1XDSA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) and 11-deoxy-beta-rhodomycin (dbra)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
336
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGERPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDDAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RdmB
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
total genus 101
structure length 336
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xdsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xdsA03
1IF1A 5E1XA 2G7HA 4F84A 1NHAA 1TQPA 5CM2Z 1KU7A 4KRGA 2ZFWA 2Y1WA 1QGPA 5FHRA 1TW2A 5FGMA 2YU3A 3UJ7A 1W4MA 1G8AA 2IP2A 3LPMA 2O03A 4LWOA 4NQWA 3IL2A 1U5TC 4AZTA 4OX9Y 1KHHA 2CMHA 3P9IA 4Q4ZF 3NWBA 5HIMA 1KU9A 2K4MA 2JG3A 4EV0A 3HHGA 2PV0A 2PXXA 2HR1A 2EV5A 5B1SA 2G8NA 5FTWA 4KICA 3R24A 1IN7A 3DFGA 4KW7A 3CKKA 3B73A 1ZGJA 3ELUA 4XRFA 4X63A 2DK5A 2XROA 3I5UA 2QBYA 2PWPA 1X1CA 4OIPF 3KCCA 3A27A 3WE2A 3J81K 5EEHA 3C6MA 2GQQA 2PG4A 4YUXA 1SD4A 5E1BA 4FT2A 4CKCA 5E1WA 3P8ZA 4GEKA 1VIDA 3BPVA 5FHQA 1FBNA 4ESBA 3F6OA 4OA5A 4PYKA 5E8RA 4WK8F 2G1PA 2RVCA 1XSVA 2JHPA 2HDCA 2VBYA 4MHGA 2ISYA 1VQ1A 2QYOA 3BPXA 5DM0A 2FNPA 2FF4A 5KVRA 1O9HA 4BHPA 2L01A 1FZPB 2Z3YA 4BP3A 4EMSA 2K4JA 4GOMD 2ZO4A 1O7LA 5GIPE 1BC7C 2IBTA 2EA4A 2FA5A 3TPZA 5DD8A 4CHUA 5K1YA 1KU3A 5DCMB 4FSXA 3R6TA 5CCBA 3GO4A 4XUCA 4UV8A 4L0YB 3E05A 4E30A 2M87A 3CDHA 3HRSA 2JJQA 3L8DA 3TM4A 3NDJA 1PP8F 3JSPA 1WS6A 2AOTB 1KQ8A 1RI3A 4CYDA 2QLZA 2RN7A 3ELWA 1XGSA 2XKPA 5BMZA 1O3TA 5MHTA 4YFXF 5DRTA 4R1HA 3AAFA 5A2QK 1U8RA 1HW1A 2Y1XA 1F4KA 2CKDA 1I27A 4I0AA 5ICCA 1T6SA 5E8GA 1REPC 3D0SA 5L3GA 3B3JA 1QYRA 1LJ9A 2ZMEB 4E33A 5CVVA 5EZSA 5HZMA 5ICGA 1RJEA 3B7PA 3GX4X 3GZ5A 1BKYA 5CYVA 1R18A 5D1NA 2IPXA 3FUWA 3WTWC 1PDNC 1F38A 2FBKA 3KP5A 1G6NA 4OQEA 4U7PB 3JTGA 3K2ZA 4M7RA 1G3WA 1I9GA 2B78A 3UJ8A 2IA2A 3BJAA 3GO5A 1T43A 4OMZA 1W7PB 3Q5FA 3LGAA 3NWEA 1P6RA 2F8LA 4NECA 3VODA 1J9IA 2CMGA 4KT5C 1K78B 1BBYA 3NW9A 1ONVA 3TRKA 1RNLA 2BBYA 3SZTA 1YQAA 2ELHA 1K79A 2VDVE 1D3YA 3P9CA 1J2XA 1N7JA 5D1HA 4C08A 4KN7X 1K7AA 1RI2A 2VE8A 2OXTA 2PWYA 2DQLA 4MTDA 4R6XA 1XN7A 2LNBA 1IN6A 2FPOA 3M6VA 1SQFA 1Z6TA 2YPRA 5CJ9A 5HILA 5CVRA 4FS8A 2JPCA 3OZRA 3R0AA 5DTMA 4XUDA 5E9JA 1FPQA 3LDGA 3FPFA 3KR2A 4E31A 1XCJA 4K2EA 3MERA 2OBPA 2V74B 3C0KA 3MTIA 2PT6A 3CGGA 2UYCA 3TOBA 5LHIA 3LKZA 2ZBRA 2VT3A 4CTJA 3TDUC 9MHTA 1AQJA 4DNCA 4EQQA 3KLOA 5ED4A 1IXCA 3BJ6A 2DPMA 1NW5A 3KPUA 5ILVA 4R05A 2WA1A 4HQMA 4IRGA 4YMGA 4A2UA 3IRQA 2RV8A 2EV6A 5K0FA 2EFNA 2AOXA 2N47A 3T7RA 3GF2A 3GJYA 1FYKA 3CO6C 4POOA 4CICA 2UZ4A 4KDPA 4M9XA 1B9MA 1ZH5A 3GUDA 4G6DA 3EVZA 4HRAA 3EYYA 3FYDA 4PYLA 2RDPA 2E7WA 1NW3A 2G9WA 1XDSA 2A68F 5F64A 2VS1A 5GM2A 1FJXA 3LSTA 2UZKA 2ZWAA 2YXEA 3HCBA 3IHUA 4MEYF 3DOUA 3KQMA 5JVTA 1DP7P 1SD6A 2G71A 3KR0A 2GXGA 3BWCA 3GIWA 1I4WA 1I1NA 5K0LA 3FM3A 2JH9A 3EVFA 4QQNA 1S7AA 1N2XA 3FTFA 5HIJA 3B3FA 5CCXA 1JE8A 5GINE 5FA8A 2QRVB 1P92A 1SD7A 1JXSA 1R8XA 1MJAA 2EB7A 5CVDA 2BYVE 2DPDA 2O0YA 1BC5A 3RYPA 4E32A 3EVCA 3TOAA 4N0BA 5E1ZB 2O3FA 3WE3A 5HOOA 3RJPA 1ZKDA 2GA1A 4FGZA 4HDVA 1NT2A 3DULA 3DMHA 4P9FA 1XD7A 4EK9A 3ER9A 2KJCA 2WC2A 4PYMA 3GDHA 2GWRA 3FWEA 3HA3A 1KA8A 3RIEA 2ZIGA 3K1PA 3HM2A 2KIUA 5HDKA 3A7EA 1IXSB 3DF8A 5D4RA 2Z6UA 5FADA 3KPJA 1YO5C 4MGRA 3HVHA 2YX7A 4AUKA 2WTEA 2UYQA 3OCJA 2FMYA 3FUUA 3SR4A 5LRRA 1IM8A 4FSDA 1FSEA 5ERGB 1MJ9A 2UWMA 3GRYA 3QPTA 2EFPA 4R8RA 4IV8A 2H94A 4HF1A 1H9TA 3F4KA 3EVEA 4GOOD 4DCGA 4Q47A 2NXCA 2R3SA 3E5UA 2XASA 5D6FA 2H09A 3HSRA 1ZHFA 3JWHA 2JHCA 5FB2A 1LDKB 1U6GA 2EG5A 2A3SA 3A25A 4LGWA 2P7CB 4ENMA 3HOSA 5HIKA 4BHCA 3GNLA 1VTNC 1Z91A 1QNTA 2LD4A 1MDMB 1J0RA 3DKWA 3TKAA 2JT1A 2BH2A 3L7WA 4IRIA 3M9AA 4JBAA 2ZCWA 3X0DA 4CWAA 4TV7A 2K4BA 4UVBA 3OU6A 4ATNA 2J5OA 3L09A 3BROA 3QU6A 4A5MA 1FSHA 2VOOA 3HCAA 2QVOA 2XBMA 2XAGA 3K0BA 2X0LA 3M6WA 1WRJA 1U78A 3GEZA 3CJTA 1INLA 3MAJA 3UJCA 1V4RA 2E1NA 5E1MA 3F3XA 3HVJA 1SFEA 2L3DA 3BGDA 2PX8A 4MTEA 3VFZA 3L2CA 1YB2A 2P8TA 3MZYA 3BGIA 1G3YA 1RI7A 1V39A 2OD5A 3CVOA 3JAMZ 4FT8A 1Z6RA 2WV0A 5GIOE 2C7RA 4JK1X 5FUBA 4GC9A 4HAMA 4Q5SF 3KQYA 1KXZA 1UFKA 1P1CA 4LG0B 3NMUF 1Z7UA 4KUMA 3KEOA 4IWNA 1M6EX 2EFWA 4L9VA 1AQIA 4RGRA 5EIFA 5TJJA 1B4AA 5U4XA 2C6YA 2VC1A 1IXKA 3M8EA 2HTSA 5JR3A 2M45A 4WCGA 5HLIA 4OQDA 3E23A 4A12A 5CVUA 2YX4A 5EG5A 1T39A 3I58A 1VL5A 2NNNA 1YF3A 3REOA 1JTFA 3SGLA 2AN3A 4E2XA 4ER3A 5HS8A 4E70A 1YLFA 2OZUA 1JTEA 2ADMA 4Y17A 2AVNA 5EIWA 5F2KA 4R8HA 2HGCA 4BLWA 5DX1A 2FU4A 2LF7A 1JGSA 3FHZA 4EJVA 2JRTA 4XLNF 4QDJA 5BW4A 2FXAA 5HLHA 3HSFA 4EGYA 5EQJB 4PCLA 4BHBA 3WTTC 5LSAA 4M6YA 1G8SA 1E2XA 1JG3A 3G89A 1XMKA 1R58A 1EH6A 1ZLKA 4WXCA 3MHTA 3BWMA 4ZYEA 2BM8A 5EKXA 3ISPA 4LG1A 3DLIA 5BW5A 2JSCA 2ZSUA 3SZPA 2F2EA 1JR4A 4ZH4F 3H92A 1Z3CA 3K0LA 3M6XA 2KKOA 1ZRCA 4ZZLA 5IT3A 2MD5A 1EQAA 3LECA 2QQ9A 3FUXA 3FZGA 1XGOA 4HH4A 4U7TB 5KQSA 2B0LA 2XRNA 2OBFA 2HTEA 3G73A 3F8FA 4YUZA 3BDDA 5C0OE 4PONA 1HSJA 1FNNA 3KZYA 4ESJA 5IT9Z 3B02A 4DKJA 1XDUA 2PLYA 2HV9A 3THRA 3IWFA 4MTLA 4D0PA 2CWWA 3FMRA 4DM3A 3DPTA 3A4TA 3W6JB 4YIFA 