA 5IC4A 1OAOC 1R6VA 1VZ2A 1RMYA 3KAJA 5KX5B 3CDIA 2ACEA 2ONYA 1PTJA 5B6PA 4FZVA 1NW7A 3EC2A 2I03A 3WQQA 1Z2DA 1Z25A 4C5BA 1PTKA 2YMLA 3W7AA 3HXQA 1U8TA 1KZ6A 2BGRA 2BBSA 3AL2A 2R6FA 2XUQA 4E7SA 1JFRA 4WLEA 1DUSA 1RRKA 4MCAA 4CM3A 4HAVA 1XGKA 2ZB2A 3KHUA 4X95A 5KNCA 1AQUA 1T08B 2CXRA 1ZGCA 4BMPB 4EL5A 1DWOA 3C6MA 1NBIA 1K6JA 1V8OA 3RTAA 4B7UA 1I39A 3D5RC 2IXGA 3AG2H 5BVHB 5KNDA 3AONB 2R86A 4C2MJ 2QT1A 4IV5A 2IGNA 2XF6A 2CMKA 4L1KA 2Y67A 2PBLA 3AUYA 3LBNA 4B9AA 1PJAA 2BUAA 4LN1A 5TJJA 5LP1A 2LYCA 1KQ9A 1V4NA 4CXFA 3ENWA 3FPEA 4IVPA 3UH1A 3D1NI 3OD5A 1KQFA 1D2NA 2JGIA 2BHNA 4TLBA 2R8ZA 1F17A 1G0NA 4RV4A 5DASA 1VKHA 1UAGA 3KEMA 4JI0B 4JKIA 1TD1A 1M1YE 4P4NA 4C1BA 4DA8A 3KJEA 4DLLA 4DPLA 5HUJA 1FS6A 1WKCA 1L8AA 3O2SB 5K0JA 3GRAA 4KGXA 3BJMA 5JI2E 4AJJA 2GA9A 4EX6A 2AI1A 3KSBC 2WTEA 4M1KA 4Q05A 1AMNA 3H5AA 1Z36A 2F4MB 2DY1A 3PHJA 1YQXA 3QKSB 4PPNA 4QYIB 1MO5A 4ZO9A 3ZD8A 3SBXA 2MDTA 1LDJA 2XR1A 4B48A 1OV6A 1NLZA 4MQVA 3NP9A 1MR3F 3T5MA 1K5GA 5ENZA 1UANA 2VAWA 521PA 2PWAA 3C2BA 4BJ5C 1I13A 3MJRA 1DP7P 4EB8A 3TQHA 3IDOA 2FX2A 4OYLA 2RGVA 1A5SB 1E7MA 1KVQA 1WZNA 2RDMA 3DZIA 4RU1A 3BN3A 5ENVA 3S28A 3OJXA 3L2UA 1UXHA 9ANTA 2H2AA 2BVLA 3UPDA 3FYUB 3TGWA 1O0SA 1WVRA 4U4AA 5CH5A 3V80A 1X80A 1GAEO 1M0WA 4IKEA 2HOEA 3OCWA 5EXTA 2CG4A 1UFMA 4YJ3F 4E15A 4QICA 1PX0A 4J1TA 5AHOA 1J56A 3JVEA 2XHZA 3RS5A 1G8FA 3WIVA 4IX1A 1BR1A 3OZ7A 2Q2OA 1ZREA 5FYDA 3PQCA 3MRXA 4OJYA 3SBEA 2PMUA 3ZGVA 4ZQFA 5KJFA 2CB9A 2QRQA 1EX6A 3IHLA 3ONWA 4TWBA 3C3MA 3D5EA 3VNQA 2EKPA 1YHZA 4U7GA 1KI7A 1UPXA 4JU9A 4RTQA 3LT5A 5JFGA 1DKLA 3JQAA 1VCHA 4X9XA 4WK4B 1JQ5A 3BD7A 2AOVA 1KO5A 5H4HA 3MWDB 4CVNA 3DMYA 4CT0A 4YRFA 1N2GA 5I8PA 3H84A 2RHOA 1QJCA 1TW3A 2LCFA 1K89A 4PUSA 4FMCF 3ZDZB 1K2VN 2X0IA 4E6EA 1KPIA 2VP0A 2CZQA 4TS4A 4FHEA 4XQGA 3O90A 1WPGA 1MRZA 2IOQA 3PJFA 3TO6A 1D1TA 3Q11A 1I5OA 2HSGA 1IO2A 3GFJA 3I1FA 4IF6A 4ZOAA 2V74B 2M4KA 4GNRA 2JLAA 3EEQA 4JODA 3QKRB 4UBOA 3VTFA 4XN0A 1QP8A 3KP1A 2DCMA 2MSKA 1Y1VJ 2R7ZJ 1CUSA 1MX1A 3UJCA 5J4KA 4UW9A 2V79A 1DV1A 3L2VA 1JIJA 1MJNA 1ODSA 