2R93J

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r93J00
1TWFJ 3LOCA 3Q0VA 5C3EJ 3JRHA 3F0CA 1ZR4A 4IHVA 2NOGA 2M34A 4JX5A 1T56A 3S1NJ 3HOZJ 4FE7A 3PM1A 5F0HA 2DA4A 3H0GJ 3A01A 3CCYA 5K7HA 2L7ZA 3HGGA 2CQQA 5F0CA 2OPTA 1MBJA 4I76A 4HNVA 1CQTA 1HCRA 3W6VA 5FKOA 3SJMA 1BL0A 1FTTA 2K9SA 2E2HJ 1H8AC 3A03A 4D5CA 2XB5A 4A3KJ 3ZQHA 1MBEA 4MO7A 1IG7A 1S7EA 3BTCA 1OJLA 1MH3A 1JUMA 1YRNA 5M5WJ 3HBLA 2HXIA 3OOUA 1HLVA 3D1NI 5J1UA 3BTIA 3S2DJ 3RZOJ 5GP9A 2XGEA 2GM4A 2TRTA 2NVQJ 2E19A 2LFBA 1FIPA 5EYRA 2CRGA 4A3JJ 3HOUJ 2MSYA 4FCYA 1ZK8A 3BQZA 4C3HJ 1P7IA 3GTQJ 2H8RA 4FE4A 4DYRA 4DYQA 5E3MA 1WGXA 4BXXJ 1TWHJ 1T33A 1A5JA 2IBDA 2XSDC 5F27A 4D7MA 1OCPA 4B4CA 2DA7A 2DMTA 4MLOA 1JT0A 1JTXA 1RESA 2CQXA 4A3DJ 4DW6A 2IEKA 1AKHB 3NAUA 2ECCA 2HQ5A 2HOSA 1MSEC 2XPUA 1VNDA 1ETYA 2ELKA 2X9DA 5IYBJ 2VKEA 5M5YJ 2JA8J 3RZDJ 1Q1VA 2K40A 2DA1A 1RETA 1LFBA 4XRSA 5IOYA 5E3LA 4J19A 5EG0A 2Y31A 1I6HJ 2DA2A 1FJLA 3HGYA 1JKRC 2TCTA 1H88C 2Y0SN 4UUTA 1ZQ3P 3LSRA 2HOTA 3GTGJ 3S17J 3HEFA 5J3LA 1MH4A 2NVYJ 3GTOJ 4A3BJ 5C4XJ 2NS7A 2Y2ZA 3IV5A 3BG9A 2EZKA 3QPSA 1IRZA 1JKOC 4DZJA 1D5YA 2WB1N 1IJWC 1Z0XA 1WI3A 3H3VK 4W97A 3JRCA 2FJ1A 1SFOJ 2X6OA 1QVTA 3M3YJ 3BTLA 4BBRJ 2R5ZB 2YUSA 5JLXA 3Q0UA 1U78A 1X2NA 2R0QC 2KT0A 4AC0A 3MKLA 4Y7NJ 2KDZA 2D5VA 4C3IJ 2LTPA 1MBKA 5EZHA 5K7FA 3A01B 3JR9A 2DMPA 1XS9A 2IAIA 3HOYJ 3LSGA 2NVTJ 2L9RA 1P7JA 2HYJA 3C2BA 4B3AA 3BR1A 1GT0C 3K2AA 3HM5A 5EGOA 5FLVA 3Q0WA 2XGCA 1R9TJ 1W0UA 1NTCA 2R7ZJ 1QPIA 2VI6A 1YRNB 4JYKA 5F04A 3DEWA 3I4MJ 2M8GX 4UUSA 3BTJA 3S16J 2ME0A 3JRDA 1VF9A 3BR5A 1U9NA 2Y30A 2DA6A 1WH7A 4IHYA 5FLMJ 5EEAA 5E3OA 1B72A 5FKLA 2LR8A 1HOMA 1B8IA 3NARA 4B1RA 2W48A 1UG2A 3SFIA 2EZHA 2ME6A 5IP9J 2ZB9A 4BY1J 5FKNA 1QVUA 3LNQA 4S0HB 2NVXJ 1F36A 3A02A 1VFCA 1G2HA 1DU6A 3JRGA 3ZOBA 2I10A 1I50J 2LKXA 1MBHA 2ECBA 2X48A 2JA6J 5M3MJ 4BY7J 2EQRA 4M3DA 3B6AA 2O9LA 1APLC 5C44J 2Y9ZA 1TC3C 3SDGA 1GV2A 2O8KA 1POGA 1TWGJ 3Q3SA 3GTMJ 1JTYA 4IHXA 3M4OJ 3S1QJ 3FIWA 2N8GA 3QPLA 3S15J 2HOAA 2LK2A 4ABZA 2LY9A 5FKMA 3HOXJ 1ENHA 1UHSA 5EG0B 1NK2P 5IOZA 4MIMA 1DU0A 2DTZA 1GV5A 2R92J 1X58A 3IH4A 5IP6A 1JJ8C 1HDPA 1QRYA 1GDTA 2YU9J 1ETOA 2AHQA 2R93J 2L7MP 2HXOA 3TW7A 1MNMC 2K9NA 4I6ZA 1LFUP 4AYBN 1WPKA 3DCFA 2HI3A 2L0KA 4C3JJ 4W1UA 1OFCX 4M6VA 3UKGA 3TP0A 3BQYA 4M3EA 5IYCJ 4M3FA 1JUPA 4JX6A 1IDZA 3OSGA 1I3QJ 4CYCA 4A3GJ 4L5EA 1U8BA 2WV1A 2E2IJ 1IV6A 1XC5A 3HB9A 3OIOA 1IGNA 2XPWA 4BBSJ 3O8GA 2ID3A 1JKPC 2MW8A 1AU7A 4QTRA 3QQAA 3CMYA 2EBIA 2R5YA 2XGDA 1E3OC 3PO2J 1IDYA 4MFEA 3JRFA 3ZQFA 1WH5A 2JMWA 1LE8A 4IHWA 1BJZA 2LP0A 5EGOB 4V2FA 2FD5A 3S14J 1GVDA 3ZQGA 2DMQA 2FX0A 2JK3A 3HOVJ 5K7ZA 1RR7A 1O4XA 1ETWA 3GTKJ 3JRAA 1HDDC 4UUSB 1MSFC 1ETVA 4XIDA 3S1MJ 4M3GA 2GLOA 3MVPA 4MFDA 1B72B 2M9HA 5IPAA 1TWCJ 5J1YA 4C2MJ 5EF6A 1B8IB 3K7AJ 2JA7J 2NS8A 3ZQLA 3LSPA 2HDDA 3FKIJ 4DYCA 3BG3A 4RDUA 1PUFA 3GTJJ 1RKTA 3BR3A 2AO9A 2DJNA 5M3FJ 1ZTRA 2B63J 2VKVA 5JLWA 4FISA 1X2MA 3ZQCA 3CQZJ 2EZIA 2E1OA 3LSJA 5EZGA 1ETKA 3BG5A 4G12A 3IH2A 1BA5A 2XPVA 2JJ7A 1W0TA 2DMUA 1BW6A 1UMQA 3I4NJ 4A3LJ 2EH3A 1A6IA 2COBA 1Z77A 3JRBA 1K83J 4A3IJ 9ANTA 1ZGWA 4A3MJ 3BR0A 2ID6A 2QF7A 3RKQA 1ZKGA 3HDDA 3G1LA 4EEFG 3TW6A 4D7NA 4LOCA 4GFBA 5FJ8J 2GBYA 2JA5J 2H1KA 1ORKA 4JP0A 1FEXA 2G0EA 1WCMJ 2QCOA 1JT6A 2Y9YA 5HODA 1AHDP 5F08A 1JKQC 1ZR2A 4M3BA 1IUFA 5DS9A 3BR2A 3GTPJ 1F43A 2RAEA 2XRLA 2P81A 2YS9A 5C4JJ 3BR6A 2CU7A 4A3CJ 1H89C 1IC8A 4A3EJ 3TP3A 2DN0A 4XICA 2FQ4A 1NK3P 2JN6A 1FIAA 1JJ6C 2O7OA 3PO3J 3G1OA 2VUMJ 5M5XJ 4CYCB 1JGGA 5F1JA 3B6CA 5E3NA 5BNGA 2M0CA 5J1RA 3JRIA 4XK4A 2E2JJ 2R5YB 3MN2A 4XRSG 4A93J 2CUEA 2WAQN 3WHCA 4BKXA 1LE8B 1ITYA 5GPAA 2MG4A 4AUXA 1Y1WJ 1SANA 1ETXA 1Y1VJ 1MBFA 5EDNA 3FK6A 1TWAJ 4JX4A 3VPRA 2LVSA 4RBOA 1AKHA 2VPRA 3L1PA 4Y52J 3FK7A 1ETQA 5F0FA 3GTLJ 5IYDJ 4D5FA 4V2GA 1FTZA 2EZLA 3TEDA 3O8HA 1RKWA 2K9QA 2LLKA 4IEJA 4NDLA 4FTHA 3E7LA 3S2HJ 5FKKA 4X1EA 4QIWN 3HKZN 3ZQIA 3GBGA 2JWTA 4X6AJ 2DMNA 1BW5A 2OF7A 2LD5A 1VI0A 1XG1A 1HF0A 1RPWA 3FISA 5GPCA 2CJJA 3CDLA 2PMZN 2MGQA 1PUFB 3BT9A 1K61A 4A3FJ 2L7FP 5DTDA 3HOWJ 2XB0X 1EF4A 3IH3A 3WHBA 4XRMA 2CUFA 1U9OA 1JUSA 3G1MA 1GUUA 3RQIA 5IP7J 2M2EA 3JREA 3S1RJ 4DZPA 1OCTC 2DA3A 2DA5A 4QSHA 4A69C 2R5ZA 3OSFA 1MBGA
chains in the Genus database with same CATH superfamily
4MTEA 2H27A 3JRHA 4JOMA 3F0CA 4L18B 4CCNA 3LA3A 2Z3YA 3VB2A 3QYBA 1IV8A 4HX7A 1D5VA 2OD5A 4HV5A 4BS9A 3H0GJ 3CCYA 5K7HA 3HGGA 3K9TA 3CCMI 1MBJA 4I76A 2HDWA 2MC3A 2OAZA 2P5LC 1SVLA 4RM3A 1D1CA 1CGPA 2K9MA 4HF0A 1WSUA 3BJAA 1FBQA 2E71A 2PMHA 1G8XA 3A03A 4HQMA 4D5CA 2XB5A 4MO7A 2XAHA 2LF8A 3BTCA 1YRNA 1J7KA 2HFHA 1HW5A 1UZCA 2K02A 4OMZA 1TQPA 2P0WA 2CV1A 2R7TA 3LQQA 2L2OA 1LB2A 1B4AA 1C0WA 4BJ6C 1K4SA 1U5TC 2CYYA 1U0JA 4WX9A 1IZ1A 2PG4A 2KIUA 2TRTA 2R7FA 5EYRA 1I27A 3BQZA 4HW0A 1P7IA 2ELJA 4IQ4A 4YEJA 3RPUA 2P7CB 3SEQA 2E1MB 1OR7C 4AIHA 1R00A 4HX8A 1T33A 5F27A 4RS8A 1OCPA 2UXXA 4O5VA 1YIOA 1JT0A 3PNYA 2LF7A 1YS7A 2IEKA 3NAUA 2HOSA 2WAEA 4MEXF 1VNDA 5IYBJ 1WJAA 2X9DA 3I71A 3DLLF 4QPOA 2DTRA 5M5YJ 2JA8J 1Q1VA 4B48A 3OYMA 4XRSA 4B8XA 3L2CA 4L9NA 3CCJI 1PP7U 2HEOA 2Y31A 5FD6A 2DA2A 4U0VA 4RA2A 5GTHC 1IRFA 2FQ3A 3RKXA 3ESWB 2VOOA 4ESJA 1H88C 1TBXA 1UAAA 5GTIC 4GO1A 1WVRA 1IN6A 3S17J 1T0FA 3VYTB 1MH4A 2NVYJ 4U7BA 2M45A 2NS7A 4DIQA 3IV5A 1SAXA 1U6GA 2BVLA 4AIJA 2EZKA 1JKOC 1YTYA 4DZJA 2R7RA 4A2UA 3TOAA 4KFCA 3DV8A 4XKWA 1IJWC 1WI3A 1SFUA 1Z6TA 5LRSA 2FJ1A 2X6OA 3HRSA 3K70C 5BOXA 3QPHA 4CICA 5ILUA 3Q0UA 3G6EI 1F1ZA 2A3SA 2M4GA 5CQEA 2R0QC 2LY2A 3BG6A 1RNLA 1MMGA 3DPUA 2D5VA 1XSDA 5AIPA 2W24A 4XMYA 2HQNA 2NS0A 3F22A 1MBKA 4RGRA 4XR6A 5K7FA 2Z99A 3JR9A 2KPMA 2OTJI 2DMPA 1XMAA 2ZMEA 2FMLA 4M72A 1OCZH 3LSGA 3TKYA 3ZQQA 2NVTJ 3M9AA 2L9RA 2V26A 2HYJA 4B3AA 1FWZA 3CJNA 3NWSA 1IN7A 2RV8A 3D5SC 1RZ4A 5L3DA 5EGOA 4K2EA 2OA4A 1QHHD 2XGCA 1NTCA 2VXDA 4P9UA 3WTWC 1WJ5A 3ECHA 2E36A 2RQPA 1YRNB 4JYKA 5J6XA 5D5WB 1TW2A 4UUSA 3BTJA 3JRDA 3PIPF 2YR2A 5BQTA 3EUAA 5FLMJ 1IAWA 3AG1H 3H9GA 3PL8A 2L3DA 2QQAA 4BL0B 4QWQA 1Z3YA 2WAQA 1B8IA 4B1RA 4PSWA 1WI9A 1XDSA 2W48A 4G6DA 1S8NA 2ZKZA 4U7DA 2AQFA 5IP9J 2ZB9A 1B1BA 4XSXF 2VQCA 5FKNA 1H9GA 3CUOA 3I3LA 4I02A 4HDUA 3KYLA 4G9YA 4XLPF 1VFCA 2F5FA 3OWTA 3ZPLA 1FP1D 1QZZA 4IRGA 2GWRA 4XBFA 2X48A 3X2QH 2JA6J 4D0PA 3QODA 2EQRA 2Y9ZA 2QVOA 5KHDA 5HS7A 2M87A 4CCOA 1I1GA 2V7FA 1POGA 3Q3SA 2MLKA 2GAUA 1JTYA 4MGRA 4IHXA 3M4OJ 2RNJA 3FIWA 3FMSA 2N8GA 3QPLA 2LKPA 1BC7C 4O3MA 2PMZA 4ABZA 3KYDB 2RQQA 3QWLA 4P96A 3AAFA 1R1TA 4UXNA 5IOZA 2X6XA 4MIMA 3D5LA 3FKJA 4A5NA 2DPUA 2XAJA 4FQGA 2QSHX 1GV5A 4KIGA 3IH4A 1WJCA 4IL6C 5IP6A 3F8MA 3KIOA 1HDPA 5CJ9A 3W2WA 2FXAA 4PJ0C 2X51A 1QRYA 3IC7A 3B73A 4EV0A 3ABLH 2IXSA 2BXYA 1M1EB 3TW7A 2IS4A 1ON2A 2E7WA 3V4GA 5K1YA 2XAQA 2HZTA 1L0OC 1MD0A 3B02A 1F5TA 2B9SA 1KGSA 1R4MB 2PX9A 2HI3A 1WJDA 2P6TA 5DEQA 2W7NA 1ZH5A 3KLOA 3TP0A 3HRTA 3DKXA 2O03A 3SZTA 5LLQA 5IYCJ 4M3FA 4E70A 1IDZA 1O57A 3WG7H 4Y15A 1PJRA 4BHBA 2E2IJ 3ULQB 3MQ0A 2P5KA 4PSXA 3PJRA 1IGNA 2IS2A 4BBSJ 4PGGA 2ZMEB 1IRGA 1JKPC 2QKMB 3FM5A 2KL4A 1AU7A 3QQAA 3CMYA 3AFHA 2XGDA 1VQOI 3PO2J 1IDYA 2OC6A 5DYMA 3QRFF 4IHWA 2LRDA 2XROA 5EGOB 3R4KA 4V2FA 2FD5A 3OOPA 4HSTA 5ED4A 1XB4A 4IO9F 4UB8C 3FMRA 2IS6A 5EJCA 1UB9A 3R0AA 2HPMA 2VE9A 4UUSB 1OLTA 2XHKA 4H4KC 2BE5F 3L2VA 2BHYA 2RKHA 2EPFA 2DCEA 1J09A 3WE3A 1FYMA 1KU3A 3SEZA 2GLOA 1IN5A 4MFDA 3ONQA 2Q2EA 1RIOH 2X1DA 1B8IB 1YI2I 4RGUA 4BXUA 4P9FA 2NS8A 1I5ZA 1H0MA 2HR3A 1DP3A 3IRQA 2BY3A 2HDDA 1KYZA 1R6RA 1X3ZB 1W1WE 2R4GA 4DQ2A 5JHFA 2EA4A 1YITI 4HNTA 4AIKA 5FB2A 3I55I 6PAXA 3OYJA 1YJNI 2DJNA 2P6SA 2E1NA 1ZTRA 2VKVA 4NUBA 1R58A 1EA3A 3CQZJ 2EZIA 5H2FC 3BPVA 3V42A 1ETKA 3VSLA 1T95A 1BA5A 1W0TA 3R0JA 5L3FA 1BW6A 1UMQA 1FLIA 2CUJA 2EH3A 3C7JA 4MTDA 2V1UA 1TNSA 2XF5A 2JSCA 1K6YA 1ZGWA 2Y0SA 3IKVA 1W4MA 4IX7A 3CLOA 2HVSA 2CMPA 4EATA 2MYSA 1NHAA 4A5MA 4EEFG 3TW6A 4A6DA 4D7NA 1B9MA 3RQ4A 1Z9CA 2IS1A 4YELA 4UB6C 4JP0A 2WA0A 3E5QA 3H36A 2ZFUA 3RKYA 2VC1A 2HVRA 3J7AO 3CESA 4M3BA 1VQKI 5FROA 4KNYA 2COMA 1YO5C 3L2RA 2WBMA 5C4JJ 1G3WA 1I39A 2XUBA 3ABTA 2DN0A 2R7SA 1R5ID 2JN6A 2NNNA 2BGCA 4BE1A 2ISZA 1FIAA 2Z5UA 2KHMA 3EUHC 3GO5A 4BJTA 2HDCA 1ZGJA 3K6GA 5M5XJ 2UUZA 5HLTA 3BP8A 5TRDA 3I4PA 1KZHA 2RN7A 2F48A 3GUDA 4H0EA 1SEUA 3MN2A 4Z2YA 4XRSG 2Q1ZB 2KZGA 1JI8A 4PUSA 2ZXJA 5HS9A 2IA1A 1KA8A 2ESNA 2P4WA 2BYVE 2UV1A 3H9JA 4GXOA 3L2QA 1Y1VJ 1Y1WJ 4BQAA 5EDNA 3LAPA 4RMNA 4O6JA 1Z7UA 2LVSA 5J47A 1BBYA 3MD2A 5DCMA 1MW7A 3L1PA 2EV0A 3FK7A 1IF1A 1FTZA 2EZLA 1RKWA 3VEPA 5A2QK 5KAIC 3E7LA 2VKDA 3I58A 3VSKA 2Q2EB 1J5YA 3WU2C 3M8JA 4X6AJ 3MMYB 3ASOH 3SYTA 2L54A 1D0YA 1VI0A 3J81Z 3DEEA 1PUEE 5HLGA 3CC2I 1WZ2A 1PDNC 4G6QA 