3CCEI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cceI00
5GAHJ 1VQPI 1QA6A 3CCUI 1YITI 3CCEI 1VQ9I 3G71I 2ZJQF 1YHQI 3CCRI 1VQMI 2E35A 1VQ7I 4IOAF 4IOCF 1VQ6I 5DM6F 3CCLI 4V19K 1HC8A 3CMAI 3CCQI 1YJWI 1VQOI 3I55I 1VQLI 2H8WA 2QEXI 3CJTB 4UY8I 5DM7F 1VQ4I 1FOWA 2ZJPF 3J7YJ 1FOYA 1YIJI 3CC2I 2K3FA 3CC4I 2QA4I 1VQ8I 1ACIA 1YJNI 2E34A 2FOWA 3CCMI 2OTLI 5GADJ 3CCJI 3CCVI 3PIOF 2ZJRF 3DLLF 3J7ZI 3CC7I 2E36A 3G4SI 4IO9F 3CF5F 5JVGF 2JQ7A 3I56I 3CMEI 1YI2I 1Y39A 5GAGJ 2NXNB 1YJ9I 3PIPF 1FOXA 1VQKI 3CD6I 3CCSI 5GAEJ 3G6EI 1MMSA 1S72I 2OTJI 1VQ5I 1VQNI
chains in the Genus database with same CATH superfamily
2TDXA 5GAHJ 2HGCA 4PSXA 1UMQA 2OA4A 1TWFJ 1TBXA 1ZHFA 2L01A 3IRRA 4HOBA 1L0OC 1YO5C 1BBYA 1LE8A 4DOZA 2EJRA 3H0GJ 1B9MA 1GV5A 2MBFA 1FSHA 2CFXA 3AL0C 1T6SA 3KP6A 3K0LA 5ILVA 1QNTA 5K1YA 4KMUX 2ZMEA 2L02A 1XG1A 2E35A 4HX7A 4BHCA 4NB5A 1WVRA 3KP2A 5J1YA 3W2WA 2CQ7A 2M2EA 2DA3A 4IOCF 3GZ5A 1LB2A 2VC1A 4J00A 3BG3A 3H9GA 4CYCA 1XTAA 1O3SA 3MQ0A 3GUDA 2XHKA 2E1CA 2G9WA 1QHHD 3QQAA 1OYWA 2ECBA 4FASD 5KVRA 2XVCA 2O03A 3MN2A 3S3OA 3OIQA 1Z6RA 3HSEA 4CCLA 2IGNA 4Y4RA 1BA5A 2M9HA 2R5ZA 1FJLA 2VN2A 1ON2A 1D0ZA 3H3ZA 2H27A 3LSJA 4HA8A 1VQ8I 3K1NA 4LOCA 4BUPA 1ACIA 3U9GA 4DYRA 1YX5A 2LG4A 3SZGA 3PFYA 3CJQB 4IL6C 4Q4ZF 2LYCA 1JJ6C 5DS9A 3PJRA 1IN4A 2K86A 4XN0A 2O8XA 4IJAA 3FBIB 5FKLA 4PFOA 1L3LA 3S93A 3A02A 1TNSA 2OV7A 2OCCH 1QZYA 2VQCA 4XSZF 3VPRA 1F43A 2OU2A 4IF4A 3ZQIA 1KONA 3C7JA 1WI9A 2OZUA 1U78A 1R1TA 4HDUA 4F92B 2R7DA 4RB2C 5BNGA 5JVTA 4YIRX 2VJ5A 1FNNA 1YYVA 2XSDC 5CVUA 2F4MB 3MFKA 5FKMA 3VB2A 1LDDA 1BIAA 4YRVA 1VQKI 4KIBA 5FD5A 2H1LA 5GAEJ 3K4JA 1W4MA 3CLQA 2CUEA 3F72A 2PJRB 3I58A 2BY1A 4A3FJ 1K6YA 5E8GA 5IY5H 1SFEA 5HLIA 1NTCA 1E3OC 2FMYA 3BG9A 3O6BB 3RKWA 5CVVA 4A12A 3LSPA 3KYDB 5CVIA 5K5OA 4PK4A 4Y52J 2KRCA 2Z16A 2IXSA 4JX5A 3W6JB 3JCUC 3HSFA 3V7SA 1X19A 3F23A 2NNNA 2IS6A 2ZFWA 3G71I 4G8XA 1T08B 3IUOA 4R8HA 2HVSA 4A3DJ 2B0LA 4A0ZA 3BR5A 4Q47A 4UUSA 1UG0A 2EWNA 2P5KA 5H20A 2F5VA 1FTTA 1FMVA 1QRYA 3QP5A 4RMNA 5DM6F 5E1WA 3ABMH 3OV8A 1H9GA 3WE3A 1BL0A 2PFBA 3O3KA 3D5SC 2UXNA 2XGDA 1A31A 2WBMA 3S1RJ 2VIXA 3I4NJ 1ZYRF 3SHFA 1OCPA 3V7CA 5FD6A 1R7JA 3E1SA 1Z6TA 3CJTB 1ULYA 2DYRH 1F36A 3SEQA 4IQ4A 2XDVA 4HBLA 4II2A 3HEFA 4Y3OA 1RIOH 1K61A 2F5CA 5KAIC 3PSFA 3CC2I 2DT7B 2VT3A 2Y30A 2VJ4A 3BTJA 2O3FA 3HOUJ 1OCOH 3BJ6A 5B5EC 3M3YJ 3F21A 2ME0A 1F4KA 2HYJA 2OC6A 4XLHA 4XRFA 2KIUA 3M8EA 5LLQA 2W85A 4I0AA 3ZQGA 4WXCA 1R5GA 3WTXC 4UV8A 1TQMA 4BEHB 3TO6A 3PIOF 3BR6A 2M30A 4A3JJ 4XM3A 3DLLF 2R3SA 4ETSA 2K3PA 1VFCA 2H94A 3ABTA 3RZDJ 1BW5A 3CF5F 4DBRA 3JRFA 2DOAA 1QZEA 4CICA 3HB9A 4ZZDA 3DTIA 1HA8A 2ZXIA 2HZDA 3FXJA 3L2VA 3SQNA 4A5MA 2GQQA 3BPXA 4PGGA 3F8BA 2R7UA 2FQ4A 3A03A 4HX8A 2EIJH 2QKMB 4LG0B 1HDDC 4WXDA 2HQ5A 1IDZA 3G6EI 2EPFA 2Y31A 3QWLA 3TDZC 4YIIA 4NQWB 2BV6A 2YS9A 4N4NB 3CMMA 3S2DJ 4ZTJA 2W25A 1EH8A 3F3XA 1ETVA 2VKVA 2IAIA 3ZP5A 2JZYA 2ZO4A 2A05A 5F6FA 2EINH 4KUMA 4L9NA 3D1NI 3OYAA 4LLGF 4IQJA 3EDPA 3WU0A 3OSGA 4I2OA 2HWVA 1S7AA 5EGOB 3R6SA 1BI2A 4AIJA 1CF7B 3TDUC 2Q2EA 1ZGJA 2G7HA 4M73A 3OOUA 1DPUA 3W2VA 1NG6A 2LBFA 1IV6A 1LDJA 1MZBA 4D0PA 1FT9A 1U5TB 2PMZA 3ZRGA 1J59A 1V54H 2CQQA 5CQGA 3K4KA 4LFUA 2OJED 2R93J 5FRMA 5DD8A 3Q0WA 1Y6IA 4CDGA 4EM0B 5E20A 2CRGA 1H0MA 4MNUA 1POGA 1DDNA 1A5JA 4XLFA 1VQLI 4UVCA 2IW5A 4S0HB 2E2IJ 1I50J 1Y1WJ 1SVOA 1OJLA 3CP8A 3F9KA 3FXUA 2ZJPF 2PI0A 2EFQA 4BHBA 1ZQ3P 4B48A 3ZQ7A 1R49A 1IRZA 4BY1J 3RTRA 4KIGA 3L2QA 2Y2ZA 3QPTA 5LHHA 1BOBA 4J19A 4E7LA 1G3SA 1YJNI 5J8FA 2R92J 2L2OA 3EUHA 1LKXA 2OQRA 1IN8A 4PJNA 5GADJ 3Q5FA 1OCTC 3F22A 3DTKA 4M6XA 2F4OB 1PDNC 4KJZA 3E5UA 3CCJI 2KDOA 1HKTA 3DTEA 2WB1N 4OU0A 1V3FA 2JT1A 4I76A 5J3LA 4Z2YA 3CC7I 1WGXA 4HV6A 4HZFA 1D1CA 2LC2A 5ILUA 5IT3A 1DPRA 2Z99A 1M1EB 2VQLA 3I4PA 2IEKA 2IA1A 1RETA 2MA3A 3WTTC 2L7FP 4KMFA 5IT9Z 2HYGD 4ENMA 3CMEI 4A3IJ 1FWZA 5D8LB 2VODA 1JXSA 3HJEA 1QVUA 1JKOC 2P5VA 1YS7A 4U88A 3OYIA 3NEUA 3FXRA 2X6WA 4QPOA 1MMSA 1JT0A 3AFHA 4WX9A 4E7HA 1MDMA 3JRGA 1X1CA 3VWBA 4B4CA 1WJ5A 3ZQQA 4LK0F 3T1BA 3CESA 4A6EA 1MMGA 3A4CA 3IP4B 3ZQFA 1IO2A 1B59A 1RC9A 5J1UA 4YIFA 4A3KJ 3BROA 1XSDA 3M07A 3ONQA 3LQQA 1U5TC 1Z9CA 1VQ9I 4GFBA 1B8IA 2EV0A 2WA0A 4CH7A 3Q3SA 2FU4A 4XOTA 1J0RA 1I3AA 1X3WB 2E7WA 2KLOA 3HGGA 4I01A 2NYXA 3G3ZA 1SFXA 4B1RA 2O8KA 2JPBA 5C4JJ 3BTCA 1T8IA 1X2MA 2XPVA 1V55H 5CQEA 2R0QC 5BQTA 2YSRA 2RNJA 1D5VA 2IRFG 2P0WA 1IRXA 4EATA 2QQ8A 2DI3A 2M8EA 2MFZA 5ICEA 1XCVA 2DOEA 2X51A 3K6GA 4NBQA 5BMZA 1IG7A 3DXJF 1S6LA 2R7XA 3RQIA 4PJJA 1IN6A 2OQGA 5K5RA 2KT0A 3SFZA 3MD2A 1XGSA 5B66C 3OY9A 3CUQA 9ANTA 2LVSA 3C2BA 3CMYA 3CC4I 1G6NA 3F6VA 1WRJA 5LRSA 2BZTA 2KPMA 1RR7A 3MEXA 4M3FA 4EQQA 5FLVA 2CH0A 2W1OA 1G2HA 3DFGA 1P2FA 5FROA 1JTYA 3L00A 2HXOA 3AG2H 1EA3A 4O6JA 2K4BA 4YFXF 1B1BA 3GYHX 2PX9A 2M1BA 3FK7A 5LFAA 2LP0A 2L0KA 2Q1ZB 3CCVI 2IS1A 3FMRA 1W0UA 3KP5A 2CQKA 1R58A 3FZVA 2E36A 2VB6A 2R5YA 3HL2A 4LGWA 3RKQA 1B9NA 3REOA 1HF0A 3L9FA 1WWXA 2KFDA 3LWFA 4XKWA 5BOXA 3OL3A 5F04A 2ESNA 3LSKA 5TJJA 1HXDA 1HW5A 2M34A 3HBLA 3KEYA 1GVJA 1ODDA 2VXZA 5GAGJ 5EG0B 4MEXF 3DCFA 5F1RA 1B72B 1JUSA 4RGSA 3J81Z 3RJPA 2EIKH 4IXAA 3K70D 2V1XA 2GAUA 2GA2A 4RS8A 3E6MA 3HUGA 4PUSA 5D8KB 3HRSA 5IYCJ 1TNTA 1W36D 4WK8F 2ELKA 3KYCB 1ERDA 2HVQA 1HSTA 4G7OF 3TO9A 1T98A 4M6YA 1DQUA 3MKWB 3H3UA 2NOGA 2XAUA 5DCFA 2MD0A 2ELHA 2FXAA 3WTWC 3DKWA 1GDTA 2BOLA 3K1PA 4C2TA 3F8CA 1UHWA 4QLCU 1IW7F 4BKXA 5E3NA 3ZR8X 4MTEA 5ICGA 4QWQA 4E70A 5LGTA 2Z9OA 2MG4A 4OMZA 4NC8A 2CW0F 5HS7A 5EEHA 2NRAC 2ESHA 1WPKA 2H6BA 5J6XA 2HS5A 2LR8A 4BJ5C 5DDGA 2RAEA 3HG9A 3V4GA 5D6FA 3CCLI 1OYIA 5KAFC 2HEOA 1HC8A 2NS7A 5E3MA 1TQIA 2Z33A 2QSFX 1FPQA 2JJ7A 3NWSA 4M3BA 1HW2A 2IS2A 2JVGA 2YX4A 1VQOI 4KITB 1MIJA 4JQFA 2Z3YA 1FEXA 4AYBA 4UVAA 2QEXI 2X9DA 1SANA 4AYBN 1J75A 1TW2A 1N25A 4GO1A 5FFXA 3RPQA 5CJ9A 1A35A 5L3BA 1Z3YA 3PFIA 4I09A 2L7MP 2OUMA 3HKZA 4D1QA 1A36A 3MZYA 2LFBA 3HKZN 3L2UA 2Y9ZA 3QYBA 3E6CC 3D0SA 3J7AY 3AG3H 2DA1A 2CUJA 2DFEA 1MMNA 5EZHA 4C3HJ 4IHYA 4CA0A 5M5XJ 1KU7A 2VASA 3LAJA 3WODF 1QGPA 1TP4A 5H6QA 2PJPA 2JTVA 4DIQA 3CCMI 4ZYDA 1RKTA 1LEAA 5HDKA 4KYWA 4DZJA 1Z67A 2NVYJ 2UV1A 1FTZA 5EEGA 2JMWA 4DYCA 5E18F 4IVNA 3JRIA 1R9TJ 5IP9J 4HW0A 3ZPLA 4B43A 4FT8A 3EUHC 4DYQA 1ON1A 2KRHA 4FX0A 1JHHA 4RLFA 4E7JA 3BT9A 4Y13A 3S16J 2FRHA 2R7RA 4W97A 2JA8J 1YQAA 2EZKA 2XKPA 3DBLB 1P9QC 