1WJEA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 12
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjeA00
3HPGA 1KONA 1MW7A 1K6YA 1WJBA 1WJCA 1WJEA 3F9KA 1E0EA 3HPHA 1WJDA 1LFPA 1WJFA 1WJAA 4F3QA
chains in the Genus database with same CATH superfamily
4B4CA 2JUCA 3OYJA 3QRFF 3CCYA 2F4MB 4WWCA 1D0XA 4BAYA 2R5ZB 2ZJRF 3M1EA 1OLTA 3LL7A 2GAUA 1N78A 4EJTA 3HUGB 5DCFA 3DU6A 2A69F 2VKHA 3B02A 3MMYB 1VQ9I 1IJWC 1UZCA 3DV8A 3OYMA 1ZELA 4IZZA 2Y0SA 3OOPA 1E17A 2KLOA 1TZLA 2ZJPF 2GXGA 1VZ0A 5CVVA 2DQRA 2XAQA 4ZZLA 1HKQA 4Q4ZF 1YJ9I 1P7JA 1Q1HA 3SYTA 2L7KA 3RKXA 2A5WA 4CZZA 1SAXA 2ELKA 3BQZA 4IRHA 4BGDA 3R60A 1B9NA 3M8FA 3B6AA 3U9GA 3RPUA 2W24A 1CF7B 3I3LA 1NHAA 3HEFA 3V7RA 2CG4A 1XDUA 2Q2EA 2VXZA 3CP2A 5JLXA 4KITB 1DU0A 1FJLA 4A5NA 4WK8F 2D1VA 4RMNA 3E3VA 3L9FA 5HNFA 3PM1A 3I9V2 3T8RA 4L9NA 2YPRA 1RETA 3TW7A 4OIRF 3WODF 5FD5A 2DFEA 2CQXA 3V42A 4XRMA 5K7FA 4KISA 2K4BA 1EF4A 1U8BA 5JHUA 3ESWB 3FXMA 3HPHA 3T0YA 1KA8A 1X58A 1GUUA 4G7HF 4A3IJ 1JKOC 4GXOA 3KLNA 2JRTA 2IVMA 1OCTC 3EYIA 2RNGA 1JGSA 2A68F 2DAOA 2VQHA 2QBYB 1OYIA 5LBQA 4O6JA 3OL3A 2JT1A 3MAJA 1WH5A 4YG2F 4KIGA 4A3KJ 2OCCH 2ZNYA 2LDUA 2CS3A 2V79A 5GP9A 1LFUP 3PFIA 3WG7H 1XCVA 4HOBA 2IS1A 3GXOA 4KICA 1SEUA 1UG2A 1ZREA 4MIMA 1LDDA 2UZKA 4PGHA 2Y9ZA 2HFHA 3MQ0A 4YFNF 4ON0A 3CLOA 4IHYA 3QOEA 1ZQ3P 3GTPJ 1TWFJ 3P9KA 3LSRA 4B1RA 3MFKA 4NBQA 2V9VA 1WCMJ 2RQQA 3NARA 4HYEA 1R5HA 4UB8C 5K7ZA 4MQVA 5BPDA 3NEUA 3HOZJ 4JYKA 1R23A 4BQQA 2NVUB 2EFNA 4BE2A 1W5SA 2L9NA 5JI6A 3K4JA 1UELB 3SJMA 3DKYA 4I0AA 1SMTA 2LREA 2HS5A 4A3JJ 2O8XA 4IQJA 4BY7J 1BI1A 2DYRH 3DXJF 4HZFA 4XICA 3O2PE 1ZHFA 1Z05A 4AC0A 1FBSA 3J7AY 1STZA 4IVNA 3DEWA 1LVKA 3I54A 2Y2ZA 3IL2A 2MFZA 3BWGA 1AHDP 4ENJA 2Y0SN 3LFUA 5KVRA 5ICFA 3F72A 1FIAA 5J8FA 1NK2P 2IPQX 1SVLA 3IUOA 1JKQC 2RNJA 5FB2A 1CQTA 3JRGA 2DA5A 2XGEA 1TTYA 1AKHA 3S1NJ 3M3YJ 2J5PA 3TBIA 2O61A 1OYWA 3WTYC 2HVRA 2MG4A 4MFEA 4Y4RA 1WI3A 5D4SA 3F8BA 3MZHA 2CQKA 2VKDA 4ZYEA 1Z6RA 1BJAA 2XAFA 4KYWA 2K3PA 1PJRA 3LSIA 1P4XA 4XOPA 4JQFA 5L3EA 1O4XA 3H5NA 1ZLJA 2EIMH 2B9SA 1ETYA 4IPAA 4M72A 3LSJA 2FJ1A 2K85A 3B6CA 1EA3A 4ZJZA 4Y17A 3IV5A 1Y39A 1VQ6I 2XKPA 2XB0X 3OYFA 4G9YA 1WJCA 1ACIA 1IDYA 4G7OF 2D5VA 4E6KG 2L54A 1QRYA 2ZJ2A 4PGGA 3CCQI 4L5JA 4ZYAA 4NNJA 2P8TA 3VYRB 1YJNI 1FMWA 2BEOA 2DK5A 1UB9A 4HW0A 5F0CA 2LR8A 2HVQA 1YG2A 3OYIA 1V3FA 1MBHA 3HOVJ 1VQ8I 2DA2A 5DD4A 1WPKA 3KYDB 2X1CA 5J8CA 4XN3A 2XF7A 3Q9SA 1T33A 3HTUA 2F4OB 2X4HA 2DDAA 1YIJI 2ZXHA 2IBDA 3FISA 3HC7A 2Q2EB 5EEAA 1XDSA 3C3WA 4P1WA 1MJAA 3GUDA 1WJEA 1YS7A 3A1YA 4RGUA 3QP6A 2ZNZA 1FOKA 1D1AA 3DEEA 4YIRX 3M07A 2DA3A 2AHQA 3S3MA 2GM4A 4IKFA 1FTZA 4MLOA 1DGRM 2MH9A 2BHYA 4CH7A 2EK5A 1JUSA 1IO2A 3BDDA 2K4JA 1CGPA 5FLXZ 1DP7P 3BZCA 4XKWA 5IYDJ 4AVPA 3TO6A 3OV8A 5GAEJ 3GYHX 5GTIC 1W0TA 2ZMEA 2HPMA 1F43A 4OMYA 4N9HA 1S7OA 3FBNB 3ZQQA 2V6CA 4ESJA 2DBBA 4HAMA 4OOIA 2KT0A 1FBUA 4PSWA 3KP2A 3A0HC 2XB5A 4PJJA 4EJUA 5AIPA 3ZMUA 3E6MA 2LK2A 4E4HA 3GTGJ 3BP8A 4CSWA 4D7NA 2FE3A 4OAYA 4L0ZB 2MW8A 2LRDA 4C3JJ 2EQRA 1PDNC 1DGWY 4AD9A 3LAPA 2DPDA 1K83J 2E1MB 2HQ5A 2DT7B 2P6SA 1LVAA 4F91B 5LFAA 3A4CA 4HBLA 3VFZA 2EZLA 2X1DA 3EUAA 2XROA 2LD5A 2VBXA 2GXBA 1NH3A 2OF7A 1ZRDA 4KFCA 5J4VA 4M71A 4I6ZA 1A5JA 2XAUA 1GXQA 4OIQF 3MZ8A 1O7FA 1ZGAA 2X6XA 1IXRC 2E2HJ 1G3WA 1WRJA 1RKWA 2XAHA 3RIRA 2VODA 2CMPA 1MNEA 5ILVA 3O8HA 1QHGA 4CCLA 5HVQC 3CJNA 2W7NA 3PIOF 5EGOB 4YIFA 4AIDA 2Y48A 3LSPA 2X85A 1I5ZA 2ZBKA 4YFXF 4HX4A 2JA8J 3GTOJ 1AKHB 1KYWA 3LAJA 4QLCU 2OPTA 1LFBA 1I6XA 3SEQA 2LTPA 2PJRB 2DT5A 3I53A 3KYLA 2EIKH 3OIPA 5HLIA 4UVCA 4CDGA 3OIQA 5CQGA 2DCEA 2K02A 2OCEA 2ID3A 4E7IA 1A35A 4JK1X 3GX4X 3J80Z 2LG4A 4XNFA 3CESA 2QM3A 3LA3A 2KRCA 4GFBA 1DDNA 2NS7A 4NB5A 3PNYA 3UKGA 3A03A 4EMSA 4KT6A 4TV7A 2JA5J 1VQOI 2IP2A 2R7UA 3K4CA 1KU3A 4RS8A 3H9JA 1U8RA 1ZLKA 2A6HF 5IOYA 4XKBA 2E1MC 3OYKA 4L18B 3DPTA 5J1UA 2HYGD 3OS1A 1AU7A 1YIOA 2VC0A 3TL4X 2ISYA 4D7MA 1X2NA 1TW3A 2FF4A 2HYJA 2P6TA 3S2HJ 2DTZA 1QPMA 3S2WA 1YW8A 1TW2A 2O9LA 3DCFA 5CQEA 2CO5A 3ABUA 1U3EM 2R3SA 3Q3SA 4BQNA 1Z3XA 2M8GX 2BBYA 4NUBA 2M5WA 5LHIA 1I3QJ 4A3LJ 1Y6IA 3M8EA 1MBFA 1VQKI 3DWLE 1SC7A 4A3CJ 2VL8A 5CVUA 4Z2YA 4U0YA 4BXXJ 3IWZA 3JCUC 3B73A 4WF2A 1KU9A 5EG0A 1JTXA 1MW7A 2FQ3A 3M7GA 4BQOA 1YRNA 1WJDA 1O3QA 1FP1D 3S15J 2XAGA 1BJZA 2X48A 4RDUA 3HL2A 1B1BA 1K7AA 2ZMEB 2PQ8A 3J7YJ 2MD5A 4M6YA 3RPUD 5FFZA 1MNMC 3CO7C 3ZQCA 3D5SC 1MSEC 2CV2A 2O7OA 1ZKGA 2Y0MA 2R7RA 3L7WA 1BC8C 3JW4A 1ZG3A 3BJAA 1XSVA 2R0QC 3A01A 3OYBA 5FGMA 4Y52J 4QPQA 1YW7A 1XSDA 1N75A 4LLLA 2H94A 2L0KA 3ISPA 5DYMA 1SD4A 3KPHA 2WA0A 3HG9A 2CU7A 3ZQGA 4CA0A 3WU1B 4PCQA 4RA2A 1OR7A 1T0FC 1WJAA 1HW5A 4DIQA 2DXIA 2KDOA 4IEJA 5LHHA 3SEZA 5LEKA 2ID6A 2QYOA 3H1CA 1QO0D 3K4BA 1TWGJ 3IRQA 1ZYRF 4EGYA 1FTTA 2MYSA 3CJQB 3TGNA 1LDJA 4XRSG 4V2FA 5DUIA 2CV0A 4DJAA 3MKZA 5K5QA 1HSJA 1WZ2A 1FNNA 2DFHA 3OYEA 2GOMA 2JPCA 5D8LB 3GEZA 1VQNI 5HODA 4I99C 4AWXB 3GTLJ 1QA6A 2EV6A 2GBYA 5IT3A 2R7VA 1QPIA 1EKEA 1XGSA 2A07F 1EV7A 4M9XA 2Z2SB 2ZMEC 3KP6A 5E79C 1YOVB 3CDHA 4JX6A 3FXRA 1HF0A 3LQQA 4A6DA 2LY2A 2Z99A 3KEYA 2EV0A 3PUBA 5EEHA 3VPRA 2H8WA 2VC1A 3L09A 1UHMA 3CMMA 2DLLA 2CJJA 2HI3A 4HX8A 2HNHA 1XTAA 3LA2A 1O3RA 2JTVA 2XKOA 5HNHA 2QBYA 2WWYA 4I0BA 1YX3A 2E2IJ 1TQIA 3WE3A 5M5WJ 1SD5A 3QPSA 4PFPA 1FY7A 4BUPA 3ABKH 2BGCA 2NOGA 1YO5C 4H4KC 2JA7J 1VQ5I 3VSKA 1SFEA 3GWZA 5IYBJ 1Z77A 3DPLC 4LG3A 1SD7A 1Y1VJ 2YX4A 4AUXA 5D5WB 3UR3C 1W5CC 2HTJA 4XLCA 3LWFA 4DQ2A 3U1DA 4RB2C 1R7JA 2N8GA 1KQ9A 1UJ8A 3ZMSA 2KZVA 3FXJA 4U7BA 1YE9A 2DI3A 3D5LA 1A04A 3KX2A 4HDVA 5F1JA 5E8IA 5CJ9A 3KYCB 2X6WA 4NC7A 2IS6A 2BYVE 5FKOA 1LB2A 1JHFA 3OWTA 3EUKL 3ZN1A 4R79A 3E5XA 3RJPA 4U87A 4MEYF 1WI9A 2KISA 3BPXA 2K9SA 2UXNA 4PUSA 3FMRA 3WTVC 5FFXA 4XLAA 3BG3A 2P7VB 3QP5A 3GFLA 5E3NA 2MBFA 5EG0B 2IRFG 2L5QA 1ULYA 4WXHA 4FISA 2IA2A 3ZRGA 4ASNA 2W57A 2H1KA 5HDKA 3J81K 2VQCA 1YRNB 2XPUA 2OTLI 2P5VA 2QQ9A 2DYSH 2GLOA 1HC8A 1EJ9A 3BJ6A 3K4LA 2O6GE 3K1NA 2GIVA 3CJRB 1BA5A 3BR0A 1FMVA 2ZXWH 1XC5A 4L5EA 5KNLA 3JRIA 2E1CA 3OYNA 4MEXF 4IHXA 1YX5A 3O6BB 2M7AA 1G59A 2HOSA 1ZARA 2JZYA 1SANA 5B66C 2W82A 4Y13A 3BG5A 5CVIA 3L2CA 2R93J 4LIVA 2EFOA 2EZIA 3FIWA 1HXDA 2DOEA 2L4AA 2EA4A 4OIPF 5K5OA 4E7SA 1U6GA 2Z16A 2HZTA 2K86A 2R7QA 2VJIA 2E36A 4OAZA 2E2JJ 3SDGA 1NG6A 2KJCA 2MSYA 3G6EI 2XRLA 1JE8A 4GDFA 1Z3YA 3CDLA 3W2AA 2AXLA 1C0WA 2NVXJ 4ZTJA 4ZTFA 3QOPA 1Z21A 1G3TA 3M4OJ 1UHSA 2HKOA 2KKOA 2JN6A 1BN5A 2ESHA 4MTEA 2BY1A 2Q1ZB 1FWZA 1WFXA 4A5MA 3RKQA 5KK1A 2A05A 4UV8A 3H3ZA 3WE2A 2OQRA 4KJZA 2M4KA 2HXOA 3BC8A 3F9KA 3PUFA 3CCSI 5F08A 1HBXG 3JRDA 5LGNA 1WHUA 1X4OA 4NC6A 3CUQA 3FKIJ 2YX7A 2WADA 2I8DA 5ICCA 3OS0A 2WAFA 1X1BA 1EH8A 4KN7X 1BI0A 1MJ9A 2L7FP 3GZNB 3ZMVA 4PFOA 4N0BA 3RDIA 5HOOA 1R6RA 4JX5A 4ZZDA 3C1DA 2KDZA 1XX5A 2LP0A 4BE1A 5J3LA 1ETKA 2MGQA 2XDVA 4MGRA 5LRRA 2IGOA 3GZ5A 2HQNA 2P81A 2D1HA 5TRDA 3LA7A 1SD6A 5FKLA 3FXKA 3WTUC 2DMPA 2LSOA 3BR3A 2M34A 2V26A 2KIUA 4BHPA 3LSHA 4R8HA 1DQUA 2VT2A 4ENMA 3HSRA 1KGSA 2EZKA 3AG4H 5IPAA 5LGUA 1LEBA 1S6LA 2I10A 1SFOJ 5FROA 1Z9CA 1RKTA 2EPFA 1D8JA 4A2UA 2QCOA 2RKHA 4XMYA 1HOMA 4XORA 3FMQA 2W4SA 1IN7A 5L3FA 5IT9K 2L7MP 2CRGA 2H6BA 3OYAA 3CCVI 1B6AA 2JWTA 4HNTA 2F5CA 4YFKF 4F7ZA 3S3NA 1BR1A 2R5YB 3ZGKA 2JJ7A 1TWAJ 4C9YA 1OR7C 3I59A 3GTKJ 2CFXA 1K6YA 1MNDA 4FETA 3KETA 3L2WA 3CQZJ 2FRHA 2BY0A 2KIFA 4B47A 3VOEA 2W84A 2GIZA 4B43A 5D4RA 4M3DA 4C2UA 2HQAA 1NK3P 3JREA 3C2GA 2B7EA 3K6GA 3F22A 3WTZA 2QA4I 1W7PA 3QU6A 1OQYA 2K9QA 2ME6A 3GBGA 4PJLA 4GYIA 1LEAA 2FEZA 5BPIA 1F4KA 2JA6J 2ECCA 5H6QA 5BOXA 1G4DA 2PMUA 1XGMA 5B1BH 4X0GA 1QZYA 1RI7A 2OZUA 1S7EA 1FLIA 1P6RA 2VPRA 4D9JA 3RSNA 4BJ6C 3JSPA 3GVAA 4ZYDA 1P2FA 3JRAA 2HGCA 3I0TA 1IRZA 5AIQA 2F5EA 4BXFA 2AXTC 5ED4A 2EILH 3V8KA 2XC7A 1I39A 5IP7J 4HSRA 1MH3A 3CUOA 3U21A 5EGOA 2M0MA 5J47A 5LRSA 3FKJA 1XD7A 2HZDA 2IJLA 2RQPA 3KCCA 1XGNA 2V9KA 3AG1H 3OS2A 3F8NA 1RPWA 2PJRA 3F6VA 3K1PA 1IUYA 4RGSA 4BNCA 1LE8B 1TLHB 4RAZA 5ERIA 3BR5A 5BQTA 5E3MA 3I55I 1MBGA 1YLFA 2DQLA 2R92J 3S17J 4LB5A 1D3YA 2UXXA 3NAUA 1R71A 5BMZA 2KRHA 3W2WA 3TW6A 1LKXA 4EGZA 3CCUI 3E5QA 2EA2A 3OYLA 1PVEA 3U1KA 2G9WA 1OCPA 2LYCA 1VQPI 2R7OA 4BJ5C 4ANJA 3AG2H 2PLYA 1FYLA 2BY3A 3HIFA 2NVTJ 5EF6A 3M9AA 2R7FA 5F27A 2NAZA 2NVYJ 1FPQA 2CGPA 2PN6A 1W5TA 4CCJA 3WGHA 1SMYF 2JPBA 4G8XA 3FF5A 2EFWA 1R58A 1ZGJA 1WJFA 3CUQB 4GRIA 1DPUA 2BXZA 3FXUA 2ELJA 4R1HA 1R1TA 5FO5A 4XM3A 2E60A 4M6VA 3CD6I 5LHGA 3C7JA 2QEXI 2QENA 1XCBA 3D5RC 1IRFA 5DDGA 4FCYA 2PEXA 3RI4A 3QQAA 1T0FA 4A3FJ 2W48A 1ZG5A 2KQRA 2QQ8A 2XGDA 3BG9A 2VI6A 2FQ4A 1F5TA 3IP4B 3OOUA 3BG7A 4PJNA 2L01A 5DS9A 2FMLA 5K1YA 4FTHA 2BHZA 5IOZA 1EH7A 5DM7F 5B3SH 2FX0A 4A3GJ 3QYFA 3AFHA 4DGWB 3A02A 1Z91A 5FJ8J 4GO1A 1A31A 3DU5A 1EH6A 1I1SA 2VT3A 1B72A 4HLXA 5JFRA 2XF6A 4B8XA 4XBFA 4G6DA 3JSOA 3K2ZA 3AL0B 4PSXA 5E20A 2FNAA 3RQ4A 4C3IJ 4KA4A 2P5LC 1HDPA 4UY8I 1WGXA 5DUKA 1B8IB 1YJWI 1Y8RB 4A3MJ 2VPLA 2NRAC 3ZMZA 4HNVA 1Y0NA 2BY2A 1KYZA 4BHCA 3CCJI 4DYQA 2Q8KA 4AIKA 3I59B 3KZZA 5DCMA 2AQEA 4CYDA 1D1BA 1Z7LA 2KP6A 4E7JA 2CW0F 1WH7A 2A3SA 2VKVA 5HDGA 3KP5A 3ULQB 2QVOA 4H0EA 5HS9A 1PUEE 2QQBA 4LMYA 4HRIA 1MBKA 4XLPF 1TC3C 3S1MJ 5BS6A 5D5XB 3CUQC 4F3QA 2LH9A 4XIDA 1W7PB 1ETOA 4V19K 3TQNA 3MVPA 1J7KA 1S8NA 1VI0A 3ABLH 3TP3A 4M6XA 3MWMA 4N9IA 1FOWA 2BE5F 3ZMTA 2G0EA 5FKMA 3RQIA 1JJ8C 3COAC 1BC7C 1U9OA 2DJIA 2FOKA 3HB9A 5M5XJ 3FBIB 2WAQA 4UHTA 5C44J 2HVSA 3WTXC 1T08B 2VJ5A 2R7SA 1BOBA 1APLC 2M2EA 2QUFA 3KZIC 2O8KA 3SHFA 5KAFC 3C2HA 5DM6F 1TT0A 1FX7A 1IC8A 3TP0A 6PAXA 1FOYA 3S16J 1KU7A 4M3BA 1ERDA 2CW7A 2E1OA 4C30A 3ROUA 2RREA 2IGKA 3F6OA 3LNQA 3LOCA 3Q0UA 1MD0A 4B44A 4IL6C 4BEHB 2JSPA 4KNYA 3IH2A 3AL0C 3ECOA 2RGVA 4RAFA 1KQ0A 3HOWJ 4L5IA 2M0CA 4A69C 4D5FA 2X0LA 4DZJA 1X1DA 2MA3A 4BU2A 5M3MJ 3FXOA 2V7FA 1E3HA 3C2BA 2STWA 1FP2A 1R00A 4FE7A 4EV0A 5TGTA 3HOUJ 4LGWA 3ZCOA 4BHBA 2F48A 2Z3YA 4LK1F 1V54H 2WBMA 2HR3A 3ZQ7A 1TQPA 2CV1A 2JMWA 1T8IA 4KUMA 5IY5H 3DBLB 3E5UA 4AU7A 4CHUA 1MMNA 4K2EA 1LJ9A 1ZG1A 2F6CA 4PJMA 3H9GA 3PSFA 4E7ZA 3GTJJ 5ICGA 3HJEA 1OFCX 2PX9A 1QZZA 3MKLA 2RAEA 5D5UB 4Y7NJ 4W97A 2EWNA 1VTNC 4XKVA 4L9JA 1AWCA 3CDIA 2IS2A 3R61A 3FDYA 4IRGA 4BE0A 2COBA 1M1EB 2WV1A 4CZCA 3MEXA 2VASA 2XF5A 3SZPA 3VWBA 3H36A 4EVIA 5KAIC 4BDYA 4B09A 1S7AA 1SFKA 4LITA 1V55H 1K61A 3JTHA 2DA1A 2UV1A 3H5RA 3O3KA 1H9TA 3W3CA 3RZOJ 3QYEA 1K4SA 3HPGA 1B9MA 1I1GA 2O3FA 2DDBA 2XRNA 2DA6A 2F5VA 4J01A 3G1OA 5AONA 4RB3C 4O3MA 5F64A 4LB6B 5FRMA 3AKZA 3NRVA 5F0FA 4AYBA 4M9SA 2DW4A 1GV5A 2GQQA 2KHMA 2LLKA 2LBFA 2ZJQF 4F52A 3LSKA 4Y33A 1S9HA 2W1OA 3G1LA 3CP8A 4DYRA 4BQAA 2CQQA 5FLVA 2HKXA 3GMEA 2FUG2 1X3ZB 2WAQN 2RVCA 5ICEA 1JT0A 3T5XA 4XSXF 1REPC 1B72B 1YITI 3GCMA 3KP4A 1F1ZA 1UFMA 4BJTA 2PMZA 3F8CA 3FMSA 3HHGA 3CCRI 2OD5A 1UG0A 3HOXJ 1BL0A 4EM1A 4LOCA 1ETXA 3ERMA 5A2QK 1X1PA 3DKWA 2DFFA 2EFPA 3BROA 3GO5A 4ZC3A 3N97A 1VQ7I 1RESA 2DT6A 5DCMB 2E34A 2HQRA 1I3AA 5GPAA 2FU4A 1IRGA 1ODDA 4AIHA 1W1WE 2AO9A 4V2GA 3Q0VA 3WGGA 4HSTA 2UWMA 2PJPA 3G3ZA 3HXLA 1OJLA 2LOOA 4C2TA 2ZC2A 1ZAOA 4J19A 4I09A 1IRXA 1KZHA 1S29A 3DP7A 2L9RA 4RB1A 2BV6A 1YS6A 3CTAA 3K2AA 4MTDA 3K7AJ 3ZOBA 4Z6YA 2PG4A 5DTDA 5E3LA 4CXFA 2E5ZA 4IHTA 2KRFA 1SFXA 2E35A 2DODA 2FA5A 2L2OA 1USTA 2L4MA 3WG9A 1FYMA 3PO2J 1QQIA 5F1RA 1E3OC 1BBYA 2LKPA 3KFWX 1WQ2A 2NNNA 5IP9J 1R5ID 4UVBA 1QZEA 3VB2A 4NC8A 1GT0C 4BY1J 3REOA 3S14J 2EFQA 4Q47A 1G3YA 4ZDPA 4FT8A 3ZMDA 1TT5B 2R7DA 3FXQA 3ASNH 3UNGC 4ESBA 1ZN2A 2K40A 2MC4A 2VXDA 2VOOA 2BOLA 2STTA 3GLXA 5KHDA 1RNLA 1J59A 5TISC 1VFCA 4F92B 4OINF 1I6HJ 2XSDC 1Y56A 2EB7A 3CMEI 2K9LA 1HW2A 2BZTA 4ABZA 2YU3A 2HTSA 2IGNA 4AYBN 2HYFA 3V8JA 4DOZA 4M3FA 1XPXA 2YS9A 2W00A 2FBKA 3I4MJ 3QWLA 1ZTRA 4ZDLA 2KL4A 5DV5A 1Z1DA 3BT9A 3WTTC 2FSWA 3A2KA 1O57A 2QKLB 2QSGX 2XIGA 2CQ7A 2BXYA 3CC7I 3MKYB 1V4RA 3S3OA 1MIJA 1OCCH 2ZSHB 2I5UA 2PMZN 5LD2C 2M30A 1POGA 4RBOA 3JAMK 4XL9A 2R5YA 3K4MA 4XLEA 1YI2I 2G7HA 5L3DA 1RUNA 2UUZA 5HDNA 3W2VA 5H2FC 1G6NA 2OV7A 1BOAA 4AIJA 2WV0A 2OAZA 4AM3A 2QF7A 3N05A 1X3UA 3I71A 3RTRA 3PJRA 2RN7A 3S1RJ 3IHUA 1VQMI 2PI0A 2O03A 1FYKA 1MJBA 1YTYA 3BTIA 1I27A 3HKZA 3JTGA 2B63J 1TNSA 2DOFA 3LFKA 3LSGA 3X2QH 3L2RA 4IF4A 1WJ5A 5HS8A 4ENKA 4IOAF 4W1UA 4OU0A 1QGPA 2BW3A 2IA0A 4ENNA 2VE9A 2LBFB 2L9SA 4QIWN 2E71A 1K79A 2ZO4A 1IV8A 4GCVA 4RM3A 2VQLA 4KMUX 2QQAA 4C3HJ 2H8RA 3LSTA 3L2VA 5M5YJ 3DQVC 2D45A 2GXAA 2K27A 3R0AA 3HRUA 3DBHB 2YUSA 4UUTA 1MZBA 2D2WA 4FX4A 1J0RA 3F23A 4DW6A 3BCAA 2XV4S 1PUFB 5KCMA 2V6EA 4EJVA 3D0SA 5J40A 2X1EA 3DLLF 4I2OA 3GW2A 1XMXA 5F04A 1XMAA 1XGOA 2NXNB 1ZRCA 1GHCA 2HXIA 5D6EA 1R36A 2GA1A 2CYYA 3V4GA 3G4SI 4M74A 4E7LA 1FC3A 3HOYJ 1TP4A 2P4WA 3CMAI 1UCRA 4BL0B 3OYCA 2R7WA 4WXCA 1Q1VA 1LE8A 4OMZA 3L2QA 3RYPA 5DD8A 4AVZA 2EIJH 4I02A 5ILSA 3D1NI 3G1MA 1A6QA 2HDWA 5CVRA 1U78A 4IHWA 5EZHA 5CKTA 1H88C 2EJRA 4MO7A 3VODA 4XRSA 3ABTA 2IEKA 3WU2C 4U7DA 3BCBA 1XS9A 4P55A 1D0ZA 3HGGA 1Z67A 9ANTA 2E1NA 2C6YA 2VBZA 2NYXA 3FM5A 4QSHA 4MQ9F 2Y69H 3LQRA 1ENHA 1JUMA 3Q9VA 2H27A 1H89C 3E7LA 1ZRFA 3ELKA 3U2RA 3G2BA 1FSHA 2ECBA 4HLYA 4FASD 2Z1DA 3R0JA 4UUSA 3HTSB 5FRNA 2E19A 3T8TA 5IT9Z 4ZYGA 2CWEA 4M3EA 3KE2A 1ONVA 4Q5SF 2HOAA 4EJOA 1A6IA 1RIOH 1P9QC 1T2KA 5J4YA 5EEGA 1VF9A 4LK0F 3W6VA 3GTMJ 4MNUA 1PP8F 4NQWB 3GFJA 3CCLI 4UV9A 3EQLF 3FHNA 4HF2A 2HOTA 3HKZN 4LFUA 1ON1A 1FEXA 5FD6A 3VYSB 2ZB9A 4RM2A 2DMUA 3CMYA 1ORKA 1D8KA 3H92A 5H6RA 1U0JA 2GWRA 3RCOA 3JRCA 2K3FA 2ZKZA 1OISA 2OZ6A 1J09A 1Z7UA 1GDTA 2A5YB 1VQLI 3P9IA 4OIOF 3H9QA 1NG7A 1MMGA 2OU2A 1T98A 1XSXA 3E0JB 3NQOA 2NNYA 1IDZA 1HCRA 4MHGA 4A12A 1HSTA 3ASOH 4N4NB 3ECHA 2XASA 2VE8A 4JP0A 3OSGA 2FBIA 4GYGA 3CC2I 2L7ZA 1TBXA 3IC7A 3S32A 3Q5FA 2FMYA 3NWTA 5IP6A 1B8IA 1UAAA 3H3VK 1U5TA 3PQKA 3PSIA 2CFOA 3LSMA 2X51A 2ZFWA 3V7SA 1WSUA 3IKVA 4EM0B 1N25A 2OBPA 2K9NA 1SAUA 4LG0A 4BYYA 1QNTA 2F2EA 3BPVA 4XONA 2FXAA 1FT9A 1K78A 1OCOH 1T38A 1ZH5A 1QVUA 2MD0A 4O5VA 1DU6A 2H6CA 4A3DJ 1ETWA 3DEUA 2Y9YA 4ETSA 2DOAA 3J7ZI 1IXSB 2LKSA 4I7HA 1ZGWA 1KU2A 3K69A 2EINH 3OYDA 2PFBA 2FOWA 3KIOA 1E2XA 2PMHA 1Y8QB 2CSOA 3QPHA 3I4PA 3FK7A 2BW3B 3K0LA 3K4NA 4QWQA 4XRFA 1E3PA 4L9VA 1ETQA 2DA4A 4A0ZA 2XHKA 3DTIA 3HZJA 3VSLA 1K6OA 3F8FA 2K7LA 4KN4X 1GLNA 1B59A 2LMDA 4B3AA 2XGCA 3VYTB 3MKWB 4A3EJ 2CW8A 1RC9A 2QLZA 3BJOA 4Y15A 3IKTA 5E1WA 1R1VA 3OSFA 2G7UA 1WJBA 3IAS2 3EETA 2EV5A 1GXPA 4G6TB 4II2A 2J5OA 5FKNA 2R4GA 5EZGA 1F9NA 3SZGA 5D6FA 2LF8A 3RKYA 3GFMA 3M8JA 4LLNA 4B3XA 4KMFA 4M73A 4BEHA 3OIOA 2VJJA 3GZ6A 1IN6A 2LNBA 2OTJI 3MCZA 1P7IA 2OJED 4PJ0C 3ZQHA 2VN2A 2NS0A 1XMKA 3FM3A 2ACJA 3R4KA 3P5JA 4RAYA 5E18F 1ZR4A 3HOSA 3S93A 4UNOA 4BXUA 2Q0OA 1Y0UA 3BZKA 5BNGA 2DTRA 3OY9A 3ZP5A 5E17F 4BDZA 2BVMA 3W6JB 2L02A 2GA2A 2EBIA 2GZWA 4FHTA 4DYCA 2DMNA 4DBRA 1O3TA 2CUZA 3HRTA 5M3FJ 1X3WB 3EUHA 3K4KA 1QU3A 2WTEA 2H1LA 1G3SA 3PFYA 5J1YA 2QSHX 1GVDA 1U2WA 5JHFA 3TEDA 3CZ6A 2A61A 4FE4A 4BKXA 4CYCA 4E7KA 2JVHA 3FXLA 3AAFA 1ITYA 1IN5A 2VBYA 4UUSB 1JUPA 