1WJEA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
b'FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 12
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjeA00
1WJFA 3HPHA 3F9KA 1WJDA 3HPGA 1E0EA 1WJEA 4F3QA 1WJCA 1LFPA 1WJBA 1KONA 1K6YA 1MW7A 1WJAA
chains in the Genus database with same CATH superfamily
2Q1ZB 5F27A 1UG0A 2WAEA 1YOVB 1VI0A 1HF0A 2O03A 2OD5A 5CVVA 3OYKA 2QBYB 1F36A 2OU2A 2BXYA 3MN2A 1Z3YA 2HKOA 9ANTA 1SVMA 4QPQA 2LTPA 1MIJA 3FIWA 4L0YB 3VYRB 4EGZA 1S7OA 1H9GA 3QOPA 2MLGA 4Y7NJ 2H1LA 1I6HJ 1WZ2A 1XC5A 3N4MA 2HFHA 2PMUA 2LH9A 1X3WB 1Z3XA 1BOBA 3CZ6A 2VODA 3CCUI 4G9YA 3JRBA 3ZQCA 1J2XA 1UZCA 3ZR8X 2ISYA 2YR2A 2P4WA 3K70C 2D2WA 2JUGA 1VTNC 2L7KA 1MBFA 2AXLA 5BPDA 1KONA 2CU7A 4RGRA 4XM3A 1JGGA 3QYFA 2JVGA 2B9SA 1A31A 2VUMJ 1QBJA 2G7HA 2EINH 1FSHA 2LREA 1PDNC 5F6FA 2I5UA 1BR2A 2FXAA 5JFRA 2UXNA 3AL0B 2O6GE 2WBMA 3M7GA 2CQQA 3OS0A 2FQ3A 2DBBA 4KN4X 4M9SA 1IJWC 3HUGB 2Y9ZA 2GXAA 3WTUC 1HCRA 3V8JA 4DNCA 3TO7A 2HS5A 1MDMA 2WC2A 3FM3A 3S2HJ 5L3GA 2LSOA 2M7BA 3HRSA 3LSTA 2NAZA 3IH4A 3QPTA 4BQOA 4EV0A 4D1QA 5AIPA 3S17J 4F92B 2HDWA 1BI2A 3E6DA 4ESBA 3K2ZA 4BXFA 4W1UA 3ZQ7A 2VE8A 3C3WA 3S8PA 3ABMH 4DZPA 1LNWA 4XMYA 4IXAA 5D8KB 2QGUA 4HLYA 1VQ9I 5J8FA 4G12A 4V19K 4XRFA 1GV2A 1IZ1A 4P9FA 4LITA 4RAZA 1T39A 2IJLA 2A05A 4S04A 1SD7A 4BY1J 3S3NA 1DU6A 3M4OJ 3ABKH 2F4OB 3WGIA 3P5JA 4OAYA 2DA5A 2XKOA 4KDPA 4HV5A 3S1RJ 1MMGA 2JVHA 5GAGJ 2X6YA 4LB6B 4ASNA 1RZ4A 3WE2A 5HNFA 2MBFA 2RAEA 2H8WA 2COMA 5HLIA 2A6EF 2DMQA 5FFZA 3E3VA 2DLLA 5F04A 5TJJA 3DPUA 3OR2C 2R7OA 2IBDA 4XSXF 5IYCJ 4BKXA 3F8MA 2ZXJA 4HF0A 4N9HA 1IXCA 2OCEA 5B66C 2XSJC 1YJ9I 3CUQC 4EQQA 1DGRM 3Q9SA 2RQPA 2JQ7A 1FT9A 1F9NA 3H3ZA 5GTHC 3QYEA 2W1OA 3U1KA 3PSIA 5BOXA 4RM3A 2R7RA 3JAMZ 1Z9CA 4EGYA 3HUGA 5E3MA 2O7OA 4WWCA 1YJNI 3DFGA 4CCNA 3GFLA 4B09A 3OYIA 3WTWC 1ULYA 4LLNA 2EILH 3I5UA 3E6MA 1BIBA 1OKRA 2M3AA 3H9QA 2VQLA 5J47A 1UMQA 1XD7A 2EQRA 1XTAA 5KHDA 1T0FC 1RC9A 2GXGA 1V54H 2QQ9A 1NK3P 1S7EA 1ENHA 2ZJ2A 3GUDA 2R3SA 1AOYA 4P96A 2Z3YA 2AHQA 2ZKZA 4F52A 2BYVE 2EFQA 2MH9A 4EM1A 2BVMA 2MD0A 4BS9A 1VQ6I 2VBYA 4FT8A 3JRGA 2GAUA 2YSRA 4CZCA 1IV8A 2XB5A 4UXNA 3JRIA 1O3RA 1OCPA 4H0EA 4PJLA 3ERED 5FD6A 1T08B 4K2EA 3P9KA 3MKYB 1J75A 3KLOA 4DYCA 3ZQHA 3TDUC 1W5TA 3B6AA 5D8LB 5LBQA 2WADA 5F1RA 4H4KC 1UHMA 1ETKA 4AUXA 1JT0A 2PJRB 3M9AA 2B63J 2VC0A 2H27A 5HLHA 5FKKA 1BJAA 1R49A 1TW2A 1TTYA 1L3LA 3PNVA 1SFEA 2FOKA 2RKHA 3K0LA 3ZMTA 1YIJI 3RPQA 4BBRJ 2GA2A 2LNBA 3AG2H 3L2WA 2KRCA 1MJ9A 4RBOA 1BW5A 1OJLA 2EH3A 3HEFA 4IQ4A 4ZZDA 2QUFA 4UVBA 2UWMA 2QQBA 2XF6A 2IVMA 4NC7A 3O6BB 1FOXA 2NVUB 4OMYA 3ESWB 3MWMA 4QWQA 1F43A 2OTJI 3EUAA 3KEQA 1A36A 1FC3A 3OR1C 1G3YA 2LBFB 1NG6A 1MBEA 1MSEC 2XHKA 1SFOJ 3EDPA 2Z2SB 1STZA 5DCMB 4Q5SF 4ZDLA 4ZDOA 4UVCA 2A69F 5J6XA 1EKEA 4NQWB 2DK8A 3S16J 2ZFWA 3F8BA 3HG9A 1FIPA 3FK7A 4B47A 2X6WA 3ASNH 2BW3B 1ZELA 4R8HA 3CP2A 5A2QK 2DFIA 3JCUC 4RLFA 4MO7A 4XLFA 1W7PD 4AC0A 3UKGA 3RPUA 1T6SA 4CYCB 5EEHA 1IXSB 3Q0UA 2PJRA 4BYYA 4B4CA 1KYZA 4Q47A 2FA5A 3SZGA 4IOAF 1L0OC 3JW4A 3CJRB 3RI4A 1HBXG 5HS7A 4JX4A 2L7FP 2RDPA 2G7UA 3SHFA 4AYBN 2VONA 2WAFA 1OYIA 5AIQA 2HU9A 2E7XA 1MGTA 3T5XA 1LFUP 4CCKA 4BHPA 1NK2P 4BE1A 2JZYA 1UB9A 1Y39A 5J1UA 5M3FJ 3NRVA 1S6LA 1UAAA 1G3SA 3V4GA 4KMFA 4IRIA 2RN7A 3HOZJ 2L5QA 4IHYA 5LEJA 2EFNA 2A6HF 1WI3A 2LR8A 4ZDPA 4UV9A 2ME6A 2V1NA 1YHQI 2A61A 2CV0A 4YIIA 3ZMZA 4I76A 1R9TJ 2HOEA 3KZZA 1BJZA 3FF5A 1ORKA 1W5CC 4NB5A 2ISZA 3OL4A 2LBFA 3D0SA 2MABA 1QNTA 4P9UA 1YJWI 2VXDA 3HOVJ 4ZTFA 5DCMA 1QZEA 3F23A 4JK1X 4LIUA 1XX5A 2NRAC 4BH9A 1TL8A 3PQJA 4G7ZF 1X58A 2V1XA 1LB2A 1SMYF 3PSFA 4I0AA 5K7ZA 4YRVA 2HPMA 4G6TB 5CPRB 4X6AJ 2IEKA 1S3JA 1X1DA 4NQWA 5D4SA 4E70A 4R79A 3BCBA 3ZOBA 3JSOA 3LQQA 4LG0B 2X0LA 1EF4A 2A3SA 3BZ6A 2D5VA 2BW3A 4IEJA 5M5XJ 4XN0A 2HQNA 4QTRA 4L5EA 2LMDA 3JAMK 1W0TA 5IPAA 2BY2A 3OYCA 1XMAA 3R6SA 3Q5FA 2EPFA 2X48A 2BHZA 4AVPA 3GBGA 3ABLH 2EIMH 1ACIA 4MGRA 1WKMA 3FK6A 1I3QJ 3FXUA 2ESHA 4MTEA 2E71A 3DU6A 4AIHA 3BG7A 1FZPB 4XBFA 3KEYA 4ON0A 2ZMEC 4JBAA 2IGOA 1ODDA 2PN6A 3TL4X 4L9VA 2M30A 5DUKA 4XKBA 3E6BA 4A2UA 1WCMJ 4M9ZA 2OQGA 3K4CA 1PP8F 4DW6A 1W36D 5TISC 3KCCA 4U87A 3I56I 5DM7F 1GDTA 2L7MP 3IV5A 2YX7A 2KT0A 2FX0A 2DAOA 4HSTA 3JTHA 3PFYA 4HNVA 1BI0A 3BG5A 2OAZA 3L1PA 4BJ5C 2KDZA 1X1PA 2O61A 1V55H 2HI3A 2X9DA 1OLTA 3G1MA 5IT3A 3CUQA 3F8CA 2ELJA 4U88A 2Z5UA 2VBXA 1FJLA 1DU0A 1ZAOA 3KP4A 1OCRH 4F3QA 2LOOA 3ZN1A 5HLTA 4YIRX 2E1NA 2HOAA 3H1CA 3BY6A 3FMRA 5JVTA 4CO8A 3BJAA 4ENMA 1HXDA 4AIJA 3FM5A 4RB1A 1QPIA 3V7CA 3GYHX 2PMHA 5FJ8J 3FMQA 2MSYA 3W2AA 1N25A 1FEXA 2M5WA 4LG0A 1U0JA 4PFOA 3OYLA 2F5DA 3FDYA 3S2WA 1T0FA 1FOKA 2M0MA 2V9KA 3DLLF 3IH2A 2GLOA 1WH7A 3CMEI 1OMIA 1UG2A 1XDUA 2HYGD 4XLHA 2B7EA 1LKXA 2X4HA 3BR6A 1W4MA 4S0HB 2R92J 3IH3A 3QODA 2O8KA 4WXCA 4UUTA 4U0VA 4LK0F 3HOXJ 3LSKA 1B9MA 2OZ6A 3JRAA 3SEZA 2L3DA 3KP3A 3DQVC 2YS9A 1I1GA 1I39A 3DCFA 3GZNB 3WU0A 4JQFA 1RIOH 2EFPA 3FXMA 3DEWA 3L2UA 2E7WA 3KYCB 2QEXI 1Z0XA 3ONQA 2UV1A 3FXOA 3OOPA 4L18B 3ECOA 3BZKA 3TOAA 4IOCF 2VI6A 1BC7C 2X1DA 3JR9A 2TRTA 5E1WA 4PFPA 1IW7F 2WAQA 1Y6IA 5HDKA 1V5FA 5GP9A 4A3LJ 3M8JA 5B5EC 5FKNA 1IRZA 2ELHA 3LSGA 1IN4A 1KYWA 2VQGA 1S7AA 1R5GA 4UV8A 3OWTA 4DBRA 2PI0A 1KU9A 1XB4A 2W7NA 3CTAA 2V9PA 2LKPA 1VQ5I 2XF7A 2HNHA 3J7AO 2Z9OA 4CYDA 4A5NA 2EFOA 1O3TA 2IS2A 2LKSA 5J8CA 5IT9Z 4FE4A 2K9SA 2KIFA 3TQNA 4EMSA 3WTTC 1PP7U 3LA7A 3VDXA 5IP9J 2GWRA 2I8DA 1IRFA 2ZO4A 2Q2EB 3VODA 2V6EA 2RVCA 2GM4A 3HRUA 3G3ZA 2K4BA 1XSDA 2VT2A 3A2KA 1D8KA 1ZN2A 1XS9A 4DBQA 3KETA 4IHVA 1HQCA 3EUHC 2ME0A 3BG3A 4FISA 3ZMDA 3KEOA 2UXXA 3WTYC 2ZFUA 2P5LC 2R7SA 1P4XA 3OV8A 2V26A 1U6GA 2VOPA 1TWCJ 2HKXA 2QF7A 3ECHA 1K78B 3O3KA 1Z67A 1MBJA 2VT3A 4XNFA 5GADJ 3MCZA 1MMNA 4XRMA 2C6YA 2V4JC 4EJTA 1IG7A 4JYKA 1N78A 5LLQA 1V4RA 2ZMEB 2DODA 4HNUA 1QRYA 3SJMA 3AAFA 3CCQI 1Y1WJ 5FKOA 3OYJA 5BMZA 2W57A 2XPUA 2PFBA 3RSNA 2ID6A 4FTHA 3IWZA 2DT5A 3ZMUA 2CUJA 1W5SA 5LFAA 1R00A 1HC8A 4Y33A 3AG1H 1FX7A 3TOBA 3G71I 3E5QA 3W3CA 1HW1A 4AD9A 5M3MJ 2VKDA 3AFHA 2ICWG 2DMPA 3CJQB 1SVOA 4UVAA 1REPC 1QA6A 3H0GJ 2DYSH 4A12A 1QVTA 4U0WA 3EUKL 3BCAA 4G7HF 1HW5A 1ZLJA 2JWTA 1R7JA 3HTUA 4C3JJ 3H3VK 2GA1A 4LFUA 3MZ8A 2IT0A 2ZSHB 2JRTA 2LK2A 5J1YA 3CCSI 3DPLC 3LSJA 2VE9A 2IGMA 1Q1HA 2W00A 1VQ8I 5JLWA 1WI9A 2Q2EA 2LG4A 4CDGA 4B3AA 1P7IA 2ZB9A 2VKEA 2FOWA 3ABTA 2ID3A 1U2WA 2EK5A 5LHGA 4ENJA 3I71A 1D0ZA 3PO2J 5E17F 2ZBKA 1JI8A 5CKTA 3EQLF 1ZGJA 1JTXA 3CO6C 1KQ9A 2WB1N 2VKVA 4KNYA 1ZGAA 1RPWA 2ZC2A 5J1RA 2KZGA 2FNAA 5IOZA 1J0RA 2DA2A 2MLKA 4OAZA 3J7YJ 1Z77A 5FD5A 2OTLI 2M8EA 2V79A 4IZZA 3WTSC 3G6EI 1Z05A 2K85A 1LDKB 3G2BA 1T38A 1K78A 1DDNA 3TP0A 4B3XA 1OFCX 5CJ9A 4KN7X 3REOA 5E1XA 5LGTA 5KVRA 2CQNA 1IF1A 2MGQA 3SQNA 4MEXF 4W97A 3H9JA 5DD8A 1WJDA 2ZMEA 3WGGA 2F5VA 4L9TA 1IN6A 1A04A 3COAC 1YW9A 1D1AA 2QVOA 2HXOA 2WY7Q 3S32A 4ZH4F 3N97A 1VZ0A 2L7ZA 3R60A 2DA3A 4ANJA 3C2HA 3F6VA 4KJZA 3A0HC 5IY5H 1UELB 4LK1F 2JSCA 1WJ5A 3DBHB 1O7FA 2BZTA 2YUSA 4CCLA 4MQ9F 2R7FA 3SXYA 5L3FA 2ZXWH 1IC8A 3ABUA 4YFNF 2IS1A 2CMPA 2YU9J 4Y17A 1W1WE 1DP3A 1GUUA 4HW0A 2DYRH 5FGMA 2K9QA 2W84A 3JRHA 2M4GA 3WE3A 4IX7A 2M4KA 2MFZA 2NS7A 5J3LA 1RRJA 5E79C 2XDVA 1MMDA 4HAMA 2MA3A 2ZSIB 2PJPA 1IV6A 1M1EB 2V7FA 3CCVI 1B9NA 1WJEA 1CQTA 3CD6I 4NUBA 1X1CA 4A3CJ 4ZJZA 1JUPA 5HS9A 2KLOA 3L09A 5EYRA 5F0HA 1PVEA 2DK5A 1B6AA 5LRSA 1YI2I 1A35A 2H1KA 2QKLB 3BP8A 2QM3A 1KQ0A 3FX3A 1GVJA 2L02A 4F55A 2XASA 3OOUA 2DFFA 