1IZ1A 1Y8QB 3DPUA 2WADA 5TISC 2VQHA 3BPVA 4LK1F 2ZKZA 4MQVA 5HS8A 1S72I 3MKZA 4ENKA 3OWTA 2PN6A 2MSYA 5J1RA 2DPDA 2LMDA 1E2XA 1MH4A 1ZN2A 2Q8KA 1JGGA 2JRTA 2TCTA 1W5SA 2P81A 1SVMA 4A5NA 3I5UA 3FHZA 4FCYA 2JA6J 2EH3A 3IAS2 2LNBA 4YELA 4MO7A 3KETA 1Z7UA 3MAJA 2VKHA 2PJRA 3CCUI 2JA7J 3IKTA 1K6OA 2XGCA 4GGGA 5F0FA 4HNVA 1XX5A 2YR2A 2W00A 3GBGA 1U6GA 2O7OA 2RKHA 3PUBA 2RNGA 1BI0A 2ZC2A 4L9TA 4NDLA 4KDPA 2XAQA 4ON0A 2ZXHA 2EA2A 2XB5A 3K10A 4HAMA 1I3QJ 3QPHA 4BU2A 1K78B 1EF4A 2JK3A 3ZMUA 1TLHB 3H3VK 1PUFB 3FXMA 2OBPA 5DCMB 2JA5J 2QSGX 4ZJZA 1WI3A 2MW8A 3IWZA 5A2QK 4RAFA 1RPWA 5DTDA 2WWYA 4OAZA 4U0YA 4ASNA 5HDNA 2LKXA 2YUSA 2ZNYA 3FHNA 3LSMA 1MJBA 3SFIA 4XBFA 3OS0A 1EJ9A 3S15J 2RDPA 2X6YA 2H09A 3KE2A 3C3WA 2VQGA 1VQ4I 2CV0A 3WHBA 1YIJI 2LOOA 3BQYA 4EGYA 2VE8A 4XLCA 2VUMJ 3DKXA 1MBHA 1R00A 1OCRH 2RQPA 1DP7P 3CUQC 3O8GA 2ISZA 4FX4A 3GWZA 3WTZA 3QAHA 2QBYB 5EEAA 4ESBA 2AQEA 4ZC3A 3T5XA 2IP2A 3K4CA 1IXRC 4JBAA 4G94A 4RB3C 3B6CA 1ZH5A 1TWGJ 3X2QH 1HW1A 5K5QA 5TGTA 3BC8A 1IDYA 1LFPA 2JUCA 1XPXA 3F8NA 5M3FJ 2KJCA 5LEJA 3FF5A 2EV6A 4H4KC 3JSPA 1BOAA 4NUBA 3PIPF 1S8NA 2HTSA 4BEHA 1WSUA 4AU7A 3OSFA 2H1KA 3MZ8A 2EIMH 2CG4A 1PP7U 3BJAA 3RCOA 1VF9A 3JW4A 1W7PB 3WU2C 3KP4A 2CO5A 2CV2A 4BACA 2XB0X 3HPGA 1YLFA 1O7FA 2RN7A 2X85A 3DBHB 4ZYGA 1LFBA 3H9JA 4CGZA 1X1AA 1VI0A 2FMLA 3M8FA 2RGVA 2X48A 3QOPA 1SD5A 4LG0A 2KRFA 1QA6A 5FGMA 2PBIA 4HEA2 3TEDA 3L2WA 5F08A 2FNAA 1BW6A 3A01B 2HR3A 3FIWA 2MD5A 2LDUA 4P96A 3RKYA 3LSRA 1LDKB 3KPHA 3TBIA 3DQVC 4A0YA 3U21A 3I0TA 4OINF 2OF7A 1T56A 4FTHA 1VQ7I 1GUUA 4XLAA 4OIPF 2BEOA 4E7SA 2E1MB 1SFUA 1MBGA 1VQ6I 3ZN0A 4X0GA 1RR8C 5HODA 3ZN1A 2F48A 5JHUA 1WKMA 4OMYA 2G0EA 1CF7A 5L3CA 4RB0A 1J2XA 1ZELA 1YJWI 2E60A 2DFFA 1JGSA 3VOEA 3JREA 1A6QA 2V9VA 2D2WA 2F5FA 3TL4X 4UNOA 3TOBA 2DTZA 4N0BA 2MLGA 2GXBA 3S32A 2FNPA 4B3XA 5DM7F 1DUXC 5HVQC 2FBKA 4G6QA 4EJTA 4Y15A 2O0YA 1OCCH 3I59B 1GVDA 2FUG2 1R36A 2DYSH 2OZ6A 3BR2A 2V9KA 2DDBA 2QA4I 2XF6A 2W84A 1H89C 2Y75A 1QBJA 3BG6A 4LITA 4YFNF 3LOCA 1LJ9A 1Z21A 3DF8A 3CF2A 3S2WA 1S5LC 4CCMA 1GXQA 1WJFA 3OIOA 1P4XA 3ZMDA 2EA4A 4AD9A 1DP3A 1PJRA 4E6KG 5GPAA 3CQZJ 3GO5A 1MBFA 2V6CA 5CLSA 2JSPA 3H5RA 3MCZA 3QODA 1JI8A 3G4SI 4BE2A 5FJ8J 2R7WA 2IVMA 1VZ0A 2QKLB 1TL8A 5F64A 1V5GA 1R1VA 3BY6A 2DK5A 3CO6C 4XORA 2LREA 2QVOA 4CYCB 4HDVA 1B4AA 1YG2A 3BZ6A 2GM4A 2CU7A 4BXFA 3S1QJ 1XS9A 3HOYJ 2BYVE 2DK8A 2KZVA 4II3A 1S7OA 1A04A 4AWXB 1E0EA 5E3LA 2M7AA 3BZKA 2DXIA 2LY2A 1D8KA 2XIGA 1G3WA 5B1AH 1OPCA 4F55A 3ZQCA 1ZGWA 3K2AA 1D1AA 5J4VA 1AKHB 4GYIA 5B1BH 4I99C 2M8GX 3C1DA 5C3EJ 1ZLJA 4LB5A 1FP2A 3G1MA 1YITI 5E17F 3CUOA 3CCEI 1WFXA 1ZAOA 2E1MC 3RIRA 4C3JJ 2UUZA 1HOMA 4BBRJ 1SD4A 3LSTA 3SZPA 3OYGA 2K9LA 4F93B 1Z7LA 2BY3A 1Z91A 3BG5A 3V8LA 5FKOA 2Y9YA 2BW3A 2ICWG 3SDBA 4CCJA 3L7WA 3R0AA 4XKVA 2K85A 2AS5F 1XDSA 2B7EA 1AU7A 1FP1D 4KICA 1W36C 4V19K 4BJTA 3ABLH 2VPRA 2AHQA 1HBXG 5HNFA 3MZHA 3S1NJ 4LLNA 2PQ8A 2DU9A 1JKQC 4D5CA 2L9VA 4PSWA 1U8RA 1H8AC 2LH9A 1V4RA 4KISA 5FO5A 3WG9A 1MSEC 2R7TA 4NC7A 3LAPA 3CJNA 2ECCA 2XF7A 2KKOA 3ECHA 2NS0A 3KLOA 1JKPC 4I02A 2ZSIB 2E1NA 1UHSA 3IAM2 2W82A 3TP3A 3AAFA 1F5TA 1BIBA 3DU5A 4AM3A 2JRMA 4CSWA 1FYMA 1ZARA 1WJDA 4S05A 3FX3A 3IH4A 4HNUA 2DMQA 2CQXA 2E71A 2JVHA 2K9MA 4WCGA 3R4KA 3E3VA 2NAZA 1D8JA 1TZLA 2N8GA 4UHTA 2QSHX 1XN7A 2EFNA 2ZMEC 3DV8A 3GTQJ 5EF6A 2OTLI 2YU9J 5LHGA 4IRGA 1IV8A 1TWAJ 3ESWB 3EUAA 4RAYA 2E19A 4IPAA 3K2ZA 1T38A 3GW2A 2MGQA 5FRNA 2GOMA 4RDUA 4UUSB 3FM3A 4IEJA 5LGNA 1KQ8A 2P7VB 2YPRA 4B09A 3OYJA 4BE1A 2YX7A 3CCYA 4A69C 5D6EA 4UUVA 3K7AJ 3PQJA 2OCEA 3HRUA 3QU3A 3OYCA 5B3SH 2XSJC 3JRAA 3KFWX 4BJ6C 1F1ZA 5E1ZB 2JN6A 3CCSI 4E7IA 1ETKA 2F5DA 3HXLA 3JRDA 4D7MA 2WB1A 2HU9A 3FKIJ 2O5RA 4N9IA 4JOMA 5GP9A 3KYLA 1HSJA 2O9LA 3DU6A 5KNLA 1KQ9A 2D1VA 4P55A 1U8BA 4WF2A 1ZRDA 4L18B 2ME6A 2QQBA 3E7LA 3OR1C 4UV9A 5CKTA 3GFIA 4FISA 3DEWA 4IZZA 3AKZA 1B72A 3F6OA 2XGEA 1TQPA 1IN5A 5E8IA 2KJBA 2KISA 3I4MJ 1R22A 4CCKA 2A3SA 3K4BA 4DW6A 1ZGAA 3R60A 3NRVA 1YRNA 5D5VB 3C2HA 4BXUA 3J7AO 3Q0VA 4QIWN 3KP7A 2PMHA 2XPUA 1NK2P 4MLOA 3TW6A 2I5UA 1OMIA 2IS4A 2BY2A 5ILSA 1YE9A 3DEEA 3RQ4A 3OYKA 1T0FA 4D9JA 1FY7A 1Y56A 3RKXA 1BR1A 4AVPA 4ANJA 4A3GJ 2COBA 3PNTA 5FFZA 3CCQI 2V26A 4OAYA 3ISPA 3QYEA 2BVLA 1Z3XA 5DD4A 5D5WB 1W1WE 2G7UA 5ED4A 4KA4A 1Z05A 3W6VA 2JWTA 2YU3A 3FISA 5HLHA 4ZYHA 4IRHA 3RYRA 2NVXJ 1ZTRA 2MYSA 2WV0A 5K7HA 2LD5A 2A07F 1ETQA 3JAMK 5HOOA 1IRFA 1R23A 3HRTA 4CHUA 3DKYA 5DV5A 4DQ2A 1NG7A 2EFPA 2HDCA 2HPIA 2VBYA 3WTSC 2QWWA 4A3EJ 1FIPA 2Y0SA 2M45A 2BXZA 2Y0SN 1R6RA 1MJAA 2VE9A 3JRBA 2QQ9A 1X3UA 4BYYA 5FLXK 3HSRA 2VL8A 4ZDLA 2MC3A 1JKRC 3RDIA 3GTOJ 4JX6A 3LQRA 1RESA 2Q2EB 4BQQA 2XROA 2D45A 1J5YA 1XC5A 2HQAA 2VI6A 4EJWA 5J8CA 1ZRFA 4OIOF 2LBFB 2DAOA 2HVRA 4UUTA 5IPAA 4IX7A 2XV4S 3BOQA 1ONVA 1SD7A 2PEXA 2BXYA 2XUBA 2M5WA 3P5JA 4CCNA 2EZLA 1V5FA 5BS6A 3VDXA 3OL4A 2COMA 1Z77A 4LIVA 3NQOA 2ZJ2A 3CD6I 1XGOA 2EQRA 4BL0B 1QVTA 2D5VA 4CUGA 5L3GA 5DUKA 2DPUA 3G1LA 1GT0C 1I1SA 2EB7A 3UNGC 2VBZA 1JUPA 3OIPA 5C44J 3DPLC 3QPSA 2HFHA 4NNJA 3OYFA 2Z1DA 3GMEA 3HZJA 3M7GA 2CFOA 5FKKA 3GFMA 4J01A 5F1JA 4MIMA 1DU6A 4XMYA 4L9VA 2WAQN 3FXKA 4L5IA 4RGRA 1V5EA 2J5PA 1S9HA 2F5EA 3HTSB 1FSEA 1LUJB 1YW7A 1YW9A 2MABA 2K5CA 3NAUA 1R4MB 3CLOA 3IV5A 5J4YA 3L2CA 4OOIA 3K4MA 2TRTA 3OYMA 5BPIA 2HOEA 3LSIA 3WTYC 1SFKA 1X4PA 5ICCA 5M5YJ 2IT0A 2X0LA 4XLEA 3ROUA 1ZLKA 3OS1A 3T0YA 4C2MJ 1MBEA 3M1EA 1XSXA 3HOTA 2CW8A 4F3QA 5L3EA 1W5TA 2FEZA 2LKPA 3H35A 5JLWA 2LKSA 3K69A 5K7FA 2STWA 4L9JA 3F8FA 2R7QA 1R4NB 4PDKA 1O4XA 3GFJA 2WAFA 1R1UA 2W24A 1MDMB 1BC8C 3E0JB 3PO2J 1X1PA 4L5EA 1UELB 2VOOA 2XF5A 2XGXA 1KU3A 2IA2A 4PGHA 1K79A 3OYHA 4HV5A 1UAAA 2BBYA 4BQAA 2QQAA 5KCMA 3IKVA 1XMAA 5EDNA 2M0MA 4A93J 3WGIA 1WZ2A 5J40A 2BHZA 3UR3C 5D4SA 2AQFA 1GLNA 1U3EM 2P6TA 4NHJA 1O3QA 1B8IB 1MH3A 4XICA 1ETYA 1D3YA 4FHTA 4RGXA 3Q9VA 1BC7C 4GDFA 2RVCA 3ZMVA 2DQRA 1RUNA 4KN7X 4NC6A 3CDLA 3OS2A 2ZSHB 2KL4A 3JTGA 2X1EA 2IGMA 2X1DA 1K7AA 1I1GA 2XRLA 3BG7A 1REPC 1YJ9I 5FLXZ 3FM5A 1C0WA 3E97A 2IBDA 1XB4A 4IHXA 3GF2A 1LEBA 3BCBA 3DPTA 3U2RA 2B63J 4V2FA 4EJOA 4CXFA 1MW7A 2HDWA 2W4SA 1KYZA 3CUQB 3A1YA 4I7HA 3SEZA 3LNQA 1STZA 3DWLE 5AIPA 1H9TA 2R7FA 3OMYA 2L9SA 2BGCA 4G12A 4ZH4F 3TW7A 3R0JA 2KIQA 4HQEA 5AIQA 1MBKA 3ERMA 3D5LA 4IHSA 1W7PA 3IL2A 1BR2A 1OLTA 2OAZA 1BR4A 1OISA 3S8PA 3BTIA 1IXCA 1QO0D 3GFLA 2GZWA 1EH6A 