1WJEA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
total genus 12
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjeA00
1WJFA 1K6YA 1LFPA 3HPGA 3HPHA 1WJDA 1WJBA 3F9KA 1MW7A 4F3QA 1WJCA 1KONA 1E0EA 1WJAA 1WJEA
chains in the Genus database with same CATH superfamily
4RS8A 1TNTA 1UHSA 4BJ5C 3ASNH 4NUBA 4QIWN 1IF1A 1DPRA 1UHWA 3PQJA 3VB2A 2X1DA 1HBXG 4IX7A 1XDSA 3HOYJ 1BIBA 2KIMA 2IEKA 4D9JA 3L2QA 1W36D 1UMQA 1FPQA 1FMVA 1PUFB 2DQRA 1MD0A 3AKZA 4LOCA 3WG9A 4U88A 2R5YB 1VQ8I 2M9HA 1AA7A 2NNNA 3CC7I 3SYTA 4XRSA 3A01B 1OKRA 3CUOA 5CPRB 3G1OA 1O7LA 1FWZA 1WI3A 3R0AA 3ULQB 1U9OA 1ETVA 3DTIA 2CWEA 3Q3SA 1FOXA 3WG7H 1FLIA 2STTA 1G2HA 2HU9A 2WC2A 2FBHA 3DEWA 1S8NA 2E7WA 2Y0SA 3B6AA 3S2DJ 1FOYA 3UNGC 1ETWA 1MW7A 4C9YA 3OL4A 2X51A 4UXNA 2VPRA 2K3PA 4QTRA 3IKVA 4F52A 2MC4A 1V5FA 3CJQB 2V6CA 5FO5A 4DIQA 5BQTA 1G3TA 2WAQN 2ZJ2A 4XORA 2A5WA 1F5TA 2A6TA 4CCOA 4CICA 4FCYA 4XICA 1ZLKA 2EFNA 1JI8A 2PEXA 4WXCA 2HZDA 4A0YA 3BCAA 3WTYC 1WJ5A 2NAZA 5E3MA 2CQNA 3NWSA 5EGOB 1VFCA 4RM2A 5GAHJ 3CJRB 4PJMA 1VQKI 4WF2A 3SFIA 2R5ZB 3JTGA 5EZGA 2AO9A 2Z2SB 2PJRB 1TW2A 4UUSB 1A6IA 3ZQFA 1ZKGA 3KP7A 4ON0A 3HM5A 4PJ0C 4BGDA 3SQNA 2COBA 4HNUA 2AS5F 1G3SA 4BL0B 1ZRFA 4HX4A 1GLNA 3LL7A 3Q9SA 4E4HA 3DKWA 3J7ZI 4UY8I 1Z7LA 1ZYRF 4CCMA 1IUYA 1OJLA 3L2UA 1I5ZA 1MNEA 3KETA 2ZKZA 2P6SA 4RLFA 4ENNA 3CJNA 2QZ8A 3M7GA 4XM3A 1VQ9I 1IN4A 3QQAA 4FQGA 4LIUA 1QPIA 3QPLA 4CXFA 3WE2A 3T8TA 2QWWA 4XRMA 2ZC2A 2H6BA 2CV2A 3FM3A 2HQNA 4MFEA 5E8IA 1IUFA 1YYVA 2K3FA 3HUGB 3VYSB 2ACJA 4CZZA 3CCLI 3VPRA 1ON1A 4P1WA 2LY1A 1FOWA 4HQMA 2YU3A 2R7VA 5GTIC 2F5DA 3ZMVA 3SZTA 3H9JA 3IV5A 1D0XA 4LK0F 3WODF 3LSHA 4A3KJ 2JQ7A 1Z7UA 3K1NA 2F5VA 2V4JC 3DBLB 3IAM2 2H09A 2TRTA 2E2HJ 3KFWX 2BBYA 2XV4S 2M7AA 5D6EA 3JRAA 1B72B 3D5LA 4LB6B 3CMYA 1B8IA 3JRBA 3IP4B 1RESA 4Q4ZF 2G7HA 4X0GA 1UZCA 2ESNA 4AUXA 5GAEJ 4HF2A 2R7OA 1B6AA 2BHZA 2IA1A 3H5NA 4Q47A 3M8JA 3IL2A 1VQNI 3GTQJ 1PYVA 2X6WA 1TWGJ 3CCJI 2JA5J 5J8FA 5DCMA 3L2VA 2DK5A 2IP2A 2CQXA 2IXSA 1MDMB 3DF8A 3HOTA 1FJLA 3R4KA 1KU9A 3ZCOA 4NNJA 3AG4H 3CF2A 4XLFA 1JE8A 4RB0A 1Z21A 1OR7A 4B8XA 4W97A 3CDLA 2K4BA 2XPUA 4OMYA 5J40A 3TO6A 2VKDA 2OJED 2KL4A 1PP7U 3EUHA 5EZHA 2V9KA 2LBFB 1ERDA 5M5XJ 4HF0A 4EJWA 4WCGA 1DQUA 2D5VA 3GF2A 1NK3P 2V6EA 1FTTA 1IRZA 2R7WA 1YFHA 3LFKA 2BW3B 4CO8A 3IRRA 1VNDA 2K9NA 1SMTA 1ZREA 4MHGA 1LPQA 4KFCA 3PIOF 2ZB9A 2A68F 4BQNA 3F22A 1FYKA 4HX7A 2K4JA 4IRGA 3J80Z 2XKOA 2BV6A 2XAGA 1K7AA 1D5VA 1EV7A 1CQTA 5DUIA 2JRMA 3H35A 3S2HJ 3CMEI 5E1ZB 5K5OA 3C2BA 1P4AA 4XSXF 1MZBA 3RTRA 2V1UA 3NRVA 4BAYA 1K83J 3OYEA 2P5LC 2XHKA 2VXDA 2L5QA 3ECHA 4IF4A 3TOAA 2Z5UA 3KP2A 2IGNA 3DBRB 2VOPA 1X58A 3CZ6A 3RYRA 3VFZA 4B4CA 2F4MB 2RAEA 1W36C 3S1QJ 1W7PA 4IRHA 4JQFA 4E7JA 2UXNA 3PNYA 1MBEA 4CDGA 2LSOA 3WGGA 5LFAA 4IPAA 2JA8J 1TBXA 3KP4A 4B43A 2DQLA 3V8JA 5JFRA 2CUZA 1J09A 4IQ4A 2EBIA 3G4SI 2XRLA 1QHGA 4P9UA 2V9VA 1E17A 3QOPA 2F2EA 2X6OA 1ZGJA 3LSKA 4D7NA 1WJEA 4LLNA 4GYIA 3C2HA 2L0KA 3SXYA 2ZNYA 1BOBA 3G73A 2MYSA 4AIKA 1JGGA 4NHJA 2VOOA 3WU2C 1O7FA 4OIOF 1LDKB 2O3FA 3IHUA 3IC7A 5JI6A 4M6XA 4PDKA 2HR3A 2CQKA 2ECCA 4G94A 2NVUB 2CUEA 3DU6A 1BIAA 1X3ZB 4B47A 3I55I 3BZ6A 1EJ9A 2VI6A 4X1EA 3DP7A 3MN2A 4LMYA 3KEYA 4G9YA 4AC0A 2Q0OA 3LQRA 4BHPA 3KE2A 1HLVA 1WFXA 1KU7A 2LF8A 3ERED 4GDFA 3FF5A 1KQ9A 1WGXA 3VODA 2KIUA 3OV8A 2RN7A 3BR1A 2IW5A 3GZNB 3VOEA 4I09A 3WHCA 3ZQIA 3O6BB 1JGSA 2L7KA 3WTUC 4YFKF 3I59A 5DTDA 3T1BA 1TW3A 3TP0A 1SANA 2VBYA 4BE0A 1QPMA 2VE8A 1DU6A 1SVLA 2FNPA 2E35A 4ZYGA 4MQVA 4LLGF 2XSJC 1H9GA 1B4AA 2BY3A 4BS9A 3JRDA 1X1AA 5BPDA 4ZC3A 4ENMA 3S3OA 2Z3YA 4EATA 2ZSIB 3H0DA 1X4OA 3U1KA 1JKOC 5A2QZ 3RPQA 4N9HA 4C3HJ 3O3KA 1MBKA 3JAMK 1YLFA 3U21A 2MD0A 2IAIA 3K0LA 2K27A 4XN0A 5IT3A 1WCMJ 3R6SA 4G7ZF 3S3MA 1MSEC 2CH0A 1R5GA 4M74A 2DOAA 5IP9J 2ZJQF 1R1UA 2BW3A 2RKHA 5GP9A 3S15J 2BY0A 4KN4X 4I7HA 1DGRM 1D0ZA 1RR7A 2WY8Q 3TW6A 4U0WA 1JTYA 4FASD 2LBFA 3KLNA 4RGRA 5IOZA 1F36A 3COAC 5IPAA 2GZWA 2JA7J 5EDNA 4CCLA 1R5ID 2ZXWH 2EILH 3LAPA 3WHBA 5EEHA 1HCRA 1K6YA 1RKWA 4XIDA 1IO2A 3GLXA 1S7AA 2DT7B 2E60A 4ZZLA 1U5TC 3AFHA 2HYGD 2E34A 4I6ZA 5C4XJ 1TP4A 5LHHA 2OQRA 3EYYA 2ZXIA 2BHYA 3IWFA 4XOTA 5K7ZA 2L9NA 2XF6A 3MZYA 1C0WA 1FNNA 1RIOH 4L5JA 2O0YA 3OYLA 2KZVA 3CLOA 1FYLA 1TQMA 3W2VA 3X2QH 3CCQI 4E7LA 1FOKA 3I4MJ 5BOXA 2DFHA 2DJNA 2XC7A 1OFCX 3B6CA 1SD7A 2PG4A 2E1NA 3RKXA 1REPC 3PUBA 3WE3A 1LEBA 2NYXA 1EH6A 1IC8A 3CMMA 2D2WA 1ZN2A 4W1UA 2P6TA 3TMOA 3A2KA 1XGOA 2GOXB 1IDZA 3IRQA 3IWZA 5B1BH 2KZGA 3L9FA 4BYYA 1KA8A 1U9NA 1LE8A 3FZVA 2OA4A 3ZP5A 1G3WA 3HOWJ 1WJBA 2Y31A 4NC7A 2H94A 1HSTA 3BR6A 5LRSA 4Y52J 4KICA 4QPOA 3HYIA 4JK1X 3OOUA 1AU7A 4G7OF 4A3JJ 2JVHA 4XK4A 5B5EC 3D0SA 2Y0SN 5FRMA 2LK2A 2DJIA 4Y17A 2DA7A 1GVDA 3FXMA 4I99C 1X3UA 2RC4A 3LSJA 1Z05A 4ZYAA 4IHVA 4IHTA 2ME0A 1YO5C 5IYCJ 1O3RA 3WGIA 2VKEA 3FXRA 4LLLA 1EA3A 3MKWB 1UG0A 2AHQA 4AWXB 3G1MA 3NQOA 2DTZA 3I58A 4F3QA 3GEZA 1SD4A 5HDKA 2BXZA 1HC8A 4A3EJ 2F4OB 3KEOA 3KZIC 3K9TA 1S9HA 2ID3A 4BU2A 3K4LA 2YUSA 3Q9VA 1DU0A 2E1MB 1LUJB 2QGUA 2XPWA 2P0WA 4M9ZA 1QO0D 2B7EA 2EIKH 3ZMDA 2B9SA 2FOKA 4MEYF 2EIMH 2HQRA 4PUSA 2W48A 2D1VA 1QA6A 2WB1A 3K4JA 1FYMA 1VF9A 2M8GX 2XSDC 1A04A 5F1JA 5CVIA 5HDGA 2IJLA 3ABKH 3P5JA 1A31A 3S16J 2A69F 1CF7B 1WI9A 1UCRA 2DMNA 3K2ZA 4PCQA 1PUEE 3HBLA 1BI0A 2O8XA 4PJNA 3RZOJ 3HGYA 5FD5A 3QP6A 2EA2A 4Q5SF 3SEQA 1MMDA 1YW7A 4JP0A 3BR3A 1U6GA 2F48A 1OCRH 2OTLI 2DA2A 2WTEA 2PN6A 2NVQJ 5J4YA 1YS6A 2QQAA 3AL0B 1QRYA 2STWA 5K7FA 3C7JA 3S93A 1EF4A 1P2FA 2L9SA 5F64A 3WU0A 3S14J 2R7SA 1UAAA 1OYWA 2VODA 3Q0UA 1MNMC 1E2XA 2C6YA 2OZ6A 1UELB 2XROA 2YSRA 3I0TA 2RNJA 5D6FA 3HC7A 1Y39A 4BY1J 2DU9A 4MQ9F 3Q5FA 4KITB 2FOWA 2OD5A 1B1BA 3U2RA 2OBPA 1ORKA 2NNYA 2HGCA 4MLOA 3KEQA 5CVRA 2KIQA 4M3DA 1IN5A 3BR5A 2ELKA 3CF5F 3GZ6A 2R93J 4A3DJ 1BA5A 4BDYA 1V3FA 5M5YJ 1BC8C 3RPUA 1UJ8A 2GXGA 3UR3C 2JK3A 4LFUA 3E6MA 9ANTA 4UB6C 1P7JA 2CFXA 2VBXA 3M1CA 2JTVA 2UZKA 1O3SA 4V2FA 2E1OA 3K69A 2X48A 3MEXA 4NC6A 2Z99A 4AIDA 1XTAA 2CUJA 4E7IA 2JPBA 4CSWA 3HEFA 2OQGA 2Y9ZA 1P9QC 1WWXA 2YX4A 1JTXA 2KRCA 4E7SA 1F1ZA 2W57A 1DP3A 4XLCA 1EKEA 1FSHA 3SEZA 2DDAA 2VKHA 1S72I 2DA4A 1XX5A 5AIPA 1XGNA 2V1XA 5CJ9A 3V7CA 4KN7X 1TQIA 4MEXF 1LEAA 1NHAA 3BQZA 2DMUA 1M1EB 1VQMI 3D5SC 5H6RA 1FBSA 3KPHA 3G2BA 1U8RA 3GFLA 4H0EA 5JVGF 1HW5A 5L3GA 5LEJA 3CCSI 1JT6A 4JBAA 1SEUA 1LE8B 3EPZA 2HPIA 3IUOA 1WJCA 2HKXA 3H3ZA 4DGWB 2HDDA 2EV0A 3ISPA 2RNGA 3OR2C 1R9TJ 1ON2A 1V5GA 3ABUA 1YTYA 2A6HF 2BY2A 2G0EA 3ZGKA 3UKGA 2DMPA 2Z33A 4LJZF 3GO5A 4D5CA 4M71A 2XAUA 4GO1A 5E8GA 4E6KG 4BQAA 1J5YA 2X6YA 2XF5A 4HX8A 3M8FA 4DYCA 3HOUJ 2Q2EA 1Z91A 3MQ0A 3HXLA 4A6EA 3MCZA 2O6GE 2PMHA 1OQYA 5HS8A 3FXLA 1OPCA 2KP6A 2VKVA 1ETQA 2CSOA 2W84A 2JA2A 1NTCA 1UG2A 1Y56A 2LDUA 3AG1H 4M3GA 5IT9Z 4HF1A 3L09A 1ONVA 1Q1VA 2W4SA 3BJ6A 1PVEA 1K78A 1OCZH 3A4CA 2HOSA 2M0CA 5HLTA 2VUMJ 3ERMA 5GTHC 3K70C 3G3ZA 1XS9A 2XUBA 2XAHA 3LA2A 2WBMA 4L0ZB 4M3EA 2XDVA 1BOAA 3H3UA 3KP6A 5AONA 3HG9A 3GTJJ 4U7BA 4IJAA 4KISA 3A0HC 1F43A 3PQKA 2XB5A 2B63J 4G7HF 2EFQA 5J3LA 4A5MA 2H8RA 4HLXA 2MG4A 2NXNB 3EDPA 3VDXA 4M6YA 4BEHA 3AG3H 1K78B 1J75A 2EINH 1YX3A 3LSTA 1W7PB 2AXLA 4IVNA 5FFXA 2UV1A 2ID6A 3TQNA 2HWVA 3BT9A 1ITYA 3HSRA 2LRDA 3SFZA 1KQ8A 1TT5B 3DFGA 2VQGA 2HOEA 2HNHA 3W6JB 5J1RA 1OLTA 1AKHB 2QQ8A 1K61A 2V1NA 4OIPF 3GTLJ 2EA4A 3S1NJ 2DTRA 5KAFC 4XRFA 2FE3A 5FLXZ 1XG1A 3W3CA 4BEHB 2N8GA 3WTVC 2ZFUA 2HYJA 2J5OA 3CUQC 2DLLA 2ECBA 3B73A 