1XDSA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) and 11-deoxy-beta-rhodomycin (dbra)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
336
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGERPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDDAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Transferase
molecule keywords Protein RdmB
total genus 101
structure length 336
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xdsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xdsA03
2CW0F 3B02A 1JSZA 2PMUA 4MTEA 4DMGA 3WU1B 2OKCA 2ONYA 3R60A 3GU3A 4ER5A 4F85A 1IRFA 5BP7A 3UJ6A 1QPMA 5TJJA 2XVCA 3IL2A 3HCEA 3PQKA 3J81Z 2IDKA 1RIOH 2Y0MA 2ZMEA 3G88A 1T98A 4KWCA 4RB3C 1XDUA 2JH9A 4B17A 2JJQA 2LD4A 3MB5A 2OB1A 1OYYA 4EJVA 3DXYA 2YVLA 2A6HF 4IWNA 1ORIA 2AN3A 3FUVA 3TDZC 2XROA 3GUDA 3OE5A 4EVIA 4A6EA 3GGDA 1EH6A 3EDPA 4KYWA 2QY6A 2F5CA 1AWCA 2VBYA 5FULA 5IT9K 3GEZA 1G4DA 3NDJA 5ED4A 1I9GA 1VP3A 5DM2A 3R0JA 2HV9A 2YU3A 3ML6A 2QWWA 2GIVA 5D8KB 5HDKA 3KETA 2HMYB 3HRUA 2EX4A 3LQQA 4ZH4F 2JTVA 4KA4A 2OBPA 2VE8A 3MERA 4YMHA 4M38A 1RI5A 3VC1A 2H6BA 4M37A 5DM4A 5LQUA 4OQEA 5KVAA 2EV6A 3WTZA 4YV2A 4DNCA 4L9JA 5E1MA 4O6JA 1DL5A 3EGEA 1YYVA 2XKOA 5KQRA 3TKYA 3IYLW 5E8IA 1RI3A 5GP1A 4EKGA 3OU7A 3TO9A 2ZW9A 4E2XA 4LD5A 2NYUA 2UZ4A 3H3UA 1U5TB 3KR9A 2ZIFA 2ZJ2A 2KIMA 4RAYA 3M33A 3BDDA 3LCVB 3J80K 4MHTA 3NQOA 4LJZF 3WTSC 3RKYA 1KPHA 2R7FA 2FSWA 2Z99A 4KW7A 4CHUA 1QAOA 3WE3A 4C4AA 3KFWX 4PYJA 5H02A 2JPCA 2FK7A 3M6XA 2BEOA 1YO5C 5EQJB 4BY9E 1B1BA 2AOUA 1S29A 1IXSB 2B3TA 1D5VA 3V8LA 2PX8A 2B9EA 3G2PA 1JSXA 1F9NA 1YQAA 2IVMA 3RIRA 2MLKA 2GPYA 5FLXZ 1NW6A 2K4BA 3JWJA 3QOPA 1BN5A 3JTHA 1HW5A 4FT4A 1IRGA 2O6GE 3KQWA 3ME5A 4FS8A 3MFKA 2PX2A 2AVNA 1TBXA 5HLHA 2Z5UA 2W25A 3ROUA 1RJEA 3BXOA 3HSRA 3V8KA 2JH8A 5LRRA 3OZRA 3GZ5A 2HYFA 5CVRA 2RKHA 2QRVA 1EAMA 1QGPA 3I9FA 1S7AA 4L0YB 1IN7A 3F21A 4KUMA 2Z33A 1GXPA 1O3TA 3NWEA 3F72A 1FYKA 3UA4A 2D2WA 3QU6A 2JT1A 3CO6C 2QVOA 1TW3A 1ZKDA 1MZBA 3RIEA 5CCBA 4QTUB 3JAMZ 5D5UB 6PAXA 2YX1A 4QTTB 3AXTA 1XN7A 4I7HA 4M6XA 1NT2A 2FK8A 1XMKA 3TKAA 4ZYDA 2R3SA 3KQPA 4FSXA 1XDSA 2VOOA 1TTYA 2L02A 4LK0F 3GDHA 4CKBA 4NQWA 3GLXA 3L2CA 1FX7A 1XMAA 4UVCA 3K0LA 3Q5FA 2P41A 2RVCA 3K6RA 2ESRA 4KT5C 2G72A 1J2XA 4ATNA 2KIUA 4PYMA 5FHQA 2VODA 1T38A 4POOA 2J5OA 3BJOA 5K1YA 2ELHA 3DUWA 2HYGD 1BI0A 3MWMA 2GA1A 3R24A 1QBJA 2P7HA 4JXJA 4WXDA 3I53A 5LEJA 2ZLBA 2ETHA 2DQRA 3QP5A 5DCMB 2CKDA 3ELWA 1UFMA 1TQIA 4HQMA 2XHKA 1GVJA 1T39A 2QQ9A 3F8MA 3O7WA 3IWFA 5EC8A 5FO5A 2FBKA 3VSEA 4ZZDA 4WK8F 5FWAA 4MWZA 2ZWAA 2QM3A 1YUBA 5FA5A 1U2WA 1RZ4A 5BMZA 5AONA 3OE4A 3DXXA 2HWVA 3KPVA 1JGSA 5CVDA 5E8GA 3AXSA 4QDJA 5LEKA 1FSEA 3B5IA 4RGSA 3I64A 2OZ6A 2ADUA 3TQNA 2M5WA 1ZG1A 2GA2A 2BM8A 1L3CA 1NV9A 3EVAA 4C08A 1T6SA 2K27A 3WE2A 2HFHA 2TDXA 1R1UA 2UXXA 3ECHA 4UNOA 1NBIA 1VP9A 4MGRA 3RJPA 1WZNA 4XRFA 1G55A 5C9ZA 2ZIGA 1BC8C 3NVMB 5EMJA 5ERIA 3ZPLA 1G38A 1LNWA 4FX4A 1RI2A 3M7GA 2PBIA 1KQ9A 1QAMA 1Z1DA 2CMHA 4KDRA 4BLUA 4KDPA 2BZGA 1EV7A 2K02A 2A3SA 1FBSA 2Q2EA 5DCFA 4I98B 3BPXA 1O7FA 4P55A 4YUXA 3WTVC 2CYYA 4M6YA 5LQAA 2ZXJA 1IXCA 2BBYA 4L5IA 3RTRA 4OINF 3DKWA 1ZN2A 2A69F 3LSTA 3RI4A 4UXNA 5DRYA 3KE2A 3T1BA 3U1DA 1KU7A 3FMRA 1JG3A 1LEAA 3COAC 3UJCA 2CGPA 3FTDA 4PYLA 3FYDA 1J7KA 1V39A 1BI3A 1UHMA 2JZYA 1MGTA 2D1VA 3PX2A 3J81K 1XB4A 3HA5A 3IRRA 1P1BA 2C7RA 5L3GA 2VXZA 5F64A 4M7RA 4WXHA 3TMAA 3OFJA 5K03A 1JQ3A 3BPVA 2VDUE 5LQNA 3BWGA 2O0YA 1VL5A 1IY9A 4I02A 4BAYA 1S3JA 1YW9A 5LBQA 1D8JA 2W57A 3CVOA 3RKWA 2PT6A 3SFZA 1K7AA 1KGSA 1OPCA 5LGTA 2M45A 4EGYA 2VONA 1E17A 1LDKB 1I1NA 3S68A 2CL5A 1O3SA 4KIGA 1ZREA 2OPBA 3LDFA 3H2BA 1SVUA 1HKTA 3FYCA 4QPPA 4RTKA 3I71A 3KR0A 3V7RA 5JFRA 5LSAA 4XUDA 1L3BA 1SD4A 1NW3A 3O4FA 3T8RA 2YPRA 2AVDA 3C3YA 3KQSA 3IKTA 4ER7A 3C7JA 1K78B 2STWA 3QU3A 5FD6A 3WG9A 3R4KA 5EMKA 5EZSA 2DPMA 4ENJA 5JR3A 5DEQA 1G6NA 5KS2A 4HF0A 2EWNA 1L1EA 3HCBA 2NRAC 2YX7A 4P9FA 3FUXA 1B9NA 2L54A 3G3ZA 5HEKA 1J9IA 2VP3A 1SD7A 4ENMA 1KPGA 3GFLA 4RGXA 4PYQA 4M74A 2G7UA 3L9FA 4PGHA 4YIFA 3KKZA 2E5WA 3LKDA 5HLIA 5FLXK 3MCTA 4L5JA 1YIOA 1ON2A 4ZTBA 2MC3A 3HTUA 1F4KA 3M6WA 3WTUC 2W24A 3CCFA 1ZAOA 3BWCA 2YTZA 2ZBQA 5D1NA 1BM9A 3MZYA 3KQYA 1MHTA 1R6AA 2FF4A 2EJRA 4R8SA 2UYHA 3GRVA 5H6RA 1IN4A 3PFGA 3DULA 2RQPA 2HTSA 2OAZA 3BJ6A 2ZZKA 3J80Z 5DXAA 4RB2C 2ORED 3BP8A 3K9TA 1OR7A 3HM2A 1P4XA 4XCXA 1JXSA 1O57A 4JBAA 2CMGA 3PQJA 1TNSA 4ZYGA 1YS6A 5FUBA 3KQOA 1Z6RA 3SMQA 1WSUA 2A5YB 2FYTA 1WI9A 1WKMA 1QAQA 1KPIA 4EV0A 1P4WA 4KMUX 5FFXA 5K0LA 2X0LA 4KN7X 3G73A 1U6GA 5E8RA 1Q1HA 5EMLA 1W7PA 5DLYA 2XRNA 2OB2A 4OMZA 1J0RA 3G8AA 3T7SA 3A4TA 2C7OA 3HVHA 2FRHA 3FX3A 4AVPA 3THRA 2DFIA 2ZNZA 4LLNA 2O03A 2DW4A 3HEMA 2ZBKA 1PJZA 4IJAA 5ICGA 4M36A 4Q47A 5C1IA 3EUHA 3F8FA 3FZGA 3JAMK 2V1UA 2P7IA 3FXQA 4A0ZA 5HFJA 1SMTA 3DF8A 3FF5A 4RWZA 1JTEA 4ER0A 4GF5A 4DKJA 4BLVA 1WRJA 1XSDA 4EQZA 4O5VA 5BS6A 3T5XA 1SFUA 3C1DA 2IBTA 4EK9A 1BIBA 2FRXA 3QAHA 2BM9A 2ONZA 4RX1A 3ZMZA 1KIAA 5C0OE 1XGNA 3CGGA 1M6YA 3GYHX 2YQZA 5A2QK 1EG2A 4PCLA 4GXOA 3JW4A 4OIQF 1Z7UA 3K2ZA 3ORHA 