3PNYA 2MLKA 4F91B 3GTKJ 2K4JA 4I98B 1X1DA 2DMPA 1TWCJ 1QPMA 1YOVB 2BE5F 3PO3J 2E5NA 3FMQA 3U1KA 2LF8A 5FLMJ 1TT5B 2FX0A 2H8RA 2HOSA 4Y17A 3S17J 4BQOA 1X2NA 3RZOJ 3I54A 1HQCA 1Y0UA 1IC8A 1G8XA 3HC7A 4FETA 1MJ9A 1BM9A 1AWCA 2HXIA 3V8JA 4XR6A 2K40A 1U9OA 4G6TB 1IUFA 1T0FC 4CO8A 2HOTA 3ZMZA 4HF2A 2L3DA 4CZZA 2E2JJ 1X3ZB 4HPQA 2HI3A 3ASOH 3HUGB 1FOYA 2XPWA 3QOEA 4RLQA 1KYWA 1WHUA 2DQLA 2DMTA 4MGRA 2A6TA 3WE2A 4HG2A 2V6EA 3GCMA 3MWMA 4MEYF 3TO7A 5JR3A 3ZMSA 3HTUA 5EJCA 4L0YB 3FDYA 2JA2A 2L4AA 1YIOA 1ZG3A 1RUOA 1QQIA 2DA2A 5LGUA 4M3EA 2L9NA 3CZ6A 4BQNA 4Z6YA 2ID3A 5IP7J 2VPLA 4I0BA 4OIQF 4U0WA 2XAFA 2DA4A 4ABZA 1P7IA 2KIFA 4BS9A 2LRDA 2A5YB 6PAXA 1FIAA 5ICFA 4PJ0C 3H9QA 3MVPA 4EGZA 1D5YA 2DLLA 3NARA 3L1PA 2KQRA 2VKEA 4BY7J 1YI2I 3O8HA 4BGDA 2W57A 1O3TA 5EYRA 1KU9A 4RAZA 4FE4A 1HDPA 1FBSA 3RPUD 2V1UA 3G1OA 2P7CB 4ITVA 3SYTA 3ZQLA 3OYNA 4EJUA 2EZHA 3BZCA 3ULQB 2HPMA 1PUEE 2UZKA 1BN5A 4MFDA 4ZTFA 2CQNA 3GTPJ 4RM3A 1UJ8A 1TT0A 5GTIC 3GTMJ 3AG4H 4DZPA 3S3NA 2WC2A 2CV1A 4MFEA 3M1CA 3KLNA 3V42A 5HLGA 4XRSA 1N77A 3IH2A 3BTLA 3TOAA 4CYDA 5DYMA 1VQMI 4ZDPA 4DJAA 4XN3A 4O3MA 4HYEA 1WJAA 4UB6C 3D5RC 2HQNA 2CJJA 2W7NA 5FB2A 1FOKA 4GXOA 2ZXJA 1AKHA 4B44A 4HX4A 2V1DA 3HM5A 2M0CA 3LA3A 4R1HA 4OIRF 4G6DA 2A68F 2VC0A 1K4TA 3LFKA 1J7KA 1MKMA 1RI7A 2FE3A 2ZCWA 3H5AA 3H0DA 2VOPA 4ENJA 3W6KB 2LY9A 3HYIA 4C30A 4BDYA 3K9TA 1XSVA 2K27A 4M3GA 4A2UA 3C2GA 4NQWA 4U7DA 1OKRA 1I5ZA 3GLXA 1Q1HA 3P9IA 1AOYA 4N4OB 4GRIA 3EQLF 3LSGA 4AVZA 1FOWA 3HDDA 1P7JA 1U0JA 4XLNF 1I39A 3WGGA 4EV0A 1XGMA 4BAYA 5LD2C 2VJJA 2GLOA 1FMWA 2R7SA 2PG4A 5L3DA 3PL8A 1VNDA 4LMYA 5HNHA 3UKGA 3MKYB 5EGOA 2DA7A 3L2RA 3KP3A 2GBYA 2WY8Q 4XOPA 5J47A 3FK6A 3GZ6A 2BVMA 5BPDA 2FOWA 5CVJA 1N78A 1HKSA 1QU3A 3OYLA 2I8DA 1KGSA 2P5LC 1MSFC 2AXLA 4EM2A 1EKEA 2R7ZJ 2DCEA 2ISYA 1Q1VA 1N75A 1ITYA 1U5TA 3TGNA 1A6IA 4HQMA 2ZJRF 4XKCA 2Z5UA 1JUMA 2CUFA 3LSHA 3Q0UA 1ZRCA 1UB9A 2NOJB 3HRMA 4KNYA 4XRMA 4AIHA 5H6RA 2I10A 1F9NA 5CYVA 1GXPA 4JX4A 1TW3A 1I27A 5A2QZ 4WWCA 1E3HA 4BHPA 5EZGA 2JUGA 1FOXA 2GXGA 1E17A 3FKJA 1MNEA 1KU2A 1LE8B 1JJ8C 2ID6A 1G4DA 1TWHJ 3QRFF 3FWEA 2L7ZA 1U2WA 2OTJI 2A5WA 3CTAA 4QTRA 2XC7A 3E6DA 3ERED 1EH7A 4C3IJ 2ZMEB 3FXQA 1IXSB 3BLYA 1DGRM 2DODA 2EBIA 2LTPA 4A0XA 2HKXA 2P6SA 5IYDJ 3RPUA 4F52A 2XAHA 2M4GA 4BXXJ 1JE8A 3ZGKA 4ZZLA 1W5CC 3HGYA 3HIFA 2V1NA 5F0CA 4PJLA 2KHMA 3CCRI 1W0TA 1WCMJ 2R7OA 2EV5A 1BJZA 2XAJA 2L9RA 2ZB9A 2K7LA 3KEQA 3KX2A 1Y8RB 3G73A 2NNYA 1O7LA 3ELKA 1X58A 2XKOA 3RSNA 3NWTA 4XSXF 3P7NA 2E7XA 1PP8F 5F0HA 4YFKF 5IT9K 4EEFG 2R5ZB 1HCRA 1WQ2A 1G3TA 2FOKA 3SXYA 4ZYEA 4X1EA 3BDDA 2V79A 3W2AA 3PUFA 2D1HA 1I6XA 3DP7A 2LLKA 1ORKA 3KEOA 3EETA 3JTHA 3S2HJ 3DBRB 3I55I 4JK1X 4HRIA 4D7NA 2H8WA 4LB6B 1ZR2A 1LPQA 5HLTA 4O5VA 3ECOA 3P9CA 2QENA 4XNFA 3GXOA 3CO7C 1SD6A 1ZKGA 4XONA 2DDAA 3Q9SA 2HNHA 3WGHA 4GCVA 1G3YA 2P8TA 2M3AA 5JFRA 2BHYA 1YTYA 2F4IA 2W48A 4U7BA 3K70C 4U0VA 1R71A 3JRHA 2ACJA 4IHTA 3HOXJ 2FF4A 5ERIA 1KZHA 1XGNA 4S04A 4N9HA 2J5OA 3EYIA 4B47A 2X1CA 3ZQHA 3M9AA 5F27A 2K9NA 4M72A 4FQGA 4A3LJ 3F8MA 4XRSG 2IA0A 3ML6A 3E5XA 4WXHA 4G7HF 1O57A 2OD5A 1FYKA 5E1XA 2GOXB 3OYBA 1YS6A 3ASNH 1LVAA 1ETXA 1IRGA 3KZZA 4EM1A 1SC7A 5JLXA 1MMDA 1AA7A 2DOFA 1GHCA 2E2HJ 5LHIA 2ELJA 1SVLA 2FBIA 2HYFA 2X6XA 3GZNB 2RV8A 4P1WA 3PM1A 4LD5A 3CDIA 1SAXA 1UG2A 4M9SA 3BWGA 4CZCA 4E7KA 1MBJA 1NH3A 2AO9A 1PYVA 1NHAA 3TKYA 4QSHA 4MQ9F 1VQ5I 3CDHA 5CPRB 5FKNA 3OYDA 1IUYA 2VBWA 1U9NA 2PMZN 3LA2A 5AONA 4CCOA 4QPQA 3RI4A 3W3CA 1VQNI 1JTXA 1Y0NA 2V9PA 3T8RA 1D0XA 4DGWB 4A3BJ 1FZPB 3H1CA 4DBQA 2O61A 1SMTA 3GLLA 3N05A 3QYFA 1YFHA 3OR2C 4E4HA 2Z2SB 3K1MA 3LFUA 2A69F 3PNVA 1QHGA 1R5HA 3U1DA 3SJMA 3LA7A 3QP6A 2ZBKA 4M74A 1FBUA 1D0YA 2F2EA 2GXAA 3GX4X 4IOAF 4IRIA 2DBBA 3LL7A 2PMUA 1T33A 3CMAI 2JSCA 3C18A 4B8XA 4F7ZA 5EG0A 4AIKA 2HTJA 3R61A 4R79A 2IGOA 3JSOA 2KDZA 1MD0A 5C4XJ 2L7KA 3N4MA 3M4OJ 2LF7A 3TP0A 5LEKA 3J81K 1KA8A 2ETHA 2EZIA 2WTEA 4XL9A 4EVIA 5IOZA 3JRCA 2O6GE 3BR0A 4UY8I 4BH9A 3WU1B 2DMNA 2X6OA 1RKWA 4LIUA 2CYYA 5L3FA 4GYGA 2NVTJ 4KIFA 4U87A 5IP6A 2EK5A 1OR7A 4PJMA 1HLVA 3JR9A 3VYSB 2GIZA 4YEJA 2GWRA 3HOVJ 4C2UA 1XMXA 2E34A 3I64A 3OOPA 1IN7A 1S29A 3RYPA 3B73A 2XAGA 5K7ZA 4G7ZF 1E3PA 3F0CA 1IAWA 3PSIA 4HLXA 1WH5A 1S7EA 2DJNA 4I6ZA 1YX3A 2NVQJ 2GA1A 4OWRB 3WTUC 2XASA 1MMAA 1SAUA 2NS8A 5CVRA 5JI6A 4IO9F 4BNCA 1P92A 4JP0A 4LJZF 3H92A 1BI3A 3L09A 2BW3B 5JVGF 3OYEA 3IRQA 2DFIA 3LMMA 3I56I 3A2KA 2H6CA 2WV1A 2RQQA 1EV7A 1P6RA 2FD5A 4A3CJ 3VFZA 1Y39A 1OQYA 4L0ZB 3SDGA 1ZREA 1TC3C 1JT6A 1BJAA 1I6HJ 1K83J 3EUKL 2CSOA 3BQZA 2QZ8A 1WJCA 3T8TA 3GTLJ 3EPZA 3J80K 1T2KA 4TV7A 1HKQA 4BE0A 4PCQA 1O3RA 2V7FA 2VBXA 3BCAA 3MMYB 2A61A 3CJRB 4XLPF 4FE7A 1SEUA 2A6EF 2DA5A 4K2EA 4MHGA 1USTA 4HNTA 1X1BA 1QZZA 2ZJQF 4H0EA 1FYLA 5E79C 5DUIA 2HDDA 2ADUA 4HF0A 3BR1A 1ZR4A 1J9IA 3ZMTA 2X4HA 5D4RA 5M5WJ 2DT5A 1W7PD 1APLC 2L54A 3S3MA 3CP2A 2QYOA 2B9SA 3IC7A 1OFCX 2A6HF 1CGPA 1ETOA 1UZCA 3DLAA 2M4KA 4EMSA 2LSOA 1BI1A 2WAQA 2AXTC 5LRRA 4HLYA 4P5OA 3A0HC 2QLZA 1ENHA 3AG1H 5LBQA 3IWFA 4M9XA 2PLYA 2DA6A 1SFOJ 1JHFA 1IGNA 1LVKA 1FBQA 4HF1A 4KT6A 4ESJA 3SZTA 2CW7A 4E7ZA 1MNDA 4XQFA 3COAC 3I71A 4A6DA 3I3LA 4AIDA 5IOYA 4IKFA 1GV2A 5D5UB 4A3MJ 4G9YA 1ZG5A 2QUFA 1Z0XA 2FA5A 3BJOA 3VYRB 2DJIA 4HSTA 2Y48A 3G2BA 5HS9A 1T95A 4ENNA 4IHWA 3A0BC 3VYTB 1YRNB 2R7VA 1UHMA 3VSLA 1ZG1A 2NVUB 1K78A 3J7ZI 3K4NA 2HZTA 2ZNZA 2R4GA 5H2FC 2ZXWH 1PUFA 1RZ4A 5DCMA 4AUXA 2RC4A 1UFMA 3VEPA 1IF1A 4UVBA 3WG7H 1FLIA 3BR3A 4YG2F 3E5QA 1WJEA 2DFHA 1OYYA 1P4WA 3VSKA 5E3OA 1LFUP 1XMKA 1LQ1A 3VYUB 2IGKA 4BBSJ 2NXNB 2DN0A 2HOAA 1MNMC 2K9QA 5IYBJ 3QU6A 1H88C 4XK4A 3FBNB 3KZYA 4P9FA 2LK2A 4EJVA 4KFCA 3GTGJ 2KZGA 4M6VA 3ABKH 2FQ3A 1YW8A 2IPQX 1VTNC 1NK3P 2C6YA 3ABUA 4RBOA 4JYKA 3JAMZ 1KQ0A 2DW4A 2MC4A 5D5XB 4M71A 2QF7A 2KP6A 3B02A 4IHVA 4Q5SF 4M3DA 4PZJA 2QCOA 2VT2A 1S3JA 1XD7A 1WJBA 1D1BA 1VQPI 2MH9A 4UXNA 3EYYA 3QPLA 3KIOA 1DGWY 4ZDOA 2QBYA 1CQTA 1YHQI 2BY0A 1PVEA 5M3MJ 2WAEA 1UCRA 2XRNA 3VODA 3WHCA 3HHGA 3H5NA 3WTVC 4RB1A 3FXOA 2EILH 3GTJJ 4RA2A 4KN4X 1RNLA 3J80Z 1OCZH 2OPTA 2QM3A 3AL0B 1USSA 2VKDA 4W1UA 2LY1A 3HOWJ 3GEZA 3FMSA 4HSRA 2HQRA 2V4JC 1TTYA 4L5JA 3B6AA 2IJLA 1WH7A 3V7RA 1QPIA 1ZK8A 2KMUA 2CS3A 2M87A 2VXDA 3FXLA 1Y1VJ 3P9KA 1FC3A 4LG3A 2L4MA 3M8JA 1XDUA 1SMYF 2P4WA 3BP8A 2FSWA 5GPCA 1IJWC 3I53A 2FJ1A 3J7YJ 3ZOBA 1RRJA 2CGPA 3MKLA 2K3FA 4PFPA 2E5ZA 4XKBA 4BDZA 3S14J 2R5YB 3TQNA 1Z1DA 3GVAA 3S1MJ 1R5ID 4XIDA 3A01A 2QGUA 1XCBA 3O2PE 2UXXA 2RREA 5HDGA 4Q48A 1FX7A 3KZIC 1T39A 1ETWA 2M7BA 3K4LA 4B3AA 5TRDA 4MTDA 1OR7C 1J09A 2L5QA 2Y0MA 5JHFA 2E1OA 3IHUA 2ZFUA 3V8KA 2VJIA 2EFOA 2K9SA 1MGTA 2HKOA 3DEUA 5GTHC 2KIMA 4Y7NJ 3HPHA 4ZYAA 4C9YA 3HHHA 4RM2A 2Q0OA 1LNWA 4RAGA 2VLAA 4V2GA 2JPCA 4KT5C 2Y69H 4UB8C 4AC0A 4Y33A 2F6CA 2JQ7A 1K4SA 3ZCOA 3H36A 5KK1A 4D5FA 2DMUA 2CMPA 4LLLA 2DT6A 1X4OA 3TMOA 2VONA 3PQKA 4RGUA 3HOZJ 1B6AA 2CUZA 2DTRA 2WY7Q 2EFWA 2CWEA 1G59A 2STTA 5DEQA 3N97A 2DO7A 4DNCA 2GIVA 2K02A 2MH2A 3I59A 4P9UA 1DU0A 3E6BA 4ESFA 5KHDA 4M9ZA 3ZXSA 2FBHA 1AHDP 2UWMA 3IH3A 3I9V2 1P4AA 3KCCA 3HOSA 4X6AJ
