2R93J

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r93J00
5GPAA 1JKQC 1HOMA 1RESA 2DMTA 5FJ8J 3GTQJ 3S1NJ 1XG1A 4XICA 4D5FA 5EZGA 1BW5A 5EF6A 5F0FA 4FE4A 5IYBJ 4BXXJ 1POGA 4NDLA 1VNDA 1MBEA 5IYCJ 1MSFC 3BTIA 1EF4A 1BJZA 1IG7A 1JGGA 1GUUA 4JX6A 2LD5A 2DTZA 4DZJA 5DTDA 5HODA 4IHXA 4JP0A 5FKNA 1HCRA 4A3MJ 3HOVJ 4QSHA 3O8GA 3OSFA 4I6ZA 5C4JJ 4AUXA 4B3AA 1ENHA 3HOXJ 3HKZN 2E1OA 3BG9A 2YU9J 2TCTA 1OFCX 4IHYA 4BY7J 1ETOA 2R5YB 4A3BJ 4W97A 2X6OA 4A3DJ 1LFUP 4IHWA 5EG0B 1CQTA 3GBGA 1I6HJ 1U9NA 2DJNA 2DMPA 2ECCA 5M5YJ 3GTJJ 2YUSA 5FKLA 4A3GJ 3OSGA 5EGOB 2JMWA 3IH3A 1JUSA 1SANA 2JJ7A 1IUFA 5FLVA 3S14J 5IP9J 3DCFA 1AU7A 4HNVA 2HI3A 3JREA 3JRHA 3M4OJ 9ANTA 2XPUA 3CQZJ 2JA7J 3TW6A 1LE8A 2LY9A 4MO7A 2HQ5A 3GTLJ 1PUFB 2EZLA 4GFBA 2Y2ZA 2VPRA 1H88C 5C3EJ 1GV2A 1F36A 1FEXA 2GM4A 2EH3A 1MBJA 2VKVA 3OIOA 1FTZA 1QVTA 2HOSA 2K40A 4MLOA 4M3DA 1OJLA 3HGYA 4LOCA 5FKMA 2HOTA 3DEWA 1ETWA 4BY1J 3JR9A 2WV1A 2CUEA 1S7EA 2OF7A 3LSRA 1K83J 1Y1WJ 4DYRA 1ZGWA 3BTCA 1T56A 3A01B 1P7IA 3NAUA 2CU7A 2NVXJ 2MG4A 1YRNA 5J1UA 4W1UA 3IH2A 4V2GA 1Z0XA 3HEFA 4MIMA 1JUPA 2E19A 4A3KJ 3JRIA 2FQ4A 2KT0A 4X1EA 1ITYA 4UUSB 3WHCA 1I50J 1VFCA 1TWGJ 2VI6A 3HGGA 3A02A 4B1RA 2ELKA 4D5CA 3HDDA 4M3BA 5IYDJ 3Q0UA 2CQXA 5F27A 5DS9A 3GTOJ 3HOWJ 5EG0A 1ZKGA 3JRCA 2O7OA 2CQQA 5F04A 4C2MJ 1ZR2A 2D5VA 4A3JJ 4ABZA 1B72A 2B63J 5J1YA 2R92J 2LFBA 3FISA 4A3EJ 1Y1VJ 2DA1A 2JK3A 3Q0VA 3FK6A 3IH4A 1A6IA 4BKXA 4MFDA 1IGNA 1WH5A 2CRGA 2XPVA 2NVQJ 2R5ZB 3QQAA 2HYJA 3BR1A 1GV5A 1BA5A 4C3IJ 3S17J 2K9NA 1UMQA 4G12A 3ZQGA 2AHQA 4XRMA 3IV5A 1IC8A 5C4XJ 3TP3A 1A5JA 1XC5A 4D7NA 3ZQCA 2O8KA 5EDNA 1NTCA 1X58A 1E3OC 1HDPA 2DA7A 3ZQHA 2XGCA 1TWFJ 5IP7J 1IDZA 2IBDA 1WPKA 3HM5A 3RKQA 4JYKA 1B8IA 5E3NA 1T33A 2EBIA 2I10A 2XGEA 3S1RJ 1U78A 3BT9A 3HOYJ 1TWAJ 1ZQ3P 2P81A 4RBOA 3MVPA 1WI3A 1JKOC 2R7ZJ 1O4XA 3FK7A 3E7LA 2XB0X 1MBGA 3K7AJ 3PM1A 3LNQA 3UKGA 1NK2P 2R5YA 1BW6A 4EEFG 4M3FA 2DA6A 2ME6A 5IOZA 1WCMJ 3TEDA 2NVTJ 4JX5A 3D1NI 2HOAA 2COBA 2LP0A 3S1MJ 4FTHA 1IRZA 2Y30A 3BR6A 1PUFA 2MSYA 2E2HJ 3F0CA 4AYBN 3LSGA 4Y52J 4A3FJ 3JRFA 3I4MJ 1FIPA 1OCPA 3HOUJ 5M3MJ 1RKTA 2H8RA 3LSPA 3Q3SA 1JTYA 5EEAA 3HBLA 2DMNA 1H89C 2XB5A 3TP0A 2X48A 3BR2A 4M3EA 2L9RA 4B4CA 2L7MP 3QPLA 2M34A 1AKHB 3O8HA 1MBFA 3VPRA 5F0HA 1P7JA 3G1LA 1IJWC 2EZIA 1JT0A 1FTTA 5F08A 3S2HJ 3WHBA 5E3MA 3G1OA 5M5XJ 1W0UA 3FKIJ 2EZKA 2ID3A 2Y0SN 3JRBA 2QF7A 4DZPA 2LLKA 1MNMC 4C3HJ 3BR3A 4A93J 1NK3P 1QVUA 4A3IJ 1Q1VA 4FE7A 1ETVA 4QIWN 4XRSG 1VF9A 1R9TJ 2DMUA 5IPAA 3NARA 2M0CA 1U9OA 5J3LA 3HOZJ 2CJJA 1RPWA 2OPTA 2DA5A 3B6AA 4Y7NJ 1JTXA 1RKWA 3BR0A 1MH3A 4M3GA 2CUFA 5FKKA 4DW6A 1LE8B 3S2DJ 1DU6A 2JA6J 1JKPC 3RZOJ 1LFBA 3OOUA 1MBHA 2MGQA 5M3FJ 2VUMJ 2KDZA 2L7ZA 2Y31A 4QTRA 2GBYA 3H0GJ 5IOYA 2M2EA 4IEJA 4FCYA 2X9DA 3BQYA 5GP9A 2K9SA 1QRYA 1X2MA 1QPIA 5IP6A 4J19A 4M6VA 4CYCB 1B8IB 1DU0A 5F0CA 3FIWA 1W0TA 3CDLA 2HXOA 2NS7A 5M5WJ 5JLWA 5EGOA 1HLVA 3MN2A 3H3VK 2IEKA 1HF0A 2XSDC 3PO2J 4A3CJ 2Y9ZA 3QPSA 5E3OA 2K9QA 3BTJA 3SDGA 2JN6A 5J1RA 1APLC 4BBRJ 2VKEA 1SFOJ 3A03A 1ETXA 3I4NJ 4S0HB 1ZR4A 2NOGA 3BG3A 1ZTRA 1FJLA 1H8AC 2XGDA 3GTPJ 3ZQIA 4I76A 2FX0A 2E2JJ 3ZOBA 5EZHA 1Z77A 2NS8A 2R5ZA 4JX4A 1IDYA 1GDTA 3S15J 2W48A 1WGXA 3A01A 3JRGA 1ZK8A 4XIDA 1YRNB 4XRSA 1MBKA 2JWTA 2DA2A 4DYCA 1ETQA 5FLMJ 2ECBA 4UUSA 1MH4A 1MSEC 2LK2A 3ZQLA 1TC3C 3LOCA 2AO9A 3CMYA 1JJ8C 4D7MA 1GVDA 1X2NA 2XPWA 1FIAA 2JA5J 2WAQN 2WB1N 4XK4A 2DN0A 4CYCA 2L0KA 3GTKJ 1G2HA 4A69C 3BTLA 1UHSA 3L1PA 2L7FP 1U8BA 3PO3J 2EZHA 1OCTC 4X6AJ 1HDDC 4DYQA 3BG5A 2M9HA 3C2BA 2XRLA 2YS9A 5BNGA 1JKRC 3HB9A 3RQIA 3GTMJ 1D5YA 2DMQA 3B6CA 3ZQFA 1TWHJ 2ME0A 2FJ1A 2GLOA 2LVSA 3S16J 2HXIA 2IAIA 5K7HA 1JUMA 3JRAA 2DA4A 1RR7A 2ID6A 3LSJA 4L5EA 2R0QC 1B72B 2ZB9A 2O9LA 4V2FA 2QCOA 1I3QJ 2E2IJ 3K2AA 3BR5A 1K61A 4AC0A 5K7ZA 1TWCJ 4RDUA 2DA3A 2M8GX 4BBSJ 4MFEA 3SJMA 1AKHA 1VI0A 1F43A 3G1MA 3Q0WA 2LKXA 5FKOA 1UG2A 2Y9YA 1IV6A 4IHVA 1ORKA 1XS9A 3M3YJ 2H1KA 2NVYJ 4C3JJ 2TRTA 2EQRA 3TW7A 5K7FA 3GTGJ 3W6VA 1BL0A 1GT0C 2JA8J 5GPCA 2FD5A 5F1JA 2PMZN 5C44J 1WH7A 1ETYA 2G0EA 3CCYA 4FISA 1JJ6C 2N8GA 3BQZA 4UUTA 3SFIA 1JT6A 1AHDP 5JLXA 3JRDA 2LTPA 2HDDA 2R93J 1ETKA 3MKLA 3RZDJ 2RAEA 2LR8A 5EYRA 5E3LA 4A3LJ 3S1QJ 1RETA 2MW8A
chains in the Genus database with same CATH superfamily
1X1BA 2IT0A 2DMTA 4PSXA 3GTQJ 1Z7LA 4G8XA 5EZGA 3WTUC 2QKLB 5HDNA 5FFXA 5F0FA 4FE4A 3S93A 5IYBJ 4IF4A 2ICWG 3P5JA 1MBEA 5JHUA 3WTYC 4ZTJA 1HBXG 1MMSA 3H92A 1GUUA 3J7YJ 2MA3A 1X4OA 2DTZA 1Q1HA 2GXGA 4DZJA 4IHXA 1FC3A 2B9SA 1H9TA 3DBLB 3DWLE 4QPOA 3O8GA 4I6ZA 2W4SA 2KHMA 4B3AA 2CO5A 1DDNA 2VQHA 3KYCB 3HOXJ 2RV8A 2DFIA 2YU9J 4XLCA 4IHYA 3BCAA 3OYGA 4A3BJ 2CW7A 2LSOA 1Z91A 1XTAA 2YX7A 4HOBA 1WJBA 2EFOA 5DYMA 2ECCA 3GTJJ 3WTVC 4RA2A 1M1EB 4IXAA 3TKYA 3HTSB 1T0FA 3L09A 1JUSA 2DFFA 1IUFA 4UY8I 4PSWA 3JREA 3NEUA 2XPUA 4BJ5C 2JA7J 1LDDA 3JAMZ 3CMMA 2IA0A 2HQ5A 3HC7A 2O5RA 5DCMA 2KISA 5HDGA 1WQ2A 5C3EJ 4XSXF 1FZPB 5KAIC 3I0TA 2HQNA 2HQRA 3S3NA 1A04A 2K40A 3N97A 2QQ8A 1IAWA 1BOBA 1K7AA 1G4DA 1IXRC 2WAEA 4MLOA 2DOFA 5FKMA 2HOTA 4ENMA 4EMSA 5ERIA 4NNJA 5E1ZB 3BTCA 1X1AA 3NAUA 2VJIA 3U21A 1YRNA 2HTJA 4A3KJ 1Z0XA 1P4AA 2M45A 2EB7A 2KRFA 3I56I 4RB2C 4UUSB 1VFCA 2VI6A 4B1RA 4BXUA 4F92B 4ZZLA 1LB2A 4I2OA 3HDDA 5KHDA 5IYDJ 4HEA2 1ZG3A 2CQXA 2XSJC 4XLAA 3JAMK 3CCSI 2QSFX 3P9CA 4BEHB 4H4KC 4EJTA 4ZH4F 1FOXA 5DEQA 2K9MA 2ZMEB 1BM9A 2QEXI 2HVQA 3Q0VA 3LA7A 1A6IA 2DJIA 4MFDA 3R4KA 3C1DA 2NVQJ 4Y4RA 1BOAA 2HYJA 1X3UA 3O3KA 3RYRA 3S17J 3CMAI 4E7SA 2K9NA 4OIRF 4FHTA 5LHHA 1X19A 2AHQA 1FSEA 3LSKA 3QU3A 1VQ9I 5BPDA 2DW4A 2ZJPF 4A6DA 1IN6A 2VC0A 4II2A 3ZQCA 3MFKA 1NTCA 1QZYA 3G6EI 3W6JB 3L2QA 2XGCA 1TWFJ 3LAJA 2Z33A 5IP7J 1OPCA 3BY6A 3D5SC 3IL2A 3HPHA 5D5XB 4OU0A 1SFXA 2DT7B 4L9JA 3HM5A 4IX7A 1MDMA 2CV1A 4JYKA 4BDYA 3S1RJ 1PUEE 1QBJA 3EUHC 2XIGA 5J4YA 3DFGA 3LMMA 2STTA 3HOYJ 3EYIA 3RKWA 1JKOC 2E71A 3V8JA 4IHTA 3UKGA 2IS4A 2BZTA 3CCQI 1BJAA 3WTXC 3K9TA 2K86A 4H0EA 2NAZA 3OS2A 2GAUA 2LYCA 2OAZA 1IN7A 2QQAA 4A6EA 3PIPF 4EGYA 4N0BA 3QOPA 1P2FA 2ZCWA 2B0LA 2P0WA 5TRDA 3IAM2 2Z2SB 3O2PE 3D1NI 3ZRGA 3OYLA 2COBA 5CVJA 2PJPA 3CZ6A 1S7AA 3QP6A 3S1MJ 4NB5A 3D5RC 1W36C 2R7XA 1EA3A 1ON2A 1WHUA 3AG4H 2MSYA 2A6EF 2V6CA 4KIGA 4Y52J 3H1CA 4DQ2A 2ZXIA 3DEEA 1K6YA 1EH6A 1OCPA 2A5WA 2XAGA 3CC7I 3Q3SA 1JTYA 2L2OA 3HBLA 2M3AA 1XGMA 2DMNA 1H89C 4EATA 4M3EA 4B4CA 3N4MA 2L9RA 2EFPA 2L7MP 4AU7A 4XL9A 2WV0A 3WTSC 3E1SA 4E7LA 1PYVA 3DQVC 2V9VA 1JHFA 3K4MA 1KU3A 1T98A 3VPRA 1BR2A 1P7JA 1U5TA 3PQKA 3G1LA 3LAPA 2EZIA 2PN6A 4PGHA 4RS8A 5HDKA 1I1GA 2BW3B 3S2HJ 4KITB 3KLNA 3G1OA 2WY8Q 1Z21A 5M5XJ 1W0UA 4IRHA 3FKIJ 1HSJA 1XD7A 3KEQA 2EZKA 3AAFA 1MNMC 4ESBA 4C3HJ 1WZ2A 3SZPA 4CXFA 2WAFA 4FE7A 4QIWN 4MEXF 3ONQA 2M4GA 1GXQA 2ZFUA 2FUG2 2GA2A 3ZMDA 1D8JA 1IZ1A 1U9OA 5LRSA 2PMUA 2FQ3A 2P5VA 3LWFA 3B6AA 4KNYA 2L5QA 5EEGA 1SMYF 4DW6A 1DU6A 1FLIA 1AA7A 1LFPA 3QPTA 2JA6J 2Y75A 2OU2A 3V7RA 3RZOJ 2M7BA 5E79C 4HX8A 1UZCA 4C9YA 5E20A 3M07A 2R7VA 3TOAA 1G8XA 4CCOA 2GZWA 5DUKA 3W2WA 2L7ZA 2Y31A 4QTRA 5A2QK 3BZ6A 3OL3A 3F23A 2X9DA 1HW2A 4LG3A 3I3LA 2HZTA 3SQNA 1RR8C 4RB0A 2JRTA 4PK4A 4J19A 3U1KA 3HJEA 4BL0B 3RCOA 2HXOA 2VBYA 3PNVA 1VQPI 3VODA 3QYFA 3BROA 4B47A 2P6SA 4KA4A 5FFZA 2Y9ZA 3B02A 5E3OA 3BTJA 2Q1ZB 4E4HA 2DU9A 1MJ9A 5J1RA 4EVIA 4XLPF 2DT5A 3K10A 1BC7C 4WXCA 2W24A 1FJLA 1F1ZA 5D5VB 2E1MC 5K5QA 2COMA 1Z77A 2MLKA 5B1AH 2NS8A 3I5UA 2R5ZA 2BHYA 2LMDA 4KMFA 2QQBA 2JVGA 1GDTA 1YOVB 1T0FC 2W48A 2VXZA 2DOAA 3M8JA 3K69A 3GMEA 4V19K 5LEJA 3BZCA 1FYLA 1XCBA 5J6XA 2DA2A 3GZ5A 1YITI 4OAZA 1NG7A 4UV8A 1MSEC 1Z6TA 4AM3A 3FM5A 5ILVA 2IP2A 4RGXA 1JJ8C 1SFEA 2OQGA 3DLAA 2QUFA 2G9WA 1GVDA 3MZYA 2HPMA 4XK4A 2A69F 1ZH5A 2A6HF 1G2HA 1LUJB 1MJAA 4HSTA 5BS6A 4HQMA 4A69C 3BTLA 4YELA 1UHSA 3AKZA 2ZMEA 3R61A 1CF7A 3E6BA 4BJTA 4YIIA 4DYQA 3FWEA 3W2VA 3C2BA 2YS9A 5BNGA 1JKRC 3SDBA 1FOKA 1Z6RA 1D5YA 3GFIA 5D6FA 3H9QA 5FB2A 1SVLA 1IO2A 5B5EC 1VQ5I 4MTEA 1EV7A 2W25A 4NQWA 4B44A 3CJNA 4XLHA 4BE0A 4XRFA 3DTIA 1B9NA 2CQ7A 4XN0A 1VQOI 1WJ5A 4BEHA 3GXOA 2DA4A 3GLXA 1RR7A 3HXLA 2R0QC 2K4JA 2C6YA 5CYVA 3PL8A 2ESHA 1K78B 1TQIA 3K2AA 1SAUA 3BR5A 2BGCA 3CCLI 4RDUA 5K7ZA 3KETA 2X1DA 4MFEA 2W57A 5FD5A 1F43A 2O8XA 4MTDA 3Q0WA 2LKXA 2LC2A 5FKOA 4L9NA 3OYHA 3Q9SA 4M6XA 1WWXA 4GGGA 2NVYJ 4I01A 3M3YJ 2ZNZA 3J7ZI 4UHTA 5FRNA 4IQJA 5GPCA 3FXKA 2F5CA 4S04A 1S3JA 3PFIA 1SD7A 5D5UB 3TDUC 2BEOA 3REOA 1JHHA 3L2VA 3RPUA 1CF7B 2DPUA 1ZREA 2N8GA 2OQRA 2Z5UA 3BQZA 4UUTA 4JOMA 4BNCA 2FOKA 2X85A 3GW2A 3JRDA 2LTPA 2JUCA 2FNPA 4E6KG 2RGVA 1HKQA 1ZARA 2GIVA 3W3CA 2QLZA 4JBAA 2CUJA 3P9KA 2LBFA 5EYRA 5E3LA 1X3ZB 3RTRA 1DPRA 2BYVE 4I98B 1TL8A 1O7LA 1RETA 2CH0A 