1WJEA

Solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.
pubmed rcsb
source organism Human immunodeficiency virus 1
total genus 12
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjeA00
1MW7A 1E0EA 1WJFA 3HPGA 3HPHA 1WJBA 1K6YA 3F9KA 1KONA 4F3QA 1WJAA 1WJEA 1WJDA 1WJCA 1LFPA
chains in the Genus database with same CATH superfamily
3I0TA 1LUJB 5D4SA 5J8FA 4OMYA 3Q3SA 1NG7A 1MJBA 3L1PA 2HZDA 2ZB9A 3PNVA 3MEXA 3LAPA 3DTKA 1J2XA 1N25A 2JA6J 1LVKA 2E34A 4CO8A 4XIDA 3FM5A 1BOBA 1D8JA 2H6BA 4J01A 2EIKH 3S16J 4EJTA 3F6OA 3S8PA 2WB1N 1U5TA 4BHBA 3IH2A 4OAZA 1T8IA 2ZXJA 1DGRM 1FMWA 1K78A 1V54H 4CYDA 4P96A 1OISA 1XMXA 1USSA 2FOWA 3M4OJ 3E5UA 4FCYA 3SEZA 3F23A 5FKMA 2K4BA 5E18F 3CJTB 2KISA 1E0EA 3KP7A 3OSFA 2CMPA 3PJRA 3TDZC 4DOZA 2P7VB 1CGPA 3K1MA 3N4MA 1HW1A 2K86A 5E1WA 3KLNA 1KQ8A 2H8WA 1VQNI 2CGPA 3AG2H 3SFZA 4AIJA 1KU7A 2WV1A 1VQ4I 1Q1HA 4RAZA 4HV6A 3VOEA 2A69F 3IH4A 3JCUC 4IVNA 4MIMA 2E5ZA 1W4MA 5EGOA 2TRTA 4IPAA 1TWCJ 4PUSA 4JK1X 3H0GJ 2E1OA 2NVQJ 1XTAA 4BYYA 3ABKH 3GEZA 4FT8A 3COAC 1PP8F 1BW5A 5M3MJ 3FXOA 2OZ6A 3JRFA 1X4PA 1IDYA 3WHBA 1XSXA 1UELB 2CO5A 1R6RA 3MVPA 3N05A 4F52A 2ZMEB 3BZKA 1PUEE 5CVJA 4GYGA 1ETOA 4U88A 3H35A 4JYKA 2FX0A 2Y75A 2JRTA 3WTZA 3X2QH 3CCMI 2NS8A 4IO9F 2JMWA 4ON0A 4B47A 1YTYA 4P9FA 1G3SA 3DP7A 2E1MC 2LBFB 4PZJA 2GBYA 2R7ZJ 1HDDC 3GZNB 5B3SH 2OTLI 3A01A 1Y56A 1XCBA 1XMAA 2F4MB 1LDDA 3RPQA 1JXSA 2WAEA 1SANA 5FD5A 4B1RA 1LFPA 3WGHA 1BI0A 2LRDA 2ZXIA 2ZNZA 2Z16A 2QM3A 3F0CA 4XRSG 2HXOA 2VC0A 2IEKA 3NRVA 3G6EI 1C0WA 4RLFA 2IT0A 4B4CA 2VBYA 1PVEA 2XB0X 3ZMZA 1H89C 3RCOA 1R5ID 3D5SC 2B0LA 4LK1F 4G9YA 5DD8A 4M72A 4A3DJ 3IWZA 2CV1A 1J09A 1TWGJ 2LSOA 1AU7A 4B09A 4FX4A 3C2HA 2R5YB 3ECOA 3I71A 2ZJPF 4D1QA 1SVLA 2X0LA 1BBYA 4UY8I 2A61A 2ISYA 4C3IJ 4DGWB 1WRJA 2LMDA 2RVCA 3TL4X 4BXFA 2DT5A 4HW0A 1ZGWA 5B1BH 3HRMA 4U7BA 4E7SA 1X19A 1VQPI 4A0ZA 4AWXB 3B6AA 2LKSA 5EDNA 2F4IA 3HOUJ 4KITB 4A5NA 2DN0A 4NC8A 3ZQGA 2GIZA 2W85A 3V7CA 5HODA 2HU9A 2HTSA 2QKMB 3IP4B 5F1RA 1MMAA 3K4JA 1Y0UA 3ZQLA 1KONA 3FIWA 1QHHD 2CSOA 2E1MB 3F21A 1WWXA 3FXQA 4LMYA 1MBHA 3REOA 3GBGA 1Z7UA 3MZYA 5DCFA 4F92B 4HQMA 2E7XA 1EJ9A 1TC3C 3DEEA 4D5CA 2Y31A 1UG0A 4OIRF 2KZGA 4I98B 1Z3YA 4AVZA 2Q2EA 2O9LA 4BNCA 2D5VA 1DGWY 3ABMH 3WTWC 3LQQA 4HX4A 2K9SA 2WA0A 3UKGA 2ZC2A 3F9KA 4F7ZA 2E36A 2VI6A 1IV6A 1T33A 4RAGA 4ZZLA 2IGMA 2YU9J 2DU9A 4UVCA 3A0BC 4EJUA 4B3XA 3M7GA 3TQNA 1BR2A 2DLLA 2KZVA 4N9IA 4YFKF 1MNDA 1YIOA 4P1WA 4E7JA 4LLGF 4DIQA 2KFDA 1ZGAA 3S2HJ 3I53A 1WJAA 2XGXA 3LNQA 2VQHA 3CUQA 2CV2A 3QU6A 2ISZA 2DMNA 2K7LA 4XOTA 2FOKA 5K5RA 2VKEA 1GT0C 2QGUA 2YX4A 3HPHA 1FZPB 3FMSA 2LY9A 3MCZA 5ILVA 3SDBA 3ZMDA 3JSPA 3RKYA 4RM3A 3JRGA 1T38A 1O3RA 3DCFA 1B9NA 3DTIA 1YYVA 2BW3A 2OUMA 3BDDA 4OOIA 2ME0A 1DP3A 2NAZA 3WHCA 3O3KA 3Q5FA 4BDYA 2A6HF 4C3JJ 5CPRB 2IBDA 1D0ZA 3CMYA 1P7JA 4KDPA 3LSRA 3K69A 1ETQA 3RZOJ 4HLYA 5BNGA 2H8RA 3HRTA 3S3OA 2JPBA 1IRFA 1GHCA 4S0HB 2VQGA 5EEAA 2DO7A 2PLYA 1IXSB 4I02A 1OR7A 3IAS2 2W25A 4GCVA 5K7ZA 3MZHA 2WY7Q 1GVDA 3I59A 1OCPA 2K9NA 2MFZA 3QPSA 2QSFX 1OYIA 2MW8A 4AIKA 1FTZA 2EA2A 1Z9CA 1RC9A 5B5EC 2RDPA 4A6DA 5IOYA 2LR8A 4N4NB 3JRHA 4QSHA 3HUGA 5DCMB 3L7WA 4YIFA 2FRHA 2AQEA 2XF6A 2BOLA 3BR6A 3PNYA 4Y13A 2NOJB 2RQPA 2ECBA 2XF7A 5ERIA 3HOTA 2MABA 2BBYA 5M5WJ 2IGNA 1O4XA 2RQQA 2EINH 4BAYA 4LK0F 5FFZA 5LRRA 1IRGA 2L9RA 4C2UA 3BQYA 2Y69H 5KAIC 2W7NA 3KYLA 1NHAA 1BJAA 1Z0XA 4MGRA 1YITI 1HBXG 3G1MA 4AYBA 3BR5A 2P5KA 3DPUA 4A3CJ 1FJLA 1U8RA 1I1SA 4K2EA 4UVBA 1ZR4A 1J5YA 1GV2A 3CDLA 3GUDA 1YW8A 2FUG2 4KN7X 5D6EA 2JSCA 2K5CA 2ZFUA 3ERMA 4XSXF 5E79C 4BBSJ 1BR4A 4HSRA 1MBEA 1V5FA 2OZUA 4Y15A 2NNNA 4GRIA 3GTLJ 3GZ6A 2UV1A 2D45A 1MJ9A 3C7JA 4RB2C 1BC7C 1MNEA 3MN2A 3ERED 3LMMA 1VTNC 3I56I 1OCCH 2DQLA 3IKVA 4F3QA 3BG9A 2K9QA 5IT9K 1HA8A 2HKXA 5IT3A 5ILUA 4EJVA 4JP0A 3CLQA 5K5OA 5F6FA 1PUFB 2XAQA 1T56A 4OIPF 4AIHA 1ON1A 3CESA 1R1VA 3L2RA 2EIMH 2VE8A 