1XDSA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) and 11-deoxy-beta-rhodomycin (dbra)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
336
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGERPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDDAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein RdmB
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
total genus 101
structure length 336
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xdsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xdsA03
3QU3A 4N9IA 2RNJA 4M72A 5DRTA 2HGCA 4BLWA 1TQMA 2JRTA 3SGLA 2XVMA 2Y0MA 4RAYA 1IRGA 2OPBA 3DF8A 2V74B 2Z6AA 2FOKA 1NT2A 1BIAA 4ENMA 1JHFA 3ULQB 3FPHA 2ZFWA 3I9FA 5KVAA 3TDUC 3KQMA 4AZSA 1XDSA 1TW2A 3WTYC 3KEOA 4BHCA 2DI3A 3VC2A 4X60A 3V8VA 3ROUA 4KA4A 4ER0A 2PQ8A 3FRHA 4OBXA 4P7KA 5D8LB 5LGUA 2HDCA 3PTAA 5FGMA 2HTSA 2QENA 3HVJA 5FB2A 2DFIA 3D5LA 3DPTA 5A2QZ 2ONZA 3H2BA 5BW4A 5E8RA 3QOXA 1JE8A 4MTLA 4P96A 2R6ZA 1U5TB 4UUVA 1KHHA 3FTEA 1DL5A 3HSRA 3RPUA 4RVDA 3IRRA 5E1MA 4EMSA 2FE3A 6PAXA 3MZYA 4B09A 1UHWA 3Q5FA 3F22A 1SG9A 3DKWA 1G3YA 3BPXA 2AS0A 4XUDA 1F1ZA 3RIRA 3ANXA 3F8FA 2YXLA 4FX0A 2VBYA 1J75A 5BPDA 2EFWA 1JG2A 4P55A 5E2AA 3PFHA 3GW2A 3Q7EA 2XYQA 3UJBA 3ZMUA 1P92A 4EJUA 5ICFA 1YF3A 5JFRA 3MCZA 3UJDA 5FWDA 1QAOA 4P7FA 4KICA 4Q4ZF 2O06A 2KJBA 2STTA 2DBBA 3KP7A 2P7CB 3EGIA 4V0RA 3KLOA 4C03A 5F1RA 2RKHA 3M6UA 4G6QA 4GC9A 3K0LA 4PCLA 2WWYA 3FM5A 3Q9SA 3LA7A 2G8NA 4XSXF 3KQVA 1G4DA 2XVCA 5EQJB 3M8EA 5DX8A 2FSWA 1DPRA 4ENKA 3Q87B 4M9XA 3OU6A 2JPCA 3FZVA 5DM4A 5BMZA 3K6RA 1KXZA 5L3EA 3SZPA 2MC3A 2PEXA 4M9SA 1Y0UA 4E30A 4E32A 1J0RA 1TLHB 4LECA 4EGYA 1JG1A 1R36A 5DXAA 3FWEA 1INLA 2VOOA 2WA1A 2PVCA 2VT3A 4D0PA 3CUQB 5D5VB 1HW2A 2K27A 1R1UA 2AVDA 2P7HA 2F2EA 2ZFUA 5KYGA 3IHUA 5ED4A 3EMDA 3GGDA 5IT9K 4AUKA 4YMHA 3ID6C 5EKXA 4AVPA 1AQJA 3TO7A 3ZMDA 3IV6A 2IP2A 2EV6A 2XVAA 1CF7A 3F3XA 3C6MA 2KIFA 2FNAA 4YUYA 2HQNA 3DXZA 3VB2A 4AIHA 2HV9A 1XMKA 4LK0F 3G8BA 4WVLA 3IYLW 4R8RA 5F2OA 1NW7A 3C7JA 1OPCA 5K0CA 1L1EA 2BM8A 3GYHX 4HGYA 4RAZA 1B6AA 3G5LA 2L3DA 4XUCA 5DTMA 5DYMA 5E1XA 2HYGD 3HOSA 1IUYA 5HDGA 4KUMA 1CF7B 1QANA 4PNEA 4PYJA 3EMBA 4M6XA 3KLNA 1X1BA 2NYUA 2E7WA 1F38A 1VBFA 2AN5A 1I4WA 3HCEA 5EPEA 1HW1A 4IPAA 5CVUA 1IAWA 3NMUF 3KE2A 1S29A 2DAOA 4NECA 2DU9A 3FMSA 1TPYA 4FR0A 3IL2A 5FQOA 2Q41A 2VODA 4M73A 1S3JA 1OKRA 3FMQA 1NV9A 3EVGA 5K05A 3LWFA 3JWIA 2Z99A 2BBYA 3K9TA 1MJAA 3R0AA 2PT6A 3ER8A 5DT2A 5HDKA 5K01A 1ODDA 4EVIA 5K5OA 3GNLA 5K0EA 2VDVE 2ORED 4HH4A 3MZHA 3GFJA 2OZUA 3JSOA 3EGVA 3JWJA 1RJFA 3AJDA 1RI7A 4KIGA 4HX7A 2DLLA 4CICA 3HRTA 1TTYA 3I58A 2ZTHA 3R6TA 2CW0F 2ZMEB 2FPOA 1BC5A 2A3SA 2V1UA 4RB3C 4ON0A 5K09A 3K1MA 5EMMA 4UOEA 1LVAA 3ER9A 2IGTA 4KIBA 3QP6A 4GOMD 3TDZC 3ABUA 2ZZNA 2JJQA 1DPUA 2UYQA 1P91A 1KPIA 2FQ3A 1MHTA 4CYDA 5DTQA 4YV0A 2ZW9A 4CGZA 3F72A 4QPPA 2CSOA 3E7PA 3NRVA 2NP6A 4XLPF 1I1GA 3IC7A 1NW8A 2JPBA 3LDGA 5K0BA 3HUGA 1M0EA 2XIGA 1KYZA 2PN6A 3KFWX 4LLLA 5GIPE 3P97A 5JR3A 2CFXA 4NB5A 1PP7U 4IHSA 4RTMA 3KQPA 3F8BA 4UV8A 1XN7A 4L9TA 1EH8A 4PIMA 1YFJA 3FUTA 1D3YA 4NQWA 3M7GA 2PXXA 3FF5A 1U2ZA 3P2IA 4U0WA 5F2NA 4L9JA 3O2PE 1RUOA 3MCTA 3L9FA 4MTDA 3JWGA 4PDKA 4HYEA 4MEXF 4KVZA 4Y15A 4ESFA 2E5WA 3CLOA 4FT2A 1E2XA 5HS7A 3D0SA 1YFHA 1XXLA 1TNSA 2C6YA 3QPTA 5CD1A 3HNRA 2O8XA 4EQZA 4QQKA 4LWPA 2XRNA 3U9GA 4DNCA 5HLHA 2OO3A 1LDJA 2C7OA 3TOAA 2XYVA 3BWMA 4IKPA 4BYYA 4YUWA 3LGAA 4YUVA 1QPMA 2GLUA 2K4JA 2AOXA 5M5BA 4OQDA 3IKVA 1ONVA 4RTQA 3FYDA 2L54A 3ZN1A 4IXAA 5HOOA 4YFXF 2L02A 4BLUA 5E8GA 4KW7A 4EKGA 3V7CA 5BOXA 4OIOF 4RTLA 2G7HA 1R1VA 4I98B 4DCMA 3OZTA 2FBKA 2O03A 3ML6A 1KU7A 1KPGA 3HTXA 5H02A 2VOPA 2MD5A 3B73A 5DSXA 1N7IA 2MH9A 4G7ZF 3KZZA 3V8LA 4ENJA 1WXXA 3ELKA 3OU2A 1BKYA 5CVRA 2BGCA 4S05A 2ZWVA 4DM3A 1KQ9A 1QAQA 1FBUA 5DCMB 1I1SA 3CC8A 2HWVA 4KN7X 5BPIA 3ZPLA 3T8RA 3SSNA 1YZHA 2Y1XA 4NHJA 4MGRA 2K4BA 1Z1DA 2EV0A 3PB3A 4ZTBA 3SR4A 4C05A 1M6YA 1YB2A 4N0BA 1VTNC 1XDUA 1TQIA 2BZGA 2XAGA 5DDGA 3BWBA 3ZP5A 3R0QA 2XASA 3MAJA 4CHUA 4Y17A 1EJ6A 1YLFA 4PONA 1JQDA 1B9NA 1H9GA 2K7LA 4KDPA 2EFOA 3X0DA 4L0ZB 1SD4A 3WGGA 3F21A 5D6EA 5FA5A 1FWZA 2H1RA 3G2OA 3GX4X 3O31A 5F64A 5LBQA 2ACJA 4HF1A 1NW3A 3KEQA 1NBHA 5LGTA 3GRRA 1SKMA 3J7AO 2Z9OA 4HG2A 2HOEA 1IN7A 2IFTA 3OFKA 2LDUA 3LA3A 4HV5A 5EEGA 1R23A 1G3TA 5E1DA 2DQLA 5K0GA 3U81A 1ULYA 4OMZA 4QWQA 4KFCA 3DLCA 3R6SA 2IIPA 3S2WA 1KQ8A 2C7QA 2AOUB 4JXJA 1H1DA 5AIPA 5K0LA 1PDNC 5LQRA 3J81Z 5EMLA 3CTAA 3WE2A 2YX1A 2RGVA 2XAJA 3KQSA 2YR2A 1HKQA 2EWNA 4L9NA 4HDVA 3J80K 4M6YA 1E17A 3GRUA 3P9NA 3PS9A 4JQFA 1HNNA 5HIMA 5D6FA 3OZSA 2MH2A 5LRSA 1WY7A 4O3MA 2P7VB 5EGSA 5L3CA 3JAMZ 3AXTA 3ERED 3CO7C 5FD5A 2VC1A 2PX8A 4RSRA 1FY7A 3NTVA 2CKDA 4RVHA 4PYQA 5IT3A 3I4PA 2KIUA 1D8KA 3RKXA 1OR7A 3BKWA 2BV6A 4OQEA 3TMAA 2P5KA 1QBJA 3FXUA 3M1EA 3BGIA 4DKJA 2YUIA 4A2UA 5D4SA 3H3UA 3TM5A 2DULA 1YIOA 1YTYA 3ZMVA 3I53A 3LQRA 2Q0OA 4E2ZA 3M9AA 3TO9A 3HRMA 3P9CA 4CTJA 5FULA 4S04A 3QOPA 5K0FA 3NDJA 3BJAA 1DCTA 3F8CA 3G89A 3PT9A 5BQTA 2RVCA 1HXDA 2AXLA 5LQCA 3R61A 3BGVA 5DRYA 3SXYA 2FK8A 4RTRA 