3CCEI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cceI00
3CCJI 3I56I 3CMEI 3CCLI 1YHQI 3CC4I 3CCEI 1VQ6I 3CJTB 3PIOF 2E36A 3J7YJ 1FOYA 3CF5F 1VQNI 4UY8I 3CCQI 5GADJ 5GAHJ 1VQ4I 2K3FA 2OTJI 1VQ8I 1YJWI 1FOWA 2OTLI 1VQPI 1Y39A 1VQKI 1ACIA 2QEXI 3I55I 3CCVI 3CCSI 4IOCF 1VQ5I 3PIPF 3CMAI 1YJNI 4IO9F 5GAEJ 1VQ9I 1VQOI 5DM7F 1YIJI 1YJ9I 2H8WA 3CCRI 5JVGF 3DLLF 2ZJQF 3G71I 1YI2I 5GAGJ 1S72I 3CD6I 1MMSA 1VQ7I 2E34A 2ZJPF 2ZJRF 1HC8A 2NXNB 5DM6F 1VQMI 1QA6A 2E35A 3J7ZI 3CCUI 3CCMI 3CC2I 3G4SI 4V19K 2QA4I 2FOWA 4IOAF 3G6EI 1FOXA 1YITI 1VQLI 2JQ7A 3CC7I
chains in the Genus database with same CATH superfamily
3CMEI 1YHQI 3CCEI 1WI3A 2RAEA 3K4BA 3JW4A 3F9KA 3ZMDA 2MGQA 3E5QA 1TW2A 5JLWA 1FBUA 2QKLB 4HRIA 5HS9A 3BJOA 4B48A 1RNLA 2QENA 3T8TA 3OV8A 3B6CA 4HQMA 3GLLA 3LL7A 4BY7J 3WGGA 1ZN2A 2WB1N 4BBSJ 2HZDA 2R5YA 4C3HJ 3HOVJ 2NNYA 3BZ6A 1R71A 3K6GA 2XRLA 1DUXC 3H5AA 3OYEA 2PN6A 3BG5A 1O3RA 3S3NA 2QSHX 2ESHA 2XASA 2QQAA 1RETA 2LKPA 2QKMB 4HNVA 2FRHA 2P7CB 2P5VA 2BVMA 1S7AA 2MH2A 1S9HA 3LSTA 3CDIA 5C4JJ 2R7VA 5EZGA 4ENJA 2ME6A 1V55H 2ZSHB 1XN7A 1A04A 3FMSA 4BEHB 1BI2A 4A3MJ 3P9CA 5F0CA 3FBIB 3K2ZA 1QPIA 1D1BA 3M9AA 4A3LJ 2EBIA 1HSTA 1VNDA 4D9JA 3GUDA 4PJNA 3CD6I 1P7IA 2HPIA 2VKHA 2ZXWH 3BG7A 2LREA 4YFXF 2D2WA 1WJ5A 2VQCA 5D5XB 2M2EA 1T56A 2R7WA 4ZDLA 3ZMZA 2CH0A 1R49A 4U0YA 4W97A 2H8RA 2H1KA 2YPRA 3F72A 2OCCH 1R5HA 1ZG1A 3MEXA 4LLLA 3ZRGA 3WODF 3PO3J 4ESJA 1Z1DA 5B5EC 1R7JA 2HQRA 1QA6A 2K9MA 2CMPA 3FXLA 4UV9A 2MD5A 5CQGA 3ZR8X 2LKSA 2ID6A 4D0PA 5M5YJ 1U5TB 2ZXHA 4DNCA 1OR7A 2BE5F 3JRFA 3OSFA 1ETQA 4V19K 2HVRA 4C9YA 2H94A 5A2QK 4CYCB 3K69A 3SHFA 1BC7C 2FD5A 2KT0A 2BXYA 3R0JA 2R7XA 2FOKA 2DDAA 3S16J 3Q0WA 1J2XA 1FOXA 4M74A 4W1UA 2W84A 1UFMA 2NYXA 3CUQB 3GFMA 2WTEA 1NTCA 3A0BC 2HWVA 5LFAA 2OF7A 2L02A 4GGGA 3A02A 4QWQA 5EF6A 3GW2A 4I0AA 2GZWA 2DFEA 2IA2A 3TO7A 3CCJI 1FP2A 1UG2A 1ZR2A 1TT5B 1MW7A 3KX2A 4YFNF 1EA3A 2ELKA 1B8IA 1T6SA 2EIJH 4IPAA 4UNOA 2CQXA 5IOYA 1MJAA 2KJBA 4QSHA 4BACA 2IW5A 1VQ8I 1SC7A 2O61A 2R7TA 2RV8A 1TW3A 3PUBA 1O57A 1ZG3A 2CUJA 2NS7A 2XB0X 5CVRA 1WHUA 3FXQA 1ZELA 4KT5C 2HYFA 3PFIA 2D1VA 3CCVI 2K4JA 5AIPA 3O6BB 1LDJA 5LGUA 2V79A 4E70A 4A3JJ 3ISPA 4D1QA 2JPCA 3QODA 5L3FA 3PSFA 4Y13A 1VQOI 1WFXA 4ZZLA 2CW8A 1D0XA 3DTEA 3IWFA 3D1NI 4D5CA 4MEXF 2UXNA 1BI1A 4JX5A 1VFCA 4EMSA 1OCZH 2EK5A 2DDBA 5K1YA 1H9GA 5K7HA 2IEKA 3S93A 2W4SA 3LA3A 4RAFA 4WXDA 2CJJA 4AYBN 3WG9A 1ZR4A 3WU1B 1RUOA 2LBFA 2LSOA 1JKPC 1TWAJ 2WAQN 2NVTJ 1A5JA 4BAYA 4IQJA 1JKOC 3DF8A 2X6OA 4GRIA 2E34A 4XORA 3WG7H 4BE0A 1D8JA 3SEZA 5EDNA 3MFKA 1MGTA 1WZ2A 3K4KA 1MBFA 1U6GA 1Z05A 3KP4A 5CLSA 4L0ZB 1K61A 4JOMA 4M9XA 4YIFA 1B4AA 2PJRA 1RC9A 1XTAA 2E5ZA 1Z0XA 3CCMI 2JVHA 4IRGA 3PM1A 3WGHA 4S05A 3CDLA 4MLOA 4RS8A 1FLIA 2Q2EB 3WE3A 3H9GA 4XMYA 2DYRH 3JRCA 4UVCA 3S1QJ 1XGNA 3RPUD 2WBMA 2JA2A 2V7FA 5FKKA 1BL0A 1ETWA 4XK4A 4OAYA 2PG4A 3FXMA 1W7PB 4ZYDA 3HC7A 2FXAA 2FF4A 1J9IA 2JK3A 2EZKA 2GQQA 3HG9A 4ESBA 3CC4I 4C2TA 1G6NA 2K85A 5K7FA 3PIOF 3I0TA 1VQ6I 3NAUA 4QPQA 3W6JB 3CF5F 1ZK8A 3C7JA 3EQLF 1JTYA 2M3AA 2DK8A 2F4OB 2DYSH 3V42A 2B7EA 1AU7A 1D5YA 1IJWC 2LY2A 2CS3A 3IP4B 1FBQA 2DA5A 3P9KA 3QPSA 3RKWA 1WSUA 2OTJI 4YRVA 1XGMA 3H9QA 3T1BA 2QLZA 4ENMA 3J7AY 1T98A 4I01A 4C30A 2YU3A 4Q5SF 3O3KA 3F0CA 3IKTA 1LNWA 1F36A 4MQ9F 4L9TA 3D0SA 1Z77A 4Q4ZF 1HW2A 2HS5A 3BZKA 2UZKA 3MN2A 2K5CA 5HLTA 1FX7A 4KNYA 2HU9A 3AG2H 1GHCA 2IPQX 4PSXA 5BMZA 2M8GX 1P4XA 1K4SA 3WU0A 3OOPA 5EJCA 1SFXA 3E5XA 3H0DA 2KL4A 1HW5A 5K7ZA 2VE9A 3KYLA 3SDGA 1SVMA 3PL8A 2Z16A 4A0YA 2V6CA 1USSA 2LYCA 2W24A 4IL6C 3LNQA 2Z9OA 1PYVA 3GX4X 3OL4A 4D7NA 2G9WA 3KPHA 3D5SC 2MLGA 5JI6A 1IO2A 1QQIA 2XAGA 2R5YB 3HL2A 4OMYA 3QOPA 2ZC2A 3FMRA 2ZXJA 4DJAA 5IT3A 5IT9Z 2XKPA 5E18F 5CKTA 2FQ4A 2VQGA 5J4VA 1Z21A 4F52A 2EZIA 2VOOA 4RAGA 4LMYA 3WTZA 4A93J 4IHSA 2CSOA 2B9SA 3ZQLA 3EUHC 3G4SI 2DPDA 4J01A 1SD7A 4IHVA 2E2HJ 2A05A 5FJ8J 1OFCX 2WWYA 1KU3A 1TT0A 5BS6A 4HLXA 3K0LA 1LKXA 3OS0A 3OMYA 2BW3B 3VDXA 4NBQA 4HG2A 2JUGA 4IOAF 5C3EJ 3AG1H 2LG4A 4R8HA 2VASA 3K9TA 4HV6A 2R3SA 2W25A 1BBYA 2J5OA 4N4OB 4UV8A 1SD4A 1D0ZA 2W7NA 4BQAA 2DOEA 2G7HA 1R36A 3I3LA 4HEA2 4EGZA 2O8XA 4IEJA 2JSCA 1GUUA 1X4PA 4UXNA 4M3FA 3HPHA 3F22A 2K3PA 1FOYA 2MBFA 3BR1A 2K9NA 3DQVC 2FBIA 3NARA 3GTPJ 4K2EA 3P7NA 3KEQA 2OZUA 1R58A 2ZSIB 2ZMEB 4XLHA 1TZLA 1OCPA 2ADUA 3F8NA 5IYCJ 1TP4A 1FSHA 3HKZA 5E1ZB 2ETHA 3I59B 1H88C 2VUMJ 1ENHA 1STZA 4B3XA 3COAC 2VC0A 4LLGF 3WE2A 4LB6B 3CCSI 4B3AA 1RI7A 2ISYA 3HYIA 4IOCF 3QRFF 2ACJA 1PUFB 3CMAI 1IF1A 2CV2A 3ZN0A 3FX3A 1BM9A 2IP2A 2DT5A 3CMYA 2XSJC 1MSFC 4DYQA 2L5QA 2CYYA 2ID3A 2M4KA 3C1DA 5E8GA 3CJRB 2V4JC 5D8LB 2XPUA 1IG7A 1ETXA 2XAJA 1HKSA 2CQNA 1U3EM 1YI2I 1JUMA 1AWCA 4WWCA 3TGNA 4U7BA 1JKRC 4RGRA 1U2WA 2MH9A 5LHHA 4XSXF 3ZOBA 4Y15A 4QTRA 3FISA 3OIPA 4G6DA 5KVRA 4AD9A 1U78A 2EINH 5E3NA 1LDDA 3KP7A 5DTDA 4M72A 4Z2YA 2MFZA 3SQNA 3CF2A 5JFRA 1YQAA 1XCVA 2ZJPF 2EA4A 4CICA 1E3OC 2A61A 1UAAA 3UKGA 1IDZA 4G8XA 4S04A 2VOPA 5B1AH 1Z7LA 2L9NA 4LGWA 4PZJA 5J3LA 1U5TA 2QUFA 1I3QJ 1XPXA 1OYWA 1E2XA 2DA1A 3W2VA 2IGMA 1IN7A 2GLOA 2XAHA 4WX9A 5EGOB 1WKMA 1DQUA 1HBXG 4BJ6C 3S1NJ 4AIDA 2QA4I 3BTCA 3L7WA 3HJEA 2P5KA 3BP8A 4XLFA 3ZP5A 3KP6A 3G3ZA 3GTLJ 2FU4A 3VYSB 5E1XA 3TW7A 1LFBA 1W7PD 1ZQ3P 3RIRA 3GLXA 1GXQA 2VT2A 1OCCH 3L9FA 2A6EF 4L5IA 1ZH5A 2EB7A 5DEQA 1IRGA 2WV0A 1ULYA 4UB6C 4ON0A 1XB4A 1T95A 1IC8A 3JRBA 3HOTA 1APLC 4B43A 3FWEA 3L2WA 2PJRB 1TL8A 4R79A 4Q47A 3CESA 4CCOA 3L2RA 1ZKGA 1YS6A 2EH3A 2HYGD 3FM3A 1U9NA 5CQEA 1G3YA 3WU2C 4BDYA 2FX0A 5J1RA 1VQ4I 1X58A 1EH7A 3SFZA 2K40A 4M3EA 4WK8F 1VQPI 5H6RA 2VPLA 1FY7A 3HRTA 1SVOA 1UHSA 4YELA 1W0UA 3L1PA 3RI4A 3A03A 2JRMA 3BR3A 3OR2C 1KU7A 1NK2P 4L5JA 3DBLB 4E7JA 3GWZA 3ZGKA 4RDUA 1MH3A 4HX4A 2FMYA 1U8RA 1WJCA 1QHGA 4KFCA 5LD2C 2XAUA 3S2HJ 3W3CA 1JHFA 1MBHA 1OISA 2KZVA 2EV6A 3DXJF 3U2RA 2FUG2 5M5XJ 1XMAA 3OYHA 4P9UA 3MKWB 4NHJA 3ABTA 3DEWA 5ED4A 2QBYA 2DMUA 2X48A 4UHTA 3M4OJ 3TL4X 1L0OC 4A3FJ 4Y17A 3MZYA 5D6EA 1KZHA 3PNTA 4A0XA 2FMLA 1MKMA 4FT8A 2HVSA 4CZCA 1NK3P 2E1CA 2UV1A 3GZ6A 2Y0SA 4XLEA 1MSEC 1OKRA 2EV5A 4CZZA 3LSIA 4DIQA 2G7UA 5J1UA 4RB1A 3WGIA 3S1RJ 2L7FP 4V2GA 9ANTA 5LGTA 2Y30A 4AIKA 4YIIA 5FLMJ 3HB9A 2QQBA 4BE2A 3RYPA 5JLXA 2VPRA 2LY9A 4HX7A 3GBGA 3G2BA 1HOMA 4PFPA 3LSRA 3Q0VA 2L9SA 2X85A 5JVTA 4MFDA 2EV0A 3AKZA 5FGMA 4DBRA 3JRAA 4BJ5C 5H6QA 3ZMSA 