4MQ4A 1NBHA 5E2AA 3W6KB 3GRZA 3ELKA 3E3VA 4Y17A 4DQ2A 3T8TA 4A6DA 5L3BA 2W84A 2K86A 4YUZA 2O8XA 4HSGA 4XUEA 2L4AA 1SAXA 2OD5A 2XGXA 5K0CA 5D1HA 4U7PB 5F2NA 3EVGA 3G2OA 2VOPA 3HVIA 4A5NA 4MQVA 4GOND 2EV5A 4LLLA 3R0QA 5DD8A 3IRQA 1FYMA 1U5TA 5E1DA 1N7JA 2IH5A 1SKMA 2YXEA 1ZLJA 5DSXA 3MTEA 2VDVE 1O9HA 3DV8A 1R1VA 1XSXA 3CJRA 7MHTA 1N7IA 1KR5A 1HW1A 2QZ8A 2V79A 4HGYA 4IPAA 3OFKA 5HDNA 2PVCA 4EM0B 3NEUA 4IVNA 1X19A 1SUSA 2M1BA 3CO7C 1SQGA 2I9KA 2RGVA 3DH0A 5F1RA 5D8LB 3DQVC 4PIPA 4RTOA 5HZMA 3FPHA 3TLJA 4AIKA 2GLUA 3BZBA 3E5XA 3GRUA 4DCMA 3BKXA 2I7CA 2YXLA 3IV6A 2VZ9A 3BWMA 4KMFA 5H6QA 4FT2A 3C3PA 3OU6A 3BOQA 3GX4X 3V8JA 1MJ9A 3E6MA 1J5YA 3C3WA 2ADMA 1SD6A 2GH1A 1S8NA 1YFJA 5LGNA 4HDUA 1X1BA 3MGGA 1Q0SA 1W7PD 2DT5A 2ERCA 3UBTA 2NXJA 2KRFA 2CFXA 4PZJA 3MEXA 4E33A 1K6OA 2YX4A 3RPUA 1JE8A 1YLFA 2P5VA 5IH3A 4AZSA 1R36A 4PCAA 4UVAA 4L0ZB 4U0VA 2FEZA 1YZHA 4MTDA 3FM3A 3WGIA 3GW2A 2FMLA 3P9IA 3CUQB 1KU2A 1FWZA 1G8SA 4EMSA 2F2EA 3ZN1A 1PRYA 5LHIA 3PS9A 4M9SA 1NE2A 2DK5A 4E2ZA 4B09A 1IAWA 1G3WA 3I59A 2VN2A 3CLOA 1J59A 3BUSA 1QNTA 1Y8CA 1XCVA 2XVAA 3P2EA 1EH7A 4GO1A 2MD5A 4XSXF 2KKOA 3CKKA 2XAGA 3F4KA 4UV9A 4G7HF 4HLXA 2ZFUA 3UZUA 5F2OA 4Q48A 4UOEA 1XJ5A 2G70A 2ZIEA 1U5TC 4UUVA 1NV8A 3H3ZA 3JWGA 4FX0A 4A0YA 1JHHA 3HSFA 2PWYA 1FBUA 3MZHA 3M8EA 4GQBA 4HF1A 2IH2A 4U0YA 4FGZA 4LECA 1RI7A 4HZFA 2DTRA 3P9KA 3E6CC 1B9MA 2UWMA 1X1DA 5CUQA 2PSSA 5A2QZ 1CF7A 3Q87B 2KJBA 2QUFA 3G8BA 2QQBA 4Q4ZF 1IF1A 2EG5A 3QOXA 3NJRA 4BLWA 3B3JA 4QLCU 3P8ZA 3LBFA 4ETSA 2EFPA 2XKPA 2BR4A 3E8SA 2RV8A 1RI4A 2O05A 5LHHA 4KRGA 4QWQA 3KP7A 5ICCA 1RJFA 1OR8A 2XBMA 3HOTA 2A07F 5LHGA 3WU0A 3E97A 3A7EA 2P7VB 5CVJA 5DV5A 2B78A 4GYIA 2GZWA 1KXZA 3K69A 3ER8A 1TLHB 2Z6QA 1UHWA 1L3LA 1UFKA 4GOMD 5D5VB 4EM1A 1BOAA 4RVDA 4AX8A 1GHCA 3RKXA 2N47A 3TOAA 1IZ1A 3KZYA 2EFNA 3E5UA 3V8VA 4AWXB 5T6BA 1CGPA 2GAFA 2AOWA 3MAJA 3EVEA 3T7TA 1OYIA 2Z9OA 4PCQA 3SXYA 1EJ0A 2OO3A 5D4RA 2EFWA 2IJLA 3T0YA 4KICA 1CF7B 3S2WA 4PGGA 4ESJA 4HH4A 1Z9CA 4OU0A 3JSOA 1FOKA 3ER9A 2AOXA 1O7LA 2YXDA 2PQ8A 3MQ0A 2V74B 4O3MA 2HKOA 4LLGF 2MBFA 2HS5A 1WG8A 2AR0A 1RNLA 5HDGA 2K7LA 5TRDA 3DOUA 4S04A 4O29A 5DX0A 3OZTA 4A12A 3REOA 2PY6A 3EVBA 2PX4A 5DYMA 3HA3A 3P71T 2QBYB 4EGZA 1KYWA 1XCBA 5KVRA 1EQAA 1T43A 5EHGA 1U78A 3ELDA 3OCJA 2LF8A 4Z2YA 1B6AA 3LGAA 4AUKA 2ZWVA 5HIIA 2PJPA 3V7SA 4CWAA 1JG4A 2OZUA 3NRVA 2QENA 1WQ2A 2IDJA 5ERGB 1P2FA 2DPDA 3R6SA 1WXXA 4PYOA 5E20A 5GM2A 4G7OF 1FPQA 1Y0UA 3HRSA 2Y1XA 3BKWA 3IEIA 4YUVA 3NVKI 4YFNF 2GWRA 1TNTA 1TQPA 9MHTA 4UHTA 1M0EA 1I1GA 4U88A 4GUAA 3Q7EA 4IV0A 2V7EA 3R9XB 1ZG5A 3FUUA 3TRKA 4PINA 1AV6A 3NW9A 4E70A 5EIFA 4PYKA 5BQTA 4IF4A 3KZZA 4HF2A 3U9GA 2AOTA 3IHTA 5T67A 2A6EF 3I5UA 3GO4A 2A68F 2IT0A 2M8EA 2EJUA 5D6FA 1PDNC 1X3UA 5DCMA 4LWOA 5CIYA 3FPJA 3I58A 2C6YA 1R1TA 5GIPE 5KK1A 2NNNA 3F8BA 1G3TA 3C6MA 3MCZA 2H00A 8MHTA 1U2ZA 3G5LA 1IXKA 4GYGA 1HQCA 1SUIA 1REPC 2NNWB 3LL7A 5HILA 5HIJA 4HQEA 5K0GA 1XXLA 3FUTA 2ZZNA 2BGCA 1E2XA 1YS7A 5E1OA 1HSJA 1UWVA 4RVGA 5U4XA 2JSCA 3HYIA 3I4PA 1NW5A 3DMFA 1VLMA 1SQFA 3DMGA 5EHIA 1ONVA 1LB2A 4EJOA 2FBIA 2Z6AA 1DCTA 4X63A 2PXXA 4YV1A 4U7DA 2EV0A 4GOOD 2IH4A 3ABUA 4DCGA 4M71A 5FTWA 1G60A 2DBBA 1EIZA 2AOUB 2V1DA 3L00A 2OYRA 5EEGA 1G8AA 3PTAA 5KYGA 3RW9A 3WSTA 3NDIA 2CG4A 1SFXA 3FRIA 2L01A 2VE9A 1LEBA 2O06A 3VOEA 3CC8A 3T7RA 3VB2A 2IA1A 1PUEE 1BC7C 4K2EA 2F5DA 4HG2A 1I27A 1BIAA 5ILVA 4DF3A 4C07A 3RYPA 3BY6A 5EGSA 1I5ZA 4LG1A 2HDCA 1S6LA 4V0RA 2ZZMA 3Q9VA 5L3EA 1KHHA 4R79A 2PXAA 2XYVA 1TPYA 4CKEA 5FWDA 4WX9A 2PGXA 4CXFA 2P3LA 3OOPA 2C7PA 3ZMTA 3PLAE 1A04A 3EVCA 5BPIA 1EJ6A 3EMBA 1T0FA 5BPDA 3CDHA 4Y15A 5BOXA 3QRFF 2NS0A 3AAFA 3DLCA 4OIOF 5EVJA 2H94A 2H11A 2VC0A 1IW7F 3CTAA 2RN7A 5T64A 4MHGA 5D5WB 4AIHA 1D2GA 2IBSA 5JVTA 2Y75A 3SGLA 2RDPA 2GAUA 3A25A 1FT9A 1ZYRF 3B3GA 5G02A 3IKVA 3TFWA 1JTFA 5CJ9A 5D5XB 3LAJA 2G8NA 5DM1A 3LA2A 1BBYA 2WK1A 4RTMA 1Z3CA 2IIPA 4CZZA 3NWBA 4U7TB 3CBGA 2E1CA 3TO7A 3DFGA 2GA9A 4ISCA 1JQEA 3V7CA 3CUOA 3ZMSA 3G7UA 3A27A 3UA3A 4PYNA 4ZZLA 1RJGA 2H09A 3ABTA 5FB2A 4RTJA 2VS1A 1KU3A 3LWFA 4HYEA 1WWXA 2LSOA 4P96A 3P9NA 3ZN0A 1SG9A 3U81A 3D5LA 3F8NA 1LVAA 3SHFA 1AOYA 1ZQ9A 3I54A 2FOKA 4QDKA 3GVAA 5K01A 4HX4A 2PN6A 4FP9A 4DZRA 4ESFA 1K79A 3GFMA 1W5SA 2CSOA 3TQSA 5K0EA 3V4GA 1ULYA 3MQ2A 2EA2A 3LECA 3I0TA 4OBWA 1XGMA 4R6XA 4XLNF 2G9WA 3LAPA 1IN5A 4WWCA 1EH8A 2ZFWA 2PBFA 1MDMA 2IFTA 3L09A 4PIMA 5DM0A 5F2KA 4AZTA 1VQ1A 5J6XA 4WXCA 4GC9A 1DP7P 5FQNA 2XIGA 1H0MA 2PXCA 5DD4A 2XAHA 4QVGA 3KR1A 1ON1A 5CYVA 2QRVB 4WF2A 4BYYA 3H92A 4C04A 4LG0A 3ANXA 1F1ZA 1DPRA 2ZMEB 2P4WA 4FR0A 3TOBA 3VFZA 1XD7A 3HIFA 5EMMA 3EYYA 4H0EA 3KPJA 4KN4X 2WA2A 3G2QA 2QE6A 5E8JA 3SR4A 1LQ1A 4E2YA 4CKCA 1TW2A 1QQIA 2RC4A 3LA3A 3EETA 1S7OA 2PV0A 2E1NA 3DXJF 4ENNA 3MTIA 3B7PA 2EA4A 2F8LA 2XVMA 3SQNA 3BGDA 3JWIA 4BQAA 5DSTA 2BYVE 2NXEA 3R6TA 3FTFA 1MDMB 4R05A 3LDGA 4HC4A 2JHPA 2B0LA 3HTSB 1I4WA 3HP7A 2JHAA 3KQMA 2ZULA 4ENKA 4BHPA 3SM3A 4G6DA 3KCCA 3VEPA 10MHA 1R8YA 4AZWA 2PT9A 3UJ9A 3F22A 3BROA 5J8CA 5K5RA 2PLWA 4NHJA 5GM1A 2ISYA 2NXNA 2UYQA 3PFIA 2XAFA 2AS0A 3L8DA 2FQ3A 