2R93J

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r93J00
1MH3A 5E3OA 2JJ7A 1HLVA 1IV6A 2X6OA 2NS8A 3FKIJ 5IOYA 5EF6A 5M5WJ 1IDYA 1JTXA 3LSJA 1FEXA 2CU7A 1MSEC 4XRSA 5JLWA 1ETQA 1OJLA 3JR9A 1ZKGA 1VNDA 3ZQHA 2ID6A 4M3GA 5F0FA 1ITYA 5C3EJ 2IEKA 3Q0VA 5EG0B 1IRZA 4LOCA 3A01B 3JREA 1DU0A 1UMQA 5E3LA 2VPRA 2E1OA 1O4XA 5IYCJ 3GTLJ 5FKNA 1FTTA 3L1PA 1E3OC 1JUSA 1B72B 4M3FA 2NS7A 4B3AA 2ME0A 2LFBA 3S16J 2DA4A 4FTHA 2JA8J 2X48A 2ZB9A 4BKXA 2XGDA 2M34A 2G0EA 2ID3A 3BQZA 1JKPC 1OCTC 4DW6A 1JKQC 3MKLA 4W1UA 4BXXJ 1RR7A 1VFCA 2RAEA 4AC0A 4XICA 5F08A 3HOUJ 1PUFB 2LLKA 4A3GJ 1JUMA 5FKOA 4DYRA 5C4JJ 2H1KA 1MBEA 3NARA 2YUSA 1R9TJ 3QPLA 1H88C 4IHXA 2W48A 1ETWA 3BR3A 5F27A 1T56A 5K7ZA 1U9NA 5FLMJ 1ENHA 2LVSA 3OOUA 3O8GA 1RESA 2ECBA 4MIMA 1YRNA 4A3IJ 4XRMA 1HCRA 3G1MA 1MBKA 3HGYA 1RKTA 2M9HA 3S17J 1P7JA 3Q0UA 4JX6A 4W97A 1ETVA 5FJ8J 2Y0SN 4MFEA 3BR1A 1Z0XA 4C3JJ 3M4OJ 2HXIA 2DN0A 3QPSA 3JRFA 3S1MJ 1HDDC 3DEWA 2DA5A 3CQZJ 1WCMJ 1I50J 2HQ5A 1BJZA 2PMZN 1JKOC 4Y7NJ 3BR6A 1BL0A 1WI3A 4M3BA 3BT9A 1ETYA 4DZPA 3S1QJ 4FE4A 3E7LA 1XS9A 1MBHA 3JRDA 3Q0WA 2HOTA 3HEFA 4QTRA 1F43A 3BG3A 2VUMJ 1MBGA 3HKZN 3MVPA 2L7ZA 2EH3A 5EZHA 1JTYA 3TW7A 4MFDA 3WHBA 3SDGA 1W0TA 1OFCX 2E2JJ 4V2GA 5IPAA 5E3MA 1U78A 1RPWA 1K61A 2NVQJ 1SFOJ 2L0KA 4V2FA 3ZQCA 2VKEA 3GTOJ 1HDPA 5HODA 2E2HJ 2DA2A 1AHDP 1LFBA 1FTZA 4C3IJ 5J1YA 3TP3A 2JA7J 3ZQGA 1ZTRA 2DA1A 1A6IA 1TWHJ 2XB5A 5J1RA 3G1LA 2DA7A 3BTLA 2K9QA 5EZGA 1RKWA 4UUSA 2OF7A 2DJNA 2WB1N 1TWCJ 1ZK8A 2XRLA 4D7NA 4IEJA 4JYKA 1MBJA 3GTJJ 2LTPA 2DMTA 2E2IJ 2ME6A 2MGQA 1G2HA 2QF7A 2JMWA 2L7FP 4FISA 1QVUA 3S1NJ 1ZR2A 1T33A 3BG5A 1HOMA 3D1NI 1TC3C 1GV5A 1RETA 4XRSG 1ORKA 3PM1A 2IBDA 4C2MJ 3GTMJ 3OSGA 2K9SA 4BBRJ 1YRNB 1U9OA 2ELKA 4AYBN 2IAIA 3IV5A 2DMNA 2O8KA 2DMQA 1NTCA 3F0CA 2MG4A 1BW6A 2EZLA 2LP0A 3TEDA 2CUFA 2FJ1A 5FLVA 4A69C 1TWGJ 3HOWJ 1X2NA 1Q1VA 5BNGA 5GPCA 3FK6A 2R0QC 5K7HA 1IUFA 2NVTJ 1JUPA 3S1RJ 1IGNA 5M3FJ 3GTKJ 1IC8A 2JWTA 1I6HJ 2CJJA 2XPUA 3DCFA 4UUTA 2EQRA 1AKHB 3TW6A 3PO2J 1NK3P 2R7ZJ 4BY7J 3HOYJ 2NVYJ 1POGA 2N8GA 2XPVA 2X9DA 3BG9A 3JRGA 2JA6J 4IHWA 2B63J 4A3KJ 2DMUA 2GLOA 3GTPJ 4ABZA 4RBOA 4BBSJ 2QCOA 4A3FJ 1TWFJ 4M3EA 1IDZA 3HOZJ 5E3NA 1AKHA 1WPKA 1I3QJ 1QPIA 2CQXA 2VKVA 4JP0A 5M5XJ 1Y1VJ 4A3JJ 3Q3SA 3K2AA 3BTJA 2AO9A 3TP0A 5IP9J 3RKQA 3WHCA 1ETXA 1S7EA 3W6VA 4NDLA 4GFBA 2K9NA 2DTZA 5EGOA 2XSDC 3B6AA 2NOGA 3BR2A 2XGEA 4M6VA 3JRCA 5J3LA 3JRHA 1SANA 5EYRA 1APLC 2R93J 2DMPA 2LD5A 4G12A 5GP9A 3ZQLA 2HI3A 4X6AJ 3LSGA 2D5VA 2KDZA 4L5EA 1D5YA 1B8IA 4UUSB 4CYCA 2HYJA 1HF0A 2L9RA 3G1OA 3S2DJ 1FIPA 2P81A 1JT6A 3ZOBA 2DA6A 5IYDJ 1JGGA 4FE7A 1QRYA 2EZHA 2WV1A 3CMYA 2O9LA 1VF9A 3HM5A 5K7FA 5M5YJ 1EF4A 3B6CA 3H3VK 4DYQA 3JRBA 2EBIA 3HOVJ 1Y1WJ 2R92J 2HXOA 2LK2A 5F0HA 1WGXA 1H89C 2MSYA 2MW8A 2YU9J 1WH7A 4DZJA 1GUUA 5FKKA 1UHSA 1X2MA 5FKMA 2VI6A 2Y9YA 2COBA 3IH2A 4X1EA 1ETOA 2R5YA 3OIOA 1ZGWA 2TCTA 3QQAA 3MN2A 1W0UA 1LE8A 1OCPA 3HGGA 3FK7A 3HBLA 2EZIA 2JK3A 1AU7A 4B1RA 3SFIA 3IH3A 4A3BJ 1GV2A 3A02A 4IHYA 4A93J 5C44J 2DA3A 1NK2P 1GDTA 3HDDA 9ANTA 4DYCA 2FD5A 3ZQFA 2Y9ZA 5IYBJ 4M3DA 2LY9A 2OPTA 1Z77A 3PO3J 3BTIA 2FQ4A 3OSFA 1IJWC 5EDNA 3C2BA 2Y30A 4MLOA 2M2EA 1H8AC 2HDDA 2HOSA 5F1JA 5JLXA 1JJ8C 1P7IA 3FISA 3BR5A 4RDUA 4D7MA 1ZR4A 3RQIA 5DS9A 1JJ6C 1IG7A 5EG0A 2Y31A 3HB9A 1LFUP 3A01A 4IHVA 4I6ZA 2ECCA 3K7AJ 4EEFG 3GBGA 2R5ZB 2Y2ZA 2E19A 1U8BA 1GT0C 3M3YJ 1B72A 1GVDA 1QVTA 3BTCA 4FCYA 4J19A 3BQYA 4XK4A 2KT0A 4JX5A 1MSFC 5FKLA 3CDLA 1WH5A 1DU6A 3I4NJ 4AUXA 3FIWA 3RZOJ 2GM4A 1PUFA 2M0CA 3A03A 5EGOB 2GBYA 4A3EJ 2R5ZA 3NAUA 2JA5J 3O8HA 4Y52J 2CQQA 2L7MP 2O7OA 2CRGA 1MBFA 4QSHA 4A3CJ 3GTGJ 1MNMC 3HOXJ 3JRAA 1BW5A 2M8GX 2H8RA 2K40A 4A3MJ 1B8IB 1FIAA 4CYCB 3VPRA 1CQTA 3CCYA 1JT0A 2XPWA 3LOCA 1X58A 2WAQN 1MH4A 3IH4A 3SJMA 4A3LJ 4MO7A 3LSRA 2XB0X 1XG1A 2AHQA 3S15J 1UG2A 2JN6A 3S2HJ 2LR8A 5J1UA 2I10A 3JRIA 3RZDJ 1JKRC 2XGCA 4D5CA 3UKGA 4JX4A 5M3MJ 3LSPA 2EZKA 3S14J 1K83J 4A3DJ 5C4XJ 1VI0A 5IOZA 5EEAA 4S0HB 5IP6A 2HOAA 5IP7J 4B4CA 4I76A 5F0CA 1FJLA 2R5YB 4C3HJ 1LE8B 1ETKA 1BA5A 2TRTA 4XIDA 5GPAA 5F04A 4QIWN 2YS9A 3ZQIA 3GTQJ 5DTDA 1A5JA 3LNQA 2FX0A 2CUEA 1TWAJ 3I4MJ 1ZQ3P 2NVXJ 4D5FA 3BR0A 2LKXA 4BY1J 3H0GJ 4HNVA 1F36A 1XC5A
chains in the Genus database with same CATH superfamily
1Z9CA 4XLHA 2HU9A 1HQCA 2KZGA 2ICWG 1JHFA 2JJ7A 4WXDA 1IV6A 1BI3A 1IAWA 2QEXI 2PG4A 2ACJA 2Z5UA 3GUDA 3H9GA 3P9IA 2CS3A 1JTXA 1YI2I 5HS9A 2ELHA 4XRSA 1CF7B 4UUVA 1ETQA 1S29A 3E6MA 1T95A 2ID6A 3ZQHA 1I6XA 4ASNA 2ISZA 2DO7A 1ITYA 1RZ4A 2IEKA 1VQPI 1HKTA 3LSTA 3CJNA 3A01B 1LEBA 1DU0A 3AG4H 2ELJA 2HFHA 3MD2A 1HBXG 2A05A 3K1MA 3U21A 3L1PA 3CCUI 1E3OC 1XMKA 2ZSIB 3K4JA 2ZSHB 4M3FA 1R71A 5LGNA 2CQ7A 2GA2A 3E6CC 2DA4A 1HSJA 1UAAA 3OY9A 3S16J 2F2EA 2BXZA 4BKXA 3QOEA 3TO9A 3BQZA 1JKPC 2AXLA 1OCTC 1Y0UA 4LIVA 5GAHJ 4NC6A 4BXXJ 4BJTA 1O3RA 2DFIA 4KT6A 4AC0A 4EJOA 5DUIA 5DM7F 4PJNA 3KX2A 2HVQA 1PUFB 4R1HA 2EFPA 2F5FA 1X1CA 3TOBA 3J80K 3OYKA 1YQAA 2E5NA 1JUMA 2VBXA 1FYLA 1WJ5A 3SZPA 1SMYF 3K4NA 3BP8A 5D4RA 2B9SA 1X3ZB 3M1EA 5A2QK 3DBLB 2W48A 2KIUA 3BPVA 2NVUB 2R7VA 1S7AA 5LRRA 3LL7A 3SZTA 1HW2A 3DTEA 1W5SA 2HR3A 3ABUA 3OOPA 5LHHA 1MMNA 4U7BA 1LDDA 4IRHA 2R7DA 2Q2EB 3OOUA 4O3MA 2CMPA 2OZUA 2ZJ2A 4OIQF 4A3IJ 2LC2A 4XRMA 4IHTA 1HCRA 1MBKA 3K6GA 2DFEA 1X1AA 2HYFA 3ZCOA 5ERIA 4IOAF 1P7JA 3DQVC 4W97A 3J81Z 2XKPA 2Q0OA 2OAZA 2LY2A 1XMXA 3BR1A 3KEOA 4U87A 4XSZF 5D6EA 2VL8A 2CV1A 3AG2H 3CC7I 2JVHA 2E7XA 2CQNA 2HQ5A 3RPQA 1BJZA 4ENKA 3VFZA 3CDHA 1N78A 3BG6A 4U0WA 1JKOC 5LGUA 3Q5FA 1B59A 3DKYA 3KYLA 3F23A 1G6NA 2B7EA 1SVOA 4XM3A 4GCVA 1R58A 4ZYGA 1MBHA 3JSPA 2NOJB 3Q0WA 2HOTA 1T6SA 1TW2A 2KJBA 1DGRM 1E3HA 2O3FA 3OWTA 2XSJC 4M9XA 2O61A 5BPIA 4M9SA 3WGHA 2A6HF 1P9QC 3C7JA 2EH3A 2R3SA 2EJRA 5CLSA 4ESBA 5EZHA 2G7HA 3SEZA 1OCZH 4F55A 1QZYA 1U5TA 2CW7A 4BYYA 2E2JJ 3FXOA 4V2GA 4ENJA 5IPAA 2K4BA 5E3MA 3J7YJ 1JXSA 1RPWA 4GYIA 1OMIA 3FHZA 1SFKA 2CYYA 4N4NB 1DPUA 3EUKL 4HDUA 3GW2A 2LMDA 4XOPA 2E2HJ 4A0ZA 1KQ0A 1J9IA 1LDKB 1OQYA 1HW1A 2ZXHA 4YIFA 1IRFA 2QBYB 1FTZA 5ICFA 1SEUA 2P5KA 2QKLB 3K4KA 2OC6A 5HNFA 2JA7J 2HWVA 5ILVA 3TDZC 2HPIA 4DIQA 1J7KA 4PJJA 2L01A 3BTLA 4A5MA 2WAQA 4L9NA 5CQEA 4B44A 3HSEA 3QPTA 2DJNA 2D1HA 1J0RA 4RGRA 2KDOA 5E8GA 4GGGA 4FETA 1IW7F 4D7NA 3GTJJ 2OBPA 2MGQA 2ADUA 2H6BA 2QF7A 2WY8Q 2FRHA 2WV0A 3MFKA 3H5AA 1ZRFA 4YIIA 1SC7A 3ASNH 2MBFA 3DPUA 4FISA 1S9HA 1USSA 5HS7A 3PNVA 1IXRC 1T33A 3BG5A 3MAJA 3HPGA 3ECOA 1K79A 3Q9SA 1ORKA 4C2MJ 3JAMZ 3PIPF 3KLNA 1MZBA 2ZXWH 1YFHA 1PP8F 1U9OA 1FP2A 2DK5A 1ZYRF 2DMQA 1E2XA 3F0CA 1VQKI 1S6LA 4YFXF 3JCUC 3FM5A 2NNYA 5HS8A 5D5WB 2FJ1A 1G8XA 3S32A 1LFPA 3ZPLA 3V7SA 1LB2A 3HYIA 1D1CA 2JQ7A 4Y4RA 1KGSA 5K7HA 2QGUA 3VEPA 1JUPA 5LRSA 4HX8A 3QODA 4ZYDA 4I98B 2RQPA 3FHNA 1R7JA 1X1PA 3J80Z 3TW6A 3GFLA 1OLTA 2R7ZJ 3HOYJ 2VQLA 1BOAA 3ERMA 3H35A 5A2QZ 3HOTA 3BG9A 4AIKA 3D5RC 4YRVA 2X51A 2D2WA 3O6BB 1KU3A 3GFMA 4RS8A 2GLOA 4HSRA 5LBQA 4JBAA 1JE8A 2QCOA 1TWFJ 3HOZJ 2ZNYA 5F1RA 1QPIA 2J5OA 3EQLF 1QBJA 1R00A 4A3JJ 3H9JA 5LGTA 4QPQA 2AO9A 1T2KA 6PAXA 3EUHC 5DV5A 3RKQA 1FP1D 3ZMDA 4CDGA 4NDLA 1W7PA 2MLGA 2L9SA 3IRRA 4GFBA 4IF4A 3BZKA 2LDUA 3DXJF 4MNUA 1APLC 3KYDB 5KK1A 2DMPA 3ZQLA 2HI3A 5HOOA 1UG0A 4LLNA 5JHFA 3CJQB 1D5YA 1B8IA 4A6DA 4CYCA 2HYJA 4CHUA 3HUGB 4L9VA 1FY7A 2P81A 3JSOA 4XN3A 2O8XA 3HHHA 1ZARA 2DA6A 2IS6A 3L2UA 4KYWA 4FE7A 2X6WA 3ZMUA 4KJZA 4CUGA 3CMYA 1XPXA 3EUAA 5J4VA 1XGOA 1YTYA 3EDPA 5KAFC 3JRBA 2VPLA 4BHCA 5B66C 2CWEA 3BOQA 2YU9J 4MTDA 1WH7A 3LWFA 5D5VB 2OUMA 3LSIA 3P9CA 1ONVA 2HS5A 3U2RA 2DI3A 4BS9A 3IH2A 3EPZA 2GXBA 2NS0A 3GCMA 3H3UA 2R5YA 1QU3A 2O0YA 3OIOA 3QU3A 2TCTA 4O5VA 2JPBA 4UV8A 1YOVB 4Y3OA 3EETA 2PJPA 3PNYA 1YHQI 2KJCA 4NQWA 2BGCA 1DUXC 1J75A 3HGGA 1S7OA 4DJAA 1PJRA 2VC1A 3I3LA 2EZIA 1TW3A 2JK3A 3FKJA 1TTYA 3QYBA 5EEHA 2HKOA 4ZYAA 3CCRI 3TDUC 2ZBKA 4I99C 5C44J 4XMYA 5JVTA 1BI0A 3HDDA 4Y15A 4DYCA 4LB5A 4M73A 2Y9ZA 1WSUA 3BTIA 2FQ4A 2V9PA 4GRIA 3IL2A 1RNLA 1R1TA 1FBSA 2M2EA 2LBFB 1IN5A 3W2AA 4G94A 1CF7A 4II2A 3RQ4A 2FF4A 4IVNA 4ZDPA 3OL4A 4JQFA 4ZTJA 1MGTA 4D7MA 2HGCA 3QPHA 4KITB 3A01A 4NNJA 4LLLA 4I6ZA 2ECCA 2JRTA 2E19A 4HA8A 3B02A 2L4MA 2PI0A 2DCEA 1IXCA 4HNTA 5CVVA 3CCQI 2VODA 4WXCA 3BQYA 5DCFA 3BWGA 5K5QA 3MZ8A 5DD8A 4XK4A 5E17F 2KT0A 1VZ0A 2LOOA 4KIGA 2A69F 4YELA 1UELB 5FKLA 3K70D 2F4IA 2JSCA 2QWWA 1WH5A 1DU6A 3A1YA 1PUFA 2M0CA 5EGOB 3NAUA 3C3WA 2JA5J 2M4KA 2RQQA 2O7OA 4YFNF 1B4AA 4QSHA 1ZRDA 3GTGJ 1OYWA 5GTHC 4EJVA 1VQLI 1SAUA 2M3AA 1I5ZA 4RA2A 4G6QA 4U7DA 3I56I 2XPWA 4LJZF 5LEJA 2DT5A 2L7KA 1W5CC 2AHQA 1ZLJA 3S2HJ 2LR8A 1R1UA 3JRIA 2DODA 2PFBA 1JKRC 2VONA 2C6YA 3RPUA 2W57A 1D1BA 4HF0A 3WTXC 