1KU3A 2L2OA 3GCMA 2X4HA 3PNVA 3BPXA 1TQPA 2EPFA 1LFPA 3IH2A 2KJBA 4NC8A 3ZXSA 2DK8A 2CO5A 4ZYDA 1IXSB 1D8KA 3FXOA 1YRNA 3GFJA 4CYDA 4L18B 3BLYA 3GTGJ 1V4RA 1SVOA 1MMSA 2HDWA 3JRCA 4LG0B 4J00A 2YX7A 1H89C 4KIGA 4A93J 2E19A 3QPTA 2WA0A 5BPIA 2F5FA 3EUHC 4A2UA 4HV5A 4BY7J 2HVQA 2VT2A 1W5TA 2FUG2 1SAUA 1ZR4A 4OWRB 3J81Z 1RR8C 2CJJA 2BZTA 3KP3A 1RUOA 1WHUA 1GHCA 3T8RA 2W24A 2LKXA 2CRGA 4J19A 3OYAA 5DCMB 1OYYA 3PSIA 1E3OC 1Z6RA 1TWAJ 3HGGA 1OCOH 2XVCA 1QZEA 3QWLA 4UUVA 1U3EM 1D1BA 2BVMA 2OV7A 4RA2A 3DPTA 2O8KA 1YIJI 1WJDA 4F93B 2PMZA 3KIOA 1EH8A 5K5QA 2PBIA 1VQ4I 3R0JA 1MBJA 1QHHD 3CDIA 1PJRA 2FNAA 5F04A 4EVIA 5HNFA 2IA2A 1S29A 5M3MJ 4PK4A 5IP6A 2K85A 2DMQA 4RLQA 2L9VA 4B48A 1YG2A 2P5KA 3GW2A 1R1TA 2H1LA 3H36A 4MTDA 2E1CA 4BXUA 4Y3OA 4HYEA 1O3TA 2R3SA 4I76A 3RZDJ 1H88C 1XDUA 5CVVA 1KGSA 2EZHA 4ZTJA 1Z3XA 2K9SA 1S7EA 2X1EA 3I54A 4RBOA 3CJTB 2YPRA 1VQPI 3QOEA 2XKPA 3RQ4A 1U0JA 3RI4A 4HQEA 1VTNC 4XLHA 5DD8A 3VYRB 2QM3A 4HA8A 2XAJA 2DAOA 4UVAA 4CUGA 4AVZA 4N4OB 3TGNA 2CW7A 2VIXA 4UV9A 4Y4RA 4LIVA 5LBQA 3A02A 3EUAA 3KZZA 2QEXI 3BDDA 2IVMA 3ZRGA 4OU0A 3O8HA 5HVQC 4KUMA 5HODA 2L4AA 5CKTA 2LREA 2EV5A 4KJZA 5TJJA 1KU2A 2K5CA 2MD5A 1MMAA 2V7FA 3MKLA 3K6GA 3IH4A 3LA3A 4G6QA 1UFMA 5M5WJ 3ONQA 4G6DA 1MIJA 3JTHA 2EZLA 2W85A 5E20A 4Y7NJ 3FHNA 4G12A 1R71A 4QPQA 3RJPA 5F1RA 1B8IB 4O6JA 4RDUA 3CESA 1B72A 5B66C 1TWCJ 1HW1A 2QUFA 2Q1ZB 3FHZA 1XSVA 4D1QA 2FX0A 2DT6A 2HPMA 2VC0A 2V26A 1XGSA 4AIHA 5A2QK 3KP5A 3OSFA 3BOQA 4WWCA 1D8JA 4UVBA 1W0TA 5LLQA 2GXAA 2QSFX 4V19K 1YW9A 3I64A 2FF4A 1QGPA 2L9RA 3HPHA 4B44A 1ETKA 5J4VA 4XRSG 1T33A 4OINF 2GBYA 1Y1VJ 3BP8A 2FJ1A 5C44J 3CD6I 3VYTB 4KNYA 2LOOA 2BYVE 1JKQC 1CF7A 1X4PA 3ZQ7A 4A69C 4S0HB 3OMYA 4A3BJ 2CG4A 3FMSA 4EJVA 1KONA 3AG2H 4XL9A 1XSDA 3GTMJ 2XF7A 4A0ZA 2KQRA 5EF6A 1R4MB 2VONA 3L2WA 3BR0A 1X3WB 5J6XA 3G71I 1CGPA 4UUSA 3HHHA 5E3OA 1HSJA 1BJAA 5EJCA 4JX5A 3F6OA 3HOZJ 4KMFA 1SAXA 3K10A 2CMPA 4RAYA 2YR2A 3BG6A 5JLWA 4D0PA 2LKSA 2IT0A 1XD7A 1IXRC 3GXOA 4RMNA 4IHYA 3GTOJ 1BL0A 3F6VA 3FIWA 5CYVA 2JZYA 2ZMEA 4J01A 2MSYA 4HZFA 1ZGWA 1ZQ3P 1IV6A 1HQCA 1Z1DA 2KPMA 2FQ3A 1ZR2A 1Z0XA 1SD5A 4UNOA 2VC1A 5JVTA 4S04A 1LVKA 5DS9A 3I4NJ 2VJJA 1S5LC 1GXPA 1GV2A 3WTXC 1DDNA 3WGHA 2EQRA 4E7HA 2E2IJ 1USSA 5TISC 3JRHA 1K4SA 4ASNA 3DEEA 2FXAA 1JT0A 3HKZA 3REOA 1GUUA 2KRHA 4NB5A 3HRSA 3VSLA 3CCVI 4EJTA 1X1PA 5ILSA 5CVUA 1WSUA 4AYBA 3OYHA 2FQ4A 4L0YB 2P7CB 1I39A 4HDVA 1R5HA 5CLSA 2M8EA 2R5YA 3CCYA 4LG0A 4F7ZA 1R4NB 3BWGA 3FXKA 4YIRX 3ROUA 4N9IA 1PUFA 4S05A 1G4DA 3DWLE 1VI0A 3ABMH 4Z6YA 2LH9A 2MW8A 1QBJA 2BXYA 1XC5A 1E3PA 2R7DA 1HDDC 3BQYA 3K4MA 5LD2C 5K7HA 4HLYA 1L0OC 4OIQF 2A61A 5DD4A 5IT9K 3OOPA 1JJ6C 2M0MA 2J5PA 5J1UA 2DDBA 4IXAA 1FSEA 3JW4A 3BTLA 3U9GA 3P9KA 5D5WB 2EV6A 3I59B 3RCOA 4KA4A 2BEOA 4BQOA 2ICWG 1VQLI 3WTWC 2MH2A 5C3EJ 5B3SH 2RGVA 3BPVA 1SMYF 1I3QJ 2BOLA 3SJMA 1ZAOA 1OYIA 2GIVA 3CUQB 1SD6A 2L7MP 4XKCA 5EYRA 1IXCA 2CQQA 3P9IA 4GCVA 2R7RA 2QF7A 3TP3A 3NWTA 1ETXA 2CFOA 2DA5A 5F0CA 3VSKA 2Y9YA 2DCEA 3W6KB 3ECOA 4H4KC 4ZDOA 1YW8A 4G8XA 1FX7A 1RC9A 2M2EA 3ML6A 3CCEI 2ZFWA 1OMIA 1ZGAA 3KYCB 1WVRA 2DODA 4EGYA 1ZLJA 3ABLH 1BW5A 4CGZA 2H8WA 3FMRA 4XBFA 3TW7A 3G1LA 4A3MJ 2KLOA 1YJ9I 5DUKA 4NQWB 3CO7C 2AQFA 2FEZA 2DW4A 1WH7A 2MBFA 2IGKA 2QBYA 1HOMA 2IA0A 2XIGA 1K79A 2O9LA 2IS1A 4A6DA 2V9PA 3BJAA 3TL4X 3LSPA 2ZSHB 1UB9A 2D1HA 3H1CA 2O5RA 3B02A 4HSRA 3JCUC 3ZOBA 5IP7J 3I71A 5E1WA 4MIMA 1IRGA 2CS3A 1LQ1A 2NS8A 5IOYA 1R23A 1YHQI 1Y0NA 1OCPA 3W6VA 3DV8A 5K5RA 1LDJA 2EZKA 3S17J 1Y1WJ 3MAJA 4ENJA 4C3IJ 1TZLA 2OZUA 4Q48A 2HOAA 4BBRJ 2KISA 5LHGA 4U87A 1USTA 3I9V2 2Y48A 1IDYA 5DCFA 4YG2F 5IY5H 2JT1A 1NH3A 4R8HA 1ZG1A 3KYDB 3IH3A 3NARA 4EV0A 1D1CA 1H0MA 3E5XA 2R4GA 3L2CA 1JHHA 1PDNC 3EUKL 4I02A 2XRNA 3GMEA 5ICFA 2LD5A 4O3MA 5F08A 4MTEA 1IV8A 1ZG5A 4IHSA 2RQQA 3AL0C 1IN8A 2KRFA 3LNQA 1ETYA 3FK7A 3FMQA 5FROA 3MKYB 3DEUA 4CA0A 3SZGA 5FRNA 1LNWA 3PM1A 2RDPA 2NVXJ 2JPCA 2DT5A 2FSWA 3DBHB 1FIAA 2COMA 4M3BA 4BH9A 4FTHA 4RAFA 4BXXJ 5IYDJ 4ZJZA 1ENHA 1U2WA 1MMGA 3FM5A 1H9TA 1W7PD 3EQLF 2UXXA 5H20A 4IZZA 2GIZA 2HXIA 4IL6C 4LD5A 2KDZA 2PI0A 2IS2A 3FBIB 2QCOA 2Q2EB 1WPKA 4GGGA 4ZYEA 3F8FA 4CH7A 4HV6A 3ABTA 4HAMA 3ZN0A 3K2AA 1WJFA 2DFFA 5E1XA 2KDOA 1MJAA 1WKMA 2ISYA 1T8IA 2PX9A 1TT0A 1I1GA 3RKQA 3DTKA 1QNTA 2GLOA 1AOYA 4LITA 1XN7A 1X19A 3HZJA 5JHUA 1TL8A 5BNGA 1X1CA 3HRTA 3OYNA 3KYLA 5HDNA 2H6CA 2I10A 2K02A 2X9DA 3MZHA 1BR1A 1LB2A 1R00A 1IW7F 3FISA 2LNBA 2EB7A 4MFDA 3HUGA 2GAUA 4EEFG 3GYHX 5GAGJ 2W00A 4KYWA 2W1OA 4Z2YA 1I1SA 1LFBA 2GOMA 4PFOA 1TC3C 2Z16A 5CVJA 4HRIA 2L7ZA 2HQ5A 2KHMA 2NRAC 3PL8A 3I56I 2MGQA 2FU4A 4AIJA 3TOBA 4IKFA 1IJWC 4II2A 3CLQA 3Q0VA 2BVLA 4IQJA 3M8EA 2DI3A 3JRFA 4M3FA 3HRMA 2MH9A 3DKYA 2LG4A 3ZPLA 2A3SA 1VQOI 4HG2A 2GXBA 3BTJA 4BBSJ 3HOSA 5TGTA 2EFPA 2FBIA 1IG7A 2CQ7A 3CCRI 4M73A 5D5VB 4U7DA 3WTTC 3L2RA 3U1DA 1TWHJ 2JN6A 1R7JA 3ELKA 3QP5A 3JRGA 2R7UA 4GFBA 2HI3A 1TTYA 5AIQA 4RB1A 4DZJA 2OPTA 3ESWB 1T38A 1IRFA 5BMZA 2M7BA 4XMYA 3FXJA 5DM7F 1W0UA 1IN7A 3CDHA 5HS7A 4BJ6C 4Y13A 1LJ9A 5C4JJ 3HHGA 4EJUA 5HOOA 4GYGA 5FKLA 4PZJA 1R22A 5J8CA 1RKTA 4BE2A 3E6CC 1TLHB 3N05A 2HFHA 4JX6A 3ZMSA 1F4KA 2NVTJ 3S2WA 5BS6A 2WV0A 2G7UA 2D45A 2KIFA 1FP1D 2LC2A 3QYFA 3SDGA 3TDUC 1PP8F 5HLIA 3OIOA 5H6QA 2HTSA 3P7NA 1XMAA 2LMDA 1I27A 1Z67A 2PJRA 4ABZA 5LGTA 3CC2I 3F8NA 1ACIA 4ZYHA 3WTZA 2DFIA 1POGA 2LKPA 4UVCA 4Y15A 4C3JJ 5JR3A 1D5YA 1A6QA 2ZBKA 3OS2A 5HS9A 3OWTA 4FX4A 2ELJA 3BTIA 2MFZA 1X2NA 1GV5A 4PSWA 3OYIA 2Z9OA 2VT3A 5J47A 1KQ0A 5KHDA 4A12A 1QZZA 3OL3A 4PSXA 1FBQA 1GDTA 1IGNA 3LFUA 2OUMA 3GUDA 2MA3A 3FXQA 1JXSA 4GRIA 3OYKA 2QA4I 2JWTA 2FMYA 3JSOA 1IN6A 4PGHA 4BKXA 2Y69H 1X2MA 4OOIA 4ZH4F 4KDPA 2IPQX 1R58A 4I0AA 3FBNB 1DPUA 1OCCH 3TEDA 3A01A 1BN5A 2CW0F 2DA3A 2LY2A 4P96A 3BZCA 3LSMA 2M30A 2R7FA 2PFBA 4FISA 3E6DA 3FK6A 4P55A 3CP8A 2R7ZJ 3OYBA 3S32A 1MMNA 2JA6J 3HTSB 1ZHFA 1D3YA 2UWMA 2IRFG 5D4SA 4HPQA 2AQEA 3K4BA 4RGXA 1JUSA 4AD9A 3VEPA 1MBGA 1FIPA 2JSCA 3OR1C 5ED4A 2EFWA 2BGCA 3GFIA 4ANJA 4XLPF 4KMUX 1YOVB 4HNTA 2CGPA 2ZJPF 2XAFA 5FJ8J 4JYKA 2XPVA 2LYCA 3T0YA 3GLLA 3HSFA 3H5AA 1MBHA 3PNTA 2VXZA 4YELA 5LEKA 2HYFA 1RUNA 3TO9A 4LB5A 5D8KB 3HPGA 4II3A 4QLCU 1OCTC 3Q0WA 2O7OA 4ESBA 3OYCA 3MKZA 4BNCA 2QVOA 2CV0A 1FP2A 1ZG3A 1HXDA 2ISZA 1JKRC 1AHDP 5L3FA 2ZCWA 4BXFA 1D0YA 1W4MA 1Z9CA 2F5EA 2P81A 2DPDA 2R7XA 2Y75A 1GVJA 2WAQA 4N4NB 4ZZDA 3CQZJ 5DM6F 3IKTA 2OF7A 4L9JA 5JLXA 3CCUI 2A5YB 5ICGA 2HVRA 2HZTA 5D5XB 4IOCF 1JUPA 2IGMA 1WRJA 3F9KA 3A03A 1MBFA 2EJRA 2FRHA 2TDXA 3E5QA 3F21A 2Y0MA 1J59A 3ZQGA 1I50J 1FZPB 3GVAA 4I2OA 3S1MJ 1GT0C 1T2KA 3M9AA 4LK1F 4ESJA 3N4MA 3S3NA 1T95A 2R7QA 4HEA2 2PQ8A 5LRRA 3V7RA 4OAYA 2FBKA 2GWRA 4D7MA 4AVPA 2PMZN 3HDDA 2NOGA 2P5VA 3K70D 3FKIJ 1XMKA 3VWBA 2XB0X 4PGGA 4KT5C 1TNSA 1NK2P 1P92A 2M4KA 4RM3A 3TKYA 3MD2A 2X1CA 1P6RA 1K6OA 1ULYA 4G6TB 1ZELA 1BM9A 3FWEA 1YI2I 2K9LA 2EFOA 3L00A 3J7AO 4XLAA 3GTPJ 5KAIC 2M45A 4K2EA 3A1YA 1R36A 4ETSA 4XLEA 1JJ8C 2EWNA 2GM4A 4EM1A 1MSFC 2XGDA 4HDUA 3CC4I 4CHUA 3E0JB 3H3VK 1A5JA 2WV1A 1FC3A 3D1NI 3E7LA 3FDYA 2L02A 3K4CA 4M72A 1YE9A 2AXTC 1XCBA 4YIFA 3ZMTA 1OR7C 3CO6C 4RAZA 1BR2A 2E71A 1X1DA 2QENA 1P4XA 3OIPA 1HF0A 1U78A 2IBDA 3CMAI 2LF7A 4M9SA 2V79A 3BC8A 2OTJI 2X6XA 2R0QC 1G59A 2W25A 1H8AC 2LVSA 2QBYB 1Y0UA 4YEJA 2PLYA 2VBZA 3JAMZ 5D8LB 2JVGA 4FT8A 2JUCA 2RV8A 3OS0A 4BACA 1T39A 5F0HA 4IHXA 1G6NA 2EIJH 1ZARA 2BY1A 4E70A 5FD6A 1EH7A 5JHFA 4F55A 