1MMDA 4NDLA 3SFZA 5F6FA 5LGTA 1OKRA 1JI8A 3TDZC 1L0OC 4RAGA 2LC2A 3DTKA 1TWCJ 1IUFA 1TQMA 2OC6A 1LNWA 1J5YA 4S05A 2IS4A 2K9MA 4CICA 1HKSA 2KIQA 2O5RA 3E1SA 2F5DA 2HDDA 4XK4A 5JR3A 1R1UA 2JUGA 3CLQA 1RR8C 2CQNA 3BTCA 3L00A 3H0DA 5L3CA 2XVCA 3P7NA 1IN4A 4UXNA 2TDXA 4NHJA 1RZ4A 3FX3A 2KMUA 3VYUB 2OA4A 2ZSIB 4KDPA 1AOYA 4UB6C 1L3LA 4IHSA 2XPVA 1KONA 3H35A 3OR2C 3P9CA 4S04A 3E6CC 3S2DJ 4U0WA 1BIAA 3BQYA 2RV8A 1G2HA 3EYYA 3KEQA 3MD2A 2MLGA 3ZXSA 3G71I 3SXYA 2FD5A 3E6BA 2XAJA 1LUJB 4A3BJ 1U5TB 3CF2A 4FX0A 3HHHA 3SDBA 2LVSA 3HOTA 1VNDA 2Z9OA 4HPQA 1OMIA 2IT0A 4EATA 4LG0B 1HKTA 4QPOA 3BR2A 2JRMA 2V9PA 5EYRA 1HA8A 3HRSA 2ISZA 3CJTB 2HDCA 5C4XJ 4UUVA 1K78B 3QU3A 3CO6C 5FKKA 3BR6A 3RZDJ 3PNTA 4JX4A 5FLMJ 1D5VA 1HLVA 2Z33A 4PZJA 4RGRA 4L0YB 3DF8A 3MZYA 2NVQJ 4QTRA 2WC2A 3OYHA 3KP3A 1Y1WJ 1GV2A 2H09A 3J7AO 1IGNA 1O7LA 1FOXA 4L9TA 4ESFA 2E7XA 2HOEA 3OMYA 1HW1A 1WVRA 1YHQI 3T1BA 4ZDOA 1D0YA 1PP7U 1OPCA 2AQFA 2M8EA 3F0CA 2M45A 3GFIA 2O0YA 3HGYA 5K5RA 5EJCA 1BI3A 4EEFG 4I98B 1IW7F 4IO9F 3H5AA 5GADJ 3IRRA 3ABMH 3I58A 3QPTA 3TO9A 3Q0WA 5K7HA 2VQGA 2V1DA 1X19A 2YSRA 2VOPA 4XLFA 5J1RA 2DPUA 4FQGA 3QPLA 1IN8A 2LY9A 1IF1A 2EH3A 1MBJA 2JSCA 2VBWA 4Y3OA 5FLXK 4U0VA 3VEPA 3DTEA 5D8KB 1HDDC 1KQ8A 3M1CA 3PIPF 2MLKA 1JJ6C 1F36A 4P5OA 3R6SA 1U5TC 5HS7A 5EDNA 2PBIA 4C2MJ 4XKCA 2M3AA 1HQCA 4LJZF 4HDUA 1JXSA 3HBLA 2COMA 1T95A 4I01A 5B1AH 1W0UA 4BBSJ 1YFHA 3BG6A 1B4AA 4F93B 4CCKA 3KP7A 4PDKA 2Z5UA 3KZYA 2DN0A 3BY6A 4IQ4A 4HA8A 4D5CA 4DNCA 3MN2A 4YRVA 5E3OA 4G12A 4RLQA 2IAIA 3SQNA 1X1AA 4CYCB 1W4MA 1RUOA 3H3UA 1T39A 3BR1A 1UHWA 3BTLA 2IW5A 4G94A 5A2QZ 3I5UA 1MMAA 4HF0A 2OQGA 2ESNA 4XSZF 2DJNA 1JHHA 4Q48A 1O3SA 4CGZA 1Z0XA 2KZGA 4MFDA 3TDUC 4E7HA 1BW6A 4U88A 1ON2A 2DA7A 3DFGA 1OYYA 1BIBA 2Y30A 4BS9A 4XQFA 2X9DA 4YIIA 2HEOA 5E1ZB 2OUMA 4G7ZF 2MC3A 3E6DA 2F4IA 3PQJA 4XN0A 3QYBA 4WXDA 2VJ4A 1R49A 3CC4I 2BVLA 1WKMA 2Y75A 1XN7A 1IAWA 5F0HA 2LFBA 1K4TA 1FIPA 2QKMB 2IGMA 3CCEI 1BR2A 3EPZA 3N4MA 2WB1A 4HEA2 3JRFA 1R22A 3ZQFA 2IA1A 5CPRB 2FBHA 3RYRA 3V7CA 4HV5A 1IV6A 3GF2A 3HYIA 4HV6A 2VLAA 1I50J 1PUFA 3FHZA 2RDPA 4HF1A 1MBEA 1V5FA 3IH3A 3J80K 2VONA 3ZN0A 1DPRA 1R4NB 2X6OA 1H9GA 3C18A 4RLFA 3JRBA 2TCTA 2VB6A 1D1CA 2LKXA 2ELHA 4BACA 4JOMA 5JVGF 3EUHC 4G6QA 3FZVA 2W25A 1JT6A 1QBJA 2M4GA 1S5LC 4XOTA 1E0EA 1J9IA 4F55A 3K70C 2WY8Q 4CO8A 2YU9J 3TOAA 5HLGA 4S0HB 3ZR8X 5LEJA 4E70A 2XGXA 3GTQJ 2VUMJ 3DPUA 3I4NJ 3I64A 4WCGA 5GAGJ 1SFUA 3TO7A 3E97A 1BM9A 1V5EA 5L3BA 3L2UA 3DLAA 1JTYA 2JQ7A 1ETVA 4ITVA 3HRMA 3F3XA 3WTWC 3WU0A 3JR9A 1FZPB 4IHVA 2YR2A 1XG1A 2QZ8A 4X1EA 3HDDA 5GAHJ 3BOQA 2R7XA 2GOXB 4A0XA 3AG3H 5IYCJ 1N77A 1A36A 1W36C 3I56I 1MDMA 1LPQA 3PO3J 2ME0A 3HSFA 2M1BA 3PL8A 4IJAA 3WHBA 4KIFA 2ZFUA 2P7CB 1NTCA 3KEOA 2XUBA 2A6EF 5HLTA 2R5ZA 1P4AA 1Z6TA 4XR6A 2L3DA 2NOJB 3JAMZ 1J2XA 5J6XA 5CLSA 1IXCA 4EJWA 3HUGA 2K5CA 5C3EJ 1DUXC 1VQ4I 4NQWA 4N4OB 5JVTA 3GLLA 3A0BC 4M9ZA 2CUEA 1LQ1A 1W7PD 5C4JJ 2MABA 2P5KA 3QAHA 2MH2A 4HX7A 3G73A 1J75A 4DBQA 2A6TA 3FK6A 4OWRB 2QGUA 2M87A 4CCNA 2ZXIA 4IOCF 3S1QJ 1USSA 2B0LA 4YEJA 2ETHA 3OR1C 5D5VB 3BZ6A 1T56A 2IXSA 1JKRC 4M3GA 2HPIA 1TL8A 2M9HA 4P9UA 3KLOA 3OL4A 5E1XA 1SVOA 3O8GA 4UVAA 1R9TJ 2DMQA 3V8LA 2WAEA 2JVGA 1FBQA 1AA7A 1CF7A 1T6SA 3PNVA 2ICWG 1MKMA 3L1PA 1V5GA 4CUGA 2L9VA 1P4WA 3H0GJ 4LIUA 3DBRB 2WB1N 3WTSC 3HM5A 1UMQA 2VIXA 3IH4A 1XB4A 4LD5A 3J81Z 3RKWA 3S8PA 4X6AJ 3DKXA 2ZXJA 4LLGF 3RPQA 2JK3A 2HU9A 4J00A 2R7ZJ 2LY1A 3TMOA 2E7WA 4IXAA 1LFPA 1DP3A 3ZQIA 1YYVA 1ZK8A 3TOBA 2AS5F 2XSJC 1R5GA 2LF7A 3QODA 3ZQLA 2P0WA 2CUFA 3LMMA 1U9NA 2TRTA 4A6EA 2DMTA 3CCMI 4CCMA 5LLQA 4EM2A 5HLHA 3K9TA 3ONQA 1D5YA 2M7BA 1RRJA 3K10A 1LDKB 3SFIA 2RC4A 2NS8A 4JBAA 1QHHD 4YELA 3K1MA 1BW5A 3TKYA 3WHCA 4PK4A 1X4PA 1TNTA 3ERED 5B5EC 5GTHC 5CYVA 1TWHJ 2CUJA 1SVMA 4RB0A 4P96A 3K70D 2KJBA 4IRIA 1X2MA 2V1NA 4KIBA 4A93J 2E5NA 1P92A 1JKPC 3F21A 5TJJA 2CH0A 4I76A 1WWXA 4DZPA 1PYVA 2ADUA 2V1XA 4D1QA 1MSFC 3NWSA 2ZCWA 3IAM2 2KPMA 4KT5C 3EDPA 1IZ1A 2VKEA 4XLHA 1BR4A 4HQEA 5GPCA 4BH9A 2XPWA 4GGGA 1IG7A 1MH4A 2W85A 3OYGA 1W36D 2QSFX 4EQQA 5CVJA 5H20A 4B48A 4HG2A 2DO7A 1YW9A 1R4MB 4D0PA 1RR7A 2KIMA 1GVJA 4IX7A 3W6KB 3HSEA 2FNPA 4ZYHA 1OCRH 4A0YA 5E8GA 4XLNF 3JRHA 5DEQA 4BBRJ 4HNUA 5L3GA 1JGGA 3CF5F 2DFIA 2WY7Q 2JA2A 2X6YA 3FWEA 4II3A 1MGTA 1OCZH 1H0MA 2KFDA 3ML6A 1FSEA 1QVTA 3VDXA 3BLYA 2F5FA 3ZPLA 1G8XA 3F8MA 2V4JC 4HQMA 1H8AC 2HWVA 4CCOA 5ILUA 2Y31A 3WGIA 3A01B 2DK8A 3SZTA 2R7TA 2QWWA 2EZHA 4P9FA 1S72I 2V1UA 1MDMB 4RGXA 5JLWA 1MMSA 1YQAA 1BI2A 3BTJA 1S3JA 1ZR2A 1X1CA 4WX9A 3IWFA 2DU9A 4ZH4F
chains in the Genus database with same CATH topology
2JSPA 2MYSA 3OYJA 4BDZA 3CJQB 3AL0C 2BVMA 1D0XA 4DBRA 2CV0A 1OLTA 2CUZA 3LL7A 3K4KA 4DJAA 1N78A 1QU3A 3HUGB 3PFYA 3MKZA 3DU6A 5JHFA 1X1DA 2VKHA 4BU2A 3CZ6A 3MMYB 2V7FA 3OYEA 2GOMA 4E7KA 2JVHA 5TGTA 3ZCOA 3OYMA 1ZELA 1MMDA 2WBMA 4IZZA 2Y0SA 2R7VA 2CV1A 2KLOA 1TZLA 4AU7A 1JI8A 1VZ0A 1MMNA 2LC2A 2Z2SB 3DTKA 2F6CA 4PJMA 3H9GA 3SYTA 2OC6A 2L7KA 3PSFA 4E7ZA 2LY2A 2A5WA 3KEYA 3PUBA 2IS4A 4BGDA 2K9MA 2IS2A 4XKVA 3CMMA 2O5RA 3FDYA 3E1SA 3I3LA 4BE0A 4CZCA 2HNHA 3CP2A 4KITB 2VXZA 2VASA 2XF5A 3VWBA 2JUGA 5HNHA 3H0DA 4BDYA 1YX3A 1SFKA 4PFPA 4LITA 4RMNA 4BUPA 5HNFA 2UV1A 3H5RA 3W3CA 2KMUA 3I9V2 4H4KC 3VYUB 3QYEA 3VSKA 3HPGA 3V42A 4KISA 2ZSIB 3DPLC 4LG3A 2F5VA 3HPHA 4J01A 5FRMA 1KONA 3H35A 3OR2C 3AKZA 2RNGA 3UR3C 2VQHA 4AYBA 4XLCA 2KHMA 3MD2A 3ZXSA 3OL3A 2LBFA 2KZVA 4F52A 3LSKA 4Y33A 4U7BA 1YE9A 1S9HA 2W1OA 3D5LA 3CF2A 3CP8A 3KX2A 2CS3A 3SDBA 3HOTA 4HPQA 4EATA 2X6WA 4NC7A 2IS6A 2FUG2 4QPOA 2IS1A 3OWTA 1HA8A 3EUKL 4R79A 4U87A 4BJTA 2PMZA 4PUSA 3PNTA 1UG0A 4XLAA 3QOEA 2L5QA 3ZRGA 4ZC3A 3OYHA 2DT6A 2VQCA 2RQQA 4BQQA 4BE2A 2L9NA 3K4LA 3OMYA 3K4JA 1UELB 4ZDOA 1D0YA 3DKYA 4HSTA 2LREA 3CJRB 2UWMA 4IQJA 3HXLA 1FMVA 2AQFA 2LOOA 4C2TA 5KNLA 3OYNA 3J7AY 3H5AA 1YX5A 1IRXA 2M7AA 1G59A 1LVKA 2VQGA 2MFZA 3LFUA 1X19A 2E5ZA 2W82A 4LIVA 4XLFA 3IUOA 2L2OA 4E7SA 2Z16A 2R7QA 2VJIA 4OAZA 4Y3OA 3TBIA 1NG6A 3DTEA 2HVRA 1Z3YA 4NC8A 3W2AA 3M1CA 4Y4RA 4ZTJA 4P5OA 4ZTFA 4ZDPA 1Z21A 2VKDA 2M3AA 4XKCA 3UNGC 2K3PA 1PJRA 2MC4A 3LSIA 2VXDA 1T95A 2Q1ZB 4XOPA 2BOLA 1WFXA 4JQFA 3H5NA 3BG6A 4KJZA 2M4KA 4F93B 5KHDA 3BC8A 3F9KA 4CCKA 1EA3A 4ZJZA 4F92B 4IQ4A 1X4OA 1Y56A 3OYFA 2K9LA 2WADA 2I8DA 4YRVA 3OS0A 1WJCA 2IGNA 2WAFA 4RLQA 1X1AA 4E6KG 1X1BA 4DOZA 4PFOA 2W00A 5HOOA 4ZYAA 1R6RA 4NNJA 3VYRB 1FMWA 4ZDLA 2KL4A 4BE1A 2HVQA 2XDVA 1MMAA 2IGOA 3OYIA 3A2KA 2QKLB 2V26A 3MKYB 2X1CA 3S3OA 4XN3A 2ZSHB 3LSHA 2XF7A 4E7HA 5LD2C 1DQUA 4BS9A 4XQFA 4XL9A 3K4MA 4XLEA 2ZXHA 3HC7A 5FROA 2Q2EB 2OUMA 2UUZA 3W2VA 2F4IA 4XN0A 3QYBA 2OV7A 4XMYA 4P1WA 4XORA 1WJEA 3N05A 3A1YA 3RTRA 2W4SA 3PJRA 2VJ4A 1D1AA 3DEEA 2BVLA 3OYAA 4HNTA 3S3MA 3HKZA 4IKFA 3S3NA 1BR1A 2QKMB 2IGMA 4MLOA 1BR2A 3EPZA 3ZGKA 1DGRM 3LSGA 4CH7A 2WB1A 4C9YA 1OR7C 3L2RA 4HEA2 1K6YA 1WJ5A 5CPRB 1MNDA 4FETA 3L2WA 2VLAA 2BW3A 4B47A 4XKWA 2LBFB 4B43A 2L9SA 1V5FA 4C2UA 2HQAA 4RM3A 2HPMA 2VQLA 4RLFA 3C2GA 3K6GA 2VB6A 1D1CA 3L2VA 3FBNB 3ZQQA 3DQVC 4JOMA 4BACA 3EUHC 3GBGA 4PJLA 2M4GA 1E0EA 4XOTA 4PSWA 4F55A 3BCAA 3K70C 5KCMA 2V6EA 4X0GA 4PJJA 2X1EA 2WY8Q 4E4HA 4D9JA 3ZR8X 3RSNA 4BJ6C 4CSWA 4OAYA 3DPUA 4E7LA 4BXFA 2LRDA 1V5EA 3L2UA 3DLAA 4BL0B 3OYCA 1DGWY 2R7WA 2XC7A 4ITVA 2E1MB 2DT7B 4HSRA 4F91B 5LFAA 3L2QA 3A4CA 4AVZA 2X1DA 2GOXB 3EUAA 3U21A 2R7XA 2M0MA 3FKJA 1N77A 2HZDA 2HDWA 1W36C 2V9KA 5CKTA 3PL8A 