2CQKA 1KQ0A 3VYRB 1MDMB 4E7IA 1IAWA 5E3OA 2BY3A 4IHYA 3ZQFA 3FXKA 4A0XA 5K7HA 1JT0A 5EZGA 1WJDA 2HTJA 5H6RA 4EJWA 2H6CA 3M1CA 5TGTA 1HKTA 3F8MA 2CJJA 4CICA 1YJWI 2FMYA 4P5OA 4I6ZA 2K9MA 4M9SA 1Z6TA 5FLXK 1JUPA 1Z3XA 1T2KA 1VQOI 1GXPA 3WU0A 1WJEA 2F5VA 3BTIA 4D0PA 2GM4A 2O8KA 2UWMA 2X9DA 3I3LA 1EH8A 1SD7A 2M87A 2DT7B 1U5TB 1KYWA 5DM6F 5E17F 2KDZA 3DU5A 3EUHA 1D3YA 2XV4S 5JFRA 1K78B 2EV0A 4F91B 5HDKA 1EF4A 2VPRA 3BG5A 4A6EA 2ZJ2A 1RRJA 2ZMEA 4G7ZF 3S14J 3AAFA 3KIOA 3PFIA 4C3HJ 4UUSA 5GADJ 2CWEA 4IQJA 3OYHA 1U8BA 1UB9A 2M45A 4KISA 2L4MA 1EA3A 1RR8C 4KUMA 1G2HA 2LBFA 2O7OA 3PQKA 3GF2A 1JKPC 1G3WA 4DBQA 5ED4A 5GTHC 3HOWJ 3SEQA 1XDSA 4ZZDA 3BJOA 1ZG5A 1G8XA 1X2MA 1HC8A 1HCRA 4XKWA 3DLAA 1ZTRA 1TZLA 3HOYJ 1P4XA 3RJPA 3JRDA 3CCEI 4FE4A 3AG1H 1FBQA 3F72A 4PK4A 3S1RJ 2CQQA 5FFXA 3OYMA 5EGOB 1B8IA 5B66C 1TQPA 2OJED 4XR6A 2Y30A 3S1MJ 1ITYA 2KLOA 2Q0OA 3CCLI 3RSNA 2EZLA 2DYSH 5HDNA 2VONA 1VF9A 4RDUA 1SEUA 3TP3A 3HM5A 3FWEA 3F22A 3B6CA 3E7LA 2JVHA 1D0YA 4XN0A 1LJ9A 2GAUA 5F04A 4HRIA 5F0CA 3LA3A 3ESWB 2HDCA 3DU6A 4BKXA 4YFXF 2QF7A 2XDVA 4LLNA 3D5RC 2PMZA 4ANJA 3J80Z 4BQQA 2F2EA 4HG2A 1Y0NA 4L5JA 4BS9A 3W6KB 1IN6A 1N75A 3R4KA 4UB8C 2L4AA 4Q47A 1MNMC 3VYUB 4BXXJ 1FEXA 1I6HJ 1J9IA 2PQ8A 2WBMA 2NRAC 1YOVB 3WG9A 1XS9A 5FROA 1O57A 4KMUX 3GCMA 1HDPA 5FKKA 2C6YA 2QWWA 1MJAA 3R0JA 2B63J 4EM1A 5J47A 2DMPA 2KMUA 4JBAA 2VASA 1I5ZA 4M3DA 4NBQA 3EYIA 5BS6A 4KJZA 1UG2A 2JQ7A 3SZGA 3OYBA 3PO3J 3QOEA 3SJMA 2EFNA 5LEKA 4ASNA 1YE9A 3LSGA 3CLOA 2CH0A 2IA1A 2RN7A 2R3SA 4KIGA 3IWFA 2WAQA 2DA7A 2GA1A 3CCRI 2VL8A 3CUQC 2XRNA 1MBJA 1XB4A 3KEQA 5EF6A 2XAGA 4Y17A 5IPAA 2DOFA 1R5HA 2IA2A 4NHJA 5HLIA 4XBFA 2LP0A 3L2UA 3VPRA 4LFUA 4HEA2 2Z99A 5CLSA 4XRMA 1HQCA 4BY7J 1Y6IA 2E2IJ 1BA5A 2O03A 3KLOA 2K4JA 1IN8A 2P5VA 2V9PA 3I54A 4L0YB 2JJ7A 3QYBA 2L5QA 1A36A 2XUBA 2EPFA 3ZN0A 5DYMA 2JA5J 3SDGA 3TW7A 3BJAA 4EGYA 2CW0F 1D0XA 2P8TA 3HTSB 2Q2EB 4RB0A 1IZ1A 4ENNA 1YQAA 1OR7C 3ABTA 1LEBA 3VDXA 3PIPF 1D1BA 1R58A 4N4OB 1BOAA 1X2NA 2BZTA 4WWCA 2OU2A 4G6QA 3JTHA 4I7HA 1K4SA 2VE9A 3NQOA 2QQBA 2XAHA 5LLQA 2V9KA 3IC7A 1OYYA 2XGEA 4IEJA 1GV5A 1QZEA 1OCZH 2BVMA 2E7WA 5EG0B 2R5ZA 1I39A 2VIXA 5C44J 2YS9A 1B4AA 3GW2A 2EFWA 5LGNA 1I6XA 1MSFC 3CQZJ 2GXBA 1FTTA 4M71A 5LBQA 2Z33A 4S04A 1HSTA 1S7OA 2IVMA 2UXXA 2DODA 1ZAOA 1P4AA 3K10A 3PL8A 4M3FA 1QZZA 2FD5A 3HYIA 3ABUA 3ZMTA 1KQ9A 2HOTA 2Z2SB 4YIRX 2QYOA 4I0AA 1P92A 1K4TA 2BEOA 2L01A 1ONVA 5J1RA 2K3FA 1FLIA 1E3HA 1AWCA 3ZQIA 3KZIC 2KPMA 2PMUA 4PCQA 2GZWA 1K6YA 2R7TA 4QPQA 1TLHB 3CTAA 1WJCA 1XGNA 4PSXA 4Y33A 3I59B 4II2A 3HSFA 4ZTJA 5FLVA 2ZFWA 3DKWA 4A3FJ 2E1NA 1O7FA 3LSMA 4B44A 2W82A 1BN5A 1F43A 4HA8A 1WH5A 3GWZA 1WHUA 1JE8A 1G59A 1LKXA 2X1EA 2JSPA 1Z67A 2L0KA 3BTLA 5E3MA 4W1UA 3QAHA 4E7ZA 1LPQA 2XAFA 3KP2A 1P9QC 5FB2A 3E6CC 2OD5A 5TRDA 1IO2A 3Q0UA 3NWSA 5CKTA 2E2JJ 5ICCA 2R7VA 3TO6A 5D4RA 3K7AJ 4IHTA 2BY2A 3WTTC 2PJPA 4L5IA 3CO6C 1X1BA 1QQIA 3E1SA 2EQRA 5JLWA 3B73A 1G6NA 1PJRA 4CZZA 1O3QA 3F8CA 3ZMUA 5EEGA 1TWAJ 3SZTA 4G7HF 2M7BA 4DW6A 5K7FA 4HDVA 1NH3A 2JA2A 3BTCA 3OYIA 3OYLA 2CW8A 1FP1D 4IQ4A 4HYEA 3ZQ7A 4ENMA 2CQXA 5TJJA 1F36A 1X4OA 2XHKA 1ENHA 4D5FA 3HHGA 4FQGA 2FQ4A 3RYRA 3OR1C 1XSDA 4XORA 1OCRH 4J19A 2ZMEC 2DK5A 4ZYAA 4AD9A 3OS1A 3PUFA 1MH4A 5CYVA 3VODA 2HVRA 2O6GE 3CCYA 1J59A 3LFUA 1A31A 3FXRA 4OIQF 5LD2C 3OYGA 1SC7A 4LG0A 4AVPA 4CA0A 2M0MA 5J4VA 1I1GA 2LKPA 2R7SA 3LQRA 1Y1WJ 5KAFC 3H9JA 4LGWA 1D8KA 1RKWA 5E8GA 3W2VA 5DM7F 1UHWA 3BZCA 5L3FA 1QU3A 3BPXA 1QA6A 2E71A 2FMLA 3JRAA 1JJ8C 4IF4A 2IGOA 2NVTJ 3A02A 2FBIA 5H2FC 2FNPA 1ERDA 4BACA 1YRNB 2V4JC 3Q0VA 3OS2A 1E2XA 1Y8QB 1QZYA 3MFKA 3BR0A 1Z1DA 2TDXA 2G0EA 1F5TA 3SHFA 4CCLA 2EK5A 1VNDA 3DQVC 1VZ0A 1KYZA 2M8EA 2F48A 2EFQA 3HKZA 2YX7A 2ZNYA 1D5VA 1JHFA 2QKLB 3RQ4A 1U2WA 3P9KA 4IRIA 5DEQA 1NK2P 3GFMA 2VPLA 2ECCA 5AIPA 4E7LA 1IJWC 4ZYHA 2VN2A 2ZSIB 4UUSB 5HLHA 2DTZA 2XPWA 3BCAA 3RPUA 1SMTA 1KU9A 1KGSA 