3CCEI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cceI00
1VQMI 3J7ZI 1HC8A 3CD6I 2H8WA 1ACIA 4IO9F 1VQNI 4IOAF 1YJNI 2ZJRF 1YJWI 3CC4I 1MMSA 1VQPI 2OTJI 3CCQI 4V19K 3CC2I 1YHQI 2NXNB 5JVGF 2E34A 3CF5F 1Y39A 3CMAI 5DM6F 2FOWA 3J7YJ 3G6EI 3G4SI 1VQ9I 1S72I 3CJTB 1QA6A 3DLLF 2K3FA 3CCRI 1YJ9I 1VQ5I 1VQ4I 2E35A 1FOWA 1FOYA 2JQ7A 3CCLI 3CMEI 1VQ7I 3CCJI 5GADJ 5GAGJ 1VQKI 2ZJQF 1VQ8I 3CC7I 1YIJI 5DM7F 3CCSI 1YI2I 3CCEI 2E36A 3I55I 3I56I 1FOXA 5GAHJ 3G71I 1VQOI 1VQ6I 2QA4I 2QEXI 3CCMI 4UY8I 1YITI 4IOCF 2OTLI 3PIPF 1VQLI 3CCUI 3CCVI 3PIOF 5GAEJ 2ZJPF
chains in the Genus database with same CATH superfamily
4HDUA 1VQMI 4BDYA 2E7WA 3IKTA 2EJRA 2DA1A 2DQLA 4QPQA 2BV6A 3UR3C 2LKSA 4II2A 4PJMA 2V79A 3KP6A 3DTEA 2WTEA 3EUHC 3H9GA 4I2OA 3RQIA 2ZJ2A 1QNTA 5FLXZ 2DW4A 1HSTA 1X4PA 2DA3A 3TGNA 2H6CA 1R71A 1IO2A 3WTYC 5H2FC 3HDDA 3BCAA 3CDIA 1G3SA 1TC3C 3I64A 2XF5A 1D8KA 1MBHA 3W2VA 1DPUA 4NBQA 1F1ZA 2F5DA 4XRFA 4BBRJ 1O4XA 1ETXA 4IHWA 4XQFA 1APLC 4IZZA 1Y39A 2AQEA 3M07A 2Z16A 3TL4X 1AKHB 2LMDA 1VI0A 4D5FA 3GCMA 4BH9A 3J80Z 4B1RA 1ZRDA 4GYGA 4FETA 2WAFA 1XMAA 3DTIA 3HOYJ 1K83J 1TWGJ 1S72I 4D9JA 2LKXA 5E1XA 4NQWA 2O7OA 4BJTA 1U78A 4Q4ZF 3HSFA 3DLLF 5LEKA 2EH3A 3N4MA 4OMZA 5F04A 2JUGA 2K9LA 2LTPA 2XASA 1B72A 2LD5A 3BY6A 2OBPA 4BEHB 3BT9A 4G7OF 4CZCA 2RNJA 4A3IJ 1WI9A 1YS7A 1R5HA 1XMKA 1XTAA 2A5YB 2O03A 5KAIC 2VBZA 2CG4A 2JA5J 4CHUA 4WXCA 1W7PD 2AS5F 2MD5A 1FEXA 5CVUA 1BIAA 2HNHA 3E97A 1TP4A 3KCCA 3GMEA 3GX4X 2MH9A 4XKCA 3KFWX 3EUHA 4PCQA 5HODA 1OMIA 2VB6A 2G9WA 5D4RA 3LAPA 3EUKL 2GOXB 2QKMB 2XDVA 4I76A 5ILUA 4L5JA 3QOEA 5K5OA 4LB6B 3GFJA 1FYKA 1OQYA 2MW8A 3IWZA 1HKTA 3T1BA 2NVYJ 2P81A 3R61A 2RV8A 1LQ1A 2O6GE 2L5QA 3Q0UA 4KJZA 2VXZA 1BN5A 5CPRB 4U7BA 1UHSA 2DXIA 1B72B 1JKOC 4IJAA 4XIDA 3L2UA 1LE8A 5J4YA 3AAFA 1OPCA 3PIPF 3FF5A 1VQLI 3PIOF 3D5RC 2VE9A 1TWFJ 2Z99A 2KJBA 1SD6A 3HPGA 4AWXB 2DFIA 2FRHA 3S15J 1IW7F 2CJJA 2L54A 2XSDC 4RLQA 3IL2A 2YU9J 4XNFA 4HNTA 1X1PA 1AOYA 4Q48A 4WXDA 3IP4B 4BUPA 1XX5A 1V3FA 2DMQA 1FC3A 1IGNA 2LSOA 4MTEA 1G6NA 4AVPA 3HL2A 3O2PE 1ZLKA 2LFBA 3LSGA 3SDGA 1QU3A 2IA2A 3BQYA 2TRTA 2DMUA 2ZC2A 4LLGF 5IYCJ 3FKJA 2E2JJ 2K40A 3HHHA 2R5YA 1QRYA 2BHZA 3ZQHA 3IAS2 4DGWB 2IA1A 1ULYA 1JUMA 2K9MA 5BPIA 1MBEA 4U87A 2O61A 2MC4A 5E1ZB 1OFCX 4F3QA 2DK5A 2ZSHB 4EATA 1K79A 4X0GA 2NNYA 3HC7A 2JA6J 3S2DJ 1BC7C 1F9NA 2KZVA 3OS2A 2XAHA 2TCTA 1BI3A 1X58A 1BI0A 2LG4A 4LG3A 1FP2A 3ASNH 4BQAA 3QYEA 4A5MA 1TWCJ 2NAZA 2HOAA 3WTSC 1BOBA 2ETHA 4KIFA 1XC5A 4UVAA 1WH5A 1B4AA 2R5YB 5F0HA 5LHIA 4I02A 1NH3A 2L0KA 2EZIA 3PQKA 3CMEI 1MJ9A 2ECCA 3LFKA 3RKQA 4CUGA 1MW7A 4XKWA 4G12A 1JUSA 3HGYA 2E1OA 1CGPA 1YOVB 4KFCA 4RDUA 2DTRA 2IS4A 3FXUA 3ZMZA 2EK5A 2FU4A 3S2WA 2PG4A 3E3VA 4ZDOA 5KNLA 1FOXA 1KGSA 2A5WA 1F5TA 3L2CA 2QA4I 4OOIA 2R5ZA 1FY7A 2XGEA 2Y0SN 3H0DA 1DU6A 3OYMA 2XHKA 1YO5C 2EFOA 1Z9CA 2MA3A 2FUG2 3W6VA 2VLAA 2A6EF 2GXAA 2PLYA 2A68F 4HLXA 5HS7A 2R4GA 3FXMA 5ICEA 4Z6YA 4DZPA 2CU7A 1W5CC 3G3ZA 1BC8C 1YS6A 1ZGJA 4EVIA 3JRCA 1AHDP 2KQRA 3PSFA 3F21A 3KP5A 1JUPA 1WJFA 2PMZN 1OCRH 1I27A 1J75A 2FNPA 1XMXA 1O7FA 1QBJA 3F22A 4KIBA 4IOAF 2HDWA 1K78A 3ISPA 2R7OA 2EIKH 2L7FP 3SQNA 2KFDA 1J7KA 1YJWI 4IEJA 2EFQA 3LSMA 2R7VA 2BE5F 2X1DA 3EPZA 4HX4A 5TJJA 5EZHA 5J4VA 4FE4A 1IN5A 2MSYA 3ABMH 3TQNA 4FT8A 1LDDA 3FMSA 1KQ9A 5JR3A 4UUSA 3OYGA 4KISA 2M45A 2XIGA 2X85A 2BVMA 3F6OA 3ZN0A 3BROA 2V1NA 4XORA 1Y8QB 1IN8A 2V6CA 3L1PA 3BWGA 5B1BH 1R7JA 4FCYA 1FX7A 1QVTA 1K78B 3ASOH 3R0JA 2W84A 3F8CA 3K9TA 5H20A 3ZN1A 1XGMA 3WTZA 5A2QK 3N05A 4I01A 4RB2C 1H89C 2PBIA 3W2WA 3FXQA 2ZBKA 1X2NA 2P7VB 3EYIA 2IW5A 5J1UA 3CP2A 4RB1A 3BJOA 1Q1VA 3Q3SA 3L2WA 1JHFA 4HEA2 5J8FA 2EZLA 3G1OA 3F23A 3E6CC 1RIOH 4YIRX 1TT0A 3J7AY 2COMA 3M1EA 3KE2A 3CC7I 2QYOA 2R92J 1P4AA 2KZGA 2O8KA 2IXSA 5D4SA 5E3LA 5IT9Z 4ZJZA 5F6FA 4BHCA 5FKNA 2AHQA 3WU1B 3BZKA 4BDZA 4G94A 3UKGA 2Y48A 3S1QJ 3E5XA 3JSPA 5GP9A 1B9MA 1FIAA 1GUUA 1MZBA 2B7EA 2K9QA 1IXRC 4LFUA 3V8JA 2QENA 2BY1A 4YELA 3RTRA 2M2EA 1WSUA 4BBSJ 4LLLA 3WHBA 1IRZA 1ZG3A 3K1PA 3TMOA 2STTA 2F5VA 3ESWB 2X0LA 2A69F 2H27A 2QUFA 2OD5A 4I98B 3I4PA 5M5WJ 2BGCA 4JBAA 2JZYA 5EZGA 2D1VA 2D5VA 2CW7A 4MHGA 4QIWN 3WTWC 2CV2A 4GDFA 1YW8A 5EJCA 5H6RA 2ZMEC 4A3EJ 3OSFA 2QM3A 2RN7A 3E0JB 5ERIA 3C3WA 2KHMA 3PNTA 2W82A 3PNVA 5K7FA 3LSPA 1MMSA 1XS9A 1XB4A 4Z2YA 4DNCA 1XSDA 4DW6A 2FX0A 1W4MA 4PJJA 2M87A 2K7LA 2L7MP 2CV1A 3KETA 4MEXF 2GIZA 3GZ5A 3KZIC 4Y3OA 3HUGA 1LDKB 1O7LA 3SYTA 3A02A 4A6EA 4WX9A 3BLYA 3GTKJ 4AD9A 3G4SI 4C2UA 1LNWA 2FJ1A 3QYBA 4HNUA 4Y13A 5D5VB 3HIFA 2Y75A 3U1DA 3WTVC 1K6YA 1SANA 3N97A 1ZGWA 4IXAA 1Z77A 3LSRA 2XUBA 3OV8A 1I5ZA 4PDKA 3ZCOA 4ASNA 3CZ6A 4XK4A 1UJ8A 3D5SC 4FISA 4NB5A 1E2XA 4A0YA 4Y52J 2F5FA 2V9KA 4LMYA 1P7JA 4NC6A 1U8BA 4BACA 4U7DA 3HUGB 5IOYA 4LG0A 2E71A 3VOEA 5HLHA 4XR6A 4CCOA 3GYHX 4EEFG 2KMUA 1YW9A 4MFDA 3DKWA 3DU5A 4S04A 2Z33A 1BW5A 2W4SA 2JA7J 2ZMEA 2W48A 4HDVA 2R7QA 1REPC 4PSWA 3CCEI 1JXSA 3R4KA 5J47A 5LBQA 3C1DA 4Q5SF 3OR1C 3JRHA 4N9HA 3DPTA 3TDZC 1XG1A 3RCOA 5M5YJ 4XBFA 3OYHA 3JSOA 4G6TB 3R6SA 3OOPA 4NUBA 3P7NA 5FFZA 3CO6C 1M1EB 2DTZA 3BG9A 4OINF 4IQJA 3ABUA 2IAIA 2WV0A 2KDZA 4CO8A 3CJRB 3TP3A 2JTVA 3GTMJ 3C2BA 2XV4S 1S29A 4G7ZF 1NK2P 2P7CB 3CF2A 3CJQB 4JQFA 1D1BA 1R22A 3MFKA 1RR7A 2ZMEB 2VC0A 3BR0A 3KLNA 3HJEA 1X1DA 2ICWG 2E5ZA 3A03A 3ZMSA 1G8XA 4C9YA 2PFBA 1TTYA 3FKIJ 1SVMA 1VNDA 3QQAA 3MKZA 3S16J 5J6XA 1P4XA 4U88A 1DQUA 2PMHA 4HSRA 3ZXSA 5HVQC 6PAXA 4XRSA 1YYVA 3BTJA 3K1NA 2XPWA 1JTYA 1HQCA 3RPQA 2L02A 2XKPA 5FFXA 3E6DA 4LGWA 3D1NI 2GA2A 1UMQA 1R1UA 2M34A 1W7PA 3BR2A 2M0CA 3HRUA 2NRAC 2V4JC 3BZ6A 2Q8KA 1WFXA 2BYVE 2NVUB 2X6YA 1H0MA 3C18A 4C3HJ 2DBBA 1BJZA 2W25A 4E7KA 4I09A 2CQXA 1FWZA 3BG5A 2MD0A 3BJAA 3IHUA 2ZFWA 3HYIA 3KZYA 3LAJA 3CJNA 2EQRA 3FK7A 2MGQA 3OR2C 1N25A 1WJCA 2NVXJ 2RC4A 1UCRA 5DUKA 3DP7A 3I0TA 1NG7A 2F6CA 1RRJA 2FOKA 4L0ZB 3ZQ7A 1VQ5I 1B1BA 3EQLF 4EJTA 1X3UA 1XSXA 3W6KB 3PL8A 3ZOBA 1JKPC 4L9NA 4H0EA 4NDLA 2KIQA 5BNGA 4ABZA 2DK8A 2LOOA 3HOTA 4ON0A 1QPIA 2LY1A 3VEPA 3DQVC 3HXLA 3M8JA 1Z0XA 3WG7H 2XAQA 4JP0A 1ZRFA 3A2KA 2AXTC 1OCPA 4DIQA 3CCSI 1EH8A 4M73A 3JAMZ 4QLCU 3TW7A 3PUBA 3I56I 2AO9A 1RUOA 1X1CA 2VT2A 3KZZA 1B59A 1FBQA 1HKSA 4C3IJ 3CCMI 3E1SA 4ZYAA 2CWEA 2X1EA 1IC8A 1OYYA 1Z7UA 1ON2A 3PO2J 1WJEA 3RKWA 2IGOA 4M3GA 4M9ZA 4OAYA 1LJ9A 1Y56A 3PUFA 4IQ4A 2H6BA 2CMPA 3ZQCA 5F27A 