2EINH

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 24
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2einH00
1OCOH 3AG4H 2ZXWH 3ASNH 3WG7H 3AG1H 2EINH 2OCCH 3ABMH 3ABKH 1V55H 3X2QH 1OCZH 2DYSH 3ABLH 2EIMH 3AG2H 5B1BH 2EIJH 2EIKH 2EILH 1V54H 1OCCH 3ASOH 2Y69H 5B1AH 1OCRH 5IY5H 3AG3H 2DYRH 5B3SH
chains in the Genus database with same CATH superfamily
2GWRA 1IN8A 1UG0A 1QGPA 3OYIA 4S0HB 4HLYA 3N97A 4KT6A 4M6VA 2NRAC 3ASNH 1Z7LA 2CG4A 1XGNA 1XCVA 4ZH4F 3AL0C 3GCMA 4ESBA 2STTA 1ZGAA 4G6TB 5M5WJ 2IS1A 3HPHA 1JHHA 4G7HF 3H35A 4MEXF 3K2ZA 4CO8A 1QPMA 2A5WA 4DGWB 4M73A 2X6XA 4KNYA 5TGTA 4OMYA 2CQ7A 2DTRA 2DK5A 2P5VA 1J5YA 3T1BA 2EZLA 2EFQA 4BEHA 5EDNA 2G0EA 1SD4A 2ELHA 1XS9A 1KU9A 2M8EA 5TRDA 1H9TA 3M3YJ 1ZLJA 5DEQA 2VJJA 4ZYGA 1I5ZA 1IV8A 2N8GA 3OYGA 1O3RA 1ZARA 3H5RA 1PVEA 1R36A 2QA4I 4R8HA 1ON1A 5J1UA 1ZLKA 3DKYA 3ZN0A 1YW9A 3G1MA 3O6BB 3BQZA 2PMUA 4N4OB 3SYTA 1R71A 3G3ZA 3CCRI 3E5QA 4B3XA 5IP6A 1DQUA 1B1BA 2VJIA 3D0SA 5CVRA 4MGRA 2XF7A 2EINH 3HRUA 3HOUJ 1HSTA 1RUOA 3KETA 2M30A 1VQNI 1NG6A 3F72A 2HDWA 4Q4ZF 2JTVA 4BEHB 2EFWA 4CGZA 4ENKA 3LOCA 1PDNC 3HBLA 1ETKA 4HA8A 1Z67A 3HXLA 3OWTA 5E1ZB 4RAYA 5F1RA 4RDUA 1D3YA 2FSWA 4RLQA 2P7CB 2KIUA 1IRXA 1NTCA 2O03A 3TP3A 1P6RA 5IP9J 3CDLA 2MG4A 2X6WA 1K6OA 2HYJA 2KRHA 2KZVA 2Y31A 1ODDA 3K4MA 2DDAA 5L3FA 2VPLA 2Q8KA 5EEGA 4D9JA 1FPQA 3IH3A 4I02A 1LFBA 2W25A 3CC7I 3CD6I 1UFMA 3MZ8A 4XRMA 1TTYA 3CLQA 3CZ6A 4Y15A 3WE2A 5BMZA 3DEUA 1WH7A 4I2OA 3SZGA 1YO5C 2L9VA 3F6OA 3DU6A 3BG3A 3CUQC 2L2OA 3RKQA 5E3MA 1HKTA 3WU1B 1FT9A 5L3BA 2CW7A 4HX8A 3COAC 3M1EA 3RDIA 1QA6A 3DKXA 3QYFA 3MCZA 3I64A 2IGOA 4KMFA 2A68F 2HQ5A 4IHXA 4C9YA 4XLCA 3BTIA 3GFIA 1A35A 1X4OA 4XLNF 4BQQA 1VTNC 1YOVB 2IA0A 2M0MA 3U1DA 3PIPF 1USSA 2EZKA 2LD5A 4I0BA 2EFOA 4ZDLA 2DMTA 2D45A 4FE7A 2XGCA 4D7NA 2VQCA 2ELKA 3VODA 3K1NA 3OYNA 1OCZH 3T5XA 2R5ZA 4FX0A 3PUFA 2OA4A 1YQAA 2XRNA 2LY9A 3PSIA 3BG9A 3FMSA 1PJRA 2Z2SB 4V2GA 1KZHA 4LLNA 1EF4A 3FXRA 4XOTA 3ESWB 3IRRA 1VI0A 1ETWA 2V1DA 5GP9A 5HDGA 5LGNA 2OUMA 2XGXA 1T08B 3BZ6A 3CCLI 2NVTJ 4GGGA 3BZKA 2WY7Q 2NAZA 2Y9YA 1ZN2A 2GOXB 1MD0A 4LGWA 4Y4RA 2R7VA 4HDUA 1O7LA 2LYCA 1ZG3A 3JRHA 5TISC 4K2EA 4HX7A 4H4KC 1MH3A 4CYCA 1SMYF 2PMZN 3I59B 1YJWI 1Z21A 2DAOA 2WTEA 4V2FA 1BI0A 1OCTC 2O8XA 3P9CA 1LNWA 2F6CA 1IXCA 1HC8A 3S17J 2PLYA 3T8RA 2ZXJA 3G2BA 1MMNA 4EATA 2VQLA 4HNTA 4PSWA 4P1WA 4HW0A 2LTPA 2F4MB 3J7ZI 4UVAA 3HRTA 5EF6A 4R1HA 2LMDA 5H2FC 4FT8A 3KP7A 1XGOA 4MLOA 1ZR4A 3RIRA 2B9SA 4ZYAA 2ZXWH 2FRHA 3TL4X 1DP7P 1U5TB 1TWHJ 1BW5A 2GA2A 4CYCB 2LY1A 1J7KA 4HSRA 4PK4A 2WY8Q 1GXQA 3S15J 2L54A 3HTUA 1A36A 6PAXA 1TP4A 4MFDA 1Y1WJ 2CW8A 4CZCA 5L3GA 1DP3A 5FKMA 3W6JB 4ESFA 4Z6YA 1CGPA 1F1ZA 3F9KA 1LDDA 2CS3A 2VKEA 3FBNB 2A05A 2A6TA 1J75A 2HDDA 1LJ9A 3FMRA 1HA8A 1SVLA 4PJLA 1ACIA 1S9HA 2H6CA 1R23A 4XLHA 3J7YJ 1A31A 1O3TA 4BDZA 2Z1DA 2FU4A 3JAMK 2AHQA 2GBYA 2P8TA 3ABKH 3B6CA 5CPRB 4LG3A 3CCJI 2VOPA 4NQWA 1RI7A 1P4WA 2W24A 4P96A 1KU3A 3FM3A 2F5EA 2K9LA 5IY5H 4UVBA 4AVZA 3DLLF 3ZQGA 2XAGA 3ZN1A 3WTYC 2H8RA 2HEOA 3I71A 3B73A 3OL4A 2F5FA 1M1EB 4B43A 4Q5SF 1G3WA 1WVRA 2MFZA 3BCAA 4IL6C 3KPHA 3KIOA 3EUHA 3K1PA 3OMYA 3FX3A 3RKWA 5FD6A 1GV2A 1Z0XA 3M8EA 3M07A 2WB1A 3IC7A 5BQTA 3ZP5A 4IQ4A 2BY0A 3FK7A 3GZ6A 2VBYA 2DK8A 2CQNA 3H92A 3RTRA 4IVNA 2IPQX 1SD7A 2VBWA 1SMTA 3FISA 1REPC 1I1SA 3GFLA 2M0CA 1YIOA 1U78A 1ETVA 4NQWB 5LFAA 1VQKI 4V19K 3GTQJ 2DOFA 3U2RA 3SEZA 3F6VA 1RIOH 2BEOA 2O7OA 1IZ1A 5GPAA 2L7KA 1AA7A 2FJ1A 3DF8A 3OIPA 1SVOA 1Q1HA 2A6HF 4FASD 3HSRA 1TLHB 2E5NA 1TZLA 3BR1A 1STZA 1UJ8A 2BY1A 2L01A 2UXXA 2WBMA 2JZYA 3T8TA 3JSOA 1UCRA 5IPAA 1OCRH 1XMKA 2Q1ZB 2JRTA 2VE9A 3S1NJ 3QP6A 4LLLA 4A2UA 4CZZA 3S2HJ 3F3XA 2HWVA 1ZYRF 5GADJ 1KYZA 2LRDA 3JCUC 3KZIC 4F92B 2P6SA 3ZQLA 1X1AA 3GF2A 4OMZA 2JA2A 3Q0VA 3BTJA 4PGHA 4UVCA 4C3IJ 3KLOA 4DW6A 1WH5A 5JR3A 2UWMA 1LUJB 3ZQFA 3E6BA 3OYJA 3IKTA 1J09A 2F5DA 2OC6A 5FROA 3VSKA 3C7JA 2DA7A 1BIBA 3L2CA 2CRGA 3DBRB 3DKWA 1JKOC 2HDCA 2DT5A 5EZHA 2WV1A 2CU7A 5H6RA 2DFEA 3DV8A 3Q3SA 3TP0A 3LSJA 4JBAA 1R5GA 2Z33A 2VOOA 1RUNA 3OIOA 2FQ4A 1R1VA 1XB4A 3W2WA 4A0XA 1GUUA 3S1QJ 2KRCA 4RGUA 2QM3A 2VQHA 2VIXA 3A02A 1FIAA 4JOMA 3K0LA 2A69F 2L7FP 4M3DA 1AKHA 4C2UA 2ZXIA 1LVAA 2G7HA 2LKPA 1VQ5I 2EZIA 4XKWA 1WZ2A 3SZTA 4HF1A 1LB2A 5K1YA 1KYWA 2M7AA 5DDGA 5KAFC 3HYIA 4HV5A 4HNUA 5D5VB 2VT2A 5K7HA 3MKLA 2H94A 2B63J 2YU9J 4RGXA 5IYCJ 1IGNA 3BLYA 4M9SA 2X1EA 2OU2A 1W4MA 1ETYA 3OL3A 1U9OA 2W57A 3LAPA 4BACA 2VC0A 4QSHA 3LAJA 1S29A 4A3LJ 3KE2A 3L7WA 3H3VK 4A0ZA 4AVPA 2IW5A 3P5JA 4UUSB 3F22A 1MBHA 3E97A 2CUJA 1TT5B 3P7NA 5H6QA 2CFOA 2WAFA 2ZB9A 4L0ZB 4E6KG 3C3WA 3CF5F 2W7NA 5LBQA 4CA0A 5FFZA 2LH9A 4KN4X 1AKHB 3AG2H 2ZJQF 4TV7A 3GFJA 4HQEA 2FNPA 1T33A 4A12A 1CQTA 1OISA 2GM4A 5CYVA 2BVLA 4KN7X 5E3OA 1Z1DA 4PDKA 5E1WA 3CESA 1XC5A 1U0JA 2BHYA 4XMYA 3O8GA 3I56I 2ESHA 2IVMA 3GTPJ 2ID6A 3ZMTA 3W6VA 1QZEA 4I99C 3DQVC 2KLOA 1DU6A 3J81K 2KIQA 3ZQ7A 1T95A 5KVRA 3BR6A 1W5SA 1POGA 4KIBA 2K9SA 1E3OC 2L9RA 3DPUA 1SFKA 3OR1C 1K79A 3UR3C 1VNDA 2ZSHB 4CSWA 2EIKH 2EILH 2F4OB 5KHDA 3ZPLA 3RQIA 1HBXG 5J8FA 1ITYA 3DTIA 2HVRA 1Z6RA 4M74A 4E70A 3HRSA 4I01A 2L02A 3ZCOA 4L5JA 2VLAA 3FF5A 4CICA 2BOLA 2X6OA 4RM3A 4YFKF 4E7KA 3J80K 2HPMA 5E1XA 2IT0A 2JMWA 4O6JA 1N75A 2DA5A 2GIZA 4MTDA 1R9TJ 4XRSG 2R7DA 1XG1A 2QWWA 5M5XJ 1D8KA 3ULQB 1SFXA 3BG6A 2J5OA 4WXCA 3AKZA 1R5ID 4I6ZA 2O9LA 3R61A 1I6HJ 4KFCA 4N9IA 4U7BA 3CP2A 2L4AA 4JP0A 1WHUA 2PX9A 1ZHFA 2E60A 2VXZA 4QWQA 1KA8A 1MIJA 1ETXA 5LLQA 1PP7U 5K7FA 5B66C 4LK1F 3EQLF 4PJJA 1JUPA 3L2WA 5IP7J 2E35A 2ETHA 1F36A 2KDOA 5D8KB 2M45A 3HOYJ 3BJAA 3DEEA 2OCCH 4NC7A 3CJRB 3JRFA 4YFNF 1SANA 2TDXA 3ABLH 2K27A 3QOEA 2KKOA 1OLTA 3LA7A 1YS6A 1LDJA 3OOPA 4RAZA 2UUZA 1RETA 2L9SA 3GLXA 3E7LA 1B6AA 2DI3A 4XK4A 2DCEA 2HQAA 1LFPA 1T6SA 4RGRA 2Y9ZA 1J0RA 1O57A 3PFIA 1P7IA 5HODA 3BG5A 3CCQI 2IRFG 3N4MA 2EJRA 1ETOA 4EGYA 4EJTA 4CUGA 3FXKA 3A0HC 4CH7A 2R93J 2KDZA 3QQAA 2OF7A 4A6EA 5J1RA 3SJMA 5DTDA 4IRHA 1X1BA 1VQ9I 1R6RA 1UHMA 3K1MA 3E6MA 1X3UA 2PEXA 4DYCA 1Q1VA 5EEHA 3FXLA 1R22A 2XPWA 5FLMJ 2CV0A 4UB8C 5E3NA 1HSJA 1VQMI 4RB3C 5IOZA 3CF2A 1OQYA 3AFHA 4M9XA 1T2KA 1RKWA 2DN0A 4G12A 