2HPMA 2ELKA 3VYTB 3JAMZ 2VT3A 3RKXA 2DXIA 4M73A 2NVUB 4UV9A 2YSRA 1JT6A 5J3LA 1V4RA 2VUMJ 4P9UA 2FNAA 4PFOA 3GVAA 4NB5A 3BC8A 3CF5F 4PJMA 1TQMA 2ME6A 1WPKA 2R93J 2D1VA 2ZJRF 2L2OA 5HNFA 3DEWA 1B8IB 5H6QA 1T0FA 5IP7J 2LF8A 1DP7P 1OCTC 5HDGA 1TW2A 3O8HA 5FKLA 1YW9A 2IA0A 1UJ8A 3L2VA 2Y9YA 2FU4A 2HPIA 3E97A 3WE2A 4RBOA 1L3LA 3F8NA 1BM9A 4MO7A 3NAUA 4FISA 1U9OA 3K1NA 1IUFA 1L0OC 4TV7A 3BJ6A 3RPUD 5JR3A 3LSHA 4U87A 1BL0A 4Z2YA 5L3EA 3OYJA 4ABZA 4C30A 2HYFA 2PN6A 3K70D 3L09A 3FHZA 3BG6A 1QGPA 4AIDA 3HTUA 1DU6A 2HQ5A 4O5VA 2R7DA 3J7ZI 4UNOA 4AYBN 1N77A 2VKVA 2CU7A 3H92A 1FYLA 2M8GX 4ZDPA 1VQLI 3ZOBA 4A3GJ 3PSIA 2ZBKA 3DBHB 1HSJA 1S8NA 2QLZA 5KK1A 1CQTA 4BQNA 2DOAA 2W4SA 1B72A 2DA6A 1ZHFA 2XPVA 3OIPA 4HDUA 3QPTA 1Y39A 5JI6A 1BI2A 2UZKA 4L0ZB 1BW6A 1U6GA 3S1NJ 2AS5F 4PFPA 2LG4A 1O3TA 1ZRFA 1TNTA 4FASD 2JWTA 5ICGA 4ESJA 2ESNA 3KP6A 2QQ8A 3E3VA 4A2UA 2KIQA 4A69C 2L7MP 4QWQA 1Z05A 3JAMK 2NNYA 2IW5A 1T98A 5B1AH 3K4KA 3D5LA 5D5XB 1FSEA 1ETVA 4XK4A 3HL2A 2V7FA 1QPMA 1TNSA 2DW4A 4PGHA 2CUFA 1SVMA 5EG0A 2L7KA 2B7EA 1E3OC 3FK6A 1WI3A 5EYRA 1OKRA 1XN7A 2EIJH 2MD0A 2X1DA 4BE1A 3H3VK 1MGTA 2HKOA 2VQCA 2LF7A 3QP5A 5HS9A 2LK2A 3K9TA 2X6WA 4BQOA 2VLAA 1RR7A 4EATA 3CMMA 5F64A 3M3YJ 3CCSI 4HNVA 4HZFA 1D1CA 2CQ7A 2F4OB 4BHCA 1BJZA 5HNHA 3CMAI 2GLOA 3I4PA 4BXUA 3KCCA 4PJLA 4M6YA 5E1ZB 3HOSA 4A93J 1B6AA 1A6QA 1XSVA 2QSHX 1ON2A 3HGYA 5IOZA 4U0VA 3KETA 3KX2A 4JX5A 4OMZA 1Y8RB 1V55H 3SQNA 4H0EA 2M5WA 3DBLB 2EWNA 2NS0A 1PDNC 2VXDA 2IP2A 3GX4X 1EV7A 4DYCA 3LL7A 4PGGA 5M5XJ 4U0YA 1FBSA 3HEFA 3ROUA 5FD6A 5BOXA 4A0YA 5ICEA 4X6AJ 3BG7A 3PFYA 3K2AA 1WCMJ 1Z77A 5IYCJ 1H9TA 1K7AA 4UB6C 4ZTFA 1BIAA 2V79A 1G4DA 3CD6I 4KA4A 2A6EF 1HXDA 3KYCB 4RGSA 2PI0A 5EEHA 2R5ZB 4IZZA 1S72I 2G7HA 4R1HA 3TDUC 4A3JJ 2BHYA 3KE2A 2KQRA 2LFBA 1O7LA 3HPGA 3IRRA 1WZ2A 5KHDA 4HAMA 4O6JA 3GO5A 2IS2A 4V19K 4RGXA 3FXUA 2KL4A 3FMRA 4N0BA 4BU2A 2HI3A 3GZ5A 3NARA 4XNFA 5D5UB 1BC8C 4HNTA 2DPUA 2PG4A 1ZRCA 1ZQ3P 3BPVA 5CQEA 2E5NA 3DXJF 5C4XJ 3KYDB 2YR2A 4MEXF 2LD5A 2ELHA 5J1UA 3K4CA 1VQ5I 4B8XA 3GTQJ 2RREA 3OS0A 2DDAA 5GTIC 3CCQI 2EBIA 2MLGA 2PMZN 2Y0MA 2W24A 4KIBA 4MTDA 2XB5A 4CYCB 1STZA 5FKNA 1IC8A 2FJ1A 2OA4A 4RGRA 1U5TC 5F27A 4XQFA 1YX3A 2LOOA 5DDGA 2NYXA 4ENJA 4ENKA 1LB2A 2M34A 4FX0A 3HC7A 1WSUA 2LY1A 2RGVA 4Q5SF 2Z3YA 1VI0A 3P5JA 5J6XA 1A35A 1RETA 3DFGA 5TISC 4BDZA 1XC5A 2QVOA 2R7OA 5C3EJ 1R23A 3EDPA 1R4NB 4ZYGA 4LLLA 5F0FA 2I5UA 3DPLC 4G8XA 1HLVA 2G9WA 5IYBJ 5GP9A 2ZKZA 4E70A 3HZJA 3G1LA 1P7IA 3H36A 1ODDA 2VBWA 1OYWA 2VQLA 1R49A 2LLKA 2B9SA 2KKOA 2MA3A 4PJNA 2NVXJ 2EH3A 2HVQA 2ZXWH 1WJ5A 4MNUA 4L5EA 3GTPJ 3HBLA 2PBIA 3BROA 2WAQN 4A3KJ 2M1BA 5LHHA 5AIQA 1K6OA 1YRNA 3OYFA 2XRLA 2PX9A 4HLXA 5CVVA 5CVUA 1QNTA 1H0MA 3AG4H 2HDDA 2N8GA 1VQMI 2BHZA 3ISPA 2DA5A 2CUEA 1JTXA 2E19A 1GLNA 3DPTA 3WGIA 1RPWA 1W36D 1BI1A 1S3JA 3QOPA 4A12A 2LKXA 1NG6A 1UAAA 2IAIA 4GFBA 2ID3A 2YU3A 2JTVA 3T5XA 4GDFA 2E60A 2JRMA 2K9LA 3L00A 3O8GA 1A04A 4IKFA 3RTRA 4PSWA 4QLCU 3LSPA 2BXZA 4LG0B 1W7PA 1P6RA 2J5OA 2NXNB 5HLGA 1X3ZB 1I3AA 2JK3A 4EVIA 1G3TA 3H9GA 2HQRA 1I27A 1Z91A 1E3PA 2RAEA 5KVRA 3Q0WA 3IH3A 3CC4I 2HGCA 2W00A 3V42A 1JJ6C 4MQ9F 2P5LC 3K4MA 3OIOA 1W5CC 1G3YA 2JT1A 1T0FC 4RMNA 1IN4A 3OMYA 1YHQI 4LIVA 2I10A 2X51A 2VOOA 2LVSA 2L54A 2VBXA 2WV0A 1XGMA 4BL0B 2XPUA 3OOUA 3HRUA 4KICA 3BR2A 4LG3A 5LGTA 4UUVA 3K1PA 1LNWA 5GAGJ 4Y4RA 5GPAA 1FMVA 4JX4A 1KU2A 3IHUA 4B48A 4D7NA 4XL9A 4CCJA 4ZH4F 2L02A 2RNGA 3SXYA 3WE3A 2FA5A 2HNHA 2K40A 3L2CA 2CYYA 3HXLA 2GXAA 4F55A 3ZQCA 3S15J 2O8XA 4A5MA 3V8KA 1EH6A 2HYGD 4XLCA 1X3WB 3NEUA 1UCRA 1TWHJ 3G2BA 4ESFA 1SAXA 3VSKA 4ZJZA 3GFIA 3FF5A 5L3BA 2GOXB 5HVQC 3L2QA 2FE3A 2V1DA 3A4CA 3I58A 4MFEA 4IX7A 3I4MJ 2K02A 4PDKA 4H4KC 1FOWA 1QVTA 5C4JJ 3TMOA 1XCVA 2FSWA 3FXJA 5J4YA 3TEDA 3TW6A 2DJIA 5F1JA 1H8AC 1B59A 2IS4A 3H3ZA 1IXRC 3FMQA 3C18A 5FRMA 1ETWA 3OYDA 4KNYA 2HEOA 1ACIA 2XSDC 3U9GA 2LYCA 3T8TA 3HDDA 