2VN2A 4RGSA 3NAUA 5FB2A 2VBWA 2XGXA 2Y2ZA 1WZ2A 1Y8RB 3CTAA 1T98A 1Z3YA 1IRXA 2K40A 2CUFA 5IYBJ 2DFEA 5EG0A 2KJCA 1LFUP 1FBUA 1E0EA 1XPXA 1MDMA 1J9IA 5FKNA 4PJJA 4DJAA 2F6CA 4C2TA 3PIPF 1ODDA 3O8GA 4UB8C 1VQ6I 2JUGA 2QSGX 3MMYB 4BQQA 4EQQA 5M3FJ 5HLGA 3M07A 3DPLC 1O4XA 5E18F 3J7AY 3C18A 3O2PE 2WB1N 4ZDLA 1WJAA 4C2MJ 2R92J 1BI3A 1W5SA 3LMMA 4XONA 4HNVA 4Y33A 1MNDA 1FY7A 5LGUA 1T0FA 4AM3A 5FGMA 1YJWI 1APLC 3S1RJ 4L9VA 4O5VA 4OMZA 3OYJA 2QQBA 4CCKA 4XOPA 3W2WA 3MVPA 4EMSA 2L01A 4KT6A 4EJOA 2H27A 2QYOA 4ZTFA 5F27A 3GX4X 1ZTRA 4B3AA 2HDCA 1ETOA 5FFZA 4A5NA 2E2JJ 2VQCA 1U5TA 3RQIA 5FKOA 2A6EF 3DLLF 2WAFA 4RAGA 4FX0A 1XMXA 2RQPA 5CQEA 2OU2A 4CCNA 1U8BA 4I98B 4A3LJ 1T08B 1XB4A 4DZPA 4A3FJ 3D5RC 2CYYA 3VYUB 2I5UA 5HNHA 3KX2A 3V42A 4CYCA 3DTEA 3R61A 3ZR8X 4IO9F 3LQQA 3K4NA 1BJZA 4XQFA 2LP0A 4M6VA 4PFPA 4RGUA 3WTSC 1YITI 2EH3A 1HDPA 1N25A 1SFXA 4JX4A 1JUMA 2LY9A 2RVCA 3H0GJ 1KZHA 1J0RA 5B1AH 1KYWA 2K9MA 5GPCA 2KT0A 3F23A 1S3JA 5DV5A 1SFUA 3S8PA 3OYDA 4IOAF 1B59A 1ZRDA 3BROA 2ZMEB 3IAS2 2YS9A 4I0BA 2XGEA 1DGWY 3J80K 4L9TA 4MGRA 2JMWA 3HL2A 2ZMEC 2WY7Q 4IRIA 5FLXK 1K4TA 1UHMA 1SFEA 4IEJA 1GXQA 2P8TA 4P5OA 4ENKA 2VL8A 2OCCH 4BE1A 2EK5A 3GWZA 3H92A 3L7WA 2B0LA 5LHIA 5D4RA 5FLMJ 4B1RA 1RPWA 2CW8A 4DOZA 2QKMB 4DBRA 1KYZA 1P4WA 2O61A 3OYMA 3RYPA 3HSEA 3V4GA 4D5FA 2DYRH 3JRIA 3EYIA 2ETHA 3RKWA 1OISA 4E7KA 2DBBA 1LKXA 2E1MC 4I01A 2HKOA 1XGMA 3OIQA 5GPAA 5ILVA 2M5WA 3LA7A 1FT9A 4XNFA 3V7SA 5DEQA 2NS7A 2VQLA 3C3WA 4GXOA 2FMLA 3PUFA 3HOVJ 3MWMA 3SZPA 2JSPA 4V2GA 5J1YA 2OCEA 5LGNA 3OS1A 2R5ZA 1A36A 2HTJA 3E97A 3LSIA 3M3YJ 2O03A 4MNUA 1O3QA 2ADUA 3GZ5A 1NG7A 2DMTA 5EGOA 1T56A 4NBQA 3K7AJ 3HRUA 6PAXA 3LSRA 4UHTA 4HW0A 2K86A 4TV7A 1G3YA 4BUPA 5H2FC 4F91B 5CQGA 2W7NA 4U0YA 2DOFA 5GADJ 3DPUA 3F8MA 1WQ2A 4WK8F 1BR4A 4A3IJ 4EGZA 3DQVC 5ICEA 4OAZA 4DNCA 2WWYA 3CCMI 2HXOA 2XGCA 3F3XA 3OY9A 4P9FA 1HKSA 2F4IA 5K1YA 2WAEA 3JSPA 3E5UA 5EEAA 2E36A 2X85A 4BJTA 3R60A 3TO7A 2M3AA 4CYCB 4C30A 2DYSH 1RZ4A 3LWFA 1V54H 1MKMA 2OAZA 4R79A 4B3XA 2JJ7A 2DOEA 4FE4A 4ESFA 1YX5A 3I5UA 1V55H 4L5EA 3V8KA 4AU7A 3ASOH 3ZMUA 3ZQHA 2M4GA 3FX3A 3M4OJ 2P4WA 3I3LA 3TDZC 5EEGA 2K7LA 2KFDA 3MFKA 3PFYA 1U5TB 3ZMZA 1DUXC 1N75A 4MO7A 2ESHA 1QU3A 3ZQQA 1W1WE 3ZQCA 1X1BA 3QAHA 3BG5A 2L7FP 2ME6A 3E1SA 1BI1A 3RPUD 1RNLA 1T6SA 2QKLB 1R49A 3KLOA 5DYMA 1NG6A 3LAJA 1WH5A 2L3DA 4N0BA 2VJ5A 2NVYJ 3H9QA 3T5XA 3QPSA 5L3EA 2VPLA 4A0XA 1HKQA 2VB6A 3I4PA 2HS5A 2L54A 4RB3C 3DU5A 3RDIA 3SDBA 2KMUA 2G9WA 3G6EI 3HTUA 1HW2A 3FKJA 2LFBA 1R6RA 3RKYA 5KCMA 1QZYA 1Z6TA 3F8CA 3HIFA 4KIFA 1D1AA 3ZN1A 4B09A 2HEOA 1HA8A 2IGOA 1LVAA 3E6BA 1TWFJ 5KNLA 4YFNF 4DBQA 1HKTA 3ZQLA 3H9GA 1SFOJ 1R1VA 4ZDPA 4BDZA 4E7ZA 4U0VA 4DYRA 2A05A 2MLGA 4XKVA 3NEUA 5E3LA 2EZIA 1LDDA 3HB9A 3SHFA 1BW6A 1F9NA 1YIOA 5KK1A 3PO2J 3RSNA 4BHBA 1P7IA 3PO3J 2DA1A 5FKKA 3JREA 1MJ9A 1I6HJ 2ZNZA 3GTKJ 3EETA 3PFIA 3K4KA 2DA6A 3KZYA 4FE7A 2HVSA 5E17F 2BE5F 2VQHA 4CCJA 4HBLA 2E5NA 3F72A 2KKOA 1YRNB 1J2XA 2HOTA 3HJEA 3TBIA 1RRJA 5ICCA 4DQ2A 2VLAA 4A3CJ 4A3GJ 1BBYA 4QWQA 3LSGA 1MGTA 5KVRA 1J7KA 3GFMA 2JRTA 2MABA 1T0FC 3AAFA 3RIRA 3BY6A 2PMUA 1RI7A 2L4MA 3F8BA 3P9CA 2VJ4A 4XLNF 1IAWA 1Y8QB 2XASA 2MC3A 5EG0B 2VJIA 1AKHA 2MLKA 1IZ1A 1I3AA 4QSHA 2E5ZA 1FTZA 2RREA 4BHCA 3QU6A 3QYBA 4YIIA 1A35A 4FETA 2LLKA 2Y30A 1MJBA 3BZKA 3DKXA 2UUZA 1W5CC 4UUTA 4XKBA 5D5UB 2ZXJA 3QODA 2DO7A 3L1PA 2I8DA 4ITVA 1YJNI 3HKZN 5E79C 3J81K 2DN0A 1QVUA 3K1MA 2K9QA 4XSZF 2DXIA 4AYBN 2YU9J 4JOMA 4WXHA 3BG3A 5ILUA 3JR9A 5ERIA 1MH4A 1N77A 4OIRF 1V5EA 3V8LA 3E3VA 1SC7A 3QPHA 3BG9A 1FEXA 3LOCA 3M1EA 1SVMA 1XCVA 3CUQA 3OYGA 4X6AJ 3A0BC 4IHWA 3N97A 2W82A 1YQAA 3QU3A 4F92B 1BI2A 4EM2A 4C2UA 4NDLA 4XN3A 1S6LA 2M87A 2QLZA 2A07F 4DW6A 2F5CA 1VZ0A 1QQIA 2CV1A 2ZO4A 3F0CA 2XAQA 2VE9A 2H1KA 2GQQA 2LR8A 2GA2A 4KIBA 5DDGA 5FKMA 2GA1A 1FMWA 2Q8KA 5E3NA 3QRFF 4L9NA 1JKPC 1E3HA 2TCTA 3WU1B 3K1PA 1DP7P 2HQAA 3BG7A 4RB2C 4LG3A 4HSTA 3HOXJ 1XSXA 1RETA 1MH3A 4CZCA 3OYFA 3KCCA 3C1DA 1JHFA 5TRDA 4EM0B 4PJLA 5L3DA 2VASA 3W2AA 1S7OA 4WXDA 4L5IA 5F0FA 2WADA 4NQWA 1G8XA 1Q1HA 2ZJRF 2OC6A 1STZA 2M1BA 5FLVA 2QSHX 1N78A 3C2GA 3DCFA 2P7VB 4FHTA 1AWCA 5HLHA 2ELHA 1SFKA 3J7YJ 1BC7C 2PJPA 2IS6A 1I6XA 2E7XA 3PSFA 4M9XA 1O57A 3CP2A 4UV8A 5F6FA 5L3CA 1VQ5I 1ZRCA 1ZK8A 3DLAA 1Z77A 1L3LA 4YFXF 3BR2A 2IS4A 3DXJF 2X0LA 2FA5A 2NS0A 4XKWA 1Y6IA 3PJRA 5L3BA 4WX9A 2R7TA 3OSGA 2CU7A 2Z1DA 2V1DA 4YRVA 1B9MA 2QQ9A 3H5RA 4XR6A 3FXUA 3BCBA 1ZH5A 4R1HA 2NOJB 3MZ8A 4LGWA 3BTCA 1B9NA 4HOBA 3I53A 1VQ7I 2FD5A 2LTPA 3BJOA 2DPUA 1QVTA 2M34A 3GBGA 3QYEA 4DYQA 2ZXHA 1YS7A
chains in the Genus database with same CATH topology
5JHFA 4F55A 4BQOA 4BJ5C 4NUBA 3S93A 1Z3YA 1IRXA 2L9SA 2R7SA 2X1DA 1UAAA 4IX7A 2BOLA 4D9JA 3L2QA 1W36D 1FMVA 1UELB 4XKCA 1E0EA 2R7RA 3HC7A 3AKZA 3NWTA 4PJJA 4DJAA 2F6CA 2CFOA 4C2TA 4KITB 3VSKA 1AA7A 2JUGA 3MMYB 3SYTA 2DCEA 4BQQA 5CPRB 4H4KC 4ZDOA 4MLOA 3DPLC 3J7AY 4ZDLA 1WJAA 4BDYA 3DTIA 3LMMA 2KLOA 3UR3C 4XONA 4NQWB 2AQFA 4Y33A 1MNDA 2HU9A 3M1CA 2IGKA 2Y0SA 3UNGC 2IS1A 3OYJA 1MW7A 4C9YA 4CCKA 3TL4X 4XOPA 2ZSHB 3W2WA 2CUJA 2X51A 3OL4A 4E7IA 4CSWA 2K3PA 4KT6A 1P9QC 2O5RA 4F52A 2KRCA 1V5FA 2MC4A 4HSRA 3CJQB 4ZTFA 4DIQA 4XORA 4E7SA 2A5WA 2CS3A 2A6TA 4CCOA 1DP3A 4XLCA 2VQCA 3SEZA 2VKHA 1JI8A 2WAFA 2HZDA 3BCAA 1WJ5A 3NWSA 5CQEA 4RM2A 3D5SC 4CCNA 3CJRB 4PJMA 3G2BA 3D5RC 3VYUB 1TZLA 5HNHA 3KX2A 2Z2SB 2PJRB 3V42A 3DTEA 3ZR8X 4U87A 3K4NA 3EPZA 3I9V2 4XQFA 2HPIA 4PFPA 3IUOA 1WJCA 4DGWB 4BGDA 2RNGA 3OR2C 4HNUA 1V5GA 4BL0B 1D1CA 3ZGKA 1GLNA 3LL7A 4E4HA 1Z7LA 2R4GA 4CCMA 3EUKL 3L2UA 2K9MA 1MNEA 2XAUA 4RLFA 3S8PA 4E6KG 3OYDA 2RQQA 2X6YA 2XF5A 4XM3A 3AL0C 3IAS2 4LIUA 3HXLA 1DGWY 5FROA 3MKYB 2CV2A 2KP6A 3SZGA 4CA0A 3HL2A 5FRNA 2WY7Q 3VYSB 3HUGB 2JA2A 4P1WA 2LY1A 4P5OA 1Y56A 2VL8A 2R7VA 4BE1A 3H9JA 2W4SA 1D0XA 4ZJZA 3LSHA 1MMGA 2F5VA 2V4JC 3A4CA 3IAM2 2CW8A 4DOZA 2QKMB 4IZZA 4DBRA 5HLTA 2IS2A 2M7AA 3OYMA 3K70C 3FBIB 2Q2EB 2WBMA 3D5LA 2XDVA 3IP4B 4CH7A 3HG9A 4X0GA 4U7BA 4E7KA 4KISA 1LKXA 2E1MC 1WJFA 2R7OA 2KDOA 3H5NA 3OIQA 3M8JA 1PYVA 1TT0A 2X6WA 4XNFA 3L2VA 3DTKA 2IXSA 3HOTA 4LITA 3ZCOA 4NNJA 1X19A 3VDXA 4BEHA 2VQLA 3CF2A 4XLFA 1X1CA 1Z21A 3OYNA 1YX3A 3KYLA 2UV1A 1BR1A 2LRDA 2JSPA 3OS1A 2VQGA 2HNHA 2VKDA 2KL4A 1OLTA 3LSIA 2V9KA 2LBFB 1ERDA 2W00A 2V1NA 2W1OA 1DQUA 1NG7A 2GOMA 2V6EA 4PFOA 2R7WA 2Z16A 4HRIA 2BW3B 3W3CA 4BEHB 2KHMA 2ZFUA 3PL8A 4BUPA 4F91B 5CQGA 2L2OA 3PNVA 2W7NA 3DPUA 4BQNA 1BR4A 1LFPA 4NC8A 3ZXSA 3DQVC 4IKFA 4OAZA 4II2A 3OY9A 3H35A 2BVLA 4IQJA 2F4IA 3BLYA 2WAEA 2HDWA 2X85A 4BJTA 3RTRA 3DKYA 2LG4A 3OYEA 4J00A 2M3AA 4HG2A 4C30A 3HOSA 5TGTA 2VXDA 2L5QA 4R79A 2IGNA 4B3XA 2WA0A 1YX5A 3EUHC 3CZ6A 4AU7A 2HVQA 3L2RA 2M4GA 1W36C 2R7UA 2FUG2 1SAUA 3I3LA 4JQFA 4OWRB 4E7JA 3PNYA 3PFYA 5LFAA 3OYAA 1N75A 1QU3A 3ZQQA 3PSIA 2M7BA 4B43A 1X1BA 4XMYA 2CUZA 1J09A 4IQ4A 4BJ6C 1QHGA 3E1SA 1D1BA 2BVMA 3RPUD 2QKLB 2OV7A 5HOOA 3LSKA 1WJEA 3DPTA 1NG6A 3C2HA 4BE2A 2VJ5A 1WJDA 3N05A 4F93B 2PMZA 3H9QA 1BOBA 2MYSA 2VPLA 1QHHD 1PJRA 2LC2A 3QYFA 5HNFA 1LDKB 4PK4A 2VB6A 4RLQA 3DU5A 3SDBA 2KMUA 2PJRA 4B48A 3DU6A 4B47A 3FKJA 1R6RA 4Y3OA 5KCMA 1D1AA 4ZTJA 3OS2A 3OWTA 1HA8A 2IGOA 1Z3XA 5KNLA 2X1EA 3KEYA 2ELJA 3QOEA 4DBQA 3H9GA 2MFZA 4ZDPA 1WFXA 4BDZA 3RQ4A 4E7ZA 1U0JA 4XLHA 4PSWA 3OYIA 4CUGA 3VYRB 5KHDA 4AVZA 4XKVA 4N4OB 2CW7A 2VIXA 4Y4RA 3OL3A 4LIVA 2L7KA 4PSXA 3EUAA 3LFUA 2OUMA 3RSNA 3ZRGA 5HVQC 4BE0A 4GRIA 