4JQFA 5BPIA 1H9GA 1KGSA 2GLOA 4DBQA 4NHJA 1D5VA 3OOUA 3CCYA 1TBXA 1LDKB 3ZMZA 4GYIA 2IGNA 4RGSA 3F8MA 2NVQJ 5F64A 1ONVA 1FSHA 2Y0MA 4ENJA 1OCCH 1SD5A 1IAWA 1BJAA 3PM1A 4XNFA 3N05A 1RR8C 2XGDA 3ELKA 1P4XA 2JUGA 2E19A 4N0BA 1XSXA 5EYRA 2VODA 1Z05A 1MKMA 3UKGA 4YELA 2ZSIB 2M3AA 2DMUA 2P5LC 1G4DA 1G8XA 1FBSA 1S7AA 2P6TA 1P7JA 4PJNA 2FBIA 4XICA 5DD4A 1ZRFA 5A2QK 5GAHJ 3F8FA 4KDPA 4X0GA 2CQXA 3K7AJ 3KX2A 4BGDA 1YTYA 4MO7A 2V1NA 1N25A 5LD2C 4UHTA 3CCSI 2X85A 2DFIA 3ERED 4WK8F 1SVMA 4ON0A 4AM3A 4HOBA 3RKYA 2E1OA 1E3HA 3FBIB 2EV0A 4P55A 4BJ5C 1YJNI 2HFHA 5D5XB 1HKSA 2MH9A 1U3EM 3TDUC 4BHPA 1WJ5A 4IQJA 2VXDA 1BJZA 4IJAA 4U0VA 4EGZA 3D5LA 2J5PA 3CP8A 2VJ4A 1XX5A 4CCMA 3KP2A 2R7OA 4PCQA 2HOEA 4GO1A 3E6CC 3WGIA 3K4NA 3DPTA 2JVGA 1BW6A 1Y1VJ 2DQLA 3CDHA 2AQEA 3NRVA 4ETSA 4ANJA 3QU6A 4WWCA 3H0DA 2DMQA 2QKMB 1TNSA 2XPUA 2A3SA 3WU2C 4QPQA 2HXIA 1RC9A 2R92J 1WJDA 4A3JJ 1VQ8I 4A3BJ 2Y30A 3KEQA 5FGMA 3FM5A 1W5CC 5HLIA 2I10A 4XLPF 3NQOA 2Q2EA 1V55H 3ZRGA 3PO2J 3V7CA 4XN0A 2QYOA 2EIMH 4PFOA 4MTEA 3B6AA 2R7RA 2V4JC 3RKXA 2K9NA 2WAQA 4FHTA 3HOSA 3OS0A 4DYQA 2PBIA 2W48A 3QPLA 2K3PA 3K70D 2O5RA 5CVIA 2XPVA 1JI8A 3E6DA 2Y48A 1BI2A 4HV6A 4EM1A 1JKPC 3RSNA 2Z16A 4F52A 2H1KA 4DOZA 4OWRB 2HQRA 3GTKJ 5HS7A 2BXYA 3OIQA 5BNGA 3DXJF 1L0OC 4UV8A 1UZCA 2VC1A 2VB6A 3E5UA 3MQ0A 2FBKA 1X1PA 1BR4A 2W4SA 4CXFA 1W0UA 3M8FA 1R1UA 1K61A 2XAHA 1DU0A 1R1TA 3FDYA 3G1OA 3ASOH 4ITVA 1W7PA 1W1WE 1OKRA 4RS8A 5E8GA 5HDKA 4L9NA 5ICEA 1F9NA 2E71A 2AO9A 2KT0A 4Y33A 2XC7A 4B8XA 1A6QA 2XASA 2Q2EB 3E5XA 2BE5F 4HZFA 4BUPA 1PYVA 4AIKA 2KISA 4KJZA 2CJJA 3PNVA 2EWNA 3QWLA 4D7MA 3H1CA 2RQQA 5D4SA 3J7AO 3I55I 4W97A 4B1RA 4C3JJ 3JRDA 3ZOBA 2QCOA 4XKCA 2E1MC 4PZJA 1T0FA 4WCGA 3W2VA 3O3KA 4M3EA 1UHWA 3BR3A 4DNCA 5M3FJ 1DUXC 1BM9A 3LA3A 4U0WA 1U2WA 2W82A 4LOCA 1FNNA 4EJVA 2EQRA 3D5RC 5CVUA 3WHBA 1XTAA 1D0XA 3EUAA 3H9JA 5FB2A 3CJQB 3ML6A 2OQRA 1R00A 2EZHA 3PQJA 4Y3OA 5DCFA 2DXIA 1YFHA 1QHHD 3I59A 2L7ZA 4IHWA 5IT9Z 3A03A 3IKVA 4IZZA 4AUXA 2MC4A 3IL2A 1FEXA 1W7PB 1ZGJA 3M8JA 4XQFA 4BXXJ 2LSOA 3V8LA 5IOYA 3WGHA 3G73A 4DZPA 4PSXA 2OPTA 2PQ8A 1J2XA 1KONA 3ZQQA 2DPDA 2O6GE 3JSPA 1U6GA 2NOJB 3GO5A 4I98B 3VYTB 2ACJA 4XRSA 2QQ9A 4RAFA 2VJ5A 4RBOA 2HOTA 2FUG2 4AC0A 3OYHA 4II2A 4N4NB 1O3QA 3HHGA 2DMPA 2TRTA 3ERMA 2V6CA 2HXOA 3DU5A 2F5VA 3OYKA 3GZ5A 2L4MA 1JTXA 2KZGA 3WTWC 2ZFWA 4KIGA 2ZMEC 2DA3A 3L2QA 3WGGA 3TGNA 1HCRA 1WJFA 4IF4A 1U5TA 4KT5C 3JRIA 2ZNZA 4YIIA 1GV5A 3LWFA 1YITI 2R7TA 5C4XJ 1H88C 1TWAJ 4WF2A 1VQ4I 3ZQCA 3D5SC 1GVJA 1WJBA 3WHCA 1KU2A 4ZTFA 4UUVA 3PNTA 1KU7A 3OY9A 3MZYA 1NK3P 3GTGJ 3CCVI 2GQQA 4GCVA 4IEJA 4XSZF 3IWFA 3PJRA 1BN5A 2VL8A 1MBGA 3HC7A 2LREA 5HNHA 4IOCF 5L3EA 1FZPB 1R5HA 3MN2A 1PP8F 3OYAA 1JJ8C 2P4WA 3H5NA 5FLXK 3BDDA 2LBFA 3H9QA 1KQ8A 1R4NB 3WU0A 1YHQI 1V4RA 2XRLA 2V9PA 4AIHA 5IYBJ 2MC3A 3WG9A 4N9HA 3F21A 2PMHA 1OCPA 1FOKA 2LY2A 3L00A 1IRZA 3BTCA 3UNGC 2DQRA 4A3MJ 2YSRA 2HYFA 1FP1D 1ETQA 3KEYA 1NH3A 1W7PD 1G3SA 5HLTA 2MSYA 3BR2A 5CVJA 1OMIA 2Y69H 1XD7A 4BYYA 4XL9A 5ERIA 4C2TA 2K85A 1BA5A 2VI6A 1UMQA 1Z9CA 3TDZC 1W0TA 1LE8A 2JA5J 1MBFA 1D8JA 2P81A 1VQ7I 2H1LA 2Q0OA 2DT6A 4FCYA 2TCTA 2HVSA 2XUBA 1V5EA 2HVQA 3FXJA 3RQ4A 2VT3A 3E1SA 2LDUA 3SQNA 3OS2A 2HTSA 2RV8A 3M7GA 3TO6A 2BBYA 1KQ0A 1WJCA 3PUBA 5J4VA 3ZMDA 5J1YA 2LBFB 3JRGA 1ZREA 1G2HA 5K5QA 4EQQA 3VPRA 2RC4A 4HAMA 1HDDC 4GRIA 3V4GA 2LKXA 5EJCA 2QENA 1MNMC 1X2NA 4MHGA 1DGRM 2XAFA 4BKXA 5K5RA 2QF7A 2CFXA 5F0CA 2DYRH 2IBDA 2OV7A 3AAFA 1WSUA 4XONA 4KIFA 2QQBA 2RN7A 2E2JJ 4HX4A 2ISZA 2BHZA 2E36A 3C18A 4F7ZA 4ESJA 5E18F 1BBYA 2VONA 3HIFA 1MMSA 4ZDOA 2K40A 2FOWA 3H3UA 1TWGJ 2WAQN 5F0FA 1X1DA 2OQGA 1LE8B 3MEXA 2V9VA 3LFUA 1ZTRA 1SAXA 4JX5A 5EG0A 4BDYA 2VKHA 1R4MB 2RQPA 4FTHA 3GLLA 1Z77A 4PUSA 3CCEI 2JWTA 1MBEA 1SC7A 4NUBA 3LSPA 1I3AA 5CJ9A 2HR3A 5FRNA 5C44J 4IXAA 3OYEA 1LEAA 1RR7A 4BBRJ 3GZNB 2K5CA 4RMNA 1TT0A 3TO7A 2DYSH 4PFPA 5FO5A 3OYLA 2Z99A 2YU3A 3PNYA 2BV6A 4EMSA 2XF6A 5DCMA 2DA2A 5AIPA 2HTJA 3ZMUA 3DWLE 5GAEJ 1YX5A 1JHFA 5D4RA 3CC2I 2CUEA 4RA2A 4BU2A 5FKLA 2H27A 5F08A 5EG0B 3H9GA 3K9TA 4EEFG 3LA2A 3LSMA 4EJOA 2DDBA 4F91B 1I1GA 3DEWA 1XDSA 5HVQC 2I5UA 1G6NA 2CUZA 3VYUB 2NVUB 2AXLA 3NAUA 2YR2A 2YX7A 2CUFA 1O7FA 1PUEE 3BR5A 4M3FA 4EM0B 1IN4A 3A01A 2X4HA 5FFXA 1WKMA 3TO9A 1VF9A 3KYDB 5E3LA 1EKEA 4F93B 3AL0B 2NNNA 1YYVA 1A5JA 2ICWG 1MMAA 1R49A 1O4XA 4G8XA 2D1VA 2Y2ZA 2MD0A 4BE0A 2IEKA 1WGXA 4UUSA 5DCMB 2HKXA 1B8IA 1OYIA 2GXGA 4OIQF 2EBIA 1Z6TA 1VQ6I 1W36D 1MNEA 3FXMA 1H89C 1G59A 1FBQA 3BP8A 4BXFA 5HOOA 1DPUA 2A61A 2OBPA 1IRFA 3VEPA 1E3PA 2Z5UA 1OFCX 1UG2A 2K4BA 3JREA 2ZBKA 1FYKA 3EETA 4BHBA 3A01B 4G7OF 2MLKA 5J3LA 1XMXA 2LC2A 2OTLI 2LK2A 1ZR2A 2GAUA 4IPAA 2E34A 2XIGA 5BS6A 2MGQA 3Q0WA 1TW2A 1V54H 2HS5A 1GHCA 2P0WA 2UV1A 4L9VA 1K78A 2K4JA 1FOWA 1MJAA 2R3SA 1TQMA 1ZQ3P 2RVCA 2X1CA 3A0BC 5GAGJ 2MABA 1T8IA 1X19A 1H0MA 1C0WA 3O2PE 1B8IB 3WTZA 3S32A 5EZGA 3EYYA 4M3GA 1XGMA 2VKVA 3CUQA 3BZCA 1IG7A 3QPHA 4Y17A 4F55A 2W84A 3CDIA 1TWCJ 4BAYA 4UXNA 2H8WA 4G6DA 2D2WA 2ME6A 3TBIA 5FKKA 2CQKA 2X48A 3FWEA 3K4JA 1MDMA 1EA3A 2DW4A 5LHHA 2EFPA 3V8KA 2V79A 4OAYA 4E7HA 4LG0A 1EH7A 1XPXA 1AU7A 1TWFJ 2VN2A 3QYEA 4BNCA 1BOAA 1VQPI 3SXYA 3GX4X 1Y56A 4J00A 1K78B 1D1AA 4KITB 4IHTA 4A5NA 4CCNA 3J7AY 2V1XA 3ECOA 2BY2A 3BG7A 4ZYEA 2CW0F 4S05A 2RNJA 5D5UB 2EIJH 2DJNA 5HDNA 4A5MA 3OR2C 3VSLA 2AQFA 2DFHA 3JR9A 2NS8A 5B1AH 2QQAA 2CV1A 1TQPA 5M5YJ 2DO7A 4FX4A 1GVDA 1ZG1A 1NK2P 5HS8A 3CUQB 1BIAA 1P2FA 3A2KA 5JLXA 2ZNYA 3LSGA 2OAZA 4DBRA 2R5YA 2VASA 4KA4A 3HUGA 3KP3A 2X9DA 1FIPA 4A3GJ 1LVKA 1VZ0A 3CMMA 1IRGA 4XN3A 1HF0A 1U5TC 1IF1A 3BWGA 1MDMB 3BPVA 5DUKA 2KIMA 4WX9A 4FQGA 5LGTA 4LG0B 3V8JA 4NB5A 3MVPA 2ESNA 1FC3A 4NC8A 1MBKA 2FX0A 2VE8A 5BPDA 1F4KA 3SHFA 1BC8C 2KPMA 4ASNA 2VQGA 5F04A 5FLVA 2L9NA 3W3CA 1S72I 3R60A 2E2HJ 3RYPA 1XGSA 1GT0C 4B09A 1BOBA 2QQ8A 1VFCA 2FXAA 1I39A 3IH4A 2MBFA 5KAIC 1JGGA 2WB1N 1QU3A 4OIOF 1D1BA 1RRJA 4OIPF 3SZPA 3HRMA 5C3EJ 3FXUA 2V6EA 4A3CJ 3ZMVA 3G4SI 5IYDJ 1E0EA 3JAMZ 2F5CA 2V26A 2CMPA 4A3DJ 3S93A 5DM6F 2R5YB 2RNGA 3U21A 3HUGB 3TEDA 1ULYA 2HGCA 4NBQA 1JKRC 3RYRA 4HRIA 3DPLC 1BL0A 1MJ9A 2ZJPF 5ILSA 3ABUA 3L2RA 3HOXJ 2O8KA 