1G2HA

Solution structure of the dna-binding domain of the tyrr protein of haemophilus influenzae
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
SAVISLDEFENKTLDEIIGFYEAQVLKLFYAEYPSTRKLAQRLGVSHTAIANKLKQYGIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN TYRR HOMOLOG
publication title Solution structure of the DNA-binding domain of the TyrR protein of Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transcription
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18024 HTH_50 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1g2hA00
3ZQGA 2QF7A 4JX4A 3JRIA 2HXOA 1HDPA 5EG0B 4IHXA 3HDDA 1HF0A 2HYJA 5M5XJ 1BL0A 2ECBA 1F36A 3HOWJ 1TWGJ 5F0FA 3JRGA 3TP0A 1ETYA 3M3YJ 4BXXJ 2ECCA 1TWCJ 3OOUA 1ZK8A 5GPAA 1DU0A 2YU9J 2DJNA 3IH3A 4MFDA 3BQZA 3JREA 1F43A 1QVTA 1VFCA 2XSDC 1H8AC 3H3VK 5FLMJ 1QPIA 1XG1A 3BTIA 3HOZJ 2R93J 5F08A 2XGDA 2FQ4A 1MBHA 5JLWA 3SFIA 5FKNA 2XPVA 1WH7A 2MG4A 1D5YA 1IUFA 1Q1VA 3O8GA 4BY1J 4Y52J 3JRAA 1IDZA 1JTXA 2JA8J 4HNVA 4BBSJ 5M3FJ 1ZKGA 2R5ZA 2M34A 3HEFA 1GV5A 3LNQA 2O8KA 3UKGA 2DA3A 4B4CA 2NVTJ 3HGYA 1FTZA 5DS9A 1VI0A 4D5CA 4XICA 4M3GA 2TCTA 3BQYA 1TWAJ 3IH4A 3GTPJ 2I10A 2CU7A 5IP7J 2K40A 1W0TA 4A3CJ 1T33A 2Y2ZA 2DA1A 4FE7A 2KT0A 1ETVA 3PO3J 4X1EA 3HBLA 1A6IA 1B72B 3TEDA 1QRYA 2CJJA 2IAIA 1LFBA 3BG5A 2Y9YA 3FKIJ 1OJLA 1PUFB 4MLOA 3LSRA 4AYBN 3PO2J 2ELKA 2W48A 1U9NA 2YS9A 4A3FJ 3S1RJ 4A3EJ 4DZPA 1FEXA 3BR3A 3NARA 3TW7A 4I6ZA 1X2NA 3Q3SA 2O9LA 1MBFA 2FX0A 3HOXJ 1P7JA 2JMWA 4L5EA 2FJ1A 2L9RA 2JWTA 1ETXA 5J1UA 4JX6A 4BBRJ 4C3HJ 1TWFJ 1P7IA 3GTKJ 2NVXJ 1I3QJ 4MIMA 3BR5A 1AHDP 2JA6J 4M3FA 4W1UA 4CYCB 1BW6A 1ZR4A 4DYRA 1Y1WJ 1GVDA 1MSEC 2HQ5A 1GV2A 3TW6A 1POGA 4C2MJ 3C2BA 2LTPA 3DEWA 1BJZA 1YRNA 1JT6A 2VI6A 3HB9A 4B1RA 5K7FA 2MW8A 3A02A 5HODA 2Y0SN 4MO7A 3ZOBA 3L1PA 3Q0WA 2EZIA 2RAEA 5EF6A 4UUSA 3QPSA 2B63J 1OCPA 2E1OA 1MSFC 2ZB9A 3JRCA 5C3EJ 2LFBA 1JUPA 1APLC 2FD5A 5EZGA 1I50J 4ABZA 2EH3A 3B6CA 1IDYA 3QQAA 1NK2P 3FK7A 1X58A 1JTYA 1RPWA 2LK2A 2O7OA 5FLVA 3WHBA 1RR7A 3BTLA 4C3JJ 1H89C 4DW6A 1AKHB 4D5FA 1IV6A 1ZR2A 1H88C 3HKZN 3LOCA 3BR0A 2AO9A 2NOGA 1JKRC 2JA7J 1WPKA 4JYKA 4A3IJ 2R5YA 1BW5A 1ITYA 2WV1A 1K61A 1B8IA 5M5YJ 4J19A 2M9HA 5GPCA 4G12A 5EDNA 5EZHA 5EEAA 2HOTA 1GT0C 2HOSA 2K9SA 1Z77A 1MBKA 1Y1VJ 5IOYA 4Y7NJ 1FIAA 2NVQJ 1DU6A 2L7ZA 5F27A 4BY7J 3GTGJ 1WGXA 4LOCA 2E2IJ 2R0QC 4IEJA 1MBJA 3OSGA 1T56A 1VF9A 2LVSA 3BTJA 4DYCA 1RKWA 4M3EA 5EYRA 3GTLJ 2IEKA 1TWHJ 2ME0A 2COBA 2H8RA 4XRMA 1NK3P 5EGOA 5E3LA 1UMQA 3H0GJ 1JT0A 1JKQC 2LKXA 3VPRA 4A3KJ 1ETKA 2XPUA 5IYCJ 2EZLA 1E3OC 3JR9A 5F1JA 2OF7A 2G0EA 1JKPC 3IH2A 2DTZA 1XC5A 2AHQA 2DMTA 3GTJJ 4IHVA 2K9QA 4NDLA 4M3DA 2YUSA 2X48A 1RETA 3LSGA 5DTDA 2XB5A 2KDZA 4GFBA 3FIWA 1O4XA 3Q0VA 5IOZA 2NVYJ 1BA5A 4A93J 3B6AA 1HCRA 2EZKA 3RZOJ 2X6OA 3TP3A 1NTCA 2XB0X 1A5JA 1Z0XA 1MBEA 2HOAA 3K2AA 3MKLA 2XPWA 2Y9ZA 3BR6A 3S1MJ 1U8BA 4AUXA 2LR8A 4W97A 3S15J 1UG2A 2MSYA 2K9NA 4MFEA 4XIDA 3GBGA 5C4XJ 2JJ7A 3S2HJ 1EF4A 5J1YA 2IBDA 1W0UA 1ZGWA 3G1OA 1HLVA 2DMQA 4CYCA 1JUSA 3CCYA 3BR2A 1R9TJ 4A3BJ 1LFUP 5F0CA 2D5VA 3MVPA 1SFOJ 1YRNB 1WH5A 5J1RA 1LE8A 1MH3A 3SDGA 1ZQ3P 5C4JJ 1GDTA 3JRFA 3ZQFA 4JP0A 5F04A 4JX5A 3A01B 4A3JJ 2ID3A 2NS7A 3HM5A 3RKQA 1G2HA 2H1KA 2L7FP 3WHCA 1OCTC 1IJWC 4M3BA 2EQRA 3S2DJ 2HDDA 1X2MA 2CQQA 2CQXA 4FTHA 1I6HJ 2LLKA 4XK4A 2CUFA 3IV5A 1OFCX 2DA6A 3RQIA 4FE4A 3JRDA 3HOUJ 1HOMA 5GP9A 3DCFA 4FISA 5IP9J 3CMYA 5EG0A 2R5YB 1VNDA 2JN6A 2M2EA 1CQTA 1B8IB 1IC8A 3HOYJ 3GTQJ 3SJMA 2DMUA 2XGEA 3I4NJ 2EBIA 2M0CA 3OIOA 4IHWA 1WI3A 3ZQHA 1HDDC 2XGCA 2MGQA 2GM4A 2E19A 2L7MP 1XS9A 2DA7A 5IYBJ 5E3NA 1FJLA 2PMZN 4D7MA 1U9OA 3NAUA 4RDUA 2ID6A 5K7HA 5FJ8J 3Q0UA 3BTCA 2GLOA 5C44J 2VPRA 4I76A 4V2GA 2L0KA 3BG3A 2WB1N 2VUMJ 4AC0A 2CUEA 5EGOB 3GTMJ 3ZQLA 2R5ZB 5F0HA 4D7NA 2R7ZJ 5K7ZA 2DA4A 2DMPA 4IHYA 3G1MA 2HXIA 1IG7A 1S7EA 1TC3C 3E7LA 5FKLA 3M4OJ 3O8HA 1K83J 2EZHA 2NS8A 4QTRA 3JRBA 2ME6A 3LSPA 1ETQA 4FCYA 2R92J 1GUUA 5M5WJ 1RKTA 1MNMC 1ETOA 3D1NI 1UHSA 5FKMA 4DZJA 4RBOA 4S0HB 1ORKA 2TRTA 3ZQIA 5E3OA 1B72A 2M8GX 3PM1A 2LD5A 1ETWA 4QIWN 4QSHA 5M3MJ 1JKOC 4EEFG 3MN2A 1FIPA 5FKOA 2Y31A 5JLXA 1PUFA 4B3AA 4A3MJ 2VKEA 3BT9A 2HI3A 2E2HJ 3GTOJ 3HGGA 2DMNA 4XRSA 2DA5A 1QVUA 4XRSG 3BG9A 5BNGA 4BKXA 4A3LJ 9ANTA 3S1QJ 2N8GA 3CQZJ 2E2JJ 1JGGA 3K7AJ 2VKVA 1IGNA 3S17J 4X6AJ 5IP6A 3HOVJ 3OSFA 3RZDJ 3I4MJ 1JUMA 2XRLA 3ZQCA 1IRZA 3S1NJ 2LY9A 1ZTRA 5J3LA 3CDLA 3FK6A 4A3GJ 4V2FA 2GBYA 3BR1A 5IPAA 5FKKA 4C3IJ 2LP0A 2P81A 4UUSB 1RESA 1WCMJ 2QCOA 3S16J 2JK3A 1LE8B 4A3DJ 3W6VA 1AU7A 2DA2A 5IYDJ 3F0CA 1JJ8C 1FTTA 2JA5J 1JJ6C 1ENHA 3JRHA 3A01A 2X9DA 3FISA 4DYQA 1SANA 1AKHA 3LSJA 2CRGA 1MH4A 3G1LA 5E3MA 3QPLA 1MBGA 4M6VA 1U78A 2WAQN 2OPTA 4UUTA 2DN0A 3S14J 3A03A 2Y30A 4A69C
chains in the Genus database with same CATH superfamily
5FGMA 2VXDA 5FFXA 5KHDA 1S5LC 4A2UA 1HDPA 1XGSA 1HKTA 1W36C 4NC6A 1YE9A 1JE8A 4IZZA 2JUCA 1SVOA 2J5PA 4XONA 3QYFA 2DBBA 1BL0A 2ISZA 1IN4A 3GZNB 3HTUA 4EJTA 3F22A 2ECCA 1ZK8A 4ZYGA 4MFDA 1K4SA 3ISPA 1F43A 1AOYA 4FHTA 2XSDC 3SZGA 1T95A 3H3VK 5TRDA 1FOYA 1QPIA 3HOZJ 2F4OB 2R93J 3BDDA 4IO9F 2ZO4A 5FKNA 4BHCA 1WH7A 1GLNA 3T8RA 4BGDA 2LOOA 5E1XA 3O8GA 1SD5A 3OY9A 1FYKA 2YX4A 5HS8A 4BHBA 3TO6A 3BZCA 5J8FA 1JTXA 2JA8J 2DDBA 2X51A 1OCCH 5D5UB 2UZKA 3O2PE 3GEZA 3QP6A 4E7IA 1Z7UA 3FWEA 2R5ZA 2M34A 3DKXA 3K70D 4NB5A 3LSMA 1D0YA 2DODA 5DS9A 3TMOA 2H1LA 2DFFA 4ZDPA 3GTPJ 4A0ZA 3UNGC 2W84A 2I10A 2CU7A 3DV8A 2K40A 4RB1A 1XMXA 2R7QA 3PJRA 2KKOA 1XMAA 1X1CA 2Y2ZA 4UVAA 4FE7A 1LEAA 3OS0A 2RKHA 3PO3J 5FO5A 1S7AA 2XAFA 3W2AA 3HC7A 3LA3A 3OYGA 1N25A 3SYTA 2Y9YA 1SFXA 3V8LA 2IGMA 3IRRA 4AYBN 3PO2J 4ESBA 2NXNB 2JT1A 1TBXA 1RRJA 2W48A 2HVSA 2RQQA 3NARA 5TJJA 3Q3SA 1YW7A 1R7JA 2DQRA 4XMYA 1EV7A 1SMYF 1QZZA 4KMUX 1U8RA 1ETXA 5J1UA 2KHMA 3FXRA 1IN8A 4GDFA 2VL8A 4HRIA 4UVCA 1LUJB 1I3QJ 2PEXA 1Z6RA 3P7NA 3BR5A 2JA6J 3DWLE 4W1UA 3ERED 3GFJA 4DYRA 1D8KA 2E1CA 4M6XA 4JBAA 2OV7A 2RQPA 1POGA 4IXAA 2Z3YA 3C2BA 4O3MA 4P1WA 3OYHA 3BOQA 1HSJA 5GAHJ 3MFKA 5LGTA 2VI6A 5K7FA 3E3VA 3K4NA 4PGGA 1UB9A 5HODA 1YS6A 2QM3A 2Y0SN 3M1CA 4HX8A 4MO7A 1I6XA 4F91B 3TKYA 5AIQA 1FPQA 2LBFA 5EF6A 3QPSA 3FBIB 1MSFC 3D5RC 4ITVA 4K2EA 3SZTA 2VQGA 5ED4A 1APLC 5EZGA 2FOKA 2LKPA 3EUKL 3V7CA 2EH3A 2BY3A 3D5SC 3PSIA 4Q5SF 1K7AA 2OTLI 2ZXWH 3CCJI 2DK5A 3NRVA 4KICA 2LF8A 1JTYA 3KYCB 3WHBA 2VJIA 1K78A 4AD9A 1H89C 3A2KA 3RPUA 3K4CA 2WTEA 1HW2A 3MMYB 4HF1A 1WPKA 2M1BA 5D5WB 1YS7A 4A3IJ 1I3AA 4CCLA 4CICA 1U3EM 2VE8A 3J80Z 5IT3A 1K61A 1YOVB 3H36A 2Z5UA 3CJTB 4G12A 3E6MA 3GCMA 5J4VA 1O3RA 3CF2A 2HDWA 2NYXA 3N97A 4L0ZB 3ML6A 1MBKA 4ETSA 1DUXC 1Y1VJ 3FXLA 1YLFA 3H5NA 3OMYA 2IPQX 2W24A 4ASNA 2NVQJ 1O7LA 1VQ6I 2E2IJ 2R0QC 4IEJA 2QZ8A 3HSRA 2OUMA 1QU3A 1T56A 1Y8QB 4Y3OA 5BMZA 4Q47A 1ZLKA 3GZ5A 1YQAA 4M3EA 5EYRA 5HDNA 3F8NA 3GTLJ 2IEKA 4KFCA 1TWHJ 1QHHD 2EILH 2Q1ZB 4XRFA 2VONA 4XSZF 4XKBA 1YG2A 2MLKA 2EFQA 4BE2A 2IJLA 4IRHA 1UMQA 1E17A 3AAFA 5E79C 3R6SA 2LKXA 2BYVE 3I56I 4BYYA 3CDHA 3CUOA 3GW2A 3RI4A 1Z67A 1Y0UA 1TNTA 2C6YA 4GRIA 1E3OC 4GYGA 3VSLA 3JR9A 4IPAA 4Y15A 2G0EA 2ICWG 3KETA 4EM1A 1JKPC 2LH9A 1IF1A 1USSA 4I98B 2HTSA 2HS5A 2DMTA 2K9QA 1T98A 2H94A 3JW4A 3RKWA 1V55H 2W7NA 2Q2EA 3F8MA 3JSPA 2XB5A 3HZJA 3KEYA 3KZIC 4E6KG 1D1AA 3CO6C 4RLQA 1O4XA 2MH2A 1R00A 1BA5A 2JZYA 2W4SA 3DLAA 1ZRCA 3E6DA 3B6AA 4G9YA 3H9JA 2HYGD 1UJ8A 3CJQB 2XB0X 4CCNA 4LLLA 3DBLB 2HEOA 1A5JA 1IN7A 1MBEA 2JPCA 3DU5A 3LFKA 2V79A 3K2AA 2UXXA 4BJTA 2ZFUA 3MKLA 4AIDA 2Z1DA 3W6JB 4LIVA 1U8BA 2LR8A 2DCEA 3K0LA 2MSYA 1W1WE 5F1RA 1B1BA 3GBGA 3DTEA 3CCEI 5HNFA 2A61A 2BXYA 2PMUA 1HW5A 1XSVA 2FXAA 4FQGA 4KMFA 3VOEA 3IRQA 5F64A 4F55A 3I9V2 4LJZF 3OYFA 2RVCA 1R9TJ 4RAZA 2V26A 2BEOA 1WH5A 1XCBA 2RC4A 5FRNA 4U7DA 1GDTA 3K4MA 1VZ0A 2WAFA 2VJ5A 3FXJA 3DLLF 3ZQFA 4IVNA 2JQ7A 1XGMA 1LEBA 3HL2A 4OINF 3RKXA 1ZG3A 2F2EA 1D0ZA 3DPLC 2X6XA 2Z16A 1BBYA 2H1KA 2P6TA 3CCSI 5B5EC 2LY1A 4PJLA 3RKYA 5FROA 3L2VA 1T2KA 1RNLA 1FMWA 1P4AA 4M3BA 2CQQA 1XGNA 2YX7A 3S3MA 3CMAI 1PP7U 1K78B 1I6HJ 2K5CA 3NWTA 4EGZA 3IC7A 1CF7A 2CUFA 1MMAA 3IV5A 1LFPA 1ZRDA 4KISA 5L3GA 2KIMA 4FE4A 3HOUJ 1OQYA 3RDIA 5GP9A 3F9KA 3ECOA 4O6JA 1SD7A 3QU6A 5D4SA 1TW3A 2JN6A 5FLXK 1SFEA 4XLAA 5CLSA 1CQTA 2E71A 1IC8A 4CCOA 4BNCA 3GTQJ 2O0YA 2HGCA 1LB2A 4YEJA 2EBIA 3O3KA 3CP2A 3T5XA 3GFIA 1ZH5A 3I4NJ 3OIOA 3VFZA 1U5TB 3BJOA 2R4GA 5HDGA 2GIVA 2MGQA 3VYTB 2GM4A 2BOLA 5IT9Z 3VYUB 2QA4I 2DA7A 1B9MA 5IYBJ 1FJLA 2KLOA 4CSWA 4WXHA 1YJ9I 2A69F 2DLLA 3QRFF 4HX7A 1EH7A 3NAUA 1GXPA 3MKWB 2EINH 3DKYA 4EATA 3Q0UA 4I09A 2GLOA 5C44J 4KNYA 2VN2A 3P9CA 3BG3A 2CUEA 3GTMJ 2PJPA 1X3WB 3EUAA 5AONA 3C7JA 3S32A 3K4LA 2CQ7A 3WE3A 5K7ZA 3DU6A 3FXKA 4XKVA 1SD4A 3RYRA 2XUBA 5BOXA 4YFXF 1IG7A 4BQAA 