1FSEA 1FPQA 4PZJA 4XL9A 4X6AJ 2ISZA 3I59A 1TWAJ 3QPLA 4H4KC 3J81Z 3LFUA 1T0FC 4NC7A 1BL0A 2I10A 2H8RA 3S93A 2E60A 2GAUA 1ITYA 3CD6I 3MKYB 2B9SA 4B43A 2X6WA 3EUAA 3IKVA 1ETQA 1A6IA 3OYNA 2KT0A 5LEJA 3REOA 1IRXA 3KEYA 2J5OA 1HDPA 2X1CA 1R5ID 3ECHA 4EMSA 2WB1A 2KIUA 2GXBA 1FTTA 5GTHC 3LSHA 4EJOA 3P9CA 4ETSA 1R36A 1MIJA 3HHGA 3VWBA 5D6EA 2ESHA 2PI0A 1B6AA 3OYDA 4OMYA 4QPOA 4FQGA 3T8RA 5FLVA 1JTXA 2VPRA 3FXOA 2Z2SB 1EH7A 2CQ7A 5DCMA 1WJ5A 3F9KA 1T39A 3GFMA 1C0WA 1PUFB 5K5RA 2HZTA 3G1MA 3OYJA 1AKHA 1QPMA 3ZQQA 2NXNB 3I59B 1EA3A 1Z21A 4HAMA 2GOMA 1LEAA 1DU0A 2L9NA 5JVGF 2E34A 1K7AA 4MEYF 1G3TA 4FX4A 1T98A 3H35A 3HM5A 2FNAA 2HWVA 3O8GA 1P7IA 2MFZA 2X4HA 4WK8F 2R7TA 1P92A 2R7FA 1BR2A 2P5KA 3SJMA 2VBWA 1HSJA 5LGNA 3JW4A 5FLMJ 5LHHA 3MKLA 2BEOA 1QO0D 4BEHA 2WY7Q 4BHPA 1L3LA 2WAQA 2XGDA 4X1EA 5J3LA 1SAXA 2XB5A 3NWSA 2PJRB 3AFHA 4QWQA 2JRTA 2DOAA 1WCMJ 2QQAA 1J09A 1KONA 5D8KB 1KQ8A 3U21A 1T0FA 4KN7X 4PUSA 5B5EC 2EZKA 3T8TA 4B4CA 5DCMB 4I0AA 4RMNA 4ITVA 3GTQJ 2EIMH 4E7SA 4A3FJ 2H09A 3KP7A 1VQ7I 2V9VA 3OYKA 4BE1A 4S0HB 2OQGA 3TDUC 1YIJI 1RC9A 2UWMA 1WVRA 4B09A 2XRLA 4AIDA 3OYAA 2HYJA 2JSPA 2R7UA 5C4JJ 1YX3A 2COBA 2JRMA 3HEFA 4JX5A 4M9SA 1JKQC 3WG9A 3TO6A 4GCVA 3DBLB 1QZYA 1R5GA 4PK4A 4RM3A 3ERMA 1K4TA 3MD2A 5JVTA 2OTLI 2W00A 3JRFA 1ENHA 5DD4A 1PVEA 2JK3A 2N8GA 3CCVI 3CDLA 3HRTA 4A3KJ 3OY9A 4XM3A 1X2MA 1O3QA 2BOLA 2EZHA 2XAGA 3C2HA 1HC8A 2IS2A 2DA6A 3UNGC 1NHAA 1R1TA 1P2FA 3A0BC 3K69A 2Y9YA 4AU7A 4BXUA 1R9TJ 3OS1A 2P5VA 3OYEA 3QU6A 1BOAA 3V8KA 1OYWA 3G1LA 3GTLJ 1ZKGA 3S32A 2FXAA 1X4OA 3T5XA 5D5WB 1PJRA 2G7HA 4BHBA 1DP7P 2KLOA 2PX9A 4A93J 2EV0A 2DQRA 3CMMA 3S17J 2XF7A 2VQLA 2XC7A 2LLKA 2X48A 2NS0A 3R60A 4BNCA 4HRIA 4PFPA 1ZH5A 1YRNA 4JX6A 2Z3YA 2F5EA 3ABTA 2D45A 4IRHA 1MNDA 3I54A 1ZG1A 1A35A 1WQ2A 1RETA 5EEHA 1EV7A 1D3YA 2ZO4A 3HSRA 3HGGA 1K61A 4EGZA 2PJPA 2HFHA 3BG6A 4II3A 3M1CA 5CJ9A 2CUZA 1H8AC 4IHYA 5AONA 2FOWA 2HPIA 3DXJF 5K5QA 1LFUP 2VXDA 2YX7A 5FLXK 1GHCA 3K4KA 1MNMC 4FASD 5JHFA 2HQNA 5BPDA 1IAWA 4A69C 3DKYA 3OS0A 4F91B 4HF0A 2VBYA 4YEJA 1AWCA 1Z91A 4LD5A 3H5NA 1YRNB 3IC7A 4P9FA 1I1SA 9ANTA 3A4CA 3BOQA 4RLFA 1JE8A 2HOEA 3S3OA 2ZCWA 3MAJA 1UAAA 2LF7A 3L2QA 2I5UA 3PFIA 3OSGA 3ZGKA 2HKXA 1TT5B 2VKEA 2WA0A 3FDYA 1YX5A 1LUJB 1Z3XA 2X51A 3FISA 2JMWA 5BMZA 2E2IJ 4KYWA 5GADJ 3AL0C 2Y0MA 3LWFA 2LKPA 4A2UA 1FJLA 3LSIA 3L2RA 2R7XA 2LREA 2O8XA 3FBIB 3ABKH 2DDBA 2ELHA 2ESNA 2XAJA 1P9QC 4CXFA 4UVCA 5IP6A 3K7AJ 3Q9VA 1O3RA 2XSJC 1I50J 1OR7C 2K9SA 3G2BA 5ILSA 1S9HA 2IP2A 2IS6A 3F6VA 2QEXI 4UUVA 3FK6A 1LB2A 4CZZA 1MSEC 2JA8J 2VJ4A 5FJ8J 1ETWA 2DA7A 3K4NA 1Z1DA 5IYBJ 1JT6A 5KVRA 1T8IA 3K2ZA 1LVAA 2STWA 4BQNA 1JGSA 5CVVA 4HV6A 1KYZA 3W3CA 2BY2A 4RGRA 5E20A 4BJ6C 4JX4A 2CH0A 3H9QA 4WF2A 4A3MJ 2GBYA 4HX7A 2W1OA 2G7UA 3K0LA 4F52A 5H6QA 4NC8A 4BU2A 2XB0X 1W36D 4HF1A 1VFCA 2ACJA 4CCMA 2M7BA 2DJNA 1XSVA 2E2HJ 3LOCA 4ZDPA 2FBHA 3U2RA 4OIOF 5JHUA 4CYCA 4ZTFA 3E5UA 1MD0A 1MMGA 2E7XA 4HPQA 1CQTA 2HZDA 5LD2C 4LOCA 2OV7A 1HOMA 2KP6A 1MH3A 5EEGA 5F0CA 3SZPA 3CCQI 3H1CA 2A3SA 4KT5C 5B1AH 5CKTA 4B3XA 2V1UA 2EIJH 1IRGA 2XAUA 2YUSA 3E6BA 2MC3A 1OCCH 5TRDA 2HEOA 5LLQA 1ZK8A 2IA0A 1X3ZB 3OIOA 1OR7A 3I71A 4A3JJ 1ERDA 3NAUA 4UNOA 1JJ8C 2FSWA 4GO1A 1GXPA 3SHFA 3CP8A 1S7EA 1H9GA 1QHGA 2E19A 3GTOJ 4ZYHA 3X2QH 4XLCA 4ZYDA 3PNYA 5E3MA 3HPHA 4BXFA 2RAEA 1QVUA 4CYCB 3K4LA 1Z05A 2CQKA 1KYWA 1XGOA 1TNSA 1YLFA 2CUEA 5E1WA 4EM2A 1KQ0A 3E6MA 5JI6A 5EEAA 3WTXC 2HOTA 1D5VA 3WHCA 4DJAA 5DD8A 2E35A 1PUEE 4MLOA 3VSLA 1V55H 3AL0B 5LRRA 2M4KA 4IVNA 1MMNA 1E0EA 2DT7B 2OUMA 3OOUA 3ZQIA 1W0UA 2M8EA 2ZJQF 1FBUA 2X6XA 4HBLA 1J2XA 4E7HA 4ESJA 3DPLC 3LA7A 1AA7A 2E1MB 3F8FA 1U9OA 1UG2A 1I6XA 2GQQA 1WJDA 1IUFA 4N4NB 3FX3A 4YFNF 3BTIA 2QBYA 4BY1J 2Z1DA 1YIOA 3OIPA 1IV6A 4P9UA 4RAYA 2QQ9A 1WH7A 3RZDJ 2IT0A 4DBQA 4HQMA 5B66C 5K7HA 1XCBA 3CCUI 2QSFX 3FXKA 5IPAA 3FMRA 3S3MA 3IH3A 2ECBA 5D5XB 1PP7U 1F4KA 5E8GA 2ELJA 1D0XA 5LHGA 3JRIA 4BE0A 2P6SA 2JT1A 3AG4H 3MN2A 2JWTA 3HOXJ 2H8WA 4A3GJ 4M71A 3LQRA 2UXXA 4A0ZA 1IZ1A 1ETKA 1VQNI 3PJRA 4KT6A 1RKTA 2BY3A 2CS3A 4A0XA 2QBYB 1I39A 3E7LA 1PYVA 4ZDLA 1TQMA 3CC4I 3QPHA 2KPMA 1U3EM 2ZFUA 1TBXA 3ELKA 5K1YA 2OF7A 4WWCA 4RA2A 1UG0A 2HVRA 1DGWY 2B0LA 2XGCA 5GTIC 1KU3A 2W85A 4W97A 1V5GA 2LBFB 2DPDA 3SFIA 4UV8A 3O3KA 2HXIA 3KX2A 2XAFA 3BJ6A 3CMAI 4BJ5C 3H3VK 4A3CJ 4F92B 3IRQA 5LGUA 3DBRB 3MEXA 3OL4A 1T38A 3U1KA 2NS8A 1B8IB 4V2FA 3IV5A 3JTGA 4A5NA 2R93J 2GLOA 2CSOA 3K10A 1MGTA 2EA2A 1ON1A 3WODF 2EFPA 4DYRA 1JT0A 3OYBA 1N75A 1P6RA 3HZJA 4PJ0C 2HQRA 3ZMUA 1S8NA 4M3EA 1Y0UA 5EF6A 1K6OA 3OYLA 5L3CA 4XN0A 1OCTC 5IOZA 4LB5A 1RNLA 2LC2A 2OQRA 3KP3A 2DO7A 3BPVA 1MKMA 5CVIA 3OYCA 4G6QA 1ODDA 1FOYA 2JQ7A 1DGRM 5CQGA 3GO5A 3O8HA 4LJZF 1IJWC 2M4GA 4I99C 1T95A 5CLSA 5HS9A 2DT5A 2ISYA 1X3WB 3OMYA 2CQNA 1ZG5A 1U9NA 4OIQF 5KCMA 2UZKA 4M6YA 2IGMA 2FA5A 2XKOA 2L01A 4XSXF 2QWWA 1QGPA 1OISA 2BHYA 5J8CA 1WWXA 2IEKA 2ZXWH 3H5RA 2Y31A 3M3YJ 2LK2A 1YFHA 2M0MA 3ZMVA 1MMAA 1GT0C 1G4DA 1JHHA 4XOTA 2Q0OA 2OCEA 4G9YA 3GLXA 5E17F 1O57A 3IWFA 3WU0A 4AYBA 4KMUX 2A6TA 3RI4A 3J7ZI 3F72A 2V1XA 1FMWA 3FIWA 2WB1N 4HA8A 5ICCA 3FHNA 5IT9K 2A61A 5L3BA 3CLQA 1Z6RA 2TDXA 3Q0VA 3HOUJ 2V1DA 3RPUA 1GVJA 2R7DA 1RZ4A 1EF4A 4D5CA 2R7RA 4V2GA 2HYGD 2MLGA 5K7ZA 4R8HA 4GGGA 5C44J 5E18F 5C4XJ 1SVLA 3RQ4A 3JRBA 5HNFA 4XLAA 2M8GX 2HVSA 3DWLE 2WV1A 3SEQA 3V8LA 3DEEA 1U5TC 2NYXA 4DZJA 2M5WA 1S7AA 1JGGA 2IJLA 3HBLA 3LMMA 3MWMA 3FXLA 3V4GA 4UB6C 2CO5A 3ERED 5J40A 1Q1HA 1OLTA 3KEQA 4F7ZA 5BQTA 1BI2A 2WAQN 3J7YJ 5FKLA 2R7SA 4E7LA 2QKLB 4DYQA 2RGVA 1USSA 3RKXA 2VOOA 3CESA 3CJTB 2JN6A 2Q2EB 3GVAA 3GUDA 3IUOA 4IPAA 5JLWA 1PDNC 3RZOJ 3TP0A 1KA8A 3TOBA 4GFBA 3S2HJ 3DEUA 3DCFA 1T2KA 1MJAA 2NOGA 2KJCA 2CGPA 2F2EA 2RVCA 4UV9A 4EGYA 1Y1WJ 3M8EA 1FMVA 4DYCA 2VQHA 2Y30A 2RQQA 1F43A 2NNNA 4NHJA 2MYSA 2FBKA 2KISA 4BE2A 2L2OA 2BXZA 2EBIA 2RDPA 5F08A 1YI2I 4CH7A 4ANJA 4PGHA 4IHSA 1GV5A 2IBDA 3K4JA 3BTLA 3ECOA 1ZQ3P 2DPUA 1DDNA 3ZQGA 5ILVA 3F8NA 2A07F 2R7WA 2JA2A 4BS9A 2W24A 4BXXJ 2DDAA 3BQZA 2D1HA 2XPVA 2DA2A 4XKVA 3Q9SA 1U5TA 2JPBA 1RPWA 2HKOA 5ED4A 4IOCF 2R3SA 4KNYA 3WE3A 3JR9A 3I4MJ 2EILH 3H5AA 3F8BA 2JVGA 2LH9A 1ZRCA 1IUYA 4HF2A 2K4BA 1LKXA 1P4WA 4G6DA 5AIQA 2C6YA 2VONA 2IRFG 4N4OB 4M3DA 4EJWA 5IT3A 2CQQA 3FZVA 1EJ9A 1TZLA 1ZREA 2FMYA 4KMFA 1UB9A 3TKYA 2IS1A 1ZLJA 3B6AA 2DMNA 1ACIA 4IO9F 2VUMJ 3LSJA 1BI1A 