2R93J

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r93J00
4AC0A 4DZJA 5EF6A 5GP9A 1RESA 1X58A 2R5ZA 1K61A 1QPIA 4Y7NJ 3GTQJ 1HCRA 3GTJJ 3Q0WA 1S7EA 3NARA 2G0EA 3G1MA 4JX4A 3HB9A 3A01B 1IDZA 2QF7A 5C3EJ 1ENHA 2JK3A 2L7MP 1MBJA 2E2IJ 2JWTA 3JRBA 3OSGA 2WV1A 3HKZN 1O4XA 3HOYJ 5M3MJ 4G12A 1UMQA 4MLOA 4B1RA 3LSGA 1RKWA 3JRCA 2Y9ZA 5M3FJ 1ZR4A 2KT0A 2L9RA 3JRDA 1XS9A 1QVUA 2E2JJ 1JUPA 3SJMA 3HM5A 1MBHA 5C4JJ 2CQQA 2DA7A 1IGNA 4UUSA 3K7AJ 5K7ZA 3TW7A 4A3LJ 1IRZA 4FISA 5F0HA 1MBEA 3QQAA 4M3EA 4AYBN 3GTPJ 3BR2A 2JN6A 5IYDJ 3D1NI 5EDNA 2X48A 4FTHA 5FJ8J 2ID3A 4BBRJ 1AU7A 2FQ4A 1B8IA 4BBSJ 2MGQA 1YRNB 2R93J 4IHVA 3MVPA 1UHSA 2W48A 1A6IA 1B72A 4DW6A 1BW5A 4CYCB 5FKLA 4S0HB 1ZQ3P 2HYJA 1FIAA 1OCTC 4HNVA 5J1UA 4LOCA 1SANA 2KDZA 4X1EA 1JT6A 2LTPA 5E3OA 1IUFA 2Y0SN 3S15J 2DA6A 2CU7A 4L5EA 3BTCA 3LSPA 4IHXA 3S2HJ 2CQXA 1G2HA 4JX6A 1ETVA 2VI6A 2R92J 3DEWA 1I3QJ 2XPVA 3Q3SA 4JYKA 3LSJA 1ZK8A 1WPKA 1I6HJ 1JJ8C 2K9QA 2JA6J 2O8KA 5GPCA 3A01A 1BW6A 5DTDA 2EH3A 2VPRA 3A03A 1XG1A 2AHQA 2NVXJ 3B6AA 1LFBA 5E3LA 4A3JJ 4A3MJ 5F0CA 3JRIA 4I6ZA 5BNGA 2XPWA 5IP7J 2IEKA 3TP0A 2LR8A 4B4CA 1ETYA 1POGA 2VKVA 3OIOA 2JA7J 1WGXA 4QIWN 1MBKA 1RR7A 4C3JJ 1GV2A 2M9HA 1GV5A 2YUSA 1WH5A 2DMNA 5EG0B 1ZTRA 5E3MA 1HF0A 4BY1J 4A3EJ 1JJ6C 3HGYA 1IDYA 2NS8A 4DYQA 4A3BJ 2GBYA 4FE4A 1AKHA 2EZLA 4AUXA 1OJLA 2R5YB 2NOGA 5K7FA 4XIDA 1IG7A 3HEFA 1W0UA 3BG3A 2LD5A 1ETWA 3I4NJ 4XRMA 3RZDJ 1JKOC 2E19A 1VI0A 2WAQN 2DMQA 1FEXA 5IP9J 4A3DJ 1TWHJ 2LK2A 1JTYA 2XPUA 4DZPA 1U9NA 3Q0UA 5J3LA 3GTKJ 1K83J 3W6VA 1HDPA 3HOZJ 1NK3P 2YU9J 5M5YJ 1FTZA 2XB0X 1GUUA 4JP0A 2MG4A 2GM4A 1ETXA 1D5YA 3S2DJ 3BG9A 3FK6A 2MW8A 5JLXA 2DMUA 2LVSA 1AHDP 1WI3A 2N8GA 4A3FJ 2DN0A 2K9SA 4C2MJ 4RBOA 3JR9A 2ECCA 2X9DA 1Y1WJ 2ECBA 3BT9A 3BR3A 2HOAA 4MIMA 3IV5A 3RKQA 3BTJA 1JTXA 1ZR2A 1H88C 2P81A 4UUTA 2XGEA 1U9OA 1B8IB 1FTTA 1JKQC 1FIPA 2ZB9A 3K2AA 5FLMJ 1NTCA 1A5JA 3BR5A 1LE8B 3JRFA 4FE7A 3WHBA 2E1OA 2FJ1A 2DTZA 2H1KA 1UG2A 3S17J 1PUFA 2HQ5A 1U8BA 2LP0A 1OFCX 3ZQHA 2EZKA 3B6CA 4V2GA 5IYCJ 3FKIJ 3FIWA 5EZHA 1GVDA 2K9NA 1P7JA 2O7OA 3GBGA 3F0CA 4FCYA 3RZOJ 1ETQA 4V2FA 4RDUA 4BY7J 1R9TJ 1TC3C 3HBLA 1W0TA 4D5CA 1MH4A 3TP3A 5F1JA 1SFOJ 4ABZA 1APLC 3MKLA 2JA8J 1LE8A 5FLVA 4A3KJ 1H89C 3JRHA 9ANTA 3OOUA 2IBDA 3HDDA 3ZQIA 1ZKGA 2COBA 2PMZN 5EGOB 4Y52J 1T33A 2M34A 2TCTA 3BQYA 3S1NJ 3BTLA 4A69C 1Y1VJ 3BTIA 3G1LA 2EQRA 4C3HJ 1X2MA 3H3VK 4M6VA 2HOSA 3H0GJ 2R5YA 1ZGWA 2DA4A 1IJWC 1WCMJ 2LKXA 1OCPA 2Y9YA 4MFDA 1VFCA 4D5FA 3CMYA 1JKRC 1DU0A 3JRAA 2HDDA 2Y31A 2EZIA 4I76A 3MN2A 3LSRA 5IP6A 5HODA 3S1RJ 5EYRA 2HI3A 4W97A 3GTOJ 2I10A 3O8GA 3I4MJ 1GT0C 3S1QJ 3HGGA 3GTGJ 2EBIA 4XRSG 4XICA 5EG0A 4M3GA 5FKNA 5C4XJ 1X2NA 3IH4A 3S14J 2TRTA 1I50J 5IPAA 5F27A 2CUEA 4M3BA 5M5WJ 1TWGJ 1QRYA 2JMWA 3CQZJ 5EZGA 5F0FA 4JX5A 5GPAA 1CQTA 1BA5A 4A3IJ 1VNDA 5M5XJ 3LNQA 1ITYA 2LFBA 2M2EA 3O8HA 4D7NA 4UUSB 3SDGA 4A93J 2LY9A 1ORKA 2X6OA 3FISA 1MH3A 1YRNA 5IYBJ 2HXIA 3ZQCA 1Z0XA 2VUMJ 3IH3A 2XGCA 1TWFJ 5F08A 5FKKA 1P7IA 1F36A 2DA3A 1DU6A 1BJZA 2IAIA 4D7MA 4DYRA 3GTMJ 2YS9A 1T56A 3QPLA 3ZQFA 5EEAA 2XB5A 4MFEA 5F04A 1JKPC 5FKMA 2VKEA 3ZOBA 3PO2J 1QVTA 2XRLA 2H8RA 1JT0A 3DCFA 1JUSA 2R5ZB 2ME6A 2K40A 5FKOA 3TEDA 4BKXA 5DS9A 1HLVA 1E3OC 4DYCA 2ME0A 3HOWJ 3HOUJ 1EF4A 2MSYA 1RKTA 1FJLA 3BG5A 3TW6A 1HDDC 3NAUA 1WH7A 2FD5A 4M3DA 2M8GX 3HOXJ 4C3IJ 1HOMA 3Q0VA 1PUFB 4A3GJ 3BR1A 1TWAJ 1U78A 3S16J 4XK4A 1GDTA 3IH2A 2L0KA 2OF7A 2Y2ZA 2D5VA 2WB1N 2NVQJ 4A3CJ 1TWCJ 2ELKA 3CCYA 1ETKA 4XRSA 3SFIA 2B63J 2XSDC 2R7ZJ 5E3NA 2HOTA 2AO9A 5J1YA 1JGGA 2DA2A 5IOZA 2RAEA 3HOVJ 3CDLA 2CJJA 3BQZA 3PO3J 2JA5J 4W1UA 3BR6A 3JRGA 5C44J 3ZQLA 3OSFA 3WHCA 1MNMC 3C2BA 1B72B 4IEJA 2JJ7A 2R0QC 2DJNA 2Y30A 3G1OA 1NK2P 4GFBA 3M4OJ 2CRGA 5J1RA 4NDLA 1F43A 2ID6A 1JUMA 3ZQGA 2NVTJ 2LLKA 1Z77A 5IOYA 4IHYA 1XC5A 2XGDA 1AKHB 4CYCA 1MBFA 1LFUP 2E2HJ 2OPTA 3A02A 1IV6A 2DMPA 3L1PA 1BL0A 3GTLJ 5JLWA 4BXXJ 1MSFC 2M0CA 1IC8A 1Q1VA 1RETA 3UKGA 3FK7A 1MBGA 3JREA 2GLOA 4M3FA 2DA1A 3M3YJ 2DMTA 4X6AJ 2L7FP 1ETOA 2HXOA 4MO7A 3E7LA 1VF9A 1H8AC 4QSHA 2L7ZA 2DA5A 3VPRA 4QTRA 5EGOA 1RPWA 2NVYJ 3QPSA 1MSEC 3RQIA 4EEFG 2NS7A 3BR0A 5K7HA 2QCOA 3LOCA 3PM1A 2FX0A 2EZHA 4B3AA 2O9LA 4J19A 3S1MJ 2CUFA 4IHWA
chains in the Genus database with same CATH superfamily
2P4WA 3QP6A 1SEUA 3ERMA 2VBWA 2R5ZA 1I3AA 1HKQA 2JPCA 1MMAA 4LIVA 1K61A 3DTIA 4Y7NJ 1QPIA 3GTQJ 2VT2A 1HCRA 1XMKA 3Q0WA 3LFKA 3TO6A 2M8EA 3H1CA 3G1MA 4HZFA 1I6XA 2OTLI 3CC2I 1ENHA 1OYIA 2GXGA 4II3A 3RKWA 4G7OF 1RI7A 2A5WA 2E2IJ 4IRHA 2K3FA 3JRBA 3OSGA 1J59A 2KPMA 3FXRA 4LLGF 4XQFA 2V7FA 4MLOA 3FM5A 3FXQA 5M3FJ 2ACJA 1ZR4A 2QQ9A 3JRDA 2LNBA 2EV6A 2E2JJ 4GYIA 3SJMA 4CHUA 1K79A 1MBHA 4F3QA 1BIBA 3D5RC 1QZZA 2W25A 3K7AJ 1F1ZA 3TW7A 2DT7B 3I9V2 4RB2C 2K5CA 4L0YB 3AG2H 5FROA 3CMEI 3OWTA 3FMQA 3DXJF 5FJ8J 2QSGX 1B8IA 3OIPA 5BS6A 1FBQA 2FOWA 2QZ8A 4IHVA 3V7CA 1WJBA 3FBNB 2V1XA 2DDBA 1UHSA 2L9VA 4CGZA 1V4RA 2E1NA 3NWTA 1O7LA 4UB8C 2VQCA 1MMDA 2QLZA 3W6KB 2X6YA 2FBIA 3MCZA 3QOEA 5F1RA 2IP2A 4DW6A 5DD4A 5FKLA 1ZQ3P 1YIJI 3WTWC 5J4YA 4CO8A 1OYWA 4AD9A 4WCGA 4GYGA 2H1LA 2HVQA 5ICGA 4X1EA 2UUZA 4ZYAA 2DODA 1MNDA 4XOPA 3K10A 1W36C 3DWLE 1BIAA 2DA6A 1LDDA 3EPZA 4L5EA 2FOKA 4G6TB 1WRJA 3BTCA 4IQJA 2AXLA 1G2HA 1ETVA 1SAUA 3FHNA 2VI6A 4H0EA 4XL9A 3Q3SA 4AYBA 3CCVI 1WPKA 3BJ6A 3CUQB 3ELKA 4IQ4A 1I6HJ 5BOXA 4PJLA 5GPCA 4ZDLA 1BW6A 4HOBA 1TQMA 2EH3A 2ZFUA 4P55A 3TBIA 4ENNA 2VL8A 4XNFA 2AHQA 2L01A 4RGSA 3E5UA 1TW3A 3B6AA 2R7XA 5J40A 1XX5A 5F0CA 3RPUA 2ISZA 4I6ZA 2ETHA 4DBQA 2HYGD 2OAZA 1OISA 2IEKA 4B4CA 2LR8A 2RC4A 3VYRB 5DCFA 2JA7J 3IKVA 2IA0A 1FY7A 2CQNA 4C3JJ 1YS6A 4WX9A 1IN6A 2JUGA 5ILUA 3H9JA 1FZPB 1GV2A 2M9HA 1WJDA 1WH5A 2P6SA 3EUHC 5D6EA 2MABA 5EG0B 4IX7A 3I71A 3P5JA 4Y4RA 2DK8A 3F21A 2Z1DA 3JCUC 1ZARA 1IDYA 4A3BJ 3HL2A 2FRHA 5DEQA 2XUBA 1Z7LA 1AKHA 2EZLA 1YYVA 4M9ZA 4NQWA 4AUXA 5ICFA 4CA0A 1E3PA 2PEXA 4UB6C 5LHHA 3TOBA 5L3BA 4E7JA 3HXLA 2A6HF 3AL0C 2LDUA 1R71A 1B4AA 1EH8A 3JSPA 2LD5A 1A04A 3EYIA 4I0AA 1JKOC 4AIKA 3KIOA 4CCLA 2LF8A 3E1SA 2F4MB 5TRDA 4E7SA 1JTYA 5A2QZ 1OCZH 2DQRA 3Q0UA 2W7NA 4CUGA 1NK3P 1VQ8I 4HDUA 2NRAC 4LK1F 5M5YJ 3Q9SA 4I7HA 2QYOA 1GUUA 1Z9CA 2VC0A 3K4BA 1ETXA 1ZELA 2HKXA 3KFWX 3NRVA 3KEYA 3QYFA 2KQRA 4CCKA 2LVSA 3ROUA 4A0XA 2WB1A 1Z6RA 2DN0A 2K9SA 4C2MJ 3H9QA 3KP4A 4NC6A 4B43A 3BT9A 3BR3A 5J47A 1UZCA 2HDCA 3CLQA 4OINF 4UNOA 2TDXA 1H88C 4RB3C 5FRMA 2GOMA 3E5XA 2DU9A 3UNGC 2CO5A 2ZJQF 5LGNA 3JRFA 1XCVA 2ADUA 4FE7A 3WHBA 2V9KA 2FJ1A 3CUOA 1S6LA 5H6QA 1UG2A 2FUG2 2XAJA 2HQ5A 3N97A 2CWEA 1UCRA 2EZKA 2WAQA 4U87A 3LAJA 2GA2A 2M5WA 4YFXF 4V2GA 1K4SA 5HLGA 3G73A 5D5XB 2K9NA 1P7JA 2O7OA 2KJCA 3F0CA 1ETQA 2WY8Q 4LG3A 2O61A 2ZMEB 1TC3C 3R6SA 3HBLA 1TLHB 4I99C 4KN7X 1W0TA 1MH4A 5F1JA 1SFOJ 4ABZA 5FD5A 2EIJH 4A12A 4A3KJ 4XOTA 1GXQA 3C1DA 1H89C 3JRHA 2KIUA 9ANTA 4XLPF 2E35A 1D1CA 2ZJ2A 3KP3A 2HEOA 5EGOB 1XCBA 4Y52J 3KP7A 1HXDA 1BC7C 3S1NJ 2EFOA 1MDMB 1IXCA 4U0VA 1IW7F 3GFIA 5BPDA 1W5CC 4EV0A 5HVQC 3H3VK 1J2XA 1FMVA 1QZYA 3FXUA 5HDGA 2R5YA 2V79A 1SFUA 2RKHA 1IF1A 1SMYF 4BS9A 1WCMJ 2LKXA 3LSHA 1ZN2A 1YJWI 5EJCA 3F9KA 2P6TA 3AL0B 3E6BA 4BJ6C 4Y17A 2BGCA 2HDDA 2R3SA 1T08B 3D0SA 4NC7A 1HQCA 4B47A 3GFLA 4L9VA 3LQRA 1FYLA 2R7QA 3S8PA 5EYRA 4WXCA 3ZXSA 2NNYA 3IUOA 3TO9A 2V1NA 1YOVB 4II2A 1Y56A 1D8JA 1X2NA 4HNTA 4UY8I 2CS3A 1N75A 4M3BA 2UZKA 2V9VA 5TISC 2BXZA 3TKYA 2LC2A 3CQZJ 5EZGA 3J80K 3OY9A 2GAUA 1CQTA 1FOWA 1X1AA 2MFZA 1ITYA 2R7FA 2LFBA 3O8HA 4BU2A 2A68F 3FMRA 3PNTA 2VBXA 3ABTA 2XC7A 2AQEA 2DFEA 4A93J 3KETA 1PUEE 3OYEA 5HS7A 5DCMA 2VUMJ 3R61A 1W7PD 2OC6A 1TWFJ 1MIJA 5FKKA 1F36A 2DA3A 3TDZC 1O3RA 1DU6A 5CVVA 2IAIA 1YX3A 5LHIA 1LDKB 5HDKA 4CYDA 1D1BA 2F5DA 2IPQX 3MZ8A 3ZQFA 1K78A 3R0JA 1WJAA 4MFEA 2NVUB 1H0MA 3QOPA 5FKMA 1JKPC 2VKEA 1UJ8A 6PAXA 1ZGJA 2FF4A 3I54A 2YU3A 4P1WA 3I64A 1REPC 3DU5A 5DS9A 1E3OC 4DYCA 4N4OB 4ZDOA 2X6XA 4TV7A 5CVIA 4B44A 3ZN0A 1KU9A 1RKTA 3BG5A 2BHYA 4PCQA 2BVMA 3GF2A 4Y15A 2W1OA 2KHMA 5IY5H 2CV0A 2XRNA 3LA7A 4Q4ZF 2BBYA 4A3GJ 2LY2A 5JVTA 3PNVA 4IRGA 2IGNA 3RSNA 3S16J 5DYMA 2Z2SB 1T39A 1YE9A 1JE8A 2A5YB 3V7SA 4RAYA 3OR1C 2L0KA 1UG0A 1UHMA 2Y2ZA 4UV8A 2D5VA 1MGTA 4A6EA 5FFXA 3ABUA 2NYXA 1BBYA 5L3EA 2HOTA 2AO9A 5J1YA 4XKBA 2JT1A 4RGXA 1VQNI 1WJFA 1R5GA 3H3ZA 2IS6A 2K4JA 3PO3J 2HNHA 2I5UA 2LSOA 4RMNA 1N25A 3JRGA 5C44J 2G9WA 2WY7Q 4FX0A 3OS0A 2R7VA 3SEQA 2PQ8A 1SD7A 3UR3C 3OSFA 2M30A 3C2BA 4OAYA 2V4JC 2L4MA 4IEJA 3FKJA 4BQNA 4IRIA 3KYCB 2DFIA 2OCEA 4BE1A 4MNUA 4FETA 3OYFA 2CRGA 1JUMA 2G7HA 3O2PE 3S32A 2NVTJ 4IHYA 1XC5A 1X1DA 2I8DA 4KIBA 5LD2C 1VQ6I 1LFUP 2E2HJ 2OPTA 1BR4A 1L3LA 2BY3A 2Z3YA 3LA2A 1SVMA 3Q9VA 1PP8F 2A07F 