2XAUA 3OS2A 3BCBA 2X6XA 2ZFUA 2PJRA 1D0ZA 5HLTA 4XR6A 2CMPA 1MNEA 2NOJB 1QHGA 4CCLA 5HVQC 2W7NA 2K5CA 4N4OB 2X85A 3G2BA 2MABA 2KRHA 3W2WA 1LKXA 4FASD 2Z1DA 5FRNA 3SEQA 4DBQA 3OYLA 2A6TA 2PJRB 4OWRB 2LYCA 3KYLA 2R7OA 4CCNA 2ZXIA 4BJ5C 4ANJA 1P9QC 4YEJA 3OIPA 3OR1C 2IXSA 2HPIA 3OIQA 5CQGA 2DCEA 4NQWB 4E7IA 4CCJA 3OL4A 3FHNA 2WAEA 2JVGA 1AA7A 2LG4A 4XNFA 3PNVA 1WJFA 3CESA 1V5GA 3VYSB 2KRCA 4CUGA 4GRIA 4LIUA 4RM2A 2ELJA 2VIXA 3PNYA 3S8PA 4XM3A 2E60A 1U0JA 4KT6A 3RCOA 3DKXA 1J09A 2R7UA 3D5RC 3K4CA 2HU9A 3H9JA 3H9QA 4J00A 4XKBA 1NG7A 1MMGA 3E0JB 2E1MC 2KQRA 2LY1A 3TMOA 1LFPA 1DP3A 3OYKA 3DPTA 3OS1A 2XSJC 3IP4B 3BG7A 3OOUA 4N4NB 3TL4X 4PJNA 3QODA 2P0WA 3LMMA 3S32A 3NWTA 4CCMA 1UAAA 3PSIA 2CFOA 3LSMA 2X51A 3ONQA 2M7BA 3K10A 1LDKB 5CQEA 3QYFA 3AFHA 1SAUA 1QHHD 4YELA 4BQNA 1Z3XA 4DGWB 4NUBA 4XONA 3DU5A 1Y6IA 4PK4A 1X4PA 3DWLE 2VL8A 2XF6A 2MD0A 3AL0B 4PSXA 3RQ4A 2CUJA 3K70D 2DOAA 2VPLA 2V1NA 2E5NA 3OYDA 1MW7A 2CH0A 4BQOA 1PYVA 1WJDA 2AQEA 1D1BA 4D1QA 1Z7LA 3K4NA 2KP6A 2BW3B 3NWSA 3IAM2 4E7JA 2KPMA 3DTIA 3VSLA 4XLHA 1BR4A 3HL2A 1GLNA 4HRIA 3RPUD 3MKWB 3VYTB 3OYGA 4F3QA 2CW8A 2LH9A 1W36D 1WJBA 4B48A 3IAS2 4HG2A 3D5SC 2CV2A 2R7RA 4G6TB 4IX7A 4II2A 2R4GA 3SZGA 3OYBA 2DJIA 4QPQA 4HNUA 1N75A 3FBIB 2WAQA 2WY7Q 2JA2A 3M8JA 2X6YA 4B3XA 4BEHA 4II3A 2HVSA 2VJ5A 2VJJA 2R7SA 1BOBA 3VDXA 3BLYA 2WA0A 3HG9A 3C2HA 4CA0A 1TT0A 1G8XA 2V4JC 4CCOA 1T0FC 1WJAA 4DIQA 2R7TA 2DXIA 2KDOA 3HOSA 1ERDA 2CW7A 4C30A 3SEZA 3S93A 2RREA 3K4BA 2IGKA 1X1CA 4B44A 4BEHB 3OY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPG A;  1KON A;  1MW7 A;  1K6Y A;  1WJB A;  1WJC A;  1WJE A;  3F9K A;  1E0E A;  3HPH A;  1WJD A;  1LFP A;  1WJF A;  1WJA A;  4F3Q A; 
#chains in the Genus database with same CATH topology
 4B4C A;  2JUC A;  3OYJ A;  3QRF F;  3CCY A;  2F4M B;  4WWC A;  1D0X A;  4BAY A;  2R5Z B;  2ZJR F;  3M1E A;  1OLT A;  3LL7 A;  2GAU A;  1N78 A;  4EJT A;  3HUG B;  5DCF A;  3DU6 A;  2A69 F;  2VKH A;  3B02 A;  3MMY B;  1VQ9 I;  1IJW C;  1UZC A;  3DV8 A;  3OYM A;  1ZEL A;  4IZZ A;  2Y0S A;  3OOP A;  1E17 A;  2KLO A;  1TZL A;  2ZJP F;  2GXG A;  1VZ0 A;  5CVV A;  2DQR A;  2XAQ A;  4ZZL A;  1HKQ A;  4Q4Z F;  1YJ9 I;  1P7J A;  1Q1H A;  3SYT A;  2L7K A;  3RKX A;  2A5W A;  4CZZ A;  1SAX A;  2ELK A;  3BQZ A;  4IRH A;  4BGD A;  3R60 A;  1B9N A;  3M8F A;  3B6A A;  3U9G A;  3RPU A;  2W24 A;  1CF7 B;  3I3L A;  1NHA A;  3HEF A;  3V7R A;  2CG4 A;  1XDU A;  2Q2E A;  2VXZ A;  3CP2 A;  5JLX A;  4KIT B;  1DU0 A;  1FJL A;  4A5N A;  4WK8 F;  2D1V A;  4RMN A;  3E3V A;  3L9F A;  5HNF A;  3PM1 A;  3I9V 2;  3T8R A;  4L9N A;  2YPR A;  1RET A;  3TW7 A;  4OIR F;  3WOD F;  5FD5 A;  2DFE A;  2CQX A;  3V42 A;  4XRM A;  5K7F A;  4KIS A;  2K4B A;  1EF4 A;  1U8B A;  5JHU A;  3ESW B;  3FXM A;  3HPH A;  3T0Y A;  1KA8 A;  1X58 A;  1GUU A;  4G7H F;  4A3I J;  1JKO C;  4GXO A;  3KLN A;  2JRT A;  2IVM A;  1OCT C;  3EYI A;  2RNG A;  1JGS A;  2A68 F;  2DAO A;  2VQH A;  2QBY B;  1OYI A;  5LBQ A;  4O6J A;  3OL3 A;  2JT1 A;  3MAJ A;  1WH5 A;  4YG2 F;  4KIG A;  4A3K J;  2OCC H;  2ZNY A;  2LDU A;  2CS3 A;  2V79 A;  5GP9 A;  1LFU P;  3PFI A;  3WG7 H;  1XCV A;  4HOB A;  2IS1 A;  3GXO A;  4KIC A;  1SEU A;  1UG2 A;  1ZRE A;  4MIM A;  1LDD A;  2UZK A;  4PGH A;  2Y9Z A;  2HFH A;  3MQ0 A;  4YFN F;  4ON0 A;  3CLO A;  4IHY A;  3QOE A;  1ZQ3 P;  3GTP J;  1TWF J;  3P9K A;  3LSR A;  4B1R A;  3MFK A;  4NBQ A;  2V9V A;  1WCM J;  2RQQ A;  3NAR A;  4HYE A;  1R5H A;  4UB8 C;  5K7Z A;  4MQV A;  5BPD A;  3NEU A;  3HOZ J;  4JYK A;  1R23 A;  4BQQ A;  2NVU B;  2EFN A;  4BE2 A;  1W5S A;  2L9N A;  5JI6 A;  3K4J A;  1UEL B;  3SJM A;  3DKY A;  4I0A A;  1SMT A;  2LRE A;  2HS5 A;  4A3J J;  2O8X A;  4IQJ A;  4BY7 J;  1BI1 A;  2DYR H;  3DXJ F;  4HZF A;  4XIC A;  3O2P E;  1ZHF A;  1Z05 A;  4AC0 A;  1FBS A;  3J7A Y;  1STZ A;  4IVN A;  3DEW A;  1LVK A;  3I54 A;  2Y2Z A;  3IL2 A;  2MFZ A;  3BWG A;  1AHD P;  4ENJ A;  2Y0S N;  3LFU A;  5KVR A;  5ICF A;  3F72 A;  1FIA A;  5J8F A;  1NK2 P;  2IPQ X;  1SVL A;  3IUO A;  1JKQ C;  2RNJ A;  5FB2 A;  1CQT A;  3JRG A;  2DA5 A;  2XGE A;  1TTY A;  1AKH A;  3S1N J;  3M3Y J;  2J5P A;  3TBI A;  2O61 A;  1OYW A;  3WTY C;  2HVR A;  2MG4 A;  4MFE A;  4Y4R A;  1WI3 A;  5D4S A;  3F8B A;  3MZH A;  2CQK A;  2VKD A;  4ZYE A;  1Z6R A;  1BJA A;  2XAF A;  4KYW A;  2K3P A;  1PJR A;  3LSI A;  1P4X A;  4XOP A;  4JQF A;  5L3E A;  1O4X A;  3H5N A;  1ZLJ A;  2EIM H;  2B9S A;  1ETY A;  4IPA A;  4M72 A;  3LSJ A;  2FJ1 A;  2K85 A;  3B6C A;  1EA3 A;  4ZJZ A;  4Y17 A;  3IV5 A;  1Y39 A;  1VQ6 I;  2XKP A;  2XB0 X;  3OYF A;  4G9Y A;  1WJC A;  1ACI A;  1IDY A;  4G7O F;  2D5V A;  4E6K G;  2L54 A;  1QRY A;  2ZJ2 A;  4PGG A;  3CCQ I;  4L5J A;  4ZYA A;  4NNJ A;  2P8T A;  3VYR B;  1YJN I;  1FMW A;  2BEO A;  2DK5 A;  1UB9 A;  4HW0 A;  5F0C A;  2LR8 A;  2HVQ A;  1YG2 A;  3OYI A;  1V3F A;  1MBH A;  3HOV J;  1VQ8 I;  2DA2 A;  5DD4 A;  1WPK A;  3KYD B;  2X1C A;  5J8C A;  4XN3 A;  2XF7 A;  3Q9S A;  1T33 A;  3HTU A;  2F4O B;  2X4H A;  2DDA A;  1YIJ I;  2ZXH A;  2IBD A;  3FIS A;  3HC7 A;  2Q2E B;  5EEA A;  1XDS A;  3C3W A;  4P1W A;  1MJA A;  3GUD A;  1WJE A;  1YS7 A;  3A1Y A;  4RGU A;  3QP6 A;  2ZNZ A;  1FOK A;  1D1A A;  3DEE A;  4YIR X;  3M07 A;  2DA3 A;  2AHQ A;  3S3M A;  2GM4 A;  4IKF A;  1FTZ A;  4MLO A;  1DGR M;  2MH9 A;  2BHY A;  4CH7 A;  2EK5 A;  1JUS A;  1IO2 A;  3BDD A;  2K4J A;  1CGP A;  5FLX Z;  1DP7 P;  3BZC A;  4XKW A;  5IYD J;  4AVP A;  3TO6 A;  3OV8 A;  5GAE J;  3GYH X;  5GTI C;  1W0T A;  2ZME A;  2HPM A;  1F43 A;  4OMY A;  4N9H A;  1S7O A;  3FBN B;  3ZQQ A;  2V6C A;  4ESJ A;  2DBB A;  4HAM A;  4OOI A;  2KT0 A;  1FBU A;  4PSW A;  3KP2 A;  3A0H C;  2XB5 A;  4PJJ A;  4EJU A;  5AIP A;  3ZMU A;  3E6M A;  2LK2 A;  4E4H A;  3GTG J;  3BP8 A;  4CSW A;  4D7N A;  2FE3 A;  4OAY A;  4L0Z B;  2MW8 A;  2LRD A;  4C3J J;  2EQR A;  1PDN C;  1DGW Y;  4AD9 A;  3LAP A;  2DPD A;  1K83 J;  2E1M B;  2HQ5 A;  2DT7 B;  2P6S A;  1LVA A;  4F91 B;  5LFA A;  3A4C A;  4HBL A;  3VFZ A;  2EZL A;  2X1D A;  3EUA A;  2XRO A;  2LD5 A;  2VBX A;  2GXB A;  1NH3 A;  2OF7 A;  1ZRD A;  4KFC A;  5J4V A;  4M71 A;  4I6Z A;  1A5J A;  2XAU A;  1GXQ A;  4OIQ F;  3MZ8 A;  1O7F A;  1ZGA A;  2X6X A;  1IXR C;  2E2H J;  1G3W A;  1WRJ A;  1RKW A;  2XAH A;  3RIR A;  2VOD A;  2CMP A;  1MNE A;  5ILV A;  3O8H A;  1QHG A;  4CCL A;  5HVQ C;  3CJN A;  2W7N A;  3PIO F;  5EGO B;  4YIF A;  4AID A;  2Y48 A;  3LSP A;  2X85 A;  1I5Z A;  2ZBK A;  4YFX F;  4HX4 A;  2JA8 J;  3GTO J;  1AKH B;  1KYW A;  3LAJ A;  4QLC U;  2OPT A;  1LFB A;  1I6X A;  3SEQ A;  2LTP A;  2PJR B;  2DT5 A;  3I53 A;  3KYL A;  2EIK H;  3OIP A;  5HLI A;  4UVC A;  4CDG A;  3OIQ A;  5CQG A;  2DCE A;  2K02 A;  2OCE A;  2ID3 A;  4E7I A;  1A35 A;  4JK1 X;  3GX4 X;  3J80 Z;  2LG4 A;  4XNF A;  3CES A;  2QM3 A;  3LA3 A;  2KRC A;  4GFB A;  1DDN A;  2NS7 A;  4NB5 A;  3PNY A;  3UKG A;  3A03 A;  4EMS A;  4KT6 A;  4TV7 A;  2JA5 J;  1VQO I;  2IP2 A;  2R7U A;  3K4C A;  1KU3 A;  4RS8 A;  3H9J A;  1U8R A;  1ZLK A;  2A6H F;  5IOY A;  4XKB A;  2E1M C;  3OYK A;  4L18 B;  3DPT A;  5J1U A;  2HYG D;  3OS1 A;  1AU7 A;  1YIO A;  2VC0 A;  3TL4 X;  2ISY A;  4D7M A;  1X2N A;  1TW3 A;  2FF4 A;  2HYJ A;  2P6T A;  3S2H J;  2DTZ A;  1QPM A;  3S2W A;  1YW8 A;  1TW2 A;  2O9L A;  3DCF A;  5CQE A;  2CO5 A;  3ABU