1T4MA 2AQIA 1S8OA 1QWOA 5G3ZA 1J5PA 2IY9A 1WH5A 3VGJA 1DTWB 3QSYA 3DKRA 1KI2A 1KYVA 2CHGA 3NH6A 3Q12A 4N0EA 1V9SA 3OZIA 2CN1A 4QTTB 4NJMA 2QVGA 3IUYA 1DLIA 1RXYA 1NYTA 4TTJA 4YJHA 3T3EA 1C41A 2O52A 3KPJA 5KSYA 4DJJA 1A71A 1QIFA 4V0ME 2CKDA 4UTRA 3CO5A 1V9CA 4A82A 2YN0A 3OIUA 4RTKA 4QREA 4BNYA 5BYAA 1H4TA 1DKUA 4PIMA 4C5AA 2V5UA 1QGPA 3DZGA 4NE9A 3U9SA 3A27A 1DJQA 2FPKA 2IW3A 1KC1A 3X2FA 1O7FA 4DNCA 3IQZA 3HVKA 5H6RA 3ZTYA 3LOPA 1XJQA 5IAOA 3LY5A 3RUAA 5JCJD 2CFOA 4XD7D 2PX4A 4BPBA 1XR3A 2RI0A 4IGFA 2D1SA 4HATA 3RJMA 1MBJA 1TNSA 3L8EA 4JYPA 4X6YA 1E7QA 5CIWA 3S5JA 2B1RA 1V0JA 5A4AA 3SJ7A 4E07A 1EKEA 4PJNA 1NUHA 1U0FA 5T8KA 1ZM3A 3C8HA 1FTYA 4Z5XA 5BV7A 1RC9A 4OQNA 1WS6A 3CIFA 3S68A 4FDLA 1G6NA 1N9GA 5GOTA 2VZ8A 2KRHA 3DCFA 3EYYA 4IM7A 4PHFA 2N1MA 3O21A 3F2IA 2TS1A 2A94A 2JA5J 1HWYA 3STVA 1SOUA 3G3EA 4NS1A 4PIPA 4GW3A 1I6LA 5A0TA 4KGVA 1JALA 4OXXA 4LKRA 2XSZD 4YEDA 1TU0A 3VOTA 1LQ2A 3CB4A 3ETGA 3RTBA 1Z38A 2Y2VA 3IVXA 1I7PA 1FQJA 4KFSA 5GOZA 1VQ4I 2G9ZA 5DBIA 4C7OA 4C6TA 4ZDKA 1NVXQ 3OEEA 3L1IA 5LYJA 4TV9B 4ZANA 2Y75A 1J99A 3S1AB 3G0HA 4K9KA 1Z9CA 4UUVA 2W4MA 4N4AA 2OAP1 4E30A 1A9ZA 1TTHA 4KREA 3D31A 3CV3A 4DGWB 3VSEA 1U02A 4CE6A 5JI3E 4HZUA 4DC9A 3DYBA 4IDQA 4U7TB 3A3OA 4TTAA 2XIGA 3NAGA 1TA0A 4TRMA 1WY7A 2AEMA 2J46A 3JASB 3UB4A 5JASA 1QHHA 4JT8A 1WULS 3AUJB 3TLGA 1IRXA 3ZKWA 4YVFA 1YJNI 2HBRA 5COAA 1AHNA 3DP9A 2O20A 3WYAA 3ZNNA 1QQ5A 3E0QA 5IWAB 1Z45A 2P75A 1K6MA 3HJEA 1RQ7A 2B1JA 1E5VA 1XJ5A 5E79C 5ED4A 4OBXA 1PR5A 1YR6A 2PVSA 2DTEA 2JA1A 1X7DA 4ICIA 3WICA 5A1TA 2BGTA 2OGUA 3LQYA 2I5UA 2VXOA 4HMPA 1X0VA 3K6JA 3TSZA 4F1JA 3CNEA 2P41A 1Y3HA 4FHTA 3PVCA 2C3MA 1HRDA 1RQXA 1JEYA 1R15A 1O3QA 1E6WA 3ZBPA 1AO0A 1KS9A 1Y7TA 3PJEA 3QG1A 2XCRB 3OZCA 2A33A 4GBGA 1SMYF 1PI3A 2OBNA 2X7HA 3FNHA 4KI7A 3NWPA 4KQJA 4PWYA 1BE1A 4WEQA 2DOFA 4JH0A 3RVOA 1VCMA 2HPZA 3DXYA 5CIYA 1SFEA 3SHFA 2PZEA 1WOYA 1PDNC 2ZUSA 3CX6A 4M53A 5J5CA 3TZLA 1SMTA 1SD5A 2V6EA 5CJPA 4ZC8A 3U40A 3LXMA 2XCSB 1QAQA 3QX7A 4PHTA 1L7AA 4BBJA 3PXAA 2M5WA 3DLTA 1MVNA 1UZAA 5FL3A 1GPMA 