1JKQC 3FK6A 2MLGA 1A6IA 5CQEA 4IHSA 4LD5A 3P9KA 1ZGWA 4LLGF 1LFUP 1W36C 4J19A 3VOEA 1DGWY 1WWXA 3I3LA 1SEUA 2FQ3A 2Y75A 1H8AC 3KYLA 2XVCA 3AG4H 5JVGF 3L09A 1V5GA 4DYRA 5E17F 3BJ6A 4C30A 3CCMI 5KCMA 2IS4A 3VYSB 4NNJA 4HEA2 3AG1H 2OD5A 3I9V2 3ZMSA 1X3WB 2R7SA 2XV4S 1SAUA 2XAJA 4JX4A 3ABMH 1T98A 3REOA 3S3MA 3IWZA 1U8BA 1BI1A 3S2WA 3QPSA 2DU9A 1B59A 1B72A 3A1YA 3TW6A 4L5IA 3KLNA 1D1CA 2XKPA 1GLNA 2YX4A 3PFYA 3QOPA 4FE4A 3HOTA 2EA2A 2RREA 1EH6A 4M71A 3F23A 1RZ4A 5AONA 4DZJA 4FETA 2XAUA 3LFKA 4HLXA 4RB2C 2K3FA 4U0YA 3EUHC 1ZRDA 1IDYA 2EB7A 2NS0A 3BR0A 4ENMA 2YPRA 2JSCA 1YW7A 5DUIA 3GBGA 4L9TA 3I5UA 4KUMA 1FY7A 2WAEA 4A93J 1L3LA 1T39A 1XSDA 2Y0SA 2GZWA 2DA1A 3KP4A 4BS9A 4YRVA 2X6YA 4BBSJ 4U7DA 3OYMA 3MAJA 1I27A 1LPQA 4Y52J 1OCOH 4C3HJ 5LEJA 3BROA 5LHGA 1YX3A 5C4JJ 2YUSA 3VDXA 1QQIA 2OZ6A 1WFXA 1B72B 1K83J 1LKXA 2FNAA 2PFBA 2KJCA 3QU3A 1HW2A 1FYMA 3ZXSA 3I4NJ 1X3ZB 2W00A 9ANTA 2HKOA 1Z3YA 2LP0A 3G1LA 5D5WB 3CC4I 2AXTC 4AWXB 2OCEA 1IXRC 2ZC2A 2QZ8A 3HKZA 5AIQA 1FJLA 4CCKA 5FKOA 5E20A 4C2MJ 5JHUA 4ABZA 2M8GX 1J59A 1V5FA 2DT7B 3BPXA 4XBFA 1ZH5A 3HM5A 2FOKA 2HQNA 4XLEA 3MZHA 1MNDA 3GUDA 1IDZA 2E7WA 2HPIA 3WTTC 4PJMA 4YEJA 2XB5A 5L3CA 2CH0A 4E7LA 3QRFF 2W1OA 3FXQA 4U87A 3E3VA 5F27A 4BY7J 1I6XA 2KHMA 3W2AA 1JT0A 3WTXC 4DQ2A 3SDGA 2ECCA 3HHHA 1QHGA 2M87A 1IO2A 3F8BA 3CMAI 3RZDJ 3DP7A 2F48A 3H36A 2BXZA 3QAHA 2QGUA 4E7ZA 1MBJA 3O8HA 1QNTA 4L9JA 2JQ7A 1IV6A 2D5VA 3LSRA 1JTYA 1S7OA 4QPOA 3VB2A 4F3QA 3HTSB 1IXSB 2X51A 3I0TA 4R79A 3S16J 2BGCA 2PI0A 3NEUA 1FOXA 2RDPA 1QZZA 5M3MJ 3I4MJ 3S1MJ 5HS9A 3L9FA 2FMYA 3TKYA 2DJIA 4EJWA 3RPUA 1JUSA 5EGOA 3C2HA 4UY8I 1QVTA 2ZKZA 2EK5A 3K10A 2IGKA 1B9NA 3CO6C 3LSTA 3HGYA 2O0YA 2JPCA 2JUCA 2NS7A 1MSEC 1WJAA 3SFIA 3Q9VA 5DYMA 3TOBA 1UELB 4QLCU 4KISA 1LQ1A 2STWA 2V1UA 1D5YA 3J81Z 3S14J 2VPRA 1AWCA 4YFXF 4DIQA 5J40A 2R0QC 2E1CA 2DA6A 1FOYA 3F8NA 2BYVE 5HLHA 3HOWJ 1X2MA 3MWMA 2KQRA 2ADUA 4UB6C 2BW3A 3Q0UA 4RLFA 3GFMA 2R7FA 4BJTA 3K4LA 3LL7A 2Z9OA 4HDVA 2UZKA 4A0YA 2XROA 4D5CA 2MD5A 4Q47A 5ILUA 5EGOB 1IUYA 2MA3A 1MW7A 2VBXA 2LF8A 1LEBA 1FP2A 3WTVC 4ZDPA 3J80Z 3T0YA 4MIMA 2JA8J 4BQOA 3M4OJ 3JTGA 2BY3A 2H09A 4QIWN 3CUOA 2KP6A 4G9YA 2GA1A 2QVOA 3DBHB 5E79C 5K5OA 2ECBA 1S7EA 1JE8A 1EV7A 1MZBA 4P5OA 3GW2A 2ZJ2A 1QO0D 4A3EJ 2IGMA 1P4AA 1USTA 1YE9A 2GIVA 3FHZA 2K86A 4LFUA 1Y8QB 5J4YA 4Y13A 1VQLI 4G94A 3L1PA 2K02A 3JTHA 3CJTB 1NG7A 1Y0UA 3NWTA 2EFNA 4IHYA 2O3FA 3GTMJ 1S6LA 2BW3B 3H0GJ 3GTOJ 5K7ZA 2HYGD 2IJLA 3S1RJ 1F5TA 3BOQA 1IN7A 1B4AA 4MEYF 4CCOA 4LIVA 2CGPA 5ED4A 2DA4A 2IXSA 4XOPA 2CQQA 1HLVA 3HDDA 2HNHA 2LG4A 2R7ZJ 3FIWA 3H5AA 2RKHA 3E0JB 1ZKGA 1QVUA 1T56A 2XKOA 4ZC3A 1MSFC 2IA1A 3WG7H 2LNBA 2K9QA 4NC6A 3DTKA 4XSXF 5CLSA 3WODF 2QEXI 4CCJA 1YS7A 3EDPA 3B02A 3ZR8X 4JYKA 2QLZA 4FISA 3BC8A 3HJEA 3WE3A 5JFRA 5GTIC 1FMWA 4HF2A 4M9ZA 1CF7A 2OTJI 2WWYA 2ZFUA 3CMEI 2F4IA 1Y8RB 1B9MA 3CLOA 4LJZF 3V7RA 4AYBA 2R5ZB 1MGTA 3GVAA 4M3BA 2JA6J 3GTLJ 4CHUA 4D5FA 1FSEA 2WADA 2Y0SN 3TOAA 4E7JA 1IUFA 4Z2YA 3R0AA 1JXSA 4BXUA 2M4GA 3VYRB 3IV5A 2JT1A 1R7JA 5H20A 3OYDA 1S5LC 2M4KA 3RPUD 3TQNA 5JLWA 4OOIA 5B1BH 1SD6A 2GXAA 2PG4A 3HGGA 3WTUC 2NVXJ 3K6GA 2KMUA 1YG2A 1WPKA 1S8NA 2XSDC 2V9KA 1RESA 3K70C 5DD8A 1Z7UA 1XSVA 3HG9A 1N78A 2X0LA 4O3MA 5F1JA 3I54A 3LQRA 5FKNA 3K2AA 3BT9A 5J47A 4PGGA 3HPGA 3EPZA 3I53A 2E1NA 3R0JA 4EV0A 3R6SA 1FX7A 1SFEA 2XF5A 3HKZN 1CF7B 2JPBA 4G7ZF 1UB9A 1ZG5A 4B48A 2ISYA 4X6AJ 2NOGA 3TMOA 1FLIA 2HU9A 1AHDP 5A2QZ 2B0LA 4I09A 2PN6A 2YS9A 1J9IA 3AG3H 1IN5A 5L3DA 4LB6B 4BHCA 2R7XA 1ZK8A 1I3QJ 2FEZA 1Y39A 1SFOJ 4RAGA 2R7UA 3HL2A 2M9HA 4P9FA 4XIDA 2KL4A 1HOMA 1G3YA 2JK3A 3CMYA 1BC7C 2ZO4A 3IAS2 3TW7A 2EH3A 1YRNA 3BJOA 4YIFA 4LB5A 1HXDA 3JRCA 1V3FA 1OR7A 2VBZA 4RB1A 2JSPA 3JW4A 4Y7NJ 1U9NA 2PJRA 2XSJC 5B3SH 4ENNA 1FMVA 3WTSC 2VUMJ 1QPIA 3EYIA 2OJED 4BJ6C 4AD9A 2M2EA 1MH4A 4BE2A 3GMEA 1ENHA 3OYFA 3D1NI 1BR1A 3OV8A 4RM2A 4JX6A 4X1EA 4B3AA 2B7EA 5E8IA 2CYYA 3DBLB 3DLAA 5D6EA 4AIDA 1ON2A 2LVSA 1WRJA 2EA4A 4S04A 5KNLA 2DODA 3OSGA 1FWZA 3HEFA 3PO3J 4BL0B 3HSFA 3KCCA 1A04A 1ZAOA 2ZCWA 1YIJI 5D6FA 1K7AA 5LHIA 1YRNB 3LSHA 3PSFA 2HZTA 4PJ0C 3K4BA 1WI9A 2KJBA 2QBYA 4M6YA 5CKTA 1XCBA 1DDNA 3KP6A 1U8RA 5JI6A 4P9UA 1P92A 4E7SA 2Z3YA 4E4HA 5EEAA 4MQVA 2F2EA 2LFBA 1HDPA 2PJRB 1DPRA 3H3ZA 2JVHA 1YJ9I 2ZJRF 4IHVA 2FMLA 1BR2A 2M34A 3R4KA 3ZGKA 4IO9F 4U88A 1K4SA 4B47A 4AU7A 3HOZJ 3NARA 1GXPA 5J6XA 5BOXA 1TNTA 2A07F 3P9IA 2NYXA 2DOEA 2HOSA 2IS6A 5FJ8J 4XM3A 1MMGA 3PIOF 5JVTA 1IN6A 4JK1X 5ICCA 3G71I 4IKFA 5CVVA 1K6YA 2FF4A 1QRYA 2COMA 1OPCA 3RZOJ 1X1CA 2IAIA 2WA0A 2E7XA 4CDGA 5HNFA 3GWZA 5ICGA 2R7WA 4L18B 1NHAA 5LGUA 2LF7A 2QBYB 2EV5A 3IUOA 3IRQA 1WQ2A 4M72A 2ZXHA 3GEZA 5D8LB 3HB9A 3KYCB 3M1CA 4A69C 4A6DA 4B44A 5LRSA 3RPQA 1E2XA 3L2UA 1P9QC 1JGSA 2EPFA 2L3DA 2ME0A 3PL8A 4E7IA 5LEKA 2COBA 3C2BA 4HQMA 1SFUA 1RNLA 1HQCA 4OIRF 4CYDA 1XN7A 5B5EC 1X4PA 5J8CA 2DOAA 4OU0A 4XLFA 2ID3A 2UXNA 4LK0F 1O3SA 3QODA 2GXBA 3F8CA 4NDLA 4L5EA 4LITA 4CCLA 4EM2A 3OYCA 1UAAA 1AOYA 1RPWA 2CO5A 4MNUA 3MKZA 3LNQA 4HSTA 1WCMJ 3MMYB 2KRFA 1ZRCA 3CO7C 1MMDA 4ZZDA 2E5ZA 3MKWB 4BQAA 1ERDA 1FTZA 4KYWA 3V42A 3Q5FA 4KICA 3IH2A 1F43A 4XR6A 1TL8A 1T0FC 2DLLA 2QSHX 3ISPA 2IA2A 4Q48A 3W6KB 3F0CA 2K9MA 1T38A 2L0KA 4UUTA 4BQNA 5LRRA 4D1QA 4AYBN 3GYHX 2RGVA 3K4KA 1RKTA 4BH9A 3JRBA 5DM7F 4A3KJ 1IC8A 1OJLA 2O61A 1HW1A 2M5WA 2MW8A 1IW7F 4GYGA 5KK1A 5JHFA 1TQIA 2DMNA 5TJJA 1G3TA 1XDUA 4MQ9F 3LSIA 3ZQHA 3G6EI 3CCUI 1MJBA 3ABTA 3S3NA 4UNOA 5F0HA 2JRMA 1TW3A 4HNVA 1TC3C 1HKQA 3CJNA 3ZQIA 3DCFA 3U1KA 2LR8A 1YLFA 1WI3A 3IHUA 2MYSA 1WJEA 4HPQA 3CTAA 5FD5A 4W1UA 2DTZA 3KEOA 2P7VB 3RCOA 2HI3A 4XORA 3BY6A 4QTRA 1UHSA 2MH2A 2EV6A 4DJAA 2JJ7A 1GDTA 4XLAA 2CWEA 2NNYA 1D0ZA 4L0YB 4AIJA 1APLC 2M1BA 4HBLA 1FTTA 5IT3A 1Y0NA 3IAM2 5FLXZ 4EJUA 4J01A 2QSGX 3ECHA 2VKDA 2E1MB 2QUFA 2IP2A 4XKBA 5F6FA 3BCBA 2W85A 1D0YA 1YW8A 3DFGA 3QP5A 2NVYJ 3X2QH 2IS2A 3OSFA 2L5QA 2ZMEA 3I4PA 3U9GA 3SDBA 3FHNA 3KFWX 3LMMA 5CQGA 2XB0X 5IT9K 3KP5A 4XRFA 2FE3A 2G9WA 2LOOA 2C6YA 3KZYA 4ZYHA 1XMAA 4IOAF 4I0AA 1I50J 2H6BA 3RI4A 4A3IJ 3ROUA 4IRIA 4ZZLA 1S3JA 2I8DA 2QKLB 3LSKA 3BTLA 4EVIA 1FYLA 2D1HA 3A4CA 4A3FJ 5HLGA 