1S9HA

Crystal structure of adeno-associated virus type 2 rep40
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
268
structure length
268
Chain Sequence
AGMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Rep 40 protein
publication title Crystal Structure of the SF3 Helicase from Adeno-Associated Virus Type 2
pubmed doi rcsb
source organism Adeno-associated virus - 2
total genus 72
structure length 268
sequence length 268
chains with identical sequence B, C
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1s9hA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1s9hA02
3BE4A 1II8B 2YVUA 1GL6A 4AIIA 1MKYA 4DZZA 1EG7A 2Q21A 1E9CA 3ONWA 4RVCA 4D4LA 2OZEA 1I2MA 2ZE7A 3MGCA 5FL3A 1EFCA 2GXSA 1KNQA 3RABA 3IBGA 2D7CA 1AZSC 2RGNC 4V0KA 3CW2A 4ZIRA 3LDAA 2HXYA 5DLQC 5E7IA 3TR5A 1NKSA 3EPHA 3SE0A 5D3MA 2GAAA 3T1TA 2RB4A 1N5IA 3Q72A 4A2QA 2Q0HA 5KSOA 1UAAA 3GLGB 2GXQA 4G5OA 3ZVMA 1DADA 4X8LA 2ZJ2A 4WZ6A 3O47A 1DBSA 4M1WA 5B64A 1KK2A 3ZD6A 1KSFX 4NONA 2JLSA 1TMKA 1RRCA 4EJSC 1W1WA 2VSOA 2QPAA 5JRZA 4LC0A 1G20E 1OHHA 3I72A 4FXPA 5AR1A 4S35A 3LQRA 2IXGA 4Q21A 4YMTA 4LY6A 1UBCA 4TL8A 2FN4A 2NIPA 1UF9A 2DFTA 1KO8A 3PUVA 4K81B 3T5GA 3TBKA 1NY5A 5DI3A 4XVUA 5JCZA 3HR7A 3SNHA 1IJFA 2ZAOA 3DMNA 2OESA 3WRXC 1DE0A 4DCVA 3U6BA 1SKYB 2A2ZA 4R98A 2P6UA 4E5UA 2H92A 5FOTA 1AS3A 4DHEA 2OBMA 4DIEA 5FOXA 1E9RA 1CR4A 2VEDA 1CJTC 1XEXB 4JT2A 3VAAA 3T5DA 2NZ8A 4B32A 1D2EA 4Q01A 4NYIQ 1E1QD 2B8TA 1US8A 4LX0A 4NE2A 2IF2A 4RKEA 4A6XA 1U94A 5FTJA 4BZQA 3N2IA 2Q9BA 4KVGA 1F3OA 2W6IA 4LUCA 4AKHA 4HLQB 3QKRA 4TYYA 4Q9KA 4ESHA 1KGDA 1NSFA 3AVQA 4PSVA 3QF4A 1KO7A 4F4IA 4TLCA 2RHDA 1SVLA 3ZD7A 2DWOA 3WMEA 1TX4B 2OLJA 4QBGB 3WP1B 3RWOA 1N6PA 2XJ9A 3N5CA 4M9ZA 5KU1A 1GNPA 4TTPA 2PJZA 1FFHA 1XTRA 1Z83A 3UANA 3MLEA 4QNMA 4A6PA 1X1SA 2FFQA 1KI2A 3KZ1E 3S1AB 4NZYA 2O8DA 3IIMA 1WA5A 3KJGA 4UNNA 4C0AC 1NMXA 1NJFA 3BS4A 4DDWA 1VYVA 1VECA 1R0WA 4IW3B 4CGZA 2ZR9A 2R44A 3NVAA 1ZYUA 2WHXA 5DIFA 5EQTA 1OFHA 3IO5A 1II9A 3RRYA 3WMGA 4RD0A 1Q3TA 2D74A 5GJVC 1X8KA 4A36A 1ZD9A 3FKSD 5FUXA 4HUTA 1JPJA 1QHYA 1GVNB 2XJ4A 4ARZA 4V0ME 1MOZA 1W48A 2P5SA 4CYMA 1RJ9A 1G41A 2FEMA 3NBFA 2WOOA 4HAYA 2JLQA 4XJXA 2ZJBA 1AK2A 1OB2A 3OEHD 3F5FA 4LHXA 4A2WA 4JKIA 3X2SA 3KXLA 4QGHA 4DIDA 3T1VA 4KODA 1TL7C 2CDNA 2BMJA 1UBEA 2IWHA 4CEHB 3L0SA 2V1UA 1Z6AA 1KI6A 2ZI3A 2MSEB 2KE5A 2YKGA 2OT3B 3QXCA 3WYGA 5BN4A 2YOGA 3BFVA 2BEKA 3VMFA 2NQ2C 3CNOA 4MRPA 5J4HA 4F4CA 1J7KA 3QF7A 2EW1A 4BASA 2VHQA 4BLOA 3CNNA 3JZAA 1E2NA 5J5CA 2NO7A 1UFQA 1VG0B 3W9YA 1NKTA 4QJ4A 1AS0A 5CK4A 4P32A 4WAUA 1ZM3A 2I4IA 1ZVQA 4XOIA 2JAQA 5BN5A 1VIAA 3I73A 1XTKA 3EX7C 4ZPXA 4RFSA 1XXHA 3CRRA 1E79A 4A0GA 4ZDIA 1GILA 4U5XA 3N2EA 5EE5B 4YQFA 821PA 1KAGA 4GL2A 1TUEA 2GZAA 1N6KA 4B33A 2RCNA 4E03A 1MO5A 4M0LA 3DOEA 1Q57A 1TTTA 2XNDD 2WWXA 4NMMA 2ZR0A 4MRRA 2H16A 5E4FA 4G5QA 1OV4A 1H8EA 1JNYA 1M7GA 5DISB 5GADl 1S3GA 3IHWA 1BYUA 1UKVY 3Q9LA 1W0JA 3CKLA 4R71A 4JLVA 3NG1A 2W6ID 4NCKA 4TMXA 2WKPA 4IFEA 2BKEA 2F55A 3C7KA 2WWHA 2J59A 4EIWA 2FH5B 4G1UC 3LH5A 4Q4JB 3DPUA 4HB0A 4KFUA 5FUVA 4KBGA 1UKYA 5CK5A 1QHHA 1XFAA 1FW6A 2V55B 2C95A 2ZI6A 4LPSA 3SJCA 1AJEA 4Y0AA 3R9XA 1TNDA 4TZ6A 2FE4A 3ZS9A 4CZ2A 1XZPA 3C16C 3L2OB 4TLDA 4EAQA 1RC8A 3QSYA 2P67A 2X19A 3U3RA 4JVNA 1GDDA 4ZKEA 1RPZA 4BZPA 4D80A 4BLTA 1WBBA 2J41A 3KXKA 4EKDA 4O2LA 4JSYA 4DCNA 3DZDA 2XZLA 5EE0A 1V5WA 4DB4A 1E9DA 2WWGA 4B73A 4KAXA 2GBLC 1DAIA 1MO6A 1BMFA 2Y8EA 3EG5A 4EJSB 4LHWA 3CLVA 1XBTA 5JEDA 1B23P 4KO8A 2IC5A 4UNQA 2ZYWX 1KDTA 2QTVB 1DAEA 2XXAB 3E2IA 3A8TA 4XWKA 1W5SA 5DYIA 4L5BA 1XMJA 4HAWA 5C2JB 4UJ3A 1DO2A 1ANKA 2FA9A 2O0KA 3PFIA 3H86A 3L82B 3EA0A 1L2TA 2QBYA 4WBSA 1E4VA 1DAMA 2BBOA 2F3RA 3I3SR 4PZLA 3R7WB 4JLMA 1G1MA 1N0UA 1XJQA 4LJYA 3UWOA 5CM8B 3K0CC 4MKFA 2WMOB 1OYWA 2BCJQ 1CXZA 2XTMA 3C8UA 2O8EB 2YZ2A 3VU9B 5L3SA 1K5DA 4O2RA 2OHFA 4LV8B 2JJ2D 2W00A 2HLDA 1DAHA 1R7RA 2WAXA 4BFVA 121PA 4LYHA 1T4GA 2A9KA 5DI3B 1CBUA 1S9DA 3BERA 1M74A 4P31A 4QBFA 1N6HA 1F2TA 2AD1A 4OHYA 2QUZA 2VH5R 1XXHE 2BOVA 2ZE5A 1EX7A 2G1JA 3D3QA 5DH9A 1KJZA 2H18A 2J0UA 3U60B 4AD8A 1SVKA 2NPIA 1YVDA 1Q1ZA 3CF2A 1G3IA 3HU3A 3PEYA 1IN8A 1S1CA 3AF3A 3OAAA 1NL3A 1XD8A 2CLDX 4XTCS 2I1QA 4Q47A 3TIFA 3DDCA 1ZM7A 2BMFA 3CPEA 4XSGA 1OXVA 3QKRB 2QSYA 2W83A 4QL3A 4BQSA 1KSHA 2G6BA 2VF8A 4BLSA 4Q4AA 2ZROA 5BYKA 2W6JD 1OXXK 5TDHA 3V4FA 1JQLB 3ND8A 3RS0A 3W3AA 3E70C 2OXCA 4LJ8A 3T61A 1TQDA 2QA5A 3QVVA 2WTUA 1FOEB 2O8DB 2A78A 2RGGA 3LX8A 4B3BA 1P9NA 4ESVA 2CVHA 4K46A 4Q02A 5EP3A 2CVFA 4EUNA 4M53A 5HZKA 2QG6A 2BCGY 1RRFA 3BWDD 3I92A 3MWLA 4DVGA 4QJ3A 2GDJA 4P0TA 3A37A 3QXJA 1SXJA 4TTQA 5KOYA 4OQMA 3TVDA 3HYTA 1KO1A 1VPLA 4ZI2A 4URWR 4NCIA 3BBPA 3K0SA 3CNLA 4GSYA 4HDOB 3D7MA 1BKDR 1RJ9B 2ODEA 3QIAA 4ERNA 3P1JA 1OH8A 4C2TA 1X86B 1W49A 4FWTA 3UMRA 1FMJA 3KQKA 5DE3A 3TUIC 1UJ2A 3RAPR 4PPNA 2HT1A 3C14C 2OLKA 5DN6A 4G0NA 5SZJA 5FBLB 1W46A 1E6CA 2GVDC 1FP7A 1AQUA 1Z0JA 4ZCIA 3A4MA 1GKIA 1MABB 3IIJA 3K53A 2O0JA 1YQTA 4GOKA 4OQXA 2HDNB 2J45A 1GP2A 3FMOB 4LK2A 4I1VA 4DRZA 1XRJA 1E0SA 4YXWA 2XNSA 1D2NA 2QN6A 3TH5A 2ZETA 1WBDA 