1STZA 2L9NA 3ESWB 5FKLA 2BY1A 4M71A 3BP8A 4KIBA 2IA2A 3JRBA 1O3TA 2DOEA 1H0MA 1S29A 3OL4A 5FB2A 1ZREA 3CLOA 2KJCA 1ORKA 4KDPA 1KZHA 2A3SA 5E3OA 4XR6A 3RCOA 2F5EA 2Q2EB 3PM1A 2LD5A 5JVGF 5JR3A 2ACJA 5M3MJ 4EEFG 4N9HA 3V7SA 5FKOA 2I8DA 5JLXA 1IN6A 3JAMK 4ANJA 4A3MJ 1OR7C 2HTJA 3HKZA 2E2HJ 3GTOJ 4XRSA 4RB2C 3IP4B 4MNUA 3RPUD 2DOAA 2KDOA 3IKTA 3BG9A 5BNGA 1G3WA 5BPIA 4BKXA 4HQEA 4A3LJ 3A4CA 2ZNYA 4RM3A 3S1QJ 4BACA 3CQZJ 5LRRA 3BWGA 3DEUA 2WWYA 1KU3A 4EJWA 2IS4A 3K7AJ 3S17J 4X6AJ 2BVLA 3K2ZA 2M30A 5IP6A 2OA4A 3J7ZI 4GXOA 4OIOF 1KQ9A 1Q1HA 4RS8A 2XGXA 2X85A 2DYSH 2X6YA 2BBYA 4G8XA 4LB5A 1P6RA 4V2FA 2XF5A 3DXJF 3EUHC 5ICEA 2FE3A 5E8GA 3RIRA 3O6BB 3ZMVA 2YPRA 1RESA 1J09A 1XX5A 2BE5F 3MKZA 4A3DJ 2MC4A 2ZJQF 4JK1X 1AU7A 1RUOA 2DA2A 5IYDJ 1SD6A 2X1EA 2W85A 3WTYC 4XLCA 3L09A 2AQEA 3U9GA 3FDYA 3AKZA 3ZMZA 1ZLJA 3GWZA 4R8HA 3JRHA 3A01A 1S6LA 2X9DA 4CZCA 4LG0A 1AKHA 5E8IA 3WE2A 3I58A 4OIRF 2JSPA 2CH0A 1MBGA 4ZH4F 5A2QK 2OPTA 5HLHA 4XLPF 5JFRA 3KFWX 3FXOA 3R0AA 3A03A 2EWNA 4N4OB 4QLCU 2ZJRF 2QF7A 3OIPA 3TOBA 4FETA 4EGYA 3HDDA 3JSOA 1F36A 5F0FA 3CCUI 1FY7A 4C2TA 1VQ9I 3G4SI 2XAGA 1TWCJ 1DU0A 5GPAA 3GFMA 1J7KA 4EQQA 3IH3A 2GOXB 2B7EA 3I0TA 2F6CA 1U6GA 5DUIA 1H8AC 1XG1A 2EIMH 3BTIA 1WJEA 3GVAA 2V1XA 2A5YB 4S04A 2DXIA 1B4AA 5JLWA 2CQKA 2BHZA 4ZYAA 3GYHX 4YFNF 1FOWA 1ERDA 1IUFA 1Q1VA 1R5HA 3EDPA 4UXNA 1MJ9A 4M73A 5M3FJ 1ZKGA 4I0AA 2ZNZA 1GV5A 4DIQA 2NVTJ 3UKGA 4B4CA 2OJED 3KX2A 4M3GA 1XCVA 4G6DA 2TCTA 3E97A 3K10A 4CYDA 1TWAJ 4E4HA 1V5GA 3WTTC 4YIRX 4HSRA 3S8PA 2FF4A 5IP7J 1IZ1A 3ZMSA 1W0TA 2O03A 4A3CJ 1T33A 1Z7LA 2KT0A 1ETVA 1K6OA 2M87A 2G7HA 3FXMA 4KT6A 1QRYA 3PIOF 1QO0D 2IAIA 2IW5A 3PNVA 4MTDA 3WTUC 4MLOA 4ENNA 4L9VA 3LSRA 2IT0A 4E7KA 2ELKA 1V5FA 3ZXSA 2Q0OA 4L9JA 4A3FJ 2W57A 3S1RJ 1YIJI 4A3EJ 2WV0A 2WAEA 1X19A 2A68F 2K27A 1OYYA 1ON2A 2ZXJA 3ZGKA 1MBFA 3HOXJ 2DJIA 2CFOA 2L9RA 5H20A 1FWZA 2JWTA 2NS0A 3OWTA 3HOTA 1EH6A 5LHGA 1TWFJ 1P7IA 2RNJA 1A04A 4BL0B 1R5GA 1QQIA 4HV6A 2CS3A 3G71I 1ZR4A 1VQNI 1GV2A 4NC8A 3TW6A 4C2MJ 1R1TA 1G8XA 2MD5A 1IW7F 2CO5A 1O3SA 2LTPA 1WKMA 3DEWA 3KPHA 2F5DA 2GXAA 2CUZA 3FHZA 3LSTA 3KCCA 3RYPA 3EYIA 2M7BA 2KPMA 3A02A 3K70C 5H6RA 1QZYA 4YIIA 4G7HF 3L1PA 2VKDA 3P5JA 4UUSA 4HAMA 5H2FC 1OCPA 4AVZA 1MZBA 3JRCA 2LFBA 4BEHB 5BQTA 4R79A 1NG6A 4XNFA 1KGSA 4ABZA 4YG2F 5L3CA 1VQOI 2QSGX 3F8BA 3B6CA 5J40A 4P5OA 3OS2A 1YX5A 2EFNA 4HDUA 2B0LA 2E5ZA 1TLHB 1RPWA 2L7KA 1W4MA 2OZ6A 3BTLA 1AKHB 1V5EA 3DKWA 1IV6A 2DO7A 3F8CA 1ZR2A 4N0BA 2XAHA 4WF2A 1H88C 2CG4A 2RDPA 3EETA 2AO9A 2NOGA 2VBYA 1JKRC 3SXYA 3OYKA 1NG7A 1RC9A 4PFPA 1BW5A 2AXTC 1B8IA 4UHTA 1Z21A 4HEA2 1MMDA 5AIPA 4C2UA 3H0DA 2L4AA 2HOTA 1GT0C 2HOSA 4N4NB 2F5VA 5ERIA 1REPC 4B47A 1FIAA 2UXNA 2ZJ2A 1A36A 2YSRA 1Y6IA 2XC7A 2W00A 1MMNA 2LG4A 4FX4A 2HR3A 2MD0A 3OSGA 2P5VA 3K1MA 2HNHA 4OMZA 3LQRA 2LVSA 4DYCA 2KISA 1RKWA 1OCRH 1B6AA 3GUDA 1P4XA 2ME0A 2COBA 1FYLA 2IGKA 4LG3A 2H8RA 3GFLA 4XRMA 3AFHA 1QA6A 1JT0A 2KL4A 2D45A 3C18A 2D1VA 1ETKA 3ABLH 4CXFA 2PQ8A 3CC7I 2EZLA 2FA5A 4NQWB 3I54A 2M5WA 3OS1A 2OCCH 1K6YA 2OF7A 2NVUB 1DGRM 4UB6C 5ILUA 5DM7F 4S05A 1ZG5A 4IHVA 3DFGA 2HQRA 4L9TA 5D6FA 3JTGA 2IRFG 4M3DA 4F92B 2YUSA 2EFWA 3KZZA 5DTDA 5KVRA 4RA2A 4EJOA 3H1CA 2DT7B 2KDZA 4GFBA 2K7LA 3VODA 4KT5C 2CUJA 4I99C 1E3HA 4A93J 4BJ6C 2LNBA 3T0YA 3TP3A 1NTCA 2FNAA 1FZPB 1BN5A 2QKMB 5L3BA 4GCVA 1BJAA 2X4HA 3GLLA 3QU3A 5LGUA 5LRSA 3S1MJ 4AUXA 5CJ9A 1OKRA 3D5LA 4DNCA 4W97A 3CCMI 1UG2A 5D5VB 1W36D 3BPXA 2K9NA 3NEUA 2CV0A 4XIDA 1EF4A 2FUG2 1JHFA 2IBDA 4I7HA 2G7UA 4XN0A 5B3SH 4QWQA 4DBQA 2R7OA 4U88A 4CYCA 2MC3A 1WHUA 2KRHA 2GIZA 1TW2A 3CCYA 4NBQA 3M9AA 2BVMA 2D5VA 4CCMA 1XPXA 4HOBA 1VQ8I 1R1VA 3OYAA 1FP1D 3E5XA 3SDGA 4RGXA 5C4JJ 1DDNA 3WG9A 3OL3A 1NHAA 1R5ID 1V3FA 5CKTA 4JX5A 3E0JB 4A3JJ 1DQUA 3HM5A 3WODF 1KQ8A 3BCBA 2VT2A 5DV5A 3OYBA 5HS9A 3CC2I 3KP3A 3AL0B 3PNYA 3WHCA 4WWCA 1IJWC 3S2DJ 1UHWA 4YIFA 4WXCA 1YJWI 5CPRB 5H6QA 1CGPA 2MABA 1IO2A 2Z33A 4HDVA 1OFCX 2XKOA 1F5TA 1ZGJA 1A31A 4OAZA 4FISA 1XTAA 5LGNA 4HF2A 4E70A 5DD8A 1S3JA 5EG0A 4HG2A 2M2EA 4PJMA 2LKSA 2MYSA 1B8IB 1IRFA 1MGTA 4BS9A 4A6DA 5J8CA 5IT9K 3ONQA 1R71A 4AYBA 2M0CA 2L01A 1JXSA 2WY7Q 6PAXA 4ESFA 4HQMA 3ZQHA 5K5OA 4Q4ZF 2PMZN 1ULYA 3ELKA 2EV6A 2CV2A 4RDUA 4OIQF 3FMRA 3RTRA 5K7HA 3ECHA 2WY8Q 2H8WA 2VBXA 1W5SA 2V4JC 3BTCA 3E6BA 3AG3H 4V2GA 1K79A 2CMPA 4M9SA 2VC1A 2WB1N 2VUMJ 4HPQA 1I27A 1BI1A 4Y52J 1XN7A 2GXGA 3ZQLA 3V42A 4FX0A 3TO7A 2R5ZB 4BDYA 4ZC3A 3MZ8A 4ZTJA 3BJ6A 2R7ZJ 3DTKA 3KLNA 3OYCA 4IHYA 4XLNF 1FP2A 3E7LA 1SMTA 3OOPA 4TV7A 3FHNA 2RGVA 3M4OJ 3T8TA 2Y0SA 3O8HA 2EZHA 2NS8A 2UWMA 3H9QA 4ZYHA 3U1DA 1D0XA 4L9NA 1OYWA 1GXQA 2D2WA 4XKWA 1RKTA 5M5WJ 2V6EA 5HLTA 1JI8A 3D1NI 4RBOA 2EV0A 4S0HB 4CHUA 2L3DA 4IF4A 3J7YJ 1B72A 2HDCA 5KNLA 2L4MA 4QIWN 1VQMI 3N05A 3MN2A 5DCMA 2KZGA 4G7OF 2Y31A 3IWFA 2F5FA 3JTHA 1YIOA 2Y75A 2VKEA 2BY2A 3S3NA 1L3LA 3FXUA 2CSOA 2RV8A 4MTEA 5LEKA 1UHMA 5HDKA 3OYDA 4XLHA 1JGGA 1ZARA 1IGNA 4ZTFA 4IX7A 2EFOA 1IN5A 2HWVA 3M8JA 3HOVJ 3OSFA 2HPMA 2PX9A 1JUMA 5K5RA 1P2FA 1IRZA 1V54H 1WRJA 2O8XA 1RR8C 3G3ZA 4AIHA 1J0RA 1IRGA 4NHJA 1KU7A 3CDLA 5J4YA 1IXCA 2PG4A 3FK6A 5DUKA 2QENA 2V9PA 4X0GA 2O61A 1RIOH 3L9FA 3MD2A 2IA0A 2KRCA 5FKKA 2ZXHA 1D3YA 4C3IJ 3WTSC 2LP0A 2A6EF 1BOBA 3BCAA 1R1UA 3HSFA 4HA8A 2LBFB 3OYJA 2EJRA 1FX7A 2JK3A 1LDDA 3U21A 3W6VA 2E5NA 3ULQB 1KU9A 5KK1A 5LHIA 3F0CA 1JJ8C 1DPUA 4PDKA 3HHHA 4DGWB 3PUBA 3LSKA 3CTAA 2E7WA 3KP5A 4KN4X 4RAYA 3Q5FA 4UY8I 3TBIA 4HZFA 1FYMA 2P7CB 2QYOA 3GX4X 1FOXA 2QSHX 1WVRA 2P6SA 3C2HA 3LSJA 2E1NA 3G1LA 5E3MA 3QPLA 1XDUA 2WAQN 4PJJA 1Y0NA 2Y69H 4KIFA 1KYWA 3ZQGA 3FMSA 1TZLA 4JX4A 4B8XA 1E0EA 2QBYA 3ERMA 3IHUA 3BY6A 5EG0B 4CH7A 5HNHA 4J00A 1MNEA 1WJBA 2LRDA 3FKJA 4M72A 4ZZLA 1YI2I 1FMVA 4IHXA 4LLNA 3TOAA 1Z91A 3L2CA 3PFIA 1HF0A 2HYJA 2JRMA 4MQVA 4Z6YA 2X6WA 1WJAA 3HOWJ 1GHCA 3JRGA 1ETYA 1MW7A 1SVMA 5CYVA 1HSTA 1KQ0A 1P4WA 2R7SA 3F6OA 4WCGA 2YU9J 3CCVI 5DYMA 3GZ6A 2OAZA 1U5TC 1HQCA 3AG4H 5E20A 4F7ZA 3V7RA 2DOFA 1MDMA 1ZN2A 3MEXA 4PJNA 5F08A 3DBHB 1S72I 3SFIA 2DTRA 2CWEA 3UR3C 3CLQA 1LQ1A 2LY2A 4E7LA 4ON0A 3LAJA 1D5YA 2EIKH 4HW0A 4AWXB 4N9IA 4BY1J 1O3QA 1SC7A 4OAYA 1UELB 3OR2C 3ABUA 2XF6A 4XQFA 4L0YB 4MEXF 4HNVA 3CD6I 3SFZA 5E1ZB 3HEFA 1ZRFA 3LMMA 3LNQA 2QGUA 2DA3A 4XKCA 3DTIA 3HGYA 4FT8A 4D5CA 4XICA 1T0FC 1BIAA 3H5RA 1IRXA 3BQYA 4LK1F 2VC0A 5CVIA 3FXQA 5D8LB 4IQJA 3D0SA 4BQQA 3L7WA 1X4OA 4CZZA 5KCMA 3ZR8X 3ROUA 3W3CA 1I1SA 1A35A 3BPVA 2VJ4A 1FT9A 1Y39A 4E7SA 1B72B 4H0EA 2DU9A 3TEDA 1J2XA 4LITA 4BXFA 4M9ZA 3HXLA 2CJJA 4P9UA 4BUPA 3LSHA 4I01A 2QEXI 1BC8C 3BG5A 3DP7A 5DCMB 2VJJA 4PGHA 3G6EI 2ZC2A 1BIBA 5CQEA 3REOA 3CMEI 3VWBA 2DW4A 3PQJA 4PSXA 3R60A 2HZDA 2FBIA 2JPBA 3KP2A 2R7RA 1AWCA 4DZPA 3BR3A 1F4KA 2V6CA 2PI0A 2BHYA 2JRTA 3MKYB 3TW7A 3M7GA 2JVHA 4I6ZA 1X2NA 4JOMA 5LD2C 2O9LA 4ZDOA 1BI2A 1P7JA 3BROA 4Y33A 4F3QA 3FF5A 2ZMEA 4M6YA 4I2OA 4BBRJ 3L2QA 2OQRA 4U0YA 4EM0B 1SAUA 3HRUA 1AHDP 1N78A 1BW6A 3K6GA 2HQ5A 4PZJA 4LK0F 2FMYA 1XD7A 2FOWA 3VYSB 3W2WA 1VTNC 2GOMA 3VEPA 3F23A 4BE1A 3GO5A 1BJZA 2F4IA 1JT6A 3HB9A 4B1RA 1VQ5I 1FSHA 4BXUA 2CW7A 2IS6A 2P0WA 3Q0WA 2PN6A 5LLQA 4UUVA 4E7ZA 2A6HF 1PJRA 2OD5A 2B63J 2E1OA 2M7AA 4IHTA 1IAWA 5C3EJ 5LHHA 1W5CC 1JUPA 2XHKA 4CDGA 4ZJZA 2Y0MA 3BJAA 1SAXA 1PUEE 1R6RA 4I0BA 3QQAA 4EMSA 1NK2P 2STWA 2CQNA 2XDVA 3FK7A 1CF7B 2HPIA 3L00A 2LK2A 2O7OA 3IKVA 5FLVA 1RR7A 4C3JJ 4DW6A 1USTA 2MH9A 4D5FA 1V4RA 3L2UA 2OZUA 1U0JA 1LKXA 3BR0A 2JA7J 2ZXIA 3M1EA 4AIJA 4MEYF 3S93A 3F6VA 5K1YA 3J7AY 3LWFA 1ITYA 3R4KA 2PBIA 5M5YJ 4HX4A 4J19A 1Z9CA 2M9HA 1E2XA 3CZ6A 4A0YA 3CDIA 3LA2A 4DQ2A 2BZTA 3SZPA 2K9SA 4HYEA 4AIKA 3H3ZA 1R22A 3SHFA 3MCZA 5IOYA 1XGOA 3KEQA 1DU6A 2EIJH 5F27A 5HVQC 4CGZA 5D4RA 1TTYA 4IRGA 4XORA 1MNDA 3GTGJ 1WGXA 5ILVA 5EEGA 1MBJA 3B02A 2XROA 4C9YA 3WGHA 2IS1A 1WZ2A 4IJAA 1YHQI 1VF9A 3BTJA 5GTIC 3EYYA 1MDMB 2OCEA 3FBNB 2FBKA 2V9VA 2ZSIB 3HSEA 2W1OA 2V1NA 1VQKI 4KUMA 1NK3P 3MQ0A 1UAAA 5EGOA 2HKOA 4LB6B 3H0GJ 5D6EA 3BC8A 3K4BA 1T08B 3HUGA 4A3KJ 3SDBA 4RM2A 4XSXF 2XPUA 5IYCJ 2IXSA 1VQ4I 1X3ZB 1M1EB 2ELJA 3ZQQA 2K3PA 4Y17A 2IGNA 2LF7A 2O5RA 1HKSA 2H6CA 1Z3XA 2E60A 2DTZA 2EB7A 2W25A 2FSWA 3GTJJ 1XMKA 3ASNH 2FQ3A 4LLGF 2LSOA 2X48A 4A0XA 2COMA 1RETA 3LSGA 3ZN0A 3E1SA 4KJZA 3DF8A 2TDXA 4IL6C 2P8TA 1Z6TA 5IOZA 2WADA 1B59A 1MMGA 1VQPI 5DCFA 3LAPA 2EPFA 4RGRA 2EV5A 1HCRA 2EZKA 2BGCA 1QGPA 2L2OA 2VOOA 1RZ4A 4I02A 1DPRA 1QNTA 2YU3A 2E1MB 3B73A 3KLOA 2HOAA 2CGPA 2XPWA 3BR6A 4UV8A 2L54A 4B3XA 4LGWA 4M74A 3S15J 1R4NB 2E35A 2JSCA 3JAMZ 2ZMEB 2XAQA 4KITB 1LDJA 1UFMA 5ICFA 1R49A 2BV6A 2JJ7A 1NH3A 3S2HJ 2XVCA 5J1YA 1ACIA 4ENJA 2KZVA 2HZTA 2DDAA 2HYFA 3RJPA 4RGSA 1ZGWA 2DMQA 2R7FA 2Y48A 1JUSA 1SEUA 4AU7A 5DM6F 4A3BJ 