2VBZA 3MKWB 3ECHA 1HOMA 4U0YA 2M4KA 1OR7C 4Y15A 2OV7A 3OYEA 2ZC2A 5H6RA 4D5FA 2EJRA 3M9AA 4L0YB 5DD8A 5IYCJ 2V9PA 2IRFG 1TQPA 3HRSA 3MWMA 2ZJQF 1JGGA 4IL6C 4JX6A 3WE2A 3BP8A 3KYDB 5CPRB 5E8IA 3WG7H 5HODA 4JP0A 4CHUA 3SFZA 3KE2A 4FX4A 3FXQA 2NS0A 1KGSA 4QSHA 4XN3A 3KZIC 3ZCOA 1T38A 4I09A 3HZJA 2VT2A 2V9KA 3F22A 3HKZN 1X1PA 4EM0B 2XUBA 4KJZA 4BY7J 1ETOA 2R5YB 2BVLA 4L9VA 1RUOA 2R7RA 4XORA 1CQTA 2EV6A 1WVRA 2V6EA 3U9GA 2DJNA 2JA2A 4BUPA 3AFHA 1IW7F 2A5YB 1R49A 4IKFA 3KP3A 1UFMA 4XLNF 5FKLA 3OSGA 3KEOA 3VYRB 5EGOB 1TW3A 2JMWA 2QKMB 3K0LA 2JJ7A 5FLVA 4HW0A 3DCFA 1AU7A 1A35A 2HI3A 4OMZA 1Y8RB 4BJ6C 1LE8A 2STWA 4MO7A 5GAHJ 3GTLJ 1PUFB 3OWTA 4GFBA 3BC8A 1J7KA 1PJRA 3C3WA 3E5UA 4IVNA 2NNNA 2HU9A 1E17A 4BQNA 3T1BA 1FTZA 1JGSA 1QVTA 3ESWB 3WU0A 2IVMA 3J80Z 2CFXA 4UB6C 4BACA 1YFHA 2UZKA 3RSNA 3HGYA 3I59A 4LOCA 4PJ0C 3JR9A 2WV1A 1S7EA 1SD4A 2QVOA 1K83J 1Y1WJ 4XOPA 4RB1A 2BXZA 2LKPA 2BOLA 4E7IA 2NVXJ 3HUGB 1ZYRF 4HBLA 1J0RA 3J7AY 4X1EA 3DKYA 4PZJA 2HZDA 1TWGJ 2AXLA 2VODA 3M7GA 3HGGA 3KP4A 3HG9A 1X1DA 3TL4X 4EGZA 3G73A 2PFBA 2KFDA 4M3BA 2CYYA 4EQQA 2CFOA 1KQ8A 1LJ9A 3Q0UA 3N05A 5F27A 5HOOA 2X6XA 1SAXA 1R1UA 1HXDA 1AWCA 2EPFA 3HOWJ 3JRCA 2O7OA 2CQQA 3ZN0A 4C2MJ 2D5VA 3T0YA 2GQQA 4OOIA 4A3JJ 4PGGA 1J75A 1ZG5A 3DXJF 4P96A 2R92J 5JR3A 4BXFA 2LFBA 2NOJB 3R0JA 1YW8A 2H27A 1Y1VJ 3LA3A 4IJAA 4BKXA 3L2UA 1WH5A 2XPVA 5L3BA 2R5ZB 4A2UA 6PAXA 5GAGJ 2KJBA 2FBKA 3BR1A 3DPTA 2A05A 4FETA 3M1CA 1HC8A 3LSHA 5EJCA 3ZQGA 1N75A 3VSLA 4XQFA 1QHHD 1LEAA 2WAQA 3GZ6A 2HTSA 4A0XA 2PG4A 3OIPA 4HQEA 5GTIC 3KZZA 3RKXA 3LFUA 5J47A 2QBYB 4MQ9F 2V7FA 5EDNA 1MGTA 3OYNA 4NC7A 1X58A 2OC6A 1E3OC 2IS6A 3ZQHA 2A68F 4RAZA 3P7NA 2QQ9A 2H6CA 4B8XA 4R8HA 3WODF 4EM1A 5E3NA 1U78A 2K3FA 2M5WA 2OA4A 4XONA 4WK8F 2HNHA 1W5TA 5CQGA 1ZQ3P 4C30A 4RBOA 3W6KB 2FEZA 2FRHA 3FK7A 1WJFA 2VIXA 2HGCA 3K7AJ 1XX5A 3BZKA 1W36D 1YW7A 2CG4A 4WXHA 1KONA 4G6TB 4ENNA 3ZR8X 2Z16A 3FF5A 3JSOA 2R7OA 1OR7A 2DA6A 3PNTA 5IOZA 4A5NA 2RC4A 4ZJZA 3E6CC 1QQIA 2FBIA 1Z1DA 3VDXA 1O3SA 3ULQB 4G7HF 4X0GA 1ZRFA 2GOMA 2HOAA 4XR6A 1KZHA 1TLHB 3GFLA 4Z6YA 2JSCA 2LP0A 2Z1DA 3E5XA 4ON0A 1R5GA 1YJWI 4FTHA 3ZQ7A 2E34A 3FHZA 3BR6A 2KJCA 2ADUA 4UNOA 1HA8A 3F3XA 2TDXA 1MMGA 3F0CA 2XV4S 3LSGA 2HR3A 3JRFA 3FMSA 1YTYA 1ZLJA 2E7XA 1FIPA 1H0MA 3BPXA 5M3MJ 1RKTA 1SFUA 3E6MA 4L0ZB 1W7PB 2XB5A 4R1HA 2XRNA 1ZGAA 3BR2A 2IGOA 4QLCU 4DGWB 4LB5A 5IT9Z 2JZYA 5AONA 4F7ZA 1MDMB 1FBUA 3I71A 5FLXZ 3RI4A 2DODA 1P92A 3GLLA 1N78A 3UR3C 1MBFA 2QSGX 5F0HA 2CUZA 4AIDA 2O6GE 4OWRB 1IJWC 3NRVA 4PJJA 4F3QA 3DKXA 4I0BA 1B1BA 1F4KA 2VE9A 3WE3A 1T08B 2K27A 1OCRH 3JRBA 2OUMA 5CJ9A 1T39A 1ZHFA 4G6DA 3QODA 5ICEA 3RQ4A 2DCEA 2JPBA 3BR3A 1FBSA 3DPLC 3SEZA 1J5YA 4FASD 4MEYF 2F5VA 1N77A 2VONA 3KP2A 4U87A 1XPXA 3PIOF 5CVRA 1WJAA 3KP7A 2O3FA 2MLGA 4XBFA 5IPAA 5E18F 1F5TA 3S8PA 4EV0A 5JI6A 1RPWA 2DA5A 3V8KA 1XSVA 2EINH 2A6TA 2MC4A 3BLYA 5TISC 4CYDA 2IS2A 4WWCA 4BQAA 1D5VA 4DIQA 2QA4I 1IRFA 5K1YA 3HKZA 4F91B 2QWWA 3ZN1A 4RAFA 1VQ7I 3OOUA 3CO6C 2EV0A 4HV5A 1KU9A 2R7FA 5L3DA 1BI1A 4I7HA 2HQAA 1XMXA 5M3FJ 5HLHA 1Z3XA 1VQ8I 1YYVA 2KMUA 2XAHA 3H0GJ 4NUBA 3FXOA 5JHFA 3CUOA 5GP9A 3ELKA 4IRGA 2E1CA 1UHWA 1X2MA 2K9SA 4DNCA 3ERED 1QPIA 4ZTFA 5FGMA 2L54A 1U0JA 3BWGA 3CDLA 3DKWA 4MNUA 5H6QA 3J80K 3QPHA 5LHGA 2NS7A 5M5WJ 2ZXJA 1NHAA 1TNTA 1MW7A 3H3VK 5D8KB 2KRCA 4PFPA 4ZYAA 4HG2A 4NC8A 3JSPA 4ESFA 2K9QA 3H3ZA 3SDGA 4PJLA 4LFUA 1W5SA 4BGDA 1DQUA 3K70D 1GXPA 1ETXA 1USTA 2V4JC 3FX3A 2YR2A 1O7FA 1ZR4A 2NOGA 1R23A 1ZTRA 2EIJH 4YIFA 1H8AC 2XGDA 4KFCA 1BR4A 4QWQA 1YQAA 4ZYEA 4UVCA 2MH2A 4LJZF 4CH7A 3T8RA 3CTAA 2DQLA 3KPHA 3VYSB 3GFMA 2K9LA 2L9NA 3JTGA 3S15J 3RJPA 1WGXA 3G3ZA 4CUGA 4CCJA 1J59A 2A07F 1BC8C 1MMAA 4Y13A 1YRNB 1MBKA 2JWTA 2UV1A 3ABTA 2EFNA 3OR2C 2XGXA 1I27A 2LNBA 2ECBA 4DYCA 5FLMJ 4UUSA 1MH4A 3EUAA 1ODDA 3I9V2 4XKBA 1OYWA 5HS8A 3J81K 3MCZA 2FA5A 1D1BA 2AO9A 1R36A 2KKOA 3OY9A 2PLYA 4D7MA 4PDKA 3RDIA 4BE2A 2MH9A 2XPWA 1FIAA 2WAQN 2PBIA 2DN0A 2F4OB 2KQRA 5D4SA 2P5KA 1HKSA 4RMNA 2DYRH 2IGMA 1DPUA 1YS7A 2EZHA 2V1XA 3F9KA 3RPUD 5LRRA 5HS9A 3CCEI 2X4HA 1Z7UA 3RQIA 1LDJA 2CWEA 3GTMJ 1P9QC 1LKXA 4Z2YA 2XASA 3SZTA 4O3MA 2NVUB 2BY1A 1UJ8A 3H36A 2HKOA 2DK5A 4P5OA 4YFKF 1SD5A 5KVRA 3I54A 2IA1A 3L2RA 2IAIA 1JUMA 2M0MA 1Z05A 4BAYA 2O9LA 3GUDA 4M9ZA 1L3LA 2DYSH 3LQRA 1FPQA 2MABA 2FE3A 3L7WA 3IKTA 1Z9CA 4KN4X 2FXAA 3CP2A 4E70A 4BBSJ 1VQKI 1VI0A 2GIZA 1O3TA 3ML6A 4MGRA 4O6JA 2D1VA 1RI7A 2ZO4A 2DK8A 4WXDA 1UG2A 3O6BB 2E36A 2V79A 4IHVA 1A6QA 3HIFA 1S29A 1OISA 2ETHA 2HDWA 2DPDA 1KU2A 2D2WA 5K7FA 1BI2A 4I0AA 4CCKA 3WGIA 2RDPA 3IWFA 2XF5A 1E3HA 4EJWA 3OYFA 3ABUA 5DCFA 2NRAC 1WH7A 3ROUA 2BV6A 3LQQA 3EQLF 4P9FA 2XAQA 2VASA 2B7EA 3IRRA 3CJTB 4FISA 5GADJ 5L3FA 2R7WA 1G3TA 1JT6A 3H9JA 3QWLA 1J09A 2EWNA 2RNJA 5JVGF 1XN7A 2RQPA 1Y8QB 3P9IA 4HZFA 4L5JA 4ANJA 2HDDA 1BR1A 4L18B 1Y0NA 3MKLA 3F21A 3S32A 2IS1A 3DF8A 2RAEA 3EUKL 3IC7A 3DBHB 4HLXA 2LR8A 2F6CA 1MD0A 3S1QJ 1E3PA 3F72A 3DPUA 3GFJA 3ISPA 5GPAA 2XVCA 1D0XA 5KK1A 2V1DA 1RESA 1GVJA 2ELJA 3HOTA 1UHMA 1XG1A 2FMYA 4XICA 1ZLKA 1B59A 5FROA 5CLSA 2XDVA 4L5IA 2IA2A 2HPIA 5JFRA 2XKPA 1W7PD 4BE1A 3KP6A 4NDLA 4HSRA 4CGZA 1MSFC 1G3SA 4IZZA 1RC9A 1ZG1A 1EH7A 1FX7A 2I8DA 2OD5A 2W1OA 1S9HA 1VZ0A 1DUXC 3TMOA 3SYTA 5DTDA 1BI3A 1U5TB 3EUHA 1V54H 4PUSA 3V7SA 3VSKA 1LPQA 1HCRA 4U7BA 4A3MJ 2ZFWA 3HOVJ 1IRGA 3F8NA 5C4JJ 3U1DA 4AUXA 1IN8A 1W7PA 2HFHA 3BG9A 2TCTA 2PMHA 3EETA 2NXNB 3TDZC 4M9XA 2R7DA 4W97A 2DDBA 2X6OA 1YJ9I 1FOWA 4A3DJ 3CJQB 2HOEA 4IHWA 5EG0B 3I64A 3GBGA 1I6HJ 2EILH 1U9NA 4AIJA 3TO6A 3OYMA 2M30A 2R7TA 2YUSA 4A3GJ 3I58A 3CCMI 1WJEA 1SANA 2D45A 3C18A 1WJDA 4FX0A 4HNVA 5HVQC 1VTNC 3M4OJ 3MZHA 5GTHC 3CQZJ 3TW6A 3TOBA 2LY9A 2ZKZA 3FZVA 3KLOA 5HLGA 2M1BA 2W84A 1H88C 4AVZA 1BI0A 1F36A 1FEXA 2WB1A 2JQ7A 1ERDA 2EFWA 2VXDA 3W2AA 1TZLA 4D0PA 2HOSA 2A61A 2E35A 2GOXB 4HF0A 4L9TA 4M3DA 2FSWA 2O03A 3DU6A 3F8CA 3DTEA 2AXTC 2CUEA 1I39A 4CCNA 4AYBA 3LSRA 4DYRA 1PP7U 4Y17A 1P7IA 1D1AA 2CU7A 3HSFA 1QA6A 2M8EA 1A31A 4W1UA 2EA4A 3HEFA 4MIMA 1JUPA 2E19A 2G7HA 3WTTC 3JRIA 2KT0A 1ITYA 2R7SA 2FBHA 3FXMA 3MQ0A 2P5LC 1P6RA 2F4MB 4E7HA 1XMAA 4PFOA 2V1UA 1WKMA 5ILSA 4A0ZA 2ZNYA 3X2QH 3L2WA 1I3AA 1V5GA 3CF5F 1W4MA 5LD2C 5LHIA 3GTOJ 1C0WA 2DXIA 2BE5F 4ZC3A 1ZKGA 4ZDOA 3CLQA 2KIMA 2D1HA 4CCLA 2IXSA 2B63J 5FLXK 4EJVA 1G59A 4G7OF 4ZDLA 5LFAA 2JK3A 4ETSA 3IH4A 1USSA 1IGNA 2CRGA 4BQOA 1U5TC 3WGHA 1SEUA 1GV5A 2FU4A 3F8BA 1DGWY 4S05A 1UMQA 1O3QA 4M6YA 3IV5A 2ZBKA 1HQCA 3MZ8A 3OR1C 3K1MA 1IC8A 5C4XJ 3TP3A 2VKDA 4LIVA 4OIPF 3I4PA 1A5JA 1XC5A 3ABLH 3GCMA 3HPGA 2VOPA 1T95A 2O8KA 3FM3A 2X6YA 2DA7A 3CESA 5H20A 1LQ1A 3QP5A 2IBDA 1TBXA 1ZN2A 2QYOA 3RKQA 2OCCH 3L9FA 3GYHX 1B8IA 1T33A 2CS3A 2DAOA 2OCEA 5BMZA 3BT9A 5LGTA 1TWAJ 3D5LA 3IWZA 2P81A 1LDKB 2Q0OA 3MVPA 1WI3A 3PUFA 2R7ZJ 4HNTA 4IOAF 3E7LA 2XB0X 1MBGA 1NK2P 2L4MA 2R5YA 3HSEA 3IAS2 4EEFG 3EPZA 2ISYA 4XKCA 3BDDA 2JRMA 1W1WE 4RGRA 3BG7A 3DLLF 3V4GA 4ENKA 4M3FA 2ME6A 3F6VA 1ULYA 2VB6A 1FMVA 3WGGA 2LH9A 3OS1A 1R4MB 2LRDA 2Q8KA 2NVTJ 4TV7A 3ECOA 2DO7A 2X1EA 4ASNA 3LL7A 1ONVA 1ZGJA 4GRIA 1JE8A 5E1WA 1K79A 4BYYA 4PJNA 4C2UA 2E1MB 1RRJA 2E2HJ 4IHSA 2OTJI 2PEXA 1Y39A 3I4MJ 5LBQA 4KIFA 2PJRA 2RKHA 4ZZDA 3HOUJ 2H8RA 1D0ZA 3DTKA 1SD6A 1XDUA 3QPLA 2M34A 2LOOA 2ZSHB 3FHNA 3OV8A 3ZQQA 5IT9K 1EJ9A 5CVUA 3ABKH 2CV0A 1AKHB 2EA2A 1WRJA 2QM3A 3O8HA 1P4XA 1MIJA 4F55A 4AVPA 3K6GA 4RAGA 3OYKA 1YJNI 1JT0A 1FTTA 5BPIA 3ZXSA 4GXOA 5E3MA 3ZMSA 4YFXF 2AQFA 1LNWA 3FMQA 1YX3A 2QF7A 2LLKA 1S7OA 1QNTA 1KA8A 1KQ9A 4A93J 1EKEA 3OMYA 3OYBA 4BU2A 3G71I 1R22A 2J5OA 3LA2A 1VF9A 4XRSG 1UB9A 3JTHA 2KLOA 4NBQA 1R9TJ 4UXNA 2DMUA 3K4LA 4G6QA 5L3CA 2KZGA 5E17F 2HKXA 3HOZJ 1QGPA 3NWSA 1JTXA 1RKWA 1MH3A 3MMYB 4EJOA 2LG4A 2P7VB 5FO5A 4HRIA 2CUFA 5FKKA 3OYIA 2DFEA 1YE9A 4Q5SF 3FDYA 1R1VA 3KIOA 1QO0D 3H5AA 3L2CA 3HSRA 1HW5A 1MBHA 1RZ4A 2MGQA 3H35A 2KDZA 1YW9A 2RVCA 2VC1A 4AWXB 2LF8A 1LEBA 1D0YA 3L00A 2M2EA 3CF2A 5E8GA 2CQKA 5D6EA 2BY0A 3BQYA 2E60A 1R5HA 1QRYA 2EFQA 4LK0F 4CZZA 1W0TA 4A5MA 3BCBA 3FXLA 3RKYA 1GLNA 4RGUA 1OCZH 2WA0A 1RIOH 2OBPA 5JLWA 5EGOA 1HLVA 2VJJA 3MN2A 2IEKA 2LDUA 2XSDC 1XSDA 3E0JB 1I5ZA 3PO2J 4A3CJ 3QPSA 4KDPA 4NHJA 2K4BA 5BOXA 3K4KA 3GWZA 1BIBA 2VOOA 4M9SA 5CQEA 1APLC 3JW4A 3A03A 1K4TA 2Z9OA 3I4NJ 4XSZF 2V1NA 4LLGF 4LG0A 1WI9A 2A3SA 4S0HB 2E1NA 3BG3A 2HS5A 2ZJ2A 4I76A 4OINF 2FX0A 3VFZA 3ZQIA 2E2JJ 1SC7A 4CDGA 3FBIB 3KX2A 2ISZA 2DQRA 2X1CA 2W82A 3ZGKA 3ABMH 4KMUX 2P4WA 3A4CA 5FD6A 3H0DA 2Z99A 3CC2I 1IDYA 4LB6B 4BS9A 3FBNB 2YSRA 3HOSA 1MNDA 1VQMI 3FXJA 1IN4A 3JRGA 2YPRA 3C2GA 2EV5A 2QZ8A 1V5EA 3ZMTA 3K1PA 4J00A 4RM2A 1N25A 5TGTA 2UUZA 1TC3C 