1G2HA

Solution structure of the dna-binding domain of the tyrr protein of haemophilus influenzae
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
SAVISLDEFENKTLDEIIGFYEAQVLKLFYAEYPSTRKLAQRLGVSHTAIANKLKQYGIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN TYRR HOMOLOG
publication title Solution structure of the DNA-binding domain of the TyrR protein of Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18024 HTH_50 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1g2hA00
1BL0A 2X48A 3GTJJ 3TW7A 5F0CA 1YRNA 2N8GA 4J19A 2MGQA 3BG9A 1IRZA 1ETYA 3MKLA 3SDGA 4CYCB 1RPWA 2W48A 1I50J 1X2NA 2DA2A 3BQYA 3JRCA 2R93J 2LR8A 3ZQHA 4AC0A 3JRFA 2Y9YA 3S1NJ 3HDDA 4C3HJ 5EG0B 3Q0UA 2Y2ZA 1RESA 4A3MJ 3SJMA 5BNGA 2FJ1A 4QSHA 4DYCA 1X2MA 2JA6J 1ORKA 2MG4A 4M3EA 5C44J 1I6HJ 5HODA 4BY7J 2JA5J 4MLOA 1IDYA 3G1OA 1ZGWA 4NDLA 2IEKA 3QPLA 3PO2J 1I3QJ 5FKLA 2EBIA 3PO3J 1YRNB 1A5JA 3CDLA 4BBSJ 2E2HJ 3S15J 5F0HA 2XB5A 4JX4A 2FX0A 4FCYA 3S2DJ 3ZOBA 3M4OJ 2M2EA 2LD5A 5C3EJ 3Q0WA 3JREA 2DA3A 3HOXJ 4XICA 3BR6A 2E19A 4A69C 5IOYA 4DZJA 4B4CA 1B72B 3FK7A 5J1YA 2DTZA 3LNQA 4Y52J 1MBHA 2TRTA 2JMWA 1NK3P 2EQRA 1A6IA 5EF6A 1ZR2A 4M6VA 5GPCA 2L7MP 3A02A 1DU6A 1MBFA 4A3LJ 2WB1N 3SFIA 3WHCA 2DMNA 2H1KA 5M5WJ 1JUSA 3BG5A 2L7ZA 3Q3SA 1SANA 3JR9A 4B1RA 2AHQA 5EZGA 1W0UA 3IH2A 2XSDC 1TWGJ 4XRSG 3D1NI 1LFUP 2E1OA 1JTXA 2NVYJ 2FD5A 3K2AA 1POGA 2HOAA 4D5FA 2LVSA 1ETOA 2R5YB 2HYJA 4UUSB 3GTMJ 2DMQA 3HB9A 1ZQ3P 4XIDA 2XGEA 5FKKA 1P7JA 3RZOJ 2GM4A 4M3DA 2QF7A 1JT6A 1MBKA 2VPRA 3OSGA 4A3EJ 4MFEA 5EDNA 3GTOJ 1XG1A 3H3VK 3H0GJ 5EG0A 1UG2A 4I76A 5E3NA 1AHDP 2ME0A 2B63J 1MSFC 1JKQC 2VUMJ 2G0EA 2ID6A 2NS7A 4IHXA 2OF7A 1ETVA 1IG7A 2M9HA 3S2HJ 1G2HA 2D5VA 2ECBA 3S16J 3JRHA 1ENHA 3UKGA 3BR2A 3DCFA 3HKZN 5EYRA 1HF0A 4FTHA 4A3DJ 1QRYA 4C3IJ 2VI6A 3BQZA 1XS9A 1LE8B 1H88C 5IOZA 1BW5A 3L1PA 3LSJA 1WH7A 1NK2P 4JX5A 4HNVA 1GUUA 4W97A 2HDDA 1LFBA 1ZKGA 4ABZA 3I4MJ 4BBRJ 3TW6A 1SFOJ 2DA4A 1B72A 3WHBA 3GTLJ 4AUXA 1U9NA 1FTZA 3JRIA 2EZLA 4M3GA 1TWAJ 3JRDA 5FKMA 2HOSA 4RBOA 2DA6A 2IAIA 3PM1A 2LP0A 1UMQA 2GBYA 1D5YA 1HOMA 3F0CA 3HGGA 4BY1J 3GTGJ 3JRAA 3B6AA 1JT0A 1F36A 1WI3A 2LY9A 5EZHA 2DMPA 5M3MJ 5DS9A 5JLXA 2CJJA 3ZQGA 5FLMJ 2E2JJ 2EZHA 4GFBA 2XPWA 2AO9A 5F04A 2DMTA 5K7HA 2NVXJ 3BTLA 1ITYA 2O9LA 5M3FJ 3RKQA 4V2FA 2R5YA 4UUSA 3GTKJ 4A3CJ 1FJLA 4EEFG 2ME6A 3E7LA 1K83J 2JK3A 2Y31A 3C2BA 5M5YJ 5EGOB 2CUEA 2HXOA 2FQ4A 3GTPJ 2Y0SN 5EEAA 1DU0A 5IYBJ 3G1LA 1HDDC 3HOVJ 3G1MA 4DYRA 3FISA 1IDZA 2DMUA 4A3FJ 3TEDA 1JGGA 3ZQIA 5J1RA 2JA8J 2K9SA 4A3GJ 3NAUA 3OIOA 1JKOC 2R7ZJ 4M3BA 1RETA 5K7ZA 4DW6A 3HEFA 3JRGA 4A3IJ 4Y7NJ 1Z0XA 3CQZJ 5FLVA 1OFCX 2RAEA 4C3JJ 3VPRA 5FKNA 1Q1VA 4D7NA 2Y30A 2E2IJ 2COBA 3NARA 4A3BJ 3BR1A 1VNDA 2Y9ZA 1AKHA 1F43A 4FE4A 2M34A 5IPAA 3HOUJ 1BA5A 2ELKA 4IHVA 2WV1A 1Y1VJ 1U8BA 2HI3A 3MVPA 2H8RA 2ECCA 1AU7A 2EH3A 1LE8A 2CRGA 2XB0X 4XK4A 1GDTA 2DJNA 4MFDA 3S17J 2VKEA 2JA7J 4I6ZA 1NTCA 2L0KA 1Y1WJ 1ETWA 3W6VA 2JN6A 4FISA 3IH3A 2XGCA 3I4NJ 1MH3A 1VFCA 4L5EA 3S1QJ 5E3MA 3K7AJ 1T56A 3BR3A 4QTRA 3ZQFA 1JJ8C 4MO7A 2O8KA 2CUFA 1MBEA 3ZQLA 5F27A 3TP0A 1TWCJ 1AKHB 1MNMC 3HM5A 4S0HB 1ETQA 2OPTA 1T33A 4A93J 1IGNA 2ID3A 3DEWA 4D5CA 1E3OC 2EZKA 1JUMA 1QVTA 2R5ZA 3RZDJ 2VKVA 3CCYA 1IV6A 4DZPA 1CQTA 1BW6A 2X9DA 1OCPA 5GPAA 2HOTA 4XRMA 2NVTJ 5JLWA 1GT0C 1OCTC 1ZK8A 2XPUA 1BJZA 4W1UA 1W0TA 1TC3C 2M8GX 3BT9A 4A3JJ 1MH4A 2KDZA 9ANTA 2O7OA 3O8GA 5EGOA 1ZTRA 2NS8A 3O8HA 5E3LA 3S14J 2DA1A 3FK6A 1FIAA 1MSEC 1H89C 3A03A 4C2MJ 3Q0VA 1UHSA 3CMYA 3BTIA 4LOCA 2LFBA 4JP0A 1ETXA 2HQ5A 2JJ7A 2YUSA 2R92J 4V2GA 3HOYJ 2CQXA 4UUTA 2R5ZB 5K7FA 1FTTA 1GVDA 2LTPA 5F1JA 1TWHJ 2LLKA 3BG3A 1RKWA 2GLOA 1FIPA 1APLC 3BR5A 5IYCJ 2M0CA 3LSPA 2KT0A 3TP3A 1HDPA 3FIWA 2LK2A 3BTJA 4DYQA 1XC5A 1JTYA 2XGDA 3QPSA 4X6AJ 3RQIA 3LSGA 5IP9J 1WCMJ 2DA5A 1VI0A 3S1MJ 2MW8A 3HBLA 2L7FP 4B3AA 2DN0A 1IUFA 3LSRA 2MSYA 5IP7J 1FEXA 5C4JJ 5IYDJ 2YU9J 2NVQJ 2CU7A 4RDUA 2WAQN 1PUFA 4BXXJ 1JUPA 3S1RJ 4IHYA 3IV5A 1JKPC 4G12A 2R0QC 1EF4A 1WGXA 1U9OA 2P81A 1GV2A 3GTQJ 5E3OA 1WPKA 1Z77A 3LOCA 2L9RA 3ZQCA 3M3YJ 3OSFA 1GV5A 2ZB9A 4A3KJ 2LKXA 5F08A 2HXIA 3A01A 3IH4A 1HCRA 3HGYA 1IJWC 1U78A 3FKIJ 5M5XJ 1R9TJ 1MBJA 3HOWJ 2K9NA 2XPVA 1HLVA 3OOUA 5FJ8J 4IEJA 1MBGA 3GBGA 4X1EA 1TWFJ 4FE7A 4JX6A 1OJLA 4XRSA 1H8AC 1B8IA 1PUFB 1K61A 3MN2A 2I10A 4IHWA 2TCTA 4M3FA 2XRLA 4MIMA 5IP6A 5J3LA 5C4XJ 1WH5A 2K9QA 1RKTA 1P7IA 4CYCA 1VF9A 1QVUA 3JRBA 1QPIA 2PMZN 2YS9A 4D7MA 1O4XA 2CQQA 2IBDA 1JJ6C 3BTCA 5J1UA 4JYKA 5F0FA 5FKOA 3QQAA 3A01B 1RR7A 4BKXA 5GP9A 1ZR4A 4AYBN 1ETKA 2QCOA 1X58A 3HOZJ 3B6CA 2X6OA 1S7EA 2DA7A 1JKRC 4QIWN 1IC8A 2K40A 2NOGA 2EZIA 3BR0A 2JWTA 1B8IB 5DTDA
chains in the Genus database with same CATH superfamily
2X48A 1T98A 5F0CA 4HW0A 2N8GA 4J19A 1ETYA 1V5GA 4CYCB 1RPWA 2W48A 4OIRF 3CUOA 5E17F 2LR8A 4R1HA 2A5WA 5B66C 3HL2A 1ODDA 1HC8A 2RNJA 4AC0A 3JRFA 2Y9YA 3HDDA 3I71A 4FASD 2BXYA 3WTZA 4AIHA 2XRNA 1YO5C 3RPUD 4NC7A 3Q0UA 4YELA 3L2VA 4KDPA 1VQ5I 1KQ8A 4XLFA 2DW4A 1ORKA 2MG4A 5BS6A 1UZCA 3CDHA 4I02A 1ZRDA 1H9GA 2K5CA 4BY7J 4EGZA 3G1OA 1KA8A 3PO2J 3PO3J 2RQPA 3F8CA 1X4PA 3CZ6A 3CDLA 2W00A 4MNUA 2LOOA 3KEYA 3AL0C 4HV5A 3PFYA 2Z33A 3H5RA 4CHUA 2WA0A 2ZXIA 4II3A 4BQOA 3M4OJ 2DA3A 3LA2A 3S93A 3V8JA 2LYCA 4O5VA 3KCCA 4A69C 5IOYA 2A07F 1YE9A 5D6FA 1B72B 2UV1A 5DM7F 3LNQA 3JTGA 2TRTA 3ESWB 1NK3P 1IRGA 3SZTA 3WG9A 2VC1A 3K10A 4JK1X 3CJQB 4HV6A 4HF2A 4CA0A 3KP4A 2L7MP 4HF1A 1DP3A 2DT7B 1F9NA 2M8EA 3BLYA 2DOAA 2WB1N 4BE2A 4GDFA 2FOWA 2H1KA 2F48A 4XMYA 2JT1A 4ZYDA 2KL4A 2ZMEB 2CFOA 2KIMA 3JR9A 4B1RA 1F4KA 1W0UA 3HUGA 3IH2A 3PQKA 4E7IA 5CQGA 2FU4A 3V7SA 3EUAA 3IAM2 1STZA 2M1BA 4L0YB 1KONA 2B0LA 2DO7A 3S2WA 3D5RC 2E60A 2VXZA 4B8XA 2FD5A 2L3DA 4XQFA 3ERMA 3K2AA 3LA3A 5JHUA 1FP1D 1I27A 4B43A 2QQ9A 2CV2A 3RQ4A 2PJRA 4BU2A 1WZ2A 3KZIC 3SFZA 4ZDOA 3GO5A 3GFLA 1Y56A 2O8XA 2AQFA 1OR7C 2Q2EA 5FKKA 3P5JA 1P7JA 1KU7A 1WVRA 4UB8C 2GM4A 2R7UA 2QBYB 4BHBA 3J81K 1YLFA 1J2XA 5KCMA 4A3EJ 2A05A 2R7FA 2BEOA 3GTOJ 2EIKH 2EK5A 3KIOA 3W2VA 3H3VK 3V7RA 2ZBKA 1R5ID 3KEQA 4WCGA 3KX2A 1BI3A 1Z7LA 3T5XA 1G2HA 2D5VA 1V3FA 4M6XA 1QHHD 4KIFA 1ENHA 2ICWG 2LH9A 4RM3A 2LSOA 2ESHA 3BR2A 4A3DJ 1YYVA 2OZUA 3ASOH 4EVIA 4C3IJ 4KMUX 5BPIA 1J09A 3V8KA 1LE8B 1WHUA 1G59A 1LUJB 1YTYA 2V79A 1W7PD 2DXIA 1YX3A 2PBIA 3OYKA 4W97A 4O6JA 2HDDA 4IQ4A 1X1AA 1N78A 4KIBA 3WHBA 3H9GA 4RAZA 4AU7A 5J6XA 2R7RA 2KZGA 1MJBA 1TT0A 1E3PA 3BPXA 1ACIA 4ZYGA 1TWAJ 1IF1A 3V4GA 2KFDA 3LL7A 3E5UA 1BR4A 2LP0A 2GXGA 1D5YA 1T38A 3HC7A 1H0MA 5FGMA 1HOMA 5LD2C 1FLIA 1YOVB 2EV5A 3KP6A 3DEUA 5J4YA 3GZ5A 3P7NA 4PJNA 4DIQA 1YW8A 4EMSA 2R7SA 3ELKA 1ULYA 2QSFX 3JRAA 1B9NA 5AIQA 1Y6IA 3BP8A 2UXNA 4RM2A 3RYPA 1RR8C 2CJJA 2KRFA 2AO9A 3RPQA 2NYXA 1B59A 2NVXJ 1ITYA 3OYDA 3ZP5A 1OR7A 2R5YA 2MD0A 3GTKJ 3ZMTA 5L3FA 3LA7A 3V7CA 4EEFG 4IOAF 3E7LA 1W5CC 2JK3A 2WAEA 5GAGJ 1R4NB 2CUEA 3O3KA 4RAYA 1VTNC 2EFOA 2RN7A 3GYHX 5EEAA 1DU0A 1UFMA 2A69F 3G1LA 1U2WA 1B9MA 3W2AA 1HW2A 3FISA 1IDZA 2EV6A 2JA8J 3O6BB 5DCMA 5FRMA 2K9SA 4A3GJ 2VKDA 3NAUA 1JKOC 4Z6YA 2EV0A 4RGUA 3JRGA 4G7ZF 4A3IJ 1JE8A 1Z0XA 3CQZJ 2W24A 3CESA 3VPRA 1Q1VA 3H92A 2VQLA 3ZXSA 3CP8A 3BR1A 1AKHA 4I7HA 4F93B 4FE4A 2HPMA 3QODA 5F6FA 2WV1A 3CMMA 2HI3A 5ERIA 4Y3OA 2EH3A 2XB0X 1GDTA 3CUQC 4IOCF 1VQ8I 4AIDA 5L3GA 1BC7C 1Z7UA 4OAZA 3JAMK 1ETWA 2UWMA 4FHTA 3ZGKA 3CDIA 2FQ3A 2R7VA 1VFCA 2V9KA 2H27A 4L5EA 2OA4A 2Y75A 3TO6A 2EFNA 3OS0A 1TQPA 3BR3A 4HQMA 4AYBA 2O3FA 4FX0A 3ZQFA 4CSWA 2O8KA 2OTJI 3E6DA 5LBQA 3OS2A 1E17A 5CQEA 3PJRA 2XDVA 1MNMC 1EKEA 1ETQA 4QLCU 4KIGA 1T33A 2X0LA 2STWA 3F21A 1I1GA 4EM2A 1IGNA 2ID3A 4ZC3A 2M7AA 2LBFB 3RPUA 1EJ9A 1FSHA 4ON0A 1U5TC 2EZKA 3DLAA 3BG7A 3CCYA 5E20A 2YX4A 2GOXB 3KETA 1IV6A 4DZPA 3EYIA 3W2WA 4OMZA 4XRMA 2E35A 3ABMH 5JLWA 3JTHA 3JW4A 4ESBA 5IT9K 2ISZA 1GT0C 2XF6A 2HKOA 2DFFA 2J5OA 4W1UA 2VQHA 2ZKZA 4ITVA 2Q1ZB 3S3OA 4EJUA 1FOXA 3LFUA 3KYCB 2KDOA 2MH2A 3O8GA 2IW5A 3GVAA 3W3CA 2F4OB 3O8HA 2DJIA 2EINH 5DCFA 5E3LA 4CH7A 1J75A 1MD0A 1FIAA 2EFPA 1ON2A 2KP6A 1YHQI 5F1RA 4L5IA 2HDWA 4XOPA 2HQ5A 5D5XB 5BOXA 4A0XA 4V2GA 1BI0A 2OD5A 1R1TA 2A6EF 3SDBA 2JRMA 1YW9A 2Q0OA 1J5YA 3I64A 1OYWA 4L18B 1HKQA 1APLC 1SMTA 4KJZA 2M0CA 4A12A 2A68F 3BZCA 5FRNA 4LLLA 3TP3A 2DU9A 2XGDA 2EA2A 1FPQA 4X6AJ 1WCMJ 2DA5A 1YI2I 3ABTA 1VI0A 3W6JB 3S1MJ 2R7TA 1WWXA 2MW8A 1BIAA 2WB1A 1DPRA 1MJAA 3OOPA 4AIKA 2OZ6A 3ISPA 3CP2A 2MSYA 4A5NA 3ZQQA 3WGHA 5IYDJ 1W36D 5HOOA 2YU9J 1K78B 5KAFC 1WRJA 2DT5A 3GLXA 2WAQN 1K79A 4XLAA 4IHYA 1EH6A 1LVAA 3IV5A 1BJAA 3BJ6A 2LY1A 1KYWA 2L5QA 4NQWB 1NH3A 4IF4A 1A35A 2VODA 3GXOA 1Z05A 2WWYA 5HDNA 1XTAA 3RKXA 1WGXA 3H3ZA 2P81A 3GTQJ 3PUBA 1YIOA 1XSDA 2OQRA 4XN3A 3M3YJ 4BJTA 1F1ZA 1Z9CA 5HLHA 