3NRVA 4MNUA 5TISC 4QTRA 3GW2A 2GA1A 3KYDB 1W36C 3BG3A 4OWRB 2WC2A 3GFLA 2M30A 4OIRF 4HX8A 5M3MJ 2DI3A 2VQCA 3PSIA 3BR3A 3IH2A 1U5TB 1PUFA 4HLYA 4XKBA 3TO9A 4FE7A 4EV0A 1DP3A 4IHXA 3FM5A 1W5TA 2LRDA 1TNTA 4U0WA 3OIQA 3CUOA 1WI3A 3S14J 2EWNA 2EA4A 1D1AA 5HLIA 2VN2A 4E7IA 4LIVA 4NNJA 5FGMA 1HW1A 3RSNA 5FROA 3QRFF 1ETYA 2L3DA 5EYRA 4YRVA 4ENKA 5CQEA 1G59A 2F4OB 2XRNA 3BP8A 4OAZA 2GWRA 2B63J 4M3BA 5FKMA 2FF4A 3ZQFA 4L18B 3ULQB 3K70C 4CA0A 4XSZF 1MBGA 4KA4A 2ID6A 2PJRA 5C3EJ 4AIHA 3AKZA 3LNQA 1A36A 4ZZDA 1S7OA 2K3FA 1R6RA 4OIPF 5M3FJ 1RKWA 4BKXA 1MSFC 3NWTA 2O9LA 1GLNA 5FRMA 2HR3A 4J00A 1E3OC 5L3GA 1R1VA 3LSKA 3M9AA 5EG0A 5FKKA 2A05A 2K3PA 2GXGA 4ZYGA 3FBNB 2K86A 3R0AA 3CCLI 4XONA 4R1HA 1BR1A 2OZUA 4B48A 3RPUD 1SFOJ 2MABA 5GPAA 3MZ8A 3AG2H 1OCOH 3GTJJ 3TOAA 4CCLA 4E70A 1LEBA 5BS6A 3M4OJ 1A04A 3QAHA 1L0OC 3IH4A 2YU3A 2KIFA 4RAFA 1XDUA 1TW3A 2WBMA 4RGSA 4BY7J 4PFOA 5HDNA 4P1WA 2J5PA 1QQIA 4F93B 3BR1A 1HDDC 5F1RA 3SDBA 1YITI 4RM2A 1U2WA 3JRDA 1WHUA 3GWZA 1SMTA 2EFNA 3H3UA 2KIMA 2QQ8A 2QGUA 5EG0B 3FMQA 5J1RA 3GF2A 4L9VA 3JAMK 2BVLA 1OCZH 3L00A 1UFMA 3SEZA 5HLGA 3ZMTA 1Z7LA 2H1KA 3CO7C 2D2WA 3I58A 3V7SA 1YE9A 2LVSA 2ZJRF 4P55A 3WGHA 4KN4X 2LY9A 5BOXA 1WJBA 4RB0A 1VQPI 3JTHA 2ZB9A 2ELKA 1XGNA 1Z6TA 3J81K 1FBSA 2BZTA 2OA4A 1E3PA 2ZKZA 4PGGA 2BY0A 2VBXA 2VJJA 1FP1D 4YFKF 3RIRA 5IY5H 3A0HC 2DFFA 3S8PA 3FXJA 2DMTA 4MGRA 4A3LJ 2DOEA 1ZHFA 3D5LA 3CF5F 1IDYA 2BW3A 3ML6A 3CLOA 1GV2A 2HTSA 3Q5FA 3IRRA 1FLIA 1E3HA 4P96A 4CCJA 3RDIA 3HKZA 4LITA 3MZYA 4DQ2A 3HOVJ 4B3AA 1G3WA 2YX4A 3TW6A 1S3JA 3QODA 3JREA 4ZC3A 1HW5A 3HTSB 1A31A 4NQWB 4CCKA 5CYVA 2NS7A 2O0YA 4M72A 3LQQA 4M6VA 2OJED 4Y17A 3V42A 5KHDA 2JPCA 3ZMDA 1BBYA 1N78A 2JJ7A 2VI6A 1VQ4I 4J19A 5HNHA 1ONVA 4R79A 2OPTA 1OKRA 1D0YA 3VYSB 1D5YA 2CV0A 4B47A 2CUJA 3TEDA 4LLNA 1LFPA 2BW3B 4LK0F 3K4CA 5IP9J 3AG3H 3K1MA 4TV7A 2P4WA 4L5IA 2ME0A 2VOPA 1WZ2A 2VIXA 3H0GJ 2Q1ZB 4EJVA 1F36A 1ZELA 3S1MJ 2XGXA 1FSHA 1CF7A 3WTTC 3EYYA 4E6KG 4ZYEA 1B9NA 2XPUA 3I55I 1XCVA 3WE2A 5IP7J 3QOPA 3JCUC 4IX7A 4I6ZA 1VQ6I 1MH4A 4XLFA 4A3DJ 3S3NA 2LY2A 3RYRA 1VF9A 2H94A 3I3LA 2X6OA 3CTAA 1RESA 5JFRA 3DBHB 2EPFA 3J80K 2OC6A 1SEUA 3I53A 2UV1A 1KU9A 1LE8B 3RJPA 2P5LC 1IG7A 3HSEA 3SZGA 1EKEA 2W7NA 2IVMA 4PSXA 4UUTA 5D6FA 1VZ0A 4N0BA 2UUZA 3OYIA 1D1CA 1I3QJ 2E1MC 4UHTA 4ESFA 5LGTA 3K4BA 4E4HA 1KU2A 1SAUA 2VT3A 2A6HF 1WGXA 4RS8A 1CF7B 3QYFA 3RKYA 2YPRA 5FD5A 3DTKA 2KKOA 2HTJA 3DEWA 3VDXA 4CCNA 4M6XA 5DDGA 3CUQC 3LL7A 1R4MB 4KICA 4B8XA 4HW0A 3GXOA 3WTUC 3D0SA 2OTJI 4D0PA 5A2QZ 2WY8Q 5DV5A 2FQ3A 4XRSG 4IKFA 1BJAA 2MG4A 2P6TA 2VKDA 4G8XA 1RR8C 4O6JA 3MKWB 1AU7A 3CC2I 4IRIA 1IN7A 3HG9A 5HOOA 4N9IA 3VYRB 2DN0A 2PN6A 3LA2A 1D0ZA 3KYLA 3HTUA 1HW2A 5M5XJ 2XVCA 2YS9A 1R00A 2Y9ZA 1TW2A 1QZZA 3G6EI 2DT6A 2O5RA 4M74A 1PP8F 2JSCA 1FYMA 3MZHA 2FE3A 1MBKA 2MLKA 1NTCA 1SD4A 3RYPA 4HOBA 2XROA 1R58A 4D1QA 1Y6IA 4FX0A 1Z3YA 5F1JA 1TLHB 3HRSA 3M7GA 3CCRI 1MJBA 2ZNYA 2L7ZA 1YJ9I 2BXYA 1ZGAA 2XF6A 2Y2ZA 3NARA 2Z5UA 3ABLH 3KP2A 3GFIA 3AG1H 2I8DA 5FD6A 3A1YA 2IGNA 4RGXA 5EGOA 3CQZJ 1IN4A 4OU0A 2LR8A 1EH6A 3K70D 3JRGA 2DYRH 4YG2F 3SZTA 4L9JA 4FHTA 5FO5A 2R0QC 1VQKI 4XLHA 3COAC 4XN3A 1OJLA 1I1GA 2KL4A 4FTHA 3ZP5A 4O3MA 1V5FA 2AQFA 1R23A 3CUQA 4LK1F 3KP4A 1R4NB 2JUCA 2HI3A 2HYFA 3DF8A 3L7WA 1YTYA 1FYLA 2PQ8A 5HS8A 1U6GA 3PFYA 2L9RA 4AYBN 3WU2C 2IGKA 3L09A 4RAZA 2GM4A 4G7HF 3ZPLA 3I9V2 2R5ZB 4YIFA 3DLAA 1JJ6C 2X9DA 5EGOB 2FEZA 1IN6A 1ZR4A 3O6BB 2GIVA 2HGCA 4YFXF 2VKHA 2R7ZJ 2CFXA 4ZH4F 4AM3A 4W1UA 2P0WA 2QZ8A 4O5VA 4ZZLA 1J9IA 2HQAA 3KIOA 1MBFA 3V7RA 3KYCB 5CVRA 3A01A 3C2GA 4XLEA 2EV5A 2E1NA 2M3AA 1MMDA 1Y0NA 3B73A 3MQ0A 4I0BA 3CUQB 1UZCA 1D8JA 1N77A 4BQQA 1XPXA 3WGIA 4IL6C 4BAYA 4ENJA 4Y7NJ 2KRCA 4AC0A 2DA5A 1BM9A 3BCBA 2Z9OA 5ICGA 1V4RA 4PJLA 5JLXA 4ENMA 2NVQJ 2HPMA 1LDJA 2DJIA 3T0YA 2LBFA 4HYEA 2WWYA 4B44A 4Y4RA 2IPQX 4C3JJ 2NVTJ 1YQAA 4YIIA 1T08B 1FNNA 3F3XA 3P9IA 1UHMA 4WXHA 1B8IA 1FIPA 2QVOA 4UUSB 3A01B 3OWTA 4CDGA 2K02A 2DMPA 1YG2A 5DUIA 1JKRC 2DFEA 2Y69H 3BZCA 1RI7A 2ME6A 3LSTA 4P5OA 4E7ZA 2VODA 4Q47A 2RREA 3QPTA 1S6LA 2L4AA 1R49A 2V7FA 2WAEA 1Y1VJ 2MH2A 3LA3A 5GPCA 4S05A 1I6HJ 1STZA 1V54H 1TL8A 2F4IA 3BC8A 1IV8A 2FQ4A 3DV8A 1FOWA 3PM1A 1YW7A 4CICA 4C2MJ 5IYDJ 4F55A 1DPRA 5DTDA 2ZXIA 5DEQA 3GTPJ 1UHWA 2CUFA 2VE8A 3TO7A 3KEOA 2ZNZA 3F0CA 2V9PA 3MMYB 3VB2A 4IHTA 3BDDA 3Q0WA 3BTCA 2E36A 3HOSA 2O3FA 3M8FA 3MVPA 3HOZJ 2P8TA 4HSTA 5HDGA 3DU6A 4RB3C 5L3EA 2KDOA 1ORKA 2PEXA 1ZARA 3GZ6A 2DYSH 2L9SA 3DKXA 3JRAA 1NK3P 1OYIA 1V5EA 1HXDA 1SMYF 3GZNB 3FM3A 4BL0B 1QZEA 2QF7A 2YSRA 4Y33A 1MDMA 5GAEJ 2K5CA 5KK1A 4HG2A 3CMYA 4C2TA 2M9HA 1J0RA 1WPKA 2Y0SA 1T56A 3BR6A 4ZTJA 4A3BJ 1WJAA 3H3ZA 2HVQA 3W6JB 5TGTA 4AVZA 1HLVA 1ZYRF 5DCFA 1T33A 2E5NA 4AIKA 3K6GA 4L5EA 1ZN2A 1A5JA 5KAFC 1O3TA 1NG6A 4DBRA 4D7MA 1IXSB 1H88C 1W1WE 3KPHA 2F48A 3IAM2 1T6SA 4HNVA 2KRHA 2CW8A 1SFXA 1XGSA 2PMZA 3I4NJ 4IHVA 3P9KA 4GYIA 1WKMA 1LVKA 3SXYA 4XLPF 5L3DA 2VJ5A 3BPXA 1HBXG 1SC7A 2VJIA 4MTDA 1MDMB 3CDHA 4V19K 1FTZA 1BA5A 4XRMA 3FWEA 2FMLA 1DUXC 2LP0A 4WCGA 3MCZA 2E1CA 3H9JA 5DM6F 1X1BA 1SD7A 2Q2EA 3ROUA 1IXCA 3EDPA 4BQOA 2LNBA 2QSGX 1VQ9I 1KZHA 3HRMA 3VODA 3OYFA 1VTNC 4ENNA 1Y8RB 3EETA 3NEUA 2KRFA 4BYYA 3W2AA 4EJUA 4UB8C 2CFOA 2VASA 1S5LC 1ZR2A 2K9NA 4IRGA 1WRJA 1GDTA 5E79C 1IRFA 3GEZA 4KIGA 3VSKA 2DAOA 2JVHA 4KITB 2HQ5A 1K4SA 1XN7A 1E17A 1G3YA 2ID3A 1ZTRA 1BR4A 1RUNA 4KDPA 2GZWA 4D7NA 1TQPA 3ZR8X 4HQEA 3B02A 4JK1X 3V7CA 4JYKA 2OCCH 1O3SA 5J1YA 2LYCA 2BBYA 1BW6A 4ESBA 3HB9A 3CCJI 4U0YA 2ZXJA 5FB2A 1W0TA 5LRSA 1SFEA 4DOZA 3VPRA 2M7AA 4LG0B 4XICA 3GLLA 5B3SH 2DOFA 3VFZA 3H92A 4HV5A 5D8LB 2HS5A 1U8RA 1VQOI 1QHHD 1XD7A 3CCYA 3DPUA 2NOJB 2WADA 1HKQA 3HOWJ 2ZXHA 4UY8I 1SD5A 2DODA 2V26A 4AIJA 5E3OA 3ONQA 2VL8A 2W57A 4MQVA 2CRGA 4RGUA 2HOSA 2VPLA 3VYUB 4KUMA 4E7JA 2QSHX 1HA8A 2HDDA 3KLOA 4Y15A 4EM0B 1J5YA 2UXNA 3B6CA 3S1RJ 1G2HA 5L3FA 1MNEA 1X1AA 3S1NJ 4A6DA 3E5QA 1ZAOA 2RKHA 3FHZA 1MBJA 2DLLA 2VC1A 2HU9A 3NQOA 3PQJA 2CYYA 5DS9A 4JOMA 4J01A 1YJNI 3DFGA 1FZPB 2EINH 2FD5A 3K4MA 5FKOA 2HDCA 5HDKA 4CYDA 3L9FA 2HXOA 4U0VA 5AIPA 3QU3A 2OZ6A 4CSWA 3G73A 4IF4A 1ETVA 4UXNA 3ZQLA 4A12A 1GVDA 3J7AO 4K2EA 2F4MB 1FT9A 2V6EA 5HLTA 1KU7A 4I7HA 3QP6A 5D5UB 1YHQI 2DFHA 1IDZA 1HCRA 2ADUA 1A6QA 3HKZN 4BGDA 2M1BA 1SVOA 3SFZA 2MBFA 4MO7A 1W7PB 1X19A 2FBIA 2F5CA 3C7JA 2PMUA 2EV6A 3TBIA 3QPSA 5E8IA 5F64A 2QLZA 3U9GA 3F8MA 2K4JA 1J59A 2ZSIB 1JI8A 2K27A 1QA6A 4EM1A 2L7KA 3P5JA 4M9XA 3OL3A 3BG7A 4MIMA 1LFBA 4CGZA 2RNGA 2OU2A 3GBGA 4L0YB 2DCEA 2G0EA 2DU9A 1SFUA 4AUXA 3ZRGA 3I5UA 4M3FA 5EDNA 5DYMA 1I3AA 5LFAA 1IF1A 4HZFA 2LDUA 2RQPA 4EQQA 2LF8A 1SFKA 1TQIA 1XDSA 2H1LA 2OAZA 1U0JA 4MFEA 5ICFA 4GRIA 2VQGA 5GAGJ 3K2AA 5CVJA 2VKVA 3WGGA 1VQ8I 2QCOA 4XLNF 2EB7A 5DM7F 4MQ9F 3VYTB 3H36A 4RBOA 1TWHJ 5FRNA 2EFWA 2DA4A 3BR5A 1GXQA 1H9TA 4LIUA 4XMYA 2L9VA 2L4MA 4L9TA 1UELB 5F0FA 5GAHJ 3G71I 3QP5A 1LPQA 3PO3J 2AXLA 1HF0A 3L2VA 4RAGA 1USTA 1ETOA 1POGA 4XOPA 2K85A 5E3NA 2YR2A 4UVBA 1Z67A 4GXOA 4C30A 1FOKA 1BIBA 3QWLA 2CW0F 2QQBA 3FXRA 4PJNA 4QSHA 3GTGJ 2ZJPF 1W5SA
