1G2HA

Solution structure of the dna-binding domain of the tyrr protein of haemophilus influenzae
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
SAVISLDEFENKTLDEIIGFYEAQVLKLFYAEYPSTRKLAQRLGVSHTAIANKLKQYGIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN TYRR HOMOLOG
publication title Solution structure of the DNA-binding domain of the TyrR protein of Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transcription
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18024 HTH_50 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1g2hA00
4UUSA 4A69C 2W48A 1FTZA 1P7IA 1K83J 3BTJA 2YUSA 4M6VA 1I50J 3CDLA 3S1QJ 4A3CJ 1ZR4A 4G12A 3D1NI 4QIWN 2EQRA 4A3JJ 3BG3A 1ZTRA 2LY9A 1JT6A 2LVSA 4RDUA 1BW5A 2CU7A 5JLWA 2XGCA 3BR3A 1R9TJ 1WH5A 1T33A 3ZQFA 3HGGA 1F43A 1W0TA 1OJLA 5F27A 2D5VA 1ETXA 2XSDC 2NVYJ 1WPKA 2DMQA 4UUSB 2LLKA 2R0QC 1D5YA 4IHXA 2EZIA 3W6VA 1MBKA 1AHDP 5FKOA 4ABZA 4XICA 1AU7A 3QPLA 1ZK8A 3ZQIA 5F04A 2CJJA 5E3LA 2TCTA 3OIOA 3BQZA 5IYDJ 2X9DA 3HM5A 3GTPJ 4A3MJ 1TC3C 2XPVA 2QF7A 1BA5A 3OSGA 4A3LJ 5FKNA 1B8IA 2H1KA 4A3BJ 3IH3A 4M3DA 4FTHA 1LFBA 2DMPA 4JX4A 3TP0A 1JJ8C 1VF9A 1WGXA 1GV2A 5F0HA 1VI0A 2EH3A 4UUTA 5E3MA 5M3MJ 1I6HJ 3IH4A 4B3AA 3BR5A 3ZQCA 5FJ8J 1U9OA 2WAQN 5F08A 1XS9A 5BNGA 1BJZA 2JK3A 1JTXA 3RQIA 4EEFG 4A3DJ 2DMNA 4M3BA 2P81A 9ANTA 2KT0A 2R5YB 5EGOA 2LK2A 2LTPA 4D7NA 1JKRC 3BTCA 3WHBA 3BQYA 4IEJA 4IHYA 1UMQA 1ZQ3P 2O7OA 2Y9YA 2Y9ZA 2O8KA 1X58A 5M5WJ 2XGEA 4D7MA 1I3QJ 4QSHA 3PO3J 3CMYA 2Y0SN 1TWHJ 1JJ6C 2KDZA 1FJLA 2MGQA 4AYBN 4MFEA 5C44J 4XRSG 5M3FJ 2L0KA 5EGOB 1WI3A 5J1UA 1AKHB 3S14J 5C4XJ 2IBDA 2NVTJ 4XRSA 3B6CA 2FD5A 1ETVA 5IPAA 4A3FJ 1MBEA 4RBOA 1ETOA 4W1UA 4C2MJ 1MSFC 4DZPA 1BW6A 5EG0A 1IUFA 3SDGA 1JTYA 1JUSA 2XRLA 2VKEA 1NK2P 2DA6A 2FX0A 4DYQA 1HOMA 4LOCA 3ZQGA 1NTCA 5EDNA 3MN2A 3UKGA 2HQ5A 5E3OA 3GBGA 2I10A 1MH4A 1LE8A 3I4MJ 5FLVA 4A93J 1UHSA 3FIWA 3G1MA 2EZHA 2GM4A 2E2JJ 3TW6A 1H89C 1QVUA 1FIAA 2O9LA 3HBLA 5E3NA 2M8GX 5C3EJ 1JT0A 2M0CA 1Z0XA 2G0EA 2EZKA 5EG0B 2WB1N 2K9QA 3I4NJ 2COBA 2NOGA 4C3JJ 3HKZN 4BXXJ 3MKLA 5EYRA 4X6AJ 5K7ZA 3JRHA 4MO7A 1LE8B 3S2HJ 3A01A 1HLVA 1RKTA 1B72A 3GTGJ 1JKPC 2XPWA 3GTMJ 3BR6A 3K2AA 4D5CA 5J1RA 2CQXA 2OPTA 2CUFA 2FJ1A 5IYCJ 1APLC 3M4OJ 4BBSJ 2LFBA 2R7ZJ 1X2NA 5FKKA 4D5FA 2N8GA 1TWGJ 2R92J 2L7ZA 3HB9A 4W97A 5M5XJ 5EEAA 3QPSA 2YU9J 1HCRA 3LSPA 1ETQA 2VI6A 1PUFA 2NVQJ 3VPRA 4V2FA 1X2MA 1IRZA 4J19A 3A01B 3DEWA 2MG4A 1RETA 4AUXA 1U78A 2IAIA 2E2HJ 1OCTC 2JJ7A 4JX5A 2AHQA 2CQQA 4IHVA 4C3IJ 1OFCX 2ZB9A 5FLMJ 1ZKGA 3TEDA 3OOUA 4DYRA 3IH2A 3HOVJ 1W0UA 2XGDA 3LSGA 3BR2A 2DN0A 5JLXA 1VFCA 4JYKA 2HDDA 3S1NJ 5J3LA 2JA8J 2Y30A 1NK3P 2GBYA 2DA5A 5IP7J 2NS8A 3TW7A 4FE7A 1B8IB 2NVXJ 2ECBA 2DMUA 2Y2ZA 3SFIA 1O4XA 3BTLA 4BY1J 3NARA 3S15J 4I76A 1IV6A 1JUMA 2XPUA 4IHWA 3ZQHA 3JR9A 2DJNA 3Q3SA 5EZGA 1ITYA 3BTIA 1RPWA 3Q0UA 4MFDA 2WV1A 2NS7A 1U8BA 4FE4A 4HNVA 5GPCA 4BY7J 1SANA 2XB5A 1FIPA 4M3EA 2R5ZA 1IG7A 3OSFA 1TWFJ 1TWCJ 2CRGA 3BG5A 5FKLA 3FISA 1ETYA 3BR1A 3H3VK 2PMZN 1E3OC 2CUEA 2ME6A 1ZGWA 5DS9A 1QVTA 4MIMA 3JRBA 2JWTA 2MSYA 3H0GJ 1A6IA 5F1JA 2DMTA 2ID3A 4A3IJ 4FISA 1OCPA 2HOTA 4XIDA 5GPAA 4GFBA 2HI3A 2Y31A 1JGGA 2E1OA 1QPIA 3GTOJ 3JRAA 2L7MP 1TWAJ 5J1YA 1HDDC 2DA7A 1MBHA 2DA4A 3L1PA 1GVDA 3FKIJ 2GLOA 3BT9A 3GTKJ 2VKVA 1Y1VJ 4BKXA 3PM1A 5K7HA 4DYCA 2JA7J 1T56A 1K61A 3RKQA 1U9NA 1Z77A 2AO9A 3MVPA 3S1MJ 3WHCA 4V2GA 2M34A 5GP9A 1H8AC 2HXOA 1EF4A 3FK7A 1ENHA 4DZJA 2HOAA 2LP0A 2LR8A 3QQAA 1YRNA 2HYJA 3C2BA 1XC5A 2JMWA 3S16J 3BG9A 2IEKA 5K7FA 1RKWA 2TRTA 4A3EJ 3HOZJ 1Q1VA 2LKXA 1H88C 3S2DJ 3LSRA 1Y1WJ 1A5JA 2EZLA 4X1EA 1IDZA 1JKOC 3S1RJ 2YS9A 2E2IJ 1JKQC 2B63J 2K9NA 3RZDJ 2VUMJ 1VNDA 1IDYA 3LNQA 4S0HB 1YRNB 1B72B 3PO2J 2JA6J 1ETKA 2M2EA 4B1RA 1SFOJ 4DW6A 1MBJA 3Q0WA 3DCFA 4M3FA 5M5YJ 3B6AA 3K7AJ 5DTDA 4L5EA 2JA5J 1MSEC 3CQZJ 1POGA 1S7EA 4XRMA 3ZQLA 1HF0A 2HOSA 3GTLJ 4QTRA 4NDLA 3GTJJ 3HOWJ 1GUUA 1DU6A 1ZR2A 2ECCA 1PUFB 1GDTA 2H8RA 1LFUP 4M3GA 2ELKA 1IC8A 3ZOBA 5EZHA 3JRFA 3JREA 3HOXJ 2R5YA 4B4CA 1FEXA 1MBGA 3M3YJ 3HDDA 4BBRJ 5C4JJ 1GT0C 2RAEA 2ID6A 3E7LA 4Y52J 2K40A 1DU0A 2DA2A 1IGNA 3RZOJ 2EBIA 5FKMA 5IOZA 2DTZA 1G2HA 3O8HA 2LD5A 1XG1A 1IJWC 5EF6A 4JX6A 3IV5A 4Y7NJ 5IYBJ 3JRDA 3S17J 5IP9J 4I6ZA 1AKHA 5IOYA 1ORKA 3NAUA 2DA3A 1RR7A 1WCMJ 2DA1A 1P7JA 1WH7A 1MNMC 1MBFA 2X48A 3BR0A 3HOYJ 3O8GA 3A02A 5F0FA 2L7FP 1BL0A 1F36A 4AC0A 3SJMA 5IP6A 2R5ZB 1CQTA 4CYCA 3FK6A 2E19A 2OF7A 3HGYA 2VPRA 2QCOA 3Q0VA 3JRGA 4FCYA 1GV5A 1RESA 2M9HA 2MW8A 4C3HJ 4A3GJ 5F0CA 2X6OA 3F0CA 2R93J 3HEFA 3GTQJ 4MLOA 3G1LA 2XB0X 3G1OA 2HXIA 1HDPA 2ME0A 4A3KJ 4XK4A 3CCYA 3LOCA 3A03A 5HODA 3JRCA 1FTTA 3TP3A 1MH3A 4CYCB 2K9SA 3HOUJ 1ETWA 2FQ4A 1UG2A 1QRYA 4JP0A 3LSJA 2L9RA 3JRIA 2JN6A 1JUPA
chains in the Genus database with same CATH superfamily
5ICCA 4A69C 3SXYA 3L2CA 4G7OF 1OCCH 2WB1A 4D9JA 4KIBA 3BTJA 5LGUA 3BWGA 3VDXA 5H2FC 2V26A 1IN4A 1E3HA 4KN7X 3CDLA 1ZR4A 2X51A 2EQRA 4XLFA 5B66C 1MDMA 4EJVA 1Z6TA 2LY9A 2ISYA 1XGNA 3BR3A 1K6OA 1YITI 2KIFA 3HGGA 1E3PA 2F5DA 1OJLA 3RPUD 1TL8A 1ETXA 1XCVA 2MFZA 5L3BA 2BGCA 2DMQA 1S6LA 4LITA 4N4NB 2R0QC 5EEGA 1SVMA 1CF7A 1LEBA 5CVUA 1T0FC 4IHXA 1USSA 1NG7A 4CH7A 4HA8A 3MKZA 1F9NA 3C3WA 5IY5H 2K9LA 5FKOA 1XGOA 2O3FA 1ZRFA 3SZGA 1SFXA 2K5CA 1ZK8A 4HNTA 3WTWC 3IHUA 2IT0A 4L9VA 5GADJ 1P4AA 1ON1A 2TCTA 4GCVA 5E3LA 3BQZA 3GTPJ 1OCOH 2HEOA 2FNPA 4KDPA 2XPVA 4F52A 5FKNA 1B8IA 1O3SA 1RUNA 3IH3A 4OIPF 4IHTA 3PNTA 5ILUA 2CUZA 2GOXB 2LY2A 1MKMA 3DTKA 1H9TA 1VF9A 2M4GA 4IKFA 3ECHA 5HNFA 2DOFA 3DU6A 2LY1A 4OIOF 2UUZA 3BR5A 4CCOA 5FJ8J 1U9OA 3KETA 3QRFF 2EPFA 1R23A 4EMSA 2GWRA 1TQIA 2JK3A 2BY1A 2V9KA 1JTXA 3CCMI 3RQIA 4EEFG 4M3BA 1PUEE 3ZMUA 1BR4A 2HDCA 1ZHFA 2KT0A 2R5YB 1Y6IA 3VSLA 2LTPA 4EGYA 4BJTA 4CXFA 1I1GA 2IA0A 2CFXA 2FOKA 2V1NA 3RTRA 1UMQA 2O8KA 3ABKH 1X58A 4ANJA 4BNCA 4D1QA 4FX0A 3K1NA 4XKVA 1IRFA 5FLXZ 3F6OA 2CO5A 3A0HC 2W4SA 3DKWA 4XR6A 3CP8A 2KDZA 2CQKA 2PMZA 5C44J 4XRSG 5M3FJ 5D8KB 2L0KA 2OC6A 1IO2A 3OYDA 1AKHB 1QO0D 4Y3OA 5AIQA 3B6CA 2VOPA 2ZFWA 1ETVA 2M1BA 3C2GA 3WGIA 1MBEA 1SFEA 1FLIA 3PUFA 1ETOA 1R5ID 3MD2A 1Z3XA 2A5WA 4W1UA 3SEQA 5ICGA 3H5AA 2KPMA 2OJED 3JAMZ 1ZAOA 2FSWA 2V1XA 5EG0A 3SDGA 3EUAA 2VKEA 3DLLF 1NK2P 4UB6C 4II3A 4HZFA 2JRTA 4DOZA 1NHAA 2K86A 1AOYA 4KT5C 2VC1A 5EDNA 1EH6A 3GBGA 3I54A 2DT7B 2JSCA 3I4MJ 1A6QA 2A05A 4KUMA 2BW3B 4NQWA 2E2JJ 1H89C 3NWTA 4PJ0C 3HYIA 1QVUA 1R4NB 1FIAA 3ZRGA 2O8XA 5E3NA 3K4MA 2CWEA 3HXLA 1D1BA 5L3FA 3J81K 3RQ4A 1Z0XA 2G0EA 2H8WA 3U9GA 4XOPA 5EG0B 1IF1A 2NOGA 4C3JJ 1YQAA 3HKZN 3K4NA 2QYOA 4XKCA 3HPGA 5E18F 1FX7A 1G6NA 5EYRA 3ZQ7A 1WQ2A 2BYVE 3C1DA 3JRHA 3S3NA 2PMHA 5A2QZ 1HKSA 4MO7A 3S2HJ 2LOOA 5H6RA 2NVUB 3A01A 3QAHA 3CDIA 1FYLA 1W7PA 2X1CA 1RKTA 1CGPA 2FE3A 1BBYA 2RKHA 4NQWB 4BH9A 3GTGJ 1P6RA 2WY8Q 1JKPC 2IXSA 3LSIA 2FJ1A 5DCFA 5IYCJ 1APLC 2R7ZJ 1XGSA 3ELKA 2JRMA 1TWGJ 4JK1X 2GQQA 4W97A 1K4SA 1W5SA 4RA2A 4X0GA 3HC7A 3E5XA 3QPSA 4BHCA 1HCRA 2YSRA 3LSPA 3PFIA 1ETQA 2VI6A 3EETA 4RS8A 3UNGC 1PUFA 4V2FA 2PG4A 2VONA 5FFXA 4J19A 3A01B 1J7KA 3DEWA 4AUXA 5LHGA 3G73A 1W7PB 2RNGA 3MKWB 1ZLJA 3L00A 3OR2C 2RNJA 1XDUA 5FLMJ 3TEDA 2O6GE 5FO5A 2FF4A 2FRHA 1YJWI 4DYRA 3M9AA 3R0JA 3IH2A 4BS9A 6PAXA 2OCCH 3HOVJ 4ON0A 2L2OA 3LSGA 1K79A 3BR2A 1OR7C 2DN0A 5JLXA 5J3LA 2JA8J 1I6XA 2GBYA 1SVLA 1U5TC 3LAJA 3CCVI 2NS8A 2RQPA 3TW7A 3P5JA 4XLPF 1QPMA 1ZREA 3GFMA 1ZG1A 4M72A 2CH0A 5DV5A 1TNSA 1O4XA 1QBJA 2HVSA 5E1WA 3ZMVA 3ZXSA 3D5LA 2XKPA 4BY1J 1K78A 5HS8A 4HRIA 2XPUA 2HWVA 2F48A 3PQKA 2DJNA 2OQRA 1YW7A 2HQRA 1FOXA 4MFDA 3GUDA 3K70D 3WTYC 2EA2A 2XSJC 3QYEA 5HLGA 2ZJQF 4HNVA 4AIDA 4GO1A 5GPCA 2BY2A 1S29A 1FIPA 1SMTA 5BOXA 3P9IA 4Y4RA 2R5ZA 2ZSHB 1RUOA 4L9NA 3KPHA 4ESJA 1SAXA 5TRDA 3DEUA 2M5WA 3H3VK 4OU0A 1LDKB 3WG9A 1YO5C 2ME6A 1IN8A 3I58A 3PUBA 1K78B 1FP1D 2FNAA 4EJOA 1DUXC 1RIOH 4HDUA 4ENNA 3JRBA 2JWTA 3F8MA 1ON2A 1A6IA 3BG7A 3H0GJ 3H0DA 4CUGA 2EFQA 2BHZA 3I9V2 4GFBA 1X3WB 4OINF 2R4GA 2IGOA 4JOMA 2Y31A 3I3LA 1KQ0A 3SDBA 3MWMA 3CUOA 1ZELA 1E17A 1QPIA 3A0BC 2MLGA 4JQFA 1A35A 2VQGA 2L7MP 1TWAJ 1FY7A 4RB2C 2DA7A 2BE5F 3GFJA 1X1BA 2W00A 3FKIJ 4HAMA 4UVAA 4EGZA 3PNYA 3BT9A 1MMAA 3GTKJ 2ZSIB 3P9CA 1BC7C 2KZGA 1KU9A 4ZYHA 2HQNA 2KIUA 4BKXA 1VQ6I 3PM1A 4J01A 3PNVA 5K7HA 2AQFA 2RREA 3B02A 2R7FA 5CLSA 3BP8A 3J81Z 2JTVA 3TDUC 4ZYAA 3AG2H 1Y8RB 3M1EA 3MVPA 5DEQA 3LSHA 4GDFA 3S1MJ 5GP9A 1BR1A 1G3YA 3CF5F 2GXAA 1ENHA 1ZGAA 1ZLKA 3DTEA 2LR8A 2DAOA 3QQAA 1YRNA 1QQIA 1XC5A 4DGWB 2FOWA 4LG3A 4RGUA 5JI6A 3HRMA 2OD5A 5DUIA 1YS7A 3D5SC 1Z21A 4S04A 2IVMA 1MMSA 5KVRA 1FWZA 3IRRA 1IDZA 3L7WA 5AIPA 4ZDPA 4MTDA 1W5CC 4F92B 1F1ZA 2E5ZA 1SD5A 2BXZA 4II2A 4UV8A 3H9JA 2Z99A 2VQLA 5GAHJ 2ACJA 2E5NA 1JKQC 3RZDJ 1TBXA 2RDPA 