3IEVA 3CB4A 4LBYA 1Q1BA 5HE9A 3CM0A 3A1WA 4MITA 1T91A 1P2UA 4OJKA 3QPVA 3B1ZA 1KDPA 3AF1A 3I8SA 4KVAA 3EZFA 4PHTA 2IUUA 2BWJA 1G3UA 2IS6A 3DHWC 3TK1A 5IHPA 2KI5A 3FVQA 2CHVA 3QENA 2CLSA 5C4MA 5KPDA 3CF0A 4LYJA 4B34A 4WXPA 1SVWA 3B60A 4JS0A 3GD7A 4G01B 4GPTA 1ZNWA 5LB4A 2FFHA 3LW7A 3DM5A 4EFNA 3GLGA 1NMYA 2YV5A 1N2CE 1XTQA 3B13B 4M1SA 2PX0A 3PUZA 2DR3A 3WYFA 2C78A 3ZVRA 4KYIB 1EESA 5FI0B 1ESNA 1GUAA 4BFWA 4HB4A 2GCOA 1Z5ZA 1ZUHA 2F3TA 5C46F 3DZ8A 2W2TA 4J0QA 3TE6A 4LJAA 1KAOA 3EAQA 2QU8A 2ODWA 2WWWA 3SR0A 2A5DA 2AX4A 5AJYA 2O8CB 1B0UA 5DNYB 2QI9C 2QMHA 2B7CA 3EIEA 2P3SA 3U7EB 3KTAB 1XEWX 1KK0A 1R8SA 3UKDA 2A30A 1JQJC 4NL4H 2ZUBA 3BB3A 4JLOA 1KMHB 1IQPA 2GRJA 2ZRIA 4LCBA 4B74A 5KDLA 4G5RA 1K8RA 3KX2A 1IN7A 1COWD 1M7HA 2OUKA 3W8NA 5EJEA 1CJUC 1S3SA 1KZ7B 1ZCAA 2BM0A 3DMDA 2WJGA 3P4XA 3P4YA 4Q9IA 1NLZA 1Z6YA 2OCBA 4JLKA 5FPSA 5B2ZA 4AG5A 2O0HA 1NIJA 4GP6A 4BFZA 4B2LA 1NVVQ 3B7GA 4I1OA 1OYYA 5FL7A 3LY5A 3SJZA 3U2QA 1L8QA 1JXMA 4TMWA 1E9BA 4WA7A 2XEXA 3SFVA 1CF4A 2HF8A 1YZQA 2IXEA 3EWSA 4M1KA 1KOFA 3K9LA 2V3CC 2PH1A 2KB0A 3QXXA 3IO3A 3QVUA 4B2PA 1FUUA 3UMSA 4ACAA 4RZ2A 1NSTA 1SXJD 1W5TA 1FZQA 2IEYA 4Q48A 4F4JA 2AK2A 2YWFA 2XITA 2IXFA 1UEJA 1TQ4A 4A9AA 3OIVA 4IDOA 3S1AA 3GJ5A 1JAHA 1Z0AA 3Q5EA 4DDUA 3P32A 1CTQA 1U81A 2IL1A 1GAJA 3Q8XB 5K8LA 1E1RD 2RKOA 2P5TB 3AGPA 1G16A 4IKEA 4RSGA 1P9WA 4DLZA 2AD5A 621PA 4Q66C 4CIDA 1ZC3A 4HZIA 3DL0A 4PZYA 4EPWA 3OFNA 3NWJA 4BFSA 4AK9A 4DT1A 1E32A 3SJAA 1W0KD 3AUYA 2B92A 4YMSA 5DHFA 4MKHA 1OIXA 4NYIR 3WBJA 4A2PA 4NDZA 1VCMA 2IF0A 2AHOA 3EPLA 3QG1A 4NPHA 2PJRA 2GK7A 5L3SB 1R5BA 1J90A 5JCPA 5HZHA 4LC1A 1YZTA 1CR0A 4M21A 1W36C 2H8KA 1DO0A 3L0IB 1Z06A 2VA8A 4PC1A 1OH7A 4V0NA 1P2VA 4TMKA 4LRWA 3FHTA 1HE8B 5J4KA 2W2XA 3GLGE 4FD2A 1W2HA 4KSBA 3O8DA 1PLJA 3VR6A 2JLYA 2ATXA 4AY2A 3NH9A 1J99A 3NTUA 4LJ6A 3GJ3A 2HJVA 1MO4A 3AH8A 2FSGA 1HA3A 1N25A 2RGCA 2ZRKA 5BXQC 1SQ5A 1RFLA 4TYNA 4QBIA 1TF2A 5KSYA 1P60A 4PFSA 2GJKA 3U3JA 1NG1A 3ZJYA 2QAGA 3LXXA 4KCGA 1AKEA 3SZRA 4G3XA 1EX6A 2DFLA 4MGKR 2QTFA 4IVQA 3CPHA 3KQUA 4RZXA 5HCNA 2ZS8A 4U00A 3B8HA 3ZDQA 1N5KA 1WE2A 4W5WA 3ZQ6A 4CW7A 5K8UA 2IYSA 1GKYA 5AK0A 1SKYE 1KI3A 1E1QA 4M9SA 2EU8A 3WMFA 4Q19A 1RW4A 4DSUA 5JJKA 1EWRA 1XF9A 1Q1EA 2CK3A 3LBHA 1R0ZA 4Q7JB 2V7QD 1QHIA 2YJTD 2Z4SA 1NI3A 1QZXA 2WKQA 1CULC 1UKEA 2OFWA 1JXOA 1DOAA 3QKUA 5FOVA 4TL6A 1SXJB 1GTVA 1IY2A 3TVTA 2WKRA 2WJYA 2XB2A 1U9IC 1GNRA 4Q4JA 2ZITA 1AQYA 4JBWA 4D4KA 3G0HA 221PA 5G3YA 1NN0A 1R4AA 3B6EA 5KO2A 5BQ5A 1KJYA 2GJSA 3E1SA 3O8CA 4LOAA 3RLFA 1UDXA 1XB2A 5JRJA 5SZIA 2RGNA 2OEPA 1ZIPA 4C7OB 2ASEA 1XX6A 1P61B 1JALA 1CJVC 2V54A 4DSTA 4ZDJA 3FKSA 2G83A 2AWOA 4HAZA 3B1YA 4YMWA 2J3EA 4Q9HA 3EA5A 3AF0A 2EFHB 3BD9A 5JHGB 1W44A 2F9MA 1A1VA 3HWSA 4OI2A 5TV2A 4D25A 1SZPA 3OFND 4NU0A 5H68A 4L15A 4PHHA 4ZKDA 3KUDA 3KKOA 1IN4A 1LNZA 3B78A 3OEHA 2REBA 3VQTA 4EJSA 2BVNA 1Y3AA 2FZLA 3GJ4A 2C03A 4WZAE 3ZZTA 4EPRA 2WVJA 1NF3A 2Z43A 3KJEA 3TRFA 2XXAA 5CYOA 3E5HA 3LQQA 4TYWA 3LV8A 1CLUA 5E3HA 1JR3D 4C4PA 3GJ6A 1E2MA 4D2IA 4CEJB 4Q1AA 4DLSA 4Q5IA 3WYAA 3LA6A 3ZS8A 4ABYA 2IEZA 2HF9A 3V4RA 2FSHA 1II0A 3MG9A 4FINA 4PAOA 1XNJA 2QT0A 1OFTA 1F5NA 3SYLA 1R10A 2GCOB 3PG5A 3R7WA 5J47A 1RIFA 3I32A 2RGAA 4TT3D 4DEYA 4ON9A 3VR4A 2WIBA 3AVOA 1VG1A 1KKMA 2O8EA 3VU9A 5EE9A 3LVQE 2OBNA 4PAQA 3LFUA 4OQNA 2C98A 2ORVA 1R0XA 3W5IA 5B58C 4XD7D 1ZRHA 3KFVA 1SKQA 4Q00A 5DO9A 2WAYA 1XPOA 3QQ5A 5IK2A 1KMQA 4NH0A 3WHLA 3CWZA 2JLWA 4TMVA 4A82A 1XTJA 3QEJA 3U3KA 3CO5A 1ETUA 4BWYA 2HCJB 2F7SA 2R6DA 3VFDA 3NBYC 3H1TA 5AUPB 3A4NA 3CRVA 1UKZA 2F43B 2XNDA 2FF7A 3B2EA 4Q1EA 4A0HA 3CRQA 3A58B 2VHUA 4HUQA 4A1FA 1NVWQ 4D4MA 4EPYA 3GLHB 4HSEA 2MMCA 1SVOA 1U0JA 4IXMA 2ZJOA 2CLCX 2QP3A 5HE8A 2CK3D 3IKJA 4I99A 4CDGA 5CITA 1KY2A 1GM5A 2OXRA 1Z22A 2CBZA 2QRNA 2FGJA 4XWAA 3C4JA 3KJIA 1GRNA 2PZEA 4HDCA 1RYFA 2ZR7A 4PQRA 3UXMA 3A1TA 4B35A 1FX0B 5B30A 4UJ5A 1PV4A 2NGRA 4P4SA 1I4TD 5E7MA 5IRCD 4HB3A 4GRAA 4R2IA 2VO1A 3TR0A 1CEEA 2RGXA 3QI2A 4AURA 3AKCA 2OAQ1 4TLAA 3TQCA 2JJ1D 3VHXA 2NO6A 4JL8A 1A82A 3Q3JB 2J7KA 4NYJQ 3EIQA 4DT1B 5BW8A 1DS6A 2CE7A 2D3WA 3FFBA 2ANCA 1WCV1 3RYTC 3VNVA 1E2EA 5CLQA 1IN6A 2Q3HA 4FW9A 4URZR 1G4UR 2IYVA 4TZ0A 4MYHA 5EXSA 4PR0A 1U8YA 3TQFA 1W4RA 5FBQB 1NN3A 3KQNA 4GDFA 3ZH9B 3RDPA 3O8BA 1ZBDA 1VMAA 3UMFA 5FBVB 1D8TA 1XTIA 3SC3A 3AVPA 2HUPA 1MABA 1VKJA 3VR5A 2ODNA 2DBYA 2ZSBA 5FPYA 2X8AA 1BO6A 5EP4A 3AF2A 1GWNA 1KI4A 4MGYR 5F3WB 2KSQA 5GVSA 1Q1QA 3SS8A 3D8BA 1OKKD 3DVLA 4UNSA 1N5LA 2N1BA 3VR3A 3THYB 4Q7MB 4LBZA 2ZPTX 4Q9LA 5L3VA 2WZQA 4QM6A 4LJ7A 2VQSA 2JJ2A 1VHLA 1ZNZA 1BYIA 4DWJA 5KSZA 1XP8A 3GFTA 4E07A 2NMVA 1QHXA 3RC3A 5LDDC 2OBLA 4JYCA 2XZPA 3VKWA 1JB1A 2ZVPX 4EFLA 2GETA 3U7FB 2QSZA 4ACBA 3K70C 3EASA 1AIPA 1GIAA 1HV8A 2V8OA 1N0WA 4LPKA 3L8ZA 2D4HA 4DLUA 5P21A 3EW9A 2QAGB 1GFIA 3JVUA 5JJLA 3NDPA 2ZI9A 4A8JC 5IK2D 1EGAA 2XGJA 2WPDA 2GCNA 1QF9A 3TMKA 4P4UA 4C2UA 4A0RA 4LZZA 4JVLA 1VYTA 3RSOA 3THXB 2O8CA 2ECKA 1M8PA 5FPTA 2LKCA 3KTAA 5J40A 3KDSE 3RRMA 5AUNB 4QKQA 4U7DA 2I1VB 2QM8A 1Q0UA 1KMHA 1U0HC 3VR2A 5UKDA 3W3ZB 1GITA 3ADBA 2W6JA 3PR1A 4HDQB 3MFYA 