4PJJA 3ECHA 2EILH 3OWTA 2HOEA 2OCCH 3FXLA 2XASA 1RESA 4R8HA 5LGUA 3CZ6A 1HW2A 3ML6A 5J8CA 1DPRA 5JLXA 3GLLA 1EKEA 4L9JA 4HNUA 4DZJA 1IRXA 1WJFA 3EUKL 3A2KA 5BQTA 4BHPA 1HKSA 2DMTA 4LIUA 2X6YA 4F93B 1RZ4A 2QCOA 2V1XA 4YG2F 3D1NI 2VXZA 3BR1A 5J1YA 3WTSC 3HOXJ 2XF5A 1B72B 3FX3A 2MLKA 3FKIJ 1F1ZA 3LA7A 4MEYF 3W2WA 3WU2C 2K3PA 1RIOH 5D5WB 1AKHA 3VWBA 4M3GA 3IUOA 1T39A 2GXGA 1MMSA 3J80K 1VQ7I 4WXDA 1QVUA 2ZJQF 3G1OA 4MFDA 3W6VA 2O0YA 4KFCA 2BXYA 2P6TA 3TKYA 4A3LJ 2OTJI 1QPIA 3OYKA 3CO7C 2DI3A 3QQAA 2XAJA 1WGXA 1NK3P 4XLNF 5E1XA 1S6LA 1VFCA 5FGMA 3KEOA 4HOBA 2CS3A 1AOYA 4ZDLA 2XROA 4BJ6C 4M3EA 2GQQA 1D1AA 2RKHA 1ZARA 2MBFA 1RUNA 5LRSA 1LDKB 9ANTA 4LD5A 4EM2A 1R4MB 2LH9A 3W3CA 3QYEA 1ZK8A 4DQ2A 2CFXA 2DFFA 2DT6A 5HS7A 1F4KA 2JA7J 1XX5A 1OQYA 2JZYA 3CP8A 3V7RA 3OYEA 4XKCA 4WXHA 3HKZN 2Y0SA 3UR3C 2L9SA 1T08B 4AM3A 2R92J 4EM0B 3JRCA 2M2EA 2OQGA 3WU1B 3QYFA 2KJBA 1Q1VA 4CXFA 1FP2A 1HF0A 3KEYA 4ZYDA 1MW7A 2MSYA 3KZYA 4ESBA 3W2AA 2LREA 1S7AA 2KP6A 2RC4A 3F8FA 4BBRJ 4CYCA 1Z21A 1MBFA 4AUXA 5HOOA 4HF1A 2KRCA 4DNCA 2OCEA 4DYRA 3N97A 4WF2A 4IXAA 2I8DA 2KRFA 1IGNA 3J7AY 3MWMA 4A3MJ 2BVLA 1W36C 3S17J 2MH9A 4CCMA 1R1UA 3ZMSA 4G12A 4E4HA 3K4BA 1AA7A 5FJ8J 1ETKA 1FNNA 3MQ0A 1LDJA 5ICFA 1KZHA 4BY1J 4HX7A 4IHSA 3BLYA 2COMA 2G7UA 4R79A 3H5NA 2IRFG 5CJ9A 1FSHA 3H3UA 2VT2A 2FF4A 2CRGA 4HSTA 2HFHA 3R0AA 2M4GA 2RV8A 4OU0A 1LVAA 1H9GA 1YI2I 2R7WA 2DAOA 4X1EA 3KP5A 3H5AA 1UMQA 3T0YA 1K83J 4D7MA 3F3XA 4BGDA 4A3BJ 4HF2A 4XN3A 3DWLE 2JA8J 5L3DA 3RZDJ 4U7DA 1A5JA 5IYDJ 2M4KA 4ETSA 3RKWA 1CF7A 3CP2A 2A6TA 3HIFA 2VJ4A 2H09A 2HZTA 1FOYA 1ZN2A 4E7KA 3EUHC 1KU3A 3K2ZA 2AQFA 1FIAA 3G73A 4BEHB 4BE2A 1S5LC 3GFJA 4M9ZA 2O3FA 3P9CA 4L9TA 3S2WA 4OAYA 5EJCA 4YELA 1IUYA 2QA4I 2E35A 4HV5A 4G6TB 2KJCA 2AHQA 1PP7U 4XOPA 4CCNA 2DBBA 2IJLA 5IP9J 2XKOA 2EB7A 4NC7A 1ULYA 1VQ9I 1SD5A 4WK8F 3GTGJ 4UVAA 1U78A 4B43A 1QRYA 2AO9A 2DA1A 1W0TA 3TO9A 1YW7A 3ABLH 2E1CA 3MD2A 4CUGA 3JTGA 3DLLF 4RLQA 3GXOA 2XGDA 2XAUA 3LSIA 3TOAA 2DJNA 1APLC 4Z6YA 4EJOA 3JW4A 1MSEC 2Z9OA 3A0HC 1R00A 2K85A 2RNJA 4LB5A 4G94A 4KIFA 1VQ8I 2PFBA 1QBJA 4BQAA 3V7SA 1IN7A 2D1HA 3D0SA 2MGQA 2Q1ZB 4I99C 5M3FJ 2EFOA 3C1DA 4GYIA 3ONQA 4PJ0C 3WTVC 2M30A 1JGSA 1AHDP 3QPHA 1SFXA 3DV8A 1DQUA 1FC3A 3S32A 2P0WA 2HQAA 1F9NA 3CCJI 1UHMA 4XLEA 3U2RA 1W7PB 5A2QZ 3CC2I 4KT5C 3A1YA 1R7JA 1MZBA 3F8BA 4IL6C 4BH9A 4XSZF 4WCGA 4I09A 4DZPA 2EJRA 2HXIA 2P6SA 4NQWB 2A05A 1HOMA 1R1TA 1QO0D 4XLAA 2V26A 5FO5A 2ADUA 4E6KG 2H27A 3G4SI 2M9HA 2NVYJ 3BY6A 3M07A 4YEJA 3QWLA 4NUBA 2ID6A 1ZLJA 4UHTA 5K5QA 2MG4A 2IPQX 2X6OA 2X6XA 1FWZA 3ZXSA 1RUOA 2HYJA 1ETYA 3BP8A 1ZKGA 3RIRA 2MC4A 4IRHA 4OINF 3MKLA 2KIUA 1JTYA 3AKZA 2X1CA 1TT5B 2DDBA 5DS9A 1TL8A 4LB6B 1T95A 1ZREA 1DDNA 3AG3H 4G7OF 1XMKA 3FM3A 2OAZA 2ESHA 3DKYA 3IV5A 1Y1VJ 2EV5A 3R6SA 3K6GA 1TBXA 1JKRC 3P9IA 2KDOA 3AL0C 1X1PA 1S29A 3ZCOA 3EQLF 2CUZA 2VC1A 3BG3A 4JQFA 1IG7A 4U0WA 2BY1A 3ZQHA 2ACJA 1WFXA 3OY9A 2P7CB 5E8IA 4HPQA 2VB6A 1V5EA 2LDUA 3T8RA 3O2PE 3K0LA 3MKZA 1LFBA 5A2QK 3CJNA 1NTCA 4LOCA 1GDTA 1Z7LA 2WAFA 2WB1A 1B1BA 2DPDA 1MKMA 2XGCA 3HJEA 3ZQQA 1RKTA 3FKJA 3HHHA 2FXAA 4MQVA 4I76A 4MTEA 1MMGA 3K4LA 1ZYRF 1IV8A 2KHMA 3LSKA 3VEPA 2DMUA 3J81Z 2EZHA 3S2DJ 3RI4A 2F5DA 3BT9A 3FXMA 5LFAA 2M0CA 4RAFA 3U1KA 3LSJA 4M74A 3ZRGA 5H20A 2CQNA 4LITA 3AFHA 4L18B 5LHGA 3WODF 1S9HA 6PAXA 1SFUA 3AL0B 5GAHJ 3H0DA 1WQ2A 1XG1A 4Q4ZF 1FT9A 3HB9A 2VBZA 3FBIB 5CVRA 3A03A 2IS1A 3RDIA 2R7UA 5IY5H 4BJTA 1AKHB 3TP0A 1FOKA 2DA3A 2KIMA 2L7FP 3M8EA 3J7AO 3FISA 2P81A 3HOVJ 4IJAA 2OF7A 3S93A 2GWRA 4XRSA 2O61A 3MMYB 3CCUI 2DYRH 5J40A 1RI7A 3DKXA 2W48A 2UUZA 3E0JB 2V1NA 4FTHA 2Y2ZA 4C2MJ 1I3QJ 2HVSA 2GA2A 1J75A 2GIVA 1IXCA 2VOPA 1TQIA 2WADA 2STTA 4B3AA 4XLPF 3SZPA 1GUUA 2HWVA 3CF2A 3TO7A 4IRGA 4C2TA 1TW3A 4DJAA 3MAJA 4V2GA 3PQJA 3QU3A 5IT9Z 1MH3A 5BPIA 4YRVA 4J00A 1WH7A 3BR3A 3RQIA 5FRNA 1GVJA 3R61A 3S1QJ 3JSOA 2QSGX 3RYPA 1UHSA 1R71A 