1S9HA

Crystal structure of adeno-associated virus type 2 rep40
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
268
structure length
268
Chain Sequence
AGMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rep 40 protein
publication title Crystal Structure of the SF3 Helicase from Adeno-Associated Virus Type 2
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
total genus 72
structure length 268
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1s9hA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9hA02
3QG1A 3ZYCA 1OIVA 1F3OA 2H17A 3NDPA 1MO5A 4D81A 3K70B 1G6HA 4BECA 1YZKA 3RAPR 1ZYUA 3LLUA 4G5RA 1WP9A 4TLDA 2O8DA 4GMDA 4P31A 3REGA 3TJZA 1LV7A 1U99A 2J59A 1LY1A 2QL6A 1BYIA 2C2HA 2LWIA 1YZLA 4EQ6B 4KYUA 2ZE7A 3A1VA 4E03A 1G8FA 3CRW1 5GJWC 2QTVB 2FJUA 4IW3B 1H8HA 3AF1A 1P62B 3MWLA 2CNWA 3N2IA 2QORA 5BN5A 1MR3F 1FFHA 2RGCA 2ZAOA 2RAPA 4A36A 3BFVA 1AS2A 1Q44A 4ZIRB 2J0QA 2GNOA 3PENA 2KE5A 2OAP1 1MOZA 1OH6A 3MRSA 3BB1A 4B44A 3EPKA 1G4UR 3BFKA 3AVPA 3GJ4A 1NVVR 1E9CA 5UKDA 4P33A 4RD4A 5KNDA 2ZRNA 3GLHB 2OE2A 1BYUA 2ZRBA 2YZ2A 4NYMQ 5FPYA 1F5NA 3K8YA 4AIIA 4DUGA 1Z63A 3UKDA 3AVYA 1P6XA 5FTLA 5ANRB 2NMVA 1RE0A 3QBVA 4A8JA 5L3SA 1GRNA 1ZC3A 4X8HA 3KJHA 421PA 2VLIA 1FPMA 5JWHA 1S9DA 5SZKB 2HCJB 1DOAA 1JI0A 2WIBA 4J0QA 2NQ2C 4IHQA 3SZRA 4QM7A 1NBME 4D2IA 1S9HA 3ND8A 4Q7LA 2CHGA 3PUXA 4F4CA 2I1VB 2PBRA 4F93B 1GKIA 2EFEB 3GJ6A 4JLOA 3SHFA 3A36A 2GF0A 4NE2A 521PA 2NO0A 2IF2A 4MH0R 3UATA 4GP7A 4HUQA 1S3SA 1N0VC 1ZRHA 2O8EB 1COWA 5M04A 2XZPA 4A82A 5BN3A 3U61B 3QG5A 3HJNA 1G7SA 4B3DA 5DISB 3I73A 3KKOA 1HQCA 1CJUC 4BEBA 4JSTA 1T9HA 2ORWA 2JLSA 4W7SA 4BFVA 2F9LA 2WM9B 4QGGA 2X2FA 2FEMA 4XVUA 3EAQA 1N2CE 3TAHA 3BK7A 1NN3A 1T5LA 4DC9A 2JIZA 2ONJA 2OCYC 1Z3IX 3PQCA 2IS2A 1W36B 3IDQA 1SQ5A 4TQ9A 2ZE8A 3IQWA 4JYCA 3HYRA 4CYMA 2RCNA 4D82A 1ZNYA 4C3ZA 4FD2A 1FTSA 2OZEA 5CB8A 4AC9A 1GWNA 2Z43A 3THWB 1KYIA 1FX0B 3I32A 4QRHA 1EFHA 3C5CA 2UZ3A 4UJ5A 4RVCA 4UNPA 2ZI6A 2V8OA 5FTMA 2XB2A 4LJAA 3L2OB 2R9VA 3GJ3A 3ZIAA 3SJBA 4F91B 5KSYA 1UEIA 4TLAA 2N42A 2PJRA 3V4FA 4DLVA 1SVIA 2XJ4A 2SHKA 3QKSB 1IBRA 2EFDB 2XXAA 2PLRA 3FOZA 1YZQA 3FMPB 4W5WA 4RY2A 2Z4SA 1NVVQ 3W8NA 1OIWA 1KAOA 3A4NA 1D9ZA 1OE0A 1D2NA 2PCLA 5IRCD 2V55B 4PPNA 3BRWD 2E9SA 5EE0A 4P4UA 1J2JA 1CRPA 3KXLA 4LHVA 1NI3A 4BASA 5IK2D 2ZJBA 4A0GA 2V9PA 3LAWA 4BLSA 3GLIA 4NBSA 1K6MA 3PFIA 4PPFA 5HZKA 2NO1A 3SQXA 4NYJR 4Q1CA 1GRRA 5JSZA 3EZ9A 4OQNA 1ZIOA 2IYTA 3DOEA 4AYXA 3KQKA 2DHRA 5AJWA 3DMNA 3QXHA 4LHZA 3PUZA 1S8FA 2KBFA 4NYIR 1NMYA 2GETA 4D25A 1Z5ZA 3CF2A 4UNSA 3W5JA 1EFRD 1NVWQ 3CX6A 2QT0A 1SVKA 5JHHB 1NVXQ 1U0JA 3EC2A 3FMOB 4US0R 2ZM5A 3BOSA 4DDTA 1DAEA 1P9NA 2RGAA 5EP3A 1M34E 3KJGA 3CH4B 4RZXA 3VKHA 3OEHD 1UDWA 4Q9LA 5DN6A 2B21A 3WMFA 2YOHA 1XWIA 1LW7A 2IBMA 1VCOA 1T6NA 4I81A 4WXRA 5J4YA 1AZTA 2ZE5A 3I5YA 1G5RA 4A6XA 4URZR 1EGAA 4LV5B 2YC2C 1N6KA 3RS4A 1EESA 4Q7MB 1II0A 2AD5A 2OXCA 3TR0A 1R4AA 2H57A 2ZPTX 4HUTA 4LYHA 1TL7C 3U3RA 3AV0B 4QBFA 3LBIA 1AA9A 4DT1B 2VP9A 4B74A 2GCOB 5EQTA 1GIAA 5SZIA 1TQ4A 5AUOB 3VQTA 1SKYE 3PV0A 4L15A 621PA 5TVKA 4DEYA 4HLUA 1CP2A 1GILA 1IAQA 1GOTA 3VU9B 1OHHA 4EFMA 2QMEA 2LCFA 3MWJA 3AP2A 1F60A 3ZQJA 3EWAA 2ZS8A 4QHYA 3C15C 1DAKA 1UM8A 2H16A 2WSSA 1TQ2A 2C95A 1X6VA 2OM2A 1KI8A 4I99A 5FR2A 3W8RA 1XTJA 4R98A 2NO9A 1G8YA 4TL9A 1JPJA 2HT1A 1VIYA 4MA4A 2JLWA 1MABB 1L8QA 4UNNA 4MGYR 1ZU4A 2BOVA 2BV3A 1NLZA 2C99A 2JCSA 2QE7A 4MYTA 4OHVA 1RW4A 2FN4A 1DO2A 3WXMA 2CE7A 4MITA 1GNQA 1T3LA 4YDSA 4A15A 4FCVA 2ZUDA 5B64A 4K46A 4ZCIA 3K0FB 5L3VA 1B0UA 2J5XA 4DIDA 3ETLA 3F0TA 4URVR 4KO8A 3LNCA 3GLGE 5KSPA 4NYJQ 4A4DA 4R2IA 3RC3A 2VH5R 3R8FA 3SJAA 2CJWB 1UKEA 3AB3A 3U6BA 3CWZA 3DEFA 3KTAB 5LDDC 1D8TA 1G7CA 4NYIQ 2W0MA 5AJXA 3PJRA 2NZ8A 1OH8A 1ANKA 4F4JA 1RZ3A 1OFUX 3ZLJA 4N1AA 4EPXA 4GRAA 2GWHA 1AKEA 4C0HA 1KOFA 3ZVNA 4PZLA 2ZJZA 5AWFC 3PUWA 1NL3A 2VHQA 3F8TA 2CK3D 1XEXA 5FBVB 5C18A 4WZ6A 1G21E 2IHBA 1UBFA 4URUR 3LA6A 4HSEA 2IT1A 2WSMA 4C7OA 3GQBA 5GVRA 2WPDD 1UF9A 4ASUD 3Q3JB 1ETUA 2FG5A 2BVNA 3LXRA 4CEJA 1GITA 1Q57A 1G3IA 1RRPA 5JS7A 1Z6XA 1E79D 1TEXA 2ODWA 2P65A 4DCTA 3PXGA 2IYUA 1C1YA 5KYKA 3OIVA 3ADKA 3VMFA 2ZJYA 2C04A 3U3KA 3VTKA 3T1TA 4TQAA 1BH2A 2P67A 4KAXA 5F3WB 4M1OA 1W4CA 3MAAC 3P20A 4PPQA 2WWXA 2WAXA 4TMVA 3ECCA 4MGIR 2OLJA 3KX2A 1H8ED 3CB4A 1EXMA 4IKEA 1G8PA 4TTPA 3WY9A 3R7WA 2QG6A 4IXNA 5JBQA 4JIMA 2J41A 1G64A 4JBXA 2XEXA 2ZSFA 4EUNA 5JRZA 2F43B 2NG1A 3W90A 2HEIA 3EZ2A 4TL7A 1PLJA 4U02A 4BFXA 1I4TD 1KTVA 4FCWA 2KB0A 4Q4AA 3ASZA 1DADA 3KQLA 1OXSC 4PZYA 1E9BA 1E2DA 4M21A 1UBCA 4QG7A 5K8IA 2JLZA 3A1SA 1QG4A 1TADA 1OSNA 3L0IB 4V0MA 1ZMXA 1R7RA 2HYIC 5SZHB 1CJKC 4OHWA 1IJFA 1VKJA 1SVOA 3LRPA 2W2VA 1KSGA 1NJFA 1A2KC 3CX7A 5FPSA 5HKKA 3TLXA 4M9QA 4M9ZA 4Z8YA 3SFZA 3VR6A 4BE7B 4G0NA 2CL0X 2BM1A 1YRAA 2IL1A 3KQUA 4C0SA 3AKYA 2IYYA 4LYAA 1CLUA 1ZM3A 3A58B 5JS8A 2V7QA 3ZZTA 2FEOA 3K9NA 4TL6A 1RJ9B 3VHXA 3KZ1E 2OCAA 2GJSA 4XTCS 1EX7A 4KHZA 3CONA 1NSFA 3VAAA 2QBYB 2B7CA 4AURA 4PHHA 5AR1A 4XWAA 4UXHA 2V4ZA 1E96A 5G40A 1KKMA 1IXRC 3VHLB 1M74A 5FOUA 2AR7A 2IYLD 3O8CA 4LPSA 