1G2HA

Solution structure of the dna-binding domain of the tyrr protein of haemophilus influenzae
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
b'SAVISLDEFENKTLDEIIGFYEAQVLKLFYAEYPSTRKLAQRLGVSHTAIANKLKQYGIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN TYRR HOMOLOG
publication title Solution structure of the DNA-binding domain of the TyrR protein of Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transcription
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18024 HTH_50 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1g2hA00
1S7EA 3NAUA 3LSGA 2JJ7A 1WGXA 1Y1VJ 3BR0A 2VKVA 2E1OA 1DU0A 3S17J 1FTTA 1OFCX 3BG5A 2HQ5A 2WV1A 2X6OA 2DA4A 4EEFG 3Q0UA 1CQTA 3HDDA 2FJ1A 2OF7A 1RKTA 2HOSA 2W48A 1ZK8A 1ITYA 2M2EA 1JKPC 1ZKGA 2WB1N 3JRBA 2R5YB 3GTQJ 2FX0A 2RAEA 4MLOA 2HOAA 3BTIA 2ID3A 1MH4A 2ME0A 3DCFA 1Q1VA 2KT0A 4DYCA 3O8GA 3S16J 3HBLA 2R7ZJ 2HXIA 5K7HA 3TEDA 1ZTRA 2DN0A 1W0TA 3JR9A 1ZGWA 1ETWA 3JRIA 2XSDC 1TWFJ 2CUFA 2DA1A 3QPLA 2DTZA 4RDUA 3ZOBA 4J19A 1VFCA 2DA6A 5EGOB 1JT6A 3S2DJ 1TWGJ 1VNDA 1TWHJ 4A3CJ 1TWCJ 1MBHA 3BQZA 5FKKA 3ZQHA 1PUFB 2R5YA 4M3BA 3JRFA 1Z77A 5FKOA 3ZQGA 2IBDA 2Y2ZA 5FJ8J 5IP7J 3O8HA 2EZHA 3LSJA 1Y1WJ 2E2IJ 1AKHB 3RKQA 3UKGA 4D5CA 4CYCA 2MG4A 3ZQCA 1K61A 2LD5A 1HDDC 3IH3A 2ZB9A 3TW6A 3LSRA 3FK6A 4DYRA 2XB0X 5FLMJ 3Q0VA 5M5XJ 1X2NA 2Y30A 4ABZA 2XRLA 3BTJA 2DA3A 2L7FP 2CJJA 3GTGJ 2QF7A 5EGOA 1P7IA 2NVQJ 1UHSA 1R9TJ 4QSHA 1D5YA 4IHYA 1IRZA 2IEKA 1PUFA 3JRAA 4BXXJ 4A3DJ 3E7LA 3OSFA 3BG9A 1AKHA 5C3EJ 1IV6A 1FEXA 4W1UA 3HKZN 1H88C 2XPUA 3ZQFA 2H1KA 4QIWN 1IG7A 2G0EA 1LFUP 1E3OC 2CQXA 2LY9A 1BW5A 1IC8A 4GFBA 4W97A 1IJWC 1XS9A 5M3MJ 2YU9J 4B3AA 1TC3C 2DJNA 4DZJA 2LTPA 3BR6A 2DMUA 3LOCA 3JREA 2FD5A 5EEAA 1MBFA 4X1EA 3JRDA 1RPWA 1MBGA 1FIPA 3CCYA 1X2MA 3K2AA 4IHXA 2EZIA 1IUFA 1NTCA 3Q3SA 4AC0A 1P7JA 1RETA 2XB5A 1FTZA 3CDLA 4XICA 1GT0C 2E19A 2ECCA 4M3GA 4QTRA 1ORKA 2JA6J 2LKXA 4DZPA 9ANTA 5GP9A 2NVYJ 5EF6A 1H8AC 1JGGA 2JA7J 3BG3A 4MFDA 5F27A 2DMTA 4A3JJ 1I50J 2VI6A 2TRTA 2L7MP 4IHVA 2OPTA 2P81A 3W6VA 2K40A 3PO3J 4CYCB 1GUUA 4C3IJ 2MSYA 4DW6A 3QPSA 3LNQA 3QQAA 1WH7A 4XRSG 4FCYA 1W0UA 3IV5A 4HNVA 1JKOC 5E3LA 5J3LA 1MSEC 2E2JJ 4IHWA 2EZKA 3A03A 1JTYA 3S1MJ 4A3LJ 5M3FJ 1U9OA 5IP6A 3HOYJ 3TP3A 1T33A 2Y9YA 4FE4A 4C2MJ 2EBIA 3ZQLA 1IGNA 1F43A 1U9NA 1WCMJ 4L5EA 2M0CA 2R0QC 3GTKJ 3RZOJ 1IDYA 1YRNB 2AO9A 2DMQA 4Y7NJ 4FE7A 2I10A 5EZGA 3S14J 3JRHA 2DA7A 4XIDA 2ID6A 5IP9J 1B8IB 3I4NJ 1T56A 1OJLA 1O4XA 3BR1A 2ELKA 2NVTJ 4A3FJ 2LK2A 3HOXJ 3RZDJ 1QPIA 3SFIA 4RBOA 1EF4A 5IOYA 1HCRA 1JUMA 2JA8J 2EH3A 3C2BA 5DS9A 3BR3A 2VKEA 3MN2A 1ETQA 3G1MA 2L9RA 1HDPA 3S15J 2VUMJ 2B63J 5C4XJ 4S0HB 1GDTA 1JT0A 1JUSA 2O7OA 2VPRA 1YRNA 4Y52J 1XC5A 2IAIA 1XG1A 2E2HJ 4A3GJ 2GM4A 2H8RA 2YUSA 2M9HA 2COBA 2K9SA 2NVXJ 3HOZJ 4AYBN 5IOZA 3JRCA 1B8IA 5FKLA 2N8GA 5E3MA 3A01B 5IYBJ 3H0GJ 2EZLA 1U8BA 3Q0WA 2XPVA 1ETYA 2XGDA 1IDZA 4BKXA 1ETKA 5C4JJ 4FTHA 1VF9A 5K7FA 2HI3A 3IH4A 2M8GX 2K9NA 2DA2A 3HOVJ 2L0KA 3LSPA 3TW7A 3WHCA 2MGQA 2GBYA 5E3OA 2O9LA 1MNMC 3MVPA 5C44J 3JRGA 2HXOA 3IH2A 3GTOJ 2EQRA 1JUPA 4JYKA 5M5YJ 3DEWA 5F04A 1UG2A 1MBJA 5J1YA 4BY7J 5F0FA 4MFEA 3D1NI 2KDZA 5M5WJ 2R93J 1LE8B 1BA5A 3A01A 2LFBA 3FIWA 1FJLA 4JX4A 2HDDA 1OCPA 3S1RJ 2PMZN 3HM5A 3GTJJ 4NDLA 3G1LA 1BW6A 1HOMA 2DMNA 1SANA 5EDNA 3PO2J 2D5VA 2LP0A 2XPWA 2ME6A 4JX5A 1ETVA 2XGCA 4C3JJ 2X48A 3HOWJ 3SJMA 5JLXA 4XRMA 3HOUJ 2YS9A 5J1UA 5F08A 5JLWA 1JJ6C 5DTDA 2JK3A 2LVSA 1ZQ3P 2JMWA 2LR8A 1MSFC 1WPKA 2GLOA 4XK4A 3F0CA 3BTCA 2CU7A 2R92J 4FISA 1WH5A 4IEJA 3M3YJ 4V2GA 1QRYA 1ZR4A 1LE8A 1POGA 3A02A 3BR5A 4D7NA 4XRSA 1ZR2A 5GPCA 1U78A 5BNGA 2ECBA 3OIOA 4M3DA 3NARA 1NK3P 2HYJA 4AUXA 4A69C 1MBKA 1GV5A 1SFOJ 2CRGA 4C3HJ 3K7AJ 3GTLJ 1RKWA 3CMYA 5F0HA 1TWAJ 3BTLA 1OCTC 5FLVA 1I6HJ 3G1OA 2M34A 5GPAA 2TCTA 2AHQA 2K9QA 1H89C 1Z0XA 3WHBA 1VI0A 3HGGA 2JN6A 4MIMA 1AU7A 4LOCA 3ZQIA 3VPRA 3FKIJ 4M3EA 4A3EJ 2LLKA 3OOUA 1QVUA 5IYDJ 2JWTA 1ENHA 2QCOA 5FKNA 3GTPJ 1A6IA 1X58A 1JJ8C 1ETOA 1JTXA 2O8KA 1GV2A 3BQYA 4BBRJ 4A3BJ 1HLVA 2XGEA 1UMQA 2NOGA 4BY1J 5HODA 3GBGA 1A5JA 3GTMJ 5J1RA 4I76A 4JP0A 1G2HA 5F0CA 1RESA 3BT9A 3B6CA 4A3MJ 4B1RA 1FIAA 4JX6A 3MKLA 4D5FA 3OSGA 2MW8A 2NS7A 1AHDP 1QVTA 4BBSJ 3SDGA 4UUSB 1MBEA 3S2HJ 4X6AJ 4V2FA 4A3IJ 5EG0B 1K83J 2CUEA 1B72B 3HGYA 4A3KJ 5EZHA 1APLC 5IYCJ 1ETXA 3BR2A 1GVDA 1I3QJ 1F36A 2R5ZB 1BJZA 1MH3A 1DU6A 2Y31A 4B4CA 3TP0A 1JKRC 2Y9ZA 5F1JA 2L7ZA 5K7ZA 3RQIA 2CQQA 1RR7A 2Y0SN 5E3NA 3FISA 1WI3A 2X9DA 3M4OJ 2HOTA 4G12A 2DA5A 2FQ4A 3FK7A 4MO7A 3CQZJ 3I4MJ 1BL0A 1LFBA 4UUTA 4A93J 3HEFA 5IPAA 1JKQC 2NS8A 1HF0A 4UUSA 3B6AA 3H3VK 3L1PA 5EG0A 3HB9A 4M3FA 4D7MA 2DMPA 3S1QJ 1B72A 5FKMA 2JA5J 3S1NJ 3PM1A 2WAQN 4I6ZA 4M6VA 1NK2P 2R5ZA 5EYRA 4DYQA
chains in the Genus database with same CATH superfamily
3NAUA 4WXDA 3LA2A 3DKYA 3IKTA 5FB2A 2JRMA 1IN6A 1FOWA 4LLNA 1QNTA 2W4SA 2M7AA 1S7OA 4B09A 1IRFA 4LB6B 1FTTA 4PCQA 4F91B 3BG5A 2M7BA 1WWXA 3Q0UA 2OF7A 4OMZA 3QYBA 4HDVA 3N4MA 2WB1N 1FBUA 5E1XA 3J7ZI 1KU3A 2R5YB 4RAFA 2VQGA 1NG6A 1Y39A 1NHAA 4BJTA 1T0FA 2RAEA 2WY8Q 2UV1A 4HV5A 2V6CA 4Y33A 4BAYA 3ZP5A 2A6HF 1TQIA 2Z16A 1JHHA 4GDFA 1BBYA 2ID3A 1DQUA 1MH4A 2WTEA 3GZ5A 4DYCA 3PL8A 3HBLA 2E7XA 2Y69H 1TP4A 2E1CA 1DGWY 1UJ8A 1MGTA 1R22A 4ENNA 1ZTRA 1HKTA 2KQRA 4MQVA 3DBLB 1SVMA 5LHGA 1OCRH 5D5VB 3PIPF 1YJ9I 1J9IA 3CUQC 2NYXA 3U1DA 4J19A 5LHIA 5BPDA 3P5JA 5EGOB 1TWGJ 4PJJA 2JT1A 2K9MA 3BQZA 5FKKA 3HOSA 4M3BA 2OBPA 3OL4A 3JRFA 3ZQGA 2VJ4A 2Y2ZA 5IP7J 2DFEA 3JTHA 2EZHA 4RB0A 3CUOA 5CVJA 1LQ1A 4M72A 4CYDA 1Y0UA 3U9GA 4F92B 1WFXA 1D0XA 1YW7A 2DT6A 4IQ4A 3ZQCA 3CF2A 4C2TA 1X1CA 4PJLA 1L3LA 3CP8A 3IH3A 5K1YA 3KIOA 1HDDC 3FWEA 3ECOA 4KJZA 2JSPA 2K02A 5FLMJ 1JI8A 3RKYA 2Y30A 4ABZA 3A0BC 4LMYA 1R1TA 2XRLA 2RV8A 5J47A 1SD5A 1XSVA 4N9IA 4BEHB 2XF6A 3IRRA 3I54A 2LH9A 5H20A 4AWXB 4KICA 4KT6A 4XN3A 4RGUA 4ON0A 3E7LA 3BG9A 5C3EJ 1IV6A 3K0LA 4W1UA 3KZIC 4E7IA 2QZ8A 3CDIA 4HW0A 2GIVA 1OCZH 3TO7A 1RRJA 4QIWN 1IG7A 2RN7A 1WJFA 2GXAA 2LY9A 3VYUB 2L3DA 4GFBA 4ZYHA 5KAIC 5M3MJ 5HS7A 2EWNA 3FXOA 4B3AA 2GAUA 3C3WA 3BJAA 3BR6A 3R60A 5GAHJ 2P8TA 4L9TA 1J2XA 1HKSA 2DMUA 2M45A 2HPIA 3LOCA 3SXYA 3ZMSA 4F52A 3JREA 1VQLI 4Q47A 2B7EA 1ZARA 3JRDA 1G6NA 2EA2A 2WA0A 1DPRA 3K2AA 2QGUA 1LFPA 1YW8A 1P7JA 1RETA 3JTGA 2CQ7A 4LIUA 4FQGA 2UZKA 2ECCA 2XV4S 1EV7A 2A61A 3SHFA 3QU6A 3WU1B 2IGKA 4E7ZA 2V9KA 3WGGA 1SFUA 2NXNB 1ODDA 4DOZA 4KT5C 2PMUA 4XOTA 1PP8F 2DFFA 1IXRC 4WF2A 3M8EA 1I50J 4LGWA 2L9SA 3CP2A 4Y3OA 2L7MP 3CTAA 4XSXF 4IHVA 3PUBA 1P4XA 4A12A 2H94A 2JSCA 4C3IJ 3QPHA 2XVCA 5L3BA 5LFAA 3KEOA 2VT2A 3LFUA 4BHCA 1WH7A 1VQ6I 1IN7A 2IA2A 4M6XA 2EZKA 2RC4A 1JTYA 4NC8A 4I2OA 3HIFA 3UR3C 4JBAA 1WRJA 1U9OA 3AG4H 2X1EA 3TP3A 3RI4A 3K70C 3S8PA 4ASNA 1QQIA 4M9XA 4C2MJ 3GW2A 2HYFA 2KL4A 2LBFA 2DCEA 5CVIA 5EEGA 5CKTA 3K4KA 4RM3A 3RZOJ 1YRNB 1FP2A 1DPUA 3G2BA 5EZGA 3S14J 5EJCA 1ONVA 2IA0A 4XRFA 1YIJI 4KDPA 2PX9A 3KLNA 5JHUA 3BR1A 1HA8A 1S6LA 2E71A 1K4SA 5FD6A 3HOXJ 2M0MA 2E36A 4QWQA 4XLFA 5IOYA 3OR1C 3DP7A 2DU9A 2DW4A 2JA8J 4E7JA 4P5OA 2QQAA 5CYVA 4XLNF 1IV8A 3S15J 2X0LA 3FBIB 1YO5C 2VUMJ 3CCEI 2B63J 1E17A 3H36A 1GDTA 1OYIA 1UELB 1TNSA 1JUSA 2VPRA 1K79A 2A07F 4Y52J 1XG1A 4BQOA 1K6OA 2H1LA 5IOZA 2MH2A 1FLIA 4OU0A 1G3YA 2N8GA 5CLSA 3A01B 3BG7A 4CCOA 3K1MA 3HRMA 2R7VA 3Q0WA 2W25A 4G7HF 2EFPA 2FEZA 2DT5A 3DV8A 3L9FA 2HFHA 4BKXA 3ECHA 3OYNA 3CMMA 4UY8I 3IH4A 2ZC2A 1R4MB 1O3RA 2K9NA 4B44A 2WWYA 3HOVJ 1QU3A 2L0KA 3SZPA 3TW7A 3WHCA 5E3OA 3FMRA 4UXNA 2O9LA 5FFZA 1VQOI 2E5ZA 5C44J 2H8WA 3JRGA 2QBYB 5E18F 2HXOA 4ESFA 3BZCA 2XAGA 3E97A 3W6KB 1UG2A 5HLTA 5J1YA 3QYFA 4XQFA 2V1UA 2R93J 2Q2EB 2CW0F 3VOEA 5J6XA 3HUGB 1SD6A 2O8XA 3EQLF 1OCPA 3KP4A 1LB2A 3RJPA 2KZVA 4CCNA 4HX8A 3TKYA 2BV6A 1BW6A 2DMNA 3F8BA 1JHFA 3HL2A 3SDBA 3HTSB 2QQ8A 4E70A 3WTUC 3KP5A 4JX5A 1SC7A 2BGCA 4C3JJ 1JGSA 2A69F 4K2EA 3SQNA 3HOWJ 1USTA 3Q9SA 4E7HA 4NC6A 1IRGA 2ZNZA 1WPKA 2L2OA 3QP5A 2GLOA 4XNFA 3F0CA 2VQLA 3BCBA 2CU7A 3BTCA 3FXLA 4HSTA 1EH6A 3C7JA 5L3GA 4FISA 1KU2A 4PUSA 1XGNA 1ZELA 1QBJA 1WJEA 1S3JA 4XLCA 2XUBA 3K1PA 1ZR4A 1LE8A 4AM3A 5HDGA 4UHTA 2CS3A 2KLOA 3BR5A 4D7NA 2VQCA 1ZR2A 4IX7A 1DGRM 2ECBA 1WZ2A 3Q9VA 4YIIA 1Y8QB 4IVNA 5E17F 1WJCA 3FXQA 3KPHA 2ACJA 1U3EM 1SFOJ 2CRGA 4I99C 2BY1A 2BYVE 3K7AJ 2MABA 1KQ8A 4E7SA 2L9VA 5FLXK 1RKWA 1OCTC 2F5FA 2OTLI 3FMSA 1V5GA 1MNDA 1O7LA 1W4MA 5GPAA 1Z0XA 2EA4A 4AIKA 2JN6A 1VQKI 3JSPA 2DOAA 4G94A 3D5RC 3ZQIA 2IGOA 4M3EA 3CCRI 2LLKA 3I59A 1D1CA 2ZNYA 3OOUA 2MLKA 2VC0A 1ACIA 4IQJA 2ESHA 3HRSA 4NBQA 2FRHA 1ZRDA 3CJQB 2YPRA 2EIMH 5FKNA 1X58A 2M1BA 4BE1A 3IAM2 3V8KA 2QKLB 4U7DA 3JSOA 2XGEA 1UMQA 2NOGA 1BOBA 3KP6A 5HODA 3GBGA 4KFCA 3I4PA 1A5JA 5DDGA 2HPMA 5J1RA 4I76A 