chains in the Genus database with same CATH topology
1VQMI 3J7ZI 1HC8A 3CD6I 2H8WA 1ACIA 4IO9F 1VQNI 4IOAF 1YJNI 2ZJRF 1YJWI 3CC4I 1MMSA 1VQPI 2OTJI 3CCQI 4V19K 3CC2I 1YHQI 2NXNB 5JVGF 2E34A 3CF5F 1Y39A 3CMAI 5DM6F 2FOWA 3J7YJ 3G6EI 3G4SI 1VQ9I 1S72I 3CJTB 1QA6A 3DLLF 2K3FA 3CCRI 1YJ9I 1VQ5I 1VQ4I 2E35A 1FOWA 1FOYA 2JQ7A 3CCLI 3CMEI 1VQ7I 3CCJI 5GADJ 5GAGJ 1VQKI 2ZJQF 1VQ8I 3CC7I 1YIJI 5DM7F 3CCSI 1YI2I 3CCEI 2E36A 3I55I 3I56I 1FOXA 5GAHJ 3G71I 1VQOI 1VQ6I 2QA4I 2QEXI 3CCMI 4UY8I 1YITI 4IOCF 2OTLI 3PIPF 1VQLI 3CCUI 3CCVI 3PIOF 5GAEJ 2ZJPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  3J7Z I;  1HC8 A;  3CD6 I;  2H8W A;  1ACI A;  4IO9 F;  1VQN I;  4IOA F;  1YJN I;  2ZJR F;  1YJW I;  3CC4 I;  1MMS A;  1VQP I;  2OTJ I;  3CCQ I;  4V19 K;  3CC2 I;  1YHQ I;  2NXN B;  5JVG F;  2E34 A;  3CF5 F;  1Y39 A;  3CMA I;  5DM6 F;  2FOW A;  3J7Y J;  3G6E I;  3G4S I;  1VQ9 I;  1S72 I;  3CJT B;  1QA6 A;  3DLL F;  2K3F A;  3CCR I;  1YJ9 I;  1VQ5 I;  1VQ4 I;  2E35 A;  1FOW A;  1FOY A;  2JQ7 A;  3CCL I;  3CME I;  1VQ7 I;  3CCJ I;  5GAD J;  5GAG J;  1VQK I;  2ZJQ F;  1VQ8 I;  3CC7 I;  1YIJ I;  5DM7 F;  3CCS I;  1YI2 I;  3CCE I;  2E36 A;  3I55 I;  3I56 I;  1FOX A;  5GAH J;  3G71 I;  1VQO I;  1VQ6 I;  2QA4 I;  2QEX I;  3CCM I;  4UY8 I;  1YIT I;  4IOC F;  2OTL I;  3PIP F;  1VQL I;  3CCU I;  3CCV I;  3PIO F;  5GAE J;  2ZJP F; 
#chains in the Genus database with same CATH topology
 4HDU A;  1VQM I;  4BDY A;  2E7W A;  3IKT A;  2EJR A;  2DA1 A;  2DQL A;  4QPQ A;  2BV6 A;  3UR3 C;  2LKS A;  4II2 A;  4PJM A;  2V79 A;  3KP6 A;  3DTE A;  2WTE A;  3EUH C;  3H9G A;  4I2O A;  3RQI A;  2ZJ2 A;  1QNT A;  5FLX Z;  2DW4 A;  1HST A;  1X4P A;  2DA3 A;  3TGN A;  2H6C A;  1R71 A;  1IO2 A;  3WTY C;  5H2F C;  3HDD A;  3BCA A;  3CDI A;  1G3S A;  1TC3 C;  3I64 A;  2XF5 A;  1D8K A;  1MBH A;  3W2V A;  1DPU A;  4NBQ A;  1F1Z A;  2F5D A;  4XRF A;  4BBR J;  1O4X A;  1ETX A;  4IHW A;  4XQF A;  1APL C;  4IZZ A;  1Y39 A;  2AQE A;  3M07 A;  2Z16 A;  3TL4 X;  1AKH B;  2LMD A;  1VI0 A;  4D5F A;  3GCM A;  4BH9 A;  3J80 Z;  4B1R A;  1ZRD A;  4GYG A;  4FET A;  2WAF A;  1XMA A;  3DTI A;  3HOY J;  1K83 J;  1TWG J;  1S72 I;  4D9J A;  2LKX A;  5E1X A;  4NQW A;  2O7O A;  4BJT A;  1U78 A;  4Q4Z F;  3HSF A;  3DLL F;  5LEK A;  2EH3 A;  3N4M A;  4OMZ A;  5F04 A;  2JUG A;  2K9L A;  2LTP A;  2XAS A;  1B72 A;  2LD5 A;  3BY6 A;  2OBP A;  4BEH B;  3BT9 A;  4G7O F;  4CZC A;  2RNJ A;  4A3I J;  1WI9 A;  1YS7 A;  1R5H A;  1XMK A;  1XTA A;  2A5Y B;  2O03 A;  5KAI C;  2VBZ A;  2CG4 A;  2JA5 J;  4CHU A;  4WXC A;  1W7P D;  2AS5 F;  2MD5 A;  1FEX A;  5CVU A;  1BIA A;  2HNH A;  3E97 A;  1TP4 A;  3KCC A;  3GME A;  3GX4 X;  2MH9 A;  4XKC A;  3KFW X;  3EUH A;  4PCQ A;  5HOD A;  1OMI A;  2VB6 A;  2G9W A;  5D4R A;  3LAP A;  3EUK L;  2GOX B;  2QKM B;  2XDV A;  4I76 A;  5ILU A;  4L5J A;  3QOE A;  5K5O A;  4LB6 B;  3GFJ A;  1FYK A;  1OQY A;  2MW8 A;  3IWZ A;  1HKT A;  3T1B A;  2NVY J;  2P81 A;  3R61 A;  2RV8 A;  1LQ1 A;  2O6G E;  2L5Q A;  3Q0U A;  4KJZ A;  2VXZ A;  1BN5 A;  5CPR B;  4U7B A;  1UHS A;  2DXI A;  1B72 B;  1JKO C;  4IJA A;  4XID A;  3L2U A;  1LE8 A;  5J4Y A;  3AAF A;  1OPC A;  3PIP F;  3FF5 A;  1VQL I;  3PIO F;  3D5R C;  2VE9 A;  1TWF J;  2Z99 A;  2KJB A;  1SD6 A;  3HPG A;  4AWX B;  2DFI A;  2FRH A;  3S15 J;  1IW7 F;  2CJJ A;  2L54 A;  2XSD C;  4RLQ A;  3IL2 A;  2YU9 J;  4XNF A;  4HNT A;  1X1P A;  1AOY A;  4Q48 A;  4WXD A;  3IP4 B;  4BUP A;  1XX5 A;  1V3F A;  2DMQ A;  1FC3 A;  1IGN A;  2LSO A;  4MTE A;  1G6N A;  4AVP A;  3HL2 A;  3O2P E;  1ZLK A;  2LFB A;  3LSG A;  3SDG A;  1QU3 A;  2IA2 A;  3BQY A;  2TRT A;  2DMU A;  2ZC2 A;  4LLG F;  5IYC J;  3FKJ A;  2E2J J;  2K40 A;  3HHH A;  2R5Y A;  1QRY A;  2BHZ A;  3ZQH A;  3IAS 2;  4DGW B;  2IA1 A;  1ULY A;  1JUM A;  2K9M A;  5BPI A;  1MBE A;  4U87 A;  2O61 A;  2MC4 A;  5E1Z B;  1OFC X;  4F3Q A;  2DK5 A;  2ZSH B;  4EAT A;  1K79 A;  4X0G A;  2NNY A;  3HC7 A;  2JA6 J;  3S2D J;  1BC7 C;  1F9N A;  2KZV A;  3OS2 A;  2XAH A;  2TCT A;  1BI3 A;  1X58 A;  1BI0 A;  2LG4 A;  4LG3 A;  1FP2 A;  3ASN H;  4BQA A;  3QYE A;  4A5M A;  1TWC J;  2NAZ A;  2HOA A;  3WTS C;  1BOB A;  2ETH A;  4KIF A;  1XC5 A;  4UVA A;  1WH5 A;  1B4A A;  2R5Y B;  5F0H A;  5LHI A;  4I02 A;  1NH3 A;  2L0K A;  2EZI A;  3PQK A;  3CME I;  1MJ9 A;  2ECC A;  3LFK A;  3RKQ A;  4CUG A;  1MW7 A;  4XKW A;  4G12 A;  1JUS A;  3HGY A;  2E1O A;  1CGP A;  1YOV B;  4KFC A;  4RDU A;  2DTR A;  2IS4 A;  3FXU A;  3ZMZ A;  2EK5 A;  2FU4 A;  3S2W A;  2PG4 A;  3E3V A;  4ZDO A;  5KNL A;  1FOX A;  1KGS A;  2A5W A;  1F5T A;  3L2C A;  2QA4 I;  4OOI A;  2R5Z A;  1FY7 A;  2XGE A;  2Y0S N;  3H0D A;  1DU6 A;  3OYM A;  2XHK A;  1YO5 C;  2EFO A;  1Z9C A;  2MA3 A;  2FUG 2;  3W6V A;  2VLA A;  2A6E F;  2GXA A;  2PLY A;  2A68 F;  4HLX A;  5HS7 A;  2R4G A;  3FXM A;  5ICE A;  4Z6Y A;  4DZP A;  2CU7 A;  1W5C C;  3G3Z A;  1BC8 C;  1YS6 A;  1ZGJ A;  4EVI A;  3JRC A;  1AHD P;  2KQR A;  3PSF A;  3F21 A;  3KP5 A;  1JUP A;  1WJF A;  2PMZ N;  1OCR H;  1I27 A;  1J75 A;  2FNP A;  1XMX A;  1O7F A;  1QBJ A;  3F22 A;  4KIB A;  4IOA F;  2HDW A;  1K78 A;  3ISP A;  2R7O A;  2EIK H;  2L7F P;  3SQN A;  2KFD A;  1J7K A;  1YJW I;  4IEJ A;  2EFQ A;  3LSM A;  2R7V A;  2BE5 F;  2X1D A;  3EPZ A;  4HX4 A;  5TJJ A;  5EZH A;  5J4V A;  4FE4 A;  1IN5 A;  2MSY A;  3ABM H;  3TQN A;  4FT8 A;  1LDD A;  3FMS A;  1KQ9 A;  5JR3 A;  4UUS A;  3OYG A;  4KIS A;  2M45 A;  2XIG A;  2X85 A;  2BVM A;  3F6O A;  3ZN0 A;  3BRO A;  2V1N A;  4XOR A;  1Y8Q B;  1IN8 A;  2V6C A;  3L1P