1XDSA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) and 11-deoxy-beta-rhodomycin (dbra)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
336
Chain Sequence
b'LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGERPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDDAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RdmB
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
total genus 101
structure length 336
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xdsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xdsA03
4KICA 4HTFB 5EMJA 4QDJA 5D5XB 3KP3A 3KEQA 1U5TB 2YX4A 4KIFA 1JHFA 1E17A 2FSWA 4BY9E 2QBYA 2HTJA 3UBTA 2P7IA 2QZ8A 5DXAA 3WTUC 1SUIA 5J8CA 3I53A 3G8AA 1RZ4A 3OZSA 4RTSA 5JFRA 2IA1A 2I9KA 5EEHA 4TV7A 3B3JA 2OQRA 3O3KA 2WTEA 1Z05A 4F7ZA 1B6AA 4OMZA 1G55A 2HQNA 2R7FA 4GEKA 1HKQA 2LDUA 1D2CA 1MJBA 1X19A 1EAMA 3CJQA 5BS6A 4XRFA 3ABTA 3E6DA 3HCDA 5IKMA 2ESHA 4HV6A 2ZBQA 4RB3C 3NDIA 3QOWA 2G1PA 5LEKA 2IA0A 1R74A 2QM3A 3T8TA 4V0QA 1JHHA 1UWVA 3HA5A 2YX7A 5P8WA 3HRMA 4KUMA 2ZZMA 1NW7A 1S7OA 4HRAA 2A69F 3T0IA 3T8RA 1M6YA 5L3CA 2VP3A 2LNBA 3KU1A 1D8JA 3ZMSA 3J80K 1X1BA 3JSPA 3IRQA 5LRRA 2P40A 3R6TA 3Q5FA 2FCAA 1O9HA 4AWXB 4EKIA 1YG2A 3F8BA 4CYDA 3M70A 4OQDA 3KPYA 3G3ZA 2PXAA 4B09A 1XCVA 2O61A 1UHWA 4L9TA 3AXSA 3HA3A 2VE9A 2GLUA 4K2EA 3IKTA 5HFJA 3DPTA 2HZTA 3C7JA 1FBUA 1HQCA 1WI9A 3KE2A 3TOSA 3T1BA 2CG4A 3DH0A 5DT2A 2B3TA 2OA4A 4L18B 2OZUA 4MTEA 4LLGF 3R0QA 1G3TA 2P4WA 5K8VA 1USSA 2PQ8A 2QLZA 2FNAA 2FBIA 4JBAA 4U0YA 4CXMA 3EEOA 1XDSA 1B59A 4WXCA 3DV8A 1IN7A 4ESFA 2ZSUA 1YFLA 2QQBA 4YIFA 2HTEA 2FF4A 4KNYA 1IUYA 2UWMA 4RGUA 4G7OF 2ONYA 4UXNA 1JR4A 1CF7B 2KIUA 2VBZA 3H92A 3M7GA 2DK8A 1X1DA 2L54A 1BIAA 5H6QA 2UYOA 2V6CA 3ELWA 4QPPA 2NNWB 2HYFA 5HVQC 4IKPA 3GF2A 3OZTA 2CFXA 3WE3A 5GM1A 3I58A 4M38A 2BZGA 3D5LA 5FULA 2B0LA 2UYHA 5GIPE 3CO7C 3RKWA 2E1NA 3B3GA 2LKPA 5E9WA 3F8CA 4Y2HA 1FYMA 5DUKA 3RTRA 2NP7A 4FR0A 1J75A 3MHTA 3PTAA 5FA8A 2PJDA 3W6JB 2IH5A 1S6LA 1PRYA 1JE8A 1ZLJA 3LBYA 4GGGA 4YV0A 4M6YA 1JG2A 4HTFA 2PWYA 3TPZA 3GXOA 1TQIA 2ZJ2A 2PKWA 1U5TA 2EFNA 1VIDA 3FTFA 3V8LA 3F8MA 3LBFA 4OMYA 4RVDA 1TW2A 3NRVA 3KQWA 3P97A 1GXQA 2MBFA 3KZYA 2WK1A 3EGIA 2G71A 3DXZA 5LHIA 2ZBKA 5HIJA 4GYIA 5EKUA 1QGPA 1HNNA 1IN6A 5D8KB 3DPLC 2OB2A 2XBMA 2PVCA 2XV4S 5DTMA 4R6XA 4DNCA 2IW5A 2RNJA 1ZGAA 3T0YA 3DMGA 1KYWA 1R58A 4EV0A 3FRHA 5HZMA 1FNNA 4C4AA 3HEMA 4C06A 5DSTA 2Z6QA 2VC0A 4LECA 2MD5A 3RW9A 3A7EA 1N7IA 5DCFA 1TNTA 4HH4A 1QAOA 3FZGA 1LEBA 2H1RA 3SX0A 3MAJA 1QANA 2A3SA 3ZPLA 2H09A 3KFWX 5L3DA 1KQ0A 5EGSA 4ATNA 5BW5A 3ULQB 3SXYA 1O54A 4BLVA 5K0GA 1UFKA 2QENA 1LJ9A 3F4KA 1R5HA 1YYVA 3MFKA 4IV8A 4RTPA 3UJ9A 2IP2A 4PDKA 2RN7A 1P91A 4CKCA 5E1MA 1L3IA 2JZYA 3WE2A 1J2XA 5HIIA 1TQPA 4E31A 1YS6A 1R18A 3CUOA 2WC2A 1EQAA 2L4MA 3NDJA 2R3SA 3F3XA 3VYWA 2OB1A 4RTOA 3S2WA 3ELUA 1RI2A 4ETSA 1INLA 4LJZF 1IXSB 1EH7A 2XUBA 4ENNA 1SG9A 1HMYA 4KDRA 2GA2A 1LQ1A 4KFCA 2BBYA 3V8VA 5L3BA 3GRZA 3G2QA 1CF7A 3NWEA 3OFKA 4O5VA 3WTVC 4OU0A 2XASA 1P6RA 1U78A 4D0PA 3KPWA 2I62A 1U2ZA 5BPIA 4G94A 3SMQA 2O0LA 4HG2A 3LWFA 2AZTA 5C0OE 1WZNA 2YXLA 5F2OA 5CYVA 3ZP5A 5T64A 1D3YA 2CQKA 2TDXA 2PG4A 5AIQA 3LKZA 3PFHA 3M6XA 3X0DA 5LQUA 5CJ9A 1HSTA 3TKYA 3FXQA 5L3FA 3BWGA 2O03A 2Q2EA 3HSRA 4FX0A 3FPJA 3T7SA 4KRGA 1IRGA 4G6DA 4PYKA 4X60A 3QU3A 1Z6RA 2XVCA 2P6SA 1FYLA 2FBKA 1ORIA 4LG0B 2FHPA 5LQAA 5EPEA 4E33A 3E97A 1QAMA 1V39A 1EG2A 5EEGA 2DBBA 2XKOA 2IGTA 4PYJA 2DO7A 4AZTA 3R61A 3QRFF 2OD5A 3RDIA 5HDNA 1ZREA 4GCVA 1YF3A 1FBNA 4QVKA 5B1SA 1W4MA 2FEZA 1SD5A 2P8JA 5C9ZA 4LLLA 3LA7A 2XVMA 2ZO4A 1JXSA 2RKHA 2XYQA 2XAFA 2VT2A 1BOAA 3G89A 4RTMA 1HW2A 4MEXF 1S3JA 3ELKA 2GXBA 3MGGA 2NNNA 5D6FA 4U7PB 1XTPA 4AZWA 4PZJA 4RTNA 3HCFA 2YU3A 2HEOA 4S04A 2JHAA 3P9CA 2LF8A 3TO9A 2EV0A 1P4XA 3OFJA 3KR2A 3EQLF 2JPCA 4OA5A 1F9NA 2YR0A 4ZZDA 4GXOA 2P7CB 4MEYF 2JG3A 5DRTA 2E7XA 2YR2A 4ON0A 2QQ9A 2O6GE 1M0EA 4POOA 5ICEA 2GQQA 4BHCA 3I9FA 5HS8A 3TKAA 3JTGA 1R5GA 2P3QA 5LBQA 4WXDA 4BYYA 2V1XA 1NBIA 7MHTA 2BM9A 1KHHA 2ZCJA 4GYGA 2YPRA 5LR6A 1WY7A 2ZBRA 4MTDA 1JQEA 1Z9CA 4DA4A 5HIMA 2D45A 2AXLA 1Q0SA 1L3LA 4YUYA 4N0BA 2IFTA 1F1ZA 4M71A 3I71A 4LG1A 1BJAA 4RX1A 5LQKA 3GO5A 5LLQA 5CUQA 4P9FA 2PN6A 5BPDA 1JG1A 2HTSA 4A5NA 3WGIA 1FYKA 2Z9OA 2J5OA 3WTTC 4KMFA 5DTQA 2Y0MA 4YFKF 4EJTA 3G5TA 4GBED 5H02A 4ZYDA 3GCZA 4E2ZA 2ZBPA 3GVAA 4ZYGA 1IF1A 3CTAA 2QQAA 4IRIA 2BV6A 2OAZA 1OKRA 3ANXA 4QVGA 4QLCU 3IHTA 2UZKA 4RYLA 1AOYA 4BLWA 3SFZA 2Y48A 2J5PA 2ERCA 4PNEA 5K0CA 3HOTA 3T7RA 1S8NA 3M33A 5CIYA 1P4AA 4AIKA 1SMTA 2DLLA 3IKVA 4Y13A 3FTDA 1XSDA 1FBQA 3NTVA 5L3GA 2G7HA 3A27A 3H3ZA 3HA7A 1Z3CA 2P8TA 3KPVA 3KR1A 2CWEA 3ZN1A 1I1SA 3IRRA 1FBSA 1NBHA 2A68F 4KW7A 1BHJA 1BC7C 4HDUA 1SQFA 2H94A 3PT9A 3MCZA 3IV6A 4X63A 1DUXC 5KQSA 3O31A 3EUHA 2B25A 1P1CA 4BHBA 3HCAA 3GZ6A 2ELHA 5CVVA 2NYXA 2NP6A 5H20A 1HXDA 3E6MA 3U9GA 3C3YA 3DOUA 3GGDA 4HGZA 2PLWA 4OBXA 4EQQA 2AS0A 3J80Z 2F5DA 4L5JA 4RV9A 3TMAA 4XUEA 2CGPA 2VONA 1IXKA 2XIGA 1NW8A 3F6VA 5EMLA 2EFPA 2F5FA 5KYGA 3R0AA 3BJOA 3GIWA 3NEUA 2JH9A 2ZZKA 2XAHA 3KQQA 4GQBA 