1VQLI 1YRNB 3I56I 2E7WA 1ZH5A 1SFOJ 4DW6A 1IXCA 1UELB 3KEOA 3NEUA 3OYAA 2XAGA 3OYMA 3CO7C 3N05A 4BEHB 1U5TB 2EIKH 5D5VB 3N97A 1T39A 3CQZJ 4BQQA 3K69A 3GTLJ 1ZG3A 1FYMA 5BPIA 2MLKA 3VYRB 5K5QA 2Z33A 2ECCA 2OBPA 2WADA 4M3GA 2CG4A 4DBRA 3S3MA 3JREA 4IF4A 1Z67A 1C0WA 2P8TA 4NC8A 1YLFA 4B4CA 4CO8A 1FOKA 3CJTB 2VXZA 5B1BH 4F91B 1JGSA 3HHGA 1MBGA 4CYDA 4BBRJ 3E7LA 2DPDA 4XKWA 5HLIA 2ZJRF 3RZOJ 2UWMA 1L0OC 2DTZA 5IOZA 3CCUI 2RGVA 2M4KA 5EF6A 1TT0A 4JX6A 3MFKA 1XB4A 4ZJZA 1SFKA 3IKTA 2OV7A 4XLCA 3QP5A 3OYNA 4HF1A 2ELJA 3MZYA 1LDJA 2A61A 3WU0A 2OU2A 4HX7A 2VKHA 1LVAA 2DOEA 1LB2A 3OL3A 2A07F 4LLGF 3O6BB 4RLQA 1P7JA 2RN7A 2O03A 1MBFA 1YFHA 3ESWB 5BPDA 4KFCA 1X3ZB 2VKDA 2HR3A 3HOYJ 1TQMA 2QBYA 5B1AH 2Z16A 3A02A 5F0FA 4YFXF 3ASNH 3QP6A 5J4YA 4HF2A 1VQ4I 2FEZA 4Q48A 3SJMA 2X85A 4I98B 4M6YA 2E19A 4HG2A 3HGYA 2KJCA 4EV0A 4BGDA 2QCOA 4FCYA 2A6HF 2F6CA 4M9ZA 4N9HA 5CJ9A 2L3DA 2VN2A 1T98A 3PIPF 2X6OA 4IQJA 2R93J 2XKOA 4PZJA 1UZCA 3T1BA 1OYIA 1HDPA 3I4PA 3BCBA 4BHBA 2LF8A 4E7JA 3EQLF 2QBYB 3TO9A 5D4RA 1Z05A 3WE3A 3CCYA 3KZYA 2QEXI 4CHUA 2ESNA 2BV6A 2P5KA 2JUCA 1BJAA 3TP3A 4PK4A 3KFWX 3HOUJ 3OYKA 2O61A 2GIZA 2OZ6A 5DYMA 3J7AO 1PJRA 4HEA2 1UG0A 3LSJA 2PI0A 3F9KA 4F3QA 1XS9A 3E97A 2DFHA 2K27A 1P7IA 2Q1ZB 3KP2A 2YUSA 2DOAA 3X2QH 4IX7A 3HKZA 4M6VA 1I50J 2IS1A 4P9UA 1W1WE 3D1NI 4QIWN 3BG3A 2CV2A 4ZC3A 1ZTRA 1JT6A 2V9PA 2DK8A 2ICWG 1BW5A 4BACA 2XGCA 1R9TJ 2CFOA 1WH5A 3CCQI 2HKXA 3RI4A 4WF2A 2EFOA 3CLOA 1U8RA 2W25A 5F27A 1DQUA 2L9VA 3CJQB 3GEZA 3TDZC 5HDNA 2BXYA 2X1DA 4G94A 4WCGA 2XSDC 3KIOA 2NVYJ 3DFGA 1LUJB 1X4OA 3A4CA 4BYYA 2NXNB 4MQ9F 1XGMA 4P9FA 5FRMA 2EZIA 3GZ5A 4FQGA 1O3TA 1KGSA 2MA3A 2LBFA 2LF7A 3AL0C 3BPVA 3ZQIA 2DDBA 2X0LA 4CZCA 1KYWA 3HM5A 4A3MJ 2EFPA 1TC3C 2AS5F 2OZUA 3T0YA 2QKLB 1V5FA 4BXUA 1R36A 4A3LJ 4LD5A 5CVRA 1BI1A 4FTHA 2CW8A 1LFBA 2DMPA 4HV5A 2HKOA 4CCJA 4BE1A 1WGXA 2R7VA 2ZXWH 1GV2A 4WXHA 5F0HA 4H0EA 4KMFA 3I64A 4UUTA 3ZR8X 1I6HJ 1UHMA 3E1SA 3V8LA 4G8XA 4LK0F 3CMEI 2IA2A 5B3SH 3KP6A 1YTYA 3I5UA 5F08A 2F4IA 3KYDB 2K4JA 3EYIA 1OCZH 1OMIA 4AIJA 2LYCA 4A5NA 3KEYA 4EJWA 4A3DJ 2DMNA 4I7HA 2XV4S 3ZMDA 2P81A 5K1YA 3OYIA 2K4BA 3OYEA 1P92A 4GGGA 5EGOA 4HBLA 2R7UA 1BC8C 1TP4A 3BTCA 3W2VA 3ZMZA 3WHBA 5HLTA 3PSIA 5JHFA 4FT8A 3K10A 4IHYA 4E7KA 3CDHA 4XORA 4XKBA 3KYCB 5LD2C 2QQBA 1I3QJ 1TT5B 1XX5A 2MYSA 2XAUA 5CKTA 1I1SA 2IGNA 5FLXK 1R71A 1T95A 2DFEA 2Y0SN 3GXOA 1T38A 4YFKF 1TWHJ 1JJ6C 4AYBN 5LGTA 3HJEA 2EV5A 4HSTA 3QPHA 5EGOB 3LQQA 5C4XJ 3U21A 2CUJA 1G3WA 2OQGA 3FHNA 5JFRA 2FD5A 5IPAA 1J0RA 3CUQA 4L9JA 3KLOA 1NG6A 4C2MJ 3SYTA 3VEPA 1IUFA 1JTYA 1R22A 2X6XA 2B9SA 3KX2A 2NOJB 5D5WB 2B0LA 3RCOA 1DP7P 2FX0A 4DYQA 3ZPLA 2A5YB 3ZQGA 4CCMA 2D1VA 1T8IA 3UKGA 3ML6A 4RB1A 3RDIA 2I10A 3QODA 2JZYA 1LE8A 4A93J 3FWEA 2UZKA 5KAFC 1UHSA 3BLYA 3FIWA 5ED4A 3ISPA 3K4CA 1O3RA 3JSOA 1R58A 3F72A 3TBIA 1Y56A 3WGGA 4D0PA 3AAFA 4XN3A 4A0ZA 2K9MA 3IKVA 2JQ7A 4ZH4F 4R79A 1IV8A 1Y39A 2D1HA 1FT9A 3OR1C 4BXXJ 2EV6A 1FSEA 2KIQA 3FM3A 2WA0A 3MCZA 1YX3A 3MKLA 3O3KA 4YELA 5A2QK 1VQ8I 2V79A 2HNHA 3U2RA 1LE8B 4HX4A 1Z7LA 1V3FA 4L5IA 3GWZA 3VODA 1B72A 4KT6A 2HU9A 3RSNA 1KYZA 2HFHA 3HOTA 3AL0B 3GTMJ 2YX7A 5J1RA 5DCMA 2CQXA 2OPTA 1YG2A 4G7HF 1VZ0A 5LEJA 2P6TA 1X1AA 1ZYRF 3KP4A 2BOLA 3SZPA 2MH9A 1MDMB 1KU3A 1V5EA 4FHTA 2Z5UA 1GXPA 2PQ8A 4IQ4A 5FB2A 3M7GA 4LIUA 2HDWA 3CO6C 4HDVA 3TQNA 2M0MA 4HX8A 2NVQJ 3H1CA 3O2PE 1X2MA 4UNOA 1IRZA 3L2WA 1VQMI 1U78A 1RETA 2IAIA 3SEZA 1OCTC 2CMPA 2JJ7A 5D6FA 1N75A 4I99C 4JX5A 1U6GA 2AHQA 1CF7B 4XMYA 1OFCX 3IAS2 3PQJA 2C6YA 5DM7F 3EPZA 2LKSA 1W0UA 3FZVA 2XGDA 1P4XA 2K3PA 2VL8A 1L3LA 3S1NJ 2VJ5A 3WE2A 4E6KG 4BDZA 4BQAA 2NNYA 2ELHA 3CCEI 4IPAA 4ZYGA 2DA5A 2XIGA 3VFZA 4LJZF 3KZIC 2G7HA 2NAZA 2ZKZA 4QWQA 1B8IB 2K02A 1JE8A 1OKRA 2ECBA 3SFIA 3G4SI 1JHFA 5CVIA 3NARA 4PFPA 1B6AA 3K1PA 2E60A 1IV6A 1HXDA 2CW7A 3WTUC 2XAQA 4IHWA 3JR9A 2QZ8A 2V6EA 5EZGA 2FU4A 1ZARA 4OWRB 4P96A 3JTHA 1B1BA 3Q0UA 2WV1A 2RV8A 4FE4A 3GLXA 3FMSA 2R7OA 1YW8A 1SANA 2KKOA 4M3EA 1N78A 3J7AY 1G8XA 1TWFJ 2XGXA 1GXQA 3J7YJ 1E3OC 2KRFA 2CUEA 5DS9A 2ZFUA 2CQ7A 1QVTA 1WJAA 3M8EA 1OPCA 1KA8A 2ZXHA 2V1UA 1G4DA 3H3ZA 1FBQA 3F3XA 1EA3A 3IUOA 4A0YA 2MSYA 2Q0OA 1LDDA 4FISA 5D8LB 2HOTA 5GPAA 4KIFA 2HI3A 1PVEA 1JGGA 1Z1DA 5L3GA 4P55A 1ULYA 5LEKA 1IZ1A 3GFIA 2P4WA 1Y0NA 3ULQB 4S05A 3GMEA 4A2UA 4BHPA 3L1PA 3I0TA 4U88A 2KISA 4B47A 1W7PD 3DF8A 4N4OB 2RVCA 4EQQA 3E0JB 2OCEA 4HPQA 4ZDLA 3D5RC 1WJBA 3RKQA 3LMMA 2KIMA 2CV1A 3QYFA 4KJZA 2AO9A 2P5VA 3BROA 3TKYA 4YRVA 2VOOA 2V1DA 1Q1HA 4DZJA 2XHKA 2DDAA 3B73A 2HYJA 2P6SA 3Q9SA 3OMYA 3HSEA 3BG9A 4RM2A 5LGNA 2HQAA 3S16J 2F5VA 2GXGA 2GIVA 4A3EJ 4LLLA 3HOZJ 3S2DJ 2MH2A 5CQGA 4G6DA 1Y1WJ 4BE0A 2EZLA 4IL6C 2XVCA 3Q5FA 5FFZA 4C2TA 1MD0A 1R49A 3BJAA 3U1KA 2E2IJ 1S7OA 3HSRA 3HSFA 2M8EA 1HQCA 5JR3A 1VNDA 4KICA 1ODDA 3PO2J 2MBFA 4B1RA 1QZEA 1T6SA 2KFDA 4ESFA 1UJ8A 4XLHA 1LNWA 3TOBA 4M3FA 4AVZA 3K7AJ 2L01A 3BY6A 3MKYB 3I59A 5DTDA 4AIHA 3H36A 2JA5J 4HSRA 2VE8A 2JVGA 3VYTB 2QA4I 1MSEC 3H9GA 1ERDA 3FXUA 1HKTA 1FYKA 1POGA 3W2WA 3ZQLA 1TW3A 1HF0A 2CGPA 4N0BA 2HOSA 4GRIA 3GTJJ 1GUUA 4ETSA 1RI7A 2QSFX 3FDYA 2DQRA 3CCRI 1PUFB 1GDTA 1EH7A 1F4KA 5EZHA 4IRGA 3CTAA 3HOXJ 1Z6RA 2MD0A 3E3VA 1LVKA 3OV8A 1HA8A 1QHHD 2DJIA 1SMYF 1DU0A 2DA2A 4EM0B 4EJTA 4Y13A 1G2HA 2KLOA 4UY8I 4AU7A 3LSKA 2ZMEC 1MNDA 4R1HA 5BQTA 3IV5A 2X4HA 1YE9A 4E7HA 4GXOA 1HBXG 2KP6A 3CLQA 1X1PA 5LLQA 2CS3A 4Y7NJ 4PDKA 4Y17A 2GA1A 1MJAA 3S17J 5ILVA 1MMDA 3CCSI 4YIRX 3ZP5A 2KHMA 3VB2A 2XAJA 2DA3A 1WCMJ 4A0XA 2EWNA 1D5VA 2R7WA 1KU2A 1MNEA 5BMZA 2Y0SA 3H92A 1PP8F 2X48A 3O8GA 3ABLH 2QKMB 4G6TB 4RGRA 4KN4X 1O3QA 4AYBA 4KMUX 4XLEA 4R8HA 1WJEA 2L7FP 1XPXA 4QPOA 1F36A 3K9TA 4AC0A 4ZDOA 2DBBA 3RIRA 3W6KB 3JSPA 5D6EA 2R5ZB 2HS5A 3FK6A 2OF7A 1CQTA 4C2UA 2QVOA 3Q0VA 1K6YA 3FXQA 3OL4A 1PP7U 2MW8A 2E34A 4C3HJ 4IOCF 4YIFA 1D8JA 4MLOA 3G1LA 2NYXA 3G1OA 2HXIA 3VYUB 2HTJA 2CSOA 1Z3YA 1A36A 1ZN2A 2VT2A 4CA0A 1RC9A 2VJJA 3JRCA 2FBKA 1MH3A 4BDYA 4I2OA 2Q8KA 2FQ4A 5JVTA 1SD6A 1QRYA 1UG2A 5D4SA 3K1MA 1FOYA 2IS2A 1JUPA 4IVNA 4IXAA 3KZZA 2H27A 2W48A 1FTZA 2LRDA 1K83J 4PJLA 3F22A 4I0BA 2X6WA 2I5UA 3E5QA 3NWSA 3S1QJ 4A3CJ 4CCNA 4OIRF 4A3JJ 1FNNA 1MW7A 1H0MA 5LRSA 2PLYA 2LVSA 1R5HA 1I5ZA 2CU7A 5JLWA 2DCEA 3RKYA 1E2XA 3ZQFA 1LQ1A 1KQ9A 5ICEA 1LKXA 4XL9A 1BM9A 4UV9A 4AIKA 3ZQQA 1W0TA 1F43A 1FMVA 4ENJA 1ZRCA 1EJ9A 1WPKA 3P9KA 5FROA 1D5YA 3QWLA 4ITVA 1R4MB 4RGXA 4UUVA 3W6VA 1R5GA 2L02A 3AKZA 1MBKA 3MQ0A 1AHDP 3LSTA 2ZMEA 2KL4A 3HHHA 4ABZA 4I0AA 5F04A 2CJJA 3OIOA 1WRJA 2X9DA 4XRFA 4ZTJA 1IXRC 3LFUA 3HZJA 3OIPA 2QF7A 1BA5A 3OSGA 1YS6A 4LG0A 3T8TA 4A3BJ 2LREA 2VBXA 3L2VA 1IRGA 4M3DA 1LEAA 2Y0MA 3WODF 5JHUA 2LKPA 1MZBA 4BJ5C 3TP0A 4V19K 2E71A 5HVQC 5KCMA 3C7JA 1I3AA 1VI0A 4CCKA 2EH3A 5E3MA 2ZMEB 2IGKA 3PL8A 2QQAA 3ZQCA 5K5RA 3T8RA 3ROUA 2M45A 5BNGA 1BJZA 2V9VA 4A6DA 3FX3A 3GX4X 2QLZA 3OYLA 4LG0B 3F8CA 2PJRA 9ANTA 2L9SA 3KE2A 2LK2A 1JKRC 1HSTA 1A04A 2Z2SB 3DQVC 3OYHA 1ZQ3P 4WXDA 4PJJA 5M5WJ 2XGEA 3AG4H 1YIJI 2L54A 5D5UB 3HRSA 4QSHA 2YPRA 3DPTA 3BZ6A 3ASOH 4Z6YA 2Z9OA 4PJMA 3CMYA 3KP3A 1KZHA 3J7ZI 1DGWY 1IXSB 2F5EA 4I01A 5J8CA 2MGQA 4MFEA 5E79C 2PJRB 5FGMA 1W4MA 5F6FA 1R1UA 1WI3A 3LSMA 4DJAA 3L2UA 5FRNA 3F8BA 5KK1A 4XRSA 1WJ5A 3QPTA 4IRHA 4A3FJ 4RBOA 3E6DA 4XLNF 5CVVA 3DPLC 2G7UA 4XLAA 1JI8A 1QA6A 1O57A 3GLLA 2XRLA 2ZBKA 2KZVA 4LOCA 1P2FA 2E7XA 1BN5A 4Y15A 1YW9A 3ZN0A 2HQ5A 2PN6A 3AG1H 1FSHA 2W85A 5FLVA 3GZNB 3OYFA 3G1MA 3L9FA 4MNUA 1Z91A 2EZHA 2A6EF 4OOIA 2UXNA 4HQMA 2GM4A 1FBUA 3TW6A 4QPQA 3BPXA 1D1AA 1XSDA 2O9LA 2BY3A 3HBLA 2PBIA 4M9SA 2GOMA 2M8GX 5C3EJ 4LGWA 1WZ2A 1JT0A 2M0CA 4BXFA 3CUQC 1K7AA 3ABTA 2L9NA 1OISA 2HVQA 5KAIC 1FP2A 3L2QA 1X1CA 3HPHA 4G6QA 2EFNA 4ZZDA 2WAEA 4AM3A 3LQRA 4X6AJ 1QHGA 3DKYA 3BDDA 1HW1A 3OOPA 2OA4A 4BUPA 4FASD 4LB6B 1W36C 3FXJA 5ILSA 4CGZA 4HNUA 1VQOI 2XPWA 1JHHA 2VBWA 5ERIA 2CUFA 3MZHA 2LFBA 1X1DA 2WV0A 1RNLA 2UXXA 2IS6A 1XCBA 1FOWA 3HL2A 2R92J 2E1NA 2L7ZA 1VQKI 2F5CA 5M5XJ 4HW0A 1HC8A 2XAFA 4F7ZA 2W84A 4TV7A 5GTHC 3IC7A 3KYLA 1OYWA 2XF6A 1U2WA 3OWTA 2WC2A 4E7ZA 1V55H 2E2HJ 4KNYA 2STWA 3BG6A 3F6VA 2E1CA 4I02A 1J2XA 2L4AA 2CQQA 4E4HA 5CPRB 2R7DA 3ZCOA 5E1ZB 3U1DA 2LBFB 3CMAI 1KONA 4HOBA 2BHYA 2COMA 4XNFA 1MGTA 2WAFA 1VFCA 2HDDA 2NS0A 4CDGA 2FMLA 2Y30A 3OS2A 1NK3P 4LIVA 2MC3A 5IP7J 1S7AA 3DBRB 2AQEA 4AD9A 2NVXJ 2DMUA 1V54H 2DT6A 4CCLA 3BTLA 3S15J 5DUKA 4I76A 4O6JA 3LWFA 4B48A 1JUMA 2ZXJA 1BIBA 3ZQHA 2DYRH 5E17F 4ZYDA 1TLHB 2LDUA 1ITYA 2ZXIA 3BZKA 1H9GA 1IN7A 2EB7A 1YHQI 2IPQX 3R6SA 4LLNA 2G9WA 4BY7J 2XB5A 1WHUA 4BQNA 1TWCJ 4FX4A 1AWCA 2CRGA 2GA2A 3BG5A 5FKLA 2K85A 1ETYA 3BR1A 3FISA 3GCMA 1D0ZA 2KQRA 4A5MA 2FBIA 4L0YB 2EILH 2QWWA 2QGUA 2A3SA 2VB6A 3ZMSA 4RB0A 