A;  3BWG A;  5B1B H;  1R7J A;  4FCY A;  1FX7 A;  1QVT A;  1K78 B;  3ASO H;  3R0J A;  2W84 A;  3F8C A;  3K9T A;  5H20 A;  3ZN1 A;  1XGM A;  3WTZ A;  5A2Q K;  3N05 A;  4I01 A;  4RB2 C;  1H89 C;  2PBI A;  3W2W A;  3FXQ A;  2ZBK A;  1X2N A;  2P7V B;  3EYI A;  2IW5 A;  5J1U A;  3CP2 A;  4RB1 A;  3BJO A;  1Q1V A;  3Q3S A;  3L2W A;  1JHF A;  4HEA 2;  5J8F A;  2EZL A;  3G1O A;  3F23 A;  3E6C C;  1RIO H;  4YIR X;  1TT0 A;  3J7A Y;  2COM A;  3M1E A;  3KE2 A;  3CC7 I;  2QYO A;  2R92 J;  1P4A A;  2KZG A;  2O8K A;  2IXS A;  5D4S A;  5E3L A;  5IT9 Z;  4ZJZ A;  5F6F A;  4BHC A;  5FKN A;  2AHQ A;  3WU1 B;  3BZK A;  4BDZ A;  4G94 A;  3UKG A;  2Y48 A;  3S1Q J;  3E5X A;  3JSP A;  5GP9 A;  1B9M A;  1FIA A;  1GUU A;  1MZB A;  2B7E A;  2K9Q A;  1IXR C;  4LFU A;  3V8J A;  2QEN A;  2BY1 A;  4YEL A;  3RTR A;  2M2E A;  1WSU A;  4BBS J;  4LLL A;  3WHB A;  1IRZ A;  1ZG3 A;  3K1P A;  3TMO A;  2STT A;  2F5V A;  3ESW B;  2X0L A;  2A69 F;  2H27 A;  2QUF A;  2OD5 A;  4I98 B;  3I4P A;  5M5W J;  2BGC A;  4JBA A;  2JZY A;  5EZG A;  2D1V A;  2D5V A;  2CW7 A;  4MHG A;  4QIW N;  3WTW C;  2CV2 A;  4GDF A;  1YW8 A;  5EJC A;  5H6R A;  2ZME C;  4A3E J;  3OSF A;  2QM3 A;  2RN7 A;  3E0J B;  5ERI A;  3C3W A;  2KHM A;  3PNT A;  2W82 A;  3PNV A;  5K7F A;  3LSP A;  1MMS A;  1XS9 A;  1XB4 A;  4Z2Y A;  4DNC A;  1XSD A;  4DW6 A;  2FX0 A;  1W4M A;  4PJJ A;  2M87 A;  2K7L A;  2L7M P;  2CV1 A;  3KET A;  4MEX F;  2GIZ A;  3GZ5 A;  3KZI C;  4Y3O A;  3HUG A;  1LDK B;  1O7L A;  3SYT A;  3A02 A;  4A6E A;  4WX9 A;  3BLY A;  3GTK J;  4AD9 A;  3G4S I;  4C2U A;  1LNW A;  2FJ1 A;  3QYB A;  4HNU A;  4Y13 A;  5D5V B;  3HIF A;  2Y75 A;  3U1D A;  3WTV C;  1K6Y A;  1SAN A;  3N97 A;  1ZGW A;  4IXA A;  1Z77 A;  3LSR A;  2XUB A;  3OV8 A;  1I5Z A;  4PDK A;  3ZCO A;  4ASN A;  3CZ6 A;  4XK4 A;  1UJ8 A;  3D5S C;  4FIS A;  4NB5 A;  1E2X A;  4A0Y A;  4Y52 J;  2F5F A;  2V9K A;  4LMY A;  1P7J A;  4NC6 A;  1U8B A;  4BAC A;  4U7D A;  3HUG B;  5IOY A;  4LG0 A;  2E71 A;  3VOE A;  5HLH A;  4XR6 A;  4CCO A;  3GYH X;  4EEF G;  2KMU A;  1YW9 A;  4MFD A;  3DKW A;  3DU5 A;  4S04 A;  2Z33 A;  1BW5 A;  2W4S A;  2JA7 J;  2ZME A;  2W48 A;  4HDV A;  2R7Q A;  1REP C;  4PSW A;  3CCE I;  1JXS A;  3R4K A;  5J47 A;  5LBQ A;  3C1D A;  4Q5S F;  3OR1 C;  3JRH A;  4N9H A;  3DPT A;  3TDZ C;  1XG1 A;  3RCO A;  5M5Y J;  4XBF A;  3OYH A;  3JSO A;  4G6T B;  3R6S A;  3OOP A;  4NUB A;  3P7N A;  5FFZ A;  3CO6 C;  1M1E B;  2DTZ A;  3BG9 A;  4OIN F;  4IQJ A;  3ABU A;  2IAI A;  2WV0 A;  2KDZ A;  4CO8 A;  3CJR B;  3TP3 A;  2JTV A;  3GTM J;  3C2B A;  2XV4 S;  1S29 A;  4G7Z F;  1NK2 P;  2P7C B;  3CF2 A;  3CJQ B;  4JQF A;  1D1B A;  1R22 A;  3MFK A;  1RR7 A;  2ZME B;  2VC0 A;  3BR0 A;  3KLN A;  3HJE A;  1X1D A;  2ICW G;  2E5Z A;  3A03 A;  3ZMS A;  1G8X A;  4C9Y A;  2PFB A;  1TTY A;  3FKI J;  1SVM A;  1VND A;  3QQA A;  3MKZ A;  3S16 J;  5J6X A;  1P4X A;  4U88 A;  1DQU A;  2PMH A;  4HSR A;  3ZXS A;  5HVQ C;  6PAX A;  4XRS A;  1YYV A;  3BTJ A;  3K1N A;  2XPW A;  1JTY A;  1HQC A;  3RPQ A;  2L02 A;  2XKP A;  5FFX A;  3E6D A;  4LGW A;  3D1N I;  2GA2 A;  1UMQ A;  1R1U A;  2M34 A;  1W7P A;  3BR2 A;  2M0C A;  3HRU A;  2NRA C;  2V4J C;  3BZ6 A;  2Q8K A;  1WFX A;  2BYV E;  2NVU B;  2X6Y A;  1H0M A;  3C18 A;  4C3H J;  2DBB A;  1BJZ A;  2W25 A;  4E7K A;  4I09 A;  2CQX A;  1FWZ A;  3BG5 A;  2MD0 A;  3BJA A;  3IHU A;  2ZFW A;  3HYI A;  3KZY A;  3LAJ A;  3CJN A;  2EQR A;  3FK7 A;  2MGQ A;  3OR2 C;  1N25 A;  1WJC A;  2NVX J;  2RC4 A;  1UCR A;  5DUK A;  3DP7 A;  3I0T A;  1NG7 A;  2F6C A;  1RRJ A;  2FOK A;  4L0Z B;  3ZQ7 A;  1VQ5 I;  1B1B A;  3EQL F;  4EJT A;  1X3U A;  1XSX A;  3W6K B;  3PL8 A;  3ZOB A;  1JKP C;  4L9N A;  4H0E A;  4NDL A;  2KIQ A;  5BNG A;  4ABZ A;  2DK8 A;  2LOO A;  3HOT A;  4ON0 A;  1QPI A;  2LY1 A;  3VEP A;  3DQV C;  3HXL A;  3M8J A;  1Z0X A;  3WG7 H;  2XAQ A;  4JP0 A;  1ZRF A;  3A2K A;  2AXT C;  1OCP A;  4DIQ A;  3CCS I;  1EH8 A;  4M73 A;  3JAM Z;  4QLC U;  3TW7 A;  3PUB A;  3I56 I;  2AO9 A;  1RUO A;  1X1C A;  2VT2 A;  3KZZ A;  1B59 A;  1FBQ A;  1HKS A;  4C3I J;  3CCM I;  3E1S A;  4ZYA A;  2CWE A;  2X1E A;  1IC8 A;  1OYY A;  1Z7U A;  1ON2 A;  3PO2 J;  1WJE A;  3RKW A;  2IGO A;  4M3G A;  4M9Z A;  4OAY A;  1LJ9 A;  1Y56 A;  3PUF A;  4IQ4 A;  2H6B A;  2CMP A;  3ZQC A;  5F27 A;  1FSE A;  1FPQ A;  4PZJ A;  4XL9 A;  4X6A J;  2ISZ A;  3I59 A;  1TWA J;  3QPL A;  4H4K C;  3J81 Z;  3LFU A;  1T0F C;  4NC7 A;  1BL0 A;  2I10 A;  2H8R A;  3S93 A;  2E60 A;  2GAU A;  1ITY A;  3CD6 I;  3MKY B;  2B9S A;  4B43 A;  2X6W A;  3EUA A;  3IKV A;  1ETQ A;  1A6I A;  3OYN A;  2KT0 A;  5LEJ A;  3REO A;  1IRX A;  3KEY A;  2J5O A;  1HDP A;  2X1C A;  1R5I D;  3ECH A;  4EMS A;  2WB1 A;  2KIU A;  2GXB A;  1FTT A;  5GTH C;  3LSH A;  4EJO A;  3P9C A;  4ETS A;  1R36 A;  1MIJ A;  3HHG A;  3VWB A;  5D6E A;  2ESH A;  2PI0 A;  1B6A A;  3OYD A;  4OMY A;  4QPO A;  4FQG A;  3T8R A;  5FLV A;  1JTX A;  2VPR A;  3FXO A;  2Z2S B;  1EH7 A;  2CQ7 A;  5DCM A;  1WJ5 A;  3F9K A;  1T39 A;  3GFM A;  1C0W A;  1PUF B;  5K5R A;  2HZT A;  3G1M A;  3OYJ A;  1AKH A;  1QPM A;  3ZQQ A;  2NXN B;  3I59 B;  1EA3 A;  1Z21 A;  4HAM A;  2GOM A;  1LEA A;  1DU0 A;  2L9N A;  5JVG F;  2E34 A;  1K7A A;  4MEY F;  1G3T A;  4FX4 A;  1T98 A;  3H35 A;  3HM5 A;  2FNA A;  2HWV A;  3O8G A;  1P7I A;  2MFZ A;  2X4H A;  4WK8 F;  2R7T A;  1P92 A;  2R7F A;  1BR2 A;  2P5K A;  3SJM A;  2VBW A;  1HSJ A;  5LGN A;  3JW4 A;  5FLM J;  5LHH A;  3MKL A;  2BEO A;  1QO0 D;  4BEH A;  2WY7 Q;  4BHP A;  1L3L A;  2WAQ A;  2XGD A;  4X1E A;  5J3L A;  1SAX A;  2XB5 A;  3NWS A;  2PJR B;  3AFH A;  4QWQ A;  2JRT A;  2DOA A;  1WCM J;  2QQA A;  1J09 A;  1KON A;  5D8K B;  1KQ8 A;  3U21 A;  1T0F A;  4KN7 X;  4PUS A;  5B5E C;  2EZK A;  3T8T A;  4B4C A;  5DCM B;  4I0A A;  4RMN A;  4ITV A;  3GTQ J;  2EIM H;  4E7S A;  4A3F J;  2H09 A;  3KP7 A;  1VQ7 I;  2V9V A;  3OYK A;  4BE1 A;  4S0H B;  2OQG A;  3TDU C;  1YIJ I;  1RC9 A;  2UWM A;  1WVR A;  4B09 A;  2XRL A;  4AID A;  3OYA A;  2HYJ A;  2JSP A;  2R7U A;  5C4J J;  1YX3 A;  2COB A;  2JRM A;  3HEF A;  4JX5 A;  4M9S A;  1JKQ C;  3WG9 A;  3TO6 A;  4GCV A;  3DBL B;  1QZY A;  1R5G A;  4PK4 A;  4RM3 A;  3ERM A;  1K4T A;  3MD2 A;  5JVT A;  2OTL I;  2W00 A;  3JRF A;  1ENH A;  