2CHVA 3LLMA 4DLUA 2XNDD 5FL7D 3ZD7A 2VSXA 1X3SA 3LX8A 1Z0IA 3UK6A 5L8VA 1K5GA 3EPHA 2F1HA 5BN4A 4GI7A 3NEYA 4PR0A 2GA8A 1YR6A 4HZIA 4JL5A 1GG2A 4OHZA 1DELA 4PXAA 4M1YA 4EDHA 4B43A 2JJ2D 5E7IA 2EFGA 4XTRA 4BWYA 2ZYWX 1E32A 2ZSBA 3I3SR 1IY0A 1XTQA 3KJIA 1ZM9A 3VKGA 1FQKA 4EJSA 4PZZA 1E9SA 2RKOA 3DHWC 5GJCA 4MGZR 2DB3A 1JXMA 1X86B 2OFWA 1P7CA 1A1VA 1L2TA 3NHBA 1KSJA 1VPLA 2R2AA 5EZ6B 4ZCMA 3QVUA 1RFLA 2BBTA 4D80A 1ZNWA 2ZVPX 1TU4A 3TUIC 2ZIAA 4DJTA 3A4LA 3M4YA 4MKGA 4LBWA 5LB4A 3ONWA 4Q18A 4IRUB 2G3YA 4IVRA 1TQDA 2G88A 2QUZA 2ODEA 4E09A 2BC9A 4O2RA 5G3ZA 2PX0A 5IF9A 3LXXA 2PMKA 2AK3A 1G8GA 3R9XA 2ZJOA 5B58C 1EWQA 2R6AA 2WJVA 5FOVA 2HLDD 2RH5A 1M7HA 4RCZA 2B6HA 2RGNA 3Q72A 3OE7D 2VP6A 2YNMA 1MKYA 2YVUA 3CPJB 1Q3TA 4OQFA 2WVJA 3I92A 3OF5A 3GLGA 1XD2A 4PO8A 3TW8B 3FPAA 1N0WA 2BMDA 2O8FA 3QXSA 2JASA 4YXWD 4KFRA 5KNCA 3FE2A 3SI7A 1NN0A 3HR7A 3WMGA 5J4LA 3DPUA 1KI6B 5H8WA 3KXIA 2RGBA 1W0JD 2JLRA 2YC4C 1TMKA 1P60A 3BH6A 1NLFA 1PLKA 4JMPA 4BLRA 3RWOA 4CRWB 2DFLA 5D3MA 1N6HA 5FBLB 4CVNA 5BYKA 4KBFA 4ZPXA 5FOWA 1ZD1A 2QU8A 3QE0A 3UANA 1F2UB 1G6OA 1QF9A 4NP6A 3FMIA 4ACBA 4WIAA 4ZDJA 2FSIA 5DI3A 2JDIA 2UKDA 4JL6A 2F3TA 4HEJA 4OJQA 4V0LA 2F55A 1XZQA 4BEJA 4DDVA 2VHTA 1T4GA 4JKIA 4JL8A 3LD9A 3QKUA 4TMXA 4MRPA 2QM8A 2DFKB 3W6PA 1FW6A 4D0LB 3IO3A 1DG3A 3BBPA 2CDNA 3EIQA 4PO9A 1YRBA 4HB2A 4XSHA 2QZ4A 4AD8A 2L0XA 5TV2A 1K8RA 1UDXA 3B60A 4QKQA 2IEZA 2VP4A 3UG7A 2FPMA 4B33A 1WDTA 1YR8A 1LFDB 2CVHA 1YJ5A 4X8OA 3VNUA 2AN9A 3FHOA 2VSFA 4KI0A 3R8CA 1P4SA 2WJGA 5JMTA 2AHOA 3GLFA 1KI2A 1JR3D 1SVWA 4CEHB 1XF9A 3CH5A 4MYHA 4KLNA 3WHKA 4DCUA 221PA 1Z08A 1SXJB 1DG1G 3LX5A 1OIXA 4BUJA 4UXIA 1X8LA 2GBLA 1P3JA 1J7KA 1IN5A 4KU4A 2J0UB 3E5HA 3WP0A 1CR1A 2IWRA 4DDUA 2IYVA 3EA0A 1N6RA 4QJ5A 3IILA 4PTLA 5LPNA 4LDJA 1KDRA 1OXTA 3BS4A 3TKLA 2RGGA 2VF7A 4EQ6A 1NNEA 1G7TA 4LBYA 1SZPA 2H8KA 2Q9BA 2QPOA 5SZJA 4D4MA 3U5ZB 1U90A 3EW9A 1UBGA 1E99A 4KXFB 3RYTC 3JZAA 4C0BA 2NOAA 3AGQA 3FKSD 3E1SA 3NIBA 4L8GA 4AG5A 5CDFE 4OHXA 1ZUIA 3B1VA 3SYLA 5CLQA 2D74A 3L0PA 2YWEA 4OI1A 2D06A 2GJ9A 1GFIA 2NIPA 2WBLC 3AP3A 3EARA 1E2LA 1XX6A 5FPHA 2UZIR 3PR1A 2YWFA 4MGKR 4C2UA 2FA9A 5DH9A 3DMDA 2X2EA 4EPRA 3BXZA 3NH9A 1ZAKA 4XD7D 2OFOA 2LKCA 2PMDA 3WHLA 2KWIA 1NBMD 2ZS7A 2P6RA 4DIEA 4W5JA 2VP5A 1PJRA 3C16C 3OHMA 1W2HA 3GLHA 5EE9A 2ANCA 2D3WA 4FWIB 1E0JA 1JXOA 2PEZA 4TL8A 3WNCA 1Z06A 1YZNA 4TSFD 1UKVY 1KO4A 2BBSA 3CRMA 2O8CB 1KO7A 1M8PA 1ZP6A 4IDQA 4JJZA 2OEPA 2QMUA 3IIKA 4NDZA 4TYQA 3QF7A 2ZQ5A 2VHUA 1J99A 3E2IA 3THXB 2Q3HA 4C0KA 4RZ2A 1DARA 3EX7C 1P9WA 2EQBA 3W34A 1PLLA 1AGPA 4YDHB 2IWHA 4DEXA 1Q1ZA 5J47A 1WF3A 2WJIA 3RS3A 2YYZA 3T12A 3PIRA 3QY0A 1XEWY 5K8LA 5KSOA 2G77B 3TBKA 2IXFA 1E69A 3QUSA 4LJ9A 3GLIE 2O8EA 2QGZA 1TTTA 5CK5A 1XJCA 1ZCBA 5FI1B 4JLJA 4TLBA 3S1AA 1BS1A 3RABA 1IHUA 5JEDA 3I61A 4Y0AA 3NC0C 4M1SA 2W0SA 3A4MA 3WBJA 1OJLA 4TZ6A 1P9RA 1TF7A 4WW0A 3NBFA 3M1IA 2FFHA 2FZ4A 2G83A 4B6FA 3GJ7A 2C98A 3MJHA 2OFXA 5G41A 1NIJA 4OQLA 1N25A 2J0VA 2ZRHA 4F7WA 3E70C 1VHLA 1W1WA 3V00A 4A2WA 2KI5A 2C9YA 1TX4B 3TR5A 4LZZA 4MUBA 4EKDA 1XMIA 2V54A 2A3RA 1E1QD 3U3OA 4B35A 1E2EA 2CL6X 2DBYA 1RRCA 4Q7JB 2BBOA 5E7MA 4GL2A 1AQYA 3T35A 5K8TA 4WA7A 4Q4HB 3IHWA 1L4YA 1R5OA 1QHGA 2QA5A 3CKLA 3T5GA 3THWA 1FX0A 1UPTA 2OBNA 3WP1B 4PC1A 1IN4A 2AKYA 4X8MA 1R8QA 1VYVA 2V1UA 2J7PA 5CYPA 1A4RA 2PZEA 3RSLA 3WMEA 4OHYA 1U0LA 1BIFA 3AF4A 1E2KA 3ZVRA 4CT5A 2P5TB 4GMXA 3L43A 3SQWA 2F1IA 4HI0E 1JR6A 3QKSA 2BHRA 2RB4A 3OFNA 4EJSC 4A1FA 2GKSA 2A5JA 2X19A 1S3GA 4K81B 1JAIA 2FU5C 4LUCA 4RD3A 1R0YA 1J8MF 4K8OA 2J7KA 1FMLA 3BJIC 4R71A 1ODFA 5FH9A 1FNMA 1R0ZA 5B2ZA 1OYWA 4C2TA 1PV4A 3U7FB 1VCIA 2W6JD 1DE0A 1U9IA 2B8TA 2BKEA 1W46A 1UJ2A 1Z6YA 2MMGA 3NC1C 4QNMA 1L7VC 2RGNC 2IW3A 2MSEB 4OI4A 4ZDIA 1KI3A 2BEKA 3U44A 3AKEA 2J0SA 1G20E 1QHHB 1YZGA 2NO6A 3CPHA 4U00A 3LVRE 5L3QA 1OT3A 3WRYC 2XJ9A 1Z6AA 5GJVC 3VR3A 2RHDA 4Q4JA 3A6PC 5CIWA 3SNHA 3I62A 4Q00A 3VX3A 1HYQA 2QPTA 2ZRGA 4JVNA 4R7ZA 4LYJA 1ZD9A 3RRZA 1U8YA 2H5EA 3O8BA 4FMCB 2GXUA 4KVGA 4DKXA 4PX9A 3MD0A 4MYCA 4KBGA 4OJKA 5LD2C 3K53A 2REXB 4D0NA 3H0KA 1GAJA 1KK3A 2QT1A 2QENA 3HU1A 3UMSA 4D4LA 1W7AA 4US2R 1Z2AA 1ZU5A 1M1YE 1SXJD 2W2TA 5CDFA 1W5TA 2C78A 1LS1A 3JVUA 4Z1MD 2CL7X 5FUXA 1PVOA 3UMRA 3KQHA 5FTJA 2C77A 1XMJA 1C4OA 2WIAA 3F3YA 3ZGXA 4L4UA 4V0NA 3TNFA 2JLUA 4IJMA 1E2IA 4B2PA 5JZVA 1HUQA 3TK1A 1FUKA 1IXZA 1E1RD 3Q85A 3NHAA 3TSWA 3BH7A 1UFQA 2VO1A 1QVRA 1BMFA 3CR8A 3IPXA 4Q1DA 1NMXA 5DYIA 4B71A 4B3FX 1JBKA 5IT5A 4Z54A 1VCMA 2BJWA 4IDPA 4M1TA 1CJTC 2GCOA 2VP2A 2W83A 4ESHA 3SN6A 5C1BA 4LJYA 4OK5A 1ZNZA 4BRUA 1T8TA 2R6FA 2NPIA 1YZTA 4BZQA 3FTQA 3VFDA 3H4MA 1QHXA 4AYTA 1Q1BA 4M22A 1R2QA 2AKAB 4LSGA 4PFSA 3VU9A 1D2MA 4E07A 1Z6GA 5GJBA 5DSZA 4URYR 3B8HA 2H1LA 1AGRA 5JHGB 2JAQA 4RFSA 3FB4A 3WRXC 4BLOA 1GKUB 1NN5A 2GBLC 3PUVA 4BGDA 1Q12A 1QHNA 3K70C 1Z29A 2GK7A 4RD1A 4RKEA 2DR3A 4DLYA 4C0AC 4B2IA 2IXEA 2BM0A 1MABA 2FX3A 4CDGA 4CEIA 1U94A 3IIMA 2VYFA 2EVWX 4Q9JA 1YR7A 1N3BA 1VHTA 5HZHA 5GADl 4AG6A 4C0QC 4LK2A 3X1XA 4JVMA 4LBZA 4A8JB 3SBDA 1M6NA 2VPPA 3UMFA 3DM9B 3TVTA 3K0FA 3EG5A 