5C4XJ 3BR6A 4P96A 3T8RA 3FK7A 2VE8A 1YW9A 3RDIA 3AL0B 4ETSA 1S8NA 2COMA 4O5VA 1M1EB 2JJ7A 1IXCA 1S29A 3H0GJ 2RREA 1IXSB 2XPVA 2R7FA 3DKXA 2VKDA 3RYRA 2BV6A 4G94A 2BVLA 4XICA 4BQOA 1T0FA 1W7PA 1MBGA 3VOEA 5HDNA 4NC6A 2YUSA 2KRCA 2FNPA 3QYFA 3QAHA 3IRQA 4A3IJ 3MKYB 2RKHA 5E3MA 2MSYA 2QQ9A 2WV1A 1FT9A 2Y31A 1V5EA 5JHUA 2OA4A 4ZDPA 4XL9A 1S5LC 1RPWA 1WI9A 4OIQF 1DGWY 2XF5A 1H0MA 4UY8I 1R1UA 3LSKA 2Z3YA 1HDPA 4JBAA 3K1PA 2VBXA 4H4KC 2P5LC 2LY1A 2DPUA 1DU6A 3JRIA 5E20A 5LHIA 3HOZJ 2I5UA 3IWZA 1XG1A 2Y2ZA 3BG3A 5FROA 5HOOA 3GTJJ 1MBKA 3JSPA 4MGRA 3M8EA 4AUXA 2BZTA 5M3MJ 1TNSA 3PIPF 3OYGA 2IGOA 2QYOA 3CJNA 3W2AA 3QQAA 3TQNA 3ML6A 4E7SA 2V1NA 5FRNA 1EH6A 3HZJA 1OCTC 3WTVC 3BPVA 3R61A 2QSGX 1A36A 1JT0A 5HODA 3PNVA 1V54H 3DPTA 1B6AA 2Z5UA 3OSGA 1K4TA 3HOWJ 2X1CA 5K5OA 3MCZA 2C6YA 2LMDA 1ZARA 1TWHJ 4XONA 3W2WA 3I64A 3HOUJ 4LLNA 3F6VA 1KA8A 4M3DA 3JAMZ 4FX0A 3CUQC 2A6TA 1WRJA 2H27A 2HOAA 1S72I 2R7SA 4II3A 4M3GA 1KQ0A 1PUEE 2NVXJ 4HX8A 2OBPA 3K10A 2R5ZB 5K5QA 1SANA 2ECBA 4WXCA 4FCYA 3OYBA 5FFZA 3G1OA 2IGKA 2TRTA 2Z99A 1P4WA 4PJJA 2DTRA 1VZ0A 3L2CA 4HV5A 4PGHA 2E1MB 4PJ0C 4XRSA 1I1GA 3TP3A 3I53A 2ESNA 4F3QA 5FKOA 3SDBA 4ZTFA 1R22A 4FQGA 4I6ZA 1ZRDA 2XGXA 4EJTA 4X6AJ 3E6BA 2DAOA 3ASOH 4XRFA 5F08A 3H35A 2DTZA 1TQIA 1JT6A 5E79C 4HA8A 3KP2A 1OCOH 4JK1X 2ZFUA 2BW3A 1LVKA 4ZYGA 4QPOA 3HOSA 1BR1A 1X3ZB 2HKXA 1QVUA 3MAJA 2KLOA 3CTAA 3FXKA 2GAUA 4E7ZA 3HXLA 3TKYA 3HRUA 1XMXA 4ZJZA 2HOSA 1WPKA 1HDDC 5F1JA 1WCMJ 2FNAA 4OINF 4XLPF 2IGNA 4RB2C 1JJ6C 1KU2A 2A5YB 2MC3A 2M9HA 2ZJ2A 5AONA 2EQRA 1RR7A 1W5TA 3Q5FA 2ME0A 3B02A 5F6FA 1H89C 4CYDA 3GFLA 3GZNB 2XSDC 1BR2A 3FHZA 4J19A 3K4CA 1DU0A 2IJLA 1V5GA 3I4PA 1T39A 2V1UA 2ZMEA 2HTJA 4EEFG 2M7AA 2HZTA 1G3TA 2RQPA 2PMUA 4M9SA 2EA2A 3I59A 1WJFA 2LTPA 1FOWA 3D5RC 2R0QC 1Y1VJ 5LRSA 3WTTC 3EDPA 1SFEA 3GEZA 2CGPA 3R6SA 3DV8A 3OOUA 4G12A 1BA5A 2R4GA 4AWXB 3CO7C 3I55I 1PUFA 1ZGJA 3NQOA 5JHFA 3WTSC 3AG4H 3GTOJ 4FHTA 4EJOA 1D1CA 3BDDA 4P5OA 4A3BJ 2VQHA 4BHCA 4L18B 1QPMA 2HQNA 1NG7A 1WJBA 2X6WA 3KLOA 4EJUA 4LOCA 2FEZA 5IP9J 1VQ9I 3M8JA 2BY3A 2FQ3A 2M0CA 3VB2A 3OL3A 5LBQA 2JMWA 2MW8A 1IRXA 3IV5A 2E5NA 2X4HA 2XB5A 1X3WB 1OLTA 3BTIA 4OAZA 2ZJQF 4PFOA 2WB1A 2YS9A 2G0EA 3U1DA 4ESFA 4UUSA 2V26A 2O6GE 5EEAA 3DU5A 1FOKA 2LRDA 3KYCB 1WH5A 3VEPA 3KYDB 1R4NB 2JUCA 3ECOA 3H3ZA 5B66C 1EKEA 2EFPA 2P8TA 3JRGA 2PMZA 3EUKL 1GV5A 1G8XA 2A3SA 2ZO4A 2NS8A 3HIFA 3BG9A 4ZYHA 3J80Z 3MD2A 2DCEA 4KYWA 2O9LA 4A12A 2H1LA 2NOJB 4P55A 2ZJRF 2IBDA 2XROA 5D4SA 5FD6A 4BKXA 2XF7A 4HW0A 2CWEA 1W0TA 3BWGA 3ZXSA 2E1OA 2NVUB 2CUZA 2QBYB 5FLXZ 1K6OA 4I0BA 3HTUA 2K4BA 5HDGA 4G7HF 2WA0A 5EGOA 2HNHA 3EYIA 3H5NA 3OYJA 2JT1A 2DJNA 3LOCA 2JA6J 3DBHB 4U87A 2ZKZA 5CYVA 5J40A 2DFFA 2DOFA 1FP1D 2VJJA 1FTTA 4NC7A 4MNUA 2EJRA 3O8GA 2KIFA 3RKXA 3G1LA 3R0AA 1IDYA 2V9PA 4FE7A 1TC3C 2VB6A 2H6BA 2OC6A 4DOZA 1SFKA 4MIMA 3RSNA 1Z91A 1FSEA 2IVMA 2M1BA 4ANJA 3UR3C 1LJ9A 4EM0B 1QO0D 1RUNA 1X1BA 1XSDA 4FTHA 3LA7A 1UHMA 1V3FA 3FDYA 3VPRA 2D45A 2V1DA 5GTHC 4HNUA 2IA1A 2OCEA 4XBFA 3BROA 3F21A 3CDHA 3D5LA 1DPUA 2V6EA 5ICEA 2X51A 4HF1A 3WTYC 4XKWA 1Z3XA 4OIPF 2VLAA 2YX7A 1BOBA 4CCLA 4JYKA 4MEYF 4EV0A 2JRTA 2WY7Q 2K9LA 3IH4A 3VWBA 3S3OA 1XCBA 3BC8A 2CQ7A 3BR2A 2GBYA 3E3VA 5D5WB 2ECCA 1ZG5A 2YU9J 1Y6IA 1YE9A 1ZAOA 2AS5F 3I71A 1WJEA 1BIBA 4BBRJ 3WTWC 3JRDA 3ABUA 1DP3A 1ONVA 3DLLF 1EH8A 2BHZA 3KCCA 1IW7F 5F04A 1IN5A 5M5WJ 2ZCWA 2LFBA 1LFPA 5CPRB 4GYGA 1FYMA 1T33A 3LFKA 3M1CA 5BQTA 2K9QA 1O4XA 1YRNB 1KQ8A 1MMSA 2KKOA 5BOXA 1B1BA 4EATA 2CQQA 3CO6C 2TCTA 1RESA 1RIOH 1BOAA 2HQAA 3I58A 5HLGA 1XMKA 2P7VB 4HNTA 3MKLA 2XC7A 2GXGA 5CVVA 1OR7C 4UVAA 2DT7B 1LE8B 2OPTA 3DKWA 1SFOJ 1P9QC 3V8JA 2ZMEC 2LNBA 5BPDA 4AYBA 4PCQA 1JGGA 3L2VA 5F27A 1C0WA 2A07F 2L4MA 4CCKA 1HKQA 3MZ8A 5KCMA 3E5UA 1FJLA 3LSHA 2JA5J 3LFUA 2DA6A 1P4AA 4F91B 5KAIC 4WXHA 1H8AC 3QYBA 4B47A 5DV5A 3GF2A 2MYSA 5ILVA 4BE1A 5IOZA 4FETA 4RA2A 4KN7X 3N4MA 4A3CJ 2JQ7A 4UUVA 1Y8QB 3CP2A 4DW6A 1MJ9A 3ABKH 4L9JA 1CF7B 5IYDJ 5HLHA 2CG4A 2AO9A 4AVPA 5J4YA 1IN8A 3TDZC 2V9KA 1E3HA 3I56I 2JA7J 2L2OA 3ZN1A 4MO7A 1U8BA 1MMDA 4IZZA 1BI3A 3M7GA 4XSZF 4CA0A 4G7ZF 2Q0OA 3E6CC 5FKLA 4KN4X 4BY1J 2STTA 2HI3A 1X1CA 4I98B 5ICGA 3A0HC 2W48A 4ZC3A 3RTRA 2KRHA 3C2HA 4NB5A 3SYTA 5F0HA 2WAEA 4YG2F 2RDPA 5LLQA 1R6RA 2LLKA 3LA2A 2VODA 3K70D 5DS9A 3GXOA 2COBA 1JHHA 2QQ8A 1LPQA 3JRHA 2DA4A 2DMNA 4KMUX 3R60A 1Z9CA 3QYEA 1MMGA 1W1WE 2K7LA 1FPQA 4LIVA 2VXDA 4CCJA 1MMNA 5DM7F 3AG3H 3WTUC 4G6TB 3K4MA 2HKOA 2RVCA 3H9JA 3P5JA 5FKMA 5JVGF 3F8CA 2L3DA 2HDCA 1ORKA 3CP8A 4CDGA 4O3MA 4MQVA 1LEAA 4U7DA 3NRVA 2CW0F 5DD8A 4CO8A 3GTQJ 2KZGA 5H20A 1OJLA 4UB8C 1YW8A 4N9HA 2R5ZA 4DZPA 2BYVE 2P6TA 1IUFA 1N25A 2BGCA 3OYIA 2HOTA 3K1NA 1YS7A 2VIXA 5ILUA 2B0LA 2L9VA 1F9NA 5J6XA 4IRHA 3PJRA 2A68F 2DU9A 1N77A 4M6XA 2RC4A 1VQ7I 1W4MA 4EM1A 4EJVA 4A3DJ 2E2IJ 5D5UB 2XPWA 3CJQB 3ELKA 3HHHA 1LFUP 4NC8A 2E2JJ 1TQPA 3V7CA 2NXNB 2H6CA 5DM6F 4I2OA 1ITYA 1AHDP 2QGUA 2L7ZA 5EEGA 2GM4A 2P0WA 4L9NA 4IX7A 1I1SA 2NVYJ 1XC5A 2E71A 3BJ6A 3BPXA 4UUSB 2HDWA 4A0ZA 2E7WA 5FB2A 3U1KA 5IPAA 1GVJA 1I50J 1R23A 3FM5A 3O8HA 3K4LA 3J81Z 1JI8A 3BR5A 2DMQA 3QP5A 4NNJA 4L9VA 2FA5A 1AOYA 4LG0A 2X6XA 5D6FA 2B63J 2DBBA 3LAJA 3L2QA 1ETVA 1R00A 4IXAA 2PMHA 4I76A 1BW6A 4DQ2A 5CVJA 1NHAA 2O03A 3FIWA 4BNCA 2AQEA 3HEFA 2LP0A 2E36A 4FISA 1BC8C 2DW4A 1HKTA 3A4CA 4NUBA 1Y1WJ 1VQNI 4HSRA 2E60A 3NEUA 1OMIA 2LOOA 5KNLA 2IS6A 2UXXA 4GDFA 2YR2A 4XN0A 5B1BH 2HTSA 1YJWI 4DGWB 3MZHA 1X19A 1B9MA 1XS9A 4M9ZA 2JVGA 1Q1HA 3OYAA 2Y9ZA 5DD4A 5LEKA 1Y39A 2M4GA 3KZZA 4HOBA 1O3SA 2XUBA 3BTLA 1ACIA 3M3YJ 5IT9K 3MMYB 1WVRA 3WTXC 5EG0A 4IF4A 4XNFA 3M1EA 3ZQCA 3DLAA 2DLLA 3OYNA 2MA3A 1S3JA 1YOVB 4IO9F 2EFOA 2VXZA 4C3IJ 1YG2A 2KDOA 5B3SH 1SAUA 1YX3A 3V8LA 3AL0C 3OS1A 2LH9A 3RJPA 1ODDA 2V9VA 2XGCA 4G6QA 1A35A 4B4CA 2PBIA 4A3KJ 1W5CC 2F4IA 1LVAA 2RGVA 2BXZA 2KPMA 2HXIA 3OR1C 3QWLA 1Z7UA 2DFHA 2XVCA 1MD0A 3ONQA 2OV7A 2GA1A 2CW7A 2JN6A 4IKFA 5D5VB 3OY9A 4HAMA 2CU7A 1E3PA 2R7UA 2A69F 2KRFA 2PEXA 5J47A 4LK1F 4HLYA 1Q1VA 1XGSA 4F93B 2O7OA 3V7SA 3IHUA 1RKTA 3F8FA 3N97A 2L01A 2DQRA 3ABMH 2ISZA 3F8BA 1SAXA 2R92J 2X1DA 3SXYA 2DO7A 4ZH4F 3M07A 5CJ9A 4LD5A 4CCMA 3DKYA 3H3VK 2ZBKA 2Y48A 1UCRA 1RRJA 3CC2I 1I6XA 5IYBJ 1O7LA 2LR8A 2R7ZJ 2XAFA 2MLKA 3FKJA 4MTEA 2IXSA 4EQQA 2QVOA 4BL0B 3GZ5A 3FKIJ 3M8FA 5DCFA 3U9GA 2N8GA 1GT0C 3LAPA 1G4DA 