A;  1U3E M;  2R3S A;  3Q3S A;  4BQN A;  1Z3X A;  2M8G X;  2BBY A;  4NUB A;  2M5W A;  5LHI A;  1I3Q J;  4A3L J;  1Y6I A;  3M8E A;  1MBF A;  1VQK I;  3DWL E;  1SC7 A;  4A3C J;  2VL8 A;  5CVU A;  4Z2Y A;  4U0Y A;  4BXX J;  3IWZ A;  3JCU C;  3B73 A;  4WF2 A;  1KU9 A;  5EG0 A;  1JTX A;  1MW7 A;  2FQ3 A;  3M7G A;  4BQO A;  1YRN A;  1WJD A;  1O3Q A;  1FP1 D;  3S15 J;  2XAG A;  1BJZ A;  2X48 A;  4RDU A;  3HL2 A;  1B1B A;  1K7A A;  2ZME B;  2PQ8 A;  3J7Y J;  2MD5 A;  4M6Y A;  3RPU D;  5FFZ A;  1MNM C;  3CO7 C;  3ZQC A;  3D5S C;  1MSE C;  2CV2 A;  2O7O A;  1ZKG A;  2Y0M A;  2R7R A;  3L7W A;  1BC8 C;  3JW4 A;  1ZG3 A;  3BJA A;  1XSV A;  2R0Q C;  3A01 A;  3OYB A;  5FGM A;  4Y52 J;  4QPQ A;  1YW7 A;  1XSD A;  1N75 A;  4LLL A;  2H94 A;  2L0K A;  3ISP A;  5DYM A;  1SD4 A;  3KPH A;  2WA0 A;  3HG9 A;  2CU7 A;  3ZQG A;  4CA0 A;  3WU1 B;  4PCQ A;  4RA2 A;  1OR7 A;  1T0F C;  1WJA A;  1HW5 A;  4DIQ A;  2DXI A;  2KDO A;  4IEJ A;  5LHH A;  3SEZ A;  5LEK A;  2ID6 A;  2QYO A;  3H1C A;  1QO0 D;  3K4B A;  1TWG J;  3IRQ A;  1ZYR F;  4EGY A;  1FTT A;  2MYS A;  3CJQ B;  3TGN A;  1LDJ A;  4XRS G;  4V2F A;  5DUI A;  2CV0 A;  4DJA A;  3MKZ A;  5K5Q A;  1HSJ A;  1WZ2 A;  1FNN A;  2DFH A;  3OYE A;  2GOM A;  2JPC A;  5D8L B;  3GEZ A;  1VQN I;  5HOD A;  4I99 C;  4AWX B;  3GTL J;  1QA6 A;  2EV6 A;  2GBY A;  5IT3 A;  2R7V A;  1QPI A;  1EKE A;  1XGS A;  2A07 F;  1EV7 A;  4M9X A;  2Z2S B;  2ZME C;  3KP6 A;  5E79 C;  1YOV B;  3CDH A;  4JX6 A;  3FXR A;  1HF0 A;  3LQQ A;  4A6D A;  2LY2 A;  2Z99 A;  3KEY A;  2EV0 A;  3PUB A;  5EEH A;  3VPR A;  2H8W A;  2VC1 A;  3L09 A;  1UHM A;  3CMM A;  2DLL A;  2CJJ A;  2HI3 A;  4HX8 A;  2HNH A;  1XTA A;  3LA2 A;  1O3R A;  2JTV A;  2XKO A;  5HNH A;  2QBY A;  2WWY A;  4I0B A;  1YX3 A;  2E2I J;  1TQI A;  3WE3 A;  5M5W J;  1SD5 A;  3QPS A;  4PFP A;  1FY7 A;  4BUP A;  3ABK H;  2BGC A;  2NOG A;  1YO5 C;  4H4K C;  2JA7 J;  1VQ5 I;  3VSK A;  1SFE A;  3GWZ A;  5IYB J;  1Z77 A;  3DPL C;  4LG3 A;  1SD7 A;  1Y1V J;  2YX4 A;  4AUX A;  5D5W B;  3UR3 C;  1W5C C;  2HTJ A;  4XLC A;  3LWF A;  4DQ2 A;  3U1D A;  4RB2 C;  1R7J A;  2N8G A;  1KQ9 A;  1UJ8 A;  3ZMS A;  2KZV A;  3FXJ A;  4U7B A;  1YE9 A;  2DI3 A;  3D5L A;  1A04 A;  3KX2 A;  4HDV A;  5F1J A;  5E8I A;  5CJ9 A;  3KYC B;  2X6W A;  4NC7 A;  2IS6 A;  2BYV E;  5FKO A;  1LB2 A;  1JHF A;  3OWT A;  3EUK L;  3ZN1 A;  4R79 A;  3E5X A;  3RJP A;  4U87 A;  4MEY F;  1WI9 A;  2KIS A;  3BPX A;  2K9S A;  2UXN A;  4PUS A;  3FMR A;  3WTV C;  5FFX A;  4XLA A;  3BG3 A;  2P7V B;  3QP5 A;  3GFL A;  5E3N A;  2MBF A;  5EG0 B;  2IRF G;  2L5Q A;  1ULY A;  4WXH A;  4FIS A;  2IA2 A;  3ZRG A;  4ASN A;  2W57 A;  2H1K A;  5HDK A;  3J81 K;  2VQC A;  1YRN B;  2XPU A;  2OTL I;  2P5V A;  2QQ9 A;  2DYS H;  2GLO A;  1HC8 A;  1EJ9 A;  3BJ6 A;  3K4L A;  2O6G E;  3K1N A;  2GIV A;  3CJR B;  1BA5 A;  3BR0 A;  1FMV A;  2ZXW H;  1XC5 A;  4L5E A;  5KNL A;  3JRI A;  2E1C A;  3OYN A;  4MEX F;  4IHX A;  1YX5 A;  3O6B B;  2M7A A;  1G59 A;  2HOS A;  1ZAR A;  2JZY A;  1SAN A;  5B66 C;  2W82 A;  4Y13 A;  3BG5 A;  5CVI A;  3L2C A;  2R93 J;  4LIV A;  2EFO A;  2EZI A;  3FIW A;  1HXD A;  2DOE A;  2L4A A;  2EA4 A;  4OIP F;  5K5O A;  4E7S A;  1U6G A;  2Z16 A;  2HZT A;  2K86 A;  2R7Q A;  2VJI A;  2E36 A;  4OAZ A;  2E2J J;  3SDG A;  1NG6 A;  2KJC A;  2MSY A;  3G6E I;  2XRL A;  1JE8 A;  4GDF A;  1Z3Y A;  3CDL A;  3W2A A;  2AXL A;  1C0W A;  2NVX J;  4ZTJ A;  4ZTF A;  3QOP A;  1Z21 A;  1G3T A;  3M4O J;  1UHS A;  2HKO A;  2KKO A;  2JN6 A;  1BN5 A;  2ESH A;  4MTE A;  2BY1 A;  2Q1Z B;  1FWZ A;  1WFX A;  4A5M A;  3RKQ A;  5KK1 A;  2A05 A;  4UV8 A;  3H3Z A;  3WE2 A;  2OQR A;  4KJZ A;  2M4K A;  2HXO A;  3BC8 A;  3F9K A;  3PUF A;  3CCS I;  5F08 A;  1HBX G;  3JRD A;  5LGN A;  1WHU A;  1X4O A;  4NC6 A;  3CUQ A;  3FKI J;  2YX7 A;  2WAD A;  2I8D A;  5ICC A;  3OS0 A;  2WAF A;  1X1B A;  1EH8 A;  4KN7 X;  1BI0 A;  1MJ9 A;  2L7F P;  3GZN B;  3ZMV A;  4PFO A;  4N0B A;  3RDI A;  5HOO A;  1R6R A;  4JX5 A;  4ZZD A;  3C1D A;  2KDZ A;  1XX5 A;  2LP0 A;  4BE1 A;  5J3L A;  1ETK A;  2MGQ A;  2XDV A;  4MGR A;  5LRR A;  2IGO A;  3GZ5 A;  2HQN A;  2P81 A;  2D1H A;  5TRD A;  3LA7 A;  1SD6 A;  5FKL A;  3FXK A;  3WTU C;  2DMP A;  2LSO A;  3BR3 A;  2M34 A;  2V26 A;  2KIU A;  4BHP A;  3LSH A;  4R8H A;  1DQU A;  2VT2 A;  4ENM A;  3HSR A;  1KGS A;  2EZK A;  3AG4 H;  5IPA A;  5LGU A;  1LEB A;  1S6L A;  2I10 A;  1SFO J;  5FRO A;  1Z9C A;  1RKT A;  2EPF A;  1D8J A;  4A2U A;  2QCO A;  2RKH A;  4XMY A;  1HOM A;  4XOR A;  3FMQ A;  2W4S A;  1IN7 A;  5L3F A;  5IT9 K;  2L7M P;  2CRG A;  2H6B A;  3OYA A;  3CCV I;  1B6A A;  2JWT A;  4HNT A;  2F5C A;  4YFK F;  4F7Z A;  3S3N A;  1BR1 A;  2R5Y B;  3ZGK A;  2JJ7 A;  1TWA J;  4C9Y A;  1OR7 C;  3I59 A;  3GTK J;  2CFX A;  1K6Y A;  1MND A;  4FET A;  3KET A;  3L2W A;  3CQZ J;  2FRH A;  2BY0 A;  2KIF A;  4B47 A;  3VOE A;  2W84 A;  2GIZ A;  4B43 A;  5D4R A;  4M3D A;  4C2U A;  2HQA A;  1NK3 P;  3JRE A;  3C2G A;  2B7E A;  3K6G A;  3F22 A;  3WTZ A;  2QA4 I;  1W7P A;  3QU6 A;  1OQY A;  2K9Q A;  2ME6 A;  3GBG A;  4PJL A;  4GYI A;  1LEA A;  2FEZ A;  5BPI A;  1F4K A;  2JA6 J;  2ECC A;  5H6Q A;  5BOX A;  1G4D A;  2PMU A;  1XGM A;  5B1B H;  4X0G A;  1QZY A;  1RI7 A;  2OZU A;  1S7E A;  1FLI A;  1P6R A;  2VPR A;  4D9J A;  3RSN A;  4BJ6 C;  3JSP A;  3GVA A;  4ZYD A;  1P2F A;  3JRA A;  2HGC A;  3I0T A;  1IRZ A;  5AIQ A;  2F5E A;  4BXF A;  2AXT C;  5ED4 A;  2EIL H;  3V8K A;  2XC7 A;  1I39 A;  5IP7 J;  4HSR A;  1MH3 A;  3CUO A;  3U21 A;  5EGO A;  2M0M A;  5J47 A;  5LRS A;  3FKJ A;  1XD7 A;  2HZD A;  2IJL A;  2RQP A;  3KCC A;  1XGN A;  2V9K A;  3AG1 H;  3OS2 A;  3F8N A;  1RPW A;  2PJR A;  3F6V A;  3K1P A;  1IUY A;  4RGS A;  4BNC A;  1LE8 B;  1TLH B;  4RAZ A;  5ERI A;  3BR5 A;  5BQT A;  5E3M A;  3I55 I;  1MBG A;  1YLF A;  2DQL A;  2R92 J;  3S17 J;  4LB5 A;  1D3Y A;  2UXX A;  3NAU A;  1R71 A;  5BMZ A;  2KRH A;  3W2W A;  3TW6 A;  1LKX A;  4EGZ A;  3CCU I;  3E5Q A;  2EA2 A;  3OYL A;  1PVE A;  3U1K A;  2G9W A;  1OCP A;  2LYC A;  1VQP I;  2R7O A;  4BJ5 C;  4ANJ A;  3AG2 H;  2PLY A;  1FYL A;  2BY3 A;  3HIF A;  2NVT J;  5EF6 A;  3M9A A;  2R7F A;  5F27 A;  2NAZ A;  2NVY J;  1FPQ A;  2CGP A;  2PN6 A;  1W5T A;  4CCJ A;  3WGH A;  1SMY F;  2JPB A;  4G8X A;  3FF5 A;  2EFW A;  1R58 A;  1ZGJ A;  1WJF A;  3CUQ B;  4GRI A;  1DPU A;  2BXZ A;  3FXU A;  2ELJ A;  4R1H A;  1R1T A;  5FO5 A;  4XM3 A;  2E60 A;  4M6V A;  3CD6 I;  5LHG A;  3C7J A;  2QEX I;  2QEN A;  1XCB A;  3D5R C;  1IRF A;  5DDG A;  4FCY A;  2PEX A;  3RI4 A;  3QQA A;  1T0F A;  4A3F J;  2W48 A;  1ZG5 A;  2KQR A;  2QQ8 A;  2XGD A;  3BG9 A;  2VI6 A;  2FQ4 A;  1F5T A;  3IP4 B;  3OOU A;  3BG7 A;  4PJN A;  2L01 A;  5DS9 A;  2FML A;  5K1Y A;  4FTH A;  2BHZ A;  5IOZ A;  1EH7 A;  5DM7 F;  5B3S H;  2FX0 A;  4A3G J;  3QYF A;  3AFH A;  4DGW B;  3A02 A;  1Z91 A;  5FJ8 J;  4GO1 A;  1A31 A;  3DU5 A;  1EH6 A;  1I1S A;  2VT3 A;  1B72 A;  4HLX A;  5JFR A;  2XF6 A;  4B8X A;  4XBF A;  4G6D A;  3JSO A;  3K2Z A;  3AL0 B;  4PSX A;  5E20 A;  2FNA A;  3RQ4 A;  4C3I J;  4KA4 A;  2P5L C;  1HDP A;  4UY8 I;  1WGX A;  5DUK A;  1B8I B;  1YJW I;  1Y8R B;  4A3M J;  2VPL A;  2NRA C;  3ZMZ A;  4HNV A;  1Y0N A;  2BY2 A;  1KYZ A;  4BHC A;  3CCJ I;  4DYQ A;  2Q8K A;  4AIK A;  3I59 B;  3KZZ A;  5DCM A;  2AQE A;  4CYD