4U0WA 1B6AA 3F22A 2XHKA 4OA8A 5ILUA 3G5TA 3LFKA 2ZZMA 1O3QA 3HVKA 1WXWA 1ZG3A 4GUAA 5DRYA 2GA2A 3C18A 3EEOA 5LEJA 4QPPA 2GIVA 2CSOA 3G8BA 2BGCA 3DMFA 1WQ2A 3ERCA 5E9WA 4UXNA 4B09A 3LWFA 3QU3A 4LK0F 4G9YA 4HTFA 2P41A 4KVZA 3AY0A 5DTRA 3KQSA 3TKYA 1GHCA 2BE5F 4IRHA 4X60A 2ETHA 1IRGA 5JHUA 3FUVA 4H0NA 4BP1A 3FX3A 3TQSA 5HVQC 4N9IA 2A07F 4ESFA 2Y48A 3G2MA 2R6ZA 3PX2A 2NRAC 5FD6A 2Z99A 3FRIA 1ZQ9A 2ESNA 5H02A 3BOQA 2ZWVA 4UOEA 4ER6A 2YXDA 3OZTA 1LQ1A 2KIFA 3IKVA 5DD4A 5EHGA 4KDCA 3MFKA 2OKCA 4HA8A 3V8LA 4QDKA 1HNNA 2DLLA 4H0EA 2FRHA 3WTVC 3K1MA 3TM5A 4MQ4A 2GAUA 1JQ3A 1K6OA 1IY9A 2VC0A 4OIQF 3LA7A 5D8KB 4HG2A 4PZJA 3JW4A 5EVJA 5LQKA 2RQPA 3BP8A 3BJOA 4RTOA 2DO7A 3PB3A 1JQEA 4EKGA 5DT2A 2QBYB 4P7JA 3R60A 2YSRA 2C7QA 4C04A 2DPUA 3PFHA 2XIGA 5K05A 4RGXA 4HBLA 4DA4A 1KGSA 4E2WA 4IHTA 4QTUB 1HW2A 1FWZA 1L1EA 4FP9A 3ELKA 3R3HA 3CCFA 1WG8A 3IC7A 3CO7C 2BR4A 1D8KA 3OV8A 2FK8A 2OZVA 2PT9A 3J80Z 2PY6A 2P4WA 4DQ0A 3EGEA 2VBZA 3V7CA 2NNWB 1JSXA 5LQJA 5ERIA 3GFIA 3LDFA 2IDKA 3U81A 4RX1A 5EMKA 2E1CA 3OU7A 5EHIA 2MC3A 4RS8A 1ZRDA 2PFBA 1EJ6A 3IHTA 4DMGA 2VBWA 3UJ6A 4L5JA 4FHTA 2CYYA 3R0JA 3GXOA 4KIFA 2F5CA 2HYFA 2XAJA 3FZVA 4B8XA 5DXJA 5EGSA 3WSTA 2F5DA 3FTEA 2JPBA 3HVIA 5EC8A 1VP9A 2W85A 2IPQX 4CXMA 2HKXA 1S7OA 5FQOA 4HX4A 5KK1A 1HBXG 2IH5A 5CVEA 3ER8A 4LK1F 3B3GA 2NXJA 3P2EA 4KMFA 1O54A 3H3UA 3OOPA 2P7IA 1OYIA 2OZ6A 3M33A 4L9NA 4EJWA 3PS9A 4QQKA 4IKPA 4C07A 3P2KA 2VBXA 1TQMA 1STZA 1S8NA 3GFMA 1UIRA 1XJ5A 3RTRA 1EAMA 3JWIA 1XVAA 2GS9A 2PJDA 2EWNA 2P6SA 2QUFA 5L3FA 2QWWA 2XKOA 3HCEA 5LHGA 3UFBA 1BN5A 3DXYA 4C05A 4BY9E 4RTJA 3ZMVA 5ILSA 2NYXA 3WTUC 4RGSA 5G02A 5P8WA 1USSA 2D1VA 2ZW9A 3DMGA 5F2NA 2ESHA 1W5TA 4ZYDA 1JG1A 1UWVA 2C7PA 3G2OA 4LLGF 2JHAA 3KFWX 1XGNA 4RB0A 3ZMZA 3RODA 1QANA 2HS5A 4PYIA 1O57A 4EM2A 4YUVA 4C03A 3LHDA 2HNKA 4FR0A 4ENKA 3QRFF 3M4XA 4QVGA 3E7PA 2CQKA 3ROUA 5EMMA 2NS0A 2ZJ2A 3NTVA 2HQNA 1L9KA 5K0JA 1QQIA 3HRMA 2XYVA 5GM1A 4OOIA 3TDZC 1HSTA 2BZGA 3SMQA 3PLAE 1NW8A 2XYQA 1FLIA 3KHKA 3UZUA 1T38A 1PRYA 3KZZA 2HKOA 3H3ZA 5M5BA 1O3RA 5KVAA 5K01A 1WI9A 5BP7A 5E20A 1R5GA 1D5VA 3ZMSA 2M8EA 3SQNA 1TLHB 4A0XA 3KKZA 3LA2A 2PX5A 4PYQA 3LBFA 2IVMA 1EJ0A 2J5PA 2FHPA 4Y15A 2R7FA 2IRFG 3KQVA 4KMUX 2PKWA 2Q8KA 2Q0OA 3NVKI 1VBFA 3MCZA 4I2OA 1MJFA 1ORIA 2I7CA 2ONYA 4Y13A 3BXOA 4X41A 2D45A 3I4PA 4ER5A 5CIYA 2F5EA 2PX4A 1SKMA 2PI0A 3E6BA 2VODA 1NBHA 3P9NA 4M74A 1IAWA 4RWZA 5K09A 3NVMB 1G3TA 1WKMA 3VC1A 1YZ3A 3AWIA 5HS9A 3CJRA 4A6EA 4ZTBA 5HIIA 3R9XB 3FMSA 2P7VB 3WU1B 4L9JA 4R8SA 2VZ9A 1MD0A 3O4FA 3T7SA 2ZVJA 2P3QA 1JQDA 4M9SA 3F72A 5J8FA 3SSNA 3KE2A 3V7SA 3U9GA 4A0YA 1B42A 2FK7A 2MA3A 5BXYA 1CF7A 3Q87B 1J5YA 1ZAOA 1C0WA 5F6FA 1OR8A 2ZNZA 3MCTA 1BI1A 3OZSA 2EJUA 2LKPA 5LGNA 1T0FA 4RVHA 4KNYA 4A0ZA 5K5OA 3FXRA 4PDKA 1CGPA 3DEUA 1RUOA 3B89A 1X3UA 2IT0A 2KIMA 3UJBA 2ZULA 5CD1A 1LEAA 3FXQA 4EJUA 5HOQA 1G38A 4L0ZB 3IV6A 3ELYA 2YUIA 4RTQA 1OPCA 5TRDA 2Y75A 3F8MA 5D5UB 1KR5A 2KRFA 8MHTA 1U3EM 5FFZA 5AIPA 3ECOA 4M38A 2GA9A 4PYJA 4RTRA 1E17A 2BR5A 4HYEA 3G2PA 4ETSA 2V9VA 1HKTA 3GW2A 1ON1A 4PINA 2G70A 3E3VA 3DH0A 2CFXA 1XCLA 2H00A 1QBJA 4V0QA 4ENNA 3LQQA 2MBFA 5DM1A 1U2ZA 1A04A 2GXBA 5BS6A 3KR1A 3KQWA 4OBWA 2QENA 1BJAA 4RTMA 3PT9A 5KS2A 2GZWA 5LGTA 1SMYF 3R6SA 4RB3C 4OMYA 3FPEA 4L7VA 2ZZKA 1RI1A 3T8RA 4RAYA 3SVZA 1XSXA 5EKUA 2PVCA 5KYGA 3RIRA 1TBXA 3VEPA 1SUSA 3OFKA 2IGTA 1DDNA 4I0BA 2PBFA 1YFLA 4DCMA 3I53A 4N9HA 2STWA 5H6QA 2MLKA 1RIOH 1BIBA 1D2CA 5CVJA 2I9KA 3ZMDA 3HA7A 1OYYA 3FPJA 1KQ9A 1KPIA 4GBED 1YTYA 2IH2A 1RZ4A 4R6WA 5K0GA 3T5XA 3M6UA 2Z9OA 3BKWA 4MEXF 4XCXA 3HNRA 1EIZA 2ESRA 3HRTA 3RKXA 3E97A 4B17A 2YTZA 3WG9A 2AS0A 5D8LB 2FOKA 5FA5A 2FBHA 3JAMK 4ON0A 2W25A 5LR6A 4I09A 2A14A 2P3LA 3DPLC 1QPMA 1I5ZA 4EVIA 3TMAA 2FE3A 4RYLA 3M7GA 4XSXF 2Z6QA 1EV7A 1AWCA 4OIOF 1Z1DA 3OE4A 3KP7A 2FSWA 3UJ9A 5AIQA 1PUEE 5T64A 3SM3A 3C7JA 4M9ZA 3I0TA 4G7HF 3S2WA 4HOBA 3UWPA 4U88A 4JXJA 2EK5A 1LVAA 1N7IA 2OA4A 4EGZA 2K86A 3E6DA 4F86A 3RI4A 4BXUA 5AONA 3UA3A 1W7PD 2EJTA 4M73A 3R61A 2X4HA 2ZIEA 3LA3A 3LL7A 2ONZA 2ZBPA 1L3CA 3I59A 4RB1A 2AVDA 5C1IA 4LMYA 2LSOA 3KPWA 5K0EA 3IEIA 1J7KA 3WU0A 5FLXZ 1VPTA 5K0CA 5LQNA 1BI3A 3LX6A 2OU2A 2CW0F 1SMTA 1KP9A 3EYIA 3QP5A 1G60A 2MH9A 1Y8CA 3KQOA 3HOTA 3KPVA 2FEZA 4AD9A 4JQFA 4WXDA 3VC2A 3PFGA 4HSGA 2EFQA 5GOZA 5K03A 3J7AO 4L18B 4IHSA 2MH2A 5DWQA 4XBFA 4BYYA 2K27A 4EKIA 1NW6A 2P35A 3WTYC 1JHFA 4P7GA 4HZFA 4O6JA 4CTKA 3GVAA 4ZZDA 2O57A 1YFHA 3SXJA 3COAC 3MAGA 4I01A 1TW3A 2FCAA 1R22A 5D5WB 3F23A 5DUIA 5E2AA 1G4DA 2HQRA 2AOUA 4Q48A 1S3JA 1SVUA 1B1BA 1BOAA 3NEUA 3F21A 1I1GA 5L3BA 5IT9K 1XCBA 3O7WA 1FBQA 3MWMA 4HLYA 5K5QA 1QAOA 1UFMA 5BPDA 1GXQA 3LKDA 4BQAA 1YS7A 3BZ6A 3THSA 3I71A 1T98A 3RDIA 3NRVA 5E8IA 4MWZA 2ZNYA 2ERCA 2LDUA 3ECHA 1QO0D 2L4MA 4OBXA 2P6TA 3NJRA 1FX7A 4YFNF 3QP6A 2O05A 5E1OA 4RTSA 4GC5A 2HWVA 1ZGAA 1OYWA 3T1BA 1FBUA 2A5YB 1M0EA 3QOPA 4YIIA 1MKMA 2AN4A 3CUQA 2DAOA 1HW5A 1R1TA 2PX2A 4LFUA 4P9UA 1L0OC 2P5KA 3AJDA 3EVGA 2XV4S 1GVJA 4EJOA 3GRZA 4DQ2A 3KP4A 1FP1D 3SSOA 3TQNA 2XAFA 1F3LA 1BM9A 3OU2A 3KEQA 4HLXA 3BUSA 1B9NA 3ORHA 