2FD5A 5GPCA 2P5KA 3MFKA 1Z91A 4GDFA 3HZJA 1EJ9A 3NWSA 2L7MP 1W5TA 3VFZA 2XGEA 2DBBA 2OZUA 2WV0A 4OAZA 3S3OA 4YG2F 4ZYDA 3S8PA 2LKSA 1PUFA 3ONQA 3QYBA 1JUMA 2ZMEB 2DFFA 1Y6IA 1E17A 2PJPA 1ORKA 1R58A 4O5VA 1ZELA 3RJPA 3PQKA 4I76A 3CQZJ 3LQQA 1JT6A 2KFDA 4HG2A 1QBJA 2V7FA 4GFBA 4LIUA 2CSOA 2KIFA 3MD2A 3OS1A 3HSEA 4WXDA 5ILVA 1HW5A 2FA5A 3SFZA 1EH8A 3BQYA 3FKIJ 2XAQA 4WXHA 3OYBA 1YI2I 4BY1J 2WC2A 4MFEA 4RB0A 1OYWA 1QZYA 2BVMA 3SEQA 5ICFA 5FRMA 1JJ6C 2E2IJ 2X1DA 4ZTJA 4I7HA 4OINF 4M6XA 2R4GA 2RAEA 2JN6A 2JA7J 4BE1A 3C2GA 3HOVJ 1N77A 3EUKL 1OYYA 5GTHC 3MKYB 5DS9A 2A6EF 2R7QA 1PUFB 2DPUA 1BI3A 3DTEA 1Z3XA 2XDVA 3M9AA 4KMUX 1IJWC 2NXNB 1FBUA 2HZDA 2ELJA 2GOMA 2M7BA 1KQ9A 2G7UA 3KZZA 2PMZA 2K7LA 4B4CA 4G6QA 3GTJJ 2QSFX 4ZJZA 3S2DJ 3Q9SA 3FKJA 4IX7A 2CV2A 1VQOI 2HOAA 4IRGA 1X58A 4YIRX 3K69A 3JRAA 3C1DA 4GXOA 4D0PA 2AS5F 2FBHA 2LLKA 1OR7C 3V7SA 3I58A 3VWBA 4UV9A 4II3A 2BZTA 4LMYA 3L2VA 3IP4B 4XKVA 3FZVA 3FMQA 4HF0A 1K4TA 2XHKA 3K4CA 5DV5A 4HYEA 4H0EA 3GXOA 3FXOA 3QPTA 2A5YB
chains in the Genus database with same CATH topology
1OCOH 3AG4H 2ZXWH 3ASNH 3WG7H 3AG1H 2EINH 2OCCH 3ABMH 3ABKH 1V55H 3X2QH 1OCZH 2DYSH 3ABLH 2EIMH 3AG2H 5B1BH 2EIJH 2EIKH 2EILH 1V54H 1OCCH 3ASOH 2Y69H 5B1AH 1OCRH 5IY5H 3AG3H 2DYRH 5B3SH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO H;  3AG4 H;  2ZXW H;  3ASN H;  3WG7 H;  3AG1 H;  2EIN H;  2OCC H;  3ABM H;  3ABK H;  1V55 H;  3X2Q H;  1OCZ H;  2DYS H;  3ABL H;  2EIM H;  3AG2 H;  5B1B H;  2EIJ H;  2EIK H;  2EIL H;  1V54 H;  1OCC H;  3ASO H;  2Y69 H;  5B1A H;  1OCR H;  5IY5 H;  3AG3 H;  2DYR H;  5B3S H; 
#chains in the Genus database with same CATH topology
 2GWR A;  1IN8 A;  1UG0 A;  1QGP A;  3OYI A;  4S0H B;  4HLY A;  3N97 A;  4KT6 A;  4M6V A;  2NRA C;  3ASN H;  1Z7L A;  2CG4 A;  1XGN A;  1XCV A;  4ZH4 F;  3AL0 C;  3GCM A;  4ESB A;  2STT A;  1ZGA A;  4G6T B;  5M5W J;  2IS1 A;  3HPH A;  1JHH A;  4G7H F;  3H35 A;  4MEX F;  3K2Z A;  4CO8 A;  1QPM A;  2A5W A;  4DGW B;  4M73 A;  2X6X A;  4KNY A;  5TGT A;  4OMY A;  2CQ7 A;  2DTR A;  2DK5 A;  2P5V A;  1J5Y A;  3T1B A;  2EZL A;  2EFQ A;  4BEH A;  5EDN A;  2G0E A;  1SD4 A;  2ELH A;  1XS9 A;  1KU9 A;  2M8E A;  5TRD A;  1H9T A;  3M3Y J;  1ZLJ A;  5DEQ A;  2VJJ A;  4ZYG A;  1I5Z A;  1IV8 A;  2N8G A;  3OYG A;  1O3R A;  1ZAR A;  3H5R A;  1PVE A;  1R36 A;  2QA4 I;  4R8H A;  1ON1 A;  5J1U A;  1ZLK A;  3DKY A;  3ZN0 A;  1YW9 A;  3G1M A;  3O6B B;  3BQZ A;  2PMU A;  4N4O B;  3SYT A;  1R71 A;  3G3Z A;  3CCR I;  3E5Q A;  4B3X A;  5IP6 A;  1DQU A;  1B1B A;  2VJI A;  3D0S A;  5CVR A;  4MGR A;  2XF7 A;  2EIN H;  3HRU A;  3HOU J;  1HST A;  1RUO A;  3KET A;  2M30 A;  1VQN I;  1NG6 A;  3F72 A;  2HDW A;  4Q4Z F;  2JTV A;  4BEH B;  2EFW A;  4CGZ A;  4ENK A;  3LOC A;  1PDN C;  3HBL A;  1ETK A;  4HA8 A;  1Z67 A;  3HXL A;  3OWT A;  5E1Z B;  4RAY A;  5F1R A;  4RDU A;  1D3Y A;  2FSW A;  4RLQ A;  2P7C B;  2KIU A;  1IRX A;  1NTC A;  2O03 A;  3TP3 A;  1P6R A;  5IP9 J;  3CDL A;  2MG4 A;  2X6W A;  1K6O A;  2HYJ A;  2KRH A;  2KZV A;  2Y31 A;  1ODD A;  3K4M A;  2DDA A;  5L3F A;  2VPL A;  2Q8K A;  5EEG A;  4D9J A;  1FPQ A;  3IH3 A;  4I02 A;  1LFB A;  2W25 A;  3CC7 I;  3CD6 I;  1UFM A;  3MZ8 A;  4XRM A;  1TTY A;  3CLQ A;  3CZ6 A;  4Y15 A;  3WE2 A;  5BMZ A;  3DEU A;  1WH7 A;  4I2O A;  3SZG A;  1YO5 C;  2L9V A;  3F6O A;  3DU6 A;  3BG3 A;  3CUQ C;  2L2O A;  3RKQ A;  5E3M A;  1HKT A;  3WU1 B;  1FT9 A;  5L3B A;  2CW7 A;  4HX8 A;  3COA C;  3M1E A;  3RDI A;  1QA6 A;  3DKX A;  3QYF A;  3MCZ A;  3I64 A;  2IGO A;  4KMF A;  2A68 F;  2HQ5 A;  4IHX A;  4C9Y A;  4XLC A;  3BTI A;  3GFI A;  1A35 A;  1X4O A;  4XLN F;  4BQQ A;  1VTN C;  1YOV B;  2IA0 A;  2M0M A;  3U1D A;  3PIP F;  1USS A;  2EZK A;  2LD5 A;  4I0B A;  2EFO A;  4ZDL A;  2DMT A;  2D45 A;  4FE7 A;  2XGC A;  4D7N A;  2VQC A;  2ELK A;  3VOD A;  3K1N A;  3OYN A;  1OCZ H;  3T5X A;  2R5Z A;  4FX0 A;  3PUF A;  2OA4 A;  1YQA A;  2XRN A;  2LY9 A;  3PSI A;  3BG9 A;  3FMS A;  1PJR A;  2Z2S B;  4V2G A;  1KZH A;  4LLN A;  1EF4 A;  3FXR A;  4XOT A;  3ESW B;  3IRR A;  1VI0 A;  1ETW A;  2V1D A;  5GP9 A;  5HDG A;  5LGN A;  2OUM A;  2XGX A;  1T08 B;  3BZ6 A;  3CCL I;  2NVT J;  4GGG A;  3BZK A;  2WY7 Q;  2NAZ A;  2Y9Y A;  1ZN2 A;  2GOX B;  1MD0 A;  4LGW A;  4Y4R A;  2R7V A;  4HDU A;  1O7L A;  2LYC A;  1ZG3 A;  3JRH A;  5TIS C;  4K2E A;  4HX7 A;  4H4K C;  1MH3 A;  4CYC A;  1SMY F;  2PMZ N;  3I59 B;  1YJW I;  1Z21 A;  2DAO A;  2WTE A;  4V2F A;  1BI0 A;  1OCT C;  2O8X A;  3P9C A;  1LNW A;  2F6C A;  1IXC A;  1HC8 A;  3S17 J;  2PLY A;  3T8R A;  2ZXJ A;  3G2B A;  1MMN A;  4EAT A;  2VQL A;  4HNT A;  4PSW A;  4P1W A;  4HW0 A;  2LTP A;  2F4M B;  3J7Z I;  4UVA A;  3HRT A;  5EF6 A;  4R1H A;  2LMD A;  5H2F C;  4FT8 A;  3KP7 A;  1XGO A;  4MLO A;  1ZR4 A;  3RIR A;  2B9S A;  4ZYA A;  2ZXW H;  2FRH A;  3TL4 X;  1DP7 P;  1U5T B;  1TWH J;  1BW5 A;  2GA2 A;  4CYC B;  2LY1 A;  1J7K A;  4HSR A;  4PK4 A;  2WY8 Q;  1GXQ A;  3S15 J;  2L54 A;  3HTU A;  1A36 A;  6PAX A;  1TP4 A;  4MFD A;  1Y1W J;  2CW8 A;  4CZC A;  5L3G A;  1DP3 A;  5FKM A;  3W6J B;  4ESF A;  4Z6Y A;  1CGP A;  1F1Z A;  3F9K A;  1LDD A;  2CS3 A;  2VKE A;  3FBN B;  2A05 A;  2A6T A;  1J75 A;  2HDD A;  1LJ9 A;  3FMR A;  1HA8 A;  1SVL A;  4PJL A;  1ACI A;  1S9H A;  2H6C A;  1R23 A;  4XLH A;  3J7Y J;  1A31 A;  1O3T A;  4BDZ A;  2Z1D A;  2FU4 A;  3JAM K;  2AHQ A;  2GBY A;  2P8T A;  3ABK H;  3B6C A;  5CPR B;  4LG3 A;  3CCJ I;  2VOP A;  4NQW A;  1RI7 A;  1P4W A;  2W24 A;  4P96 A;  1KU3 A;  3FM3 A;  2F5E A;  2K9L A;  5IY5 H;  4UVB A;  4AVZ A;  3DLL F;  3ZQG A;  2XAG A;  3ZN1 A;  3WTY C;  2H8R A;  2HEO A;  3I71 A;  3B73 A;  3OL4 A;  2F5F A;  1M1E B;  4B43 A;  4Q5S F;  1G3W A;  1WVR A;  2MFZ A;  3BCA A;  4IL6 C;  3KPH A;  3KIO A;  3EUH A;  3K1P A;  3OMY A;  3FX3 A;  3RKW A;  5FD6 A;  1GV2 A;  1Z0X A;  3M8E A;  3M07 A;  2WB1 A;  3IC7 A;  5BQT A;  3ZP5 A;  4IQ4 A;  2BY0 A;  3FK7 A;  3GZ6 A;  2VBY A;  2DK8 A;  2CQN A;  3H92 A;  3RTR A;  4IVN A;  2IPQ X;  1SD7 A;  2VBW A;  1SMT A;  3FIS A;  1REP C;  1I1S A;  3GFL A;  2M0C A;  