1WJEA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
total genus 12
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjeA00
1LFPA 1WJDA 1WJBA 1K6YA 4F3QA 1E0EA 1WJAA 1WJFA 1MW7A 3HPGA 1WJCA 1KONA 3F9KA 3HPHA 1WJEA
chains in the Genus database with same CATH superfamily
3OS0A 2A6TA 2ZXIA 2E1MB 2I10A 2ELJA 1QVTA 3ABLH 6PAXA 2CUZA 2DTRA 2ZFWA 1H9TA 3M9AA 5BPDA 1P4WA 2MG4A 4ZYAA 3NQOA 4AWXB 3H35A 2GWRA 2GXBA 5B3SH 4I98B 1MIJA 1R5ID 3HRUA 4XM3A 4BH9A 1BC7C 4E7ZA 4ENNA 1FWZA 3S8PA 1ETVA 1K83J 2KIFA 3O6BB 1LEBA 4JP0A 4JBAA 4XSZF 1SFKA 1MDMA 1WJDA 2FMLA 1LUJB 2CW7A 2K3PA 1W0TA 2CQ7A 3P9IA 1FSEA 4LLLA 3ZOBA 2BE5F 2EIJH 1FNNA 3HHGA 1O3RA 2K85A 2DYSH 2E5ZA 1JGGA 2ZSHB 3HOZJ 3JREA 4UB8C 1MJAA 4CCOA 3N05A 1NK3P 2DT5A 2HDCA 2HOTA 5F0FA 1UMQA 2DU9A 1XSXA 2ZMEB 4A2UA 3IH2A 2H6CA 1W7PA 4M73A 2M8GX 1B4AA 3O8HA 2COBA 2L7MP 4KIBA 1APLC 3HSEA 2QKLB 2L54A 1BN5A 2QQ9A 2DA3A 1YW7A 2YUSA 3KP5A 1SD7A 1UCRA 4G12A 3PQJA 3FXLA 4XLNF 1BJZA 4UB6C 5ICEA 3DLLF 4PFPA 1QPMA 3CDLA 5FJ8J 2JRMA 4M3FA 4UNOA 2MD5A 4XLPF 3BLYA 1R9TJ 5M3MJ 3ASOH 4XKCA 3CCVI 4UY8I 2R5YB 2YR2A 4A3CJ 3RIRA 3L2UA 2ID3A 4J00A 1IAWA 3G1LA 1GXQA 3NWTA 4MEYF 1R49A 4RGSA 1BI0A 3BZ6A 1IO2A 2LD5A 1BM9A 4I0BA 1BI1A 3NEUA 3TGNA 2OTLI 3K2ZA 2LMDA 3OYFA 4AVPA 1J75A 1XMXA 3L00A 2LKSA 4DBQA 4M3DA 1Y8RB 3FIWA 1S72I 2ISYA 3OIOA 4KMFA 3HKZN 1WSUA 4L9VA 2RN7A 2IA1A 4O6JA 2F5CA 4HV6A 1KQ0A 3CC2I 4CXFA 1VTNC 3A03A 3SXYA 1YG2A 3ESWB 3GYHX 2LC2A 4RAGA 2M3AA 3JRIA 1GXPA 2E1CA 3OYDA 2RNGA 1KU3A 3HUGB 4MQ9F 1UZCA 4BY1J 3E6CC 1W5CC 1F43A 2VC0A 4AVZA 1JJ8C 1LVAA 3GBGA 4XKVA 4BU2A 4FX0A 1FMWA 1NHAA 3ONQA 4CDGA 4IX7A 2JN6A 5J8FA 3ZQHA 3LSMA 2XVCA 4KIGA 1O4XA 4C2MJ 4XONA 2VPLA 4YFKF 1NTCA 2Y69H 4QTRA 1WH7A 2LK2A 3FXKA 3QP5A 1FTTA 2O8KA 2CQNA 2HZDA 2KFDA 2HVRA 2E71A 2QYOA 1GV5A 4XRMA 3KPHA 2BW3A 2WAFA 3K9TA 3WU0A 1QBJA 3UKGA 5GTHC 3D0SA 3OMYA 1WVRA 2NVUB 3S2HJ 4NQWA 4BQNA 2UXNA 2L9SA 1WFXA 3FKIJ 1Z67A 1XSDA 2OA4A 2HPMA 2XUBA 1RIOH 4MFEA 2VN2A 2EB7A 2FNAA 2X51A 2EFQA 4AD9A 1T38A 2VQCA 3ZP5A 2LBFA 1F4KA 1G8XA 2E60A 3FISA 1OCZH 5IT3A 4FTHA 1YX5A 4P5OA 3WTXC 3S93A 2RREA 5H20A 3MQ0A 3KP2A 3ZQCA 5E1ZB 3JAMZ 3OV8A 2JA8J 2ME0A 5HLIA 5F04A 4EATA 3J80K 2V6CA 4NDLA 3SZGA 2R7FA 3VYUB 3RZOJ 2X6WA 3CDIA 2E1NA 3IP4B 1ZLJA 5JFRA 2IA2A 2DA2A 2DMUA 1SD4A 2DT7B 2RKHA 1ZGWA 4OIQF 2R0QC 3WG7H 4QWQA 3W6VA 1XGMA 2OC6A 3BDDA 1Y0NA 5FLXK 2MD0A 5M5YJ 2DMTA 1MMGA 1RKTA 4PUSA 1SD6A 3HTUA 2DXIA 1WQ2A 1ZRCA 2W82A 4DNCA 1H0MA 3K7AJ 2BY0A 2DYRH 4A69C 3CC7I 2W24A 1D5VA 5EZGA 3L1PA 2UXXA 3ZMSA 4F93B 2A07F 1PYVA 1SVMA 3CJQB 3ZRGA 1GVJA 5DCFA 2PMHA 1A5JA 1ORKA 3OYCA 2LG4A 1USTA 2FEZA 1BC8C 4V19K 3K4LA 4HG2A 1X1AA 2K3FA 3BTLA 2O7OA 4V2FA 4XLFA 1OCCH 2MA3A 1S7AA 1XDUA 2K4JA 3OOPA 2VASA 3QYEA 4II3A 1T8IA 4G7ZF 5J8CA 4IKFA 3J81K 3HUGA 4Q48A 1HQCA 3W2AA 1I5ZA 5DTDA 1MH4A 1J09A 4KMUX 4PJMA 4MEXF 4MNUA 2P0WA 3MKLA 1XMKA 1E17A 3P9KA 2JPCA 5HDGA 2CYYA 1FY7A 3TP3A 4R79A 1STZA 2UWMA 1IGNA 3N4MA 2MW8A 2NVXJ 1ZGAA 2DMNA 1FIAA 1Q1VA 5FLVA 3L2CA 2V9VA 1Z7UA 2FSWA 1SFEA 2G7HA 3F8NA 1TP4A 3SYTA 5D5VB 4IHYA 2XAFA 1A6IA 2KIQA 3GVAA 4QPQA 1FLIA 5LBQA 3V4GA 3A2KA 2XDVA 3CO7C 1KYWA 5L3FA 5B5EC 1O7FA 4FISA 5GTIC 4QLCU 3PIOF 2I8DA 3IV5A 2IRFG 2IGKA 2VKHA 3R0AA 2YPRA 2GOXB 2PX9A 5CVJA 1IN5A 3KP6A 2Y0SN 4B44A 2M5WA 3OYGA 1P4AA 1R58A 4FT8A 4KICA 3D5RC 4XSXF 5DYMA 2CJJA 1XC5A 3TDUC 4C2UA 5L3DA 3JTGA 1DP7P 4W97A 2EH3A 4I0AA 2R93J 2DMQA 2G7UA 3DEWA 3J81Z 3NRVA 2W4SA 3FZVA 5FKLA 2PMZA 4FETA 3LFKA 2H8RA 1RUOA 3SZTA 1AA7A 2R7XA 1IRZA 1RR8C 2IEKA 1GUUA 2GAUA 4G7HF 2P81A 4A6DA 3HJEA 1U9OA 2UUZA 1JI8A 1WJCA 3OYAA 1YQAA 2HQNA 2DLLA 4RGXA 3SFIA 1ZHFA 1R6RA 4XLEA 2CUJA 1MBFA 1ZN2A 5IOYA 4A3DJ 2EZIA 2H6BA 2K9NA 3R6SA 2BY3A 2IGOA 2GXAA 4RAZA 1HW1A 5IYBJ 1VQ7I 4ZYHA 3QOPA 3P5JA 4KYWA 3WHBA 2M87A 1LFBA 4Y33A 5TRDA 3VODA 3TW7A 5HS8A 2N8GA 1QHHD 1G6NA 4UUVA 3ZCOA 3H9GA 4XLCA 1WHUA 3K4BA 4A93J 2VQGA 1ON2A 3DBRB 5FKKA 4PK4A 4JX6A 2E19A 4Z2YA 4XICA 4U7BA 5DCMA 3HRTA 3C3WA 5EZHA 2KMUA 1FOXA 2WAEA 5KHDA 1VQOI 1RKWA 4RA2A 2PG4A 3CTAA 4A3LJ 5FGMA 1D0XA 4A3KJ 4G6TB 5KVRA 1JKPC 2PN6A 3OYJA 4O3MA 4BS9A 2LFBA 5D5UB 4IQJA 2EV6A 3BR6A 1IDYA 2RC4A 2ZFUA 2LBFB 1D0ZA 2X0LA 2CFXA 4XLAA 5CYVA 3I56I 1F36A 4RB0A 1NG6A 3HHHA 3R61A 4LITA 1T6SA 2EFWA 3F3XA 2J5PA 2XB0X 3FXUA 5ILVA 4RDUA 4ZDPA 1HDDC 1DU0A 2JA5J 3B6CA 1K6YA 2UZKA 2P5KA 2CQXA 2VQHA 2PI0A 5DM6F 1HF0A 3DPUA 1YJWI 4PFOA 1ODDA 3E6DA 1GT0C 2DO7A 2F4MB 2VBZA 4U87A 4EM0B 3QODA 1MSEC 3I71A 3E5UA 3IH4A 1R1VA 1ETKA 1JUSA 3IAM2 2PEXA 2MC4A 4ZZDA 3P7NA 2CFOA 1ERDA 1OR7A 4UVCA 2NS7A 4N9HA 5B1BH 4PSXA 5HDNA 5IYCJ 1I6HJ 2M8EA 3GTQJ 2IS1A 4E70A 2IGNA 1OLTA 2A69F 1W5SA 3HEFA 4HZFA 4XBFA 1FOYA 5LEJA 1JUPA 1Y0UA 3HC7A 4EJOA 4CZZA 1YW8A 1ITYA 1BOAA 4N9IA 3VYSB 3E0JB 3GW2A 3MKWB 1FOWA 3PFYA 4MFDA 1D3YA 4L0YB 2FBKA 2W84A 1MNDA 2WB1A 3A0HC 2L4MA 2QWWA 4I01A 2TDXA 4QSHA 4U0YA 1IXSB 1HSJA 3ASNH 2HEOA 4BGDA 1LJ9A 3EYYA 3Q3SA 1UELB 1VQ4I 3M07A 3LNQA 2X6YA 3EYIA 3HOTA 5DD8A 4YELA 2H1KA 4HAMA 4YFNF 2WB1N 2L4AA 3OOUA 2DA7A 4CO8A 3FBIB 4I6ZA 3L2RA 3H3VK 4IHSA 2LREA 4IXAA 3BG6A 5E18F 4MGRA 3KE2A 1TWGJ 4UXNA 2MBFA 4LG0A 3JSOA 2V9PA 4HW0A 1MMSA 3ERED 2EV0A 2QQBA 2EFOA 2XKOA 1E2XA 2NNNA 2NVYJ 3QU3A 1EKEA 3H9JA 2GBYA 2MSYA 1SD5A 2A5YB 3QYBA 2ZB9A 3M8JA 3QYFA 2KISA 3E3VA 4JK1X 5E79C 3MKYB 1HDPA 5M5WJ 5K5RA 4CGZA 1IRGA 3H3ZA 1HC8A 3AFHA 3I53A 3K4JA 1MMNA 2FBHA 2GQQA 2DDBA 2XASA 4K2EA 4NC7A 4P55A 4HF0A 2ZNZA 2L7ZA 2VBXA 2HYGD 4M6XA 4XKWA 1QQIA 4HDVA 2X4HA 4HX7A 3OYLA 2QSHX 4LGWA 5IYDJ 2RV8A 4P96A 2IVMA 1IRXA 4ANJA 2Z3YA 4EJVA 3AG2H 3W2WA 3HBLA 1RR7A 3BR5A 5D4SA 1KGSA 2CSOA 2JA6J 2PBIA 3RKYA 2IGMA 3S3OA 4N4OB 1MBJA 2IT0A 3DLAA 4P1WA 5IT9Z 2EZLA 5C3EJ 2DK8A 2Z99A 1YO5C 2AO9A 1QNTA 2CW8A 2V6EA 5IT9K 3H5AA 4YFXF 1OR7C 1B9MA 1ETXA 5ICCA 5D4RA 2G9WA 2E7WA 4XIDA 2QM3A 3ABTA 2L2OA 3Q0VA 1TQMA 1ZELA 4HLXA 4CZCA 5ICGA 2L02A 3SDGA 2CO5A 4ZTJA 2JA7J 2EINH 5FRNA 4GO1A 2J5OA 4JYKA 3VWBA 3U1DA 1M1EB 3S1NJ 2K02A 3RSNA 5HDKA 1ZK8A 3RJPA 4CUGA 2O6GE 2F2EA 4KN7X 2HOEA 4CICA 3WU2C 5E17F 1LDKB 3LSGA 4HEA2 3F6OA 3ZQGA 4M74A 2V4JC 3BP8A 4LD5A 1IN8A 1BIBA 2KLOA 2L7FP 2XIGA 5EF6A 3CMMA 4LB6B 3RPQA 4HNTA 2LTPA 3I0TA 3GTGJ 3BPVA 2OCCH 4BJTA 5HVQC 4GDFA 4HRIA 4E7LA 1EH8A 1IZ1A 4M3BA 1Z6RA 1UJ8A 3KZYA 4LLGF 5JLXA 2OU2A 1XTAA 1FBSA 1P4XA 3GUDA 3KLNA 1U5TC 4KUMA 4BUPA 4X6AJ 2V26A 3C2BA 4AC0A 2MH9A 2Q8KA 1JTYA 2MC3A 1LVKA 3RYRA 4LJZF 1Y56A 1EV7A 2XHKA 3C1DA 3GF2A 2KDZA 1I6XA 1I50J 4NHJA 1HSTA 3IUOA 4N4NB 2ZJPF 3CF5F 2EJRA 1YS7A 4M72A 2HDWA 2CRGA 1O7LA 3DU5A 1R7JA 2QSGX 1RESA 1FBUA 3EUAA 3TOAA 2Y48A 3IAS2 2BZTA 1UHMA 3ISPA 4WK8F 2A68F 2FRHA 3BROA 1HOMA 5GP9A 1TWFJ 3JAMK 3CMEI 2ZKZA 3DEUA 3LOCA 1MBHA 2E2HJ 2FA5A 1KU7A 4BEHA 3LA3A 2KIUA 1G3YA 1UHWA 2JA2A 2R7QA 2XB5A 2WAQA 1R23A 4U88A 5JVTA 2E2JJ 4YG2F 3S2WA 4UUSA 1JT6A 1WI3A 5K1YA 1BW5A 3WTTC 2VE9A 3UR3C 1JE8A 2CV2A 1Z3XA 1V4RA 2MLGA 3OYMA 4IO9F 1MBGA 3DBLB 1X4PA 3ZMUA 2FXAA 4ZDOA 4L5EA 4ZJZA 2ADUA 4QPOA 3HPHA 4HF1A 1T0FC 1JGSA 4S05A 2NAZA 4E7HA 3GTKJ 1X1BA 2L7KA 5HS9A 4OIOF 4A6EA 1TT5B 4BXXJ 1SFXA 3EPZA 3GXOA 5H6RA 3TO7A 1LDJA 3HG9A 1FOKA 2IPQX 2NOJB 3D5SC 2DA6A 1FTZA 3PSFA 1X1CA 5E3NA 1XGOA 3CC4I 3KP4A 2HVQA 2M34A 2K4BA 1X4OA 3RKXA 1ZRDA 2L0KA 1U5TB 4PGHA 4BAYA 5DV5A 1AKHB 3I5UA 3LSJA 4RGUA 1MJBA 3MD2A 2BEOA 2OF7A 2VJJA 2M9HA 1SAXA 1H9GA 2BVLA 4HQMA 4V2GA 1TWAJ 3SEQA 2HTSA 2VKDA 1B9NA 3KYDB 4ESJA 5E1WA 2Q1ZB 