2PFBA 3DQVC 5EC8A 5CVIA 5CM2Z 3O3KA 3NEUA 3TQSA 3G88A 3V7SA 5K5QA 2FRHA 5GOZA 4XLNF 4H0NA 5BS6A 4ER7A 1NW5A 3O6BB 2ZBKA 3PX3A 4EM0B 4PIPA 4XSZF 2VBXA 2PT9A 2BYVE 3M33A 2HYFA 2F5FA 2W85A 5AONA 5A2QK 1K78B 3LDUA 4EJOA 2G9WA 1DUSA 1OR8A 1W7PD 1FZPB 5DM0A 2OD5A 1NV8A 3QPHA 5T67A 3V4GA 4IRHA 3T8TA 4KMUX 3TFWA 1WQ2A 3A4TA 3JWHA 5LSAA 5CVVA 4AD9A 4ZH4F 3FXRA 4KDCA 3CDHA 5LQNA 3A27A 1XJ5A 2P35A 4X41A 4C04A 1RI4A 3REOA 4GBED 3OU7A 1D8JA 4DCGA 3G2MA 3KPYA 3KQWA 4C06A 4A6EA 3M70A 5F6FA 1AOYA 2V1XA 1XCLA 3GFLA 2PMUA 3PLAE 1EIZA 1ZRDA 2YU3A 4L5JA 5L3GA 4RTPA 2XAFA 1YW7A 5EMKA 1NBIA 1IXKA 1D2HA 2ZBQA 3HHHA 4A12A 2EJTA 1ZN2A 4U0YA 2VDWA 1W4MA 4I0BA 4QDKA 1BJAA 2YSRA 4BAYA 3BUSA 2OQGA 4GGGA 3DMGA 1HSJA 5LHIA 5LRRA 2IT0A 2CL5A 3EPPA 1X1AA 5TRDA 5E9JA 2FYTA 3B7PA 4G56A 1SMYF 4P9UA 1XCVA 4M7RA 3B5IA 2BR3A 2HS5A 4EJWA 3C3PA 3DEUA 4X61A 1SFEA 3HSEA 2K02A 5CYVA 1FOKA 2PX4A 1U5TA 3G3ZA 2XHKA 5FO5A 3FPEA 4UNOA 4PINA 4TV7A 2C7PA 5GP1A 3RPQA 4U7BA 2QQ9A 1EV7A 4M38A 2NNYA 1UCRA 2FF4A 5HEKA 3GIWA 2XKOA 4HW0A 2NXCA 3BZBA 1U3EM 1R1TA 3B3JA 3GRZA 4WXCA 2Z6QA 2O07A 1XCBA 3QP5A 1LDKB 4R8HA 2FXAA 3A7EA 1R5HA 1ZRFA 2ZJ2A 4IHTA 1P6RA 5CJ9A 2AS5F 1KYWA 1ZGJA 3VOEA 3WG9A 3WTWC 3TKYA 2XYRA 2AOTB 1VL5A 1J9IA 3RKWA 1G8AA 2OB1A 1ZGAA 1O3TA 5DLYA 2HKOA 4QDJA 3SMQA 3ORHA 4QVKA 1OMIA 3NQOA 3ELUA 4E33A 1YW9A 3LX6A 4N9HA 2I9KA 3GDHA 3SVZA 5DSTA 1VIDA 2N47A 4MNUA 4HA8A 1BI2A 4HLXA 1FLIA 5JUWA 3RDIA 3GZ5A 5D1HA 5K1YA 3LFKA 3WTUC 2LD4A 1ZKDA 2ZNZA 2OA4A 1GXPA 1YW8A 2M45A 3THSA 3H92A 3BPVA 1R7JA 4UVBA 1STZA 2AR0A 1O9HA 3F23A 2D1VA 4U0VA 2B3TA 3HVHA 2ZCWA 1L9KA 3CUQA 2IPQX 3T0YA 2HTEA 1R58A 2YX7A 3ELDA 3R4KA 3LPMA 2NXNA 4MWZA 4OBWA 2GZWA 3NWBA 4U7TB 3FTFA 4OU0A 4AZWA 4L0YB 5C9ZA 2YXDA 2JSCA 5ILUA 4LLNA 2P6TA 2PJPA 2G1PA 5HIJA 3EETA 5E18F 4E31A 2BH2A 3TM4A 1JG4A 3LHDA 4JBAA 3DOUA 1FSHA 1PJZA 3V8KA 3I0TA 2QLZA 3GO5A 3E5QA 4Y13A 3C1DA 3BWCA 3FTCA 3KPVA 2IH4A 5E1OA 4PGHA 5BP7A 2QYOA 1AWCA 1RJDA 3GEZA 4LD5A 1U2WA 4GXOA 1QZYA 4BP1A 3EGEA 3V7RA 4ZYHA 3EVCA 3GRVA 2OU2A 3DTNA 2OQRA 4PYNA 1G6NA 5DPMA 1BOOA 2ADMA 1SQGA 4HTFB 4HSGA 1W7PB 4CXMA 2ZIEA 5IH3A 4ZYEA 1JHHA 4M37A 3ZMTA 3KR0A 4Y30A 2P40A 3ZMZA 1FYKA 1G55A 1WG8A 2ZSUA 4RS8A 2EV5A 4MEYF 2JTVA 1D2CA 3PVCA 2GXBA 3TLJA 1H9TA 3MAGA 3WTSC 4EKIA 3HCFA 9MHTA 2PXCA 4F85A 5LHGA 2KW5A 3BP8A 1U8RA 3FUVA 3BT7A 3O4FA 1R00A 3E6DA 4EM2A 3FXQA 2ZMEA 4L7VA 4RVFA 5FUBA 4RX1A 3EYIA 2OBFA 4HGZA 1XVAA 1KA8A 4WK8F 1BOAA 2FU4A 2QQAA 5ICCA 3EYYA 3FM3A 3CJRA 3MB5A 1OYIA 2YR0A 3FUWA 3COAC 2EA4A 4MHTA 1L0OC 1ORIA 3CKKA 5FA8A 4LFUA 3UJAA 1WXWA 3HTSB 2M87A 1S6LA 2LF8A 5HFJA 5IKMA 4PYMA 3ERCA 1I5ZA 1MZBA 4FT4A 1HSTA 4OX9Y 4AZTA 4ATNA 4A0ZA 1IN6A 1BN5A 4K6MA 3E6BA 3JW4A 5KQSA 4GCVA 3K0BA 2O61A 4M71A 3I71A 3JTHA 4RWZA 5LQJA 2YTZA 2EG5A 5FHQA 3ISPA 2IDJA 2RN7A 1Z9CA 1FBSA 2XV4S 1FX7A 1AQIA 4E2WA 1I27A 3M4XA 3KZYA 1ON1A 1Z6RA 1SVUA 4DQ2A 2PGXA 2K86A 2YXEA 1J7KA 3GF2A 4LB5A 4FT8A 5DV5A 1G38A 3RW9A 2XROA 5IT9Z 2EFPA 3GLXA 1G8SA 3LCCA 4MTEA 5ILSA 4I7HA 3P71T 4XRFA 1OYYA 2IW5A 1XSVA 3PFGA 5MHTA 1ZARA 2F5DA 3EVAA 1T39A 2B0LA 4A5MA 4YV1A 4PCAA 3THRA 1YQAA 2KRFA 3DP7A 3SSMA 2H6BA 4CKEA 3I59B 1U78A 3LCUA 3MERA 1Z05A 2B25A 2BR5A 1KIAA 2VP3A 3LDFA 4G6DA 4GO1A 2GB4A 3HCBA 5JI6A 2OY0A 4RGUA 2O57A 3HHGA 5CCXA 2PV0A 5FHRA 2L01A 2NP7A 5FLXK 4DA4A 2PLWA 1RZ4A 4ER3A 1SD7A 1WS6A 2EB7A 1WWXA 3G8AA 3UA4A 3BZ6A 2CQKA 2B2CA 4GF5A 1EG2A 1ZHFA 5FQNA 2EJUA 2DK5A 5HOQA 1K6OA 2IJLA 1K7AA 1SQFA 3LA2A 3C18A 5EEHA 1Z91A 2P1DA 3Q9VA 1XGNA 1WZNA 1G6Q1 3E5UA 4L5IA 4QTTB 3RYRA 4RGRA 1GHCA 5CCBA 2M1BA 1Q1HA 5DCMA 3LKDA 3HVKA 3WSTA 3EEYA 1NHAA 2ETHA 4XBFA 3KETA 3ME5A 1RNLA 2XAHA 2P6SA 1UHMA 2QBYB 1O9GA 1VE3A 2COMA 3H3ZA 2UWMA 2QQBA 4GOND 4MQ9F 1KP9A 4OIPF 2O05A 4GYGA 4R8SA 5DCFA 3OPNA 1BC7C 4ISCA 5LQUA 3HRSA 3DMHA 1USSA 3SZTA 1P39A 4LK1F 5GIOE 1YG2A 1J59A 3M6VA 4PZJA 2BR4A 3LBFA 1KU9A 4L18B 1XD7A 2PBFA 2TDXA 1OYWA 4CO8A 4B17A 5LQAA 3KP5A 5D1NA 2EX4A 2GS9A 3VSEA 3UBTA 5EMJA 4DMGA 3AY0A 2G72A 1I6XA 4HLYA 2UYOA 4IF4A 1FP1D 2JHCA 3DPLC 1TBXA 2NAZA 2ZZKA 2Z6UA 5K8VA 4MQ4A 4ZZDA 2QVOA 4A5NA 3C3YA 4MQVA 2ZZMA 4C08A 2AOUA 3LBYA 4RB1A 5CVDA 1YS7A 2UXNA 5HS8A 2PX5A 5FCDA 2VE8A 1W5SA 3TO6A 3GU3A 5B1SA 5D5UB 4O29A 3A7DA 1XCJA 4KRGA 1A04A 3FPFA 1HQCA 5H6RA 1MKMA 2ERCA 5CVJA 3A25A 4YUZA 5L3DA 1TQPA 4BP3A 2NNNA 3EVBA 1ZAOA 4LGWA 3MTEA 5GM1A 3B3FA 2X0LA 3KP6A 3UJ6A 3KQTA 3GVAA 1REPC 2LKPA 3LL7A 4ESJA 1AF7A 2VC0A 5J8FA 2A68F 1I1NA 1ZLKA 5L3FA 3BJOA 3T7TA 2C7RA 1BBYA 5EOVA 2A07F 2HKXA 1YS6A 5D5WB 3BY6A 4RTNA 5E8IA 1KGSA 3BROA 4ER5A 5TJJA 1JTFA 3DLIA 2FK7A 4AZVA 3DXXA 3HCAA 2X4HA 5H6QA 4YFKF 1PRYA 2OXTA 4WX9A 2R7FA 3SQNA 1EQAA 4UXNA 2GAFA 5DD4A 5DWQA 3HA3A 2ONYA 3FMRA 4I09A 1UB9A 2AOWA 3KR2A 3WE3A 4KDRA 4P7GA 2ZXJA 2P4WA 3WU0A 3EVFA 4QPNA 4A0YA 1XSDA 4BXUA 1ZG5A 2ISZA 3E97A 3EDPA 2VXZA 4WF2A 3E3VA 3NWEA 3L09A 3R3HA 1YFLA 3T5XA 2JH8A 1I9GA 3DFGA 2FRXA 2O0YA 2P41A 2JHPA 2LF7A 4HRAA 1Q0TA 2P8TA 2PLYA 1BI1A 3ZQ7A 1IN4A 3K1NA 4KN4X 3MEXA 5DTRA 5GWXA 3OV8A 3KPWA 4YG2F 5FD6A 3U2RA 2ZO4A 1K78A 4HQMA 4RB2C 1EAMA 4QVGA 4R1HA 