1OCCH 3SDBA 1NG7A 3O8HA 2CV2A 5IT9K 5KAFC 1JHFA 4M71A 1X2NA 4UB8C 2KISA 3AG3H 2F5FA 3MMYB 4BACA 4KITB 5LHHA 3DU5A 2F4IA 3X2QH 2V6CA 4XKVA 4PGGA 2HR3A 2HVSA 1ETXA 2QSFX 2VASA 1QU3A 2VIXA 2P6SA 3KP6A 3LA2A 3OL3A 3BQZA 3OYGA 2VN2A 3WU2C 3CCLI 4BJTA 3RZDJ 1UHWA 2JA7J 3E97A 1YTYA 3MKZA 1MNMC 1AHDP 2QQAA 4MEYF 3I53A 1K61A 4KT5C 4CUGA 2ZXHA 3GXOA 2VQCA 3ASOH 1QQIA 5LEKA 4HX8A 3FMSA 2LDUA 1ETVA 2DTRA 4J00A 4LB5A 3GMEA 4ENKA 1DP7P 1I1SA 3ISPA 2D1VA 1XDSA 3GX4X 1TWAJ 2GOXB 3FXJA 5DD4A 1G2HA 5E1ZB 4UHTA 1K6OA 2CQXA 2KIQA 4AWXB 4RB0A 2DA4A 4I6ZA 3VYSB 2QA4I 4NC6A 2EJRA 4KA4A 1KU2A 2V1DA 2Y9YA 4M9XA 3K70D 2PLYA 2LKXA 3RIRA 3K6GA 4XKWA 2DA1A 4RA2A 4OU0A 1ETOA 2P81A 2Y0MA 2YPRA 5D5WB 3E5UA 3H35A 4LMYA 3WODF 3BC8A 3CLQA 5HVQC 2COBA 3LA3A 3RKYA 4EM0B 5JHFA 4XLPF 1T98A 3FXRA 2EZLA 4EVIA 3R0AA 2FJ1A 1TBXA 2N8GA 4D5FA 3GZ5A 1U9NA 3RKXA 3EUHA 1EH6A 1A5JA 2XPWA 1MJBA 3FXQA 1VFCA 1KGSA 2L9VA 2R5ZB 3QP5A 4HQEA 4WK8F 5DYMA 3U2RA 3V42A 1HKTA 2R7ZJ 3K4JA 3B02A 1G3TA 2A07F 1S29A 1BL0A 2X85A 2CQ7A 2J5OA 3DTIA 2CG4A 3BR5A 1TWHJ 1SD6A 1WFXA 2A5WA 4LGWA 2LRDA 3ZQFA 2XUBA 3CC2I 2J5PA 2B0LA 3CCMI 3K1PA 1RNLA 1XGNA 4AYBA 2K9MA 3DV8A 2NNYA 4M3GA 3O2PE 5K7FA 2BY0A 1HKQA 2L9SA 2VBZA 2W25A 3JRCA 3U1DA 2JA5J 3VB2A 5IYDJ 1IN7A 3CDLA 2FBIA 2VL8A 1UJ8A 2VC1A 1TNTA 1WRJA 2LY9A 3MKWB 2EZIA 3WTVC 5D5XB 1SEUA 4CCJA 3DTEA 3A01B 2HWVA 3FXLA 1CGPA 2Z16A 4RLQA 5IP7J 2JA2A 4HPQA 3M8EA 4OIOF 3HJEA 4HF1A 4BQAA 3S1NJ 1RI7A 4A5MA 1R58A 1ZHFA 3HBLA 1YRNB 3PM1A 1U3EM 3ZN0A 2Y2ZA 1QGPA 4DIQA 4EEFG 4FHTA 1FBQA 4F93B 1VQPI 1WWXA 1P9QC 4C30A 1ZGWA 2ACJA 3GFIA 4M6VA 4BL0B 3C2GA 1JJ6C 1SFUA 1BIAA 2HXIA 2VJJA 2EIJH 3T8RA 4MQVA 4ZZLA 1MW7A 3LSPA 1YLFA 1TQPA 3RQ4A 3BPXA 3K4LA 2KJCA 1Z6TA 4XN3A 4JP0A 5EF6A 4U0YA 4RMNA 5EG0A 3ZQIA 2L9NA 2IA0A 2R5ZA 2HVRA 4NDLA 3CDHA 2ECCA 2X1EA 4Z2YA 3CDIA 4EJVA 1D8JA 3G1LA 1UHSA 1KU7A 4I7HA 4EJWA 1O3QA 5KAIC 1EH7A 2E34A 5DCFA 5D5UB 3LSRA 1S8NA 4HLXA 1W36C 2ZJPF 1TT0A 3H92A 1D3YA 4HDUA 2CW8A 2FSWA 3DWLE 3W2VA 2K86A 2M87A 2E5NA 1XCVA 4WF2A 2R7UA 3LAPA 5DV5A 1Z1DA 2CRGA 3T0YA 2DI3A 3F8NA 2H94A 2AQFA 1RR8C 3HTSB 2FNPA 3D5SC 1MH4A 3HRMA 4A93J 3UNGC 2W48A 1HKSA 1E3OC 1N75A 3BR1A 1Z7UA 5E3OA 4A0XA 3ZXSA 3F3XA 4KIGA 5BPIA 4J19A 3A01A 3TEDA 2R7XA 1ZG3A 3NAUA 2VJ5A 4BDYA 4E7HA 1FBUA 2VJIA 3TO6A 1P2FA 4BHBA 1FP1D 2CSOA 3FXKA 3CUQB 2G9WA 4A3KJ 3DPTA 1QPMA 3HM5A 2NVTJ 2JA8J 1YRNA 1U9OA 1YG2A 5FRMA 2DO7A 4A6DA 1MKMA 4N4NB 1Y0UA 2QYOA 1V5EA 1VQKI 1USTA 3CLOA 1D0XA 4MNUA 2HPIA 3OIPA 2BOLA 3IRQA 1RKWA 3HOSA 1S72I 4RDUA 3CF2A 1FTTA 2CUZA 3CF5F 4OMZA 4ETSA 5FKMA 2ZXIA 1YO5C 4DYRA 2HZDA 3CMAI 1FNNA 2RQQA 1XMKA 2P0WA 3WU1B 3S3MA 2JSPA 2LP0A 3KP7A 2XB0X 3MAJA 1PYVA 1LEBA 1U8BA 2LY2A 1VQ4I 4ZYDA 1MSFC 2DQRA 1FSEA 2Y0SN 4ZYHA 1OISA 2OZUA 3BZCA 3R61A 1IN5A 4GYIA 4YIFA 2WV0A 5K1YA 2R0QC 1W0UA 2BEOA 1W7PB 4F7ZA 4KIBA 1GT0C 4EATA 2ETHA 4XR6A 4KT6A 1YX3A 3D5LA 1F4KA 2GBYA 5ICCA 4II3A 3SFIA 3OYNA 4I2OA 2IS4A 1X2MA 3M1CA 2VBWA 1GVDA 2KKOA 5AONA 4GO1A 2XAUA 2P5KA 3L2VA 2O8XA 4XQFA 1O4XA 4CA0A 3I4MJ 3PQKA 1LQ1A 3BOQA 1BOAA 4XIDA 1LVAA 4XRSA 4L5IA 2AO9A 3NWTA 1T95A 2HTJA 5EZGA 3H3UA 1MBKA 2E60A 4OIPF 4XLAA 1OCZH 1KZHA 3GZ6A 2XGXA 5EJCA 3J80Z 2VPRA 4BQNA 1VNDA 4G6DA 4KIFA 3W2WA 1IUYA 2DTZA 2FMYA 4HYEA 1T2KA 3F8FA 4GXOA 1LFBA 1HA8A 5FLXZ 3KIOA 1J5YA 4M3BA 2M45A 4N0BA 1UCRA 3WHCA 4HF2A 5ICGA 4BAYA 4RGSA 3V8LA 5ICEA 2NVXJ 1VQ7I 3L2QA 2DDBA 2R4GA 3BJOA 1V3FA 4PGHA 1R1TA 1F1ZA 4RAGA 2L54A 2K40A 3BTJA 4DOZA 4I0BA 4CXFA 5HDNA 4GYGA 3OSFA 2Z33A 4ZYAA 3IAM2 4PK4A 2JUCA 1SD4A 1XGOA 2E19A 2GOMA 2EFWA 1WJAA 3CJTB 4BNCA 2A5YB 4HX4A 4D7MA 2PG4A 1OYYA 2KDOA 3CESA 1W7PA 2F4MB 2QWWA 1T8IA 1ZKGA 1WJFA 5H20A 1ZYRF 1X19A 1WVRA 3OYMA 1WJBA 1JGSA 4C3HJ 4E7JA 1KQ8A 1EA3A 4MLOA 4Y4RA 3KLNA 2JRMA 4ABZA 3RKWA 3FHNA 2MC4A 2M34A 3K1NA 2BHYA 3SYTA 3O8GA 1JKQC 4FASD 4B44A 2CGPA 4IVNA 3OSGA 3UR3C 3LAJA 4YELA 2M7AA 3Q0WA 2DMUA 4OIRF 4RGXA 2XIGA 3A4CA 3L00A 1JUSA 2ESNA 3GTLJ 1RESA 2OJED 5GAEJ 4S05A 1OR7C 2DFEA 4AM3A 3OYFA 1TP4A 2K27A 2X1CA 3IUOA 1O57A 4BE0A 5EGOB 3GWZA 3BTIA 4XK4A 3H5AA 1H8AC 1ZR4A 1XSXA 3K9TA 3I54A 3DKWA 3E7LA 1I27A 3M07A 2DFHA 1ZR2A 3FKJA 5K5RA 2OCCH 3M1EA 4L9NA 1MBHA 3BT9A 4HZFA 3ZRGA 2JA6J 5EZHA 3T1BA 3H9GA 3CCEI 1IRXA 3LL7A 1IRGA 4X1EA 4KYWA 2NVYJ 3NARA 4CH7A 1DGWY 5K5QA 3DEUA 3TGNA 2HDCA 2FD5A 1WHUA 2XRLA 1JUMA 3P7NA 2VKHA 1IXRC 2MC3A 4OOIA 3ZQLA 3LQRA 1O7LA 3TP3A 2NNNA 4Y52J 4EJUA 3V7RA 4FETA 1IDYA 2KHMA 1MNEA 5KK1A 1D1BA 2RNJA 3BR0A 3OS2A 4PJJA 1SAXA 5GTIC 2DT6A 5CVUA 2YU3A 2AXTC 1YYVA 1FY7A 1H89C 2WB1A 3OIOA 3I55I 3JRDA 2VOOA 1BC8C 3K69A 3GTOJ 2NOGA 3R0JA 2H8RA 3HC7A 1LDDA 2JN6A 1ONVA 3ULQB 2EWNA 1FBSA 4HX7A 5K7HA 1I3AA 5JVGF 4C2UA 2HQAA 3KYLA 5GPCA 3HHHA 3EETA 2JMWA 3V7SA 4II2A 1JTYA 3M3YJ 3HDDA 5E18F 1YIOA 3PUFA 1JJ8C 1R1UA 2O5RA 3GFMA 2CW0F 2L01A 4IHTA 1FTZA 3HGGA 2OPTA 1TLHB 5CVRA 4MTDA 2LYCA 2R7DA 4A3GJ 1E3PA 1NH3A 2WWYA 5EGOA 5ED4A 4EJOA 3GW2A 2EZKA 3WTXC 4RAFA 1WH5A 2HOSA 4QLCU 1ZRCA 1GV5A 4M3FA 2XGDA 5KCMA 2DOAA 2MYSA 5M5WJ 2R7TA 2TCTA 3ZGKA 2KIMA 3W6JB 1OYWA 3IHUA 4CZZA 2WAQN 2KQRA 3H36A 1JKRC 3QRFF 2W4SA 3C7JA 1JXSA 3NEUA 2MG4A 1DUXC 5HLGA 1BM9A 1G4DA 2CV1A 4F91B 2R7QA 2IGNA 4I02A 4RB2C 2H09A 1R4MB 3KYDB 4HQMA 5CQGA 4YEJA 1YFHA 2WA0A 1EJ9A 5C3EJ 3KX2A 1R5HA 3F72A 1FYMA 1D5VA 3HL2A 3TMOA 2CJJA 3FBNB 2ECBA 1QZYA 2XVCA 3I4PA 4PJNA 3J80K 1DPRA 5IP6A 4HBLA 2STWA 3GFJA 2CO5A 3MZYA 3LSMA 1SANA 1HSTA 2XAHA 4ZYEA 1P4WA 4YFXF 3R4KA 5FLXK 3HKZN 4OINF 3MQ0A 3TW7A 4A3EJ 5IYBJ 2E1MC 3A02A 3HYIA 3OYBA 1E2XA 1OPCA 2XAQA 1AKHB 4IHXA 4E7KA 2QSHX 2BBYA 3KE2A 3PFIA 4Q4ZF 2FE3A 1P92A 3ZQGA 4BEHB 4C9YA 2XSDC 4GRIA 2KPMA 4ENNA 1FWZA 2HEOA 2RREA 5CVJA 1G6NA 3C1DA 4A6EA 5HODA 4X0GA 2MH2A 1K7AA 3OMYA 2HVQA 4UUSB 3B6CA 3DKYA 1X4PA 1EH8A 5TGTA 3A03A 4P5OA 3RQIA 3G1OA 1SFKA 4BJ6C 3V8KA 1HDPA 3OYHA 4B8XA 4BY7J 3ZMSA 4Z6YA 3OY9A 1NHAA 1FLIA 4L0ZB 1BN5A 4HA8A 3KZIC 2W85A 3DP7A 4FE7A 2KP6A 2IRFG 2DQLA 2HQ5A 2EA4A 2CH0A 5HNHA 2JK3A 3BROA 4C2TA 4RM2A 3H0DA 5CVIA 4ZC3A 2R5YB 4RAYA 4WXDA 2D1HA 3HIFA 3CCYA 3NWSA 4IRHA 4HOBA 2Y30A 3DBRB 4MFEA 4U7BA 2H6CA 2HYJA 2RNGA 5FLVA 1J09A 2QKMB 3DF8A 3TBIA 4G6QA 2PMZN 2Y31A 3F0CA 5HOOA 5CQEA 3ZCOA 4QIWN 3CCJI 4L9JA 2DA6A 1T56A 2QSGX 1E3HA 3CMMA 4YFKF 5A2QZ 1R6RA 3E1SA 1BI1A 3JREA 4D0PA 2O9LA 2FUG2 3RCOA 4UUVA 2BVLA 1BW6A 3HZJA 1ETWA 2ZNZA 3M8FA 3J7ZI 1FOWA 1YW7A 5JHUA 1XGMA 3GTQJ 1AKHA 1PUEE 2FBKA 1ZRFA 2VB6A 5E20A 4D5CA 5D5VB 3FKIJ 2XC7A 1LPQA 3VWBA 3K2AA 4KICA 4BEHA 1D1CA 1ZARA 1FMVA 1AA7A 4E6KG 1XGSA 2QBYA 3WGHA 3RTRA 3VSKA 2P7VB 2WV1A 4UUSA 1R5ID 1X3UA 4WX9A 3KPHA 4Q48A 2P6TA 3I64A 1C0WA 2L2OA 3RPUD 1SC7A 4XKCA 5CLSA 3PUBA 2UZKA 4XORA 1NTCA 3QU3A 1OR7A 4Y15A 1G8XA 2E1OA 1SMTA 3IAS2 3D5RC 1TW3A 5F08A 3S93A 4A3DJ 2LF8A 4IKFA 1USSA 1XCBA 3W6KB 4B1RA 5ERIA 1LEAA 4BHCA 4NHJA 3HSFA 4YG2F 1APLC 2W82A 1I5ZA 3L2CA 1VQNI 1BR1A 1MNDA 1S9HA 1ZTRA 3AKZA 1ZLKA 2R5YA 4HRIA 4FX4A 2NS8A 1GLNA 5EEAA 3IWFA 3QYBA 2IP2A 1OCOH 1VQMI 2K3FA 1RR7A 2Q0OA 5J4VA 2XF5A 3ROUA 2L0KA 2EIKH 3ELKA 5LD2C 1ITYA 4JX6A 3CCRI 1P6RA 2KZVA 2E5ZA 1Y8RB 4C3IJ 2ZJQF 5D6FA 2V1UA 3CUOA 1MJAA 2EB7A 3HPHA 1MBGA 3DLAA 3N05A 3LOCA 1PJRA 2JPCA 3RJPA 1R4NB 2VLAA 1WQ2A 3IKTA 3VEPA 3VYTB 4A3FJ 3KZYA 3RYRA 5FROA 3F9KA 2NVQJ 3DKXA 2IA2A 4BGDA 3BQYA 5EG0B 4IPAA 1JKOC 4OWRB 4A0YA 2CFOA 2P8TA 1IO2A 4PSWA 2NOJB 1ETQA 3GEZA 1H9TA 3HOUJ 2KFDA 4CCMA 2AS5F 1MMSA 1MMAA 2RC4A 2E1MB 1JT6A 3F21A 4GCVA 