chains in the Genus database with same CATH topology
5GAHJ 1VQPI 1QA6A 3CCUI 1YITI 3CCEI 1VQ9I 3G71I 2ZJQF 1YHQI 3CCRI 1VQMI 2E35A 1VQ7I 4IOAF 4IOCF 1VQ6I 5DM6F 3CCLI 4V19K 1HC8A 3CMAI 3CCQI 1YJWI 1VQOI 3I55I 1VQLI 2H8WA 2QEXI 3CJTB 4UY8I 5DM7F 1VQ4I 1FOWA 2ZJPF 3J7YJ 1FOYA 1YIJI 3CC2I 2K3FA 3CC4I 2QA4I 1VQ8I 1ACIA 1YJNI 2E34A 2FOWA 3CCMI 2OTLI 5GADJ 3CCJI 3CCVI 3PIOF 2ZJRF 3DLLF 3J7ZI 3CC7I 2E36A 3G4SI 4IO9F 3CF5F 5JVGF 2JQ7A 3I56I 3CMEI 1YI2I 1Y39A 5GAGJ 2NXNB 1YJ9I 3PIPF 1FOXA 1VQKI 3CD6I 3CCSI 5GAEJ 3G6EI 1MMSA 1S72I 2OTJI 1VQ5I 1VQNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH J;  1VQP I;  1QA6 A;  3CCU I;  1YIT I;  3CCE I;  1VQ9 I;  3G71 I;  2ZJQ F;  1YHQ I;  3CCR I;  1VQM I;  2E35 A;  1VQ7 I;  4IOA F;  4IOC F;  1VQ6 I;  5DM6 F;  3CCL I;  4V19 K;  1HC8 A;  3CMA I;  3CCQ I;  1YJW I;  1VQO I;  3I55 I;  1VQL I;  2H8W A;  2QEX I;  3CJT B;  4UY8 I;  5DM7 F;  1VQ4 I;  1FOW A;  2ZJP F;  3J7Y J;  1FOY A;  1YIJ I;  3CC2 I;  2K3F A;  3CC4 I;  2QA4 I;  1VQ8 I;  1ACI A;  1YJN I;  2E34 A;  2FOW A;  3CCM I;  2OTL I;  5GAD J;  3CCJ I;  3CCV I;  3PIO F;  2ZJR F;  3DLL F;  3J7Z I;  3CC7 I;  2E36 A;  3G4S I;  4IO9 F;  3CF5 F;  5JVG F;  2JQ7 A;  3I56 I;  3CME I;  1YI2 I;  1Y39 A;  5GAG J;  2NXN B;  1YJ9 I;  3PIP F;  1FOX A;  1VQK I;  3CD6 I;  3CCS I;  5GAE J;  3G6E I;  1MMS A;  1S72 I;  2OTJ I;  1VQ5 I;  1VQN I; 
#chains in the Genus database with same CATH topology
 2TDX A;  5GAH J;  2HGC A;  4PSX A;  1UMQ A;  2OA4 A;  1TWF J;  1TBX A;  1ZHF A;  2L01 A;  3IRR A;  4HOB A;  1L0O C;  1YO5 C;  1BBY A;  1LE8 A;  4DOZ A;  2EJR A;  3H0G J;  1B9M A;  1GV5 A;  2MBF A;  1FSH A;  2CFX A;  3AL0 C;  1T6S A;  3KP6 A;  3K0L A;  5ILV A;  1QNT A;  5K1Y A;  4KMU X;  2ZME A;  2L02 A;  1XG1 A;  2E35 A;  4HX7 A;  4BHC A;  4NB5 A;  1WVR A;  3KP2 A;  5J1Y A;  3W2W A;  2CQ7 A;  2M2E A;  2DA3 A;  4IOC F;  3GZ5 A;  1LB2 A;  2VC1 A;  4J00 A;  3BG3 A;  3H9G A;  4CYC A;  1XTA A;  1O3S A;  3MQ0 A;  3GUD A;  2XHK A;  2E1C A;  2G9W A;  1QHH D;  3QQA A;  1OYW A;  2ECB A;  4FAS D;  5KVR A;  2XVC A;  2O03 A;  3MN2 A;  3S3O A;  3OIQ A;  1Z6R A;  3HSE A;  4CCL A;  2IGN A;  4Y4R A;  1BA5 A;  2M9H A;  2R5Z A;  1FJL A;  2VN2 A;  1ON2 A;  1D0Z A;  3H3Z A;  2H27 A;  3LSJ A;  4HA8 A;  1VQ8 I;  3K1N A;  4LOC A;  4BUP A;  1ACI A;  3U9G A;  4DYR A;  1YX5 A;  2LG4 A;  3SZG A;  3PFY A;  3CJQ B;  4IL6 C;  4Q4Z F;  2LYC A;  1JJ6 C;  5DS9 A;  3PJR A;  1IN4 A;  2K86 A;  4XN0 A;  2O8X A;  4IJA A;  3FBI B;  5FKL A;  4PFO A;  1L3L A;  3S93 A;  3A02 A;  1TNS A;  2OV7 A;  2OCC H;  1QZY A;  2VQC A;  4XSZ F;  3VPR A;  1F43 A;  2OU2 A;  4IF4 A;  3ZQI A;  1KON A;  3C7J A;  1WI9 A;  2OZU A;  1U78 A;  1R1T A;  4HDU A;  4F92 B;  2R7D A;  4RB2 C;  5BNG A;  5JVT A;  4YIR X;  2VJ5 A;  1FNN A;  1YYV A;  2XSD C;  5CVU A;  2F4M B;  3MFK A;  5FKM A;  3VB2 A;  1LDD A;  1BIA A;  4YRV A;  1VQK I;  4KIB A;  5FD5 A;  2H1L A;  5GAE J;  3K4J A;  1W4M A;  3CLQ A;  2CUE A;  3F72 A;  2PJR B;  3I58 A;  2BY1 A;  4A3F J;  1K6Y A;  5E8G A;  5IY5 H;  1SFE A;  5HLI A;  1NTC A;  1E3O C;  2FMY A;  3BG9 A;  3O6B B;  3RKW A;  5CVV A;  4A12 A;  3LSP A;  3KYD B;  5CVI A;  5K5O A;  4PK4 A;  4Y52 J;  2KRC A;  2Z16 A;  2IXS A;  4JX5 A;  3W6J B;  3JCU C;  3HSF A;  3V7S A;  1X19 A;  3F23 A;  2NNN A;  2IS6 A;  2ZFW A;  3G71 I;  4G8X A;  1T08 B;  3IUO A;  4R8H A;  2HVS A;  4A3D J;  2B0L A;  4A0Z A;  3BR5 A;  4Q47 A;  4UUS A;  1UG0 A;  2EWN A;  2P5K A;  5H20 A;  2F5V A;  1FTT A;  1FMV A;  1QRY A;  3QP5 A;  4RMN A;  5DM6 F;  5E1W A;  3ABM H;  3OV8 A;  1H9G A;  3WE3 A;  1BL0 A;  2PFB A;  3O3K A;  3D5S C;  2UXN A;  2XGD A;  1A31 A;  2WBM A;  3S1R J;  2VIX A;  3I4N J;  1ZYR F;  3SHF A;  1OCP A;  3V7C A;  5FD6 A;  1R7J A;  3E1S A;  1Z6T A;  3CJT B;  1ULY A;  2DYR H;  1F36 A;  3SEQ A;  4IQ4 A;  2XDV A;  4HBL A;  4II2 A;  3HEF A;  4Y3O A;  1RIO H;  1K61 A;  2F5C A;  5KAI C;  3PSF A;  3CC2 I;  2DT7 B;  2VT3 A;  2Y30 A;  2VJ4 A;  3BTJ A;  2O3F A;  3HOU J;  1OCO H;  3BJ6 A;  5B5E C;  3M3Y J;  3F21 A;  2ME0 A;  1F4K A;  2HYJ A;  2OC6 A;  4XLH A;  4XRF A;  2KIU A;  3M8E A;  5LLQ A;  2W85 A;  4I0A A;  3ZQG A;  4WXC A;  1R5G A;  3WTX C;  4UV8 A;  1TQM A;  4BEH B;  3TO6 A;  3PIO F;  3BR6 A;  2M30 A;  4A3J J;  4XM3 A;  3DLL F;  2R3S A;  4ETS A;  2K3P A;  1VFC A;  2H94 A;  3ABT A;  3RZD J;  1BW5 A;  3CF5 F;  4DBR A;  3JRF A;  2DOA A;  1QZE A;  4CIC A;  3HB9 A;  4ZZD A;  3DTI A;  1HA8 A;  2ZXI A;  2HZD A;  3FXJ A;  3L2V A;  3SQN A;  4A5M A;  2GQQ A;  3BPX A;  4PGG A;  3F8B A;  2R7U A;  2FQ4 A;  3A03 A;  4HX8 A;  2EIJ H;  2QKM B;  4LG0 B;  1HDD C;  4WXD A;  2HQ5 A;  1IDZ A;  3G6E I;  2EPF A;  2Y31 A;  3QWL A;  3TDZ C;  4YII A;  4NQW B;  2BV6 A;  2YS9 A;  4N4N B;  3CMM A;  3S2D J;  4ZTJ A;  2W25 A;  1EH8 A;  3F3X A;  1ETV A;  2VKV A;  2IAI A;  3ZP5 A;  2JZY A;  2ZO4 A;  2A05 A;  5F6F A;  2EIN H;  4KUM A;  4L9N A;  3D1N I;  3OYA A;  4LLG F;  4IQJ A;  3EDP A;  3WU0 A;  3OSG A;  4I2O A;  2HWV A;  1S7A A;  5EGO B;  3R6S A;  1BI2 A;  4AIJ A;  1CF7 B;  3TDU C;  2Q2E A;  1ZGJ A;  2G7H A;  4M73 A;  3OOU A;  1DPU A;  3W2V A;  1NG6 A;  2LBF A;  1IV6 A;  1LDJ A;  1MZB A;  4D0P A;  1FT9 A;  1U5T B;  2PMZ A;  3ZRG A;  1J59 A;  1V54 H;  2CQQ A;  5CQG A;  3K4K A;  4LFU A;  2OJE D;  2R93 J;  5FRM A;  5DD8 A;  3Q0W A;  1Y6I A;  4CDG A;  4EM0 B;  5E20 A;  2CRG A;  1H0M A;  4MNU A;  1POG A;  1DDN A;  1A5J A;  4XLF A;  1VQL I;  4UVC A;  2IW5 A;  4S0H B;  2E2I J;  1I50 J;  1Y1W J;  1SVO A;  1OJL A;  3CP8 A;  3F9K A;  3FXU A;  2ZJP F;  2PI0 A;  2EFQ A;  4BHB A;  1ZQ3 