3C2GA 3ZQHA 1PDNC 2M7BA 3VFZA 2ZNYA 2HGCA 4Q48A 4HF2A 3K4JA 4XLCA 2JWTA 3HTSB 5E17F 2HPMA 4I02A 2I10A 2CUEA 3BOQA 1W36D 3CUOA 4JQFA 4XIDA 5E3OA 4Y3OA 1FBSA 5GAHJ 4Z6YA 1A6IA 1B72B 3KP5A 5FLVA 2FE3A 1LB2A 4B09A 5GPCA 4Y7NJ 3OYMA 5DYMA 4IHTA 4LITA 2E7XA 3CCYA 2EFNA 2XIGA 1VTNC 2AHQA 1ZYRF 1FMVA 1XGOA 1TTYA 1U0JA 2DFIA 2VN2A 2FJ1A 4ZYAA 1FWZA 2Y75A 3KIOA 1MNEA 2K86A 4IHXA 2R7QA 3R4KA 1IN6A 1E0EA 4KA4A 5L3CA 3TBIA 3W6VA 5LEJA 2QM3A 3OIQA 4KISA 2JSPA 4KDPA 2VJ4A 4A2UA 2OUMA 5GAEJ 4CHUA 3ESWB 1FMWA 1YIJI 1CQTA 4AC0A 3FMQA 1DDNA 3CCRI 2DA3A 4LIUA 4PJMA 2QF7A 1AKHA 5L3EA 2NOGA 2XHKA 1YRNA 3LSPA 4A69C 3SZPA 4A3EJ 3HRMA 4XR6A 2CV1A 3L09A 2ZXIA 2JZYA 5FFXA 3I54A 3VODA 5FRMA 2LF7A 1FEXA 2L7MP 2XKOA 4XKVA 4CCNA 1LDKB 4AM3A 2EWNA 1U5TC 4S0HB 1LE8A 2JTVA 3F23A 1ZGWA 1FTZA 2HQ5A 1HC8A 3FBNB 1ETYA 5BNGA 4BGDA 2XGEA 3E0JB 2P81A 4I99C 2XV4S 2XAQA 4UVBA 2HR3A 3DFGA 4DBQA 4A5MA 5HDKA 3FXOA 1WQ2A 1J75A 3CCUI 3UNGC 2RNJA 3FK6A 4IJAA 5TGTA 1IRFA 2J5PA 2RQQA 2IS4A 1QU3A 3MKZA 4CSWA 1RZ4A 3GFIA 1LEBA 3OYKA 3K70C 3P9IA 2OZ6A 5ERIA 3V8KA 3G6EI 4XQFA 1YIOA 4KIGA 1GV2A 2LC2A 2M45A 4EGYA 1CF7A 1VQLI 3VSKA 2RN7A 4KMFA 3LSJA 3DCFA 2HOEA 2KMUA 1UG0A 3TEDA 3TP0A 1D3YA 1P7JA 4EM2A 4OIRF 1JUPA 1GVDA 3GMEA 5GPAA 1JKQC 3IC7A 4LB5A 1EF4A 3I4MJ 1MDMA 3A1YA 4IHWA 1WH7A 4F92B 5KHDA 1PP8F 3ZQFA 2ZNZA 5HNFA 1HQCA 2FSWA 4BUPA 1SVLA 2PMZN 1K78A 1LUJB 2W1OA 3LMMA 1YFHA 4WCGA 1Y0NA 2WY8Q 4C3JJ 3C18A 4TV7A 3OYFA 2KIMA 2HYJA 4Y4RA 2PQ8A 1MJBA 2IA0A 3CZ6A 1RR8C 1X4OA 3LQRA 1QGPA 4HDVA 1IN4A 2BY2A 4I7HA 4LG0B 4NQWA 3JR9A 2EZHA 1F1ZA 3VYUB 1IUYA 5ICFA 1YJNI 3BQZA 5LRRA 3S8PA 1SMYF 2Q8KA 5J8CA 1TWCJ 5TJJA 5LGNA 1S7OA 3PFYA 4QIWN 2EIKH 2P6SA 5ICCA 3BR0A 3A01A 5FKNA 4IRIA 4MTDA 1R9TJ 4PK4A 3S2DJ 3RKQA 3JSOA 2KDZA 2XDVA 2K27A 5H2FC 4ZDOA 2OQGA 2VONA 4PSWA 5E8IA 3EYYA 3TO6A 3H3UA 5F64A 3KETA 3RQ4A 2E1NA 2OJED 4M6VA 3IH2A 2ZFWA 2STWA 3ZPLA 1P6RA 4N4NB 2QSFX 3FXJA 2GOMA 1WWXA 2JPBA 3QP6A 5EG0B 3KLNA 3WHCA 3X2QH 3VYRB 2F48A 3DU6A 5IP6A 1J0RA 1A31A 2MD0A 2KP6A 5DCMB 2XGDA 2R7RA 2K02A 3RCOA 4U0WA 5LHGA 1IZ1A 3PQJA 4RM2A 1GDTA 2NAZA 3ULQB 3HUGA 3OYLA 3T5XA 5JR3A 5IP7J 1T0FC 2BBYA 3IAS2 3QPHA 3PUFA 1ERDA 3EUAA 4ITVA 4XN3A 3HGYA 3PNYA 5L3GA 3GYHX 1B9NA 2FBKA 1TNTA 3OS2A 2DA2A 3B6AA 1XDUA 2VBZA 4YIRX 1JJ8C 2GOXB 3EUHA 4IVNA 2TDXA 3RPQA 4II2A 2QWWA 3HHGA 1PP7U 2L4AA 3EPZA 3BY6A 3L00A 4M73A 4E6KG 2VJ5A 2UWMA 4NDLA 5FD5A 2ELHA 3E97A 4HBLA 1BN5A 3N05A 1BJZA 1ETKA 1G3SA 2QZ8A 4BXFA 4XRMA 3MWMA 1DP7P 3GFJA 3ROUA 3ECHA 2WC2A 1G3WA 2A5WA 3JAMK 4ENNA 5M3FJ 1JUSA 4KJZA 4QLCU 3E7LA 3ERMA 4XLAA 1EV7A 4M3BA 4BYYA 4M71A 1Z6TA 3HRSA 3HOYJ 3VYTB 4KIBA 2LK2A 4JP0A 1YLFA 2X0LA 4FE4A 2DJIA 4O6JA 4B44A 5GTIC 4AVZA 4XKCA 4HQEA 1VQ5I 1P92A 2L9RA 2XF6A 2W85A 5C44J 1MBJA 5DUIA 3NWSA 1HLVA 4AIHA 1FYLA 2KIQA 4M6YA 2Y0MA 3KFWX 1GLNA 4HYEA 5E1WA 3CLQA 1HSJA 2R93J 3HM5A 2MG4A 1IRZA 5HS7A 4EVIA 1I27A 4LK0F 2KQRA 1I3AA 2X6YA 3KEOA 3PSIA 1R5GA 1V4RA 3BG6A 1J7KA 3HPGA 3LQQA 1XD7A 1NH3A 2DXIA 1X2NA 4OU0A 1WGXA 1USTA 4JX4A 4ASNA 2VKVA 1SD5A 2GXAA 3L2UA 3DEUA 3H5RA 3S2WA 1BIAA 4C2UA 1UHWA 4B1RA 4AIJA 1NG6A 1W36C 2D1HA 5FO5A 1R1TA 2X1EA 4YEJA 3SEQA 2IS1A 4V2FA 2DI3A 1YO5C 2CQKA 1L3LA 3B73A 3J7ZI 1AKHB 4HDUA 3GO5A 1S7EA 3Q0UA 2CFXA 1DPRA 3K4NA 4L5EA 3F8MA 2M30A 3I5UA 4BHBA 3ZMUA 3SZTA 2HFHA 1MZBA 1ZHFA 1Y56A 4G7OF 3O2PE 1N75A 1YTYA 1D0YA 4B8XA 1MH4A 2FOWA 4RB0A 4KUMA 4X0GA 2Z2SB 4ENKA 1LQ1A 1T2KA 1SD6A 3HKZN 1AA7A 4HSTA 4RGUA 4U0VA 5E3LA 4ZZDA 5GP9A 2DT6A 1IXRC 3W6KB 4AU7A 3MQ0A 4N0BA 1B72A 2WAQA 3K7AJ 3J7YJ 1FYKA 5TISC 5GADJ 1V5FA 2EILH 2M87A 5HLIA 3ZCOA 1P2FA 4RM3A 3V4GA 2ELJA 5F0FA 1GXPA 2GXBA 5AIQA 3H36A 4CH7A 3IKVA 5IY5H 2O5RA 4Y33A 2VKEA 4GFBA 2R7DA 2V1XA 1VQKI 1QZZA 1TLHB 3J80K 2QEXI 2KIUA 1EJ9A 3SFIA 3S15J 1XSXA 4WF2A 1WJDA 3KZYA 4ABZA 2DK5A 3C3WA 3DTIA 2VT3A 1IV6A 4BS9A 4RBOA 1O3TA 4OIOF 3ZQGA 2HDDA 5BPIA 2VC1A 1MDMB 2GIZA 2DMPA 2I8DA 2F4MB 2UUZA 2VI6A 3IUOA 1UJ8A 3BJAA 4BHPA 2EZLA 5FLXK 2XRNA 1SMTA 1K78B 1YJ9I 2DOAA 4HF0A 3FF5A 2OU2A 1E17A 2KFDA 3DTKA 3QU6A 1KQ9A 3OYDA 4F7ZA 4P9FA 1HCRA 4GYIA 3FXUA 3ABLH 3A2KA 3SZGA 2KISA 1W5SA 3TOBA 1J09A 4GXOA 3TOAA 1F5TA 2E19A 4RGSA 3JTHA 2M5WA 4NQWB 2FBHA 2PFBA 1N78A 3HDDA 1FIAA 3WHBA 1HF0A 1UB9A 1ZLKA 1F43A 3RPUA 4E7IA 3G1MA 5EEHA 4D5FA 2F5DA 3TDUC 3ERED 2NNNA 3BCBA 2W82A 3BTJA 2DQLA 2VL8A 2A6HF 4KICA 1QRYA 3A01B 1ZRCA 5HNHA 4FASD 1HA8A 2O8KA 2DN0A 1KU9A 2LD5A 3ZQIA 2AXLA 4A3GJ 2KHMA 3S32A 1D1AA 1Y0UA 2M0MA 2ICWG 3EETA 4RAYA 1I5ZA 3GTGJ 3CMMA 5K5RA 1X3UA 2QCOA 4E7HA 2X9DA 2RNGA 1R1VA 3KEYA 2NVQJ 4XKBA 1IV8A 3I4NJ 3F6OA 3AFHA 4BU2A 1SFUA 3FXRA 4KIFA 1IAWA 5HS8A 1BI0A 3V7RA 3KP3A 3Q9SA 4BDZA 5J1YA 1BW5A 1UZCA 2W00A 3F3XA 1BJAA 4A6EA 2F5FA 4P1WA 3KE2A 1G59A 3AAFA 5DDGA 4U88A 3OYCA 3HUGB 3SJMA 5F1RA 4HPQA 4ZTJA 1YW7A 4H0EA 1I39A 3CCQI 1B8IB 3DP7A 4XOPA 2DODA 4BEHA 3IL2A 4MHGA 2L54A 1G2HA 3LWFA 2K3FA 3LSGA 4PUSA 4L0YB 3E6MA 1XDSA 1T38A 1QHHD 1Z67A 1X2MA 2CRGA 4XOTA 3ZMTA 2VQLA 3JREA 1UELB 3RZDJ 5KAFC 1MMAA 1ZTRA 4C2MJ 4FX4A 2PX9A 2CFOA 2M34A 4BQQA 1J5YA 3CLOA 2Y0SN 5ILSA 1Z3YA 2MABA 2EIMH 3ZQ7A 5L3BA 3RQIA 4RB3C 2MC4A 3PO2J 1XSVA 2EFQA 1JXSA 4GO1A 2P4WA 4PGGA 2PI0A 1PVEA 3S17J 4RGXA 5CVIA 3DEEA 2HXOA 4E7KA 1TWFJ 4IQ4A 1JGSA 3MVPA 3RZOJ 3PQKA 1VI0A 2Y9YA 3Q9VA 5GAGJ 1IGNA 2CO5A 3LSMA 2BHYA 1CGPA 4BH9A 1T08B 2CUFA 1BR4A 1ZLJA 4BXUA 2LVSA 4XLNF 3DPUA 4CYCA 1MNMC 4KT6A 1KONA 4JX6A 2F5VA 2GA2A 2Y69H 2LKXA 1KYWA 2LBFB 3RKYA 1XX5A 5DCMA 3CUQA 3IH3A 5KK1A 4UUTA 3BT9A 3HBLA 1H9TA 1R5ID 1OYIA 5TRDA 1D8KA 3CQZJ 1O3QA 4LFUA 1K79A 1K7AA 2VJIA 2YSRA 1YX5A 5EZHA 1ZREA 2IT0A 4DYRA 1J59A 2PJPA 4I09A 2GIVA 3TW6A 1VF9A 2LF8A 3HSEA 2VBYA 1Y8RB 4PDKA 3GTMJ 4D7MA 3REOA 3QPLA 1I6HJ 3DBRB 3GVAA 4N9IA 4LJZF 3HGGA 5L3DA 2F2EA 3BZCA 3TMOA 4F55A 1MIJA 3OWTA 4PJLA 5EYRA 1YITI 1KGSA 1KYZA 1QZYA 3QU3A 4A6DA 4LG3A 4GCVA 4X1EA 3H92A 3S14J 4G9YA 3J7AO 3S1MJ 3VSLA 6PAXA 3IAM2 3ASNH 2AXTC 3CCLI 2D5VA 1QBJA 3I9V2 3NWTA 5CVUA 1OYYA 3CJTB 3U21A 2K9SA 4BJTA 1F4KA 1K83J 3TO9A 2HEOA 3Q3SA 4IHYA 4E4HA 3FZVA 2LDUA 3KZIC 3ZQQA 4OOIA 1FZPB 1TBXA 1HW1A 3FHNA 2OTLI 1FNNA 1Z6RA 1TQMA 1ON1A 2CV0A 4Y52J 1T8IA 1ETOA 4J00A 5D8KB 4RMNA 3GTKJ 2BOLA 1O7FA 2GWRA 2M8EA 1RKWA 1QZEA 3HSRA 4R1HA 1OCRH 3BLYA 1QVTA 3G73A 2EPFA 2YX4A 4DZJA 3HSFA 1WJAA 3IRRA 4CUGA 1ZGAA 2F5EA 4KITB 5D4RA 2W57A 1MNDA 1MBEA 1PJRA 4YFKF 2H8WA 2IS2A 4MFEA 4RLQA 2IAIA 4EJWA 1K6YA 3G71I 2DA7A 4DYCA 2PLYA 5A2QZ 2E1MC 2Z33A 2AQFA 1FC3A 2KJCA 3J81K 1ON2A 3E6DA 1X1AA 3QPTA 2EFWA 3ZMVA 1B59A 2Q2EA 4A5NA 2NRAC 2L0KA 2BY0A 2JA8J 3DPLC 3BQYA 2IRFG 2OD5A 4OWRB 1ZRFA 3BCAA 3E1SA 3GCMA 3JCUC 2HVQA 1HXDA 2WADA 1X1PA 1VQMI 1R4MB 2Q1ZB 4BXXJ 1A6QA 5HVQC 1X1DA 2O3FA 1QNTA 2E35A 3K1MA 2DMTA 5J8FA 1U9OA 2NS0A 2L7KA 4RLFA 4BQNA 1UMQA 1D5VA 2BY1A 1TWGJ 1JTXA 3C2BA 1DGRM 3OIOA 3QOEA 4CGZA 3DWLE 1YYVA 1OPCA 1S6LA 2R7OA 3HOXJ 3JTGA 5DUKA 1JE8A 2H09A 4OMZA 4ZYEA 4E7LA 1OQYA 3T0YA 4XM3A 2BEOA 2OQRA 4XRSG 1SEUA 2VBWA 2O0YA 2ZB9A 4HZFA 3H1CA 3CC7I 2F5CA 3K2AA 4RAZA 4CXFA 2F6CA 3S3MA 2Z1DA 2OAZA 1REPC 1FIPA 2WAFA 1POGA