3S3OA 4A3DJ 3F8FA 2DPDA 1VI0A 5EEAA 2WAFA 4S0HB 2GZWA 5IP6A 2HOAA 4P1WA 2DBBA 2KZVA 1KQ9A 3KZZA 4S05A 4M74A 2Y0SA 2V79A 4C3HJ 2DFHA 1L3LA 1V55H 2P5LC 1FMWA 1XMAA 1EH7A 2TRTA 3VOEA 1VQ4I 4XIDA 1VQ8I 5F04A 2L5QA 3B73A 4M6XA 2YS9A 3I4PA 3GTQJ 5DTDA 3KIOA 2W85A 3LNQA 1X1BA 4MEXF 3FXMA 4KUMA 3OYLA 1TWAJ 4N9HA 4XLFA 1ZQ3P 2QSHX 1WWXA 1G3TA 3BR0A 4EMSA 1T0FA 4KA4A 2VKHA 1XCBA 3K9TA 3TGNA 3WG9A 3CCJI 1YITI 3TO7A 4HQMA 1HLVA 2X6OA 3PQKA 3WTWC 2LKPA 2NS8A 5EF6A 3VODA 2EFWA 4HAMA 4OOIA 1MSEC 1OJLA 1YE9A 3M07A 1ZKGA 3BZ6A 2XV4S 5F0FA 1QO0D 2YSRA 3RYPA 3Q0VA 3V4GA 3JREA 1XSDA 3ZMSA 4TV7A 2DQRA 5E3LA 3CDIA 2E1OA 1O4XA 5IYCJ 2QBYA 3QP6A 2VC0A 2K4JA 5IT9K 4XKWA 1UZCA 1PP7U 3ZN1A 2V7FA 4HLYA 3SFZA 1YG2A 2LFBA 2ME0A 2KISA 3FM3A 1OCRH 2ZB9A 3J7AY 2EWNA 2XGDA 2M34A 2ID3A 4PFOA 4E4HA 2P7VB 4DW6A 1JKQC 3I9V2 1MIJA 5TJJA 1SD7A 3HZJA 2RAEA 3OYFA 5F08A 4RMNA 4I2OA 4B43A 5HDKA 3BJOA 1VQMI 1G3SA 1QHHD 2UXNA 3CC4I 4DYRA 2IA0A 5FFXA 3MKYB 2JRMA 2LREA 4AVPA 1MBEA 2DT6A 1XB4A 4WCGA 1H88C 2JT1A 1ETWA 5F27A 3OS0A 3CMEI 1DQUA 4XR6A 1E3PA 3I59B 2L2OA 1D8JA 4G6TB 4E7ZA 2W25A 3O8GA 4MIMA 3VSKA 5HDGA 4X0GA 5H2FC 2CO5A 3HGYA 2F5CA 4LGWA 1RKTA 3S17J 3VB2A 5FFZA 3WTUC 2M87A 3KLOA 2R7QA 3A0HC 3CP8A 3IKTA 3Q0UA 5FJ8J 1G3YA 2HQAA 2Y0SN 4NUBA 1FBUA 4AIJA 1ZELA 1NH3A 2VBWA 4ZZDA 2DA5A 3I53A 3H0DA 1WCMJ 3FXUA 3DLLF 3OIQA 2OA4A 3S3NA 2PMZN 2WA0A 4PSXA 3OMYA 2X1CA 3CUQC 4BACA 5BOXA 1USTA 3FXKA 4IRIA 3TL4X 3E7LA 2EA2A 1MMSA 3HEFA 4QTRA 3HXLA 5LHGA 3ULQB 3E1SA 3DBRB 1HXDA 2AS5F 4BUPA 4XSXF 1K6OA 2JPCA 1SAXA 2LKSA 3GF2A 2XGXA 1JTYA 1WRJA 2FMYA 4FT8A 4OIRF 3REOA 2XAJA 1VQ9I 1OFCX 3S93A 3E6BA 4L9TA 3TO6A 4E7LA 4JK1X 1YW7A 1K61A 4S04A 2LNBA 1XGMA 2VKEA 2BW3B 4DOZA 1HDPA 1Z3XA 5E1ZB 5K1YA 5HLGA 4R8HA 2H27A 2DA2A 1GXQA 3VYSB 2EB7A 1A04A 1QZZA 2QSFX 4C3IJ 1A6IA 1TWHJ 4C9YA 1J09A 2DA7A 2I8DA 3J7ZI 2K9QA 2IT0A 4L18B 2EIKH 2FBIA 2RNGA 3AFHA 2OF7A 1XN7A 3HUGA 4RB2C 2E5ZA 2XRLA 2PN6A 4IEJA 4JYKA 5CJ9A 2X1EA 2LRDA 2P0WA 1G2HA 2RREA 2JMWA 4LG0B 2KRHA 2Z3YA 3ECHA 3S2WA 3S1NJ 2NNNA 3QP5A 1Z7LA 2K9MA 2M4GA 1F1ZA 3PM1A 1VQNI 3OR2C 2KRCA 4LK1F 3GTMJ 4E7JA 1NG7A 3ABKH 4RAZA 1RIOH 4ANJA 1YRNB 4KICA 5KAIC 2IAIA 3IAS2 4PGGA 3IV5A 2W82A 3F3XA 1NTCA 5J8FA 3GVAA 1UB9A 4HOBA 3T0YA 1F9NA 2LP0A 3TEDA 4C2UA 4CCNA 1IN6A 4L5JA 1IRXA 4ZJZA 4UY8I 2VBZA 5IT9Z 1TP4A 2M45A 3S8PA 3CMMA 1RR8C 1X2NA 2COMA 1FOKA 1FOWA 3IKVA 2R0QC 2BHZA 5FGMA 3SEQA 1IUFA 2NVTJ 2QENA 4ESJA 5M3FJ 3LSHA 4A0XA 4LFUA 4EGZA 2BY2A 2CJJA 2VJ4A 2XPUA 3BG7A 2DQLA 2RNJA 3QAHA 4U88A 4E7IA 2EQRA 1AKHB 2IVMA 2LBFA 1L0OC 3PO2J 3DBHB 2VJ5A 2VN2A 4PSWA 1W1WE 2X4HA 2AXTC 2K02A 2XPVA 1FZPB 4PUSA 1XDUA 1EH6A 3F8MA 1XX5A 4ABZA 2CUJA 2ZJQF 5D6FA 2Q8KA 1R23A 4QLCU 3DEEA 2BV6A 5CVJA 5GAGJ 1WPKA 4A0YA 3G6EI 4O6JA 4XN0A 2OQRA 3KETA 3ZXSA 3MZYA 3TP0A 1WJFA 1P4WA 3RPUD 1ZAOA 4KMUX 2PX9A 5IP9J 3WGGA 3WTYC 3WHCA 5IT3A 1S7EA 1I1GA 1Y8RB 1YX3A 3W6VA 3I5UA 2Z9OA 3VDXA 2K9NA 5EGOA 1BBYA 2AQFA 5FRMA 1IN7A 2XSDC 2K3PA 2NOGA 3P7NA 2XAQA 2R93J 4ZYHA 1KU9A 1SANA 5EYRA 3HOSA 4IHSA 4Q48A 2LD5A 1FOYA 1S3JA 4G12A 4RGUA 5D4SA 2D5VA 2E35A 1WJDA 2XDVA 4Y13A 1K4SA 1HF0A 4XLPF 1WKMA 2L9RA 3G1OA 5BPDA 2HKXA 4EGYA 1JT6A 3KP7A 1OR7C 3ZOBA 3QOPA 5J47A 2A6EF 3DKXA 4G8XA 4HX4A 1NHAA 1Z6TA 4OAYA 3RDIA 1O7FA 2WV1A 3OS2A 3OR1C 1VF9A 5L3FA 2A6TA 2IGOA 1SVLA 2VB6A 3HOVJ 1Y1WJ 2HXOA 4NC7A 3ABLH 2LK2A 5F0HA 3F22A 2MSYA 1RUNA 2BZTA 2QA4I 4DZJA 2OJED 1JHHA 3FMRA 2M5WA 2V9KA 1UHSA 2BY3A 2VI6A 2Y9YA 4X1EA 3IHUA 4EJUA 5ICGA 3BCBA 2VOOA 1W0UA 1LKXA 3ZP5A 3G2BA 4KT5C 1XGSA 3E0JB 4IL6C 1OISA 4IQJA 4ON0A 2W84A 1MDMB 2XF6A 4XKVA 1B6AA 1OCPA 2F5EA 3MMYB 1LPQA 5E20A 2CV0A 2G9WA 3UR3C 1AU7A 4I01A 3IH3A 4A3BJ 1IO2A 2LSOA 3HTSB 4M71A 4MEYF 5JR3A 2CH0A 3GZNB 1ZGJA 4IHYA 3BJAA 5DCMB 3PSFA 1FX7A 1NK2P 1GDTA 3AG3H 2FD5A 4M3DA 2LY9A 1Z77A 2TDXA 3PO3J 1Z91A 1IJWC 2UV1A 2ISYA 4HLXA 5D8KB 1BC7C 4BNCA 4WF2A 2Y30A 3A2KA 2DDAA 1H8AC 3E6DA 5JLXA 1S5LC 3ERED 4BL0B 2EV0A 2KMUA 2ZFWA 1S72I 1A35A 1UJ8A 1JJ6C 2V1UA 2NXNB 2VQCA 2JUGA 3GFJA 2Y31A 2ZKZA 4I09A 2R5ZB 1GT0C 2Y2ZA 1U8BA 1EKEA 1QVTA 4BE0A 3R6SA 1P4XA 3VYRB 5HLTA 4KISA 3LFKA 1D3YA 4M72A 4DBRA 1Z7UA 1T39A 4CO8A 1MMGA 3F21A 3ELKA 5ILUA 1BIAA 4UHTA 1MSFC 2BBYA 3PUFA 4B48A 3A4CA 3CDLA 4UXNA 1FOXA 2CQKA 4XL9A 5J4YA 3AAFA 4XLCA 4A3EJ 2DJIA 2QVOA 2EV5A 3KP6A 1IRGA 2PLYA 1YLFA 1MJ9A 3ZMVA 3G4SI 2X0LA 3WG7H 2CQQA 3OYGA 4BHPA 1H0MA 3HOXJ 2OCEA 2ZXIA 4QWQA 4CA0A 2H8RA 4I0BA 2OCCH 3VPRA 2ZFUA 3CCYA 3ZMTA 3GFIA 3I59A 3CCSI 2XAUA 3LOCA 1LNWA 1K7AA 1X58A 3N4MA 3FMQA 5DDGA 2VLAA 2OQGA 2WAQN 4OMZA 3IH4A 3IRQA 4A3LJ 2HYGD 3M1CA 3HPHA 1G3WA 4G6DA 3CCVI 3S15J 1UG2A 2JN6A 2RDPA 3PSIA 2FQ3A 3ZQ7A 5J1UA 2I10A 2ZO4A 5F6FA 3CLQA 3DKWA 2XGCA 3OIPA 5M3MJ 2EK5A 3LSPA 1HKQA 4IZZA 4C2TA 3FZVA 2CW8A 1R49A 1FYMA 3S14J 1TNSA 3CMAI 5IP7J 4B4CA 4I76A 1HA8A 3T8TA 5J6XA 3HHGA 1T08B 2MYSA 1ETKA 1BA5A 5GPAA 3D0SA 1RI7A 3L2QA 3ZQIA 5BMZA 1B1BA 1F4KA 3BZCA 4AWXB 4UNOA 2VT2A 3KCCA 3ZMZA 2LKXA 2LG4A 2V26A 3H0GJ 3E3VA 3M8EA 4D1QA 3K10A 3PFYA 1F36A 2ZMEC 1MH3A 5E3OA 2RVCA 1P4AA 4E6KG 4BEHB 3FKIJ 2J5PA 4HV6A 3U9GA 5FB2A 1I1SA 2XROA 3U1DA 1IDYA 3HKZA 3LSJA 4CSWA 5JLWA 3RKXA 3JR9A 1ZH5A 2WADA 3CO7C 4F7ZA 1R36A 3W6JB 4HG2A 4BAYA 2BW3A 1IRZA 5FO5A 3K1NA 1FMVA 3CO6C 1UMQA 2VPRA 4IJAA 3H1CA 4Q47A 3OYIA 2FU4A 3QU6A 4B3AA 2PBIA 3L2CA 1EH8A 2V6CA 3FBIB 3ONQA 1LVAA 2F5VA 2G0EA 2UUZA 3CD6I 4IOCF 2DYSH 4F52A 1RR7A 1VFCA 1O3SA 2JZYA 3ZQQA 5ILSA 1FBQA 3HOUJ 5TRDA 2LLKA 2IA1A 1A6QA 1BR4A 1MJAA 2KL4A 1K78B 1X19A 2F4OB 4RLQA 5C4JJ 5E1WA 4LG0A 2H1KA 2STWA 2OTJI 4YG2F 1R9TJ 4D0PA 4IHXA 3DPLC 2DDBA 5J8CA 3BR3A 5L3EA 4PGHA 4E7SA 3I55I 3R61A 5FLMJ 1ENHA 2LVSA 4FX4A 1YRNA 5KNLA 2ZNZA 3OS1A 1Z3YA 2MFZA 3IAM2 4IXAA 2D1VA 1WJBA 5CVRA 1X1DA 3I54A 3L9FA 4AYBA 2FA5A 3Q9VA 5BQTA 2W7NA 4MFEA 3WTZA 1BI1A 2HXIA 2DN0A 3GYHX 3JRFA 3S1MJ 1HDDC 4XLEA 3C1DA 2RGVA 3DEWA 3CQZJ 2E1CA 2Q2EA 3H9QA 4MQVA 1OCCH 2AQEA 2CW0F 5TISC 3TQNA 3WU2C 1Y56A 3BR6A 4OU0A 4ZDLA 4M3BA 4IKFA 1UCRA 1IUYA 1ETYA 1R1VA 1ZN2A 3W2VA 4AD9A 2R4GA 3K70C 1GLNA 1TBXA 4FE4A 1XS9A 3KEQA 2UXXA 4II3A 1F43A 4XORA 1YS7A 4ZZLA 1WVRA 3ZRGA 5L3CA 5HVQC 1QHGA 4MQ9F 1N75A 3H36A 4A2UA 1J2XA 3HKZN 3IC7A 3V7CA 4UB6C 2IXSA 2WAEA 3GWZA 3I0TA 4MFDA 3MKZA 1W0TA 2BEOA 1U2WA 5HLHA 2IW5A 4PJ0C 3JW4A 4HPQA 1YX5A 2DT7B 1V5EA 3T8RA 3L2VA 1U78A 3F6VA 3OYCA 1SFOJ 1V54H 2VXDA 4V2FA 2R7XA 2FMLA 4ZYEA 4HRIA 3GTOJ 3LA3A 1BR1A 4ZH4F 1J5YA 4H4KC 4OAZA 4P9UA 2L3DA 1XSXA 2F5DA 2JTVA 1AHDP 3BLYA 1PYVA 1ZG5A 5J1YA 3ZQGA 3HL2A 1ZTRA 2DA1A 3QYEA 1U5TC 2EIMH 2XB5A 1DGWY 2DW4A 3G1LA 4K2EA 4JOMA 2A5YB 5E79C 4CYDA 5LFAA 4PZJA 1N77A 5EZGA 3CP2A 2HVSA 1XGNA 1R5GA 2VJIA 3DTIA 4RGXA 1V3FA 3WE3A 1TWCJ 5CYVA 3UNGC 2KRFA 1MBJA 3GMEA 2E2IJ 2ME6A 3FF5A 1SFXA 2CFOA 3H5NA 1FLIA 2L7FP 2YU3A 3L2RA 5H6RA 2IPQX 4YEJA 2CFXA 1HOMA 2KIQA 3KP3A 4H0EA 1TC3C 3CJTB 1GV5A 1R5ID 1RETA 1LUJB 2V9VA 2LF7A 4P55A 1H9GA 3RSNA 3HSRA 1BIBA 2IBDA 1ZGAA 2BE5F 3KP4A 3TKYA 2VQGA 2DOFA 3ESWB 1MMAA 4WWCA 5GAEJ 2ELKA 4AYBN 2ZC2A 2O8KA 2DTRA 3HRMA 5AIPA 1SMTA 1P2FA 2MG4A 2A68F 3CUQB 2EZLA 1MDMA 2V1XA 5B3SH 1ZREA 2YX7A 2OTLI 2I5UA 5FLVA 2FOWA 1Q1HA 2X1DA 4A69C 1TWGJ 4YIRX 2K86A 4L0YB 3S3MA 4XKCA 1IXSB 3PUBA 3U1KA 3FDYA 3HOWJ 2QQBA 3IUOA 2XAHA 2BYVE 1Q1VA 3HTUA 2DAOA 1EV7A 5BNGA 1XD7A 2K9LA 5DCMA 4ZTFA 1XCVA 4RGSA 3SQNA 3OYBA 2BOLA 2FBHA 1IGNA 5B1AH 3S1RJ 2DU9A 3PIOF 3GTKJ 2ZJPF 2K3FA 2JWTA 1IC8A 4I02A 3ABTA 3FMSA 1GXPA 5GTIC 3DCFA 3ZR8X 2O03A 3F72A 2CSOA 3QWLA 4UVCA 1JGSA 2K7LA 4UV9A 4AVZA 2P8TA 2X85A 2E1MC 1A31A 4E7KA 4CZZA 2X6YA 3L09A 3ISPA 2X9DA 3EUHA 4LIUA 3JRGA 3NQOA 2JA6J 1Z05A 5B1BH 1YIJI 3H92A 2VE9A 2B63J 4A3KJ 5JI6A 3DEUA 2DMUA 5LLQA 1W7PD 1E0EA 3GTPJ 4RBOA 4OMYA 1I39A 3O2PE 4LITA 4M3EA 3LQQA 1IDZA 5E3NA 5CVUA 1HC8A 3K4CA 2IS2A 2CQXA 2VKVA 1TNTA 1Y1VJ 5AIQA 4V19K 3K2AA 3BTJA 2FEZA 2V1NA 2WTEA 1X3WB 3LA2A 2DTZA 1MD0A 4J00A 4GDFA 4KDPA 1WFXA 2ESNA 1KU7A 3H3ZA 4N9IA 4NHJA 2V1DA 2HVRA 2XGEA 4M6VA 3NRVA 3JRHA 3I64A 5GP9A 3COAC 3LSGA 1PUEE 2E1NA 4GXOA 2HDWA 1YS6A 4L5EA 4UUSB 5DD4A 3MZHA 3S2DJ 4OIPF 1U0JA 2KKOA 1UHWA 2XF5A 3RKWA 4BDYA 5IYDJ 1JGGA 2DFFA 2ZJRF 2GOXB 1QRYA 4KN7X 4UVBA 1EJ9A 4EM1A 2O9LA 5K7FA 2EFOA 3GLLA 3B6CA 4I7HA 4Q4ZF 1OKRA 2BY1A 1WGXA 1H89C 4ETSA 4P9FA 3W2WA 2H94A 3G3ZA 3SDBA 5J40A 1X2MA 5FKMA 1V5FA 2COBA 3NWTA 2BVLA 4LG3A 1ETOA 3RKYA 2QQAA 3QQAA 1OYIA 3MN2A 1M1EB 2VBYA 3D5SC 4E70A 2W1OA 3LMMA 2M0MA 4EQQA 3JAMK 3HBLA 2QUFA 3V8KA 1WJEA 5K5OA 5ICEA 1FSHA 2JUCA 1JI8A 1GV2A 3E5XA 4BQOA 3AL0C 4CCLA 2HTSA 3PNTA 4KFCA 4EVIA 3OYMA 3KFWX 2DA3A 3SHFA 3R60A 5FROA 4CCOA 4XOTA 1S8NA 3HIFA 5IYBJ 1SVMA 4BEHA 3QRFF 