P;  4B48 A;  3ZQ7 A;  1R49 A;  1IRZ A;  4BY1 J;  3RTR A;  4KIG A;  3L2Q A;  2Y2Z A;  3QPT A;  5LHH A;  1BOB A;  4J19 A;  4E7L A;  1G3S A;  1YJN I;  5J8F A;  2R92 J;  2L2O A;  3EUH A;  1LKX A;  2OQR A;  1IN8 A;  4PJN A;  5GAD J;  3Q5F A;  1OCT C;  3F22 A;  3DTK A;  4M6X A;  2F4O B;  1PDN C;  4KJZ A;  3E5U A;  3CCJ I;  2KDO A;  1HKT A;  3DTE A;  2WB1 N;  4OU0 A;  1V3F A;  2JT1 A;  4I76 A;  5J3L A;  4Z2Y A;  3CC7 I;  1WGX A;  4HV6 A;  4HZF A;  1D1C A;  2LC2 A;  5ILU A;  5IT3 A;  1DPR A;  2Z99 A;  1M1E B;  2VQL A;  3I4P A;  2IEK A;  2IA1 A;  1RET A;  2MA3 A;  3WTT C;  2L7F P;  4KMF A;  5IT9 Z;  2HYG D;  4ENM A;  3CME I;  4A3I J;  1FWZ A;  5D8L B;  2VOD A;  1JXS A;  3HJE A;  1QVU A;  1JKO C;  2P5V A;  1YS7 A;  4U88 A;  3OYI A;  3NEU A;  3FXR A;  2X6W A;  4QPO A;  1MMS A;  1JT0 A;  3AFH A;  4WX9 A;  4E7H A;  1MDM A;  3JRG A;  1X1C A;  3VWB A;  4B4C A;  1WJ5 A;  3ZQQ A;  4LK0 F;  3T1B A;  3CES A;  4A6E A;  1MMG A;  3A4C A;  3IP4 B;  3ZQF A;  1IO2 A;  1B59 A;  1RC9 A;  5J1U A;  4YIF A;  4A3K J;  3BRO A;  1XSD A;  3M07 A;  3ONQ A;  3LQQ A;  1U5T C;  1Z9C A;  1VQ9 I;  4GFB A;  1B8I A;  2EV0 A;  2WA0 A;  4CH7 A;  3Q3S A;  2FU4 A;  4XOT A;  1J0R A;  1I3A A;  1X3W B;  2E7W A;  2KLO A;  3HGG A;  4I01 A;  2NYX A;  3G3Z A;  1SFX A;  4B1R A;  2O8K A;  2JPB A;  5C4J J;  3BTC A;  1T8I A;  1X2M A;  2XPV A;  1V55 H;  5CQE A;  2R0Q C;  5BQT A;  2YSR A;  2RNJ A;  1D5V A;  2IRF G;  2P0W A;  1IRX A;  4EAT A;  2QQ8 A;  2DI3 A;  2M8E A;  2MFZ A;  5ICE A;  1XCV A;  2DOE A;  2X51 A;  3K6G A;  4NBQ A;  5BMZ A;  1IG7 A;  3DXJ F;  1S6L A;  2R7X A;  3RQI A;  4PJJ A;  1IN6 A;  2OQG A;  5K5R A;  2KT0 A;  3SFZ A;  3MD2 A;  1XGS A;  5B66 C;  3OY9 A;  3CUQ A;  9ANT A;  2LVS A;  3C2B A;  3CMY A;  3CC4 I;  1G6N A;  3F6V A;  1WRJ A;  5LRS A;  2BZT A;  2KPM A;  1RR7 A;  3MEX A;  4M3F A;  4EQQ A;  5FLV A;  2CH0 A;  2W1O A;  1G2H A;  3DFG A;  1P2F A;  5FRO A;  1JTY A;  3L00 A;  2HXO A;  3AG2 H;  1EA3 A;  4O6J A;  2K4B A;  4YFX F;  1B1B A;  3GYH X;  2PX9 A;  2M1B A;  3FK7 A;  5LFA A;  2LP0 A;  2L0K A;  2Q1Z B;  3CCV I;  2IS1 A;  3FMR A;  1W0U A;  3KP5 A;  2CQK A;  1R58 A;  3FZV A;  2E36 A;  2VB6 A;  2R5Y A;  3HL2 A;  4LGW A;  3RKQ A;  1B9N A;  3REO A;  1HF0 A;  3L9F A;  1WWX A;  2KFD A;  3LWF A;  4XKW A;  5BOX A;  3OL3 A;  5F04 A;  2ESN A;  3LSK A;  5TJJ A;  1HXD A;  1HW5 A;  2M34 A;  3HBL A;  3KEY A;  1GVJ A;  1ODD A;  2VXZ A;  5GAG J;  5EG0 B;  4MEX F;  3DCF A;  5F1R A;  1B72 B;  1JUS A;  4RGS A;  3J81 Z;  3RJP A;  2EIK H;  4IXA A;  3K70 D;  2V1X A;  2GAU A;  2GA2 A;  4RS8 A;  3E6M A;  3HUG A;  4PUS A;  5D8K B;  3HRS A;  5IYC J;  1TNT A;  1W36 D;  4WK8 F;  2ELK A;  3KYC B;  1ERD A;  2HVQ A;  1HST A;  4G7O F;  3TO9 A;  1T98 A;  4M6Y A;  1DQU A;  3MKW B;  3H3U A;  2NOG A;  2XAU A;  5DCF A;  2MD0 A;  2ELH A;  2FXA A;  3WTW C;  3DKW A;  1GDT A;  2BOL A;  3K1P A;  4C2T A;  3F8C A;  1UHW A;  4QLC U;  1IW7 F;  4BKX A;  5E3N A;  3ZR8 X;  4MTE A;  5ICG A;  4QWQ A;  4E70 A;  5LGT A;  2Z9O A;  2MG4 A;  4OMZ A;  4NC8 A;  2CW0 F;  5HS7 A;  5EEH A;  2NRA C;  2ESH A;  1WPK A;  2H6B A;  5J6X A;  2HS5 A;  2LR8 A;  4BJ5 C;  5DDG A;  2RAE A;  3HG9 A;  3V4G A;  5D6F A;  3CCL I;  1OYI A;  5KAF C;  2HEO A;  1HC8 A;  2NS7 A;  5E3M A;  1TQI A;  2Z33 A;  2QSF X;  1FPQ A;  2JJ7 A;  3NWS A;  4M3B A;  1HW2 A;  2IS2 A;  2JVG A;  2YX4 A;  1VQO I;  4KIT B;  1MIJ A;  4JQF A;  2Z3Y A;  1FEX A;  4AYB A;  4UVA A;  2QEX I;  2X9D A;  1SAN A;  4AYB N;  1J75 A;  1TW2 A;  1N25 A;  4GO1 A;  5FFX A;  3RPQ A;  5CJ9 A;  1A35 A;  5L3B A;  1Z3Y A;  3PFI A;  4I09 A;  2L7M P;  2OUM A;  3HKZ A;  4D1Q A;  1A36 A;  3MZY A;  2LFB A;  3HKZ N;  3L2U A;  2Y9Z A;  3QYB A;  3E6C C;  3D0S A;  3J7A Y;  3AG3 H;  2DA1 A;  2CUJ A;  2DFE A;  1MMN A;  5EZH A;  4C3H J;  4IHY A;  4CA0 A;  5M5X J;  1KU7 A;  2VAS A;  3LAJ A;  3WOD F;  1QGP A;  1TP4 A;  5H6Q A;  2PJP A;  2JTV A;  4DIQ A;  3CCM I;  4ZYD A;  1RKT A;  1LEA A;  5HDK A;  4KYW A;  4DZJ A;  1Z67 A;  2NVY J;  2UV1 A;  1FTZ A;  5EEG A;  2JMW A;  4DYC A;  5E18 F;  4IVN A;  3JRI A;  1R9T J;  5IP9 J;  4HW0 A;  3ZPL A;  4B43 A;  4FT8 A;  3EUH C;  4DYQ A;  1ON1 A;  2KRH A;  4FX0 A;  1JHH A;  4RLF A;  4E7J A;  3BT9 A;  4Y13 A;  3S16 J;  2FRH A;  2R7R A;  4W97 A;  2JA8 J;  1YQA A;  2EZK A;  2XKP A;  3DBL B;  1P9Q C;  1IZ1 A;  1Y8Q B;  3DPU A;  2WAD A;  5TIS C;  2VQH A;  3BPV A;  4LK1 F;  2ZKZ A;  4MQV A;  5HS8 A;  1S72 I;  3MKZ A;  4ENK A;  3OWT A;  2PN6 A;  2MSY A;  5J1R A;  2DPD A;  2LMD A;  1E2X A;  1MH4 A;  1ZN2 A;  2Q8K A;  1JGG A;  2JRT A;  2TCT A;  1W5S A;  2P81 A;  1SVM A;  4A5N A;  3I5U A;  3FHZ A;  4FCY A;  2JA6 J;  2EH3 A;  3IAS 2;  2LNB A;  4YEL A;  4MO7 A;  3KET A;  1Z7U A;  3MAJ A;  2VKH A;  2PJR A;  3CCU I;  2JA7 J;  3IKT A;  1K6O A;  2XGC A;  4GGG A;  5F0F A;  4HNV A;  1XX5 A;  2YR2 A;  2W00 A;  3GBG A;  1U6G A;  2O7O A;  2RKH A;  3PUB A;  2RNG A;  1BI0 A;  2ZC2 A;  4L9T A;  4NDL A;  4KDP A;  2XAQ A;  4ON0 A;  2ZXH A;  2EA2 A;  2XB5 A;  3K10 A;  4HAM A;  1I3Q J;  3QPH A;  4BU2 A;  1K78 B;  1EF4 A;  2JK3 A;  3ZMU A;  1TLH B;  3H3V K;  1PUF B;  3FXM A;  2OBP A;  5DCM B;  2JA5 J;  2QSG X;  4ZJZ A;  1WI3 A;  2MW8 A;  3IWZ A;  5A2Q K;  4RAF A;  1RPW A;  5DTD A;  2WWY A;  4OAZ A;  4U0Y A;  4ASN A;  5HDN A;  2LKX A;  2YUS A;  2ZNY A;  3FHN A;  3LSM A;  1MJB A;  3SFI A;  4XBF A;  3OS0 A;  1EJ9 A;  3S15 J;  2RDP A;  2X6Y A;  2H09 A;  3KE2 A;  3C3W A;  2VQG A;  1VQ4 I;  2CV0 A;  3WHB A;  1YIJ I;  2LOO A;  3BQY A;  4EGY A;  2VE8 A;  4XLC A;  2VUM J;  3DKX A;  1MBH A;  1R00 A;  1OCR H;  2RQP A;  1DP7 P;  3CUQ C;  3O8G A;  2ISZ A;  4FX4 A;  3GWZ A;  3WTZ A;  3QAH A;  2QBY B;  5EEA A;  4ESB A;  2AQE A;  4ZC3 A;  3T5X A;  2IP2 A;  3K4C A;  1IXR C;  4JBA A;  4G94 A;  4RB3 C;  3B6C A;  1ZH5 A;  1TWG J;  3X2Q H;  1HW1 A;  5K5Q A;  5TGT A;  3BC8 A;  1IDY A;  1LFP A;  2JUC A;  1XPX A;  3F8N A;  5M3F J;  2KJC A;  5LEJ A;  3FF5 A;  2EV6 A;  4H4K C;  3JSP A;  1BOA A;  4NUB A;  3PIP F;  1S8N A;  2HTS A;  4BEH A;  1WSU A;  4AU7 A;  3OSF A;  2H1K A;  3MZ8 A;  2EIM H;  2CG4 A;  1PP7 U;  3BJA A;  3RCO A;  1VF9 A;  3JW4 A;  1W7P B;  3WU2 C;  3KP4 A;  2CO5 A;  2CV2 A;  4BAC A;  2XB0 X;  3HPG A;  1YLF A;  1O7F A;  2RN7 A;  2X85 A;  3DBH B;  4ZYG A;  1LFB