2EINH

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2einH00
2EILH 5B1BH 1OCZH 5B1AH 3AG1H 2DYRH 3ASOH 1OCCH 1OCRH 3X2QH 1V54H 3AG2H 3WG7H 3ABKH 3AG3H 1V55H 3ABMH 5IY5H 2ZXWH 2EINH 2OCCH 3ABLH 3AG4H 2Y69H 2DYSH 3ASNH 1OCOH 2EIKH 5B3SH 2EIMH 2EIJH
chains in the Genus database with same CATH superfamily
5F0CA 3LSTA 2VC1A 4ZTJA 2BV6A 2VASA 2M30A 3D5LA 2OF7A 3L2VA 4EJWA 1OKRA 2HKOA 3RZDJ 2LKXA 1ZKGA 2Z1DA 1GV5A 2P6TA 4F55A 5D8LB 1KU2A 5L3EA 4YRVA 3EUHA 5D5VB 4XLHA 1YLFA 3G3ZA 2WY7Q 3FXLA 4NDLA 2CUJA 5BQTA 1D5YA 2B0LA 2JSPA 3K1PA 2QLZA 2IGMA 3W6JB 3CDIA 1XD7A 2H6CA 2NVQJ 2R5YA 4BQQA 1FNNA 3LL7A 5H6QA 2W84A 4PJJA 2UZKA 2DK8A 2K7LA 1U6GA 3HTSB 1UHMA 3KETA 2P6SA 1U9NA 3OYMA 2K27A 4A5MA 5IYDJ 3CC7I 3S2DJ 4YIRX 5B5EC 4KT6A 4KITB 1A6QA 4F93B 2G0EA 2KRCA 4QLCU 1IN7A 2DFIA 2B9SA 2NOJB 5IT9K 3A4CA 3FKIJ 1I1SA 2MBFA 2V26A 3FHNA 4UVAA 3TO7A 4RA2A 5L3FA 4UVCA 3FXQA 4A6DA 3I3LA 2LFBA 2Q2EB 5FRNA 1IXSB 1LE8A 1UELB 5F0HA 4HF1A 3WU2C 4E6KG 3K1MA 1SAUA 3CCSI 5KK1A 1G3WA 3HOWJ 2HU9A 3U9GA 2ELHA 5J4YA 1K4TA 4IHTA 2O7OA 4FASD 4Y13A 2ZNYA 1IRXA 1D3YA 2X1DA 3K4NA 1IGNA 2M0CA 5KVRA 2HZDA 3HM5A 5F64A 1O7LA 3OYBA 1VQ9I 1QU3A 9ANTA 3H0GJ 3ZQHA 3FM5A 3HRUA 3CJRB 3OIOA 4DOZA 2W00A 3E6MA 4FE7A 2IS4A 1R1VA 5LGNA 5E18F 3RPUA 2IBDA 1MZBA 1L3LA 3B02A 2E35A 4RS8A 4IJAA 5ICEA 2A6HF 2MLGA 1W0UA 2VODA 1SVLA 1ZELA 3J7ZI 1HC8A 2R7DA 1T56A 4IHXA 1RRJA 2XVCA 3HKZN 3WE2A 1K4SA 4BJ5C 3IKVA 3CCEI 2AS5F 3BR3A 2XKPA 4GRIA 2X6XA 4N4NB 2VONA 2E19A 2E7XA 1WPKA 4CHUA 4HF2A 3G4SI 2MA3A 2VKVA 1RIOH 3DXJF 5D6EA 5F0FA 4ENJA 2GM4A 2ESHA 3DPLC 3FBNB 2X6YA 2LTPA 5TJJA 2IA0A 3RYPA 4ZYGA 3QQAA 3H1CA 1N77A 2YR2A 1T8IA 1ZREA 2FNPA 1Y8RB 2LDUA 4A3IJ 5JR3A 2YSRA 2CW8A 1P9QC 4NNJA 2EINH 5EZGA 2DO7A 1FYMA 3OSGA 5GTHC 1DGRM 1MBEA 4UB8C 2VOPA 4D5FA 3GYHX 1YW8A 3LNQA 2MC4A 5E20A 1AKHB 3K4MA 4HNTA 3QYBA 3G73A 1SD7A 1IAWA 2V4JC 4NC6A 4ZC3A 2H1KA 4ZDOA 3Q9VA 5TISC 3SXYA 2OZUA 1MH3A 3HOSA 3C2GA 4A3KJ 1RKWA 3RPUD 3HRMA 3VYUB 1Y39A 2MD5A 4M9SA 2OTJI 2DMNA 3HUGB 3IKTA 5HDNA 5C4XJ 3LQQA 2A69F 1Y56A 4Y52J 4G7ZF 4PJMA 5K7HA 3JRBA 2VQHA 3VODA 3KEOA 5H20A 3I64A 3SHFA 4WXDA 1LB2A 4IZZA 3IH4A 2LREA 1YS7A 4LG0B 1KONA 2DT7B 4Q48A 3RCOA 2JUGA 1ERDA 3F8MA 2IVMA 5D6FA 2JK3A 1WWXA 4X0GA 3EUHC 3PO2J 3DTKA 2FQ4A 3RYRA 1TNTA 4ZDPA 2F4OB 3F8FA 3BTIA 2GXGA 1T0FC 4MO7A 1P7JA 3CCQI 4HYEA 1QGPA 4BU2A 5K7ZA 4B3AA 2LVSA 3CCMI 1O3RA 4UHTA 5FJ8J 4BE2A 4R1HA 4HDUA 4L18B 4HG2A 2JA8J 2H94A 5F08A 2GIVA 3R4KA 4LGWA 4P5OA 4A3JJ 1VTNC 1D8KA 3AL0B 2RREA 2OQGA 3FXOA 3MMYB 2FUG2 4OMZA 3JRFA 1IV6A 4M6YA 3TGNA 2P81A 5LLQA 2OD5A 3PFIA 2HDCA 1QPIA 2KKOA 1BR2A 2HS5A 3OL3A 4WF2A 1X2NA 3ABTA 3M8FA 3OYKA 1O3SA 3ZP5A 4H0EA 4HEA2 5LRRA 2HYFA 4EM2A 3SFZA 3LFKA 2ZMEB 1BIBA 1BI1A 2DCEA 3K6GA 3NQOA 3V8KA 2GAUA 3E5QA 1REPC 1MMSA 1Y1VJ 1NTCA 4XOPA 2D45A 2DPUA 2UV1A 2XF7A 5F1JA 3HHHA 2ZJ2A 3OYIA 1ETKA 1FP1D 1V3FA 2BW3B 3CJTB 2M3AA 4WXHA 2E1CA 1K6YA 1TT0A 6PAXA 2IS2A 3M9AA 2ID3A 2PI0A 2OA4A 1JKPC 1MMAA 4F3QA 2UWMA 3H92A 2OCEA 3TEDA 1SANA 5EF6A 1S7OA 3CCYA 1I1GA 3JRIA 1FTTA 2CRGA 1ZLJA 3L2WA 5H2FC 4EGZA 1GV2A 4HLYA 1A36A 1YS6A 1O57A 1EH6A 3CC2I 2WV1A 4PJ0C 3K2ZA 3L2CA 2W25A 4BHBA 3HPHA 4GO1A 4WWCA 4XLCA 1U78A 2KMUA 3BC8A 3PFYA 2L7ZA 2M4GA 5LRSA 2VQLA 1H9TA 4OAZA 3GBGA 5M3FJ 2EZKA 3S17J 3P5JA 1FX7A 3G1OA 5DUIA 2PG4A 1D1AA 1TL8A 1LFBA 3BCAA 2FBKA 1MMDA 3L09A 4AUXA 3HIFA 4EEFG 4M9XA 3I4NJ 1VQMI 3I59A 2COBA 5FLMJ 2YPRA 3C3WA 4NC8A 1CF7A 4RM3A 4XONA 2EK5A 2K9LA 4XLNF 1D0YA 3GMEA 3OY9A 4HDVA 2KHMA 1USTA 3WTZA 1BOAA 2GOXB 2LLKA 2GBYA 3RKQA 3KEYA 1S3JA 3QPTA 4BJ6C 3S1QJ 2BY1A 1FSEA 2TCTA 2V9PA 1PJRA 1NG6A 2B7EA 3HOYJ 1MNEA 4GYIA 2HDDA 2W4SA 2YX4A 2XPWA 1D0XA 3GF2A 1XDSA 4L9NA 1Z77A 4RLQA 2O0YA 1C0WA 2CH0A 2DU9A 4CDGA 4S04A 1B59A 2M5WA 2GQQA 4CYCA 4A5NA 1MGTA 2FJ1A 3MZYA 4XSZF 3K9TA 1HXDA 1OCRH 1H8AC 2CWEA 1WGXA 3O2PE 2DJNA 2H6BA 2IGNA 3MAJA 3D0SA 1T08B 1IN5A 2I5UA 3F8BA 3RZOJ 2E34A 2HOSA 2K85A 4CUGA 3QWLA 2VXZA 3M7GA 2G7HA 1FOKA 3C2BA 4EVIA 1VQOI 1MBFA 1OISA 2XSDC 3GTLJ 4G6QA 1UZCA 3HSFA 2ACJA 1FC3A 2M87A 2WC2A 3ONQA 1XMAA 4CH7A 1SFKA 1J5YA 1LDDA 3D5SC 3M1CA 5TGTA 4RDUA 2DTZA 3ECHA 1Z21A 4KDPA 4DJAA 4YELA 5CVVA 1XMXA 2ZXWH 1IN8A 2VQGA 2NNNA 1FEXA 2QZ8A 2ZFWA 5JHFA 4BBSJ 2A5WA 5DM7F 1SMTA 1KGSA 3WU0A 5HS8A 1MNMC 2FD5A 4IHYA 1Z6RA 4XBFA 3L1PA 4AIJA 1TW3A 1QQIA 4ZH4F 1WRJA 5HDGA 4EJOA 3DF8A 3IH3A 3QYEA 4HOBA 4P96A 4BS9A 4CCNA 2VC0A 3I53A 2EQRA 3PNTA 5LD2C 3P9CA 3H9QA 2K3PA 3CUQB 3GZ5A 4V2FA 3J80K 2CUEA 4AM3A 4RM2A 2X0LA 2ZBKA 3FX3A 1MIJA 3TP3A 2E5NA 2JWTA 2CU7A 5K7FA 1XTAA 3JREA 1YIJI 1GT0C 2L9NA 3H5RA 3MZ8A 2KFDA 2JN6A 3CQZJ 4G94A 4MLOA 4RB0A 2MD0A 3ZMTA 4FQGA 2W24A 4KN7X 3JR9A 3CCLI 2FU4A 4QPOA 5CPRB 2LD5A 2V1XA 4MGRA 3F72A 5KNLA 2V79A 1FYLA 1GLNA 4ESJA 1XSVA 4XKCA 3LA3A 4FHTA 1V4RA 4DGWB 1OCPA 1TLHB 2CMPA 2XRLA 3DEEA 3H5NA 2O8XA 2IAIA 2ZXIA 1FPQA 3RPQA 4U7DA 3RKXA 1QHHD 1ZGJA 3IL2A 4K2EA 2BHYA 4LOCA 4CCKA 1IUYA 4FT8A 2XB0X 4PCQA 3ZMZA 2LP0A 2CS3A 2LF8A 4EATA 4RBOA 3J7AO 2JTVA 1QNTA 3LMMA 1OCOH 1IW7F 2E1OA 2ID6A 2K9SA 2VJ5A 5JHUA 4XR6A 3K7AJ 1LVAA 4BDZA 2XAJA 3ROUA 3I5UA 3HOTA 3ML6A 2FE3A 1B72A 4UUVA 2N8GA 2OU2A 2XAQA 5LHHA 4BEHA 4QTRA 3GTMJ 1IO2A 2LKSA 1P92A 5E3NA 5M5WJ 2R4GA 4A3BJ 2BZTA 2LBFB 2XV4S 2LF7A 1JJ6C 2BXZA 3N4MA 2A61A 4BGDA 3FXKA 4OINF 1TWHJ 1R36A 2WBMA 5HS7A 1MDMA 1RUNA 4DYCA 4I98B 2BE5F 2DBBA 3ZXSA 4XIDA 2GXBA 1BA5A 2O9LA 4PUSA 1RC9A 2WV0A 5FKNA 3HDDA 4KUMA 3C1DA 4PSWA 4R79A 2K9QA 1WJFA 1KA8A 1JT0A 1IXCA 1OYWA 3SZPA 3L2UA 1JT6A 3QAHA 4ZJZA 4RB2C 2JJ7A 2GA2A 4M3GA 2HOEA 2F6CA 2XAHA 2RDPA 3KP7A 2VPRA 3AG1H 4DYQA 2FF4A 5K5RA 2HEOA 1JUMA 1YO5C 3BTJA 5GAHJ 5FROA 4BQAA 3BQZA 1E2XA 4D0PA 1J7KA 4GYGA 2RQQA 3EPZA 3IWZA 3KP3A 3D1NI 3C7JA 4II2A 2CUZA 2XSJC 2DA1A 3QU6A 4AVPA 1LQ1A 1ODDA 3RIRA 4BKXA 1FIPA 1B6AA 1FY7A 1P4AA 2VN2A 3E6BA 1TW2A 2VBXA 1KU7A 4IF4A 1SC7A 1DGWY 1UG0A 2NOGA 4OWRB 1SVMA 3B6AA 3KCCA 4JBAA 2FA5A 2LR8A 3CMMA 3CCRI 2FX0A 4C3JJ 1ZR4A 1WH5A 4XICA 2E36A 4YFKF 1IDYA 5CKTA 3V8JA 2EFNA 3AG3H 4LLLA 5IT3A 3OR2C 1V55H 3ABMH 1OFCX 3WTYC 3KLNA 2DN0A 2QKMB 2Z2SB 2K02A 4PFOA 4BXUA 1HDDC 2H27A 4RB1A 1JHHA 5CQGA 1TBXA 2P5VA 