2Y1XA 2W84A 1MDMB 2CL5A 4XUDA 1SQGA 3V7CA 3ZMVA 3QP6A 4A6EA 2ZKZA 3CLOA 3G88A 4F86A 2A6EF 4E32A 1KQ8A 3KQOA 5ERGB 2DT5A 3G5LA 8MHTA 5HLGA 4L0ZB 3ZMUA 2PLYA 1VLMA 1OYWA 3UJBA 1D2GA 4UV8A 2H6BA 4B17A 3BZ6A 4KN4X 4XUCA 2PMUA 1NHAA 4L9JA 1Y0UA 4LWPA 2VS1A 3ABUA 4PCLA 2Z99A 2EFWA 4FT4A 3ER9A 1J0RA 1XDUA 3MWMA 2X0LA 2P5VA 2LD4A 5D5UB 1R8XA 3RODA 2K4JA 3Q87B 2Q0OA 5FD5A 3TRKA 3IWZA 3KP7A 2AOUB 5E8JA 1Z7UA 2FE3A 2DPDA 3GDHA 3T7TA 1FPQA 3LFKA 3EVAA 2Y1WA 3C3WA 4O6JA 2K4MA 2GB4A 3FMQA 2WA1A 1YS7A 2PBFA 2MLKA 4KIBA 3IEIA 4EJUA 2ESRA 1KA8A 4XCXA 4P5OA 1OPCA 1RUOA 3KQYA 3CGGA 2ORED 2EG5A 3EEYA 4OX9Y 2FA5A 5DSXA 2PXCA 1RJDA 3RIEA 4ESJA 4F84A 2H6CA 1J9IA 4E2XA 3GFLA 3CO6C 3EGVA 2G8NA 4PYLA 5T67A 4NB5A 4C08A 5DV5A 5MHTA 1XGOA 2HNKA 3B02A 3L7WA 4YUVA 3F72A 3DMHA 1H9TA 4DF3A 2WA2A 2O8XA 4M73A 1HBXG 3D0SA 3R0JA 3PQJA 1FX7A 3PFIA 2PI0A 4HDVA 4ENKA 2VDVE 3BWYA 3LECA 2W24A 3EPPA 3UFBA 4GOMD 1XMKA 2DI3A 2JRTA 1YW7A 1YW8A 5GINE 2JH8A 4GF5A 1OYYA 2AOXA 2L02A 3LAPA 1XVAA 2JHCA 3LGAA 1HKTA 5LEJA 2VOPA 1VP3A 4EQZA 2V7EA 2ZCWA 3JW4A 4U7TB 1OYIA 4AX8A 3I64A 3A7DA 1YUBA 2P7HA 4MQ4A 1O3SA 1EIZA 1SVUA 5EOVA 1Z1DA 1BM9A 5KVAA 1O3TA 4YG2F 4BQAA 4GUAA 3WTWC 1SFUA 2HR3A 3KPJA 2HWKA 1ODDA 2FYTA 4KN7X 4H0NA 1MD0A 1R23A 1YB2A 5DLYA 2EFOA 2KJCA 4IV0A 3MTEA 2NNYA 3HCBA 3NWBA 3GZ5A 4HAMA 3FF5A 3VOEA 2C7RA 3E6BA 3IL2A 5U4XA 4MGRA 5GM2A 4X61A 2HFHA 2COMA 3QV2A 4M9SA 4L0YB 3LCCA 4LWOA 5HS9A 5AIPA 5FQOA 2A14A 1HKSA 1MDMA 2FBHA 4I01A 5CVRA 3KP2A 4BLUA 4IHSA 1QNTA 4EM1A 1I1NA 2ONZA 4P7FA 4PYIA 2VBXA 3E3VA 3L00A 3ZMDA 5CCXA 1G6NA 4LK0F 4ENMA 3TOAA 4P55A 3HVHA 3K0LA 1KYZA 4PGGA 3PX2A 4ZZLA 9MHTA 2A5YB 5K03A 1N7JA 1B9MA 4KMUX 1IN8A 1FOKA 2RC4A 1IRFA 1D2HA 4L5IA 2BR4A 2EJUA 2VODA 2Y75A 3EYYA 2LSOA 2BH2A 3LAJA 1UFMA 3RPQA 1FJXA 4PCQA 1SFEA 3HSEA 1XB4A 1BI3A 1KU9A 5IT3A 4RGRA 3WGHA 3CC8A 4E2YA 1G60A 2AOUA 2EX4A 3GX4X 1H9GA 4PWYA 1P1BA 4CGZA 1AF7A 3G2MA 1K7AA 1ZG3A 3DF8A 5TJJA 5LQNA 3UJ7A 4Q4ZF 2P5KA 3JAMK 1T39A 5E1BA 5DX1A 5DD4A 5EMMA 1QPMA 4MQVA 2VDUE 1TTYA 3C0KA 3CJTA 5K09A 1F38A 1RI3A 3M1EA 5EC8A 3EMBA 4H0EA 1R22A 1ZARA 1L9KA 3OOPA 3T5XA 5KQRA 3P8ZA 5GOZA 4R6WA 4YUXA 3LA3A 2DPUA 3F22A 2DFIA 3QP5A 3C3PA 1JG4A 3UJ6A 5K0NA 2OBFA 2L4AA 5EHGA 1XJ5A 1L0OC 3KQSA 3R3HA 3R6SA 1SD6A 1W7PD 3TFWA 1Q0TA 3ERCA 2O3FA 3V8KA 1TPYA 5HIKA 1YTYA 2IDJA 1SD4A 4HYEA 2VOOA 2Z6AA 2IIPA 4YUWA 3ME5A 3B3FA 1VPTA 5FCDA 1U2WA 4DKJA 3NW9A 3UZUA 3SR4A 1MKMA 1PDNC 3LCUA 4JK1X 3OCJA 1ZGJA 3P9IA 2EFQA 2R6ZA 3KHKA 4AUKA 5ILUA 1YZ3A 4MHGA 4I0AA 2Z3YA 2VXZA 1EJ6A 3ERED 1ZQ9A 3THRA 5E17F 2UXXA 4P7KA 4AIJA 3EVZA 5EZSA 1DP7P 3TQNA 2F5CA 5LGTA 4N9HA 3R4KA 2EK5A 2PBIA 2DQLA 3FMRA 2FOKA 2HOEA 4P96A 2IDKA 4ZH4F 4KVZA 2AN5A 2B78A 1WSUA 2EB7A 1KPGA 3A4TA 2VZ9A 2ZXJA 2PGXA 5D4RA 1IM8A 4BP1A 3DLCA 1G38A 3BWBA 2UZ4A 3I5UA 3V7RA 1TLHB 3U1DA 5JUWA 5FA5A 4OIRF 1O9GA 3LSTA 1L3BA 4GOND 5KVRA 1IW7F 4EJVA 3ZN0A 5FHRA 3OU6A 1MZBA 2KRFA 4UVAA 5DCMB 4MTLA 4YV2A 2FU4A 1QO0D 1GHCA 2P35A 4E30A 1F5TA 1RI4A 4HC4A 3GFIA 3FHZA 5CVIA 3EVGA 2PX4A 5FD6A 4M9XA 1UB9A 3WTSC 1KXZA 5FB2A 3A26A 5E8RA 1FZPB 3FM5A 1KIAA 3DEUA 1DL5A 1VQ1A 1ON1A 1P4WA 5JR3A 3KLNA 2ISYA 4ER3A 2DTRA 5ERIA 4PIMA 3MZHA 2ADMA 2QE6A 3KETA 4M6XA 5D4SA 5DDGA 3SZTA 4IWNA 5GIOE 1JQ3A 5BP7A 2FQ3A 3WGGA 2B9EA 5D8LB 1L3CA 3P2EA 10MHA 3LQRA 3N97A 2MC3A 4UUVA 3QOPA 5K5RA 1BBYA 1SMYF 3WSTA 4HBLA 2R7DA 5ICGA 1D8KA 4CHUA 1KQ9A 4HLXA 2N47A 4ZTBA 1KU7A 3FWEA 4R8RA 3U2RA 4G7ZF 3QAHA 2K27A 2G9WA 4E70A 3M8FA 4KDPA 1GVJA 2NXJA 2ZZNA 3PLAE 3I4PA 1D5VA 4CKEA 2M5WA 1BN5A 3BJ6A 4QQNA 3GLXA 1P2FA 4N9IA 4IRHA 3BGDA 4CO8A 3JSOA 2GA9A 1BI2A 4EGZA 4R8SA 2OBPA 3CJRA 3EVDA 4OIQF 1MJAA 2I6GA 3BPXA 4U0WA 1TQMA 3BT7A 4U88A 3Q9SA 5LRSA 3G8BA 4RTQA 4XLPF 3NVKI 4WVLA 4OIOF 2QWWA 5ILSA 2V79A 3ZQ7A 1F3LA 1B1BA 5K01A 4CTKA 5E9JA 5CLSA 3TDZC 3D2LA 3KPUA 1FLIA 1IZ1A 1ZH5A 4A0ZA 3KP5A 2OO3A 4FGZA 5DM1A 5IT9K 2YUIA 5TRDA 2GIVA 2IJLA 2XYRA 3L09A 4ESBA 3HRSA 4XLNF 2FRXA 1DPRA 1J59A 3VFZA 5CM2Z 4PYOA 4PYQA 4MHTA 4RB1A 2NRAC 2P1DA 1EV7A 4XSZF 4FT2A 1XN7A 2BE5F 3CCFA 2IH4A 1KU2A 3HTUA 2WV0A 2VDWA 1SAXA 5J6XA 2DPMA 2VT3A 2QUFA 2RQPA 3LDUA 2PXXA 3N4MA 2MA3A 5E1OA 1ZKDA 4IRGA 2D2WA 2HWVA 4ER0A 1RJGA 5CVUA 2EV5A 4LB5A 3FXRA 3OE5A 3BPVA 2V9VA 1WWXA 4A0YA 2QY6A 3VSEA 1YFJA 3G2OA 3PFGA 1K78B 2O06A 3GRUA 4IHTA 3UJCA 3I0TA 3GEZA 4YIIA 1XCBA 3FPGA 1UHMA 2VN2A 3GNLA 5EMKA 2Z33A 3HTXA 1HW5A 4EJOA 3UJAA 5JVTA 1R1UA 1PP8F 2DK5A 1VTNC 4R1HA 2F2EA 4U0VA 3GWZA 1XMAA 2OY0A 1OMIA 5ICFA 5DM0A 2ZTHA 2CW0F 1NE2A 3DFGA 2YXEA 4GOLD 2GWRA 4A2UA 4C03A 2KJBA 2W85A 4HOBA 2BYVE 2QYOA 2XVAA 3A25A 4PYMA 3O7WA 3R9XB 4V0RA 3ECHA 2PT6A 1LEAA 3WTZA 5LQJA 4MNUA 1R8YA 4ISCA 3PQKA 2JJQA 2DAOA 2LF7A 1N2XA 3HM2A 3HVJA 3E5UA 2QVOA 1YZHA 2FNPA 3DP7A 4JQFA 5DEQA 2P41A 2O0YA 2XAGA 3CJNA 3TM4A 3CVOA 2EJRA 4P7GA 2JT1A 5DTRA 2CYYA 3GUDA 1YO5C 4LG0A 3P7NA 3ISPA 2PEXA 3KQMA 4OA8A 4LFUA 5KK1A 1I9GA 4IVNA 1O57A 4FSXA 3AJDA 1EJ0A 3TQSA 2P3LA 3ECOA 1A04A 4UOEA 4RVGA 3BKXA 4RVHA 2VBYA 3THSA 2IRFG 3TM5A 1OR7A 1KP9A 2GAUA 3GJYA 3O4FA 4KIGA 2AR0A 1IN4A 1NT2A 3K1NA 4ER5A 2AN4A 