4DGWB 4L9VA 4KMUX 4A3MJ 3F8CA 2NNNA 1GXPA 3OYDA 3BZKA 3DQVC 3E0JB 1QGPA 3VYSB 1T39A 5H6QA 3OR2C 2ZFWA 2M4KA 4X6AJ 1X19A 5KK1A 1WJAA 4AU7A 5D4RA 1RI7A 2KPMA 2X4HA 4U7BA 4A3KJ 5LD2C 5EZHA 3J80K 1APLC 4Y15A 2FBKA 5IYCJ 3BR2A 3ELKA 2EFNA 1WJDA 2EFQA 3WE3A 3CUQA 4GGGA 2IGNA 4HPQA 1JKRC 3EDPA 5K7ZA 3RQIA 2XF5A 5E3NA 2R7WA 1WI3A 2X9DA 2DPDA 1FZPB 3HZJA 4G12A 2K27A 5DCMA 1YX3A 5KHDA 2DA5A 2FQ4A 3H5RA 2CO5A 3CQZJ 2R7SA 4NB5A 4UUTA 3A1YA 2CFXA 3HEFA 5LHHA 2JA2A 1HF0A 1U6GA 5DM6F 4UUSA 3WGIA 3TO9A 3CC2I 2VJIA 4M3FA 1RUNA 4DBRA 2YX4A 5CQGA 2KRHA 3HPGA 3F6VA 1U0JA 4EJWA 1WI9A 3OYJA 5D5WB 5LLQA 3CJRB 4LG0A 1NK2P 3EETA 2R5ZA 2DQRA 4OIQF 5EYRA 1Z7LA 3M07A 1S7EA 4G6TB 4BXFA 4JQFA 4UUVA 2E1NA 2BY0A 3P7NA 2VKVA 2E1OA 4WXHA 4CUGA 3CLOA 1DU0A 1HC8A 1EH7A 1VQ8I 5ICCA 3FMQA 2V4JC 5A2QZ 3V8LA 2HQ5A 2ELHA 2P7VB 2DOFA 2EV5A 4EEFG 3HDDA 2VC1A 3JCUC 2FE3A 4RGRA 4BDYA 1G59A 1KQ0A 4X0GA 1PJRA 1ZKGA 2D2WA 2TDXA 2VL8A 3M1CA 1BC8C 1FOXA 3ASOH 1K78A 1BM9A 3GTQJ 2Y75A 2CGPA 3KFWX 2FX0A 2O5RA 2HOAA 1QZEA 3BTIA 3I58A 2KMUA 2MA3A 3TGNA 5DD8A 1IUYA 4Y4RA 5HNFA 4E6KG 2R7ZJ 3V8JA 3QRFF 1J5YA 1DDNA 4AIJA 2IJLA 2JQ7A 2DN0A 3H9QA 3PNYA 2HS5A 4LJZF 4HNTA 1ETWA 1ZGWA 1V5EA 3FKJA 5DUIA 2O0YA 2VN2A 2HTJA 4DQ2A 3U2RA 1D8KA 1T95A 1TWFJ 2CUFA 3AL0B 2DA1A 3OS2A 2FXAA 2K9LA 2WADA 3ZOBA 5IT9Z 1VQPI 3S2DJ 1VNDA 1CF7A 3I64A 1TWHJ 2EV0A 2PG4A 1ZN2A 3BY6A 4I7HA 1UCRA 3J7YJ 2ZO4A 4XORA 1Z3XA 5F64A 4RGXA 5FKOA 1F1ZA 2A3SA 2ZFUA 1MJAA 4HQMA 3CMEI 2E2IJ 2V9VA 3RKQA 3DU6A 2EFOA 2F4MB 4D5CA 5JVGF 1Z67A 3UKGA 2I5UA 4CYCA 2MG4A 2PQ8A 4KUMA 4LITA 2DDAA 4ZYDA 5DM7F 3WTWC 2K3FA 2LD5A 3QWLA 1ZH5A 2ZB9A 3ONQA 2BXYA 2W82A 3TW6A 4L5JA 3LSRA 4II2A 2P5VA 4DYRA 1MMSA 4CSWA 2XB0X 5M5XJ 1Z7UA 1N78A 1R1VA 1B4AA 2X51A 4FT8A 4E7LA 3WG9A 3BTJA 2L7FP 2CJJA 5JFRA 4M9ZA 4M9SA 3ABMH 1S5LC 5B3SH 2OZUA 4CO8A 1E3HA 1P7IA 3KZZA 2NVQJ 2ZXIA 5H2FC 1E0EA 4QSHA 3CESA 1YS6A 1D5YA 3F9KA 4IHYA 2IEKA 3AG1H 1PUFA 3ZGKA 4UNOA 4Q5SF 1H9GA 4M6YA 4PK4A 3VSKA 5F1RA 5GTIC 5FO5A 4A3DJ 4BXXJ 4YELA 1W7PA 2Y0SA 3ZRGA 2DODA 3F72A 1FEXA 3A2KA 4NHJA 1OQYA 3IKVA 4I02A 1G3SA 1I5ZA 2LMDA 3NWSA 3NEUA 1V3FA 3K10A 2IS4A 2IS6A 4P9FA 3EYIA 1YFHA 4BNCA 2G0EA 2KHMA 3H1CA 1LFUP 1E3OC 3VWBA 2CQXA 1BW5A 4MQ9F 4R79A 1IC8A 4EJOA 1P4AA 2QYOA 1T98A 3TOBA 1IJWC 2P4WA 1U5TC 2W1OA 4H4KC 4RM2A 1VQNI 1PYVA 2DJNA 2HQNA 4BQNA 2VJJA 3U21A 2KRCA 2LSOA 2VASA 1R23A 2FNPA 1OPCA 3OYIA 1PUEE 1X4PA 4IJAA 3PNVA 4C2UA 1R00A 5HOOA 2HTSA 2DJIA 2HZDA 3HG9A 2JPBA 4X1EA 2R7DA 5D5UB 3ERMA 1MBGA 3CCYA 2JRTA 5CQEA 2MYSA 3E6CC 2GA2A 3HRTA 1REPC 4ZZLA 1IRXA 3PSFA 3IHUA 3ERED 2C6YA 4HLXA 1FTZA 3T8RA 4XICA 4H0EA 1GT0C 3WU0A 4XKVA 3LFKA 2BY3A 1LEAA 3CJNA 4RA2A 2EK5A 5D6FA 5HLHA 1Y0NA 1XN7A 4QTRA 3ZPLA 4PDKA 1S7AA 2LBFB 4L9JA 9ANTA 1R36A 1Z21A 5KNLA 6PAXA 2DDBA 2KIMA 4ZYAA 3W2WA 5BQTA 2X6YA 1SD4A 3BG3A 1JGGA 2HEOA 3I56I 3CCQI 5L3CA 3CCMI 2K40A 5FRMA 3OY9A 1I1SA 1D0YA 2AQFA 2A6EF 3HXLA 3QQAA 3G71I 1SMTA 3CCVI 4XRSG 1YITI 1USSA 1W0UA 4DBQA 4I09A 3F23A 2QA4I 5E3LA 4ZDLA 1MSEC 3BWGA 4CGZA 1IN8A 1B9MA 4A3LJ 3K9TA 3M8FA 4O3MA 1V5FA 2PN6A 2Y9YA 2STWA 1T6SA 4HDUA 2HVRA 3ZQLA 2EBIA 2FMYA 1F43A 5DEQA 2ZXJA 2GA1A 1KONA 3GTKJ 1BI0A 2AO9A 2JVHA 3AFHA 2I10A 3T1BA 1ZHFA 2F4IA 3JRHA 4CZCA 4XLAA 1N77A 3I4NJ 4HEA2 3ZR8X 1OJLA 3ZMDA 1U2WA 4ENJA 2K4BA 1YJWI 1W36C 3WU2C 2DLLA 1OR7C 5E1WA 2BZTA 1KYWA 5HS8A 3CDHA 4OIOF 2ELKA 2XAFA 3GEZA 3MZYA 2VBYA 1SFXA 1G4DA 2E1MB 4RBOA 1EF4A 1HCRA 2K3PA 2EH3A 2DQLA 1VZ0A 5DS9A 1FP1D 3BR3A 1ETQA 3G1MA 3U1KA 3BZ6A 4HX4A 4O5VA 2PJRA 3GFLA 3GX4X 3I5UA 3OIQA 1JT0A 1W7PD 2DFHA 3K70D 1XC5A 2IAIA 3MQ0A 4DIQA 1J59A 2GM4A 2M3AA 2YUSA 3GVAA 1ZGJA 1EA3A 2IPQX 3EPZA 4AYBN 3JRCA 1ON2A 3HOZJ 1FY7A 3LQQA 1B8IA 1QA6A 5FKLA 4EM1A 1P9QC 1SD7A 2O61A 5J4YA 2ZSIB 3W3CA 4Z6YA 1TT0A 1BIBA 2XPVA 3KETA 5KCMA 1ETYA 4CH7A 2XGDA 1U8RA 2XSJC 4FTHA 2LKSA 2M8GX 4HQEA 4S05A 2DA2A 4BDZA 1IZ1A 3LSPA 4G8XA 2R7RA 1RR8C 1E3PA 4UB8C 4CCMA 3MVPA 2RQPA 3QYEA 3OV8A 3IH2A 2IW5A 3GTOJ 2EQRA 1JUPA 3WE2A 3OS0A 5M5YJ 1RC9A 3IL2A 2CV2A 2D1HA 4ZDPA 1FYMA 3DTKA 1B9NA 2IP2A 3FXUA 4BY7J 4CICA 1XMKA 1KU7A 1ZLJA 1LE8B 4EMSA 3H92A 2LFBA 2CQNA 2EV6A 2HDDA 3ESWB 2PMZN 4IKFA 4HAMA 2WAEA 2MC3A 1LNWA 3UNGC 2OCCH 3G1LA 5ILUA 3ZMVA 1HOMA 3BPVA 5EDNA 1HQCA 2E34A 1ZRFA 5HLGA 3BC8A 2ME6A 1ETVA 2LRDA 2XGCA 2X48A 3E6BA 3DPTA 5IY5H 4XR6A 3GFJA 4KIFA 4NUBA 3NQOA 2JTVA 5F08A 2BW3A 3GLLA 4MTEA 3EUAA 4XLPF 4XK4A 4EJVA 3CZ6A 3HTUA 3I59B 3LMMA 1SFEA 2M4GA 4IRIA 1QRYA 1A31A 5B1AH 2YSRA 4IPAA 5JVTA 3V7CA 1S9HA 5GPCA 1XMXA 3FM3A 3IP4B 2VT3A 1UB9A 2P6SA 1FC3A 3IUOA 3NRVA 3OIOA 2VODA 3DXJF 3NARA 2HYJA 3HRUA 4ZDOA 4A69C 3TDUC 1MBKA 1XD7A 4WXCA 1J09A 3SEQA 4XBFA 1DP3A 3GTLJ 1MMDA 2BBYA 2QSGX 3KE2A 3DLAA 1TW2A 2K5CA 3TBIA 2IS2A 1G3WA 3CMYA 1TWAJ 3BTLA 5E20A 4A5MA 1RUOA 2UUZA 4HOBA 2TCTA 2AHQA 2K85A 3COAC 1FPQA 1VI0A 2QSHX 3MKWB 4IO9F 2O03A 5D8LB 2EILH 2ADUA 3RYRA 1AU7A 3JAMZ 4BQQA 2H27A 4A3EJ 2YX7A 2HWVA 1YW9A 4B48A 2XRNA 1QVUA 5IYDJ 2JWTA 2Y48A 2V7FA 2OQRA 5BS6A 1ENHA 4HRIA 3GTPJ 1TW3A 3I0TA 3E6DA 4F3QA 3CUQB 3MCZA 5J40A 2ETHA 2XKPA 2OAZA 5CJ9A 4HF2A 1QZYA 3LWFA 1QO0D 2FMLA 2VB6A 3E3VA 4XKCA 5D6EA 1G2HA 2UXXA 2LNBA 5DCMB 2ZMEC 2VKDA 1RESA 2LG4A 2VE8A 2Q8KA 3CC7I 4JX6A 4D5FA 1OCOH 2NS7A 1YHQI 4KISA 1OKRA 4HG2A 3W6JB 2X6WA 2MD5A 4UUSB 1MBEA 1PDNC 2KZGA 4V2FA 5ICFA 2CUEA 2VXZA 2CG4A 2PI0A 3S2WA 1T8IA 1P6RA 2BHYA 4QPQA 1X3ZB 2WC2A 1I3QJ 4LG0B 2V1XA 4XKBA 2R5ZB 3KP3A 4RLFA 2Y31A 5AONA 2PJPA 4RS8A 2Y9ZA 2GZWA 1YX5A 1FX7A 4O6JA 1OMIA 2CQQA 3ZQQA 4OAYA 1H0MA 4MO7A 4QLCU 1MDMA 3I4MJ 2V79A 1BI1A 3O2PE 1ZREA 2ESNA 3P9IA 3WGHA 3FXRA 5IPAA 1JKQC 4KYWA 4PFOA 5DCFA 5TJJA 3IRQA 3M1EA 2F5DA 2OTJI 5EG0A 2F5VA 2DTRA 1K78B 2QSFX 2DMPA 3VYTB 3S1QJ 1B72A 4HF0A 1FBQA 4JK1X 4M74A 4XMYA 3VDXA 2HNHA 2VQHA 4P9UA 2XAQA 4I6ZA 3M7GA 1MJBA 3JW4A 2V26A 5TRDA 3LSGA 1WGXA 1Y1VJ 3KYLA 3F6OA 3E5UA 4A2UA 3CCLI 4PFPA 2E5NA 4CCJA 3S17J 1OFCX 2WV1A 2X6OA 1UHMA 2DA4A 2RDPA 2IT0A 2FJ1A 2HOSA 2BVMA 3PQKA 1CF7B 1SEUA 2QKMB 1ZK8A 3K4LA 1ITYA 1KU9A 1O7FA 3TL4X 5GTHC 2V1NA 4EVIA 1MD0A 2ZSHB 3JRBA 1WJBA 1VQ7I 3V42A 2KJBA 1BI2A 1UZCA 2LREA 2F4OB 2HZTA 4UVAA 4ITVA 3PFYA 3F3XA 3DCFA 2ME0A 1Q1VA 2KT0A 5TGTA 3O8GA 5FGMA 3S16J 4WCGA 3J81Z 1U5TA 1ZLKA 1W5TA 4MNUA 1MNEA 3WTVC 5K7HA 3OYKA 3TEDA 1CGPA 4I98B 3JRIA 2XSDC 2DPUA 2XHKA 1J7KA 2P0WA 1OYYA 4S04A 2QLZA 1LEBA 3H5AA 3OYCA 3QPLA 4RDUA 2KIUA 2JPCA 2QUFA 2DA6A 1LDKB 1MMGA 4A3CJ 1D5VA 1HSTA 2DFIA 1TWCJ 1MBHA 2GQQA 3ZQHA 4EQQA 1PUFB 1Z05A 2X85A 1G3TA 4J01A 3V4GA 1ZGAA 2ZXHA 4GO1A 2LOOA 3LSJA 1W7PB 1Y1WJ 3ULQB 3TQNA 1O3SA 4OMYA 3GLXA 1YYVA 2DK5A 2VXDA 4G7ZF 2QEXI 1OLTA 2D1VA 4ZH4F 1K61A 5HVQC 2JVGA 4LLLA 4LK1F 5LBQA 2BXZA 3Q0VA 3BDDA 4LG3A 4M73A 4BQAA 3TDZC 1ZG1A 2O3FA 1N75A 1TTYA 3ZCOA 3H9JA 4A0YA 4KIGA 2NRAC 1LKXA 2KRFA 1IRZA 3L2UA 2O6GE 1GXQA 2G9WA 3L09A 2HVSA 2CH0A 3GCMA 1G8XA 3DTIA 1Z9CA 1LUJB 2R4GA 1AKHA 2J5OA 4MTDA 4YRVA 1C0WA 3HKZN 4NQWA 2IGMA 3DBHB 1W5SA 4E4HA 4YIRX 2PMHA 3ZQFA 4L18B 3G73A 1SMYF 2A68F 4L9NA 5E79C 4MGRA 1HXDA 4XN0A 1YE9A 1IXCA 3MKYB 4W97A 3S93A 2I8DA 1OR7A 2DK8A 4GYIA 3RSNA 2KISA 3IAS2 3FXMA 4G9YA 1D1BA 2LTPA 2A5YB 4DZJA 3SZTA 3CO7C 2BHZA 2QVOA 3CLQA 3FF5A 4B3XA 2L4AA 3HJEA 2VBXA 1MBFA 3FHZA 4G6DA 1FIPA 2GWRA 3KZYA 4ZTFA 4XONA 5FFXA 4CZZA 3Q3SA 4AC0A 3Q5FA 4GXOA 2LDUA 3CDLA 3GXOA 5CVVA 3CC4I 5L3FA 2VJ5A 2FBHA 2ZJPF 1XDSA 1ORKA 2OCEA 1FMVA 3S3MA 2JA6J 2VOOA 2KP6A 1Z6TA 2R7FA 2V1DA 4RGSA 3T8TA 2LKXA 4DZPA 4BE0A 3DBRB 4Q48A 1IN5A 1R5HA 2NVYJ 3BJOA 2GXGA 4ENKA 3H0DA 4A3JJ 3OYGA 2QBYA 2L4MA 3GUDA 2P81A 3W6VA 4BACA 3PO3J 1IO2A 2ZJQF 2MSYA 3DLLF 3QPSA 2B9SA 1RIOH 2PLYA 2FBIA 3ABKH 3C2HA 3ZMTA 1A04A 3IV5A 4HNVA 5LEJA 2NVUB 5J3LA 4AVZA 2E2JJ 4IHWA 1O3TA 3A03A 3S1MJ 3PJRA 3S3NA 1ZAOA 4PGGA 5M3FJ 1QHHD 1XTAA 3F8FA 5IP6A 3HOYJ 1Z1DA 1T33A 2P6TA 2D45A 4KITB 3A0HC 4AD9A 1IGNA 4RMNA 1WCMJ 4A6EA 2BE5F 3ABLH 2M0CA 4UV8A 2OQGA 1X1DA 1IDYA 2ELJA 4N0BA 4EGYA 1OCCH 2Z99A 2FNAA 4FE7A 3WTTC 4A0XA 4D0PA 2CWEA 2ID6A 5IP9J 4C9YA 3VODA 1B8IB 3D5LA 5IT3A 4OIPF 2R7UA 2BVLA 4II3A 2KFDA 4YIFA 1YS7A 2BEOA 4XSZF 2F2EA 4HBLA 2KIQA 3AG3H 4YEJA 3F8NA 1O3QA 4A3FJ 1SFKA 2LK2A 1IAWA 1D0ZA 3RZDJ 2UXNA 2RQQA 1QPIA 3C18A 4BYYA 2A5WA 1LPQA 1JUMA 3C1DA 3C2BA 3GFMA 1TNTA 4G6QA 3K4JA 2VKEA 1Y6IA 2L01A 1XMAA 2L9RA 1HDPA 4N4NB 3ABTA 2NS0A 1AWCA 2GXBA 3OYHA 4S0HB 2HVQA 2O7OA 3D0SA 2E2HJ 4A3GJ 1MJ9A 3GMEA 2COBA 4I0AA 2K9SA 4YFNF 2OC6A 2P5LC 4C30A 3OS1A 3X2QH 1EJ9A 3H0GJ 2RVCA 1XGSA 2EZLA 3K2ZA 2CFOA 1U8BA 3KP7A 1IDZA 2MD0A 4LD5A 1VF9A 1W36D 3OOPA 1OYWA 5K7FA 2HI3A 2RGVA 2VE9A 3E6MA 3T0YA 4N4OB 4B47A 1UG0A 1A36A 2MGQA 2GBYA 2M8EA 3J7AO 2R7QA 5JI6A 2YR2A 3L2WA 5HDKA 2WAQA 4ESBA 4XKWA 2BW3B 1JE8A 3MD2A 