5JVGF 3PL8A 3M1EA 1IN5A 1U2WA 2EPFA 1X1BA 4PDKA 1MSFC 1MJBA 1DPUA 2IS2A 1RETA 2OU2A 4HBLA 3FK7A 2R7TA 1MBGA 3NEUA 4JQFA 3JREA 4HF0A 3SZTA 4QLCU 3P9CA 3OYLA 4X6AJ 4CCOA 1XD7A 3K70C 4Y13A 1X19A 1FOKA 1O7FA 2L7FP 3KEOA 1YJ9I 1V5FA 5A2QK 2L7ZA 2W82A 2DOEA 1W5TA 5HLHA 1ONVA 1XMXA 1W7PB 1S72I 3QPSA 1MSEC 4CCNA 2NAZA 3KYDB 3RDIA 5K5OA 2V1DA 3MKZA 2WTEA 3PM1A 1VQ5I 4B3AA 4ENMA 3GFJA 3ML6A 3S1MJ 1XSXA 4IHTA 2CUFA 2MD0A 3RKXA 4DGWB 1G3WA 1RESA 1TW2A 2M1BA 3BJAA 2PBIA 4ZYGA 2BYVE 3ESWB 1K6OA 4WF2A 2BY1A 4JX4A 2G0EA 1S3JA 3A01B 5L3GA 2M4KA 3N05A 3MKWB 4EGZA 5HLTA 3HOTA 2WA0A 4DNCA 3K4NA 1MBJA 2YR2A 3CCRI 3WG7H 3OYJA 3HKZN 1O4XA 2GIVA 2K3PA 3L2RA 2HPMA 4B1RA 4PGGA 3JRCA 3TO7A 2QKLB 1FSEA 2BV6A 3GX4X 1S9HA 2KT0A 1XS9A 5JR3A 2VOOA 2HOEA 1X4PA 4EJOA 2VLAA 3KEQA 1P92A 4EM0B 4XKVA 5C4JJ 2DA7A 4D9JA 1B9NA 3LSIA 2J5PA 2BEOA 2D2WA 3I59A 4UUSA 4E7HA 1WFXA 5K7ZA 5B1AH 5J6XA 4ANJA 4EQQA 4IOAF 1M1EB 2Y48A 4FISA 4IL6C 3EUAA 1MBEA 3QQAA 3VYTB 2EV0A 1R4MB 2LBFB 3GTPJ 3OR2C 2XASA 2LH9A 2RNJA 5IYDJ 1Y0UA 4A0ZA 3D1NI 5EDNA 3MFKA 3A0BC 5CVJA 3D5LA 3K9TA 1FBUA 4YIIA 1ACIA 3WTVC 2CYYA 3IWZA 4BBSJ 1RRJA 3Q5FA 3G4SI 3M1CA 1HKTA 3EYYA 3K4KA 1D1AA 5KK1A 1S8NA 3SZPA 1RIOH 5GTIC 1VQMI 2QBYB 3K1MA 4ZYDA 1A6IA 1HKSA 1U3EM 1IN7A 4LD5A 5CLSA 2HYJA 3LSMA 4EJUA 5DV5A 1FPQA 4XRFA 3J7AO 3P7NA 4EJVA 4Z6YA 1OCTC 1SANA 5LRSA 4O5VA 2ZXWH 2KIFA 2ZC2A 4H4KC 5E3OA 4JOMA 5FGMA 1W1WE 1IUFA 3TMOA 3HOSA 4UVAA 4F91B 3LSPA 4IHXA 3S2HJ 1MJAA 5D4RA 4BDYA 4CCJA 5E1ZB 1ZYRF 3L2CA 4I2OA 3G3ZA 4WXDA 3HUGA 4XM3A 1YTYA 1KONA 2LMDA 3QRFF 1WJCA 3PSFA 3RI4A 2VPRA 1T8IA 1W7PA 4HYEA 4L5JA 3GWZA 4YG2F 2V26A 4M73A 4AIJA 1Z91A 1V54H 3VB2A 5BNGA 3IWFA 4G9YA 2O8XA 3TP0A 1ETYA 3OIOA 2PJRB 5DDGA 1WHUA 3WODF 4QIWN 1MBKA 1G3TA 1RR7A 2V6CA 1FSHA 2FXAA 3S3NA 1A36A 1GV5A 1GXPA 1CF7B 3I56I 2IA1A 3WTSC 1ZTRA 3X2QH 4XSXF 2Z16A 4BHBA 4BY1J 2OJED 3ECOA 3HGYA 3HIFA 3J81K 1LEAA 2NS8A 1HW1A 4FE4A 4L9TA 2QUFA 5ED4A 1J9IA 4FT8A 3MWMA 3HSRA 2WV0A 2MLKA 1S5LC 4DIQA 5K7FA 4XIDA 3BG3A 2PLYA 1ETWA 1B59A 1E3HA 2Q8KA 2WC2A 2RREA 1YO5C 3I4NJ 3HTUA 3WGGA 2E19A 2VB6A 4XR6A 1ZRDA 3JAMK 4J01A 1OLTA 1WJEA 3PIPF 2JQ7A 2WADA 1QHGA 4PSXA 2OV7A 1TWHJ 1KA8A 3V8KA 2K85A 2KMUA 2XPUA 1Z7UA 5J3LA 3W6VA 3ABKH 4ZH4F 4HA8A 2R7SA 2YU9J 2PI0A 4OMYA 3PQKA 4HQMA 1D5YA 2DYRH 3S2DJ 2FMYA 4E7KA 3FK6A 2JVHA 5JLXA 1QGPA 5ILSA 4A3FJ 3HKZA 2CV1A 2ECCA 2X9DA 2O5RA 2PMUA 3CMMA 3FWEA 3GO5A 1CGPA 2BVLA 2HS5A 1IV8A 2VN2A 3WU0A 2KL4A 3ZCOA 2F4IA 4UUTA 1RNLA 1BJAA 3HYIA 4M9XA 4RB1A 1B8IB 1FIPA 3K2AA 2QBYA 5B1BH 2LF7A 4RGRA 1NTCA 4F7ZA 5K5RA 1A5JA 1FWZA 3CCSI 3SXYA 3ZMTA 1U5TC 1DUXC 3FXMA 1WSUA 2CQKA 3HC7A 3BDDA 1W5SA 1FYKA 3J7AY 3BP8A 2JZYA 1OFCX 3ZQHA 1PDNC 2HQRA 4RM3A 2XIGA 2LYCA 5IYCJ 3F3XA 3S3OA 3FKIJ 2VKDA 3WTYC 3VSLA 5EZHA 1AA7A 3PJRA 1GVDA 3CD6I 3GBGA 3PFIA 4LB5A 4IF4A 1XSDA 3OYAA 1D0YA 2BY2A 3R60A 2B9SA 4D5CA 2DK5A 3D5SC 2JSPA 3MKLA 5BPIA 2JA8J 2WAFA 3GFMA 2IW5A 2VT3A 2STTA 2UXXA 2YSRA 1UHWA 1U5TA 2IBDA 3MD2A 3OOUA 3I58A 3IP4B 3ZR8X 3ZQIA 5H2FC 4BE2A 2W84A 2COBA 3AG1H 1BI2A 2KIQA 1T33A 2TCTA 1ZAOA 4Q47A 3BTLA 4A69C 3W2WA 4BQOA 5L3CA 3H5NA 4C3HJ 2EJRA 5KNLA 5KAIC 1I39A 3DBHB 1T0FC 4CH7A 2HOSA 3J80Z 2DT6A 1IJWC 3B02A 5H20A 2ICWG 1OCPA 4BUPA 4AM3A 2A6EF 4KA4A 3L2VA 2CMPA 3IHUA 3MQ0A 4EJTA 2R7WA 3MN2A 1I27A 5CQGA 1H9GA 3CESA 3VWBA 1MW7A 2C6YA 4GXOA 4HAMA 2PG4A 4E7IA 4RLQA 1HSJA 2XAHA 3GTGJ 3NWSA 2XAFA 4XRSG 3VFZA 2H8WA 4A2UA 4XICA 1JHFA 4M3GA 3SDBA 5FRNA 2F2EA 3ASOH 3W2AA 3IH4A 5C4XJ 5GAGJ 1I50J 5IPAA 5F27A 2CUEA 5M5WJ 1DGRM 2VXDA 2WAEA 2ISYA 2JMWA 4XN3A 1LNWA 3CTAA 3SZGA 4JX5A 1XDUA 4NBQA 3LMMA 4BHCA 4MQVA 3DPLC 1KU7A 2NOJB 5LEJA 3J81Z 3DPUA 1VNDA 2KLOA 1KYWA 2QSFX 4LB6B 4D7NA 3I3LA 1Y6IA 2P0WA 2E5ZA 3SDGA 2HKOA 4C30A 5FB2A 1HA8A 1ORKA 2PMZA 3K4MA 2KDOA 3FISA 2LG4A 1MH3A 2RNGA 3L09A 4NUBA 4U0WA 3WGHA 1XPXA 1BR2A 4WK8F 3ZQCA 3PSIA 3GLXA 3IH3A 1P7IA 4D7MA 3R0AA 3DLLF 2ESHA 1JGSA 4DJAA 4PUSA 5EEAA 2FNPA 2XB5A 2ZNZA 2ZFWA 2KJBA 5L3FA 5FLXK 1YLFA 3V8JA 4CSWA 1VQ9I 3T8RA 3ZOBA 3WTXC 3K69A 1XGOA 2XRLA 4XLAA 1J09A 3OIQA 4KUMA 4EATA 4HX8A 2ME6A 1LFPA 4U7DA 2R5ZB 3FMSA 3T0YA 3WE3A 2WWYA 3H5RA 3HOWJ 1R49A 2MSYA 3U21A 4B8XA 4AU7A 3MEXA 5LEKA 4ON0A 2A69F 1FJLA 4L9JA 1ZLJA 3TW6A 1LQ1A 3K4JA 1DQUA 2FD5A 1U0JA 3HOXJ 3N4MA 1TBXA 3BR1A 4I0BA 3PUFA 4AIDA 2GXAA 2O6GE 2B0LA 4NQWB 2EFNA 2ELJA 4HV6A 3FF5A 4CXFA 2XROA 1LPQA 1GDTA 2O0YA 4LLNA 2EIMH 4ESBA 2OF7A 3CO7C 4A5MA 2EA4A 2ELKA 2L9NA 2B7EA 3CCYA 3VDXA 4XRSA 1XSVA 4AIHA 5DM6F 2DPUA 2XSDC 2R7ZJ 3A1YA 2EA2A 2K27A 4QPQA 2FBHA 2P5LC 1SD4A 3FDYA 3MZYA 1QU3A 2OUMA 2XV4S 2R7DA 3E6CC 5AIPA 3C3WA 2XSJC 5JI6A 2HZTA 3BOQA 3GW2A 3J7ZI 3E0JB 4B09A 3BQZA 4W1UA 3BR6A 3CJTB 3LSKA 2F5EA 1KU2A 2KZVA 3K1PA 5CQEA 3WHCA 4R1HA 5B5EC 2EK5A 2R0QC 2DJNA 2LRDA 3CDHA 3RYRA 3ZMUA 2AXTC 3E3VA 5J1RA 4NDLA 4I98B 1YFHA 1Z77A 2QWWA 1VQPI 2DBBA 1YHQI 2DPDA 5IT3A 3W6JB 3KCCA 2HR3A 3ZPLA 1J7KA 3A02A 1IV6A 3F72A 3CDIA 1S29A 2HWVA 1BL0A 1BI0A 2ZXIA 4OIQF 2EILH 3E97A 5D8LB 1W36D 2BY0A 1V55H 4OIOF 4ZTFA 3UKGA 4Y3OA 4O6JA 2OCCH 4X0GA 2OTJI 4KN4X 2NNNA 2GLOA 4M3FA 2Y0SA 1R5ID 2DA1A 3M3YJ 1YW9A 1X1CA 3JTGA 2XVCA 3HRTA 3HTSB 3ZRGA 3SQNA 4M71A 2W4SA 1EJ9A 1VZ0A 4QSHA 2IXSA 2PFBA 2OQGA 2IT0A 4LJZF 4ESJA 4RGUA 2NS7A 3BR0A 1U5TB 4B3XA 2EZHA 1TQIA 1SFEA 2YX7A 3GVAA 1SD6A 1RZ4A 3L2UA 2PN6A 2VJIA 4B48A 1V5EA 3R4KA 4DOZA 3OYNA 4IHWA 4AC0A 4DZJA 1IZ1A 2A6TA 3JW4A 5GP9A 5GAEJ 4RAZA 4G7HF 1J75A 1VQ4I 2BZTA 2JRMA 1XGMA 5E20A 3RTRA 4NNJA 1Y0NA 1SC7A 5KCMA 1R1UA 3NARA 5CYVA 3L2QA 3C18A 2JK3A 3BZ6A 4ZYEA 2JWTA 3FXLA 4L9NA 4MTDA 4M72A 1Z67A 3DPTA 1P4XA 4YIRX 1MD0A 4BEHB 2P5VA 3DFGA 4G12A 3ZP5A 1UMQA 3LSGA 3OS1A 1RKWA 1P2FA 1YG2A 2Y9ZA 4WWCA 4XBFA 4HDVA 1X4OA 3QODA 2L9RA 4NB5A 1KQ9A 3ZMZA 3OYDA 4L0ZB 2G7UA 1ERDA 1ZG3A 1BOBA 3MKYB 1WJ5A 1IGNA 3BWGA 5K1YA 4A3LJ 3H5AA 3CJNA 1XMAA 5F0HA 3FXOA 4AYBN 3BR2A 3KP5A 3VOEA 2JN6A 4XN0A 3AG4H 3H3UA 2MH9A 4HSTA 4FTHA 2ID3A 2FQ4A 2DOFA 3RPQA 2L3DA 3J7YJ 4AWXB 2MGQA 1YRNB 2R93J 1T2KA 1KU3A 3DTKA 4U7BA 4BH9A 2QQ8A 3CCMI 2LBFA 1X3UA 1ZRFA 3ASNH 3CO6C 5HLIA 2VXZA 2W48A 1MMSA 3G6EI 3VODA 1B72A 3F8FA 2LY1A 5JHFA 2MH2A 4JK1X 2A05A 3CF2A 4S0HB 3CMAI 2K86A 4PZJA 2DFFA 2CW0F 2ZXJA 4Z2YA 4HNVA 5J1UA 3SYTA 4IVNA 3M8FA 1HC8A 4A6DA 2HVRA 1SD5A 4IPAA 3LFUA 2Y0SN 2YX4A 2CU7A 4C9YA 5L3DA 3OOPA 2CQXA 3CLOA 1D5VA 3GXOA 5E1XA 4HQEA 3PQJA 1R1VA 4CICA 3DEWA 1I3QJ 5D6FA 2M87A 2XAUA 4BHPA 2ELHA 3LA3A 2R7RA 3ERED 1JJ8C 2K9QA 2O8KA 3IRQA 2MYSA 5DTDA 2E1MC 2GWRA 3BJOA 3HJEA 1ZGAA 1OCOH 4KJZA 2HGCA 3M8EA 4PJNA 3ZN1A 1O3QA 1ZH5A 1LUJB 2PX9A 3ONQA 3QWLA 3U2RA 2NVXJ 3EQLF 5E3LA 2EFQA 3M7GA 3JRIA 2HYFA 2XPWA 3QPHA 1POGA 3ECHA 5FLXZ 2LREA 5B3SH 5HDNA 4LLLA 2YUSA 5HS8A 5D4SA 1OQYA 2LKPA 2DMNA 5HNHA 2HTSA 2L4AA 5E3MA 1FC3A 3OYBA 4A3EJ 4ESFA 3T1BA 4LG0B 1IRFA 3DV8A 4BQQA 1ZREA 2BW3B 1T38A 2KZGA 4M6YA 1TL8A 1OJLA 1ZRCA 2R5YB 2FA5A 3KZIC 2NOGA 3RCOA 4ENJA 1NH3A 1IG7A 1MDMA 4PSWA 2M0MA 5ICEA 3DF8A 4XRMA 3IL2A 3K0LA 2WAQN 3IAM2 5LFAA 2BW3A 3OYMA 2DMQA 2ZNYA 1FEXA 3V4GA 5IP9J 4A3DJ 3FX3A 4ETSA 2LK2A 3CZ6A 4DZPA 3TOAA 2DLLA 2HDWA 4BJ5C 1K83J 3HOZJ 2W85A 1QO0D 4HX7A 1FTZA 1FBSA 2F5VA 3EETA 4GRIA 4XKCA 4JP0A 2MG4A 4FHTA 2CH0A 2M7BA 1HSTA 1YX5A 2X0LA 3BG9A 2DT5A 2MW8A 3CJQB 1PVEA 2N8GA 3ABLH 5LHGA 3JR9A 1K78B 1Y1WJ 3O6BB 2ECBA 3I53A 4Q48A 4MIMA 4PFPA 3HUGB 1A31A 3RKQA 3BTJA 3W2VA 1JTXA 1FMWA 2MD5A 2P81A 1IN8A 3ZMSA 1G6NA 2LOOA 2DXIA 2FE3A 1LE8B 2L5QA 2E1OA 3JTHA 1EH7A 2A3SA 3S17J 4RS8A 2LP0A 4XLNF 1R23A 2CFOA 4HG2A 2H27A 1IXSB 4BAYA 3HZJA 1JXSA 1I5ZA 3DKWA 2VQHA 4NC8A 2HFHA 3FIWA 3HG9A 3K4CA 1R9TJ 1WVRA 3TP3A 1F4KA 4KITB 1LE8A 2VONA 3KP2A 1TP4A 2D1HA 5FLVA 2E34A 4D1QA 3GZNB 4BXUA 1W4MA 3C7JA 2QM3A 2KRCA 2JVGA 2VE8A 3HRMA 1RUOA 2HQAA 2Z5UA 2M34A 3BQYA 2VODA 5HOOA 1Y1VJ 3G1LA 2DQLA 2EQRA 2ZJRF 3F8NA 3V7RA 2RGVA 1O3SA 2IGMA 3AAFA 4M6VA 3H0GJ 2DA4A 2QA4I 4M9SA 2VJ5A 3A2KA 2BOLA 3I59B 3F8BA 1Z3XA 2MBFA 4MFDA 4LITA 2QGUA 4XONA 2KKOA 3L7WA 1O57A 3CMYA 1DU0A 1DPRA 2UV1A 3FXKA 4L18B 2EZIA 4I76A 1FLIA 3KYLA 2Y69H 3ZMDA 3L9FA 1LDJA 1IRGA 2PJRA 3S1RJ 1P4WA 1R5HA 2HI3A 1TZLA 4RM2A 2I10A 1GT0C 4HW0A 3WG9A 3S1QJ 3HGGA 1BR1A 2W24A 1FX7A 2EBIA 3T8TA 4I01A 3SFZA 1J5YA 5FKNA 5CJ9A 2TRTA 5D5WB 2E36A 2RQQA 1WKMA 2ZMEC 1Z1DA 1TWGJ 3C2HA 1QRYA 4A5NA 3I4PA 3KLNA 5BMZA 5GPAA 1O3TA 1BA5A 3C2GA 2IGOA 2XDVA 4G6DA 1UELB 3LNQA 2M2EA 4PJ0C 2E7XA 2DCEA 4UUSB 2X6WA 4MHGA 3CCQI 4ASNA 2X1DA 2X6OA 1YRNA 1Z0XA 4IZZA 2XGCA 5F08A 1YS7A 2Y75A 2K4BA 4DYRA 4BQAA 4KMFA 2F48A 1N78A 2Q1ZB 3P9KA 2YS9A 5F04A 2L7KA 1PJRA 4YRVA 2DAOA 3CCJI 3PO2J 1QVTA 4UVCA 3GZ6A 2F5CA 1JT0A 3K6GA 1JUSA 4UXNA 4OMZA 