3OSFA 2LYCA 2K5CA 3C2BA 2A61A 2D45A 4U0VA 4MLOA 2M1BA 2HOSA 1JJ8C 2DK8A 1QZEA 3FISA 3PL8A 4OIOF 3OYHA 2K27A 3TMOA 4BJ5C 1YYVA 4AM3A 1IG7A 2VJJA 2ETHA 3VYUB 1VQOI 1Z67A 1LFUP 3WGIA 3L7WA 1W5TA 1YO5C 1Z1DA 4EEFG 3GBGA 1AWCA 4OWRB 3N97A 2R7TA 1TQPA 1IN8A 1GVDA 3BTCA 4FCYA 3N05A 4IRGA 2GQQA 4L0ZB 2EFNA 3HSFA 5LEKA 1B9NA 2W00A 5GADJ 2PMUA 4JX5A 2P6TA 3MKWB 3CF2A 4KIBA 3GX4X 3LFUA 3ZGKA 2CV2A 3I4NJ 3DU6A 4NBQA 1B9MA 2RC4A 2GBYA 3A03A 3RI4A 4RB1A 2KHMA 2MC3A 3GZ5A 1D8KA 1K78A 2Z1DA 4KN4X 3CTAA 1BJAA 1BI2A 1I3AA 1MJBA 2E36A 4A3CJ 3CC2I 3HC7A 1MNMC 4XONA 3JRAA 4AIDA 1BW5A 3HRSA 2K40A 4A3MJ 3ABMH 1FIAA 2EINH 4EJTA 3R4KA 1CQTA 2HTJA 3KP5A 4FASD 4G7HF 4CGZA 1X4OA 3HJEA 4IPAA 2QLZA 5LD2C 4BQAA 4F92B 1P92A 3SJMA 4XNFA 1CGPA 1U6GA 2XB0X 4HNUA 1XG1A 1TQMA 1T38A 3RTRA 1SD6A 2BVMA 4B8XA 2XUBA 2MC4A 4RAFA 3RZDJ 4RAGA 2XVCA 4PJMA 5IOZA 1BOBA 4NC8A 3T5XA 3CCEI 5F0CA 1FJLA 2WC2A 1FNNA 1Z21A 3FXRA 1LE8B 1OCOH 4C30A 4BGDA 2PMHA 2JA2A 4LB6B 1Y39A 2P4WA 2CUZA 4XRFA 3KE2A 4HBLA 4MTEA 3P5JA 1DP7P 1E17A 3L00A 4EM2A 3TOAA 1I27A 1TT5B 3I4MJ 2Z99A 3FXQA 2NVXJ 4D5FA 2WY7Q 2H1LA 2NRAC 4BY1J 2KP6A 4XKBA 2KIFA 4B3XA 3DV8A 4ENMA 3SZGA 1XC5A 1LJ9A 2L54A 3M9AA 3F6OA 3MQ0A 3I71A 2Y0MA 5CPRB 5EJCA 4G7ZF 1LQ1A 2G7UA 4PCQA 1FT9A 5KHDA 2PJRB 2FUG2 5IOYA 3K4LA 5M5WJ 1FEXA 2QM3A 2CU7A 3MEXA 2HZTA 5K5RA 1KU2A 1VNDA 1WI9A 2DLLA 3EYIA 4M3GA 3FBNB 1T0FC 1YW8A 4CCJA 5C3EJ 5EG0B 3K69A 2M30A 4LOCA 2QQ8A 4P96A 4DGWB 3GTLJ 4LLGF 5FKNA 3GLXA 4Z2YA 1FTTA 4BXFA 5L3DA 2IS4A 1JUSA 1B72B 3E5QA 2NS7A 2IA2A 4HZFA 4FTHA 2JA8J 2X48A 2E34A 2F4MB 5FLXK 2HDCA 2V4JC 4BU2A 1DP3A 1KONA 3M8FA 5DEQA 3MKLA 1TT0A 1O57A 3OL3A 1MNEA 4W1UA 2UWMA 1STZA 4WXHA 1R5HA 2DOAA 4XICA 2F48A 3KZYA 4CH7A 2WWYA 4A3GJ 1ACIA 1MW7A 2CG4A 5FKOA 3O3KA 1ZLKA 1BR2A 2HZDA 1ZG1A 3NARA 2WB1A 3GO5A 1XSVA 5TGTA 2YUSA 2EFQA 3WE2A 3QPLA 4RM2A 1T56A 5K7ZA 4GO1A 3F8BA 2ZCWA 4HEA2 1U9NA 5L3GA 3BY6A 3GEZA 1ZG3A 4RAYA 1RESA 2ECBA 1V4RA 4LK0F 3K2ZA 1FPQA 4MGRA 5ED4A 1SFUA 4BJ6C 2R7UA 3KEYA 3G1MA 1HKSA 2HQRA 1U3EM 2VOPA 2KFDA 3CUQA 2M9HA 3I58A 4HYEA 3C2HA 4KMFA 5E8IA 1AOYA 3BPXA 3H5RA 4JX6A 1ETVA 3GZ6A 1H9TA 1HW5A 3ASOH 3ML6A 5H20A 1Z0XA 4ITVA 4C3JJ 2KIMA 2PQ8A 3M4OJ 3QPSA 5JVGF 2R7OA 4LD5A 2WBMA 1I50J 3T1BA 4WK8F 3ZN0A 3J7AO 5EEGA 2XHKA 1D5VA 2KQRA 2IS1A 2ZMEB 3C18A 4Y7NJ 1BL0A 1WI3A 2VIXA 3LSMA 3BT9A 2OU2A 4DZPA 2Y48A 3FWEA 3V8LA 2MA3A 2QYOA 3S1QJ 3K1PA 1NG6A 3E5UA 2HEOA 2FNAA 3JRDA 3L2WA 3M7GA 3G71I 2VXZA 3BG3A 4M9ZA 2VUMJ 1MBGA 1TLHB 2QKMB 4BQQA 3MVPA 1YW9A 2L4AA 2L7ZA 2Z33A 2HPMA 2O6GE 5FD5A 3WODF 4Z6YA 1A36A 4PJLA 1LVKA 2E71A 3DF8A 4KNYA 4XQFA 3TW7A 3WHBA 1IF1A 1WJAA 3SDGA 1REPC 3OYDA 3SYTA 1SFEA 1TL8A 1QGPA 2XAGA 2BY0A 1X4PA 1W4MA 2DXIA 4EV0A 5AONA 4DNCA 2NVQJ 1R4NB 2IJLA 1RUOA 2FOKA 1Y0NA 2IGKA 2EV6A 2L0KA 2NAZA 3R0AA 3WU0A 3ZQCA 1G59A 2EILH 3QYFA 4XLNF 2YPRA 5HODA 1FWZA 2XF7A 2M7BA 1LFBA 4BQNA 3OYJA 3LAPA 3F9KA 3TP3A 2Z16A 4BH9A 2H6CA 2MD0A 2STTA 5J1RA 5LHIA 5CVIA 4HV5A 1MKMA 4F91B 4IO9F 4N4OB 1RKWA 4UUSA 4DBQA 2WB1N 1ZK8A 2R7WA 2RN7A 2YX4A 1Y6IA 1DDNA 3A0BC 1OYYA 1D0ZA 1V5GA 2EIJH 2LTPA 1GVJA 2DMTA 4P5OA 2Y69H 3SXYA 1KZHA 4CXFA 1BC8C 1QVUA 2XASA 3WU1B 1ZR2A 2FSWA 3ROUA 1KYZA 1R6RA 3D1NI 4LMYA 2GIZA 2HNHA 4RLFA 5H6QA 4XRSG 4FX0A 5KCMA 3BJ6A 3OSGA 2K9SA 4BBRJ 2XKOA 1LEAA 2LH9A 4G9YA 4Y33A 1SD4A 2DMNA 2DOEA 4UB8C 2B0LA 3NEUA 4HQEA 1BW6A 2FNPA 3CZ6A 3WTTC 4HDVA 1K4TA 2VASA 1C0WA 1D0XA 3MWMA 3V42A 2LY1A 1QQIA 2CUFA 2YR2A 3HRTA 2XAFA 2ZXJA 2VT3A 2OV7A 2H8WA 1RC9A 5FLXZ 5JHUA 3AKZA 5GPCA 2W24A 3FK6A 4HW0A 3X2QH 3LSKA 1W36D 2FE3A 1KYWA 5BS6A 2IRFG 1I6HJ 3NWSA 4UUTA 3VWBA 3DWLE 1VQ6I 3V8JA 1IZ1A 5B5EC 1NK3P 4Q5SF 4BY7J 1YJNI 2Z2SB 2MD5A 1J59A 2IGMA 2R7FA 3WTVC 2NVYJ 1VQ7I 1POGA 2N8GA 3CF5F 4IHWA 1Z6RA 3W3CA 4BE1A 3R0JA 4IQ4A 3JTGA 4B47A 4F3QA 3KPHA 4CZCA 3OYNA 1IN4A 4BHBA 1N25A 2F6CA 3D5LA 4AU7A 4BBSJ 2Q1ZB 4A3FJ 5F64A 3DFGA 2IP2A 1AKHA 1U5TB 1I3QJ 4M6YA 1R22A 2R7RA 4JP0A 5M5XJ 3Q3SA 1ZRCA 1ERDA 4HF1A 2QQ9A 2E7WA 4B09A 4UVAA 1ETXA 3DTKA 5DYMA 1W36C 3JTHA 4ENNA 3CLOA 1OR7A 1P6RA 1PDNC 4HSTA 3CCMI 1OPCA 4BDZA 2R7SA 1QA6A 3B6AA 2L9VA 2OZ6A 4RM3A 3BR2A 3OYAA 3F8CA 3JRCA 5J3LA 4FQGA 3FXJA 2GOMA 4A12A 1FYKA 5D5XB 4X6AJ 3BC8A 3PFIA 2E60A 2KDZA 1G4DA 3E97A 5FRNA 1KQ8A 3F8NA 4FHTA 1FIPA 1O7LA 4BE2A 3DU5A 4RB3C 2GIVA 2UZKA 4YFKF 1DPRA 4CICA 3C2GA 3OYEA 1Y8QB 2EZHA 3HM5A 2KLOA 5M5YJ 1EF4A 1D0YA 2OD5A 4L9JA 3H3VK 4DYQA 1FSEA 2EBIA 2XRNA 3HRUA 2R92J 2VQHA 2PMZA 1VQ5I 2MW8A 3CUOA 2P5VA 1GUUA 3CJRB 5FKKA 4A6EA 4E7HA 3AG1H 3V7RA 3KP2A 2NYXA 2DYRH 5E1XA 1ZGWA 2FBKA 2W4SA 1LE8A 4ESFA 1YJ9I 5L3BA 2GWRA 5CKTA 2LF8A 2A3SA 2EPFA 3K0LA 2QSGX 1YJWI 3LQRA 3RIRA 3WTSC 1YIOA 1RRJA 4AIHA 3FK7A 3EYYA 3GXOA 4B1RA 4J01A 3SFIA 2E1MB 3BROA 4IX7A 2KPMA 2H09A 3A02A 2MH9A 1EA3A 4A93J 1GHCA 4F93B 1ULYA 3KYCB 2HOEA 3KZIC 3OV8A 4PFPA 4EM0B 3FX3A 4R79A 9ANTA 5HLIA 4EATA 3ZQFA 2PJRA 1XTAA 2OPTA 1QPMA 1AA7A 1MNDA 5EDNA 3LA7A 3P9KA 2RV8A 2HDDA 5F1JA 2GA1A 5D5UB 1P7IA 2VKDA 4Y17A 5ICCA 2HQNA 1WQ2A 2MH2A 1SD5A 3RCOA 5HNHA 3BR5A 4WX9A 1PVEA 5E18F 4RDUA 3DP7A 1XDSA 2IGNA 1ZR4A 2VE8A 3RQIA 1F5TA 5DS9A 5CQGA 5EG0A 3FXLA 3HB9A 5FD6A 1WHUA 4IHVA 2MLKA 1ODDA 3K7AJ 2QZ8A 3J81K 4XBFA 3IWFA 1D1AA 3K4MA 4L5IA 4D9JA 1B72A 2V6EA 3M3YJ 4J19A 2M8EA 2CGPA 2RKHA 1HSTA 4CCKA 3BDDA 2FXAA 4KIFA 5IY5H 2ESHA 1T8IA 5HDNA 3LAJA 1TZLA 4CCMA 3DPTA 2A5WA 3K4BA 5JFRA 4OINF 2XC7A 4AUXA 3FIWA 1W7PB 3RZOJ 3G73A 3CESA 2GM4A 4G7OF 2R5ZA 3O8HA 4HX7A 4Y52J 1UFMA 2BXYA 2L02A 3W6KB 2L7MP 3RJPA 2CRGA 1MBFA 1WZ2A 1R4MB 2O5RA 3IWZA 2P7CB 1X3UA 2M8GX 2P6SA 1T98A 1B8IB 3MCZA 4CYCB 4I0AA 4ZDOA 2M7AA 4BXUA 1LDJA 3M8JA 4PDKA 1JT0A 2PEXA 1QNTA 3VYTB 4ZC3A 4RB0A 2DPUA 3IP4B 1MH4A 1KA8A 4MO7A 3LSRA 1U8RA 1FC3A 1VTNC 1UHMA 2Y75A 2X6XA 3VSLA 4N0BA 4MHGA 1ON2A 1K6YA 4QPOA 2EA4A 4D5CA 4DQ2A 1ON1A 2BHYA 4JX4A 2K85A 4GYGA 4XLAA 3RYRA 3UKGA 2EZKA 3BCAA 1K83J 1WJCA 5C4XJ 3CCLI 3AL0B 4EJWA 1IV8A 4PK4A 2R5YB 1MMDA 1O3QA 2ZMEA 4A5NA 1ZHFA 4HF2A 2JVGA 5DUKA 4QIWN 4NQWB 2GXGA 2GXAA 2MABA 2XIGA 5KVRA 1BM9A 3HG9A 1A5JA 2FX0A 2CUEA 3PQJA 1O3TA 2JSPA 5DM6F 2A07F 3TBIA 2GAUA 1TQIA 3DLAA 4NB5A 5D8LB 4U0YA 1BN5A 2L9NA 4HNVA 3PJRA
chains in the Genus database with same CATH topology
1MH3A 5E3OA 2JJ7A 1HLVA 1IV6A 2X6OA 2NS8A 3FKIJ 5IOYA 5EF6A 5M5WJ 1IDYA 1JTXA 3LSJA 1FEXA 2CU7A 1MSEC 4XRSA 5JLWA 1ETQA 1OJLA 3JR9A 1ZKGA 1VNDA 3ZQHA 2ID6A 4M3GA 5F0FA 1ITYA 5C3EJ 2IEKA 3Q0VA 5EG0B 1IRZA 4LOCA 3A01B 3JREA 1DU0A 1UMQA 5E3LA 2VPRA 2E1OA 1O4XA 5IYCJ 3GTLJ 5FKNA 1FTTA 3L1PA 1E3OC 1JUSA 1B72B 4M3FA 2NS7A 4B3AA 2ME0A 2LFBA 3S16J 2DA4A 4FTHA 2JA8J 2X48A 2ZB9A 4BKXA 2XGDA 2M34A 2G0EA 2ID3A 3BQZA 1JKPC 1OCTC 4DW6A 1JKQC 3MKLA 4W1UA 4BXXJ 1RR7A 1VFCA 2RAEA 4AC0A 4XICA 5F08A 3HOUJ 1PUFB 2LLKA 4A3GJ 1JUMA 5FKOA 4DYRA 5C4JJ 2H1KA 1MBEA 3NARA 2YUSA 1R9TJ 3QPLA 1H88C 4IHXA 2W48A 1ETWA 3BR3A 5F27A 1T56A 5K7ZA 1U9NA 5FLMJ 1ENHA 2LVSA 3OOUA 3O8GA 1RESA 2ECBA 4MIMA 1YRNA 4A3IJ 4XRMA 1HCRA 3G1MA 1MBKA 3HGYA 1RKTA 2M9HA 3S17J 1P7JA 3Q0UA 4JX6A 4W97A 1ETVA 5FJ8J 2Y0SN 4MFEA 3BR1A 1Z0XA 4C3JJ 3M4OJ 2HXIA 2DN0A 3QPSA 3JRFA 3S1MJ 1HDDC 3DEWA 2DA5A 3CQZJ 1WCMJ 1I50J 2HQ5A 1BJZA 2PMZN 1JKOC 4Y7NJ 3BR6A 1BL0A 1WI3A 4M3BA 3BT9A 1ETYA 4DZPA 3S1QJ 4FE4A 3E7LA 1XS9A 1MBHA 3JRDA 3Q0WA 2HOTA 3HEFA 4QTRA 1F43A 3BG3A 2VUMJ 1MBGA 3HKZN 3MVPA 2L7ZA 2EH3A 5EZHA 1JTYA 3TW7A 4MFDA 3WHBA 3SDGA 1W0TA 1OFCX 2E2JJ 4V2GA 5IPAA 5E3MA 1U78A 1RPWA 1K61A 2NVQJ 1SFOJ 2L0KA 4V2FA 3ZQCA 2VKEA 3GTOJ 1HDPA 5HODA 2E2HJ 2DA2A 1AHDP 1LFBA 1FTZA 4C3IJ 5J1YA 3TP3A 2JA7J 3ZQGA 1ZTRA 2DA1A 1A6IA 1TWHJ 2XB5A 5J1RA 3G1LA 2DA7A 3BTLA 2K9QA 5EZGA 1RKWA 4UUSA 2OF7A 2DJNA 2WB1N 1TWCJ 1ZK8A 2XRLA 4D7NA 4IEJA 4JYKA 1MBJA 3GTJJ 2LTPA 2DMTA 2E2IJ 2ME6A 2MGQA 1G2HA 2QF7A 2JMWA 2L7FP 4FISA 1QVUA 3S1NJ 1ZR2A 1T33A 3BG5A 1HOMA 3D1NI 1TC3C 1GV5A 1RETA 4XRSG 1ORKA 3PM1A 2IBDA 4C2MJ 3GTMJ 3OSGA 2K9SA 4BBRJ 1YRNB 1U9OA 2ELKA 4AYBN 2IAIA 3IV5A 2DMNA 2O8KA 2DMQA 1NTCA 3F0CA 2MG4A 1BW6A 2EZLA 2LP0A 3TEDA 2CUFA 2FJ1A 5FLVA 4A69C 1TWGJ 3HOWJ 1X2NA 1Q1VA 5BNGA 5GPCA 3FK6A 2R0QC 5K7HA 1IUFA 2NVTJ 1JUPA 3S1RJ 1IGNA 5M3FJ 3GTKJ 1IC8A 2JWTA 1I6HJ 2CJJA 2XPUA 3DCFA 4UUTA 2EQRA 1AKHB 3TW6A 3PO2J 1NK3P 2R7ZJ 4BY7J 3HOYJ 2NVYJ 1POGA 2N8GA 2XPVA 2X9DA 3BG9A 3JRGA 2JA6J 4IHWA 2B63J 4A3KJ 2DMUA 2GLOA 3GTPJ 4ABZA 4RBOA 4BBSJ 2QCOA 4A3FJ 1TWFJ 4M3EA 1IDZA 3HOZJ 5E3NA 1AKHA 1WPKA 1I3QJ 1QPIA 2CQXA 2VKVA 4JP0A 5M5XJ 1Y1VJ 4A3JJ 3Q3SA 3K2AA 3BTJA 2AO9A 3TP0A 5IP9J 3RKQA 3WHCA 1ETXA 1S7EA 3W6VA 4NDLA 4GFBA 2K9NA 2DTZA 5EGOA 2XSDC 3B6AA 2NOGA 3BR2A 2XGEA 4M6VA 3JRCA 5J3LA 3JRHA 1SANA 5EYRA 1APLC 2R93J 2DMPA 2LD5A 