4A3KJ 4A0ZA 3I53A 1U5TA 5TGTA 5ICGA 5F08A 3GX4X 3GCMA 2M0MA 1EV7A 1MNDA 2Q8KA 1R5HA 2KMUA 1K4SA 2DODA 2BBYA 3HOWJ 4E6KG 2V6EA 3CC4I 1LDJA 4IEJA 2L9VA 3GBGA 1LDDA 3N97A 5HDGA 5LGNA 3H5AA 1R36A 4FX4A 2VKHA 1B8IA 4BUPA 1OMIA 1HSJA 3FMQA 1TQMA 2Z9OA 3M8JA 2MFZA 3HOTA 4M3FA 4LG0B 1BI1A 1D1CA 2EB7A 2XKPA 1S7OA 3VYSB 5C4XJ 1IAWA 4XR6A 1P7IA 3SZGA 5HLGA 3JRBA 1SD6A 2X51A 2EFQA 2PMZN 1MMDA 2W85A 1W7PA 1M1EB 2KHMA 4E7KA 3J7AY 1XMAA 4BJ6C 5H20A 1JJ6C 2LKPA 3TDUC 5F0FA 3HRMA 3HUGB 4YFXF 3QRFF 3IP4B 2KRCA 4TV7A 2GQQA 1RR7A 4BKXA 3AAFA 3G73A 3VOEA 1XN7A 2OUMA 4RLFA 4XKBA 3HOZJ 2EILH 1JKRC 4YG2F 2XAUA 2K40A 3BR0A 2EZIA 4EQQA 1WJ5A 3P9KA 2JPCA 2PJRB 4F52A 5ICEA 4I0AA 3U2RA 3RTRA 1VZ0A 2BY1A 4U7BA 3OS1A 1YRNA 2KIQA 1U3EM 2QWWA 1IRZA 1LDKB 3MKLA 2FSWA 2KKOA 2HVQA 1ZARA 1I50J 3BJOA 3BWGA 1X2NA 1K6YA 1XDUA 2DA2A 3BQYA 5FFXA 2R93J 2OAZA 3ZMSA 1USTA 5D6EA 4AD9A 3H1CA 1R5GA 1MKMA 1WKMA 3S8PA 2D1HA 1D0XA 2KZVA 2Y2ZA 4DYCA 1X2MA 2QA4I 4EGYA 1I6HJ 3ZN0A 5HODA 3NRVA 1IW7F 4MLOA 2DYRH 3AL0B 1I3QJ 4UHTA 1DP7P 2EBIA 3AG1H 1A5JA 4P9FA 2L54A 4OIQF 1E0EA 3I58A 4BBSJ 2IRFG 2O5RA 3NQOA 4HRIA 2XB5A 4JX4A 2FEZA 3HRUA 5HS8A 1XCBA 3ZOBA 1XB4A 2M2EA 5J40A 5HLIA 3DPLC 4GGGA 5C3EJ 3JREA 1SAUA 1B4AA 2HTSA 2OQGA 2ADUA 2Y48A 3BR6A 4NBQA 3OYGA 2X1CA 2Z16A 1Z3YA 4DZJA 5TJJA 2DTZA 1O7FA 3RKWA 4Y52J 1MBHA 3OIPA 2JMWA 3G71I 2KPMA 2FMYA 3GZ6A 1D0ZA 5FO5A 2W57A 1PYVA 2BE5F 1A6IA 2QKMB 1ZR2A 3HG9A 3KLNA 1DU6A 1GHCA 3QYEA 3WHCA 1N25A 2H6BA 4PSXA 2CW7A 4CZCA 2CG4A 2BW3A 5M5WJ 1FNNA 2L7ZA 2R4GA 3TMOA 2EJRA 2VASA 5LHIA 1TWGJ 3PIPF 5LLQA 4XRSG 3U21A 2E34A 3GFJA 4A5MA 5LRSA 2GZWA 3D1NI 4D1QA 1JTXA 1LKXA 2XSJC 2DBBA 4YRVA 3OYLA 2JVHA 3CCUI 4KT5C 4XKCA 3IKTA 4LMYA 2HYFA 4D5FA 1UJ8A 2R5YB 2K9MA 2HYJA 4HPQA 3T8RA 2HZDA 5DUIA 3JSOA 3FDYA 4UVBA 4XIDA 4HYEA 3M1CA 2PI0A 3R60A 2P7CB 4JBAA 1JHHA 3RZOJ 2HEOA 2ZXWH 3IKVA 1MBKA 2VPRA 3OSGA 4PUSA 3FXKA 4MFEA 3FXOA 4MQVA 3EPZA 1O57A 5E3NA 4BS9A 1MSFC 5CPRB 1JKQC 2VUMJ 4X0GA 4RAGA 2ID6A 1BC8C 2E36A 1WJAA 3M8EA 3K1MA 3R61A 2OF7A 4U0YA 2M9HA 3S2HJ 2XASA 1XGSA 1Z6RA 3HSEA 4EM1A 3JRHA 3Q9SA 2B9SA 1RNLA 3UKGA 1HF0A 2DAOA 5L3DA 2P0WA 2VI6A 3BQZA 4IX7A 1XS9A 1H88C 1Y8QB 4OOIA 5HNHA 3HOSA 5IOZA 5GAHJ 3OYHA 4F55A 1BW5A 1NK2P 4ZZLA 4HNVA 3PSFA 2F4MB 3G6EI 3A0BC 1ZKGA 2PX9A 5E8GA 5KHDA 4A6EA 3EYYA 3F72A 1TP4A 2OC6A 2DA4A 1S9HA 3GTLJ 5BMZA 5H6QA 4AUXA 3CCMI 3FKJA 1PJRA 2CW8A 1FX7A 3CF5F 1U9NA 4MGRA 2EZLA 1CF7B 1NG6A 1I39A 2JUCA 2VOPA 1A04A 3HTSB 1YX5A 1I6XA 3JRDA 2OV7A 2V1UA 5FKMA 3RSNA 1S72I 2KRHA 3LSKA 3OV8A 1ZAOA 2HU9A 3L9FA 5D5UB 4NHJA 4U0VA 2MC4A 4M6YA 3GTGJ 3B6AA 2CO5A 3MCZA 2CV0A 4ZYAA 2DMPA 5M3MJ 3FXJA 1JXSA 2CUJA 3C18A 2EZHA 2QLZA 1MJ9A 4K2EA 5F04A 3IUOA 3LSMA 3I9V2 3I59A 4GYGA 5K7HA 4YEJA 2VT2A 1R22A 3CMEI 2ZNYA 2IXSA 2O9LA 5M3FJ 1PVEA 1FOWA 1UELB 5J4VA 1Y0NA 2E1NA 2WAQA 2HPIA 3LSTA 3A2KA 2HXOA 4ESFA 1G3YA 2E1CA 2Y0SN 3DKYA 3ZR8X 1ZG3A 3HTUA 4ZYHA 1MIJA 4PCQA 4PGGA 3DBLB 3DU5A 3HOVJ 5FD6A 3ZMZA 4N4NB 1LQ1A 2AXLA 2DMUA 1R1VA 1K6OA 1H9TA 2AXTC 4HX8A 3F3XA 5CKTA 5J1RA 2VJ5A 3OIOA 3F23A 1RETA 4WWCA 4UVAA 1OFCX 1OCRH 2Y30A 3GZNB 3C2HA 2Y9ZA 2HTJA 4WXCA 3CUQB 3ZRGA 3HYIA 2JUGA 1G4DA 1AU7A 2DFEA 2JA2A 4F7ZA 1XX5A 2ACJA 4MEYF 2F5DA 2VKEA 4F3QA 4JQFA 2DPUA 2JA7J 4I6ZA 2PMZA 1GXPA 1VQ7I 2L0KA 1BBYA 1Y1WJ 1PUEE 5HDKA 1KU9A 4FISA 1KYZA 2VBWA 2X4HA 2YPRA 2R3SA 3IH3A 3QPTA 3PNYA 3CLOA 2L02A 1N77A 1D8JA 1S7AA 3Q9VA 5JHFA 1T56A 2VE8A 4KYWA 4PGHA 1JJ8C 2F6CA 2XV4S 3VB2A 1USSA 5ICFA 3U1DA 3ABUA 1TWCJ 2GIZA 3HM5A 4KN4X 5CVJA 4S0HB 4CCMA 2F4IA 4U0WA 3I55I 1SEUA 1SFEA 4L9TA 2P5LC 1TW3A 3DQVC 1YS7A 3IRRA 4QPQA 2VN2A 2VJIA 2O0YA 5HS7A 4D5CA 2QSGX 1Q1HA 1E3OC 6PAXA 3D0SA 1QU3A 1QZYA 3I5UA 4RB2C 2GAUA 4CCLA 2HOTA 5ILVA 4RMNA 1YW7A 4XSZF 2MABA 2YSRA 1JGSA 1BJZA 2VJ4A 1VQLI 3VYUB 4HDUA 1MZBA 4NC6A 3BT9A 3K4MA 2ESNA 1MH4A 2KDZA 4A3JJ 1IUYA 2O7OA 3DV8A 2M3AA 1FWZA 1QPMA 1W7PB 2LG4A 3TBIA 2IGOA 2DA1A 2XAGA 1MSEC 2RREA 1XMXA 2IA1A 1J59A 2J5PA 3BTIA 4BEHB 2XAFA 2LFBA 4JP0A 1G8XA 2JJ7A 3MKYB 1SVMA 1A36A 4HAMA 3WU1B 4L0ZB 1P6RA 2R5ZB 1QQIA 3I4PA 2LNBA 1SMYF 4CO8A 1RI7A 4MQ9F 2FNAA 4OINF 3WGIA 3CCSI 2LLKA 4B3XA 4P55A 3IAS2 2GLOA 4Y13A 4HF0A 3J80Z 1EH7A 1FIPA 1FSEA 1HKSA 1WFXA 2WC2A 4E7LA 1MMSA 3BR5A 2G7HA 5IYCJ 1D8KA 4BYYA 3DU6A 3FM3A 4CCOA 4CZZA 2BY0A 2LK2A 2X6WA 4DYQA 5FLXK 4HA8A 1IN7A 5K1YA 1LVKA 1FC3A 2BGCA 3LSGA 5IP9J 1UHMA 2EPFA 3FWEA 2XIGA 5LEKA 1XPXA 3GEZA 4C9YA 3ECHA 4Q4ZF 3B02A 3HHGA 1FEXA 1OCZH 5CYVA 4ETSA 1TNSA 4KUMA 3OYNA 5JR3A 2BVMA 1PUFA 1JUPA 3DTKA 2HFHA 2G9WA 2M30A 2V26A 4G6DA 4HLXA 2L01A 4XRFA 2DFHA 4PSWA 1FYKA 3EETA 4NNJA 2CQ7A 1SFKA 1SD4A 4GXOA 3W6KB 4HNUA 2R0QC 1EF4A 2PEXA 3KZZA 3ABLH 3RKYA 1SC7A 1IZ1A 2BOLA 2V4JC 3OYIA 1W4MA 2P5VA 1GV2A 4I99C 1ZREA 4PK4A 1DGRM 3FF5A 4QWQA 2C6YA 4GCVA 1BIBA 1Z77A 2L9RA 4XOTA 1GV5A 3GW2A 4M9XA 1Y39A 3MQ0A 2HXIA 1HCRA 3IH4A 3MKZA 3HGYA 1OQYA 2ZMEC 4EJWA 3DBRB 3K0LA 5M5XJ 3L2UA 1WQ2A 1L0OC 2TDXA 3WGGA 2CUZA 2Z99A 1SD7A 1HLVA 2PG4A 5FJ8J 3ZPLA 1MBGA 4X1EA 1H8AC 3ML6A 4JX6A 1VQKI 2A3SA 4XORA 4C2UA 4IRGA 2X1DA 3DPTA 4IHWA 1CGPA 5HNFA 4I0BA 2H6CA 4MIMA 4R8HA 1YS6A 5IP6A 3I56I 4P9UA 2DT6A 4CYCA 1VF9A 1QVUA 3HPHA 3L09A 3R0AA 3R6SA 2M7BA 3MFKA 2F5VA 1QNTA 2QQAA 1J0RA 5J1UA 4U7DA 1IXSB 4QPOA 4RB1A 2IA0A 4B09A 3S3MA 4IRHA 3A01B 4ENMA 2IS2A 4G94A 5FLXZ 1ETKA 2QCOA 2ZXHA 1X58A 3B6CA 1T0FC 2X6OA 2DA7A 4OAYA 2NRAC 2LMDA 3F6VA 1XSXA 1XSVA 2NOGA 4XLNF 3S3NA 2H8WA 2BYVE 5DTDA 2R7XA 4BAYA 2GOMA 4BHPA 3GTJJ 3TW7A 2XGXA 5KVRA 2ZNZA 3G3ZA 4HOBA 4LIVA 2STTA 1MDMB 3GUDA 4M71A 1R7JA 5K5OA 4F91B 5TRDA 1U6GA 2MLKA 3JRCA 3OR2C 1B1BA 3WTVC 3CCRI 3ZQHA 2MBFA 2QSHX 4C3HJ 2CFXA 3F9KA 1ZGAA 4IQJA 4WK8F 4E7ZA 2ZC2A 1RESA 4ENNA 3SJMA 3DXJF 4QSHA 3KLOA 2DDBA 2KJBA 3HPGA 4L5JA 4M3EA 3SZPA 3V8LA 1VQMI 2RQQA 1G6NA 3OR1C 3FBNB 3VYRB 1ZLKA 1BM9A 1ZGWA 2XAHA 2IEKA 5CVUA 4B48A 5FKLA 2G7UA 3CJNA 1LB2A 3E3VA 3KP7A 2E2HJ 3CF2A 1HSTA 1QZEA 1YIJI 4BXFA 2IGNA 2FX0A 2ZMEA 3P9IA 3TOAA 3TQNA 3K4LA 2VPLA 2W84A 4LG3A 2PQ8A 4AIJA 2VE9A 2LD5A 3CCLI 2L9SA 3CCVI 3HOXJ 4XICA 1ON1A 2YU3A 4IRIA 3BROA 4MHGA 2UUZA 2Y0SA 2E71A 4B4CA 2Z2SB 5J1YA 4OWRB 1VQNI 3E0JB 3OIQA 5IT3A 1R6RA 1FBSA 2K3PA 4D0PA 3E6BA 3QPHA 4P96A 2FA5A 4DNCA 5A2QK 2BV6A 1XD7A 4M6VA 4ENKA 2FF4A 5LGUA 3V42A 2JZYA 3SFIA 2XF5A 5E1WA 4ZDLA 2QBYA 1O3QA 2L9NA 1JUSA 2IA2A 3BG5A 2BZTA 3Q3SA 1XDSA 2WBMA 2ZXJA 4WF2A 3REOA 5GTIC 2RVCA 2X1EA 1T0FA 2HQRA 5HVQC 3MZYA 4N9HA 2X6XA 2R7WA 4ZZDA 1LFUP 2UXXA 3KE2A 3A1YA 4EATA 3WODF 3DWLE 4BJ5C 2ZFUA 2NVYJ 3F22A 3WG7H 5CVRA 1FYLA 1HW1A 2ZCWA 1POGA 2BXZA 2LF7A 3CCEI 2L4AA 2CQNA 2LVSA 4LK1F 1ETOA 1IV8A 1QZZA 3GFMA 2DMQA 2JTVA 4M73A 1UHWA 1P4XA 1IN5A 1ZQ3P 4B47A 2QKLB 4U87A 4NB5A 4LK0F 2ZJRF 1WSUA 1KU2A 2MC3A 3WU2C 2QF7A 1JT6A 1P4AA 3MD2A 3VWBA 1TBXA 1V54H 2QEXI 1P4WA 4HZFA 3OYFA 1XG1A 2HKXA 1MNEA 5EG0A 5FB2A 4KN7X 1BOAA 2H1LA 2ME0A 1AHDP 2B63J 1RZ4A 3CTAA 2NS7A 1NG7A 3H9QA 4LB6B 4UNOA 1IG7A 4PJJA 4MEXF 3BCBA 2ECBA 3KZYA 1ERDA 3J7ZI 4KITB 2ZJPF 1IXRC 3HKZN 5DDGA 2H09A 2LKSA 4HG2A 4RGSA 3OYAA 2Q2EB 2HGCA 3E97A 4XKVA 5A2QZ 2LY2A 3KYLA 4LJZF 3L1PA 2X85A 3LSJA 1WH7A 5E1ZB 1E2XA 2Z1DA 1MW7A 4ZH4F 3H5NA 5D4RA 1AA7A 1LFBA 1KU3A 3T8TA 2ZJ2A 2XUBA 2HYGD 4A0YA 4ABZA 3I4MJ 4BBRJ 3AFHA 1SFOJ 1D3YA 1VQ4I 1LNWA 2HZTA 3QU6A 3QYBA 3DLLF 3EUKL 3KP5A 1HA8A 5EEGA 1FTZA 2KLOA 4BHCA 4M3GA 5BPDA 3M07A 2FOKA 1R23A 1T08B 2QZ8A 4RBOA 2DA6A 1QGPA 2DDAA 2IAIA 3PL8A 4G9YA 3TOBA 5B1AH 5JVGF 1UMQA 2JPBA 1ZELA 3FXLA 2VOOA 1X1DA 2RGVA 2K02A 1K7AA 3K1PA 1IRXA 2BY2A 3HGGA 4BY1J 1A6QA 1Y0UA 4AM3A 1JT0A 1WI3A 2LY9A 4RAFA 5EZHA 3K4JA 2VONA 2FMLA 1G3WA 4IVNA 5DS9A 3FMRA 4A2UA 1P9QC 5JLXA 3F8MA 3RYRA 3ZQGA 3CCJI 1KGSA 2OU2A 5FLMJ 1Z67A 2BVLA 2XPWA 3J7AO 4C2TA 4IZZA 3AG4H 3F8BA 5JI6A 2DMTA 3DFGA 2KJCA 2XHKA 3BTLA 4XM3A 4IL6C 1RC9A 1SVOA 2P6TA 3I54A 2D45A 3U1KA 3RKQA 4UUSA 4UXNA 5AIPA 1FJLA 2VLAA 4CCNA 4A3CJ 2HS5A 1K83J 2W1OA 2PLYA 2B7EA 2Y31A 5M5YJ 4HX7A 5DD8A 2COMA 2FQ4A 3H0DA 2XC7A 3COAC 1IN6A 4PDKA 2M87A 3FM5A 1C0WA 5IYBJ 4PFOA 5E18F 1HDDC 3G1MA 1N75A 2DYSH 2QYOA 2QGUA 4BQNA 1WJEA 3K1NA 1MMNA 3KP2A 3JCUC 2YR2A 3QOPA 2R7ZJ 4M3BA 3K2ZA 1OKRA 3DP7A 4DW6A 3KP3A 2R7DA 4Y7NJ 2LREA 2RAEA 3M9AA 3F6OA 4ESJA 1W36C 4BH9A 3C3WA 5FKNA 4Q48A 3WE2A 2COBA 3NARA 1OYYA 4XLHA 5CVIA 1VNDA 5DD4A 3FX3A 4ENJA 3SXYA 4LIUA 2M34A 3CD6I 3HOUJ 1BA5A 4BGDA 1IN4A 1Y1VJ 2H8RA 3B73A 3F8NA 4CXFA 1ZRFA 2MYSA 1OYIA 4XK4A 3S17J 2F5CA 1WJCA 2JSPA 5GAEJ 1RRJA 1IO2A 3OY9A 1S3JA 3UNGC 4AVPA 2DK5A 2K86A 3N4MA 3W6VA 3MZHA 1T8IA 5B5EC 4RB0A 2XGCA 4EJTA 1MH3A 1S8NA 3I4NJ 1UCRA 2XF7A 4E70A 3S1QJ 5DCMB 3S32A 2HOEA 3TGNA 1A31A 3LAJA 2HDCA 1T6SA 5E3MA 3G4SI 5ILUA 1UB9A 3K7AJ 4I09A 3FBIB 4UV9A 