5DD4 A;  1PVE A;  2JK3 A;  2N8G A;  3CCV I;  3CDL A;  3HRT A;  4A3K J;  3OY9 A;  4XM3 A;  1X2M A;  1O3Q A;  2BOL A;  2EZH A;  2XAG A;  3C2H A;  1HC8 A;  2IS2 A;  2DA6 A;  3UNG C;  1NHA A;  1R1T A;  1P2F A;  3A0B C;  3K69 A;  2Y9Y A;  4AU7 A;  4BXU A;  1R9T J;  3OS1 A;  2P5V A;  3OYE A;  3QU6 A;  1BOA A;  3V8K A;  1OYW A;  3G1L A;  3GTL J;  1ZKG A;  3S32 A;  2FXA A;  1X4O A;  3T5X A;  5D5W B;  1PJR A;  2G7H A;  4BHB A;  1DP7 P;  2KLO A;  2PX9 A;  4A93 J;  2EV0 A;  2DQR A;  3CMM A;  3S17 J;  2XF7 A;  2VQL A;  2XC7 A;  2LLK A;  2X48 A;  2NS0 A;  3R60 A;  4BNC A;  4HRI A;  4PFP A;  1ZH5 A;  1YRN A;  4JX6 A;  2Z3Y A;  2F5E A;  3ABT A;  2D45 A;  4IRH A;  1MND A;  3I54 A;  1ZG1 A;  1A35 A;  1WQ2 A;  1RET A;  5EEH A;  1EV7 A;  1D3Y A;  2ZO4 A;  3HSR A;  3HGG A;  1K61 A;  4EGZ A;  2PJP A;  2HFH A;  3BG6 A;  4II3 A;  3M1C A;  5CJ9 A;  2CUZ A;  1H8A C;  4IHY A;  5AON A;  2FOW A;  2HPI A;  3DXJ F;  5K5Q A;  1LFU P;  2VXD A;  2YX7 A;  5FLX K;  1GHC A;  3K4K A;  1MNM C;  4FAS D;  5JHF A;  2HQN A;  5BPD A;  1IAW A;  4A69 C;  3DKY A;  3OS0 A;  4F91 B;  4HF0 A;  2VBY A;  4YEJ A;  1AWC A;  1Z91 A;  4LD5 A;  3H5N A;  1YRN B;  3IC7 A;  4P9F A;  1I1S A;  9ANT A;  3A4C A;  3BOQ A;  4RLF A;  1JE8 A;  2HOE A;  3S3O A;  2ZCW A;  3MAJ A;  1UAA A;  2LF7 A;  3L2Q A;  2I5U A;  3PFI A;  3OSG A;  3ZGK A;  2HKX A;  1TT5 B;  2VKE A;  2WA0 A;  3FDY A;  1YX5 A;  1LUJ B;  1Z3X A;  2X51 A;  3FIS A;  2JMW A;  5BMZ A;  2E2I J;  4KYW A;  5GAD J;  3AL0 C;  2Y0M A;  3LWF A;  2LKP A;  4A2U A;  1FJL A;  3LSI A;  3L2R A;  2R7X A;  2LRE A;  2O8X A;  3FBI B;  3ABK H;  2DDB A;  2ELH A;  2ESN A;  2XAJ A;  1P9Q C;  4CXF A;  4UVC A;  5IP6 A;  3K7A J;  3Q9V A;  1O3R A;  2XSJ C;  1I50 J;  1OR7 C;  2K9S A;  3G2B A;  5ILS A;  1S9H A;  2IP2 A;  2IS6 A;  3F6V A;  2QEX I;  4UUV A;  3FK6 A;  1LB2 A;  4CZZ A;  1MSE C;  2JA8 J;  2VJ4 A;  5FJ8 J;  1ETW A;  2DA7 A;  3K4N A;  1Z1D A;  5IYB J;  1JT6 A;  5KVR A;  1T8I A;  3K2Z A;  1LVA A;  2STW A;  4BQN A;  1JGS A;  5CVV A;  4HV6 A;  1KYZ A;  3W3C A;  2BY2 A;  4RGR A;  5E20 A;  4BJ6 C;  4JX4 A;  2CH0 A;  3H9Q A;  4WF2 A;  4A3M J;  2GBY A;  4HX7 A;  2W1O A;  2G7U A;  3K0L A;  4F52 A;  5H6Q A;  4NC8 A;  4BU2 A;  2XB0 X;  1W36 D;  4HF1 A;  1VFC A;  2ACJ A;  4CCM A;  2M7B A;  2DJN A;  1XSV A;  2E2H J;  3LOC A;  4ZDP A;  2FBH A;  3U2R A;  4OIO F;  5JHU A;  4CYC A;  4ZTF A;  3E5U A;  1MD0 A;  1MMG A;  2E7X A;  4HPQ A;  1CQT A;  2HZD A;  5LD2 C;  4LOC A;  2OV7 A;  1HOM A;  2KP6 A;  1MH3 A;  5EEG A;  5F0C A;  3SZP A;  3CCQ I;  3H1C A;  2A3S A;  4KT5 C;  5B1A H;  5CKT A;  4B3X A;  2V1U A;  2EIJ H;  1IRG A;  2XAU A;  2YUS A;  3E6B A;  2MC3 A;  1OCC H;  5TRD A;  2HEO A;  5LLQ A;  1ZK8 A;  2IA0 A;  1X3Z B;  3OIO A;  1OR7 A;  3I71 A;  4A3J J;  1ERD A;  3NAU A;  4UNO A;  1JJ8 C;  2FSW A;  4GO1 A;  1GXP A;  3SHF A;  3CP8 A;  1S7E A;  1H9G A;  1QHG A;  2E19 A;  3GTO J;  4ZYH A;  3X2Q H;  4XLC A;  4ZYD A;  3PNY A;  5E3M A;  3HPH A;  4BXF A;  2RAE A;  1QVU A;  4CYC B;  3K4L A;  1Z05 A;  2CQK A;  1KYW A;  1XGO A;  1TNS A;  1YLF A;  2CUE A;  5E1W A;  4EM2 A;  1KQ0 A;  3E6M A;  5JI6 A;  5EEA A;  3WTX C;  2HOT A;  1D5V A;  3WHC A;  4DJA A;  5DD8 A;  2E35 A;  1PUE E;  4MLO A;  3VSL A;  1V55 H;  3AL0 B;  5LRR A;  2M4K A;  4IVN A;  1MMN A;  1E0E A;  2DT7 B;  2OUM A;  3OOU A;  3ZQI A;  1W0U A;  2M8E A;  2ZJQ F;  1FBU A;  2X6X A;  4HBL A;  1J2X A;  4E7H A;  4ESJ A;  3DPL C;  3LA7 A;  1AA7 A;  2E1M B;  3F8F A;  1U9O A;  1UG2 A;  1I6X A;  2GQQ A;  1WJD A;  1IUF A;  4N4N B;  3FX3 A;  4YFN F;  3BTI A;  2QBY A;  4BY1 J;  2Z1D A;  1YIO A;  3OIP A;  1IV6 A;  4P9U A;  4RAY A;  2QQ9 A;  1WH7 A;  3RZD J;  2IT0 A;  4DBQ A;  4HQM A;  5B66 C;  5K7H A;  1XCB A;  3CCU I;  2QSF X;  3FXK A;  5IPA A;  3FMR A;  3S3M A;  3IH3 A;  2ECB A;  5D5X B;  1PP7 U;  1F4K A;  5E8G A;  2ELJ A;  1D0X A;  5LHG A;  3JRI A;  4BE0 A;  2P6S A;  2JT1 A;  3AG4 H;  3MN2 A;  2JWT A;  3HOX J;  2H8W A;  4A3G J;  4M71 A;  3LQR A;  2UXX A;  4A0Z A;  1IZ1 A;  1ETK A;  1VQN I;  3PJR A;  4KT6 A;  1RKT A;  2BY3 A;  2CS3 A;  4A0X A;  2QBY B;  1I39 A;  3E7L A;  1PYV A;  4ZDL A;  1TQM A;  3CC4 I;  3QPH A;  2KPM A;  1U3E M;  2ZFU A;  1TBX A;  3ELK A;  5K1Y A;  2OF7 A;  4WWC A;  4RA2 A;  1UG0 A;  2HVR A;  1DGW Y;  2B0L A;  2XGC A;  5GTI C;  1KU3 A;  2W85 A;  4W97 A;  1V5G A;  2LBF B;  2DPD A;  3SFI A;  4UV8 A;  3O3K A;  2HXI A;  3KX2 A;  2XAF A;  3BJ6 A;  3CMA I;  4BJ5 C;  3H3V K;  4A3C J;  4F92 B;  3IRQ A;  5LGU A;  3DBR B;  3MEX A;  3OL4 A;  1T38 A;  3U1K A;  2NS8 A;  1B8I B;  4V2F A;  3IV5 A;  3JTG A;  4A5N A;  2R93 J;  2GLO A;  2CSO A;  3K10 A;  1MGT A;  2EA2 A;  1ON1 A;  3WOD F;  2EFP A;  4DYR A;  1JT0 A;  3OYB A;  1N75 A;  1P6R A;  3HZJ A;  4PJ0 C;  2HQR A;  3ZMU A;  1S8N A;  4M3E A;  1Y0U A;  5EF6 A;  1K6O A;  3OYL A;  5L3C A;  4XN0 A;  1OCT C;  5IOZ A;  4LB5 A;  1RNL A;  2LC2 A;  2OQR A;  3KP3 A;  2DO7 A;  3BPV A;  1MKM A;  5CVI A;  3OYC A;  4G6Q A;  1ODD A;  1FOY A;  2JQ7 A;  1DGR M;  5CQG A;  3GO5 A;  3O8H A;  4LJZ F;  1IJW C;  2M4G A;  4I99 C;  1T95 A;  5CLS A;  5HS9 A;  2DT5 A;  2ISY A;  1X3W B;  3OMY A;  2CQN A;  1ZG5 A;  1U9N A;  4OIQ F;  5KCM A;  2UZK A;  4M6Y A;  2IGM A;  2FA5 A;  2XKO A;  2L01 A;  4XSX F;  2QWW A;  1QGP A;  1OIS A;  2BHY A;  5J8C A;  1WWX A;  2IEK A;  2ZXW H;  3H5R A;  2Y31 A;  3M3Y J;  2LK2 A;  1YFH A;  2M0M A;  3ZMV A;  1MMA A;  1GT0 C;  1G4D A;  1JHH A;  4XOT A;  2Q0O A;  2OCE A;  4G9Y A;  3GLX A;  5E17 F;  1O57 A;  3IWF A;  3WU0 A;  4AYB A;  4KMU X;  2A6T A;  3RI4 A;  3J7Z I;  3F72 A;  2V1X A;  1FMW A;  3FIW A;  2WB1 N;  4HA8 A;  5ICC A;  3FHN A;  5IT9 K;  2A61 A;  5L3B A;  3CLQ A;  1Z6R A;  2TDX A;  3Q0V A;  3HOU J;  2V1D A;  3RPU A;  1GVJ A;  2R7D A;  1RZ4 A;  1EF4 A;  4D5C A;  2R7R A;  4V2G A;  2HYG D;  2MLG A;  5K7Z A;  4R8H A;  4GGG A;  5C44 J;  5E18 F;  5C4X J;  1SVL A;  3RQ4 A;  3JRB A;  5HNF A;  4XLA A;  2M8G X;  2HVS A;  3DWL E;  2WV1 A;  3SEQ A;  3V8L A;  3DEE A;  1U5T C;  2NYX A;  4DZJ A;  2M5W A;  1S7A A;  1JGG A;  2IJL A;  3HBL A;  3LMM A;  3MWM A;  3FXL A;  3V4G A;  4UB6 C;  2CO5 A;  3ERE D;  5J40 A;  1Q1H A;  1OLT A;  3KEQ A;  4F7Z A;  5BQT A;  1BI2 A;  2WAQ N;  3J7Y J;  5FKL A;  2R7S A;  4E7L A;  2QKL B;  4DYQ A;  2RGV A;  