3K0BA 5H6RA 2PY6A 2M8EA 2ZWAA 5K5OA 5DX0A 1T98A 4BH9A 2Q41A 4M72A 5FUBA 1REPC 3EMDA 2NAZA 2AVNA 2IT0A 4Q47A 2ETHA 3F21A 5FQNA 4U7DA 2OKCA 1DUSA 2GH1A 5EIWA 1T2KA 2VBWA 1W7PB 5LHHA 5FFZA 3DUWA 2ZIGA 3TDUC 3TOBA 2Z5UA 3BOQA 4G9YA 5E2AA 3TO7A 5FTWA 5FLXK 3GRRA 1QAQA 1E2XA 1FY7A 3HRTA 1XXLA 5T6BA 1O7FA 4WXHA 3IC7A 4L9VA 2GAFA 1XSXA 2CSOA 3CKKA 3K2ZA 3GRYA 2YXDA 1TNSA 1XGMA 2DULA 4FT8A 3H3UA 4FHTA 1YLFA 2STTA 1WRJA 3CUQC 3BWCA 3KP4A 4PGHA 4P9UA 3SGLA 5BQTA 3JWGA 1ZYRF 1TBXA 3VB2A 3QPTA 3M4XA 1WS6A 2PJPA 4KYWA 1ON2A 1V3FA 2FK7A 5D1HA 3J7AO 2K02A 2E5WA 3V8JA 1HW1A 3OE4A 2HS5A 5DM4A 1U6GA 5K1YA 2JTVA 2XGXA 4LD5A 3M9AA 2P5LC 2CWWA 3V4GA 1ORHA 5DUIA 3E6CC 1JG3A 1JSXA 3RYPA 3HVIA 3HP7A 1I5ZA 3JWJA 2XAQA 4PCAA 3LQQA 1AQIA 3TO6A 3BZBA 1TW3A 4A5MA 1FSEA 4A12A 5HEKA 3M6VA 1H0MA 2CKDA 3GFMA 5K05A 2OXTA 1ZN2A 3JAMZ 4AVPA 4FZVA 3S68A 1U3EM 2GS9A 3EVCA 1YFHA 2PMHA 4R79A 1G8AA 4M37A 1GXPA 3M6WA 1VBFA 3HCCA 5HLIA 5DXJA 1MJ9A 2K4BA 2ISZA 1RJFA 2WWYA 1ZRFA 4GO1A 5C1IA 1DDNA 4Y30A 3UA4A 3P71T 3RI4A 3HRUA 2IPQX 1G4DA 4UVCA 5CVDA 2UYCA 3G2PA 3B5IA 2DU9A 3JTHA 3RYRA 5EZQA 1IY9A 2L3DA 1PUEE 5LSAA 4GOOD 1LDDA 3AY0A 5EHIA 1Y8CA 3WODF 3SM3A 1KPIA 3DXYA 4HQMA 1RNLA 5LQCA 2W57A 2ZVJA 3MCTA 5K0BA 3WTXC 1SUSA 4QTUB 1R00A 4RAYA 1BC5A 1LVAA 2HV9A 2HDCA 2HGCA 3IWFA 4LLNA 3SSNA 2QRVB 4UHTA 3K69A 3ELYA 1FT9A 1G6Q1 2A61A 5LQRA 4L9NA 3J81K 3ZMZA 1FC3A 4HQEA 1BC8C 5E8IA 1JTEA 3AAFA 3GFJA 1FWZA 4HSGA 4YUZA 4KWCA 2A6HF 2K86A 4CWAA 1YIOA 3OU7A 4HW0A 1J7KA 3QOXA 1KPHA 3P2KA 4QWQA 1NKVA 1ZAOA 2ACJA 1R6AA 5K0FA 1UIRA 1T6SA 2V1DA 2CMGA 1ZHFA 5K0EA 3KCCA 3ER8A 4DMGA 2KIMA 4NHJA 1OR8A 1FSHA 1QZYA 1W7PA 1RIOH 3HUGA 1WXXA 5CCBA 2GA1A 3KQPA 5IH3A 5BW4A 4Y15A 5E1ZB 3PS9A 1EH6A 5D6EA 2ADUA 5D5WB 1H1DA 4YMHA 4HZFA 4S05A 3HOSA 4PINA 4KA4A 2RVCA 3WTYC 2AS5F 1X3UA 3DULA 1G3SA 3C1DA 3K1MA 5D5VB 4BNCA 2RDPA 2OZ6A 1G3WA 2XHKA 3NMUF 1NW6A 4QPNA 4WK8F 4RB0A 4YFNF 2ZNZA 2FPOA 1QYRA 4EJWA 1QBJA 2AOVA 2OZVA 1T38A 4CDGA 1I1GA 1VL5A 4LMYA 3RJPA 3DR5A 2ZIEA 1STZA 5DWQA 2YTZA 4AZSA 4AZVA 2C7PA 2W25A 3BDDA 2I7CA 3I54A 4RTRA 2HMYB 3WG9A 1JSZA 4P7JA 1XCJA 1ZRCA 4RVFA 5K5QA 3WU1B 1NW5A 4FP9A 4BP3A 2V1UA 4IXAA 2M87A 4PYNA 5E1XA 5LHGA 1U5TC 3KP6A 1Q1HA 1QZZA 3M6UA 2K7LA 3EYIA 2NYUA 3FUVA 1DPUA 3SXJA 3OV8A 3MZYA 4ASNA 3P2IA 2IH2A 3BJAA 3TR6A 2XKPA 4JXJA 1R36A 3FYDA 3BY6A 5GWXA 5DD8A 2IBSA 3KLOA 3DMFA 3NVMB 4CXFA 1EH8A 3NQOA 1G8SA 4DQ2A 5FGMA 2H27A 2FMLA 2IBTA 5D1NA 3FUTA 1ZG1A 3RKXA 5EIFA 1YW9A 4HF2A 5FWDA 4YV1A 5K0JA 1BOOA 3E8SA 3EDPA 5BMZA 4MWZA 1JGSA 5FWAA 1RUNA 3NJRA 4G8XA 3FUUA 3KQTA 3COAC 1LB2A 3HVKA 4L7VA 3H2BA 4BHPA 2BM8A 3JWHA 2XRNA 3O6BB 4B8XA 1RI5A 4Y17A 3FTCA 3RIRA 4ZYHA 3P9KA 5E8GA 4MQ9F 4HF1A 2YVLA 3K1PA 3HHGA 3HIFA 5BOXA 2STWA 2PX8A 2YSRA 2AN3A 4C07A 4IJAA 2QRVA 3TLJA 4RTKA 2PFBA 5IT9Z 5F1RA 5CD1A 4IPAA 1NV8A 3ZMTA 3G73A 2ZW9A 3FM3A 3CDHA 5HOOA 4DM3A 3O2PE 1NW3A 2BR3A 2ZULA 1KU3A 2AVDA 3SSMA 1K6OA 1ZLKA 1O7LA 4UNOA 1WKMA 3FPFA 4GC9A 1I6XA 1BI1A 3ELDA 3MTIA 3HHHA 3GW2A 1K79A 3KQVA 4RGXA 3LKDA 5ILVA 2CO5A 3L9FA 3SZPA 4EM0B 3G7UA 2GPYA 4HLYA 5FO5A 3V7SA 4M74A 5ICCA 2EA4A 2ZFUA 2HKXA 3F8FA 3UJDA 3GYHX 2FRHA 5A2QZ 4XSXF 4BXUA 3HCEA 4OBWA 1XGSA 3FUXA 3GU3A 2Q8KA 4EGYA 1F4KA 2NXEA 3E23A 3VC1A 4M7RA 1IAWA 3REOA 3IHUA 4HA8A 1J5YA 1ZRDA 3ORHA 3RKYA 5DRYA 3LDFA 3V97A 5F64A 4CZZA 3K6RA 4DCGA 1I27A 3RPUA 1JTFA 3W6KB 1LDJA 3FX3A 2BGCA 6PAXA 4DQ0A 4I7HA 3FPEA 4IF4A 5HOQA 3MQ2A 4XBFA 2ZWVA 2XROA 2M30A 4MIKA 4I02A 3MERA 4G56A 2C6YA 4RS8A 2Z6UA 4Z2YA 2E7WA 3MB5A 1SKMA 3BKWA 1KR5A 5M5BA 3E5XA 2PX2A 3AWIA 3F23A 3EVEA 2KW5A 3PVCA 5F6FA 4PIPA 3HTSB 3BP8A 3HYIA 5K0LA 3UA3A 2JPBA 2ZMEB 4A0XA 5EVJA 4X41A 1O3RA 3C18A 2V74B 2HR1A 1NV9A 2ZNYA 5FHQA 2E1CA 2G7UA 5FADA 3FUWA 4O3MA 3TGNA 1U8RA 2D1VA 3BUSA 1Z91A 3BGVA 1RI7A 2M45A 3L2CA 2HYGD 1BKYA 1R1VA 1BIBA 2YQZA 3HNRA 3DKWA 1S29A 2DW4A 2EV6A 4I0BA 4I98B 2KIFA 1C0WA 4ENJA 2PWPA 5E2BA 3SQNA 1AQJA 4LGWA 1MJFA 4WCGA 3Q7EA 2ZFWA 3ROUA 5JHUA 1PP7U 3QU6A 3F6OA 1M6EX 3KKZA 5EQJB 2ZLBA 3JWIA 4FS8A 3WU0A 4HX4A 2L01A 2RGVA 4YMGA 3UWPA 4RTJA 4QTTB 4HF0A 2B2CA 3AXTA 4A6DA 3EGEA 4FSDA 3ID6C 3UJ8A 5E18F 4O29A 4DZRA 4M36A 3DLIA 3LL7A 2JSCA 4OIPF 1B42A 4ER7A 4QQKA 5FLXZ 4OOIA 3KEOA 2AOWA 3OU2A 4CICA 3DXJF 3I59B 5DM2A 3DQVC 5AONA 3BROA 1L1EA 3Q9VA 1JQDA 2AOTB 1XSVA 3EETA 4RB2C 3LHDA 3LX6A 4F85A 5G02A 1MGTA 3FTEA 1WG8A 5HDGA 5F2KA 1IXRC 4LB6B 2NXCA 3VEPA 1R7JA 1RI1A 1QQIA 5DPMA 4HGYA 2PSSA 4LK1F 3IYLW 3VC2A 3CUQB 4RAZA 1V4RA 1XGNA 2KKOA 5A2QK 5EKXA 5F2NA 4WX9A 5DCMA 2NXNA 2P3OA 2RV8A 1HSJA 2VC1A 5E20A 4AIHA 1XDZA 3B73A 3E7PA 2OPBA 3BGIA 3FPHA 3R24A 3R60A 2HQRA 4WWCA 4PONA 4CTJA 2A07F 3MAGA 5LGNA 4M9ZA 4Q48A 4Q5SF 1IXCA 1WQ2A 1X1CA 5E9QA 4KT5C 3FMSA 5EG5A 3EVFA 3GO4A 1UCRA 4UV9A 4UVBA 2QBYB 5HDKA 2UYQA 1KGSA 2MH2A 4ZYEA 3E5QA 2MH9A 2MLGA 2ESNA 4EMSA 1XCLA 4BAYA 2VE8A 4RSRA 1X1AA 3U81A 4G6QA 5CVEA 1IN5A 1USTA 4RGSA 2PV0A 3OZRA 5E1DA 1SFXA 3LCVB 2M1BA 1XD7A 2O57A 3P9NA 2EA2A 1T0FA 3F8NA 2XAJA 2PX5A 5J8FA 4U7BA 4KDCA 2G72A 5JI6A 2ZIFA 2C7OA 1B4AA 2F5EA 2IA2A 2H00A 3BWMA 3QPHA 2UXNA 4C04A 3DXXA 