3OYAA 3KP2A 2A68F 3TW6A 3CMYA 1IGNA 3QAHA 2F5EA 3K7AJ 1QHHD 4M73A 1G59A 3PJRA 3QPLA 4CCOA 1PUFB 1X1BA 2HTSA 1VQLI 2ZNYA 1GXPA 3CJNA 3HSRA 2M0CA 2CYYA 2DN0A 3GCMA 1FIAA 1BI3A 3I9V2 1SVLA 2DJNA 2I10A 3B73A 5EDNA 4G7OF 1DPUA 3F6OA 1RUOA 2O0YA 1O3SA 1R71A 4PCQA 4IHWA 2DW4A 3CP8A 1K4TA 1FYLA 1R1VA 3HOYJ 4A3IJ 4E7SA 3QU6A 2GIVA 2JJ7A 2Z99A 2RV8A 1BA5A 3WG9A 5F0FA 3OIQA 2QCOA 2OC6A 4HG2A 2OA4A 5J4YA 3J7AY 4R1HA 4PSXA 1Z91A 2ELKA 1A6IA 3K1MA 3H5NA 5DM6F 2VXZA 3VOEA 2IXSA 1OQYA 4N4OB 1LVKA 3GTJJ 3VPRA 2L4AA 3PL8A 4RB3C 1FMWA 4LLLA 3SZTA 2FMLA 5B3SH 5D4RA 3A0BC 5ILVA 3ZPLA 3K4NA 3GO5A 4FCYA 1OCTC 2LD5A 4DYQA 4ITVA 5LHIA 3WTZA 2ZCWA 3SDGA 5IOYA 2IPQX 5TRDA 1ZRDA 2OQRA 2OBPA 3TDZC 4XSZF 3GLLA 5E8IA 5K5OA 2GZWA 2BGCA 3U21A 3J81Z 2NS0A 2JTVA 3HGYA 1YQAA 2KJBA 4IJAA 2DOFA 4FX0A 3Q0VA 1TNSA 2Y0SA 1U5TC 1K79A 3DTKA 2BY1A 5F1JA 1RKTA 2W24A 3EYYA 4DGWB 3K4KA 1IUFA 1E0EA 2ZJRF 1MH3A 3CQZJ 4A3JJ 3MD2A 4WCGA 4XICA 4EM2A 1PUFA 3MVPA 1TC3C 4KUMA 1ETYA 4CHUA 4I98B 2R93J 5E3NA 5C44J 1B59A 2XGCA 4M6YA 1SFXA 3SZPA 3D1NI 1FYKA 3GTGJ 3E6CC 2F2EA 1B4AA 2X51A 5FFXA 2A6TA 3DXJF 3JTGA 1RUNA 5EEGA 1K6YA 3FISA 2DPDA 3BJ6A 3EPZA 2PBIA 1B72B 4IL6C 1RETA 4BUPA 3K4MA 2X6OA 1Y56A 2XRNA 3ZP5A 3AG4H 3LNQA 4M3DA 3S1MJ 2DT7B 4XLEA 5B1AH 2LVSA 1Y8QB 3L9FA 5CYVA 2E1CA 2DXIA 3MFKA 5BNGA 4ZTJA 2K7LA 4L5JA 3NQOA 4HEA2 2HQRA 3BWGA 1ON2A 3RKQA 5FKLA 1Y1VJ 5H6QA 3QOEA 3JRFA 4O6JA 1GHCA 4A0ZA 4CICA 2M1BA 3LSHA 4XL9A 1HLVA 3CC4I 3GLXA 2EA2A 2DU9A 3QPHA 4HNTA 2GXBA 2NYXA 2E2JJ 3T8TA 4M3EA 3S2DJ 2R7WA 2JT1A 2M9HA 1X4OA 4M72A 2BXZA 2F6CA 2Y48A 3I3LA 3L2RA 1VF9A 4GFBA 4BBSJ 3VSLA 2ADUA 2CUFA 2OUMA 4LJZF 1YS7A 3P9CA 4O5VA 4AU7A 3C2BA 2QLZA 4ESJA 3I59B 1E17A 1KU3A 1TQMA 2PX9A 2STTA 3E5XA 3L7WA 1GXQA 1XPXA 3ZMVA 1YE9A 1D0YA 2KRFA 4ESFA 1T33A 4RS8A 1ON1A 5L3EA 5DUIA 1QZZA 1HOMA 5L3DA 1J59A 5H6RA 2WY8Q 2BY3A 1H0MA 2FRHA 1J9IA 3FBIB 2BV6A 5B1BH 4XLCA 4XOPA 2DMNA 1P7JA 1POGA 4B48A 2IGKA 3ML6A 4NC8A 4PDKA 2XKPA 3BLYA 2LLKA 3WG7H 4CYCA 3PIPF 2GIZA 2DMTA 2RGVA 4BU2A 2K3PA 1F5TA 1IN8A 5HS8A 1TZLA 3QPSA 1FOYA 4I99C 4AIDA 2K5CA 1B72A 4U7DA 1SAUA 4LD5A 1D5YA 3RYPA 2E36A 5JI6A 5KNLA 1S5LC 4UB6C 1AWCA 3RDIA 5LGNA 3W6VA 1FPQA 3BR3A 2CFXA 3DBLB 2XPVA 3WHBA 3GTKJ 1X3ZB 3GTMJ 1MZBA 5GPAA 2VJ4A 2V9VA 5BQTA 4B43A 2KRHA 5L3CA 4JX5A 4CGZA 1WGXA 4DQ2A 2F5CA 2HDDA 1XN7A 2TDXA 1JHHA 2E35A 3ERMA 3IP4B 2DA7A 3LFUA 4P55A 2XGEA 2LY1A 3BR2A 5GAHJ 5FB2A 3RZOJ 2KIUA 2XAJA 2NXNB 3GVAA 1YX5A 2QENA 2E2IJ 2EZHA 3S15J 1V5GA 3Q9VA 4MFDA 3F22A 1ZG5A 2CW7A 3HHGA 4IO9F 3MKLA 3OYDA 1ZQ3P 2CS3A 2HZTA 3I59A 1U8RA 2X6XA 3PNYA 4XONA 4IF4A 4A69C 4IHSA 2CQKA 3OS1A 3K10A 3GTPJ 4PUSA 2VQHA 2XAGA 3LSIA 4N9IA 3SFZA 2LC2A 4V2FA 3ZQQA 5ILUA 1BR4A 1ZH5A 4I09A 3U9GA 2K9LA 3OYEA 3S14J 2EV0A 4E7ZA 4GDFA 3IKVA 1JKPC 4JOMA 3BG6A 5JR3A 1U5TB 2XV4S 5C4XJ 3CO7C 2DJIA 2IS6A 4LG3A 1ZK8A 1UFMA 3QP6A 2CWEA 4FQGA 4O3MA 2HYFA 3BDDA 2PEXA 1G3WA 2IW5A 4LOCA 3VYUB 1WPKA 2P5VA 1ZREA 2M2EA 4HSRA 1HW2A 1B8IB 3J81K 1B1BA 3TKYA 5C4JJ 1CF7B 1EV7A 4KMUX 4NNJA 4MIMA 5E3LA 2L4MA 5FLMJ 2FEZA 2EV6A 1SD5A 1TT5B 5DS9A 2Q8KA 1MD0A 3PNTA 3HSEA 2M8GX 4J01A 4DZJA 1LE8B 3JSPA 1R36A 4BDZA 1N77A 1K4SA 4M74A 5H2FC 1WJCA 4E7IA 2VPLA 1HSJA 4UY8I 4RGUA 3IRRA 4V2GA 2L9RA 4GGGA 4XLNF 3Q3SA 3PIOF 5D6EA 3I4NJ 5BS6A 3GF2A 2E2HJ 2D45A 1WSUA 1LUJB 2LF7A 4QPOA 3DEEA 2HGCA 4AVZA 4XRSG 2R7VA 3AL0C 4XOTA 2Y75A 2FBHA 2K4JA 5LGUA 1TQIA 4E4HA 3I58A 1KA8A 3MEXA 1I6XA 1Y0NA 1XSVA 2H6BA 3P9IA 5JLXA 3IL2A 2FF4A 4G94A 3HOTA 4BXXJ 1J7KA 2KMUA 2EV5A 3TO9A 4PJMA 2F48A 3G73A 1TWGJ 5FO5A 3HOWJ 1FP2A 1LFPA 1R22A 2Z1DA 5F0CA 5F64A 4BE2A 2GQQA 4HV6A 4NBQA 4PZJA 3MZHA 2FU4A 3HKZA 3BG9A 3LFKA 4TV7A 3G4SI 4Y13A 1U5TA 3FZVA 1Z7LA 4WXHA 1JE8A 5ICFA 4E7LA 2MD5A 4AIKA 4P1WA 2XAFA 1QO0D 3FHZA 4ZYGA 2HOTA 1XG1A 1X1AA 1YW8A 2O3FA 4KFCA 1YS6A 4Y3OA 2WTEA 1K83J 2EBIA 1B8IA 5DEQA 1CF7A 2DCEA 1P4AA 4DJAA 4D7NA 3S3OA 4IQJA 2IA1A 1Q1VA 1R23A 2KL4A 2PQ8A 5DTDA 1HDDC 2YX4A 3LWFA 4A3MJ 3E0JB 4CSWA 2LFBA 2G0EA 3BTCA 3EYIA 3KP5A 3QQAA 2QQ8A 3I0TA 4I01A 4C2MJ 2CUEA 1LDJA 5LRRA 3SEQA 3PO3J 4UNOA 4MHGA 2IAIA 5M5YJ 1YITI 1LE8A 1BBYA 5ILSA 4OIQF 3KFWX 1TWFJ 1ERDA 3IC7A 1IAWA 2UUZA 4LIVA 3BPVA 1Z6RA 2QZ8A 4PJ0C 4BXUA 2K02A 2JPBA 4LLGF 1H88C 3HPGA 4KISA 2P7CB 3HRTA 2OF7A 1QVUA 4M6XA 4A3BJ 3HXLA 5J40A 5E8GA 4G8XA 2FQ4A 2Y69H 4IRGA 2DOEA 5FRNA 2BE5F 5HDGA 3LMMA 5DDGA 3BTLA 2PMZA 3QWLA 1U78A 6PAXA 1QHGA 1AU7A 3C18A 2MW8A 3HB9A 1A6QA 3K4BA 4BQQA 1ZG1A 1XMXA 3H5RA 1DQUA 3CC7I 3A1YA 4HDVA 2DPUA 3S1QJ 4QSHA 1Z21A 3FWEA 5L3BA 1MDMB 1LJ9A 4D9JA 2XROA 1I50J 1VQOI 3VFZA 2OV7A 2K9NA 2AQEA 2DDAA 1IDZA
chains in the Genus database with same CATH topology
2Q1ZB 1UG0A 3HPHA 3DLAA 3N05A 3DPTA 4JQFA 2WAEA 1PJRA 2VLAA 3VYTB 5FRMA 3OYKA 3L2UA 5FROA 3F9KA 3ONQA 4N4NB 3DKXA 2UV1A 1Z3YA 4BGDA 1V5EA 1D0XA 4OWRB 2CFOA 2HPIA 2X1DA 4PSWA 3OIPA 2BOLA 2NOJB 4PFPA 4QPQA 3HOSA 2WAQA 1Y6IA 3CF2A 1V5FA 2CUZA 4CCMA 3M8JA 1MMAA 3VYRB 2E1MB 2ZXIA 3OYAA 2HZDA 2RQQA 3LSGA 2P0WA 2VQGA 3S3MA 2JSPA 2LH9A 1Z3XA 3OWTA 4DBRA 1BOBA 1PYVA 1QHHD 3CZ6A 1G59A 3PJRA 2LY2A 4CCOA 2W7NA 1X1BA 2XF7A 2HNHA 3ZR8X 2IS2A 3K70C 2JUGA 2L7KA 3I9V2 1KONA 4XM3A 4EATA 4XR6A 3QYFA 4KT6A 3VDXA 1YX3A 2JVGA 3D5LA 2I8DA 4II3A 3OYNA 2IS4A 2Q2EB 3M1CA 3CP8A 2LREA 2V6EA 1BR2A 4E7SA 3AL0B 3A2KA 2WBMA 3OS0A 3OIQA 2XAUA 2OC6A 4HG2A 4DBQA 3L2VA 4XQFA 3J7AY 4PSXA 3EUHC 3HUGB 4CA0A 3H5NA 2VXZA 2IXSA 4N4OB 2ZFUA 1LVKA 2R7SA 2M7BA 4BQOA 2V26A 3NWTA 3PL8A 4D1QA 1T95A 1FMWA 4F92B 2HDWA 4BXFA 2E60A 4XNFA 3K4NA 4XLAA 3S8PA 4XMYA 1MMNA 4BQNA 4ITVA 2V4JC 3W2WA 1N78A 4HNUA 1HA8A 4LITA 3OYJA 3U21A 3RSNA 2Y0SA 2CUJA 3DTKA 5LFAA 3S3NA 4Y33A 3L2QA 2R4GA 4DGWB 3W3CA 3K4KA 4OAYA 1E0EA 2VKDA 3AFHA 4DOZA 3MD2A 3CJQB 1MMGA 2JVHA 2X6YA 4ZYAA 3IAM2 4PK4A 5HNFA 3EUKL 3BCAA 2GOMA 1WJAA 2KDOA 3CESA 2ZSHB 3DPUA 3OR2C 2R7OA 1WJFA 3DPLC 1X19A 2X51A 2IGMA 2XSJC 2W00A 2A6TA 3OYMA 1WJBA 4E7JA 1K6YA 1DGRM 1EA3A 4MLOA 4Y4RA 3EPZA 2LG4A 3FHNA 2MC4A 3SYTA 1D0ZA 3K4MA 3QYEA 4BUPA 4B44A 4FASD 1Y56A 2W1OA 1JI8A 3PSIA 4RM3A 2DT7B 5CKTA 4XLEA 3UR3C 2R7RA 4YELA 2M7AA 2DXIA 4ZTJA 4HEA2 4OAZA 3A4CA 4CCNA 3QOEA 4IZZA 3OYIA 1OR7C 3OYFA 3G2BA 1LDKB 3LSHA 4XL9A 2X1CA 3IUOA 4B3XA 4HNTA 2M3AA 3H9QA 4BE0A 2VQLA 3H5AA 5KHDA 2R7WA 1T0FC 1X4OA 3FKJA 2F6CA 3I3LA 3L2RA 3H9JA 4F52A 3VSLA 1WJDA 2BVMA 2MD0A 2F5VA 4BS9A 2OUMA 3ZRGA 1D1AA 4CZCA 3H9GA 2WY7Q 1IRXA 3S32A 4AU7A 1VZ0A 3LL7A 4PJLA 4ANJA 3C2HA 4KJZA 4CH7A 1DGWY 3MKYB 1YE9A 1D0YA 1UELB 1WJ5A 2WADA 4H4KC 2VKHA 2PJRB 4CCLA 2WY8Q 3FBIB 2IS1A 2CMPA 4XLCA 4FETA 2KHMA 4XOPA 1MNEA 3PNVA 4B48A 2IGKA 1DP3A 4NC8A 1D1BA 4IX7A 2M4GA 3BLYA 3OS2A 4PJJA 2DT6A 2M4KA 2MFZA 3L2WA 4BU2A 2XDVA 1MMDA 2K3PA 2KRCA 2WB1A 2ZSIB 1TZLA 2V7FA 1WJEA 3HC7A 2K5CA 1X1CA 4NUBA 4IQ4A 4ZJZA 1SAUA 2KLOA 2UWMA 2XF6A 4NC7A 2QKLB 5KNLA 4C2UA 2HQAA 3KYLA 4II2A 2VJ4A 4F55A 3EUAA 3OOUA 4B43A 2KRHA 2O5RA 3SDBA 1NG7A 3OR1C 2CV2A 2LBFB 1NG6A 2LYCA 3IP4B 2Z2SB 3LFUA 2LY1A 3MMYB 4BACA 4KITB 3DU5A 2F4IA 4XKVA 4ZDLA 4ZDOA 2HVSA 1YX5A 1V5GA 4NQWB 2VASA 1QU3A 2VIXA 5KCMA 2DOAA 2MYSA 3HG9A 2CW7A 3OL3A 3OYGA 3OYDA 3ZGKA 2CS3A 2X6WA 2BW3B 1ZELA 4B47A 4BJTA 2R7TA 3CP2A 2KQRA 2X6XA 3PNYA 4XONA 4RLFA 3MKZA 2W4SA 4XLFA 3K10A 3OS1A 4PUSA 2VQHA 2CV1A 3LSIA 2R7QA 4CUGA 2IGNA 2ZXHA 2LC2A 2VQCA 4F91B 3ZQQA 4YEJA 5CQGA 1BR4A 2PJRA 2WA0A 2K9LA 4J00A 3SZGA 3OYEA 4E7ZA 3KX2A 3CJRB 3HL2A 4JOMA 3BG6A 3TMOA 3FBNB 2WAFA 2GOXB 