3IHUA 3LSIA 5AONA 4MO7A 2DOFA 3DBHB 4G7OF 2CUFA 1MBEA 2E1MC 4CCJA 5F27A 1AKHB 1SFXA 2DTRA 1Z91A 4UV8A 3SEZA 3P9CA 1XMKA 2XAJA 2X6YA 2V1DA 4L9VA 5BQTA 1T39A 4A93J 2PJPA 4L9JA 3QP6A 4PJLA 4E7HA 1UAAA 1TLHB 3QOEA 2VKVA 4GRIA 3ROUA 1VQOI 3MWMA 5GPAA 2NVTJ 2MA3A 2WTEA 1OCTC 3AG3H 2NXNB 3OL4A 2PFBA 5GTHC 1LEBA 2AQEA 3HIFA 1F5TA 1TC3C 2M8GX 2ZSHB 4HQEA 3G2BA 2ZSIB 9ANTA 4IHTA 2KISA 3OYMA 2HNHA 5FROA 1ZTRA 3OMYA 5EGOA 2NS8A 2ETHA 2HQNA 3IWZA 3PSIA 2JRTA 4G6QA 3VSKA 4L9NA 4YFKF 3WTUC 3S14J 3FK6A 3FHZA 3WTYC 3A03A 4IPAA 2RDPA 3CMYA 5F64A 1ETXA 4XL9A 2CWEA 2YUSA 2R92J 2IS1A 3GWZA 3M8FA 4FQGA 3HOYJ 1ZHFA 3ZQ7A 1K78A 1XGOA 2R7OA 1GVDA 1V5EA 2IGKA 2LTPA 2O03A 4WXDA 2V9VA 2KQRA 1QBJA 5B3SH 1RKWA 2EWNA 4RGXA 4NQWA 5LEJA 3PNTA 4KA4A 1UG0A 1AWCA 4HBLA 2IPQX 4B44A 2IJLA 3C1DA 2KT0A 4Z2YA 3FIWA 3BTJA 4LFUA 2WY7Q 2OCEA 3BZ6A 1JTYA 3LQRA 3BZKA 3QPSA 3EUHA 2FBHA 3HRSA 4I98B 3K6GA 2DPDA 4HSTA 3T1BA 2FUG2 5LFAA 1QA6A 4B3AA 2DN0A 1IUFA 5J47A 1DPUA 3N05A 5C4JJ 3TO7A 4P1WA 2CU7A 5HLTA 2NVQJ 4RDUA 2LRDA 4BXXJ 3S1RJ 1V4RA 2I5UA 2PMUA 2GA1A 2RKHA 3HSRA 3HXLA 4LG0A 1JKPC 1FOYA 3PQJA 3ULQB 2HWVA 1FMVA 3PIOF 2PMHA 3SQNA 2EIMH 1X3UA 1U9OA 3MAJA 3OYEA 4RLQA 3WTTC 2OTLI 3HZJA 3ZQCA 2ZB9A 1LEAA 4MTDA 2VB6A 2LKXA 3BOQA 2GXAA 1R4MB 5D8KB 1IJWC 3FKIJ 4ZDPA 2VJJA 4DBRA 2P4WA 1R9TJ 1MBJA 3DTIA 2K9NA 3OOUA 3PNVA 3J80K 2P6SA 1SAXA 4FE7A 4PZJA 3SEQA 3UR3C 4XRSA 2O6GE 4G6TB 2OCCH 1BOBA 3MN2A 1FBUA 2TCTA 3PUFA 5B1BH 1GLNA 2NS0A 1TQIA 5J3LA 2L7KA 1WH5A 3BPVA 1QO0D 2MLGA 5KK1A 2R7QA 3R4KA 2OBPA 4Y17A 4EJVA 4LLGF 1WJBA 1X4OA 4OIOF 1HKTA 4JYKA 3HKZA 5FKOA 2OJED 1U5TB 3DEEA 4XLCA 1L3LA 1ZR4A 3ECOA 1DGWY 1TT5B 4YIRX 1ZN2A 4MTEA 2ZFWA 1XCVA 3K4KA 1IXCA 4QIWN 1HXDA 3GFIA 4XSXF 1X1PA 3BC8A 2F5FA 1FBQA 2IP2A 3O2PE 4UB6C 2JWTA 1B8IB 2DK8A 1PP8F 5ED4A 1BL0A 3ZMVA 4IXAA 4KISA 3X2QH 2MGQA 4OMYA 3CMAI 3BG9A 2NAZA 2W4SA 3SDGA 4DJAA 4EJOA 1X3ZB 3AKZA 3WE3A 4J00A 3GMEA 1PP7U 3VODA 1JI8A 3D5LA 3H35A 3I0TA 2K4JA 3S1NJ 5EG0B 1R49A 4OU0A 5KNLA 3FHNA 4AWXB 2WADA 4A3MJ 2XAQA 5BNGA 1JHFA 2FJ1A 3BG6A 4Q5SF 2JA6J 5C44J 4LB5A 4BE0A 1AOYA 4KNYA 2P7VB 2JSCA 4IJAA 2JA5J 3QU3A 2K3FA 1IDYA 3OWTA 4NDLA 4IKFA 5DV5A 2FE3A 3QPLA 1KQ0A 1R71A 1YRNB 2V1NA 2E5ZA 2ELJA 4ZTFA 4E4HA 3S15J 4RB3C 5F0HA 4HNTA 2A5YB 1V55H 4FCYA 3S2DJ 1TTYA 1SD5A 2CH0A 1OCOH 2ELHA 3K69A 4XN0A 3F8FA 3K70D 3Q0WA 5DEQA 2QENA 1W5SA 1J7KA 1FMWA 2E19A 3J81Z 3QAHA 1X1CA 1VQ9I 2K7LA 3FK7A 4WX9A 1PDNC 3BDDA 2EQRA 1XGNA 4Y4RA 2IS6A 4XBFA 4FT8A 3A0HC 3M7GA 5H2FC 5D5WB 5EF6A 4M72A 1W5TA 5GPCA 5L3EA 3A02A 1MBFA 3ZCOA 4A3LJ 3IRQA 1EH8A 3IC7A 1XGMA 4XKWA 2DMNA 2VXDA 2NVUB 1FP2A 2VBZA 3DKXA 2YX7A 3VEPA 2HVRA 1SANA 3HRTA 2AHQA 3LSHA 3R0JA 5CJ9A 4XLEA 5EZGA 3L2RA 2XSDC 1ZYRF 4RA2A 2V6CA 4M9SA 2E1OA 1R1UA 2V1XA 1E3HA 3ONQA 2W25A 3KFWX 4JOMA 1SVLA 4ZTJA 2HOAA 4RS8A 5EJCA 3CO7C 2NNYA 4BDYA 2K9LA 4XLPF 4I01A 4BDZA 4UUSB 3GTMJ 3Q5FA 4ASNA 2QQ8A 3QYFA 2DOEA 1I5ZA 3HB9A 1R00A 1D1BA 3K4NA 2XGEA 2DQLA 1REPC 1RUOA 2RNGA 2IT0A 2LDUA 1OCCH 1Z6TA 2ZO4A 4M3DA 4UVCA 3SYTA 3TL4X 2BW3B 5J8FA 1P92A 3MMYB 2FXAA 2WV0A 2V9PA 2CQKA 1WJDA 1YJWI 1B6AA 4KT6A 5EDNA 2K27A 3H0GJ 2KIUA 3TDZC 1UG2A 4PJMA 4I76A 5J8CA 2BY3A 1D1AA 1LFPA 2VT3A 1R58A 2G0EA 4IHXA 4E7SA 1ETVA 3RCOA 4N4OB 4LD5A 1TL8A 3JSPA 1CF7A 2VBYA 3QP5A 3S16J 3VFZA 1RUNA 5E79C 2W7NA 1OISA 2M4GA 4FETA 4HLYA 2XROA 3FMSA 3DCFA 5EYRA 2NOJB 4FTHA 1QRYA 2UZKA 2CYYA 2NNNA 4ZJZA 5LRRA 4DBQA 3L2WA 4JX5A 4DGWB 2RC4A 4OIPF 1O3TA 1YITI 1GUUA 5HS9A 4ZYEA 4M9ZA 3CLQA 2ZJQF 5DUKA 4H4KC 3TW6A 1B72A 4J01A 3TO9A 4KICA 3DKWA 2ISYA 1EA3A 1ONVA 3JRIA 2Z3YA 4YIFA 2P5KA 5FD5A 4BACA 2L2OA 2Y69H 4RGRA 2HOSA 4XNFA 2CSOA 1I1SA 3EDPA 3PM1A 2XKOA 2GBYA 1FT9A 3F0CA 4CUGA 5GADJ 3J7YJ 2IS4A 4N0BA 2CV1A 4I2OA 2QVOA 4EM0B 1U0JA 4CYDA 1F36A 1BI2A 3U9GA 3RDIA 3TKYA 4UY8I 1W1WE 2E2JJ 2E7XA 3NWSA 3L2QA 1GVJA 5K5RA 1G3SA 4GFBA 1GXQA 3CC7I 2K85A 4WXHA 3JAMZ 1X1BA 5JVTA 1WI9A 5DM6F 1BN5A 3E1SA 1K4TA 2FRHA 4G8XA 4DOZA 4GYIA 3BCAA 4V2FA 2CGPA 5LHHA 4IHSA 2JVGA 1VQ6I 3CUQA 2ME6A 4KFCA 4D9JA 3C2BA 5EGOB 2QQBA 3KYDB 3WTWC 2D2WA 3GTPJ 3ABKH 5H6RA 4CGZA 4GO1A 1S29A 4DYRA 2EA4A 2GIVA 3K70C 4A3FJ 3TEDA 1JGGA 3ZQIA 2AS5F 2JQ7A 4CCKA 2M45A 3CCQI 1BR1A 5K7ZA 3HEFA 1SFUA 4BE1A 5FLVA 1IN8A 3I59B 4C3JJ 4D7NA 1ZH5A 2QM3A 2E2IJ 4C30A 4A3BJ 1RIOH 1MMAA 3QWLA 3SHFA 3E5XA 1F43A 1HBXG 5IT9Z 2WY8Q 4BNCA 5IPAA 4IO9F 2ELKA 4IHVA 1U8BA 3MVPA 5L3CA 3CO6C 2ECCA 1ZG5A 3HHHA 3K4BA 1LE8A 2CRGA 3LFKA 4NC8A 2DJNA 3OL3A 4MFDA 2GXBA 4II2A 5KAIC 2DLLA 1I3AA 3HJEA 3LQQA 4AVZA 3VSLA 3MKWB 4HDVA 1NTCA 1TZLA 2FNPA 4R79A 2JN6A 3L00A 4HSRA 2A6HF 1FY7A 2A61A 2CMPA 4XONA 3FXRA 2E1MB 2IGMA 4QTRA 2DQRA 3GF2A 4BQAA 3I3LA 4HEA2 3BJAA 5JFRA 1X19A 2MH9A 3ZQLA 3TP0A 3CJRB 4N9IA 3C7JA 1O3RA 5D4SA 1ZG1A 1X3WB 2L4MA 3IL2A 1MGTA 2OPTA 3K9TA 1U8RA 4BEHA 3DEWA 3EQLF 1Y8RB 5K5QA 4Q47A 3E6CC 1JUMA 2E7WA 1QVTA 2R5ZA 1ZRCA 3RZDJ 1FOKA 5D5VB 5DYMA 1CQTA 2M4KA 1BW6A 2X9DA 1OCPA 3NEUA 4EV0A 4H0EA 2VQCA 3IWFA 3MEXA 3OYBA 3GLLA 1ZK8A 5LHGA 2DFIA 2HR3A 3FXMA 5E1XA 2XPUA 1W0TA 4CDGA 3WTXC 2BHZA 1WJFA 1Z21A 3DF8A 1S6LA 2HQAA 1OPCA 3VDXA 2XVCA 1DDNA 2FBIA 1YQAA 2VQGA 2F2EA 1O7LA 4A6DA 2BHYA 2LF8A 1G3TA 2FBKA 2DI3A 2I8DA 3HSFA 3A4CA 1YFHA 1H89C 3DTEA 4C2MJ 2W82A 3Q0VA 1UHSA 4YFNF 2GA2A 4BQQA 1VQPI 4LOCA 4PFPA 3H3UA 3VYTB 5LGTA 3WTSC 3L2CA 1Z1DA 2VL8A 2CQXA 4UUTA 1YJNI 5K7FA 1FTTA 2VIXA 1QHGA 5CVVA 2CW0F 3E6MA 2GWRA 1HQCA 1TWHJ 5F1JA 1D0YA 3C2GA 3BG3A 5E8IA 4DQ2A 3WU0A 3D5SC 1YG2A 3LSPA 3ZMDA 2CS3A 2F5EA 5D8LB 1HDPA 3M1EA 4CICA 1J9IA 2MD5A 3KEOA 1XC5A 4LGWA 4G7HF 1HW5A 1KQ9A 3RQIA 3L7WA 5L3BA 3E5QA 4LLNA 4O3MA 1DQUA 2D1VA 1YJ9I 3OYCA 3HBLA 2L7FP 1NHAA 4YIIA 4NUBA 1V5FA 5ILSA 3K4CA 3LSRA 3AG2H 5IP7J 1ZGJA 3FXQA 3RJPA 4HX4A 1Z3XA 3MZ8A 2K4BA 1P2FA 5CLSA 3CC2I 4E7JA 2EIJH 3ZMUA 2O61A 3H9JA 4Y33A 3DPUA 3ERED 2P8TA 4G12A 2QUFA 1TNTA 5ICCA 3LWFA 3NWTA 4BL0B 3KPHA 5E3OA 1WPKA 3LOCA 4UUVA 2Z5UA 4P5OA 3T0YA 3OSFA 4ANJA 1OLTA 4BXUA 3A01A 1U78A 2WAFA 2LBFA 3OYJA 3EUHC 2V7FA 3RI4A 2IVMA 1MMGA 2KIFA 4U88A 2XPVA 3ZN1A 1TWFJ 1KZHA 1OJLA 1DUXC 4V19K 1PUFB 1K61A 5FFZA 1TW2A 2I10A 4KMFA 2HVSA 2LC2A 2PN6A 2H94A 2XRLA 4LITA 1MDMA 1S5LC 2K9QA 1IRFA 1RKTA 2VC0A 5TISC 1LJ9A 3RIRA 1T2KA 1QPIA 2DCEA 1FYMA 2YS9A 3PFIA 4D7MA 5IY5H 1FZPB 1D5VA 1O4XA 3FXUA 3ASNH 2CQQA 2IBDA 3BTCA 1BR2A 2A6TA 4F92B 3QQAA 2EFWA 3FZVA 1O3SA 2Y0MA 5GP9A 3CJTB 4M74A 4AYBN 4S05A 3LMMA 1S7EA 4S04A 1ZLJA 1LPQA 3BY6A 1IC8A 1T95A 4Y15A 5EEHA 3LAPA 2E5NA 2M5WA 3H36A 2VBXA 2RV8A 4PJ0C
chains in the Genus database with same CATH topology
1BL0A 2X48A 3GTJJ 3TW7A 5F0CA 1YRNA 2N8GA 4J19A 2MGQA 3BG9A 1IRZA 1ETYA 3MKLA 3SDGA 4CYCB 1RPWA 2W48A 1I50J 1X2NA 2DA2A 3BQYA 3JRCA 2R93J 2LR8A 3ZQHA 4AC0A 3JRFA 2Y9YA 3S1NJ 3HDDA 4C3HJ 5EG0B 3Q0UA 2Y2ZA 1RESA 4A3MJ 3SJMA 5BNGA 2FJ1A 4QSHA 4DYCA 1X2MA 2JA6J 1ORKA 2MG4A 4M3EA 5C44J 1I6HJ 5HODA 4BY7J 2JA5J 4MLOA 1IDYA 3G1OA 1ZGWA 4NDLA 2IEKA 3QPLA 3PO2J 1I3QJ 5FKLA 2EBIA 3PO3J 1YRNB 1A5JA 3CDLA 4BBSJ 2E2HJ 3S15J 5F0HA 2XB5A 4JX4A 2FX0A 4FCYA 3S2DJ 3ZOBA 3M4OJ 2M2EA 2LD5A 5C3EJ 3Q0WA 3JREA 2DA3A 3HOXJ 4XICA 3BR6A 2E19A 4A69C 5IOYA 4DZJA 4B4CA 1B72B 3FK7A 5J1YA 2DTZA 3LNQA 4Y52J 1MBHA 2TRTA 2JMWA 1NK3P 2EQRA 1A6IA 5EF6A 1ZR2A 4M6VA 5GPCA 2L7MP 3A02A 1DU6A 1MBFA 4A3LJ 2WB1N 3SFIA 3WHCA 2DMNA 2H1KA 5M5WJ 1JUSA 3BG5A 2L7ZA 3Q3SA 1SANA 3JR9A 4B1RA 2AHQA 5EZGA 1W0UA 3IH2A 2XSDC 1TWGJ 4XRSG 3D1NI 1LFUP 2E1OA 1JTXA 2NVYJ 2FD5A 3K2AA 1POGA 2HOAA 4D5FA 2LVSA 1ETOA 2R5YB 2HYJA 4UUSB 3GTMJ 2DMQA 3HB9A 1ZQ3P 4XIDA 2XGEA 5FKKA 1P7JA 3RZOJ 2GM4A 4M3DA 2QF7A 1JT6A 1MBKA 2VPRA 3OSGA 4A3EJ 4MFEA 5EDNA 3GTOJ 1XG1A 3H3VK 3H0GJ 5EG0A 1UG2A 4I76A 5E3NA 1AHDP 2ME0A 2B63J 1MSFC 1JKQC 2VUMJ 2G0EA 2ID6A 2NS7A 4IHXA 2OF7A 1ETVA 1IG7A 2M9HA 3S2HJ 1G2HA 2D5VA 2ECBA 3S16J 3JRHA 1ENHA 3UKGA 3BR2A 3DCFA 3HKZN 5EYRA 1HF0A 4FTHA 4A3DJ 1QRYA 4C3IJ 2VI6A 3BQZA 1XS9A 1LE8B 1H88C 5IOZA 1BW5A 3L1PA 3LSJA 1WH7A 1NK2P 4JX5A 4HNVA 1GUUA 4W97A 2HDDA 1LFBA 1ZKGA 4ABZA 3I4MJ 4BBRJ 3TW6A 1SFOJ 2DA4A 1B72A 3WHBA 3GTLJ 4AUXA 1U9NA 1FTZA 3JRIA 2EZLA 4M3GA 1TWAJ 3JRDA 5FKMA 2HOSA 4RBOA 2DA6A 2IAIA 3PM1A 2LP0A 1UMQA 2GBYA 1D5YA 1HOMA 3F0CA 3HGGA 4BY1J 3GTGJ 3JRAA 3B6AA 1JT0A 1F36A 1WI3A 2LY9A 5EZHA 2DMPA 5M3MJ 5DS9A 5JLXA 2CJJA 3ZQGA 5FLMJ 2E2JJ 2EZHA 4GFBA 2XPWA 2AO9A 5F04A 2DMTA 5K7HA 2NVXJ 3BTLA 1ITYA 2O9LA 5M3FJ 3RKQA 4V2FA 2R5YA 4UUSA 3GTKJ 4A3CJ 1FJLA 4EEFG 2ME6A 3E7LA 1K83J 2JK3A 2Y31A 3C2BA 5M5YJ 5EGOB 2CUEA 2HXOA 2FQ4A 3GTPJ 2Y0SN 5EEAA 1DU0A 5IYBJ 3G1LA 1HDDC 3HOVJ 3G1MA 4DYRA 3FISA 1IDZA 2DMUA 4A3FJ 3TEDA 1JGGA 3ZQIA 5J1RA 2JA8J 2K9SA 4A3GJ 3NAUA 3OIOA 1JKOC 2R7ZJ 4M3BA 1RETA 5K7ZA 4DW6A 3HEFA 3JRGA 4A3IJ 4Y7NJ 