2R7XA 1MJBA 4P55A 5CVRA 3DPTA 1MKMA 5F0CA 1T8IA 3HPGA 1H9TA 3CUQC 1ZQ3P 2M4GA 1PYVA 3R61A 4B48A 1BC7C 3JRFA 4CCJA 2VQCA 2UV1A 2AS5F 2P4WA 3RSNA 3A01B 2ID3A 5E18F 1MD0A 4LG0B 3ABMH 5GAEJ 1GVJA 3J80K 5LBQA 1OCTC 1YJNI 4XOPA 2EQRA 4FTHA 1T39A 3KZYA 5HOOA 3MWMA 4LIUA 3TGNA 2GAUA 2LC2A 3VB2A 1EJ9A 2DA6A 3RQIA 1OMIA 1W5TA 5TISC 4II2A 2Q8KA 1HOMA 4LFUA 4IOCF 4ZDLA 2QQAA 4HBLA 3CO7C 5IP9J 2DT5A 3CMYA 2AXLA 1G6NA 3LL7A 2VLAA 4CO8A 2MLGA 2DT6A 3FM5A 4BAYA 4UNOA 5A2QZ 5EEHA 3SJMA 2QUFA 2XGEA 4QPOA 5B66C 3HRSA 5CQGA 4U7BA 1LVKA 3FM3A 4IHWA 4ZYEA 3JCUC 3ZPLA 1IV8A 1WI3A 1FNNA 3TQNA 1G3SA 1LVAA 2H09A 3U2RA 2E19A 4U87A 2QWWA 3ZRGA 5E3NA 2VPLA 4D7MA 5D5XB 2K4BA 3FZVA 3A1YA 4LD5A 2RREA 1BR1A 2EA4A 4GYIA 1G59A 3Q9VA 4I76A 3E6CC 4Y13A 4E7JA 3CF5F 3QOPA 2IVMA 2DFEA 2WA0A 3I64A 5EGOB 2Z2SB 1ZHFA 3HPHA 1A6QA 3GXOA 4PFOA 4BU2A 1J59A 1HA8A 3HUGB 2E7XA 2DA4A 2DMPA 2J5OA 3FX3A 2VKHA 1S7EA 1TC3C 2K9LA 1R4MB 3DBRB 5JVTA 2ESHA 1R36A 1KA8A 1K83J 3KP6A 4L5IA 1KONA 1F1ZA 1XSXA 2DPUA 1ETQA 2BXZA 3C3WA 4FCYA 1GUUA 2R92J 3LA7A 3X2QH 1MNMC 2VB6A 3QPHA 4RAFA 1UHSA 1S7OA 4GGGA 1OLTA 2LDUA 1R23A 2TRTA 4JQFA 1XSDA 4ZYDA 3VYRB 1ETWA 1Y8RB 4PUSA 3WTVC 4BDZA 2KP6A 2DFHA 1JKOC 1XDSA 2ETHA 1PUFA 4B3AA 5BPDA 3BT9A 4RLFA 2HI3A 4ENMA 5ICCA 2DA5A 1QVUA 3A0BC 4XRSG 4NC7A 4B44A 4J01A 1BI3A 1SVLA 4RMNA 5L3EA 4YELA 2ZJPF 1ON1A 9ANTA 3PNTA 4Z2YA 2K4JA 4A12A 2N8GA 2VT3A 2VBZA 2E2JJ 1IUYA 2A07F 1B9NA 3IL2A 2F48A 3I4MJ 2XRLA 4EM2A 4P9FA 3V8KA 1Z05A 2LY9A 5B1AH 5HLIA 2MBFA 5J3LA 3F21A 2QQ8A 4A3GJ 1UG0A 2KFDA 5L3DA 3BR1A 4WK8F 3J81Z 3K1PA 4A6EA 3QODA 1BM9A 4UUSB 2GWRA 1WCMJ 2QCOA 2GQQA 3AG2H 4U0WA 3C1DA 3WU2C 2F5CA 4UVBA 3VDXA 5LFAA 1FBSA 2KIFA 4O5VA 4U0VA 3CESA 2MA3A 2LMDA 2NRAC 2DPDA 1QHGA 3FISA 4DYQA 3HYIA 1SANA 1Z3YA 1YW8A 1ODDA 2X1CA 2CRGA 2HVQA 5E17F 3L2RA 1LPQA 4B43A 3AL0C 4M6VA 2P5KA 2KIQA 5K5QA 2DN0A 1MIJA 1VQLI 4EJUA 2CW0F 1G3TA 3I4PA 4MQ9F 4A69C 4DJAA 3QYEA 1SFKA 2OC6A 2GA2A 3K9TA 4ENKA 3JRIA 2ADUA 2HXOA 1ZYRF 3K4KA 2HOEA 4ZZDA 3HIFA 3WGIA 3V8JA 5B1BH 3TL4X 5M5XJ 3HRMA 2ECBA 1TWGJ 4M9XA 3TP0A 2QKLB 1LNWA 5J47A 2OQGA 3M3YJ 5CVJA 1BI0A 1WI9A 3CJNA 3OOUA 2FRHA 5HS7A 4CA0A 4BXXJ 5FD5A 2A6TA 3G2BA 4XOTA 1U5TA 2QSFX 2DJNA 4CCKA 3RPQA 4RB3C 3SEQA 1G3YA 1O57A 3BQZA 3JREA 1QVTA 3M07A 3NWSA 2X1DA 1VFCA 1T38A 3P9IA 2HQAA 3DQVC 2VQHA 3A0HC 5FLMJ 3BZ6A 3PUFA 2XGDA 2FQ4A 1MBHA 4A5NA 2HFHA 2E36A 3CMMA 1X4PA 3SQNA 2XPVA 4F93B 3ABTA 3U1KA 2MG4A 2VBWA 2W82A 3I55I 2DQLA 4XLFA 2M0MA 3JRAA 1IDZA 4BBSJ 4R1HA 4L5JA 2EFPA 3ZN1A 3CCLI 2O8KA 1FTZA 1T0FA 1VI0A 5DEQA 2P5LC 1YITI 5IY5H 2EK5A 2M3AA 4MGRA 3E5QA 3IH4A 2NAZA 2IGOA 4XN3A 1OYIA 5JHFA 1I5ZA 1X1AA 4II3A 1MJAA 2DA1A 5L3FA 2D1HA 2ESNA 1I1GA 3BG6A 4KYWA 1EA3A 2VOPA 4X1EA 1OR7A 2QQBA 3HBLA 1A6IA 1OCOH 2XASA 1QBJA 4YRVA 2GZWA 2R7DA 1LFBA 3OR1C 4QPQA 4IOAF 4HV5A 3FKIJ 1OJLA 2YR2A 1YX3A 2IA1A 1PUFB 1O7FA 2RNGA 2DAOA 5D8KB 4D1QA 1U9NA 2YS9A 2BY0A 1FEXA 1WWXA 4Y4RA 1J75A 3ZMTA 1IXSB 2FX0A 2JMWA 4KIGA 3SEZA 4L5EA 2FJ1A 2QLZA 4OWRB 2VE9A 1HBXG 4BQOA 2OU2A 1FBUA 3HHGA 3M8EA 4G94A 4JX6A 4C3HJ 4F52A 3GTKJ 2G9WA 3KYDB 2NVXJ 2GA1A 4MIMA 5FFZA 4M3FA 4CYCB 3MZHA 3EUHA 1Y1WJ 1GVDA 1MSEC 3W6KB 4H4KC 3ZQ7A 1Y56A 3N4MA 3J7AO 4HLYA 2M8EA 1YO5C 2R3SA 3WU1B 3WTXC 2PMZA 3H3UA 4OIPF 1YRNA 3HTSB 4RGUA 2MW8A 3P9KA 3K1NA 1ZAOA 2FEZA 3ZOBA 2E34A 3M8FA 3E5UA 5KAFC 2EZIA 2PJRA 2RAEA 3F3XA 2WB1A 3EPZA 3QP5A 2JA2A 2ZB9A 3PFYA 5F6FA 3TDUC 1ZG1A 5CVVA 2FD5A 2L5QA 3T1BA 1I50J 1Z1DA 4BHPA 1IXRC 3MZYA 2DYRH 2DK8A 1IDYA 2H27A 1X58A 5LEJA 3IUOA 3DEEA 3HKZN 3LOCA 4Q48A 3COAC 1W7PA 1HXDA 3KP4A 3BLYA 4JYKA 2R5YA 2V9KA 2WV1A 1I39A 3FMQA 5GPCA 2GXBA 5EDNA 3K4JA 5EZHA 2ZSHB 5DD4A 5EEAA 2ZFWA 1Z77A 1LDKB 3F8FA 1UCRA 2L02A 2FMLA 4Y7NJ 1H9GA 1EKEA 2L7ZA 4BY7J 4HNUA 4LOCA 4ESJA 3I59A 3OYLA 1DP7P 1E3PA 4BH9A 3HJEA 1JGSA 4B09A 4E7HA 4UB8C 5FD6A 2KQRA 3WTWC 1WJCA 2AQFA 4P96A 2KMUA 1J5YA 3C2GA 5E3LA 3S2WA 1JKQC 3ASOH 3VPRA 2ZCWA 5J6XA 4L18B 3I71A 1TL8A 1ZGAA 3WG7H 3ZMUA 3KP7A 1X3UA 5F1JA 1N77A 4EVIA 1OISA 4V19K 1TQPA 3BG7A 1WQ2A 3QWLA 3GF2A 3IH2A 1D1CA 1XC5A 2AHQA 1UZCA 3HRTA 5EJCA 4KN7X 5JHUA 3VSKA 2O3FA 4XBFA 4NDLA 2LYCA 2KJBA 2CW8A 4NNJA 3CP8A 2BW3A 3W2VA 5GTHC 2VXZA 1FOKA 3Q9SA 1K4TA 4EV0A 2QQ9A 1T6SA 2ELHA 2ZKZA 3FIWA 4NUBA 1YTYA 2JTVA 3Q0VA 2CV1A 2NVYJ 2IS2A 3V4GA 4HNTA 3RQ4A 1S9HA 2WAQA 3RZOJ 1J9IA 2X6OA 3QPTA 1Z0XA 2HQNA 4IQ4A 2Y9ZA 1X1DA 5JI6A 1MMSA 1VQ7I 2L9SA 2UUZA 2OBPA 5ILSA 4XM3A 3I5UA 4AVPA 4MFEA 5C4XJ 3OYEA 1PP8F 2KIUA 3HG9A 1W0UA 2P7VB 3G1OA 4A5MA 4EJVA 5DDGA 3QAHA 1HLVA 3K69A 3AG1H 1ZELA 3R0JA 1BR4A 1S8NA 4IHSA 3LFUA 3H9GA 3BR2A 1RI7A 1LFUP 2IP2A 3H92A 3MVPA 1SFOJ 1QZEA 3OYMA 2K85A 3CUQA 5J1RA 1YRNB 2VODA 1LE8A 1MH3A 4RAGA 4G7ZF 1D5VA 2XIGA 1PVEA 4MHGA 2PJRB 1FC3A 4DBRA 4JP0A 5F04A 1HKQA 4GO1A 4D0PA 4LMYA 5E1WA 3BZKA 1TT0A 2NS7A 4BE0A 2X0LA 2ZBKA 3RKQA 1G2HA 4BEHA 2Z99A 1DP3A 1KU2A 2WC2A 1YYVA 1WJDA 3QOEA 1EH8A 2L7FP 3PL8A 5GAGJ 3IWZA 4IKFA 1U2WA 4G6TB 1X2MA 2CQXA 4C30A 2XV4S 2HDDA 4OU0A 4DOZA 3GMEA 2LLKA 4XK4A 3ZMDA 3DPUA 2A05A 5HLGA 1W7PB 2CFXA 1PDNC 3JRDA 3F72A 1G4DA 2QBYB 2PFBA 3DCFA 2R7VA 2QVOA 3LSIA 3WTZA 2XF7A 2XKPA 2R5YB 2JUGA 1VNDA 1X1BA 4BQNA 3S3OA 3G73A 1WJFA 3I53A 3HOYJ 3ZCOA 1WSUA 3CC4I 2DMUA 2FU4A 4HLXA 1QPMA 5FLXZ 1R58A 1HW1A 4D9JA 1HDDC 2XGCA 2F4MB 2L7MP 4KA4A 1XS9A 2A5WA 4PJ0C 2R7WA 4OMYA 2R7UA 2VASA 3I59B 1U9OA 2LREA 1BR2A 2EA2A 2ID6A 3IAS2 1FLIA 2K02A 5FJ8J 1FSEA 4XLEA 2VPRA 5CVUA 3PQKA 2I5UA 2L0KA 1ONVA 4AC0A 1F9NA 5F0HA 1N75A 3NQOA 1TQMA 4D7NA 2HKXA 1X1PA 3KYLA 4XL9A 1OPCA 4PK4A 1HC8A 3QYBA 1P9QC 2NNYA 2XAJA 3G1MA 2HXIA 2K86A 2ISYA 3H5AA 2V7FA 3ZP5A 2XSJC 3CJRB 4NQWA 1FBQA 2FNPA 4QTRA 3OV8A 2ME6A 3LSPA 3CCQI 4HSTA 2KRFA 1ETOA 4DZJA 5FKMA 4PCQA 3H35A 5ICGA 2HU9A 3KE2A 3ZQIA 2CYYA 3WU0A 2M8GX 3EQLF 3ABKH 2B9SA 2BW3B 4AM3A 4WXDA 4QSHA 5KAIC 2NNNA 3OYNA 1D8JA 1FIPA 2M4KA 1TNSA 4BJ5C 1WJ5A 2M45A 2OTJI 2VIXA 3HGGA 2DMNA 1P92A 4IRIA 3CCRI 1KYZA 1W7PD 5BS6A 2STTA 4PSWA 3GLXA 4CUGA 1RUNA 2VKVA 2E1MC 2NOJB 2PMHA 1JHHA 3RZDJ 4HF0A 1TP4A 3ZQCA 3LQQA 3S1NJ 3PSFA 2K9MA 3WGGA 2DFIA 1ZTRA 1SFUA 2ZMEC 3J81K 1YFHA 1DGWY 1D1BA 2L9VA 2VQLA 2HVRA 2MFZA 3IAM2 2GBYA 4YFKF 3I3LA 5IPAA 1L0OC 2DI3A 4UV9A 2JVGA 1BOAA 2K3FA 2Z9OA 3TDZC 2P81A 1AA7A 3L2WA 3CUQB 4FASD 3HOSA 3S16J 1LJ9A 4OOIA 2RN7A 1LE8B 2R7TA 1YW9A 2WBMA 3MAJA 2O6GE 2PLYA 4WX9A 1FTTA 2JA5J 4RB0A 3PIPF 1JJ6C 1C0WA 1ENHA 3OIQA 1TQIA 3OYIA 2FBHA 1OCZH 5FRMA 3KEOA 3KIOA 1MH4A 2H6BA 2XAUA 1U78A 5GADJ 4UUTA 3S14J 1TT5B 3TO9A 2Y30A 1XB4A 1WFXA 2V1UA 4G6QA 5TGTA 2XRNA 2V1DA
chains in the Genus database with same CATH topology
3ZQGA 2QF7A 4JX4A 3JRIA 2HXOA 1HDPA 5EG0B 4IHXA 3HDDA 1HF0A 2HYJA 5M5XJ 1BL0A 2ECBA 1F36A 3HOWJ 1TWGJ 5F0FA 3JRGA 3TP0A 1ETYA 3M3YJ 4BXXJ 2ECCA 1TWCJ 3OOUA 1ZK8A 5GPAA 1DU0A 2YU9J 2DJNA 3IH3A 4MFDA 3BQZA 3JREA 1F43A 1QVTA 1VFCA 2XSDC 1H8AC 3H3VK 5FLMJ 1QPIA 1XG1A 3BTIA 3HOZJ 2R93J 5F08A 2XGDA 2FQ4A 1MBHA 5JLWA 3SFIA 5FKNA 2XPVA 1WH7A 2MG4A 1D5YA 1IUFA 1Q1VA 3O8GA 4BY1J 4Y52J 3JRAA 1IDZA 1JTXA 2JA8J 4HNVA 4BBSJ 5M3FJ 1ZKGA 2R5ZA 2M34A 3HEFA 1GV5A 3LNQA 2O8KA 3UKGA 2DA3A 4B4CA 2NVTJ 3HGYA 1FTZA 5DS9A 1VI0A 4D5CA 4XICA 4M3GA 2TCTA 3BQYA 1TWAJ 3IH4A 3GTPJ 2I10A 2CU7A 5IP7J 2K40A 1W0TA 4A3CJ 1T33A 2Y2ZA 2DA1A 4FE7A 2KT0A 1ETVA 3PO3J 4X1EA 3HBLA 1A6IA 1B72B 3TEDA 1QRYA 2CJJA 2IAIA 1LFBA 3BG5A 2Y9YA 3FKIJ 1OJLA 1PUFB 4MLOA 3LSRA 4AYBN 3PO2J 2ELKA 2W48A 1U9NA 2YS9A 4A3FJ 3S1RJ 4A3EJ 4DZPA 1FEXA 3BR3A 3NARA 3TW7A 4I6ZA 1X2NA 3Q3SA 2O9LA 1MBFA 2FX0A 3HOXJ 1P7JA 2JMWA 4L5EA 2FJ1A 2L9RA 2JWTA 1ETXA 5J1UA 4JX6A 4BBRJ 4C3HJ 1TWFJ 1P7IA 3GTKJ 2NVXJ 1I3QJ 4MIMA 3BR5A 1AHDP 2JA6J 4M3FA 4W1UA 4CYCB 1BW6A 1ZR4A 4DYRA 1Y1WJ 1GVDA 1MSEC 2HQ5A 1GV2A 3TW6A 1POGA 4C2MJ 3C2BA 2LTPA 3DEWA 1BJZA 1YRNA 1JT6A 2VI6A 3HB9A 4B1RA 5K7FA 2MW8A 3A02A 5HODA 2Y0SN 4MO7A 3ZOBA 3L1PA 3Q0WA 2EZIA 2RAEA 5EF6A 4UUSA 3QPSA 2B63J 1OCPA 2E1OA 1MSFC 2ZB9A 3JRCA 5C3EJ 2LFBA 1JUPA 1APLC 2FD5A 5EZGA 1I50J 4ABZA 2EH3A 3B6CA 1IDYA 3QQAA 1NK2P 3FK7A 1X58A 1JTYA 1RPWA 2LK2A 2O7OA 5FLVA 3WHBA 1RR7A 3BTLA 4C3JJ 1H89C 4DW6A 1AKHB 4D5FA 1IV6A 1ZR2A 1H88C 3HKZN 3LOCA 3BR0A 2AO9A 2NOGA 1JKRC 2JA7J 1WPKA 4JYKA 4A3IJ 2R5YA 1BW5A 1ITYA 2WV1A 1K61A 1B8IA 5M5YJ 4J19A 2M9HA 5GPCA 4G12A 5EDNA 5EZHA 5EEAA 2HOTA 1GT0C 2HOSA 2K9SA 1Z77A 1MBKA 1Y1VJ 5IOYA 4Y7NJ 1FIAA 2NVQJ 1DU6A 2L7ZA 5F27A 4BY7J 3GTGJ 1WGXA 4LOCA 2E2IJ 2R0QC 4IEJA 1MBJA 3OSGA 1T56A 1VF9A 2LVSA 3BTJA 4DYCA 1RKWA 4M3EA 5EYRA 3GTLJ 2IEKA 1TWHJ 2ME0A 2COBA 2H8RA 4XRMA 1NK3P 5EGOA 5E3LA 1UMQA 3H0GJ 1JT0A 1JKQC 2LKXA 3VPRA 4A3KJ 1ETKA 2XPUA 5IYCJ 2EZLA 1E3OC 3JR9A 5F1JA 2OF7A 2G0EA 1JKPC 3IH2A 2DTZA 1XC5A 2AHQA 2DMTA 3GTJJ 4IHVA 2K9QA 