3MCZA 3S3OA 5GPCA 3DTIA 1XX5A 1LVKA 1OQYA 5E1ZB 5D5XB 2MGQA 2LBFA 5CVVA 2LMDA 3KP7A 1HKQA 2NVUB 2CV0A 5IY5H 1EF4A 3WHBA 3OL4A 2QENA 2V9KA 4XRMA 1UJ8A 2ZSHB 3OYKA 2K9LA 4PZJA 4L9TA 2KRHA 3A0HC 3SFZA 2WAFA 2QWWA 2KIMA 2Q8KA 1TL8A 2LSOA 1ZRDA 1MZBA 3EPZA 3H3ZA 3K1MA 2R5ZA 3EYYA 1TWFJ 5BPIA 3LOCA 4HF2A 5C3EJ 5JHUA 2FU4A 3AG4H 5GAGJ 4XLAA 4IHVA 4G7HF 4JX5A 2XAGA 1T56A 4IXAA 3S1NJ 2RC4A 1RRJA 4FE7A 1P9QC 4HLXA 3E6MA 2RGVA 3FXMA 1QZEA 4EJTA 4MEYF 3DXJF 2OPTA 3BOQA 3DFGA 3ABMH 3W6VA 5CVRA 1MNDA 3VYSB 5FKOA 2FUG2 3KEQA 3RSNA 1G6NA 4ANJA 1BL0A 1FTTA 4GGGA 2DOAA 4E7JA 2DLLA 1Z1DA 4EGYA 3F8NA 1ZG3A 2EINH 3ZQHA 1S7EA 2RDPA 1X1AA 5ICGA 4ENKA 3GWZA 1PYVA 4NC6A 4E6KG 3H0DA 2X6WA 4OIPF 2DJIA 3LFUA 4NQWA 1LQ1A 3PSFA 4II2A 5GP9A 2C6YA 3L09A 4ZTJA 1HA8A 2E19A 2LFBA 1FIPA 1TT5B 1XMXA 2CRGA 3W6KB 1S29A 3SXYA 4FCYA 4C3HJ 1FT9A 3JCUC 3LSIA 2R3SA 4PJNA 3O3KA 2KJBA 1LDDA 4BXXJ 4MQ9F 1KONA 3HRMA 3ZMDA 1N77A 3MKYB 1WKMA 4D1QA 4Q4ZF 2E60A 2IBDA 2OU2A 2XSDC 4D7MA 1ODDA 1R36A 3IWFA 4BDYA 1T6SA 2DMTA 4MLOA 4LLNA 1JTXA 4LITA 4DW6A 5DCMB 2FNAA 2DO7A 2ECCA 2F5EA 1DP7P 2DOFA 4D9JA 4R1HA 4DJAA 4XOPA 2J5PA 3E5UA 2K40A 3FWEA 4ZDLA 5J4YA 4KISA 1VQ5I 2JQ7A 1LFBA 3ZCOA 5IOYA 1S6LA 5E17F 5EG0A 1UG0A 4Y3OA 2H94A 2ZC2A 1K78A 3CUQA 3GVAA 1YQAA 2W82A 3HGYA 5FLXZ 1JKRC 1W36D 4UUTA 3M8EA 1F9NA 4ZJZA 1ZQ3P 3IAM2 2HOTA 3GTGJ 5CVUA 2VONA 3GTOJ 4TV7A 4AVZA 3L00A 3CJRB 2Y2ZA 3IL2A 3CCRI 1D5YA 2WB1N 3HOTA 2KMUA 1Z0XA 5B1AH 2PI0A 3H3VK 4CSWA 3JRCA 3FM3A 4L0YB 2FBIA 4L0ZB 3D0SA 1SFOJ 3H1CA 5E20A 1O7LA 2VXZA 1ZRFA 4YIFA 1KU2A 4BBRJ 3AL0C 2R5ZB 5JLXA 4LD5A 2PJRA 2KT0A 2XKPA 5IT9Z 1QPMA 3OR1C 4Y7NJ 1RC9A 2OQGA 3JAMK 1YX5A 3WU1B 4C3IJ 3F6OA 5EZHA 5E1XA 4IHSA 2JSPA 3KFWX 4AIDA 1XS9A 2IAIA 3R60A 4V19K 3LA7A 2PBIA 5K5OA 3ASNH 3P9IA 4HG2A 3KP2A 3TO9A 3Q9SA 1A35A 3BR1A 4ZYDA 2O0YA 1IXRC 1I1SA 1VQ4I 4ZYAA 5FLVA 2QYOA 1R9TJ 1W0UA 3A4CA 3FXLA 1K6OA 1R1UA 2VI6A 3DLAA 3TQNA 2M8GX 2JZYA 1ON1A 2IGMA 4NQWB 1U9NA 3TMOA 5B3SH 2DA6A 1WH7A 2WWYA 2JT1A 3PSIA 3MWMA 2CGPA 3LSTA 1B72A 2EWNA 2LR8A 1LPQA 3QU3A 3AG2H 4L9JA 5DUIA 1KQ8A 3FHZA 3F8BA 1K7AA 3N05A 3SFIA 4B09A 2EZHA 4HA8A 2V1DA 1OYIA 1BI1A 3DWLE 3ZN1A 4U0YA 1A36A 2KRFA 2RVCA 3SHFA 1J2XA 3UNGC 1V5GA 1U5TA 5D6EA 2NVXJ 1F36A 2I10A 1OPCA 3M1EA 4KN7X 2LKXA 1MBHA 3UR3C 2ECBA 1MGTA 2IJLA 3CP8A 4DBRA 4RB2C 4RB0A 5J40A 1P92A 4Y17A 1SC7A 4HBLA 2O9LA 1APLC 5C44J 2RNGA 3K1PA 2FOKA 3HXLA 3KPHA 1TWGJ 1OR7A 3GTMJ 3HPGA 2WB1A 3CCUI 2BV6A 2L7KA 2DFFA 2LK2A 3S32A 5FKMA 1N78A 2VBXA 3HYIA 1XMKA 5EG0B 3HOXJ 2LY1A 2UZKA 2WC2A 1K78B 1NK2P 4G7OF 3CUQB 4N9HA 4RB3C 2EJRA 3OYNA 4RLQA 3QAHA 4P55A 1QGPA 1G3YA 2DTZA 3U1DA 2ZO4A 3ZMTA 4XQFA 2KISA 3ZXSA 1JJ8C 3WTYC 2GIVA 2X1CA 3TOBA 3MKWB 2YU9J 3RI4A 2DDBA 4R8HA 4YFXF 1ONVA 3FX3A 1MNMC 2AXTC 3EQLF 4NBQA 2ZJQF 3DCFA 2XIGA 3P5JA 3UKGA 4ZYGA 4N9IA 3WGHA 2W00A 2VT3A 3BQYA 2EFNA 3TL4X 2FA5A 2W4SA 2PJRB 1JUPA 1X3WB 5CKTA 4XLHA 3KETA 5DCFA 3ML6A 3DKWA 3OSGA 3ELKA 2WV1A 1OYWA 3WG9A 1XC5A 3HB9A 1X1DA 2MH2A 3OIOA 3GZ6A 4ZZLA 1U2WA 3O8GA 2K86A 3VFZA 3OY9A 4WXDA 4IRHA 2E5NA 2R7QA 5KCMA 4PFPA 2P8TA 3OL3A 2PN6A 3LL7A 1YE9A 3EYIA 1WH5A 2JMWA 4KA4A 1BJZA 4B47A 1JHFA 2LP0A 2VODA 1GVDA 2XKOA 2DMQA 2X1EA 4FASD 3HOVJ 1FMVA 2BZTA 3M07A 5K7ZA 1FBSA 1O4XA 2FEZA 3CC7I 4LB5A 1HDDC 1LDKB 2E34A 3GEZA 3CCEI 4AWXB 1ETVA 4HYEA 3S1MJ 3K4JA 4M3GA 3NEUA 4FX4A 1B72B 2R7XA 2HTJA 1X1BA 2X4HA 5IPAA 1TZLA 2A61A 4XKBA 2CW7A 4XLFA 5DV5A 5J1YA 4ENJA 4IKFA 1YJ9I 2V9PA 4II3A 3RPQA 1IXSB 2FSWA 1MKMA 3BG3A 2ZJRF 1VTNC 1PUFA 1U5TB 2AO9A 2O3FA 2M7BA 3V8LA 1J59A 1USSA 5ICEA 3V8JA 2E1OA 3RKWA 5EZGA 5HNFA 2LOOA 2XPVA 5D8LB 2PQ8A 3KZIC 2JVGA 2L02A 1SD4A 2GA1A 2COBA 4KIBA 1BI0A 1K83J 3L2WA 4A3IJ 1PP8F 9ANTA 4HV6A 1BR2A 1R5HA 3ZP5A 1LEBA 3K4CA 3K10A 2BY2A 3RKQA 4EM0B 3G1LA 4I01A 3HDDA 2DK5A 3M1CA 2A05A 2DU9A 5HOOA 4GFBA 2ELHA 2M3AA 4E7KA 1G4DA 3LSHA 5CPRB 5FJ8J 4NB5A 4KICA 2H1KA 2Y69H 2X6YA 3MAJA 1D1BA 2G0EA 2DFHA 1HW2A 1JT6A 4NNJA 3WTTC 5HODA 2W1OA 1FBUA 5F08A 1JKQC 2JRMA 1EJ9A 2M5WA 2Y75A 3WU0A 1T08B 4M9XA 5DS9A 3I56I 3BR2A 3I0TA 4RAGA 3VYUB 4WK8F 2RAEA 1D0XA 3CMEI 3IWZA 5CYVA 1L3LA 1H89C 3S93A 5KNLA 2KZVA 4A3EJ 1XD7A 3OYBA 3CDHA 5AIQA 4XICA 2FQ4A 4N4NB 3FXJA 5HS8A 2QKLB 4GRIA 1ZELA 3Q5FA 3PO3J 4IVNA 3NWTA 2H8WA 2VQLA 1KU9A 2ETHA 2BVMA 4AVPA 5F1JA 2PEXA 3KP3A 5E3NA 4Y13A 3U1KA 2YSRA 1FPQA 3H5RA 2KDOA 3CJQB 4E7ZA 3W2VA 2IP2A 1WQ2A 5FO5A 4A93J 3J7AY 4OWRB 5LEJA 4HAMA 3PQJA 4LB6B 2H6BA 2MG4A 4PJJA 3L2UA 2A5WA 2EFQA 1ETXA 3ERMA 3I54A 5FFXA 3WE2A 3FK6A 4JX4A 1JGSA 1X1CA 3KP6A 2Z33A 1AKHA 1V5FA 4RAFA 2E5ZA 2MABA 4Y52J 1EKEA 1ETQA 1A6QA 4Q5SF 4AM3A 4V2GA 2IA0A 3O8HA 3TEDA 2LLKA 3K2ZA 4EJWA 3S2HJ 5FKKA 4QIWN 3HKZN 5ILVA 3GBGA 4IRIA 3DKYA 4RB1A 1LEAA 2CV2A 3F3XA 1JXSA 2DMNA 3LMMA 3WTSC 2OF7A 1G3SA 1S7OA 2LD5A 3H5AA 1EH7A 5FRMA 1XG1A 4DNCA 1FYLA 3FISA 4HNUA 3CDLA 3BWGA 4AD9A 3CMMA 1PUFB 1D8JA 4OAZA 1P4AA 2A5YB 1ZGAA 2AQEA 3MZ8A 3HOWJ 3HL2A 1B9NA 2W84A 4EJOA 1Z6RA 4IJAA 2L9SA 1X19A 2JPBA 1IN4A 2KJCA 4XL9A 2P5VA 3PUBA 4EJUA 2M2EA 1BM9A 2DAOA 5B1BH 4DZPA 1VQLI 4QSHA 4OU0A 3HTSB 2O5RA 3K69A 1BR4A 2FRHA 3FXKA 5LGTA 3CO6C 3AKZA 3OYGA 2XAFA 3RTRA 3DBRB 2OTLI 2XASA 2MD0A 2VB6A 2NOGA 2L5QA 3IP4B 5F64A 1IV6A 2DXIA 3C18A 1HBXG 3HOZJ 2LKSA 1VQMI 2L7ZA 2CQQA 3G73A 4HNVA 1CQTA 4CHUA 3ZN0A 2O61A 3E0JB 1S9HA 2MFZA 2LC2A 3LA2A 3E6CC 3SJMA 1YHQI 4GDFA 2K9SA 1ZLKA 4M73A 5LGUA 1H8AC 3S2WA 3A1YA 4M6XA 5LHHA 1IG7A 1Z3XA 3N97A 1WFXA 1R49A 3GZNB 3LQRA 1UELB 4R79A 5M5WJ 1HC8A 3HBLA 1R1VA 3RZOJ 3HSFA 3S2DJ 2R7VA 1ZYRF 2GM4A 4GYGA 1X1PA 1WJBA 2NVQJ 2DFEA 5GAHJ 4A3JJ 2A6HF 2V1NA 3HKZA 2MSYA 4XM3A 4XORA 5DDGA 4P1WA 2H8RA 4DYRA 3JTHA 5E3MA 1WGXA 5F6FA 1BN5A 3BPXA 3EUHA 4XN3A 2QSFX 5F1RA 3PNTA 4U0WA 2DT5A 3QYFA 2MLGA 1A5JA 3I9V2 5HNHA 3SZGA 1MJBA 3GFMA 3E1SA 3S3NA 2DA7A 1FSEA 3C2GA 3HRUA 3SDBA 4A3DJ 3J80Z 1AKHB 1XGOA 1SD6A 2ZSIB 1MSEC 4YG2F 2XPUA 4C2UA 1ETYA 1FOWA 2XSJC 2OCCH 2O6GE 3IHUA 1R5GA 2FOWA 3RZDJ 2DYSH 2VBWA 3K0LA 3OYDA 2DA1A 2EK5A 1ZRCA 4ETSA 1RETA 2CSOA 1X3UA 5D5VB 2NAZA 5E3LA 3HHHA 4J19A 1HKTA 5DUKA 3C2HA 1P6RA 2LREA 3QOEA 1I6HJ 1FJLA 3QOPA 1UFMA 5HLHA 4G94A 2TCTA 2CW0F 4F93B 4KT6A 4I7HA 1LVAA 1ULYA 2VOPA 4LLGF 4YFNF 3HEFA 2VIXA 4CCLA 4LIUA 1W5TA 1MMNA 2A6EF 5J8CA 3HSRA 3HHGA 2NNYA 4GYIA 1BI2A 3MFKA 2EA2A 3F23A 3PUFA 3BG9A 3QPSA 1VQ9I 1IRZA 3WGIA 4MQVA 1W5CC 5JVGF 4NHJA 2OBPA 1FOXA 2V1XA 4UY8I 1KQ0A 2HNHA 5BS6A 1EV7A 2EB7A 2ZXIA 4OOIA 4CA0A 3O6BB 1QVTA 3M3YJ 1Z67A 5E79C 3R6SA 2YUSA 5TISC 4ITVA 4LK0F 5H20A 3RYRA 4AC0A 3MKLA 4DBQA 2HGCA 4A12A 4FX0A 4PGHA 4E7SA 3GXOA 2Y0MA 3HOYJ 2F4MB 1HW1A 1TP4A 2CW8A 2G7UA 4G8XA 4YFKF 4KN4X 3N4MA 3QU6A 3BCBA 3K2AA 3KLNA 4M9SA 2M0MA 2ACJA 4BE0A 3CCQI 1QPIA 4HQEA 3T5XA 2HZDA 2VJ5A 1IW7F 2BOLA 2IGNA 2GQQA 2MBFA 3DEWA 3DU6A 3SQNA 3S16J 2ME0A 1T98A 5K5RA 1IO2A 4WF2A 1QU3A 1VF9A 2BBYA 3KP5A 3DEUA 2Y30A 4IHYA 3BROA 1XGNA 2A69F 5JR3A 3CP2A 2E35A 1XCVA 2VC0A 5FFZA 2VPLA 1HOMA 1XSVA 2HQAA 1MMDA 4HOBA 1UG2A 2DDAA 4CCJA 1YX3A 3VYRB 3CD6I 3ZGKA 2ME6A 2CG4A 4RM2A 5EEGA 4BY1J 4Q47A 4EM1A 1AWCA 4KDPA 4KIFA 2GXBA 5J8FA 3LNQA 1ERDA 4S0HB 1SVOA 3A02A 1G2HA 2EIJH 2OZ6A 3IUOA 5ICFA 5KK1A 3ZOBA 4ESBA 1I50J 3JRGA 4J00A 1DU6A 3DTEA 2JUCA 1FOKA 5M3MJ 4M3DA 3B6AA 4LK1F 1R71A 1O3SA 3OYFA 3K4KA 4OIOF 1DQUA 3OV8A 2DFIA 4FETA 5JFRA 5D5UB 2X0LA 3SDGA 4CYDA 1QO0D 4ZYEA 4M6YA 4BQQA 3S1QJ 3FMQA 1VQ8I 1SMTA 3NRVA 1XCBA 2K27A 1ZLJA 3OYHA 3S15J 2HOAA 5J4VA 1WRJA 4LJZF 2DBBA 4M71A 2PMUA 1TQMA 1J75A 1ENHA 1UHSA 4N0BA 5CQGA 4LFUA 1A31A 2ZJ2A 3VODA 4KMFA 1YW7A 3BZKA 1W36C 2IGOA 2OJED 5LRRA 1FOYA 3QP5A 3AG3H 3TGNA 4UNOA 1E17A 1FMWA 2KRCA 3C1DA 2AHQA 5GADJ 1WJFA 1I3AA 4HDVA 2QQ8A 4I6ZA 1P4WA 4L9VA 1JHHA 4CH7A 4BH9A 3RIRA 1S72I 4C3JJ 1MJAA 1Y6IA 2AXLA 2LBFB 1FSHA 1TQIA 2FE3A 2K3FA 1R7JA 2TDXA 1MDMA 2KLOA 4M3EA 2E1MC 3ZR8X 3J7YJ 5L3EA 4JX6A 3L7WA 2CFOA 1W7PA 4A6EA 1SFEA 4A3GJ 1XTAA 1Z7LA 4L5EA 2VQGA 2JPCA 1DUXC 1S7AA 3DPLC 2XPWA 2HYGD 2VQHA 2FF4A 4QTRA 3HIFA 2XRNA 4BJ5C 4WCGA 1Y8RB 3PQKA 4MFEA 5HDGA 2O8XA 1LE8A 3DTKA 3OIQA 3MKZA 4BQNA 1GLNA 4EQQA 3F21A 2JK3A 1RR7A 1ETWA 3U2RA 3G71I 3BZCA 1O3QA 3CLQA 2CUZA 4KT5C 1E2XA 3BLYA 1MSFC 1V4RA 2F6CA 1ZHFA 3K4MA 3ERED 2QEXI 2M9HA 5KVRA 1TWCJ 4ZDOA 3K4LA 1KYWA 3BZ6A 4C2MJ 5EF6A 1QZYA 3OIPA 3ZQLA 2FNPA 3KZZA 5LHIA 1LDJA 5LGNA 3FKIJ 1EH6A 4FT8A 4DYCA 4YRVA 4KITB 4RDUA 2VBZA 5BPDA 3W6JB 3GTJJ 2HYFA 3KX2A 3BR3A 3FHNA 1TW3A 1QA6A 2IGKA 2B63J 5TJJA 2G9WA 2K4BA 4FISA 5JLWA 2EIKH 3ZQCA 2F4IA 1RUNA 1ACIA 2HTSA 4ENNA 4G12A 3CMAI 1Z05A 3IH2A 2EILH 1G3TA 2HS5A 2DMUA 2QZ8A 2R7DA 2I5UA 3ABKH 1E3PA 2M1BA 4B44A 1JE8A 1ZG1A 1VQNI 1A6IA 3RDIA 4LIVA 5HVQC 