1WJEA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
total genus 12
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjeA00
1E0EA 1WJEA 1WJDA 1MW7A 1KONA 1WJBA 1WJFA 4F3QA 1WJCA 1LFPA 1K6YA 3HPHA 1WJAA 3HPGA 3F9KA
chains in the Genus database with same CATH superfamily
3CLQA 1FBSA 4UHTA 2A6HF 3KIOA 1VQPI 5FLVA 4CH7A 4A3LJ 2QKMB 2X1DA 1WH5A 2FBIA 2R5ZB 4U7DA 2DO7A 2HDCA 1R58A 1BR1A 3WG9A 3F0CA 1YLFA 5FFXA 5IT9Z 3WTSC 2PMUA 2LLKA 4XSZF 1S5LC 2NS8A 2QENA 3JAMK 1CF7A 1IZ1A 4ESJA 2W85A 4FT8A 1QU3A 2CU7A 3GLLA 2VI6A 1ZRDA 2D1HA 4HLXA 2FF4A 3H5NA 2DW4A 1B1BA 2KJBA 4C2TA 2VKHA 4A3EJ 1B9MA 1XTAA 3BJ6A 1KQ0A 3FXRA 2Z16A 1UG0A 3BTJA 2MC3A 4A0YA 5CVIA 2MABA 2RKHA 1D0XA 4RB1A 2CRGA 5FKOA 3FXQA 1BIBA 2LKXA 3G1LA 3HUGB 4XRSA 4UUSB 1GXQA 4EMSA 2Y30A 3DWLE 2R7SA 1W7PB 3I54A 3S2HJ 2XGDA 4RB0A 3IKVA 1T2KA 4HF1A 4IHSA 5FRMA 1R9TJ 2VE8A 4EM2A 4I0BA 2DBBA 1P92A 5FO5A 1XSXA 3CF2A 2QZ8A 1CGPA 3DTKA 1QA6A 3PNYA 2PI0A 3KEQA 5L3EA 1U5TB 3GFIA 3C2HA 3SHFA 2HNHA 2QYOA 2OBPA 2JUGA 5B1BH 3K1MA 3ERMA 4LITA 2CW7A 3AKZA 2G9WA 4GXOA 2HWVA 3KPHA 2PG4A 1T8IA 3FM3A 3CDLA 3QYFA 2XROA 1GT0C 2OAZA 3HJEA 3SZGA 3GTQJ 4CZCA 1U3EM 2M3AA 1IUYA 2I8DA 1S3JA 1USSA 4MTEA 4BGDA 2FQ4A 2EA2A 2XKOA 3DPUA 2P81A 3VSLA 1FY7A 1JUMA 2EFWA 2ECCA 1R36A 2A05A 3LA2A 3HYIA 4FX0A 3DTIA 3CCEI 4DJAA 1QQIA 2KIFA 2QF7A 5M5WJ 2L5QA 3EUHC 4L0ZB 1V54H 5M5XJ 3GEZA 3GCMA 3L9FA 1KU9A 4M3EA 2ZNYA 3DLAA 4DYCA 2O3FA 3ZR8X 5J4VA 5IYCJ 3HOVJ 5J6XA 2N8GA 3LSIA 2G0EA 4RB2C 2DA6A 1YYVA 5ILUA 2VN2A 2HKXA 2HOAA 4BQQA 4A3KJ 1IN6A 4BQNA 1AU7A 4GGGA 2ID3A 4GFBA 2OF7A 2EWNA 3IL2A 2JSPA 2HGCA 4HNUA 3MKLA 2YPRA 3CZ6A 3JTHA 4BXXJ 1YX5A 4XLHA 2Z5UA 3TMOA 5J47A 2K5CA 4L5EA 3L2CA 3LQQA 1IXCA 3CUQB 3K4CA 4D0PA 2CGPA 2Y0SA 1YS7A 1SVOA 4MEYF 3H9QA 1IC8A 2FMLA 5ILVA 1OR7C 1I39A 4G12A 3RKXA 2KQRA 2O8KA 2Q1ZB 1Z7UA 1RKWA 3DCFA 1MMGA 1W1WE 5LHIA 2ELJA 3PFYA 4EQQA 5GPAA 1DPRA 3A2KA 1SD5A 3I64A 3FK6A 2P7VB 3AAFA 5B66C 4XN0A 4RGXA 3QQAA 2JK3A 2Y69H 3M4OJ 2F48A 2FNPA 1VQLI 3WTWC 3RQ4A 2HEOA 1JT6A 4A69C 1X2MA 2MSYA 3T5XA 3VYSB 4B1RA 4ZYHA 2BVLA 4AU7A 2TDXA 3KP7A 1LKXA 1GXPA 2PX9A 3HOYJ 4AM3A 4PJ0C 2WV0A 4AIJA 2VC0A 2DA1A 2R7XA 4HX4A 2XB0X 2DT7B 2XPVA 4I99C 4C2MJ 2NVTJ 5BQTA 3KETA 5F64A 3M9AA 2BXZA 2QKLB 1BN5A 1MIJA 4M71A 2LF7A 3I55I 5E8IA 4F91B 5K7HA 1G3SA 1RR8C 2LKSA 4XICA 2GLOA 4EJTA 5FKMA 5LRSA 3ONQA 3J81K 1WKMA 3HG9A 2DAOA 3HPGA 2DMNA 4CCKA 2HOTA 2XV4S 2IRFG 1MBEA 4UVAA 1D5VA 2E1CA 3AG3H 4Y15A 1HF0A 1D3YA 2XIGA 2V79A 5J8CA 1TLHB 2ELKA 2KIMA 4Y7NJ 5K7ZA 1VTNC 1BW5A 3D5LA 1J09A 4RGRA 4YFXF 1JT0A 3J7ZI 2VONA 3S3MA 2DOFA 1QPMA 2K9SA 3IV5A 3OIQA 4HRIA 4P96A 3WTVC 1FWZA 1D8KA 4MO7A 4AD9A 3LSJA 5HOOA 3CP2A 4GRIA 3FXJA 2R7VA 1FP2A 3F22A 1V5GA 1N75A 2GXGA 4BY7J 1WVRA 4FX4A 1ZREA 5FD5A 2I10A 3AG1H 2KP6A 2DFFA 4EJWA 1TL8A 3HDDA 4IRHA 3E6BA 2HQRA 2KDOA 2VBXA 2LDUA 2H6CA 3PQKA 4XKBA 2FMYA 2IS1A 1JGSA 2WC2A 4PDKA 1G8XA 2V26A 4A6EA 2M8EA 2ZXIA 3CCQI 1IV6A 4ITVA 2R5ZA 2M34A 4M6VA 3JSOA 1HKQA 2GIZA 2NRAC 3C18A 3PSIA 4K2EA 4BACA 1L0OC 4HBLA 1S7AA 3ZPLA 3FMSA 3OOPA 4PK4A 5D5VB 2DQLA 4A3BJ 2W7NA 1BR4A 1MD0A 1F5TA 4OAZA 2M45A 1OKRA 2DU9A 2L9NA 4S04A 3S3OA 2DMPA 1YRNB 5J3LA 1EH8A 5LEJA 4LLGF 5GTIC 5LEKA 2RQPA 5DDGA 1ETQA 3K2AA 3BC8A 2E5NA 2QLZA 3CMMA 1T6SA 2ZKZA 4CCNA 4WWCA 1E0EA 3CCYA 3WTXC 1VQ7I 2ZMEB 3FHZA 2VPRA 1FBUA 1MH3A 4IO9F 1VQ5I 2L9RA 2HQNA 1FSEA 1JKPC 4M72A 3OIOA 3ZN1A 1I5ZA 4AC0A 3MKWB 1G3TA 2LNBA 1ETVA 5CJ9A 5FGMA 4HDUA 1QGPA 2NNYA 2ZJQF 5L3DA 2HU9A 3BG3A 3WGGA 3DLLF 3V8KA 3L2VA 3HOXJ 4CCOA 4A3CJ 3AL0C 4IVNA 2CQNA 5EYRA 4EJUA 3ISPA 1IN5A 1XGMA 1GDTA 2HYGD 4II3A 1KONA 2BHYA 3IWZA 3FBNB 4XLFA 1FMWA 2CUJA 1VZ0A 3C3WA 3HM5A 3BTLA 4AVZA 1OYIA 2E71A 4XIDA 1LFBA 1Y0UA 3VB2A 3ZQFA 2OJED 1G6NA 2P5KA 3H5RA 5HODA 4E7HA 5KK1A 3L2UA 3E6CC 3AG4H 3EUAA 5FFZA 2NS0A 2CW0F 3LAPA 5HVQC 3JRHA 1OCPA 4AWXB 2JZYA 3RSNA 4DQ2A 1H0MA 1MSEC 3OR1C 3MAJA 2IAIA 3I4NJ 2DDBA 5E1WA 2LYCA 3EQLF 2FBHA 2MLKA 4DGWB 1B4AA 1QRYA 3RZDJ 1ZRCA 4XR6A 2K9QA 3F8NA 3DXJF 4OWRB 2RVCA 5K5OA 2RV8A 2DI3A 2L4MA 4YFNF 1LNWA 1CF7B 1I3AA 4J00A 1IJWC 2M1BA 5E3LA 3C1DA 2O9LA 2CG4A 2OQGA 1P6RA 4OOIA 1Y6IA 4JOMA 1FMVA 2IGKA 4B48A 5FLXZ 2RDPA 2DA7A 3HSRA 4KT6A 3V7SA 3SJMA 1X3ZB 2PN6A 5EZHA 4AUXA 2HOSA 2XGCA 1OCRH 3BTIA 1I27A 1S29A 5CQEA 3LSRA 2V6EA 3COAC 2VOPA 3CUQA 3QP5A 2FU4A 1TWHJ 3A0HC 3D5RC 3HHGA 3KEOA 5ED4A 1Q1HA 1WH7A 4NUBA 3ZMSA 2MFZA 1JHHA 4EV0A 4DNCA 2H6BA 4KT5C 2Z99A 3BR3A 4HQMA 4BAYA 4XRMA 3IHUA 1VQNI 2NOGA 3BQYA 2ELHA 1ZARA 2QM3A 4RM3A 4BJ6C 3CMYA 4WX9A 4QSHA 2FEZA 1QNTA 3HRTA 4IRGA 1ZGAA 4JYKA 3CD6I 3FZVA 2XB5A 1SC7A 2VBZA 2E7XA 2CUEA 1ZKGA 2F6CA 3WTTC 3OOUA 1I1GA 3F6VA 1ORKA 4B44A 5DS9A 3HSFA 1TWAJ 1HSTA 4F52A 5CVRA 1G59A 4ZTJA 1O3TA 1OJLA 1ZTRA 2FSWA 4KNYA 3HOWJ 3PUBA 4UUVA 3K2ZA 4XOTA 4BJ5C 2PQ8A 3KYLA 2OU2A 1EH6A 1FJLA 4KIGA 3G1OA 3FWEA 3IC7A 4OMZA 4JP0A 4YELA 1KQ8A 4CYCA 2H27A 1NH3A 1JKRC 1HDPA 2EZKA 4CUGA 1LVAA 1ZR2A 1YW9A 4S05A 4C3JJ 3BY6A 1BOBA 2NVUB 1TQPA 2K9MA 5CVVA 3R6SA 2ICWG 4L5JA 2EIKH 3DP7A 2DCEA 3CESA 1REPC 1FTZA 2COMA 2DN0A 1UFMA 2LP0A 5A2QK 2CV2A 1JE8A 3ULQB 4BQAA 4C3IJ 3I58A 3E5UA 2MD0A 3PNTA 1GV2A 4IHWA 4Y33A 2AO9A 3LQRA 4ZYAA 3OS1A 1IG7A 2BZTA 1MGTA 2JUCA 4G7ZF 1Z7LA 3P9CA 4AIHA 4U88A 3CMAI 3M8EA 3OYLA 5D4SA 3RKQA 5LGUA 4EVIA 4CHUA 1SMYF 2HPIA 4ETSA 1X19A 4JX5A 3I4MJ 4PJLA 2B9SA 4MFDA 1KYWA 3JR9A 5IP9J 2MH9A 2OTJI 4CA0A 2O5RA 2YUSA 2CFXA 1RETA 2KDZA 1W36D 3JW4A 3OY9A 4OIPF 2XUBA 2STWA 2VJ4A 1IN8A 4Q48A 4M74A 2E1MC 2KLOA 2R7WA 4O5VA 3TO6A 2A61A 4RA2A 2GXAA 3L1PA 3BG5A 5M3MJ 2VBYA 4UXNA 2UUZA 3TW7A 1MBHA 3L2RA 3NWTA 3ESWB 4CZZA 2M9HA 1K79A 1MZBA 5LBQA 2X6WA 2YS9A 2WADA 1LDKB 1OYWA 3FK7A 1GUUA 1MBKA 3ZMUA 4BBSJ 1TTYA 3E3VA 2H8WA 1R71A 3GVAA 4BS9A 1T39A 2K9LA 4Y4RA 4ZYDA 4EGZA 3MD2A 2DODA 4OMYA 2F5DA 1FOKA 2PFBA 2ZFUA 1F1ZA 2XF6A 3M1EA 3VYTB 5LD2C 3GYHX 2MLGA 5JVGF 3VPRA 5KAIC 2W00A 3BDDA 1WSUA 4KITB 3I4PA 4XLNF 3V7RA 4X6AJ 4LGWA 3RPUA 2JA6J 1TWGJ 2ZBKA 2DFHA 3FKJA 4RGUA 1KU2A 4BQOA 4IPAA 5F1JA 3H3VK 3SXYA 5GAEJ 2WWYA 1Y1WJ 4PGHA 1SEUA 1IRXA 4DZPA 3GTKJ 1BA5A 2XASA 4BYYA 4XORA 3GTLJ 4XQFA 2RREA 3BZCA 3OYHA 1H9TA 5JI6A 3TO7A 1STZA 4M6YA 1QZEA 3BG9A 3P5JA 1TQMA 1WJBA 3KYCB 1JKQC 2A6EF 2HOEA 4UV8A 3ERED 2W24A 3KP5A 4A2UA 1XC5A 4CCJA 1IXRC 1GVJA 4GCVA 4HSRA 4QWQA 4RS8A 4Y17A 4HLYA 1KGSA 2QQ9A 1POGA 5JHUA 1R00A 1ZK8A 3BP8A 3QPLA 4PJNA 1SVMA 4PFOA 4BXFA 1K4SA 1RRJA 3QWLA 3WTYC 2OZUA 4A0ZA 3D1NI 1D5YA 1RESA 4RBOA 2KL4A 3CDHA 1UHSA 5C4JJ 1VQMI 2E35A 3CCLI 1X3UA 4W97A 2PMZA 3O6BB 4ZZDA 1A36A 1MMAA 2CS3A 5ICGA 2VODA 2E1NA 2JPBA 5CVJA 1HW1A 3BWGA 4CCLA 3CC4I 2XDVA 4IX7A 3BZ6A 1HCRA 3HBLA 3OIPA 4KDPA 2E19A 2A07F 2ZSIB 1UB9A 3LMMA 4WK8F 1VQ8I 3KLNA 3FISA 5ICCA 3WG7H 4I2OA 2M5WA 3GWZA 3GTGJ 2VB6A 1D0ZA 2GWRA 1BI0A 3DPLC 4XLCA 2R7ZJ 1R22A 3Q0UA 2GIVA 2M2EA 5IYBJ 2RC4A 3PL8A 3KX2A 4LG3A 3G73A 4HQEA 4II2A 2V9KA 3K7AJ 3GF2A 3J80Z 1TQIA 3MCZA 2HQAA 3W6JB 3N05A 3OYMA 4ENJA 1HKTA 2LY1A 3GTJJ 2VT3A 2XRNA 2NYXA 5AIQA 3L2QA 4OINF 3LFUA 2C6YA 1X1AA 5FLXK 3HL2A 1X1CA 3AL0B 1Z91A 4MLOA 1Z77A 1OCTC 2DFEA 2DXIA 2KJCA 1BOAA 2VJ5A 2WY8Q 2GZWA 2XSJC 2HR3A 4ON0A 2JA7J 5E1XA 5DUKA 1ETKA 4OIRF 3UNGC 2VXDA 3JRFA 1EJ9A 2EA4A 3WTZA 1XCBA 4GO1A 2CMPA 3QPHA 2FOWA 3JRCA 2GBYA 3HGYA 4XKVA 1P4AA 3KEYA 2VIXA 4XK4A 2JWTA 3K6GA 3FDYA 3OYAA 3U9GA 3W6KB 1SFKA 2QBYA 4HF2A 1AA7A 1SAXA 4A3DJ 5HDGA 4FHTA 2ZCWA 3N97A 2M87A 2P6TA 2X85A 3OL3A 3WU0A 