4F4IA 1KIMA 5EE3A 2P6UA 4B3GA 2OBMA 5JFGA 3TH5A 3TAUA 1W0KD 4YMTA 3OAAA 4V0ME 1T0HB 3SJCA 1S96A 4HZUB 3T1OA 3QXJA 2CJWA 2V3CC 3TVDA 2WWWA 4ARZB 5DYGA 3U7EB 1NY5A 2Q9CA 2W6ID 5CJPA 2FOLA 3AVQA 3BE4A 5AJYA 3SYKA 4UKDA 2ZI7A 2VL7A 3AH8A 5CB6A 4BFWA 1KK0A 1CBUA 4KV9A 4BLPA 1VCNA 1ZD8A 4TMWA 4H9GA 3RSOA 3TSZA 2I1QA 2AK2A 1T91A 4GZMA 2FSHA 4BRWA 4F92B 3K0CA 5CK4A 1IOZA 1AN0A 1ZM7A 4L16A 5DE3A 1Z6TA 2Q0HA 1G16A 5J4HA 2ZRFA 4QJ4A 4GT1A 2CVFA 2EU8A 4TT3D 4YMUA 1W4AA 2BWJA 4NCNA 2UVQA 5J4KA 3FGNA 3T61A 1CIPA 3MCAA 2ZYUX 4LHXA 3KB1A 4P32A 4M1MA 2JJ1A 3OEED 4OKSA 4RCYA 2D2EA 5KPJA 1G4AE 3LY5A 4FMCF 3K0SA 4DB4A 3OIYA 2HT6A 2GILA 1WA5A 4HB3A 3RRMA 3KKPA 1WMSA 3AQ4A 1FP7A 1KY2A 2ERXA 2O8BB 4IEEA 1J70A 2PJZA 3EZ6A 2AWOA 3EZFA 2DWOA 2K5UA 2GAAA 3IBGA 1NSTA 1II8B 2PL3A 3QIAA 4XWKA 4JLNA 3P1JA 2HYDA 3I72A 3NDBB 1XBTA 5IDVA 4M2LA 4TMTA 3JVVA 1OKKD 2IEYA 2XTZA 3AVUA 4NU0A 2ZSAA 3G82C 4N3NA 3CUEF 3U6KA 4B76A 2YOGA 2FMXA 4HDQB 1ESMA 4IVQA 4C0LA 2IS1A 2DPXA 2ZVQX 2ORVA 1XXHE 4OK3A 3TE6A 2RHMA 1Q22A 2WWGA 1XNJA 1EG7A 3VKWA 1E9FA 5EUMA 3ICEA 1W36C 4Q4LA 1W48A 2VBCA 5FTKA 4C30A 2WWYA 3B1YA 4YMWA 2QNRA 3K0AA 1XEWX 3A1UA 3I8XA 4I1UA 5DIFA 3T15A 1W4BA 1Z0KA 1II9A 4MUAA 4HDCA 2KSQA 3X2SA 1CR4A 2GESA 1BO6A 2ZSEA 4MDEA 2XSZA 2QQEA 4IFBA 1XPRA 4TMKA 1N5KA 4P4SB 1CJVC 1FUUA 2QAGB 3W6NA 1RJ9A 821PA 2IYZA 3UIEA 1XEFA 1OXVA 4EPTA 2W2XA 2IX3A 1VG1A 4EPVA 4WVFA 3OIWA 4NKRA 3D3QA 2C9OA 3L82B 1KJYA 5EUQB 3TMKA 5FR1A 3ZH9B 4B2LA 4BFYA 3SJZA 1G19A 5TB5A 1TF5A 4YMVA 1Z47A 4Q1BA 4Q5IA 2J1LA 3GFOA 3CZQA 1MT0A 2REBA 2ZROA 2F3RA 2FFQA 3L0SA 4Y0VA 3K09A 5FTNA 1P73A 1WB9A 3SS8A 3FHCB 1XFAA 3GJXC 3G0HA 3ASYA 1E0AA 5CM9C 4PC3A 1IY2A 3IPYA 3LVQE 4U7DA 3DKVA 1T5IA 4RFVA 4B34A 1U9IC 3H86A 4DDWA 4DSNA 1E9DA 3I5XA 5JJKA 2XITA 3C7KA 3CF0A 4FMBB 3MLEA 4URXR 4FIDA 5AK0A 4LCBA 2WOJA 4JLPA 1R0WA 2QPAA 4NPHA 2C96A 1KO8A 4C4PA 1A5TA 1KY3A 4A0RA 3GLFE 1NRJB 3FVQA 2EW1A 1AKYA 5JI2E 5JWRA 1WBBA 1G1MA 1N6NA 1Q1EA 4Q1EA 5FUYA 5JEEA 1Q0UA 1BKDR 2Q3FA 2G9NA 1N6LA 3PCRB 5BXQC 2WKPA 2F1JA 2IUTA 2G1KA 1G41A 1H8HD 5EXTA 4S2EA 2CNWD 1VECA 3D6TB 3KKMA 5E3HA 3X1ZA 4JLAA 5CLLA 2BIFA 3MFYA 4B3BA 1E6CA 1XD9A 3NKVA 4DSOA 3JZMA 3TIFA 4G3XA 1GUAA 2E1RA 1ZC4A 2GXQA 1VMAA 2XOKD 4TYWA 2JA1A 2JJ8A 2P5SA 4LBVA 4MKIA 3QVVA 1KI1A 3TQCA 4DCSA 2R6DA 1OXUA 3B2EA 4CGZA 3KB2A 2ZEJA 3AKDA 2AX4A 2QRNA 1G3RA 3B9PA 2D7DA 4MYUA 4DWJA 1GL7A 3X1YA 2B7BA 1XRJA 2C03A 3LDAA 1YR9A 1XDBA 4DUGD 2ZRLA 2ZR0A 5TXGA 1MO6A 5EXSA 1SHZA 4D4JA 1AK2A 2VHCA 3BFXA 4JBYA 4XH9B 1HT1E 2QI9C 4ILEA 4PAOA 4Q03A 1ZVQA 2QRZA 4BZXA 2QP4A 3NVAA 4HATA 2Z6VA 4FMDB 1E9AA 3C14C 1W49A 5J4VA 5JJLA 3KQNA 4PSKA 3GLHE 2OO7A 4LJ6A 2BKUA 3GCGA 1L4UA 4A2QA 1N5IA 2HXSA 3MSXA 1TAGA 4LYFA 3C4JA 2XZLA 4DB2A 4CIDA 5DGXA 5HTKA 4QM6A 4N0DA 4CZ2A 2HJGA 2KBEA 1COWD 1QRAA 3QF4B 3QPWA 3B1ZA 1Z2CA 2DYKA 1NMZA 4QBGB 4QBIA 2XAUA 2QSZA 4OI2A 3AM1A 1E0KA 1XP8A 3DZ8A 4PAQA 2I4IA 3EC1A 4BFSA 4D4KA 3SU8A 1AS3A 4GFDA 4LPKA 4JVLA 3Q7QA 4Q9HA 3X1WA 1XEXB 4CEHA 1UADA 1KMHB 1E4YA 1SXJA 2ZJAA 4TMZA 2XTNA 2A5FA 4LC0A 2JIZD 3DVLA 4Q48A 4C7OB 1KI4A 1SKQA 4LJ8A 2ONKA 2Q6TA 2QMHA 4NHOA 3KUDA 4CEJB 1P72A 3SYNA 1U2RA 1VYUA 2FV8A 2GEDA 1XXHA 3QKTA 2I3BA 1DS6A 1K5DA 2VHJA 4E22A 2OUKA 1GSIA 2ZRPA 2IUSA 4YMSA 4GBMA 4RZUA 3QENA 5TDHA 3NBYC 2F7SA 3M6AA 1QG2A 3VR4A 4HAYA 2ZR7A 5EJEA 2F6RA 4KCGA 4XVRA 2GZHA 2QTFA 5E4FA 4TQUS 2ZRMA 3O8DA 1QHYA 3QI2A 3FDIA 8OHMA 1NKTA 2O0JA 4FWTA 2R8RA 2CE2X 1SVSA 2HV8A 4NCJA 3D7MA 1CTQA 2ORIA 3SDZA 4BFUA 4FINA 3B78A 3K0CC 4HB4A 4IEIA 3ZIAD 3U4QB 1KHTA 1NVUQ 1RRGA 1TPZA 4XVQA 3GFPA 4Q66C 5DHFA 4NL4H 1OPXA 2QQ0A 3N2EA 1WBDA 1YU9A 4GZLA 4DHEA 4O3MA 1KZGB 1B23P 3U60B 4PSVA 1DPFA 4YQFA 2CCKA 1F2TA 5H70A 4E5UA 2FGJA 4L9SA 2BMEA 1E2MA 1E2GA 4TWZA 2O5VA 2OG2A 2IUUA 2Q9AA 1EFTA 4PSAA 4LY6A 4UXJA 5IK2A 1E9EA 3HR8A 2WJYA 3AP1A 5BW8A 2NZJA 2VF8A 4ZDWA 3VNVA 2RGXA 4XJXA 4BLQA 4B48A 4DRZA 3A8TA 1E2HA 2N1BA 3PG5A 1WCV1 3RS5A 4CT4B 1JEDA 5FBQB 1RIFA 1EWRA 4O2LA 4MQBA 3HYTA 2VRWA 4NZYA 3THXA 4AYWA 5J5CA 2WOOA 1E2NA 2XTMA 3WYFA 4B6EA 3WBKA 3B5JA 4MRRA 1W4RA 3RDPA 1EFRA 1I2MA 2PLFA 1KNXA 3Q7PA 3RS0A 4JKYA 4A0HA 1OLOA 1JNYA 1S2MA 4O25A 3B85A 1CKEA 2RMKA 3QKRB 4JSYA 1KGDA 2ANBA 5AUNB 1U0HC 3K9HA 4S35A 1TF2A 4H1UA 4Q9KA 5DI9A 3LV8A 3C5HA 2ZRAA 4TYNA 4B73A 1VIAA 2NPFA 3OEHA 2XB4A 4KITB 3CRQA 3MJRA 4GOKA 1N5LA 1SKYB 4KVAA 2QROA 4F38A 4BZPA 2H7VA 3IIJA 4FMDF 2X1VA 5DN6D 2XGJA 1NJGA 3Q9LA 4V02A 4GDFA 1GZSA 4M0LA 2GZDA 2ATXA 1ZW6A 1ONBA 5L3RA 4QGFA 1OFIA 4MRSA 2YINC 3ZQ6A 3VR5A 4IOJA 1DAFA 1E3MA 3QOFA 5EXPA 1OB2A 1JJ7A 2ZI5A 2HUPA 3FWYA 3DO6A 3KKQA 1WRBA 5C4MA 4JLBA 1KAGA 1JAHA 2ZI9A 4Q1FA 3R9WA 4Q4HA 4ZIRA 3FYHA 4AKGA 2PX3A 4JVSB 1G291 1US8B 4Z51A 2BBWA 4JLMA 4G01B 2BCGY 3RLFA 3K09C 1NN1A 2QM7A 2WTUA 3Q5DA 1OHHD 721PA 2Y8EA 1IY1A 3MMPA 1OKKA 1GNPA 4LOAA 1JECA 1X1RA 5F2EA 3V9PA 1N6OA 3DOFA 3GLGB 2BMFA 2WSSD 1KKLA 2O8FB 2WWIA 2R6GA 3LH5A 1Z0AA 1RC8A 1OW3B 2PCJA 1OF1A 2GRJA 3M0EA 2DY1A 1XD8A 2JGNA 1FNNA 3GEHA 4OYHA 2QY9A 4QHSA 2AD1A 3AUYA 2QE7D 4BFZA 1GVNB 3QXCA 3SR0A 3I4LA 2QMOA 3EXAA 3CF6R 1J90A 2MSDB 