4NDLA 4M3DA 2YUSA 2X48A 1RETA 3LSGA 5DTDA 2XB5A 2KDZA 4GFBA 3FIWA 1O4XA 3Q0VA 5IOZA 2NVYJ 1BA5A 4A93J 3B6AA 1HCRA 2EZKA 3RZOJ 2X6OA 3TP3A 1NTCA 2XB0X 1A5JA 1Z0XA 1MBEA 2HOAA 3K2AA 3MKLA 2XPWA 2Y9ZA 3BR6A 3S1MJ 1U8BA 4AUXA 2LR8A 4W97A 3S15J 1UG2A 2MSYA 2K9NA 4MFEA 4XIDA 3GBGA 5C4XJ 2JJ7A 3S2HJ 1EF4A 5J1YA 2IBDA 1W0UA 1ZGWA 3G1OA 1HLVA 2DMQA 4CYCA 1JUSA 3CCYA 3BR2A 1R9TJ 4A3BJ 1LFUP 5F0CA 2D5VA 3MVPA 1SFOJ 1YRNB 1WH5A 5J1RA 1LE8A 1MH3A 3SDGA 1ZQ3P 5C4JJ 1GDTA 3JRFA 3ZQFA 4JP0A 5F04A 4JX5A 3A01B 4A3JJ 2ID3A 2NS7A 3HM5A 3RKQA 1G2HA 2H1KA 2L7FP 3WHCA 1OCTC 1IJWC 4M3BA 2EQRA 3S2DJ 2HDDA 1X2MA 2CQQA 2CQXA 4FTHA 1I6HJ 2LLKA 4XK4A 2CUFA 3IV5A 1OFCX 2DA6A 3RQIA 4FE4A 3JRDA 3HOUJ 1HOMA 5GP9A 3DCFA 4FISA 5IP9J 3CMYA 5EG0A 2R5YB 1VNDA 2JN6A 2M2EA 1CQTA 1B8IB 1IC8A 3HOYJ 3GTQJ 3SJMA 2DMUA 2XGEA 3I4NJ 2EBIA 2M0CA 3OIOA 4IHWA 1WI3A 3ZQHA 1HDDC 2XGCA 2MGQA 2GM4A 2E19A 2L7MP 1XS9A 2DA7A 5IYBJ 5E3NA 1FJLA 2PMZN 4D7MA 1U9OA 3NAUA 4RDUA 2ID6A 5K7HA 5FJ8J 3Q0UA 3BTCA 2GLOA 5C44J 2VPRA 4I76A 4V2GA 2L0KA 3BG3A 2WB1N 2VUMJ 4AC0A 2CUEA 5EGOB 3GTMJ 3ZQLA 2R5ZB 5F0HA 4D7NA 2R7ZJ 5K7ZA 2DA4A 2DMPA 4IHYA 3G1MA 2HXIA 1IG7A 1S7EA 1TC3C 3E7LA 5FKLA 3M4OJ 3O8HA 1K83J 2EZHA 2NS8A 4QTRA 3JRBA 2ME6A 3LSPA 1ETQA 4FCYA 2R92J 1GUUA 5M5WJ 1RKTA 1MNMC 1ETOA 3D1NI 1UHSA 5FKMA 4DZJA 4RBOA 4S0HB 1ORKA 2TRTA 3ZQIA 5E3OA 1B72A 2M8GX 3PM1A 2LD5A 1ETWA 4QIWN 4QSHA 5M3MJ 1JKOC 4EEFG 3MN2A 1FIPA 5FKOA 2Y31A 5JLXA 1PUFA 4B3AA 4A3MJ 2VKEA 3BT9A 2HI3A 2E2HJ 3GTOJ 3HGGA 2DMNA 4XRSA 2DA5A 1QVUA 4XRSG 3BG9A 5BNGA 4BKXA 4A3LJ 9ANTA 3S1QJ 2N8GA 3CQZJ 2E2JJ 1JGGA 3K7AJ 2VKVA 1IGNA 3S17J 4X6AJ 5IP6A 3HOVJ 3OSFA 3RZDJ 3I4MJ 1JUMA 2XRLA 3ZQCA 1IRZA 3S1NJ 2LY9A 1ZTRA 5J3LA 3CDLA 3FK6A 4A3GJ 4V2FA 2GBYA 3BR1A 5IPAA 5FKKA 4C3IJ 2LP0A 2P81A 4UUSB 1RESA 1WCMJ 2QCOA 3S16J 2JK3A 1LE8B 4A3DJ 3W6VA 1AU7A 2DA2A 5IYDJ 3F0CA 1JJ8C 1FTTA 2JA5J 1JJ6C 1ENHA 3JRHA 3A01A 2X9DA 3FISA 4DYQA 1SANA 1AKHA 3LSJA 2CRGA 1MH4A 3G1LA 5E3MA 3QPLA 1MBGA 4M6VA 1U78A 2WAQN 2OPTA 4UUTA 2DN0A 3S14J 3A03A 2Y30A 4A69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQG A;  2QF7 A;  4JX4 A;  3JRI A;  2HXO A;  1HDP A;  5EG0 B;  4IHX A;  3HDD A;  1HF0 A;  2HYJ A;  5M5X J;  1BL0 A;  2ECB A;  1F36 A;  3HOW J;  1TWG J;  5F0F A;  3JRG A;  3TP0 A;  1ETY A;  3M3Y J;  4BXX J;  2ECC A;  1TWC J;  3OOU A;  1ZK8 A;  5GPA A;  1DU0 A;  2YU9 J;  2DJN A;  3IH3 A;  4MFD A;  3BQZ A;  3JRE A;  1F43 A;  1QVT A;  1VFC A;  2XSD C;  1H8A C;  3H3V K;  5FLM J;  1QPI A;  1XG1 A;  3BTI A;  3HOZ J;  2R93 J;  5F08 A;  2XGD A;  2FQ4 A;  1MBH A;  5JLW A;  3SFI A;  5FKN A;  2XPV A;  1WH7 A;  2MG4 A;  1D5Y A;  1IUF A;  1Q1V A;  3O8G A;  4BY1 J;  4Y52 J;  3JRA A;  1IDZ A;  1JTX A;  2JA8 J;  4HNV A;  4BBS J;  5M3F J;  1ZKG A;  2R5Z A;  2M34 A;  3HEF A;  1GV5 A;  3LNQ A;  2O8K A;  3UKG A;  2DA3 A;  4B4C A;  2NVT J;  3HGY A;  1FTZ A;  5DS9 A;  1VI0 A;  4D5C A;  4XIC A;  4M3G A;  2TCT A;  3BQY A;  1TWA J;  3IH4 A;  3GTP J;  2I10 A;  2CU7 A;  5IP7 J;  2K40 A;  1W0T A;  4A3C J;  1T33 A;  2Y2Z A;  2DA1 A;  4FE7 A;  2KT0 A;  1ETV A;  3PO3 J;  4X1E A;  3HBL A;  1A6I A;  1B72 B;  3TED A;  1QRY A;  2CJJ A;  2IAI A;  1LFB A;  3BG5 A;  2Y9Y A;  3FKI J;  1OJL A;  1PUF B;  4MLO A;  3LSR A;  4AYB N;  3PO2 J;  2ELK A;  2W48 A;  1U9N A;  2YS9 A;  4A3F J;  3S1R J;  4A3E J;  4DZP A;  1FEX A;  3BR3 A;  3NAR A;  3TW7 A;  4I6Z A;  1X2N A;  3Q3S A;  2O9L A;  1MBF A;  2FX0 A;  3HOX J;  1P7J A;  2JMW A;  4L5E A;  2FJ1 A;  2L9R A;  2JWT A;  1ETX A;  5J1U A;  4JX6 A;  4BBR J;  4C3H J;  1TWF J;  1P7I A;  3GTK J;  2NVX J;  1I3Q J;  4MIM A;  3BR5 A;  1AHD P;  2JA6 J;  4M3F A;  4W1U A;  4CYC B;  1BW6 A;  1ZR4 A;  4DYR A;  1Y1W J;  1GVD A;  1MSE C;  2HQ5 A;  1GV2 A;  3TW6 A;  1POG A;  4C2M J;  3C2B A;  2LTP A;  3DEW A;  1BJZ A;  1YRN A;  1JT6 A;  2VI6 A;  3HB9 A;  4B1R A;  5K7F A;  2MW8 A;  3A02 A;  5HOD A;  2Y0S N;  4MO7 A;  3ZOB A;  3L1P A;  3Q0W A;  2EZI A;  2RAE A;  5EF6 A;  4UUS A;  3QPS A;  2B63 J;  1OCP A;  2E1O A;  1MSF C;  2ZB9 A;  3JRC A;  5C3E J;  2LFB A;  1JUP A;  1APL C;  2FD5 A;  5EZG A;  1I50 J;  4ABZ A;  2EH3 A;  3B6C A;  1IDY A;  3QQA A;  1NK2 P;  3FK7 A;  1X58 A;  1JTY A;  1RPW A;  2LK2 A;  2O7O A;  5FLV A;  3WHB A;  1RR7 A;  3BTL A;  4C3J J;  1H89 C;  4DW6 A;  1AKH B;  4D5F A;  1IV6 A;  1ZR2 A;  1H88 C;  3HKZ N;  3LOC A;  3BR0 A;  2AO9 A;  2NOG A;  1JKR C;  2JA7 J;  1WPK A;  4JYK A;  4A3I J;  2R5Y A;  1BW5 A;  1ITY A;  2WV1 A;  1K61 A;  1B8I A;  5M5Y J;  4J19 A;  2M9H A;  5GPC A;  4G12 A;  5EDN A;  5EZH A;  5EEA A;  2HOT A;  1GT0 C;  2HOS A;  2K9S A;  1Z77 A;  1MBK A;  1Y1V J;  5IOY A;  4Y7N J;  1FIA A;  2NVQ J;  1DU6 A;  2L7Z A;  5F27 A;  4BY7 J;  3GTG J;  1WGX A;  4LOC A;  2E2I J;  2R0Q C;  4IEJ A;  1MBJ A;  3OSG A;  1T56 A;  1VF9 A;  2LVS A;  3BTJ A;  4DYC A;  1RKW A;  4M3E A;  5EYR A;  3GTL J;  2IEK A;  1TWH J;  2ME0 A;  2COB A;  2H8R A;  4XRM A;  1NK3 P;  5EGO A;  5E3L A;  1UMQ A;  3H0G J;  1JT0 A;  1JKQ C;  2LKX A;  3VPR A;  4A3K J;  1ETK A;  2XPU A;  5IYC J;  2EZL A;  1E3O C;  3JR9 A;  5F1J A;  2OF7 A;  2G0E A;  1JKP C;  3IH2 A;  2DTZ A;  1XC5 A;  2AHQ A;  2DMT A;  3GTJ J;  4IHV A;  2K9Q A;  4NDL A;  4M3D A;  2YUS A;  2X48 A;  1RET A;  3LSG A;  5DTD A;  2XB5 A;  2KDZ A;  4GFB A;  3FIW A;  1O4X A;  3Q0V A;  5IOZ A;  2NVY J;  1BA5 A;  4A93 J;  3B6A A;  1HCR A;  2EZK A;  3RZO J;  2X6O A;  3TP3 A;  1NTC A;  2XB0 X;  1A5J A;  1Z0X A;  1MBE A;  2HOA A;  3K2A A;  3MKL A;  2XPW A;  2Y9Z A;  3BR6 A;  3S1M J;  1U8B A;  4AUX A;  2LR8 A;  4W97 A;  3S15 J;  1UG2 A;  2MSY A;  2K9N A;  4MFE A;  4XID A;  3GBG A;  5C4X J;  2JJ7 A;  3S2H J;  1EF4 A;  5J1Y A;  2IBD A;  1W0U A;  1ZGW A;  3G1O A;  1HLV A;  2DMQ A;  4CYC A;  1JUS A;  3CCY A;  3BR2 A;  1R9T J;  4A3B J;  1LFU P;  5F0C A;  2D5V A;  3MVP A;  1SFO J;  1YRN B;  1WH5 A;  5J1R A;  1LE8 A;  1MH3 A;  3SDG A;  1ZQ3 P;  5C4J J;  1GDT A;  3JRF A;  3ZQF A;  4JP0 A;  5F04 A;  4JX5 A;  3A01 B;  4A3J J;  2ID3 A;  2NS7 A;  3HM5 A;  3RKQ A;  1G2H A;  2H1K A;  2L7F P;  3WHC A;  1OCT C;  1IJW C;  4M3B A;  2EQR A;  3S2D J;  2HDD A;  1X2M A;  2CQQ A;  2CQX A;  4FTH A;  1I6H J;  2LLK A;  4XK4 A;  2CUF A;  3IV5 A;  1OFC X;  2DA6 A;  3RQI A;  4FE4 A;  3JRD A;  3HOU J;  1HOM A;  5GP9 A;  3DCF A;  4FIS A;  5IP9 J;  3CMY A;  5EG0 A;  2R5Y B;  1VND A;  2JN6 A;  2M2E A;  1CQT A;  1B8I B;  1IC8 A;  3HOY J;  3GTQ J;  3SJM A;  2DMU A;  2XGE A;  3I4N J;  2EBI A;  2M0C A;  3OIO A;  4IHW A;  1WI3 A;  3ZQH A;  1HDD C;  2XGC A;  2MGQ A;  2GM4 A;  2E19 A;  2L7M P;  1XS9 A;  2DA7 A;  5IYB J;  5E3N A;  1FJL A;  2PMZ N;  4D7M A;  1U9O A;  3NAU A;  4RDU A;  2ID6 A;  5K7H A;  5FJ8 J;  3Q0U A;  3BTC A;  2GLO A;  5C44 J;  2VPR A;  4I76 A;  4V2G A;  2L0K A;  3BG3 A;  2WB1 N;  2VUM J;  4AC0 A;  2CUE A;  5EGO B;  3GTM J;  3ZQL A;  2R5Z B;  5F0H A;  4D7N A;  2R7Z J;  5K7Z A;  2DA4 A;  2DMP A;  4IHY A;  3G1M A;  2HXI A;  1IG7 A;  1S7E A;  1TC3 C;  3E7L A;  5FKL A;  3M4O J;  3O8H A;  1K83 J;  2EZH A;  2NS8 A;  4QTR A;  3JRB A;  2ME6 A;  3LSP A;  1ETQ A;  4FCY A;  2R92 J;  1GUU A;  5M5W J;  1RKT A;  1MNM C;  1ETO A;  3D1N I;  1UHS A;  5FKM A;  4DZJ A;  4RBO A;  4S0H B;  1ORK A;  2TRT A;  3ZQI A;  5E3O A;  1B72 A;  2M8G X;  3PM1 A;  2LD5 A;  1ETW A;  4QIW N;  4QSH A;  5M3M J;  1JKO C;  4EEF G;  3MN2 A;  1FIP A;  5FKO A;  2Y31 A;  5JLX A;  1PUF A;  4B3A A;  4A3M J;  2VKE A;  3BT9 A;  2HI3 A;  2E2H J;  3GTO J;  3HGG A;  2DMN A;  4XRS A;  2DA5 A;  1QVU A;  4XRS G;  3BG9 A;  5BNG A;  4BKX A;  4A3L J;  9ANT A;  3S1Q J;  2N8G A;  3CQZ J;  2E2J J;  1JGG A;  3K7A J;  2VKV A;  1IGN A;  3S17 J;  4X6A J;  5IP6 A;  3HOV J;  3OSF A;  3RZD J;  3I4M J;  1JUM A;  2XRL A;  3ZQC A;  1IRZ A;  3S1N J;  2LY9 A;  1ZTR A;  5J3L A;  3CDL A;  3FK6 A;  4A3G J;  4V2F A;  2GBY A;  3BR1 A;  5IPA A;  5FKK A;  4C3I J;  2LP0 A;  2P81 A;  4UUS B;  1RES A;  1WCM J;  2QCO A;  3S16 J;  2JK3 A;  1LE8 B;  4A3D J;  3W6V A;  1AU7 A;  2DA2 A;  5IYD J;  3F0C A;  1JJ8 C;  1FTT A;  2JA5 J;  1JJ6 C;  1ENH A;  3JRH A;  3A01 A;  2X9D A;  3FIS A;  4DYQ A;  1SAN A;  1AKH A;  3LSJ A;  2CRG A;  1MH4 A;  3G1L A;  5E3M A;  3QPL A;  1MBG A;  4M6V A;  1U78 A;  2WAQ N;  2OPT A;  4UUT A;  2DN0 A;  3S14 J;  3A03 A;  2Y30 A;  4A69 C; 
#chains in the Genus database with same CATH topology