4DOZA 2E5ZA 1YITI 1LVKA 2OUMA 4E4HA 3JRAA 1BBYA 1ZQ3P 2CQKA 2M4GA 2W4SA 3T0YA 3BCBA 3EUHA 4FETA 3JRIA 2VXZA 2OCEA 4HV5A 2XAGA 5DCMB 2EK5A 4G8XA 4AVPA 2A5YB 2XVCA 3IWFA 4XONA 2BGCA 4C30A 3ZOBA 1ZLJA 1PYVA 4J19A 1O3QA 3BR6A 3SZPA 2DMQA 2FX0A 2ME6A 2L3DA 1XDSA 2MH2A 2KMUA 4G7OF 4BDYA 1S7EA 1UAAA 3RIRA 2GAUA 4U0VA 3F8FA 1RNLA 4M3FA 4BY1J 4W1UA 1WPKA 1TNSA 2LRDA 4XMYA 4C3HJ 2HI3A 5KVRA 3ZP5A 4RLFA 2NOJB 4P1WA 1U9OA 3EUKL 1G2HA 2E7WA 3MQ0A 1AKHB 3VODA 3DKYA 1F36A 1JTYA 3ZQIA 1FPQA 2DK5A 1YX3A 2DT6A 2LY2A 2JA8J 2XF5A 2K4BA 5K7FA 1P7JA 1OR7A 4QIWN 2V4JC 1XN7A 3EYIA 3F23A 2BW3A 4P5OA 1WFXA 1FIAA 2R5YA 3B02A 1U8BA 2RNJA 2BBYA 3HRMA 3QOPA 1VFCA 5EZGA 2HVSA 3LA7A 2DOEA 4PJJA 2CFOA 2OZ6A 2DJNA 1M1EB 1FC3A 2FJ1A 3HIFA 3HC7A 1PUFB 2PJRA 3CO6C 3Q3SA 1H89C 2ETHA 2MGQA 5BPIA 4LOCA 2J5PA 2WY7Q 3TO9A 2DDAA 4BHBA 3ZGKA 1GLNA 2EFOA 4G94A 2CO5A 3ABLH 1MKMA 1WZ2A 3H36A 3SDGA 1PP7U 2W84A 1S8NA 1J9IA 3VEPA 1J7KA 1YQAA 2DLLA 5HLHA 3WE3A 3TP0A 2EQRA 3D5SC 1JGGA 5HS9A 1ITYA 3NEUA 1IW7F 3FIWA 2DMTA 1Q1VA 1XSVA 3TDZC 3CO7C 3L7WA 2JRTA 2WBMA 1ZLKA 5GADJ 2FA5A 2ZXHA 3BTCA 4WXCA 4A0XA 2K85A 2R7DA 5FKLA 3T1BA 4CYCB 2B63J 1E17A 1OMIA 2OD5A 3QOEA 1HC8A 5LHGA 3E5QA 3MMYB 4MIMA 3CCVI 4BDZA 2WAQA 4IQ4A 5E1ZB 2Y75A 4BL0B 1RI7A 1ETXA 3O8HA 1R49A 3KZIC 3G2BA 3BOQA 1F9NA 3L00A 5B5EC 1K61A 2H1LA 1T98A 2JMWA 4OIQF 1ON1A 2EFNA 3E5XA 1J5YA 2ESHA 1TT5B 2XRLA 3T8RA 4G6TB 1MNDA 3O8GA 2RGVA 3TOBA 2VOOA 3QRFF 3IH4A 2NNNA 1YIJI 2VUMJ 2EZHA 1ULYA 1YW7A 5CVUA 1JXSA 4D7MA 5DM6F 3OSGA 1R6RA 4LG0A 5FLMJ 1W5CC 1IUFA 2VPLA 3OYGA 1N77A 3DFGA 3K1PA 5J8FA 1NG7A 3H92A 4N4NB 2Q8KA 2E2JJ 2LTPA 3X2QH 1HDDC 3GMEA 2Y31A 5HS8A 1X3WB 4P9UA 1WJFA 2K9NA 5HNHA 5CPRB 5D6FA 4ZH4F 4I0AA 2E1MB 3FM5A 3DBLB 1JUPA 1O7FA 3PM1A 1T38A 5LGTA 2LOOA 4M3GA 1MJAA 1MH4A 3QPTA 1IV8A 3G3ZA 2XAHA 4XN3A 2Q0OA 5FRNA 2IA1A 4I76A 4YRVA 1XD7A 1ZHFA 5TGTA 4HG2A 4LB5A 4XLEA 3I71A 2IEKA 4NC6A 2VQCA 3OV8A 1A6QA 4MNUA 4XRSG 4U0WA 1XPXA 3RTRA 2P7CB 4UB6C 1U0JA 2QWWA 4NDLA 4QLCU 2ZO4A 1TW2A 5J4YA 2J5OA 4F93B 4A3MJ 3CLOA 5DEQA 3IH2A 1L3LA 2VQLA 2EZIA 4MFEA 2FUG2 2BV6A 2F4IA 3MVPA 1R5ID 4HZFA 1WRJA 5IT9K 3PFIA 2R7RA 1D8JA 2FXAA 2K27A 5L3CA 4KMUX 1XX5A 2CYYA 2X6OA 2H1KA 3VSKA 4BKXA 2QUFA 3ASNH 2AHQA 4PJMA 4BE0A 2ZC2A 1BR2A 1RR7A 4IOCF 1SVLA 4M9SA 2G7HA 3S8PA 2ISZA 2XPWA 2V1XA 5E3NA 3KE2A 4N4OB 2KZVA 1IXSB 3J80K 1W7PD 3IRRA 2YSRA 1U78A 1A35A 4A5MA 5HDNA 3GLXA 2HZTA 3KZYA 5K1YA 2ZJ2A 4IXAA 2GM4A 2GA1A 4E7IA 4QTRA 3GTOJ 5M5YJ 1XGSA 2M7AA 1CQTA 2B7EA 1D1AA 1ERDA 1WGXA 2XSDC 4KN4X 3S2DJ 4I6ZA 1HBXG 2EV6A 1NK2P 3BG6A 4XNFA 1P4XA 5F6FA 1PUEE 2BEOA 3W2WA 4HF0A 2AS5F 3FXUA 1MMDA 3KP3A 3V8JA 2IGOA 3FF5A 2JA5J 2W1OA 3S93A 3H0GJ 2D1VA 2VBWA 4N9HA 1T33A 1E2XA 1B8IB 4KUMA 1MNEA 2XF7A 1WJEA 2DJIA 1W4MA 2RNGA 2JVHA 2LG4A 5J1YA 3K0LA 4MTDA 4FTHA 5KHDA 2ADUA 1EA3A 1MJ9A 3WU2C 3GZ6A 2K02A 2OCCH 2E36A 5DCMA 4UY8I 1U5TC 2HXIA 1Z21A 2XPUA 5KCMA 1PDNC 1Y56A 4WCGA 3ABTA 4FQGA 3ZQCA 2D5VA 3LSPA 4HNVA 3B6AA 1GV5A 4HPQA 3K4LA 3TGNA 3DF8A 3I53A 1S9HA 1TW3A 4I02A 4EGYA 3HHHA 1ZGWA 4R79A 2GA2A 2R3SA 3TBIA 1TZLA 2Z3YA 2EV0A 3RCOA 2QQAA 2K4JA 4B43A 1RIOH 1V3FA 2JN6A 4ENMA 3ZQ7A 2V6CA 4PZJA 4I01A 4L9VA 4ABZA 1T56A 3IAS2 3HKZA 2DA5A 4G6QA 1IN4A 1AKHA 2L4AA 1ACIA 2P8TA 1S6LA 2JQ7A 5E8GA 1JTXA 1IDYA 3I56I 2ZXWH 3NRVA 4XL9A 3BLYA 2JTVA 1Y8RB 3G71I 3ABUA 2HPMA 1B9NA 4RM2A 4U87A 3KP2A 2PMZN 1O3RA 2DPDA 3SFZA 3K4NA 3FXOA 1FLIA 4JX4A 4C9YA 4KIFA 3IP4B 3S1MJ 1W5SA 3HZJA 1PUFA 2O6GE 1DPUA 4L5IA 2V9PA 1BL0A 1TP4A 1QHHD 2LBFA 3SZTA 3M07A 4RB3C 1VF9A 3F9KA 1XS9A 2O0YA 5JLXA 2QCOA 1RUOA 2A5WA 5AIPA 1ZG1A 1N25A 2DTZA 3LNQA 2QBYB 4HAMA 3J7AO 2IA0A 5K5QA 3E97A 2AXLA 2FOKA 1Z6TA 2JT1A 4X0GA 3I3LA 3M8JA 5KAFC 1FOYA 3LWFA 2LMDA 3DU6A 4PFPA 2A69F 2IS4A 2DYRH 2BVMA 4BE2A 1ZYRF 2DOAA 2KHMA 1KA8A 3DEWA 2XAFA 3ML6A 5HDKA 2YU9J 4D9JA 1ZH5A 4XLAA 4NQWB 1LFPA 5EEHA 2M8GX 5E3OA 3S17J 4LB6B 4M3DA 2BE5F 4IHXA 4D7NA 2EZLA 2L01A 3HOSA 4KYWA 1XG1A 4I7HA 1XSDA 4FASD 1APLC 4E6KG 3K4JA 3CCSI 3ASOH 1BJAA 3G1MA 1YTYA 4YIIA 2GOXB 2VJJA 3OYNA 3PO2J 2K40A 4HNTA 1O57A 2X51A 1PVEA 2E2HJ 3U1KA 1XGOA 1A04A 1E3OC 1LE8A 3KLOA 3GZNB 5TRDA 1WJ5A 1RKTA 5DD4A 2OPTA 5GTHC 2F2EA 2X6YA 1Z3XA 1IN7A 2RN7A 2WB1A 4N9IA 4FE4A 2KRCA 1TWCJ 2R92J 1OCZH 4MQVA 1D1CA 3BR0A 4Y3OA 2A3SA 4NB5A 5EG0B 3S3NA 1SD7A 2TRTA 1ONVA 2BW3B 2GOMA 3ZCOA 5JHFA 2R5YB 3W3CA 1SFUA 1G3WA 4F55A 3BR5A 1GHCA 5J40A 1HW5A 1QPIA 2IXSA 4LMYA 4PSXA 1JUSA 1R1VA 1NTCA 2DK8A 4HX8A 2PJRB 1QZZA 1XMKA 2IW5A 3A02A 3L09A 4ZYEA 2VKEA 3I5UA 3GFMA 1BC8C 1LQ1A 2E1OA 2EIJH 2OC6A 5KNLA 1YJNI 2VLAA 2R4GA 3SQNA 3ZMVA 1G3YA 4A93J 1UZCA 1V5FA 3DKWA 1U2WA 3OS2A 1X4OA 3CJNA 2ZSHB 1VQ6I 1B59A 4Y52J 1IRGA 4RAZA 2X4HA 4GYGA 1IGNA 4G7HF 1U8RA 3HOUJ 2YX7A 3QAHA 2IBDA 2CH0A 2UXXA 5F0CA 2LY9A 6PAXA 5EGOA 5BOXA 4CICA 4F92B 1VQOI 2DA2A 2KIUA 3JSPA 4M73A 4DW6A 2VKVA 5AONA 4A5NA 1MBFA 1J0RA 1OQYA 1LB2A 1OYYA 2CQXA 1YS6A 4IL6C 1UMQA 4XLPF 1W36C 4FE7A 2RAEA 2HTSA 1TWFJ 2Y48A 3IH3A 2WAEA 3I0TA 1B72A 9ANTA 1SANA 2XC7A 1A5JA 3F3XA 1AOYA 4ZDOA 5DTDA 1WWXA 1Z1DA 2NXNB 3KP6A 1R5HA 2BYVE 2IVMA 2P0WA 1LFUP 1XMXA 3K1NA 4HW0A 5H2FC 3W2AA 3CTAA 4HDVA 3CCRI 1ZG5A 1K83J 4FISA 3RPUD 2OTLI 2ZFWA 3FHNA 2M0MA 1R5GA 2MW8A 1TNTA 4YEJA 5GAGJ 5HLIA 1K6YA 4B47A 2L7ZA 4UVCA 3WTUC 1O4XA 2ZXJA 2ZMEC 4BEHB 3LSKA 2LF8A 4RAGA 4BNCA 3M3YJ 2LC2A 4LG0B 4UB8C 4IF4A 3SFIA 4NNJA 4WXDA 4ZDPA 2DT5A 1HLVA 3ABKH 4RDUA 5C3EJ 3HXLA 2Z9OA 2EV5A 3MZ8A 1B8IA 1HQCA 1WCMJ 1LDJA 4H4KC 4C2UA 1J2XA 2UV1A 4N0BA 2BOLA 3RKWA 3CJQB 3NQOA 2BY2A 3WODF 5B1AH 4YG2F 2KKOA 1DQUA 3HPHA 5C44J 1DGWY 2R7OA 1DU0A 4ZJZA 1QO0D 4AIDA 5IYDJ 1IF1A 3W2VA 4CDGA 2WAQN 3GTPJ 3OYBA 3OMYA 5LLQA 3RYPA 1F4KA 5F08A 3IAM2 3OYFA 1X58A 3I59A 2YX4A 5F27A 4D5FA 3P9IA 2V1NA 4LLNA 1Y39A 4IRIA 3LSGA 3FMQA 1I6XA 1ZRFA 3Q9VA 1R1TA 1Z67A 2L7KA 1EF4A 3GFJA 4HSTA 3TDUC 1YIOA 2F4OB 3OYKA 2VJIA 3H3ZA 4HX7A 4WXHA 3Q0VA 2HKOA 3F21A 2MC4A 3NARA 1D1BA 3GUDA 1V4RA 3MEXA 5HLGA 1JJ8C 3R0JA 2V9VA 5HNFA 2FE3A 3CCUI 5IOZA 5IP7J 1IDZA 2L7FP 3HRSA 3MN2A 4KIBA 1BIAA 5D8KB 4B4CA 4IZZA 3K69A 3SEQA 5HS7A 4JK1X 5GAHJ 3BPXA 1S7OA 3LL7A 5K5RA 4M6XA 5CLSA 2HTJA 2KT0A 3L2WA 2EB7A 4A12A 3BQZA 3ZQLA 1P2FA 4HA8A 5TISC 2JJ7A 2NVQJ 1QVUA 4HEA2 1KZHA 3MFKA 5LHHA 4O3MA 3CP8A 2DYSH 3IKTA 5DUIA 1UG2A 2CJJA 2KFDA 4CXFA 5HLTA 3O2PE 1HW2A 2MA3A 2IJLA 2HYJA 2W57A 3QYEA 2R0QC 1QHGA 1ODDA 4UV9A 1OLTA 2MD5A 4NQWA 4AIKA 5DYMA 4ENKA 1SAUA 2Y9ZA 3R0AA 3TQNA 3GZ5A 1LEBA 1H88C 2F5FA 4A3IJ 4L9JA 3RZOJ 2MG4A 1VNDA 3GX4X 4BE1A 2AQEA 2MBFA 4E70A 1FTTA 3CC2I 2G7UA 3F72A 3Q9SA 5D6EA 4CSWA 2MYSA 1LPQA 2R7TA 4QPOA 1YO5C 3FXMA 4EM0B 2LR8A 4EATA 2Q2EA 2XAUA 5B3SH 3LA3A 3Q0WA 2O8XA 5JVTA 1E3PA 1ZAOA 1Z9CA 1FZPB 3IRQA 5E3MA 3DTEA 1IRFA 1A31A 3K70D 1FNNA 3CDIA 2IPQX 5E18F 1VQ9I 3R60A 3DV8A 1Y8QB 2E2IJ 4D1QA 2UXNA 1HXDA 3M7GA 2VL8A 3OYCA 1SMTA 2VT2A 3MWMA 2COBA 5EG0A 1T95A 1DUXC 1R7JA 2ESNA 2FQ3A 2STTA 1I3QJ 2NAZA 1IAWA 4TV7A 2W25A 4ZTFA 2JPCA 1QVTA 5ILSA 1FYLA 1DP7P 4NHJA 4V2FA 3G6EI 5IPAA 2CV0A 4DYRA 3DQVC 3H35A 2FBKA 2H94A 2GXBA 3EDPA 1ENHA 2NS7A 1WQ2A 2LBFB 2KISA 3K70C 1K78B 1OFCX 4ESBA 1MBGA 2Z2SB 3OWTA 1ON2A 4Q4ZF 3GW2A 2O61A 1O7LA 2XAJA 1XCVA 2K3PA 1LUJB 3MKZA 4ZDLA 3DEUA 2DA3A 2Y2ZA 3MZYA 2CQQA 1K6OA 3N4MA 1Z6RA 2QSFX 4AYBA 2DQRA 1S72I 3A1YA 3HKZN 3U1DA 3A01A 4A3GJ 3HOZJ 1C0WA 5D5XB 2EPFA 3CQZJ 5BPDA 1XB4A 1V5EA 5ICFA 3HOTA 3IUOA 1LJ9A 3M1CA 1KQ9A 1FYKA 3VWBA 3WE2A 3EETA 