2GVZC 1XCPA 2AKYA 1MV5A 3C5HA 2DPXA 3PXGA 3T1OA 1NRJB 2XZOA 4QGFA 3VNUA 4E22A 1XMIA 3ICQB 1GNQA 1G7TA 3UIEA 4BUJA 1L4YA 1AS2A 1HH4A 2GBLA 2GWHA 4Q9JA 5G53C 521PA 4ITRC 4B3FX 3CRMA 4CF7A 3EPJA 3PEWA 3AKYA 3NEYA 2C77A 1U8AA 1G19A 1YJ5A 2Q3MA 4JJKA 3SN6A 4B75A 4AYWA 1ZW6A 3CX8A 4IVRA 4HAUA 1YZGA 2R2AA 1PVOA 3WY9A 2GF9A 2V6JA 1BS1A 2W0SA 4MRVA 2QZ4A 4I81A 1N6NA 1UDWA 2BEJA 4TLBA 1E2IA 3KQLA 3GEEA 4DCSA 3OE7D 1BH2A 3PQCA 4B3XA 1YRAA 1SVIA 5K8IA 3G5UA 4LSGA 4Q4LA 3FDIA 3K0CA 3OEED 4IRUB 3HPRA 3QKSB 1AZTA 2ZI5A 4Q03A 5DSZA 2C9YA 2ZSDA 3IUYA 1T5LA 4OHWA 2AN9A 2IX3A 2GJ8A 2OCAA 2ZRMA 2GCPA 2WWYA 1Q21A 4PC3A 4ZV4A 1NBMA 1VCIA 2AXPA 4GMXA 1ESMA 1T0JB 1P62B 4NKRA 1XCGB 2VP4A 1JAIA 4RFVA 1IONA 1NVVR 4TWZA 4PO8A 1S1MA 2XOKD 3A1SA 3RRZA 2QTHA 1HT1E 4KBFA 2UKDA 4IVPA 3THWB 2O8FA 3CZQA 4KLNA 1LW7A 5BN3A 5JWRA 3B1VA 1KJWA 2ODBA 5HPYB 3EZ2A 1KK1A 4MKIA 4RZUA 1S4QA 4HEJA 4QHYA 3NEJA 2LCFA 4URUR 1P73A 1P4SA 2ZSEA 3ZVLA 3T1QA 1E96A 2A5YB 5E7JA 3UK6A 1P6XA 4JIMA 4RD6A 4C0KA 2BV3A 4DB2A 5FTLA 3TJZA 4C0HA 1L4UA 3IILA 2C04A 1XU4A 2ZS7A 4A15A 2B7BA 3AVYA 4MUAA 1UM8A 4U02A 3CR7A 4YDHB 3DKPA 2JDID 2J46A 1W2GA 5EE3A 2WPDD 1QVAA 3K0EA 4W9MC 2ZI7A 1OFUX 4XVQA 5EUMA 4HUQB 3SBDA 2FU5C 1XJ0A 4JLJA 4NCJA 3P27A 4C0QC 4DDTA 4AWXA 1E2GA 1KO4A 2EWVA 2WBLC 1CR2A 2ZRAA 3ICEA 2QPTA 2OFOA 4RY2A 4US1R 2V4ZA 1COWA 4RCYA 5D3QA 2PZGA 1NLFA 2NO1A 2FJUA 3AKDA 4DLXA 1E2DA 4II7A 3ECCA 1G3QA 4NTZA 1S0UA 1NVXQ 3KQHA 3RS2A 1HEIA 3MCAA 1DARA 3ADDA 5F2EA 3VX3A 4CVNA 2GXAA 3QXHA 1KO5A 4LBWA 3UG6A 4C0SA 1R0YA 1TPZA 2H57A 5FOSA 1RE0A 1LVGA 3QE0A 4MRSA 4P4SB 1O87A 4B76A 1U2RA 2C96A 1MRSA 4GBMA 4Q1DA 4OI0A 2J7PA 2OG2A 4TL9A 2F1HA 4TL7A 1R6BX 2P65A 3B1XA 5HTKA 4TQUS 4KXFB 1DTSA 4IHQA 2ZRJA 2ZRGA 3CH4B 5TXGA 4AC9A 4IDPA 3K09C 1G5TA 4MYCA 1G4AE 2CNWD 1MR3F 2ZRBA 3FMIA 1DG1G 1ZIOA 3GJXC 3HU1A 4LHVA 1EFRD 3Q7QA 2ZTSA 2VTKA 4N0EA 1Y63A 2P0EA 4Z8XA 2GNOA 3SJBA 4YC7A 2X1VA 4AYTA 2AKAB 2YWGA 2F9LA 5FOWA 4O25A 2CL7X 1Z29A 2BJVA 1KI9A 4PHFA 1SHKA 1E1RA 1F6BA 4MGIR 4URVR 4C7OA 4JLBA 3OF5A 2VP2A 2BMEA 5CB6A 3GJ7A 1KI1A 3LBIA 2TMKA 3EXAA 2VHJA 1TQ2A 2O8BB 1EXMA 2YWHA 2QQ0A 1NMZA 1MT0A 2AFHE 4F92B 2OILA 5KNBA 5EXPA 4FCVA 1Q44A 1W0KA 4CEIA 1NBMD 4OQLA 3IGFA 2OSBA 1CRQA 2ZS9A 3VX4A 2AFIE 4A8JB 4KYUA 2GZHA 1DELA 4X8OA 2DHRA 3T06B 5AJZA 1M1YE 4F93B 2R65A 4AKGA 3DOFA 1XTSA 3VR1A 4L8GA 1T3LA 1ELOA 2ZREA 3AM1A 3AQ4A 1T8TA 2Z4RA 3KXIA 1HUQA 3ADKA 1XJCA 4B43A 2JLRA 4TLEA 4IDNA 4JMPA 3D6TB 5KDOA 2L0XA 4CEJA 1CP2A 4L9WA 4JSTA 4KI0A 2YWEA 3SFZA 2BDTA 2Z5FA 4H1UA 4C9BA 3BFXA 1VDZA 4MQBA 3J81k 1OIVA 3JZMA 2C9OA 4Q4HA 3WNDA 4L9SA 4EPVA 5K8TA 1JEDA 1YRBA 3QY0A 1DEKA 1HQCA 2QE7D 2YOFA 2QAJA 4V02A 4M8NE 5EUQB 4OBEA 3KJHA 1VHTA 2JATA 2R62A 4B6FA 4E09A 3RANA 3FMPB 1Z63A 4GI7A 5TY0A 3VHLB 5FFMA 3OIWA 2CCJA 4HI0E 4HLCA 3PJRA 4B3DA 3QEOA 1CS4C 4A4DA 1IY1A 3WNBA 4AYXA 1G7SA 2ZI4A 5EXTA 1IJEA 1YKSA 1CU1A 1M2OB 3U7GA 5L8VA 2F43A 4F7WA 2P2LA 4PC7A 3X1XA 2C5LA 2AWNA 2CJWA 4MDFA 3SHFA 2IYXA 3ZZ0A 1KI7A 2ERYA 1PJRA 3GLHA 3MJHA 4A0FA 2V7QA 2XB4A 2DFNA 3CPJB 3T15A 4D26A 3W6NA 1P7CA 1E0KA 2C2HA 2YC4C 3D31A 1KHTA 2GEUA 1WQ1R 1LS6A 1OXUA 3UWKA 1U0LA 2JGNA 5KNDA 1M6NA 1ZUNB 2J7PD 3C15C 2BM1A 2F1RA 2FPMA 3W34A 3U4QB 2VP5A 3FHOA 3SU8A 1QHSA 2QP4A 5G3ZA 2WM9B 3SYKA 3WRYC 5F9HA 1VYUA 3NC0C 1Z6GA 5FPKA 2ZIAA 5CIQA 2NPFA 3RS4A 1SXJE 2CL6X 3TW4A 4Z54A 2DB3A 4MKGA 2PMDA 3UG7A 1NY6A 2IYWA 3QXSA 1FX0A 1U99A 2E1RA 1E9AA 4JBYA 3IPYA 2ERXA 5TARA 2R9VA 2ZRNA 1S8FA 4V0OA 1G6HA 5FTNA 4DUGD 1QHGA 1MO3A 2IS2A 1GOTA 4UQOA 5EE1A 1O3YA 2ZAMA 3TGPA 1GRRA 3BJIC 2IS1A 1X1RA 1ZCBA 3HP1A 4XSHA 5JZVA 4IOJA 3VTKA 5DGXA 1FQJA 3DO6A 2XAUA 5JSZA 4FMDB 4MYTA 2O8FB 4JLPA 2E9SA 4M2LA 5EZ6B 1C4OA 5LPNA 1CKEA 3RNLA 2GHIA 1ZNYA 1XMSA 1XZQA 1JR3A 3AV0B 5H1YA 4W7SA 2ZXUA 2VP9A 4UKDA 4DCUA 2FV8A 1EFHA 1GKUB 3NC1C 3WHKA 1Z0FA 3GMTA 3AGQA 3EPKA 4R7ZA 1DVRA 1KK3A 5G41A 3TAUA 3IDQA 3KL4A 3GEIA 1BOFA 5JHHB 1N0VC 1Q20A 2LKDA 2V9PA 4TT3A 2D2EA 1IOZA 5FBWB 2J9RA 1JBKA 2OO7A 4RKFA 2FX3A 4FMCF 3THYA 3TKLA 1IAQA 1Z0IA 5FR2A 1VG8A 1YHNA 1Z2AA 3ASYA 5LB2A 4XD7A 5F98A 4X8HA 1YZLA 2RGDA 4BLRA 4NYJR 2G88A 2IBMA 3GCGA 4B47A 1AM4D 4P33A 3P26A 2ZYVX 5GJWC 2B6HA 1A7JA 2V1XA 3B9QA 3X1ZA 1KKLA 2BBWA 5DI9A 4QOSA 4IOKA 3EIHA 1EK0A 2W58A 1LF5A 4QG7A 3HDTA 4OJQA 1GL7A 3MWYW 3IBYA 4L16A 4LJ9A 3AP1A 4PPFA 1E0JA 1AGRA 1Z3IX 5E95A 2RHMA 1U9IA 4PO1A 5DYGA 2FEOA 1GRQA 4S2EA 3QBTA 3THXA 2VLIA 3SEAA 4B3GA 4FWIB 1Z6XA 1C1YA 1JPNA 3QG5A 1XD2A 1V43A 1U98A 2QRZA 4LYFA 1P9RA 2IYTA 1S2MA 2WICA 1I2DA 3GLHE 2J0QA 1E9SA 3AVVA 4HLUC 3JVVA 1TADA 3BH7A 3HPQA 5B57C 2J0SA 5KSPA 1OFIA 2ZEJA 1KY3A 1DPFA 3QUSA 3ZLJA 1HYQA 5GJBA 3L43A 2FOLA 4W5HA 2KWIA 5FTKA 5TB5A 2PX3A 4C3ZA 4BFXA 3K9GA 4TN1A 5FOUA 4NP6A 3QKTA 1LS1A 3AUXA 4Q1BA 4LGMA 4EPTA 3I5YA 4PC2A 1E3MA 1GL9B 5IDVA 2VPPA 4I4LA 4BLPA 1N6RA 5LBIA 1E98A 1FNNA 3MMPA 2EVWX 2ONKA 3I62A 5LD2C 2Q9AA 1EWQA 1AGPA 3R9IA 4KHZA 4TYQA 2JJ1A 2VP0A 4IDHA 2UVQA 2VBCA 4UNPA 1K5GA 2NTYC 2LWIA 2QMEA 3NHBA 2DY1A 4B6EA 1TU4A 2PEZA 1W36D 2D7DA 3ZVNA 3CH5A 4US0R 4JBXA 4CEIB 4YMUA 4EDHA 1HURA 1X6VA 3MAAC 