2BBYA 2DMTA 4XIDA 1B9NA 3CCJI 3HG9A 2F5FA 1RR8C 4O5VA 2EK5A 3GTOJ 3ECOA 3REOA 4ASNA 4U0WA 1N25A 2DA4A 4RB3C 1GVDA 4NB5A 4PUSA 5H20A 3DV8A 4XONA 3ZN1A 1YI2I 2VQHA 1MJ9A 2DW4A 3CUQB 1F5TA 1T56A 4HF0A 3RYRA 1K61A 1UAAA 3IWZA 1Z77A 3Q9VA 4RGSA 4A6EA 1BIAA 1GHCA 5H6QA 2HTSA 2ZJ2A 3MMYB 4NNJA 1KU7A 1LFPA 3WHCA 4HLXA 2VASA 2M7BA 4V2GA 2M34A 4ZZLA 1QNTA 2HXOA 3GF2A 1EF4A 1T2KA 3G2BA 4U7BA 2HOAA 3CCLI 3R4KA 3OS0A 2LC2A 3HTSB 2JMWA 3F8FA 4E70A 1SVOA 2IEKA 4KYWA 1YJ9I 2E36A 3WU2C 1H88C 1K4TA 3F21A 4J00A 4MGRA 4U7DA 1OCRH 3I53A 1OYYA 3S1RJ 4Q5SF 3FXOA 1WJCA 2HYFA 4L5JA 2FQ3A 1MIJA 4CSWA 2VUMJ 1IDYA 2LH9A 4S0HB 3DP7A 1S8NA 3GO5A 3G71I 1B72B 1BOBA 2JA6J 3H9QA 1ETKA 2M2EA 3K6GA 5KNLA 3KLNA 4RAYA 1Z9CA 1HW2A 3IP4B 5DCMB 3DCFA 5E8GA 4NC6A 3W6JB 5GAEJ 2FBHA 4IRIA 1WJFA 2W7NA 4G7ZF 3ZMTA 4PCQA 1J09A 2BY0A 4XRMA 1S7EA 3PJRA 3S93A 4QTRA 3HUGA 3RPUA 3HOWJ 2EINH 4I09A 1ZR2A 2XUBA 2XASA 4YIIA 1LFUP 2ELKA 2F4MB 3IL2A 3JRFA 3DTIA 1ZG5A 2R5YA 2PMUA 3K4BA 1WSUA 3G6EI 2KMUA 1X3UA 2DLLA 5LRRA 3HDDA 1GT0C 2RAEA 2ID6A 2HPIA 4Y52J 3K0LA 5TJJA 4YFNF 3ABMH 5J4VA 3WTTC 2AXLA 1YOVB 2STTA 1B59A 3O8HA 1I27A 1AA7A 4O3MA 1V4RA 3FMRA 4M6XA 1IJWC 4H4KC 1E0EA 3L2RA 3HUGB 2ADUA 5HDGA 1XTAA 5IYBJ 3JRDA 2VJ4A 4B43A 1BI3A 4PGGA 5IP9J 4I6ZA 4HYEA 5IT9K 2HGCA 1AKHA 5IOYA 1QGPA 2ISZA 1ONVA 4MTEA 3EUKL 2DXIA 2HOEA 1A31A 3NAUA 3CF2A 4E7IA 5KHDA 3QYBA 1MNMC 3SQNA 4B8XA 4HLYA 2EFWA 3SFZA 3I55I 4PSXA 3AG3H 4MEYF 3P7NA 1S5LC 3FF5A 4EVIA 2M3AA 5L3DA 1WI9A 1O7LA 4UHTA 1SC7A 2ZC2A 3E5UA 3R0AA 5LBQA 3V7CA 3QU6A 3COAC 5CYVA 3ABUA 3EUHC 2HVRA 2VPRA 1LJ9A 4WXCA 2XF7A 3MZ8A 1GV5A 2QSHX 1RESA 2M9HA 2BW3A 5F0CA 4L0ZB 3F0CA 3WTXC 2Q2EA 2R7TA 3HEFA 2XB0X 1J5YA 4BL0B 4XSZF 2WTEA 3W2AA 4WK8F 2ME0A 3DPUA 3GFLA 3KP7A 3M1CA 4XK4A 3RYPA 1B9MA 2ETHA 2VE9A 1P9QC 3V8KA 5HODA 2Z1DA 2FUG2 4P1WA 1U3EM 4XBFA 5TGTA 2K9SA 3S8PA 3E6CC 1IN6A 2J5OA 2B7EA 1W5TA 1T0FA 3HTUA 3FXKA 2LSOA 2Y9ZA 4BU2A 5HS9A 3H3UA 4UUSA 1ZGJA 3FHZA 3V4GA 2QSGX 2Q2EB 4PJNA 3UR3C 2EV0A 2XAHA 3ERED 1FC3A 2A69F 2KDOA 4P5OA 3L09A 4G12A 4F93B 4RAFA 5LHHA 3K70C 4RDUA 1B4AA 4BAYA 2XDVA 4Z2YA 4KITB 4EATA 1T33A 2PX9A 3KP5A 3KEQA 2D5VA 2P0WA 5LFAA 1PDNC 4XSXF 4UUSB 2LLKA 1ACIA 1DGRM 4UB8C 2PJPA 3F8NA 5EJCA 1J9IA 1J75A 1QU3A 2Y69H 2ZNYA 1R7JA 5HOOA 4XICA 3OYCA 3QPLA 1M1EB 4Q4ZF 1AU7A 4DQ2A 2D45A 1REPC 1TQPA 4RMNA 5IYDJ 1PYVA 1TNTA 5JVGF 2R7XA 3H5NA 3QOPA 2CQNA 3GYHX 3WTZA 1MJBA 3OYGA 5F64A 4IHSA 2H1KA 2H94A 4JBAA 2VLAA 4XQFA 1BR2A 4WWCA 2L4MA 4UVBA 4BQOA 4KISA 3C18A 4JX4A 1JJ8C 1D3YA 3A1YA 1MMNA 5M3MJ 2KRHA 3IH4A 4B3AA 4ZTFA 4PFOA 3I59B 2ZO4A 4GYIA 4DIQA 2WAQN 3K4KA 2QENA 2R3SA 1STZA 2ZNZA 2V4JC 3K2ZA 2O0YA 3EUHA 2JT1A 4U0VA 3OYBA 1RZ4A 2I8DA 2DO7A 1S3JA 2YU3A 4Y33A 1S72I 2QM3A 2PEXA 3ZGKA 5IT9Z 4D7NA 1R1TA 1USTA 2D2WA 3BQYA 4IEJA 4AWXB 4ZYEA 3N4MA 2TDXA 1D1CA 2O7OA 2Y9YA 1GVJA 2ESHA 4D7MA 4G9YA 1EV7A 2DFFA 3H5RA 2W82A 4MHGA 3CC2I 1WJDA 2OAZA 3PO3J 3RPQA 2E1MC 4Q47A 3D0SA 2PFBA 3HRTA 3CC7I 1YX5A 3QOEA 5EEHA 2IP2A 1FJLA 2OTJI 5IT3A 2BZTA 2Y75A 3LFKA 3W3CA 4M71A 1JXSA 2BVLA 5J1UA 4IO9F 3S14J 2IBDA 4N9IA 2NVTJ 2VQCA 5HLHA 3IRQA 1IAWA 2FMYA 3TMOA 1LPQA 3GVAA 3FM5A 1MSFC 1GLNA 4DZPA 2VPLA 1BW6A 2M87A 1BI2A 1NH3A 1D0XA 1JUSA 1XDSA 3HRUA 2WBMA 2DA6A 4LB5A 2KRCA 4C9YA 1HOMA 1NTCA 3LA2A 2A6TA 3MN2A 1Y8QB 5E3OA 4A12A 1MH4A 2DU9A 3CP2A 2Z3YA 2NNNA 1Y0UA 3A2KA 5DD4A 3JW4A 3CD6I 3OY9A 1WFXA 2P5LC 3EDPA 3OYJA 2QQ9A 1WWXA 3R61A 4LFUA 2EZKA 3V42A 5L3EA 2WB1N 2K9QA 3WTVC 2COBA 3FXMA 3M8FA 3RJPA 3I4NJ 3WGHA 4DBQA 2BEOA 3TL4X 5FD6A 3DKXA 2VODA 4PSWA 1EKEA 3FXLA 3C2HA 5HS7A 5L3CA 2GZWA 3WU1B 4EJUA 5K7ZA 3LA3A 3K4JA 2OUMA 1UHWA 5AONA 2LNBA 2XF5A 4M9XA 3HIFA 5J6XA 2MD5A 3DWLE 1HLVA 2DK5A 4E7SA 5LHIA 2ZJPF 1FBSA 3BR6A 3IAM2 1I39A 1OR7A 3K2AA 2DQLA 3R60A 4D5CA 5BS6A 1R00A 1VQPI 3M4OJ 4BBSJ 1X2NA 5FKKA 4D5FA 2N8GA 2R7RA 4BEHA 2DPUA 1U5TA 5D5XB 3WTSC 2DI3A 3HB9A 3GZ6A 3VOEA 5EEAA 2MC4A 2YU9J 3PSFA 3VPRA 3NQOA 3J80K 4IZZA 1IN5A 1IUYA 1S9HA 4NUBA 2MG4A 4L9TA 1VQ7I 2X1EA 2DFIA 2EIMH 4OAYA 3VSKA 3FXRA 4IHVA 2H6BA 4C3IJ 2ZB9A 2F4OB 4EM1A 1ZKGA 5TISC 4KA4A 1UB9A 3OOUA 3GW2A 2MABA 3DBHB 4XOTA 4M73A 3BJ6A 2W24A 5E1XA 4JYKA 2P7CB 1DP3A 2M30A 1RRJA 4ENMA 2DYSH 4CZZA 1YJNI 3LAPA 5FD5A 1FZPB 4FE7A 5E8IA 3LL7A 2XROA 2Y2ZA 2JPBA 4IJAA 2RC4A 1VQ9I 3NRVA 3CESA 4OAZA 2E1MB 1QZYA 4PGHA 1SD4A 3VYSB 1HKQA 3Q3SA 3OS1A 4ESBA 3BTIA 3V8JA 3H35A 3JTGA 1RPWA 1VQNI 1X4PA 3CZ6A 2W57A 2NS7A 3BC8A 1U8BA 5J40A 5GAGJ 4RLFA 1SEUA 1IRXA 5E20A 4C30A 1WKMA 2H09A 3IWFA 1IG7A 3OSFA 1TZLA 1MMGA 4KIGA 4U87A 5CVJA 2H1LA 3M8JA 2PMZN 1BI0A 2IW5A 3T5XA 2VBYA 1VTNC 1ZGWA 4CICA 4BE2A 3DLAA 2IRFG 3DEEA 4DNCA 1QZZA 3DXJF 4QLCU 4MIMA 1XSVA 3I71A 5F1JA 2ID3A 4WX9A 2H6CA 4A3IJ 2GXBA 5DD8A 1OCPA 4M74A 4LK1F 4NC7A 4YG2F 1HSJA 3MEXA 3K4LA 2EA4A 2E1OA 1N77A 4LMYA 2V7FA 3JRAA 4UVCA 2X6YA 2K3FA 2R7SA 5J1YA 3S2WA 1HDDC 1MBHA 3V7SA 3DBLB 2GLOA 2VKVA 2L5QA 1UCRA 2XC7A 1Y1VJ 3PIOF 1SD7A 2J5PA 3TO7A 4DYCA 2JA7J 2WY7Q 4RAZA 1U9NA 1D0YA 2P7VB 3BOQA 5GTIC 2EIJH 2JVHA 2HZTA 3RKXA 3FKJA 3TOAA 1XMKA 2DTRA 1H8AC 1OLTA 1DPRA 3FK7A 2BVMA 1KQ8A 2HYGD 5J8FA 2LP0A 5F1RA 1DPUA 2QUFA 3CMMA 3C2BA 2WWYA 1Z7UA 3TO6A 2IJLA 1G59A 1SAUA 3VWBA 4OMYA 5DDGA 3E6MA 3SHFA 5K7FA 1RKWA 2TRTA 1Q1VA 2LKXA 3LSRA 5DM6F 1A5JA 1XN7A 2KJBA 4X1EA 3DU5A 1G3SA 3CJRB 4FETA 1JKOC 3M07A 1XD7A 2RQQA 2YS9A 2B63J 2K9NA 3OIQA 4B3XA 3J80Z 2IS4A 4UXNA 3LNQA 2FA5A 2DT5A 5B5EC 4E7LA 1MBJA 3Q0WA 5M5YJ 3B6AA 2JSPA 2GAUA 5CQEA 4YEJA 4L5EA 4XN0A 1J59A 1YYVA 1YIOA 2YX4A 3F23A 2VJIA 3FBIB 4NDLA 4BJ6C 1DU6A 1XSXA 4F55A 1XMXA 2H8RA 4OMZA 1IC8A 3FMQA 3ZOBA 2FXAA 2LG4A 1OQYA 2E35A 1FEXA 2VXDA 3BZCA 4RM3A 3M3YJ 3CJNA 5C4JJ 3RKWA 3TGNA 2WAQA 2YR2A 4RAGA 4AVPA 2K40A 3S3OA 1V5GA 2VC0A 1IGNA 1FPQA 2EBIA 2JUGA 5FKMA 1BOAA 1WVRA 2LD5A 1G3TA 1XG1A 2A68F 3AFHA 2DODA 2HPMA 3V7RA 2OTLI 4MQVA 4K2EA 3S32A 1DDNA 4XM3A 4NHJA 1TW2A 2LMDA 1W36D 2IGMA 2CYYA 3QU3A 2Y48A 2JA2A 1ORKA 3E6BA 2M7AA 3ERMA 1T08B 4EM2A 2O5RA 1RR7A 2K7LA 5J47A 2DA1A 2VIXA 3FBNB 2JPCA 2VBZA 2UV1A 1WH7A 2R7QA 4U0YA 5K5OA 3LA7A 4B44A 1P4WA 2CV0A 3BR0A 5HDKA 2F2EA 1X19A 5HNHA 2EJRA 1UFMA 3MAJA 4NBQA 1BL0A 4HQEA 3BCAA 2NRAC 1VQ5I 2HZDA 5IP6A 3SZTA 4MEXF 4CYCA 3HOSA 4OIQF 1SFUA 3KCCA 1TTYA 3CC4I 2L7KA 3JRGA 1U0JA 4L18B 1IW7F 1R6RA 3JCUC 2IA1A 4A3GJ 2XRNA 4ENKA 4IOAF 1HW5A 1XMAA 2CW0F 1FMWA 3GTQJ 3G3ZA 4HV6A 3JAMK 1D8KA 2AXTC 2VT3A 2ZCWA 4A3KJ 1R1VA 4GYGA 2QQ8A 2V6CA 3EYYA 3LOCA 1EH8A 3A03A 1FTTA 1O7FA 4CYCB 1ZRDA 3ONQA 3WG7H 2W1OA 1ETWA 4B09A 4JP0A 5ICFA 3PFYA 2L9RA 3BJOA 3JRIA 2JN6A
chains in the Genus database with same CATH topology
4UUSA 4A69C 2W48A 1FTZA 1P7IA 1K83J 3BTJA 2YUSA 4M6VA 1I50J 3CDLA 3S1QJ 4A3CJ 1ZR4A 4G12A 3D1NI 4QIWN 2EQRA 4A3JJ 3BG3A 1ZTRA 2LY9A 1JT6A 2LVSA 4RDUA 1BW5A 2CU7A 5JLWA 2XGCA 3BR3A 1R9TJ 1WH5A 1T33A 3ZQFA 3HGGA 1F43A 1W0TA 1OJLA 5F27A 2D5VA 1ETXA 2XSDC 2NVYJ 1WPKA 2DMQA 4UUSB 2LLKA 2R0QC 1D5YA 4IHXA 2EZIA 3W6VA 1MBKA 1AHDP 5FKOA 4ABZA 4XICA 1AU7A 3QPLA 1ZK8A 3ZQIA 5F04A 2CJJA 5E3LA 2TCTA 3OIOA 3BQZA 5IYDJ 2X9DA 3HM5A 3GTPJ 4A3MJ 1TC3C 2XPVA 2QF7A 1BA5A 3OSGA 4A3LJ 5FKNA 1B8IA 2H1KA 4A3BJ 3IH3A 4M3DA 4FTHA 1LFBA 2DMPA 4JX4A 3TP0A 1JJ8C 1VF9A 1WGXA 1GV2A 5F0HA 1VI0A 2EH3A 4UUTA 5E3MA 5M3MJ 1I6HJ 3IH4A 4B3AA 3BR5A 3ZQCA 5FJ8J 1U9OA 2WAQN 5F08A 1XS9A 5BNGA 1BJZA 2JK3A 1JTXA 3RQIA 4EEFG 4A3DJ 2DMNA 4M3BA 2P81A 9ANTA 2KT0A 2R5YB 5EGOA 2LK2A 2LTPA 4D7NA 1JKRC 3BTCA 3WHBA 3BQYA 4IEJA 4IHYA 1UMQA 1ZQ3P 2O7OA 2Y9YA 2Y9ZA 2O8KA 1X58A 5M5WJ 2XGEA 4D7MA 1I3QJ 4QSHA 3PO3J 3CMYA 2Y0SN 1TWHJ 1JJ6C 2KDZA 1FJLA 2MGQA 4AYBN 4MFEA 5C44J 4XRSG 5M3FJ 2L0KA 5EGOB 1WI3A 5J1UA 1AKHB 3S14J 5C4XJ 2IBDA 2NVTJ 4XRSA 3B6CA 2FD5A 1ETVA 5IPAA 4A3FJ 1MBEA 4RBOA 1ETOA 4W1UA 4C2MJ 1MSFC 4DZPA 1BW6A 5EG0A 1IUFA 3SDGA 1JTYA 1JUSA 2XRLA 2VKEA 1NK2P 2DA6A 2FX0A 4DYQA 1HOMA 4LOCA 3ZQGA 1NTCA 5EDNA 3MN2A 3UKGA 2HQ5A 5E3OA 3GBGA 2I10A 1MH4A 1LE8A 3I4MJ 5FLVA 4A93J 1UHSA 3FIWA 3G1MA 2EZHA 2GM4A 2E2JJ 3TW6A 1H89C 1QVUA 1FIAA 2O9LA 3HBLA 5E3NA 2M8GX 5C3EJ 1JT0A 2M0CA 1Z0XA 2G0EA 2EZKA 5EG0B 2WB1N 2K9QA 3I4NJ 2COBA 2NOGA 4C3JJ 3HKZN 4BXXJ 3MKLA 5EYRA 4X6AJ 5K7ZA 3JRHA 4MO7A 1LE8B 3S2HJ 3A01A 1HLVA 1RKTA 1B72A 3GTGJ 1JKPC 2XPWA 3GTMJ 3BR6A 3K2AA 4D5CA 5J1RA 2CQXA 2OPTA 2CUFA 2FJ1A 5IYCJ 1APLC 3M4OJ 4BBSJ 2LFBA 2R7ZJ 1X2NA 5FKKA 4D5FA 2N8GA 1TWGJ 2R92J 2L7ZA 3HB9A 4W97A 5M5XJ 5EEAA 3QPSA 2YU9J 1HCRA 3LSPA 1ETQA 2VI6A 1PUFA 2NVQJ 3VPRA 4V2FA 1X2MA 1IRZA 4J19A 3A01B 3DEWA 2MG4A 1RETA 4AUXA 1U78A 2IAIA 2E2HJ 1OCTC 2JJ7A 4JX5A 2AHQA 2CQQA 4IHVA 4C3IJ 1OFCX 2ZB9A 5FLMJ 1ZKGA 3TEDA 3OOUA 4DYRA 3IH2A 3HOVJ 1W0UA 2XGDA 3LSGA 3BR2A 2DN0A 5JLXA 1VFCA 4JYKA 2HDDA 3S1NJ 5J3LA 2JA8J 2Y30A 