4G12A 5GP9A 3ZQLA 2HI3A 4X6AJ 3LSGA 2D5VA 2KDZA 4L5EA 1D5YA 1B8IA 4UUSB 4CYCA 2HYJA 1HF0A 2L9RA 3G1OA 3S2DJ 1FIPA 2P81A 1JT6A 3ZOBA 2DA6A 5IYDJ 1JGGA 4FE7A 1QRYA 2EZHA 2WV1A 3CMYA 2O9LA 1VF9A 3HM5A 5K7FA 5M5YJ 1EF4A 3B6CA 3H3VK 4DYQA 3JRBA 2EBIA 3HOVJ 1Y1WJ 2R92J 2HXOA 2LK2A 5F0HA 1WGXA 1H89C 2MSYA 2MW8A 2YU9J 1WH7A 4DZJA 1GUUA 5FKKA 1UHSA 1X2MA 5FKMA 2VI6A 2Y9YA 2COBA 3IH2A 4X1EA 1ETOA 2R5YA 3OIOA 1ZGWA 2TCTA 3QQAA 3MN2A 1W0UA 1LE8A 1OCPA 3HGGA 3FK7A 3HBLA 2EZIA 2JK3A 1AU7A 4B1RA 3SFIA 3IH3A 4A3BJ 1GV2A 3A02A 4IHYA 4A93J 5C44J 2DA3A 1NK2P 1GDTA 3HDDA 9ANTA 4DYCA 2FD5A 3ZQFA 2Y9ZA 5IYBJ 4M3DA 2LY9A 2OPTA 1Z77A 3PO3J 3BTIA 2FQ4A 3OSFA 1IJWC 5EDNA 3C2BA 2Y30A 4MLOA 2M2EA 1H8AC 2HDDA 2HOSA 5F1JA 5JLXA 1JJ8C 1P7IA 3FISA 3BR5A 4RDUA 4D7MA 1ZR4A 3RQIA 5DS9A 1JJ6C 1IG7A 5EG0A 2Y31A 3HB9A 1LFUP 3A01A 4IHVA 4I6ZA 2ECCA 3K7AJ 4EEFG 3GBGA 2R5ZB 2Y2ZA 2E19A 1U8BA 1GT0C 3M3YJ 1B72A 1GVDA 1QVTA 3BTCA 4FCYA 4J19A 3BQYA 4XK4A 2KT0A 4JX5A 1MSFC 5FKLA 3CDLA 1WH5A 1DU6A 3I4NJ 4AUXA 3FIWA 3RZOJ 2GM4A 1PUFA 2M0CA 3A03A 5EGOB 2GBYA 4A3EJ 2R5ZA 3NAUA 2JA5J 3O8HA 4Y52J 2CQQA 2L7MP 2O7OA 2CRGA 1MBFA 4QSHA 4A3CJ 3GTGJ 1MNMC 3HOXJ 3JRAA 1BW5A 2M8GX 2H8RA 2K40A 4A3MJ 1B8IB 1FIAA 4CYCB 3VPRA 1CQTA 3CCYA 1JT0A 2XPWA 3LOCA 1X58A 2WAQN 1MH4A 3IH4A 3SJMA 4A3LJ 4MO7A 3LSRA 2XB0X 1XG1A 2AHQA 3S15J 1UG2A 2JN6A 3S2HJ 2LR8A 5J1UA 2I10A 3JRIA 3RZDJ 1JKRC 2XGCA 4D5CA 3UKGA 4JX4A 5M3MJ 3LSPA 2EZKA 3S14J 1K83J 4A3DJ 5C4XJ 1VI0A 5IOZA 5EEAA 4S0HB 5IP6A 2HOAA 5IP7J 4B4CA 4I76A 5F0CA 1FJLA 2R5YB 4C3HJ 1LE8B 1ETKA 1BA5A 2TRTA 4XIDA 5GPAA 5F04A 4QIWN 2YS9A 3ZQIA 3GTQJ 5DTDA 1A5JA 3LNQA 2FX0A 2CUEA 1TWAJ 3I4MJ 1ZQ3P 2NVXJ 4D5FA 3BR0A 2LKXA 4BY1J 3H0GJ 4HNVA 1F36A 1XC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH3 A;  5E3O A;  2JJ7 A;  1HLV A;  1IV6 A;  2X6O A;  2NS8 A;  3FKI J;  5IOY A;  5EF6 A;  5M5W J;  1IDY A;  1JTX A;  3LSJ A;  1FEX A;  2CU7 A;  1MSE C;  4XRS A;  5JLW A;  1ETQ A;  1OJL A;  3JR9 A;  1ZKG A;  1VND A;  3ZQH A;  2ID6 A;  4M3G A;  5F0F A;  1ITY A;  5C3E J;  2IEK A;  3Q0V A;  5EG0 B;  1IRZ A;  4LOC A;  3A01 B;  3JRE A;  1DU0 A;  1UMQ A;  5E3L A;  2VPR A;  2E1O A;  1O4X A;  5IYC J;  3GTL J;  5FKN A;  1FTT A;  3L1P A;  1E3O C;  1JUS A;  1B72 B;  4M3F A;  2NS7 A;  4B3A A;  2ME0 A;  2LFB A;  3S16 J;  2DA4 A;  4FTH A;  2JA8 J;  2X48 A;  2ZB9 A;  4BKX A;  2XGD A;  2M34 A;  2G0E A;  2ID3 A;  3BQZ A;  1JKP C;  1OCT C;  4DW6 A;  1JKQ C;  3MKL A;  4W1U A;  4BXX J;  1RR7 A;  1VFC A;  2RAE A;  4AC0 A;  4XIC A;  5F08 A;  3HOU J;  1PUF B;  2LLK A;  4A3G J;  1JUM A;  5FKO A;  4DYR A;  5C4J J;  2H1K A;  1MBE A;  3NAR A;  2YUS A;  1R9T J;  3QPL A;  1H88 C;  4IHX A;  2W48 A;  1ETW A;  3BR3 A;  5F27 A;  1T56 A;  5K7Z A;  1U9N A;  5FLM J;  1ENH A;  2LVS A;  3OOU A;  3O8G A;  1RES A;  2ECB A;  4MIM A;  1YRN A;  4A3I J;  4XRM A;  1HCR A;  3G1M A;  1MBK A;  3HGY A;  1RKT A;  2M9H A;  3S17 J;  1P7J A;  3Q0U A;  4JX6 A;  4W97 A;  1ETV A;  5FJ8 J;  2Y0S N;  4MFE A;  3BR1 A;  1Z0X A;  4C3J J;  3M4O J;  2HXI A;  2DN0 A;  3QPS A;  3JRF A;  3S1M J;  1HDD C;  3DEW A;  2DA5 A;  3CQZ J;  1WCM J;  1I50 J;  2HQ5 A;  1BJZ A;  2PMZ N;  1JKO C;  4Y7N J;  3BR6 A;  1BL0 A;  1WI3 A;  4M3B A;  3BT9 A;  1ETY A;  4DZP A;  3S1Q J;  4FE4 A;  3E7L A;  1XS9 A;  1MBH A;  3JRD A;  3Q0W A;  2HOT A;  3HEF A;  4QTR A;  1F43 A;  3BG3 A;  2VUM J;  1MBG A;  3HKZ N;  3MVP A;  2L7Z A;  2EH3 A;  5EZH A;  1JTY A;  3TW7 A;  4MFD A;  3WHB A;  3SDG A;  1W0T A;  1OFC X;  2E2J J;  4V2G A;  5IPA A;  5E3M A;  1U78 A;  1RPW A;  1K61 A;  2NVQ J;  1SFO J;  2L0K A;  4V2F A;  3ZQC A;  2VKE A;  3GTO J;  1HDP A;  5HOD A;  2E2H J;  2DA2 A;  1AHD P;  1LFB A;  1FTZ A;  4C3I J;  5J1Y A;  3TP3 A;  2JA7 J;  3ZQG A;  1ZTR A;  2DA1 A;  1A6I A;  1TWH J;  2XB5 A;  5J1R A;  3G1L A;  2DA7 A;  3BTL A;  2K9Q A;  5EZG A;  1RKW A;  4UUS A;  2OF7 A;  2DJN A;  2WB1 N;  1TWC J;  1ZK8 A;  2XRL A;  4D7N A;  4IEJ A;  4JYK A;  1MBJ A;  3GTJ J;  2LTP A;  2DMT A;  2E2I J;  2ME6 A;  2MGQ A;  1G2H A;  2QF7 A;  2JMW A;  2L7F P;  4FIS A;  1QVU A;  3S1N J;  1ZR2 A;  1T33 A;  3BG5 A;  1HOM A;  3D1N I;  1TC3 C;  1GV5 A;  1RET A;  4XRS G;  1ORK A;  3PM1 A;  2IBD A;  4C2M J;  3GTM J;  3OSG A;  2K9S A;  4BBR J;  1YRN B;  1U9O A;  2ELK A;  4AYB N;  2IAI A;  3IV5 A;  2DMN A;  2O8K A;  2DMQ A;  1NTC A;  3F0C A;  2MG4 A;  1BW6 A;  2EZL A;  2LP0 A;  3TED A;  2CUF A;  2FJ1 A;  5FLV A;  4A69 C;  1TWG J;  3HOW J;  1X2N A;  1Q1V A;  5BNG A;  5GPC A;  3FK6 A;  2R0Q C;  5K7H A;  1IUF A;  2NVT J;  1JUP A;  3S1R J;  1IGN A;  5M3F J;  3GTK J;  1IC8 A;  2JWT A;  1I6H J;  2CJJ A;  2XPU A;  3DCF A;  4UUT A;  2EQR A;  1AKH B;  3TW6 A;  3PO2 J;  1NK3 P;  2R7Z J;  4BY7 J;  3HOY J;  2NVY J;  1POG A;  2N8G A;  2XPV A;  2X9D A;  3BG9 A;  3JRG A;  2JA6 J;  4IHW A;  2B63 J;  4A3K J;  2DMU A;  2GLO A;  3GTP J;  4ABZ A;  4RBO A;  4BBS J;  2QCO A;  4A3F J;  1TWF J;  4M3E A;  1IDZ A;  3HOZ J;  5E3N A;  1AKH A;  1WPK A;  1I3Q J;  1QPI A;  2CQX A;  2VKV A;  4JP0 A;  5M5X J;  1Y1V J;  4A3J J;  3Q3S A;  3K2A A;  3BTJ A;  2AO9 A;  3TP0 A;  5IP9 J;  3RKQ A;  3WHC A;  1ETX A;  1S7E A;  3W6V A;  4NDL A;  4GFB A;  2K9N A;  2DTZ A;  5EGO A;  2XSD C;  3B6A A;  2NOG A;  3BR2 A;  2XGE A;  4M6V A;  3JRC A;  5J3L A;  3JRH A;  1SAN A;  5EYR A;  1APL C;  2R93 J;  2DMP A;  2LD5 A;  4G12 A;  5GP9 A;  3ZQL A;  2HI3 A;  4X6A J;  3LSG A;  2D5V A;  2KDZ A;  4L5E A;  1D5Y A;  1B8I A;  4UUS B;  4CYC A;  2HYJ A;  1HF0 A;  2L9R A;  3G1O A;  3S2D J;  1FIP A;  2P81 A;  1JT6 A;  3ZOB A;  2DA6 A;  5IYD J;  1JGG A;  4FE7 A;  1QRY A;  2EZH A;  2WV1 A;  3CMY A;  2O9L A;  1VF9 A;  3HM5 A;  5K7F A;  5M5Y J;  1EF4 A;  3B6C A;  3H3V K;  4DYQ A;  3JRB A;  2EBI A;  3HOV J;  1Y1W J;  2R92 J;  2HXO A;  2LK2 A;  5F0H A;  1WGX A;  1H89 C;  2MSY A;  2MW8 A;  2YU9 J;  1WH7 A;  4DZJ A;  1GUU A;  5FKK A;  1UHS A;  1X2M A;  5FKM A;  2VI6 A;  2Y9Y A;  2COB A;  3IH2 A;  4X1E A;  1ETO A;  2R5Y A;  3OIO A;  1ZGW A;  2TCT A;  3QQA A;  3MN2 A;  1W0U A;  1LE8 A;  1OCP A;  3HGG A;  3FK7 A;  3HBL A;  2EZI A;  2JK3 A;  1AU7 A;  4B1R A;  3SFI A;  3IH3 A;  4A3B J;  1GV2 A;  3A02 A;  4IHY A;  4A93 J;  5C44 J;  2DA3 A;  1NK2 P;  1GDT A;  3HDD A;  9ANT A;  4DYC A;  2FD5 A;  3ZQF A;  2Y9Z A;  5IYB J;  4M3D A;  2LY9 A;  2OPT A;  1Z77 A;  3PO3 J;  3BTI A;  2FQ4 A;  3OSF A;  1IJW C;  5EDN A;  3C2B A;  2Y30 A;  4MLO A;  2M2E A;  1H8A C;  2HDD A;  2HOS A;  5F1J A;  5JLX A;  1JJ8 C;  1P7I A;  3FIS A;  3BR5 A;  4RDU A;  4D7M A;  1ZR4 A;  3RQI A;  5DS9 A;  1JJ6 C;  1IG7 A;  5EG0 A;  2Y31 A;  3HB9 A;  1LFU P;  3A01 A;  4IHV A;  4I6Z A;  2ECC A;  3K7A J;  4EEF G;  3GBG A;  2R5Z B;  2Y2Z A;  2E19 A;  1U8B A;  1GT0 C;  3M3Y J;  1B72 A;  1GVD A;  1QVT A;  3BTC A;  4FCY A;  4J19 A;  3BQY A;  4XK4 A;  2KT0 A;  4JX5 A;  1MSF C;  5FKL A;  3CDL A;  1WH5 A;  1DU6 A;  3I4N J;  4AUX A;  3FIW A;  3RZO J;  2GM4 A;  1PUF A;  2M0C A;  3A03 A;  5EGO B;  2GBY A;  4A3E J;  2R5Z A;  3NAU A;  2JA5 J;  3O8H A;  4Y52 J;  2CQQ A;  2L7M P;  2O7O A;  2CRG A;  1MBF A;  4QSH A;  4A3C J;  3GTG J;  1MNM C;  3HOX J;  3JRA A;  1BW5 A;  2M8G X;  2H8R A;  2K40 A;  4A3M J;  1B8I B;  1FIA A;  4CYC B;  3VPR A;  1CQT A;  3CCY A;  1JT0 A;  2XPW A;  3LOC A;  1X58 A;  2WAQ N;  1MH4 A;  3IH4 A;  3SJM A;  4A3L J;  4MO7 A;  3LSR A;  2XB0 X;  1XG1 A;  2AHQ A;  3S15 J;  1UG2 A;  2JN6 A;  3S2H J;  2LR8 A;  5J1U A;  2I10 A;  3JRI A;  3RZD J;  1JKR C;  2XGC A;  4D5C A;  3UKG A;  4JX4 A;  5M3M J;  3LSP A;  2EZK A;  3S14 J;  1K83 J;  4A3D J;  5C4X J;  1VI0 A;  5IOZ A;  5EEA A;  4S0H B;  5IP6 A;  2HOA A;  5IP7 J;  4B4C A;  4I76 A;  5F0C A;  1FJL A;  2R5Y B;  4C3H J;  1LE8 B;  1ETK A;  1BA5 A;  2TRT A;  4XID A;  5GPA A;  5F04 A;  4QIW N;  2YS9 A;  3ZQI A;  3GTQ J;  5DTD A;  1A5J A;  3LNQ A;  2FX0 A;  2CUE A;  1TWA J;  3I4M J;  1ZQ3 P;  2NVX J;  4D5F A;  3BR0 A;  2LKX A;  4BY1 J;  3H0G J;  4HNV A;  1F36 A;  1XC5 A; 
#chains in the Genus database with same CATH topology