2ME0A 3AFHA 5ERIA 2L0KA 2L7MP 1U9NA 1X1DA 3P7NA 5H6RA 4U7BA 4ZC3A 3TL4X 1JKOC 1P4WA 3H0DA 2B0LA 3QP6A 1AWCA 5J1UA 2HVQA 3K9TA 4IEJA 4DYQA 1MJBA 4IKFA 2QSHX 4LFUA 1W0TA 3A4CA 3QU6A 5CYVA 3V42A 2K7LA 2E60A 3ECHA 3CUOA 3E7LA 3H9GA 1LE8B 3VYRB 3S14J 4OIOF 4P55A 2A68F 2NVYJ 3LSHA 5A2QZ 1BI1A 1XDUA 4YIRX 2AQFA 2KZGA 3RI4A 4A6DA 3EPZA 4BEHA 3CC7I 3R61A 4UNOA 4NC8A 1YI2I 2PBIA 1H8AC 2P6SA 4G6DA 1BI2A 1OCOH 4UUTA 3JCUC 1HOMA 4LLLA 3QPSA 4P9FA 5L3FA 1N78A 1WI3A 2CWEA 3GBGA 5D5UB 1H9GA 1RPWA 3K4KA 2P5LC 1ETOA 2KRFA 2BXYA 4G9YA 1W5TA 2BHZA 1FIPA 3KFWX 4L9NA 2YR2A 2JVGA 1R4MB 4LD5A 2EILH 4HV6A 5FD6A 3H3UA 1VQKI 3C2GA 3S1RJ 1PJRA 3S1NJ 3ZQGA 1BW6A 2LD5A 5FROA 1FT9A 3BZKA 3H9JA 4LK1F 4IHTA 4QPQA 1E3HA 2CV1A 2D2WA 3HSEA 5JLWA 4KFCA 2WV1A 3Q5FA 1YG2A 4PSWA 2IGMA 4XOPA 4IHVA 2LK2A 3TW6A 4L18B 3MKYB 3BT9A 2JA2A 5EGOB 3HTSB 3ZXSA 1FX7A 3S1QJ 2CQ7A 1G4DA 1T0FA 5IT3A 2WTEA 3FBIB 4EJOA 1SD4A 4GYIA 2KIQA 2WB1N 4JQFA 4EM1A 5C4XJ 3OYJA 5E79C 4KA4A 2X1CA 1DU6A 1UHMA 3E6DA 1T0FC 1B72B 3SEZA 2BY0A 2M4KA 3F8MA 3ZQHA 3RDIA 2M0CA 2WAFA 3V4GA 1DDNA 2HDWA 2Z33A 1X2NA 2R7FA 1RC9A 2RQQA 2DTRA 2Y0MA 4F7ZA 4XRFA 5H20A 5E20A 3H5AA 4J01A 1YW8A 3LOCA 4L9TA 3QODA 4IJAA 2L9SA 4B09A 3PUFA 1MMNA 5EJCA 3FXKA 1FOWA 1WJCA 5CQGA 3HUGA 3KP4A 1MNMC 4I98B 4UUSA 5IP6A 1W7PA 5FB2A 2VQHA 5LRRA 3TP3A 2VC1A 3JRGA 5E17F 5F0FA 4UVBA 1YHQI 4KISA 3O3KA 1KU3A 4XKCA 1IO2A 1LEAA 2EH3A 3BJAA 3HRUA 4DIQA 1U5TA 2L54A 1MDMB 3JTGA 4RAYA 3W6VA 5LGNA 4V2GA 1UCRA 5BNGA 4FCYA 3BR2A 3U2RA 4LK0F 2CSOA 4RGSA 3VOEA 2AXTC 5EEAA 3HGGA 2QGUA 4H0EA 2P4WA 2GQQA 1FOXA 3F8BA 2I5UA 3DPTA 3TEDA 2ID6A 4Z6YA 3VYUB 1TC3C 3BCAA 1JHFA 1EV7A 3JREA 4DBQA 4BBRJ 3RKYA 1Z0XA 3I59B 2XAQA 2YU3A 4ESFA 3CJRB 1B6AA 3B6CA 2WA0A 2FNAA 2XKPA 1TBXA 1YJ9I 4E7JA 4RAFA 3JAMZ 3WHBA 5GPCA 4PCQA 2FRHA 4U0YA 2F5VA 4KN7X 5IY5H 3ZRGA 2HVRA 2V1UA 3S2WA 4L0YB 3OYIA 4DBRA 3E0JB 2QEXI 4BU2A 2DMUA 4A3FJ 5DCFA 2VKDA 4ZYGA 3WGIA 1DP3A 2ECBA 4IOAF 2JRMA 4I09A 2HYFA 4V19K 2KRHA 4BUPA 2XHKA 2PJPA 1X1PA 4MGRA 1SFXA 2Z1DA 3CF5F 5JFRA 4Z2YA 2L02A 2BY3A 3RJPA 3WU1B 2IS2A 2M7BA 1OPCA 3VFZA 3J7AY 2HZDA 1VI0A 1X4PA 2IA2A 1RZ4A 4LIVA 1UELB 3OR2C 3CCMI 4F3QA 1D0YA 3RYRA 2F5EA 1JJ6C 2EIMH 2ZJRF 4XBFA 3ZN0A 1YJWI 1O3SA 1YOVB 2CUFA 1K78A 4XM3A 2ZB9A 2IS6A 3KZZA 2R7UA 1MBJA 1R1UA 1WJDA 3OL4A 4B8XA 5IOYA 4D5CA 4WF2A 3GFLA 1SFOJ 5FKKA 2Y9YA 2O03A 3LSMA 4LIUA 3NAUA 1TT0A 3CUQC 1IRZA 1BM9A 5ICEA 3GTMJ 3FXLA 3T8TA 1I1SA 4E7SA 3KYDB 4HYEA 4HOBA 3REOA 3DKXA 4B3XA 3MZHA 1HKSA 3D0SA 1FYMA 5FJ8J 2EFQA 3RPQA 3KCCA 2UWMA 1SFEA 4KJZA 1EH7A 5EEGA 4JX6A 5FKNA 1HA8A 3TKYA 3ZQQA 5BMZA 3PQJA 4GDFA 5DM7F 1FSHA 3C2BA 2LFBA 2A6TA 3E6MA 4NC7A 4CYDA 3OYEA 4M9XA 1BC7C 1RUNA 3FX3A 3LAJA 1R4NB 1WJAA 3S15J 3EYYA 1OCCH 3RQIA 3ZMZA 3PIOF 1UHWA 3K4BA 4CO8A 1W0UA 1QBJA 2CW8A 1MMSA 3C7JA 3BG7A 2TCTA 4IHYA 2Q2EB 1FBQA 3J7YJ 2HQ5A 2DPUA 4ASNA 3WHCA 5F1RA 1ETWA 1J59A 1EKEA 3LFKA 4ENNA 2QQ8A 4BXUA 2FD5A 3P9KA 4O6JA 5CKTA 1KU7A 3UKGA 2HDDA 5F0HA 1T08B 1KYZA 1MW7A 4E7ZA 4KICA 4YFKF 3DU5A 2L9VA 1VQ4I 1YFHA 2X0LA 3LSTA 3UR3C 3CJTB 5D8LB 2L2OA 4EJVA 3G4SI 4Q47A 3V8LA 1NK3P 4XSXF 2F5CA 5M3FJ 2EFPA 2EINH 2O7OA 2ZJPF 3GO5A 2PEXA 3NWSA 5GP9A 5F04A 1JI8A 2R93J 1XGNA 3A0BC 4BHCA 2IT0A 2HS5A 2X6XA 3E1SA 3HEFA 2OA4A 1WI9A 1ZN2A 1YE9A 2W82A 2X1EA 2BY1A 1ZG3A 3V7CA 1LDDA 1Y1VJ 3WGHA 1P9QC 3ABMH 4ANJA 2HFHA 4LJZF 3DBRB 1BJZA 4ZZLA 1K4TA 2IGNA 4BH9A 3BROA 4OU0A 1UJ8A 2QA4I 2R7QA 3B73A 2LKPA 3BJOA 2QSGX 5DD8A 2D45A 1Z05A 5JR3A 4CGZA 2ISYA 3A01B 3HTUA 3ROUA 2F4MB 4CCMA 3CMEI 5D5WB 3I9V2 1NG6A 3F6OA 3PIPF 1K7AA 4RMNA 5TJJA 1SD6A 4R8HA 2OQRA 3SYTA 3F8CA 1GVDA 2LREA 3VDXA 2K3FA 5BS6A 3HB9A 5LFAA 4Q5SF 3K4MA 3DEEA 2NVXJ 2V1DA 4PGGA 1ZR4A 4MEXF 2QVOA 2ZNZA 4M9ZA 3H1CA 4M3BA 1XMAA 3BR1A 1FP1D 4E7LA 2H09A 3ELKA 3GXOA 1BI3A 1YRNA 2VE9A 2LSOA 1WHUA 3TOAA 3R4KA 2HXOA 3PSFA 1DGRM 2EJRA 3DBHB 3A03A 2DFIA 1I50J 5H6QA 3J81Z 5L3GA 4JBAA 4YIFA 5EF6A 1Z3YA 2ZMEA 3ZMTA 2X48A 3QYBA 4B3AA 4EEFG 2EBIA 2Y0SN 1ZELA 3FKIJ 2LH9A 2XGEA 1F43A 2OV7A 2H8RA 3K10A 3AG2H 1OISA 4E7KA 2VASA 5L3BA 1QZYA 2XGXA 3ECOA 2ACJA 1Y0NA 3PNVA 2DA4A 1AHDP 4AYBN 3PO3J 3QU3A 3S16J 3M8FA 4X1EA 4BHPA 1ETYA 2V7FA 3SDBA 2PLYA 3PJRA 4Y13A 3FMRA 1PP8F 1NHAA 4DZJA 1MSFC 1P7IA 1MDMA 2QQBA 4A3JJ 2LVSA 3JRBA 2KPMA 1A6IA 4S0HB 5DV5A 2P5VA 1I6HJ 1R23A 3JRDA 4MHGA 3U21A 1U6GA 2X9DA 3OSFA 1HSJA 2IP2A 3S32A 1X1BA 4IQJA 4MQ9F 4PUSA 3BPVA 1J75A 2UZKA 2PMHA 5EDNA 2JSCA 2M30A 1FEXA 2E34A 4RLQA 5D4RA 2CUZA 4OAYA 1USTA 4BJTA 3CCJI 3OYDA 4XKWA 2K86A 2VQGA 1V55H 3ZMDA 1ZGJA 4KMFA 3OS0A 4NBQA 4R1HA 2W48A 5J1RA
chains in the Genus database with same CATH topology
3MKZA 2K3PA 1BOBA 4ZDLA 2M7AA 4CH7A 2K9MA 1ERDA 1D1AA 2QKMB 2X1DA 2DCEA 3CESA 4AYBA 1BR1A 3BG6A 4XNFA 2CV2A 3A1YA 3W2WA 2MD0A 3PNTA 1MMDA 4Y33A 3OS1A 2IGOA 4ZYAA 2W1OA 3S93A 1V5EA 1QU3A 3HOTA 1Z7LA 3IUOA 3H5NA 3M1CA 1MNEA 3VWBA 2XF7A 1WJEA 3OYLA 2DJIA 3AFHA 2RNGA 2JVHA 1X1DA 4C2TA 2LG4A 2VKHA 4U7BA 5KHDA 4ZC3A 1EA3A 2HPIA 3TL4X 2Z16A 1UG0A 3H0DA 2MABA 1Z21A 5KCMA 1X19A 1Y56A 2HVQA 1D0XA 4PJLA 4IKFA 4HPQA 3A4CA 3K4LA 3HUGB 3V42A 1S9HA 2E60A 2O5RA 3DWLE 4CA0A 2R7SA 5FRMA 3H9GA 4R79A 3VYRB 3TBIA 1W36D 1TZLA 3OY9A 3LSHA 3RCOA 4B43A 3CF2A 2AQFA 3DTKA 2VJ4A 3EPZA 3PNYA 4BEHA 2E1MC 2KLOA 3C2HA 4NC8A 2R7WA 2HNHA 3IAS2 3HKZA 2JUGA 4LITA 2UUZA 2CW7A 3AKZA 3L2RA 1N78A 3NWTA 3GBGA 2X6WA 2WADA 4XL9A 3BLYA 3K4KA 1LDKB 3QYFA 3SZGA 4CZCA 2HPMA 2M3AA 4BS9A 2K9LA 2I8DA 4RM2A 4Y4RA 4U87A 2JVGA 3MD2A 4BGDA 3K4NA 3DPUA 2ZFUA 3VYTB 2XF6A 3VSLA 5LD2C 4C9YA 3C2GA 3IP4B 1PJRA 2W00A 4KITB 5FROA 3H9JA 3DTIA 4QPQA 2CV1A 1QHHD 4DJAA 2LBFA 2L5QA 3FKJA 3EUHC 4BQOA 4PSWA 2IGMA 4XOPA 3F9KA 1IRXA 3MKYB 2A5WA 2JA2A 3DLAA 4XORA 3ZXSA 3ZR8X 4XQFA 2RREA 3OYHA 3FBIB 3LSIA 1WJBA 4JQFA 4X0GA 3I3LA 3M8JA 3OYJA 4CCJA 3DU6A 2X1CA 4HSRA 4PFPA 2IS4A 1T0FC 2BVMA 3SEZA 4BQQA 4BE2A 2DOAA 4BQNA 2KHMA 4PFOA 4PJNA 4BXFA 2M4KA 4D9JA 2JSPA 4XLAA 4NQWB 4HNUA 1LFPA 2KL4A 3CZ6A 1YX5A 4XLHA 2WAFA 2HDWA 3TMOA 2K5CA 2RQQA 2PMZA 3HOSA 3K4CA 2Y0SA 3H5AA 4J01A 1MMAA 2CS3A 4FASD 3H9QA 3K4JA 3QODA 4E6KG 4CCLA 2XDVA 2L9SA 1OR7C 4IX7A 1MMNA 3OIPA 2GOXB 2VJJA 3OYNA 2ZSIB 2KQRA 1WJCA 4HNTA 2Q1ZB 5CQGA 3LMMA 1MMGA 2X51A 2ELJA 3PFYA 3A2KA 2VQHA 4XN0A 1WJ5A 4KISA 4XKCA 2VB6A 1D0ZA 2X6YA 1Z3XA 2WB1A 4DIQA 3DPLC 4XLCA 2KRCA 4Y3OA 1D1CA 3PL8A 3KX2A 4LG3A 2IS2A 3RQ4A 4II2A 2V9KA 3S3NA 2BW3B 2GOMA 3ZCOA 5JHFA 3VYSB 2HQAA 3N05A 3W3CA 3OYMA 4F55A 2BVLA 4AU7A 2LY1A 1LKXA 3DPTA 2IXSA 4PSXA 3L2QA 3VYUB 3LFUA 3BCAA 1X1AA 4DBQA 2PJRB 2R7XA 2DT7B 3HL2A 1X1CA 3AL0B 2OC6A 3CJRB 5KNLA 4MLOA 2VLAA 2R4GA 2QKLB 2WA0A 2DXIA 2VJ5A 2WY8Q 2XSJC 4E7JA 3OS2A 1V5FA 4F91B 1X4OA 3UNGC 2ZSHB 2VXDA 3ONQA 2F5VA 2CMPA 3ZRGA 3HG9A 2HVRA 3OYIA 3HPGA 4XKVA 4CCKA 3E0JB 3KEYA 4DBRA 2VIXA 2CH0A 3K6GA 4BU2A 3FDYA 3OYAA 2VKDA 1DP3A 4F92B 1SFKA 1AA7A 3D5LA 1J09A 2KRHA 4BUPA 2Z1DA 3S3MA 1W36C 2X85A 2M7BA 3OL3A 4DOZA 2E5ZA 3J7AY 1LVKA 2HZDA 2OUMA 2WAEA 4E4HA 3OIQA 1X4PA 4HRIA 2XC7A 2M4GA 2W4SA 4LIVA 1UELB 3BCBA 3OR2C 4FETA 4F3QA 2VXZA 5HOOA 2R7VA 4ZDOA 3CP2A 4GRIA 1D0YA 1V5GA 1N75A 2P0WA 4C30A 4XONA 1PYVA 2KP6A 3W2AA 4XM3A 2IS6A 2KDOA 4XKBA 2R7UA 3RPUD 3OL4A 1WJDA 3FHNA 2IS1A 2KMUA 2M0MA 1G8XA 4BDYA 1UAAA 2V26A 3LSMA 4LIUA 4YEJA 2ZXIA 1TT0A 1K6YA 4ITVA 4B47A 2LRDA 4XMYA 3PSIA 4BACA 4BEHB 3LSKA 4E7SA 4RLFA 2NOJB 4P1WA 4PK4A 3EUKL 3DKXA 4B3XA 2LC2A 2W7NA 1BR4A 4ZDPA 4NNJA 3DKYA 4OAZA 