1ZKDA 4NC7A 2R92J 1O08A 1SPXA 4ZT6A 4JIGA 5JIBA 4JBNA 2PV7A 1JZQA 3TSYA 4MEBA 3W6JB 1B41A 1IDN1 3T4EA 1XTSA 1WJEA 4C08A 1XB2A 2WT9A 1YRNB 1XZBA 2JCSA 2ZNYA 2QR3A 4FDUA 3GBGA 1RADA 2B36A 3LVRE 1YR2A 2D2VA 5CT4A 4ASUD 2HCBA 3DE0X 1Z5NA 3PXXA 4ROSA 1RPWA 4LHZA 5U1PA 3RC9A 3UHJA 5K99A 2KL4A 1CF2O 2M2EA 3QXGA 1OLXB 2EFPA 1SQSA 5GAHJ 2J59A 4HGOA 1YOBA 1WSWA 3ME5A 3NHUA 5AJUA 1JMKC 2YH2A 1DBWA 4S1WA 1JG1A 1CK4A 5EKUA 1XXLA 2XUPA 1EWQA 1RVV1 1XXHA 1X1AA 1NOIA 4L9VA 1QG2A 2SBTA 2RGYA 2X9LA 4G4JA 2D5LA 2QE7A 3D3NA 4E5KA 4YAJA 2ZAYA 2GD2A 2KLOA 5D5WB 1SVSA 4EZEA 2AFRA 4LF4B 2BMEA 2X9GA 2JRTA 4WUVA 1PK9A 1FYVA 1NI4A 3EPZA 1W5AA 3AU8A 3FZGA 4G01B 4G5XA 3TNYA 4RY9A 2B8TA 3O92A 4PZ9A 2DWPA 1J97A 2VHTA 4IOMA 4TYYA 1TVCA 3KOWA 2BLLA 3HA3A 4MRPA 5DGCA 3TLYA 2BVMA 5EKXA 3WXBA 2EJCA 3K7EA 3LKBA 1XAIA 3S70A 4G12A 1NBAA 1NVBA 1MDFA 3C8MA 5P8WA 5I4KA 4M7PA 1LJ9A 3KD3A 3HHPA 3Q4GA 4H3VA 1XELA 1GO2A 2V7PA 4RBNA 2QBYB 4B85A 5E3IA 5JCOA 2HPMA 1M5RA 3L6DA 5I7AA 3HWRA 1EE2A 2QXTA 4DQDA 4IDCA 5JS8A 3G4SI 1K6IA 3OYGA 2Q3CA 2Y0EA 3LWNA 4JEMA 1IG7A 3UFXB 3CG4A 4G5YA 3GT4A 4KU4A 4Q3LA 4R69A 4ACAA 1ZVKA 2IQIA 3Q7QA 1U7XA 4LNHA 5HE9A 1ZAKA 2ZI9A 5TQ0B 3NKVA 2FGJA 2HEOA 4G0XA 3E1GA 4IQGA 1F06A 3OZEA 4MWTA 1JBEA 1IXRC 1S2NA 3H2SA 1IYZA 3KL2A 4JR2A 4N9HA 5M2QA 2PSHA 4LXXA 3SLRA 1QZYA 3RYCB 1NTRA 2P9BA 2E1RA 3OYHA 1VLZA 4RKFA 1Y34E 4RV5A 3C6QA 4JSYA 4ZYHA 1DG1G 4HX8A 1WP4A 3PO2J 2I3DA 2YHIA 5FD5A 3JQQA 3N87A 2DMUA 4GYKA 1ZM7A 2CEKA 4YA6A 4C43A 1W0JA 3RG2A 4OLBA 4P0PB 2DK5A 3RU7A 2FMYA 1SUSA 1IRFA 1W88A 3BFKA 3DFUA 2IYFA 2JHCA 1JG7A 3PNPA 5EOVA 2XHKA 4DM3A 5C8DA 1FSGA 2V7WA 3LC2O 5EQTA 2IW5A 4KFCA 3CJTA 1MP0A 2XRNA 1JXSA 4DKJA 1QCDA 3AXTA 3BULA 4OQ4A 4LFCB 5C8ZA 4ZPXA 4AMGA 2DF8A 3LL7A 1DEHA 4KO1S 1WTCA 1VG9B 3WWYA 4CF5A 4ZVOA 4F4JA 2JGFA 3HJUA 1IHDA 4BVFA 4OJQA 1XDDA 4IO9F 1MH1A 2B83A 3JALB 3A1DA 5ICCA 1DOAA 1M1NA 3SN6A 1CP3A 3ZVKA 1YS2X 3TEDA 2XUDA 3K9CA 1B7GO 2X2PA 3ANYB 3GJTA 4KISA 3A70A 1BN7A 3NS7A 3OE7D 5CA0A 2WYIA 2O9LA 1S5PA 4YJ2F 2H09A 5IU6A 3BMQA 3MT7A 1CE8B 3DNMA 2CMGA 