4R79A 5FADA 4OA5A 2EFNA 3FTDA 5F2KA 1RI2A 1S7OA 1IXRC 3L00A 4ETSA 1DDNA 4G7OF 1N7JA 4M36A 4R6WA 5K0JA 3UZUA 1MDMB 1ZLJA 2DPUA 3RODA 2D1HA 2G70A 2ZIFA 5LQKA 4PYKA 3HSFA 3W6JB 2JT1A 3UJ7A 3GRYA 2A5YB 4YUXA 3CVOA 2AOVA 2YPRA 3DR5A 2OBPA 5DX1A 1R8YA 4P7JA 3SXJA 3T1BA 2CO5A 4WXHA 2ZCJA 3OOPA 3JTGA 3P9KA 1UFMA 2FEZA 1B1BA 4I01A 1Z6TA 4I2OA 3FRIA 2OKCA 1HKTA 2F5CA 3C3WA 3EUHA 4GEKA 4CTKA 4BY9E 1HKSA 3MWMA 1BHJA 2PG4A 4YMGA 3HRUA 2A69F 4HX4A 4HBLA 1LEBA 3TR6A 2NNWB 1XMAA 1T98A 10MHA 2PX2A 3KHKA 4U7PB 5ERGB 3S68A 2XKPA 5D8KB 2UZKA 4JK1X 1RI3A 2QRVB 3HEMA 2BE5F 1B4AA 1PP8F 5HLIA 2DT5A 3T0IA 3G2PA 3M8FA 3F8NA 2ZNYA 2HR1A 3LKZA 4RTJA 4AIJA 3FUXA 2HNKA 4GUAA 5GINE 1G3SA 4LG0B 5ERIA 3FPJA 4GYIA 3UJ8A 2CG4A 5EHIA 3G7UA 1WSUA 2EJRA 5CIYA 5HIKA 3L7WA 3BDDA 1SMTA 3WTXC 1XTPA 3HIFA 1XSXA 1UWVA 3N97A 3E8SA 4FP9A 1L3CA 3OCJA 1JG3A 4A0XA 5E1BA 4OINF 2PMHA 2G7UA 2EFJA 5H20A 1SUIA 1G3WA 2O0LA 2E1NA 1JTEA 4Q5SF 3EVZA 3PFIA 1NE2A 2WA2A 3ECOA 3I54A 2VDUE 2G71A 2OZ6A 3KP3A 3DMFA 1JXSA 4DF3A 2IVMA 2J5PA 4HF0A 3WU1B 4FZVA 4G94A 4LWOA 4ZYDA 1QYRA 2AOTA 2QE6A 1C0WA 3IWFA 1P4XA 1R18A 2UZ4A 2JG3A 1KQ0A 2R3SA 4F7ZA 3CJQA 2NRAC 4MIKA 2YVLA 3I5UA 4Q47A 2VBWA 3CGGA 4E2XA 2XUBA 2M8EA 5DUKA 5LGNA 1LDDA 3B02A 2P7IA 2RDPA 4UVAA 1B42A 4MHGA 3NDIA 2CYYA 1XDZA 4M9ZA 3MFKA 3TGNA 4CKBA 1GVJA 2O3FA 1P2FA 2HZTA 3KCCA 3IWZA 1VP9A 1L3LA 4V0QA 5U4XA 4OIQF 2MA3A 3C0KA 4IJAA 3E5XA 1J5YA 2UYHA 1V39A 4F84A 3EEOA 4IVNA 4CDGA 3QAHA 3TQNA 3P2EA 5FFXA 2XGXA 2EFQA 4X63A 2W84A 1SUSA 3DUWA 1T6SA 2M30A 1RJGA 2STWA 5FTWA 4WWCA 2HWKA 4B8XA 1ZH5A 4Z2YA 5CUQA 3FZGA 5EVJA 3LAJA 1XB4A 4H0EA 1JR4A 2A61A 1MJFA 1IF1A 1CGPA 1JQEA 2Z33A 4WCGA 4RGXA 1IN5A 2QZ8A 4BLVA 2MLKA 2PSSA 3SM3A 1P4AA 4WXDA 4AX8A 2AN4A 5K5RA 5CVEA 4RB0A 3IKTA 4DQ0A 1JSZA 1J2XA 3WODF 1V4RA 4CWAA 1Z7UA 2LSOA 2D45A 1PUEE 2P3QA 2NXEA 1BC8C 3R9XB 2RQPA 4BQAA 1QAMA 2P8JA 1UFKA 3HA5A 1B59A 5LEKA 3PQKA 1SD6A 3PQJA 2ZLBA 3MGGA 1LQ1A 1WI9A 4EK9A 5LEJA 3GUDA 1X1DA 3LSTA 3AXSA 3PX2A 1U5TC 2L4MA 5ILVA 4HZFA 1X19A 1M6EX 3R24A 3DULA 1XGSA 2IH5A 4FGZA 1D5VA 4I0AA 3HA7A 4HTFA 4I02A 1IXCA 1DUXC 1EH6A 1KU3A 1W7PA 3K2ZA 4ASNA 3BWYA 3RJPA 4RTKA 4P58A 2GXGA 3NVKI 1VP3A 3BXOA 2F5EA 1S8NA 1JSXA 2Q2EA 2ISYA 1TNTA 2QY6A 4EM1A 4FHTA 2GQQA 3CUOA 2V7EA 4O5VA 5E8JA 2A6HF 5HIIA 2LNBA 3UA3A 3VFZA 4RVGA 4Q48A 4ZYGA 3UJCA 3NW9A 2KKOA 3KP2A 2HQRA 4HAMA 4EJTA 4U88A 3WGIA 4GC5A 3GXOA 2DPDA 2NS0A 2ADUA 3VC1A 3M6XA 3OZRA 1O3RA 2VN2A 1VLMA 3KQQA 2H94A 2JH9A 1SFXA 5HZMA 1VQ1A 4GQBA 3RKYA 3T7RA 2H27A 2Y48A 3ABTA 4KNYA 2J5OA 2E7XA 4BHBA 3GJYA 3RIEA 4IRIA 1S7AA 2M5WA 2H11A 3FHZA 2FBIA 5GM2A 3GWZA 3KQYA 5D4RA 1B9MA 4RTOA 1FJXA 2R7DA 4PCQA 5T64A 2IRFG 4EQQA 2A6EF 3VEPA 5E9QA 1IY9A 3TRKA 2H09A 1RI1A 1XGOA 3K69A 1UIRA 3CUQC 5KS2A 4IV0A 2VE9A 1ZG1A 5DX0A 3DV8A 2W25A 1X1CA 3BKXA 1YO5C 1R8XA 4AIKA 4AWXB 2L4AA 3RI4A 1JGSA 1L3BA 2DTRA 1HW5A 4HX8A 3P7NA 1ZQ9A 5KK1A 2Y75A 2FHPA 3KPJA 4POOA 3DXJF 2P5VA 4G7HF 2ESRA 2FCAA 4HV6A 1LNWA 2V9VA 2BM9A 3BWGA 1ORHA 2GA9A 3G2QA 5BXYA 5E2BA 3R0JA 3KQOA 2HEOA 1U6GA 2Q8KA 3EQLF 3SFZA 2CMGA 3BJ6A 3I59A 2IA0A 4U7DA 2NXJA 4EGZA 4R05A 3KP4A 2W24A 2HMYB 1F5TA 1IN8A 5JHUA 3VYWA 4BHPA 2CWEA 3G73A 5HILA 4P9FA 1IW7F 4GOLD 4ENNA 5KVRA 3HVIA 3FYCA 2VT2A 2E1CA 2PKWA 2PWPA 3AAFA 3HCDA 3UWPA 3OFJA 4HDUA 1IM8A 2IBTA 2OAZA 1P1CA 4PYLA 4FSDA 2JHAA 2KJCA 1WRJA 2CMHA 2PY6A 1RJEA 2I62A 4X1OA 1HMYA 1FYLA 3LECA 3IEIA 4P5OA 1JQ3A 4BH9A 2F8LA 5C1IA 3FPGA 3LAPA 3TOBA 4M74A 2FBHA 5BW5A 4ESBA 4OA8A 4FS8A 2V1DA 3GO4A 3KR9A 3L2CA 4HF2A 2IA1A 3KU1A 2QBYA 2ESHA 2V79A 1Y8CA 3J81K 3HCCA 4OIRF 1QQIA 1RUNA 3L8DA 4XUEA 4LG1A 3DXYA 3FUUA 5HVQC 4K2EA 2CGPA 4RV9A 1O57A 5CLSA 1F9NA 1USTA 3P9IA 2B78A 3M6WA 1BI3A 1QO0D 3IHTA 1IRFA 3SX0A 3FX3A 7MHTA 1F4KA 5ICGA 3P8ZA 1MD0A 3JAMK 2P3OA 1BM9A 1V3FA 1MJ9A 3D2LA 4EJVA 5EZQA 2ZKZA 1FT9A 3E05A 3GFIA 2IDKA 4KIFA 2ZWAA 1QZZA 3CCFA 3WTTC 3SHFA 2JZYA 4LB6B 2YQZA 1LEAA 2EA2A 2H00A 5T6BA 4UHTA 2RC4A 4FX4A 1BIBA 5K03A 1FP2A 5E20A 2VONA 3ELWA 3KPUA 3LCVB 5E1ZB 2Z5UA 3TOSA 4PYOA 1MGTA 1W5TA 3QOWA 8MHTA 2KIMA 1WKMA 1EH7A 3B89A 1KPHA 5AIQA 3RTRA 2HFHA 3MTIA 3BGDA 3U1DA 2I7CA 2PXAA 5EIFA 2UYCA 1N2XA 5DXJA 2VS1A 4OOIA 3WGHA 1FBNA 1FBQA 3JSPA 3V8JA 1KR5A 1YUBA 1ZG3A 3R60A 5LLQA 3ELYA 1NW6A 3ECHA 5DD8A 3E6CC 4HOBA 4R6XA 2DW4A 3F8MA 3QU6A 3LQQA 1ON2A 4LLGF 4F86A 1XGMA 1F3LA 1O7LA 2FA5A 2GWRA 2GH1A 2GPYA 4HQEA 5EKUA 3GFMA 3C6KA 1L3IA 1R74A 5ICEA 2CWWA 4RTSA 3UFBA 3IRQA 1R22A 3RYPA 1X3UA 1FPQA 4E70A 5FLXZ 4XCXA 3TKAA 3TPZA 4OMYA 3G5TA 2OZVA 2P5LC 5G02A 1QNTA 1O54A 5P8WA 2ZULA 1KU2A 1T2KA 1IXSB 4HC4A 1FC3A 5EIWA 4YIFA 3SSOA 1P4WA 2MLGA 4DZRA 1LJ9A 3WTZA 2EK5A 2PI0A 1O7FA 1HBXG 1QGPA 4E2YA 2OYRA 1D2GA 4EV0A 3GZ6A 3DH0A 2QM3A 4YIIA 2AZTA 2ZIGA 3I64A 2MBFA 2UXXA 2WV0A 4KMFA 4IV8A 2IPXA 2HR3A 3AWIA 2O6GE 4A6DA 3GCZA 4PGGA 1VPTA 3E6MA 1EJ0A 3VODA 2A14A 4G9YA 5EHGA 2OB2A 2DPMA 1P1BA 5JVTA 3EVEA 4Y2HA 2IH2A 3HTUA 5LHHA 3CBGA 2VBZA 1FYMA 3MQ2A 4FSXA 4C07A 3K1PA 3T7SA 2DQRA 1RIOH 3KKZA 2VZ9A 2NYXA 3HOTA 3BOQA 5FFZA 2HTJA 2DO7A 4YFNF 1MDMA 2V6CA 3O7WA 4BNCA 1R6AA 1BI0A 