1Z6TA 5FKOA 3TEDA 4XMYA 4BKXA 3VSKA 1QNTA 1HLVA 3GMEA 1XN7A 4IKFA 3MMYB 2FEZA 4GCVA 4J00A 3HOUJ 4Q5SF 5DD8A 1D3YA 2MC3A 2VQGA 2M3AA 1B9MA 3LL7A 3WTUC 4G7ZF 2V1UA 4E70A 1WZ2A 3F23A 2ESNA 4M3DA 4YELA 2M8GX 1OCRH 4RLFA 1HOMA 2EB7A 1R4NB 3Q0VA 3WU1B 1WWXA 1TWAJ 1PUFB 1GLNA 4N0BA 3ABMH 1R58A 1T98A 4XK4A 5DUIA 1E17A 4ENKA 5F6FA 3IH2A 3PIOF 1ODDA 2FSWA 1TWCJ 3KE2A 1XB4A 3HSEA 1HBXG 5J4VA 2BXYA 3LQQA 5E3NA 2VBYA 1RUNA 4HLYA 5IOZA 2IA2A 4RAGA 1GHCA 5LBQA 4YIFA 4EGYA 1I1SA 1BM9A 2D45A 3CDLA 2CJJA 1G8XA 1YI2I 3KZZA 1B6AA 2D1VA 1X3WB 2M4GA 4M74A 2EWNA 4KYWA 2VPLA 3S2WA 1F5TA 1K7AA 5KAFC 4R8HA 3SHFA 4OU0A 4PJJA 1B72B 2IS4A 1YW7A 2JJ7A 3BG6A 4LK0F 2XGXA 2Y30A 4IO9F 2FBKA 1G3YA 4GFBA 2GIZA 3DKYA 1F43A 1PYVA 2ID6A 5LLQA 1U8RA 3ZQGA 2STWA 5H6RA 5IOYA 4EMSA 3U1DA 2FU4A 1AKHB 4CYCA 3OMYA 1MBFA 4L5IA 3WTZA 2P5KA 5AIQA 4EJWA 2M45A 3HHHA 4F55A 3W3CA 3GUDA 2DMPA 2K9MA 4OIRF 3TQNA 1R6RA 3I5UA 3L1PA 3GTLJ 5JLWA 2DW4A 2ZBKA 4MQ9F 4BGDA 3WE2A 3RIRA 2NS0A 1Q1VA 1IC8A 3PNYA 2KIMA 3AKZA 3E6DA 2WBMA 5IT9Z 3BZKA 3DEEA 3SEZA 3M8JA 2QENA 2DMTA 2R7UA 1LKXA 3K2ZA 3NQOA 1ETOA 3E7LA 2OD5A 2XAGA 4XLCA 2FQ3A 3M9AA 4D0PA 2DA5A 5EEHA 2CFXA 3VPRA 1MJ9A 2QVOA 2E7WA 5EGOA 1RPWA 1TQPA 3KLOA 3DTEA 3H9GA 3CC4I 3FZVA 2P7VB 4K2EA 4EEFG 1EA3A 1FP1D 3CJRB 1R7JA 5K7HA 2VOPA 2FX0A 2HTJA 1CF7A 4BEHA 1NG6A 2DTRA 1K6YA 3OL4A 5CVRA 5EF6A 4G8XA 4BACA 1SFKA 4KICA 4MEXF 1X58A 2OBPA 1UFMA 1VQOI 4AVZA 3GTJJ 1P4AA 1S7EA 3HB9A 4UUVA 3H0DA 2IRFG 1IDZA 1ULYA 2XF6A 1QHHD 2QF7A 2Q0OA 3H35A 4N9IA 4A0YA 5C3EJ 2L7MP 2IVMA 2COMA 1I1GA 3AG3H 2W00A 2WV1A 1YQAA 1STZA 1NHAA 4N4NB 3HOYJ 1JHHA 5M3MJ 4HF1A 1ZG1A 4CZZA 3MZHA 3VYSB 4CZCA 4OAZA 5J8CA 2DYSH 1R36A 2XKOA 1EH6A 1QVUA 4HV5A 1JUPA 1E0EA 2W57A 3HPHA 3HM5A 1XTAA 3ISPA 3MAJA 4MTEA 3RJPA 2CQQA 2F6CA 4BYYA 2OZ6A 4ITVA 2CGPA 5KHDA 1ZLKA 2E5NA 2ZO4A 5D5UB 3PFYA 4BL0B 2Z9OA 2VE9A 4HF2A 2J5OA 1IRZA 4LG0A 1TTYA 1IO2A 4QWQA 5TGTA 2OA4A 2IS1A 1MZBA 5E8IA 4M3EA 1T0FA 1FP2A 3GEZA 4LIUA 5DM7F 5DUKA 2X48A 4G94A 3F8CA 4UVBA 4KFCA 2EFWA 3V42A 1VQLI 4BBRJ 1AU7A 3VYUB 3KZYA 3AFHA 5B66C 3S93A 1KGSA 4DBRA 4KIGA 3MVPA 3A4CA 3M07A 3KPHA 4F52A 4XLEA 2Q2EB 4IXAA 1LJ9A 2VIXA 2K9LA 1BW5A 4CYCB 1IAWA 2LKSA 2X1EA 3CCUI 1FIAA 1YITI 4FASD 3BCBA 4CCMA 3OYCA 4LOCA 2CW8A 2KDZA 1Y8RB 2RVCA 4ZC3A 4XLFA 5J8FA 1JT6A 2LTPA 4PFOA 3TDUC 4E6KG 4BJTA 3KX2A 3S15J 3BCAA 1D8KA 2XHKA 4YEJA 2E1CA 1DGWY 3GLLA 5JFRA 4DQ2A 5DCMB 4JX6A 3RQ4A 4KT6A 5D5VB 3FHZA 4KISA 5F64A 2R92J 2KRFA 5E79C 2FMLA 2XPVA 3F8MA 3DLAA 4XORA 4JYKA 3LSJA 1TNSA 1ZK8A 4GGGA 4S05A 2KRHA 5EEGA 1XGNA 2JA6J 1P9QC 2M7AA 3A01A 1G59A 3A03A 5IT9K 3DEUA 2XF5A 1NG7A 1JI8A 1BN5A 1XG1A 1YJNI 2JPBA 5LRRA 1BI3A 3CUQA 1LFBA 4A3JJ 4A3MJ 4XLHA 4IHSA 2ZSHB 4F92B 1AOYA 2ZMEA 3EDPA 5IP7J 3QU3A 2EFPA 2CSOA 2VKVA 1WGXA 1J0RA 1Y39A 4U0YA 5FFZA 2H6CA 4ZZDA 2AQFA 1U6GA 2X4HA 3EUHA 2XAQA 3BG7A 3LAPA 2L2OA 2E60A 4P5OA 2QSHX 3ZMVA 1HF0A 2Z33A 2IJLA 2JUCA 5K5QA 3F22A 1JJ6C 3DP7A 1VQ7I 2X85A 4DYQA 2GBYA 3FBIB 3OS2A 4XKWA 2DJIA 1QQIA 2MLGA 2Z99A 1USTA 2L02A 4HNUA 2L9SA 3S3MA 3HEFA 2VASA 1XGSA 1W0UA 1OMIA 3RZDJ 4U88A 5KVRA 1VI0A 3ZQ7A 1E2XA 3G2BA 1QPMA 3B73A 5FD6A 1V5GA 2DDAA 1ZHFA 1BC8C 4ZTJA 1U9NA 3GTKJ 2GZWA 4UV9A 3RYPA 1HDPA 3FM3A 3H36A 3CC7I 2O3FA 2XB0X 4I09A 3TL4X 1X1PA 4YFNF 2HVSA 2HZDA 2BE5F 1H9TA 2GM4A 1YW8A 5GTHC 3DKXA 2DMUA 3F6VA 1WI3A 1HW5A 2CW7A 3OYGA 1AHDP 3WTTC 1A6QA 2ZJPF 4RBOA 4KIFA 4EM2A 1B1BA 1USSA 2KISA 3DBLB 2HOAA 1T6SA 1MMNA 2HQNA 3IV5A 1FT9A 1EV7A 1ZR2A 3CCEI 1DP7P 2XGEA 1RR8C 1U9OA 1FTTA 1JKQC 2PJPA 2ZB9A 4P96A 5FLMJ 4V19K 3BR5A 2JA2A 2H1KA 2DTZA 4R79A 2CV2A 1L0OC 3PUBA 1PUFA 4FX4A 2P7CB 4MGRA 4RA2A 1U8BA 2Q2EA 3BY6A 2GOXB 1PP7U 2QKMB 3LSTA 2DI3A 1SFXA 3B6CA 1C0WA 1IXRC 4PGHA 3HRSA 1RC9A 5CKTA 3GYHX 4BXFA 1QBJA 4KNYA 1Q1HA 4FCYA 3RZOJ 4N9HA 2ZCWA 3OV8A 3QU6A 4V2FA 4BY7J 4RDUA 2F4OB 3EUKL 3FXJA 1QZEA 3CP2A 4BDZA 1UAAA 1APLC 3VEPA 1TT0A 2CG4A 5HS9A 1SMTA 5E1WA 4NHJA 1Y8QB 3DU6A 3HDDA 1OYYA 1YIOA 1D0XA 3ULQB 4YFKF 1WQ2A 1ZKGA 2GQQA 2PMZN 1G3SA 4E7ZA 3L00A 2HU9A 3OL3A 4S04A 4IOCF 5D8KB 3F6OA 3BTIA 4F93B 3U1KA 4P9UA 1X2MA 2H94A 3LWFA 4BE0A 1ZGWA 3BC8A 4HX4A 2JRTA 3IC7A 1FNNA 1SAXA 5E8GA 2ZSIB 2Y9YA 1R1TA 3BROA 4UHTA 1VFCA 4D5FA 1JKRC 4LFUA 3JRAA 3OYIA 2Y31A 4IJAA 2H6BA 2X1CA 4KT5C 2H09A 2O03A 2OZUA 2K7LA 3GZ5A 5IP6A 3LSRA 2CUZA 3DQVC 1G4DA 5HODA 4FQGA 4W97A 1K4TA 3GTOJ 3HRUA 2NXNB 2X51A 3O8GA 1SVOA 3I4MJ 2V6EA 2EINH 3IAS2 3O3KA 3WU2C 4P9FA 5EG0A 2BHZA 3I0TA 3QPTA 1TT5B 3S14J 2KP6A 3QYBA 3BPXA 4C2TA 1A35A 2YPRA 3K1NA 5CVUA 5F0FA 1FOYA 3CP8A 4MEYF 5E17F 4A3IJ 1IRXA 4HRIA 3ZGKA 1R22A 5M5XJ 2A61A 5E18F 1KYZA 5FO5A 2VQLA 2UWMA 2DOAA 3V8LA 1VQKI 2RDPA 2LY9A 2DFHA 4WXHA 3U9GA 2PMHA 2KFDA 3QAHA 1DP3A 3BPVA 5IYBJ 4HPQA 2RN7A 3RPUD 2HXIA 1OPCA 3P9IA 2QEXI 3G71I 1KQ8A 1BJZA 1FYMA 3GTMJ 1Z05A 3DBRB 1T56A 1ON2A 3QPLA 4GDFA 3CUQC 3OYKA 1AWCA 3TGNA 1XDSA 3HPGA 3JSOA 1S7OA 1ZG5A 2QQBA 4OOIA 3WGIA 1BI1A 2Y0MA 2H8RA 3DCFA 1MNEA 2K40A 4QPOA 2GA1A 2ME0A 2CQ7A 1EF4A 5ICCA 2IGKA 3A0HC 3REOA 4KDPA 5AONA 2JSCA 1HDDC 3NAUA 1VTNC 2MC4A 2P8TA 1WH7A 2K02A 2V9PA 1HW2A 2VJJA 4C3IJ 4HSRA 3T5XA 3L2WA 4C2UA 4HEA2 1OR7A 2E1MB 2R7OA 4ZDPA 1U78A 4ZJZA 4ZYHA 1WI9A 3QP5A 3HHGA 3ZQQA 4I02A 1LEBA 2R4GA 4Y33A 2AS5F 3I55I 2ZKZA 2WB1N 4KMUX 2UXNA 2NVQJ 4A3CJ 4G6QA 1ETKA 1S7AA 3SFIA 2B63J 2FNAA 2HPIA 3BLYA 5GADJ 1T95A 2VKHA 1IUYA 1BOAA 1JGGA 3QYEA 4GO1A 1QA6A 1P6RA 2DA2A 3K70D 2RAEA 3HOVJ 5ERIA 1X3ZB 2L54A 2VBZA 4RB0A 5GAHJ 2CUJA 2JA5J 1MKMA 1D0ZA 1OKRA 1UB9A 4ZZLA 3ZQLA 4LMYA 3E5QA 2QQAA 2DO7A 1MNMC 2ZXHA 1Z21A 2VJ4A 1V3FA 3IKTA 2E71A 3G1OA 1ON1A 3K4LA 1NK2P 3HSFA 3H92A 3M4OJ 2F5FA 1R00A 5LGTA 2LLKA 4HLXA 4EVIA 2XGDA 3CF5F 4E7LA 1MMGA 4LGWA 1LB2A 1F9NA 2EV5A 3COAC 3RKYA 1GVJA 4JBAA 4XSZF 4BXXJ 3BZCA 4PK4A 5JHUA 2M0CA 4EM1A 4OWRB 3OYHA 4OIPF 1TNTA 2XKPA 5LGUA 4O3MA 1OCCH 5CPRB 2VC1A 4RAFA 5ILVA 5HNFA 1OR7C 5TJJA 5BQTA 1Z3YA 4M6XA 2HXOA 4MO7A 4BNCA 4CDGA 1DDNA 1SVLA 1VF9A 1H8AC 3E6MA 2EIKH 1KQ0A 1IN4A 2MA3A 4E4HA 4QTRA 1N77A 2NVYJ 1KZHA 1LVKA 2RV8A 3GCMA 3RQIA 4PJMA 2JTVA 3CCLI 1EKEA 2QCOA 3LOCA 1LVAA 3JAMZ 3IRRA 2O9LA 2OQRA 4J19A 1FOXA 2XF7A 3KP6A 2GXBA 2RQPA 4AVPA
chains in the Genus database with same CATH topology
4AC0A 4DZJA 5EF6A 5GP9A 1RESA 1X58A 2R5ZA 1K61A 1QPIA 4Y7NJ 3GTQJ 1HCRA 3GTJJ 3Q0WA 1S7EA 3NARA 2G0EA 3G1MA 4JX4A 3HB9A 3A01B 1IDZA 2QF7A 5C3EJ 1ENHA 2JK3A 2L7MP 1MBJA 2E2IJ 2JWTA 3JRBA 3OSGA 2WV1A 3HKZN 1O4XA 3HOYJ 5M3MJ 4G12A 1UMQA 4MLOA 4B1RA 3LSGA 1RKWA 3JRCA 2Y9ZA 5M3FJ 1ZR4A 2KT0A 2L9RA 3JRDA 1XS9A 1QVUA 2E2JJ 1JUPA 3SJMA 3HM5A 1MBHA 5C4JJ 2CQQA 2DA7A 1IGNA 4UUSA 3K7AJ 5K7ZA 3TW7A 4A3LJ 1IRZA 4FISA 5F0HA 1MBEA 3QQAA 4M3EA 4AYBN 3GTPJ 3BR2A 2JN6A 5IYDJ 3D1NI 5EDNA 2X48A 4FTHA 5FJ8J 2ID3A 4BBRJ 1AU7A 2FQ4A 1B8IA 4BBSJ 2MGQA 1YRNB 2R93J 4IHVA 3MVPA 1UHSA 2W48A 1A6IA 1B72A 4DW6A 1BW5A 4CYCB 5FKLA 4S0HB 1ZQ3P 2HYJA 1FIAA 1OCTC 4HNVA 5J1UA 4LOCA 1SANA 2KDZA 4X1EA 1JT6A 2LTPA 5E3OA 1IUFA 2Y0SN 3S15J 2DA6A 2CU7A 4L5EA 3BTCA 3LSPA 4IHXA 3S2HJ 2CQXA 1G2HA 4JX6A 1ETVA 2VI6A 2R92J 3DEWA 1I3QJ 2XPVA 3Q3SA 4JYKA 3LSJA 1ZK8A 1WPKA 1I6HJ 1JJ8C 2K9QA 2JA6J 2O8KA 5GPCA 3A01A 1BW6A 5DTDA 2EH3A 2VPRA 3A03A 1XG1A 2AHQA 2NVXJ 3B6AA 1LFBA 5E3LA 4A3JJ 4A3MJ 5F0CA 3JRIA 4I6ZA 5BNGA 2XPWA 5IP7J 2IEKA 3TP0A 2LR8A 4B4CA 1ETYA 1POGA 2VKVA 3OIOA 2JA7J 1WGXA 4QIWN 1MBKA 1RR7A 4C3JJ 1GV2A 2M9HA 1GV5A 2YUSA 1WH5A 2DMNA 5EG0B 1ZTRA 5E3MA 1HF0A 4BY1J 4A3EJ 1JJ6C 3HGYA 1IDYA 2NS8A 4DYQA 4A3BJ 2GBYA 4FE4A 1AKHA 2EZLA 4AUXA 1OJLA 2R5YB 2NOGA 5K7FA 4XIDA 1IG7A 3HEFA 1W0UA 3BG3A 2LD5A 1ETWA 3I4NJ 4XRMA 3RZDJ 1JKOC 2E19A 1VI0A 2WAQN 2DMQA 1FEXA 5IP9J 4A3DJ 1TWHJ 2LK2A 1JTYA 2XPUA 4DZPA 1U9NA 3Q0UA 5J3LA 3GTKJ 1K83J 3W6VA 1HDPA 3HOZJ 1NK3P 2YU9J 5M5YJ 1FTZA 2XB0X 1GUUA 4JP0A 2MG4A 2GM4A 1ETXA 1D5YA 3S2DJ 3BG9A 3FK6A 2MW8A 5JLXA 2DMUA 2LVSA 1AHDP 1WI3A 2N8GA 4A3FJ 2DN0A 2K9SA 4C2MJ 4RBOA 3JR9A 2ECCA 2X9DA 1Y1WJ 2ECBA 3BT9A 3BR3A 2HOAA 4MIMA 3IV5A 3RKQA 3BTJA 1JTXA 1ZR2A 1H88C 2P81A 4UUTA 2XGEA 1U9OA 1B8IB 1FTTA 1JKQC 1FIPA 2ZB9A 3K2AA 5FLMJ 1NTCA 1A5JA 3BR5A 1LE8B 3JRFA 4FE7A 3WHBA 2E1OA 2FJ1A 2DTZA 2H1KA 1UG2A 3S17J 1PUFA 2HQ5A 1U8BA 2LP0A 1OFCX 3ZQHA 2EZKA 3B6CA 4V2GA 5IYCJ 3FKIJ 3FIWA 5EZHA 1GVDA 2K9NA 1P7JA 2O7OA 3GBGA 3F0CA 4FCYA 3RZOJ 1ETQA 4V2FA 4RDUA 4BY7J 1R9TJ 1TC3C 3HBLA 1W0TA 4D5CA 1MH4A 3TP3A 5F1JA 1SFOJ 4ABZA 1APLC 3MKLA 2JA8J 1LE8A 5FLVA 4A3KJ 1H89C 3JRHA 9ANTA 3OOUA 2IBDA 3HDDA 3ZQIA 1ZKGA 2COBA 2PMZN 5EGOB 4Y52J 1T33A 2M34A 2TCTA 3BQYA 3S1NJ 3BTLA 4A69C 1Y1VJ 3BTIA 3G1LA 2EQRA 4C3HJ 1X2MA 3H3VK 4M6VA 2HOSA 3H0GJ 2R5YA 1ZGWA 2DA4A 1IJWC 1WCMJ 2LKXA 