1XDSA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) and 11-deoxy-beta-rhodomycin (dbra)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
336
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGERPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDDAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
molecule keywords Protein RdmB
total genus 101
structure length 336
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xdsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xdsA03
2E1NA 5LHHA 2H1RA 5FO5A 4F85A 1ZRCA 3ULQB 5FGMA 4ESBA 3BUSA 5HIKA 3HUGA 4QTTB 5LSAA 5DWQA 3GXOA 4YUXA 4UV8A 2HOEA 4EGYA 1S3JA 3ME5A 4X60A 1JQ3A 5HDKA 3GFMA 2A61A 3PQKA 4DCGA 4BAYA 2DBBA 5CVVA 1NW8A 5L3EA 1O3TA 4U0WA 3F22A 1FOKA 3M8FA 3TKAA 1ON2A 2OQRA 3MCTA 2ZNYA 2BM8A 3JWJA 3THSA 3L00A 4RTJA 3QAHA 3J80K 3KR2A 3O2PE 5L3BA 3M8EA 5LQRA 4AZWA 1K7AA 1YLFA 3G5LA 3FMQA 1U2ZA 4H0NA 4CTKA 5DD4A 1K6OA 1BI3A 3EGIA 5CVUA 2M5WA 5LQCA 3GRVA 5EC8A 3GWZA 2FMYA 4Q48A 3MAJA 4A0XA 1WS6A 1P2FA 1OYIA 3DMFA 5KYGA 3G3ZA 1HW1A 1RZ4A 2ACJA 4P55A 5DPMA 3E6BA 3CC8A 4KDCA 1V4RA 2CFXA 5HOQA 3H3ZA 4A5NA 1VL5A 4RTRA 3ORHA 2VBXA 2PI0A 1XMAA 2XAQA 3HRTA 1LEBA 3L7WA 2JJQA 3F3XA 2PWYA 5EQJB 3J7AO 1TNTA 4GBED 2IW5A 1IXCA 2ZBRA 2E7WA 5DXAA 4BYYA 1UB9A 1TQIA 5LGUA 4HSGA 4P7KA 1QQIA 1IXSB 2G70A 4CICA 1RI2A 5HS9A 3I0TA 4RGRA 1SFUA 2AOTB 3TOBA 5HS8A 5K8VA 4D0PA 4R8HA 1CF7B 4CKCA 1KP9A 3MFKA 3S68A 2C7OA 4WXCA 4KIFA 1G55A 3V8KA 1XXLA 1U8RA 3E7PA 4KN7X 3M6XA 4PNEA 5EMLA 3VC1A 1YW7A 3G7UA 3L8DA 1XDSA 3U81A 4KIGA 2WC2A 2FHPA 3E97A 5D1HA 1JTEA 2PFBA 5EG5A 5KQRA 1DPUA 3G88A 3PFIA 3CJNA 3R61A 2O03A 1GXPA 2JT1A 3EMBA 4AX8A 3I71A 1F5TA 3T7RA 2VDVE 2STTA 2ZNZA 3JTGA 1MJFA 1HNNA 4GUAA 5JI6A 3TKYA 4C07A 2JPCA 1L0OC 4G8XA 3D5LA 3LSTA 4DKJA 1OR7A 2C6YA 3GRRA 3LQQA 3R9XB 3EVAA 2VZ9A 2B2CA 1KIAA 3DXZA 2O6GE 4UVCA 2P35A 1M6EX 4UNOA 2XASA 1IAWA 1ODDA 5D8KB 3NVMB 5ICFA 1SAXA 3BGVA 3CUOA 4QWQA 2EFWA 3RJPA 4ETSA 3KP7A 3X0DA 4LGWA 4H0EA 2C7PA 2O61A 3FMSA 5D4SA 3IRQA 3TOSA 1I27A 4RGUA 2PBFA 1RNLA 1R7JA 3M70A 2QRVA 2Y75A 1G8AA 2JG3A 1R1TA 5BMZA 1RJGA 2F8LA 1XTPA 3FWEA 3B3JA 2EB7A 2HTSA 2EFPA 1IZ1A 4OBWA 2XKPA 4XLPF 3E3VA 3F8BA 4PGGA 3BWYA 2BGCA 3TM4A 2CMGA 2D2WA 3KQQA 2IA1A 2QZ8A 2P3QA 2G9WA 2G7HA 5AONA 2ZW9A 3HCCA 2VDUE 3HCEA 3IV6A 2HKOA 2W25A 3GO5A 2RNJA 3EYYA 2C7RA 1QZZA 2XYVA 3EYIA 5LQNA 1RJEA 1Q1HA 1QYRA 2AVDA 1T43A 5F64A 3FTCA 3M6WA 3MQ0A 2GB4A 3H92A 2BR4A 4MQ9F 2IH5A 3SZTA 5FWAA 2CW0F 2ESHA 2HV9A 2HGCA 1FJXA 4WXHA 5HIIA 2ZZMA 2RDPA 1F38A 4M37A 2MA3A 3FXRA 2P7CB 2QUFA 2CMHA 3O3KA 2EX4A 1ZHFA 3FTFA 2P5VA 2J5PA 2W57A 1WWXA 2Q8KA 2GPYA 2LD4A 2EFQA 2K4MA 1I9GA 1D8KA 4Q47A 2PXCA 1KQ9A 2QRVB 3F8CA 1R6AA 5IKMA 4ZZDA 5DLYA 3HTUA 4RTNA 2QM3A 2IH4A 4HA8A 4OIOF 2EV5A 1N2XA 3G89A 3J81Z 1YZHA 3RKYA 3JTHA 2DPUA 4G7OF 1P6RA 3FTEA 3FRIA 1XSDA 3ELDA 1ZGAA 2HZTA 5HEKA 4CTJA 2YSRA 5M5BA 4PCQA 2OQGA 1B4AA 1O54A 4QTUB 1MDMB 3CO7C 2O06A 4ATNA 1RIOH 5DTRA 4ENMA 3DF8A 2BZGA 2PXXA 3G8AA 1Z7UA 1I5ZA 4ER3A 4M38A 3BDDA 3B02A 5LBQA 2PX2A 2HNKA 5E2AA 3UBTA 5D1NA 3KEQA 3K69A 1B6AA 1EAMA 4EM2A 4Y13A 1G6NA 4WWCA 3LPMA 4NHJA 1LNWA 5DM0A 3GZ5A 1JHHA 4FSDA 5FFXA 2HYGD 2RGVA 4DF3A 5HZMA 4IRGA 3T1BA 3IWZA 2H27A 2IVMA 2JH9A 4FT4A 2AN3A 4RTQA 2ERCA 3ZMUA 1NW7A 1BJAA 5E2BA 5DCFA 1LDDA 3BOQA 1MJ9A 2JZYA 5KVAA 3KQVA 1IN5A 1ZGJA 1G4DA 3EPPA 4CKEA 4KNYA 4KA4A 5FCDA 4L7VA 1HKQA 3LFKA 1HXDA 4KRGA 3E23A 3KZYA 4P7JA 5EOVA 2A69F 3M1EA 5CVIA 4KMUX 3HCDA 4R05A 3LKZA 3UJ9A 3MERA 1HKSA 2IP2A 4DZRA 5LHIA 1QPMA 1XGSA 3RYPA 1D2CA 4ZYGA 1L3IA 1RI7A 2Y0MA 4MHGA 1FBUA 2DO7A 3SHFA 3HM2A 1MKMA 3AAFA 2YX1A 4HBLA 1FYMA 2JTVA 3TDUC 1FWZA 2KRFA 3OFJA 2EJRA 1OR8A 3TM5A 2CSOA 4EJUA 3AY0A 2GA1A 5D4RA 4MIKA 2AVNA 2JHPA 2PVCA 2KKOA 3KR9A 3RTRA 2EFOA 4OA8A 1NKVA 4Q5SF 5K0LA 4HV5A 4R6WA 3F8NA 1Q0SA 3HSRA 4KT5C 4WXDA 2H6BA 1UFKA 5T6BA 3O31A 3SR4A 3DEUA 3G8BA 1DL5A 4P5OA 4N9IA 3EVBA 3LKDA 4G9YA 5A2QZ 2DFIA 2OO3A 4MQ4A 5DM1A 3BWCA 3DPLC 1QZYA 4RTMA 3NDJA 4DM3A 4HTFA 3P71T 3V8VA 1B42A 3ZN0A 4QDJA 3NEUA 4LWOA 1ZG1A 1XMKA 3PLAE 1R8XA 3TLJA 5KQSA 4OQDA 3Q5FA 1P91A 1Q0TA 3L09A 2W85A 5FLXK 1LDKB 4M9SA 3K1MA 4N0BA 2OYRA 4F86A 1TBXA 5ED4A 3F23A 4AIKA 4CXFA 1YUBA 3V7RA 1EV7A 3ZMZA 2AN5A 3FF5A 1FBNA 4HTFB 1NW6A 2FA5A 5DSTA 1D8JA 2FE3A 2W24A 4I02A 4LK1F 2RKHA 4BHPA 3K0BA 3UA4A 1JG3A 1EJ6A 4QDKA 5LGTA 1FZPB 3P2IA 5CVDA 2HYFA 4U7BA 3T7SA 1USTA 2L02A 3DFGA 1H1DA 5LRSA 5E1DA 3TOAA 3O7WA 2GZWA 2UXNA 3KP6A 4RTPA 4C05A 3K1NA 4EM0B 5ERIA 2QENA 3WODF 1H9TA 4YUVA 3KLNA 4KFCA 2PLWA 3PTAA 4LJZF 4M6YA 1UCRA 3ZMVA 3KKZA 3UJ7A 4G94A 3SVZA 4S05A 2PLYA 3KQSA 3IL2A 3ID6C 4IRIA 4ZTBA 4IHTA 3P9NA 4OIQF 2VOPA 3LHDA 3JAMK 1AQJA 4I7HA 3GF2A 2O0YA 3GUDA 3R6TA 1H9GA 1K78A 2PQ8A 2E5WA 3FYCA 3LDFA 4LLGF 2Z6AA 2V1XA 1AQIA 4R8RA 1SMTA 2JHCA 4Y30A 2NNWB 5HOOA 3DXXA 3KQPA 4DNCA 3EVEA 2E1CA 4F84A 4YV0A 5GM1A 3IHUA 5BXYA 3C0KA 5E1OA 1SD4A 2MLGA 3CO6C 3KR0A 2AXLA 2M45A 4MEXF 1ORIA 4L9VA 4S04A 4C03A 1T38A 1BI1A 3D0SA 5ICGA 2FBKA 3M4XA 2GQQA 4A6EA 4ER7A 2VODA 3QPTA 2DPDA 3QU6A 3BWGA 2NXJA 1W5SA 1HSTA 5E1ZB 