4PSXA 4KIBA 3HSRA 2QWWA 2EILH 3S2WA 2EBIA 3PUBA 3NWSA 2HXIA 2EFWA 1EJ9A 3HTUA 2JPBA 3GEZA 2V1DA 1PUFA 1R71A 2K86A 1YW7A 5L3CA 1WHUA 1U5TA 3TMOA 1XN7A 1Z3XA 3Q0VA 1ZG3A 4W1UA 1DQUA 1RPWA 1XGNA 5FLVA 3FXMA 4AU7A 1PUEE 4KA4A 3E5XA 2FRHA 5E1ZB 4IVNA 4G12A 2OJED 2VE9A 1EH8A 2BHZA 1POGA 2Y9ZA 3IUOA 5FLXZ 3SFIA 4I09A 2DOFA 3ZPLA 2EZHA 2Q0OA 1U2WA 1Y0UA 3MD2A 3K4CA 1VQ6I 1YW9A 2J5PA 3HXLA 3DLLF 4EGYA 3AFHA 4YEJA 4E7JA 3OYHA 2H8WA 4P9UA 4PJLA 2LYCA 2Y75A 4II3A 4CXFA 3FHZA 1ZK8A 4E70A 3LAPA 4XLFA 2OUMA 2ZSIB 3DKWA 5GPAA 1T2KA 4JP0A 1S7AA 5J40A 4JOMA 4B4CA 2STTA 2DA2A 2F4IA 1W5SA 5DUKA 1ZRDA 5DCFA 1QZEA 3BP8A 3EDPA 4PJNA 3QPLA 2WY8Q 3PM1A 1G3YA 1MBGA 4L5EA 2MH2A 2OTLI 4E7HA 1ZG1A 2KPMA 1KQ0A 1XB4A 1D8JA 1S5LC 4HX7A 4UB6C 4E4HA 4Y3OA 1T39A 2BVMA 1AU7A 4LFUA 5EG0A 2PJRA 1ON2A 1RZ4A 4CYDA 1YIOA 2FOWA 1XCBA 1HDPA 4FX4A 1T0FA 2F2EA 3HSEA 2OZ6A 3L7WA 3QOEA 5D5UB 2KZGA 3ZMUA 2BBYA 5CJ9A 1W36D 2BGCA 4RMNA 2NAZA 1BL0A 5J8FA 4JK1X 5L3BA 1GXPA 3BZ6A 1LPQA 5KCMA 2MSYA 2HXOA 1Z7LA 2V6EA 1YJ9I 3TL4X 2LY1A 3OV8A 2GLOA 4ZYAA 3B6CA 3A01B 1ETYA 1YE9A 2CW0F 1WJDA 3VYRB 1X4PA 1FOYA 2NVTJ 1GXQA 1B8IA 5FKOA 2OAZA 2ZMEC 1YJWI 2EJRA 4U0VA 5KAFC 2ZXJA 4DIQA 1RKTA 3WTWC 4ZDLA 1MMGA 2L54A 3BZCA 4HX8A 3JCUC 2V1UA 3P7NA 1HKTA 3GTOJ 4XN3A 2R5ZA 3QODA 3WG7H 5ICGA 3DFGA 2PBIA 4AYBN 4E7KA 2IS6A 2KRHA 5DCMB 4I2OA 1IUFA 4C9YA 3RDIA 2PEXA 3R61A 2E1MB 2K9NA 4Q5SF 4KN4X 2FQ3A 3AAFA 1BOBA 5GAGJ 1I27A 3BQYA 4DZJA 3W3CA 4XN0A 1Y0NA 2L7KA 4D1QA 3GW2A 2M8GX 2VJIA 2YX7A 1R58A 1TQMA 2DFFA 3HEFA 4OAYA 5JFRA 1GDTA 1VQ8I 2L5QA 5BPDA 3BY6A 1U0JA 1R4NB 1F36A 1H0MA 2Y30A 4Z6YA 5IY5H 1UJ8A 1YTYA 5K5OA 1Z7UA 4L5JA 3TDUC 1QHGA 3BROA 3BG6A 1WJEA 5M5YJ 4ETSA 3TOBA 4ZZDA 1Y6IA 1MSFC 1IJWC 4M3BA 3K4BA 2JQ7A 2WAQA 2NRAC 4IHSA 1U5TC 3BOQA 3E5UA 4I99C 4XMYA 1FIAA 4WX9A 1XX5A 1VZ0A 2KIQA 4HF0A 3U21A 1A04A 4GCVA 2Y0SN 2X9DA 3IAM2 4O5VA 4UXNA 3CD6I 3E6DA 2I10A 2NXNB 2XGCA 2X6WA 5E3LA 1W36C 2K4BA 4UV8A 1LKXA 2FMYA 3GFIA 2W7NA 2FMLA 3HHGA 4YFNF 3DQVC 4KFCA 3DEUA 1ETVA 4AWXB 2QEXI 2R7FA 3NRVA 1OQYA 4M3EA 5C4JJ 4XL9A 2H1LA 2NS0A 3W6VA 1BC8C 1V5GA 3KYLA 2EPFA 2UUZA 1OLTA 2XAFA 4E7SA 2ZJRF 4RGSA 3KFWX 2AQEA 3MCZA 3PIPF 4EM0B 3F6OA 2F5FA 2KIFA 1RESA 1FP2A 2IXSA 3DKYA 4RGRA 4NQWB 2QQ9A 4X1EA 3ZN0A 5K1YA 2GOMA 5E1XA 4RGXA 3F8NA 4HZFA 3QP6A 1MMNA 2NYXA 3P9KA 3E97A 3GFJA 1F43A 4DW6A 5ERIA 3WHBA 2JZYA 2IT0A 5A2QZ 2VBZA 1XSDA 2PMZN 4XQFA 4CSWA 2ZFUA 3C18A 3BR5A 1IRGA 3OYJA 4A3MJ 3CMEI 4A6EA 3S3MA 2QENA 2Z9OA 1Z0XA 1D0ZA 3VEPA 4HRIA 3R0JA 3KP2A 2WADA 3S3NA 3QRFF 2JPCA 2COMA 2RVCA 4BDYA 2O6GE 4OIOF 2QGUA 1MJBA 3SEZA 3OYGA 1K78B 3EUKL 2QYOA 4JX4A 4Y17A 1UHWA 2ZC2A 5EGOB 3GZ6A 1I6XA 3JW4A 3EQLF 3CUQC 3I55I 1FBQA 2IW5A 2O8KA 2CFXA 2W57A 2L4AA 2NS7A 3CLQA 4J01A 1T38A 2VT2A 1K61A 4LK1F 1ZLKA 2L9SA 3CUOA 4MEYF 2BVLA 5HNHA 3ZCOA 3F8CA 2GA1A 2QM3A 3GFLA 2V7FA 5DM6F 1OYIA 4XK4A 3WODF 2Z3YA 5IP7J 1O7FA 2M7AA 4L9JA 4JQFA 1XGOA 3KE2A 4D9JA 5J1YA 3IRRA 3LFUA 1ZRCA 4HSTA 1Y1WJ 5C44J 4B44A 2F5CA 1P4XA 4YG2F 2CGPA 4IQJA 4A3CJ 4HW0A 4XSXF 2HI3A 5AIQA 4BQNA 3LA2A 3TOAA 1STZA 2DMQA 2MABA 2M34A 3ZOBA 1KYWA 2XHKA 4N9HA 2UXNA 3GLLA 5E8GA 4HPQA 2K3FA 4XRSA 2DAOA 2EFOA 1OR7C 2K5CA 2DA6A 2JMWA 4L0YB 4LLGF 1VQKI 3FM3A 4IRGA 1FJLA 3OWTA 3COAC 1T98A 3ASOH 2R3SA 4WXCA 3DWLE 1V54H 5D4RA 2E7WA 2ZJQF 3M3YJ 4A0YA 3QU3A 3DKXA 1JTYA 3I9V2 4LIVA 2OCCH 2VOOA 4XRMA 2Y0MA 1B9MA 3FBIB 3FK7A 1G3SA 1Z9CA 1WKMA 2ZJPF 2M1BA 4HNUA 2KDZA 1N78A 2HGCA 3CCUI 3O6BB 3JRCA 4M74A 1Y8QB 1TWAJ 1I3AA 3CDLA 3J81Z 3NWTA 3DLAA 2JA2A 3G1LA 2LOOA 3AG2H 2XIGA 4AIDA 2QQ8A 3DBHB 2HR3A 2VPLA 2EFQA 1ORKA 5GADJ 3CMYA 2ZSHB 2NS8A 3HZJA 4KICA 2EIJH 1TTYA 1QA6A 5D5XB 2EWNA 2LY9A 2QF7A 4XLAA 5JLWA 1X3ZB 2F4MB 4U7BA 1ZQ3P 2X4HA 3JAMZ 1AHDP 3QPSA 5IYCJ 3H3ZA 3PNVA 3CP2A 3FDYA 4IOCF 3CCJI 2Q2EA 1UCRA 2CV0A 2ECBA 3ECOA 5FD5A 5L3DA 5CVRA 1ZGWA 1FYKA 4ZYDA 4UUSB 1HSTA 3S93A 2QBYB 3H0DA 4ENKA 1X4OA 5J3LA 2P8TA 5HLHA 2O3FA 2D5VA 2QQBA 4EMSA 1UAAA 2VE8A 4XRFA 5CVJA 4RAGA 3CF5F 2JA7J 1KU9A 2H8RA 4KMUX 4OOIA 1KZHA 1HW2A 1W1WE 1LEBA 4R8HA 1DP7P 3VDXA 2DA3A 3K1NA 3RKWA 2KJBA 2NVXJ 2QQAA 3S16J 2DT5A 4UNOA 5DD4A 3K2AA 4TV7A 1YRNB 1VQ7I 5FLXK 1EF4A 2E60A 2XUBA 4A3LJ 2LC2A 5LFAA 5B3SH 1ACIA 2C6YA 3LSIA 2QVOA 4G8XA 2BEOA 2DDAA 4A93J 3HBLA 4G7HF 2Z5UA 3K4KA 1T33A 3HPGA 2JT1A 2VKEA 2VJJA 3HRTA 2RKHA 2WB1A 5EEGA 3BJAA 4CCOA 2W48A 2R0QC 2STWA 3BR2A 3TDZC 1WI9A 2R7OA 5C3EJ 1MJAA 3GO5A 3T5XA 3GX4X 2FBHA 4YFXF 3BJOA 1BR4A 1AKHA 2KDOA 3I54A 2JA6J 3E1SA 2VB6A 2PMUA 1V5EA 4HQMA 4C30A 5DTDA 2R5YB 5ICCA 4N0BA 5GAEJ 5F04A 3PQKA 3GTPJ 1IZ1A 3GXOA 4H4KC 1JGGA 2XAUA 1DPUA 3ZGKA 4MNUA 1XG1A 3HUGA 4LG3A 4M71A 1F9NA 4S0HB 1YX5A 3BPVA 1QPMA 1T95A 5FD6A 5JVGF 5LHIA 1X1AA 3M8EA 3NARA 2F5VA 3WGGA 3T8TA 3E6CC 2P5KA 1KYZA 2ME6A 3RTRA 3ZQLA 4XKVA 3MFKA 4LG0A 4HV5A 1EV7A 4XOTA 3S14J 1LE8B 4YIFA 4ZYHA 4F7ZA 3S32A 1BW5A 3PUFA 1LJ9A 1HQCA 2VLAA 2QKLB 4JYKA 3F22A 4BNCA 1JE8A 1JTXA 1R5GA 4MQ9F 3JTHA 4ZYEA 1KQ8A 2DQLA 2R7XA 1CGPA 1WJBA 3OS2A 1VI0A 2FEZA 2PJPA 4BYYA 1F5TA 3M4OJ 5HDKA 4B09A 2PMHA 1X3WB 3NEUA 1VQ5I 5IP6A 1R5HA 1WJ5A 3GCMA 4UV9A 1OCCH 2IPQX 1OJLA 2VJ4A 3TKYA 2ELJA 4ZTFA 2HQ5A 1R00A 3LOCA 4NB5A 4C2TA 1O3TA 2I8DA 1ZN2A 4BBRJ 3H3UA 4CCMA 2IA1A 4MQVA 1LDJA 2HOAA 5E3MA 1JKRC 4BXXJ 2E2HJ 4IKFA 1I39A 1DU6A 2ZXHA 3VB2A 3K0LA 1X2MA 2OBPA 2FBIA 2IEKA 2EFPA 3WU1B 4KNYA 3OYNA 1TWGJ 2DJIA 2GZWA 3FWEA 2FSWA 3DCFA 1FOWA 2BY2A 3MKLA 2ZMEA 2ZCWA 3OYDA 5HNFA 4S05A 1NK3P 4V2GA 3H5AA 2KZVA 5KHDA 3FKJA 1Z3YA 5BOXA 1NH3A 2W85A 1HA8A 2R7ZJ 1UFMA 5ILVA 2LRDA 3R6SA 3PIOF 2BW3A 2E1MC 3N97A 5EJCA 5E3OA 4D5CA 1R4MB 3W6KB 2X51A 1HLVA 2Y69H 3WE3A 3GVAA 3DTIA 1ONVA 4XKWA 1PVEA 4IPAA 5DV5A 3MQ0A 3I4PA 2RV8A 3F21A 1HW5A 3ZMVA 2WAEA 3JRDA 1IXRC 1WQ2A 3G1MA 2IA2A 2IS1A 1QZYA 4B8XA 2HFHA 2HVQA 3BTCA 4NBQA 4N4OB 5HLIA 3Q5FA 2GXAA 2JVGA 2FOKA 3S8PA 5D4SA 4DBRA 3GTGJ 3S1NJ 2CUFA 4NUBA 2O03A 1IC8A 3ASNH 1PYVA 1H9GA 1R49A 1MBHA 1FT9A 2WAFA 1VF9A 4HLXA 2WA0A 5DYMA 2X85A 2M7BA 2LH9A 1ULYA 1MSEC 1TT5B 3M07A 1YI2I 3FIWA 4ASNA 4I0BA 4MFDA 3OR1C 4L5IA 1VNDA 2WWYA 1BI0A 1PP8F 2DPDA 3KZIC 3LWFA 3RKYA 3MKYB 2R7TA 1SFXA 2VBWA 4GFBA 1OYYA 1BJAA 