2UWMA 4KJZA 1HA8A 3ZQQA 1YX3A 2DT6A 2L9NA 2LY2A 3HXLA 3S3OA 2XF5A 4H4KC 4C2UA 4NC7A 2A6TA 2UV1A 2BOLA 2V4JC 3BC8A 2E5NA 3CJQB 4CCNA 3CMMA 2BW3A 4P5OA 3OYEA 1E0EA 1WFXA 1DQUA 3HPHA 1WJAA 1DGWY 2R7OA 4ZJZA 3K4BA 2CW8A 2HVSA 3BG7A 3W2VA 4PJJA 2CFOA 3OYBA 3OMYA 3HC7A 2Q2EB 3OYFA 3IAM2 2PJRA 3MKWB 2WY7Q 2V1NA 5CKTA 3ZGKA 1GLNA 3LSGA 2HU9A 3L2VA 4CCOA 1MW7A 3AL0C 4E7ZA 2L7KA 4HSTA 3DU5A 3OYKA 2VJIA 4II3A 1KONA 3UR3C 2L2OA 3D5SC 3FBNB 4XLFA 1FMWA 2CUJA 1VZ0A 2MC4A 4AVZA 1D1BA 3NWSA 5HNFA 1JI8A 2WBMA 3H5RA 4E7HA 2ZXHA 3L2UA 3E1SA 2X6XA 4IZZA 3EUAA 1YE9A 3QOEA 2W82A 5HVQC 3SEQA 2X1EA 3MMYB 3RSNA 4BDZA 2WAQA 4IQ4A 3OR1C 4BL0B 1P9QC 3LL7A 4ANJA 2LYCA 4DGWB 2IGNA 2R7QA 3G2BA 4XR6A 3L2WA 4CCMA 4OWRB 3I9V2 1NG6A 4RMNA 4G6TB 3SYTA 1MNDA 4HEA2 4J00A 2LREA 3VDXA 3CP8A 5HLTA 5LFAA 3K4MA 3DEEA 1Y6IA 4JOMA 1FMVA 2IGKA 4B48A 1R6RA 3QYEA 4KT6A 1QHGA 2VPLA 3OYGA 1N77A 1OLTA 1SAUA 4E7LA 1NG7A 4N4NB 5CQEA 4BE1A 2V6EA 2AQEA 3PSFA 1DGRM 1WJFA 5HNHA 5CPRB 3D5RC 1Z3YA 3QYBA 2E1MB 4NUBA 4CSWA 2MFZA 1ZELA 2LOOA 2LH9A 2MYSA 2OV7A 3K10A 4QPOA 2R7TA 4E7KA 2VASA 4EATA 4XN3A 5FRNA 2XAUA 4YRVA 4BJ6C 4RM3A 3PNVA 4HG2A 5TGTA 4XLEA 2VQCA 3DTEA 3RTRA 3K70D 2V7FA 3SDBA 1U0JA 3PJRA 4F93B 4D1QA 2F6CA 2VQLA 2KPMA 2VL8A 3OOUA 3OYCA 4B44A 2FUG2 2F4IA 1T95A 4F52A 1G59A 3U21A 2R7RA 4ZTJA 3S32A 1X1BA 3VSKA 4IQJA 4ZTFA 4PUSA 4PJMA 4BE0A 3PUBA 1BR2A 2CV0A 4XOTA 4BJ5C 3DQVC 3H35A 3KYLA 4RLQA 3S8PA 2CUZA 4OAYA 4BJTA 3OYDA 4N4OB 4XKWA 2VQGA 2LBFB 3K70C 2KZVA 4YELA 2Z2SB 3OWTA 3OS0A 4CUGA 4E7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0E A;  1WJE A;  1WJD A;  1MW7 A;  1KON A;  1WJB A;  1WJF A;  4F3Q A;  1WJC A;  1LFP A;  1K6Y A;  3HPH A;  1WJA A;  3HPG A;  3F9K A; 
#chains in the Genus database with same CATH topology
 3CLQ A;  1FBS A;  4UHT A;  2A6H F;  3KIO A;  1VQP I;  5FLV A;  4CH7 A;  4A3L J;  2QKM B;  2X1D A;  1WH5 A;  2FBI A;  2R5Z B;  4U7D A;  2DO7 A;  2HDC A;  1R58 A;  1BR1 A;  3WG9 A;  3F0C A;  1YLF A;  5FFX A;  5IT9 Z;  3WTS C;  2PMU A;  2LLK A;  4XSZ F;  1S5L C;  2NS8 A;  2QEN A;  3JAM K;  1CF7 A;  1IZ1 A;  4ESJ A;  2W85 A;  4FT8 A;  1QU3 A;  2CU7 A;  3GLL A;  2VI6 A;  1ZRD A;  2D1H A;  4HLX A;  2FF4 A;  3H5N A;  2DW4 A;  1B1B A;  2KJB A;  4C2T A;  2VKH A;  4A3E J;  1B9M A;  1XTA A;  3BJ6 A;  1KQ0 A;  3FXR A;  2Z16 A;  1UG0 A;  3BTJ A;  2MC3 A;  4A0Y A;  5CVI A;  2MAB A;  2RKH A;  1D0X A;  4RB1 A;  2CRG A;  5FKO A;  3FXQ A;  1BIB A;  2LKX A;  3G1L A;  3HUG B;  4XRS A;  4UUS B;  1GXQ A;  4EMS A;  2Y30 A;  3DWL E;  2R7S A;  1W7P B;  3I54 A;  3S2H J;  2XGD A;  4RB0 A;  3IKV A;  1T2K A;  4HF1 A;  4IHS A;  5FRM A;  1R9T J;  2VE8 A;  4EM2 A;  4I0B A;  2DBB A;  1P92 A;  5FO5 A;  1XSX A;  3CF2 A;  2QZ8 A;  1CGP A;  3DTK A;  1QA6 A;  3PNY A;  2PI0 A;  3KEQ A;  5L3E A;  1U5T B;  3GFI A;  3C2H A;  3SHF A;  2HNH A;  2QYO A;  2OBP A;  2JUG A;  5B1B H;  3K1M A;  3ERM A;  4LIT A;  2CW7 A;  3AKZ A;  2G9W A;  4GXO A;  2HWV A;  3KPH A;  2PG4 A;  1T8I A;  3FM3 A;  3CDL A;  3QYF A;  2XRO A;  1GT0 C;  2OAZ A;  3HJE A;  3SZG A;  3GTQ J;  4CZC A;  1U3E M;  2M3A A;  1IUY A;  2I8D A;  1S3J A;  1USS A;  4MTE A;  4BGD A;  2FQ4 A;  2EA2 A;  2XKO A;  3DPU A;  2P81 A;  3VSL A;  1FY7 A;  1JUM A;  2EFW A;  2ECC A;  1R36 A;  2A05 A;  3LA2 A;  3HYI A;  4FX0 A;  3DTI A;  3CCE I;  4DJA A;  1QQI A;  2KIF A;  2QF7 A;  5M5W J;  2L5Q A;  3EUH C;  4L0Z B;  1V54 H;  5M5X J;  3GEZ A;  3GCM A;  3L9F A;  1KU9 A;  4M3E A;  2ZNY A;  3DLA A;  4DYC A;  2O3F A;  3ZR8 X;  5J4V A;  5IYC J;  3HOV J;  5J6X A;  2N8G A;  3LSI A;  2G0E A;  4RB2 C;  2DA6 A;  1YYV A;  5ILU A;  2VN2 A;  2HKX A;  2HOA A;  4BQQ A;  4A3K J;  1IN6 A;  4BQN A;  1AU7 A;  4GGG A;  2ID3 A;  4GFB A;  2OF7 A;  2EWN A;  3IL2 A;  2JSP A;  2HGC A;  4HNU A;  3MKL A;  2YPR A;  3CZ6 A;  3JTH A;  4BXX J;  1YX5 A;  4XLH A;  2Z5U A;  3TMO A;  5J47 A;  2K5C A;  4L5E A;  3L2C A;  3LQQ A;  1IXC A;  3CUQ B;  3K4C A;  4D0P A;  2CGP A;  2Y0S A;  1YS7 A;  1SVO A;  4MEY F;  3H9Q A;  1IC8 A;  2FML A;  5ILV A;  1OR7 C;  1I39 A;  4G12 A;  3RKX A;  2KQR A;  2O8K A;  2Q1Z B;  1Z7U A;  1RKW A;  3DCF A;  1MMG A;  1W1W E;  5LHI A;  2ELJ A;  3PFY A;  4EQQ A;  5GPA A;  1DPR A;  3A2K A;  1SD5 A;  3I64 A;  3FK6 A;  2P7V B;  3AAF A;  5B66 C;  4XN0 A;  4RGX A;  3QQA A;  2JK3 A;  2Y69 H;  3M4O J;  2F48 A;  2FNP A;  1VQL I;  3WTW C;  3RQ4 A;  2HEO A;  1JT6 A;  4A69 C;  1X2M A;  2MSY A;  3T5X A;  3VYS B;  4B1R A;  4ZYH A;  2BVL A;  4AU7 A;  2TDX A;  3KP7 A;  1LKX A;  1GXP A;  2PX9 A;  3HOY J;  4AM3 A;  4PJ0 C;  2WV0 A;  4AIJ A;  2VC0 A;  2DA1 A;  2R7X A;  4HX4 A;  2XB0 X;  2DT7 B;  2XPV A;  4I99 C;  4C2M J;  2NVT J;  5BQT A;  3KET A;  5F64 A;  3M9A A;  2BXZ A;  2QKL B;  1BN5 A;  1MIJ A;  4M71 A;  2LF7 A;  3I55 I;  5E8I A;  4F91 B;  5K7H A;  1G3S A;  1RR8 C;  2LKS A;  4XIC A;  2GLO A;  4EJT A;  5FKM A;  5LRS A;  3ONQ A;  3J81 K;  1WKM A;  3HG9 A;  2DAO A;  3HPG A;  2DMN A;  4CCK A;  2HOT A;  2XV4 S;  2IRF G;  1MBE A;  4UVA A;  1D5V A;  2E1C A;  3AG3 H;  4Y15 A;  1HF0 A;  1D3Y A;  2XIG A;  2V79 A;  5J8C A;  1TLH B;  2ELK A;  2KIM A;  4Y7N J;  5K7Z A;  1VTN C;  1BW5 A;  3D5L A;  1J09 A;  4RGR A;  4YFX F;  1JT0 A;  3J7Z I;  2VON A;  3S3M A;  2DOF A;  1QPM A;  2K9S A;  3IV5 A;  3OIQ A;  4HRI A;  4P96 A;  3WTV C;  1FWZ A;  1D8K A;  4MO7 A;  4AD9 A;  3LSJ A;  5HOO A;  3CP2 A;  4GRI A;  3FXJ A;  2R7V A;  1FP2 A;  3F22 A;  1V5G A;  1N75 A;  2GXG A;  4BY7 J;  1WVR A;  4FX4 A;  1ZRE A;  5FD5 A;  2I10 A;  3AG1 H;  2KP6 A;  2DFF A;  4EJW A;  1TL8 A;  3HDD A;  4IRH A;  3E6B A;  2HQR A;  2KDO A;  2VBX A;  2LDU A;  2H6C A;  3PQK A;  4XKB A;  2FMY A;  2IS1 A;  1JGS A;  2WC2 A;  4PDK A;  1G8X A;  2V26 A;  4A6E A;  2M8E A;  2ZXI A;  3CCQ I;  1IV6 A;  4ITV A;  2R5Z A;  2M34 A;  4M6V A;  3JSO A;  1HKQ A;  2GIZ A;  2NRA C;  3C18 A;  3PSI A;  4K2E A;  4BAC A;  1L0O C;  4HBL A;  1S7A A;  3ZPL A;  3FMS A;  3OOP A;  4PK4 A;  5D5V B;  2DQL A;  4A3B J;  2W7N A;  1BR4 A;  1MD0 A;  1F5T A;  4OAZ A;  2M45 A;  1OKR A;  2DU9 A;  2L9N A;  4S04 A;  3S3O A;  2DMP A;  1YRN B;  5J3L A;  1EH8 A;  5LEJ A;  4LLG F;  5GTI C;  5LEK A;  2RQP A;  5DDG A;  1ETQ A;  3K2A A;  3BC8 A;  2E5N A;  2QLZ A;  3CMM A;  1T6S A;  2ZKZ A;  4CCN A;  4WWC A;  1E0E A;  3CCY A;  3WTX C;  1VQ7 I;  2ZME B;  3FHZ A;  2VPR A;  1FBU A;  1MH3 A;  4IO9 F;  1VQ5 I;  2L9R A;  2HQN A;  1FSE A;  1JKP C;  4M72 A;  3OIO A;  3ZN1 A;  1I5Z A;  4AC0 A;  3MKW B;  1G3T A;  2LNB A;  1ETV A;  5CJ9 A;  5FGM A;  4HDU A;  1QGP A;  2NNY A;  2ZJQ F;  5L3D A;  2HU9 A;  3BG3 A;  3WGG A;  3DLL F;  3V8K A;  3L2V A;  3HOX J;  4CCO A;  4A3C J;  3AL0 C;  4IVN A;  2CQN A;  5EYR A;  4EJU A;  3ISP A;  1IN5 A;  1XGM A;  1GDT A;  2HYG D;  4II3 A;  1KON A;  2BHY A;  3IWZ A;  3FBN B;  4XLF A;  1FMW A;  2CUJ A;  1VZ0 A;  3C3W A;  3HM5 A;  3BTL A;  4AVZ A;  1OYI A;  2E71 A;  4XID A;  1LFB A;  1Y0U A;  3VB2 A;  3ZQF A;  2OJE D;  1G6N A;  2P5K A;  3H5R A;  5HOD A;  4E7H A;  5KK1 A;  3L2U A;  3E6C C;  3AG4 H;  3EUA A;  5FFZ A;  2NS0 A;  2CW0 F;  3LAP A;  5HVQ C;  3JRH A;  1OCP A;  4AWX B;  2JZY A;  3RSN A;  4DQ2 A;  1H0M A;  1MSE C;  3OR1 C;  3MAJ A;  2IAI A;  3I4N J;  2DDB A;  5E1W A;  2LYC A;  3EQL F;  2FBH A;  2MLK A;  4DGW B;  1B4A A;  1QRY A;  3RZD J;  1ZRC A;  4XR6 A;  2K9Q A;  3F8N A;  3DXJ F;  4OWR B;  2RVC A;  5K5O A;  