2ID6A 2QF7A 1V3FA 1P4XA 1LNWA 5H6QA 4S04A 3J81K 1I6XA 4PFOA 1ZKGA 4F55A 1O3TA 3OYEA 2V9VA 1CF7A 1VQ6I 2VL8A 4EJVA 2GBYA 2IPQX 2JA5J 1ORKA 4I0BA 1FEXA 2QCOA 1WCMJ 2EFWA 4BAYA 3RYPA 3ZMZA 2BXZA 4P5OA 4EMSA 2CS3A 2OV7A 1ZR2A 1KU7A 1DGWY 2VN2A 4ZYHA 2ZCWA 2F5DA 4PDKA 4KJZA 2L4AA 2JA2A 3OS0A 3GTPJ 2YS9A 1XN7A 2P81A 4KUMA 4HLYA 2CU7A 3ZMVA 5DM6F 4A3CJ 2EIMH 3TP3A 3E6DA 4HSRA 1NK3P 2HKOA 2YU3A 1RUOA 1BIBA 1SFKA 4E7IA 1MDMB 3G4SI 4UV8A 1RI7A 4I98B 3CTAA 5HLIA 1W7PB 4BEHA 2VASA 1LJ9A 3WODF 4ZDPA 3B6CA 3ZRGA 4EM2A 2VT2A 1G59A 2DT7B 2CFXA 3MZYA 5J1RA 2D1VA 5FRNA 3WTVC 4WXCA 3AL0B 3JRIA 2HVQA 1SMYF 1Y0NA 4XK4A 4RLFA 2VLAA 4WXHA 3HZJA 2BW3A 3RPUD 2WAQN 1LE8B 4UHTA 1SANA 1HKSA 1MBFA 3WTXC 1FP2A 2V4JC 3VPRA 2OCEA 1BOAA 2XVCA 2DODA 1LUJB 3GZ5A 5F0FA 1YS6A 4UV9A 1D8KA 3E5XA 4BUPA 2K9QA 4IEJA 4BNCA 4X1EA 1T0FC 2KP6A 1GXQA 4LLLA 2NYXA 3P9CA 3CO7C 2JWTA 2VKHA 2YX4A 2QSGX 1YW8A 3T8RA 1HF0A 3MEXA 4M9ZA 1RPWA 2PMZN 1HSJA 2F5VA 1U8RA 1K61A 3V7CA 4PJLA 5DTDA 3BJ6A 4BHPA 3J7ZI 3IH3A 2XDVA 2L9NA 3ROUA 3LWFA 3GFIA 2CUFA 1U9OA 3W3CA 2V79A 3IKTA 3RQIA 2K3PA 3HTUA 5IP7J 3RCOA 3JREA 3KEOA 3S1RJ 1OCTC 2DA3A 2DA5A 1WWXA 2M30A 4A69C 1YLFA 2ZMEC 2IRFG 3K70D 1ZAOA 3BG7A 1Y39A 2B0LA 2JVHA 2MH9A 1ZG5A 1B59A 1WHUA 5ERIA 2WTEA 3Q0VA 4JQFA 1ZR4A 4F91B 5LFAA 1VQ7I 3GX4X 2PLYA 2EV6A 1R22A 5FLXK 3VOEA 2M34A 1CF7B 2J5OA 5DM7F 1GVJA 5L3GA 1DPRA 3JSPA 3K4NA 3PM1A 5F0HA 2DA4A 3A01A 2DQLA 1NG6A 4UVBA 3I59A 5EEHA 5F0CA 3OYIA 1HCRA 2KQRA 3A0BC 4CZCA 2JTVA 5E1WA 2HQRA 4BHCA 3KEYA 3TDZC 4LG0A 1FY7A 4RAYA 3OYAA 4ZTFA 3M8FA 3I53A 5DD4A 4BGDA 3FBNB 2E2HJ 4CCMA 1TNTA 2L01A 1Y56A 4A3KJ 1MBEA 3IAS2 1V55H 3GFLA 1SD5A 4I0AA 2QUFA 1OJLA 1MH3A 4ASNA 4E7LA 1JUMA 3G2BA 2QLZA 4A0XA 4J01A 2HXIA 5IT9K 2XF6A 4I2OA 2Q0OA 3OOUA 1SVMA 1HLVA 3D1NI 1FNNA 5J1UA 3BTIA 4E4HA 5A2QZ 1GXPA 4C2TA 4BEHB 1EH8A 2XGEA 3NQOA 4XN0A 4UUVA 1GHCA 3JSOA 3HOUJ 2XAUA 1YOVB 5ICCA 1ZK8A 2VJIA 3MZHA 2CQ7A 1S3JA 3GTQJ 1J9IA 4FE4A 1Z21A 4DYQA 2A07F 1VQPI 1D0ZA 1TWHJ 2CQKA 1XGMA 3U21A 2BW3B 1OMIA 2K4JA 4CXFA 3OYCA 1OKRA 3CF2A 3HOSA 3SZPA 4MHGA 4Z6YA 2STWA 4B4CA 3LSMA 2K85A 4IZZA 4BE2A 1RESA 2CQXA 3ZMUA 3P7NA 2L4MA 1R4NB 2HQ5A 4PCQA 5B5EC 2ELKA 1Q1HA 1USTA 4ZZDA 4ESFA 1BIAA 1REPC 4A0YA 2VKEA 2E7XA 5KAFC 2F2EA 2JRTA 3DBLB 1W5SA 3V8KA 4M74A 2M4KA 3KCCA 1E0EA 4IOCF 2IT0A 1YYVA 2Z16A 3L9FA 1MMSA 2Y0SN 2QBYA 3F9KA 1T38A 3FXRA 2OZUA 3LSRA 2DT6A 3FZVA 3TBIA 5J3LA 5GAEJ 2BY1A 1XDUA 2QQBA 4A3BJ 3GYHX 3FDYA 1ZN2A 5C4XJ 2CQNA 3QYEA 1Y8QB 4ENMA 3CC4I 4C30A 3CCSI 2EFOA 4OINF 4XONA 1BI3A 3ZQ7A 2LG4A 2I8DA 3M7GA 1XPXA 4W97A 1X4PA 3FXOA 2UXNA 2KFDA 2YX7A 3EUKL 2ESHA 3BTLA 2DI3A 1U78A 3E3VA 2HPIA 1X2NA 1R23A 2ZXWH 1V5EA 2KDZA 1XSXA 3F72A 4YIIA 3LAJA 1FYKA 2ICWG 4BDZA 1RR8C 4F7ZA 4LMYA 4HEA2 4RGXA 2LTPA 4BYYA 4UVAA 3A01B 1F4KA 4AU7A 3I59B 1YIJI 3WTZA 2Z2SB 3H3UA 4OIQF 1V54H 1P7JA 3C2BA 3VDXA 3BDDA 4LG0B 3QPTA 1GT0C 3ISPA 1QHGA 5E18F 3HM5A 1Y0UA 3T8TA 3Q0WA 4CCKA 2R7ZJ 1LKXA 2GA2A 2H1LA 5F04A 4U88A 3I4MJ 3H92A 3GW2A 4HX4A 1OCCH 5LHGA 2HU9A 1D3YA 2UWMA 3BR5A 5TGTA 1FZPB 4G7ZF 4XOTA 2H09A 1O7FA 5EEAA 3HUGA 5E3OA 2K7LA 5FKLA 1BJAA 3HSEA 5JI6A 2ISYA 3GFJA 3NARA 5AONA 1KQ9A 3ABUA 3WGGA 4A0ZA 1QNTA 3ECOA 1QVUA 4Q48A 5K5QA 3COAC 2HOEA 1IN8A 2WY7Q 4PK4A 3LFKA 1H9TA 4WWCA 4F92B 1MMAA 3G3ZA 1ZREA 4OMYA 1MNEA 1TLHB 4BY7J 5CVJA 1UHWA 1TC3C 1B6AA 1GV2A 2IW5A 4XLNF 3CCLI 2BEOA 2O8KA 5D8KB 4NC8A 4IF4A 4C9YA 2CH0A 2XF7A 2P7VB 5LD2C 2LY9A 3HJEA 2HWVA 1K4TA 2W57A 5JVTA 2NOJB 3KE2A 2A68F 1AA7A 3JAMZ 1DU0A 2QBYB 4BACA 2RREA 4DOZA 4XKVA 5B66C 1QBJA 2KIFA 1ZARA 2W25A 2R92J 1X58A 2FBHA 4LGWA 5FGMA 3OYLA 3R61A 5D4SA 1GDTA 2OQRA 1ETOA 4ZC3A 4F3QA 3CF5F 2R93J 4GCVA 2L7MP 3Q9VA 3FBIB 3I64A 2HXOA 2K9NA 2KIQA 2IA2A 1PVEA 3KP4A 1LFUP 4IHTA 4AYBN 3T1BA 2DW4A 1WPKA 2R7OA 2L0KA 4QPQA 3F6VA 2QA4I 1P2FA 5HDNA 4W1UA 1OFCX 4M6VA 3H35A 3DBHB 4KMUX 1BR1A 2F4OB 2CWEA 4JK1X 1FC3A 3H5NA 5DD8A 3W2AA 4OAYA 1I3QJ 1HXDA 4CYCA 4I99C 2VJ4A 3ZMSA 3CCVI 1U8BA 4LG3A 4OIRF 2X85A 4HPQA 2ID3A 4UVCA 2MW8A 3K4BA 1SAUA 2BY0A 3REOA 4B43A 1DGRM 4CUGA 2EBIA 2R5YA 4JBAA 3CJTB 1YFHA 1E3OC 3S8PA 3JRFA 3ZQFA 3I5UA 2CO5A 2ZFWA 3S14J 3ZQGA 4ZH4F 2FX0A 3BC8A 2A6TA 2WY8Q 4IPAA 4XLEA 4EGZA 1MJ9A 1SFXA 3GTKJ 4U87A 3JRAA 2DQRA 2DYRH 4Y4RA 2FBKA 3OS2A 2GIZA 4G6TB 3S3MA 2VBYA 2XGXA 5D4RA 4XIDA 3HG9A 2Z9OA 3HUGB 3GF2A 1IRXA 3MVPA 5BMZA 1YW9A 4RAZA 3OMYA 1UHMA 4BQOA 3HC7A 3K7AJ 2JA7J 1WJEA 2HKXA 2R7WA 3CDIA 4NC7A 2MC4A 3LSPA 1DDNA 5CLSA 4QLCU 3JTGA 1N75A 1J0RA 1RKTA 2QQ9A 5LBQA 3FXUA 4N4OB 1X4OA 1VZ0A 5M3FJ 4F52A 2STTA 1X2MA 2EFPA 3HPHA 3LSJA 3E97A 3GLLA 3RJPA 4XRFA 3BG5A 2L9VA 2JJ7A 3DQVC 4A3LJ 3I4NJ 2XV4S 2F5CA 2K5CA 3O2PE 3U9GA 4X0GA 4AYBA 3JRBA 1Z77A 1MIJA 2DPDA 2BHZA 2D45A 2PJPA 4A3MJ 3BR0A 2GOXB 2DK8A 2WV0A 5H6RA 4CO8A 2QGUA 2YPRA 3PIOF 2LH9A 3PFYA 1XGSA 3K1NA 4LOCA 5E8GA 2FMYA 3KYCB 3FXQA 5IT3A 1AOYA 3GLXA 1D1AA 4DGWB 2ZJPF 1YJWI 2Y9YA 3QP6A 1AHDP 2DOEA 2OUMA 3OR2C 3H9QA 2E1CA 2D1HA 2VE8A 1IUFA 3LSKA 1T39A 3FF5A 4B3XA 4BU2A 1F43A 3DF8A 2W85A 2XRLA 3TO6A 2Z1DA 1O3RA 4HF1A 2M7AA 3BR6A 2D2WA 2Y48A 1T2KA 1NH3A 1IC8A 3TO7A 3OS1A 4HZFA 4IOAF 4Y33A 3EDPA 2MD5A 2ZNYA 1HQCA 1SD7A 2PFBA 3VWBA 1JJ6C 3KZYA 2O7OA 2NRAC 4MNUA 1QQIA 3PNVA 3G1OA 2VUMJ 2WADA 1IUYA 2IVMA 3BCAA 2JUGA 2GZWA 4E7HA 4CYCB 1JGGA 1T8IA 3DPTA 5BNGA 4CDGA 2GXGA 2M0CA 3V7RA 1LFPA 1OISA 1Z91A 2VJJA 4EVIA 1IXCA 3T0YA 1K79A 3JW4A 4HRIA 1A04A 2EV5A 1NG7A 1HSTA 1TTYA 4I09A 2E2JJ 1DPUA 2R5YB 5D6FA 2CUEA 3CZ6A 3WHCA 4PJMA 3V7SA 4BKXA 4BXFA 2V6EA 1ITYA 3EETA 1FX7A 5GPAA 3IRRA 4ON0A 4KYWA 4AUXA 2ZBKA 1STZA 1N25A 4L5JA 1BC8C 3WTUC 2H6CA 1TWAJ 1BOBA 4RBOA 4FHTA 4L5IA 2VPRA 3F8CA 1U3EM 3CUQC 4XKCA 3GTLJ 5HDKA 5IYDJ 4D5FA 1E3HA 3GMEA 4FTHA 2KKOA 4NDLA 2MA3A 2LDUA 3P9KA 3ZQIA 1UCRA 2GOMA 1S5LC 3C3WA 4IQJA 3PFIA 2ADUA 3TDUC 2ZNZA 2M8EA 3BJOA 1BW5A 3E6BA 2AS5F 2LNBA 4RGSA 1OCOH 4XLCA 1YG2A 2CJJA 5ILSA 2R7UA 2B7EA 2QM3A 2XC7A 1TT0A 3GCMA 5L3CA 3BT9A 4A3FJ 5L3BA 2L7FP 2XB0X 5LEKA 3D5RC 4YIRX 3J80K 3F8FA 3BY6A 5CVIA 5E8IA 3DP7A 2NXNB 1JUSA 1W7PD 1GUUA 3G1MA 4XSZF 2G7HA 4XNFA 4S05A 2GXAA 1OCRH 3DU5A 1OYYA 2LYCA 5FD5A 4CZZA 2V6CA 3A2KA 3OSFA 4CGZA 2ZXHA 1MBGA
chains in the Genus database with same CATH topology
1TWFJ 3LOCA 3Q0VA 5C3EJ 3JRHA 3F0CA 1ZR4A 4IHVA 2NOGA 2M34A 4JX5A 1T56A 3S1NJ 3HOZJ 4FE7A 3PM1A 5F0HA 2DA4A 3H0GJ 3A01A 3CCYA 5K7HA 2L7ZA 3HGGA 2CQQA 5F0CA 2OPTA 1MBJA 4I76A 4HNVA 1CQTA 1HCRA 3W6VA 5FKOA 3SJMA 1BL0A 1FTTA 2K9SA 2E2HJ 1H8AC 3A03A 4D5CA 2XB5A 4A3KJ 3ZQHA 1MBEA 4MO7A 1IG7A 1S7EA 3BTCA 1OJLA 1MH3A 1JUMA 1YRNA 5M5WJ 3HBLA 2HXIA 3OOUA 1HLVA 3D1NI 5J1UA 3BTIA 3S2DJ 3RZOJ 5GP9A 2XGEA 2GM4A 2TRTA 2NVQJ 2E19A 2LFBA 1FIPA 5EYRA 2CRGA 4A3JJ 3HOUJ 2MSYA 4FCYA 1ZK8A 3BQZA 4C3HJ 1P7IA 3GTQJ 2H8RA 4FE4A 4DYRA 4DYQA 5E3MA 1WGXA 4BXXJ 1TWHJ 1T33A 1A5JA 2IBDA 2XSDC 5F27A 4D7MA 1OCPA 4B4CA 2DA7A 2DMTA 4MLOA 1JT0A 1JTXA 1RESA 2CQXA 4A3DJ 4DW6A 2IEKA 1AKHB 3NAUA 2ECCA 2HQ5A 2HOSA 1MSEC 2XPUA 1VNDA 1ETYA 2ELKA 2X9DA 5IYBJ 2VKEA 5M5YJ 2JA8J 3RZDJ 1Q1VA 2K40A 2DA1A 1RETA 1LFBA 4XRSA 5IOYA 5E3LA 4J19A 5EG0A 2Y31A 1I6HJ 2DA2A 1FJLA 3HGYA 1JKRC 2TCTA 1H88C 2Y0SN 4UUTA 1ZQ3P 3LSRA 2HOTA 3GTGJ 3S17J 3HEFA 5J3LA 1MH4A 2NVYJ 3GTOJ 4A3BJ 5C4XJ 2NS7A 2Y2ZA 3IV5A 3BG9A 2EZKA 3QPSA 1IRZA 1JKOC 4DZJA 1D5YA 2WB1N 1IJWC 1Z0XA 1WI3A 3H3VK 4W97A 3JRCA 2FJ1A 1SFOJ 2X6OA 1QVTA 3M3YJ 3BTLA 4BBRJ 2R5ZB 2YUSA 5JLXA 3Q0UA 1U78A 1X2NA 2R0QC 2KT0A 4AC0A 3MKLA 4Y7NJ 2KDZA 2D5VA 4C3IJ 2LTPA 1MBKA 5EZHA 5K7FA 3A01B 3JR9A 2DMPA 1XS9A 2IAIA 3HOYJ 3LSGA 2NVTJ 2L9RA 1P7JA 2HYJA 3C2BA 4B3AA 3BR1A 1GT0C 3K2AA 3HM5A 5EGOA 5FLVA 3Q0WA 2XGCA 1R9TJ 1W0UA 1NTCA 2R7ZJ 1QPIA 2VI6A 1YRNB 4JYKA 5F04A 3DEWA 3I4MJ 2M8GX 4UUSA 3BTJA 3S16J 2ME0A 3JRDA 1VF9A 3BR5A 1U9NA 2Y30A 2DA6A 1WH7A 4IHYA 5FLMJ 5EEAA 5E3OA 1B72A 5FKLA 2LR8A 1HOMA 1B8IA 3NARA 4B1RA 2W48A 1UG2A 3SFIA 2EZHA 2ME6A 5IP9J 2ZB9A 4BY1J 5FKNA 1QVUA 3LNQA 4S0HB 2NVXJ 1F36A 3A02A 1VFCA 1G2HA 1DU6A 3JRGA 3ZOBA 2I10A 1I50J 2LKXA 1MBHA 2ECBA 2X48A 2JA6J 5M3MJ 4BY7J 2EQRA 4M3DA 3B6AA 2O9LA 1APLC 5C44J 2Y9ZA 1TC3C 3SDGA 1GV2A 2O8KA 1POGA 1TWGJ 3Q3SA 3GTMJ 1JTYA 4IHXA 3M4OJ 3S1QJ 3FIWA 2N8GA 3QPLA 3S15J 2HOAA 2LK2A 4ABZA 2LY9A 5FKMA 3HOXJ 1ENHA 1UHSA 5EG0B 1NK2P 5IOZA 4MIMA 1DU0A 2DTZA 1GV5A 2R92J 1X58A 3IH4A 5IP6A 1JJ8C 1HDPA 1QRYA 1GDTA 2YU9J 1ETOA 2AHQA 2R93J 2L7MP 2HXOA 3TW7A 1MNMC 2K9NA 4I6ZA 1LFUP 4AYBN 1WPKA 3DCFA 2HI3A 2L0KA 4C3JJ 4W1UA 1OFCX 4M6VA 3UKGA 3TP0A 3BQYA 4M3EA 5IYCJ 4M3FA 1JUPA 4JX6A 1IDZA 3OSGA 1I3QJ 4CYCA 4A3GJ 4L5EA 1U8BA 2WV1A 2E2IJ 1IV6A 1XC5A 3HB9A 3OIOA 1IGNA 2XPWA 4BBSJ 3O8GA 2ID3A 1JKPC 2MW8A 1AU7A 