4BE0A 1E3OC 3BT9A 3F0CA 4KIFA 5A2QK 2PLYA 2CJJA 3MN2A 3ZR8X 3W2VA 1FMWA 5JLXA 1E0EA 2L01A 5F6FA 1LFUP 3HB9A 2K4JA 1O3QA 4NC7A 3B73A 1MBJA 3BCBA 3DV8A 2MLKA 2DOAA 3WTTC 2DOEA 2JRTA 4I0AA 3BG3A 4OIRF 5D8KB 3OS0A 2D1VA 1TQIA 2DW4A 1YOVB 3UR3C 3RQIA 5EDNA 4KYWA 2EIKH 3OYEA 2JUCA 3ABUA 4Y15A 5TRDA 1YYVA 4OIQF 4C2MJ 4FX0A 1BC7C 1ENHA 3FZVA 2JSCA 5GTIC 2KLOA 1ZR2A 4AVZA 3IC7A 3E7LA 3FK6A 3ISPA 3T0YA 1HKQA 3ZMSA 1FSHA 5J6XA 2DODA 1AOYA 4XNFA 1EH7A 3ZN1A 3K69A 1XS9A 2PN6A 1KU3A 2CQNA 3R60A 3LSHA 4HA8A 1MW7A 4V19K 2XGEA 4G6TB 1E17A 4E7LA 3HKZA 1VFCA 2LG4A 3OIPA 1YHQI 1YRNA 4Y7NJ 1FWZA 2HWVA 1IN4A 1NHAA 3DBRB 2EZIA 3IAS2 2DA5A 4JX5A 3AL0C 1SD6A 2ZB9A 5LGUA 2RGVA 2ELKA 3KPHA 3K70D 1ETWA 5M3MJ 4I01A 1J75A 1NK2P 1FBSA 4RGUA 4BY7J 5D5WB 2B63J 1N25A 2Y0SA 2YUSA 4B3XA 1JJ8C 2ZO4A 2M2EA 2VL8A 3CUQA 3HGYA 4ON0A 2DMPA 2HOTA 2HPMA 3GLXA 5J47A 2CSOA 1ZRFA 3KP4A 1B9NA 3UKGA 3REOA 1X1DA 4HSRA 1JUPA 5LEKA 3T1BA 2O5RA 3CF2A 1XCVA 3I59B 1D1CA 2XGXA 4UY8I 1BW6A 1CF7B 3CC4I 1MKMA 2RC4A 2VIXA 4CA0A 1SMYF 3LSRA 3MWMA 4MFEA 4LMYA 4RAZA 4PK4A 1G6NA 1X58A 5B66C 5GPCA 4CCLA 3QOPA 3OS1A 4CZZA 3K4JA 3MKZA 5HODA 3KEQA 3W2AA 2JA5J 1I50J 4UVBA 2XGDA 4DZPA 4D7MA 3I56I 2A05A 1XGMA 3BR0A 1FBUA 5BS6A 1HCRA 3F23A 3BR1A 4CYCB 1XSXA 2GWRA 1IG7A 4L9VA 2HKXA 1WI3A 1ZAOA 3W2WA 3J81K 2BOLA 2LMDA 5IOZA 1OR7A 2L02A 4FISA 2O61A 2PMZA 1SD4A 4M9ZA 2V1NA 3CTAA 1AWCA 2R7UA 2HPIA 1VQNI 3QP5A 1K6OA 1JUSA 4BHCA 1ZARA 2HNHA 2EB7A 2IRFG 2QSFX 2RNGA 1MD0A 1RR8C 1YX3A 1S29A 3FMRA 1BM9A 4QPQA 4N9IA 2LBFA 4IX7A 3H3VK 2AO9A 1BBYA 3K10A 3N05A 1W7PB 2XRNA 4IXAA 2HYJA 5J4VA 3JAMK 2UXXA 3GTJJ 2A3SA 3RI4A 3S1RJ 2OV7A 3U1KA 1MNDA 4MEXF 1HW1A 1YG2A 3S3OA 2R7WA 3TW6A 1P6RA 4ZZLA 2VBYA 4HQEA 2JRMA 1QBJA 3OSFA 1F4KA 1NG7A 2A5YB 2ZKZA 2HQRA 4U88A 4BL0B 5EEAA 1JXSA 1GVJA 2A6TA 3PO3J 4C3HJ 2VQCA 2Y2ZA 3MZHA 3OL4A 3TBIA 3WGHA 1X1PA 3K70C 2CV2A 3DPTA 1FLIA 5BMZA 2DMUA 2R7RA 2LSOA 4IQ4A 4L9TA 2VT3A 4KMFA 4LJZF 5CYVA 2GIZA 3U1DA 1L0OC 3TO6A 1IN6A 2QCOA 1WSUA 5LEJA 4JX6A 1V5FA 2EA2A 2KISA 5H6RA 3CJQB 1J09A 1A5JA 3RJPA 2L7FP 2G9WA 3F9KA 3GTQJ 2XASA 2DMTA 4HAMA 1E3PA 2OC6A 3L00A 1VQLI 1W5TA 2CQ7A 2MH9A 5FB2A 3OOUA 3ERMA 3RQ4A 1BIAA 2XROA 1U8BA 2NVUB 1LUJB 3VPRA 3HRSA 3BTLA 3ZQQA 4ENNA 4EM1A 1FTZA 2R93J 1Z91A 1IF1A 1PP7U 5FKMA 2L3DA 1K83J 2RAEA 2E2IJ 2XKOA 4O6JA 3CO7C 1USSA 1EA3A 2KIMA 2IP2A 3QYFA 4M3DA 4LB5A 5LGTA 3CO6C 3DBLB 3ZQGA 2L9RA 3DTEA 2K40A 2F5EA 2LK2A 4MTEA 5L3GA 3JTGA 4A3DJ 3KIOA 1YITI 5E17F 1ITYA 4IO9F 3IWFA 4IEJA 3J7AY 4KT5C 4E7ZA 3I58A 4E7IA 3M1EA 3SEQA 2L0KA 2E1NA 5KAIC 4EQQA 5FFXA 1G8XA 2LKPA 2YU3A 4CGZA 4IOAF 1S6LA 3PL8A 3OYFA 1TC3C 4M6VA 3OYLA 1WCMJ 3CESA 2AHQA 1Z6TA 3ZRGA 1B72B 3Q3SA 3EYIA 4NHJA 1QVTA 3BDDA 1BR1A 5M5XJ 2QSHX 4IHVA 2EV0A 4BEHB 4OIPF 4X6AJ 3WGIA 5IP9J 2R7QA 4XORA 1ZH5A 3P9IA 2DI3A 3JRAA 4IRIA 3I0TA 1E3HA 2VI6A 3PJRA 3HOXJ 4I6ZA 2KT0A 4CO8A 2NNYA 2CQKA 3A03A 3VWBA 3V7RA 4C2UA 2ZNZA 2VUMJ 1M1EB 2W1OA 3BG7A 3L2QA 3KZZA 2WAQN 1G4DA 2BY0A 1MDMB 1UMQA 4M72A 1B4AA 3CZ6A 3SYTA 1CQTA 3KP5A 1JHFA 2DFEA 2L9VA 4BQOA 4ANJA 1Q1VA 5HOOA 1BI2A 2K9MA 2HVRA 2P5LC 1I6HJ 4FTHA 1LVKA 4DYRA 4A3FJ 5FFZA 4O3MA 1FOXA 2V9KA 1WJCA 4BY1J 5E8IA 2PX9A 4LB6B 3KX2A 4RAFA 4G9YA 2VKDA 5E1WA 1FMVA 2ME0A 1YFHA 1ETXA 4CZCA 4P1WA 3CP8A 4F52A 2EH3A 4BJTA 3HOVJ 1R6RA 1LNWA 4M3FA 1GUUA 4HX4A 1X3UA 4Y33A 4KISA 3V7CA 4BHPA 1MJ9A 4LLNA 3S2HJ 4AC0A 2L2OA 1R5ID 3ZQFA 1UG2A 4FETA 2KL4A 4BXFA 3JRHA 5EEHA 2R92J 3SJMA 2ISYA 5FRMA 5FO5A 3H9GA 3Q9SA 1JKOC 4LIUA 1QRYA 4GGGA 1SAXA 4YIIA 5EZHA 5B1AH 2MW8A 2DQRA 5IT9Z 2XAGA 2HQAA 2AQFA 4A3EJ 1JKQC 2DA7A 2MGQA 2DTRA 1MBKA 2Q8KA 2D1HA 2M9HA 4HV6A 3JSPA 1VQPI 5CVIA 4ABZA 2P7VB 3SZTA 3BG5A 1RR7A 3A2KA 3A01A 1HSJA 1Z67A 3O3KA 1ETOA 4WCGA 2Z99A 2TRTA 4GDFA 1DDNA 2H09A 4PFPA 3M8JA 1ETQA 3A0HC 3DU5A 4RB3C 2A07F 2W82A 1X1BA 3FMQA 1IRFA 2EIMH 4P55A 2M0MA 4MHGA 2Z16A 3EETA 4L0ZB 5HS9A 1FZPB 2FXAA 1EKEA 1PUFB 2QSGX 1YJNI 2XPVA 1S7EA 1Z05A 2M4KA 5ILUA 1SVOA 1U5TB 5AIPA 2M8EA 1G3TA 3NAUA 2Q1ZB 1BN5A 4AD9A 3V8LA 3LSGA 3FISA 3MEXA 5BPIA 3VSKA 1J9IA 1N75A 3KP6A 3SDGA 1X1CA 3ZQCA 1UB9A 2E2JJ 3CLOA 5DCMA 1J2XA 2MC3A 4A0ZA 1OCTC 3LSJA 3Q0WA 1DU0A 3E0JB 4BACA 3R0AA 1WH7A 1P4WA 1HBXG 2XPUA 1ZG5A 2RQPA 2P7CB 1BJZA 2BY3A 2KRFA 2ESNA 4Q4ZF 2AXTC 3H36A 1TNSA 4A3GJ 3SDBA 5HLGA 2DFHA 4J19A 3BZKA 4PDKA 1YQAA 2IJLA 2CG4A 4OMYA 4XRSG 3VSLA 4M73A 3AG4H 3V7SA 1W4MA 1XMKA 2QUFA 4M6XA 4B43A 1JI8A 3FF5A 1W7PA 4LITA 4LK0F 4A12A 1RETA 2ICWG 3V4GA 5J1RA 3V42A 2J5OA 1ZGAA 2V9VA 5ILSA 3HC7A 4B1RA 4ITVA 3ERED 3QPHA 4EV0A 2BXYA 3O8HA 1LEAA 3HYIA 2JVHA 4PGHA 1PDNC 3GWZA 1ZYRF 3U2RA 5DEQA 3IV5A 4D7NA 1WZ2A 5FGMA 3DPUA 3PQJA 5EG0B 1H89C 1TZLA 2PJRB 1UHSA 2R7SA 3BG9A 4GXOA 2IGKA 4QWQA 3T8RA 2FNAA 3IH2A 4MIMA 5CQEA 2MFZA 4HNVA 1R1UA 4F91B 1U8RA 2A68F 3D5RC 2ECCA 1K79A 1RNLA 2MG4A 3G6EI 3K4LA 2HVSA 3HOUJ 3CCVI 4IL6C 4AIKA 3GZNB 4P9FA 2IGOA 3SQNA 5HLTA 4WK8F 3I4MJ 2M45A 2VKHA 2CQQA 5E79C 3ZQ7A 1JGSA 4G6DA 3JRGA 4NQWA 2DT6A 3BJ6A 1B8IB 4BH9A 4W97A 4DNCA 5DS9A 4PZJA 1DP3A 1A31A 2CQXA 3LA7A 4DBQA 1RUOA 3BLYA 1AA7A 4KJZA 4IRHA 3O8GA 3JSOA 2P4WA 1W7PD 3LAJA 1D1BA 5GP9A 2KJCA 4CCJA 1SD5A 3IHUA 5DD8A 5FKKA 2AXLA 3OMYA 1ON1A 2VXDA 4ESFA 2R5ZB 4PGGA 1HKSA 3MVPA 2PQ8A 3LSKA 4EJTA 5LHGA 3H35A 2R7VA 3CMAI 3VYTB 1D5VA 1RI7A 1SFOJ 4ENMA 1K7AA 2ETHA 2OPTA 2V6CA 2E71A 3HJEA 1GVDA 3VFZA 4RLFA 4HBLA 3TO9A 5JI6A 4Q47A 1G59A 3S15J 2PFBA 1K78A 1TWCJ 3C2HA 3J7YJ 2LY2A 4U0WA 4XKBA 2Z33A 4EJUA 3G2BA 5EGOA 1WJAA 2X1EA 1B1BA 2DA4A 3G71I 3BWGA 3WTSC 5ICFA 1R9TJ 1IDZA 1S8NA 4CICA 3FMSA 3GUDA 1Z1DA 3KLOA 3ULQB 3ZMDA 5K5QA 2HZTA 3WTVC 3HG9A 3PSFA 3BR6A 3AKZA 1SFEA 4U87A 3ABLH 2CV1A 3I71A 5JVTA 4QIWN 5BNGA 1R23A 2CYYA 1A6IA 3KYCB 4KIGA 3LQRA 4XLPF 3WTXC 3MKWB 2KIUA 4RAYA 3VYSB 2XDVA 3WG9A 2WB1N 4DQ2A 2EV5A 2OQRA 2ISZA 3A02A 1U3EM 1BI3A 4B48A 1H88C 1SEUA 1Q1HA 4BAYA 3A0BC 5J8CA 2XC7A 4I02A 2CO5A 3TP0A 5IYBJ 2E5ZA 2DK5A 2P0WA 1LFPA 4AIHA 2NVYJ 2X6OA 2MYSA 2XF5A 1J0RA 3HOZJ 3FXUA 3DU6A 4EJVA 1TP4A 3IP4B 1DUXC 3TQNA 1O4XA 1OMIA 1WVRA 2DLLA 5CVUA 1R1TA 1ZTRA 1DPRA 1J59A 3F3XA 2RN7A 4UUTA 3ZQIA 4MTDA 2HDWA 3OYAA 2D2WA 2HQNA 4Y4RA 3BPXA 1QZZA 