5FUWA 1N5JA 1AA9A 3CF6R 4D81A 2ZUCA 4NBSA 4ZDWA 2QL6A 5HKKD 2ZRDA 2G9NA 4Z51A 1OJLA 5KDDA 5J4YA 2WV9A 4G5SA 1QG4A 1OXTA 4DEXA 1FTSA 1F2UA 1ZINA 2FFAA 3QKSA 1XCMA 1YE8A 1ZMXA 1UEIA 4OK3A 2GXUA 4M4SA 1JR3E 4CT5A 1E2FA 2QQEA 3GLIB 2NOAA 1DAFA 4LV5B 1OSNA 1WDTA 3LX5A 1OKKA 4KU4A 4POAA 1G9XA 5FUYA 3SHWA 4PQYA 4BFUA 3PENA 2GJ9A 3KKQA 4LDJA 4PSKA 4Q4HB 1D9XA 1OF1A 1E2JA 3THWA 2NO0A 4UXJA 4GOXA 3L0PA 3RVBA 2GEDA 2N42A 5G40A 2OAP1 4BFYA 3FKQA 3OZXA 3ZQJA 2Q9CA 1H8HD 2Z6VA 5CJPA 2IS4A 3K0AA 5F9FA 1N3BA 1S96A 4QGAA 4NHOA 3ZIAA 3BFKA 5CLLA 2K5UA 2W0MA 1ZUIA 3B5JA 4L4UA 2OCYC 2VL7A 4FCWA 1G5PA 4WXRA 3CR8A 2QPOA 1KSGA 5CIWA 3M1IA 4O3MA 4GP7A 3GLFA 2BJWA 1XPUA 3FMFA 4EQ6A 3LBNA 3N70A 1CJKC 1OLOA 4JVMA 1KSJA 3LXRA 4MRNA 3TSOA 4ASUD 2CJWB 2GESA 1H65A 2N46A 4IEIA 4AI6A 1IXRC 3FWYA 3KB1A 4JT4A 1KTVA 2WWFA 3NIBA 3R9WA 1ZM2A 1AN0A 3KKMA 1JJ7A 2V6IA 2YYZA 2HYDA 3FGNA 1E94E 4DKXA 2MSDB 2HYIC 3U61B 1G291 2C8VA 3WBKA 2IHBA 3W8RA 4YDSA 2GA8A 4TQ9A 3NHAA 3CUEF 1HE1C 3NDBB 1ZJ6A 4N1AA 2QY9A 5FI1B 3LNCA 2J5XA 3W5JA 2H17A 5EZ5A 1G8PA 1WF3A 2YHSA 2IA5A 2IUTA 3BB1A 5AJWA 3GEHA 4LI0A 1RRPA 2ZJZA 2BBSA 1XDBA 2X77A 3FFAA 1T0HB 3P20A 2R6GA 1T5IA 1FMLA 1ODFA 4NCHA 2WSSA 3CRW1 4RD3A 4TSFA 4DXAA 1W36B 3I1FA 2R6FA 1QHNA 1X8LA 4OHZA 4GT1A 1A2BA 3ZYCA 1W4BA 1VCOA 1PUJA 2KJQA 3OE7A 3NBXX 1E99A 2E87A 3V9PA 2Z83A 4NYMQ 1Q12A 3EWAA 3TNFA 3OEEA 4GFDA 5J4LA 5JSZB 2OE2A 1C9KA 2ZYTX 2WOJA 4P4TA 2HXSA 3U5ZB 1VTKA 3BH0A 1U90A 1Z0DA 2SHKA 3DM9B 1G7CA 2YC2C 3LWNA 4P3YA 4TQAA 1YR8A 4R9UC 2XTNA 4D4JA 2EYUA 1D9ZA 4JLNA 3ZZUA 2A5FA 2Q6TA 3SYNA 1PLKA 2J0VA 5ANRB 2O8BA 1OXSC 1T6NA 1ZNXA 4OK6A 2ZUDA 3MWJA 1S9HA 1I4LD 1IXSB 2ZJ8A 2RGEA 1GZSA 2JLXA 2AXNA 1OH6A 1L7VC 1Z47A 3H4MA 4URYR 4KFTA 5TVKA 3C41J 2XOKA 1KDRA 2BKUA 4QC2A 5CYPA 4A8JA 3X1YA 5KTYA 3M0EA 2IWRA 4LHYA 2OV2A 5AWFC 4BLQA 2REOA 1CRPA 1ONBA 3EZ9A 2DCUA 2EQBA 2R8RA 4B44A 1YR6A 2C9CA 3LW8A 4HZUB 1JEEA 2GZDA 4KJZA 1NIPA 5IT5A 5L3QA 2FDCA 2CEAA 2RH5A 3CX7A 3NBZC 3RS3A 3SQXA 5CDFA 2ZU0C 4QRHA 2IYLD 3K1JA 2FWRA 3ZIAD 4TYPA 1E2QA 1WMSA 3K9HA 1XPRA 2JJ8A 2JDIA 3EZ6A 3H0KA 4HLDA 4UXIA 4KITB 4C0JA 1BIFA 4PPGA 5JBQA 2CL0X 3TW8B 1P2SA 2FPKA 2VHTA 2RGBA 3I61A 1RYHA 2X2EA 2IYYA 4F91B 3GLFE 1JR6A 1OHHD 1XD9A 5IF9A 5C1BA 3WXMA 4BPBA 4OK5A 4DJTA 3FPAA 3NXSA 4H1VA 3HJNA 3AEZA 1XD2B 2IYRA 3A36A 1P75A 3FB4A 4MYUA 2D06A 2IYUA 3T12A 5LD2B 4QHTA 1TQ6A 4DLTA 3AP3A 1QVRA 3CONA 2ZQ5A 3U44A 2QT1A 2QENA 1E2HA 4IXNA 1UADA 3O8RA 5FPHA 4DC9A 3BOSA 3GP8A 2CHGA 1HY3A 4IEEA 1WP9A 3SQWA 4KLZA 4BFTA 1HTWA 5KYKA 4JKYA 3OESA 4CRWB 2EYQA 3PUWA 3SDZA 1G18A 4YONB 5M04A 1G8FA 1GG2A 4V0LA 3AF4A 5JS7A 4OL0A 5SZKB 3THOA 4OHXA 2X2FA 1EFTA 1X8JA 3KKNA 2HV8A 4Z1MA 3CIOA 4QXAA 1IXZA 3OHMA 2ZE6A 4RCZA 2CNWA 1CJMA 3X1DA 1DG3A 2WSSD 2IW3A 4TSFD 1EFRA 4M9XA 2QGZA 3U4QA 1J2JA 4DBLC 3RWMB 2CCKA 3KUCA 5FTMA 3L0OA 2NO9A 3TUJC 1SGWA 2WSMA 3REFA 2RAPA 5HR5A 2ZJAA 4MUBA 2A5GA 2B21A 2PLFA 3RS5A 1F2UB 2QMUA 5H70A 1R5NA 1XMVA 2EFDB 3TAHA 2G3YA 3TLXA 3PCRB 1VIYA 1G17A 1RZ3A 2IK8A 3DEFA 3LLUA 2JLZA 3BB4A 1LB1B 4US2R 1F48A 1ZC4A 2R6AA 4PO9A 3LVRE 2BC9A 5JJIA 2JASA 3BH6A 4BEBA 1R8QA 4QBHA 4QHSA 3PV0A 3U3MA 3K70D 1IN5A 1TF7A 1UBFA 5FH9A 4AKEA 1D2MA 2G1KA 5A4JA 1FTNA 3PVSA 4ZIRB 4QGGA 1IHUA 3AB3A 4Y0VA 3M4YA 3IHLA 3BAFA 3MJRA 2A7QA 4LV6A 5D3MB 3PEUA 3IQXA 2ZM5A 3K0AB 1UPTA 2AK3A 2GKSA 2IUSA 3MUFA 4MDEA 1LTQA 1TEVA 1TAGA 1ZM4A 5CJ2A 3BXZA 4PPQA 2ZANA 6Q21A 2CMKA 5L3RA 2PLRA 4OYHA 4DLVA 1IY0A 3BC1A 3R20A 1P2TA 4LHZA 4HATA 1NLYA 4I1SA 4IJMA 1FUKA 2P6RA 2IT1A 4EPXA 5CDFE 3GLFB 2FSFA 2VSFA 2JEOA 2QE7A 2XTZA 3WP0A 2QORA 3K0FA 1MH1A 4EQ6B 1XEWY 3RS7A 4DLWA 4I1UA 4JZKA 3SBEA 2F6RA 1OPXA 4B3CA 2H5EA 4TMTA 4Q7LA 5HCIA 2C99A 3KB2A 3A4LA 2WWIA 3F0TA 1FNMA 3VKHA 4IDQA 2AL7A 1WXQA 2JIZA 4RJLA 4PANA 3K8YA 1CIPA 1M34E 2G0TA 2HJGA 3B82A 3ADCA 1LFDB 1OE0A 1E79D 1TF5A 1FQKA 1W4CA 2HT6A 3AP2A 3FYHA 3K09A 5GVRA 2QGNA 4F38A 1YU9A 1TEXA 2QP9X 1KYIA 2G77B 3TUZC 4WVFA 1ZU5A 3QOFA 2O52A 2R6CA 2IYZA 1ZAKA 2PT5A 1US8B 2ZRHA 2IHYA 2WIAA 4MA4A 3LO5A 3DKVA 2FFBA 2ZJ5A 3AVWA 1NJGA 3BRWD 3HR8A 5TMPA 1IBRA 2JLVA 1H8ED 2FMXA 4BE7B 4C30A 1ZP6A 2NG1A 2H1LA 3GQBA 3QF4B 4ZDKA 1R2QA 5JI2E 1Z8FA 1YZNA 1W0JD 4Z1MD 5H8WA 2IYQA 2WJJA 4R2HA 2EFCB 2VYFA 3EC1A 4N3NA 8OHMA 4YMVA 721PA 4OKSA 5JFGA 3OIYA 3MRSA 3PUXA 1E69A 2FPLA 5KPJA 5AJVB 3LLMA 2QMOA 4OQFA 4M1MA 3IQWA 4DCTA 1OB5A 2CHQA 2QM7A 1PUIA 1KI8A 4B71A 3OIUA 2PT7A 1J8YF 4UXHA 4DUGA 1G7RA 4C0LA 1A2KC 2W2VA 1N6LA 1JECA 4LBVA 1P5ZB 3CX6A 1A5TA 4FCTA 3K70B 4PZZA 4ARZB 3LAWA 1G5RA 1WB9A 421PA 4O0MA 4WW0A 5GJCA 1NBME 4BRWA 1NN1A 2UZ3A 1Z2CA 3FTQA 3UPUA 1KDOA 4M9QA 2OFXA 1QRAA 1KNXA 4GZLA 1BMFD 1I4DD 4URXR 3GFPA 3Q85A 1U8ZA 1P3JA 2PCJA 2H7VA 2ZRFA 3Q5DA 4ILEA 5JLJA 5L3QB 1N6IA 4B2IA 3R8FA 5C4GB 4AG6A 3PITA 4HAVA 4LJ5A 2JA1A 1G21E 1SXJC 1KI6B 1LV7A 3R8CA 4ZO4A 3MSXA 4D0GA 1II8A 2QROA 3PEVA 5JS8A 3GLIA 1SULA 2GEVA 2XSZA 4PSAA 3W6PA 1XWIA 4N0DA 1DAGA 3U6KA 4OI1A 4B48A 3C5CA 4G5GA 3V00A 4PHGA 1T8UA 2P6NA 1E0AA 5SZHB 2ORIA 1QBKC 1RVDA 4IFBA 4XWOA 1T3HA 4XTRA 4Q1CA 3EZ7A 4FI3C 4XVRA 4XH9B 4A92A 4LWZA 3HYRA 