1OCPA 2Y9YA 4MFDA 1VFCA 4D5FA 3CMYA 1JKRC 1DU0A 3JRAA 2HDDA 2Y31A 2EZIA 4I76A 3MN2A 3LSRA 5IP6A 5HODA 3S1RJ 5EYRA 2HI3A 4W97A 3GTOJ 2I10A 3O8GA 3I4MJ 1GT0C 3S1QJ 3HGGA 3GTGJ 2EBIA 4XRSG 4XICA 5EG0A 4M3GA 5FKNA 5C4XJ 1X2NA 3IH4A 3S14J 2TRTA 1I50J 5IPAA 5F27A 2CUEA 4M3BA 5M5WJ 1TWGJ 1QRYA 2JMWA 3CQZJ 5EZGA 5F0FA 4JX5A 5GPAA 1CQTA 1BA5A 4A3IJ 1VNDA 5M5XJ 3LNQA 1ITYA 2LFBA 2M2EA 3O8HA 4D7NA 4UUSB 3SDGA 4A93J 2LY9A 1ORKA 2X6OA 3FISA 1MH3A 1YRNA 5IYBJ 2HXIA 3ZQCA 1Z0XA 2VUMJ 3IH3A 2XGCA 1TWFJ 5F08A 5FKKA 1P7IA 1F36A 2DA3A 1DU6A 1BJZA 2IAIA 4D7MA 4DYRA 3GTMJ 2YS9A 1T56A 3QPLA 3ZQFA 5EEAA 2XB5A 4MFEA 5F04A 1JKPC 5FKMA 2VKEA 3ZOBA 3PO2J 1QVTA 2XRLA 2H8RA 1JT0A 3DCFA 1JUSA 2R5ZB 2ME6A 2K40A 5FKOA 3TEDA 4BKXA 5DS9A 1HLVA 1E3OC 4DYCA 2ME0A 3HOWJ 3HOUJ 1EF4A 2MSYA 1RKTA 1FJLA 3BG5A 3TW6A 1HDDC 3NAUA 1WH7A 2FD5A 4M3DA 2M8GX 3HOXJ 4C3IJ 1HOMA 3Q0VA 1PUFB 4A3GJ 3BR1A 1TWAJ 1U78A 3S16J 4XK4A 1GDTA 3IH2A 2L0KA 2OF7A 2Y2ZA 2D5VA 2WB1N 2NVQJ 4A3CJ 1TWCJ 2ELKA 3CCYA 1ETKA 4XRSA 3SFIA 2B63J 2XSDC 2R7ZJ 5E3NA 2HOTA 2AO9A 5J1YA 1JGGA 2DA2A 5IOZA 2RAEA 3HOVJ 3CDLA 2CJJA 3BQZA 3PO3J 2JA5J 4W1UA 3BR6A 3JRGA 5C44J 3ZQLA 3OSFA 3WHCA 1MNMC 3C2BA 1B72B 4IEJA 2JJ7A 2R0QC 2DJNA 2Y30A 3G1OA 1NK2P 4GFBA 3M4OJ 2CRGA 5J1RA 4NDLA 1F43A 2ID6A 1JUMA 3ZQGA 2NVTJ 2LLKA 1Z77A 5IOYA 4IHYA 1XC5A 2XGDA 1AKHB 4CYCA 1MBFA 1LFUP 2E2HJ 2OPTA 3A02A 1IV6A 2DMPA 3L1PA 1BL0A 3GTLJ 5JLWA 4BXXJ 1MSFC 2M0CA 1IC8A 1Q1VA 1RETA 3UKGA 3FK7A 1MBGA 3JREA 2GLOA 4M3FA 2DA1A 3M3YJ 2DMTA 4X6AJ 2L7FP 1ETOA 2HXOA 4MO7A 3E7LA 1VF9A 1H8AC 4QSHA 2L7ZA 2DA5A 3VPRA 4QTRA 5EGOA 1RPWA 2NVYJ 3QPSA 1MSEC 3RQIA 4EEFG 2NS7A 3BR0A 5K7HA 2QCOA 3LOCA 3PM1A 2FX0A 2EZHA 4B3AA 2O9LA 4J19A 3S1MJ 2CUFA 4IHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC0 A;  4DZJ A;  5EF6 A;  5GP9 A;  1RES A;  1X58 A;  2R5Z A;  1K61 A;  1QPI A;  4Y7N J;  3GTQ J;  1HCR A;  3GTJ J;  3Q0W A;  1S7E A;  3NAR A;  2G0E A;  3G1M A;  4JX4 A;  3HB9 A;  3A01 B;  1IDZ A;  2QF7 A;  5C3E J;  1ENH A;  2JK3 A;  2L7M P;  1MBJ A;  2E2I J;  2JWT A;  3JRB A;  3OSG A;  2WV1 A;  3HKZ N;  1O4X A;  3HOY J;  5M3M J;  4G12 A;  1UMQ A;  4MLO A;  4B1R A;  3LSG A;  1RKW A;  3JRC A;  2Y9Z A;  5M3F J;  1ZR4 A;  2KT0 A;  2L9R A;  3JRD A;  1XS9 A;  1QVU A;  2E2J J;  1JUP A;  3SJM A;  3HM5 A;  1MBH A;  5C4J J;  2CQQ A;  2DA7 A;  1IGN A;  4UUS A;  3K7A J;  5K7Z A;  3TW7 A;  4A3L J;  1IRZ A;  4FIS A;  5F0H A;  1MBE A;  3QQA A;  4M3E A;  4AYB N;  3GTP J;  3BR2 A;  2JN6 A;  5IYD J;  3D1N I;  5EDN A;  2X48 A;  4FTH A;  5FJ8 J;  2ID3 A;  4BBR J;  1AU7 A;  2FQ4 A;  1B8I A;  4BBS J;  2MGQ A;  1YRN B;  2R93 J;  4IHV A;  3MVP A;  1UHS A;  2W48 A;  1A6I A;  1B72 A;  4DW6 A;  1BW5 A;  4CYC B;  5FKL A;  4S0H B;  1ZQ3 P;  2HYJ A;  1FIA A;  1OCT C;  4HNV A;  5J1U A;  4LOC A;  1SAN A;  2KDZ A;  4X1E A;  1JT6 A;  2LTP A;  5E3O A;  1IUF A;  2Y0S N;  3S15 J;  2DA6 A;  2CU7 A;  4L5E A;  3BTC A;  3LSP A;  4IHX A;  3S2H J;  2CQX A;  1G2H A;  4JX6 A;  1ETV A;  2VI6 A;  2R92 J;  3DEW A;  1I3Q J;  2XPV A;  3Q3S A;  4JYK A;  3LSJ A;  1ZK8 A;  1WPK A;  1I6H J;  1JJ8 C;  2K9Q A;  2JA6 J;  2O8K A;  5GPC A;  3A01 A;  1BW6 A;  5DTD A;  2EH3 A;  2VPR A;  3A03 A;  1XG1 A;  2AHQ A;  2NVX J;  3B6A A;  1LFB A;  5E3L A;  4A3J J;  4A3M J;  5F0C A;  3JRI A;  4I6Z A;  5BNG A;  2XPW A;  5IP7 J;  2IEK A;  3TP0 A;  2LR8 A;  4B4C A;  1ETY A;  1POG A;  2VKV A;  3OIO A;  2JA7 J;  1WGX A;  4QIW N;  1MBK A;  1RR7 A;  4C3J J;  1GV2 A;  2M9H A;  1GV5 A;  2YUS A;  1WH5 A;  2DMN A;  5EG0 B;  1ZTR A;  5E3M A;  1HF0 A;  4BY1 J;  4A3E J;  1JJ6 C;  3HGY A;  1IDY A;  2NS8 A;  4DYQ A;  4A3B J;  2GBY A;  4FE4 A;  1AKH A;  2EZL A;  4AUX A;  1OJL A;  2R5Y B;  2NOG A;  5K7F A;  4XID A;  1IG7 A;  3HEF A;  1W0U A;  3BG3 A;  2LD5 A;  1ETW A;  3I4N J;  4XRM A;  3RZD J;  1JKO C;  2E19 A;  1VI0 A;  2WAQ N;  2DMQ A;  1FEX A;  5IP9 J;  4A3D J;  1TWH J;  2LK2 A;  1JTY A;  2XPU A;  4DZP A;  1U9N A;  3Q0U A;  5J3L A;  3GTK J;  1K83 J;  3W6V A;  1HDP A;  3HOZ J;  1NK3 P;  2YU9 J;  5M5Y J;  1FTZ A;  2XB0 X;  1GUU A;  4JP0 A;  2MG4 A;  2GM4 A;  1ETX A;  1D5Y A;  3S2D J;  3BG9 A;  3FK6 A;  2MW8 A;  5JLX A;  2DMU A;  2LVS A;  1AHD P;  1WI3 A;  2N8G A;  4A3F J;  2DN0 A;  2K9S A;  4C2M J;  4RBO A;  3JR9 A;  2ECC A;  2X9D A;  1Y1W J;  2ECB A;  3BT9 A;  3BR3 A;  2HOA A;  4MIM A;  3IV5 A;  3RKQ A;  3BTJ A;  1JTX A;  1ZR2 A;  1H88 C;  2P81 A;  4UUT A;  2XGE A;  1U9O A;  1B8I B;  1FTT A;  1JKQ C;  1FIP A;  2ZB9 A;  3K2A A;  5FLM J;  1NTC A;  1A5J A;  3BR5 A;  1LE8 B;  3JRF A;  4FE7 A;  3WHB A;  2E1O A;  2FJ1 A;  2DTZ A;  2H1K A;  1UG2 A;  3S17 J;  1PUF A;  2HQ5 A;  1U8B A;  2LP0 A;  1OFC X;  3ZQH A;  2EZK A;  3B6C A;  4V2G A;  5IYC J;  3FKI J;  3FIW A;  5EZH A;  1GVD A;  2K9N A;  1P7J A;  2O7O A;  3GBG A;  3F0C A;  4FCY A;  3RZO J;  1ETQ A;  4V2F A;  4RDU A;  4BY7 J;  1R9T J;  1TC3 C;  3HBL A;  1W0T A;  4D5C A;  1MH4 A;  3TP3 A;  5F1J A;  1SFO J;  4ABZ A;  1APL C;  3MKL A;  2JA8 J;  1LE8 A;  5FLV A;  4A3K J;  1H89 C;  3JRH A;  9ANT A;  3OOU A;  2IBD A;  3HDD A;  3ZQI A;  1ZKG A;  2COB A;  2PMZ N;  5EGO B;  4Y52 J;  1T33 A;  2M34 A;  2TCT A;  3BQY A;  3S1N J;  3BTL A;  4A69 C;  1Y1V J;  3BTI A;  3G1L A;  2EQR A;  4C3H J;  1X2M A;  3H3V K;  4M6V A;  2HOS A;  3H0G J;  2R5Y A;  1ZGW A;  2DA4 A;  1IJW C;  1WCM J;  2LKX A;  1OCP A;  2Y9Y A;  4MFD A;  1VFC A;  4D5F A;  3CMY A;  1JKR C;  1DU0 A;  3JRA A;  2HDD A;  2Y31 A;  2EZI A;  4I76 A;  3MN2 A;  3LSR A;  5IP6 A;  5HOD A;  3S1R J;  5EYR A;  2HI3 A;  4W97 A;  3GTO J;  2I10 A;  3O8G A;  3I4M J;  1GT0 C;  3S1Q J;  3HGG A;  3GTG J;  2EBI A;  4XRS G;  4XIC A;  5EG0 A;  4M3G A;  5FKN A;  5C4X J;  1X2N A;  3IH4 A;  3S14 J;  2TRT A;  1I50 J;  5IPA A;  5F27 A;  2CUE A;  4M3B A;  5M5W J;  1TWG J;  1QRY A;  2JMW A;  3CQZ J;  5EZG A;  5F0F A;  4JX5 A;  5GPA A;  1CQT A;  1BA5 A;  4A3I J;  1VND A;  5M5X J;  3LNQ A;  1ITY A;  2LFB A;  2M2E A;  3O8H A;  4D7N A;  4UUS B;  3SDG A;  4A93 J;  2LY9 A;  1ORK A;  2X6O A;  3FIS A;  1MH3 A;  1YRN A;  5IYB J;  2HXI A;  3ZQC A;  1Z0X A;  2VUM J;  3IH3 A;  2XGC A;  1TWF J;  5F08 A;  5FKK A;  1P7I A;  1F36 A;  2DA3 A;  1DU6 A;  1BJZ A;  2IAI A;  4D7M A;  4DYR A;  3GTM J;  2YS9 A;  1T56 A;  3QPL A;  3ZQF A;  5EEA A;  2XB5 A;  4MFE A;  5F04 A;  1JKP C;  5FKM A;  2VKE A;  3ZOB A;  3PO2 J;  1QVT A;  2XRL A;  2H8R A;  1JT0 A;  3DCF A;  1JUS A;  2R5Z B;  2ME6 A;  2K40 A;  5FKO A;  3TED A;  4BKX A;  5DS9 A;  1HLV A;  1E3O C;  4DYC A;  2ME0 A;  3HOW J;  3HOU J;  1EF4 A;  2MSY A;  1RKT A;  1FJL A;  3BG5 A;  3TW6 A;  1HDD C;  3NAU A;  1WH7 A;  2FD5 A;  4M3D A;  2M8G X;  3HOX J;  4C3I J;  1HOM A;  3Q0V A;  1PUF B;  4A3G J;  3BR1 A;  1TWA J;  1U78 A;  3S16 J;  4XK4 A;  1GDT A;  3IH2 A;  2L0K A;  2OF7 A;  2Y2Z A;  2D5V A;  2WB1 N;  2NVQ J;  4A3C J;  1TWC J;  2ELK A;  3CCY A;  1ETK A;  4XRS A;  3SFI A;  2B63 J;  2XSD C;  2R7Z J;  5E3N A;  2HOT A;  2AO9 A;  5J1Y A;  1JGG A;  2DA2 A;  5IOZ A;  2RAE A;  3HOV J;  3CDL A;  2CJJ A;  3BQZ A;  3PO3 J;  2JA5 J;  4W1U A;  3BR6 A;  3JRG A;  5C44 J;  3ZQL A;  3OSF A;  3WHC A;  1MNM C;  3C2B A;  1B72 B;  4IEJ A;  2JJ7 A;  2R0Q C;  2DJN A;  2Y30 A;  3G1O A;  1NK2 P;  4GFB A;  3M4O J;  2CRG A;  5J1R A;  4NDL A;  1F43 A;  2ID6 A;  1JUM A;  3ZQG A;  2NVT J;  2LLK A;  1Z77 A;  5IOY A;  4IHY A;  1XC5 A;  2XGD A;  1AKH B;  4CYC A;  1MBF A;  1LFU P;  2E2H J;  2OPT A;  3A02 A;  1IV6 A;  2DMP A;  3L1P A;  1BL0 A;  3GTL J;  5JLW A;  4BXX J;  1MSF C;  2M0C A;  1IC8 A;  1Q1V A;  1RET A;  3UKG A;  3FK7 A;  1MBG A;  3JRE A;  2GLO A;  4M3F A;  2DA1 A;  3M3Y J;  2DMT A;  4X6A J;  2L7F P;  1ETO A;  2HXO A;  4MO7 A;  3E7L A;  1VF9 A;  1H8A C;  4QSH A;  2L7Z A;  2DA5 A;  3VPR A;  4QTR A;  5EGO A;  1RPW A;  2NVY J;  3QPS A;  1MSE C;  3RQI A;  4EEF G;  2NS7 A;  3BR0 A;  5K7H A;  2QCO A;  3LOC A;  3PM1 A;  2FX0 A;  2EZH A;  4B3A A;  2O9L A;  4J19 A;  3S1M J;  2CUF A;  4IHW A; 
#chains in the Genus database with same CATH topology