1YYVA 5HLGA 4KWCA 4QLCU 5E17F 3V97A 5LR6A 1FNNA 2IA2A 4PWYA 1H0MA 4YV2A 2RV8A 2D2WA 1Z3CA 1T0FA 2ELHA 4GOOD 2Z3YA 4IWNA 2XBMA 2FMLA 3HM2A 5L3BA 1SD5A 2P3LA 5C0OE 1K79A 3OE5A 4LJZF 5FWAA 3QRFF 3KR1A 3MHTA 5HS9A 1YZ3A 2ZVJA 2BEOA 3B3GA 1ZYRF 1G60A 2H6CA 4KYWA 5J8CA 4KT5C 2XAQA 4LMYA 2Y1WA 3HP7A 1O3QA 2GAUA 1R5GA 2AN3A 2PJDA 3F6OA 2QRVA 3QV2A 2PBIA 2DK8A 4G8XA 3CJTA 3UJ9A 3WTVC 5DEQA 5J6XA 1IZ1A 5EZSA 5HDNA 1GXQA 2YX4A 1FSEA 3ZMSA 1ZRCA 4CZZA 4UV9A 5E1WA 2ZBPA 2W57A 1AV6A 2AVNA 1TW3A 2GA1A 4LG0A 3CO6C 3J80Z 1SFUA 1NKVA 3NJRA 1MJBA 4QTUB 1LB2A 5EG5A 2ESNA 2ZBRA 2WTEA 3CJNA 3W6KB 2PWYA 3N4MA 4ZZLA 2WK1A 4UVCA 4RGSA 4RYLA 5DUIA 1RI5A 3OE4A 3EVDA 3F4KA 5K0NA 3E23A 2GA2A 4QQNA 3P2KA 4O6JA 2FNPA 2GIVA 5DM1A 2WC2A 1ZREA 1Q0SA 4CXFA 2B9EA 2QWWA 3A26A 2I6GA 3MQ0A 2IBSA 1T43A 4CKCA 4IRGA 5KQRA 4ER6A 4PYIA 2FMYA 3ZN0A 4C4AA 1DP7P 3NVMB 2QUFA 5E9WA 3F6VA 3HYIA 5D5XB 2K4MA 1O3SA 5DM2A 1SAXA 1T38A 4L9VA
chains in the Genus database with same CATH superfamily
2H1KA 1UWCA 3CRNA 2XVMA 3WU2C 2BEKA 3RYIA 1Q1NA 5IJXA 4IJMA 2ZSJA 2RHTA 2CNNA 4AZSA 4FQ5A 3V8VA 3FXAA 5HQ3B 1MC5A 3RFTA 3QKRA 3TMOA 1ZWKA 4HOYA 4Q9KA 4UDXX 2ZU6A 4YALA 1PL6A 3T3IA 1H9CA 5JZSA 2G8LA 2D74A 3EDYA 1KTIA 2H0AA 3UT6A 1HDPA 3RSNA 5FFNA 3FPKA 4CM6A 4ASUD 4A1OA 2EEPA 4HYYA 5LYJF 4IW3B 1JHDA 2DWCA 1OKKD 4RGQA 4FX0A 4LVNA 4YRKA 1PZFA 4DILA 3HPHA 2KHMA 4LJLA 2DFNA 2BEVA 2ZYTX 3L6DA 3PJFA 3REQB 3GTJJ 4QRHA 4DSZA 4KICA 4H9GA 2QI9C 1FFDA 1UBEA 3KALA 2A6PA 3KP7A 1SXIA 3AVOA 3EGIA 3FJOA 1J0XO 3BCAA 1BSVA 1H8EA 5CXXA 4PG6A 2WWYA 3UNGC 3Q9SA 1T5TA 3CCQI 1T13A 1ZJ5A 3AR2A 2DFTA 4EG7A 2HN9A 2GSDA 3JAMA 2FN8A 4UJ5A 4KQMA 1L1FA 4JC8A 1V3QE 2BE7A 2VNIA 2VOOA 2B9SA 3IMFA 2W00A 4LOJA 4RA6A 4YRJA 2P7HA 2ZRHA 3UT0A 3T9EA 2A9KA 4H1TA 4JODA 2RGCA 1SCDA 1O1YA 2Y77A 3KOOA 5KYXA 3ZCVA 3RU7A 2HV9A 2WY7Q 3DHNA 4BEJA 1DBSA 3TXXA 1E5XA 1UJNA 4BAGA 3NYQA 2YFHA 5DTMA 3M4OJ 1XCMA 3UXEA 3ZV6A 4U6SA 3C8HA 3VAAA 2Z1MA 4XE5A 1F38A 1IEWA 2AN5A 3ZXSA 4MP8A 3TL4X 1MQSA 4DMCA 4A16A 5EXTA 4B44A 1BCSB 1H6DA 4K6CA 1TPYA 2HQOA 2Q41A 2Z99A 3RYCA 1TM4E 4IIHA 2QTVA 3MJHA 4H6PA 3HYNA 4LOCA 1CR1A 5HK9A 1LS6A 5E4FA 1NLMA 3DD1A 2L7ZA 2HOQA 3RC8A 3RHFA 5JECA 1XPOA 1LNQA 4A3FJ 4W5WA 1W49A 3RYCB 4A5SA 4RB3C 4FOLA 2PSEA 1P5JA 1P9RA 1BS1A 4UOEA 1UK7A 4OUKX 3ER9A 2JFHA 1A9ZA 5ALNA 3CJRB 4MB2A 1GSIA 3GD7A 4PBSA 4KGDA 2OCIA 1J8QA 2NUPA 2PZJA 2OAP1 1IU9A 4CF6A 2QDXA 2IEAA 4BNDA 4PIVA 1OUMA 4L9TA 4PIMA 1K86A 1JNXX 4U0WA 3MCTA 3L9FA 5AXCA 1QQAA 2E5WA 2VJMA 4BMCA 4TL9A 2IGKA 5C53B 2KQUA 3FAKA 3HKBB 2BN4A 4DDKA 4JVMA 2JLSA 1YA6A 3TOAA 2QX7A 3ETEA 4HK4A 4HLUA 2QAGA 2GLUA 2R6R1 5M5BA 1DG3A 4OHUA 2OHXA 3EHDA 3L79A 2D0PB 3AM3A 4P35A 3E2IA 2DCMA 4ALKA 4IMJB 4HV4A 3RR2A 4L8YA 2XBUA 1IUNA 2MH9A 2ECBA 3EZYA 2G36A 3LCJA 3IV7A 3T5CA 3I2IA 4YMSA 1BKYA 3BQMB 4DM3A 1QAQA 5I3ZA 2D3WA 4NHJA 5FO1A 3PB3A 3SR4A 2C0QA 3FPCA 3VTZA 1U0OC 3PBKA 4ZCPA 1EVIA 1M1YE 4U9IS 1EE2A 5K99A 2WYHA 4BEWA 3MWEB 3RRBA 2Q1SA 2W42A 5FA5A 4XASA 3TTUA 3HGGA 3Q9UA 3DW3X 2C9MA 4CMHA 5LGTA 2FWRA 2WFAA 4CIYA 4EELA 5JXJA 3DGFC 1K2WA 3ZNPA 3O84A 1TM3E 3P5SA 1E2BA 2IHKA 2RIPA 1VQ5I 3ZOZA 2YX1A 2V6IA 4C2UA 3FJYA 3QVGA 5K0TA 2BEUA 4B6EA 3O7MA 3U7HB 2P7VB 1H2XA 2I76A 2CZGA 2WHEA 5FKOA 4D25A 3ZCQA 3QVGB 2CKDA 1D8KA 3RKXA 4OK3A 4TTQA 4FB4A 5B2ZA 4V2GA 5E9AA 1G7RA 4NCKA 3WL4A 4CV1A 3ICCA 5LD2B 1XDWA 1XNJA 4EBBA 3ER6A 3AKYA 4R2JA 5KNBH 5AVRA 4Q9HA 2HSWA 5GY7A 3UAWA 1N5IA 4JBHA 1QYCA 5DLEA 3U1TA 4BFLA 2VQSA 1XWFA 5CM2Z 1ZR4A 4B2PA 1U9IA 5K5QA 1YR9A 3J7YJ 2OJED 1L4LA 2W85A 1LVKA 4R71A 1DFIA 3UO8B 3VR5D 2OKGA 5C4GB 1GT91 1WQ2A 3B6MA 3I39X 2RD2A 5EKTA 5LQNA 3QLVC 4XQ0A 2RAPA 1K9VF 4Y1RB 3DJYA 1M7BA 3KQWA 3LL4A 4R84A 1KL7A 1C9JA 1XTIA 3WLSA 4W9MC 4Q4LA 3RUEA 4ZJYA 3F3MA 2QTCA 4KWHA 2NSDA 2KHZA 1HSOA 2GTHA 2QQEA 5GP9A 2C5AA 1NDUA 2Y69H 4FFLA 2L7FP 3F2VA 4KXXA 4G1UC 5FYDA 4TTJA 1TM2A 2OBYA 1SFEA 3OIWA 2D54A 2ZI7A 4BFYA 4O2AA 3WWYA 1XR3A 2WOOA 1QHIA 3HZJA 3K3PA 4OSEA 4MPDA 1U9NA 1XE3A 5DF1A 3LQYA 3LT2A 5NULA 1FOWA 1R5HA 3HJEA 1Q91A 4R1NA 2G5GX 3HBAA 2X40A 5GGYA 4O33A 1GQOA 3ZKAA 5J4HA 4N8EA 4WINA 1E8NA 4QYIA 2OB1A 4IJVA 1ZGAA 4QOIA 5FV7A 2M1XA 2QRPA 3HDYA 2ATXA 5HS6A 3A9SA 1NBEA 2LIPA 1R12A 3SVZA 1RFGE 2N47A 4MNUA 4ZTZB 4A0GA 1A27A 5D1HA 1XB2A 2JD0A 1TF5A 1W5AA 4H1UA 1KE1A 4ZZ3A 1R7JA 3B6AA 1U7PA 1OXTA 2ZCWA 1MC8A 4A3SA 4MV1A 1NY6A 3T0YA 2QHXA 1FTYA 4R0MA 2Q45A 2O7NA 2Z3WA 4OU0A 4BP9A 4GGPA 3CLRC 5FROA 2ODAA 1F8UA 2DHRA 5MN4A 1ESZA 2PMZN 2RC5A 4JBAA 3ZWKA 4HDMA 1STOA 3BWCA 2GYYA 4KEAA 1DEKA 1O6ZA 5B36A 4DY4A 4KR7A 4OGFA 1R0RE 2GF9A 2WW8A 3I2HA 3KZ1E 1QXSA 1N3YA 4V0OA 1K4MA 1BOBA 4X45A 4FINA 4TVOA 5AVUA 4JITA 5KJCA 1JJBA 1CJVC 1X9HA 2B3DA 4XD2A 2OXFA 1U8RA 4G0PA 5KYVA 1GCGA 2GM9A 1R00A 2QUKA 4DDVA 2LVSA 3EYIA 1KA8A 3L06A 3BDAA 3BT9A 3DQZA 1L0OC 2Z83A 2ALJA 4LJ4A 5FUVA 2QA4I 3ENKA 2W8BB 1EUCA 3PGKA 2B5WA 1I5ZA 1MZBA 3EZ2A 5HK8A 1IVSA 4RWZA 3OKCA 1PS9A 3GFVA 1W0TA 1SVOA 2DETA 5D86A 1PKEA 1HE4A 3IOEA 1JA1A 1NFFA 2VKDA 2K86A 4KNVA 4FDVA 3ND6A 4J9UE 2GJ4A 3RW9A 3LCCA 4MTEA 5ILSA 2ATIA 1N2ZA 3MZ0A 1IEVA 1C1YA 