1USS A;  3RKX A;  2VOO A;  3CES A;  3CJT B;  2JN6 A;  2Q2E B;  3GVA A;  3GUD A;  3IUO A;  4IPA A;  5JLW A;  1PDN C;  3RZO J;  3TP0 A;  1KA8 A;  3TOB A;  4GFB A;  3S2H J;  3DEU A;  3DCF A;  1T2K A;  1MJA A;  2NOG A;  2KJC A;  2CGP A;  2F2E A;  2RVC A;  4UV9 A;  4EGY A;  1Y1W J;  3M8E A;  1FMV A;  4DYC A;  2VQH A;  2Y30 A;  2RQQ A;  1F43 A;  2NNN A;  4NHJ A;  2MYS A;  2FBK A;  2KIS A;  4BE2 A;  2L2O A;  2BXZ A;  2EBI A;  2RDP A;  5F08 A;  1YI2 I;  4CH7 A;  4ANJ A;  4PGH A;  4IHS A;  1GV5 A;  2IBD A;  3K4J A;  3BTL A;  3ECO A;  1ZQ3 P;  2DPU A;  1DDN A;  3ZQG A;  5ILV A;  3F8N A;  2A07 F;  2R7W A;  2JA2 A;  4BS9 A;  2W24 A;  4BXX J;  2DDA A;  3BQZ A;  2D1H A;  2XPV A;  2DA2 A;  4XKV A;  3Q9S A;  1U5T A;  2JPB A;  1RPW A;  2HKO A;  5ED4 A;  4IOC F;  2R3S A;  4KNY A;  3WE3 A;  3JR9 A;  3I4M J;  2EIL H;  3H5A A;  3F8B A;  2JVG A;  2LH9 A;  1ZRC A;  1IUY A;  4HF2 A;  2K4B A;  1LKX A;  1P4W A;  4G6D A;  5AIQ A;  2C6Y A;  2VON A;  2IRF G;  4N4O B;  4M3D A;  4EJW A;  5IT3 A;  2CQQ A;  3FZV A;  1EJ9 A;  1TZL A;  1ZRE A;  2FMY A;  4KMF A;  1UB9 A;  3TKY A;  2IS1 A;  1ZLJ A;  3B6A A;  2DMN A;  1ACI A;  4IO9 F;  2VUM J;  3LSJ A;  1BI1 A;  3NRV A;  4MNU A;  5TIS C;  4QTR A;  3GW2 A;  2GA1 A;  3KYD B;  1W36 C;  3BG3 A;  4OWR B;  2WC2 A;  3GFL A;  2M30 A;  4OIR F;  4HX8 A;  5M3M J;  2DI3 A;  2VQC A;  3PSI A;  3BR3 A;  3IH2 A;  1U5T B;  1PUF A;  4HLY A;  4XKB A;  3TO9 A;  4FE7 A;  4EV0 A;  1DP3 A;  4IHX A;  3FM5 A;  1W5T A;  2LRD A;  1TNT A;  4U0W A;  3OIQ A;  3CUO A;  1WI3 A;  3S14 J;  2EWN A;  2EA4 A;  1D1A A;  5HLI A;  2VN2 A;  4E7I A;  4LIV A;  4NNJ A;  5FGM A;  1HW1 A;  3RSN A;  5FRO A;  3QRF F;  1ETY A;  2L3D A;  5EYR A;  4YRV A;  4ENK A;  5CQE A;  1G59 A;  2F4O B;  2XRN A;  3BP8 A;  4OAZ A;  2GWR A;  2B63 J;  4M3B A;  5FKM A;  2FF4 A;  3ZQF A;  4L18 B;  3ULQ B;  3K70 C;  4CA0 A;  4XSZ F;  1MBG A;  4KA4 A;  2ID6 A;  2PJR A;  5C3E J;  4AIH A;  3AKZ A;  3LNQ A;  1A36 A;  4ZZD A;  1S7O A;  2K3F A;  1R6R A;  4OIP F;  5M3F J;  1RKW A;  4BKX A;  1MSF C;  3NWT A;  2O9L A;  1GLN A;  5FRM A;  2HR3 A;  4J00 A;  1E3O C;  5L3G A;  1R1V A;  3LSK A;  3M9A A;  5EG0 A;  5FKK A;  2A05 A;  2K3P A;  2GXG A;  4ZYG A;  3FBN B;  2K86 A;  3R0A A;  3CCL I;  4XON A;  4R1H A;  1BR1 A;  2OZU A;  4B48 A;  3RPU D;  1SFO J;  2MAB A;  5GPA A;  3MZ8 A;  3AG2 H;  1OCO H;  3GTJ J;  3TOA A;  4CCL A;  4E70 A;  1LEB A;  5BS6 A;  3M4O J;  1A04 A;  3QAH A;  1L0O C;  3IH4 A;  2YU3 A;  2KIF A;  4RAF A;  1XDU A;  1TW3 A;  2WBM A;  4RGS A;  4BY7 J;  4PFO A;  5HDN A;  4P1W A;  2J5P A;  1QQI A;  4F93 B;  3BR1 A;  1HDD C;  5F1R A;  3SDB A;  1YIT I;  4RM2 A;  1U2W A;  3JRD A;  1WHU A;  3GWZ A;  1SMT A;  2EFN A;  3H3U A;  2KIM A;  2QQ8 A;  2QGU A;  5EG0 B;  3FMQ A;  5J1R A;  3GF2 A;  4L9V A;  3JAM K;  2BVL A;  1OCZ H;  3L00 A;  1UFM A;  3SEZ A;  5HLG A;  3ZMT A;  1Z7L A;  2H1K A;  3CO7 C;  2D2W A;  3I58 A;  3V7S A;  1YE9 A;  2LVS A;  2ZJR F;  4P55 A;  3WGH A;  4KN4 X;  2LY9 A;  5BOX A;  1WJB A;  4RB0 A;  1VQP I;  3JTH A;  2ZB9 A;  2ELK A;  1XGN A;  1Z6T A;  3J81 K;  1FBS A;  2BZT A;  2OA4 A;  1E3P A;  2ZKZ A;  4PGG A;  2BY0 A;  2VBX A;  2VJJ A;  1FP1 D;  4YFK F;  3RIR A;  5IY5 H;  3A0H C;  2DFF A;  3S8P A;  3FXJ A;  2DMT A;  4MGR A;  4A3L J;  2DOE A;  1ZHF A;  3D5L A;  3CF5 F;  1IDY A;  2BW3 A;  3ML6 A;  3CLO A;  1GV2 A;  2HTS A;  3Q5F A;  3IRR A;  1FLI A;  1E3H A;  4P96 A;  4CCJ A;  3RDI A;  3HKZ A;  4LIT A;  3MZY A;  4DQ2 A;  3HOV J;  4B3A A;  1G3W A;  2YX4 A;  3TW6 A;  1S3J A;  3QOD A;  3JRE A;  4ZC3 A;  1HW5 A;  3HTS B;  1A31 A;  4NQW B;  4CCK A;  5CYV A;  2NS7 A;  2O0Y A;  4M72 A;  3LQQ A;  4M6V A;  2OJE D;  4Y17 A;  3V42 A;  5KHD A;  2JPC A;  3ZMD A;  1BBY A;  1N78 A;  2JJ7 A;  2VI6 A;  1VQ4 I;  4J19 A;  5HNH A;  1ONV A;  4R79 A;  2OPT A;  1OKR A;  1D0Y A;  3VYS B;  1D5Y A;  2CV0 A;  4B47 A;  2CUJ A;  3TED A;  4LLN A;  1LFP A;  2BW3 B;  4LK0 F;  3K4C A;  5IP9 J;  3AG3 H;  3K1M A;  4TV7 A;  2P4W A;  4L5I A;  2ME0 A;  2VOP A;  1WZ2 A;  2VIX A;  3H0G J;  2Q1Z B;  4EJV A;  1F36 A;  1ZEL A;  3S1M J;  2XGX A;  1FSH A;  1CF7 A;  3WTT C;  3EYY A;  4E6K G;  4ZYE A;  1B9N A;  2XPU A;  3I55 I;  1XCV A;  3WE2 A;  5IP7 J;  3QOP A;  3JCU C;  4IX7 A;  4I6Z A;  1VQ6 I;  1MH4 A;  4XLF A;  4A3D J;  3S3N A;  2LY2 A;  3RYR A;  1VF9 A;  2H94 A;  3I3L A;  2X6O A;  3CTA A;  1RES A;  5JFR A;  3DBH B;  2EPF A;  3J80 K;  2OC6 A;  1SEU A;  3I53 A;  2UV1 A;  1KU9 A;  1LE8 B;  3RJP A;  2P5L C;  1IG7 A;  3HSE A;  3SZG A;  1EKE A;  2W7N A;  2IVM A;  4PSX A;  4UUT A;  5D6F A;  1VZ0 A;  4N0B A;  2UUZ A;  3OYI A;  1D1C A;  1I3Q J;  2E1M C;  4UHT A;  4ESF A;  5LGT A;  3K4B A;  4E4H A;  1KU2 A;  1SAU A;  2VT3 A;  2A6H F;  1WGX A;  4RS8 A;  1CF7 B;  3QYF A;  3RKY A;  2YPR A;  5FD5 A;  3DTK A;  2KKO A;  2HTJ A;  3DEW A;  3VDX A;  4CCN A;  4M6X A;  5DDG A;  3CUQ C;  3LL7 A;  1R4M B;  4KIC A;  4B8X A;  4HW0 A;  3GXO A;  3WTU C;  3D0S A;  2OTJ I;  4D0P A;  5A2Q Z;  2WY8 Q;  5DV5 A;  2FQ3 A;  4XRS G;  4IKF A;  1BJA A;  2MG4 A;  2P6T A;  2VKD A;  4G8X A;  1RR8 C;  4O6J A;  3MKW B;  1AU7 A;  3CC2 I;  4IRI A;  1IN7 A;  3HG9 A;  5HOO A;  4N9I A;  3VYR B;  2DN0 A;  2PN6 A;  3LA2 A;  1D0Z A;  3KYL A;  3HTU A;  1HW2 A;  5M5X J;  2XVC A;  2YS9 A;  1R00 A;  2Y9Z A;  1TW2 A;  1QZZ A;  3G6E I;  2DT6 A;  2O5R A;  4M74 A;  1PP8 F;  2JSC A;  1FYM A;  3MZH A;  2FE3 A;  1MBK A;  2MLK A;  1NTC A;  1SD4 A;  3RYP A;  4HOB A;  2XRO A;  1R58 A;  4D1Q A;  1Y6I A;  4FX0 A;  1Z3Y A;  5F1J A;  1TLH B;  3HRS A;  3M7G A;  3CCR I;  1MJB A;  2ZNY A;  2L7Z A;  1YJ9 I;  2BXY A;  1ZGA A;  2XF6 A;  2Y2Z A;  3NAR A;  2Z5U A;  3ABL H;  3KP2 A;  3GFI A;  3AG1 H;  2I8D A;  5FD6 A;  3A1Y A;  2IGN A;  4RGX A;  5EGO A;  3CQZ J;  1IN4 A;  4OU0 A;  2LR8 A;  1EH6 A;  3K70 D;  3JRG A;  2DYR H;  4YG2 F;  3SZT A;  4L9J A;  4FHT A;  5FO5 A;  2R0Q C;  1VQK I;  4XLH A;  3COA C;  4XN3 A;  1OJL A;  1I1G A;  2KL4 A;  4FTH A;  3ZP5 A;  4O3M A;  1V5F A;  2AQF A;  1R23 A;  3CUQ A;  4LK1 F;  3KP4 A;  1R4N B;  2JUC A;  2HI3 A;  2HYF A;  3DF8 A;  3L7W A;  1YTY A;  1FYL A;  2PQ8 A;  5HS8 A;  1U6G A;  3PFY A;  2L9R A;  4AYB N;  3WU2 C;  2IGK A;  3L09 A;  4RAZ A;  2GM4 A;  4G7H F;  3ZPL A;  3I9V 2;  2R5Z B;  4YIF A;  3DLA A;  1JJ6 C;  2X9D