2WICA 3AKCA 5FFMA 4PPGA 2C8VA 2IXGA 4HAUA 3KJEA 4DVGA 5DI3B 1N6IA 5C2JB 1TQ6A 1ZINA 2HCBA 4KODA 1KDOA 1IXSB 2YWHA 4QGHA 5KSZA 1QHHA 1ZNXA 2R65A 3ZZ0A 2ZYTX 4I1OA 1U8AA 4KFTA 1KMQA 1NLYA 1KJWA 2CCJA 2ZE6A 3O47A 2OT3B 2JLQA 2ZSDA 3UWKA 1HURA 2JLXA 4PQRA 1Z0JA 2ODNA 3QJYA 1AIPA 3I1FA 2CK3A 3CBQA 3TW4A 3H84A 3MGCA 1CR0A 1YVDA 2GAOA 4RD0A 2P0EA 4M4SA 1XMVA 1Z28A 2A5GA 3W3AA 3KKNA 3THYB 4QFMA 2FWRA 4ITRC 1OH7A 1M2OB 4M8NE 4CW7A 1DAGA 4IFEA 2WPDA 4ASUA 2O52A 2HXYA 4HLDA 1QHIA 4PC2A 2OCBA 4LV6A 1UBEA 2QP3A 5BQ5A 2F1RA 2HJVA 4PQFA 4RD2A 5EP1A 2WWFA 1E79A 1P2UA 1WE2A 3BH0A 5D3QA 1XCGB 1IONA 1Y3AA 2G0NA 2VP0A 3UG6A 6Q21A 5HPYB 2IS6A 1GDDA 1T8UA 4G5SA 1EFCA 3EASA 2Z4RA 1JR3E 2GF9A 1H8EA 1E2QA 4GPTA 1ZUNB 4KYIB 4WXPA 2IA5A 3OZXA 2FDCA 1CU1A 4URWR 2CMKA 5ELXA 3PEWA 2IF0A 4DSUA 2ZI3A 3A1TA 3HU2A 2ODBA 4NMMA 5HR5A 3UPUA 1KSFX 4WZAE 4OQMA 2ZUBA 1SXJC 1AM4D 2XOKA 2CBZA 1KI9A 2EFCB 4LJ7A 4H1VA 4Q01A 3CIOA 3FHTA 1W47A 5A4JA 5KUTA 3EA5A 1XPUA 2GVZC 1VTKA 4I1SA 4KFSA 4JT2A 5HKKD 2QGNA 4LJ5A 3QBTA 3L0OA 4PANA 1KK1A 4LC1A 3KFVA 4Q47A 1JQJC 2AL7A 3AVTA 5G3YA 5CYOA 2V7QD 1OFHA 5KNBA 4C9BA 2X77A 4P4TA 1Z22A 3B82A 2HF9A 3RRNA 3FFBA 4EFLA 1FZQA 4FW9A 4PQYA 1KDPA 3PEYA 4HZUA 3W5IA 5EE1A 4ARZA 2J87A 1T3SA 2XNDA 4IDHA 4IXMA 5FL7A 3W6OA 1VG0B 2IC5A 2ZU0C 1FTNA 3VR2A 1V5WA 5FBRB 1DEKA 2ZITA 1XTRA 121PA 3ZDQA 1X1SA 2BEJA 3VR1A 5K8UA 2A5DA 2A5YB 1E98A 2FPKA 2JJ2A 3AVWA 1N5JA 1NY6A 3S1AB 2WJJA 3OESA 4XSGA 4B32A 4KLZA 1Q21A 4DLTA 2FFAA 1OYYA 3B9QA 3B13B 2O8DB 1OV4A 1RKBA 5FOTA 1RPZA 1G18A 1IN7A 4NH0A 1E94E 4AI6A 2Z83A 3HWSA 4FI3C 3QEOA 3CR7A 4DT1A 1RRFA 2FPLA 1XPOA 1U8ZA 3EIEA 3EZ7A 2ZJ8A 3GJ5A 4YONB 2D7CA 1KJZA 3T34A 4IDNA 4W5HA 5AUPB 4ZCLA 2ZI4A 2QEQA 3ND9A 2HLDA 2LKDA 3B1XA 2O8BA 4ABYA 2Q21A 3OE7A 1ZBDA 3BC1A 4LRWA 1II8A 4DLXA 4QJ3A 2GEUA 4B47A 5E95A 3LBHA 4NCIA 4BFTA 5EE5B 3CX8A 4HDOB 1FMJA 1T0JB 2OILA 4YXWA 3L8ZA 2YOFA 3CPEA 4WZBE 4JZKA 5KDDA 1AQUA 3AGPA 2TMKA 1W0JA 3U2QA 1GP2A 1XU4A 2OCPA 3U7HB 4D26A 2REOA 4LJ4A 5KDLA 2GXAA 4NCKA 4GOJA 2GCPA 1OFTA 4US1R 1Z0DA 4QHTA 2CCGA 5L3SB 3ZS8A 1VDZA 1S1MA 2RGDA 4D6PA 4PAMA 3LQRA 3UWOA 4G5OA 3F5FA 1NKSA 4GNKA 3AF0A 3T06B 1P75A 2B8WA 1YQTA 4AY2A 1GTVA 4EPYA 4ZO4A 3GPLA 2JDID 3SOPA 3C41J 1M7GA 2OBLA 2YV5A 2FSFA 3KTAA 3U3MA 2PZFA 4HAWA 1SGWA 4P4SA 1U98A 3U44B 2QAGA 2AFIE 3EPLA 3AF2A 4HUQB 1WQ1R 2IHYA 5L3QB 1U81A 4IOLA 3CRVA 3IHLA 1XTIA 3FKQA 4Q4JB 2GJ8A 3EWSA 4PHGA 1UAAA 4V0KA 2O0KA 4ON9A 2YKGA 4L9WA 1G3MA 2A9KA 3DKPA 1FP6A 1ZJ6A 3NG1A 1XCMA 1A7JA 3IEUA 1AZSC 1TNDA 1JR3A 2QN6A 5JCZA 2J3EA 2OHFA 2ECKA 2IYWA 3DDCA 1X8KA 3VX4A 1XJQA 3IQXA 2XZOA 3KFXA 1S0UA 2MMCA 4AK9A 2RGEA 1CS4C 1YE8A 1ZIPA 2JATA 1G7RA 3SHWA 3I8SA 1MV5A 4I1VA 4G5GA 1KI7A 5DLQC 4MKFA 3K70D 4G5QA 3V4RA 1P2TA 1LVGA 1LF0A 4BPBA 2GEVA 2PH1A 1D9XA 4PO1A 1JJVA 3IKJA 2ZTSA 2WKQA 2QTHA 1HEIA 2AWNA 3R9IA 2ZUCA 4C0JA 1NF3A 2DFTA 5F9FA 2YWGA 3G5UA 1AJEA 1E4VA 3WYGA 3HDTA 1TEVA 3FKSA 1SXJE 2EFHB 1W5SA 4KJZA 4DSTA 1SHKA 1UKZA 2EWVA 4PHTA 1Q20A 4ZKDA 2F43A 4M53A 4TZ0A 1MH1A 5KOYA 4JYBA 4DLZA 4I4LA 1DAMA 2XXAB 3CNLA 4WBSA 1ESNA 5B57C 2ZRIA 2GHIA 3T1VA 2BMJA 4XD7A 5FBWB 3O8RA 2F9MA 4A9AA 4DLSA 2DWPA 1MRSA 1NBMA 1S1CA 2VEDA 5BYJA 4RFSB 4XWOA 5TMPA 3MWYW 1R5NA 3B1WA 5C4GB 4HAVA 1G3QA 3WNDA 1LTQA 1IJEA 4HAXA 2R62A 1P2VA 2MSCB 2Q3MA 2ZREA 3DM5A 4QC2A 4TSFA 5KPDA 2HF8A 4EIWA 4CEIB 5FL3A 1JB1A 3WNBA 3GLIB 1IN8A 2PZGA 1Y63A 4FXPA 1J8YF 4TYPA 5LBIA 4TTQA 5JSZB 1VG8A 2YJTD 4YC7A 1N0UA 4KFUA 2QBYA 5FUVA 4M9SA 3FMFA 4UQOA 4B3XA 1HT2E 2QSYA 3GEEA 1JQLB 1N6PA 1C9KA 4A92A 3PEUA 3LW7A 4LHWA 2P2LA 4ZDKA 2IYXA 2FGKA 2ZR9A 4GSYA 2CXXA 4BQSA 4ACAA 1E2FA 1OH5A 3TQFA 3BWDD 5HE9A 4PHFA 2G0TA 3IUYA 4XOIA 2XX3A 4ZKEA 1A82A 1V43A 2OSBA 3NBXX 3LBNA 2D4HA 4PC6A 1NG1A 1XJ0A 3QF4A 3D31A 2IS4A 4WAUA 3KL4A 3W9YA 4LX0A 3SFVA 4P3YA 1GNRA 1VYTA 3P32A 4Q7KA 4ESVA 2GJKA 4TN1A 2QP9X 3LFUA 3P4XA 1OB5A 1QVAA 1TUIA 2B92A 2R44A 3GEIA 2IYSA 3HU3A 4M1KA 5HCNA 5DNYB 3KXKA 3BB3A 3TGPA 3N70A 1KMHA 4O0MA 3AVVA 1G3UA 2DWQA 4A8JC 5BWMA 3ICQB 4QL3A 4IOKA 3CM0A 2N46A 3NEJA 4DZZA 3K9LA 2ZETA 2NTYC 2C9CA 3CO5A 1HTWA 1E1QA 1CJMA 1E2JA 1ZUHA 2PT5A 1Z8FA 3DL0A 1W36D 1XZPA 2JEOA 5JCPA 4R2HA 1GL9B 2E87A 1W44A 4D0GA 2A30A 3K0EA 1HE1C 1EFUA 4BLTA 2OAQ1 3AVOA 2WKRA 3ZJYA 4IDOA 3ADCA 2AXPA 5F9HA 1YZUA 3ADDA 3MWKA 1BOFA 1NG9A 4R9UC 2J7PD 3MG9A 4IVPA 2CLDX 1OXXK 5C46F 2G6BA 4ZI3A 2CHQA 2Z0MA 5CJ2A 4PC7A 3U4QA 4HB0A 5AUQA 1SVMA 4LHYA 3K1JA 1KI6A 1QHSA 4RSGA 2O0HA 4WOPA 4A0FA 2ASEA 2WMOB 1R8SA 4LV8B 5FOSA 4QGAA 1D5CA 1G17A 3OFND 4UNQA 1NP6A 3CRRA 3H1TA 1G5TA 1MO4A 4IOMA 1T3HA 1LB1B 1PUJA 1E9RA 5EP4A 1F2UA 3REFA 5KU1A 1Z83A 2BJVA 2GJAA 4DLWA 1I4DD 1JALA 2A2ZA 3PVSA 2W6JA 1M7BA 3RNLA 2G1JA 3PUYA 4B3CA 2FF7A 5JLJA 3K0AB 2V6JA 3C8UA 3HPQA 3Q8XB 1JEEA 1X8JA 2EYQA 1GRQA 3QPUA 4HLCA 1XTSA 4LWZA 2FZLA 2A7QA 2H18A 3GMTA 3LO5A 4OBEA 1RYFA 3K9GA 1IQPA 2DCUA 1ZM4A 3NBZC 5KO2A 2NGRA 3A37A 2FH5B 3SEAA 2IYQA 1FQJA 4HLQB 4DLRA 1CULC 1KDTA 1EX6A 1YHNA 2D62A 1KNQA 3FFAA 4M1WA 3RANA 4NCHA 5EZ5A 4MKHA 1KZ7B 3QKRA 4EPWA 3P27A 1DAIA 4RD6A 3QSYA 3U7GA 2WZQA 