A;  3H9J A;  4CGZ A;  1X1A A;  1VI0 A;  2FML A;  3M8F A;  2RGV A;  2X48 A;  3QOP A;  1SD5 A;  4LG0 A;  2KRF A;  1QA6 A;  5FGM A;  2PBI A;  4HEA 2;  3TED A;  3L2W A;  5F08 A;  2FNA A;  1BW6 A;  3A01 B;  2HR3 A;  3FIW A;  2MD5 A;  2LDU A;  4P96 A;  3RKY A;  3LSR A;  1LDK B;  3KPH A;  3TBI A;  3DQV C;  4A0Y A;  3U21 A;  3I0T A;  4OIN F;  2OF7 A;  1T56 A;  4FTH A;  1VQ7 I;  1GUU A;  4XLA A;  4OIP F;  2BEO A;  4E7S A;  2E1M B;  1SFU A;  1MBG A;  1VQ6 I;  3ZN0 A;  4X0G A;  1RR8 C;  5HOD A;  3ZN1 A;  2F48 A;  5JHU A;  1WKM A;  4OMY A;  2G0E A;  1CF7 A;  5L3C A;  4RB0 A;  1J2X A;  1ZEL A;  1YJW I;  2E60 A;  2DFF A;  1JGS A;  3VOE A;  3JRE A;  1A6Q A;  2V9V A;  2D2W A;  2F5F A;  3TL4 X;  4UNO A;  3TOB A;  2DTZ A;  4N0B A;  2MLG A;  2GXB A;  3S32 A;  2FNP A;  4B3X A;  5DM7 F;  1DUX C;  5HVQ C;  2FBK A;  4G6Q A;  4EJT A;  4Y15 A;  2O0Y A;  1OCC H;  3I59 B;  1GVD A;  2FUG 2;  1R36 A;  2DYS H;  2OZ6 A;  3BR2 A;  2V9K A;  2DDB A;  2QA4 I;  2XF6 A;  2W84 A;  1H89 C;  2Y75 A;  1QBJ A;  3BG6 A;  4LIT A;  4YFN F;  3LOC A;  1LJ9 A;  1Z21 A;  3DF8 A;  3CF2 A;  3S2W A;  1S5L C;  4CCM A;  1GXQ A;  1WJF A;  3OIO A;  1P4X A;  3ZMD A;  2EA4 A;  4AD9 A;  1DP3 A;  1PJR A;  4E6K G;  5GPA A;  3CQZ J;  3GO5 A;  1MBF A;  2V6C A;  5CLS A;  2JSP A;  3H5R A;  3MCZ A;  3QOD A;  1JI8 A;  3G4S I;  4BE2 A;  5FJ8 J;  2R7W A;  2IVM A;  1VZ0 A;  2QKL B;  1TL8 A;  5F64 A;  1V5G A;  1R1V A;  3BY6 A;  2DK5 A;  3CO6 C;  4XOR A;  2LRE A;  2QVO A;  4CYC B;  4HDV A;  1B4A A;  1YG2 A;  3BZ6 A;  2GM4 A;  2CU7 A;  4BXF A;  3S1Q J;  1XS9 A;  3HOY J;  2BYV E;  2DK8 A;  2KZV A;  4II3 A;  1S7O A;  1A04 A;  4AWX B;  1E0E A;  5E3L A;  2M7A A;  3BZK A;  2DXI A;  2LY2 A;  1D8K A;  2XIG A;  1G3W A;  5B1A H;  1OPC A;  4F55 A;  3ZQC A;  1ZGW A;  3K2A A;  1D1A A;  5J4V A;  1AKH B;  4GYI A;  5B1B H;  4I99 C;  2M8G X;  3C1D A;  5C3E J;  1ZLJ A;  4LB5 A;  1FP2 A;  3G1M A;  1YIT I;  5E17 F;  3CUO A;  3CCE I;  1WFX A;  1ZAO A;  2E1M C;  3RIR A;  4C3J J;  2UUZ A;  1HOM A;  4BBR J;  1SD4 A;  3LST A;  3SZP A;  3OYG A;  2K9L A;  4F93 B;  1Z7L A;  2BY3 A;  1Z91 A;  3BG5 A;  3V8L A;  5FKO A;  2Y9Y A;  2BW3 A;  2ICW G;  3SDB A;  4CCJ A;  3L7W A;  3R0A A;  4XKV A;  2K85 A;  2AS5 F;  1XDS A;  2B7E A;  1AU7 A;  1FP1 D;  4KIC A;  1W36 C;  4V19 K;  4BJT A;  3ABL H;  2VPR A;  2AHQ A;  1HBX G;  5HNF A;  3MZH A;  3S1N J;  4LLN A;  2PQ8 A;  2DU9 A;  1JKQ C;  4D5C A;  2L9V A;  4PSW A;  1U8R A;  1H8A C;  2LH9 A;  1V4R A;  4KIS A;  5FO5 A;  3WG9 A;  1MSE C;  2R7T A;  4NC7 A;  3LAP A;  3CJN A;  2ECC A;  2XF7 A;  2KKO A;  3ECH A;  2NS0 A;  3KLO A;  1JKP C;  4I02 A;  2ZSI B;  2E1N A;  1UHS A;  3IAM 2;  2W82 A;  3TP3 A;  3AAF A;  1F5T A;  1BIB A;  3DU5 A;  4AM3 A;  2JRM A;  4CSW A;  1FYM A;  1ZAR A;  1WJD A;  4S05 A;  3FX3 A;  3IH4 A;  4HNU A;  2DMQ A;  2CQX A;  2E71 A;  2JVH A;  2K9M A;  4WCG A;  3R4K A;  3E3V A;  2NAZ A;  1D8J A;  1TZL A;  2N8G A;  4UHT A;  2QSH X;  1XN7 A;  2EFN A;  2ZME C;  3DV8 A;  3GTQ J;  5EF6 A;  2OTL I;  2YU9 J;  5LHG A;  4IRG A;  1IV8 A;  1TWA J;  3ESW B;  3EUA A;  4RAY A;  2E19 A;  4IPA A;  3K2Z A;  1T38 A;  3GW2 A;  2MGQ A;  5FRN A;  2GOM A;  4RDU A;  4UUS B;  3FM3 A;  4IEJ A;  5LGN A;  1KQ8 A;  2P7V B;  2YPR A;  4B09 A;  3OYJ A;  4BE1 A;  2YX7 A;  3CCY A;  4A69 C;  5D6E A;  4UUV A;  3K7A J;  3PQJ A;  2OCE A;  3HRU A;  3QU3 A;  3OYC A;  5B3S H;  2XSJ C;  3JRA A;  3KFW X;  4BJ6 C;  1F1Z A;  5E1Z B;  2JN6 A;  3CCS I;  4E7I A;  1ETK A;  2F5D A;  3HXL A;  3JRD A;  4D7M A;  2WB1 A;  2HU9 A;  3FKI J;  2O5R A;  4N9I A;  4JOM A;  5GP9 A;  3KYL A;  1HSJ A;  2O9L A;  3DU6 A;  5KNL A;  1KQ9 A;  2D1V A;  4P55 A;  1U8B A;  4WF2 A;  1ZRD A;  4L18 B;  2ME6 A;  2QQB A;  3E7L A;  3OR1 C;  4UV9 A;  5CKT A;  3GFI A;  4FIS A;  3DEW A;  4IZZ A;  3AKZ A;  1B72 A;  3F6O A;  2XGE A;  1TQP A;  1IN5 A;  5E8I A;  2KJB A;  2KIS A;  3I4M J;  1R22 A;  4CCK A;  2A3S A;  3K4B A;  4DW6 A;  1ZGA A;  3R60 A;  3NRV A;  1YRN A;  5D5V B;  3C2H A;  4BXU A;  3J7A O;  3Q0V A;  4QIW N;  3KP7 A;  2PMH A;  2XPU A;  1NK2 P;  4MLO A;  3TW6 A;  2I5U A;  1OMI A;  2IS4 A;  2BY2 A;  5ILS A;  1YE9 A;  3DEE A;  3RQ4 A;  3OYK A;  1T0F A;  4D9J A;  1FY7 A;  1Y56 A;  3RKX A;  1BR1 A;  4AVP A;  4ANJ A;  4A3G J;  2COB A;  3PNT A;  5FFZ A;  3CCQ I;  2V26 A;  4OAY A;  3ISP A;  3QYE A;  2BVL A;  1Z3X A;  5DD4 A;  5D5W B;  1W1W E;  2G7U A;  5ED4 A;  4KA4 A;  1Z05 A;  3W6V A;  2JWT A;  2YU3 A;  3FIS A;  5HLH A;  4ZYH A;  4IRH A;  3RYR A;  2NVX J;  1ZTR A;  2MYS A;  2WV0 A;  5K7H A;  2LD5 A;  2A07 F;  1ETQ A;  3JAM K;  5HOO A;  1IRF A;  1R23 A;  3HRT A;  4CHU A;  3DKY A;  5DV5 A;  4DQ2 A;  1NG7 A;  2EFP A;  2HDC A;  2HPI A;  2VBY A;  3WTS C;  2QWW A;  4A3E J;  1FIP A;  2Y0S A;  2M45 A;  2BXZ A;  2Y0S N;  1R6R A;  1MJA A;  2VE9 A;  3JRB A;  2QQ9 A;  1X3U A;  4BYY A;  5FLX K;  3HSR A;  2VL8 A;  4ZDL A;  2MC3 A;  1JKR C;  3RDI A;  3GTO J;  4JX6 A;  3LQR A;  1RES A;  2Q2E B;  4BQQ A;  2XRO A;  2D45 A;  1J5Y A;  1XC5 A;  2HQA A;  2VI6 A;  4EJW A;  5J8C A;  1ZRF A;  4OIO F;  2LBF B;  2DAO A;  2HVR A;  4UUT A;  5IPA A;  4IX7 A;  2XV4 S;  3BOQ A;  1ONV A;  1SD7 A;  2PEX A;  2BXY A;  2XUB A;  2M5W A;  3P5J A;  4CCN A;  2EZL A;  1V5F A;  5BS6 A;  3VDX A;  3OL4 A;  2COM A;  1Z77 A;  4LIV A;  3NQO A;  2ZJ2 A;  3CD6 I;  1XGO A;  2EQR A;  4BL0 B;  1QVT A;  2D5V A;  4CUG A;  5L3G A;  5DUK A;  2DPU A;  3G1L A;  1GT0 C;  1I1S A;  2EB7 A;  3UNG C;  2VBZ A;  1JUP A;  3OIP A;  5C44 J;  3DPL C;  3QPS A;  2HFH A;  4NNJ A;  3OYF A;  2Z1D A;  3GME A;  3HZJ A;  3M7G A;  2CFO A;  5FKK A;  3GFM A;  4J01 A;  5F1J A;  4MIM A;  1DU6 A;  4XMY A;  4L9V A;  2WAQ N;  3FXK A;  4L5I A;  4RGR A;  1V5E A;  2J5P A;  1S9H A;  2F5E A;  3HTS B;  1FSE A;  1LUJ B;  1YW7 A;  1YW9 A;  2MAB A;  2K5C A;  3NAU A;  1R4M B;  3CLO A;  3IV5 A;  5J4Y A;  3L2C A;  4OOI A;  3K4M A;  2TRT A;  3OYM A;  5BPI A;  2HOE A;  3LSI A;  3WTY C;  1SFK A;  1X4P A;  5ICC A;  5M5Y J;  2IT0 A;  2X0L A;  4XLE A;  3ROU A;  1ZLK A;  3OS1 A;  3T0Y A;  4C2M J;  1MBE A;  3M1E A;  1XSX A;  3HOT A;  2CW8 A;  4F3Q A;  5L3E A;  1W5T A;  2FEZ A;  2LKP A;  3H35 A;  5JLW A;  2LKS A;  3K69 A;  5K7F A;  2STW A;  4L9J A;  3F8F A;  2R7Q A;  1R4N B;  4PDK A;  1O4X A;  3GFJ A;  2WAF A;  1R1U A;  