3KKLA 1G2HA 2PCJA 1MG5A 3UYKA 2HY7A 1OCOH 3OUZA 4FB5A 2HXSA 4MJ7A 5IBPA 3S2YA 3F6YA 4MQLA 5IFLA 1A2QA 1H9GA 1XCMA 3OM0A 4FC7A 1HDXA 4AYBN 1T9GS 3H13A 3V4LA 4BLOA 1GUBA 4KQHA 3GFTA 3CZPA 5HMMA 4X90A 3RBXA 1C8KA 4NCIA 1ZN2A 2HJWA 5C81A 3QPWA 3IUJA 4FDMA 4A3DJ 4OCZA 3H1EA 2B9EA 3NDJA 1DJOA 1I3OA 2MLKA 4BNHA 2V1UA 1QDLB 2GJ9A 1J0EA 4O4JA 1XA4A 3T3NA 2YWCA 5T4EA 1OBFO 2QPOA 4O5OA 2JCGA 4RZ3A 5AT1A 4MQMA 1UR5A 4UHCA 2AXQA 1Z39A 2W6NA 4W5WA 2XGEA 1OOEA 4M55A 1MTOA 1V7CA 3N5KA 3H1FA 1BDHA 1ANKA 1XMIA 4CZ2A 4FMDF 2GK4A 4HAWA 4D45A 2BY3A 4FGUA 1ZQ1A 1KY2A 2IITA 3I9JA 1V37A 4IDAA 1J0AA 1GHTA 4KZKA 4U0YA 4MPDA 4TROA 5D3QA 2NU7B 1RZRA 1Z7GA 2BFFB 3RH0A 1FC0A 4RMGA 1S7CA 4NBLA 2YIMA 3QXSA 4B6JA 1OPRA 1PUFB 1J49A 3K1ZA 3FG9A 4LG0A 2O8EA 3KXPA 4CHUA 1B4DA 1Y8AA 3F6CA 5BPFA 2DLCX 5GPBA 5E1OA 1FOYA 2LIVA 3H9UA 1GFZA 3VU1A 3LLVA 4UULA 4YHBA 4K28A 3DFFA 4IVQA 1XCLA 1RWMA 2IUTA 2JARA 2V54A 3JQ6A 2GXUA 2EX1A 1BMDA 3HJCA 3CPHA 4QU9A 1SG9A 2MR6A 2FWMX 2VNKA 3KPVA 4UUTA 1FXWF 3W6OA 3T5PA 3LPMA 2BHYA 1BG6A 3I73A 2A0WA 2Q6IA 3N39C 3JQ8B 4Q3NA 4Q4HB 3NC1C 5EE0A 4UU0A 4Y17A 1I3CA 2HHAA 3UQYS 4BFVA 1JJBA 2JANA 1SVLA 2IEDA 3K9WA 1UK6A 3HPQA 3OP1A 3L2WA 3FWYA 4OXNA 4QOFA 2JGRA 1YJ5A 2PMKA 3C41J 3R20A 4C2TA 3D0SA 3URMA 2NMVA 5KTPA 1QAOA 2PO7A 4D3ZA 3QU3A 1ZSYA 4QFCA 3U7IA 2CJYA 4LOAA 1M9NA 2Y0CA 3WI7A 4O59O 3L7AA 3E5HA 3MOIA 3U6KA 4N7JA 4DB2A 2I4MA 3HS3A 3T99A 2V0GA 2ZIUB 1SKYB 3OLYA 4BRWA 2OHJA 2VKEA 4YAGA 4M88A 1GCGA 5TB5A 3OURA 3EG9B 1BOAA 3S27A 2XMDA 5A62A 1T34A 5L9AA 5FBWB 4DARA 3SX0A 3CC7I 2X1EA 3PL5A 2Z8YA 1L4NA 3JRXA 2ZJ7A 2HZDA 4UHFA 3IQEA 1A31A 1DFHA 4F9EA 1SQFA 4J7AA 3LCUA 3WMRA 1HLFA 3OPMA 1O9HA 1BN6A 2HRBA 1NW9B 3O8OA 1U7PA 1G2IA 2CXQA 4B2PA 1ZGJA 3FHOA 5CCDA 1JVNA 1Z12A 3A4VA 1VQ7I 2GKGA 1G6HA 4Q3EA 4BQFA 1CLEA 1DAOA 3B52X 5C44J 3FXLA 1D2GA 2GRUA 2HWYA 2Q4TA 2LG4A 1AHDP 2QVCA 4M8KA 2KISA 1KIAA 3DBOB 2ECOA 1ZUNB 2JAOA 3PF9A 4LYDA 4RVGA 1X1PA 2IZ7A 1XCGB 2O3UA 2Y0PA 4TUYB 5DN6D 4N9WA 4OQYA 4L9SA 1IM5A 2C5LA 4M1MA 1JHUA 1KH3A 2VOEA 3HIFA 1G4AE 1WE2A 2CNWD 