5E3LA 2TCTA 1REPC 2A3SA 5JVGF 5D8KB 2W84A 4UXNA 3S3NA 1XGSA 2H1KA 3LA2A 3R60A 1ETXA 1K79A 3IAM2 4Q48A 3LFKA 3SYTA 2P4WA 4I01A 1XD7A 3J81K 3GTOJ 3GLXA 2L9NA 4HQEA 2PJRA 3LWFA 1BI3A 4EQQA 2HDWA 1ZG3A 1S7EA 5FLXZ 2IS6A 2HOAA 2JUGA 4V2FA 1LE8A 4JX6A 1IF1A 4A3IJ 3WTUC 1R9TJ 2VJIA 2R0QC 3OYNA 1YS6A 2QZ8A 3CUOA 1FIPA 1LFUP 1XDUA 1YJNI 4NC6A 3WTXC 2A5YB 4W97A 1W5SA 3FK7A 4XLHA 1OFCX 2DQRA 4BEHA 1UFMA 1ORKA 2LNBA 2NS7A 1EH7A 2QBYB 1J7KA 4WXCA 5DV5A 5EZHA 2X85A 1JKQC 3C3WA 1YIJI 1I50J 2CV0A 3OV8A 2ELJA 1MD0A 4XICA 1USTA 4KYWA 4XRFA 4S05A 1PYVA 5ILSA 5DTDA 1SFEA 2BGCA 2R7QA 4I2OA 4AC0A 4IHVA 3BOQA 3ZR8X 5HS8A 3GTJJ 1ZGJA 4ZC3A 2BYVE 2HR3A 5KCMA 3G71I 3VB2A 3W6JB 1FPQA 4CZCA 2JN6A 4RB3C 3QODA 1ZR2A 1X1CA 2H1LA 2COBA 1CF7B 1SVOA 3E6MA 2YPRA 2OBPA 1R36A 1TTYA 5D8LB 2FBHA 2O5RA 2HOSA 1T6SA 1WKMA 2QEXI 1YX5A 2R7FA 3HSRA 2KT0A 3L2WA 2QQ9A 3DTEA 2XSJC 2BV6A 5DUIA 2WTEA 3I55I 3BCBA 4N9HA 1VQKI 4RAYA 3S3MA 4HX8A 1IW7F 3U1DA 4L9NA 2EZIA 2W1OA 5L3CA 2A07F 3OR2C 3ZGKA 1WVRA 2WWYA 4L9VA 5D6FA 5IP6A 1U0JA 3TOBA 4EEFG 3K70C 4EMSA 3IRQA 3GFLA 4EGZA 2L7ZA 1JGGA 2H94A 1R22A 1X3UA 2DFHA 2WY8Q 3JRBA 2LY2A 1DUXC 4HBLA 3WG7H 5LHIA 5D5VB 1FY7A 4NQWA 3ASNH 1YFHA 2ETHA 3BWGA 4O3MA 1POGA 2EFPA 4D9JA 3MZ8A 1LEAA 1YS7A 2PMHA 3CDIA 1SFKA 2Y48A 2ZSHB 3H9QA 3BZ6A 5LEJA 3U21A 4DBRA 3H1CA 2GOMA 4MLOA 4RB1A 2M7AA 1FYMA 1X1AA 2DTRA 4RM2A 2ZO4A 2CW7A 5FKOA 3PIOF 4NDLA 1TWFJ 2OC6A 1W7PD 4ZYEA 2Y0SN 4XMYA 2NOGA 2BE5F 1OMIA 3QRFF 3IKTA 5FLMJ 3Q9SA 3UNGC 2OPTA 3ASOH 3BTJA 2A5WA 3HG9A 2F6CA 3B02A 5KNLA 1SD4A 2D2WA 2R5YA 3KP3A 1XPXA 1R5GA 4KMFA 4M6VA 3OYCA 1KA8A 4IHWA 2VJ5A 3I5UA 1YLFA 1JI8A 2PEXA 4YFNF 2CUJA 1ZG1A 3JR9A 1Z6RA 2KIFA 4XKVA 2X48A 3MKYB 4ZDOA 4GO1A 4XKBA 5M5YJ 2ZCWA 2DA2A 4RA2A 2R7RA 4Y52J 5JHFA 4IHXA 4IOCF 3CC7I 2ZXHA 5DUKA 1SMYF 1FX7A 3PM1A 2Q8KA 3OYAA 1ZLKA 3SFIA 2DFEA 2QQAA 3EPZA 3A01B 1M1EB 3MKWB 3OL4A 4X0GA 4E7HA 2YUSA 3ULQB 3EETA 1DU0A 3I9V2 1A6IA 3WGGA 1VQ6I 3ZN1A 1LQ1A 1YO5C 3E6DA 4CSWA 2W57A 2Z5UA 1D5YA 1XGOA 3PNTA 1N78A 2UXNA 1X58A 2L9VA 3PSFA 1J0RA 3C2BA 2A68F 2EV6A 2MC3A 1ZELA 1JUMA 1WJBA 1TT0A 3V8JA 4FE7A 3V4GA 3HOZJ 4C9YA 4RGUA 3OSGA 3OIQA 3E6BA 3HSEA 3O6BB 3M8FA 5AONA 3HRSA 4CH7A 3RKQA 3BQZA 3L9FA 5E20A 4DYQA 2AXLA 1V3FA 2LC2A 1P2FA 4A3EJ 3JREA 3GMEA 4CHUA 4CDGA 5GAEJ 4CGZA 3CDHA 3OL3A 3KPHA 2HQNA 4WX9A 4CCOA 3CCVI 3LAJA 1BR1A 4G6DA 3E5XA 2F5FA 1MMDA 1MMNA 3CJRB 1YG2A 1OCOH 5CVIA 2MD5A 3QP6A 1OLTA 2DCEA 4FHTA 1K61A 3LOCA 3M8JA 4GGGA 4I0BA 4OWRB 4XM3A 3TBIA 2FQ3A 2DOEA 3G3ZA 1P4WA 2DFIA 4AU7A 4GXOA 2JUCA 1OJLA 3FZVA 1HKQA 1IDZA 2AXTC 3LSTA 3KFWX 4P55A 3M9AA 2DK8A 1WI9A 3DBRB 3PO2J 3HGGA 3OOPA 1SD6A 3F6VA 1QHGA 3C2GA 4KN4X 4BE0A 4OIOF 1ZH5A 4FETA 1H88C 2IGKA 2M3AA 4MHGA 2FEZA 2HS5A 3I64A 4CCKA 3IL2A 2L3DA 2LTPA 5GPCA 3VSLA 2DMQA 3GYHX 1W0UA 2JVGA 2R7XA 2XC7A 5BPDA 1O3SA 1X1DA 2XKPA 5K1YA 2FBKA 4II3A 3CMEI 1SAUA 4RS8A 4QTRA 4M9XA 1E17A 2IXSA 2F5CA 3CUQB 2OQRA 3EUAA 1BIBA 1U3EM 1GXQA 3ELKA 2JPCA 1B9MA 5DD4A 5JVTA 1UZCA 3EYYA 5DCMA 1FOXA 2EZKA 3GTKJ 1W1WE 1MBGA 3KZZA 2F5EA 4EV0A 1V5GA 5BMZA 4UUTA 4XLFA 2VKDA 1IN5A 2ICWG 3CJQB 2BW3B 1JUSA 4M6XA 3TGNA 1HW5A 4YIIA 4BJ5C 4QPOA 3I4NJ 3T1BA 3M1EA 2STWA 4XONA 1JKOC 2XVCA 5F08A 2VKHA 2VJJA 2DA4A 4HF0A 4IOAF 4NNJA 3ZMVA 5E3NA 2XIGA 4ITVA 3QPLA 3DF8A 3ZP5A 4Y7NJ 4LJZF 2QBYA 4KT6A 3H5RA 4M3BA 2CG4A 3NWTA 3Q9VA 1FBUA 5CQGA 5L3GA 3WTYC 5HLTA 3K4NA 2E2HJ 4UV8A 2V6EA 4JOMA 2QUFA 3JRIA 1MIJA 2V1UA 3E5QA 3GTMJ 3J7YJ 2CFOA 1YJ9I 1ZRDA 1DPUA 2QENA 2BY0A 3PUBA 2Y9ZA 3FDYA 3V8LA 2EA4A 3FBNB 1MBKA 4BUPA 2MH2A 2V9VA 3FHNA 3VYSB 2R4GA 2PJRB 3ZPLA 1JHHA 2K27A 2V6CA 1PUFA 3HUGB 2Z1DA 1IRZA 2OV7A 4QIWN 1RNLA 5JHUA 1OPCA 1LE8B 2VODA 1W5TA 3VFZA 3KP4A 1MDMA 1FYKA 2KRHA 5F0HA 4Y3OA 1U9NA 3DEUA 1SFOJ 2WC2A 2MYSA 3P7NA 2X4HA 1TP4A 2J5PA
chains in the Genus database with same CATH topology