3OYKA 5CKTA 2LREA 2XSJC 4BS9A 3K4KA 2HVSA 4KJZA 1X1AA 2K5CA 4ZC3A 2VQHA 4CCJA 3S3OA 1MMAA 2V7FA 4EATA 2ZSIB 2E5NA 3K6GA 1X4OA 3H0DA 3TBIA 3ONQA 3FBNB 2VLAA 3U21A 2MD0A 4XN0A 3FHNA 3S3MA 2LY2A 4QPQA 3LSGA 2CH0A 3LSMA 2DOAA 2MABA 3CESA 2BW3A 1T0FC 3CP8A 3OYBA 3S32A 1MMNA 2Q1ZB 2VJ4A 4D1QA 2UWMA 1DGRM 1D0ZA 2WY8Q 4FASD 2DT6A 2AQEA 2LBFA 2VJIA 2V26A 3K4BA 4HPQA 2HPMA 3OR1C 4CCLA 4ANJA 4HNTA 1K6YA 2E5ZA 2RREA 3QYBA 2DT7B 2E60A 2LYCA 4FETA 3AFHA 3DKXA 3H5AA 3PNTA 2UUZA 2ZXIA 2VXZA 4XKBA 4XOTA 4YELA 2L9NA 3QODA 2XF6A 3HPHA 4B44A 3HPGA 4II3A 2I8DA 2KZVA 4ITVA 3OYLA 3VYTB 3W2VA 2LOOA 4E7LA 3OYCA 3MKZA 2XC7A 2CV0A 2DXIA 1X4PA 3OMYA 4JOMA 3PUBA 4BXFA 1KONA 1D0YA 1N77A 1V5EA 4XL9A 3CMMA 3TMOA 2XF7A 3A2KA 2KQRA 2GOXB 2R7XA 2WAQA 4N4NB 3OYGA 3L2WA 2HVRA 2W82A 4F92B 2IGMA 1WJBA 3F9KA 4NC7A 4C2UA 4XN3A 4QPOA 3K10A 3OOUA 1VZ0A 2CMPA 3BG6A 2CV1A 2JVHA 5FRMA 4RMNA 2DJIA 3S3NA 1FMWA 1T95A 2R7QA 4HEA2 4J01A 4OAYA 2HQAA 3BG7A 2KPMA 4ZYAA 4LG3A 3K70D 4HSTA 4CZCA 3VWBA 3OYFA 1LVKA 2VJJA 1EA3A 3MKWB 1UG0A 2M4KA 4RM3A 3MD2A 4E7HA 4PJLA 2X1CA 2VASA 4F3QA 3W2AA 2WADA 4G6TB 1G8XA 3DEEA 1ZELA 2OC6A 3HKZA 2K9LA 1N78A 2KRHA 3C2GA 3VSLA 1S9HA 4XLAA 4BU2A 3K4LA 1SFKA 2E1MB 4AYBA 3OYHA 2IS6A 3A1YA 2P0WA 3PSFA 4XLEA 3CP2A 3E0JB 4PUSA 3DLAA 3FDYA 3K4CA 3K4JA 2WB1A 1YE9A 2IS4A 1OR7C 4XKWA 1Y6IA 1BR2A 3PJRA 1X1DA 2R7TA 3DWLE 2Z1DA 3OIPA 2LH9A 4YRVA 3K4MA 5LD2C 3H5RA 4XR6A 3BCBA 4PJNA 3BC8A 2X6XA 2NOJB 3SEQA 1MMDA 1G59A 4YEJA 2M0MA 2JVGA 4BACA 3GBGA 3OS0A 3QYEA 2ZXHA 3AL0B 3RCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJF A;  1K6Y A;  1LFP A;  3HPG A;  3HPH A;  1WJD A;  1WJB A;  3F9K A;  1MW7 A;  4F3Q A;  1WJC A;  1KON A;  1E0E A;  1WJA A;  1WJE A; 
#chains in the Genus database with same CATH topology
 4RS8 A;  1TNT A;  1UHS A;  4BJ5 C;  3ASN H;  4NUB A;  4QIW N;  1IF1 A;  1DPR A;  1UHW A;  3PQJ A;  3VB2 A;  2X1D A;  1HBX G;  4IX7 A;  1XDS A;  3HOY J;  1BIB A;  2KIM A;  2IEK A;  4D9J A;  3L2Q A;  1W36 D;  1UMQ A;  1FPQ A;  1FMV A;  1PUF B;  2DQR A;  1MD0 A;  3AKZ A;  4LOC A;  3WG9 A;  4U88 A;  2R5Y B;  1VQ8 I;  2M9H A;  1AA7 A;  2NNN A;  3CC7 I;  3SYT A;  4XRS A;  3A01 B;  1OKR A;  3CUO A;  5CPR B;  3G1O A;  1O7L A;  1FWZ A;  1WI3 A;  3R0A A;  3ULQ B;  1U9O A;  1ETV A;  3DTI A;  2CWE A;  3Q3S A;  1FOX A;  3WG7 H;  1FLI A;  2STT A;  1G2H A;  2HU9 A;  2WC2 A;  2FBH A;  3DEW A;  1S8N A;  2E7W A;  2Y0S A;  3B6A A;  3S2D J;  1FOY A;  3UNG C;  1ETW A;  1MW7 A;  4C9Y A;  3OL4 A;  2X51 A;  4UXN A;  2VPR A;  2K3P A;  4QTR A;  3IKV A;  4F52 A;  2MC4 A;  1V5F A;  3CJQ B;  2V6C A;  5FO5 A;  4DIQ A;  5BQT A;  1G3T A;  2WAQ N;  2ZJ2 A;  4XOR A;  2A5W A;  1F5T A;  2A6T A;  4CCO A;  4CIC A;  4FCY A;  4XIC A;  1ZLK A;  2EFN A;  1JI8 A;  2PEX A;  4WXC A;  2HZD A;  4A0Y A;  3BCA A;  3WTY C;  1WJ5 A;  2NAZ A;  5E3M A;  2CQN A;  3NWS A;  5EGO B;  1VFC A;  4RM2 A;  5GAH J;  3CJR B;  4PJM A;  1VQK I;  4WF2 A;  3SFI A;  2R5Z B;  3JTG A;  5EZG A;  2AO9 A;  2Z2S B;  2PJR B;  1TW2 A;  4UUS B;  1A6I A;  3ZQF A;  1ZKG A;  3KP7 A;  4ON0 A;  3HM5 A;  4PJ0 C;  4BGD A;  3SQN A;  2COB A;  4HNU A;  2AS5 F;  1G3S A;  4BL0 B;  1ZRF A;  4HX4 A;  1GLN A;  3LL7 A;  3Q9S A;  4E4H A;  3DKW A;  3J7Z I;  4UY8 I;  1Z7L A;  1ZYR F;  4CCM A;  1IUY A;  1OJL A;  3L2U A;  1I5Z A;  1MNE A;  3KET A;  2ZKZ A;  2P6S A;  4RLF A;  4ENN A;  3CJN A;  2QZ8 A;  3M7G A;  4XM3 A;  1VQ9 I;  1IN4 A;  3QQA A;  4FQG A;  4LIU A;  1QPI A;  3QPL A;  4CXF A;  3WE2 A;  3T8T A;  2QWW A;  4XRM A;  2ZC2 A;  2H6B A;  2CV2 A;  3FM3 A;  2HQN A;  4MFE A;  5E8I A;  1IUF A;  1YYV A;  2K3F A;  3HUG B;  3VYS B;  2ACJ A;  4CZZ A;  3CCL I;  3VPR A;  1ON1 A;  4P1W A;  2LY1 A;  1FOW A;  4HQM A;  2YU3 A;  2R7V A;  5GTI C;  2F5D A;  3ZMV A;  3SZT A;  3H9J A;  3IV5 A;  1D0X A;  4LK0 F;  3WOD F;  3LSH A;  4A3K J;  2JQ7 A;  1Z7U A;  3K1N A;  2F5V A;  2V4J C;  3DBL B;  3IAM 2;  2H09 A;  2TRT A;  2E2H J;  3KFW X;  2BBY A;  2XV4 S;  2M7A A;  5D6E A;  3JRA A;  1B72 B;  3D5L A;  4LB6 B;  3CMY A;  1B8I A;  3JRB A;  3IP4 B;  1RES A;  4Q4Z F;  2G7H A;  4X0G A;  1UZC A;  2ESN A;  4AUX A;  5GAE J;  4HF2 A;  2R7O A;  1B6A A;  2BHZ A;  2IA1 A;  3H5N A;  4Q47 A;  3M8J A;  3IL2 A;  1VQN I;  3GTQ J;  1PYV A;  2X6W A;  1TWG J;  3CCJ I;  2JA5 J;  5J8F A;  5DCM A;  3L2V A;  2DK5 A;  2IP2 A;  2CQX A;  2IXS A;  1MDM B;  3DF8 A;  3HOT A;  1FJL A;  3R4K A;  1KU9 A;  3ZCO A;  4NNJ A;  3AG4 H;  3CF2 A;  4XLF A;  1JE8 A;  4RB0 A;  1Z21 A;  1OR7 A;  4B8X A;  4W97 A;  3CDL A;  2K4B A;  2XPU A;  4OMY A;  5J40 A;  3TO6 A;  2VKD A;  2OJE D;  2KL4 A;  1PP7 U;  3EUH A;  5EZH A;  2V9K A;  2LBF B;  1ERD A;  5M5X J;  4HF0 A;  4EJW A;  4WCG A;  1DQU A;  2D5V A;  3GF2 A;  1NK3 P;  2V6E A;  1FTT A;  1IRZ A;  2R7W A;  1YFH A;  3LFK A;  2BW3 B;  4CO8 A;  3IRR A;  1VND A;  2K9N A;  1SMT A;  1ZRE A;  4MHG A;  1LPQ A;  4KFC A;  3PIO F;  2ZB9 A;  2A68 F;  4BQN A;  3F22 A;  1FYK A;  4HX7 A;  2K4J A;  4IRG A;  3J80 Z;  2XKO A;  2BV6 A;  2XAG A;  1K7A A;  1D5V A;  1EV7 A;  1CQT A;  5DUI A;  2JRM A;  3H35 A;  3S2H J;  3CME I;  5E1Z B;  5K5O A;  3C2B A;  1P4A A;  4XSX F;  1MZB A;  3RTR A;  2V1U A;  3NRV A;  4BAY A;  1K83 J;  3OYE A;  2P5L C;  2XHK A;  2VXD A;  2L5Q A;  3ECH A;  4IF4 A;  3TOA A;  2Z5U A;  3KP2 A;  2IGN A;  3DBR B;  2VOP A;  1X58 A;  3CZ6 A;  3RYR A;  3VFZ A;  4B4C A;  2F4M B;  2RAE A;  1W36 C;  3S1Q J;  1W7P A;  4IRH A;  4JQF A;  4E7J A;  2UXN A;  3PNY A;  1MBE A;  4CDG A;  2LSO A;  3WGG A;  5LFA A;  4IPA A;  2JA8 J;  1TBX A;  3KP4 A;  4B43 A;  2DQL A;  3V8J A;  5JFR A;  2CUZ A;  1J09 A;  4IQ4 A;  2EBI A;  3G4S I;  2XRL A;  1QHG A;  4P9U A;  2V9V A;  1E17 A;  3QOP A;  2F2E A;  2X6O A;  1ZGJ A;  3LSK A;  4D7N A;  1WJE A;  4LLN A;  4GYI A;  3C2H A;  2L0K A;  3SXY A;  2ZNY A;  1BOB A;  3G73 A;  2MYS A;  4AIK A;  1JGG A;  4NHJ A;  2VOO A;  3WU2 C;  1O7F A;  4OIO F;  1LDK B;  2O3F A;  3IHU A;  3IC7 A;  5JI6 A;  4M6X A;  4PDK A;  2HR3 A;  2CQK A;  2ECC A;  4G94 A;  2NVU B;  2CUE A;  3DU6 A;  1BIA A;  1X3Z B;  4B47 A;  3I55 I;  3BZ6 A;  1EJ9 A;  2VI6 A;  4X1E A;  3DP7 A;  3MN2 A;  4LMY A;  3KEY A;  4G9Y A;  4AC0 A;  2Q0O A;  3LQR A;  4BHP A;  3KE2 A;  1HLV A;  1WFX A;  1KU7 A;  2LF8 A;  3ERE D;  4GDF A;  3FF5 A;  1KQ9 A;  1WGX A;  3VOD A;  2KIU A;  3OV8 A;  2RN7 A;  3BR1 A;  2IW5 A;  3GZN B;  3VOE A;  4I09 A;  3WHC A;  3ZQI A;  3O6B B;  1JGS A;  2L7K A;  3WTU C;  4YFK F;  3I59 A;  5DTD A;  3T1B A;  1TW3 A;  3TP0 A;  1SAN A;  2VBY A;  4BE0 A;  1QPM A;  2VE8 A;  1DU6 A;  1SVL A;  2FNP A;  2E35 A;  4ZYG A;  4MQV A;  4LLG F;  2XSJ C;  1H9G A;  1B4A A;  2BY3 A;  4BS9 A;  3JRD A;  1X1A A;  5BPD A;  4ZC3 A;  4ENM A;  3S3O A;  2Z3Y A;  4EAT A;  2ZSI B;  3H0D A;  1X4O A;  3U1K A;  1JKO C;  5A2Q Z;  3RPQ A;  4N9H A;  4C3H J;  3O3K A;  1MBK A;  3JAM K;  1YLF A;  3U21 A;  2MD0 A;  2IAI A;  3K0L A;  2K27 A;  4XN0 A;  5IT3 A;  1WCM J;  3R6S A;  4G7Z F;  3S3M A;  1MSE C;  2CH0 A;  1R5G A;  4M74 A;  2DOA A;  5IP9 J;  2ZJQ F;  1R1U A;  2BW3 A;  2RKH A;  5GP9 A;  3S15 J;  2BY0 A;  4KN4 X;  4I7H A;  1DGR M;  1D0Z A;  1RR7 A;  2WY8 Q;  3TW6 A;  4U0W A;  1JTY A;  4FAS D;  2LBF A;  3KLN A;  4RGR A;  5IOZ A;  1F36 A;  3COA C;  5IPA A;  2GZW A;  2JA7 J;  5EDN A;  4CCL A;  1R5I D;  2ZXW H;  2EIL H;  3LAP A;  3WHB A;  5EEH A;  1HCR A;  1K6Y A;  1RKW A;  