 1Z9C A;  4XLH A;  2HU9 A;  1HQC A;  2KZG A;  2ICW G;  1JHF A;  2JJ7 A;  4WXD A;  1IV6 A;  1BI3 A;  1IAW A;  2QEX I;  2PG4 A;  2ACJ A;  2Z5U A;  3GUD A;  3H9G A;  3P9I A;  2CS3 A;  1JTX A;  1YI2 I;  5HS9 A;  2ELH A;  4XRS A;  1CF7 B;  4UUV A;  1ETQ A;  1S29 A;  3E6M A;  1T95 A;  2ID6 A;  3ZQH A;  1I6X A;  4ASN A;  2ISZ A;  2DO7 A;  1ITY A;  1RZ4 A;  2IEK A;  1VQP I;  1HKT A;  3LST A;  3CJN A;  3A01 B;  1LEB A;  1DU0 A;  3AG4 H;  2ELJ A;  2HFH A;  3MD2 A;  1HBX G;  2A05 A;  3K1M A;  3U21 A;  3L1P A;  3CCU I;  1E3O C;  1XMK A;  2ZSI B;  3K4J A;  2ZSH B;  4M3F A;  1R71 A;  5LGN A;  2CQ7 A;  2GA2 A;  3E6C C;  2DA4 A;  1HSJ A;  1UAA A;  3OY9 A;  3S16 J;  2F2E A;  2BXZ A;  4BKX A;  3QOE A;  3TO9 A;  3BQZ A;  1JKP C;  2AXL A;  1OCT C;  1Y0U A;  4LIV A;  5GAH J;  4NC6 A;  4BXX J;  4BJT A;  1O3R A;  2DFI A;  4KT6 A;  4AC0 A;  4EJO A;  5DUI A;  5DM7 F;  4PJN A;  3KX2 A;  2HVQ A;  1PUF B;  4R1H A;  2EFP A;  2F5F A;  1X1C A;  3TOB A;  3J80 K;  3OYK A;  1YQA A;  2E5N A;  1JUM A;  2VBX A;  1FYL A;  1WJ5 A;  3SZP A;  1SMY F;  3K4N A;  3BP8 A;  5D4R A;  2B9S A;  1X3Z B;  3M1E A;  5A2Q K;  3DBL B;  2W48 A;  2KIU A;  3BPV A;  2NVU B;  2R7V A;  1S7A A;  5LRR A;  3LL7 A;  3SZT A;  1HW2 A;  3DTE A;  1W5S A;  2HR3 A;  3ABU A;  3OOP A;  5LHH A;  1MMN A;  4U7B A;  1LDD A;  4IRH A;  2R7D A;  2Q2E B;  3OOU A;  4O3M A;  2CMP A;  2OZU A;  2ZJ2 A;  4OIQ F;  4A3I J;  2LC2 A;  4XRM A;  4IHT A;  1HCR A;  1MBK A;  3K6G A;  2DFE A;  1X1A A;  2HYF A;  3ZCO A;  5ERI A;  4IOA F;  1P7J A;  3DQV C;  4W97 A;  3J81 Z;  2XKP A;  2Q0O A;  2OAZ A;  2LY2 A;  1XMX A;  3BR1 A;  3KEO A;  4U87 A;  4XSZ F;  5D6E A;  2VL8 A;  2CV1 A;  3AG2 H;  3CC7 I;  2JVH A;  2E7X A;  2CQN A;  2HQ5 A;  3RPQ A;  1BJZ A;  4ENK A;  3VFZ A;  3CDH A;  1N78 A;  3BG6 A;  4U0W A;  1JKO C;  5LGU A;  3Q5F A;  1B59 A;  3DKY A;  3KYL A;  3F23 A;  1G6N A;  2B7E A;  1SVO A;  4XM3 A;  4GCV A;  1R58 A;  4ZYG A;  1MBH A;  3JSP A;  2NOJ B;  3Q0W A;  2HOT A;  1T6S A;  1TW2 A;  2KJB A;  1DGR M;  1E3H A;  2O3F A;  3OWT A;  2XSJ C;  4M9X A;  2O61 A;  5BPI A;  4M9S A;  3WGH A;  2A6H F;  1P9Q C;  3C7J A;  2EH3 A;  2R3S A;  2EJR A;  5CLS A;  4ESB A;  5EZH A;  2G7H A;  3SEZ A;  1OCZ H;  4F55 A;  1QZY A;  1U5T A;  2CW7 A;  4BYY A;  2E2J J;  3FXO A;  4V2G A;  4ENJ A;  5IPA A;  2K4B A;  5E3M A;  3J7Y J;  1JXS A;  1RPW A;  4GYI A;  1OMI A;  3FHZ A;  1SFK A;  2CYY A;  4N4N B;  1DPU A;  3EUK L;  4HDU A;  3GW2 A;  2LMD A;  4XOP A;  2E2H J;  4A0Z A;  1KQ0 A;  1J9I A;  1LDK B;  1OQY A;  1HW1 A;  2ZXH A;  4YIF A;  1IRF A;  2QBY B;  1FTZ A;  5ICF A;  1SEU A;  2P5K A;  2QKL B;  3K4K A;  2OC6 A;  5HNF A;  2JA7 J;  2HWV A;  5ILV A;  3TDZ C;  2HPI A;  4DIQ A;  1J7K A;  4PJJ A;  2L01 A;  3BTL A;  4A5M A;  2WAQ A;  4L9N A;  5CQE A;  4B44 A;  3HSE A;  3QPT A;  2DJN A;  2D1H A;  1J0R A;  4RGR A;  2KDO A;  5E8G A;  4GGG A;  4FET A;  1IW7 F;  4D7N A;  3GTJ J;  2OBP A;  2MGQ A;  2ADU A;  2H6B A;  2QF7 A;  2WY8 Q;  2FRH A;  2WV0 A;  3MFK A;  3H5A A;  1ZRF A;  4YII A;  1SC7 A;  3ASN H;  2MBF A;  3DPU A;  4FIS A;  1S9H A;  1USS A;  5HS7 A;  3PNV A;  1IXR C;  1T33 A;  3BG5 A;  3MAJ A;  3HPG A;  3ECO A;  1K79 A;  3Q9S A;  1ORK A;  4C2M J;  3JAM Z;  3PIP F;  3KLN A;  1MZB A;  2ZXW H;  1YFH A;  1PP8 F;  1U9O A;  1FP2 A;  2DK5 A;  1ZYR F;  2DMQ A;  1E2X A;  3F0C A;  1VQK I;  1S6L A;  4YFX F;  3JCU C;  3FM5 A;  2NNY A;  5HS8 A;  5D5W B;  2FJ1 A;  1G8X A;  3S32 A;  1LFP A;  3ZPL A;  3V7S A;  1LB2 A;  3HYI A;  1D1C A;  2JQ7 A;  4Y4R A;  1KGS A;  5K7H A;  2QGU A;  3VEP A;  1JUP A;  5LRS A;  4HX8 A;  3QOD A;  4ZYD A;  4I98 B;  2RQP A;  3FHN A;  1R7J A;  1X1P A;  3J80 Z;  3TW6 A;  3GFL A;  1OLT A;  2R7Z J;  3HOY J;  2VQL A;  1BOA A;  3ERM A;  3H35 A;  5A2Q Z;  3HOT A;  3BG9 A;  4AIK A;  3D5R C;  4YRV A;  2X51 A;  2D2W A;  3O6B B;  1KU3 A;  3GFM A;  4RS8 A;  2GLO A;  4HSR A;  5LBQ A;  4JBA A;  1JE8 A;  2QCO A;  1TWF J;  3HOZ J;  2ZNY A;  5F1R A;  1QPI A;  2J5O A;  3EQL F;  1QBJ A;  1R00 A;  4A3J J;  3H9J A;  5LGT A;  4QPQ A;  2AO9 A;  1T2K A;  6PAX A;  3EUH C;  5DV5 A;  3RKQ A;  1FP1 D;  3ZMD A;  4CDG A;  4NDL A;  1W7P A;  2MLG A;  2L9S A;  3IRR A;  4GFB A;  4IF4 A;  3BZK A;  2LDU A;  3DXJ F;  4MNU A;  1APL C;  3KYD B;  5KK1 A;  2DMP A;  3ZQL A;  2HI3 A;  5HOO A;  1UG0 A;  4LLN A;  5JHF A;  3CJQ B;  1D5Y A;  1B8I A;  4A6D A;  4CYC A;  2HYJ A;  4CHU A;  3HUG B;  4L9V A;  1FY7 A;  2P81 A;  3JSO A;  4XN3 A;  2O8X A;  3HHH A;  1ZAR A;  2DA6 A;  2IS6 A;  3L2U A;  4KYW A;  4FE7 A;  2X6W A;  3ZMU A;  4KJZ A;  4CUG A;  3CMY A;  1XPX A;  3EUA A;  5J4V A;  1XGO A;  1YTY A;  3EDP A;  5KAF C;  3JRB A;  2VPL A;  4BHC A;  5B66 C;  2CWE A;  3BOQ A;  2YU9 J;  4MTD A;  1WH7 A;  3LWF A;  5D5V B;  2OUM A;  3LSI A;  3P9C A;  1ONV A;  2HS5 A;  3U2R A;  2DI3 A;  4BS9 A;  3IH2 A;  3EPZ A;  2GXB A;  2NS0 A;  3GCM A;  3H3U A;  2R5Y A;  1QU3 A;  2O0Y A;  3OIO A;  3QU3 A;  2TCT A;  4O5V A;  2JPB A;  4UV8 A;  1YOV B;  4Y3O A;  3EET A;  2PJP A;  3PNY A;  1YHQ I;  2KJC A;  4NQW A;  2BGC A;  1DUX C;  1J75 A;  3HGG A;  1S7O A;  4DJA A;  1PJR A;  2VC1 A;  3I3L A;  2EZI A;  1TW3 A;  2JK3 A;  3FKJ A;  1TTY A;  3QYB A;  5EEH A;  2HKO A;  4ZYA A;  3CCR I;  3TDU C;  2ZBK A;  4I99 C;  5C44 J;  4XMY A;  5JVT A;  1BI0 A;  3HDD A;  4Y15 A;  4DYC A;  4LB5 A;  4M73 A;  2Y9Z A;  1WSU A;  3BTI A;  2FQ4 A;  2V9P A;  4GRI A;  3IL2 A;  1RNL A;  1R1T A;  1FBS A;  2M2E A;  2LBF B;  1IN5 A;  3W2A A;  4G94 A;  1CF7 A;  4II2 A;  3RQ4 A;  2FF4 A;  4IVN A;  4ZDP A;  3OL4 A;  4JQF A;  4ZTJ A;  1MGT A;  4D7M A;  2HGC A;  3QPH A;  4KIT B;  3A01 A;  4NNJ A;  4LLL A;  4I6Z A;  2ECC A;  2JRT A;  2E19 A;  4HA8 A;  3B02 A;  2L4M A;  2PI0 A;  2DCE A;  1IXC A;  4HNT A;  5CVV A;  3CCQ I;  2VOD A;  4WXC A;  3BQY A;  5DCF A;  3BWG A;  5K5Q A;  3MZ8 A;  5DD8 A;  4XK4 A;  5E17 F;  2KT0 A;  1VZ0 A;  2LOO A;  4KIG A;  2A69 F;  4YEL A;  1UEL B;  5FKL A;  3K70 D;  2F4I A;  2JSC A;  2QWW A;  1WH5 A;  1DU6 A;  3A1Y A;  1PUF A;  2M0C A;  5EGO B;  3NAU A;  3C3W A;  2JA5 J;  2M4K A;  2RQQ A;  2O7O A;  4YFN F;  1B4A A;  4QSH A;  1ZRD A;  3GTG J;  1OYW A;  5GTH C;  4EJV A;  1VQL I;  1SAU A;  2M3A A;  1I5Z A;  4RA2 A;  4G6Q A;  4U7D A;  3I56 I;  2XPW A;  4LJZ F;  5LEJ A;  2DT5 A;  2L7K A;  1W5C C;  2AHQ A;  1ZLJ A;  3S2H J;  2LR8 A;  1R1U A;  3JRI A;  2DOD A;  2PFB A;  1JKR C;  2VON A;  2C6Y A;  3RPU A;  2W57 A;  1D1B A;  4HF0 A;  3WTX C;  3S3O A;  4A3D J;  3F8F A;  2DPD A;  1VI0 A;  5EEA A;  2WAF A;  4S0H B;  2GZW A;  5IP6 A;  2HOA A;  4P1W A;  2DBB A;  2KZV A;  1KQ9 A;  3KZZ A;  4S05 A;  4M74 A;  2Y0S A;  2V79 A;  4C3H J;  2DFH A;  1L3L A;  1V55 H;  2P5L C;  1FMW A;  1XMA A;  1EH7 A;  2TRT A;  3VOE A;  1VQ4 I;  4XID A;  1VQ8 I;  5F04 A;  2L5Q A;  3B73 A;  4M6X A;  2YS9 A;  3I4P A;  3GTQ J;  5DTD A;  3KIO A;  2W85 A;  3LNQ A;  1X1B A;  4MEX F;  3FXM A;  4KUM A;  3OYL A;  1TWA J;  4N9H A;  4XLF A;  1ZQ3 P;  2QSH X;  1WWX A;  1G3T A;  3BR0 A;  4EMS A;  1T0F A;  4KA4 A;  2VKH A;  1XCB A;  3K9T A;  3TGN A;  3WG9 A;  3CCJ I;  1YIT I;  3TO7 A;  4HQM A;  1HLV A;  2X6O A;  3PQK A;  3WTW C;  2LKP A;  2NS8 A;  5EF6 A;  3VOD A;  2EFW A;  4HAM A;  4OOI A;  1MSE C;  1OJL A;  1YE9 A;  3M07 A;  1ZKG A;  3BZ6 A;  2XV4 S;  5F0F A;  1QO0 D;  2YSR A;  3RYP A;  3Q0V A;  3V4G A;  3JRE A;  1XSD A;  3ZMS A;  4TV7 A;  2DQR A;  5E3L A;  3CDI A;  2E1O A;  1O4X A;  5IYC J;  2QBY A;  3QP6 A;  2VC0 A;  2K4J A;  5IT9 K;  4XKW A;  1UZC A;  1PP7 U;  3ZN1 A;  2V7F A;  4HLY A;  3SFZ A;  1YG2 A;  2LFB A;  2ME0 A;  2KIS A;  3FM3 A;  1OCR H;  2ZB9 A;  3J7A Y;  2EWN A;  2XGD A;  2M34 A;  2ID3 A;  4PFO A;  4E4H A;  2P7V B;  4DW6 A;  1JKQ C;  3I9V 2;  1MIJ A;  5TJJ A;  1SD7 A;  3HZJ A;  2RAE A;  3OYF A;  5F08 A;  4RMN A;  4I2O A;  4B43 A;  5HDK A;  3BJO A;  1VQM I;  1G3S A;  1QHH D;  2UXN A;  3CC4 I;  4DYR A;  2IA0 A;  5FFX A;  3MKY B;  2JRM A;  2LRE A;  4AVP A;  1MBE A;  2DT6 A;  1XB4 A;  4WCG A;  1H88 C;  2JT1 A;  1ETW A;  5F27 A;  3OS0 A;  3CME I;  1DQU A;  4XR6 A;  1E3P A;  3I59 B;  2L2O A;  1D8J A;  4G6T B;  4E7Z A;  2W25 A;  3O8G A;  4MIM A;  3VSK A;  5HDG A;  4X0G A;  5H2F C;  2CO5 A;  3HGY A;  2F5C A;  4LGW A;  1RKT A;  3S17 J;  3VB2 A;  5FFZ A;  3WTU C;  2M87 A;  3KLO A;  2R7Q A;  3A0H C;  3CP8 A;  3IKT A;  3Q0U A;  5FJ8 J;  1G3Y A;  2HQA A;  2Y0S N;  4NUB A;  1FBU A;  4AIJ A;  1ZEL A;  1NH3 A;  2VBW A;  4ZZD A;  2DA5 A;  3I53 A;  3H0D A;  1WCM J;  3FXU A;  3DLL F;  3OIQ A;  2OA4 A;  3S3N A;  2PMZ N;  2WA0 A;  4PSX A;  3OMY A;  2X1C A;  3CUQ C;  4BAC A;  5BOX A;  1UST A;  3FXK A;  4IRI A;  3TL4 X;  3E7L A;  2EA2 A;  1MMS A;  3HEF A;  4QTR A;  3HXL A;  5LHG A;  3ULQ B;  3E1S A;  3DBR B;  1HXD A;  2AS5 F;  4BUP A;  4XSX F;  1K6O A;  2JPC A;  1SAX A;  2LKS A;  3GF2 A;  2XGX A;  1JTY A;  1WRJ A;  2FMY A;  4FT8 A;  4OIR F;  3REO A;  2XAJ A;  1VQ9 I;  1OFC X;  3S93 A;  3E6B A;  4L9T A;  3TO6 A;  4E7L A;  4JK1 X;  1YW7 A;  1K61 A;  4S04 A;  2LNB A;  1XGM A;  2VKE A;  2BW3 B;  4DOZ A;  1HDP A;  1Z3X A;  5E1Z B;  5K1Y A;  5HLG A;  