1XDSA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) and 11-deoxy-beta-rhodomycin (dbra)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
336
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGERPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDDAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
molecule keywords Protein RdmB
total genus 101
structure length 336
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xdsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xdsA03
2A61A 2MBFA 4JBAA 2PX2A 3CTAA 5L3FA 2JHPA 3WTYC 2AOUB 4L7VA 3ECOA 1XGOA 2ERCA 2P5LC 4KN7X 7MHTA 4ER3A 1Z1DA 4A5MA 4DQ0A 3RKXA 3RIEA 3RI4A 1ZHFA 3ML6A 1ZLKA 5FTWA 3ERCA 2M5WA 3P9NA 5LQNA 3TGNA 2HTSA 4WX9A 5K05A 1QO0D 4H0NA 5L3CA 2KIMA 4CTKA 5H6RA 4HDUA 5DXJA 2CQKA 3HSEA 5E8IA 5KK1A 5DTMA 1NHAA 1S7AA 5DCMB 3P97A 2ZIEA 1DL5A 3WODF 1D8JA 1VBFA 2RQPA 3LECA 2ADUA 4DNCA 4E2ZA 4LG1A 4HV6A 2RDPA 4PYIA 5EMLA 3I9FA 3FF5A 1F9NA 2OA4A 4ON0A 1ZQ9A 3M6WA 4EM2A 3KP4A 2H11A 2PXCA 5DTRA 4ESBA 2B25A 3EYYA 2ISYA 1VTNC 1TLHB 1EAMA 1NW3A 5B1SA 4Q47A 3E5UA 3PFGA 3PT9A 3QRFF 5T67A 2QUFA 3S68A 4PYOA 2HFHA 1KPIA 4R8HA 5LR6A 4DF3A 5CD1A 2MH9A 3OU7A 3KCCA 3DFGA 4KT5C 4ZTBA 5EEGA 2GLUA 5LEJA 3WSTA 2AR0A 2ZTHA 1BJAA 2JHCA 2Y0MA 4ZH4F 4IRIA 5EMKA 2VN2A 4HG2A 3E6MA 3RYRA 3IRQA 5LQUA 5JI6A 4OMZA 3CO7C 1H0MA 1K79A 3GGDA 3OFKA 2V1DA 4X41A 1MJ9A 3G8AA 2G70A 3KP5A 2RNJA 4QTTB 3P2IA 1IN7A 2K86A 1G60A 2WC2A 3LA2A 1XDZA 2F5EA 5HS9A 2NYXA 1FYKA 2KRFA 1FPQA 3SVZA 3BWYA 3QOXA 4GOLD 4A6DA 5LQCA 2Y1WA 5HIJA 5D5WB 4LWPA 3C6MA 3KP6A 1ZYRF 1JG3A 3MZYA 2XAHA 5BMZA 2A6EF 3Q87B 5ERIA 1BI0A 3TKYA 2NP6A 5D5VB 3GRVA 1D8KA 2YXEA 2IIPA 4A6EA 3EDPA 3MQ2A 2YU3A 3DP7A 4K2EA 5BPIA 1B1BA 1VIDA 2DULA 2G9WA 1W5SA 5FADA 2QENA 4RTQA 2CMGA 4QDKA 3EQLF 3UWPA 2A3SA 3D0SA 3I59B 2IDJA 2YTZA 3BKXA 2IW5A 2OU2A 1RJGA 3PVCA 3X0DA 3BWMA 5E9WA 2BGCA 2PFBA 3FPEA 1P4AA 1WZNA 1ZG3A 3EETA 1G8AA 5F64A 2TDXA 1TNSA 5F1RA 4R1HA 3DMFA 2FBKA 3TDZC 3V8LA 3WGGA 4EGZA 4I98B 3LKZA 4BP1A 3T7TA 1HKSA 3BJOA 5LRRA 5D5UB 4U7PB 3F6VA 2A6HF 2LKPA 3MCTA 2IFTA 5JVTA 1XTPA 2PX5A 2MLGA 4UVBA 4C04A 1CF7B 4EJTA 1WY7A 1K78B 2GIVA 1U3EM 1SUSA 2YX4A 4HW0A 3FRHA 5C0OE 3CBGA 1YYVA 5ICEA 1M6YA 2JJQA 3C6KA 2HDCA 2QBYB 1K6OA 2LF7A 1YZHA 1IRGA 1SVUA 3MWMA 5FWDA 4L5IA 3M33A 2H6CA 2XBMA 4MWZA 4RYLA 4POOA 3WTXC 2KJBA 5HS8A 5LBQA 5A2QK 1VPTA 1QZYA 5CYVA 4KDRA 1R23A 3U9GA 1W7PA 4PYQA 2Z6AA 3TM4A 3BXOA 5E1WA 3P8ZA 5K0LA 2DPMA 3FUTA 1R5GA 4CKEA 1BIAA 1ZARA 3GEZA 3KQWA 4ZZDA 2ZVJA 2C6YA 4ASNA 4UVAA 4F7ZA 3R6TA 5HEKA 1BIBA 1XCBA 5H6QA 3IWFA 1KR5A 3MEXA 1CF7A 3EGIA 1KU3A 2ZNYA 1IW7F 4AVPA 3IC7A 4YUXA 2I6GA 1H9TA 3EVAA 1LDDA 3I64A 5BW4A 4M72A 4FT8A 2HEOA 1Y0UA 2OXTA 2EFOA 3UJ8A 1IN6A 2F5CA 1EV7A 1AV6A 2O6GE 3D2LA 4MGRA 2C7QA 3R24A 3CDHA 2OQRA 5GWXA 3TKAA 2B78A 1KXZA 5KYGA 5FHQA 5M5BA 1KHHA 4PWYA 1BKYA 3P2KA 1UCRA 5T64A 4AIJA 2XKOA 3TLJA 5CVIA 1ZKDA 1IXCA 2H1RA 3FXUA 3OOPA 3EVDA 4RGSA 5HDGA 4LK0F 2FHPA 2QBYA 2FCAA 5DD8A 3LAJA 1JE8A 1IXSB 4H0EA 2VODA 1FNNA 3LBYA 2H09A 3GFMA 4GC5A 4DCGA 2XIGA 1OKRA 3TM5A 3CC8A 3KQOA 3WU0A 1MDMA 1LNWA 2O06A 2GPYA 4Q4ZF 3A27A 2I9KA 3ZQ7A 4GOMD 1P92A 2ZSUA 2YQZA 5CUQA 1JTFA 5HOQA 4RV9A 5KQSA 3K1MA 2IP2A 4FT4A 3EGVA 4YG2F 2QYOA 3BPVA 1AQIA 1KIAA 1NBHA 5FCDA 2M45A 3GW2A 2OKCA 4OMYA 1YW9A 5K0BA 3F3XA 3RPQA 3HVIA 2B0LA 5K01A 4CDGA 2DLLA 2RV8A 3MERA 3KR2A 2JSCA 4PZJA 3UJ7A 3K2ZA 1BC8C 4P7JA 4A5NA 2PXAA 5D6FA 5CVUA 1SQGA 2YXDA 4HH4A 1G55A 2K27A 1FJXA 1IAWA 4EQZA 1IRFA 5FWAA 2E7WA 2K4BA 1IY9A 4DQ2A 5E18F 4PYMA 2AOUA 1STZA 4X61A 1F5TA 10MHA 3IYLW 2GAFA 3VEPA 3JW4A 4EV0A 1USSA 3EVCA 1OPCA 4HSGA 1NW6A 2VE8A 1VQ1A 2ZFWA 1RIOH 2W24A 4L9VA 4MQ4A 2QRVB 1G38A 3V4GA 4OIPF 4S04A 3KETA 1O7FA 2WTEA 2P8TA 1HKQA 3BKWA 1I9GA 3LDUA 4QPNA 2GQQA 3FUWA 2WWYA 4IXAA 3GRRA 4RAYA 3DEUA 4O6JA 3DKWA 4KIGA 4YIIA 4E32A 1WI9A 1R8XA 3ELUA 3V7CA 1HW2A 3EVFA 1R1VA 2PSSA 3OZTA 3EMBA 3ZMUA 4A2UA 3ROUA 3HCEA 2YVLA 3IHUA 4P7GA 4G6QA 2O07A 2B2CA 3BY6A 2IPXA 1NW5A 3KE2A 1REPC 4AWXB 1UFKA 2HMYB 2HZTA 5E17F 4I2OA 4KMUX 3C1DA 5EZSA 2XROA 5G02A 2BM9A 4C06A 1JTEA 1L9KA 1KQ9A 3Q7EA 3ELYA 4WF2A 4UUVA 2BEOA 4IWNA 3RYPA 1WXWA 3F8BA 3FRIA 1HXDA 2G71A 3TQNA 3F23A 4C03A 3EEOA 1ZGJA 2PJPA 1UHWA 1Z6TA 1KU9A 5K8VA 3KPUA 3N4MA 4EJOA 1DDNA 5K0NA 5F2OA 4ZYHA 3IKTA 1GHCA 3A4TA 4RAZA 1ZREA 5K0FA 2EFQA 4XUEA 1HSTA 5HDKA 4C4AA 2VC1A 1TPYA 1JHHA 3W6JB 4BHCA 1JQ3A 2EG5A 4X1OA 3WGHA 3TRKA 4DA4A 3HRSA 2ELHA 3DR5A 5DX0A 5EKUA 5ILVA 5TRDA 1NE2A 4OIRF 4LD5A 2FEZA 2HNKA 2VDVE 2BE5F 3HCFA 1TNTA 1KYWA 2PXXA 5DTQA 4E70A 1WQ2A 3KQVA 3JAMZ 3BT7A 1OMIA 2X4HA 5IT9Z 2V1UA 3VOEA 1XJ5A 3M4XA 3TPZA 3HSFA 1X1DA 4UHTA 2JZYA 2QE6A 2ZKZA 2ZO4A 9MHTA 3K0LA 4HAMA 3I58A 3BWBA 2NXCA 3KLNA 3PFIA 1U5TC 2V7EA 2GZWA 5CVDA 3WTWC 3L09A 4M6XA 3QU3A 1HW5A 5BP7A 5FD5A 4RTJA 1LDKB 4GQBA 4IRGA 4E33A 1YFJA 1XMAA 1BOAA 3FXQA 1GXPA 2IT0A 3F8NA 1YW8A 1VL5A 2FBIA 1S29A 4E2YA 3KQMA 2EV6A 4OA5A 3A7DA 5E8GA 3U1DA 3GYHX 3B5IA 3LAPA 4EJVA 3F22A 3RPUA 4XSXF 2FRXA 3RIRA 5HOOA 4U0YA 3E7PA 4ER7A 5DM0A 3AXTA 1YFLA 5D8KB 1BM9A 3HVKA 1QQIA 