1R22A 3Q0UA 4ESBA 4LD5A 5DDGA 3GTKJ 3OYCA 2DYSH 1GHCA 1SFUA 4IHWA 5IOYA 1I5ZA 1XGSA 5F27A 1TWFJ 1QO0D 3ELKA 3PSIA 4J00A 2WTEA 4FE4A 3HL2A 3WHCA 3KZYA 3FXJA 3L9FA 2XF6A 1A35A 1XPXA 3OOPA 5IPAA 2KP6A 5ED4A 3IRQA 2F5DA 4F92B 2A6EF 3S1MJ 1HF0A 3EUAA 4C3IJ 2YS9A 1VQ4I 3E3VA 4QSHA 1P2FA 4FCYA 1ZHFA 3FXRA 4Z2YA 2G7UA 2HYGD 3ESWB 1OPCA 1APLC 2EZLA 5B1BH 1P7IA 3OIQA 1OCZH 1T6SA 4B47A 2EA4A 4BUPA 3GFMA 2DXIA 1KQ9A 5HVQC 1X19A 2CFOA 4I7HA 5LBQA 2F48A 2HTSA 3DP7A 3H9JA 3X2QH 2EV6A 2X48A 1TQPA 1S72I 3CJNA 3LSMA 3VOEA 4UUSA 2XB5A 4AYBA 4BE1A 1W0TA 2QBYA 3KYDB 3UNGC 4U0YA 5CLSA 2TDXA 5EYRA 1MH4A 1G2HA 3DEWA 2DDBA 3RSNA 1QVUA 5J1UA 1W5CC 3LSPA 2L4MA 3PNYA 4OU0A 3EYYA 2CW7A 2BYVE 2RNJA 3WTUC 3L2RA 4G7OF 1F1ZA 1WFXA 1XC5A 1XDUA 2DYRH 2Y31A 1IV8A 2KQRA 4XLEA 4I76A 4XM3A 2YU9J 4A0XA 4A69C 3ABKH 3TW7A 3CDHA 3F6VA 2HTJA 4A2UA 2LNBA 2X1CA 3HGGA 2QA4I 1U9OA 2L7MP 3J80Z 1R7JA 3SZGA 1HOMA 3A1YA 1IRZA 5F1RA 2Y9YA 5AONA 1I3QJ 1LDKB 5FKLA 2Y48A 1S9HA 2ADUA
chains in the Genus database with same CATH topology
2EILH 5B1BH 1OCZH 5B1AH 3AG1H 2DYRH 3ASOH 1OCCH 1OCRH 3X2QH 1V54H 3AG2H 3WG7H 3ABKH 3AG3H 1V55H 3ABMH 5IY5H 2ZXWH 2EINH 2OCCH 3ABLH 3AG4H 2Y69H 2DYSH 3ASNH 1OCOH 2EIKH 5B3SH 2EIMH 2EIJH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL H;  5B1B H;  1OCZ H;  5B1A H;  3AG1 H;  2DYR H;  3ASO H;  1OCC H;  1OCR H;  3X2Q H;  1V54 H;  3AG2 H;  3WG7 H;  3ABK H;  3AG3 H;  1V55 H;  3ABM H;  5IY5 H;  2ZXW H;  2EIN H;  2OCC H;  3ABL H;  3AG4 H;  2Y69 H;  2DYS H;  3ASN H;  1OCO H;  2EIK H;  5B3S H;  2EIM H;  2EIJ H; 
#chains in the Genus database with same CATH topology
 5F0C A;  3LST A;  2VC1 A;  4ZTJ A;  2BV6 A;  2VAS A;  2M30 A;  3D5L A;  2OF7 A;  3L2V A;  4EJW A;  1OKR A;  2HKO A;  3RZD J;  2LKX A;  1ZKG A;  2Z1D A;  1GV5 A;  2P6T A;  4F55 A;  5D8L B;  1KU2 A;  5L3E A;  4YRV A;  3EUH A;  5D5V B;  4XLH A;  1YLF A;  3G3Z A;  2WY7 Q;  3FXL A;  4NDL A;  2CUJ A;  5BQT A;  1D5Y A;  2B0L A;  2JSP A;  3K1P A;  2QLZ A;  2IGM A;  3W6J B;  3CDI A;  1XD7 A;  2H6C A;  2NVQ J;  2R5Y A;  4BQQ A;  1FNN A;  3LL7 A;  5H6Q A;  2W84 A;  4PJJ A;  2UZK A;  2DK8 A;  2K7L A;  1U6G A;  3HTS B;  1UHM A;  3KET A;  2P6S A;  1U9N A;  3OYM A;  2K27 A;  4A5M A;  5IYD J;  3CC7 I;  3S2D J;  4YIR X;  5B5E C;  4KT6 A;  4KIT B;  1A6Q A;  4F93 B;  2G0E A;  2KRC A;  4QLC U;  1IN7 A;  2DFI A;  2B9S A;  2NOJ B;  5IT9 K;  3A4C A;  3FKI J;  1I1S A;  2MBF A;  2V26 A;  3FHN A;  4UVA A;  3TO7 A;  4RA2 A;  5L3F A;  4UVC A;  3FXQ A;  4A6D A;  3I3L A;  2LFB A;  2Q2E B;  5FRN A;  1IXS B;  1LE8 A;  1UEL B;  5F0H A;  4HF1 A;  3WU2 C;  4E6K G;  3K1M A;  1SAU A;  3CCS I;  5KK1 A;  1G3W A;  3HOW J;  2HU9 A;  3U9G A;  2ELH A;  5J4Y A;  1K4T A;  4IHT A;  2O7O A;  4FAS D;  4Y13 A;  2ZNY A;  1IRX A;  1D3Y A;  2X1D A;  3K4N A;  1IGN A;  2M0C A;  5KVR A;  2HZD A;  3HM5 A;  5F64 A;  1O7L A;  3OYB A;  1VQ9 I;  1QU3 A;  9ANT A;  3H0G J;  3ZQH A;  3FM5 A;  3HRU A;  3CJR B;  3OIO A;  4DOZ A;  2W00 A;  3E6M A;  4FE7 A;  2IS4 A;  1R1V A;  5LGN A;  5E18 F;  3RPU A;  2IBD A;  1MZB A;  1L3L A;  3B02 A;  2E35 A;  4RS8 A;  4IJA A;  5ICE A;  2A6H F;  2MLG A;  1W0U A;  2VOD A;  1SVL A;  1ZEL A;  3J7Z I;  1HC8 A;  2R7D A;  1T56 A;  4IHX A;  1RRJ A;  2XVC A;  3HKZ N;  3WE2 A;  1K4S A;  4BJ5 C;  3IKV A;  3CCE I;  2AS5 F;  3BR3 A;  2XKP A;  4GRI A;  2X6X A;  4N4N B;  2VON A;  2E19 A;  2E7X A;  1WPK A;  4CHU A;  4HF2 A;  3G4S I;  2MA3 A;  2VKV A;  1RIO H;  3DXJ F;  5D6E A;  5F0F A;  4ENJ A;  2GM4 A;  2ESH A;  3DPL C;  3FBN B;  2X6Y A;  2LTP A;  5TJJ A;  2IA0 A;  3RYP A;  4ZYG A;  3QQA A;  3H1C A;  1N77 A;  2YR2 A;  1T8I A;  1ZRE A;  2FNP A;  1Y8R B;  2LDU A;  4A3I J;  5JR3 A;  2YSR A;  2CW8 A;  1P9Q C;  4NNJ A;  2EIN H;  5EZG A;  2DO7 A;  1FYM A;  3OSG A;  5GTH C;  1DGR M;  1MBE A;  4UB8 C;  2VOP A;  4D5F A;  3GYH X;  1YW8 A;  3LNQ A;  2MC4 A;  5E20 A;  1AKH B;  3K4M A;  4HNT A;  3QYB A;  3G73 A;  1SD7 A;  1IAW A;  2V4J C;  4NC6 A;  4ZC3 A;  2H1K A;  4ZDO A;  3Q9V A;  5TIS C;  3SXY A;  2OZU A;  1MH3 A;  3HOS A;  3C2G A;  4A3K J;  1RKW A;  3RPU D;  3HRM A;  3VYU B;  1Y39 A;  2MD5 A;  4M9S A;  2OTJ I;  2DMN A;  3HUG B;  3IKT A;  5HDN A;  5C4X J;  3LQQ A;  2A69 F;  1Y56 A;  4Y52 J;  4G7Z F;  4PJM A;  5K7H A;  3JRB A;  2VQH A;  3VOD A;  3KEO A;  5H20 A;  3I64 A;  3SHF A;  4WXD A;  1LB2 A;  4IZZ A;  3IH4 A;  2LRE A;  1YS7 A;  4LG0 B;  1KON A;  2DT7 B;  4Q48 A;  3RCO A;  2JUG A;  1ERD A;  3F8M A;  2IVM A;  5D6F A;  2JK3 A;  1WWX A;  4X0G A;  3EUH C;  3PO2 J;  3DTK A;  2FQ4 A;  3RYR A;  1TNT A;  4ZDP A;  2F4O B;  3F8F A;  3BTI A;  2GXG A;  1T0F C;  4MO7 A;  1P7J A;  3CCQ I;  4HYE A;  1QGP A;  4BU2 A;  5K7Z A;  4B3A A;  2LVS A;  3CCM I;  1O3R A;  4UHT A;  5FJ8 J;  4BE2 A;  4R1H A;  4HDU A;  4L18 B;  4HG2 A;  2JA8 J;  2H94 A;  5F08 A;  2GIV A;  3R4K A;  4LGW A;  4P5O A;  4A3J J;  1VTN C;  1D8K A;  3AL0 B;  2RRE A;  2OQG A;  3FXO A;  3MMY B;  2FUG 2;  4OMZ A;  3JRF A;  1IV6 A;  4M6Y A;  3TGN A;  2P81 A;  5LLQ A;  2OD5 A;  3PFI A;  2HDC A;  1QPI A;  2KKO A;  1BR2 A;  2HS5 A;  3OL3 A;  4WF2 A;  1X2N A;  3ABT A;  3M8F A;  3OYK A;  1O3S A;  3ZP5 A;  4H0E A;  4HEA 2;  5LRR A;  2HYF A;  4EM2 A;  3SFZ A;  3LFK A;  2ZME B;  1BIB A;  1BI1 A;  2DCE A;  3K6G A;  3NQO A;  3V8K A;  2GAU A;  3E5Q A;  1REP C;  1MMS A;  1Y1V J;  1NTC A;  4XOP A;  2D45 A;  2DPU A;  2UV1 A;  2XF7 A;  5F1J A;  3HHH A;  2ZJ2 A;  3OYI A;  1ETK A;  1FP1 D;  1V3F A;  2BW3 B;  3CJT B;  2M3A A;  4WXH A;  2E1C A;  1K6Y A;  1TT0 A;  6PAX A;  2IS2 A;  3M9A A;  2ID3 A;  2PI0 A;  2OA4 A;  1JKP C;  1MMA A;  4F3Q A;  2UWM A;  3H92 A;  2OCE A;  3TED A;  1SAN A;  5EF6 A;  1S7O A;  3CCY A;  1I1G A;  3JRI A;  1FTT A;  2CRG A;  1ZLJ A;  3L2W A;  5H2F C;  4EGZ A;  1GV2 A;  4HLY A;  1A36 A;  1YS6 A;  1O57 A;  1EH6 A;  3CC2 I;  2WV1 A;  4PJ0 C;  3K2Z A;  3L2C A;  2W25 A;  4BHB A;  3HPH A;  4GO1 A;  4WWC A;  4XLC A;  1U78 A;  2KMU A;  3BC8 A;  3PFY A;  2L7Z A;  2M4G A;  5LRS A;  2VQL A;  1H9T A;  4OAZ A;  3GBG A;  5M3F J;  2EZK A;  3S17 J;  3P5J A;  1FX7 A;  3G1O A;  