4R8H A;  2H27 A;  2DA2 A;  1GXQ A;  3VYS B;  2EB7 A;  1A04 A;  1QZZ A;  2QSF X;  4C3I J;  1A6I A;  1TWH J;  4C9Y A;  1J09 A;  2DA7 A;  2I8D A;  3J7Z I;  2K9Q A;  2IT0 A;  4L18 B;  2EIK H;  2FBI A;  2RNG A;  3AFH A;  2OF7 A;  1XN7 A;  3HUG A;  4RB2 C;  2E5Z A;  2XRL A;  2PN6 A;  4IEJ A;  4JYK A;  5CJ9 A;  2X1E A;  2LRD A;  2P0W A;  1G2H A;  2RRE A;  2JMW A;  4LG0 B;  2KRH A;  2Z3Y A;  3ECH A;  3S2W A;  3S1N J;  2NNN A;  3QP5 A;  1Z7L A;  2K9M A;  2M4G A;  1F1Z A;  3PM1 A;  1VQN I;  3OR2 C;  2KRC A;  4LK1 F;  3GTM J;  4E7J A;  1NG7 A;  3ABK H;  4RAZ A;  1RIO H;  4ANJ A;  1YRN B;  4KIC A;  5KAI C;  2IAI A;  3IAS 2;  4PGG A;  3IV5 A;  2W82 A;  3F3X A;  1NTC A;  5J8F A;  3GVA A;  1UB9 A;  4HOB A;  3T0Y A;  1F9N A;  2LP0 A;  3TED A;  4C2U A;  4CCN A;  1IN6 A;  4L5J A;  1IRX A;  4ZJZ A;  4UY8 I;  2VBZ A;  5IT9 Z;  1TP4 A;  2M45 A;  3S8P A;  3CMM A;  1RR8 C;  1X2N A;  2COM A;  1FOK A;  1FOW A;  3IKV A;  2R0Q C;  2BHZ A;  5FGM A;  3SEQ A;  1IUF A;  2NVT J;  2QEN A;  4ESJ A;  5M3F J;  3LSH A;  4A0X A;  4LFU A;  4EGZ A;  2BY2 A;  2CJJ A;  2VJ4 A;  2XPU A;  3BG7 A;  2DQL A;  2RNJ A;  3QAH A;  4U88 A;  4E7I A;  2EQR A;  1AKH B;  2IVM A;  2LBF A;  1L0O C;  3PO2 J;  3DBH B;  2VJ5 A;  2VN2 A;  4PSW A;  1W1W E;  2X4H A;  2AXT C;  2K02 A;  2XPV A;  1FZP B;  4PUS A;  1XDU A;  1EH6 A;  3F8M A;  1XX5 A;  4ABZ A;  2CUJ A;  2ZJQ F;  5D6F A;  2Q8K A;  1R23 A;  4QLC U;  3DEE A;  2BV6 A;  5CVJ A;  5GAG J;  1WPK A;  4A0Y A;  3G6E I;  4O6J A;  4XN0 A;  2OQR A;  3KET A;  3ZXS A;  3MZY A;  3TP0 A;  1WJF A;  1P4W A;  3RPU D;  1ZAO A;  4KMU X;  2PX9 A;  5IP9 J;  3WGG A;  3WTY C;  3WHC A;  5IT3 A;  1S7E A;  1I1G A;  1Y8R B;  1YX3 A;  3W6V A;  3I5U A;  2Z9O A;  3VDX A;  2K9N A;  5EGO A;  1BBY A;  2AQF A;  5FRM A;  1IN7 A;  2XSD C;  2K3P A;  2NOG A;  3P7N A;  2XAQ A;  2R93 J;  4ZYH A;  1KU9 A;  1SAN A;  5EYR A;  3HOS A;  4IHS A;  4Q48 A;  2LD5 A;  1FOY A;  1S3J A;  4G12 A;  4RGU A;  5D4S A;  2D5V A;  2E35 A;  1WJD A;  2XDV A;  4Y13 A;  1K4S A;  1HF0 A;  4XLP F;  1WKM A;  2L9R A;  3G1O A;  5BPD A;  2HKX A;  4EGY A;  1JT6 A;  3KP7 A;  1OR7 C;  3ZOB A;  3QOP A;  5J47 A;  2A6E F;  3DKX A;  4G8X A;  4HX4 A;  1NHA A;  1Z6T A;  4OAY A;  3RDI A;  1O7F A;  2WV1 A;  3OS2 A;  3OR1 C;  1VF9 A;  5L3F A;  2A6T A;  2IGO A;  1SVL A;  2VB6 A;  3HOV J;  1Y1W J;  2HXO A;  4NC7 A;  3ABL H;  2LK2 A;  5F0H A;  3F22 A;  2MSY A;  1RUN A;  2BZT A;  2QA4 I;  4DZJ A;  2OJE D;  1JHH A;  3FMR A;  2M5W A;  2V9K A;  1UHS A;  2BY3 A;  2VI6 A;  2Y9Y A;  4X1E A;  3IHU A;  4EJU A;  5ICG A;  3BCB A;  2VOO A;  1W0U A;  1LKX A;  3ZP5 A;  3G2B A;  4KT5 C;  1XGS A;  3E0J B;  4IL6 C;  1OIS A;  4IQJ A;  4ON0 A;  2W84 A;  1MDM B;  2XF6 A;  4XKV A;  1B6A A;  1OCP A;  2F5E A;  3MMY B;  1LPQ A;  5E20 A;  2CV0 A;  2G9W A;  3UR3 C;  1AU7 A;  4I01 A;  3IH3 A;  4A3B J;  1IO2 A;  2LSO A;  3HTS B;  4M71 A;  4MEY F;  5JR3 A;  2CH0 A;  3GZN B;  1ZGJ A;  4IHY A;  3BJA A;  5DCM B;  3PSF A;  1FX7 A;  1NK2 P;  1GDT A;  3AG3 H;  2FD5 A;  4M3D A;  2LY9 A;  1Z77 A;  2TDX A;  3PO3 J;  1Z91 A;  1IJW C;  2UV1 A;  2ISY A;  4HLX A;  5D8K B;  1BC7 C;  4BNC A;  4WF2 A;  2Y30 A;  3A2K A;  2DDA A;  1H8A C;  3E6D A;  5JLX A;  1S5L C;  3ERE D;  4BL0 B;  2EV0 A;  2KMU A;  2ZFW A;  1S72 I;  1A35 A;  1UJ8 A;  1JJ6 C;  2V1U A;  2NXN B;  2VQC A;  2JUG A;  3GFJ A;  2Y31 A;  2ZKZ A;  4I09 A;  2R5Z B;  1GT0 C;  2Y2Z A;  1U8B A;  1EKE A;  1QVT A;  4BE0 A;  3R6S A;  1P4X A;  3VYR B;  5HLT A;  4KIS A;  3LFK A;  1D3Y A;  4M72 A;  4DBR A;  1Z7U A;  1T39 A;  4CO8 A;  1MMG A;  3F21 A;  3ELK A;  5ILU A;  1BIA A;  4UHT A;  1MSF C;  2BBY A;  3PUF A;  4B48 A;  3A4C A;  3CDL A;  4UXN A;  1FOX A;  2CQK A;  4XL9 A;  5J4Y A;  3AAF A;  4XLC A;  4A3E J;  2DJI A;  2QVO A;  2EV5 A;  3KP6 A;  1IRG A;  2PLY A;  1YLF A;  1MJ9 A;  3ZMV A;  3G4S I;  2X0L A;  3WG7 H;  2CQQ A;  3OYG A;  4BHP A;  1H0M A;  3HOX J;  2OCE A;  2ZXI A;  4QWQ A;  4CA0 A;  2H8R A;  4I0B A;  2OCC H;  3VPR A;  2ZFU A;  3CCY A;  3ZMT A;  3GFI A;  3I59 A;  3CCS I;  2XAU A;  3LOC A;  1LNW A;  1K7A A;  1X58 A;  3N4M A;  3FMQ A;  5DDG A;  2VLA A;  2OQG A;  2WAQ N;  4OMZ A;  3IH4 A;  3IRQ A;  4A3L J;  2HYG D;  3M1C A;  3HPH A;  1G3W A;  4G6D A;  3CCV I;  3S15 J;  1UG2 A;  2JN6 A;  2RDP A;  3PSI A;  2FQ3 A;  3ZQ7 A;  5J1U A;  2I10 A;  2ZO4 A;  5F6F A;  3CLQ A;  3DKW A;  2XGC A;  3OIP A;  5M3M J;  2EK5 A;  3LSP A;  1HKQ A;  4IZZ A;  4C2T A;  3FZV A;  2CW8 A;  1R49 A;  1FYM A;  3S14 J;  1TNS A;  3CMA I;  5IP7 J;  4B4C A;  4I76 A;  1HA8 A;  3T8T A;  5J6X A;  3HHG A;  1T08 B;  2MYS A;  1ETK A;  1BA5 A;  5GPA A;  3D0S A;  1RI7 A;  3L2Q A;  3ZQI A;  5BMZ A;  1B1B A;  1F4K A;  3BZC A;  4AWX B;  4UNO A;  2VT2 A;  3KCC A;  3ZMZ A;  2LKX A;  2LG4 A;  2V26 A;  3H0G J;  3E3V A;  3M8E A;  4D1Q A;  3K10 A;  3PFY A;  1F36 A;  2ZME C;  1MH3 A;  5E3O A;  2RVC A;  1P4A A;  4E6K G;  4BEH B;  3FKI J;  2J5P A;  4HV6 A;  3U9G A;  5FB2 A;  1I1S A;  2XRO A;  3U1D A;  1IDY A;  3HKZ A;  3LSJ A;  4CSW A;  5JLW A;  3RKX A;  3JR9 A;  1ZH5 A;  2WAD A;  3CO7 C;  4F7Z A;  1R36 A;  3W6J B;  4HG2 A;  4BAY A;  2BW3 A;  1IRZ A;  5FO5 A;  3K1N A;  1FMV A;  3CO6 C;  1UMQ A;  2VPR A;  4IJA A;  3H1C A;  4Q47 A;  3OYI A;  2FU4 A;  3QU6 A;  4B3A A;  2PBI A;  3L2C A;  1EH8 A;  2V6C A;  3FBI B;  3ONQ A;  1LVA A;  2F5V A;  2G0E A;  2UUZ A;  3CD6 I;  4IOC F;  2DYS H;  4F52 A;  1RR7 A;  1VFC A;  1O3S A;  2JZY A;  3ZQQ A;  5ILS A;  1FBQ A;  3HOU J;  5TRD A;  2LLK A;  2IA1 A;  1A6Q A;  1BR4 A;  1MJA A;  2KL4 A;  1K78 B;  1X19 A;  2F4O B;  4RLQ A;  5C4J J;  5E1W A;  4LG0 A;  2H1K A;  2STW A;  2OTJ I;  4YG2 F;  1R9T J;  4D0P A;  4IHX A;  3DPL C;  2DDB A;  5J8C A;  3BR3 A;  5L3E A;  4PGH A;  4E7S A;  3I55 I;  3R61 A;  5FLM J;  1ENH A;  2LVS A;  4FX4 A;  1YRN A;  5KNL A;  2ZNZ A;  3OS1 A;  1Z3Y A;  2MFZ A;  3IAM 2;  4IXA A;  2D1V A;  1WJB A;  5CVR A;  1X1D A;  3I54 A;  3L9F A;  4AYB A;  2FA5 A;  3Q9V A;  5BQT A;  2W7N A;  4MFE A;  3WTZ A;  1BI1 A;  2HXI A;  2DN0 A;  3GYH X;  3JRF A;  3S1M J;  1HDD C;  4XLE A;  3C1D A;  2RGV A;  3DEW A;  3CQZ J;  2E1C A;  2Q2E A;  3H9Q A;  4MQV A;  1OCC H;  2AQE A;  2CW0 F;  5TIS C;  3TQN A;  3WU2 C;  1Y56 A;  3BR6 A;  4OU0 A;  4ZDL A;  4M3B A;  4IKF A;  1UCR A;  1IUY A;  1ETY A;  1R1V A;  1ZN2 A;  3W2V A;  4AD9 A;  2R4G A;  3K70 C;  1GLN A;  1TBX A;  4FE4 A;  1XS9 A;  3KEQ A;  2UXX A;  4II3 A;  1F43 A;  4XOR A;  1YS7 A;  4ZZL A;  1WVR A;  3ZRG A;  5L3C A;  5HVQ C;  1QHG A;  4MQ9 F;  1N75 A;  3H36 A;  4A2U A;  1J2X A;  3HKZ N;  3IC7 A;  3V7C A;  4UB6 C;  2IXS A;  2WAE A;  3GWZ A;  3I0T A;  4MFD A;  3MKZ A;  1W0T A;  2BEO A;  1U2W A;  5HLH A;  2IW5 A;  4PJ0 C;  3JW4 A;  4HPQ A;  1YX5 A;  2DT7 B;  1V5E A;  3T8R A;  3L2V A;  1U78 A;  3F6V A;  3OYC A;  1SFO J;  1V54 H;  2VXD A;  4V2F A;  2R7X A;  2FML A;  4ZYE A;  4HRI A;  3GTO J;  3LA3 A;  1BR1 A;  4ZH4 F;  1J5Y A;  4H4K C;  4OAZ A;  4P9U A;  2L3D A;  1XSX A;  2F5D A;  2JTV A;  1AHD P;  3BLY A;  1PYV A;  1ZG5 A;  5J1Y A;  3ZQG A;  3HL2 A;  1ZTR A;  2DA1 A;  3QYE A;  1U5T C;  2EIM H;  2XB5 A;  1DGW Y;  2DW4 A;  3G1L A;  4K2E A;  4JOM A;  2A5Y B;  5E79 C;  4CYD A;  5LFA A;  4PZJ A;  1N77 A;  5EZG A;  3CP2 A;  2HVS A;  1XGN A;  1R5G A;  2VJI A;  3DTI A;  4RGX A;  1V3F A;  3WE3 A;  1TWC J;  5CYV A;  3UNG C;  2KRF A;  1MBJ A;  3GME A;  2E2I J;  2ME6 A;  3FF5 A;  1SFX A;  2CFO A;  3H5N A;  1FLI A;  2L7F P;  2YU3 A;  3L2R A;  5H6R A;  2IPQ X;  4YEJ A;  2CFX A;  1HOM A;  2KIQ A;  3KP3 A;  4H0E A;  1TC3 C;  3CJT B;  1GV5 A;  1R5I D;  1RET A;  1LUJ B;  2V9V A;  2LF7 A;  4P55 A;  1H9G A;  3RSN A;  3HSR A;  1BIB A;  2IBD A;  1ZGA A;  2BE5 F;  3KP4 A;  3TKY A;  2VQG A;  2DOF A;  3ESW B;  1MMA A;  4WWC A;  5GAE J;  2ELK A;  4AYB N;  2ZC2 A;  2O8K A;  2DTR A;  3HRM A;  5AIP A;  1SMT A;  1P2F A;  2MG4 A;  2A68 F;  3CUQ B;  2EZL A;  1MDM A;  2V1X A;  5B3S H;  1ZRE A;  2YX7 A;  2OTL I;  2I5U A;  5FLV A;  2FOW A;  1Q1H A;  2X1D A;  4A69 C;  1TWG J;  4YIR X;  2K86 A;  4L0Y B;  3S3M A;  4XKC A;  1IXS B;  3PUB A;  3U1K A;  3FDY A;  3HOW J;  2QQB A;  3IUO A;  2XAH A;  2BYV E;  1Q1V A;  3HTU A;  2DAO A;  1EV7 A;  5BNG A;  1XD7 A;  2K9L A;  5DCM A;  4ZTF A;  1XCV A;  4RGS A;  3SQN A;  3OYB A;  2BOL A;  2FBH A;  1IGN A;  5B1A H;  3S1R J;  2DU9 A;  3PIO F;  3GTK J;  2ZJP F;  2K3F A;  2JWT A;  1IC8 A;  4I02 A;  3ABT A;  3FMS A;  1GXP A;  5GTI C;  3DCF A;  3ZR8 X;  2O03 A;  3F72 A;  2CSO A;  3QWL A;  4UVC A;  1JGS A;  2K7L A;  4UV9 A;  4AVZ A;  2P8T A;  