4QTRA 3QQAA 3CMYA 2EBIA 2R5YA 2XGDA 1E3OC 3PO2J 1IDYA 4MFEA 3JRFA 3ZQFA 1WH5A 2JMWA 1LE8A 4IHWA 1BJZA 2LP0A 5EGOB 4V2FA 2FD5A 3S14J 1GVDA 3ZQGA 2DMQA 2FX0A 2JK3A 3HOVJ 5K7ZA 1RR7A 1O4XA 1ETWA 3GTKJ 3JRAA 1HDDC 4UUSB 1MSFC 1ETVA 4XIDA 3S1MJ 4M3GA 2GLOA 3MVPA 4MFDA 1B72B 2M9HA 5IPAA 1TWCJ 5J1YA 4C2MJ 5EF6A 1B8IB 3K7AJ 2JA7J 2NS8A 3ZQLA 3LSPA 2HDDA 3FKIJ 4DYCA 3BG3A 4RDUA 1PUFA 3GTJJ 1RKTA 3BR3A 2AO9A 2DJNA 5M3FJ 1ZTRA 2B63J 2VKVA 5JLWA 4FISA 1X2MA 3ZQCA 3CQZJ 2EZIA 2E1OA 3LSJA 5EZGA 1ETKA 3BG5A 4G12A 3IH2A 1BA5A 2XPVA 2JJ7A 1W0TA 2DMUA 1BW6A 1UMQA 3I4NJ 4A3LJ 2EH3A 1A6IA 2COBA 1Z77A 3JRBA 1K83J 4A3IJ 9ANTA 1ZGWA 4A3MJ 3BR0A 2ID6A 2QF7A 3RKQA 1ZKGA 3HDDA 3G1LA 4EEFG 3TW6A 4D7NA 4LOCA 4GFBA 5FJ8J 2GBYA 2JA5J 2H1KA 1ORKA 4JP0A 1FEXA 2G0EA 1WCMJ 2QCOA 1JT6A 2Y9YA 5HODA 1AHDP 5F08A 1JKQC 1ZR2A 4M3BA 1IUFA 5DS9A 3BR2A 3GTPJ 1F43A 2RAEA 2XRLA 2P81A 2YS9A 5C4JJ 3BR6A 2CU7A 4A3CJ 1H89C 1IC8A 4A3EJ 3TP3A 2DN0A 4XICA 2FQ4A 1NK3P 2JN6A 1FIAA 1JJ6C 2O7OA 3PO3J 3G1OA 2VUMJ 5M5XJ 4CYCB 1JGGA 5F1JA 3B6CA 5E3NA 5BNGA 2M0CA 5J1RA 3JRIA 4XK4A 2E2JJ 2R5YB 3MN2A 4XRSG 4A93J 2CUEA 2WAQN 3WHCA 4BKXA 1LE8B 1ITYA 5GPAA 2MG4A 4AUXA 1Y1WJ 1SANA 1ETXA 1Y1VJ 1MBFA 5EDNA 3FK6A 1TWAJ 4JX4A 3VPRA 2LVSA 4RBOA 1AKHA 2VPRA 3L1PA 4Y52J 3FK7A 1ETQA 5F0FA 3GTLJ 5IYDJ 4D5FA 4V2GA 1FTZA 2EZLA 3TEDA 3O8HA 1RKWA 2K9QA 2LLKA 4IEJA 4NDLA 4FTHA 3E7LA 3S2HJ 5FKKA 4X1EA 4QIWN 3HKZN 3ZQIA 3GBGA 2JWTA 4X6AJ 2DMNA 1BW5A 2OF7A 2LD5A 1VI0A 1XG1A 1HF0A 1RPWA 3FISA 5GPCA 2CJJA 3CDLA 2PMZN 2MGQA 1PUFB 3BT9A 1K61A 4A3FJ 2L7FP 5DTDA 3HOWJ 2XB0X 1EF4A 3IH3A 3WHBA 4XRMA 2CUFA 1U9OA 1JUSA 3G1MA 1GUUA 3RQIA 5IP7J 2M2EA 3JREA 3S1RJ 4DZPA 1OCTC 2DA3A 2DA5A 4QSHA 4A69C 2R5ZA 3OSFA 1MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF J;  3LOC A;  3Q0V A;  5C3E J;  3JRH A;  3F0C A;  1ZR4 A;  4IHV A;  2NOG A;  2M34 A;  4JX5 A;  1T56 A;  3S1N J;  3HOZ J;  4FE7 A;  3PM1 A;  5F0H A;  2DA4 A;  3H0G J;  3A01 A;  3CCY A;  5K7H A;  2L7Z A;  3HGG A;  2CQQ A;  5F0C A;  2OPT A;  1MBJ A;  4I76 A;  4HNV A;  1CQT A;  1HCR A;  3W6V A;  5FKO A;  3SJM A;  1BL0 A;  1FTT A;  2K9S A;  2E2H J;  1H8A C;  3A03 A;  4D5C A;  2XB5 A;  4A3K J;  3ZQH A;  1MBE A;  4MO7 A;  1IG7 A;  1S7E A;  3BTC A;  1OJL A;  1MH3 A;  1JUM A;  1YRN A;  5M5W J;  3HBL A;  2HXI A;  3OOU A;  1HLV A;  3D1N I;  5J1U A;  3BTI A;  3S2D J;  3RZO J;  5GP9 A;  2XGE A;  2GM4 A;  2TRT A;  2NVQ J;  2E19 A;  2LFB A;  1FIP A;  5EYR A;  2CRG A;  4A3J J;  3HOU J;  2MSY A;  4FCY A;  1ZK8 A;  3BQZ A;  4C3H J;  1P7I A;  3GTQ J;  2H8R A;  4FE4 A;  4DYR A;  4DYQ A;  5E3M A;  1WGX A;  4BXX J;  1TWH J;  1T33 A;  1A5J A;  2IBD A;  2XSD C;  5F27 A;  4D7M A;  1OCP A;  4B4C A;  2DA7 A;  2DMT A;  4MLO A;  1JT0 A;  1JTX A;  1RES A;  2CQX A;  4A3D J;  4DW6 A;  2IEK A;  1AKH B;  3NAU A;  2ECC A;  2HQ5 A;  2HOS A;  1MSE C;  2XPU A;  1VND A;  1ETY A;  2ELK A;  2X9D A;  5IYB J;  2VKE A;  5M5Y J;  2JA8 J;  3RZD J;  1Q1V A;  2K40 A;  2DA1 A;  1RET A;  1LFB A;  4XRS A;  5IOY A;  5E3L A;  4J19 A;  5EG0 A;  2Y31 A;  1I6H J;  2DA2 A;  1FJL A;  3HGY A;  1JKR C;  2TCT A;  1H88 C;  2Y0S N;  4UUT A;  1ZQ3 P;  3LSR A;  2HOT A;  3GTG J;  3S17 J;  3HEF A;  5J3L A;  1MH4 A;  2NVY J;  3GTO J;  4A3B J;  5C4X J;  2NS7 A;  2Y2Z A;  3IV5 A;  3BG9 A;  2EZK A;  3QPS A;  1IRZ A;  1JKO C;  4DZJ A;  1D5Y A;  2WB1 N;  1IJW C;  1Z0X A;  1WI3 A;  3H3V K;  4W97 A;  3JRC A;  2FJ1 A;  1SFO J;  2X6O A;  1QVT A;  3M3Y J;  3BTL A;  4BBR J;  2R5Z B;  2YUS A;  5JLX A;  3Q0U A;  1U78 A;  1X2N A;  2R0Q C;  2KT0 A;  4AC0 A;  3MKL A;  4Y7N J;  2KDZ A;  2D5V A;  4C3I J;  2LTP A;  1MBK A;  5EZH A;  5K7F A;  3A01 B;  3JR9 A;  2DMP A;  1XS9 A;  2IAI A;  3HOY J;  3LSG A;  2NVT J;  2L9R A;  1P7J A;  2HYJ A;  3C2B A;  4B3A A;  3BR1 A;  1GT0 C;  3K2A A;  3HM5 A;  5EGO A;  5FLV A;  3Q0W A;  2XGC A;  1R9T J;  1W0U A;  1NTC A;  2R7Z J;  1QPI A;  2VI6 A;  1YRN B;  4JYK A;  5F04 A;  3DEW A;  3I4M J;  2M8G X;  4UUS A;  3BTJ A;  3S16 J;  2ME0 A;  3JRD A;  1VF9 A;  3BR5 A;  1U9N A;  2Y30 A;  2DA6 A;  1WH7 A;  4IHY A;  5FLM J;  5EEA A;  5E3O A;  1B72 A;  5FKL A;  2LR8 A;  1HOM A;  1B8I A;  3NAR A;  4B1R A;  2W48 A;  1UG2 A;  3SFI A;  2EZH A;  2ME6 A;  5IP9 J;  2ZB9 A;  4BY1 J;  5FKN A;  1QVU A;  3LNQ A;  4S0H B;  2NVX J;  1F36 A;  3A02 A;  1VFC A;  1G2H A;  1DU6 A;  3JRG A;  3ZOB A;  2I10 A;  1I50 J;  2LKX A;  1MBH A;  2ECB A;  2X48 A;  2JA6 J;  5M3M J;  4BY7 J;  2EQR A;  4M3D A;  3B6A A;  2O9L A;  1APL C;  5C44 J;  2Y9Z A;  1TC3 C;  3SDG A;  1GV2 A;  2O8K A;  1POG A;  1TWG J;  3Q3S A;  3GTM J;  1JTY A;  4IHX A;  3M4O J;  3S1Q J;  3FIW A;  2N8G A;  3QPL A;  3S15 J;  2HOA A;  2LK2 A;  4ABZ A;  2LY9 A;  5FKM A;  3HOX J;  1ENH A;  1UHS A;  5EG0 B;  1NK2 P;  5IOZ A;  4MIM A;  1DU0 A;  2DTZ A;  1GV5 A;  2R92 J;  1X58 A;  3IH4 A;  5IP6 A;  1JJ8 C;  1HDP A;  1QRY A;  1GDT A;  2YU9 J;  1ETO A;  2AHQ A;  2R93 J;  2L7M P;  2HXO A;  3TW7 A;  1MNM C;  2K9N A;  4I6Z A;  1LFU P;  4AYB N;  1WPK A;  3DCF A;  2HI3 A;  2L0K A;  4C3J J;  4W1U A;  1OFC X;  4M6V A;  3UKG A;  3TP0 A;  3BQY A;  4M3E A;  5IYC J;  4M3F A;  1JUP A;  4JX6 A;  1IDZ A;  3OSG A;  1I3Q J;  4CYC A;  4A3G J;  4L5E A;  1U8B A;  2WV1 A;  2E2I J;  1IV6 A;  1XC5 A;  3HB9 A;  3OIO A;  1IGN A;  2XPW A;  4BBS J;  3O8G A;  2ID3 A;  1JKP C;  2MW8 A;  1AU7 A;  4QTR A;  3QQA A;  3CMY A;  2EBI A;  2R5Y A;  2XGD A;  1E3O C;  3PO2 J;  1IDY A;  4MFE A;  3JRF A;  3ZQF A;  1WH5 A;  2JMW A;  1LE8 A;  4IHW A;  1BJZ A;  2LP0 A;  5EGO B;  4V2F A;  2FD5 A;  3S14 J;  1GVD A;  3ZQG A;  2DMQ A;  2FX0 A;  2JK3 A;  3HOV J;  5K7Z A;  1RR7 A;  1O4X A;  1ETW A;  3GTK J;  3JRA A;  1HDD C;  4UUS B;  1MSF C;  1ETV A;  4XID A;  3S1M J;  4M3G A;  2GLO A;  3MVP A;  4MFD A;  1B72 B;  2M9H A;  5IPA A;  1TWC J;  5J1Y A;  4C2M J;  5EF6 A;  1B8I B;  3K7A J;  2JA7 J;  2NS8 A;  3ZQL A;  3LSP A;  2HDD A;  3FKI J;  4DYC A;  3BG3 A;  4RDU A;  1PUF A;  3GTJ J;  1RKT A;  3BR3 A;  2AO9 A;  2DJN A;  5M3F J;  1ZTR A;  2B63 J;  2VKV A;  5JLW A;  4FIS A;  1X2M A;  3ZQC A;  3CQZ J;  2EZI A;  2E1O A;  3LSJ A;  5EZG A;  1ETK A;  3BG5 A;  4G12 A;  3IH2 A;  1BA5 A;  2XPV A;  2JJ7 A;  1W0T A;  2DMU A;  1BW6 A;  1UMQ A;  3I4N J;  4A3L J;  2EH3 A;  1A6I A;  2COB A;  1Z77 A;  3JRB A;  1K83 J;  4A3I J;  9ANT A;  1ZGW A;  4A3M J;  3BR0 A;  2ID6 A;  2QF7 A;  3RKQ A;  1ZKG A;  3HDD A;  3G1L A;  4EEF G;  3TW6 A;  4D7N A;  4LOC A;  4GFB A;  5FJ8 J;  2GBY A;  2JA5 J;  2H1K A;  1ORK A;  4JP0 A;  1FEX A;  2G0E A;  1WCM J;  2QCO A;  1JT6 A;  2Y9Y A;  5HOD A;  1AHD P;  5F08 A;  1JKQ C;  1ZR2 A;  4M3B A;  1IUF A;  5DS9 A;  3BR2 A;  3GTP J;  1F43 A;  2RAE A;  2XRL A;  2P81 A;  2YS9 A;  5C4J J;  3BR6 A;  2CU7 A;  4A3C J;  1H89 C;  1IC8 A;  4A3E J;  3TP3 A;  2DN0 A;  4XIC A;  2FQ4 A;  1NK3 P;  2JN6 A;  1FIA A;  1JJ6 C;  2O7O A;  3PO3 J;  3G1O A;  2VUM J;  5M5X J;  4CYC B;  1JGG A;  5F1J A;  3B6C A;  5E3N A;  5BNG A;  2M0C A;  5J1R A;  3JRI A;  4XK4 A;  2E2J J;  2R5Y B;  3MN2 A;  4XRS G;  4A93 J;  2CUE A;  2WAQ N;  3WHC A;  4BKX A;  1LE8 B;  1ITY A;  5GPA A;  2MG4 A;  4AUX A;  1Y1W J;  1SAN A;  1ETX A;  1Y1V J;  1MBF A;  5EDN A;  3FK6 A;  1TWA J;  4JX4 A;  3VPR A;  2LVS A;  4RBO A;  1AKH A;  2VPR A;  3L1P A;  4Y52 J;  3FK7 A;  1ETQ A;  5F0F A;  3GTL J;  5IYD J;  4D5F A;  4V2G A;  1FTZ A;  2EZL A;  3TED A;  3O8H A;  1RKW A;  2K9Q A;  2LLK A;  4IEJ A;  4NDL A;  4FTH A;  3E7L A;  3S2H J;  5FKK A;  4X1E A;  4QIW N;  3HKZ N;  3ZQI A;  3GBG A;  2JWT A;  4X6A J;  2DMN A;  1BW5 A;  2OF7 A;  2LD5 A;  1VI0 A;  1XG1 A;  1HF0 A;  1RPW A;  3FIS A;  5GPC A;  2CJJ A;  3CDL A;  2PMZ N;  2MGQ A;  1PUF B;  3BT9 A;  1K61 A;  4A3F J;  2L7F P;  5DTD A;  3HOW J;  2XB0 X;  1EF4 A;  3IH3 A;  3WHB A;  4XRM A;  2CUF A;  1U9O A;  1JUS A;  3G1M A;  1GUU A;  3RQI A;  5IP7 J;  2M2E A;  3JRE A;  3S1R J;  4DZP A;  1OCT C;  2DA3 A;  2DA5 A;  4QSH A;  4A69 C;  2R5Z A;  3OSF A;  1MBG A; 
#chains in the Genus database with same CATH topology