A;  1D1B A;  1Z7L A;  2KP6 A;  4E7J A;  2CW0 F;  1WH7 A;  2A3S A;  2VKV A;  5HDG A;  3KP5 A;  3ULQ B;  2QVO A;  4H0E A;  5HS9 A;  1PUE E;  2QQB A;  4LMY A;  4HRI A;  1MBK A;  4XLP F;  1TC3 C;  3S1M J;  5BS6 A;  5D5X B;  3CUQ C;  4F3Q A;  2LH9 A;  4XID A;  1W7P B;  1ETO A;  4V19 K;  3TQN A;  3MVP A;  1J7K A;  1S8N A;  1VI0 A;  3ABL H;  3TP3 A;  4M6X A;  3MWM A;  4N9I A;  1FOW A;  2BE5 F;  3ZMT A;  2G0E A;  5FKM A;  3RQI A;  1JJ8 C;  3COA C;  1BC7 C;  1U9O A;  2DJI A;  2FOK A;  3HB9 A;  5M5X J;  3FBI B;  2WAQ A;  4UHT A;  5C44 J;  2HVS A;  3WTX C;  1T08 B;  2VJ5 A;  2R7S A;  1BOB A;  1APL C;  2M2E A;  2QUF A;  3KZI C;  2O8K A;  3SHF A;  5KAF C;  3C2H A;  5DM6 F;  1TT0 A;  1FX7 A;  1IC8 A;  3TP0 A;  6PAX A;  1FOY A;  3S16 J;  1KU7 A;  4M3B A;  1ERD A;  2CW7 A;  2E1O A;  4C30 A;  3ROU A;  2RRE A;  2IGK A;  3F6O A;  3LNQ A;  3LOC A;  3Q0U A;  1MD0 A;  4B44 A;  4IL6 C;  4BEH B;  2JSP A;  4KNY A;  3IH2 A;  3AL0 C;  3ECO A;  2RGV A;  4RAF A;  1KQ0 A;  3HOW J;  4L5I A;  2M0C A;  4A69 C;  4D5F A;  2X0L A;  4DZJ A;  1X1D A;  2MA3 A;  4BU2 A;  5M3M J;  3FXO A;  2V7F A;  1E3H A;  3C2B A;  2STW A;  1FP2 A;  1R00 A;  4FE7 A;  4EV0 A;  5TGT A;  3HOU J;  4LGW A;  3ZCO A;  4BHB A;  2F48 A;  2Z3Y A;  4LK1 F;  1V54 H;  2WBM A;  2HR3 A;  3ZQ7 A;  1TQP A;  2CV1 A;  2JMW A;  1T8I A;  4KUM A;  5IY5 H;  3DBL B;  3E5U A;  4AU7 A;  4CHU A;  1MMN A;  4K2E A;  1LJ9 A;  1ZG1 A;  2F6C A;  4PJM A;  3H9G A;  3PSF A;  4E7Z A;  3GTJ J;  5ICG A;  3HJE A;  1OFC X;  2PX9 A;  1QZZ A;  3MKL A;  2RAE A;  5D5U B;  4Y7N J;  4W97 A;  2EWN A;  1VTN C;  4XKV A;  4L9J A;  1AWC A;  3CDI A;  2IS2 A;  3R61 A;  3FDY A;  4IRG A;  4BE0 A;  2COB A;  1M1E B;  2WV1 A;  4CZC A;  3MEX A;  2VAS A;  2XF5 A;  3SZP A;  3VWB A;  3H36 A;  4EVI A;  5KAI C;  4BDY A;  4B09 A;  1S7A A;  1SFK A;  4LIT A;  1V55 H;  1K61 A;  3JTH A;  2DA1 A;  2UV1 A;  3H5R A;  3O3K A;  1H9T A;  3W3C A;  3RZO J;  3QYE A;  1K4S A;  3HPG A;  1B9M A;  1I1G A;  2O3F A;  2DDB A;  2XRN A;  2DA6 A;  2F5V A;  4J01 A;  3G1O A;  5AON A;  4RB3 C;  4O3M A;  5F64 A;  4LB6 B;  5FRM A;  3AKZ A;  3NRV A;  5F0F A;  4AYB A;  4M9S A;  2DW4 A;  1GV5 A;  2GQQ A;  2KHM A;  2LLK A;  2LBF A;  2ZJQ F;  4F52 A;  3LSK A;  4Y33 A;  1S9H A;  2W1O A;  3G1L A;  3CP8 A;  4DYR A;  4BQA A;  2CQQ A;  5FLV A;  2HKX A;  3GME A;  2FUG 2;  1X3Z B;  2WAQ N;  2RVC A;  5ICE A;  1JT0 A;  3T5X A;  4XSX F;  1REP C;  1B72 B;  1YIT I;  3GCM A;  3KP4 A;  1F1Z A;  1UFM A;  4BJT A;  2PMZ A;  3F8C A;  3FMS A;  3HHG A;  3CCR I;  2OD5 A;  1UG0 A;  3HOX J;  1BL0 A;  4EM1 A;  4LOC A;  1ETX A;  3ERM A;  5A2Q K;  1X1P A;  3DKW A;  2DFF A;  2EFP A;  3BRO A;  3GO5 A;  4ZC3 A;  3N97 A;  1VQ7 I;  1RES A;  2DT6 A;  5DCM B;  2E34 A;  2HQR A;  1I3A A;  5GPA A;  2FU4 A;  1IRG A;  1ODD A;  4AIH A;  1W1W E;  2AO9 A;  4V2G A;  3Q0V A;  3WGG A;  4HST A;  2UWM A;  2PJP A;  3G3Z A;  3HXL A;  1OJL A;  2LOO A;  4C2T A;  2ZC2 A;  1ZAO A;  4J19 A;  4I09 A;  1IRX A;  1KZH A;  1S29 A;  3DP7 A;  2L9R A;  4RB1 A;  2BV6 A;  1YS6 A;  3CTA A;  3K2A A;  4MTD A;  3K7A J;  3ZOB A;  4Z6Y A;  2PG4 A;  5DTD A;  5E3L A;  4CXF A;  2E5Z A;  4IHT A;  2KRF A;  1SFX A;  2E35 A;  2DOD A;  2FA5 A;  2L2O A;  1UST A;  2L4M A;  3WG9 A;  1FYM A;  3PO2 J;  1QQI A;  5F1R A;  1E3O C;  1BBY A;  2LKP A;  3KFW X;  1WQ2 A;  2NNN A;  5IP9 J;  1R5I D;  4UVB A;  1QZE A;  3VB2 A;  4NC8 A;  1GT0 C;  4BY1 J;  3REO A;  3S14 J;  2EFQ A;  4Q47 A;  1G3Y A;  4ZDP A;  4FT8 A;  3ZMD A;  1TT5 B;  2R7D A;  3FXQ A;  3ASN H;  3UNG C;  4ESB A;  1ZN2 A;  2K40 A;  2MC4 A;  2VXD A;  2VOO A;  2BOL A;  2STT A;  3GLX A;  5KHD A;  1RNL A;  1J59 A;  5TIS C;  1VFC A;  4F92 B;  4OIN F;  1I6H J;  2XSD C;  1Y56 A;  2EB7 A;  3CME I;  2K9L A;  1HW2 A;  2BZT A;  4ABZ A;  2YU3 A;  2HTS A;  2IGN A;  4AYB N;  2HYF A;  3V8J A;  4DOZ A;  4M3F A;  1XPX A;  2YS9 A;  2W00 A;  2FBK A;  3I4M J;  3QWL A;  1ZTR A;  4ZDL A;  2KL4 A;  5DV5 A;  1Z1D A;  3BT9 A;  3WTT C;  2FSW A;  3A2K A;  1O57 A;  2QKL B;  2QSG X;  2XIG A;  2CQ7 A;  2BXY A;  3CC7 I;  3MKY B;  1V4R A;  3S3O A;  1MIJ A;  1OCC H;  2ZSH B;  2I5U A;  2PMZ N;  5LD2 C;  2M30 A;  1POG A;  4RBO A;  3JAM K;  4XL9 A;  2R5Y A;  3K4M A;  4XLE A;  1YI2 I;  2G7H A;  5L3D A;  1RUN A;  2UUZ A;  5HDN A;  3W2V A;  5H2F C;  1G6N A;  2OV7 A;  1BOA A;  4AIJ A;  2WV0 A;  2OAZ A;  4AM3 A;  2QF7 A;  3N05 A;  1X3U A;  3I71 A;  3RTR A;  3PJR A;  2RN7 A;  3S1R J;  3IHU A;  1VQM I;  2PI0 A;  2O03 A;  1FYK A;  1MJB A;  1YTY A;  3BTI A;  1I27 A;  3HKZ A;  3JTG A;  2B63 J;  1TNS A;  2DOF A;  3LFK A;  3LSG A;  3X2Q H;  3L2R A;  4IF4 A;  1WJ5 A;  5HS8 A;  4ENK A;  4IOA F;  4W1U A;  4OU0 A;  1QGP A;  2BW3 A;  2IA0 A;  4ENN A;  2VE9 A;  2LBF B;  2L9S A;  4QIW N;  2E71 A;  1K79 A;  2ZO4 A;  1IV8 A;  4GCV A;  4RM3 A;  2VQL A;  4KMU X;  2QQA A;  4C3H J;  2H8R A;  3LST A;  3L2V A;  5M5Y J;  3DQV C;  2D45 A;  2GXA A;  2K27 A;  3R0A A;  3HRU A;  3DBH B;  2YUS A;  4UUT A;  1MZB A;  2D2W A;  4FX4 A;  1J0R A;  3F23 A;  4DW6 A;  3BCA A;  2XV4 S;  1PUF B;  5KCM A;  2V6E A;  4EJV A;  3D0S A;  5J40 A;  2X1E A;  3DLL F;  4I2O A;  3GW2 A;  1XMX A;  5F04 A;  1XMA A;  1XGO A;  2NXN B;  1ZRC A;  1GHC A;  2HXI A;  5D6E A;  1R36 A;  2GA1 A;  2CYY A;  3V4G A;  3G4S I;  4M74 A;  4E7L A;  1FC3 A;  3HOY J;  1TP4 A;  2P4W A;  3CMA I;  1UCR A;  4BL0 B;  3OYC A;  2R7W A;  4WXC A;  1Q1V A;  1LE8 A;  4OMZ A;  3L2Q A;  3RYP A;  5DD8 A;  4AVZ A;  2EIJ H;  4I02 A;  5ILS A;  3D1N I;  3G1M A;  1A6Q A;  2HDW A;  5CVR A;  1U78 A;  4IHW A;  5EZH A;  5CKT A;  1H88 C;  2EJR A;  4MO7 A;  3VOD A;  4XRS A;  3ABT A;  2IEK A;  3WU2 C;  4U7D A;  3BCB A;  1XS9 A;  4P55 A;  1D0Z A;  3HGG A;  1Z67 A;  9ANT A;  2E1N A;  2C6Y A;  2VBZ A;  2NYX A;  3FM5 A;  4QSH A;  4MQ9 F;  2Y69 H;  3LQR A;  1ENH A;  1JUM A;  3Q9V A;  2H27 A;  1H89 C;  3E7L A;  1ZRF A;  3ELK A;  3U2R A;  3G2B A;  1FSH A;  2ECB A;  4HLY A;  4FAS D;  2Z1D A;  3R0J A;  4UUS A;  3HTS B;  5FRN A;  2E19 A;  3T8T A;  5IT9 Z;  4ZYG A;  2CWE A;  4M3E A;  3KE2 A;  1ONV A;  4Q5S F;  2HOA A;  4EJO A;  1A6I A;  1RIO H;  1P9Q C;  1T2K A;  5J4Y A;  5EEG A;  1VF9 A;  4LK0 F;  3W6V A;  3GTM J;  4MNU A;  1PP8 F;  4NQW B;  3GFJ A;  3CCL I;  4UV9 A;  3EQL F;  3FHN A;  4HF2 A;  2HOT A;  3HKZ N;  4LFU A;  1ON1 A;  1FEX A;  5FD6 A;  3VYS B;  2ZB9 A;  4RM2 A;  2DMU A;  3CMY A;  1ORK A;  1D8K A;  3H92 A;  5H6R A;  1U0J A;  2GWR A;  3RCO A;  3JRC A;  2K3F A;  2ZKZ A;  1OIS A;  2OZ6 A;  1J09 A;  1Z7U A;  1GDT A;  2A5Y B;  1VQL I;  3P9I A;  4OIO F;  3H9Q A;  1NG7 A;  1MMG A;  2OU2 A;  1T98 A;  1XSX A;  3E0J B;  3NQO A;  2NNY A;  1IDZ A;  1HCR A;  4MHG A;  4A12 A;  1HST A;  3ASO H;  4N4N B;  3ECH A;  2XAS A;  2VE8 A;  4JP0 A;  3OSG A;  2FBI A;  4GYG A;  3CC2 I;  2L7Z A;  1TBX A;  3IC7 A;  3S32 A;  3Q5F A;  2FMY A;  3NWT A;  5IP6 A;  1B8I A;  1UAA A;  3H3V K;  1U5T A;  3PQK A;  3PSI A;  2CFO A;  3LSM A;  2X51 A;  2ZFW A;  3V7S A;  1WSU A;  3IKV A;  4EM0 B;  1N25 A;  2OBP A;  2K9N A;  1SAU A;  4LG0 A;  4BYY A;  1QNT A;  2F2E A;  3BPV A;  4XON A;  2FXA A;  1FT9 A;  1K78 A;  1OCO H;  1T38 A;  1ZH5 A;  1QVU A;  2MD0 A;  4O5V A;  1DU6 A;  2H6C A;  4A3D J;  1ETW A;  3DEU A;  2Y9Y A;  4ETS A;  2DOA A;  3J7Z I;  1IXS B;  2LKS A;  4I7H A;  1ZGW A;  1KU2 A;  3K69 A;  2EIN H;  3OYD A;  2PFB A;  