4PJNA 2DJIA 2HU9A 2IS6A 4LG3A 3LSMA 4CCKA 4BE1A 3VYUB 3VYSB 4HSRA 2E1MC 1UAAA 3K70D 3OYBA 2L5QA 4NNJA 3K6GA 4XKWA 4E7KA 4ZDPA 2V1NA 3H35A 4BEHB 4C9YA 2CV0A 4GRIA 2KPMA 3BC8A 3PNTA 5HVQC 4J01A 3OL4A 5JHFA 2RREA 4X0GA 2LBFA 2MABA 3OMYA 2HVQA 4BDZA 1N77A 1WJCA 4E7IA 2VXDA 2VPLA 3DKYA 1X4PA 5TGTA 4ZTFA 4P5OA 1SFKA 4LIUA 4BJ6C 3PSFA 4QPOA 4YRVA 3DEEA 4AVZA 4G6TB 3V42A 5CPRB 3OYHA 4XOTA 2HPMA 3AL0C 2R7VA 3K4JA 1X1DA 4R79A 3OY9A 3BCBA 4E4HA 2X85A 3DTIA 2BW3A 2KP6A 1WFXA 2A5WA 4XN0A 2LRDA 2CH0A 3HOTA 5HNHA 2KMUA 4PJMA 3OYCA 4C2TA 4AYBA 2K9MA 4RM2A 3H0DA 4ZC3A 1LFPA 2L9SA 3GBGA 2Z1DA 4BE2A 3NWSA 2VL8A 4U7BA 2RNGA 3HKZA 1J09A 2QKMB 3DU6A 3BG7A 3MKWB 3TBIA 3KEYA 1Z7LA 5HOOA 5CQEA 3ZCOA 4CCJA 3DTEA 2IGOA 4E7LA 3TL4X 2Z16A 4XKBA 4RLQA 2JA2A 4HPQA 3CMMA 3K4CA 4P1WA 1W36D 1R6RA 3E1SA 4U87A 2FUG2 1X1AA 3RCOA 2BVLA 4Y3OA 4DIQA 2DCEA 4DJAA 3S3OA 4IQJA 4F93B 4HSTA 1P9QC 3PFYA 2KL4A 4C30A 2VB6A 4BL0B 3C2GA 4BJ5C 3E0JB 4CSWA 2VJJA 2XC7A 1OLTA 3VWBA 2ELJA 4BEHA 1D1CA 1MW7A 1FMVA 3SEQA 1AA7A 3RQ4A 4E6KG 3K4LA 3RTRA 3VSKA 4XN3A 4F3QA 2LOOA 5HLTA 4RMNA 1ERDA 2UUZA 4LIVA 2L9NA 2L2OA 3RPUD 4XKCA 2HVRA 3PUBA 3HPGA 2X1EA 4KISA 4XORA 3W2AA 1G8XA 1U0JA 3D5RC 3IAS2 3S93A 3HXLA 4IKFA 4PFOA 3OYLA 3FDYA 1W36C 5FRNA 1TT0A 2CW8A 2M0MA 3DWLE 2V9KA 3LMMA 3W2VA 2W82A 2E5NA 2PMZA 2R7UA 1BR1A 1MNDA 1S9HA 3AKZA 2AQFA 4HRIA 1QHGA 3D5SC 4XLHA 1GLNA 3K4BA 4BQQA 1LKXA 3QYBA 3H5RA 1DQUA 3UNGC 3A1YA 3QODA 2XF5A 1N75A 5LD2C 1Z21A 4D9JA 3ZXSA 3LSKA 2R7XA 2OV7A 2KZVA 2E5ZA 2VJ5A 3SEZA 4BDYA 4E7HA 2AQEA 2VJIA 3DQVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJF A;  3HPH A;  3F9K A;  1WJD A;  3HPG A;  1E0E A;  1WJE A;  4F3Q A;  1WJC A;  1LFP A;  1WJB A;  1KON A;  1K6Y A;  1MW7 A;  1WJA A; 
#chains in the Genus database with same CATH topology
 2Q1Z B;  5F27 A;  1UG0 A;  2WAE A;  1YOV B;  1VI0 A;  1HF0 A;  2O03 A;  2OD5 A;  5CVV A;  3OYK A;  2QBY B;  1F36 A;  2OU2 A;  2BXY A;  3MN2 A;  1Z3Y A;  2HKO A;  9ANT A;  1SVM A;  4QPQ A;  2LTP A;  1MIJ A;  3FIW A;  4L0Y B;  3VYR B;  4EGZ A;  1S7O A;  1H9G A;  3QOP A;  2MLG A;  4Y7N J;  2H1L A;  1I6H J;  1WZ2 A;  1XC5 A;  3N4M A;  2HFH A;  2PMU A;  2LH9 A;  1X3W B;  1Z3X A;  1BOB A;  3CZ6 A;  2VOD A;  3CCU I;  4G9Y A;  3JRB A;  3ZQC A;  1J2X A;  1UZC A;  3ZR8 X;  2ISY A;  2YR2 A;  2P4W A;  3K70 C;  2D2W A;  2JUG A;  1VTN C;  2L7K A;  1MBF A;  2AXL A;  5BPD A;  1KON A;  2CU7 A;  4RGR A;  4XM3 A;  1JGG A;  3QYF A;  2JVG A;  2B9S A;  1A31 A;  2VUM J;  1QBJ A;  2G7H A;  2EIN H;  1FSH A;  2LRE A;  1PDN C;  5F6F A;  2I5U A;  1BR2 A;  2FXA A;  5JFR A;  2UXN A;  3AL0 B;  2O6G E;  2WBM A;  3M7G A;  2CQQ A;  3OS0 A;  2FQ3 A;  2DBB A;  4KN4 X;  4M9S A;  1IJW C;  3HUG B;  2Y9Z A;  2GXA A;  3WTU C;  1HCR A;  3V8J A;  4DNC A;  3TO7 A;  2HS5 A;  1MDM A;  2WC2 A;  3FM3 A;  3S2H J;  5L3G A;  2LSO A;  2M7B A;  3HRS A;  3LST A;  2NAZ A;  3IH4 A;  3QPT A;  4BQO A;  4EV0 A;  4D1Q A;  5AIP A;  3S17 J;  4F92 B;  2HDW A;  1BI2 A;  3E6D A;  4ESB A;  3K2Z A;  4BXF A;  4W1U A;  3ZQ7 A;  2VE8 A;  3C3W A;  3S8P A;  3ABM H;  4DZP A;  1LNW A;  4XMY A;  4IXA A;  5D8K B;  2QGU A;  4HLY A;  1VQ9 I;  5J8F A;  4G12 A;  4V19 K;  4XRF A;  1GV2 A;  1IZ1 A;  4P9F A;  4LIT A;  4RAZ A;  1T39 A;  2IJL A;  2A05 A;  4S04 A;  1SD7 A;  4BY1 J;  3S3N A;  1DU6 A;  3M4O J;  3ABK H;  2F4O B;  3WGI A;  3P5J A;  4OAY A;  2DA5 A;  2XKO A;  4KDP A;  4HV5 A;  3S1R J;  1MMG A;  2JVH A;  5GAG J;  2X6Y A;  4LB6 B;  4ASN A;  1RZ4 A;  3WE2 A;  5HNF A;  2MBF A;  2RAE A;  2H8W A;  2COM A;  5HLI A;  2A6E F;  2DMQ A;  5FFZ A;  3E3V A;  2DLL A;  5F04 A;  5TJJ A;  3DPU A;  3OR2 C;  2R7O A;  2IBD A;  4XSX F;  5IYC J;  4BKX A;  3F8M A;  2ZXJ A;  4HF0 A;  4N9H A;  1IXC A;  2OCE A;  5B66 C;  2XSJ C;  1YJ9 I;  3CUQ C;  4EQQ A;  1DGR M;  3Q9S A;  2RQP A;  2JQ7 A;  1FT9 A;  1F9N A;  3H3Z A;  5GTH C;  3QYE A;  2W1O A;  3U1K A;  3PSI A;  5BOX A;  4RM3 A;  2R7R A;  3JAM Z;  1Z9C A;  4EGY A;  3HUG A;  5E3M A;  2O7O A;  4WWC A;  1YJN I;  3DFG A;  4CCN A;  3GFL A;  4B09 A;  3OYI A;  3WTW C;  1ULY A;  4LLN A;  2EIL H;  3I5U A;  3E6M A;  1BIB A;  1OKR A;  2M3A A;  3H9Q A;  2VQL A;  5J47 A;  1UMQ A;  1XD7 A;  2EQR A;  1XTA A;  5KHD A;  1T0F C;  1RC9 A;  2GXG A;  1V54 H;  2QQ9 A;  1NK3 P;  1S7E A;  1ENH A;  2ZJ2 A;  3GUD A;  2R3S A;  1AOY A;  4P96 A;  2Z3Y A;  2AHQ A;  2ZKZ A;  4F52 A;  2BYV E;  2EFQ A;  2MH9 A;  4EM1 A;  2BVM A;  2MD0 A;  4BS9 A;  1VQ6 I;  2VBY A;  4FT8 A;  3JRG A;  2GAU A;  2YSR A;  4CZC A;  1IV8 A;  2XB5 A;  4UXN A;  3JRI A;  1O3R A;  1OCP A;  4H0E A;  4PJL A;  3ERE D;  5FD6 A;  1T08 B;  4K2E A;  3P9K A;  3MKY B;  1J75 A;  3KLO A;  4DYC A;  3ZQH A;  3TDU C;  1W5T A;  3B6A A;  5D8L B;  5LBQ A;  2WAD A;  5F1R A;  4H4K C;  1UHM A;  1ETK A;  4AUX A;  1JT0 A;  2PJR B;  3M9A A;  2B63 J;  2VC0 A;  2H27 A;  5HLH A;  5FKK A;  1BJA A;  1R49 A;  1TW2 A;  1TTY A;  1L3L A;  3PNV A;  1SFE A;  2FOK A;  2RKH A;  3K0L A;  3ZMT A;  1YIJ I;  3RPQ A;  4BBR J;  2GA2 A;  2LNB A;  3AG2 H;  3L2W A;  2KRC A;  1MJ9 A;  4RBO A;  1BW5 A;  1OJL A;  2EH3 A;  3HEF A;  4IQ4 A;  4ZZD A;  2QUF A;  4UVB A;  2UWM A;  2QQB A;  2XF6 A;  2IVM A;  4NC7 A;  3O6B B;  1FOX A;  2NVU B;  4OMY A;  3ESW B;  3MWM A;  4QWQ A;  1F43 A;  2OTJ I;  3EUA A;  3KEQ A;  1A36 A;  1FC3 A;  3OR1 C;  1G3Y A;  2LBF B;  1NG6 A;  1MBE A;  1MSE C;  2XHK A;  1SFO J;  3EDP A;  2Z2S B;  1STZ A;  5DCM B;  4Q5S F;  4ZDL A;  4ZDO A;  4UVC A;  2A69 F;  5J6X A;  1EKE A;  4NQW B;  2DK8 A;  3S16 J;  2ZFW A;  3F8B A;  3HG9 A;  1FIP A;  3FK7 A;  4B47 A;  2X6W A;  3ASN H;  2BW3 B;  1ZEL A;  4R8H A;  3CP2 A;  5A2Q K;  2DFI A;  3JCU C;  4RLF A;  4MO7 A;  4XLF A;  1W7P D;  4AC0 A;  3UKG A;  3RPU A;  1T6S A;  4CYC B;  5EEH A;  1IXS B;  3Q0U A;  2PJR A;  4BYY A;  4B4C A;  1KYZ A;  4Q47 A;  2FA5 A;  3SZG A;  4IOA F;  1L0O C;  3JW4 A;  3CJR B;  3RI4 A;  1HBX G;  5HS7 A;  4JX4 A;  2L7F P;  2RDP A;  2G7U A;  3SHF A;  4AYB N;  2VON A;  2WAF A;  1OYI A;  5AIQ A;  2HU9 A;  2E7X A;  1MGT A;  3T5X A;  1LFU P;  4CCK A;  4BHP A;  1NK2 P;  4BE1 A;  2JZY A;  1UB9 A;  1Y39 A;  5J1U A;  5M3F J;  3NRV A;  1S6L A;  1UAA A;  1G3S A;  3V4G A;  4KMF A;  4IRI A;  2RN7 A;  3HOZ J;  2L5Q A;  4IHY A;  5LEJ A;  2EFN A;  2A6H F;  1WI3 A;  2LR8 A;  4ZDP A;  4UV9 A;  2ME6 A;  2V1N A;  1YHQ I;  2A61 A;  2CV0 A;  4YII A;  3ZMZ A;  4I76 A;  1R9T J;  2HOE A;  3KZZ A;  1BJZ A;  3FF5 A;  1ORK A;  1W5C C;  4NB5 A;  2ISZ A;  3OL4 A;  2LBF A;  3D0S A;  2MAB A;  1QNT A;  4P9U A;  1YJW I;  2VXD A;  3HOV J;  4ZTF A;  5DCM A;  1QZE A;  3F23 A;  4JK1 X;  4LIU A;  1XX5 A;  2NRA C;  4BH9 A;  1TL8 A;  3PQJ A;  4G7Z F;  1X58 A;  2V1X A;  1LB2 A;  1SMY F;  3PSF A;  4I0A A;  5K7Z A;  4YRV A;  2HPM A;  4G6T B;  5CPR B;  4X6A J;  2IEK A;  1S3J A;  1X1D A;  4NQW A;  5D4S A;  4E70 A;  4R79 A;  3BCB A;  3ZOB A;  3JSO A;  3LQQ A;  4LG0 B;  2X0L A;  1EF4 A;  2A3S A;  3BZ6 A;  2D5V A;  2BW3 A;  4IEJ A;  5M5X J;  4XN0 A;  2HQN A;  4QTR A;  4L5E A;  2LMD A;  3JAM K;  1W0T A;  5IPA A;  2BY2 A;  3OYC A;  1XMA A;  3R6S A;  3Q5F A;  2EPF A;  2X48 A;  2BHZ A;  4AVP A;  3GBG A;  3ABL H;  2EIM H;  1ACI A;  4MGR A;  1WKM A;  3FK6 A;  1I3Q J;  3FXU A;  2ESH A;  4MTE A;  2E71 A;  3DU6 A;  4AIH A;  3BG7 A;  1FZP B;  4XBF A;  3KEY A;  4ON0 A;  2ZME C;  4JBA A;  2IGO A;  1ODD A;  2PN6 A;  3TL4 