2X85 A;  2E1M C;  1A31 A;  4E7K A;  4CZZ A;  2X6Y A;  3L09 A;  3ISP A;  2X9D A;  3EUH A;  4LIU A;  3JRG A;  3NQO A;  2JA6 J;  1Z05 A;  5B1B H;  1YIJ I;  3H92 A;  2VE9 A;  2B63 J;  4A3K J;  5JI6 A;  3DEU A;  2DMU A;  5LLQ A;  1W7P D;  1E0E A;  3GTP J;  4RBO A;  4OMY A;  1I39 A;  3O2P E;  4LIT A;  4M3E A;  3LQQ A;  1IDZ A;  5E3N A;  5CVU A;  1HC8 A;  3K4C A;  2IS2 A;  2CQX A;  2VKV A;  1TNT A;  1Y1V J;  5AIQ A;  4V19 K;  3K2A A;  3BTJ A;  2FEZ A;  2V1N A;  2WTE A;  1X3W B;  3LA2 A;  2DTZ A;  1MD0 A;  4J00 A;  4GDF A;  4KDP A;  1WFX A;  2ESN A;  1KU7 A;  3H3Z A;  4N9I A;  4NHJ A;  2V1D A;  2HVR A;  2XGE A;  4M6V A;  3NRV A;  3JRH A;  3I64 A;  5GP9 A;  3COA C;  3LSG A;  1PUE E;  2E1N A;  4GXO A;  2HDW A;  1YS6 A;  4L5E A;  4UUS B;  5DD4 A;  3MZH A;  3S2D J;  4OIP F;  1U0J A;  2KKO A;  1UHW A;  2XF5 A;  3RKW A;  4BDY A;  5IYD J;  1JGG A;  2DFF A;  2ZJR F;  2GOX B;  1QRY A;  4KN7 X;  4UVB A;  1EJ9 A;  4EM1 A;  2O9L A;  5K7F A;  2EFO A;  3GLL A;  3B6C A;  4I7H A;  4Q4Z F;  1OKR A;  2BY1 A;  1WGX A;  1H89 C;  4ETS A;  4P9F A;  3W2W A;  2H94 A;  3G3Z A;  3SDB A;  5J40 A;  1X2M A;  5FKM A;  1V5F A;  2COB A;  3NWT A;  2BVL A;  4LG3 A;  1ETO A;  3RKY A;  2QQA A;  3QQA A;  1OYI A;  3MN2 A;  1M1E B;  2VBY A;  3D5S C;  4E70 A;  2W1O A;  3LMM A;  2M0M A;  4EQQ A;  3JAM K;  3HBL A;  2QUF A;  3V8K A;  1WJE A;  5K5O A;  5ICE A;  1FSH A;  2JUC A;  1JI8 A;  1GV2 A;  3E5X A;  4BQO A;  3AL0 C;  4CCL A;  2HTS A;  3PNT A;  4KFC A;  4EVI A;  3OYM A;  3KFW X;  2DA3 A;  3SHF A;  3R60 A;  5FRO A;  4CCO A;  4XOT A;  1S8N A;  3HIF A;  5IYB J;  1SVM A;  4BEH A;  3QRF F;  3OSF A;  2LYC A;  2K5C A;  3C2B A;  2A61 A;  2D45 A;  4U0V A;  4MLO A;  2M1B A;  2HOS A;  1JJ8 C;  2DK8 A;  1QZE A;  3FIS A;  3PL8 A;  4OIO F;  3OYH A;  2K27 A;  3TMO A;  4BJ5 C;  1YYV A;  4AM3 A;  1IG7 A;  2VJJ A;  2ETH A;  3VYU B;  1VQO I;  1Z67 A;  1LFU P;  3WGI A;  3L7W A;  1W5T A;  1YO5 C;  1Z1D A;  4EEF G;  3GBG A;  1AWC A;  4OWR B;  3N97 A;  2R7T A;  1TQP A;  1IN8 A;  1GVD A;  3BTC A;  4FCY A;  3N05 A;  4IRG A;  2GQQ A;  4L0Z B;  2EFN A;  3HSF A;  5LEK A;  1B9N A;  2W00 A;  5GAD J;  2PMU A;  4JX5 A;  2P6T A;  3MKW B;  3CF2 A;  4KIB A;  3GX4 X;  3LFU A;  3ZGK A;  2CV2 A;  3I4N J;  3DU6 A;  4NBQ A;  1B9M A;  2RC4 A;  2GBY A;  3A03 A;  3RI4 A;  4RB1 A;  2KHM A;  2MC3 A;  3GZ5 A;  1D8K A;  1K78 A;  2Z1D A;  4KN4 X;  3CTA A;  1BJA A;  1BI2 A;  1I3A A;  1MJB A;  2E36 A;  4A3C J;  3CC2 I;  3HC7 A;  1MNM C;  4XON A;  3JRA A;  4AID A;  1BW5 A;  3HRS A;  2K40 A;  4A3M J;  3ABM H;  1FIA A;  2EIN H;  4EJT A;  3R4K A;  1CQT A;  2HTJ A;  3KP5 A;  4FAS D;  4G7H F;  4CGZ A;  1X4O A;  3HJE A;  4IPA A;  2QLZ A;  5LD2 C;  4BQA A;  4F92 B;  1P92 A;  3SJM A;  4XNF A;  1CGP A;  1U6G A;  2XB0 X;  4HNU A;  1XG1 A;  1TQM A;  1T38 A;  3RTR A;  1SD6 A;  2BVM A;  4B8X A;  2XUB A;  2MC4 A;  4RAF A;  3RZD J;  4RAG A;  2XVC A;  4PJM A;  5IOZ A;  1BOB A;  4NC8 A;  3T5X A;  3CCE I;  5F0C A;  1FJL A;  2WC2 A;  1FNN A;  1Z21 A;  3FXR A;  1LE8 B;  1OCO H;  4C30 A;  4BGD A;  2PMH A;  2JA2 A;  4LB6 B;  1Y39 A;  2P4W A;  2CUZ A;  4XRF A;  3KE2 A;  4HBL A;  4MTE A;  3P5J A;  1DP7 P;  1E17 A;  3L00 A;  4EM2 A;  3TOA A;  1I27 A;  1TT5 B;  3I4M J;  2Z99 A;  3FXQ A;  2NVX J;  4D5F A;  2WY7 Q;  2H1L A;  2NRA C;  4BY1 J;  2KP6 A;  4XKB A;  2KIF A;  4B3X A;  3DV8 A;  4ENM A;  3SZG A;  1XC5 A;  1LJ9 A;  2L54 A;  3M9A A;  3F6O A;  3MQ0 A;  3I71 A;  2Y0M A;  5CPR B;  5EJC A;  4G7Z F;  1LQ1 A;  2G7U A;  4PCQ A;  1FT9 A;  5KHD A;  2PJR B;  2FUG 2;  5IOY A;  3K4L A;  5M5W J;  1FEX A;  2QM3 A;  2CU7 A;  3MEX A;  2HZT A;  5K5R A;  1KU2 A;  1VND A;  1WI9 A;  2DLL A;  3EYI A;  4M3G A;  3FBN B;  1T0F C;  1YW8 A;  4CCJ A;  5C3E J;  5EG0 B;  3K69 A;  2M30 A;  4LOC A;  2QQ8 A;  4P96 A;  4DGW B;  3GTL J;  4LLG F;  5FKN A;  3GLX A;  4Z2Y A;  1FTT A;  4BXF A;  5L3D A;  2IS4 A;  1JUS A;  1B72 B;  3E5Q A;  2NS7 A;  2IA2 A;  4HZF A;  4FTH A;  2JA8 J;  2X48 A;  2E34 A;  2F4M B;  5FLX K;  2HDC A;  2V4J C;  4BU2 A;  1DP3 A;  1KON A;  3M8F A;  5DEQ A;  3MKL A;  1TT0 A;  1O57 A;  3OL3 A;  1MNE A;  4W1U A;  2UWM A;  1STZ A;  4WXH A;  1R5H A;  2DOA A;  4XIC A;  2F48 A;  3KZY A;  4CH7 A;  2WWY A;  4A3G J;  1ACI A;  1MW7 A;  2CG4 A;  5FKO A;  3O3K A;  1ZLK A;  1BR2 A;  2HZD A;  1ZG1 A;  3NAR A;  2WB1 A;  3GO5 A;  1XSV A;  5TGT A;  2YUS A;  2EFQ A;  3WE2 A;  3QPL A;  4RM2 A;  1T56 A;  5K7Z A;  4GO1 A;  3F8B A;  2ZCW A;  4HEA 2;  1U9N A;  5L3G A;  3BY6 A;  3GEZ A;  1ZG3 A;  4RAY A;  1RES A;  2ECB A;  1V4R A;  4LK0 F;  3K2Z A;  1FPQ A;  4MGR A;  5ED4 A;  1SFU A;  4BJ6 C;  2R7U A;  3KEY A;  3G1M A;  1HKS A;  2HQR A;  1U3E M;  2VOP A;  2KFD A;  3CUQ A;  2M9H A;  3I58 A;  4HYE A;  3C2H A;  4KMF A;  5E8I A;  1AOY A;  3BPX A;  3H5R A;  4JX6 A;  1ETV A;  3GZ6 A;  1H9T A;  1HW5 A;  3ASO H;  3ML6 A;  5H20 A;  1Z0X A;  4ITV A;  4C3J J;  2KIM A;  2PQ8 A;  3M4O J;  3QPS A;  5JVG F;  2R7O A;  4LD5 A;  2WBM A;  1I50 J;  3T1B A;  4WK8 F;  3ZN0 A;  3J7A O;  5EEG A;  2XHK A;  1D5V A;  2KQR A;  2IS1 A;  2ZME B;  3C18 A;  4Y7N J;  1BL0 A;  1WI3 A;  2VIX A;  3LSM A;  3BT9 A;  2OU2 A;  4DZP A;  2Y48 A;  3FWE A;  3V8L A;  2MA3 A;  2QYO A;  3S1Q J;  3K1P A;  1NG6 A;  3E5U A;  2HEO A;  2FNA A;  3JRD A;  3L2W A;  3M7G A;  3G71 I;  2VXZ A;  3BG3 A;  4M9Z A;  2VUM J;  1MBG A;  1TLH B;  2QKM B;  4BQQ A;  3MVP A;  1YW9 A;  2L4A A;  2L7Z A;  2Z33 A;  2HPM A;  2O6G E;  5FD5 A;  3WOD F;  4Z6Y A;  1A36 A;  4PJL A;  1LVK A;  2E71 A;  3DF8 A;  4KNY A;  4XQF A;  3TW7 A;  3WHB A;  1IF1 A;  1WJA A;  3SDG A;  1REP C;  3OYD A;  3SYT A;  1SFE A;  1TL8 A;  1QGP A;  2XAG A;  2BY0 A;  1X4P A;  1W4M A;  2DXI A;  4EV0 A;  5AON A;  4DNC A;  2NVQ J;  1R4N B;  2IJL A;  1RUO A;  2FOK A;  1Y0N A;  2IGK A;  2EV6 A;  2L0K A;  2NAZ A;  3R0A A;  3WU0 A;  3ZQC A;  1G59 A;  2EIL H;  3QYF A;  4XLN F;  2YPR A;  5HOD A;  1FWZ A;  2XF7 A;  2M7B A;  1LFB A;  4BQN A;  3OYJ A;  3LAP A;  3F9K A;  3TP3 A;  2Z16 A;  4BH9 A;  2H6C A;  2MD0 A;  2STT A;  5J1R A;  5LHI A;  5CVI A;  4HV5 A;  1MKM A;  4F91 B;  4IO9 F;  4N4O B;  1RKW A;  4UUS A;  4DBQ A;  2WB1 N;  1ZK8 A;  2R7W A;  2RN7 A;  2YX4 A;  1Y6I A;  1DDN A;  3A0B C;  1OYY A;  1D0Z A;  1V5G A;  2EIJ H;  2LTP A;  1GVJ A;  2DMT A;  4P5O A;  2Y69 H;  3SXY A;  1KZH A;  4CXF A;  1BC8 C;  1QVU A;  2XAS A;  3WU1 B;  1ZR2 A;  2FSW A;  3ROU A;  1KYZ A;  1R6R A;  3D1N I;  4LMY A;  2GIZ A;  2HNH A;  4RLF A;  5H6Q A;  4XRS G;  4FX0 A;  5KCM A;  3BJ6 A;  3OSG A;  2K9S A;  4BBR J;  2XKO A;  1LEA A;  2LH9 A;  4G9Y A;  4Y33 A;  1SD4 A;  2DMN A;  2DOE A;  4UB8 C;  2B0L A;  3NEU A;  4HQE A;  1BW6 A;  2FNP A;  3CZ6 A;  3WTT C;  4HDV A;  1K4T A;  2VAS A;  1C0W A;  1D0X A;  3MWM A;  3V42 A;  2LY1 A;  1QQI A;  2CUF A;  2YR2 A;  3HRT A;  2XAF A;  2ZXJ A;  2VT3 A;  2OV7 A;  2H8W A;  1RC9 A;  5FLX Z;  5JHU A;  3AKZ A;  5GPC A;  2W24 A;  3FK6 A;  4HW0 A;  3X2Q H;  3LSK A;  1W36 D;  2FE3 A;  1KYW A;  5BS6 A;  2IRF G;  1I6H J;  3NWS A;  4UUT A;  3VWB A;  3DWL E;  1VQ6 I;  3V8J A;  1IZ1 A;  5B5E C;  1NK3 P;  4Q5S F;  4BY7 J;  1YJN I;  2Z2S B;  2MD5 A;  1J59 A;  2IGM A;  2R7F A;  3WTV C;  2NVY J;  1VQ7 I;  1POG A;  2N8G A;  3CF5 F;  4IHW A;  1Z6R A;  3W3C A;  4BE1 A;  3R0J A;  4IQ4 A;  3JTG A;  4B47 A;  4F3Q A;  3KPH A;  4CZC A;  3OYN A;  1IN4 A;  4BHB A;  1N25 A;  2F6C A;  3D5L A;  4AU7 A;  4BBS J;  2Q1Z B;  4A3F J;  5F64 A;  3DFG A;  2IP2 A;  1AKH A;  1U5T B;  1I3Q J;  4M6Y A;  1R22 A;  2R7R A;  4JP0 A;  5M5X J;  3Q3S A;  1ZRC A;  1ERD A;  4HF1 A;  2QQ9 A;  2E7W A;  4B09 A;  4UVA A;  1ETX A;  3DTK A;  5DYM A;  1W36 C;  3JTH A;  4ENN A;  3CLO A;  1OR7 A;  1P6R A;  1PDN C;  4HST A;  3CCM I;  1OPC A;  4BDZ A;  2R7S A;  1QA6 A;  3B6A A;  2L9V A;  2OZ6 A;  4RM3 A;  3BR2 A;  3OYA A;  3F8C A;  3JRC A;  5J3L A;  4FQG A;  3FXJ A;  2GOM A;  4A12 A;  1FYK A;  5D5X B;  4X6A J;  3BC8 A;  3PFI A;  2E60 A;  2KDZ A;  1G4D A;  3E97 A;  5FRN A;  1KQ8 A;  3F8N A;  4FHT A;  1FIP A;  1O7L A;  4BE2 A;  3DU5 A;  4RB3 C;  2GIV A;  2UZK A;  4YFK F;  1DPR A;  4CIC A;  3C2G A;  3OYE A;  1Y8Q B;  2EZH A;  3HM5 A;  2KLO A;  5M5Y J;  1EF4 A;  1D0Y A;  2OD5 A;  4L9J A;  3H3V K;  4DYQ A;  1FSE A;  2EBI A;  2XRN A;  3HRU A;  2R92 J;  2VQH A;  2PMZ A;  1VQ5 I;  2MW8 A;  3CUO A;  2P5V A;  1GUU A;  3CJR B;  5FKK A;  4A6E A;  4E7H A;  3AG1 H;  3V7R A;  3KP2 A;  2NYX A;  2DYR H;  5E1X A;  1ZGW A;  2FBK A;  2W4S A;  1LE8 A;  4ESF A;  1YJ9 I;  5L3B A;  2GWR A;  5CKT A;  2LF8 A;  2A3S A;  2EPF A;  3K0L