1ZYRF 3WG9A 3I59B 4POOA 4AD9A 1XJ5A 1IF1A 5K01A 3SGLA 5EEHA 1J2XA 5BPIA 2K4JA 3K9TA 3U1DA 4KIBA 1ZG5A 2FK7A 2UYQA 4GF5A 4IXAA 4QVGA 3A7DA 5FULA 2PGXA 2UWMA 2AS5F 5AIQA 1T0FA 4ZYHA 4KMFA 1O9GA 4PYQA 3TR6A 4JQFA 3RIRA 3BXOA 3OV8A 1S6LA 1Y8CA 2YTZA 2L4AA 5EZSA 2I6GA 2FK8A 3FMRA 5EPEA 5H6QA 2DT5A 5AIPA 5F1RA 4E70A 4L0ZB 5DYMA 3OZRA 2M87A 2EK5A 3G73A 1QBJA 2BYVE 4PONA 3E6DA 3I59A 2LF8A 1PRYA 2QQ9A 2VBWA 5ILVA 2IDKA 3WTSC 5JR3A 2COMA 5DM2A 2O3FA 5D5VB 5CM2Z 2XAJA 1YS6A 5DT2A 3KQYA 4PZJA 4ER5A 3E05A 4OQEA 1OPCA 2PSSA 4ENNA 3IHTA 1IRGA 1YF3A 4K6MA 5HS7A 3OU2A 2XROA 2L54A 1L3BA 1W5TA 3H2BA 3ABTA 2VC1A 1CF7A 1X1CA 1HW5A 5DEQA 4HDVA 4PYMA 4HLXA 2ZIGA 4RS8A 2PEXA 3FPHA 1O7FA 3T5XA 4RTOA 1XGMA 1XSVA 2E7XA 1S7OA 3OE4A 1EG2A 3I5UA 3HSEA 5FA5A 3E8SA 1P1CA 3BWBA 4AIHA 2EA4A 3KHKA 1JG4A 4HH4A 1KR5A 2Y1WA 2LKPA 4BH9A 1TTYA 2IPXA 2DLLA 2IA0A 3GRUA 3HHHA 2O57A 3HEMA 3OE5A 1G8SA 5CVJA 5D6FA 4XUDA 1STZA 5E9QA 4WX9A 3C6KA 2AOUB 1WG8A 1VE3A 4RYLA 5FUBA 2DI3A 1XN7A 1J7KA 2JSCA 2XHKA 3HA3A 1ZQ9A 3LBYA 2ADUA 4HV6A 2D1VA 5GIOE 2PG4A 4EMSA 3EUHA 3KCCA 3F4KA 3T0IA 4GOLD 3G2PA 1D2HA 2IDJA 5LQAA 5D5UB 1NW5A 3DXJF 2P3LA 1VP3A 3LL7A 4WCGA 1YIOA 2UZKA 2PBIA 4HF2A 4AZVA 1EH6A 4MGRA 1ONVA 2YXEA 4L0YB 1XVAA 1IN4A 1ZREA 1KU9A 4ESFA 1KYWA 4FT8A 3I53A 2CWWA 2DULA 3TQNA 4YG2F 5CIYA 1B59A 2AOUA 1RI4A 3HOTA 2X4HA 5ILSA 5LQJA 5GINE 1QGPA 2OBPA 3T7TA 1RJDA 4PYOA 2AOVA 2FYTA 4RVGA 5K0GA 3JSOA 4WF2A 4HC4A 10MHA 1LJ9A 4RV9A 2F5EA 1BM9A 3RPUA 5EGSA 1SKMA 3GRZA 4HAMA 2P8JA 1YW8A 4RAYA 1NE2A 3WTYC 2YX7A 5FADA 3V7CA 4P9FA 5DUIA 3PX2A 1O3QA 3DUWA 3FPGA 1Z9CA 4M7RA 1LB2A 2IPQX 5DM4A 3P9KA 4LWPA 1NW3A 2WTEA 4CXMA 1Z6TA 2BV6A 1QAOA 1P92A 1WI9A 3UJ8A 2N47A 3KP5A 1H0MA 2XVMA 3COAC 3CJTA 4PYKA 3ERED 2NYUA 3G2OA 1U5TA 2EFJA 3NWEA 2M8EA 5LR6A 5DCMB 3KE2A 2LSOA 1SG9A 2HWKA 3EVGA 1SFXA 5P8WA 1O57A 5IH3A 1IW7F 4U7TB 1F1ZA 2BR3A 5K5RA 3DP7A 4HQMA 2XYQA 2IT0A 3RKWA 1S8NA 3DLCA 2GAUA 1EJ0A 3PFGA 1KU7A 3E5QA 2ZVJA 3LDUA 1XCBA 3PT9A 1SD6A 5E20A 3DTNA 2XAGA 2QYOA 3QRFF 4IHSA 2ESRA 4U7PB 1X1DA 3PVCA 5BP7A 4PYLA 4JK1X 2HTEA 4GOMD 2VE8A 2AS0A 2EA2A 5J8CA 2FCAA 3ERCA 1T39A 2GH1A 2O07A 3GGDA 5FA8A 3ZP5A 5F2KA 2CL5A 2C7QA 1PUEE 3M6UA 3KP2A 3WTVC 1ZRFA 1JHFA 1N7JA 3NW9A 1DPRA 3WTTC 2GWRA 4XRFA 3BT7A 2OZ6A 3PX3A 2BEOA 1HMYA 1XDUA 4UOEA 1E2XA 3NVKI 5FQOA 1WQ2A 3LQRA 2Y48A 2CWEA 1BOOA 1SQGA 2ZMEB 3LBFA 3MB5A 2VBYA 8MHTA 3BZBA 1AF7A 1WZNA 5K0JA 5F6FA 5HLHA 1U2WA 1JXSA 2QE6A 3WTWC 5CVEA 1SUSA 4A0ZA 3W6JB 3FUWA 3HA5A 5U4XA 1ON1A 4KDPA 4P9UA 2GLUA 2Z33A 4MEYF 5A2QK 2G72A 1HKTA 3ELKA 4AZSA 5K05A 3IWFA 4HX8A 3FTDA 2G71A 2AOWA 3ZPLA 2ELHA 3NTVA 2VN2A 3CJQA 2FU4A 5DUKA 3OPNA 2P5LC 1SMYF 3F8FA 1R58A 2NXEA 1ZN2A 2ZFUA 5EHIA 4ER0A 2NP7A 3RPQA 4RWZA 4KWCA 5H20A 1UHWA 4ENJA 4E2ZA 2TDXA 1KU3A 2UYCA 2JPBA 3ROUA 1B9NA 1W4MA 5EMMA 2ISYA 5J6XA 3TQSA 1XGOA 2OU2A 3GX4X 1JQEA 3CJRA 4HG2A 4PCAA 4XLNF 2FF4A 5TRDA 2K4BA 2LDUA 3HOSA 1QAMA 3THRA 2ZZKA 5HIMA 3P2EA 4GC5A 2P40A 2QQBA 3KPVA 1UHMA 4F7ZA 3C3YA 4MWZA 4XUEA 4R79A 1KHHA 4ESJA 1S29A 2G8NA 2YR2A 5IT3A 5K03A 4M74A 3Q87B 3LDGA 5T64A 2WK1A 2XBMA 2EJTA 1INLA 2DK8A 4WK8F 3LWFA 4P7GA 5DV5A 4EKGA 3V8LA 2XRNA 3LX6A 2B9EA 1BN5A 4MQVA 5GP1A 5H02A 2B25A 2V1DA 4YUYA 2Z6QA 2VBZA 3VSEA 3GVAA 5HDGA 2ESNA 1M6YA 5DD8A 2ZSUA 2HR1A 5EVJA 2P41A 2PX8A 4RVFA 3TO9A 3R0QA 3OZTA 4EJTA 3E5UA 5EKUA 1IUYA 1SUIA 3KP3A 2R6ZA 4M6XA 1MD0A 1OMIA 2RV8A 4PCLA 4RB0A 1EH7A 1VIDA 1GHCA 4OBXA 1D3YA 2P7HA 2UZ4A 3VYWA 4U88A 4O5VA 1X19A 3UFBA 3S2WA 4RTLA 4HLYA 5L3FA 2QVOA 3B89A 1XSXA 4CZZA 1G3YA 3ZN1A 2I62A 5CYVA 1VQ1A 2Z6UA 3I54A 5EZQA 4RTSA 4XUCA 3CLOA 3VC2A 2K27A 4EV0A 2VONA 5DXJA 4CO8A 2JRTA 5EHGA 1DUSA 3WU1B 3GRYA 4GYGA 2YQZA 5ILUA 3RYRA 2GA9A 1REPC 2MC3A 4XBFA 2NXNA 5GOZA 2RVCA 3DR5A 3EEYA 2LF7A 3GO4A 2MH9A 3LGAA 1SFEA 2V79A 1U3EM 1MJAA 3RDIA 3HCFA 3GDHA 4PIMA 2KJBA 4ON0A 1DUXC 2OZVA 3GYHX 1J0RA 3LAJA 3V4GA 4I2OA 5K09A 4G7HF 5FD5A 2XKOA 4CKBA 3P2KA 1ZKDA 4YFKF 1AV6A 4R1HA 3SXYA 2FNPA 3ZMTA 4FZVA 4HRAA 3OCJA 5D8LB 1J59A 3UA3A 4IV8A 3DPTA 2O05A 1FPQA 1FBQA 3BKXA 5HFJA 1FSHA 4EGZA 3U9GA 4R6XA 5FWDA 2KW5A 4OX9Y 1BI2A 5K1YA 1U6GA 1IXKA 4KUMA 1D5VA 4FS8A 4DCMA 3C6MA 3MGGA 3NWBA 2H6CA 1S7AA 5LLQA 4FGZA 2FQ3A 3P9IA 3UJAA 2K7LA 5K0FA 4MTEA 4OIPF 3HVJA 1IN7A 1J9IA 1WRJA 3L9FA 3PQJA 4RGXA 1UFMA 3I64A 1YYVA 1KGSA 5C9ZA 2FBIA 4UVBA 2PMUA 3FYDA 3KEOA 1IN8A 1WSUA 4L5JA 2STWA 3Q9SA 2CKDA 4NB5A 2V1UA 2P6SA 2PJPA 2NAZA 2IA2A 3EVCA 3EVDA 2KIFA 5GIPE 2Z5UA 3BGIA 3SFZA 3EETA 4LG1A 4ZYEA 3I9FA 4G6DA 1GVJA 5LHGA 5IT9K 1R74A 3QOWA 4GYIA 5E1WA 4WVLA 2NS0A 3M6VA 4CHUA 1KPGA 5HILA 3ZQ7A 2MH2A 3U2RA 5EMJA 1J75A 4BP3A 2IBSA 4UUVA 1RUNA 5BPDA 3MEXA 2XUBA 2NNYA 3PS9A 3C3PA 2Z9OA 3OU7A 3N4MA 2H94A 5CUQA 1LDJA 3I4PA 2ZTHA 5K0NA 4RGSA 1U78A 3DLIA 2EJUA 5LQUA 4EQQA 3GU3A 1KPHA 2DW4A 2OB2A 2Y1XA 4R8SA 3LCVB 3CKKA 2QY6A 1OYYA 2XAHA 2MBFA 4QPPA 4M72A 4Y15A 3SSOA 2P4WA 2EV0A 1QAQA 1XB4A 2DTRA 3EGVA 3FUXA 1FP2A 1YFHA 2OBFA 5E9JA 1HW2A 5LEJA 1YQAA 1FP1D 2DU9A 1NBIA 5BS6A 4UVAA 2QBYA 5E9WA 2VE9A 1T98A 4K2EA 5K0EA 4M71A 4EM1A 1PP8F 1LVAA 4ASNA 