chains in the Genus database with same CATH topology
3CCJI 3I56I 3CMEI 3CCLI 1YHQI 3CC4I 3CCEI 1VQ6I 3CJTB 3PIOF 2E36A 3J7YJ 1FOYA 3CF5F 1VQNI 4UY8I 3CCQI 5GADJ 5GAHJ 1VQ4I 2K3FA 2OTJI 1VQ8I 1YJWI 1FOWA 2OTLI 1VQPI 1Y39A 1VQKI 1ACIA 2QEXI 3I55I 3CCVI 3CCSI 4IOCF 1VQ5I 3PIPF 3CMAI 1YJNI 4IO9F 5GAEJ 1VQ9I 1VQOI 5DM7F 1YIJI 1YJ9I 2H8WA 3CCRI 5JVGF 3DLLF 2ZJQF 3G71I 1YI2I 5GAGJ 1S72I 3CD6I 1MMSA 1VQ7I 2E34A 2ZJPF 2ZJRF 1HC8A 2NXNB 5DM6F 1VQMI 1QA6A 2E35A 3J7ZI 3CCUI 3CCMI 3CC2I 3G4SI 4V19K 2QA4I 2FOWA 4IOAF 3G6EI 1FOXA 1YITI 1VQLI 2JQ7A 3CC7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ I;  3I56 I;  3CME I;  3CCL I;  1YHQ I;  3CC4 I;  3CCE I;  1VQ6 I;  3CJT B;  3PIO F;  2E36 A;  3J7Y J;  1FOY A;  3CF5 F;  1VQN I;  4UY8 I;  3CCQ I;  5GAD J;  5GAH J;  1VQ4 I;  2K3F A;  2OTJ I;  1VQ8 I;  1YJW I;  1FOW A;  2OTL I;  1VQP I;  1Y39 A;  1VQK I;  1ACI A;  2QEX I;  3I55 I;  3CCV I;  3CCS I;  4IOC F;  1VQ5 I;  3PIP F;  3CMA I;  1YJN I;  4IO9 F;  5GAE J;  1VQ9 I;  1VQO I;  5DM7 F;  1YIJ I;  1YJ9 I;  2H8W A;  3CCR I;  5JVG F;  3DLL F;  2ZJQ F;  3G71 I;  1YI2 I;  5GAG J;  1S72 I;  3CD6 I;  1MMS A;  1VQ7 I;  2E34 A;  2ZJP F;  2ZJR F;  1HC8 A;  2NXN B;  5DM6 F;  1VQM I;  1QA6 A;  2E35 A;  3J7Z I;  3CCU I;  3CCM I;  3CC2 I;  3G4S I;  4V19 K;  2QA4 I;  2FOW A;  4IOA F;  3G6E I;  1FOX A;  1YIT I;  1VQL I;  2JQ7 A;  3CC7 I; 
#chains in the Genus database with same CATH topology
 3CME I;  1YHQ I;  3CCE I;  1WI3 A;  2RAE A;  3K4B A;  3JW4 A;  3F9K A;  3ZMD A;  2MGQ A;  3E5Q A;  1TW2 A;  5JLW A;  1FBU A;  2QKL B;  4HRI A;  5HS9 A;  3BJO A;  4B48 A;  1RNL A;  2QEN A;  3T8T A;  3OV8 A;  3B6C A;  4HQM A;  3GLL A;  3LL7 A;  4BY7 J;  3WGG A;  1ZN2 A;  2WB1 N;  4BBS J;  2HZD A;  2R5Y A;  4C3H J;  3HOV J;  2NNY A;  3BZ6 A;  1R71 A;  3K6G A;  2XRL A;  1DUX C;  3H5A A;  3OYE A;  2PN6 A;  3BG5 A;  1O3R A;  3S3N A;  2QSH X;  2ESH A;  2XAS A;  2QQA A;  1RET A;  2LKP A;  2QKM B;  4HNV A;  2FRH A;  2P7C B;  2P5V A;  2BVM A;  1S7A A;  2MH2 A;  1S9H A;  3LST A;  3CDI A;  5C4J J;  2R7V A;  5EZG A;  4ENJ A;  2ME6 A;  1V55 H;  2ZSH B;  1XN7 A;  1A04 A;  3FMS A;  4BEH B;  1BI2 A;  4A3M J;  3P9C A;  5F0C A;  3FBI B;  3K2Z A;  1QPI A;  1D1B A;  3M9A A;  4A3L J;  2EBI A;  1HST A;  1VND A;  4D9J A;  3GUD A;  4PJN A;  3CD6 I;  1P7I A;  2HPI A;  2VKH A;  2ZXW H;  3BG7 A;  2LRE A;  4YFX F;  2D2W A;  1WJ5 A;  2VQC A;  5D5X B;  2M2E A;  1T56 A;  2R7W A;  4ZDL A;  3ZMZ A;  2CH0 A;  1R49 A;  4U0Y A;  4W97 A;  2H8R A;  2H1K A;  2YPR A;  3F72 A;  2OCC H;  1R5H A;  1ZG1 A;  3MEX A;  4LLL A;  3ZRG A;  3WOD F;  3PO3 J;  4ESJ A;  1Z1D A;  5B5E C;  1R7J A;  2HQR A;  1QA6 A;  2K9M A;  2CMP A;  3FXL A;  4UV9 A;  2MD5 A;  5CQG A;  3ZR8 X;  2LKS A;  2ID6 A;  4D0P A;  5M5Y J;  1U5T B;  2ZXH A;  4DNC A;  1OR7 A;  2BE5 F;  3JRF A;  3OSF A;  1ETQ A;  4V19 K;  2HVR A;  4C9Y A;  2H94 A;  5A2Q K;  4CYC B;  3K69 A;  3SHF A;  1BC7 C;  2FD5 A;  2KT0 A;  2BXY A;  3R0J A;  2R7X A;  2FOK A;  2DDA A;  3S16 J;  3Q0W A;  1J2X A;  1FOX A;  4M74 A;  4W1U A;  2W84 A;  1UFM A;  2NYX A;  3CUQ B;  3GFM A;  2WTE A;  1NTC A;  3A0B C;  2HWV A;  5LFA A;  2OF7 A;  2L02 A;  4GGG A;  3A02 A;  4QWQ A;  5EF6 A;  3GW2 A;  4I0A A;  2GZW A;  2DFE A;  2IA2 A;  3TO7 A;  3CCJ I;  1FP2 A;  1UG2 A;  1ZR2 A;  1TT5 B;  1MW7 A;  3KX2 A;  4YFN F;  1EA3 A;  2ELK A;  1B8I A;  1T6S A;  2EIJ H;  4IPA A;  4UNO A;  2CQX A;  5IOY A;  1MJA A;  2KJB A;  4QSH A;  4BAC A;  2IW5 A;  1VQ8 I;  1SC7 A;  2O61 A;  2R7T A;  2RV8 A;  1TW3 A;  3PUB A;  1O57 A;  1ZG3 A;  2CUJ A;  2NS7 A;  2XB0 X;  5CVR A;  1WHU A;  3FXQ A;  1ZEL A;  4KT5 C;  2HYF A;  3PFI A;  2D1V A;  3CCV I;  2K4J A;  5AIP A;  3O6B B;  1LDJ A;  5LGU A;  2V79 A;  4E70 A;  4A3J J;  3ISP A;  4D1Q A;  2JPC A;  3QOD A;  5L3F A;  3PSF A;  4Y13 A;  1VQO I;  1WFX A;  4ZZL A;  2CW8 A;  1D0X A;  3DTE A;  3IWF A;  3D1N I;  4D5C A;  4MEX F;  2UXN A;  1BI1 A;  4JX5 A;  1VFC A;  4EMS A;  1OCZ H;  2EK5 A;  2DDB A;  5K1Y A;  1H9G A;  5K7H A;  2IEK A;  3S93 A;  2W4S A;  3LA3 A;  4RAF A;  4WXD A;  2CJJ A;  4AYB N;  3WG9 A;  1ZR4 A;  3WU1 B;  1RUO A;  2LBF A;  2LSO A;  1JKP C;  1TWA J;  2WAQ N;  2NVT J;  1A5J A;  4BAY A;  4IQJ A;  1JKO C;  3DF8 A;  2X6O A;  4GRI A;  2E34 A;  4XOR A;  3WG7 H;  4BE0 A;  1D8J A;  3SEZ A;  5EDN A;  3MFK A;  1MGT A;  1WZ2 A;  3K4K A;  1MBF A;  1U6G A;  1Z05 A;  3KP4 A;  5CLS A;  4L0Z B;  1K61 A;  4JOM A;  4M9X A;  4YIF A;  1B4A A;  2PJR A;  1RC9 A;  1XTA A;  2E5Z A;  1Z0X A;  3CCM I;  2JVH A;  4IRG A;  3PM1 A;  3WGH A;  4S05 A;  3CDL A;  4MLO A;  4RS8 A;  1FLI A;  2Q2E B;  3WE3 A;  3H9G A;  4XMY A;  2DYR H;  3JRC A;  4UVC A;  3S1Q J;  1XGN A;  3RPU D;  2WBM A;  2JA2 A;  2V7F A;  5FKK A;  1BL0 A;  1ETW A;  4XK4 A;  4OAY A;  2PG4 A;  3FXM A;  1W7P B;  4ZYD A;  3HC7 A;  2FXA A;  2FF4 A;  1J9I A;  2JK3 A;  2EZK A;  2GQQ A;  3HG9 A;  4ESB A;  3CC4 I;  4C2T A;  1G6N A;  2K85 A;  5K7F A;  3PIO F;  3I0T A;  1VQ6 I;  3NAU A;  4QPQ A;  3W6J B;  3CF5 F;  1ZK8 A;  3C7J A;  3EQL F;  1JTY A;  2M3A A;  2DK8 A;  2F4O B;  2DYS H;  3V42 A;  2B7E A;  1AU7 A;  1D5Y A;  1IJW C;  2LY2 A;  2CS3 A;  3IP4 B;  1FBQ A;  2DA5 A;  3P9K A;  3QPS A;  3RKW A;  1WSU A;  2OTJ I;  4YRV A;  1XGM A;  3H9Q A;  3T1B A;  2QLZ A;  4ENM A;  3J7A Y;  1T98 A;  4I01 A;  4C30 A;  2YU3 A;  4Q5S F;  3O3K A;  3F0C A;  3IKT A;  1LNW A;  1F36 A;  4MQ9 F;  4L9T A;  3D0S A;  1Z77 A;  4Q4Z F;  1HW2 A;  2HS5 A;  3BZK A;  2UZK A;  3MN2 A;  2K5C A;  5HLT A;  1FX7 A;  4KNY A;  2HU9 A;  3AG2 H;  1GHC A;  2IPQ X;  4PSX A;  5BMZ A;  2M8G X;  1P4X A;  1K4S A;  3WU0 A;  3OOP A;  5EJC A;  1SFX A;  3E5X A;  3H0D A;  2KL4 A;  1HW5 A;  5K7Z A;  2VE9 A;  3KYL A;  3SDG A;  1SVM A;  3PL8 A;  2Z16 A;  4A0Y A;  2V6C A;  1USS A;  2LYC A;  2W24 A;  4IL6 C;  3LNQ A;  2Z9O A;  1PYV A;  3GX4 X;  3OL4 A;  4D7N A;  2G9W A;  3KPH A;  3D5S C;  2MLG A;  5JI6 A;  1IO2 A;  1QQI A;  2XAG A;  2R5Y B;  3HL2 A;  4OMY A;  3QOP A;  2ZC2 A;  3FMR A;  2ZXJ A;  4DJA A;  5IT3 A;  5IT9 Z;  2XKP A;  5E18 F;  5CKT A;  2FQ4 A;  2VQG A;  5J4V A;  1Z21 A;  4F52 A;  2EZI A;  2VOO A;  4RAG A;  4LMY A;  3WTZ A;  4A93 J;  4IHS A;  2CSO A;  2B9S A;  3ZQL A;  3EUH C;  3G4S I;  2DPD A;  4J01 A;  1SD7 A;  4IHV A;  2E2H J;  2A05 A;  5FJ8 J;  1OFC X;  2WWY A;  1KU3 A;  1TT0 A;  5BS6 A;  4HLX A;  3K0L A;  1LKX A;  3OS0 A;  3OMY A;  2BW3 B;  3VDX A;  4NBQ A;  4HG2 A;  2JUG A;  4IOA F;  5C3E J;  3AG1 H;  2LG4 A;  4R8H A;  2VAS A;  3K9T A;  4HV6 A;  2R3S A;  2W25 A;  1BBY A;  2J5O A;  4N4O B;  4UV8 A;  1SD4 A;  1D0Z A;  2W7N A;  4BQA A;  2DOE A;  2G7H A;  1R36 A;  3I3L A;  4HEA 2;  4EGZ A;  2O8X A;  4IEJ A;  2JSC A;  1GUU A;  1X4P A;  4UXN A;  4M3F A;  3HPH A;  3F22 A;  2K3P A;  1FOY A;  2MBF A;  3BR1 A;  2K9N A;  3DQV C;  2FBI A;  3NAR A;  3GTP J;  4K2E A;  3P7N A;  3KEQ A;  2OZU A;  1R58 A;  2ZSI B;  2ZME B;  4XLH A;  1TZL A;  1OCP A;  2ADU A;  3F8N A;  5IYC J;  1TP4 A;  1FSH A;  3HKZ A;  5E1Z B;  2ETH A;  3I59 B;  1H88 C;  2VUM J;  1ENH A;  1STZ A;  4B3X A;  3COA C;  2VC0 A;  4LLG F;  3WE2 A;  4LB6 B;  3CCS I;  4B3A A;  1RI7 A;  2ISY A;  3HYI A;  4IOC F;  3QRF F;  2ACJ A;  1PUF B;  3CMA I;  1IF1 A;  2CV2 A;  3ZN0 A;  3FX3 A;  1BM9 A;  2IP2 A;  2DT5 A;  3CMY A;  2XSJ C;  1MSF C;  4DYQ A;  2L5Q A;  2CYY A;  2ID3 A;  2M4K A;  3C1D A;  5E8G A;  3CJR B;  2V4J C;  5D8L B;  2XPU A;  1IG7 A;  1ETX A;  2XAJ A;  1HKS A;  2CQN A;  1U3E M;  1YI2 I;  1JUM A;  1AWC A;  4WWC A;  3TGN A;  4U7B A;  1JKR C;  4RGR A;  1U2W A;  2MH9 A;  5LHH A;  4XSX F;  3ZOB A;  4Y15 A;  4QTR A;  3FIS A;  3OIP A;  4G6D A;  5KVR A;  4AD9 A;  1U78 A;  2EIN H;  5E3N A;  1LDD A;  3KP7 A;  5DTD A;  4M72 A;  4Z2Y A;  2MFZ A;  3SQN A;  3CF2 A;  5JFR A;  1YQA A;  1XCV A;  2ZJP F;  2EA4 A;  4CIC A;  1E3O C;  2A61 A;  1UAA A;  3UKG A;  1IDZ A;  4G8X A;  4S04 A;  2VOP A;  5B1A H;  1Z7L A;  2L9N A;  4LGW A;  4PZJ A;  5J3L A;  1U5T A;  2QUF A;  1I3Q J;  1XPX A;  1OYW A;  1E2X A;  2DA1 A;  3W2V A;  2IGM A;  1IN7 A;  2GLO A;  2XAH A;  4WX9 A;  5EGO B;  1WKM A;  1DQU A;  1HBX G;  4BJ6 C;  3S1N J;  4AID A;  2QA4 I;  3BTC A;  3L7W A;  3HJE A;  2P5K A;  3BP8 A;  4XLF A;  3ZP5 A;  3KP6 A;  3G3Z A;  3GTL J;  2FU4 A;  3VYS B;  5E1X A;  3TW7 A;  1LFB A;  1W7P D;  1ZQ3 P;  3RIR A;  3GLX A;  1GXQ A;  2VT2 A;  1OCC H;  3L9F A;  2A6E F;  4L5I A;  1ZH5 A;  2EB7 A;  5DEQ A;  1IRG A;  2WV0 A;  1ULY A;  4UB6 C;  4ON0 A;  1XB4 A;  1T95 A;  1IC8 A;  3JRB A;  3HOT A;  1APL C;  4B43 A;  3FWE A;  3L2W A;  2PJR B;  1TL8 A;  4R79 A;  4Q47 A;  3CES A;  4CCO A;  3L2R A;  1ZKG A;  1YS6 A;  2EH3 A;  2HYG D;  3FM3 A;  1U9N A;  5CQE A;  1G3Y A;  3WU2 C;  4BDY A;  2FX0 A;  5J1R A;  1VQ4 I;  1X58 A;  1EH7 A;  3SFZ A;  2K40 A;  4M3E A;  4WK8 F;  1VQP I;  5H6R A;  2VPL A;  1FY7 A;  3HRT A;  1SVO A;  1UHS A;  4YEL A;  1W0U A;  3L1P A;  3RI4 A;  3A03 A;  2JRM A;  3BR3 A;  3OR2 C;  1KU7 A;  1NK2 P;  4L5J A;  3DBL B;  4E7J A;  3GWZ A;  3ZGK A;  4RDU A;  1MH3 A;  4HX4 A;  2FMY A;  1U8R A;  1WJC A;  1QHG A;  4KFC A;  5LD2 C;  2XAU A;  3S2H J;  3W3C A;  1JHF A;  1MBH A;  1OIS A;  2KZV A;  2EV6 A;  3DXJ F;  3U2R A;  2FUG 2;  5M5X J;  1XMA A;  3OYH A;  4P9U A;  3MKW B;  4NHJ A;  3ABT A;  3DEW A;  5ED4 A;  2QBY A;  2DMU A;  2X48 A;  4UHT A;  3M4O J;  3TL4 X;  1L0O C;  4A3F J;  4Y17 A;  3MZY A;  5D6E A;  1KZH A;  3PNT A;  4A0X A;  2FML A;  1MKM A;  4FT8 A;  2HVS A;  4CZC A;  1NK3 P;  2E1C A;  2UV1 A;  3GZ6 A;  2Y0S A;  4XLE A;  1MSE C;  1OKR A;  2EV5 A;  4CZZ A;  3LSI A;  4DIQ A;  2G7U A;  5J1U A;  4RB1 A;  3WGI A;  3S1R J;  2L7F P;  4V2G A;  9ANT A;  5LGT A;  2Y30 A;  4AIK A;  4YII A;  5FLM J;  3HB9 A;  2QQB A;  4BE2 A;  3RYP A;  5JLX A;  2VPR A;  2LY9 A;  4HX7 A;  3GBG A;  3G2B A;  1HOM A;  4PFP A;  3LSR A;  3Q0V A;  2L9S A;  2X85 A;  5JVT A;  4MFD A;  2EV0 A;  3AKZ A;  5FGM A;  4DBR A;  3JRA A;  4BJ5 C;  5H6Q A;  3ZMS A;  5C4X J;  3BR6 A;  4P96 A;  3T8R A;  3FK7 A;  2VE8 A;  1YW9 A;  3RDI A;  3AL0 B;  4ETS A;  1S8N A;  2COM A;  4O5V A;  1M1E B;  2JJ7 A;  1IXC A;  1S29 A;  3H0G J;  2RRE A;  1IXS B;  2XPV A;  2R7F A;  3DKX A;  2VKD A;  3RYR A;  2BV6 A;  4G94 A;  2BVL A;  4XIC A;  4BQO A;  1T0F A;  1W7P A;  1MBG A;  3VOE A;  5HDN A;  4NC6 A;  2YUS A;  2KRC A;  2FNP A;  3QYF A;  3QAH A;  3IRQ A;  4A3I J;  3MKY B;  2RKH A;  5E3M A;  2MSY A;  2QQ9 A;  2WV1 A;  1FT9 A;  2Y31 A;  1V5E A;  5JHU A;  2OA4 A;  4ZDP A;  4XL9 A;  1S5L C;  1RPW A;  1WI9 A;  4OIQ F;  1DGW Y;  2XF5 A;  1H0M A;  4UY8 I;  1R1U A;  3LSK A;  2Z3Y A;  1HDP A;  4JBA A;  3K1P A;  2VBX A;  4H4K C;  2P5L C;  2LY1 A;  2DPU A;  1DU6 A;  3JRI A;  5E20 A;  5LHI A;  3HOZ J;  2I5U A;  3IWZ A;  1XG1 A;  2Y2Z A;  3BG3 A;  5FRO A;  5HOO A;  3GTJ J;  1MBK A;  3JSP A;  4MGR A;  3M8E A;  4AUX A;  2BZT A;  5M3M J;  1TNS A;  3PIP F;  3OYG A;  2IGO A;  2QYO A;  3CJN A;  3W2A A;  3QQA A;  3TQN A;  3ML6 A;  4E7S A;  2V1N A;  5FRN A;  1EH6 A;  3HZJ A;  1OCT C;  3WTV C;  3BPV A;  3R61 A;  2QSG X;  1A36 A;  1JT0 A;  5HOD A;  3PNV A;  1V54 H;  3DPT A;  1B6A A;  2Z5U A;  3OSG A;  1K4T A;  3HOW J;  2X1C A;  5K5O A;  3MCZ A;  2C6Y A;  2LMD A;  1ZAR A;  1TWH J;  4XON A;  3W2W A;  3I64 A;  3HOU J;  4LLN A;  3F6V A;  1KA8 A;  4M3D A;  3JAM Z;  4FX0 A;  3CUQ C;  2A6T A;  1WRJ A;  2H27 A;  2HOA A;  1S72 I;  2R7S A;  4II3 A;  4M3G A;  1KQ0 A;  1PUE E;  2NVX J;  4HX8 A;  2OBP A;  3K10 A;  2R5Z B;  5K5Q A;  1SAN A;  2ECB A;  4WXC A;  4FCY A;  3OYB A;  5FFZ A;  3G1O A;  2IGK A;  2TRT A;  2Z99 A;  1P4W A;  4PJJ A;  2DTR A;  1VZ0 A;  3L2C A;  4HV5 A;  4PGH A;  2E1M B;  4PJ0 C;  4XRS A;  1I1G A;  3TP3 A;  3I53 A;  2ESN A;  4F3Q A;  5FKO A;  3SDB A;  4ZTF A;  1R22 A;  4FQG A;  4I6Z A;  1ZRD A;  2XGX A;  4EJT A;  4X6A J;  3E6B A;  2DAO A;  3ASO H;  4XRF A;  5F08 A;  3H35 A;  2DTZ A;  1TQI A;  1JT6 A;  5E79 C;  4HA8 A;  3KP2 