1U8RA 2ZMEC 3MZYA 4D7MA 4EJWA 3JSPA 2OAZA 1SMTA 2IJLA 2VE8A 5F0HA 3ABMH 1I1GA 1YX3A 1DP3A 1OQYA 1HBXG 1QU3A 2RVCA 5IP6A 1MNMC 2FMYA 4D9JA 4WX9A 4B09A 1BOBA 4HYEA 1WCMJ 2YX4A 1FP1D 2ZJ2A 3RDIA 2E1OA 1MSFC 3TOBA 4BACA 5H2FC 1A31A 3ZR8X 3GLLA 3OS1A 3OSGA 3MVPA 4IZZA 4U7DA 1U0JA 5DD4A 1KYZA 4D5CA 1Q1HA 1B72A 1TNTA 3F21A 1IJWC 3HSRA 2M4GA 1ON1A 3LA7A 4XLHA 3K1MA 1ZRFA 5GPCA 2AHQA 1T33A 1F1ZA 5K7ZA 3BTJA 3MZHA 2CG4A 5LFAA 3F8CA 3FMRA 2K40A 2Q2EA 3BTCA 3ZMDA 4CCKA 1PUFA 1ETYA 3OYNA 1VQLI 3FK6A 4BJ6C 3K1NA 2XV4S 1X2MA 3VDXA 4KFCA 1S29A 2FJ1A 4J19A 4LMYA 3ZN1A 3WGIA 4IOAF 3HRMA 5LGTA 4CA0A 4F7ZA 1Z1DA 1PVEA 3V8KA 1GVDA 2KPMA 2CW0F 3H92A 1H88C 5TGTA 3CD6I 1WI9A 2D1HA 3WTSC 1X1PA 4RAFA 3GFIA 4OOIA 3M1CA 2KQRA 2E36A 4GFBA 5ED4A 3ZGKA 2EFPA 1R5HA 4Y7NJ 5IPAA 2XGCA 3BR0A 3H0DA 2Y0MA 1ETQA 1BJAA 2M7AA 2LY1A 4OAZA 5FKOA 4C2TA 3SZPA 3D5LA 1JXSA 2LVSA 3ERMA 3LSHA 5EEGA 5J6XA 4XRFA 2EK5A 2R5ZB 2KZVA 4ETSA 4G7OF 5F64A 4IJAA 3LQRA 2LRDA 1X3UA 2Z1DA 1ZG1A 5FO5A 2R7ZJ 1TLHB 2KP6A 1CF7A 3ZQFA 5J40A 3CJNA 5FB2A 1I3AA 4BQQA 3NARA 3CCMI 4OWRB 5CVRA 2EA4A 3ZQQA 3OYEA 3H5RA 1O3SA 2R7UA 4EGZA 4DOZA 3OYKA 3R60A 3BR2A 1BR4A 2X6OA 1D0YA 2TRTA 5L3BA 1WJFA 3L2WA 1YI2I 4KT6A 3GFMA 1D1CA 3TEDA 2I5UA 1YOVB 3DXJF 1LEAA 1OCTC 3I59A 1OFCX 4R8HA 4B8XA 2PLYA 2LY9A 2XF5A 4B1RA 4GRIA 1R4NB 3RKWA 2LKPA 3K4CA 5KK1A 2OPTA 1D8KA 2QKMB 3GFLA 1V54H 2JWTA 2HQAA 3T0YA 1N78A 2OZ6A 1K61A 3K4MA 4IL6C 3BJAA 3HOXJ 3TO9A 1TNSA 1K6OA 1DPRA 4W1UA 3SJMA 2PJRA 3IWFA 2MGQA 5JVGF 4XRSG 1MNEA 2R7RA 4LG3A 4FASD 1B6AA 4A3FJ 1S9HA 1KZHA 2OTJI 4IQ4A 1FX7A 5AIPA 3TQNA 2HYFA 3KP3A 1LKXA 3V42A 3HXLA 2DMPA 3VSLA 2F4OB 4DJAA 1J7KA 3F6VA 3ZQLA 2DOEA 1D5YA 1Y8QB 2Y31A 4BHCA 2LF7A 1VQ9I 4L9NA 5BNGA 1A35A 1PUEE 1E0EA 2QF7A 1P7JA 1RNLA 3CF2A 3ROUA 2D1VA 3OSFA 1QZZA 3DTKA 1YITI 1XCVA 3RTRA 4I2OA 3Q9SA 1RRJA 2JMWA 4S0HB 3L09A 2E7XA 1XGSA 4AUXA 3CCEI 5E3LA 4WXCA 4HF2A 3T8RA 2IXSA 2H1LA 1G3TA 3BTIA 2EZHA 3REOA 3PNYA 3EUKL 2M1BA 5L3EA 2DT6A 2LY2A 5FD6A 2XROA 3COAC 3FMQA 2L9RA 1SEUA 3Q0UA 2IA0A 1IF1A 4HBLA 2NOGA 2R5ZA 1W4MA 3HGGA 3HGYA 3B6AA 3X2QH 4L0ZB 1I27A 3E7LA 2YU3A 2FQ4A 3BZCA 2QCOA 1XB4A 5D5WB 3K4NA 4P9UA 3IRQA 3TMOA 3V8JA 1AWCA 4IHXA 1X2NA 3L9FA 4XOTA 5EGOB 1HW5A 2XRNA 2JT1A 2E35A 3KLOA 3WTVC 1W5TA 4WCGA 4EJTA 5GAEJ 2FE3A 1T56A 2ZO4A 2JK3A 3V7SA 4HOBA 2HVSA 1R71A 2PMZN 3BCAA 1UAAA 1Y1VJ 2BHYA 5CQEA 1YHQI 3S16J 2IS6A 2EBIA 2AQEA 3G73A 3F23A 3CCLI 1T0FA 4HDUA 1QO0D 2IW5A 1IW7F 4D7NA 1AHDP 3LAJA 4B48A 2R92J 3TKYA 2KIMA 4ESBA 4M71A 4AIKA 4H4KC 1XSVA 2EIKH 4IHTA 1Z7LA 1LPQA 4BQAA 2EFNA 1YJ9I 2P6SA 2JVGA 4X1EA 3HM5A 2VOPA 3BR3A 1E3HA 4WXDA 2FQ3A 3K69A 2IBDA 4XKBA 3ECOA 2XAHA 3J7AO 2JVHA 1I3QJ 4JX5A 1T39A 1REPC 2NVQJ 3ZMTA 4PGGA 5B1AH 3M8FA 5D8KB 4A5NA 5J1YA 1YFHA 2WV1A 5AIQA 4OMZA 2JUCA 4J01A 3PUFA 4XORA 1FIPA 3L7WA 1J2XA 4ASNA 1WJEA 3K70C 4A0YA 1VQ8I 3GCMA 4B43A 2VT3A 4XRSA 1LFUP 4RB3C 3ZPLA 3KETA 3FXOA 4YIFA 4P9FA 1WZ2A 5CQGA 4BY7J 1T98A 4EVIA 4ENJA 2KRFA 1LE8A 2TCTA 3CCSI 4L5IA 2L9VA 3KCCA 4ZYGA 3I55I 3AG3H 3SDBA 4BXFA 4ZTFA 2LNBA 3MEXA 2F5FA 5JLWA 5DUIA 1BIAA 3I3LA 3HSFA 2FU4A 4OU0A 2VPRA 1EJ9A 1SVLA 1CF7B 3S3MA 2K7LA 2JJ7A 2HZTA 1MMDA 3W6KB 5JR3A 1YJNI 1XMAA 4ENKA 1UG0A 4LK1F 3ABUA 2P6TA 2QUFA 3QQAA 1DGWY 2K86A 3DWLE 1MW7A 2DFEA 3OWTA 4A12A 1KA8A 5HLHA 2W48A 3TP0A 1E3OC 1OPCA 2OCEA 4MTDA 3CUQC 3WGGA 1JJ6C 1V5GA 3SQNA 4XN3A 2ETHA 4ESFA 2M30A 1G3WA 2VJIA 4D0PA 3RKQA 3KEQA 3EUHA 1D1AA 2NS8A 1F5TA 3I4NJ 4KN4X 1UHSA 2HGCA 3GLXA 4D5FA 5EGOA 2B63J 4BNCA 1RPWA 2M2EA 3ZQ7A 2CWEA 5HOOA 2QEXI 3JCUC 4BYYA 3ABKH 3CCYA 2BOLA 1IXCA 1LE8B 3QP6A 2LF8A 4RGRA 1F9NA 2CQQA 5DM7F 2OJED 3AL0B 2XAGA 4HSRA 3IHUA 5BMZA 1R1UA 2Y30A 4OIRF 4CCMA 3BPXA 3FXJA 1BW6A 3DKXA 5DS9A 1PP8F 1VZ0A 4FE7A 4E7IA 3HOSA 5H6QA 4NQWB 2GIZA 3I59B 4C3HJ 2KJCA 2GA1A 2F5EA 5KAFC 2CU7A 5JI6A 1RZ4A 3IKTA 4OAYA 5C4JJ 4Y17A 1B8IB 4MIMA 2FNPA 3WTUC 3S15J 3E5QA 4PJLA 2QBYA 5FROA 1MD0A 2WAQN 1IN6A 1KU2A 1Z6TA 3E6MA 4E4HA 3AKZA 4AM3A 2DPDA 4R1HA 2UV1A 3GTOJ 4Z6YA 1YRNA 5J1UA 5JHFA 2HKXA 1IN4A 4A0ZA 2E2IJ 4H0EA 2R5YA 1TBXA 4QIWN 5EG0A 1FYMA 1HKTA 1FC3A 4I09A 3C2HA 2QZ8A 1FZPB 3QRFF 5JHUA 3GWZA 2HFHA 4RM2A 3LSTA 2EV5A 1IDZA 4KNYA 1CQTA 4GCVA 2M4KA 2C6YA 3E97A 2Y75A 4OIPF 2E5NA 3W2VA 3LSRA 2XF6A 2BV6A 3KZZA 3VEPA 5KCMA 3CP2A 3CCJI 2RAEA 4LFUA 4B47A 1V5FA 5HS7A 1MKMA 1OCOH 2D2WA 4BHPA 4EV0A 4C3JJ 3T1BA 2KZGA 4BDZA 2BXZA 2XAJA 1WH5A 3CMYA 1QHGA 1IUYA 3BOQA 3DTEA 4BXUA 2V1NA 3I58A 2VB6A 2BYVE 1JKRC 4NC8A 2P7VB 1XN7A 1U6GA 5F08A 1LNWA 3G3ZA 4NBQA 2V1UA 4Q5SF 4UUTA 2L3DA 1DDNA 2O03A 1R4MB 1O57A 1TQPA 5LHHA 3HKZA 3DQVC 2F4IA 1TZLA 4E7KA 4CHUA 4BBRJ 1A04A 3K1PA 5M3FJ 2DN0A 2XKPA 3RI4A 4PJNA 5EG0B 2DODA 1XD7A 2JPBA 1TW2A 4Y15A 3CQZJ 4A3IJ 2V1DA 5F1RA 2R7DA 3EQLF 3DFGA 2L9NA 3BC8A 1V3FA 1BL0A 2QGUA 1DPUA 2OBPA 2PMUA 3GZNB 1A6QA 3HRSA 4I99C 2EWNA 3V8LA 4BE0A 3BG9A 1JKOC 1QRYA 2D5VA 2B9SA 2F5VA 5HLTA 3A01B 3M4OJ 3MAJA 3A02A 3R4KA 4ABZA 3FMSA 5BOXA 3C7JA 2GZWA 4HA8A 1HKSA 4CCNA 3HTSB 3OYIA 1LQ1A 2PFBA 3A0BC 5DUKA 2ELKA 2RQPA 1OYIA 3G1OA 3ZN0A 3GO5A 3J7AY 2VI6A 3HB9A 4I76A 3QPLA 2W57A 1TWCJ 2VBYA 3CCQI 3BQZA 1H8AC 2W7NA 1FSHA 1MZBA 2LLKA 3CO6C 1TL8A 2D45A 1ZG5A 2Y9YA 4PCQA 4YIRX 1SMYF 3BZKA 3OL3A 2FX0A 2WC2A 2GM4A 2W00A 1L3LA 2VT2A 3NWSA 4FCYA 2JSPA 4GYGA 4M6YA 1MGTA 4IVNA 4BDYA 2ACJA 3NAUA 1WWXA 2CS3A 4A5MA 1VQPI 1IUFA 1GLNA 1X3ZB 5E3MA 2X9DA 3QPSA 2BXYA 3PUBA 4Y52J 1OJLA 1QZEA 1IG7A 1X1DA 3LMMA 5BPIA 4ZYDA 4IOCF 2QA4I 2WTEA 5GAGJ 2ECCA 2DA1A 3BCBA 1U8BA 1R36A 2HOAA 4RBOA 1OCRH 5LHIA 1TTYA 1UG2A 1GV2A 3LFUA 2E34A 2X1CA 3ELKA 3F8BA 5CPRB 1TWHJ 4ZH4F 4PDKA 2DQRA 1Z05A 5ERIA 3WODF 2VOOA 2H94A 2HU9A 1IXRC 5D6FA 2DJNA 2Q2EB 4XMYA 2KL4A 2XGEA 1YE9A 3GTLJ 3WE3A 5TJJA 1Z91A 5DCMB 4BL0B 4FQGA 4N0BA 3T5XA 1WJBA 4RM3A 2HQ5A 2XGDA 2R4GA 4OINF 2AS5F 3VYRB 2O9LA 3VSKA 1BI2A 3PNTA 4FHTA 2PJPA 3PIPF 2HXOA 1ZGJA 2ECBA 5K5OA 5J47A 3F9KA 1QZYA 2A05A 1P92A 2CV1A 2QQAA 1Y39A 4LOCA 4Y13A 2XAUA 2X1DA 3M7GA 1Z3YA 2VJ5A 1ENHA 1PJRA 3BG7A 3GEZA 4YEJA 2BHZA 3DU6A 3K6GA 1YLFA 3CUOA 3FKJA 4KT5C 3C2GA 2WBMA 4S04A 2B7EA 2Z5UA 3MN2A 5CVVA 4PJ0C 1Z77A 4G6DA 3J7ZI 2L01A 2O5RA 4CSWA 3G2BA 3WU1B 3HOUJ 2DAOA 3W3CA 5E8GA 2L5QA 2JQ7A 2NXNB 2FOKA 1SC7A 1ZKGA 1B8IA 1T95A 1RI7A 4FX4A 1T08B 1YS6A 1FEXA 2EZKA 5FRMA 4E7JA 4A0XA 3PM1A 3GTJJ 4UVAA 2IAIA 5EYRA 1ZR2A 4ZYEA 1UB9A 4L9TA 3TDZC 5ILSA 5LGNA 4LK0F 1MBEA 3FHZA 3F0CA 2AXTC 3JTHA 3FF5A 1WRJA 2OD5A 2LKXA 1O3QA 2DDAA 5LLQA 4ZC3A 3JRDA 2STTA 3PJRA 2AXLA 5TISC 4F52A 2PQ8A 3KZIC 1EF4A 1JHFA 2V79A 5LRRA 1EA3A 4KIFA 4UVBA 1EH7A 4GXOA 1QPIA 5J4VA 2XSDC 1G2HA 1BI3A 3O2PE 3WHCA 3GX4X 2F6CA 3D1NI 4RMNA 2CUFA 2ESNA 3F22A 3CJRB 1WJ5A 4OMYA 2A6HF 1ZYRF 3I4PA 3VOEA 3S1QJ 3KFWX 1N25A 3PQKA 3CMAI 3BQYA 5C44J 4AIDA 4DGWB 5B66C 2LSOA 3LSKA 5D6EA 2M7BA 4BE1A 1KQ8A 3PFIA 5HNHA 1WPKA 1IC8A 3OYBA 1KONA 5LD2C 2ELHA 1JUMA 1NK2P 2Y0SA 2LH9A 4B3AA 1S7EA 1J9IA 3A1YA 1IV6A 4RS8A 3FHNA 1USSA 2FUG2 4I7HA 3LQQA 2K9MA 1SFOJ 2BY2A 4X0GA 3U1KA 1H89C 3HL2A 4YRVA 1AOYA 1GHCA 1Y1WJ 1N77A 5BS6A 2O61A 3HOYJ 4LIVA 2OUMA 4LLNA 3S32A 1Z0XA 4AYBN 4MTEA 4KA4A 1T2KA 1BA5A 4DZJA 1LFPA 1XX5A 4BEHB 1TC3C 2GOMA 3H3UA 1LDDA 4RAYA 5FFZA 3JRBA 1P2FA 4NNJA 4EJUA 2ZBKA 3MKZA 1ZR4A 4O5VA 3Q0WA 2K27A 4XK4A 1YRNB 3LAPA 2DA4A 3FXMA 1S3JA 2FOWA 3BY6A 5ICFA 3WG9A 3AG1H 2GLOA 2HDDA 4XR6A 4E6KG 1UFMA 4C30A 3HOVJ 1U2WA 1DU6A 5F27A 2ZXWH 2ESHA 4NC6A 4HX4A 2H27A 3FBNB 5A2QK 