2DO7A 3CMAI 4P1WA 2Z1DA 3DEWA 1MBJA 1XX5A 2OD5A 4P96A 5F0FA 4MFEA 3D1NI 3RIRA 2KDZA 5M5WJ 1SAUA 1YIOA 1J0RA 3FZVA 4JX4A 3D5SC 3KCCA 2ZMEA 3S1RJ 1F9NA 3GYHX 3W2AA 2G7UA 4R8HA 4Z2YA 1Y56A 2WB1A 1SANA 3PFIA 4BH9A 3WODF 3PO2J 5F6FA 2D5VA 3REOA 2CQKA 2X1DA 1R7JA 2J5PA 2XF7A 3G3ZA 4EJUA 5BMZA 3DPLC 5JLXA 3QODA 3SJMA 2FSWA 3HOUJ 5J1UA 3M9AA 1ZQ3P 2JK3A 2JMWA 1BR4A 3IWFA 1VQMI 2XDVA 3V7SA 4OWRB 4PGHA 1S72I 1WH5A 2EPFA 2CSOA 4IEJA 3K4BA 4V2GA 1POGA 3TOAA 4YFXF 1TBXA 1X3WB 4XM3A 4XRSA 3RKWA 1F4KA 4U0YA 5BNGA 3QAHA 3QP6A 4M3DA 4YG2F 4IZZA 1GV5A 1XCVA 3MKZA 5KAFC 3GFIA 4C3HJ 5ERIA 1PP7U 2EIJH 1I39A 3K4CA 4BUPA 3LSIA 4EM0B 5BPIA 1WQ2A 3G1OA 4KN7X 1I6HJ 2PEXA 1BI3A 1ZYRF 2R7XA 1R5ID 2K9QA 2QQ9A 5DV5A 4E7KA 3HGGA 2HDCA 3G6EI 3VPRA 3AG2H 1P2FA 3LA7A 1L0OC 2H6BA 4F93B 5J4VA 2CMPA 1A6IA 1JJ8C 3ISPA 1MMAA 1KQ9A 1Q1HA 2O8KA 1GV2A 2VONA 3BQYA 1KGSA 4NNJA 2R3SA 5JHFA 5LGUA 4BY1J 1AOYA 3J7AY 4BL0B 3E5XA 1LVKA 4CHUA 5F0CA 1RNLA 3T5XA 3C2GA 3B6CA 4NC7A 1MDMB 3BOQA 4LK0F 4AYBA 1STZA 2LF7A 1FSEA 4XOPA 3OSGA 1WJ5A 4ANJA 2P7CB 3WTSC 1QVTA 1XCBA 1TLHB 2STTA 1S8NA 5L3EA 3SDGA 3RYPA 3S2HJ 3KX2A 5EG0B 3NWTA 3OL3A 1K83J 4BJ6C 3CCUI 5A2QK 1B72B 5HNHA 1HBXG 3HGYA 2HR3A 2Q1ZB 3FXJA 3WTYC 1ETXA 5FLXZ 1BJZA 1MH3A 1DU6A 5E8GA 5AIQA 4B4CA 5F1JA 2GIZA 2L7ZA 3DTEA 1IN4A 1TT5B 4IOAF 3MAJA 3FISA 4EATA 1X4OA 4OIRF 3M4OJ 2X6XA 2HOTA 5ED4A 1R58A 1K6YA 4UVBA 3AKZA 1X3UA 1LFBA 2HKOA 4FX0A 2VKHA 4RLQA 4LFUA 4RAZA 4IL6C 2WV0A 3RPUA 1XB4A 2DYRH 3RDIA 4KN4X 2F5CA 5ILVA 3FX3A 3B6AA 2PMZA 3H3VK 3L1PA 1Z6RA 4D7MA 5ICEA 1EKEA 2VOPA 1R71A 2LF8A 1XGOA 4MEXF 5IT9K 2JA5J 4WWCA 3PM1A 4LB5A 1TQMA 3LA3A 4GYGA 3DEEA 1U5TB 2QM3A 5CVUA 2JJ7A 3OYEA 3I3LA 4DNCA 5EEHA 2DT7B 1YI2I 1UAAA 3BR0A 3PSIA 3PNTA 3G4SI 1Z3YA 3VB2A 1W5CC 3MWMA 2MLGA 3E1SA 2Q0OA 1FT9A 1SVLA 2Z9OA 5FRNA 1CQTA 1X1AA 1LDJA 1RKTA 2W48A 5ICGA 3J80Z 2M87A 5JR3A 3B73A 2M2EA 1JKPC 2R7OA 3DWLE 2E7WA 4Y17A 4HZFA 1VQ4I 3ZQ7A 5J8FA 4MHGA 1FBSA 3H35A 4MLOA 4HLYA 2VBZA 2R7TA 2RREA 4B43A 2W84A 2YU3A 4WX9A 2QWWA 2PBIA 5LGTA 2DBBA 2HXIA 1XSDA 3KYDB 2HDWA 4ZYGA 1W0TA 2X1CA 3L2RA 3JR9A 3GF2A 2B0LA 4OINF 3KEQA 1V55H 2DTZA 3BROA 5BOXA 1ZG3A 1VFCA 3WG7H 2L54A 2XKOA 1JT6A 4PZJA 4RB2C 3VFZA 4GRIA 4CXFA 4LIVA 4RB3C 2R5YA 1ZG5A 1Z77A 2IBDA 5FJ8J 2ZBKA 3HSEA 1ZRCA 4HX7A 3O8HA 3R0JA 4L0ZB 3EUHC 1B59A 2IS1A 1AKHB 2FOWA 4F55A 2CW8A 1Y8RB 3PUFA 5E8IA 2VLAA 4NQWB 4U0WA 2F5EA 3LSKA 1HSJA 2G7HA 4PJ0C 2W00A 2Y0MA 3P9CA 3QOEA 3FK6A 3HOTA 3M8JA 1NG7A 3LSTA 1X2NA 4IOCF 4HNUA 3P9KA 1GVJA 3W2VA 3L2QA 2V6EA 1P4WA 4BHPA 2DA3A 3OIPA 1YLFA 1R6RA 3GTGJ 5DUKA 2QF7A 5EGOA 2XAJA 1V4RA 1UHSA 2WAFA 1R9TJ 1BIAA 3VYRB 2KDOA 2A6TA 4F7ZA 2IXSA 1LDDA 3BJ6A 4P55A 2BY2A 3OYAA 3JRAA 3ML6A 3HHGA 2OV7A 2ZKZA 4L5IA 3OSFA 3RQ4A 2LY2A 2ZCWA 3DFGA 2HU9A 4IHTA 3CD6I 2L5QA 2XPUA 2M30A 3CCJI 1H88C 2H1KA 2EFWA 3RPUD 1T0FC 2OZ6A 5CPRB 5H6RA 5J8CA 1T2KA 5LRRA 2F6CA 4YFKF 4D1QA 1SVOA 3GWZA 5B5EC 1IF1A 4HYEA 1TL8A 4R1HA 3MMYB 4KA4A 3KYCB 1XS9A 4BEHA 1P92A 1MZBA 2YU9J 1TC3C 4IRHA 5LRSA 4DJAA 1K7AA 2KKOA 3OYMA 2ZJ2A 1R49A 3FDYA 3I71A 2CW7A 3MFKA 2FD5A 2AQEA 3K6GA 2ICWG 5EEAA 3FM5A 1YG2A 2M5WA 4J00A 3H3ZA 4AVPA 1RPWA 2FQ3A 3VEPA 1X2MA 3BLYA 4HA8A 1A35A 4IHSA 2EZIA 4IHXA 1IUFA 4AIDA 1NTCA 2EJRA 4U88A 2CYYA 2XB5A 3RPQA 1AA7A 4KIBA 3CF5F 2E19A 5K5OA 3LAJA 3A4CA 4M3GA 4FASD 1FWZA 1WVRA 1A6QA 3BPXA 1HKQA 1K4TA 1DP7P 2FU4A 3ZXSA 3LL7A 3DF8A 2H6CA 3HPHA 5D5XB 4FHTA 4UV9A 5GP9A 5EF6A 1H8AC 4L0YB 2JA7J 4MFDA 5F27A 1TZLA 2OJED 2DMTA 3LQRA 2VIXA 5HS9A 2VI6A 3HSRA 2NNYA 1ON1A 5ILSA 1HW1A 2TRTA 1QPMA 2OPTA 3O3KA 3AL0C 4BGDA 1B1BA 4A6DA 4CYCB 1GUUA 2OU2A 3R61A 1T08B 4DW6A 3LNQA 4Y13A 4UVCA 4BS9A 1O57A 3F22A 4FCYA 2FOKA 3K1NA 4V19K 2HQRA 3MEXA 1KZHA 2XROA 3S32A 2RKHA 1JKOC 2RNJA 5AIPA 2JZYA 2LC2A 4FX4A 2Z3YA 2L9NA 1I27A 4ZC3A 3GZ6A 2CV0A 2Z33A 2VPLA 1IW7F 4U87A 4FE4A 5L3DA 4AIHA 1U9NA 3CCSI 4L5EA 2R0QC 4ZYEA 2QENA 2EB7A 1R4NB 1X1BA 2HQAA 3GZNB 2DMQA 5KVRA 3QPTA 4Y7NJ 3HHHA 2DYSH 1GHCA 2ZJRF 2DA7A 2XAHA 4XIDA 1T56A 2DOEA 2MC4A 3L00A 1O4XA 1KYZA 2JUGA 4LLGF 2NAZA 2MH9A 2HKXA 5LEKA 4OAZA 3LSMA 1FNNA 2NVTJ 3FHNA 2EIKH 2W85A 1FMWA 1BOAA 2AXTC 1N25A 3SFIA 2FF4A 3OYBA 2E60A 2DI3A 2ISYA 1XPXA 1XGMA 5HDNA 2K86A 4BU2A 2L02A 1KA8A 3MN2A 2P5KA 3OWTA 5K5RA 3ROUA 2ISZA 3H9GA 5DD4A 3KEYA 3BG6A 4ENMA 1WSUA 3WTZA 5C4XJ 3BCAA 1YRNA 1HW2A 3H5NA 4OOIA 2CV1A 1QHGA 2H8RA 2FUG2 2W7NA 2M9HA 3HKZA 4ETSA 5D4SA 2NVXJ 2WBMA 1R5GA 1YJNI 2XC7A 1M1EB 1RZ4A 5E3MA 2DXIA 3F8MA 5IYBJ 4CCKA 3R0AA 1S29A 2XIGA 2ZMEB 4JOMA 4BE2A 3ZN1A 5B1BH 1I1GA 3SEZA 2F48A 2IVMA 3DKXA 4PSXA 4D9JA 2HGCA 5C4JJ 1ETKA 4G7OF 3FBNB 5E1ZB 3I53A 1J75A 3L2CA 1FOYA 4A5NA 3KLOA 4I0BA 3L2VA 1MNMC 4U0VA 4KMFA 4N9HA 4TV7A 3OMYA 4I01A 5GADJ 1JXSA 3PQJA 2IRFG 4JYKA 1TQPA 3MZ8A 2K4JA 5F04A 1BR1A 3IC7A 2DAOA 2LY1A 3O6BB 2HOEA 3ZMZA 5CVRA 3A01A 1WKMA 1BA5A 2KJCA 1FJLA 3FIWA 3K69A 3AAFA 3JAMK 3HM5A 3GTJJ 3EUKL 2CUJA 4NDLA 3LSHA 3R4KA 1PVEA 3E5QA 4XLHA 2E35A 4PJNA 2XGXA 3KP2A 1ULYA 2L7KA 2LP0A 2XPWA 1H9TA 1DUXC 4WK8F 2KIFA 2CUZA 2W24A 1VQ5I 4QPOA 4ESJA 2HYGD 4GCVA 4XRMA 1BC7C 1HW5A 2YS9A 4ZZDA 5JLWA 2VBWA 3DPUA 5DTDA 1JJ6C 2LVSA 2LR8A 1MSFC 2XASA 2R92J 3R6SA 4EGZA 1B6AA 3HYIA 3M3YJ 1MIJA 2LKPA 3MZHA 2Q2EA 3ZN0A 1GLNA 3A02A 3HUGA 1FYKA 3GO5A 1BJAA 5B66C 3S3OA 4RAYA 3F21A 1U78A 4Q4ZF 1BR2A 4B8XA 2OA4A 3ZMUA 4RAGA 1NK3P 4HV6A 4A0ZA 3CJTB 4AUXA 1T38A 1D8JA 1LVAA 3ASNH 3EYYA 3CO6C 1FYLA 3FXKA 2EINH 2PJRB 3RCOA 1X1PA 3B02A 1V54H 5HLIA 1YOVB 4XL9A 5F0HA 4EM2A 2OUMA 4EV0A 5FLVA 2GOXB 2M34A 2PFBA 1H89C 4IRGA 2E1MC 3WHBA 3QOPA 2QQBA 3SFZA 2W57A 4MIMA 3QU3A 4LOCA 3HC7A 3I9V2 3K4MA 1FOKA 1Z91A 3FKIJ 2COMA 1D1AA 5FD5A 1LJ9A 3BP8A 3SYTA 4RB1A 3TO6A 1FSHA 2XAUA 2QCOA 1F5TA 3K4NA 1WHUA 1ETOA 1JTXA 4PSWA 3HSFA 4PJMA 4IXAA 4HF1A 4BBRJ 4A3BJ 1EH8A 1HLVA 1MMNA 2K7LA 3L7WA 3N05A 5FROA 3IWZA 2BOLA 2RNGA 3OYFA 5D8KB 4UB6C 3GTMJ 4HSRA 3RTRA 3TMOA 4JP0A 1R1UA 1YQAA 2Z5UA 2H09A 2Z2SB 3BT9A 1VTNC 4ZTJA 2IA1A 1FIAA 4B1RA 2AXLA 1XDUA 3PIOF 4BJ5C 3MKLA 1AHDP 2MW8A 3H3UA 1OISA 4BBSJ 3RKXA 2GOMA 4M71A 4MEYF 3LAPA 1VQ9I 4A3IJ 3DEUA 2ZXWH 2NOJB 1YTYA 4EJTA 1IXSB 1XSXA 2V9PA 3SZGA 3OYLA 5LGNA 1D3YA 4IF4A 1GVDA 1F36A 4FETA 4BHBA 3V7RA 1ERDA 3TP0A 3DU5A 3N97A 3DKWA 1E2XA 5GAEJ 1NH3A 2A05A 1RR7A 4KNYA 2Y0SN 1UFMA 1I3AA 5DYMA 2UWMA 3FK7A 1BN5A 5GAGJ 1BL0A 4XLEA 4ZJZA 3J81K 3WTXC 4A93J 2MBFA 2LYCA 3EUHA 5K5QA 3ABUA 1W1WE 1MKMA 4CA0A 2JUCA 2NS8A 2WY7Q 1I6XA 4CCLA 1UHWA 3VSLA 5TISC 3HB9A 3I55I 4BXUA 4CDGA 1SAXA 5FKMA 1MW7A 3S1NJ 2WAQN 2FA5A 4M6VA 2AS5F 2MFZA 1QZZA 4DYQA
chains in the Genus database with same CATH topology
1S7EA 3NAUA 3LSGA 2JJ7A 1WGXA 1Y1VJ 3BR0A 2VKVA 2E1OA 1DU0A 3S17J 1FTTA 1OFCX 3BG5A 2HQ5A 2WV1A 2X6OA 2DA4A 4EEFG 3Q0UA 1CQTA 3HDDA 2FJ1A 2OF7A 1RKTA 2HOSA 2W48A 1ZK8A 1ITYA 2M2EA 1JKPC 1ZKGA 2WB1N 3JRBA 2R5YB 3GTQJ 2FX0A 2RAEA 4MLOA 2HOAA 3BTIA 2ID3A 1MH4A 2ME0A 3DCFA 1Q1VA 2KT0A 4DYCA 3O8GA 3S16J 3HBLA 2R7ZJ 2HXIA 5K7HA 3TEDA 1ZTRA 2DN0A 1W0TA 3JR9A 1ZGWA 1ETWA 3JRIA 2XSDC 1TWFJ 2CUFA 2DA1A 3QPLA 2DTZA 4RDUA 3ZOBA 4J19A 1VFCA 2DA6A 5EGOB 1JT6A 3S2DJ 1TWGJ 1VNDA 1TWHJ 4A3CJ 1TWCJ 1MBHA 3BQZA 5FKKA 3ZQHA 1PUFB 2R5YA 4M3BA 3JRFA 1Z77A 5FKOA 3ZQGA 2IBDA 2Y2ZA 5FJ8J 5IP7J 3O8HA 2EZHA 3LSJA 1Y1WJ 2E2IJ 1AKHB 3RKQA 3UKGA 4D5CA 4CYCA 2MG4A 3ZQCA 1K61A 2LD5A 1HDDC 3IH3A 2ZB9A 3TW6A 3LSRA 3FK6A 4DYRA 2XB0X 5FLMJ 3Q0VA 5M5XJ 1X2NA 2Y30A 4ABZA 2XRLA 3BTJA 2DA3A 2L7FP 2CJJA 3GTGJ 2QF7A 5EGOA 1P7IA 2NVQJ 1UHSA 1R9TJ 4QSHA 1D5YA 4IHYA 1IRZA 2IEKA 1PUFA 3JRAA 4BXXJ 4A3DJ 3E7LA 3OSFA 3BG9A 1AKHA 5C3EJ 1IV6A 1FEXA 4W1UA 3HKZN 1H88C 2XPUA 3ZQFA 2H1KA 4QIWN 1IG7A 2G0EA 1LFUP 1E3OC 2CQXA 2LY9A 1BW5A 1IC8A 4GFBA 4W97A 1IJWC 1XS9A 5M3MJ 2YU9J 4B3AA 1TC3C 2DJNA 4DZJA 2LTPA 3BR6A 2DMUA 3LOCA 3JREA 2FD5A 5EEAA 1MBFA 4X1EA 3JRDA 1RPWA 1MBGA 1FIPA 3CCYA 1X2MA 3K2AA 4IHXA 2EZIA 1IUFA 1NTCA 3Q3SA 4AC0A 1P7JA 1RETA 2XB5A 1FTZA 3CDLA 4XICA 1GT0C 2E19A 2ECCA 4M3GA 4QTRA 1ORKA 2JA6J 2LKXA 4DZPA 9ANTA 5GP9A 2NVYJ 5EF6A 1H8AC 1JGGA 2JA7J 3BG3A 4MFDA 5F27A 2DMTA 4A3JJ 1I50J 2VI6A 2TRTA 2L7MP 4IHVA 2OPTA 2P81A 3W6VA 2K40A 3PO3J 4CYCB 1GUUA 4C3IJ 2MSYA 4DW6A 3QPSA 3LNQA 3QQAA 1WH7A 4XRSG 4FCYA 1W0UA 3IV5A 4HNVA 1JKOC 5E3LA 5J3LA 1MSEC 2E2JJ 4IHWA 2EZKA 3A03A 1JTYA 3S1MJ 4A3LJ 5M3FJ 1U9OA 5IP6A 3HOYJ 3TP3A 1T33A 2Y9YA 4FE4A 4C2MJ 2EBIA 3ZQLA 1IGNA 1F43A 1U9NA 1WCMJ 4L5EA 2M0CA 2R0QC 3GTKJ 3RZOJ 1IDYA 1YRNB 2AO9A 2DMQA 4Y7NJ 4FE7A 2I10A 5EZGA 3S14J 3JRHA 2DA7A 4XIDA 2ID6A 5IP9J 1B8IB 3I4NJ 1T56A 1OJLA 1O4XA 3BR1A 2ELKA 2NVTJ 4A3FJ 2LK2A 3HOXJ 3RZDJ 1QPIA 3SFIA 4RBOA 1EF4A 5IOYA 1HCRA 1JUMA 2JA8J 2EH3A 3C2BA 5DS9A 3BR3A 2VKEA 3MN2A 1ETQA 3G1MA 2L9RA 1HDPA 3S15J 