 5FGM A;  2VXD A;  5FFX A;  5KHD A;  1S5L C;  4A2U A;  1HDP A;  1XGS A;  1HKT A;  1W36 C;  4NC6 A;  1YE9 A;  1JE8 A;  4IZZ A;  2JUC A;  1SVO A;  2J5P A;  4XON A;  3QYF A;  2DBB A;  1BL0 A;  2ISZ A;  1IN4 A;  3GZN B;  3HTU A;  4EJT A;  3F22 A;  2ECC A;  1ZK8 A;  4ZYG A;  4MFD A;  1K4S A;  3ISP A;  1F43 A;  1AOY A;  4FHT A;  2XSD C;  3SZG A;  1T95 A;  3H3V K;  5TRD A;  1FOY A;  1QPI A;  3HOZ J;  2F4O B;  2R93 J;  3BDD A;  4IO9 F;  2ZO4 A;  5FKN A;  4BHC A;  1WH7 A;  1GLN A;  3T8R A;  4BGD A;  2LOO A;  5E1X A;  3O8G A;  1SD5 A;  3OY9 A;  1FYK A;  2YX4 A;  5HS8 A;  4BHB A;  3TO6 A;  3BZC A;  5J8F A;  1JTX A;  2JA8 J;  2DDB A;  2X51 A;  1OCC H;  5D5U B;  2UZK A;  3O2P E;  3GEZ A;  3QP6 A;  4E7I A;  1Z7U A;  3FWE A;  2R5Z A;  2M34 A;  3DKX A;  3K70 D;  4NB5 A;  3LSM A;  1D0Y A;  2DOD A;  5DS9 A;  3TMO A;  2H1L A;  2DFF A;  4ZDP A;  3GTP J;  4A0Z A;  3UNG C;  2W84 A;  2I10 A;  2CU7 A;  3DV8 A;  2K40 A;  4RB1 A;  1XMX A;  2R7Q A;  3PJR A;  2KKO A;  1XMA A;  1X1C A;  2Y2Z A;  4UVA A;  4FE7 A;  1LEA A;  3OS0 A;  2RKH A;  3PO3 J;  5FO5 A;  1S7A A;  2XAF A;  3W2A A;  3HC7 A;  3LA3 A;  3OYG A;  1N25 A;  3SYT A;  2Y9Y A;  1SFX A;  3V8L A;  2IGM A;  3IRR A;  4AYB N;  3PO2 J;  4ESB A;  2NXN B;  2JT1 A;  1TBX A;  1RRJ A;  2W48 A;  2HVS A;  2RQQ A;  3NAR A;  5TJJ A;  3Q3S A;  1YW7 A;  1R7J A;  2DQR A;  4XMY A;  1EV7 A;  1SMY F;  1QZZ A;  4KMU X;  1U8R A;  1ETX A;  5J1U A;  2KHM A;  3FXR A;  1IN8 A;  4GDF A;  2VL8 A;  4HRI A;  4UVC A;  1LUJ B;  1I3Q J;  2PEX A;  1Z6R A;  3P7N A;  3BR5 A;  2JA6 J;  3DWL E;  4W1U A;  3ERE D;  3GFJ A;  4DYR A;  1D8K A;  2E1C A;  4M6X A;  4JBA A;  2OV7 A;  2RQP A;  1POG A;  4IXA A;  2Z3Y A;  3C2B A;  4O3M A;  4P1W A;  3OYH A;  3BOQ A;  1HSJ A;  5GAH J;  3MFK A;  5LGT A;  2VI6 A;  5K7F A;  3E3V A;  3K4N A;  4PGG A;  1UB9 A;  5HOD A;  1YS6 A;  2QM3 A;  2Y0S N;  3M1C A;  4HX8 A;  4MO7 A;  1I6X A;  4F91 B;  3TKY A;  5AIQ A;  1FPQ A;  2LBF A;  5EF6 A;  3QPS A;  3FBI B;  1MSF C;  3D5R C;  4ITV A;  4K2E A;  3SZT A;  2VQG A;  5ED4 A;  1APL C;  5EZG A;  2FOK A;  2LKP A;  3EUK L;  3V7C A;  2EH3 A;  2BY3 A;  3D5S C;  3PSI A;  4Q5S F;  1K7A A;  2OTL I;  2ZXW H;  3CCJ I;  2DK5 A;  3NRV A;  4KIC A;  2LF8 A;  1JTY A;  3KYC B;  3WHB A;  2VJI A;  1K78 A;  4AD9 A;  1H89 C;  3A2K A;  3RPU A;  3K4C A;  2WTE A;  1HW2 A;  3MMY B;  4HF1 A;  1WPK A;  2M1B A;  5D5W B;  1YS7 A;  4A3I J;  1I3A A;  4CCL A;  4CIC A;  1U3E M;  2VE8 A;  3J80 Z;  5IT3 A;  1K61 A;  1YOV B;  3H36 A;  2Z5U A;  3CJT B;  4G12 A;  3E6M A;  3GCM A;  5J4V A;  1O3R A;  3CF2 A;  2HDW A;  2NYX A;  3N97 A;  4L0Z B;  3ML6 A;  1MBK A;  4ETS A;  1DUX C;  1Y1V J;  3FXL A;  1YLF A;  3H5N A;  3OMY A;  2IPQ X;  2W24 A;  4ASN A;  2NVQ J;  1O7L A;  1VQ6 I;  2E2I J;  2R0Q C;  4IEJ A;  2QZ8 A;  3HSR A;  2OUM A;  1QU3 A;  1T56 A;  1Y8Q B;  4Y3O A;  5BMZ A;  4Q47 A;  1ZLK A;  3GZ5 A;  1YQA A;  4M3E A;  5EYR A;  5HDN A;  3F8N A;  3GTL J;  2IEK A;  4KFC A;  1TWH J;  1QHH D;  2EIL H;  2Q1Z B;  4XRF A;  2VON A;  4XSZ F;  4XKB A;  1YG2 A;  2MLK A;  2EFQ A;  4BE2 A;  2IJL A;  4IRH A;  1UMQ A;  1E17 A;  3AAF A;  5E79 C;  3R6S A;  2LKX A;  2BYV E;  3I56 I;  4BYY A;  3CDH A;  3CUO A;  3GW2 A;  3RI4 A;  1Z67 A;  1Y0U A;  1TNT A;  2C6Y A;  4GRI A;  1E3O C;  4GYG A;  3VSL A;  3JR9 A;  4IPA A;  4Y15 A;  2G0E A;  2ICW G;  3KET A;  4EM1 A;  1JKP C;  2LH9 A;  1IF1 A;  1USS A;  4I98 B;  2HTS A;  2HS5 A;  2DMT A;  2K9Q A;  1T98 A;  2H94 A;  3JW4 A;  3RKW A;  1V55 H;  2W7N A;  2Q2E A;  3F8M A;  3JSP A;  2XB5 A;  3HZJ A;  3KEY A;  3KZI C;  4E6K G;  1D1A A;  3CO6 C;  4RLQ A;  1O4X A;  2MH2 A;  1R00 A;  1BA5 A;  2JZY A;  2W4S A;  3DLA A;  1ZRC A;  3E6D A;  3B6A A;  4G9Y A;  3H9J A;  2HYG D;  1UJ8 A;  3CJQ B;  2XB0 X;  4CCN A;  4LLL A;  3DBL B;  2HEO A;  1A5J A;  1IN7 A;  1MBE A;  2JPC A;  3DU5 A;  3LFK A;  2V79 A;  3K2A A;  2UXX A;  4BJT A;  2ZFU A;  3MKL A;  4AID A;  2Z1D A;  3W6J B;  4LIV A;  1U8B A;  2LR8 A;  2DCE A;  3K0L A;  2MSY A;  1W1W E;  5F1R A;  1B1B A;  3GBG A;  3DTE A;  3CCE I;  5HNF A;  2A61 A;  2BXY A;  2PMU A;  1HW5 A;  1XSV A;  2FXA A;  4FQG A;  4KMF A;  3VOE A;  3IRQ A;  5F64 A;  4F55 A;  3I9V 2;  4LJZ F;  3OYF A;  2RVC A;  1R9T J;  4RAZ A;  2V26 A;  2BEO A;  1WH5 A;  1XCB A;  2RC4 A;  5FRN A;  4U7D A;  1GDT A;  3K4M A;  1VZ0 A;  2WAF A;  2VJ5 A;  3FXJ A;  3DLL F;  3ZQF A;  4IVN A;  2JQ7 A;  1XGM A;  1LEB A;  3HL2 A;  4OIN F;  3RKX A;  1ZG3 A;  2F2E A;  1D0Z A;  3DPL C;  2X6X A;  2Z16 A;  1BBY A;  2H1K A;  2P6T A;  3CCS I;  5B5E C;  2LY1 A;  4PJL A;  3RKY A;  5FRO A;  3L2V A;  1T2K A;  1RNL A;  1FMW A;  1P4A A;  4M3B A;  2CQQ A;  1XGN A;  2YX7 A;  3S3M A;  3CMA I;  1PP7 U;  1K78 B;  1I6H J;  2K5C A;  3NWT A;  4EGZ A;  3IC7 A;  1CF7 A;  2CUF A;  1MMA A;  3IV5 A;  1LFP A;  1ZRD A;  4KIS A;  5L3G A;  2KIM A;  4FE4 A;  3HOU J;  1OQY A;  3RDI A;  5GP9 A;  3F9K A;  3ECO A;  4O6J A;  1SD7 A;  3QU6 A;  5D4S A;  1TW3 A;  2JN6 A;  5FLX K;  1SFE A;  4XLA A;  5CLS A;  1CQT A;  2E71 A;  1IC8 A;  4CCO A;  4BNC A;  3GTQ J;  2O0Y A;  2HGC A;  1LB2 A;  4YEJ A;  2EBI A;  3O3K A;  3CP2 A;  3T5X A;  3GFI A;  1ZH5 A;  3I4N J;  3OIO A;  3VFZ A;  1U5T B;  3BJO A;  2R4G A;  5HDG A;  2GIV A;  2MGQ A;  3VYT B;  2GM4 A;  2BOL A;  5IT9 Z;  3VYU B;  2QA4 I;  2DA7 A;  1B9M A;  5IYB J;  1FJL A;  2KLO A;  4CSW A;  4WXH A;  1YJ9 I;  2A69 F;  2DLL A;  3QRF F;  4HX7 A;  1EH7 A;  3NAU A;  1GXP A;  3MKW B;  2EIN H;  3DKY A;  4EAT A;  3Q0U A;  4I09 A;  2GLO A;  5C44 J;  4KNY A;  2VN2 A;  3P9C A;  3BG3 A;  2CUE A;  3GTM J;  2PJP A;  1X3W B;  3EUA A;  5AON A;  3C7J A;  3S32 A;  3K4L A;  2CQ7 A;  3WE3 A;  5K7Z A;  3DU6 A;  3FXK A;  4XKV A;  1SD4 A;  3RYR A;  2XUB A;  5BOX A;  4YFX F;  1IG7 A;  4BQA A;  1STZ A;  2L9N A;  3ESW B;  5FKL A;  2BY1 A;  4M71 A;  3BP8 A;  4KIB A;  2IA2 A;  3JRB A;  1O3T A;  2DOE A;  1H0M A;  1S29 A;  3OL4 A;  5FB2 A;  1ZRE A;  3CLO A;  2KJC A;  1ORK A;  4KDP A;  1KZH A;  2A3S A;  5E3O A;  4XR6 A;  3RCO A;  2F5E A;  2Q2E B;  3PM1 A;  2LD5 A;  5JVG F;  5JR3 A;  2ACJ A;  5M3M J;  4EEF G;  4N9H A;  3V7S A;  5FKO A;  2I8D A;  5JLX A;  1IN6 A;  3JAM K;  4ANJ A;  4A3M J;  1OR7 C;  2HTJ A;  3HKZ A;  2E2H J;  3GTO J;  4XRS A;  4RB2 C;  3IP4 B;  4MNU A;  3RPU D;  2DOA A;  2KDO A;  3IKT A;  3BG9 A;  5BNG A;  1G3W A;  5BPI A;  4BKX A;  4HQE A;  4A3L J;  3A4C A;  2ZNY A;  4RM3 A;  3S1Q J;  4BAC A;  3CQZ J;  5LRR A;  3BWG A;  3DEU A;  2WWY A;  1KU3 A;  4EJW A;  2IS4 A;  3K7A J;  3S17 J;  4X6A J;  2BVL A;  3K2Z A;  2M30 A;  5IP6 A;  2OA4 A;  3J7Z I;  4GXO A;  4OIO F;  1KQ9 A;  1Q1H A;  4RS8 A;  2XGX A;  2X85 A;  2DYS H;  2X6Y A;  2BBY A;  4G8X A;  4LB5 A;  1P6R A;  4V2F A;  2XF5 A;  3DXJ F;  3EUH C;  5ICE A;  2FE3 A;  5E8G A;  3RIR A;  3O6B B;  3ZMV A;  2YPR A;  1RES A;  1J09 A;  1XX5 A;  2BE5 F;  3MKZ A;  4A3D J;  2MC4 A;  2ZJQ F;  4JK1 X;  1AU7 A;  1RUO A;  2DA2 A;  5IYD J;  1SD6 A;  2X1E A;  2W85 A;  3WTY C;  4XLC A;  3L09 A;  2AQE A;  3U9G A;  3FDY A;  3AKZ A;  3ZMZ A;  1ZLJ A;  3GWZ A;  4R8H A;  3JRH A;  3A01 A;  1S6L A;  2X9D A;  4CZC A;  4LG0 A;  1AKH A;  5E8I A;  3WE2 A;  3I58 A;  4OIR F;  2JSP A;  2CH0 A;  1MBG A;  4ZH4 F;  5A2Q K;  2OPT A;  5HLH A;  4XLP F;  5JFR A;  3KFW X;  3FXO A;  3R0A A;  3A03 A;  2EWN A;  4N4O B;  4QLC U;  2ZJR F;  2QF7 A;  3OIP A;  3TOB A;  4FET A;  4EGY A;  3HDD A;  3JSO A;  1F36 A;  5F0F A;  3CCU I;  1FY7 A;  4C2T A;  1VQ9 I;  3G4S I;  2XAG A;  1TWC J;  1DU0 A;  5GPA A;  3GFM A;  1J7K A;  4EQQ A;  3IH3 A;  2GOX B;  2B7E A;  3I0T A;  2F6C A;  1U6G A;  5DUI A;  1H8A C;  1XG1 A;  2EIM H;  3BTI A;  1WJE A;  3GVA A;  2V1X A;  2A5Y B;  4S04 A;  2DXI A;  1B4A A;  5JLW A;  2CQK A;  2BHZ A;  4ZYA A;  3GYH X;  4YFN F;  1FOW A;  1ERD A;  1IUF A;  1Q1V A;  1R5H A;  3EDP A;  4UXN A;  1MJ9 A;  4M73 A;  5M3F J;  1ZKG A;  4I0A A;  2ZNZ A;  1GV5 A;  4DIQ A;  2NVT J;  3UKG A;  4B4C A;  2OJE D;  3KX2 A;  4M3G A;  1XCV A;  4G6D A;  2TCT A;  3E97 A;  3K10 A;  4CYD A;  1TWA J;  4E4H A;  1V5G A;  3WTT C;  4YIR X;  4HSR A;  3S8P A;  2FF4 A;  5IP7 J;  1IZ1 A;  3ZMS A;  1W0T A;  2O03 A;  4A3C J;  1T33 A;  1Z7L A;  2KT0 A;  1ETV A;  1K6O A;  2M87 A;  2G7H A;  3FXM A;  4KT6 A;  1QRY A;  3PIO F;  1QO0 D;  2IAI A;  2IW5 A;  3PNV A;  4MTD A;  3WTU C;  4MLO A;  4ENN A;  4L9V A;  3LSR A;  2IT0 A;  4E7K A;  2ELK A;  1V5F A;  3ZXS A;  2Q0O A;  4L9J A;  4A3F J;  2W57 A;  3S1R J;  1YIJ I;  4A3E J;  2WV0 A;  2WAE A;  1X19 A;  2A68 F;  2K27 A;  1OYY A;  1ON2 A;  2ZXJ A;  3ZGK A;  1MBF A;  3HOX J;  2DJI A;  2CFO A;  2L9R A;  5H20 A;  1FWZ A;  2JWT A;  2NS0 A;  3OWT A;  3HOT A;  1EH6 A;  5LHG A;  1TWF J;  1P7I A;  2RNJ A;  1A04 A;  4BL0 B;  1R5G A;  1QQI A;  4HV6 A;  2CS3 A;  3G71 I;  1ZR4 A;  1VQN I;  1GV2 A;  4NC8 A;  3TW6 A;  4C2M J;  1R1T A;  1G8X A;  2MD5 A;  1IW7 F;  2CO5 A;  1O3S A;  2LTP A;  1WKM