4ENMA 3OL4A 4DYRA 2A5WA 5BQTA 2Z9OA 4BBSJ 2MYSA 3HIFA 5IY5H 4GGGA 2W1OA 3RZDJ 2VXZA 1FP2A 5FLXZ 1K4SA 1ETWA 4HV5A 1G4DA 4HPQA 3SEZA 2P7CB 3FK7A 1R5GA 3K70D 2NRAC 3K10A 2MLKA 4MLOA 3MFKA 1XGNA 4AYBA 2MABA 3KP7A 1ZG3A 5D5XB 3HOWJ 3S17J 2KDOA 2NYXA 3QPTA 4WWCA 2EA2A 2DJIA 3JRGA 5K7HA 1OMIA 3BG3A 2YX7A 2KKOA 2DFHA 2DA5A 3H5NA 4AU7A 2XRLA 4PSWA 3GMEA 2BBYA 2HTJA 5L3GA 1IV8A 1OISA 2VONA 3HYIA 4XN0A 4CCLA 4BJ5C 5GADJ 3IRRA 3DF8A 3F8MA 3IKVA 3KEOA 5E20A 1J5YA 1MJ9A 2EIMH 1BR2A 3OY9A 3WTYC 3CP8A 4DYCA 2XPWA 3F72A 1VQ5I 2R7TA 1IRFA 2F48A 1OYWA 4A3MJ 1W1WE 1FT9A 1OCPA 2X48A 1N75A 1VF9A 1ZAOA 4UV8A 3A4CA 1ULYA 1VQKI 3HZJA 4L9JA 1O3TA 5IP9J 3DV8A 4KITB 3J80Z 2O3FA 1DGRM 3DKWA 4M9XA 1HXDA 5A2QZ 1TW3A 3DPTA 4BHBA 3S14J 2OV7A 2DQLA 1TQIA 4M3EA 5CLSA 1AU7A 2R7SA 3BT9A 5EDNA 3H0GJ 2A61A 1BBYA 1WJAA 1ACIA 3CZ6A 3DTIA 2EILH 4XL9A 5KNLA 3G4SI 4EEFG 1SVOA 2Z2SB 3IH3A 5E1XA 5FFXA 1YYVA 4MQVA 1MMAA 3CJTB 3EETA 2CGPA 3DP7A 4ZZLA 1BR1A 1QVUA 2HNHA 3BWGA 3L2QA 2JSCA 3AAFA 3O8GA 4HLYA 1P9QC 4IRIA 3QPHA 1HKQA 2M45A 5LHGA 2DFIA 2Z16A 3CESA 2ZJQF 5DEQA 2XF7A 1HW2A 1XDSA 3PNVA 1SFUA 2VC1A 1AKHA 5GAHJ 3S1MJ 2W25A 2VL8A 2OZUA 3I64A 3TBIA 3WTZA 4E7SA 2QVOA 3IWZA 5EEAA 5IOZA 1NG7A 2WY7Q 4XQFA 2LP0A 4IEJA 3GTPJ 1P6RA 5IP7J 4KISA 3LWFA 4ZDLA 2EPFA 5F6FA 1K4TA 2HXIA 3DCFA 4IHWA 4A3GJ 3QWLA 2VKVA 4EM2A 2RGVA 2HQRA 4IRGA 4II2A 3TO6A 4LG0B 2KT0A 4Y4RA 5E3OA 3RPUA 2KJBA 3TW6A 1OYYA 4TV7A 3U9GA 2RQQA 2WV0A 4A3BJ 4G9YA 4EQQA 2ME6A 5F1JA 2H09A 3OR2C 1DQUA 5FD5A 3I54A 3A01A 1U9NA 2X1EA 2WWYA 1JT0A 1J0RA 3RCOA 3W6JB 5LRSA 4DYQA 1E3PA 3OIQA 5CKTA 1D1BA 1ETOA 1VQNI 3CLQA 2WY8Q 2P4WA 1HA8A 2IP2A 3RQ4A 3H1CA 4JOMA 1Z21A 3MMYB 1YTYA 4IF4A 4ITVA 2ZSIB 4YIIA 1HCRA 3B73A 2R7WA 2YSRA 3VPRA 3P9CA 5HNFA 2IS4A 4HNVA 3Q9VA 1XPXA 2DFFA 2P5VA 2P5LC 2XGXA 4B4CA 1K78B 2K9SA 4DBRA 1VNDA 1W36C 4HSTA 4LIUA 3C18A 2WA0A 1X3WB 3M1EA 2MH2A 1S7OA 3JRHA 5J3LA 2RDPA 4EGYA 1S8NA 1XCBA 4NB5A 4ON0A 1LB2A 3VB2A 4F91B 1SAUA 1PP7U 3PO3J 4DQ2A 4XOPA 5EJCA 1U5TA 2K9QA 3PL8A 2O0YA 4CYCB 2DTZA 2VBWA 1QA6A 1NH3A 3GTMJ 2A6EF 1D8JA 3CUQB 3IC7A 5EEHA 2HOSA 3WTWC 2H8WA 3L2VA 1W7PD 1ZTRA 2V7FA 4JX4A 4F55A 2M0MA 4B3XA 4U0VA 1K78A 3ZQIA 2R7VA 2NNYA 2VLAA 1L0OC 2ICWG 4HX8A 3HPGA 2PJRB 1RETA 2LDUA 5J4YA 1K79A 2G0EA 4M3GA 4C9YA 2CQKA 2XSJC 4RLQA 3R0JA 4DIQA 3OS2A 5FKNA 3VYTB 1ZLKA 2QQ8A 2GIVA 2VIXA 4IRHA 1G59A 4DZPA 1B59A 3JRCA 3H9QA 2Y9ZA 1KQ9A 3KIOA 3MCZA 2XPVA 3E1SA 3TL4X 4Q47A 3CUQA 3JW4A 3U21A 4DW6A 1PDNC 1P7IA 3MZ8A 2Z33A 2Y2ZA 1JHHA 2KRCA 5K7FA 3WE2A 1KU9A 4M9SA 1EH6A 4G94A 3PO2J 1W36D 4EMSA 4UUSB 2CMPA 5E8IA 2OQRA 2DOAA 1WGXA 4WF2A 3K2AA 3RPUD 1MBKA 1ZARA 2KHMA 2DBBA 2JRTA 3CLOA 4EM1A 2A3SA 5LEKA 3FXRA 3CCRI 2X6XA 3GZ6A 3ZMZA 3DBHB 4XNFA 4AIJA 4A3EJ 4IHVA 1VI0A 1XG1A 2V1XA 2X85A 3KEYA 2ID6A 2VXDA 3FWEA 4CH7A 3KX2A 3ULQB 1R22A 3U2RA 3B02A 3S1RJ 3GZ5A 1JTXA 2DW4A 4A3JJ 1SANA 2BY1A 1Z9CA 4BKXA 1ZQ3P 5HLGA 2LYCA 2ZMEA 2BGCA 3F8FA 1XS9A 2HR3A 2ZJRF 5LGUA 2V9KA 2AQFA 2B0LA 2QLZA 3T8TA 5K5QA 3S3NA 4RLFA 2GA2A 3DEEA 3Q5FA 3RQIA 5J1RA 2K9LA 4G6QA 3LSPA 1QGPA 1CGPA 1OKRA 3JRAA 2ZCWA 1YIOA 2ZXHA 4RB1A 2XC7A 3KYLA 1S6LA 2LOOA 1ZREA 1FMVA 1X58A 4CYCA 1VQ6I 3SHFA 2COMA 1R1TA 2W85A 4AIHA 4D1QA 3LSIA 1DUXC 3JRFA 2VKEA 2CUEA 2DOFA 4JQFA 3EDPA 1FPQA 2FF4A 2QBYB 2VJ4A 3ML6A 4BQOA 2DCEA 4U0WA 1W0UA 3G6EI 4IPAA 3IL2A 2JTVA 3BR1A 4I02A 4HNUA 3V7RA 1VQMI 1MH3A 4LB5A 2XPUA 4WXHA 3OYHA 2Q0OA 4CYDA 3N97A 1PUFB 2F5DA 3E5XA 3FDYA 4F3QA 1U78A 2HS5A 3O3KA 3I4MJ 1YIJI 2EQRA 1FYLA 4CCJA 1ZH5A 2MFZA 5HODA 1C0WA 2BVMA 4L5JA 3CCUI 1I1SA 4MHGA 3DPLC 3E6BA 4BE2A 3QU6A 2HWVA 3OR1C 2CV0A 2JUGA 3ZMVA 2RNJA 3AG4H 2FBIA 1B72B 2FD5A 2ISZA 1TT0A 2HPIA 3BJOA 5ILUA 1ONVA 3AL0C 2K5CA 3GFJA 3QOEA 1R00A 3FX3A 1J59A 1VFCA 4KDPA 1RC9A 1IN7A 4RB2C 5C4XJ 1W7PB 2DK5A 2E1MC 4GYIA 3J7YJ 1WKMA 3M3YJ 2LR8A 1S5LC 3HDDA 3VFZA 1GDTA 3V7CA 1FYKA 2DI3A 4M6VA 2GXGA 4UV9A 3K4KA 1I39A 2BW3B 2YU9J 5CJ9A 4Y3OA 5CVIA 3ZXSA 5M5XJ 4M9ZA 4KJZA 1A36A 2IS2A 5L3CA 3K0LA 2OQGA 3FXQA 3LL7A 1B1BA 1YW9A 1POGA 3RYPA 3ECHA 3M8EA 5FLMJ 3PSIA 4L18B 4HQEA 3S2DJ 2VODA 2M0CA 5DDGA 3FM3A 4FE4A 1U3EM 2VQLA 3MWMA 3EUHC 5KAIC 3H36A 2KRHA 2HYJA 2O8XA 4MO7A 3SFZA 4G8XA 3JR9A 4PJJA 5FKMA 5D8LB 4NUBA 4C3IJ 2CH0A 2ZNYA 3LA2A 1MDMB 5F0CA 1V55H 2YS9A 2HI3A 2HKOA 1JKQC 2NS0A 3WGHA 3BJ6A 1X19A 2R3SA 5CVUA 1HLVA 3I9V2 3OIPA 4PZJA 4F92B 9ANTA 3G71I 1RUNA 1Y6IA 5GPAA 1V5EA 4Q4ZF 2VUMJ 3KYCB 2DPUA 2JZYA 2XAQA 2P8TA 2R7OA 2QENA 2WADA 5AONA 3CDHA 3QAHA 1FJLA 3FM5A 3G1MA 3UNGC 2NVTJ 2ZC2A 1FBQA 2STWA 3BG5A 3DKYA 1G3SA 2QSFX 1K7AA 4UHTA 2ZXJA
chains in the Genus database with same CATH topology
3OS0A 4J01A 2A6TA 3QYFA 2ZXIA 2E1MB 3FBNB 4XORA 3OL4A 2ELJA 3MKYB 2A5WA 1WJEA 3K70C 2CUZA 2MYSA 4ZYAA 3AFHA 4B43A 3K4JA 3H35A 1MMNA 2W1OA 2VXZA 4XM3A 4NC7A 4E7ZA 4HPQA 3SEZA 3S8PA 3K70D 3K10A 4XKWA 5CQGA 4MLOA 1SFKA 1WJDA 4AYBA 2MABA 3OYLA 4ZTFA 2KDOA 3SDBA 4BXFA 2CW7A 2K3PA 2DJIA 1IRXA 3I3LA 4ANJA 3W2WA 2E5ZA 2ZSHB 3H5NA 4AU7A 2IGMA 3S3OA 4CCOA 3N05A 4N4OB 3S3MA 4PSWA 3DLAA 4P1WA 1MMDA 2CW8A 2V6EA 1UG0A 3H5AA 4XN0A 4CCLA 4BJ5C 1OR7C 1DGWY 3DWLE 2QKLB 1MW7A 3OWTA 1BR2A 3OY9A 2L2OA 3CP8A 1ZELA 4CZCA 2R7TA 4PFPA 1V5GA 4XN3A 4ZTJA 5FRNA 3BLYA 1N75A 3VWBA 2VJIA 3RSNA 4XKCA 4CUGA 3A4CA 1D1AA 1LDKB 3LSGA 4HEA2 4KITB 3L2UA 1DGRM 4J00A 5HOOA 3DPTA 2V4JC 2OV7A 3NWTA 2BOLA 2KLOA 3CMMA 4HNTA 3AL0B 5HVQC 4HSRA 4BJTA 2R7SA 4HRIA 4CCMA 4E7LA 3OYFA 4DBQA 3DKXA 1WJAA 1VZ0A 3CZ6A 4E7IA 3DTIA 3HOSA 4NQWB 4BUPA 4XL9A 5KNLA 2V26A 2Z2SB 1LVKA 1MMAA 1Y56A 2LC2A 1BR1A 2HNHA 3L2QA 4OAYA 3IUOA 2M3AA 1P9QC 4N4NB 3OYDA 2RNGA 2HDWA 3HUGB 2Z16A 4PJLA 3CESA 5FROA 3DU5A 2XF7A 3PNVA 4AVZA 3EUAA 3IAS2 4E4HA 3GBGA 3AKZA 4XKVA 4BU2A 1FMWA 2VL8A 3ONQA 3TBIA 2UV1A 4E7SA 5JHFA 4IX7A 1NG7A 2WY7Q 3LSMA 4XQFA 4BEHA 4XONA 2VPLA 2JA2A 2R7QA 4KISA 2WAQA 4ZDLA 3C2HA 4RM2A 2HZDA 4II2A 2HVRA 2M4KA 3UR3C 2E5NA 3W2VA 2BW3A 1Z3XA 4Y4RA 3OYMA 2WAFA 2XF6A 2CV2A 5KCMA 3CP2A 1X4PA 3OMYA 4B47A 4ZDOA 4ZJZA 1V5FA 2RQQA 4BQNA 4QPOA 2L9SA 3HPHA 1WFXA 1T0FC 4E7HA 3OR2C 1DQUA 2HPMA 1X1BA 2L7KA 4BDZA 2X1EA 2X51A 2VQCA 3RCOA 2LBFA 1QHGA 1G8XA 2E60A 3DTEA 3EPZA 2V1NA 2VB6A 3HG9A 3OIQA 1YX5A 2NOJB 3D5SC 4NC8A 4P5OA 1D1BA 5CKTA 2RREA 3S93A 3PSFA 1X1CA 2WY8Q 2HVQA 1X4OA 1HA8A 3RQ4A 4EATA 4JOMA 1Z21A 3MMYB 3SZGA 3VYUB 3HKZA 3DQVC 2X6WA 3IP4B 4ITVA 2F4IA 1TZLA 2ZSIB 3MD2A 2VJJA 2R7WA 4E7KA 2BVLA 3SEQA 5HNFA 2IS4A 2DT7B 2VKDA 4PJNA 2Q1ZB 4DBRA 1W36C 2OC6A 4HSTA 4LIUA 2MD0A 2WA0A 2L9NA 3BC8A 1MMGA 4PUSA 2DXIA 2W82A 1YX3A 1DP3A 1QU3A 4F91B 4D9JA 4BE0A 1SAUA 1BOBA 2F5VA 4XOPA 5HLTA 4F93B 3PL8A 1PYVA 3CJQB 3ZRGA 3OYCA 2LG4A 4BACA 3ZR8X 4CCNA 2V7FA 3L2VA 4F55A 3OYIA 3OS1A 3K4LA 4HG2A 2M0MA 1X1AA 4B3XA 4IZZA 2R7VA 1U0JA 4XLFA 2VLAA 3J7AY 3HPGA 2PJRB 2VASA 3QYEA 2M4GA 4II3A 2XSJC 4C9YA 4IKFA 4RLQA 4DIQA 4XLHA 3OS2A 3VYTB 3W2AA 2VIXA 2W7NA 1G59A 1J09A 3H9QA 4PJMA 3TL4X 2P0WA 3E1SA 4CCKA 5LFAA 3U21A 3OYNA 3OL3A 4BJ6C 2W00A 3NWSA 4R79A 3VDXA 2UWMA 2JSPA 2KRCA 4BDYA 1W36D 2CS3A 2CMPA 4CA0A 1GLNA 2DOAA 2KPMA 3SYTA 5TGTA 3PUBA 4QPQA 1X1DA 3RPUD 3LMMA 3A2KA 2XDVA 3BCBA 2KHMA 3M1CA 2KQRA 3ZGKA 2I8DA 2X6XA 2IGKA 2VKHA 3H0DA 2GOXB 4XNFA 2M7AA 4OAZA 2LY1A 4C2TA 2X85A 3D5LA 3LFUA 3LSHA 2X1CA 3KEYA 2VXDA 5CPRB 4B44A 4CH7A 3KX2A 2KZVA 3OYGA 2HU9A 3D5RC 2Q2EB 4XMYA 2KL4A 1YE9A 2LRDA 2Z1DA 4C2UA 2KP6A 4BL0B 4BQQA 2LYCA 1WJBA 2W4SA 4RM3A 2PMZA 4FETA 2R4GA 4OWRB 