3R6SA 1ZRDA 3LOCA 4OIOF 1XGOA 3IKVA 3K4NA 1OCOH 3CMYA 1R5ID 5J8CA 1X2NA 2JA5J 1UAAA 1K4SA 4N9IA 3LSMA 1XMKA 3BJOA 3GTKJ 5EEHA 2JSPA 1RUNA 2O0YA 1E2XA 2L7FP 4LMYA 3PO3J 1U2WA 2BY3A 1OCTC 3VYUB 2XHKA 3IUOA 1VQ4I 3HB9A 4PJMA 3D0SA 2NYXA 2L4AA 1TW2A 3ZQFA 5BQTA 4Q47A 1TWHJ 1NG6A 3E5QA 2GLOA 2UXXA 4KT5C 5AIPA 2F5DA 2MBFA 5CKTA 1XCVA 2BBYA 3ZMVA 5K7HA 3JRAA 2RN7A 3LSJA 2ID6A 2LKSA 1B72B 1R1TA 2ZB9A 4B09A 5F6FA 5DM6F 4V2FA 1R6RA 1Z3YA 2QBYA 1I3QJ 1FYKA 5IY5H 1IV8A 3LSTA 4HPQA 2VLAA 3I59B 4RLQA 2MD0A 4M71A 4AC0A 2XROA 1TWCJ 2Z3YA 2DA3A 4D9JA 2RNGA 3SJMA 5JVTA 1OQYA 1AKHA 3G1MA 3CCVI 2W00A 4YFNF 2VL8A 4P55A 1YIJI 4BQQA 4AIKA 1NH3A 2MFZA 3HYIA 2XF7A 4WCGA 1FBQA 1T8IA 1X3WB 1IV6A 2JT1A 1ORKA 2GXAA 1MZBA 3SXYA 4C3JJ 2TRTA 2EQRA 2ZMEC 1IRXA 3KCCA 3TW7A 1QHGA 2K85A 4EM2A 3DP7A 3S3OA 1VQ6I 1BL0A 1GT0C 2R3SA 1T6SA 2FD5A 2PMZN 5F1JA 2WC2A 3DV8A 1FY7A 3PSIA 3G2BA 1PP8F 3A2KA 4CA0A 4YEJA 3I55I 3BOQA 3FMRA 3H5RA 4HLYA 4I02A 3PFYA 4R79A 4GYGA 3ZMUA 1EH8A 4MQVA 2WWYA 4IRIA 3GO5A 2BY2A 4GYIA 3HHGA 4RB3C 2FF4A 3MD2A 2R93J 1YX5A 3M1EA 3RZDJ 1Z67A 1Y0UA 3AG1H 1STZA 4XLFA 1WJCA 3E97A 3C2HA 1OMIA 1JKQC 4ZYHA 5FJ8J 1VQNI 2IGNA 2PJRB 3S1NJ 2DLLA 4D1QA 1BW5A 5EF6A 5L3EA 1S5LC 2V26A 4BXXJ 3T8TA 5KNLA 2HVSA 1POGA 1YO5C 3SHFA 1VNDA 1A36A 2XF6A 5D8LB 5B3SH 3BTIA 2DI3A 2J5PA 1FP2A 4RAYA 1BJZA 1XGNA 2H94A 3KP5A 1EF4A 1FSHA 1IG7A 4K2EA 3F6OA 2LD5A 2KIFA 2H1LA 4Y33A 4DJAA 2ZSIB 3HRUA 2AQEA 3EDPA 5FKNA 4HX4A 4BHCA 2WBMA 1VQLI 3OSFA 2ELHA 2LY1A 2Q2EA 3CUQB 3V42A 1ENHA 4B3XA 1H9GA 1YS6A 3SEQA 2XAJA 2KIQA 1S8NA 2E1OA 1OFCX 2OZ6A 1R4NB 1O57A 2L01A 3QAHA 3OYCA 1U3EM 2ZJRF 1LFUP 2L9SA 4LG0B 2HDCA 3K4BA 1SMTA 5F64A 1L0OC 1R00A 1ZRCA 4IOCF 2DMPA 4HF1A 2G7UA 5HS7A 5M5YJ 3CUQC 2NNYA 1SVMA 2PQ8A 2QENA 3IH3A 4I99C 3K70C 5IP9J 3S14J 5FRMA 5AIQA 2XAUA 3JRHA 2CMPA 1JXSA 9ANTA 2RQQA 4P1WA 2KRHA 1K6OA 1CGPA 3BPVA 4OIQF 4XLEA 2KPMA 3M8EA 2DBBA 3C7JA 2FMLA 2EZLA 1G6NA 2Y2ZA 2VPRA 1GV2A 2GM4A 1FP1D 2MD5A 2EH3A 4CSWA 1MBJA 2VKVA 3OIOA 4GO1A 2ZXHA 3COAC 5ICGA 4B43A 4MHGA 1K78A 1R71A 4GCVA 3MAJA 1OYIA 1OJLA 2OZUA 3DEWA 1ETWA 2MYSA 3VEPA 5J8FA 3RYPA 1IN5A 2JPCA 4BY1J 1QU3A 2OF7A 3JCUC 3BJAA 1HKTA 4XKWA 4LITA 3T5XA 1ZGWA 2E5ZA 3TO9A 4BH9A 1T56A 2M87A 2VKHA 1B4AA 4KIBA 5GAEJ 1SFKA 3A01B 1FOYA 3F8FA 1ACIA 2MG4A 3GF2A 3KEYA 5J1UA 3IH2A 4V2GA 3G4SI 1AOYA 3CJRB 4LD5A 1OYYA 2FQ4A 3CDHA 3WHCA 1I50J 4LLLA 3GX4X 2BW3A 3ZP5A 3IHUA 3A02A 3QOEA 3QRFF 2ELKA 2K3PA 1SVOA 4D5CA 1ON1A 3K4JA 3Q9VA 2KZVA 4LIUA 1O3RA 2ESNA 3CDIA 1UELB 5F1RA 2VQGA 5DS9A 4N4NB 4LK1F 5EG0A 2IW5A 3CP8A 2K5CA 5B1BH 5F04A 1ZR2A 4ABZA 1B72A 3VYTB 5ICFA 5J1YA 3FISA 4A3EJ 2K02A 2DA1A 4HDVA 1S6LA 3FK6A 4C2TA 2KDOA 1PDNC 3NWTA 1XGSA 4U0VA 3QQAA 2W85A 2L9VA 1BA5A 1BBYA 4C3IJ 2W7NA 2ZXWH 4DBQA 1KU7A 1QPMA 3LSIA 4NQWB 1MMNA 4G12A 3MKYB 2LF7A 3H3UA 1S72I 2CV2A 1WFXA 4XRMA 2HWVA 1REPC 4HYEA 4J01A 2LY2A 3MKZA 4UB8C 4N9HA 2KIUA 4D7NA 4CZCA 1KQ0A 3CCUI 2F48A 1HDPA 3CC4I 3HHHA 3AL0C 2JUGA 2VN2A 3OYDA 3VOEA 5CVVA 1IDZA 1WPKA 2P7CB 1XDSA 3CCRI 4F52A 1QZZA 1TTYA 2I10A 2EBIA 3V8LA 2XGEA 4CICA 2E7WA 3WG9A 4AIHA 5D4RA 3S3MA 4M73A 1O4XA 4IQ4A 2M7AA 3HRMA 4XNFA 3PM1A 2DOEA 3LNQA 3VWBA 3VB2A 1BW6A 3BG6A 4B48A 5HLIA 2H8WA 1YHQI 3OOPA 4HAMA 1FT9A 3ASOH 3MEXA 5B66C 4XKVA 1IXCA 1WCMJ 3S2WA 4CO8A 3TEDA 1FWZA 4Q4ZF 2PMZA 3R60A 4JX5A 1J9IA 4F93B 3WU1B 2H09A 4E7ZA 2RREA 3KZYA 4PCQA 2P6TA 1YI2I 1IRZA 2Y30A 2PI0A 5DD4A 3OS0A 1PUFA 2LBFB 1E0EA 5D5WB 2HVRA 4RGSA 4AYBN 4YG2F 3AL0B 1BIAA 2EIKH 4A3FJ 1MJBA 2VE8A 1TP4A 1XB4A 2F5FA 2X51A 5ED4A 1R58A 3EYYA 2CW0F 3NQOA 3LSPA 3ERMA 5EEAA 2Y48A 3QYBA 3TP0A 2X48A 2VPLA 3WTZA 3B73A 4DOZA 4KN7X 4KT6A 1HW1A 4HNUA 5DUIA 3TQNA 2OTLI 2FOWA 1I6XA 2X6WA 3E6DA 3HUGA 4AD9A 4WX9A 3GEZA 4IO9F 4BHBA 3TO7A 4ITVA 2I5UA 5DM7F 5F08A 4UVBA 3QYEA 3TGNA 3WHBA 3ASNH 2CQNA 3LFKA 4II3A 2R4GA 1X4PA 5LGUA 3Q5FA 1RNLA 4ENJA 4YIRX 2ID3A 2Y0SN 4ZDPA 4HDUA 1B6AA 1MMDA 3V7CA 4DZPA 1JI8A 1NK3P 1QVUA 4A3IJ 1Q1VA 1ETVA 2CW8A 3PQJA 3CO7C 2F5EA 2LREA 2VQCA 4HA8A 4CCMA 3AG3H 4Y3OA 3FXUA 5KAFC 4WF2A 4OAYA 3OYAA 3NARA 2PX9A 3OIQA 2M0CA 2QSHX 4RLFA 2GWRA 3H5NA 3PNYA 4Q48A 2CJJA 1OLTA 5J3LA 2OPTA 4A0YA 1XSXA 4Y7NJ 3K1NA 3QU6A 4E7JA 2YX4A 1FNNA 3BR0A 4M3GA 2VJ4A 3CD6I 2VT3A 4XM3A 1LE8B 3S2DJ 4JQFA 1X1CA 1D8KA 1JKPC 5DCMB 4U88A 4KISA 3DBRB 1LFBA 3DU5A 2WTEA 2WADA 2HYGD 1DGRM 5ICCA 2VUMJ 1TT5B 1BN5A 4YRVA 2XC7A 2GBYA 5IOYA 4XOTA 4FT8A 4IEJA 4G94A 4FCYA 4HV6A 1R7JA 1IUYA 3AG2H 2X0LA 1UCRA 1FYMA 2Y0SA 3A0HC 4UVAA 5IP6A 4M6VA 4CYCB 4LLNA 4BDZA 2DFHA 2F2EA 5HNFA 1B8IB 1DU0A 5F0CA 2P8TA 3FIWA 3M8FA 4U0WA 4G7ZF 1OCCH 1HF0A 1HSTA 4UV9A 3UNGC 4DBRA 2Q2EB 3CUQA 3GZNB 1GHCA 1Y6IA 2BVMA 3E3VA 1DP3A 1F9NA 2YU3A 2JN6A 2WY7Q 1IF1A 5DV5A 2IJLA 2L7KA 4E7KA 4BBRJ 2VKEA 1SFOJ 4HX7A 1QZEA 2L02A 2OJED 3KFWX 3BJ6A 3ZMZA 5K5RA 2AS5F 3GTPJ 2HEOA 3ZOBA 5ILUA 5EZHA 2ACJA 1OKRA 1W5CC 1WSUA 5LEKA 3J81Z 4JX4A 1T2KA 2UWMA 3HL2A 3A1YA 1IXSB 3IRQA 2F4IA 3A01A 4A12A 5KCMA 2VBXA 1YIOA 1ZK8A 3R0AA 4XIDA 4XRSA 5HLTA 1V55H 1ZELA 2VJ5A 2GXBA 3SZGA 1ETQA 1KYWA 5TJJA 4ZYGA 2LK2A 3ZQLA 3HRTA 5E1XA 2L3DA 4U7DA 3OYJA 1V5FA 2JTVA 3CCJI 1U8RA 4ZYDA 3PJRA 2DDAA 4KYWA 4OMYA 4N4OB 1D1CA 2EK5A 2WB1N 3I53A 2CSOA 4CYCA 5HNHA 2L0KA 4M74A 2H6BA 2R7UA 4G9YA 3WU2C 3RPQA 1KYZA 3L1PA 2VQLA 1U8BA 5H2FC 3PUBA 4BHPA 4X6AJ 5LLQA 5K5OA 1HDDC 3BG5A 2M9HA 4RM3A 1V3FA 2IGKA 2XRLA 1DP7P 1UG0A 4QPQA 2DMQA 3B6CA 4KICA 2ME0A 2FJ1A 1I1SA 2E5NA 2MC3A 4NC6A 2LVSA 5LGNA 4JK1X 1P4WA 4ESJA 3S16J 2HXIA 1YG2A 3PSFA 1ZAOA 4L5EA 4LGWA 3RIRA 1LVKA 5J40A 4GDFA 2QGUA 4EJUA 4O5VA 1YLFA 2QCOA 3FXRA 1B9MA 3H9GA 2E2IJ 1G3WA 1PVEA 2GA1A 2XKOA 3KYLA 1K61A 1TT0A 1TQMA 5A2QZ 2M8GX 5IT3A 1MNEA 5DDGA 3J7AO 2R7QA 3FKJA 2UXNA 1Y56A 3TBIA 3GVAA 2K7LA 2VBWA 3F8MA 3DEUA 4UUVA 2Y9YA 1XS9A 2H1KA 3A0BC 5L3GA 4M72A 1LVAA 2FNAA 3GTGJ 3W6VA 2DTRA 2BHZA 2KP6A 2JA8J 2Y69H 5J4VA 2KL4A 2DT6A 1J2XA 3HTUA 5C44J 2Y0MA 1ETYA 1G3YA 2BXYA 2G0EA 3WTWC 3K2ZA 1TNSA 3CCYA 3K4CA 4FQGA 2O61A 1JJ6C 3SFIA 3OL4A 2HYFA 4KUMA 1AHDP 1V4RA 4XMYA 3U2RA 3CLOA 5JLXA 4P9UA 1U6GA 2CGPA 1FMWA 1ETKA 4IPAA 4HF2A 3IP4B 3ZPLA 2JVHA 2XAFA 3CMEI 5CVIA 1MKMA 2IPQX 4A3LJ 2EIMH 1D3YA 2MW8A
chains in the Genus database with same CATH topology
5GPAA 1JKQC 1HOMA 1RESA 2DMTA 5FJ8J 3GTQJ 3S1NJ 1XG1A 4XICA 4D5FA 5EZGA 1BW5A 5EF6A 5F0FA 4FE4A 5IYBJ 4BXXJ 1POGA 4NDLA 1VNDA 1MBEA 5IYCJ 1MSFC 3BTIA 1EF4A 1BJZA 1IG7A 1JGGA 1GUUA 4JX6A 2LD5A 2DTZA 4DZJA 5DTDA 5HODA 4IHXA 4JP0A 5FKNA 1HCRA 4A3MJ 3HOVJ 4QSHA 3O8GA 3OSFA 4I6ZA 5C4JJ 4AUXA 4B3AA 1ENHA 3HOXJ 3HKZN 2E1OA 3BG9A 2YU9J 2TCTA 1OFCX 4IHYA 4BY7J 1ETOA 2R5YB 4A3BJ 4W97A 2X6OA 4A3DJ 1LFUP 4IHWA 5EG0B 1CQTA 3GBGA 1I6HJ 1U9NA 2DJNA 2DMPA 2ECCA 5M5YJ 3GTJJ 2YUSA 5FKLA 4A3GJ 3OSGA 5EGOB 2JMWA 3IH3A 1JUSA 1SANA 2JJ7A 1IUFA 5FLVA 3S14J 5IP9J 3DCFA 1AU7A 4HNVA 2HI3A 3JREA 3JRHA 3M4OJ 9ANTA 2XPUA 3CQZJ 2JA7J 3TW6A 1LE8A 2LY9A 4MO7A 2HQ5A 3GTLJ 1PUFB 2EZLA 4GFBA 2Y2ZA 2VPRA 1H88C 5C3EJ 1GV2A 1F36A 1FEXA 2GM4A 2EH3A 1MBJA 2VKVA 3OIOA 1FTZA 1QVTA 2HOSA 2K40A 4MLOA 4M3DA 1OJLA 3HGYA 4LOCA 5FKMA 2HOTA 3DEWA 1ETWA 4BY1J 3JR9A 2WV1A 2CUEA 1S7EA 2OF7A 3LSRA 1K83J 1Y1WJ 4DYRA 1ZGWA 3BTCA 1T56A 3A01B 1P7IA 3NAUA 2CU7A 2NVXJ 2MG4A 1YRNA 5J1UA 4W1UA 3IH2A 4V2GA 1Z0XA 3HEFA 4MIMA 1JUPA 2E19A 4A3KJ 3JRIA 2FQ4A 2KT0A 4X1EA 1ITYA 4UUSB 3WHCA 1I50J 1VFCA 1TWGJ 2VI6A 3HGGA 3A02A 4B1RA 2ELKA 4D5CA 3HDDA 4M3BA 5IYDJ 3Q0UA 2CQXA 5F27A 5DS9A 3GTOJ 3HOWJ 5EG0A 1ZKGA 3JRCA 2O7OA 2CQQA 5F04A 4C2MJ 1ZR2A 2D5VA 4A3JJ 4ABZA 1B72A 2B63J 5J1YA 2R92J 2LFBA 3FISA 4A3EJ 1Y1VJ 2DA1A 2JK3A 3Q0VA 3FK6A 3IH4A 1A6IA 4BKXA 4MFDA 1IGNA 1WH5A 2CRGA 2XPVA 2NVQJ 2R5ZB 3QQAA 2HYJA 3BR1A 1GV5A 1BA5A 4C3IJ 3S17J 2K9NA 1UMQA 4G12A 3ZQGA 2AHQA 4XRMA 3IV5A 1IC8A 5C4XJ 3TP3A 1A5JA 1XC5A 4D7NA 3ZQCA 2O8KA 5EDNA 1NTCA 1X58A 1E3OC 1HDPA 2DA7A 3ZQHA 2XGCA 1TWFJ 5IP7J 1IDZA 2IBDA 1WPKA 3HM5A 3RKQA 4JYKA 1B8IA 5E3NA 1T33A 2EBIA 2I10A 2XGEA 3S1RJ 1U78A 3BT9A 3HOYJ 1TWAJ 1ZQ3P 2P81A 4RBOA 3MVPA 1WI3A 1JKOC 2R7ZJ 1O4XA 3FK7A 3E7LA 2XB0X 1MBGA 3K7AJ 3PM1A 3LNQA 3UKGA 1NK2P 2R5YA 1BW6A 4EEFG 4M3FA 2DA6A 2ME6A 5IOZA 1WCMJ 3TEDA 2NVTJ 4JX5A 3D1NI 2HOAA 2COBA 2LP0A 3S1MJ 4FTHA 1IRZA 2Y30A 3BR6A 1PUFA 2MSYA 2E2HJ 3F0CA 4AYBN 3LSGA 4Y52J 4A3FJ 3JRFA 3I4MJ 1FIPA 1OCPA 3HOUJ 5M3MJ 1RKTA 2H8RA 3LSPA 3Q3SA 1JTYA 5EEAA 3HBLA 2DMNA 1H89C 2XB5A 3TP0A 2X48A 3BR2A 4M3EA 2L9RA 4B4CA 2L7MP 3QPLA 2M34A 1AKHB 3O8HA 1MBFA 3VPRA 5F0HA 1P7JA 3G1LA 1IJWC 2EZIA 1JT0A 1FTTA 5F08A 3S2HJ 3WHBA 5E3MA 3G1OA 5M5XJ 1W0UA 3FKIJ 2EZKA 2ID3A 2Y0SN 3JRBA 2QF7A 4DZPA 2LLKA 1MNMC 4C3HJ 3BR3A 4A93J 1NK3P 1QVUA 4A3IJ 1Q1VA 4FE7A 