2FOW A;  3KIO A;  1E2X A;  2PMH A;  1Y8Q B;  2CSO A;  3QPH A;  3I4P A;  3FK7 A;  2BW3 B;  3K0L A;  3K4N A;  4QWQ A;  4XRF A;  1E3P A;  4L9V A;  1ETQ A;  2DA4 A;  4A0Z A;  2XHK A;  3DTI A;  3HZJ A;  3VSL A;  1K6O A;  3F8F A;  2K7L A;  4KN4 X;  1GLN A;  1B59 A;  2LMD A;  4B3A A;  2XGC A;  3VYT B;  3MKW B;  4A3E J;  2CW8 A;  1RC9 A;  2QLZ A;  3BJO A;  4Y15 A;  3IKT A;  5E1W A;  1R1V A;  3OSF A;  2G7U A;  1WJB A;  3IAS 2;  3EET A;  2EV5 A;  1GXP A;  4G6T B;  4II2 A;  2J5O A;  5FKN A;  2R4G A;  5EZG A;  1F9N A;  3SZG A;  5D6F A;  2LF8 A;  3RKY A;  3GFM A;  3M8J A;  4LLN A;  4B3X A;  4KMF A;  4M73 A;  4BEH A;  3OIO A;  2VJJ A;  3GZ6 A;  1IN6 A;  2LNB A;  2OTJ I;  3MCZ A;  1P7I A;  2OJE D;  4PJ0 C;  3ZQH A;  2VN2 A;  2NS0 A;  1XMK A;  3FM3 A;  2ACJ A;  3R4K A;  3P5J A;  4RAY A;  5E18 F;  1ZR4 A;  3HOS A;  3S93 A;  4UNO A;  4BXU A;  2Q0O A;  1Y0U A;  3BZK A;  5BNG A;  2DTR A;  3OY9 A;  3ZP5 A;  5E17 F;  4BDZ A;  2BVM A;  3W6J B;  2L02 A;  2GA2 A;  2EBI A;  2GZW A;  4FHT A;  4DYC A;  2DMN A;  4DBR A;  1O3T A;  2CUZ A;  3HRT A;  5M3F J;  1X3W B;  3EUH A;  3K4K A;  1QU3 A;  2WTE A;  2H1L A;  1G3S A;  3PFY A;  5J1Y A;  2QSH X;  1GVD A;  1U2W A;  5JHF A;  3TED A;  3CZ6 A;  2A61 A;  4FE4 A;  4BKX A;  4CYC A;  4E7K A;  2JVH A;  3FXL A;  3AAF A;  1ITY A;  1IN5 A;  2VBY A;  4UUS B;  1JUP A;  1MMD A;  4NDL A;  3SFZ A;  5F6F A;  5LGT A;  1OKR A;  1JI8 A;  3TDZ C;  1L0O C;  4RAG A;  2LC2 A;  3DTK A;  1TWC J;  1IUF A;  1TQM A;  2OC6 A;  1LNW A;  1J5Y A;  4S05 A;  2IS4 A;  2K9M A;  4CIC A;  1HKS A;  2KIQ A;  2O5R A;  3E1S A;  2F5D A;  2HDD A;  4XK4 A;  5JR3 A;  1R1U A;  2JUG A;  3CLQ A;  1RR8 C;  2CQN A;  3BTC A;  3L00 A;  3H0D A;  5L3C A;  2XVC A;  3P7N A;  1IN4 A;  4UXN A;  2TDX A;  4NHJ A;  1RZ4 A;  3FX3 A;  2KMU A;  3VYU B;  2OA4 A;  2ZSI B;  4KDP A;  1AOY A;  4UB6 C;  1L3L A;  4IHS A;  2XPV A;  1KON A;  3H35 A;  3OR2 C;  3P9C A;  4S04 A;  3E6C C;  3S2D J;  4U0W A;  1BIA A;  3BQY A;  2RV8 A;  1G2H A;  3EYY A;  3KEQ A;  3MD2 A;  2MLG A;  3ZXS A;  3G71 I;  3SXY A;  2FD5 A;  3E6B A;  2XAJ A;  1LUJ B;  4A3B J;  1U5T B;  3CF2 A;  4FX0 A;  3HHH A;  3SDB A;  2LVS A;  3HOT A;  1VND A;  2Z9O A;  4HPQ A;  1OMI A;  2IT0 A;  4EAT A;  4LG0 B;  1HKT A;  4QPO A;  3BR2 A;  2JRM A;  2V9P A;  5EYR A;  1HA8 A;  3HRS A;  2ISZ A;  3CJT B;  2HDC A;  5C4X J;  4UUV A;  1K78 B;  3QU3 A;  3CO6 C;  5FKK A;  3BR6 A;  3RZD J;  3PNT A;  4JX4 A;  5FLM J;  1D5V A;  1HLV A;  2Z33 A;  4PZJ A;  4RGR A;  4L0Y B;  3DF8 A;  3MZY A;  2NVQ J;  4QTR A;  2WC2 A;  3OYH A;  3KP3 A;  1Y1W J;  1GV2 A;  2H09 A;  3J7A O;  1IGN A;  1O7L A;  1FOX A;  4L9T A;  4ESF A;  2E7X A;  2HOE A;  3OMY A;  1HW1 A;  1WVR A;  1YHQ I;  3T1B A;  4ZDO A;  1D0Y A;  1PP7 U;  1OPC A;  2AQF A;  2M8E A;  3F0C A;  2M45 A;  3GFI A;  2O0Y A;  3HGY A;  5K5R A;  5EJC A;  1BI3 A;  4EEF G;  4I98 B;  1IW7 F;  4IO9 F;  3H5A A;  5GAD J;  3IRR A;  3ABM H;  3I58 A;  3QPT A;  3TO9 A;  3Q0W A;  5K7H A;  2VQG A;  2V1D A;  1X19 A;  2YSR A;  2VOP A;  4XLF A;  5J1R A;  2DPU A;  4FQG A;  3QPL A;  1IN8 A;  2LY9 A;  1IF1 A;  2EH3 A;  1MBJ A;  2JSC A;  2VBW A;  4Y3O A;  5FLX K;  4U0V A;  3VEP A;  3DTE A;  5D8K B;  1HDD C;  1KQ8 A;  3M1C A;  3PIP F;  2MLK A;  1JJ6 C;  1F36 A;  4P5O A;  3R6S A;  1U5T C;  5HS7 A;  5EDN A;  2PBI A;  4C2M J;  4XKC A;  2M3A A;  1HQC A;  4LJZ F;  4HDU A;  1JXS A;  3HBL A;  2COM A;  1T95 A;  4I01 A;  5B1A H;  1W0U A;  4BBS J;  1YFH A;  3BG6 A;  1B4A A;  4F93 B;  4CCK A;  3KP7 A;  4PDK A;  2Z5U A;  3KZY A;  2DN0 A;  3BY6 A;  4IQ4 A;  4HA8 A;  4D5C A;  4DNC A;  3MN2 A;  4YRV A;  5E3O A;  4G12 A;  4RLQ A;  2IAI A;  3SQN A;  1X1A A;  4CYC B;  1W4M A;  1RUO A;  3H3U A;  1T39 A;  3BR1 A;  1UHW A;  3BTL A;  2IW5 A;  4G94 A;  5A2Q Z;  3I5U A;  1MMA A;  4HF0 A;  2OQG A;  2ESN A;  4XSZ F;  2DJN A;  1JHH A;  4Q48 A;  1O3S A;  4CGZ A;  1Z0X A;  2KZG A;  4MFD A;  3TDU C;  4E7H A;  1BW6 A;  4U88 A;  1ON2 A;  2DA7 A;  3DFG A;  1OYY A;  1BIB A;  2Y30 A;  4BS9 A;  4XQF A;  2X9D A;  4YII A;  2HEO A;  5E1Z B;  2OUM A;  4G7Z F;  2MC3 A;  3E6D A;  2F4I A;  3PQJ A;  4XN0 A;  3QYB A;  4WXD A;  2VJ4 A;  1R49 A;  3CC4 I;  2BVL A;  1WKM A;  2Y75 A;  1XN7 A;  1IAW A;  5F0H A;  2LFB A;  1K4T A;  1FIP A;  2QKM B;  2IGM A;  3CCE I;  1BR2 A;  3EPZ A;  3N4M A;  2WB1 A;  4HEA 2;  3JRF A;  1R22 A;  3ZQF A;  2IA1 A;  5CPR B;  2FBH A;  3RYR A;  3V7C A;  4HV5 A;  1IV6 A;  3GF2 A;  3HYI A;  4HV6 A;  2VLA A;  1I50 J;  1PUF A;  3FHZ A;  2RDP A;  4HF1 A;  1MBE A;  1V5F A;  3IH3 A;  3J80 K;  2VON A;  3ZN0 A;  1DPR A;  1R4N B;  2X6O A;  1H9G A;  3C18 A;  4RLF A;  3JRB A;  2TCT A;  2VB6 A;  1D1C A;  2LKX A;  2ELH A;  4BAC A;  4JOM A;  5JVG F;  3EUH C;  4G6Q A;  3FZV A;  2W25 A;  1JT6 A;  1QBJ A;  2M4G A;  1S5L C;  4XOT A;  1E0E A;  1J9I A;  4F55 A;  3K70 C;  2WY8 Q;  4CO8 A;  2YU9 J;  3TOA A;  5HLG A;  4S0H B;  3ZR8 X;  5LEJ A;  4E70 A;  2XGX A;  3GTQ J;  2VUM J;  3DPU A;  3I4N J;  3I64 A;  4WCG A;  5GAG J;  1SFU A;  3TO7 A;  3E97 A;  1BM9 A;  1V5E A;  5L3B A;  3L2U A;  3DLA A;  1JTY A;  2JQ7 A;  1ETV A;  4ITV A;  3HRM A;  3F3X A;  3WTW C;  3WU0 A;  3JR9 A;  1FZP B;  4IHV A;  2YR2 A;  1XG1 A;  2QZ8 A;  4X1E A;  3HDD A;  5GAH J;  3BOQ A;  2R7X A;  2GOX B;  4A0X A;  3AG3 H;  5IYC J;  1N77 A;  1A36 A;  1W36 C;  3I56 I;  1MDM A;  1LPQ A;  3PO3 J;  2ME0 A;  3HSF A;  2M1B A;  3PL8 A;  4IJA A;  3WHB A;  4KIF A;  2ZFU A;  2P7C B;  1NTC A;  3KEO A;  2XUB A;  2A6E F;  5HLT A;  2R5Z A;  1P4A A;  1Z6T A;  4XR6 A;  2L3D A;  2NOJ B;  3JAM Z;  1J2X A;  5J6X A;  5CLS A;  1IXC A;  4EJW A;  3HUG A;  2K5C A;  5C3E J;  1DUX C;  1VQ4 I;  4NQW A;  4N4O B;  5JVT A;  3GLL A;  3A0B C;  4M9Z A;  2CUE A;  1LQ1 A;  1W7P D;  5C4J J;  2MAB A;  2P5K A;  3QAH A;  2MH2 A;  4HX7 A;  3G73 A;  1J75 A;  4DBQ A;  2A6T A;  3FK6 A;  4OWR B;  2QGU A;  2M87 A;  4CCN A;  2ZXI A;  4IOC F;  3S1Q J;  1USS A;  2B0L A;  4YEJ A;  2ETH A;  3OR1 C;  5D5V B;  3BZ6 A;  1T56 A;  2IXS A;  1JKR C;  4M3G A;  2HPI A;  1TL8 A;  2M9H A;  4P9U A;  3KLO A;  3OL4 A;  5E1X A;  1SVO A;  3O8G A;  4UVA A;  1R9T J;  2DMQ A;  3V8L A;  2WAE A;  2JVG A;  1FBQ A;  1AA7 A;  1CF7 A;  1T6S A;  3PNV A;  2ICW G;  1MKM A;  3L1P A;  1V5G A;  4CUG A;  2L9V A;  1P4W A;  3H0G J;  4LIU A;  3DBR B;  2WB1 N;  3WTS C;  3HM5 A;  1UMQ A;  2VIX A;  3IH4 A;  1XB4 A;  4LD5 A;  3J81 Z;  3RKW A;  3S8P A;  4X6A J;  3DKX A;  2ZXJ A;  4LLG F;  3RPQ A;  2JK3 A;  2HU9 A;  4J00 A;  2R7Z J;  2LY1 A;  3TMO A;  2E7W A;  4IXA A;  1LFP A;  1DP3 A;  3ZQI A;  1YYV A;  1ZK8 A;  3TOB A;  2AS5 F;  2XSJ C;  1R5G A;  2LF7 A;  3QOD A;  3ZQL A;  2P0W A;  2CUF A;  3LMM A;  1U9N A;  2TRT A;  4A6E A;  2DMT A;  3CCM I;  4CCM A;  5LLQ A;  4EM2 A;  5HLH A;  3K9T A;  3ONQ A;  1D5Y A;  2M7B A;  1RRJ A;  3K10 A;  1LDK B;  3SFI A;  2RC4 A;  2NS8 A;  4JBA A;  1QHH D;  4YEL A;  3K1M A;  1BW5 A;  3TKY A;  3WHC A;  4PK4 A;  1X4P A;  1TNT A;  3ERE D;  5B5E C;  5GTH C;  5CYV A;  1TWH J;  2CUJ A;  1SVM A;  4RB0 A;  4P96 A;  3K70 D;  2KJB A;  4IRI A;  1X2M A;  2V1N A;  4KIB A;  4A93 J;  2E5N A;  1P92 A;  1JKP C;  3F21 A;  5TJJ A;  2CH0 A;  4I76 A;  1WWX A;  4DZP A;  1PYV A;  2ADU A;  2V1X A;  4D1Q A;  1MSF C;  3NWS A;  2ZCW A;  3IAM 2;  2KPM A;  4KT5 C;  3EDP A;  1IZ1 A;  2VKE A;  4XLH A;  1BR4 A;  4HQE A;  5GPC A;  4BH9 A;  2XPW A;  4GGG A;  1IG7 A;  1MH4 A;  2W85 A;  3OYG A;  1W36 D;  2QSF X;  4EQQ A;  5CVJ A;  5H20 A;  4B48 A;  4HG2 A;  2DO7 A;  1YW9 A;  1R4M B;  4D0P A;  1RR7 A;  2KIM A;  1GVJ A;  4IX7 A;  3W6K B;  3HSE A;  2FNP A;  4ZYH A;  1OCR H;  4A0Y A;  5E8G A;  4XLN F;  3JRH A;  5DEQ A;  4BBR J;  4HNU A;  5L3G A;  1JGG A;  3CF5 F;  2DFI A;  2WY7 Q;  2JA2 A;  2X6Y A;  3FWE A;  4II3 A;  1MGT A;  1OCZ H;  1H0M A;  2KFD A;  3ML6 A;  1FSE A;  1QVT A;  3VDX A;  3BLY A;  2F5F A;  3ZPL A;  1G8X A;  3F8M A;  2V4J C;  4HQM A;  1H8A C;  2HWV A;  4CCO A;  5ILU A;  2Y31 A;  3WGI A;  3A01 B;  2DK8 A;  3SZT A;  2R7T A;  2QWW A;  2EZH A;  4P9F A;  1S72 I;  2V1U A;  1MDM B;  4RGX A;  5JLW A;  1MMS A;  1YQA A;  1BI2 A;  3BTJ A;  1S3J A;  1ZR2 A;  1X1C A;  4WX9 A;  3IWF A;  2DU9 A;  4ZH4 F; 