3VYRB 2V9KA 2AQFA 3ZQQA 3VSKA 3H5RA 3OYEA 2R7UA 1AA7A 3PNTA 4DOZA 2R7XA 3OYKA 3S3NA 1BR4A 1D0YA 3L2WA 1WJFA 2UUZA 4RLFA 1JI8A 1WJCA 3DEEA 3F9KA 3OYAA 4KT6A 1D1CA 1R6RA 4XLEA 2K9LA 2CV1A 2CUJA 2XAUA 2X1DA 1Z3YA 2VJ5A 1PJRA 2ZXHA 3BG7A 2XC7A 2LOOA 4YEJA 3KYLA 1FMVA 3DU6A 3K6GA 2IGOA 2XF5A 3FKJA 4GRIA 3C2GA 2WBMA 4D1QA 3K4CA 3LSIA 2QKMB 2HQAA 4JQFA 1N78A 3K4MA 4Y33A 2VJ4A 2O5RA 4CSWA 3G2BA 4BQOA 3W3CA 1QHHD 3ZCOA 3H9GA 4XLCA 2PJRA 2DCEA 2L5QA 3K4BA 2VQGA 1T95A 1MNEA 2R7RA 4LG3A 4PK4A 4FASD 4U7BA 4HNUA 1S9HA 2KMUA 4IQ4A 2WAEA 5KHDA 1LKXA 3V42A 3OYHA 4E7JA 5FRMA 1D0XA 3HXLA 4G6TB 4F3QA 3VSLA 3FDYA 3OYJA 4BS9A 4DJAA 4IQJA 4CCJA 2MFZA 2ZFUA 2LBFB 1D0ZA 2BVMA 4XLAA 4ZC3A 3DPLC 1NG6A 1E0EA 4BE2A 3CF2A 4LITA 3PJRA 3OR1C 3DTKA 4F52A 2CV0A 3RTRA 2JUGA 1EA3A 1TT0A 2HPIA 4ZDPA 1K6YA 3AL0C 2K5CA 2VQHA 3QOEA 2F6CA 4RMNA 3CJRB 1WJ5A 3DPUA 2E1MC 4PFOA 2IXSA 4U87A 3QODA 3PNYA 3EUKL 4DGWB 2DT6A 3IAM2 2LY2A 3LSKA 2MC4A 2M7BA 4BE1A 2CFOA 1ERDA 3K4KA 2BW3B 5HNHA 4Y3OA 4PSXA 3ZXSA 3OYBA 1KONA 4KJZA 5LD2C 2IS1A 2IS2A 2Y0SA 2IGNA 1OLTA 2LH9A 3A1YA 3LL7A 3FHNA 3HC7A 2FUG2 3K4NA 2K9MA 3PSIA 3TMOA 4X0GA 3VYSB 3E0JB 4XOTA 3HL2A 3MKWB 4YRVA 2VQLA 3PFYA 3EUHC 2KRHA 1N77A 1MNDA 2WB1A 4LIVA 2HVSA 3BCAA 1UAAA 4PJJA 5CQEA 2OUMA 3S32A 4NUBA 4BGDA 2CH0A 1UELB 2IS6A 2AQEA 2X6YA 3HOTA 1LFPA 4BEHB 1X19A 2GOMA 4YELA 3I9V2 3OIPA 4F92B 4B48A 3OOUA 4NNJA 1Y6IA 3FBIB 4H4KC 3L2RA 1Z7LA 3MKZA 1V5EA 2LREA 2JVGA 3BG6A 4XKBA 2R7OA 2JVHA 2WADA 4XR6A 4E6KG 4C30A 3UNGC 3H9JA 3DKYA 3QYBA 3M8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFP A;  1WJD A;  1WJB A;  1K6Y A;  4F3Q A;  1E0E A;  1WJA A;  1WJF A;  1MW7 A;  3HPG A;  1WJC A;  1KON A;  3F9K A;  3HPH A;  1WJE A; 
#chains in the Genus database with same CATH topology
 3OS0 A;  2A6T A;  2ZXI A;  2E1M B;  2I10 A;  2ELJ A;  1QVT A;  3ABL H;  6PAX A;  2CUZ A;  2DTR A;  2ZFW A;  1H9T A;  3M9A A;  5BPD A;  1P4W A;  2MG4 A;  4ZYA A;  3NQO A;  4AWX B;  3H35 A;  2GWR A;  2GXB A;  5B3S H;  4I98 B;  1MIJ A;  1R5I D;  3HRU A;  4XM3 A;  4BH9 A;  1BC7 C;  4E7Z A;  4ENN A;  1FWZ A;  3S8P A;  1ETV A;  1K83 J;  2KIF A;  3O6B B;  1LEB A;  4JP0 A;  4JBA A;  4XSZ F;  1SFK A;  1MDM A;  1WJD A;  2FML A;  1LUJ B;  2CW7 A;  2K3P A;  1W0T A;  2CQ7 A;  3P9I A;  1FSE A;  4LLL A;  3ZOB A;  2BE5 F;  2EIJ H;  1FNN A;  3HHG A;  1O3R A;  2K85 A;  2DYS H;  2E5Z A;  1JGG A;  2ZSH B;  3HOZ J;  3JRE A;  4UB8 C;  1MJA A;  4CCO A;  3N05 A;  1NK3 P;  2DT5 A;  2HDC A;  2HOT A;  5F0F A;  1UMQ A;  2DU9 A;  1XSX A;  2ZME B;  4A2U A;  3IH2 A;  2H6C A;  1W7P A;  4M73 A;  2M8G X;  1B4A A;  3O8H A;  2COB A;  2L7M P;  4KIB A;  1APL C;  3HSE A;  2QKL B;  2L54 A;  1BN5 A;  2QQ9 A;  2DA3 A;  1YW7 A;  2YUS A;  3KP5 A;  1SD7 A;  1UCR A;  4G12 A;  3PQJ A;  3FXL A;  4XLN F;  1BJZ A;  4UB6 C;  5ICE A;  3DLL F;  4PFP A;  1QPM A;  3CDL A;  5FJ8 J;  2JRM A;  4M3F A;  4UNO A;  2MD5 A;  4XLP F;  3BLY A;  1R9T J;  5M3M J;  3ASO H;  4XKC A;  3CCV I;  4UY8 I;  2R5Y B;  2YR2 A;  4A3C J;  3RIR A;  3L2U A;  2ID3 A;  4J00 A;  1IAW A;  3G1L A;  1GXQ A;  3NWT A;  4MEY F;  1R49 A;  4RGS A;  1BI0 A;  3BZ6 A;  1IO2 A;  2LD5 A;  1BM9 A;  4I0B A;  1BI1 A;  3NEU A;  3TGN A;  2OTL I;  3K2Z A;  2LMD A;  3OYF A;  4AVP A;  1J75 A;  1XMX A;  3L00 A;  2LKS A;  4DBQ A;  4M3D A;  1Y8R B;  3FIW A;  1S72 I;  2ISY A;  3OIO A;  4KMF A;  3HKZ N;  1WSU A;  4L9V A;  2RN7 A;  2IA1 A;  4O6J A;  2F5C A;  4HV6 A;  1KQ0 A;  3CC2 I;  4CXF A;  1VTN C;  3A03 A;  3SXY A;  1YG2 A;  3ESW B;  3GYH X;  2LC2 A;  4RAG A;  2M3A A;  3JRI A;  1GXP A;  2E1C A;  3OYD A;  2RNG A;  1KU3 A;  3HUG B;  4MQ9 F;  1UZC A;  4BY1 J;  3E6C C;  1W5C C;  1F43 A;  2VC0 A;  4AVZ A;  1JJ8 C;  1LVA A;  3GBG A;  4XKV A;  4BU2 A;  4FX0 A;  1FMW A;  1NHA A;  3ONQ A;  4CDG A;  4IX7 A;  2JN6 A;  5J8F A;  3ZQH A;  3LSM A;  2XVC A;  4KIG A;  1O4X A;  4C2M J;  4XON A;  2VPL A;  4YFK F;  1NTC A;  2Y69 H;  4QTR A;  1WH7 A;  2LK2 A;  3FXK A;  3QP5 A;  1FTT A;  2O8K A;  2CQN A;  2HZD A;  2KFD A;  2HVR A;  2E71 A;  2QYO A;  1GV5 A;  4XRM A;  3KPH A;  2BW3 A;  2WAF A;  3K9T A;  3WU0 A;  1QBJ A;  3UKG A;  5GTH C;  3D0S A;  3OMY A;  1WVR A;  2NVU B;  3S2H J;  4NQW A;  4BQN A;  2UXN A;  2L9S A;  1WFX A;  3FKI J;  1Z67 A;  1XSD A;  2OA4 A;  2HPM A;  2XUB A;  1RIO H;  4MFE A;  2VN2 A;  2EB7 A;  2FNA A;  2X51 A;  2EFQ A;  4AD9 A;  1T38 A;  2VQC A;  3ZP5 A;  2LBF A;  1F4K A;  1G8X A;  2E60 A;  3FIS A;  1OCZ H;  5IT3 A;  4FTH A;  1YX5 A;  4P5O A;  3WTX C;  3S93 A;  2RRE A;  5H20 A;  3MQ0 A;  3KP2 A;  3ZQC A;  5E1Z B;  3JAM Z;  3OV8 A;  2JA8 J;  2ME0 A;  5HLI A;  5F04 A;  4EAT A;  3J80 K;  2V6C A;  4NDL A;  3SZG A;  2R7F A;  3VYU B;  3RZO J;  2X6W A;  3CDI A;  2E1N A;  3IP4 B;  1ZLJ A;  5JFR A;  2IA2 A;  2DA2 A;  2DMU A;  1SD4 A;  2DT7 B;  2RKH A;  1ZGW A;  4OIQ F;  2R0Q C;  3WG7 H;  4QWQ A;  3W6V A;  1XGM A;  2OC6 A;  3BDD A;  1Y0N A;  5FLX K;  2MD0 A;  5M5Y J;  2DMT A;  1MMG A;  1RKT A;  4PUS A;  1SD6 A;  3HTU A;  2DXI A;  1WQ2 A;  1ZRC A;  2W82 A;  4DNC A;  1H0M A;  3K7A J;  2BY0 A;  2DYR H;  4A69 C;  3CC7 I;  2W24 A;  1D5V A;  5EZG A;  3L1P A;  2UXX A;  3ZMS A;  4F93 B;  2A07 F;  1PYV A;  1SVM A;  3CJQ B;  3ZRG A;  1GVJ A;  5DCF A;  2PMH A;  1A5J A;  1ORK A;  3OYC A;  2LG4 A;  1UST A;  2FEZ A;  1BC8 C;  4V19 K;  3K4L A;  4HG2 A;  1X1A A;  2K3F A;  3BTL A;  2O7O A;  4V2F A;  4XLF A;  1OCC H;  2MA3 A;  1S7A A;  1XDU A;  2K4J A;  3OOP A;  2VAS A;  3QYE A;  4II3 A;  1T8I A;  4G7Z F;  5J8C A;  4IKF A;  3J81 K;  3HUG A;  4Q48 A;  1HQC A;  3W2A A;  1I5Z A;  5DTD A;  1MH4 A;  1J09 A;  4KMU X;  4PJM A;  4MEX F;  4MNU A;  2P0W A;  3MKL A;  1XMK A;  1E17 A;  3P9K A;  2JPC A;  5HDG A;  2CYY A;  1FY7 A;  3TP3 A;  4R79 A;  1STZ A;  2UWM A;  1IGN A;  3N4M A;  2MW8 A;  2NVX J;  1ZGA A;  2DMN A;  1FIA A;  1Q1V A;  5FLV A;  3L2C A;  2V9V A;  1Z7U A;  2FSW A;  1SFE A;  2G7H A;  3F8N A;  1TP4 A;  3SYT A;  5D5V B;  4IHY A;  2XAF A;  1A6I A;  2KIQ A;  3GVA A;  4QPQ A;  1FLI A;  5LBQ A;  3V4G A;  3A2K A;  2XDV A;  3CO7 C;  1KYW A;  5L3F A;  5B5E C;  1O7F A;  4FIS A;  5GTI C;  4QLC U;  3PIO F;  2I8D A;  3IV5 A;  2IRF G;  2IGK A;  2VKH A;  3R0A A;  2YPR A;  2GOX B;  2PX9 A;  5CVJ A;  1IN5 A;  3KP6 A;  2Y0S N;  4B44 A;  2M5W A;  3OYG A;  1P4A A;  1R58 A;  4FT8 A;  4KIC A;  3D5R C;  4XSX F;  5DYM A;  2CJJ A;  1XC5 A;  3TDU C;  4C2U A;  5L3D A;  3JTG A;  1DP7 P;  4W97 A;  2EH3 A;  4I0A A;  2R93 J;  2DMQ A;  2G7U A;  3DEW A;  3J81 Z;  3NRV A;  2W4S A;  3FZV A;  5FKL A;  2PMZ A;  4FET A;  3LFK A;  2H8R A;  1RUO A;  3SZT A;  1AA7 A;  2R7X A;  1IRZ A;  1RR8 C;  2IEK A;  1GUU A;  2GAU A;  4G7H F;  2P81 A;  4A6D A;  3HJE A;  1U9O A;  2UUZ A;  1JI8 A;  1WJC A;  3OYA A;  1YQA A;  2HQN A;  2DLL A;  4RGX A;  3SFI A;  1ZHF A;  1R6R A;  4XLE A;  2CUJ A;  1MBF A;  1ZN2 A;  5IOY A;  4A3D J;  2EZI A;  2H6B A;  2K9N A;  3R6S A;  2BY3 A;  2IGO A;  2GXA A;  4RAZ A;  1HW1 A;  5IYB J;  1VQ7 I;  4ZYH A;  3QOP A;  3P5J A;  4KYW A;  3WHB A;  2M87 A;  1LFB A;  4Y33 A;  5TRD A;  3VOD A;  3TW7 A;  5HS8 A;  2N8G A;  1QHH D;  1G6N A;  4UUV A;  3ZCO A;  3H9G A;  4XLC A;  1WHU A;  3K4B A;  4A93 J;  2VQG A;  1ON2 A;  3DBR B;  5FKK A;  4PK4 A;  4JX6 A;  2E19 A;  4Z2Y A;  4XIC A;  4U7B A;  5DCM A;  3HRT A;  3C3W A;  5EZH A;  2KMU A;  1FOX A;  2WAE A;  5KHD A;  1VQO I;  