1X3UA 3DLCA 1XGNA 1YF3A 2XRNA 5DLYA 2EWNA 2YSRA 2AXLA 3DXZA 1O9HA 4Q48A 1QZZA 1JQEA 2VP3A 2BR4A 2UZKA 1DUSA 2AZTA 1O57A 2LNBA 5EG5A 3K1NA 1J0RA 2COMA 4BYYA 3RTRA 1VE3A 2AOVA 3M6XA 2L4MA 4G7ZF 3UJ6A 1WXXA 2ACJA 2V79A 5BW5A 3EGEA 4M71A 2YXLA 4HYEA 3OU2A 2DK5A 4BQAA 2OBFA 4ER5A 3MFKA 3C0KA 3IWZA 1Q1HA 3J81Z 4IV8A 5E20A 1XDUA 1RJFA 1HW1A 5J8CA 1Z91A 2VBYA 3P9KA 2O0YA 3C3PA 1BC5A 1FSEA 3ABUA 3K69A 4P55A 4A0ZA 4CYDA 5IKMA 3KLOA 2V6CA 3QU6A 2HR1A 5LQRA 4FT2A 1R18A 4RVDA 3RODA 3M6UA 5JUWA 1EJ0A 3BGDA 3NJRA 2GXBA 4NHJA 4M7RA 3PX3A 2FF4A 3UA4A 5H20A 2ZBPA 1MD0A 3L9FA 2Z9OA 3E5XA 2JH8A 2YX1A 1F38A 3CUQA 5HFJA 2NAZA 1SFXA 3QPTA 1BBYA 1HBXG 5EKXA 1R22A 1ULYA 1N2XA 3V7RA 3JWGA 3QV2A 4RB0A 3OFJA 3EVBA 4ESFA 1G8SA 2BZGA 1O54A 2HYFA 2DPUA 4RVFA 3QP5A 3GZ5A 4RGRA 2ZIGA 3TR6A 1ZN2A 3ME5A 2NNNA 4M36A 3ZP5A 3MB5A 2EJTA 3SMQA 3B7PA 1XCLA 2ZCWA 2HTJA 1M6EX 3JWIA 3FHZA 2CKDA 3OV8A 2NS0A 4WCGA 2FE3A 2ZJ2A 3RJPA 1IZ1A 5L3GA 2DBBA 1U5TA 3Q5FA 2VS1A 3B3JA 4L9JA 4R79A 2PBIA 1YG2A 5CVJA 4GO1A 2PG4A 5F6FA 1P39A 2Z33A 3A26A 2FSWA 3BGIA 4RB2C 3J81K 4HOBA 2DI3A 2QY6A 3ER8A 3FXRA 3SZTA 4I0AA 3VC1A 1X1BA 4O29A 3MTEA 3KU1A 4M73A 1JGSA 3BJAA 5FO5A 2HOEA 2BV6A 3G5LA 4GOND 3BZ6A 2FMYA 1T6SA 5D4RA 3BWGA 3G2PA 2QLZA 2NP7A 4B8XA 3G8BA 4PYKA 1LEBA 4RTLA 1G4DA 2W85A 3THRA 4C08A 4M9XA 4XUCA 4MEXF 3EVZA 5CVEA 5DSTA 1N7JA 3LCVB 1XSXA 1JHFA 3ZPLA 4BH9A 2D1HA 4U0WA 4AX8A 3I54A 5DRTA 4HX7A 2DPDA 2XVCA 4BAYA 3VSEA 5DYMA 1I1NA 3ZN0A 2NYUA 3CJRA 2HGCA 5DPMA 3VYWA 4X60A 1I5ZA 2NXJA 3EVGA 2C7OA 3D5LA 5F2KA 2EV5A 3SQNA 4TV7A 3CJQA 4O5VA 3VC2A 1G6NA 2QWWA 3OE4A 4MNUA 3KR0A 4C05A 3WE3A 3DPLC 1R1UA 3B73A 4HLYA 3J80Z 2PT9A 3ABTA 3F8MA 2QQAA 2M30A 3CCFA 3PQKA 1B6AA 3GJYA 4Y17A 4PYJA 2RC4A 2JG3A 4UNOA 3I59A 4WXHA 2Q2EA 1Y8CA 2HWVA 2ONZA 2A5YB 1QYRA 3LA3A 2AN5A 4P7FA 1AOYA 1M0EA 5BXYA 4MEYF 3F72A 1IF1A 3R0AA 2BR3A 2CYYA 1UIRA 4E2WA 1R36A 4R8SA 2VXZA 4CXMA 3LWFA 1YIOA 1RI2A 4LB6B 2FK8A 2IVMA 1XVAA 3HEMA 1UB9A 1NW7A 2IRFG 2VC0A 3LFKA 3A25A 5ILSA 1AF7A 1U2ZA 3BOQA 3KPVA 4F86A 1PUEE 3HRMA 4XCXA 4M37A 3R6SA 2L4AA 5HVQC 4L18B 1FSHA 2P7HA 2UYOA 4I01A 2ZBQA 5HLHA 3FUXA 4BHPA 3JWHA 4G6DA 4CHUA 3KQSA 3V8JA 3ELWA 1SFEA 2IH4A 1ZGAA 1ZAOA 1XCVA 3L2CA 2IA2A 4FSXA 2P5KA 5FUBA 4LB5A 5J8FA 3G3ZA 1ONVA 4G7OF 1B42A 3GRUA 3LBFA 4OBXA 4V0QA 2EJRA 2GWRA 6PAXA 2EK5A 4JQFA 3GZ6A 2PT6A 1RUOA 2P3QA 4ISCA 4AZWA 3I4PA 3QOWA 1ON2A 4A0YA 2F2EA 5HS7A 3FWEA 4Y15A 4CZZA 4N9HA 1KYZA 5EHGA 4YFNF 2ORED 2P40A 1BI3A 2LD4A 3HVHA 3E8SA 2WV0A 3O7WA 1JXSA 3JSPA 3GRZA 1RZ4A 2PWYA 5E1BA 3B3GA 4FZVA 5DT2A 2QRVA 2FNAA 1QAQA 3VFZA 1YQAA 1J5YA 3P2EA 2HKOA 1EQAA 5DUKA 5LGTA 2DW4A 4MTDA 5DX8A 1MJFA 5A2QZ 2ISZA 3EYIA 4DM3A 3C3YA 4LGWA 2ZXJA 1U8RA 1I27A 3KEOA 1VP9A 3FTCA 2P5VA 2O57A 3WE2A 1R74A 2A68F 4GBED 1HSJA 4MQ9F 4OIQF 1TTYA 4G56A 1HQCA 4RVHA 2KJCA 3NWBA 3LQRA 3NTVA 3MHTA 1RJDA 4B17A 4CKBA 1FYMA 3G88A 3KR9A 4OBWA 2F8LA 3RW9A 3GF2A 3SSNA 4EKIA 3T8RA 2W25A 2FRHA 3NVMB 2D2WA 3P7NA 1G3SA 1OYIA 4ZYGA 4Y30A 5E8JA 4DCMA 5D6EA 2HS5A 3M8EA 4PCAA 4HZFA 4PDKA 2B9EA 1FYLA 1ZG1A 3R0QA 3GRYA 1NV8A 2NXNA 4HBLA 1D5VA 1QANA 2R6ZA 2Y75A 5CLSA 1Z3CA 2OO3A 4KFCA 4KUMA 5HZMA 5DEQA 1JG1A 3CUQC 5E8RA 1Q0SA 5L3BA 2ZZKA 3L00A 2E5WA 5FB2A 4ENMA 4O3MA 3EUHA 3VODA 3R60A 3HHGA 3HNRA 3FMQA 3UZUA 2JT1A 1QAMA 1ZH5A 1UWVA 3FTDA 5KVAA 4KWCA 3PX2A 2YR2A 2OQGA 4EKGA 1IN8A 2MA3A 2UYQA 3LCCA 1PP8F 2PX4A 3KHKA 1I1GA 3FYDA 5IT3A 3KQTA 4CO8A 2G1PA 4XRFA 1YLFA 4U7TB 4KIBA 3GO5A 2FXAA 4P58A 1KGSA 2XGXA 1MHTA 2VOOA 2HWKA 3GNLA 1MGTA 1D2CA 5LHGA 1FC3A 4OINF 3LGAA 1UHMA 5BS6A 3B89A 2EA4A 5CCBA 1S7OA 2PY6A 1IN4A 5E1OA 2XKPA 3AJDA 2NNYA 3M8FA 4AD9A 3OE5A 3CLOA 2QM3A 4KVZA 3T1BA 5ICCA 3E3VA 2RN7A 1T38A 4IPAA 2AVDA 1USTA 4BLUA 5EMJA 2G72A 2NNWB 2XYVA 3B3FA 4EM1A 4CGZA 3LDGA 5CIYA 3CUOA 1YS6A 3CUQB 1ZRFA 4RX1A 2WA2A 4PCQA 2P3LA 3KP3A 5K0JA 2EFNA 1EIZA 2G7UA 3UJCA 5EPEA 3TOAA 4KNYA 3GDHA 1P1CA 1JR4A 4YV2A 4MIKA 2UXNA 1A04A 3WTSC 1NV9A 4WVLA 1IN5A 1TQPA 1Z6RA 4PIPA 5ICGA 4FR0A 2OB1A 4DMGA 2Q8KA 3ELDA 5CM2Z 5T6BA 4GUAA 4HF0A 3PS9A 4RS8A 5C1IA 4DKJA 1KQ0A 2BH2A 1YTYA 3DMGA 4D0PA 1V3FA 1ZLJA 3NQOA 3CVOA 3DTNA 1U6GA 4KN4X 5CCXA 2PX8A 3PQJA 2EFPA 5FFZA 2XUBA 1INLA 1WG8A 5GINE 3R0JA 5E9QA 4QQNA 1YS7A 3OZSA 2ZCJA 4FHTA 5EZQA 1B9MA 1XGMA 3BJ6A 1Z7UA 5HDNA 3WTTC 1F3LA 2HR3A 1DCTA 4L5JA 3PB3A 1P1BA 4GOOD 2DFIA 2DAOA 2CWEA 2BYVE 3BUSA 3L7WA 2AOTA 2DTRA 1W7PD 3FZVA 3HCAA 3QPHA 1FY7A 1RI5A 2GA1A 3O3KA 3EPPA 3DXJF 3HYIA 5BQTA 1B9NA 2PQ8A 4QWQA 1K78A 1SUIA 1BC7C 2CSOA 1SD7A 3GXOA 3NMUF 2RGVA 3F21A 3FMSA 4ENKA 4CKCA 4KA4A 4V0RA 4MHTA 3C7JA 4NECA 3HA5A 5DUIA 3HVJA 3HOSA 4HX8A 1B59A 5K03A 3G2OA 5FFXA 3LPMA 3TDUC 1L3BA 3ZMVA 3M6VA 4IHTA 2FPOA 1V39A 5MHTA 2XHKA 2OZUA 1KU2A 2P8JA 1SD4A 4ENNA 2DQRA 2FA5A 3WU1B 5DM4A 2JPCA 2Z5UA 4GC9A 4A0XA 2IGTA 3GUDA 1LVAA 3VB2A 5IT9K 3ZN1A 5D4SA 1XCJA 2STTA 5EC8A 4RB3C 5FQNA 4RTRA 1J9IA 4GYGA 1SKMA 1JSZA 3UFBA 4CXFA 4UOEA 1D2GA 4HLXA 2XV4S 3KKZA 4N9IA 3UJDA 3MAGA 2RVCA 3I5UA 3WG9A 3KQQA 1QGPA 3DF8A 4M74A 2CWWA 1R00A 2JRTA 2CL5A 3H3ZA 2Z99A 2CFXA 3FUUA 2ZBKA 1MJAA 