2ZZNA 4S05A 2D2WA 1YG2A 2W57A 1S6LA 5FD5A 2VDUE 2ISZA 1FOKA 5DSTA 2NP6A 2V6CA 2BR3A 4HTFB 3MTEA 3I64A 2HOEA 4HX7A 5HFJA 3KLNA 3BWGA 2C7OA 3GZ6A 3W6KB 1D8JA 1YW9A 1IN4A 3PQKA 2O0LA 1P91A 4M37A 4GQBA 3EEYA 1S29A 2FBIA 1O7FA 3TO6A 2AOWA 1TNTA 4CO8A 5CUQA 3GLXA 4GOND 3V97A 4UUVA 3HHHA 2L4AA 3C3PA 3GFJA 3CUOA 4P58A 1KIAA 3F8BA 4O29A 5DXAA 5HDGA 5LLQA 2STTA 3LCVB 3E5QA 2NP7A 2HMYB 1SFUA 2QZ8A 3MQ0A 2KW5A 4R79A 3EQLF 1IXRC 3FPHA 3HCFA 4ER7A 1ON2A 1IN8A 2O8XA 1DUXC 1R7JA 5JI6A 4ER0A 3KR9A 3J80K 3GU3A 1LEBA 5FWDA 3CTAA 4MQ9F 1SAXA 1BI2A 5DDGA 3EGIA 1SFXA 3U1DA 4HDUA 4C4AA 1UCRA 2PN6A 3WGHA 2K02A 5IKMA 4DZRA 4PCQA 3TO9A 4DF3A 4HGZA 5DM4A 4IVNA 1P4AA 1BI0A 4GO1A 4RGUA 3JSOA 3V8VA 4AWXB 2V1UA 3U2RA 5DX0A 4M71A 2JTVA 5L3EA 3ERED 5K5RA 1YW8A 3VYWA 3DUWA 1ZN2A 1WXXA 1IUYA 4CDGA 1KQ0A 2CG4A 4KN4X 1EH7A 2CGPA 1YFJA 3DP7A 2P3OA 5EEGA 4WXHA 4QWQA 3RKWA 1RJGA 4O3MA 1BHJA 1J75A 1AOYA 1YYVA 3PFIA 4IXAA 4AX8A 4BLUA 3WGIA 2E5WA 1Q1HA 2OAZA 5HS7A 3HP7A 4CKBA 3D5LA 4FT4A 2EFJA 1YUBA 3Q9SA 4I02A 1X19A 1QAQA 2Z6AA 4ASNA 4BNCA 2XAQA 2AS5F 4LD5A 1JG2A 3WODF 2XAHA 2Z33A 4HF0A 4A5NA 2PSSA 2UXNA 3O3KA 3RPQA 5LQRA 3M70A 5GP1A 2H11A 1EG2A 4PGHA 4FX0A 4IPAA 2DU9A 3HSEA 4MIKA 1R23A 1OR7A 4G7ZF 3I54A 2XGXA 3SFZA 5JFRA 4HV6A 2JH8A 3HCCA 2O61A 1P2FA 1NW7A 2M30A 3GRUA 4A6DA 4AZSA 1ZG1A 1ORHA 3J81Z 2ADUA 2O06A 2OY0A 2VE9A 4HGYA 1NV9A 4U7DA 3C6KA 3T0IA 5LHHA 3LDUA 3ML6A 2QY6A 1MGTA 5DCMA 3EGVA 5D5VB 4HX8A 2M5WA 2L02A 3K69A 3FTCA 5HDNA 4G94A 2PQ8A 1BC8C 2K7LA 1TQIA 1XMAA 3P97A 2AOTA 2ACJA 4LB5A 1P4WA 4UV9A 1H1DA 1HMYA 2A61A 5LRSA 3E6CC 1W5SA 2GPYA 3QOXA 2ZKZA 1MHTA 3UA4A 1JSZA 4PYOA 4Z2YA 5LGUA 1ODDA 2NXNA 2Y0MA 2PGXA 5E18F 3ZP5A 3GWZA 3CJNA 5DPMA 1X1AA 5KQRA 3CUQC 1X1DA 2B2CA 2ZMEA 1UHWA 5D4SA 2E7XA 2IIPA 2AXLA 4WVLA 4HQEA 3UBTA 3PTAA 5CVIA 1WY7A 4KA4A 3LCCA 4RTPA 3E8SA 2RKHA 4I7HA 4G7OF 2OB1A 3T0YA 4UNOA 3EVBA 3TFWA 2W24A 1USTA 1XDZA 1AV6A 4PGGA 5A2QZ 2ZCJA 5BPIA 4NB5A 2DTRA 3F8CA 4P7KA 1HKSA 2G7UA 4PIMA 1MZBA 2XVCA 5E9QA 2CWEA 3HTXA 4OU0A 1W7PA 4ENJA 3TGNA 5E2BA 2NNYA 3G3ZA 4UHTA 3SX0A 3ZN1A 3ZMUA 4LWPA 2YR2A 1XXLA 4CXFA 3ME5A 1L3LA 3P71T 1G3SA 1K78A 4C06A 2L54A 2W84A 2ZXJA 2ZTHA 4WX9A 3KQPA 1F9NA 3IRRA 2WWYA 2ZBQA 2AOVA 2XYRA 4UVAA 4AIKA 1XSDA 2IH4A 4RVGA 3HTUA 5FO5A 10MHA 3LAJA 3E5XA 3MQ2A 2O6GE 4AZVA 3P7NA 4LB6B 3BWYA 4LECA 3M1EA 2IBSA 4HW0A 3SXYA 2FYTA 1ZARA 2OQRA 3HYIA 1ZRFA 4AZWA 1CF7B 2F5FA 1DL5A 1PP7U 4PCAA 3DXJF 2P7HA 1DPRA 2OYRA 4U0VA 1X1BA 1LB2A 1NV8A 1XTPA 5DLYA 3EDPA 5DTQA 1FY7A 4RV9A 2HZTA 1VP3A 2ZFUA 1DCTA 1AF7A 3DXZA 1RJDA 4PWYA 3HIFA 5DEQA 4IV0A 5E17F 4M36A 3TO7A 3BKXA 3NDIA 2NYUA 2WA2A 4M72A 2VONA 3ZQ7A 4E2YA 1Z9CA 3IKTA 1FP2A 4QVKA 4YV1A 2Q41A 3LCUA 2KJBA 5LQUA 3FM5A 3VB2A 3BT7A 1BIAA 2AN5A 4F85A 1UHMA 5LEKA 5T67A 4RVFA 4XSZF 3M8FA 2DFIA 1ULYA 1HXDA 2PXCA 5DM2A 3EMBA 5IH3A 2DK8A 4RTKA 3C3WA 1U2WA 1G55A 2IDJA 5DV5A 2QQBA 5K0NA 2IJLA 2B25A 5BQTA 1XB4A 2H6BA 2XVAA 4M6XA 5F2OA 2HFHA 5DYMA 3DLCA 3QV2A 4CGZA 4P55A 3OPNA 1OMIA 4YV2A 2EJRA 1LDJA 5F1RA 3DQVC 1F5TA 4YUYA 2HR3A 4ISCA 4LLLA 3RYRA 2P40A 4BH9A 2YXLA 3EVDA 4PYNA 2V79A 4O5VA 1FC3A 3HCDA 3V4GA 2QRVA 3EETA 2DULA 5EMJA 5HLGA 2HWKA 1QZZA 3RPUA 2A6EF 3V7RA 3GYHX 3T7TA 1P39A 5LQCA 5H6RA 2DBBA 4ZYGA 1WZNA 2HEOA 5EZQA 3B5IA 1R1UA 1VE3A 4YG2F 2OO3A 2YR0A 3UJAA 5D5XB 2P5VA 2GH1A 2QQAA 3BGVA 1YW7A 3I9FA 4IF4A 3QAHA 1O9GA 2PBIA 1WWXA 2AZTA 1KPHA 3T8TA 3G88A 4AIHA 3FRHA 2A69F 4P5OA 3AXTA 4P96A 3ZMTA 4X61A 3EUHA 3GFLA 4CZZA 2RC4A 3MEXA 1LNWA 3G8AA 3R0QA 2BV6A 3JWGA 2PXAA 5FCDA 1UB9A 3JTHA 2PLWA 4RAZA 1D2GA 1SUIA 5LBQA 3BY6A 3PQJA 2HTJA 4MNUA 2BEOA 3P9KA 1SD5A 3KU1A 3DXXA 2P5LC 3MB5A 4KWCA 2GLUA 4V0RA 2JZYA 2UYOA 5FLXK 2FRXA 3NQOA 2EA2A 2ZLBA 1YZHA 4BAYA 1U5TB 5D6EA 3FMQA 2I62A 3PX3A 2R7DA 4Y30A 4NHJA 2OQGA 3BWBA 2CO5A 1Y0UA 3IYLW 1I1SA 4WF2A 3EVAA 3AXSA 1T2KA 2QM3A 2H1RA 3I59B 1WSUA 1OKRA 2UXXA 1U5TA 1V3FA 4EM1A 3Q7EA 3A7DA 1RUNA 5E1DA 1MDMA 1JHHA 2RNJA 2LF8A 2PMHA 3KQQA 3BZBA 3EPPA 1LDDA 3K1NA 3ABTA 3L00A 4LLNA 4CKEA 4IJAA 4K6MA 4RSRA 4EQZA 1IN5A 3FPGA 3KPYA 4EJTA 1FT9A 5FULA 4GGGA 1RI4A 4HF2A 4GYGA 2VT2A 1P1BA 2RGVA 3TR6A 4YMHA 2A6HF 4AVPA 3WTZA 2EX4A 4YV0A 2XVMA 1KU2A 4G8XA 2GB4A 3QOWA 3VSEA 2VOPA 2IA1A 1ZLJA 5FFXA 2V1XA 1P4XA 3ZN0A 1Q0SA 3WGGA 1HQCA 1O3SA 5EOVA 3MGGA 4PIPA 1EH8A 2V7EA 4XUEA 5J8CA 5E8JA 3WTSC 1H0MA 3V8KA 1ZREA 5CLSA 2DI3A 3R4KA 2AOUB 1BOOA 2VN2A 1GXPA 4LJZF 5FQNA 5BOXA 4LG0A 2COMA 5J6XA 3HTSB 2DT5A 1Q0TA 4BLVA 5ICFA 3K9TA 5FWAA 3KQTA 5JUWA 2IFTA 3LQRA 4KIBA 5DUKA 2OPBA 3ULQB 2QE6A 1L3BA 1NBIA 4G6QA 3GRRA 2B3TA 1R1VA 3V8JA 4YUWA 3KP6A 4L9TA 3KETA 2ORED 1RI5A 4U7BA 3Q9VA 1R00A 3WTXC 4RTNA 2TDXA 1IW7F 1B59A 4I98B 4U0YA 3FF5A 1IRFA 4KYWA 3DTNA 5T6BA 3HEMA 3K6RA 4X1OA 3HRUA 3D2LA 1MJBA 1DUSA 3MZHA 5K0BA 2P8JA 1R74A 4RB2C 4OIRF 1KYWA 1M6YA 1TNSA 3N4MA 3PVCA 3ABUA 2YX1A 4RTLA 2ZIFA 5DSXA 1SQGA 2V1DA 7MHTA 2I6GA 1R8YA 3EMDA 3CUQB 1KYZA 4F7ZA 3UJDA 2FQ3A 3F6VA 2FMLA 3LAPA 2DW4A 3SHFA 2WK1A 2YVLA 3G7UA 1KPGA 3O31A 4MHTA 3QPHA 3IWZA 5GWXA 2OB2A 4AIJA 6PAXA 1NE2A 4UVCA 3JWJA 4RVDA 3O2PE 4MQVA 3HUGA 