A;  3DEW A;  3KPH A;  2F5D A;  2GXA A;  2CUZ A;  3FHZ A;  3LST A;  3KCC A;  3RYP A;  3EYI A;  2M7B A;  2KPM A;  3A02 A;  3K70 C;  5H6R A;  1QZY A;  4YII A;  4G7H F;  3L1P A;  2VKD A;  3P5J A;  4UUS A;  4HAM A;  5H2F C;  1OCP A;  4AVZ A;  1MZB A;  3JRC A;  2LFB A;  4BEH B;  5BQT A;  4R79 A;  1NG6 A;  4XNF A;  1KGS A;  4ABZ A;  4YG2 F;  5L3C A;  1VQO I;  2QSG X;  3F8B A;  3B6C A;  5J40 A;  4P5O A;  3OS2 A;  1YX5 A;  2EFN A;  4HDU A;  2B0L A;  2E5Z A;  1TLH B;  1RPW A;  2L7K A;  1W4M A;  2OZ6 A;  3BTL A;  1AKH B;  1V5E A;  3DKW A;  1IV6 A;  2DO7 A;  3F8C A;  1ZR2 A;  4N0B A;  2XAH A;  4WF2 A;  1H88 C;  2CG4 A;  2RDP A;  3EET A;  2AO9 A;  2NOG A;  2VBY A;  1JKR C;  3SXY A;  3OYK A;  1NG7 A;  1RC9 A;  4PFP A;  1BW5 A;  2AXT C;  1B8I A;  4UHT A;  1Z21 A;  4HEA 2;  1MMD A;  5AIP A;  4C2U A;  3H0D A;  2L4A A;  2HOT A;  1GT0 C;  2HOS A;  4N4N B;  2F5V A;  5ERI A;  1REP C;  4B47 A;  1FIA A;  2UXN A;  2ZJ2 A;  1A36 A;  2YSR A;  1Y6I A;  2XC7 A;  2W00 A;  1MMN A;  2LG4 A;  4FX4 A;  2HR3 A;  2MD0 A;  3OSG A;  2P5V A;  3K1M A;  2HNH A;  4OMZ A;  3LQR A;  2LVS A;  4DYC A;  2KIS A;  1RKW A;  1OCR H;  1B6A A;  3GUD A;  1P4X A;  2ME0 A;  2COB A;  1FYL A;  2IGK A;  4LG3 A;  2H8R A;  3GFL A;  4XRM A;  3AFH A;  1QA6 A;  1JT0 A;  2KL4 A;  2D45 A;  3C18 A;  2D1V A;  1ETK A;  3ABL H;  4CXF A;  2PQ8 A;  3CC7 I;  2EZL A;  2FA5 A;  4NQW B;  3I54 A;  2M5W A;  3OS1 A;  2OCC H;  1K6Y A;  2OF7 A;  2NVU B;  1DGR M;  4UB6 C;  5ILU A;  5DM7 F;  4S05 A;  1ZG5 A;  4IHV A;  3DFG A;  2HQR A;  4L9T A;  5D6F A;  3JTG A;  2IRF G;  4M3D A;  4F92 B;  2YUS A;  2EFW A;  3KZZ A;  5DTD A;  5KVR A;  4RA2 A;  4EJO A;  3H1C A;  2DT7 B;  2KDZ A;  4GFB A;  2K7L A;  3VOD A;  4KT5 C;  2CUJ A;  4I99 C;  1E3H A;  4A93 J;  4BJ6 C;  2LNB A;  3T0Y A;  3TP3 A;  1NTC A;  2FNA A;  1FZP B;  1BN5 A;  2QKM B;  5L3B A;  4GCV A;  1BJA A;  2X4H A;  3GLL A;  3QU3 A;  5LGU A;  5LRS A;  3S1M J;  4AUX A;  5CJ9 A;  1OKR A;  3D5L A;  4DNC A;  4W97 A;  3CCM I;  1UG2 A;  5D5V B;  1W36 D;  3BPX A;  2K9N A;  3NEU A;  2CV0 A;  4XID A;  1EF4 A;  2FUG 2;  1JHF A;  2IBD A;  4I7H A;  2G7U A;  4XN0 A;  5B3S H;  4QWQ A;  4DBQ A;  2R7O A;  4U88 A;  4CYC A;  2MC3 A;  1WHU A;  2KRH A;  2GIZ A;  1TW2 A;  3CCY A;  4NBQ A;  3M9A A;  2BVM A;  2D5V A;  4CCM A;  1XPX A;  4HOB A;  1VQ8 I;  1R1V A;  3OYA A;  1FP1 D;  3E5X A;  3SDG A;  4RGX A;  5C4J J;  1DDN A;  3WG9 A;  3OL3 A;  1NHA A;  1R5I D;  1V3F A;  5CKT A;  4JX5 A;  3E0J B;  4A3J J;  1DQU A;  3HM5 A;  3WOD F;  1KQ8 A;  3BCB A;  2VT2 A;  5DV5 A;  3OYB A;  5HS9 A;  3CC2 I;  3KP3 A;  3AL0 B;  3PNY A;  3WHC A;  4WWC A;  1IJW C;  3S2D J;  1UHW A;  4YIF A;  4WXC A;  1YJW I;  5CPR B;  5H6Q A;  1CGP A;  2MAB A;  1IO2 A;  2Z33 A;  4HDV A;  1OFC X;  2XKO A;  1F5T A;  1ZGJ A;  1A31 A;  4OAZ A;  4FIS A;  1XTA A;  5LGN A;  4HF2 A;  4E70 A;  5DD8 A;  1S3J A;  5EG0 A;  4HG2 A;  2M2E A;  4PJM A;  2LKS A;  2MYS A;  1B8I B;  1IRF A;  1MGT A;  4BS9 A;  4A6D A;  5J8C A;  5IT9 K;  3ONQ A;  1R71 A;  4AYB A;  2M0C A;  2L01 A;  1JXS A;  2WY7 Q;  6PAX A;  4ESF A;  4HQM A;  3ZQH A;  5K5O A;  4Q4Z F;  2PMZ N;  1ULY A;  3ELK A;  2EV6 A;  2CV2 A;  4RDU A;  4OIQ F;  3FMR A;  3RTR A;  5K7H A;  3ECH A;  2WY8 Q;  2H8W A;  2VBX A;  1W5S A;  2V4J C;  3BTC A;  3E6B A;  3AG3 H;  4V2G A;  1K79 A;  2CMP A;  4M9S A;  2VC1 A;  2WB1 N;  2VUM J;  4HPQ A;  1I27 A;  1BI1 A;  4Y52 J;  1XN7 A;  2GXG A;  3ZQL A;  3V42 A;  4FX0 A;  3TO7 A;  2R5Z B;  4BDY A;  4ZC3 A;  3MZ8 A;  4ZTJ A;  3BJ6 A;  2R7Z J;  3DTK A;  3KLN A;  3OYC A;  4IHY A;  4XLN F;  1FP2 A;  3E7L A;  1SMT A;  3OOP A;  4TV7 A;  3FHN A;  2RGV A;  3M4O J;  3T8T A;  2Y0S A;  3O8H A;  2EZH A;  2NS8 A;  2UWM A;  3H9Q A;  4ZYH A;  3U1D A;  1D0X A;  4L9N A;  1OYW A;  1GXQ A;  2D2W A;  4XKW A;  1RKT A;  5M5W J;  2V6E A;  5HLT A;  1JI8 A;  3D1N I;  4RBO A;  2EV0 A;  4S0H B;  4CHU A;  2L3D A;  4IF4 A;  3J7Y J;  1B72 A;  2HDC A;  5KNL A;  2L4M A;  4QIW N;  1VQM I;  3N05 A;  3MN2 A;  5DCM A;  2KZG A;  4G7O F;  2Y31 A;  3IWF A;  2F5F A;  3JTH A;  1YIO A;  2Y75 A;  2VKE A;  2BY2 A;  3S3N A;  1L3L A;  3FXU A;  2CSO A;  2RV8 A;  4MTE A;  5LEK A;  1UHM A;  5HDK A;  3OYD A;  4XLH A;  1JGG A;  1ZAR A;  1IGN A;  4ZTF A;  4IX7 A;  2EFO A;  1IN5 A;  2HWV A;  3M8J A;  3HOV J;  3OSF A;  2HPM A;  2PX9 A;  1JUM A;  5K5R A;  1P2F A;  1IRZ A;  1V54 H;  1WRJ A;  2O8X A;  1RR8 C;  3G3Z A;  4AIH A;  1J0R A;  1IRG A;  4NHJ A;  1KU7 A;  3CDL A;  5J4Y A;  1IXC A;  2PG4 A;  3FK6 A;  5DUK A;  2QEN A;  2V9P A;  4X0G A;  2O61 A;  1RIO H;  3L9F A;  3MD2 A;  2IA0 A;  2KRC A;  5FKK A;  2ZXH A;  1D3Y A;  4C3I J;  3WTS C;  2LP0 A;  2A6E F;  1BOB A;  3BCA A;  1R1U A;  3HSF A;  4HA8 A;  2LBF B;  3OYJ A;  2EJR A;  1FX7 A;  2JK3 A;  1LDD A;  3U21 A;  3W6V A;  2E5N A;  3ULQ B;  1KU9 A;  5KK1 A;  5LHI A;  3F0C A;  1JJ8 C;  1DPU A;  4PDK A;  3HHH A;  4DGW B;  3PUB A;  3LSK A;  3CTA A;  2E7W A;  3KP5 A;  4KN4 X;  4RAY A;  3Q5F A;  4UY8 I;  3TBI A;  4HZF A;  1FYM A;  2P7C B;  2QYO A;  3GX4 X;  1FOX A;  2QSH X;  1WVR A;  2P6S A;  3C2H A;  3LSJ A;  2E1N A;  3G1L A;  5E3M A;  3QPL A;  1XDU A;  2WAQ N;  4PJJ A;  1Y0N A;  2Y69 H;  4KIF A;  1KYW A;  3ZQG A;  3FMS A;  1TZL A;  4JX4 A;  4B8X A;  1E0E A;  2QBY A;  3ERM A;  3IHU A;  3BY6 A;  5EG0 B;  4CH7 A;  5HNH A;  4J00 A;  1MNE A;  1WJB A;  2LRD A;  3FKJ A;  4M72 A;  4ZZL A;  1YI2 I;  1FMV A;  4IHX A;  4LLN A;  3TOA A;  1Z91 A;  3L2C A;  3PFI A;  1HF0 A;  2HYJ A;  2JRM A;  4MQV A;  4Z6Y A;  2X6W A;  1WJA A;  3HOW J;  1GHC A;  3JRG A;  1ETY A;  1MW7 A;  1SVM A;  5CYV A;  1HST A;  1KQ0 A;  1P4W A;  2R7S A;  3F6O A;  4WCG A;  2YU9 J;  3CCV I;  5DYM A;  3GZ6 A;  2OAZ A;  1U5T C;  1HQC A;  3AG4 H;  5E20 A;  4F7Z A;  3V7R A;  2DOF A;  1MDM A;  1ZN2 A;  3MEX A;  4PJN A;  5F08 A;  3DBH B;  1S72 I;  3SFI A;  2DTR A;  2CWE A;  3UR3 C;  3CLQ A;  1LQ1 A;  2LY2 A;  4E7L A;  4ON0 A;  3LAJ A;  1D5Y A;  2EIK H;  4HW0 A;  4AWX B;  4N9I A;  4BY1 J;  1O3Q A;  1SC7 A;  4OAY A;  1UEL B;  3OR2 C;  3ABU A;  2XF6 A;  4XQF A;  4L0Y B;  4MEX F;  4HNV A;  3CD6 I;  3SFZ A;  5E1Z B;  3HEF A;  1ZRF A;  3LMM A;  3LNQ A;  2QGU A;  2DA3 A;  4XKC A;  3DTI A;  3HGY A;  4FT8 A;  4D5C A;  4XIC A;  1T0F C;  1BIA A;  3H5R A;  1IRX A;  3BQY A;  4LK1 F;  2VC0 A;  5CVI A;  3FXQ A;  5D8L B;  4IQJ A;  3D0S A;  4BQQ A;  3L7W A;  1X4O A;  4CZZ A;  5KCM A;  3ZR8 X;  3ROU A;  3W3C A;  1I1S A;  1A35 A;  3BPV A;  2VJ4 A;  1FT9 A;  1Y39 A;  4E7S A;  1B72 B;  4H0E A;  2DU9 A;  3TED A;  1J2X A;  4LIT A;  4BXF A;  4M9Z A;  3HXL A;  2CJJ A;  4P9U A;  4BUP A;  3LSH A;  4I01 A;  2QEX I;  1BC8 C;  3BG5 A;  3DP7 A;  5DCM B;  2VJJ A;  4PGH A;  3G6E I;  2ZC2 A;  1BIB A;  5CQE A;  3REO A;  3CME I;  3VWB A;  2DW4 A;  3PQJ A;  4PSX A;  3R60 A;  2HZD A;  2FBI A;  2JPB A;  3KP2 A;  2R7R A;  1AWC A;  4DZP A;  3BR3 A;  1F4K A;  2V6C A;  2PI0 A;  2BHY A;  2JRT A;  3MKY B;  3TW7 A;  3M7G A;  2JVH A;  4I6Z A;  1X2N A;  4JOM A;  5LD2 C;  2O9L A;  4ZDO A;  1BI2 A;  1P7J A;  3BRO A;  4Y33 A;  4F3Q A;  3FF5 A;  2ZME A;  4M6Y A;  4I2O A;  4BBR J;  3L2Q A;  2OQR A;  4U0Y A;  4EM0 B;  1SAU A;  3HRU A;  1AHD P;  1N78 A;  1BW6 A;  3K6G A;  2HQ5 A;  4PZJ A;  4LK0 F;  2FMY A;  1XD7 A;  2FOW A;  3VYS B;  3W2W A;  1VTN C;  2GOM A;  3VEP A;  3F23 A;  4BE1 A;  3GO5 A;  1BJZ A;  2F4I A;  1JT6 A;  3HB9 A;  4B1R A;  1VQ5 I;  1FSH A;  4BXU A;  2CW7 A;  2IS6 A;  2P0W A;  3Q0W A;  2PN6 A;  5LLQ A;  4UUV A;  4E7Z A;  2A6H F;  1PJR A;  2OD5 A;  2B63 J;  2E1O A;  2M7A A;  4IHT A;  1IAW A;  5C3E J;  5LHH A;  1W5C C;  1JUP A;  2XHK A;  4CDG A;  4ZJZ A;  2Y0M A;  3BJA A;  1SAX A;  1PUE E;  1R6R A;  4I0B A;  3QQA A;  4EMS A;  1NK2 P;  2STW A;  2CQN A;  2XDV A;  3FK7 A;  1CF7 B;  2HPI A;  3L00 A;  2LK2 A;  2O7O A;  3IKV A;  5FLV A;  1RR7 A;  4C3J J;  4DW6 A;  1UST A;  2MH9 A;  4D5F A;  1V4R A;  3L2U A;  2OZU A;  1U0J A;  1LKX A;  3BR0 A;  2JA7 J;  2ZXI A;  3M1E A;  4AIJ A;  4MEY F;  3S93 A;  3F6V A;  5K1Y A;  3J7A Y;  3LWF A;  1ITY A;  3R4K A;  2PBI A;  5M5Y J;  4HX4 A;  4J19 A;  1Z9C A;  2M9H A;  1E2X A;  3CZ6 A;  4A0Y A;  3CDI A;  3LA2 A;  4DQ2 A;  2BZT A;  3SZP A;  2K9S A;  4HYE A;  4AIK A;  3H3Z A;  1R22 A;  3SHF A;  3MCZ A;  5IOY A;  1XGO A;  3KEQ A;  1DU6 A;  2EIJ H;  5F27 A;  5HVQ C;  4CGZ A;  5D4R A;  1TTY A;  4IRG A;  4XOR A;  1MND A;  3GTG J;  1WGX A;  5ILV A;  5EEG A;  1MBJ A;  3B02 A;  2XRO A;  4C9Y A;  3WGH A;  2IS1 A;  1WZ2 A;  4IJA A;  1YHQ I;  1VF9 A;  3BTJ A;  5GTI C;  3EYY A;  1MDM B;  2OCE A;  3FBN B;  2FBK A;  2V9V A;  2ZSI B;  3HSE A;  2W1O A;  2V1N