1NV8A 2I7CA 4BQAA 2VT3A 4QVKA 2AR0A 1Z1DA 3O4FA 3KQMA 2DQLA 2GIVA 4GQBA 4I09A 2PMHA 4FT2A 1W7PD 3QP5A 3P8ZA 2ADMA 3Q7EA 3FUTA 3GNLA 2BM9A 1TQMA 2CGPA 3HVKA 4FP9A 4KW7A 3FPJA 3CTAA 3EQLF 1PP7U 4HYEA 2P8TA 4Q4ZF 4PDKA 4A2UA 2HS5A 4YIFA 2EWNA 2P7IA 2QWWA 3G5TA 3VB2A 4ZZLA 2ZO4A 1QO0D 3HVIA 3UJDA 2DPMA 3A25A 4G6QA 1LEAA 3O6BB 2KIMA 2NYXA 5HVQC 4IWNA 2O8XA 1K79A 1AOYA 2CQKA 4GO1A 1FX7A 2KJCA 4BLUA 5BW5A 2GA2A 5E8IA 3QV2A 4E32A 1KYZA 4FX0A 3WU0A 1CGPA 2I9KA 3KFWX 3WE3A 2CG4A 4E30A 1ZG3A 4PINA 3DMGA 3ER9A 3BGDA 3DH0A 1R18A 3DV8A 3ZMSA 3OFKA 2YPRA 1FBSA 2DK5A 3V8JA 2OB1A 4FSXA 3SXJA 5D5XB 2WV0A 4LLLA 2ZCJA 3UJBA 3F6OA 1I1NA 3REOA 4GOND 2KIUA 4MNUA 1QANA 3V7SA 4AWXB 4LK0F 4I0AA 4OOIA 2D45A 2ETHA 4IVNA 1MZBA 5J8FA 3EVFA 1G38A 3BY6A 4IRHA 4RAZA 5L3CA 5DRTA 5DX8A 1PJZA 2PKWA 3A26A 4B17A 4X1OA 1WY7A 2QQAA 3WE2A 2IRFG 1R1VA 4MTLA 1XGNA 4AIJA 4O3MA 5C1IA 2ONYA 3BWMA 3HSFA 4GC9A 3QU3A 4LG0B 1V3FA 1F4KA 1P39A 2EV6A 1SVUA 3VEPA 2QLZA 2XYRA 4M9XA 3UZUA 1T2KA 4C4AA 3M9AA 1O7LA 4RVHA 4EJOA 1ZARA 3DXYA 1BC5A 2V7EA 5E8JA 4TV7A 2RQPA 2L4MA 3BJ6A 5D6EA 3TPZA 1OYWA 2YXDA 4DMGA 1JR4A 2IH2A 2ZJ2A 5JFRA 2A6EF 1T6SA 3LECA 3GEZA 4LLNA 1ORHA 3FM5A 3TO6A 3LA2A 1TQPA 2FOKA 4XSXF 3HRUA 4OU0A 3R4KA 3HRMA 2DQRA 2L01A 3SSNA 3TMAA 3R6SA 2HQRA 3IYLW 4UV9A 4QQNA 2A14A 3FPEA 3ML6A 2ZIFA 1SQFA 2OAZA 4Y17A 1IN6A 2PT6A 1B1BA 3P97A 4HDUA 5BOXA 3CUQC 1F9NA 2Q2EA 1FC3A 4E31A 3NDIA 1XCVA 2K86A 2D1HA 1C0WA 1NHAA 5K5OA 4BXUA 4OMZA 3HCBA 1U5TB 4V0QA 1TNSA 4JBAA 1YW9A 1Z05A 5E1MA 2ZLBA 3A27A 1ZLJA 3ZMDA 4DQ2A 3KPWA 5KS2A 4OIRF 4UHTA 4L18B 4UXNA 5HLIA 2WA1A 3G2MA 4QPNA 3IKVA 3KZZA 2MLKA 3HRSA 2PX5A 3TRKA 1ZAOA 3ELUA 3B3GA 3QPHA 2ZWVA 4FHTA 1EQAA 4B09A 2Q0OA 3AXTA 3M33A 3NJRA 2DAOA 1HSJA 4A0YA 2PJDA 5KK1A 1NBHA 2VS1A 4U0VA 2BE5F 3MWMA 3R24A 4A12A 4PYNA 1ZLKA 3NRVA 3HIFA 4LG0A 3FHZA 3ABUA 2CO5A 2OY0A 2FBHA 3LCUA 2XVCA 2ZIEA 2GAFA 1G6Q1 3CUQA 2FNAA 4OA5A 3K6RA 2R7DA 3T8TA 9MHTA 3JAMZ 5E1BA 5GM2A 3FXUA 3FM3A 5C0OE 4KICA 2VOOA 4QLCU 2FRXA 3NMUF 1I1SA 4LECA 5FD6A 2HWVA 4HF1A 2WWYA 3IRRA 1JSZA 4LD5A 4BHCA 2AZTA 3I58A 3TFWA 1P1BA 5K0CA 3FZGA 2PN6A 1L9KA 3R60A 2HEOA 2PT9A 3IEIA 4IJAA 5F2OA 3CUQB 1F3LA 3EMDA 3R0AA 1FYKA 3MAGA 2ZBPA 3T0YA 3WSTA 4BHBA 3JSPA 3WTXC 1YTYA 2J5OA 3W6KB 4X61A 1MHTA 1A04A 1R36A 1RI1A 2BH2A 1JG2A 4X63A 4BY9E 2YUIA 3BPXA 3HA7A 3ECHA 2P5KA 1IM8A 3F21A 2B3TA 3LA3A 1ZH5A 3WGIA 2UXXA 4V0RA 2VT2A 5H6RA 2ORED 5DX1A 3SQNA 2WA2A 3UWPA 2ZBKA 2Z3YA 3B73A 1Z6RA 3BROA 2ZFWA 2F2EA 2ZBQA 4Y2HA 1Y0UA 1JTFA 3TO7A 1KQ8A 2PY6A 3KP4A 5LQKA 2M1BA 5DCMA 4GOOD 5EIFA 2YU3A 2H11A 5DSXA 1KA8A 4Z2YA 2ZULA 3DOUA 1N7IA 4MHTA 4CYDA 2VXZA 3LCCA 1O3SA 1GXQA 2PX4A 7MHTA 5LEKA 2FSWA 2NNNA 5JVTA 1I4WA 2EG5A 4EK9A 4NQWA 3HP7A 2OPBA 3WTUC 2B0LA 1R22A 2IBTA 5LGNA 2ZWAA 3L2CA 3Q9VA 1WXWA 2P7VB 2XIGA 3C18A 1UIRA 5FHQA 2RN7A 5BQTA 1RJFA 3KPJA 5CVRA 5E17F 1BBYA 4HGYA 4ZH4F 4YV1A 3K0LA 1HBXG 3D2LA 4IF4A 3GIWA 3K2ZA 1G3SA 2G7UA 3UJ6A 4GGGA 3KQWA 4HGZA 1J5YA 3MZYA 2P1DA 4GXOA 4EJVA 1V39A 3SSMA 1YS7A 3KQTA 1E17A 3C3WA 3BP8A 3P7NA 3FX3A 2ONZA 4HQEA 4I0BA 1BC7C 3AWIA 3N97A 3KETA 3KQOA 3ELYA 4LFUA 1NV9A 3G2QA 1R5HA 4I98B 1JQDA 4L9JA 1BOAA 3DQVC 2M30A 4O6JA 5CJ9A 1K78B 4P96A 4A5MA 1ZRDA 1G60A 3FUVA 4EQZA 3FRHA 5ICCA 1SD5A 2A68F 3H3UA 2V74B 2VP3A 2FMLA 4YIIA 1O9HA 4BLVA 4HZFA 2F5CA 2OXTA 4G7ZF 5CLSA 5KVRA 1FYLA 3ISPA 5E1XA 2Q41A 5DX0A 3WTZA 4P7FA 2IJLA 3FPFA 2P3OA 1YFLA 2AN4A 3PB3A 2OD5A 3GFIA 5IT9Z 2O0LA 3ECOA 4NECA 4PYJA 3E6MA 4KDRA 1VP9A 2R3SA 3VFZA 4GEKA 3OZSA 2AOTA 4YFNF 4G56A 1KXZA 1XD7A 1R23A 4I01A 2YVLA 1WXXA 5E8GA 2FPOA 5CCXA 3MHTA 3GFJA 3WGGA 5JUWA 5HDNA 2YR0A 4FX4A 2BBYA 3RI4A 5EMKA 3QOPA 5D5WB 1D2GA 2X0LA 2GS9A 3GW2A 1DCTA 4L5IA 1EH8A 2CYYA 5FB2A 1FLIA 4C06A 4YUZA 1HQCA 4N9HA 1L3LA 3ANXA 3GZ6A 3CCFA 3KPYA 2NXCA 2IIPA 3EVZA 4KVZA 1JGSA 3GJYA 4BNCA 3KU1A 4PGHA 1RUOA 3ELWA 5BW4A 4KYWA 2A5YB 3B7PA 3OOPA 1YB2A 3HVHA 5FFZA 3MTIA 1XCJA 2MD5A 2PWPA 3J81K 2YX4A 4LB6B 3B3FA 2BR5A 5MHTA 2FXAA 2G1PA 1TW2A 4X41A 5EKXA 5CCBA 3M7GA 5FQNA 4IKPA 2NRAC 2H09A 2FEZA 4RTKA 3MZHA 5TJJA 4DA4A 3RODA 1SD7A 1QNTA 3E5XA 1Z3CA 4E2YA 2VDWA 2XAFA 4KN4X 4B8XA 3F6VA 1I1GA 4LB5A 5EIWA 1AWCA 1FT9A 3JWIA 3GCZA 3KLOA 3P9CA 3HHGA 2ZMEA 3EEOA 1I6XA 3BKWA 3BZ6A 1L1EA 1P4WA 4O29A 4RSRA 4LMYA 3CDHA 1XDZA 4E2XA 1RI5A 3HTXA 2XGXA 3FXQA 3F8MA 1YFJA 2A6HF 1XCLA 4RB2C 3CGGA 1IY9A 4P58A 2HKXA 2A3SA 1R5GA 2R7FA 3B5IA 4IV0A 1FNNA 3A7EA 3DULA 4CWAA 3SZPA 3JWGA 3SX0A 4M36A 4L9TA 5F2NA 4PWYA 3R0JA 2HQNA 1USSA 1BHJA 3E6CC 1TPYA 2XVAA 3KR1A 2ZZNA 1VLMA 2F5DA 4XCXA 4YFXF 1TW3A 2B78A 3NQOA 2ZKZA 4C04A 3BPVA 3MTEA 3OU6A 2RC4A 2JHAA 4M73A 4YV2A 3C1DA 3EGEA 3BJOA 3UJCA 3MCZA 2IGTA 3VOEA 2F5FA 3C7JA 2JH8A 3HTSB 1KU2A 2K02A 2ZCWA 3JW4A 4RB1A 2GXBA 1BKYA 1M0EA 1NT2A 2ZXJA 1X1AA 5GWXA 4DQ0A 3DMHA 1PDNC 2H00A 4GCVA 1G3TA 4FR0A 2HFHA 3WGHA 5B1SA 4BP1A 4AVPA 2HR3A 4ER6A 2UYOA 3V97A 5DRYA 4ISCA 1FY7A 1U5TC 1B9MA 2XV4S 1WKMA 2OA4A 2OKCA 4AUKA 3SM3A 1KQ0A 1BC8C 2YXLA 1EIZA 1JG1A 3GLXA 2V9VA 4M9ZA 3JWHA 1TLHB 5T67A 4YMHA 5FTWA 2P6TA 3HYIA 4OMYA 3BJAA 2ISZA 1VTNC 1MDMA 