2BM9A 4L5IA 5ICEA 4QLCU 2P1DA 3O6BB 4HV5A 4OINF 2MLGA 2CL5A 3GGDA 3FUTA 2H6CA 3N97A 2NXEA 2IA0A 2ZBKA 2D1HA 1TPYA 4GF5A 3KP3A 1XGMA 4GCVA 4FZVA 4GOLD 4Y2HA 5EMLA 4PNEA 4YFKF 2DQRA 1I6XA 2UYHA 2YQZA 3OE5A 4EM0B 2Q2EA 3F8NA 3CLOA 3RW9A 2VXZA 3CC8A 3TLJA 3FYCA 5EPEA 2PEXA 1NKVA 2XUBA 4FX4A 3L9FA 1IZ1A 5L3DA 2EFOA 2O07A 1R36A 2GAFA 3CJQA 3P2IA 3FXUA 2VP3A 2NAZA 1QAMA 5LQAA 5DX8A 4HC4A 3C3YA 3SSMA 4S04A 3DR5A 1SG9A 2VDWA 3KP2A 5K8VA 1R5HA 2M1BA 1ZYRF 1JG4A 4QTTB 2IW5A 3CBGA 4ZYHA 3TOSA 2EV0A 4KDRA 3DV8A 3ZPLA 3H2BA 2AR0A 4P7FA 1F1ZA 3VOEA 3C1DA 4KFCA 5L3CA 2H27A 1H9GA 1Z05A 3ELDA 3RKYA 1XCVA 1FYLA 3ID6C 2PJPA 1FBSA 2HYGD 2Z5UA 1J59A 3ANXA 3S68A 4GYIA 1DPUA 1RJFA 1FYMA 2FNAA 2G72A 1L3IA 1VLMA 3G5LA 4G56A 1PJZA 3FTDA 3HA5A 3A26A 3G2QA 1R6AA 4QPNA 5HEKA 3GCZA 1D2HA 3E6MA 1HKQA 4GXOA 5DCFA 2B9EA 2PMUA 4E2ZA 1TTYA 1YS6A 4XLPF 3GRVA 1YIOA 5H20A 4WWCA 1G6Q1 4KIGA 3OFJA 5C9ZA 3LBYA 1QZYA 1ZG5A
chains in the Genus database with same CATH superfamily
4L5CA 3PXGA 3R3UA 4BEBA 2VTBA 1USIA 1GVDA 4UTNA 1LDYA 3HYCA 3OO1A 4LWOA 3U48A 3NDPA 1T26A 2EV5A 4KXLA 1R9JA 4FEGA 1QVZA 3KL4A 3B73A 3CF6R 1IEWA 3PQ3A 1PX2A 1T3SA 1SVIA 2H7YA 3CCQI 4UFNA 5BN4B 4JLAA 3S1MJ 3SQMA 3HI6A 4PYKA 2XNCA 4OQLA 4QJBA 4ALJA 4EF6A 3PC8A 4DT1B 1QFMA 4EW1A 3HJNA 4JLSA 4BHPA 2AQEA 5LYJB 1PJSA 1ZWLA 3PUVA 1SM4A 4DY6A 2DR3A 3U9LA 3IAFA 4HATA 4GI5A 4HGQA 2IEKA 4FW9A 3HABA 4COOA 1BEZA 2UXDB 1XHFA 4INAA 3T5TA 3EJWA 1GZ3A 4RHUA 2XKPA 1G8HA 4EAAA 3QKRA 1ZXBA 3CC7I 1UXJA 3OJLA 1QXSA 2PD3A 1I27A 3QA9A 5E8GA 3GJ3A 5L3GA 3VDMA 2GAAA 1NI5A 1BKYA 3EVTA 3QXXA 1N9GA 4PSCA 1E69A 3I92A 1YDGA 4U7PB 1M1YB 1MBEA 1WW2A 2X77A 3OJOA 1DO0A 4RM2A 2WM8A 2G09A 4S1VA 2XITA 1QDEA 1D2AA 3HO6A 1GLVA 4TTRA 4BAUA 2BBYA 1K7SN 1D3YA 1P61B 5IAJA 3X1ZA 5I5GA 3EIUA 2OXTA 1UMBA 4KLRA 2PWYA 4MDEA 3I0MA 4MTDA 1XN7A 1E5TA 2VNHA 1M33A 4F97A 3UT5A 2HI3A 4RU1A 3R0AA 2Q6TA 5LYJF 4PM4A 1X1TA 1T8YA 3N6XA 5JARA 1DUIA 1UKEA 2PT6A 1P5HA 3LPAA 1L6IA 3SZOA 2QZSA 3M5PA 4TYNA 5IBRA 4UPVA 1CY4A 4CIYA 3EN0A 1MT0A 4RF4A 3BJEA 4XJSA 4ZZ0A 3T7RA 2NVYJ 2WAFA 2RMKA 3BG7A 4OMDA 4IIJB 2VWPA 4KDPA 1P80A 4GVXA 2SCUB 4RXTA 4HRAA 3B5EA 5HCUA 5BR4A 2RDPA 5JC1A 1FJXA 3LSTA 2VHXA 4HN2A 2XF8A 3DOUA 2P6MA 5A5GA 1H8AC 2D3WA 2IQ5A 3HB0A 4ZI7B 3QOEA 2PS9A 4BMSA 5JJBA 3E9RA 4BBRJ 1HUQA 4MJLA 2OGSA 3PR3A 4GVPA 2JZNA 3EWNA 3KTFA 1BC5A 2FWBA 3L0BA 2YJ4A 5LZ5A 2G04A 4XGNA 4HDVA 1DT5A 1A31A 1G7CA 4MS1A 3SXUB 1KIFA 1NHGA 1FNSA 9ABPA 4BNVA 2HYDA 2H2WA 1AUQA 1PW7A 5LD2B 3D3WB 2Z6UA 1PK7A 1TCVA 4PLVA 1Y3IA 3HVHA 2YX7A 5DXFA 4D9NA 3ND8A 1FTTA 5ERGB 3HU3A 4BN4A 4AUXA 5H2FC 4FOTA 3VDRA 3GJ8A 5GGXA 2XOKA 1NVAA 3JYPA 1Z35A 1D1BA 5JSZA 5AW7A 4XLTA 1JVSA 4IIJF 1CR0A 4YNBA 1W75A 1H8HD 1RPTA 1E3HA 3OMWA 4HFNA 5KNBD 4IIFA 4DRZA 5BO5A 2CV2A 2CVPA 1HYGA 4XK4A 1TEXA 2CLLB 1V11A 4NFHA 4K28A 1B6RA 3I2FA 4ZI7F 3FWZA 4LZAA 3K2EA 3A9WA 2AJBA 2L3DA 2WV7A 4ABTA 1T9CA 3CM0A 2M6RA 3AKCA 2ZUSA 4BTEA 5KDOA 3G17A 4CM4B 1XZGA 2ZQYA 4RFVA 2CXSA 4TYPA 1YJXA 4D46A 2QVYX 4IWNA 4A92A 1ZR2A 1AQIA 4A5SA 1SGWA 4N0QA 3FPKA 4HDAA 3OIFA 3FISA 2RBEA 1Q1GA 2Q62A 4EQ6A 2Q1TA 4O25A 3SGLA 4O4HB 4E70A 1TWAJ 4R8VA 1L8OA 3CT4A 5F2KA 2WSYB 3VNQA 5ESDA 1C3JA 4EJVA 1T1GA 1DTWA 4P1WA 5A5EA 3RC8A 4RD6A 1XQWA 4N65A 3KAQA 2XQVA 5LSAA 1L4UA 1G5IA 4KIWA 2CUTA 4OI1A 4AG3A 5IW8A 1ISMA 4OH7A 4YJGA 2F2EA 1JR4A 2OBYA 2R7OA 5TDHA 1A82A 5ALNA 3A6EA 4G0PA 1HMPA 1BH2A 4I4CA 1E62A 2VSQA 3KKOA 2O7SA 4GGMX 3GK3A 5IT9Z 5K4AA 5G1PA 5IYZB 2PLYA 4MTLA 1YDMA 1Z2OX 1EWQA 4YH1A 4BO8A 5MFZA 1O3QA 2HCFA 1SKAA 5LEJA 3EXFB 4IG4A 1ENZA 2RAPA 2QCOA 4IHXA 3NTXA 4POAA 4PR0A 2BKLA 4MUJA 3QU3A 2C8JA 1V5EA 3P0JA 1AQNA 3GVHA 3KQSA 5I7FA 1P62B 5FWYA 4B3HA 3CR7A 3OC0A 2ESNA 2QZPA 1XZPA 4ER6A 4B3RB 2KMUA 2H9YA 2OKCA 1CQPA 3KM0A 1M7BA 1HNNA 1GXSB 1CRWG 4YY3B 4UW9A 2VHJA 3ND9A 2XWBF 4NEHB 5KYWA 1Z17A 1U3TA 3GLFB 4WBSA 4OQNA 4RTOA 3ZCOA 4P7JA 1XSEA 1U8ZA 2R7LA 2P2NA 2VNAA 4QD3A 3CB2A 2H8KA 1KGSA 2KLBA 1HW2A 1X70A 2YZKA 2PT9A 4XGKA 4LYHA 1EBBA 5IYZF 2J6IA 4RVUA 4NU6A 4PQRA 4FZJA 4TMKA 3DE1X 2IITA 1EHCA 5ERIA 3DBHA 4HRYA 3L84A 3P0FA 3EDCA 1ZNZA 3JAWA 5L8VA 2F55A 4LHWA 1S72I 3BBPA 2HEGA 1UJMA 4AO8A 1YZTA 3IR7A 3WGYA 1N3IA 5I7SA 4RK1A 3KAJA 4EKYA 1ZAYA 2Z1MA 1BWRA 5J3JA 4C7MA 1C3XA 4QOIA 4Z8XA 5AVSA 1AQLA 3GFMA 2Y77A 3BT9A 4A0GA 2ADOA 1IJBA 1AUPA 4Y6SA 5LHGA 3ZNOA 1BN5A 2NX2A 4JUIA 3JX9A 4FQ7A 3UAXA 1ZD3A 1LI4A 3L2UA 1ZPDA 1T2CA 1U3VA 1SXJD 4BJHB 1Q74A 4K6CA 3KZIC 2GPSA 5EP2A 1K75A 2VDQB 2QVBA 4G5SA 3L8FA 3ISVA 2HT6A 4YUVA 2H7XA 2HJGA 3ERMA 2HNKA 3DEZA 3EPRA 1ECJA 3MD2A 1BXZA 5D3MA 4ZXPA 4ZI2A 3TRJA 1L4BA 4BQQA 4S1OA 4C4TA 3WIEA 3RS5A 4QJ3A 4CCYB 1ABBA 2W42A 1DQPA 3HZRA 3FKIJ 4HPJB 3KTOA 2J5PA 2JJ8A 3DBLB 5E6RB 4WZAE 3QUTA 3V4SA 1SCQA 2YN2A 4I2OA 3WXMA 1IWOA 5TEVA 1CY0A 3A9UA 1V1RB 1H4TA 5AXDA 4I3HA 4U9IS 4OHCA 1BHQ1 4M74A 1QGED 1EDOA 3C4VA 1WUJS 1BN7A 1SQ6A 4YMSA 5CFOA 3WMWA 4DB2A 3O5AA 4KO3S 1D07A 4HDKA 3X2SA 3TUJC 1JHQA 3TUZC 2Z5VA 1V5WA 4BFZA 4I1SA 4NICA 2ZJ7A 1OR8A 5BMOA 1IYZA 1M1NA 4Q1DA 4EHIA 2BSQA 5LGNA 3E2MA 1T0FA 1V8FA 3LQ4A 5FT9A 2O1WA 