2RV8 A;  2DI3 A;  2L4M A;  4YFN F;  1LNW A;  1CF7 B;  1I3A A;  4J00 A;  1IJW C;  2M1B A;  5E3L A;  3C1D A;  2O9L A;  2CG4 A;  2OQG A;  1P6R A;  4OOI A;  1Y6I A;  4JOM A;  1FMV A;  2IGK A;  4B48 A;  5FLX Z;  2RDP A;  2DA7 A;  3HSR A;  4KT6 A;  3V7S A;  3SJM A;  1X3Z B;  2PN6 A;  5EZH A;  4AUX A;  2HOS A;  2XGC A;  1OCR H;  3BTI A;  1I27 A;  1S29 A;  5CQE A;  3LSR A;  2V6E A;  3COA C;  2VOP A;  3CUQ A;  3QP5 A;  2FU4 A;  1TWH J;  3A0H C;  3D5R C;  3HHG A;  3KEO A;  5ED4 A;  1Q1H A;  1WH7 A;  4NUB A;  3ZMS A;  2MFZ A;  1JHH A;  4EV0 A;  4DNC A;  2H6B A;  4KT5 C;  2Z99 A;  3BR3 A;  4HQM A;  4BAY A;  4XRM A;  3IHU A;  1VQN I;  2NOG A;  3BQY A;  2ELH A;  1ZAR A;  2QM3 A;  4RM3 A;  4BJ6 C;  3CMY A;  4WX9 A;  4QSH A;  2FEZ A;  1QNT A;  3HRT A;  4IRG A;  1ZGA A;  4JYK A;  3CD6 I;  3FZV A;  2XB5 A;  1SC7 A;  2VBZ A;  2E7X A;  2CUE A;  1ZKG A;  2F6C A;  3WTT C;  3OOU A;  1I1G A;  3F6V A;  1ORK A;  4B44 A;  5DS9 A;  3HSF A;  1TWA J;  1HST A;  4F52 A;  5CVR A;  1G59 A;  4ZTJ A;  1O3T A;  1OJL A;  1ZTR A;  2FSW A;  4KNY A;  3HOW J;  3PUB A;  4UUV A;  3K2Z A;  4XOT A;  4BJ5 C;  2PQ8 A;  3KYL A;  2OU2 A;  1EH6 A;  1FJL A;  4KIG A;  3G1O A;  3FWE A;  3IC7 A;  4OMZ A;  4JP0 A;  4YEL A;  1KQ8 A;  4CYC A;  2H27 A;  1NH3 A;  1JKR C;  1HDP A;  2EZK A;  4CUG A;  1LVA A;  1ZR2 A;  1YW9 A;  4S05 A;  4C3J J;  3BY6 A;  1BOB A;  2NVU B;  1TQP A;  2K9M A;  5CVV A;  3R6S A;  2ICW G;  4L5J A;  2EIK H;  3DP7 A;  2DCE A;  3CES A;  1REP C;  1FTZ A;  2COM A;  2DN0 A;  1UFM A;  2LP0 A;  5A2Q K;  2CV2 A;  1JE8 A;  3ULQ B;  4BQA A;  4C3I J;  3I58 A;  3E5U A;  2MD0 A;  3PNT A;  1GV2 A;  4IHW A;  4Y33 A;  2AO9 A;  3LQR A;  4ZYA A;  3OS1 A;  1IG7 A;  2BZT A;  1MGT A;  2JUC A;  4G7Z F;  1Z7L A;  3P9C A;  4AIH A;  4U88 A;  3CMA I;  3M8E A;  3OYL A;  5D4S A;  3RKQ A;  5LGU A;  4EVI A;  4CHU A;  1SMY F;  2HPI A;  4ETS A;  1X19 A;  4JX5 A;  3I4M J;  4PJL A;  2B9S A;  4MFD A;  1KYW A;  3JR9 A;  5IP9 J;  2MH9 A;  2OTJ I;  4CA0 A;  2O5R A;  2YUS A;  2CFX A;  1RET A;  2KDZ A;  1W36 D;  3JW4 A;  3OY9 A;  4OIP F;  2XUB A;  2STW A;  2VJ4 A;  1IN8 A;  4Q48 A;  4M74 A;  2E1M C;  2KLO A;  2R7W A;  4O5V A;  3TO6 A;  2A61 A;  4RA2 A;  2GXA A;  3L1P A;  3BG5 A;  5M3M J;  2VBY A;  4UXN A;  2UUZ A;  3TW7 A;  1MBH A;  3L2R A;  3NWT A;  3ESW B;  4CZZ A;  2M9H A;  1K79 A;  1MZB A;  5LBQ A;  2X6W A;  2YS9 A;  2WAD A;  1LDK B;  1OYW A;  3FK7 A;  1GUU A;  1MBK A;  3ZMU A;  4BBS J;  1TTY A;  3E3V A;  2H8W A;  1R71 A;  3GVA A;  4BS9 A;  1T39 A;  2K9L A;  4Y4R A;  4ZYD A;  4EGZ A;  3MD2 A;  2DOD A;  4OMY A;  2F5D A;  1FOK A;  2PFB A;  2ZFU A;  1F1Z A;  2XF6 A;  3M1E A;  3VYT B;  5LD2 C;  3GYH X;  2MLG A;  5JVG F;  3VPR A;  5KAI C;  2W00 A;  3BDD A;  1WSU A;  4KIT B;  3I4P A;  4XLN F;  3V7R A;  4X6A J;  4LGW A;  3RPU A;  2JA6 J;  1TWG J;  2ZBK A;  2DFH A;  3FKJ A;  4RGU A;  1KU2 A;  4BQO A;  4IPA A;  5F1J A;  3H3V K;  3SXY A;  5GAE J;  2WWY A;  1Y1W J;  4PGH A;  1SEU A;  1IRX A;  4DZP A;  3GTK J;  1BA5 A;  2XAS A;  4BYY A;  4XOR A;  3GTL J;  4XQF A;  2RRE A;  3BZC A;  3OYH A;  1H9T A;  5JI6 A;  3TO7 A;  1STZ A;  4M6Y A;  1QZE A;  3BG9 A;  3P5J A;  1TQM A;  1WJB A;  3KYC B;  1JKQ C;  2A6E F;  2HOE A;  4UV8 A;  3ERE D;  2W24 A;  3KP5 A;  4A2U A;  1XC5 A;  4CCJ A;  1IXR C;  1GVJ A;  4GCV A;  4HSR A;  4QWQ A;  4RS8 A;  4Y17 A;  4HLY A;  1KGS A;  2QQ9 A;  1POG A;  5JHU A;  1R00 A;  1ZK8 A;  3BP8 A;  3QPL A;  4PJN A;  1SVM A;  4PFO A;  4BXF A;  1K4S A;  1RRJ A;  3QWL A;  3WTY C;  2OZU A;  4A0Z A;  3D1N I;  1D5Y A;  1RES A;  4RBO A;  2KL4 A;  3CDH A;  1UHS A;  5C4J J;  1VQM I;  2E35 A;  3CCL I;  1X3U A;  4W97 A;  2PMZ A;  3O6B B;  4ZZD A;  1A36 A;  1MMA A;  2CS3 A;  5ICG A;  2VOD A;  2E1N A;  2JPB A;  5CVJ A;  1HW1 A;  3BWG A;  4CCL A;  3CC4 I;  2XDV A;  4IX7 A;  3BZ6 A;  1HCR A;  3HBL A;  3OIP A;  4KDP A;  2E19 A;  2A07 F;  2ZSI B;  1UB9 A;  3LMM A;  4WK8 F;  1VQ8 I;  3KLN A;  3FIS A;  5ICC A;  3WG7 H;  4I2O A;  2M5W A;  3GWZ A;  3GTG J;  2VB6 A;  1D0Z A;  2GWR A;  1BI0 A;  3DPL C;  4XLC A;  2R7Z J;  1R22 A;  3Q0U A;  2GIV A;  2M2E A;  5IYB J;  2RC4 A;  3PL8 A;  3KX2 A;  4LG3 A;  3G73 A;  4HQE A;  4II2 A;  2V9K A;  3K7A J;  3GF2 A;  3J80 Z;  1TQI A;  3MCZ A;  2HQA A;  3W6J B;  3N05 A;  3OYM A;  4ENJ A;  1HKT A;  2LY1 A;  3GTJ J;  2VT3 A;  2XRN A;  2NYX A;  5AIQ A;  3L2Q A;  4OIN F;  3LFU A;  2C6Y A;  1X1A A;  5FLX K;  3HL2 A;  1X1C A;  3AL0 B;  1Z91 A;  4MLO A;  1Z77 A;  1OCT C;  2DFE A;  2DXI A;  2KJC A;  1BOA A;  2VJ5 A;  2WY8 Q;  2GZW A;  2XSJ C;  2HR3 A;  4ON0 A;  2JA7 J;  5E1X A;  5DUK A;  1ETK A;  4OIR F;  3UNG C;  2VXD A;  3JRF A;  1EJ9 A;  2EA4 A;  3WTZ A;  1XCB A;  4GO1 A;  2CMP A;  3QPH A;  2FOW A;  3JRC A;  2GBY A;  3HGY A;  4XKV A;  1P4A A;  3KEY A;  2VIX A;  4XK4 A;  2JWT A;  3K6G A;  3FDY A;  3OYA A;  3U9G A;  3W6K B;  1SFK A;  2QBY A;  4HF2 A;  1AA7 A;  1SAX A;  4A3D J;  5HDG A;  4FHT A;  2ZCW A;  3N97 A;  2M87 A;  2P6T A;  2X85 A;  3OL3 A;  3WU0 A;  4DOZ A;  2E5Z A;  1YIT I;  1LVK A;  2OUM A;  4E4H A;  3JRA A;  1BBY A;  1ZQ3 P;  2CQK A;  2M4G A;  2W4S A;  3T0Y A;  3BCB A;  3EUH A;  4FET A;  3JRI A;  2VXZ A;  2OCE A;  4HV5 A;  2XAG A;  5DCM B;  2EK5 A;  4G8X A;  4AVP A;  2A5Y B;  2XVC A;  3IWF A;  4XON A;  2BGC A;  4C30 A;  3ZOB A;  1ZLJ A;  1PYV A;  4J19 A;  1O3Q A;  3BR6 A;  3SZP A;  2DMQ A;  2FX0 A;  2ME6 A;  2L3D A;  1XDS A;  2MH2 A;  2KMU A;  4G7O F;  4BDY A;  1S7E A;  1UAA A;  3RIR A;  2GAU A;  4U0V A;  3F8F A;  1RNL A;  4M3F A;  4BY1 J;  4W1U A;  1WPK A;  1TNS A;  2LRD A;  4XMY A;  4C3H J;  2HI3 A;  5KVR A;  3ZP5 A;  4RLF A;  2NOJ B;  4P1W A;  1U9O A;  3EUK L;  1G2H A;  2E7W A;  3MQ0 A;  1AKH B;  3VOD A;  3DKY A;  1F36 A;  1JTY A;  3ZQI A;  1FPQ A;  2DK5 A;  1YX3 A;  2DT6 A;  2LY2 A;  2JA8 J;  2XF5 A;  2K4B A;  5K7F A;  1P7J A;  1OR7 A;  4QIW N;  2V4J C;  1XN7 A;  3EYI A;  3F23 A;  2BW3 A;  4P5O A;  1WFX A;  1FIA A;  2R5Y A;  3B02 A;  1U8B A;  2RNJ A;  2BBY A;  3HRM A;  3QOP A;  1VFC A;  5EZG A;  2HVS A;  3LA7 A;  2DOE A;  4PJJ A;  2CFO A;  2OZ6 A;  2DJN A;  1M1E B;  1FC3 A;  2FJ1 A;  3HIF A;  3HC7 A;  1PUF B;  2PJR A;  3CO6 C;  3Q3S A;  1H89 C;  2ETH A;  2MGQ A;  5BPI A;  4LOC A;  2J5P A;  2WY7 Q;  3TO9 A;  2DDA A;  4BHB A;  3ZGK A;  1GLN A;  2EFO A;  4G94 A;  2CO5 A;  3ABL H;  1MKM A;  1WZ2 A;  3H36 A;  3SDG A;  1PP7 U;  2W84 A;  1S8N A;  1J9I A;  3VEP A;  1J7K A;  1YQA A;  2DLL A;  5HLH A;  3WE3 A;  3TP0 A;  2EQR A;  3D5S C;  1JGG A;  5HS9 A;  1ITY A;  3NEU A;  1IW7 F;  3FIW A;  2DMT A;  1Q1V A;  1XSV A;  3TDZ C;  3CO7 C;  3L7W A;  2JRT A;  2WBM A;  1ZLK A;  5GAD J;  2FA5 A;  2ZXH A;  3BTC A;  4WXC A;  4A0X A;  2K85 A;  2R7D A;  5FKL A;  3T1B A;  4CYC B;  2B63 J;  1E17 A;  1OMI A;  2OD5 A;  3QOE A;  1HC8 A;  5LHG A;  3E5Q A;  3MMY B;  4MIM A;  3CCV I;  4BDZ A;  2WAQ A;  4IQ4 A;  5E1Z B;  2Y75 A;  4BL0 B;  1RI7 A;  1ETX A;  3O8H A;  1R49 A;  3KZI C;  3G2B A;  3BOQ A;  1F9N A;  3L00 A;  5B5E C;  1K61 A;  2H1L A;  1T98 A;  2JMW A;  4OIQ F;  1ON1 A;  2EFN A;  3E5X A;  1J5Y A;  2ESH A;  1TT5 B;  2XRL A;  3T8R A;  4G6T B;  1MND A;  3O8G A;  2RGV A;  3TOB A;  2VOO A;  3QRF F;  3IH4 A;  2NNN A;  1YIJ I;  2VUM J;  2EZH A;  1ULY A;  1YW7 A;  5CVU A;  1JXS A;  4D7M A;  5DM6 F;  3OSG A;  1R6R A;  4LG0 A;  5FLM J;  1W5C C;  1IUF A;  