 4MTE A;  2H27 A;  3JRH A;  4JOM A;  3F0C A;  4L18 B;  4CCN A;  3LA3 A;  2Z3Y A;  3VB2 A;  3QYB A;  1IV8 A;  4HX7 A;  1D5V A;  2OD5 A;  4HV5 A;  4BS9 A;  3H0G J;  3CCY A;  5K7H A;  3HGG A;  3K9T A;  3CCM I;  1MBJ A;  4I76 A;  2HDW A;  2MC3 A;  2OAZ A;  2P5L C;  1SVL A;  4RM3 A;  1D1C A;  1CGP A;  2K9M A;  4HF0 A;  1WSU A;  3BJA A;  1FBQ A;  2E71 A;  2PMH A;  1G8X A;  3A03 A;  4HQM A;  4D5C A;  2XB5 A;  4MO7 A;  2XAH A;  2LF8 A;  3BTC A;  1YRN A;  1J7K A;  2HFH A;  1HW5 A;  1UZC A;  2K02 A;  4OMZ A;  1TQP A;  2P0W A;  2CV1 A;  2R7T A;  3LQQ A;  2L2O A;  1LB2 A;  1B4A A;  1C0W A;  4BJ6 C;  1K4S A;  1U5T C;  2CYY A;  1U0J A;  4WX9 A;  1IZ1 A;  2PG4 A;  2KIU A;  2TRT A;  2R7F A;  5EYR A;  1I27 A;  3BQZ A;  4HW0 A;  1P7I A;  2ELJ A;  4IQ4 A;  4YEJ A;  3RPU A;  2P7C B;  3SEQ A;  2E1M B;  1OR7 C;  4AIH A;  1R00 A;  4HX8 A;  1T33 A;  5F27 A;  4RS8 A;  1OCP A;  2UXX A;  4O5V A;  1YIO A;  1JT0 A;  3PNY A;  2LF7 A;  1YS7 A;  2IEK A;  3NAU A;  2HOS A;  2WAE A;  4MEX F;  1VND A;  5IYB J;  1WJA A;  2X9D A;  3I71 A;  3DLL F;  4QPO A;  2DTR A;  5M5Y J;  2JA8 J;  1Q1V A;  4B48 A;  3OYM A;  4XRS A;  4B8X A;  3L2C A;  4L9N A;  3CCJ I;  1PP7 U;  2HEO A;  2Y31 A;  5FD6 A;  2DA2 A;  4U0V A;  4RA2 A;  5GTH C;  1IRF A;  2FQ3 A;  3RKX A;  3ESW B;  2VOO A;  4ESJ A;  1H88 C;  1TBX A;  1UAA A;  5GTI C;  4GO1 A;  1WVR A;  1IN6 A;  3S17 J;  1T0F A;  3VYT B;  1MH4 A;  2NVY J;  4U7B A;  2M45 A;  2NS7 A;  4DIQ A;  3IV5 A;  1SAX A;  1U6G A;  2BVL A;  4AIJ A;  2EZK A;  1JKO C;  1YTY A;  4DZJ A;  2R7R A;  4A2U A;  3TOA A;  4KFC A;  3DV8 A;  4XKW A;  1IJW C;  1WI3 A;  1SFU A;  1Z6T A;  5LRS A;  2FJ1 A;  2X6O A;  3HRS A;  3K70 C;  5BOX A;  3QPH A;  4CIC A;  5ILU A;  3Q0U A;  3G6E I;  1F1Z A;  2A3S A;  2M4G A;  5CQE A;  2R0Q C;  2LY2 A;  3BG6 A;  1RNL A;  1MMG A;  3DPU A;  2D5V A;  1XSD A;  5AIP A;  2W24 A;  4XMY A;  2HQN A;  2NS0 A;  3F22 A;  1MBK A;  4RGR A;  4XR6 A;  5K7F A;  2Z99 A;  3JR9 A;  2KPM A;  2OTJ I;  2DMP A;  1XMA A;  2ZME A;  2FML A;  4M72 A;  1OCZ H;  3LSG A;  3TKY A;  3ZQQ A;  2NVT J;  3M9A A;  2L9R A;  2V26 A;  2HYJ A;  4B3A A;  1FWZ A;  3CJN A;  3NWS A;  1IN7 A;  2RV8 A;  3D5S C;  1RZ4 A;  5L3D A;  5EGO A;  4K2E A;  2OA4 A;  1QHH D;  2XGC A;  1NTC A;  2VXD A;  4P9U A;  3WTW C;  1WJ5 A;  3ECH A;  2E36 A;  2RQP A;  1YRN B;  4JYK A;  5J6X A;  5D5W B;  1TW2 A;  4UUS A;  3BTJ A;  3JRD A;  3PIP F;  2YR2 A;  5BQT A;  3EUA A;  5FLM J;  1IAW A;  3AG1 H;  3H9G A;  3PL8 A;  2L3D A;  2QQA A;  4BL0 B;  4QWQ A;  1Z3Y A;  2WAQ A;  1B8I A;  4B1R A;  4PSW A;  1WI9 A;  1XDS A;  2W48 A;  4G6D A;  1S8N A;  2ZKZ A;  4U7D A;  2AQF A;  5IP9 J;  2ZB9 A;  1B1B A;  4XSX F;  2VQC A;  5FKN A;  1H9G A;  3CUO A;  3I3L A;  4I02 A;  4HDU A;  3KYL A;  4G9Y A;  4XLP F;  1VFC A;  2F5F A;  3OWT A;  3ZPL A;  1FP1 D;  1QZZ A;  4IRG A;  2GWR A;  4XBF A;  2X48 A;  3X2Q H;  2JA6 J;  4D0P A;  3QOD A;  2EQR A;  2Y9Z A;  2QVO A;  5KHD A;  5HS7 A;  2M87 A;  4CCO A;  1I1G A;  2V7F A;  1POG A;  3Q3S A;  2MLK A;  2GAU A;  1JTY A;  4MGR A;  4IHX A;  3M4O J;  2RNJ A;  3FIW A;  3FMS A;  2N8G A;  3QPL A;  2LKP A;  1BC7 C;  4O3M A;  2PMZ A;  4ABZ A;  3KYD B;  2RQQ A;  3QWL A;  4P96 A;  3AAF A;  1R1T A;  4UXN A;  5IOZ A;  2X6X A;  4MIM A;  3D5L A;  3FKJ A;  4A5N A;  2DPU A;  2XAJ A;  4FQG A;  2QSH X;  1GV5 A;  4KIG A;  3IH4 A;  1WJC A;  4IL6 C;  5IP6 A;  3F8M A;  3KIO A;  1HDP A;  5CJ9 A;  3W2W A;  2FXA A;  4PJ0 C;  2X51 A;  1QRY A;  3IC7 A;  3B73 A;  4EV0 A;  3ABL H;  2IXS A;  2BXY A;  1M1E B;  3TW7 A;  2IS4 A;  1ON2 A;  2E7W A;  3V4G A;  5K1Y A;  2XAQ A;  2HZT A;  1L0O C;  1MD0 A;  3B02 A;  1F5T A;  2B9S A;  1KGS A;  1R4M B;  2PX9 A;  2HI3 A;  1WJD A;  2P6T A;  5DEQ A;  2W7N A;  1ZH5 A;  3KLO A;  3TP0 A;  3HRT A;  3DKX A;  2O03 A;  3SZT A;  5LLQ A;  5IYC J;  4M3F A;  4E70 A;  1IDZ A;  1O57 A;  3WG7 H;  4Y15 A;  1PJR A;  4BHB A;  2E2I J;  3ULQ B;  3MQ0 A;  2P5K A;  4PSX A;  3PJR A;  1IGN A;  2IS2 A;  4BBS J;  4PGG A;  2ZME B;  1IRG A;  1JKP C;  2QKM B;  3FM5 A;  2KL4 A;  1AU7 A;  3QQA A;  3CMY A;  3AFH A;  2XGD A;  1VQO I;  3PO2 J;  1IDY A;  2OC6 A;  5DYM A;  3QRF F;  4IHW A;  2LRD A;  2XRO A;  5EGO B;  3R4K A;  4V2F A;  2FD5 A;  3OOP A;  4HST A;  5ED4 A;  1XB4 A;  4IO9 F;  4UB8 C;  3FMR A;  2IS6 A;  5EJC A;  1UB9 A;  3R0A A;  2HPM A;  2VE9 A;  4UUS B;  1OLT A;  2XHK A;  4H4K C;  2BE5 F;  3L2V A;  2BHY A;  2RKH A;  2EPF A;  2DCE A;  1J09 A;  3WE3 A;  1FYM A;  1KU3 A;  3SEZ A;  2GLO A;  1IN5 A;  4MFD A;  3ONQ A;  2Q2E A;  1RIO H;  2X1D A;  1B8I B;  1YI2 I;  4RGU A;  4BXU A;  4P9F A;  2NS8 A;  1I5Z A;  1H0M A;  2HR3 A;  1DP3 A;  3IRQ A;  2BY3 A;  2HDD A;  1KYZ A;  1R6R A;  1X3Z B;  1W1W E;  2R4G A;  4DQ2 A;  5JHF A;  2EA4 A;  1YIT I;  4HNT A;  4AIK A;  5FB2 A;  3I55 I;  6PAX A;  3OYJ A;  1YJN I;  2DJN A;  2P6S A;  2E1N A;  1ZTR A;  2VKV A;  4NUB A;  1R58 A;  1EA3 A;  3CQZ J;  2EZI A;  5H2F C;  3BPV A;  3V42 A;  1ETK A;  3VSL A;  1T95 A;  1BA5 A;  1W0T A;  3R0J A;  5L3F A;  1BW6 A;  1UMQ A;  1FLI A;  2CUJ A;  2EH3 A;  3C7J A;  4MTD A;  2V1U A;  1TNS A;  2XF5 A;  2JSC A;  1K6Y A;  1ZGW A;  2Y0S A;  3IKV A;  1W4M A;  4IX7 A;  3CLO A;  2HVS A;  2CMP A;  4EAT A;  2MYS A;  1NHA A;  4A5M A;  4EEF G;  3TW6 A;  4A6D A;  4D7N A;  1B9M A;  3RQ4 A;  1Z9C A;  2IS1 A;  4YEL A;  4UB6 C;  4JP0 A;  2WA0 A;  3E5Q A;  3H36 A;  2ZFU A;  3RKY A;  2VC1 A;  2HVR A;  3J7A O;  3CES A;  4M3B A;  1VQK I;  5FRO A;  4KNY A;  2COM A;  1YO5 C;  3L2R A;  2WBM A;  5C4J J;  1G3W A;  1I39 A;  2XUB A;  3ABT A;  2DN0 A;  2R7S A;  1R5I D;  2JN6 A;  2NNN A;  2BGC A;  4BE1 A;  2ISZ A;  1FIA A;  2Z5U A;  2KHM A;  3EUH C;  3GO5 A;  4BJT A;  2HDC A;  1ZGJ A;  3K6G A;  5M5X J;  2UUZ A;  5HLT A;  3BP8 A;  5TRD A;  3I4P A;  1KZH A;  2RN7 A;  2F48 A;  3GUD A;  4H0E A;  1SEU A;  3MN2 A;  4Z2Y A;  4XRS G;  2Q1Z B;  2KZG A;  1JI8 A;  4PUS A;  2ZXJ A;  5HS9 A;  2IA1 A;  1KA8 A;  2ESN A;  2P4W A;  2BYV E;  2UV1 A;  3H9J A;  4GXO A;  3L2Q A;  1Y1V J;  1Y1W J;  4BQA A;  5EDN A;  3LAP A;  4RMN A;  4O6J A;  1Z7U A;  2LVS A;  5J47 A;  1BBY A;  3MD2 A;  5DCM A;  1MW7 A;  3L1P A;  2EV0 A;  3FK7 A;  1IF1 A;  1FTZ A;  2EZL A;  1RKW A;  3VEP A;  5A2Q K;  5KAI C;  3E7L A;  2VKD A;  3I58 A;  3VSK A;  2Q2E B;  1J5Y A;  3WU2 C;  3M8J A;  4X6A J;  3MMY B;  3ASO H;  3SYT A;  2L54 A;  1D0Y A;  1VI0 A;  3J81 Z;  3DEE A;  1PUE E;  5HLG A;  3CC2 I;  1WZ2 A;  1PDN C;  4G6Q A;  3MCZ A;  3S3O A;  5GPC A;  3DTI A;  1XX5 A;  1LVK A;  1OQY A;  5E1Z B;  5D5X B;  2MGQ A;  2LBF A;  5CVV A;  2LMD A;  3KP7 A;  1HKQ A;  2NVU B;  2CV0 A;  5IY5 H;  1EF4 A;  3WHB A;  3OL4 A;  2QEN A;  2V9K A;  4XRM A;  1UJ8 A;  2ZSH B;  3OYK A;  2K9L A;  4PZJ A;  4L9T A;  2KRH A;  3A0H C;  3SFZ A;  2WAF A;  2QWW A;  2KIM A;  2Q8K A;  1TL8 A;  2LSO A;  1ZRD A;  1MZB A;  3EPZ A;  3H3Z A;  3K1M A;  2R5Z A;  3EYY A;  1TWF J;  5BPI A;  3LOC A;  4HF2 A;  5C3E J;  5JHU A;  2FU4 A;  3AG4 H;  5GAG J;  4XLA A;  4IHV A;  4G7H F;  4JX5 A;  2XAG A;  1T56 A;  4IXA A;  3S1N J;  2RC4 A;  1RRJ A;  4FE7 A;  1P9Q C;  4HLX A;  3E6M A;  2RGV A;  3FXM A;  1QZE A;  4EJT A;  4MEY F;  3DXJ F;  2OPT A;  3BOQ A;  3DFG A;  3ABM H;  3W6V A;  5CVR A;  1MND A;  3VYS B;  5FKO A;  2FUG 2;  3KEQ A;  3RSN A;  1G6N A;  4ANJ A;  1BL0 A;  1FTT A;  4GGG A;  2DOA A;  4E7J A;  2DLL A;  1Z1D A;  4EGY A;  3F8N A;  1ZG3 A;  2EIN H;  3ZQH A;  1S7E A;  2RDP A;  1X1A A;  5ICG A;  4ENK A;  3GWZ A;  1PYV A;  4NC6 A;  4E6K G;  3H0D A;  2X6W A;  4OIP F;  2DJI A;  3LFU A;  4NQW A;  1LQ1 A;  3PSF A;  4II2 A;  5GP9 A;  2C6Y A;  3L09 A;  4ZTJ A;  1HA8 A;  2E19 A;  2LFB A;  1FIP A;  1TT5 B;  1XMX A;  2CRG A;  3W6K B;  1S29 A;  3SXY A;  4FCY A;  4C3H J;  1FT9 A;  3JCU C;  3LSI A;  2R3S A;  4PJN A;  3O3K A;  2KJB A;  1LDD A;  4BXX J;  4MQ9 F;  1KON A;  3HRM A;  3ZMD A;  1N77 A;  3MKY B;  1WKM A;  4D1Q A;  4Q4Z F;  2E60 A;  2IBD A;  2OU2 A;  2XSD C;  4D7M A;  1ODD A;  1R36 A;  3IWF A;  4BDY A;  1T6S A;  2DMT A;  4MLO A;  4LLN A;  1JTX A;  4LIT A;  4DW6 A;  5DCM B;  2FNA A;  2DO7 A;  2ECC A;  2F5E A;  1DP7 P;  2DOF A;  4D9J A;  4R1H A;  4DJA A;  4XOP A;  2J5P A;  3E5U A;  2K40 A;  3FWE A;  4ZDL A;  5J4Y A;  4KIS A;  1VQ5 I;  2JQ7 A;  1LFB A;  3ZCO A;  5IOY A;  1S6L A;  5E17 F;  5EG0 A;  1UG0 A;  4Y3O A;  2H94 A;  2ZC2 A;  1K78 A;  3CUQ A;  3GVA A;  1YQA A;  2W82 A;  3HGY A;  5FLX Z;  1JKR C;  1W36 D;  4UUT A;  3M8E A;  1F9N A;  4ZJZ A;  1ZQ3 P;  3IAM 2;  2HOT A;  3GTG J;  5CVU A;  2VON A;  3GTO J;  4TV7 A;  4AVZ A;  3L00 A;  3CJR B;  2Y2Z A;  3IL2 A;  3CCR I;  1D5Y A;  2WB1 N;  3HOT A;  2KMU A;  1Z0X A;  5B1A H;  2PI0 A;  3H3V K;  4CSW A;  3JRC A;  3FM3 A;  4L0Y B;  2FBI A;  4L0Z B;  3D0S A;  1SFO J;  3H1C A;  5E20 A;  1O7L A;  2VXZ A;  1ZRF A;  4YIF A;  1KU2 A;  4BBR J;  3AL0 C;  2R5Z B;  5JLX A;  4LD5 A;  2PJR A;  2KT0 A;  2XKP A;  5IT9 Z;  1QPM A;  3OR1 C;  4Y7N J;  1RC9 A;  2OQG A;  3JAM K;  1YX5 A;  3WU1 B;  4C3I J;  3F6O A;  5EZH A;  5E1X A;  4IHS A;  2JSP A;  3KFW X;  4AID A;  1XS9 A;  2IAI A;  3R60 A;  4V19 K;  