1H1DA 3PB3A 4N9HA 3M4XA 3R3HA 4RTRA 1I1SA 4CDGA 5HS7A 4G6QA 5E1BA 2NXCA 2P7CB 3PVCA 2P8JA 3JWHA 1DUSA 2HOEA 1MJAA 2EFOA 1N2XA 4QQKA 4P7KA 3HVKA 3ZQ7A 5K0JA 3ECOA 4R8HA 3EVZA 3MAGA 1DUXC 4I01A 1HMYA 3DLIA 3DMHA 3HVJA 2FMYA 3X0DA 3IHUA 3UJDA 4KNYA 5CVUA 3KP5A 1IXRC 3TDUC 1VE3A 1YF3A 2DI3A 2LDUA 3HUGA 3UJ7A 3CUQC 5ILSA 5FGMA 2E7XA 4MEYF 4AIJA 1O9GA 2P8TA 2ZO4A 5DUKA 2F5FA 2AN5A 2Y48A 4IXAA 5DRTA 4PYIA 2WWYA 4HTFB 2ZCWA 4PDKA 5F6FA 2L4MA 3P97A 3KLNA 3GFIA 4PNEA 2YSRA 4DM3A 4XSZF 1XGSA 2MH2A 3FTEA 3FPGA 3FWEA 4GBED 3EPPA 3F8CA 2VT3A 3KP2A 3ULQB 3WTTC 5P8WA 2AXLA 2QYOA 4Y2HA 3DP7A 4GC5A 1SD5A 3GZ6A 4R6WA 5CCXA 1JR4A 2BR5A 1QZZA 4HX8A 2OBFA 4F86A 3BWYA 4CTKA 1R5HA 4IRHA 5BXYA 5CVIA 1ZRFA 5CM2Z 4OIPF 4OA5A 2HQNA 3HHGA 2ISZA 3C18A 3P2KA 3ELUA 4IKPA 4HV6A 3UJBA 5MHTA 1V3FA 1ZRCA 3VYWA 4P7FA 3LHDA 4M73A 4UVBA 2ZVJA 5CD1A 1FZPB 2QLZA 1B59A 2P1DA 4M72A 4BHCA 4V0QA 1FNNA 4KIFA 3DPTA 4RV9A 3ZMVA 4RVHA 1YTYA 2JG3A 1MKMA 3FXUA 3GNLA 3GJYA 4EJUA 1P91A 2O0LA 3LBYA 3GXOA 3EVFA 1GXQA 4YFKF 1AQIA 1B42A 1R5GA 2R6ZA 4H0NA 4F84A 1X1CA 1XCLA 3E6DA 1P4AA 1DPUA 1PP7U 3KU1A 3TPZA 3LFKA 5DTMA 1UCRA 3LPMA 2EFQA 2LNBA 3U2RA 2P3QA 2QQAA 5L3FA 3A7DA 1ZGJA 3O6BB 4YIIA 3TO6A 2P6SA 4N9IA 2IW5A 5HVQC 1D2CA 1FY7A 5FFZA 4Y30A 4YUWA 4ZYHA 2IA0A 4L9VA 2NAZA 4M9ZA 4L9TA 2DU9A 3SSNA 1FLIA 1INLA 3GRRA 1L0OC 3DXZA 4HAMA 2H6CA 2EFJA 2BH2A 5LQRA 4OA8A 3P2IA 4YMGA 2CWEA 2O61A 4FZVA 5AIPA 3PFHA 2P5LC 3F3XA 2P40A 3P7NA 5HIKA 5DX1A 4G56A 2OXTA 3GRYA 4X41A 3D0SA 1LJ9A 3R61A 4BP3A 4RGRA 2JPBA 2DQLA 4HDVA 4B8XA 2RNJA 4N0BA 2QBYA 2PG4A 3FZVA 4LB6B 1XVAA 3LA7A 1YW8A 1KA8A 4G9YA 1NHAA 2UYOA 2HGCA 2PMHA 3P9CA 1RJDA 1VIDA 2PKWA 4DA4A 1D2HA 4ON0A 3RDIA 2B25A 2AN4A 2IP2A 2ZBRA 1TQMA 5JHUA 3KPUA 3UJAA 4KIBA 1X1AA 2MH9A 1R00A 4FHTA 5CVVA 2GS9A 5K05A 1YW7A 4ESBA 3LQRA 2VDWA 3ELYA 3M1EA 5LQCA 4CICA 1L3IA 4LB5A 2IPQX 4BH9A 4D0PA 4G7ZF 1U8RA 4RSRA 1K78A 5EOVA 2VT2A 3HOSA 1IUYA 1L9KA 3AWIA 1VTNC 1O54A 2Q41A 1KYZA 3TGNA 4MTLA 4YFXF 4L7VA 5DTRA 3DTNA 3HNRA 3SXJA 1OMIA 5EEHA 1U3EM 1HXDA 1O3RA 5JUWA 4LFUA 3BGIA 5LLQA 2P6TA 1R22A 4RAZA 4PONA 4HLYA 3E23A 3F23A 4M9XA 2WA1A 4BXUA 3KQTA 2HTJA 1D3YA 5FHRA 3AY0A 5E1XA 2Z6UA 3ZMUA 2G1PA 4RS8A 3SSOA 4GGGA 3JSPA 2IGTA 3EGIA 3EEOA 3E6BA 1FP1D 4RB0A 4ER6A 1H9GA 4IRIA 2ZTHA 2IRFG 2KJCA 2V6CA 1R18A 3DR5A 4C06A 3B3FA 1BHJA 3KP6A 4LWPA 2P5KA 1Q0TA 1P39A 2NP7A 5E1WA 1MJFA 2AZTA 2STTA 4LG0B 5K5QA 3M6UA 4OQDA 3KQVA 2GXBA 5K0BA 1YG2A 1F38A 1IN6A 2G7HA 3KPWA 1HW2A 2BV6A 3SX0A 2OQGA 3N4MA 3FMSA 4LK1F 2J5PA 1LDDA 2XAQA 4A2UA 5JI6A 2B2CA 3CJQA 4WVLA 4HRAA 5D4SA 4BP1A 4FSDA 2ESHA 2XV4S 2FNPA 4A5MA 2CQKA 3QP6A 3K1NA 2XUBA 5ICFA 4EM2A 4YG2F 1DDNA 3SZPA 2FHPA 3M8FA 2COMA 1C0WA 1ZRDA 4OIRF 2H1RA 3FRHA 1SMYF 5E9WA 5E9JA 1ZGAA 4QQNA 4G8XA 3ZP5A 3BJAA 4HA8A 4MIKA 3A26A 4GOLD 2HEOA 1BC5A 4OOIA 5LQJA 2YR2A 2VBXA 3RYRA 4HV5A 4S05A 3WODF 2CO5A 3K1MA 5LQKA 2FBHA 5LR6A 2FE3A 1UIRA 3VODA 2YR0A 2DAOA 2C7QA 4IHTA 3NMUF 1ZHFA 5DDGA 1F5TA 4U7BA 2D45A 4RYLA 1FBNA 4ASNA 2AOTB 3LKZA 3I59B 2OZVA 2UYCA 4NECA 4EKIA 2XASA 5FA8A 4EQQA 4CO8A 4I0BA 1HNNA 1JQDA 1WXWA 1I6XA 3FHZA 5K0FA 1QO0D 5M5BA 1BI2A 3TR6A 5GINE 3FUWA 4OX9Y 3IWZA 2EJTA 5HIMA 3C0KA 4MEXF 2A14A 2XAJA 4NB5A 2PI0A 1YZ3A 4X1OA 1M6EX 3TM4A 2Q8KA 3GO5A 5HS8A 2AOVA 3ZMDA 4C03A 4HGZA 2V9VA 1NKVA 1KP9A 5B1SA 4A0XA 1HKSA 2HQRA 1R7JA 4Q5SF 3D2LA 4P7GA 3PT9A 3HCDA 2ACJA 1OYWA 4P9UA 4MQ9F 2OA4A 2FNAA 3EGVA 4X60A 1R74A 3WTWC 2DO7A 1QANA 3FTCA 5DWQA 2HR1A 4RTPA 1AQJA 5EIWA 5HS9A 5L3CA 2K4MA 2X4HA 3K1PA 1JG2A 5DPMA 4PWYA 4QVKA 5E9QA 1BKYA 1WY7A 2MA3A 3TOSA 4E32A 1O3QA 1NW7A 1ORHA 1XDZA 1XSVA 2K4JA 3KP3A 4P5OA 5H20A 1ODDA 2BE5F 5DTQA 4XLPF 3LCUA 3J7AO 2GB4A 3R0AA 4E30A 4Y13A 2EB7A 2HTEA 4IRGA 2E7WA 1NW8A 1FYLA 1RI1A 2HNKA 2WV0A 4AZVA 4BNCA 1RUOA 3Q9SA 1Z05A 3FPEA 3HCAA 5FCDA 2DK8A 2FXAA 4GEKA 3LX6A 3FM5A 4ZYEA 1IN8A 2L3DA 5HOQA 3HRTA 3JTGA 2FCAA 3GIWA 1XCJA 5GOZA 1FP2A 2OY0A 3G2MA 5EZQA 2FA5A 3B73A 1OKRA 3QPTA 2M30A 5ICEA 1P1CA 2HWKA 2OU2A 1FBQA 5DUIA 2PJDA 1T2KA 3G5TA 2Z3YA 3WGHA 4R1HA 1JG1A 4JQFA 3BZ6A 4KFCA 5KQSA 4UV8A 4L18B 2PWPA 5BW5A 2NYXA 2O3FA 4TV7A 3ISPA 3V97A 2PLYA 2G71A 5EG5A 1KQ0A 1QYRA 3O2PE 1LDJA 3OZSA 1R58A 1KU9A 5D6EA 5LGUA 1HKQA 4RGUA 3BGVA 3CJTA 3SVZA 4EJTA 3DEUA 5J8FA 4EJWA 3G89A 3OV8A 3BWBA 3HTXA 3QOWA 2FPOA 3GFJA 5HOOA 1XTPA 1RUNA 4YUYA 5AIQA 2NP6A 4RTSA 3F6VA 2HKXA 4RTNA 1P92A 4OMYA 3B89A 1R8XA 2ZBPA 2FU4A 5E17F 1B4AA 3HRMA 2DULA 4HW0A 2I62A 4KDCA 4MNUA 2ESNA 3T0IA 5DT2A 3KEOA 3EMDA 4RVFA 2PX5A 5CLSA 3FXRA 2YUIA 4HOBA 2D1HA 2WTEA 2P35A 3KLOA 4X61A 5GIOE 2ZNYA 1VBFA 1ZH5A 4XUCA 3C6KA 1YFHA 2KIFA 4AD9A 3ID6C 4YV0A 3KR2A 5L3DA 4I0AA 4XBFA 4R8RA 1ZLKA 1FC3A 2LKPA 3EVDA 1BOOA 3GWZA 1IM8A 1J75A 3SZTA 4JK1X 3HCCA 1JHFA 3OPNA 4RB1A 3HHHA 5K09A 2VBWA 3EEYA 2AS5F 3UFBA 3MHTA 4U0WA 2Y1WA 3E05A 3HA7A 2GQQA 3M6VA 4LGWA 3ERED 2I6GA 3AJDA 1D8KA 1ZARA 1FSHA 5IT3A 2HZTA 4CXMA 2ZSUA 2LF7A 3PX3A 1WS6A 3FPFA 4BHBA 3IC7A 5LRSA 2H27A 1BJAA 3F6OA 5EKXA 3UWPA 4RTLA 1W4MA 5EKUA 3HSEA 1ZG3A 2VC1A 4RTQA 3O31A 1Z6TA 2UXNA 1VPTA 3UJ8A 4HX7A 1USTA 