1Z0XA 3CQZJ 5FLVA 1OFCX 2RAEA 4C3JJ 3VPRA 5FKNA 1Q1VA 4D7NA 2Y30A 2E2IJ 2COBA 3NARA 4A3BJ 3BR1A 1VNDA 2Y9ZA 1AKHA 1F43A 4FE4A 2M34A 5IPAA 3HOUJ 1BA5A 2ELKA 4IHVA 2WV1A 1Y1VJ 1U8BA 2HI3A 3MVPA 2H8RA 2ECCA 1AU7A 2EH3A 1LE8A 2CRGA 2XB0X 4XK4A 1GDTA 2DJNA 4MFDA 3S17J 2VKEA 2JA7J 4I6ZA 1NTCA 2L0KA 1Y1WJ 1ETWA 3W6VA 2JN6A 4FISA 3IH3A 2XGCA 3I4NJ 1MH3A 1VFCA 4L5EA 3S1QJ 5E3MA 3K7AJ 1T56A 3BR3A 4QTRA 3ZQFA 1JJ8C 4MO7A 2O8KA 2CUFA 1MBEA 3ZQLA 5F27A 3TP0A 1TWCJ 1AKHB 1MNMC 3HM5A 4S0HB 1ETQA 2OPTA 1T33A 4A93J 1IGNA 2ID3A 3DEWA 4D5CA 1E3OC 2EZKA 1JUMA 1QVTA 2R5ZA 3RZDJ 2VKVA 3CCYA 1IV6A 4DZPA 1CQTA 1BW6A 2X9DA 1OCPA 5GPAA 2HOTA 4XRMA 2NVTJ 5JLWA 1GT0C 1OCTC 1ZK8A 2XPUA 1BJZA 4W1UA 1W0TA 1TC3C 2M8GX 3BT9A 4A3JJ 1MH4A 2KDZA 9ANTA 2O7OA 3O8GA 5EGOA 1ZTRA 2NS8A 3O8HA 5E3LA 3S14J 2DA1A 3FK6A 1FIAA 1MSEC 1H89C 3A03A 4C2MJ 3Q0VA 1UHSA 3CMYA 3BTIA 4LOCA 2LFBA 4JP0A 1ETXA 2HQ5A 2JJ7A 2YUSA 2R92J 4V2GA 3HOYJ 2CQXA 4UUTA 2R5ZB 5K7FA 1FTTA 1GVDA 2LTPA 5F1JA 1TWHJ 2LLKA 3BG3A 1RKWA 2GLOA 1FIPA 1APLC 3BR5A 5IYCJ 2M0CA 3LSPA 2KT0A 3TP3A 1HDPA 3FIWA 2LK2A 3BTJA 4DYQA 1XC5A 1JTYA 2XGDA 3QPSA 4X6AJ 3RQIA 3LSGA 5IP9J 1WCMJ 2DA5A 1VI0A 3S1MJ 2MW8A 3HBLA 2L7FP 4B3AA 2DN0A 1IUFA 3LSRA 2MSYA 5IP7J 1FEXA 5C4JJ 5IYDJ 2YU9J 2NVQJ 2CU7A 4RDUA 2WAQN 1PUFA 4BXXJ 1JUPA 3S1RJ 4IHYA 3IV5A 1JKPC 4G12A 2R0QC 1EF4A 1WGXA 1U9OA 2P81A 1GV2A 3GTQJ 5E3OA 1WPKA 1Z77A 3LOCA 2L9RA 3ZQCA 3M3YJ 3OSFA 1GV5A 2ZB9A 4A3KJ 2LKXA 5F08A 2HXIA 3A01A 3IH4A 1HCRA 3HGYA 1IJWC 1U78A 3FKIJ 5M5XJ 1R9TJ 1MBJA 3HOWJ 2K9NA 2XPVA 1HLVA 3OOUA 5FJ8J 4IEJA 1MBGA 3GBGA 4X1EA 1TWFJ 4FE7A 4JX6A 1OJLA 4XRSA 1H8AC 1B8IA 1PUFB 1K61A 3MN2A 2I10A 4IHWA 2TCTA 4M3FA 2XRLA 4MIMA 5IP6A 5J3LA 5C4XJ 1WH5A 2K9QA 1RKTA 1P7IA 4CYCA 1VF9A 1QVUA 3JRBA 1QPIA 2PMZN 2YS9A 4D7MA 1O4XA 2CQQA 2IBDA 1JJ6C 3BTCA 5J1UA 4JYKA 5F0FA 5FKOA 3QQAA 3A01B 1RR7A 4BKXA 5GP9A 1ZR4A 4AYBN 1ETKA 2QCOA 1X58A 3HOZJ 3B6CA 2X6OA 1S7EA 2DA7A 1JKRC 4QIWN 1IC8A 2K40A 2NOGA 2EZIA 3BR0A 2JWTA 1B8IB 5DTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL0 A;  2X48 A;  3GTJ J;  3TW7 A;  5F0C A;  1YRN A;  2N8G A;  4J19 A;  2MGQ A;  3BG9 A;  1IRZ A;  1ETY A;  3MKL A;  3SDG A;  4CYC B;  1RPW A;  2W48 A;  1I50 J;  1X2N A;  2DA2 A;  3BQY A;  3JRC A;  2R93 J;  2LR8 A;  3ZQH A;  4AC0 A;  3JRF A;  2Y9Y A;  3S1N J;  3HDD A;  4C3H J;  5EG0 B;  3Q0U A;  2Y2Z A;  1RES A;  4A3M J;  3SJM A;  5BNG A;  2FJ1 A;  4QSH A;  4DYC A;  1X2M A;  2JA6 J;  1ORK A;  2MG4 A;  4M3E A;  5C44 J;  1I6H J;  5HOD A;  4BY7 J;  2JA5 J;  4MLO A;  1IDY A;  3G1O A;  1ZGW A;  4NDL A;  2IEK A;  3QPL A;  3PO2 J;  1I3Q J;  5FKL A;  2EBI A;  3PO3 J;  1YRN B;  1A5J A;  3CDL A;  4BBS J;  2E2H J;  3S15 J;  5F0H A;  2XB5 A;  4JX4 A;  2FX0 A;  4FCY A;  3S2D J;  3ZOB A;  3M4O J;  2M2E A;  2LD5 A;  5C3E J;  3Q0W A;  3JRE A;  2DA3 A;  3HOX J;  4XIC A;  3BR6 A;  2E19 A;  4A69 C;  5IOY A;  4DZJ A;  4B4C A;  1B72 B;  3FK7 A;  5J1Y A;  2DTZ A;  3LNQ A;  4Y52 J;  1MBH A;  2TRT A;  2JMW A;  1NK3 P;  2EQR A;  1A6I A;  5EF6 A;  1ZR2 A;  4M6V A;  5GPC A;  2L7M P;  3A02 A;  1DU6 A;  1MBF A;  4A3L J;  2WB1 N;  3SFI A;  3WHC A;  2DMN A;  2H1K A;  5M5W J;  1JUS A;  3BG5 A;  2L7Z A;  3Q3S A;  1SAN A;  3JR9 A;  4B1R A;  2AHQ A;  5EZG A;  1W0U A;  3IH2 A;  2XSD C;  1TWG J;  4XRS G;  3D1N I;  1LFU P;  2E1O A;  1JTX A;  2NVY J;  2FD5 A;  3K2A A;  1POG A;  2HOA A;  4D5F A;  2LVS A;  1ETO A;  2R5Y B;  2HYJ A;  4UUS B;  3GTM J;  2DMQ A;  3HB9 A;  1ZQ3 P;  4XID A;  2XGE A;  5FKK A;  1P7J A;  3RZO J;  2GM4 A;  4M3D A;  2QF7 A;  1JT6 A;  1MBK A;  2VPR A;  3OSG A;  4A3E J;  4MFE A;  5EDN A;  3GTO J;  1XG1 A;  3H3V K;  3H0G J;  5EG0 A;  1UG2 A;  4I76 A;  5E3N A;  1AHD P;  2ME0 A;  2B63 J;  1MSF C;  1JKQ C;  2VUM J;  2G0E A;  2ID6 A;  2NS7 A;  4IHX A;  2OF7 A;  1ETV A;  1IG7 A;  2M9H A;  3S2H J;  1G2H A;  2D5V A;  2ECB A;  3S16 J;  3JRH A;  1ENH A;  3UKG A;  3BR2 A;  3DCF A;  3HKZ N;  5EYR A;  1HF0 A;  4FTH A;  4A3D J;  1QRY A;  4C3I J;  2VI6 A;  3BQZ A;  1XS9 A;  1LE8 B;  1H88 C;  5IOZ A;  1BW5 A;  3L1P A;  3LSJ A;  1WH7 A;  1NK2 P;  4JX5 A;  4HNV A;  1GUU A;  4W97 A;  2HDD A;  1LFB A;  1ZKG A;  4ABZ A;  3I4M J;  4BBR J;  3TW6 A;  1SFO J;  2DA4 A;  1B72 A;  3WHB A;  3GTL J;  4AUX A;  1U9N A;  1FTZ A;  3JRI A;  2EZL A;  4M3G A;  1TWA J;  3JRD A;  5FKM A;  2HOS A;  4RBO A;  2DA6 A;  2IAI A;  3PM1 A;  2LP0 A;  1UMQ A;  2GBY A;  1D5Y A;  1HOM A;  3F0C A;  3HGG A;  4BY1 J;  3GTG J;  3JRA A;  3B6A A;  1JT0 A;  1F36 A;  1WI3 A;  2LY9 A;  5EZH A;  2DMP A;  5M3M J;  5DS9 A;  5JLX A;  2CJJ A;  3ZQG A;  5FLM J;  2E2J J;  2EZH A;  4GFB A;  2XPW A;  2AO9 A;  5F04 A;  2DMT A;  5K7H A;  2NVX J;  3BTL A;  1ITY A;  2O9L A;  5M3F J;  3RKQ A;  4V2F A;  2R5Y A;  4UUS A;  3GTK J;  4A3C J;  1FJL A;  4EEF G;  2ME6 A;  3E7L A;  1K83 J;  2JK3 A;  2Y31 A;  3C2B A;  5M5Y J;  5EGO B;  2CUE A;  2HXO A;  2FQ4 A;  3GTP J;  2Y0S N;  5EEA A;  1DU0 A;  5IYB J;  3G1L A;  1HDD C;  3HOV J;  3G1M A;  4DYR A;  3FIS A;  1IDZ A;  2DMU A;  4A3F J;  3TED A;  1JGG A;  3ZQI A;  5J1R A;  2JA8 J;  2K9S A;  4A3G J;  3NAU A;  3OIO A;  1JKO C;  2R7Z J;  4M3B A;  1RET A;  5K7Z A;  4DW6 A;  3HEF A;  3JRG A;  4A3I J;  4Y7N J;  1Z0X A;  3CQZ J;  5FLV A;  1OFC X;  2RAE A;  4C3J J;  3VPR A;  5FKN A;  1Q1V A;  4D7N A;  2Y30 A;  2E2I J;  2COB A;  3NAR A;  4A3B J;  3BR1 A;  1VND A;  2Y9Z A;  1AKH A;  1F43 A;  4FE4 A;  2M34 A;  5IPA A;  3HOU J;  1BA5 A;  2ELK A;  4IHV A;  2WV1 A;  1Y1V J;  1U8B A;  2HI3 A;  3MVP A;  2H8R A;  2ECC A;  1AU7 A;  2EH3 A;  1LE8 A;  2CRG A;  2XB0 X;  4XK4 A;  1GDT A;  2DJN A;  4MFD A;  3S17 J;  2VKE A;  2JA7 J;  4I6Z A;  1NTC A;  2L0K A;  1Y1W J;  1ETW A;  3W6V A;  2JN6 A;  4FIS A;  3IH3 A;  2XGC A;  3I4N J;  1MH3 A;  1VFC A;  4L5E A;  3S1Q J;  5E3M A;  3K7A J;  1T56 A;  3BR3 A;  4QTR A;  3ZQF A;  1JJ8 C;  4MO7 A;  2O8K A;  2CUF A;  1MBE A;  3ZQL A;  5F27 A;  3TP0 A;  1TWC J;  1AKH B;  1MNM C;  3HM5 A;  4S0H B;  1ETQ A;  2OPT A;  1T33 A;  4A93 J;  1IGN A;  2ID3 A;  3DEW A;  4D5C A;  1E3O C;  2EZK A;  1JUM A;  1QVT A;  2R5Z A;  3RZD J;  2VKV A;  3CCY A;  1IV6 A;  4DZP A;  1CQT A;  1BW6 A;  2X9D A;  1OCP A;  5GPA A;  2HOT A;  4XRM A;  2NVT J;  5JLW A;  1GT0 C;  1OCT C;  1ZK8 A;  2XPU A;  1BJZ A;  4W1U A;  1W0T A;  1TC3 C;  2M8G X;  3BT9 A;  4A3J J;  1MH4 A;  2KDZ A;  9ANT A;  2O7O A;  3O8G A;  5EGO A;  1ZTR A;  2NS8 A;  3O8H A;  5E3L A;  3S14 J;  2DA1 A;  3FK6 A;  1FIA A;  1MSE C;  1H89 C;  3A03 A;  4C2M J;  3Q0V A;  1UHS A;  3CMY A;  3BTI A;  4LOC A;  2LFB A;  4JP0 A;  1ETX A;  2HQ5 A;  2JJ7 A;  2YUS A;  2R92 J;  4V2G A;  3HOY J;  2CQX A;  4UUT A;  2R5Z B;  5K7F A;  1FTT A;  1GVD A;  2LTP A;  5F1J A;  1TWH J;  2LLK A;  3BG3 A;  1RKW A;  2GLO A;  1FIP A;  1APL C;  3BR5 A;  5IYC J;  2M0C A;  3LSP A;  2KT0 A;  3TP3 A;  1HDP A;  3FIW A;  2LK2 A;  3BTJ A;  4DYQ A;  1XC5 A;  1JTY A;  2XGD A;  3QPS A;  4X6A J;  3RQI A;  3LSG A;  5IP9 J;  1WCM J;  2DA5 A;  1VI0 A;  3S1M J;  2MW8 A;  3HBL A;  2L7F P;  4B3A A;  2DN0 A;  1IUF A;  3LSR A;  2MSY A;  5IP7 J;  1FEX A;  5C4J J;  5IYD J;  2YU9 J;  2NVQ J;  2CU7 A;  4RDU A;  2WAQ N;  1PUF A;  4BXX J;  1JUP A;  3S1R J;  4IHY A;  3IV5 A;  1JKP C;  4G12 A;  2R0Q C;  1EF4 A;  1WGX A;  1U9O A;  2P81 A;  1GV2 A;  3GTQ J;  5E3O A;  1WPK A;  1Z77 A;  3LOC A;  2L9R A;  3ZQC A;  3M3Y J;  3OSF A;  1GV5 A;  2ZB9 A;  4A3K J;  2LKX A;  5F08 A;  2HXI A;  3A01 A;  3IH4 A;  1HCR A;  3HGY A;  1IJW C;  1U78 A;  3FKI J;  5M5X J;  1R9T J;  1MBJ A;  3HOW J;  2K9N A;  2XPV A;  1HLV A;  3OOU A;  5FJ8 J;  4IEJ A;  1MBG A;  3GBG A;  4X1E A;  1TWF J;  4FE7 A;  4JX6 A;  1OJL A;  4XRS A;  1H8A C;  1B8I A;  1PUF B;  1K61 A;  3MN2 A;  2I10 A;  4IHW A;  2TCT A;  4M3F A;  2XRL A;  4MIM A;  5IP6 A;  5J3L A;  5C4X J;  1WH5 A;  2K9Q A;  1RKT A;  1P7I A;  4CYC A;  1VF9 A;  1QVU A;  3JRB A;  1QPI A;  2PMZ N;  2YS9 A;  4D7M A;  1O4X A;  2CQQ A;  2IBD A;  1JJ6 C;  3BTC A;  5J1U A;  4JYK A;  5F0F A;  5FKO A;  3QQA A;  3A01 B;  1RR7 A;  4BKX A;  5GP9 A;  1ZR4 A;  4AYB N;  1ETK A;  2QCO A;  1X58 A;  3HOZ J;  3B6C A;  2X6O A;  1S7E A;  2DA7 A;  1JKR C;  4QIW N;  1IC8 A;  2K40 A;  2NOG A;  2EZI A;  3BR0 A;  2JWT A;  1B8I B;  5DTD A; 
#chains in the Genus database with same CATH topology