3LA7 A;  2PBI A;  5K5O A;  3ASN H;  3P9I A;  4HG2 A;  3KP2 A;  3TO9 A;  3Q9S A;  1A35 A;  3BR1 A;  4ZYD A;  2O0Y A;  1IXR C;  1I1S A;  1VQ4 I;  4ZYA A;  5FLV A;  2QYO A;  1R9T J;  1W0U A;  3A4C A;  3FXL A;  1K6O A;  1R1U A;  2VI6 A;  3DLA A;  3TQN A;  2M8G X;  2JZY A;  1ON1 A;  2IGM A;  4NQW B;  1U9N A;  3TMO A;  5B3S H;  2DA6 A;  1WH7 A;  2WWY A;  2JT1 A;  3PSI A;  3MWM A;  2CGP A;  3LST A;  1B72 A;  2EWN A;  2LR8 A;  1LPQ A;  3QU3 A;  3AG2 H;  4L9J A;  5DUI A;  1KQ8 A;  3FHZ A;  3F8B A;  1K7A A;  3N05 A;  3SFI A;  4B09 A;  2EZH A;  4HA8 A;  2V1D A;  1OYI A;  1BI1 A;  3DWL E;  3ZN1 A;  4U0Y A;  1A36 A;  2KRF A;  2RVC A;  3SHF A;  1J2X A;  3UNG C;  1V5G A;  1U5T A;  5D6E A;  2NVX J;  1F36 A;  2I10 A;  1OPC A;  3M1E A;  4KN7 X;  2LKX A;  1MBH A;  3UR3 C;  2ECB A;  1MGT A;  2IJL A;  3CP8 A;  4DBR A;  4RB2 C;  4RB0 A;  5J40 A;  1P92 A;  4Y17 A;  1SC7 A;  4HBL A;  2O9L A;  1APL C;  5C44 J;  2RNG A;  3K1P A;  2FOK A;  3HXL A;  3KPH A;  1TWG J;  1OR7 A;  3GTM J;  3HPG A;  2WB1 A;  3CCU I;  2BV6 A;  2L7K A;  2DFF A;  2LK2 A;  3S32 A;  5FKM A;  1N78 A;  2VBX A;  3HYI A;  1XMK A;  5EG0 B;  3HOX J;  2LY1 A;  2UZK A;  2WC2 A;  1K78 B;  1NK2 P;  4G7O F;  3CUQ B;  4N9H A;  4RB3 C;  2EJR A;  3OYN A;  4RLQ A;  3QAH A;  4P55 A;  1QGP A;  1G3Y A;  2DTZ A;  3U1D A;  2ZO4 A;  3ZMT A;  4XQF A;  2KIS A;  3ZXS A;  1JJ8 C;  3WTY C;  2GIV A;  2X1C A;  3TOB A;  3MKW B;  2YU9 J;  3RI4 A;  2DDB A;  4R8H A;  4YFX F;  1ONV A;  3FX3 A;  1MNM C;  2AXT C;  3EQL F;  4NBQ A;  2ZJQ F;  3DCF A;  2XIG A;  3P5J A;  3UKG A;  4ZYG A;  4N9I A;  3WGH A;  2W00 A;  2VT3 A;  3BQY A;  2EFN A;  3TL4 X;  2FA5 A;  2W4S A;  2PJR B;  1JUP A;  1X3W B;  5CKT A;  4XLH A;  3KET A;  5DCF A;  3ML6 A;  3DKW A;  3OSG A;  3ELK A;  2WV1 A;  1OYW A;  3WG9 A;  1XC5 A;  3HB9 A;  1X1D A;  2MH2 A;  3OIO A;  3GZ6 A;  4ZZL A;  1U2W A;  3O8G A;  2K86 A;  3VFZ A;  3OY9 A;  4WXD A;  4IRH A;  2E5N A;  2R7Q A;  5KCM A;  4PFP A;  2P8T A;  3OL3 A;  2PN6 A;  3LL7 A;  1YE9 A;  3EYI A;  1WH5 A;  2JMW A;  4KA4 A;  1BJZ A;  4B47 A;  1JHF A;  2LP0 A;  2VOD A;  1GVD A;  2XKO A;  2DMQ A;  2X1E A;  4FAS D;  3HOV J;  1FMV A;  2BZT A;  3M07 A;  5K7Z A;  1FBS A;  1O4X A;  2FEZ A;  3CC7 I;  4LB5 A;  1HDD C;  1LDK B;  2E34 A;  3GEZ A;  3CCE I;  4AWX B;  1ETV A;  4HYE A;  3S1M J;  3K4J A;  4M3G A;  3NEU A;  4FX4 A;  1B72 B;  2R7X A;  2HTJ A;  1X1B A;  2X4H A;  5IPA A;  1TZL A;  2A61 A;  4XKB A;  2CW7 A;  4XLF A;  5DV5 A;  5J1Y A;  4ENJ A;  4IKF A;  1YJ9 I;  2V9P A;  4II3 A;  3RPQ A;  1IXS B;  2FSW A;  1MKM A;  3BG3 A;  2ZJR F;  1VTN C;  1PUF A;  1U5T B;  2AO9 A;  2O3F A;  2M7B A;  3V8L A;  1J59 A;  1USS A;  5ICE A;  3V8J A;  2E1O A;  3RKW A;  5EZG A;  5HNF A;  2LOO A;  2XPV A;  5D8L B;  2PQ8 A;  3KZI C;  2JVG A;  2L02 A;  1SD4 A;  2GA1 A;  2COB A;  4KIB A;  1BI0 A;  1K83 J;  3L2W A;  4A3I J;  1PP8 F;  9ANT A;  4HV6 A;  1BR2 A;  1R5H A;  3ZP5 A;  1LEB A;  3K4C A;  3K10 A;  2BY2 A;  3RKQ A;  4EM0 B;  3G1L A;  4I01 A;  3HDD A;  2DK5 A;  3M1C A;  2A05 A;  2DU9 A;  5HOO A;  4GFB A;  2ELH A;  2M3A A;  4E7K A;  1G4D A;  3LSH A;  5CPR B;  5FJ8 J;  4NB5 A;  4KIC A;  2H1K A;  2Y69 H;  2X6Y A;  3MAJ A;  1D1B A;  2G0E A;  2DFH A;  1HW2 A;  1JT6 A;  4NNJ A;  3WTT C;  5HOD A;  2W1O A;  1FBU A;  5F08 A;  1JKQ C;  2JRM A;  1EJ9 A;  2M5W A;  2Y75 A;  3WU0 A;  1T08 B;  4M9X A;  5DS9 A;  3I56 I;  3BR2 A;  3I0T A;  4RAG A;  3VYU B;  4WK8 F;  2RAE A;  1D0X A;  3CME I;  3IWZ A;  5CYV A;  1L3L A;  1H89 C;  3S93 A;  5KNL A;  2KZV A;  4A3E J;  1XD7 A;  3OYB A;  3CDH A;  5AIQ A;  4XIC A;  2FQ4 A;  4N4N B;  3FXJ A;  5HS8 A;  2QKL B;  4GRI A;  1ZEL A;  3Q5F A;  3PO3 J;  4IVN A;  3NWT A;  2H8W A;  2VQL A;  1KU9 A;  2ETH A;  2BVM A;  4AVP A;  5F1J A;  2PEX A;  3KP3 A;  5E3N A;  4Y13 A;  3U1K A;  2YSR A;  1FPQ A;  3H5R A;  2KDO A;  3CJQ B;  4E7Z A;  3W2V A;  2IP2 A;  1WQ2 A;  5FO5 A;  4A93 J;  3J7A Y;  4OWR B;  5LEJ A;  4HAM A;  3PQJ A;  4LB6 B;  2H6B A;  2MG4 A;  4PJJ A;  3L2U A;  2A5W A;  2EFQ A;  1ETX A;  3ERM A;  3I54 A;  5FFX A;  3WE2 A;  3FK6 A;  4JX4 A;  1JGS A;  1X1C A;  3KP6 A;  2Z33 A;  1AKH A;  1V5F A;  4RAF A;  2E5Z A;  2MAB A;  4Y52 J;  1EKE A;  1ETQ A;  1A6Q A;  4Q5S F;  4AM3 A;  4V2G A;  2IA0 A;  3O8H A;  3TED A;  2LLK A;  3K2Z A;  4EJW A;  3S2H J;  5FKK A;  4QIW N;  3HKZ N;  5ILV A;  3GBG A;  4IRI A;  3DKY A;  4RB1 A;  1LEA A;  2CV2 A;  3F3X A;  1JXS A;  2DMN A;  3LMM A;  3WTS C;  2OF7 A;  1G3S A;  1S7O A;  2LD5 A;  3H5A A;  1EH7 A;  5FRM A;  1XG1 A;  4DNC A;  1FYL A;  3FIS A;  4HNU A;  3CDL A;  3BWG A;  4AD9 A;  3CMM A;  1PUF B;  1D8J A;  4OAZ A;  1P4A A;  2A5Y B;  1ZGA A;  2AQE A;  3MZ8 A;  3HOW J;  3HL2 A;  1B9N A;  2W84 A;  4EJO A;  1Z6R A;  4IJA A;  2L9S A;  1X19 A;  2JPB A;  1IN4 A;  2KJC A;  4XL9 A;  2P5V A;  3PUB A;  4EJU A;  2M2E A;  1BM9 A;  2DAO A;  5B1B H;  4DZP A;  1VQL I;  4QSH A;  4OU0 A;  3HTS B;  2O5R A;  3K69 A;  1BR4 A;  2FRH A;  3FXK A;  5LGT A;  3CO6 C;  3AKZ A;  3OYG A;  2XAF A;  3RTR A;  3DBR B;  2OTL I;  2XAS A;  2MD0 A;  2VB6 A;  2NOG A;  2L5Q A;  3IP4 B;  5F64 A;  1IV6 A;  2DXI A;  3C18 A;  1HBX G;  3HOZ J;  2LKS A;  1VQM I;  2L7Z A;  2CQQ A;  3G73 A;  4HNV A;  1CQT A;  4CHU A;  3ZN0 A;  2O61 A;  3E0J B;  1S9H A;  2MFZ A;  2LC2 A;  3LA2 A;  3E6C C;  3SJM A;  1YHQ I;  4GDF A;  2K9S A;  1ZLK A;  4M73 A;  5LGU A;  1H8A C;  3S2W A;  3A1Y A;  4M6X A;  5LHH A;  1IG7 A;  1Z3X A;  3N97 A;  1WFX A;  1R49 A;  3GZN B;  3LQR A;  1UEL B;  4R79 A;  5M5W J;  1HC8 A;  3HBL A;  1R1V A;  3RZO J;  3HSF A;  3S2D J;  2R7V A;  1ZYR F;  2GM4 A;  4GYG A;  1X1P A;  1WJB A;  2NVQ J;  2DFE A;  5GAH J;  4A3J J;  2A6H F;  2V1N A;  3HKZ A;  2MSY A;  4XM3 A;  4XOR A;  5DDG A;  4P1W A;  2H8R A;  4DYR A;  3JTH A;  5E3M A;  1WGX A;  5F6F A;  1BN5 A;  3BPX A;  3EUH A;  4XN3 A;  2QSF X;  5F1R A;  3PNT A;  4U0W A;  2DT5 A;  3QYF A;  2MLG A;  1A5J A;  3I9V 2;  5HNH A;  3SZG A;  1MJB A;  3GFM A;  3E1S A;  3S3N A;  2DA7 A;  1FSE A;  3C2G A;  3HRU A;  3SDB A;  4A3D J;  3J80 Z;  1AKH B;  1XGO A;  1SD6 A;  2ZSI B;  1MSE C;  4YG2 F;  2XPU A;  4C2U A;  1ETY A;  1FOW A;  2XSJ C;  2OCC H;  2O6G E;  3IHU A;  1R5G A;  2FOW A;  3RZD J;  2DYS H;  2VBW A;  3K0L A;  3OYD A;  2DA1 A;  2EK5 A;  1ZRC A;  4ETS A;  1RET A;  2CSO A;  1X3U A;  5D5V B;  2NAZ A;  5E3L A;  3HHH A;  4J19 A;  1HKT A;  5DUK A;  3C2H A;  1P6R A;  2LRE A;  3QOE A;  1I6H J;  1FJL A;  3QOP A;  1UFM A;  5HLH A;  4G94 A;  2TCT A;  2CW0 F;  4F93 B;  4KT6 A;  4I7H A;  1LVA A;  1ULY A;  2VOP A;  4LLG F;  4YFN F;  3HEF A;  2VIX A;  4CCL A;  4LIU A;  1W5T A;  1MMN A;  2A6E F;  5J8C A;  3HSR A;  3HHG A;  2NNY A;  4GYI A;  1BI2 A;  3MFK A;  2EA2 A;  3F23 A;  3PUF A;  3BG9 A;  3QPS A;  1VQ9 I;  1IRZ A;  3WGI A;  4MQV A;  1W5C C;  5JVG F;  4NHJ A;  2OBP A;  1FOX A;  2V1X A;  4UY8 I;  1KQ0 A;  2HNH A;  5BS6 A;  1EV7 A;  2EB7 A;  2ZXI A;  4OOI A;  4CA0 A;  3O6B B;  1QVT A;  3M3Y J;  1Z67 A;  5E79 C;  3R6S A;  2YUS A;  5TIS C;  4ITV A;  4LK0 F;  5H20 A;  3RYR A;  4AC0 A;  3MKL A;  4DBQ A;  2HGC A;  4A12 A;  4FX0 A;  4PGH A;  4E7S A;  3GXO A;  2Y0M A;  3HOY J;  2F4M B;  1HW1 A;  1TP4 A;  2CW8 A;  2G7U A;  4G8X A;  4YFK F;  4KN4 X;  3N4M A;  3QU6 A;  3BCB A;  3K2A A;  3KLN A;  4M9S A;  2M0M A;  2ACJ A;  4BE0 A;  3CCQ I;  1QPI A;  4HQE A;  3T5X A;  2HZD A;  2VJ5 A;  1IW7 F;  2BOL A;  2IGN A;  2GQQ A;  2MBF A;  3DEW A;  3DU6 A;  3SQN A;  3S16 J;  2ME0 A;  1T98 A;  5K5R A;  1IO2 A;  4WF2 A;  1QU3 A;  1VF9 A;  2BBY A;  3KP5 A;  3DEU A;  2Y30 A;  4IHY A;  3BRO A;  1XGN A;  2A69 F;  5JR3 A;  3CP2 A;  2E35 A;  1XCV A;  2VC0 A;  5FFZ A;  2VPL A;  1HOM A;  1XSV A;  2HQA A;  1MMD A;  4HOB A;  1UG2 A;  2DDA A;  4CCJ A;  1YX3 A;  3VYR B;  3CD6 I;  3ZGK A;  2ME6 A;  2CG4 A;  4RM2 A;  5EEG A;  4BY1 J;  4Q47 A;  4EM1 A;  1AWC A;  4KDP A;  4KIF A;  2GXB A;  5J8F A;  3LNQ A;  1ERD A;  4S0H B;  1SVO A;  3A02 A;  1G2H A;  2EIJ H;  2OZ6 A;  3IUO A;  5ICF A;  5KK1 A;  3ZOB A;  4ESB A;  1I50 J;  3JRG A;  4J00 A;  1DU6 A;  3DTE A;  2JUC A;  1FOK A;  5M3M J;  4M3D A;  3B6A A;  4LK1 F;  1R71 A;  1O3S A;  3OYF A;  3K4K A;  4OIO F;  1DQU A;  3OV8 A;  2DFI A;  4FET A;  5JFR A;  5D5U B;  2X0L A;  3SDG A;  4CYD A;  1QO0 D;  4ZYE A;  4M6Y A;  4BQQ A;  3S1Q J;  3FMQ A;  1VQ8 I;  1SMT A;  3NRV A;  1XCB A;  2K27 A;  1ZLJ A;  3OYH A;  3S15 J;  2HOA A;  5J4V A;  1WRJ A;  4LJZ F;  2DBB A;  4M71 A;  2PMU A;  1TQM A;  1J75 A;  1ENH A;  1UHS A;  4N0B A;  5CQG A;  4LFU A;  1A31 A;  2ZJ2 A;  3VOD A;  