2ZKZA 1K6EA 3KPWA 3FOBA 3W2WA 2D1TA 4AP6A 1J0XO 1GL9B 2VRWA 1Y56A 5CVUA 3B3AA 3BHIA 1KU9A 2EGUA 3HY6A 3I2YX 5EE1A 1NJFA 1N0IA 2M4GA 4MUJA 3QITA 4BAZA 3BUSA 3REGA 3L2CA 2ZUBA 4OH1A 4PX3A 4BH9A 3UK2A 2PVCA 4UUOA 4ZYZA 2VEDA 5A04A 3ZE1B 3PKJA 5A7GA 3KJXA 1O96A 4W1UA 1ZEJA 2JJYA 2X4IA 3AYXB 3R6DA 4JN6B 4WCFB 5F33A 4JBYA 1WABA 2ZRPA 4D44A 4DILA 4LB6B 3U48A 2VDOB 4D6YA 3N1UA 3NBMA 3DQVC 3E3MA 5ESRA 1RTKA 3BP8A 2O7OA 5AONA 5DHSA 4U2DA 3PQJA 5TSDA 5FNVB 4N8DA 3WLQA 3Q7RA 4LMYA 2FWBA 1R1TA 1H6AA 4GBJA 4N5DA 5B3JC 3M34A 2P9CA 3ZMTA 2VHWA 3DDZX 3O95A 1MOZA 1WXQA 3FOCA 4YP7A 3D8BA 4NBSA 3MMSA 2C7BA 4V2IA 1LE8A 1W9MA 4HSGA 3VYTB 4LOLA 3IOEA 4RKEA 3KDSE 4GR4A 4WCGA 5T41A 2ZG6A 2DSNA 2A58A 2VN2A 1C1XB 4JEHA 4JYMA 2WAOA 4WFIA 1W36D 4HNQA 2C4NA 2OMKA 3BSFA 4JC0A 4KJXA 2ZS8A 4BNWA 2WU4A 3EYWA 4NCHA 4HAYA 4JOCA 5BPIA 3ECSA 4M87A 5EXXA 3U3MA 3W5HA 4AJEA 2E82A 3JYPA 3ZGZA 2PT5A 1Y1TA 4IVRA 3BJOA 1PZGA 3IE2A 3TO5A 1DOZA 5FR1A 5GPAA 4QTZA 5BNFA 5LEKA 3KZ1E 2I66A 2OHHA 2QYTA 3BTUA 3HKBA 3L7NA 3RU3A 3TDUC 3ITDA 2CQNA 3MJEA 4JSTA 4X0EA 1FP1D 4K7JA 1SU8A 1NVAA 2JGNA 3SS7X 3I05A 3QP6A 1OH5A 1R4MB 3DEAA 4GI5A 3LT4A 3EC1A 2BY1A 1Z5VA 2MMCA 3PT5A 3V8PA 5J2UA 1UT8A 1ZY2A 4I4NA 4JLKA 7ABPA 5DHRA 1FLIA 3RK1A 3H1AA 3Q7SA 3FTFA 1RLUA 4HS4A 4CSWA 4KITB 4IILA 1LI5A 5J23A 4E7LA 1CSEE 1BO6A 2AL7A 1TI7A 2W2TA 3EGCA 3WOVA 1WCWA 1YKGA 3MWEA 2IZ1A 4C7JA 1F5TA 1MMAA 1V5IA 4BV8A 2BKXA 4RE6A 1KYWA 3FSRA 4DBQA 1OR7C 2OK7A 2QX6A 4FB4A 4M6VA 3TM4A 3LSJA 1G2QA 1QVRA 3DMNA 3G0BA 3BIOA 4QDUA 4EYKA 3M4YA 5CPFA 4FJ0A 1QK4A 4E70A 1HYBA 4FZ3A 1UM9B 2GN9A 4BKUA 5LXTF 2F1JA 3JAWA 3JVIA 4K3VA 3TW4A 2I7TA 1NN1A 2A1UB 3LPDA 4OIQF 2Y3IA 3RS4A 1O96B 3VR6D 1WHUA 3ZGXA 3G2KA 4Y1GA 1VQ5I 1IZ9A 3ZV5A 1N5KA 1QV9A 2XUIA 4PANA 1ETOA 5BQPA 1JDBB 3TXAA 1LKZA 3LA7A 4C89A 1TYZA 5B55A 4CMCA 1HDIA 3K0HA 1E98A 3F1KA 4A15A 1BDMA 2I5PO 1G8PA 3IBGA 4I1RA 3L6CA 4ALLA 1VTKA 5CLHA 4B7AA 2HYIC 1TT5A 1EXWA 2IA2A 4O1IA 4LRUA 3RSOA 3T5XA 3WYDA 5C37A 1ZWLA 4DBVO 2HAEA 4I01A 3I55I 2R5ZA 2GTPA 5JCXA 3DKWA 1A9YA 5LEJA 1IMJA 4MW0A 