3FXUA 1I4WA 2CMHA 2C7QA 4RWZA 3SSOA 2JHPA 3ML6A 2PT9A 2ZMEA 2EFJA 2EWNA 1G3YA 4CKBA 5E1WA 1P39A 1FP1D 3SVZA 1ZG5A 1O3QA 5L3EA 3PB3A 4HV5A 3C6KA 3DTNA 4GC5A 2GXGA 1MHTA 4P58A 1BI0A 1SD7A 1DCTA 2GZWA 2FXAA 5ED4A 1CGPA 4E2WA 3J81Z 3L8DA 2HKOA 4C05A 1FP2A 2DQRA 5CVJA 5BXYA 1S7AA 4EVIA 1W5TA 4NECA 3LA2A 4NQWA 3MEXA 4G7HF 1LNWA 1PJZA 2OU2A 1B9NA 2OQGA 2P7VB 5LGUA 3HSFA 3E05A 2H11A 1ULYA 3KZZA 3SHFA 2NS0A 2FMYA 2BR5A 1RJEA 5KS2A 4X1OA 4RTLA 4EKGA 3GRVA 1T43A 2IPXA 2FK8A 4DCMA 4EK9A 1VP9A 3M8EA 5GP1A 3KR0A 3FYCA 3BXOA 2IVMA 1VE3A 3OPNA 4R8HA 2P6TA 2O07A 3VODA 2YX1A 5DYMA 4ER6A 1YQAA 4EM2A 2F8LA 3I59A 4I09A 4OINF 4R05A 4I2OA 4HX7A 2X4HA 3B89A 4YFXF 3CBGA 1P92A 4K6MA 5FFXA 2AOTA 2EJTA 5DX8A 1W5SA 3KR9A 2OYRA 1WXWA 4AD9A 3PX3A 3EVBA 1ONVA 4QDKA 5HS7A 1R1TA 5HLHA 4OQEA 2G70A 3CUQA 3LPMA 3MQ0A 4HX8A 2XYVA 2D1HA 3FRIA 1K78A 3C6MA 2BEOA 2O05A 3LDGA 1Z6TA 4FX4A 1LDKB 3B7PA 1AWCA 4WF2A 3FZVA 5HILA 3K9TA 1AV6A
chains in the Genus database with same CATH superfamily
1M2FA 3ZPXA 4HTFB 3TE6A 2CHEA 4DPLA 4QDJA 2DWOA 3RTEA 2X6OA 3FKQA 2FSWA 2DYKA 3AU8A 4IOCF 1NX9A 3T1HB 1N2SA 3RSSA 3F9RA 3C6QA 2QSUA 2VPTA 4RORA 2I9KA 3D1VA 2I34A 3RJMA 4JB8A 1G55A 1UAAA 4FSHA 5EJ6A 3AOGA 4HVAA 2FMFA 1KBZA 1EAMA 1W2GA 2KDOA 4FMDF 3HCDA 1U94A 2WWXA 2NV6A 3IELA 4M60A 3BL5A 5JAQA 3U49A 2H2GA 4FCWA 1HSZA 2LNBA 2G04A 1UMDA 1D8JA 3ZMSA 2ZRHA 2TMKA 4IW3B 3Q5FA 4AWXB 1EBBA 4BJ5C 1H4QA 3JARA 3PDIB 3BS4A 4K87A 4FQGA 3WL6A 4JI2B 1CUUA 4X3PA 3UJNA 4UE6A 3E3MA 1B0UA 3LQ2A 4ZVVA 1TTQB 4Y0AA 3D59A 2B3TA 5BQOA 2ZR7A 2P4WA 3BTJA 3ZQUA 3L7MA 4CXMA 2QUKA 4BCDA 2FPIB 5CJ2A 4NS1A 3H7AA 2HTEA 4KNYA 4POAA 3M6FA 4WZBE 4G0OA 3A1UA 3F96A 3NARA 3PENA 4WKNA 4I1UA 1R15A 1H5NA 2GYYA 2LXNA 2CUKA 2LKPA 3BCRA 4UQOA 5ELLA 2YMQA 1FYMA 2WHYA 5KJ6A 1Y4UA 4DLBA 2C3UA 4GGGA 4B7UA 4CG3A 5JQGA 2PKWA 4JUAA 2VXBA 4ZAWA 1I3KA 3MNFA 1P2DA 3C7KA 2FTKE 2WNHA 3I5YA 4Y52J 2C4TA 1S0UA 4J1NA 2OFWA 2TS1A 1ZMRA 2WC1A 2XBMA 1N8TA 4BZWA 4QJ3A 4RMNA 5IJWA 1OU4A 3UV3A 2R85A 4DWVA 1U8TA 3RW9A 3WWOA 5DCFA 4RH0A 4HH4A 1QAOA 5HA5A 3ANYB 4XGIA 2X6RA 2IZ1A 3F3KA 1PQ4A 3PGKA 4FFBB 5FI3A 3ULQB 5AJTA 3UG6A 1H2WA 2X1VA 4UTRA 3UGQA 5KTOA 3UJ9A 2VQFB 2JZYA 3WE2A 3F71A 4EMUA 4DV5B 1YS6A 4CQMD 4OG2A 1R5BA 2KT0A 3VYWA 2YVQA 4OQFA 3UT5A 3D3WB 1SIWA 4KDRA 2GA2A 1LQ1A 1AKEA 1EZZA 3B38A 4Y2GA 5KMGA 2ZSIA 4HB0A 1OTHA 3IIEA 3AKDA 5T4BA 1FPMA 1QHHD 3H0DA 4OU0A 3UATA 1P6RA 2BFMA 4FZJA 1IBLB 3KPWA 1MBHA 4G94A 2JIZD 1ODLA 4HG2A 4FD3A 1H9AA 1MEJA 2VP6A 2BEWB 3EF0A 5SV2A 1OBOA 4BB0A 1EFPB 3AR2A 3GD5A 4MYUA 3JPWA 3M6XA 5AW5A 1N3IA 1T95A 3JAWB 3PYMA 2DCEA 2XVCA 5LQAA 2W5UA 1DKOA 4YASA 1G9SA 4KBYA 1UDWA 1Z36A 5DCUA 4N6GA 1VPVA 2C77A 3K4PA 1KI6B 4EO9A 2B8WA 2AJDA 2GAIA 3AYXB 1BA5A 4XB6B 2VTKA 4Z1OA 2CLFB 2VEOA 3DEHA 2ZO4A 2A78A 3ETDA 2FOLA 4HY3A 2WB1N 3MXTA 4U7PB 4U8GA 2H18A 2LIPA 3CINA 1F9NA 5JHFA 1HRKA 3AESB 3W9BA 2GAAA 4ON0A 2QQ9A 1FP7A 2R1VB 3DONA 2HW8A 1OPRA 4WLNA 2ONKA 1G2PA 1N2HA 4BYYA 4J8PA 3DBRB 1P1KA 5CNMA 4NABA 1IK6A 3WGJA 5JLAA 3V8PA 3IEKA 5HIMA 1NVKA 4YUYA 4LG1A 1BRTA 2DTZA 3N2ZB 5LQKA 1P8AA 5LLQA 2R5YB 3NRJA 3H1TA 4L9RA 1G5HA 3KX2A 4JB3A 5ENZA 5H02A 4I4TA 2XTZA 1LWNA 3OIDA 4FZ5A 3ZHRA 1QHXA 1FYVA 2I6UA 4N47A 1Y5RA 3DDUA 4LOIA 4M0MA 3P32A 1HDEA 2JUCA 4PX3A 4QJ5A 1IV8A 3CN9A 1ZH4A 3P4UA 1A9ZA 1U3FA 2K85A 2I54A 5L3GA 1GKLA 2G7HA 3ETHA 3H3ZA 3KTOA 3HA7A 3PC8A 3GZNB 4AT1A 4AUNA 2L0XA 3ICWA 3DTVA 3JQRA 2YW2A 1BHJA 1RM0A 4HDUA 1DT5A 1N9GB 4RKFA 2OD2A 1K6EA 4PHTA 1XEWX 3KKNA 3VV2A 1D8AA 4L5JA 2Y67A 1IXKA 1TYEB 2FP4B 1YZGA 2F6RA 3G23A 2Z58A 4GL2A 3GUCA 3UXEA 1BVHA 1MVOA 3V7CA 2O2ZA 3QP6A 4L4ZA 3CLOA 1FS6A 5DYTA 3G5LA 4Q1AA 1W7AA 3QG1A 3ND6A 4LOJA 5JDIC 1E4EB 3GLLA 5DOZA 3BZ6A 3KO8A 4UUNA 2VS1A 4PCLA 3HJCA 1K68A 3DOHA 1ZR4A 3ER9A 4ZVTA 4L02A 2QHXA 5FD5A 2GM9A 2AOUB 1TMOA 3VSBA 5HIAA 5ECYA 1W85B 4Z8XA 3TI9A 3W2EA 3C3WA 2VWQA 4ROTA 1FMJA 1Y3IA 1QLJA 5EKSA 5DK6A 4MCAA 4O2BB 4B48A 4PG4A 3AY7A 4UNPA 1XCPA 3EEYA 1D2RA 4IKFA 1ZJWA 4X7MA 4DV3B 4C08A 4F9GA 1VA5A 1NFQA 2XRFA 3I37X 2ECOA 1XF1A 3BIXA 3LNTA 1XU7A 4P8RA 3EFBA 1RLJA 4UTOA 5EG0B 3EPPA 4M1KA 3R0VA 2VQLA 3F67A 4AIDA 3O75A 1HGXA 4XOUA 2Z1NA 4CG1A 3AI1A 3BT9A 2A5JA 2YN0A 2IT1A 5IJ9B 3I9JA 1WXDA 4JC5A 3T3PB 2K87A 3K5IA 4HQ6A 3TJMA 3PXDA 2C7RA 2GN8A 2YBEA 3MJRA 3PVSA 3TOCA 3RRXA 4IOLA 2ZJ7A 2XECA 1ETYA 4R8MA 3QHAA 3NATA 4BLUA 2ICAA 1KZHA 3TIVA 4HNSA 2IVFA 3ZU2A 1XAHA 5KNDA 1KMHB 4BATA 1Z6PA 3MOSA 1B9MA 1F36A 3EYYA 1QFSA 4L28A 5EQTA 4GR9A 1UPTA 1SFEA 3N2YA 3NKFA 4UTPA 1F14A 3MBIA 4BNZA 1NUTA 3GLIB 4ZEWA 3LMMA 2XF7A 2VJQA 1YMQA 1QGOA 5IK2A 2JKVA 1AGPA 1D3AA 2V6EA 3CRZA 4NV0A 4I1OA 4Y9RA 1CR4A 1RI3A 5KQGA 5IUNC 2HOAA 4MS1A 3OURA 3KG2A 4Y1GA 3AHDA 2L4AA 3LOQA 2XWBF 1SD6A 3ERCA 1KRXA 2VYVD 2HA6A 1L5HA 3I2FA 3ZGYA 2OMEA 1T4GA 5T57A 3W5JA 3STWA 2AZMA 1Y8RB 2YV1A 2QQEA 5C53B 3BSWA 5F3RA 5ILUA 4OP2A 5I9LA 5JZVA 4MHGA 4HCJA 3ERED 3PHHA 3IQXA 4P7KA 3WL4A 5BR7A 3CWZA 2J33A 5EXPA 3QPBA 3P4YA 2AYXA 3JQ8A 1G8GA 2HOEA 4CFYA 1T5BA 3A37A 3ZLJA 1WCIA 2WYVA 4P1WA 2VZ9A 3I5UA 3ZCSA 2DQ4A 2I5UA 5A3RA 4K46A 1A8SA 1DV1A 1IW7F 