1ETVA 4QIWN 4XRSG 1VF9A 1R9TJ 2DMUA 5IPAA 3NARA 2M0CA 1U9OA 5J3LA 3HOZJ 2CJJA 1RPWA 2OPTA 2DA5A 3B6AA 4Y7NJ 1JTXA 1RKWA 3BR0A 1MH3A 4M3GA 2CUFA 5FKKA 4DW6A 1LE8B 3S2DJ 1DU6A 2JA6J 1JKPC 3RZOJ 1LFBA 3OOUA 1MBHA 2MGQA 5M3FJ 2VUMJ 2KDZA 2L7ZA 2Y31A 4QTRA 2GBYA 3H0GJ 5IOYA 2M2EA 4IEJA 4FCYA 2X9DA 3BQYA 5GP9A 2K9SA 1QRYA 1X2MA 1QPIA 5IP6A 4J19A 4M6VA 4CYCB 1B8IB 1DU0A 5F0CA 3FIWA 1W0TA 3CDLA 2HXOA 2NS7A 5M5WJ 5JLWA 5EGOA 1HLVA 3MN2A 3H3VK 2IEKA 1HF0A 2XSDC 3PO2J 4A3CJ 2Y9ZA 3QPSA 5E3OA 2K9QA 3BTJA 3SDGA 2JN6A 5J1RA 1APLC 4BBRJ 2VKEA 1SFOJ 3A03A 1ETXA 3I4NJ 4S0HB 1ZR4A 2NOGA 3BG3A 1ZTRA 1FJLA 1H8AC 2XGDA 3GTPJ 3ZQIA 4I76A 2FX0A 2E2JJ 3ZOBA 5EZHA 1Z77A 2NS8A 2R5ZA 4JX4A 1IDYA 1GDTA 3S15J 2W48A 1WGXA 3A01A 3JRGA 1ZK8A 4XIDA 1YRNB 4XRSA 1MBKA 2JWTA 2DA2A 4DYCA 1ETQA 5FLMJ 2ECBA 4UUSA 1MH4A 1MSEC 2LK2A 3ZQLA 1TC3C 3LOCA 2AO9A 3CMYA 1JJ8C 4D7MA 1GVDA 1X2NA 2XPWA 1FIAA 2JA5J 2WAQN 2WB1N 4XK4A 2DN0A 4CYCA 2L0KA 3GTKJ 1G2HA 4A69C 3BTLA 1UHSA 3L1PA 2L7FP 1U8BA 3PO3J 2EZHA 1OCTC 4X6AJ 1HDDC 4DYQA 3BG5A 2M9HA 3C2BA 2XRLA 2YS9A 5BNGA 1JKRC 3HB9A 3RQIA 3GTMJ 1D5YA 2DMQA 3B6CA 3ZQFA 1TWHJ 2ME0A 2FJ1A 2GLOA 2LVSA 3S16J 2HXIA 2IAIA 5K7HA 1JUMA 3JRAA 2DA4A 1RR7A 2ID6A 3LSJA 4L5EA 2R0QC 1B72B 2ZB9A 2O9LA 4V2FA 2QCOA 1I3QJ 2E2IJ 3K2AA 3BR5A 1K61A 4AC0A 5K7ZA 1TWCJ 4RDUA 2DA3A 2M8GX 4BBSJ 4MFEA 3SJMA 1AKHA 1VI0A 1F43A 3G1MA 3Q0WA 2LKXA 5FKOA 1UG2A 2Y9YA 1IV6A 4IHVA 1ORKA 1XS9A 3M3YJ 2H1KA 2NVYJ 4C3JJ 2TRTA 2EQRA 3TW7A 5K7FA 3GTGJ 3W6VA 1BL0A 1GT0C 2JA8J 5GPCA 2FD5A 5F1JA 2PMZN 5C44J 1WH7A 1ETYA 2G0EA 3CCYA 4FISA 1JJ6C 2N8GA 3BQZA 4UUTA 3SFIA 1JT6A 1AHDP 5JLXA 3JRDA 2LTPA 2HDDA 2R93J 1ETKA 3MKLA 3RZDJ 2RAEA 2LR8A 5EYRA 5E3LA 4A3LJ 3S1QJ 1RETA 2MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPA A;  1JKQ C;  1HOM A;  1RES A;  2DMT A;  5FJ8 J;  3GTQ J;  3S1N J;  1XG1 A;  4XIC A;  4D5F A;  5EZG A;  1BW5 A;  5EF6 A;  5F0F A;  4FE4 A;  5IYB J;  4BXX J;  1POG A;  4NDL A;  1VND A;  1MBE A;  5IYC J;  1MSF C;  3BTI A;  1EF4 A;  1BJZ A;  1IG7 A;  1JGG A;  1GUU A;  4JX6 A;  2LD5 A;  2DTZ A;  4DZJ A;  5DTD A;  5HOD A;  4IHX A;  4JP0 A;  5FKN A;  1HCR A;  4A3M J;  3HOV J;  4QSH A;  3O8G A;  3OSF A;  4I6Z A;  5C4J J;  4AUX A;  4B3A A;  1ENH A;  3HOX J;  3HKZ N;  2E1O A;  3BG9 A;  2YU9 J;  2TCT A;  1OFC X;  4IHY A;  4BY7 J;  1ETO A;  2R5Y B;  4A3B J;  4W97 A;  2X6O A;  4A3D J;  1LFU P;  4IHW A;  5EG0 B;  1CQT A;  3GBG A;  1I6H J;  1U9N A;  2DJN A;  2DMP A;  2ECC A;  5M5Y J;  3GTJ J;  2YUS A;  5FKL A;  4A3G J;  3OSG A;  5EGO B;  2JMW A;  3IH3 A;  1JUS A;  1SAN A;  2JJ7 A;  1IUF A;  5FLV A;  3S14 J;  5IP9 J;  3DCF A;  1AU7 A;  4HNV A;  2HI3 A;  3JRE A;  3JRH A;  3M4O J;  9ANT A;  2XPU A;  3CQZ J;  2JA7 J;  3TW6 A;  1LE8 A;  2LY9 A;  4MO7 A;  2HQ5 A;  3GTL J;  1PUF B;  2EZL A;  4GFB A;  2Y2Z A;  2VPR A;  1H88 C;  5C3E J;  1GV2 A;  1F36 A;  1FEX A;  2GM4 A;  2EH3 A;  1MBJ A;  2VKV A;  3OIO A;  1FTZ A;  1QVT A;  2HOS A;  2K40 A;  4MLO A;  4M3D A;  1OJL A;  3HGY A;  4LOC A;  5FKM A;  2HOT A;  3DEW A;  1ETW A;  4BY1 J;  3JR9 A;  2WV1 A;  2CUE A;  1S7E A;  2OF7 A;  3LSR A;  1K83 J;  1Y1W J;  4DYR A;  1ZGW A;  3BTC A;  1T56 A;  3A01 B;  1P7I A;  3NAU A;  2CU7 A;  2NVX J;  2MG4 A;  1YRN A;  5J1U A;  4W1U A;  3IH2 A;  4V2G A;  1Z0X A;  3HEF A;  4MIM A;  1JUP A;  2E19 A;  4A3K J;  3JRI A;  2FQ4 A;  2KT0 A;  4X1E A;  1ITY A;  4UUS B;  3WHC A;  1I50 J;  1VFC A;  1TWG J;  2VI6 A;  3HGG A;  3A02 A;  4B1R A;  2ELK A;  4D5C A;  3HDD A;  4M3B A;  5IYD J;  3Q0U A;  2CQX A;  5F27 A;  5DS9 A;  3GTO J;  3HOW J;  5EG0 A;  1ZKG A;  3JRC A;  2O7O A;  2CQQ A;  5F04 A;  4C2M J;  1ZR2 A;  2D5V A;  4A3J J;  4ABZ A;  1B72 A;  2B63 J;  5J1Y A;  2R92 J;  2LFB A;  3FIS A;  4A3E J;  1Y1V J;  2DA1 A;  2JK3 A;  3Q0V A;  3FK6 A;  3IH4 A;  1A6I A;  4BKX A;  4MFD A;  1IGN A;  1WH5 A;  2CRG A;  2XPV A;  2NVQ J;  2R5Z B;  3QQA A;  2HYJ A;  3BR1 A;  1GV5 A;  1BA5 A;  4C3I J;  3S17 J;  2K9N A;  1UMQ A;  4G12 A;  3ZQG A;  2AHQ A;  4XRM A;  3IV5 A;  1IC8 A;  5C4X J;  3TP3 A;  1A5J A;  1XC5 A;  4D7N A;  3ZQC A;  2O8K A;  5EDN A;  1NTC A;  1X58 A;  1E3O C;  1HDP A;  2DA7 A;  3ZQH A;  2XGC A;  1TWF J;  5IP7 J;  1IDZ A;  2IBD A;  1WPK A;  3HM5 A;  3RKQ A;  4JYK A;  1B8I A;  5E3N A;  1T33 A;  2EBI A;  2I10 A;  2XGE A;  3S1R J;  1U78 A;  3BT9 A;  3HOY J;  1TWA J;  1ZQ3 P;  2P81 A;  4RBO A;  3MVP A;  1WI3 A;  1JKO C;  2R7Z J;  1O4X A;  3FK7 A;  3E7L A;  2XB0 X;  1MBG A;  3K7A J;  3PM1 A;  3LNQ A;  3UKG A;  1NK2 P;  2R5Y A;  1BW6 A;  4EEF G;  4M3F A;  2DA6 A;  2ME6 A;  5IOZ A;  1WCM J;  3TED A;  2NVT J;  4JX5 A;  3D1N I;  2HOA A;  2COB A;  2LP0 A;  3S1M J;  4FTH A;  1IRZ A;  2Y30 A;  3BR6 A;  1PUF A;  2MSY A;  2E2H J;  3F0C A;  4AYB N;  3LSG A;  4Y52 J;  4A3F J;  3JRF A;  3I4M J;  1FIP A;  1OCP A;  3HOU J;  5M3M J;  1RKT A;  2H8R A;  3LSP A;  3Q3S A;  1JTY A;  5EEA A;  3HBL A;  2DMN A;  1H89 C;  2XB5 A;  3TP0 A;  2X48 A;  3BR2 A;  4M3E A;  2L9R A;  4B4C A;  2L7M P;  3QPL A;  2M34 A;  1AKH B;  3O8H A;  1MBF A;  3VPR A;  5F0H A;  1P7J A;  3G1L A;  1IJW C;  2EZI A;  1JT0 A;  1FTT A;  5F08 A;  3S2H J;  3WHB A;  5E3M A;  3G1O A;  5M5X J;  1W0U A;  3FKI J;  2EZK A;  2ID3 A;  2Y0S N;  3JRB A;  2QF7 A;  4DZP A;  2LLK A;  1MNM C;  4C3H J;  3BR3 A;  4A93 J;  1NK3 P;  1QVU A;  4A3I J;  1Q1V A;  4FE7 A;  1ETV A;  4QIW N;  4XRS G;  1VF9 A;  1R9T J;  2DMU A;  5IPA A;  3NAR A;  2M0C A;  1U9O A;  5J3L A;  3HOZ J;  2CJJ A;  1RPW A;  2OPT A;  2DA5 A;  3B6A A;  4Y7N J;  1JTX A;  1RKW A;  3BR0 A;  1MH3 A;  4M3G A;  2CUF A;  5FKK A;  4DW6 A;  1LE8 B;  3S2D J;  1DU6 A;  2JA6 J;  1JKP C;  3RZO J;  1LFB A;  3OOU A;  1MBH A;  2MGQ A;  5M3F J;  2VUM J;  2KDZ A;  2L7Z A;  2Y31 A;  4QTR A;  2GBY A;  3H0G J;  5IOY A;  2M2E A;  4IEJ A;  4FCY A;  2X9D A;  3BQY A;  5GP9 A;  2K9S A;  1QRY A;  1X2M A;  1QPI A;  5IP6 A;  4J19 A;  4M6V A;  4CYC B;  1B8I B;  1DU0 A;  5F0C A;  3FIW A;  1W0T A;  3CDL A;  2HXO A;  2NS7 A;  5M5W J;  5JLW A;  5EGO A;  1HLV A;  3MN2 A;  3H3V K;  2IEK A;  1HF0 A;  2XSD C;  3PO2 J;  4A3C J;  2Y9Z A;  3QPS A;  5E3O A;  2K9Q A;  3BTJ A;  3SDG A;  2JN6 A;  5J1R A;  1APL C;  4BBR J;  2VKE A;  1SFO J;  3A03 A;  1ETX A;  3I4N J;  4S0H B;  1ZR4 A;  2NOG A;  3BG3 A;  1ZTR A;  1FJL A;  1H8A C;  2XGD A;  3GTP J;  3ZQI A;  4I76 A;  2FX0 A;  2E2J J;  3ZOB A;  5EZH A;  1Z77 A;  2NS8 A;  2R5Z A;  4JX4 A;  1IDY A;  1GDT A;  3S15 J;  2W48 A;  1WGX A;  3A01 A;  3JRG A;  1ZK8 A;  4XID A;  1YRN B;  4XRS A;  1MBK A;  2JWT A;  2DA2 A;  4DYC A;  1ETQ A;  5FLM J;  2ECB A;  4UUS A;  1MH4 A;  1MSE C;  2LK2 A;  3ZQL A;  1TC3 C;  3LOC A;  2AO9 A;  3CMY A;  1JJ8 C;  4D7M A;  1GVD A;  1X2N A;  2XPW A;  1FIA A;  2JA5 J;  2WAQ N;  2WB1 N;  4XK4 A;  2DN0 A;  4CYC A;  2L0K A;  3GTK J;  1G2H A;  4A69 C;  3BTL A;  1UHS A;  3L1P A;  2L7F P;  1U8B A;  3PO3 J;  2EZH A;  1OCT C;  4X6A J;  1HDD C;  4DYQ A;  3BG5 A;  2M9H A;  3C2B A;  2XRL A;  2YS9 A;  5BNG A;  1JKR C;  3HB9 A;  3RQI A;  3GTM J;  1D5Y A;  2DMQ A;  3B6C A;  3ZQF A;  1TWH J;  2ME0 A;  2FJ1 A;  2GLO A;  2LVS A;  3S16 J;  2HXI A;  2IAI A;  5K7H A;  1JUM A;  3JRA A;  2DA4 A;  1RR7 A;  2ID6 A;  3LSJ A;  4L5E A;  2R0Q C;  1B72 B;  2ZB9 A;  2O9L A;  4V2F A;  2QCO A;  1I3Q J;  2E2I J;  3K2A A;  3BR5 A;  1K61 A;  4AC0 A;  5K7Z A;  1TWC J;  4RDU A;  2DA3 A;  2M8G X;  4BBS J;  4MFE A;  3SJM A;  1AKH A;  1VI0 A;  1F43 A;  3G1M A;  3Q0W A;  2LKX A;  5FKO A;  1UG2 A;  2Y9Y A;  1IV6 A;  4IHV A;  1ORK A;  1XS9 A;  3M3Y J;  2H1K A;  2NVY J;  4C3J J;  2TRT A;  2EQR A;  3TW7 A;  5K7F A;  3GTG J;  3W6V A;  1BL0 A;  1GT0 C;  2JA8 J;  5GPC A;  2FD5 A;  5F1J A;  2PMZ N;  5C44 J;  1WH7 A;  1ETY A;  2G0E A;  3CCY A;  4FIS A;  1JJ6 C;  2N8G A;  3BQZ A;  4UUT A;  3SFI A;  1JT6 A;  1AHD P;  5JLX A;  3JRD A;  2LTP A;  2HDD A;  2R93 J;  1ETK A;  3MKL A;  3RZD J;  2RAE A;  2LR8 A;  5EYR A;  5E3L A;  4A3L J;  3S1Q J;  1RET A;  2MW8 A; 
#chains in the Genus database with same CATH topology