5DUI A;  2PG4 A;  1D1A A;  1TL8 A;  1LFB A;  3BCA A;  2FBK A;  1MMD A;  3L09 A;  4AUX A;  3HIF A;  4EEF G;  4M9X A;  3I4N J;  1VQM I;  3I59 A;  2COB A;  5FLM J;  2YPR A;  3C3W A;  4NC8 A;  1CF7 A;  4RM3 A;  4XON A;  2EK5 A;  2K9L A;  4XLN F;  1D0Y A;  3GME A;  3OY9 A;  4HDV A;  2KHM A;  1UST A;  3WTZ A;  1BOA A;  2GOX B;  2LLK A;  2GBY A;  3RKQ A;  3KEY A;  1S3J A;  3QPT A;  4BJ6 C;  3S1Q J;  2BY1 A;  1FSE A;  2TCT A;  2V9P A;  1PJR A;  1NG6 A;  2B7E A;  3HOY J;  1MNE A;  4GYI A;  2HDD A;  2W4S A;  2YX4 A;  2XPW A;  1D0X A;  3GF2 A;  1XDS A;  4L9N A;  1Z77 A;  4RLQ A;  2O0Y A;  1C0W A;  2CH0 A;  2DU9 A;  4CDG A;  4S04 A;  1B59 A;  2M5W A;  2GQQ A;  4CYC A;  4A5N A;  1MGT A;  2FJ1 A;  3MZY A;  4XSZ F;  3K9T A;  1HXD A;  1OCR H;  1H8A C;  2CWE A;  1WGX A;  3O2P E;  2DJN A;  2H6B A;  2IGN A;  3MAJ A;  3D0S A;  1T08 B;  1IN5 A;  2I5U A;  3F8B A;  3RZO J;  2E34 A;  2HOS A;  2K85 A;  4CUG A;  3QWL A;  2VXZ A;  3M7G A;  2G7H A;  1FOK A;  3C2B A;  4EVI A;  1VQO I;  1MBF A;  1OIS A;  2XSD C;  3GTL J;  4G6Q A;  1UZC A;  3HSF A;  2ACJ A;  1FC3 A;  2M87 A;  2WC2 A;  3ONQ A;  1XMA A;  4CH7 A;  1SFK A;  1J5Y A;  1LDD A;  3D5S C;  3M1C A;  5TGT A;  4RDU A;  2DTZ A;  3ECH A;  1Z21 A;  4KDP A;  4DJA A;  4YEL A;  5CVV A;  1XMX A;  2ZXW H;  1IN8 A;  2VQG A;  2NNN A;  1FEX A;  2QZ8 A;  2ZFW A;  5JHF A;  4BBS J;  2A5W A;  5DM7 F;  1SMT A;  1KGS A;  3WU0 A;  5HS8 A;  1MNM C;  2FD5 A;  4IHY A;  1Z6R A;  4XBF A;  3L1P A;  4AIJ A;  1TW3 A;  1QQI A;  4ZH4 F;  1WRJ A;  5HDG A;  4EJO A;  3DF8 A;  3IH3 A;  3QYE A;  4HOB A;  4P96 A;  4BS9 A;  4CCN A;  2VC0 A;  3I53 A;  2EQR A;  3PNT A;  5LD2 C;  3P9C A;  3H9Q A;  2K3P A;  3CUQ B;  3GZ5 A;  4V2F A;  3J80 K;  2CUE A;  4AM3 A;  4RM2 A;  2X0L A;  2ZBK A;  3FX3 A;  1MIJ A;  3TP3 A;  2E5N A;  2JWT A;  2CU7 A;  5K7F A;  1XTA A;  3JRE A;  1YIJ I;  1GT0 C;  2L9N A;  3H5R A;  3MZ8 A;  2KFD A;  2JN6 A;  3CQZ J;  4G94 A;  4MLO A;  4RB0 A;  2MD0 A;  3ZMT A;  4FQG A;  2W24 A;  4KN7 X;  3JR9 A;  3CCL I;  2FU4 A;  4QPO A;  5CPR B;  2LD5 A;  2V1X A;  4MGR A;  3F72 A;  5KNL A;  2V79 A;  1FYL A;  1GLN A;  4ESJ A;  1XSV A;  4XKC A;  3LA3 A;  4FHT A;  1V4R A;  4DGW B;  1OCP A;  1TLH B;  2CMP A;  2XRL A;  3DEE A;  3H5N A;  2O8X A;  2IAI A;  2ZXI A;  1FPQ A;  3RPQ A;  4U7D A;  3RKX A;  1QHH D;  1ZGJ A;  3IL2 A;  4K2E A;  2BHY A;  4LOC A;  4CCK A;  1IUY A;  4FT8 A;  2XB0 X;  4PCQ A;  3ZMZ A;  2LP0 A;  2CS3 A;  2LF8 A;  4EAT A;  4RBO A;  3J7A O;  2JTV A;  1QNT A;  3LMM A;  1OCO H;  1IW7 F;  2E1O A;  2ID6 A;  2K9S A;  2VJ5 A;  5JHU A;  4XR6 A;  3K7A J;  1LVA A;  4BDZ A;  2XAJ A;  3ROU A;  3I5U A;  3HOT A;  3ML6 A;  2FE3 A;  1B72 A;  4UUV A;  2N8G A;  2OU2 A;  2XAQ A;  5LHH A;  4BEH A;  4QTR A;  3GTM J;  1IO2 A;  2LKS A;  1P92 A;  5E3N A;  5M5W J;  2R4G A;  4A3B J;  2BZT A;  2LBF B;  2XV4 S;  2LF7 A;  1JJ6 C;  2BXZ A;  3N4M A;  2A61 A;  4BGD A;  3FXK A;  4OIN F;  1TWH J;  1R36 A;  2WBM A;  5HS7 A;  1MDM A;  1RUN A;  4DYC A;  4I98 B;  2BE5 F;  2DBB A;  3ZXS A;  4XID A;  2GXB A;  1BA5 A;  2O9L A;  4PUS A;  1RC9 A;  2WV0 A;  5FKN A;  3HDD A;  4KUM A;  3C1D A;  4PSW A;  4R79 A;  2K9Q A;  1WJF A;  1KA8 A;  1JT0 A;  1IXC A;  1OYW A;  3SZP A;  3L2U A;  1JT6 A;  3QAH A;  4ZJZ A;  4RB2 C;  2JJ7 A;  2GA2 A;  4M3G A;  2HOE A;  2F6C A;  2XAH A;  2RDP A;  3KP7 A;  2VPR A;  3AG1 H;  4DYQ A;  2FF4 A;  5K5R A;  2HEO A;  1JUM A;  1YO5 C;  3BTJ A;  5GAH J;  5FRO A;  4BQA A;  3BQZ A;  1E2X A;  4D0P A;  1J7K A;  4GYG A;  2RQQ A;  3EPZ A;  3IWZ A;  3KP3 A;  3D1N I;  3C7J A;  4II2 A;  2CUZ A;  2XSJ C;  2DA1 A;  3QU6 A;  4AVP A;  1LQ1 A;  1ODD A;  3RIR A;  4BKX A;  1FIP A;  1B6A A;  1FY7 A;  1P4A A;  2VN2 A;  3E6B A;  1TW2 A;  2VBX A;  1KU7 A;  4IF4 A;  1SC7 A;  1DGW Y;  1UG0 A;  2NOG A;  4OWR B;  1SVM A;  3B6A A;  3KCC A;  4JBA A;  2FA5 A;  2LR8 A;  3CMM A;  3CCR I;  2FX0 A;  4C3J J;  1ZR4 A;  1WH5 A;  4XIC A;  2E36 A;  4YFK F;  1IDY A;  5CKT A;  3V8J A;  2EFN A;  3AG3 H;  4LLL A;  5IT3 A;  3OR2 C;  1V55 H;  3ABM H;  1OFC X;  3WTY C;  3KLN A;  2DN0 A;  2QKM B;  2Z2S B;  2K02 A;  4PFO A;  4BXU A;  1HDD C;  2H27 A;  4RB1 A;  1JHH A;  5CQG A;  1TBX A;  2P5V A;  4PSX A;  4KIB A;  3HSR A;  2QWW A;  2EIL H;  3S2W A;  2EBI A;  3PUB A;  3NWS A;  2HXI A;  2EFW A;  1EJ9 A;  3HTU A;  2JPB A;  3GEZ A;  2V1D A;  1PUF A;  1R71 A;  2K86 A;  1YW7 A;  5L3C A;  1WHU A;  1U5T A;  3TMO A;  1XN7 A;  1Z3X A;  3Q0V A;  1ZG3 A;  4W1U A;  1DQU A;  1RPW A;  1XGN A;  5FLV A;  3FXM A;  4AU7 A;  1PUE E;  4KA4 A;  3E5X A;  2FRH A;  5E1Z B;  4IVN A;  4G12 A;  2OJE D;  2VE9 A;  1EH8 A;  2BHZ A;  1POG A;  2Y9Z A;  3IUO A;  5FLX Z;  3SFI A;  4I09 A;  2DOF A;  3ZPL A;  2EZH A;  2Q0O A;  1U2W A;  1Y0U A;  3MD2 A;  3K4C A;  1VQ6 I;  1YW9 A;  2J5P A;  3HXL A;  3DLL F;  4EGY A;  3AFH A;  4YEJ A;  4E7J A;  3OYH A;  2H8W A;  4P9U A;  4PJL A;  2LYC A;  2Y75 A;  4II3 A;  4CXF A;  3FHZ A;  1ZK8 A;  4E70 A;  3LAP A;  4XLF A;  2OUM A;  2ZSI B;  3DKW A;  5GPA A;  1T2K A;  4JP0 A;  1S7A A;  5J40 A;  4JOM A;  4B4C A;  2STT A;  2DA2 A;  2F4I A;  1W5S A;  5DUK A;  1ZRD A;  5DCF A;  1QZE A;  3BP8 A;  3EDP A;  4PJN A;  3QPL A;  2WY8 Q;  3PM1 A;  1G3Y A;  1MBG A;  4L5E A;  2MH2 A;  2OTL I;  4E7H A;  1ZG1 A;  2KPM A;  1KQ0 A;  1XB4 A;  1D8J A;  1S5L C;  4HX7 A;  4UB6 C;  4E4H A;  4Y3O A;  1T39 A;  2BVM A;  1AU7 A;  4LFU A;  5EG0 A;  2PJR A;  1ON2 A;  1RZ4 A;  4CYD A;  1YIO A;  2FOW A;  1XCB A;  1HDP A;  4FX4 A;  1T0F A;  2F2E A;  3HSE A;  2OZ6 A;  3L7W A;  3QOE A;  5D5U B;  2KZG A;  3ZMU A;  2BBY A;  5CJ9 A;  1W36 D;  2BGC A;  4RMN A;  2NAZ A;  1BL0 A;  5J8F A;  4JK1 X;  5L3B A;  1GXP A;  3BZ6 A;  1LPQ A;  5KCM A;  2MSY A;  2HXO A;  1Z7L A;  2V6E A;  1YJ9 I;  3TL4 X;  2LY1 A;  3OV8 A;  2GLO A;  4ZYA A;  3B6C A;  3A01 B;  1ETY A;  1YE9 A;  2CW0 F;  1WJD A;  3VYR B;  1X4P A;  1FOY A;  2NVT J;  1GXQ A;  1B8I A;  5FKO A;  2OAZ A;  2ZME C;  1YJW I;  2EJR A;  4U0V A;  5KAF C;  2ZXJ A;  4DIQ A;  1RKT A;  3WTW C;  4ZDL A;  1MMG A;  2L54 A;  3BZC A;  4HX8 A;  3JCU C;  2V1U A;  3P7N A;  