2DM6A 1DJOA 1GQQA 5C2JB 2QD5A 5DCMB 3DAOA 1RI4A 3A9VA 5CCEA 2WKRA 4UU8A 1OXKB 2VSXA 1B6RA 5AHOA 1C3LA 4WNAB 1AQLA 5H83A 1U9OA 2HWWA 1D2AA 3GY0A 1TEHA 1MH4A 1WW3A 1MB3A 2XCUA 4BGEA 1CC1S 1RYBA 1ZQ1A 3U4AA 3MZHA 4J03A 4TV9A 4KYVA 5GIOE 2WV7A 5CYFA 1RRFA 3AUAA 2IYRA 1ETHA 3MTGA 3SICE 3O95A 3O73A 2J0QA 4D9FA 3HLKA 4MYCA 3SLGA 4KTTE 1Z4PX 3U9TA 2Y92A 2D0IA 1K08A 4E70A 2X51A 3UXMA 3BJ6A 3BGDA 3GJZA 1H94A 1YL5A 1J97A 2GAOA 3E9NA 1QRYA 4Q6BA 1VQ5I 4B2PA 4OIOF 3CWQA 1O5TA 1C4KA 2IA5A 3KAPA 3B6MA 1CR6A 1G0OA 4GGMX 3ZXUB 3NM6B 2ZYGA 5BYAA 1ZD2P 1H3EA 1KYQA 3GJ6A 1N1GA 3IEMA 1B41A 4NMHA 4E7KA 2P1DA 3EAFA 2FW7A 1QO9A 4EEZA 2HUPA 3AVYA 4CA0A 3MPOA 4TWRA 4EMBA 4MMXB 4QPQA 4NC7A 4P3XA 2K2WA 3QF7A 3NBKA 4BKRA 2D5VA 5CTJA 4ZHSA 1G18A 1WJBA 3AVVA 2VXOA 5JJBA 3KXDA 2G25A 3VSEA 4PSWA 2E1RA 2ZRNA 3GFRA 3FOCA 3OTWA 4DG9A 4R3UC 4EJOA 3UJAA 4I2VA 4TTTS 2F2EA 3GWZA 3E7XA 3AVTA 5IJ0B 1BVRA 1KEUA 1HZZA 3U44B 4CCKA 3OCZA 1LTKA 4XOTA 1VL0A 4FFMA 2QRKA 4QPOA 2VCEA 1ZXLA 1RYZA 1R5ID 1W4CA 2Z2SB 2CNLA 4S2EA 2OFPA 3DEWA 2R7VA 3ZY4A 4MJXA 4Q7QA 4BE4A 1NASA 3DLAA 3SOZA 1A2BA 3VZQA 2C29D 3TZQA 3KKPA 3R5TA 1NF8A 3DL0A 1L6RA 1Z6AA 2GAUA 3MTJA 4WZ6A 1SVNA 3ZI0A 1A4RA 2IUEA 1WXHA 3O2JA 1VSQA 1VL8A 3E1SA 3DKXA 5LYJF 4HEHA 1T98A 3IAS1 1NPDA 1YH3A 3LP5A 3Q85A 1ORVA 3O0TA 2O3TA 3ORFA 1R5OA 2XA2A 4INJA 3NIGB 3T06B 5BYJA 1NXVA 3AESA 3OKPA 2A0XA 1YU6A 3F74A 2R7XA 2WT9A 3K2ZA 4ZEVA 2VO1A 3OR1C 2DULA 3MQFA 4TLDA 4P4LA 3IDZA 3MJHA 3KZIC 4PPNA 4DM4A 5LU8A 4P9UA 1VQOI 1BQEA 1H6DA 2ZTVA 4YRRA 4BFXA 5FKLA 4KYWA 2XYHA 4YCDA 2WTMA 2BC9A 3OE4A 5DBOA 3TRDA 1VXRA 4ZDKA 1VPLA 3HY6A 2AMVA 4ANJA 1XZMA 1XXHB 1AQIA 3BZBA 4Z0NA 1K6XA 1VF9A 2QF7A 4EEFG 3JAKA 2V4UA 3M6WA 1JMVA 3MWEB 4YAKA 1K63A 3VJKA 3HRUA 1JMKC 1GP2A 2GXSA 1JT9A 3RYRA 4LOCA 4LJ7A 3KZMA 1PUEE 1UBUS 4RY2A 4L57A 2HBQA 3HXPA 1J0AA 4UM9D 3A01A 4RVSA 3V55A 3BWDD 4U9UA 4GU5A 4DTCA 5AW2A 2QZ9A 5IYZF 3RIGA 5LQDA 3EXIB 4LG3A 1EM6A 1M7BA 2HRRA 4ZOCA 2EKBA 2IHUA 2ISQA 3S93A 5LB2A 4YUZA 4QRHA 4HWGA 2Q4TA 1J7KA 5BPHA 1HYHA 2VL8A 5DH9A 3PP8A 1UIRA 3M7IA 1A69A 5K20A 3DDCA 4N49A 1MO6A 3DE1X 3WTBA 2J8ZA 4OCZA 3MLAA 3H5TA 1A2OA 2VLBA 3TDKA 1LK5A 2PWAA 2XKBA 1LLCA 4NONA 3ZZMA 4ZJPA 3OYHA 3FZYA 2YHSA 4CETA 2NUAB 1M6VA 5E95A 2GJ4A 4KN5A 1XLUA 1ES9A 3HDHA 2Z4SA 3L82B 4CN8A 5IOYA 1I7PA 1VI5A 5JWHA 3IBTA 1YI8A 2D62A 2WKWA 3KSZO 4JUFA 1GFSA 1WCYA 3TX2A 3E9ZA 2ZJAA 1G8KA 1VPDA 1RU3A 1U28A 2P0YA 1SEPA 5DS9A 1V11A 2PMEA 1LW7A 4K6FA 1Z4MA 2A5GA 4JOCA 4BNHA 3AL0C 3QVGB 2VDMB 3O1IC 1W5AA 1GEGA 1N75A 4QU8A 3CRVA 2C00A 2O8BB 3REGA 1K6MA 5LP6A 3GLFB 4EFNA 5IAKA 2STWA 1L4EA 5BNFA 5H8WA 4OD0A 1OWPA 3L18A 4C07A 1J0CA 4IJAA 1AUPA 3T54A 2YNMD 1EFLA 3OJ0A 3OQVA 3BHNA 1QK3A 4YONB 3KVOA 3N8GA 4CFZA 3E27A 3H35A 2Z4TA 3W6PA 2RGUA 2RJNA 4OFZA 4FCTA 1DV2A 3GRPA 3RVOA 4ETMA 3A6GA 1N78A 1WP9A 3LKBA 1LVUA 4U3JA 1PR6A 3GTGJ 2IE8A 4M1YA 3T0GA 4M99A 2GJ8A 2P9TA 3EY4A 3AFGA 1V43A 4XR6A 2X0JA 1NXTA 2NU7B 2Q1YA 3RPUA 1RXCA 2FMUA 3GLIA 3HB4X 4WESB 2IY8A 1ECBA 3IKMB 2YZ7A 3QE9Y 3IV7A 2UUBB 2MJLA 3T5CA 2Y99A 1KR5A 2FX0A 1FDOA 1PEDA 3BMOA 5ALOA 5K0LA 4ALNA 3JQCA 1UINA 1G20B 4WBSA 1CDEA 3FUWA 1OIXA 1TZCA 1N2CE 1PYVA 3RARA 3WRYA 4JJ4A 2QMZA 1N4AA 1QX4A 2Q50A 3QFSA 2NU8A 4K9SA 1OW3B 5H7XA 1J1IA 1NA5A 3RWOA 2EXXA 1J5XA 4JUBA 5E2BA 3SQNA 5F78A 2P0EA 1QJCA 4OP1A 1BU5A 2WTXA 4MAMA 1TEVA 3FZQA 3SAJA 2QIPA 3MS4A 2ZSKA 3PIDA 3KKZA 1M6EX 4L3VA 1V25A 4RTJA 1NVMB 3BMCB 1XJ0A 3E22B 1JF8A 1L4FA 4LSWA 4RDIA 1XNQB 4P22A 3I6BA 2OCAA 1W0KD 1KSFX 3DF9A 1Z67A 3N28A 1CB7A 1HDCA 2X8BA 3O47A 2AD1A 2Q21A 3UV7A 2AOTB 3RVJA 1KC1A 3BFPA 3AW8A 3LHDA 4RXMA 2JJ1A 5TISC 2DY0A 2W2MA 3OPMA 4JBHA 2KKOA 4Z1MD 1UM8A 5DCMA 3NEYA 1VQ9I 1Q14A 5HCNA 3CFYA 4BEVA 3FNIA 1L5VA 3OIQA 4RHUA 3FPHA 4EG3A 1XNJA 3KBOA 4L9SA 3JR9A 2B1RA 5I9TA 3BWEA 1H0HA 2MH9A 5HE8A 1AKVA 3TTVA 4KQFA 5A62A 4NF2A 3WJAA 1XD7A 4RS3A 3BREA 1NXXA 4CEJB 2OCGA 1GLVA 1DWQA 2JEOA 5M2QA 4J0CA 2HNHA 3FFXA 1J8QA 5FOXA 2AFVA 3T3EA 4F72A 1BYIA 1FVFA 1G9TA 4Y9DA 3OOJA 2C0QA 1R0SA 2RKOA 2GXGA 1BI0A 1N2JA 3M49A 5JWRA 1OAOC 3ZQCA 2FXAA 1SCAA 1XN4A 1NSTA 2H2IA 2A94A 3LK6A 3OCCA 1XDDA 2B61A 1LNWA 1SBQA 3PEEA 3HXTA 3N8HA 3HSFA 3KLMX 2NU9B 3T7DA 1V9LA 4YECA 2IXDA 3N6VA 1L9XA 3GT4A 2FWJA 3NHSA 3SEFA 1VP9A 3AU9A 1GNPA 2ZKIA 2FE4A 3RVKA 5IMSA 3VODA 3MUOA 5JS8A 4PAQA 1SFRA 2LDXA 2DU8A 1W5SA 4KE8A 3LSIA 2YY7A 5HLHA 4XB2A 3MQ0A 4EI2A 2AL7A 1XFDA 3EAQA 1DHRA 3TW8A 1LPAB 1O4VA 2O05A 2QW0X 3SE7A 4D9IA 1G59A 1XG5A 3IDSA 5I3CA 1G5TA 1CERA 1T9AA 3KEQA 1U5TB 4EVSA 5TT1A 3QVWA 1JHFA 4YQYA 1E17A 4BY9E 3UB4A 3HJNA 2CXRA 5IUKC 1I2AA 3GCWA 3I53A 1MN6A 2QN3A 4TV7A 4GM1A 1D2CA 3PGA1 2WTBA 1JEOA 4BTLA 4XRFA 1R6BX 3GX1A 2OM6A 2BMFA 3UPDA 4A3BJ 3T8TA 1AZWA 1JHHA 1LS6A 1RBQA 4HRAA 2LP0A 1XAIA 3FUCA 1M6YA 5JEEA 4QGGA 2A67A 2EDCA 2XMSA 2FCAA 4F4CA 5CFLA 4LVNA 3VSDA 3M6LA 1BTOA 3OQ1A 3QLTA 3EQ6A 4G4IA 3I0MA 2XXAB 1RHUA 3MD2A 4DR5B 3NASA 3KE2A 1FMFA 4FU0A 1OXMA 3GJ8A 2XGSA 5DNAA 5BSTA 3K70D 2BKAA 1PV2A 1R6TA 3I6MA 4B4CA 2Q6KA 4WNIA 2GPAA 2BUAA 4OREX 5T8KC 5G1NA 2P79A 2DPLA 2VXDA 4KMOA 3OJWA 4Y0NA 