 2P4W A;  3QP6 A;  1SEU A;  3ERM A;  2VBW A;  2R5Z A;  1I3A A;  1HKQ A;  2JPC A;  1MMA A;  4LIV A;  1K61 A;  3DTI A;  4Y7N J;  1QPI A;  3GTQ J;  2VT2 A;  1HCR A;  1XMK A;  3Q0W A;  3LFK A;  3TO6 A;  2M8E A;  3H1C A;  3G1M A;  4HZF A;  1I6X A;  2OTL I;  3CC2 I;  1ENH A;  1OYI A;  2GXG A;  4II3 A;  3RKW A;  4G7O F;  1RI7 A;  2A5W A;  2E2I J;  4IRH A;  2K3F A;  3JRB A;  3OSG A;  1J59 A;  2KPM A;  3FXR A;  4LLG F;  4XQF A;  2V7F A;  4MLO A;  3FM5 A;  3FXQ A;  5M3F J;  2ACJ A;  1ZR4 A;  2QQ9 A;  3JRD A;  2LNB A;  2EV6 A;  2E2J J;  4GYI A;  3SJM A;  4CHU A;  1K79 A;  1MBH A;  4F3Q A;  1BIB A;  3D5R C;  1QZZ A;  2W25 A;  3K7A J;  1F1Z A;  3TW7 A;  2DT7 B;  3I9V 2;  4RB2 C;  2K5C A;  4L0Y B;  3AG2 H;  5FRO A;  3CME I;  3OWT A;  3FMQ A;  3DXJ F;  5FJ8 J;  2QSG X;  1B8I A;  3OIP A;  5BS6 A;  1FBQ A;  2FOW A;  2QZ8 A;  4IHV A;  3V7C A;  1WJB A;  3FBN B;  2V1X A;  2DDB A;  1UHS A;  2L9V A;  4CGZ A;  1V4R A;  2E1N A;  3NWT A;  1O7L A;  4UB8 C;  2VQC A;  1MMD A;  2QLZ A;  3W6K B;  2X6Y A;  2FBI A;  3MCZ A;  3QOE A;  5F1R A;  2IP2 A;  4DW6 A;  5DD4 A;  5FKL A;  1ZQ3 P;  1YIJ I;  3WTW C;  5J4Y A;  4CO8 A;  1OYW A;  4AD9 A;  4WCG A;  4GYG A;  2H1L A;  2HVQ A;  5ICG A;  4X1E A;  2UUZ A;  4ZYA A;  2DOD A;  1MND A;  4XOP A;  3K10 A;  1W36 C;  3DWL E;  1BIA A;  2DA6 A;  1LDD A;  3EPZ A;  4L5E A;  2FOK A;  4G6T B;  1WRJ A;  3BTC A;  4IQJ A;  2AXL A;  1G2H A;  1ETV A;  1SAU A;  3FHN A;  2VI6 A;  4H0E A;  4XL9 A;  3Q3S A;  4AYB A;  3CCV I;  1WPK A;  3BJ6 A;  3CUQ B;  3ELK A;  4IQ4 A;  1I6H J;  5BOX A;  4PJL A;  5GPC A;  4ZDL A;  1BW6 A;  4HOB A;  1TQM A;  2EH3 A;  2ZFU A;  4P55 A;  3TBI A;  4ENN A;  2VL8 A;  4XNF A;  2AHQ A;  2L01 A;  4RGS A;  3E5U A;  1TW3 A;  3B6A A;  2R7X A;  5J40 A;  1XX5 A;  5F0C A;  3RPU A;  2ISZ A;  4I6Z A;  2ETH A;  4DBQ A;  2HYG D;  2OAZ A;  1OIS A;  2IEK A;  4B4C A;  2LR8 A;  2RC4 A;  3VYR B;  5DCF A;  2JA7 J;  3IKV A;  2IA0 A;  1FY7 A;  2CQN A;  4C3J J;  1YS6 A;  4WX9 A;  1IN6 A;  2JUG A;  5ILU A;  3H9J A;  1FZP B;  1GV2 A;  2M9H A;  1WJD A;  1WH5 A;  2P6S A;  3EUH C;  5D6E A;  2MAB A;  5EG0 B;  4IX7 A;  3I71 A;  3P5J A;  4Y4R A;  2DK8 A;  3F21 A;  2Z1D A;  3JCU C;  1ZAR A;  1IDY A;  4A3B J;  3HL2 A;  2FRH A;  5DEQ A;  2XUB A;  1Z7L A;  1AKH A;  2EZL A;  1YYV A;  4M9Z A;  4NQW A;  4AUX A;  5ICF A;  4CA0 A;  1E3P A;  2PEX A;  4UB6 C;  5LHH A;  3TOB A;  5L3B A;  4E7J A;  3HXL A;  2A6H F;  3AL0 C;  2LDU A;  1R71 A;  1B4A A;  1EH8 A;  3JSP A;  2LD5 A;  1A04 A;  3EYI A;  4I0A A;  1JKO C;  4AIK A;  3KIO A;  4CCL A;  2LF8 A;  3E1S A;  2F4M B;  5TRD A;  4E7S A;  1JTY A;  5A2Q Z;  1OCZ H;  2DQR A;  3Q0U A;  2W7N A;  4CUG A;  1NK3 P;  1VQ8 I;  4HDU A;  2NRA C;  4LK1 F;  5M5Y J;  3Q9S A;  4I7H A;  2QYO A;  1GUU A;  1Z9C A;  2VC0 A;  3K4B A;  1ETX A;  1ZEL A;  2HKX A;  3KFW X;  3NRV A;  3KEY A;  3QYF A;  2KQR A;  4CCK A;  2LVS A;  3ROU A;  4A0X A;  2WB1 A;  1Z6R A;  2DN0 A;  2K9S A;  4C2M J;  3H9Q A;  3KP4 A;  4NC6 A;  4B43 A;  3BT9 A;  3BR3 A;  5J47 A;  1UZC A;  2HDC A;  3CLQ A;  4OIN F;  4UNO A;  2TDX A;  1H88 C;  4RB3 C;  5FRM A;  2GOM A;  3E5X A;  2DU9 A;  3UNG C;  2CO5 A;  2ZJQ F;  5LGN A;  3JRF A;  1XCV A;  2ADU A;  4FE7 A;  3WHB A;  2V9K A;  2FJ1 A;  3CUO A;  1S6L A;  5H6Q A;  1UG2 A;  2FUG 2;  2XAJ A;  2HQ5 A;  3N97 A;  2CWE A;  1UCR A;  2EZK A;  2WAQ A;  4U87 A;  3LAJ A;  2GA2 A;  2M5W A;  4YFX F;  4V2G A;  1K4S A;  5HLG A;  3G73 A;  5D5X B;  2K9N A;  1P7J A;  2O7O A;  2KJC A;  3F0C A;  1ETQ A;  2WY8 Q;  4LG3 A;  2O61 A;  2ZME B;  1TC3 C;  3R6S A;  3HBL A;  1TLH B;  4I99 C;  4KN7 X;  1W0T A;  1MH4 A;  5F1J A;  1SFO J;  4ABZ A;  5FD5 A;  2EIJ H;  4A12 A;  4A3K J;  4XOT A;  1GXQ A;  3C1D A;  1H89 C;  3JRH A;  2KIU A;  9ANT A;  4XLP F;  2E35 A;  1D1C A;  2ZJ2 A;  3KP3 A;  2HEO A;  5EGO B;  1XCB A;  4Y52 J;  3KP7 A;  1HXD A;  1BC7 C;  3S1N J;  2EFO A;  1MDM B;  1IXC A;  4U0V A;  1IW7 F;  3GFI A;  5BPD A;  1W5C C;  4EV0 A;  5HVQ C;  3H3V K;  1J2X A;  1FMV A;  1QZY A;  3FXU A;  5HDG A;  2R5Y A;  2V79 A;  1SFU A;  2RKH A;  1IF1 A;  1SMY F;  4BS9 A;  1WCM J;  2LKX A;  3LSH A;  1ZN2 A;  1YJW I;  5EJC A;  3F9K A;  2P6T A;  3AL0 B;  3E6B A;  4BJ6 C;  4Y17 A;  2BGC A;  2HDD A;  2R3S A;  1T08 B;  3D0S A;  4NC7 A;  1HQC A;  4B47 A;  3GFL A;  4L9V A;  3LQR A;  1FYL A;  2R7Q A;  3S8P A;  5EYR A;  4WXC A;  3ZXS A;  2NNY A;  3IUO A;  3TO9 A;  2V1N A;  1YOV B;  4II2 A;  1Y56 A;  1D8J A;  1X2N A;  4HNT A;  4UY8 I;  2CS3 A;  1N75 A;  4M3B A;  2UZK A;  2V9V A;  5TIS C;  2BXZ A;  3TKY A;  2LC2 A;  3CQZ J;  5EZG A;  3J80 K;  3OY9 A;  2GAU A;  1CQT A;  1FOW A;  1X1A A;  2MFZ A;  1ITY A;  2R7F A;  2LFB A;  3O8H A;  4BU2 A;  2A68 F;  3FMR A;  3PNT A;  2VBX A;  3ABT A;  2XC7 A;  2AQE A;  2DFE A;  4A93 J;  3KET A;  1PUE E;  3OYE A;  5HS7 A;  5DCM A;  2VUM J;  3R61 A;  1W7P D;  2OC6 A;  1TWF J;  1MIJ A;  5FKK A;  1F36 A;  2DA3 A;  3TDZ C;  1O3R A;  1DU6 A;  5CVV A;  2IAI A;  1YX3 A;  5LHI A;  1LDK B;  5HDK A;  4CYD A;  1D1B A;  2F5D A;  2IPQ X;  3MZ8 A;  3ZQF A;  1K78 A;  3R0J A;  1WJA A;  4MFE A;  2NVU B;  1H0M A;  3QOP A;  5FKM A;  1JKP C;  2VKE A;  1UJ8 A;  6PAX A;  1ZGJ A;  2FF4 A;  3I54 A;  2YU3 A;  4P1W A;  3I64 A;  1REP C;  3DU5 A;  5DS9 A;  1E3O C;  4DYC A;  4N4O B;  4ZDO A;  2X6X A;  4TV7 A;  5CVI A;  4B44 A;  3ZN0 A;  1KU9 A;  1RKT A;  3BG5 A;  2BHY A;  4PCQ A;  2BVM A;  3GF2 A;  4Y15 A;  2W1O A;  2KHM A;  5IY5 H;  2CV0 A;  2XRN A;  3LA7 A;  4Q4Z F;  2BBY A;  4A3G J;  2LY2 A;  5JVT A;  3PNV A;  4IRG A;  2IGN A;  3RSN A;  3S16 J;  5DYM A;  2Z2S B;  1T39 A;  1YE9 A;  1JE8 A;  2A5Y B;  3V7S A;  4RAY A;  3OR1 C;  2L0K A;  1UG0 A;  1UHM A;  2Y2Z A;  4UV8 A;  2D5V A;  1MGT A;  4A6E A;  5FFX A;  3ABU A;  2NYX A;  1BBY A;  5L3E A;  2HOT A;  2AO9 A;  5J1Y A;  4XKB A;  2JT1 A;  4RGX A;  1VQN I;  1WJF A;  1R5G A;  3H3Z A;  2IS6 A;  2K4J A;  3PO3 J;  2HNH A;  2I5U A;  2LSO A;  4RMN A;  1N25 A;  3JRG A;  5C44 J;  2G9W A;  2WY7 Q;  4FX0 A;  3OS0 A;  2R7V A;  3SEQ A;  2PQ8 A;  1SD7 A;  3UR3 C;  3OSF A;  2M30 A;  3C2B A;  4OAY A;  2V4J C;  2L4M A;  4IEJ A;  3FKJ A;  4BQN A;  4IRI A;  3KYC B;  2DFI A;  2OCE A;  4BE1 A;  4MNU A;  4FET A;  3OYF A;  2CRG A;  1JUM A;  2G7H A;  3O2P E;  3S32 A;  2NVT J;  4IHY A;  1XC5 A;  1X1D A;  2I8D A;  4KIB A;  5LD2 C;  1VQ6 I;  1LFU P;  2E2H J;  2OPT A;  1BR4 A;  1L3L A;  2BY3 A;  2Z3Y A;  3LA2 A;  1SVM A;  3Q9V A;  1PP8 F;  2A07 F;  5JVG F;  3PL8 A;  3M1E A;  1IN5 A;  1U2W A;  2EPF A;  1X1B A;  4PDK A;  1MSF C;  1MJB A;  1DPU A;  2IS2 A;  1RET A;  2OU2 A;  4HBL A;  3FK7 A;  2R7T A;  1MBG A;  3NEU A;  4JQF A;  3JRE A;  4HF0 A;  3SZT A;  4QLC U;  3P9C A;  3OYL A;  4X6A J;  4CCO A;  1XD7 A;  3K70 C;  4Y13 A;  1X19 A;  1FOK A;  1O7F A;  2L7F P;  3KEO A;  1YJ9 I;  1V5F A;  5A2Q K;  2L7Z A;  2W82 A;  2DOE A;  1W5T A;  5HLH A;  1ONV A;  1XMX A;  1W7P B;  1S72 I;  3QPS A;  1MSE C;  4CCN A;  2NAZ A;  3KYD B;  3RDI A;  5K5O A;  2V1D A;  3MKZ A;  2WTE A;  3PM1 A;  1VQ5 I;  4B3A A;  4ENM A;  3GFJ A;  3ML6 A;  3S1M J;  1XSX A;  4IHT A;  2CUF A;  2MD0 A;  3RKX A;  4DGW B;  1G3W A;  1RES A;  1TW2 A;  2M1B A;  3BJA A;  2PBI A;  4ZYG A;  2BYV E;  3ESW B;  1K6O A;  4WF2 A;  2BY1 A;  4JX4 A;  2G0E A;  1S3J A;  3A01 B;  5L3G A;  2M4K A;  3N05 A;  3MKW B;  4EGZ A;  5HLT A;  3HOT A;  2WA0 A;  4DNC A;  3K4N A;  1MBJ A;  2YR2 A;  3CCR I;  3WG7 H;  3OYJ A;  3HKZ N;  1O4X A;  2GIV A;  2K3P A;  3L2R A;  2HPM A;  4B1R A;  4PGG A;  3JRC A;  3TO7 A;  2QKL B;  1FSE A;  2BV6 A;  3GX4 X;  1S9H A;  2KT0 A;  1XS9 A;  5JR3 A;  2VOO A;  2HOE A;  1X4P A;  4EJO A;  2VLA A;  3KEQ A;  1P92 A;  4EM0 B;  4XKV A;  5C4J J;  2DA7 A;  4D9J A;  1B9N A;  3LSI A;  2J5P A;  2BEO A;  2D2W A;  3I59 A;  4UUS A;  4E7H A;  1WFX A;  5K7Z A;  5B1A H;  5J6X A;  4ANJ A;  4EQQ A;  4IOA F;  1M1E B;  2Y48 A;  4FIS A;  4IL6 C;  3EUA A;  1MBE A;  3QQA A;  3VYT B;  2EV0 A;  1R4M B;  2LBF B;  3GTP J;  3OR2 C;  2XAS A;  2LH9 A;  2RNJ A;  5IYD J;  1Y0U A;  4A0Z A;  3D1N I;  5EDN A;  3MFK A;  3A0B C;  5CVJ A;  3D5L A;  3K9T A;  1FBU A;  4YII A;  1ACI A;  3WTV C;  2CYY A;  3IWZ A;  4BBS J;  1RRJ A;  3Q5F A;  3G4S I;  3M1C A;  1HKT A;  3EYY A;  3K4K A;  1D1A A;  5KK1 A;  1S8N A;  3SZP A;  1RIO H;  5GTI C;  1VQM I;  2QBY B;  3K1M A;  4ZYD A;  1A6I A;  1HKS A;  1U3E M;  1IN7 A;  4LD5 A;  5CLS A;  2HYJ A;  3LSM A;  4EJU A;  5DV5 A;  1FPQ A;  4XRF A;  3J7A O;  3P7N A;  4EJV A;  4Z6Y A;  1OCT C;  1SAN A;  5LRS A;  4O5V A;  2ZXW H;  2KIF A;  2ZC2 A;  4H4K C;  5E3O A;  4JOM A;  5FGM A;  1W1W E;  1IUF A;  3TMO A;  3HOS A;  4UVA A;  4F91 B;  3LSP A;  4IHX A;  3S2H J;  1MJA A;  5D4R A;  4BDY A;  4CCJ A;  5E1Z B;  1ZYR F;  3L2C A;  4I2O A;  3G3Z A;  4WXD A;  3HUG A;  4XM3 A;  1YTY A;  1KON A;  2LMD A;  3QRF F;  1WJC A;  3PSF A;  3RI4 A;  2VPR A;  1T8I A;  1W7P A;  4HYE A;  4L5J A;  3GWZ A;  4YG2 F;  2V26 A;  4M73 A;  4AIJ A;  1Z91 A;  1V54 H;  3VB2 A;  5BNG A;  3IWF A;  4G9Y A;  2O8X A;  3TP0 A;  1ETY A;  3OIO A;  2PJR B;  5DDG A;  1WHU A;  3WOD F;  4QIW N;  1MBK A;  