1TW2A 2VDWA 2XAGA 5F2NA 2GH1A 1LEAA 4R6WA 2R7DA 1X1CA 2L54A 3E6DA 1GXQA 5DCFA 2GB4A 3FMRA 3WTVC 4G9YA 4YUZA 3H92A 5LLQA 4LJZF 4RTMA 4HQEA 2ADMA 3BWCA 2O8XA 1JSXA 5DXAA 1KPGA 3COAC 5K0GA 5FA8A 2V1XA 1O9GA 4Z2YA 2XAFA 1YW7A 2F5FA 3MQ0A 4C07A 3Q9SA 2Z6UA 4KMFA 2HKXA 4U88A 1SAXA 2P4WA 5HIMA 3E23A 1AQJA 2H27A 2K02A 3U81A 1QAOA 1QBJA 2XYQA 2GA9A 1TW3A 1O3QA 5AIQA 4OA8A 2VOPA 5TJJA 3J7AO 3NDJA 2M1BA 4N0BA 5LSAA 1MKMA 2A69F 5D1HA 3ISPA 4GCVA 4OOIA 2PKWA 3KEQA 3DLIA 3FM5A 2E1CA 1P91A 2CGPA 3U2RA 3DULA 2IBSA 4MQVA 2K4MA 1H9GA 4YV0A 4E30A 4ZYEA 2AOWA 1R58A 3K6RA 4IF4A 3L8DA 4HA8A 4EJUA 3DH0A 1NBIA 1G3YA 3WTUC 3HTXA 3JAMK 4LMYA 3HSRA 2BBYA 3DPTA 1SMTA 2AN4A 2STWA 3HP7A 4R05A 1P4XA 2PLWA 1ORIA 3GFLA 2QVOA 2Q0OA 3JTHA 3DUWA 1LQ1A 1W7PB 5IH3A 5LHIA 2Z6QA 2LF8A 5GP1A 3HCCA 3R61A 3LHDA 4P7KA 3PTAA 4QLCU 5DDGA 1N7IA 1DPUA 2ZIFA 5GM2A 4P96A 4IRHA 3KPJA 2VZ9A 3K9TA 1PP7U 2DU9A 5J6XA 1BI2A 3DQVC 1X19A 5HILA 4RVGA 3T7RA 4P9UA 2ZFUA 1FZPB 1IXKA 1IM8A 4OQDA 2EA2A 4MTLA 1FBQA 1XSVA 2CW0F 2OBPA 1P6RA 1G6Q1 3FPFA 2ESRA 2VBZA 3FUVA 3NWEA 3CJNA 4GXOA 3ZMTA 2O61A 1P2FA 4YUWA 2C7PA 4RSRA 3OCJA 1U5TB 3O2PE 4U0VA 2EFWA 4FS8A 4R8RA 3HTUA 3QAHA 2VE9A 4I0BA 5FQOA 3P9CA 2K7LA 5FD6A 2PWPA 3ECHA 2P7IA 5E1DA 3GO4A 2MLKA 4YMHA 2HQNA 2QQBA 3SZPA 4FX4A 2OPBA 4GEKA 1X1AA 4M6YA 5HIKA 5FLXZ 3G73A 2O03A 2ZWAA 3WTZA 3KPYA 1TBXA 1ON1A 1D3YA 4M9SA 1WKMA 3T0YA 1JG4A 2A14A 3G2QA 1T2KA 3GCZA 2ONYA 1TQMA 3TO7A 1HNNA 4P9FA 3T5XA 1E17A 1FWZA 5AONA 3MGGA 3AY0A 2IA0A 5K5QA 2UXXA 4QPPA 2DT5A 4A12A 2OB2A 3LCUA 1L1EA 2O0LA 4BLWA 4RB1A 2KIFA 2O05A 2YX7A 2FOKA 2O3FA 3ZMZA 3MTIA 1HKTA 2XVMA 2RKHA 5FA5A 5GIOE 1YZ3A 5EIFA 1SD5A 1G3TA 3MCZA 3E5QA 3R4KA 5FLXK 5BPDA 2GAUA 3G5TA 4QTUB 3HA7A 1XD7A 3ORHA 3OU6A 3B02A 4KDCA 2ZLBA 1TQIA 3GWZA 4B09A 2PVCA 2PGXA 2J5PA 1AWCA 1J59A 3GX4X 3F4KA 2AN3A 4HDVA 1IXRC 2LDUA 2HV9A 4YUYA 2UYHA 5EQJB 2VT2A 1OR8A 4QQKA 4NQWA 4X63A 4XBFA 2Y1XA 1BHJA 3ER9A 2KKOA 4YIFA 4PONA 5DV5A 3C18A 1BN5A 3K0BA 3KPWA 2P1DA 3F8CA 3CO6C 4G94A 3SXYA 1O3TA 3SXJA 1W4MA 4EJWA 2ZMEA 1H1DA 1L3CA 2DK8A 1O7LA 4WXDA 1PDNC 3ANXA 1BOOA 5C9ZA 4OIOF 4PINA 5K1YA 5KS2A 4G7HF 4BXUA 3UA3A 3KR1A 3T0IA 3QP6A 3HOTA 3QOPA 4HF1A 4WXCA 2P6TA 3T8TA 2EFJA 2G8NA 1S6LA 3FTFA 2MC3A 2CG4A 4XLNF 5FGMA 5P8WA 4MHGA 4GGGA 5LGUA 4IHSA 4LFUA 4PYLA 4WWCA 1F1ZA 1W5TA 1R6AA 2I62A 1QNTA 1U78A 2DQLA 4E31A 4GF5A 2H94A 2JH9A 4EK9A 2EV0A 1KU7A 2VDUE 3V97A 5D8LB 4CICA 1SQFA 3HUGA 4G8XA 3FPJA 2VBWA 1Z05A 4LG0A 2KW5A 2ZBRA 1CGPA 1FP1D 2L02A 5JHUA 3E6BA 1EJ6A 4FP9A 3G7UA 2FNPA 3SSOA 1GVJA 1XMKA 5KQRA 4EM0B 1RUNA 3E05A 4NB5A 4HGZA 1RI1A 3TFWA 4PYNA 4YV1A 3AXSA 1RNLA 2NRAC 4PCLA 4UXNA 1XB4A 2PI0A 1NT2A 4RTNA 4RTKA 5EGSA 3DXYA 3PLAE 1C0WA 3ELKA 4AZTA 3FZGA 2WA1A 3P9IA 4M9ZA 1KQ8A 2B3TA 4AZSA 4CWAA 3GIWA 4L9TA 3BROA 3NW9A 4BY9E 1R5HA 1R8YA 1OYYA 4UV8A 3J80K 1YFHA 1RI4A 1WS6A 3IHTA 4HGYA 2P6SA 3TO9A 1RI3A 2P41A 3HTSB 3HHHA 3M7GA 1I4WA 3IV6A 2QQ9A 3T7SA 2PV0A 4I02A 2V9VA 3JSOA 2P3OA 3OPNA 2OYRA 1FLIA 5AIPA 5GIPE 1WWXA 1PJZA 2JHAA 3S2WA 4Y13A 3LKDA 5LQAA 3FM3A 5DD4A 3FYCA 1IUYA 1B4AA 3RKYA 4S05A 2G7HA 1D2HA 2AOTB 2OZ6A 3H3UA 5FHRA 3O31A 1J2XA 2IDKA 3EEYA 5EOVA 1FBNA 1T98A 2F5DA 4HTFA 3IRRA 4CTJA 1MDMB 2DO7A 3TO6A 3O6BB 2M87A 2XASA 2HTEA 4XLPF 3OZRA 2Z3YA 1LDJA 4P5OA 1ZRCA 2CMHA 4RWZA 3SX0A 2YPRA 5BOXA 1L3LA 4QVGA 4RGUA 3V8KA 5CJ9A 2WK1A 1NKVA 2QZ8A 4Y2HA 2EX4A 1BI1A 3BZBA 5ICFA 2VONA 1T39A 2ZWVA 5GOZA 2FU4A 1XGSA 3DV8A 1YO5C 2PJDA 1Z9CA 2A07F 1F4KA 2Y48A 1RI7A 4AIKA 3NDIA 4HV5A 1UFMA 2ESNA 5E1MA 4RTOA 4LG0B 4DZRA 3V8VA 2PBFA 1DUXC 3FTEA 2AOXA 3E97A 3P71T 1VP3A 4IV0A 4LWOA 5ED4A 1HMYA 4AZVA 4F85A 1FBUA 2IH5A 8MHTA 2IBTA 1DP7P 5DM2A 2FMLA 5LQJA 3TOBA 3K1PA 5HLGA 3TMAA 4OX9Y 2L01A 3SM3A 1PRYA 4YFKF 4U7DA 2ESHA 4RTSA 4L9NA 2D1VA 1VLMA 1YUBA 3SR4A 3UBTA 4LLLA 2XYRA 3GFIA 4AUKA 4ZZLA 4OU0A 4HQMA 5EIWA 1NW8A 5E1XA 3TQSA 1MZBA 3LQQA 3R9XB 1OR7A 2PEXA 2D45A 3R3HA 4E2XA 2IJLA 1O3RA 3O4FA 4UVCA 4KYWA 5EVJA 5DRYA 2LSOA 1FT9A 2GXGA 1JQDA 3DMHA 4FGZA 3GFJA 2VT3A 1S8NA 4FSDA 4Q5SF 1SMYF 5ERGB 4YFXF 4OQEA 4BLVA 3LDFA 3LX6A 1R1TA 1XN7A 3BDDA 2YUIA 1LJ9A 2GS9A 1YB2A 5CVRA 2N47A 3NRVA 3I71A 5L3EA 3I53A 3KZYA 3BGVA 3GVAA 4HTFB 5E2AA 3IKVA 2IPQX 3GLXA 1Q0TA 4HC4A 1L3IA 2ZZNA 1LB2A 3EVEA 2W57A 5E1ZB 2OAZA 4QVKA 2AS0A 1DPRA 2W84A 2YR0A 4I7HA 5FULA 3V7SA 1KPHA 2M8EA 3HCBA 5H02A 3BPXA 3FPGA 3RDIA 3M1EA 3KFWX 3G89A 4R6XA 2C7RA 4F84A 5LEKA 1T43A 1WSUA 5E2BA 4JXJA 4KW7A 4L0YB 4ER6A 2R7FA 2MD5A 3IEIA 2OZVA 5LGNA 4ENJA 3AWIA 1ORHA 5LHHA 4EGYA 1O3SA 2R3SA 1J75A 1FOKA 3CJTA 5L3DA 5DM1A 5K0CA 1I6XA 4ETSA 1P4WA 3LA7A 3A7EA 1E2XA 2BM8A 2FYTA 2AVNA 3EMDA 3HRTA 1QPMA 2PLYA 1XSDA 5HIIA 2ETHA 3W6KB 4RTPA 4PIMA 5U4XA 2PN6A 2EJUA 4EMSA 4LECA 1FX7A 2L3DA 3C3WA 2E7XA 5JFRA 1V4RA 3KP2A 2VBXA 4EQQA 4IKPA 3THSA 3CGGA 2CO5A 3Q9VA 1I1SA 1S3JA 2GA2A 3WGIA 2XVAA 1EH8A 4WK8F 1J7KA 3DXXA 1U2WA 4AIHA 5LRSA 1JG2A 4KDPA 3TOSA 3ZMDA 5E9JA 3MZHA 5DSXA 1RJEA 3SSMA 4HRAA 3KQPA 1EH6A 1KP9A 3DOUA 1FP2A 5DWQA 2FQ3A 2X0LA 2V74B 3F6OA 3UJ9A 2K4JA 2HYGD 2ZZMA 2OD5A 1T0FA 3I0TA 3ERED 2ZNZA 2KIUA 