2VUMJ 2B63J 5C4XJ 4S0HB 1GDTA 1JT0A 1JUSA 2O7OA 2VPRA 1YRNA 4Y52J 1XC5A 2IAIA 1XG1A 2E2HJ 4A3GJ 2GM4A 2H8RA 2YUSA 2M9HA 2COBA 2K9SA 2NVXJ 3HOZJ 4AYBN 5IOZA 3JRCA 1B8IA 5FKLA 2N8GA 5E3MA 3A01B 5IYBJ 3H0GJ 2EZLA 1U8BA 3Q0WA 2XPVA 1ETYA 2XGDA 1IDZA 4BKXA 1ETKA 5C4JJ 4FTHA 1VF9A 5K7FA 2HI3A 3IH4A 2M8GX 2K9NA 2DA2A 3HOVJ 2L0KA 3LSPA 3TW7A 3WHCA 2MGQA 2GBYA 5E3OA 2O9LA 1MNMC 3MVPA 5C44J 3JRGA 2HXOA 3IH2A 3GTOJ 2EQRA 1JUPA 4JYKA 5M5YJ 3DEWA 5F04A 1UG2A 1MBJA 5J1YA 4BY7J 5F0FA 4MFEA 3D1NI 2KDZA 5M5WJ 2R93J 1LE8B 1BA5A 3A01A 2LFBA 3FIWA 1FJLA 4JX4A 2HDDA 1OCPA 3S1RJ 2PMZN 3HM5A 3GTJJ 4NDLA 3G1LA 1BW6A 1HOMA 2DMNA 1SANA 5EDNA 3PO2J 2D5VA 2LP0A 2XPWA 2ME6A 4JX5A 1ETVA 2XGCA 4C3JJ 2X48A 3HOWJ 3SJMA 5JLXA 4XRMA 3HOUJ 2YS9A 5J1UA 5F08A 5JLWA 1JJ6C 5DTDA 2JK3A 2LVSA 1ZQ3P 2JMWA 2LR8A 1MSFC 1WPKA 2GLOA 4XK4A 3F0CA 3BTCA 2CU7A 2R92J 4FISA 1WH5A 4IEJA 3M3YJ 4V2GA 1QRYA 1ZR4A 1LE8A 1POGA 3A02A 3BR5A 4D7NA 4XRSA 1ZR2A 5GPCA 1U78A 5BNGA 2ECBA 3OIOA 4M3DA 3NARA 1NK3P 2HYJA 4AUXA 4A69C 1MBKA 1GV5A 1SFOJ 2CRGA 4C3HJ 3K7AJ 3GTLJ 1RKWA 3CMYA 5F0HA 1TWAJ 3BTLA 1OCTC 5FLVA 1I6HJ 3G1OA 2M34A 5GPAA 2TCTA 2AHQA 2K9QA 1H89C 1Z0XA 3WHBA 1VI0A 3HGGA 2JN6A 4MIMA 1AU7A 4LOCA 3ZQIA 3VPRA 3FKIJ 4M3EA 4A3EJ 2LLKA 3OOUA 1QVUA 5IYDJ 2JWTA 1ENHA 2QCOA 5FKNA 3GTPJ 1A6IA 1X58A 1JJ8C 1ETOA 1JTXA 2O8KA 1GV2A 3BQYA 4BBRJ 4A3BJ 1HLVA 2XGEA 1UMQA 2NOGA 4BY1J 5HODA 3GBGA 1A5JA 3GTMJ 5J1RA 4I76A 4JP0A 1G2HA 5F0CA 1RESA 3BT9A 3B6CA 4A3MJ 4B1RA 1FIAA 4JX6A 3MKLA 4D5FA 3OSGA 2MW8A 2NS7A 1AHDP 1QVTA 4BBSJ 3SDGA 4UUSB 1MBEA 3S2HJ 4X6AJ 4V2FA 4A3IJ 5EG0B 1K83J 2CUEA 1B72B 3HGYA 4A3KJ 5EZHA 1APLC 5IYCJ 1ETXA 3BR2A 1GVDA 1I3QJ 1F36A 2R5ZB 1BJZA 1MH3A 1DU6A 2Y31A 4B4CA 3TP0A 1JKRC 2Y9ZA 5F1JA 2L7ZA 5K7ZA 3RQIA 2CQQA 1RR7A 2Y0SN 5E3NA 3FISA 1WI3A 2X9DA 3M4OJ 2HOTA 4G12A 2DA5A 2FQ4A 3FK7A 4MO7A 3CQZJ 3I4MJ 1BL0A 1LFBA 4UUTA 4A93J 3HEFA 5IPAA 1JKQC 2NS8A 1HF0A 4UUSA 3B6AA 3H3VK 3L1PA 5EG0A 3HB9A 4M3FA 4D7MA 2DMPA 3S1QJ 1B72A 5FKMA 2JA5J 3S1NJ 3PM1A 2WAQN 4I6ZA 4M6VA 1NK2P 2R5ZA 5EYRA 4DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7E A;  3NAU A;  3LSG A;  2JJ7 A;  1WGX A;  1Y1V J;  3BR0 A;  2VKV A;  2E1O A;  1DU0 A;  3S17 J;  1FTT A;  1OFC X;  3BG5 A;  2HQ5 A;  2WV1 A;  2X6O A;  2DA4 A;  4EEF G;  3Q0U A;  1CQT A;  3HDD A;  2FJ1 A;  2OF7 A;  1RKT A;  2HOS A;  2W48 A;  1ZK8 A;  1ITY A;  2M2E A;  1JKP C;  1ZKG A;  2WB1 N;  3JRB A;  2R5Y B;  3GTQ J;  2FX0 A;  2RAE A;  4MLO A;  2HOA A;  3BTI A;  2ID3 A;  1MH4 A;  2ME0 A;  3DCF A;  1Q1V A;  2KT0 A;  4DYC A;  3O8G A;  3S16 J;  3HBL A;  2R7Z J;  2HXI A;  5K7H A;  3TED A;  1ZTR A;  2DN0 A;  1W0T A;  3JR9 A;  1ZGW A;  1ETW A;  3JRI A;  2XSD C;  1TWF J;  2CUF A;  2DA1 A;  3QPL A;  2DTZ A;  4RDU A;  3ZOB A;  4J19 A;  1VFC A;  2DA6 A;  5EGO B;  1JT6 A;  3S2D J;  1TWG J;  1VND A;  1TWH J;  4A3C J;  1TWC J;  1MBH A;  3BQZ A;  5FKK A;  3ZQH A;  1PUF B;  2R5Y A;  4M3B A;  3JRF A;  1Z77 A;  5FKO A;  3ZQG A;  2IBD A;  2Y2Z A;  5FJ8 J;  5IP7 J;  3O8H A;  2EZH A;  3LSJ A;  1Y1W J;  2E2I J;  1AKH B;  3RKQ A;  3UKG A;  4D5C A;  4CYC A;  2MG4 A;  3ZQC A;  1K61 A;  2LD5 A;  1HDD C;  3IH3 A;  2ZB9 A;  3TW6 A;  3LSR A;  3FK6 A;  4DYR A;  2XB0 X;  5FLM J;  3Q0V A;  5M5X J;  1X2N A;  2Y30 A;  4ABZ A;  2XRL A;  3BTJ A;  2DA3 A;  2L7F P;  2CJJ A;  3GTG J;  2QF7 A;  5EGO A;  1P7I A;  2NVQ J;  1UHS A;  1R9T J;  4QSH A;  1D5Y A;  4IHY A;  1IRZ A;  2IEK A;  1PUF A;  3JRA A;  4BXX J;  4A3D J;  3E7L A;  3OSF A;  3BG9 A;  1AKH A;  5C3E J;  1IV6 A;  1FEX A;  4W1U A;  3HKZ N;  1H88 C;  2XPU A;  3ZQF A;  2H1K A;  4QIW N;  1IG7 A;  2G0E A;  1LFU P;  1E3O C;  2CQX A;  2LY9 A;  1BW5 A;  1IC8 A;  4GFB A;  4W97 A;  1IJW C;  1XS9 A;  5M3M J;  2YU9 J;  4B3A A;  1TC3 C;  2DJN A;  4DZJ A;  2LTP A;  3BR6 A;  2DMU A;  3LOC A;  3JRE A;  2FD5 A;  5EEA A;  1MBF A;  4X1E A;  3JRD A;  1RPW A;  1MBG A;  1FIP A;  3CCY A;  1X2M A;  3K2A A;  4IHX A;  2EZI A;  1IUF A;  1NTC A;  3Q3S A;  4AC0 A;  1P7J A;  1RET A;  2XB5 A;  1FTZ A;  3CDL A;  4XIC A;  1GT0 C;  2E19 A;  2ECC A;  4M3G A;  4QTR A;  1ORK A;  2JA6 J;  2LKX A;  4DZP A;  9ANT A;  5GP9 A;  2NVY J;  5EF6 A;  1H8A C;  1JGG A;  2JA7 J;  3BG3 A;  4MFD A;  5F27 A;  2DMT A;  4A3J J;  1I50 J;  2VI6 A;  2TRT A;  2L7M P;  4IHV A;  2OPT A;  2P81 A;  3W6V A;  2K40 A;  3PO3 J;  4CYC B;  1GUU A;  4C3I J;  2MSY A;  4DW6 A;  3QPS A;  3LNQ A;  3QQA A;  1WH7 A;  4XRS G;  4FCY A;  1W0U A;  3IV5 A;  4HNV A;  1JKO C;  5E3L A;  5J3L A;  1MSE C;  2E2J J;  4IHW A;  2EZK A;  3A03 A;  1JTY A;  3S1M J;  4A3L J;  5M3F J;  1U9O A;  5IP6 A;  3HOY J;  3TP3 A;  1T33 A;  2Y9Y A;  4FE4 A;  4C2M J;  2EBI A;  3ZQL A;  1IGN A;  1F43 A;  1U9N A;  1WCM J;  4L5E A;  2M0C A;  2R0Q C;  3GTK J;  3RZO J;  1IDY A;  1YRN B;  2AO9 A;  2DMQ A;  4Y7N J;  4FE7 A;  2I10 A;  5EZG A;  3S14 J;  3JRH A;  2DA7 A;  4XID A;  2ID6 A;  5IP9 J;  1B8I B;  3I4N J;  1T56 A;  1OJL A;  1O4X A;  3BR1 A;  2ELK A;  2NVT J;  4A3F J;  2LK2 A;  3HOX J;  3RZD J;  1QPI A;  3SFI A;  4RBO A;  1EF4 A;  5IOY A;  1HCR A;  1JUM A;  2JA8 J;  2EH3 A;  3C2B A;  5DS9 A;  3BR3 A;  2VKE A;  3MN2 A;  1ETQ A;  3G1M A;  2L9R A;  1HDP A;  3S15 J;  2VUM J;  2B63 J;  5C4X J;  4S0H B;  1GDT A;  1JT0 A;  1JUS A;  2O7O A;  2VPR A;  1YRN A;  4Y52 J;  1XC5 A;  2IAI A;  1XG1 A;  2E2H J;  4A3G J;  2GM4 A;  2H8R A;  2YUS A;  2M9H A;  2COB A;  2K9S A;  2NVX J;  3HOZ J;  4AYB N;  5IOZ A;  3JRC A;  1B8I A;  5FKL A;  2N8G A;  5E3M A;  3A01 B;  5IYB J;  3H0G J;  2EZL A;  1U8B A;  3Q0W A;  2XPV A;  1ETY A;  2XGD A;  1IDZ A;  4BKX A;  1ETK A;  5C4J J;  4FTH A;  1VF9 A;  5K7F A;  2HI3 A;  3IH4 A;  2M8G X;  2K9N A;  2DA2 A;  3HOV J;  2L0K A;  3LSP A;  3TW7 A;  3WHC A;  2MGQ A;  2GBY A;  5E3O A;  2O9L A;  1MNM C;  3MVP A;  5C44 J;  3JRG A;  2HXO A;  3IH2 A;  3GTO J;  2EQR A;  1JUP A;  4JYK A;  5M5Y J;  3DEW A;  5F04 A;  1UG2 A;  1MBJ A;  5J1Y A;  4BY7 J;  5F0F A;  4MFE A;  3D1N I;  2KDZ A;  5M5W J;  2R93 J;  1LE8 B;  1BA5 A;  3A01 A;  2LFB A;  3FIW A;  1FJL A;  4JX4 A;  2HDD A;  1OCP A;  3S1R J;  2PMZ N;  3HM5 A;  3GTJ J;  4NDL A;  3G1L A;  1BW6 A;  1HOM A;  2DMN A;  1SAN A;  5EDN A;  3PO2 J;  2D5V A;  2LP0 A;  2XPW A;  2ME6 A;  4JX5 A;  1ETV A;  2XGC A;  4C3J J;  2X48 A;  3HOW J;  3SJM A;  5JLX A;  4XRM A;  3HOU J;  2YS9 A;  5J1U A;  5F08 A;  5JLW A;  1JJ6 C;  5DTD A;  2JK3 A;  2LVS A;  1ZQ3 P;  2JMW A;  2LR8 A;  1MSF C;  1WPK A;  2GLO A;  4XK4 A;  3F0C A;  3BTC A;  2CU7 A;  2R92 J;  4FIS A;  1WH5 A;  4IEJ A;  3M3Y J;  4V2G A;  1QRY A;  1ZR4 A;  1LE8 A;  1POG A;  3A02 A;  3BR5 A;  4D7N A;  4XRS A;  1ZR2 A;  5GPC A;  1U78 A;  5BNG A;  2ECB A;  3OIO A;  4M3D A;  3NAR A;  1NK3 P;  2HYJ A;  4AUX A;  4A69 C;  1MBK A;  1GV5 A;  1SFO J;  2CRG A;  4C3H J;  3K7A J;  3GTL J;  1RKW A;  3CMY A;  5F0H A;  1TWA J;  3BTL A;  1OCT C;  5FLV A;  1I6H J;  3G1O A;  2M34 A;  5GPA A;  2TCT A;  2AHQ A;  2K9Q A;  1H89 C;  1Z0X A;  3WHB A;  1VI0 A;  3HGG A;  2JN6 A;  4MIM A;  1AU7 A;  4LOC A;  3ZQI A;  3VPR A;  3FKI J;  4M3E A;  4A3E J;  2LLK A;  3OOU A;  1QVU A;  5IYD J;  2JWT A;  1ENH A;  2QCO A;  5FKN A;  3GTP J;  1A6I A;  1X58 A;  1JJ8 C;  1ETO A;  1JTX A;  2O8K A;  1GV2 A;  3BQY A;  4BBR J;  4A3B J;  1HLV A;  2XGE A;  1UMQ A;  2NOG A;  4BY1 J;  5HOD A;  3GBG A;  1A5J A;  3GTM J;  5J1R A;  4I76 A;  4JP0 A;  1G2H A;  5F0C A;  1RES A;  3BT9 A;  3B6C A;  4A3M J;  4B1R A;  1FIA A;  4JX6 A;  3MKL A;  4D5F A;  3OSG A;  2MW8 A;  2NS7 A;  1AHD P;  1QVT A;  4BBS J;  3SDG A;  4UUS B;  1MBE A;  3S2H J;  4X6A J;  4V2F A;  4A3I J;  5EG0 B;  1K83 J;  2CUE A;  1B72 B;  3HGY A;  4A3K J;  5EZH A;  1APL C;  5IYC J;  1ETX A;  3BR2 A;  1GVD A;  1I3Q J;  1F36 A;  2R5Z B;  1BJZ A;  1MH3 A;  1DU6 A;  2Y31 A;  4B4C A;  3TP0 A;  1JKR C;  2Y9Z A;  5F1J A;  2L7Z A;  5K7Z A;  3RQI A;  2CQQ A;  1RR7 A;  2Y0S N;  5E3N A;  3FIS A;  1WI3 A;  2X9D A;  3M4O J;  2HOT A;  4G12 A;  2DA5 A;  2FQ4 A;  3FK7 A;  4MO7 A;  3CQZ J;  3I4M J;  1BL0 A;  1LFB A;  4UUT A;  4A93 J;  3HEF A;  5IPA A;  1JKQ C;  2NS8 A;  1HF0 A;  4UUS A;  3B6A A;  3H3V K;  3L1P A;  5EG0 A;  3HB9 A;  4M3F A;  4D7M A;  2DMP A;  3S1Q J;  1B72 A;  5FKM A;  2JA5 J;  3S1N J;  3PM1 A;  2WAQ N;  4I6Z A;  4M6V A;  1NK2 P;  2R5Z A;  5EYR A;  4DYQ A; 
#chains in the Genus database with same CATH topology