1BI0A 4EVIA 1R00A 3HCAA 3SMQA 1VPTA 5CD1A 4U0YA 4HX7A 6PAXA 5DTMA 2Z99A 4A6DA 3FZVA 4JXJA 5L3GA 1JE8A 2FRHA 5L3DA 1UWVA 1R8YA 1YG2A 5E18F 1Z91A 3RKXA 4PYIA 1RI3A 5FLXZ 3LA7A 5K0BA 5DDGA 3ER8A 4HW0A 3TGNA 2HDCA 2PXAA 4RB3C 4EJWA 5FHRA 2V6CA 3CBGA 1X3UA 3LAPA 4CGZA 5EEGA 2VC0A 2HMYB 1W7PA 3RIEA 2L3DA 1MGTA 1O3RA 2UYHA 3AXSA 4C08A 2GXGA 3MQ2A 1BIAA 2EFNA 2OZUA 5LRRA 1JSXA 4YMGA 4ZYDA 3GFLA 4RVDA 3FUUA 4QQKA 5JHUA 3HNRA 1DDNA 3K1PA 3CVOA 1FSEA 3QP6A 1P4XA 2QBYB 4XSZF 1IXRC 1W7PB 3R3HA 1KPIA 1X1BA 4EKIA 2AOXA 3QOXA 4PIPA 5G02A 1ULYA 1LQ1A 2LNBA 3A4TA 4MTDA 2A07F 1MJBA 1L3CA 1P4AA 4HX4A 4HF0A 3T8RA 4OINF 3RW9A 1YZ3A 1IRFA 5HLGA 3IKTA 1DP7P 2PV0A 4E2WA 4U7DA 4IPAA 3IC7A 5DTQA 2IFTA 1VBFA 5E8RA 3VODA 1R1UA 3AJDA 3J80Z 1BIBA 5ICEA 1G3WA 4L9NA 3PFHA 3KPUA 5HIJA 4RX1A 2W84A 4ENKA 4CDGA 4AZTA 2NP6A 4HOBA 4BLWA 4YUWA 3TDZC 4E33A 3F72A 5ERGB 2HTJA 3DKWA 1OKRA 5K5QA 1YO5C 3EDPA
chains in the Genus database with same CATH superfamily
4GOJA 4LY0A 3LP5A 4C14A 5IWCA 3ROMA 5SZHB 3ULQB 1NW9B 5HIKA 5JPDA 4RULA 1GP2A 5U4QA 1FYDA 3OBBA 4IWYA 3GXOA 1UKCA 1TK9A 3DBRA 1VQKI 1HDEA 2I22A 4QVIA 1MBHA 4ME6A 4JP1A 5TQVA 1OAOA 2IYEA 5HDKA 5LBUA 4JY7A 5BY2A 3OZBA 3G8DA 4MWTA 2DBBA 2IXBA 5CVVA 2W5UA 3UAGA 2C7BA 2WBLC 5L3EA 3C1OA 1H89C 1RXVA 5GADl 1VE5A 4FR5A 4CL8A 1JDUA 1W4BA 5LZ4A 1PJ4A 2G25A 2ADOA 2Q9BA 4B0OA 4G5QA 4FMDF 2BXZA 1H2EA 5JS2A 3OT1B 1OLSB 4WZBA 3UMJA 2V6EA 2RG1A 1NVVQ 3D81A 1WIWA 1HUQA 3EXG2 3LSYA 5GQSA 3THSA 1QFXA 1E5LA 2HBRA 1YDWA 2VHWA 2XLBA 4RTJA 4D9NA 5EJ4A 1XA3A 3IJPA 4DLNA 1YXMA 1YVPA 1XFAA 3CRMA 5AT1A 2B82A 1XZEA 2YHIB 3F5MA 1I13A 4LRTB 5FOUA 4AZWA 5LQRA 1YLFA 1U7ZA 2ZUFA 4BAUA 3FMQA 1EBBA 2X9GA 1U2ZA 2VNIA 3K5IA 4PLTA 4R7TA 1K6OA 1ULHA 4CTKA 1BI3A 3FXMA 1OV4A 2Q4BA 1GDHA 2WFZA 3EGIA 3NV7A 4EB6A 3HDYA 4LYHA 1OWOA 4R41A 1YMVA 2CLCX 3DSRA 1ZISA 5IJ9B 5LQCA 3GRVA 1LK0A 3QKIA 3BH7A 1JUSA 5EC8A 5IC6A 2FMYA 4Q48A 3MAJA 1SC7A 1LVGA 2EDAA 3QF4A 3QTBA 4A0XA 4AVZA 4IX1A 5FNZA 1CS0A 4JP8A 2EZ4A 3RIMA 2H07A 5M3MJ 3P2YA 4IHAA 2Q46A 5SYAA 3RS4A 3GA7A 2PYIA 4FDUA 4AKTA 4EJ2A 3EGOA 2W43A 4GXTA 3CCMI 1WS6A 2Q5OA 2VQSA 3CLSC 5KWVA 3GLIE 2WU1A 3WWCA 1EKXA 1LC3A 3ADKA 4XCQA 4LRYA 1JAYA 1RZ4A 2ACJA 3OVMA 4P81A 4WDRA 2PRYA 3D3QA 4A0RA 4OY3A 1VQ4I 3E6BA 1X15A 2QVBA 3HYSA 2CFXA 2ZR8A 4GP6A 2LCFA 4IIEA 5DMHA 3H3ZA 2FP4A 1ACLA 4HRVA 3ZZ1A 5ES3A 3JYQA 5DI3A 1RYZA 3QU4A 4I08A 4MUJA 5E0KB 1JMKC 3RUFA 4ZICA 4F9GA 2FWJA 5FL7A 5FYQA 4YCNA 6ADHA 1XMAA 2XAQA 1LEBA 3KJGA 5BSMA 1ZD3A 1M2OB 3L7WA 4JLKA 2VDRB 5EWLA 1F17A 1L8QA 3MWYW 5EQJB 3LPLA 4JB0A 1DRWA 4IO1A 3CWCA 5T7BA 1VKNA 3NXKA 1IXCA 2O8DB 1SQSA 1IM5A 2GLXA 4EO9A 3CQZJ 3ABOB 5H3HA 2CQ7A 3WK9A 2E7WA 1E7WA 4BUZA 1XVTA 3QF4B 5IYDJ 4V2UA 1FMWA 4BX2A 2F4IA 1FA9A 3OZ7A 1DU6A 4P4LA 4HEHA 4XJXA 4QNNA 1ADGA 1DBWA 1Z2EA 1RI2A 2FSVC 1Y98A 1JG6A 3F71A 4LE1A 1SFUA 2AOTB 4L78A 4EZBA 3TOBA 3WLOA 4DAOA 5HS8A 5A5VA 4D4KA 4R8HA 1T0FC 3FBIB 1CF7B 3KYIB 4PGMA 1JR3D 1UMBB 2ZAIA 3OHSX 3WJ7A 2W6OA 1J8MF 1LSSA 4UHBA 5EERA 3T1OA 4D9EA 3GP8A 3CF5F 1R3DA 4NCJA 2BGMA 5TGDA 5EYRA 4Q24A 2Y1CA 4ASUD 3S70A 3TI9A 1DPGA 4QARA 2OPTA 3FNQA 3IQZA 4WXCA 3I04A 4KIFA 1G55A 3V8KA 3BSWA 3MKWB 4U7JA 1U8RA 1W36C 2OV6A 4ZVQA 3WGJA 4CT0A 2P5YA 3M6XA 2IU3A 3O74A 1KK1A 1P5RA 1PX2A 1WXQA 1ECJA 3P4YA 1L7MA 4KIGA 2FHPA 1O1YA 4H27A 3TRFA 2ZRAA 3AW8A 1BW6A 4IIGA 2VJ4A 3OQIA 1TK2A 4LZPA 3DE3X 4K6GA 3PFIA 3DZIA 4LY6A 3QFHA 2O03A 3F3MA 2JT1A 1XJ0A 3KELA 3O8BA 5A2GA 3NIGB 1F06A 1M2GA 4KEAA 2H9YA 2RH9B 1K4KA 3DPIA 1FUUA 4I46A 5HNKA 3JQ9C 2OBLA 1F5TA 1W4AA 1X70A 2YXPX 2QRJA 4TXHA 1GCGA 5LXTF 4B3BA 2JH3A 4BRUA 2D0DA 3GMSA 4OYRA 1RT9A 3FNGA 4BFUA 5EQFA 3AHIA 2IEGA 4EFMA 4P7BA 4PY2A 2Z98A 3C5HA 3TDNA 4G8XA 2ECBA 1Y3FE 2X9QA 3DCYA 2ST1A 2O8KA 1GSHA 5JFOA 2HM7A 3MQFA 2AZMA 4C01A 4AM3A 2D5BA 2C6YA 1Z3YA 3IAUA 4ZPXA 3PDIA 3GQBB 2VTDA 1QVRA 1CEXA 2AHOA 2B2CA 1K6IA 1GARA 4HGNA 4PTZA 3UT6A 1QMPA 2O6GE 2EH3A 2DH6A 4L4YA 4D9CA 1QQAA 3ZDBA 4UVCA 2CFOA 4MARA 3B6AA 2AC2A 4KQWA 4UHFA 3H04A 4NY1A 3E3AA 3MEQA 1IAWA 4U8HA 1ZFNA 4E2ZA 5FBZA 1K86A 1SQ0A 3VR2A 2JK1A 3NVMB 1FFCA 4WERA 1L5KA 3OTWA 2CCGA 1ISSA 4M9UA 3CUOA 2P0EA 3D8TA 2VLBA 2EFWA 4M2LA 3RJPA 2PKQP 2YIJA 1MCZA 1PJCA 2O4CA 2R92J 4LGWA 2XNSA 1JEQA 1I33A 4HUTA 1H22A 3O03A 5EP2A 3JREA 3JAKB 4IZHA 5TRTA 3D2AA 4BQEA 3NTRA 1R7JA 3FPSA 5L6LB 1ZLXA 1VSQA 2PX9A 1ZX1A 4A0HA 1R1TA 2JG3A 1H2FA 3SKXA 3CSDA 3O2QB 1CUFA 4EVSA 1E0JA 4HD8A 1ONSA 1XTPA 4CMGA 1B2LA 1WQ3A 4PSCA 3B3JA 1U0JA 4D8UA 4DMRA 4JYBA 1FS4A 4NV0A 1B1CA 3TTXA 2X6OA 2R8EA 3EFEA 2CEAA 1IZ1A 1L7DA 3ZZNA 2XKPA 1RRCA 3B12A 2X5JO 3OYBA 4X8HA 5HE9A 4WZAB 1R6RA 2VDPB 4LMRA 4ZEWA 4BJ5C 4XLPF 1AG9A 3E3VA 1IEXA 1E8MA 5I9TA 1SN7A 5IJAA 2J5XA 4RA9A 3ESYA 5TMDA 1AXRA 4ZJZA 1IUNA 1Z22A 1T36B 2GO7A 1GZ3A 2QJWA 3BMXA 3MS2A 4MW7A 3DTKA 3HDTA 3FYUC 4Z0NA 1NM5C 2VSXA 2G7HA 3QP9A 2D0PB 3LUHA 3STUA 2MW8A 1NURA 2NLOA 3A4MA 5B57C 2W25A 4XB2A 1XF1A 2OORC 2RNJA 2HRZA 4ZO6A 4RNDB 4R3UC 3EYYA 5AOBA 4EI8A 3RTGA 1QZZA 3WAJA 1UDWA 1I4DD 3EXHA 4O1HA 3NHWA 2V5AA 2NO0A 4RDIA 4D9KA 4E07A 4ZOQI 3SLRA 4NQZA 4P8RA 