1NK3P 2GBYA 2DA5A 5IP7J 2NS8A 3TW7A 4FE7A 1B8IB 2NVXJ 2ECBA 2DMUA 2Y2ZA 3SFIA 1O4XA 3BTLA 4BY1J 3NARA 3S15J 4I76A 1IV6A 1JUMA 2XPUA 4IHWA 3ZQHA 3JR9A 2DJNA 3Q3SA 5EZGA 1ITYA 3BTIA 1RPWA 3Q0UA 4MFDA 2WV1A 2NS7A 1U8BA 4FE4A 4HNVA 5GPCA 4BY7J 1SANA 2XB5A 1FIPA 4M3EA 2R5ZA 1IG7A 3OSFA 1TWFJ 1TWCJ 2CRGA 3BG5A 5FKLA 3FISA 1ETYA 3BR1A 3H3VK 2PMZN 1E3OC 2CUEA 2ME6A 1ZGWA 5DS9A 1QVTA 4MIMA 3JRBA 2JWTA 2MSYA 3H0GJ 1A6IA 5F1JA 2DMTA 2ID3A 4A3IJ 4FISA 1OCPA 2HOTA 4XIDA 5GPAA 4GFBA 2HI3A 2Y31A 1JGGA 2E1OA 1QPIA 3GTOJ 3JRAA 2L7MP 1TWAJ 5J1YA 1HDDC 2DA7A 1MBHA 2DA4A 3L1PA 1GVDA 3FKIJ 2GLOA 3BT9A 3GTKJ 2VKVA 1Y1VJ 4BKXA 3PM1A 5K7HA 4DYCA 2JA7J 1T56A 1K61A 3RKQA 1U9NA 1Z77A 2AO9A 3MVPA 3S1MJ 3WHCA 4V2GA 2M34A 5GP9A 1H8AC 2HXOA 1EF4A 3FK7A 1ENHA 4DZJA 2HOAA 2LP0A 2LR8A 3QQAA 1YRNA 2HYJA 3C2BA 1XC5A 2JMWA 3S16J 3BG9A 2IEKA 5K7FA 1RKWA 2TRTA 4A3EJ 3HOZJ 1Q1VA 2LKXA 1H88C 3S2DJ 3LSRA 1Y1WJ 1A5JA 2EZLA 4X1EA 1IDZA 1JKOC 3S1RJ 2YS9A 2E2IJ 1JKQC 2B63J 2K9NA 3RZDJ 2VUMJ 1VNDA 1IDYA 3LNQA 4S0HB 1YRNB 1B72B 3PO2J 2JA6J 1ETKA 2M2EA 4B1RA 1SFOJ 4DW6A 1MBJA 3Q0WA 3DCFA 4M3FA 5M5YJ 3B6AA 3K7AJ 5DTDA 4L5EA 2JA5J 1MSEC 3CQZJ 1POGA 1S7EA 4XRMA 3ZQLA 1HF0A 2HOSA 3GTLJ 4QTRA 4NDLA 3GTJJ 3HOWJ 1GUUA 1DU6A 1ZR2A 2ECCA 1PUFB 1GDTA 2H8RA 1LFUP 4M3GA 2ELKA 1IC8A 3ZOBA 5EZHA 3JRFA 3JREA 3HOXJ 2R5YA 4B4CA 1FEXA 1MBGA 3M3YJ 3HDDA 4BBRJ 5C4JJ 1GT0C 2RAEA 2ID6A 3E7LA 4Y52J 2K40A 1DU0A 2DA2A 1IGNA 3RZOJ 2EBIA 5FKMA 5IOZA 2DTZA 1G2HA 3O8HA 2LD5A 1XG1A 1IJWC 5EF6A 4JX6A 3IV5A 4Y7NJ 5IYBJ 3JRDA 3S17J 5IP9J 4I6ZA 1AKHA 5IOYA 1ORKA 3NAUA 2DA3A 1RR7A 1WCMJ 2DA1A 1P7JA 1WH7A 1MNMC 1MBFA 2X48A 3BR0A 3HOYJ 3O8GA 3A02A 5F0FA 2L7FP 1BL0A 1F36A 4AC0A 3SJMA 5IP6A 2R5ZB 1CQTA 4CYCA 3FK6A 2E19A 2OF7A 3HGYA 2VPRA 2QCOA 3Q0VA 3JRGA 4FCYA 1GV5A 1RESA 2M9HA 2MW8A 4C3HJ 4A3GJ 5F0CA 2X6OA 3F0CA 2R93J 3HEFA 3GTQJ 4MLOA 3G1LA 2XB0X 3G1OA 2HXIA 1HDPA 2ME0A 4A3KJ 4XK4A 3CCYA 3LOCA 3A03A 5HODA 3JRCA 1FTTA 3TP3A 1MH3A 4CYCB 2K9SA 3HOUJ 1ETWA 2FQ4A 1UG2A 1QRYA 4JP0A 3LSJA 2L9RA 3JRIA 2JN6A 1JUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUS A;  4A69 C;  2W48 A;  1FTZ A;  1P7I A;  1K83 J;  3BTJ A;  2YUS A;  4M6V A;  1I50 J;  3CDL A;  3S1Q J;  4A3C J;  1ZR4 A;  4G12 A;  3D1N I;  4QIW N;  2EQR A;  4A3J J;  3BG3 A;  1ZTR A;  2LY9 A;  1JT6 A;  2LVS A;  4RDU A;  1BW5 A;  2CU7 A;  5JLW A;  2XGC A;  3BR3 A;  1R9T J;  1WH5 A;  1T33 A;  3ZQF A;  3HGG A;  1F43 A;  1W0T A;  1OJL A;  5F27 A;  2D5V A;  1ETX A;  2XSD C;  2NVY J;  1WPK A;  2DMQ A;  4UUS B;  2LLK A;  2R0Q C;  1D5Y A;  4IHX A;  2EZI A;  3W6V A;  1MBK A;  1AHD P;  5FKO A;  4ABZ A;  4XIC A;  1AU7 A;  3QPL A;  1ZK8 A;  3ZQI A;  5F04 A;  2CJJ A;  5E3L A;  2TCT A;  3OIO A;  3BQZ A;  5IYD J;  2X9D A;  3HM5 A;  3GTP J;  4A3M J;  1TC3 C;  2XPV A;  2QF7 A;  1BA5 A;  3OSG A;  4A3L J;  5FKN A;  1B8I A;  2H1K A;  4A3B J;  3IH3 A;  4M3D A;  4FTH A;  1LFB A;  2DMP A;  4JX4 A;  3TP0 A;  1JJ8 C;  1VF9 A;  1WGX A;  1GV2 A;  5F0H A;  1VI0 A;  2EH3 A;  4UUT A;  5E3M A;  5M3M J;  1I6H J;  3IH4 A;  4B3A A;  3BR5 A;  3ZQC A;  5FJ8 J;  1U9O A;  2WAQ N;  5F08 A;  1XS9 A;  5BNG A;  1BJZ A;  2JK3 A;  1JTX A;  3RQI A;  4EEF G;  4A3D J;  2DMN A;  4M3B A;  2P81 A;  9ANT A;  2KT0 A;  2R5Y B;  5EGO A;  2LK2 A;  2LTP A;  4D7N A;  1JKR C;  3BTC A;  3WHB A;  3BQY A;  4IEJ A;  4IHY A;  1UMQ A;  1ZQ3 P;  2O7O A;  2Y9Y A;  2Y9Z A;  2O8K A;  1X58 A;  5M5W J;  2XGE A;  4D7M A;  1I3Q J;  4QSH A;  3PO3 J;  3CMY A;  2Y0S N;  1TWH J;  1JJ6 C;  2KDZ A;  1FJL A;  2MGQ A;  4AYB N;  4MFE A;  5C44 J;  4XRS G;  5M3F J;  2L0K A;  5EGO B;  1WI3 A;  5J1U A;  1AKH B;  3S14 J;  5C4X J;  2IBD A;  2NVT J;  4XRS A;  3B6C A;  2FD5 A;  1ETV A;  5IPA A;  4A3F J;  1MBE A;  4RBO A;  1ETO A;  4W1U A;  4C2M J;  1MSF C;  4DZP A;  1BW6 A;  5EG0 A;  1IUF A;  3SDG A;  1JTY A;  1JUS A;  2XRL A;  2VKE A;  1NK2 P;  2DA6 A;  2FX0 A;  4DYQ A;  1HOM A;  4LOC A;  3ZQG A;  1NTC A;  5EDN A;  3MN2 A;  3UKG A;  2HQ5 A;  5E3O A;  3GBG A;  2I10 A;  1MH4 A;  1LE8 A;  3I4M J;  5FLV A;  4A93 J;  1UHS A;  3FIW A;  3G1M A;  2EZH A;  2GM4 A;  2E2J J;  3TW6 A;  1H89 C;  1QVU A;  1FIA A;  2O9L A;  3HBL A;  5E3N A;  2M8G X;  5C3E J;  1JT0 A;  2M0C A;  1Z0X A;  2G0E A;  2EZK A;  5EG0 B;  2WB1 N;  2K9Q A;  3I4N J;  2COB A;  2NOG A;  4C3J J;  3HKZ N;  4BXX J;  3MKL A;  5EYR A;  4X6A J;  5K7Z A;  3JRH A;  4MO7 A;  1LE8 B;  3S2H J;  3A01 A;  1HLV A;  1RKT A;  1B72 A;  3GTG J;  1JKP C;  2XPW A;  3GTM J;  3BR6 A;  3K2A A;  4D5C A;  5J1R A;  2CQX A;  2OPT A;  2CUF A;  2FJ1 A;  5IYC J;  1APL C;  3M4O J;  4BBS J;  2LFB A;  2R7Z J;  1X2N A;  5FKK A;  4D5F A;  2N8G A;  1TWG J;  2R92 J;  2L7Z A;  3HB9 A;  4W97 A;  5M5X J;  5EEA A;  3QPS A;  2YU9 J;  1HCR A;  3LSP A;  1ETQ A;  2VI6 A;  1PUF A;  2NVQ J;  3VPR A;  4V2F A;  1X2M A;  1IRZ A;  4J19 A;  3A01 B;  3DEW A;  2MG4 A;  1RET A;  4AUX A;  1U78 A;  2IAI A;  2E2H J;  1OCT C;  2JJ7 A;  4JX5 A;  2AHQ A;  2CQQ A;  4IHV A;  4C3I J;  1OFC X;  2ZB9 A;  5FLM J;  1ZKG A;  3TED A;  3OOU A;  4DYR A;  3IH2 A;  3HOV J;  1W0U A;  2XGD A;  3LSG A;  3BR2 A;  2DN0 A;  5JLX A;  1VFC A;  4JYK A;  2HDD A;  3S1N J;  5J3L A;  2JA8 J;  2Y30 A;  1NK3 P;  2GBY A;  2DA5 A;  5IP7 J;  2NS8 A;  3TW7 A;  4FE7 A;  1B8I B;  2NVX J;  2ECB A;  2DMU A;  2Y2Z A;  3SFI A;  1O4X A;  3BTL A;  4BY1 J;  3NAR A;  3S15 J;  4I76 A;  1IV6 A;  1JUM A;  2XPU A;  4IHW A;  3ZQH A;  3JR9 A;  2DJN A;  3Q3S A;  5EZG A;  1ITY A;  3BTI A;  1RPW A;  3Q0U A;  4MFD A;  2WV1 A;  2NS7 A;  1U8B A;  4FE4 A;  4HNV A;  5GPC A;  4BY7 J;  1SAN A;  2XB5 A;  1FIP A;  4M3E A;  2R5Z A;  1IG7 A;  3OSF A;  1TWF J;  1TWC J;  2CRG A;  3BG5 A;  5FKL A;  3FIS A;  1ETY A;  3BR1 A;  3H3V K;  2PMZ N;  1E3O C;  2CUE A;  2ME6 A;  1ZGW A;  5DS9 A;  1QVT A;  4MIM A;  3JRB A;  2JWT A;  2MSY A;  3H0G J;  1A6I A;  5F1J A;  2DMT A;  2ID3 A;  4A3I J;  4FIS A;  1OCP A;  2HOT A;  4XID A;  5GPA A;  4GFB A;  2HI3 A;  2Y31 A;  1JGG A;  2E1O A;  1QPI A;  3GTO J;  3JRA A;  2L7M P;  1TWA J;  5J1Y A;  1HDD C;  2DA7 A;  1MBH A;  2DA4 A;  3L1P A;  1GVD A;  3FKI J;  2GLO A;  3BT9 A;  3GTK J;  2VKV A;  1Y1V J;  4BKX A;  3PM1 A;  5K7H A;  4DYC A;  2JA7 J;  1T56 A;  1K61 A;  3RKQ A;  1U9N A;  1Z77 A;  2AO9 A;  3MVP A;  3S1M J;  3WHC A;  4V2G A;  2M34 A;  5GP9 A;  1H8A C;  2HXO A;  1EF4 A;  3FK7 A;  1ENH A;  4DZJ A;  2HOA A;  2LP0 A;  2LR8 A;  3QQA A;  1YRN A;  2HYJ A;  3C2B A;  1XC5 A;  2JMW A;  3S16 J;  3BG9 A;  2IEK A;  5K7F A;  1RKW A;  2TRT A;  4A3E J;  3HOZ J;  1Q1V A;  2LKX A;  1H88 C;  3S2D J;  3LSR A;  1Y1W J;  1A5J A;  2EZL A;  4X1E A;  1IDZ A;  1JKO C;  3S1R J;  2YS9 A;  2E2I J;  1JKQ C;  2B63 J;  2K9N A;  3RZD J;  2VUM J;  1VND A;  1IDY A;  3LNQ A;  4S0H B;  1YRN B;  1B72 B;  3PO2 J;  2JA6 J;  1ETK A;  2M2E A;  4B1R A;  1SFO J;  4DW6 A;  1MBJ A;  3Q0W A;  3DCF A;  4M3F A;  5M5Y J;  3B6A A;  3K7A J;  5DTD A;  4L5E A;  2JA5 J;  1MSE C;  3CQZ J;  1POG A;  1S7E A;  4XRM A;  3ZQL A;  1HF0 A;  2HOS A;  3GTL J;  4QTR A;  4NDL A;  3GTJ J;  3HOW J;  1GUU A;  1DU6 A;  1ZR2 A;  2ECC A;  1PUF B;  1GDT A;  2H8R A;  1LFU P;  4M3G A;  2ELK A;  1IC8 A;  3ZOB A;  5EZH A;  3JRF A;  3JRE A;  3HOX J;  2R5Y A;  4B4C A;  1FEX A;  1MBG A;  3M3Y J;  3HDD A;  4BBR J;  5C4J J;  1GT0 C;  2RAE A;  2ID6 A;  3E7L A;  4Y52 J;  2K40 A;  1DU0 A;  2DA2 A;  1IGN A;  3RZO J;  2EBI A;  5FKM A;  5IOZ A;  2DTZ A;  1G2H A;  3O8H A;  2LD5 A;  1XG1 A;  1IJW C;  5EF6 A;  4JX6 A;  3IV5 A;  4Y7N J;  5IYB J;  3JRD A;  3S17 J;  5IP9 J;  4I6Z A;  1AKH A;  5IOY A;  1ORK A;  3NAU A;  2DA3 A;  1RR7 A;  1WCM J;  2DA1 A;  1P7J A;  1WH7 A;  1MNM C;  1MBF A;  2X48 A;  3BR0 A;  3HOY J;  3O8G A;  3A02 A;  5F0F A;  2L7F P;  1BL0 A;  1F36 A;  4AC0 A;  3SJM A;  5IP6 A;  2R5Z B;  1CQT A;  4CYC A;  3FK6 A;  2E19 A;  2OF7 A;  3HGY A;  2VPR A;  2QCO A;  3Q0V A;  3JRG A;  4FCY A;  1GV5 A;  1RES A;  2M9H A;  2MW8 A;  4C3H J;  4A3G J;  5F0C A;  2X6O A;  3F0C A;  2R93 J;  3HEF A;  3GTQ J;  4MLO A;  3G1L A;  2XB0 X;  3G1O A;  2HXI A;  1HDP A;  2ME0 A;  4A3K J;  4XK4 A;  3CCY A;  3LOC A;  3A03 A;  5HOD A;  3JRC A;  1FTT A;  3TP3 A;  1MH3 A;  4CYC B;  2K9S A;  3HOU J;  1ETW A;  2FQ4 A;  1UG2 A;  1QRY A;  4JP0 A;  3LSJ A;  2L9R A;  3JRI A;  2JN6 A;  1JUP A; 
#chains in the Genus database with same CATH topology