 2X48 A;  1T98 A;  5F0C A;  4HW0 A;  2N8G A;  4J19 A;  1ETY A;  1V5G A;  4CYC B;  1RPW A;  2W48 A;  4OIR F;  3CUO A;  5E17 F;  2LR8 A;  4R1H A;  2A5W A;  5B66 C;  3HL2 A;  1ODD A;  1HC8 A;  2RNJ A;  4AC0 A;  3JRF A;  2Y9Y A;  3HDD A;  3I71 A;  4FAS D;  2BXY A;  3WTZ A;  4AIH A;  2XRN A;  1YO5 C;  3RPU D;  4NC7 A;  3Q0U A;  4YEL A;  3L2V A;  4KDP A;  1VQ5 I;  1KQ8 A;  4XLF A;  2DW4 A;  1ORK A;  2MG4 A;  5BS6 A;  1UZC A;  3CDH A;  4I02 A;  1ZRD A;  1H9G A;  2K5C A;  4BY7 J;  4EGZ A;  3G1O A;  1KA8 A;  3PO2 J;  3PO3 J;  2RQP A;  3F8C A;  1X4P A;  3CZ6 A;  3CDL A;  2W00 A;  4MNU A;  2LOO A;  3KEY A;  3AL0 C;  4HV5 A;  3PFY A;  2Z33 A;  3H5R A;  4CHU A;  2WA0 A;  2ZXI A;  4II3 A;  4BQO A;  3M4O J;  2DA3 A;  3LA2 A;  3S93 A;  3V8J A;  2LYC A;  4O5V A;  3KCC A;  4A69 C;  5IOY A;  2A07 F;  1YE9 A;  5D6F A;  1B72 B;  2UV1 A;  5DM7 F;  3LNQ A;  3JTG A;  2TRT A;  3ESW B;  1NK3 P;  1IRG A;  3SZT A;  3WG9 A;  2VC1 A;  3K10 A;  4JK1 X;  3CJQ B;  4HV6 A;  4HF2 A;  4CA0 A;  3KP4 A;  2L7M P;  4HF1 A;  1DP3 A;  2DT7 B;  1F9N A;  2M8E A;  3BLY A;  2DOA A;  2WB1 N;  4BE2 A;  4GDF A;  2FOW A;  2H1K A;  2F48 A;  4XMY A;  2JT1 A;  4ZYD A;  2KL4 A;  2ZME B;  2CFO A;  2KIM A;  3JR9 A;  4B1R A;  1F4K A;  1W0U A;  3HUG A;  3IH2 A;  3PQK A;  4E7I A;  5CQG A;  2FU4 A;  3V7S A;  3EUA A;  3IAM 2;  1STZ A;  2M1B A;  4L0Y B;  1KON A;  2B0L A;  2DO7 A;  3S2W A;  3D5R C;  2E60 A;  2VXZ A;  4B8X A;  2FD5 A;  2L3D A;  4XQF A;  3ERM A;  3K2A A;  3LA3 A;  5JHU A;  1FP1 D;  1I27 A;  4B43 A;  2QQ9 A;  2CV2 A;  3RQ4 A;  2PJR A;  4BU2 A;  1WZ2 A;  3KZI C;  3SFZ A;  4ZDO A;  3GO5 A;  3GFL A;  1Y56 A;  2O8X A;  2AQF A;  1OR7 C;  2Q2E A;  5FKK A;  3P5J A;  1P7J A;  1KU7 A;  1WVR A;  4UB8 C;  2GM4 A;  2R7U A;  2QBY B;  4BHB A;  3J81 K;  1YLF A;  1J2X A;  5KCM A;  4A3E J;  2A05 A;  2R7F A;  2BEO A;  3GTO J;  2EIK H;  2EK5 A;  3KIO A;  3W2V A;  3H3V K;  3V7R A;  2ZBK A;  1R5I D;  3KEQ A;  4WCG A;  3KX2 A;  1BI3 A;  1Z7L A;  3T5X A;  1G2H A;  2D5V A;  1V3F A;  4M6X A;  1QHH D;  4KIF A;  1ENH A;  2ICW G;  2LH9 A;  4RM3 A;  2LSO A;  2ESH A;  3BR2 A;  4A3D J;  1YYV A;  2OZU A;  3ASO H;  4EVI A;  4C3I J;  4KMU X;  5BPI A;  1J09 A;  3V8K A;  1LE8 B;  1WHU A;  1G59 A;  1LUJ B;  1YTY A;  2V79 A;  1W7P D;  2DXI A;  1YX3 A;  2PBI A;  3OYK A;  4W97 A;  4O6J A;  2HDD A;  4IQ4 A;  1X1A A;  1N78 A;  4KIB A;  3WHB A;  3H9G A;  4RAZ A;  4AU7 A;  5J6X A;  2R7R A;  2KZG A;  1MJB A;  1TT0 A;  1E3P A;  3BPX A;  1ACI A;  4ZYG A;  1TWA J;  1IF1 A;  3V4G A;  2KFD A;  3LL7 A;  3E5U A;  1BR4 A;  2LP0 A;  2GXG A;  1D5Y A;  1T38 A;  3HC7 A;  1H0M A;  5FGM A;  1HOM A;  5LD2 C;  1FLI A;  1YOV B;  2EV5 A;  3KP6 A;  3DEU A;  5J4Y A;  3GZ5 A;  3P7N A;  4PJN A;  4DIQ A;  1YW8 A;  4EMS A;  2R7S A;  3ELK A;  1ULY A;  2QSF X;  3JRA A;  1B9N A;  5AIQ A;  1Y6I A;  3BP8 A;  2UXN A;  4RM2 A;  3RYP A;  1RR8 C;  2CJJ A;  2KRF A;  2AO9 A;  3RPQ A;  2NYX A;  1B59 A;  2NVX J;  1ITY A;  3OYD A;  3ZP5 A;  1OR7 A;  2R5Y A;  2MD0 A;  3GTK J;  3ZMT A;  5L3F A;  3LA7 A;  3V7C A;  4EEF G;  4IOA F;  3E7L A;  1W5C C;  2JK3 A;  2WAE A;  5GAG J;  1R4N B;  2CUE A;  3O3K A;  4RAY A;  1VTN C;  2EFO A;  2RN7 A;  3GYH X;  5EEA A;  1DU0 A;  1UFM A;  2A69 F;  3G1L A;  1U2W A;  1B9M A;  3W2A A;  1HW2 A;  3FIS A;  1IDZ A;  2EV6 A;  2JA8 J;  3O6B B;  5DCM A;  5FRM A;  2K9S A;  4A3G J;  2VKD A;  3NAU A;  1JKO C;  4Z6Y A;  2EV0 A;  4RGU A;  3JRG A;  4G7Z F;  4A3I J;  1JE8 A;  1Z0X A;  3CQZ J;  2W24 A;  3CES A;  3VPR A;  1Q1V A;  3H92 A;  2VQL A;  3ZXS A;  3CP8 A;  3BR1 A;  1AKH A;  4I7H A;  4F93 B;  4FE4 A;  2HPM A;  3QOD A;  5F6F A;  2WV1 A;  3CMM A;  2HI3 A;  5ERI A;  4Y3O A;  2EH3 A;  2XB0 X;  1GDT A;  3CUQ C;  4IOC F;  1VQ8 I;  4AID A;  5L3G A;  1BC7 C;  1Z7U A;  4OAZ A;  3JAM K;  1ETW A;  2UWM A;  4FHT A;  3ZGK A;  3CDI A;  2FQ3 A;  2R7V A;  1VFC A;  2V9K A;  2H27 A;  4L5E A;  2OA4 A;  2Y75 A;  3TO6 A;  2EFN A;  3OS0 A;  1TQP A;  3BR3 A;  4HQM A;  4AYB A;  2O3F A;  4FX0 A;  3ZQF A;  4CSW A;  2O8K A;  2OTJ I;  3E6D A;  5LBQ A;  3OS2 A;  1E17 A;  5CQE A;  3PJR A;  2XDV A;  1MNM C;  1EKE A;  1ETQ A;  4QLC U;  4KIG A;  1T33 A;  2X0L A;  2STW A;  3F21 A;  1I1G A;  4EM2 A;  1IGN A;  2ID3 A;  4ZC3 A;  2M7A A;  2LBF B;  3RPU A;  1EJ9 A;  1FSH A;  4ON0 A;  1U5T C;  2EZK A;  3DLA A;  3BG7 A;  3CCY A;  5E20 A;  2YX4 A;  2GOX B;  3KET A;  1IV6 A;  4DZP A;  3EYI A;  3W2W A;  4OMZ A;  4XRM A;  2E35 A;  3ABM H;  5JLW A;  3JTH A;  3JW4 A;  4ESB A;  5IT9 K;  2ISZ A;  1GT0 C;  2XF6 A;  2HKO A;  2DFF A;  2J5O A;  4W1U A;  2VQH A;  2ZKZ A;  4ITV A;  2Q1Z B;  3S3O A;  4EJU A;  1FOX A;  3LFU A;  3KYC B;  2KDO A;  2MH2 A;  3O8G A;  2IW5 A;  3GVA A;  3W3C A;  2F4O B;  3O8H A;  2DJI A;  2EIN H;  5DCF A;  5E3L A;  4CH7 A;  1J75 A;  1MD0 A;  1FIA A;  2EFP A;  1ON2 A;  2KP6 A;  1YHQ I;  5F1R A;  4L5I A;  2HDW A;  4XOP A;  2HQ5 A;  5D5X B;  5BOX A;  4A0X A;  4V2G A;  1BI0 A;  2OD5 A;  1R1T A;  2A6E F;  3SDB A;  2JRM A;  1YW9 A;  2Q0O A;  1J5Y A;  3I64 A;  1OYW A;  4L18 B;  1HKQ A;  1APL C;  1SMT A;  4KJZ A;  2M0C A;  4A12 A;  2A68 F;  3BZC A;  5FRN A;  4LLL A;  3TP3 A;  2DU9 A;  2XGD A;  2EA2 A;  1FPQ A;  4X6A J;  1WCM J;  2DA5 A;  1YI2 I;  3ABT A;  1VI0 A;  3W6J B;  3S1M J;  2R7T A;  1WWX A;  2MW8 A;  1BIA A;  2WB1 A;  1DPR A;  1MJA A;  3OOP A;  4AIK A;  2OZ6 A;  3ISP A;  3CP2 A;  2MSY A;  4A5N A;  3ZQQ A;  3WGH A;  5IYD J;  1W36 D;  5HOO A;  2YU9 J;  1K78 B;  5KAF C;  1WRJ A;  2DT5 A;  3GLX A;  2WAQ N;  1K79 A;  4XLA A;  4IHY A;  1EH6 A;  1LVA A;  3IV5 A;  1BJA A;  3BJ6 A;  2LY1 A;  1KYW A;  2L5Q A;  4NQW B;  1NH3 A;  4IF4 A;  1A35 A;  2VOD A;  3GXO A;  1Z05 A;  2WWY A;  5HDN A;  1XTA A;  3RKX A;  1WGX A;  3H3Z A;  2P81 A;  3GTQ J;  3PUB A;  1YIO A;  1XSD A;  2OQR A;  4XN3 A;  3M3Y J;  4BJT A;  1F1Z A;  1Z9C A;  5HLH A;  4A3K J;  4A0Z A;  3I53 A;  1U5T A;  5TGT A;  5ICG A;  5F08 A;  3GX4 X;  3GCM A;  2M0M A;  1EV7 A;  1MND A;  2Q8K A;  1R5H A;  2KMU A;  1K4S A;  2DOD A;  2BBY A;  3HOW J;  4E6K G;  2V6E A;  3CC4 I;  1LDJ A;  4IEJ A;  2L9V A;  3GBG A;  1LDD A;  3N97 A;  5HDG A;  5LGN A;  3H5A A;  1R36 A;  4FX4 A;  2VKH A;  1B8I A;  4BUP A;  1OMI A;  1HSJ A;  3FMQ A;  1TQM A;  2Z9O A;  3M8J A;  2MFZ A;  3HOT A;  4M3F A;  4LG0 B;  1BI1 A;  1D1C A;  2EB7 A;  2XKP A;  1S7O A;  3VYS B;  5C4X J;  1IAW A;  4XR6 A;  1P7I A;  3SZG A;  5HLG A;  3JRB A;  1SD6 A;  2X51 A;  2EFQ A;  2PMZ N;  1MMD A;  2W85 A;  1W7P A;  1M1E B;  2KHM A;  4E7K A;  3J7A Y;  1XMA A;  4BJ6 C;  5H20 A;  1JJ6 C;  2LKP A;  3TDU C;  5F0F A;  3HRM A;  3HUG B;  4YFX F;  3QRF F;  3IP4 B;  2KRC A;  4TV7 A;  2GQQ A;  1RR7 A;  4BKX A;  3AAF A;  3G73 A;  3VOE A;  1XN7 A;  2OUM A;  4RLF A;  4XKB A;  3HOZ J;  2EIL H;  1JKR C;  4YG2 F;  2XAU A;  2K40 A;  3BR0 A;  2EZI A;  4EQQ A;  1WJ5 A;  3P9K A;  2JPC A;  2PJR B;  4F52 A;  5ICE A;  4I0A A;  3U2R A;  3RTR A;  1VZ0 A;  2BY1 A;  4U7B A;  3OS1 A;  1YRN A;  2KIQ A;  1U3E M;  2QWW A;  1IRZ A;  1LDK B;  3MKL A;  2FSW A;  2KKO A;  2HVQ A;  1ZAR A;  1I50 J;  3BJO A;  3BWG A;  1X2N A;  1K6Y A;  1XDU A;  2DA2 A;  3BQY A;  5FFX A;  2R93 J;  2OAZ A;  3ZMS A;  1UST A;  5D6E A;  4AD9 A;  3H1C A;  1R5G A;  1MKM A;  1WKM A;  3S8P A;  2D1H A;  1D0X A;  2KZV A;  2Y2Z A;  4DYC A;  1X2M A;  2QA4 I;  4EGY A;  1I6H J;  3ZN0 A;  5HOD A;  3NRV A;  1IW7 F;  4MLO A;  2DYR H;  3AL0 B;  1I3Q J;  4UHT A;  1DP7 P;  2EBI A;  3AG1 H;  1A5J A;  4P9F A;  2L54 A;  4OIQ F;  1E0E A;  3I58 A;  4BBS J;  2IRF G;  2O5R A;  3NQO A;  4HRI A;  2XB5 A;  4JX4 A;  2FEZ A;  3HRU A;  5HS8 A;  1XCB A;  3ZOB A;  1XB4 A;  2M2E A;  5J40 A;  5HLI A;  3DPL C;  4GGG A;  5C3E J;  3JRE A;  1SAU A;  1B4A A;  2HTS A;  2OQG A;  2ADU A;  2Y48 A;  3BR6 A;  4NBQ A;  3OYG A;  2X1C A;  2Z16 A;  1Z3Y A;  4DZJ A;  5TJJ A;  2DTZ A;  1O7F A;  3RKW A;  4Y52 J;  1MBH A;  3OIP A;  2JMW A;  3G71 I;  2KPM A;  2FMY A;  3GZ6 A;  1D0Z A;  5FO5 A;  2W57 A;  1PYV A;  2BE5 F;  1A6I A;  2QKM B;  1ZR2 A;  3HG9 A;  3KLN A;  1DU6 A;  1GHC A;  3QYE A;  3WHC A;  1N25 A;  2H6B A;  4PSX A;  2CW7 A;  4CZC A;  2CG4 A;  2BW3 A;  5M5W J;  1FNN A;  2L7Z A;  2R4G A;  3TMO A;  2EJR A;  2VAS A;  5LHI A;  1TWG J;  3PIP F;  5LLQ A;  4XRS G;  3U21 A;  2E34 A;  3GFJ A;  4A5M A;  5LRS A;  2GZW A;  3D1N I;  4D1Q A;  1JTX A;  1LKX A;  2XSJ C;  2DBB A;  4YRV A;  3OYL A;  2JVH A;  3CCU I;  4KT5 C;  4XKC A;  3IKT A;  4LMY A;  2HYF A;  4D5F A;  1UJ8 A;  2R5Y B;  2K9M A;  2HYJ A;  4HPQ A;  3T8R A;  2HZD A;  5DUI A;  3JSO A;  3FDY A;  4UVB A;  4XID A;  4HYE A;  3M1C A;  2PI0 A;  3R60 A;  2P7C B;  4JBA A;  1JHH A;  3RZO J;  2HEO A;  2ZXW H;  3IKV A;  1MBK A;  2VPR A;  3OSG A;  4PUS A;  3FXK A;  4MFE A;  3FXO A;  4MQV A;  3EPZ A;  1O57 A;  5E3N A;  4BS9 A;  1MSF C;  5CPR B;  1JKQ C;  2VUM J;  4X0G A;  4RAG A;  2ID6 A;  1BC8 C;  2E36 A;  1WJA A;  3M8E A;  3K1M A;  3R61 A;  