X;  4L9V A;  2M30 A;  5DUK A;  4XKB A;  3E6B A;  4A2U A;  1WCM J;  4M9Z A;  2OQG A;  3K4C A;  1PP8 F;  4DW6 A;  1W36 D;  5TIS C;  3KCC A;  4U87 A;  3I56 I;  5DM7 F;  1GDT A;  2L7M P;  3IV5 A;  2YX7 A;  2KT0 A;  2FX0 A;  2DAO A;  4HST A;  3JTH A;  3PFY A;  4HNV A;  1BI0 A;  3BG5 A;  2OAZ A;  3L1P A;  4BJ5 C;  2KDZ A;  1X1P A;  2O61 A;  1V55 H;  2HI3 A;  2X9D A;  1OLT A;  3G1M A;  5IT3 A;  3CUQ A;  3F8C A;  2ELJ A;  4U88 A;  2Z5U A;  2VBX A;  1FJL A;  1DU0 A;  1ZAO A;  3KP4 A;  1OCR H;  4F3Q A;  2LOO A;  3ZN1 A;  5HLT A;  4YIR X;  2E1N A;  2HOA A;  3H1C A;  3BY6 A;  3FMR A;  5JVT A;  4CO8 A;  3BJA A;  4ENM A;  1HXD A;  4AIJ A;  3FM5 A;  4RB1 A;  1QPI A;  3V7C A;  3GYH X;  2PMH A;  5FJ8 J;  3FMQ A;  2MSY A;  3W2A A;  1N25 A;  1FEX A;  2M5W A;  4LG0 A;  1U0J A;  4PFO A;  3OYL A;  2F5D A;  3FDY A;  3S2W A;  1T0F A;  1FOK A;  2M0M A;  2V9K A;  3DLL F;  3IH2 A;  2GLO A;  1WH7 A;  3CME I;  1OMI A;  1UG2 A;  1XDU A;  2HYG D;  4XLH A;  2B7E A;  1LKX A;  2X4H A;  3BR6 A;  1W4M A;  4S0H B;  2R92 J;  3IH3 A;  3QOD A;  2O8K A;  4WXC A;  4UUT A;  4U0V A;  4LK0 F;  3HOX J;  3LSK A;  1B9M A;  2OZ6 A;  3JRA A;  3SEZ A;  2L3D A;  3KP3 A;  3DQV C;  2YS9 A;  1I1G A;  1I39 A;  3DCF A;  3GZN B;  3WU0 A;  4JQF A;  1RIO H;  2EFP A;  3FXM A;  3DEW A;  3L2U A;  2E7W A;  3KYC B;  2QEX I;  1Z0X A;  3ONQ A;  2UV1 A;  3FXO A;  3OOP A;  4L18 B;  3ECO A;  3BZK A;  3TOA A;  4IOC F;  2VI6 A;  1BC7 C;  2X1D A;  3JR9 A;  2TRT A;  5E1W A;  4PFP A;  1IW7 F;  2WAQ A;  1Y6I A;  5HDK A;  1V5F A;  5GP9 A;  4A3L J;  3M8J A;  5B5E C;  5FKN A;  1IRZ A;  2ELH A;  3LSG A;  1IN4 A;  1KYW A;  2VQG A;  1S7A A;  1R5G A;  4UV8 A;  3OWT A;  4DBR A;  2PI0 A;  1KU9 A;  1XB4 A;  2W7N A;  3CTA A;  2V9P A;  2LKP A;  1VQ5 I;  2XF7 A;  2HNH A;  3J7A O;  2Z9O A;  4CYD A;  4A5N A;  2EFO A;  1O3T A;  2IS2 A;  2LKS A;  5J8C A;  5IT9 Z;  4FE4 A;  2K9S A;  2KIF A;  3TQN A;  4EMS A;  3WTT C;  1PP7 U;  3LA7 A;  3VDX A;  5IP9 J;  2GWR A;  2I8D A;  1IRF A;  2ZO4 A;  2Q2E B;  3VOD A;  2V6E A;  2RVC A;  2GM4 A;  3HRU A;  3G3Z A;  2K4B A;  1XSD A;  2VT2 A;  3A2K A;  1D8K A;  1ZN2 A;  1XS9 A;  4DBQ A;  3KET A;  4IHV A;  1HQC A;  3EUH C;  2ME0 A;  3BG3 A;  4FIS A;  3ZMD A;  3KEO A;  2UXX A;  3WTY C;  2ZFU A;  2P5L C;  2R7S A;  1P4X A;  3OV8 A;  2V26 A;  1U6G A;  2VOP A;  1TWC J;  2HKX A;  2QF7 A;  3ECH A;  1K78 B;  3O3K A;  1Z67 A;  1MBJ A;  2VT3 A;  4XNF A;  5GAD J;  3MCZ A;  1MMN A;  4XRM A;  2C6Y A;  2V4J C;  4EJT A;  1IG7 A;  4JYK A;  1N78 A;  5LLQ A;  1V4R A;  2ZME B;  2DOD A;  4HNU A;  1QRY A;  3SJM A;  3AAF A;  3CCQ I;  1Y1W J;  5FKO A;  3OYJ A;  5BMZ A;  2W57 A;  2XPU A;  2PFB A;  3RSN A;  2ID6 A;  4FTH A;  3IWZ A;  2DT5 A;  3ZMU A;  2CUJ A;  1W5S A;  5LFA A;  1R00 A;  1HC8 A;  4Y33 A;  3AG1 H;  1FX7 A;  3TOB A;  3G71 I;  3E5Q A;  3W3C A;  1HW1 A;  4AD9 A;  5M3M J;  2VKD A;  3AFH A;  2ICW G;  2DMP A;  3CJQ B;  1SVO A;  4UVA A;  1REP C;  1QA6 A;  3H0G J;  2DYS H;  4A12 A;  1QVT A;  4U0W A;  3EUK L;  3BCA A;  4G7H F;  1HW5 A;  1ZLJ A;  2JWT A;  1R7J A;  3HTU A;  4C3J J;  3H3V K;  2GA1 A;  4LFU A;  3MZ8 A;  2IT0 A;  2ZSH B;  2JRT A;  2LK2 A;  5J1Y A;  3CCS I;  3DPL C;  3LSJ A;  2VE9 A;  2IGM A;  1Q1H A;  2W00 A;  1VQ8 I;  5JLW A;  1WI9 A;  2Q2E A;  2LG4 A;  4CDG A;  4B3A A;  1P7I A;  2ZB9 A;  2VKE A;  2FOW A;  3ABT A;  2ID3 A;  1U2W A;  2EK5 A;  5LHG A;  4ENJ A;  3I71 A;  1D0Z A;  3PO2 J;  5E17 F;  2ZBK A;  1JI8 A;  5CKT A;  3EQL F;  1ZGJ A;  1JTX A;  3CO6 C;  1KQ9 A;  2WB1 N;  2VKV A;  4KNY A;  1ZGA A;  1RPW A;  2ZC2 A;  5J1R A;  2KZG A;  2FNA A;  5IOZ A;  1J0R A;  2DA2 A;  2MLK A;  4OAZ A;  3J7Y J;  1Z77 A;  5FD5 A;  2OTL I;  2M8E A;  2V79 A;  4IZZ A;  3WTS C;  3G6E I;  1Z05 A;  2K85 A;  1LDK B;  3G2B A;  1T38 A;  1K78 A;  1DDN A;  3TP0 A;  4B3X A;  1OFC X;  5CJ9 A;  4KN7 X;  3REO A;  5E1X A;  5LGT A;  5KVR A;  2CQN A;  1IF1 A;  2MGQ A;  3SQN A;  4MEX F;  4W97 A;  3H9J A;  5DD8 A;  1WJD A;  2ZME A;  3WGG A;  2F5V A;  4L9T A;  1IN6 A;  1A04 A;  3COA C;  1YW9 A;  1D1A A;  2QVO A;  2HXO A;  2WY7 Q;  3S32 A;  4ZH4 F;  3N97 A;  1VZ0 A;  2L7Z A;  3R60 A;  2DA3 A;  4ANJ A;  3C2H A;  3F6V A;  4KJZ A;  3A0H C;  5IY5 H;  1UEL B;  4LK1 F;  2JSC A;  1WJ5 A;  3DBH B;  1O7F A;  2BZT A;  2YUS A;  4CCL A;  4MQ9 F;  2R7F A;  3SXY A;  5L3F A;  2ZXW H;  1IC8 A;  3ABU A;  4YFN F;  2IS1 A;  2CMP A;  2YU9 J;  4Y17 A;  1W1W E;  1DP3 A;  1GUU A;  4HW0 A;  2DYR H;  5FGM A;  2K9Q A;  2W84 A;  3JRH A;  2M4G A;  3WE3 A;  4IX7 A;  2M4K A;  2MFZ A;  2NS7 A;  5J3L A;  1RRJ A;  5E79 C;  2XDV A;  1MMD A;  4HAM A;  2MA3 A;  2ZSI B;  2PJP A;  1IV6 A;  1M1E B;  2V7F A;  3CCV I;  1B9N A;  1WJE A;  1CQT A;  3CD6 I;  4NUB A;  1X1C A;  4A3C J;  4ZJZ A;  1JUP A;  5HS9 A;  2KLO A;  3L09 A;  5EYR A;  5F0H A;  1PVE A;  2DK5 A;  1B6A A;  5LRS A;  1YI2 I;  1A35 A;  2H1K A;  2QKL B;  3BP8 A;  2QM3 A;  1KQ0 A;  3FX3 A;  1GVJ A;  2L02 A;  4F55 A;  2XAS A;  3OOU A;  2DFF A;  1OCC H;  3SDB A;  1NG7 A;  3O8H A;  2CV2 A;  5IT9 K;  5KAF C;  1JHF A;  4M71 A;  1X2N A;  4UB8 C;  2KIS A;  3AG3 H;  2F5F A;  3MMY B;  4BAC A;  4KIT B;  5LHH A;  3DU5 A;  2F4I A;  3X2Q H;  2V6C A;  4XKV A;  4PGG A;  2HR3 A;  2HVS A;  1ETX A;  2QSF X;  2VAS A;  1QU3 A;  2VIX A;  2P6S A;  3KP6 A;  3LA2 A;  3OL3 A;  3BQZ A;  3OYG A;  2VN2 A;  3WU2 C;  3CCL I;  4BJT A;  3RZD J;  1UHW A;  2JA7 J;  3E97 A;  1YTY A;  3MKZ A;  1MNM C;  1AHD P;  2QQA A;  4MEY F;  3I53 A;  1K61 A;  4KT5 C;  4CUG A;  2ZXH A;  3GXO A;  2VQC A;  3ASO H;  1QQI A;  5LEK A;  4HX8 A;  3FMS A;  2LDU A;  1ETV A;  2DTR A;  4J00 A;  4LB5 A;  3GME A;  4ENK A;  1DP7 P;  1I1S A;  3ISP A;  2D1V A;  1XDS A;  3GX4 X;  1TWA J;  2GOX B;  3FXJ A;  5DD4 A;  1G2H A;  5E1Z B;  4UHT A;  1K6O A;  2CQX A;  2KIQ A;  4AWX B;  4RB0 A;  2DA4 A;  4I6Z A;  3VYS B;  2QA4 I;  4NC6 A;  2EJR A;  4KA4 A;  1KU2 A;  2V1D A;  2Y9Y A;  4M9X A;  3K70 D;  2PLY A;  2LKX A;  3RIR A;  3K6G A;  4XKW A;  2DA1 A;  4RA2 A;  4OU0 A;  1ETO A;  2P81 A;  2Y0M A;  2YPR A;  5D5W B;  3E5U A;  3H35 A;  4LMY A;  3WOD F;  3BC8 A;  3CLQ A;  5HVQ C;  2COB A;  3LA3 A;  3RKY A;  4EM0 B;  5JHF A;  4XLP F;  1T98 A;  3FXR A;  2EZL A;  4EVI A;  3R0A A;  2FJ1 A;  1TBX A;  2N8G A;  4D5F A;  3GZ5 A;  1U9N A;  3RKX A;  3EUH A;  1EH6 A;  1A5J A;  2XPW A;  1MJB A;  3FXQ A;  1VFC A;  1KGS A;  2L9V A;  2R5Z B;  3QP5 A;  4HQE A;  4WK8 F;  5DYM A;  3U2R A;  3V42 A;  1HKT A;  2R7Z J;  3K4J A;  3B02 A;  1G3T A;  2A07 F;  1S29 A;  1BL0 A;  2X85 A;  2CQ7 A;  2J5O A;  3DTI A;  2CG4 A;  3BR5 A;  1TWH J;  1SD6 A;  1WFX A;  2A5W A;  4LGW A;  2LRD A;  3ZQF A;  2XUB A;  3CC2 I;  2J5P A;  2B0L A;  3CCM I;  3K1P A;  1RNL A;  1XGN A;  4AYB A;  2K9M A;  3DV8 A;  2NNY A;  4M3G A;  3O2P E;  5K7F A;  2BY0 A;  1HKQ A;  2L9S A;  2VBZ A;  2W25 A;  3JRC A;  3U1D A;  2JA5 J;  3VB2 A;  5IYD J;  1IN7 A;  3CDL A;  2FBI A;  2VL8 A;  1UJ8 A;  2VC1 A;  1TNT A;  1WRJ A;  2LY9 A;  3MKW B;  2EZI A;  3WTV C;  5D5X B;  1SEU A;  4CCJ A;  3DTE A;  3A01 B;  2HWV A;  3FXL A;  1CGP A;  2Z16 A;  4RLQ A;  5IP7 J;  2JA2 A;  4HPQ A;  3M8E A;  4OIO F;  3HJE A;  4HF1 A;  4BQA A;  3S1N J;  1RI7 A;  4A5M A;  1R58 A;  1ZHF A;  3HBL A;  1YRN B;  3PM1 A;  1U3E M;  3ZN0 A;  2Y2Z A;  1QGP A;  4DIQ A;  4EEF G;  4FHT A;  1FBQ A;  4F93 B;  1VQP I;  1WWX A;  1P9Q C;  4C30 A;  