2ZMEB 2JPBA 2JTVA 4ER0A 1ODDA 3G2MA 4LLGF 2FBHA 2P35A 4PGHA 4PGGA 3MAJA 3UJAA 2UZ4A 3SFZA 4KRGA 3ID6C 2P7VB 3HCDA 3HM2A 4JK1X 4L0ZB 3REOA 1SFUA 4XUDA 4HX4A 4LLNA 3FX3A 5K5OA 2I7CA 3SGLA 4IJAA 1ZRDA 4IVNA 1SD6A 3CKKA 2PMHA 5EMMA 4BHBA 5DX1A 3ZMSA 5HLIA 1XXLA 3JWJA 5EEHA 2XAQA 4LK1F 5DCMA 2PMUA 1SG9A 2ZULA 3NEUA 4U7BA 3ULQB 1G3WA 5K0EA 4K6MA 1FBSA 4I09A 1OYWA 2EB7A 3AAFA 1XDSA 3F8FA 3LL7A 3SHFA 4KIFA 2AS5F 5JR3A 4ZYDA 2NXEA 2Q41A 3M9AA 4YMGA 5ILUA 2E1NA 2HQRA 2ZW9A 1L0OC 2P7CB 5K09A 3UJBA 3PFHA 4M38A 3HRUA 2J5OA 3KZZA 3HIFA 5EHIA 5D5XB 3BP8A 1EH7A 4XSZF 2IA1A 1ZG5A 4HF2A 3FPHA 3JTGA 3E6CC 4ATNA 4KICA 5GM1A 2UYCA 3N97A 3NVKI 4UV9A 4EVIA 2H00A 4YUVA 3M70A 4PNEA 4MTEA 3H2BA 2OY0A 3KQYA 3RKWA 4FX0A 4BP3A 1EG2A 1K7AA 3GU3A 2FK7A 4GYIA 3HA3A 5K5RA 3IL2A 1KA8A 3KP7A 4BNCA 2MH2A 3LSTA 4RGXA 1MJBA 4QDJA 5LQKA 2BR5A 2XAJA 5CVVA 2H6BA 5D1NA 1R7JA 4ESJA 1WRJA 2UWMA 2IH2A 5KVRA
chains in the Genus database with same CATH superfamily
5HMLA 1I6KA 4YO7A 3ROZA 4URVR 2JKYA 2XTJA 2YC4C 5L3FA 2JHPA 1P9RA 1B2RA 3NTLA 1TVCA 3WTYC 3CHYA 4TXHA 3TQFA 3EAGA 1K4YA 2AOUB 3HDGA 3E3MA 4P82A 2WJJA 3FDFA 3R7DA 2I54A 3F6PA 4H2DA 3WLOA 3PXXA 2ERCA 4DG8A 4KN7X 3OM8A 4AICA 1L5HB 4ARZB 1HETA 1ECGA 2OV1A 5DEIA 3RARA 2JW5A 1Z1DA 1NFRA 3DT9A 1X77A 3JQDA 5HCIA 4XQ9A 2ZSIA 2WHYA 4K3VA 3S2IA 5HS6A 4RY0A 1XD2B 1ZHFA 3BG7A 4MLOA 1WU8A 1ZEMA 4DCCA 1ECCA 1JMYA 2R4QA 5FTWA 3ERCA 3P9NA 2XA9A 3TGNA 2F5VA 2G67A 4IM7A 1QO0D 1QOPB 2QD1A 1RWWA 1FQJA 4TMKA 2RHRA 2WU8A 5L3CA 4Q9LA 3G1WA 3SS8A 3BJMA 3HOUJ 4PQGA 3WO1A 2VH1A 1V5FA 1YS4A 2CQKA 4EVSA 4P4TA 5KK1A 4JR2A 5DTMA 5BNIA 3HR4A 1ADJA 3RRBA 4DUZB 1HRKA 5L6MB 2BW3A 5DCMB 2XY4A 3DKRA 5A5DA 1PR0A 2ZIEA 4ZYXA 1VQKI 2PZGA 5CLGA 4Y2TA 2GCPA 1TMYA 5KTSA 3LP8A 1WJ5A 1GTJ1 3PD1A 4JLWA 1ZKGA 5D7NA 4MB0A 1TKAA 1G8PA 2BHTA 4LG1A 4NTZA 2IOQA 1TPZA 3WTBA 3I9FA 2DSNA 2WFLB 1XQYA 3Q2OA 5BR4A 3R3VA 3AJEA 3K4KA 721PA 3IP9A 3S27A 4ON0A 1JH9A 2WNSA 2J6HA 1OFCX 1CUJA 4I1RA 1I39A 2PXCA 4ESBA 3LRTA 3EYYA 1VBMA 4ITVA 2HZ7A 3IQGX 1RR6A 1SA0B 4PSUA 4BRSA 5MF6A 3ZGXA 5IFKA 2BRUA 3IEVA 5IDYA 2G0NA 1RKUA 1T2UA 1IHOA 1K7FB 4JNKA 4Q47A 4GLFA 4Q9DA 3B1FA 1A76A 3PFGA 1QE0A 2J3IA 1M1NB 4GPEA 4WY8A 4IYJA 3W6OA 4NCAA 3CE6A 5IXJA 1BEZA 4WOCA 2AXQA 3M5PA 4JODA 2QUFA 2VDNB 4W6ZA 5AKLA 1C4WA 3M6AA 4UXJA 3GFPA 5BN5B 3B36A 4PZPA 2HFHA 1KL7A 2AXPA 2ETXA 1YZTA 4RA2A 3A04A 2VZLA 2ABWA 4U87A 4MVJE 2P81A 4P0PB 5DYYA 7GPBA 4LUCA 2GM5A 1KQNA 5KHOC 4MV3A 3RADC 2QQ0A 3DFGA 1QBKC 2BVLA 3E5RA 4ZTBA 3R7WB 3UEOA 3VNSA 5KNCA 1SGWA 4BE2A 3R7SA 1QZXA 4M3BA 5LEJA 2BOVA 2GLUA 3INYA 4NBUA 2ZTHA 4JQZA 3S8YA 3P19A 1FDTA 2L9NA 1GA1A 1H2AS 2HUNA 2IE8A 4MJXA 2WG1A 5F0HA 4FC7A 2C2OA 1O97C 4N5IX 5IP7J 4A3MJ 4ESHA 3DO8A 3I61A 3EPHA 3L8ZA 3BWXA 3HYLA 1ETXA 3Q7TA 5HR5A 1H0MA 1K79A 3P2MA 1GGNA 4RZXA 3GGDA 1K4SA 4X41A 5LD2C 3L7BA 2XPWA 2ZXIA 2B82A 4PC2A 2R5ZA 3F8TA 3AFMA 2DHQA 4X45A 3U7EB 3GYGA 3H0DA 5B1HA 1DIHA 2BZ0A 3PD0A 4FYJA 2B9VA 2EZ9A 2K86A 3U4IA 4J75A 1NTCA 1EDOA 3A9TA 3AVPA 3C7TA 3DNMA 2GK4A 1XDZA 3H4TA 3ND8A 3QFCA 4EX6A 3H1FA 1E1CB 1OVGA 2ANCA 2EJBA 3EX7C 3K1JA 4NDAA 2Q3HA 3FMGA 4YGYA 1V9LA 2ZXEA 1TD1A 3IMGA 4TROA 2H4WA 5BW6B 3RSQA 3W6UA 3E0JB 1GKLA 4A6DA 1NXTA 2GT1A 1OXVA 1PL7A 4LY0A 4NCKA 4OU5A 1JQ5A 3RFUA 4F2GA 1EUDA 1QCCA 4TWAA 2Y1WA 2W6CX 3VYUB 1WKBA 3PT5A 3DT6A 2DTZA 4I36A 4FCYA 1SXGA 2V97A 3DE6X 1QVUA 2HEGA 3L93A 4RGYA 1N2EA 4U1RA 4MA4A 4ZAXA 4G1BA 3EGOA 4MW1A 3RKQA 4D92A 4LOCA 1JG3A 4OXIA 3MZYA 2W58A 3ZLBA 2OSVA 2PBRA 2A6EF 5A4AA 4B45A 2PA0A 1W35A 1YOBA 5ALJA 1KJ8A 3OZDA 1DRWA 3E9CA 5ITSA 4X71A 5D5VB 3PC2A 2GFQA 3LK7A 1D8KA 2NU7B 1QIFA 2GCEA 4MLDA 4QPQA 1XCGB 4R7TA 4RFLA 4XX0A 2VQ3A 4LZPA 5JWHA 4D9JA 2OCXA 3O1IC 5TEWA 4Y4RA 1WDKA 2WHRA 2O5RA 2X58A 4Q3DA 3EDPA 2LV8A 3MQ2A 2A30A 4JLSA 2WF6A 3LNQA 5BPIA 1EB9A 1S1MA 1B1BA 5IYZF 3D4NA 3WADA 2G9WA 4BGDA 2VQHA 1QGZA 1ZMTA 2BMWA 1W5SA 3OYBA 1H42A 1HLPA 1T36B 4QJ5A 4ZI5A 5BXQC 2W6ID 4EBFA 2R8PA 4MYRA 3G59A 4A8HA 2ZP1A 4QDKA 1Q84A 5JCXA 1JFTA 4ARCA 3EQLF 3DKVA 4FLFA 3QHAA 2A3SA 2LYCA 3D0SA 3I59B 3LSIA 3O93A 2Y0SN 4OPMA 3SYRA 1Z16A 2WMNB 2OU2A 1NASA 5CIWA 1TYEB 1OI7A 2MSEB 2Q5JA 2ZUWA 3X0DA 4TV9A 4K0KB 3OYNA 2BGCA 3HN2A 4IH1A 3WJAA 2BE9A 1TADA 3BQYA 3CB4A 4P2GA 4PSKA 4ALMA 3ZHRA 3UHFA 4IOKA 1LD3A 2D3WA 4NZNA 3PSIA 1IZ7A 1ZG3A 3EETA 3EZGA 4RZQA 5A3VA 5K3AA 5F1RA 5AQEA 1DQPA 1H2ZA 3B1VA 4ZJZA 3N1UA 1ZVKA 3IKLA 3HQ4O 4AZ0B 4R1HA 1JDBB 4LYEA 3DMFA 2RGYA 3IPRA 4GXTA 1KE1A 2R6R1 4EGZA 4JQSA 2DH6A 1AN9A 2HWWA 3O0TA 4I98B 5INTA 4CEHB 3I04A 3QPBA 2DMUA 3FTQA 2RHMA 3F6VA 4RADA 4D4HA 3L4BA 1K5HA 1Q7EA 4XLFA 1U8AA 3WHCA 1ZI8A 2C0CA 4P9NA 5A4MS 5K2MA 5KKCA 3A6KA 4W7SA 2VR1A 2WDZA 5DWDA 2PZFA 4Z51A 5EWJB 4LF8B 1T1GA 1CF7B 2HFJA 3G68A 3A4YA 1JKJB 4EFLA 1U3EM 1HA8A 1ZVJA 1SUSA 3HOXJ 4C7OB 3ZE1B 3IJEB 3KUXA 1YYVA 3HGYA 3SZGA 1M6YA 1SC4A 2PFGA 4KN8A 4KQFA 4C7KA 4C78A 2EP8A 3GBPA 3CZMA 1XTTA 5B3JA 1H2RS 1JEYB 5J59A 3RJ5A 1SCNE 1E4EB 1ZGGA 2REXB 3FJYA 2UUOA 3F9KA 3ZU5A 4Q6BA 2C8JA 4EI9A 4W5QA 2HDCA 2XSDC 1Z0JA 4JI2B 2V7FA 1ETVA 1JTYA 3CCEI 1FDSA 3MWMA 1SVUA 