4ZCMA 2ZVQX 2PL3A 4IOMA 1YZKA 4JLAA 4Z8YA 2MMGA 2EWWA 2ORWA 4AKIA 4PAMA 5EXXA 2QNRA 1AKYA 5BYJA 5JWHA 2HLDD 2Q3FA 1A4RA 2KBFA 4RFSB 3IEUA 1XXHB 1X3SA 5JECA 3U44B 4X8MA 4QJ5A 1DAKA 2KBEA 1YR9A 2JIZD 4TMZA 2ANBA 2DYKA 1E9EA 3H84A 4KFRA 5A0FA 2DWQA 1OT3A 1XEFA 2BHRA 4PX9A 2FNAA 4XIGS 3RSLA 4FN5A 4HAXA 4DDVA 2VRWA 3B9PA 1JJVA 4RZ3A 2DFKB 3NH6A 3OAAD 1KZGB 2PEYA 4PXAA 1SHZA 2GK6A 3BGWA 1G3MA 3U7HB 1EFUA 4OI4A 3X1WA 3ZGXA 1E2PA 3A1VA 3KKPA 4JJZA 2ZRLA 5A5GA 5CB8A 1W47A 4GOJA 2VHCA 3QPWA 1QHHB 2REXB 3Q7PA 4EFMA 3A1UA 1XEXA 3CWQA 4M1YA 4JL5A 2ZYUX 1G64A 4H9GA 1M7BA 4RD2A 1E2LA 1R5OA 2RMKA 2MSCB 4BEJA 4LJ4A 3CBQA 4FMBB 3NKVA 2D62A 3AVUA 5J4VA 2J1LA 2HEIA 4WIAA 2BBTA 2YINC 3QPUA 4QFMA 2I3BA 1KIMA 1Q22A 1TU3A 3T34A 4BZXA 4QNRA 1FPMA 5BWMA 2CCGA 3RHFA 4FMCB 1F60A 1P72A 3REGA 2UZIR 5HKKA 2PCLA 1D5CA 1E4YA 2QEQA 1HQYE 5EP1A 1N6OA 4Q7KA 2Z0MA 3M6AA 1QG2A 3GJ8A 4BGDA 3IPXA 5JI3E 3A6PC 2WJVA 3W90A 2WMNB 2CXXA 3U3OA 4HB2A 5JWOA 1QDEA 4KV9A 4D6PA 3F8TA 1W7AA 4QM7A 3FE2A 2WJIA 1YZUA 3CZPA 1PZNA 3GFOA 5DN6D 1E9FA 4HYYA 1G3RA 4UNRA 4TTRA 4CT4B 1OH5A 2FZ4A 2VP6A 1FL9A 4RD4A 4DSNA 4C0BA 2B8WA 2QBYB 2PMKA 4YXWD 5EP2A 2ATVA 4YLGA 1PLLA 2XSZD 2FSIA 3GLIE 5DHAA 2G0NA 3I8XA 1Z28A 1J8MF 2EFEB 3MWKA 1SVSA 4D0NA 4WOPA 1NG9A 4PC6A 1LY1A 3K0FB 1H8HA 3PUYA 3IIKA 4HZUA 2GJAA 4DLYA 2HCBA 3SOPA 2ONJA 1VCNA 2OM2A 2ZJYA 3SI7A 4CEHA 1G8HA 3RC8A 1UBGA 2WJHA 2ZSAA 4KFSA 2FG5A 1G8GA 3T35A 3G82C 1FP6A 3AKEA 2NZJA 3EARA 4NYMR 1WRBA 4JL6A 4HLUA 3AVXA 4JVSB 4PTLA 2BMDA 2VF7A 4PQFA 1F2TB 3BIFA 3GPLA 3KFXA 1Z0KA 2GAOA 1RRGA 1ZD8A 2EFGA 1MRNA 4GNKA 1OIWA 4ASUA 2OCPA 2J0UB 1T3SA 3K9NA 1JI0A 4Q1FA 1OW3B 1NN5A 2D2FA 4FMDF 5FR1A 3FOZA 3ASZA 1NNEA 4D82A 1VG9B 4OHVA 3B1WA 2PBRA 2ZE8A 4IOLA 3VKGA 1G6OA 4LYAA 3ETLA 2O5VA 5KUTA 2F1JA 4BRUA 4RD1A 1NVUQ 1SVMA 3L8YA 3EC2A 4ZI3A 2JCSA 2JLUA 4Q4AB 1HT2E 1Z08A 3LD9A 5KHOC 1NP6A 3PIRA 2BIFA 4MH0R 3BORA 2F1IA 2AR7A 1Z6TA 2VIIA 2ZRCA 3I4LA 4GZMA 4FIDA 5AUQA 1CR1A 3LRPA 1Q3HA 1IM2A 2ZRPA 5AJXA 2FGKA 4DSOA 5KNCA 1K6MA 2PZFA 4D0LB 2VSXA 3ND9A 1W4AA 3GJ0A 1TUIA 5AUOB 4V03A 5FL7D 5C18A 1GSIA 3F3YA 2GTPA 4JYBA 4KSCA 2QAGC 3TSZA 3B85A 2J87A 3QNUA 4W5JA 5JEEA 2GF0A 3MD0A 2A3RA 3BK7A 4GMDA 5JMTA 4M22A 1ZD1A 1RKBA 3TSWA 1ZU4A 3W6OA 4ZCLA 3WNCA 4M1OA 4M1TA 1LF0A 1G8YA 2ZSFA 4WZBE 4K8OA 4MGZR 4BECA 2CE2X 5FBRB 1D6JA 1T9HA 1YR7A 1Z07A 2YOHA 3QBVA 4JLDA 4Q18A 3AVTA 3HU2A 1ZM9A 2YNMA 2DWPA 5CM9C 4DLRA 2A5JA 3RRNA 1E2KA 3FHCB 3UATA 2ZU6A 3QJYA 3I5XA 5ELXA 2GILA 2XX3A 3H2YA 4NCNA 4V0MA 1J70A
chains in the Genus database with same CATH superfamily
3ZHQA 1N1EA 3SZLA 3F8FA 4ZT6A 4EVSA 2ZGVA 2QIPA 3BT7A 4TWIA 3J81K 1OCRH 1E3EA 2K9QA 3HO6A 5E7IA 3UO8B 4JI1B 1Z0SA 1R4NB 2V9CA 3I56I 4LSMA 4RVUA 2X0FA 3ZW9A 4B8YA 2VN8A 4NONA 2JLSA 5JAQA 4NDNE 2PH7A 3DWEX 4PYJA 4LC0A 3SKYA 2IXGA 1C9DB 4F11A 1X9IA 4LY6A 3A6GA 3IVRA 4K81B 3NT5A 2FJPA 2OMEA 2ZAOA 1W88B 2OESA 4Y2RA 2H92A 2K2QB 3ILYA 1J1ZA 1GCAA 1RPTA 1DHRA 3HB0A 2P4UA 3OS2A 1TWHJ 4Y8VA 2GZ2A 5DCYA 4HLQB 3CUOA 5CVJA 2C29D 1QK4A 1TDJA 4JB2A 1VQ6I 4WZBB 2CSXA 1BWRA 1RAAA 3HDQA 3BIWA 4C0AC 2I4NA 3ND5A 3K9BA 3WMGA 4MUKA 2RGWA 1X8KA 3TLAA 1THZA 1ZMRA 4GU5A 4HPWA 1VL2A 1W48A 2XB5A 4L28A 4WFKA 1ML4A 3F5FA 5AVRA 4N8EA 4KLAA 2PN1A 4QYIB 3L2QA 2Q7OE 1GZ3A 4E88A 1KQ0A 1M2WA 3RTDA 1JEQB 2JLBA 4XLTA 1Z21A 3HJAA 4BLOA 3CNNA 3JZAA 2WADA 3L8FA 4GPIB 1SURA 3LJKA 4P3OA 1N7JA 4WKCA 3D5QA 3SM9A 3K5IA 5BUQA 1E79A 4JQFA 4CV1A 2O54A 2C3OA 1QHEA 5I8PA 2KQUA 4R0VA 1JDVA 5FDFA 4MRRA 3GFMA 1RI5A 3IUBA 4CKEA 2FR1A 5J1RA 4RS8A 1JDZA 3U0BA 2ICWG 1EXDA 5AIBA 4HB0A 1VQLI 1VFCA 3SJCA 3RQIA 4XIIA 1R4MB 2G5CA 3GX1A 4G37A 5J1TB 1RWKA 4EBBA 4XKJA 3KXKA 3CZ4A 1J0RA 1U9CA 2CJFA 4U9UA 4JYZA 1B23P 1H1LA 1I5EA 1XZIA 2ZKZA 1EEHA 1GEGA 2JD1A 4L5BA 4IWNA 1XZDA 4RKYA 3OM1A 2VUHB 2WMOB 2ZDQA 2QJRA 3N8DA 1JF8A 4K7JA 3AYZB 1OCCH 2A9OA 1R7RA 3ZKAA 1NE2A 4GO1A 3P0EA 5T4FA 3GLVA 4S1OA 2Z09A 3RUFA 3N0TA 1YB6A 4LWPA 5M3MJ 1N2JA 2J0UA 3I76A 1KR5A 3DEKA 1OXVA 2WR8A 4YNBA 3ABQB 4RMNA 5HLGA 2QRJA 3JSAA 4LGYA 4N65A 1XRSB 3T61A 2QA5A 3JQFA 4YROA 4YCAA 2A78A 3ESQA 3PGLA 5AOAA 1RXWA 4II2A 2HQBA 4DVGA 3C6QA 3GJQA 5KX5B 2XUZA 2P7VB 1SBZA 2EJCA 4WXMA 1BJKA 4MW2A 3K1AA 2YZNA 1JDBB 4P8RA 1W46A 1FP7A 2JJYA 4GNRA 5FKNA 4YDRA 1H6DA 1UMCA 1PNVA 3OL3A 1E0SA 4YXWA 4G2TA 1E1MA 5E7QA 3WTVC 2F8LA 1LW6E 1T25A 2CHVA 2V7EA 4I9UA 3FVVA 1A8SA 4HF2A 3KCQA 1YRLA 2QSUA 5JYCA 2FFHA 3PSHA 5FAKA 3N6RA 1N2CE 5B4TA 4JA2A 2HMWA 4L2IB 5LQCA 2R92J 2A9JA 1O3SA 5DNYB 5DJ5A 4BBPA 4WADA 1VKOA 4HQRA 2W4IA 2VDPB 1PVEA 2DCMA 1JQEA 4ZA2A 1XYYA 5F2OA 2OK7A 4EJVA 2QTZA 3HO1A 3ZXIA 2NVUA 4YQZA 1FYDA 4BNMA 3LY5A 1TVKA 3CINA 2FZGA 3SFVA 3PC6A 3PUKA 2J5PA 3NDJA 4WGFA 2F4VB 3DAYA 1PWHA 2I29A 1XL0A 1YL5A 3KR2A 4DLZA 4FSXA 3PLAE 3UY4A 4UB6C 3FA2A 3HKCB 2XA1A 1GGNA 3CUVA 4OY3A 1WWKA 3NFRA 3GNQA 3OOHA 1K89A 3R23A 2ZT8A 5HZHA 2D2WA 1WPRA 4BHTA 1W2WB 2X8JA 1U9OA 2LPMA 1L7OA 4KQ9A 1IWOA 2C3UA 2VYVD 1PLJA 2IFTA 2HR3A 1R6RA 1J99A 3IDAA 4R6XA 3GJ3A 1BFDA 4UU8A 4TYNA 2J5QA 1V7PC 4WOKA 1EX6A 1PFYA 4RH0A 4X1KB 2PBIA 3CEPB 3FSRA 3K4MA 1GCUA 4R8RA 