1RKW A;  4RA2 A;  2PG4 A;  3CTA A;  4A3L J;  5FGM A;  1D0X A;  4A3K J;  4G6T B;  5KVR A;  1JKP C;  2PN6 A;  3OYJ A;  4O3M A;  4BS9 A;  2LFB A;  5D5U B;  4IQJ A;  2EV6 A;  3BR6 A;  1IDY A;  2RC4 A;  2ZFU A;  2LBF B;  1D0Z A;  2X0L A;  2CFX A;  4XLA A;  5CYV A;  3I56 I;  1F36 A;  4RB0 A;  1NG6 A;  3HHH A;  3R61 A;  4LIT A;  1T6S A;  2EFW A;  3F3X A;  2J5P A;  2XB0 X;  3FXU A;  5ILV A;  4RDU A;  4ZDP A;  1HDD C;  1DU0 A;  2JA5 J;  3B6C A;  1K6Y A;  2UZK A;  2P5K A;  2CQX A;  2VQH A;  2PI0 A;  5DM6 F;  1HF0 A;  3DPU A;  1YJW I;  4PFO A;  1ODD A;  3E6D A;  1GT0 C;  2DO7 A;  2F4M B;  2VBZ A;  4U87 A;  4EM0 B;  3QOD A;  1MSE C;  3I71 A;  3E5U A;  3IH4 A;  1R1V A;  1ETK A;  1JUS A;  3IAM 2;  2PEX A;  2MC4 A;  4ZZD A;  3P7N A;  2CFO A;  1ERD A;  1OR7 A;  4UVC A;  2NS7 A;  4N9H A;  5B1B H;  4PSX A;  5HDN A;  5IYC J;  1I6H J;  2M8E A;  3GTQ J;  2IS1 A;  4E70 A;  2IGN A;  1OLT A;  2A69 F;  1W5S A;  3HEF A;  4HZF A;  4XBF A;  1FOY A;  5LEJ A;  1JUP A;  1Y0U A;  3HC7 A;  4EJO A;  4CZZ A;  1YW8 A;  1ITY A;  1BOA A;  4N9I A;  3VYS B;  3E0J B;  3GW2 A;  3MKW B;  1FOW A;  3PFY A;  4MFD A;  1D3Y A;  4L0Y B;  2FBK A;  2W84 A;  1MND A;  2WB1 A;  3A0H C;  2L4M A;  2QWW A;  4I01 A;  2TDX A;  4QSH A;  4U0Y A;  1IXS B;  1HSJ A;  3ASN H;  2HEO A;  4BGD A;  1LJ9 A;  3EYY A;  3Q3S A;  1UEL B;  1VQ4 I;  3M07 A;  3LNQ A;  2X6Y A;  3EYI A;  3HOT A;  5DD8 A;  4YEL A;  2H1K A;  4HAM A;  4YFN F;  2WB1 N;  2L4A A;  3OOU A;  2DA7 A;  4CO8 A;  3FBI B;  4I6Z A;  3L2R A;  3H3V K;  4IHS A;  2LRE A;  4IXA A;  3BG6 A;  5E18 F;  4MGR A;  3KE2 A;  1TWG J;  4UXN A;  2MBF A;  4LG0 A;  3JSO A;  2V9P A;  4HW0 A;  1MMS A;  3ERE D;  2EV0 A;  2QQB A;  2EFO A;  2XKO A;  1E2X A;  2NNN A;  2NVY J;  3QU3 A;  1EKE A;  3H9J A;  2GBY A;  2MSY A;  1SD5 A;  2A5Y B;  3QYB A;  2ZB9 A;  3M8J A;  3QYF A;  2KIS A;  3E3V A;  4JK1 X;  5E79 C;  3MKY B;  1HDP A;  5M5W J;  5K5R A;  4CGZ A;  1IRG A;  3H3Z A;  1HC8 A;  3AFH A;  3I53 A;  3K4J A;  1MMN A;  2FBH A;  2GQQ A;  2DDB A;  2XAS A;  4K2E A;  4NC7 A;  4P55 A;  4HF0 A;  2ZNZ A;  2L7Z A;  2VBX A;  2HYG D;  4M6X A;  4XKW A;  1QQI A;  4HDV A;  2X4H A;  4HX7 A;  3OYL A;  2QSH X;  4LGW A;  5IYD J;  2RV8 A;  4P96 A;  2IVM A;  1IRX A;  4ANJ A;  2Z3Y A;  4EJV A;  3AG2 H;  3W2W A;  3HBL A;  1RR7 A;  3BR5 A;  5D4S A;  1KGS A;  2CSO A;  2JA6 J;  2PBI A;  3RKY A;  2IGM A;  3S3O A;  4N4O B;  1MBJ A;  2IT0 A;  3DLA A;  4P1W A;  5IT9 Z;  2EZL A;  5C3E J;  2DK8 A;  2Z99 A;  1YO5 C;  2AO9 A;  1QNT A;  2CW8 A;  2V6E A;  5IT9 K;  3H5A A;  4YFX F;  1OR7 C;  1B9M A;  1ETX A;  5ICC A;  5D4R A;  2G9W A;  2E7W A;  4XID A;  2QM3 A;  3ABT A;  2L2O A;  3Q0V A;  1TQM A;  1ZEL A;  4HLX A;  4CZC A;  5ICG A;  2L02 A;  3SDG A;  2CO5 A;  4ZTJ A;  2JA7 J;  2EIN H;  5FRN A;  4GO1 A;  2J5O A;  4JYK A;  3VWB A;  3U1D A;  1M1E B;  3S1N J;  2K02 A;  3RSN A;  5HDK A;  1ZK8 A;  3RJP A;  4CUG A;  2O6G E;  2F2E A;  4KN7 X;  2HOE A;  4CIC A;  3WU2 C;  5E17 F;  1LDK B;  3LSG A;  4HEA 2;  3F6O A;  3ZQG A;  4M74 A;  2V4J C;  3BP8 A;  4LD5 A;  1IN8 A;  1BIB A;  2KLO A;  2L7F P;  2XIG A;  5EF6 A;  3CMM A;  4LB6 B;  3RPQ A;  4HNT A;  2LTP A;  3I0T A;  3GTG J;  3BPV A;  2OCC H;  4BJT A;  5HVQ C;  4GDF A;  4HRI A;  4E7L A;  1EH8 A;  1IZ1 A;  4M3B A;  1Z6R A;  1UJ8 A;  3KZY A;  4LLG F;  5JLX A;  2OU2 A;  1XTA A;  1FBS A;  1P4X A;  3GUD A;  3KLN A;  1U5T C;  4KUM A;  4BUP A;  4X6A J;  2V26 A;  3C2B A;  4AC0 A;  2MH9 A;  2Q8K A;  1JTY A;  2MC3 A;  1LVK A;  3RYR A;  4LJZ F;  1Y56 A;  1EV7 A;  2XHK A;  3C1D A;  3GF2 A;  2KDZ A;  1I6X A;  1I50 J;  4NHJ A;  1HST A;  3IUO A;  4N4N B;  2ZJP F;  3CF5 F;  2EJR A;  1YS7 A;  4M72 A;  2HDW A;  2CRG A;  1O7L A;  3DU5 A;  1R7J A;  2QSG X;  1RES A;  1FBU A;  3EUA A;  3TOA A;  2Y48 A;  3IAS 2;  2BZT A;  1UHM A;  3ISP A;  4WK8 F;  2A68 F;  2FRH A;  3BRO A;  1HOM A;  5GP9 A;  1TWF J;  3JAM K;  3CME I;  2ZKZ A;  3DEU A;  3LOC A;  1MBH A;  2E2H J;  2FA5 A;  1KU7 A;  4BEH A;  3LA3 A;  2KIU A;  1G3Y A;  1UHW A;  2JA2 A;  2R7Q A;  2XB5 A;  2WAQ A;  1R23 A;  4U88 A;  5JVT A;  2E2J J;  4YG2 F;  3S2W A;  4UUS A;  1JT6 A;  1WI3 A;  5K1Y A;  1BW5 A;  3WTT C;  2VE9 A;  3UR3 C;  1JE8 A;  2CV2 A;  1Z3X A;  1V4R A;  2MLG A;  3OYM A;  4IO9 F;  1MBG A;  3DBL B;  1X4P A;  3ZMU A;  2FXA A;  4ZDO A;  4L5E A;  4ZJZ A;  2ADU A;  4QPO A;  3HPH A;  4HF1 A;  1T0F C;  1JGS A;  4S05 A;  2NAZ A;  4E7H A;  3GTK J;  1X1B A;  2L7K A;  5HS9 A;  4OIO F;  4A6E A;  1TT5 B;  4BXX J;  1SFX A;  3EPZ A;  3GXO A;  5H6R A;  3TO7 A;  1LDJ A;  3HG9 A;  1FOK A;  2IPQ X;  2NOJ B;  3D5S C;  2DA6 A;  1FTZ A;  3PSF A;  1X1C A;  5E3N A;  1XGO A;  3CC4 I;  3KP4 A;  2HVQ A;  2M34 A;  2K4B A;  1X4O A;  3RKX A;  1ZRD A;  2L0K A;  1U5T B;  4PGH A;  4BAY A;  5DV5 A;  1AKH B;  3I5U A;  3LSJ A;  4RGU A;  1MJB A;  3MD2 A;  2BEO A;  2OF7 A;  2VJJ A;  2M9H A;  1SAX A;  1H9G A;  2BVL A;  4HQM A;  4V2G A;  1TWA J;  3SEQ A;  2HTS A;  2VKD A;  1B9N A;  3KYD B;  4ESJ A;  5E1W A;  2Q1Z B;  1U8R A;  2ZME C;  3MZY A;  4D7M A;  4EJW A;  3JSP A;  2OAZ A;  1SMT A;  2IJL A;  2VE8 A;  5F0H A;  3ABM H;  1I1G A;  1YX3 A;  1DP3 A;  1OQY A;  1HBX G;  1QU3 A;  2RVC A;  5IP6 A;  1MNM C;  2FMY A;  4D9J A;  4WX9 A;  4B09 A;  1BOB A;  4HYE A;  1WCM J;  2YX4 A;  1FP1 D;  2ZJ2 A;  3RDI A;  2E1O A;  1MSF C;  3TOB A;  4BAC A;  5H2F C;  1A31 A;  3ZR8 X;  3GLL A;  3OS1 A;  3OSG A;  3MVP A;  4IZZ A;  4U7D A;  1U0J A;  5DD4 A;  1KYZ A;  4D5C A;  1Q1H A;  1B72 A;  1TNT A;  3F21 A;  1IJW C;  3HSR A;  2M4G A;  1ON1 A;  3LA7 A;  4XLH A;  3K1M A;  1ZRF A;  5GPC A;  2AHQ A;  1T33 A;  1F1Z A;  5K7Z A;  3BTJ A;  3MZH A;  2CG4 A;  5LFA A;  3F8C A;  3FMR A;  2K40 A;  2Q2E A;  3BTC A;  3ZMD A;  4CCK A;  1PUF A;  1ETY A;  3OYN A;  1VQL I;  3FK6 A;  4BJ6 C;  3K1N A;  2XV4 S;  1X2M A;  3VDX A;  4KFC A;  1S29 A;  2FJ1 A;  4J19 A;  4LMY A;  3ZN1 A;  3WGI A;  4IOA F;  3HRM A;  5LGT A;  4CA0 A;  4F7Z A;  1Z1D A;  1PVE A;  3V8K A;  1GVD A;  2KPM A;  2CW0 F;  3H92 A;  1H88 C;  5TGT A;  3CD6 I;  1WI9 A;  2D1H A;  3WTS C;  1X1P A;  4RAF A;  3GFI A;  4OOI A;  3M1C A;  2KQR A;  2E36 A;  4GFB A;  5ED4 A;  3ZGK A;  2EFP A;  1R5H A;  4Y7N J;  5IPA A;  2XGC A;  3BR0 A;  3H0D A;  2Y0M A;  1ETQ A;  1BJA A;  2M7A A;  2LY1 A;  4OAZ A;  5FKO A;  4C2T A;  3SZP A;  3D5L A;  1JXS A;  2LVS A;  3ERM A;  3LSH A;  5EEG A;  5J6X A;  4XRF A;  2EK5 A;  2R5Z B;  2KZV A;  4ETS A;  4G7O F;  5F64 A;  4IJA A;  3LQR A;  2LRD A;  1X3U A;  2Z1D A;  1ZG1 A;  5FO5 A;  2R7Z J;  1TLH B;  2KP6 A;  1CF7 A;  3ZQF A;  5J40 A;  3CJN A;  5FB2 A;  1I3A A;  4BQQ A;  3NAR A;  3CCM I;  4OWR B;  5CVR A;  2EA4 A;  3ZQQ A;  3OYE A;  3H5R A;  1O3S A;  2R7U A;  4EGZ A;  4DOZ A;  3OYK A;  3R60 A;  3BR2 A;  1BR4 A;  2X6O A;  1D0Y A;  2TRT A;  5L3B A;  1WJF A;  3L2W A;  1YI2 I;  4KT6 A;  3GFM A;  1D1C A;  3TED A;  2I5U A;  1YOV B;  3DXJ F;  1LEA A;  1OCT C;  3I59 A;  1OFC X;  4R8H A;  4B8X A;  2PLY A;  2LY9 A;  2XF5 A;  4B1R A;  4GRI A;  1R4N B;  3RKW A;  2LKP A;  3K4C A;  5KK1 A;  2OPT A;  1D8K A;  2QKM B;  3GFL A;  1V54 H;  2JWT A;  2HQA A;  3T0Y A;  1N78 A;  2OZ6 A;  1K61 A;  3K4M A;  4IL6 C;  3BJA A;  3HOX J;  3TO9 A;  1TNS A;  1K6O A;  1DPR A;  4W1U A;  3SJM A;  2PJR A;  3IWF A;  2MGQ A;  5JVG F;  4XRS G;  1MNE A;  2R7R A;  4LG3 A;  4FAS D;  1B6A A;  4A3F J;  