1ZGW A;  2ACJ A;  3GFI A;  4M6V A;  4BL0 B;  3C2G A;  1JJ6 C;  1SFU A;  1BIA A;  2HXI A;  2VJJ A;  2EIJ H;  3T8R A;  4MQV A;  4ZZL A;  1MW7 A;  3LSP A;  1YLF A;  1TQP A;  3RQ4 A;  3BPX A;  3K4L A;  2KJC A;  1Z6T A;  4XN3 A;  4JP0 A;  5EF6 A;  4U0Y A;  4RMN A;  5EG0 A;  3ZQI A;  2L9N A;  2IA0 A;  2R5Z A;  2HVR A;  4NDL A;  3CDH A;  2ECC A;  2X1E A;  4Z2Y A;  3CDI A;  4EJV A;  1D8J A;  3G1L A;  1UHS A;  1KU7 A;  4I7H A;  4EJW A;  1O3Q A;  5KAI C;  1EH7 A;  2E34 A;  5DCF A;  5D5U B;  3LSR A;  1S8N A;  4HLX A;  1W36 C;  2ZJP F;  1TT0 A;  3H92 A;  1D3Y A;  4HDU A;  2CW8 A;  2FSW A;  3DWL E;  3W2V A;  2K86 A;  2M87 A;  2E5N A;  1XCV A;  4WF2 A;  2R7U A;  3LAP A;  5DV5 A;  1Z1D A;  2CRG A;  3T0Y A;  2DI3 A;  3F8N A;  2H94 A;  2AQF A;  1RR8 C;  3HTS B;  2FNP A;  3D5S C;  1MH4 A;  3HRM A;  4A93 J;  3UNG C;  2W48 A;  1HKS A;  1E3O C;  1N75 A;  3BR1 A;  1Z7U A;  5E3O A;  4A0X A;  3ZXS A;  3F3X A;  4KIG A;  5BPI A;  4J19 A;  3A01 A;  3TED A;  2R7X A;  1ZG3 A;  3NAU A;  2VJ5 A;  4BDY A;  4E7H A;  1FBU A;  2VJI A;  3TO6 A;  1P2F A;  4BHB A;  1FP1 D;  2CSO A;  3FXK A;  3CUQ B;  2G9W A;  4A3K J;  3DPT A;  1QPM A;  3HM5 A;  2NVT J;  2JA8 J;  1YRN A;  1U9O A;  1YG2 A;  5FRM A;  2DO7 A;  4A6D A;  1MKM A;  4N4N B;  1Y0U A;  2QYO A;  1V5E A;  1VQK I;  1UST A;  3CLO A;  1D0X A;  4MNU A;  2HPI A;  3OIP A;  2BOL A;  3IRQ A;  1RKW A;  3HOS A;  1S72 I;  4RDU A;  3CF2 A;  1FTT A;  2CUZ A;  3CF5 F;  4OMZ A;  4ETS A;  5FKM A;  2ZXI A;  1YO5 C;  4DYR A;  2HZD A;  3CMA I;  1FNN A;  2RQQ A;  1XMK A;  2P0W A;  3WU1 B;  3S3M A;  2JSP A;  2LP0 A;  3KP7 A;  2XB0 X;  3MAJ A;  1PYV A;  1LEB A;  1U8B A;  2LY2 A;  1VQ4 I;  4ZYD A;  1MSF C;  2DQR A;  1FSE A;  2Y0S N;  4ZYH A;  1OIS A;  2OZU A;  3BZC A;  3R61 A;  1IN5 A;  4GYI A;  4YIF A;  2WV0 A;  5K1Y A;  2R0Q C;  1W0U A;  2BEO A;  1W7P B;  4F7Z A;  4KIB A;  1GT0 C;  4EAT A;  2ETH A;  4XR6 A;  4KT6 A;  1YX3 A;  3D5L A;  1F4K A;  2GBY A;  5ICC A;  4II3 A;  3SFI A;  3OYN A;  4I2O A;  2IS4 A;  1X2M A;  3M1C A;  2VBW A;  1GVD A;  2KKO A;  5AON A;  4GO1 A;  2XAU A;  2P5K A;  3L2V A;  2O8X A;  4XQF A;  1O4X A;  4CA0 A;  3I4M J;  3PQK A;  1LQ1 A;  3BOQ A;  1BOA A;  4XID A;  1LVA A;  4XRS A;  4L5I A;  2AO9 A;  3NWT A;  1T95 A;  2HTJ A;  5EZG A;  3H3U A;  1MBK A;  2E60 A;  4OIP F;  4XLA A;  1OCZ H;  1KZH A;  3GZ6 A;  2XGX A;  5EJC A;  3J80 Z;  2VPR A;  4BQN A;  1VND A;  4G6D A;  4KIF A;  3W2W A;  1IUY A;  2DTZ A;  2FMY A;  4HYE A;  1T2K A;  3F8F A;  4GXO A;  1LFB A;  1HA8 A;  5FLX Z;  3KIO A;  1J5Y A;  4M3B A;  2M45 A;  4N0B A;  1UCR A;  3WHC A;  4HF2 A;  5ICG A;  4BAY A;  4RGS A;  3V8L A;  5ICE A;  2NVX J;  1VQ7 I;  3L2Q A;  2DDB A;  2R4G A;  3BJO A;  1V3F A;  4PGH A;  1R1T A;  1F1Z A;  4RAG A;  2L54 A;  2K40 A;  3BTJ A;  4DOZ A;  4I0B A;  4CXF A;  5HDN A;  4GYG A;  3OSF A;  2Z33 A;  4ZYA A;  3IAM 2;  4PK4 A;  2JUC A;  1SD4 A;  1XGO A;  2E19 A;  2GOM A;  2EFW A;  1WJA A;  3CJT B;  4BNC A;  2A5Y B;  4HX4 A;  4D7M A;  2PG4 A;  1OYY A;  2KDO A;  3CES A;  1W7P A;  2F4M B;  2QWW A;  1T8I A;  1ZKG A;  1WJF A;  5H20 A;  1ZYR F;  1X19 A;  1WVR A;  3OYM A;  1WJB A;  1JGS A;  4C3H J;  4E7J A;  1KQ8 A;  1EA3 A;  4MLO A;  4Y4R A;  3KLN A;  2JRM A;  4ABZ A;  3RKW A;  3FHN A;  2MC4 A;  2M34 A;  3K1N A;  2BHY A;  3SYT A;  3O8G A;  1JKQ C;  4FAS D;  4B44 A;  2CGP A;  4IVN A;  3OSG A;  3UR3 C;  3LAJ A;  4YEL A;  2M7A A;  3Q0W A;  2DMU A;  4OIR F;  4RGX A;  2XIG A;  3A4C A;  3L00 A;  1JUS A;  2ESN A;  3GTL J;  1RES A;  2OJE D;  5GAE J;  4S05 A;  1OR7 C;  2DFE A;  4AM3 A;  3OYF A;  1TP4 A;  2K27 A;  2X1C A;  3IUO A;  1O57 A;  4BE0 A;  5EGO B;  3GWZ A;  3BTI A;  4XK4 A;  3H5A A;  1H8A C;  1ZR4 A;  1XSX A;  3K9T A;  3I54 A;  3DKW A;  3E7L A;  1I27 A;  3M07 A;  2DFH A;  1ZR2 A;  3FKJ A;  5K5R A;  2OCC H;  3M1E A;  4L9N A;  1MBH A;  3BT9 A;  4HZF A;  3ZRG A;  2JA6 J;  5EZH A;  3T1B A;  3H9G A;  3CCE I;  1IRX A;  3LL7 A;  1IRG A;  4X1E A;  4KYW A;  2NVY J;  3NAR A;  4CH7 A;  1DGW Y;  5K5Q A;  3DEU A;  3TGN A;  2HDC A;  2FD5 A;  1WHU A;  2XRL A;  1JUM A;  3P7N A;  2VKH A;  1IXR C;  2MC3 A;  4OOI A;  3ZQL A;  3LQR A;  1O7L A;  3TP3 A;  2NNN A;  4Y52 J;  4EJU A;  3V7R A;  4FET A;  1IDY A;  2KHM A;  1MNE A;  5KK1 A;  1D1B A;  2RNJ A;  3BR0 A;  3OS2 A;  4PJJ A;  1SAX A;  5GTI C;  2DT6 A;  5CVU A;  2YU3 A;  2AXT C;  1YYV A;  1FY7 A;  1H89 C;  2WB1 A;  3OIO A;  3I55 I;  3JRD A;  2VOO A;  1BC8 C;  3K69 A;  3GTO J;  2NOG A;  3R0J A;  2H8R A;  3HC7 A;  1LDD A;  2JN6 A;  1ONV A;  3ULQ B;  2EWN A;  1FBS A;  4HX7 A;  5K7H A;  1I3A A;  5JVG F;  4C2U A;  2HQA A;  3KYL A;  5GPC A;  3HHH A;  3EET A;  2JMW A;  3V7S A;  4II2 A;  1JTY A;  3M3Y J;  3HDD A;  5E18 F;  1YIO A;  3PUF A;  1JJ8 C;  1R1U A;  2O5R A;  3GFM A;  2CW0 F;  2L01 A;  4IHT A;  1FTZ A;  3HGG A;  2OPT A;  1TLH B;  5CVR A;  4MTD A;  2LYC A;  2R7D A;  4A3G J;  1E3P A;  1NH3 A;  2WWY A;  5EGO A;  5ED4 A;  4EJO A;  3GW2 A;  2EZK A;  3WTX C;  4RAF A;  1WH5 A;  2HOS A;  4QLC U;  1ZRC A;  1GV5 A;  4M3F A;  2XGD A;  5KCM A;  2DOA A;  2MYS A;  5M5W J;  2R7T A;  2TCT A;  3ZGK A;  2KIM A;  3W6J B;  1OYW A;  3IHU A;  4CZZ A;  2WAQ N;  2KQR A;  3H36 A;  1JKR C;  3QRF F;  2W4S A;  3C7J A;  1JXS A;  3NEU A;  2MG4 A;  1DUX C;  5HLG A;  1BM9 A;  1G4D A;  2CV1 A;  4F91 B;  2R7Q A;  2IGN A;  4I02 A;  4RB2 C;  2H09 A;  1R4M B;  3KYD B;  4HQM A;  5CQG A;  4YEJ A;  1YFH A;  2WA0 A;  1EJ9 A;  5C3E J;  3KX2 A;  1R5H A;  3F72 A;  1FYM A;  1D5V A;  3HL2 A;  3TMO A;  2CJJ A;  3FBN B;  2ECB A;  1QZY A;  2XVC A;  3I4P A;  4PJN A;  3J80 K;  1DPR A;  5IP6 A;  4HBL A;  2STW A;  3GFJ A;  2CO5 A;  3MZY A;  3LSM A;  1SAN A;  1HST A;  2XAH A;  4ZYE A;  1P4W A;  4YFX F;  3R4K A;  5FLX K;  3HKZ N;  4OIN F;  3MQ0 A;  3TW7 A;  4A3E J;  5IYB J;  2E1M C;  3A02 A;  3HYI A;  3OYB A;  1E2X A;  1OPC A;  2XAQ A;  1AKH B;  4IHX A;  4E7K A;  2QSH X;  2BBY A;  3KE2 A;  3PFI A;  4Q4Z F;  2FE3 A;  1P92 A;  3ZQG A;  4BEH B;  4C9Y A;  2XSD C;  4GRI A;  2KPM A;  4ENN A;  1FWZ A;  2HEO A;  2RRE A;  5CVJ A;  1G6N A;  3C1D A;  4A6E A;  5HOD A;  4X0G A;  2MH2 A;  1K7A A;  3OMY A;  2HVQ A;  4UUS B;  3B6C A;  3DKY A;  1X4P A;  1EH8 A;  5TGT A;  3A03 A;  4P5O A;  3RQI A;  3G1O A;  1SFK A;  4BJ6 C;  3V8K A;  1HDP A;  3OYH A;  4B8X A;  4BY7 J;  3ZMS A;  4Z6Y A;  3OY9 A;  1NHA A;  1FLI A;  4L0Z B;  1BN5 A;  4HA8 A;  3KZI C;  2W85 A;  3DP7 A;  4FE7 A;  2KP6 A;  2IRF G;  2DQL A;  2HQ5 A;  2EA4 A;  2CH0 A;  5HNH A;  2JK3 A;  3BRO A;  4C2T A;  4RM2 A;  3H0D A;  5CVI A;  4ZC3 A;  2R5Y B;  4RAY A;  4WXD A;  2D1H A;  3HIF A;  3CCY A;  3NWS A;  4IRH A;  4HOB A;  2Y30 A;  3DBR B;  4MFE A;  4U7B A;  2H6C A;  2HYJ A;  2RNG A;  5FLV A;  1J09 A;  2QKM B;  3DF8 A;  3TBI A;  4G6Q A;  2PMZ N;  2Y31 A;  3F0C A;  5HOO A;  5CQE A;  3ZCO A;  4QIW N;  3CCJ I;  4L9J A;  2DA6 A;  1T56 A;  2QSG X;  1E3H A;  3CMM A;  4YFK F;  5A2Q Z;  1R6R A;  3E1S A;  1BI1 A;  3JRE A;  4D0P A;  2O9L A;  2FUG 2;  3RCO A;  4UUV A;  2BVL A;  1BW6 A;  3HZJ A;  1ETW A;  2ZNZ A;  3M8F A;  3J7Z I;  1FOW A;  1YW7 A;  5JHU A;  1XGM A;  3GTQ J;  1AKH A;  1PUE E;  2FBK A;  1ZRF A;  2VB6 A;  5E20 A;  4D5C A;  5D5V B;  3FKI J;  2XC7 A;  1LPQ A;  3VWB A;  3K2A A;  4KIC A;  4BEH A;  1D1C A;  1ZAR A;  1FMV A;  1AA7 A;  4E6K G;  1XGS A;  2QBY A;  3WGH A;  3RTR A;  3VSK