3JAMA 2RC6A 3ELWA 3H1FA 3QELA 5HVQC 3QVKA 4IDDA 1V7ZA 1TF7A 3CO7C 5GIPE 4AS3A 2ZWPA 1AXEA 3KSDO 1KIFA 1XD2A 1FJ2A 4NFSA 3PO2J 5FA8A 3NAUA 4OM8A 3Q8WA 1JG2A 4AB1A 3PPWA 3SIXA 1OLUA 1TQIA 2BEVA 1USKA 3P97A 5TPZA 3T34A 1BS9A 1TQ6A 3DXZA 5EYRA 3OT4A 1RBMA 5EKUA 2PL3A 4E5MA 3P5SA 5DTMA 1VQPI 1DC4A 1KI8A 3GCGA 3OHPA 4N0QA 4JT8A 2IUFA 4LECA 1Q11A 1GLGA 1OVGA 4DCSA 3B6KA 4A5OA 4M86A 4MWSA 4OHVA 3NANA 5FYDA 2H09A 1I6LA 5EGSA 1KQ0A 4ATNA 2PCJA 4A0GA 4G86A 5AVWA 1E9EA 4X1YA 1GAWA 1E1LA 1MMSA 4MGYR 3B1KA 3IUSA 2X5KO 4FGSA 3RAFC 5IAAA 4IO1A 4OHPA 1UXHA 3U40A 1L3IA 1ZY2A 1J2XA 2QP3A 2WPNA 4Y2SA 1VSUA 1R18A 3JQAA 2JD0A 5JS2A 5LOVB 2QN1A 1JIIA 3W3CA 2L4MA 3OT5A 4EJSC 4M8LA 4NCXA 3ABLH 3FCEA 4DBLC 1Q3TA 1V1MB 3U4CA 3S1RJ 4AD8A 5GONB 4ENUA 3PGJA 2QSJA 1MH9A 2FPXA 5K0TA 1I6WA 4JHLA 4MWTA 1X1TA 3K7EA 2CQQA 1FJLA 3U0BA 4L5YA 4MHOA 1O96B 4ARZA 1IU9A 2KLBA 4BEHA 3EGCA 3RKSA 4ENWA 4YJGA 3HWRA 1GARA 4CCYB 4W8GA 1IRGA 5FPTA 1E5TA 4PYKA 3QU3A 3N75A 5JO0A 5I4KA 5K2MA 3SNHA 5HPYB 1VHLA 3CMAI 1KOLA 4Y33A 4N5DA 1SA0A 4M1OA 2V0GA 1N25A 3HL0A 1YF3A 1FQJA 3W4JA 2VDKB 3Q0IA 3WQBA 2P8JA 3AM5A 4AP6A 2W2KB 2IYPA 3K6JA 1D2NA 4WX2B 4OQXA 3GLFA 3ZWCA 1BX0A 2J7KA 3AJAA 4RE5A 1RSZA 5D6FA 3EGDA 4RTNA 1H3FA 1UFQA 5AKXA 2HCRA 3FYHA 2FD5A 1N6RA 1QP4A 5JCOC 4A3DJ 4FOTA 2J9ZB 3TLXA 1QA6A 4RENA 3DHNA 4O2RA 4GZMA 4TT3D 3KBBA 2L82A 1I39A 1U4SA 2H2HA 5LA6F 1AS2A 2ZBRA 4FZ3A 4XSGA 1USWA 3F47A 4YCLA 4PFJA 2O7OA 3I71A 2V5UA 1GTJ1 2ZVDA 4ZV4A 1XTKA 2GIZA 4F11A 3TSYA 1NIPA 3FLMA 2VTEA 1EXDA 2FSVC 4KMFA 1EWTA 2O1SA 2R7QA 1QKIA 2C2GA 4J43A 1JLRA 1NQUA 1JDBC 4QVGA 3IHTA 2J5PA 2ERCA 1BKDR 1T9GR 1U7ZA 1P4AA 2FPLA 1MORA 3WRXC 3IOEA 2NQ8A 1G21B 3RDPA 4NOLA 4WKOA 3VKWA 1FBSA 3SP1A 1U98A 1NJ2A 1YR6A 4OJQA 1DUXC 1RW4A 2PIDA 2ZJOA 3ABRB 1W36B 2C5AA 1GQFA 2ELHA 3BBPA 3MZ0A 4C0JA 3QEBZ 3DOUA 2LKXA 2PD3A 4HF7A 4YJ3F 5AM4A 4DT1B 4QIHA 3ILYA 3EIUA 3OBIA 4F4DA 4IRMA 5BUCA 4BVBA 3GIWA 3QITA 5AO9A 3E53A 4XTCS 1M34A 4KXYA 1P80A 2W84A 1C2TA 4D02A 2IIVA 3LHFA 5C34B 1K98A 2Q8QA 1ZK8A 4BX0A 7REQB 1DIHA 3L2UA 3OCUA 4EYSA 3OPYB 1Q3KA 4G25A 2BDTA 4MYTA 2PVPA 5FNVB 3Q11A 2MYUA 1EFKA 1Y4DE 4Z5XA 2YHBA 3PJFA 4Q9AA 3AF4A 2X0LA 3Q3EA 3PRJA 2LD4A 2D1FA 5A7HA 1JKMA 4WA8A 3B2NA 1R8QA 4QAJA 2VRBA 5EIBD 2NZ2A 4D2IA 5KYYA 2FN9A 1T13A 4EJUA 2UUCB 4J76A 1YVRA 3KUCA 4N54A 4B7ZA 3U1VA 5EJ7A 3T9EA 3DLPX 3W6NA 4YYZA 1Z47A 4HS4A 4AYBA 1MB4A 1G7TA 4RD3A 1UQUA 2PBZA 4IJMA 2GA8A 3MINA 1YE8A 1XTTA 1FU7A 4LZZA 1L2TA 2Z0MA 3NWPA 3UFBA 4LTMA 4I14A 5H0IA 5IF3A 5IHPA 2AOXA 2HWYA 2VKEA 2AC4A 4OHBA 4KFSA 2BY0A 1S4MA 3LT5A 4KAJA 1JHUA 1YUBA 4D96A 2YJGA 2J0EA 5EOVA 1QP7A 1O3TA 4FEAA 1EBFA 2BFFB 4KO1S 4BNWA 3QM1A 621PA 4IV0A 3THXB 2WY2D 2X7XA 2JW5A 2H1VA 1UKYA 5CB4B 1V9CA 3QPCA 5JZSA 4M9SA 4L0YB 2IGMA 5AIPA 3L8MA 4IBOA 2NU9A 4IVPA 1E6EA 2GQ0A 1F8UA 1TJ5A 2XPVA 3L00A 3ZMDA 1DP3A 1MJ5A 1SC1A 1WVMA 2NVTJ 1PJ8A 3KQHA 2G5PA 2GZDA 2BKXA 1WJAA 3SE0A 2CEAA 5K8TA 2SCUB 3RSFA 4B35A 1FFXA 3P5JA 3TBIA 3RYIB 1ZM9A 5DTEA 3HV0A 4HN9A 3S7TA 3GX4X 3BSFA 2ZRBA 4KGZA 4YMSA 3RLIA 1Q7TA 3GFFA 4REMA 5FX2A 3T5GA 1ESNA 1X80B 8ADHA 3CCCA 1KQ3A 4Q4ZF 3LC0A 1SXJA 4ND3A 2VQDA 5E1BA 4XM1A 4OHFA 3DVQX 4CU5A 3DKVA 4PZDA 4PVDA 3BQZA 1F38A 1TQ8A 4PSAA 1V3VA 1E5LA 1ZARA 3B5JA 3K2EA 1KJIA 1XPOA 2ZR9A 1OBCA 5KQRA 2WVAA 4PU0A 3P52A 4A16A 3DLBA 1IHDA 5JY6A 2PXHA 3C1AA 3OAAA 4YCCA 3F22A 4M87A 3WLTA 5CDSA 1TYCA 2V3WA 3ZW7A 3FISA 2PZLA 3AVWA 4ZAVA 1G8JA 4IX9A 3WGOA 3SS8A 4OAQA 1PJAA 4PRZA 2ZB4A 5K51A 3PNMA 3V7WA 3HG9A 4DKJA 4UNIA 2YOFA 4WBNA 4LY6A 1CULC 3A0BC 3ZW9A 4A36A 4ZYZA 1ZGJA 4I6ZA 4X71A 2LREA 1CF4A 4CTOA 1ZQ9A 4XDGA 3CSUA 1DP7P 3QU2A 4E07A 2JMWA 4N3NA 3A2KA 4CMIB 3STXA 3KEYA 2EB7A 4R1UA 3A4TA 4O4LB 2ZTSA 3GLHB 4OIRF 2DFNA 4HV4A 3K96A 4ERNA 3D5EA 2CVHA 2ZI4A 1QE3A 5D3ZA 1YJBA 1MG0A 3NAGA 1QFZA 5KOYA 1MIJA 3ZYZA 2H1LA 1PG5A 1EK2A 3N8NA 2CB9A 1PL6A 3AHIA 5H5JA 5CNIA 1P4WA 1P81A 4XH9B 1ZGCA 2X7HA 4ERXA 3KSBC 1N5DA 1XQYA 3IFSA 4ZRDA 4HKTA 4IZHA 4C6TA 1H9BA 5F35A 4NU6A 3NBZC 1RKUA 1ZH8A 1X7DA 2Y31A 1UBFA 5L3QA 4C1NA 5L4SA 1TLLA 4U7HA 3DO5A 5EHZA 4HLXA 1EVQA 1WZIA 1Q12A 4RPKA 3L6CA 3L4KA 3H9CA 2LMDA 3J7AC 1GVJA 4G9EA 4I4CA 3GR6A 4MCHA 1F7VA 1OKKA 3PFFA 1BN5A 1U04A 4U2EA 1N5JA 2VC2B 4ZDJA 3CH5A 3BPXA 1TQMA 3GBSA 2XSJC 1CSEE 3AG4H 3V2UA 1IL0A 4E94A 1LJ8A 4DNOA 2H65A 1QRDA 1CR2A 4I9NA 2R7SA 4ZVQA 1NRXA 1JIUA 2XYRA 5IVIA 2A9QA 4A1OA 1MX5A 4FFPA 1UT8A 1C29B 5HWSA 4XTRA 4NSNA 2VTBB 4V2UA 5CX1B 4ZVNA 1LLQA 2HYIC 3LDUA 1PFQA 1TZLA 5CVUA 3DDOA 3LU1A 3ITEA 5LZ7A 4IDGA 3UJCA 1CLEA 3U0VA 4M8KA 2H2WA 1T5LA 2P4SA 3ROZA 2X8JB 3HDGA 3BVPA 4URZR 4Z6YA 1TA4A 2EDAA 3H0CA 3A25A 3R9XB 2ZJ6A 3TBHA 4PN7A 4QSMA 3SBXA 3MMSA 1MGPA 2V4MA 2XWQA 1DBSA 1DBWA 4I1SA 3ASVA 5DIZA 3ISPA 1SBCA 4A91A 2VSYA 4MLPA 1OFTA 2P3LA 3ECOA 4UD6A 1FYDA 1UK6A 3R3JA 2AN4A 1ULSA 5H6RA 3L06A 3KFVA 2A30A 1LXCA 4PJNA 1Q2UA 3UF0A 5CYGA 3IAM1 3DFKA 3PD7A 2XQGA 3BXPA 4U7DA 1KWKA 4C29A 4JUIA 2HHLA 2Z5FA 2W82A 1UMCB 2D5LA 4F1WA 3NBYC 1ESDA 2G9ZA 3T4XA 5E2AA 2EYUA 3HYRA 1ND5A 2FDCA 3PEVA 2TRTA 1YB5A 5T6BA 4HUQB 2LR0A 1LJUA 1XKLA 4FT8A 4MV6A 