2EU8A 2AX3A 2HSDA 3L01A 2L19A 4GQAA 3HIFA 3JQAD 2AQKA 4RJIA 5I01A 1RC9A 4P1WA 1GTVA 5K0GA 4KQMA 2PUTA 2Z8YM 5B5SA 5GOTA 1KJYA 3IH5A 4ZK6A 2CLMB 1XX6A 4DSTA 1E6UA 1P29A 4YRZA 4MWEA 4DLPA 3SSMA 1PZXA 1R6VA 2H2HA 3AY6A 3OEHA 2DTZA 1C3OB 2IEGA 3G0CA 1Y3AA 2JCXA 4K9KA 5HLIA 4W5QA 1W7PA 2B83A 1ADFA 2GA9A 3QU3A 1ERDA 2GBGA 2D2XA 2IYNA 5IU6A 1M2FA 5JLWA 3LA6A 1Y6RA 4JMLA 1S72I 5EJ9A 3PQ6A 4MV8A 1R10A 5DXAA 5HUQA 2VHYA 3WRXA 1KF0A 1U1CA 4RGVA 2FSPA 4MVWA 4IRIA 5B58C 3FETA 4MUJA 2XT9A 5DF1A 1CDDA 1CUYA 3H2JA 4TMVA 3ECAA 3QEJA 4OINF 1K0UA 2QW1A 1P1IA 3VFDA 3CCFA 1BBYA 5D51S 3KSBC 5IJ0A 2E2JJ 1FBQA 5HE8A 4CTJA 2QTTA 2Q2OA 1F0YA 4FLMA 3KSUA 1QS0B 1VKNA 3KJNA 3W9UA 5TPWA 2V4JC 2HZBA 3PQJA 1QKKA 3OG9A 3ZH2A 2VO1A 1ZRDA 2NP6A 1EWTA 2FE3A 3L7AA 2K9SA 1JJIA 1IH8A 3C3CA 4TKMA 2R5ZB 5CRIA 3WV5A 3HI6A 3KQPA 1BX1A 1ZBQA 4YAGA 5DGDA 3H3XA 1D8TA 1E5LA 2YJGA 4RCVA 3D2AA 5BMVA 1GWNA 4MGYR 2P2GA 1D8AA 3D8BA 3BQMB 4AUEA 3JRAA 4FQGA 3FTNA 3OUUA 4J1NA 1B8OA 5BWNA 3U7FB 3ROMA 1K79A 1IM8A 5G4KB 4JI3B 1V8DA 1V3FA 3KSZO 5JJLA 2ZI9A 4KUEA 4YJDA 4ZTBA 2F4MB 5AW2A 5FPTA 2EZIA 5B4UA 1R5ID 1NLMA 3KLNA 3UWDA 1GITA 1MBHA 4GGGA 2W6JA 4CM1A 4J4HA 1RTTA 2ONCA 2B25A 5L53A 3ROGA 4U88A 2GBLA 5G53C 2FF5A 3L7LA 3N97A 3EPJA 1BW9B 3L07A 2UZ4A 3GAZA 3RBXA 1YJ5A 5DPMA 1P4JA 4KN8A 4B75A 3GPCA 2GF9A 2QMZA 3GY0A 4MQLA 4I81A 1FK8A 4NZOA 5M7EA 4IRGA 3Q5FA 1J1UA 4BLVA 1RJEA 1M2NA 4B0PA 2B1RA 2DLNA 2WWYA 1Q21A 3GJTA 2C4NA 1XF1A 4IFIA 2BTQA 1FIUA 2AFIA 4Y6LA 4NKRA 5KWJA 1XCGB 1EE1A 4B80A 1OMIA 4TWZA 3A1SA 3RRZA 4KBFA 2UKDA 5IJ9B 5HPYB 3GGDA 3BJRA 2AZDA 2K7FA 1TCAA 2B2CA 3K2AA 2EZHA 5KJFA 1V2HE 4RIHA 1IIRA 2DQRA 2PRIA 5C7LO 3OE4A 1XU4A 4H18A 2PKEA 4EL0A 3K0EA 1YI0A 3U9TA 3AFGA 4JLJA 4RGXA 1OYVA 5A9TA 1NLFA 4DLXA 4I4TF 5JAHA 3KQHA 3ZLUA 5I7EA 3FWHA 8GPBA 2QE6A 2R8ZA 3N3BC 1YX5A 4P5OA 4U0YA 2QLLA 3QX7A 2CW8A 1Z33A 1ENPA 4BX9A 3FWPA 3FMIA 2E4UA 1GQQA 1ZIOA 3B2QA 3GXBA 4YA6A 1BJZA 3LYUA 3PXXA 4D96A 2BMEA 2JA7J 3LBIA 4C7VA 1RD4A 1EKEA 4YCDA 1VJGA 3VI3B 4P4GA 5HCUA 3T06B 2R65A 4AKGA 3VR1A 3PRHA 1E7WA 1R5HA 1UBMS 3H0CA 2FOIA 4BO9A 4ALIA 5FUQA 3MXTA 1BM9A 3NTRA 2Y67A 1H2BA 1WTAA 2XDAA 4L9SA 2ZUEA 4RPGA 3QY0A 4AJJA 3P19A 5KYTA 5KAIC 2WTBA 3O9ZA 4W1PA 2QG9A 3IESA 2CUZA 4JQOA 4CICA 1ORDA 4JP5A 1G3SA 5H02A 3ZV7A 3HSKA 3Q41A 1UDBA 5HVNA 4MDFA 3KIOA 1NQVA 1GZ5A 4XAQA 4EF5A 3Q5GA 3NTVA 3K4JA 1DKPA 4BCBA 2GXGA 1ISMA 2JN6A 5BWBA 1CF7A 1P0CA 3D2LA 3NC0C 4M7OA 3BR6A 2NPFA 2OHVA 2IA2A 3GRZA 5IYBJ 4JBYA 3BDAA 1N0IA 1GPUA 2H3HA 2LR0A 3I2HA 1P1FA 1MUUA 1RHKA 1AGXA 3EH1A 4U9HS 4RPLA 1M5RA 1GG9A 5JZOA 5BN3B 4BMCA 3PNYA 1ZNYA 3GFGA 2X58A 4UKDA 1NW9B 3CLOA 2R00A 3JV7A 2O2GA 3M89A 3V8KA 1XCBA 2LKDA 4KXUA 2P9QA 5FBWB 1M76A 4DR6B 1M72A 2FX3A 5MN5A 2DLLA 5FEMA 4FZVA 3OX2A 3B6JA 1VG8A 3ASYA 3GDFA 1SC6A 1YZLA 5LWHA 2L4AA 2OL4A 1LB2A 3SQNA 3BGDA 3P26A 4CR7A 4XNFA 4LW8A 2LNBA 2HR1A 3MWYW 1W5BA 2RJ3A 4C0XA 5GP1A 3LK7A 1NASA 1SQ0A 4R1PA 5EZYB 1V8ZA 3WODF 4X1YB 3TDMA 2RC4A 2IYTA 4KTTE 3WK7A 5JFRA 1E9SA 1SBIA 2GA1A 5B57C 4JLUA 2PN6A 3NGLA 2P5LC 5HK8A 2PX3A 1T1SA 2NN3C 4KHPB 4RV4A 3IB3A 3DEEA 4UV8A 4NNPA 4HAIA 1YJ9I 2HJRA 2P6PA 4GPAA 5FULA 1W36D 2PEZA 2D7DA 1U4NA 5FUWA 1QVZA 2QR5A 4C88A 4V1CB 5MGNA 1GV0A 3F6CA 3U4CA 2ZRDA 2DFVA 2WV9A 1OXTA 1M1XB 3GG9A 2CB9A 2DTEA 4Q3LA 3C3KA 3DT8A 4Q7QA 2RARA 3TEJA 3IKMB 3OICA 2JBWA 3GBPA 4S24A 2NM0A 2VKDA 5EMLA 5FD8A 3R0IA 1JZQA 2NO0A 4GOXA 4BVEA 2YX4A 4QLCU 2V96A 3ZQJA 1RCUA 2Q9CA 4N9IA 1S7AA 2IA0A 3UAXA 1G8SA 2PQ8A 2I67A 3CLSC 1RYBA 3S5UA 5IMBA 1UBKS 2O14A 2VDUE 2WUDA 2IDKA 1VI6A 4Z9YA 1U2DC 2PUVA 4HEA1 4EMBA 3J80K 1JJ7A 1QQ7A 1O7JA 2JAHA 3QUCA 3C3WA 3IL2A 2CMFA 1XMXA 4TQ9A 4Q39A 3GHYA 2WIKA 1MX3A 2A59A 2A3NA 5E4YA 2NPOA 3M4JA 1BI1A 3FOCA 1Y6JA 3OL4A 3SF8A 1FFCA 3ZYCA 3ST7A 3C1DA 4EKGA 5THXA 5SV2A 1FMCA 3J7AC 1M75A 3FXRA 2GHRA 4D4JA 3LYLA 4PIMA 4X7MA 3PEFA 5JQGF 2I8AA 2YN2A 1HORA 1LPBB 5B53A 3N2NA 2ZJ8A 1GZSA 3UT5A 2BKUA 1HT3A 2XWSA 3OJXA 2GAJA 2M0CA 4KPEC 3IP6A 5L3QA 1ISJA 5G0SA 3X1KA 4RB1A 4K9RA 5ED4A 3TW6A 3L4JA 1B8NA 1RETA 1XPRA 2YCLA 3D8HA 4ZZLA 4FGJA 1BCSA 3ME5A 1P2SA 2FPKA 4GXQA 2VHTA 4F91B 2D1VA 4HXGA 1LX6A 4BPBA 3WK4A 3AEZA 1XD2B 3L4SO 3CLHA 4XDHA 1DQNA 4DM3A 2OUMA 4P7KA 2BLNA 5FORA 3L7NA 4MR7A 1LSSA 5CXUA 1OFGA 4KLZA 3K2BA 2QX7A 2R7OA 4YRVA 4YHHB 4M54A 3OU6A 4DIUA 2GN8A 5A5DA 3GEMA 1QRYA 1YF3A 1H23A 2HTFA 2IZ6A 3OX1A 3S3OA 3ESAA 4RELA 4HPQA 2G09A 1ZXBA 2PX6A 3QYFA 4BUZA 1DIOB 4AJ4A 1JHPA 3BWCA 4QICA 3GI1A 1CVIA 1UBFA 1XD7A 1WPGA 4QGGA 1VGQA 4UAUA 1JKQC 1C3EA 1E1CB 2GSDA 3ZHBA 1DC7A 5JAUA 2K7ZA 4ENRA 4HATA 5CDFE 3HKBA 1OA1A 4G63A 3WP0A 4EQ6B 3RS7A 1QPIA 4JZKA 3T7AA 1ND5A 2I55A 2WY7Q 3GW2A 1QKIA 2ZBUA 3PXEA 2DOEA 2ZYSA 3OZUA 4IDQA 4D7NA 1OLXA 2XAQA 3FZVA 1SXPA 4UHFA 3EVFA 5AI5A 4WVFA 4H7HA 1MC4A 3RAEC 2Y1XA 3C7AA 4TRMA 3LQYA 1H2ZA 2ZSHA 2F2EA 5AW7A 2X85A 4DQ2A 4RSHA 1W5AA 1ADYA 1I10A 4CMBA 2QUKA 3DBRB 4YMVA 3EPZA 3I6IA 5B3SH 3LSYA 2QM7A 2IIBA 2FWAA 1CJCA 1GXQA 2GB4A 2L54A 1U5TA 3HH8A 1T1EA 5ARBA 1V96A 4BO7A 2DWCA 3EYWA 5J2TA 1XTVA 2IXSA 2B8NA 3NNSA 2NTVA 4URXR 5LLDA 4ILEA 4EB0A 5KZMB 1N6IA 