5GAEJ 1I6KA 1YRBA 1PBTA 3H13A 2BEJA 1K5GA 1C0EA 5ADHA 4DLYA 2C07A 2C92A 3N8KA 5ECWA 1JIUA 3FOAA 2X1MA 1ESNA 2GB4A 4ZAFA 4E6PA 1SD7A 3CM0A 4QEDA 5DYGA 1HDXA 1R9JA 2GDZA 4TL7A 3BZ6A 4BGUA 1SBIA 1MO4A 2IV2X 1JZSA 3AI1A 3HVRA 2C2XA 2XLCA 2P1DA 2I4IA 2PG3A 3PLRA 2TRTA 3E5UA 4IXDA 4HZUB 1CEEA 5IKOA 4Q7KA 1WSAA 5HA5A 3T12A 1L5NA 1SU6A 1ULUA 4RZQA 1KY2A 4MQ9F 1M2VB 2HEGA 4F2GA 2PVSA 5IP9J 3A1EA 2WICA 2O8BA 3K94A 1I33A 1ZAYA 5TPWA 4FE4A 1OYWA 1QOZA 3INYA 2FUG1 4IRXA 5L53A 2NAZA 4IHQA 4NPHA 3EE6A 1QRTA 1XWWA 2QVOA 2MW8A 2HU8A 4HGOA 4J9VA 3IEXA 3DEJA 1WBJB 3OPYB 4EKYA 3HI6A 5D5UB 2LRHA 3U3RA 3KPHA 1HQCA 4MUAA 3DAHA 3VA7A 3CLRD 5MGNA 4IIJA 5IXSA 2VHCA 4DYRA 1REPC 3CZQA 3MMZA 4YT4A 2LYCA 3T7TA 2Q1YA 2I91A 1BBYA 3U7FB 4RZIA 1FA9A 1SC4A 3CCMI 2CUTA 3UC5A 3WQBA 2HD4A 3DXXA 2DDAA 1V5GA 3GLHA 3RFFA 3WQRA 2XOXA 3RVRA 2WHRA 2ONYA 3P0RA 1F0PA 4PBRA 1MMDA 1XSDA 2XEXA 3NJ8A 4ZIRA 2IUEA 1YVEI 1CJCA 2YJZA 4C0QC 3V32A 3R3HA 4L95C 1I9GA 3PZRA 5LU9A 2BGIA 2ZG6A 2OGUA 1UC5B 2WHYA 3Q6NA 4TQUS 4RB2C 3ILVA 2LKXA 4OA5A 1RI2A 4ZC1A 4INOA 1N5RA 2L2OA 1AH2A 2GRAA 3W6JB 2D7JA 3GRYA 4P4SB 4YUXA 3CVWA 4IDBA 2Q49A 2D3TA 3PIDA 1ULBA 3OOPA 4NPAA 4I2OA 2HMTA 4LY6A 4P5EA 3EUHA 4CEHB 5LDGA 3WIDA 1HKSA 5ER9A 1JVSA 3O1JC 3ZHSA 4KQCA 4MS1B 4GAEA 1JQKA 3JSAA 4QAQA 1V8DA 2PX2A 2ECOA 1RLOA 4RQAA 1I1HA 2BE5F 5HLIA 5FAXA 1RPZA 3F8NA 2ZNYA 5BNFA 1TADA 3B6EA 1NJ2A 3TNDA 4Q0MA 2PM8A 3LVQE 5L3QB 4JXZA 1OFHA 1UWVA 3ROZA 2OP1A 4C0XA 4TXLA 2A59A 2WU8A 4KQ6A 2Q3BA 3A14A 4IUDS 2M98A 4WK4B 3IPRA 2VBWA 3BFKA 5IAJA 1FX1A 4OHZA 3GLVA 3L6BA 3FK6A 4YYZA 1A3CA 1CJKC 3GEBA 4ZU6X 3CURA 1QFJA 2ZSDA 3S2YA 2HRRA 1QH1A 4EYSA 4O4IA 5B1BH 3TTXA 2WF9A 4MO2A 4J8PA 1NYQA 2TS1A 4G0NA 5FFXA 4ZK2A 2VO1A 3MGKA 2O2SA 4QTXA 4WWCA 2XF8A 3AM4A 4QG7A 1CQXA 1XNGA 1UPCA 3LWBA 4XWKA 3DYBA 1E4EB 2Z33A 4UM7A 3FSGD 4EMBA 3RVDA 3N2ZB 3BG5A 2NPOA 3K53A 3LWNA 3CF5F 3HHEA 2JIOA 1ORTA 3H99A 1NN0A 1IDZA 1CQWA 2RQPA 2P8JA 1QP8A 1NXTA 1OCOH 2NTVA 4TV8A 1VJCA 3MGGA 3KV1A 3IS3A 1AGNA 4U3JA 4L5EA 3UFXB 1D5VA 3K4KA 3RTCA 4WX2B 1TK3A 4OGKA 4Z49A 4EMUA 1EK6A 4YAWA 5ENDA 3VJRA 5KKCA 3QWFA 4JI7B 1LPMA 6PFKA 3HFGA 3DSRA 3O73A 1FDOA 4HYTA 1L4YA 2D59A 2QKYA 1YOVB 4XVRA 4KQGA 1BW9A 2H11A 2JFUA 3ZGZA 3MWKA 4M88A 4RTOA 2Y99A 1EA7A 4JR2A 4HNSA 5T64A 1RI1A 4X84A 4C4OA 5KS2A 3KQLA 4XRGA 1ZG1A 4BBAA 2XOKD 4AIKA 1UP6A 2J0SA 2XQGA 1XRNA 2XADA 4BN4A 2QNIA 3WRVA 2OBBA 1Z6GA 1OFTA 4DSTA 2P5VA 2JFXA 2BM9A 2V9VA 3JVEA 3HKCB 5TXGA 4XWOA 1T4MA 2QZJA 5DT9A 2B8EA 3P4UA 1V6CA 5GPCA 2HMYB 4GD3Q 3I6ZA 1AXRA 2QTGA 3CMCO 4NULA 5EN4A 4JC5A 1BQ4A 3HUEA 4CTMA 2MC4A 2VT2A 1SBZA 3OFJA 4DR1B 3U7JA 3WICA 3KJXA 4X1OA 3IEIA 1FRVA 4Y6RA 5JJKA 1JA0A 1AHPA 1U1IA 4FMDB 4MFDA 3LX4A 1IWPB 4UTPA 3H4IA 3JQGB 3KFXA 3JV7A 2JLAA 3CWZA 5JSFA 2A5GA 5KUTA 3OZ7A 4RV9A 1R4AA 2GMWA 1ND6A 1IWOA 4PWZA 4S2EA 1ZRMA 3WGKA 2LTAA 1IRFA 3QUAA 3W2TA 5IMSA 3JAMK 3VYTB 1X3SA 3BWDD 3NALA 3AO0B 3KO8A 2C77A 2ZKZA 2GVZC 1IK4A 1CD5A 1KI4A 1UOOA 3PO3J 2XPUA 4JBYA 3KQNA 5LJLA 3GFQA 1QZ3A 3KXPA 8MHTA 1E7MA 5SY9A 1JKPC 2XDAA 1EU1A 3RTRA 4OLAA 4B3TB 3IVCA 1WHTA 1TE2A 1TIKA 1U9OA 1QX3A 4GVXA 5FLKA 1FBQA 1E9AA 1ZD8A 1W4BA 1Q0HA 3ZUGA 4MW5A 4R51A 3JAKB 4TXMA 3HG9A 1SXJB 1A6IA 3BR6A 4I46A 4INPA 3VPFA 2Y76A 1IK6A 1KEUA 3DV0B 3WGJA 3FDYA 1QVAA 2OD2A 1QVWA 1GGEA 1QNTA 3AP2A 1DKPA 4UHBA 1FFXB 1IXSB 4HC4A 3WNQA 1T56A 1P4WA 2NAFA 4JGBA 5MN6A 5H8WA 3CF6R 4EY8A 4FHGA 5IJ9B 3CTPA 2Z1NA 2JBAA 2M9HA 5BV8A 1FIPA 1J1ZA 1R37A 1DJPA 3JALB 4A6DA 5TPZD 5M5WJ 3VODA 2ILVA 2K2WA 5IZCA 4RPJA 4U6NA 3AJ9A 4PSVA 3QXXA 4GL2A 3MK31 3NOOA 1L4FA 5C8VA 1G5RA 4KH0A 5KTYA 1L8QA 4RKFA 2E21A 4B6JA 3HOTA 4OOEA 1MDMA 4MQLA 4CLOB 2EBFX 4KE6A 5DIFA 4F5EA 4X54A 4E11A 1NLYA 3PJGA 4CPDA 1HV8A 1NTOA 3MAAC 4R68A 5TMBA 4X8LA 5L3BA 2DMPA 1AKVA 5K7ZA 3T38A 2XT0A 3IQWA 3S1NJ 3EQ8A 4QRIA 2AD1A 1VYUA 2H6CA 3SQXA 2XAQA 4L75A 4N8SA 2QRVA 3W9SA 1TO1E 5D3MA 3M9WA 4RQBA 1JHQA 3G59A 2AVNA 2GVDC 4AUNA 3K9NA 1O2DA 3N4MA 2PZAA 2NZ8A 4L3WA 1AXEA 5BSMA 1PZNA 3ZS8A 1TCAA 4RNCA 1E2QA 2XCLA 1CJSA 4UBJA 4A93J 5EPUA 4LV8B 4JOQA 1DMRA 5BMVA 1E5DA 1XU9A 4QGBA 2VPQA 3WMFA 1CEQA 2K4MA 5FORA 4EF4A 2W6PA 4LGYA 5AVXA 1TQMA 4RAYA 5JYBA 5J9FA 4PRYA 5DNDA 4WIAA 1JYSA 4CCYB 1CTQA 3NR2A 3TSAA 4BHCA 2DPLA 4NESA 2FEAA 3QI2A 3W6NA 3LAWA 2HRDA 4HF7A 4N7BA 4LJYA 4IFIA 1PP4A 1U3CA 3DPTA 2ONZA 5IVHA 4I4TB 4CODB 1E61A 2HY7A 1OAOC 1XTJA 3IVAA 3MVEA 1BXGA 3B78A 4O0LA 1M0TA 4UBLA 1YQQA 3CH4B 1E7QA 1YXMA 3O3OB 3OQIA 4KXMA 1BROA 1JT6A 1XKLA 1Z2NX 1UBFA 4JASB 3WWPA 1YS2X 2YRXA 2FQQA 4RLQA 1R0YA 1LPBB 2O50A 2QGNA 1G5HA 1Q2XA 3PNKA 5HDQA 2W58A 1N9GB 4B75A 1JG6A 5E6RA 2P7CB 4V0RA 3TL6A 3K09C 2HFJA 3NRBA 4E4TA 2ASVA 5CLIA 1JI8A 3W7BA 4PCLA 2Y3IA 4XQEA 4YB8A 2XE7A 4MB6A 4MQFA 4CKWB 3MA0A 4D5EA 2XRMA 4TMTA 5CHYA 1PK8A 3A1TA 1XP8A 3FZVA 5CAEB 1C8BA 1NP7A 1WSWA 2A3RA 2IKQA 2VK8A 5LMNB 3ILHA 4MH0R 3H5TA 1I7NA 3QLEA 5EJFA 3QG1A 3G2KA 1C3VA 5JCPA 3AP1A 2PUWA 3FZEA 1OZ0A 1F9EA 1B4DA 1NHWA 2KIFA 4BNXA 2CFOA 4Z7QB 2G67A 2WIAA 2R7MA 4QPOA 3W2VA 1Z6QA 3VR3A 1JEYA 3GYHX 3SQDA 4EJ6A 2C2HA 5DYMA 1L7MA 2J0VA 3RQIA 