1YIO A;  1U78 A;  1ETV A;  4NQW B;  5LFA A;  1VQK I;  4V19 K;  3GTQ J;  2DOF A;  3U2R A;  3SEZ A;  3F6V A;  1RIO H;  2BEO A;  2O7O A;  1IZ1 A;  5GPA A;  2L7K A;  1AA7 A;  2FJ1 A;  3DF8 A;  3OIP A;  1SVO A;  1Q1H A;  2A6H F;  4FAS D;  3HSR A;  1TLH B;  2E5N A;  1TZL A;  3BR1 A;  1STZ A;  1UJ8 A;  2BY1 A;  2L01 A;  2UXX A;  2WBM A;  2JZY A;  3T8T A;  3JSO A;  1UCR A;  5IPA A;  1OCR H;  1XMK A;  2Q1Z B;  2JRT A;  2VE9 A;  3S1N J;  3QP6 A;  4LLL A;  4A2U A;  4CZZ A;  3S2H J;  3F3X A;  2HWV A;  1ZYR F;  5GAD J;  1KYZ A;  2LRD A;  3JCU C;  3KZI C;  4F92 B;  2P6S A;  3ZQL A;  1X1A A;  3GF2 A;  4OMZ A;  2JA2 A;  3Q0V A;  3BTJ A;  4PGH A;  4UVC A;  4C3I J;  3KLO A;  4DW6 A;  1WH5 A;  5JR3 A;  2UWM A;  1LUJ B;  3ZQF A;  3E6B A;  3OYJ A;  3IKT A;  1J09 A;  2F5D A;  2OC6 A;  5FRO A;  3VSK A;  3C7J A;  2DA7 A;  1BIB A;  3L2C A;  2CRG A;  3DBR B;  3DKW A;  1JKO C;  2HDC A;  2DT5 A;  5EZH A;  2WV1 A;  2CU7 A;  5H6R A;  2DFE A;  3DV8 A;  3Q3S A;  3TP0 A;  3LSJ A;  4JBA A;  1R5G A;  2Z33 A;  2VOO A;  1RUN A;  3OIO A;  2FQ4 A;  1R1V A;  1XB4 A;  3W2W A;  4A0X A;  1GUU A;  3S1Q J;  2KRC A;  4RGU A;  2QM3 A;  2VQH A;  2VIX A;  3A02 A;  1FIA A;  4JOM A;  3K0L A;  2A69 F;  2L7F P;  4M3D A;  1AKH A;  4C2U A;  2ZXI A;  1LVA A;  2G7H A;  2LKP A;  1VQ5 I;  2EZI A;  4XKW A;  1WZ2 A;  3SZT A;  4HF1 A;  1LB2 A;  5K1Y A;  1KYW A;  2M7A A;  5DDG A;  5KAF C;  3HYI A;  4HV5 A;  4HNU A;  5D5V B;  2VT2 A;  5K7H A;  3MKL A;  2H94 A;  2B63 J;  2YU9 J;  4RGX A;  5IYC J;  1IGN A;  3BLY A;  4M9S A;  2X1E A;  2OU2 A;  1W4M A;  1ETY A;  3OL3 A;  1U9O A;  2W57 A;  3LAP A;  4BAC A;  2VC0 A;  4QSH A;  3LAJ A;  1S29 A;  4A3L J;  3KE2 A;  3L7W A;  3H3V K;  4A0Z A;  4AVP A;  2IW5 A;  3P5J A;  4UUS B;  3F22 A;  1MBH A;  3E97 A;  2CUJ A;  1TT5 B;  3P7N A;  5H6Q A;  2CFO A;  2WAF A;  2ZB9 A;  4L0Z B;  4E6K G;  3C3W A;  3CF5 F;  2W7N A;  5LBQ A;  4CA0 A;  5FFZ A;  2LH9 A;  4KN4 X;  1AKH B;  3AG2 H;  2ZJQ F;  4TV7 A;  3GFJ A;  4HQE A;  2FNP A;  1T33 A;  4A12 A;  1CQT A;  1OIS A;  2GM4 A;  5CYV A;  2BVL A;  4KN7 X;  5E3O A;  1Z1D A;  4PDK A;  5E1W A;  3CES A;  1XC5 A;  1U0J A;  2BHY A;  4XMY A;  3O8G A;  3I56 I;  2ESH A;  2IVM A;  3GTP J;  2ID6 A;  3ZMT A;  3W6V A;  1QZE A;  4I99 C;  3DQV C;  2KLO A;  1DU6 A;  3J81 K;  2KIQ A;  3ZQ7 A;  1T95 A;  5KVR A;  3BR6 A;  1W5S A;  1POG A;  4KIB A;  2K9S A;  1E3O C;  2L9R A;  3DPU A;  1SFK A;  3OR1 C;  1K79 A;  3UR3 C;  1VND A;  2ZSH B;  4CSW A;  2EIK H;  2EIL H;  2F4O B;  5KHD A;  3ZPL A;  3RQI A;  1HBX G;  5J8F A;  1ITY A;  3DTI A;  2HVR A;  1Z6R A;  4M74 A;  4E70 A;  3HRS A;  4I01 A;  2L02 A;  3ZCO A;  4L5J A;  2VLA A;  3FF5 A;  4CIC A;  2BOL A;  2X6O A;  4RM3 A;  4YFK F;  4E7K A;  3J80 K;  2HPM A;  5E1X A;  2IT0 A;  2JMW A;  4O6J A;  1N75 A;  2DA5 A;  2GIZ A;  4MTD A;  1R9T J;  4XRS G;  2R7D A;  1XG1 A;  2QWW A;  5M5X J;  1D8K A;  3ULQ B;  1SFX A;  3BG6 A;  2J5O A;  4WXC A;  3AKZ A;  1R5I D;  4I6Z A;  2O9L A;  3R61 A;  1I6H J;  4KFC A;  4N9I A;  4U7B A;  3CP2 A;  2L4A A;  4JP0 A;  1WHU A;  2PX9 A;  1ZHF A;  2E60 A;  2VXZ A;  4QWQ A;  1KA8 A;  1MIJ A;  1ETX A;  5LLQ A;  1PP7 U;  5K7F A;  5B66 C;  4LK1 F;  3EQL F;  4PJJ A;  1JUP A;  3L2W A;  5IP7 J;  2E35 A;  2ETH A;  1F36 A;  2KDO A;  5D8K B;  2M45 A;  3HOY J;  3BJA A;  3DEE A;  2OCC H;  4NC7 A;  3CJR B;  3JRF A;  4YFN F;  1SAN A;  2TDX A;  3ABL H;  2K27 A;  3QOE A;  2KKO A;  1OLT A;  3LA7 A;  1YS6 A;  1LDJ A;  3OOP A;  4RAZ A;  2UUZ A;  1RET A;  2L9S A;  3GLX A;  3E7L A;  1B6A A;  2DI3 A;  4XK4 A;  2DCE A;  2HQA A;  1LFP A;  1T6S A;  4RGR A;  2Y9Z A;  1J0R A;  1O57 A;  3PFI A;  1P7I A;  5HOD A;  3BG5 A;  3CCQ I;  2IRF G;  3N4M A;  2EJR A;  1ETO A;  4EGY A;  4EJT A;  4CUG A;  3FXK A;  3A0H C;  4CH7 A;  2R93 J;  2KDZ A;  3QQA A;  2OF7 A;  4A6E A;  5J1R A;  3SJM A;  5DTD A;  4IRH A;  1X1B A;  1VQ9 I;  1R6R A;  1UHM A;  3K1M A;  3E6M A;  1X3U A;  2PEX A;  4DYC A;  1Q1V A;  5EEH A;  3FXL A;  1R22 A;  2XPW A;  5FLM J;  2CV0 A;  4UB8 C;  5E3N A;  1HSJ A;  1VQM I;  4RB3 C;  5IOZ A;  3CF2 A;  1OQY A;  3AFH A;  4M9X A;  1T2K A;  1RKW A;  2DN0 A;  4G12 A;  4JQF A;  5BPI A;  1H9G A;  1KGS A;  2GLO A;  4DBQ A;  4NHJ A;  1D5V A;  3OOU A;  3CCY A;  1TBX A;  1LDK B;  3ZMZ A;  4GYI A;  2IGN A;  4RGS A;  3F8M A;  2NVQ J;  5F64 A;  1ONV A;  1FSH A;  2Y0M A;  4ENJ A;  1OCC H;  1SD5 A;  1IAW A;  1BJA A;  3PM1 A;  4XNF A;  3N05 A;  1RR8 C;  2XGD A;  3ELK A;  1P4X A;  2JUG A;  2E19 A;  4N0B A;  1XSX A;  5EYR A;  2VOD A;  1Z05 A;  1MKM A;  3UKG A;  4YEL A;  2ZSI B;  2M3A A;  2DMU A;  2P5L C;  1G4D A;  1G8X A;  1FBS A;  1S7A A;  2P6T A;  1P7J A;  4PJN A;  2FBI A;  4XIC A;  5DD4 A;  1ZRF A;  5A2Q K;  5GAH J;  3F8F A;  4KDP A;  4X0G A;  2CQX A;  3K7A J;  3KX2 A;  4BGD A;  1YTY A;  4MO7 A;  2V1N A;  1N25 A;  5LD2 C;  4UHT A;  3CCS I;  2X85 A;  2DFI A;  3ERE D;  4WK8 F;  1SVM A;  4ON0 A;  4AM3 A;  4HOB A;  3RKY A;  2E1O A;  1E3H A;  3FBI B;  2EV0 A;  4P55 A;  4BJ5 C;  1YJN I;  2HFH A;  5D5X B;  1HKS A;  2MH9 A;  1U3E M;  3TDU C;  4BHP A;  1WJ5 A;  4IQJ A;  2VXD A;  1BJZ A;  4IJA A;  4U0V A;  4EGZ A;  3D5L A;  2J5P A;  3CP8 A;  2VJ4 A;  1XX5 A;  4CCM A;  3KP2 A;  2R7O A;  4PCQ A;  2HOE A;  4GO1 A;  3E6C C;  3WGI A;  3K4N A;  3DPT A;  2JVG A;  1BW6 A;  1Y1V J;  2DQL A;  3CDH A;  2AQE A;  3NRV A;  4ETS A;  4ANJ A;  3QU6 A;  4WWC A;  3H0D A;  2DMQ A;  2QKM B;  1TNS A;  2XPU A;  2A3S A;  3WU2 C;  4QPQ A;  2HXI A;  1RC9 A;  2R92 J;  1WJD A;  4A3J J;  1VQ8 I;  4A3B J;  2Y30 A;  3KEQ A;  5FGM A;  3FM5 A;  1W5C C;  5HLI A;  2I10 A;  4XLP F;  3NQO A;  2Q2E A;  1V55 H;  3ZRG A;  3PO2 J;  3V7C A;  4XN0 A;  2QYO A;  2EIM H;  4PFO A;  4MTE A;  3B6A A;  2R7R A;  2V4J C;  3RKX A;  2K9N A;  2WAQ A;  4FHT A;  3HOS A;  3OS0 A;  4DYQ A;  2PBI A;  2W48 A;  3QPL A;  2K3P A;  3K70 D;  2O5R A;  5CVI A;  2XPV A;  1JI8 A;  3E6D A;  2Y48 A;  1BI2 A;  4HV6 A;  4EM1 A;  1JKP C;  3RSN A;  2Z16 A;  4F52 A;  2H1K A;  4DOZ A;  4OWR B;  2HQR A;  3GTK J;  5HS7 A;  2BXY A;  3OIQ A;  5BNG A;  3DXJ F;  1L0O C;  4UV8 A;  1UZC A;  