 3NAU A;  4WXD A;  3LA2 A;  3DKY A;  3IKT A;  5FB2 A;  2JRM A;  1IN6 A;  1FOW A;  4LLN A;  1QNT A;  2W4S A;  2M7A A;  1S7O A;  4B09 A;  1IRF A;  4LB6 B;  1FTT A;  4PCQ A;  4F91 B;  3BG5 A;  2M7B A;  1WWX A;  3Q0U A;  2OF7 A;  4OMZ A;  3QYB A;  4HDV A;  3N4M A;  2WB1 N;  1FBU A;  5E1X A;  3J7Z I;  1KU3 A;  2R5Y B;  4RAF A;  2VQG A;  1NG6 A;  1Y39 A;  1NHA A;  4BJT A;  1T0F A;  2RAE A;  2WY8 Q;  2UV1 A;  4HV5 A;  2V6C A;  4Y33 A;  4BAY A;  3ZP5 A;  2A6H F;  1TQI A;  2Z16 A;  1JHH A;  4GDF A;  1BBY A;  2ID3 A;  1DQU A;  1MH4 A;  2WTE A;  3GZ5 A;  4DYC A;  3PL8 A;  3HBL A;  2E7X A;  2Y69 H;  1TP4 A;  2E1C A;  1DGW Y;  1UJ8 A;  1MGT A;  1R22 A;  4ENN A;  1ZTR A;  1HKT A;  2KQR A;  4MQV A;  3DBL B;  1SVM A;  5LHG A;  1OCR H;  5D5V B;  3PIP F;  1YJ9 I;  1J9I A;  3CUQ C;  2NYX A;  3U1D A;  4J19 A;  5LHI A;  5BPD A;  3P5J A;  5EGO B;  1TWG J;  4PJJ A;  2JT1 A;  2K9M A;  3BQZ A;  5FKK A;  3HOS A;  4M3B A;  2OBP A;  3OL4 A;  3JRF A;  3ZQG A;  2VJ4 A;  2Y2Z A;  5IP7 J;  2DFE A;  3JTH A;  2EZH A;  4RB0 A;  3CUO A;  5CVJ A;  1LQ1 A;  4M72 A;  4CYD A;  1Y0U A;  3U9G A;  4F92 B;  1WFX A;  1D0X A;  1YW7 A;  2DT6 A;  4IQ4 A;  3ZQC A;  3CF2 A;  4C2T A;  1X1C A;  4PJL A;  1L3L A;  3CP8 A;  3IH3 A;  5K1Y A;  3KIO A;  1HDD C;  3FWE A;  3ECO A;  4KJZ A;  2JSP A;  2K02 A;  5FLM J;  1JI8 A;  3RKY A;  2Y30 A;  4ABZ A;  3A0B C;  4LMY A;  1R1T A;  2XRL A;  2RV8 A;  5J47 A;  1SD5 A;  1XSV A;  4N9I A;  4BEH B;  2XF6 A;  3IRR A;  3I54 A;  2LH9 A;  5H20 A;  4AWX B;  4KIC A;  4KT6 A;  4XN3 A;  4RGU A;  4ON0 A;  3E7L A;  3BG9 A;  5C3E J;  1IV6 A;  3K0L A;  4W1U A;  3KZI C;  4E7I A;  2QZ8 A;  3CDI A;  4HW0 A;  2GIV A;  1OCZ H;  3TO7 A;  1RRJ A;  4QIW N;  1IG7 A;  2RN7 A;  1WJF A;  2GXA A;  2LY9 A;  3VYU B;  2L3D A;  4GFB A;  4ZYH A;  5KAI C;  5M3M J;  5HS7 A;  2EWN A;  3FXO A;  4B3A A;  2GAU A;  3C3W A;  3BJA A;  3BR6 A;  3R60 A;  5GAH J;  2P8T A;  4L9T A;  1J2X A;  1HKS A;  2DMU A;  2M45 A;  2HPI A;  3LOC A;  3SXY A;  3ZMS A;  4F52 A;  3JRE A;  1VQL I;  4Q47 A;  2B7E A;  1ZAR A;  3JRD A;  1G6N A;  2EA2 A;  2WA0 A;  1DPR A;  3K2A A;  2QGU A;  1LFP A;  1YW8 A;  1P7J A;  1RET A;  3JTG A;  2CQ7 A;  4LIU A;  4FQG A;  2UZK A;  2ECC A;  2XV4 S;  1EV7 A;  2A61 A;  3SHF A;  3QU6 A;  3WU1 B;  2IGK A;  4E7Z A;  2V9K A;  3WGG A;  1SFU A;  2NXN B;  1ODD A;  4DOZ A;  4KT5 C;  2PMU A;  4XOT A;  1PP8 F;  2DFF A;  1IXR C;  4WF2 A;  3M8E A;  1I50 J;  4LGW A;  2L9S A;  3CP2 A;  4Y3O A;  2L7M P;  3CTA A;  4XSX F;  4IHV A;  3PUB A;  1P4X A;  4A12 A;  2H94 A;  2JSC A;  4C3I J;  3QPH A;  2XVC A;  5L3B A;  5LFA A;  3KEO A;  2VT2 A;  3LFU A;  4BHC A;  1WH7 A;  1VQ6 I;  1IN7 A;  2IA2 A;  4M6X A;  2EZK A;  2RC4 A;  1JTY A;  4NC8 A;  4I2O A;  3HIF A;  3UR3 C;  4JBA A;  1WRJ A;  1U9O A;  3AG4 H;  2X1E A;  3TP3 A;  3RI4 A;  3K70 C;  3S8P A;  4ASN A;  1QQI A;  4M9X A;  4C2M J;  3GW2 A;  2HYF A;  2KL4 A;  2LBF A;  2DCE A;  5CVI A;  5EEG A;  5CKT A;  3K4K A;  4RM3 A;  3RZO J;  1YRN B;  1FP2 A;  1DPU A;  3G2B A;  5EZG A;  3S14 J;  5EJC A;  1ONV A;  2IA0 A;  4XRF A;  1YIJ I;  4KDP A;  2PX9 A;  3KLN A;  5JHU A;  3BR1 A;  1HA8 A;  1S6L A;  2E71 A;  1K4S A;  5FD6 A;  3HOX J;  2M0M A;  2E36 A;  4QWQ A;  4XLF A;  5IOY A;  3OR1 C;  3DP7 A;  2DU9 A;  2DW4 A;  2JA8 J;  4E7J A;  4P5O A;  2QQA A;  5CYV A;  4XLN F;  1IV8 A;  3S15 J;  2X0L A;  3FBI B;  1YO5 C;  2VUM J;  3CCE I;  2B63 J;  1E17 A;  3H36 A;  1GDT A;  1OYI A;  1UEL B;  1TNS A;  1JUS A;  2VPR A;  1K79 A;  2A07 F;  4Y52 J;  1XG1 A;  4BQO A;  1K6O A;  2H1L A;  5IOZ A;  2MH2 A;  1FLI A;  4OU0 A;  1G3Y A;  2N8G A;  5CLS A;  3A01 B;  3BG7 A;  4CCO A;  3K1M A;  3HRM A;  2R7V A;  3Q0W A;  2W25 A;  4G7H F;  2EFP A;  2FEZ A;  2DT5 A;  3DV8 A;  3L9F A;  2HFH A;  4BKX A;  3ECH A;  3OYN A;  3CMM A;  4UY8 I;  3IH4 A;  2ZC2 A;  1R4M B;  1O3R A;  2K9N A;  4B44 A;  2WWY A;  3HOV J;  1QU3 A;  2L0K A;  3SZP A;  3TW7 A;  3WHC A;  5E3O A;  3FMR A;  4UXN A;  2O9L A;  5FFZ A;  1VQO I;  2E5Z A;  5C44 J;  2H8W A;  3JRG A;  2QBY B;  5E18 F;  2HXO A;  4ESF A;  3BZC A;  2XAG A;  3E97 A;  3W6K B;  1UG2 A;  5HLT A;  5J1Y A;  3QYF A;  4XQF A;  2V1U A;  2R93 J;  2Q2E B;  2CW0 F;  3VOE A;  5J6X A;  3HUG B;  1SD6 A;  2O8X A;  3EQL F;  1OCP A;  3KP4 A;  1LB2 A;  3RJP A;  2KZV A;  4CCN A;  4HX8 A;  3TKY A;  2BV6 A;  1BW6 A;  2DMN A;  3F8B A;  1JHF A;  3HL2 A;  3SDB A;  3HTS B;  2QQ8 A;  4E70 A;  3WTU C;  3KP5 A;  4JX5 A;  1SC7 A;  2BGC A;  4C3J J;  1JGS A;  2A69 F;  4K2E A;  3SQN A;  3HOW J;  1UST A;  3Q9S A;  4E7H A;  4NC6 A;  1IRG A;  2ZNZ A;  1WPK A;  2L2O A;  3QP5 A;  2GLO A;  4XNF A;  3F0C A;  2VQL A;  3BCB A;  2CU7 A;  3BTC A;  3FXL A;  4HST A;  1EH6 A;  3C7J A;  5L3G A;  4FIS A;  1KU2 A;  4PUS A;  1XGN A;  1ZEL A;  1QBJ A;  1WJE A;  1S3J A;  4XLC A;  2XUB A;  3K1P A;  1ZR4 A;  1LE8 A;  4AM3 A;  5HDG A;  4UHT A;  2CS3 A;  2KLO A;  3BR5 A;  4D7N A;  2VQC A;  1ZR2 A;  4IX7 A;  1DGR M;  2ECB A;  1WZ2 A;  3Q9V A;  4YII A;  1Y8Q B;  4IVN A;  5E17 F;  1WJC A;  3FXQ A;  3KPH A;  2ACJ A;  1U3E M;  1SFO J;  2CRG A;  4I99 C;  2BY1 A;  2BYV E;  3K7A J;  2MAB A;  1KQ8 A;  4E7S A;  2L9V A;  5FLX K;  1RKW A;  1OCT C;  2F5F A;  2OTL I;  3FMS A;  1V5G A;  1MND A;  1O7L A;  1W4M A;  5GPA A;  1Z0X A;  2EA4 A;  4AIK A;  2JN6 A;  1VQK I;  3JSP A;  2DOA A;  4G94 A;  3D5R C;  3ZQI A;  2IGO A;  4M3E A;  3CCR I;  2LLK A;  3I59 A;  1D1C A;  2ZNY A;  3OOU A;  2MLK A;  2VC0 A;  1ACI A;  4IQJ A;  2ESH A;  3HRS A;  4NBQ A;  2FRH A;  1ZRD A;  3CJQ B;  2YPR A;  2EIM H;  5FKN A;  1X58 A;  2M1B A;  4BE1 A;  3IAM 2;  3V8K A;  2QKL B;  4U7D A;  3JSO A;  2XGE A;  1UMQ A;  2NOG A;  1BOB A;  3KP6 A;  5HOD A;  3GBG A;  4KFC A;  3I4P A;  1A5J A;  5DDG A;  2HPM A;  5J1R A;  4I76 A;  4DGW B;  4L9V A;  4KMU X;  4A3M J;  3F8C A;  2NNN A;  1GXP A;  3OYD A;  3BZK A;  3DQV C;  3E0J B;  1QGP A;  3VYS B;  1T39 A;  5H6Q A;  3OR2 C;  2ZFW A;  2M4K A;  4X6A J;  1X19 A;  5KK1 A;  1WJA A;  4AU7 A;  5D4R A;  1RI7 A;  2KPM A;  2X4H A;  4U7B A;  4A3K J;  5LD2 C;  5EZH A;  3J80 K;  1APL C;  4Y15 A;  2FBK A;  5IYC J;  3BR2 A;  3ELK A;  2EFN A;  1WJD A;  2EFQ A;  3WE3 A;  3CUQ A;  4GGG A;  2IGN A;  4HPQ A;  1JKR C;  3EDP A;  5K7Z A;  3RQI A;  2XF5 A;  5E3N A;  2R7W A;  1WI3 A;  2X9D A;  2DPD A;  1FZP B;  3HZJ A;  4G12 A;  2K27 A;  5DCM A;  1YX3 A;  5KHD A;  2DA5 A;  2FQ4 A;  3H5R A;  2CO5 A;  3CQZ J;  2R7S A;  4NB5 A;  4UUT A;  3A1Y A;  2CFX A;  3HEF A;  5LHH A;  2JA2 A;  1HF0 A;  1U6G A;  5DM6 F;  4UUS A;  3WGI A;  3TO9 A;  3CC2 I;  2VJI A;  4M3F A;  1RUN A;  4DBR A;  2YX4 A;  5CQG A;  2KRH A;  3HPG A;  3F6V A;  1U0J A;  4EJW A;  1WI9 A;  3OYJ A;  5D5W B;  5LLQ A;  3CJR B;  4LG0 A;  1NK2 P;  3EET A;  2R5Z A;  2DQR A;  4OIQ F;  5EYR A;  1Z7L A;  3M07 A;  1S7E A;  4G6T B;  4BXF A;  4JQF A;  4UUV A;  2E1N A;  2BY0 A;  3P7N A;  2VKV A;  2E1O A;  4WXH A;  4CUG A;  3CLO A;  1DU0 A;  1HC8 A;  1EH7 A;  1VQ8 I;  5ICC A;  3FMQ A;  2V4J C;  5A2Q Z;  3V8L A;  2HQ5 A;  2ELH A;  2P7V B;  2DOF A;  2EV5 A;  4EEF G;  3HDD A;  2VC1 A;  3JCU C;  2FE3 A;  4RGR A;  4BDY A;  1G59 A;  1KQ0 A;  4X0G A;  1PJR A;  1ZKG A;  2D2W A;  2TDX A;  2VL8 A;  3M1C A;  1BC8 C;  1FOX A;  3ASO H;  1K78 A;  1BM9 A;  3GTQ J;  2Y75 A;  2CGP A;  3KFW X;  2FX0 A;  2O5R A;  2HOA A;  1QZE A;  3BTI A;  3I58 A;  2KMU A;  2MA3 A;  3TGN A;  5DD8 A;  1IUY A;  4Y4R A;  5HNF A;  4E6K G;  2R7Z J;  3V8J A;  3QRF F;  1J5Y A;  1DDN A;  4AIJ A;  2IJL A;  2JQ7 A;  2DN0 A;  3H9Q A;  3PNY A;  2HS5 A;  4LJZ F;  4HNT A;  1ETW A;  1ZGW A;  1V5E A;  3FKJ A;  5DUI A;  2O0Y A;  2VN2 A;  2HTJ A;  4DQ2 A;  3U2R A;  1D8K A;  1T95 A;  1TWF J;  2CUF A;  3AL0 B;  2DA1 A;  3OS2 A;  2FXA A;  2K9L A;  2WAD A;  3ZOB A;  5IT9 Z;  1VQP I;  3S2D J;  1VND A;  1CF7 A;  3I64 A;  1TWH J;  2EV0 A;  2PG4 A;  1ZN2 A;  3BY6 A;  4I7H A;  1UCR A;  3J7Y J;  2ZO4 A;  4XOR A;  1Z3X A;  5F64 A;  4RGX A;  5FKO A;  1F1Z A;  2A3S A;  2ZFU A;  1MJA A;  4HQM A;  3CME I;  2E2I J;  2V9V A;  3RKQ A;  3DU6 A;  2EFO A;  2F4M B;  4D5C A;  5JVG F;  1Z67 A;  3UKG A;  2I5U A;  4CYC A;  2MG4 A;  2PQ8 A;  4KUM A;  4LIT A;  2DDA A;  4ZYD A;  5DM7 F;  3WTW C;  2K3F A;  2LD5 A;  3QWL A;  1ZH5 A;  2ZB9 A;  3ONQ A;  2BXY A;  2W82 A;  3TW6 A;  4L5J A;  3LSR A;  4II2 A;  2P5V A;  4DYR A;  1MMS A;  4CSW A;  2XB0 X;  5M5X J;  1Z7U A;  1N78 A;  1R1V A;  1B4A A;  2X51 A;  4FT8 A;  4E7L A;  3WG9 A;  3BTJ A;  2L7F P;  2CJJ A;  5JFR A;  4M9Z A;  4M9S A;  3ABM H;  1S5L C;  5B3S H;  2OZU A;  4CO8 A;  1E3H A;  1P7I A;  3KZZ A;  2NVQ J;  2ZXI A;  5H2F C;  1E0E A;  4QSH A;  3CES A;  1YS6 A;  1D5Y A;  3F9K A;  4IHY A;  2IEK A;  3AG1 H;  1PUF A;  3ZGK A;  4UNO A;  4Q5S F;  1H9G A;  4M6Y A;  4PK4 A;  3VSK A;  5F1R A;  5GTI C;  5FO5 A;  4A3D J;  4BXX J;  4YEL A;  1W7P A;  2Y0S A;  3ZRG A;  2DOD A;  3F72 A;  1FEX A;  3A2K A;  4NHJ A;  