3MKZA 1YE9A 3LSGA 2CH0A 1NG7A 2HZDA 3PNVA 1Z7LA 2WAFA 2WB1A 3DTKA 2WAQA 2VQLA 2VL8A 1LVKA 4PJNA 3ZQQA 1BOBA 3FKJA 2HVQA 1WJ5A 3L2UA 1MMGA 3K4LA 3S8PA 4HEA2 2KHMA 3LSKA 4OAZA 3OYFA 1Y6IA 1DGRM 1FMWA 5LFAA 3SEZA 3ZRGA 3QYBA 4LITA 3AFHA 2L5QA 1GLNA 3DPTA 1W36D 1E0EA 1S9HA 1D0XA 2CMPA 3AL0B 3PJRA 1NG6A 1UAAA 2Q2EB 3H0DA 4DOZA 2E60A 2K9LA 1OR7C 3FBIB 3VDXA 2IS1A 2R7UA 4IKFA 3RTRA 1D1BA 4PSWA 4N4OB 4BJTA 3H9GA 2E5ZA 3S93A 3MMYB 2V9KA 3DKXA 4PUSA 2UUZA 3E0JB 2V1NA 2W00A 2BVMA 3V42A 2HVSA 3K4MA 2VIXA 1T0FC 4RMNA 3OMYA 4LIVA 2WADA 2X51A 1X4PA 3CF2A 4C2TA 4BL0B 4DJAA 1UELB 1R6RA 3OOUA 3N05A 4F52A 4YRVA 4J00A 4LG3A 5FRNA 3K10A 3PL8A 4Y4RA 1FMVA 3H35A 4B48A 4XL9A 4CCJA 2Z2SB 2RNGA 4B47A 2HNHA 2E1MC 2LBFB 3HXLA 3S3NA 4F55A 1Y56A 2KPMA 3IAM2 3SYTA 4XLCA 1K6YA 2WAEA 2R7TA 4QPQA 2L9NA 2PJRA 1WJCA 3G2BA 1LFPA 4PSXA 4Y33A 2HDWA 4II2A 2LRDA 2ZXIA 3VSKA 4ZJZA 4ZTJA 2Z16A 2GOXB 5HVQC 3L2QA 2IS6A 2JUGA 3A4CA 4IX7A 3LSMA 4RLFA 2W82A 4B44A 4H4KC 3RCOA 3D5SC 3TMOA 2VJIA 3OYNA 1G59A 1LKXA 2CV1A 2X1EA 1J09A 2JSPA 4XLHA 3C2HA 4E7ZA 4BEHA 2DJIA 4D1QA 1P9QC 2IS4A 4DGWB 3NWSA 5FRMA 3TL4X 5CKTA 4BXFA 3OYDA 2R7VA 2X85A 4U7BA 4E7SA 1X19A 2LYCA 1X1BA 3E1SA 4PJJA 2CV0A 2ELJA 3OWTA 1PJRA 2F4IA 4KITB 3CZ6A 2M7BA 4NC8A 4J01A 2HU9A 2QKMB 1PYVA 3IP4B 1MMAA 3K4JA 1KONA 1QHHD 4HNUA 2JA2A 2E1MB 3OYIA 3OYLA 2R7QA 1IRXA 1WJFA 2CW8A 3EUKL 4IQ4A 3ZR8X 3A2KA 3GBGA 4ZC3A 1X4OA 4F92B 5KCMA 4LIUA 2X6YA 3DEEA 4F93B 3OR1C 4CZCA 1UG0A 4XORA 3QODA 4AVZA 1X1CA 2VXZA 1DGWY 4ZYAA 3OS1A 2WA0A 2XF5A 2HVRA 3W2WA 3F9KA 3LFUA 2O5RA 2K3PA 5LD2C 1YX5A 2IGMA 3VWBA 3OYGA 3L2WA 3DTEA 4CA0A 2XSJC 2M0MA 4B3XA 3IUOA 2R7SA 3BCBA 3S3MA 1BR2A 2KZVA 1MNDA 4P1WA 3H9JA 4E7JA 2W1OA 4DIQA 3OR2C 3W2VA 3ZGKA 1QU3A 1WJAA 1U0JA 2VQHA 2IGOA 3OYKA 2CV2A 3K70C 4XOTA 3HPHA 1ERDA 4BACA 2V4JC 3SDBA 4RM3A 3OS2A 2WY8Q 2CS3A 2LY2A 4ZDLA 4BJ6C 3DTIA 1D1AA 4CCLA 3DQVC 1VZ0A 2BW3A 2OUMA 1LDKB 1DP3A 4BDYA 2LH9A 3HKZA 3W3CA 3QYEA 4D9JA 5CPRB 1D0ZA 2DT6A 2QKLB 3RQ4A 2VPLA 3CP8A 1SFKA 3OYEA 4E7LA 4XKCA 2ZSHB 3S3OA 3H9QA 2Y0SA 3UR3C 2L9SA 2VQGA 2ZSIB 3U21A 4DBRA 2GOMA 4MLOA 3IAS2 2M7AA 1X1AA 4RM2A 3BCAA 2WY7Q 3QYFA 2CW7A 2OC6A 2MFZA 3KEYA 2HPMA 4XMYA 3VYTB 1MW7A 2DXIA 3W2AA 2LREA 2KP6A 1Z21A 5HOOA 2KRCA 3UNGC 4PFOA 3BC8A 4N4NB 2I8DA 4PJMA 2A5WA 3HG9A 2F6CA 5KNLA 3J7AY 2L2OA 2XF6A 2AQEA 5HNFA 2BOLA 2BVLA 3PNYA 2NOJB 1W36C 2XF7A 3OYCA 3HOTA 2MABA 4CCMA 2IGNA 2RQQA 2VJ5A 4E4HA 1JI8A 3K4BA 2CUJA 1AA7A 4XKVA 3L2VA 4C2UA 3MKYB 4ZDOA 2HPIA 4XKBA 3BLYA 2R7RA 4R79A 3H5NA 5JHFA 2W7NA 3KYLA 4HSTA 3RPUD 2ZXHA 3LSHA 2M4GA 4U87A 3OYAA 4AYBA 3DPUA 3OYJA 3EPZA 4C30A 2R7WA 3K70D 3H5AA 3MKWB 3BG6A 3OL4A 2FUG2 4X0GA 4E7HA 2K5CA 2ZFUA 4BGDA 1BR4A 4HSRA 1V5FA 4XN3A 3DWLE 3I9V2 4GRIA 1N77A 2UV1A 4ZDPA 2M4KA 1MNEA 4CSWA 3LMMA 3PSIA 3CP2A 2A6TA 2VJ4A 3PNTA 4BQNA 2DOAA 2W4SA 1N78A 4F3QA 4E7KA 3EUHC 3OIPA 1HA8A 3PSFA 2AQFA 1ZELA 1WJBA 1TT0A 4BEHB 4C9YA 4BE2A 3OIQA 2LG4A 4PFPA 3CESA 3L2RA 4CH7A 4FASD 4OAYA 3VYRB 4YELA 4E7IA 2LC2A 4G6TB 3K4KA 1WJDA 3OL3A 4XOPA 4CCNA 3D5LA 3M1CA 5TGTA 4CCOA 4NC7A 1BR1A 4P5OA 2K9MA 1MMDA 1MMNA 4B43A 3HL2A 3CJRB 2V7FA 1Z3XA 2F5VA 1WJEA 3MD2A 4CUGA 1OLTA 2DCEA 2L7KA 4RLQA 2UWMA 2XAUA 3LSIA 3I3LA 3M8JA 4OWRB 2MD0A 2DT7B 2X1DA 4XM3A 3TBIA 4BE1A 3DU5A 4AU7A 2VQCA 4F91B 2X6WA 4BQOA 2VLAA 4EATA 3CMMA 1QHGA 3C2GA 4BE0A 1D1CA 4FETA 2IGKA 2M3AA 2Q1ZB 4IQJA 3OYHA 4CCKA 5HNHA 4KISA 3VSLA 4PJLA 1EA3A 3ONQA 2JVGA 3HOSA 2XC7A 2R7XA 2LBFA 1X1DA 4DBQA 4II3A 1DQUA 3KX2A 1SAUA 3SEQA 3S32A 2P0WA 2HQAA 1G8XA 4XLEA 2VXDA 2IXSA 3A1YA 3EUAA 4XKWA 3DLAA 1TZLA 3LL7A 4PK4A 3BG7A 3PFYA 3OYMA 4ZTFA 4XR6A 1V5GA 4XLFA 2VKDA 4NQWB 3CJQB 2BW3B 4IZZA 4XLAA 2V26A 4BJ5C 2KLOA 4QPOA 4E6KG 3RSNA 2KQRA 3HPGA 4XONA 2VKHA 2VJJA 4YEJA 5KHDA 4NUBA 4NNJA 2IS2A 4ITVA 2KL4A 4BU2A 2X6XA 2JVHA 1D0YA 4XN0A 4KT6A 4HRIA 4XNFA 3H5RA 3ZXSA 4HNTA 3NWTA 5CQGA 3DU6A 5HLTA 3K4NA 2MC4A 5CQEA 2E5NA 2XDVA 3D5RC 2V6EA 4JOMA 2PMZA 4ANJA 4BQQA 4HG2A 4BS9A 3AKZA 2X1CA 3K4CA 2CFOA 1N75A 2RREA 1T95A 3OS0A 3PUBA 3FDYA 3FBNB 4BUPA 3VYUB 3DKYA 4XQFA 3FHNA 3VYSB 2R4GA 2PJRB 3K6GA 1YX3A 2LOOA 2WBMA 2KDOA 5FROA 3AL0C 3HC7A 3HUGB 2Z1DA 2OV7A 3ZCOA 2CUZA 2LY1A 4JQFA 1WFXA 3OY9A 4BDZA 2R7OA 2KMUA 4HPQA 2VASA 2KRHA 4Y3OA 4KJZA 2VB6A 1V5EA 2MYSA 3SZGA 3OYBA 3DPLC 3QOEA 1Z3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MW7 A;  1E0E A;  1WJF A;  3HPG A;  3HPH A;  1WJB A;  1K6Y A;  3F9K A;  1KON A;  4F3Q A;  1WJA A;  1WJE A;  1WJD A;  1WJC A;  1LFP A; 