2VPL A;  3OYG A;  1N77 A;  3DFG A;  3K1P A;  5J8F A;  1NG7 A;  3H92 A;  4N4N B;  2Q8K A;  2E2J J;  2LTP A;  3X2Q H;  1HDD C;  3GME A;  2Y31 A;  5HS8 A;  1X3W B;  4P9U A;  1WJF A;  2K9N A;  5HNH A;  5CPR B;  5D6F A;  4ZH4 F;  4I0A A;  2E1M B;  3FM5 A;  3DBL B;  1JUP A;  1O7F A;  3PM1 A;  1T38 A;  5LGT A;  2LOO A;  4M3G A;  1MJA A;  1MH4 A;  3QPT A;  1IV8 A;  3G3Z A;  2XAH A;  4XN3 A;  2Q0O A;  5FRN A;  2IA1 A;  4I76 A;  4YRV A;  1XD7 A;  1ZHF A;  5TGT A;  4HG2 A;  4LB5 A;  4XLE A;  3I71 A;  2IEK A;  4NC6 A;  2VQC A;  3OV8 A;  1A6Q A;  4MNU A;  4XRS G;  4U0W A;  1XPX A;  3RTR A;  2P7C B;  4UB6 C;  1U0J A;  2QWW A;  4NDL A;  4QLC U;  2ZO4 A;  1TW2 A;  5J4Y A;  2J5O A;  4F93 B;  4A3M J;  3CLO A;  5DEQ A;  3IH2 A;  1L3L A;  2VQL A;  2EZI A;  4MFE A;  2FUG 2;  2BV6 A;  2F4I A;  3MVP A;  1R5I D;  4HZF A;  1WRJ A;  5IT9 K;  3PFI A;  2R7R A;  1D8J A;  2FXA A;  2K27 A;  5L3C A;  4KMU X;  1XX5 A;  2CYY A;  2X6O A;  2H1K A;  3VSK A;  4BKX A;  2QUF A;  3ASN H;  2AHQ A;  4PJM A;  4BE0 A;  2ZC2 A;  1BR2 A;  1RR7 A;  4IOC F;  1SVL A;  4M9S A;  2G7H A;  3S8P A;  2ISZ A;  2XPW A;  2V1X A;  5E3N A;  3KE2 A;  4N4O B;  2KZV A;  1IXS B;  3J80 K;  1W7P D;  3IRR A;  2YSR A;  1U78 A;  1A35 A;  4A5M A;  5HDN A;  3GLX A;  2HZT A;  3KZY A;  5K1Y A;  2ZJ2 A;  4IXA A;  2GM4 A;  2GA1 A;  4E7I A;  4QTR A;  3GTO J;  5M5Y J;  1XGS A;  2M7A A;  1CQT A;  2B7E A;  1D1A A;  1ERD A;  1WGX A;  2XSD C;  4KN4 X;  3S2D J;  4I6Z A;  1HBX G;  2EV6 A;  1NK2 P;  3BG6 A;  4XNF A;  1P4X A;  5F6F A;  1PUE E;  2BEO A;  3W2W A;  4HF0 A;  2AS5 F;  3FXU A;  1MMD A;  3KP3 A;  3V8J A;  2IGO A;  3FF5 A;  2JA5 J;  2W1O A;  3S93 A;  3H0G J;  2D1V A;  2VBW A;  4N9H A;  1T33 A;  1E2X A;  1B8I B;  4KUM A;  1MNE A;  2XF7 A;  1WJE A;  2DJI A;  1W4M A;  2RNG A;  2JVH A;  2LG4 A;  5J1Y A;  3K0L A;  4MTD A;  4FTH A;  5KHD A;  2ADU A;  1EA3 A;  1MJ9 A;  3WU2 C;  3GZ6 A;  2K02 A;  2OCC H;  2E36 A;  5DCM A;  4UY8 I;  1U5T C;  2HXI A;  1Z21 A;  2XPU A;  5KCM A;  1PDN C;  1Y56 A;  4WCG A;  3ABT A;  4FQG A;  3ZQC A;  2D5V A;  3LSP A;  4HNV A;  3B6A A;  1GV5 A;  4HPQ A;  3K4L A;  3TGN A;  3DF8 A;  3I53 A;  1S9H A;  1TW3 A;  4I02 A;  4EGY A;  3HHH A;  1ZGW A;  4R79 A;  2GA2 A;  2R3S A;  3TBI A;  1TZL A;  2Z3Y A;  2EV0 A;  3RCO A;  2QQA A;  2K4J A;  4B43 A;  1RIO H;  1V3F A;  2JN6 A;  4ENM A;  3ZQ7 A;  2V6C A;  4PZJ A;  4I01 A;  4L9V A;  4ABZ A;  1T56 A;  3IAS 2;  3HKZ A;  2DA5 A;  4G6Q A;  1IN4 A;  1AKH A;  2L4A A;  1ACI A;  2P8T A;  1S6L A;  2JQ7 A;  5E8G A;  1JTX A;  1IDY A;  3I56 I;  2ZXW H;  3NRV A;  4XL9 A;  3BLY A;  2JTV A;  1Y8R B;  3G71 I;  3ABU A;  2HPM A;  1B9N A;  4RM2 A;  4U87 A;  3KP2 A;  2PMZ N;  1O3R A;  2DPD A;  3SFZ A;  3K4N A;  3FXO A;  1FLI A;  4JX4 A;  4C9Y A;  4KIF A;  3IP4 B;  3S1M J;  1W5S A;  3HZJ A;  1PUF A;  2O6G E;  1DPU A;  4L5I A;  2V9P A;  1BL0 A;  1TP4 A;  1QHH D;  2LBF A;  3SZT A;  3M07 A;  4RB3 C;  1VF9 A;  3F9K A;  1XS9 A;  2O0Y A;  5JLX A;  2QCO A;  1RUO A;  2A5W A;  5AIP A;  1ZG1 A;  1N25 A;  2DTZ A;  3LNQ A;  2QBY B;  4HAM A;  3J7A O;  2IA0 A;  5K5Q A;  3E97 A;  2AXL A;  2FOK A;  1Z6T A;  2JT1 A;  4X0G A;  3I3L A;  3M8J A;  5KAF C;  1FOY A;  3LWF A;  2LMD A;  3DU6 A;  4PFP A;  2A69 F;  2IS4 A;  2DYR H;  2BVM A;  4BE2 A;  1ZYR F;  2DOA A;  2KHM A;  1KA8 A;  3DEW A;  2XAF A;  3ML6 A;  5HDK A;  2YU9 J;  4D9J A;  1ZH5 A;  4XLA A;  4NQW B;  1LFP A;  5EEH A;  2M8G X;  5E3O A;  3S17 J;  4LB6 B;  4M3D A;  2BE5 F;  4IHX A;  4D7N A;  2EZL A;  2L01 A;  3HOS A;  4KYW A;  1XG1 A;  4I7H A;  1XSD A;  4FAS D;  1APL C;  4E6K G;  3K4J A;  3CCS I;  3ASO H;  1BJA A;  3G1M A;  1YTY A;  4YII A;  2GOX B;  2VJJ A;  3OYN A;  3PO2 J;  2K40 A;  4HNT A;  1O57 A;  2X51 A;  1PVE A;  2E2H J;  3U1K A;  1XGO A;  1A04 A;  1E3O C;  1LE8 A;  3KLO A;  3GZN B;  5TRD A;  1WJ5 A;  1RKT A;  5DD4 A;  2OPT A;  5GTH C;  2F2E A;  2X6Y A;  1Z3X A;  1IN7 A;  2RN7 A;  2WB1 A;  4N9I A;  4FE4 A;  2KRC A;  1TWC J;  2R92 J;  1OCZ H;  4MQV A;  1D1C A;  3BR0 A;  4Y3O A;  2A3S A;  4NB5 A;  5EG0 B;  3S3N A;  1SD7 A;  2TRT A;  1ONV A;  2BW3 B;  2GOM A;  3ZCO A;  5JHF A;  2R5Y B;  3W3C A;  1SFU A;  1G3W A;  4F55 A;  3BR5 A;  1GHC A;  5J40 A;  1HW5 A;  1QPI A;  2IXS A;  4LMY A;  4PSX A;  1JUS A;  1R1V A;  1NTC A;  2DK8 A;  4HX8 A;  2PJR B;  1QZZ A;  1XMK A;  2IW5 A;  3A02 A;  3L09 A;  4ZYE A;  2VKE A;  3I5U A;  3GFM A;  1BC8 C;  1LQ1 A;  2E1O A;  2EIJ H;  2OC6 A;  5KNL A;  1YJN I;  2VLA A;  2R4G A;  3SQN A;  3ZMV A;  1G3Y A;  4A93 J;  1UZC A;  1V5F A;  3DKW A;  1U2W A;  3OS2 A;  1X4O A;  3CJN A;  2ZSH B;  1VQ6 I;  1B59 A;  4Y52 J;  1IRG A;  4RAZ A;  2X4H A;  4GYG A;  1IGN A;  4G7H F;  1U8R A;  3HOU J;  2YX7 A;  3QAH A;  2IBD A;  2CH0 A;  2UXX A;  5F0C A;  2LY9 A;  6PAX A;  5EGO A;  5BOX A;  4CIC A;  4F92 B;  1VQO I;  2DA2 A;  2KIU A;  3JSP A;  4M73 A;  4DW6 A;  2VKV A;  5AON A;  4A5N A;  1MBF A;  1J0R A;  1OQY A;  1LB2 A;  1OYY A;  2CQX A;  1YS6 A;  4IL6 C;  1UMQ A;  4XLP F;  1W36 C;  4FE7 A;  2RAE A;  2HTS A;  1TWF J;  2Y48 A;  3IH3 A;  2WAE A;  3I0T A;  1B72 A;  9ANT A;  1SAN A;  2XC7 A;  1A5J A;  3F3X A;  1AOY A;  4ZDO A;  5DTD A;  1WWX A;  1Z1D A;  2NXN B;  3KP6 A;  1R5H A;  2BYV E;  2IVM A;  2P0W A;  1LFU P;  1XMX A;  3K1N A;  4HW0 A;  5H2F C;  3W2A A;  3CTA A;  4HDV A;  3CCR I;  1ZG5 A;  1K83 J;  4FIS A;  3RPU D;  2OTL I;  2ZFW A;  3FHN A;  2M0M A;  1R5G A;  2MW8 A;  1TNT A;  4YEJ A;  5GAG J;  5HLI A;  1K6Y A;  4B47 A;  2L7Z A;  4UVC A;  3WTU C;  1O4X A;  2ZXJ A;  2ZME C;  4BEH B;  3LSK A;  2LF8 A;  4RAG A;  4BNC A;  3M3Y J;  2LC2 A;  4LG0 B;  4UB8 C;  4IF4 A;  3SFI A;  4NNJ A;  4WXD A;  4ZDP A;  2DT5 A;  1HLV A;  3ABK H;  4RDU A;  5C3E J;  3HXL A;  2Z9O A;  2EV5 A;  3MZ8 A;  1B8I A;  1HQC A;  1WCM J;  1LDJ A;  4H4K C;  4C2U A;  1J2X A;  2UV1 A;  4N0B A;  2BOL A;  3RKW A;  3CJQ B;  3NQO A;  2BY2 A;  3WOD F;  5B1A H;  4YG2 F;  2KKO A;  1DQU A;  3HPH A;  5C44 J;  1DGW Y;  2R7O A;  1DU0 A;  4ZJZ A;  1QO0 D;  4AID A;  5IYD J;  1IF1 A;  3W2V A;  4CDG A;  2WAQ N;  3GTP J;  3OYB A;  3OMY A;  5LLQ A;  3RYP A;  1F4K A;  5F08 A;  3IAM 2;  3OYF A;  1X58 A;  3I59 A;  2YX4 A;  5F27 A;  4D5F A;  3P9I A;  2V1N A;  4LLN A;  1Y39 A;  4IRI A;  3LSG A;  3FMQ A;  1I6X A;  1ZRF A;  3Q9V A;  1R1T A;  1Z67 A;  2L7K A;  1EF4 A;  3GFJ A;  4HST A;  3TDU C;  1YIO A;  2F4O B;  3OYK A;  2VJI A;  3H3Z A;  4HX7 A;  4WXH A;  3Q0V A;  2HKO A;  3F21 A;  2MC4 A;  3NAR A;  1D1B A;  3GUD A;  1V4R A;  3MEX A;  5HLG A;  1JJ8 C;  3R0J A;  2V9V A;  5HNF A;  2FE3 A;  3CCU I;  5IOZ A;  5IP7 J;  1IDZ A;  2L7F P;  3HRS A;  3MN2 A;  4KIB A;  1BIA A;  5D8K B;  4B4C A;  4IZZ A;  3K69 A;  3SEQ A;  5HS7 A;  4JK1 X;  5GAH J;  3BPX A;  1S7O A;  3LL7 A;  5K5R A;  4M6X A;  5CLS A;  2HTJ A;  2KT0 A;  3L2W A;  2EB7 A;  4A12 A;  3BQZ A;  3ZQL A;  1P2F A;  4HA8 A;  5TIS C;  2JJ7 A;  2NVQ J;  1QVU A;  4HEA 2;  1KZH A;  3MFK A;  5LHH A;  4O3M A;  3CP8 A;  2DYS H;  3IKT A;  5DUI A;  1UG2 A;  2CJJ A;  2KFD A;  4CXF A;  5HLT A;  3O2P E;  1HW2 A;  2MA3 A;  2IJL A;  2HYJ A;  2W57 A;  3QYE A;  2R0Q C;  1QHG A;  1ODD A;  4UV9 A;  1OLT A;  2MD5 A;  4NQW A;  4AIK A;  5DYM A;  4ENK A;  1SAU A;  2Y9Z A;  3R0A A;  3TQN A;  3GZ5 A;  1LEB A;  1H88 C;  2F5F A;  4A3I J;  4L9J A;  3RZO J;  2MG4 A;  1VND A;  3GX4 X;  4BE1 A;  2AQE A;  