1OQY A;  3IKV A;  4I02 A;  1G3S A;  1I5Z A;  2LMD A;  3NWS A;  3NEU A;  1V3F A;  3K10 A;  2IS4 A;  2IS6 A;  4P9F A;  3EYI A;  1YFH A;  4BNC A;  2G0E A;  2KHM A;  3H1C A;  1LFU P;  1E3O C;  3VWB A;  2CQX A;  1BW5 A;  4MQ9 F;  4R79 A;  1IC8 A;  4EJO A;  1P4A A;  2QYO A;  1T98 A;  3TOB A;  1IJW C;  2P4W A;  1U5T C;  2W1O A;  4H4K C;  4RM2 A;  1VQN I;  1PYV A;  2DJN A;  2HQN A;  4BQN A;  2VJJ A;  3U21 A;  2KRC A;  2LSO A;  2VAS A;  1R23 A;  2FNP A;  1OPC A;  3OYI A;  1PUE E;  1X4P A;  4IJA A;  3PNV A;  4C2U A;  1R00 A;  5HOO A;  2HTS A;  2DJI A;  2HZD A;  3HG9 A;  2JPB A;  4X1E A;  2R7D A;  5D5U B;  3ERM A;  1MBG A;  3CCY A;  2JRT A;  5CQE A;  2MYS A;  3E6C C;  2GA2 A;  3HRT A;  1REP C;  4ZZL A;  1IRX A;  3PSF A;  3IHU A;  3ERE D;  2C6Y A;  4HLX A;  1FTZ A;  3T8R A;  4XIC A;  4H0E A;  1GT0 C;  3WU0 A;  4XKV A;  3LFK A;  2BY3 A;  1LEA A;  3CJN A;  4RA2 A;  2EK5 A;  5D6F A;  5HLH A;  1Y0N A;  1XN7 A;  4QTR A;  3ZPL A;  4PDK A;  1S7A A;  2LBF B;  4L9J A;  9ANT A;  1R36 A;  1Z21 A;  5KNL A;  6PAX A;  2DDB A;  2KIM A;  4ZYA A;  3W2W A;  5BQT A;  2X6Y A;  1SD4 A;  3BG3 A;  1JGG A;  2HEO A;  3I56 I;  3CCQ I;  5L3C A;  3CCM I;  2K40 A;  5FRM A;  3OY9 A;  1I1S A;  1D0Y A;  2AQF A;  2A6E F;  3HXL A;  3QQA A;  3G71 I;  1SMT A;  3CCV I;  4XRS G;  1YIT I;  1USS A;  1W0U A;  4DBQ A;  4I09 A;  3F23 A;  2QA4 I;  5E3L A;  4ZDL A;  1MSE C;  3BWG A;  4CGZ A;  1IN8 A;  1B9M A;  4A3L J;  3K9T A;  3M8F A;  4O3M A;  1V5F A;  2PN6 A;  2Y9Y A;  2STW A;  1T6S A;  4HDU A;  2HVR A;  3ZQL A;  2EBI A;  2FMY A;  1F43 A;  5DEQ A;  2ZXJ A;  2GA1 A;  1KON A;  3GTK J;  1BI0 A;  2AO9 A;  2JVH A;  3AFH A;  2I10 A;  3T1B A;  1ZHF A;  2F4I A;  3JRH A;  4CZC A;  4XLA A;  1N77 A;  3I4N J;  4HEA 2;  3ZR8 X;  1OJL A;  3ZMD A;  1U2W A;  4ENJ A;  2K4B A;  1YJW I;  1W36 C;  3WU2 C;  2DLL A;  1OR7 C;  5E1W A;  2BZT A;  1KYW A;  5HS8 A;  3CDH A;  4OIO F;  2ELK A;  2XAF A;  3GEZ A;  3MZY A;  2VBY A;  1SFX A;  1G4D A;  2E1M B;  4RBO A;  1EF4 A;  1HCR A;  2K3P A;  2EH3 A;  2DQL A;  1VZ0 A;  5DS9 A;  1FP1 D;  3BR3 A;  1ETQ A;  3G1M A;  3U1K A;  3BZ6 A;  4HX4 A;  4O5V A;  2PJR A;  3GFL A;  3GX4 X;  3I5U A;  3OIQ A;  1JT0 A;  1W7P D;  2DFH A;  3K70 D;  1XC5 A;  2IAI A;  3MQ0 A;  4DIQ A;  1J59 A;  2GM4 A;  2M3A A;  2YUS A;  3GVA A;  1ZGJ A;  1EA3 A;  2IPQ X;  3EPZ A;  4AYB N;  3JRC A;  1ON2 A;  3HOZ J;  1FY7 A;  3LQQ A;  1B8I A;  1QA6 A;  5FKL A;  4EM1 A;  1P9Q C;  1SD7 A;  2O61 A;  5J4Y A;  2ZSI B;  3W3C A;  4Z6Y A;  1TT0 A;  1BIB A;  2XPV A;  3KET A;  5KCM A;  1ETY A;  4CH7 A;  2XGD A;  1U8R A;  2XSJ C;  4FTH A;  2LKS A;  2M8G X;  4HQE A;  4S05 A;  2DA2 A;  4BDZ A;  1IZ1 A;  3LSP A;  4G8X A;  2R7R A;  1RR8 C;  1E3P A;  4UB8 C;  4CCM A;  3MVP A;  2RQP A;  3QYE A;  3OV8 A;  3IH2 A;  2IW5 A;  3GTO J;  2EQR A;  1JUP A;  3WE2 A;  3OS0 A;  5M5Y J;  1RC9 A;  3IL2 A;  2CV2 A;  2D1H A;  4ZDP A;  1FYM A;  3DTK A;  1B9N A;  2IP2 A;  3FXU A;  4BY7 J;  4CIC A;  1XMK A;  1KU7 A;  1ZLJ A;  1LE8 B;  4EMS A;  3H92 A;  2LFB A;  2CQN A;  2EV6 A;  2HDD A;  3ESW B;  2PMZ N;  4IKF A;  4HAM A;  2WAE A;  2MC3 A;  1LNW A;  3UNG C;  2OCC H;  3G1L A;  5ILU A;  3ZMV A;  1HOM A;  3BPV A;  5EDN A;  1HQC A;  2E34 A;  1ZRF A;  5HLG A;  3BC8 A;  2ME6 A;  1ETV A;  2LRD A;  2XGC A;  2X48 A;  3E6B A;  3DPT A;  5IY5 H;  4XR6 A;  3GFJ A;  4KIF A;  4NUB A;  3NQO A;  2JTV A;  5F08 A;  2BW3 A;  3GLL A;  4MTE A;  3EUA A;  4XLP F;  4XK4 A;  4EJV A;  3CZ6 A;  3HTU A;  3I59 B;  3LMM A;  1SFE A;  2M4G A;  4IRI A;  1QRY A;  1A31 A;  5B1A H;  2YSR A;  4IPA A;  5JVT A;  3V7C A;  1S9H A;  5GPC A;  1XMX A;  3FM3 A;  3IP4 B;  2VT3 A;  1UB9 A;  2P6S A;  1FC3 A;  3IUO A;  3NRV A;  3OIO A;  2VOD A;  3DXJ F;  3NAR A;  2HYJ A;  3HRU A;  4ZDO A;  4A69 C;  3TDU C;  1MBK A;  1XD7 A;  4WXC A;  1J09 A;  3SEQ A;  4XBF A;  1DP3 A;  3GTL J;  1MMD A;  2BBY A;  2QSG X;  3KE2 A;  3DLA A;  1TW2 A;  2K5C A;  3TBI A;  2IS2 A;  1G3W A;  3CMY A;  1TWA J;  3BTL A;  5E20 A;  4A5M A;  1RUO A;  2UUZ A;  4HOB A;  2TCT A;  2AHQ A;  2K85 A;  3COA C;  1FPQ A;  1VI0 A;  2QSH X;  3MKW B;  4IO9 F;  2O03 A;  5D8L B;  2EIL H;  2ADU A;  3RYR A;  1AU7 A;  3JAM Z;  4BQQ A;  2H27 A;  4A3E J;  2YX7 A;  2HWV A;  1YW9 A;  4B48 A;  2XRN A;  1QVU A;  5IYD J;  2JWT A;  2Y48 A;  2V7F A;  2OQR A;  5BS6 A;  1ENH A;  4HRI A;  3GTP J;  1TW3 A;  3I0T A;  3E6D A;  4F3Q A;  3CUQ B;  3MCZ A;  5J40 A;  2ETH A;  2XKP A;  2OAZ A;  5CJ9 A;  4HF2 A;  1QZY A;  3LWF A;  1QO0 D;  2FML A;  2VB6 A;  3E3V A;  4XKC A;  5D6E A;  1G2H A;  2UXX A;  2LNB A;  5DCM B;  2ZME C;  2VKD A;  1RES A;  2LG4 A;  2VE8 A;  2Q8K A;  3CC7 I;  4JX6 A;  4D5F A;  1OCO H;  2NS7 A;  1YHQ I;  4KIS A;  1OKR A;  4HG2 A;  3W6J B;  2X6W A;  2MD5 A;  4UUS B;  1MBE A;  1PDN C;  2KZG A;  4V2F A;  5ICF A;  2CUE A;  2VXZ A;  2CG4 A;  2PI0 A;  3S2W A;  1T8I A;  1P6R A;  2BHY A;  4QPQ A;  1X3Z B;  2WC2 A;  1I3Q J;  4LG0 B;  2V1X A;  4XKB A;  2R5Z B;  3KP3 A;  4RLF A;  2Y31 A;  5AON A;  2PJP A;  4RS8 A;  2Y9Z A;  2GZW A;  1YX5 A;  1FX7 A;  4O6J A;  1OMI A;  2CQQ A;  3ZQQ A;  4OAY A;  1H0M A;  4MO7 A;  4QLC U;  1MDM A;  3I4M J;  2V79 A;  1BI1 A;  3O2P E;  1ZRE A;  2ESN A;  3P9I A;  3WGH A;  3FXR A;  5IPA A;  1JKQ C;  4KYW A;  4PFO A;  5DCF A;  5TJJ A;  3IRQ A;  3M1E A;  2F5D A;  2OTJ I;  5EG0 A;  2F5V A;  2DTR A;  1K78 B;  2QSF X;  2DMP A;  3VYT B;  3S1Q J;  1B72 A;  4HF0 A;  1FBQ A;  4JK1 X;  4M74 A;  4XMY A;  3VDX A;  2HNH A;  2VQH A;  4P9U A;  2XAQ A;  4I6Z A;  3M7G A;  1MJB A;  3JW4 A;  2V26 A;  5TRD A;  3LSG A;  1WGX A;  1Y1V J;  3KYL A;  3F6O A;  3E5U A;  4A2U A;  3CCL I;  4PFP A;  2E5N A;  4CCJ A;  3S17 J;  1OFC X;  2WV1 A;  2X6O A;  1UHM A;  2DA4 A;  2RDP A;  2IT0 A;  2FJ1 A;  2HOS A;  2BVM A;  3PQK A;  1CF7 B;  1SEU A;  2QKM B;  1ZK8 A;  3K4L A;  1ITY A;  1KU9 A;  1O7F A;  3TL4 X;  5GTH C;  2V1N A;  4EVI A;  1MD0 A;  2ZSH B;  3JRB A;  1WJB A;  1VQ7 I;  3V42 A;  2KJB A;  1BI2 A;  1UZC A;  2LRE A;  2F4O B;  2HZT A;  4UVA A;  4ITV A;  3PFY A;  3F3X A;  3DCF A;  2ME0 A;  1Q1V A;  2KT0 A;  5TGT A;  3O8G A;  5FGM A;  3S16 J;  4WCG A;  3J81 Z;  1U5T A;  1ZLK A;  1W5T A;  4MNU A;  1MNE A;  3WTV C;  5K7H A;  3OYK A;  3TED A;  1CGP A;  4I98 B;  3JRI A;  2XSD C;  2DPU A;  2XHK A;  1J7K A;  2P0W A;  1OYY A;  4S04 A;  2QLZ A;  1LEB A;  3H5A A;  3OYC A;  3QPL A;  4RDU A;  2KIU A;  2JPC A;  2QUF A;  2DA6 A;  1LDK B;  1MMG A;  4A3C J;  1D5V A;  1HST A;  2DFI A;  1TWC J;  1MBH A;  2GQQ A;  3ZQH A;  4EQQ A;  1PUF B;  1Z05 A;  2X85 A;  1G3T A;  4J01 A;  3V4G A;  1ZGA A;  2ZXH A;  4GO1 A;  2LOO A;  3LSJ A;  1W7P B;  1Y1W J;  3ULQ B;  3TQN A;  1O3S A;  4OMY A;  3GLX A;  1YYV A;  2DK5 A;  2VXD A;  4G7Z F;  2QEX I;  1OLT A;  2D1V A;  4ZH4 F;  1K61 A;  5HVQ C;  2JVG A;  4LLL A;  4LK1 F;  5LBQ A;  2BXZ A;  3Q0V A;  3BDD A;  4LG3 A;  4M73 A;  4BQA A;  3TDZ C;  1ZG1 A;  2O3F A;  1N75 A;  1TTY A;  3ZCO A;  3H9J A;  4A0Y A;  4KIG A;  2NRA C;  1LKX A;  2KRF A;  1IRZ A;  3L2U A;  2O6G E;  1GXQ A;  2G9W A;  3L09 A;  2HVS A;  2CH0 A;  3GCM A;  1G8X A;  3DTI A;  1Z9C A;  1LUJ B;  2R4G A;  1AKH A;  2J5O A;  4MTD A;  4YRV A;  1C0W A;  3HKZ N;  4NQW A;  2IGM A;  3DBH B;  1W5S A;  4E4H A;  4YIR X;  2PMH A;  3ZQF A;  4L18 B;  3G73 A;  1SMY F;  2A68 F;  4L9N A;  5E79 C;  4MGR A;  1HXD A;  4XN0 A;  1YE9 A;  1IXC A;  3MKY B;  4W97 A;  3S93 A;  2I8D A;  1OR7 A;  2DK8 A;  4GYI A;  3RSN A;  2KIS A;  3IAS 2;  3FXM A;  4G9Y A;  1D1B A;  2LTP A;  2A5Y B;  4DZJ A;  3SZT A;  3CO7 C;  2BHZ A;  2QVO A;  3CLQ A;  3FF5 A;  4B3X A;  2L4A A;  3HJE A;  2VBX A;  1MBF A;  3FHZ A;  4G6D A;  1FIP A;  2GWR A;  3KZY A;  4ZTF A;  4XON A;  5FFX A;  4CZZ A;  3Q3S A;  4AC0 A;  3Q5F A;  4GXO A;  2LDU A;  3CDL A;  3GXO A;  5CVV A;  3CC4 I;  5L3F A;  2VJ5 A;  2FBH A;  2ZJP F;  1XDS A;  1ORK A;  2OCE A;  1FMV A;  3S3M A;  2JA6 J;  2VOO A;  2KP6 A;  1Z6T A;  2R7F A;  2V1D A;  4RGS A;  3T8T A;  2LKX A;  4DZP A;  4BE0 A;  3DBR B;  4Q48 A;  1IN5 A;  1R5H A;  2NVY J;  3BJO A;  2GXG A;  4ENK A;  3H0D A;  4A3J J;  3OYG A;  2QBY A;  2L4M A;  3GUD A;  2P81 A;  3W6V A;  4BAC A;  3PO3 J;  1IO2 A;  2ZJQ F;  2MSY A;  3DLL F;  3QPS A;  2B9S A;  1RIO H;  2PLY A;  2FBI A;  3ABK H;  3C2H A;  3ZMT A;  1A04 A;  3IV5 A;  4HNV A;  5LEJ A;  2NVU B;  5J3L A;  4AVZ A;  2E2J J;  4IHW A;  1O3T A;  3A03 A;  3S1M J;  3PJR A;  3S3N A;  1ZAO A;  4PGG A;  5M3F J;  1QHH D;  1XTA A;  3F8F A;  5IP6 A;  3HOY J;  1Z1D A;  1T33 A;  2P6T A;  2D45 A;  4KIT B;  3A0H C;  4AD9 A;  1IGN A;  4RMN A;  1WCM J;  4A6E A;  2BE5 F;  3ABL H;  2M0C A;  4UV8 A;  2OQG