4KMF A;  1YW7 A;  3BZK A;  1W36 C;  2IGO A;  2OJE D;  5LRR A;  1FOY A;  3QP5 A;  3AG3 H;  3TGN A;  4UNO A;  1E17 A;  1FMW A;  2KRC A;  3C1D A;  2AHQ A;  5GAD J;  1WJF A;  1I3A A;  4HDV A;  2QQ8 A;  4I6Z A;  1P4W A;  4L9V A;  1JHH A;  4CH7 A;  4BH9 A;  3RIR A;  1S72 I;  4C3J J;  1MJA A;  1Y6I A;  2AXL A;  2LBF B;  1FSH A;  1TQI A;  2FE3 A;  2K3F A;  1R7J A;  2TDX A;  1MDM A;  2KLO A;  4M3E A;  2E1M C;  3ZR8 X;  3J7Y J;  5L3E A;  4JX6 A;  3L7W A;  2CFO A;  1W7P A;  4A6E A;  1SFE A;  4A3G J;  1XTA A;  1Z7L A;  4L5E A;  2VQG A;  2JPC A;  1DUX C;  1S7A A;  3DPL C;  2XPW A;  2HYG D;  2VQH A;  2FF4 A;  4QTR A;  3HIF A;  2XRN A;  4BJ5 C;  4WCG A;  1Y8R B;  3PQK A;  4MFE A;  5HDG A;  2O8X A;  1LE8 A;  3DTK A;  3OIQ A;  3MKZ A;  4BQN A;  1GLN A;  4EQQ A;  3F21 A;  2JK3 A;  1RR7 A;  1ETW A;  3U2R A;  3G71 I;  3BZC A;  1O3Q A;  3CLQ A;  2CUZ A;  4KT5 C;  1E2X A;  3BLY A;  1MSF C;  1V4R A;  2F6C A;  1ZHF A;  3K4M A;  3ERE D;  2QEX I;  2M9H A;  5KVR A;  1TWC J;  4ZDO A;  3K4L A;  1KYW A;  3BZ6 A;  4C2M J;  5EF6 A;  1QZY A;  3OIP A;  3ZQL A;  2FNP A;  3KZZ A;  5LHI A;  1LDJ A;  5LGN A;  3FKI J;  1EH6 A;  4FT8 A;  4DYC A;  4YRV A;  4KIT B;  4RDU A;  2VBZ A;  5BPD A;  3W6J B;  3GTJ J;  2HYF A;  3KX2 A;  3BR3 A;  3FHN A;  1TW3 A;  1QA6 A;  2IGK A;  2B63 J;  5TJJ A;  2G9W A;  2K4B A;  4FIS A;  5JLW A;  2EIK H;  3ZQC A;  2F4I A;  1RUN A;  1ACI A;  2HTS A;  4ENN A;  4G12 A;  3CMA I;  1Z05 A;  3IH2 A;  2EIL H;  1G3T A;  2HS5 A;  2DMU A;  2QZ8 A;  2R7D A;  2I5U A;  3ABK H;  1E3P A;  2M1B A;  4B44 A;  1JE8 A;  1ZG1 A;  1VQN I;  1A6I A;  3RDI A;  4LIV A;  5HVQ C;  2ID6 A;  2QF7 A;  1V3F A;  1P4X A;  1LNW A;  5H6Q A;  4S04 A;  3J81 K;  1I6X A;  4PFO A;  1ZKG A;  4F55 A;  1O3T A;  3OYE A;  2V9V A;  1CF7 A;  1VQ6 I;  2VL8 A;  4EJV A;  2GBY A;  2IPQ X;  2JA5 J;  1ORK A;  4I0B A;  1FEX A;  2QCO A;  1WCM J;  2EFW A;  4BAY A;  3RYP A;  3ZMZ A;  2BXZ A;  4P5O A;  4EMS A;  2CS3 A;  2OV7 A;  1ZR2 A;  1KU7 A;  1DGW Y;  2VN2 A;  4ZYH A;  2ZCW A;  2F5D A;  4PDK A;  4KJZ A;  2L4A A;  2JA2 A;  3OS0 A;  3GTP J;  2YS9 A;  1XN7 A;  2P81 A;  4KUM A;  4HLY A;  2CU7 A;  3ZMV A;  5DM6 F;  4A3C J;  2EIM H;  3TP3 A;  3E6D A;  4HSR A;  1NK3 P;  2HKO A;  2YU3 A;  1RUO A;  1BIB A;  1SFK A;  4E7I A;  1MDM B;  3G4S I;  4UV8 A;  1RI7 A;  4I98 B;  3CTA A;  5HLI A;  1W7P B;  4BEH A;  2VAS A;  1LJ9 A;  3WOD F;  4ZDP A;  3B6C A;  3ZRG A;  4EM2 A;  2VT2 A;  1G59 A;  2DT7 B;  2CFX A;  3MZY A;  5J1R A;  2D1V A;  5FRN A;  3WTV C;  4WXC A;  3AL0 B;  3JRI A;  2HVQ A;  1SMY F;  1Y0N A;  4XK4 A;  4RLF A;  2VLA A;  4WXH A;  3HZJ A;  2BW3 A;  3RPU D;  2WAQ N;  1LE8 B;  4UHT A;  1SAN A;  1HKS A;  1MBF A;  3WTX C;  1FP2 A;  2V4J C;  3VPR A;  2OCE A;  1BOA A;  2XVC A;  2DOD A;  1LUJ B;  3GZ5 A;  5F0F A;  1YS6 A;  4UV9 A;  1D8K A;  3E5X A;  4BUP A;  2K9Q A;  4IEJ A;  4BNC A;  4X1E A;  1T0F C;  2KP6 A;  1GXQ A;  4LLL A;  2NYX A;  3P9C A;  3CO7 C;  2JWT A;  2VKH A;  2YX4 A;  2QSG X;  1YW8 A;  3T8R A;  1HF0 A;  3MEX A;  4M9Z A;  1RPW A;  2PMZ N;  1HSJ A;  2F5V A;  1U8R A;  1K61 A;  3V7C A;  4PJL A;  5DTD A;  3BJ6 A;  4BHP A;  3J7Z I;  3IH3 A;  2XDV A;  2L9N A;  3ROU A;  3LWF A;  3GFI A;  2CUF A;  1U9O A;  3W3C A;  2V79 A;  3IKT A;  3RQI A;  2K3P A;  3HTU A;  5IP7 J;  3RCO A;  3JRE A;  3KEO A;  3S1R J;  1OCT C;  2DA3 A;  2DA5 A;  1WWX A;  2M30 A;  4A69 C;  1YLF A;  2ZME C;  2IRF G;  3K70 D;  1ZAO A;  3BG7 A;  1Y39 A;  2B0L A;  2JVH A;  2MH9 A;  1ZG5 A;  1B59 A;  1WHU A;  5ERI A;  2WTE A;  3Q0V A;  4JQF A;  1ZR4 A;  4F91 B;  5LFA A;  1VQ7 I;  3GX4 X;  2PLY A;  2EV6 A;  1R22 A;  5FLX K;  3VOE A;  2M34 A;  1CF7 B;  2J5O A;  5DM7 F;  1GVJ A;  5L3G A;  1DPR A;  3JSP A;  3K4N A;  3PM1 A;  5F0H A;  2DA4 A;  3A01 A;  2DQL A;  1NG6 A;  4UVB A;  3I59 A;  5EEH A;  5F0C A;  3OYI A;  1HCR A;  2KQR A;  3A0B C;  4CZC A;  2JTV A;  5E1W A;  2HQR A;  4BHC A;  3KEY A;  3TDZ C;  4LG0 A;  1FY7 A;  4RAY A;  3OYA A;  4ZTF A;  3M8F A;  3I53 A;  5DD4 A;  4BGD A;  3FBN B;  2E2H J;  4CCM A;  1TNT A;  2L01 A;  1Y56 A;  4A3K J;  1MBE A;  3IAS 2;  1V55 H;  3GFL A;  1SD5 A;  4I0A A;  2QUF A;  1OJL A;  1MH3 A;  4ASN A;  4E7L A;  1JUM A;  3G2B A;  2QLZ A;  4A0X A;  4J01 A;  2HXI A;  5IT9 K;  2XF6 A;  4I2O A;  2Q0O A;  3OOU A;  1SVM A;  1HLV A;  3D1N I;  1FNN A;  5J1U A;  3BTI A;  4E4H A;  5A2Q Z;  1GXP A;  4C2T A;  4BEH B;  1EH8 A;  2XGE A;  3NQO A;  4XN0 A;  4UUV A;  1GHC A;  3JSO A;  3HOU J;  2XAU A;  1YOV B;  5ICC A;  1ZK8 A;  2VJI A;  3MZH A;  2CQ7 A;  1S3J A;  3GTQ J;  1J9I A;  4FE4 A;  1Z21 A;  4DYQ A;  2A07 F;  1VQP I;  1D0Z A;  1TWH J;  2CQK A;  1XGM A;  3U21 A;  2BW3 B;  1OMI A;  2K4J A;  4CXF A;  3OYC A;  1OKR A;  3CF2 A;  3HOS A;  3SZP A;  4MHG A;  4Z6Y A;  2STW A;  4B4C A;  3LSM A;  2K85 A;  4IZZ A;  4BE2 A;  1RES A;  2CQX A;  3ZMU A;  3P7N A;  2L4M A;  1R4N B;  2HQ5 A;  4PCQ A;  5B5E C;  2ELK A;  1Q1H A;  1UST A;  4ZZD A;  4ESF A;  1BIA A;  1REP C;  4A0Y A;  2VKE A;  2E7X A;  5KAF C;  2F2E A;  2JRT A;  3DBL B;  1W5S A;  3V8K A;  4M74 A;  2M4K A;  3KCC A;  1E0E A;  4IOC F;  2IT0 A;  1YYV A;  2Z16 A;  3L9F A;  1MMS A;  2Y0S N;  2QBY A;  3F9K A;  1T38 A;  3FXR A;  2OZU A;  3LSR A;  2DT6 A;  3FZV A;  3TBI A;  5J3L A;  5GAE J;  2BY1 A;  1XDU A;  2QQB A;  4A3B J;  3GYH X;  3FDY A;  1ZN2 A;  5C4X J;  2CQN A;  3QYE A;  1Y8Q B;  4ENM A;  3CC4 I;  4C30 A;  3CCS I;  2EFO A;  4OIN F;  4XON A;  1BI3 A;  3ZQ7 A;  2LG4 A;  2I8D A;  3M7G A;  1XPX A;  4W97 A;  1X4P A;  3FXO A;  2UXN A;  2KFD A;  2YX7 A;  3EUK L;  2ESH A;  3BTL A;  2DI3 A;  1U78 A;  3E3V A;  2HPI A;  1X2N A;  1R23 A;  2ZXW H;  1V5E A;  2KDZ A;  1XSX A;  3F72 A;  4YII A;  3LAJ A;  1FYK A;  2ICW G;  4BDZ A;  1RR8 C;  4F7Z A;  4LMY A;  4HEA 2;  4RGX A;  2LTP A;  4BYY A;  4UVA A;  3A01 B;  1F4K A;  4AU7 A;  3I59 B;  1YIJ I;  3WTZ A;  2Z2S B;  3H3U A;  4OIQ F;  1V54 H;  1P7J A;  3C2B A;  3VDX A;  3BDD A;  4LG0 B;  3QPT A;  1GT0 C;  3ISP A;  1QHG A;  5E18 F;  3HM5 A;  1Y0U A;  3T8T A;  3Q0W A;  4CCK A;  2R7Z J;  1LKX A;  2GA2 A;  2H1L A;  5F04 A;  4U88 A;  3I4M J;  3H92 A;  3GW2 A;  4HX4 A;  1OCC H;  5LHG A;  2HU9 A;  1D3Y A;  2UWM A;  3BR5 A;  5TGT A;  1FZP B;  4G7Z F;  4XOT A;  2H09 A;  1O7F A;  5EEA A;  3HUG A;  5E3O A;  2K7L A;  5FKL A;  1BJA A;  3HSE A;  5JI6 A;  2ISY A;  3GFJ A;  3NAR A;  5AON A;  1KQ9 A;  3ABU A;  3WGG A;  4A0Z A;  1QNT A;  3ECO A;  1QVU A;  4Q48 A;  5K5Q A;  3COA C;  2HOE A;  1IN8 A;  2WY7 Q;  4PK4 A;  3LFK A;  1H9T A;  4WWC A;  4F92 B;  1MMA A;  3G3Z A;  1ZRE A;  4OMY A;  1MNE A;  1TLH B;  4BY7 J;  5CVJ A;  1UHW A;  1TC3 C;  1B6A A;  1GV2 A;  2IW5 A;  4XLN F;  3CCL I;  2BEO A;  2O8K A;  5D8K B;  4NC8 A;  4IF4 A;  4C9Y A;  2CH0 A;  2XF7 A;  2P7V B;  5LD2 C;  2LY9 A;  3HJE A;  2HWV A;  1K4T A;  2W57 A;  5JVT A;  2NOJ B;  3KE2 A;  2A68 F;  1AA7 A;  3JAM Z;  1DU0 A;  2QBY B;  4BAC A;  2RRE A;  4DOZ A;  4XKV A;  5B66 C;  1QBJ A;  2KIF A;  1ZAR A;  2W25 A;  2R92 J;  1X58 A;  2FBH A;  4LGW A;  5FGM A;  3OYL A;  3R61 A;  5D4S A;  1GDT A;  2OQR A;  1ETO A;  4ZC3 A;  4F3Q A;  3CF5 F;  2R93 J;  4GCV A;  2L7M P;  3Q9V A;  3FBI B;  3I64 A;  2HXO A;  2K9N A;  2KIQ A;  2IA2 A;  1PVE A;  3KP4 A;  1LFU P;  4IHT A;  4AYB N;  3T1B A;  2DW4 A;  1WPK A;  2R7O A;  2L0K A;  4QPQ A;  3F6V A;  2QA4 I;  1P2F A;  5HDN A;  4W1U A;  1OFC X;  4M6V A;  3H35 A;  3DBH B;  4KMU X;  1BR1 A;  2F4O B;  2CWE A;  4JK1 X;  1FC3 A;  3H5N A;  5DD8 A;  3W2A A;  4OAY A;  1I3Q J;  1HXD A;  4CYC A;  4I99 C;  2VJ4 A;  3ZMS A;  3CCV I;  1U8B A;  4LG3 A;  4OIR F;  2X85 A;  4HPQ A;  2ID3 A;  4UVC A;  2MW8 A;  3K4B A;  1SAU A;  2BY0 A;  3REO A;  4B43 A;  1DGR M;  4CUG A;  2EBI A;  2R5Y A;  4JBA A;  3CJT B;  1YFH A;  1E3O C;  3S8P A;  3JRF A;  3ZQF A;  3I5U A;  2CO5 A;  2ZFW A;  3S14 J;  3ZQG A;  4ZH4 F;  2FX0 A;  3BC8 A;  2A6T A;  2WY8 Q;  4IPA A;  4XLE A;  4EGZ A;  1MJ9 A;  1SFX A;  3GTK J;  4U87 A;  3JRA A;  2DQR A;  2DYR H;  4Y4R A;  2FBK A;  3OS2 A;  2GIZ A;  4G6T B;  3S3M A;  2VBY A;  2XGX A;  5D4R A;  4XID A;  3HG9 A;  2Z9O A;  3HUG B;  3GF2 A;  1IRX A;  3MVP A;  5BMZ A;  1YW9 A;  4RAZ A;  3OMY A;  1UHM A;  4BQO A;  3HC7 A;  3K7A J;  2JA7 J;  1WJE A;  2HKX A;  2R7W A;  3CDI A;  4NC7 A;  2MC4 A;  3LSP A;  1DDN A;  5CLS A;  4QLC U;  3JTG A;  1N75 A;  1J0R A;  1RKT A;  2QQ9 A;  5LBQ A;  3FXU A;  4N4O B;  1X4O A;  1VZ0 A;  5M3F J;  4F52 A;  2STT A;  1X2M A;  2EFP A;  3HPH A;  3LSJ A;  3E97 A;  3GLL A;  3RJP A;  4XRF A;  3BG5 A;  2L9V A;  2JJ7 A;  3DQV C;  4A3L