4Y2UA 2BW3A 2GMWA 4MYUA 3GPCA 1IN4A 1QIHA 2H4HA 2AA3A 2ZDQA 4Q4ZF 4PLGA 4UMDA 4C3VA 2WQZA 1C30A 4PZCA 3VR5D 4BFYA 4FEGA 3OMYA 4YAKA 1U3DA 2R7MA 4OMZA 3I3OA 2V6JA 1LDNA 1M2VA 3DLPX 1YGYA 4UNSA 1EYZA 3DTVD 3O3OB 4XH9B 1I3MA 4NK4A 2IY7A 1R0XA 2XF5A 1H2AS 2Y9MB 3ETJA 4DCPA 4E31A 2QXYA 5G0SA 2QAGC 1X9GA 3U4DA 4EHJA 4F6LA 1MW8X 1XB4A 3LFKA 5LGTA 1U8UA 3PX3A 2Y0BA 1XQXA 2LY9A 3S6JA 2C9ZA 2J9RA 1QX4A 5LRRA 1LPAB 1YI2I 1FDOA 3HE3A 4CIXA 4ND3A 4NE2A 4ZFNA 2BCEA 5D3KA 3OL4A 4Q9AA 5G4KA 3S40A 4QWQA 4ISCA 4FETA 3GJ8A 2IUSA 1MENA 1ZQ3P 3UHAA 1YZHA 3H3ZA 4BE4A 2E5ZA 2WWGA 1VRVA 2PGXA 4KMFA 3B3GA 3CCLI 3HV2A 2A69F 3J81k 1HW1A 1ZOPA 2NTNA 2R7QA 4JQFA 3QBJA 4MVJG 2HR1A 3TVYA 4JI8B 5DUIA 1QX3A 3DO5A 1KFEB 2VNHA 4TTIA 4A8TA 4Q00A 1FX0A 4G0YA 3HR7A 3QUQA 4YPFA 4ZD6A 2VKQA 2JEYA 4G8DA 1PZNA 4XR6A 2CWEA 2WSMA 2ZTLA 3DEHA 3WKDA 4WZ6A 1NKSA 2WADA 3QRFF 3BC1A 3HB5X 4HOYA 2HJ9A 4PLFA 2B8JA 1XEAA 3SEZA 2ZJPF 1D6NA 3L6UA 2VAPA 4JLAA 2HS5A 3PGKA 3QPUA 3TOZA 4BASA 5BUCA 1L7DA 3RAFC 3B7GA 3HVIA 5KWVA 1M34E 5CX1A 4B8XA 2VQ6A 5FR2A 1BH2A 4JJEA 3AG4H 3ENKA 4U3JA 3M81A 1W1WA 2SKCA 3OJFA 1KBQA 4CYCB 2JLBA 4MVJE 3UUWA 2HIGA 3R41A 3DL7A 5BWNA 2IA5A 5F08A 4X8HA 3HRSA 1V2GA 4PAWA 3IE1A 2J3JA 2BFFA 4CMGA 2F3UA 3VTKA 2BI8A 3E23A 3U0BA 2E2WA 3EBOA 3KT0A 2IGOA 3MCWA 4XGRA 1G6KA 3WGNA 2KPMA 1LPBB 3OJCA 1RPTA 3OOHA 3BG5A 4U6QA 4E21A 5EMMA 5T5QA 5DEQA 2CD7A 3FVVA 3EIFA 1MORA 3K9QO 3E22A 3W3AD 4KE6A 2C97A 4A9AA 3CMEI 3MELA 4L73A 4A0XA 1BCRA 3U9TA 3HGMA 5JVDF 1JDZA 4KO2S 1VQLI 4LWPA 2HL6A 1QRTA 5LQKA 1G3YA 5KJ1A 1UDAA 2X22A 3T38A 2H4XA 2XYGA 5AUOB 1JI8A 5CEFA 2ME6A 2M6SA 1I3KA 4YFNF 5J9FA 3UWOA 3WLTA 5E18F 4UAGA 4Z4CA 2CQXA 3ZLTA 1T9AA 2OKGA 1ST2A 1JXAA 1OA0A 3CBQA 3AW9A 2D7DA 4WV3A 4C4PA 3D1LA 3KQLA 4G0UA 1P0QA 4CCLA 4MPPA 3QBDA 3OCCA 3P19A 1U31A 3F5FA 5ALQA 1CP2A 4LJ8A 1IXSB 2BI7A 2HLDD 4C87A 4N76A 2LKPA 3DAPA 4GGOA 2JI6A 1QGOA 3ZMVA 1GSHA 3HV0A 4LV6A 5DK6A 1QPBA 1XTZA 4XYGA 3LSTA 5FWNA 1IRZA 5H6QA 1X7GA 3BCBA 2ZIXB 3GP5A 1T5SA 3ZCUA 2C1EA 3W34A 4J6EA 4D81A 3SZLA 3BR5A 2YJTD 3FYDA 