2VC1 A;  2VB6 A;  3E5U A;  3MQ0 A;  2FBK A;  1X1P A;  1BR4 A;  2W4S A;  4CXF A;  1W0U A;  3M8F A;  1R1U A;  1K61 A;  2XAH A;  1DU0 A;  1R1T A;  3FDY A;  3G1O A;  3ASO H;  4ITV A;  1W7P A;  1W1W E;  1OKR A;  4RS8 A;  5E8G A;  5HDK A;  4L9N A;  5ICE A;  1F9N A;  2E71 A;  2AO9 A;  2KT0 A;  4Y33 A;  2XC7 A;  4B8X A;  1A6Q A;  2XAS A;  2Q2E B;  3E5X A;  2BE5 F;  4HZF A;  4BUP A;  1PYV A;  4AIK A;  2KIS A;  4KJZ A;  2CJJ A;  3PNV A;  2EWN A;  3QWL A;  4D7M A;  3H1C A;  2RQQ A;  5D4S A;  3J7A O;  3I55 I;  4W97 A;  4B1R A;  4C3J J;  3JRD A;  3ZOB A;  2QCO A;  4XKC A;  2E1M C;  4PZJ A;  1T0F A;  4WCG A;  3W2V A;  3O3K A;  4M3E A;  1UHW A;  3BR3 A;  4DNC A;  5M3F J;  1DUX C;  1BM9 A;  3LA3 A;  4U0W A;  1U2W A;  2W82 A;  4LOC A;  1FNN A;  4EJV A;  2EQR A;  3D5R C;  5CVU A;  3WHB A;  1XTA A;  1D0X A;  3EUA A;  3H9J A;  5FB2 A;  3CJQ B;  3ML6 A;  2OQR A;  1R00 A;  2EZH A;  3PQJ A;  4Y3O A;  5DCF A;  2DXI A;  1YFH A;  1QHH D;  3I59 A;  2L7Z A;  4IHW A;  5IT9 Z;  3A03 A;  3IKV A;  4IZZ A;  4AUX A;  2MC4 A;  3IL2 A;  1FEX A;  1W7P B;  1ZGJ A;  3M8J A;  4XQF A;  4BXX J;  2LSO A;  3V8L A;  5IOY A;  3WGH A;  3G73 A;  4DZP A;  4PSX A;  2OPT A;  2PQ8 A;  1J2X A;  1KON A;  3ZQQ A;  2DPD A;  2O6G E;  3JSP A;  1U6G A;  2NOJ B;  3GO5 A;  4I98 B;  3VYT B;  2ACJ A;  4XRS A;  2QQ9 A;  4RAF A;  2VJ5 A;  4RBO A;  2HOT A;  2FUG 2;  4AC0 A;  3OYH A;  4II2 A;  4N4N B;  1O3Q A;  3HHG A;  2DMP A;  2TRT A;  3ERM A;  2V6C A;  2HXO A;  3DU5 A;  2F5V A;  3OYK A;  3GZ5 A;  2L4M A;  1JTX A;  2KZG A;  3WTW C;  2ZFW A;  4KIG A;  2ZME C;  2DA3 A;  3L2Q A;  3WGG A;  3TGN A;  1HCR A;  1WJF A;  4IF4 A;  1U5T A;  4KT5 C;  3JRI A;  2ZNZ A;  4YII A;  1GV5 A;  3LWF A;  1YIT I;  2R7T A;  5C4X J;  1H88 C;  1TWA J;  4WF2 A;  1VQ4 I;  3ZQC A;  3D5S C;  1GVJ A;  1WJB A;  3WHC A;  1KU2 A;  4ZTF A;  4UUV A;  3PNT A;  1KU7 A;  3OY9 A;  3MZY A;  1NK3 P;  3GTG J;  3CCV I;  2GQQ A;  4GCV A;  4IEJ A;  4XSZ F;  3IWF A;  3PJR A;  1BN5 A;  2VL8 A;  1MBG A;  3HC7 A;  2LRE A;  5HNH A;  4IOC F;  5L3E A;  1FZP B;  1R5H A;  3MN2 A;  1PP8 F;  3OYA A;  1JJ8 C;  2P4W A;  3H5N A;  5FLX K;  3BDD A;  2LBF A;  3H9Q A;  1KQ8 A;  1R4N B;  3WU0 A;  1YHQ I;  1V4R A;  2XRL A;  2V9P A;  4AIH A;  5IYB J;  2MC3 A;  3WG9 A;  4N9H A;  3F21 A;  2PMH A;  1OCP A;  1FOK A;  2LY2 A;  3L00 A;  1IRZ A;  3BTC A;  3UNG C;  2DQR A;  4A3M J;  2YSR A;  2HYF A;  1FP1 D;  1ETQ A;  3KEY A;  1NH3 A;  1W7P D;  1G3S A;  5HLT A;  2MSY A;  3BR2 A;  5CVJ A;  1OMI A;  2Y69 H;  1XD7 A;  4BYY A;  4XL9 A;  5ERI A;  4C2T A;  2K85 A;  1BA5 A;  2VI6 A;  1UMQ A;  1Z9C A;  3TDZ C;  1W0T A;  1LE8 A;  2JA5 J;  1MBF A;  1D8J A;  2P81 A;  1VQ7 I;  2H1L A;  2Q0O A;  2DT6 A;  4FCY A;  2TCT A;  2HVS A;  2XUB A;  1V5E A;  2HVQ A;  3FXJ A;  3RQ4 A;  2VT3 A;  3E1S A;  2LDU A;  3SQN A;  3OS2 A;  2HTS A;  2RV8 A;  3M7G A;  3TO6 A;  2BBY A;  1KQ0 A;  1WJC A;  3PUB A;  5J4V A;  3ZMD A;  5J1Y A;  2LBF B;  3JRG A;  1ZRE A;  1G2H A;  5K5Q A;  4EQQ A;  3VPR A;  2RC4 A;  4HAM A;  1HDD C;  4GRI A;  3V4G A;  2LKX A;  5EJC A;  2QEN A;  1MNM C;  1X2N A;  4MHG A;  1DGR M;  2XAF A;  4BKX A;  5K5R A;  2QF7 A;  2CFX A;  5F0C A;  2DYR H;  2IBD A;  2OV7 A;  3AAF A;  1WSU A;  4XON A;  4KIF A;  2QQB A;  2RN7 A;  2E2J J;  4HX4 A;  2ISZ A;  2BHZ A;  2E36 A;  3C18 A;  4F7Z A;  4ESJ A;  5E18 F;  1BBY A;  2VON A;  3HIF A;  1MMS A;  4ZDO A;  2K40 A;  2FOW A;  3H3U A;  1TWG J;  2WAQ N;  5F0F A;  1X1D A;  2OQG A;  1LE8 B;  3MEX A;  2V9V A;  3LFU A;  1ZTR A;  1SAX A;  4JX5 A;  5EG0 A;  4BDY A;  2VKH A;  1R4M B;  2RQP A;  4FTH A;  3GLL A;  1Z77 A;  4PUS A;  3CCE I;  2JWT A;  1MBE A;  1SC7 A;  4NUB A;  3LSP A;  1I3A A;  5CJ9 A;  2HR3 A;  5FRN A;  5C44 J;  4IXA A;  3OYE A;  1LEA A;  1RR7 A;  4BBR J;  3GZN B;  2K5C A;  4RMN A;  1TT0 A;  3TO7 A;  2DYS H;  4PFP A;  5FO5 A;  3OYL A;  2Z99 A;  2YU3 A;  3PNY A;  2BV6 A;  4EMS A;  2XF6 A;  5DCM A;  2DA2 A;  5AIP A;  2HTJ A;  3ZMU A;  3DWL E;  5GAE J;  1YX5 A;  1JHF A;  5D4R A;  3CC2 I;  2CUE A;  4RA2 A;  4BU2 A;  5FKL A;  2H27 A;  5F08 A;  5EG0 B;  3H9G A;  3K9T A;  4EEF G;  3LA2 A;  3LSM A;  4EJO A;  2DDB A;  4F91 B;  1I1G A;  3DEW A;  1XDS A;  5HVQ C;  2I5U A;  1G6N A;  2CUZ A;  3VYU B;  2NVU B;  2AXL A;  3NAU A;  2YR2 A;  2YX7 A;  2CUF A;  1O7F A;  1PUE E;  3BR5 A;  4M3F A;  4EM0 B;  1IN4 A;  3A01 A;  2X4H A;  5FFX A;  1WKM A;  3TO9 A;  1VF9 A;  3KYD B;  5E3L A;  1EKE A;  4F93 B;  3AL0 B;  2NNN A;  1YYV A;  1A5J A;  2ICW G;  1MMA A;  1R49 A;  1O4X A;  4G8X A;  2D1V A;  2Y2Z A;  2MD0 A;  4BE0 A;  2IEK A;  1WGX A;  4UUS A;  5DCM B;  2HKX A;  1B8I A;  1OYI A;  2GXG A;  4OIQ F;  2EBI A;  1Z6T A;  1VQ6 I;  1W36 D;  1MNE A;  3FXM A;  1H89 C;  1G59 A;  1FBQ A;  3BP8 A;  4BXF A;  5HOO A;  1DPU A;  2A61 A;  2OBP A;  1IRF A;  3VEP A;  1E3P A;  2Z5U A;  1OFC X;  1UG2 A;  2K4B A;  3JRE A;  2ZBK A;  1FYK A;  3EET A;  4BHB A;  3A01 B;  4G7O F;  2MLK A;  5J3L A;  1XMX A;  2LC2 A;  2OTL I;  2LK2 A;  1ZR2 A;  2GAU A;  4IPA A;  2E34 A;  2XIG A;  5BS6 A;  2MGQ A;  3Q0W A;  1TW2 A;  1V54 H;  2HS5 A;  1GHC A;  2P0W A;  2UV1 A;  4L9V A;  1K78 A;  2K4J A;  1FOW A;  1MJA A;  2R3S A;  1TQM A;  1ZQ3 P;  2RVC A;  2X1C A;  3A0B C;  5GAG J;  2MAB A;  1T8I A;  1X19 A;  1H0M A;  1C0W A;  3O2P E;  1B8I B;  3WTZ A;  3S32 A;  5EZG A;  3EYY A;  4M3G A;  1XGM A;  2VKV A;  3CUQ A;  3BZC A;  1IG7 A;  3QPH A;  4Y17 A;  4F55 A;  2W84 A;  3CDI A;  1TWC J;  4BAY A;  4UXN A;  2H8W A;  4G6D A;  2D2W A;  2ME6 A;  3TBI A;  5FKK A;  2CQK A;  2X48 A;  3FWE A;  3K4J A;  1MDM A;  1EA3 A;  2DW4 A;  5LHH A;  2EFP A;  3V8K A;  2V79 A;  4OAY A;  4E7H A;  4LG0 A;  1EH7 A;  1XPX A;  1AU7 A;  1TWF J;  2VN2 A;  3QYE A;  4BNC A;  1BOA A;  1VQP I;  3SXY A;  3GX4 X;  1Y56 A;  4J00 A;  1K78 B;  1D1A A;  4KIT B;  4IHT A;  4A5N A;  4CCN A;  3J7A Y;  2V1X A;  3ECO A;  2BY2 A;  3BG7 A;  4ZYE A;  2CW0 F;  4S05 A;  2RNJ A;  5D5U B;  2EIJ H;  2DJN A;  5HDN A;  4A5M A;  3OR2 C;  3VSL A;  2AQF A;  2DFH A;  3JR9 A;  2NS8 A;  5B1A H;  2QQA A;  2CV1 A;  1TQP A;  5M5Y J;  2DO7 A;  4FX4 A;  