1HKT A;  3GTO J;  4XN3 A;  2R5Z A;  3QOD A;  3WG7 H;  5ICG A;  3DFG A;  2PBI A;  4AYB N;  4E7K A;  2IS6 A;  2KRH A;  5DCM B;  4I2O A;  1IUF A;  4C9Y A;  3RDI A;  2PEX A;  3R61 A;  2E1M B;  2K9N A;  4Q5S F;  4KN4 X;  2FQ3 A;  3AAF A;  1BOB A;  5GAG J;  1I27 A;  3BQY A;  4DZJ A;  3W3C A;  4XN0 A;  1Y0N A;  2L7K A;  4D1Q A;  3GW2 A;  2M8G X;  2VJI A;  2YX7 A;  1R58 A;  1TQM A;  2DFF A;  3HEF A;  4OAY A;  5JFR A;  1GDT A;  1VQ8 I;  2L5Q A;  5BPD A;  3BY6 A;  1U0J A;  1R4N B;  1F36 A;  1H0M A;  2Y30 A;  4Z6Y A;  5IY5 H;  1UJ8 A;  1YTY A;  5K5O A;  1Z7U A;  4L5J A;  3TDU C;  1QHG A;  3BRO A;  3BG6 A;  1WJE A;  5M5Y J;  4ETS A;  3TOB A;  4ZZD A;  1Y6I A;  1MSF C;  1IJW C;  4M3B A;  3K4B A;  2JQ7 A;  2WAQ A;  2NRA C;  4IHS A;  1U5T C;  3BOQ A;  3E5U A;  4I99 C;  4XMY A;  1FIA A;  4WX9 A;  1XX5 A;  1VZ0 A;  2KIQ A;  4HF0 A;  3U21 A;  1A04 A;  4GCV A;  2Y0S N;  2X9D A;  3IAM 2;  4O5V A;  4UXN A;  3CD6 I;  3E6D A;  2I10 A;  2NXN B;  2XGC A;  2X6W A;  5E3L A;  1W36 C;  2K4B A;  4UV8 A;  1LKX A;  2FMY A;  3GFI A;  2W7N A;  2FML A;  3HHG A;  4YFN F;  3DQV C;  4KFC A;  3DEU A;  1ETV A;  4AWX B;  2QEX I;  2R7F A;  3NRV A;  1OQY A;  4M3E A;  5C4J J;  4XL9 A;  2H1L A;  2NS0 A;  3W6V A;  1BC8 C;  1V5G A;  3KYL A;  2EPF A;  2UUZ A;  1OLT A;  2XAF A;  4E7S A;  2ZJR F;  4RGS A;  3KFW X;  2AQE A;  3MCZ A;  3PIP F;  4EM0 B;  3F6O A;  2F5F A;  2KIF A;  1RES A;  1FP2 A;  2IXS A;  3DKY A;  4RGR A;  4NQW B;  2QQ9 A;  4X1E A;  3ZN0 A;  5K1Y A;  2GOM A;  5E1X A;  4RGX A;  3F8N A;  4HZF A;  3QP6 A;  1MMN A;  2NYX A;  3P9K A;  3E97 A;  3GFJ A;  1F43 A;  4DW6 A;  5ERI A;  3WHB A;  2JZY A;  2IT0 A;  5A2Q Z;  2VBZ A;  1XSD A;  2PMZ N;  4XQF A;  4CSW A;  2ZFU A;  3C18 A;  3BR5 A;  1IRG A;  3OYJ A;  4A3M J;  3CME I;  4A6E A;  3S3M A;  2QEN A;  2Z9O A;  1Z0X A;  1D0Z A;  3VEP A;  4HRI A;  3R0J A;  3KP2 A;  2WAD A;  3S3N A;  3QRF F;  2JPC A;  2COM A;  2RVC A;  4BDY A;  2O6G E;  4OIO F;  2QGU A;  1MJB A;  3SEZ A;  3OYG A;  1K78 B;  3EUK L;  2QYO A;  4JX4 A;  4Y17 A;  1UHW A;  2ZC2 A;  5EGO B;  3GZ6 A;  1I6X A;  3JW4 A;  3EQL F;  3CUQ C;  3I55 I;  1FBQ A;  2IW5 A;  2O8K A;  2CFX A;  2W57 A;  2L4A A;  2NS7 A;  3CLQ A;  4J01 A;  1T38 A;  2VT2 A;  1K61 A;  4LK1 F;  1ZLK A;  2L9S A;  3CUO A;  4MEY F;  2BVL A;  5HNH A;  3ZCO A;  3F8C A;  2GA1 A;  2QM3 A;  3GFL A;  2V7F A;  5DM6 F;  1OYI A;  4XK4 A;  3WOD F;  2Z3Y A;  5IP7 J;  1O7F A;  2M7A A;  4L9J A;  4JQF A;  1XGO A;  3KE2 A;  4D9J A;  5J1Y A;  3IRR A;  3LFU A;  1ZRC A;  4HST A;  1Y1W J;  5C44 J;  4B44 A;  2F5C A;  1P4X A;  4YG2 F;  2CGP A;  4IQJ A;  4A3C J;  4HW0 A;  4XSX F;  2HI3 A;  5AIQ A;  4BQN A;  3LA2 A;  3TOA A;  1STZ A;  2DMQ A;  2MAB A;  2M34 A;  3ZOB A;  1KYW A;  2XHK A;  4N9H A;  2UXN A;  3GLL A;  5E8G A;  4HPQ A;  2K3F A;  4XRS A;  2DAO A;  2EFO A;  1OR7 C;  2K5C A;  2DA6 A;  2JMW A;  4L0Y B;  4LLG F;  1VQK I;  3FM3 A;  4IRG A;  1FJL A;  3OWT A;  3COA C;  1T98 A;  3ASO H;  2R3S A;  4WXC A;  3DWL E;  1V54 H;  5D4R A;  2E7W A;  2ZJQ F;  3M3Y J;  4A0Y A;  3QU3 A;  3DKX A;  1JTY A;  3I9V 2;  4LIV A;  2OCC H;  2VOO A;  4XRM A;  2Y0M A;  1B9M A;  3FBI B;  3FK7 A;  1G3S A;  1Z9C A;  1WKM A;  2ZJP F;  2M1B A;  4HNU A;  2KDZ A;  1N78 A;  2HGC A;  3CCU I;  3O6B B;  3JRC A;  4M74 A;  1Y8Q B;  1TWA J;  1I3A A;  3CDL A;  3J81 Z;  3NWT A;  3DLA A;  2JA2 A;  3G1L A;  2LOO A;  3AG2 H;  2XIG A;  4AID A;  2QQ8 A;  3DBH B;  2HR3 A;  2VPL A;  2EFQ A;  1ORK A;  5GAD J;  3CMY A;  2ZSH B;  2NS8 A;  3HZJ A;  4KIC A;  2EIJ H;  1TTY A;  1QA6 A;  5D5X B;  2EWN A;  2LY9 A;  2QF7 A;  4XLA A;  5JLW A;  1X3Z B;  2F4M B;  4U7B A;  1ZQ3 P;  2X4H A;  3JAM Z;  1AHD P;  3QPS A;  5IYC J;  3H3Z A;  3PNV A;  3CP2 A;  3FDY A;  4IOC F;  3CCJ I;  2Q2E A;  1UCR A;  2CV0 A;  2ECB A;  3ECO A;  5FD5 A;  5L3D A;  5CVR A;  1ZGW A;  1FYK A;  4ZYD A;  4UUS B;  1HST A;  3S93 A;  2QBY B;  3H0D A;  4ENK A;  1X4O A;  5J3L A;  2P8T A;  5HLH A;  2O3F A;  2D5V A;  2QQB A;  4EMS A;  1UAA A;  2VE8 A;  4XRF A;  5CVJ A;  4RAG A;  3CF5 F;  2JA7 J;  1KU9 A;  2H8R A;  4KMU X;  4OOI A;  1KZH A;  1HW2 A;  1W1W E;  1LEB A;  4R8H A;  1DP7 P;  3VDX A;  2DA3 A;  3K1N A;  3RKW A;  2KJB A;  2NVX J;  2QQA A;  3S16 J;  2DT5 A;  4UNO A;  5DD4 A;  3K2A A;  4TV7 A;  1YRN B;  1VQ7 I;  5FLX K;  1EF4 A;  2E60 A;  2XUB A;  4A3L J;  2LC2 A;  5LFA A;  5B3S H;  1ACI A;  2C6Y A;  3LSI A;  2QVO A;  4G8X A;  2BEO A;  2DDA A;  4A93 J;  3HBL A;  4G7H F;  2Z5U A;  3K4K A;  1T33 A;  3HPG A;  2JT1 A;  2VKE A;  2VJJ A;  3HRT A;  2RKH A;  2WB1 A;  5EEG A;  3BJA A;  4CCO A;  2W48 A;  2R0Q C;  2STW A;  3BR2 A;  3TDZ C;  1WI9 A;  2R7O A;  5C3E J;  1MJA A;  3GO5 A;  3T5X A;  3GX4 X;  2FBH A;  4YFX F;  3BJO A;  1BR4 A;  1AKH A;  2KDO A;  3I54 A;  2JA6 J;  3E1S A;  2VB6 A;  2PMU A;  1V5E A;  4HQM A;  4C30 A;  5DTD A;  2R5Y B;  5ICC A;  4N0B A;  5GAE J;  5F04 A;  3PQK A;  3GTP J;  1IZ1 A;  3GXO A;  4H4K C;  1JGG A;  2XAU A;  1DPU A;  3ZGK A;  4MNU A;  1XG1 A;  3HUG A;  4LG3 A;  4M71 A;  1F9N A;  4S0H B;  1YX5 A;  3BPV A;  1QPM A;  1T95 A;  5FD6 A;  5JVG F;  5LHI A;  1X1A A;  3M8E A;  3NAR A;  2F5V A;  3WGG A;  3T8T A;  3E6C C;  2P5K A;  1KYZ A;  2ME6 A;  3RTR A;  3ZQL A;  4XKV A;  3MFK A;  4LG0 A;  4HV5 A;  1EV7 A;  4XOT A;  3S14 J;  1LE8 B;  4YIF A;  4ZYH A;  4F7Z A;  3S32 A;  1BW5 A;  3PUF A;  1LJ9 A;  1HQC A;  2VLA A;  2QKL B;  4JYK A;  3F22 A;  4BNC A;  1JE8 A;  1JTX A;  1R5G A;  4MQ9 F;  3JTH A;  4ZYE A;  1KQ8 A;  2DQL A;  2R7X A;  1CGP A;  1WJB A;  3OS2 A;  1VI0 A;  2FEZ A;  2PJP A;  4BYY A;  1F5T A;  3M4O J;  5HDK A;  4B09 A;  2PMH A;  1X3W B;  3NEU A;  1VQ5 I;  5IP6 A;  1R5H A;  1WJ5 A;  3GCM A;  4UV9 A;  1OCC H;  2IPQ X;  1OJL A;  2VJ4 A;  3TKY A;  2ELJ A;  4ZTF A;  2HQ5 A;  1R00 A;  3LOC A;  4NB5 A;  4C2T A;  1O3T A;  2I8D A;  1ZN2 A;  4BBR J;  3H3U A;  4CCM A;  2IA1 A;  4MQV A;  1LDJ A;  2HOA A;  5E3M A;  1JKR C;  4BXX J;  2E2H J;  4IKF A;  1I39 A;  1DU6 A;  2ZXH A;  3VB2 A;  3K0L A;  1X2M A;  2OBP A;  2FBI A;  2IEK A;  2EFP A;  3WU1 B;  4KNY A;  3OYN A;  1TWG J;  2DJI