1S9H A;  1KZH A;  2OTJ I;  4IQ4 A;  1FX7 A;  5AIP A;  3TQN A;  2HYF A;  3KP3 A;  1LKX A;  3V42 A;  3HXL A;  2DMP A;  3VSL A;  2F4O B;  4DJA A;  1J7K A;  3F6V A;  3ZQL A;  2DOE A;  1D5Y A;  1Y8Q B;  2Y31 A;  4BHC A;  2LF7 A;  1VQ9 I;  4L9N A;  5BNG A;  1A35 A;  1PUE E;  1E0E A;  2QF7 A;  1P7J A;  1RNL A;  3CF2 A;  3ROU A;  2D1V A;  3OSF A;  1QZZ A;  3DTK A;  1YIT I;  1XCV A;  3RTR A;  4I2O A;  3Q9S A;  1RRJ A;  2JMW A;  4S0H B;  3L09 A;  2E7X A;  1XGS A;  4AUX A;  3CCE I;  5E3L A;  4WXC A;  4HF2 A;  3T8R A;  2IXS A;  2H1L A;  1G3T A;  3BTI A;  2EZH A;  3REO A;  3PNY A;  3EUK L;  2M1B A;  5L3E A;  2DT6 A;  2LY2 A;  5FD6 A;  2XRO A;  3COA C;  3FMQ A;  2L9R A;  1SEU A;  3Q0U A;  2IA0 A;  1IF1 A;  4HBL A;  2NOG A;  2R5Z A;  1W4M A;  3HGG A;  3HGY A;  3B6A A;  3X2Q H;  4L0Z B;  1I27 A;  3E7L A;  2YU3 A;  2FQ4 A;  3BZC A;  2QCO A;  1XB4 A;  5D5W B;  3K4N A;  4P9U A;  3IRQ A;  3TMO A;  3V8J A;  1AWC A;  4IHX A;  1X2N A;  3L9F A;  4XOT A;  5EGO B;  1HW5 A;  2XRN A;  2JT1 A;  2E35 A;  3KLO A;  3WTV C;  1W5T A;  4WCG A;  4EJT A;  5GAE J;  2FE3 A;  1T56 A;  2ZO4 A;  2JK3 A;  3V7S A;  4HOB A;  2HVS A;  1R71 A;  2PMZ N;  3BCA A;  1UAA A;  1Y1V J;  2BHY A;  5CQE A;  1YHQ I;  3S16 J;  2IS6 A;  2EBI A;  2AQE A;  3G73 A;  3F23 A;  3CCL I;  1T0F A;  4HDU A;  1QO0 D;  2IW5 A;  1IW7 F;  4D7N A;  1AHD P;  3LAJ A;  4B48 A;  2R92 J;  3TKY A;  2KIM A;  4ESB A;  4M71 A;  4AIK A;  4H4K C;  1XSV A;  2EIK H;  4IHT A;  1Z7L A;  1LPQ A;  4BQA A;  2EFN A;  1YJ9 I;  2P6S A;  2JVG A;  4X1E A;  3HM5 A;  2VOP A;  3BR3 A;  1E3H A;  4WXD A;  2FQ3 A;  3K69 A;  2IBD A;  4XKB A;  3ECO A;  2XAH A;  3J7A O;  2JVH A;  1I3Q J;  4JX5 A;  1T39 A;  1REP C;  2NVQ J;  3ZMT A;  4PGG A;  5B1A H;  3M8F A;  5D8K B;  4A5N A;  5J1Y A;  1YFH A;  2WV1 A;  5AIQ A;  4OMZ A;  2JUC A;  4J01 A;  3PUF A;  4XOR A;  1FIP A;  3L7W A;  1J2X A;  4ASN A;  1WJE A;  3K70 C;  4A0Y A;  1VQ8 I;  3GCM A;  4B43 A;  2VT3 A;  4XRS A;  1LFU P;  4RB3 C;  3ZPL A;  3KET A;  3FXO A;  4YIF A;  4P9F A;  1WZ2 A;  5CQG A;  4BY7 J;  1T98 A;  4EVI A;  4ENJ A;  2KRF A;  1LE8 A;  2TCT A;  3CCS I;  4L5I A;  2L9V A;  3KCC A;  4ZYG A;  3I55 I;  3AG3 H;  3SDB A;  4BXF A;  4ZTF A;  2LNB A;  3MEX A;  2F5F A;  5JLW A;  5DUI A;  1BIA A;  3I3L A;  3HSF A;  2FU4 A;  4OU0 A;  2VPR A;  1EJ9 A;  1SVL A;  1CF7 B;  3S3M A;  2K7L A;  2JJ7 A;  2HZT A;  1MMD A;  3W6K B;  5JR3 A;  1YJN I;  1XMA A;  4ENK A;  1UG0 A;  4LK1 F;  3ABU A;  2P6T A;  2QUF A;  3QQA A;  1DGW Y;  2K86 A;  3DWL E;  1MW7 A;  2DFE A;  3OWT A;  4A12 A;  1KA8 A;  5HLH A;  2W48 A;  3TP0 A;  1E3O C;  1OPC A;  2OCE A;  4MTD A;  3CUQ C;  3WGG A;  1JJ6 C;  1V5G A;  3SQN A;  4XN3 A;  2ETH A;  4ESF A;  2M30 A;  1G3W A;  2VJI A;  4D0P A;  3RKQ A;  3KEQ A;  3EUH A;  1D1A A;  2NS8 A;  1F5T A;  3I4N J;  4KN4 X;  1UHS A;  2HGC A;  3GLX A;  4D5F A;  5EGO A;  2B63 J;  4BNC A;  1RPW A;  2M2E A;  3ZQ7 A;  2CWE A;  5HOO A;  2QEX I;  3JCU C;  4BYY A;  3ABK H;  3CCY A;  2BOL A;  1IXC A;  1LE8 B;  3QP6 A;  2LF8 A;  4RGR A;  1F9N A;  2CQQ A;  5DM7 F;  2OJE D;  3AL0 B;  2XAG A;  4HSR A;  3IHU A;  5BMZ A;  1R1U A;  2Y30 A;  4OIR F;  4CCM A;  3BPX A;  3FXJ A;  1BW6 A;  3DKX A;  5DS9 A;  1PP8 F;  1VZ0 A;  4FE7 A;  4E7I A;  3HOS A;  5H6Q A;  4NQW B;  2GIZ A;  3I59 B;  4C3H J;  2KJC A;  2GA1 A;  2F5E A;  5KAF C;  2CU7 A;  5JI6 A;  1RZ4 A;  3IKT A;  4OAY A;  5C4J J;  4Y17 A;  1B8I B;  4MIM A;  2FNP A;  3WTU C;  3S15 J;  3E5Q A;  4PJL A;  2QBY A;  5FRO A;  1MD0 A;  2WAQ N;  1IN6 A;  1KU2 A;  1Z6T A;  3E6M A;  4E4H A;  3AKZ A;  4AM3 A;  2DPD A;  4R1H A;  2UV1 A;  3GTO J;  4Z6Y A;  1YRN A;  5J1U A;  5JHF A;  2HKX A;  1IN4 A;  4A0Z A;  2E2I J;  4H0E A;  2R5Y A;  1TBX A;  4QIW N;  5EG0 A;  1FYM A;  1HKT A;  1FC3 A;  4I09 A;  3C2H A;  2QZ8 A;  1FZP B;  3QRF F;  5JHU A;  3GWZ A;  2HFH A;  4RM2 A;  3LST A;  2EV5 A;  1IDZ A;  4KNY A;  1CQT A;  4GCV A;  2M4K A;  2C6Y A;  3E97 A;  2Y75 A;  4OIP F;  2E5N A;  3W2V A;  3LSR A;  2XF6 A;  2BV6 A;  3KZZ A;  3VEP A;  5KCM A;  3CP2 A;  3CCJ I;  2RAE A;  4LFU A;  4B47 A;  1V5F A;  5HS7 A;  1MKM A;  1OCO H;  2D2W A;  4BHP A;  4EV0 A;  4C3J J;  3T1B A;  2KZG A;  4BDZ A;  2BXZ A;  2XAJ A;  1WH5 A;  3CMY A;  1QHG A;  1IUY A;  3BOQ A;  3DTE A;  4BXU A;  2V1N A;  3I58 A;  2VB6 A;  2BYV E;  1JKR C;  4NC8 A;  2P7V B;  1XN7 A;  1U6G A;  5F08 A;  1LNW A;  3G3Z A;  4NBQ A;  2V1U A;  4Q5S F;  4UUT A;  2L3D A;  1DDN A;  2O03 A;  1R4M B;  1O57 A;  1TQP A;  5LHH A;  3HKZ A;  3DQV C;  2F4I A;  1TZL A;  4E7K A;  4CHU A;  4BBR J;  1A04 A;  3K1P A;  5M3F J;  2DN0 A;  2XKP A;  3RI4 A;  4PJN A;  5EG0 B;  2DOD A;  1XD7 A;  2JPB A;  1TW2 A;  4Y15 A;  3CQZ J;  4A3I J;  2V1D A;  5F1R A;  2R7D A;  3EQL F;  3DFG A;  2L9N A;  3BC8 A;  1V3F A;  1BL0 A;  2QGU A;  1DPU A;  2OBP A;  2PMU A;  3GZN B;  1A6Q A;  3HRS A;  4I99 C;  2EWN A;  3V8L A;  4BE0 A;  3BG9 A;  1JKO C;  1QRY A;  2D5V A;  2B9S A;  2F5V A;  5HLT A;  3A01 B;  3M4O J;  3MAJ A;  3A02 A;  3R4K A;  4ABZ A;  3FMS A;  5BOX A;  3C7J A;  2GZW A;  4HA8 A;  1HKS A;  4CCN A;  3HTS B;  3OYI A;  1LQ1 A;  2PFB A;  3A0B C;  5DUK A;  2ELK A;  2RQP A;  1OYI A;  3G1O A;  3ZN0 A;  3GO5 A;  3J7A Y;  2VI6 A;  3HB9 A;  4I76 A;  3QPL A;  2W57 A;  1TWC J;  2VBY A;  3CCQ I;  3BQZ A;  1H8A C;  2W7N A;  1FSH A;  1MZB A;  2LLK A;  3CO6 C;  1TL8 A;  2D45 A;  1ZG5 A;  2Y9Y A;  4PCQ A;  4YIR X;  1SMY F;  3BZK A;  3OL3 A;  2FX0 A;  2WC2 A;  2GM4 A;  2W00 A;  1L3L A;  2VT2 A;  3NWS A;  4FCY A;  2JSP A;  4GYG A;  4M6Y A;  1MGT A;  4IVN A;  4BDY A;  2ACJ A;  3NAU A;  1WWX A;  2CS3 A;  4A5M A;  1VQP I;  1IUF A;  1GLN A;  1X3Z B;  5E3M A;  2X9D A;  3QPS A;  2BXY A;  3PUB A;  4Y52 J;  1OJL A;  1QZE A;  1IG7 A;  1X1D A;  3LMM A;  5BPI A;  4ZYD A;  4IOC F;  2QA4 I;  2WTE A;  5GAG J;  2ECC A;  2DA1 A;  3BCB A;  1U8B A;  1R36 A;  2HOA A;  4RBO A;  1OCR H;  5LHI A;  1TTY A;  1UG2 A;  1GV2 A;  3LFU A;  2E34 A;  2X1C A;  3ELK A;  3F8B A;  5CPR B;  1TWH J;  4ZH4 F;  4PDK A;  2DQR A;  1Z05 A;  5ERI A;  3WOD F;  2VOO A;  2H94 A;  2HU9 A;  1IXR C;  5D6F A;  2DJN A;  2Q2E B;  4XMY A;  2KL4 A;  2XGE A;  1YE9 A;  3GTL J;  3WE3 A;  5TJJ A;  1Z91 A;  5DCM B;  4BL0 B;  4FQG A;  4N0B A;  3T5X A;  1WJB A;  4RM3 A;  2HQ5 A;  2XGD A;  2R4G A;  4OIN F;  2AS5 F;  3VYR B;  2O9L A;  3VSK A;  1BI2 A;  3PNT A;  4FHT A;  2PJP A;  3PIP F;  2HXO A;  1ZGJ A;  2ECB A;  5K5O A;  5J47 A;  3F9K A;  1QZY A;  2A05 A;  1P92 A;  2CV1 A;  2QQA A;  1Y39 A;  4LOC A;  4Y13 A;  2XAU A;  2X1D A;  3M7G A;  1Z3Y A;  2VJ5 A;  1ENH A;  1PJR A;  3BG7 A;  3GEZ A;  4YEJ A;  2BHZ A;  3DU6 A;  3K6G A;  1YLF A;  3CUO A;  3FKJ A;  4KT5 C;  3C2G A;  2WBM A;  4S04 A;  2B7E A;  2Z5U A;  3MN2 A;  5CVV A;  4PJ0 C;  1Z77 A;  4G6D A;  3J7Z I;  2L01 A;  2O5R A;  4CSW A;  3G2B A;  3WU1 B;  3HOU J;  2DAO A;  3W3C A;  5E8G A;  2L5Q A;  2JQ7 A;  2NXN B;  2FOK A;  1SC7 A;  1ZKG A;  1B8I A;  1T95 A;  1RI7 A;  4FX4 A;  1T08 B;  1YS6 A;  1FEX A;  2EZK A;  5FRM A;  4E7J A;  4A0X A;  3PM1 A;  3GTJ J;  4UVA A;  2IAI A;  5EYR A;  1ZR2 A;  4ZYE A;  1UB9 A;  4L9T A;  3TDZ C;  5ILS A;  5LGN A;  4LK0 F;  1MBE A;  3FHZ A;  3F0C A;  2AXT C;  3JTH A;  3FF5 A;  1WRJ A;  2OD5 A;  2LKX A;  1O3Q A;  2DDA A;  5LLQ A;  4ZC3 A;  3JRD A;  2STT A;  3PJR A;  2AXL A;  5TIS C;  4F52 A;  2PQ8 A;  3KZI C;  