2MBF A;  4E70 A;  1FTT A;  3CC2 I;  2G7U A;  3F72 A;  3Q9S A;  5D6E A;  4CSW A;  2MYS A;  1LPQ A;  2R7T A;  4QPO A;  1YO5 C;  3FXM A;  4EM0 B;  2LR8 A;  4EAT A;  2Q2E A;  2XAU A;  5B3S H;  3LA3 A;  3Q0W A;  2O8X A;  5JVT A;  1E3P A;  1ZAO A;  1Z9C A;  1FZP B;  3IRQ A;  5E3M A;  3DTE A;  1IRF A;  1A31 A;  3K70 D;  1FNN A;  3CDI A;  2IPQ X;  5E18 F;  1VQ9 I;  3R60 A;  3DV8 A;  1Y8Q B;  2E2I J;  4D1Q A;  2UXN A;  1HXD A;  3M7G A;  2VL8 A;  3OYC A;  1SMT A;  2VT2 A;  3MWM A;  2COB A;  5EG0 A;  1T95 A;  1DUX C;  1R7J A;  2ESN A;  2FQ3 A;  2STT A;  1I3Q J;  2NAZ A;  1IAW A;  4TV7 A;  2W25 A;  4ZTF A;  2JPC A;  1QVT A;  5ILS A;  1FYL A;  1DP7 P;  4NHJ A;  4V2F A;  3G6E I;  5IPA A;  2CV0 A;  4DYR A;  3DQV C;  3H35 A;  2FBK A;  2H94 A;  2GXB A;  3EDP A;  1ENH A;  2NS7 A;  1WQ2 A;  2LBF B;  2KIS A;  3K70 C;  1K78 B;  1OFC X;  4ESB A;  1MBG A;  2Z2S B;  3OWT A;  1ON2 A;  4Q4Z F;  3GW2 A;  2O61 A;  1O7L A;  2XAJ A;  1XCV A;  2K3P A;  1LUJ B;  3MKZ A;  4ZDL A;  3DEU A;  2DA3 A;  2Y2Z A;  3MZY A;  2CQQ A;  1K6O A;  3N4M A;  1Z6R A;  2QSF X;  4AYB A;  2DQR A;  1S72 I;  3A1Y A;  3HKZ N;  3U1D A;  3A01 A;  4A3G J;  3HOZ J;  1C0W A;  5D5X B;  2EPF A;  3CQZ J;  5BPD A;  1XB4 A;  1V5E A;  5ICF A;  3HOT A;  3IUO A;  1LJ9 A;  3M1C A;  1KQ9 A;  1FYK A;  3VWB A;  3WE2 A;  3EET A;  2ME0 A;  3AFH A;  5ERI A;  2L0K A;  2L7M P;  1U9N A;  1X1D A;  3P7N A;  5H6R A;  4U7B A;  4ZC3 A;  3TL4 X;  1JKO C;  1P4W A;  3H0D A;  2B0L A;  3QP6 A;  1AWC A;  5J1U A;  2HVQ A;  3K9T A;  4IEJ A;  4DYQ A;  1MJB A;  4IKF A;  2QSH X;  4LFU A;  1W0T A;  3A4C A;  3QU6 A;  5CYV A;  3V42 A;  2K7L A;  2E60 A;  3ECH A;  3CUO A;  3E7L A;  3H9G A;  1LE8 B;  3VYR B;  3S14 J;  4OIO F;  4P55 A;  2A68 F;  2NVY J;  3LSH A;  5A2Q Z;  1BI1 A;  1XDU A;  4YIR X;  2AQF A;  2KZG A;  3RI4 A;  4A6D A;  3EPZ A;  4BEH A;  3CC7 I;  3R61 A;  4UNO A;  4NC8 A;  1YI2 I;  2PBI A;  1H8A C;  2P6S A;  4G6D A;  1BI2 A;  1OCO H;  4UUT A;  3JCU C;  1HOM A;  4LLL A;  3QPS A;  4P9F A;  5L3F A;  1N78 A;  1WI3 A;  2CWE A;  3GBG A;  5D5U B;  1H9G A;  1RPW A;  3K4K A;  2P5L C;  1ETO A;  2KRF A;  2BXY A;  4G9Y A;  1W5T A;  2BHZ A;  1FIP A;  3KFW X;  4L9N A;  2YR2 A;  2JVG A;  1R4M B;  4LD5 A;  2EIL H;  4HV6 A;  5FD6 A;  3H3U A;  1VQK I;  3C2G A;  3S1R J;  1PJR A;  3S1N J;  3ZQG A;  1BW6 A;  2LD5 A;  5FRO A;  1FT9 A;  3BZK A;  3H9J A;  4LK1 F;  4IHT A;  4QPQ A;  1E3H A;  2CV1 A;  2D2W A;  3HSE A;  5JLW A;  4KFC A;  2WV1 A;  3Q5F A;  1YG2 A;  4PSW A;  2IGM A;  4XOP A;  4IHV A;  2LK2 A;  3TW6 A;  4L18 B;  3MKY B;  3BT9 A;  2JA2 A;  5EGO B;  3HTS B;  3ZXS A;  1FX7 A;  3S1Q J;  2CQ7 A;  1G4D A;  1T0F A;  5IT3 A;  2WTE A;  3FBI B;  4EJO A;  1SD4 A;  4GYI A;  2KIQ A;  2WB1 N;  4JQF A;  4EM1 A;  5C4X J;  3OYJ A;  5E79 C;  4KA4 A;  2X1C A;  1DU6 A;  1UHM A;  3E6D A;  1T0F C;  1B72 B;  3SEZ A;  2BY0 A;  2M4K A;  3F8M A;  3ZQH A;  3RDI A;  2M0C A;  2WAF A;  3V4G A;  1DDN A;  2HDW A;  2Z33 A;  1X2N A;  2R7F A;  1RC9 A;  2RQQ A;  2DTR A;  2Y0M A;  4F7Z A;  4XRF A;  5H20 A;  5E20 A;  3H5A A;  4J01 A;  1YW8 A;  3LOC A;  4L9T A;  3QOD A;  4IJA A;  2L9S A;  4B09 A;  3PUF A;  1MMN A;  5EJC A;  3FXK A;  1FOW A;  1WJC A;  5CQG A;  3HUG A;  3KP4 A;  1MNM C;  4I98 B;  4UUS A;  5IP6 A;  1W7P A;  5FB2 A;  2VQH A;  5LRR A;  3TP3 A;  2VC1 A;  3JRG A;  5E17 F;  5F0F A;  4UVB A;  1YHQ I;  4KIS A;  3O3K A;  1KU3 A;  4XKC A;  1IO2 A;  1LEA A;  2EH3 A;  3BJA A;  3HRU A;  4DIQ A;  1U5T A;  2L54 A;  1MDM B;  3JTG A;  4RAY A;  3W6V A;  5LGN A;  4V2G A;  1UCR A;  5BNG A;  4FCY A;  3BR2 A;  3U2R A;  4LK0 F;  2CSO A;  4RGS A;  3VOE A;  2AXT C;  5EEA A;  3HGG A;  2QGU A;  4H0E A;  2P4W A;  2GQQ A;  1FOX A;  3F8B A;  2I5U A;  3DPT A;  3TED A;  2ID6 A;  4Z6Y A;  3VYU B;  1TC3 C;  3BCA A;  1JHF A;  1EV7 A;  3JRE A;  4DBQ A;  4BBR J;  3RKY A;  1Z0X A;  3I59 B;  2XAQ A;  2YU3 A;  4ESF A;  3CJR B;  1B6A A;  3B6C A;  2WA0 A;  2FNA A;  2XKP A;  1TBX A;  1YJ9 I;  4E7J A;  4RAF A;  3JAM Z;  3WHB A;  5GPC A;  4PCQ A;  2FRH A;  4U0Y A;  2F5V A;  4KN7 X;  5IY5 H;  3ZRG A;  2HVR A;  2V1U A;  3S2W A;  4L0Y B;  3OYI A;  4DBR A;  3E0J B;  2QEX I;  4BU2 A;  2DMU A;  4A3F J;  5DCF A;  2VKD A;  4ZYG A;  3WGI A;  1DP3 A;  2ECB A;  4IOA F;  2JRM A;  4I09 A;  2HYF A;  4V19 K;  2KRH A;  4BUP A;  2XHK A;  2PJP A;  1X1P A;  4MGR A;  1SFX A;  2Z1D A;  3CF5 F;  5JFR A;  4Z2Y A;  2L02 A;  2BY3 A;  3RJP A;  3WU1 B;  2IS2 A;  2M7B A;  1OPC A;  3VFZ A;  3J7A Y;  2HZD A;  1VI0 A;  1X4P A;  2IA2 A;  1RZ4 A;  4LIV A;  1UEL B;  3OR2 C;  3CCM I;  4F3Q A;  1D0Y A;  3RYR A;  2F5E A;  1JJ6 C;  2EIM H;  2ZJR F;  4XBF A;  3ZN0 A;  1YJW I;  1O3S A;  1YOV B;  2CUF A;  1K78 A;  4XM3 A;  2ZB9 A;  2IS6 A;  3KZZ A;  2R7U A;  1MBJ A;  1R1U A;  1WJD A;  3OL4 A;  4B8X A;  5IOY A;  4D5C A;  4WF2 A;  3GFL A;  1SFO J;  5FKK A;  2Y9Y A;  2O03 A;  3LSM A;  4LIU A;  3NAU A;  1TT0 A;  3CUQ C;  1IRZ A;  1BM9 A;  5ICE A;  3GTM J;  3FXL A;  3T8T A;  1I1S A;  4E7S A;  3KYD B;  4HYE A;  4HOB A;  3REO A;  3DKX A;  4B3X A;  3MZH A;  1HKS A;  3D0S A;  1FYM A;  5FJ8 J;  2EFQ A;  3RPQ A;  3KCC A;  2UWM A;  1SFE A;  4KJZ A;  1EH7 A;  5EEG A;  4JX6 A;  5FKN A;  1HA8 A;  3TKY A;  3ZQQ A;  5BMZ A;  3PQJ A;  4GDF A;  5DM7 F;  1FSH A;  3C2B A;  2LFB A;  2A6T A;  3E6M A;  4NC7 A;  4CYD A;  3OYE A;  4M9X A;  1BC7 C;  1RUN A;  3FX3 A;  3LAJ A;  1R4N B;  1WJA A;  3S15 J;  3EYY A;  1OCC H;  3RQI A;  3ZMZ A;  3PIO F;  1UHW A;  3K4B A;  4CO8 A;  1W0U A;  1QBJ A;  2CW8 A;  1MMS A;  3C7J A;  3BG7 A;  2TCT A;  4IHY A;  2Q2E B;  1FBQ A;  3J7Y J;  2HQ5 A;  2DPU A;  4ASN A;  3WHC A;  5F1R A;  1ETW A;  1J59 A;  1EKE A;  3LFK A;  4ENN A;  2QQ8 A;  4BXU A;  2FD5 A;  3P9K A;  4O6J A;  5CKT A;  1KU7 A;  3UKG A;  2HDD A;  5F0H A;  1T08 B;  1KYZ A;  1MW7 A;  4E7Z A;  4KIC A;  4YFK F;  3DU5 A;  2L9V A;  1VQ4 I;  1YFH A;  2X0L A;  3LST A;  3UR3 C;  3CJT B;  5D8L B;  2L2O A;  4EJV A;  3G4S I;  4Q47 A;  3V8L A;  1NK3 P;  4XSX F;  2F5C A;  5M3F J;  2EFP A;  2EIN H;  2O7O A;  2ZJP F;  3GO5 A;  2PEX A;  3NWS A;  5GP9 A;  5F04 A;  1JI8 A;  2R93 J;  1XGN A;  3A0B C;  4BHC A;  2IT0 A;  2HS5 A;  2X6X A;  3E1S A;  3HEF A;  2OA4 A;  1WI9 A;  1ZN2 A;  1YE9 A;  2W82 A;  2X1E A;  2BY1 A;  1ZG3 A;  3V7C A;  1LDD A;  1Y1V J;  3WGH A;  1P9Q C;  3ABM H;  4ANJ A;  2HFH A;  4LJZ F;  3DBR B;  1BJZ A;  4ZZL A;  1K4T A;  2IGN A;  4BH9 A;  3BRO A;  4OU0 A;  1UJ8 A;  2QA4 I;  2R7Q A;  3B73 A;  2LKP A;  3BJO A;  2QSG X;  5DD8 A;  2D45 A;  1Z05 A;  5JR3 A;  4CGZ A;  2ISY A;  3A01 B;  3HTU A;  3ROU A;  2F4M B;  4CCM A;  3CME I;  5D5W B;  3I9V 2;  1NG6 A;  3F6O A;  3PIP F;  1K7A A;  4RMN A;  5TJJ A;  1SD6 A;  4R8H A;  2OQR A;  3SYT A;  3F8C A;  1GVD A;  2LRE A;  3VDX A;  2K3F A;  5BS6 A;  3HB9 A;  5LFA A;  4Q5S F;  3K4M A;  3DEE A;  2NVX J;  2V1D A;  4PGG A;  1ZR4 A;  4MEX F;  2QVO A;  2ZNZ A;  4M9Z A;  3H1C A;  4M3B A;  1XMA A;  3BR1 A;  1FP1 D;  4E7L A;  2H09 A;  3ELK A;  3GXO A;  1BI3 A;  1YRN A;  2VE9 A;  2LSO A;  1WHU A;  3TOA A;  3R4K A;  2HXO A;  3PSF A;  1DGR M;  2EJR A;  3DBH B;  3A03 A;  2DFI A;  1I50 J;  5H6Q A;  3J81 Z;  5L3G A;  4JBA A;  4YIF A;  5EF6 A;  1Z3Y A;  2ZME A;  3ZMT A;  2X48 A;  3QYB A;  4B3A A;  4EEF G;  2EBI A;  2Y0S N;  1ZEL A;  3FKI J;  2LH9 A;  2XGE A;  1F43 A;  2OV7 A;  2H8R A;  3K10 A;  3AG2 H;  1OIS A;  4E7K A;  2VAS A;  5L3B A;  1QZY A;  2XGX A;  3ECO A;  2ACJ A;  1Y0N A;  3PNV A;  2DA4 A;  1AHD P;  4AYB N;  3PO3 J;  3QU3 A;  3S16 J;  3M8F A;  4X1E A;  4BHP A;  1ETY A;  2V7F A;  3SDB A;  2PLY A;  3PJR A;  4Y13 A;  3FMR A;  1PP8 F;  1NHA A;  4DZJ A;  1MSF C;  1P7I A;  1MDM A;  2QQB A;  4A3J J;  2LVS A;  3JRB A;  2KPM A;  1A6I A;  4S0H B;  5DV5 A;  2P5V A;  1I6H J;  1R23 A;  3JRD A;  4MHG A;  3U21 A;  1U6G A;  2X9D A;  3OSF A;  1HSJ A;  2IP2 A;  3S32 A;  1X1B A;  4IQJ A;  4MQ9 F;  4PUS A;  3BPV A;  1J75 A;  2UZK A;  2PMH A;  5EDN A;  2JSC A;  2M30 A;  1FEX A;  2E34 A;  4RLQ A;  5D4R A;  2CUZ A;  4OAY A;  1UST A;  4BJT A;  3CCJ I;  3OYD A;  4XKW A;  2K86 A;  2VQG A;  1V55 H;  3ZMD A;  1ZGJ A;  4KMF A;  3OS0 A;  4NBQ A;  4R1H A;  2W48 A;  5J1R A; 