5I7FA 4KK3A 4NAVA 2V4JC 4XI9A 2GVDC 4WECA 1R58A 4EB6A 3RK0A 2Q5FA 4J6FA 3C3JA 2V9VA 3C7AA 3GFBA 4HS9A 1ECFA 2VRBA 4PZJA 3T1NA 2LW7A 4DIFA 1V3UA 3QWHA 5HJ7A 2WJ4A 2DJ5A 1I50J 4BACA 1DX9A 3G2LA 4J4BA 5E7QA 3HYCA 4HWOA 1AXEA 3DAYA 4YBZA 1Q1BA 3DL4A 2IP1A 2J4CA 4AO6A 3OQNA 1Q6ZA 3FNQA 1HDOA 4TTQA 5DTMA 1FIAA 3RE1A 4E12A 2NS7A 3PA6A 1B6RA 3O3CA 1D1QA 2NPFA 3IIMA 3I6YA 1QYIA 3VEPA 4KXUA 1LSOA 3B6MA 4FQ8A 3FWZA 2WD7B 2KKOA 3I59A 3FUVA 4L8FA 3HYTA 3P96A 1KA9H 1IWPB 1DAPA 1DRJA 2IF2A 3QWLA 1VM6A 4JX9A 5JE8A 5ALEA 2M32A 3WGVA 4DFDA 2FFBA 1NR1A 1AKYA 4I1SA 4PBRA 1OWNA 2H31A 1M2HA 3A2NA 4K9OA 3JRDA 2ZU0C 1T4BA 4L5AA 4WA7A 4X20A 5CYOA 2PUEA 2VI5A 4Y1RB 1NFRA 5I4IA 2BMWA 1BEZA 4GWKA 1TWGJ 4ZP1A 4JXXA 1EGMB 3E3LA 4K6OA 1NQ5A 2BF4A 3AF4A 4YNBA 1O5IA 2FZ4A 2PA3A 4DLTA 1UFKA 5D4RA 3T3DA 4C29A 3EDQA 4WPGA 1U1EA 4Q9NA 3KCCA 1TMYA 1Y6ZA 3FXUA 1NG7A 3BGOS 3NUGA 4Y9TA 3VDRA 1Z0ZA 3HNPA 3WNDA 1QVTA 2HQ1A 1R5ID 2HJVA 2Q9AA 5DP1A 3BZCA 1GCOA 3D6TB 4R8KA 3ADKA 4EMBA 2QMZA 3B8HA 3H86A 2JJ1A 5LFAA 4TTPA 4QDOA 1SCNE 3MTJA 5JG7A 1YA8A 2H4ZA 1AK9A 4PRYA 3ZR4B 1IY9A 1KXZA 1MT3A 4D4MA 4RNDB 5HJEA 5L3CA 4UUBA 3UZUA 2L2QA 3T7TA 4BGIA 4WZZA 3LH5A 2X9DA 2J7PD 1XCJA 2FMXA 3H5VA 4C4OA 5E3OA 2I54A 3QRWA 1YB4A 2VBFA 4C20A 5FKLA 3E97A 3H11A 2M0MA 4E3WA 4ZAVA 1GM5A 1YIAA 2R93J 1DP4A 1JS1X 1VIDA 3TPFA 3UJ3X 3QV1A 4BLPA 4X7PA 3KP4A 2PS3A 1V95A 4ZHQB 3T34A 4DDUA 1W2GA 2QHXA 2OAQ1 2CLMB 1SHTX 2JSCA 4YJ2A 2AZXA 2JS7A 1IQRA 1HQKA 2HCRA 4G1UC 4HGRA 2WUDA 2CNBA 1Z16A 4RZ2A 1ORTA 3NNDA 3S3NA 1AMOA 3QODA 2X8JA 1P9QC 3JQPA 1YR1A 5KSOA 3L7IA 1XNRB 4DM4A 3AKZA 3PFBA 5DZSA 4QQNA 1N25A 5FH9A 4XE5A 1QGDA 2CLKB 3BXZA 3FYHA 4C14A 2IHNA 1LDEA 2X0NA 3LMKA 3OU6A 4NICA 1AQIA 3Q2IA 5G3YA 4YV1A 2FN3A 4US1R 3ELDA 3CE6A 4HDMA 4MVJF 3U09A 1FFXB 5KO2A 4CG3A 1JR3D 2JF0A 4HJRA 3QIVA 3BX1A 1H1TA 3DOUA 3VKGA 1D09A 3M6UA 2VS1A 4IQFA 4DNXA 3VMMA 3JYOA 3IAS6 5EC8A 3WLNA 1R49A 1XL1A 1M34B 1OC2A 5EXPA 5JCJA 2XMRA 5ADUS 4EGFA 2G9WA 4GCVA 2ZTMA 4DNPA 1T6SA 3CVXA 2BMJA 3KNZA 4DZRA 2VJJA 3GT7A 2NOGA 2RHGB 5YASA 2PQ6A 