1EF4 A;  1JHF A;  2V79 A;  5LRR A;  1EA3 A;  4KIF A;  4UVB A;  1EH7 A;  4GXO A;  1QPI A;  5J4V A;  2XSD C;  1G2H A;  1BI3 A;  3O2P E;  3WHC A;  3GX4 X;  2F6C A;  3D1N I;  4RMN A;  2CUF A;  2ESN A;  3F22 A;  3CJR B;  1WJ5 A;  4OMY A;  2A6H F;  1ZYR F;  3I4P A;  3VOE A;  3S1Q J;  3KFW X;  1N25 A;  3PQK A;  3CMA I;  3BQY A;  5C44 J;  4AID A;  4DGW B;  5B66 C;  2LSO A;  3LSK A;  5D6E A;  2M7B A;  4BE1 A;  1KQ8 A;  3PFI A;  5HNH A;  1WPK A;  1IC8 A;  3OYB A;  1KON A;  5LD2 C;  2ELH A;  1JUM A;  1NK2 P;  2Y0S A;  2LH9 A;  4B3A A;  1S7E A;  1J9I A;  3A1Y A;  1IV6 A;  4RS8 A;  3FHN A;  1USS A;  2FUG 2;  4I7H A;  3LQQ A;  2K9M A;  1SFO J;  2BY2 A;  4X0G A;  3U1K A;  1H89 C;  3HL2 A;  4YRV A;  1AOY A;  1GHC A;  1Y1W J;  1N77 A;  5BS6 A;  2O61 A;  3HOY J;  4LIV A;  2OUM A;  4LLN A;  3S32 A;  1Z0X A;  4AYB N;  4MTE A;  4KA4 A;  1T2K A;  1BA5 A;  4DZJ A;  1LFP A;  1XX5 A;  4BEH B;  1TC3 C;  2GOM A;  3H3U A;  1LDD A;  4RAY A;  5FFZ A;  3JRB A;  1P2F A;  4NNJ A;  4EJU A;  2ZBK A;  3MKZ A;  1ZR4 A;  4O5V A;  3Q0W A;  2K27 A;  4XK4 A;  1YRN B;  3LAP A;  2DA4 A;  3FXM A;  1S3J A;  2FOW A;  3BY6 A;  5ICF A;  3WG9 A;  3AG1 H;  2GLO A;  2HDD A;  4XR6 A;  4E6K G;  1UFM A;  4C30 A;  3HOV J;  1U2W A;  1DU6 A;  5F27 A;  2ZXW H;  2ESH A;  4NC6 A;  4HX4 A;  2H27 A;  3FBN B;  5A2Q K;  4ENM A;  3OL4 A;  4DYR A;  2A5W A;  5BQT A;  2Z9O A;  4BBS J;  2MYS A;  3HIF A;  5IY5 H;  4GGG A;  2W1O A;  3RZD J;  2VXZ A;  1FP2 A;  5FLX Z;  1K4S A;  1ETW A;  4HV5 A;  1G4D A;  4HPQ A;  3SEZ A;  2P7C B;  3FK7 A;  1R5G A;  3K70 D;  2NRA C;  3K10 A;  2MLK A;  4MLO A;  3MFK A;  1XGN A;  4AYB A;  2MAB A;  3KP7 A;  1ZG3 A;  5D5X B;  3HOW J;  3S17 J;  2KDO A;  2NYX A;  3QPT A;  4WWC A;  2EA2 A;  2DJI A;  3JRG A;  5K7H A;  1OMI A;  3BG3 A;  2YX7 A;  2KKO A;  2DFH A;  2DA5 A;  3H5N A;  4AU7 A;  2XRL A;  4PSW A;  3GME A;  2BBY A;  2HTJ A;  5L3G A;  1IV8 A;  1OIS A;  2VON A;  3HYI A;  4XN0 A;  4CCL A;  4BJ5 C;  5GAD J;  3IRR A;  3DF8 A;  3F8M A;  3IKV A;  3KEO A;  5E20 A;  1J5Y A;  1MJ9 A;  2EIM H;  1BR2 A;  3OY9 A;  3WTY C;  3CP8 A;  4DYC A;  2XPW A;  3F72 A;  1VQ5 I;  2R7T A;  1IRF A;  2F48 A;  1OYW A;  4A3M J;  1W1W E;  1FT9 A;  1OCP A;  2X48 A;  1N75 A;  1VF9 A;  1ZAO A;  4UV8 A;  3A4C A;  1ULY A;  1VQK I;  3HZJ A;  4L9J A;  1O3T A;  5IP9 J;  3DV8 A;  4KIT B;  3J80 Z;  2O3F A;  1DGR M;  3DKW A;  4M9X A;  1HXD A;  5A2Q Z;  1TW3 A;  3DPT A;  4BHB A;  3S14 J;  2OV7 A;  2DQL A;  1TQI A;  4M3E A;  5CLS A;  1AU7 A;  2R7S A;  3BT9 A;  5EDN A;  3H0G J;  2A61 A;  1BBY A;  1WJA A;  1ACI A;  3CZ6 A;  3DTI A;  2EIL H;  4XL9 A;  5KNL A;  3G4S I;  4EEF G;  1SVO A;  2Z2S B;  3IH3 A;  5E1X A;  5FFX A;  1YYV A;  4MQV A;  1MMA A;  3CJT B;  3EET A;  2CGP A;  3DP7 A;  4ZZL A;  1BR1 A;  1QVU A;  2HNH A;  3BWG A;  3L2Q A;  2JSC A;  3AAF A;  3O8G A;  4HLY A;  1P9Q C;  4IRI A;  3QPH A;  1HKQ A;  2M45 A;  5LHG A;  2DFI A;  2Z16 A;  3CES A;  2ZJQ F;  5DEQ A;  2XF7 A;  1HW2 A;  1XDS A;  3PNV A;  1SFU A;  2VC1 A;  1AKH A;  5GAH J;  3S1M J;  2W25 A;  2VL8 A;  2OZU A;  3I64 A;  3TBI A;  3WTZ A;  4E7S A;  2QVO A;  3IWZ A;  5EEA A;  5IOZ A;  1NG7 A;  2WY7 Q;  4XQF A;  2LP0 A;  4IEJ A;  3GTP J;  1P6R A;  5IP7 J;  4KIS A;  3LWF A;  4ZDL A;  2EPF A;  5F6F A;  1K4T A;  2HXI A;  3DCF A;  4IHW A;  4A3G J;  3QWL A;  2VKV A;  4EM2 A;  2RGV A;  2HQR A;  4IRG A;  4II2 A;  3TO6 A;  4LG0 B;  2KT0 A;  4Y4R A;  5E3O A;  3RPU A;  2KJB A;  3TW6 A;  1OYY A;  4TV7 A;  3U9G A;  2RQQ A;  2WV0 A;  4A3B J;  4G9Y A;  4EQQ A;  2ME6 A;  5F1J A;  2H09 A;  3OR2 C;  1DQU A;  5FD5 A;  3I54 A;  3A01 A;  1U9N A;  2X1E A;  2WWY A;  1JT0 A;  1J0R A;  3RCO A;  3W6J B;  5LRS A;  4DYQ A;  1E3P A;  3OIQ A;  5CKT A;  1D1B A;  1ETO A;  1VQN I;  3CLQ A;  2WY8 Q;  2P4W A;  1HA8 A;  2IP2 A;  3RQ4 A;  3H1C A;  4JOM A;  1Z21 A;  3MMY B;  1YTY A;  4IF4 A;  4ITV A;  2ZSI B;  4YII A;  1HCR A;  3B73 A;  2R7W A;  2YSR A;  3VPR A;  3P9C A;  5HNF A;  2IS4 A;  4HNV A;  3Q9V A;  1XPX A;  2DFF A;  2P5V A;  2P5L C;  2XGX A;  4B4C A;  1K78 B;  2K9S A;  4DBR A;  1VND A;  1W36 C;  4HST A;  4LIU A;  3C18 A;  2WA0 A;  1X3W B;  3M1E A;  2MH2 A;  1S7O A;  3JRH A;  5J3L A;  2RDP A;  4EGY A;  1S8N A;  1XCB A;  4NB5 A;  4ON0 A;  1LB2 A;  3VB2 A;  4F91 B;  1SAU A;  1PP7 U;  3PO3 J;  4DQ2 A;  4XOP A;  5EJC A;  1U5T A;  2K9Q A;  3PL8 A;  2O0Y A;  4CYC B;  2DTZ A;  2VBW A;  1QA6 A;  1NH3 A;  3GTM J;  2A6E F;  1D8J A;  3CUQ B;  3IC7 A;  5EEH A;  2HOS A;  3WTW C;  2H8W A;  3L2V A;  1W7P D;  1ZTR A;  2V7F A;  4JX4 A;  4F55 A;  2M0M A;  4B3X A;  4U0V A;  1K78 A;  3ZQI A;  2R7V A;  2NNY A;  2VLA A;  1L0O C;  2ICW G;  4HX8 A;  3HPG A;  2PJR B;  1RET A;  2LDU A;  5J4Y A;  1K79 A;  2G0E A;  4M3G A;  4C9Y A;  2CQK A;  2XSJ C;  4RLQ A;  3R0J A;  4DIQ A;  3OS2 A;  5FKN A;  3VYT B;  1ZLK A;  2QQ8 A;  2GIV A;  2VIX A;  4IRH A;  1G59 A;  4DZP A;  1B59 A;  3JRC A;  3H9Q A;  2Y9Z A;  1KQ9 A;  3KIO A;  3MCZ A;  2XPV A;  3E1S A;  3TL4 X;  4Q47 A;  3CUQ A;  3JW4 A;  3U21 A;  4DW6 A;  1PDN C;  1P7I A;  3MZ8 A;  2Z33 A;  2Y2Z A;  1JHH A;  2KRC A;  5K7F A;  3WE2 A;  1KU9 A;  4M9S A;  1EH6 A;  4G94 A;  3PO2 J;  1W36 D;  4EMS A;  4UUS B;  2CMP A;  5E8I A;  2OQR A;  2DOA A;  1WGX A;  4WF2 A;  3K2A A;  3RPU D;  1MBK A;  1ZAR A;  2KHM A;  2DBB A;  2JRT A;  3CLO A;  4EM1 A;  2A3S A;  5LEK A;  3FXR A;  3CCR I;  2X6X A;  3GZ6 A;  3ZMZ A;  3DBH B;  4XNF A;  4AIJ A;  4A3E J;  4IHV A;  1VI0 A;  1XG1 A;  2V1X A;  2X85 A;  3KEY A;  2ID6 A;  2VXD A;  3FWE A;  4CH7 A;  3KX2 A;  3ULQ B;  1R22 A;  3U2R A;  3B02 A;  3S1R J;  3GZ5 A;  1JTX A;  2DW4 A;  4A3J J;  1SAN A;  2BY1 A;  1Z9C A;  4BKX A;  1ZQ3 P;  5HLG A;  2LYC A;  2ZME A;  2BGC A;  3F8F A;  1XS9 A;  2HR3 A;  2ZJR F;  5LGU A;  2V9K A;  2AQF A;  2B0L A;  2QLZ A;  3T8T A;  5K5Q A;  3S3N A;  4RLF A;  2GA2 A;  3DEE A;  3Q5F A;  3RQI A;  5J1R A;  2K9L A;  4G6Q A;  3LSP A;  1QGP A;  1CGP A;  1OKR A;  3JRA A;  2ZCW A;  1YIO A;  2ZXH A;  4RB1 A;  2XC7 A;  3KYL A;  1S6L A;  2LOO A;  1ZRE A;  1FMV A;  1X58 A;  4CYC A;  1VQ6 I;  3SHF A;  2COM A;  1R1T A;  2W85 A;  4AIH A;  4D1Q A;  3LSI A;  1DUX C;  3JRF A;  2VKE A;  2CUE A;  2DOF A;  4JQF A;  3EDP A;  1FPQ A;  2FF4 A;  2QBY B;  2VJ4 A;  3ML6 A;  4BQO A;  2DCE A;  4U0W A;  1W0U A;  3G6E I;  4IPA A;  3IL2 A;  2JTV A;  3BR1 A;  4I02 A;  4HNU A;  3V7R A;  1VQM I;  1MH3 A;  4LB5 A;  2XPU A;  4WXH A;  3OYH A;  2Q0O A;  4CYD A;  3N97 A;  1PUF B;  2F5D A;  3E5X A;  3FDY A;  4F3Q A;  1U78 A;  2HS5 A;  3O3K A;  3I4M J;  1YIJ I;  2EQR A;  1FYL A;  4CCJ A;  1ZH5 A;  2MFZ A;  5HOD A;  1C0W A;  2BVM A;  4L5J A;  3CCU I;  1I1S A;  4MHG A;  3DPL C;  3E6B A;  4BE2 A;  3QU6 A;  2HWV A;  3OR1 C;  2CV0 A;  2JUG A;  3ZMV A;  2RNJ A;  3AG4 H;  2FBI A;  1B72 B;  2FD5 A;  2ISZ A;  1TT0 A;  2HPI A;  3BJO A;  5ILU A;  1ONV A;  3AL0 C;  2K5C A;  3GFJ A;  3QOE A;  1R00 A;  3FX3 A;  1J59 A;  1VFC A;  4KDP A;  1RC9 A;  1IN7 A;  4RB2 C;  5C4X J;  1W7P B;  2DK5 A;  2E1M C;  4GYI A;  3J7Y J;  1WKM A;  3M3Y J;  2LR8 A;  1S5L C;  3HDD A;  3VFZ A;  1GDT A;  3V7C A;  1FYK A;  2DI3 A;  4M6V A;  2GXG A;  4UV9 A;  3K4K A;  1I39 A;  2BW3 B;  2YU9 J;  5CJ9 A;  4Y3O A;  5CVI A;  3ZXS A;  5M5X J;  4M9Z A;  4KJZ A;  1A36 A;  2IS2 A;  5L3C A;  3K0L A;  2OQG A;  3FXQ A;  3LL7 A;  1B1B A;  1YW9 A;  1POG A;  3RYP A;  3ECH A;  3M8E A;  5FLM J;  3PSI A;  4L18 B;  4HQE A;  3S2D J;  2VOD A;  2M0C A;  5DDG A;  3FM3 A;  4FE4 A;  1U3E M;  2VQL A;  3MWM A;  3EUH C;  5KAI C;  3H36 A;  2KRH A;  2HYJ A;  2O8X A;  4MO7 A;  3SFZ A;  4G8X A;  3JR9 A;  4PJJ A;  5FKM A;  5D8L B;  4NUB A;  4C3I J;  2CH0 A;  2ZNY A;  3LA2 A;  1MDM B;  5F0C A;  1V55 H;  2YS9 A;  2HI3 A;  2HKO A;  1JKQ C;  2NS0 A;  3WGH A;  3BJ6 A;  1X19 A;  2R3S A;  5CVU A;  1HLV A;  3I9V 2;  3OIP A;  4PZJ A;  4F92 B;  9ANT A;  3G71 I;  1RUN A;  1Y6I A;  5GPA A;  1V5E A;  4Q4Z F;  2VUM J;  3KYC B;  2DPU A;  2JZY A;  2XAQ A;  2P8T A;  2R7O A;  2QEN A;  2WAD A;  5AON A;  3CDH A;  3QAH A;  1FJL A;  3FM5 A;  3G1M A;  3UNG C;  2NVT J;  2ZC2 A;  1FBQ A;  2STW A;  3BG5 A;  3DKY A;  1G3S A;  2QSF X;  1K7A A;  4UHT A;  2ZXJ A; 