A;  1OCO H;  4JK1 X;  2ZFU A;  2BW3 A;  1LVK A;  4ZYG A;  4QPO A;  3HOS A;  1BR1 A;  1X3Z B;  2HKX A;  1QVU A;  3MAJ A;  2KLO A;  3CTA A;  3FXK A;  2GAU A;  4E7Z A;  3HXL A;  3TKY A;  3HRU A;  1XMX A;  4ZJZ A;  2HOS A;  1WPK A;  1HDD C;  5F1J A;  1WCM J;  2FNA A;  4OIN F;  4XLP F;  2IGN A;  4RB2 C;  1JJ6 C;  1KU2 A;  2A5Y B;  2MC3 A;  2M9H A;  2ZJ2 A;  5AON A;  2EQR A;  1RR7 A;  1W5T A;  3Q5F A;  2ME0 A;  3B02 A;  5F6F A;  1H89 C;  4CYD A;  3GFL A;  3GZN B;  2XSD C;  1BR2 A;  3FHZ A;  4J19 A;  3K4C A;  1DU0 A;  2IJL A;  1V5G A;  3I4P A;  1T39 A;  2V1U A;  2ZME A;  2HTJ A;  4EEF G;  2M7A A;  2HZT A;  1G3T A;  2RQP A;  2PMU A;  4M9S A;  2EA2 A;  3I59 A;  1WJF A;  2LTP A;  1FOW A;  3D5R C;  2R0Q C;  1Y1V J;  5LRS A;  3WTT C;  3EDP A;  1SFE A;  3GEZ A;  2CGP A;  3R6S A;  3DV8 A;  3OOU A;  4G12 A;  1BA5 A;  2R4G A;  4AWX B;  3CO7 C;  3I55 I;  1PUF A;  1ZGJ A;  3NQO A;  5JHF A;  3WTS C;  3AG4 H;  3GTO J;  4FHT A;  4EJO A;  1D1C A;  3BDD A;  4P5O A;  4A3B J;  2VQH A;  4BHC A;  4L18 B;  1QPM A;  2HQN A;  1NG7 A;  1WJB A;  2X6W A;  3KLO A;  4EJU A;  4LOC A;  2FEZ A;  5IP9 J;  1VQ9 I;  3M8J A;  2BY3 A;  2FQ3 A;  2M0C A;  3VB2 A;  3OL3 A;  5LBQ A;  2JMW A;  2MW8 A;  1IRX A;  3IV5 A;  2E5N A;  2X4H A;  2XB5 A;  1X3W B;  1OLT A;  3BTI A;  4OAZ A;  2ZJQ F;  4PFO A;  2WB1 A;  2YS9 A;  2G0E A;  3U1D A;  4ESF A;  4UUS A;  2V26 A;  2O6G E;  5EEA A;  3DU5 A;  1FOK A;  2LRD A;  3KYC B;  1WH5 A;  3VEP A;  3KYD B;  1R4N B;  2JUC A;  3ECO A;  3H3Z A;  5B66 C;  1EKE A;  2EFP A;  2P8T A;  3JRG A;  2PMZ A;  3EUK L;  1GV5 A;  1G8X A;  2A3S A;  2ZO4 A;  2NS8 A;  3HIF A;  3BG9 A;  4ZYH A;  3J80 Z;  3MD2 A;  2DCE A;  4KYW A;  2O9L A;  4A12 A;  2H1L A;  2NOJ B;  4P55 A;  2ZJR F;  2IBD A;  2XRO A;  5D4S A;  5FD6 A;  4BKX A;  2XF7 A;  4HW0 A;  2CWE A;  1W0T A;  3BWG A;  3ZXS A;  2E1O A;  2NVU B;  2CUZ A;  2QBY B;  5FLX Z;  1K6O A;  4I0B A;  3HTU A;  2K4B A;  5HDG A;  4G7H F;  2WA0 A;  5EGO A;  2HNH A;  3EYI A;  3H5N A;  3OYJ A;  2JT1 A;  2DJN A;  3LOC A;  2JA6 J;  3DBH B;  4U87 A;  2ZKZ A;  5CYV A;  5J40 A;  2DFF A;  2DOF A;  1FP1 D;  2VJJ A;  1FTT A;  4NC7 A;  4MNU A;  2EJR A;  3O8G A;  2KIF A;  3RKX A;  3G1L A;  3R0A A;  1IDY A;  2V9P A;  4FE7 A;  1TC3 C;  2VB6 A;  2H6B A;  2OC6 A;  4DOZ A;  1SFK A;  4MIM A;  3RSN A;  1Z91 A;  1FSE A;  2IVM A;  2M1B A;  4ANJ A;  3UR3 C;  1LJ9 A;  4EM0 B;  1QO0 D;  1RUN A;  1X1B A;  1XSD A;  4FTH A;  3LA7 A;  1UHM A;  1V3F A;  3FDY A;  3VPR A;  2D45 A;  2V1D A;  5GTH C;  4HNU A;  2IA1 A;  2OCE A;  4XBF A;  3BRO A;  3F21 A;  3CDH A;  3D5L A;  1DPU A;  2V6E A;  5ICE A;  2X51 A;  4HF1 A;  3WTY C;  4XKW A;  1Z3X A;  4OIP F;  2VLA A;  2YX7 A;  1BOB A;  4CCL A;  4JYK A;  4MEY F;  4EV0 A;  2JRT A;  2WY7 Q;  2K9L A;  3IH4 A;  3VWB A;  3S3O A;  1XCB A;  3BC8 A;  2CQ7 A;  3BR2 A;  2GBY A;  3E3V A;  5D5W B;  2ECC A;  1ZG5 A;  2YU9 J;  1Y6I A;  1YE9 A;  1ZAO A;  2AS5 F;  3I71 A;  1WJE A;  1BIB A;  4BBR J;  3WTW C;  3JRD A;  3ABU A;  1DP3 A;  1ONV A;  3DLL F;  1EH8 A;  2BHZ A;  3KCC A;  1IW7 F;  5F04 A;  1IN5 A;  5M5W J;  2ZCW A;  2LFB A;  1LFP A;  5CPR B;  4GYG A;  1FYM A;  1T33 A;  3LFK A;  3M1C A;  5BQT A;  2K9Q A;  1O4X A;  1YRN B;  1KQ8 A;  1MMS A;  2KKO A;  5BOX A;  1B1B A;  4EAT A;  2CQQ A;  3CO6 C;  2TCT A;  1RES A;  1RIO H;  1BOA A;  2HQA A;  3I58 A;  5HLG A;  1XMK A;  2P7V B;  4HNT A;  3MKL A;  2XC7 A;  2GXG A;  5CVV A;  1OR7 C;  4UVA A;  2DT7 B;  1LE8 B;  2OPT A;  3DKW A;  1SFO J;  1P9Q C;  3V8J A;  2ZME C;  2LNB A;  5BPD A;  4AYB A;  4PCQ A;  1JGG A;  3L2V A;  5F27 A;  1C0W A;  2A07 F;  2L4M A;  4CCK A;  1HKQ A;  3MZ8 A;  5KCM A;  3E5U A;  1FJL A;  3LSH A;  2JA5 J;  3LFU A;  2DA6 A;  1P4A A;  4F91 B;  5KAI C;  4WXH A;  1H8A C;  3QYB A;  4B47 A;  5DV5 A;  3GF2 A;  2MYS A;  5ILV A;  4BE1 A;  5IOZ A;  4FET A;  4RA2 A;  4KN7 X;  3N4M A;  4A3C J;  2JQ7 A;  4UUV A;  1Y8Q B;  3CP2 A;  4DW6 A;  1MJ9 A;  3ABK H;  4L9J A;  1CF7 B;  5IYD J;  5HLH A;  2CG4 A;  2AO9 A;  4AVP A;  5J4Y A;  1IN8 A;  3TDZ C;  2V9K A;  1E3H A;  3I56 I;  2JA7 J;  2L2O A;  3ZN1 A;  4MO7 A;  1U8B A;  1MMD A;  4IZZ A;  1BI3 A;  3M7G A;  4XSZ F;  4CA0 A;  4G7Z F;  2Q0O A;  3E6C C;  5FKL A;  4KN4 X;  4BY1 J;  2STT A;  2HI3 A;  1X1C A;  4I98 B;  5ICG A;  3A0H C;  2W48 A;  4ZC3 A;  3RTR A;  2KRH A;  3C2H A;  4NB5 A;  3SYT A;  5F0H A;  2WAE A;  4YG2 F;  2RDP A;  5LLQ A;  1R6R A;  2LLK A;  3LA2 A;  2VOD A;  3K70 D;  5DS9 A;  3GXO A;  2COB A;  1JHH A;  2QQ8 A;  1LPQ A;  3JRH A;  2DA4 A;  2DMN A;  4KMU X;  3R60 A;  1Z9C A;  3QYE A;  1MMG A;  1W1W E;  2K7L A;  1FPQ A;  4LIV A;  2VXD A;  4CCJ A;  1MMN A;  5DM7 F;  3AG3 H;  3WTU C;  4G6T B;  3K4M A;  2HKO A;  2RVC A;  3H9J A;  3P5J A;  5FKM A;  5JVG F;  3F8C A;  2L3D A;  2HDC A;  1ORK A;  3CP8 A;  4CDG A;  4O3M A;  4MQV A;  1LEA A;  4U7D A;  3NRV A;  2CW0 F;  5DD8 A;  4CO8 A;  3GTQ J;  2KZG A;  5H20 A;  1OJL A;  4UB8 C;  1YW8 A;  4N9H A;  2R5Z A;  4DZP A;  2BYV E;  2P6T A;  1IUF A;  1N25 A;  2BGC A;  3OYI A;  2HOT A;  3K1N A;  1YS7 A;  2VIX A;  5ILU A;  2B0L A;  2L9V A;  1F9N A;  5J6X A;  4IRH A;  3PJR A;  2A68 F;  2DU9 A;  1N77 A;  4M6X A;  2RC4 A;  1VQ7 I;  1W4M A;  4EM1 A;  4EJV A;  4A3D J;  2E2I J;  5D5U B;  2XPW A;  3CJQ B;  3ELK A;  3HHH A;  1LFU P;  4NC8 A;  2E2J J;  1TQP A;  3V7C A;  2NXN B;  2H6C A;  5DM6 F;  4I2O A;  1ITY A;  1AHD P;  2QGU A;  2L7Z A;  5EEG A;  2GM4 A;  2P0W A;  4L9N A;  4IX7 A;  1I1S A;  2NVY J;  1XC5 A;  2E71 A;  3BJ6 A;  3BPX A;  4UUS B;  2HDW A;  4A0Z A;  2E7W A;  5FB2 A;  3U1K A;  5IPA A;  1GVJ A;  1I50 J;  1R23 A;  3FM5 A;  3O8H A;  3K4L A;  3J81 Z;  1JI8 A;  3BR5 A;  2DMQ A;  3QP5 A;  4NNJ A;  4L9V A;  2FA5 A;  1AOY A;  4LG0 A;  2X6X A;  5D6F A;  2B63 J;  2DBB A;  3LAJ A;  3L2Q A;  1ETV A;  1R00 A;  4IXA A;  2PMH A;  4I76 A;  1BW6 A;  4DQ2 A;  5CVJ A;  1NHA A;  2O03 A;  3FIW A;  4BNC A;  2AQE A;  3HEF A;  2LP0 A;  2E36 A;  4FIS A;  1BC8 C;  2DW4 A;  1HKT A;  3A4C A;  4NUB A;  1Y1W J;  1VQN I;  4HSR A;  2E60 A;  3NEU A;  1OMI A;  2LOO A;  5KNL A;  2IS6 A;  2UXX A;  4GDF A;  2YR2 A;  4XN0 A;  5B1B H;  2HTS A;  1YJW I;  4DGW B;  3MZH A;  1X19 A;  1B9M A;  1XS9 A;  4M9Z A;  2JVG A;  1Q1H A;  3OYA A;  2Y9Z A;  5DD4 A;  5LEK A;  1Y39 A;  2M4G A;  3KZZ A;  