4B2IA 1ODKA 3C5VA 4ZO4A 4RX1A 2O59A 3PEVA 5CAEA 4WFIA 1Q14A 3V00A 3X44A 4TTTS 1B3BA 1ZREA 3ZWPA 3R61A 1QH9A 3HY4A 3AEQA 4X94A 1YSCA 5EG5A 2ID7A 3DDNA 3LX6A 4JLAA 2Y77A 3EVBA 3P2IA 3H7IA 5LCXA 2KBEA 1KY4A 4KFRA 2DYSH 3U49A 3IH4A 3TG8A 3ZWCA 1O0BA 1PQPA 5BQXA 3TTUA 1NQUA 4FONA 2GFIA 1MIOA 3ZGVA 1CUDA 2Q6VA 5JVDF 1CY8A 4I36A 1RRKA 4H6VA 4DA4A 3OC6A 3P9ZA 2SKCA 3QA3E 2X42A 1PNRA 3FNIA 1JXAA 2HEIA 4WDQA 4DR3B 5DOZA 1R58A 2P9GA 4OMUA 3FAKA 4AZVA 2WG2A 5TQ2B 2K3PA 3REGA 2AQFA 2P77A 3MGBA 3M6AA 1YO6A 1SPXA 3VYRB 3P2MA 5G02A 4KUGA 3DOUA 3CZPA 4J01A 1ZIXA 4D3FA 1DX4A 2G1PA 5EVJA 4CU2A 2C5HA 2G07A 5K5RA 2BDUA 5EIXA 3Q0TA 3BWBA 2AMYA 2GJAA 1XCLA 1O95D 1UBGA 2QV0A 1O94A 1K8XB 3H87A 5CB0A 2NZJA 3JU3A 1HEUA 1EWYA 4FD3A 1ZRSA 3V1KA 1QIGA 2PL9A 1Z0KA 4HNSA 3EZGA 2VJ4A 3LDFA 5D5WB 2IZ1A 3WGHA 1GPNA 3VKGA 1Z6RA 3HMQA 1J5YA 4D9HA 2ELKA 1JPUA 3L8YA 4D41A 3OLVA 3PSIA 4ZMRA 3S2EA 4AAYA 4BO0A 3LRPA 3DZGA 3VJLA 3ND9A 4K9SA 1M0WA 4C2AA 5HVQC 3D4NA 5F0FA 2DAOA 4GX2A 1JDUA 4UUOA 2ABWA 4CKWA 3N1UA 1LDYA 3A6DA 2E4AA 3WYBA 1YU6A 2YOHA 4J7XA 1ZM9A 4U6NA 2DWPA 1BX0A 2O1WA 3E6AA 5ALZA 1NJ6A 4IEFB 5ERGB 3QVJA 1Z16A 1M6WA 2HIAA 2GXSA 2A61A 3ZHZA 1MOQA 4YRMA 1B3RA 5B55A 1ZWKA 3QYPA 3V2GA 7MDHA 4F04A 5B36A 5E6RB 3ETEA 4BB5A 1RRCA 1UG0A 1W1WA 1RKUA 3ZHYA 2C57A 2VSOA 1N36B 3UXYA 1SUIA 3N2LA 4LG0A 2XF6A 3IHKA 1F43A 3KZOA 1RUOA 2NIPA 3T5GA 5JCZA 3IAS2 3F9KA 4YMGA 1A8IA 3HA5A 1SCAA 2R79A 1LXCA 2O2ZA 3RYHB 4RGQA 4BN4A 1CUEA 2JJQA 4Q01A 4A6XA 2IF2A 3PWZA 3WTSC 4TYYA 4Q9KA 4LDAA 1NF2A 2XPCA 3N5CA 2X5JO 3A02A 3TBFA 3OPYI 1WA5A 3GEDA 3D5RC 3HOUJ 2B5OA 3NVAA 5GJVC 4CHGA 4XR9A 1KC1A 3FNEA 3SIPA 1WXDA 2YWCA 5DSXA 1TXGA 3NBFA 5FLXA 1T5TA 2WOOA 5BSMA 1U3VA 2CDRA 5EMNA 3VZQA 1USTA 2ZC2A 3T1VA 4OYYA 1ZH6A 1Z6AA 3IOCA 3ZTYA 2YKGA 1QH8A 1ZVKA 4IDGA 1U0OC 2VHQA 4KKXB 5HBRA 2J48A 3TNDA 4K6MA 3HJRA 3HYLA 3RJTA 1PR1A 1QP8A 1EQ2A 3F74A 1X19A 2BGTA 1W35A 4HDSA 5EE5B 1N6KA 4B33A 1MO5A 4GXTA 1JILA 2XNDD 1ZJ4A 5DM7F 3OY9A 4CM4A 5BSKA 3EUHA 4MTLA 1AKMA 2W6ID 1QF7A 2DT6A 2J59A 3MJEA 4KFUA 2PUBA 3D0SA 1QCCA 3TP3A 3C6YA 2JRMA 3HUGA 3UNXA 3PICA 3BDVA 2P67A 2OCXA 4BNDB 2GCIA 2X5KO 3LGAA 3TQQA 1Q16A 1V5WA 4FR2A 5AOVA 1MO6A 4EA7A 4YFNF 2APJA 3ETCA 4HDNA 1EIZA 4BJ5C 5K5QA 3F23A 3AM3A 3Q2KA 2FA9A 2WJAA 3PFIA 5JD6A 4HLXA 4YCBA 5EL0A 1L2TA 4B6SA 4GX0A 2L3DA 2BCJQ 3NP7A 4GQBA 3CCVI 3ZOBA 1T4GA 3G0DA 4CQNA 4KXWA 4MO2A 4X20B 2EK5A 4YACA 2AXLA 1EX7A 3D5EA 1C9EA 2DA4A 2QJFA 2H18A 1PHPA 1F1ZA 3U60B 3GJSA 2NPIA 4NZNA 3WSWA 1F7UA 2M6LA 3KO8A 3CQ9A 3U1KA 2PJUA 1NL3A 3PGA1 4QOFA 1ZPDA 3ENQA 4HGPA 3G5AA 3QKRB 4KMMA 3UHOA 5DW3A 2IEIA 1RQLA 1Y42X 4LJ8A 2GASA 4C07A 3ZCPA 1U7TA 4QUDA 3AUKA 3Q3CA 4JQSA 4K46A 1NQ5A 4PLPA 1AO0A 1EPUA 2H4YA 2HQNA 3H36A 1KO1A 3A1NA 2H2FA 4N3AA 4WXHA 2BFDA 1AQIA 2LK2A 2OHXA 2W4SA 3QX8A 3A4MA 3USZA 5EMHA 1NJ8A 4TS9A 2VKVA 4PN7A 5E1XA 1MH9A 3L0DA 3I83A 2CLSA 2C4TA 4INPA 3GD7A 5TC4A 4ND1A 4XPIB 3RQSA 4MKRA 1EESA 5FI0B 4J0QA 3S3MA 4YFXF 4DQXA 1RE1A 4D3DA 3WWYA 1A4IA 1KK0A 2PZ8A 1E8NA 4OLHA 3U7RA 1UDCA 3SYMA 1YA4A 4XI9A 4ZXPA 4D9KA 1XQ6A 3OZWA 1KRXA 4N39A 1CJUC 5ECWA 1UZLA 4TUYF 4RM3A 3UGQA 1VMIA 4EEZA 4GP6A 2AG1A 4FQ8A 2DETA 2JFGA 4L75A 1GAEO 1KOFA 2QG4A 1L4FA 3UMSA 4WLVA 1NSTA 4IUBS 2AK2A 4F3KA 3HBMA 3S29A 2NTEA 1MSEC 2ROQA 4R1TA 1CTQA 2FMKA 3MFQA 1P9WA 4PJ0C 4HN9A 4PZYA 1H93A 3NWJA 4H35A 4AK9A 2Z8YA 4WZAA 4MKHA 3F5DA 4P08A 4EECA 4JI4B 3PX3A 1ZKGA 5B37A 3WG9A 1OH7A 4G4IA 5A02A 2V26A 5C3MA 1F8GA 3VGPA 5JYEA 4EYOA 2OHIA 2WUWE 4KSBA 4EGZA 1DZIA 4P7JA 5D01A 2IQ5A 3HA2A 5JNWA 2HXIA 2X6QA 2HJVA 4PTYA 2HU7A 4K1LA 5CHEA 1NG1A 1A36A 4XEUA 4IVQA 2XA2A 3AF6A 2Q0SA 3LSPA 1Y1QA 4LFAB 2ZSIB 3ZDXB 3MJ4A 4Q19A 4WZZA 3RGGA 3LBHA 5KOIA 3SHVA 2WKQA 1CULC 3K9TA 3HCNA 2CUFA 5E3LA 1YS1X 3OYAA 3HFRA 5D6FA 2YWBA 1X13A 1JIQA 1LPPA 3WNZA 2UZKA 2F9MA 2WVGA 4BUCA 3Q12A 3M9LA 1Z3CA 2DM6A 3CVYA 4EPRA 4LXTA 4Z4QA 4D2IA 1KVQA 2GN0A 4IIJF 2HF9A 1Z26A 1OFTA 3W7BA 1TM7E 3THRA 4MJXA 1H9BA 3TAXA 5JS1A 2O48X 4ENNA 1QIMA 2DULA 3G2HA 1DC3A 5AKKA 4BNVA 2XXBA 1ZRHA 1Z0ZA 4L95C 3ANYB 4LF8B 3H11B 2AE2A 1VE6A 2KL4A 3N6XA 1V37A 2WDZA 5JQGB 2X1EA 4QXRA 1UZMA 4RTKA 4BMVA 5CITA 1LK7A 2OXRA 2Y92A 2FMLA 1J2YA 1AGNA 5C1OA 4RY9A 5D86A 5H3LA 3BTOA 1GKKA 4DV7B 2F5VA 4MMYB 5DBEX 2OQIA 5DGCA 2JJ1D 4QPZA 5JNVA 3ZU6A 1WCV1 3VUEA 2JHFA 1VL1A 5CLQA 2RH4A 2Q3JA 3TQFA 3W2HA 1AB6A 2VTEA 4FFBA 2X6OA 3V8BA 2YHAA 3VR5A 3PFFA 2PM8A 4I0AA 5L6MB 3O93A 4PLHA 2H11A 1FT9A 2PWZA 4MZDA 3AX6A 2COBA 4Z7JA 4TGLA 4A23A 4BB0A 4PCQA 1O5OA 3T4UA 1CG6A 2J9FA 5BYAA 2JZOA 1PYGA 1ODLA 4FFPA 5P21A 2CXTA 2WB2A 2BN4A 3PDIB 4LZZA 4J0EA 4Z4GA 4M9CA 4EEFG 4U0KA 3I59B 5UKDA 4IHSA 3W3ZB 4CBVA 5JIBA 1BEUB 3VH1A 1RACA 1ON1A 2GJ4A 3K5PA 1L4YA 1AS2A 2GWHA 2DQSA 3HWX1 4MQ6A 3T3EA 2VLAA 1CQJB 1HNXB 2PNFA 4N9HA 2QD5A 3HYSA 4CIYA 4L07A 3KQLA 4YV1A 2AUMA 4TKUB 4ANJA 1YRAA 3G5UA 4Q4LA 4NENB 3QKSB 5LRSA 1KAQA 2PO5A 2ZSDA 3TL4X 4IIEA 2OC9A 1GSOA 4G86A 2QRVA 1ZZEA 4RK5A 4HYQA 3I64A 1T0JB 2PVPA 4GMXA 1GYRA 4AP6A 3ZNNA 4KOEC 4L0YB 4B4VA 3ABKH 3KYDA 2ODBA 3GAAA 1GPMA 2ZSEA 4C20A 4O3FA 2ZS7A 5AESA 5IP5A 3DKPA 