4AWXA 2PZGA 2FSVC 4DAEA 2R11A 5FBWB 1HW1A 4JKIA 1UMCB 5ES4B 1S29A 1YK0A 3E48A 2DU9A 1G7CA 4BV3A 1EVJA 4AF7A 2FZWA 3BB1A 5JJBA 3JWIA 3A0UA 4UXJA 3ZV3A 4RMJA 1E9EA 3GQBB 4XOIA 4OF4A 5DHUA 1SCAA 2Q3LA 4YJ3B 3BJZA 1UBOS 3Q3IA 2I8AA 3R6TA 3ONEA 3HLTA 1SUCA 4H7KA 5FPQA 4XIFA 1YR6A 4J1QA 1OFUA 4BFZA 5CDYA 2R8EA 2BEWA 4Y0NA 4V1CA 4D45A 2CSOA 3KSAC 4JQZA 2JPBA 2J0QA 4ZYVA 3HUGA 4F71A 1CZUA 3CPSA 3ZLUA 3VO2A 5GIPE 2KL4A 2CFXA 5FLMJ 2Y30A 2BEWB 2P9QA 4AJ9A 4EGSA 1J24A 5F2NA 1DGRM 1FIUA 4K9QA 2OO5A 2UZAA 2FUKA 3JVVA 3CESA 3GZ4A 3PUHA 1NRIA 1QP4A 2WD8A 3E2PA 2XRNA 4F8JA 2BJHA 1QHGA 3LGAA 4GMDA 3DOCA 5KIAA 4JB2A 2CDBA 5HJ7A 2RI1A 2DWUA 5FNVA 4IXAA 2H1VA 5HOOA 3FSJX 3EGDA 1E3OC 4OB7A 2AI1A 4RK6A 5EKSA 1MO2A 3E3LA 3RUHA 3K30A 1VIVA 1KPGA 1ZINA 5H02A 4UTXA 1DTEA 2IUUA 3ROQA 1G64A 4PYRA 2WV9A 3V4OA 1KQ9A 2VDOB 5E3NA 3GDOA 4LY3A 4IIEA 1VHDA 4C3OB 1Z12A 1FFAA 1XDUA 1YZTA 5LC1A 1N0UA 1A2KC 1HLPA 1A2QA 1TJPB 2J3DA 5KTRA 3K70C 3F4LA 1T8TA 4XEHA 3VVBA 5C8XA 1Z8HA 2WWWA 4LJRA 3CS3A 4XKJA 5LYJA 3D2BA 2Z8YA 3EXIB 1Y6GA 3IT1A 5E1DA 1II9A 3DLCA 4RMIA 4RPKA 5EY5B 1UMDB 5HR5A 3AHJA 4HDVA 1MORA 5HYVA 2VJ4A 4BB9A 2ZUSA 4L9AA 5REQA 2A7QA 2REOA 3OYNA 1WMAA 1QC5B 1YU9A 4NXNB 2KZGA 4H1HA 3ZW7A 3D5RC 1PJ3A 3OWTA 4NSNA 4CDMA 4PYQA 1QWOA 2A5DA 5IAGA 5REQB 1OR7A 3IQGX 4XN3A 2ECQA 2JVIA 4M0UA 4NV3A 3VDNB 4OHXA 5D4SA 2BDEA 3PUZA 3ABMH 4BNVA 3NTQA 5EP1A 4M22A 3TG8A 3LPNA 1E0SA 4PANA 1EWYA 3ZDCA 1KI6B 5EWJA 4BQSA 3CRZA 4MOWA 1ZD1A 1O95A 1JRLA 1QVTA 2ZRJA 1SO8A 5DGCA 3ZCSA 3X44A 2FRHA 4BS9A 4L72A 4JKYA 2ATVA 1K78B 4HNUA 2G9WA 2ZS7A 3ZWBA 3ICVA 2KQRA 4XI9A 5DM0A 5T67A 3V4GA 5AKJA 4LZLA 1L4NA 1C0IA 3ROKA 2J85A 1J07A 4G1EB 4TTPA 4QOEA 1JHZA 1J23A 3HGQA 1W1WE 4OFWA 2JL1A 2BCJQ 3X1KA 5CEFA 4CM3A 1X7DA 5LLSA 1CQIA 4RMHA 2XAFA 3Q2KA 1EJBA 3HDHA 3L8MA 3O8GA 2XUHA 2ZBQA 3FHNA 4DN6A 3W90A 1OWOA 1JVBA 1RXWA 1ZJJA 4NMWA 3EPPA 2CBGA 2O2GA 4DBLE 4DZJA 1MLDA 1WX1A 1T35A 4CM8A 1ADJA 1MEOA 4I2VA 3CTMA 1UPXA 4J49A 2DY0A 4YAOA 1N0IA 1TFUA 3FNHA 3IKJA 4DR6B 1GA6A 1TL8A 3V1UA 1OSNA 4KPFC 5CYOA 1YC2A 3R0XA 4C2MJ 1S3SA 3B3JA 3GRZA 1YJAA 4L5BA 4EHHA 3CG0A 4OQYA 1V1RA 5FH9A 4RSGA 4IHTA 4FLMA 1AT1A 2J4CA 1JE0A 1TP4A 4LJ6A 4M99A 3BIXA 2VVTA 2ZBDA 4HWKA 1IQUA 4CKBB 4Z3KA 3K70D 2PZFA 3R76A 2PMKA 2CVHA 3UG7A 5AW5A 5AW4A 2DY1A 3HE3A 1ONOA 2ZT7A 3FJ1A 5IKPA 4RZSA 2AR0A 2BMVA 2GCPA 2OCBA 5KTOA 4HLNA 3VPSA 4MWZA 3LPDA 4BY1J 1YVRA 2ATCA 3ZDDA 2H07A 4RFSA 3WYBA 1PI3A 2VTVA 4ZAVA 4AYWA 4JQYA 2BGUA 2JD1A 2NU8A 5LYYA 1JG4A 3VDMA 2BYTA 4W5TA 1GL3A 1PWEA 4GSYA 4HNQA 1BZYA 2O2EA 4GFDA 5J4YA 1XC5A 2J6BA 4GPAA 4B4CA 1Q7CA 4J1TC 2FR0A 5D5HA 2PQ6A 3LFUA 5E7IA 4QBHA 3W04A 3HU2A 3D8HA 5IH3A 1JHHA 1MVOA 1UBSB 1G41A 3TOVA 3WTSC 5FKLA 4F85A 2QM0A 4PSXA 3OMWA 2G4VA 4BB0A 5F9FA 3E6DA 3G9TA 2JA2A 4EM2A 3JRCA 5HE8A 2WAQN 1SVLA 1I3QJ 3EYYA 3MIZA 2JEYA 3A36A 2W98A 4GSKA 1QCZA 3UB4A 1NULA 4LFUA 2GBIA 1S6LA 2ZRCA 3LSKA 2RHHA 4M0FA 4FT4A 3R44A 3AOEA 3QEAZ 1ACJA 3SD7A 5LLTA 4GCVA 3KYBA 2P2GA 5JASA 3OZVA 2IDJA 5CQGA 2M0CA 3U80A 1FX7A 1AS0A 3FXKA 1I27A 2V0GA 4BRUA 2XDVA 4ND3A 5CDUA 2PSJA 3IURA 3GF2A 1OV4A 4XRSG 3WHBA 2IV7A 1L7EA 2BTOA 2IGBA 1MBHA 2A33A 3H65A 5K8IA 3KLBA 5MHTA 4QPDA 1TEVA 2G0TA 2KJQA 5K20A 3SSMA 2JFVA 2VP3A 3W77A 3HCBA 1LKZA 4RGUA 3FGOA 1U2SA 2GN8A 1IH8A 4NLLA 1UXOA 2CEKA 2EB7A 5FD8A 1Y6JA 2X4GA 4NYIQ 1EG2A 3EXFA 1PG5A 4U02A 2IJLA 1JR3E 4W7SA 3INNA 4RPCA 1H2BA 2WWHA 1F1JA 2QTBA 3NBMA 1OH5A 4WNAB 4ZARA 4AJJA 3LTNC 2AR7A 4OYHA 3ZQCA 3NP9A 5KINB 1POGA 4RZHA 5GZ3A 1JFSA 2VRBA 2XAHA 4F8EA 3GGJA 4NCJA 3DCYA 4B3BA 2AFIB 2QQBA 1MU0A 1P3JA 3PSHA 5AK5A 4OIPF 4HXFB 4CCAA 5K3EA 4HSEA 4J00A 1GT0C 3GARA 4FJ0A 2PBFA 3RU2A 1SEPA 4NH4A 5K4GA 2XZOA 2GS9A 5DMHA 2O2CA 4JLSA 2VJJA 1QBKC 3ZBQA 3KTAA 1MMAA 2A9RA 1ZJZA 3KXLA 2HLNA 5DMXA 3QE2A 2ZI3A 1LZKA 3OT5A 2JFGA 1V7CA 1IXZA 1OE0A 3AV3A 1RE1A 1TYZA 3IJ5A 5IP6A 1QVRA 2DBQA 1OJ7A 4Y2XA 4D4HA 1BW5A 3EISA 2JWTA 1XLVA 1JFLA 3JQRA 1XELA 3S7ZA 2B8WA 2JJ1A 3C3EA 3H16A 3ESZA 4EDHA 2X6TA 3RROA 3QMPA 5JWRA 2B7CA 1AN0A 1VNDA 2O0MA 4PVDA 4AM8A 1N6KA 1XZDA 4LHXA 2ZUBA 3LY8A 2UXCB 3H3VK 3IELA 1S4MA 1Z4OA 2FPRA 4OGGA 3N05A 3RJTA 1SCJA 3DZBA 1F5NA 1R9TJ 1NWCA 5ALPA 1JHVA 3SC2A 1FC0A 5IF3A 1IZZA 1RPWA 4P7GA 3WK5A 5ESXA 4KGVA 1IUPA 2L0XA 4BXUA 3E97A 1YFLA 1Z73A 1ZUHA 3J7AC 2R6AA 3PYLA 1Z13A 1Y98A 1DKNA 3U2RA 1B74A 4R41A 1V5WA 3KFLA 2MSEB 3ICQB 5F2KA 4YFVA 4A3DJ 1A6QA 5K0JA 4YR9A 5C37A 3UJ7A 1J2UA 1KMMA 3BL5A 4NU8X 2ROQA 2MGQA 3P9KA 1I7SB 1Y1VJ 3NEPX 4ND7A 4RHTA 2IYFA 4OIMA 4R1QA 5LP6B 4ACBA 2YJTD 2JH3A 2HPHA 1SUPA 3NLLA 1N3IA 2OO7A 1MMFB 2MJLA 4QU8A 3WAKA 2WZCA 1PP8F 1BOFA 4M7WA 4HMQA 2QQ0A 4BNWA 3MMNA 2J5RA 5I7RA 2HR1A 3R5SA 3Q15C 2QXYA 3Q88A 4OXYA 5GINE 4WLNA 1M6NA 5CIYA 2DA6A 5HIKA 3U09A 3WTXC 2O20A 1XK6A 2I3ZA 2DA7A 4HAVA 3COJA 3CVJA 1OXSC 3DDNA 4JJEA 2ECFA 2F4NA 3TQRA 2O0LA 1XRRA 3N70A 5CT5A 1GPDG 2RKWA 3KAQA 1YJ8A 4TLBA 3GLTA 1ZD4A 4IP0A 4Z1MA 1HY3A 3NTOA 1IB6A 3EBOA 2FP4B 4UEQA 3VDQA 1P5ZB 3ABQB 4D3XA 3QE0A 3EFOB 4MHSA 2Z5FA 3IBCA 4MGZR 3AHHA 4QXOA 4YR7A 1D1QA 3DLTA 3PVSA 3RYIB 4HY3A 3VZPA 2WB1N 