#chains in the Genus database with same CATH topology
 3I0T A;  1LUJ B;  5D4S A;  5J8F A;  4OMY A;  3Q3S A;  1NG7 A;  1MJB A;  3L1P A;  2HZD A;  2ZB9 A;  3PNV A;  3MEX A;  3LAP A;  3DTK A;  1J2X A;  1N25 A;  2JA6 J;  1LVK A;  2E34 A;  4CO8 A;  4XID A;  3FM5 A;  1BOB A;  1D8J A;  2H6B A;  4J01 A;  2EIK H;  3S16 J;  4EJT A;  3F6O A;  3S8P A;  2WB1 N;  1U5T A;  4BHB A;  3IH2 A;  4OAZ A;  1T8I A;  2ZXJ A;  1DGR M;  1FMW A;  1K78 A;  1V54 H;  4CYD A;  4P96 A;  1OIS A;  1XMX A;  1USS A;  2FOW A;  3M4O J;  3E5U A;  4FCY A;  3SEZ A;  3F23 A;  5FKM A;  2K4B A;  5E18 F;  3CJT B;  2KIS A;  1E0E A;  3KP7 A;  3OSF A;  2CMP A;  3PJR A;  3TDZ C;  4DOZ A;  2P7V B;  1CGP A;  3K1M A;  3N4M A;  1HW1 A;  2K86 A;  5E1W A;  3KLN A;  1KQ8 A;  2H8W A;  1VQN I;  2CGP A;  3AG2 H;  3SFZ A;  4AIJ A;  1KU7 A;  2WV1 A;  1VQ4 I;  1Q1H A;  4RAZ A;  4HV6 A;  3VOE A;  2A69 F;  3IH4 A;  3JCU C;  4IVN A;  4MIM A;  2E5Z A;  1W4M A;  5EGO A;  2TRT A;  4IPA A;  1TWC J;  4PUS A;  4JK1 X;  3H0G J;  2E1O A;  2NVQ J;  1XTA A;  4BYY A;  3ABK H;  3GEZ A;  4FT8 A;  3COA C;  1PP8 F;  1BW5 A;  5M3M J;  3FXO A;  2OZ6 A;  3JRF A;  1X4P A;  1IDY A;  3WHB A;  1XSX A;  1UEL B;  2CO5 A;  1R6R A;  3MVP A;  3N05 A;  4F52 A;  2ZME B;  3BZK A;  1PUE E;  5CVJ A;  4GYG A;  1ETO A;  4U88 A;  3H35 A;  4JYK A;  2FX0 A;  2Y75 A;  2JRT A;  3WTZ A;  3X2Q H;  3CCM I;  2NS8 A;  4IO9 F;  2JMW A;  4ON0 A;  4B47 A;  1YTY A;  4P9F A;  1G3S A;  3DP7 A;  2E1M C;  2LBF B;  4PZJ A;  2GBY A;  2R7Z J;  1HDD C;  3GZN B;  5B3S H;  2OTL I;  3A01 A;  1Y56 A;  1XCB A;  1XMA A;  2F4M B;  1LDD A;  3RPQ A;  1JXS A;  2WAE A;  1SAN A;  5FD5 A;  4B1R A;  1LFP A;  3WGH A;  1BI0 A;  2LRD A;  2ZXI A;  2ZNZ A;  2Z16 A;  2QM3 A;  3F0C A;  4XRS G;  2HXO A;  2VC0 A;  2IEK A;  3NRV A;  3G6E I;  1C0W A;  4RLF A;  2IT0 A;  4B4C A;  2VBY A;  1PVE A;  2XB0 X;  3ZMZ A;  1H89 C;  3RCO A;  1R5I D;  3D5S C;  2B0L A;  4LK1 F;  4G9Y A;  5DD8 A;  4M72 A;  4A3D J;  3IWZ A;  2CV1 A;  1J09 A;  1TWG J;  2LSO A;  1AU7 A;  4B09 A;  4FX4 A;  3C2H A;  2R5Y B;  3ECO A;  3I71 A;  2ZJP F;  4D1Q A;  1SVL A;  2X0L A;  1BBY A;  4UY8 I;  2A61 A;  2ISY A;  4C3I J;  4DGW B;  1WRJ A;  2LMD A;  2RVC A;  3TL4 X;  4BXF A;  2DT5 A;  4HW0 A;  1ZGW A;  5B1B H;  3HRM A;  4U7B A;  4E7S A;  1X19 A;  1VQP I;  4A0Z A;  4AWX B;  3B6A A;  2LKS A;  5EDN A;  2F4I A;  3HOU J;  4KIT B;  4A5N A;  2DN0 A;  4NC8 A;  3ZQG A;  2GIZ A;  2W85 A;  3V7C A;  5HOD A;  2HU9 A;  2HTS A;  2QKM B;  3IP4 B;  5F1R A;  1MMA A;  3K4J A;  1Y0U A;  3ZQL A;  1KON A;  3FIW A;  1QHH D;  2CSO A;  2E1M B;  3F21 A;  1WWX A;  3FXQ A;  4LMY A;  1MBH A;  3REO A;  3GBG A;  1Z7U A;  3MZY A;  5DCF A;  4F92 B;  4HQM A;  2E7X A;  1EJ9 A;  1TC3 C;  3DEE A;  4D5C A;  2Y31 A;  1UG0 A;  4OIR F;  2KZG A;  4I98 B;  1Z3Y A;  4AVZ A;  2Q2E A;  2O9L A;  4BNC A;  2D5V A;  1DGW Y;  3ABM H;  3WTW C;  3LQQ A;  4HX4 A;  2K9S A;  2WA0 A;  3UKG A;  2ZC2 A;  3F9K A;  4F7Z A;  2E36 A;  2VI6 A;  1IV6 A;  1T33 A;  4RAG A;  4ZZL A;  2IGM A;  2YU9 J;  2DU9 A;  4UVC A;  3A0B C;  4EJU A;  4B3X A;  3M7G A;  3TQN A;  1BR2 A;  2DLL A;  2KZV A;  4N9I A;  4YFK F;  1MND A;  1YIO A;  4P1W A;  4E7J A;  4LLG F;  4DIQ A;  2KFD A;  1ZGA A;  3S2H J;  3I53 A;  1WJA A;  2XGX A;  3LNQ A;  2VQH A;  3CUQ A;  2CV2 A;  3QU6 A;  2ISZ A;  2DMN A;  