2W24 A;  1MDM B;  1BC8 C;  3E0J B;  3PO2 J;  1X1P A;  4L5E A;  1UEL B;  2VOO A;  2XF5 A;  2XGX A;  1KU3 A;  2IA2 A;  4PGH A;  1K79 A;  3OYH A;  4HV5 A;  1UAA A;  2BBY A;  4BQA A;  2QQA A;  5KCM A;  3IKV A;  1XMA A;  5EDN A;  2M0M A;  4A93 J;  3WGI A;  1WZ2 A;  5J40 A;  2BHZ A;  3UR3 C;  5D4S A;  2AQF A;  1GLN A;  1U3E M;  2P6T A;  4NHJ A;  1O3Q A;  1B8I B;  1MH3 A;  4XIC A;  1ETY A;  1D3Y A;  4FHT A;  4RGX A;  3Q9V A;  1BC7 C;  4GDF A;  2RVC A;  3ZMV A;  2DQR A;  1RUN A;  4KN7 X;  4NC6 A;  3CDL A;  3OS2 A;  2ZSH B;  2KL4 A;  3JTG A;  2X1E A;  2IGM A;  2X1D A;  1K7A A;  1I1G A;  2XRL A;  3BG7 A;  1REP C;  1YJ9 I;  5FLX Z;  3FM5 A;  1C0W A;  3E97 A;  2IBD A;  1XB4 A;  4IHX A;  3GF2 A;  1LEB A;  3BCB A;  3DPT A;  3U2R A;  2B63 J;  4V2F A;  4EJO A;  4CXF A;  1MW7 A;  2HDW A;  2W4S A;  1KYZ A;  3CUQ B;  3A1Y A;  4I7H A;  3SEZ A;  3LNQ A;  1STZ A;  3DWL E;  5AIP A;  1H9T A;  2R7F A;  3OMY A;  2L9S A;  2BGC A;  4G12 A;  4ZH4 F;  3TW7 A;  3R0J A;  2KIQ A;  4HQE A;  5AIQ A;  1MBK A;  3ERM A;  3D5L A;  4IHS A;  1W7P A;  3IL2 A;  1BR2 A;  1OLT A;  2OAZ A;  1BR4 A;  1OIS A;  3S8P A;  3BTI A;  1IXC A;  1QO0 D;  3GFL A;  2GZW A;  1EH6 A;  3PNY A;  2MLK A;  4F91 B;  3GTK J;  2K4J A;  4I98 B;  1X1D A;  2DMP A;  1TWC J;  1QPM A;  1YOV B;  2BE5 F;  3PO3 J;  2E5N A;  3FMQ A;  3U1K A;  2LF8 A;  5FLM J;  1TT5 B;  2FX0 A;  2H8R A;  2HOS A;  4Y17 A;  3S17 J;  4BQO A;  1X2N A;  3RZO J;  3I54 A;  1HQC A;  1Y0U A;  1IC8 A;  1G8X A;  3HC7 A;  4FET A;  1MJ9 A;  1BM9 A;  1AWC A;  2HXI A;  3V8J A;  4XR6 A;  2K40 A;  1U9O A;  4G6T B;  1IUF A;  1T0F C;  4CO8 A;  2HOT A;  3ZMZ A;  4HF2 A;  2L3D A;  4CZZ A;  2E2J J;  1X3Z B;  4HPQ A;  2HI3 A;  3ASO H;  3HUG B;  1FOY A;  2XPW A;  3QOE A;  4RLQ A;  1KYW A;  1WHU A;  2DQL A;  2DMT A;  4MGR A;  2A6T A;  3WE2 A;  4HG2 A;  2V6E A;  3GCM A;  3MWM A;  4MEY F;  3TO7 A;  5JR3 A;  3ZMS A;  3HTU A;  5EJC A;  4L0Y B;  3FDY A;  2JA2 A;  2L4A A;  1YIO A;  1ZG3 A;  1RUO A;  1QQI A;  2DA2 A;  5LGU A;  4M3E A;  2L9N A;  3CZ6 A;  4BQN A;  4Z6Y A;  2ID3 A;  5IP7 J;  2VPL A;  4I0B A;  4OIQ F;  4U0W A;  2XAF A;  2DA4 A;  4ABZ A;  1P7I A;  2KIF A;  4BS9 A;  2LRD A;  2A5Y B;  6PAX A;  1FIA A;  5ICF A;  4PJ0 C;  3H9Q A;  3MVP A;  4EGZ A;  1D5Y A;  2DLL A;  3NAR A;  3L1P A;  2KQR A;  2VKE A;  4BY7 J;  1YI2 I;  3O8H A;  4BGD A;  2W57 A;  1O3T A;  5EYR A;  1KU9 A;  4RAZ A;  4FE4 A;  1HDP A;  1FBS A;  3RPU D;  2V1U A;  3G1O A;  2P7C B;  4ITV A;  3SYT A;  3ZQL A;  3OYN A;  4EJU A;  2EZH A;  3BZC A;  3ULQ B;  2HPM A;  1PUE E;  2UZK A;  1BN5 A;  4MFD A;  4ZTF A;  2CQN A;  3GTP J;  4RM3 A;  1UJ8 A;  1TT0 A;  5GTI C;  3GTM J;  3AG4 H;  4DZP A;  3S3N A;  2WC2 A;  2CV1 A;  4MFE A;  3M1C A;  3KLN A;  3V42 A;  5HLG A;  4XRS A;  1N77 A;  3IH2 A;  3BTL A;  3TOA A;  4CYD A;  5DYM A;  1VQM I;  4ZDP A;  4DJA A;  4XN3 A;  4O3M A;  4HYE A;  1WJA A;  4UB6 C;  3D5R C;  2HQN A;  2CJJ A;  2W7N A;  5FB2 A;  1FOK A;  4GXO A;  2ZXJ A;  1AKH A;  4B44 A;  4HX4 A;  2V1D A;  3HM5 A;  2M0C A;  3LA3 A;  4R1H A;  4OIR F;  4G6D A;  2A68 F;  2VC0 A;  1K4T A;  3LFK A;  1J7K A;  1MKM A;  1RI7 A;  2FE3 A;  2ZCW A;  3H5A A;  3H0D A;  2VOP A;  4ENJ A;  3W6K B;  2LY9 A;  3HYI A;  4C30 A;  4BDY A;  3K9T A;  1XSV A;  2K27 A;  4M3G A;  4A2U A;  3C2G A;  4NQW A;  4U7D A;  1OKR A;  1I5Z A;  3GLX A;  1Q1H A;  3P9I A;  1AOY A;  4N4O B;  4GRI A;  3EQL F;  3LSG A;  4AVZ A;  1FOW A;  3HDD A;  1P7J A;  1U0J A;  4XLN F;  1I39 A;  3WGG A;  4EV0 A;  1XGM A;  4BAY A;  5LD2 C;  2VJJ A;  2GLO A;  1FMW A;  2R7S A;  2PG4 A;  5L3D A;  3PL8 A;  1VND A;  4LMY A;  5HNH A;  3UKG A;  3MKY B;  5EGO A;  2DA7 A;  3L2R A;  3KP3 A;  2GBY A;  2WY8 Q;  4XOP A;  5J47 A;  3FK6 A;  3GZ6 A;  2BVM A;  5BPD A;  2FOW A;  5CVJ A;  1N78 A;  1HKS A;  1QU3 A;  3OYL A;  2I8D A;  1KGS A;  2P5L C;  1MSF C;  2AXL A;  4EM2 A;  1EKE A;  2R7Z J;  2DCE A;  2ISY A;  1Q1V A;  1N75 A;  1ITY A;  1U5T A;  3TGN A;  1A6I A;  4HQM A;  2ZJR F;  4XKC A;  2Z5U A;  1JUM A;  2CUF A;  3LSH A;  3Q0U A;  1ZRC A;  1UB9 A;  2NOJ B;  3HRM A;  4KNY A;  4XRM A;  4AIH A;  5H6R A;  2I10 A;  1F9N A;  5CYV A;  1GXP A;  4JX4 A;  1TW3 A;  1I27 A;  5A2Q Z;  4WWC A;  1E3H A;  4BHP A;  5EZG A;  2JUG A;  1FOX A;  2GXG A;  1E17 A;  3FKJ A;  1MNE A;  1KU2 A;  1LE8 B;  1JJ8 C;  2ID6 A;  1G4D A;  1TWH J;  3QRF F;  3FWE A;  2L7Z A;  1U2W A;  2OTJ I;  2A5W A;  3CTA A;  4QTR A;  2XC7 A;  3E6D A;  3ERE D;  1EH7 A;  4C3I J;  2ZME B;  3FXQ A;  1IXS B;  3BLY A;  1DGR M;  2DOD A;  2EBI A;  2LTP A;  4A0X A;  2HKX A;  2P6S A;  5IYD J;  3RPU A;  4F52 A;  2XAH A;  2M4G A;  4BXX J;  1JE8 A;  3ZGK A;  4ZZL A;  1W5C C;  3HGY A;  3HIF A;  2V1N A;  5F0C A;  4PJL A;  2KHM A;  3CCR I;  1W0T A;  1WCM J;  2R7O A;  2EV5 A;  1BJZ A;  2XAJ A;  2L9R A;  2ZB9 A;  2K7L A;  3KEQ A;  3KX2 A;  1Y8R B;  3G73 A;  2NNY A;  1O7L A;  3ELK A;  1X58 A;  2XKO A;  3RSN A;  3NWT A;  4XSX F;  3P7N A;  2E7X A;  1PP8 F;  5F0H A;  4YFK F;  5IT9 K;  4EEF G;  2R5Z B;  1HCR A;  1WQ2 A;  1G3T A;  2FOK A;  3SXY A;  4ZYE A;  4X1E A;  3BDD A;  2V79 A;  3W2A A;  3PUF A;  2D1H A;  1I6X A;  3DP7 A;  2LLK A;  1ORK A;  3KEO A;  3EET A;  3JTH A;  3S2H J;  3DBR B;  3I55 I;  4JK1 X;  4HRI A;  4D7N A;  2H8W A;  4LB6 B;  1ZR2 A;  1LPQ A;  5HLT A;  4O5V A;  3ECO A;  3P9C A;  2QEN A;  4XNF A;  3GXO A;  3CO7 C;  1SD6 A;  1ZKG A;  4XON A;  2DDA A;  3Q9S A;  2HNH A;  3WGH A;  4GCV A;  1G3Y A;  2P8T A;  2M3A A;  5JFR A;  2BHY A;  1YTY A;  2F4I A;  2W48 A;  4U7B A;  3K70 C;  4U0V A;  1R71 A;  3JRH A;  2ACJ A;  4IHT A;  3HOX J;  2FF4 A;  5ERI A;  1KZH A;  1XGN A;  4S04 A;  4N9H A;  2J5O A;  3EYI A;  4B47 A;  2X1C A;  3ZQH A;  3M9A A;  5F27 A;  2K9N A;  4M72 A;  4FQG A;  4A3L J;  3F8M A;  4XRS G;  2IA0 A;  3ML6 A;  3E5X A;  4WXH A;  4G7H F;  1O57 A;  2OD5 A;  1FYK A;  5E1X A;  2GOX B;  3OYB A;  1YS6 A;  3ASN H;  1LVA A;  1ETX A;  1IRG A;  3KZZ A;  4EM1 A;  1SC7 A;  5JLX A;  1MMD A;  1AA7 A;  2DOF A;  1GHC A;  2E2H J;  5LHI A;  2ELJ A;  1SVL A;  2FBI A;  2HYF A;  2X6X A;  3GZN B;  2RV8 A;  4P1W A;  3PM1 A;  4LD5 A;  3CDI A;  1SAX A;  1UG2 A;  4M9S A;  3BWG A;  4CZC A;  4E7K A;  1MBJ A;  1NH3 A;  2AO9 A;  1PYV A;  1NHA A;  3TKY A;  4QSH A;  4MQ9 F;  1VQ5 I;  3CDH A;  5CPR B;  5FKN A;  3OYD