4JSTA 4BVHA 1MOPA 3PUZA 2I8CA 1WRJA 1Z2DA 4DA7A 4KOAA 1ZYRF 1TBXA 3IE1A 1T29A 2ZAMA 5AXAA 2P2YA 1ON2A 4RL6A 2K02A 1K8XB 1RXYA 2HS5A 3IR6A 2W2XA 3VH4A 3V4GA 2X0RA 1F2UB 2AJCA 4RA2A 3BTOA 5IKEA 1UDRA 4X1IB 3KTFA 1H0MA 5BSKA 3GFMA 1A8PA 4P3OA 1YS4A 2W2LD 2I2BA 5FOQA 5IPFA 3ER6A 3O03A 2BGLA 3LUJA 1GZVA 4H7PA 3K8ZA 4QXRA 3G2PA 4IXMA 4FYMA 1G2IA 3J80A 3K4HA 5JHGB 2ID6A 3VR0A 4DA0A 2BBTA 2VJYA 3OE7D 3C2GA 3RVPA 3UB2A 3QYJA 1Z62A 1SB8A 4HX2A 4RXTA 4A0QA 3DLHA 2Q3BA 5F7JA 1T2UA 1ZMXA 2HM7A 4PTZA 3OZFA 2HMSA 1YRNB 1FT9A 5HBGA 4DT1A 5AOCA 1RZUA 1MOSA 5DIFA 2NZ8A 3HDQA 4EL0A 3ADDA 2I65A 3FGZA 5T41A 2ACJA 1YJNI 5BSVA 2V1DA 4ZDOA 1XEXA 1GDDA 2X6WA 1YNOA 5ILQA 4Y7NJ 1EH6A 5D6EA 2LLKA 1DMRA 4IIJA 2A0KA 4ZICA 5BMVB 5D5VB 2RDPA 1E61A 5K0SA 2JK3A 3WFJA 1SVSA 1UPFA 1XLWA 4O3FA 5KX5F 4CDGA 2M2EA 1X2BA 4EG6A 1AHNA 1RMYA 4N6NA 4GPIB 4I0WB 1RKBA 1TVCA 2IEYA 4YRPA 4P7JA 2LR8A 4LY3A 5LN1A 2HEGA 3UK1A 1JJBA 3IHKA 1M2EA 4XWTA 4BIIA 5KAIC 3H9UA 4QBHA 3M4YA 4U1RA 4Y9TA 1V26A 5JZMA 4MOWA 2L69A 2ERYA 5DD8A 1XJQA 2P65A 3I3SR 5DNYB 2BTOA 3JQ9C 5FGMA 3PBKA 4TMKA 4F46A 3FNBA 3N7TA 1BOOA 5LKAA 1TL7C 3H87A 1B0ZA 1CUVA 1RXUA 4PEVA 1HLDA 2I3ZA 1H23A 4DYHA 3RIRA 5E8GA 1S3SA 2Z1MA 4BNVA 1NBMA 2HPAA 3I2HA 4OXNA 2LNDA 2GPWA 2WM8A 5WRFA 2Q6TA 4DLRA 1ZOOA 5F1RA 1JHXA 4FHGA 2Q2WA 4HOYA 1GGHA 5JO9A 5ALDA 1OCRH 1BA3A 3A31A 1C7RA 6Q21A 2WU1A 2EZUA 4BKPA 1Y42X 3ZVKA 5SY9A 4EEXA 3GW2A 1Z5NA 4XKBA 3CZAA 1DMSA 2J6CA 1U3VA 3V7SA 2EA4A 3JZIA 4BEBA 4WLVA 1BFKA 4LY0A 2SCUA 3KZKA 1KO5A 2J3JA 1PSWA 1LUAA 3ZS9A 2Q8KA 1Z4KA 3E61A 1CDOA 3WO1A 3BD7A 5JANA 3PWKA 1CEXA 2PRJA 2I2AA 4JX6A 2C97A 4RF2A 4YWHA 3OYEA 5ALTA 4IF4A 1WWKA 1X80A 1MW9X 5JQWA 1NIJA 1L7OA 3IUQA 4G56A 1I50J 3RF7A 2XHZA 2C6YA 4G9GA 1ISFA 2R86A 4UM5A 1PNVA 5M5BA 4BRSA 4PIPA 2R5ZA 2JPBA 2ZMEB 2H2FA 3EIXA 4A0XA 4X41A 4B7CA 2GCGA 2DSNA 2G7UA 2P9GA 4TKUA 3JQBC 3OMYA 3HUEA 1C9KA 3DYIA 3F4BA 1W52X 5EQDA 1TM5E 4RD6A 5I4IA 2J46A 3EZNA 4UUPA 4TXJA 2OLEA 3X1YA 1S7EA 4TM7A 4JODA 5B7NA 1FTWA 4G5XA 1HFWA 5J1RA 4PPFA 3FBWA 3WU0A 1YD7A 1U0FA 3BCBA 4GM4A 2GEFA 2GN0A 2L18A 2GF9A 4CM9A 3HU5A 4GSLA 1XTIA 5FLXZ 3NHFA 1PT7A 1W19A 2FJ1A 3KB6A 4B0OA 3NHJA 3HOUJ 4MLDA 3V8EA 4ESEA 4XWWA 3EETA 2CLOB 1AD2A 1YR7A 1JNYA 2PZAA 2KZGA 5DK4A 4P81A 4KWEA 1L5WA 3U19A 1Z8DA 2WSSA 4HQLA 1YMUA 1V5IA 3Q0WA 4A03A 2XRZA 4ZVRA 3LOCA 5GPCA 1K6JA 3EHDA 4B3SB 3OM9A 2CXXA 4DSUA 3F90A 1CP2A 1XA3A 2O2HA 2IYQA 4CI0B 4BX3A 4UD2A 4OLJA 3ABMH 2OGZA 4CUGA 1T2AA 2A5DA 4G6QA 2WD7A 1X94A 4UUTA 1FFCA 4EUSA 4P0PB 1AXRA 2FJPA 2CJPA 3JASA 4PX9A 1Y8QB 4GX5A 3BWMA 3O3OB 2CMDA 2ZSEA 5EXTA 2W6MA 1Z6XA 2GAJA 4Y2TA 4F1KA 5DW0A 3CMCO 4TSFA 2I3GA 1JWAB 2AX4A 3O8OA 3R3ZA 4OAZA 3UYLA 5L3EA 3E1GA 4UC0A 5HNKA 1MHPA 3J7YJ 4NYJQ 2EV9A 2UAGA 2GPJA 1JBKA 3E2PA 1QPIA 3VSKA 5FJ8J 2BVNA 2JD1A 2WSBA 1B9NA 4ICIA 3DMRA 1E3IA 1HG0A 3TXYA 5CT6A 4DR3B 3CG4A 5KS2A 3IQDB 4OMUA 5GP1A 1RLOA 4DARA 3OPNA 4N41A 3C5VA 4M0UA 4FQ8A 4ER6A 1SHZA 2JIMA 1QB8A 2QTZA 4YFXF 1PJ2A 3ZCRA 2EJTA 2CK3D 3PX3A 2ZBEA 3EVBA 1HI9A 4G8JA 3EXFB 3LPMA 4BLTA 1JGTA 2GVZC 3HPGA 2DTDA 4DB4A 2I0FA 2O0KA 2VQSA 4WF2A 4UZFA 2JASA 3FZVA 2C9OA 2PD4A 4FJ1A 3SF8A 2XF6A 1ADGA 3KP3A 3E1KA 5ERYA 1GNQA 3IV9A 4AJ9A 3TSOA 5I7FA 2EKLA 3WTUC 4PTYA 2HU8A 2M7AA 3ED5A 3A58B 4ZD6A 1VLJA 5EEHA 3SFVA 2CU7A 2JA7J 2LE0A 1M76A 2QTVA 3PU6A 3MQ4A 2XUIA 5IDQA 1MU0A 2WHEA 1AHIA 3LWBA 4KH0A 1JVBA 1E9SA 4WCFA 5K7FA 3SC2A 3R41A 4EJFA 2Z2ZA 2KHMA 3WYGA 5E9AA 1IEWA 1MBFA 1S2LA 3BXXA 3BE5A 5P8WA 4KUMA 4FYHA 1COWD 1NW7A 3L0YA 9ANTA 3S15J 1K2WA 3HBLA 3FAKA 3GDGA 3JSPA 3R6TA 3F8BA 1Q0LA 1RCTE 1SR8A 1TO6A 4ESHA 3C97A 3T7EA 2P81A 1IK4A 4RBOA 1PR0A 4XQFA 1H4VB 5KAPA 3EG9B 1J0XO 4NEQA 4JI8B 2C9YA 4HUQA 4MCJA 3V32A 1B59A 3CA8A 5GAJA 2W6OA 2Z16A 2GEJA 3WA7A 3EQ7A 4ZQEA 1DQPA 3SZ3A 2P0WA 3H92A 2DK8A 4DNPA 1HORA 3UAYA 2CL7X 3ZVRA 3RAJA 5DM7F 5BORA 2V6CA 4QJ4A 2RB4A 1OCCH 1ML3A 3D5LA 4KGDA 4PSKA 2B0LA 3RKWA 3IRVA 3KQLA 4RADA 2R5NA 2XNDA 5KINB 4YRMA 3SEAA 1I7QB 4CT5A 2PJDA 5BWOA 2IH5A 1S6LA 3DMDA 1P33A 2VQHA 3LK7A 4HXGA 3GG2A 4QEZA 2Q2EB 4HTFA 3TPZA 1ZKGA 3GXOA 3MMPA 4PSCA 3NZEA 4QUDA 3UMJA 5FPKA 3DVRX 3QOEA 3IQGX 2FAXA 1WTCA 2MBFA 5FKOA 3ETEA 3OA0A 2G71A 2ACKA 4CI9A 5DM6F 1VOTA 1N77A 2Y4OA 1S89A 4TWAA 4EAAA 4HGNA 4GKBA 1P4JA 2XV4S 3ND8A 3SX4A 4DNCA 1CY0A 2CSUA 2JAOA 5DLQC 4ZJYA 4B6EA 4X6AJ 3B9QA 3G9TA 4C4AA 4NBSA 3OICA 1NBAA 3J7ZI 3WLQA 5BURA 2RARA 1YRNA 4UCWA 5T5QA 3ZPLA 5BRJA 3A9SA 5AI6A 3PXUA 4AWXA 4FCCA 3PDIA 5B3JA 1NJ5A 1MRSA 2DGDA 4K6KA 2ORVA 4R69A 3O9ZA 5EIEA 2ZBVA 4INOA 3K16A 1TQPA 4YRTA 4IMRA 4OHXA 3REQB 2C2MA 1M8JA 2ECFA 3HMQA 4ZJZA 5H59A 4NYMR 5FH9A 1E79A 2BGUA 3IAAA 1EH7A 2FPIA 1ORRA 5D2CA 2IITA 2FETA 1CZLA 4INAA 4OU5A 3CR7A 1JT0A 4LRQA 4MULA 2OOKA 2O0LA 3CLKA 2UVQA 2IIBA 2JI7A 1JAXA 1FCJA 1W9HA 5IC5A 5CYVA 3LRTA 4JQYA 4P5PA 5T64A 2FFJA 1H66A 3JTEA 4P5DA 2BFNA 2RD2A 1Y5MA 3TOZA 1WMBA 1IWBB 3PFHA 3VVCA 2ZQYA 5J4LA 4TPKA 3D3KA 3O8NA 1EG2A 1JIKA 1U7OA 3FG9A 1KI7A 3S2HJ 3KP1A 1Z0SA 4Z2AA 4MRNA 2XYQA 1RWOA 1T0BA 2VT2A 1Q84A 2QP9X 3CURA 5B1HA 4DANA 2AT1A 3OHMA 3VQTA 3PA8A 3E3NA 