1KIMA 1A9TA 3DDSA 3GJ0A 1HQYE 2P6OA 3IE1A 1EP1B 3N6XA 2XGOA 2WD9A 2X9LA 4CKEB 4WBSA 5AW5A 4C4RA 4XM3A 1GT91 2JLBA 1QHSA 5A2QK 5J2UF 5LD2B 1OQAA 3DG9A 2PMFA 5GV7A 1QZYA 2WHPB 1RQGA 3DQPA 3MPOA 5EIOA 4BFXA 1MORA 1CS4C 3SC6A 4MO7A 4JP2A 2RGNC 5EFZA 3WXMA 4C3ZA 1IXYA 4IXTA 2Z6AA 1M2NA 4MRMB 5LBTA 5FL7D 3SQMA 1TTHA 3CLHA 5JNVA 1GWNA 3R77A 5E1WA 5CA0A 1AMOA 1C9JA 1MENA 3OZWA 5ELLA 2DPMA 4LRYA 3WYEA 2ZB2A 2PGJA 1TTTA 3GBSA 5ENVA 3KT3A 4ABYA 5CM9C 3KQWA 4NBQA 4ZZDA 1B6TA 2ZVJA 3D1NI 4IIFA 1V26A 4UVAA 4F7ZA 1JJ8C 4NFSA 1VRVA 5LDHA 2FJ1A 5F04A 3CKYA 3COZA 3GJRA 3JXEA 1FMWA 3KUDA 1MBEA 4ZOAA 3RR2A 3UWOA 4HS9A 5LNK6 3TI9A 1KU3A 3UK1A 4BX0A 1U1CA 3G17A 3NHWA 3N8NA 5IXYA 5ILQA 5HZHA 1Z4IA 3EVAA 3K0EA 1WSBA 4CIYA 2MSDB 3BCHA 1FVOA 3AR7A 1OLUA 3RQ4A 1XBTA 2W70A 1YQQA 3M83A 4RVUA 2HEOA 2DFPA 2QVXX 2X9QA 2AMJA 2REQB 3D1JA 3NV9A 2X42A 2EFOA 4HNTA 3UJ8A 1OH8A 4EG1A 1T0BA 1FFCA 1IN6A 1EZ1A 1F48A 4XLHA 3TK1A 2HL6A 2F5CA 4Z0NA 3CWCA 3LKVA 1YJQA 3RU2A 4MGRA 1C1DA 1NVEA 1EHCA 1TJ4A 5H70A 2QJRA 2ELJA 3CDHA 1Q0UA 2UYYA 1LBQA 2B94A 1K5GA 3JASA 1YUMA 1CJKC 3DFZA 3HU2A 4HFMA 4KK3A 3I56I 1FEZA 2CJJA 1KXZA 1U7UA 5D00A 2VA8A 5DBHX 5J5AA 1XEWX 1NMEA 2ODBA 1A4XA 4PWYA 3QYJA 1UCRA 5T64A 2V45A 1J5PA 4HDSA 4HZIA 2NU9B 1IXCA 2QL5A 1IY2A 2QAIA 2JFBA 3FXUA 3FJOA 1K2VN 2W4QA 1XA3A 3CF6R 4HWOA 4NE9A 3EVDA 2F4VB 4LJ6A 5HDGA 3L92A 1CRWG 4E7JA 1P2TA 2I7XA 1E3DA 2R7TA 4HD8A 4YDQA 3I52A 4HDNB 5I9BA 5KOJA 1OWPA 2BGWA 2QBYA 1XQVA 3R7NA 2RGWA 5CDFA 4D56A 1JE8A 4NZPA 4EO9A 4ZK6A 3FH0A 3OQNA 5JBIA 3JQAB 5MGBA 4CEJA 3LBYA 3GFMA 2EIJH 3LQYA 1UPBA 2GZMA 3MMNA 3EPRA 1OKRA 1DAFA 2E37A 2VCHA 4Z9BA 3TM5A 1A5JA 3KQOA 4BBPA 4BECA 4EFDA 2VQSA 1DHTA 2DM6A 1KIFA 2CQ7A 4Q4ZF 3KV3O 4MLZA 2AKYA 3NWJA 3BCBA 1EVJA 3OQIB 1W5BA 4ND6A 2ORIA 4YRDA 2MC4A 1KEZA 3J7ZI 3PDUA 2JA8J 1P92A 4GOMD 4P80A 4X3CA 5EIAA 3RVDA 5THKA 4B6QA 2KLHA 5CUQA 1JTFA 5HOQA 4IIYA 3EPZA 2Y0PA 1GLNA 3L1VA 5KQSA 1XLUA 2PD3A 4QUGA 1R50A 4YASA 3T35A 3LC7O 2C9YA 4MW0A 4EUNA 4LJSA 2SCUB 3ZE0B 3A03A 2GYYA 3PJDA 3TLGB 5I8WA 4E0BA 1QGED 1HYEA 1UK9A 1F4VA 4BACA 2AJ8A 2CE7A 3GW2A 2M45A 3F9CA 3KEMA 1E1RD 1JV2B 4HGNA 4R9RA 4O2BF 4TSKA 5IP5A 2XMZA 5DK4A 1G0NA 2AJCA 4NE7A 3VJKA 4CMGA 4KR3A 2XIQA 1WVRA 2Z8ZA 1NOIA 4CDGA 2WTMA 1V95A 3MERA 1MT3A 5EE0A 2JSCA 5DTDA 2ZJQF 1JKXA 1Z2PX 4YAWA 5E0KB 5ULLA 1IEXA 1X7WA 4XSHA 2QWXA 3NEPX 4BDSA 4V2IA 1L4BA 3BMCA 3OX1A 4MQUA 4X1KA 2PXAA 2AJLI 5K7FA 2BP7A 4HH4A 3NHSA 4KXWA 1G55A 1UBFA 2FJPA 3SEFA 5LP6A 2HQSA 4JR0A 3THYB 1FJXA 4HR7A 1Z4LA 4NOKA 1TK2A 3AEZA 4OGKA 4TMWA 5HP4A 4IYRA 4N5HX 4DQ2A 1MT0A 2D0IA 4PYMA 2AOUA 2JFGA 2OGSA 4QWWA 4CODB 3B3QA 1UDXA 5I51A 3FYSA 2DOEA 4NBWA 3IAAA 1FSPA 2HMUA 2NV0A 4ZOLB 5JXHA 3F9RA 1OPCA 1NRXA 4HSGA 3SLKA 1E8NA 5KTMA 1C2TA 2WE8A 4B6EA 4ZO4A 5IUJC 3CDIA 3N76A 5K0TA 2Z98A 1QS0A 4K6HA 5EJCA 1J21A 2AA3A 2ZFWA 3KSBC 2QF7A 1OA1A 4QYMA 4L9VA 2QA5A 3NV7A 4BZZA 3DMTC 1J0XO 4PAMA 2DY0A 4Y6OA 5EUCA 5IHPA 3LBHA 1G38A 2C0PA 2G9VA 2PN1A 1I36A 2O7VA 2QRQA 3OA0A 1NJFA 1P7PA 3QEJA 1GFZA 2FGJA 4RL6A 1BCSB 3F96A 2P8TA 4Z3OA 1WL8A 4HQRA 5AK3A 2WYWA 1HKQA 3QQAA 1YBFA 4MGHA 1DOZA 5JJLA 2JD2A 5E4TA 2Q5QA 2FQYA 2Z4TA 1EE1A 3LDUA 4LMRA 2NO7A 3TTUA 2QG9A 4UQLA 4BMDA 4PEVA 3QPSA 2WWYA 1DE0A 1JIQA 1Z08A 3DO6A 3FUWA 5SZJA 3D5EA 2VN8A 3BTOA 2O8CB 4WERA 4RANA 1CNMA 3WIEA 5CA0B 4RAYA 2GRUA 2X9GA 3IELA 4FBMA 4W6QA 3W7VA 2MJLA 4URHA 5BQ5A 3UT0A 4BNXA 4DNOA 1J2TA 5JS1A 1SKQA 3G1LA 4JEMA 3ZY4A 4ZCMA 1TA9A 3ELBA 1H1LB 2JGDA 1FVHA 1U28A 2IITA 2XB6A 1YL6A 1VKJA 3TECE 2BI8A 2FXIA 4RNDB 3EVFA 2WWHA 3PJRA 1CJVC 1AQUA 4OI0A 1RQPA 2C61A 1WDWB 3ROUA 2OL4A 3VO8A 4DDUA 2F59A 3QBVA 4X7MA 4Y2VA 1EJBA 2GEVA 3NRBA 1KK2A 3HNPA 1NFFA 4W99A 1P0CA 1FYFA 4WW0A 1RRJA 4I19A 2QZSA 4BJ1A 2B4YA 5KWVA 5AHWA 1V7ZA 1GLVA 2B2CA 4URFA 2P11A 3PUJA 2WFAA 3W3AD 2VT6A 4B83A 1U2PA 5IK2A 1U7WA 4YH1A 3EUWA 4MICA 5G3YA 4MFEA 1ND6A 1BA2A 1BW9B 4AWXB 1NVAA 4BUJA 4I2OA 1DPGA 3DGEC 4MIYA 4KMUX 3TEDA 3AETA 3FMPB 3LNTA 5EZSA 3S44A 2PK3A 1BDBA 2E0IA 3DNPA 5K4AA 1WW3A 1NNI1 3UWKA 4AN1A 2IYSA 2V3VA 4ILEA 1T3SA 3PITA 4ZTZB 4FC6A 2P2CA 1IG0A 1N2CB 1XYYA 2FQWA 4BX9A 4UFPA 4YYZA 1NA5A 1SUFA 2JLXA 1KYXA 3PO2J 3BRWA 4L2IA 2PKQP 2XMBA 1HZJA 3D5QA 3RYPA 1KY2A 1Q1EA 3K2QA 3OT4A 1V7CA 1JG7A 2F1RA 3BB3A 4J03A 5AIAA 2FOWA 4M1KA 5TARA 4I3HA 1CP3A 3PC7A 1L5QA 3QKSA 4GI3A 4JKYA 1YB5A 5I5EA 5IKEA 3GA0A 5EIBD 1CQJA 1D5WA 1MH1A 3KYDA 3UCFA 4BLPA 1DJLA 2WMYA 5DIFA 4XD2A 2WU1A 5FBZA 3EEOA 1ZGJA 1NUSA 2PJPA 2X4GA 1IWPB 4WEOA 4QHTA 4JGBA 5LA6A 1KU9A 1XROA 3FBWA 4GRIA 2V5UA 3NOOA 4B3FX 1C1XB 2RHDA 3KPUA 3O1LA 2ZIXA 3WK9A 5K8VA 1B3RA 5FO0A 2DBYA 2C2YA 2QLBA 3C7KA 3GUZA 5F2OA 3WJ7A 2Z5GA 5LOVF 3AR2A 1ZREA 2QUBA 3A4MA 3Q5GA 2JGEA 1IHYA 2P68A 4WKNA 5K0FA 1UXHA 2AFRA 3UMSA 1X9IA 2GNAA 2HHLA 2QRHA 2HGZA 4HWRA 3RJMA 2P2GA 2ZAOA 5KSYA 1SKBA 3U4QA 3UK7A 4WK0B 4C20A 1PFWA 1JR3A 3ZKWA 3C45A 2JC3A 4IXNA 3EUAA 2R8ZA 1HE2A 2W98A 2J3DA 3TSOA 3W6JB 1JQ3A 2JLAA 4N9QA 2EG5A 4HRXA 5HGJA 1LBTA 2FUG1 3WGHA 2KRHA 2CVOA 4IDEA 4K28A 4KVFA 4X1OA 1NVWQ 3T3NA 4HSRA 1FRFS 1YZYA 3DR5A 2OENG 2G40A 