A;  2GZW A;  3FWE A;  2FSW A;  3DCF A;  1FOW A;  2BY2 A;  3MKL A;  2ZME A;  2ZCW A;  3OYD A;  5HNF A;  4S05 A;  1NK3 P;  4V2G A;  3H5A A;  2KZV A;  5KHD A;  3FKJ A;  1Z3Y A;  5BOX A;  1NH3 A;  2W85 A;  1HA8 A;  2R7Z J;  1UFM A;  5ILV A;  2LRD A;  3R6S A;  3PIO F;  2BW3 A;  2E1M C;  3N97 A;  5EJC A;  5E3O A;  4D5C A;  1R4M B;  3W6K B;  2X51 A;  1HLV A;  2Y69 H;  3WE3 A;  3GVA A;  3DTI A;  1ONV A;  4XKW A;  1PVE A;  4IPA A;  5DV5 A;  3MQ0 A;  3I4P A;  2RV8 A;  3F21 A;  1HW5 A;  3ZMV A;  2WAE A;  3JRD A;  1IXR C;  1WQ2 A;  3G1M A;  2IA2 A;  2IS1 A;  1QZY A;  4B8X A;  2HFH A;  2HVQ A;  3BTC A;  4NBQ A;  4N4O B;  5HLI A;  3Q5F A;  2GXA A;  2JVG A;  2FOK A;  3S8P A;  5D4S A;  4DBR A;  3GTG J;  3S1N J;  2CUF A;  4NUB A;  2O03 A;  1IC8 A;  3ASN H;  1PYV A;  1H9G A;  1R49 A;  1MBH A;  1FT9 A;  2WAF A;  1VF9 A;  4HLX A;  2WA0 A;  5DYM A;  2X85 A;  2M7B A;  2LH9 A;  1ULY A;  1MSE C;  1TT5 B;  3M07 A;  1YI2 I;  3FIW A;  4ASN A;  4I0B A;  4MFD A;  3OR1 C;  4L5I A;  1VND A;  2WWY A;  1BI0 A;  1PP8 F;  2DPD A;  3KZI C;  3LWF A;  3RKY A;  3MKY B;  2R7T A;  1SFX A;  2VBW A;  4GFB A;  1OYY A;  1BJA A;  4BE0 A;  1E3O C;  3BT9 A;  3F0C A;  4KIF A;  5A2Q K;  2PLY A;  2CJJ A;  3MN2 A;  3ZR8 X;  3W2V A;  1FMW A;  5JLX A;  1E0E A;  2L01 A;  5F6F A;  1LFU P;  3HB9 A;  2K4J A;  1O3Q A;  4NC7 A;  3B73 A;  1MBJ A;  3BCB A;  3DV8 A;  2MLK A;  2DOA A;  3WTT C;  2DOE A;  2JRT A;  4I0A A;  3BG3 A;  4OIR F;  5D8K B;  3OS0 A;  2D1V A;  1TQI A;  2DW4 A;  1YOV B;  3UR3 C;  3RQI A;  5EDN A;  4KYW A;  2EIK H;  3OYE A;  2JUC A;  3ABU A;  4Y15 A;  5TRD A;  1YYV A;  4OIQ F;  4C2M J;  4FX0 A;  1BC7 C;  1ENH A;  3FZV A;  2JSC A;  5GTI C;  2KLO A;  1ZR2 A;  4AVZ A;  3IC7 A;  3E7L A;  3FK6 A;  3ISP A;  3T0Y A;  1HKQ A;  3ZMS A;  1FSH A;  5J6X A;  2DOD A;  1AOY A;  4XNF A;  1EH7 A;  3ZN1 A;  3K69 A;  1XS9 A;  2PN6 A;  1KU3 A;  2CQN A;  3R60 A;  3LSH A;  4HA8 A;  1MW7 A;  4V19 K;  2XGE A;  4G6T B;  1E17 A;  4E7L A;  3HKZ A;  1VFC A;  2LG4 A;  3OIP A;  1YHQ I;  1YRN A;  4Y7N J;  1FWZ A;  2HWV A;  1IN4 A;  1NHA A;  3DBR B;  2EZI A;  3IAS 2;  2DA5 A;  4JX5 A;  3AL0 C;  1SD6 A;  2ZB9 A;  5LGU A;  2RGV A;  2ELK A;  3KPH A;  3K70 D;  1ETW A;  5M3M J;  4I01 A;  1J75 A;  1NK2 P;  1FBS A;  4RGU A;  4BY7 J;  5D5W B;  2B63 J;  1N25 A;  2Y0S A;  2YUS A;  4B3X A;  1JJ8 C;  2ZO4 A;  2M2E A;  2VL8 A;  3CUQ A;  3HGY A;  4ON0 A;  2DMP A;  2HOT A;  2HPM A;  3GLX A;  5J47 A;  2CSO A;  1ZRF A;  3KP4 A;  1B9N A;  3UKG A;  3REO A;  1X1D A;  4HSR A;  1JUP A;  5LEK A;  3T1B A;  2O5R A;  3CF2 A;  1XCV A;  3I59 B;  1D1C A;  2XGX A;  4UY8 I;  1BW6 A;  1CF7 B;  3CC4 I;  1MKM A;  2RC4 A;  2VIX A;  4CA0 A;  1SMY F;  3LSR A;  3MWM A;  4MFE A;  4LMY A;  4RAZ A;  4PK4 A;  1G6N A;  1X58 A;  5B66 C;  5GPC A;  4CCL A;  3QOP A;  3OS1 A;  4CZZ A;  3K4J A;  3MKZ A;  5HOD A;  3KEQ A;  3W2A A;  2JA5 J;  1I50 J;  4UVB A;  2XGD A;  4DZP A;  4D7M A;  3I56 I;  2A05 A;  1XGM A;  3BR0 A;  1FBU A;  5BS6 A;  1HCR A;  3F23 A;  3BR1 A;  4CYC B;  1XSX A;  2GWR A;  1IG7 A;  4L9V A;  2HKX A;  1WI3 A;  1ZAO A;  3W2W A;  3J81 K;  2BOL A;  2LMD A;  5IOZ A;  1OR7 A;  2L02 A;  4FIS A;  2O61 A;  2PMZ A;  1SD4 A;  4M9Z A;  2V1N A;  3CTA A;  1AWC A;  2R7U A;  2HPI A;  1VQN I;  3QP5 A;  1K6O A;  1JUS A;  4BHC A;  1ZAR A;  2HNH A;  2EB7 A;  2IRF G;  2QSF X;  2RNG A;  1MD0 A;  1RR8 C;  1YX3 A;  1S29 A;  3FMR A;  1BM9 A;  4QPQ A;  4N9I A;  2LBF A;  4IX7 A;  3H3V K;  2AO9 A;  1BBY A;  3K10 A;  3N05 A;  1W7P B;  2XRN A;  4IXA A;  2HYJ A;  5J4V A;  3JAM K;  2UXX A;  3GTJ J;  2A3S A;  3RI4 A;  3S1R J;  2OV7 A;  3U1K A;  1MND A;  4MEX F;  1HW1 A;  1YG2 A;  3S3O A;  2R7W A;  3TW6 A;  1P6R A;  4ZZL A;  2VBY A;  4HQE A;  2JRM A;  1QBJ A;  3OSF A;  1F4K A;  1NG7 A;  2A5Y B;  2ZKZ A;  2HQR A;  4U88 A;  4BL0 B;  5EEA A;  1JXS A;  1GVJ A;  2A6T A;  3PO3 J;  4C3H J;  2VQC A;  2Y2Z A;  3MZH A;  3OL4 A;  3TBI A;  3WGH A;  1X1P A;  3K70 C;  2CV2 A;  3DPT A;  1FLI A;  5BMZ A;  2DMU A;  2R7R A;  2LSO A;  4IQ4 A;  4L9T A;  2VT3 A;  4KMF A;  4LJZ F;  5CYV A;  2GIZ A;  3U1D A;  1L0O C;  3TO6 A;  1IN6 A;  2QCO A;  1WSU A;  5LEJ A;  4JX6 A;  1V5F A;  2EA2 A;  2KIS A;  5H6R A;  3CJQ B;  1J09 A;  1A5J A;  3RJP A;  2L7F P;  2G9W A;  3F9K A;  3GTQ J;  2XAS A;  2DMT A;  4HAM A;  1E3P A;  2OC6 A;  3L00 A;  1VQL I;  1W5T A;  2CQ7 A;  2MH9 A;  5FB2 A;  3OOU A;  3ERM A;  3RQ4 A;  1BIA A;  2XRO A;  1U8B A;  2NVU B;  1LUJ B;  3VPR A;  3HRS A;  3BTL A;  3ZQQ A;  4ENN A;  4EM1 A;  1FTZ A;  2R93 J;  1Z91 A;  1IF1 A;  1PP7 U;  5FKM A;  2L3D A;  1K83 J;  2RAE A;  2E2I J;  2XKO A;  4O6J A;  3CO7 C;  1USS A;  1EA3 A;  2KIM A;  2IP2 A;  3QYF A;  4M3D A;  4LB5 A;  5LGT A;  3CO6 C;  3DBL B;  3ZQG A;  2L9R A;  3DTE A;  2K40 A;  2F5E A;  2LK2 A;  4MTE A;  5L3G A;  3JTG A;  4A3D J;  3KIO A;  1YIT I;  5E17 F;  1ITY A;  4IO9 F;  3IWF A;  4IEJ A;  3J7A Y;  4KT5 C;  4E7Z A;  3I58 A;  4E7I A;  3M1E A;  3SEQ A;  2L0K A;  2E1N A;  5KAI C;  4EQQ A;  5FFX A;  1G8X A;  2LKP A;  2YU3 A;  4CGZ A;  4IOA F;  1S6L A;  3PL8 A;  3OYF A;  1TC3 C;  4M6V A;  3OYL A;  1WCM J;  3CES A;  2AHQ A;  1Z6T A;  3ZRG A;  1B72 B;  3Q3S A;  3EYI A;  4NHJ A;  1QVT A;  3BDD A;  1BR1 A;  5M5X J;  2QSH X;  4IHV A;  2EV0 A;  4BEH B;  4OIP F;  4X6A J;  3WGI A;  5IP9 J;  2R7Q A;  4XOR A;  1ZH5 A;  3P9I A;  2DI3 A;  3JRA A;  4IRI A;  3I0T A;  1E3H A;  2VI6 A;  3PJR A;  3HOX J;  4I6Z A;  2KT0 A;  4CO8 A;  2NNY A;  2CQK A;  3A03 A;  3VWB A;  3V7R A;  4C2U A;  2ZNZ A;  2VUM J;  1M1E B;  2W1O A;  3BG7 A;  3L2Q A;  3KZZ A;  2WAQ N;  1G4D A;  2BY0 A;  1MDM B;  1UMQ A;  4M72 A;  1B4A A;  3CZ6 A;  3SYT A;  1CQT A;  3KP5 A;  1JHF A;  2DFE A;  2L9V A;  4BQO A;  4ANJ A;  1Q1V A;  5HOO A;  1BI2 A;  2K9M A;  2HVR A;  2P5L C;  1I6H J;  4FTH A;  1LVK A;  4DYR A;  4A3F J;  5FFZ A;  4O3M A;  1FOX A;  2V9K A;  1WJC A;  4BY1 J;  5E8I A;  2PX9 A;  4LB6 B;  3KX2 A;  4RAF A;  4G9Y A;  2VKD A;  5E1W A;  1FMV A;  2ME0 A;  1YFH A;  1ETX A;  4CZC A;  4P1W A;  3CP8 A;  4F52 A;  2EH3 A;  4BJT A;  3HOV J;  1R6R A;  1LNW