2XYRA 3QV2A 3E7PA 1PP8F 1W7PB 2BR3A 2DPUA 5HLGA 1G6Q1 3WTYC 5ILUA 1UB9A 3BT7A 5K8VA 2KW5A 2OQRA 4IHSA 1YB2A 3THSA 2NNYA 1MJBA 2W85A 2V1XA 4I09A 5FQOA 2JRTA 3L7WA 5DX8A 1YFLA 1HSTA 3GF2A 2DLLA 1BI1A 4CGZA 4L9NA 3OU2A 2F5EA 3M9AA 4WCGA 1G3YA 1R23A 3RODA 3CUQA 3VC2A 2Q0OA 3RPQA 3N97A 4P7JA 5IKMA 2EK5A 2R7DA 4P58A 2JHCA 1F3LA 2UZKA 2MLGA 5E18F 4G94A 1W5TA 1MD0A 2P3OA 2VBZA 3KHKA 3EQLF 4K6MA 3KP4A 3M70A 3K0BA 4I2OA 2IA2A 1FJXA 5DXJA 2CWWA 4E2WA 2PFBA 4F7ZA 2A61A 3HCFA 4IV8A 1P6RA 5K5OA 1G3SA 3WTXC 1KQ8A 5CVEA 4E31A 1STZA 3CJNA 4C05A 5FD5A 3DPLC 3O3KA 5E2BA 4QPNA 2HR3A 1SFEA 4OBXA 3KEQA 5GWXA 2O07A 3ERCA 5IT9Z 1V4RA 4HTFA 4ER3A 5BW4A 3E5QA 4FT8A 2M87A 3NTVA 4GCVA 3KQQA 1HBXG 2WC2A 3KPYA 3GCZA 3WGGA 5EPEA 1AF7A 3LCCA 5FADA 3SSMA 3EYIA 2PEXA 3FMQA 2XYQA 4KVZA 2ZCJA 4HBLA 1H9TA 3TM5A 1XGOA 1Z91A 4CTJA 1QZYA 4CYDA 2O57A 5K0NA 3LDUA 2IPXA 4LMYA 1USSA 2ZKZA 3W6JB 5E1ZB 4DQ0A 3QPHA 2GXGA
chains in the Genus database with same CATH superfamily
2QXUA 1SWVA 1Q1VA 3HPGA 4ZCSA 1JSZA 1ORWA 2CHEA 2G9UA 2O6HA 3NAZA 4MTEA 4LNUB 5DNWA 5C8VA 1JWLA 3EW7A 4KSYA 1SKQA 2R5ZA 2ONYA 1NP6A 2XV1A 3VAZA 3LYAA 3SCZA 3C3MA 4W8OA 4B3FX 3KEFA 3H8SA 2ZYUX 4YRFA 4ER5A 2QPTA 3QBVA 4ISBA 1WXIA 3V3KA 4DUPA 1DP4A 1N5LA 1UK9A 1FTWA 1FTZA 1A9OA 2J6HA 3EGCA 4RV4A 1BS1A 4YRCA 3CSUA 4AJ9A 5TJJA 1JJ8C 5BP7A 3SEQA 1CDEA 3PQKA 1QJCA 5D3KA 2O5EA 2V45A 2J45A 2GTHA 1RIOH 2DMRA 4KT6A 2F3TA 3AC0A 3IPAA 5EUMA 4B5KA 5BV0A 3D8UA 3QKWA 1VQ7I 2ZMEA 4JUFA 1OB2A 1XA0A 5B58T 4BUPA 1F7UA 4RB3C 3OYBA 2QAJA 3RTBA 2V4ZA 1OA1A 3D3JA 1Y9DA 4BVFA 4B17A 4A93J 4WN3A 2LR0A 4GGPA 2HSGA 2OP0A 2BKVA 2DM6A 2A6HF 2YVLA 2Y6UA 4DBZA 2W48A 4H0FA 1FSGA 3PX7A 4Z8XA 2QL5A 1T2DA 2BM0A 3FZQA 4ZVQA 5IAJA 1TT5B 1TTHA 3N05A 4CETA 1TGYA 1TK2A 4LISA 1IONA 1TEVA 3BMCA 4LXXA 3HKDB 1AKTA 4LDRA 3O9VA 3UKJA 1NMQA 1D0VA 4KYWA 3N2IA 5EPUA 4OJMX 5L3SB 4V0LA 4MRNA 4C6HA 2JLUA 4HMQA 5I7RA 2AKYA 2C2MA 3IIEA 3O03A 3BTIA 4U87A 1WXFA 2DSTA 3D1LA 3E0QA 3PPVA 4JP1A 3NDJA 1IWBB 5DVZA 5ED4A 2RKWA 5I9MA 5EHZA 1GTG1 4C3OB 2I6TA 4YIRX 4NDZA 2QWWA 2VPRA 2I3AA 3U4DA 3CMAI 5BV7A 5KTPA 1P77A 2AW3A 4HVAA 4FFVA 1CKEA 1CUZA 1DOHA 1S3SA 2PL9A 4ND6A 4OMDA 5JH7B 2GCIA 1Y4AE 3OF3A 4INJA 5LNK1 4BLRA 2XUJA 4ZH4F 3EZ9A 4KA4A 5TEVA 4L8FA 1GYRA 3WGOA 4PC6A 1IJWC 4P5EA 5CYGA 4CV0A 4NBRA 2ZRPA 1PNOA 3VC1A 4RY8A 2Y71A 1PSZA 1JLRA 2I1WA 4RLSA 2Q6TA 3OC0A 3PXAA 1DZ3A 5LQUA 1VCHA 5F33A 2EV6A 3WTZA 1NWHA 2F3SA 5CLIA 4L9JA 121PA 4YV2A 5E1MA 4O6JA 2HF7A 5ULLA 1YYVA 1XZHA 2QMEA 3CVJA 4FYVA 3E7FA 2Z5FA 4G9GA 3TKYA 4LZZA 5AK0A 3OFSA 1R4AA 3U9TA 4TRNA 1RI3A 4WOKA 4ZI7A 4B3AA 2I3ZA 4J7UA 4RZ3A 1S2NA 3ABSB 1K4MA 3OLXA 1V6CA 2ZW9A 2VWPA 1XZFA 3UK7A 3W90A 3ZZUA 3LH5A 5FH9A 4JX9A 3CVXA 4GRIA 4YYZA 3LOQA 4ZZIA 5F1KA 1M73E 3WIBA 2LC2A 4O2LA 4C4YA 1E8MA 1RYNA 2DEUA 2ZJ2A 4WSOA 5K2OA 2KIMA 4RAYA 1L4UA 1XZBA 1E64A 1E1RA 1NI4A 3M33A 2YV4A 4D4HA 5A3JA 3W5BA 1CF9A 1LVHA 5EJMA 2II6A 2FMKA 4XA8A 2XB9A 2QRNA 1OXKB 2WWIA 2XBLA 1MH4A 1G8KA 3KYCA 3D2CA 1VQPI 4JSRA 2KIQA 3WTSC 1H4VB 1KPHA 3SN6A 3DLBA 4X3CA 2R7FA 4M8IA 4U3JB 2C20A 2E2JJ 4ROTA 5C3EJ 4CHUA 1GKKA 1KI9A 4V38A 3W8DA 5HGJA 4DE5A 4ZYUA 2JA2A 1FBTA 2PLNA 4KODA 1PT6A 2Z3WA 1FX0B 2OBMA 3OYLA 4YJGA 4QPCA 1E9CA 4W9NA 4M60A 2JPCA 1ECBA 4Y0AA 2H1FA 3TQIA 3NTOA 2I54A 4PXSA 5CDFA 2NM0A 2AOUA 1SM4A 2BTQA 1AY0A 4XDGA 3ZTTA 2DHQA 5LLDA 2RGXA 1Y33E 3PWTA 4KMRA 2B9EA 2GNAA 2HSJA 3M89A 4NBVA 4XIIA 5DTJA 4D0RA 1ST2A 1F9NA 1MPXA 3RIRA 3Q10A 2GPYA 1L1QA 3SZOA 1OLSA 1NW6A 2QF7A 1YBFA 2YZMA 2K4BA 1Q14A 3OWXA 1BN5A 1YQXA 1HKUA 1CUCA 4E6EA 3CFYA 4M1ZA 5SY9A 1LPSA 3MJTA 3LWZA 4FT4A 2O6GE 2VRCA 4JKOA 3V8QA 1QK5A 4HPWA 2HPIA 5LBIA 1DIRA 1GQ2A 2FSFA 5CH8A 5GGXA 1MOQA 2OD9A 1CERA 5HLHA 1ODLA 2Z5UA 1U7HA 3K0EA 4MWCA 5K4GA 4ZYLA 4HLUC 4NZMA 4UCWA 1TWHJ 1EFLA 1UMDA 1P5RA 2Z4RA 5EXTA 1QE3A 4CT4B 5A2QA 1HC7A 1E98A 3GZ5A 3W5CA 5KDDA 3W6OA 2RHHA 4HQ0A 1T25A 1CF2O 2QRVA 3OOYA 1EAMA 1UXHA 2DSNA 2PCLA 3QOFA 4K28A 3BIJA 5HJ7A 3EZNA 4P35A 2AG8A 2AFHA 3I9FA 2WNIA 3K05A 3OIQA 4MX8A 2DFVA 2VHUA 1O3TA 3QFTA 2N0SA 1Q16A 1Y8AA 3DO5A 1SVMA 3FOEC 4Z7QB 2AD1A 2I2CA 4HGPA 1FNMA 1UBMS 5DT9A 4E22A 1Z5GA 1AIPA 3RVLA 2JT1A 1XEAA 3L1JA 2VL8A 1D6NA 2IKSA 2WPDD 4ZANA 4BQEA 3OJFA 5IU6A 3QW4B 4S1WA 1DJOA 1E7YA 2FJ1A 1UKVY 1T0IA 1DRKA 1ZKDA 3RIEA 4RK0A 3SHQA 4ZARA 1MOZA 3T8YA 3MFYA 5CCBA 5DCYA 5LPNA 2FPPA 3WMWA 3ZLBA 2X0FA 1QYVA 3HJUA 6PAXA 2BXYA 1LWOA 4P7BA 3BG7A 4I7HA 1F1BA 3W2IA 3L1HA 5KIAA 1E6CA 4BVBA 4P3PA 2IYAA 1KH1A 1XOIA 4ZYDA 2R3SA 3KQPA 5ILQA 3SC4A 1L5HB 3WNZA 5IDXA 3E1KA 4IVRA 3ULKA 3IT3A 2I10A 2VOOA 3A6HA 4A5SA 1A95A 5A9SA 1KZ7B 3HJTA 4GWKA 5KHOC 2L02A 4Y3OA 1YZFA 5BUCA 1WXHA 3GDHA 1PJQA 1O4XA 3WQHA 3QENA 4ECAA 4NQWA 5BXQC 4URHA 1ESDA 2ACEA 1LLDA 1VL6A 3T9FA 2Q28A 4R9SA 1JRLA 3SNHA 3ZRGA 3HO6A 1TCBA 2OWDA 4F21A 3AV0B 3Q5FA 1H69A 2P41A 5GZ1A 4OHUA 1FK8A 4QWMA 4F6LA 2X1LA 4KT5C 2G72A 2VT6A 3CMCO 1PUXA 2DQ4A 1O6GA 1UK7A 4ATNA 3A28A 3JPWA 4UM7A 4UDXX 4MRMA 5AIBA 1T38A 1LKXA 4EHDA 1ZW6A 1C8VB 2BCJQ 3UATA 4OB6A 1PWZA 4WKNA 1I94B 2HYGD 4GMKA 4MQMA 2R7ZJ 1OI2A 2PQMA 4XB1A 1JKMA 