3CU5A 3PJEA 2HU7A 3KQLA 2W2OA 4BJ5C 3UJBA 1LEAA 2QMZA 4PAQA 3DKXA 2YFYA 5LXTA 1G38A 3ZWBA 2B82A 5KYNA 2FH5B 5KTNA 2YWEA 3A2LA 4OSPA 1U3EM 1P77A 2AJLI 4ZEXA 3KAKA 4FISA 2I8DA 2EHDA 1NBMA 2ISSD 3RSNA 3L2WA 4OHKA 2EW1A 3TBHA 5DM1A 4E1VA 3GGSA 4JEIA 2WFLB 2OLKA 5G2OA 5HM6A 1KI1A 3QELB 4N3BA 2E6UX 1AY0A 3RVPA 3EZNA 4R83A 3KUXA 3D8HA 3DMNA 1FLNA 1YZVA 2BT4A 1RZ4A 3RABA 1W2WB 3UXHA 5A5FA 4ND8B 3ZX4A 4D8VA 3JAMK 3R7FA 3BXGA 4D3YA 2Z8XA 1O5TA 2EQBA 4I09A 2A14A 2YYSA 1E6EA 3T3OA 1II8B 3CJTB 2VAPA 1QGDA 3G1OA 4HNHA 5T64A 3AUAA 3NIGB 1D4OA 1YE5A 3IP3A 3KSAC 1S6YA 3O83A 4MQ5A 1BE6A 1WIWA 4B6OA 5FNZA 1QIDA 2FWAA 1NG1A 2E7ZA 2G7MC 4Y33A 2ZBPA 1GTL1 2R7ZJ 3IEIA 4D56A 3I5AA 4WZAA 2RGDA 3S40A 3M81A 3DEEA 1KNXA 5AXBA 3O84A 4GI3A 4RK0A 3I28A 2P27A 1I3MA 5A9SB 3VPAA 4N3CA 2Q8QA 1WHTA 3BH7A 4K5QA 3D0KA 5B3KA 3A3YA 2B0JA 3VKFA 2GZHA 1DAPA 5FBRB 1B41A 1MMGA 4PRYA 2OCCH 1Y6FA 2P0YA 4KX5A 5B7GA 4FFOA 5CFMA 4KQKA 3TLMA 3LH5A 5E2AA 3BF8A 1BOAA 2VIXA 4DNPA 3LWBA 2I6FA 3LC1O 2LVSA 3D2CA 3HUEA 1X77A 1NMQA 2CK3A 2PZJA 1PWXA 3MXOA 4UHDA 3IB3A 2BHTA 4HGNA 4D3SA 4PQGA 1KDPA 4G4GA 3FCXA 1D5WA 3A70A 3BR0A 1QU2A 3CUQA 1T9DA 2O9JA 2JRLA 2XLCA 3WLNA 1F3LA 5AW4A 4CLRB 2VDUE 3Q3CA 4OATA 1ZW6A 2NP6A 3PHLA 2JLVA 5CDUA 2JLAA 3M6LA 1RP7A 2C7OA 4B3SB 1JKXA 2DFKB 1KL7A 3X3HA 3F6BX 4HBGA 5KJCA 3A0RB 3UGJA 3IMFA 1SAYA 3HOZJ 4HQ0A 3RZOJ 3TSYA 1AZWA 1DKQA 5B1HA 2F1KA 2W37A 1S89A 3E9YA 2DA2A 2BFOA 4JBGA 4L4XA 3HCFA 2M34A 2JPDA 4NE7A 3QFTA 5JNSA 5JI6A 3BGOS 1SAXA 1B8VA 2DYKA 3MSCA 1HPLA 4PIVA 1SKBA 3FLBA 4M0PA 3NV9A 1ZJ5A 3TO9A 1C0PA 4IVNA 1L5GB 1AK2A 3JQCA 3V8VA 1KYQA 2D74A 1AKQA 1CLEA 4LW8A 3Q5GA 2VDPB 3C74A 2E49A 3ONWA 1W85A 5H4GA 2BZTA 1ODJA 1A9OA 5ALMA 2AQ8A 5CK4A 2XC7A 4GWKA 3FXKA 3D5LA 1A5AB 4FT4A 4GS5A 2IGBA 3OA2A 2XX3A 4MV5A 4AJLA 3HOVJ 3AK4A 4J7AA 4KI7A 4XWOA 2Z33A 4ZWNA 3A0UA 1QH8A 1BKSB 3PQEA 3S2YA 3UJPA 1GU0A 5LBUA 5FBLB 3BM5A 5JFGA 2R7TA 4ZAFA 2YFHA 3DVRX 1FUYB 1OT3A 3KT0A 4DV5B 1KDTA 3IV5A 3HWX1 5KVCA 1NK2P 2XDWA 2JK1A 4MO2A 1P4WA 4QWMA 2GN9A 5TPWB 1TEHA 2FEKA 3QOXA 1RE0A 1WF6A 1DP4A 4Z53A 1O03A 3A1YA 3DV9A 3LUBA 1F8GA 2VDLB 2Q1YA 3GWZA 5IXYA 4Q3KA 2XQJA 2EZHA 1CZRA 5A3RA 3WLMA 2CXHA 1HA3A 3NH6A 5IS2A 4RNCA 1CIPA 4UNOA 4ZU3A 4JB3A 2W24A 1CKEA 4NV0A 4CETA 4AKSA 2P3SA 3QXJA 1KI6B 4OSOA 4URVR 1PJLA 5CB4A 4UUQA 2QTTA 2AJ8A 3IUEA 3O0TA 1UDRA 3AI3A 3IRRA 1RZUA 3WHCA 1JKOC 5A6SA 5AOCA 4F92B 2WAQN 3MQ2A 1IBSA 2LOOA 3H1GA 2OLEA 4LECA 1FTQA 3M1EA 5B37A 3H8JA 4Z6YA 3FPBA 3KQUA 2VJNA 2FSSA 4ZDKA 4JL5A 3DXJF 3TB6A 1Q6YA 2CDNA 1DQNA 1CYDA 5AI5A 2LP4Y 4D45A 1I01A 3ZU6A 2TS1A 2PUTA 5KEIA 3TO7A 1L1FA 1TWGJ 2VLAA 3BKXA 4V2GA 1Q0QA 4ETMA 2WA2A 3IKTA 4L78A 5E3JA 4EX7A 4HAXA 2FAXA 2YXNA 1UHMA 2XGEA 3OYJA 2CB0A 4P34A 1XGKA 4XSZF 3PRJA 4B6GA 1MGOA 4V0MA 3ZJTA 3G8DA 4GZMA 2AR7A 3HYNA 2VAVA 2XUFA 5DZSA 3PJGA 1HEUA 2HFHA 5DM6F 4UU0A 2F8MA 1G19A 4BB0A 2DT7B 1TQ6A 3OSUA 2X8WA 5FTLA 3QMPA 4YUYA 2CJJA 2BY2A 1FC3A 5KB3A 3V4GA 3TLGB 4KYIB 3QWFA 1H85A 4Y2TA 1QTQA 3B6KA 2M0MA 4FKMA 3ZWCA 1KQNA 5D5XB 4IJMA 3CZ4A 1TUBB 3GPCA 2G83A 3S29A 1RYMA 3PQ7A 1P0QA 1OR7C 1WMEA 3P2YA 3OTGA 4U5QA 5E3IA 2QHXA 1WCWA 3MEXA 3W5UA 4HZIA 3GBSA 3R0QA 2BV6A 5GJVC 1E9DA 3PQJA 3Q12A 1PFYA 2AV6A 1UXIA 1PR2A 4KRYA 3TQQA 1QIKA 3BZKA 13PKA 4EENA 4YRNA 3RUPA 1ZM4A 2A9RA 3TOVA 1MMDA 2PMZA 1NJGA 3GYGA 3L7JA 3N2YA 3QFCA 1E58A 1I1SA 3GLKA 3EX7C 3V8MA 3FD8A 3Q7EA 1MDMA 2MSWA 1P31A 3WGJA 4ARSA 1FNCA 1PV1A 3UAZA 1LDDA 3K1NA 5H83A 5C1BA 4HQKA 4GBJA 4CLOB 4JUCA 2AXTC 2JB9A 1HT2E 2MGQA 1HQCA 4CKWA 5HCIA 4TSFA 5EOVA 5KNBH 4MICA 1IY0A 3P20A 3GBPA 4KQXA 1CQJA 2ZVPX 4ZV9A 2YOGA 2JA5J 1GXPA 4BUJA 5J6XA 3KSBC 2BJWA 4WE3A 3PNSA 2CZCA 3H86A 2QVXX 2OPBA 3REQB 1K0UA 2G9ZA 4QC2A 2VJYA 2IS4A 3B48A 2OHIA 4EB6B 4YUWA 4KYTA 2IKSA 3IKLA 1RI5A 1C7IA 5TQ2A 1BS1A 1IULA 3RT1A 1BR1A 1Y8RB 3ECCA 1H93A 2H31A 3FK6A 4JIMA 2YX1A 3OD5A 3RTDA 4UNNA 2WPDD 2RGGA 2YBDA 2JD1A 3O21A 3CDIA 1TB4A 1OROA 1KYZA 2QKYA 3GPBA 4G0ZA 1WSWA 2JLUA 4AIJA 6PAXA 3JWJA 3OQIB 3EXHB 4PLFA 1DMSA 2FUKA 3EUKL 4ZVVA 4WL0A 5AW3A 3CPJB 3TR0A 3NCTA 1TK3A 3OCVA 2P9CA 1Y1RA 2A0WA 5M3BA 3CC8A 3RW9A 2OUKA 3N76A 1CUJA 5FAXA 2QRNA 4MR9B 2V54A 2KRCA 1M7HA 4KWTA 1CUCA 4RF5A 3DEYX 1LFAA 1HM5A 4TLEA 1CZHA 1MIJA 1Z16A 4KDRA 3DV8A 4OK3A 2XEDA 4DOZA 2I2FA 3UG6A 4UU1A 3ETEA 3QLJA 2X9QA 4ALMA 5J2TA 3BRWA 4LZJA 4W5QA 4UBKA 4IZHA 4KPGA 4KIGA 4PGAA 2ZB7A 3A05A 3ZKWA 3KOYA 1X4PA 2RARA 5DYTA 1EWVA 2Y27A 3ZJVA 1SUCA 3IULA 4HUJA 3NO4A 3IH3A 5LKRA 4KWEA 1WDLA 4OX9B 1K86A 3HHGA 1XEWX 5FTWA 4RPGA 3ZXXA 3I1FA 3C14C 3A0HC 2R7WA 1UMQA 1YA8A 3AEUA 3Q1KA 4L2IB 2C5GA 1VIDA 3BPVA 2A35A 4OA5A 4NJOA 4QPOA 4BO9A 1DKRA 2VLIA 2PLNA 2I6SA 2LCQA 2LTPA 2L01A 3CPSA 2PIAA 1ZGHA 1X7WA 4GAEA 2Z3YA 4IR7A 3HPGA 2ZO4A 2DWCA 5LIPA 1JEYA 3NTUA 2K9MA 2MYSA 4HO1X 2HXSA 3R6TA 1W5FA 2X13A 3ITNA 3H4IA 1NVVQ 2OUIA 4KSCA 3U3DA 4B40A 3F47A 1E5LA 2JH3A 1OKKA 1KI2A 4QX6A 2YS9A 5DOVA 3LYHA 3P4XA 3OSGA 1LE8B 2VYQA 5KX5A 2Y1XA 3H1PA 3FXOA 3V8BA 3PQ8A 1LJ9A 2XADA 1HFWA 1RJEA 3AMVA 3KP5A 3CRZA 4PG7A 1IB0A 5EL0A 4B8YA 2VF2A 3JTGA 1I0ZA 1YHZA 4INPA 5ALUA 3V9PA 