1G3T A;  1RR7 A;  2V6C A;  1FSH A;  2FXA A;  3S3N A;  1A36 A;  1GV5 A;  1GXP A;  1CF7 B;  3I56 I;  2IA1 A;  3WTS C;  1ZTR A;  3X2Q H;  4XSX F;  2Z16 A;  4BHB A;  4BY1 J;  2OJE D;  3ECO A;  3HGY A;  3HIF A;  3J81 K;  1LEA A;  2NS8 A;  1HW1 A;  4FE4 A;  4L9T A;  2QUF A;  5ED4 A;  1J9I A;  4FT8 A;  3MWM A;  3HSR A;  2WV0 A;  2MLK A;  1S5L C;  4DIQ A;  5K7F A;  4XID A;  3BG3 A;  2PLY A;  1ETW A;  1B59 A;  1E3H A;  2Q8K A;  2WC2 A;  2RRE A;  1YO5 C;  3I4N J;  3HTU A;  3WGG A;  2E19 A;  2VB6 A;  4XR6 A;  1ZRD A;  3JAM K;  4J01 A;  1OLT A;  1WJE A;  3PIP F;  2JQ7 A;  2WAD A;  1QHG A;  4PSX A;  2OV7 A;  1TWH J;  1KA8 A;  3V8K A;  2K85 A;  2KMU A;  2XPU A;  1Z7U A;  5J3L A;  3W6V A;  3ABK H;  4ZH4 F;  4HA8 A;  2R7S A;  2YU9 J;  2PI0 A;  4OMY A;  3PQK A;  4HQM A;  1D5Y A;  2DYR H;  3S2D J;  2FMY A;  4E7K A;  3FK6 A;  2JVH A;  5JLX A;  1QGP A;  5ILS A;  4A3F J;  3HKZ A;  2CV1 A;  2ECC A;  2X9D A;  2O5R A;  2PMU A;  3CMM A;  3FWE A;  3GO5 A;  1CGP A;  2BVL A;  2HS5 A;  1IV8 A;  2VN2 A;  3WU0 A;  2KL4 A;  3ZCO A;  2F4I A;  4UUT A;  1RNL A;  1BJA A;  3HYI A;  4M9X A;  4RB1 A;  1B8I B;  1FIP A;  3K2A A;  2QBY A;  5B1B H;  2LF7 A;  4RGR A;  1NTC A;  4F7Z A;  5K5R A;  1A5J A;  1FWZ A;  3CCS I;  3SXY A;  3ZMT A;  1U5T C;  1DUX C;  3FXM A;  1WSU A;  2CQK A;  3HC7 A;  3BDD A;  1W5S A;  1FYK A;  3J7A Y;  3BP8 A;  2JZY A;  1OFC X;  3ZQH A;  1PDN C;  2HQR A;  4RM3 A;  2XIG A;  2LYC A;  5IYC J;  3F3X A;  3S3O A;  3FKI J;  2VKD A;  3WTY C;  3VSL A;  5EZH A;  1AA7 A;  3PJR A;  1GVD A;  3CD6 I;  3GBG A;  3PFI A;  4LB5 A;  4IF4 A;  1XSD A;  3OYA A;  1D0Y A;  2BY2 A;  3R60 A;  2B9S A;  4D5C A;  2DK5 A;  3D5S C;  2JSP A;  3MKL A;  5BPI A;  2JA8 J;  2WAF A;  3GFM A;  2IW5 A;  2VT3 A;  2STT A;  2UXX A;  2YSR A;  1UHW A;  1U5T A;  2IBD A;  3MD2 A;  3OOU A;  3I58 A;  3IP4 B;  3ZR8 X;  3ZQI A;  5H2F C;  4BE2 A;  2W84 A;  2COB A;  3AG1 H;  1BI2 A;  2KIQ A;  1T33 A;  2TCT A;  1ZAO A;  4Q47 A;  3BTL A;  4A69 C;  3W2W A;  4BQO A;  5L3C A;  3H5N A;  4C3H J;  2EJR A;  5KNL A;  5KAI C;  1I39 A;  3DBH B;  1T0F C;  4CH7 A;  2HOS A;  3J80 Z;  2DT6 A;  1IJW C;  3B02 A;  5H20 A;  2ICW G;  1OCP A;  4BUP A;  4AM3 A;  2A6E F;  4KA4 A;  3L2V A;  2CMP A;  3IHU A;  3MQ0 A;  4EJT A;  2R7W A;  3MN2 A;  1I27 A;  5CQG A;  1H9G A;  3CES A;  3VWB A;  1MW7 A;  2C6Y A;  4GXO A;  4HAM A;  2PG4 A;  4E7I A;  4RLQ A;  1HSJ A;  2XAH A;  3GTG J;  3NWS A;  2XAF A;  4XRS G;  3VFZ A;  2H8W A;  4A2U A;  4XIC A;  1JHF A;  4M3G A;  3SDB A;  5FRN A;  2F2E A;  3ASO H;  3W2A A;  3IH4 A;  5C4X J;  5GAG J;  1I50 J;  5IPA A;  5F27 A;  2CUE A;  5M5W J;  1DGR M;  2VXD A;  2WAE A;  2ISY A;  2JMW A;  4XN3 A;  1LNW A;  3CTA A;  3SZG A;  4JX5 A;  1XDU A;  4NBQ A;  3LMM A;  4BHC A;  4MQV A;  3DPL C;  1KU7 A;  2NOJ B;  5LEJ A;  3J81 Z;  3DPU A;  1VND A;  2KLO A;  1KYW A;  2QSF X;  4LB6 B;  4D7N A;  3I3L A;  1Y6I A;  2P0W A;  2E5Z A;  3SDG A;  2HKO A;  4C30 A;  5FB2 A;  1HA8 A;  1ORK A;  2PMZ A;  3K4M A;  2KDO A;  3FIS A;  2LG4 A;  1MH3 A;  2RNG A;  3L09 A;  4NUB A;  4U0W A;  3WGH A;  1XPX A;  1BR2 A;  4WK8 F;  3ZQC A;  3PSI A;  3GLX A;  3IH3 A;  1P7I A;  4D7M A;  3R0A A;  3DLL F;  2ESH A;  1JGS A;  4DJA A;  4PUS A;  5EEA A;  2FNP A;  2XB5 A;  2ZNZ A;  2ZFW A;  2KJB A;  5L3F A;  5FLX K;  1YLF A;  3V8J A;  4CSW A;  1VQ9 I;  3T8R A;  3ZOB A;  3WTX C;  3K69 A;  1XGO A;  2XRL A;  4XLA A;  1J09 A;  3OIQ A;  4KUM A;  4EAT A;  4HX8 A;  2ME6 A;  1LFP A;  4U7D A;  2R5Z B;  3FMS A;  3T0Y A;  3WE3 A;  2WWY A;  3H5R A;  3HOW J;  1R49 A;  2MSY A;  3U21 A;  4B8X A;  4AU7 A;  3MEX A;  5LEK A;  4ON0 A;  2A69 F;  1FJL A;  4L9J A;  1ZLJ A;  3TW6 A;  1LQ1 A;  3K4J A;  1DQU A;  2FD5 A;  1U0J A;  3HOX J;  3N4M A;  1TBX A;  3BR1 A;  4I0B A;  3PUF A;  4AID A;  2GXA A;  2O6G E;  2B0L A;  4NQW B;  2EFN A;  2ELJ A;  4HV6 A;  3FF5 A;  4CXF A;  2XRO A;  1LPQ A;  1GDT A;  2O0Y A;  4LLN A;  2EIM H;  4ESB A;  2OF7 A;  3CO7 C;  4A5M A;  2EA4 A;  2ELK A;  2L9N A;  2B7E A;  3CCY A;  3VDX A;  4XRS A;  1XSV A;  4AIH A;  5DM6 F;  2DPU A;  2XSD C;  2R7Z J;  3A1Y A;  2EA2 A;  2K27 A;  4QPQ A;  2FBH A;  2P5L C;  1SD4 A;  3FDY A;  3MZY A;  1QU3 A;  2OUM A;  2XV4 S;  2R7D A;  3E6C C;  5AIP A;  3C3W A;  2XSJ C;  5JI6 A;  2HZT A;  3BOQ A;  3GW2 A;  3J7Z I;  3E0J B;  4B09 A;  3BQZ A;  4W1U A;  3BR6 A;  3CJT B;  3LSK A;  2F5E A;  1KU2 A;  2KZV A;  3K1P A;  5CQE A;  3WHC A;  4R1H A;  5B5E C;  2EK5 A;  2R0Q C;  2DJN A;  2LRD A;  3CDH A;  3RYR A;  3ZMU A;  2AXT C;  3E3V A;  5J1R A;  4NDL A;  4I98 B;  1YFH A;  1Z77 A;  2QWW A;  1VQP I;  2DBB A;  1YHQ I;  2DPD A;  5IT3 A;  3W6J B;  3KCC A;  2HR3 A;  3ZPL A;  1J7K A;  3A02 A;  1IV6 A;  3F72 A;  3CDI A;  1S29 A;  2HWV A;  1BL0 A;  1BI0 A;  2ZXI A;  4OIQ F;  2EIL H;  3E97 A;  5D8L B;  1W36 D;  2BY0 A;  1V55 H;  4OIO F;  4ZTF A;  3UKG A;  4Y3O A;  4O6J A;  2OCC H;  4X0G A;  2OTJ I;  4KN4 X;  2NNN A;  2GLO A;  4M3F A;  2Y0S A;  1R5I D;  2DA1 A;  3M3Y J;  1YW9 A;  1X1C A;  3JTG A;  2XVC A;  3HRT A;  3HTS B;  3ZRG A;  3SQN A;  4M71 A;  2W4S A;  1EJ9 A;  1VZ0 A;  4QSH A;  2IXS A;  2PFB A;  2OQG A;  2IT0 A;  4LJZ F;  4ESJ A;  4RGU A;  2NS7 A;  3BR0 A;  1U5T B;  4B3X A;  2EZH A;  1TQI A;  1SFE A;  2YX7 A;  3GVA A;  1SD6 A;  1RZ4 A;  3L2U A;  2PN6 A;  2VJI A;  4B48 A;  1V5E A;  3R4K A;  4DOZ A;  3OYN A;  4IHW A;  4AC0 A;  4DZJ A;  1IZ1 A;  2A6T A;  3JW4 A;  5GP9 A;  5GAE J;  4RAZ A;  4G7H F;  1J75 A;  1VQ4 I;  2BZT A;  2JRM A;  1XGM A;  5E20 A;  3RTR A;  4NNJ A;  1Y0N A;  1SC7 A;  5KCM A;  1R1U A;  3NAR A;  5CYV A;  3L2Q A;  3C18 A;  2JK3 A;  3BZ6 A;  4ZYE A;  2JWT A;  3FXL A;  4L9N A;  4MTD A;  4M72 A;  1Z67 A;  3DPT A;  1P4X A;  4YIR X;  1MD0 A;  4BEH B;  2P5V A;  3DFG A;  4G12 A;  3ZP5 A;  1UMQ A;  3LSG A;  3OS1 A;  1RKW A;  1P2F A;  1YG2 A;  2Y9Z A;  4WWC A;  4XBF A;  4HDV A;  1X4O A;  3QOD A;  2L9R A;  4NB5 A;  1KQ9 A;  3ZMZ A;  3OYD A;  4L0Z B;  2G7U A;  1ERD A;  1ZG3 A;  1BOB A;  3MKY B;  1WJ5 A;  1IGN A;  3BWG A;  5K1Y A;  4A3L J;  3H5A A;  3CJN A;  1XMA A;  5F0H A;  3FXO A;  4AYB N;  3BR2 A;  3KP5 A;  3VOE A;  2JN6 A;  4XN0 A;  3AG4 H;  3H3U A;  2MH9 A;  4HST A;  4FTH A;  2ID3 A;  2FQ4 A;  2DOF A;  3RPQ A;  2L3D A;  3J7Y J;  4AWX B;  2MGQ A;  1YRN B;  2R93 J;  1T2K A;  1KU3 A;  3DTK A;  4U7B A;  4BH9 A;  2QQ8 A;  3CCM I;  2LBF A;  1X3U A;  1ZRF A;  3ASN H;  3CO6 C;  5HLI A;  2VXZ A;  2W48 A;  1MMS A;  3G6E I;  3VOD A;  1B72 A;  3F8F A;  2LY1 A;  5JHF A;  2MH2 A;  4JK1 X;  2A05 A;  3CF2 A;  4S0H B;  3CMA I;  2K86 A;  4PZJ A;  2DFF A;  2CW0 F;  2ZXJ A;  4Z2Y A;  4HNV A;  5J1U A;  3SYT A;  4IVN A;  3M8F A;  1HC8 A;  4A6D A;  2HVR A;  1SD5 A;  4IPA A;  3LFU A;  2Y0S N;  2YX4 A;  2CU7 A;  4C9Y A;  5L3D A;  3OOP A;  2CQX A;  3CLO A;  1D5V A;  3GXO A;  5E1X A;  4HQE A;  3PQJ A;  1R1V A;  4CIC A;  3DEW A;  1I3Q J;  5D6F A;  2M87 A;  2XAU A;  4BHP A;  2ELH A;  3LA3 A;  2R7R A;  3ERE D;  1JJ8 C;  2K9Q A;  2O8K A;  3IRQ A;  2MYS A;  5DTD A;  2E1M C;  2GWR A;  3BJO A;  3HJE A;  1ZGA A;  1OCO H;  4KJZ A;  2HGC A;  3M8E A;  4PJN A;  3ZN1 A;  1O3Q A;  1ZH5 A;  1LUJ B;  2PX9 A;  3ONQ A;  3QWL A;  3U2R A;  2NVX J;  3EQL F;  5E3L A;  2EFQ A;  3M7G A;  3JRI A;  2HYF A;  2XPW A;  3QPH A;  1POG A;  3ECH A;  5FLX Z;  2LRE A;  5B3S H;  5HDN A;  4LLL A;  2YUS A;  5HS8 A;  5D4S A;  1OQY A;  2LKP A;  2DMN A;  5HNH A;  2HTS A;  2L4A A;  5E3M A;  1FC3 A;  3OYB A;  4A3E J;  4ESF A;  3T1B A;  4LG0 B;  1IRF A;  3DV8 A;  4BQQ A;  1ZRE A;  2BW3 B;  1T38 A;  2KZG A;  4M6Y A;  1TL8 A;  1OJL A;  1ZRC A;  2R5Y B;  2FA5 A;  3KZI C;  2NOG A;  3RCO A;  4ENJ A;  1NH3 A;  1IG7 A;  1MDM A;  4PSW A;  2M0M A;  5ICE A;  3DF8 A;  4XRM A;  3IL2 A;  3K0L A;  2WAQ N;  3IAM 2;  5LFA A;  2BW3 A;  3OYM A;  2DMQ A;  2ZNY A;  1FEX A;  3V4G A;  5IP9 J;  4A3D J;  3FX3 A;  4ETS A;  2LK2 A;  3CZ6 A;  4DZP A;  3TOA A;  2DLL A;  2HDW A;  4BJ5 C;  1K83 J;  3HOZ J;  2W85 A;  1QO0 D;  4HX7 A;  1FTZ A;  1FBS A;  2F5V A;  3EET A;  4GRI A;  4XKC A;  4JP0 A;  2MG4 A;  4FHT A;  2CH0 A;  2M7B A;  1HST A;  1YX5 A;  2X0L A;  3BG9 A;  2DT5 A;  2MW8 A;  3CJQ B;  1PVE A;  2N8G A;  3ABL H;  5LHG A;  3JR9 A;  1K78 B;  1Y1W J;  3O6B B;  2ECB A;  3I53 A;  4Q48 A;  4MIM A;  4PFP A;  3HUG B;  1A31 A;  3RKQ A;  3BTJ A;  3W2V A;  1JTX A;  1FMW A;  2MD5 A;  2P81 A;  1IN8 A;  3ZMS A;  1G6N A;  2LOO A;  2DXI A;  2FE3 A;  1LE8 B;  2L5Q A;  2E1O A;  3JTH A;  1EH7 A;  2A3S A;  3S17 J;  4RS8 A;  2LP0 A;  4XLN F;  1R23 A;  2CFO A;  4HG2 A;  2H27 A;  1IXS B;  