4ERNA 4JLVA 1QBKC 4OI0A 1E2PA 4Z1MA 3CWQA 1KK2A 3THOA 3WYAA 1R5BA 1W2GA 4Q9IA 1D2EA 1EK0A 3D8BA 2J0UA 3NTUA 4LGMA 5FPKA 5KHOC 1XB2A 3J81k 4A6PA 4JLDA 1CXZA 2V6IA 3QPVA 4QOSA 5CM8B 1E1RA 4ZV4A 2FE4A 4X8LA 5AJZA 2OV2A 2QAGC 2ATVA 1LS6A 2D2FA 2AFHE 4OQXA 2ZRJA 3GP8A 4HYYA 5A5GA 1BMFD 3RHFA 3SE0A 2ZXUA 1TU3A 1XCPA 3IO5A 2J45A 3PITA 4MDFA 1S4QA 2XNSA 1SULA 2ZJ2A 4Q21A 1DTSA 3GD7A 3R7WB 3CLVA 3X1DA 4UNRA 5DO9A 3ZZUA 2IYRA 1HH4A 1TUEA 2VA8A 2VQSA 2X8AA 2ZYVX 1XTKA 2VIIA 1US8A 4POAA 1VG9B 1Q3HA 2HDNB 1CR2A 3QQ5A 4FN5A 5AJVB 2BDTA 4JS0A 1HA3A 1YKSA 4Q4AB 2GXSA 3AEZA 2EWWA 1JPNA 3NWJA 3IBYA 4RKFA 1FL9A 5H68A 3BERA 2YHSA 3B7GA 3Q5EA 1GKYA 4LI0A 3A1WA 1DVRA 3R20A 2JLYA 3EIHA 3L8YA 3AF3A 4DBLC 3TRFA 1HQYE 1RVDA 1GL6A 3T1QA 1G5PA 1H65A 1AS0A 1CRQA 5CITA 2O8CA 2P3SA 4QBHA 4JT4A 4EAQA 3KDSE 3QXXA 1KO5A 1ELOA 4NTZA 4B75A 5LB2A 1WXQA 5FUWA 2CEAA 3MUFA 1DAHA 3RRYA 4CF7A 3IGFA 4GP6A 1HV8A 4TLCA 1W0KA 4QNRA 1SVLA 1UKYA 1MO3A 4II7A 2CLSA 1ZM2A 3RWMB 3RVBA 5KTYA 4HLUC 3OAAD 4U5XA 2ZANA 2W6IA 2PT7A 4L5BA 2KJQA 2VSOA 2JLVA 2ZS9A 2BCJQ 1LF5A 3SBEA 5JECA 4W9MC 4KSCA 3TSOA 2H92A 1G9XA 5H1YA 2AXNA 2OXRA 5FOXA 3B6EA 2NO7A 4RJLA 4AKIA 1UEJA 2P6NA 5J40A 1HY3A 3RC8A 4TYYA 3NXSA 4XIGS 2GTPA 1I4LD 4N0EA 1ZCAA 4JLKA 4MRNA 3N5CA 3THYA 3BAFA 3P26A 3ZVLA 4AKEA 1F48A 5GVSA 2ZRDA 4OK6A 3SC3A 4TT3A 3CW2A 4EJSB 2PEYA 2FSGA 4AKHA 1RYHA 3ZD6A 5TY0A 3HPRA 3OEEA 2J46A 1CEEA 4KSBA 3NH6A 1I2DA 3IEVA 1E0SA 2JJ1D 1O87A 2ZU6A 1FOEB 1CF4A 3GJ8A 2V1XA 5HE8A 4M9XA 3HP1A 2GVDC 1XXHB 1PZNA 2J9RA 5EXXA 3RS7A 1QZXA 1P61B 1Z0FA 1R6BX 3T5DA 1IN6A 1O3YA 4JJKA 5IHPA 2QAJA 5JRJA 3H2YA 3BD9A 4NONA 5JWOA 4Z8XA 3TUJC 4DXAA 1D6JA 1XD2B 4Q1AA 1HE8B 5DHAA 3QEJA 1MRNA 2OESA 3W3ZB 3UXMA 2DFNA 4DCVA 2OLKA 2WV9A 1GM5A 2GZAA 5FI0B 3EPJA 5E7JA 5P21A 5TARA 4AWXA 2W58A 5JI3E 4JBWA 1KSHA 3LW8A 2ZRCA 3BORA 4G1UC 5D3MB 1IM2A 4HAZA 5LD2B 4DCNA 3OIUA 5G53C 3ADBA 1Z07A 1F2TB 4NYMR 2WHXA 5B30A 4OL0A 1P2SA 2ZJ5A 2GK6A 3QNUA 4P0TA 2GCNA 3BB4A 4EFNA 2Z5FA 5FPTA 4Q19A 2CLCX 5JJIA 3CNNA 1DBSA 2R6CA 3BIFA 1LNZA 2GDJA 3PEVA 4TLEA 4TTRA 1A2BA 2ERYA 3ZS9A 4V03A 4UJ3A 4YLGA 2XSZD 3KUCA 3P4YA 5EP2A 4ZI2A 3BGWA 1R0XA 3CNOA 1NIPA 2EYUA 1XMSA 2WWHA 1P5ZB 5A0FA 1F6BA 2ZAMA 3GJ0A 2FFBA 4Q02A 1G8HA 3U3JA 5KDOA 5CIQA 3LQQA 3LWNA 2VTKA 4V0OA 3RS2A 3TUZC 1PUIA 2W00A 3CZPA 4MRVA 4QXAA 3DZDA 2FNAA 1R10A 4GOXA 4A2PA 2C5LA 4RZ3A 3GLFB 5HCIA 3AVXA 2WAYA 3GFTA 2WMNB 3AUXA 4FCTA 1Q1QA 2A78A 1DO0A 5F98A 2IK8A 1QDEA 2ZRKA 2WJHA 1KO1A 3ZVMA
chains in the Genus database with same CATH superfamily
2YV4A 2PIAA 3X1JA 3Q8LA 3W7VA 2XUZA 4RQUA 1TM5E 5A3QA 4G67A 3O1JC 3HJAA 3FXUA 1DRVA 3UM9A 3MWLA 3PL8A 2OHHA 1FFHA 4AUNA 4N47A 5KBYA 3WZ2A 1V5FA 4B45A 4BMXA 5E3IA 3A0RB 3F98A 5DTMA 3RPUD 1T5DX 3GJ4A 1PAUA 3E9RA 3ZWPA 4YJ3F 1RZUA 2IIPA 4RW0A 1TZJA 2BHTA 5FPYA 3MOIA 4ZJPA 2NMVA 2GLXA 5L3SA 2PUCA 5D7NA 1FPMA 3L5OA 2DE0X 1ARZA 1ULAA 1MJNA 2I03A 3LC2O 2X5KO 2FZKA 2PBRA 4JX4A 4L8VA 2LSOA 3FXOA 1J2YA 1T36B 4BKQA 4OAZA 5M04A 5HRUA 4JXZA 3HJNA 1VHJA 4EI2A 2WM9B 1ZRCA 3BK7A 1YLFA 3DHNA 5EESA 4FI3F 4C6HA 3VOSA 3ABMH 2RDPA 3CEMA 1EGVB 1ZNYA 4ESJA 2WW8A 1LVKA 3KAKA 3L40A 2OCEA 3T0GA 4AWAA 4LJSA 3EOZA 4J2HA 1VYHA 5K0GA 4LB5A 4M7OA 5KNCD 1J2RA 1OE0A 3FOAA 2FPGB 2P4WA 3HDJA 4NYJR 3STTA 1GRRA 5M3BA 4EG5A 4AMBA 2B2NA 1S8FA 5HDBB 2H2IA 4Z3DA 5A03A 1Z5ZA 2B6NA 1EFRD 5ILVA 1HE5A 3BG3A 4US0R 5I6DA 2ZM5A 4KR7A 3EA4A 2GN9A 2GLTA 4WNAB 4CM3A 1DAEA 1IG7A 1XXLA 2MW8A 4UC0A 3A1YA 2O3TA 3KWLA 5DN6A 1R6DA 3ASNH 2WSLA 4XFJA 1NU8A 2YH2A 1VE7A 3G7NA 3OWHA 1NXVA 4LV5B 5IAEA 3F5DA 2M98A 3KC2A 3FYSA 1GPKA 2JFVA 4KZPA 4CDNA 4CICA 1HXHA 2NOJB 1C3JA 1KONA 3ML6A 1LBHA 1LSOA 3VQTA 3UMMA 4L15A 3M49A 5TVKA 1GILA 5CEFA 4L07A 5A5FA 4FLFA 2C97A 2V0GA 3PQ7A 1JVNA 1J5XA 4TL9A 2HVQA 3INRA 4TSKA 6LDHA 5IUJC 3VJMA 2WF5A 1O54A 1H1LA 2C88A 3LY9A 2CSUA 1FLIA 3O73A 2ZUDA 2GPAA 4OINF 3F0TA 1ODDA 3F74A 3BCHA 5IJWA 5FYQA 4ZP1A 5IPAA 3PC7A 3R8FA 2RIRA 5AMXA 3SIWA 3K2ZA 2PWPA 3C74A 3WBBA 1XDSA 1MMDA 1KOFA 2CK3D 5BNFA 3HR4A 3LECA 4G63A 2IJLA 3GQBA 1YS7A 2BY3A 2LK2A 2JCBA 3HVUA 2CUJA 5FAXA 2LUOA 2OPHA 4O33A 3OYJA 2WWXA 1Q0RA 2XI4A 1JHDA 1UZAA 3TL6A 3CB4A 4Z2AA 1EMDA 5CDUA 1K63A 3U17A 3A2NA 1KERA 1ZFNA 2JT1A 3SHVA 3W90A 4FQGA 5DM0A 1KTVA 2FWPA 3GZNA 4JP1A 1O94A 5TIIA 1USSA 5JISA 5CXSA 3UAYA 4V0MA 1IJFA 1SUSA 1N0IA 4NPCA 4O6JA 1QNLA 1R0LA 2IYYA 4U3JB 4X1YB 1ZM3A 1W2WB 3K9NA 2O7OA 4EVRA 2YWXA 4MR7A 4CKWA 3WKAA 4HX7A 3KSDO 3HMKA 2EFNA 4MTDA 1BXZA 2FETA 1P2DA 5HIMA 3X1KA 1M74A 1U6KA 3LLMA 3UHJA 1PIWA 2GD1O 4GI7A 4HZIA 1SBNE 1R9MA 4B43A 4ZYZA 4J9UE 1MJHA 4ZQFA 2ESRA 1RFLA 1L7AA 2QX7A 4CL0A 1JDNA 1RR8C 3FSJX 1CFJA 3TLMA 3WWEA 4LSMA 4M8IA 1X4OA 1ZGCA 4POOA 5FKLA 1DX6A 3CPJB 3OPNA 1N33B 3H6KA 2QIOA 2JASA 5KNCA 4UD6A 5C8VA 1U2WA 4MAAA 4FEAA 2I7VA 2AFIB 3WIVA 3FCOA 4O6VA 1TTHA 4RKQA 5FDFA 3RBXA 4NNOA 1YKFA 5IVPA 5A7FA 2YZ7A 1Q5PA 4V0LA 1BL0A 4NVRA 3ZK9A 2IGTA 1YMQA 3T7EA 2ZBUA 5HS6A 2Z5LA 1DDIA 4JFRA 2AOUB 3ZU3A 3VNUA 1ON2A 1OGJA 4F8JA 2IP4A 2OGWA 1SVWA 3BHIA 4KLNA 3WHKA 221PA 3LX5A 4BUJA 1U2DC 4A3IJ 2FPPB 4QECA 1V8PA 