2PKQO 4QU0A 3HWX1 5KAMA 1I5RA 5K3SA 5AHOA 3K96A 3SSAA 3FXMA 4X1IA 2Q4OA 1GN9A 3QKRB 2J45A 4XR4A 1N2JA 3FA2A 2Z4RA 2K9QA 4B8ZA 5M34A 1PL0A 3QK7A 4JLWA 4RIHA 1CR2A 2MLKA 3B1JA 4BFSA 2OGZA 5K5RA 3E5HA 4BVBA 1J2XA 3WODF 3JXEA 2P3QA 1D0SA 1U0FA 5G2OA 5LEKA 5B1DA 1GTMA 2BEVB 1W36C 4I5DA 4G37A 3OYIA 2G5CA 4Y6PA 5JWHA 2XT6A 4D9FA 2IYTA 2O8CA 3DULA 1XGSA 3HA7A 3EPZA 4G5RA 1PL7A 1WUYA 3I9NA 4QUEA 4EM1A 3DEWA 4XWYA 2OV4A 1TB4A 1ZMTA 2YJ6A 3QVLA 3I12A 4TLAA 2O3RA 4GC5A 2W4SA 4J19A 4FYKA 2NYAA 2DPDA 4X97A 4RA6B 3OZRA 3TRJA 3RBZA 1GUUA 3T7RA 4BX2A 4IXMA 2E7XA 4PPQA 4BHBA 2EGGA 3R1IA 3NHSA 3NCTA 3D6JA 1R0KA 4G5YA 3A6FA 4URWR 2ACKA 3KQYA 2VJQA 5KYXB 1B9MA 4PLCA 3PQ5A 2V58A 2VF2A 3WDSA 3TRKA 1Z4QA 2JEZA 2CUKA 1X14A 1NI5A 3BE5A 3UKGA 1UAAA 1CR4A 1YO5C 1DDIA 1PYGA 3A9CA 3RI4A 3QJ5A 1L3BA 4XORA 3DB1A 2GZ2A 1AKMA 5ALHA 1WETA 1R88A 2FHPA 3HOXJ 2J3JA 1D7AA 1OTXA 1KARA 3AIOA 3EQLF 2CMGA 3VYUB 4NXMB 4FWTA 1YTLA 2O5RA 1IOVA 2QTVB 3AU8A 2XPWA 4LY9A 3IOBA 1IN8A 2LG4A 3VRHA 1XI2A 1QORA 4JI4B 3C7CB 1GCAA 4F93B 4ENNA 3WB1A 2E1CA 3HCDA 2WJYA 2XRLA 4QTRA 1RJEA 2NUPB 3UQZA 3IMCA 3QBEA 5C1IA 4IOKA 3K4JA 4E4RA 3ND7A 4KGZA 4DDHA 3DBLA 4D4MA 4UM9D 3T9CA 2V7QD 2GIZA 2QBYA 4YCLA 1AMNA 4IVPA 4BNDB 2QD1A 1IZYA 1KJIA 3DEEA 1USTA 5IM4A 1NXSA 1BKSB 3R7WA 3TSOA 3ANLA 2Q5CA 1LNSA 2V59A 2VJMB 4E88A 4S0ZA 1DCKA 4F46A 3DE7X 1U7ZA 1WWKA 3NATA 1QZZA 3SHFA 3FFTA 4LB6B 2YYYA 3Q40A 2GO7A 3UICA 2QAGB 1Z7YA 1MO5A 2X13A 5E1ZB 1ATZA 3RWMB 1CETA 3NXKA 1JKQC 1A50B 1M0SA 3JPYA 1TRHA 1ZI6A 3DMDA 3I6QA 1LFDB 4EB3A 5MGBA 1FBNA 1I2CA 1ZN7A 4PHHA 2FPSA 5KX5F 4YRZA 3HY3A 1D1TA 4MEJA 1A97A 1WB5A 3LSJA 3LQQA 3JYOA 3GWGA 2CBZA 5K8TA 4A73A 1SU7A 4MVJG 1UC4B 4MWCA 1BX0A 5P8WA 2EP7A 3KG2A 1KU2A 4DRXA 3PDJA 1XHFA 1BDBA 3HOUJ 1VIMA 2PI0A 5J23A 1IRXA 3GZ6A 1I2MA 5CYGA 4RADA 4HAOA 1DWOA 1NL3A 6Q21A 3MN1A 2KS6A 2BZ1A 1YRYE 2FPIA 5G0UA 1HDRA 3AVVA 4IDHA 1AZSC 5DBFA 2YC4C 5TEVA 4GRIA 4CIXA 1PIWA 4RSMA 1YQEA 2JLXA 3C1OA 2BEUB 3S3NA 1F51E 1QQBA 1CU1A 3NHPA 3QHPA 2RGGA 4EPTA 1TYBE 2E2HJ 2XTJA 1G1AA 1NXVA 1EX1A 2F1OA 1E63A 1YI8A 2BOVA 3RCBA 1MENA 1QHXA 3EXEA 1I10A 5FWAA 4G9BA 1MJGM 2FJ0A 2C7BA 5KNCA 2Z1DA 2QRNA 1CX9B 4KT5C 3P2YA 1ZLXA 4I14A 1FUIA 3JTMA 2OORA 3WYAA 1V96A 4E5MA 4FFMA 3EY4A 3CJTA 3WTVC 4QGAA 1D1AA 2YMPA 2UVDA 3Q2OA 1GXQA 1KI2A 3JQDA 2Z2ZA 2BLNA 3HZHA 3OS1A 1NKVA 1C9YA 4FGKA 3UT5A 2BFFA 4OEHA 3FB1A 1V26A 1UDWA 1E3EA 1CF9A 2EV9A 3TLBA 4N01A 4UVEA 4M1WA 3UJNA 1TMOA 2L69A 2NU9A 3HUUA 5A0TA 5DBHX 2Z98A 2KLHA 1PJQA 3KFVA 1DIGA 3MD2A 1S9HA 3ABRB 3HYIA 2R7RA 2C84A 1JAZA 3HWWA 1AZLA 1O3SA 4L9VA 4UU1A 2YRWA 4TRJA 5EMNA 3GH1A 1YZKA 2D2IA 3I4CA 2Y0MA 3NYIA 5UKDA 4R1TA 1X1TA 3O3NB 3I9FA 1Y4ZA 1BN6A 3K35A 2DI3A 1PFYA 4M55A 3G0BA 2X0NA 3D5TA 3SXPA 5AVWA 2A0XA 3HVJA 3D5LA 4KP7A 4LHYA 3G2BA 4HEA6 1YSCA 2Y71A 1CQZA 2IHYA 4O2AB 4GLOA 3FZNA 4IL5A 1UHWA 3JVDA 1G3YA 3BPXA 4FTWA 2YXLA 4PLYA 1UQUA 1YDMA 3VOAA 4ENTA 3OJFA 1V5EA 1G8XA 1PGJA 3D8TA 3OTOB 4QYIB 3VGPA 1SVKA 3G4SI 4HNTA 1QH8A 4EGAA 1N57A 4C03A 2ZT5A 5H80A 4LCEA 4MI9A 4M3EA 2PCJA 3F6SA 4Q93A 3L8GA 5F73A 2Z2KA 2ACVA 4J0JA 3Q87B 4MLCA 2E2WA 3PD7A 1R10A 5DXAA 1JG1A 1R36A 1RABA 2ZB4A 4A3KJ 9LDBA 2PDAA 1NYLA 4DBVO 1UM9A 1TM7E 3FNRA 2VYFA 1ZH0A 4M8LA 4EA7A 1WGXA 3PXXA 4BLRA 1FE8A 1LSSA 1NZFA 4RL4A 1AGXA 3DO6A 2W43A 1WHSA 5FT9A 4L07A 4BNUA 1IMOA 3ESAA 3ISTA 4HDMB 4YDQA 4GZ6A 1K6XA 1L1EA 2L3DA 2O8VA 2ADFA 3HOSA 1KDZA 2BIFA 3JRBA 4ROTA 1H3NA 3MS2A 5EQDA 4M6XA 3QV1A 1SUFA 5EPEA 4JT9A 1IAWA 1GNQA 2CKMA 3F8SA 1PJSA 1JBEA 1SVNA 4GG1A 2WYWA 5ARDA 3FMSA 4ZEMA 2WPNA 1IO2A 1NV9A 2GLTA 2C95A 4ZQCB 4EJSA 5ITWA 2OHVA 3ODPA 3F9KA 4DMKA 5DNUA 1RJFA 2PBLA 4HX7A 4CV0A 3RH0A 3B1YA 1CZRA 2HQBA 1A4UA 4KNWA 4XUGB 1G9SA 3QP6A 3CZ6A 1NNI1 2PR7A 1T2FA 5ALEA 1VBMA 4FCYA 4CGZA 2K85A 1EUCB 2PUVA 1UZLA 5FTJA 2H2GA 2I2DA 3EGOA 4PO1A 1RR7A 2VH2A 4I9UA 4DV7B 4F12A 1LLFA 4EATA 3EFEA 1VC2A 4DUYB 1YACA 4WD3A 5CG2A 1SQ5A 3O2PE 3QOEA 1EGAA 3LM8A 2HGSA 2DUUA 4IO0A 4MEXF 4DMMA 1VTKA 3RTGA 1BQ3A 2JC3A 5CD1A 1UBLS 4JFRA 1NP3A 2EFGA 1EBUA 2FPWA 3HN2A 5HSGA 2OO3A 2QUHA 4ZTJA 4OBBA 4BYYA 1QPMA 1KIFA 4TMKA 3WJ2A 2Q4BA 1LV7A 4AQYB 4YJ2F 3TDKA 4BWFB 4DRYA 1BA3A 2RNGA 5I47A 3RK0A 1RAIA 3IXMA 2A86A 2OGSA 5ALDA 3NBUA 2CW7A 1DHRA 3KSBC 2F48A 5EJCA 3PC7A 4KREA 1YDGA 3TR0A 3ELKA 1ZQ3P 3R2JA 2I9PA 3TXAA 5BPIA 1SMKA 2GM4A 3QTLA 5AMXA 4H31A 2PSHA 5ESDA 4RESA 3WLTA 2XAGA 5DDGA 3PSAA 3MUFA 1N1DA 3I73A 3X0DA 1C8LA 4BQOA 3ZQLA 3SLGA 3BWXA 2O8BB 5TPWB 1G2IA 2VPLA 3EQ9A 4LQLA 5J4VA 3D02A 2GBGA 5EEGA 2V0NA 4D8VA 1XLUA 1GZ7A 2QLNA 1QMGA 1ZZEA 1PG2A 4OFZA 4FEGA 2VPWA 4B82A 2B7BA 1K5PA 2J0UA 4AKSA 2ZEJA 2BP7A 4C3JJ 4GKBA 5LRSA 1W4CA 1DWUA 4IIJB 5DFAA 4G5FA 4RSRA 5ALMA 3W34A 1MX3A 3NC4A 1UQRA 3KVRA 2KIQA 1Z0KA 3AHCA 1RSZA 1HA8A 2J3IA 3H4TA 3CNLA 3BKWA 2BI4A 1Q57A 4F5YA 2W82A 3ZQKA 4LBYA 1UDRA 4JL5A 2RHOA 3W1EA 4XX0A 4K9NA 3RJ9A 2HZDA 4GX0A 5PGMA 1IDYA 3GLHB 2CLIB 2WVAA 4GPZA 2RCNA 3GTQJ 2WY8Q 3IP9A 3NBZC 4C3HJ 2P3SA 1PNOA 3T4EA 4CCLA 3WXMA 4ZIRB 4Q1CA 3CLUC 1PQPA 1PEKE 3GG9A 5HNHA 3WL5A 1KSHA 1LDMA 4P92A 2W2OA 3COZA 1T1RA 4M1OA 3S99A 