4XID A;  1IO2 A;  3GLX A;  1S7A A;  2DT7 B;  2E60 A;  4ZZL A;  1U5T C;  3AFH A;  2HYG D;  2E34 A;  4I6Z A;  5C4X J;  1TP4 A;  5LHH A;  2OQR A;  3EYY A;  2ZXI A;  2BHY A;  3IWF A;  4XOT A;  5K7Z A;  2L9N A;  2XF6 A;  3MZY A;  1C0W A;  1FNN A;  1RIO H;  4L5J A;  2O0Y A;  3OYL A;  2KZV A;  3CLO A;  1FYL A;  1TQM A;  3W2V A;  3X2Q H;  3CCQ I;  4E7L A;  1FOK A;  3I4M J;  5BOX A;  2DFH A;  2DJN A;  2XC7 A;  1OFC X;  3B6C A;  1SD7 A;  2PG4 A;  2E1N A;  3RKX A;  1REP C;  3PUB A;  3WE3 A;  1LEB A;  2NYX A;  1EH6 A;  1IC8 A;  3CMM A;  2D2W A;  1ZN2 A;  4W1U A;  2P6T A;  3TMO A;  3A2K A;  1XGO A;  2GOX B;  1IDZ A;  3IRQ A;  3IWZ A;  5B1B H;  2KZG A;  3L9F A;  4BYY A;  1KA8 A;  1U9N A;  1LE8 A;  3FZV A;  2OA4 A;  3ZP5 A;  1G3W A;  3HOW J;  1WJB A;  2Y31 A;  4NC7 A;  2H94 A;  1HST A;  3BR6 A;  5LRS A;  4Y52 J;  4KIC A;  4QPO A;  3HYI A;  4JK1 X;  3OOU A;  1AU7 A;  4G7O F;  4A3J J;  2JVH A;  4XK4 A;  5B5E C;  3D0S A;  2Y0S N;  5FRM A;  2LK2 A;  2DJI A;  4Y17 A;  2DA7 A;  1GVD A;  3FXM A;  4I99 C;  1X3U A;  2RC4 A;  3LSJ A;  1Z05 A;  4ZYA A;  4IHV A;  4IHT A;  2ME0 A;  1YO5 C;  5IYC J;  1O3R A;  3WGI A;  2VKE A;  3FXR A;  4LLL A;  1EA3 A;  3MKW B;  1UG0 A;  2AHQ A;  4AWX B;  3G1M A;  3NQO A;  2DTZ A;  3I58 A;  4F3Q A;  3GEZ A;  1SD4 A;  5HDK A;  2BXZ A;  1HC8 A;  4A3E J;  2F4O B;  3KEO A;  3KZI C;  3K9T A;  1S9H A;  2ID3 A;  4BU2 A;  3K4L A;  2YUS A;  3Q9V A;  1DU0 A;  2E1M B;  1LUJ B;  2QGU A;  2XPW A;  2P0W A;  4M9Z A;  1QO0 D;  2B7E A;  2EIK H;  3ZMD A;  2B9S A;  2FOK A;  4MEY F;  2EIM H;  2HQR A;  4PUS A;  2W48 A;  2D1V A;  1QA6 A;  2WB1 A;  3K4J A;  1FYM A;  1VF9 A;  2M8G X;  2XSD C;  1A04 A;  5F1J A;  5CVI A;  5HDG A;  2IJL A;  3ABK H;  3P5J A;  1A31 A;  3S16 J;  2A69 F;  1CF7 B;  1WI9 A;  1UCR A;  2DMN A;  3K2Z A;  4PCQ A;  1PUE E;  3HBL A;  1BI0 A;  2O8X A;  4PJN A;  3RZO J;  3HGY A;  5FD5 A;  3QP6 A;  2EA2 A;  4Q5S F;  3SEQ A;  1MMD A;  1YW7 A;  4JP0 A;  3BR3 A;  1U6G A;  2F48 A;  1OCR H;  2OTL I;  2DA2 A;  2WTE A;  2PN6 A;  2NVQ J;  5J4Y A;  1YS6 A;  2QQA A;  3AL0 B;  1QRY A;  2STW A;  5K7F A;  3C7J A;  3S93 A;  1EF4 A;  1P2F A;  2L9S A;  5F64 A;  3WU0 A;  3S14 J;  2R7S A;  1UAA A;  1OYW A;  2VOD A;  3Q0U A;  1MNM C;  1E2X A;  2C6Y A;  2OZ6 A;  1UEL B;  2XRO A;  2YSR A;  3I0T A;  2RNJ A;  5D6F A;  3HC7 A;  1Y39 A;  4BY1 J;  2DU9 A;  4MQ9 F;  3Q5F A;  4KIT B;  2FOW A;  2OD5 A;  1B1B A;  3U2R A;  2OBP A;  1ORK A;  2NNY A;  2HGC A;  4MLO A;  3KEQ A;  5CVR A;  2KIQ A;  4M3D A;  1IN5 A;  3BR5 A;  2ELK A;  3CF5 F;  3GZ6 A;  2R93 J;  4A3D J;  1BA5 A;  4BDY A;  1V3F A;  5M5Y J;  1BC8 C;  3RPU A;  1UJ8 A;  2GXG A;  3UR3 C;  2JK3 A;  4LFU A;  3E6M A;  9ANT A;  4UB6 C;  1P7J A;  2CFX A;  2VBX A;  3M1C A;  2JTV A;  2UZK A;  1O3S A;  4V2F A;  2E1O A;  3K69 A;  2X48 A;  3MEX A;  4NC6 A;  2Z99 A;  4AID A;  1XTA A;  2CUJ A;  4E7I A;  2JPB A;  4CSW A;  3HEF A;  2OQG A;  2Y9Z A;  1P9Q C;  1WWX A;  2YX4 A;  1JTX A;  2KRC A;  4E7S A;  1F1Z A;  2W57 A;  1DP3 A;  4XLC A;  1EKE A;  1FSH A;  3SEZ A;  2DDA A;  2VKH A;  1S72 I;  2DA4 A;  1XX5 A;  5AIP A;  1XGN A;  2V1X A;  5CJ9 A;  3V7C A;  4KN7 X;  1TQI A;  4MEX F;  1LEA A;  1NHA A;  3BQZ A;  2DMU A;  1M1E B;  1VQM I;  3D5S C;  5H6R A;  1FBS A;  3KPH A;  3G2B A;  1U8R A;  3GFL A;  4H0E A;  5JVG F;  1HW5 A;  5L3G A;  5LEJ A;  3CCS I;  1JT6 A;  4JBA A;  1SEU A;  1LE8 B;  3EPZ A;  2HPI A;  3IUO A;  1WJC A;  2HKX A;  3H3Z A;  4DGW B;  2HDD A;  2EV0 A;  3ISP A;  2RNG A;  3OR2 C;  1R9T J;  1ON2 A;  1V5G A;  3ABU A;  1YTY A;  2A6H F;  2BY2 A;  2G0E A;  3ZGK A;  3UKG A;  2DMP A;  2Z33 A;  4LJZ F;  3GO5 A;  4D5C A;  4M71 A;  2XAU A;  4GO1 A;  5E8G A;  4E6K G;  4BQA A;  1J5Y A;  2X6Y A;  2XF5 A;  4HX8 A;  3M8F A;  4DYC A;  3HOU J;  2Q2E A;  1Z91 A;  3MQ0 A;  3HXL A;  4A6E A;  3MCZ A;  2O6G E;  2PMH A;  1OQY A;  5HS8 A;  3FXL A;  1OPC A;  2KP6 A;  2VKV A;  1ETQ A;  2CSO A;  2W84 A;  2JA2 A;  1NTC A;  1UG2 A;  1Y56 A;  2LDU A;  3AG1 H;  4M3G A;  5IT9 Z;  4HF1 A;  3L09 A;  1ONV A;  1Q1V A;  2W4S A;  3BJ6 A;  1PVE A;  1K78 A;  1OCZ H;  3A4C A;  2HOS A;  2M0C A;  5HLT A;  2VUM J;  3ERM A;  5GTH C;  3K70 C;  3G3Z A;  1XS9 A;  2XUB A;  2XAH A;  3LA2 A;  2WBM A;  4L0Z B;  4M3E A;  2XDV A;  1BOA A;  3H3U A;  3KP6 A;  5AON A;  3HG9 A;  3GTJ J;  4U7B A;  4IJA A;  4KIS A;  3A0H C;  1F43 A;  3PQK A;  2XB5 A;  2B63 J;  4G7H F;  2EFQ A;  5J3L A;  4A5M A;  2H8R A;  4HLX A;  2MG4 A;  2NXN B;  3EDP A;  3VDX A;  4M6Y A;  4BEH A;  3AG3 H;  1K78 B;  1J75 A;  2EIN H;  1YX3 A;  3LST A;  1W7P B;  2AXL A;  4IVN A;  5FFX A;  2UV1 A;  2ID6 A;  3TQN A;  2HWV A;  3BT9 A;  1ITY A;  3HSR A;  2LRD A;  3SFZ A;  1KQ8 A;  1TT5 B;  3DFG A;  2VQG A;  2HOE A;  2HNH A;  3W6J B;  5J1R A;  1OLT A;  1AKH B;  2QQ8 A;  1K61 A;  2V1N A;  4OIP F;  3GTL J;  2EA4 A;  3S1N J;  2DTR A;  5KAF C;  4XRF A;  2FE3 A;  5FLX Z;  1XG1 A;  3W3C A;  4BEH B;  2N8G A;  3WTV C;  2ZFU A;  2HYJ A;  2J5O A;  3CUQ C;  2DLL A;  2ECB A;  3B73 A;  1KU3 A;  2L2O A;  3GCM A;  2X4H A;  3PNV A;  3BPX A;  1TQP A;  2EPF A;  1LFP A;  3IH2 A;  2KJB A;  4NC8 A;  3ZXS A;  2DK8 A;  2CO5 A;  4ZYD A;  1IXS B;  1D8K A;  3FXO A;  1YRN A;  3GFJ A;  4CYD A;  4L18 B;  3BLY A;  3GTG J;  1V4R A;  1SVO A;  1MMS A;  2HDW A;  3JRC A;  4LG0 B;  4J00 A;  2YX7 A;  1H89 C;  4KIG A;  4A93 J;  2E19 A;  3QPT A;  2WA0 A;  5BPI A;  2F5F A;  3EUH C;  4A2U A;  4HV5 A;  4BY7 J;  2HVQ A;  2VT2 A;  1W5T A;  2FUG 2;  1SAU A;  1ZR4 A;  4OWR B;  3J81 Z;  1RR8 C;  2CJJ A;  2BZT A;  3KP3 A;  1RUO A;  1WHU A;  1GHC A;  3T8R A;  2W24 A;  2LKX A;  2CRG A;  4J19 A;  3OYA A;  5DCM B;  1OYY A;  3PSI A;  1E3O C;  1Z6R A;  1TWA J;  3HGG A;  1OCO H;  2XVC A;  1QZE A;  3QWL A;  4UUV A;  1U3E M;  1D1B A;  2BVM A;  2OV7 A;  4RA2 A;  3DPT A;  2O8K A;  1YIJ I;  1WJD A;  4F93 B;  2PMZ A;  3KIO A;  1EH8 A;  5K5Q A;  2PBI A;  1VQ4 I;  3R0J A;  1MBJ A;  1QHH D;  3CDI A;  1PJR A;  2FNA A;  5F04 A;  4EVI A;  5HNF A;  2IA2 A;  1S29 A;  5M3M J;  4PK4 A;  5IP6 A;  2K85 A;  2DMQ A;  4RLQ A;  2L9V A;  4B48 A;  1YG2 A;  2P5K A;  3GW2 A;  1R1T A;  2H1L A;  3H36 A;  4MTD A;  2E1C A;  4BXU A;  4Y3O A;  4HYE A;  1O3T A;  2R3S A;  4I76 A;  3RZD J;  1H88 C;  1XDU A;  5CVV A;  1KGS A;  2EZH A;  4ZTJ A;  1Z3X A;  2K9S A;  1S7E A;  2X1E A;  3I54 A;  4RBO A;  3CJT B;  2YPR A;  1VQP I;  3QOE A;  2XKP A;  3RQ4 A;  1U0J A;  3RI4 A;  4HQE A;  1VTN C;  4XLH A;  5DD8 A;  3VYR B;  2QM3 A;  4HA8 A;  2XAJ A;  2DAO A;  4UVA A;  4CUG A;  4AVZ A;  4N4O B;  3TGN A;  2CW7 A;  2VIX A;  4UV9 A;  4Y4R A;  4LIV A;  5LBQ A;  3A02 A;  3EUA A;  3KZZ A;  2QEX I;  3BDD A;  2IVM A;  3ZRG A;  4OU0 A;  3O8H A;  5HVQ C;  4KUM A;  5HOD A;  2L4A A;  5CKT A;  2LRE A;  2EV5 A;  4KJZ A;  5TJJ A;  1KU2 A;  2K5C A;  2MD5 A;  1MMA A;  2V7F A;  3MKL A;  3K6G A;  3IH4 A;  3LA3 A;  4G6Q A;  1UFM A;  5M5W J;  3ONQ A;  4G6D A;  1MIJ A;  3JTH A;  2EZL A;  2W85 A;  5E20 A;  4Y7N J;  3FHN A;  4G12 A;  1R71 A;  4QPQ A;  3RJP A;  5F1R A;  1B8I B;  4O6J A;  4RDU A;  3CES A;  1B72 A;  5B66 C;  1TWC J;  1HW1 A;  2QUF A;  2Q1Z B;  3FHZ A;  1XSV A;  4D1Q A;  2FX0 A;  2DT6 A;  2HPM A;  2VC0 A;  2V26 A;  1XGS A;  4AIH A;  5A2Q K;  3KP5 A;  3OSF A;  3BOQ A;  4WWC A;  1D8J A;  4UVB A;  1W0T A;  5LLQ A;  2GXA A;  2QSF X;  4V19 K;  1YW9 A;  3I64 A;  2FF4 A;  