4GI2A 4DDUA 1PTJC 2Q2EB 1ZL2A 5HBRA 4JI1B 4CJXA 5B5EC 1C3EA 2B9VA 2ONCA 3DR5A 3EB9A 2L0KA 4IXTA 4WADA 5SZJA 2JEYA 3TZKA 3FKSD 3AOEC 3SZOA 5CDFE 2BFAA 2D74A 4K6FA 4O2AA 1SC1A 3W5AA 3HCEA 3ZHRA 1BEUB 4GW3A 3I9MA 5CHEA 3UT5A 1NBMD 1EDEA 2ZS7A 5HF8A 4UM7A 4M99A 1Z06A 3BWYA 4XRFA 2O8CB 2H4XA 3MMZA 4IIHA 1YI2I 1DFIA 3EX7C 1P9WA 3W34A 2L4AA 3FUTA 2X1LA 1PZGA 3USCS 4KIWA 5KSOA 2G77B 2CZQA 2HK9A 1WTAA 3F6PA 3EVAA 1TTTA 4XM3A 1AQNA 2CRGA 1W4LA 3OYMA 4MV7A 5H81A 3IT3A 1MDMB 1BVHA 4BNFA 1DP4A 4XFKA 1UHSA 4OD0A 4CWAA 4MI9A 5D86A 1FX0A 1MG5A 1FYFA 1LBEA 4M0PA 4CT5A 2IW5A 2G1PA 3L43A 5JFRA 2BEUB 4HI0E 4LW8A 1JR6A 1VF9A 1RYMA 3WWOA 4K81B 4LUCA 4FFDA 1ODFA 3AK4A 1TM4E 4F8YA 5A9RA 1DE0A 5DEOA 5B6PA 3COWA 2OQGA 1N2ZA 3U44A 2K5CA 3IOMA 3QVSA 1QKIA 1RYDA 3OMXA 4Q4JA 3SNHA 3I62A 2PAFA 1HX7A 5J9FA 1ZD9A 5F4ZA 1BROA 1XRQA 3ED1A 1Z2AA 4EUEA 2CL7X 5C35A 1MQAA 1U3DA 4G94A 1JXQA 4EITA 1KS9A 1HUQA 3AILA 3TSWA 3IQZA 3V8PA 4B71A 4W63A 1Y39A 5C51B 5DT9A 2GEJA 3LQ4A 4ZRMA 3RGGA 3UKOA 4EX7A 1T39A 1GT0C 1PZEA 2HQBA 2EJRA 3FTPA 5AK6A 4JCOA 1EJ2A 4JI8B 5FB3A 1Q1BA 4HF7A 3BD6A 3RUPA 2HH9A 3R5SA 3IB3A 4WN9A 2BUAA 1XE3A 2B69A 2W90A 4CDGA 2IV7A 2GQQA 4JT9A 8GPBA 4CH7A 2VYND 4LDZA 1P4GA 1XTTA 3IV6A 3PT9A 4AIRA 4LBZA 5F35A 4OF4A 3ROEA 3AUSA 3TVTA 1JP7A 3LPDA 3Q7TA 4V0ME 4O3FA 4L73A 4Z7NB 3PWSA 3TVDA 1D1SA 1QH1A 4WK6A 3LUKA 3ZQKA 1RM4A 4PZ9A 5F73A 1JUPA 3JAKA 2Y9PB 1S3FA 5J4HA 1WJEA 1ZO8A 1XCBA 2QG9A 3C6KA 4DQVA 4HTAA 3N59A 3K6JA 1SK9A 5IJAA 2Y48A 3NRJA 3CVUA 3VI3B 1Z33A 4XQCA 1QZ3A 2YZKA 5B1AH 1U28C 1ZK4A 2K5UA 3HTUA 1NXOA 3QIAA 4UBLA 4J7XA 4JX8A 3MYRA 2PLYA 5CBPA 1UJMA 2ZSAA 5FI5A 5JASA 2O0YA 3GG9A 1LFUP 2VNHA 3K71B 3OICA 4A0XA 1EG7A 5EUMA 1NDUA 2WWYA 2WZCA 2QNRA 4D6YA 1YF3A 4UAJA 5K3EA 3VTZA 3RIXA 1BVYF 1RJ9A 4LRUA 4RGSA 4JXKA 2ECOA 3A01A 5ADWA 5EUQB 3G0CA 1TF5A 1PVEA 3B6MA 1EFDN 2REBA 2FFQA 2LDUA 3ETCA 2OD5A 3TBIA 3TLCA 4ER5A 3SS8A 1Q1NA 3C3PA 1PJ4A 2BVMA 4AIDA 3HL0A 3I09A 4RGBA 1MSEC 1LVUA 3CC7I 2VONA 2AE2A 1RZVA 5DASA 3EOBI 3D2LA 2N3ZA 1BS2A 1PNQA 2CNWD 2ETHA 4F3CA 1TTQB 3NWEA 2P3OA 3LM8A 2O0LA 3PICA 5BQFA 3CSSA 1P18A 1OBVA 1G3RA 4RDUA 4Y7DA 4YAFA 2H8GA 4EY7A 5BW4A 1YUBA 3SX0A 5DBEX 2V4UA 4CF6A 1ZHOA 3U26A 1AB5A 3VC1A 2QSHX 3OZEA 2H1SA 2CVQA 2HRQA 4I7HA 2QP4A 3ILHA 4GC5A 4FMDB 4RXTA 4HH1A 5G1OA 3T4XA 2JH8A 3A3OA 3SYMA 4LYFA 3RBVA 2P6OA 1A7UA 1PWZA 2B7LA 2KBEA 1FIAA 1KDZA 1P7YA 4P84A 2I4RA 4YFYA 1JIUA 2QLBA 1TWGJ 3VYWA 2A5FA 1CUZA 4AYBN 3RI4A 1Q74A 4YP9A 2YR2A 4YJ3A 4C87A 1JIXA 1DS6A 3UJNA 3KKKA 1Y82A 2V98A 5IAGA 3VR4A 1H2HA 1DXHA 4KCGA 4P3NA 4JQYA 3SSAA 3LRTA 1OR7C 2HV8A 2XCIA 3NAQA 3NV7A 1CTQA 4IJVA 3U4QB 2H1FA 4DLBA 5JAZA 1YU9A 4UBNA 3S40A 4KO3S 3Q0WA 1LNSA 1YD7A 3EVFA 3ILSA 3LSHA 4CI9A 3PNYA 5BSFA 3V8MA 1Z5WA 2LC2A 1OMOA 1ONNA 1PR0A 4YY3B 1T4DA 4ZDWA 2VYNA 4XR4A 1QIFA 5IH7A 2HXIA 4JMLA 1JEDA 5BR8B 4RA2A 2VRWA 4RENA 1H2ZA 3OF3A 3RS0A 2YIVX 1S2MA 4O25A 4WFJA 2BHLA 4QQRA 1NPYA 3O2PE 2EKLA 2JFYA 2KX7A 1R5JA 1YTUA 5CLIA 2O6LA 4F86A 2XB4A 4QRIA 5K6RA 3D5QA 4EQQA 2JD2A 4HQEA 2AQ8A 2J6IA 3WMRA 3I4PA 5CFQA 4OMUA 4FFBA 4QGFA 4C4XA 4QA9A 3IAAA 3SLGA 1L1RA 4JLBA 2BYVE 4OLAA 2Q99A 2XV4S 4B5LA 3PGMA 4ZT7A 3RBAA 1MZPA 1RAIA 3V9PA 3C87A 4PX3A 2XKJE 1QR2A 2DQZA 3M0EA 4RK5A 2JGNA 2MINB 2CFSA 3T3GA 4BFZA 3WTTC 2DWCA 2RG1A 3WDSA 2MSDB 3UTCA 2QDXA 3C3CA 1Y8ZA 4MWOA 1Z68A 1WU7A 1G21B 4LISA 3PO2J 2HMUA 3OWTA 1QRDA 3BIXA 1GG9A 1PGQA 4KE9A 3LZDA 3Q9UA 3NVKI 3HKDA 2ODNA 1AIPA 5F0CA 3H84A 1CZRA 4U2GA 3SY8A 2XEDA 2GSDA 3WB2A 4PQGA 1BMQA 4B0PA 1UBEA 1GZDA 4BJ6C 4XUCA 4JOQA 4BYGA 2RKHA 2XVXA 2QRHA 2ZT7A 2COBA 2JFWA 4RVSA 5J5VA 1FFWA 3ZP5A 3FVTA 3ZDYB 4LZNA 3TDUC 2JLCA 3E2MA 3L4JA 2O05A 1E3EA 4FOLA 1MGTA 2HPMA 4BX9A 4K9RA 3PIOF 1CEXA 4PANA 4LC1A 5CB0A 1IIRA 2GM4A 4C9BA 1I1HA 1ZZEA 2X77A 4HDKB 1Z22A 2F64A 4LNUA 3PEYA 4H4KC 4HZUA 5CT4A 3PTLA 3IVCA 5TQ2B 5FL7A 2V74B 3CLTD 4HGRA 2A5DA 4JAVC 2JJ2A 1QWSA 3IP6A 4BE9A 1SD1A 2G0AA 5DYTA 4B32A 2BTQA 3HDQA 4QXMA 2OBYA 1E94E 3V8EA 5EJ8A 1QG0A 4Q0MA 1L9KA 2Z2JA 4QUKA 2FQYA 4KDPA 5AUPB 2VTVA 3HBAA 3TI7A 3NT2A 5JYEA 2C4WA 2BM8A 2I2DA 4WKNA 4P9UA 3C3DA 4KWEA 3F4LA 1YX5A 1JFLA 3ZXXA 1AQLA 2VWPA 5ALDA 3R0AA 3L8HA 4QHTA 5NLLA 4KIJA 5CXUA 1WABA 5KNBH 4JASB 4FNOA 4HYEA 3QEKA 2ZSUA 5B1DA 1PUFA 1A9QA 3KEOA 1LQUA 4OIOF 1AX9A 2ZTLA 2D1VA 2MLGA 1SGWA 5JMPA 5JH7B 2YXLA 3AF2A 1U8CB 2IUYA 3CRVA 2EZHA 2YVLA 4RPGA 3NP7A 4S1PA 1G3MA 2AV6A 2PKWA 4OMCA 2DR2A 3FXRA 3IEUA 5C8XA 2M3AA 5KJFA 1SEPA 2IH2A 4JN6B 5J59A 3WE3A 5D1NA 1RAAA 2W6PA 4NOJA 1R37A 1KJQA 4I1VA 1Q17A 2X41A 3QM1A 3H4TA 1HEIA 2DHDA 3V4VB 4D96A 4MP3A 1UKZA 5BV1A 4PHTA 3DZGA 3F7MA 2C20A 2D8AA 4HJXA 4M53A 1QRSA 2PJRB 4GX1A 4ITVA 4KXWA 4DNCA 5LU8A 2L9SA 2X6WA 1HLFA 3DA8A 2Z3ZA 4WCGA 5A9SA 3B1WA 4HFNA 4MRAA 3KJFA 1P2VA 2G9ZA 4EIWA 1HWYA 1I3OA 3QPTA 1JEQA 1NX6A 1VG8A 4YC7A 3CJNA 4UQOA 2HXGA 1B8IB 5A4IS 2Z4TA 3NYRA 2LKPA 3VPCA 4F56A 5FV4A 5HODA 2OSBA 3HGMA 4Q7KA 4ESVA 5LEKA 1GQSA 1RI1A 5GQSA 4IHVA 5BV2P 1E3DA 4A8JC 4E7SA 1P1KA 3CM0A 4JC5A 3NEJA 2X0NA 5FI3A 1HTWA 4P4NA 2PSFA 4YB8A 5LQDA 4MDYA 1HE1C 3ND6A 4MW9A 3ADCA 4HH0A 