1GVD A;  1ZG1 A;  1NK2 P;  5HS8 A;  3CUQ B;  1BIA A;  1P2F A;  3A2K A;  5JLX A;  2ZNY A;  3LSG A;  2OAZ A;  4DBR A;  2R5Y A;  2VAS A;  4KA4 A;  3HUG A;  3KP3 A;  2X9D A;  1FIP A;  4A3G J;  1LVK A;  1VZ0 A;  3CMM A;  1IRG A;  4XN3 A;  1HF0 A;  1U5T C;  1IF1 A;  3BWG A;  1MDM B;  3BPV A;  5DUK A;  2KIM A;  4WX9 A;  4FQG A;  5LGT A;  4LG0 B;  3V8J A;  4NB5 A;  3MVP A;  2ESN A;  1FC3 A;  4NC8 A;  1MBK A;  2FX0 A;  2VE8 A;  5BPD A;  1F4K A;  3SHF A;  1BC8 C;  2KPM A;  4ASN A;  2VQG A;  5F04 A;  5FLV A;  2L9N A;  3W3C A;  1S72 I;  3R60 A;  2E2H J;  3RYP A;  1XGS A;  1GT0 C;  4B09 A;  1BOB A;  2QQ8 A;  1VFC A;  2FXA A;  1I39 A;  3IH4 A;  2MBF A;  5KAI C;  1JGG A;  2WB1 N;  1QU3 A;  4OIO F;  1D1B A;  1RRJ A;  4OIP F;  3SZP A;  3HRM A;  5C3E J;  3FXU A;  2V6E A;  4A3C J;  3ZMV A;  3G4S I;  5IYD J;  1E0E A;  3JAM Z;  2F5C A;  2V26 A;  2CMP A;  4A3D J;  3S93 A;  5DM6 F;  2R5Y B;  2RNG A;  3U21 A;  3HUG B;  3TED A;  1ULY A;  2HGC A;  4NBQ A;  1JKR C;  3RYR A;  4HRI A;  3DPL C;  1BL0 A;  1MJ9 A;  2ZJP F;  5ILS A;  3ABU A;  3L2R A;  3HOX J;  2O8K A;  1JKQ C;  3FK6 A;  2MLG A;  1A6I A;  5CQE A;  4IHS A;  4LD5 A;  3P9K A;  1ZGW A;  4LLG F;  1LFU P;  1W36 C;  4J19 A;  3VOE A;  1DGW Y;  1WWX A;  3I3L A;  1SEU A;  2FQ3 A;  2Y75 A;  1H8A C;  3KYL A;  2XVC A;  3AG4 H;  5JVG F;  3L09 A;  1V5G A;  4DYR A;  5E17 F;  3BJ6 A;  4C30 A;  3CCM I;  5KCM A;  2IS4 A;  3VYS B;  4NNJ A;  4HEA 2;  3AG1 H;  2OD5 A;  3I9V 2;  3ZMS A;  1X3W B;  2R7S A;  2XV4 S;  1SAU A;  2XAJ A;  4JX4 A;  3ABM H;  1T98 A;  3REO A;  3S3M A;  3IWZ A;  1U8B A;  1BI1 A;  3S2W A;  3QPS A;  2DU9 A;  1B59 A;  1B72 A;  3A1Y A;  3TW6 A;  4L5I A;  3KLN A;  1D1C A;  2XKP A;  1GLN A;  2YX4 A;  3PFY A;  3QOP A;  4FE4 A;  3HOT A;  2EA2 A;  2RRE A;  1EH6 A;  4M71 A;  3F23 A;  1RZ4 A;  5AON A;  4DZJ A;  4FET A;  2XAU A;  3LFK A;  4HLX A;  4RB2 C;  2K3F A;  4U0Y A;  3EUH C;  1ZRD A;  1IDY A;  2EB7 A;  2NS0 A;  3BR0 A;  4ENM A;  2YPR A;  2JSC A;  1YW7 A;  5DUI A;  3GBG A;  4L9T A;  3I5U A;  4KUM A;  1FY7 A;  2WAE A;  4A93 J;  1L3L A;  1T39 A;  1XSD A;  2Y0S A;  2GZW A;  2DA1 A;  3KP4 A;  4BS9 A;  4YRV A;  2X6Y A;  4BBS J;  4U7D A;  3OYM A;  3MAJ A;  1I27 A;  1LPQ A;  4Y52 J;  1OCO H;  4C3H J;  5LEJ A;  3BRO A;  5LHG A;  1YX3 A;  5C4J J;  2YUS A;  3VDX A;  1QQI A;  2OZ6 A;  1WFX A;  1B72 B;  1K83 J;  1LKX A;  2FNA A;  2PFB A;  2KJC A;  3QU3 A;  1HW2 A;  1FYM A;  3ZXS A;  3I4N J;  1X3Z B;  2W00 A;  9ANT A;  2HKO A;  1Z3Y A;  2LP0 A;  3G1L A;  5D5W B;  3CC4 I;  2AXT C;  4AWX B;  2OCE A;  1IXR C;  2ZC2 A;  2QZ8 A;  3HKZ A;  5AIQ A;  1FJL A;  4CCK A;  5FKO A;  5E20 A;  4C2M J;  5JHU A;  4ABZ A;  2M8G X;  1J59 A;  1V5F A;  2DT7 B;  3BPX A;  4XBF A;  1ZH5 A;  3HM5 A;  2FOK A;  2HQN A;  4XLE A;  3MZH A;  1MND A;  3GUD A;  1IDZ A;  2E7W A;  2HPI A;  3WTT C;  4PJM A;  4YEJ A;  2XB5 A;  5L3C A;  2CH0 A;  4E7L A;  3QRF F;  2W1O A;  3FXQ A;  4U87 A;  3E3V A;  5F27 A;  4BY7 J;  1I6X A;  2KHM A;  3W2A A;  1JT0 A;  3WTX C;  4DQ2 A;  3SDG A;  2ECC A;  3HHH A;  1QHG A;  2M87 A;  1IO2 A;  3F8B A;  3CMA I;  3RZD J;  3DP7 A;  2F48 A;  3H36 A;  2BXZ A;  3QAH A;  2QGU A;  4E7Z A;  1MBJ A;  3O8H A;  1QNT A;  4L9J A;  2JQ7 A;  1IV6 A;  2D5V A;  3LSR A;  1JTY A;  1S7O A;  4QPO A;  3VB2 A;  4F3Q A;  3HTS B;  1IXS B;  2X51 A;  3I0T A;  4R79 A;  3S16 J;  2BGC A;  2PI0 A;  3NEU A;  1FOX A;  2RDP A;  1QZZ A;  5M3M J;  3I4M J;  3S1M J;  5HS9 A;  3L9F A;  2FMY A;  3TKY A;  2DJI A;  4EJW A;  3RPU A;  1JUS A;  5EGO A;  3C2H A;  4UY8 I;  1QVT A;  2ZKZ A;  2EK5 A;  3K10 A;  2IGK A;  1B9N A;  3CO6 C;  3LST A;  3HGY A;  2O0Y A;  2JPC A;  2JUC A;  2NS7 A;  1MSE C;  1WJA A;  3SFI A;  3Q9V A;  5DYM A;  3TOB A;  1UEL B;  4QLC U;  4KIS A;  1LQ1 A;  2STW A;  2V1U A;  1D5Y A;  3J81 Z;  3S14 J;  2VPR A;  1AWC A;  4YFX F;  4DIQ A;  5J40 A;  2R0Q C;  2E1C A;  2DA6 A;  1FOY A;  3F8N A;  2BYV E;  5HLH A;  3HOW J;  1X2M A;  3MWM A;  2KQR A;  2ADU A;  4UB6 C;  2BW3 A;  3Q0U A;  4RLF A;  3GFM A;  2R7F A;  4BJT A;  3K4L A;  3LL7 A;  2Z9O A;  4HDV A;  2UZK A;  4A0Y A;  2XRO A;  4D5C A;  2MD5 A;  4Q47 A;  5ILU A;  5EGO B;  1IUY A;  2MA3 A;  1MW7 A;  2VBX A;  2LF8 A;  1LEB A;  1FP2 A;  3WTV C;  4ZDP A;  3J80 Z;  3T0Y A;  4MIM A;  2JA8 J;  4BQO A;  3M4O J;  3JTG A;  2BY3 A;  2H09 A;  4QIW N;  3CUO A;  2KP6 A;  4G9Y A;  2GA1 A;  2QVO A;  3DBH B;  5E79 C;  5K5O A;  2ECB A;  1S7E A;  1JE8 A;  1EV7 A;  1MZB A;  4P5O A;  3GW2 A;  2ZJ2 A;  1QO0 D;  4A3E J;  2IGM A;  1P4A A;  1UST A;  1YE9 A;  2GIV A;  3FHZ A;  2K86 A;  4LFU A;  1Y8Q B;  5J4Y A;  4Y13 A;  1VQL I;  4G94 A;  3L1P A;  2K02 A;  3JTH A;  3CJT B;  1NG7 A;  1Y0U A;  3NWT A;  2EFN A;  4IHY A;  2O3F A;  3GTM J;  1S6L A;  2BW3 B;  3H0G J;  3GTO J;  5K7Z A;  2HYG D;  2IJL A;  3S1R J;  1F5T A;  3BOQ A;  1IN7 A;  1B4A A;  4MEY F;  4CCO A;  4LIV A;  2CGP A;  5ED4 A;  2DA4 A;  2IXS A;  4XOP A;  2CQQ A;  1HLV A;  3HDD A;  2HNH A;  2LG4 A;  2R7Z J;  3FIW A;  3H5A A;  2RKH A;  3E0J B;  1ZKG A;  1QVU A;  1T56 A;  2XKO A;  4ZC3 A;  1MSF C;  2IA1 A;  3WG7 H;  2LNB A;  2K9Q A;  4NC6 A;  3DTK A;  4XSX F;  5CLS A;  3WOD F;  2QEX I;  4CCJ A;  1YS7 A;  3EDP A;  3B02 A;  3ZR8 X;  4JYK A;  2QLZ A;  4FIS A;  3BC8 A;  3HJE A;  3WE3 A;  5JFR A;  5GTI C;  1FMW A;  4HF2 A;  4M9Z A;  1CF7 A;  2OTJ I;  2WWY A;  2ZFU A;  3CME I;  2F4I A;  1Y8R B;  1B9M A;  3CLO A;  4LJZ F;  3V7R A;  4AYB A;  2R5Z B;  1MGT A;  3GVA A;  4M3B A;  2JA6 J;  3GTL J;  4CHU A;  4D5F A;  1FSE A;  2WAD A;  2Y0S N;  3TOA A;  4E7J A;  1IUF A;  4Z2Y A;  3R0A A;  1JXS A;  4BXU A;  2M4G A;  3VYR B;  3IV5 A;  2JT1 A;  1R7J A;  5H20 A;  3OYD A;  1S5L C;  2M4K A;  3RPU D;  3TQN A;  5JLW A;  4OOI A;  5B1B H;  1SD6 A;  2GXA A;  2PG4 A;  3HGG A;  3WTU C;  2NVX J;  3K6G A;  2KMU A;  1YG2 A;  1WPK A;  1S8N A;  2XSD C;  2V9K A;  1RES A;  3K70 C;  5DD8 A;  1Z7U A;  1XSV A;  3HG9 A;  1N78 A;  2X0L A;  4O3M A;  5F1J A;  3I54 A;  3LQR A;  5FKN A;  3K2A A;  3BT9 A;  5J47 A;  4PGG A;  3HPG A;  3EPZ A;  3I53 A;  2E1N A;  3R0J A;  4EV0 A;  3R6S A;  1FX7 A;  