3ELBA 4AMVA 2QIPA 2IJGX 4NMXB 5A5GA 2GPYA 4UHHA 2GN0A 2P6TA 1WQ2A 3N6VA 2BKLA 1ND6A 1IMOA 3AHCA 3IX7A 3NKLA 4I1VA 3ZWKA 5CFPA 4TMFA 1RXEA 3VVMA 3AEKA 4OQXA 1QQBA 4TXLA 1QPZA 4NMWA 3DZ8A 4G4GA 4US0R 5T8KC 1Y37A 2PL1A 1PL0A 1KSGA 1ZD3A 5TEWA 2P2CA 1QH1B 4PAOA 4F8JA 1I0LA 1SXJC 1V1RB 3EIHA 3GJ7A 3PL8A 4OIRF 4Q5SF 1P7VA 1YS4A 4H0FA 2H0AA 3CZCA 4AIKA 4K81B 2A67A 3T0YA 4LRWA 1XZJA 4CCNA 2VTBA 5U4XA 4WBXC 4D96A 2L9SA 1JPNA 2J5QA 3PWZA 3T5CA 4X71A 3HJBA 4I46A 5DF1A 5DX0A 2DHCA 4J07A 2EFNA 3OZUA 2VDQB 5C8YA 4BWFB 1RRCA 1H3NA 1IOVA 2YHAA 1YE3A 5KOYA 2FZCA 1QB7A 7REQB 1KOGA 5KX5F 4UM5A 1WHSA 1WI3A 1CJVC 3OPVA 1Z7YA 4LISA 1HNZB 1YIJI 4MICA 4Q9HA 4B6QA 1KORA 1Z05A 1K7YA 2QPLA 5CB4B 1D5VA 1D5CA 1E3QA 2AS0A 2Y1CA 1E7SA 1I0IA 4JBWA 2GAFA 4G85A 4KPFC 3JQFC 3WU0A 4LK3A 5THQA 4O33A 4DANA 1XTIA 4WRRA 1G5IA 2Z43A 3PDJA 2ZM6B 4IDFA 4WY2A 5FL7D 2R7NA 5JMPA 7MHTA 3W6PA 1PL7A 4UBKA 2ORYA 3JRIA 1YQEA 2HK9A 3DFIA 3MRVA 4MQ6A 4P32A 2P0WA 4H0EA 1VMIA 4TTTS 4BHTA 3BLYA 3WMFA 3GD7A 3TG2A 2AHQA 3R5TA 4PO3X 3DPUA 4M60A 3GEBA 3ODPA 4RLSA 5KAPA 4MYHA 1L4EA 4XRSA 4EGQA 4Q9LA 4GECA 3LJKA 2HEIA 1VL8A 4CN8A 2A88A 4NBUA 4TS9A 1KXJA 4PYJA 2DQ4A 4IIYA 4BXXJ 3U21A 4Q4AA 2O6HA 2ANBA 3CJRB 5IDVA 2VKVA 3SEAA 1OWPA 1K61A 3BFXA 4GEKA 4JX6A 3VR2D 2F17A 1TP4A 5LP6C 3DVAB 2XAJA 4MVCA 3GL9A 3AR4A 2OHFA 3QVGA 3L0ZA 3NONA 4LTDA 3VO1A 2UUAB 3TNDA 2R7WA 4UUMA 2W42A 1AZWA 1V3FA 1PYVA 1J9EA 1ZVMA 3IIIA 4MRMB 4X94A 5IEBA 4WUTA 3RFUA 2OD9A 1XWWA 1S9HA 4RM3A 2QV0A 2V8BA 3L7YA 1SRRA 4PG5A 4WDRA 4CKWB 4FX5A 4JT9A 3R9XB 4KB5A 4BV9A 2DW4A 4BS9A 3AM3A 3S99A 1ZN8A 4BYMA 3MEXA 1YS6A 3KO8A 1M2EA 2FXVA 3EARA 4FOOA 3MC1A 2EA2A 1DKNA 1BX1A 2ZYVX 4NTZA 5JY1A 2RHJA 4D6PA 4RKQA 3HOSA 1V5GA 2P7CB 1JQKA 4NBKA 4MFEA 4B3AA 2NXNA 5DYIA 5KYXB 1K68A 1UG2A 2X8LA 3C6ZA 4UOEA 2G06A 3CZ5A 1R9TJ 3E5QA 1M1XB 3RHTA 4EPYA 4HX5A 3ORSA 4FHCA 4L0ZB 3QFHA 1OR7A 1G16A 1WXGA 1Q7CA 3J7AO 1RCFA 2AK2A 2GO7A 4NECA 1M75A 1LDBA 3HKDA 4DNFA 5K0TA 5J4HA 1ST3A 2FSHA 2HLNA 4ESEA 1PJCA 3F96A 2WDZA 3O7WA 3V33A 4BO5A 2RHWA 4D9IA 4BXFA 3F7TA 3GLQA