4EVSA 3TRJA 2BGUA 1BOFA 3ISJA 4R9UC 2J7PD 3F71A 4M9UA 3I28A 1LKXA 2CSXA 5DYWA 1S5PA 2YXNA 2WTMA 1P2BA 4WOPA 4PM4A 1DCMA 1NG6A 4PWZA 3ZQ4A 3CRRA 3A6HA 1PUJA 3E35A 5KU1A 3TOBA 3WGVA 5IVKA 2XGMA 3FUUA 1GGNA 1JA9A 3ZZMA 4V0QA 4MQFA 4J7UA 1X8JA 5B1YA 3S5JA 1V9SA 3EXG2 1DQPA 3U21A 1RYFA 2DCUA 2FH5B 2G8LA 2D62A 2DTEA 4JLSA 1AVTA 2DYRH 4PG7A 5E1ZB 5ENDA 1CY2A 2OTJI 3CWQA 1KETA 1P4WA 4A6PA 5EAIA 1F9AA 3WG9A 4Z4HA 4LVOA 2GPYA 2AQIA 1L5NA 1W8DA 5C4IA 1LPBB 1BW9B 1Q3HA 1QYDA 2XODA 3TZQA 2R8EA 3T3OA 4KN7X 4XGNA 2I10A 1QH8A 3LDUA 2JLYA 3L1JA 1GVDA 4KR0A 1P81A 4HT3B 4EEXA 2P3SA 4E7OA 4UPDA 4EAQA 3N05A 1R0SA 4YI5A 3RRYA 5JCXA 3LCRA 5E2AA 2GF2A 4ZANA 5JPDA 4NUBA 1B59A 3WR5A 3PVZA 3MIIA 2BISA 4Z4IA 4HNUA 2QG4A 3TFOA 2P6NA 1YBAA 2GTPA 3THYA 1GVJA 1NTCA 2ZATA 2E1OA 3WOHA 2JHGA 1QVUA 1T38A 2ZU6A 5JXIA 1CF4A 3LUAA 2AUMA 4M9XA 4LXQA 1QOZA 1ZK0A 3W5UA 1MC4A 2C7OA 4L22A 3BQNB 3TDMA 3AIIA 3O2SB 1PG2A 2CB0A 1R0KA 1ZUNA 4JEIA 4NONA 3HRSA 2ATEA 3W3ZB 2DFNA 1VI5A 2K7LA 2EPFA 1UH5A 1X7ZA 3DOUA 1GCIA 4C7MA 3BB4A 3UH0A 5DWVA 4EZBA 2VE8A 1PJ2A 2C2BA 4I6ZA 3ELKA 5GAGJ 1UL1X 1L3IA 4UD2A 2WHRA 3BPVA 3V7SA 5WRFA 5JCOA 1JN0A 3EIXA 1MO5A 3OZUA 4EKNB 1IAVA 4J49A 1MD0A 5J58A 2XHEA 2J9FA 4B3IA 1AKHA 1Z12A 2IEAA 3KR9A 4HDAA 3PENA 2VK4A 4D8VA 4WLUA 3EPKA 1ENOA 1NBWB 3AVPA 1V2HE 1AOYA 1O57A 2BHNA 5I3ZA 3RC2A 3UKDA 1ISHA 2OL4A 1S7AA 1C8BA 4DA9A 3N8HA 3TZHA 4Q7LA 2VQ6A 2I65A 4F85A 2DPLA 2E71A 3VNSA 4I02A 4DR4B 5K0EA 5CPFA 3LPCA 4I19A 5CRIA 4FYIA 1DHRA 4BLWA 2FEMA 3SQOA 3TAHA 5I01A 1NW9B 4X65B 3WHPA 3W7AA 3DKYA 1QYCA 1B0ZA 3E8MA 1QORA 3NNSA 1MJBA 3PDHA 4NY1A 1BE1A 2RJNA 2XQFA 3WL6A 2DA7A 3IJ5A 3JRWA 1KL7A 4LJAA 2BEVA 3IA2A 1T4CB 1SVIA 1WUIS 3T3EA 2DERA 4GAEA 3UWSA 4JXXA 3GRPA 2V55B 2VR1A 5U4QA 1IRXA 3KXLA 5IK2D 3KYBA 5JQWA 1H3FA 4WK4B 1Z91A 1VE5A 3KQKA 1QGOA 3IIIA 1PGJA 4CR7A 2P30A 4YLYA 4RWEA 5AVTA 1NVXQ 3EXG1 1V55H 1ATIA 1NPTO 1IYZA 4P0QB 4G65A 3OY9A 3LY8A 1I1GA 4EM0B 1I3KA 3O8OA 3KJXA 4S0ZA 4XL9A 1FT9A 4HUTA 3EQ6A 4QBFA 1T6BY 2QWXA 3GW8A 1B16A 1N5DA 1ZGBA 4NQRA 2NU6A 3NFRA 2QMEA 2ZS8A 5FWDA 4CM9D 2H1HA 2C95A 1KI8A 3CJQB 3OM1A 2YV1A 4C4TA 1ZU4A 1OI3A 3H11A 4M1EA 4UTOA 1XPXA 3MQFA 4FYMA 4OYLA 4ZCIA 1L4LA 4NYJQ 5A0TA 2I6SA 1LCIA 5G1NA 1G7CA 3F5SA 3PJRA 3L05A 3HB9A 2WUDA 3ZLJA 5FLMJ 1CS0B 2Q1TA 2I7CA 1ZVVA 4HXFB 5FBVB 1ABFA 4QLOA 5AXAA 3IUPA 4F2HA 3NRVA 4RAQA 4ZU1X 1UF9A 1GITA 2OVBA 3B02A 1SU4A 1LLCA 2DKNA 3FCAA 3T1TA 2NV0A 4FVTA 1WEHA 4DDKA 1G8PA 2GN1A 3W6JB 2CJXA 1P31A 3I4FA 4JBXA 2NSDA 1Z3CA 1EHIA 2PI0A 4CM6A 2GTHA 5IARA 3E5QA 4PZYA 1E2DA 2IYNA 5IAJA 5JO9A 1G66A 2YZGA 4TL6A 2CY0A 5KNBD 1GAEO 1YC5A 4MDHA 4PHHA 1Z5PA 4HAIA 1PT5A 2QLNA 3UJDA 3ZD7A 4G2TA 3M4JA 1JKJA 5HOQA 4QAQA 2EJTA 5CM2Z 1AKTA 2EFGA 3M5WA 2JKZA 3LT0A 1OYVA 3H0DA 3K73O 2DB3A 1L2TA 1L5ZA 4N7RA 3C6YA 4BNVA 3CURA 3TQNA 3QU6A 4E09A 2BC9A 1XB4A 2GZWA 1M7HA 2PEXA 3HSKA 3HVRA 3SLRA 4R6WA 2ELHA 2INGX 1LC0A 1M6WA 2UU9B 1XZIA 3ZLUA 1XD2A 1E0EA 4M0DA 4E5MA 4X7RA 3QKIA 1SC7A 3BH6A 4BLRA 4D1YA 2OV6A 4J16C 2CUFA 1EJ9A 1TO6A 1MW8X 3DAFA 5IYCJ 1QF9A 4WIAA 3U0BA 3U39A 4DMGA 1H69A 3FCXA 3PYXA 2JFPA 3FPBA 2JVHA 2O2DA 4UUSA 4JKIA 4MRPA 1TZKA 4KXQA 4PX5A 2A0KA 4W5QA 2FYTA 3BTIA 4J0DA 1T0FC 3LHSA 3DDWA 4WASA 4GM1A 5JADA 6NULA 1Y98A 3RLIA 5JMTA 1QP4A 4RTLA 4MYHA 1M1UA 4XUDA 4KMSA 2I6FA 5F04A 1X8LA 4TT8A 4OFXA 4HNTA 5EWMA 1W5FA 2F4MB 4OY3A 1XN7A 1WKVA 2GXGA 4K9SA 4S12A 2VF7A 1QA6A 2DULA 4QFBA 1UBGA 4LF7B 1MBEA 3ZPXA 4AG5A 2BGGA 3E23A 4L5EA 4F4FA 4KPUB 2WIDA 4I2OA 1DEAA 1JHVA 2Y75A 3GEDA 3GLHA 5IASA 2ANCA 4WXMA 2P7IA 1UXKA 1Y89A 4B4WA 4HQ6A 1NQTA 4CM4B 2DBVO 3GRKA 2EV6A 3GJQA 2XDYA 4BEHB 4GR5A 2Y1WA 5J2TF 2V3WA 3T12A 1T9CA 4IHJB 1HQDA 4JA2A 1LJLA 5GM2A 1D0ZA 2VDVE 2WUWE 4WCFC 2DPMA 3I61A 3V1UA 2JFUA 4G36A 1Z74A 3E3NA 1C1DA 5HUJA 2FZ4A 2G83A 4B6FA 1FTWA 2VASA 4EYGA 3LTEA 2ERCA 3GEGA 4JQCA 1L4YA 1FYXA 4OQYA 1QPBA 2O2CA 5EEAA 4REQA 3F23A 4HZFA 3MZ0A 4MWTA 5D5WB 3NM6B 2VBIA 1G98A 5CFOA 3OFNA 4HX4A 3OYKA 1JAIA 3KHUA 3IBFA 3JVIA 3HBMA 4RD3A 4HGQA 2XZDA 4GO1A 4FSHA 1Y1LA 4QQ8A 5IBCA 4JJAA 1Z3YA 2Q0QA 4ARBA 1L7VC 3WGGA 4NV3A 3LVRE 4CG2A 2XJ9A 3IMGA 1NV8A 4G56A 1MB4A 2UAGA 4ESEA 2J5KA 3SX2A 2Y1LA 4BOYA 1XWFA 4KVGA 3QLUC 2ZXEA 5ALZA 1PG0A 5IJ0A 1BS9A 3UMSA 1ZU5A 1Q0SA 3FCYA 4QD3A 3ACDA 3PPWA 4JGIA 5FOQA 3H19A 5J2UA 2RN7A 4DMFA 5DYIA 3DV9A 2JL1A 2GCOA 4ESHA 4DPKA 4M46A 1X0VA 1V3TA 4AYTA 2X7HA 4JI0B 5DSZA 2OAZA 5COAA 1X14A 2HA4A 1NN5A 3QA9A 5C4JJ 4UMFA 4C08A 4MTLA 3ZWBA 1LDMA 1C7RA 4H35A 4PLFA 2QY6A 2ZNYA 4K8RB 2E4YA 5JFGA 1E18A 4YMTA 1TWHJ 3QXJA 5BMVA 4TWBA 4X63A 2WWWA 1T9GR 2W6ID 3SYKA 2E19A 3ORRA 1DKPA 2A5LA 4R8RA 2CZCA 1BU5A 3GFMA 1ZM7A 2Q0HA 1CVIA 3AJ9A 2Y1OA 4N82A 4ZCQA 4CTJA 1YGPA 3CW9A 1M2VB 2EFJA 4A27A 1LB2A 4S1TA 2D2EA 4YRBA 4HB3A 3H1GA 2ERXA 1ENZA 3G1MA 1ZQ1A 3IQFA 1NSTA 1HORA 1KQ9A 3I6ZA 1E66A 2YOGA 1G20A 1NBIA 3IESA 1U3EM 4NQZA 3A1FA 5LYJB 2SKEA 1GKLA 5LSAA 1MXFA 4GM0A 4I1UA 2KHMA 2EX0A 1P0QA 2GRUA 3TO7A 3SAJA 3V1YA 3C7CB 4C01A 1NJ1A 5HZMA 4RM2A 2W2KB 3PSFA 3R0JA 3LPMA 3TZ6A 3ZN1A 3BA6A 3T7DA 3GK3A 5FO1A 3U4MA 4G0ZA 3D3QA 5L7YA 