3MD9A 1QTQA 1NRWA 4HSEA 2Y99A 2M8GX 1W8DA 3A58B 3GN2A 4K03A 4LRWA 1DBIA 3L0DA 4MCAA 2YJ6A 3HFGA 5J2UF 3ZVKA 1QBJA 2MYTA 3G9XA 4B0PA 3NKLA 2DUUA 4RF3A 3I53A 1GSHA 5AOVA 5FWYA 1U2DA 4KN9S 4TRJA 3T9BA 3PNBA 3DU6A 1E69A 3FYSA 3ZKWB 3WY9A 3EB9A 4GPBA 1NYLA 3MSCA 4J07A 4NVRA 4BMNA 3JPYA 4D6XA 1FIUA 3T4UA 4XLLA 4BIIA 2GILA 3T3NA 5K8TA 2ID6A 4ND4A 4EW6A 5C81A 5D84A 2H1KA 2JZNA 4DTIA 2O52A 1XPOA 3WX0A 4XJSA 1TQIA 1WZEA 3A70A 4HQMA 2XHKA 2AYYA 2VNAA 1G7RA 3Q1LA 2OVFA 3DQZA 2MSWA 3H1GA 4RAQA 3VNUA 1M33A 3WIDA 3O7WA 3IAM1 5CFQA 2B8EA 2PJRA 2V4UA 4HQFA 2FBKA 2C5EA 4RJIA 2JGIA 4ZO9A 4ZDKA 5BN5A 2YC2C 4MVJM 4Q39A 1MMDA 4Q3EA 4MWZA 3SWWA 5AUPB 1QVTA 2QM3A 3RC1A 5IH7A 5J2UA 3BL8A 5HG0A 4MB2A 3REQA 1F0PA 3HUGB 1VIAA 2EFGA 2PGLA 4MO9A 5TQVA 3SXUB 1PTKA 3OE4A 3TSYA 1MBHA 1YJNI 3SC6A 3QXSA 1MV8A 2XJ9A 3KPVA 2V7QD 1JGSA 2Y2UA 2ZSDA 4FFNA 3I8OA 1P0QA 2D0OB 3BIOA 4PAGA 3VPFA 1WDLA 1S4QA 3S3OA 2H18A 3CEJA 5I4CA 3GMDA 5E8GA 5CR9A 4DL9A 3G0BA 4QDJA 1C8BA 3W2WA 2JK1A 5TV2A 5KYKA 2ADUA 3WDLA 1FXWA 4I8IA 3RBZA 4Y98A 1Q0PA 2Z2IA 1NV9A 3VTZA 5KWVA 3UM9A 3CLSD 1OIXA 3FDIA 4C08A 4BEBA 4Q4CA 1Z07A 5AICA 5HMMA 2HQOA 1PZXA 2K27A 3SDBA 3WE2A 3B2QA 1R1UA 4RXMA 3ECHA 3KKLA 4XD7D 5KTNA 4RLFA 3F9KA 3R6DA 1M2VB 1NBIA 4OO3A 5BQPA 1MA0A 1UBCA 1VHLA 3RJPA 1WZNA 2HHAA 3NAUA 1G55A 1JBQA 4IMPA 3TZ6A 3VZCA 4RGQA 1GKUB 1IY2A 4LZNA 4MCJA 1P9WA 4H7PA 1EK2A 1FVFA 4DT1B 4ETMA 1WLSA 2HXGA 2PQ0A 1TKRA 3EG9B 4PFQA 4JLMA 4P5PA 2JGMA 1SWWA 3PHBE 3T5AA 1RBQA 1XEXB 1JJVA 1LSUA 2HHLA 3BMNA 3FNEA 1AXGA 3AW8A 4KXWA 3ASUA 1WPXA 3X2EA 1NMEA 2ZPTX 3QVGB 2Z57A 1D2AA 1QHNA 2O1SA 1FBSA 4QXRA 4BVGA 5DCFA 1CUSA 2VK1A 2WUEA 2BZSA 3NBYC 4QFBA 2DVMA 2V55B 5FTMA 4HEA2 3W9UA 1YZVA 2BLNA 2ZXJA 2ORWA 1CZUA 4IFEA 4EYGA 4N7RA 4AM3A 3WYNA 2WJWA 7REQA 3BRSA 3GJTA 5JWRA 2OO7A 1PX0A 1C7FA 3JTMA 3PZBA 5KJCA 1ZN2A 2A69F 5A71A 3ECCA 3H9BA 1QRAA 5FOTA 2Y1FA 5FKOA 1AGRA 4Q02A 3DEFA 4XTCS 4YAGA 2SKCA 2VTBB 4CTOA 2GXQA 4GMDA 4ZQFA 1FOWA 3CT6A 1WH7A 2CFRA 3COAC 3HB4X 3K5IA 2JJ1A 2CJWA 3GI1A 4J0CA 4V3BA 3ZJUA 3LF1A 1DEXA 4PQEA 4ZYTA 1X2NA 1VM6A 1XT6A 1XNJA 2ZS9A 4KQ1A 1ZVVA 5IVHA 1MXHA 4FCTA 1VPLA 1V6AA 3HJAA 4YP0A 2NT4A 4YJGB 2W98A 4BBPA 2ECBA 3NONA 3KYLA 5FROA 1N6IA 2CMFA 2Q5CA 3PR1A 4B71A 1RD4A 2WICA 1MGTA 5EYPA 2EKZA 2Q5HA 4AUMA 4MV7A 1MBJA 2HOSA 3G5AA 4LSWA 3H9JA 3WKBA 3PSFA 2NS8A 1QH1A 3OBBA 4FYPA 2JC3A 3D8BA 1P1BA 1E6KA 3CDLA 2AQKA 1RETA 5M3FJ 5L3GA 1VRWA 5F64A 4D1QA 2B1GA 2RGEA 4G5FA 3WYAA 4M7RA 2ZJ8A 3MINA 4US0R 5GVRA 4B6PA 4B83A 3N74A 3N87A 5E2IA 5K03A 1YX3A 1A77A 2GBYA 2PZEA 3B7GA 3I4CA 1FNSA 5DI9A 2KHMA 1N9ZA 2O5VA 3ABMH 1RM3A 3IAS2 1GWNA 4KYUA 3K2BA 5EGOB 1GT6A 1VL5A 3BC8A 2XXBA 4C3JJ 1WP9A 4HWSA 4AECA 3W3AD 1AN0A 1W6RA 3AEUB 1CHNA 1D8JA 1KORA 1KSHA 3FPCA 3L7BA 2PT6A 1WQ3A 1FVHA 3RSZA 4AN4A 5HR5A 2C2WA 1JI0A 3FF4A 2ZSHB 4RSHA 5CLGA 1NJ8A 2V0CA 2UU9B 4EGYA 1P45A 3HU2A 1I1NA 1U2DC 2CL5A 2ZKIA 3RAGA 1Y4ZA 3P0EA 3SQOA 2W2LA 2RFLA 1M1EB 3ZH9B 2Q1UA 3F78A 3AP2A 4KWTA 5DKFA 1B72B 3QELB 4Q7QA 3IOCA 1ZREA 4ZQIA 2XCOA 3OCYA 3WKCA 1ZK4A 2F8TA 4D9JA 2ZRFA 2QW8A 1HKTA 2O8NA 2IUUA 4WJLA 1NF9A 4P54A 4QPPA 4DIQA 2ZATA 1IQ0A 1U3FA 3TX6A 3WGKA 2O8VA 3V7RA 3T6KA 1C80A 4XKJA 3ZCQA 3I6YA 3BR0A 2PCJA 4D9FA 1NBAA 3ZWYA 4BMPB 3THOA 2E1MB 2B82A 1KSJA 2DFTA 3LT5A 1THMA 3GLTA 1JLKA 3O4FA 3PEEA 4YO7A 3WDSA 4DBLE 2AVDA 3FHTA 3C3YA 2G1KA 3JRAA 4ZO6A 4ZVSA 1HNZB 5AXDA 2YWRA 2RAFA 3JRBA 1K78B 4AF8A 1MG0A 2B7EA 2VO1A 3QU3A 1JFLA 2VJAA 3OIVA 4PPNA 4WESA 4BX3A 1J39A 4Z9AA 1JHOA 1WEHA 2CBZA 4BNNA 3WG9A 1GA1A 4A91A 2DPMA 3CEHA 1SHUX 4HDNB 4KR6A 1G6NA 1IB0A 5HJ2A 1KARA 2IZOA 5GJWC 2NRAC 1JDZA 4G09A 1I3KA 2R8EA 1FDVA 1GFSA 3KJFA 4JKIA 1B9NA 2L54A 1SBNE 3D54D 3NEPX 1J9IA 1XFAA 4FDLA 5CB4A 2WR8A 3Q3CA 2VP3A 4BRSA 1SD7A 3PUBA 4ENMA 2ZRQA 2EJWA 5KX5B 1JIUA 1VKJA 1QR2A 3ICPA 2BY2A 4EATA 2UYGA 5F23A 1CUDA 1X0XA 2QMQA 3BCRA 3ZE8A 4ARBA 1IM2A 2HWUA 1U98A 5B4VA 2W2PA 1P3DA 1U7PA 2XGMA 4OJKA 3RS3A 3L9FA 3UMCA 4Z0NA 1UBNA 2E37A 3BEOA 3JATA 4J16A 1R6DA 1P7IA 4EY7A 4HRYA 4XX0B 5D8DA 2ZUDA 1EYZA 1O5OA 3KKZA 2IBMA 2WT9A 3HJHA 3LKDA 4KUGA 4OY3A 4R1SA 4RH0A 2FMUA 4L5JA 4PO8A 1YV9A 2ID8A 2A9OA 2MC3A 1II0A 1NNLA 2WFLB 3GD7A 2WY7Q 1M2OB 1LSSA 2XTJA 2JA1A 3C2QA 1JZQA 4TQGA 2W24A 2PS0A 5IC6A 1Z2EA 4RD4A 1LRJA 1ZAOA 2IEAA 2MWMA 1X14A 3BWCA 3MJRA 4L57A 1HL3A 1XD8A 2FZ5A 1G8XA 4Q37A 3DEIA 3ILSA 5FWYB 3U3OA 3U7QA 4DY4A 5F12A 4G0UA 1XMSA 3LUPA 2REQA 3DBRB 2AUTA 1H94A 4PZPA 3FXMA 1PEYA 2APJA 4FPXA 3ENQA 4LVOA 3ZCUA 5K9ZA 3GRVA 4Y2UA 2AK3A 4NR0A 4QUKA 3X1XA 1IN4A 2ATEA 3K4KA 3H6HA 3OF2A 4W1UA 3P5SA 3PFGA 3MMPA 1V11A 4Z8YA 5A02A 5C2JB 2QZJA 3D6NB 2PD3A 2WT4A 3B53X 3Q0IA 1U8ZA 2WIDA 4BMOB 2VTVA 2C2YA 5BRAA 1T3TA 3RGWS 2RHBA 2ZZKA 4MLCA 4WNYA 3RRJA 4MMXB 4GHWA 3N07A 4EJMA 3ZWVA 4M8NE 1DXQA 1MRNA 1P4XA 4KO3S 4RK7A 3ROZA 1XTJA 2P9QA 2AZDA 1YZGA 4JBAA 2CMGA 4W7HA 4M53A 4NOKA 4I9HA 2WZDA 1RKXA 2Z1DA 2RCNA 4RY0A 3UOWA 1RPNA 4NU5A 4BB0A 3TNDA 4DTCA 1Z6RA 3UYKA 4AM8A 1PUJA 3IEUA 1IY0A 2R87A 3NATA 4GH5A 5ERXA 5PGMA 1WSUA 2BEJA 4NULA 1KDTA 3WHIA 2FYTA 5LYYA 1WI9A 1WKMA 1X7WB 3U7RA 