 1X1B A;  2IT0 A;  2DMT A;  4PSX A;  3GTQ J;  1Z7L A;  4G8X A;  5EZG A;  3WTU C;  2QKL B;  5HDN A;  5FFX A;  5F0F A;  4FE4 A;  3S93 A;  5IYB J;  4IF4 A;  2ICW G;  3P5J A;  1MBE A;  5JHU A;  3WTY C;  4ZTJ A;  1HBX G;  1MMS A;  3H92 A;  1GUU A;  3J7Y J;  2MA3 A;  1X4O A;  2DTZ A;  1Q1H A;  2GXG A;  4DZJ A;  4IHX A;  1FC3 A;  2B9S A;  1H9T A;  3DBL B;  3DWL E;  4QPO A;  3O8G A;  4I6Z A;  2W4S A;  2KHM A;  4B3A A;  2CO5 A;  1DDN A;  2VQH A;  3KYC B;  3HOX J;  2RV8 A;  2DFI A;  2YU9 J;  4XLC A;  4IHY A;  3BCA A;  3OYG A;  4A3B J;  2CW7 A;  2LSO A;  1Z91 A;  1XTA A;  2YX7 A;  4HOB A;  1WJB A;  2EFO A;  5DYM A;  2ECC A;  3GTJ J;  3WTV C;  4RA2 A;  1M1E B;  4IXA A;  3TKY A;  3HTS B;  1T0F A;  3L09 A;  1JUS A;  2DFF A;  1IUF A;  4UY8 I;  4PSW A;  3JRE A;  3NEU A;  2XPU A;  4BJ5 C;  2JA7 J;  1LDD A;  3JAM Z;  3CMM A;  2IA0 A;  2HQ5 A;  3HC7 A;  2O5R A;  5DCM A;  2KIS A;  5HDG A;  1WQ2 A;  5C3E J;  4XSX F;  1FZP B;  5KAI C;  3I0T A;  2HQN A;  2HQR A;  3S3N A;  1A04 A;  2K40 A;  3N97 A;  2QQ8 A;  1IAW A;  1BOB A;  1K7A A;  1G4D A;  1IXR C;  2WAE A;  4MLO A;  2DOF A;  5FKM A;  2HOT A;  4ENM A;  4EMS A;  5ERI A;  4NNJ A;  5E1Z B;  3BTC A;  1X1A A;  3NAU A;  2VJI A;  3U21 A;  1YRN A;  2HTJ A;  4A3K J;  1Z0X A;  1P4A A;  2M45 A;  2EB7 A;  2KRF A;  3I56 I;  4RB2 C;  4UUS B;  1VFC A;  2VI6 A;  4B1R A;  4BXU A;  4F92 B;  4ZZL A;  1LB2 A;  4I2O A;  3HDD A;  5KHD A;  5IYD J;  4HEA 2;  1ZG3 A;  2CQX A;  2XSJ C;  4XLA A;  3JAM K;  3CCS I;  2QSF X;  3P9C A;  4BEH B;  4H4K C;  4EJT A;  4ZH4 F;  1FOX A;  5DEQ A;  2K9M A;  2ZME B;  1BM9 A;  2QEX I;  2HVQ A;  3Q0V A;  3LA7 A;  1A6I A;  2DJI A;  4MFD A;  3R4K A;  3C1D A;  2NVQ J;  4Y4R A;  1BOA A;  2HYJ A;  1X3U A;  3O3K A;  3RYR A;  3S17 J;  3CMA I;  4E7S A;  2K9N A;  4OIR F;  4FHT A;  5LHH A;  1X19 A;  2AHQ A;  1FSE A;  3LSK A;  3QU3 A;  1VQ9 I;  5BPD A;  2DW4 A;  2ZJP F;  4A6D A;  1IN6 A;  2VC0 A;  4II2 A;  3ZQC A;  3MFK A;  1NTC A;  1QZY A;  3G6E I;  3W6J B;  3L2Q A;  2XGC A;  1TWF J;  3LAJ A;  2Z33 A;  5IP7 J;  1OPC A;  3BY6 A;  3D5S C;  3IL2 A;  3HPH A;  5D5X B;  4OU0 A;  1SFX A;  2DT7 B;  4L9J A;  3HM5 A;  4IX7 A;  1MDM A;  2CV1 A;  4JYK A;  4BDY A;  3S1R J;  1PUE E;  1QBJ A;  3EUH C;  2XIG A;  5J4Y A;  3DFG A;  3LMM A;  2STT A;  3HOY J;  3EYI A;  3RKW A;  1JKO C;  2E71 A;  3V8J A;  4IHT A;  3UKG A;  2IS4 A;  2BZT A;  3CCQ I;  1BJA A;  3WTX C;  3K9T A;  2K86 A;  4H0E A;  2NAZ A;  3OS2 A;  2GAU A;  2LYC A;  2OAZ A;  1IN7 A;  2QQA A;  4A6E A;  3PIP F;  4EGY A;  4N0B A;  3QOP A;  1P2F A;  2ZCW A;  2B0L A;  2P0W A;  5TRD A;  3IAM 2;  2Z2S B;  3O2P E;  3D1N I;  3ZRG A;  3OYL A;  2COB A;  5CVJ A;  2PJP A;  3CZ6 A;  1S7A A;  3QP6 A;  3S1M J;  4NB5 A;  3D5R C;  1W36 C;  2R7X A;  1EA3 A;  1ON2 A;  1WHU A;  3AG4 H;  2MSY A;  2A6E F;  2V6C A;  4KIG A;  4Y52 J;  3H1C A;  4DQ2 A;  2ZXI A;  3DEE A;  1K6Y A;  1EH6 A;  1OCP A;  2A5W A;  2XAG A;  3CC7 I;  3Q3S A;  1JTY A;  2L2O A;  3HBL A;  2M3A A;  1XGM A;  2DMN A;  1H89 C;  4EAT A;  4M3E A;  4B4C A;  3N4M A;  2L9R A;  2EFP A;  2L7M P;  4AU7 A;  4XL9 A;  2WV0 A;  3WTS C;  3E1S A;  4E7L A;  1PYV A;  3DQV C;  2V9V A;  1JHF A;  3K4M A;  1KU3 A;  1T98 A;  3VPR A;  1BR2 A;  1P7J A;  1U5T A;  3PQK A;  3G1L A;  3LAP A;  2EZI A;  2PN6 A;  4PGH A;  4RS8 A;  5HDK A;  1I1G A;  2BW3 B;  3S2H J;  4KIT B;  3KLN A;  3G1O A;  2WY8 Q;  1Z21 A;  5M5X J;  1W0U A;  4IRH A;  3FKI J;  1HSJ A;  1XD7 A;  3KEQ A;  2EZK A;  3AAF A;  1MNM C;  4ESB A;  4C3H J;  1WZ2 A;  3SZP A;  4CXF A;  2WAF A;  4FE7 A;  4QIW N;  4MEX F;  3ONQ A;  2M4G A;  1GXQ A;  2ZFU A;  2FUG 2;  2GA2 A;  3ZMD A;  1D8J A;  1IZ1 A;  1U9O A;  5LRS A;  2PMU A;  2FQ3 A;  2P5V A;  3LWF A;  3B6A A;  4KNY A;  2L5Q A;  5EEG A;  1SMY F;  4DW6 A;  1DU6 A;  1FLI A;  1AA7 A;  1LFP A;  3QPT A;  2JA6 J;  2Y75 A;  2OU2 A;  3V7R A;  3RZO J;  2M7B A;  5E79 C;  4HX8 A;  1UZC A;  4C9Y A;  5E20 A;  3M07 A;  2R7V A;  3TOA A;  1G8X A;  4CCO A;  2GZW A;  5DUK A;  3W2W A;  2L7Z A;  2Y31 A;  4QTR A;  5A2Q K;  3BZ6 A;  3OL3 A;  3F23 A;  2X9D A;  1HW2 A;  4LG3 A;  3I3L A;  2HZT A;  3SQN A;  1RR8 C;  4RB0 A;  2JRT A;  4PK4 A;  4J19 A;  3U1K A;  3HJE A;  4BL0 B;  3RCO A;  2HXO A;  2VBY A;  3PNV A;  1VQP I;  3VOD A;  3QYF A;  3BRO A;  4B47 A;  2P6S A;  4KA4 A;  5FFZ A;  2Y9Z A;  3B02 A;  5E3O A;  3BTJ A;  2Q1Z B;  4E4H A;  2DU9 A;  1MJ9 A;  5J1R A;  4EVI A;  4XLP F;  2DT5 A;  3K10 A;  1BC7 C;  4WXC A;  2W24 A;  1FJL A;  1F1Z A;  5D5V B;  2E1M C;  5K5Q A;  2COM A;  1Z77 A;  2MLK A;  5B1A H;  2NS8 A;  3I5U A;  2R5Z A;  2BHY A;  2LMD A;  4KMF A;  2QQB A;  2JVG A;  1GDT A;  1YOV B;  1T0F C;  2W48 A;  2VXZ A;  2DOA A;  3M8J A;  3K69 A;  3GME A;  4V19 K;  5LEJ A;  3BZC A;  1FYL A;  1XCB A;  5J6X A;  2DA2 A;  3GZ5 A;  1YIT I;  4OAZ A;  1NG7 A;  4UV8 A;  1MSE C;  1Z6T A;  4AM3 A;  3FM5 A;  5ILV A;  2IP2 A;  4RGX A;  1JJ8 C;  1SFE A;  2OQG A;  3DLA A;  2QUF A;  2G9W A;  1GVD A;  3MZY A;  2HPM A;  4XK4 A;  2A69 F;  1ZH5 A;  2A6H F;  1G2H A;  1LUJ B;  1MJA A;  4HST A;  5BS6 A;  4HQM A;  4A69 C;  3BTL A;  4YEL A;  1UHS A;  3AKZ A;  2ZME A;  3R61 A;  1CF7 A;  3E6B A;  4BJT A;  4YII A;  4DYQ A;  3FWE A;  3W2V A;  3C2B A;  2YS9 A;  5BNG A;  1JKR C;  3SDB A;  1FOK A;  1Z6R A;  1D5Y A;  3GFI A;  5D6F A;  3H9Q A;  5FB2 A;  1SVL A;  1IO2 A;  5B5E C;  1VQ5 I;  4MTE A;  1EV7 A;  2W25 A;  4NQW A;  4B44 A;  3CJN A;  4XLH A;  4BE0 A;  4XRF A;  3DTI A;  1B9N A;  2CQ7 A;  4XN0 A;  1VQO I;  1WJ5 A;  4BEH A;  3GXO A;  2DA4 A;  3GLX A;  1RR7 A;  3HXL A;  2R0Q C;  2K4J A;  2C6Y A;  5CYV A;  3PL8 A;  2ESH A;  1K78 B;  1TQI A;  3K2A A;  1SAU A;  3BR5 A;  2BGC A;  3CCL I;  4RDU A;  5K7Z A;  3KET A;  2X1D A;  4MFE A;  2W57 A;  5FD5 A;  1F43 A;  2O8X A;  4MTD A;  3Q0W A;  2LKX A;  2LC2 A;  5FKO A;  4L9N A;  3OYH A;  3Q9S A;  4M6X A;  1WWX A;  4GGG A;  2NVY J;  4I01 A;  3M3Y J;  2ZNZ A;  3J7Z I;  4UHT A;  5FRN A;  4IQJ A;  5GPC A;  3FXK A;  2F5C A;  4S04 A;  1S3J A;  3PFI A;  1SD7 A;  5D5U B;  3TDU C;  2BEO A;  3REO A;  1JHH A;  3L2V A;  3RPU A;  1CF7 B;  2DPU A;  1ZRE A;  2N8G A;  2OQR A;  2Z5U A;  3BQZ A;  4UUT A;  4JOM A;  4BNC A;  2FOK A;  2X85 A;  3GW2 A;  3JRD A;  2LTP A;  2JUC A;  2FNP A;  4E6K G;  2RGV A;  1HKQ A;  1ZAR A;  2GIV A;  3W3C A;  2QLZ A;  4JBA A;  2CUJ A;  3P9K A;  2LBF A;  5EYR A;  5E3L A;  1X3Z B;  3RTR A;  1DPR A;  2BYV E;  4I98 B;  1TL8 A;  1O7L A;  1RET A;  2CH0 A;  2VBZ A;  3MKW B;  3ECH A;  1HOM A;  4U0Y A;  2M4K A;  1OR7 C;  4Y15 A;  2OV7 A;  3OYE A;  2ZC2 A;  5H6R A;  4D5F A;  2EJR A;  3M9A A;  4L0Y B;  5DD8 A;  5IYC J;  2V9P A;  2IRF G;  1TQP A;  3HRS A;  3MWM A;  2ZJQ F;  1JGG A;  4IL6 C;  4JX6 A;  3WE2 A;  3BP8 A;  3KYD B;  5CPR B;  5E8I A;  3WG7 H;  5HOD A;  4JP0 A;  4CHU A;  3SFZ A;  3KE2 A;  4FX4 A;  3FXQ A;  2NS0 A;  1KGS A;  4QSH A;  4XN3 A;  3KZI C;  3ZCO A;  1T38 A;  4I09 A;  3HZJ A;  2VT2 A;  2V9K A;  3F22 A;  3HKZ N;  1X1P A;  4EM0 B;  2XUB A;  4KJZ A;  4BY7 J;  1ETO A;  2R5Y B;  2BVL A;  4L9V A;  1RUO A;  2R7R A;  4XOR A;  1CQT A;  2EV6 A;  1WVR A;  2V6E A;  3U9G A;  2DJN A;  2JA2 A;  4BUP A;  3AFH A;  1IW7 F;  2A5Y B;  1R49 A;  4IKF A;  3KP3 A;  1UFM A;  4XLN F;  5FKL A;  3OSG A;  3KEO A;  3VYR B;  5EGO B;  1TW3 A;  2JMW A;  2QKM B;  3K0L A;  2JJ7 A;  5FLV A;  4HW0 A;  3DCF A;  1AU7 A;  1A35 A;  2HI3 A;  4OMZ A;  1Y8R B;  4BJ6 C;  1LE8 A;  2STW A;  4MO7 A;  5GAH J;  3GTL J;  1PUF B;  3OWT A;  4GFB A;  3BC8 A;  1J7K A;  1PJR A;  3C3W A;  3E5U A;  4IVN A;  2NNN A;  2HU9 A;  1E17 A;  4BQN A;  3T1B A;  1FTZ A;  1JGS A;  1QVT A;  3ESW B;  3WU0 A;  2IVM A;  3J80 Z;  2CFX A;  4UB6 C;  4BAC A;  1YFH A;  2UZK A;  3RSN A;  3HGY A;  3I59 A;  4LOC A;  4PJ0 C;  3JR9 A;  2WV1 A;  1S7E A;  1SD4 A;  2QVO A;  1K83 J;  1Y1W J;  4XOP A;  4RB1 A;  2BXZ A;  2LKP A;  2BOL A;  4E7I A;  2NVX J;  3HUG B;  1ZYR F;  4HBL A;  1J0R A;  3J7A Y;  4X1E A;  3DKY A;  4PZJ A;  2HZD A;  1TWG J;  2AXL A;  2VOD A;  3M7G A;  3HGG A;  3KP4 A;  3HG9 A;  1X1D A;  3TL4 X;  4EGZ A;  3G73 A;  2PFB A;  2KFD A;  4M3B A;  2CYY A;  4EQQ A;  2CFO A;  1KQ8 A;  1LJ9 A;  3Q0U A;  3N05 A;  5F27 A;  5HOO A;  2X6X A;  1SAX A;  1R1U A;  1HXD A;  1AWC A;  2EPF A;  3HOW J;  3JRC A;  2O7O A;  2CQQ A;  3ZN0 A;  4C2M J;  2D5V A;  3T0Y A;  2GQQ A;  4OOI A;  4A3J J;  4PGG A;  1J75 A;  1ZG5 A;  3DXJ F;  4P96 A;  2R92 J;  5JR3 A;  4BXF A;  2LFB A;  2NOJ B;  3R0J A;  1YW8 A;  2H27 A;  1Y1V J;  3LA3 A;  4IJA A;  4BKX A;  3L2U A;  1WH5 A;  2XPV A;  5L3B A;  2R5Z B;  4A2U A;  6PAX A;  5GAG J;  2KJB A;  2FBK A;  3BR1 A;  3DPT A;  2A05 A;  4FET A;  3M1C A;  1HC8 A;  3LSH A;  5EJC A;  3ZQG A;  1N75 A;  3VSL A;  4XQF A;  1QHH D;  1LEA A;  2WAQ A;  3GZ6 A;  2HTS A;  4A0X A;  2PG4 A;  3OIP A;  4HQE A;  5GTI C;  3KZZ A;  3RKX A;  3LFU A;  5J47 A;  2QBY B;  4MQ9 F;  2V7F A;  5EDN A;  1MGT A;  3OYN A;  4NC7 A;  1X58 A;  2OC6 A;  1E3O C;  2IS6 A;  3ZQH A;  2A68 F;  4RAZ A;  3P7N A;  2QQ9 A;  2H6C A;  4B8X A;  4R8H A;  3WOD F;  4EM1 A;  5E3N A;  1U78 A;  2K3F A;  2M5W A;  2OA4 