3IP8A 2JLZA 3WE7A 2L9NA 1CRZA 2XW6A 3PGXA 3LUGA 5JS6A 5CIQA 2AFIB 2H4ZA 3FXOA 3IH2A 3DE5X 4FFBA 5DRTA 3FJ1A 4D5EA 3TCKA 1PVEA 4FYVA 5A2QA 1JUMA 4F06A 3EZFA 1QF6A 4WRRA 5C4IA 3ZXSA 2ZRQA 5CXUA 1Q0SA 2Q4BA 2PFSA 4BKQA 4MMZB 3GO5A 3N53A 1VIMA 1FTTA 3D3WA 1P73A 4KDEA 5HRAA 4PVCA 3RFCA 4KAXA 2ZS7A 3HLYA 4Y4RA 4Q4CA 4QLCU 1VE7A 3SFZA 3EWSA 1JGGA 3TEFA 3OQJA 5JEDA 2BEWA 3MIIA 1GTSA 3GLTA 5EIHA 2OF7A 1EFPA 4BO1A 3IX7A 2ZUWA 3JAWA 3OZCA 3ZZ0A 3LOUA 4G37A 3FHCB 4OI4A 5FBVB 1IY1A 3KJHA 3MCZA 5L3ZA 5KQSA 4NBTA 3IVMA 4ECEA 5FUYA 2QPAA 4B1FA 3QG5A 4C3HJ 1WVIA 1KI6A 4ZDIA 1QWOA 4PG6A 4URUR 1LRLA 3PHGA 4QDZA 2JBAB 2XIGA 2ZZKA 2JEZA 1WDMA 2XJ9A 4P3PA 3EQ2A 2FZWA 4QM7A 4FZRA 3RIXA 4PWZA 4MZDA 1D07A 3ICVA 3UJBA 1GVHA 3IKJA 2H6BA 2R1VA 4JNKA 4TUYF 4WY2A 4XUCA 2V1NA 1NQ5A 3OQMA 1L7AA 2EFWA 2QMUA 1B0PA 3DBRA 3QA3E 2ZYUX 4MINA 5ESXA 2HJRA 4G24A 3GFSA 2AC2A 4DBZA 4O6JA 4IJWA 5I7SA 2R5YA 4C2AA 4GG1A 2ZUDA 4KXXA 2R0QC 2OILA 3ULKA 4W4TA 3RJTA 2XYGA 3O83A 3GFLA 4JLSA 3EGVA 1KFEB 2ZSAA 4NB5A 3ZUGA 4YUVA 3IH5A 2GNPA 1Y8QA 3MCVA 1GVDA 3VOBA 2AEFA 3SJAA 3PQFA 3DM9B 1YW7A 3HJEA 3RYCB 3ZXIA 3GZNA 3CF2A 1TU0A 3LAPA 2CDRA 4HEA1 1M83A 5JAMA 2C1ZA 4W1RA 3K2QA 4I6EA 2RGRA 1QQ5A 3A6HA 1GU0A 5KVAA 1Z1DA 1N9GA 2IWHA 3A9TA 4H0NA 3U7IA 3HB0A 4MRMB 2BZTA 2WHQA 2ZXEA 2H5JA 3SZMA 5A2GA 2HQAA 2A1TS 2FP4A 3LCCA 5HS9A 1E5QA 1YX3A 4M4SA 1WSDA 4M0DA 1HKSA 5CVRA 3KP2A 1QNTA 4EM1A 4GI5A 2GLTA 3LQ4A 4RBNA 4F3CA 3CQ9A 1J09A 3T3GA 4LK0F 2OV8A 2QLNA 1N2IA 3DZGA 2PGAA 5I9NA 3PX2A 4QM6A 3VO2A 1E4EA 1PR2A 1FOKA 2AUNA 3VJMA 3ESYA 1IRFA 1D2HA 3GZTB 1ZN7A 2VODA 1CIPA 2AKEA 1AU7A 2FR0A 3ILVA 2IYLD 3OD1A 1JIVA 3SHVA 3Q1LA 4D0SA 2QL6A 5G40A 4UHHA 3UK2A 3OJOA 1G60A 2AOUA 1W85A 1SD2A 4NBVA 3MJCA 2RHDA 3AVQA 1MB9A 2GK4A 1HA8A 1DXOA 4O2BA 2KB0A 2A84A 5DD4A 1C80A 5E6UB 5ABPA 3A06A 5IRCD 3QJGA 2FSUA 1NVVQ 4UHDA 4U8HA 3IALA 1BU8A 2ZT7A 3RFXA 5AVQA 1ZICA 1ZK1A 2FOXA 1DC7A 4XWYA 4Q9HA 2WVHA 8AT1A 2Q2OA 3CCUI 3CBQA 3X1ZA 1C1XB 5F1KA 1K7CA 5EHGA 4TX1A 3VSLA 4BNNA 3IIMA 5EG0A 1HDIA 2JRMA 3A2MA 5B66C 2YZ2A 1YTYA 2IDJA 3K4KA 1SD4A 3AJEA 2UVPB 5M34A 3PI6A 4MUFA 3QWIA 4AUKA 5JV5A 5IJ9A 1W581 1T3GA 4LDAA 2GFQA 2W4MA 1W6RA 2FJ0A 1GT0C 2PYIA 2EKPA 1BHSA 4D98A 3KV1A 3GT3A 1KPGA 3TNDA 1XHEA 3V7RA 2Z2YA 3BK1A 4LOKA 3SYNA 4UU7A 5EFOA 3OX3A 5FA5A 1N0IA 5AVJA 3T3OA 2D1RA 1DJPA 5I8WA 4JOSA 3P9QA 2NYVA 4OI2A 1DTSA 4XCQA 3R7WB 1KMHA 2JK0A 3QPWA 1KXJA 2PX4A 4MQLA 4LX8A 3WLLA 1R0BA 2PM8A 5IT5A 1W5EA 3ZY3A 2FP3A 1FZPB 1QHIA 3FCYA 1P5FA 4LXXA 4MYHA 2KMLA 3CUUA 1F17A 1T9BA 3L8EA 3WICA 2LRDA 1AGRA 2ZCVA 3C5WP 2POQX 2DTEA 3KDAA 4TTSA 3ZHBA 4G63A 5BP7A 1N1DA 2WYIA 3VISA 3D3JA 3HUDA 2B9EA 3DVLA 1ZRHA 4GXTA 1JI8A 3V6MA 3OUUA 1SEUA 4BJ6C 4LV6A 4DIUA 3F78A 1KU7A 4LIPD 5CA0F 1NI4B 3I9KA 4IL5A 4CG0A 5JH7F 3QKRB 1TB4A 2HWUA 2G9WA 4KDPA 4U39A 3FM9A 4GECA 3KXPA 3GLXA 5BUSA 5C31A 1ODCA 2GA9A 4EGZA 4H4KC 3JPYA 1A5JA 2GM3A 1JUSA 3BT7A 4C0KA 4O4HB 5CH3A 4RTQA 2B6HA 1NHGA 5ILSA 2R96A 1Y8RA 2DR0A 1PGOA 1Z2OX 3VR6D 1IZ1A 4A0ZA 1NM5C 1PGPA 4O4JF 3HP4A 2VEDA 2IJLA 4X20B 2BEKA 4Q1VA 2WBLC 3P0EA 4FILA 4B81A 1Q20A 1CQXA 1YACA 2BE5F 2VKHA 3RTCA 4RLHA 4B5LA 2V7PA 1KEVA 2I6TA 4Q3BA 2Q0QA 4N82A 2QUFA 1GQ2A 1NMZA 5JXJA 5CKTA 2H52A 4RNCA 4HFRA 1P44A 1PTJC 3W8FA 3OE5A 2YYZA 1BXGB 3DS8A 4WSOA 2ZJQF 3CLHA 1WBBA 4YIIA 2OHGA 1UHMA 2AW5A 3GNLA 3KOOA 4NYIR 5K3FB 2DSTA 1S7CA 3JR7A 2WJYA 1UPCA 5AOVA 4BNFA 1AKHB 4WNAA 1JQ5A 3WK8A 2J4CA 3EIFA 3LSGA 1ECFA 4ZYWA 2KJBA 2XT6A 4LVCA 2PAFA 4DIEA 1LNQA 1Z7WA 1L5YA 3G2IA 5LQJA 4MNUA 1R8YA 2VDRB 1M0TA 1GZ3A 1YU9A 3CWCA 4JJIA 2JLUA 1E32A 1TE2A 1FU4A 1SEVA 1K83J 1X7XB 1IJFA 1JZSA 1O57A 1K1EA 2BDUA 1NYRA 1EFTA 2IYZA 2ZYVX 5JALA 1ZUD1 2PZ8A 4GP9A 5DASA 3QQPA 2RBKA 2IAIA 3BG6A 4OQMA 1A71A 3HU3A 1W76A 1CYEA 3RO7A 1REPC 3DZHA 1IPHA 1HDGO 2Q1XA 3GRCA 4B6JA 4ND8B 4ZMSA 2VK8A 5JRZA 3P9PA 2I10A 3TDUC 2GARA 3W5SA 3DLLF 2IHJA 1XSXA 4ONEA 3BJZA 2X41A 3SHWA 4C0LA 1FTYA 1BN7A 4UOQA 3H6HA 3K8OE 1IOVA 4JI4B 2GBIA 5L9AA 1QZ3A 1EJBA 5KAFC 3PD1A 2Q99A 1BE8A 4R2WA 2E5WA 3NIWA 2Q2QA 4W7HA 2XGXA 1UIMA 2CBZA 3HVIA 1SOUA 1I5ZA 2GN1A 5BSGA 1TW3A 3OEWA 1H2EA 1NJGA 5FLVA 4OAPA 1ACLA 3CXRA 4UFPA 1KDOA 5JCPA 2Z04A 2ISZA 1T0JB 1RJFA 2WWYA 1KMIY 5IJ0A 2RGNC 3UA4A 3OSUA 3RI4A 1XRLA 4L85A 3U44A 2XA1A 1UKAA 1XYGA 3OF5A 3T99A 4I50F 2DKNA 1NNUA 3EA0A 3FR7A 3G9UA 3O26A 4MVJH 4Q01A 2BT4A 5AW6A 3ZC3A 2G7ZA 1Y8CA 3ZE7A 3R7SA 5LQCA 13PKA 3WTXC 2JFVA 2AR7A 4XVCA 4FIDA 1I24A 7YASA 2R1UA 3SYMA 2EWVA 2N1MA 4F8YA 2A61A 1FC3A 1LI7A 3WO0A 1UWLA 1OXSC 4JL5A 5KTNA 4LYFA 2EJWA 3R9KA 4UUAA 1DRKA 3O94A 2K86A 5IW8A 3UICA 3BM5A 1I3QJ 4N65A 3R7BA 3A1CA 2P78A 5ETJA 3ZJ5A 2PVSA 4AVZA 1QZYA 1VA4A 4O1MA 5ALIA 3HOSA 3URKA 4PINA 3UV6A 2SKCA 4O0LA 1ZMBA 5AH0A 3C1DA 1SY7A 5G3YA 2ZBFA 1G3WA 4ZYTA 4DZPA 5CQEA 2JGMA 3OLQA 2V98A 4GKKB 1LBSA 2CJXA 3GBGA 2V6MA 2XOKA 4IFEA 1MMAA 1TRHA 3BR2A 2Z8YM 1I1OA 3E7DA 2D06A 5AIAA 5TIIA 4IRXA 1XCJA 1D0VA 4FP9A 1XXHA 3QVOA 5DV9A 3QPVA 1QORA 2NYUA 4QG3A 1G8YA 3DL4A 3M5WA 2LFBA 4WY8A 4CUZA 2YDYA 1PT9A 3OL3A 1EH8A 1NDHA 1W46A 4QDUA 2MMCA 3R40A 3MWEA 3G6WA 4ZOAA