4HOB A;  1O3S A;  2XUB A;  3BTL A;  1ACI A;  3M3Y J;  5IT9 K;  3MMY B;  1WVR A;  3WTX C;  5EG0 A;  4IF4 A;  4XNF A;  3M1E A;  3ZQC A;  3DLA A;  2DLL A;  3OYN A;  2MA3 A;  1S3J A;  1YOV B;  4IO9 F;  2EFO A;  2VXZ A;  4C3I J;  1YG2 A;  2KDO A;  5B3S H;  1SAU A;  1YX3 A;  3V8L A;  3AL0 C;  3OS1 A;  2LH9 A;  3RJP A;  1ODD A;  2V9V A;  2XGC A;  4G6Q A;  1A35 A;  4B4C A;  2PBI A;  4A3K J;  1W5C C;  2F4I A;  1LVA A;  2RGV A;  2BXZ A;  2KPM A;  2HXI A;  3OR1 C;  3QWL A;  1Z7U A;  2DFH A;  2XVC A;  1MD0 A;  3ONQ A;  2OV7 A;  2GA1 A;  2CW7 A;  2JN6 A;  4IKF A;  5D5V B;  3OY9 A;  4HAM A;  2CU7 A;  1E3P A;  2R7U A;  2A69 F;  2KRF A;  2PEX A;  5J47 A;  4LK1 F;  4HLY A;  1Q1V A;  1XGS A;  4F93 B;  2O7O A;  3V7S A;  3IHU A;  1RKT A;  3F8F A;  3N97 A;  2L01 A;  2DQR A;  3ABM H;  2ISZ A;  3F8B A;  1SAX A;  2R92 J;  2X1D A;  3SXY A;  2DO7 A;  4ZH4 F;  3M07 A;  5CJ9 A;  4LD5 A;  4CCM A;  3DKY A;  3H3V K;  2ZBK A;  2Y48 A;  1UCR A;  1RRJ A;  3CC2 I;  1I6X A;  5IYB J;  1O7L A;  2LR8 A;  2R7Z J;  2XAF A;  2MLK A;  3FKJ A;  4MTE A;  2IXS A;  4EQQ A;  2QVO A;  4BL0 B;  3GZ5 A;  3FKI J;  3M8F A;  5DCF A;  3U9G A;  2N8G A;  1GT0 C;  3LAP A;  1G4D A;  3C2G A;  3ZQH A;  1PDN C;  2M7B A;  3VFZ A;  2ZNY A;  2HGC A;  4Q48 A;  4HF2 A;  3K4J A;  4XLC A;  2JWT A;  3HTS B;  5E17 F;  2HPM A;  4I02 A;  2I10 A;  2CUE A;  3BOQ A;  1W36 D;  3CUO A;  4JQF A;  4XID A;  5E3O A;  4Y3O A;  1FBS A;  5GAH J;  4Z6Y A;  1A6I A;  1B72 B;  3KP5 A;  5FLV A;  2FE3 A;  1LB2 A;  4B09 A;  5GPC A;  4Y7N J;  3OYM A;  5DYM A;  4IHT A;  4LIT A;  2E7X A;  3CCY A;  2EFN A;  2XIG A;  1VTN C;  2AHQ A;  1ZYR F;  1FMV A;  1XGO A;  1TTY A;  1U0J A;  2DFI A;  2VN2 A;  2FJ1 A;  4ZYA A;  1FWZ A;  2Y75 A;  3KIO A;  1MNE A;  2K86 A;  4IHX A;  2R7Q A;  3R4K A;  1IN6 A;  1E0E A;  4KA4 A;  5L3C A;  3TBI A;  3W6V A;  5LEJ A;  2QM3 A;  3OIQ A;  4KIS A;  2JSP A;  4KDP A;  2VJ4 A;  4A2U A;  2OUM A;  5GAE J;  4CHU A;  3ESW B;  1FMW A;  1YIJ I;  1CQT A;  4AC0 A;  3FMQ A;  1DDN A;  3CCR I;  2DA3 A;  4LIU A;  4PJM A;  2QF7 A;  1AKH A;  5L3E A;  2NOG A;  2XHK A;  1YRN A;  3LSP A;  4A69 C;  3SZP A;  4A3E J;  3HRM A;  4XR6 A;  2CV1 A;  3L09 A;  2ZXI A;  2JZY A;  5FFX A;  3I54 A;  3VOD A;  5FRM A;  2LF7 A;  1FEX A;  2L7M P;  2XKO A;  4XKV A;  4CCN A;  1LDK B;  4AM3 A;  2EWN A;  1U5T C;  4S0H B;  1LE8 A;  2JTV A;  3F23 A;  1ZGW A;  1FTZ A;  2HQ5 A;  1HC8 A;  3FBN B;  1ETY A;  5BNG A;  4BGD A;  2XGE A;  3E0J B;  2P81 A;  4I99 C;  2XV4 S;  2XAQ A;  4UVB A;  2HR3 A;  3DFG A;  4DBQ A;  4A5M A;  5HDK A;  3FXO A;  1WQ2 A;  1J75 A;  3CCU I;  3UNG C;  2RNJ A;  3FK6 A;  4IJA A;  5TGT A;  1IRF A;  2J5P A;  2RQQ A;  2IS4 A;  1QU3 A;  3MKZ A;  4CSW A;  1RZ4 A;  3GFI A;  1LEB A;  3OYK A;  3K70 C;  3P9I A;  2OZ6 A;  5ERI A;  3V8K A;  3G6E I;  4XQF A;  1YIO A;  4KIG A;  1GV2 A;  2LC2 A;  2M45 A;  4EGY A;  1CF7 A;  1VQL I;  3VSK A;  2RN7 A;  4KMF A;  3LSJ A;  3DCF A;  2HOE A;  2KMU A;  1UG0 A;  3TED A;  3TP0 A;  1D3Y A;  1P7J A;  4EM2 A;  4OIR F;  1JUP A;  1GVD A;  3GME A;  5GPA A;  1JKQ C;  3IC7 A;  4LB5 A;  1EF4 A;  3I4M J;  1MDM A;  3A1Y A;  4IHW A;  1WH7 A;  4F92 B;  5KHD A;  1PP8 F;  3ZQF A;  2ZNZ A;  5HNF A;  1HQC A;  2FSW A;  4BUP A;  1SVL A;  2PMZ N;  1K78 A;  1LUJ B;  2W1O A;  3LMM A;  1YFH A;  4WCG A;  1Y0N A;  2WY8 Q;  4C3J J;  3C18 A;  4TV7 A;  3OYF A;  2KIM A;  2HYJ A;  4Y4R A;  2PQ8 A;  1MJB A;  2IA0 A;  3CZ6 A;  1RR8 C;  1X4O A;  3LQR A;  1QGP A;  4HDV A;  1IN4 A;  2BY2 A;  4I7H A;  4LG0 B;  4NQW A;  3JR9 A;  2EZH A;  1F1Z A;  3VYU B;  1IUY A;  5ICF A;  1YJN I;  3BQZ A;  5LRR A;  3S8P A;  1SMY F;  2Q8K A;  5J8C A;  1TWC J;  5TJJ A;  5LGN A;  1S7O A;  3PFY A;  4QIW N;  2EIK H;  2P6S A;  5ICC A;  3BR0 A;  3A01 A;  5FKN A;  4IRI A;  4MTD A;  1R9T J;  4PK4 A;  3S2D J;  3RKQ A;  3JSO A;  2KDZ A;  2XDV A;  2K27 A;  5H2F C;  4ZDO A;  2OQG A;  2VON A;  4PSW A;  5E8I A;  3EYY A;  3TO6 A;  3H3U A;  5F64 A;  3KET A;  3RQ4 A;  2E1N A;  2OJE D;  4M6V A;  3IH2 A;  2ZFW A;  2STW A;  3ZPL A;  1P6R A;  4N4N B;  2QSF X;  3FXJ A;  2GOM A;  1WWX A;  2JPB A;  3QP6 A;  5EG0 B;  3KLN A;  3WHC A;  3X2Q H;  3VYR B;  2F48 A;  3DU6 A;  5IP6 A;  1J0R A;  1A31 A;  2MD0 A;  2KP6 A;  5DCM B;  2XGD A;  2R7R A;  2K02 A;  3RCO A;  4U0W A;  5LHG A;  1IZ1 A;  3PQJ A;  4RM2 A;  1GDT A;  2NAZ A;  3ULQ B;  3HUG A;  3OYL A;  3T5X A;  5JR3 A;  5IP7 J;  1T0F C;  2BBY A;  3IAS 2;  3QPH A;  3PUF A;  1ERD A;  3EUA A;  4ITV A;  4XN3 A;  3HGY A;  3PNY A;  5L3G A;  3GYH X;  1B9N A;  2FBK A;  1TNT A;  3OS2 A;  2DA2 A;  3B6A A;  1XDU A;  2VBZ A;  4YIR X;  1JJ8 C;  2GOX B;  3EUH A;  4IVN A;  2TDX A;  3RPQ A;  4II2 A;  2QWW A;  3HHG A;  1PP7 U;  2L4A A;  3EPZ A;  3BY6 A;  3L00 A;  4M73 A;  4E6K G;  2VJ5 A;  2UWM A;  4NDL A;  5FD5 A;  2ELH A;  3E97 A;  4HBL A;  1BN5 A;  3N05 A;  1BJZ A;  1ETK A;  1G3S A;  2QZ8 A;  4BXF A;  4XRM A;  3MWM A;  1DP7 P;  3GFJ A;  3ROU A;  3ECH A;  2WC2 A;  1G3W A;  2A5W A;  3JAM K;  4ENN A;  5M3F J;  1JUS A;  4KJZ A;  4QLC U;  3E7L A;  3ERM A;  4XLA A;  1EV7 A;  4M3B A;  4BYY A;  4M71 A;  1Z6T A;  3HRS A;  3HOY J;  3VYT B;  4KIB A;  2LK2 A;  4JP0 A;  1YLF A;  2X0L A;  4FE4 A;  2DJI A;  4O6J A;  4B44 A;  5GTI C;  4AVZ A;  4XKC A;  4HQE A;  1VQ5 I;  1P92 A;  2L9R A;  2XF6 A;  2W85 A;  5C44 J;  1MBJ A;  5DUI A;  3NWS A;  1HLV A;  4AIH A;  1FYL A;  2KIQ A;  4M6Y A;  2Y0M A;  3KFW X;  1GLN A;  4HYE A;  5E1W A;  3CLQ A;  1HSJ A;  2R93 J;  3HM5 A;  2MG4 A;  1IRZ A;  5HS7 A;  4EVI A;  1I27 A;  4LK0 F;  2KQR A;  1I3A A;  2X6Y A;  3KEO A;  3PSI A;  1R5G A;  1V4R A;  3BG6 A;  1J7K A;  3HPG A;  3LQQ A;  1XD7 A;  1NH3 A;  2DXI A;  1X2N A;  4OU0 A;  1WGX A;  1UST A;  4JX4 A;  4ASN A;  2VKV A;  1SD5 A;  2GXA A;  3L2U A;  3DEU A;  3H5R A;  3S2W A;  1BIA A;  4C2U A;  1UHW A;  4B1R A;  4AIJ A;  1NG6 A;  1W36 C;  2D1H A;  5FO5 A;  1R1T A;  2X1E A;  4YEJ A;  3SEQ A;  2IS1 A;  4V2F A;  2DI3 A;  1YO5 C;  2CQK A;  1L3L A;  3B73 A;  3J7Z I;  1AKH B;  4HDU A;  3GO5 A;  1S7E A;  3Q0U A;  2CFX A;  1DPR A;  3K4N A;  4L5E A;  3F8M A;  2M30 A;  3I5U A;  4BHB A;  3ZMU A;  3SZT A;  2HFH A;  1MZB A;  1ZHF A;  1Y56 A;  4G7O F;  3O2P E;  1N75 A;  1YTY A;  1D0Y A;  4B8X A;  1MH4 A;  2FOW A;  4RB0 A;  4KUM A;  4X0G A;  2Z2S B;  4ENK