A;  2QSG X;  1YJW I;  3LQR A;  3RIR A;  3WTS C;  1YIO A;  1RRJ A;  4AIH A;  3FK7 A;  3EYY A;  3GXO A;  4B1R A;  4J01 A;  3SFI A;  2E1M B;  3BRO A;  4IX7 A;  2KPM A;  2H09 A;  3A02 A;  2MH9 A;  1EA3 A;  4A93 J;  1GHC A;  4F93 B;  1ULY A;  3KYC B;  2HOE A;  3KZI C;  3OV8 A;  4PFP A;  4EM0 B;  3FX3 A;  4R79 A;  9ANT A;  5HLI A;  4EAT A;  3ZQF A;  2PJR A;  1XTA A;  2OPT A;  1QPM A;  1AA7 A;  1MND A;  5EDN A;  3LA7 A;  3P9K A;  2RV8 A;  2HDD A;  5F1J A;  2GA1 A;  5D5U B;  1P7I A;  2VKD A;  4Y17 A;  5ICC A;  2HQN A;  1WQ2 A;  2MH2 A;  1SD5 A;  3RCO A;  5HNH A;  3BR5 A;  4WX9 A;  1PVE A;  5E18 F;  4RDU A;  3DP7 A;  1XDS A;  2IGN A;  1ZR4 A;  2VE8 A;  3RQI A;  1F5T A;  5DS9 A;  5CQG A;  5EG0 A;  3FXL A;  3HB9 A;  5FD6 A;  1WHU A;  4IHV A;  2MLK A;  1ODD A;  3K7A J;  2QZ8 A;  3J81 K;  4XBF A;  3IWF A;  1D1A A;  3K4M A;  4L5I A;  4D9J A;  1B72 A;  2V6E A;  3M3Y J;  4J19 A;  2M8E A;  2CGP A;  2RKH A;  1HST A;  4CCK A;  3BDD A;  2FXA A;  4KIF A;  5IY5 H;  2ESH A;  1T8I A;  5HDN A;  3LAJ A;  1TZL A;  4CCM A;  3DPT A;  2A5W A;  3K4B A;  5JFR A;  4OIN F;  2XC7 A;  4AUX A;  3FIW A;  1W7P B;  3RZO J;  3G73 A;  3CES A;  2GM4 A;  4G7O F;  2R5Z A;  3O8H A;  4HX7 A;  4Y52 J;  1UFM A;  2BXY A;  2L02 A;  3W6K B;  2L7M P;  3RJP A;  2CRG A;  1MBF A;  1WZ2 A;  1R4M B;  2O5R A;  3IWZ A;  2P7C B;  1X3U A;  2M8G X;  2P6S A;  1T98 A;  1B8I B;  3MCZ A;  4CYC B;  4I0A A;  4ZDO A;  2M7A A;  4BXU A;  1LDJ A;  3M8J A;  4PDK A;  1JT0 A;  2PEX A;  1QNT A;  3VYT B;  4ZC3 A;  4RB0 A;  2DPU A;  3IP4 B;  1MH4 A;  1KA8 A;  4MO7 A;  3LSR A;  1U8R A;  1FC3 A;  1VTN C;  1UHM A;  2Y75 A;  2X6X A;  3VSL A;  4N0B A;  4MHG A;  1ON2 A;  1K6Y A;  4QPO A;  2EA4 A;  4D5C A;  4DQ2 A;  1ON1 A;  2BHY A;  4JX4 A;  2K85 A;  4GYG A;  4XLA A;  3RYR A;  3UKG A;  2EZK A;  3BCA A;  1K83 J;  1WJC A;  5C4X J;  3CCL I;  3AL0 B;  4EJW A;  1IV8 A;  4PK4 A;  2R5Y B;  1MMD A;  1O3Q A;  2ZME A;  4A5N A;  1ZHF A;  4HF2 A;  2JVG A;  5DUK A;  4QIW N;  4NQW B;  2GXG A;  2GXA A;  2MAB A;  2XIG A;  5KVR A;  1BM9 A;  3HG9 A;  1A5J A;  2FX0 A;  2CUE A;  3PQJ A;  1O3T A;  2JSP A;  5DM6 F;  2A07 F;  3TBI A;  2GAU A;  1TQI A;  3DLA A;  4NB5 A;  5D8L B;  4U0Y A;  1BN5 A;  2L9N A;  4HNV A;  3PJR A; 
#chains in the Genus database with same CATH homology
 1MH3 A;  5E3O A;  2JJ7 A;  1HLV A;  1IV6 A;  2X6O A;  2NS8 A;  3FKI J;  5IOY A;  5EF6 A;  5M5W J;  1IDY A;  1JTX A;  3LSJ A;  1FEX A;  2CU7 A;  1MSE C;  4XRS A;  5JLW A;  1ETQ A;  1OJL A;  3JR9 A;  1ZKG A;  1VND A;  3ZQH A;  2ID6 A;  4M3G A;  5F0F A;  1ITY A;  5C3E J;  2IEK A;  3Q0V A;  5EG0 B;  1IRZ A;  4LOC A;  3A01 B;  3JRE A;  1DU0 A;  1UMQ A;  5E3L A;  2VPR A;  2E1O A;  1O4X A;  5IYC J;  3GTL J;  5FKN A;  1FTT A;  3L1P A;  1E3O C;  1JUS A;  1B72 B;  4M3F A;  2NS7 A;  4B3A A;  2ME0 A;  2LFB A;  3S16 J;  2DA4 A;  4FTH A;  2JA8 J;  2X48 A;  2ZB9 A;  4BKX A;  2XGD A;  2M34 A;  2G0E A;  2ID3 A;  3BQZ A;  1JKP C;  1OCT C;  4DW6 A;  1JKQ C;  3MKL A;  4W1U A;  4BXX J;  1RR7 A;  1VFC A;  2RAE A;  4AC0 A;  4XIC A;  5F08 A;  3HOU J;  1PUF B;  2LLK A;  4A3G J;  1JUM A;  5FKO A;  4DYR A;  5C4J J;  2H1K A;  1MBE A;  3NAR A;  2YUS A;  1R9T J;  3QPL A;  1H88 C;  4IHX A;  2W48 A;  1ETW A;  3BR3 A;  5F27 A;  1T56 A;  5K7Z A;  1U9N A;  5FLM J;  1ENH A;  2LVS A;  3OOU A;  3O8G A;  1RES A;  2ECB A;  4MIM A;  1YRN A;  4A3I J;  4XRM A;  1HCR A;  3G1M A;  1MBK A;  3HGY A;  1RKT A;  2M9H A;  3S17 J;  1P7J A;  3Q0U A;  4JX6 A;  4W97 A;  1ETV A;  5FJ8 J;  2Y0S N;  4MFE A;  3BR1 A;  1Z0X A;  4C3J J;  3M4O J;  2HXI A;  2DN0 A;  3QPS A;  3JRF A;  3S1M J;  1HDD C;  3DEW A;  2DA5 A;  3CQZ J;  1WCM J;  1I50 J;  2HQ5 A;  1BJZ A;  2PMZ N;  1JKO C;  4Y7N J;  3BR6 A;  1BL0 A;  1WI3 A;  4M3B A;  3BT9 A;  1ETY A;  4DZP A;  3S1Q J;  4FE4 A;  3E7L A;  1XS9 A;  1MBH A;  3JRD A;  3Q0W A;  2HOT A;  3HEF A;  4QTR A;  1F43 A;  3BG3 A;  2VUM J;  1MBG A;  3HKZ N;  3MVP A;  2L7Z A;  2EH3 A;  5EZH A;  1JTY A;  3TW7 A;  4MFD A;  3WHB A;  3SDG A;  1W0T A;  1OFC X;  2E2J J;  4V2G A;  5IPA A;  5E3M A;  1U78 A;  1RPW A;  1K61 A;  2NVQ J;  1SFO J;  2L0K A;  4V2F A;  3ZQC A;  2VKE A;  3GTO J;  1HDP A;  5HOD A;  2E2H J;  2DA2 A;  1AHD P;  1LFB A;  1FTZ A;  4C3I J;  5J1Y A;  3TP3 A;  2JA7 J;  3ZQG A;  1ZTR A;  2DA1 A;  1A6I A;  1TWH J;  2XB5 A;  5J1R A;  3G1L A;  2DA7 A;  3BTL A;  2K9Q A;  5EZG A;  1RKW A;  4UUS A;  2OF7 A;  2DJN A;  2WB1 N;  1TWC J;  1ZK8 A;  2XRL A;  4D7N A;  4IEJ A;  4JYK A;  1MBJ A;  3GTJ J;  2LTP A;  2DMT A;  2E2I J;  2ME6 A;  2MGQ A;  1G2H A;  2QF7 A;  2JMW A;  2L7F P;  4FIS A;  1QVU A;  3S1N J;  1ZR2 A;  1T33 A;  3BG5 A;  1HOM A;  3D1N I;  1TC3 C;  1GV5 A;  1RET A;  4XRS G;  1ORK A;  3PM1 A;  2IBD A;  4C2M J;  3GTM J;  3OSG A;  2K9S A;  4BBR J;  1YRN B;  1U9O A;  2ELK A;  4AYB N;  2IAI A;  3IV5 A;  2DMN A;  2O8K A;  2DMQ A;  1NTC A;  3F0C A;  2MG4 A;  1BW6 A;  2EZL A;  2LP0 A;  3TED A;  2CUF A;  2FJ1 A;  5FLV A;  4A69 C;  1TWG J;  3HOW J;  1X2N A;  1Q1V A;  5BNG A;  5GPC A;  3FK6 A;  2R0Q C;  5K7H A;  1IUF A;  2NVT J;  1JUP A;  3S1R J;  1IGN A;  5M3F J;  3GTK J;  1IC8 A;  2JWT A;  1I6H J;  2CJJ A;  2XPU A;  3DCF A;  4UUT A;  2EQR A;  1AKH B;  3TW6 A;  3PO2 J;  1NK3 P;  2R7Z J;  4BY7 J;  3HOY J;  2NVY J;  1POG A;  2N8G A;  2XPV A;  2X9D A;  3BG9 A;  3JRG A;  2JA6 J;  4IHW A;  2B63 J;  4A3K J;  2DMU A;  2GLO A;  3GTP J;  4ABZ A;  4RBO A;  4BBS J;  2QCO A;  4A3F J;  1TWF J;  4M3E A;  1IDZ A;  3HOZ J;  5E3N A;  1AKH A;  1WPK A;  1I3Q J;  1QPI A;  2CQX A;  2VKV A;  4JP0 A;  5M5X J;  1Y1V J;  4A3J J;  3Q3S A;  3K2A A;  3BTJ A;  2AO9 A;  3TP0 A;  5IP9 J;  3RKQ A;  3WHC A;  1ETX A;  1S7E A;  3W6V A;  4NDL A;  4GFB A;  2K9N A;  2DTZ A;  5EGO A;  2XSD C;  3B6A A;  2NOG A;  3BR2 A;  2XGE A;  4M6V A;  3JRC A;  5J3L A;  3JRH A;  1SAN A;  5EYR A;  1APL C;  2R93 J;  2DMP A;  2LD5 A;  4G12 A;  5GP9 A;  3ZQL A;  2HI3 A;  4X6A J;  3LSG A;  2D5V A;  2KDZ A;  4L5E A;  1D5Y A;  1B8I A;  4UUS B;  4CYC A;  2HYJ A;  1HF0 A;  2L9R A;  3G1O A;  3S2D J;  1FIP A;  2P81 A;  1JT6 A;  3ZOB A;  2DA6 A;  5IYD J;  1JGG A;  4FE7 A;  1QRY A;  2EZH A;  2WV1 A;  3CMY A;  2O9L A;  1VF9 A;  3HM5 A;  5K7F A;  5M5Y J;  1EF4 A;  3B6C A;  3H3V K;  4DYQ A;  3JRB A;  2EBI A;  3HOV J;  1Y1W J;  2R92 J;  2HXO A;  2LK2 A;  5F0H A;  1WGX A;  1H89 C;  2MSY A;  2MW8 A;  2YU9 J;  1WH7 A;  4DZJ A;  1GUU A;  5FKK A;  1UHS A;  1X2M A;  5FKM A;  2VI6 A;  2Y9Y A;  2COB A;  3IH2 A;  4X1E A;  1ETO A;  2R5Y A;  3OIO A;  1ZGW A;  2TCT A;  3QQA A;  3MN2 A;  1W0U A;  1LE8 A;  1OCP A;  3HGG A;  3FK7 A;  3HBL A;  2EZI A;  2JK3 A;  1AU7 A;  4B1R A;  3SFI A;  3IH3 A;  4A3B J;  1GV2 A;  3A02 A;  4IHY A;  4A93 J;  5C44 J;  2DA3 A;  1NK2 P;  1GDT A;  3HDD A;  9ANT A;  4DYC A;  2FD5 A;  3ZQF A;  2Y9Z A;  5IYB J;  4M3D A;  2LY9 A;  2OPT A;  1Z77 A;  3PO3 J;  3BTI A;  2FQ4 A;  3OSF A;  1IJW C;  5EDN A;  3C2B A;  2Y30 A;  4MLO A;  2M2E A;  1H8A C;  2HDD A;  2HOS A;  5F1J A;  5JLX A;  1JJ8 C;  1P7I A;  3FIS A;  3BR5 A;  4RDU A;  4D7M A;  1ZR4 A;  3RQI A;  5DS9 A;  1JJ6 C;  1IG7 A;  5EG0 A;  2Y31 A;  3HB9 A;  1LFU P;  3A01 A;  4IHV A;  4I6Z A;  2ECC A;  3K7A J;  4EEF G;  3GBG A;  2R5Z B;  2Y2Z A;  2E19 A;  1U8B A;  1GT0 C;  3M3Y J;  1B72 A;  1GVD A;  1QVT A;  3BTC A;  4FCY A;  4J19 A;  3BQY A;  4XK4 A;  2KT0 A;  4JX5 A;  1MSF C;  5FKL A;  3CDL A;  1WH5 A;  1DU6 A;  3I4N J;  4AUX A;  3FIW A;  3RZO J;  2GM4 A;  1PUF A;  2M0C A;  3A03 A;  5EGO B;  2GBY A;  4A3E J;  2R5Z A;  3NAU A;  2JA5 J;  3O8H A;  4Y52 J;  2CQQ A;  2L7M P;  2O7O A;  2CRG A;  1MBF A;  4QSH A;  4A3C J;  3GTG J;  1MNM C;  3HOX J;  3JRA A;  1BW5 A;  2M8G X;  2H8R A;  2K40 A;  4A3M J;  1B8I B;  1FIA A;  4CYC B;  3VPR A;  1CQT A;  3CCY A;  1JT0 A;  2XPW A;  3LOC A;  1X58 A;  2WAQ N;  1MH4 A;  3IH4 A;  3SJM A;  4A3L J;  4MO7 A;  3LSR A;  2XB0 X;  1XG1 A;  2AHQ A;  3S15 J;  1UG2 A;  2JN6 A;  3S2H J;  2LR8 A;  5J1U A;  2I10 A;  3JRI A;  3RZD J;  1JKR C;  2XGC A;  4D5C A;  3UKG A;  4JX4 A;  5M3M J;  3LSP A;  2EZK A;  3S14 J;  1K83 J;  4A3D J;  5C4X J;  1VI0 A;  5IOZ A;  5EEA A;  4S0H B;  5IP6 A;  2HOA A;  5IP7 J;  4B4C A;  4I76 A;  5F0C A;  1FJL A;  2R5Y B;  4C3H J;  1LE8 B;  1ETK A;  1BA5 A;  2TRT A;  4XID A;  5GPA A;  5F04 A;  4QIW N;  2YS9 A;  3ZQI A;  3GTQ J;  5DTD A;  1A5J A;  3LNQ A;  2FX0 A;  2CUE A;  1TWA J;  3I4M J;  1ZQ3 P;  2NVX J;  4D5F A;  3BR0 A;  2LKX A;  4BY1 J;  3H0G J;  4HNV A;  1F36 A;  1XC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...