A;  4XON A;  4WK8 F;  2HNH A;  1W5T A;  5CQG A;  1ZQ3 P;  4C30 A;  4RBO A;  3W6K B;  2FEZ A;  2FRH A;  3FK7 A;  1WJF A;  2VIX A;  2HGC A;  3K7A J;  1XX5 A;  3BZK A;  1W36 D;  1YW7 A;  2CG4 A;  4WXH A;  1KON A;  4G6T B;  4ENN A;  3ZR8 X;  2Z16 A;  3FF5 A;  3JSO A;  2R7O A;  1OR7 A;  2DA6 A;  3PNT A;  5IOZ A;  4A5N A;  2RC4 A;  4ZJZ A;  3E6C C;  1QQI A;  2FBI A;  1Z1D A;  3VDX A;  1O3S A;  3ULQ B;  4G7H F;  4X0G A;  1ZRF A;  2GOM A;  2HOA A;  4XR6 A;  1KZH A;  1TLH B;  3GFL A;  4Z6Y A;  2JSC A;  2LP0 A;  2Z1D A;  3E5X A;  4ON0 A;  1R5G A;  1YJW I;  4FTH A;  3ZQ7 A;  2E34 A;  3FHZ A;  3BR6 A;  2KJC A;  2ADU A;  4UNO A;  1HA8 A;  3F3X A;  2TDX A;  1MMG A;  3F0C A;  2XV4 S;  3LSG A;  2HR3 A;  3JRF A;  3FMS A;  1YTY A;  1ZLJ A;  2E7X A;  1FIP A;  1H0M A;  3BPX A;  5M3M J;  1RKT A;  1SFU A;  3E6M A;  4L0Z B;  1W7P B;  2XB5 A;  4R1H A;  2XRN A;  1ZGA A;  3BR2 A;  2IGO A;  4QLC U;  4DGW B;  4LB5 A;  5IT9 Z;  2JZY A;  5AON A;  4F7Z A;  1MDM B;  1FBU A;  3I71 A;  5FLX Z;  3RI4 A;  2DOD A;  1P92 A;  3GLL A;  1N78 A;  3UR3 C;  1MBF A;  2QSG X;  5F0H A;  2CUZ A;  4AID A;  2O6G E;  4OWR B;  1IJW C;  3NRV A;  4PJJ A;  4F3Q A;  3DKX A;  4I0B A;  1B1B A;  1F4K A;  2VE9 A;  3WE3 A;  1T08 B;  2K27 A;  1OCR H;  3JRB A;  2OUM A;  5CJ9 A;  1T39 A;  1ZHF A;  4G6D A;  3QOD A;  5ICE A;  3RQ4 A;  2DCE A;  2JPB A;  3BR3 A;  1FBS A;  3DPL C;  3SEZ A;  1J5Y A;  4FAS D;  4MEY F;  2F5V A;  1N77 A;  2VON A;  3KP2 A;  4U87 A;  1XPX A;  3PIO F;  5CVR A;  1WJA A;  3KP7 A;  2O3F A;  2MLG A;  4XBF A;  5IPA A;  5E18 F;  1F5T A;  3S8P A;  4EV0 A;  5JI6 A;  1RPW A;  2DA5 A;  3V8K A;  1XSV A;  2EIN H;  2A6T A;  2MC4 A;  3BLY A;  5TIS C;  4CYD A;  2IS2 A;  4WWC A;  4BQA A;  1D5V A;  4DIQ A;  2QA4 I;  1IRF A;  5K1Y A;  3HKZ A;  4F91 B;  2QWW A;  3ZN1 A;  4RAF A;  1VQ7 I;  3OOU A;  3CO6 C;  2EV0 A;  4HV5 A;  1KU9 A;  2R7F A;  5L3D A;  1BI1 A;  4I7H A;  2HQA A;  1XMX A;  5M3F J;  5HLH A;  1Z3X A;  1VQ8 I;  1YYV A;  2KMU A;  2XAH A;  3H0G J;  4NUB A;  3FXO A;  5JHF A;  3CUO A;  5GP9 A;  3ELK A;  4IRG A;  2E1C A;  1UHW A;  1X2M A;  2K9S A;  4DNC A;  3ERE D;  1QPI A;  4ZTF A;  5FGM A;  2L54 A;  1U0J A;  3BWG A;  3CDL A;  3DKW A;  4MNU A;  5H6Q A;  3J80 K;  3QPH A;  5LHG A;  2NS7 A;  5M5W J;  2ZXJ A;  1NHA A;  1TNT A;  1MW7 A;  3H3V K;  5D8K B;  2KRC A;  4PFP A;  4ZYA A;  4HG2 A;  4NC8 A;  3JSP A;  4ESF A;  2K9Q A;  3H3Z A;  3SDG A;  4PJL A;  4LFU A;  1W5S A;  4BGD A;  1DQU A;  3K70 D;  1GXP A;  1ETX A;  1UST A;  2V4J C;  3FX3 A;  2YR2 A;  1O7F A;  1ZR4 A;  2NOG A;  1R23 A;  1ZTR A;  2EIJ H;  4YIF A;  1H8A C;  2XGD A;  4KFC A;  1BR4 A;  4QWQ A;  1YQA A;  4ZYE A;  4UVC A;  2MH2 A;  4LJZ F;  4CH7 A;  3T8R A;  3CTA A;  2DQL A;  3KPH A;  3VYS B;  3GFM A;  2K9L A;  2L9N A;  3JTG A;  3S15 J;  3RJP A;  1WGX A;  3G3Z A;  4CUG A;  4CCJ A;  1J59 A;  2A07 F;  1BC8 C;  1MMA A;  4Y13 A;  1YRN B;  1MBK A;  2JWT A;  2UV1 A;  3ABT A;  2EFN A;  3OR2 C;  2XGX A;  1I27 A;  2LNB A;  2ECB A;  4DYC A;  5FLM J;  4UUS A;  1MH4 A;  3EUA A;  1ODD A;  3I9V 2;  4XKB A;  1OYW A;  5HS8 A;  3J81 K;  3MCZ A;  2FA5 A;  1D1B A;  2AO9 A;  1R36 A;  2KKO A;  3OY9 A;  2PLY A;  4D7M A;  4PDK A;  3RDI A;  4BE2 A;  2MH9 A;  2XPW A;  1FIA A;  2WAQ N;  2PBI A;  2DN0 A;  2F4O B;  2KQR A;  5D4S A;  2P5K A;  1HKS A;  4RMN A;  2DYR H;  2IGM A;  1DPU A;  1YS7 A;  2EZH A;  2V1X A;  3F9K A;  3RPU D;  5LRR A;  5HS9 A;  3CCE I;  2X4H A;  1Z7U A;  3RQI A;  1LDJ A;  2CWE A;  3GTM J;  1P9Q C;  1LKX A;  4Z2Y A;  2XAS A;  3SZT A;  4O3M A;  2NVU B;  2BY1 A;  1UJ8 A;  3H36 A;  2HKO A;  2DK5 A;  4P5O A;  4YFK F;  1SD5 A;  5KVR A;  3I54 A;  2IA1 A;  3L2R A;  2IAI A;  1JUM A;  2M0M A;  1Z05 A;  4BAY A;  2O9L A;  3GUD A;  4M9Z A;  1L3L A;  2DYS H;  3LQR A;  1FPQ A;  2MAB A;  2FE3 A;  3L7W A;  3IKT A;  1Z9C A;  4KN4 X;  2FXA A;  3CP2 A;  4E70 A;  4BBS J;  1VQK I;  1VI0 A;  2GIZ A;  1O3T A;  3ML6 A;  4MGR A;  4O6J A;  2D1V A;  1RI7 A;  2ZO4 A;  2DK8 A;  4WXD A;  1UG2 A;  3O6B B;  2E36 A;  2V79 A;  4IHV A;  1A6Q A;  3HIF A;  1S29 A;  1OIS A;  2ETH A;  2HDW A;  2DPD A;  1KU2 A;  2D2W A;  5K7F A;  1BI2 A;  4I0A A;  4CCK A;  3WGI A;  2RDP A;  3IWF A;  2XF5 A;  1E3H A;  4EJW A;  3OYF A;  3ABU A;  5DCF A;  2NRA C;  1WH7 A;  3ROU A;  2BV6 A;  3LQQ A;  3EQL F;  4P9F A;  2XAQ A;  2VAS A;  2B7E A;  3IRR A;  3CJT B;  4FIS A;  5GAD J;  5L3F A;  2R7W A;  1G3T A;  1JT6 A;  3H9J A;  3QWL A;  1J09 A;  2EWN A;  2RNJ A;  5JVG F;  1XN7 A;  2RQP A;  1Y8Q B;  3P9I A;  4HZF A;  4L5J A;  4ANJ A;  2HDD A;  1BR1 A;  4L18 B;  1Y0N A;  3MKL A;  3F21 A;  3S32 A;  2IS1 A;  3DF8 A;  2RAE A;  3EUK L;  3IC7 A;  3DBH B;  4HLX A;  2LR8 A;  2F6C A;  1MD0 A;  3S1Q J;  1E3P A;  3F72 A;  3DPU A;  3GFJ A;  3ISP A;  5GPA A;  2XVC A;  1D0X A;  5KK1 A;  2V1D A;  1RES A;  1GVJ A;  2ELJ A;  3HOT A;  1UHM A;  1XG1 A;  2FMY A;  4XIC A;  1ZLK A;  1B59 A;  5FRO A;  5CLS A;  2XDV A;  4L5I A;  2IA2 A;  2HPI A;  5JFR A;  2XKP A;  1W7P D;  4BE1 A;  3KP6 A;  4NDL A;  4HSR A;  4CGZ A;  1MSF C;  1G3S A;  4IZZ A;  1RC9 A;  1ZG1 A;  1EH7 A;  1FX7 A;  2I8D A;  2OD5 A;  2W1O A;  1S9H A;  1VZ0 A;  1DUX C;  3TMO A;  3SYT A;  5DTD A;  1BI3 A;  1U5T B;  3EUH A;  1V54 H;  4PUS A;  3V7S A;  3VSK A;  1LPQ A;  1HCR A;  4U7B A;  4A3M J;  2ZFW A;  3HOV J;  1IRG A;  3F8N A;  5C4J J;  3U1D A;  4AUX A;  1IN8 A;  1W7P A;  2HFH A;  3BG9 A;  2TCT A;  2PMH A;  3EET A;  2NXN B;  3TDZ C;  4M9X A;  2R7D A;  4W97 A;  2DDB A;  2X6O A;  1YJ9 I;  1FOW A;  4A3D J;  3CJQ B;  2HOE A;  4IHW A;  5EG0 B;  3I64 A;  3GBG A;  1I6H J;  2EIL H;  1U9N A;  4AIJ A;  3TO6 A;  3OYM A;  2M30 A;  2R7T A;  2YUS A;  4A3G J;  3I58 A;  3CCM I;  1WJE A;  1SAN A;  2D45 A;  3C18 A;  1WJD A;  4FX0 A;  4HNV A;  5HVQ C;  1VTN C;  3M4O J;  3MZH A;  5GTH C;  3CQZ J;  3TW6 A;  3TOB A;  2LY9 A;  2ZKZ A;  3FZV A;  3KLO A;  5HLG A;  2M1B A;  2W84 A;  1H88 C;  4AVZ A;  1BI0 A;  1F36 A;  1FEX A;  2WB1 A;  2JQ7 A;  1ERD A;  2EFW A;  2VXD A;  3W2A A;  1TZL A;  4D0P A;  2HOS A;  2A61 A;  2E35 A;  2GOX B;  4HF0 A;  4L9T A;  4M3D A;  2FSW A;  2O03 A;  3DU6 A;  3F8C A;  3DTE A;  2AXT C;  2CUE A;  1I39 A;  4CCN A;  4AYB A;  3LSR A;  4DYR A;  1PP7 U;  4Y17 A;  1P7I A;  1D1A A;  2CU7 A;  3HSF A;  1QA6 A;  2M8E A;  1A31 A;  4W1U A;  2EA4 A;  3HEF A;  4MIM A;  1JUP A;  2E19 A;  2G7H A;  3WTT C;  3JRI A;  2KT0 A;  1ITY A;  2R7S A;  2FBH A;  3FXM A;  3MQ0 A;  2P5L C;  1P6R A;  2F4M B;  4E7H A;  1XMA A;  4PFO A;  2V1U A;  1WKM A;  5ILS A;  4A0Z A;  2ZNY A;  3X2Q H;  3L2W A;  1I3A A;  1V5G A;  3CF5 F;  1W4M A;  5LD2 C;  5LHI A;  3GTO J;  1C0W A;  2DXI A;  2BE5 F;  4ZC3 A;  1ZKG A;  4ZDO A;  3CLQ A;  2KIM A;  2D1H A;  4CCL A;  2IXS A;  2B63 J;  5FLX K;  4EJV A;  1G59 A;  4G7O F;  4ZDL A;  5LFA A;  2JK3 A;  4ETS A;  3IH4 A;  1USS A;  1IGN A;  2CRG A;  4BQO A;  1U5T C;  3WGH A;  1SEU A;  1GV5 A;  2FU4 A;  3F8B A;  1DGW Y;  4S05 A;  1UMQ A;  1O3Q A;  4M6Y A;  3IV5 A;  2ZBK A;  1HQC A;  3MZ8 A;  3OR1 C;  3K1M A;  1IC8 A;  5C4X J;  3TP3 A;  2VKD A;  4LIV A;  4OIP F;  3I4P A;  1A5J A;  1XC5 A;  3ABL H;  3GCM A;  3HPG A;  2VOP A;  1T95 A;  2O8K A;  3FM3 A;  2X6Y A;  2DA7 A;  3CES A;  5H20 A;  1LQ1 A;  3QP5 A;  2IBD A;  1TBX A;  1ZN2 A;  2QYO A;  3RKQ A;  2OCC H;  3L9F A;  3GYH X;  1B8I A;  1T33 A;  2CS3 A;  2DAO A;  2OCE A;  5BMZ A;  3BT9 A;  5LGT A;  1TWA J;  3D5L A;  3IWZ A;  2P81 A;  1LDK B;  2Q0O A;  3MVP A;  1WI3 A;  3PUF A;  2R7Z J;  4HNT A;  4IOA F;  3E7L A;  2XB0 X;  1MBG A;  1NK2 P;  2L4M A;  2R5Y A;  3HSE A;  3IAS 2;  4EEF G;  3EPZ A;  2ISY A;  4XKC A;  3BDD A;  2JRM A;  1W1W E;  4RGR A;  3BG7 A;  3DLL F;  3V4G A;  4ENK A;  4M3F A;  2ME6 A;  3F6V A;  1ULY A;  2VB6 A;  1FMV A;  3WGG A;  2LH9 A;  3OS1 A;  1R4M B;  2LRD A;  2Q8K A;  2NVT J;  4TV7 A;  3ECO A;  2DO7 A;  2X1E A;  4ASN A;  3LL7 A;  1ONV A;  1ZGJ A;  4GRI A;  1JE8 A;  5E1W A;  1K79 A;  4BYY A;  4PJN A;  4C2U A;  2E1M B;  1RRJ A;  2E2H J;  4IHS A;  2OTJ I;  2PEX A;  1Y39 A;  3I4M J;  5LBQ A;  4KIF A;  2PJR A;  2RKH A;  4ZZD A;  3HOU J;  2H8R A;  1D0Z A;  3DTK A;  1SD6 A;  1XDU A;  3QPL A;  2M34 A;  2LOO A;  2ZSH B;  3FHN A;  3OV8 A;  3ZQQ A;  5IT9 K;  1EJ9 A;  5CVU A;  3ABK H;  2CV0 A;  1AKH B;  2EA2 A;  1WRJ A;  2QM3 A;  3O8H A;  1P4X A;  1MIJ A;  4F55 A;  4AVP A;  3K6G A;  4RAG A;  3OYK A;  1YJN I;  1JT0 A;  1FTT A;  5BPI A;  3ZXS A;  4GXO A;  5E3M A;  3ZMS A;  4YFX F;  2AQF A;  1LNW A;  3FMQ A;  1YX3 A;  2QF7 A;  2LLK A;  1S7O A;  1QNT A;  1KA8 A;  1KQ9 A;  4A93 J;  