4BN5A 4DC0A 5KX5F 2QYTA 2QUKA 3F8SA 3GB9A 5ILVA 1LVGA 4DR2B 4MMYB 2Z1DA 4XX0B 4F2PA 1Y9DA 4LD5A 1FYWA 3I6BA 3IQHX 2VDVE 2J6IA 2JI9A 3H3FA 1XE3A 3OYMA 3ND6A 4JT8A 4NCBA 1TNTA 3GQVA 3RT9A 4V03A 1QO0A 1T15A 3KS9A 2D13A 2BKXA 2DBVO 5E3OA 2VKTA 3KQVA 4EUKA 1OMIA 2VPXA 2PE5A 1ISFA 2V1UA 1WPGA 3Q8KA 3VOEA 4YV2A 3M4XA 1KEEB 5ITVA 4K9SA 4MUJA 1ZI6A 1WZIA 5DIZA 2QE6A 1Y1QA 2AK2A 3LQKA 3BC1A 3TXYA 4J0JA 3R0VA 4PSVA 4XYEA 9MHTA 2ZTMA 4RVOA 2NXCA 3KLNA 4QELA 4DM7A 1FZQA 4WZAE 1J22A 4KSBA 1XZBA 2CXXA 5ARCA 1MB0A 4F21A 4MEBA 1YFJA 2ASVA 3DUFA 4MARA 4W63A 2Z95A 3QU3A 1ORVA 2GN4A 1ONPA 2DP4E 2PUVA 1A7AA 1EP9A 5BP7A 3ZWKA 1SZDA 2HRRA 3NBZC 4XPIB 1LDKB 1WUIS 5G4KB 4EARA 4IRGA 3DBHA 1K66A 2G04A 4P6VF 5J3JA 4L9RA 1U7XA 4G9BA 1TIBA 1SFKA 1XMAA 1TMKA 2AW5A 3PHIA 3B9QA 5CJ2A 3FXQA 2JHGA 2F4IA 2CXRA 3KXKA 4KFSA 4RGVA 2O8FB 4ODIA 1YT5A 4OIFA 1YW8A 1EX7A 3SD7A 1S29A 5LYJA 1OFUA 3W5CA 4HJXA 3SJAA 1Y1SA 1YRLA 1ZK1A 2EV6A 2XB0X 1G4AE 2O8NA 3CMAI 2JJ7A 3LX5A 4XD7D 4ERXA 3FOAA 4R68A 4MYUA 3TZBA 4HB2A 3IP6A 4CI9A 1NVTA 4O8CA 4XSXF 1CUBA 1NYQA 4FNMA 4PRLA 4BMYA 4YAKA 1Q0PA 1TO1E 5JPCA 2J0QA 4YR7A 2ACWA 3RIRA 2IL1A 4ILKA 1J2JA 5AI5A 1O03A 1GQSA 3FVTA 3AQIA 4Q1BA 4YTEA 5FPQA 5U4QA 5BR7A 5GZ1A 5D8KB 3A6LA 1B8IB 3DP9A 2ZYUX 2KM1A 3DLCA 4MGIR 4DLRA 2XUFA 1U3VA 3LO8A 3QTTA 5ALSA 1M0WA 3V2UA 2G06A 1CS0B 1S4QA 1WEKA 2Y0SA 4DT1B 2Y76A 3JRXA 1WXFA 2DLCX 5K8IA 2AXLA 3G9TA 3DXZA 1M34B 4LYJA 4ZDPA 5DGIA 4UBKA 2Q8QA 5C5DA 4Q48A 2AFVA 1TL8A 1K8YB 5C7LO 3DLAA 1TGVA 4ALKA 4QDTA 1GZ7A 4KYVA 4ZT2A 3CF4A 4K86A 1O57A 2ZC2A 2LNBA 4JBLA 4F92B 4G6ZA 4Q9IA 5EG5A 4BNDA 4EEKA 3FOFC 3UUEA 1HH4A 1NPYA 3AEUB 2COMA 4ZU1X 5JZVA 5KYWA 4MHSA 3ZDBA 1ZQ1A 1RXWA 4MUXA 1OI3A 1VE3A 1OE0A 1UWCA 4D3FA 4COOA 3DAYA 1NI5A 1XU7A 3W2TA 4XGQA 1V9SA 3LYAA 1I2ZA 4UQOA 2O2HA 5BW5A 4UBMA 1DTWB 4ENTA 5THQA 1T29A 4AECA 4HQLA 1K8XB 1N2CE 3MD0A 2OBFA 1KBOA 2WSYB 1L8XA 1SIBE 3VDMA 2HRDA 1Y9ZA 3C0KA 4GWGA 1CU1A 5KDOA 4MDYA 5AOAA 5MN6A 8LDHA 2F3SA 1CK4A 4IV8A 1RJFA 3LRPA 5EZGA 1PKEA 4NU8X 1Z2OX 3VPHA 1NVBA 1AXRA 3EDRA 3GUUA 2VBYA 2ECFA 3G2NA 4QOGA 2O0YA 3C3PA 3PDIA 2P5TB 3K92A 4MQ6A 4NZYA 5GJCA 1FSEA 3ABUA 4P55A 4M98A 3PQFA 5ALRA 1JPUA 1U31A 1ODLA 4G8BA 2CW5A 2VKVA 4N6GA 2IEDA 3A01A 4ARUA 1CHNA 3QU6A 1IHPA 4N0PA 3PRJA 4N01A 4LRXA 4U7HA 5TX7A 3ZV7A 3ILXA 1H3FA 1U0OC 1V4VA 3R23A 2ZCVA 5FBQB 4FT2A 2ICAA 4Z0PA 3RODA 4E46A 4ZDIA 4OG2A 3B1ZA 2JJMA 3KIOA 2CJWA 3ROTA 2VYND 4P1ZA 2GXBA 3V32A 1VL1A 1YRWA 2C5FA 1GKYA 2AQHA 3PX3A 3BULA 1RU3A 3EGDA 4M7RA 2H54A 3V1MA 4F5DA 2ZBPA 5KEIA 1GZSA 4G4IA 2Z9OA 2YX1A 5EZYB 2QSFX 5JECA 4DB4A 4RABA 5FUQA 3A4CA 1SBYA 4YT8A 4L3OA 1IJFA 4OL9A 3B9RA 1IV8A 3QPTA 3OTQA 3FWPA 1BBYA 2C9ZA 4PIVA 4Y2QA 4ZV4A 1ULYA 3HCNA 4G0YA 1AUPA 2MYTA 3V7RA 3WRYA 3ZU4A 2E21A 2JGAA 3LY9A 1E4YA 1ETUA 1DTEA 1T0IA 2VJMB 2Y0BA 3EVBA 4ESFA 2FTKE 1UPUA 1R0ZA 3OOEA 4W1QA 4DXAA 5CDHA 5DHTA 1F1JA 1O54A 4KQHA 4WT7A 1VMEA 2I67A 4AIRA 4EHDA 1GUFA 1XPRA 3TBFA 3MBIA 1QOQB 3O4RA 3KOMA 2PWAA 1FDRA 4WN9A 4RGRA 3SEQA 2HV8A 3JQCA 3RGGA 2C5LA 3ME5A 4PRZA 4ZD6A 4M36A 3VHRA 1XEXA 3QWHA 4EUHA 1FDVA 4MS3B 1XCLA 3SXPA 1XWFA 2JASA 4LXTA 3F6RA 4LXGA 3H36A 5FDFA 1NSTA 1ZH8A 1KQOA 3FHZA 3GPIA 1A50B 3OV8A 1GT6A 2Q4OA 1ZTRA 1VPEA 3E35A 4A3IJ 3VPRA 3IT2A 2FE3A 1D2NA 1SURA 1ZRSA 3FNBA 1U5TA 3Q5FA 3RVBA 3UHAA 3T5PA 2OM2A 2IHBA 4L9JA 3K31A 2AMFA 4KPUB 2PBIA 5G1OA 1IM5A 1RJ9B 3D9QX 3QXGA 4F1KA 4HEA2 1WDMA 2JGFA 2PG4A 3P0HA 1P39A 3WMWA 3PK0A 3A26A 4L8LA 4Z1MA 1WTAA 1UQTA 4FYXA 4RB2C 3GGGA 5AXAA 1RBQA 2HJRA 3VDQA 4BE4A 5AVUA 3AFNA 3GQBB 4DREA 1EPUA 1XOIA 1QYDA 2ZT8A 5KMGB 1Z13A 1GRRA 2R7KA 1R5NA 4P0TA 3T7DA 3VC1A 4BO8A 3JQGB 5SY6A 1JGSA 3TTXA 1C8LA 5DTRA 4WRRA 2GYUA 1JQAA 3FGPA 3HKEB 4KPEC 5FO5A 4LOLA 1YFKA 3RUCA 3ADBA 1GUDA 3JZFA 4ZCLA 1PJAA 4GOND 3BZ6A 2R7RA 4PXYA 2IYOA 1F9AA 1T6SA 1QA6A 4B43A 5D4RA 4BNJA 4JVSB 4G89A 3UB3A 1UXOA 3DFFA 1UXIA 3U7QA 4EVQA 3GTPJ 5C81A 1BNCA 1COZA 4RAGA 2OAP1 3GRKA 4KU4A 2PRKA 4OI1A 1HE8B 4C08A 2QTMA 2YVUA 4I76A 2Q1UA 3PGJA 4XUCA 4EKYA 1N7JA 3THWB 1J1IA 1XSXA 1TM2A 4YJ3F 3KL4A 3ZPLA 1K3FA 2C2ZA 3KT8A 3DDZX 3QFRA 4LYYA 3PEVA 1UBUS 5CK5A 2J67A 2XMPA 2FE1A 1C3JA 2HD4A 3WB9A 2PUJA 3H5NA 2DPDA 4FR2A 4GMXA 3O1HB 4Q3CA 1G5FA 1RWPA 4FDVA 3M8KA 3VSEA 2KT0A 1MEOA 2EW1A 5DYMA 3C3DA 1CLEA 3LH5A 3LWNA 4FFLA 3UMGA 5TGTA 3EBLA 4QYXA 3TOCA 1SQ0A 4DR5B 1E77A 2NVUA 1OXTA 3HSYA 3IDSA 1I5ZA 5KREA 3GP8A 4AZ3B 2NXJA 3EY9A 4XIDA 3BGOS 4R2IA 3W05A 5KNCD 1P0FA 3MG9A 2BFPA 1N4AA 2FHSA 2I4RA 2XMCA 2GZ3A 4QAQA 3ASYA 4UNNA 2IHNA 1PGOA 1U0NA 1YQUA 1GGVA 2QV0A 3R5KA 4TV7A 2QVLA 1LC3A 1G0OA 2FPKA 2O1WA 3F6BX 3ND9A 1G6NA 4WE3A 5I7AA 5JNWA 1MNQA 4MW7A 3U6KA 3GVPA 1H2EA 5E9AA 1J0DA 1M8PA 2Y77A 5E7JA 2R8YA 5M5YJ 1A4UA 4JQOA 3VO2A 4C05A 4CNQA 3T3OA 4RF5A 4C43A 1R3UA 3JVVA 2G9RA 2ATXA 3O8OB 4N4AA 2OFPA 2XCLA 2FEMA 1DG9A 4QUDA 2LP0A 1DP4A 2VP0A 4WL0A 5AVZA 2JA2A 3B6IA 1QG2A 3ZI7A 4DNFA 3F8MA 5JH7F 5D5HA 3ZK9A 1U2DC 1NG9A 3GTMJ 4D0SA 2RK4A 5IUKC 4DBVO 1JBEA 2BAGA 4XDYA 4RK4A 2CC2A 1Z5UA 2MR6A 2ZYGA 1S8FA 1ACJA 2P5YA 3WLHA 2IYNA 5AHXA 2DFLA 2CD7A 2QRGA 5KVQA 