2V6GA 3HP1A 3MQ0A 3UNXA 1SZDA 2BR4A 1KKLA 5K9ZA 3GRAA 4LBYA 1ZK3A 2P75A 4QC2A 4R8KA 2C8KA 5KDLA 2HV9A 1OTXA 2BJHA 2ODQA 3ASZA 4YAIA 4ANFA 1FJXA 5FPHA 3C7AA 2FUG1 1QFSA 4RNCA 3OD5A 3V4LA 2MA3A 1MFZA 3FXRA 1RHKA 2AF4C 3B8HA 4IDAA 3W5SA 1JLKA 2CNWD 2QUFA 1E3OC 2VATA 3O3KA 3ZJUA 1EDEA 1ZHFA 1OOEA 5JD4A 1P73A 1ZBQA 4IMJB 4KCGA 4WFKA 3SS8A 1OTYA 4BO3A 3IPLA 1PBTA 4GKJB 3IDSA 3SC3A 3FA2A 3PC7A 1XOIA 1Z5ZA 4BWVA 2AG0A 2YWRA 5J4KA 3HPHA 2AKAB 4Z9YA 3TIFA 4D6PA 4ZHQA 4Q47A 1BU8A 2PXCA 3GCWA 1MNEA 4A73A 3HH8A 3QNUA 1K6EA 3VBEA 2JJ2A 4IIDA 4EB6B 5IKMA 2OHHA 4RTNA 1A9TA 3T3MB 5LIPA 3CDLA 2QM3A 1ABEA 4OIOF 2EV5A 2DHDA 4H4EA 2OZLB 1VYHA 5KWSA 1N2XA 1M5TA 2FW7A 2UVPA 3G2KA 5CFLA 3DW1X 5L3RA 3DBRB 2HWUA 4K3UA 4CCOA 4XDGA 5DKFA 2NV0A 4D9HA 2ZJYA 3FRIA 1XSDA 3RV4A 3H1EA 1ZGAA 2WVGA 4DW8A 4P98A 5IN5A 3CZ6A 5A62A 1UMKA 5G0VA 1N34B 2OFFA 2M7BA 2R9VA 5HEKA 4CTJA 1NMEA 5CFNA 3EGXA 1R4MB 2QPTA 3NHYA 3OCCA 4EATA 4QTUB 1E1RA 3S2YA 5FJIA 1ZD2P 1E5DA 2O06A 3I6QA 3VKFA 1RIOH 1TT0A 1X8JA 3F9RA 2HNBA 3OZEA 3W3CA 1YVEI 3H1PA 2ACVA 2LW7A 3MJFA 1AX9A 3OYHA 2QP4A 2RI6A 1Z7UA 3B9RA 1XF9A 2A0WA 1I5ZA 5IW8A 2X22A 4N6OA 2WYVA 3TIIA 2Q4EA 4B31A 1HT3A 4PZLA 4M0KA 2C1ZA 4RLSA 4W5JA 4LCEA 1WQ4A 1CQIB 2GSDA 4MIEA 4WBNB 5KWEA 3E27A 3G0CA 3J81A 2V7GA 3TEMA 2JRLA 3A1CA 3IP9A 4KO1S 4UPVA 1A9XA 1Z0JA 4F1WA 3JVDA 4LBZA 3JD2A 2FPXA 1B6AA 3QH4A 4Y13A 2CFSA 3AYXB 1G6NA 4RBNA 5AVKA 1TYDE 4H6WA 4K6CA 4DLLA 3I09A 1N2OA 3E6AA 3LBIA 4W99A 4NHJA 1W4ZA 1BJTA 3O73A 4IXDA 1Y7HA 3GGGA 4XVUA 5AHXA 4WL0A 2BP7B 4KGDA 4GQIA 5I5GA 5FFXA 2HYGD 4QO8A 2HIMA 2E1OA 3S8EA 2W7TA 4I5GA 2C9DA 1K7EB 2DMTA 4MIOA 5ER9A 2AN3A 5FOWA 4CFYA 4BTEA 4F1JA 2UZ0A 1B0PA 1QIHA 1A7KA 5DCFA 1DJNA 2JRCA 3QEJA 2DQ4A 2I8LA 5TVGA 3RE1A 1JBKA 5EA2A 3EUAA 2ES4A 2MSCB 5KYYB 4N18A 3T5MA 3TMKA 4DOZA 4X44A 1C8KA 4DZJA 3TOZA 1C9DB 3B36A 4UZFA 3UWDA 3NHMA 4EJSC 1G4DA 3ENZA 4CKEA 4EYEA 3ET4A 5A4KA 1MAHA 3Q5GA 2R7KA 3NYWA 3W1VA 4FCVA 5BN4A 3ECSA 4JLBA 3RCOA 2EZUA 2HXIA 1YHYA 1HXDA 1EX7A 1SBTA 2IF2A 4KRGA 4M54A 2ZBFA 3IBCA 3BIOA 3E23A 3ZI7A 1RC1A 2BMDA 4HDMB 3M1EA 4OWRB 1G8HA 4J16C 1QH1B 4IIXA 3UJ9A 2H2GA 2X19A 3C70A 4Q3LA 2ZMEC 1AQ6A 1QRRA 3RYPA 1D2CA 2GWHA 5BT8A 1ZH6A 4LCBA 5D51S 2QPAA 4MHGA 1FBUA 2DO7A 2YRWA 1ETKA 3HV2A 1VYUA 3HU2A 3VAYA 3RRBA 1MKMA 3AAFA 1QJ4A 2CXHA 3ER6A 3LY7A 1NRWA 4NCIA 2HVRA 1FYMA 2ZI4A 3N39C 4ABYA 1FUYB 1KSJA 2H2DA 4MINA 1I2MA 3UQYS 3BR1A 2I2AA 2JATA 1E18A 1GPUA 2B0JA 3NIBA 3R0VA 4XJVA 1OR8A 1R9GA 1V35A 2LV8A 2XXJA 1ZIDA 3QZUA 1TO6A 4GRDA 4RA6A 4LWQA 5G0UA 4EJUA 3AY0A 4PAGA 5K0ZA 3PTZA 2GA1A 5D4RA 1I36A 1FDTA 1XK6A 1S9DA 2MD0A 4PJNA 1FX1A 1WV1A 2PWZA 1DOZA 2VP9A 2QN7A 3MMXA 2KKOA 4HQ0A 2AG6A 1TC2A 3DBLB 2D3TA 4ZAFA 4BNUA 1DNPA 2HKIA 4OA8A 3WTBA 5A5DA 4HV5A 3TTVA 3AG3H 3BBPA 3FWHA 3ZGOA 4UAGA 3LGXA 1RPTA 2PSDA 4BBSJ 4A3IJ 4A3GJ 1WMFA 3LDHA 5BSUA 2C20A 3I5AA 4KLAA 2JAOA 2J9RA 4B1RA 4DW6A 2HPVA 2YVAA 3GLHE 2NO9A 2RCNA 4Q3KA 1DIBA 3CUUA 4Q3EA 4YQFA 1K2VN 3OY9A 1XAGA 3DEUA 2F1IA 2HB6A 1K4MA 1DAMA 2ZETA 4EYQA 1L8OA 5BUQA 4QU0A 2G4CA 1JUMA 4DG8A 2BDEA 2QL5A 421PA 1CQXA 5A5FA 2VZEA 4MI3A 2GLTA 1U8UA 2DFIA 1GKYA 2JIRA 4G4IA 4JUFA 4L0QA 4QA9A 3OEHD 5KVQA 3SE0A 1QZYA 2A0KA 1ABBA 4DLYA 3V8VA 3IPCA 2HBQA 2KIQA 1LRLA 4AM8A 4CMIB 3ZN0A 5BMOA 2WLTA 3CVJA 2KWIA 3ENWA 4C0BA 4CR8A 2R86A 1G3RA 2XMBA 3R6DA 2B6NA 4FD3A 4UNPA 1KEWA 4F3NA 5FKNA 1I9CA 1KS9A 3AEQB 5KQSA 3W1WA 2HCRA 4L8WB 3NANA 1CQJA 4OQDA 1GQQA 2QRQA 4G0NA 3PUZA 3UWKA 4ARBA 2O5EA 3OOEA 2X8AA 2BKXA 3T9CA 5COBA 2AFHA 2BLNA 2SHKA 3ADDA 1ZONA 3MN2A 1HL7A 1TFUA 2F00A 2OYRA 4F86A 2JVGA 3F23A 2I6SA 3QUQA 4H7IA 4AIKA 4D0GA 5CA0F 3LVQE 3WWOA 4CCWA 2LBFA 1PCXA 2YQ5A 4UBKA 4TTVA 3ZUGA 5JYEA 1FLNA 3VPAA 4CXFA 3LY5A 3WZLA 3A05A 2BJWA 4NL4H 1YUBA 4V3BA 3V7RA 4I5DA 4EMUA 4Y2UA 3EDRA 4EMBA 3AI7A 1YAHA 2AHQA 2OT3B 1ULAA 2NTYC 3T94A 1KJWA 2J5RA 3FIJA 3UM9A 4A8JB 4TTJA 4XR9A 1LQ2A 2FE3A 3ZQ4A 5A3JA 2GJAA 5G0WA 5JEDA 2UKDA 3HDGA 3W7AA 1XB2A 3LIPA 1JG3A 2J3MA 4QDKA 3SE7A 3TGWA 3ROKA 2JA1A 3K1AA 4TQ9A 4C7VA 3JQGB 3JQBA 4UFNA 3ZDCA 2ZB2A 1PYGA 4RD4A 1VPWA 3GVCA 1KTVA 3DPSA 1SHLA 1DO8A 4U7BA 3ANNA 5BWMA 1UFRA 1ZIOA 3DEZA 3T7SA 3L2WA 3RLFA 1USTA 1IHDA 4HQLA 4JT9A 4JUAA 2A8YA 2OGSA 2PH5A 5KKCA 2RHWA 4KQ1A 5E1DA 1ISRA 2G0AA 3EIHA 3O7WA 4C4PA 1IZ7A 1N3IA 1JKPC 2GZWA 3DQQA 2H2IA 3H2SA 3C3AA 3K7AJ 4O3FA 2ZE5A 2GESA 3SC4A 5DHRA 1M0SA 4ND4A 3BXHA 5WRFA 2QGNA 1CP2A 1JLSA 2C57A 3F6CA 4P1WA 1UFQA 3AOEA 2GAIA 2XE7A 3CF0A 3D43A 3KLNA 4RZHA 3RREA 2Z43A 2VPXA 1VMKA 4G94A 1E58A 5LA6B 2AZ4A 4IMRA 2VQLA 5EMNA 1P17A 3PV0A 4RD2A 2WIGA 4R8LA 1E6KA 3G6EI 2GRUA 3IUNA 3KQSA 3P27A 1DG9A 2C61A 3H5WA 4OBBA 3ID6C 3QVKA 4MA4A 1QRSA 2P2SA 4WHMA 4DLUA 3PFNA 4ZVRA 4YDSA 3D02A 1GAQA 1OAAA 1N0HA 2E6UX 2FSPA 1Z29A 3P9NA 4CN9A 4CEJB 2WI8A 3JAMK 2XZTA 4XM0A 2C42A 4I7HA 3GF2A 2PHZA 3W4IA 3KOMA 4MVJG 1WUIS 4QYTA 1W0KD 1G3IA 3GJXC 3K71B 5JSZA 1DJQA 3FYCA 3OCUA 4FI3F 4L3WA 4BBZA 4LLGF 4X8LA 4Y0AA 2Z6AA 1HFKA 4D25A 5EAIA 1U81A 5EKDA 1EM8A 1HLVA 3BL6A 3E03A 3QUCA 4J1TC 5C7YA 3TN7A 5JJKA 4IUDS 3I9V6 4C6RA 4DNCA 1PQUA 4ZVMA 