 5ICC A;  4A69 C;  3SXY A;  3L2C A;  4G7O F;  1OCC H;  2WB1 A;  4D9J A;  4KIB A;  3BTJ A;  5LGU A;  3BWG A;  3VDX A;  5H2F C;  2V26 A;  1IN4 A;  1E3H A;  4KN7 X;  3CDL A;  1ZR4 A;  2X51 A;  2EQR A;  4XLF A;  5B66 C;  1MDM A;  4EJV A;  1Z6T A;  2LY9 A;  2ISY A;  1XGN A;  3BR3 A;  1K6O A;  1YIT I;  2KIF A;  3HGG A;  1E3P A;  2F5D A;  1OJL A;  3RPU D;  1TL8 A;  1ETX A;  1XCV A;  2MFZ A;  5L3B A;  2BGC A;  2DMQ A;  1S6L A;  4LIT A;  4N4N B;  2R0Q C;  5EEG A;  1SVM A;  1CF7 A;  1LEB A;  5CVU A;  1T0F C;  4IHX A;  1USS A;  1NG7 A;  4CH7 A;  4HA8 A;  3MKZ A;  1F9N A;  3C3W A;  5IY5 H;  2K9L A;  5FKO A;  1XGO A;  2O3F A;  1ZRF A;  3SZG A;  1SFX A;  2K5C A;  1ZK8 A;  4HNT A;  3WTW C;  3IHU A;  2IT0 A;  4L9V A;  5GAD J;  1P4A A;  1ON1 A;  2TCT A;  4GCV A;  5E3L A;  3BQZ A;  3GTP J;  1OCO H;  2HEO A;  2FNP A;  4KDP A;  2XPV A;  4F52 A;  5FKN A;  1B8I A;  1O3S A;  1RUN A;  3IH3 A;  4OIP F;  4IHT A;  3PNT A;  5ILU A;  2CUZ A;  2GOX B;  2LY2 A;  1MKM A;  3DTK A;  1H9T A;  1VF9 A;  2M4G A;  4IKF A;  3ECH A;  5HNF A;  2DOF A;  3DU6 A;  2LY1 A;  4OIO F;  2UUZ A;  3BR5 A;  4CCO A;  5FJ8 J;  1U9O A;  3KET A;  3QRF F;  2EPF A;  1R23 A;  4EMS A;  2GWR A;  1TQI A;  2JK3 A;  2BY1 A;  2V9K A;  1JTX A;  3CCM I;  3RQI A;  4EEF G;  4M3B A;  1PUE E;  3ZMU A;  1BR4 A;  2HDC A;  1ZHF A;  2KT0 A;  2R5Y B;  1Y6I A;  3VSL A;  2LTP A;  4EGY A;  4BJT A;  4CXF A;  1I1G A;  2IA0 A;  2CFX A;  2FOK A;  2V1N A;  3RTR A;  1UMQ A;  2O8K A;  3ABK H;  1X58 A;  4ANJ A;  4BNC A;  4D1Q A;  4FX0 A;  3K1N A;  4XKV A;  1IRF A;  5FLX Z;  3F6O A;  2CO5 A;  3A0H C;  2W4S A;  3DKW A;  4XR6 A;  3CP8 A;  2KDZ A;  2CQK A;  2PMZ A;  5C44 J;  4XRS G;  5M3F J;  5D8K B;  2L0K A;  2OC6 A;  1IO2 A;  3OYD A;  1AKH B;  1QO0 D;  4Y3O A;  5AIQ A;  3B6C A;  2VOP A;  2ZFW A;  1ETV A;  2M1B A;  3C2G A;  3WGI A;  1MBE A;  1SFE A;  1FLI A;  3PUF A;  1ETO A;  1R5I D;  3MD2 A;  1Z3X A;  2A5W A;  4W1U A;  3SEQ A;  5ICG A;  3H5A A;  2KPM A;  2OJE D;  3JAM Z;  1ZAO A;  2FSW A;  2V1X A;  5EG0 A;  3SDG A;  3EUA A;  2VKE A;  3DLL F;  1NK2 P;  4UB6 C;  4II3 A;  4HZF A;  2JRT A;  4DOZ A;  1NHA A;  2K86 A;  1AOY A;  4KT5 C;  2VC1 A;  5EDN A;  1EH6 A;  3GBG A;  3I54 A;  2DT7 B;  2JSC A;  3I4M J;  1A6Q A;  2A05 A;  4KUM A;  2BW3 B;  4NQW A;  2E2J J;  1H89 C;  3NWT A;  4PJ0 C;  3HYI A;  1QVU A;  1R4N B;  1FIA A;  3ZRG A;  2O8X A;  5E3N A;  3K4M A;  2CWE A;  3HXL A;  1D1B A;  5L3F A;  3J81 K;  3RQ4 A;  1Z0X A;  2G0E A;  2H8W A;  3U9G A;  4XOP A;  5EG0 B;  1IF1 A;  2NOG A;  4C3J J;  1YQA A;  3HKZ N;  3K4N A;  2QYO A;  4XKC A;  3HPG A;  5E18 F;  1FX7 A;  1G6N A;  5EYR A;  3ZQ7 A;  1WQ2 A;  2BYV E;  3C1D A;  3JRH A;  3S3N A;  2PMH A;  5A2Q Z;  1HKS A;  4MO7 A;  3S2H J;  2LOO A;  5H6R A;  2NVU B;  3A01 A;  3QAH A;  3CDI A;  1FYL A;  1W7P A;  2X1C A;  1RKT A;  1CGP A;  2FE3 A;  1BBY A;  2RKH A;  4NQW B;  4BH9 A;  3GTG J;  1P6R A;  2WY8 Q;  1JKP C;  2IXS A;  3LSI A;  2FJ1 A;  5DCF A;  5IYC J;  1APL C;  2R7Z J;  1XGS A;  3ELK A;  2JRM A;  1TWG J;  4JK1 X;  2GQQ A;  4W97 A;  1K4S A;  1W5S A;  4RA2 A;  4X0G A;  3HC7 A;  3E5X A;  3QPS A;  4BHC A;  1HCR A;  2YSR A;  3LSP A;  3PFI A;  1ETQ A;  2VI6 A;  3EET A;  4RS8 A;  3UNG C;  1PUF A;  4V2F A;  2PG4 A;  2VON A;  5FFX A;  4J19 A;  3A01 B;  1J7K A;  3DEW A;  4AUX A;  5LHG A;  3G73 A;  1W7P B;  2RNG A;  3MKW B;  1ZLJ A;  3L00 A;  3OR2 C;  2RNJ A;  1XDU A;  5FLM J;  3TED A;  2O6G E;  5FO5 A;  2FF4 A;  2FRH A;  1YJW I;  4DYR A;  3M9A A;  3R0J A;  3IH2 A;  4BS9 A;  6PAX A;  2OCC H;  3HOV J;  4ON0 A;  2L2O A;  3LSG A;  1K79 A;  3BR2 A;  1OR7 C;  2DN0 A;  5JLX A;  5J3L A;  2JA8 J;  1I6X A;  2GBY A;  1SVL A;  1U5T C;  3LAJ A;  3CCV I;  2NS8 A;  2RQP A;  3TW7 A;  3P5J A;  4XLP F;  1QPM A;  1ZRE A;  3GFM A;  1ZG1 A;  4M72 A;  2CH0 A;  5DV5 A;  1TNS A;  1O4X A;  1QBJ A;  2HVS A;  5E1W A;  3ZMV A;  3ZXS A;  3D5L A;  2XKP A;  4BY1 J;  1K78 A;  5HS8 A;  4HRI A;  2XPU A;  2HWV A;  2F48 A;  3PQK A;  2DJN A;  2OQR A;  1YW7 A;  2HQR A;  1FOX A;  4MFD A;  3GUD A;  3K70 D;  3WTY C;  2EA2 A;  2XSJ C;  3QYE A;  5HLG A;  2ZJQ F;  4HNV A;  4AID A;  4GO1 A;  5GPC A;  2BY2 A;  1S29 A;  1FIP A;  1SMT A;  5BOX A;  3P9I A;  4Y4R A;  2R5Z A;  2ZSH B;  1RUO A;  4L9N A;  3KPH A;  4ESJ A;  1SAX A;  5TRD A;  3DEU A;  2M5W A;  3H3V K;  4OU0 A;  1LDK B;  3WG9 A;  1YO5 C;  2ME6 A;  1IN8 A;  3I58 A;  3PUB A;  1K78 B;  1FP1 D;  2FNA A;  4EJO A;  1DUX C;  1RIO H;  4HDU A;  4ENN A;  3JRB A;  2JWT A;  3F8M A;  1ON2 A;  1A6I A;  3BG7 A;  3H0G J;  3H0D A;  4CUG A;  2EFQ A;  2BHZ A;  3I9V 2;  4GFB A;  1X3W B;  4OIN F;  2R4G A;  2IGO A;  4JOM A;  2Y31 A;  3I3L A;  1KQ0 A;  3SDB A;  3MWM A;  3CUO A;  1ZEL A;  1E17 A;  1QPI A;  3A0B C;  2MLG A;  4JQF A;  1A35 A;  2VQG A;  2L7M P;  1TWA J;  1FY7 A;  4RB2 C;  2DA7 A;  2BE5 F;  3GFJ A;  1X1B A;  2W00 A;  3FKI J;  4HAM A;  4UVA A;  4EGZ A;  3PNY A;  3BT9 A;  1MMA A;  3GTK J;  2ZSI B;  3P9C A;  1BC7 C;  2KZG A;  1KU9 A;  4ZYH A;  2HQN A;  2KIU A;  4BKX A;  1VQ6 I;  3PM1 A;  4J01 A;  3PNV A;  5K7H A;  2AQF A;  2RRE A;  3B02 A;  2R7F A;  5CLS A;  3BP8 A;  3J81 Z;  2JTV A;  3TDU C;  4ZYA A;  3AG2 H;  1Y8R B;  3M1E A;  3MVP A;  5DEQ A;  3LSH A;  4GDF A;  3S1M J;  5GP9 A;  1BR1 A;  1G3Y A;  3CF5 F;  2GXA A;  1ENH A;  1ZGA A;  1ZLK A;  3DTE A;  2LR8 A;  2DAO A;  3QQA A;  1YRN A;  1QQI A;  1XC5 A;  4DGW B;  2FOW A;  4LG3 A;  4RGU A;  5JI6 A;  3HRM A;  2OD5 A;  5DUI A;  1YS7 A;  3D5S C;  1Z21 A;  4S04 A;  2IVM A;  1MMS A;  5KVR A;  1FWZ A;  3IRR A;  1IDZ A;  3L7W A;  5AIP A;  4ZDP A;  4MTD A;  1W5C C;  4F92 B;  1F1Z A;  2E5Z A;  1SD5 A;  2BXZ A;  4II2 A;  4UV8 A;  3H9J A;  2Z99 A;  2VQL A;  5GAH J;  2ACJ A;  2E5N A;  1JKQ C;  3RZD J;  1TBX A;  2RDP A;  1VQL I;  1YRN B;  3I56 I;  2E7W A;  1ZH5 A;  1SFO J;  4DW6 A;  1IXC A;  1UEL B;  3KEO A;  3NEU A;  3OYA A;  2XAG A;  3OYM A;  3CO7 C;  3N05 A;  4BEH B;  1U5T B;  2EIK H;  5D5V B;  3N97 A;  1T39 A;  3CQZ J;  4BQQ A;  3K69 A;  3GTL J;  1ZG3 A;  1FYM A;  5BPI A;  2MLK A;  3VYR B;  5K5Q A;  2Z33 A;  2ECC A;  2OBP A;  2WAD A;  4M3G A;  2CG4 A;  4DBR A;  3S3M A;  3JRE A;  4IF4 A;  1Z67 A;  1C0W A;  2P8T A;  4NC8 A;  1YLF A;  4B4C A;  4CO8 A;  1FOK A;  3CJT B;  2VXZ A;  5B1B H;  4F91 B;  1JGS A;  3HHG A;  1MBG A;  4CYD A;  4BBR J;  3E7L A;  2DPD A;  4XKW A;  5HLI A;  2ZJR F;  3RZO J;  2UWM A;  1L0O C;  2DTZ A;  5IOZ A;  3CCU I;  2RGV A;  2M4K A;  5EF6 A;  1TT0 A;  4JX6 A;  3MFK A;  1XB4 A;  4ZJZ A;  1SFK A;  3IKT A;  2OV7 A;  4XLC A;  3QP5 A;  3OYN A;  4HF1 A;  2ELJ A;  3MZY A;  1LDJ A;  2A61 A;  3WU0 A;  2OU2 A;  4HX7 A;  2VKH A;  1LVA A;  2DOE A;  1LB2 A;  3OL3 A;  2A07 F;  4LLG F;  3O6B B;  4RLQ A;  1P7J A;  2RN7 A;  2O03 A;  1MBF A;  1YFH A;  3ESW B;  5BPD A;  4KFC A;  1X3Z B;  2VKD A;  2HR3 A;  3HOY J;  1TQM A;  2QBY A;  5B1A H;  2Z16 A;  3A02 A;  5F0F A;  4YFX F;  3ASN H;  3QP6 A;  5J4Y A;  4HF2 A;  1VQ4 I;  2FEZ A;  4Q48 A;  3SJM A;  2X85 A;  4I98 B;  4M6Y A;  2E19 A;  4HG2 A;  3HGY A;  2KJC A;  4EV0 A;  4BGD A;  2QCO A;  4FCY A;  2A6H F;  2F6C A;  4M9Z A;  4N9H A;  5CJ9 A;  2L3D A;  2VN2 A;  1T98 A;  3PIP F;  2X6O A;  4IQJ A;  2R93 J;  2XKO A;  4PZJ A;  1UZC A;  3T1B A;  1OYI A;  1HDP A;  3I4P A;  3BCB A;  4BHB A;  2LF8 A;  4E7J A;  3EQL F;  2QBY B;  3TO9 A;  5D4R A;  1Z05 A;  3WE3 A;  3CCY A;  3KZY A;  2QEX I;  4CHU A;  2ESN A;  2BV6 A;  2P5K A;  2JUC A;  1BJA A;  3TP3 A;  4PK4 A;  3KFW X;  3HOU J;  3OYK A;  2O61 A;  2GIZ A;  2OZ6 A;  5DYM A;  3J7A O;  1PJR A;  4HEA 2;  1UG0 A;  3LSJ A;  2PI0 A;  3F9K A;  4F3Q A;  1XS9 A;  3E97 A;  2DFH A;  2K27 A;  1P7I A;  2Q1Z B;  3KP2 A;  2YUS A;  2DOA A;  3X2Q H;  4IX7 A;  3HKZ A;  4M6V A;  1I50 J;  2IS1 A;  4P9U A;  1W1W E;  3D1N I;  4QIW N;  3BG3 A;  2CV2 A;  4ZC3 A;  1ZTR A;  1JT6 A;  2V9P A;  2DK8 A;  2ICW G;  1BW5 A;  4BAC A;  2XGC A;  1R9T J;  2CFO A;  1WH5 A;  3CCQ I;  2HKX A;  3RI4 A;  4WF2 A;  2EFO A;  3CLO A;  1U8R A;  2W25 A;  5F27 A;  1DQU A;  2L9V A;  3CJQ B;  3GEZ A;  3TDZ C;  5HDN A;  2BXY A;  2X1D A;  4G94 A;  4WCG A;  2XSD C;  3KIO A;  2NVY J;  3DFG A;  1LUJ B;  1X4O A;  3A4C A;  4BYY A;  2NXN B;  4MQ9 F;  1XGM A;  4P9F A;  5FRM A;  2EZI A;  3GZ5 A;  4FQG A;  1O3T A;  1KGS A;  2MA3 A;  2LBF A;  2LF7 A;  3AL0 C;  3BPV A;  3ZQI A;  2DDB A;  2X0L A;  4CZC A;  1KYW A;  3HM5 A;  4A3M J;  2EFP A;  1TC3 C;  2AS5 F;  2OZU A;  3T0Y A;  2QKL B;  1V5F A;  4BXU A;  1R36 A;  4A3L J;  4LD5 A;  5CVR A;  1BI1 A;  4FTH A;  2CW8 A;  1LFB A;  2DMP A;  4HV5 A;  2HKO A;  4CCJ A;  4BE1 A;  1WGX A;  2R7V A;  2ZXW H;  1GV2 A;  4WXH A;  5F0H A;  4H0E A;  4KMF A;  3I64 A;  4UUT A;  3ZR8 X;  1I6H J;  1UHM A;  3E1S A;  3V8L A;  4G8X A;  4LK0 F;  3CME I;  2IA2 A;  5B3S H;  3KP6 A;  1YTY A;  3I5U A;  5F08 A;  2F4I A;  3KYD B;  2K4J A;  3EYI A;  1OCZ H;  1OMI A;  4AIJ A;  2LYC A;  4A5N