4BAY A;  3HZJ A;  1JXS A;  1I5Z A;  3DKW A;  2VQH A;  4NC8 A;  2HFH A;  3FIW A;  3HG9 A;  3K4C A;  1R9T J;  1WVR A;  3TP3 A;  1F4K A;  4KIT B;  1LE8 A;  2VON A;  3KP2 A;  1TP4 A;  2D1H A;  5FLV A;  2E34 A;  4D1Q A;  3GZN B;  4BXU A;  1W4M A;  3C7J A;  2QM3 A;  2KRC A;  2JVG A;  2VE8 A;  3HRM A;  1RUO A;  2HQA A;  2Z5U A;  2M34 A;  3BQY A;  2VOD A;  5HOO A;  1Y1V J;  3G1L A;  2DQL A;  2EQR A;  2ZJR F;  3F8N A;  3V7R A;  2RGV A;  1O3S A;  2IGM A;  3AAF A;  4M6V A;  3H0G J;  2DA4 A;  2QA4 I;  4M9S A;  2VJ5 A;  3A2K A;  2BOL A;  3I59 B;  3F8B A;  1Z3X A;  2MBF A;  4MFD A;  4LIT A;  2QGU A;  4XON A;  2KKO A;  3L7W A;  1O57 A;  3CMY A;  1DU0 A;  1DPR A;  2UV1 A;  3FXK A;  4L18 B;  2EZI A;  4I76 A;  1FLI A;  3KYL A;  2Y69 H;  3ZMD A;  3L9F A;  1LDJ A;  1IRG A;  2PJR A;  3S1R J;  1P4W A;  1R5H A;  2HI3 A;  1TZL A;  4RM2 A;  2I10 A;  1GT0 C;  4HW0 A;  3WG9 A;  3S1Q J;  3HGG A;  1BR1 A;  2W24 A;  1FX7 A;  2EBI A;  3T8T A;  4I01 A;  3SFZ A;  1J5Y A;  5FKN A;  5CJ9 A;  2TRT A;  5D5W B;  2E36 A;  2RQQ A;  1WKM A;  2ZME C;  1Z1D A;  1TWG J;  3C2H A;  1QRY A;  4A5N A;  3I4P A;  3KLN A;  5BMZ A;  5GPA A;  1O3T A;  1BA5 A;  3C2G A;  2IGO A;  2XDV A;  4G6D A;  1UEL B;  3LNQ A;  2M2E A;  4PJ0 C;  2E7X A;  2DCE A;  4UUS B;  2X6W A;  4MHG A;  3CCQ I;  4ASN A;  2X1D A;  2X6O A;  1YRN A;  1Z0X A;  4IZZ A;  2XGC A;  5F08 A;  1YS7 A;  2Y75 A;  2K4B A;  4DYR A;  4BQA A;  4KMF A;  2F48 A;  1N78 A;  2Q1Z B;  3P9K A;  2YS9 A;  5F04 A;  2L7K A;  1PJR A;  4YRV A;  2DAO A;  3CCJ I;  3PO2 J;  1QVT A;  4UVC A;  3GZ6 A;  2F5C A;  1JT0 A;  3K6G A;  1JUS A;  4UXN A;  4OMZ A;  1Z6T A;  5FKO A;  3TED A;  4XMY A;  4BKX A;  3VSK A;  1QNT A;  1HLV A;  3GME A;  1XN7 A;  4IKF A;  3MMY B;  2FEZ A;  4GCV A;  4J00 A;  3HOU J;  4Q5S F;  5DD8 A;  1D3Y A;  2MC3 A;  2VQG A;  2M3A A;  1B9M A;  3LL7 A;  3WTU C;  4G7Z F;  2V1U A;  4E70 A;  1WZ2 A;  3F23 A;  2ESN A;  4M3D A;  4YEL A;  2M8G X;  1OCR H;  4RLF A;  1HOM A;  2EB7 A;  1R4N B;  3Q0V A;  3WU1 B;  1WWX A;  1TWA J;  1PUF B;  1GLN A;  4N0B A;  3ABM H;  1R58 A;  1T98 A;  4XK4 A;  5DUI A;  1E17 A;  4ENK A;  5F6F A;  3IH2 A;  3PIO F;  1ODD A;  2FSW A;  1TWC J;  3KE2 A;  1XB4 A;  3HSE A;  1HBX G;  5J4V A;  2BXY A;  3LQQ A;  5E3N A;  2VBY A;  1RUN A;  4HLY A;  5IOZ A;  2IA2 A;  4RAG A;  1GHC A;  5LBQ A;  4YIF A;  4EGY A;  1I1S A;  1BM9 A;  2D45 A;  3CDL A;  2CJJ A;  1G8X A;  1YI2 I;  3KZZ A;  1B6A A;  2D1V A;  1X3W B;  2M4G A;  4M74 A;  2EWN A;  4KYW A;  2VPL A;  3S2W A;  1F5T A;  1K7A A;  5KAF C;  4R8H A;  3SHF A;  4OU0 A;  4PJJ A;  1B72 B;  2IS4 A;  1YW7 A;  2JJ7 A;  3BG6 A;  4LK0 F;  2XGX A;  2Y30 A;  4IO9 F;  2FBK A;  1G3Y A;  4GFB A;  2GIZ A;  3DKY A;  1F43 A;  1PYV A;  2ID6 A;  5LLQ A;  1U8R A;  3ZQG A;  2STW A;  5H6R A;  5IOY A;  4EMS A;  3U1D A;  2FU4 A;  1AKH B;  4CYC A;  3OMY A;  1MBF A;  4L5I A;  3WTZ A;  2P5K A;  5AIQ A;  4EJW A;  2M45 A;  3HHH A;  4F55 A;  3W3C A;  3GUD A;  2DMP A;  2K9M A;  4OIR F;  3TQN A;  1R6R A;  3I5U A;  3L1P A;  3GTL J;  5JLW A;  2DW4 A;  2ZBK A;  4MQ9 F;  4BGD A;  3WE2 A;  3RIR A;  2NS0 A;  1Q1V A;  1IC8 A;  3PNY A;  2KIM A;  3AKZ A;  3E6D A;  2WBM A;  5IT9 Z;  3BZK A;  3DEE A;  3SEZ A;  3M8J A;  2QEN A;  2DMT A;  2R7U A;  1LKX A;  3K2Z A;  3NQO A;  1ETO A;  3E7L A;  2OD5 A;  2XAG A;  4XLC A;  2FQ3 A;  3M9A A;  4D0P A;  2DA5 A;  5EEH A;  2CFX A;  3VPR A;  1MJ9 A;  2QVO A;  2E7W A;  5EGO A;  1RPW A;  1TQP A;  3KLO A;  3DTE A;  3H9G A;  3CC4 I;  3FZV A;  2P7V B;  4K2E A;  4EEF G;  1EA3 A;  1FP1 D;  3CJR B;  1R7J A;  5K7H A;  2VOP A;  2FX0 A;  2HTJ A;  1CF7 A;  4BEH A;  1NG6 A;  2DTR A;  1K6Y A;  3OL4 A;  5CVR A;  5EF6 A;  4G8X A;  4BAC A;  1SFK A;  4KIC A;  4MEX F;  1X58 A;  2OBP A;  1UFM A;  1VQO I;  4AVZ A;  3GTJ J;  1P4A A;  1S7E A;  3HB9 A;  4UUV A;  3H0D A;  2IRF G;  1IDZ A;  1ULY A;  2XF6 A;  1QHH D;  2QF7 A;  2Q0O A;  3H35 A;  4N9I A;  4A0Y A;  5C3E J;  2L7M P;  2IVM A;  2COM A;  1I1G A;  3AG3 H;  2W00 A;  2WV1 A;  1YQA A;  1STZ A;  1NHA A;  4N4N B;  3HOY J;  1JHH A;  5M3M J;  4HF1 A;  1ZG1 A;  4CZZ A;  3MZH A;  3VYS B;  4CZC A;  4OAZ A;  5J8C A;  2DYS H;  1R36 A;  2XKO A;  1EH6 A;  1QVU A;  4HV5 A;  1JUP A;  1E0E A;  2W57 A;  3HPH A;  3HM5 A;  1XTA A;  3ISP A;  3MAJ A;  4MTE A;  3RJP A;  2CQQ A;  2F6C A;  4BYY A;  2OZ6 A;  4ITV A;  2CGP A;  5KHD A;  1ZLK A;  2E5N A;  2ZO4 A;  5D5U B;  3PFY A;  4BL0 B;  2Z9O A;  2VE9 A;  4HF2 A;  2J5O A;  1IRZ A;  4LG0 A;  1TTY A;  1IO2 A;  4QWQ A;  5TGT A;  2OA4 A;  2IS1 A;  1MZB A;  5E8I A;  4M3E A;  1T0F A;  1FP2 A;  3GEZ A;  4LIU A;  5DM7 F;  5DUK A;  2X48 A;  4G94 A;  3F8C A;  4UVB A;  4KFC A;  2EFW A;  3V42 A;  1VQL I;  4BBR J;  1AU7 A;  3VYU B;  3KZY A;  3AFH A;  5B66 C;  3S93 A;  1KGS A;  4DBR A;  4KIG A;  3MVP A;  3A4C A;  3M07 A;  3KPH A;  4F52 A;  4XLE A;  2Q2E B;  4IXA A;  1LJ9 A;  2VIX A;  2K9L A;  1BW5 A;  4CYC B;  1IAW A;  2LKS A;  2X1E A;  3CCU I;  1FIA A;  1YIT I;  4FAS D;  3BCB A;  4CCM A;  3OYC A;  4LOC A;  2CW8 A;  2KDZ A;  1Y8R B;  2RVC A;  4ZC3 A;  4XLF A;  5J8F A;  1JT6 A;  2LTP A;  4PFO A;  3TDU C;  4E6K G;  4BJT A;  3KX2 A;  3S15 J;  3BCA A;  1D8K A;  2XHK A;  4YEJ A;  2E1C A;  1DGW Y;  3GLL A;  5JFR A;  4DQ2 A;  5DCM B;  4JX6 A;  3RQ4 A;  4KT6 A;  5D5V B;  3FHZ A;  4KIS A;  5F64 A;  2R92 J;  2KRF A;  5E79 C;  2FML A;  2XPV A;  3F8M A;  3DLA A;  4XOR A;  4JYK A;  3LSJ A;  1TNS A;  1ZK8 A;  4GGG A;  4S05 A;  2KRH A;  5EEG A;  1XGN A;  2JA6 J;  1P9Q C;  2M7A A;  3A01 A;  1G59 A;  3A03 A;  5IT9 K;  3DEU A;  2XF5 A;  1NG7 A;  1JI8 A;  1BN5 A;  1XG1 A;  1YJN I;  2JPB A;  5LRR A;  1BI3 A;  3CUQ A;  1LFB A;  4A3J J;  4A3M J;  4XLH A;  4IHS A;  2ZSH B;  4F92 B;  1AOY A;  2ZME A;  3EDP A;  5IP7 J;  3QU3 A;  2EFP A;  2CSO A;  2VKV A;  1WGX A;  1J0R A;  1Y39 A;  4U0Y A;  5FFZ A;  2H6C A;  4ZZD A;  2AQF A;  1U6G A;  2X4H A;  3EUH A;  2XAQ A;  3BG7 A;  3LAP A;  2L2O A;  2E60 A;  4P5O A;  2QSH X;  3ZMV A;  1HF0 A;  2Z33 A;  2IJL A;  2JUC A;  5K5Q A;  3F22 A;  1JJ6 C;  3DP7 A;  1VQ7 I;  2X85 A;  4DYQ A;  2GBY A;  3FBI B;  3OS2 A;  4XKW A;  2DJI A;  1QQI A;  2MLG A;  2Z99 A;  1UST A;  2L02 A;  4HNU A;  2L9S A;  3S3M A;  3HEF A;  2VAS A;  1XGS A;  1W0U A;  1OMI A;  3RZD J;  4U88 A;  5KVR A;  1VI0 A;  3ZQ7 A;  1E2X A;  3G2B A;  1QPM A;  3B73 A;  5FD6 A;  1V5G A;  2DDA A;  1ZHF A;  1BC8 C;  4ZTJ A;  1U9N A;  3GTK J;  2GZW A;  4UV9 A;  3RYP A;  1HDP A;  3FM3 A;  3H36 A;  3CC7 I;  2O3F A;  2XB0 X;  4I09 A;  3TL4 X;  1X1P A;  4YFN F;  2HVS A;  2HZD A;  2BE5 F;  1H9T A;  2GM4 A;  1YW8 A;  5GTH C;  3DKX A;  2DMU A;  3F6V A;  1WI3 A;  1HW5 A;  2CW7 A;  3OYG A;  1AHD P;  3WTT C;  1A6Q A;  2ZJP F;  4RBO A;  4KIF A;  4EM2 A;  1B1B A;  1USS A;  2KIS A;  3DBL B;  2HOA A;  1T6S A;  1MMN A;  2HQN A;  3IV5 A;  1FT9 A;  1EV7 A;  1ZR2 A;  3CCE I;  1DP7 P;  2XGE A;  1RR8 C;  1U9O A;  1FTT A;  1JKQ C;  2PJP A;  2ZB9 A;  4P96 A;  5FLM J;  4V19 K;  3BR5 A;  2JA2 A;  2H1K A;  2DTZ A;  4R79 A;  2CV2 A;  1L0O C;  3PUB A;  1PUF A;  4FX4 A;  2P7C B;  4MGR A;  4RA2 A;  1U8B A;  2Q2E A;  3BY6 A;  2GOX B;  1PP7 U;  2QKM B;  3LST A;  2DI3 A;  1SFX A;  3B6C A;  1C0W A;  1IXR C;  4PGH A;  3HRS A;  1RC9 A;  5CKT A;  3GYH X;  4BXF A;  1QBJ A;  4KNY A;  1Q1H A;  4FCY A;  3RZO J;  4N9H A;  2ZCW A;  3OV8 A;  3QU6 A;  4V2F A;  4BY7 J;  4RDU A;  2F4O B;  3EUK L;  3FXJ A;  1QZE A;  3CP2 A;  4BDZ A;  1UAA A;  1APL C;  3VEP A;  1TT0 A;  2CG4 A;  5HS9 A;  1SMT A;  5E1W A;  4NHJ A;  1Y8Q B;  3DU6 A;  3HDD A;  1OYY A;  1YIO A;  1D0X A;  3ULQ B;  4YFK F;  1WQ2 A;  1ZKG A;  2GQQ A;  2PMZ N;  1G3S A;  4E7Z A;  3L00 A;  2HU9 A;  3OL3 A;  4S04 A;  4IOC F;  5D8K B;  3F6O A;  3BTI A;  4F93 B;  3U1K A;  4P9U A;  1X2M A;  2H94 A;  3LWF A;  4BE0 A;  1ZGW A;  3BC8 A;  4HX4 A;  2JRT A;  3IC7 A;  1FNN A;  1SAX A;  5E8G A;  2ZSI B;  2Y9Y A;  1R1T A;  3BRO A;  4UHT A;  1VFC A;  4D5F A;  1JKR C;  4LFU A;  3JRA A;  3OYI A;  2Y31 A;  4IJA A;  2H6B A;  2X1C A;  4KT5 C;  2H09 A;  2O03 A;  2OZU A;  2K7L A;  3GZ5 A;  5IP6 A;  3LSR A;  2CUZ A;  3DQV C;  1G4D A;  5HOD A;  4FQG A;  4W97 A;  1K4T A;  3GTO J;  3HRU A;  2NXN B;  2X51 A;  3O8G A;  1SVO A;  3I4M J;  2V6E A;  2EIN H;  3IAS 2;  3O3K A;  3WU2 C;  4P9F A;  5EG0 A;  2BHZ A;  3I0T A;  3QPT A;  1TT5 B;  3S14 J;  2KP6 A;  3QYB A;  3BPX A;  4C2T A;  1A35 A;  2YPR A;  3K1N A;  5CVU A;  5F0F A;  1FOY A;  3CP8 A;  4MEY F;  5E17 F;  4A3I J;  1IRX A;  4HRI A;  3ZGK A;  1R22 A;  5M5X J;  2A61 A;  5E18 F;  1KYZ A;  5FO5 A;  2VQL