5KTYA 4E1BA 3CN9A 4DJEC 1T5BA 2ORYA 3BDIA 3F72A 2BR3A 3N07A 4ZI7A 1SUCA 3BERA 2A05A 3ANMA 2JVGA 3C5VA 4KDFA 1UEJA 4DDWA 2OHJA 3TQCA 5BQPA 2W2LA 4LB6B 2CE2X 1HTWA 4UEJA 2WM2A 1UAGA 4UU8A 1JT6A 1XVAA 1ZCBA 2BFOA 2O2DA 1GKUB 1EM6A 2OO5A 1XALA 4NYMQ 2R6FA 2IRFG 1XAHA 5HNFA 2O3RA 3CG4A 3HKBA 1X8XA 3WRXC 4Q21A 3SYMA 4PO8A 2X0RA 2XGMA 1U2ZA 3BOQA 1ENPA 1YQDA 5B3JC 1EGMB 4F91B 4FETA 4G0UA 1N2ZA 5DW3A 1PJSA 4R8KA 3DLLF 1MAVA 4XCXA 4F3RA 2OE2A 1ZK2A 2IUSA 3RVOA 5F3RA 1FSHA 1G9SA 1R6UA 3FLAA 3KVNA 4OJMX 2UYOA 4QXRA 4RLSA 4FCVA 5HQ3A 2BY1A 1XF9A 3F49S 2NSYA 2WJ6A 3FUXA 4O2AB 4DR4B 1R0LA 3C6YA 3LZDA 4H9GA 4BHPA 4MQBA 4QO8A 3VR2A 3VU1A 1GTZA 2EFCB 2HPZA 4OM8A 2M34A 4CIXA 2PQ6A 4V38A 1A9XB 1N0WA 2AFIE 3P9YA 4JP5A 5CNKA 4YIKA 3WLKX 5FWXB 2UUCB 1ZD2P 1ZGAA 1TWCJ 1XCVA 5M3MJ 2VOEA 2AW3A 3BR6A 2FFJA 1YRNA 2IV7A 4IMPA 2MYUA 1ACIA 4ZO9A 1KO1A 5BWBA 1RMYA 2MIIA 5IOZA 3DBLA 4G7OF 3K6KA 3GRUA 4GI7A 4QPCA 3JAWB 4RHXA 3ZUGA 4BLQA 3VOBA 2FKAA 5FPYA 4ESOA 6PAXA 5J43A 3BOSA 5LMNB 4JQFA 1H22A 3LLUA 3PUYA 3V00A 4DA6A 4HN2A 1RHKA 5EJGA 821PA 5GTDA 1SQSA 3AI1A 3RC9A 2PT6A 3AHIA 3BD7A 2BM0A 3DTYA 2LCFA 3HPRA 3PC8C 3Q0EA 3FR8A 2VXOA 1ON2A 4ISCA 4JLJA 2F2EA 5KJ1A 4TTJA 5B12A 3KEFA 1DQUA 3BCRA 1O1YA 3GLVA 3REQB 4M6VA 2ORED 1BI3A 1OASA 3VVBA 2RHLA 4PXSA 2FUG6 4A5OA 2F55A 5LOVA 5DGCA 1E66A 2EATA 2WV0A 1EFHA 3JSPA 3D7LA 1YBVA 2IVFA 1T9GR 4G09A 5BSRA 3PRYA 5BQFA 1GCGA 2XCQA 3L40A 2PWYA 4FZVA 1ENOA 2QRVA 2FNAA 3O4IA 3U44B 4O6VA 2P6RA 1T0FC 1YQAA 1EDEA 1P7VA 4HYTA 1JMKC 1HWYA 3P2EA 2ZUCA 3E70C 3HY6A 5EESA 4XGNA 3I4FA 2HKOA 1T0JB 4AJIA 3H75A 2UZAA 1AKEA 1DFHA 4ETNA 2PUCA 3N2ZB 5AOBA 1L4HA 3UFXA 2DW4A 4MTDA 3KRTA 1XKQA 5DP1A 1OCPA 4J16A 3EYIA 2ISZA 5IDQA 4XM0A 3OTOB 1C4KA 1WHTA 4DM3A 2QCOA 3OYLA 2JVIA 3R8FA 1E1LA 1K86A 5K9ZA 1VP9A 4CH7A 2XW6A 3I2FA 3F71A 3ZR8X 2R1TA 2YJ5A 4LXQA 4TV8A 4BNYA 5ESXA 5KTOA 1C4OA 1G2IA 1NF8A 4Z9FA 1KS2A 1NR5A 4G1UC 5G4LA 2HSDA 2M32A 4KUEA 3RT1A 3TAHA 3VDRA 3ZQKA 3CU5A 3OYHA 3D7RA 4EHLA 1ESCA 3EZ9A 3A4IA 3KUKA 4A15A 1MP0A 3N9IA 2QN3A 1RYZA 2Y99A 4RVHA 1NURA 5C8ZA 3KKOA 4TYPA 1W25A 2VBCA 1GPWB 2VPTA 3E0QA 4IJVA 1Q1QA 1OROA 3K1AB 2YYYA 2QE7D 1SU4A 2FEKA 5J3LA 3O6VA 3CNHA 4CKBA 5HDBB 2WV7A 3KR9A 4X90A 4DCTA 3SVLA 3GZNB 4YCSA 2Q99A 3WGMA 1QHHA 5I9LA 3T4UA 2WWXA 3DEFA 2SICE 3NVMB 1SIOA 4PC6A 1KY5A 1CEEA 3MYYA 1O96B 1OCTC 3IQIX 5AMXA 4DCMA 5D6EA 1DUIA 4ZOCA 5ALIA 3GHYA 1PG0A 1EJ2A 4YELA 3ILVA 5ERYA 2R1VB 4HZFA 2CXPA 1WAMA 1ZG1A 2RGCA 1YQTA 3VR6D 4B7AA 1NV8A 4CMEA 4HBLA 5BUQA 1OZAA 3IVAA 5EP3A 1P29A 4E94A 4AKIA 3C8HA 1QIJA 2P4SA 5I7EA 2Y75A 3OPYA 2M6RA 2Y1DA 3PUVA 1NYTA 4KFCA 3HLYA 1A8PA 5G0TA 2BFCA 3NHJA 2HHCA 1QYWA 3CUQC 1E63A 4G4JA 3BH6A 4Z86A 1V43A 4PZYA 3FFWA 2EGUA 4UTOA 5E3LA 1AHHA 1AA6A 1E3MA 2I80A 3ANNA 3KJNA 4Q6WA 4JOMA 3U3KA 3ICVA 5C2JB 5HGXA 3CLUC 4RLHA 3EUHA 1SB8A 4TKUA 5D6NA 4C01A 4B75A 3R60A 2OV7A 3JQQA 4CV1A 1I6LA 2Q8PA 3T3DA 5FRDA 1QAMA 1S3IA 3FMVA 3V7UA 1DBQA 3JD1A 1PQPA 2QX8A 1A9XA 1PQWA 4KWCA 3PX2A 2NVQJ 4RD4A 3LXRA 3NRCA 4C6RA 4EKGA 1N25A 1IN8A 1IUOA 1PP8F 1E8MA 1HLFA 3RZOJ 1XZEA 2PX4A 3KHKA 3OLWA 4RGQA 2E5LB 1QRSA 1GQQA 3MHTA 2YYZA 3KQTA 5JCPA 3S2GA 2G1PA 4XRFA 3HUDA 3LOCA 1HL7A 1YLFA 2FWPA 3ZY3A 3N2LA 5IT5A 3I9NA 2FPPB 4L72A 3JAKB 2CKMA 1QORA 1CY7A 1DPFA 1HT3A 6AT1A 2X23A 2O7RA 1I3LA 1CUIA 3EH1A 4TL7A 2VOOA 1DXHA 3AERA 2E35A 3MKLA 1NULA 3C6XA 4JZKA 2OTLI 3AESA 3NYWA 3GNLA 4UUOA 4E7PA 1D2CA 1KQGA 1PEDA 3Q15C 5D01A 4OINF 1N0HA 1XDGA 3V3TA 3Q0WA 1IG7A 1X94A 3WIOA 2DTXA 1S7OA 1XZNA 3FAZA 3QJYA 4B74A 3PP8A 4EY7A 1A5TA 2QG6A 3CD6I 3KJFA 3O4GA 1Y0BA 2J07A 4GDFA 3GGJA 2UV1A 5FBHA 1XHLA 2WQ7A 2XKPA 4MR8A 1E2HA 4HEHA 2NNYA 3U62A 4AD9A 3V9AA 2DCEA 4IIHA 4BWVA 5KQLA 4B2YA 2QM3A 4KVZA 2Q7OE 3E3VA 3D8NA 4YQYA 3W6NA 1TRKA 2PGOA 4PQRA 3DMRA 4IPAA 3W5SA 1DUVG 1W34A 3EGWA 1UDBA 2G72A 1ZIDA 4BN0A 1BVUA 3I5YA 3V4LA 3B3FA 2VXBA 3LCMA 4X84A 1I6HJ 4EM1A 4CGZA 2H2WA 1D6NA 1XXHE 4PHGA 4D4IA 4H7EA 1K7YA 2EFGA 2NX2A 4X3PA 1ODJA 4PC7A 1ZRFA 2CBGA 4RX1A 3RTEA 1I2DA 5CNIA 3WO0A 2WAQN 1ICEA 2EFNA 5FKOA 1M0TA 2G7UA 2JB9A 5DWVA 2JLQA 3R9KA 2XQKA 1XNRB 1EUQA 3CH5A 3TLZA 2PNFA 2DFHA 2VPQA 5CLLA 1K3UB 1ELOA 1IG3A 1KO4A 1NFQA 5EPEA 3G2HA 4X8OA 2X8JA 2XUIA 4XI9A 1XQXA 3ASUA 3W90A 3DAFA 3EE6A 4XMYA 1SCAA 3NTOA 4LJKA 3KPHA 2FW8A 3QM1A 2B83A 2UXNA 1SXHA 4IIJB 1P19A 4ZANA 2V26A 1MBZA 2QVZX 3WLLA 1NV9A 2C97A 1IN5A 2X5NA 4WVLA 2WIBA 4MUMA 1EX9A 1NUUA 3TW0A 1CY2A 2GPAA 1I1OA 2V7XA 4NG5A 1ZRMA 5HS4A 3JR3A 1LKZA 4RQUA 2DTDA 1B8OA 1O4WA 3KV1A 3MRVA 3DM9B 2A3NA 1WH5A 4UUSB 1BR2A 1YOVA 4N54A 3NJ8A 2VUIB 5CM2Z 2HWXA 3CF4G 3UB4A 5KTKA 1PGJA 5C1IA 1KQ0A 1BWRA 3EC1A 2BH2A 2XGDA 4L07A 2FUG2 2ZBEA 3GMTA 5TLSA 1WXQA 4XN3A 1ZLJA 1IATA 2RAUA 1XMVA 3FIJA 1QCDA 1UODA 4P4GA 4X8HA 3OZBA 2CHFA 3EPKA 2AGVA 4UATA 4RELA 3DLBA 4TSFD 1C30B 2ODAA 2ZE8A 1Y9EA 2JD1A 5FJ8J 5G53C 1XZFA 5CFNA 3KKEA 1SCQA 5HRUA 1Q50A 1Y6JA 1WG8A 3EIFA 4WV3A 3IUPA 2FMUA 3L7AA 1HLDA 1NTRA 4JLUA 5J1TB 3TVDA 1DKLA 4QQNA 4AJHA 2OOKA 3K9NA 4HY3A 2NOGA 1RXSA 3H16A 4KQXA 4TVKA 4ZC8A 4PPQA 2VNHA 2E1OA 1B9MA 2M6SA 3FDJA 