1SFE A;  2XF5 A;  3HKZ N;  1CF7 B;  2JPB A;  4G7Z F;  1UB9 A;  1ZG5 A;  4B48 A;  2ISY A;  4X6A J;  2NOG A;  3TMO A;  1FLI A;  2HU9 A;  1AHD P;  5A2Q Z;  2B0L A;  4I09 A;  2PN6 A;  2YS9 A;  1J9I A;  3AG3 H;  1IN5 A;  5L3D A;  4LB6 B;  4BHC A;  2R7X A;  1ZK8 A;  1I3Q J;  2FEZ A;  1Y39 A;  1SFO J;  4RAG A;  2R7U A;  3HL2 A;  2M9H A;  4P9F A;  4XID A;  2KL4 A;  1HOM A;  1G3Y A;  2JK3 A;  3CMY A;  1BC7 C;  2ZO4 A;  3IAS 2;  3TW7 A;  2EH3 A;  1YRN A;  3BJO A;  4YIF A;  4LB5 A;  1HXD A;  3JRC A;  1V3F A;  1OR7 A;  2VBZ A;  4RB1 A;  2JSP A;  3JW4 A;  4Y7N J;  1U9N A;  2PJR A;  2XSJ C;  5B3S H;  4ENN A;  1FMV A;  3WTS C;  2VUM J;  1QPI A;  3EYI A;  2OJE D;  4BJ6 C;  4AD9 A;  2M2E A;  1MH4 A;  4BE2 A;  3GME A;  1ENH A;  3OYF A;  3D1N I;  1BR1 A;  3OV8 A;  4RM2 A;  4JX6 A;  4X1E A;  4B3A A;  2B7E A;  5E8I A;  2CYY A;  3DBL B;  3DLA A;  5D6E A;  4AID A;  1ON2 A;  2LVS A;  1WRJ A;  2EA4 A;  4S04 A;  5KNL A;  2DOD A;  3OSG A;  1FWZ A;  3HEF A;  3PO3 J;  4BL0 B;  3HSF A;  3KCC A;  1A04 A;  1ZAO A;  2ZCW A;  1YIJ I;  5D6F A;  1K7A A;  5LHI A;  1YRN B;  3LSH A;  3PSF A;  2HZT A;  4PJ0 C;  3K4B A;  1WI9 A;  2KJB A;  2QBY A;  4M6Y A;  5CKT A;  1XCB A;  1DDN A;  3KP6 A;  1U8R A;  5JI6 A;  4P9U A;  1P92 A;  4E7S A;  2Z3Y A;  4E4H A;  5EEA A;  4MQV A;  2F2E A;  2LFB A;  1HDP A;  2PJR B;  1DPR A;  3H3Z A;  2JVH A;  1YJ9 I;  2ZJR F;  4IHV A;  2FML A;  1BR2 A;  2M34 A;  3R4K A;  3ZGK A;  4IO9 F;  4U88 A;  1K4S A;  4B47 A;  4AU7 A;  3HOZ J;  3NAR A;  1GXP A;  5J6X A;  5BOX A;  1TNT A;  2A07 F;  3P9I A;  2NYX A;  2DOE A;  2HOS A;  2IS6 A;  5FJ8 J;  4XM3 A;  1MMG A;  3PIO F;  5JVT A;  1IN6 A;  4JK1 X;  5ICC A;  3G71 I;  4IKF A;  5CVV A;  1K6Y A;  2FF4 A;  1QRY A;  2COM A;  1OPC A;  3RZO J;  1X1C A;  2IAI A;  2WA0 A;  2E7X A;  4CDG A;  5HNF A;  3GWZ A;  5ICG A;  2R7W A;  4L18 B;  1NHA A;  5LGU A;  2LF7 A;  2QBY B;  2EV5 A;  3IUO A;  3IRQ A;  1WQ2 A;  4M72 A;  2ZXH A;  3GEZ A;  5D8L B;  3HB9 A;  3KYC B;  3M1C A;  4A69 C;  4A6D A;  4B44 A;  5LRS A;  3RPQ A;  1E2X A;  3L2U A;  1P9Q C;  1JGS A;  2EPF A;  2L3D A;  2ME0 A;  3PL8 A;  4E7I A;  5LEK A;  2COB A;  3C2B A;  4HQM A;  1SFU A;  1RNL A;  1HQC A;  4OIR F;  4CYD A;  1XN7 A;  5B5E C;  1X4P A;  5J8C A;  2DOA A;  4OU0 A;  4XLF A;  2ID3 A;  2UXN A;  4LK0 F;  1O3S A;  3QOD A;  2GXB A;  3F8C A;  4NDL A;  4L5E A;  4LIT A;  4CCL A;  4EM2 A;  3OYC A;  1UAA A;  1AOY A;  1RPW A;  2CO5 A;  4MNU A;  3MKZ A;  3LNQ A;  4HST A;  1WCM J;  3MMY B;  2KRF A;  1ZRC A;  3CO7 C;  1MMD A;  4ZZD A;  2E5Z A;  3MKW B;  4BQA A;  1ERD A;  1FTZ A;  4KYW A;  3V42 A;  3Q5F A;  4KIC A;  3IH2 A;  1F43 A;  4XR6 A;  1TL8 A;  1T0F C;  2DLL A;  2QSH X;  3ISP A;  2IA2 A;  4Q48 A;  3W6K B;  3F0C A;  2K9M A;  1T38 A;  2L0K A;  4UUT A;  4BQN A;  5LRR A;  4D1Q A;  4AYB N;  3GYH X;  2RGV A;  3K4K A;  1RKT A;  4BH9 A;  3JRB A;  5DM7 F;  4A3K J;  1IC8 A;  1OJL A;  2O61 A;  1HW1 A;  2M5W A;  2MW8 A;  1IW7 F;  4GYG A;  5KK1 A;  5JHF A;  1TQI A;  2DMN A;  5TJJ A;  1G3T A;  1XDU A;  4MQ9 F;  3LSI A;  3ZQH A;  3G6E I;  3CCU I;  1MJB A;  3ABT A;  3S3N A;  4UNO A;  5F0H A;  2JRM A;  1TW3 A;  4HNV A;  1TC3 C;  1HKQ A;  3CJN A;  3ZQI A;  3DCF A;  3U1K A;  2LR8 A;  1YLF A;  1WI3 A;  3IHU A;  2MYS A;  1WJE A;  4HPQ A;  3CTA A;  5FD5 A;  4W1U A;  2DTZ A;  3KEO A;  2P7V B;  3RCO A;  2HI3 A;  4XOR A;  3BY6 A;  4QTR A;  1UHS A;  2MH2 A;  2EV6 A;  4DJA A;  2JJ7 A;  1GDT A;  4XLA A;  2CWE A;  2NNY A;  1D0Z A;  4L0Y B;  4AIJ A;  1APL C;  2M1B A;  4HBL A;  1FTT A;  5IT3 A;  1Y0N A;  3IAM 2;  5FLX Z;  4EJU A;  4J01 A;  2QSG X;  3ECH A;  2VKD A;  2E1M B;  2QUF A;  2IP2 A;  4XKB A;  5F6F A;  3BCB A;  2W85 A;  1D0Y A;  1YW8 A;  3DFG A;  3QP5 A;  2NVY J;  3X2Q H;  2IS2 A;  3OSF A;  2L5Q A;  2ZME A;  3I4P A;  3U9G A;  3SDB A;  3FHN A;  3KFW X;  3LMM A;  5CQG A;  2XB0 X;  5IT9 K;  3KP5 A;  4XRF A;  2FE3 A;  2G9W A;  2LOO A;  2C6Y A;  3KZY A;  4ZYH A;  1XMA A;  4IOA F;  4I0A A;  1I50 J;  2H6B A;  3RI4 A;  4A3I J;  3ROU A;  4IRI A;  4ZZL A;  1S3J A;  2I8D A;  2QKL B;  3LSK A;  3BTL A;  4EVI A;  1FYL A;  2D1H A;  3A4C A;  4A3F J;  5HLG A;  2FD5 A;  5GPC A;  2P5K A;  3MFK A;  1Z91 A;  4GDF A;  3HZJ A;  1EJ9 A;  3NWS A;  2L7M P;  1W5T A;  3VFZ A;  2XGE A;  2DBB A;  2OZU A;  2WV0 A;  4OAZ A;  3S3O A;  4YG2 F;  4ZYD A;  3S8P A;  2LKS A;  1PUF A;  3ONQ A;  3QYB A;  1JUM A;  2ZME B;  2DFF A;  1Y6I A;  1E17 A;  2PJP A;  1ORK A;  1R58 A;  4O5V A;  1ZEL A;  3RJP A;  3PQK A;  4I76 A;  3CQZ J;  3LQQ A;  1JT6 A;  2KFD A;  4HG2 A;  1QBJ A;  2V7F A;  4GFB A;  4LIU A;  2CSO A;  2KIF A;  3MD2 A;  3OS1 A;  3HSE A;  4WXD A;  5ILV A;  1HW5 A;  2FA5 A;  3SFZ A;  1EH8 A;  3BQY A;  3FKI J;  2XAQ A;  4WXH A;  3OYB A;  1YI2 I;  4BY1 J;  2WC2 A;  4MFE A;  4RB0 A;  1OYW A;  1QZY A;  2BVM A;  3SEQ A;  5ICF A;  5FRM A;  1JJ6 C;  2E2I J;  2X1D A;  4ZTJ A;  4I7H A;  4OIN F;  4M6X A;  2R4G A;  2RAE A;  2JN6 A;  2JA7 J;  4BE1 A;  3C2G A;  3HOV J;  1N77 A;  3EUK L;  1OYY A;  5GTH C;  3MKY B;  5DS9 A;  2A6E F;  2R7Q A;  1PUF B;  2DPU A;  1BI3 A;  3DTE A;  1Z3X A;  2XDV A;  3M9A A;  4KMU X;  1IJW C;  2NXN B;  1FBU A;  2HZD A;  2ELJ A;  2GOM A;  2M7B A;  1KQ9 A;  2G7U A;  3KZZ A;  2PMZ A;  2K7L A;  4B4C A;  4G6Q A;  3GTJ J;  2QSF X;  4ZJZ A;  3S2D J;  3Q9S A;  3FKJ A;  4IX7 A;  2CV2 A;  1VQO I;  2HOA A;  4IRG A;  1X58 A;  4YIR X;  3K69 A;  3JRA A;  3C1D A;  4GXO A;  4D0P A;  2AS5 F;  2FBH A;  2LLK A;  1OR7 C;  3V7S A;  3I58 A;  3VWB A;  4UV9 A;  4II3 A;  2BZT A;  4LMY A;  3L2V A;  3IP4 B;  4XKV A;  3FZV A;  3FMQ A;  4HF0 A;  1K4T A;  2XHK A;  3K4C A;  5DV5 A;  4HYE A;  4H0E A;  3GXO A;  3FXO A;  3QPT A;  2A5Y B; 
#chains in the Genus database with same CATH homology
 1OCO H;  3AG4 H;  2ZXW H;  3ASN H;  3WG7 H;  3AG1 H;  2EIN H;  2OCC H;  3ABM H;  3ABK H;  1V55 H;  3X2Q H;  1OCZ H;  2DYS H;  3ABL H;  2EIM H;  3AG2 H;  5B1B H;  2EIJ H;  2EIK H;  2EIL H;  1V54 H;  1OCC H;  3ASO H;  2Y69 H;  5B1A H;  1OCR H;  5IY5 H;  3AG3 H;  2DYR H;  5B3S H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...