3VR1A 3UJ8A 2B78A 1UXHA 1W9MA 3SZMA 2PLRA 3ZCQA 1K66A 2D0DA 4IJQA 5A3SA 2R6R1 2WD9A 1J9IA 4K26A 1QQ7A 2BGGA 1UPTA 4EY3A 3IP9A 2C4VA 4NONA 1T9GS 3DLTA 5HF9A 1JNXX 1DX4A 1IN6A 3Q7TA 1GZVA 5CVRA 1GM5A 4AWBA 1UBLS 4MV0A 4BS9A 3UGKA 2Y69H 1QCZA 2F8SA 1GZ5A 1U8CB 3WHIA 5LHIA 2GK6A 5FKMA 1UZCA 1IM5A 2GK3A 2M98A 4K05A 4X90A 4QT0A 5JCZA 1ZOIA 1ACJA 3WAGA 3PNMA 2IXGA 2WDZA 2EC5A 2ZAGA 1VJGA 2EV6A 3SZ3A 3GF2A 1HQDA 1MRZA 2CUJA 3ADDA 4D8WA 4UM5A 4B43A 4Q16A 2PM8A 4IVQA 1XDSA 4GXRA 2ZWAA 3IVCA 4Q7JB 2Z2YA 4HB0A 2AA3A 3KOOA 4Q66C 1P7WA 2JH9A 1GZSA 2RGRA 5HVNA 1NQOA 5CCXA 4I5EA 1IM2A 5HR5A 4F8EA 1R8XA 5FXMA 4QUIA 1GG2A 5AK0A 1KSFX 2G1JA 1CDDA 3TIGA 3WMRA 1VFNA 4MW9A 4U87A 3GJQA 2EF0A 4FGZA 5BNFA 4CYCA 3SZRA 2PWZA 2W6JD 3EEQA 2FSVC 2DAPA 2ASEA 3GIDA 3GDHA 1YR9A 3WOVA 3RIEA 2BF7A 5CBPB 1P72A 1ZRNA 3L8ZA 3PT5A 3ZQQA 1GUYA 2HRBA 2NQ8A 4IBOA 3CE9A 1TQ2A 2Y9PB 3HJTA 1SQ0A 1ZUHA 2H94A 1H9TA 2R751 1ZJYA 4GOKA 3JWHA 3I09A 5EYPB 4JYMA 4LGWA 1SO8A 5JO0A 1V3VA 1B14A 3GUVA 3FZNA 1K7CA 3OTQA 3NH9A 4Q6BA 2W6ID 4IRIA 1CY8A 3WWOA 3KUCA 2HVSA 2CWDA 1CUVA 3OEHD 4KEAA 4ZZ2A 4BECA 3G0HA 2WLSA 1P60A 1UQUA 2XMQA 3O95A 3FYTA 4QDOA 4C3VA 4C0WA 4OQQA 3VFZA 2PIDA 2I2DA 1RI7A 4MW7A 2C03A 4NE2A 3INGA 4M89A 5J23A 3PSAA 2OM2A 1LJUA 2BBOA 3S99A 1CYEA 3TNDA 4AC0A 2H5EA 1MC5A 1TIPA 1HGXA 3I58A 5ALYA 2RAEA 3NKLA 1ZBDA 2AVNA 3A9RA 2X1EA 3HPQA 2VUHB 1J56A 1B00A 1JGSA 3JRXA 1G3QA 4XLNF 2EW2A 4LPSA 4HVAA 2Y9MB 3EDMA 3NT5A 1EBUA 2WE8A 1R88A 2HSZA 4G1BA 2Y99A 1R5OA 1DO8A 2O2CA 2EQ5A 1UDWA 2RCNA 5EKXA 3ISPA 4HFMA 2JEOA 1RWWA 2DPLA 4CF6A 3H92A 1Z3CA 3LO5A 1FA9A 1YK1A 3OESA 4PXSA 1PBTA 4IWYA 1G291 2X40A 3EZ2A 5BQ5A 4BNKA 1DHRA 3LDAA 2LR8A 2L7ZA 3QYPA 4KMMA 4NC6A 4EZEA 5HUJA 2G5GX 5ILUA 5TX7A 5TGZA 3ZLJA 2FN3A 4AS3A 4BRWA 5ECWA 1SXIA 3LWFA 4F0JA 1NG7A 4B8ZA 3STTA 2C2MA 4N9IA 2A07F 2R8ZA 5I4CA 1P4GA 2YXDA 3KZ1E 3V8LA 4XCQA 4L5AA 2X14A 3VM6A 3WL6A 1YQQA 2CYAA 3CLQA 5JD4A 1V9CA 5KQPA 4ZT2A 6REQA 3JW4A 3INRA 4G65A 2A4MA 2EL7A 4RMJA 1CUXA 2VPRA 2YSRA 2GD2A 2W6OA 3GTQJ 4JJIA 3BIJA 5C3EJ 4YIRX 1WG8A 2FK8A 4PZPA 5TT1A 2Y9ZA 1JQLB 4DQUA 2OP0A 4H1VA 1MNQA 5WRFA 4O6VA 2A5GA 5C37A 4EGAA 1BOBA 3BXZA 2JGNA 3QVMA 3PKJA 4L75A 3W06A 2HYFA 5EGSA 5DXJA 4OLBA 4OGLA 2E1MC 5EC8A 1EJ9A 2MSYA 1R16A 3HM5A 3ZH9B 1I4TD 3DDCA 3PIDA 3DT9A 5DI3A 2XD9A 2YJTD 2VRWA 4ZTFA 2XCQA 2DPXA 2ZYSA 4IKPA 1NF2A 4K9LA 5IDYA 1V5FA 5CJ2A 5G3ZA 2VPXA 3K4PA 2DXIA 4YT8A 3U49A 1R5BA 1FUIA 2VZEA 4Y18A 1STZA 1S8NA 4A36A 1KRXA 4RY9A 2XKOA 4RDCA 1EWRA 4JEUA 4JOBA 4C05A 4FGJA 3NNSA 1ETKA 2VHEA 3CFYA 3INYA 3DE0X 5DMXA 1IOZA 3UK1A 1UWVA 4EJSB 1XR3A 2A9JA 2JHAA 1MMFB 2XKKA 1GG9A 4A3LJ 1AKEA 3LW7A 3LHDA 1VBKA 4F52A 2NS0A 3IHKA 1BE1A 2A0FA 4G5YA 2HQNA 3BN3A 4IDHA 2XYQA 1FLIA 3NGMA 1AX9A 1CY7A 1G8JA 1T5SA 3EDQA 3LSRA 3N0WA 4J16A 1R5GA 3ZMSA 1NAIA 2AFHE 3LBFA 3F49S 1O87A 3DBRA 2AEMA 3E27A 3QX3A 3PUKA 3EC7A 4FPXA 2ZR7A 1E64A 4A3GJ 3NHJA 5DV9A 5C1PA 2A9QA 4WZ6A 1WKMA 2KIQA 3AWIA 4LQLA 4ZTBA 1ESDA 1I9CA 3L0OA 3WU1B 2MOKA 2O8NA 4MPRA 5A05A 1RLOA 1MD0A 2XMGA 4J4TA 1KYTA 4Q82A 4H3VA 2AKEA 4B4WA 2O48X 2JAOA 3F72A 2QU8A 1JB1A 2C78A 4H31A 5CX4A 6CHYA 5I3ZA 1QGOA 4C7XA 1UOEA 1O96B 1XFDA 2BFNA 3NYIA 3E3LA 2J3QA 4Y98A 4P6VF 5DH9A 2K7FA 3NC4A 3X1DA 3H9GA 1UJ2A 1RUOA 3RVJA 4OQZA 2BCJQ 3VGPA 5FJJA 1R27A 5AICA 2GN2A 1ZNYA 1E3QA 2G7ZA 1ZCFA 4G63A 5B36A 2CQQA 4I76A 3L0YA 2AFVA 4X85A 3OQMA 4EG6A 2XGOA 2G70A 4PEVA 2Z2KA 4KH0A 4A8JC 4YCSA 3HGMA 4ECEA 4PHFA 2C57A 2DMQA 1ENHA 3QY9A 4RAYA 4C4YA 3IRVA 1E9VA 3I5MA 5EE5B 2WI8A 1KRHA 3OFKA 5H6QA 2UUAB 2MLKA 1T2AA 5JAUA 2EZIA 5GV8A 1W1WA 1HNZB 2IH2A 5IVPA 4BY1J 1QKKA 4MAFA 2K85A 3BKWA 3HRTA 4D7NA 4XMYA 4IIHA 5FA5A 4ON0A 1LK5A 1ERDA 2XCTB 4QULA 1EV7A 4X6UA 3WWPA 5CCEA 3ZLBA 4BVEA 3IP4B 1PUEE 4G7HF 5M5WJ 1YB6A 2DN0A 2AB0A 2J9ZB 2IGMA 4FMCB 4JXJA 1GGMA 3TQRA 5AD1A 2D00A 4GIBA 4EGZA 3E6DA 1KA9H 3RI4A 4F96A 4JX4A 3PX7A 1WP9A 1L3CA 3LSGA 4C4XA 3Q2KA 4YN3A 1VPWA 1WDWB 1Z29A 3X1XA 3B12A 1IK6A 4L16A 4PG8A 3LLSA 2GN1A 3OPYI 4E03A 4GZ3A 4FIDA 1E77A 2R0QC 1QG0A 2GEBA 5CXXA 4RZSA 2P4EA 1FJHA 4C7OA 4UBOA 3G02A 1XO1A 2WVHA 3CUVA 3A1NA 4J43A 3GZNA 5HMMA 3LP5A 3DAFA 1E2NA 2O57A 3IMEA 1YFHA 1UAYA 3S1LA 4CQNA 3V7NA 2DA5A 3F23A 2HO4A 2EIKH 3OHSX 3R76A 1WDKA 2NIPA 3RUIA 2YS6A 3UJNA 1YS7A 3IVXA 3RYCB 1HTBA 5GJCA 2H7VA 5ENVA 3ECHA 3PNOA 2PMEA 4YJ3A 1TCBA 1MBKA 3OZUA 2EWMA 4FMCF 5L40A 4ZYLA 4J2HA 1W1IA 1J49A 2A5YB 5AHOA 3CUKA 1TO2E 5G4LA 2P5KA 3CTMA 2AUTA 4FI3F 5IN5A 3ZY2A 1FDIA 4RPIA 1BM9A 2FMUA 4IXWA 4HLXA 1GUFA 2FX5A 3L6RA 2P62A 3K6SB 1NONA 3P7MA 5FTKA 3O4JA 5DSTA 1LW7A 1PWZA 4OJMX 3DVAB 2QTMA 3CURA 5EG0B 1IC6A 4H3SA 2CJFA 1TKAA 4IY1A 2D3TA 1P91A 4GQBA 3H3FA 1QHGA 2FBIA 1TNTA 1H9BA 1Z7GA 4UUVA 2ZRPA 4IICA 4WW0A 4TS3A 1IO2A 2P91A 2N3ZA 2L17A 4FHGA 1U0LA 3WNBA 1T6BY 1YQEA 1P75A 4KE7A 4W6QA 2G1UA 2O8KA 2J32A 3ZBQA 3EGXA 5ENZA 2C2ZA 3A6HA 3R09A 3UTDA 5CNKA 2P4SA 3S1AB 3OZGA 4CA0A 3JR7A 5JASA 2H4HA 2WOJA 1CNEA 1UXGA 3D6VA 5EY5B 2D4AA 1JLMA 1WXFA 1P4AA 1U8FO 1T3TA 3BE4A 4QGHA 4P86A 3TXXA 4JJEA 2C0CA 4QXAA 4M71A 2MT9A 3P9XA 1G8YA 1U2RA 3ERED 2DUJA 