A;  5EGO B;  2FEZ A;  1IN6 A;  1ZR4 A;  3O6B B;  2GIV A;  2HGC A;  4YFX F;  2VKH A;  2R7Z J;  2CFX A;  4ZH4 F;  4AM3 A;  4W1U A;  2P0W A;  2QZ8 A;  4O5V A;  4ZZL A;  1J9I A;  2HQA A;  3KIO A;  1MBF A;  3V7R A;  3KYC B;  5CVR A;  3A01 A;  3C2G A;  4XLE A;  2EV5 A;  2E1N A;  2M3A A;  1MMD A;  1Y0N A;  3B73 A;  3MQ0 A;  4I0B A;  3CUQ B;  1UZC A;  1D8J A;  1N77 A;  4BQQ A;  1XPX A;  3WGI A;  4IL6 C;  4BAY A;  4ENJ A;  4Y7N J;  2KRC A;  4AC0 A;  2DA5 A;  1BM9 A;  3BCB A;  2Z9O A;  5ICG A;  1V4R A;  4PJL A;  5JLX A;  4ENM A;  2NVQ J;  2HPM A;  1LDJ A;  2DJI A;  3T0Y A;  2LBF A;  4HYE A;  2WWY A;  4B44 A;  4Y4R A;  2IPQ X;  4C3J J;  2NVT J;  1YQA A;  4YII A;  1T08 B;  1FNN A;  3F3X A;  3P9I A;  1UHM A;  4WXH A;  1B8I A;  1FIP A;  2QVO A;  4UUS B;  3A01 B;  3OWT A;  4CDG A;  2K02 A;  2DMP A;  1YG2 A;  5DUI A;  1JKR C;  2DFE A;  2Y69 H;  3BZC A;  1RI7 A;  2ME6 A;  3LST A;  4P5O A;  4E7Z A;  2VOD A;  4Q47 A;  2RRE A;  3QPT A;  1S6L A;  2L4A A;  1R49 A;  2V7F A;  2WAE A;  1Y1V J;  2MH2 A;  3LA3 A;  5GPC A;  4S05 A;  1I6H J;  1STZ A;  1V54 H;  1TL8 A;  2F4I A;  3BC8 A;  1IV8 A;  2FQ4 A;  3DV8 A;  1FOW A;  3PM1 A;  1YW7 A;  4CIC A;  4C2M J;  5IYD J;  4F55 A;  1DPR A;  5DTD A;  2ZXI A;  5DEQ A;  3GTP J;  1UHW A;  2CUF A;  2VE8 A;  3TO7 A;  3KEO A;  2ZNZ A;  3F0C A;  2V9P A;  3MMY B;  3VB2 A;  4IHT A;  3BDD A;  3Q0W A;  3BTC A;  2E36 A;  3HOS A;  2O3F A;  3M8F A;  3MVP A;  3HOZ J;  2P8T A;  4HST A;  5HDG A;  3DU6 A;  4RB3 C;  5L3E A;  2KDO A;  1ORK A;  2PEX A;  1ZAR A;  3GZ6 A;  2DYS H;  2L9S A;  3DKX A;  3JRA A;  1NK3 P;  1OYI A;  1V5E A;  1HXD A;  1SMY F;  3GZN B;  3FM3 A;  4BL0 B;  1QZE A;  2QF7 A;  2YSR A;  4Y33 A;  1MDM A;  5GAE J;  2K5C A;  5KK1 A;  4HG2 A;  3CMY A;  4C2T A;  2M9H A;  1J0R A;  1WPK A;  2Y0S A;  1T56 A;  3BR6 A;  4ZTJ A;  4A3B J;  1WJA A;  3H3Z A;  2HVQ A;  3W6J B;  5TGT A;  4AVZ A;  1HLV A;  1ZYR F;  5DCF A;  1T33 A;  2E5N A;  4AIK A;  3K6G A;  4L5E A;  1ZN2 A;  1A5J A;  5KAF C;  1O3T A;  1NG6 A;  4DBR A;  4D7M A;  1IXS B;  1H88 C;  1W1W E;  3KPH A;  2F48 A;  3IAM 2;  1T6S A;  4HNV A;  2KRH A;  2CW8 A;  1SFX A;  1XGS A;  2PMZ A;  3I4N J;  4IHV A;  3P9K A;  4GYI A;  1WKM A;  1LVK A;  3SXY A;  4XLP F;  5L3D A;  2VJ5 A;  3BPX A;  1HBX G;  1SC7 A;  2VJI A;  4MTD A;  1MDM B;  3CDH A;  4V19 K;  1FTZ A;  1BA5 A;  4XRM A;  3FWE A;  2FML A;  1DUX C;  2LP0 A;  4WCG A;  3MCZ A;  2E1C A;  3H9J A;  5DM6 F;  1X1B A;  1SD7 A;  2Q2E A;  3ROU A;  1IXC A;  3EDP A;  4BQO A;  2LNB A;  2QSG X;  1VQ9 I;  1KZH A;  3HRM A;  3VOD A;  3OYF A;  1VTN C;  4ENN A;  1Y8R B;  3EET A;  3NEU A;  2KRF A;  4BYY A;  3W2A A;  4EJU A;  4UB8 C;  2CFO A;  2VAS A;  1S5L C;  1ZR2 A;  2K9N A;  4IRG A;  1WRJ A;  1GDT A;  5E79 C;  1IRF A;  3GEZ A;  4KIG A;  3VSK A;  2DAO A;  2JVH A;  4KIT B;  2HQ5 A;  1K4S A;  1XN7 A;  1E17 A;  1G3Y A;  2ID3 A;  1ZTR A;  1BR4 A;  1RUN A;  4KDP A;  2GZW A;  4D7N A;  1TQP A;  3ZR8 X;  4HQE A;  3B02 A;  4JK1 X;  3V7C A;  4JYK A;  2OCC H;  1O3S A;  5J1Y A;  2LYC A;  2BBY A;  1BW6 A;  4ESB A;  3HB9 A;  3CCJ I;  4U0Y A;  2ZXJ A;  5FB2 A;  1W0T A;  5LRS A;  1SFE A;  4DOZ A;  3VPR A;  2M7A A;  4LG0 B;  4XIC A;  3GLL A;  5B3S H;  2DOF A;  3VFZ A;  3H92 A;  4HV5 A;  5D8L B;  2HS5 A;  1U8R A;  1VQO I;  1QHH D;  1XD7 A;  3CCY A;  3DPU A;  2NOJ B;  2WAD A;  1HKQ A;  3HOW J;  2ZXH A;  4UY8 I;  1SD5 A;  2DOD A;  2V26 A;  4AIJ A;  5E3O A;  3ONQ A;  2VL8 A;  2W57 A;  4MQV A;  2CRG A;  4RGU A;  2HOS A;  2VPL A;  3VYU B;  4KUM A;  4E7J A;  2QSH X;  1HA8 A;  2HDD A;  3KLO A;  4Y15 A;  4EM0 B;  1J5Y A;  2UXN A;  3B6C A;  3S1R J;  1G2H A;  5L3F A;  1MNE A;  1X1A A;  3S1N J;  4A6D A;  3E5Q A;  1ZAO A;  2RKH A;  3FHZ A;  1MBJ A;  2DLL A;  2VC1 A;  2HU9 A;  3NQO A;  3PQJ A;  2CYY A;  5DS9 A;  4JOM A;  4J01 A;  1YJN I;  3DFG A;  1FZP B;  2EIN H;  2FD5 A;  3K4M A;  5FKO A;  2HDC A;  5HDK A;  4CYD A;  3L9F A;  2HXO A;  4U0V A;  5AIP A;  3QU3 A;  2OZ6 A;  4CSW A;  3G73 A;  4IF4 A;  1ETV A;  4UXN A;  3ZQL A;  4A12 A;  1GVD A;  3J7A O;  4K2E A;  2F4M B;  1FT9 A;  2V6E A;  5HLT A;  1KU7 A;  4I7H A;  3QP6 A;  5D5U B;  1YHQ I;  2DFH A;  1IDZ A;  1HCR A;  2ADU A;  1A6Q A;  3HKZ N;  4BGD A;  2M1B A;  1SVO A;  3SFZ A;  2MBF A;  4MO7 A;  1W7P B;  1X19 A;  2FBI A;  2F5C A;  3C7J A;  2PMU A;  2EV6 A;  3TBI A;  3QPS A;  5E8I A;  5F64 A;  2QLZ A;  3U9G A;  3F8M A;  2K4J A;  1J59 A;  2ZSI B;  1JI8 A;  2K27 A;  1QA6 A;  4EM1 A;  2L7K A;  3P5J A;  4M9X A;  3OL3 A;  3BG7 A;  4MIM A;  1LFB A;  4CGZ A;  2RNG A;  2OU2 A;  3GBG A;  4L0Y B;  2DCE A;  2G0E A;  2DU9 A;  1SFU A;  4AUX A;  3ZRG A;  3I5U A;  4M3F A;  5EDN A;  5DYM A;  1I3A A;  5LFA A;  1IF1 A;  4HZF A;  2LDU A;  2RQP A;  4EQQ A;  2LF8 A;  1SFK A;  1TQI A;  1XDS A;  2H1L A;  2OAZ A;  1U0J A;  4MFE A;  5ICF A;  4GRI A;  2VQG A;  5GAG J;  3K2A A;  5CVJ A;  2VKV A;  3WGG A;  1VQ8 I;  2QCO A;  4XLN F;  2EB7 A;  5DM7 F;  4MQ9 F;  3VYT B;  3H36 A;  4RBO A;  1TWH J;  5FRN A;  2EFW A;  2DA4 A;  3BR5 A;  1GXQ A;  1H9T A;  4LIU A;  4XMY A;  2L9V A;  2L4M A;  4L9T A;  1UEL B;  5F0F A;  5GAH J;  3G71 I;  3QP5 A;  1LPQ A;  3PO3 J;  2AXL A;  1HF0 A;  3L2V A;  4RAG A;  1UST A;  1ETO A;  1POG A;  4XOP A;  2K85 A;  5E3N A;  2YR2 A;  4UVB A;  1Z67 A;  4GXO A;  4C30 A;  1FOK A;  1BIB A;  3QWL A;  2CW0 F;  2QQB A;  3FXR A;  4PJN A;  4QSH A;  3GTG J;  2ZJP F;  1W5S A; 
#chains in the Genus database with same CATH homology
 1VQM I;  3J7Z I;  1HC8 A;  3CD6 I;  2H8W A;  1ACI A;  4IO9 F;  1VQN I;  4IOA F;  1YJN I;  2ZJR F;  1YJW I;  3CC4 I;  1MMS A;  1VQP I;  2OTJ I;  3CCQ I;  4V19 K;  3CC2 I;  1YHQ I;  2NXN B;  5JVG F;  2E34 A;  3CF5 F;  1Y39 A;  3CMA I;  5DM6 F;  2FOW A;  3J7Y J;  3G6E I;  3G4S I;  1VQ9 I;  1S72 I;  3CJT B;  1QA6 A;  3DLL F;  2K3F A;  3CCR I;  1YJ9 I;  1VQ5 I;  1VQ4 I;  2E35 A;  1FOW A;  1FOY A;  2JQ7 A;  3CCL I;  3CME I;  1VQ7 I;  3CCJ I;  5GAD J;  5GAG J;  1VQK I;  2ZJQ F;  1VQ8 I;  3CC7 I;  1YIJ I;  5DM7 F;  3CCS I;  1YI2 I;  3CCE I;  2E36 A;  3I55 I;  3I56 I;  1FOX A;  5GAH J;  3G71 I;  1VQO I;  1VQ6 I;  2QA4 I;  2QEX I;  3CCM I;  4UY8 I;  1YIT I;  4IOC F;  2OTL I;  3PIP F;  1VQL I;  3CCU I;  3CCV I;  3PIO F;  5GAE J;  2ZJP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...