1FB5A 4BFYA 3MB5A 1OVMA 1UOQA 2VZEA 4XJSA 4MIYA 3WQRA 1WB9A 3HV0A 3WU0A 5M5XJ 5HS7A 1N2SA 1KMCA 2J6HA 1K78B 3EYYA 4JLPA 4C4PA 3SS7X 1IJKA 4UV8A 5JLXA 3WWDA 2DBBA 3H9EO 1PYGA 3F7NA 2PG3A 3MFYA 2O1SA 3AI1A 1WIWA 3TIFA 3SMVA 5FWYA 5AW9A 4ZCPA 3L1PA 3F97A 1XRPA 2R6DA 5BURA 1WPQA 4ZRDA 2X2OA 1XRJA 3JQGA 4C7JA 1P1BA 2CDBA 2UYHA 3WK7A 3PX2A 1B8OA 5J4VA 1AMUA 3GLHE 3W9SA 1JKOC 3QU5A 3UJ9A 2QD1A 4M3EA 2TDXA 4J9VA 4OL9A 1Z7WA 3FISA 5EGSA 3D0KA 4NU8X 3LL4A 3QF4B 3B1ZA 3JAWA 1PJBA 1ETKA 1N1EA 3OJLA 4NPAA 3L1HA 4BO0A 2XCOA 1XX5A 4X7BA 4G25A 4BBSJ 2VATA 1BR2A 4EI8A 1W34A 1F3LA 3FF5A 5EJ9A 4YMSA 3BP8A 1LNQA 5FADA 2BRUA 3CMCO 4FWTA 3ML1A 3D7MA 2ET6A 1MU0A 1RRGA 1Q11A 2PVCA 2QMQA 1IWBB 4O2BB 1B23P 1QQ5A 4U4AA 4IM7A 4E5UA 1LPMA 2P0WA 1WCMJ 5EHIA 1U0SY 2HSWA 2GCGA 1E2GA 1B1AA 3HR8A 4L0CA 1RD4A 2KMLA 2R1ZA 4U7JA 4B48A 4JP5A 3ZCPA 2E5NA 3A9VA 1NBHA 5ES4B 3OV8A 2QL9A 3AOGA 1JNYA 3DV0A 3OC6A 5ITWA 2RMKA 5DD4A 2A0FA 5F6FA 2O57A 1U8BA 3ZRGA 4G84A 4C3JJ 2Q0XA 3OR1C 4B3AA 4H2DA 1QZYA 4PQEA 2ARKA 2H3EA 5DN6D 2E5LB 1I0IA 1Z8DA 3UB4A 2IGMA 1K89A 1DQZA 1L9XA 1WPXA 2LP4Y 2GIZA 3ZR8X 4U6NA 4K9MA 4Q4HA 2YY6A 1S8NA 2ZAIA 3U62A 3L46A 1U3WA 1GPMA 4BNNA 3KR2A 2C2ZA 1GNPA 2PQ8A 1V39A 4C2AA 5D5QA 4Z9FA 4DYVA 4OBBA 1L5WA 1OF1A 2AD1A 1CVRA 2Y93A 3CY6A 2Z2IA 3DEZA 4PF1A 1Y6JA 4HAUA 2F4IA 5C2JB 2ZKLA 1W52X 5ED4A 3IWFA 1C1XA 4LY3A 2OT3B 3M33A 2J9YB 1Z0JA 2VAMA 5JNRA 4GF5A 2FJ0A 2XAHA 4GX5A 3BQYA 2R1VB 4LV6A 4YAKA 4R6XA 3ZMDA 5EP1A 1QLHA 3V2IA 3WLJA 3NKLA 4M72A 1T8UA 5CFNA 2RHGB 3NHKA 3RHSA 1UHWA 3EEOA 1K68A 4MWBA 1CU1A 2HMVA 4IJ6A 4RK0A 4YVFA 2HVSA 5BT8A 2IF0A 3ENWA 4DSUA 1RP1A 1V9LA 5BN1A 5ILUA 2I8CA 3F6YA 4NF2A 1WULS 2ZULA 1C7ZA 5GOTA 5A4JA 4G0VA 3MMSA 1O94D 1C2TA 4YRKA 5AIAA 4I1SA 3OQJA 4KQWA 3E58A 2WK1A 1KK1A 1GUBA 4DUPA 3FTEA 3MMXA 2LYCA 2M1BA 3FLEA 3FIWA 1PD1A 3F1LA 1M6YA 3HPHA 5FAKA 2RK4A 4RTKA 4ZREA 3C3BA 3OIDA 4N76A 2RHJA 3VR2A 4C9YA 1V5WA 121PA 4QEZA 1WPGA 5KOHB 4XA8A 1Y8QB 5JVDA 9ANTA 3IUEA 1QP0A 3L7JA 1OV4A 4YAJA 3MUOA 1JEOA 4NH0A 3D8HA 3I4CA 4X7PA 8AT1A 3CR7A 4UUTA 5TMBA 4A5NA 2IUEA 1NW4A 3B3GA 3T34A 3KCNA 1AHPA 4U63A 2Q21A 2VJNA 5ALIA 3BC1A 5B1EA 4JOBA 3E4DA 5E95A 3GC6A 2F1KA 4BFTA 4UUQA 5F0HA 3QMWA 3ZEIA 4FDLA 2V45A 4D26A 2REOA 2BUBA 2GXAA 2BR5A 1YAHA 2RIPA 4ND7A 5BUCA 1LTKA 2SNIE 4HG2A 1GDTA 1GTVA 1UBUS 3P5BA 2GBFA 5EG0A 3BTUA 4IOLA 3FOBA 2X3FA 5EJ4A 3TIXB 3LUDA 4XR9A 2I55A 3H3JA 3EZGA 3CCCA 2G08A 4FJ2A 2ADOA 3IQXA 3CLOA 1S0UA 2SICE 2ENWA 5MN5A 1KP3A 1G7RA 1VLVA 4GYWA 4GQAA 3K70D 4FGUA 3CLUC 2GEVA 4PO1A 4Y6PA 3CUQA 2DFTA 3PBKA 1LLQA 2W6ZA 2GT1A 3F49S 5IFKA 4FSDA 1AGYA 3ZQUA 1Z39A 2ILVA 5HYVA 1XL1A 2ZRIA 3OYGA 4G12A 4O4HB 3QYEA 1CRWG 1PFYA 4N3CA 5HNKA 1XMQB 4OU5A 1MRZA 2YJ3A 3SQDA 3ZCTA 4H4CA 1JKPC 3EHEA 5L40A 4ZODA 2HF8A 4GBED 1WB5A 4O29A 4HNAA 4AWBA 1MJAA 4EO9A 4KFUA 3NJRA 1G2OA 3FMFA 3ZMUA 2L01A 3LW7A 1NI4A 4YMLA 1GYQA 2VQFB 1L7RA 5BSMA 3HXPA 3NGMA 4H0EA 3DMHA 3S7TA 3H83A 5BSVA 4JHLA 3CP8A 4P3YA 2WAQA 4F6CA 2CLKB 4QUHA 1GPDG 5HCNA 4Z0TA 3RODA 4NS4A 3ZG6A 5LP1A 2ZZKA 2C9CA 4IIBA 1YO6A 4KXUA 2R5FA 2FX5A 1TWAJ 3PWKA 2OGUA 5CXQA 2GM9A 2OAQ1 3LSIA 3DE4X 5CPBA 4M6YA 2O14A 3ADDA 1XU7A 4G7OF 2Z56A 4PLWA 4E5NA 3GEMA 4LYYA 2JN6A 4GXOA 1WCXA 2QX4A 4P55A 1YRHA 1F8XA 5J2TA 4DCCA 1FK8A 3J80A 1R6VA 2L18A 3REFA 4EM1A 3SOZA 1Y0BA 3AR9A 3RNLA 1I32A 3QE4A 4MUMA 4WBXC 3PU6A 3WV5A 2I2FA 3A37A 1TECE 5FFFA 3TCKA 3B1JA 2OZPA 1SD5A 3HEFA 5H83A 2HHJA 5ALTA 1X70A 1NXQA 4JUCA 1E2PA 4DIMA 2QTNA 3VPBA 1T2CA 1Z4QA 4JLDA 3I6IA 2ADFA 1Z45A 3PKJA 5HMLA 1C0WA 5A5GA 1SH7A 2KFDA 4MUXA 2IZ0A 1AOXA 3R6DA 3JAMA 2AOTA 2VQSA 1CUCA 4QELA 2Q5EA 3M1YA 2E34A 1YKSA 2VZ9A 1JH9A 1KVTA 1T5BA 1UG2A 5H68A 4II2A 3A1WA 3C6BA 1R7JA 3BFPA 1HQYE 4BCDA 1JBEA 5TT0A 4JT4A 3PXXA 2PMZA 2R7LA 2WHPA 1ZN9A 2OBPA 4GP6A 5CNKA 1ZPDA 4UTNA 3AONB 3LMMA 3SBEA 3TOCA 4KSCA 5JECA 1G9XA 1Q7RA 3UMJA 4BJ1A 1ZCAA 3HCBA 4X97A 3PDIA 2JVKA 1NA5A 1QH0A 2FPUA 3DSRA 3QVGB 4KTTE 5A4DA 1E1LA 4P2GA 1E8DA 4EJFA 1FVOA 1YE3A 1L3CA 1HNNA 3HDHA 1SCAA 3D5SC 1BHSA 2ZDQA 1VLZA 1C81A 1MNEA 5TARA 3LW8A 4E5YA 4NU5A 1XGSA 5IT3A 4PS0A 4DCNA 5JOQA 1TVKA 4ZO9A 5LLTA 1O3RA 3CE9A 3V7FA 1UDAA 3P5SA 2H0AA 4I55A 3E15A 4RB0A 3OZDA 4IWNA 1IZZA 3CNQS 6GPBA 2VHYA 2Z57A 3GD5A 4GLFA 4AZ0B 4GOXA 3GLFB 4UDOA 5DFAA 1QQBA 3RTBA 1P4XA 4UATA 2ZSIA 2GA1A 4LZWA 5AW6A 3CE6A 3LI2A 2MSKA 1XZGA 1E8MA 1U1IA 2K02A 1DTWB 1SUIA 4P31A 3REGA 5AI6A 2LW7A 1OQAA 2BBYA 1WHUA 1YZLA 1FRFS 1Z4OA 4KC0A 4KQ2A 1H8HA 5ALQA 3N2IA 3X2FA 4DJAA 2GOXB 3BFVA 1SBYA 1YONA 4LF6B 2P9BA 4RELA 1OLUB 4B44A 1I4WA 2OD9A 3EDCA 3W9UA 2H31A 1YS6A 1NUSA 3CF5F 4DBZA 2X5NA 1FSPA 1GGJA 1I39A 4X8HA 4RA6B 2HCJB 1RHKA 2WIBA 3OQBA 3GZ4A 5IMBA 4RAFA 1JUDA 3RFCA 3ND8A 3G2IA 3CUSA 3A36A 1Q77A 1S3SA 1JMVA 5IP6A 3ZZNA 2FTKE 1CJUC 1W7PA 5ALLA 4DCPA 1LEHA 4QGGA 3OJXA 2X2FA 1OBHA 1XSDA 1ZR2A 1X2EA 4DC9A 3VH2A 2FMHA 2GARA 1X3WB 3IAEA 2OCYC 3Q8MA 2IS2A 1VGVA 1BRTA 2PH7A 4Y13A 3UOGA 4CPDA 5E6SB 3I32A 3VR4D 1Z26A 3C3XA 2VXBA 4O02B 3V4FA 1NVTA 4DLVA 1H88C 2C5HA 4PU0A 5LHIA 3LYLA 2XXAA 3KLMX 3FOZA 5FBZA 2TECE 4W5WA 3CN7A 1JMKC 2QD4A