2OF7 A;  4U0Y A;  2M9H A;  3S2H J;  2XAS A;  1XGS A;  1Z6R A;  3HSE A;  4EM1 A;  3JRH A;  3Q9S A;  2B9S A;  1RNL A;  3UKG A;  1HF0 A;  2DAO A;  5L3D A;  2P0W A;  2VI6 A;  3BQZ A;  4IX7 A;  1XS9 A;  1H88 C;  1Y8Q B;  4OOI A;  5HNH A;  3HOS A;  5IOZ A;  5GAH J;  3OYH A;  4F55 A;  1BW5 A;  1NK2 P;  4ZZL A;  4HNV A;  3PSF A;  2F4M B;  3G6E I;  3A0B C;  1ZKG A;  2PX9 A;  5E8G A;  5KHD A;  4A6E A;  3EYY A;  3F72 A;  1TP4 A;  2OC6 A;  2DA4 A;  1S9H A;  3GTL J;  5BMZ A;  5H6Q A;  4AUX A;  3CCM I;  3FKJ A;  1PJR A;  2CW8 A;  1FX7 A;  3CF5 F;  1U9N A;  4MGR A;  2EZL A;  1CF7 B;  1NG6 A;  1I39 A;  2JUC A;  2VOP A;  1A04 A;  3HTS B;  1YX5 A;  1I6X A;  3JRD A;  2OV7 A;  2V1U A;  5FKM A;  3RSN A;  1S72 I;  2KRH A;  3LSK A;  3OV8 A;  1ZAO A;  2HU9 A;  3L9F A;  5D5U B;  4NHJ A;  4U0V A;  2MC4 A;  4M6Y A;  3GTG J;  3B6A A;  2CO5 A;  3MCZ A;  2CV0 A;  4ZYA A;  2DMP A;  5M3M J;  3FXJ A;  1JXS A;  2CUJ A;  3C18 A;  2EZH A;  2QLZ A;  1MJ9 A;  4K2E A;  5F04 A;  3IUO A;  3LSM A;  3I9V 2;  3I59 A;  4GYG A;  5K7H A;  4YEJ A;  2VT2 A;  1R22 A;  3CME I;  2ZNY A;  2IXS A;  2O9L A;  5M3F J;  1PVE A;  1FOW A;  1UEL B;  5J4V A;  1Y0N A;  2E1N A;  2WAQ A;  2HPI A;  3LST A;  3A2K A;  2HXO A;  4ESF A;  1G3Y A;  2E1C A;  2Y0S N;  3DKY A;  3ZR8 X;  1ZG3 A;  3HTU A;  4ZYH A;  1MIJ A;  4PCQ A;  4PGG A;  3DBL B;  3DU5 A;  3HOV J;  5FD6 A;  3ZMZ A;  4N4N B;  1LQ1 A;  2AXL A;  2DMU A;  1R1V A;  1K6O A;  1H9T A;  2AXT C;  4HX8 A;  3F3X A;  5CKT A;  5J1R A;  2VJ5 A;  3OIO A;  3F23 A;  1RET A;  4WWC A;  4UVA A;  1OFC X;  1OCR H;  2Y30 A;  3GZN B;  3C2H A;  2Y9Z A;  2HTJ A;  4WXC A;  3CUQ B;  3ZRG A;  3HYI A;  2JUG A;  1G4D A;  1AU7 A;  2DFE A;  2JA2 A;  4F7Z A;  1XX5 A;  2ACJ A;  4MEY F;  2F5D A;  2VKE A;  4F3Q A;  4JQF A;  2DPU A;  2JA7 J;  4I6Z A;  2PMZ A;  1GXP A;  1VQ7 I;  2L0K A;  1BBY A;  1Y1W J;  1PUE E;  5HDK A;  1KU9 A;  4FIS A;  1KYZ A;  2VBW A;  2X4H A;  2YPR A;  2R3S A;  3IH3 A;  3QPT A;  3PNY A;  3CLO A;  2L02 A;  1N77 A;  1D8J A;  1S7A A;  3Q9V A;  5JHF A;  1T56 A;  2VE8 A;  4KYW A;  4PGH A;  1JJ8 C;  2F6C A;  2XV4 S;  3VB2 A;  1USS A;  5ICF A;  3U1D A;  3ABU A;  1TWC J;  2GIZ A;  3HM5 A;  4KN4 X;  5CVJ A;  4S0H B;  4CCM A;  2F4I A;  4U0W A;  3I55 I;  1SEU A;  1SFE A;  4L9T A;  2P5L C;  1TW3 A;  3DQV C;  1YS7 A;  3IRR A;  4QPQ A;  2VN2 A;  2VJI A;  2O0Y A;  5HS7 A;  4D5C A;  2QSG X;  1Q1H A;  1E3O C;  6PAX A;  3D0S A;  1QU3 A;  1QZY A;  3I5U A;  4RB2 C;  2GAU A;  4CCL A;  2HOT A;  5ILV A;  4RMN A;  1YW7 A;  4XSZ F;  2MAB A;  2YSR A;  1JGS A;  1BJZ A;  2VJ4 A;  1VQL I;  3VYU B;  4HDU A;  1MZB A;  4NC6 A;  3BT9 A;  3K4M A;  2ESN A;  1MH4 A;  2KDZ A;  4A3J J;  1IUY A;  2O7O A;  3DV8 A;  2M3A A;  1FWZ A;  1QPM A;  1W7P B;  2LG4 A;  3TBI A;  2IGO A;  2DA1 A;  2XAG A;  1MSE C;  2RRE A;  1XMX A;  2IA1 A;  1J59 A;  2J5P A;  3BTI A;  4BEH B;  2XAF A;  2LFB A;  4JP0 A;  1G8X A;  2JJ7 A;  3MKY B;  1SVM A;  1A36 A;  4HAM A;  3WU1 B;  4L0Z B;  1P6R A;  2R5Z B;  1QQI A;  3I4P A;  2LNB A;  1SMY F;  4CO8 A;  1RI7 A;  4MQ9 F;  2FNA A;  4OIN F;  3WGI A;  3CCS I;  2LLK A;  4B3X A;  4P55 A;  3IAS 2;  2GLO A;  4Y13 A;  4HF0 A;  3J80 Z;  1EH7 A;  1FIP A;  1FSE A;  1HKS A;  1WFX A;  2WC2 A;  4E7L A;  1MMS A;  3BR5 A;  2G7H A;  5IYC J;  1D8K A;  4BYY A;  3DU6 A;  3FM3 A;  4CCO A;  4CZZ A;  2BY0 A;  2LK2 A;  2X6W A;  4DYQ A;  5FLX K;  4HA8 A;  1IN7 A;  5K1Y A;  1LVK A;  1FC3 A;  2BGC A;  3LSG A;  5IP9 J;  1UHM A;  2EPF A;  3FWE A;  2XIG A;  5LEK A;  1XPX A;  3GEZ A;  4C9Y A;  3ECH A;  4Q4Z F;  3B02 A;  3HHG A;  1FEX A;  1OCZ H;  5CYV A;  4ETS A;  1TNS A;  4KUM A;  3OYN A;  5JR3 A;  2BVM A;  1PUF A;  1JUP A;  3DTK A;  2HFH A;  2G9W A;  2M30 A;  2V26 A;  4G6D A;  4HLX A;  2L01 A;  4XRF A;  2DFH A;  4PSW A;  1FYK A;  3EET A;  4NNJ A;  2CQ7 A;  1SFK A;  1SD4 A;  4GXO A;  3W6K B;  4HNU A;  2R0Q C;  1EF4 A;  2PEX A;  3KZZ A;  3ABL H;  3RKY A;  1SC7 A;  1IZ1 A;  2BOL A;  2V4J C;  3OYI A;  1W4M A;  2P5V A;  1GV2 A;  4I99 C;  1ZRE A;  4PK4 A;  1DGR M;  3FF5 A;  4QWQ A;  2C6Y A;  4GCV A;  1BIB A;  1Z77 A;  2L9R A;  4XOT A;  1GV5 A;  3GW2 A;  4M9X A;  1Y39 A;  3MQ0 A;  2HXI A;  1HCR A;  3IH4 A;  3MKZ A;  3HGY A;  1OQY A;  2ZME C;  4EJW A;  3DBR B;  3K0L A;  5M5X J;  3L2U A;  1WQ2 A;  1L0O C;  2TDX A;  3WGG A;  2CUZ A;  2Z99 A;  1SD7 A;  1HLV A;  2PG4 A;  5FJ8 J;  3ZPL A;  1MBG A;  4X1E A;  1H8A C;  3ML6 A;  4JX6 A;  1VQK I;  2A3S A;  4XOR A;  4C2U A;  4IRG A;  2X1D A;  3DPT A;  4IHW A;  1CGP A;  5HNF A;  4I0B A;  2H6C A;  4MIM A;  4R8H A;  1YS6 A;  5IP6 A;  3I56 I;  4P9U A;  2DT6 A;  4CYC A;  1VF9 A;  1QVU A;  3HPH A;  3L09 A;  3R0A A;  3R6S A;  2M7B A;  3MFK A;  2F5V A;  1QNT A;  2QQA A;  1J0R A;  5J1U A;  4U7D A;  1IXS B;  4QPO A;  4RB1 A;  2IA0 A;  4B09 A;  3S3M A;  4IRH A;  3A01 B;  4ENM A;  2IS2 A;  4G94 A;  5FLX Z;  1ETK A;  2QCO A;  2ZXH A;  1X58 A;  3B6C A;  1T0F C;  2X6O A;  2DA7 A;  4OAY A;  2NRA C;  2LMD A;  3F6V A;  1XSX A;  1XSV A;  2NOG A;  4XLN F;  3S3N A;  2H8W A;  2BYV E;  5DTD A;  2R7X A;  4BAY A;  2GOM A;  4BHP A;  3GTJ J;  3TW7 A;  2XGX A;  5KVR A;  2ZNZ A;  3G3Z A;  4HOB A;  4LIV A;  2STT A;  1MDM B;  3GUD A;  4M71 A;  1R7J A;  5K5O A;  4F91 B;  5TRD A;  1U6G A;  2MLK A;  3JRC A;  3OR2 C;  1B1B A;  3WTV C;  3CCR I;  3ZQH A;  2MBF A;  2QSH X;  4C3H J;  2CFX A;  3F9K A;  1ZGA A;  4IQJ A;  4WK8 F;  4E7Z A;  2ZC2 A;  1RES A;  4ENN A;  3SJM A;  3DXJ F;  4QSH A;  3KLO A;  2DDB A;  2KJB A;  3HPG A;  4L5J A;  4M3E A;  3SZP A;  3V8L A;  1VQM I;  2RQQ A;  1G6N A;  3OR1 C;  3FBN B;  3VYR B;  1ZLK A;  1BM9 A;  1ZGW A;  2XAH A;  2IEK A;  5CVU A;  4B48 A;  5FKL A;  2G7U A;  3CJN A;  1LB2 A;  3E3V A;  3KP7 A;  2E2H J;  3CF2 A;  1HST A;  1QZE A;  1YIJ I;  4BXF A;  2IGN A;  2FX0 A;  2ZME A;  3P9I A;  3TOA A;  3TQN A;  3K4L A;  2VPL A;  2W84 A;  4LG3 A;  2PQ8 A;  4AIJ A;  2VE9 A;  2LD5 A;  3CCL I;  2L9S A;  3CCV I;  3HOX J;  4XIC A;  1ON1 A;  2YU3 A;  4IRI A;  3BRO A;  4MHG A;  2UUZ A;  2Y0S A;  2E71 A;  4B4C A;  2Z2S B;  5J1Y A;  4OWR B;  1VQN I;  3E0J B;  3OIQ A;  5IT3 A;  1R6R A;  1FBS A;  2K3P A;  4D0P A;  3E6B A;  3QPH A;  4P96 A;  2FA5 A;  4DNC A;  5A2Q K;  2BV6 A;  1XD7 A;  4M6V A;  4ENK A;  2FF4 A;  5LGU A;  3V42 A;  2JZY A;  3SFI A;  2XF5 A;  5E1W A;  4ZDL A;  2QBY A;  1O3Q A;  2L9N A;  1JUS A;  2IA2 A;  3BG5 A;  2BZT A;  3Q3S A;  1XDS A;  2WBM A;  2ZXJ A;  4WF2 A;  3REO A;  5GTI C;  2RVC A;  2X1E A;  1T0F A;  2HQR A;  5HVQ C;  3MZY A;  4N9H A;  2X6X A;  2R7W A;  4ZZD A;  1LFU P;  2UXX A;  3KE2 A;  3A1Y A;  4EAT A;  3WOD F;  3DWL E;  4BJ5 C;  2ZFU A;  2NVY J;  3F22 A;  3WG7 H;  5CVR A;  1FYL A;  1HW1 A;  2ZCW A;  1POG A;  2BXZ A;  2LF7 A;  3CCE I;  2L4A A;  2CQN A;  2LVS A;  4LK1 F;  1ETO A;  1IV8 A;  1QZZ A;  3GFM A;  2DMQ A;  2JTV A;  4M73 A;  1UHW A;  1P4X A;  1IN5 A;  1ZQ3 P;  4B47 A;  2QKL B;  4U87 A;  4NB5 A;  4LK0 F;  2ZJR F;  1WSU A;  1KU2 A;  2MC3 A;  3WU2 C;  2QF7 A;  1JT6 A;  1P4A A;  3MD2 A;  3VWB A;  1TBX A;  1V54 H;  2QEX I;  1P4W A;  4HZF A;  3OYF A;  1XG1 A;  2HKX A;  1MNE A;  5EG0 A;  5FB2 A;  4KN7 X;  1BOA A;  2H1L A;  2ME0 A;  1AHD P;  2B63 J;  1RZ4 A;  3CTA A;  2NS7 A;  1NG7 A;  3H9Q A;  4LB6 B;  4UNO A;  1IG7 A;  4PJJ A;  4MEX F;  3BCB A;  2ECB A;  3KZY A;  1ERD A;  3J7Z I;  4KIT B;  2ZJP F;  1IXR C;  3HKZ N;  5DDG A;  2H09 A;  2LKS A;  4HG2 A;  4RGS A;  3OYA A;  2Q2E B;  2HGC A;  3E97 A;  4XKV A;  5A2Q Z;  2LY2 A;  3KYL A;  4LJZ F;  3L1P A;  2X85 A;  3LSJ A;  1WH7 A;  5E1Z B;  1E2X A;  2Z1D A;  1MW7 A;  4ZH4 F;  3H5N A;  5D4R A;  1AA7 A;  1LFB A;  1KU3 A;  3T8T A;  2ZJ2 A;  2XUB A;  2HYG D;  4A0Y A;  4ABZ A;  3I4M J;  4BBR J;  3AFH A;  1SFO J;  1D3Y A;  1VQ4 I;  1LNW A;  2HZT A;  3QU6 A;  3QYB A;  3DLL F;  3EUK L;  3KP5 A;  1HA8 A;  5EEG A;  1FTZ A;  2KLO A;  4BHC A;  4M3G A;  5BPD A;  3M07 A;  2FOK A;  1R23 A;  1T08 B;  2QZ8 A;  4RBO A;  2DA6 A;  1QGP A;  2DDA A;  2IAI A;  3PL8 A;  4G9Y A;  3TOB A;  5B1A H;  5JVG F;  1UMQ A;  2JPB A;  1ZEL A;  3FXL A;  2VOO A;  1X1D A;  2RGV A;  2K02 A;  1K7A A;  3K1P A;  1IRX A;  2BY2 A;  3HGG A;  4BY1 J;  1A6Q A;  1Y0U A;  4AM3 A;  1JT0 A;  1WI3 A;  2LY9 A;  4RAF A;  5EZH A;  3K4J A;  2VON A;  2FML A;  1G3W A;  4IVN A;  5DS9 A;  3FMR A;  4A2U A;  1P9Q C;  5JLX A;  3F8M A;  3RYR A;  3ZQG A;  3CCJ I;  1KGS A;  2OU2 A;  5FLM J;  1Z67 A;  2BVL A;  2XPW A;  3J7A O;  4C2T A;  4IZZ A;  3AG4 H;  3F8B A;  5JI6 A;  2DMT A;  3DFG A;  2KJC A;  2XHK A;  3BTL A;  4XM3 A;  4IL6 C;  1RC9 A;  1SVO A;  2P6T A;  3I54 A;  2D45 A;  3U1K A;  3RKQ A;  4UUS