A;  1VQK I;  4KUM A;  1NK3 P;  3MQ0 A;  1UAA A;  5EGO A;  2HKO A;  4LB6 B;  3H0G J;  5D6E A;  3BC8 A;  3K4B A;  1T08 B;  3HUG A;  4A3K J;  3SDB A;  4RM2 A;  4XSX F;  2XPU A;  5IYC J;  2IXS A;  1VQ4 I;  1X3Z B;  1M1E B;  2ELJ A;  3ZQQ A;  2K3P A;  4Y17 A;  2IGN A;  2LF7 A;  2O5R A;  1HKS A;  2H6C A;  1Z3X A;  2E60 A;  2DTZ A;  2EB7 A;  2W25 A;  2FSW A;  3GTJ J;  1XMK A;  3ASN H;  2FQ3 A;  4LLG F;  2LSO A;  2X48 A;  4A0X A;  2COM A;  1RET A;  3LSG A;  3ZN0 A;  3E1S A;  4KJZ A;  3DF8 A;  2TDX A;  4IL6 C;  2P8T A;  1Z6T A;  5IOZ A;  2WAD A;  1B59 A;  1MMG A;  1VQP I;  5DCF A;  3LAP A;  2EPF A;  4RGR A;  2EV5 A;  1HCR A;  2EZK A;  2BGC A;  1QGP A;  2L2O A;  2VOO A;  1RZ4 A;  4I02 A;  1DPR A;  1QNT A;  2YU3 A;  2E1M B;  3B73 A;  3KLO A;  2HOA A;  2CGP A;  2XPW A;  3BR6 A;  4UV8 A;  2L54 A;  4B3X A;  4LGW A;  4M74 A;  3S15 J;  1R4N B;  2E35 A;  2JSC A;  3JAM Z;  2ZME B;  2XAQ A;  4KIT B;  1LDJ A;  1UFM A;  5ICF A;  1R49 A;  2BV6 A;  2JJ7 A;  1NH3 A;  3S2H J;  2XVC A;  5J1Y A;  1ACI A;  4ENJ A;  2KZV A;  2HZT A;  2DDA A;  2HYF A;  3RJP A;  4RGS A;  1ZGW A;  2DMQ A;  2R7F A;  2Y48 A;  1JUS A;  1SEU A;  4AU7 A;  5DM6 F;  4A3B J;  2R7X A;  1MJB A;  4P55 A;  5CVR A;  3DPT A;  1MKM A;  5F0C A;  1T8I A;  3HPG A;  1H9T A;  3CUQ C;  1ZQ3 P;  2M4G A;  1PYV A;  3R61 A;  4B48 A;  1BC7 C;  3JRF A;  4CCJ A;  2VQC A;  2UV1 A;  2AS5 F;  2P4W A;  3RSN A;  3A01 B;  2ID3 A;  5E18 F;  1MD0 A;  4LG0 B;  3ABM H;  5GAE J;  1GVJ A;  3J80 K;  5LBQ A;  1OCT C;  1YJN I;  4XOP A;  2EQR A;  4FTH A;  1T39 A;  3KZY A;  5HOO A;  3MWM A;  4LIU A;  3TGN A;  2GAU A;  2LC2 A;  3VB2 A;  1EJ9 A;  2DA6 A;  3RQI A;  1OMI A;  1W5T A;  5TIS C;  4II2 A;  2Q8K A;  1HOM A;  4LFU A;  4IOC F;  4ZDL A;  2QQA A;  4HBL A;  3CO7 C;  5IP9 J;  2DT5 A;  3CMY A;  2AXL A;  1G6N A;  3LL7 A;  2VLA A;  4CO8 A;  2MLG A;  2DT6 A;  3FM5 A;  4BAY A;  4UNO A;  5A2Q Z;  5EEH A;  3SJM A;  2QUF A;  2XGE A;  4QPO A;  5B66 C;  3HRS A;  5CQG A;  4U7B A;  1LVK A;  3FM3 A;  4IHW A;  4ZYE A;  3JCU C;  3ZPL A;  1IV8 A;  1WI3 A;  1FNN A;  3TQN A;  1G3S A;  1LVA A;  2H09 A;  3U2R A;  2E19 A;  4U87 A;  2QWW A;  3ZRG A;  5E3N A;  2VPL A;  4D7M A;  5D5X B;  2K4B A;  3FZV A;  3A1Y A;  4LD5 A;  2RRE A;  1BR1 A;  2EA4 A;  4GYI A;  1G59 A;  3Q9V A;  4I76 A;  3E6C C;  4Y13 A;  4E7J A;  3CF5 F;  3QOP A;  2IVM A;  2DFE A;  2WA0 A;  3I64 A;  5EGO B;  2Z2S B;  1ZHF A;  3HPH A;  1A6Q A;  3GXO A;  4PFO A;  4BU2 A;  1J59 A;  1HA8 A;  3HUG B;  2E7X A;  2DA4 A;  2DMP A;  2J5O A;  3FX3 A;  2VKH A;  1S7E A;  1TC3 C;  2K9L A;  1R4M B;  3DBR B;  5JVT A;  2ESH A;  1R36 A;  1KA8 A;  1K83 J;  3KP6 A;  4L5I A;  1KON A;  1F1Z A;  1XSX A;  2DPU A;  1ETQ A;  2BXZ A;  3C3W A;  4FCY A;  1GUU A;  2R92 J;  3LA7 A;  3X2Q H;  1MNM C;  2VB6 A;  3QPH A;  4RAF A;  1UHS A;  1S7O A;  4GGG A;  1OLT A;  2LDU A;  1R23 A;  2TRT A;  4JQF A;  1XSD A;  4ZYD A;  3VYR B;  1ETW A;  1Y8R B;  4PUS A;  3WTV C;  4BDZ A;  2KP6 A;  2DFH A;  1JKO C;  1XDS A;  2ETH A;  1PUF A;  4B3A A;  5BPD A;  3BT9 A;  4RLF A;  2HI3 A;  4ENM A;  5ICC A;  2DA5 A;  1QVU A;  3A0B C;  4XRS G;  4NC7 A;  4B44 A;  4J01 A;  1BI3 A;  1SVL A;  4RMN A;  5L3E A;  4YEL A;  2ZJP F;  1ON1 A;  9ANT A;  3PNT A;  4Z2Y A;  2K4J A;  4A12 A;  2N8G A;  2VT3 A;  2VBZ A;  2E2J J;  1IUY A;  2A07 F;  1B9N A;  3IL2 A;  2F48 A;  3I4M J;  2XRL A;  4EM2 A;  4P9F A;  3V8K A;  1Z05 A;  2LY9 A;  5B1A H;  5HLI A;  2MBF A;  5J3L A;  3F21 A;  2QQ8 A;  4A3G J;  1UG0 A;  2KFD A;  5L3D A;  3BR1 A;  4WK8 F;  3J81 Z;  3K1P A;  4A6E A;  3QOD A;  1BM9 A;  4UUS B;  2GWR A;  1WCM J;  2QCO A;  2GQQ A;  3AG2 H;  4U0W A;  3C1D A;  3WU2 C;  2F5C A;  4UVB A;  3VDX A;  5LFA A;  1FBS A;  2KIF A;  4O5V A;  4U0V A;  3CES A;  2MA3 A;  2LMD A;  2NRA C;  2DPD A;  1QHG A;  3FIS A;  4DYQ A;  3HYI A;  1SAN A;  1Z3Y A;  1YW8 A;  1ODD A;  2X1C A;  2CRG A;  2HVQ A;  5E17 F;  3L2R A;  1LPQ A;  4B43 A;  3AL0 C;  4M6V A;  2P5K A;  2KIQ A;  5K5Q A;  2DN0 A;  1MIJ A;  1VQL I;  4EJU A;  2CW0 F;  1G3T A;  3I4P A;  4MQ9 F;  4A69 C;  4DJA A;  3QYE A;  1SFK A;  2OC6 A;  2GA2 A;  3K9T A;  4ENK A;  3JRI A;  2ADU A;  2HXO A;  1ZYR F;  3K4K A;  2HOE A;  4ZZD A;  3HIF A;  3WGI A;  3V8J A;  5B1B H;  3TL4 X;  5M5X J;  3HRM A;  2ECB A;  1TWG J;  4M9X A;  3TP0 A;  2QKL B;  1LNW A;  5J47 A;  2OQG A;  3M3Y J;  5CVJ A;  1BI0 A;  1WI9 A;  3CJN A;  3OOU A;  2FRH A;  5HS7 A;  4CA0 A;  4BXX J;  5FD5 A;  2A6T A;  3G2B A;  4XOT A;  1U5T A;  2QSF X;  2DJN A;  4CCK A;  3RPQ A;  4RB3 C;  3SEQ A;  1G3Y A;  1O57 A;  3BQZ A;  3JRE A;  1QVT A;  3M07 A;  3NWS A;  2X1D A;  1VFC A;  1T38 A;  3P9I A;  2HQA A;  3DQV C;  2VQH A;  3A0H C;  5FLM J;  3BZ6 A;  3PUF A;  2XGD A;  2FQ4 A;  1MBH A;  4A5N A;  2HFH A;  2E36 A;  3CMM A;  1X4P A;  3SQN A;  2XPV A;  4F93 B;  3ABT A;  3U1K A;  2MG4 A;  2VBW A;  2W82 A;  3I55 I;  2DQL A;  4XLF A;  2M0M A;  3JRA A;  1IDZ A;  4BBS J;  4R1H A;  4L5J A;  2EFP A;  3ZN1 A;  3CCL I;  2O8K A;  1FTZ A;  1T0F A;  1VI0 A;  5DEQ A;  2P5L C;  1YIT I;  5IY5 H;  2EK5 A;  2M3A A;  4MGR A;  3E5Q A;  3IH4 A;  2NAZ A;  2IGO A;  4XN3 A;  1OYI A;  5JHF A;  1I5Z A;  1X1A A;  4II3 A;  1MJA A;  2DA1 A;  5L3F A;  2D1H A;  2ESN A;  1I1G A;  3BG6 A;  4KYW A;  1EA3 A;  2VOP A;  4X1E A;  1OR7 A;  2QQB A;  3HBL A;  1A6I A;  1OCO H;  2XAS A;  1QBJ A;  4YRV A;  2GZW A;  2R7D A;  1LFB A;  3OR1 C;  4QPQ A;  4IOA F;  4HV5 A;  3FKI J;  1OJL A;  2YR2 A;  1YX3 A;  2IA1 A;  1PUF B;  1O7F A;  2RNG A;  2DAO A;  5D8K B;  4D1Q A;  1U9N A;  2YS9 A;  2BY0 A;  1FEX A;  1WWX A;  4Y4R A;  1J75 A;  3ZMT A;  1IXS B;  2FX0 A;  2JMW A;  4KIG A;  3SEZ A;  4L5E A;  2FJ1 A;  2QLZ A;  4OWR B;  2VE9 A;  1HBX G;  4BQO A;  2OU2 A;  1FBU A;  3HHG A;  3M8E A;  4G94 A;  4JX6 A;  4C3H J;  4F52 A;  3GTK J;  2G9W A;  3KYD B;  2NVX J;  2GA1 A;  4MIM A;  5FFZ A;  4M3F A;  4CYC B;  3MZH A;  3EUH A;  1Y1W J;  1GVD A;  1MSE C;  3W6K B;  4H4K C;  3ZQ7 A;  1Y56 A;  3N4M A;  3J7A O;  4HLY A;  2M8E A;  1YO5 C;  2R3S A;  3WU1 B;  3WTX C;  2PMZ A;  3H3U A;  4OIP F;  1YRN A;  3HTS B;  4RGU A;  2MW8 A;  3P9K A;  3K1N A;  1ZAO A;  2FEZ A;  3ZOB A;  2E34 A;  3M8F A;  3E5U A;  5KAF C;  2EZI A;  2PJR A;  2RAE A;  3F3X A;  2WB1 A;  3EPZ A;  3QP5 A;  2JA2 A;  2ZB9 A;  3PFY A;  5F6F A;  3TDU C;  1ZG1 A;  5CVV A;  2FD5 A;  2L5Q A;  3T1B A;  1I50 J;  1Z1D A;  4BHP A;  1IXR C;  3MZY A;  2DYR H;  2DK8 A;  1IDY A;  2H27 A;  1X58 A;  5LEJ A;  3IUO A;  3DEE A;  3HKZ N;  3LOC A;  4Q48 A;  3COA C;  1W7P A;  1HXD A;  3KP4 A;  3BLY A;  4JYK A;  2R5Y A;  2V9K A;  2WV1 A;  1I39 A;  3FMQ A;  5GPC A;  2GXB A;  5EDN A;  3K4J A;  5EZH A;  2ZSH B;  5DD4 A;  5EEA A;  2ZFW A;  1Z77 A;  1LDK B;  3F8F A;  1UCR A;  2L02 A;  2FML A;  4Y7N J;  1H9G A;  1EKE A;  2L7Z A;  4BY7 J;  4HNU A;  4LOC A;  4ESJ A;  3I59 A;  3OYL A;  1DP7 P;  1E3P A;  4BH9 A;  3HJE A;  1JGS A;  4B09 A;  4E7H A;  4UB8 C;  5FD6 A;  2KQR A;  3WTW C;  1WJC A;  2AQF A;  4P96 A;  2KMU A;  1J5Y A;  3C2G A;  5E3L A;  3S2W A;  1JKQ C;  3ASO H;  3VPR A;  2ZCW A;  5J6X A;  4L18 B;  3I71 A;  1TL8 A;  1ZGA A;  3WG7 H;  3ZMU A;  3KP7 A;  1X3U A;  5F1J A;  1N77 A;  4EVI A;  1OIS A;  4V19 K;  1TQP A;  3BG7 A;  1WQ2 A;  3QWL A;  3GF2 A;  3IH2 A;  1D1C A;  1XC5 A;  2AHQ A;  1UZC A;  3HRT A;  5EJC A;  4KN7 X;  5JHU A;  3VSK A;  2O3F A;  4XBF A;  4NDL A;  2LYC A;  2KJB A;  2CW8 A;  4NNJ A;  3CP8 A;  2BW3 A;  3W2V A;  5GTH C;  2VXZ A;  1FOK A;  3Q9S A;  1K4T A;  4EV0 A;  2QQ9 A;  1T6S A;  2ELH A;  2ZKZ A;  3FIW A;  4NUB A;  1YTY A;  2JTV A;  3Q0V A;  2CV1 A;  2NVY J;  2IS2 A;  3V4G A;  4HNT A;  3RQ4 A;  1S9H A;  2WAQ A;  3RZO J;  1J9I A;  2X6O A;  3QPT A;  1Z0X A;  2HQN A;  4IQ4 A;  2Y9Z A;  1X1D A;  5JI6 A;  1MMS A;  1VQ7 I;  2L9S A;  2UUZ A;  2OBP A;  5ILS A;  4XM3 A;  3I5U A;  4AVP A;  4MFE A;  5C4X J;  3OYE A;  1PP8 F;  2KIU A;  3HG9 A;  1W0U A;  2P7V B;  3G1O A;  4A5M A;  4EJV A;  5DDG A;  3QAH A;  1HLV A;  3K69 A;  3AG1 H;  1ZEL A;  3R0J A;  1BR4 A;  1S8N A;  4IHS A;  3LFU A;  3H9G A;  3BR2 A;  1RI7 A;  1LFU P;  2IP2 A;  3H92 A;  3MVP A;  1SFO J;  1QZE A;  3OYM A;  2K85 A;  3CUQ A;  5J1R A;  1YRN B;  2VOD A;  1LE8 A;  1MH3 A;  4RAG A;  4G7Z F;  1D5V A;  2XIG A;  1PVE A;  4MHG A;  2PJR B;  1FC3 A;  4DBR A;  4JP0 A;  5F04 A;  1HKQ A;  4GO1 A;  4D0P A;  4LMY A;  5E1W A;  3BZK A;  1TT0 A;  2NS7 A;  4BE0 A;  2X0L A;  2ZBK A;  3RKQ A;  1G2H A;  4BEH A;  2Z99 A;  1DP3 A;  1KU2 A;  2WC2 A;  1YYV A;  1WJD A;  3QOE A;  1EH8 A;  2L7F P;  3PL8 A;  5GAG J;  3IWZ A;  4IKF A;  1U2W A;  4G6T B;  1X2M A;  2CQX A;  4C30 A;  2XV4 