A;  2P7V B;  2WV1 A;  4UUS A;  1R5I D;  1X3U A;  4WX9 A;  3KPH A;  4Q48 A;  2P6T A;  3I64 A;  1C0W A;  2L2O A;  3RPU D;  1SC7 A;  4XKC A;  5CLS A;  3PUB A;  2UZK A;  4XOR A;  1NTC A;  3QU3 A;  1OR7 A;  4Y15 A;  1G8X A;  2E1O A;  1SMT A;  3IAS 2;  3D5R C;  1TW3 A;  5F08 A;  3S93 A;  4A3D J;  2LF8 A;  4IKF A;  1USS A;  1XCB A;  3W6K B;  4B1R A;  5ERI A;  1LEA A;  4BHC A;  4NHJ A;  3HSF A;  4YG2 F;  1APL C;  2W82 A;  1I5Z A;  3L2C A;  1VQN I;  1BR1 A;  1MND A;  1S9H A;  1ZTR A;  3AKZ A;  1ZLK A;  2R5Y A;  4HRI A;  4FX4 A;  2NS8 A;  1GLN A;  5EEA A;  3IWF A;  3QYB A;  2IP2 A;  1OCO H;  1VQM I;  2K3F A;  1RR7 A;  2Q0O A;  5J4V A;  2XF5 A;  3ROU A;  2L0K A;  2EIK H;  3ELK A;  5LD2 C;  1ITY A;  4JX6 A;  3CCR I;  1P6R A;  2KZV A;  2E5Z A;  1Y8R B;  4C3I J;  2ZJQ F;  5D6F A;  2V1U A;  3CUO A;  1MJA A;  2EB7 A;  3HPH A;  1MBG A;  3DLA A;  3N05 A;  3LOC A;  1PJR A;  2JPC A;  3RJP A;  1R4N B;  2VLA A;  1WQ2 A;  3IKT A;  3VEP A;  3VYT B;  4A3F J;  3KZY A;  3RYR A;  5FRO A;  3F9K A;  2NVQ J;  3DKX A;  2IA2 A;  4BGD A;  3BQY A;  5EG0 B;  4IPA A;  1JKO C;  4OWR B;  4A0Y A;  2CFO A;  2P8T A;  1IO2 A;  4PSW A;  2NOJ B;  1ETQ A;  3GEZ A;  1H9T A;  3HOU J;  2KFD A;  4CCM A;  2AS5 F;  1MMS A;  1MMA A;  2RC4 A;  2E1M B;  1JT6 A;  3F21 A;  4GCV A;  3OYA A;  3KP2 A;  2A68 F;  3TW6 A;  3CMY A;  1IGN A;  3QAH A;  2F5E A;  3K7A J;  1QHH D;  4M73 A;  1G59 A;  3PJR A;  3QPL A;  4CCO A;  1PUF B;  1X1B A;  2HTS A;  1VQL I;  2ZNY A;  1GXP A;  3CJN A;  3HSR A;  2M0C A;  2CYY A;  2DN0 A;  3GCM A;  1FIA A;  1BI3 A;  3I9V 2;  1SVL A;  2DJN A;  2I10 A;  3B73 A;  5EDN A;  4G7O F;  1DPU A;  3F6O A;  1RUO A;  2O0Y A;  1O3S A;  1R71 A;  4PCQ A;  4IHW A;  2DW4 A;  3CP8 A;  1K4T A;  1FYL A;  1R1V A;  3HOY J;  4A3I J;  4E7S A;  3QU6 A;  2GIV A;  2JJ7 A;  2Z99 A;  2RV8 A;  1BA5 A;  3WG9 A;  5F0F A;  3OIQ A;  2QCO A;  2OC6 A;  4HG2 A;  2OA4 A;  5J4Y A;  3J7A Y;  4R1H A;  4PSX A;  1Z91 A;  2ELK A;  1A6I A;  3K1M A;  3H5N A;  5DM6 F;  2VXZ A;  3VOE A;  2IXS A;  1OQY A;  4N4O B;  1LVK A;  3GTJ J;  3VPR A;  2L4A A;  3PL8 A;  4RB3 C;  1FMW A;  4LLL A;  3SZT A;  2FML A;  5B3S H;  5D4R A;  3A0B C;  5ILV A;  3ZPL A;  3K4N A;  3GO5 A;  4FCY A;  1OCT C;  2LD5 A;  4DYQ A;  4ITV A;  5LHI A;  3WTZ A;  2ZCW A;  3SDG A;  5IOY A;  2IPQ X;  5TRD A;  1ZRD A;  2OQR A;  2OBP A;  3TDZ C;  4XSZ F;  3GLL A;  5E8I A;  5K5O A;  2GZW A;  2BGC A;  3U21 A;  3J81 Z;  2NS0 A;  2JTV A;  3HGY A;  1YQA A;  2KJB A;  4IJA A;  2DOF A;  4FX0 A;  3Q0V A;  1TNS A;  2Y0S A;  1U5T C;  1K79 A;  3DTK A;  2BY1 A;  5F1J A;  1RKT A;  2W24 A;  3EYY A;  4DGW B;  3K4K A;  1IUF A;  1E0E A;  2ZJR F;  1MH3 A;  3CQZ J;  4A3J J;  3MD2 A;  4WCG A;  4XIC A;  4EM2 A;  1PUF A;  3MVP A;  1TC3 C;  4KUM A;  1ETY A;  4CHU A;  4I98 B;  2R93 J;  5E3N A;  5C44 J;  1B59 A;  2XGC A;  4M6Y A;  1SFX A;  3SZP A;  3D1N I;  1FYK A;  3GTG J;  3E6C C;  2F2E A;  1B4A A;  2X51 A;  5FFX A;  2A6T A;  3DXJ F;  3JTG A;  1RUN A;  5EEG A;  1K6Y A;  3FIS A;  2DPD A;  3BJ6 A;  3EPZ A;  2PBI A;  1B72 B;  4IL6 C;  1RET A;  4BUP A;  3K4M A;  2X6O A;  1Y56 A;  2XRN A;  3ZP5 A;  3AG4 H;  3LNQ A;  4M3D A;  3S1M J;  2DT7 B;  4XLE A;  5B1A H;  2LVS A;  1Y8Q B;  3L9F A;  5CYV A;  2E1C A;  2DXI A;  3MFK A;  5BNG A;  4ZTJ A;  2K7L A;  4L5J A;  3NQO A;  4HEA 2;  2HQR A;  3BWG A;  1ON2 A;  3RKQ A;  5FKL A;  1Y1V J;  5H6Q A;  3QOE A;  3JRF A;  4O6J A;  1GHC A;  4A0Z A;  4CIC A;  2M1B A;  3LSH A;  4XL9 A;  1HLV A;  3CC4 I;  3GLX A;  2EA2 A;  2DU9 A;  3QPH A;  4HNT A;  2GXB A;  2NYX A;  2E2J J;  3T8T A;  4M3E A;  3S2D J;  2R7W A;  2JT1 A;  2M9H A;  1X4O A;  4M72 A;  2BXZ A;  2F6C A;  2Y48 A;  3I3L A;  3L2R A;  1VF9 A;  4GFB A;  4BBS J;  3VSL A;  2ADU A;  2CUF A;  2OUM A;  4LJZ F;  1YS7 A;  3P9C A;  4O5V A;  4AU7 A;  3C2B A;  2QLZ A;  4ESJ A;  3I59 B;  1E17 A;  1KU3 A;  1TQM A;  2PX9 A;  2STT A;  3E5X A;  3L7W A;  1GXQ A;  1XPX A;  3ZMV A;  1YE9 A;  1D0Y A;  2KRF A;  4ESF A;  1T33 A;  4RS8 A;  1ON1 A;  5L3E A;  5DUI A;  1QZZ A;  1HOM A;  5L3D A;  1J59 A;  5H6R A;  2WY8 Q;  2BY3 A;  1H0M A;  2FRH A;  1J9I A;  3FBI B;  2BV6 A;  5B1B H;  4XLC A;  4XOP A;  2DMN A;  1P7J A;  1POG A;  4B48 A;  2IGK A;  3ML6 A;  4NC8 A;  4PDK A;  2XKP A;  3BLY A;  2LLK A;  3WG7 H;  4CYC A;  3PIP F;  2GIZ A;  2DMT A;  2RGV A;  4BU2 A;  2K3P A;  1F5T A;  1IN8 A;  5HS8 A;  1TZL A;  3QPS A;  1FOY A;  4I99 C;  4AID A;  2K5C A;  1B72 A;  4U7D A;  1SAU A;  4LD5 A;  1D5Y A;  3RYP A;  2E36 A;  5JI6 A;  5KNL A;  1S5L C;  4UB6 C;  1AWC A;  3RDI A;  5LGN A;  3W6V A;  1FPQ A;  3BR3 A;  2CFX A;  3DBL B;  2XPV A;  3WHB A;  3GTK J;  1X3Z B;  3GTM J;  1MZB A;  5GPA A;  2VJ4 A;  2V9V A;  5BQT A;  4B43 A;  2KRH A;  5L3C A;  4JX5 A;  4CGZ A;  1WGX A;  4DQ2 A;  2F5C A;  2HDD A;  1XN7 A;  2TDX A;  1JHH A;  2E35 A;  3ERM A;  3IP4 B;  2DA7 A;  3LFU A;  4P55 A;  2XGE A;  2LY1 A;  3BR2 A;  5GAH J;  5FB2 A;  3RZO J;  2KIU A;  2XAJ A;  2NXN B;  3GVA A;  1YX5 A;  2QEN A;  2E2I J;  2EZH A;  3S15 J;  1V5G A;  3Q9V A;  4MFD A;  3F22 A;  1ZG5 A;  2CW7 A;  3HHG A;  4IO9 F;  3MKL A;  3OYD A;  1ZQ3 P;  2CS3 A;  2HZT A;  3I59 A;  1U8R A;  2X6X A;  3PNY A;  4XON A;  4IF4 A;  4A69 C;  4IHS A;  2CQK A;  3OS1 A;  3K10 A;  3GTP J;  4PUS A;  2VQH A;  2XAG A;  3LSI A;  4N9I A;  3SFZ A;  2LC2 A;  4V2F A;  3ZQQ A;  5ILU A;  1BR4 A;  1ZH5 A;  4I09 A;  3U9G A;  2K9L A;  3OYE A;  3S14 J;  2EV0 A;  4E7Z A;  4GDF A;  3IKV A;  1JKP C;  4JOM A;  3BG6 A;  5JR3 A;  1U5T B;  2XV4 S;  5C4X J;  3CO7 C;  2DJI A;  2IS6 A;  4LG3 A;  1ZK8 A;  1UFM A;  3QP6 A;  2CWE A;  4FQG A;  4O3M A;  2HYF A;  3BDD A;  2PEX A;  1G3W A;  2IW5 A;  4LOC A;  3VYU B;  1WPK A;  2P5V A;  1ZRE A;  2M2E A;  4HSR A;  1HW2 A;  1B8I B;  3J81 K;  1B1B A;  3TKY A;  5C4J J;  1CF7 B;  1EV7 A;  4KMU X;  4NNJ A;  4MIM A;  5E3L A;  2L4M A;  5FLM J;  2FEZ A;  2EV6 A;  1SD5 A;  1TT5 B;  5DS9 A;  2Q8K A;  1MD0 A;  3PNT A;  3HSE A;  2M8G X;  4J01 A;  4DZJ A;  1LE8 B;  3JSP A;  1R36 A;  4BDZ A;  1N77 A;  1K4S A;  4M74 A;  5H2F C;  1WJC A;  4E7I A;  2VPL A;  1HSJ A;  4UY8 I;  4RGU A;  3IRR A;  4V2G A;  2L9R A;  4GGG A;  4XLN F;  3Q3S A;  3PIO F;  5D6E A;  3I4N J;  5BS6 A;  3GF2 A;  2E2H J;  2D45 A;  1WSU A;  1LUJ B;  2LF7 A;  4QPO A;  3DEE A;  2HGC A;  4AVZ A;  4XRS G;  2R7V A;  3AL0 C;  4XOT A;  2Y75 A;  2FBH A;  2K4J A;  5LGU A;  1TQI A;  4E4H A;  3I58 A;  1KA8 A;  3MEX A;  1I6X A;  1Y0N A;  1XSV A;  2H6B A;  3P9I A;  5JLX A;  3IL2 A;  2FF4 A;  4G94 A;  3HOT A;  4BXX J;  1J7K A;  2KMU A;  2EV5 A;  3TO9 A;  4PJM A;  2F48 A;  3G73 A;  1TWG J;  5FO5 A;  3HOW J;  1FP2 A;  1LFP A;  1R22 A;  2Z1D A;  5F0C A;  5F64 A;  4BE2 A;  2GQQ A;  4HV6 A;  4NBQ A;  4PZJ A;  3MZH A;  2FU4 A;  3HKZ A;  3BG9 A;  3LFK A;  4TV7 A;  3G4S I;  4Y13 A;  1U5T A;  3FZV A;  1Z7L A;  4WXH A;  1JE8 A;  5ICF A;  4E7L A;  2MD5 A;  4AIK A;  4P1W A;  2XAF A;  1QO0 D;  3FHZ A;  4ZYG A;  2HOT A;  1XG1 A;  1X1A A;  1YW8 A;  2O3F A;  4KFC A;  1YS6 A;  4Y3O A;  2WTE A;  1K83 J;  2EBI A;  1B8I A;  5DEQ A;  1CF7 A;  2DCE A;  1P4A A;  4DJA A;  4D7N A;  3S3O A;  4IQJ A;  2IA1 A;  1Q1V A;  1R23 A;  2KL4 A;  2PQ8 A;  5DTD A;  1HDD C;  2YX4 A;  3LWF A;  4A3M J;  3E0J B;  4CSW A;  2LFB A;  2G0E A;  3BTC A;  3EYI A;  3KP5 A;  3QQA A;  2QQ8 A;  3I0T A;  4I01 A;  4C2M J;  2CUE A;  1LDJ A;  5LRR A;  3SEQ A;  3PO3 J;  4UNO A;  4MHG A;  2IAI A;  5M5Y J;  1YIT I;  1LE8 A;  1BBY A;  5ILS A;  4OIQ F;  3KFW X;  1TWF J;  1ERD A;  3IC7 A;  1IAW A;  2UUZ A;  4LIV A;  3BPV A;  1Z6R A;  2QZ8 A;  4PJ0 C;  4BXU A;  2K02 A;  2JPB A;  4LLG F;  1H88 C;  3HPG A;  4KIS A;  2P7C B;  3HRT A;  2OF7 A;  1QVU A;  4M6X A;  4A3B J;  3HXL A;  5J40 A;  5E8G A;  4G8X A;  2FQ4 A;  2Y69 H;  4IRG A;  2DOE A;  5FRN A;  2BE5 F;  5HDG A;  3LMM A;  5DDG A;  3BTL A;  2PMZ A;  3QWL A;  1U78 A;  6PAX A;  1QHG A;  1AU7 A;  3C18 A;  2MW8 A;  3HB9 A;  1A6Q A;  3K4B A;  4BQQ A;  1ZG1 A;  1XMX A;  3H5R A;  1DQU A;  3CC7 I;  3A1Y A;  4HDV A;  2DPU A;  3S1Q J;  4QSH A;  1Z21 A;  3FWE A;  5L3B A;  1MDM B;  1LJ9 A;  4D9J A;  2XRO A;  1I50 J;  1VQO I;  3VFZ A;  2OV7 A;  2K9N A;  2AQE A;  2DDA A;  1IDZ A; 