#chains in the Genus database with same CATH homology
 2JSP A;  2MYS A;  3OYJ A;  4BDZ A;  3CJQ B;  3AL0 C;  2BVM A;  1D0X A;  4DBR A;  2CV0 A;  1OLT A;  2CUZ A;  3LL7 A;  3K4K A;  4DJA A;  1N78 A;  1QU3 A;  3HUG B;  3PFY A;  3MKZ A;  3DU6 A;  5JHF A;  1X1D A;  2VKH A;  4BU2 A;  3CZ6 A;  3MMY B;  2V7F A;  3OYE A;  2GOM A;  4E7K A;  2JVH A;  5TGT A;  3ZCO A;  3OYM A;  1ZEL A;  1MMD A;  2WBM A;  4IZZ A;  2Y0S A;  2R7V A;  2CV1 A;  2KLO A;  1TZL A;  4AU7 A;  1JI8 A;  1VZ0 A;  1MMN A;  2LC2 A;  2Z2S B;  3DTK A;  2F6C A;  4PJM A;  3H9G A;  3SYT A;  2OC6 A;  2L7K A;  3PSF A;  4E7Z A;  2LY2 A;  2A5W A;  3KEY A;  3PUB A;  2IS4 A;  4BGD A;  2K9M A;  2IS2 A;  4XKV A;  3CMM A;  2O5R A;  3FDY A;  3E1S A;  3I3L A;  4BE0 A;  4CZC A;  2HNH A;  3CP2 A;  4KIT B;  2VXZ A;  2VAS A;  2XF5 A;  3VWB A;  2JUG A;  5HNH A;  3H0D A;  4BDY A;  1YX3 A;  1SFK A;  4PFP A;  4LIT A;  4RMN A;  4BUP A;  5HNF A;  2UV1 A;  3H5R A;  3W3C A;  2KMU A;  3I9V 2;  4H4K C;  3VYU B;  3QYE A;  3VSK A;  3HPG A;  3V42 A;  4KIS A;  2ZSI B;  3DPL C;  4LG3 A;  2F5V A;  3HPH A;  4J01 A;  5FRM A;  1KON A;  3H35 A;  3OR2 C;  3AKZ A;  2RNG A;  3UR3 C;  2VQH A;  4AYB A;  4XLC A;  2KHM A;  3MD2 A;  3ZXS A;  3OL3 A;  2LBF A;  2KZV A;  4F52 A;  3LSK A;  4Y33 A;  4U7B A;  1YE9 A;  1S9H A;  2W1O A;  3D5L A;  3CF2 A;  3CP8 A;  3KX2 A;  2CS3 A;  3SDB A;  3HOT A;  4HPQ A;  4EAT A;  2X6W A;  4NC7 A;  2IS6 A;  2FUG 2;  4QPO A;  2IS1 A;  3OWT A;  1HA8 A;  3EUK L;  4R79 A;  4U87 A;  4BJT A;  2PMZ A;  4PUS A;  3PNT A;  1UG0 A;  4XLA A;  3QOE A;  2L5Q A;  3ZRG A;  4ZC3 A;  3OYH A;  2DT6 A;  2VQC A;  2RQQ A;  4BQQ A;  4BE2 A;  2L9N A;  3K4L A;  3OMY A;  3K4J A;  1UEL B;  4ZDO A;  1D0Y A;  3DKY A;  4HST A;  2LRE A;  3CJR B;  2UWM A;  4IQJ A;  3HXL A;  1FMV A;  2AQF A;  2LOO A;  4C2T A;  5KNL A;  3OYN A;  3J7A Y;  3H5A A;  1YX5 A;  1IRX A;  2M7A A;  1G59 A;  1LVK A;  2VQG A;  2MFZ A;  3LFU A;  1X19 A;  2E5Z A;  2W82 A;  4LIV A;  4XLF A;  3IUO A;  2L2O A;  4E7S A;  2Z16 A;  2R7Q A;  2VJI A;  4OAZ A;  4Y3O A;  3TBI A;  1NG6 A;  3DTE A;  2HVR A;  1Z3Y A;  4NC8 A;  3W2A A;  3M1C A;  4Y4R A;  4ZTJ A;  4P5O A;  4ZTF A;  4ZDP A;  1Z21 A;  2VKD A;  2M3A A;  4XKC A;  3UNG C;  2K3P A;  1PJR A;  2MC4 A;  3LSI A;  2VXD A;  1T95 A;  2Q1Z B;  4XOP A;  2BOL A;  1WFX A;  4JQF A;  3H5N A;  3BG6 A;  4KJZ A;  2M4K A;  4F93 B;  5KHD A;  3BC8 A;  3F9K A;  4CCK A;  1EA3 A;  4ZJZ A;  4F92 B;  4IQ4 A;  1X4O A;  1Y56 A;  3OYF A;  2K9L A;  2WAD A;  2I8D A;  4YRV A;  3OS0 A;  1WJC A;  2IGN A;  2WAF A;  4RLQ A;  1X1A A;  4E6K G;  1X1B A;  4DOZ A;  4PFO A;  2W00 A;  5HOO A;  4ZYA A;  1R6R A;  4NNJ A;  3VYR B;  1FMW A;  4ZDL A;  2KL4 A;  4BE1 A;  2HVQ A;  2XDV A;  1MMA A;  2IGO A;  3OYI A;  3A2K A;  2QKL B;  2V26 A;  3MKY B;  2X1C A;  3S3O A;  4XN3 A;  2ZSH B;  3LSH A;  2XF7 A;  4E7H A;  5LD2 C;  1DQU A;  4BS9 A;  4XQF A;  4XL9 A;  3K4M A;  4XLE A;  2ZXH A;  3HC7 A;  5FRO A;  2Q2E B;  2OUM A;  2UUZ A;  3W2V A;  2F4I A;  4XN0 A;  3QYB A;  2OV7 A;  4XMY A;  4P1W A;  4XOR A;  1WJE A;  3N05 A;  3A1Y A;  3RTR A;  2W4S A;  3PJR A;  2VJ4 A;  1D1A A;  3DEE A;  2BVL A;  3OYA A;  4HNT A;  3S3M A;  3HKZ A;  4IKF A;  3S3N A;  1BR1 A;  2QKM B;  2IGM A;  4MLO A;  1BR2 A;  3EPZ A;  3ZGK A;  1DGR M;  3LSG A;  4CH7 A;  2WB1 A;  4C9Y A;  1OR7 C;  3L2R A;  4HEA 2;  1K6Y A;  1WJ5 A;  5CPR B;  1MND A;  4FET A;  3L2W A;  2VLA A;  2BW3 A;  4B47 A;  4XKW A;  2LBF B;  4B43 A;  2L9S A;  1V5F A;  4C2U A;  2HQA A;  4RM3 A;  2HPM A;  2VQL A;  4RLF A;  3C2G A;  3K6G A;  2VB6 A;  1D1C A;  3L2V A;  3FBN B;  3ZQQ A;  3DQV C;  4JOM A;  4BAC A;  3EUH C;  3GBG A;  4PJL A;  2M4G A;  1E0E A;  4XOT A;  4PSW A;  4F55 A;  3BCA A;  3K70 C;  5KCM A;  2V6E A;  4X0G A;  4PJJ A;  2X1E A;  2WY8 Q;  4E4H A;  4D9J A;  3ZR8 X;  3RSN A;  4BJ6 C;  4CSW A;  4OAY A;  3DPU A;  4E7L A;  4BXF A;  2LRD A;  1V5E A;  3L2U A;  3DLA A;  4BL0 B;  3OYC A;  1DGW Y;  2R7W A;  2XC7 A;  4ITV A;  2E1M B;  2DT7 B;  4HSR A;  4F91 B;  5LFA A;  3L2Q A;  3A4C A;  4AVZ A;  2X1D A;  2GOX B;  3EUA A;  3U21 A;  2R7X A;  2M0M A;  3FKJ A;  1N77 A;  2HZD A;  2HDW A;  1W36 C;  2V9K A;  5CKT A;  3PL8 A;  2XAU A;  3OS2 A;  3BCB A;  2X6X A;  2ZFU A;  2PJR A;  1D0Z A;  5HLT A;  4XR6 A;  2CMP A;  1MNE A;  2NOJ B;  1QHG A;  4CCL A;  5HVQ C;  2W7N A;  2K5C A;  4N4O B;  2X85 A;  3G2B A;  2MAB A;  2KRH A;  3W2W A;  1LKX A;  4FAS D;  2Z1D A;  5FRN A;  3SEQ A;  4DBQ A;  3OYL A;  2A6T A;  2PJR B;  4OWR B;  2LYC A;  3KYL A;  2R7O A;  4CCN A;  2ZXI A;  4BJ5 C;  4ANJ A;  1P9Q C;  4YEJ A;  3OIP A;  3OR1 C;  2IXS A;  2HPI A;  3OIQ A;  5CQG A;  2DCE A;  4NQW B;  4E7I A;  4CCJ A;  3OL4 A;  3FHN A;  2WAE A;  2JVG A;  1AA7 A;  2LG4 A;  4XNF A;  3PNV A;  1WJF A;  3CES A;  1V5G A;  3VYS B;  2KRC A;  4CUG A;  4GRI A;  4LIU A;  4RM2 A;  2ELJ A;  2VIX A;  3PNY A;  3S8P A;  4XM3 A;  2E60 A;  1U0J A;  4KT6 A;  3RCO A;  3DKX A;  1J09 A;  2R7U A;  3D5R C;  3K4C A;  2HU9 A;  3H9J A;  3H9Q A;  4J00 A;  4XKB A;  1NG7 A;  1MMG A;  3E0J B;  2E1M C;  2KQR A;  2LY1 A;  3TMO A;  1LFP A;  1DP3 A;  3OYK A;  3DPT A;  3OS1 A;  2XSJ C;  3IP4 B;  3BG7 A;  3OOU A;  4N4N B;  3TL4 X;  4PJN A;  3QOD A;  2P0W A;  3LMM A;  3S32 A;  3NWT A;  4CCM A;  1UAA A;  3PSI A;  2CFO A;  3LSM A;  2X51 A;  3ONQ A;  2M7B A;  3K10 A;  1LDK B;  5CQE A;  3QYF A;  3AFH A;  1SAU A;  1QHH D;  4YEL A;  4BQN A;  1Z3X A;  4DGW B;  4NUB A;  4XON A;  3DU5 A;  1Y6I A;  4PK4 A;  1X4P A;  3DWL E;  2VL8 A;  2XF6 A;  2MD0 A;  3AL0 B;  4PSX A;  3RQ4 A;  2CUJ A;  3K70 D;  2DOA A;  2VPL A;  2V1N A;  2E5N A;  3OYD A;  1MW7 A;  2CH0 A;  4BQO A;  1PYV A;  1WJD A;  2AQE A;  1D1B A;  4D1Q A;  1Z7L A;  3K4N A;  2KP6 A;  2BW3 B;  3NWS A;  3IAM 2;  4E7J A;  2KPM A;  3DTI A;  3VSL A;  4XLH A;  1BR4 A;  3HL2 A;  1GLN A;  4HRI A;  3RPU D;  3MKW B;  3VYT B;  3OYG A;  4F3Q A;  2CW8 A;  2LH9 A;  1W36 D;  1WJB A;  4B48 A;  3IAS 2;  4HG2 A;  3D5S C;  2CV2 A;  2R7R A;  4G6T B;  4IX7 A;  4II2 A;  2R4G A;  3SZG A;  3OYB A;  2DJI A;  4QPQ A;  4HNU A;  1N75 A;  3FBI B;  2WAQ A;  2WY7 Q;  2JA2 A;  3M8J A;  2X6Y A;  4B3X A;  4BEH A;  4II3 A;  2HVS A;  2VJ5 A;  2VJJ A;  2R7S A;  1BOB A;  3VDX A;  3BLY A;  2WA0 A;  3HG9 A;  3C2H A;  4CA0 A;  1TT0 A;  1G8X A;  2V4J C;  4CCO A;  1T0F C;  1WJA A;  4DIQ A;  2R7T A;  2DXI A;  2KDO A;  3HOS A;  1ERD A;  2CW7 A;  4C30 A;  3SEZ A;  3S93 A;  2RRE A;  3K4B A;  2IGK A;  1X1C A;  4B44 A;  4BEH B;  3OY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...