#chains in the Genus database with same CATH homology
 3OS0 A;  4J01 A;  2A6T A;  3QYF A;  2ZXI A;  2E1M B;  3FBN B;  4XOR A;  3OL4 A;  2ELJ A;  3MKY B;  2A5W A;  1WJE A;  3K70 C;  2CUZ A;  2MYS A;  4ZYA A;  3AFH A;  4B43 A;  3K4J A;  3H35 A;  1MMN A;  2W1O A;  2VXZ A;  4XM3 A;  4NC7 A;  4E7Z A;  4HPQ A;  3SEZ A;  3S8P A;  3K70 D;  3K10 A;  4XKW A;  5CQG A;  4MLO A;  1SFK A;  1WJD A;  4AYB A;  2MAB A;  3OYL A;  4ZTF A;  2KDO A;  3SDB A;  4BXF A;  2CW7 A;  2K3P A;  2DJI A;  1IRX A;  3I3L A;  4ANJ A;  3W2W A;  2E5Z A;  2ZSH B;  3H5N A;  4AU7 A;  2IGM A;  3S3O A;  4CCO A;  3N05 A;  4N4O B;  3S3M A;  4PSW A;  3DLA A;  4P1W A;  1MMD A;  2CW8 A;  2V6E A;  1UG0 A;  3H5A A;  4XN0 A;  4CCL A;  4BJ5 C;  1OR7 C;  1DGW Y;  3DWL E;  2QKL B;  1MW7 A;  3OWT A;  1BR2 A;  3OY9 A;  2L2O A;  3CP8 A;  1ZEL A;  4CZC A;  2R7T A;  4PFP A;  1V5G A;  4XN3 A;  4ZTJ A;  5FRN A;  3BLY A;  1N75 A;  3VWB A;  2VJI A;  3RSN A;  4XKC A;  4CUG A;  3A4C A;  1D1A A;  1LDK B;  3LSG A;  4HEA 2;  4KIT B;  3L2U A;  1DGR M;  4J00 A;  5HOO A;  3DPT A;  2V4J C;  2OV7 A;  3NWT A;  2BOL A;  2KLO A;  3CMM A;  4HNT A;  3AL0 B;  5HVQ C;  4HSR A;  4BJT A;  2R7S A;  4HRI A;  4CCM A;  4E7L A;  3OYF A;  4DBQ A;  3DKX A;  1WJA A;  1VZ0 A;  3CZ6 A;  4E7I A;  3DTI A;  3HOS A;  4NQW B;  4BUP A;  4XL9 A;  5KNL A;  2V26 A;  2Z2S B;  1LVK A;  1MMA A;  1Y56 A;  2LC2 A;  1BR1 A;  2HNH A;  3L2Q A;  4OAY A;  3IUO A;  2M3A A;  1P9Q C;  4N4N B;  3OYD A;  2RNG A;  2HDW A;  3HUG B;  2Z16 A;  4PJL A;  3CES A;  5FRO A;  3DU5 A;  2XF7 A;  3PNV A;  4AVZ A;  3EUA A;  3IAS 2;  4E4H A;  3GBG A;  3AKZ A;  4XKV A;  4BU2 A;  1FMW A;  2VL8 A;  3ONQ A;  3TBI A;  2UV1 A;  4E7S A;  5JHF A;  4IX7 A;  1NG7 A;  2WY7 Q;  3LSM A;  4XQF A;  4BEH A;  4XON A;  2VPL A;  2JA2 A;  2R7Q A;  4KIS A;  2WAQ A;  4ZDL A;  3C2H A;  4RM2 A;  2HZD A;  4II2 A;  2HVR A;  2M4K A;  3UR3 C;  2E5N A;  3W2V A;  2BW3 A;  1Z3X A;  4Y4R A;  3OYM A;  2WAF A;  2XF6 A;  2CV2 A;  5KCM A;  3CP2 A;  1X4P A;  3OMY A;  4B47 A;  4ZDO A;  4ZJZ A;  1V5F A;  2RQQ A;  4BQN A;  4QPO A;  2L9S A;  3HPH A;  1WFX A;  1T0F C;  4E7H A;  3OR2 C;  1DQU A;  2HPM A;  1X1B A;  2L7K A;  4BDZ A;  2X1E A;  2X51 A;  2VQC A;  3RCO A;  2LBF A;  1QHG A;  1G8X A;  2E60 A;  3DTE A;  3EPZ A;  2V1N A;  2VB6 A;  3HG9 A;  3OIQ A;  1YX5 A;  2NOJ B;  3D5S C;  4NC8 A;  4P5O A;  1D1B A;  5CKT A;  2RRE A;  3S93 A;  3PSF A;  1X1C A;  2WY8 Q;  2HVQ A;  1X4O A;  1HA8 A;  3RQ4 A;  4EAT A;  4JOM A;  1Z21 A;  3MMY B;  3SZG A;  3VYU B;  3HKZ A;  3DQV C;  2X6W A;  3IP4 B;  4ITV A;  2F4I A;  1TZL A;  2ZSI B;  3MD2 A;  2VJJ A;  2R7W A;  4E7K A;  2BVL A;  3SEQ A;  5HNF A;  2IS4 A;  2DT7 B;  2VKD A;  4PJN A;  2Q1Z B;  4DBR A;  1W36 C;  2OC6 A;  4HST A;  4LIU A;  2MD0 A;  2WA0 A;  2L9N A;  3BC8 A;  1MMG A;  4PUS A;  2DXI A;  2W82 A;  1YX3 A;  1DP3 A;  1QU3 A;  4F91 B;  4D9J A;  4BE0 A;  1SAU A;  1BOB A;  2F5V A;  4XOP A;  5HLT A;  4F93 B;  3PL8 A;  1PYV A;  3CJQ B;  3ZRG A;  3OYC A;  2LG4 A;  4BAC A;  3ZR8 X;  4CCN A;  2V7F A;  3L2V A;  4F55 A;  3OYI A;  3OS1 A;  3K4L A;  4HG2 A;  2M0M A;  1X1A A;  4B3X A;  4IZZ A;  2R7V A;  1U0J A;  4XLF A;  2VLA A;  3J7A Y;  3HPG A;  2PJR B;  2VAS A;  3QYE A;  2M4G A;  4II3 A;  2XSJ C;  4C9Y A;  4IKF A;  4RLQ A;  4DIQ A;  4XLH A;  3OS2 A;  3VYT B;  3W2A A;  2VIX A;  2W7N A;  1G59 A;  1J09 A;  3H9Q A;  4PJM A;  3TL4 X;  2P0W A;  3E1S A;  4CCK A;  5LFA A;  3U21 A;  3OYN A;  3OL3 A;  4BJ6 C;  2W00 A;  3NWS A;  4R79 A;  3VDX A;  2UWM A;  2JSP A;  2KRC A;  4BDY A;  1W36 D;  2CS3 A;  2CMP A;  4CA0 A;  1GLN A;  2DOA A;  2KPM A;  3SYT A;  5TGT A;  3PUB A;  4QPQ A;  1X1D A;  3RPU D;  3LMM A;  3A2K A;  2XDV A;  3BCB A;  2KHM A;  3M1C A;  2KQR A;  3ZGK A;  2I8D A;  2X6X A;  2IGK A;  2VKH A;  3H0D A;  2GOX B;  4XNF A;  2M7A A;  4OAZ A;  2LY1 A;  4C2T A;  2X85 A;  3D5L A;  3LFU A;  3LSH A;  2X1C A;  3KEY A;  2VXD A;  5CPR B;  4B44 A;  4CH7 A;  3KX2 A;  2KZV A;  3OYG A;  2HU9 A;  3D5R C;  2Q2E B;  4XMY A;  2KL4 A;  1YE9 A;  2LRD A;  2Z1D A;  4C2U A;  2KP6 A;  4BL0 B;  4BQQ A;  2LYC A;  1WJB A;  2W4S A;  4RM3 A;  2PMZ A;  4FET A;  2R4G A;  4OWR B;  3VYR B;  2V9K A;  2AQF A;  3ZQQ A;  3VSK A;  3H5R A;  3OYE A;  2R7U A;  1AA7 A;  3PNT A;  4DOZ A;  2R7X A;  3OYK A;  3S3N A;  1BR4 A;  1D0Y A;  3L2W A;  1WJF A;  2UUZ A;  4RLF A;  1JI8 A;  1WJC A;  3DEE A;  3F9K A;  3OYA A;  4KT6 A;  1D1C A;  1R6R A;  4XLE A;  2K9L A;  2CV1 A;  2CUJ A;  2XAU A;  2X1D A;  1Z3Y A;  2VJ5 A;  1PJR A;  2ZXH A;  3BG7 A;  2XC7 A;  2LOO A;  4YEJ A;  3KYL A;  1FMV A;  3DU6 A;  3K6G A;  2IGO A;  2XF5 A;  3FKJ A;  4GRI A;  3C2G A;  2WBM A;  4D1Q A;  3K4C A;  3LSI A;  2QKM B;  2HQA A;  4JQF A;  1N78 A;  3K4M A;  4Y33 A;  2VJ4 A;  2O5R A;  4CSW A;  3G2B A;  4BQO A;  3W3C A;  1QHH D;  3ZCO A;  3H9G A;  4XLC A;  2PJR A;  2DCE A;  2L5Q A;  3K4B A;  2VQG A;  1T95 A;  1MNE A;  2R7R A;  4LG3 A;  4PK4 A;  4FAS D;  4U7B A;  4HNU A;  1S9H A;  2KMU A;  4IQ4 A;  2WAE A;  5KHD A;  1LKX A;  3V42 A;  3OYH A;  4E7J A;  5FRM A;  1D0X A;  3HXL A;  4G6T B;  4F3Q A;  3VSL A;  3FDY A;  3OYJ A;  4BS9 A;  4DJA A;  4IQJ A;  4CCJ A;  2MFZ A;  2ZFU A;  2LBF B;  1D0Z A;  2BVM A;  4XLA A;  4ZC3 A;  3DPL C;  1NG6 A;  1E0E A;  4BE2 A;  3CF2 A;  4LIT A;  3PJR A;  3OR1 C;  3DTK A;  4F52 A;  2CV0 A;  3RTR A;  2JUG A;  1EA3 A;  1TT0 A;  2HPI A;  4ZDP A;  1K6Y A;  3AL0 C;  2K5C A;  2VQH A;  3QOE A;  2F6C A;  4RMN A;  3CJR B;  1WJ5 A;  3DPU A;  2E1M C;  4PFO A;  2IXS A;  4U87 A;  3QOD A;  3PNY A;  3EUK L;  4DGW B;  2DT6 A;  3IAM 2;  2LY2 A;  3LSK A;  2MC4 A;  2M7B A;  4BE1 A;  2CFO A;  1ERD A;  3K4K A;  2BW3 B;  5HNH A;  4Y3O A;  4PSX A;  3ZXS A;  3OYB A;  1KON A;  4KJZ A;  5LD2 C;  2IS1 A;  2IS2 A;  2Y0S A;  2IGN A;  1OLT A;  2LH9 A;  3A1Y A;  3LL7 A;  3FHN A;  3HC7 A;  2FUG 2;  3K4N A;  2K9M A;  3PSI A;  3TMO A;  4X0G A;  3VYS B;  3E0J B;  4XOT A;  3HL2 A;  3MKW B;  4YRV A;  2VQL A;  3PFY A;  3EUH C;  2KRH A;  1N77 A;  1MND A;  2WB1 A;  4LIV A;  2HVS A;  3BCA A;  1UAA A;  4PJJ A;  5CQE A;  2OUM A;  3S32 A;  4NUB A;  4BGD A;  2CH0 A;  1UEL B;  2IS6 A;  2AQE A;  2X6Y A;  3HOT A;  1LFP A;  4BEH B;  1X19 A;  2GOM A;  4YEL A;  3I9V 2;  3OIP A;  4F92 B;  4B48 A;  3OOU A;  4NNJ A;  1Y6I A;  3FBI B;  4H4K C;  3L2R A;  1Z7L A;  3MKZ A;  1V5E A;  2LRE A;  2JVG A;  3BG6 A;  4XKB A;  2R7O A;  2JVH A;  2WAD A;  4XR6 A;  4E6K G;  4C30 A;  3UNG C;  3H9J A;  3DKY A;  3QYB A;  3M8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...