J;  3I4N J;  2XV4 S;  2F5C A;  2K5C A;  3O2P E;  3U9G A;  4X0G A;  4AYB A;  3JRB A;  1Z77 A;  1MIJ A;  2DPD A;  2BHZ A;  2D45 A;  2PJP A;  4A3M J;  3BR0 A;  2GOX B;  2DK8 A;  2WV0 A;  5H6R A;  4CO8 A;  2QGU A;  2YPR A;  3PIO F;  2LH9 A;  3PFY A;  1XGS A;  3K1N A;  4LOC A;  5E8G A;  2FMY A;  3KYC B;  3FXQ A;  5IT3 A;  1AOY A;  3GLX A;  1D1A A;  4DGW B;  2ZJP F;  1YJW I;  2Y9Y A;  3QP6 A;  1AHD P;  2DOE A;  2OUM A;  3OR2 C;  3H9Q A;  2E1C A;  2D1H A;  2VE8 A;  1IUF A;  3LSK A;  1T39 A;  3FF5 A;  4B3X A;  4BU2 A;  1F43 A;  3DF8 A;  2W85 A;  2XRL A;  3TO6 A;  2Z1D A;  1O3R A;  4HF1 A;  2M7A A;  3BR6 A;  2D2W A;  2Y48 A;  1T2K A;  1NH3 A;  1IC8 A;  3TO7 A;  3OS1 A;  4HZF A;  4IOA F;  4Y33 A;  3EDP A;  2MD5 A;  2ZNY A;  1HQC A;  1SD7 A;  2PFB A;  3VWB A;  1JJ6 C;  3KZY A;  2O7O A;  2NRA C;  4MNU A;  1QQI A;  3PNV A;  3G1O A;  2VUM J;  2WAD A;  1IUY A;  2IVM A;  3BCA A;  2JUG A;  2GZW A;  4E7H A;  4CYC B;  1JGG A;  1T8I A;  3DPT A;  5BNG A;  4CDG A;  2GXG A;  2M0C A;  3V7R A;  1LFP A;  1OIS A;  1Z91 A;  2VJJ A;  4EVI A;  1IXC A;  3T0Y A;  1K79 A;  3JW4 A;  4HRI A;  1A04 A;  2EV5 A;  1NG7 A;  1HST A;  1TTY A;  4I09 A;  2E2J J;  1DPU A;  2R5Y B;  5D6F A;  2CUE A;  3CZ6 A;  3WHC A;  4PJM A;  3V7S A;  4BKX A;  4BXF A;  2V6E A;  1ITY A;  3EET A;  1FX7 A;  5GPA A;  3IRR A;  4ON0 A;  4KYW A;  4AUX A;  2ZBK A;  1STZ A;  1N25 A;  4L5J A;  1BC8 C;  3WTU C;  2H6C A;  1TWA J;  1BOB A;  4RBO A;  4FHT A;  4L5I A;  2VPR A;  3F8C A;  1U3E M;  3CUQ C;  4XKC A;  3GTL J;  5HDK A;  5IYD J;  4D5F A;  1E3H A;  3GME A;  4FTH A;  2KKO A;  4NDL A;  2MA3 A;  2LDU A;  3P9K A;  3ZQI A;  1UCR A;  2GOM A;  1S5L C;  3C3W A;  4IQJ A;  3PFI A;  2ADU A;  3TDU C;  2ZNZ A;  2M8E A;  3BJO A;  1BW5 A;  3E6B A;  2AS5 F;  2LNB A;  4RGS A;  1OCO H;  4XLC A;  1YG2 A;  2CJJ A;  5ILS A;  2R7U A;  2B7E A;  2QM3 A;  2XC7 A;  1TT0 A;  3GCM A;  5L3C A;  3BT9 A;  4A3F J;  5L3B A;  2L7F P;  2XB0 X;  5LEK A;  3D5R C;  4YIR X;  3J80 K;  3F8F A;  3BY6 A;  5CVI A;  5E8I A;  3DP7 A;  2NXN B;  1JUS A;  1W7P D;  1GUU A;  3G1M A;  4XSZ F;  2G7H A;  4XNF A;  4S05 A;  2GXA A;  1OCR H;  3DU5 A;  1OYY A;  2LYC A;  5FD5 A;  4CZZ A;  2V6C A;  3A2K A;  3OSF A;  4CGZ A;  2ZXH A;  1MBG A; 
#chains in the Genus database with same CATH homology
 1TWF J;  3LOC A;  3Q0V A;  5C3E J;  3JRH A;  3F0C A;  1ZR4 A;  4IHV A;  2NOG A;  2M34 A;  4JX5 A;  1T56 A;  3S1N J;  3HOZ J;  4FE7 A;  3PM1 A;  5F0H A;  2DA4 A;  3H0G J;  3A01 A;  3CCY A;  5K7H A;  2L7Z A;  3HGG A;  2CQQ A;  5F0C A;  2OPT A;  1MBJ A;  4I76 A;  4HNV A;  1CQT A;  1HCR A;  3W6V A;  5FKO A;  3SJM A;  1BL0 A;  1FTT A;  2K9S A;  2E2H J;  1H8A C;  3A03 A;  4D5C A;  2XB5 A;  4A3K J;  3ZQH A;  1MBE A;  4MO7 A;  1IG7 A;  1S7E A;  3BTC A;  1OJL A;  1MH3 A;  1JUM A;  1YRN A;  5M5W J;  3HBL A;  2HXI A;  3OOU A;  1HLV A;  3D1N I;  5J1U A;  3BTI A;  3S2D J;  3RZO J;  5GP9 A;  2XGE A;  2GM4 A;  2TRT A;  2NVQ J;  2E19 A;  2LFB A;  1FIP A;  5EYR A;  2CRG A;  4A3J J;  3HOU J;  2MSY A;  4FCY A;  1ZK8 A;  3BQZ A;  4C3H J;  1P7I A;  3GTQ J;  2H8R A;  4FE4 A;  4DYR A;  4DYQ A;  5E3M A;  1WGX A;  4BXX J;  1TWH J;  1T33 A;  1A5J A;  2IBD A;  2XSD C;  5F27 A;  4D7M A;  1OCP A;  4B4C A;  2DA7 A;  2DMT A;  4MLO A;  1JT0 A;  1JTX A;  1RES A;  2CQX A;  4A3D J;  4DW6 A;  2IEK A;  1AKH B;  3NAU A;  2ECC A;  2HQ5 A;  2HOS A;  1MSE C;  2XPU A;  1VND A;  1ETY A;  2ELK A;  2X9D A;  5IYB J;  2VKE A;  5M5Y J;  2JA8 J;  3RZD J;  1Q1V A;  2K40 A;  2DA1 A;  1RET A;  1LFB A;  4XRS A;  5IOY A;  5E3L A;  4J19 A;  5EG0 A;  2Y31 A;  1I6H J;  2DA2 A;  1FJL A;  3HGY A;  1JKR C;  2TCT A;  1H88 C;  2Y0S N;  4UUT A;  1ZQ3 P;  3LSR A;  2HOT A;  3GTG J;  3S17 J;  3HEF A;  5J3L A;  1MH4 A;  2NVY J;  3GTO J;  4A3B J;  5C4X J;  2NS7 A;  2Y2Z A;  3IV5 A;  3BG9 A;  2EZK A;  3QPS A;  1IRZ A;  1JKO C;  4DZJ A;  1D5Y A;  2WB1 N;  1IJW C;  1Z0X A;  1WI3 A;  3H3V K;  4W97 A;  3JRC A;  2FJ1 A;  1SFO J;  2X6O A;  1QVT A;  3M3Y J;  3BTL A;  4BBR J;  2R5Z B;  2YUS A;  5JLX A;  3Q0U A;  1U78 A;  1X2N A;  2R0Q C;  2KT0 A;  4AC0 A;  3MKL A;  4Y7N J;  2KDZ A;  2D5V A;  4C3I J;  2LTP A;  1MBK A;  5EZH A;  5K7F A;  3A01 B;  3JR9 A;  2DMP A;  1XS9 A;  2IAI A;  3HOY J;  3LSG A;  2NVT J;  2L9R A;  1P7J A;  2HYJ A;  3C2B A;  4B3A A;  3BR1 A;  1GT0 C;  3K2A A;  3HM5 A;  5EGO A;  5FLV A;  3Q0W A;  2XGC A;  1R9T J;  1W0U A;  1NTC A;  2R7Z J;  1QPI A;  2VI6 A;  1YRN B;  4JYK A;  5F04 A;  3DEW A;  3I4M J;  2M8G X;  4UUS A;  3BTJ A;  3S16 J;  2ME0 A;  3JRD A;  1VF9 A;  3BR5 A;  1U9N A;  2Y30 A;  2DA6 A;  1WH7 A;  4IHY A;  5FLM J;  5EEA A;  5E3O A;  1B72 A;  5FKL A;  2LR8 A;  1HOM A;  1B8I A;  3NAR A;  4B1R A;  2W48 A;  1UG2 A;  3SFI A;  2EZH A;  2ME6 A;  5IP9 J;  2ZB9 A;  4BY1 J;  5FKN A;  1QVU A;  3LNQ A;  4S0H B;  2NVX J;  1F36 A;  3A02 A;  1VFC A;  1G2H A;  1DU6 A;  3JRG A;  3ZOB A;  2I10 A;  1I50 J;  2LKX A;  1MBH A;  2ECB A;  2X48 A;  2JA6 J;  5M3M J;  4BY7 J;  2EQR A;  4M3D A;  3B6A A;  2O9L A;  1APL C;  5C44 J;  2Y9Z A;  1TC3 C;  3SDG A;  1GV2 A;  2O8K A;  1POG A;  1TWG J;  3Q3S A;  3GTM J;  1JTY A;  4IHX A;  3M4O J;  3S1Q J;  3FIW A;  2N8G A;  3QPL A;  3S15 J;  2HOA A;  2LK2 A;  4ABZ A;  2LY9 A;  5FKM A;  3HOX J;  1ENH A;  1UHS A;  5EG0 B;  1NK2 P;  5IOZ A;  4MIM A;  1DU0 A;  2DTZ A;  1GV5 A;  2R92 J;  1X58 A;  3IH4 A;  5IP6 A;  1JJ8 C;  1HDP A;  1QRY A;  1GDT A;  2YU9 J;  1ETO A;  2AHQ A;  2R93 J;  2L7M P;  2HXO A;  3TW7 A;  1MNM C;  2K9N A;  4I6Z A;  1LFU P;  4AYB N;  1WPK A;  3DCF A;  2HI3 A;  2L0K A;  4C3J J;  4W1U A;  1OFC X;  4M6V A;  3UKG A;  3TP0 A;  3BQY A;  4M3E A;  5IYC J;  4M3F A;  1JUP A;  4JX6 A;  1IDZ A;  3OSG A;  1I3Q J;  4CYC A;  4A3G J;  4L5E A;  1U8B A;  2WV1 A;  2E2I J;  1IV6 A;  1XC5 A;  3HB9 A;  3OIO A;  1IGN A;  2XPW A;  4BBS J;  3O8G A;  2ID3 A;  1JKP C;  2MW8 A;  1AU7 A;  4QTR A;  3QQA A;  3CMY A;  2EBI A;  2R5Y A;  2XGD A;  1E3O C;  3PO2 J;  1IDY A;  4MFE A;  3JRF A;  3ZQF A;  1WH5 A;  2JMW A;  1LE8 A;  4IHW A;  1BJZ A;  2LP0 A;  5EGO B;  4V2F A;  2FD5 A;  3S14 J;  1GVD A;  3ZQG A;  2DMQ A;  2FX0 A;  2JK3 A;  3HOV J;  5K7Z A;  1RR7 A;  1O4X A;  1ETW A;  3GTK J;  3JRA A;  1HDD C;  4UUS B;  1MSF C;  1ETV A;  4XID A;  3S1M J;  4M3G A;  2GLO A;  3MVP A;  4MFD A;  1B72 B;  2M9H A;  5IPA A;  1TWC J;  5J1Y A;  4C2M J;  5EF6 A;  1B8I B;  3K7A J;  2JA7 J;  2NS8 A;  3ZQL A;  3LSP A;  2HDD A;  3FKI J;  4DYC A;  3BG3 A;  4RDU A;  1PUF A;  3GTJ J;  1RKT A;  3BR3 A;  2AO9 A;  2DJN A;  5M3F J;  1ZTR A;  2B63 J;  2VKV A;  5JLW A;  4FIS A;  1X2M A;  3ZQC A;  3CQZ J;  2EZI A;  2E1O A;  3LSJ A;  5EZG A;  1ETK A;  3BG5 A;  4G12 A;  3IH2 A;  1BA5 A;  2XPV A;  2JJ7 A;  1W0T A;  2DMU A;  1BW6 A;  1UMQ A;  3I4N J;  4A3L J;  2EH3 A;  1A6I A;  2COB A;  1Z77 A;  3JRB A;  1K83 J;  4A3I J;  9ANT A;  1ZGW A;  4A3M J;  3BR0 A;  2ID6 A;  2QF7 A;  3RKQ A;  1ZKG A;  3HDD A;  3G1L A;  4EEF G;  3TW6 A;  4D7N A;  4LOC A;  4GFB A;  5FJ8 J;  2GBY A;  2JA5 J;  2H1K A;  1ORK A;  4JP0 A;  1FEX A;  2G0E A;  1WCM J;  2QCO A;  1JT6 A;  2Y9Y A;  5HOD A;  1AHD P;  5F08 A;  1JKQ C;  1ZR2 A;  4M3B A;  1IUF A;  5DS9 A;  3BR2 A;  3GTP J;  1F43 A;  2RAE A;  2XRL A;  2P81 A;  2YS9 A;  5C4J J;  3BR6 A;  2CU7 A;  4A3C J;  1H89 C;  1IC8 A;  4A3E J;  3TP3 A;  2DN0 A;  4XIC A;  2FQ4 A;  1NK3 P;  2JN6 A;  1FIA A;  1JJ6 C;  2O7O A;  3PO3 J;  3G1O A;  2VUM J;  5M5X J;  4CYC B;  1JGG A;  5F1J A;  3B6C A;  5E3N A;  5BNG A;  2M0C A;  5J1R A;  3JRI A;  4XK4 A;  2E2J J;  2R5Y B;  3MN2 A;  4XRS G;  4A93 J;  2CUE A;  2WAQ N;  3WHC A;  4BKX A;  1LE8 B;  1ITY A;  5GPA A;  2MG4 A;  4AUX A;  1Y1W J;  1SAN A;  1ETX A;  1Y1V J;  1MBF A;  5EDN A;  3FK6 A;  1TWA J;  4JX4 A;  3VPR A;  2LVS A;  4RBO A;  1AKH A;  2VPR A;  3L1P A;  4Y52 J;  3FK7 A;  1ETQ A;  5F0F A;  3GTL J;  5IYD J;  4D5F A;  4V2G A;  1FTZ A;  2EZL A;  3TED A;  3O8H A;  1RKW A;  2K9Q A;  2LLK A;  4IEJ A;  4NDL A;  4FTH A;  3E7L A;  3S2H J;  5FKK A;  4X1E A;  4QIW N;  3HKZ N;  3ZQI A;  3GBG A;  2JWT A;  4X6A J;  2DMN A;  1BW5 A;  2OF7 A;  2LD5 A;  1VI0 A;  1XG1 A;  1HF0 A;  1RPW A;  3FIS A;  5GPC A;  2CJJ A;  3CDL A;  2PMZ N;  2MGQ A;  1PUF B;  3BT9 A;  1K61 A;  4A3F J;  2L7F P;  5DTD A;  3HOW J;  2XB0 X;  1EF4 A;  3IH3 A;  3WHB A;  4XRM A;  2CUF A;  1U9O A;  1JUS A;  3G1M A;  1GUU A;  3RQI A;  5IP7 J;  2M2E A;  3JRE A;  3S1R J;  4DZP A;  1OCT C;  2DA3 A;  2DA5 A;  4QSH A;  4A69 C;  2R5Z A;  3OSF A;  1MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...