A;  1LQ1 A;  1T2K A;  1SD6 A;  3HKZ N;  1AA7 A;  4HST A;  4RGU A;  4U0V A;  5E3L A;  4ZZD A;  5GP9 A;  2DT6 A;  1IXR C;  3W6K B;  4AU7 A;  3MQ0 A;  4N0B A;  1B72 A;  2WAQ A;  3K7A J;  3J7Y J;  1FYK A;  5TIS C;  5GAD J;  1V5F A;  2EIL H;  2M87 A;  5HLI A;  3ZCO A;  1P2F A;  4RM3 A;  3V4G A;  2ELJ A;  5F0F A;  1GXP A;  2GXB A;  5AIQ A;  3H36 A;  4CH7 A;  3IKV A;  5IY5 H;  2O5R A;  4Y33 A;  2VKE A;  4GFB A;  2R7D A;  2V1X A;  1VQK I;  1QZZ A;  1TLH B;  3J80 K;  2QEX I;  2KIU A;  1EJ9 A;  3SFI A;  3S15 J;  1XSX A;  4WF2 A;  1WJD A;  3KZY A;  4ABZ A;  2DK5 A;  3C3W A;  3DTI A;  2VT3 A;  1IV6 A;  4BS9 A;  4RBO A;  1O3T A;  4OIO F;  3ZQG A;  2HDD A;  5BPI A;  2VC1 A;  1MDM B;  2GIZ A;  2DMP A;  2I8D A;  2F4M B;  2UUZ A;  2VI6 A;  3IUO A;  1UJ8 A;  3BJA A;  4BHP A;  2EZL A;  5FLX K;  2XRN A;  1SMT A;  1K78 B;  1YJ9 I;  2DOA A;  4HF0 A;  3FF5 A;  2OU2 A;  1E17 A;  2KFD A;  3DTK A;  3QU6 A;  1KQ9 A;  3OYD A;  4F7Z A;  4P9F A;  1HCR A;  4GYI A;  3FXU A;  3ABL H;  3A2K A;  3SZG A;  2KIS A;  1W5S A;  3TOB A;  1J09 A;  4GXO A;  3TOA A;  1F5T A;  2E19 A;  4RGS A;  3JTH A;  2M5W A;  4NQW B;  2FBH A;  2PFB A;  1N78 A;  3HDD A;  1FIA A;  3WHB A;  1HF0 A;  1UB9 A;  1ZLK A;  1F43 A;  3RPU A;  4E7I A;  3G1M A;  5EEH A;  4D5F A;  2F5D A;  3TDU C;  3ERE D;  2NNN A;  3BCB A;  2W82 A;  3BTJ A;  2DQL A;  2VL8 A;  2A6H F;  4KIC A;  1QRY A;  3A01 B;  1ZRC A;  5HNH A;  4FAS D;  1HA8 A;  2O8K A;  2DN0 A;  1KU9 A;  2LD5 A;  3ZQI A;  2AXL A;  4A3G J;  2KHM A;  3S32 A;  1D1A A;  1Y0U A;  2M0M A;  2ICW G;  3EET A;  4RAY A;  1I5Z A;  3GTG J;  3CMM A;  5K5R A;  1X3U A;  2QCO A;  4E7H A;  2X9D A;  2RNG A;  1R1V A;  3KEY A;  2NVQ J;  4XKB A;  1IV8 A;  3I4N J;  3F6O A;  3AFH A;  4BU2 A;  1SFU A;  3FXR A;  4KIF A;  1IAW A;  5HS8 A;  1BI0 A;  3V7R A;  3KP3 A;  3Q9S A;  4BDZ A;  5J1Y A;  1BW5 A;  1UZC A;  2W00 A;  3F3X A;  1BJA A;  4A6E A;  2F5F A;  4P1W A;  3KE2 A;  1G59 A;  3AAF A;  5DDG A;  4U88 A;  3OYC A;  3HUG B;  3SJM A;  5F1R A;  4HPQ A;  4ZTJ A;  1YW7 A;  4H0E A;  1I39 A;  3CCQ I;  1B8I B;  3DP7 A;  4XOP A;  2DOD A;  4BEH A;  3IL2 A;  4MHG A;  2L54 A;  1G2H A;  3LWF A;  2K3F A;  3LSG A;  4PUS A;  4L0Y B;  3E6M A;  1XDS A;  1T38 A;  1QHH D;  1Z67 A;  1X2M A;  2CRG A;  4XOT A;  3ZMT A;  2VQL A;  3JRE A;  1UEL B;  3RZD J;  5KAF C;  1MMA A;  1ZTR A;  4C2M J;  4FX4 A;  2PX9 A;  2CFO A;  2M34 A;  4BQQ A;  1J5Y A;  3CLO A;  2Y0S N;  5ILS A;  1Z3Y A;  2MAB A;  2EIM H;  3ZQ7 A;  5L3B A;  3RQI A;  4RB3 C;  2MC4 A;  3PO2 J;  1XSV A;  2EFQ A;  1JXS A;  4GO1 A;  2P4W A;  4PGG A;  2PI0 A;  1PVE A;  3S17 J;  4RGX A;  5CVI A;  3DEE A;  2HXO A;  4E7K A;  1TWF J;  4IQ4 A;  1JGS A;  3MVP A;  3RZO J;  3PQK A;  1VI0 A;  2Y9Y A;  3Q9V A;  5GAG J;  1IGN A;  2CO5 A;  3LSM A;  2BHY A;  1CGP A;  4BH9 A;  1T08 B;  2CUF A;  1BR4 A;  1ZLJ A;  4BXU A;  2LVS A;  4XLN F;  3DPU A;  4CYC A;  1MNM C;  4KT6 A;  1KON A;  4JX6 A;  2F5V A;  2GA2 A;  2Y69 H;  2LKX A;  1KYW A;  2LBF B;  3RKY A;  1XX5 A;  5DCM A;  3CUQ A;  3IH3 A;  5KK1 A;  4UUT A;  3BT9 A;  3HBL A;  1H9T A;  1R5I D;  1OYI A;  5TRD A;  1D8K A;  3CQZ J;  1O3Q A;  4LFU A;  1K79 A;  1K7A A;  2VJI A;  2YSR A;  1YX5 A;  5EZH A;  1ZRE A;  2IT0 A;  4DYR A;  1J59 A;  2PJP A;  4I09 A;  2GIV A;  3TW6 A;  1VF9 A;  2LF8 A;  3HSE A;  2VBY A;  1Y8R B;  4PDK A;  3GTM J;  4D7M A;  3REO A;  3QPL A;  1I6H J;  3DBR B;  3GVA A;  4N9I A;  4LJZ F;  3HGG A;  5L3D A;  2F2E A;  3BZC A;  3TMO A;  4F55 A;  1MIJ A;  3OWT A;  4PJL A;  5EYR A;  1YIT I;  1KGS A;  1KYZ A;  1QZY A;  3QU3 A;  4A6D A;  4LG3 A;  4GCV A;  4X1E A;  3H92 A;  3S14 J;  4G9Y A;  3J7A O;  3S1M J;  3VSL A;  6PAX A;  3IAM 2;  3ASN H;  2AXT C;  3CCL I;  2D5V A;  1QBJ A;  3I9V 2;  3NWT A;  5CVU A;  1OYY A;  3CJT B;  3U21 A;  2K9S A;  4BJT A;  1F4K A;  1K83 J;  3TO9 A;  2HEO A;  3Q3S A;  4IHY A;  4E4H A;  3FZV A;  2LDU A;  3KZI C;  3ZQQ A;  4OOI A;  1FZP B;  1TBX A;  1HW1 A;  3FHN A;  2OTL I;  1FNN A;  1Z6R A;  1TQM A;  1ON1 A;  2CV0 A;  4Y52 J;  1T8I A;  1ETO A;  4J00 A;  5D8K B;  4RMN A;  3GTK J;  2BOL A;  1O7F A;  2GWR A;  2M8E A;  1RKW A;  1QZE A;  3HSR A;  4R1H A;  1OCR H;  3BLY A;  1QVT A;  3G73 A;  2EPF A;  2YX4 A;  4DZJ A;  3HSF A;  1WJA A;  3IRR A;  4CUG A;  1ZGA A;  2F5E A;  4KIT B;  5D4R A;  2W57 A;  1MND A;  1MBE A;  1PJR A;  4YFK F;  2H8W A;  2IS2 A;  4MFE A;  4RLQ A;  2IAI A;  4EJW A;  1K6Y A;  3G71 I;  2DA7 A;  4DYC A;  2PLY A;  5A2Q Z;  2E1M C;  2Z33 A;  2AQF A;  1FC3 A;  2KJC A;  3J81 K;  1ON2 A;  3E6D A;  1X1A A;  3QPT A;  2EFW A;  3ZMV A;  1B59 A;  2Q2E A;  4A5N A;  2NRA C;  2L0K A;  2BY0 A;  2JA8 J;  3DPL C;  3BQY A;  2IRF G;  2OD5 A;  4OWR B;  1ZRF A;  3BCA A;  3E1S A;  3GCM A;  3JCU C;  2HVQ A;  1HXD A;  2WAD A;  1X1P A;  1VQM I;  1R4M B;  2Q1Z B;  4BXX J;  1A6Q A;  5HVQ C;  1X1D A;  2O3F A;  1QNT A;  2E35 A;  3K1M A;  2DMT A;  5J8F A;  1U9O A;  2NS0 A;  2L7K A;  4RLF A;  4BQN A;  1UMQ A;  1D5V A;  2BY1 A;  1TWG J;  1JTX A;  3C2B A;  1DGR M;  3OIO A;  3QOE A;  4CGZ A;  3DWL E;  1YYV A;  1OPC A;  1S6L A;  2R7O A;  3HOX J;  3JTG A;  5DUK A;  1JE8 A;  2H09 A;  4OMZ A;  4ZYE A;  4E7L A;  1OQY A;  3T0Y A;  4XM3 A;  2BEO A;  2OQR A;  4XRS G;  1SEU A;  2VBW A;  2O0Y A;  2ZB9 A;  4HZF A;  3H1C A;  3CC7 I;  2F5C A;  3K2A A;  4RAZ A;  4CXF A;  2F6C A;  3S3M A;  2Z1D A;  2OAZ A;  1REP C;  1FIP A;  2WAF A;  1POG A; 
#chains in the Genus database with same CATH homology
 3CCJ I;  3I56 I;  3CME I;  3CCL I;  1YHQ I;  3CC4 I;  3CCE I;  1VQ6 I;  3CJT B;  3PIO F;  2E36 A;  3J7Y J;  1FOY A;  3CF5 F;  1VQN I;  4UY8 I;  3CCQ I;  5GAD J;  5GAH J;  1VQ4 I;  2K3F A;  2OTJ I;  1VQ8 I;  1YJW I;  1FOW A;  2OTL I;  1VQP I;  1Y39 A;  1VQK I;  1ACI A;  2QEX I;  3I55 I;  3CCV I;  3CCS I;  4IOC F;  1VQ5 I;  3PIP F;  3CMA I;  1YJN I;  4IO9 F;  5GAE J;  1VQ9 I;  1VQO I;  5DM7 F;  1YIJ I;  1YJ9 I;  2H8W A;  3CCR I;  5JVG F;  3DLL F;  2ZJQ F;  3G71 I;  1YI2 I;  5GAG J;  1S72 I;  3CD6 I;  1MMS A;  1VQ7 I;  2E34 A;  2ZJP F;  2ZJR F;  1HC8 A;  2NXN B;  5DM6 F;  1VQM I;  1QA6 A;  2E35 A;  3J7Z I;  3CCU I;  3CCM I;  3CC2 I;  3G4S I;  4V19 K;  2QA4 I;  2FOW A;  4IOA F;  3G6E I;  1FOX A;  1YIT I;  1VQL I;  2JQ7 A;  3CC7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...