1QGP A;  2L9R A;  3HPH A;  4B44 A;  1ETK A;  5J4V A;  4XRS G;  1T33 A;  4OIN F;  2GBY A;  1Y1V J;  3BP8 A;  2FJ1 A;  5C44 J;  3CD6 I;  3VYT B;  4KNY A;  2LOO A;  2BYV E;  1JKQ C;  1CF7 A;  1X4P A;  3ZQ7 A;  4A69 C;  4S0H B;  3OMY A;  4A3B J;  2CG4 A;  3FMS A;  4EJV A;  1KON A;  3AG2 H;  4XL9 A;  1XSD A;  3GTM J;  2XF7 A;  4A0Z A;  2KQR A;  5EF6 A;  1R4M B;  2VON A;  3L2W A;  3BR0 A;  1X3W B;  5J6X A;  3G71 I;  1CGP A;  4UUS A;  3HHH A;  5E3O A;  1HSJ A;  1BJA A;  5EJC A;  4JX5 A;  3F6O A;  3HOZ J;  4KMF A;  1SAX A;  3K10 A;  2CMP A;  4RAY A;  2YR2 A;  3BG6 A;  5JLW A;  4D0P A;  2LKS A;  2IT0 A;  1XD7 A;  1IXR C;  3GXO A;  4RMN A;  4IHY A;  3GTO J;  1BL0 A;  3F6V A;  3FIW A;  5CYV A;  2JZY A;  2ZME A;  4J01 A;  2MSY A;  4HZF A;  1ZGW A;  1ZQ3 P;  1IV6 A;  1HQC A;  1Z1D A;  2KPM A;  2FQ3 A;  1ZR2 A;  1Z0X A;  1SD5 A;  4UNO A;  2VC1 A;  5JVT A;  4S04 A;  1LVK A;  5DS9 A;  3I4N J;  2VJJ A;  1S5L C;  1GXP A;  1GV2 A;  3WTX C;  1DDN A;  3WGH A;  2EQR A;  4E7H A;  2E2I J;  1USS A;  5TIS C;  3JRH A;  1K4S A;  4ASN A;  3DEE A;  2FXA A;  1JT0 A;  3HKZ A;  3REO A;  1GUU A;  2KRH A;  4NB5 A;  3HRS A;  3VSL A;  3CCV I;  4EJT A;  1X1P A;  5ILS A;  5CVU A;  1WSU A;  4AYB A;  3OYH A;  2FQ4 A;  4L0Y B;  2P7C B;  1I39 A;  4HDV A;  1R5H A;  5CLS A;  2M8E A;  2R5Y A;  3CCY A;  4LG0 A;  4F7Z A;  1R4N B;  3BWG A;  3FXK A;  4YIR X;  3ROU A;  4N9I A;  1PUF A;  4S05 A;  1G4D A;  3DWL E;  1VI0 A;  3ABM H;  4Z6Y A;  2LH9 A;  2MW8 A;  1QBJ A;  2BXY A;  1XC5 A;  1E3P A;  2R7D A;  1HDD C;  3BQY A;  3K4M A;  5LD2 C;  5K7H A;  4HLY A;  1L0O C;  4OIQ F;  2A61 A;  5DD4 A;  5IT9 K;  3OOP A;  1JJ6 C;  2M0M A;  2J5P A;  5J1U A;  2DDB A;  4IXA A;  1FSE A;  3JW4 A;  3BTL A;  3U9G A;  3P9K A;  5D5W B;  2EV6 A;  3I59 B;  3RCO A;  4KA4 A;  2BEO A;  4BQO A;  2ICW G;  1VQL I;  3WTW C;  2MH2 A;  5C3E J;  5B3S H;  2RGV A;  3BPV A;  1SMY F;  1I3Q J;  2BOL A;  3SJM A;  1ZAO A;  1OYI A;  2GIV A;  3CUQ B;  1SD6 A;  2L7M P;  4XKC A;  5EYR A;  1IXC A;  2CQQ A;  3P9I A;  4GCV A;  2R7R A;  2QF7 A;  3TP3 A;  3NWT A;  1ETX A;  2CFO A;  2DA5 A;  5F0C A;  3VSK A;  2Y9Y A;  2DCE A;  3W6K B;  3ECO A;  4H4K C;  4ZDO A;  1YW8 A;  4G8X A;  1FX7 A;  1RC9 A;  2M2E A;  3ML6 A;  3CCE I;  2ZFW A;  1OMI A;  1ZGA A;  3KYC B;  1WVR A;  2DOD A;  4EGY A;  1ZLJ A;  3ABL H;  1BW5 A;  4CGZ A;  2H8W A;  3FMR A;  4XBF A;  3TW7 A;  3G1L A;  4A3M J;  2KLO A;  1YJ9 I;  5DUK A;  4NQW B;  3CO7 C;  2AQF A;  2FEZ A;  2DW4 A;  1WH7 A;  2MBF A;  2IGK A;  2QBY A;  1HOM A;  2IA0 A;  2XIG A;  1K79 A;  2O9L A;  2IS1 A;  4A6D A;  2V9P A;  3BJA A;  3TL4 X;  3LSP A;  2ZSH B;  1UB9 A;  2D1H A;  3H1C A;  2O5R A;  3B02 A;  4HSR A;  3JCU C;  3ZOB A;  5IP7 J;  3I71 A;  5E1W A;  4MIM A;  1IRG A;  2CS3 A;  1LQ1 A;  2NS8 A;  5IOY A;  1R23 A;  1YHQ I;  1Y0N A;  1OCP A;  3W6V A;  3DV8 A;  5K5R A;  1LDJ A;  2EZK A;  3S17 J;  1Y1W J;  3MAJ A;  4ENJ A;  4C3I J;  1TZL A;  2OZU A;  4Q48 A;  2HOA A;  4BBR J;  2KIS A;  5LHG A;  4U87 A;  1UST A;  3I9V 2;  2Y48 A;  1IDY A;  5DCF A;  4YG2 F;  5IY5 H;  2JT1 A;  1NH3 A;  4R8H A;  1ZG1 A;  3KYD B;  3IH3 A;  3NAR A;  4EV0 A;  1D1C A;  1H0M A;  3E5X A;  2R4G A;  3L2C A;  1JHH A;  1PDN C;  3EUK L;  4I02 A;  2XRN A;  3GME A;  5ICF A;  2LD5 A;  4O3M A;  5F08 A;  4MTE A;  1IV8 A;  1ZG5 A;  4IHS A;  2RQQ A;  3AL0 C;  1IN8 A;  2KRF A;  3LNQ A;  1ETY A;  3FK7 A;  3FMQ A;  5FRO A;  3MKY B;  3DEU A;  4CA0 A;  3SZG A;  5FRN A;  1LNW A;  3PM1 A;  2RDP A;  2NVX J;  2JPC A;  2DT5 A;  2FSW A;  3DBH B;  1FIA A;  2COM A;  4M3B A;  4BH9 A;  4FTH A;  4RAF A;  4BXX J;  5IYD J;  4ZJZ A;  1ENH A;  1U2W A;  1MMG A;  3FM5 A;  1H9T A;  1W7P D;  3EQL F;  2UXX A;  5H20 A;  4IZZ A;  2GIZ A;  2HXI A;  4IL6 C;  4LD5 A;  2KDZ A;  2PI0 A;  2IS2 A;  3FBI B;  2QCO A;  2Q2E B;  1WPK A;  4GGG A;  4ZYE A;  3F8F A;  4CH7 A;  4HV6 A;  3ABT A;  4HAM A;  3ZN0 A;  3K2A A;  1WJF A;  2DFF A;  5E1X A;  2KDO A;  1MJA A;  1WKM A;  2ISY A;  1T8I A;  2PX9 A;  1TT0 A;  1I1G A;  3RKQ A;  3DTK A;  1QNT A;  2GLO A;  1AOY A;  4LIT A;  1XN7 A;  1X19 A;  3HZJ A;  5JHU A;  1TL8 A;  5BNG A;  1X1C A;  3HRT A;  3OYN A;  3KYL A;  5HDN A;  2H6C A;  2I10 A;  2K02 A;  2X9D A;  3MZH A;  1BR1 A;  1LB2 A;  1R00 A;  1IW7 F;  3FIS A;  2LNB A;  2EB7 A;  4MFD A;  3HUG A;  2GAU A;  4EEF G;  3GYH X;  5GAG J;  2W00 A;  4KYW A;  2W1O A;  4Z2Y A;  1I1S A;  1LFB A;  2GOM A;  4PFO A;  1TC3 C;  2Z16 A;  5CVJ A;  4HRI A;  2L7Z A;  2HQ5 A;  2KHM A;  2NRA C;  3PL8 A;  3I56 I;  2MGQ A;  2FU4 A;  4AIJ A;  3TOB A;  4IKF A;  1IJW C;  4II2 A;  3CLQ A;  3Q0V A;  2BVL A;  4IQJ A;  3M8E A;  2DI3 A;  3JRF A;  4M3F A;  3HRM A;  2MH9 A;  3DKY A;  2LG4 A;  3ZPL A;  2A3S A;  1VQO I;  4HG2 A;  2GXB A;  3BTJ A;  4BBS J;  3HOS A;  5TGT A;  2EFP A;  2FBI A;  1IG7 A;  2CQ7 A;  3CCR I;  4M73 A;  5D5V B;  4U7D A;  3WTT C;  3L2R A;  3U1D A;  1TWH J;  2JN6 A;  1R7J A;  3ELK A;  3QP5 A;  3JRG A;  2R7U A;  4GFB A;  2HI3 A;  1TTY A;  5AIQ A;  4RB1 A;  4DZJ A;  2OPT A;  3ESW B;  1T38 A;  1IRF A;  5BMZ A;  2M7B A;  4XMY A;  3FXJ A;  5DM7 F;  1W0U A;  1IN7 A;  3CDH A;  5HS7 A;  4BJ6 C;  4Y13 A;  1LJ9 A;  5C4J J;  3HHG A;  4EJU A;  5HOO A;  4GYG A;  5FKL A;  4PZJ A;  1R22 A;  5J8C A;  1RKT A;  4BE2 A;  3E6C C;  1TLH B;  3N05 A;  2HFH A;  4JX6 A;  3ZMS A;  1F4K A;  2NVT J;  3S2W A;  5BS6 A;  2WV0 A;  2G7U A;  2D45 A;  2KIF A;  1FP1 D;  2LC2 A;  3QYF A;  3SDG A;  3TDU C;  1PP8 F;  5HLI A;  3OIO A;  5H6Q A;  2HTS A;  3P7N A;  1XMA A;  2LMD A;  1I27 A;  1Z67 A;  2PJR A;  4ABZ A;  5LGT A;  3CC2 I;  3F8N A;  1ACI A;  4ZYH A;  3WTZ A;  2DFI A;  1POG A;  2LKP A;  4UVC A;  4Y15 A;  4C3J J;  5JR3 A;  1D5Y A;  1A6Q A;  2ZBK A;  3OS2 A;  5HS9 A;  3OWT A;  4FX4 A;  2ELJ A;  3BTI A;  2MFZ A;  1X2N A;  1GV5 A;  4PSW A;  3OYI A;  2Z9O A;  2VT3 A;  5J47 A;  1KQ0 A;  5KHD A;  4A12 A;  1QZZ A;  3OL3 A;  4PSX A;  1FBQ A;  1GDT A;  1IGN A;  3LFU A;  2OUM A;  3GUD A;  2MA3 A;  3FXQ A;  1JXS A;  4GRI A;  3OYK A;  2QA4 I;  2JWT A;  2FMY A;  3JSO A;  1IN6 A;  4PGH A;  4BKX A;  2Y69 H;  1X2M A;  4OOI A;  4ZH4 F;  4KDP A;  2IPQ X;  1R58 A;  4I0A A;  3FBN B;  1DPU A;  1OCC H;  3TED A;  3A01 A;  1BN5 A;  2CW0 F;  2DA3 A;  2LY2 A;  4P96 A;  3BZC A;  3LSM A;  2M30 A;  2R7F A;  2PFB A;  4FIS A;  3E6D A;  3FK6 A;  4P55 A;  3CP8 A;  2R7Z J;  3OYB A;  3S32 A;  1MMN A;  2JA6 J;  3HTS B;  1ZHF A;  1D3Y A;  2UWM A;  2IRF G;  5D4S A;  4HPQ A;  2AQE A;  3K4B A;  4RGX A;  1JUS A;  4AD9 A;  3VEP A;  1MBG A;  1FIP A;  2JSC A;  3OR1 C;  5ED4 A;  2EFW A;  2BGC A;  3GFI A;  4ANJ A;  4XLP F;  4KMU X;  1YOV B;  4HNT A;  2CGP A;  2ZJP F;  2XAF A;  5FJ8 J;  4JYK A;  2XPV A;  2LYC A;  3T0Y A;  3GLL A;  3HSF A;  3H5A A;  1MBH A;  3PNT A;  2VXZ A;  4YEL A;  5LEK A;  2HYF A;  1RUN A;  3TO9 A;  4LB5 A;  5D8K B;  3HPG A;  4II3 A;  4QLC U;  1OCT C;  3Q0W A;  2O7O A;  4ESB A;  3OYC A;  3MKZ A;  4BNC A;  2QVO A;  2CV0 A;  1FP2 A;  1ZG3 A;  1HXD A;  2ISZ A;  1JKR C;  1AHD P;  5L3F A;  2ZCW A;  4BXF A;  1D0Y A;  1W4M A;  1Z9C A;  2F5E A;  2P81 A;  2DPD A;  2R7X A;  2Y75 A;  1GVJ A;  2WAQ A;  4N4N B;  4ZZD A;  3CQZ J;  5DM6 F;  3IKT A;  2OF7 A;  4L9J A;  5JLX A;  3CCU I;  2A5Y B;  5ICG A;  2HVR A;  2HZT A;  5D5X B;  4IOC F;  1JUP A;  2IGM A;  1WRJ A;  3F9K A;  3A03 A;  1MBF A;  2EJR A;  2FRH A;  2TDX A;  