A;  3KEY A;  4EJW A;  4A3D J;  2DMN A;  4I7H A;  2XV4 S;  3ZMD A;  2P81 A;  5K1Y A;  3OYI A;  2K4B A;  3OYE A;  1P92 A;  4GGG A;  5EGO A;  4HBL A;  2R7U A;  1BC8 C;  1TP4 A;  3BTC A;  3W2V A;  3ZMZ A;  3WHB A;  5HLT A;  3PSI A;  5JHF A;  4FT8 A;  3K10 A;  4IHY A;  4E7K A;  3CDH A;  4XOR A;  4XKB A;  3KYC B;  5LD2 C;  2QQB A;  1I3Q J;  1TT5 B;  1XX5 A;  2MYS A;  2XAU A;  5CKT A;  1I1S A;  2IGN A;  5FLX K;  1R71 A;  1T95 A;  2DFE A;  2Y0S N;  3GXO A;  1T38 A;  4YFK F;  1TWH J;  1JJ6 C;  4AYB N;  5LGT A;  3HJE A;  2EV5 A;  4HST A;  3QPH A;  5EGO B;  3LQQ A;  5C4X J;  3U21 A;  2CUJ A;  1G3W A;  2OQG A;  3FHN A;  5JFR A;  2FD5 A;  5IPA A;  1J0R A;  3CUQ A;  4L9J A;  3KLO A;  1NG6 A;  4C2M J;  3SYT A;  3VEP A;  1IUF A;  1JTY A;  1R22 A;  2X6X A;  2B9S A;  3KX2 A;  2NOJ B;  5D5W B;  2B0L A;  3RCO A;  1DP7 P;  2FX0 A;  4DYQ A;  3ZPL A;  2A5Y B;  3ZQG A;  4CCM A;  2D1V A;  1T8I A;  3UKG A;  3ML6 A;  4RB1 A;  3RDI A;  2I10 A;  3QOD A;  2JZY A;  1LE8 A;  4A93 J;  3FWE A;  2UZK A;  5KAF C;  1UHS A;  3BLY A;  3FIW A;  5ED4 A;  3ISP A;  3K4C A;  1O3R A;  3JSO A;  1R58 A;  3F72 A;  3TBI A;  1Y56 A;  3WGG A;  4D0P A;  3AAF A;  4XN3 A;  4A0Z A;  2K9M A;  3IKV A;  2JQ7 A;  4ZH4 F;  4R79 A;  1IV8 A;  1Y39 A;  2D1H A;  1FT9 A;  3OR1 C;  4BXX J;  2EV6 A;  1FSE A;  2KIQ A;  3FM3 A;  2WA0 A;  3MCZ A;  1YX3 A;  3MKL A;  3O3K A;  4YEL A;  5A2Q K;  1VQ8 I;  2V79 A;  2HNH A;  3U2R A;  1LE8 B;  4HX4 A;  1Z7L A;  1V3F A;  4L5I A;  3GWZ A;  3VOD A;  1B72 A;  4KT6 A;  2HU9 A;  3RSN A;  1KYZ A;  2HFH A;  3HOT A;  3AL0 B;  3GTM J;  2YX7 A;  5J1R A;  5DCM A;  2CQX A;  2OPT A;  1YG2 A;  4G7H F;  1VZ0 A;  5LEJ A;  2P6T A;  1X1A A;  1ZYR F;  3KP4 A;  2BOL A;  3SZP A;  2MH9 A;  1MDM B;  1KU3 A;  1V5E A;  4FHT A;  2Z5U A;  1GXP A;  2PQ8 A;  4IQ4 A;  5FB2 A;  3M7G A;  4LIU A;  2HDW A;  3CO6 C;  4HDV A;  3TQN A;  2M0M A;  4HX8 A;  2NVQ J;  3H1C A;  3O2P E;  1X2M A;  4UNO A;  1IRZ A;  3L2W A;  1VQM I;  1U78 A;  1RET A;  2IAI A;  3SEZ A;  1OCT C;  2CMP A;  2JJ7 A;  5D6F A;  1N75 A;  4I99 C;  4JX5 A;  1U6G A;  2AHQ A;  1CF7 B;  4XMY A;  1OFC X;  3IAS 2;  3PQJ A;  2C6Y A;  5DM7 F;  3EPZ A;  2LKS A;  1W0U A;  3FZV A;  2XGD A;  1P4X A;  2K3P A;  2VL8 A;  1L3L A;  3S1N J;  2VJ5 A;  3WE2 A;  4E6K G;  4BDZ A;  4BQA A;  2NNY A;  2ELH A;  3CCE I;  4IPA A;  4ZYG A;  2DA5 A;  2XIG A;  3VFZ A;  4LJZ F;  3KZI C;  2G7H A;  2NAZ A;  2ZKZ A;  4QWQ A;  1B8I B;  2K02 A;  1JE8 A;  1OKR A;  2ECB A;  3SFI A;  3G4S I;  1JHF A;  5CVI A;  3NAR A;  4PFP A;  1B6A A;  3K1P A;  2E60 A;  1IV6 A;  1HXD A;  2CW7 A;  3WTU C;  2XAQ A;  4IHW A;  3JR9 A;  2QZ8 A;  2V6E A;  5EZG A;  2FU4 A;  1ZAR A;  4OWR B;  4P96 A;  3JTH A;  1B1B A;  3Q0U A;  2WV1 A;  2RV8 A;  4FE4 A;  3GLX A;  3FMS A;  2R7O A;  1YW8 A;  1SAN A;  2KKO A;  4M3E A;  1N78 A;  3J7A Y;  1G8X A;  1TWF J;  2XGX A;  1GXQ A;  3J7Y J;  1E3O C;  2KRF A;  2CUE A;  5DS9 A;  2ZFU A;  2CQ7 A;  1QVT A;  1WJA A;  3M8E A;  1OPC A;  1KA8 A;  2ZXH A;  2V1U A;  1G4D A;  3H3Z A;  1FBQ A;  3F3X A;  1EA3 A;  3IUO A;  4A0Y A;  2MSY A;  2Q0O A;  1LDD A;  4FIS A;  5D8L B;  2HOT A;  5GPA A;  4KIF A;  2HI3 A;  1PVE A;  1JGG A;  1Z1D A;  5L3G A;  4P55 A;  1ULY A;  5LEK A;  1IZ1 A;  3GFI A;  2P4W A;  1Y0N A;  3ULQ B;  4S05 A;  3GME A;  4A2U A;  4BHP A;  3L1P A;  3I0T A;  4U88 A;  2KIS A;  4B47 A;  1W7P D;  3DF8 A;  4N4O B;  2RVC A;  4EQQ A;  3E0J B;  2OCE A;  4HPQ A;  4ZDL A;  3D5R C;  1WJB A;  3RKQ A;  3LMM A;  2KIM A;  2CV1 A;  3QYF A;  4KJZ A;  2AO9 A;  2P5V A;  3BRO A;  3TKY A;  4YRV A;  2VOO A;  2V1D A;  1Q1H A;  4DZJ A;  2XHK A;  2DDA A;  3B73 A;  2HYJ A;  2P6S A;  3Q9S A;  3OMY A;  3HSE A;  3BG9 A;  4RM2 A;  5LGN A;  2HQA A;  3S16 J;  2F5V A;  2GXG A;  2GIV A;  4A3E J;  4LLL A;  3HOZ J;  3S2D J;  2MH2 A;  5CQG A;  4G6D A;  1Y1W J;  4BE0 A;  2EZL A;  4IL6 C;  2XVC A;  3Q5F A;  5FFZ A;  4C2T A;  1MD0 A;  1R49 A;  3BJA A;  3U1K A;  2E2I J;  1S7O A;  3HSR A;  3HSF A;  2M8E A;  1HQC A;  5JR3 A;  1VND A;  4KIC A;  1ODD A;  3PO2 J;  2MBF A;  4B1R A;  1QZE A;  1T6S A;  2KFD A;  4ESF A;  1UJ8 A;  4XLH A;  1LNW A;  3TOB A;  4M3F A;  4AVZ A;  3K7A J;  2L01 A;  3BY6 A;  3MKY B;  3I59 A;  5DTD A;  4AIH A;  3H36 A;  2JA5 J;  4HSR A;  2VE8 A;  2JVG A;  3VYT B;  2QA4 I;  1MSE C;  3H9G A;  1ERD A;  3FXU A;  1HKT A;  1FYK A;  1POG A;  3W2W A;  3ZQL A;  1TW3 A;  1HF0 A;  2CGP A;  4N0B A;  2HOS A;  4GRI A;  3GTJ J;  1GUU A;  4ETS A;  1RI7 A;  2QSF X;  3FDY A;  2DQR A;  3CCR I;  1PUF B;  1GDT A;  1EH7 A;  1F4K A;  5EZH A;  4IRG A;  3CTA A;  3HOX J;  1Z6R A;  2MD0 A;  3E3V A;  1LVK A;  3OV8 A;  1HA8 A;  1QHH D;  2DJI A;  1SMY F;  1DU0 A;  2DA2 A;  4EM0 B;  4EJT A;  4Y13 A;  1G2H A;  2KLO A;  4UY8 I;  4AU7 A;  3LSK A;  2ZME C;  1MND A;  4R1H A;  5BQT A;  3IV5 A;  2X4H A;  1YE9 A;  4E7H A;  4GXO A;  1HBX G;  2KP6 A;  3CLQ A;  1X1P A;  5LLQ A;  2CS3 A;  4Y7N J;  4PDK A;  4Y17 A;  2GA1 A;  1MJA A;  3S17 J;  5ILV A;  1MMD A;  3CCS I;  4YIR X;  3ZP5 A;  2KHM A;  3VB2 A;  2XAJ A;  2DA3 A;  1WCM J;  4A0X A;  2EWN A;  1D5V A;  2R7W A;  1KU2 A;  1MNE A;  5BMZ A;  2Y0S A;  3H92 A;  1PP8 F;  2X48 A;  3O8G A;  3ABL H;  2QKM B;  4G6T B;  4RGR A;  4KN4 X;  1O3Q A;  4AYB A;  4KMU X;  4XLE A;  4R8H A;  1WJE A;  2L7F P;  1XPX A;  4QPO A;  1F36 A;  3K9T A;  4AC0 A;  4ZDO A;  2DBB A;  3RIR A;  3W6K B;  3JSP A;  5D6E A;  2R5Z B;  2HS5 A;  3FK6 A;  2OF7 A;  1CQT A;  4C2U A;  2QVO A;  3Q0V A;  1K6Y A;  3FXQ A;  3OL4 A;  1PP7 U;  2MW8 A;  2E34 A;  4C3H J;  4IOC F;  4YIF A;  1D8J A;  4MLO A;  3G1L A;  2NYX A;  3G1O A;  2HXI A;  3VYU B;  2HTJ A;  2CSO A;  1Z3Y A;  1A36 A;  1ZN2 A;  2VT2 A;  4CA0 A;  1RC9 A;  2VJJ A;  3JRC A;  2FBK A;  1MH3 A;  4BDY A;  4I2O A;  2Q8K A;  2FQ4 A;  5JVT A;  1SD6 A;  1QRY A;  1UG2 A;  5D4S A;  3K1M A;  1FOY A;  2IS2 A;  1JUP A;  4IVN A;  4IXA A;  3KZZ A;  2H27 A;  2W48 A;  1FTZ A;  2LRD A;  1K83 J;  4PJL A;  3F22 A;  4I0B A;  2X6W A;  2I5U A;  3E5Q A;  3NWS A;  3S1Q J;  4A3C J;  4CCN A;  4OIR F;  4A3J J;  1FNN A;  1MW7 A;  1H0M A;  5LRS A;  2PLY A;  2LVS A;  1R5H A;  1I5Z A;  2CU7 A;  5JLW A;  2DCE A;  3RKY A;  1E2X A;  3ZQF A;  1LQ1 A;  1KQ9 A;  5ICE A;  1LKX A;  4XL9 A;  1BM9 A;  4UV9 A;  4AIK A;  3ZQQ A;  1W0T A;  1F43 A;  1FMV A;  4ENJ A;  1ZRC A;  1EJ9 A;  1WPK A;  3P9K A;  5FRO A;  1D5Y A;  3QWL A;  4ITV A;  1R4M B;  4RGX A;  4UUV A;  3W6V A;  1R5G A;  2L02 A;  3AKZ A;  1MBK A;  3MQ0 A;  1AHD P;  3LST A;  2ZME A;  2KL4 A;  3HHH A;  4ABZ A;  4I0A A;  5F04 A;  2CJJ A;  3OIO A;  1WRJ A;  2X9D A;  4XRF A;  4ZTJ A;  1IXR C;  3LFU A;  3HZJ A;  3OIP A;  2QF7 A;  1BA5 A;  3OSG A;  1YS6 A;  4LG0 A;  3T8T A;  4A3B J;  2LRE A;  2VBX A;  3L2V A;  1IRG A;  4M3D A;  1LEA A;  2Y0M A;  3WOD F;  5JHU A;  2LKP A;  1MZB A;  4BJ5 C;  3TP0 A;  4V19 K;  2E71 A;  5HVQ C;  5KCM A;  3C7J A;  1I3A A;  1VI0 A;  4CCK A;  2EH3 A;  5E3M A;  2ZME B;  2IGK A;  3PL8 A;  2QQA A;  3ZQC A;  5K5R A;  3T8R A;  3ROU A;  2M45 A;  5BNG A;  1BJZ A;  2V9V A;  4A6D A;  3FX3 A;  3GX4 X;  2QLZ A;  3OYL A;  4LG0 B;  3F8C A;  2PJR A;  9ANT A;  2L9S A;  3KE2 A;  2LK2 A;  1JKR C;  1HST A;  1A04 A;  2Z2S B;  3DQV C;  3OYH A;  1ZQ3 P;  4WXD A;  4PJJ A;  5M5W J;  2XGE A;  3AG4 H;  1YIJ I;  2L54 A;  5D5U B;  3HRS A;  4QSH A;  2YPR A;  3DPT A;  3BZ6 A;  3ASO H;  4Z6Y A;  2Z9O A;  4PJM A;  3CMY A;  3KP3 A;  1KZH A;  3J7Z I;  1DGW Y;  1IXS B;  2F5E A;  4I01 A;  5J8C A;  2MGQ A;  4MFE A;  5E79 C;  2PJR B;  5FGM A;  1W4M A;  5F6F A;  1R1U A;  1WI3 A;  3LSM A;  4DJA A;  3L2U A;  5FRN A;  3F8B A;  5KK1 A;  4XRS A;  1WJ5 A;  3QPT A;  4IRH A;  4A3F J;  4RBO A;  3E6D A;  4XLN F;  5CVV A;  3DPL C;  2G7U A;  4XLA A;  1JI8 A;  1QA6 A;  1O57 A;  3GLL A;  2XRL A;  2ZBK A;  2KZV A;  4LOC A;  1P2F A;  2E7X A;  1BN5 A;  4Y15 A;  1YW9 A;  3ZN0 A;  2HQ5 A;  2PN6 A;  3AG1 H;  1FSH A;  2W85 A;  5FLV A;  3GZN B;  3OYF A;  3G1M A;  3L9F A;  4MNU A;  1Z91 A;  2EZH A;  2A6E F;  4OOI A;  2UXN A;  4HQM A;  2GM4 A;  1FBU A;  3TW6 A;  4QPQ A;  3BPX A;  1D1A A;  1XSD A;  2O9L A;  2BY3 A;  3HBL A;  2PBI A;  4M9S A;  2GOM A;  2M8G X;  5C3E J;  4LGW A;  1WZ2 A;  1JT0 A;  2M0C A;  4BXF A;  3CUQ C;  1K7A A;  3ABT A;  2L9N A;  1OIS A;  2HVQ A;  5KAI C;  1FP2 A;  3L2Q A;  1X1C A;  3HPH A;  4G6Q A;  2EFN A;  4ZZD A;  2WAE A;  4AM3 A;  3LQR A;  4X6A J;  1QHG A;  3DKY A;  3BDD A;  1HW1 A;  3OOP A;  2OA4 A;  4BUP A;  4FAS D;  4LB6 B;  1W36 C;  3FXJ A;  5ILS A;  4CGZ A;  4HNU A;  1VQO I;  2XPW A;  1JHH A;  2VBW A;  5ERI A;  2CUF A;  3MZH A;  2LFB A;  1X1D A;  2WV0 A;  1RNL A;  2UXX