A;  1X1D A;  1IDY A;  2ELJ A;  4N0B A;  4EGY A;  1OCC H;  2Z99 A;  2FNA A;  4FE7 A;  3WTT C;  4A0X A;  4D0P A;  2CWE A;  2ID6 A;  5IP9 J;  4C9Y A;  3VOD A;  1B8I B;  3D5L A;  5IT3 A;  4OIP F;  2R7U A;  2BVL A;  4II3 A;  2KFD A;  4YIF A;  1YS7 A;  2BEO A;  4XSZ F;  2F2E A;  4HBL A;  2KIQ A;  3AG3 H;  4YEJ A;  3F8N A;  1O3Q A;  4A3F J;  1SFK A;  2LK2 A;  1IAW A;  1D0Z A;  3RZD J;  2UXN A;  2RQQ A;  1QPI A;  3C18 A;  4BYY A;  2A5W A;  1LPQ A;  1JUM A;  3C1D A;  3C2B A;  3GFM A;  1TNT A;  4G6Q A;  3K4J A;  2VKE A;  1Y6I A;  2L01 A;  1XMA A;  2L9R A;  1HDP A;  4N4N B;  3ABT A;  2NS0 A;  1AWC A;  2GXB A;  3OYH A;  4S0H B;  2HVQ A;  2O7O A;  3D0S A;  2E2H J;  4A3G J;  1MJ9 A;  3GME A;  2COB A;  4I0A A;  2K9S A;  4YFN F;  2OC6 A;  2P5L C;  4C30 A;  3OS1 A;  3X2Q H;  1EJ9 A;  3H0G J;  2RVC A;  1XGS A;  2EZL A;  3K2Z A;  2CFO A;  1U8B A;  3KP7 A;  1IDZ A;  2MD0 A;  4LD5 A;  1VF9 A;  1W36 D;  3OOP A;  1OYW A;  5K7F A;  2HI3 A;  2RGV A;  2VE9 A;  3E6M A;  3T0Y A;  4N4O B;  4B47 A;  1UG0 A;  1A36 A;  2MGQ A;  2GBY A;  2M8E A;  3J7A O;  2R7Q A;  5JI6 A;  2YR2 A;  3L2W A;  5HDK A;  2WAQ A;  4ESB A;  4XKW A;  2BW3 B;  1JE8 A;  3MD2 A;  2DO7 A;  3CMA I;  4P1W A;  2Z1D A;  3DEW A;  1MBJ A;  1XX5 A;  2OD5 A;  4P96 A;  5F0F A;  4MFE A;  3D1N I;  3RIR A;  2KDZ A;  5M5W J;  1SAU A;  1YIO A;  1J0R A;  3FZV A;  4JX4 A;  3D5S C;  3KCC A;  2ZME A;  3S1R J;  1F9N A;  3GYH X;  3W2A A;  2G7U A;  4R8H A;  4Z2Y A;  1Y56 A;  2WB1 A;  1SAN A;  3PFI A;  4BH9 A;  3WOD F;  3PO2 J;  5F6F A;  2D5V A;  3REO A;  2CQK A;  2X1D A;  1R7J A;  2J5P A;  2XF7 A;  3G3Z A;  4EJU A;  5BMZ A;  3DPL C;  5JLX A;  3QOD A;  3SJM A;  2FSW A;  3HOU J;  5J1U A;  3M9A A;  1ZQ3 P;  2JK3 A;  2JMW A;  1BR4 A;  3IWF A;  1VQM I;  2XDV A;  3V7S A;  4OWR B;  4PGH A;  1S72 I;  1WH5 A;  2EPF A;  2CSO A;  4IEJ A;  3K4B A;  4V2G A;  1POG A;  3TOA A;  4YFX F;  1TBX A;  1X3W B;  4XM3 A;  4XRS A;  3RKW A;  1F4K A;  4U0Y A;  5BNG A;  3QAH A;  3QP6 A;  4M3D A;  4YG2 F;  4IZZ A;  1GV5 A;  1XCV A;  3MKZ A;  5KAF C;  3GFI A;  4C3H J;  5ERI A;  1PP7 U;  2EIJ H;  1I39 A;  3K4C A;  4BUP A;  3LSI A;  4EM0 B;  5BPI A;  1WQ2 A;  3G1O A;  4KN7 X;  1I6H J;  2PEX A;  1BI3 A;  1ZYR F;  2R7X A;  1R5I D;  2K9Q A;  2QQ9 A;  5DV5 A;  4E7K A;  3HGG A;  2HDC A;  3G6E I;  3VPR A;  3AG2 H;  1P2F A;  3LA7 A;  1L0O C;  2H6B A;  4F93 B;  5J4V A;  2CMP A;  1A6I A;  1JJ8 C;  3ISP A;  1MMA A;  1KQ9 A;  1Q1H A;  2O8K A;  1GV2 A;  2VON A;  3BQY A;  1KGS A;  4NNJ A;  2R3S A;  5JHF A;  5LGU A;  4BY1 J;  1AOY A;  3J7A Y;  4BL0 B;  3E5X A;  1LVK A;  4CHU A;  5F0C A;  1RNL A;  3T5X A;  3C2G A;  3B6C A;  4NC7 A;  1MDM B;  3BOQ A;  4LK0 F;  4AYB A;  1STZ A;  2LF7 A;  1FSE A;  4XOP A;  3OSG A;  1WJ5 A;  4ANJ A;  2P7C B;  3WTS C;  1QVT A;  1XCB A;  1TLH B;  2STT A;  1S8N A;  5L3E A;  3SDG A;  3RYP A;  3S2H J;  3KX2 A;  5EG0 B;  3NWT A;  3OL3 A;  1K83 J;  4BJ6 C;  3CCU I;  5A2Q K;  1B72 B;  5HNH A;  1HBX G;  3HGY A;  2HR3 A;  2Q1Z B;  3FXJ A;  3WTY C;  1ETX A;  5FLX Z;  1BJZ A;  1MH3 A;  1DU6 A;  5E8G A;  5AIQ A;  4B4C A;  5F1J A;  2GIZ A;  2L7Z A;  3DTE A;  1IN4 A;  1TT5 B;  4IOA F;  3MAJ A;  3FIS A;  4EAT A;  1X4O A;  4OIR F;  3M4O J;  2X6X A;  2HOT A;  5ED4 A;  1R58 A;  1K6Y A;  4UVB A;  3AKZ A;  1X3U A;  1LFB A;  2HKO A;  4FX0 A;  2VKH A;  4RLQ A;  4LFU A;  4RAZ A;  4IL6 C;  2WV0 A;  3RPU A;  1XB4 A;  2DYR H;  3RDI A;  4KN4 X;  2F5C A;  5ILV A;  3FX3 A;  3B6A A;  2PMZ A;  3H3V K;  3L1P A;  1Z6R A;  4D7M A;  5ICE A;  1EKE A;  2VOP A;  1R71 A;  2LF8 A;  1XGO A;  4MEX F;  5IT9 K;  2JA5 J;  4WWC A;  3PM1 A;  4LB5 A;  1TQM A;  3LA3 A;  4GYG A;  3DEE A;  1U5T B;  2QM3 A;  5CVU A;  2JJ7 A;  3OYE A;  3I3L A;  4DNC A;  5EEH A;  2DT7 B;  1YI2 I;  1UAA A;  3BR0 A;  3PSI A;  3PNT A;  3G4S I;  1Z3Y A;  3VB2 A;  1W5C C;  3MWM A;  2MLG A;  3E1S A;  2Q0O A;  1FT9 A;  1SVL A;  2Z9O A;  5FRN A;  1CQT A;  1X1A A;  1LDJ A;  1RKT A;  2W48 A;  5ICG A;  3J80 Z;  2M87 A;  5JR3 A;  3B73 A;  2M2E A;  1JKP C;  2R7O A;  3DWL E;  2E7W A;  4Y17 A;  4HZF A;  1VQ4 I;  3ZQ7 A;  5J8F A;  4MHG A;  1FBS A;  3H35 A;  4MLO A;  4HLY A;  2VBZ A;  2R7T A;  2RRE A;  4B43 A;  2W84 A;  2YU3 A;  4WX9 A;  2QWW A;  2PBI A;  5LGT A;  2DBB A;  2HXI A;  1XSD A;  3KYD B;  2HDW A;  4ZYG A;  1W0T A;  2X1C A;  3L2R A;  3JR9 A;  3GF2 A;  2B0L A;  4OIN F;  3KEQ A;  1V55 H;  2DTZ A;  3BRO A;  5BOX A;  1ZG3 A;  1VFC A;  3WG7 H;  2L54 A;  2XKO A;  1JT6 A;  4PZJ A;  4RB2 C;  3VFZ A;  4GRI A;  4CXF A;  4LIV A;  4RB3 C;  2R5Y A;  1ZG5 A;  1Z77 A;  2IBD A;  5FJ8 J;  2ZBK A;  3HSE A;  1ZRC A;  4HX7 A;  3O8H A;  3R0J A;  4L0Z B;  3EUH C;  1B59 A;  2IS1 A;  1AKH B;  2FOW A;  4F55 A;  2CW8 A;  1Y8R B;  3PUF A;  5E8I A;  2VLA A;  4NQW B;  4U0W A;  2F5E A;  3LSK A;  1HSJ A;  2G7H A;  4PJ0 C;  2W00 A;  2Y0M A;  3P9C A;  3QOE A;  3FK6 A;  3HOT A;  3M8J A;  1NG7 A;  3LST A;  1X2N A;  4IOC F;  4HNU A;  3P9K A;  1GVJ A;  3W2V A;  3L2Q A;  2V6E A;  1P4W A;  4BHP A;  2DA3 A;  3OIP A;  1YLF A;  1R6R A;  3GTG J;  5DUK A;  2QF7 A;  5EGO A;  2XAJ A;  1V4R A;  1UHS A;  2WAF A;  1R9T J;  1BIA A;  3VYR B;  2KDO A;  2A6T A;  4F7Z A;  2IXS A;  1LDD A;  3BJ6 A;  4P55 A;  2BY2 A;  3OYA A;  3JRA A;  3ML6 A;  3HHG A;  2OV7 A;  2ZKZ A;  4L5I A;  3OSF A;  3RQ4 A;  2LY2 A;  2ZCW A;  3DFG A;  2HU9 A;  4IHT A;  3CD6 I;  2L5Q A;  2XPU A;  2M30 A;  3CCJ I;  1H88 C;  2H1K A;  2EFW A;  3RPU D;  1T0F C;  2OZ6 A;  5CPR B;  5H6R A;  5J8C A;  1T2K A;  5LRR A;  2F6C A;  4YFK F;  4D1Q A;  1SVO A;  3GWZ A;  5B5E C;  1IF1 A;  4HYE A;  1TL8 A;  4R1H A;  3MMY B;  4KA4 A;  3KYC B;  1XS9 A;  4BEH A;  1P92 A;  1MZB A;  2YU9 J;  1TC3 C;  4IRH A;  5LRS A;  4DJA A;  1K7A A;  2KKO A;  3OYM A;  2ZJ2 A;  1R49 A;  3FDY A;  3I71 A;  2CW7 A;  3MFK A;  2FD5 A;  2AQE A;  3K6G A;  2ICW G;  5EEA A;  3FM5 A;  1YG2 A;  2M5W A;  4J00 A;  3H3Z A;  4AVP A;  1RPW A;  2FQ3 A;  3VEP A;  1X2M A;  3BLY A;  4HA8 A;  1A35 A;  4IHS A;  2EZI A;  4IHX A;  1IUF A;  4AID A;  1NTC A;  2EJR A;  4U88 A;  2CYY A;  2XB5 A;  3RPQ A;  1AA7 A;  4KIB A;  3CF5 F;  2E19 A;  5K5O A;  3LAJ A;  3A4C A;  4M3G A;  4FAS D;  1FWZ A;  1WVR A;  1A6Q A;  3BPX A;  1HKQ A;  1K4T A;  1DP7 P;  2FU4 A;  3ZXS A;  3LL7 A;  3DF8 A;  2H6C A;  3HPH A;  5D5X B;  4FHT A;  4UV9 A;  5GP9 A;  5EF6 A;  1H8A C;  4L0Y B;  2JA7 J;  4MFD A;  5F27 A;  1TZL A;  2OJE D;  2DMT A;  3LQR A;  2VIX A;  5HS9 A;  2VI6 A;  3HSR A;  2NNY A;  1ON1 A;  5ILS A;  1HW1 A;  2TRT A;  1QPM A;  2OPT A;  3O3K A;  3AL0 C;  4BGD A;  1B1B A;  4A6D A;  4CYC B;  1GUU A;  2OU2 A;  3R61 A;  1T08 B;  4DW6 A;  3LNQ A;  4Y13 A;  4UVC A;  4BS9 A;  1O57 A;  3F22 A;  4FCY A;  2FOK A;  3K1N A;  4V19 K;  2HQR A;  3MEX A;  1KZH A;  2XRO A;  3S32 A;  2RKH A;  1JKO C;  2RNJ A;  5AIP A;  2JZY A;  2LC2 A;  4FX4 A;  2Z3Y A;  2L9N A;  1I27 A;  4ZC3 A;  3GZ6 A;  2CV0 A;  2Z33 A;  2VPL A;  1IW7 F;  4U87 A;  4FE4 A;  5L3D A;  4AIH A;  1U9N A;  3CCS I;  4L5E A;  2R0Q C;  4ZYE A;  2QEN A;  2EB7 A;  1R4N B;  1X1B A;  2HQA A;  3GZN B;  2DMQ A;  5KVR A;  3QPT A;  4Y7N J;  3HHH A;  2DYS H;  1GHC A;  2ZJR F;  2DA7 A;  2XAH A;  4XID A;  1T56 A;  2DOE A;  2MC4 A;  3L00 A;  1O4X A;  1KYZ A;  2JUG A;  4LLG F;  2NAZ A;  2MH9 A;  2HKX A;  5LEK A;  4OAZ A;  3LSM A;  1FNN A;  2NVT J;  3FHN A;  2EIK H;  2W85 A;  1FMW A;  1BOA A;  2AXT C;  1N25 A;  3SFI A;  2FF4 A;  3OYB A;  2E60 A;  2DI3 A;  2ISY A;  1XPX A;  1XGM A;  5HDN A;  2K86 A;  4BU2 A;  2L02 A;  1KA8 A;  3MN2 A;  2P5K A;  3OWT A;  5K5R A;  3ROU A;  2ISZ A;  3H9G A;  5DD4 A;  3KEY A;  3BG6 A;  4ENM A;  1WSU A;  3WTZ A;  5C4X J;  3BCA A;  1YRN A;  1HW2 A;  3H5N A;  4OOI A;  2CV1 A;  1QHG A;  2H8R A;  2FUG 2;  2W7N A;  2M9H A;  3HKZ A;  4ETS A;  5D4S A;  2NVX J;  2WBM A;  1R5G A;  1YJN I;  2XC7 A;  1M1E B;  1RZ4 A;  5E3M A;  2DXI A;  3F8M A;  5IYB J;  4CCK A;  3R0A A;  1S29 A;  2XIG A;  2ZME B;  4JOM A;  4BE2 A;  3ZN1 A;  5B1B H;  1I1G A;  3SEZ A;  2F48 A;  2IVM A;  3DKX A;  4PSX A;  4D9J A;  2HGC A;  5C4J J;  1ETK A;  4G7O F;  3FBN B;  5E1Z B;  3I53 A;  1J75 A;  3L2C A;  1FOY A;  4A5N A;  3KLO A;  4I0B A;  3L2V A;  1MNM C;  4U0V A;  4KMF A;  4N9H A;  4TV7 A;  3OMY A;  4I01 A;  5GAD J;  1JXS A;  3PQJ A;  2IRF G;  4JYK A;  1TQP A;  3MZ8 A;  2K4J A;  5F04 A;  1BR1 A;  3IC7 A;  2DAO A;  2LY1 A;  3O6B B;  2HOE A;  3ZMZ A;  5CVR A;  3A01 A;  1WKM A;  1BA5 A;  2KJC A;  1FJL A;  3FIW A;  3K69 A;  3AAF A;  3JAM K;  3HM5 A;  3GTJ J;  3EUK L;  2CUJ A;  4NDL A;  3LSH A;  3R4K A;  1PVE A;  3E5Q A;  4XLH A;  2E35 A;  4PJN A;  2XGX A;  3KP2 A;  1ULY