3E5Q A;  3F21 A;  2Y0M A;  1J59 A;  3ZQG A;  1I50 J;  1FZP B;  3GVA A;  4I2O A;  3S1M J;  1GT0 C;  1T2K A;  3M9A A;  4LK1 F;  4ESJ A;  3N4M A;  3S3N A;  1T95 A;  2R7Q A;  4HEA 2;  2PQ8 A;  5LRR A;  3V7R A;  4OAY A;  2FBK A;  2GWR A;  4D7M A;  4AVP A;  2PMZ N;  3HDD A;  2NOG A;  2P5V A;  3K70 D;  3FKI J;  1XMK A;  3VWB A;  2XB0 X;  4PGG A;  4KT5 C;  1TNS A;  1NK2 P;  1P92 A;  2M4K A;  4RM3 A;  3TKY A;  3MD2 A;  2X1C A;  1P6R A;  1K6O A;  1ULY A;  4G6T B;  1ZEL A;  1BM9 A;  3FWE A;  1YI2 I;  2K9L A;  2EFO A;  3L00 A;  3J7A O;  4XLA A;  3GTP J;  5KAI C;  2M45 A;  4K2E A;  3A1Y A;  1R36 A;  4ETS A;  4XLE A;  1JJ8 C;  2EWN A;  2GM4 A;  4EM1 A;  1MSF C;  2XGD A;  4HDU A;  3CC4 I;  4CHU A;  3E0J B;  3H3V K;  1A5J A;  2WV1 A;  1FC3 A;  3D1N I;  3E7L A;  3FDY A;  2L02 A;  3K4C A;  4M72 A;  1YE9 A;  2AXT C;  1XCB A;  4YIF A;  3ZMT A;  1OR7 C;  3CO6 C;  4RAZ A;  1BR2 A;  2E71 A;  1X1D A;  2QEN A;  1P4X A;  3OIP A;  1HF0 A;  1U78 A;  2IBD A;  3CMA I;  2LF7 A;  4M9S A;  2V79 A;  3BC8 A;  2OTJ I;  2X6X A;  2R0Q C;  1G59 A;  2W25 A;  1H8A C;  2LVS A;  2QBY B;  1Y0U A;  4YEJ A;  2PLY A;  2VBZ A;  3JAM Z;  5D8L B;  2JVG A;  4FT8 A;  2JUC A;  2RV8 A;  3OS0 A;  4BAC A;  1T39 A;  5F0H A;  4IHX A;  1G6N A;  2EIJ H;  1ZAR A;  2BY1 A;  4E70 A;  5FD6 A;  1EH7 A;  5JHF A;  4F55 A;  2VN2 A;  4RGS A;  3NAU A;  5FB2 A;  2VBW A;  2XGX A;  2Y2Z A;  1WZ2 A;  1Y8R B;  3CTA A;  1T98 A;  1Z3Y A;  1IRX A;  2K40 A;  2CUF A;  5IYB J;  2DFE A;  5EG0 A;  2KJC A;  1LFU P;  1FBU A;  1E0E A;  1XPX A;  1MDM A;  1J9I A;  5FKN A;  4PJJ A;  4DJA A;  2F6C A;  4C2T A;  3PIP F;  1ODD A;  3O8G A;  4UB8 C;  1VQ6 I;  2JUG A;  2QSG X;  3MMY B;  4BQQ A;  4EQQ A;  5M3F J;  5HLG A;  3M07 A;  3DPL C;  1O4X A;  5E18 F;  3J7A Y;  3C18 A;  3O2P E;  2WB1 N;  4ZDL A;  1WJA A;  4C2M J;  2R92 J;  1BI3 A;  1W5S A;  3LMM A;  4XON A;  4HNV A;  4Y33 A;  1MND A;  1FY7 A;  5LGU A;  1T0F A;  4AM3 A;  5FGM A;  1YJW I;  1APL C;  3S1R J;  4L9V A;  4O5V A;  4OMZ A;  3OYJ A;  2QQB A;  4CCK A;  4XOP A;  3W2W A;  3MVP A;  4EMS A;  2L01 A;  4KT6 A;  4EJO A;  2H27 A;  2QYO A;  4ZTF A;  5F27 A;  3GX4 X;  1ZTR A;  4B3A A;  2HDC A;  1ETO A;  5FFZ A;  4A5N A;  2E2J J;  2VQC A;  1U5T A;  3RQI A;  5FKO A;  2A6E F;  3DLL F;  2WAF A;  4RAG A;  4FX0 A;  1XMX A;  2RQP A;  5CQE A;  2OU2 A;  4CCN A;  1U8B A;  4I98 B;  4A3L J;  1T08 B;  1XB4 A;  4DZP A;  4A3F J;  3D5R C;  2CYY A;  3VYU B;  2I5U A;  5HNH A;  3KX2 A;  3V42 A;  4CYC A;  3DTE A;  3R61 A;  3ZR8 X;  4IO9 F;  3LQQ A;  3K4N A;  1BJZ A;  4XQF A;  2LP0 A;  4M6V A;  4PFP A;  4RGU A;  3WTS C;  1YIT I;  2EH3 A;  1HDP A;  1N25 A;  1SFX A;  4JX4 A;  1JUM A;  2LY9 A;  2RVC A;  3H0G J;  1KZH A;  1J0R A;  5B1A H;  1KYW A;  2K9M A;  5GPC A;  2KT0 A;  3F23 A;  1S3J A;  5DV5 A;  1SFU A;  3S8P A;  3OYD A;  4IOA F;  1B59 A;  1ZRD A;  3BRO A;  2ZME B;  3IAS 2;  2YS9 A;  4I0B A;  2XGE A;  1DGW Y;  3J80 K;  4L9T A;  4MGR A;  2JMW A;  3HL2 A;  2ZME C;  2WY7 Q;  4IRI A;  5FLX K;  1K4T A;  1UHM A;  1SFE A;  4IEJ A;  1GXQ A;  2P8T A;  4P5O A;  4ENK A;  2VL8 A;  2OCC H;  4BE1 A;  2EK5 A;  3GWZ A;  3H92 A;  3L7W A;  2B0L A;  5LHI A;  5D4R A;  5FLM J;  4B1R A;  1RPW A;  2CW8 A;  4DOZ A;  2QKM B;  4DBR A;  1KYZ A;  1P4W A;  2O61 A;  3OYM A;  3RYP A;  3HSE A;  3V4G A;  4D5F A;  2DYR H;  3JRI A;  3EYI A;  2ETH A;  3RKW A;  1OIS A;  4E7K A;  2DBB A;  1LKX A;  2E1M C;  4I01 A;  2HKO A;  1XGM A;  3OIQ A;  5GPA A;  5ILV A;  2M5W A;  3LA7 A;  1FT9 A;  4XNF A;  3V7S A;  5DEQ A;  2NS7 A;  2VQL A;  3C3W A;  4GXO A;  2FML A;  3PUF A;  3HOV J;  3MWM A;  3SZP A;  2JSP A;  4V2G A;  5J1Y A;  2OCE A;  5LGN A;  3OS1 A;  2R5Z A;  1A36 A;  2HTJ A;  3E97 A;  3LSI A;  3M3Y J;  2O03 A;  4MNU A;  1O3Q A;  2ADU A;  3GZ5 A;  1NG7 A;  2DMT A;  5EGO A;  1T56 A;  4NBQ A;  3K7A J;  3HRU A;  6PAX A;  3LSR A;  4UHT A;  4HW0 A;  2K86 A;  4TV7 A;  1G3Y A;  4BUP A;  5H2F C;  4F91 B;  5CQG A;  2W7N A;  4U0Y A;  2DOF A;  5GAD J;  3DPU A;  3F8M A;  1WQ2 A;  4WK8 F;  1BR4 A;  4A3I J;  4EGZ A;  3DQV C;  5ICE A;  4OAZ A;  4DNC A;  2WWY A;  3CCM I;  2HXO A;  2XGC A;  3F3X A;  3OY9 A;  4P9F A;  1HKS A;  2F4I A;  5K1Y A;  2WAE A;  3JSP A;  3E5U A;  5EEA A;  2E36 A;  2X85 A;  4BJT A;  3R60 A;  3TO7 A;  2M3A A;  4CYC B;  4C30 A;  2DYS H;  1RZ4 A;  3LWF A;  1V54 H;  1MKM A;  2OAZ A;  4R79 A;  4B3X A;  2JJ7 A;  2DOE A;  4FE4 A;  4ESF A;  1YX5 A;  3I5U A;  1V55 H;  4L5E A;  3V8K A;  4AU7 A;  3ASO H;  3ZMU A;  3ZQH A;  2M4G A;  3FX3 A;  3M4O J;  2P4W A;  3I3L A;  3TDZ C;  5EEG A;  2K7L A;  2KFD A;  3MFK A;  3PFY A;  1U5T B;  3ZMZ A;  1DUX C;  1N75 A;  4MO7 A;  2ESH A;  1QU3 A;  3ZQQ A;  1W1W E;  3ZQC A;  1X1B A;  3QAH A;  3BG5 A;  2L7F P;  2ME6 A;  3E1S A;  1BI1 A;  3RPU D;  1RNL A;  1T6S A;  2QKL B;  1R49 A;  3KLO A;  5DYM A;  1NG6 A;  3LAJ A;  1WH5 A;  2L3D A;  4N0B A;  2VJ5 A;  2NVY J;  3H9Q A;  3T5X A;  3QPS A;  5L3E A;  2VPL A;  4A0X A;  1HKQ A;  2VB6 A;  3I4P A;  2HS5 A;  2L54 A;  4RB3 C;  3DU5 A;  3RDI A;  3SDB A;  2KMU A;  2G9W A;  3G6E I;  3HTU A;  1HW2 A;  3FKJ A;  2LFB A;  1R6R A;  3RKY A;  5KCM A;  1QZY A;  1Z6T A;  3F8C A;  3HIF A;  4KIF A;  1D1A A;  3ZN1 A;  4B09 A;  2HEO A;  1HA8 A;  2IGO A;  1LVA A;  3E6B A;  1TWF J;  5KNL A;  4YFN F;  4DBQ A;  1HKT A;  3ZQL A;  3H9G A;  1SFO J;  1R1V A;  4ZDP A;  4BDZ A;  4E7Z A;  4U0V A;  4DYR A;  2A05 A;  2MLG A;  4XKV A;  3NEU A;  5E3L A;  2EZI A;  1LDD A;  3HB9 A;  3SHF A;  1BW6 A;  1F9N A;  1YIO A;  5KK1 A;  3PO2 J;  3RSN A;  4BHB A;  1P7I A;  3PO3 J;  2DA1 A;  5FKK A;  3JRE A;  1MJ9 A;  1I6H J;  2ZNZ A;  3GTK J;  3EET A;  3PFI A;  3K4K A;  2DA6 A;  3KZY A;  4FE7 A;  2HVS A;  5E17 F;  2BE5 F;  2VQH A;  4CCJ A;  4HBL A;  2E5N A;  3F72 A;  2KKO A;  1YRN B;  1J2X A;  2HOT A;  3HJE A;  3TBI A;  1RRJ A;  5ICC A;  4DQ2 A;  2VLA A;  4A3C J;  4A3G J;  1BBY A;  4QWQ A;  3LSG A;  1MGT A;  5KVR A;  1J7K A;  3GFM A;  2JRT A;  2MAB A;  1T0F C;  3AAF A;  3RIR A;  3BY6 A;  2PMU A;  1RI7 A;  2L4M A;  3F8B A;  3P9C A;  2VJ4 A;  4XLN F;  1IAW A;  1Y8Q B;  2XAS A;  2MC3 A;  5EG0 B;  2VJI A;  1AKH A;  2MLK A;  1IZ1 A;  1I3A A;  4QSH A;  2E5Z A;  1FTZ A;  2RRE A;  4BHC A;  3QU6 A;  3QYB A;  4YII A;  1A35 A;  4FET A;  2LLK A;  2Y30 A;  1MJB A;  3BZK A;  3DKX A;  2UUZ A;  1W5C C;  4UUT A;  4XKB A;  5D5U B;  2ZXJ A;  3QOD A;  2DO7 A;  3L1P A;  2I8D A;  4ITV A;  1YJN I;  3HKZ N;  5E79 C;  3J81 K;  2DN0 A;  1QVU A;  3K1M A;  2K9Q A;  4XSZ F;  2DXI A;  4AYB N;  2YU9 J;  4JOM A;  4WXH A;  3BG3 A;  5ILU A;  3JR9 A;  5ERI A;  1MH4 A;  1N77 A;  4OIR F;  1V5E A;  3V8L A;  3E3V A;  1SC7 A;  3QPH A;  3BG9 A;  1FEX A;  3LOC A;  3M1E A;  1SVM A;  1XCV A;  3CUQ A;  3OYG A;  4X6A J;  3A0B C;  4IHW A;  3N97 A;  2W82 A;  1YQA A;  3QU3 A;  4F92 B;  1BI2 A;  4EM2 A;  4C2U A;  4NDL A;  4XN3 A;  1S6L A;  2M87 A;  2QLZ A;  2A07 F;  4DW6 A;  2F5C A;  1VZ0 A;  1QQI A;  2CV1 A;  2ZO4 A;  3F0C A;  2XAQ A;  2VE9 A;  2H1K A;  2GQQ A;  2LR8 A;  2GA2 A;  4KIB A;  5DDG A;  5FKM A;  2GA1 A;  1FMW A;  2Q8K A;  5E3N A;  3QRF F;  4L9N A;  1JKP C;  1E3H A;  2TCT A;  3WU1 B;  3K1P A;  1DP7 P;  2HQA A;  3BG7 A;  4RB2 C;  4LG3 A;  4HST A;  3HOX J;  1XSX A;  1RET A;  1MH3 A;  4CZC A;  3OYF A;  3KCC A;  3C1D A;  1JHF A;  5TRD A;  4EM0 B;  4PJL A;  5L3D A;  2VAS A;  3W2A A;  1S7O A;  4WXD A;  4L5I A;  5F0F A;  2WAD A;  4NQW A;  1G8X A;  1Q1H A;  2ZJR F;  2OC6 A;  1STZ A;  2M1B A;  5FLV A;  2QSH X;  1N78 A;  3C2G A;  3DCF A;  2P7V B;  4FHT A;  1AWC A;  5HLH A;  2ELH A;  1SFK A;  3J7Y J;  1BC7 C;  2PJP A;  2IS6 A;  1I6X A;  2E7X A;  3PSF A;  4M9X A;  1O57 A;  3CP2 A;  4UV8 A;  5F6F A;  5L3C A;  1VQ5 I;  1ZRC A;  1ZK8 A;  3DLA A;  1Z77 A;  1L3L A;  4YFX F;  3BR2 A;  2IS4 A;  3DXJ F;  2X0L A;  2FA5 A;  2NS0 A;  4XKW A;  1Y6I A;  3PJR A;  5L3B A;  4WX9 A;  2R7T A;  3OSG A;  2CU7 A;  2Z1D A;  2V1D A;  4YRV A;  1B9M A;  2QQ9 A;  3H5R A;  4XR6 A;  3FXU A;  3BCB A;  1ZH5 A;  4R1H A;  2NOJ B;  3MZ8 A;  4LGW A;  3BTC A;  1B9N A;  4HOB A;  3I53 A;  1VQ7 I;  2FD5 A;  2LTP A;  3BJO A;  2DPU A;  1QVT A;  2M34 A;  3GBG A;  3QYE A;  4DYQ A;  2ZXH A;  1YS7 A; 