A;  2IS6 A;  1XCB A;  1FOW A;  3HL2 A;  2R92 J;  2E1N A;  2L7Z A;  1VQK I;  2F5C A;  5M5X J;  4HW0 A;  1HC8 A;  2XAF A;  4F7Z A;  2W84 A;  4TV7 A;  5GTH C;  3IC7 A;  3KYL A;  1OYW A;  2XF6 A;  1U2W A;  3OWT A;  2WC2 A;  4E7Z A;  1V55 H;  2E2H J;  4KNY A;  2STW A;  3BG6 A;  3F6V A;  2E1C A;  4I02 A;  1J2X A;  2L4A A;  2CQQ A;  4E4H A;  5CPR B;  2R7D A;  3ZCO A;  5E1Z B;  3U1D A;  2LBF B;  3CMA I;  1KON A;  4HOB A;  2BHY A;  2COM A;  4XNF A;  1MGT A;  2WAF A;  1VFC A;  2HDD A;  2NS0 A;  4CDG A;  2FML A;  2Y30 A;  3OS2 A;  1NK3 P;  4LIV A;  2MC3 A;  5IP7 J;  1S7A A;  3DBR B;  2AQE A;  4AD9 A;  2NVX J;  2DMU A;  1V54 H;  2DT6 A;  4CCL A;  3BTL A;  3S15 J;  5DUK A;  4I76 A;  4O6J A;  3LWF A;  4B48 A;  1JUM A;  2ZXJ A;  1BIB A;  3ZQH A;  2DYR H;  5E17 F;  4ZYD A;  1TLH B;  2LDU A;  1ITY A;  2ZXI A;  3BZK A;  1H9G A;  1IN7 A;  2EB7 A;  1YHQ I;  2IPQ X;  3R6S A;  4LLN A;  2G9W A;  4BY7 J;  2XB5 A;  1WHU A;  4BQN A;  1TWC J;  4FX4 A;  1AWC A;  2CRG A;  2GA2 A;  3BG5 A;  5FKL A;  2K85 A;  1ETY A;  3BR1 A;  3FIS A;  3GCM A;  1D0Z A;  2KQR A;  4A5M A;  2FBI A;  4L0Y B;  2EIL H;  2QWW A;  2QGU A;  2A3S A;  2VB6 A;  3ZMS A;  4RB0 A;  2BBY A;  2DMT A;  4XID A;  1B9N A;  3CCJ I;  3HG9 A;  2F5F A;  1RR8 C;  4O5V A;  2EK5 A;  3GTO J;  3ECO A;  3REO A;  4ASN A;  4U0W A;  1N25 A;  2DA4 A;  4RB3 C;  1GVD A;  4NB5 A;  4PUS A;  5H20 A;  3DV8 A;  4XON A;  3ZN1 A;  1YI2 I;  2VQH A;  1MJ9 A;  2DW4 A;  3CUQ B;  1F5T A;  1T56 A;  4HF0 A;  3RYR A;  1K61 A;  1UAA A;  3IWZ A;  1Z77 A;  3Q9V A;  4RGS A;  4A6E A;  1BIA A;  1GHC A;  5H6Q A;  2HTS A;  2ZJ2 A;  3MMY B;  4NNJ A;  1KU7 A;  1LFP A;  3WHC A;  4HLX A;  2VAS A;  2M7B A;  4V2G A;  2M34 A;  4ZZL A;  1QNT A;  2HXO A;  3GF2 A;  1EF4 A;  1T2K A;  3G2B A;  4U7B A;  2HOA A;  3CCL I;  3R4K A;  3OS0 A;  2LC2 A;  3HTS B;  2JMW A;  3F8F A;  4E70 A;  1SVO A;  2IEK A;  4KYW A;  1YJ9 I;  2E36 A;  3WU2 C;  1H88 C;  1K4T A;  3F21 A;  4J00 A;  4MGR A;  4U7D A;  1OCR H;  3I53 A;  1OYY A;  3S1R J;  4Q5S F;  3FXO A;  1WJC A;  2HYF A;  4L5J A;  2FQ3 A;  1MIJ A;  4CSW A;  2VUM J;  1IDY A;  2LH9 A;  4S0H B;  3DP7 A;  1S8N A;  3GO5 A;  3G71 I;  1B72 B;  1BOB A;  2JA6 J;  3H9Q A;  1ETK A;  2M2E A;  3K6G A;  5KNL A;  3KLN A;  4RAY A;  1Z9C A;  1HW2 A;  3IP4 B;  5DCM B;  3DCF A;  5E8G A;  4NC6 A;  3W6J B;  5GAE J;  2FBH A;  4IRI A;  1WJF A;  2W7N A;  4G7Z F;  3ZMT A;  4PCQ A;  1J09 A;  2BY0 A;  4XRM A;  1S7E A;  3PJR A;  3S93 A;  4QTR A;  3HUG A;  3RPU A;  3HOW J;  2EIN H;  4I09 A;  1ZR2 A;  2XUB A;  2XAS A;  4YII A;  1LFU P;  2ELK A;  2F4M B;  3IL2 A;  3JRF A;  3DTI A;  1ZG5 A;  2R5Y A;  2PMU A;  3K4B A;  1WSU A;  3G6E I;  2KMU A;  1X3U A;  2DLL A;  5LRR A;  3HDD A;  1GT0 C;  2RAE A;  2ID6 A;  2HPI A;  4Y52 J;  3K0L A;  5TJJ A;  4YFN F;  3ABM H;  5J4V A;  3WTT C;  2AXL A;  1YOV B;  2STT A;  1B59 A;  3O8H A;  1I27 A;  1AA7 A;  4O3M A;  1V4R A;  3FMR A;  4M6X A;  1IJW C;  4H4K C;  1E0E A;  3L2R A;  3HUG B;  2ADU A;  5HDG A;  1XTA A;  5IYB J;  3JRD A;  2VJ4 A;  4B43 A;  1BI3 A;  4PGG A;  5IP9 J;  4I6Z A;  4HYE A;  5IT9 K;  2HGC A;  1AKH A;  5IOY A;  1QGP A;  2ISZ A;  1ONV A;  4MTE A;  3EUK L;  2DXI A;  2HOE A;  1A31 A;  3NAU A;  3CF2 A;  4E7I A;  5KHD A;  3QYB A;  1MNM C;  3SQN A;  4B8X A;  4HLY A;  2EFW A;  3SFZ A;  3I55 I;  4PSX A;  3AG3 H;  4MEY F;  3P7N A;  1S5L C;  3FF5 A;  4EVI A;  2M3A A;  5L3D A;  1WI9 A;  1O7L A;  4UHT A;  1SC7 A;  2ZC2 A;  3E5U A;  3R0A A;  5LBQ A;  3V7C A;  3QU6 A;  3COA C;  5CYV A;  3ABU A;  3EUH C;  2HVR A;  2VPR A;  1LJ9 A;  4WXC A;  2XF7 A;  3MZ8 A;  1GV5 A;  2QSH X;  1RES A;  2M9H A;  2BW3 A;  5F0C A;  4L0Z B;  3F0C A;  3WTX C;  2Q2E A;  2R7T A;  3HEF A;  2XB0 X;  1J5Y A;  4BL0 B;  4XSZ F;  2WTE A;  3W2A A;  4WK8 F;  2ME0 A;  3DPU A;  3GFL A;  3KP7 A;  3M1C A;  4XK4 A;  3RYP A;  1B9M A;  2ETH A;  2VE9 A;  1P9Q C;  3V8K A;  5HOD A;  2Z1D A;  2FUG 2;  4P1W A;  1U3E M;  4XBF A;  5TGT A;  2K9S A;  3S8P A;  3E6C C;  1IN6 A;  2J5O A;  2B7E A;  1W5T A;  1T0F A;  3HTU A;  3FXK A;  2LSO A;  2Y9Z A;  4BU2 A;  5HS9 A;  3H3U A;  4UUS A;  1ZGJ A;  3FHZ A;  3V4G A;  2QSG X;  2Q2E B;  4PJN A;  3UR3 C;  2EV0 A;  2XAH A;  3ERE D;  1FC3 A;  2A69 F;  2KDO A;  4P5O A;  3L09 A;  4G12 A;  4F93 B;  4RAF A;  5LHH A;  3K70 C;  4RDU A;  1B4A A;  4BAY A;  2XDV A;  4Z2Y A;  4KIT B;  4EAT A;  1T33 A;  2PX9 A;  3KP5 A;  3KEQ A;  2D5V A;  2P0W A;  5LFA A;  1PDN C;  4XSX F;  4UUS B;  2LLK A;  1ACI A;  1DGR M;  4UB8 C;  2PJP A;  3F8N A;  5EJC A;  1J9I A;  1J75 A;  1QU3 A;  2Y69 H;  2ZNY A;  1R7J A;  5HOO A;  4XIC A;  3OYC A;  3QPL A;  1M1E B;  4Q4Z F;  1AU7 A;  4DQ2 A;  2D45 A;  1REP C;  1TQP A;  4RMN A;  5IYD J;  1PYV A;  1TNT A;  5JVG F;  2R7X A;  3H5N A;  3QOP A;  2CQN A;  3GYH X;  3WTZ A;  1MJB A;  3OYG A;  5F64 A;  4IHS A;  2H1K A;  2H94 A;  4JBA A;  2VLA A;  4XQF A;  1BR2 A;  4WWC A;  2L4M A;  4UVB A;  4BQO A;  4KIS A;  3C18 A;  4JX4 A;  1JJ8 C;  1D3Y A;  3A1Y A;  1MMN A;  5M3M J;  2KRH A;  3IH4 A;  4B3A A;  4ZTF A;  4PFO A;  3I59 B;  2ZO4 A;  4GYI A;  4DIQ A;  2WAQ N;  3K4K A;  2QEN A;  2R3S A;  1STZ A;  2ZNZ A;  2V4J C;  3K2Z A;  2O0Y A;  3EUH A;  2JT1 A;  4U0V A;  3OYB A;  1RZ4 A;  2I8D A;  2DO7 A;  1S3J A;  2YU3 A;  4Y33 A;  1S72 I;  2QM3 A;  2PEX A;  3ZGK A;  5IT9 Z;  4D7N A;  1R1T A;  1UST A;  2D2W A;  3BQY A;  4IEJ A;  4AWX B;  4ZYE A;  3N4M A;  2TDX A;  1D1C A;  2O7O A;  2Y9Y A;  1GVJ A;  2ESH A;  4D7M A;  4G9Y A;  1EV7 A;  2DFF A;  3H5R A;  2W82 A;  4MHG A;  3CC2 I;  1WJD A;  2OAZ A;  3PO3 J;  3RPQ A;  2E1M C;  4Q47 A;  3D0S A;  2PFB A;  3HRT A;  3CC7 I;  1YX5 A;  3QOE A;  5EEH A;  2IP2 A;  1FJL A;  2OTJ I;  5IT3 A;  2BZT A;  2Y75 A;  3LFK A;  3W3C A;  4M71 A;  1JXS A;  2BVL A;  5J1U A;  4IO9 F;  3S14 J;  2IBD A;  4N9I A;  2NVT J;  2VQC A;  5HLH A;  3IRQ A;  1IAW A;  2FMY A;  3TMO A;  1LPQ A;  3GVA A;  3FM5 A;  1MSF C;  1GLN A;  4DZP A;  2VPL A;  1BW6 A;  2M87 A;  1BI2 A;  1NH3 A;  1D0X A;  1JUS A;  1XDS A;  3HRU A;  2WBM A;  2DA6 A;  4LB5 A;  2KRC A;  4C9Y A;  1HOM A;  1NTC A;  3LA2 A;  2A6T A;  3MN2 A;  1Y8Q B;  5E3O A;  4A12 A;  1MH4 A;  2DU9 A;  3CP2 A;  2Z3Y A;  2NNN A;  1Y0U A;  3A2K A;  5DD4 A;  3JW4 A;  3CD6 I;  3OY9 A;  1WFX A;  2P5L C;  3EDP A;  3OYJ A;  2QQ9 A;  1WWX A;  3R61 A;  4LFU A;  2EZK A;  3V42 A;  5L3E A;  2WB1 N;  2K9Q A;  3WTV C;  2COB A;  3FXM A;  3M8F A;  3RJP A;  3I4N J;  3WGH A;  4DBQ A;  2BEO A;  3TL4 X;  5FD6 A;  3DKX A;  2VOD A;  4PSW A;  1EKE A;  3FXL A;  3C2H A;  5HS7 A;  5L3C A;  2GZW A;  3WU1 B;  4EJU A;  5K7Z A;  3LA3 A;  3K4J A;  2OUM A;  1UHW A;  5AON A;  2LNB A;  2XF5 A;  4M9X A;  3HIF A;  5J6X A;  2MD5 A;  3DWL E;  1HLV A;  2DK5 A;  4E7S A;  5LHI A;  2ZJP F;  1FBS A;  3BR6 A;  3IAM 2;  1I39 A;  1OR7 A;  3K2A A;  2DQL A;  3R60 A;  4D5C A;  5BS6 A;  1R00 A;  1VQP I;  3M4O J;  4BBS J;  1X2N A;  5FKK A;  4D5F A;  2N8G A;  2R7R A;  4BEH A;  2DPU A;  1U5T A;  5D5X B;  3WTS C;  2DI3 A;  3HB9 A;  3GZ6 A;  3VOE A;  5EEA A;  2MC4 A;  2YU9 J;  3PSF A;  3VPR A;  3NQO A;  3J80 K;  4IZZ A;  1IN5 A;  1IUY A;  1S9H A;  4NUB A;  2MG4 A;  4L9T A;  1VQ7 I;  2X1E A;  2DFI A;  2EIM H;  4OAY A;  3VSK A;  3FXR A;  4IHV A;  2H6B A;  4C3I J;  2ZB9 A;  2F4O B;  4EM1 A;  1ZKG A;  5TIS C;  4KA4 A;  1UB9 A;  3OOU A;  3GW2 A;  2MAB A;  3DBH B;  4XOT A;  4M73 A;  3BJ6 A;  2W24 A;  5E1X A;  4JYK A;  2P7C B;  1DP3 A;  2M30 A;  1RRJ A;  4ENM A;  2DYS H;  4CZZ A;  1YJN I;  3LAP A;  5FD5 A;  1FZP B;  4FE7 A;  5E8I A;  3LL7 A;  2XRO A;  2Y2Z A;  2JPB A;  4IJA A;  2RC4 A;  1VQ9 I;  3NRV A;  3CES A;  4OAZ A;  2E1M B;  1QZY A;  4PGH A;  1SD4 A;  3VYS B;  1HKQ A;  3Q3S A;  3OS1 A;  4ESB A;  3BTI A;  3V8J A;  3H35 A;  3JTG A;  1RPW A;  1VQN I;  1X4P A;  3CZ6 A;  2W57 A;  2NS7 A;  3BC8 A;  1U8B A;  5J40 A;  5GAG J;  4RLF A;  1SEU A;  1IRX A;  5E20 A;  4C30 A;  1WKM A;  2H09 A;  3IWF A;  1IG7 A;  3OSF A;  1TZL A;  1MMG A;  4KIG A;  4U87 A;  5CVJ A;  2H1L A;  3M8J A;  2PMZ N;  1BI0 A;  2IW5 A;  3T5X A;  2VBY A;  1VTN C;  1ZGW A;  4CIC A;  4BE2 A;  3DLA A;  2IRF G;  3DEE A;  4DNC A;  1QZZ A;  3DXJ F;  4QLC U;  4MIM A;  1XSV A;  3I71 A;  5F1J A;  2ID3 A;  4WX9 A;  2H6C A;  4A3I J;  2GXB A;  5DD8 A;  1OCP A;  4M74 A;  4LK1 F;  4NC7 A;  4YG2 F;  1HSJ A;  3MEX A;  3K4L A;  2EA4 A;  2E1O A;  1N77 A;  4LMY A;  2V7F A;  3JRA A;  4UVC A;  2X6Y A;  2K3F A;  2R7S A;  5J1Y A;  3S2W A;  1HDD C;  1MBH A;  3V7S A;  3DBL B;  2GLO A;  2VKV A;  2L5Q A;  1UCR A;  2XC7 A;  1Y1V J;  3PIO F;  1SD7 A;  2J5P A;  3TO7 A;  4DYC A;  2JA7 J;  2WY7 Q;  4RAZ A;  1U9N