1EKE A;  3OMY A;  3OYB A;  4BU2 A;  3G71 I;  1R22 A;  2J5O A;  3LA2 A;  1VF9 A;  4XRS G;  1UB9 A;  3JTH A;  2KLO A;  4NBQ A;  1R9T J;  4UXN A;  2DMU A;  3K4L A;  4G6Q A;  5L3C A;  2KZG A;  5E17 F;  2HKX A;  3HOZ J;  1QGP A;  3NWS A;  1JTX A;  1RKW A;  1MH3 A;  3MMY B;  4EJO A;  2LG4 A;  2P7V B;  5FO5 A;  4HRI A;  2CUF A;  5FKK A;  3OYI A;  2DFE A;  1YE9 A;  4Q5S F;  3FDY A;  1R1V A;  3KIO A;  1QO0 D;  3H5A A;  3L2C A;  3HSR A;  1HW5 A;  1MBH A;  1RZ4 A;  2MGQ A;  3H35 A;  2KDZ A;  1YW9 A;  2RVC A;  2VC1 A;  4AWX B;  2LF8 A;  1LEB A;  1D0Y A;  3L00 A;  2M2E A;  3CF2 A;  5E8G A;  2CQK A;  5D6E A;  2BY0 A;  3BQY A;  2E60 A;  1R5H A;  1QRY A;  2EFQ A;  4LK0 F;  4CZZ A;  1W0T A;  4A5M A;  3BCB A;  3FXL A;  3RKY A;  1GLN A;  4RGU A;  1OCZ H;  2WA0 A;  1RIO H;  2OBP A;  5JLW A;  5EGO A;  1HLV A;  2VJJ A;  3MN2 A;  2IEK A;  2LDU A;  2XSD C;  1XSD A;  3E0J B;  1I5Z A;  3PO2 J;  4A3C J;  3QPS A;  4KDP A;  4NHJ A;  2K4B A;  5BOX A;  3K4K A;  3GWZ A;  1BIB A;  2VOO A;  4M9S A;  5CQE A;  1APL C;  3JW4 A;  3A03 A;  1K4T A;  2Z9O A;  3I4N J;  4XSZ F;  2V1N A;  4LLG F;  4LG0 A;  1WI9 A;  2A3S A;  4S0H B;  2E1N A;  3BG3 A;  2HS5 A;  2ZJ2 A;  4I76 A;  4OIN F;  2FX0 A;  3VFZ A;  3ZQI A;  2E2J J;  1SC7 A;  4CDG A;  3FBI B;  3KX2 A;  2ISZ A;  2DQR A;  2X1C A;  2W82 A;  3ZGK A;  3ABM H;  4KMU X;  2P4W A;  3A4C A;  5FD6 A;  3H0D A;  2Z99 A;  3CC2 I;  1IDY A;  4LB6 B;  4BS9 A;  3FBN B;  2YSR A;  3HOS A;  1MND A;  1VQM I;  3FXJ A;  1IN4 A;  3JRG A;  2YPR A;  3C2G A;  2EV5 A;  2QZ8 A;  1V5E A;  3ZMT A;  3K1P A;  4J00 A;  4RM2 A;  1N25 A;  5TGT A;  2UUZ A;  1TC3 C;  3R6S A;  1ZRD A;  3LOC A;  4OIO F;  1XGO A;  3IKV A;  3K4N A;  1OCO H;  3CMY A;  1R5I D;  5J8C A;  1X2N A;  2JA5 J;  1UAA A;  1K4S A;  4N9I A;  3LSM A;  1XMK A;  3BJO A;  3GTK J;  5EEH A;  2JSP A;  1RUN A;  2O0Y A;  1E2X A;  2L7F P;  4LMY A;  3PO3 J;  1U2W A;  2BY3 A;  1OCT C;  3VYU B;  2XHK A;  3IUO A;  1VQ4 I;  3HB9 A;  4PJM A;  3D0S A;  2NYX A;  2L4A A;  1TW2 A;  3ZQF A;  5BQT A;  4Q47 A;  1TWH J;  1NG6 A;  3E5Q A;  2GLO A;  2UXX A;  4KT5 C;  5AIP A;  2F5D A;  2MBF A;  5CKT A;  1XCV A;  2BBY A;  3ZMV A;  5K7H A;  3JRA A;  2RN7 A;  3LSJ A;  2ID6 A;  2LKS A;  1B72 B;  1R1T A;  2ZB9 A;  4B09 A;  5F6F A;  5DM6 F;  4V2F A;  1R6R A;  1Z3Y A;  2QBY A;  1I3Q J;  1FYK A;  5IY5 H;  1IV8 A;  3LST A;  4HPQ A;  2VLA A;  3I59 B;  4RLQ A;  2MD0 A;  4M71 A;  4AC0 A;  2XRO A;  1TWC J;  2Z3Y A;  2DA3 A;  4D9J A;  2RNG A;  3SJM A;  5JVT A;  1OQY A;  1AKH A;  3G1M A;  3CCV I;  2W00 A;  4YFN F;  2VL8 A;  4P55 A;  1YIJ I;  4BQQ A;  4AIK A;  1NH3 A;  2MFZ A;  3HYI A;  2XF7 A;  4WCG A;  1FBQ A;  1T8I A;  1X3W B;  1IV6 A;  2JT1 A;  1ORK A;  2GXA A;  1MZB A;  3SXY A;  4C3J J;  2TRT A;  2EQR A;  2ZME C;  1IRX A;  3KCC A;  3TW7 A;  1QHG A;  2K85 A;  4EM2 A;  3DP7 A;  3S3O A;  1VQ6 I;  1BL0 A;  1GT0 C;  2R3S A;  1T6S A;  2FD5 A;  2PMZ N;  5F1J A;  2WC2 A;  3DV8 A;  1FY7 A;  3PSI A;  3G2B A;  1PP8 F;  3A2K A;  4CA0 A;  4YEJ A;  3I55 I;  3BOQ A;  3FMR A;  3H5R A;  4HLY A;  4I02 A;  3PFY A;  4R79 A;  4GYG A;  3ZMU A;  1EH8 A;  4MQV A;  2WWY A;  4IRI A;  3GO5 A;  2BY2 A;  4GYI A;  3HHG A;  4RB3 C;  2FF4 A;  3MD2 A;  2R93 J;  1YX5 A;  3M1E A;  3RZD J;  1Z67 A;  1Y0U A;  3AG1 H;  1STZ A;  4XLF A;  1WJC A;  3E97 A;  3C2H A;  1OMI A;  1JKQ C;  4ZYH A;  5FJ8 J;  1VQN I;  2IGN A;  2PJR B;  3S1N J;  2DLL A;  4D1Q A;  1BW5 A;  5EF6 A;  5L3E A;  1S5L C;  2V26 A;  4BXX J;  3T8T A;  5KNL A;  2HVS A;  1POG A;  1YO5 C;  3SHF A;  1VND A;  1A36 A;  2XF6 A;  5D8L B;  5B3S H;  3BTI A;  2DI3 A;  2J5P A;  1FP2 A;  4RAY A;  1BJZ A;  1XGN A;  2H94 A;  3KP5 A;  1EF4 A;  1FSH A;  1IG7 A;  4K2E A;  3F6O A;  2LD5 A;  2KIF A;  2H1L A;  4Y33 A;  4DJA A;  2ZSI B;  3HRU A;  2AQE A;  3EDP A;  5FKN A;  4HX4 A;  4BHC A;  2WBM A;  1VQL I;  3OSF A;  2ELH A;  2LY1 A;  2Q2E A;  3CUQ B;  3V42 A;  1ENH A;  4B3X A;  1H9G A;  1YS6 A;  3SEQ A;  2XAJ A;  2KIQ A;  1S8N A;  2E1O A;  1OFC X;  2OZ6 A;  1R4N B;  1O57 A;  2L01 A;  3QAH A;  3OYC A;  1U3E M;  2ZJR F;  1LFU P;  2L9S A;  4LG0 B;  2HDC A;  3K4B A;  1SMT A;  5F64 A;  1L0O C;  1R00 A;  1ZRC A;  4IOC F;  2DMP A;  4HF1 A;  2G7U A;  5HS7 A;  5M5Y J;  3CUQ C;  2NNY A;  1SVM A;  2PQ8 A;  2QEN A;  3IH3 A;  4I99 C;  3K70 C;  5IP9 J;  3S14 J;  5FRM A;  5AIQ A;  2XAU A;  3JRH A;  2CMP A;  1JXS A;  9ANT A;  2RQQ A;  4P1W A;  2KRH A;  1K6O A;  1CGP A;  3BPV A;  4OIQ F;  4XLE A;  2KPM A;  3M8E A;  2DBB A;  3C7J A;  2FML A;  2EZL A;  1G6N A;  2Y2Z A;  2VPR A;  1GV2 A;  2GM4 A;  1FP1 D;  2MD5 A;  2EH3 A;  4CSW A;  1MBJ A;  2VKV A;  3OIO A;  4GO1 A;  2ZXH A;  3COA C;  5ICG A;  4B43 A;  4MHG A;  1K78 A;  1R71 A;  4GCV A;  3MAJ A;  1OYI A;  1OJL A;  2OZU A;  3DEW A;  1ETW A;  2MYS A;  3VEP A;  5J8F A;  3RYP A;  1IN5 A;  2JPC A;  4BY1 J;  1QU3 A;  2OF7 A;  3JCU C;  3BJA A;  1HKT A;  4XKW A;  4LIT A;  3T5X A;  1ZGW A;  2E5Z A;  3TO9 A;  4BH9 A;  1T56 A;  2M87 A;  2VKH A;  1B4A A;  4KIB A;  5GAE J;  1SFK A;  3A01 B;  1FOY A;  3F8F A;  1ACI A;  2MG4 A;  3GF2 A;  3KEY A;  5J1U A;  3IH2 A;  4V2G A;  3G4S I;  1AOY A;  3CJR B;  4LD5 A;  1OYY A;  2FQ4 A;  3CDH A;  3WHC A;  1I50 J;  4LLL A;  3GX4 X;  2BW3 A;  3ZP5 A;  3IHU A;  3A02 A;  3QOE A;  3QRF F;  2ELK A;  2K3P A;  1SVO A;  4D5C A;  1ON1 A;  3K4J A;  3Q9V A;  2KZV A;  4LIU A;  1O3R A;  2ESN A;  3CDI A;  1UEL B;  5F1R A;  2VQG A;  5DS9 A;  4N4N B;  4LK1 F;  5EG0 A;  2IW5 A;  3CP8 A;  2K5C A;  5B1B H;  5F04 A;  1ZR2 A;  4ABZ A;  1B72 A;  3VYT B;  5ICF A;  5J1Y A;  3FIS A;  4A3E J;  2K02 A;  2DA1 A;  4HDV A;  1S6L A;  3FK6 A;  4C2T A;  2KDO A;  1PDN C;  3NWT A;  1XGS A;  4U0V A;  3QQA A;  2W85 A;  2L9V A;  1BA5 A;  1BBY A;  4C3I J;  2W7N A;  2ZXW H;  4DBQ A;  1KU7 A;  1QPM A;  3LSI A;  4NQW B;  1MMN A;  4G12 A;  3MKY B;  2LF7 A;  3H3U A;  1S72 I;  2CV2 A;  1WFX A;  4XRM A;  2HWV A;  1REP C;  4HYE A;  4J01 A;  2LY2 A;  3MKZ A;  4UB8 C;  4N9H A;  2KIU A;  4D7N A;  4CZC A;  1KQ0 A;  3CCU I;  2F48 A;  1HDP A;  3CC4 I;  3HHH A;  3AL0 C;  2JUG A;  2VN2 A;  3OYD A;  3VOE A;  5CVV A;  1IDZ A;  1WPK A;  2P7C B;  1XDS A;  3CCR I;  4F52 A;  1QZZ A;  1TTY A;  2I10 A;  2EBI A;  3V8L A;  2XGE A;  4CIC A;  2E7W A;  3WG9 A;  4AIH A;  5D4R A;  3S3M A;  4M73 A;  1O4X A;  4IQ4 A;  2M7A A;  3HRM A;  4XNF A;  3PM1 A;  2DOE A;  3LNQ A;  3VWB A;  3VB2 A;  1BW6 A;  3BG6 A;  4B48 A;  5HLI A;  2H8W A;  1YHQ I;  3OOP A;  4HAM A;  1FT9 A;  3ASO H;  3MEX A;  5B66 C;  4XKV A;  1IXC A;  1WCM J;  3S2W A;  4CO8 A;  3TED A;  1FWZ A;  4Q4Z F;  2PMZ A;  3R60 A;  4JX5 A;  1J9I A;  4F93 B;  3WU1 B;  2H09 A;  4E7Z A;  2RRE A;  3KZY A;  4PCQ A;  2P6T A;  1YI2 I;  1IRZ A;  2Y30 A;  2PI0 A;  5DD4 A;  3OS0 A;  1PUF A;  2LBF B;  1E0E A;  5D5W B;  2HVR A;  4RGS A;  4AYB N;  4YG2 F;  3AL0 B;  1BIA A;  2EIK H;  4A3F J;  1MJB A;  2VE8 A;  1TP4 A;  1XB4 A;  2F5F A;  2X51 A;  5ED4 A;  1R58 A;  3EYY A;  2CW0 F;  3NQO A;  3LSP A;  3ERM A;  5EEA A;  2Y48 A;  3QYB A;  3TP0 A;  2X48 A;  2VPL A;  3WTZ A;  3B73 A;  4DOZ A;  4KN7 X;  4KT6 A;  1HW1 A;  4HNU A;  5DUI A;  3TQN A;  2OTL I;  2FOW A;  1I6X A;  2X6W A;  3E6D A;  3HUG A;  4AD9 A;  4WX9 A;  3GEZ A;  4IO9 F;  4BHB A;  3TO7 A;  4ITV A;  2I5U A;  5DM7 F;  5F08 A;  4UVB A;  3QYE A;  3TGN A;  3WHB A;  3ASN H;  2CQN A;  3LFK A;  4II3 A;  2R4G A;  1X4P A;  5LGU A;  3Q5F A;  1RNL A;  4ENJ A;  4YIR X;  2ID3 A;  2Y0S N;  4ZDP A;  4HDU A;  1B6A A;  1MMD A;  3V7C A;  4DZP A;  1JI8 A;  1NK3 P;  1QVU A;  4A3I J;  1Q1V A;  1ETV A;  2CW8 A;  3PQJ A;  3CO7 C;  2F5E A;  2LRE A;  2VQC A;  4HA8 A;  4CCM A;  3AG3 H;  4Y3O A;  3FXU A;  5KAF C;  4WF2 A;  4OAY A;  3OYA A;  3NAR A;  2PX9 A;  3OIQ A;  2M0C A;  2QSH X;  4RLF A;  2GWR A;  3H5N A;  3PNY A;  4Q48 A;  2CJJ A;  1OLT A;  5J3L A;  2OPT A;  4A0Y A;  1XSX A;  4Y7N J;  3K1N A;  3QU6 A;  4E7J A;  2YX4 A;  1FNN A;  3BR0 A;  4M3G A;  2VJ4 A;  3CD6 I;  2VT3 A;  4XM3 A;  1LE8 B;  3S2D J;  4JQF A;  1X1C A;  1D8K A;  1JKP C;  5DCM B;  4U88 A;  4KIS A;  3DBR B;  1LFB A;  3DU5 A;  2WTE A;  2WAD A;  2HYG D;  1DGR M;  5ICC A;  2VUM J;  1TT5 B;  1BN5 A;  4YRV A;  2XC7 A;  2GBY A;  5IOY A;  4XOT A;  4FT8 A;  4IEJ A;  4G94 A;  4FCY A;  4HV6 A;  1R7J A;  1IUY A;  3AG2 H;  2X0L A;  1UCR A;  1FYM A;  2Y0S A;  3A0H C;  4UVA A;  5IP6 A;  4M6V A;  4CYC B;  4LLN A;  4BDZ A;  2DFH A;  2F2E A;  5HNF A;  1B8I B;  1DU0 A;  5F0C A;  2P8T A;  3FIW A;  3M8F A;  4U0W A;  4G7Z F;  1OCC H;  1HF0 A;  1HST A;  4UV9 A;  3UNG C;  4DBR A;  2Q2E