#chains in the Genus database with same CATH homology
 5JHF A;  4F55 A;  4BQO A;  4BJ5 C;  4NUB A;  3S93 A;  1Z3Y A;  1IRX A;  2L9S A;  2R7S A;  2X1D A;  1UAA A;  4IX7 A;  2BOL A;  4D9J A;  3L2Q A;  1W36 D;  1FMV A;  1UEL B;  4XKC A;  1E0E A;  2R7R A;  3HC7 A;  3AKZ A;  3NWT A;  4PJJ A;  4DJA A;  2F6C A;  2CFO A;  4C2T A;  4KIT B;  3VSK A;  1AA7 A;  2JUG A;  3MMY B;  3SYT A;  2DCE A;  4BQQ A;  5CPR B;  4H4K C;  4ZDO A;  4MLO A;  3DPL C;  3J7A Y;  4ZDL A;  1WJA A;  4BDY A;  3DTI A;  3LMM A;  2KLO A;  3UR3 C;  4XON A;  4NQW B;  2AQF A;  4Y33 A;  1MND A;  2HU9 A;  3M1C A;  2IGK A;  2Y0S A;  3UNG C;  2IS1 A;  3OYJ A;  1MW7 A;  4C9Y A;  4CCK A;  3TL4 X;  4XOP A;  2ZSH B;  3W2W A;  2CUJ A;  2X51 A;  3OL4 A;  4E7I A;  4CSW A;  2K3P A;  4KT6 A;  1P9Q C;  2O5R A;  4F52 A;  2KRC A;  1V5F A;  2MC4 A;  4HSR A;  3CJQ B;  4ZTF A;  4DIQ A;  4XOR A;  4E7S A;  2A5W A;  2CS3 A;  2A6T A;  4CCO A;  1DP3 A;  4XLC A;  2VQC A;  3SEZ A;  2VKH A;  1JI8 A;  2WAF A;  2HZD A;  3BCA A;  1WJ5 A;  3NWS A;  5CQE A;  4RM2 A;  3D5S C;  4CCN A;  3CJR B;  4PJM A;  3G2B A;  3D5R C;  3VYU B;  1TZL A;  5HNH A;  3KX2 A;  2Z2S B;  2PJR B;  3V42 A;  3DTE A;  3ZR8 X;  4U87 A;  3K4N A;  3EPZ A;  3I9V 2;  4XQF A;  2HPI A;  4PFP A;  3IUO A;  1WJC A;  4DGW B;  4BGD A;  2RNG A;  3OR2 C;  4HNU A;  1V5G A;  4BL0 B;  1D1C A;  3ZGK A;  1GLN A;  3LL7 A;  4E4H A;  1Z7L A;  2R4G A;  4CCM A;  3EUK L;  3L2U A;  2K9M A;  1MNE A;  2XAU A;  4RLF A;  3S8P A;  4E6K G;  3OYD A;  2RQQ A;  2X6Y A;  2XF5 A;  4XM3 A;  3AL0 C;  3IAS 2;  4LIU A;  3HXL A;  1DGW Y;  5FRO A;  3MKY B;  2CV2 A;  2KP6 A;  3SZG A;  4CA0 A;  3HL2 A;  5FRN A;  2WY7 Q;  3VYS B;  3HUG B;  2JA2 A;  4P1W A;  2LY1 A;  4P5O A;  1Y56 A;  2VL8 A;  2R7V A;  4BE1 A;  3H9J A;  2W4S A;  1D0X A;  4ZJZ A;  3LSH A;  1MMG A;  2F5V A;  2V4J C;  3A4C A;  3IAM 2;  2CW8 A;  4DOZ A;  2QKM B;  4IZZ A;  4DBR A;  5HLT A;  2IS2 A;  2M7A A;  3OYM A;  3K70 C;  3FBI B;  2Q2E B;  2WBM A;  3D5L A;  2XDV A;  3IP4 B;  4CH7 A;  3HG9 A;  4X0G A;  4U7B A;  4E7K A;  4KIS A;  1LKX A;  2E1M C;  1WJF A;  2R7O A;  2KDO A;  3H5N A;  3OIQ A;  3M8J A;  1PYV A;  1TT0 A;  2X6W A;  4XNF A;  3L2V A;  3DTK A;  2IXS A;  3HOT A;  4LIT A;  3ZCO A;  4NNJ A;  1X19 A;  3VDX A;  4BEH A;  2VQL A;  3CF2 A;  4XLF A;  1X1C A;  1Z21 A;  3OYN A;  1YX3 A;  3KYL A;  2UV1 A;  1BR1 A;  2LRD A;  2JSP A;  3OS1 A;  2VQG A;  2HNH A;  2VKD A;  2KL4 A;  1OLT A;  3LSI A;  2V9K A;  2LBF B;  1ERD A;  2W00 A;  2V1N A;  2W1O A;  1DQU A;  1NG7 A;  2GOM A;  2V6E A;  4PFO A;  2R7W A;  2Z16 A;  4HRI A;  2BW3 B;  3W3C A;  4BEH B;  2KHM A;  2ZFU A;  3PL8 A;  4BUP A;  4F91 B;  5CQG A;  2L2O A;  3PNV A;  2W7N A;  3DPU A;  4BQN A;  1BR4 A;  1LFP A;  4NC8 A;  3ZXS A;  3DQV C;  4IKF A;  4OAZ A;  4II2 A;  3OY9 A;  3H35 A;  2BVL A;  4IQJ A;  2F4I A;  3BLY A;  2WAE A;  2HDW A;  2X85 A;  4BJT A;  3RTR A;  3DKY A;  2LG4 A;  3OYE A;  4J00 A;  2M3A A;  4HG2 A;  4C30 A;  3HOS A;  5TGT A;  2VXD A;  2L5Q A;  4R79 A;  2IGN A;  4B3X A;  2WA0 A;  1YX5 A;  3EUH C;  3CZ6 A;  4AU7 A;  2HVQ A;  3L2R A;  2M4G A;  1W36 C;  2R7U A;  2FUG 2;  1SAU A;  3I3L A;  4JQF A;  4OWR B;  4E7J A;  3PNY A;  3PFY A;  5LFA A;  3OYA A;  1N75 A;  1QU3 A;  3ZQQ A;  3PSI A;  2M7B A;  4B43 A;  1X1B A;  4XMY A;  2CUZ A;  1J09 A;  4IQ4 A;  4BJ6 C;  1QHG A;  3E1S A;  1D1B A;  2BVM A;  3RPU D;  2QKL B;  2OV7 A;  5HOO A;  3LSK A;  1WJE A;  3DPT A;  1NG6 A;  3C2H A;  4BE2 A;  2VJ5 A;  1WJD A;  3N05 A;  4F93 B;  2PMZ A;  3H9Q A;  1BOB A;  2MYS A;  2VPL A;  1QHH D;  1PJR A;  2LC2 A;  3QYF A;  5HNF A;  1LDK B;  4PK4 A;  2VB6 A;  4RLQ A;  3DU5 A;  3SDB A;  2KMU A;  2PJR A;  4B48 A;  3DU6 A;  4B47 A;  3FKJ A;  1R6R A;  4Y3O A;  5KCM A;  1D1A A;  4ZTJ A;  3OS2 A;  3OWT A;  1HA8 A;  2IGO A;  1Z3X A;  5KNL A;  2X1E A;  3KEY A;  2ELJ A;  3QOE A;  4DBQ A;  3H9G A;  2MFZ A;  4ZDP A;  1WFX A;  4BDZ A;  3RQ4 A;  4E7Z A;  1U0J A;  4XLH A;  4PSW A;  3OYI A;  4CUG A;  3VYR B;  5KHD A;  4AVZ A;  4XKV A;  4N4O B;  2CW7 A;  2VIX A;  4Y4R A;  3OL3 A;  4LIV A;  2L7K A;  4PSX A;  3EUA A;  3LFU A;  2OUM A;  3RSN A;  3ZRG A;  5HVQ C;  4BE0 A;  4GRI A;  3OYK A;  5CKT A;  2LRE A;  2XSJ C;  4BS9 A;  3K4K A;  2HVS A;  4KJZ A;  1X1A A;  2K5C A;  4ZC3 A;  2VQH A;  4CCJ A;  3S3O A;  1MMA A;  2V7F A;  4EAT A;  2ZSI B;  2E5N A;  3K6G A;  1X4O A;  3H0D A;  3TBI A;  3ONQ A;  3FBN B;  2VLA A;  3U21 A;  2MD0 A;  4XN0 A;  3FHN A;  3S3M A;  2LY2 A;  4QPQ A;  3LSG A;  2CH0 A;  3LSM A;  2DOA A;  2MAB A;  3CES A;  2BW3 A;  1T0F C;  3CP8 A;  3OYB A;  3S32 A;  1MMN A;  2Q1Z B;  2VJ4 A;  4D1Q A;  2UWM A;  1DGR M;  1D0Z A;  2WY8 Q;  4FAS D;  2DT6 A;  2AQE A;  2LBF A;  2VJI A;  2V26 A;  3K4B A;  4HPQ A;  2HPM A;  3OR1 C;  4CCL A;  4ANJ A;  4HNT A;  1K6Y A;  2E5Z A;  2RRE A;  3QYB A;  2DT7 B;  2E60 A;  2LYC A;  4FET A;  3AFH A;  3DKX A;  3H5A A;  3PNT A;  2UUZ A;  2ZXI A;  2VXZ A;  4XKB A;  4XOT A;  4YEL A;  2L9N A;  3QOD A;  2XF6 A;  3HPH A;  4B44 A;  3HPG A;  4II3 A;  2I8D A;  2KZV A;  4ITV A;  3OYL A;  3VYT B;  3W2V A;  2LOO A;  4E7L A;  3OYC A;  3MKZ A;  2XC7 A;  2CV0 A;  2DXI A;  1X4P A;  3OMY A;  4JOM A;  3PUB A;  4BXF A;  1KON A;  1D0Y A;  1N77 A;  1V5E A;  4XL9 A;  3CMM A;  3TMO A;  2XF7 A;  3A2K A;  2KQR A;  2GOX B;  2R7X A;  2WAQ A;  4N4N B;  3OYG A;  3L2W A;  2HVR A;  2W82 A;  4F92 B;  2IGM A;  1WJB A;  3F9K A;  4NC7 A;  4C2U A;  4XN3 A;  4QPO A;  3K10 A;  3OOU A;  1VZ0 A;  2CMP A;  3BG6 A;  2CV1 A;  2JVH A;  5FRM A;  4RMN A;  2DJI A;  3S3N A;  1FMW A;  1T95 A;  2R7Q A;  4HEA 2;  4J01 A;  4OAY A;  2HQA A;  3BG7 A;  2KPM A;  4ZYA A;  4LG3 A;  3K70 D;  4HST A;  4CZC A;  3VWB A;  3OYF A;  1LVK A;  2VJJ A;  1EA3 A;  3MKW B;  1UG0 A;  2M4K A;  4RM3 A;  3MD2 A;  4E7H A;  4PJL A;  2X1C A;  2VAS A;  4F3Q A;  3W2A A;  2WAD A;  4G6T B;  1G8X A;  3DEE A;  1ZEL A;  2OC6 A;  3HKZ A;  2K9L A;  1N78 A;  2KRH A;  3C2G A;  3VSL A;  1S9H A;  4XLA A;  4BU2 A;  3K4L A;  1SFK A;  2E1M B;  4AYB A;  3OYH A;  2IS6 A;  3A1Y A;  2P0W A;  3PSF A;  4XLE A;  3CP2 A;  3E0J B;  4PUS A;  3DLA A;  3FDY A;  3K4C A;  3K4J A;  2WB1 A;  1YE9 A;  2IS4 A;  1OR7 C;  4XKW A;  1Y6I A;  1BR2 A;  3PJR A;  1X1D A;  2R7T A;  3DWL E;  2Z1D A;  3OIP A;  2LH9 A;  4YRV A;  3K4M A;  5LD2 C;  3H5R A;  4XR6 A;  3BCB A;  4PJN A;  3BC8 A;  2X6X A;  2NOJ B;  3SEQ A;  1MMD A;  1G59 A;  4YEJ A;  2M0M A;  2JVG A;  4BAC A;  3GBG A;  3OS0 A;  3QYE A;  2ZXH A;  3AL0 B;  3RCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...