3CRW1 3IKJA 4K9QA 2ECQA 2B9VA 3DZIA 1P4WA 4HADA 1MHPA 2AI2A 4DY6A 1E3SA 4ZIRA 4QQ8A 2X0LA 2BY0A 3G73A 3S6JA 1ETHA 1UP4A 4DIFA 5E8RA 5AQEA 4EPTA 1Q1HA 1TQ2A 5FNZA 7AT1A 3N7UA 5L3VA 5CIQA 5DLYA 1XV5A 5AVZA 4QYSA 1A8QA 4CKXA 2XRNA 1C8LA 2F00A 3IDZA 5JQGB 2NXNB 2OB2A 1X94A 1EWVA 1J0RA 2PGIA 4R2MA 2IYRA 4GYKA 5IAOA 4DC1A 5LQJA 1Z4LA 3GMSA 1N5MA 2N1BA 4IQJA 4MROA 1SC9A 2ODNA 3A4TA 3T1QA 2B37A 4CQMD 5CBPA 5B53A 2HXYA 3ILXA 2RDMA 4EW1A 4QU9A 1WQ4A 2AQIA 4OUDA 2O03A 5E3HA 1IBLB 4PANA 2ZBKA 1PJZA 1MAUA 4FJ0A 4FN4A 4AC9A 4R3NA 2PKCA 1FW6A 2I66A 4M36A 1C3EA 4Q47A 3FIJA 2W2OA 3TTVA 3U1KA 3KVYA 2YUSA 5AJVB 3EUHA 2ZTSA 1QFYA 1X9IA 3F8FA 2GN8A 2WMDA 4GPEA 4QTXA 3ZCOA 4E09A 1XRJA 3UHJA 2TMYA 4ZOLA 1YR7A 5K6AA 4B9EA 2UYCA 3FXQA 4KQFA 4A0ZA 1BQ4A 2BCGY 4F06A 1NUHA 2UV1A 3G1MA 4YRTA 3ZZMA 2O4UX 2YXNA 3SYTA 2AFIE 1O96A 5D51S 5AVJA 3T1VA 1GKYA 3W2VA 2Y0CA 4M7OA 2C2GA 2R7VA 3J7YJ 1Y5LA 2GKGA 1POGA 3DT8A 4GAEA 4C0BA 3L2VA 4HEA6 4JEIA 5MGNA 4RA9B 1HKHA 3PXXA 4AS2A 5TRTA 4J3NA 4ER0A 4YAKA 2DFLA 2PGDA 2WUFA 3W0LB 4D5CA 3UUGA 3MB8A 4F45A 1WY5A 2P9TA 4LJ4A 1WRJA 3E2MA 2FPRA 4FGSA 4JBGA 4KQMA 2NW6A 5BS6A 3T5XA 3GEEA 4NU8X 2CNKA 4BJ1A 3HXTA 4Q1FA 3C3BA 3PPWA 1PR4A 1BIBA 1MDBA 1DAKA 1EZ1A 2VHWA 3FDJA 4IXMA 3VR3D 1I14A 1KO8A 1JJIA 1V45E 2BM9A 3GARA 3ETNA 2O7SA 4B74A 2C82A 5BSMA 2DPYA 4HXFB 2C1ZA 2C5SA 4RETA 1I1OA 4IO9F 3F3YA 4QUEA 3AM1A 3J80A 1I7DA 1BA3A 4CMEC 2KZGA 3DLPX 2B4RO 1EG2A 2TRSB 3O8QB 4K8RB 5B58C 3U61B 1WB4A 2YNMA 3GJ3A 4PCLA 5L3ZA 1CZNA 4QEKA 4BNTA 1I4OA 2VQ6A 3K2ZA 2CJFA 5DCUA 1J0CA 4XN3A 1N6PA 1PS9A 4EUNA 3OR1C 1NBHA 2WJZB 1VB5A 1S96A 5F5XA 3E3VA 4Y17A 1IC6A 3NDRA 3TJRA 3EPKA 5F76A 4AYWA 3RIMA 2O8XA 5FPHA 2L4AA 4KJZA 5IK2A 2VNKA 2OD5A 2QTLA 2R8XA 3GY0A 1R8SA 4CMIB 2CLLB 2EVWX 4U7PB 2BFOA 2FQYA 2NTJA 3G2OA 3AG4H 3CCRI 1U0LA 4D6PA 3A6JA 3HVIA 3VU9B 3H1CA 2QRHA 4N47A 5BT9A 1D09A 1RZUA 1THTA 4INPA 2IYEA 4Y7NJ 3ITEA 3M9XA 3PDIB 2CJJA 2IH5A 1E2NA 1F48A 1RRFA 4IDOA 2A94A 1BVHA 1LWNA 1WVRA 2FEWB 3KJZA 3LX5A 3CCLI 4XH9B 1LZLA 3NOQA 1YS9A 2VJIA 4UBLA 5DSXA 5I7EA 1CRPA 3MTEA 2Y1GA 3CF4G 4CCOA 4ZO8A 1XSXA 2G9VA 3L8HA 3RR2A 4MGIR 3CJRA 7MHTA 4WVFA 2ETXA 1HW1A 2QZ8A 2V79A 3DE2X 4C21A 4DEXA 1W36B 3NEUA 1NW9B 3GP5A 4UAVA 3EWSA 3O3CA 1Z6YA 3F97A 5I7OA 2G83A 2K9MA 2RKBA 3N53A 2EGHA 2RGVA 2IOYA 3DH0A 4YGXB 1KBZA 3VH3A 4DMFA 4RTOA 5SYMA 2JCXA 3TLJA 4FFBA 1RC8A 3A3PA 4COOA 1M0SA 4F4DA 3MS4A 3NFYA 1PIWA 4XM0A 2LH9A 2RREA 3GIDA 3QLUA 4WKPA 3BLYA 1HDXA 2R7XA 2KBFA 2GTIA 2ECKA 3I01M 4QHTA 4DAEA 4EUFA 4RKEA 2O59A 2EINH 5H6QA 2GM5A 5FRNA 1OOEA 3B3QA 4QODA 4RESA 1U9IC 3BOQA 2GXAA 5KNBA 1AKUA 4IDHA 1XKTA 1MJ9A 1UMQA 2C94A 1S02A 1XVLA 2A78A 2P9CA 2WSBA 4FLFA 4HH1A 4HNGA 5IM4A 4M9RA 4F52A 2NACA 1UXKA 2GH1A 1YQTA 2CJPA 3CW2A 1A88A 1WVGA 2W6NA 2C00A 4HDUA 3L8GA 2HCFA 1X1BA 4I7EA 2DT5A 2ERCA 4UU1A 3UBTA 1Z39A 3A10A 3DCJA 1YI2I 4NWIA 3T1NA 4E33A 2ODTX 3FTQA 4BN4A 2Z8YA 4AZSA 3I4NJ 4L4UA 4AMYA 4CFSA 3K09C 2GQ0A 1UR5A 2FSUA 2OHXA 3MD2A 1RAHA 2OV6A 4PCAA 3OS1A 2KQRA 4U0VA 3EXFA 4MIOA 2IS4A 4YJHB 3DOEA 2PXHA 1H22A 4UXIA 4I4TA 4ZOBA 1I51A 1ETVA 2LNDA 3UMRA 1YZHA 4MTDA 1PUFA 3WGIA 4MR9A 3TSCA 3CUQB 3JYQA 1VLJA 3ZZ0A 4RJTA 3OQIB 1FWZA 1G8SA 1T8SA 2EFEB 2E2HJ 2PSDA 4FMCB 2OTJI 3ND8A 4G84A 4WERA 2OHOA 1XCPA 3BEDA 4DPMA 3GP8A 1QP0A 1PZMA 1NVBA 3GJ8A 4O59O 3PS9A 4OHRA 1LS6A 2JGDB 1A69A 1FP6A 4NPHA 5CNMA 5JBIA 4PEVA 2MCFA 3UOGA 2AR9A 2B30A 1SOAA 3BR2A 2R62A 2RK6A 4BO6A 2GBPA 3I59A 1E94E 4FHFA 2QPLA 4RZUA 3VR1A 5EIBD 4EY3A 4RGBA 2VN2A 2XVAA 1Y8CA 3P2EA 4LWPA 5AT1A 4XSXF 4G24A 4JI1B 3WXBA 2REQB 3PE6A 4KACA 3ZU5A 2XAGA 2C2OA 3BX1A 3Q0UA 3FZEA 3VR6H 5B36A 3QEKA 4ZXPA 4AG6A 4CNBA 4JYCA 3GJSA 1PR3A 3W9YA 2WKWA 5K7SA 4IEIA 3IKMB 3GFGA 1U5TC 2ONKA 3TZQA 5MFZA 5LD2C 3D7SA 3AKEA 4NOMA 3V46A 2WG2A 2E4UA 1KQGA 2IXBA 1LPQA 3Q5GA 3V2UA 3V1TC 4RPGA 5H81A 1FUEA 1QVWA 4L8GA 2GPSA 4TMVA 2PWYA 5IVIA 5C53B 3HS3A 2G76A 3SU8A 3U62A 2YY5A 1SFOJ 3MZHA 4UM5A 3UNGC 1P18A 2HNBA 4HL6A 2KHZA 4J91A 2ZB2A 4YJKA 5H9VA 5IF3A 3HOZJ 3IP5A 5IULC 4LECA 3ZY6A 4B33A 3WLJA 4O2AB 2OO5C 4MPPA 2ZIXA 2JKVA 1LDEA 5FL7D 1WJBA 1TTQB 1KA9H 1TU3A 1U4SA 2X2OA 3G8BA 4ALNA 1NLUA 2X4IA 4Q4ZF 3L0CA 5LQSA 4BACA 4KQ6A 3TLXA 1DBRA 2JBHA 2QX6A 1MEJA 2K87A 2FF5A 2MMGA 1GNQA 3FCCA 1NJ5A 3NJRA 3QOXA 3PNSA 1U2TA 4CEIA 5AI4A 1AK1A 2VP4A 4C9BA 4ETSA 3UANA 2WU1A 3VSAA 1RRGA 3FYUB 4XLCA 1RI4A 2REOA 2V98A 2Z43A 3LD9A 4X71A 4RIGA 2LY2A 3NS7A 4KRGA 4QWQA 1VG1A 3KDPA 3IO3A 1OR8A 3EDYA 1IUKA 1LGYA 4Q4JA 4XQEA 3VI3B 4EG8A 3ZDQA 1U2QA 3ASVA 3DZBA 3E97A 2ZAYA 3QFHA 5JTUA 4KPUA 5IT5A 1IG7A 5KOJB 4N12A 1P73A 1PEAA 5KNBH 1KXZA 1DTEA 4JOQA 1QLJA 5I5EA 1Y5RA 2ILVA 1ZGZA 4FYHA 2BWJA 2ODPA 4WOBA 2GRUA 1UXIA 2R8YA 4XYBA 4CUGA 1DUIA 5AH0A 4UFNA 5CM9C 3C2GA 3SC2A 4BX0A 1BDIA 2XTMA 3O95A 1VXOA 3VNBA 1BOAA 1GTL1 1L6IA 2GTPA 1JXAA 3GEGA 3OQNA 3RKXA 1EK1A 4LE2A 4FXOA 4IHYA 2WQ7A 3ZQ6A 2FX0A 1TA4A 3MUNA 3MXTA 3CPJB 2HU5A 3B1KA 4AJLA 1P3Y1 1ILWA 1U0GA 2V8BA 1E2KA 3DAPA 5JFTA 4AWXB 1CGPA 2GAFA 4UVEA 2L7MP 4PSAA 4H3SA 1DOZA 3W4KA 4Z4HA 5CA0F 5IT4A 3DB1A 4H3HB 3S1SA 4PCQA 