2JDID 2Q5FA 3CSSA 2XYPA 1YOBA 4LRUA 1K7FB 5C5DA 4HF1A 1NHGA 1Z37A 3HCCA 2OFOA 4XQFA 4Q3AA 3AKDA 3ECCA 1LH0A 3I9V1 1WETA 3VX3A 5HRCA 3OCUA 3QXHA 3QMWA 1OX6A 5IOZA 2ZBPA 4PZJA 1V9SA 1UHWA 2GRUA 2KDOA 1ZK0A 3TLGB 3QEAZ 1IZ7A 4MYCA 2CNWD 3GJXC 4LHVA 4N0BA 4ZYXA 2X1VA 1W4ZA 2YWGA 4NXNB 2FN7A 1Z29A 4KACA 4ZFNA 5JANA 1JI8A 4IUYA 2I9KA 2H9IA 1XTBA 1UPCA 2VK1A 2VP2A 4UTPA 1C3VA 3BTJA 1ZONA 1CCWA 5FCDA 1ISRA 1L7EA 1UP4A 2CJYA 1GXSA 1JKIA 5JSQA 1W581 1GO2A 4FB4A 1QYXA 2Y99A 4L8GA 1DKLA 3KXIA 2IXAA 3BCSA 2AV6A 4JMPA 3AL3A 5JVDB 1KOGA 1NOIA 4YRKA 4QQNA 4LI3X 2X7XA 3S0JA 4XE5A 2V4MA 2TMGA 3TBHA 2JUGA 4CHTA 1G55A 4AJHA 1OCZH 1TEHA 3LAJA 1LVAA 1JUDA 2E7ZA 2QTLA 3USES 1IOVA 3RF7A 5F4ZA 4BX2A 1HX7A 2IEAA 4Z4FA 4J0DA 3X1XA 1JU9A 1CYDA 2F4IA 5JHFA 2I99A 1BN6A 1KMNA 3KEGA 4FYHA 1Z56C 4U2GA 3EE6A 1U0LA 1P44A 4BHBA 4UD6A 4R4JA 5FKMA 3WRYC 5C8ZA 1NUTA 3OD1A 2DFDA 2DB3A 2A9RA 2ZB8A 3I45A 3CZ6A 5EKUA 4FOOA 1XVLA 5HKBA 1H0HA 2WB1N 3BLYA 2P2DA 2HD4A 3CUUA 4CE6A 1YDHA 3SIXA 4JLPA 4A6DA 1XZQA 1G21B 3IDSA 3WHKA 5AHOA 1KE1A 3K4LA 2FG7C 4IDAA 4XYBA 1BOFA 1MW9X 5KOHA 1V1RB 4UAVA 5ILGA 3THYA 2GPNA 3L77A 4JUFA 2C0CA 4D9GA 1QP0A 4MV1A 3FRIA 4G8CA 1XG5A 4BXOB 3VMMA 1M66A 3OPVA 1AF4A 4HXFB 4J03A 2EFYA 2WWVD 1EFDN 5BMZA 1V55H 4FJ2A 3C18A 1BGVA 1T5SA 1C1YA 2D1FA 2AKEA 4UTOA 2WICA 4MR8B 3GGCA 5KSPA 1E5XA 3JQGB 6PAXA 4YT4A 2FOLA 2JFOA 4MICA 1LS1A 3MMXA 3AETA 4RUKA 3D7NA 4JELA 5I8ZA 3ZWMA 2Q9AA 3INRA 2B63J 3SKXA 2MSLA 2QXYA 1XC7A 4D5FA 3JQRA 1N5JA 4P81A 3H8WA 3GGSA 2BFBA 2FFAA 1XCMA 4CNQA 1MNAA 2HYJA 2WIJA 2JJ7A 1FBTA 4OK3A 2XPWA 4WLEA 1XQYA 4F4FA 2NOAA 3RHZA 1F0NA 3PENA 3DNMA 4UXJA 1LQ1A 4CJXA 5EPEA 1H8HD 2Z6VA 2ILVA 5CJPA 3JZDA 1MORA 4OREX 5CLLA 1L5GB 1C9JA 1YMVA 4BPRA 2YX1A 3LFHA 5A2QZ 4IQ8A 3D1NI 4S3MA 4XYGA 1ZI8A 1F06A 2L42A 3TSOA 4IHYA 4FFSA 1FSHA 2N46A 4QUJA 2YYZA 2G63A 2O4UX 3FZEA 3HKEB 5JNSA 3H1BA 3CZ9A 3W8FA 5FA8A 2WFAA 1PBTA 1QAQA 3LY7A 3CUEF 1PTJA 2H17A 5M29A 1FMTA 1X1EA 1WF3A 4D0SA 3VC7A 2ZJZA 2BF7A 5KYYA 4JI0B 5ECGC 4MEXF 4OQEA 5F5NA 2QUBA 1O2DA 1ODFA 2R6FA 3AUJB 1X8LA 1B2RA 1A2BA 4EM0B 1EAYA 4WNAA 4JC5A 4J0GA 1FMVA 3C1AA 3OE7A 4ZJZA 3W3AH 3BOQA 3E7WA 4JR2A 2OKGA 1PR0A 1Z0DA 1KEUA 3CF4G 1YR8A 1R22A 1D9ZA 2HZTA 1FTQA 2R7UA 1QDLB 2LCQA 1CQZA 3V97A 5IFKA 1QZYA 2PZMA 2SBTA 1ONBA 3G2QA 4MXDA 2WF9A 3DBHA 2IV7A 1V0JA 2FDCA 3DMGA 2VOOA 1SBNE 3ZIAD 1ORRA 4ZZ0A 2J4DA 4ENUA 4BVJA 4LRXA 3WXMA 5AVYA 4OK5A 2M6SA 1W8DA 2FRDA 4JYAB 1KU0A 3A36A 4GOLD 2OPBA 4YBRA 2ZQ5A 4W82A 5DTQA 2JLCA 3ZW7A 1NMQA 2P2CA 1JDPA 2QNBA 8MHTA 5B3KA 1QGOA 4ANFA 5EYPB 5GTHC 4J0JA 2JA5J 4KQ1A 1XZFA 1T1GA 1FDSA 5I7RA 1IBCA 1G0NA 3RR2A 1IXZA 3PZBA 4AIJA 4JP8A 2NO9A 3LP5A 1PHRA 1R0LA 4XB6B 3V3TA 4DR1B 2EFDB 2HDWA 4WSOA 4Q3DA 2W90A 4GYJA 3ZE8A 5IT9A 3WISA 5EGOB 1TF7A 3EIWA 1SRRA 2PAAA 3TTSA 2XMDA 2KRHA 2DX7A 1Z2PX 1DP4A 4EV0A 2BGLA 4GX5A 4JX9A 5HGXA 2ZANA 2CXUA 4UTZA 2MDTA 2HW8A 4FK8A 2QORA 3K5WA 2I6FA 2V9ZA 4QOEA 3BKXA 1OPXA 4M6XA 4EA6A 4TMTA 3RVPA 4IV5A 3A4LA 4NICA 4TOIA 2AL7A 4P3NA 1C4WA 4IG4A 2HJGA 4IH9A 6NULA 1OE0A 1TF5A 1YU9A 2H4HA 3GVCA 2NU7B 4GUDA 1MMFB 2ZRHA 1L4BA 5E1MA 1IBRA 4LLLA 4BE7B 1T9KA 2W71A 5TGTA 2FOXA 4YP9A 2DUMA 4WCFA 2WJJA 3C8HA 2JA6J 1XG1A 1KI8A 5HS6A 1LRKA 1TTYA 1QFXA 5JQWA 1YJWI 1SEUA 1Y6FA 3C98A 1MJHA 1YNSA 1VSTA 1NBME 4KISA 3T7KA 4M9QA 2R7NA 4BH9A 3MBOA 2H7VA 1P45A 4YP1A 3OLYA 1LV7A 1II8A 4QOIA 1SULA 3W2IA 4TUYB 1T8UA 1L5OA 4UDYX 4X91A 1T3HA 4Q1CA 9ATCA 4IOMA 1GAXA 4KXLA 2MMGA 3S8PA 3FDJA 3EEFA 3P5SA 1XXHB 2M6KA 4Y2QA 4NE7A 2JIZD 4XMYA 1OAAA 1MC5A 5JAPA 4IXAA 4RSRA 3ZMVA 3JYPA 5I5EA 1QG6A 3MOSA 2RC5A 2OCKA 4PLYA 5ICFA 3C70A 4JUIA 1QDUA 5A5GA 1I3KA 1GHCA 1MA3A 2NSYA 3M33A 1B6RA 4NEHB 4OFZA 1JFFA 3PDJA 5LGUA 1EE9A 2HYFA 1KIMA 2D0DA 4MVCA 3NB0A 3UJBA 2R8YA 4F21A 3GPDG 5EP1A 2CJJA 3GJ8A 1KBQA 4EKEA 4KV9A 3WLJA 4QM7A 1WJCA 2D0OB 1YVEI 3WFIA 1E9FA 5AM1A 1WTCA 6YASA 4HXYA 3VZRA 2HBRA 5FI3A 4GGPA 1P1RA 5F21A 2TRTA 2QUFA 3L7DA 5KMGA 2OZPA 2FG6C 3C7CB 3NIGB 3MTAA 4HZUA 3HZHA 5JLXA 1K6XA 2OM2A 2ATCA 4FOLA 1RU3A 2BRUC 3P0FA 4P55A 2FPSA 3UGKA 2VF7A 1WJ5A 3EMKA 4WBXC 3L6OO 1NN5A 5JNTA 2XUFA 3B1WA 2HPMA 4P9FA 4BRUA 4U7TB 1HYGA 3GCZA 5AO9A 3BORA 1YFZA 3T9FA 1I4WA 1SPBS 2P6TA 4KOAA 1V8FA 4DYQA 1H1TA 4MI9A 1W4AA 3ECHA 4GYGA 3AFMA 4IIJB 2FUG2 4MR9A 1U5BB 1DBVO 3N05A 4QAJA 5BOVA 1ZD1A 4C3OB 4C76A 2NACA 4RVDA 4MRMA 3L7KA 3WNCA 4DG9A 3EFOB 1EM8B 2KPMA 1YR7A 2IYOA 2G5PA 3MA0A 2YNMA 2BFMA 1NA5A 1Y48E 2C8LA 3UATA 2OZVA 2W8ZA 8ABPA 2XCIA 3O3CA 1H3NA 4JK3A 2I2FA 3GLTA 2EQRA 3HTUA 2ZE7A 5TEWA 3IBGA 1JKOC 2AEMA 3ZHTA 4R8LA 2H0AA 3R0AA 4ARBA 4IL5A 1XJWA 1VQ7I 3D43A 1UAAA 1MOPA 7GPBA 3U56A 4N6GA 4X8LA 3EZXA 3DAPA 3O47A 5B64A 2AOVA 3KG2A 1OR7C 3RVLA 3EIFA 3I72A 3COYA 3LQRA 3O4FA 3TPFA 3RYIA 1K7AA 3E7LA 2BY3A 3LSMA 4RGSA 3FOWA 4QDJA 3DMNA 5EAIA 3HUUA 2C0PA 1Q1GA 2I2BA 2UZ0A 2CRGA 1YFLA 2VEDA 1VLQA 1L4GA 1AQLA 1EGHA 3D81A 5MHTA 1YJQA 4MUGA 4CM7A 1QBJA 1C2TA 1ZHOA 4DV0B 3WMEA 3UTCA 4M9ZA 4UARA 3OJ0A 4C29A 4DXDA 4TTPA 1PQ4A 2X0NA 2PH5A 2A86A 3DEZA 4RKRA 1YW9A 1KQ3A 3ZQUA 5EQTA 4F7DA 4IQFA 3PCXA 1SOVA 3M1EA 3ZQCA 3SZMA