4TMWA 3THWA 3EPLA 5EE0A 1G9SA 1E3LA 3DP7A 1J7JA 2AW3A 4JHLA 2ZRJA 2QX8A 4J1TC 1T2FA 5L7WA 3ZQKA 2R7VA 2WIKA 3CCRI 4RQUA 3DCFA 4QREA 1OFUX 3Q9SA 4N4NB 2XB9A 2FPSA 1N77A 4IPAA 4F2WA 2WVGA 1KMMA 4LJ5A 1I6KA 5B53A 2LW7A 1SNYA 4X6AJ 1NVDA 3J81Z 3WLOA 2OY0A 5LIRA 5J1RA 2WYWA 3G0BA 4J1SA 3HXOA 3LDUA 2HLHA 2IUUA 1O08A 3H17A 2QAIA 3OLCX 1TQIA 4C20A 4L72A 4NRDA 3WK6A 4X7PA 1OXSC 3FBWA 2PZ8A 4L9SA 4PYOA 1OHHD 1N4AA 4WX2B 4QATA 1F8UA 5CCDA 1ZH4A 1KJ9A 3L7BA 3H0DA 1ZO8A 2F48A 2CLCX 5FFNA 3AH8A 4NB5A 2M7BA 1XN1A 5H0IA 3IALA 2RI6A 4XICA 4R3UC 1RR6A 4MCAA 3NWJA 4MMZB 5CT4A 4URXR 4C06A 1A9RA 3R4CA 1F9NA 5ELXA 4A9AA 1XSDA 5DFAA 3HTUA 4DCVA 5IK2A 5HBGA 1I7NA 3INTA 4PSWA 2J33A 3CUWA 2IBSA 1U2PA 3MRSA 3KKNA 3CYFA 4RPKA 4PPYA 1ZARA 3PUXA 2ZRFA 2Y1CA 1CF7B 1PP7U 1IV8A 4I9FA 1V4VA 2OSBA 2FUNB 2BFFB 2DMRA 1KARA 4X0EA 3OUTA 4RV9A 1J21A 2X1HA 4I1VA 1MNEA 1O4VA 4ROTA 3W05A 2BW3A 4R8MA 1JTXA 1ETWA 4OOFA 1VZ2A 4OXQA 5LQUA 3IQEA 4M0DA 4BUPA 4LF4B 4QBIA 4UQPA 2G9RA 4GDFA 2VBIA 3EMBA 4ND7A 3GG9A 1V48A 4RTKA 1N3YA 1I2ZA 2QQ0A 1P8JA 3ET5A 1GARA 1G2PA 3KVRA 2QAJA 2PL3A 4ARVA 5KYUB 1XL1A 3KCQA 4ISCA 2CD7A 2HJHA 1NN3A 3O38A 2YNMA 3B1FA 4K6KA 3UUGA 5CLFA 2HDDA 4IJWA 4EA8A 2QRVA 2X4LA 1JA0A 4CIAA 1M1ZA 1WCXA 2HCRA 2WLTA 1VE3A 5K6AC 5FPTA 2CEAA 4M6WB 1P7CA 4UEWA 4TMFA 3CRRA 3RREA 3EUHA 3CXUA 5IBPA 1F0YA 3WLFA 5FCDA 4AMZA 4EG8A 2R8OA 3K5WA 3TRHA 4RL6A 2FQQA 3QVXA 2JZYA 2E37A 2V6GA 4INJA 3O8QA 2JA2A 4B1RA 4KBGA 1U5TB 2IX3A 2TSYB 4BU2A 1U94A 1UXKA 2R1UA 1QRSA 2IYSA 3TLEA 2W6ZA 3N0XA 5FX2A 4GT1A 1NZDA 1GCIA 1C9JA 1JS1X 1RUNA 1JVNA 3IIKA 3TJMA 2QL5A 4MI6A 3WRYC 2RHMA 3ZJ4A 5T41A 3PKIA 1QR6A 1HDPA 2BHSA 1T35A 4TZ6A 1N2EA 3GFQA 3JRIA 1HR0B 2A6HF 3FHJA 1QF9A 4K0RA 4AMGA 2GB4A 3T0FA 4NLLA 3ZN0A 2Q0QA 5K3SA 2JLYA 3UXMA 3N86A 3MPUA 1K5PA 1CW2B 1GRRA 3G9UA 2YV1A 2VYVA 2MJLA 3KUDA 2JI8A 4F12A 1MX5A 2XCIA 5FWAA 2KSQA 4YMWA 1H2XA 1QQBA 2M4KA 3CINA 2OFWA 3OJCA 5BN5A 1PFUA 4JKYA 1B59A 4DEVA 3K6RA 3HRUA 1EHIA 3D2LA 4LVUA 4ZAWA 3IQGX 2X6RA 3N5KA 4OIRF 3TH5A 3WHBA 1YZLA 4YO8A 1TNSA 4CL3A 4LRQA 2BFPA 1B15A 5K8IA 5A3JA 3HUUA 2J6HA 2GN8A 2RHOA 1SXJB 1BVYF 4IOAF 3WU2C 5B3SH 3ZK9A 1VSTA 4MQVA 1ADYA 5JAQA 1U4OA 2R47A 1T6XA 2EQRA 3P96A 3G82C 2FSFA 1QHXA 2YQZA 1OI3A 3IEKA 3H84A 3HXPA 3DDWA 4FS3A 3A0BC 2JAUA 3RYIB 1EDBA 2IBDA 1X94A 1Z33A 3JD3A 1W6UA 1RAHA 2B8WA 3GUHA 1U3CA 2VP3A 3OIDA 2QN9A 2GCEA 3SSMA 3L7IA 1F17A 1D6NA 3H9JA 1MLDA 3MPOA 4WCDA 3ZQHA 1JW9B 4QTTB 1AHDP 4JL8A 3LNQA 2MSKA 4YYEA 3EIEA 5J5VA 1XCVA 1FOEB 1FL9A 4PAWA 2YIDA 4BDSA 2CMDA 3DFZA 1VQKI 1T9BA 8AT1A 3EZLA 2QRKA 3U7EB 2P0EA 1Y7HA 1HKQA 4YREA 2MYUA 2ME6A 4GL4A 1TTYA 2PUWA 3PHCA 4W5OA 3QYEA 2IYXA 4AZ0A 4FYJA 4KRGA 1G1AA 1TM3E 1QGPA 3MOSA 2VSXA 5KDDA 2GTPA 2YVAA 3S32A 4PPNA 4WKNA 4GSKA 5AKEA 3VZPA 2Y4OA 3IP6A 4LJAA 3KS9A 3X1MA 2CNDA 2PRJA 1Q7TA 2ZITA 1PV2A 1OLXA 2EKDA 5EIHA 1KH3A 2B8NA 1SC6A 1EXMA 5HMLA 3BSWA 2GQQA 2PG4A 2I91A 3ZNPA 2ROQA 2GMWA 2RVCA 4BL0B 2XPCA 4K9QA 4TV8A 5TISC 1U0HC 3L7YA 1DGQA 3M5DA 5IYDJ 5HUHA 1QR2A 2C7BA 2FX2A 4J0HA 4RA6B 1Q3KA 1NBME 2C84A 3L1IA 4XUCA 4RDIA 3TM4A 1F2TB 1AE1A 2XQKA 2CUEA 3G59A 1ZBQA 2YZMA 5GV7A 3ZG6A 4KTTE 3H0CA 1FBTA 2B94A 2GBFA 5DRTA 4YJ2A 3HGQA 4IF6A 5BUQA 3DLPX 1MW8X 2ZSBA 5BUCA 4MVJG 2Q99A 1Y8AA 2GNOA 2PX9A 1UBCA 2OLJA 4N12A 3C8UA 1XK6A 2QUBA 5HA5A 4H3HB 3IJRA 4URHA 1IC8A 1Z6AA 4TXJA 2GD1O 1MXFA 1G6NA 1GY8A 1JH8A 3UHAA 5BV2P 1Q19A 2ATIA 2XVZA 4WNAA 3B8HA 3W8NA 1FJGB 1A7AA 2H2GA 4UUTA 4L50A 4AN4A 5IVKA 4JVLA 4JT9A 2I9PA 4MS3A 1SUAA 4E11A 1CE8A 3K2BA 3L3BA 4KR0A 1GUZA 2FPUA 2Z9BA 1LRLA 4NHEA 3WK8A 4U8HA 1ID8A 1FPQA 3I9V6 3QXCA 1VYHA 2EDAA 4II7A 2O8EB 4XAQA 5JYEA 4XB6B 4DDWA 4KLZA 4WCVA 2Q5CA 2VL7A 4EUSA 5T4HA 3VA7A 3PQ4A 5GTHC 3RVKA 1DCKA 3OAAD 1IXZA 2ZJ4A 1MSEC 1NPTO 1KZ6A 2K2QB 1E2HA 2CCGA 4WXEA 2L9SA 4CICA 2BMFA 1S3IA 3EYYA 3CLKA 3SQXA 4KQEA 3H5RA 2C5FA 4UUAA 3DMTC 3FPCA 4ZAXA 4YRJA 2GXGA 3Q3GE 5FI1B 1DCFA 2BI8A 2FPPB 3GFOA 1Y6IA 1PO7A 2CBGA 3KVNA 4DCCA 2N1MA 3EZ7A 3AP2A 4IMIB 3TOXA 3C6QA 3FDYA 5FBHA 2VHCA 2Q5IA 3FIWA 3S7ZA 2Y67A 3S0JA 4OKIA 4JYAB 2DSNA 3OWTA 4MINA 1MO6A 1LPMA 2KJQA 5IEBA 4ZOLB 4JI8B 1IXSB 2Q9BA 1DDOA 4EUKA 1TMYA 2WTEA 2UYQA 4OAZA 4A03A 1YX5A 2DHCA 2OCPA 3WYGA 5B2FA 2EFPA 3WP0A 2BF4A 3GTMJ 4HF1A 3JVUA 4C4OA 1JHYA 2KRHA 2CBXA 5D6FA 1FTNA 3H8VA 1TZKA 2HU8A 3IAM6 3TP3A 1ZOLA 4IS3A 4D7AA 2VHQA 5DGDA 3DKWA 3OQNA 1LK0A 5HPYB 4K2AA 4PC1A 5D51S 3KKKA 2XAGA 1QHIA 4HJXA 2NVWA 2R65A 4V39A 1G21B 1L5MA 1J0XO 4QIWN 4W7IA 4MYDA 4EA9A 3HVJA 2PX8A 5ED0A 1WBBA 4X7MA 3S15J 1W5BA 4P0QB 4GC9A 4K0KB 1SK8A 3KEOA 1CSEE 4J0IA 1FXWF 3IIJA 2NSJA 4ZOLF 4FK8A 1Z77A 3ANMA 5CVUA 1LTHR 1K89A 3UW3A 4RBOA 1Z8NA 1YLFA 3KZMA 4DXAA 1SUWA 1OREA 3X2FA 2RH9B 3NOOA 2W2KB 3LY7A 4HT3B 1BN6A 3UWKA 3WFIA 3HJEA 2WNHA 2JIQA 5ALSA 3MYRA 3F8WA 5EXXA 5I4IA 4EY4A 1TUIA 1EH6A 3D1NI 4KQHA 2QP3A 1II0A 2R4QA 3F6SA 1I3LA 4I66A 4KN6A 2YCLA 1KQGA 3O94A 2GX6A 4R0MA 3FZGA 3N2KB 3W8DA 2XRNA 1QC5A 1SCUB 1NMZA 1EMDA 4EG4A 3L5KA 2WT4A 1QIHA 1BDJA 1HORA 3O0DA 2CWWA 3A4TA 3COSA 3H42B 1CCWA 4PJLA 4KK4A 1P6XA 4KYVA 1RHUA 3JSXA 4TWJA 