2HF8A 3QVVA 1FX1A 2DUJA 4P4TA 2OO3A 1DQPA 1A5ZA 2R9VA 2VCHA 2IJLA 3AR2A 3LY8A 3CMMA 4KICA 1CF7B 4PGGA 2QROA 5LC1A 3IUYA 4ESJA 1RKUA 1Z9CA 1FOKA 2BMJA 5D2CA 1ISGA 3GXBA 5FBLB 4ZO4A 2FRDA 2W1OA 4P4SB 1FMCA 1SAYA 1TIPA 2V74B 4H35A 4O3MA 5MF6A 3KQLA 4OTZA 4CCYA 1NE7A 2A35A 4HEA1 4IJVA 3B38A 2DYKA 1FUIA 3T1OA 1FTYA 1RNLA 2K7LA 2UZAA 4RL4A 1J9ZA 2VJ4A 4O29A 5P21A 3RSNA 4A12A 5I8PA 3L4KA 4TV9A 2OZKA 1YI8A 2JGRA 2PY6A 2V7PA 2X8WA 3G0IA 4YMSA 5DGHA 2RHWA 2WAFA 2P6OA 3VVLA 4DC9A 3KQHA 1HURA 1K7XB 4UARA 2RQQA 1KFBB 4EGZA 1RLTA 1WPRA 1ZL2A 3G85A 5D01A 3AR4A 4ZVNA 2H63A 2QVYX 5AHOA 2F3UA 4LHYA 5EHGA 1NOKA 4R9VA 2QU8A 3K8OE 5IT0A 2HY7A 1K9VF 1V1JA 5C5IA 2EFCB 3KEMA 3LY5A 4PNPA 3RS8A 3RTGA 3IODA 3TN7A 3TUIC 5IJ9B 2ZWVA 2QPOA 1MABB 3HRIA 3ZXUB 1M7GA 3GDGA 3EX7C 3V7SA 1CRQA 2FEOA 4PLWA 4TMFA 4UTXA 1PSWA 2OZUA 4EPXA 1MMGA 2QENA 1AQLA 5DNDA 3JYLA 4BU1A 4MO2A 4F8EA 3ILYA 4ZAVA 1S3IA 3OJCA 1FNCA 5KEIA 4XR6A 3R6SA 1A6QA 1HA3A 3HOYJ 2QRMA 1GZHB 2J9FA 2XW6A 4R7TA 3UXEA 1Y0UA 3ISVA 1E7MA 1B8IA 4G2TA 3OE7A 4U02A 3DE0X 3R7SA 4N0PA 1TNTA 4UE6A 1AUOA 3PO2J 1I1GA 4GUAA 4IV0A 3Q7EA 5GZ6A 4LJ5A 4FD2A 2MSNA 2W9XA 1VSBA 3RRFA 1D03A 3CH5A 3FUUA 1LH0A 3L40A 3OZBA 4H1UA 1F43A 1J8YF 4YQZA 3C43A 2O7QA 1U3WA 2FUKA 3IC5A 3NOXA 4BATA 5ALZA 5IDQA 4HYQA 3AP3A 4MHOA 3WRXA 3VUFA 5EIFA 4AP9A 1UFQA 1GOTA 3D4OA 3EUAA 2J1LA 1V5FA 2ZJYA 3PF8A 4BN5A 4D4GA 3WTCA 3DEYX 3QEBZ 1YB4A 1IMJA 3NHPA 3DT6A 4FFBB 1IJFA 2B83A 4DMCA 4EFKA 3LQ1A 5T67A 3LUBA 4MIYA 1VQLI 2X76A 3I5UA 2BKUA 3BHNA 2A68F 2QLLA 2YVUA 4JT2A 5CLQA 5JAOA 2IPMA 1W88A 1ECJA 4ZHQA 2ACVA 3W2TA 1X3UA 5DCMA 4JT9A 3RWBA 1T9HA 3A3YA 3I58A 2N75A 3OCUA 3RPUD 3VBEA 3OA2A 2JCYA 4O8CA 2J5BA 5TT1A 1K5GA 4AFNA 5F4ZA 3TNLA 1E3IA 1U8CB 5KK1A 2VUMJ 4Z4FA 2NNNA 3QIVA 4S0ZA 2AK2A 2VKVA 3C6MA 3RB8A 2H00A 1FLAA 1DNPA 5ESDA 3V80A 4HVLA 3DO8A 1IXKA 2Y0SN 1K92A 2HVRA 4Y0NA 1SHJA 2JJ7A 4CL3A 1SUIA 4NJMA 1REPC 2IDMA 5I45A 3LSJA 1C29B 2OO5A 3OYJA 1A76A 1N5RA 4HH3C 1XXLA 1QG0A 3B60A 3ND5A 2OGWA 4D46A 1E2XA 4J1SA 4MP8A 4ZGGA 4ZYYA 3VTAA 1HORA 1YBMA 5E1OA 3ZHTA 2Q3FA 2I5PO 5LUAA 1PR6A 1UWVA 3AKCA 3THYB 1U2PA 1LW7A 2JSCA 4LY3A 5ARCA 3RU7A 4MQ6A 4UUNA 4G5XA 3LM8A 5ANRB 3WFIA 2WM3A 5JXJA 3NXSA 2X86A 2H0RA 4U2GA 2DX7A 4MR9B 1I3OA 1EEHA 1RAIA 3QLVC 5AO9A 1M2WA 1T0UA 3MT9A 2PMKA 2I6XA 1DCTA 3A6PC 1HQKA 3UFXA 3DEZA 2AFHE 1CB0A 1O95C 1WU7A 1Z0UA 2PSJA 4M1SA 3W7BA 2ZVQX 3HVUA 2CD9A 3IS3A 4PHCA 5AIAA 4H1HA 4FHZA 4UVIA 1TQ4A 2Q3EA 4AYXA 1SFKA 1V35A 1HEYA 3NPAA 2PE5A 2JBWA 5FLXA 5IFKA 1OWPA 3PFFA 2VXOA 4C4ZA 2DTEA 2XZTA 1U80A 4XPZA 1XELA 4AJEA 2EU8A 1AT1A 1SMKA 2V1DA 5C8DA 3TZLA 2HN9A 1I6LA 2X5KO 3IH4A 2POCA 1G8AA 3IR6A 1ZD2P 2O8BA 1UJ8A 4W4TA 5KYGA 3S2HJ 2R7AA 3SJUA 2EP5A 2IYLD 3BXZA 4BO1A 2IV2X 3AFNA 3D3WB 5TMDA 1SKBA 3COJA 1P2UA 2C5HA 3MWJA 3T4XA 2B4TO 1H65A 2G4CA 1W2WB 3AHCA 5CDYA 5JYDA 2MR5A 3GT0A 3T7RA 5C3MA 3G1UA 4DQKA 1T9AA 3NKVA 4UPEA 4KLAA 1PUEE 3BFJA 4LHZA 4D4JA 1BJKA 4F04A 1NN5A 1RHUA 1Z38A 3EA5A 3N59A 4L9RA 1OCCH 3FMOB 4PJLA 3O9ZA 2WFZA 3STVA 3UHOA 4C07A 2O8CB 2O0HA 2B1QA 3BY6A 1YZLA 4N5MA 5JFGA 1I5ZA 2C7GA 2H6EA 2OFFA 1XL0A 1I6KA 1MVOA 5KAIC 4QYXA 4CT5A 3PUIA 5L3SA 5M34A 1A1VA 4K6KA 3SNKA 1KHHA 5CDFE 2DETA 3JVIA 1PR2A 1O94A 3OBIA 5ELLA 3ZDXB 1OBHA 3U1VA 1TPYA 1C7JA 4PPYA 5TX7A 4TVBA 2P3LA 3OOPA 4CODB 1R66A 4PIVA 2ZT5A 5ENDA 4H7KA 1L5HA 5LIPA 5CT5A 3BHMA 3PLAE 3EVCA 1OU4A 2XNHA 4Q9DA 3STTA 3UW1A 4YPFA 3LGXA 3PV0A 4HFMA 2NIPA 4A03A 2ZJ5A 2C1EA 2JI6A 1LE8B 3II6X 2XOXA 3HOUJ 4OH1A 2TCTA 2OM2A 2G77B 5ALXA 3RF6A 1OTYA 2CVFA 3CDHA 1ZD9A 3H9QA 1SJ9A 1GTVA 3QRFF 1RMTA 2JA7J 1K3TA 3R6GA 3PGXA 3OZVA 4L15A 4LIPD 4I1VA 3TAHA 2VC0A 4J0FA 1IW7F 4YRLA 2ME6A 2PL1A 5JDIC 1ERDA 1B3RA 4M3EA 2Q1SA 3H65A 1Y6IA 2ZIUB 3E9MA 4J8PA 1COWD 4JXKA 3E22A 4AIHA 1D2GA 2Y75A 2MR6A 2VT7A 2GAUA 4BMSA 4I5DA 5T41A 4DUGD 4KQKA 1KI1A 4KHPB 3OIUA 4JUBA 2ZSBA 5IKPA 1AXEA 4JDPA 3JU3A 3R5KA 1J22A 1LDGA 3ABLH 1WV1A 2BGKA 3ENZA 3QWAA 4TPKA 4XGKA 3VOBA 5D5XB 5BW6B 5JTTA 1N32B 3ROTA 3TG8A 5AJHA 1L2TA 3HCRA 3WP1B 1SR8A 5LU9A 1APBA 3C87A 2ZUVA 3QPLA 1RQ2A 2IIPA 3JAMA 4BFTA 2E4YA 1Q7GA 2KMUA 3NWOA 4GKKB 5CFZA 2UZ0A 5F0FA 1MBEA 3OLQA 4NQRA 4RPLA 4I8XA 4NCKA 3IB3A 4U7TB 2E1CA 3ZQ4A 5JNTA 5JMWA 1KI3A 3DFGA 3IH5A 4ISCA 1VZ3A 3H7IA 3N2KA 2H4FA 4N3CA 3CNHA 3G7UA 3R0XA 3UA3A 3O8RA 1H9CA 3KAQA 4DLRA 5LZ9A 4EEFG 3NIBA 4BASA 5JXGA 2CMPA 2ATIA 3FR8A 5FB2A 2WD8A 3TW7A 2PJRB 1PD1A 1QYXA 2E87A 2R8OA 1DIHA 4LXHA 1B74A 1T3GA 1N5JA 1YWGO 2GWHA 2P9YA 3EZ7A 4KQ9A 1TAQA 2OKGA 3CF4A 1T36B 2HHHB 3ZN0A 2HJ9A 5BOSB 2CSUA 4NG5A 4ITUA 3WB9A 2I3GA 3RQ4A 4L9AA 3DDHA 3RHFA 1E32A 1UELB 3F8NA 3OSGA 1VI0A 1YHQI 3NBQA 3R5XA 2K40A 1X80A 3GG9A 4KK3A 3SXUA 4UHJA 3OWTA 4QDKA 1M1YA 4RS3A 4CCAA 4OV6B 2Q2OA 4ITRC 5KNBD 3RS2A 4F12A 4QTRA 2PN6A 2ME0A 3P4UA 2VXYA 4JD5A 3EGDA 4NEGA 4DW8A 1JIQA 2PMBA 5IBQA 2OA0A 1ODJA 1JXMA 4KWIA 5CHYA 4OSOA 3I1JA 3M4ZA 4C6TB 3R8CA 1EX7A 4J3JA 4CHGA 1ULYA 4ON9A 2E0IA 3E9EA 2XMDA 1XGMA 1T56A 1JFVA 4XLNF 1N2IA 2YV5A 2G9WA 1K88A 3LAPA 3CG4A 3DV2A 3JTEA 1IN5A 3FOCA 1T10A 3L02A 4FYMA 4HN9A 1EH8A 2ZFWA 1TD1A 