#chains in the Genus database with same CATH homology
 3MKZ A;  2K3P A;  1BOB A;  4ZDL A;  2M7A A;  4CH7 A;  2K9M A;  1ERD A;  1D1A A;  2QKM B;  2X1D A;  2DCE A;  3CES A;  4AYB A;  1BR1 A;  3BG6 A;  4XNF A;  2CV2 A;  3A1Y A;  3W2W A;  2MD0 A;  3PNT A;  1MMD A;  4Y33 A;  3OS1 A;  2IGO A;  4ZYA A;  2W1O A;  3S93 A;  1V5E A;  1QU3 A;  3HOT A;  1Z7L A;  3IUO A;  3H5N A;  3M1C A;  1MNE A;  3VWB A;  2XF7 A;  1WJE A;  3OYL A;  2DJI A;  3AFH A;  2RNG A;  2JVH A;  1X1D A;  4C2T A;  2LG4 A;  2VKH A;  4U7B A;  5KHD A;  4ZC3 A;  1EA3 A;  2HPI A;  3TL4 X;  2Z16 A;  1UG0 A;  3H0D A;  2MAB A;  1Z21 A;  5KCM A;  1X19 A;  1Y56 A;  2HVQ A;  1D0X A;  4PJL A;  4IKF A;  4HPQ A;  3A4C A;  3K4L A;  3HUG B;  3V42 A;  1S9H A;  2E60 A;  2O5R A;  3DWL E;  4CA0 A;  2R7S A;  5FRM A;  3H9G A;  4R79 A;  3VYR B;  3TBI A;  1W36 D;  1TZL A;  3OY9 A;  3LSH A;  3RCO A;  4B43 A;  3CF2 A;  2AQF A;  3DTK A;  2VJ4 A;  3EPZ A;  3PNY A;  4BEH A;  2E1M C;  2KLO A;  3C2H A;  4NC8 A;  2R7W A;  2HNH A;  3IAS 2;  3HKZ A;  2JUG A;  4LIT A;  2UUZ A;  2CW7 A;  3AKZ A;  3L2R A;  1N78 A;  3NWT A;  3GBG A;  2X6W A;  2WAD A;  4XL9 A;  3BLY A;  3K4K A;  1LDK B;  3QYF A;  3SZG A;  4CZC A;  2HPM A;  2M3A A;  4BS9 A;  2K9L A;  2I8D A;  4RM2 A;  4Y4R A;  4U87 A;  2JVG A;  3MD2 A;  4BGD A;  3K4N A;  3DPU A;  2ZFU A;  3VYT B;  2XF6 A;  3VSL A;  5LD2 C;  4C9Y A;  3C2G A;  3IP4 B;  1PJR A;  2W00 A;  4KIT B;  5FRO A;  3H9J A;  3DTI A;  4QPQ A;  2CV1 A;  1QHH D;  4DJA A;  2LBF A;  2L5Q A;  3FKJ A;  3EUH C;  4BQO A;  4PSW A;  2IGM A;  4XOP A;  3F9K A;  1IRX A;  3MKY B;  2A5W A;  2JA2 A;  3DLA A;  4XOR A;  3ZXS A;  3ZR8 X;  4XQF A;  2RRE A;  3OYH A;  3FBI B;  3LSI A;  1WJB A;  4JQF A;  4X0G A;  3I3L A;  3M8J A;  3OYJ A;  4CCJ A;  3DU6 A;  2X1C A;  4HSR A;  4PFP A;  2IS4 A;  1T0F C;  2BVM A;  3SEZ A;  4BQQ A;  4BE2 A;  2DOA A;  4BQN A;  2KHM A;  4PFO A;  4PJN A;  4BXF A;  2M4K A;  4D9J A;  2JSP A;  4XLA A;  4NQW B;  4HNU A;  1LFP A;  2KL4 A;  3CZ6 A;  1YX5 A;  4XLH A;  2WAF A;  2HDW A;  3TMO A;  2K5C A;  2RQQ A;  2PMZ A;  3HOS A;  3K4C A;  2Y0S A;  3H5A A;  4J01 A;  1MMA A;  2CS3 A;  4FAS D;  3H9Q A;  3K4J A;  3QOD A;  4E6K G;  4CCL A;  2XDV A;  2L9S A;  1OR7 C;  4IX7 A;  1MMN A;  3OIP A;  2GOX B;  2VJJ A;  3OYN A;  2ZSI B;  2KQR A;  1WJC A;  4HNT A;  2Q1Z B;  5CQG A;  3LMM A;  1MMG A;  2X51 A;  2ELJ A;  3PFY A;  3A2K A;  2VQH A;  4XN0 A;  1WJ5 A;  4KIS A;  4XKC A;  2VB6 A;  1D0Z A;  2X6Y A;  1Z3X A;  2WB1 A;  4DIQ A;  3DPL C;  4XLC A;  2KRC A;  4Y3O A;  1D1C A;  3PL8 A;  3KX2 A;  4LG3 A;  2IS2 A;  3RQ4 A;  4II2 A;  2V9K A;  3S3N A;  2BW3 B;  2GOM A;  3ZCO A;  5JHF A;  3VYS B;  2HQA A;  3N05 A;  3W3C A;  3OYM A;  4F55 A;  2BVL A;  4AU7 A;  2LY1 A;  1LKX A;  3DPT A;  2IXS A;  4PSX A;  3L2Q A;  3VYU B;  3LFU A;  3BCA A;  1X1A A;  4DBQ A;  2PJR B;  2R7X A;  2DT7 B;  3HL2 A;  1X1C A;  3AL0 B;  2OC6 A;  3CJR B;  5KNL A;  4MLO A;  2VLA A;  2R4G A;  2QKL B;  2WA0 A;  2DXI A;  2VJ5 A;  2WY8 Q;  2XSJ C;  4E7J A;  3OS2 A;  1V5F A;  4F91 B;  1X4O A;  3UNG C;  2ZSH B;  2VXD A;  3ONQ A;  2F5V A;  2CMP A;  3ZRG A;  3HG9 A;  2HVR A;  3OYI A;  3HPG A;  4XKV A;  4CCK A;  3E0J B;  3KEY A;  4DBR A;  2VIX A;  2CH0 A;  3K6G A;  4BU2 A;  3FDY A;  3OYA A;  2VKD A;  1DP3 A;  4F92 B;  1SFK A;  1AA7 A;  3D5L A;  1J09 A;  2KRH A;  4BUP A;  2Z1D A;  3S3M A;  1W36 C;  2X85 A;  2M7B A;  3OL3 A;  4DOZ A;  2E5Z A;  3J7A Y;  1LVK A;  2HZD A;  2OUM A;  2WAE A;  4E4H A;  3OIQ A;  1X4P A;  4HRI A;  2XC7 A;  2M4G A;  2W4S A;  4LIV A;  1UEL B;  3BCB A;  3OR2 C;  4FET A;  4F3Q A;  2VXZ A;  5HOO A;  2R7V A;  4ZDO A;  3CP2 A;  4GRI A;  1D0Y A;  1V5G A;  1N75 A;  2P0W A;  4C30 A;  4XON A;  1PYV A;  2KP6 A;  3W2A A;  4XM3 A;  2IS6 A;  2KDO A;  4XKB A;  2R7U A;  3RPU D;  3OL4 A;  1WJD A;  3FHN A;  2IS1 A;  2KMU A;  2M0M A;  1G8X A;  4BDY A;  1UAA A;  2V26 A;  3LSM A;  4LIU A;  4YEJ A;  2ZXI A;  1TT0 A;  1K6Y A;  4ITV A;  4B47 A;  2LRD A;  4XMY A;  3PSI A;  4BAC A;  4BEH B;  3LSK A;  4E7S A;  4RLF A;  2NOJ B;  4P1W A;  4PK4 A;  3EUK L;  3DKX A;  4B3X A;  2LC2 A;  2W7N A;  1BR4 A;  4ZDP A;  4NNJ A;  3DKY A;  4OAZ A;  2UWM A;  4KJZ A;  1HA8 A;  3ZQQ A;  1YX3 A;  2DT6 A;  2L9N A;  2LY2 A;  3HXL A;  3S3O A;  2XF5 A;  4H4K C;  4C2U A;  4NC7 A;  2A6T A;  2UV1 A;  2BOL A;  2V4J C;  3BC8 A;  2E5N A;  3CJQ B;  4CCN A;  3CMM A;  2BW3 A;  4P5O A;  3OYE A;  1E0E A;  1WFX A;  1DQU A;  3HPH A;  1WJA A;  1DGW Y;  2R7O A;  4ZJZ A;  3K4B A;  2CW8 A;  2HVS A;  3BG7 A;  3W2V A;  4PJJ A;  2CFO A;  3OYB A;  3OMY A;  3HC7 A;  2Q2E B;  3OYF A;  3IAM 2;  2PJR A;  3MKW B;  2WY7 Q;  2V1N A;  5CKT A;  3ZGK A;  1GLN A;  3LSG A;  2HU9 A;  3L2V A;  4CCO A;  1MW7 A;  3AL0 C;  4E7Z A;  2L7K A;  4HST A;  3DU5 A;  3OYK A;  2VJI A;  4II3 A;  1KON A;  3UR3 C;  2L2O A;  3D5S C;  3FBN B;  4XLF A;  1FMW A;  2CUJ A;  1VZ0 A;  2MC4 A;  4AVZ A;  1D1B A;  3NWS A;  5HNF A;  1JI8 A;  2WBM A;  3H5R A;  4E7H A;  2ZXH A;  3L2U A;  3E1S A;  2X6X A;  4IZZ A;  3EUA A;  1YE9 A;  3QOE A;  2W82 A;  5HVQ C;  3SEQ A;  2X1E A;  3MMY B;  3RSN A;  4BDZ A;  2WAQ A;  4IQ4 A;  3OR1 C;  4BL0 B;  1P9Q C;  3LL7 A;  4ANJ A;  2LYC A;  4DGW B;  2IGN A;  2R7Q A;  3G2B A;  4XR6 A;  3L2W A;  4CCM A;  4OWR B;  3I9V 2;  1NG6 A;  4RMN A;  4G6T B;  3SYT A;  1MND A;  4HEA 2;  4J00 A;  2LRE A;  3VDX A;  3CP8 A;  5HLT A;  5LFA A;  3K4M A;  3DEE A;  1Y6I A;  4JOM A;  1FMV A;  2IGK A;  4B48 A;  1R6R A;  3QYE A;  4KT6 A;  1QHG A;  2VPL A;  3OYG A;  1N77 A;  1OLT A;  1SAU A;  4E7L A;  1NG7 A;  4N4N B;  5CQE A;  4BE1 A;  2V6E A;  2AQE A;  3PSF A;  1DGR M;  1WJF A;  5HNH A;  5CPR B;  3D5R C;  1Z3Y A;  3QYB A;  2E1M B;  4NUB A;  4CSW A;  2MFZ A;  1ZEL A;  2LOO A;  2LH9 A;  2MYS A;  2OV7 A;  3K10 A;  4QPO A;  2R7T A;  4E7K A;  2VAS A;  4EAT A;  4XN3 A;  5FRN A;  2XAU A;  4YRV A;  4BJ6 C;  4RM3 A;  3PNV A;  4HG2 A;  5TGT A;  4XLE A;  2VQC A;  3DTE A;  3RTR A;  3K70 D;  2V7F A;  3SDB A;  1U0J A;  3PJR A;  4F93 B;  4D1Q A;  2F6C A;  2VQL A;  2KPM A;  2VL8 A;  3OOU A;  3OYC A;  4B44 A;  2FUG 2;  2F4I A;  1T95 A;  4F52 A;  1G59 A;  3U21 A;  2R7R A;  4ZTJ A;  3S32 A;  1X1B A;  3VSK A;  4IQJ A;  4ZTF A;  4PUS A;  4PJM A;  4BE0 A;  3PUB A;  1BR2 A;  2CV0 A;  4XOT A;  4BJ5 C;  3DQV C;  3H35 A;  3KYL A;  4RLQ A;  3S8P A;  2CUZ A;  4OAY A;  4BJT A;  3OYD A;  4N4O B;  4XKW A;  2VQG A;  2LBF B;  3K70 C;  2KZV A;  4YEL A;  2Z2S B;  3OWT A;  3OS0 A;  4CUG A;  4E7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...