4GLOA 5FF9A 4MUEA 3SXUB 4A3FJ 1NF9A 3K9GA 4F52A 4X8LA 2W6JA 3TTVA 3WTTC 3NDRA 3SIWA 1V5GA 3SI7A 3B1XA 4L5JA 3DTIA 3K09C 5J63A 3BSYA 4IKEA 2IIVA 4XWOA 3EXFB 3PE6A 3QVGB 3FBIB 3KSMA 5CTJA 5C7YA 2VQCA 4C30A 1EE9A 4CUZA 1LNQA 1O6GA 3A32A 5F7JA 5KUTA 2DAOA 3AF6A 2CT8A 4BBAA 2CWEA 2BYVE 3BUSA 3L7WA 2FSHA 3OO0A 1JDVA 3H7AA 5KNDH 3VOTA 3FZVA 1LW7A 3LUDA 3QXJA 3HCAA 1WFXA 2OBYA 5FRNA 3CUUA 3S7ZA 5BV2P 2QRLA 4R71A 2IHUA 3FZNA 1VB3A 5AJWA 4YRKA 2XSJC 4MPRA 1ZQ3P 1G66A 3I01A 4G25A 5CW1A 3DXJF 3HYIA 4AO6A 1E2LA 3ICQB 1DMSA 5BQTA 1B9NA 1K78A 1QR2A 1TCVA 2CDRA 1CC1S 3CCQI 3HLTA 5BYAA 1YFZA 1YJBA 1CZKA 1MG5A 2X7JA 3JZIA 3LC2O 4GZLA 2V7GA 3HN6A 4DPKA 1XPXA 2KRCA 2W22A 2R79A 4KMMA 4D8TA 4F4JA 3D6TB 1E0AA 2O1SA 4F45A 3EFOA 3PNTA 3VDXA 2WKPA 4LQ4A 1G6KA 4CMJA 2XLBA 3ZQCA 4V0RA 2CW7A 5FPHA 4YX9A 2OXFA 4ZMBA 1FXSA 2BDTA 3HA5A 1AUOA 1RPJA 3DKYA 1SK8A 2AYXA 1VA4A 4R5MA 1USIA 2YHSA 4Q4HA 1U3GA 1BMTA 1C7ZA 1L5MA 4BN4A 4LSWA 5DNYB 1S5LC 1V2GA 3TX6A 4NIMA 4H1VA 3TCNA 2QUHA 2QX9A 2JARA 3X2QH 1D0XA 2WOOA 3EYWA 2WMDA 3OM0A 3LUHA 1O94A 1V39A 2X1LA 1I2CA 4I55A 3R3XA 1KU2A 2Z08A 1IOLA 1F2TB 2JAPA 2P8JA 3JU3A 2XMQA 4GPZA 3SNKA 1JDUA 3ADPA 4DDKA 3CRW1 1PT7A 2DQRA 4QJ4A 2WAXA 4C2MJ 4RJLA 4PZZA 1Z4KA 3SFIA 4MI3A 2WFMA 3E03A 2CUTA 4QUBA 5J4LA 2LBFA 2JPCA 1JZSA 2QRUA 4GC9A 2CUKA 3GUDA 4NBRA 3PJEA 1LVAA 3VB2A 4QARA 4YBRA 1VLLA 4R83A 5IT9K 5EYPA 1ONOA 1YZKA 3E3LA 3TZ6A 5D4SA 1MO5A 2ICWG 4RTRA 4LF9B 1F9EA 1WCV1 3W2HA 3GFGA 1XX5A 4G5QA 5IWCA 4A0GA 1J9IA 4GYGA 3I2JA 3F6EX 4GOJA 3TOVA 3UFBA 1XJCA 3M9WA 1C1YA 2O0JA 4MS1B 4BLOA 2ZM5A 4JYZA 5H4HA 4Q4DA 5HMMA 4UOEA 3UNXA 2V7VA 1VGRA 2XE8A 4BO5A 3ZJYA 4ETWA 3D4IA 1U9YA 2HPHA 3AR5A 3L1KA 4UNRA 4QD3A 2G76A 4LE1A 3KKZA 4N9IA 5TSDA 3UJDA 5HBRA 4HBGA 4NBNA 2RVCA 4LJRA 3WG9A 1ZD9A 5HF6A 4FTWA 4F5WA 4LZZA 3FK7A 4B9EA 1OXKB 3PFWO 2I65A 4FDAA 1B8VA 4F3NA 1ZUNA 1GEEA 2H7XA 3CT6A 1OXMA 5H16A 3ZHSA 3QPUA 3UBMA 2JRTA 3K0AB 3H3ZA 3D3QA 2ET6A 4DHWA 3L8MA 1FNBA 2H4XA 1QVWA 1YA6A 3BTUA 1PUXA 1Q17A 2ZBKA 4JX5A 2Q46A 4Y8VA 2BBSA 4JCOA 1TW2A 1YC5A 1W44A 1IBCA 4O1IA 4ZAZA 3ZDXB 4A26A 9GPBA 5ICMA 5H83A 1E5DA 1L7MA 4PO3X 5JAOA 4FDLA 1RE0A 1ZGWA 4DM4A 2H1SA 3KJGA 1BOFA 5DNUA 3E9ZA 4CM9D 3VYSB 1KZ4A 2PL3A 5DS9A 3F73A 1B74A 1WI3A 1Z3XA 1JLMA 1X1CA 2L54A 3S3OA 1PJLA 1SD1A 3JY6A 3QKSB 4AMZA 5BSMA 2HOAA 1GXQA 1WB4A 2IP4A 4RMGA 5BUZA 4DR7B 3BILA 2QKYA 4Q7JB 3A02A 1L8LA 4UASA 2ASEA 2E2JJ 2WJ3A 1IDN1 2O1XA 3AZOA 4YUZA 4ZAWA 4XLAA 3O8CA 4HQEA 4X92A 2XGGA 1RLUA 1Y1PA 2ADMA 1AUQA 1UP6A 1Y4ZA 1FLAA 3BWCA 1JSXA 3QLVC 1BRTA 1ZN9A 1XJQA 4GX5A 3UUFA 4AURA 5FA8A 5K0GA 5FUYA 3VVLA 3STYA 3IMCA 2WMOB 1O9GA 2PU7A 2IU3A 1YZFA 1U8TA 2X1HA 2IS6A 5AW9A 3F3YA 3LLVA 3ZN2A 5C7OO 4K2HA 1PEYA 1N7GA 3MQ0A 1TLFA 4EY5A 2PR7A 2BY2A 4HDNA 2Z6UA 3GJ7A 2ZAYA 4RDIA 3OCYA 4Q4AA 3PPVA 1KKLA 3UK6A 4U88A 3LVRE 2FQ1A 3CMCO 3IBCA 3OQVA 5HIMA 5CK4A 1Z6ZA 4CEJB 5LU8A 1XSEA 4XICA 3EA5A 5E6RB 4ZO8A 1RXEA 1YO6A 2R6AA 4BRWA 4D8WA 5A0VA 4JLMA 1QAOA 5K3OA 1JL3A 1QBJA 5LBIA 5CYGA 2XYQA 2DWQA 3UMYA 5NULA 3TTYA 1JLRA 4I5IA 3ZXIA 4HNAB 4WA8A 2VHTA 5IN5A 2QDXA 1UWLA 2LOOA 4FHCA 4A82A 4N0BA 2RHJA 1MKMA 2DXIA 2NVXJ 1I0LA 2C84A 2YMMA 5A62A 3AK4A 4I4CA 5EJEA 2FMXA 4GCVA 1I2AA 4FFDA 3VSDA 4AS2A 1CXZA 1TU0A 3E8XA 2R7OA 1D7OA 5SV2A 3QFTA 2MSWA 5D6OA 521PA 3U2RA 3HI4A 1G8JA 3ILHA 4XSVA 3PLRA 4NENB 4EO4A 2ATEA 2JJ1D 1UBJS 3RSSA 4YCDA 4M8IA 5JD4A 1H9GA 1XMXA 1KFBB 1RT9A 1PFVA 3VSKA 1XMPA 2GSDA 1XV5A 4KMOA 2AEEA 2EOAA 3D6UA 4HDRB 4DRYA 3VPAA 1RC8A 4Y0AA 2DFVA 4AJKA 3NANA 2C4HA 3KJQA 4HA8A 3DH0A 3UANA 4BC0A 1DJQA 3U13A 4L0QA 3R3SA 2NAPA 4JJ4A 3OJWA 1U1FA 2I2CA 1QHHD 4YB8A 3OECA 1G20E 3HE3A 4FMBB 4XDZA 3RC7A 3L2WA 1HKHA 2AXEA 2ENUA 3JQRA 3HACA 3KYIB 3NALA 3S5JA 1B1AA 3GTQJ 4RKFA 2OBMA 3BJEA 1PFGA 3CRMA 3SYKA 1U9IC 1SMTA 2AN4A 3TQQA 4YDRA 1MEEA 2X77A 3R5FA 2DHEA 5A05A 1OU0A 3QVVA 4AXBA 1GZ3A 1KYVA 2QVOA 5CB0A 4D6PA 1P1RA 1I3OA 3DVRX 5D3MB 4PS0A 3V55A 4IDQA 3UM9A 4DN6A 3SEZA 1XELA 2ZRDA 1CVLA 2CUEA 1CUGA 1W7PB 2OP1A 2E4WA 3W5HA 4H17A 3RJ9A 4WY5A 2BV3A 2DJ5A 4EEZA 5B4TA 4AQYB 3R61A 2XMDA 1HNWB 3RYIA 1W49A 3AH8A 2IXAA 1F51E 4QLCU 1RYHA 4Y6QA 2A86A 5JXWA 1T5HX 3DFMA 1F17A 1P75A 1GNVA 1N7IA 2XMSA 1YUNA 2ZIFA 3A1NA 3IPAA 4KWHA 3V9PA 2I4LA 1ZW6A 3I30X 1PYDA 5CIQA 2VZ9A 3H9CA 4DQDA 1POXA 3GARA 4ARZA 3K9TA 1GV2A 2J3QA 5IJ9B 1N5KA 2DU9A 5J6XA 1BROA 1VPDA 2C2WA 2FZEA 3AQ4A 3JRDA 3CURA 3GD7A 3H2JA 4NULA 2IY8A 3T7RA 2ZFUA 5IYZA 2H48A 3MFQA 1OFUX 4WFKA 3PXDA 2OXIA 2PMZN 4MV8A 1IXKA 1J2UA 1ISJA 3TEMA 2VJOA 1CJMA 2N1BA 1LQ2A 2YNMA 3H9JA 2EA2A 1XSVA 4MTLA 1G6Q1 1H1TA 4QXQA 3RABA 5CFPA 1QGAA 3PNLA 3CJNA 1OWOA 2RAPA 3IBSA 1WBDA 3P5SA 4ETIA 4TGLA 4EA8A 2C9DA 5TQVA 2GETA 2D3TA 3ZJ4A 1TEVA 4BP8A 1QPZA 1L8OA 1JAXA 4FS8A 1GSHA 2M7AA 2Z8YM 2W6QA 3QAHA 4M0DA 1JXAA 1PQYA 4K6OA 1PZMA 2LR0A 1UT8A 1BO6A 2MYPA 2V9ZA 4H59A 5AP9A 1TYBE 2P7IA 5E1DA 3RTBA 3GO4A 3ZGYA 4E03A 4MMZB 3BQMB 5DBOA 2XUDA 2NZ8A 3JD3A 1VZ2A 2EBFX 3J7AC 2NUTB 3PFNA 3WV4A 5FLKA 1P9QC 5AK6A 4GEKA 4Y2RA 3THOA 4DUPA 1PFQA 4PF1A 1VA5A 1OYOA 1UH5A 4R4JA 5JSZB 1D0VA 2OCAA 3VJLA 4Q4CA