B;  3CUQ A;  3GZN B;  1GHC A;  1Y6I A;  2BVM A;  3E3V A;  1DP3 A;  1F9N A;  2YU3 A;  2JN6 A;  2WY7 Q;  1IF1 A;  5DV5 A;  2IJL A;  2L7K A;  4E7K A;  4BBR J;  2VKE A;  1SFO J;  4HX7 A;  1QZE A;  2L02 A;  2OJE D;  3KFW X;  3BJ6 A;  3ZMZ A;  5K5R A;  2AS5 F;  3GTP J;  2HEO A;  3ZOB A;  5ILU A;  5EZH A;  2ACJ A;  1OKR A;  1W5C C;  1WSU A;  5LEK A;  3J81 Z;  4JX4 A;  1T2K A;  2UWM A;  3HL2 A;  3A1Y A;  1IXS B;  3IRQ A;  2F4I A;  3A01 A;  4A12 A;  5KCM A;  2VBX A;  1YIO A;  1ZK8 A;  3R0A A;  4XID A;  4XRS A;  5HLT A;  1V55 H;  1ZEL A;  2VJ5 A;  2GXB A;  3SZG A;  1ETQ A;  1KYW A;  5TJJ A;  4ZYG A;  2LK2 A;  3ZQL A;  3HRT A;  5E1X A;  2L3D A;  4U7D A;  3OYJ A;  1V5F A;  2JTV A;  3CCJ I;  1U8R A;  4ZYD A;  3PJR A;  2DDA A;  4KYW A;  4OMY A;  4N4O B;  1D1C A;  2EK5 A;  2WB1 N;  3I53 A;  2CSO A;  4CYC A;  5HNH A;  2L0K A;  4M74 A;  2H6B A;  2R7U A;  4G9Y A;  3WU2 C;  3RPQ A;  1KYZ A;  3L1P A;  2VQL A;  1U8B A;  5H2F C;  3PUB A;  4BHP A;  4X6A J;  5LLQ A;  5K5O A;  1HDD C;  3BG5 A;  2M9H A;  4RM3 A;  1V3F A;  2IGK A;  2XRL A;  1DP7 P;  1UG0 A;  4QPQ A;  2DMQ A;  3B6C A;  4KIC A;  2ME0 A;  2FJ1 A;  1I1S A;  2E5N A;  2MC3 A;  4NC6 A;  2LVS A;  5LGN A;  4JK1 X;  1P4W A;  4ESJ A;  3S16 J;  2HXI A;  1YG2 A;  3PSF A;  1ZAO A;  4L5E A;  4LGW A;  3RIR A;  1LVK A;  5J40 A;  4GDF A;  2QGU A;  4EJU A;  4O5V A;  1YLF A;  2QCO A;  3FXR A;  1B9M A;  3H9G A;  2E2I J;  1G3W A;  1PVE A;  2GA1 A;  2XKO A;  3KYL A;  1K61 A;  1TT0 A;  1TQM A;  5A2Q Z;  2M8G X;  5IT3 A;  1MNE A;  5DDG A;  3J7A O;  2R7Q A;  3FKJ A;  2UXN A;  1Y56 A;  3TBI A;  3GVA A;  2K7L A;  2VBW A;  3F8M A;  3DEU A;  4UUV A;  2Y9Y A;  1XS9 A;  2H1K A;  3A0B C;  5L3G A;  4M72 A;  1LVA A;  2FNA A;  3GTG J;  3W6V A;  2DTR A;  2BHZ A;  2KP6 A;  2JA8 J;  2Y69 H;  5J4V A;  2KL4 A;  2DT6 A;  1J2X A;  3HTU A;  5C44 J;  2Y0M A;  1ETY A;  1G3Y A;  2BXY A;  2G0E A;  3WTW C;  3K2Z A;  1TNS A;  3CCY A;  3K4C A;  4FQG A;  2O61 A;  1JJ6 C;  3SFI A;  3OL4 A;  2HYF A;  4KUM A;  1AHD P;  1V4R A;  4XMY A;  3U2R A;  3CLO A;  5JLX A;  4P9U A;  1U6G A;  2CGP A;  1FMW A;  1ETK A;  4IPA A;  4HF2 A;  3IP4 B;  3ZPL A;  2JVH A;  2XAF A;  3CME I;  5CVI A;  1MKM A;  2IPQ X;  4A3L J;  2EIM H;  1D3Y A;  2MW8 A; 
#chains in the Genus database with same CATH homology
 5GPA A;  1JKQ C;  1HOM A;  1RES A;  2DMT A;  5FJ8 J;  3GTQ J;  3S1N J;  1XG1 A;  4XIC A;  4D5F A;  5EZG A;  1BW5 A;  5EF6 A;  5F0F A;  4FE4 A;  5IYB J;  4BXX J;  1POG A;  4NDL A;  1VND A;  1MBE A;  5IYC J;  1MSF C;  3BTI A;  1EF4 A;  1BJZ A;  1IG7 A;  1JGG A;  1GUU A;  4JX6 A;  2LD5 A;  2DTZ A;  4DZJ A;  5DTD A;  5HOD A;  4IHX A;  4JP0 A;  5FKN A;  1HCR A;  4A3M J;  3HOV J;  4QSH A;  3O8G A;  3OSF A;  4I6Z A;  5C4J J;  4AUX A;  4B3A A;  1ENH A;  3HOX J;  3HKZ N;  2E1O A;  3BG9 A;  2YU9 J;  2TCT A;  1OFC X;  4IHY A;  4BY7 J;  1ETO A;  2R5Y B;  4A3B J;  4W97 A;  2X6O A;  4A3D J;  1LFU P;  4IHW A;  5EG0 B;  1CQT A;  3GBG A;  1I6H J;  1U9N A;  2DJN A;  2DMP A;  2ECC A;  5M5Y J;  3GTJ J;  2YUS A;  5FKL A;  4A3G J;  3OSG A;  5EGO B;  2JMW A;  3IH3 A;  1JUS A;  1SAN A;  2JJ7 A;  1IUF A;  5FLV A;  3S14 J;  5IP9 J;  3DCF A;  1AU7 A;  4HNV A;  2HI3 A;  3JRE A;  3JRH A;  3M4O J;  9ANT A;  2XPU A;  3CQZ J;  2JA7 J;  3TW6 A;  1LE8 A;  2LY9 A;  4MO7 A;  2HQ5 A;  3GTL J;  1PUF B;  2EZL A;  4GFB A;  2Y2Z A;  2VPR A;  1H88 C;  5C3E J;  1GV2 A;  1F36 A;  1FEX A;  2GM4 A;  2EH3 A;  1MBJ A;  2VKV A;  3OIO A;  1FTZ A;  1QVT A;  2HOS A;  2K40 A;  4MLO A;  4M3D A;  1OJL A;  3HGY A;  4LOC A;  5FKM A;  2HOT A;  3DEW A;  1ETW A;  4BY1 J;  3JR9 A;  2WV1 A;  2CUE A;  1S7E A;  2OF7 A;  3LSR A;  1K83 J;  1Y1W J;  4DYR A;  1ZGW A;  3BTC A;  1T56 A;  3A01 B;  1P7I A;  3NAU A;  2CU7 A;  2NVX J;  2MG4 A;  1YRN A;  5J1U A;  4W1U A;  3IH2 A;  4V2G A;  1Z0X A;  3HEF A;  4MIM A;  1JUP A;  2E19 A;  4A3K J;  3JRI A;  2FQ4 A;  2KT0 A;  4X1E A;  1ITY A;  4UUS B;  3WHC A;  1I50 J;  1VFC A;  1TWG J;  2VI6 A;  3HGG A;  3A02 A;  4B1R A;  2ELK A;  4D5C A;  3HDD A;  4M3B A;  5IYD J;  3Q0U A;  2CQX A;  5F27 A;  5DS9 A;  3GTO J;  3HOW J;  5EG0 A;  1ZKG A;  3JRC A;  2O7O A;  2CQQ A;  5F04 A;  4C2M J;  1ZR2 A;  2D5V A;  4A3J J;  4ABZ A;  1B72 A;  2B63 J;  5J1Y A;  2R92 J;  2LFB A;  3FIS A;  4A3E J;  1Y1V J;  2DA1 A;  2JK3 A;  3Q0V A;  3FK6 A;  3IH4 A;  1A6I A;  4BKX A;  4MFD A;  1IGN A;  1WH5 A;  2CRG A;  2XPV A;  2NVQ J;  2R5Z B;  3QQA A;  2HYJ A;  3BR1 A;  1GV5 A;  1BA5 A;  4C3I J;  3S17 J;  2K9N A;  1UMQ A;  4G12 A;  3ZQG A;  2AHQ A;  4XRM A;  3IV5 A;  1IC8 A;  5C4X J;  3TP3 A;  1A5J A;  1XC5 A;  4D7N A;  3ZQC A;  2O8K A;  5EDN A;  1NTC A;  1X58 A;  1E3O C;  1HDP A;  2DA7 A;  3ZQH A;  2XGC A;  1TWF J;  5IP7 J;  1IDZ A;  2IBD A;  1WPK A;  3HM5 A;  3RKQ A;  4JYK A;  1B8I A;  5E3N A;  1T33 A;  2EBI A;  2I10 A;  2XGE A;  3S1R J;  1U78 A;  3BT9 A;  3HOY J;  1TWA J;  1ZQ3 P;  2P81 A;  4RBO A;  3MVP A;  1WI3 A;  1JKO C;  2R7Z J;  1O4X A;  3FK7 A;  3E7L A;  2XB0 X;  1MBG A;  3K7A J;  3PM1 A;  3LNQ A;  3UKG A;  1NK2 P;  2R5Y A;  1BW6 A;  4EEF G;  4M3F A;  2DA6 A;  2ME6 A;  5IOZ A;  1WCM J;  3TED A;  2NVT J;  4JX5 A;  3D1N I;  2HOA A;  2COB A;  2LP0 A;  3S1M J;  4FTH A;  1IRZ A;  2Y30 A;  3BR6 A;  1PUF A;  2MSY A;  2E2H J;  3F0C A;  4AYB N;  3LSG A;  4Y52 J;  4A3F J;  3JRF A;  3I4M J;  1FIP A;  1OCP A;  3HOU J;  5M3M J;  1RKT A;  2H8R A;  3LSP A;  3Q3S A;  1JTY A;  5EEA A;  3HBL A;  2DMN A;  1H89 C;  2XB5 A;  3TP0 A;  2X48 A;  3BR2 A;  4M3E A;  2L9R A;  4B4C A;  2L7M P;  3QPL A;  2M34 A;  1AKH B;  3O8H A;  1MBF A;  3VPR A;  5F0H A;  1P7J A;  3G1L A;  1IJW C;  2EZI A;  1JT0 A;  1FTT A;  5F08 A;  3S2H J;  3WHB A;  5E3M A;  3G1O A;  5M5X J;  1W0U A;  3FKI J;  2EZK A;  2ID3 A;  2Y0S N;  3JRB A;  2QF7 A;  4DZP A;  2LLK A;  1MNM C;  4C3H J;  3BR3 A;  4A93 J;  1NK3 P;  1QVU A;  4A3I J;  1Q1V A;  4FE7 A;  1ETV A;  4QIW N;  4XRS G;  1VF9 A;  1R9T J;  2DMU A;  5IPA A;  3NAR A;  2M0C A;  1U9O A;  5J3L A;  3HOZ J;  2CJJ A;  1RPW A;  2OPT A;  2DA5 A;  3B6A A;  4Y7N J;  1JTX A;  1RKW A;  3BR0 A;  1MH3 A;  4M3G A;  2CUF A;  5FKK A;  4DW6 A;  1LE8 B;  3S2D J;  1DU6 A;  2JA6 J;  1JKP C;  3RZO J;  1LFB A;  3OOU A;  1MBH A;  2MGQ A;  5M3F J;  2VUM J;  2KDZ A;  2L7Z A;  2Y31 A;  4QTR A;  2GBY A;  3H0G J;  5IOY A;  2M2E A;  4IEJ A;  4FCY A;  2X9D A;  3BQY A;  5GP9 A;  2K9S A;  1QRY A;  1X2M A;  1QPI A;  5IP6 A;  4J19 A;  4M6V A;  4CYC B;  1B8I B;  1DU0 A;  5F0C A;  3FIW A;  1W0T A;  3CDL A;  2HXO A;  2NS7 A;  5M5W J;  5JLW A;  5EGO A;  1HLV A;  3MN2 A;  3H3V K;  2IEK A;  1HF0 A;  2XSD C;  3PO2 J;  4A3C J;  2Y9Z A;  3QPS A;  5E3O A;  2K9Q A;  3BTJ A;  3SDG A;  2JN6 A;  5J1R A;  1APL C;  4BBR J;  2VKE A;  1SFO J;  3A03 A;  1ETX A;  3I4N J;  4S0H B;  1ZR4 A;  2NOG A;  3BG3 A;  1ZTR A;  1FJL A;  1H8A C;  2XGD A;  3GTP J;  3ZQI A;  4I76 A;  2FX0 A;  2E2J J;  3ZOB A;  5EZH A;  1Z77 A;  2NS8 A;  2R5Z A;  4JX4 A;  1IDY A;  1GDT A;  3S15 J;  2W48 A;  1WGX A;  3A01 A;  3JRG A;  1ZK8 A;  4XID A;  1YRN B;  4XRS A;  1MBK A;  2JWT A;  2DA2 A;  4DYC A;  1ETQ A;  5FLM J;  2ECB A;  4UUS A;  1MH4 A;  1MSE C;  2LK2 A;  3ZQL A;  1TC3 C;  3LOC A;  2AO9 A;  3CMY A;  1JJ8 C;  4D7M A;  1GVD A;  1X2N A;  2XPW A;  1FIA A;  2JA5 J;  2WAQ N;  2WB1 N;  4XK4 A;  2DN0 A;  4CYC A;  2L0K A;  3GTK J;  1G2H A;  4A69 C;  3BTL A;  1UHS A;  3L1P A;  2L7F P;  1U8B A;  3PO3 J;  2EZH A;  1OCT C;  4X6A J;  1HDD C;  4DYQ A;  3BG5 A;  2M9H A;  3C2B A;  2XRL A;  2YS9 A;  5BNG A;  1JKR C;  3HB9 A;  3RQI A;  3GTM J;  1D5Y A;  2DMQ A;  3B6C A;  3ZQF A;  1TWH J;  2ME0 A;  2FJ1 A;  2GLO A;  2LVS A;  3S16 J;  2HXI A;  2IAI A;  5K7H A;  1JUM A;  3JRA A;  2DA4 A;  1RR7 A;  2ID6 A;  3LSJ A;  4L5E A;  2R0Q C;  1B72 B;  2ZB9 A;  2O9L A;  4V2F A;  2QCO A;  1I3Q J;  2E2I J;  3K2A A;  3BR5 A;  1K61 A;  4AC0 A;  5K7Z A;  1TWC J;  4RDU A;  2DA3 A;  2M8G X;  4BBS J;  4MFE A;  3SJM A;  1AKH A;  1VI0 A;  1F43 A;  3G1M A;  3Q0W A;  2LKX A;  5FKO A;  1UG2 A;  2Y9Y A;  1IV6 A;  4IHV A;  1ORK A;  1XS9 A;  3M3Y J;  2H1K A;  2NVY J;  4C3J J;  2TRT A;  2EQR A;  3TW7 A;  5K7F A;  3GTG J;  3W6V A;  1BL0 A;  1GT0 C;  2JA8 J;  5GPC A;  2FD5 A;  5F1J A;  2PMZ N;  5C44 J;  1WH7 A;  1ETY A;  2G0E A;  3CCY A;  4FIS A;  1JJ6 C;  2N8G A;  3BQZ A;  4UUT A;  3SFI A;  1JT6 A;  1AHD P;  5JLX A;  3JRD A;  2LTP A;  2HDD A;  2R93 J;  1ETK A;  3MKL A;  3RZD J;  2RAE A;  2LR8 A;  5EYR A;  5E3L A;  4A3L J;  3S1Q J;  1RET A;  2MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...