A;  1IUY A;  2VBW A;  1U9N A;  2PMZ N;  3LA2 A;  5AON A;  4CCO A;  4QPQ A;  3RI4 A;  3W3C A;  1VQN I;  1JTX A;  1Y0N A;  2V9P A;  3T8R A;  1D0X A;  4DGW B;  4A3B J;  1FZP B;  3H1C A;  4DBQ A;  2O61 A;  1SMT A;  3GLL A;  3N05 A;  3QYF A;  1YFH A;  3OR2 C;  4E4H A;  2Z2S B;  3K1M A;  3LFU A;  2A69 F;  3PNV A;  1QHG A;  1R5H A;  3U1D A;  3SJM A;  3LA7 A;  3QP6 A;  2ZBK A;  4M74 A;  1FBU A;  1D0Y A;  2F2E A;  2GXA A;  3GX4 X;  4IOA F;  4IRI A;  2DBB A;  3LL7 A;  2PMU A;  1T33 A;  3CMA I;  2JSC A;  3C18 A;  4B8X A;  4F7Z A;  5EG0 A;  4AIK A;  2HTJ A;  3R61 A;  4R79 A;  2IGO A;  3JSO A;  2KDZ A;  1MD0 A;  5C4X J;  2L7K A;  3N4M A;  3M4O J;  2LF7 A;  3TP0 A;  5LEK A;  3J81 K;  1KA8 A;  2ETH A;  2EZI A;  2WTE A;  4XL9 A;  4EVI A;  5IOZ A;  3JRC A;  2O6G E;  3BR0 A;  4UY8 I;  4BH9 A;  3WU1 B;  2DMN A;  2X6O A;  1RKW A;  4LIU A;  2CYY A;  5L3F A;  4GYG A;  2NVT J;  4KIF A;  4U87 A;  5IP6 A;  2EK5 A;  1OR7 A;  4PJM A;  1HLV A;  3JR9 A;  3VYS B;  2GIZ A;  4YEJ A;  2GWR A;  3HOV J;  4C2U A;  1XMX A;  2E34 A;  3I64 A;  3OOP A;  1IN7 A;  1S29 A;  3RYP A;  3B73 A;  2XAG A;  5K7Z A;  4G7Z F;  1E3P A;  3F0C A;  1IAW A;  3PSI A;  4HLX A;  1WH5 A;  1S7E A;  2DJN A;  4I6Z A;  1YX3 A;  2NVQ J;  2GA1 A;  4OWR B;  3WTU C;  2XAS A;  1MMA A;  1SAU A;  2NS8 A;  5CVR A;  5JI6 A;  4IO9 F;  4BNC A;  1P92 A;  4JP0 A;  4LJZ F;  3H92 A;  1BI3 A;  3L09 A;  2BW3 B;  5JVG F;  3OYE A;  3IRQ A;  2DFI A;  3LMM A;  3I56 I;  3A2K A;  2H6C A;  2WV1 A;  2RQQ A;  1EV7 A;  1P6R A;  2FD5 A;  4A3C J;  3VFZ A;  1Y39 A;  1OQY A;  4L0Z B;  3SDG A;  1ZRE A;  1TC3 C;  1JT6 A;  1BJA A;  1I6H J;  1K83 J;  3EUK L;  2CSO A;  3BQZ A;  2QZ8 A;  1WJC A;  3T8T A;  3GTL J;  3EPZ A;  3J80 K;  1T2K A;  4TV7 A;  1HKQ A;  4BE0 A;  4PCQ A;  1O3R A;  2V7F A;  2VBX A;  3BCA A;  3MMY B;  2A61 A;  3CJR B;  4XLP F;  4FE7 A;  1SEU A;  2A6E F;  2DA5 A;  4K2E A;  4MHG A;  1UST A;  4HNT A;  1X1B A;  1QZZ A;  2ZJQ F;  4H0E A;  1FYL A;  5E79 C;  5DUI A;  2HDD A;  2ADU A;  4HF0 A;  3BR1 A;  1ZR4 A;  1J9I A;  3ZMT A;  2X4H A;  5D4R A;  5M5W J;  2DT5 A;  1W7P D;  1APL C;  2L54 A;  3S3M A;  3CP2 A;  2QYO A;  2B9S A;  3IC7 A;  1OFC X;  2A6H F;  1CGP A;  1ETO A;  1UZC A;  3DLA A;  2M4K A;  4EMS A;  2LSO A;  1BI1 A;  2WAQ A;  2AXT C;  5LRR A;  4HLY A;  4P5O A;  3A0H C;  2QLZ A;  1ENH A;  3AG1 H;  5LBQ A;  3IWF A;  4M9X A;  2PLY A;  2DA6 A;  1SFO J;  1JHF A;  1IGN A;  1LVK A;  1FBQ A;  4HF1 A;  4KT6 A;  4ESJ A;  3SZT A;  2CW7 A;  4E7Z A;  1MND A;  4XQF A;  3COA C;  3I71 A;  4A6D A;  3I3L A;  4AID A;  5IOY A;  4IKF A;  1GV2 A;  5D5U B;  4A3M J;  4G9Y A;  1ZG5 A;  2QUF A;  1Z0X A;  2FA5 A;  3BJO A;  3VYR B;  2DJI A;  4HST A;  2Y48 A;  3G2B A;  5HS9 A;  1T95 A;  4ENN A;  4IHW A;  3A0B C;  3VYT B;  1YRN B;  2R7V A;  1UHM A;  3VSL A;  1ZG1 A;  2NVU B;  1K78 A;  3J7Z I;  3K4N A;  2HZT A;  2ZNZ A;  2R4G A;  5H2F C;  2ZXW H;  1PUF A;  1RZ4 A;  5DCM A;  4AUX A;  2RC4 A;  1UFM A;  3VEP A;  1IF1 A;  4UVB A;  3WG7 H;  1FLI A;  3BR3 A;  4YG2 F;  3E5Q A;  1WJE A;  2DFH A;  1OYY A;  1P4W A;  3VSK A;  5E3O A;  1LFU P;  1XMK A;  1LQ1 A;  3VYU B;  2IGK A;  4BBS J;  2NXN B;  2DN0 A;  2HOA A;  1MNM C;  2K9Q A;  5IYB J;  3QU6 A;  1H88 C;  4XK4 A;  3FBN B;  3KZY A;  4P9F A;  2LK2 A;  4EJV A;  4KFC A;  3GTG J;  2KZG A;  4M6V A;  3ABK H;  2FQ3 A;  1YW8 A;  2IPQ X;  1VTN C;  1NK3 P;  2C6Y A;  3ABU A;  4RBO A;  4JYK A;  3JAM Z;  1KQ0 A;  2DW4 A;  2MC4 A;  5D5X B;  4M71 A;  2QF7 A;  2KP6 A;  3B02 A;  4IHV A;  4Q5S F;  4M3D A;  4PZJ A;  2QCO A;  2VT2 A;  1S3J A;  1XD7 A;  1WJB A;  1D1B A;  1VQP I;  2MH9 A;  4UXN A;  3EYY A;  3QPL A;  3KIO A;  1DGW Y;  4ZDO A;  2QBY A;  1CQT A;  1YHQ I;  2BY0 A;  1PVE A;  5M3M J;  2WAE A;  1UCR A;  2XRN A;  3VOD A;  3WHC A;  3HHG A;  3H5N A;  3WTV C;  4RB1 A;  3FXO A;  2EIL H;  3GTJ J;  4RA2 A;  4KN4 X;  1RNL A;  3J80 Z;  1OCZ H;  2OPT A;  2QM3 A;  3AL0 B;  1USS A;  2VKD A;  4W1U A;  2LY1 A;  3HOW J;  3GEZ A;  3FMS A;  4HSR A;  2HQR A;  2V4J C;  1TTY A;  4L5J A;  3B6A A;  2IJL A;  1WH7 A;  3V7R A;  1QPI A;  1ZK8 A;  2KMU A;  2CS3 A;  2M87 A;  2VXD A;  3FXL A;  1Y1V J;  3P9K A;  1FC3 A;  4LG3 A;  2L4M A;  3M8J A;  1XDU A;  1SMY F;  2P4W A;  3BP8 A;  2FSW A;  5GPC A;  1IJW C;  3I53 A;  2FJ1 A;  3J7Y J;  3ZOB A;  1RRJ A;  2CGP A;  3MKL A;  2K3F A;  4PFP A;  2E5Z A;  4XKB A;  4BDZ A;  3S14 J;  2R5Y B;  3TQN A;  1Z1D A;  3GVA A;  3S1M J;  1R5I D;  4XID A;  3A01 A;  2QGU A;  1XCB A;  3O2P E;  2UXX A;  2RRE A;  5HDG A;  4Q48 A;  1FX7 A;  3KZI C;  1T39 A;  1ETW A;  2M7B A;  3K4L A;  4B3A A;  5TRD A;  4MTD A;  1OR7 C;  1J09 A;  2L5Q A;  2Y0M A;  5JHF A;  2E1O A;  3IHU A;  2ZFU A;  3V8K A;  2VJI A;  2EFO A;  2K9S A;  1MGT A;  2HKO A;  3DEU A;  5GTH C;  2KIM A;  4Y7N J;  3HPH A;  4ZYA A;  4C9Y A;  3HHH A;  4RM2 A;  2Q0O A;  1LNW A;  4RAG A;  2VLA A;  4V2G A;  2JPC A;  4KT5 C;  2Y69 H;  4UB8 C;  4AC0 A;  4Y33 A;  2F6C A;  2JQ7 A;  1K4S A;  3ZCO A;  3H36 A;  5KK1 A;  4D5F A;  2DMU A;  2CMP A;  4LLL A;  2DT6 A;  1X4O A;  3TMO A;  2VON A;  3PQK A;  4RGU A;  3HOZ J;  1B6A A;  2CUZ A;  2DTR A;  2WY7 Q;  2EFW A;  2CWE A;  1G59 A;  2STT A;  5DEQ A;  3N97 A;  2DO7 A;  4DNC A;  2GIV A;  2K02 A;  2MH2 A;  3I59 A;  4P9U A;  1DU0 A;  3E6B A;  4ESF A;  5KHD A;  4M9Z A;  3ZXS A;  2FBH A;  1AHD P;  2UWM A;  3IH3 A;  3I9V 2;  1P4A A;  3KCC A;  3HOS A;  4X6A J; 
#chains in the Genus database with same CATH homology
 5GAH J;  1VQP I;  1QA6 A;  3CCU I;  1YIT I;  3CCE I;  1VQ9 I;  3G71 I;  2ZJQ F;  1YHQ I;  3CCR I;  1VQM I;  2E35 A;  1VQ7 I;  4IOA F;  4IOC F;  1VQ6 I;  5DM6 F;  3CCL I;  4V19 K;  1HC8 A;  3CMA I;  3CCQ I;  1YJW I;  1VQO I;  3I55 I;  1VQL I;  2H8W A;  2QEX I;  3CJT B;  4UY8 I;  5DM7 F;  1VQ4 I;  1FOW A;  2ZJP F;  3J7Y J;  1FOY A;  1YIJ I;  3CC2 I;  2K3F A;  3CC4 I;  2QA4 I;  1VQ8 I;  1ACI A;  1YJN I;  2E34 A;  2FOW A;  3CCM I;  2OTL I;  5GAD J;  3CCJ I;  3CCV I;  3PIO F;  2ZJR F;  3DLL F;  3J7Z I;  3CC7 I;  2E36 A;  3G4S I;  4IO9 F;  3CF5 F;  5JVG F;  2JQ7 A;  3I56 I;  3CME I;  1YI2 I;  1Y39 A;  5GAG J;  2NXN B;  1YJ9 I;  3PIP F;  1FOX A;  1VQK I;  3CD6 I;  3CCS I;  5GAE J;  3G6E I;  1MMS A;  1S72 I;  2OTJ I;  1VQ5 I;  1VQN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...