A;  1D0Y A;  2P7V B;  3BOQ A;  5GTI C;  2EIJ H;  2JVH A;  2HZT A;  3RKX A;  3FKJ A;  3TOA A;  1XMK A;  2DTR A;  1H8A C;  1OLT A;  1DPR A;  3FK7 A;  2BVM A;  1KQ8 A;  2HYG D;  5J8F A;  2LP0 A;  5F1R A;  1DPU A;  2QUF A;  3CMM A;  3C2B A;  2WWY A;  1Z7U A;  3TO6 A;  2IJL A;  1G59 A;  1SAU A;  3VWB A;  4OMY A;  5DDG A;  3E6M A;  3SHF A;  5K7F A;  1RKW A;  2TRT A;  1Q1V A;  2LKX A;  3LSR A;  5DM6 F;  1A5J A;  1XN7 A;  2KJB A;  4X1E A;  3DU5 A;  1G3S A;  3CJR B;  4FET A;  1JKO C;  3M07 A;  1XD7 A;  2RQQ A;  2YS9 A;  2B63 J;  2K9N A;  3OIQ A;  4B3X A;  3J80 Z;  2IS4 A;  4UXN A;  3LNQ A;  2FA5 A;  2DT5 A;  5B5E C;  4E7L A;  1MBJ A;  3Q0W A;  5M5Y J;  3B6A A;  2JSP A;  2GAU A;  5CQE A;  4YEJ A;  4L5E A;  4XN0 A;  1J59 A;  1YYV A;  1YIO A;  2YX4 A;  3F23 A;  2VJI A;  3FBI B;  4NDL A;  4BJ6 C;  1DU6 A;  1XSX A;  4F55 A;  1XMX A;  2H8R A;  4OMZ A;  1IC8 A;  3FMQ A;  3ZOB A;  2FXA A;  2LG4 A;  1OQY A;  2E35 A;  1FEX A;  2VXD A;  3BZC A;  4RM3 A;  3M3Y J;  3CJN A;  5C4J J;  3RKW A;  3TGN A;  2WAQ A;  2YR2 A;  4RAG A;  4AVP A;  2K40 A;  3S3O A;  1V5G A;  2VC0 A;  1IGN A;  1FPQ A;  2EBI A;  2JUG A;  5FKM A;  1BOA A;  1WVR A;  2LD5 A;  1G3T A;  1XG1 A;  2A68 F;  3AFH A;  2DOD A;  2HPM A;  3V7R A;  2OTL I;  4MQV A;  4K2E A;  3S32 A;  1DDN A;  4XM3 A;  4NHJ A;  1TW2 A;  2LMD A;  1W36 D;  2IGM A;  2CYY A;  3QU3 A;  2Y48 A;  2JA2 A;  1ORK A;  3E6B A;  2M7A A;  3ERM A;  1T08 B;  4EM2 A;  2O5R A;  1RR7 A;  2K7L A;  5J47 A;  2DA1 A;  2VIX A;  3FBN B;  2JPC A;  2VBZ A;  2UV1 A;  1WH7 A;  2R7Q A;  4U0Y A;  5K5O A;  3LA7 A;  4B44 A;  1P4W A;  2CV0 A;  3BR0 A;  5HDK A;  2F2E A;  1X19 A;  5HNH A;  2EJR A;  1UFM A;  3MAJ A;  4NBQ A;  1BL0 A;  4HQE A;  3BCA A;  2NRA C;  1VQ5 I;  2HZD A;  5IP6 A;  3SZT A;  4MEX F;  4CYC A;  3HOS A;  4OIQ F;  1SFU A;  3KCC A;  1TTY A;  3CC4 I;  2L7K A;  3JRG A;  1U0J A;  4L18 B;  1IW7 F;  1R6R A;  3JCU C;  2IA1 A;  4A3G J;  2XRN A;  4ENK A;  4IOA F;  1HW5 A;  1XMA A;  2CW0 F;  1FMW A;  3GTQ J;  3G3Z A;  4HV6 A;  3JAM K;  1D8K A;  2AXT C;  2VT3 A;  2ZCW A;  4A3K J;  1R1V A;  4GYG A;  2QQ8 A;  2V6C A;  3EYY A;  3LOC A;  1EH8 A;  3A03 A;  1FTT A;  1O7F A;  4CYC B;  1ZRD A;  3ONQ A;  3WG7 H;  2W1O A;  1ETW A;  4B09 A;  4JP0 A;  5ICF A;  3PFY A;  2L9R A;  3BJO A;  3JRI A;  2JN6 A; 
#chains in the Genus database with same CATH homology
 4UUS A;  4A69 C;  2W48 A;  1FTZ A;  1P7I A;  1K83 J;  3BTJ A;  2YUS A;  4M6V A;  1I50 J;  3CDL A;  3S1Q J;  4A3C J;  1ZR4 A;  4G12 A;  3D1N I;  4QIW N;  2EQR A;  4A3J J;  3BG3 A;  1ZTR A;  2LY9 A;  1JT6 A;  2LVS A;  4RDU A;  1BW5 A;  2CU7 A;  5JLW A;  2XGC A;  3BR3 A;  1R9T J;  1WH5 A;  1T33 A;  3ZQF A;  3HGG A;  1F43 A;  1W0T A;  1OJL A;  5F27 A;  2D5V A;  1ETX A;  2XSD C;  2NVY J;  1WPK A;  2DMQ A;  4UUS B;  2LLK A;  2R0Q C;  1D5Y A;  4IHX A;  2EZI A;  3W6V A;  1MBK A;  1AHD P;  5FKO A;  4ABZ A;  4XIC A;  1AU7 A;  3QPL A;  1ZK8 A;  3ZQI A;  5F04 A;  2CJJ A;  5E3L A;  2TCT A;  3OIO A;  3BQZ A;  5IYD J;  2X9D A;  3HM5 A;  3GTP J;  4A3M J;  1TC3 C;  2XPV A;  2QF7 A;  1BA5 A;  3OSG A;  4A3L J;  5FKN A;  1B8I A;  2H1K A;  4A3B J;  3IH3 A;  4M3D A;  4FTH A;  1LFB A;  2DMP A;  4JX4 A;  3TP0 A;  1JJ8 C;  1VF9 A;  1WGX A;  1GV2 A;  5F0H A;  1VI0 A;  2EH3 A;  4UUT A;  5E3M A;  5M3M J;  1I6H J;  3IH4 A;  4B3A A;  3BR5 A;  3ZQC A;  5FJ8 J;  1U9O A;  2WAQ N;  5F08 A;  1XS9 A;  5BNG A;  1BJZ A;  2JK3 A;  1JTX A;  3RQI A;  4EEF G;  4A3D J;  2DMN A;  4M3B A;  2P81 A;  9ANT A;  2KT0 A;  2R5Y B;  5EGO A;  2LK2 A;  2LTP A;  4D7N A;  1JKR C;  3BTC A;  3WHB A;  3BQY A;  4IEJ A;  4IHY A;  1UMQ A;  1ZQ3 P;  2O7O A;  2Y9Y A;  2Y9Z A;  2O8K A;  1X58 A;  5M5W J;  2XGE A;  4D7M A;  1I3Q J;  4QSH A;  3PO3 J;  3CMY A;  2Y0S N;  1TWH J;  1JJ6 C;  2KDZ A;  1FJL A;  2MGQ A;  4AYB N;  4MFE A;  5C44 J;  4XRS G;  5M3F J;  2L0K A;  5EGO B;  1WI3 A;  5J1U A;  1AKH B;  3S14 J;  5C4X J;  2IBD A;  2NVT J;  4XRS A;  3B6C A;  2FD5 A;  1ETV A;  5IPA A;  4A3F J;  1MBE A;  4RBO A;  1ETO A;  4W1U A;  4C2M J;  1MSF C;  4DZP A;  1BW6 A;  5EG0 A;  1IUF A;  3SDG A;  1JTY A;  1JUS A;  2XRL A;  2VKE A;  1NK2 P;  2DA6 A;  2FX0 A;  4DYQ A;  1HOM A;  4LOC A;  3ZQG A;  1NTC A;  5EDN A;  3MN2 A;  3UKG A;  2HQ5 A;  5E3O A;  3GBG A;  2I10 A;  1MH4 A;  1LE8 A;  3I4M J;  5FLV A;  4A93 J;  1UHS A;  3FIW A;  3G1M A;  2EZH A;  2GM4 A;  2E2J J;  3TW6 A;  1H89 C;  1QVU A;  1FIA A;  2O9L A;  3HBL A;  5E3N A;  2M8G X;  5C3E J;  1JT0 A;  2M0C A;  1Z0X A;  2G0E A;  2EZK A;  5EG0 B;  2WB1 N;  2K9Q A;  3I4N J;  2COB A;  2NOG A;  4C3J J;  3HKZ N;  4BXX J;  3MKL A;  5EYR A;  4X6A J;  5K7Z A;  3JRH A;  4MO7 A;  1LE8 B;  3S2H J;  3A01 A;  1HLV A;  1RKT A;  1B72 A;  3GTG J;  1JKP C;  2XPW A;  3GTM J;  3BR6 A;  3K2A A;  4D5C A;  5J1R A;  2CQX A;  2OPT A;  2CUF A;  2FJ1 A;  5IYC J;  1APL C;  3M4O J;  4BBS J;  2LFB A;  2R7Z J;  1X2N A;  5FKK A;  4D5F A;  2N8G A;  1TWG J;  2R92 J;  2L7Z A;  3HB9 A;  4W97 A;  5M5X J;  5EEA A;  3QPS A;  2YU9 J;  1HCR A;  3LSP A;  1ETQ A;  2VI6 A;  1PUF A;  2NVQ J;  3VPR A;  4V2F A;  1X2M A;  1IRZ A;  4J19 A;  3A01 B;  3DEW A;  2MG4 A;  1RET A;  4AUX A;  1U78 A;  2IAI A;  2E2H J;  1OCT C;  2JJ7 A;  4JX5 A;  2AHQ A;  2CQQ A;  4IHV A;  4C3I J;  1OFC X;  2ZB9 A;  5FLM J;  1ZKG A;  3TED A;  3OOU A;  4DYR A;  3IH2 A;  3HOV J;  1W0U A;  2XGD A;  3LSG A;  3BR2 A;  2DN0 A;  5JLX A;  1VFC A;  4JYK A;  2HDD A;  3S1N J;  5J3L A;  2JA8 J;  2Y30 A;  1NK3 P;  2GBY A;  2DA5 A;  5IP7 J;  2NS8 A;  3TW7 A;  4FE7 A;  1B8I B;  2NVX J;  2ECB A;  2DMU A;  2Y2Z A;  3SFI A;  1O4X A;  3BTL A;  4BY1 J;  3NAR A;  3S15 J;  4I76 A;  1IV6 A;  1JUM A;  2XPU A;  4IHW A;  3ZQH A;  3JR9 A;  2DJN A;  3Q3S A;  5EZG A;  1ITY A;  3BTI A;  1RPW A;  3Q0U A;  4MFD A;  2WV1 A;  2NS7 A;  1U8B A;  4FE4 A;  4HNV A;  5GPC A;  4BY7 J;  1SAN A;  2XB5 A;  1FIP A;  4M3E A;  2R5Z A;  1IG7 A;  3OSF A;  1TWF J;  1TWC J;  2CRG A;  3BG5 A;  5FKL A;  3FIS A;  1ETY A;  3BR1 A;  3H3V K;  2PMZ N;  1E3O C;  2CUE A;  2ME6 A;  1ZGW A;  5DS9 A;  1QVT A;  4MIM A;  3JRB A;  2JWT A;  2MSY A;  3H0G J;  1A6I A;  5F1J A;  2DMT A;  2ID3 A;  4A3I J;  4FIS A;  1OCP A;  2HOT A;  4XID A;  5GPA A;  4GFB A;  2HI3 A;  2Y31 A;  1JGG A;  2E1O A;  1QPI A;  3GTO J;  3JRA A;  2L7M P;  1TWA J;  5J1Y A;  1HDD C;  2DA7 A;  1MBH A;  2DA4 A;  3L1P A;  1GVD A;  3FKI J;  2GLO A;  3BT9 A;  3GTK J;  2VKV A;  1Y1V J;  4BKX A;  3PM1 A;  5K7H A;  4DYC A;  2JA7 J;  1T56 A;  1K61 A;  3RKQ A;  1U9N A;  1Z77 A;  2AO9 A;  3MVP A;  3S1M J;  3WHC A;  4V2G A;  2M34 A;  5GP9 A;  1H8A C;  2HXO A;  1EF4 A;  3FK7 A;  1ENH A;  4DZJ A;  2HOA A;  2LP0 A;  2LR8 A;  3QQA A;  1YRN A;  2HYJ A;  3C2B A;  1XC5 A;  2JMW A;  3S16 J;  3BG9 A;  2IEK A;  5K7F A;  1RKW A;  2TRT A;  4A3E J;  3HOZ J;  1Q1V A;  2LKX A;  1H88 C;  3S2D J;  3LSR A;  1Y1W J;  1A5J A;  2EZL A;  4X1E A;  1IDZ A;  1JKO C;  3S1R J;  2YS9 A;  2E2I J;  1JKQ C;  2B63 J;  2K9N A;  3RZD J;  2VUM J;  1VND A;  1IDY A;  3LNQ A;  4S0H B;  1YRN B;  1B72 B;  3PO2 J;  2JA6 J;  1ETK A;  2M2E A;  4B1R A;  1SFO J;  4DW6 A;  1MBJ A;  3Q0W A;  3DCF A;  4M3F A;  5M5Y J;  3B6A A;  3K7A J;  5DTD A;  4L5E A;  2JA5 J;  1MSE C;  3CQZ J;  1POG A;  1S7E A;  4XRM A;  3ZQL A;  1HF0 A;  2HOS A;  3GTL J;  4QTR A;  4NDL A;  3GTJ J;  3HOW J;  1GUU A;  1DU6 A;  1ZR2 A;  2ECC A;  1PUF B;  1GDT A;  2H8R A;  1LFU P;  4M3G A;  2ELK A;  1IC8 A;  3ZOB A;  5EZH A;  3JRF A;  3JRE A;  3HOX J;  2R5Y A;  4B4C A;  1FEX A;  1MBG A;  3M3Y J;  3HDD A;  4BBR J;  5C4J J;  1GT0 C;  2RAE A;  2ID6 A;  3E7L A;  4Y52 J;  2K40 A;  1DU0 A;  2DA2 A;  1IGN A;  3RZO J;  2EBI A;  5FKM A;  5IOZ A;  2DTZ A;  1G2H A;  3O8H A;  2LD5 A;  1XG1 A;  1IJW C;  5EF6 A;  4JX6 A;  3IV5 A;  4Y7N J;  5IYB J;  3JRD A;  3S17 J;  5IP9 J;  4I6Z A;  1AKH A;  5IOY A;  1ORK A;  3NAU A;  2DA3 A;  1RR7 A;  1WCM J;  2DA1 A;  1P7J A;  1WH7 A;  1MNM C;  1MBF A;  2X48 A;  3BR0 A;  3HOY J;  3O8G A;  3A02 A;  5F0F A;  2L7F P;  1BL0 A;  1F36 A;  4AC0 A;  3SJM A;  5IP6 A;  2R5Z B;  1CQT A;  4CYC A;  3FK6 A;  2E19 A;  2OF7 A;  3HGY A;  2VPR A;  2QCO A;  3Q0V A;  3JRG A;  4FCY A;  1GV5 A;  1RES A;  2M9H A;  2MW8 A;  4C3H J;  4A3G J;  5F0C A;  2X6O A;  3F0C A;  2R93 J;  3HEF A;  3GTQ J;  4MLO A;  3G1L A;  2XB0 X;  3G1O A;  2HXI A;  1HDP A;  2ME0 A;  4A3K J;  4XK4 A;  3CCY A;  3LOC A;  3A03 A;  5HOD A;  3JRC A;  1FTT A;  3TP3 A;  1MH3 A;  4CYC B;  2K9S A;  3HOU J;  1ETW A;  2FQ4 A;  1UG2 A;  1QRY A;  4JP0 A;  3LSJ A;  2L9R A;  3JRI A;  2JN6 A;  1JUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...