4YAWA 5GM1A 5B1BH 4K8OA 1J00A 3PJDA 5E1OA 3DMPA 1SD4A 1Y5RA 5G0TA 2MLGA 4OQPA 3RFUA 4C0AC 5KMGA 4LOIA 4Y4RA 4MH0R 4D0NA 1ORIA 4QYSA 4L75A 4C03A 1J0XO 2XE8A 4KE6A 4UEJA 1BI1A 3D0SA 2BEUA 2PYDA 5ICGA 4I6EA 1Z5WA 2OZLA 3X1JA 3N8IA 1GCIA 4I4TF 2IUSA 1OAKA 2CFCA 3IXMA 5IM4F 1KAGA 4ZMRA 1VFPA 3NU1A 1W5SA 3MGAA 3TH5A 4GPIB 4E4HA 1ZYRF 3WG9A 3AKDA 2R5YB 5EPUA 1TUGA 3U26A 4AD9A 1TQ2A 4I8DA 3ZPXA 4G25A 3CTPA 3SGLA 4PZZA 3WWEA 3NI2A 4Q4JA 5B2EA 2EX0A 4JVSB 1JLLB 3K9TA 1HO3A 1VI6A 1G16A 2GGSA 4KIBA 4NESA 3MSXA 2BCJQ 1NZDA 1D1PA 4K5QA 4LJ8A 2UYQA 4PZCA 2GZDA 5HS4A 3T5TA 3A7DA 3A6FA 4GGOA 2PM8A 1QQ7A 1NXPA 2AS5F 3F1KA 2WF9A 3FTNA 1LVKA 1E1RD 3HUGB 5AIQA 1T0FA 1IB6A 1SKYE 1VL6A 2OBNA 2X14A 2YJ6A 4KVFA 4AWBA 3U3RA 3JQ6A 4D81A 4U2DA 3BXOA 3C97A 5F1OA 2YV4A 3VU3A 3MJTA 4PC2A 1Y8CA 3QKWA 3OETA 1KEVA 3PPWA 2ID9A 3RUEA 5KYWB 1VIVA 2YHUA 1X92A 4W1QA 3JAWB 1KC1A 3HR4A 2FK8A 2I9PA 4C0KA 2D4HA 3FMRA 2QN3A 2ZYAA 4OI4A 2ZS9A 5CNKA 3TPFA 3OO0A 4V1CA 1BVHA 4IVRA 2UUBB 1DEAA 5F1RA 5AIPA 3G79A 5CIQA 3RT7A 3T1VA 2ORVA 3OAAA 4A8PA 2FH5B 2F3UA 5BWBA 2V96A 4E70A 4X97A 5DYMA 3ONEA 4LJ7A 1P1FA 3H5TA 4OF4A 3CC7I 4Y9UA 4LMBA 5CVCA 3BJRA 2QJTA 2M0CA 3E6DA 4N48A 2Y99A 4A8JA 1A6QA 2J3KA 4QPZA 3A9RA 2IF0A 2VBWA 1B72A 1KY2A 2JAUA 3EZFA 3CZQA 4CMJA 2BGGA 2GR9A 1YR9A 2C5FA 2C3UA 1KYIA 1X7XB 3S29A 2O3FA 3KYDA 1SPBS 1UM8A 2ONKA 1E61A 1XROA 1YS6A 2FPGA 3ADPA 3AR8A 3CTMA 4P31A 3OQOA 2G06A 1TEHA 2UZ3A 1BS2A 3KC2A 2ZB7A 5K8LA 4GECA 4ER5A 4YT5A 3RU2A 2KI5A 4P32A 1X38A 2QIOA 4GDMA 1CUBA 3OPQA 4YGXB 3ASUA 4BDSA 5L4LA 4CVNA 3GLGA 1IQPA 4FGJA 4G0WA 3FKSD 1VQNI 4K6MA 1I4LD 1T1SA 1DSSG 2O8DA 2F7SA 5DEOA 4GLBA 3W9YA 5JALA 5LVAA 3VX4A 4IGIA 2WRZA 4GMDA 3KAPA 2VC1A 1UANA 1Y1TA 3FVVA 4M83A 4HDVA 4XFJA 4PYMA 1NMQA 5JAUA 3WRXA 4JYZA 5AW0A 2ZJRF 3FPHA 5CDGA 1YQWA 1X39A 1EZ1A 2L9VA 2A3RA 5F04A 3PLNA 5LP6B 2GJ4A 4CCLA 3I1FA 3ZH2A 1XSVA 3GFRA 4ITUA 3WZMA 5B37A 3LY9A 1TKRA 1JDPA 1N8KA 2OWEA 3FPLA 4M3BA 3L6OO 5D01A 3CX7A 4HFJA 3KJFA 1NFQA 3HSEA 1UBOS 3ZDDA 3TXAA 1ZC4A 1P8AA 1MEEA 1ZI6A 3FBGA 2LDXA 3FCEA 2Z5FA 3N1UA 4CTNA 5IDWA 1SCAA 2EA4A 1A72A 1WUKS 2H1FA 3JQQA 4HH4A 4JITA 4UUMA 4OH1A 3IBYA 1ZELA 4NCAA 4IDNA 4K0KB 2XECA 4QXOA 3S3TA 4HXGA 4TV8B 4DEYA 2C5BA 1TTYA 4LE0A 4MGYR 2IA0A 4W8OA 4DLBA 3ESWB 1U8FO 3HHHA 3OE5A 1G8SA 4AMBA 4CM4A 2XNJA 2IGBA 1SCBA 3A4VA 1WCV1 5HA5A 2RHDA 3DT9A 2WHPA 2AD5A 1LB1B 3DO8A 5D6FA 4Q39A 5CGZA 1IHYA 5E7IA 4CMKA 2Y1FA 2MIIA 4WX9A 1OA1A 4ENSA 2R97A 3H9GA 2VHEA 3BL8A 1VE3A 3NDRA 4KMRA 3AU9A 4H08A 1RWMA 3GV0A 3I2JA 3LO8A 1BX3A 3OESA 4ZVUA 3MT8A 1IGNA 1WCIA 1J7KA 1Y56A 1VQ7I 2JSCA 2CE2X 2R6DA 3HA3A 3VU0A 3WFIA 1F2TA 3EQ9A 1NG1A 5BUZA 2PQ0A 1DG3A 3NH6A 3ZGVA 2ZAMA 4E7ZA 1EE2A 4TQAA 1I51A 5GIOE 1SB9A 3QPAA 3P5JA 4GOLD 4XOIA 3L7JA 4A36A 2IDJA 1YRYE 3K1YA 3MTJA 4L76A 5D5UB 3RYIA 2RC6A 4GVLA 3DXJF 2J32A 2QMUA 1T1IA 1F8UA 1THZA 3QX9A 4AO8A 4ESEA 2GM3A 3AJEA 1EE1A 1SU6A 4HF2A 1R71A 1FP7A 1N1DA 1RLUA 4DYRA 1BFUA 1JEEA 1P29A 3AOEC 2P0AA 1ZI9A 3BE6A 4NFHA 3RB8A 4QTRA 4B4WA 2YXEA 1XVAA 4UTRA 1XU7A 2C5HA 2VF4X 3EISA 2ODNA 2DULA 2EW2A 1ZK0A 3FJOA 2GXUA 3RM3A 4ZO8A 1RJDA 2FYTA 1GYQA 2NPFA 5K0GA 3NIWA 3WIUA 1R64A 4DVJA 4IGEA 3PNTA 1LLUA 2HHJA 9LDBA 5CTJA 2J0SA 3D5RC 2R7WA 1VA4A 2IHVA 1II8B 1FL9A 3BIXA 1BM9A 3RPUA 2F6CA 3Q6NA 3VR4D 3UGQA 1QORA 1SKMA 2DERA 1C7QA 2XWSA 3DE1X 1TJNA 1RU3A 2WP0A 1V25A 1N2ZA 5B1AH 3V7CA 1MABB 1Q7RA 4P9FA 4LAFA 3PX2A 1NUUA 1YTUA 1O3QA 3FPGA 1IZZA 3BG9A 4QIHA 4FEEA 1LB2A 4WZAE 2ECFA 1PWYE 3SF8B 1QRYA 5DM4A 3K4MA 3QVTA 5CFOA 5CT6A 3B6JA 1XZLA 1NNUA 2P68A 4J7AA 1UCFA 3RNLA 4G4SO 2BV6A 4S0HB 1X9HA 1CUEA 1Y1QA 3UJ8A 2RAFA 5FRDA 2QUHA 5F3RA 3AP2A 4E3ZA 2CXSA 2FEPA 3COAC 3JS5A 3PC6A 2CUTA 3CJTA 3KZKA 1AUPA 4BMSA 2WJAA 4O2AB 3ERED 2HMWA 3KVOA 1ZR4A 4PYKA 4DRXA 3G2OA 2C7GA 2J3QA 3KTOA 4FFPA 4DZPA 4Y3OA 4GMHA 4C5CA 1YHQI 4P6VF 1SPXA 1RMYA 1WB4A 2VT6A 2M8EA 3NWEA 4XRGA 3BIWA 5DCMB 4WGGA 4XYGA 2G1KA 1GD1O 1PKXA 3FNBA 4CLOB 3FFBA 2FV8A 2O1SA 4IH4A 5CEJA 1Z0AA 2LSOA 2BMEA 3P4XA 3NAGA 3L4SO 4MKRA 3U1TA 3ZXYA 2I2BA 5C4MA 5G1NA 1D3AA 1CQWA 4MWEA 1GDDA 1YS2X 4NFYA 4YRBA 5AO9A 2BSXA 2HWKA 5H9WA 3IB3A 1TAUA 1MQSA 3GBVA 2HCFA 2V97A 1J1IA 4LXIA 1O57A 4MCAA 2RGWA 3OR1C 4ARSA 4L8VA 4D45A 3ZD6A 4X6UA 5B4TA 3DP7A 5IUNC 4HAYA 4G1VA 5TPZD 2WUVA 4B76A 4HQMA 3GLIA 4HOYA 2YMPA 1TMKA 1XKXA 3EDYA 4ZTFA 4PC1A 3HUEA 1T8TA 2C31A 1DU4A 1MO2A 4YGYA 1W9MA 1WMDA 4IHJF 1ZN9A 3DTNA 1LUJB 2E19A 3IH4A 1LE8B 3BCSA 1SXQA 2QYOA 2ID6A 4IHSA 3ZIUA 4B34A 4YROA 2ESRA 2ORYA 2ZIUB 1UZUA 1YR2A 2CHUA 3M6LA 4P4SA 2GUGA 2GLOA 4EL0A 4D80A 1PTJC 2JFBA 2R6FA 4MUMA 5TMBA 3BHNA 3C16C 2QPLA 2QTVB 4OK3A 2K85A 1Y89A 5EJEA 4JK1X 3B9QA 2P1ZA 4MI9A 4EG0A 4PNPA 4F45A 4HSTA 1YQEA 2BFDA 2CLDX 1X3LA 3HADA 1XCPA 3MM4A 5FJJA 3ZTYA 4EY7A 2Q6VA 3NOOA 1T39A 1WMBA 4G65A 3OM0A 1RRMA 2GH1A 4G26A 2O07A 1KMMA 1MOPA 1FP4B 4YJHA 1Y48E 1KKMA 1CJTC 2C2GA 3OYIA 5A0FA 3FVQA 3P9QA 4V2IA 3LQFA 4CYCB 1DQPA 1OISA 3MUFA 1MZPA 1ZRFA 1H5NA 1N7JA 5TC4A 5IH7A 1G5QA 3JU3A 4CG2A 1E1QD 1STOA 1VJRA 4N3AA 1WBBA 2ZC2A 3RUCA 3QF7A 2YMMA 2BEOA 2H59A 2CVPA 2ZXUA 