3Q7RA 4M0DA 4D8TA 3D8NA 4P2GA 4QBGB 2IFTA 2XZDA 4OGKA 2A05A 5F2KA 5FDFA 4NESA 1VQ1A 2EG9A 3I2HA 1B8IB 1UFVA 1DP7P 1T1EA 2PIDA 5GTIC 4TVKA 4V1CB 2YBEA 4EG7A 1NBME 2CS3A 3HJGA 4YS6A 5AJTA 5DHRA 1NVDA 5CYVA 2QRVB 3Q3EA 3EMKA 4NBUA 5D6OA 1X86B 4F91B 5FKLA 1TE2A 3Q5DA 4Y2TA 3S3TA 3H92A 2GVNA 3AF2A 4C04A 3AETB 3I4FA 3NWSA 4E3WA 5CXXA 2FSIA 1Z15A 1GITA 3PYMA 5AI9A 3RSFA 1RM0A 2VL7A 3ON5A 1AU7A 4H27A 3MMYB 1JILA 2AMFA 4H59A 1G4UR 4M54A 4RHCA 4YCJA 4XE5A 5JI2E 1FMLA 1D07A 3TOBA 1DC4A 1XD7A 5I9SA 1HDZA 2GEKA 4BB5A 1IOZA 1FMTA 2QUBA 4O02B 1CT9A 5EMMA 1XMXA 1V9CA 3BQ9A 2V0GA 3PUZA 2EIXA 3RKSA 2MSKA 4E6PA 5E8JA 1C3LA 3DYVA 1LQ1A 4JC5A 3SDGA 3SR4A 2QVBA 1YFJA 3ZYZA 1RKWA 2C97A 5K7FA 3QY9A 4MI1A 5IX8A 1XJQA 3HZHA 3DPIA 5EXXA 4BC0A 5FRDA 3S8EA 1Q77A 3HUEA 2B4KA 1C0PA 3IOYA 2PL5A 1NQAO 3KM0A 2P2YA 2EFHB 2R11A 1S9HA 3TAXA 2ABWA 3VVMA 4P0QB 2V7BA 1K1EA 3ZBQA 4QASA 1JG7A 1RBZA 2B0CA 2F8LA 5A9SB 4NXNB 2Z5VA 2F48A 2HK8A 1QGUA 2OXEA 1YIDA 3A1SA 2IP1A 3RFXA 3V9PA 1X1SA 4M98A 4IIXA 4BMYA 4DMRA 1BWSA 2H2HA 4L22A 3BCHA 4BQAA 2ZRAA 3K09A 1CVRA 2D06A 1RXWA 5DSTA 1QH0A 3L2UA 2DWOA 3ZS9A 4R05A 3V8NA 3E82A 4Z1MD 5H8WA 4L8YA 4DMHA 4V0SA 3F6EX 3VSDA 2ZULA 3DF7A 1WULS 2P65A 2C5LA 4ENKA 2WWVD 1XZGA 5IS2A 1HNXB 3LVRE 3GHHA 3PQEA 3GLVA 3FKQA 4RMHA 4FOPA 1CUYA 2R1UA 3EDCA 2EZ9A 1R8YA 1RR7A 2YWDA 3IXQA 5EZ6B 4AZWA 1S7CA 2A88A 1UBHS 3F22A 2HIGA 5J8CA 5K5RA 2EBUA 2O7NA 3HYTA 2WP8J 3PR3A 3QHQA 4KZKA 4OQNA 1SXJC 4EJ6A 1K8QA 5HF5A 1VF9A 1Y56A 4IXDA 4M0LA 3T5CA 4JXZA 2FQ3A 3QUAA 3V48A 5EJAA 2LZ0A 2EW1A 1FY2A 3R3HA 4LHXA 3WMFA 5CGZA 4JBWA 3T95A 2LG4A 1EDEA 2J5QA 1XQ1A 4IIDA 3HLYA 5HS7A 1N9GB 2Q3DA 3FZNA 1QHXA 1J5PA 2L69A 3JYNA 2NXCA 1K8YB 4BAUA 3CZ4A 3TI7A 4CKBB 3ZDZB 4GMXA 1U1FA 3RSGA 1W44A 3WLSA 1JUSA 4HDRB 5CMLA 1RC0A 2LY9A 4CGYA 1IQPA 3EARA 5JDIA 4F8YA 3N7AA 1Z25A 2CE7A 4S24A 1CJTC 1D6MA 1FLVA 1YJ9I 4I1SA 1N2XA 2OHJA 2XGOA 2YYYA 3AEKA 3C7KA 3KFVA 3HVKA 3OM1A 2ZK7A 4ZEWA 5LB4A 4B3IA 3DA8A 3ACBA 4O2BF 5GONB 2DKFA 1JEEA 1VSTA 2GOYA 1SOUA 3C7AA 1E9RA 2DJ5A 3OZUA 1UAAA 4P1WA 1H9AA 4J6EA 1EP3B 3X0DA 4CYMA 3IHUA 4CR8A 5HNFA 2PANA 1MNDA 2LGJA 4X97A 4EB6B 4I6JA 4N0DA 5CVUA 3KP5A 2IW3A 1WOYA 2WW8A 3DVLA 2EF0A 5TMEA 3TDUC 4BJ5C 3HUGA 2LDUA 2EEZA 3IQDB 1J7JA 3CUQC 2OCDA 3FY4A 4XVHA 2PUAA 1MG5A 1NI3A 1O7JA 1M1XB 5CG2A 4JJAA 3KZ1E 2M6SA 4PCUA 4AIJA 3G59A 5LA6A 4YY3B 2P8TA 1B8VA 1B73A 1GUAA 2IPAB 4DW6A 5DUKA 1D2NA 2RGWA 4PS0A 2AN5A 4M1EA 5FAKA 1PWHA 1V5EA 1Z08A 4B46A 2E2IJ 1E0EA 3PHHA 2ZDQA 3P0FA 3WRVA 5F6FA 1C3XA 2JIPA 2QUKA 3TVYA 2L4MA 1I33A 4LJRA 2PWAA 3DZKA 1JI8A 2JIMA 5B1YA 1R1DA 1BU8A 2ET6A 4MVJI 3AFOA 3JRGA 3H5IA 1ZRHA 4H31A 4LDNA 3W3ZB 2FEXA 1IUNA 5EHXA 5IBCA 1RCUA 3FTEA 1DJLA 1MC8A 3FWEA 1RXSA 3NT2A 1ZM4A 5TQ0B 1QYWA 5P8WA 3WTTC 3EF3A 2QYOA 2PUVA 4EG5A 3RVRA 1WI3A 3GZ6A 1T5HX 4YFVA 1Z2OX 4YUXA 2BR5A 3FXKA 1I4TD 4HX8A 3AIIA 1CUUA 4F86A 3PXUA 2Z16A 2DPXA 1YHNA 2EKDA 1TVKB 3JASB 5AXAA 1R5HA 4CTKA 1FIPA 3OLWA 3T3HA 1JEYA 2XWJI 4II3A 1ZRFA 1V9SA 4QARA 3UK0A 5I7WA 4DDVA 4AROA 3O8LA 3KALA 4JK3A 1MQ8B 2ZTUA 2XUGA 2R44A 2ISZA 4X6YA 3GVPA 1GAWA 4TMWA 4Y2PA 2OXIA 4DCCA 1JDVA 2A9VA 1DPGA 1Y1SA 2YZ7A 4RAFA 3D5EA 4BBSJ 3PNQA 4H4DA 4RQBA 3VOAA 4B4VA 2DUMA 1V3FA 1CY6A 3GJQA 2L7ZA 1ZRCA 1CBUA 1TMGE 2CK3A 4HXYA 4LNUA 4N7BA 1QR6A 4FLEA 4GD3Q 5FOWA 2YASA 4BNXA 4DRZA 2DFFA 4M73A 3HU1A 1DO8A 2QRQA 3FPAA 1NJGA 1N2ZA 1TPZA 1YL7A 4KN6A 4MCIA 3C74A 3IESA 4URXR 4RH3A 2P1DA 4M72A 5H68A 2J31A 5CQGA 1S8OA 4BHCA 1NMSA 1R2QA 1WKCA 1FNNA 2JAUA 3FI9A 1V11B 2A7XA 3E3AA 3IEPA 3NJ4A 3R2JA 1NMZA 3ZMVA 1I2DA 1V0JA 1YTYA 1JB1A 1ZXLA 1OT3A 2ZETA 5F73A 2JG3A 4LBZA 3IEVA 2YHUA 1OFVA 3EZ6A 3MM4A 5IM4F 4C0SA 4GM0A 1KAEA 3EVFA 1GXQA 2ECFA 3VR4H 3VKVA 2X0RA 3TTTA 3HMKA 2WA0A 2Q2EB 1X1CA 1XQXA 3GX1A 3RTEA 4MTCA 4DLWA 5CFNA 3DTVB 4YR9A 3RJZA 4HPJB 1X80B 2Y9PB 1CUVA 1HDYA 1BE8A 1QDUA 3EISA 4K9MA 5TR9A 1FXUA 3SJCA 3IE1A 1UCRA 4HDOB 1XRMA 1Y6FA 3ZLJA 2EFQA 3U2RA 2AA3A 1DWOA 2OTLI 4I1YA 4RF2A 1CEQA 3A7DA 3EGDB 1LFPA 1OZ0A 1F6WA 1KI2A 1ZGJA 1J1IA 3ZW7A 1ETXA 2XUOA 5HVQC 1D2CA 1JDBC 1YE3A 4PRLA 5F1JA 4QQFA 3TO5A 1W4ZA 2K6GA 5EGOA 3BICA 4K9NA 2IA0A 2RH9B 3EQ2A 3WAKA 2NAZA 4R31A 5KYWB 3PQ3A 1GLGA 1D4AA 2ZE6A 3SSNA 4EY4A 2Y31A 2NTEA 2F6RA 3B51X 4L7QA 1FC0A 5AVUA 3QWIA 1T2UA 2O2JA 1QYCA 2CLFB 3GRRA 5JASA 1U8YA 4MS1B 4LVNA 2H6CA 2EFJA 3G1TA 3W2FA 3E15A 4DV3B 3G82C 2FWBA 5LQRA 3CF5F 3QUQA 1HUQA 4YMGA 4N4OB 1TFRA 3S27A 4G5SA 5KKAA 2FA9A 2PKRA 4BJ5A 4FEYA 5T3YA 5CFOA 3UGJA 4CEJB 2MJLA 2O0KA 1RPZA 3ERMA 2KS6A 1FB5A 1EB8A 2ZMEC 1LZKA 2YWBA 2JJYA 3QU9A 3ZK7A 2P5LC 1DDGA 2ODQA 2P40A 3BHJA 5I7AA 3UPUA 1TJ4A 2VJYA 3K4CA 2VRCD 1L4FA 3FDZB 4RY9A 4YI3A 1PI3A 3ZY3A 4F2GA 4YA6A 5JRZA 3HL4A 1UFOA 5DEOA 1LJ9A 4FHDA 3WNQA 3AJAA 1C9YA 2IYUA 2DBVO 1A8UA 2DQLA 1P2SA 4TMTA 1RACA 1JWAB 4C7OB 2QBYA 3WBBA 2J0SA 2PG4A 1Q15A 4LB6B 4DLBA 4JBIA 1RE0A 3G0CA 1KA8A 4HWPA 3UMFA 3NX4A 1YJ8A 4KL8S 3PXEA 2VHQA 1C9EA 2PMHA 1G9SA 1RJDA 2PKWA 3BBLA 4AICA 3KYCB 4NK5A 1TQ6A 3IAAA 1KU6A 3IFSA 3JVEA 1MW7A 4RFSA 1CUAA 5CB4B 4P3OA 2H65A 2GXUA 3ZI4A 2AN4A 3MN2A 2PT5A 1T0FC