A;  2L7K A;  2LP0 A;  2XPW A;  1H9T A;  1DUX C;  4WK8 F;  2KIF A;  2CUZ A;  2W24 A;  1VQ5 I;  4QPO A;  4ESJ A;  2HYG D;  4GCV A;  4XRM A;  1BC7 C;  1HW5 A;  2YS9 A;  4ZZD A;  5JLW A;  2VBW A;  3DPU A;  5DTD A;  1JJ6 C;  2LVS A;  2LR8 A;  1MSF C;  2XAS A;  2R92 J;  3R6S A;  4EGZ A;  1B6A A;  3HYI A;  3M3Y J;  1MIJ A;  2LKP A;  3MZH A;  2Q2E A;  3ZN0 A;  1GLN A;  3A02 A;  3HUG A;  1FYK A;  3GO5 A;  1BJA A;  5B66 C;  3S3O A;  4RAY A;  3F21 A;  1U78 A;  4Q4Z F;  1BR2 A;  4B8X A;  2OA4 A;  3ZMU A;  4RAG A;  1NK3 P;  4HV6 A;  4A0Z A;  3CJT B;  4AUX A;  1T38 A;  1D8J A;  1LVA A;  3ASN H;  3EYY A;  3CO6 C;  1FYL A;  3FXK A;  2EIN H;  2PJR B;  3RCO A;  1X1P A;  3B02 A;  1V54 H;  5HLI A;  1YOV B;  4XL9 A;  5F0H A;  4EM2 A;  2OUM A;  4EV0 A;  5FLV A;  2GOX B;  2M34 A;  2PFB A;  1H89 C;  4IRG A;  2E1M C;  3WHB A;  3QOP A;  2QQB A;  3SFZ A;  2W57 A;  4MIM A;  3QU3 A;  4LOC A;  3HC7 A;  3I9V 2;  3K4M A;  1FOK A;  1Z91 A;  3FKI J;  2COM A;  1D1A A;  5FD5 A;  1LJ9 A;  3BP8 A;  3SYT A;  4RB1 A;  3TO6 A;  1FSH A;  2XAU A;  2QCO A;  1F5T A;  3K4N A;  1WHU A;  1ETO A;  1JTX A;  4PSW A;  3HSF A;  4PJM A;  4IXA A;  4HF1 A;  4BBR J;  4A3B J;  1EH8 A;  1HLV A;  1MMN A;  2K7L A;  3L7W A;  3N05 A;  5FRO A;  3IWZ A;  2BOL A;  2RNG A;  3OYF A;  5D8K B;  4UB6 C;  3GTM J;  4HSR A;  3RTR A;  3TMO A;  4JP0 A;  1R1U A;  1YQA A;  2Z5U A;  2H09 A;  2Z2S B;  3BT9 A;  1VTN C;  4ZTJ A;  2IA1 A;  1FIA A;  4B1R A;  2AXL A;  1XDU A;  3PIO F;  4BJ5 C;  3MKL A;  1AHD P;  2MW8 A;  3H3U A;  1OIS A;  4BBS J;  3RKX A;  2GOM A;  4M71 A;  4MEY F;  3LAP A;  1VQ9 I;  4A3I J;  3DEU A;  2ZXW H;  2NOJ B;  1YTY A;  4EJT A;  1IXS B;  1XSX A;  2V9P A;  3SZG A;  3OYL A;  5LGN A;  1D3Y A;  4IF4 A;  1GVD A;  1F36 A;  4FET A;  4BHB A;  3V7R A;  1ERD A;  3TP0 A;  3DU5 A;  3N97 A;  3DKW A;  1E2X A;  5GAE J;  1NH3 A;  2A05 A;  1RR7 A;  4KNY A;  2Y0S N;  1UFM A;  1I3A A;  5DYM A;  2UWM A;  3FK7 A;  1BN5 A;  5GAG J;  1BL0 A;  4XLE A;  4ZJZ A;  3J81 K;  3WTX C;  4A93 J;  2MBF A;  2LYC A;  3EUH A;  5K5Q A;  3ABU A;  1W1W E;  1MKM A;  4CA0 A;  2JUC A;  2NS8 A;  2WY7 Q;  1I6X A;  4CCL A;  1UHW A;  3VSL A;  5TIS C;  3HB9 A;  3I55 I;  4BXU A;  4CDG A;  1SAX A;  5FKM A;  1MW7 A;  3S1N J;  2WAQ N;  2FA5 A;  4M6V A;  2AS5 F;  2MFZ A;  1QZZ A;  4DYQ A; 
#chains in the Genus database with same CATH homology
 1S7E A;  3NAU A;  3LSG A;  2JJ7 A;  1WGX A;  1Y1V J;  3BR0 A;  2VKV A;  2E1O A;  1DU0 A;  3S17 J;  1FTT A;  1OFC X;  3BG5 A;  2HQ5 A;  2WV1 A;  2X6O A;  2DA4 A;  4EEF G;  3Q0U A;  1CQT A;  3HDD A;  2FJ1 A;  2OF7 A;  1RKT A;  2HOS A;  2W48 A;  1ZK8 A;  1ITY A;  2M2E A;  1JKP C;  1ZKG A;  2WB1 N;  3JRB A;  2R5Y B;  3GTQ J;  2FX0 A;  2RAE A;  4MLO A;  2HOA A;  3BTI A;  2ID3 A;  1MH4 A;  2ME0 A;  3DCF A;  1Q1V A;  2KT0 A;  4DYC A;  3O8G A;  3S16 J;  3HBL A;  2R7Z J;  2HXI A;  5K7H A;  3TED A;  1ZTR A;  2DN0 A;  1W0T A;  3JR9 A;  1ZGW A;  1ETW A;  3JRI A;  2XSD C;  1TWF J;  2CUF A;  2DA1 A;  3QPL A;  2DTZ A;  4RDU A;  3ZOB A;  4J19 A;  1VFC A;  2DA6 A;  5EGO B;  1JT6 A;  3S2D J;  1TWG J;  1VND A;  1TWH J;  4A3C J;  1TWC J;  1MBH A;  3BQZ A;  5FKK A;  3ZQH A;  1PUF B;  2R5Y A;  4M3B A;  3JRF A;  1Z77 A;  5FKO A;  3ZQG A;  2IBD A;  2Y2Z A;  5FJ8 J;  5IP7 J;  3O8H A;  2EZH A;  3LSJ A;  1Y1W J;  2E2I J;  1AKH B;  3RKQ A;  3UKG A;  4D5C A;  4CYC A;  2MG4 A;  3ZQC A;  1K61 A;  2LD5 A;  1HDD C;  3IH3 A;  2ZB9 A;  3TW6 A;  3LSR A;  3FK6 A;  4DYR A;  2XB0 X;  5FLM J;  3Q0V A;  5M5X J;  1X2N A;  2Y30 A;  4ABZ A;  2XRL A;  3BTJ A;  2DA3 A;  2L7F P;  2CJJ A;  3GTG J;  2QF7 A;  5EGO A;  1P7I A;  2NVQ J;  1UHS A;  1R9T J;  4QSH A;  1D5Y A;  4IHY A;  1IRZ A;  2IEK A;  1PUF A;  3JRA A;  4BXX J;  4A3D J;  3E7L A;  3OSF A;  3BG9 A;  1AKH A;  5C3E J;  1IV6 A;  1FEX A;  4W1U A;  3HKZ N;  1H88 C;  2XPU A;  3ZQF A;  2H1K A;  4QIW N;  1IG7 A;  2G0E A;  1LFU P;  1E3O C;  2CQX A;  2LY9 A;  1BW5 A;  1IC8 A;  4GFB A;  4W97 A;  1IJW C;  1XS9 A;  5M3M J;  2YU9 J;  4B3A A;  1TC3 C;  2DJN A;  4DZJ A;  2LTP A;  3BR6 A;  2DMU A;  3LOC A;  3JRE A;  2FD5 A;  5EEA A;  1MBF A;  4X1E A;  3JRD A;  1RPW A;  1MBG A;  1FIP A;  3CCY A;  1X2M A;  3K2A A;  4IHX A;  2EZI A;  1IUF A;  1NTC A;  3Q3S A;  4AC0 A;  1P7J A;  1RET A;  2XB5 A;  1FTZ A;  3CDL A;  4XIC A;  1GT0 C;  2E19 A;  2ECC A;  4M3G A;  4QTR A;  1ORK A;  2JA6 J;  2LKX A;  4DZP A;  9ANT A;  5GP9 A;  2NVY J;  5EF6 A;  1H8A C;  1JGG A;  2JA7 J;  3BG3 A;  4MFD A;  5F27 A;  2DMT A;  4A3J J;  1I50 J;  2VI6 A;  2TRT A;  2L7M P;  4IHV A;  2OPT A;  2P81 A;  3W6V A;  2K40 A;  3PO3 J;  4CYC B;  1GUU A;  4C3I J;  2MSY A;  4DW6 A;  3QPS A;  3LNQ A;  3QQA A;  1WH7 A;  4XRS G;  4FCY A;  1W0U A;  3IV5 A;  4HNV A;  1JKO C;  5E3L A;  5J3L A;  1MSE C;  2E2J J;  4IHW A;  2EZK A;  3A03 A;  1JTY A;  3S1M J;  4A3L J;  5M3F J;  1U9O A;  5IP6 A;  3HOY J;  3TP3 A;  1T33 A;  2Y9Y A;  4FE4 A;  4C2M J;  2EBI A;  3ZQL A;  1IGN A;  1F43 A;  1U9N A;  1WCM J;  4L5E A;  2M0C A;  2R0Q C;  3GTK J;  3RZO J;  1IDY A;  1YRN B;  2AO9 A;  2DMQ A;  4Y7N J;  4FE7 A;  2I10 A;  5EZG A;  3S14 J;  3JRH A;  2DA7 A;  4XID A;  2ID6 A;  5IP9 J;  1B8I B;  3I4N J;  1T56 A;  1OJL A;  1O4X A;  3BR1 A;  2ELK A;  2NVT J;  4A3F J;  2LK2 A;  3HOX J;  3RZD J;  1QPI A;  3SFI A;  4RBO A;  1EF4 A;  5IOY A;  1HCR A;  1JUM A;  2JA8 J;  2EH3 A;  3C2B A;  5DS9 A;  3BR3 A;  2VKE A;  3MN2 A;  1ETQ A;  3G1M A;  2L9R A;  1HDP A;  3S15 J;  2VUM J;  2B63 J;  5C4X J;  4S0H B;  1GDT A;  1JT0 A;  1JUS A;  2O7O A;  2VPR A;  1YRN A;  4Y52 J;  1XC5 A;  2IAI A;  1XG1 A;  2E2H J;  4A3G J;  2GM4 A;  2H8R A;  2YUS A;  2M9H A;  2COB A;  2K9S A;  2NVX J;  3HOZ J;  4AYB N;  5IOZ A;  3JRC A;  1B8I A;  5FKL A;  2N8G A;  5E3M A;  3A01 B;  5IYB J;  3H0G J;  2EZL A;  1U8B A;  3Q0W A;  2XPV A;  1ETY A;  2XGD A;  1IDZ A;  4BKX A;  1ETK A;  5C4J J;  4FTH A;  1VF9 A;  5K7F A;  2HI3 A;  3IH4 A;  2M8G X;  2K9N A;  2DA2 A;  3HOV J;  2L0K A;  3LSP A;  3TW7 A;  3WHC A;  2MGQ A;  2GBY A;  5E3O A;  2O9L A;  1MNM C;  3MVP A;  5C44 J;  3JRG A;  2HXO A;  3IH2 A;  3GTO J;  2EQR A;  1JUP A;  4JYK A;  5M5Y J;  3DEW A;  5F04 A;  1UG2 A;  1MBJ A;  5J1Y A;  4BY7 J;  5F0F A;  4MFE A;  3D1N I;  2KDZ A;  5M5W J;  2R93 J;  1LE8 B;  1BA5 A;  3A01 A;  2LFB A;  3FIW A;  1FJL A;  4JX4 A;  2HDD A;  1OCP A;  3S1R J;  2PMZ N;  3HM5 A;  3GTJ J;  4NDL A;  3G1L A;  1BW6 A;  1HOM A;  2DMN A;  1SAN A;  5EDN A;  3PO2 J;  2D5V A;  2LP0 A;  2XPW A;  2ME6 A;  4JX5 A;  1ETV A;  2XGC A;  4C3J J;  2X48 A;  3HOW J;  3SJM A;  5JLX A;  4XRM A;  3HOU J;  2YS9 A;  5J1U A;  5F08 A;  5JLW A;  1JJ6 C;  5DTD A;  2JK3 A;  2LVS A;  1ZQ3 P;  2JMW A;  2LR8 A;  1MSF C;  1WPK A;  2GLO A;  4XK4 A;  3F0C A;  3BTC A;  2CU7 A;  2R92 J;  4FIS A;  1WH5 A;  4IEJ A;  3M3Y J;  4V2G A;  1QRY A;  1ZR4 A;  1LE8 A;  1POG A;  3A02 A;  3BR5 A;  4D7N A;  4XRS A;  1ZR2 A;  5GPC A;  1U78 A;  5BNG A;  2ECB A;  3OIO A;  4M3D A;  3NAR A;  1NK3 P;  2HYJ A;  4AUX A;  4A69 C;  1MBK A;  1GV5 A;  1SFO J;  2CRG A;  4C3H J;  3K7A J;  3GTL J;  1RKW A;  3CMY A;  5F0H A;  1TWA J;  3BTL A;  1OCT C;  5FLV A;  1I6H J;  3G1O A;  2M34 A;  5GPA A;  2TCT A;  2AHQ A;  2K9Q A;  1H89 C;  1Z0X A;  3WHB A;  1VI0 A;  3HGG A;  2JN6 A;  4MIM A;  1AU7 A;  4LOC A;  3ZQI A;  3VPR A;  3FKI J;  4M3E A;  4A3E J;  2LLK A;  3OOU A;  1QVU A;  5IYD J;  2JWT A;  1ENH A;  2QCO A;  5FKN A;  3GTP J;  1A6I A;  1X58 A;  1JJ8 C;  1ETO A;  1JTX A;  2O8K A;  1GV2 A;  3BQY A;  4BBR J;  4A3B J;  1HLV A;  2XGE A;  1UMQ A;  2NOG A;  4BY1 J;  5HOD A;  3GBG A;  1A5J A;  3GTM J;  5J1R A;  4I76 A;  4JP0 A;  1G2H A;  5F0C A;  1RES A;  3BT9 A;  3B6C A;  4A3M J;  4B1R A;  1FIA A;  4JX6 A;  3MKL A;  4D5F A;  3OSG A;  2MW8 A;  2NS7 A;  1AHD P;  1QVT A;  4BBS J;  3SDG A;  4UUS B;  1MBE A;  3S2H J;  4X6A J;  4V2F A;  4A3I J;  5EG0 B;  1K83 J;  2CUE A;  1B72 B;  3HGY A;  4A3K J;  5EZH A;  1APL C;  5IYC J;  1ETX A;  3BR2 A;  1GVD A;  1I3Q J;  1F36 A;  2R5Z B;  1BJZ A;  1MH3 A;  1DU6 A;  2Y31 A;  4B4C A;  3TP0 A;  1JKR C;  2Y9Z A;  5F1J A;  2L7Z A;  5K7Z A;  3RQI A;  2CQQ A;  1RR7 A;  2Y0S N;  5E3N A;  3FIS A;  1WI3 A;  2X9D A;  3M4O J;  2HOT A;  4G12 A;  2DA5 A;  2FQ4 A;  3FK7 A;  4MO7 A;  3CQZ J;  3I4M J;  1BL0 A;  1LFB A;  4UUT A;  4A93 J;  3HEF A;  5IPA A;  1JKQ C;  2NS8 A;  1HF0 A;  4UUS A;  3B6A A;  3H3V K;  3L1P A;  5EG0 A;  3HB9 A;  4M3F A;  4D7M A;  2DMP A;  3S1Q J;  1B72 A;  5FKM A;  2JA5 J;  3S1N J;  3PM1 A;  2WAQ N;  4I6Z A;  4M6V A;  1NK2 P;  2R5Z A;  5EYR A;  4DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...