1PVOA 1E2XA 4MYTA 1M66A 3R7BA 1S2OA 2W58A 4CL3A 3BPSA 1W0CA 4P4GA 3EUKL 4AQDA 4F97A 2ZJ6A 4QJ4A 2ZMEB 2W2KA 1C7IA 4PZPA 3QE9Y 3CSSA 3T3HA 1TECE 2V7VA 4R9NA 4H59A 3V8MA 2IYSA 3VQTA 5HLHA 2QEXI 5K0JA 3RYCB 2RHBA 5IZCA 3BTVA 3L8ZA 3SIRA 2PYZA 1TEZA 4XOPA 4EGFA 1EGVB 2NOJB 3PCRB 4R9RA 1UOEA 3W6JB 2BUCA 2HADA 3FUWA 3PL5A 4HK4A 5ALJA 1YK0A 2J3HA 3AIMA 5FUQA 1UHSA 3OC6A 1P6QA 1ON1A 1FUEA 1A88A 1NLFA 2H0RA 4P9UA 3BRSA 3HU1A 3X1KA 1JEYB 2QSUA 5D3ZA 1F8FA 2DT6A 5A2QK 3GAZA 4L3OA 5EHZA 1HKTA 3CJRB 1D0YA 1CVRA 2WQZA 3E7DA 4DMHA 4M7PA 5K05A 3ZKWA 1T3HA 3T9AA 1YAJA 3IFSA 3FTDA 1EM8B 4WY5A 5G0SA 4ARVA 2G71A 1RWNA 1ZUWA 2AOWA 1U28A 2H52A 3OHPA 2I54A 4CTMA 3CNLA 1BOFA 4ROSA 3CJQA 4N5IX 5DUKA 3T5GA 2R48A 2P5LC 1BQ3A 4M9RA 5DOZA 3EODA 4DLZA 1N4AA 3T3EA 3BE8A 1ZN2A 1SBCA 3IUYA 2NT3A 3K6SB 3KT6A 4GI7A 3ESDA 2QRGA 1D8AA 1I1HA 4GWLA 4KWCA 4RWZA 3SC2B 3TLGB 5J2UF 3A3PA 3LLVA 2LH9A 1QIKA 3LKVA 2J33A 1KU3A 4B2IA 5HKKD 2UYCA 1N9GB 2VKTA 5EMMA 3UW3A 1QQBA 4FBMA 2ISYA 4X90A 2KL4A 5J6XA 2VHVA 5F9FA 1JJBA 3N2IA 1E2UA 3KD2A 1FYEA 3UN1A 3TQSA 4HDAA 1G20E 4JXKA 2BGNA 4CIDA 1D2RA 4JD5A 3FE2A 1VJGA 1I6LA 3IX7A 4HG2A 1P7WA 3CF4G 1RLMA 3K32A 3OD1A 4RZ3A 3RYTC 5CVTA 2VJQA 2A94A 1BQ4A 1G6HA 2ODEA 4LDQA 2LDUA 3HOSA 2E2IJ 4LVNA 2SKEA 2ZZKA 5DF1A 2XF2A 4YXWA 2GCEA 3P2EA 5LQSA 1SXIA 2A9FA 4U7WA 2EC5A 1GV5A 5HRAA 1NVDA 1NHWA 2ZUCA 2FFBA 3WNCA 4WIAA 5EHNA 1C3XA 4FXOA 1IUPA 3A3NA 4H7DA 3HPGA 1XMJA 2C3YA 2QQ0A 3HCOA 1QS0A 2B21A 2Z16A 1B3BA 2ZUBA 4JA0A 1JHMA 4JLOA 4MGEA 1Q1GA 4MV4A 4ZDLA 5JW6A 2AZXA 3H1BA 5K03A 1NVGA 1IQRA 3TSZA 1PVVA 3G0BA 1T2UA 1NG9A 4B9EA 5FLMJ 1K5DA 1YRNA 2YXBA 2EJTA 1AKMA 4MK4A 2OORA 2IV7A 1T29A 4XN0A 1JALA 2FPPA 2W4QA 4RV9A 1NWCA 1L5HB 4L6IA 1JFFB 3VPXA 2Q5JA 4Y2TA 3A02A 3SIXA 4IRXA 3L7YA 3PL8A 4O2RA 4XWWA 1NYQA 4FISA 2JGEA 3OQNA 2BW3A 4AN4A 3KXIA 2Z6QA 2YMQA 2LCQA 3H35A 2FX2A 2ZT8A 2B98A 1YHZA 5EE1A 1XTTA 2HR1A 2ZTMA 4NC7A 2P41A 2PX8A 2O1WA 3VR6A 2HNHA 2WDZA 2WT4A 4FYIA 2OG2A 1UAYA 1G9XA 3F7MA 4RVFA 2EKQA 1UZLA 3BJZA 2JC3A 1GPNA 4EJTA 4KSYA 1QLHA 1H2RS 4FUTA 5FKKA 1V37A 1VRWA 3R74A 1JYFA 1UBGA 4KXYA 3BVPA 5TLSA 3A6KA 1GXSB 3A6EA 3IQGX 5ECGC 5IVDA 4DDWA 3G2JA 2RV8A 2CQQA 5UKDA 1SK8A 4CCJA 1R2QA 1VIDA 4DCOA 1PDVA 1XHFA 3TBHA 2ZDGA 3WBBA 4CV3A 2UZ4A 1G2OA 3VYWA 4DLAA 1X19A 2GN6A 3DCJA 4EHDA 3VNVA 1WDLA 3UFBA 1OW3B 1SNYA 3KOXA 4NRDA 4R1QA 4M3DA 1E6EA 4WXRA 3U2QA 1UBEA 3VH4A 2FPKA 3B89A 5LMZA 4DV7B 3UHAA 3B3QA 1G3YA 3GA0A 1KH3A 3ABQB 1FDOA 4ENTA 5A9SA 2NO7A 5CXSA 2H8KA 2F1HA 2G36A 4M1WA 4Z51A 5J47A 1FU7A 3INNA 4DV1B 4PS1A 2K27A 5D8DA 3OYFA 2DP4E 2MSKA 3EDOA 5LQNA 2IEKA 2PGAA 4FKMA 3ZLBA 2XYGA 3OMLA 4H3HB 1BS9A 1ZXXA 1GPBA 2JRTA 4RADA 3PD0A 2PIAA 5KAPA 1DUSA 3GRYA 1SG0A 4QLAA 5ILUA 3RYRA 1AGYA 3PPXA 2E4YA 4RKWA 2MC3A 4XBFA 3OJCA 4CEIA 2OZEA 2NXNA 3ILYA 3J81k 2HYIC 4RAGA 4OOEA 3RNOA 2AC7A 1Z13A 1XS9A 3JQ7B 2LF7A 3GO4A 1HETA 2GAOA 1H2XA 3NUQA 3R6GA 1O03A 3TUIC 1SA0A 1TZKA 3TLAA 4E3WA 2WHQA 5KNDA 2J3DA 2Z2IA 2ZB8A 4NNOA 1CSEE 1Y5IA 3B6EA 1NTCA 3W7VA 4CE6A 5BR4A 3GDHA 2V9PA 3QXGA 2DTZA 3OH8A 4LNAA 4PIMA 4WJZA 4EA8A 5JSFA 1SU4A 3V4GA 4FW8A 4BFZA 4UUQA 1KY5A 1SELA 1Y6QA 3HZHA 5GJWC 4CKBA 2VUIB 3U7FB 3T1NA 4B3AA 1FFGA 1U9IA 3DL4A 2BHZA 4QUIA 4B3CA 2WIAA 1GAEO 1OLXA 3BWXA 3MQ4A 1FDRA 3M49A 2Q3HA 3PE6A 4H31A 5K3AA 3SP1A 3TX2A 3IHWA 1AV6A 3MG9A 2DHEA 3QQ5A 4F72A 4YR9A 2XPCA 2FNPA 3S99A 4U39A 3L4BC 4ZHQB 2WZCA 1T1GA 5GVRA 2QAGB 3WGLA 3PVSA 4M0UA 5GJBA 1FEZA 4DV0B 3FYHA 1RP7A 2YYZA 3EG9A 3QFRA 4P3PA 1J59A 1VHTA 1HY3A 2WWGA 4QODA 5G4LA 5AW9A 4F2WA 1ZI8A 5HUQA 4MNTA 4D9MA 2IBDA 1FPQA 4UTNA 4EYGA 1QNLA 3FMFA 4INOA 3N8NA 5HKLA 2J6CA 1J70A 3BKXA 3KB6A 5KX5F 1LU9A 2VP4A 4EGZA 4NZPA 4J0EA 5CAEB 4DDMA 5FWDA 2QSGX 2C9MA 3KUDA 5CW1A 3NWSA 3D59A 5JOQA 2XZPA 3AIKA 2EJBA 1Z73A 1DADA 1FSGA 3LXMA 1U6GA 4ROTA 6LDHA 3Q7RA 4KUMA 4ITVA 3C6MA 1JEDA 2IYQA 3NNDA 3F96A 2MR6A 2H6CA 3OE7D 2CNKA 3EZ7A 3SF0A 1NJ1A 5H9VA 3SFVA 4FGZA 1Q5PA 1DV1A 3P9IA 1U2GC 1GHTA 1L7AA 1TQ4A 1VSBA 2BEJA 2P2NA 3KJXA 3OPYI 5E6RB 5HTOA 2K7LA 4NARA 4P08A 3IUBA 4MTEA 2R1VB 1GFIA 3CN7A 3HVJA 1JKXA 3KALA 2IQ5A 4YPVA 2DA5A 3K0HA 4UUBA 2X86A 1E9BA 4CUKA 2VPRA 1ZUIA 2VQDA 3O8NA 2F3PA 4IGKA 3ZCVA 2XXAB 3G5UA 3ENKA 2XPWA 2YICA 2CJFA 3OBIA 5C9ZA 3AVPA 1WBDA 3E2PA 3L0SA 5TGTA 3PP8A 4O5AA 5I7VA 4N8SA 2HSZA 5EMHA 1E7SA 2IEBA 3U9SA 4GPD1 3KEOA 1IN8A 2I5UA 5KHDA 1WSUA 1PUFB 4YCJA 2WYWA 3AINA 2QJRA 3W34A 1JGGA 1L5NA 1VPDA 2LVBA 3EXEB 1YRLA 3N2ZB 4OB8A 3GW8A 4RC9A 1IEVA 1UKBA 3R4VA 4AG5A 3G9UA 3TPCA 4WINA 3DUFA 2NAZA 1ZAKA 3U5TA 4H7PA 4AAYA 2VHTA 2ERYA 2Z5UA 3BGIA 4DJAA 3B2NA 3KNZA 3P26A 4LG1A 4DCJA 4YLGA 4A2WA 2FFRA 3MOSA 4G5SA 5G53C 1MRNA 5DK4A 3JTEA 2XUQA 3QOWA 5ALXA 1JEQB 1XL0A 4F9FA 3NBKA 3G6WA 3L6BA 1NN0A 1USIA 1EK2A 3UAWA 2HY7A 1C30B 1ECPA 1PFKA 2I3ZA 3M6VA 3M9LA 4CKEB 5K6AC 1YE3A 4QOHA 5HILA 5D85A 2MH2A 3UWSA 1I7PA 1COWD 2XPUA 4IQ0A 1T0HB 1XJCA 3I0MA 4QU5A 1DOAA 3TEJA 4E51A 5CB6A 5KYYA 2FG5A 4EKEA 4GI3A 2XUBA 1M2JA 4IKFA 2YC2C 1SKQA 3THWB 2ZUTA 2ZANA 1JKRC 3C3PA 2PMEA 3RG2A 4FHGA 5JNTA 4NCBA 3N4MA 5CUQA 4QGAA 1T2AA 