1FOWA 3I3OA 2JUCA 4UZEA 1SZJG 1SIBE 1LSSA 4P5DA 7AT1A 2GCPA 3BILA 3FX3A 1MJGA 3VTKA 5FD6A 2LV8A 2W2XA 3KE9A 1N7GA 4RMGA 3WJ2A 1C3EA 3LKBA 1RYNA 1IEQA 3GD5A 4X7RA 1LJ8A 2Z4RA 3CLSD 4G1FA 3UG7A 3I4FA 4WV3A 2RQPA 1QV7A 1U2GC 5SZJA 4KQ1A 2VJPA 4YCMA 3LSKA 3WQSB 4PFOA 4BJ5A 1FWZA 3JYHA 1W4CA 3AHGA 3WVNA 1GDHA 1R4AA 4M0UA 3S28A 2P4WA 3TG2A 3IV7A 2EATA 4F8JA 2Q8PA 4Q1CA 3MS7A 1LF5A 1KORA 2M3AA 4BRZA 1XTJA 4V0ME 2HRCA 2AE1A 5BWLA 3O73A 3WL8A 2HADA 2DPHA 3EF0A 1N5IA 2HA2A 3AR3A 1A4UA 3GXOA 5HTKA 2E6KA 3B3AA 3FTEA 3MFQA 2HPAA 2IOFA 4P2GA 1OBFO 1Y89A 1DWPA 3A1TA 2Q1SA 2E4VA 4AMUA 2VDNB 3KYIB 1YAHA 3H9CA 3NQ41 1I6WA 1P1HA 3P2EA 5L4SA 1GSIA 2XSZA 3Q0VA 3ZZTA 1DXOA 1A9ZA 3WNQA 1YKFA 3AJAA 4ES6A 3C3AA 4R1MA 1U8AA 2ZI4A 3IO3A 4AIDA 4F71A 4YCNA 3UFBA 3DXYA 1ZSVA 3N6VA 2WVJA 2D7DA 2CZQA 1CRZA 4F9EA 1AK1A 3DMGA 1W5TA 4C88A 1KFKB 1RXVA 2NT3A 2FN7A 4FCVA 1QRTA 3E7PA 3ROUA 3FWNA 4Q1EA 2ZETA 1OI4A 2XYVA 3EQZA 3RYFB 4NXNB 5SY4A 2JS7A 3LC2O 1N1GA 2HQAA 3W1EA 3KHKA 1N6NA 2PO5A 3ABSB 2HKOA 2IIVA 1BG6A 4FONA 5KVAA 3ETJA 1HC8A 1YVDA 5BPHA 3RFCA 1DU0A 1XNRB 3H9BA 3AG4H 3KTAA 3AY6A 1TRHA 4XARA 1C4XA 2JMWA 2JJMA 3PL1A 4X41A 4JXKA 4BGVA 1SD1A 8LDHA 4YP7A 2VTVA 1IVNA 5DTDA 4C0JA 2FD5A 1SUDA 1G1MA 2D7CA 1S5LC 2P67A 5BOSA 3QLUC 2A6TA 2ID6A 1BVUA 2DT8A 4JZKA 1AT1A 3DLHA 2MA3A 1J5YA 1FFGA 4J4BA 4N9QA 3BD7A 2XE7A 4RM3A 1TA9A 4B5KA 5DTJA 1VRVA 3GFBA 3EFEA 3GD7A 3RV4A 1QH1A 1MIOB 1K2VN 5KC9A 2BEWA 2VK4A 3O75A 4XWGA 4C5AA 5A2GA 3RJMA 1VZ3A 2Y8EA 2BSXA 2HT1A 4RTQA 1N2BA 3L1UA 4BVBA 4N49A 4DCUA 2WKPA 1VG0B 4ASUA 3PL8A 2FVXA 2QJFA 2H2HA 5H16A 3OWXA 1GTZA 4ENNA 2CCJA 4NMMA 2RG1A 3VX4A 1T9AA 1EFLA 5ARCA 1JR3A 5CM8B 4BLOA 3AF4A 3KIPA 2A2ZA 1W87A 1GG8A 3W6VA 4MGYR 3AOGA 2QL6A 4IH1A 5F5LA 1POXA 3I6BA 1J2RA 3DT8A 3D02A 2LDBA 5F0CA 1PEDA 1XHEA 2YWDA 4MRNA 1M1UA 3VHQA 1BS9A 1JFSA 1HLGA 4Q4DA 4RGBA 5JANA 2Z9DA 4CIWA 5JNRA 3WG9A 1W0JA 4NK4A 4OP3A 4C7JA 1JHDA 2Q6IA 4ENVA 2XWQA 4FXPA 1U65A 3QIVA 2YUSA 5FRDA 2P3LA 2F4NA 1YDEA 1LFUP 2G3YA 4M88A 3TMAA 4EELA 2FE3A 2ZXHA 2FOXA 3S5JA 4OIOF 2MR5A 3TSZA 5JDCC 1TO6A 2PTHA 1SEVA 4ZCIA 4KLNA 2DF8A 4XIDA 1GGFA 3PFKA 1E1YA 2MSCB 3R61A 4TZKA 1SUFA 1WTCA 3HUDA 1TKRA 3CHYA 5J43A 2VR1A 5FLXZ 3LX6A 1PVDA 5AK3A 4BV8A 1ZH0A 4YJFB 5DEIA 2BFBA 2BTOA 2NGRA 2DYSH 1H3NA 3F9CA 3PUJA 3ZBTA 3B38A 4I4IA 2Z5FA 5IRCD 2QT0A 3AR8A 2W2PA 2GSDA 2KDOA 3CX8A 5E3MA 2NV0A 3R5HA 5EPUA 5GAGJ 2D13A 1MOPA 3LLCA 3SXJA 3L1KA 4D9HA 2NTNA 2FCAA 2YYYA 1QNFA 2IT1A 3NASA 3KUUA 2ON6A 5K5QA 4ZYTA 3IUJA 1GZHB 1UFMA 3LKDA 1IMOA 4JQYA 4W5WA 2GD0A 2JLZA 1P29A 2L4MA 4RMIA 1DVRA 3NJRA 2R5ZA 5BT8A 5C34B 3FFBA 5BQ3A 3ZVKA 1EFCA 2DM6A 3FOBA 1IJWC 1VMDA 2OL4A 2PD6A 4RSMA 1L5QA 5ES3A 1TZBA 1FS4A 4QRDA 1D4ZA 1B9NA 5AVVA 3RUEA 3LLMA 2NV2B 5AI9A 3STVA 3VYSB 2QY9A 3L8GA 4BE4A 3TE6A 3FHLA 5I4KA 4HTFB 3PQDA 2FE1A 2ZYHA 4D57A 1OFVA 4D9JA 4Z4FA 4W5HA 2KZVA 1SK9A 4BB6A 1KY4A 3RT9A 2ZIXA 1KEKA 4U0KA 2IUYA 4KVGA 4ZXFA 2HMYB 1PS0A 1Z5UA 3B9BA 3VR6A 2O8XA 4TTAA 5EJ6A 2XODA 5AI6A 3EGIA 4GYYA 1N6RA 2YH2A 1RR8C 3VKHA 2IXSA 3WGHA 4HGZA 4UNPA 4BX0A 4ZYZA 4GO1A 2KB0A 3Q3SA 5A7FA 4L57A 3U2RA 4WASA 2JFHA 5DX0A 3OIUA 1AKYA 4EGCB 2OFXA 4ND6A 3K9BA 4OD0A 5ADWA 5J4HA 2CG4A 2ZJBA 2P3OA 4GMGA 2XE8A 1BHJA 2G1AA 1Q6ZA 3M7IA 3NHLA 2HF9A 4IXAA 1OMOA 4AX8A 3RQSA 2BVLA 4U0JA 4BNFA 2MMCA 4MKRA 2NYRA 1AS3A 3DCNA 3I04A 4MS4B 1Z0KA 1UK8A 2C2WA 1RACA 1WCMJ 1GG5A 4AJPA 2QG4A 4QPQA 3O2JA 5AK5A 4EG5A 5JXIA 1OR7A 3BRQA 3QMWA 4JOCA 3DL7A 4NWIA 2O61A 2M30A 3OT1A 4NBRA 4B3DA 1WQ1R 2O06A 1OW3B 1L1RA 3W6PA 4DR3B 1K27A 4FXOA 3L18A 3M9LA 4D26A 5BSWA 4LY9A 3T3HA 1KK1A 2LE0A 1I3QJ 3WFJA 2XRYA 5IZCC 2AOTA 3MZ0A 4RQAA 4N39A 5FR1A 1GPWB 3B6MA 4GYJA 3IEVA 5TMBA 4R5HA 5LGUA 2HA4A 4I50A 1X1AA 5KQRA 4WK2B 3LG2A 5G4KA 5EIAA 3PFFA 1ML3A 4RPJA 3K92A 4DE5A 2KQRA 4WXMA 1A7JA 1HRDA 3IAS1 3MINB 1Z37A 4NZMA 3MKZA 2XVCA 1V4NA 5HKKD 3G3ZA 2ANCA 2C59A 4XPIA 3D0QA 3WFZA 2QROA 4RZUA 3JALB 2AOVA 1MKYA 5FO5A 4OQMA 1DXQA 3BMXA 3E5XA 1FMFA 4UHHA 3CD6I 4YAJA 3HYIA 4BE9A 4REOA 2IGOA 1QF6A 3ENNA 1R71A 2HCBA 4MVJA 2OYRA 1ULHA 3RWOA 2NG1A 1ITYA 4XJVA 2HZTA 3PUIA 2CW8A 1K5HA 1XRMA 3TLAA 3HFRA 1X1PA 3AFMA 3OFND 4FTHA 2O1EA 4Q4JB 2C2GA 4QVKA 2IHJA 2NO0A 2QYSA 4DIKA 5T67A 4PO1A 4HRVA 2P2GA 3N58A 4WINA 3CW8X 4NMWA 1ULYA 1R12A 1W0KD 4L0CA 3RRFA 2PXCA 4KTVE 4I36A 4RORA 3ZCPA 2H6BA 2PUAA 5DYMA 1CUBA 5CLJA 1D6MA 2RHBA 3L8MA 2Y0PA 2OD9A 4O3FA 2DYRH 2AEFA 1Q1AA 4D99A 3PE3A 1R4NA 3CMMA 1ZOOA 2E4ZA 4J03A 3CKYA 4F46A 2I1QA 4G81A 3REGA 2ZPTX 1DQRA 2WBMA 3ORSA 1HYQA 4ZVLA 1B0UA 5KU1A 1OBVA 1Z18A 1Q95A 3I9FA 3WWDA 4FNOA 5FPYA 4QBGB 1D1TA 2HA7A 4PGMA 1IY1A 1MG5A 2BBWA 3A01A 5DNAA 3IOMA 1PYDA 1DAOA 1C81A 1EFPB 1Z9BA 2DFLA 1DMRA 3LRXA 4AI6A 3BY6A 1EUDA 5GJWC 2B1GA 3WQQA 2JEZA 1APBA 2O5RA 2PUEA 5A06A 8GPBA 4JL6A 3C7AA 2OGUA 4Z3DA 2IY9A 4DJAA 1AHHA 2R7DA 4U5XA 1VA5A 4ZHSA 2XGCA 3ISTA 5KO2A 3P4UA 1T2KA 2EP5A 4A2WA 1UBSB 5KKCA 4FE7A 1AV7A 4ARIA 3ZR4B 1TOAA 1L5ZA 3SEFA 1RLUA 4CKEA 1UMCA 2OWEA 4HQRA 5GONB 5TY0A 3IC5A 4AL4A 3AC0A 2RGVA 2IF0A 1W88B 1ZUNB 3DOHA 2BELA 2GBLC 4B33A 4W1RA 1G7TA 2HLNA