A;  2UWM A;  2DOA A;  3V8L A;  1VQK I;  2RDP A;  2LY9 A;  2DFH A;  4WXH A;  3U9G A;  2PMH A;  2KFD A;  3QAH A;  1DP3 A;  3BPV A;  5IYB J;  4HPQ A;  2RN7 A;  3RPU D;  2HXI A;  1OPC A;  3P9I A;  2QEX I;  3G71 I;  1KQ8 A;  1BJZ A;  1FYM A;  3GTM J;  1Z05 A;  3DBR B;  1T56 A;  1ON2 A;  3QPL A;  4GDF A;  3CUQ C;  3OYK A;  1AWC A;  3TGN A;  1XDS A;  3HPG A;  3JSO A;  1S7O A;  1ZG5 A;  2QQB A;  4OOI A;  3WGI A;  1BI1 A;  2Y0M A;  2H8R A;  3DCF A;  1MNE A;  2K40 A;  4QPO A;  2GA1 A;  2ME0 A;  2CQ7 A;  1EF4 A;  5ICC A;  2IGK A;  3A0H C;  3REO A;  4KDP A;  5AON A;  2JSC A;  1HDD C;  3NAU A;  1VTN C;  2MC4 A;  2P8T A;  1WH7 A;  2K02 A;  2V9P A;  1HW2 A;  2VJJ A;  4C3I J;  4HSR A;  3T5X A;  3L2W A;  4C2U A;  4HEA 2;  1OR7 A;  2E1M B;  2R7O A;  4ZDP A;  1U78 A;  4ZJZ A;  4ZYH A;  1WI9 A;  3QP5 A;  3HHG A;  3ZQQ A;  4I02 A;  1LEB A;  2R4G A;  4Y33 A;  2AS5 F;  3I55 I;  2ZKZ A;  2WB1 N;  4KMU X;  2UXN A;  2NVQ J;  4A3C J;  4G6Q A;  1ETK A;  1S7A A;  3SFI A;  2B63 J;  2FNA A;  2HPI A;  3BLY A;  5GAD J;  1T95 A;  2VKH A;  1IUY A;  1BOA A;  1JGG A;  3QYE A;  4GO1 A;  1QA6 A;  1P6R A;  2DA2 A;  3K70 D;  2RAE A;  3HOV J;  5ERI A;  1X3Z B;  2L54 A;  2VBZ A;  4RB0 A;  5GAH J;  2CUJ A;  2JA5 J;  1MKM A;  1D0Z A;  1OKR A;  1UB9 A;  4ZZL A;  3ZQL A;  4LMY A;  3E5Q A;  2QQA A;  2DO7 A;  1MNM C;  2ZXH A;  1Z21 A;  2VJ4 A;  1V3F A;  3IKT A;  2E71 A;  3G1O A;  1ON1 A;  3K4L A;  1NK2 P;  3HSF A;  3H92 A;  3M4O J;  2F5F A;  1R00 A;  5LGT A;  2LLK A;  4HLX A;  4EVI A;  2XGD A;  3CF5 F;  4E7L A;  1MMG A;  4LGW A;  1LB2 A;  1F9N A;  2EV5 A;  3COA C;  3RKY A;  1GVJ A;  4JBA A;  4XSZ F;  4BXX J;  3BZC A;  4PK4 A;  5JHU A;  2M0C A;  4EM1 A;  4OWR B;  3OYH A;  4OIP F;  1TNT A;  2XKP A;  5LGU A;  4O3M A;  1OCC H;  5CPR B;  2VC1 A;  4RAF A;  5ILV A;  5HNF A;  1OR7 C;  5TJJ A;  5BQT A;  1Z3Y A;  4M6X A;  2HXO A;  4MO7 A;  4BNC A;  4CDG A;  1DDN A;  1SVL A;  1VF9 A;  1H8A C;  3E6M A;  2EIK H;  1KQ0 A;  1IN4 A;  2MA3 A;  4E4H A;  4QTR A;  1N77 A;  2NVY J;  1KZH A;  1LVK A;  2RV8 A;  3GCM A;  3RQI A;  4PJM A;  2JTV A;  3CCL I;  1EKE A;  2QCO A;  3LOC A;  1LVA A;  3JAM Z;  3IRR A;  2O9L A;  2OQR A;  4J19 A;  1FOX A;  2XF7 A;  3KP6 A;  2GXB A;  2RQP A;  4AVP A; 
#chains in the Genus database with same CATH homology
 4AC0 A;  4DZJ A;  5EF6 A;  5GP9 A;  1RES A;  1X58 A;  2R5Z A;  1K61 A;  1QPI A;  4Y7N J;  3GTQ J;  1HCR A;  3GTJ J;  3Q0W A;  1S7E A;  3NAR A;  2G0E A;  3G1M A;  4JX4 A;  3HB9 A;  3A01 B;  1IDZ A;  2QF7 A;  5C3E J;  1ENH A;  2JK3 A;  2L7M P;  1MBJ A;  2E2I J;  2JWT A;  3JRB A;  3OSG A;  2WV1 A;  3HKZ N;  1O4X A;  3HOY J;  5M3M J;  4G12 A;  1UMQ A;  4MLO A;  4B1R A;  3LSG A;  1RKW A;  3JRC A;  2Y9Z A;  5M3F J;  1ZR4 A;  2KT0 A;  2L9R A;  3JRD A;  1XS9 A;  1QVU A;  2E2J J;  1JUP A;  3SJM A;  3HM5 A;  1MBH A;  5C4J J;  2CQQ A;  2DA7 A;  1IGN A;  4UUS A;  3K7A J;  5K7Z A;  3TW7 A;  4A3L J;  1IRZ A;  4FIS A;  5F0H A;  1MBE A;  3QQA A;  4M3E A;  4AYB N;  3GTP J;  3BR2 A;  2JN6 A;  5IYD J;  3D1N I;  5EDN A;  2X48 A;  4FTH A;  5FJ8 J;  2ID3 A;  4BBR J;  1AU7 A;  2FQ4 A;  1B8I A;  4BBS J;  2MGQ A;  1YRN B;  2R93 J;  4IHV A;  3MVP A;  1UHS A;  2W48 A;  1A6I A;  1B72 A;  4DW6 A;  1BW5 A;  4CYC B;  5FKL A;  4S0H B;  1ZQ3 P;  2HYJ A;  1FIA A;  1OCT C;  4HNV A;  5J1U A;  4LOC A;  1SAN A;  2KDZ A;  4X1E A;  1JT6 A;  2LTP A;  5E3O A;  1IUF A;  2Y0S N;  3S15 J;  2DA6 A;  2CU7 A;  4L5E A;  3BTC A;  3LSP A;  4IHX A;  3S2H J;  2CQX A;  1G2H A;  4JX6 A;  1ETV A;  2VI6 A;  2R92 J;  3DEW A;  1I3Q J;  2XPV A;  3Q3S A;  4JYK A;  3LSJ A;  1ZK8 A;  1WPK A;  1I6H J;  1JJ8 C;  2K9Q A;  2JA6 J;  2O8K A;  5GPC A;  3A01 A;  1BW6 A;  5DTD A;  2EH3 A;  2VPR A;  3A03 A;  1XG1 A;  2AHQ A;  2NVX J;  3B6A A;  1LFB A;  5E3L A;  4A3J J;  4A3M J;  5F0C A;  3JRI A;  4I6Z A;  5BNG A;  2XPW A;  5IP7 J;  2IEK A;  3TP0 A;  2LR8 A;  4B4C A;  1ETY A;  1POG A;  2VKV A;  3OIO A;  2JA7 J;  1WGX A;  4QIW N;  1MBK A;  1RR7 A;  4C3J J;  1GV2 A;  2M9H A;  1GV5 A;  2YUS A;  1WH5 A;  2DMN A;  5EG0 B;  1ZTR A;  5E3M A;  1HF0 A;  4BY1 J;  4A3E J;  1JJ6 C;  3HGY A;  1IDY A;  2NS8 A;  4DYQ A;  4A3B J;  2GBY A;  4FE4 A;  1AKH A;  2EZL A;  4AUX A;  1OJL A;  2R5Y B;  2NOG A;  5K7F A;  4XID A;  1IG7 A;  3HEF A;  1W0U A;  3BG3 A;  2LD5 A;  1ETW A;  3I4N J;  4XRM A;  3RZD J;  1JKO C;  2E19 A;  1VI0 A;  2WAQ N;  2DMQ A;  1FEX A;  5IP9 J;  4A3D J;  1TWH J;  2LK2 A;  1JTY A;  2XPU A;  4DZP A;  1U9N A;  3Q0U A;  5J3L A;  3GTK J;  1K83 J;  3W6V A;  1HDP A;  3HOZ J;  1NK3 P;  2YU9 J;  5M5Y J;  1FTZ A;  2XB0 X;  1GUU A;  4JP0 A;  2MG4 A;  2GM4 A;  1ETX A;  1D5Y A;  3S2D J;  3BG9 A;  3FK6 A;  2MW8 A;  5JLX A;  2DMU A;  2LVS A;  1AHD P;  1WI3 A;  2N8G A;  4A3F J;  2DN0 A;  2K9S A;  4C2M J;  4RBO A;  3JR9 A;  2ECC A;  2X9D A;  1Y1W J;  2ECB A;  3BT9 A;  3BR3 A;  2HOA A;  4MIM A;  3IV5 A;  3RKQ A;  3BTJ A;  1JTX A;  1ZR2 A;  1H88 C;  2P81 A;  4UUT A;  2XGE A;  1U9O A;  1B8I B;  1FTT A;  1JKQ C;  1FIP A;  2ZB9 A;  3K2A A;  5FLM J;  1NTC A;  1A5J A;  3BR5 A;  1LE8 B;  3JRF A;  4FE7 A;  3WHB A;  2E1O A;  2FJ1 A;  2DTZ A;  2H1K A;  1UG2 A;  3S17 J;  1PUF A;  2HQ5 A;  1U8B A;  2LP0 A;  1OFC X;  3ZQH A;  2EZK A;  3B6C A;  4V2G A;  5IYC J;  3FKI J;  3FIW A;  5EZH A;  1GVD A;  2K9N A;  1P7J A;  2O7O A;  3GBG A;  3F0C A;  4FCY A;  3RZO J;  1ETQ A;  4V2F A;  4RDU A;  4BY7 J;  1R9T J;  1TC3 C;  3HBL A;  1W0T A;  4D5C A;  1MH4 A;  3TP3 A;  5F1J A;  1SFO J;  4ABZ A;  1APL C;  3MKL A;  2JA8 J;  1LE8 A;  5FLV A;  4A3K J;  1H89 C;  3JRH A;  9ANT A;  3OOU A;  2IBD A;  3HDD A;  3ZQI A;  1ZKG A;  2COB A;  2PMZ N;  5EGO B;  4Y52 J;  1T33 A;  2M34 A;  2TCT A;  3BQY A;  3S1N J;  3BTL A;  4A69 C;  1Y1V J;  3BTI A;  3G1L A;  2EQR A;  4C3H J;  1X2M A;  3H3V K;  4M6V A;  2HOS A;  3H0G J;  2R5Y A;  1ZGW A;  2DA4 A;  1IJW C;  1WCM J;  2LKX A;  1OCP A;  2Y9Y A;  4MFD A;  1VFC A;  4D5F A;  3CMY A;  1JKR C;  1DU0 A;  3JRA A;  2HDD A;  2Y31 A;  2EZI A;  4I76 A;  3MN2 A;  3LSR A;  5IP6 A;  5HOD A;  3S1R J;  5EYR A;  2HI3 A;  4W97 A;  3GTO J;  2I10 A;  3O8G A;  3I4M J;  1GT0 C;  3S1Q J;  3HGG A;  3GTG J;  2EBI A;  4XRS G;  4XIC A;  5EG0 A;  4M3G A;  5FKN A;  5C4X J;  1X2N A;  3IH4 A;  3S14 J;  2TRT A;  1I50 J;  5IPA A;  5F27 A;  2CUE A;  4M3B A;  5M5W J;  1TWG J;  1QRY A;  2JMW A;  3CQZ J;  5EZG A;  5F0F A;  4JX5 A;  5GPA A;  1CQT A;  1BA5 A;  4A3I J;  1VND A;  5M5X J;  3LNQ A;  1ITY A;  2LFB A;  2M2E A;  3O8H A;  4D7N A;  4UUS B;  3SDG A;  4A93 J;  2LY9 A;  1ORK A;  2X6O A;  3FIS A;  1MH3 A;  1YRN A;  5IYB J;  2HXI A;  3ZQC A;  1Z0X A;  2VUM J;  3IH3 A;  2XGC A;  1TWF J;  5F08 A;  5FKK A;  1P7I A;  1F36 A;  2DA3 A;  1DU6 A;  1BJZ A;  2IAI A;  4D7M A;  4DYR A;  3GTM J;  2YS9 A;  1T56 A;  3QPL A;  3ZQF A;  5EEA A;  2XB5 A;  4MFE A;  5F04 A;  1JKP C;  5FKM A;  2VKE A;  3ZOB A;  3PO2 J;  1QVT A;  2XRL A;  2H8R A;  1JT0 A;  3DCF A;  1JUS A;  2R5Z B;  2ME6 A;  2K40 A;  5FKO A;  3TED A;  4BKX A;  5DS9 A;  1HLV A;  1E3O C;  4DYC A;  2ME0 A;  3HOW J;  3HOU J;  1EF4 A;  2MSY A;  1RKT A;  1FJL A;  3BG5 A;  3TW6 A;  1HDD C;  3NAU A;  1WH7 A;  2FD5 A;  4M3D A;  2M8G X;  3HOX J;  4C3I J;  1HOM A;  3Q0V A;  1PUF B;  4A3G J;  3BR1 A;  1TWA J;  1U78 A;  3S16 J;  4XK4 A;  1GDT A;  3IH2 A;  2L0K A;  2OF7 A;  2Y2Z A;  2D5V A;  2WB1 N;  2NVQ J;  4A3C J;  1TWC J;  2ELK A;  3CCY A;  1ETK A;  4XRS A;  3SFI A;  2B63 J;  2XSD C;  2R7Z J;  5E3N A;  2HOT A;  2AO9 A;  5J1Y A;  1JGG A;  2DA2 A;  5IOZ A;  2RAE A;  3HOV J;  3CDL A;  2CJJ A;  3BQZ A;  3PO3 J;  2JA5 J;  4W1U A;  3BR6 A;  3JRG A;  5C44 J;  3ZQL A;  3OSF A;  3WHC A;  1MNM C;  3C2B A;  1B72 B;  4IEJ A;  2JJ7 A;  2R0Q C;  2DJN A;  2Y30 A;  3G1O A;  1NK2 P;  4GFB A;  3M4O J;  2CRG A;  5J1R A;  4NDL A;  1F43 A;  2ID6 A;  1JUM A;  3ZQG A;  2NVT J;  2LLK A;  1Z77 A;  5IOY A;  4IHY A;  1XC5 A;  2XGD A;  1AKH B;  4CYC A;  1MBF A;  1LFU P;  2E2H J;  2OPT A;  3A02 A;  1IV6 A;  2DMP A;  3L1P A;  1BL0 A;  3GTL J;  5JLW A;  4BXX J;  1MSF C;  2M0C A;  1IC8 A;  1Q1V A;  1RET A;  3UKG A;  3FK7 A;  1MBG A;  3JRE A;  2GLO A;  4M3F A;  2DA1 A;  3M3Y J;  2DMT A;  4X6A J;  2L7F P;  1ETO A;  2HXO A;  4MO7 A;  3E7L A;  1VF9 A;  1H8A C;  4QSH A;  2L7Z A;  2DA5 A;  3VPR A;  4QTR A;  5EGO A;  1RPW A;  2NVY J;  3QPS A;  1MSE C;  3RQI A;  4EEF G;  2NS7 A;  3BR0 A;  5K7H A;  2QCO A;  3LOC A;  3PM1 A;  2FX0 A;  2EZH A;  4B3A A;  2O9L A;  4J19 A;  3S1M J;  2CUF A;  4IHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...