#chains in the Genus database with same CATH homology
 2Q1Z B;  1UG0 A;  3HPH A;  3DLA A;  3N05 A;  3DPT A;  4JQF A;  2WAE A;  1PJR A;  2VLA A;  3VYT B;  5FRM A;  3OYK A;  3L2U A;  5FRO A;  3F9K A;  3ONQ A;  4N4N B;  3DKX A;  2UV1 A;  1Z3Y A;  4BGD A;  1V5E A;  1D0X A;  4OWR B;  2CFO A;  2HPI A;  2X1D A;  4PSW A;  3OIP A;  2BOL A;  2NOJ B;  4PFP A;  4QPQ A;  3HOS A;  2WAQ A;  1Y6I A;  3CF2 A;  1V5F A;  2CUZ A;  4CCM A;  3M8J A;  1MMA A;  3VYR B;  2E1M B;  2ZXI A;  3OYA A;  2HZD A;  2RQQ A;  3LSG A;  2P0W A;  2VQG A;  3S3M A;  2JSP A;  2LH9 A;  1Z3X A;  3OWT A;  4DBR A;  1BOB A;  1PYV A;  1QHH D;  3CZ6 A;  1G59 A;  3PJR A;  2LY2 A;  4CCO A;  2W7N A;  1X1B A;  2XF7 A;  2HNH A;  3ZR8 X;  2IS2 A;  3K70 C;  2JUG A;  2L7K A;  3I9V 2;  1KON A;  4XM3 A;  4EAT A;  4XR6 A;  3QYF A;  4KT6 A;  3VDX A;  1YX3 A;  2JVG A;  3D5L A;  2I8D A;  4II3 A;  3OYN A;  2IS4 A;  2Q2E B;  3M1C A;  3CP8 A;  2LRE A;  2V6E A;  1BR2 A;  4E7S A;  3AL0 B;  3A2K A;  2WBM A;  3OS0 A;  3OIQ A;  2XAU A;  2OC6 A;  4HG2 A;  4DBQ A;  3L2V A;  4XQF A;  3J7A Y;  4PSX A;  3EUH C;  3HUG B;  4CA0 A;  3H5N A;  2VXZ A;  2IXS A;  4N4O B;  2ZFU A;  1LVK A;  2R7S A;  2M7B A;  4BQO A;  2V26 A;  3NWT A;  3PL8 A;  4D1Q A;  1T95 A;  1FMW A;  4F92 B;  2HDW A;  4BXF A;  2E60 A;  4XNF A;  3K4N A;  4XLA A;  3S8P A;  4XMY A;  1MMN A;  4BQN A;  4ITV A;  2V4J C;  3W2W A;  1N78 A;  4HNU A;  1HA8 A;  4LIT A;  3OYJ A;  3U21 A;  3RSN A;  2Y0S A;  2CUJ A;  3DTK A;  5LFA A;  3S3N A;  4Y33 A;  3L2Q A;  2R4G A;  4DGW B;  3W3C A;  3K4K A;  4OAY A;  1E0E A;  2VKD A;  3AFH A;  4DOZ A;  3MD2 A;  3CJQ B;  1MMG A;  2JVH A;  2X6Y A;  4ZYA A;  3IAM 2;  4PK4 A;  5HNF A;  3EUK L;  3BCA A;  2GOM A;  1WJA A;  2KDO A;  3CES A;  2ZSH B;  3DPU A;  3OR2 C;  2R7O A;  1WJF A;  3DPL C;  1X19 A;  2X51 A;  2IGM A;  2XSJ C;  2W00 A;  2A6T A;  3OYM A;  1WJB A;  4E7J A;  1K6Y A;  1DGR M;  1EA3 A;  4MLO A;  4Y4R A;  3EPZ A;  2LG4 A;  3FHN A;  2MC4 A;  3SYT A;  1D0Z A;  3K4M A;  3QYE A;  4BUP A;  4B44 A;  4FAS D;  1Y56 A;  2W1O A;  1JI8 A;  3PSI A;  4RM3 A;  2DT7 B;  5CKT A;  4XLE A;  3UR3 C;  2R7R A;  4YEL A;  2M7A A;  2DXI A;  4ZTJ A;  4HEA 2;  4OAZ A;  3A4C A;  4CCN A;  3QOE A;  4IZZ A;  3OYI A;  1OR7 C;  3OYF A;  3G2B A;  1LDK B;  3LSH A;  4XL9 A;  2X1C A;  3IUO A;  4B3X A;  4HNT A;  2M3A A;  3H9Q A;  4BE0 A;  2VQL A;  3H5A A;  5KHD A;  2R7W A;  1T0F C;  1X4O A;  3FKJ A;  2F6C A;  3I3L A;  3L2R A;  3H9J A;  4F52 A;  3VSL A;  1WJD A;  2BVM A;  2MD0 A;  2F5V A;  4BS9 A;  2OUM A;  3ZRG A;  1D1A A;  4CZC A;  3H9G A;  2WY7 Q;  1IRX A;  3S32 A;  4AU7 A;  1VZ0 A;  3LL7 A;  4PJL A;  4ANJ A;  3C2H A;  4KJZ A;  4CH7 A;  1DGW Y;  3MKY B;  1YE9 A;  1D0Y A;  1UEL B;  1WJ5 A;  2WAD A;  4H4K C;  2VKH A;  2PJR B;  4CCL A;  2WY8 Q;  3FBI B;  2IS1 A;  2CMP A;  4XLC A;  4FET A;  2KHM A;  4XOP A;  1MNE A;  3PNV A;  4B48 A;  2IGK A;  1DP3 A;  4NC8 A;  1D1B A;  4IX7 A;  2M4G A;  3BLY A;  3OS2 A;  4PJJ A;  2DT6 A;  2M4K A;  2MFZ A;  3L2W A;  4BU2 A;  2XDV A;  1MMD A;  2K3P A;  2KRC A;  2WB1 A;  2ZSI B;  1TZL A;  2V7F A;  1WJE A;  3HC7 A;  2K5C A;  1X1C A;  4NUB A;  4IQ4 A;  4ZJZ A;  1SAU A;  2KLO A;  2UWM A;  2XF6 A;  4NC7 A;  2QKL B;  5KNL A;  4C2U A;  2HQA A;  3KYL A;  4II2 A;  2VJ4 A;  4F55 A;  3EUA A;  3OOU A;  4B43 A;  2KRH A;  2O5R A;  3SDB A;  1NG7 A;  3OR1 C;  2CV2 A;  2LBF B;  1NG6 A;  2LYC A;  3IP4 B;  2Z2S B;  3LFU A;  2LY1 A;  3MMY B;  4BAC A;  4KIT B;  3DU5 A;  2F4I A;  4XKV A;  4ZDL A;  4ZDO A;  2HVS A;  1YX5 A;  1V5G A;  4NQW B;  2VAS A;  1QU3 A;  2VIX A;  5KCM A;  2DOA A;  2MYS A;  3HG9 A;  2CW7 A;  3OL3 A;  3OYG A;  3OYD A;  3ZGK A;  2CS3 A;  2X6W A;  2BW3 B;  1ZEL A;  4B47 A;  4BJT A;  2R7T A;  3CP2 A;  2KQR A;  2X6X A;  3PNY A;  4XON A;  4RLF A;  3MKZ A;  2W4S A;  4XLF A;  3K10 A;  3OS1 A;  4PUS A;  2VQH A;  2CV1 A;  3LSI A;  2R7Q A;  4CUG A;  2IGN A;  2ZXH A;  2LC2 A;  2VQC A;  4F91 B;  3ZQQ A;  4YEJ A;  5CQG A;  1BR4 A;  2PJR A;  2WA0 A;  2K9L A;  4J00 A;  3SZG A;  3OYE A;  4E7Z A;  3KX2 A;  3CJR B;  3HL2 A;  4JOM A;  3BG6 A;  3TMO A;  3FBN B;  2WAF A;  2GOX B;  4PJN A;  2DJI A;  2HU9 A;  2IS6 A;  4LG3 A;  3LSM A;  4CCK A;  4BE1 A;  3VYU B;  3VYS B;  4HSR A;  2E1M C;  1UAA A;  3K70 D;  3OYB A;  2L5Q A;  4NNJ A;  3K6G A;  4XKW A;  4E7K A;  4ZDP A;  2V1N A;  3H35 A;  4BEH B;  4C9Y A;  2CV0 A;  4GRI A;  2KPM A;  3BC8 A;  3PNT A;  5HVQ C;  4J01 A;  3OL4 A;  5JHF A;  2RRE A;  4X0G A;  2LBF A;  2MAB A;  3OMY A;  2HVQ A;  4BDZ A;  1N77 A;  1WJC A;  4E7I A;  2VXD A;  2VPL A;  3DKY A;  1X4P A;  5TGT A;  4ZTF A;  4P5O A;  1SFK A;  4LIU A;  4BJ6 C;  3PSF A;  4QPO A;  4YRV A;  3DEE A;  4AVZ A;  4G6T B;  3V42 A;  5CPR B;  3OYH A;  4XOT A;  2HPM A;  3AL0 C;  2R7V A;  3K4J A;  1X1D A;  4R79 A;  3OY9 A;  3BCB A;  4E4H A;  2X85 A;  3DTI A;  2BW3 A;  2KP6 A;  1WFX A;  2A5W A;  4XN0 A;  2LRD A;  2CH0 A;  3HOT A;  5HNH A;  2KMU A;  4PJM A;  3OYC A;  4C2T A;  4AYB A;  2K9M A;  4RM2 A;  3H0D A;  4ZC3 A;  1LFP A;  2L9S A;  3GBG A;  2Z1D A;  4BE2 A;  3NWS A;  2VL8 A;  4U7B A;  2RNG A;  3HKZ A;  1J09 A;  2QKM B;  3DU6 A;  3BG7 A;  3MKW B;  3TBI A;  3KEY A;  1Z7L A;  5HOO A;  5CQE A;  3ZCO A;  4CCJ A;  3DTE A;  2IGO A;  4E7L A;  3TL4 X;  2Z16 A;  4XKB A;  4RLQ A;  2JA2 A;  4HPQ A;  3CMM A;  3K4C A;  4P1W A;  1W36 D;  1R6R A;  3E1S A;  4U87 A;  2FUG 2;  1X1A A;  3RCO A;  2BVL A;  4Y3O A;  4DIQ A;  2DCE A;  4DJA A;  3S3O A;  4IQJ A;  4F93 B;  4HST A;  1P9Q C;  3PFY A;  2KL4 A;  4C30 A;  2VB6 A;  4BL0 B;  3C2G A;  4BJ5 C;  3E0J B;  4CSW A;  2VJJ A;  2XC7 A;  1OLT A;  3VWB A;  2ELJ A;  4BEH A;  1D1C A;  1MW7 A;  1FMV A;  3SEQ A;  1AA7 A;  3RQ4 A;  4E6K G;  3K4L A;  3RTR A;  3VSK A;  4XN3 A;  4F3Q A;  2LOO A;  5HLT A;  4RMN A;  1ERD A;  2UUZ A;  4LIV A;  2L9N A;  2L2O A;  3RPU D;  4XKC A;  2HVR A;  3PUB A;  3HPG A;  2X1E A;  4KIS A;  4XOR A;  3W2A A;  1G8X A;  1U0J A;  3D5R C;  3IAS 2;  3S93 A;  3HXL A;  4IKF A;  4PFO A;  3OYL A;  3FDY A;  1W36 C;  5FRN A;  1TT0 A;  2CW8 A;  2M0M A;  3DWL E;  2V9K A;  3LMM A;  3W2V A;  2W82 A;  2E5N A;  2PMZ A;  2R7U A;  1BR1 A;  1MND A;  1S9H A;  3AKZ A;  2AQF A;  4HRI A;  1QHG A;  3D5S C;  4XLH A;  1GLN A;  3K4B A;  4BQQ A;  1LKX A;  3QYB A;  3H5R A;  1DQU A;  3UNG C;  3A1Y A;  3QOD A;  2XF5 A;  1N75 A;  5LD2 C;  1Z21 A;  4D9J A;  3ZXS A;  3LSK A;  2R7X A;  2OV7 A;  2KZV A;  2E5Z A;  2VJ5 A;  3SEZ A;  4BDY A;  4E7H A;  2AQE A;  2VJI A;  3DQV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...