S;  2HDD A;  4OU0 A;  4DOZ A;  3GME A;  2LLK A;  4XK4 A;  3ZMD A;  3DPU A;  2A05 A;  5HLG A;  1W7P B;  2CFX A;  1PDN C;  3JRD A;  3F72 A;  1G4D A;  2QBY B;  2PFB A;  3DCF A;  2R7V A;  2QVO A;  3LSI A;  3WTZ A;  2XF7 A;  2XKP A;  2R5Y B;  2JUG A;  1VND A;  1X1B A;  4BQN A;  3S3O A;  3G73 A;  1WJF A;  3I53 A;  3HOY J;  3ZCO A;  1WSU A;  3CC4 I;  2DMU A;  2FU4 A;  4HLX A;  1QPM A;  5FLX Z;  1R58 A;  1HW1 A;  4D9J A;  1HDD C;  2XGC A;  2F4M B;  2L7M P;  4KA4 A;  1XS9 A;  2A5W A;  4PJ0 C;  2R7W A;  4OMY A;  2R7U A;  2VAS A;  3I59 B;  1U9O A;  2LRE A;  1BR2 A;  2EA2 A;  2ID6 A;  3IAS 2;  1FLI A;  2K02 A;  5FJ8 J;  1FSE A;  4XLE A;  2VPR A;  5CVU A;  3PQK A;  2I5U A;  2L0K A;  1ONV A;  4AC0 A;  1F9N A;  5F0H A;  1N75 A;  3NQO A;  1TQM A;  4D7N A;  2HKX A;  1X1P A;  3KYL A;  4XL9 A;  1OPC A;  4PK4 A;  1HC8 A;  3QYB A;  1P9Q C;  2NNY A;  2XAJ A;  3G1M A;  2HXI A;  2K86 A;  2ISY A;  3H5A A;  2V7F A;  3ZP5 A;  2XSJ C;  3CJR B;  4NQW A;  1FBQ A;  2FNP A;  4QTR A;  3OV8 A;  2ME6 A;  3LSP A;  3CCQ I;  4HST A;  2KRF A;  1ETO A;  4DZJ A;  5FKM A;  4PCQ A;  3H35 A;  5ICG A;  2HU9 A;  3KE2 A;  3ZQI A;  2CYY A;  3WU0 A;  2M8G X;  3EQL F;  3ABK H;  2B9S A;  2BW3 B;  4AM3 A;  4WXD A;  4QSH A;  5KAI C;  2NNN A;  3OYN A;  1D8J A;  1FIP A;  2M4K A;  1TNS A;  4BJ5 C;  1WJ5 A;  2M45 A;  2OTJ I;  2VIX A;  3HGG A;  2DMN A;  1P92 A;  4IRI A;  3CCR I;  1KYZ A;  1W7P D;  5BS6 A;  2STT A;  4PSW A;  3GLX A;  4CUG A;  1RUN A;  2VKV A;  2E1M C;  2NOJ B;  2PMH A;  1JHH A;  3RZD J;  4HF0 A;  1TP4 A;  3ZQC A;  3LQQ A;  3S1N J;  3PSF A;  2K9M A;  3WGG A;  2DFI A;  1ZTR A;  1SFU A;  2ZME C;  3J81 K;  1YFH A;  1DGW Y;  1D1B A;  2L9V A;  2VQL A;  2HVR A;  2MFZ A;  3IAM 2;  2GBY A;  4YFK F;  3I3L A;  5IPA A;  1L0O C;  2DI3 A;  4UV9 A;  2JVG A;  1BOA A;  2K3F A;  2Z9O A;  3TDZ C;  2P81 A;  1AA7 A;  3L2W A;  3CUQ B;  4FAS D;  3HOS A;  3S16 J;  1LJ9 A;  4OOI A;  2RN7 A;  1LE8 B;  2R7T A;  1YW9 A;  2WBM A;  3MAJ A;  2O6G E;  2PLY A;  4WX9 A;  1FTT A;  2JA5 J;  4RB0 A;  3PIP F;  1JJ6 C;  1C0W A;  1ENH A;  3OIQ A;  1TQI A;  3OYI A;  2FBH A;  1OCZ H;  5FRM A;  3KEO A;  3KIO A;  1MH4 A;  2H6B A;  2XAU A;  1U78 A;  5GAD J;  4UUT A;  3S14 J;  1TT5 B;  3TO9 A;  2Y30 A;  1XB4 A;  1WFX A;  2V1U A;  4G6Q A;  5TGT A;  2XRN A;  2V1D A; 
#chains in the Genus database with same CATH homology
 3ZQG A;  2QF7 A;  4JX4 A;  3JRI A;  2HXO A;  1HDP A;  5EG0 B;  4IHX A;  3HDD A;  1HF0 A;  2HYJ A;  5M5X J;  1BL0 A;  2ECB A;  1F36 A;  3HOW J;  1TWG J;  5F0F A;  3JRG A;  3TP0 A;  1ETY A;  3M3Y J;  4BXX J;  2ECC A;  1TWC J;  3OOU A;  1ZK8 A;  5GPA A;  1DU0 A;  2YU9 J;  2DJN A;  3IH3 A;  4MFD A;  3BQZ A;  3JRE A;  1F43 A;  1QVT A;  1VFC A;  2XSD C;  1H8A C;  3H3V K;  5FLM J;  1QPI A;  1XG1 A;  3BTI A;  3HOZ J;  2R93 J;  5F08 A;  2XGD A;  2FQ4 A;  1MBH A;  5JLW A;  3SFI A;  5FKN A;  2XPV A;  1WH7 A;  2MG4 A;  1D5Y A;  1IUF A;  1Q1V A;  3O8G A;  4BY1 J;  4Y52 J;  3JRA A;  1IDZ A;  1JTX A;  2JA8 J;  4HNV A;  4BBS J;  5M3F J;  1ZKG A;  2R5Z A;  2M34 A;  3HEF A;  1GV5 A;  3LNQ A;  2O8K A;  3UKG A;  2DA3 A;  4B4C A;  2NVT J;  3HGY A;  1FTZ A;  5DS9 A;  1VI0 A;  4D5C A;  4XIC A;  4M3G A;  2TCT A;  3BQY A;  1TWA J;  3IH4 A;  3GTP J;  2I10 A;  2CU7 A;  5IP7 J;  2K40 A;  1W0T A;  4A3C J;  1T33 A;  2Y2Z A;  2DA1 A;  4FE7 A;  2KT0 A;  1ETV A;  3PO3 J;  4X1E A;  3HBL A;  1A6I A;  1B72 B;  3TED A;  1QRY A;  2CJJ A;  2IAI A;  1LFB A;  3BG5 A;  2Y9Y A;  3FKI J;  1OJL A;  1PUF B;  4MLO A;  3LSR A;  4AYB N;  3PO2 J;  2ELK A;  2W48 A;  1U9N A;  2YS9 A;  4A3F J;  3S1R J;  4A3E J;  4DZP A;  1FEX A;  3BR3 A;  3NAR A;  3TW7 A;  4I6Z A;  1X2N A;  3Q3S A;  2O9L A;  1MBF A;  2FX0 A;  3HOX J;  1P7J A;  2JMW A;  4L5E A;  2FJ1 A;  2L9R A;  2JWT A;  1ETX A;  5J1U A;  4JX6 A;  4BBR J;  4C3H J;  1TWF J;  1P7I A;  3GTK J;  2NVX J;  1I3Q J;  4MIM A;  3BR5 A;  1AHD P;  2JA6 J;  4M3F A;  4W1U A;  4CYC B;  1BW6 A;  1ZR4 A;  4DYR A;  1Y1W J;  1GVD A;  1MSE C;  2HQ5 A;  1GV2 A;  3TW6 A;  1POG A;  4C2M J;  3C2B A;  2LTP A;  3DEW A;  1BJZ A;  1YRN A;  1JT6 A;  2VI6 A;  3HB9 A;  4B1R A;  5K7F A;  2MW8 A;  3A02 A;  5HOD A;  2Y0S N;  4MO7 A;  3ZOB A;  3L1P A;  3Q0W A;  2EZI A;  2RAE A;  5EF6 A;  4UUS A;  3QPS A;  2B63 J;  1OCP A;  2E1O A;  1MSF C;  2ZB9 A;  3JRC A;  5C3E J;  2LFB A;  1JUP A;  1APL C;  2FD5 A;  5EZG A;  1I50 J;  4ABZ A;  2EH3 A;  3B6C A;  1IDY A;  3QQA A;  1NK2 P;  3FK7 A;  1X58 A;  1JTY A;  1RPW A;  2LK2 A;  2O7O A;  5FLV A;  3WHB A;  1RR7 A;  3BTL A;  4C3J J;  1H89 C;  4DW6 A;  1AKH B;  4D5F A;  1IV6 A;  1ZR2 A;  1H88 C;  3HKZ N;  3LOC A;  3BR0 A;  2AO9 A;  2NOG A;  1JKR C;  2JA7 J;  1WPK A;  4JYK A;  4A3I J;  2R5Y A;  1BW5 A;  1ITY A;  2WV1 A;  1K61 A;  1B8I A;  5M5Y J;  4J19 A;  2M9H A;  5GPC A;  4G12 A;  5EDN A;  5EZH A;  5EEA A;  2HOT A;  1GT0 C;  2HOS A;  2K9S A;  1Z77 A;  1MBK A;  1Y1V J;  5IOY A;  4Y7N J;  1FIA A;  2NVQ J;  1DU6 A;  2L7Z A;  5F27 A;  4BY7 J;  3GTG J;  1WGX A;  4LOC A;  2E2I J;  2R0Q C;  4IEJ A;  1MBJ A;  3OSG A;  1T56 A;  1VF9 A;  2LVS A;  3BTJ A;  4DYC A;  1RKW A;  4M3E A;  5EYR A;  3GTL J;  2IEK A;  1TWH J;  2ME0 A;  2COB A;  2H8R A;  4XRM A;  1NK3 P;  5EGO A;  5E3L A;  1UMQ A;  3H0G J;  1JT0 A;  1JKQ C;  2LKX A;  3VPR A;  4A3K J;  1ETK A;  2XPU A;  5IYC J;  2EZL A;  1E3O C;  3JR9 A;  5F1J A;  2OF7 A;  2G0E A;  1JKP C;  3IH2 A;  2DTZ A;  1XC5 A;  2AHQ A;  2DMT A;  3GTJ J;  4IHV A;  2K9Q A;  4NDL A;  4M3D A;  2YUS A;  2X48 A;  1RET A;  3LSG A;  5DTD A;  2XB5 A;  2KDZ A;  4GFB A;  3FIW A;  1O4X A;  3Q0V A;  5IOZ A;  2NVY J;  1BA5 A;  4A93 J;  3B6A A;  1HCR A;  2EZK A;  3RZO J;  2X6O A;  3TP3 A;  1NTC A;  2XB0 X;  1A5J A;  1Z0X A;  1MBE A;  2HOA A;  3K2A A;  3MKL A;  2XPW A;  2Y9Z A;  3BR6 A;  3S1M J;  1U8B A;  4AUX A;  2LR8 A;  4W97 A;  3S15 J;  1UG2 A;  2MSY A;  2K9N A;  4MFE A;  4XID A;  3GBG A;  5C4X J;  2JJ7 A;  3S2H J;  1EF4 A;  5J1Y A;  2IBD A;  1W0U A;  1ZGW A;  3G1O A;  1HLV A;  2DMQ A;  4CYC A;  1JUS A;  3CCY A;  3BR2 A;  1R9T J;  4A3B J;  1LFU P;  5F0C A;  2D5V A;  3MVP A;  1SFO J;  1YRN B;  1WH5 A;  5J1R A;  1LE8 A;  1MH3 A;  3SDG A;  1ZQ3 P;  5C4J J;  1GDT A;  3JRF A;  3ZQF A;  4JP0 A;  5F04 A;  4JX5 A;  3A01 B;  4A3J J;  2ID3 A;  2NS7 A;  3HM5 A;  3RKQ A;  1G2H A;  2H1K A;  2L7F P;  3WHC A;  1OCT C;  1IJW C;  4M3B A;  2EQR A;  3S2D J;  2HDD A;  1X2M A;  2CQQ A;  2CQX A;  4FTH A;  1I6H J;  2LLK A;  4XK4 A;  2CUF A;  3IV5 A;  1OFC X;  2DA6 A;  3RQI A;  4FE4 A;  3JRD A;  3HOU J;  1HOM A;  5GP9 A;  3DCF A;  4FIS A;  5IP9 J;  3CMY A;  5EG0 A;  2R5Y B;  1VND A;  2JN6 A;  2M2E A;  1CQT A;  1B8I B;  1IC8 A;  3HOY J;  3GTQ J;  3SJM A;  2DMU A;  2XGE A;  3I4N J;  2EBI A;  2M0C A;  3OIO A;  4IHW A;  1WI3 A;  3ZQH A;  1HDD C;  2XGC A;  2MGQ A;  2GM4 A;  2E19 A;  2L7M P;  1XS9 A;  2DA7 A;  5IYB J;  5E3N A;  1FJL A;  2PMZ N;  4D7M A;  1U9O A;  3NAU A;  4RDU A;  2ID6 A;  5K7H A;  5FJ8 J;  3Q0U A;  3BTC A;  2GLO A;  5C44 J;  2VPR A;  4I76 A;  4V2G A;  2L0K A;  3BG3 A;  2WB1 N;  2VUM J;  4AC0 A;  2CUE A;  5EGO B;  3GTM J;  3ZQL A;  2R5Z B;  5F0H A;  4D7N A;  2R7Z J;  5K7Z A;  2DA4 A;  2DMP A;  4IHY A;  3G1M A;  2HXI A;  1IG7 A;  1S7E A;  1TC3 C;  3E7L A;  5FKL A;  3M4O J;  3O8H A;  1K83 J;  2EZH A;  2NS8 A;  4QTR A;  3JRB A;  2ME6 A;  3LSP A;  1ETQ A;  4FCY A;  2R92 J;  1GUU A;  5M5W J;  1RKT A;  1MNM C;  1ETO A;  3D1N I;  1UHS A;  5FKM A;  4DZJ A;  4RBO A;  4S0H B;  1ORK A;  2TRT A;  3ZQI A;  5E3O A;  1B72 A;  2M8G X;  3PM1 A;  2LD5 A;  1ETW A;  4QIW N;  4QSH A;  5M3M J;  1JKO C;  4EEF G;  3MN2 A;  1FIP A;  5FKO A;  2Y31 A;  5JLX A;  1PUF A;  4B3A A;  4A3M J;  2VKE A;  3BT9 A;  2HI3 A;  2E2H J;  3GTO J;  3HGG A;  2DMN A;  4XRS A;  2DA5 A;  1QVU A;  4XRS G;  3BG9 A;  5BNG A;  4BKX A;  4A3L J;  9ANT A;  3S1Q J;  2N8G A;  3CQZ J;  2E2J J;  1JGG A;  3K7A J;  2VKV A;  1IGN A;  3S17 J;  4X6A J;  5IP6 A;  3HOV J;  3OSF A;  3RZD J;  3I4M J;  1JUM A;  2XRL A;  3ZQC A;  1IRZ A;  3S1N J;  2LY9 A;  1ZTR A;  5J3L A;  3CDL A;  3FK6 A;  4A3G J;  4V2F A;  2GBY A;  3BR1 A;  5IPA A;  5FKK A;  4C3I J;  2LP0 A;  2P81 A;  4UUS B;  1RES A;  1WCM J;  2QCO A;  3S16 J;  2JK3 A;  1LE8 B;  4A3D J;  3W6V A;  1AU7 A;  2DA2 A;  5IYD J;  3F0C A;  1JJ8 C;  1FTT A;  2JA5 J;  1JJ6 C;  1ENH A;  3JRH A;  3A01 A;  2X9D A;  3FIS A;  4DYQ A;  1SAN A;  1AKH A;  3LSJ A;  2CRG A;  1MH4 A;  3G1L A;  5E3M A;  3QPL A;  1MBG A;  4M6V A;  1U78 A;  2WAQ N;  2OPT A;  4UUT A;  2DN0 A;  3S14 J;  3A03 A;  2Y30 A;  4A69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...