A;  4UXN A;  5AIP A;  1FJL A;  2VLA A;  4CCN A;  4A3C J;  2HS5 A;  1K83 J;  2W1O A;  2PLY A;  2B7E A;  2Y31 A;  5M5Y J;  4HX7 A;  5DD8 A;  2COM A;  2FQ4 A;  3H0D A;  2XC7 A;  3COA C;  1IN6 A;  4PDK A;  2M87 A;  3FM5 A;  1C0W A;  5IYB J;  4PFO A;  5E18 F;  1HDD C;  3G1M A;  1N75 A;  2DYS H;  2QYO A;  2QGU A;  4BQN A;  1WJE A;  3K1N A;  1MMN A;  3KP2 A;  3JCU C;  2YR2 A;  3QOP A;  2R7Z J;  4M3B A;  3K2Z A;  1OKR A;  3DP7 A;  4DW6 A;  3KP3 A;  2R7D A;  4Y7N J;  2LRE A;  2RAE A;  3M9A A;  3F6O A;  4ESJ A;  1W36 C;  4BH9 A;  3C3W A;  5FKN A;  4Q48 A;  3WE2 A;  2COB A;  3NAR A;  1OYY A;  4XLH A;  5CVI A;  1VND A;  5DD4 A;  3FX3 A;  4ENJ A;  3SXY A;  4LIU A;  2M34 A;  3CD6 I;  3HOU J;  1BA5 A;  4BGD A;  1IN4 A;  1Y1V J;  2H8R A;  3B73 A;  3F8N A;  4CXF A;  1ZRF A;  2MYS A;  1OYI A;  4XK4 A;  3S17 J;  2F5C A;  1WJC A;  2JSP A;  5GAE J;  1RRJ A;  1IO2 A;  3OY9 A;  1S3J A;  3UNG C;  4AVP A;  2DK5 A;  2K86 A;  3N4M A;  3W6V A;  3MZH A;  1T8I A;  5B5E C;  4RB0 A;  2XGC A;  4EJT A;  1MH3 A;  1S8N A;  3I4N J;  1UCR A;  2XF7 A;  4E70 A;  3S1Q J;  5DCM B;  3S32 A;  2HOE A;  3TGN A;  1A31 A;  3LAJ A;  2HDC A;  1T6S A;  5E3M A;  3G4S I;  5ILU A;  1UB9 A;  3K7A J;  4I09 A;  3FBI B;  4UV9 A;  3IHU A;  3LSI A;  5AON A;  4MO7 A;  2DOF A;  3DBH B;  4G7O F;  2CUF A;  1MBE A;  2E1M C;  4CCJ A;  5F27 A;  1AKH B;  1SFX A;  2DTR A;  1Z91 A;  4UV8 A;  3SEZ A;  3P9C A;  1XMK A;  2XAJ A;  2X6Y A;  2V1D A;  4L9V A;  5BQT A;  1T39 A;  4A93 J;  2PJP A;  4L9J A;  3QP6 A;  4PJL A;  4E7H A;  1UAA A;  1TLH B;  3QOE A;  2VKV A;  4GRI A;  3ROU A;  1VQO I;  3MWM A;  5GPA A;  2NVT J;  2MA3 A;  2WTE A;  1OCT C;  3AG3 H;  2NXN B;  3OL4 A;  2PFB A;  5GTH C;  1LEB A;  2AQE A;  3HIF A;  1F5T A;  1TC3 C;  2M8G X;  2ZSH B;  4HQE A;  3G2B A;  2ZSI B;  9ANT A;  4IHT A;  2KIS A;  3OYM A;  2HNH A;  5FRO A;  1ZTR A;  3OMY A;  5EGO A;  2NS8 A;  2ETH A;  2HQN A;  3IWZ A;  3PSI A;  2JRT A;  4G6Q A;  3VSK A;  4L9N A;  4YFK F;  3WTU C;  3S14 J;  3FK6 A;  3FHZ A;  3WTY C;  3A03 A;  4IPA A;  2RDP A;  3CMY A;  5F64 A;  1ETX A;  4XL9 A;  2CWE A;  2YUS A;  2R92 J;  2IS1 A;  3GWZ A;  3M8F A;  4FQG A;  3HOY J;  1ZHF A;  3ZQ7 A;  1K78 A;  1XGO A;  2R7O A;  1GVD A;  1V5E A;  2IGK A;  2LTP A;  2O03 A;  4WXD A;  2V9V A;  2KQR A;  1QBJ A;  5B3S H;  1RKW A;  2EWN A;  4RGX A;  4NQW A;  5LEJ A;  3PNT A;  4KA4 A;  1UG0 A;  1AWC A;  4HBL A;  2IPQ X;  4B44 A;  2IJL A;  3C1D A;  2KT0 A;  4Z2Y A;  3FIW A;  3BTJ A;  4LFU A;  2WY7 Q;  2OCE A;  3BZ6 A;  1JTY A;  3LQR A;  3BZK A;  3QPS A;  3EUH A;  2FBH A;  3HRS A;  4I98 B;  3K6G A;  2DPD A;  4HST A;  3T1B A;  2FUG 2;  5LFA A;  1QA6 A;  4B3A A;  2DN0 A;  1IUF A;  5J47 A;  1DPU A;  3N05 A;  5C4J J;  3TO7 A;  4P1W A;  2CU7 A;  5HLT A;  2NVQ J;  4RDU A;  2LRD A;  4BXX J;  3S1R J;  1V4R A;  2I5U A;  2PMU A;  2GA1 A;  2RKH A;  3HSR A;  3HXL A;  4LG0 A;  1JKP C;  1FOY A;  3PQJ A;  3ULQ B;  2HWV A;  1FMV A;  3PIO F;  2PMH A;  3SQN A;  2EIM H;  1X3U A;  1U9O A;  3MAJ A;  3OYE A;  4RLQ A;  3WTT C;  2OTL I;  3HZJ A;  3ZQC A;  2ZB9 A;  1LEA A;  4MTD A;  2VB6 A;  2LKX A;  3BOQ A;  2GXA A;  1R4M B;  5D8K B;  1IJW C;  3FKI J;  4ZDP A;  2VJJ A;  4DBR A;  2P4W A;  1R9T J;  1MBJ A;  3DTI A;  2K9N A;  3OOU A;  3PNV A;  3J80 K;  2P6S A;  1SAX A;  4FE7 A;  4PZJ A;  3SEQ A;  3UR3 C;  4XRS A;  2O6G E;  4G6T B;  2OCC H;  1BOB A;  3MN2 A;  1FBU A;  2TCT A;  3PUF A;  5B1B H;  1GLN A;  2NS0 A;  1TQI A;  5J3L A;  2L7K A;  1WH5 A;  3BPV A;  1QO0 D;  2MLG A;  5KK1 A;  2R7Q A;  3R4K A;  2OBP A;  4Y17 A;  4EJV A;  4LLG F;  1WJB A;  1X4O A;  4OIO F;  1HKT A;  4JYK A;  3HKZ A;  5FKO A;  2OJE D;  1U5T B;  3DEE A;  4XLC A;  1L3L A;  1ZR4 A;  3ECO A;  1DGW Y;  1TT5 B;  4YIR X;  1ZN2 A;  4MTE A;  2ZFW A;  1XCV A;  3K4K A;  1IXC A;  4QIW N;  1HXD A;  3GFI A;  4XSX F;  1X1P A;  3BC8 A;  2F5F A;  1FBQ A;  2IP2 A;  3O2P E;  4UB6 C;  2JWT A;  1B8I B;  2DK8 A;  1PP8 F;  5ED4 A;  1BL0 A;  3ZMV A;  4IXA A;  4KIS A;  3X2Q H;  2MGQ A;  4OMY A;  3CMA I;  3BG9 A;  2NAZ A;  2W4S A;  3SDG A;  4DJA A;  4EJO A;  1X3Z B;  3AKZ A;  3WE3 A;  4J00 A;  3GME A;  1PP7 U;  3VOD A;  1JI8 A;  3D5L A;  3H35 A;  3I0T A;  2K4J A;  3S1N J;  5EG0 B;  1R49 A;  4OU0 A;  5KNL A;  3FHN A;  4AWX B;  2WAD A;  4A3M J;  2XAQ A;  5BNG A;  1JHF A;  2FJ1 A;  3BG6 A;  4Q5S F;  2JA6 J;  5C44 J;  4LB5 A;  4BE0 A;  1AOY A;  4KNY A;  2P7V B;  2JSC A;  4IJA A;  2JA5 J;  3QU3 A;  2K3F A;  1IDY A;  3OWT A;  4NDL A;  4IKF A;  5DV5 A;  2FE3 A;  3QPL A;  1KQ0 A;  1R71 A;  1YRN B;  2V1N A;  2E5Z A;  2ELJ A;  4ZTF A;  4E4H A;  3S15 J;  4RB3 C;  5F0H A;  4HNT A;  2A5Y B;  1V55 H;  4FCY A;  3S2D J;  1TTY A;  1SD5 A;  2CH0 A;  1OCO H;  2ELH A;  3K69 A;  4XN0 A;  3F8F A;  3K70 D;  3Q0W A;  5DEQ A;  2QEN A;  1W5S A;  1J7K A;  1FMW A;  2E19 A;  3J81 Z;  3QAH A;  1X1C A;  1VQ9 I;  2K7L A;  3FK7 A;  4WX9 A;  1PDN C;  3BDD A;  2EQR A;  1XGN A;  4Y4R A;  2IS6 A;  4XBF A;  4FT8 A;  3A0H C;  3M7G A;  5H2F C;  5D5W B;  5EF6 A;  4M72 A;  1W5T A;  5GPC A;  5L3E A;  3A02 A;  1MBF A;  3ZCO A;  4A3L J;  3IRQ A;  1EH8 A;  3IC7 A;  1XGM A;  4XKW A;  2DMN A;  2VXD A;  2NVU B;  1FP2 A;  2VBZ A;  3DKX A;  2YX7 A;  3VEP A;  2HVR A;  1SAN A;  3HRT A;  2AHQ A;  3LSH A;  3R0J A;  5CJ9 A;  4XLE A;  5EZG A;  3L2R A;  2XSD C;  1ZYR F;  4RA2 A;  2V6C A;  4M9S A;  2E1O A;  1R1U A;  2V1X A;  1E3H A;  3ONQ A;  2W25 A;  3KFW X;  4JOM A;  1SVL A;  4ZTJ A;  2HOA A;  4RS8 A;  5EJC A;  3CO7 C;  2NNY A;  4BDY A;  2K9L A;  4XLP F;  4I01 A;  4BDZ A;  4UUS B;  3GTM J;  3Q5F A;  4ASN A;  2QQ8 A;  3QYF A;  2DOE A;  1I5Z A;  3HB9 A;  1R00 A;  1D1B A;  3K4N A;  2XGE A;  2DQL A;  1REP C;  1RUO A;  2RNG A;  2IT0 A;  2LDU A;  1OCC H;  1Z6T A;  2ZO4 A;  4M3D A;  4UVC A;  3SYT A;  3TL4 X;  2BW3 B;  5J8F A;  1P92 A;  3MMY B;  2FXA A;  2WV0 A;  2V9P A;  2CQK A;  1WJD A;  1YJW I;  1B6A A;  4KT6 A;  5EDN A;  2K27 A;  3H0G J;  2KIU A;  3TDZ C;  1UG2 A;  4PJM A;  4I76 A;  5J8C A;  2BY3 A;  1D1A A;  1LFP A;  2VT3 A;  1R58 A;  2G0E A;  4IHX A;  4E7S A;  1ETV A;  3RCO A;  4N4O B;  4LD5 A;  1TL8 A;  3JSP A;  1CF7 A;  2VBY A;  3QP5 A;  3S16 J;  3VFZ A;  1RUN A;  5E79 C;  2W7N A;  1OIS A;  2M4G A;  4FET A;  4HLY A;  2XRO A;  3FMS A;  3DCF A;  5EYR A;  2NOJ B;  4FTH A;  1QRY A;  2UZK A;  2CYY A;  2NNN A;  4ZJZ A;  5LRR A;  4DBQ A;  3L2W A;  4JX5 A;  4DGW B;  2RC4 A;  4OIP F;  1O3T A;  1YIT I;  1GUU A;  5HS9 A;  4ZYE A;  4M9Z A;  3CLQ A;  2ZJQ F;  5DUK A;  4H4K C;  3TW6 A;  1B72 A;  4J01 A;  3TO9 A;  4KIC A;  3DKW A;  2ISY A;  1EA3 A;  1ONV A;  3JRI A;  2Z3Y A;  4YIF A;  2P5K A;  5FD5 A;  4BAC A;  2L2O A;  2Y69 H;  4RGR A;  2HOS A;  4XNF A;  2CSO A;  1I1S A;  3EDP A;  3PM1 A;  2XKO A;  2GBY A;  1FT9 A;  3F0C A;  4CUG A;  5GAD J;  3J7Y J;  2IS4 A;  4N0B A;  2CV1 A;  4I2O A;  2QVO A;  4EM0 B;  1U0J A;  4CYD A;  1F36 A;  1BI2 A;  3U9G A;  3RDI A;  3TKY A;  4UY8 I;  1W1W E;  2E2J J;  2E7X A;  3NWS A;  3L2Q A;  1GVJ A;  5K5R A;  1G3S A;  4GFB A;  1GXQ A;  3CC7 I;  2K85 A;  4WXH A;  3JAM Z;  1X1B A;  5JVT A;  1WI9 A;  5DM6 F;  1BN5 A;  3E1S A;  1K4T A;  2FRH A;  4G8X A;  4DOZ A;  4GYI A;  3BCA A;  4V2F A;  2CGP A;  5LHH A;  4IHS A;  2JVG A;  1VQ6 I;  3CUQ A;  2ME6 A;  4KFC A;  4D9J A;  3C2B A;  5EGO B;  2QQB A;  3KYD B;  3WTW C;  2D2W A;  3GTP J;  3ABK H;  5H6R A;  4CGZ A;  4GO1 A;  1S29 A;  4DYR A;  2EA4 A;  2GIV A;  3K70 C;  4A3F J;  3TED A;  1JGG A;  3ZQI A;  2AS5 F;  2JQ7 A;  4CCK A;  2M45 A;  3CCQ I;  1BR1 A;  5K7Z A;  3HEF A;  1SFU A;  4BE1 A;  5FLV A;  1IN8 A;  3I59 B;  4C3J J;  4D7N A;  1ZH5 A;  2QM3 A;  2E2I J;  4C30 A;  4A3B J;  1RIO H;  1MMA A;  3QWL A;  3SHF A;  3E5X A;  1F43 A;  1HBX G;  5IT9 Z;  2WY8 Q;  4BNC A;  5IPA A;  4IO9 F;  2ELK A;  4IHV A;  1U8B A;  3MVP A;  5L3C A;  3CO6 C;  2ECC A;  1ZG5 A;  3HHH A;  3K4B A;  1LE8 A;  2CRG A;  3LFK A;  4NC8 A;  2DJN A;  3OL3 A;  4MFD A;  2GXB A;  4II2 A;  5KAI C;  2DLL A;  1I3A A;  3HJE A;  3LQQ A;  4AVZ A;  3VSL A;  3MKW B;  4HDV A;  1NTC A;  1TZL A;  2FNP A;  4R79 A;  2JN6 A;  3L00 A;  4HSR A;  2A6H F;  1FY7 A;  2A61 A;  2CMP A;  4XON A;  3FXR A;  2E1M B;  2IGM A;  4QTR A;  2DQR A;  3GF2 A;  4BQA A;  3I3L A;  4HEA 2;  3BJA A;  5JFR A;  1X19 A;  2MH9 A;  3ZQL A;  3TP0 A;  3CJR B;  4N9I A;  3C7J A;  1O3R A;  5D4S A;  1ZG1 A;  1X3W B;  2L4M A;  3IL2 A;  1MGT A;  2OPT A;  3K9T A;  1U8R A;  4BEH A;  3DEW A;  3EQL F;  1Y8R B;  5K5Q A;  4Q47 A;  3E6C C;  1JUM A;  2E7W A;  1QVT A;  2R5Z A;  1ZRC A;  3RZD J;  1FOK A;  5D5V B;  5DYM A;  1CQT A;  2M4K A;  1BW6 A;  2X9D A;  1OCP