3TFWA 5BURA 4QPZA 4CFZA 1HWYA 1R6VA 3LV8A 4H77A 4NPCA 3S4YA 4RXTA 3KE9A 3A1WA 3KJGA 1P9WA 2IKSA 2Q3HA 2M2IA 4XIYA 4WXRA 1P61B 1V6AA 4LMBA 2W2LA 4AJIA 4KQIA 1RR8C 3LP6A 2R1VA 5T4HA 1YRHA 4BX8A 5B7GA 4OUDA 3RK1A 1N2OA 1XJWA 1K7CA 2JIDA 4LTMA 5EHXA 4MUMA 1QHFA 1E0EA 2CCGA 3IGFA 2R1VB 1OH8A 3CYFA 1YUNA 3ZQJA 2CMKA 1MG5A 5B1YA 5B1HA 3SN6A 1N75A 3DEUA 4QJIA 5BXQC 4UNOA 5BOSA 1LS1A 3L2WA 2RAUA 5AXBA 3EIWA 3SP1A 3LLSA 2XGOA 1W34A 2O9JA 3JW8A 3PGA1 3RS3A 1KYWA 3WG9A 3E61A 2XYRA 2EHJA 1CRQA 2VKHA 3OE7D 3ZWDA 4GMXA 2E82A 5CH3A 3QUQA 5BT8A 1GT6A 3UHOA 5DGTA 3IOCA 3RABA 2I9KA 3K71B 1QO9A 1RJWA 3TD6A 5AVQA 1QH1B 1WB9A 4O4IB 1E9RA 2ZBGA 4A4DA 3CUQA 1X1RA 4A2CA 3PQDA 4JBXA 4EG5A 2HQSA 1AA6A 3A6PC 4Y7NJ 3NWBA 3LLCA 1MKYA 4NATA 5BSHA 4FHEA 3D1JA 1LF5A 4UAGA 4B76A 1SHZA 1P5RA 1K9SA 1ZS9A 3QU7A 1EHYA 1YBFA 3RIXA 3L0PA 4DSOA 2FPXA 3V8KA 3FHOA 2ZJPF 3C1DA 1I5OA 4DQUA 3WO1A 1CUGA 4V02A 3SE7A 1ZN8A 1YZFA 4O1IA 3JS5A 4TV8B 4IZZA 4U3JB 2Y0PA 3NWSA 1D0XA 2QNBA 3MTBA 4MPTA 3K0KA 1YRQA 2N0SA 2NZ2A 2G76A 3NHBA 5G0WA 3C97A 4ZOLF 1GR0A 4RS8A 2ICWG 3FMIA 3HN7A 2P9CA 1K8XB 3DVLA 4Y7CA 2Q7XA 3O4FA 4B43A 1KU6A 5FUBA 3CLUD 3UC9A 4ZCRA 5H9VA 4TROA 1W2WB 3IAS6 2VNHA 4GE0A 3WAGA 2GJKA 1PR9A 1OYIA 2YR0A 2HMUA 3EF3A 4M1MA 2GEBA 5IT4A 5FA8A 4DVGA 1JFVA 1Q1ZA 3ERCA 4XGIA 1BW9B 3IBFA 2L7MP 4WNYA 2Z3ZA 4ATNA 3DMTA 2OZKA 4GZLA 1X4OA 3HLKA 3K1JA 1BWQA 4HVCA 2PEZA 3QU5A 4FFSA 4CL2A 4FYIA 1G38A 2EFPA 4ASUA 4CLRA 1PDOA 2NZVG 3UAXA 1OKKA 3UV6A 3X1JA 1AF4A 5A0VA 4A5MA 4INJA 2KRFA 1WLSA 4WBSA 1JQAA 1FQOA 2VK2A 4XB2A 4G6DA 2R8RA 3GNTA 3DDUA 3HHGA 5CCXA 3MPOA 3RIYA 3QEOA 4GI1A 2AHOA 4ER3A 1QHNA 3FE2A 1G8PA 4DBZA 1Y1TA 4GF5A 5K8UA 1GWNA 1VQ6I 2EJUA 1XTZA 2KPMA 1IC6A 3OAAD 1P80A 4L5IA 3RYRA 3PPXA 4RLHA 4BQFA 3HVKA 2HSZA 4RH1A 5A1JA 5CX1A 2QSZA 4XBFA 1JKIA 1TYCA 3PRYA 3N1UA 1I01A 3IP3A 4ARBA 3P32A 3W8RA 3E0JB 3A1SA 5T3YA 3R7SA 2XGJA 2F3RA 2UXBB 4LK1F 5B12A 4G1MB 3M6VA 5JH7A 4L18B 1XD7A 3TL2A 1E7WA 1G8KA 1IFXA 3N74A 1NC1A 4DMGA 2QF7A 1QZXA 3DPLC 4MJXA 3VNQA 4MJ3A 1NP6A 4B0PA 2QMHA 4ESOA 4MQ4A 5TS2A 1NQXA 2VF8A 4Q18A 1DWQA 3E18A 4G4SO 4KUHA 5A5VA 4YQZA 1WHUA 2IP1A 5AFSA 1PJBA 2WNSA 2ZJ0A 1J2RA 1WHTB 5H6RA 5IVIA 1II0A 4LZOA 5FKJA 1TQPA 4DJJA 1Y7IA 2DT8A 2MSDB 1IEQA 3KP6A 3V3TA 3E82A 2Q28A 1N2IA 1W2GA 1AF7A 3AY6A 3W5VA 4QDXA 4CCNA 5L3FA 3PHIA 2BSAA 5H16A 1QE5A 4PHCA 4L0MA 2VTEA 5IX8A 4Q3DA 3RPUD 3O8LA 3B20A 4DR4B 3GP3A 3ZHOA 3IP1A 2A1TS 2R7FA 4J6FA 2XE4A 2JJMA 2PS1A 2ZSHA 4MVJF 5A0FA 3ZEIA 4HYQA 4FFOA 3G5UA 1SIOA 4QPNA 2XYHA 2JBAB 1M8FA 3TTWA 3NWEA 3DHWC 5JXGA 2OFWA 3QKIA 2P8TA 2PLYA 2JCGA 5HF5A 5FD6A 4FASD 2WJJA 2O59A 2NPFA 3M9LA 4ALNA 4UQLA 3UMBA 5K7SA 1MDMB 2N42A 1COZA 5CEJA 4DYVA 3WMWA 4FPXA 4QAJA 4H60A 5TQ0A 4R2HA 4GOKA 4C4ZA 4XTCS 3O38A 1N6PA 1U0JA 3LSRA 1P0FA 3O1HB 4JBNA 4I01A 1C7RA 4MCAA 3FRIA 4JQSA 2R6HA 4RULA 4TWRA 1V3TA 3OYMA 4KTVE 2Y6UA 2A9JA 3ANSA 2EL9A 3HRUA 4KQWA 5K3CA 1ISMA 3KHKA 3AJAA 4EMTA 4P4GA 2F1RA 2QRVB 2Q6OA 1SC1A 4BTEA 3ZZ0A 1USWA 2CXSA 2EKBA 5D3MB 4ARAA 1VIYA 4QIWN 3PUJA 4XQCA 4I55F 1ULTA 3WKDA 2W22A 1U8TA 3AEYA 3O83A 1Z74A 4JP5A 1JHRA 5IMBA 1Y9DA 3PGVA 4HWTA 5F5LA 4NL4H 3SBEA 2QMOA 3BDDA 3WQQA 2CVQA 3RDPA 3N75A 4EHNA 4OINF 1VB3A 2PMHA 5FKKA 5SYMA 4C0SA 1NE2A 1G18A 2DC1A 1NSYA 3WZLA 2EZUA 3WU1B 1YT5A 5AKXA 3M4YA 2FLKA 5BMVB 2JG3A 3NHUA 4FX2A 4IJQA 2JZCA 4M60A 2XMQA 3RARA 4DS3A 1NAHA 4DREA 4AKEA 4QUKA 4XN0A 1UZCA 1VECA 2R751 2ZJAA 4DUGD 4UVAA 1FLAA 2YN0A 3LSYA 1Y9EA 2P4HX 3EC7A 2FRDA 1PHPA 3V6MA 2X14A 2CXOA 2A9QA 1R0XA 3GJ7A 4C0AC 2VDNB 3DMYA 4URUR 3I83A 2X7JA 4OJNA 1UH5A 4P3YA 4E3ZA 2ZYVX 4TWIA 1Y9ZA 1RJGA 3PNPA 2QVYX 2QTNA 1ZIXA 4RCZA 5C1DA 1LRJA 4YO8A 1E96A 3ONQA 4IZHA 4EGCB 5CT8A 4RGXA 5HS4A 5JNTA 1BXGB 2H08A 3MT9A 3W3AH 3N8IA 3RVJA 1E92A 3QBDA 3OQIB 3HXMA 5EZYF 2NXEA 3KTFA 1E3PA 4NFLA 3RFVA 1LC3A 4K0RA 1S3IA 4JYBA 2PNJA 1OZAA 3LPLA 5LZ4A 3O74A 1X1DA 2K9MA 3QVXA 3TNJA 5E6RB 1ZNQO 4G0YA 1DUXC 4DYQA 4GM0A 4X8MA 3VR5A 5JARA 1R4MA 2BBWA 2A5FA 3BWYA 4DIOA 3N2LA 2JVJA 4RKEA 5BORA 2ISYA 4IYRA 4XKWA 4MQFB 3KVVA 1U0GA 3QBVA 4ZYTA 4II3A 5DNAA 3WWCA 5KYYA 5EE9A 2ZB8A 4LKRA 4ISBA 1P6XA 3RHSA 4Z4QA 2FW6A 3GH3A 3MGBA 4RZ2A 1I2BA 1R9GA 1J2YA 3H2HA 2EKLA 3QUTA 4BCDA 4UDOA 3BILA 4B74A 5BYJA 2L42A 4WL0A 1E2JA 3ACDA 3GJYA 5KYYB 4C7BA 4CF3A 3PTLA 3OMXA 4KV7A 3H75A 5KAFC 4ZICA 5F4BA 4EQQA 2FSSA 3K73O 1ZGCA 4HCJA 1UIRA 3KWFA 1BU8A 3BGOS 1JEYB 1L8AA 1M1NA 3CPJB 3C5WP 3KSDO 4AWXB 1Y39A 2CUEA 4IEIA 2DTRA 4IHYA 1X92A 2AE2A 2Q62A 1UOPA 3HDJA 4IIGA 4POOA 5AI5A 3FFWA 3FGZA 3Q5DA 4GZ3A 3KJIA 4K9SA 4MRNA 5JMTA 3GTGJ 3KWLA 3PE3A 4BDSA 1JDBB 4PVCA 4RVNA 2WAFA 4OJTA 1HKHA 3PEUA 4KO1S 2QL7A 2YXNA 1DEHA 4I9GA 2JFOA 2AG1A 1ETXA 5EG0A 1LNZA 3WLFA 1J0DA 1E2MA 2YZ7A 4V1CB 2DP4E 2FVXA 2IPLA 2F8LA 2JJ2D 1Y3IA 2LD5A 4RJJA 3HUGB 4M1ZA 1XA0A 2PUDA 6AT1A 1RYEA 3ZU2A 1Y8CA 3HCCA 2HF7A 3ZQQA 4JYAB 1XOIA 1GTZA 3N6XA 2AZXA 1WEHA 5B3AA 2BSQA 2R7TA 3O21A 3H35A 1P7IA 4B3IA 4MDFA 1WD5A 5DBOA 4RHEA 3T99A 3WTTC 5A5DA 2YQZA 1O6BA 3RM3A 1DP3A 5JNSA 3FCCA 1ZK8A 1MHPA 3KPUA 2VHEA 5IJWA 5FNVB 3DV9A 3EGDB 3W4KA 2QRMA