2DYKA 3MINA 3PFYA 2KRCA 2H65A 4FUQA 4NCKA 5HF5A 4EHBA 5JZVA 1JAZA 4UBNA 2QVLA 5KPDA 1OFVA 4LJSA 1LPBB 1KMHA 4P3XA 2XNDA 4B32A 3S2HJ 4DRZA 2PNJA 3I3LA 4PLFA 3RTBA 3UAOA 5LQUA 3QU9A 1A97A 3O1JC 2OCCH 3DTVB 2DW4A 1YR3A 3IUEA 3RSZA 4I1PA 4W5RA 4N7MA 2OQVA 4G0PA 4NJMA 3FVRA 3HKDA 2PRKA 1QIDA 1YRQA 5J1SB 3VYVA 4QPPA 1UEIA 2DA6A 4NDLA 1DO2A 3T3IA 4Y15A 1YD7A 4RSGA 3K09A 3IMCA 3D2CA 1DKLA 2CUJA 1W25A 4U7HA 2IHTA 2P4WA 3I0NA 3ZU3A 1KQGA 1XB4A 3EGVA 5FL3A 4XMYA 4QOFA 1E1QA 3FUXA 3OY2A 1GRRA 2QLLA 1ABFA 5H4HA 4KREA 1N4DA 3FSGD 4C7XA 1MW8X 4HDNA 1V1RB 5LEJA 1YQAA 1FP1D 4OTZA 1C7JA 4UVAA 1QGZA 4MV0A 3RJ9A 2VE9A 4EPXA 4RMNA 4LXHA 2R79A 4X5OA 1GZ4A 1OVGA 2A9PA 4GXQA 1Z77A 3LPNA 4FK8A 3REFA 1SZPA 5CM9C 5K0EA 2VZ8A 2YUSA 2Q4TA 3LZCA 1UMCA 3P9PA 4EM1A 3CEMA 1W4CA 1W0JD 1LVAA 1PSWA 2NQ2C 4MI1A 2HT1A 4BQAA 1PZEA 3VU8A 4BV8A 5FAKA 1XYGA 3V48A 2ICAA 4M9QA 2ET6A 4UJ3A 4JQZA 4II7A 4JVNA 3ADOA 1SXJB 1DTWA 1RJ9B 3P8ZA 4UEQA 4ZQHA 3A28A 4HXEB 1RYNA 4JZKA 2FUG6 5DYYA 2JCVA 3UMYA 1QVVA 1HE1C 3EQLF 5EG0A 2XOXA 2P8TA 1RCTE 2G1UA 3BHMA 1IU9A 2JRMA 3PENA 4PDKA 4TYPA 3RVQA 1CQZA 5G3ZA 2OV3A 3OLCX 4E7HA 2KLBA 2WPDD 4DIUA 2F4NA 3R5KA 3G5TA 3AONB 2QMQA 1MMNA 1YZFA 1K4SA 1CY0A 2FGKA 3BB4A 1MB0A 1EFDN 3QMMA 3A25A 5C80A 1A8QA 4G6QA 1XRLA 2WSSA 3CESA 3BDAA 3GDWA 2NYXA 3H9CA 3L79A 3MNFA 3O3CA 3ANTA 3VNBA 3H5OA 4IWNA 5F1PA 4L74A 4JI7B 2MG4A 1U8BA 4UUSA 1CKEA 1OXXK 2QTZA 1LEHA 2ZBUA 3G2BA 2CYCA 3LT4A 3RU9A 1XPOA 2CQKA 5DGDA 2LZ0A 2YS6A 1FX7A 3HB0A 5D7BA 2V55B 3TXXA 4RZQA 3LC2O 4BVJA 4CQLA 3BK1A 5HOEA 5FWXA 5JEEA 1LE8A 1DAGA 2D7CA 3T3DA 2DT7B 1ZJWA 3QV2A 3GT3A 1KYZA 3BCUA 2M6SA 2BYTA 1CGPA 4M3GA 1NG7A 3KFWX 2PO5A 2QGUA 3ENVA 1Z37A 4U2GA 3TTUA 5IT9A 2C84A 3GNQA 1FUKA 2GBIA 1Q91A 2ZAYA 4GFDA 4PINA 3BZKA 1NVVR 1RPAA 1NL3A 2BFAA 1R18A 2EP8A 3A70A 3ER9A 4GM1A 2NXWA 3OUUA 1ZM2A 4K6FA 1ODJA 1PEAA 2QRNA 4P5PA 1T0PA 4LOCA 3V8JA 3PR1A 2ONJA 3KT8A 2PGIA 2LP0A 4LLLA 3WKBA 2Z2SB 2PU7A 1EVEA 1E99A 1KI3A 1UK8A 3OM9A 3ZOZA 3N59A 3MIIA 4YAGA 2KIUA 1MMGA 4GAEA 2ZTVA 1MC4A 3DD5A 1FCJA 2O3RA 1YJQA 3CNNA 3E5RA 4BV9A 5BMVB 4F5DA 1LPOA 5BN1A 2OHVA 2O7NA 3UJPA 3DL2A 2QA4I 1KIFA 1MZBA 1K6MA 1D0SA 1TCAA 3EVFA 1CT9A 1G38A 2VF7A 4DARA 1P31A 2AUMA 2DMRA 4MR7A 1FMFA 3E9CA 1N6PA 4NBSA 1CJUC 4I9HA 5DRTA 1XZBA 3M6IA 3L0BA 2A9OA 3A26A 2QT1A 3OKAA 5IEJA 2OBYA 2QQAA 3WE2A 2FSSA 3M4YA 4TT3A 4WA7A 3H19A 3H84A 2LR8A 1R1VA 2XMSA 4AC9A 4Y2YA 2G1JA 3TNDA 4AIJA 3QJ5A 1NPYA 2XA2A 1P60A 1HEYA 1OT5A 2CJPA 2Y1OA 5C1IA 3BMCB 1YTLA 3E0JB 4XPIA 2YW2A 2YFYA 4MGHA 3SC2A 5DCUA 1U7WA 3U62A 4LG0B 2IS6A 1U0GA 2JFPA 2AEEA 2JZOA 3Q8XB 3E9QA 1F4KA 3E3MA 1B2RA 1XKQA 3SJCA 4N8EA 3ZIAA 4GZ5A 5JSHA 3PUHA 1LX6A 1R9NA 2BY4A 4BDYA 1GFSA 1SVUA 3IT3A 3K9NA 1JECA 3S1NJ 3GFFA 4C4TA 5IAOA 3L0OA 2D62A 2AR7A 4EB8A 3C5WP 4TVKA 4DJTA 5K3EA 1ES9A 4MVJF 3M9AA 1E6LA 4JBYA 4RVHA 1M34A 4N3BA 3WHBA 1DJPA 1PDWA 4L5CA 3SXUB 4JQYA 2EYQA 2ISCA 4JNKA 1BC5A 3OQVA 3QMPA 3HXPA 1N36B 5E8JA 4KAFA 3U56A 2D8AA 2CDRA 3WGKA 5JYBA 4ZOCA 3MK31 4ZHSA 1XZJA 4RPGA 1C3EA 1KFEB 1QUEA 3GAAA 4KX5A 1FYFA 1UJNA 3WGYA 1RXSA 2XCSB 5D6EA 3G1MA 3DTVD 5JDIA 4PCUA 3N2LA 2HLPA 1DS6A 4JFRA 3PICA 1JR4A 3M5CA 3IEXA 4TMTA 3ICPA 3PXBA 1MP0A 2ZJ2A 1FSFA 2BFEB 3I05A 1T6SA 4O2LA 1WPKA 4BLRA 3T1HB 2QD2A 3JYLA 2QIPA 4LLNA 4N12A 3CXUA 4Q00A 1OYVA 3LA2A 3CCJI 3F74A 4AJ4A 2ID7A 1N5DA 4RD3A 4D1YA 1VFCA 3FVTA 3OYKA 4MDFA 2V9CA 3ZBUA 1Z9BA 2GHIA 2QU7A 4YJ3B 4BDTA 1DKRA 4IH9A 4OYHA 4B75A 4DFDA 1RKUA 3OIUA 1NQUA 4ZYYA 1IZ0A 2FP4B 4B73A 3HRMA 1VKRA 1H5QA 5B4VA 3DB1A 3HL2A 1BD4A 1GOTA 3AMVA 3EARA 4F6RB 3H0KA 4LV6A 4YA6A 1PK7A 3I55I 3FDJA 3L02A 4IO0A 1SCUB 1VJTA 2AMFA 4JH0A 4BJ6A 4TLLB 5FA6A 3IYLW 3I92A 4U2CA 5EJIA 1E79D 3A2MA 3ETJA 4MWOA 2WFAA 3Q7QA 4YQEA 1EFTA 1NUQA 3RTEA 1K3UB 1THTA 3GEHA 1R6VA 3I8OA 4Y17A 1IN6A 2NVXJ 1S01A 2ZDHA 4YRKA 4N7RA 1F2TB 1C0IA 1PG5A 2PU5A 1LW7A 2YHSA 4HDUA 5CLFA 3QVXA 4DDKA 1GPH1 4KAXA 3A1FA 2Q2EA 2AE1A 3INTA 2M1XA 3RD5A 2VSNA 3V34A 1OQAA 3V4RA 5EUMA 2K86A 4G01B 1VGVA 3WMFA 3RPUD 5K51A 1NHAA 3BN3A 1LRKA 1YGYA 1XD8A 4G09A 1P44A 1DC7A 2GO1A 4L8YA 4PFSA 5JO0A 2QI9C 1Z2DA 1M8FA 4PG4A 1U7DA 1EE9A 1XMSA 1YJCA 2HJHA 4RAOA 1G2HA 1E89A 4CQLB 4EG5A 3UKJA 3VJLA 5LDHA 3SDBA 1OZAA 4JBAA 1YW9A 1JQAA 4BNIA 1X2MA 4FOOA 1N6RA 4HZUA 1ZLJA 4PAWA 2EQ5A 5KS2A 5H2FC 1YI1A 5DHSA 2XUDA 3VPRA 2XCIA 3AGQA 2JCSA 3ZV3A 2XIJA 3H9QA 3VZCA 3KIOA 1JLRA 1FXUA 2W90A 1U3CA 4OQZA 3SIPA 2JANA 2E21A 1NQXA 4O4LA 1C3JA 4JX4A 1WJCA 3WYFA 3JRFA 2CL6X 3PNPA 1VHQA 1OCPA 3HABA 2CJYA 4I5EA 2WOOA 2HXYA 3CF6R 1DC6A 2PRJA 2CLHB 2OGUA 1PGQA 1WU7A 2CZQA 3ED1A 2O1EA 3KVNA 3HKZN 2FXIA 1KE1A 2I4MA 2QL9A 3U3XA 3RADC 4RMHA 5BV2P 2WV9A 3DYVA 4WCFA 1BFKA 2QMZA 3JV7A 1RRVA 2QMEA 4JI4B 2MYUA 4XAQA 3ND5A 2I3AA 3AY6A 3HZOA 3LZDA 4CA0A 3OT1A 4WZBB 2N42A 3L1PA 3WBKA 1EQAA 4B09A 2Q0OA 3IIIA 3VVLA 3PG5A 1YJAA 3ZVRA 4KXQA 1M6WA 3HP4A 2HDWA 3Q0WA 3KHTA 4Z9BA 3X1DA 1A71A 1U9JA 3KZIC 3JAKA 3UJHA 2O2EA 2M9HA 4KQIA 1OH6A 4A0YA 2GN1A 4M3FA 5KK1A 2FSVA 2R68A 4JELA 1TJYA 4XZ3A 1FSPA 3MWMA 4IHYA 3P2JA 5B5EC 1E8NA 2F8MA 3QJYA 1DRVA 4B6JA 1G21A