A;  4M3F A;  1GUU A;  4HX4 A;  1X3U A;  4Y33 A;  4KIS A;  3V7C A;  4BHP A;  1MJ9 A;  4LLN A;  3S2H J;  4AC0 A;  2L2O A;  1R5I D;  3ZQF A;  1UG2 A;  4FET A;  2KL4 A;  4BXF A;  3JRH A;  5EEH A;  2R92 J;  3SJM A;  2ISY A;  5FRM A;  5FO5 A;  3H9G A;  3Q9S A;  1JKO C;  4LIU A;  1QRY A;  4GGG A;  1SAX A;  4YII A;  5EZH A;  5B1A H;  2MW8 A;  2DQR A;  5IT9 Z;  2XAG A;  2HQA A;  2AQF A;  4A3E J;  1JKQ C;  2DA7 A;  2MGQ A;  2DTR A;  1MBK A;  2Q8K A;  2D1H A;  2M9H A;  4HV6 A;  3JSP A;  1VQP I;  5CVI A;  4ABZ A;  2P7V B;  3SZT A;  3BG5 A;  1RR7 A;  3A2K A;  3A01 A;  1HSJ A;  1Z67 A;  3O3K A;  1ETO A;  4WCG A;  2Z99 A;  2TRT A;  4GDF A;  1DDN A;  2H09 A;  4PFP A;  3M8J A;  1ETQ A;  3A0H C;  3DU5 A;  4RB3 C;  2A07 F;  2W82 A;  1X1B A;  3FMQ A;  1IRF A;  2EIM H;  4P55 A;  2M0M A;  4MHG A;  2Z16 A;  3EET A;  4L0Z B;  5HS9 A;  1FZP B;  2FXA A;  1EKE A;  1PUF B;  2QSG X;  1YJN I;  2XPV A;  1S7E A;  1Z05 A;  2M4K A;  5ILU A;  1SVO A;  1U5T B;  5AIP A;  2M8E A;  1G3T A;  3NAU A;  2Q1Z B;  1BN5 A;  4AD9 A;  3V8L A;  3LSG A;  3FIS A;  3MEX A;  5BPI A;  3VSK A;  1J9I A;  1N75 A;  3KP6 A;  3SDG A;  1X1C A;  3ZQC A;  1UB9 A;  2E2J J;  3CLO A;  5DCM A;  1J2X A;  2MC3 A;  4A0Z A;  1OCT C;  3LSJ A;  3Q0W A;  1DU0 A;  3E0J B;  4BAC A;  3R0A A;  1WH7 A;  1P4W A;  1HBX G;  2XPU A;  1ZG5 A;  2RQP A;  2P7C B;  1BJZ A;  2BY3 A;  2KRF A;  2ESN A;  4Q4Z F;  2AXT C;  3H36 A;  1TNS A;  4A3G J;  3SDB A;  5HLG A;  2DFH A;  4J19 A;  3BZK A;  4PDK A;  1YQA A;  2IJL A;  2CG4 A;  4OMY A;  4XRS G;  3VSL A;  4M73 A;  3AG4 H;  3V7S A;  1W4M A;  1XMK A;  2QUF A;  4M6X A;  4B43 A;  1JI8 A;  3FF5 A;  1W7P A;  4LIT A;  4LK0 F;  4A12 A;  1RET A;  2ICW G;  3V4G A;  5J1R A;  3V42 A;  2J5O A;  1ZGA A;  2V9V A;  5ILS A;  3HC7 A;  4B1R A;  4ITV A;  3ERE D;  3QPH A;  4EV0 A;  2BXY A;  3O8H A;  1LEA A;  3HYI A;  2JVH A;  4PGH A;  1PDN C;  3GWZ A;  1ZYR F;  3U2R A;  5DEQ A;  3IV5 A;  4D7N A;  1WZ2 A;  5FGM A;  3DPU A;  3PQJ A;  5EG0 B;  1H89 C;  1TZL A;  2PJR B;  1UHS A;  2R7S A;  3BG9 A;  4GXO A;  2IGK A;  4QWQ A;  3T8R A;  2FNA A;  3IH2 A;  4MIM A;  5CQE A;  2MFZ A;  4HNV A;  1R1U A;  4F91 B;  1U8R A;  2A68 F;  3D5R C;  2ECC A;  1K79 A;  1RNL A;  2MG4 A;  3G6E I;  3K4L A;  2HVS A;  3HOU J;  3CCV I;  4IL6 C;  4AIK A;  3GZN B;  4P9F A;  2IGO A;  3SQN A;  5HLT A;  4WK8 F;  3I4M J;  2M45 A;  2VKH A;  2CQQ A;  5E79 C;  3ZQ7 A;  1JGS A;  4G6D A;  3JRG A;  4NQW A;  2DT6 A;  3BJ6 A;  1B8I B;  4BH9 A;  4W97 A;  4DNC A;  5DS9 A;  4PZJ A;  1DP3 A;  1A31 A;  2CQX A;  3LA7 A;  4DBQ A;  1RUO A;  3BLY A;  1AA7 A;  4KJZ A;  4IRH A;  3O8G A;  3JSO A;  2P4W A;  1W7P D;  3LAJ A;  1D1B A;  5GP9 A;  2KJC A;  4CCJ A;  1SD5 A;  3IHU A;  5DD8 A;  5FKK A;  2AXL A;  3OMY A;  1ON1 A;  2VXD A;  4ESF A;  2R5Z B;  4PGG A;  1HKS A;  3MVP A;  2PQ8 A;  3LSK A;  4EJT A;  5LHG A;  3H35 A;  2R7V A;  3CMA I;  3VYT B;  1D5V A;  1RI7 A;  1SFO J;  4ENM A;  1K7A A;  2ETH A;  2OPT A;  2V6C A;  2E71 A;  3HJE A;  1GVD A;  3VFZ A;  4RLF A;  4HBL A;  3TO9 A;  5JI6 A;  4Q47 A;  1G59 A;  3S15 J;  2PFB A;  1K78 A;  1TWC J;  3C2H A;  3J7Y J;  2LY2 A;  4U0W A;  4XKB A;  2Z33 A;  4EJU A;  3G2B A;  5EGO A;  1WJA A;  2X1E A;  1B1B A;  2DA4 A;  3G71 I;  3BWG A;  3WTS C;  5ICF A;  1R9T J;  1IDZ A;  1S8N A;  4CIC A;  3FMS A;  3GUD A;  1Z1D A;  3KLO A;  3ULQ B;  3ZMD A;  5K5Q A;  2HZT A;  3WTV C;  3HG9 A;  3PSF A;  3BR6 A;  3AKZ A;  1SFE A;  4U87 A;  3ABL H;  2CV1 A;  3I71 A;  5JVT A;  4QIW N;  5BNG A;  1R23 A;  2CYY A;  1A6I A;  3KYC B;  4KIG A;  3LQR A;  4XLP F;  3WTX C;  3MKW B;  2KIU A;  4RAY A;  3VYS B;  2XDV A;  3WG9 A;  2WB1 N;  4DQ2 A;  2EV5 A;  2OQR A;  2ISZ A;  3A02 A;  1U3E M;  1BI3 A;  4B48 A;  1H88 C;  1SEU A;  1Q1H A;  4BAY A;  3A0B C;  5J8C A;  2XC7 A;  4I02 A;  2CO5 A;  3TP0 A;  5IYB J;  2E5Z A;  2DK5 A;  2P0W A;  1LFP A;  4AIH A;  2NVY J;  2X6O A;  2MYS A;  2XF5 A;  1J0R A;  3HOZ J;  3FXU A;  3DU6 A;  4EJV A;  1TP4 A;  3IP4 B;  1DUX C;  3TQN A;  1O4X A;  1OMI A;  1WVR A;  2DLL A;  5CVU A;  1R1T A;  1ZTR A;  1DPR A;  1J59 A;  3F3X A;  2RN7 A;  4UUT A;  3ZQI A;  4MTD A;  2HDW A;  3OYA A;  2D2W A;  2HQN A;  4Y4R A;  3BPX A;  1QZZ A;  1R22 A;  3Q0U A;  4ESB A;  4LD5 A;  5DDG A;  3GTK J;  3OYC A;  2DYS H;  1GHC A;  1SFU A;  4IHW A;  5IOY A;  1I5Z A;  1XGS A;  5F27 A;  1TWF J;  1QO0 D;  3ELK A;  3PSI A;  4J00 A;  2WTE A;  4FE4 A;  3HL2 A;  3WHC A;  3KZY A;  3FXJ A;  3L9F A;  2XF6 A;  1A35 A;  1XPX A;  3OOP A;  5IPA A;  2KP6 A;  5ED4 A;  3IRQ A;  2F5D A;  4F92 B;  2A6E F;  3S1M J;  1HF0 A;  3EUA A;  4C3I J;  2YS9 A;  1VQ4 I;  3E3V A;  4QSH A;  1P2F A;  4FCY A;  1ZHF A;  3FXR A;  4Z2Y A;  2G7U A;  2HYG D;  3ESW B;  1OPC A;  1APL C;  2EZL A;  5B1B H;  1P7I A;  3OIQ A;  1OCZ H;  1T6S A;  4B47 A;  2EA4 A;  4BUP A;  3GFM A;  2DXI A;  1KQ9 A;  5HVQ C;  1X19 A;  2CFO A;  4I7H A;  5LBQ A;  2F48 A;  2HTS A;  3DP7 A;  3H9J A;  3X2Q H;  2EV6 A;  2X48 A;  1TQP A;  1S72 I;  3CJN A;  3LSM A;  3VOE A;  4UUS A;  2XB5 A;  4AYB A;  4BE1 A;  1W0T A;  2QBY A;  3KYD B;  3UNG C;  4U0Y A;  5CLS A;  2TDX A;  5EYR A;  1MH4 A;  1G2H A;  3DEW A;  2DDB A;  3RSN A;  1QVU A;  5J1U A;  1W5C C;  3LSP A;  2L4M A;  3PNY A;  4OU0 A;  3EYY A;  2CW7 A;  2BYV E;  2RNJ A;  3WTU C;  3L2R A;  4G7O F;  1F1Z A;  1WFX A;  1XC5 A;  1XDU A;  2DYR H;  2Y31 A;  1IV8 A;  2KQR A;  4XLE A;  4I76 A;  4XM3 A;  2YU9 J;  4A0X A;  4A69 C;  3ABK H;  3TW7 A;  3CDH A;  3F6V A;  2HTJ A;  4A2U A;  2LNB A;  2X1C A;  3HGG A;  2QA4 I;  1U9O A;  2L7M P;  3J80 Z;  1R7J A;  3SZG A;  1HOM A;  3A1Y A;  1IRZ A;  5F1R A;  2Y9Y A;  5AON A;  1I3Q J;  1LDK B;  5FKL A;  2Y48 A;  1S9H A;  2ADU A; 
#chains in the Genus database with same CATH homology
 2EIL H;  5B1B H;  1OCZ H;  5B1A H;  3AG1 H;  2DYR H;  3ASO H;  1OCC H;  1OCR H;  3X2Q H;  1V54 H;  3AG2 H;  3WG7 H;  3ABK H;  3AG3 H;  1V55 H;  3ABM H;  5IY5 H;  2ZXW H;  2EIN H;  2OCC H;  3ABL H;  3AG4 H;  2Y69 H;  2DYS H;  3ASN H;  1OCO H;  2EIK H;  5B3S H;  2EIM H;  2EIJ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...