A;  3NEU A;  4EV0 A;  4H0E A;  2VQC A;  3IWF A;  3MEX A;  3OYB A;  3GLL A;  1ZK8 A;  5LHG A;  2DFI A;  2HR3 A;  3FXM A;  5E1X A;  2XPU A;  1W0T A;  4CDG A;  3WTX C;  2BHZ A;  1WJF A;  1Z21 A;  3DF8 A;  1S6L A;  2HQA A;  1OPC A;  3VDX A;  2XVC A;  1DDN A;  2FBI A;  1YQA A;  2VQG A;  2F2E A;  1O7L A;  4A6D A;  2BHY A;  2LF8 A;  1G3T A;  2FBK A;  2DI3 A;  2I8D A;  3HSF A;  3A4C A;  1YFH A;  1H89 C;  3DTE A;  4C2M J;  2W82 A;  3Q0V A;  1UHS A;  4YFN F;  2GA2 A;  4BQQ A;  1VQP I;  4LOC A;  4PFP A;  3H3U A;  3VYT B;  5LGT A;  3WTS C;  3L2C A;  1Z1D A;  2VL8 A;  2CQX A;  4UUT A;  1YJN I;  5K7F A;  1FTT A;  2VIX A;  1QHG A;  5CVV A;  2CW0 F;  3E6M A;  2GWR A;  1HQC A;  1TWH J;  5F1J A;  1D0Y A;  3C2G A;  3BG3 A;  5E8I A;  4DQ2 A;  3WU0 A;  3D5S C;  1YG2 A;  3LSP A;  3ZMD A;  2CS3 A;  2F5E A;  5D8L B;  1HDP A;  3M1E A;  4CIC A;  1J9I A;  2MD5 A;  3KEO A;  1XC5 A;  4LGW A;  4G7H F;  1HW5 A;  1KQ9 A;  3RQI A;  3L7W A;  5L3B A;  3E5Q A;  4LLN A;  4O3M A;  1DQU A;  2D1V A;  1YJ9 I;  3OYC A;  3HBL A;  2L7F P;  1NHA A;  4YII A;  4NUB A;  1V5F A;  5ILS A;  3K4C A;  3LSR A;  3AG2 H;  5IP7 J;  1ZGJ A;  3FXQ A;  3RJP A;  4HX4 A;  1Z3X A;  3MZ8 A;  2K4B A;  1P2F A;  5CLS A;  3CC2 I;  4E7J A;  2EIJ H;  3ZMU A;  2O61 A;  3H9J A;  4Y33 A;  3DPU A;  3ERE D;  2P8T A;  4G12 A;  2QUF A;  1TNT A;  5ICC A;  3LWF A;  3NWT A;  4BL0 B;  3KPH A;  5E3O A;  1WPK A;  3LOC A;  4UUV A;  2Z5U A;  4P5O A;  3T0Y A;  3OSF A;  4ANJ A;  1OLT A;  4BXU A;  3A01 A;  1U78 A;  2WAF A;  2LBF A;  3OYJ A;  3EUH C;  2V7F A;  3RI4 A;  2IVM A;  1MMG A;  2KIF A;  4U88 A;  2XPV A;  3ZN1 A;  1TWF J;  1KZH A;  1OJL A;  1DUX C;  4V19 K;  1PUF B;  1K61 A;  5FFZ A;  1TW2 A;  2I10 A;  4KMF A;  2HVS A;  2LC2 A;  2PN6 A;  2H94 A;  2XRL A;  4LIT A;  1MDM A;  1S5L C;  2K9Q A;  1IRF A;  1RKT A;  2VC0 A;  5TIS C;  1LJ9 A;  3RIR A;  1T2K A;  1QPI A;  2DCE A;  1FYM A;  2YS9 A;  3PFI A;  4D7M A;  5IY5 H;  1FZP B;  1D5V A;  1O4X A;  3FXU A;  3ASN H;  2CQQ A;  2IBD A;  3BTC A;  1BR2 A;  2A6T A;  4F92 B;  3QQA A;  2EFW A;  3FZV A;  1O3S A;  2Y0M A;  5GP9 A;  3CJT B;  4M74 A;  4AYB N;  4S05 A;  3LMM A;  1S7E A;  4S04 A;  1ZLJ A;  1LPQ A;  3BY6 A;  1IC8 A;  1T95 A;  4Y15 A;  5EEH A;  3LAP A;  2E5N A;  2M5W A;  3H36 A;  2VBX A;  2RV8 A;  4PJ0 C; 
#chains in the Genus database with same CATH homology
 1BL0 A;  2X48 A;  3GTJ J;  3TW7 A;  5F0C A;  1YRN A;  2N8G A;  4J19 A;  2MGQ A;  3BG9 A;  1IRZ A;  1ETY A;  3MKL A;  3SDG A;  4CYC B;  1RPW A;  2W48 A;  1I50 J;  1X2N A;  2DA2 A;  3BQY A;  3JRC A;  2R93 J;  2LR8 A;  3ZQH A;  4AC0 A;  3JRF A;  2Y9Y A;  3S1N J;  3HDD A;  4C3H J;  5EG0 B;  3Q0U A;  2Y2Z A;  1RES A;  4A3M J;  3SJM A;  5BNG A;  2FJ1 A;  4QSH A;  4DYC A;  1X2M A;  2JA6 J;  1ORK A;  2MG4 A;  4M3E A;  5C44 J;  1I6H J;  5HOD A;  4BY7 J;  2JA5 J;  4MLO A;  1IDY A;  3G1O A;  1ZGW A;  4NDL A;  2IEK A;  3QPL A;  3PO2 J;  1I3Q J;  5FKL A;  2EBI A;  3PO3 J;  1YRN B;  1A5J A;  3CDL A;  4BBS J;  2E2H J;  3S15 J;  5F0H A;  2XB5 A;  4JX4 A;  2FX0 A;  4FCY A;  3S2D J;  3ZOB A;  3M4O J;  2M2E A;  2LD5 A;  5C3E J;  3Q0W A;  3JRE A;  2DA3 A;  3HOX J;  4XIC A;  3BR6 A;  2E19 A;  4A69 C;  5IOY A;  4DZJ A;  4B4C A;  1B72 B;  3FK7 A;  5J1Y A;  2DTZ A;  3LNQ A;  4Y52 J;  1MBH A;  2TRT A;  2JMW A;  1NK3 P;  2EQR A;  1A6I A;  5EF6 A;  1ZR2 A;  4M6V A;  5GPC A;  2L7M P;  3A02 A;  1DU6 A;  1MBF A;  4A3L J;  2WB1 N;  3SFI A;  3WHC A;  2DMN A;  2H1K A;  5M5W J;  1JUS A;  3BG5 A;  2L7Z A;  3Q3S A;  1SAN A;  3JR9 A;  4B1R A;  2AHQ A;  5EZG A;  1W0U A;  3IH2 A;  2XSD C;  1TWG J;  4XRS G;  3D1N I;  1LFU P;  2E1O A;  1JTX A;  2NVY J;  2FD5 A;  3K2A A;  1POG A;  2HOA A;  4D5F A;  2LVS A;  1ETO A;  2R5Y B;  2HYJ A;  4UUS B;  3GTM J;  2DMQ A;  3HB9 A;  1ZQ3 P;  4XID A;  2XGE A;  5FKK A;  1P7J A;  3RZO J;  2GM4 A;  4M3D A;  2QF7 A;  1JT6 A;  1MBK A;  2VPR A;  3OSG A;  4A3E J;  4MFE A;  5EDN A;  3GTO J;  1XG1 A;  3H3V K;  3H0G J;  5EG0 A;  1UG2 A;  4I76 A;  5E3N A;  1AHD P;  2ME0 A;  2B63 J;  1MSF C;  1JKQ C;  2VUM J;  2G0E A;  2ID6 A;  2NS7 A;  4IHX A;  2OF7 A;  1ETV A;  1IG7 A;  2M9H A;  3S2H J;  1G2H A;  2D5V A;  2ECB A;  3S16 J;  3JRH A;  1ENH A;  3UKG A;  3BR2 A;  3DCF A;  3HKZ N;  5EYR A;  1HF0 A;  4FTH A;  4A3D J;  1QRY A;  4C3I J;  2VI6 A;  3BQZ A;  1XS9 A;  1LE8 B;  1H88 C;  5IOZ A;  1BW5 A;  3L1P A;  3LSJ A;  1WH7 A;  1NK2 P;  4JX5 A;  4HNV A;  1GUU A;  4W97 A;  2HDD A;  1LFB A;  1ZKG A;  4ABZ A;  3I4M J;  4BBR J;  3TW6 A;  1SFO J;  2DA4 A;  1B72 A;  3WHB A;  3GTL J;  4AUX A;  1U9N A;  1FTZ A;  3JRI A;  2EZL A;  4M3G A;  1TWA J;  3JRD A;  5FKM A;  2HOS A;  4RBO A;  2DA6 A;  2IAI A;  3PM1 A;  2LP0 A;  1UMQ A;  2GBY A;  1D5Y A;  1HOM A;  3F0C A;  3HGG A;  4BY1 J;  3GTG J;  3JRA A;  3B6A A;  1JT0 A;  1F36 A;  1WI3 A;  2LY9 A;  5EZH A;  2DMP A;  5M3M J;  5DS9 A;  5JLX A;  2CJJ A;  3ZQG A;  5FLM J;  2E2J J;  2EZH A;  4GFB A;  2XPW A;  2AO9 A;  5F04 A;  2DMT A;  5K7H A;  2NVX J;  3BTL A;  1ITY A;  2O9L A;  5M3F J;  3RKQ A;  4V2F A;  2R5Y A;  4UUS A;  3GTK J;  4A3C J;  1FJL A;  4EEF G;  2ME6 A;  3E7L A;  1K83 J;  2JK3 A;  2Y31 A;  3C2B A;  5M5Y J;  5EGO B;  2CUE A;  2HXO A;  2FQ4 A;  3GTP J;  2Y0S N;  5EEA A;  1DU0 A;  5IYB J;  3G1L A;  1HDD C;  3HOV J;  3G1M A;  4DYR A;  3FIS A;  1IDZ A;  2DMU A;  4A3F J;  3TED A;  1JGG A;  3ZQI A;  5J1R A;  2JA8 J;  2K9S A;  4A3G J;  3NAU A;  3OIO A;  1JKO C;  2R7Z J;  4M3B A;  1RET A;  5K7Z A;  4DW6 A;  3HEF A;  3JRG A;  4A3I J;  4Y7N J;  1Z0X A;  3CQZ J;  5FLV A;  1OFC X;  2RAE A;  4C3J J;  3VPR A;  5FKN A;  1Q1V A;  4D7N A;  2Y30 A;  2E2I J;  2COB A;  3NAR A;  4A3B J;  3BR1 A;  1VND A;  2Y9Z A;  1AKH A;  1F43 A;  4FE4 A;  2M34 A;  5IPA A;  3HOU J;  1BA5 A;  2ELK A;  4IHV A;  2WV1 A;  1Y1V J;  1U8B A;  2HI3 A;  3MVP A;  2H8R A;  2ECC A;  1AU7 A;  2EH3 A;  1LE8 A;  2CRG A;  2XB0 X;  4XK4 A;  1GDT A;  2DJN A;  4MFD A;  3S17 J;  2VKE A;  2JA7 J;  4I6Z A;  1NTC A;  2L0K A;  1Y1W J;  1ETW A;  3W6V A;  2JN6 A;  4FIS A;  3IH3 A;  2XGC A;  3I4N J;  1MH3 A;  1VFC A;  4L5E A;  3S1Q J;  5E3M A;  3K7A J;  1T56 A;  3BR3 A;  4QTR A;  3ZQF A;  1JJ8 C;  4MO7 A;  2O8K A;  2CUF A;  1MBE A;  3ZQL A;  5F27 A;  3TP0 A;  1TWC J;  1AKH B;  1MNM C;  3HM5 A;  4S0H B;  1ETQ A;  2OPT A;  1T33 A;  4A93 J;  1IGN A;  2ID3 A;  3DEW A;  4D5C A;  1E3O C;  2EZK A;  1JUM A;  1QVT A;  2R5Z A;  3RZD J;  2VKV A;  3CCY A;  1IV6 A;  4DZP A;  1CQT A;  1BW6 A;  2X9D A;  1OCP A;  5GPA A;  2HOT A;  4XRM A;  2NVT J;  5JLW A;  1GT0 C;  1OCT C;  1ZK8 A;  2XPU A;  1BJZ A;  4W1U A;  1W0T A;  1TC3 C;  2M8G X;  3BT9 A;  4A3J J;  1MH4 A;  2KDZ A;  9ANT A;  2O7O A;  3O8G A;  5EGO A;  1ZTR A;  2NS8 A;  3O8H A;  5E3L A;  3S14 J;  2DA1 A;  3FK6 A;  1FIA A;  1MSE C;  1H89 C;  3A03 A;  4C2M J;  3Q0V A;  1UHS A;  3CMY A;  3BTI A;  4LOC A;  2LFB A;  4JP0 A;  1ETX A;  2HQ5 A;  2JJ7 A;  2YUS A;  2R92 J;  4V2G A;  3HOY J;  2CQX A;  4UUT A;  2R5Z B;  5K7F A;  1FTT A;  1GVD A;  2LTP A;  5F1J A;  1TWH J;  2LLK A;  3BG3 A;  1RKW A;  2GLO A;  1FIP A;  1APL C;  3BR5 A;  5IYC J;  2M0C A;  3LSP A;  2KT0 A;  3TP3 A;  1HDP A;  3FIW A;  2LK2 A;  3BTJ A;  4DYQ A;  1XC5 A;  1JTY A;  2XGD A;  3QPS A;  4X6A J;  3RQI A;  3LSG A;  5IP9 J;  1WCM J;  2DA5 A;  1VI0 A;  3S1M J;  2MW8 A;  3HBL A;  2L7F P;  4B3A A;  2DN0 A;  1IUF A;  3LSR A;  2MSY A;  5IP7 J;  1FEX A;  5C4J J;  5IYD J;  2YU9 J;  2NVQ J;  2CU7 A;  4RDU A;  2WAQ N;  1PUF A;  4BXX J;  1JUP A;  3S1R J;  4IHY A;  3IV5 A;  1JKP C;  4G12 A;  2R0Q C;  1EF4 A;  1WGX A;  1U9O A;  2P81 A;  1GV2 A;  3GTQ J;  5E3O A;  1WPK A;  1Z77 A;  3LOC A;  2L9R A;  3ZQC A;  3M3Y J;  3OSF A;  1GV5 A;  2ZB9 A;  4A3K J;  2LKX A;  5F08 A;  2HXI A;  3A01 A;  3IH4 A;  1HCR A;  3HGY A;  1IJW C;  1U78 A;  3FKI J;  5M5X J;  1R9T J;  1MBJ A;  3HOW J;  2K9N A;  2XPV A;  1HLV A;  3OOU A;  5FJ8 J;  4IEJ A;  1MBG A;  3GBG A;  4X1E A;  1TWF J;  4FE7 A;  4JX6 A;  1OJL A;  4XRS A;  1H8A C;  1B8I A;  1PUF B;  1K61 A;  3MN2 A;  2I10 A;  4IHW A;  2TCT A;  4M3F A;  2XRL A;  4MIM A;  5IP6 A;  5J3L A;  5C4X J;  1WH5 A;  2K9Q A;  1RKT A;  1P7I A;  4CYC A;  1VF9 A;  1QVU A;  3JRB A;  1QPI A;  2PMZ N;  2YS9 A;  4D7M A;  1O4X A;  2CQQ A;  2IBD A;  1JJ6 C;  3BTC A;  5J1U A;  4JYK A;  5F0F A;  5FKO A;  3QQA A;  3A01 B;  1RR7 A;  4BKX A;  5GP9 A;  1ZR4 A;  4AYB N;  1ETK A;  2QCO A;  1X58 A;  3HOZ J;  3B6C A;  2X6O A;  1S7E A;  2DA7 A;  1JKR C;  4QIW N;  1IC8 A;  2K40 A;  2NOG A;  2EZI A;  3BR0 A;  2JWT A;  1B8I B;  5DTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...