2K7L A;  4XOT A;  2FOK A;  5K5R A;  2VKE A;  1GT0 C;  2QGU A;  2YX4 A;  3HPH A;  1FZP B;  3FMS A;  2LY9 A;  3MCZ A;  5ILV A;  3SDB A;  3ZMD A;  3JSP A;  3RKY A;  4RM3 A;  3JRG A;  1T38 A;  1O3R A;  3DCF A;  1B9N A;  3DTI A;  1YYV A;  2BW3 A;  2OUM A;  3BDD A;  4OOI A;  2ME0 A;  1DP3 A;  2NAZ A;  3WHC A;  3O3K A;  3Q5F A;  4BDY A;  2A6H F;  4C3J J;  5CPR B;  2IBD A;  1D0Z A;  3CMY A;  1P7J A;  4KDP A;  3LSR A;  3K69 A;  1ETQ A;  3RZO J;  4HLY A;  5BNG A;  2H8R A;  3HRT A;  3S3O A;  2JPB A;  1IRF A;  1GHC A;  4S0H B;  2VQG A;  5EEA A;  2DO7 A;  2PLY A;  1IXS B;  4I02 A;  1OR7 A;  3IAS 2;  2W25 A;  4GCV A;  5K7Z A;  3MZH A;  2WY7 Q;  1GVD A;  3I59 A;  1OCP A;  2K9N A;  2MFZ A;  3QPS A;  2QSF X;  1OYI A;  2MW8 A;  4AIK A;  1FTZ A;  2EA2 A;  1Z9C A;  1RC9 A;  5B5E C;  2RDP A;  4A6D A;  5IOY A;  2LR8 A;  4N4N B;  3JRH A;  4QSH A;  3HUG A;  5DCM B;  3L7W A;  4YIF A;  2FRH A;  2AQE A;  2XF6 A;  2BOL A;  3BR6 A;  3PNY A;  4Y13 A;  2NOJ B;  2RQP A;  2ECB A;  2XF7 A;  5ERI A;  3HOT A;  2MAB A;  2BBY A;  5M5W J;  2IGN A;  1O4X A;  2RQQ A;  2EIN H;  4BAY A;  4LK0 F;  5FFZ A;  5LRR A;  1IRG A;  2L9R A;  4C2U A;  3BQY A;  2Y69 H;  5KAI C;  2W7N A;  3KYL A;  1NHA A;  1BJA A;  1Z0X A;  4MGR A;  1YIT I;  1HBX G;  3G1M A;  4AYB A;  3BR5 A;  2P5K A;  3DPU A;  4A3C J;  1FJL A;  1U8R A;  1I1S A;  4K2E A;  4UVB A;  1ZR4 A;  1J5Y A;  1GV2 A;  3CDL A;  3GUD A;  1YW8 A;  2FUG 2;  4KN7 X;  5D6E A;  2JSC A;  2K5C A;  2ZFU A;  3ERM A;  4XSX F;  5E79 C;  4BBS J;  1BR4 A;  4HSR A;  1MBE A;  1V5F A;  2OZU A;  4Y15 A;  2NNN A;  4GRI A;  3GTL J;  3GZ6 A;  2UV1 A;  2D45 A;  1MJ9 A;  3C7J A;  4RB2 C;  1BC7 C;  1MNE A;  3MN2 A;  3ERE D;  3LMM A;  1VTN C;  3I56 I;  1OCC H;  2DQL A;  3IKV A;  4F3Q A;  3BG9 A;  2K9Q A;  5IT9 K;  1HA8 A;  2HKX A;  5IT3 A;  5ILU A;  4EJV A;  4JP0 A;  3CLQ A;  5K5O A;  5F6F A;  1PUF B;  2XAQ A;  1T56 A;  4OIP F;  4AIH A;  1ON1 A;  3CES A;  1R1V A;  3L2R A;  2EIM H;  2VE8 A;  2CQK A;  1KQ0 A;  3VYR B;  1MDM B;  4E7I A;  1IAW A;  5E3O A;  2BY3 A;  4IHY A;  3ZQF A;  3FXK A;  4A0X A;  5K7H A;  1JT0 A;  5EZG A;  1WJD A;  2HTJ A;  5H6R A;  4EJW A;  2H6C A;  3M1C A;  5TGT A;  1HKT A;  3F8M A;  2CJJ A;  4CIC A;  1YJW I;  2FMY A;  4P5O A;  4I6Z A;  2K9M A;  4M9S A;  1Z6T A;  5FLX K;  1JUP A;  1Z3X A;  1T2K A;  1VQO I;  1GXP A;  3WU0 A;  1WJE A;  2F5V A;  3BTI A;  4D0P A;  2GM4 A;  2O8K A;  2UWM A;  2X9D A;  3I3L A;  1EH8 A;  1SD7 A;  2M87 A;  2DT7 B;  1U5T B;  1KYW A;  5DM6 F;  5E17 F;  2KDZ A;  3DU5 A;  3EUH A;  1D3Y A;  2XV4 S;  5JFR A;  1K78 B;  2EV0 A;  4F91 B;  5HDK A;  1EF4 A;  2VPR A;  3BG5 A;  4A6E A;  2ZJ2 A;  1RRJ A;  2ZME A;  4G7Z F;  3S14 J;  3AAF A;  3KIO A;  3PFI A;  4C3H J;  4UUS A;  5GAD J;  2CWE A;  4IQJ A;  3OYH A;  1U8B A;  1UB9 A;  2M45 A;  4KIS A;  2L4M A;  1EA3 A;  1RR8 C;  4KUM A;  1G2H A;  2LBF A;  2O7O A;  3PQK A;  3GF2 A;  1JKP C;  1G3W A;  4DBQ A;  5ED4 A;  5GTH C;  3HOW J;  3SEQ A;  1XDS A;  4ZZD A;  3BJO A;  1ZG5 A;  1G8X A;  1X2M A;  1HC8 A;  1HCR A;  4XKW A;  3DLA A;  1ZTR A;  1TZL A;  3HOY J;  1P4X A;  3RJP A;  3JRD A;  3CCE I;  4FE4 A;  3AG1 H;  1FBQ A;  3F72 A;  4PK4 A;  3S1R J;  2CQQ A;  5FFX A;  3OYM A;  5EGO B;  1B8I A;  5B66 C;  1TQP A;  2OJE D;  4XR6 A;  2Y30 A;  3S1M J;  1ITY A;  2KLO A;  2Q0O A;  3CCL I;  3RSN A;  2EZL A;  2DYS H;  5HDN A;  2VON A;  1VF9 A;  4RDU A;  1SEU A;  3TP3 A;  3HM5 A;  3FWE A;  3F22 A;  3B6C A;  3E7L A;  2JVH A;  1D0Y A;  4XN0 A;  1LJ9 A;  2GAU A;  5F04 A;  4HRI A;  5F0C A;  3LA3 A;  3ESW B;  2HDC A;  3DU6 A;  4BKX A;  4YFX F;  2QF7 A;  2XDV A;  4LLN A;  3D5R C;  2PMZ A;  4ANJ A;  3J80 Z;  4BQQ A;  2F2E A;  4HG2 A;  1Y0N A;  4L5J A;  4BS9 A;  3W6K B;  1IN6 A;  1N75 A;  3R4K A;  4UB8 C;  2L4A A;  4Q47 A;  1MNM C;  3VYU B;  4BXX J;  1FEX A;  1I6H J;  1J9I A;  2PQ8 A;  2WBM A;  2NRA C;  1YOV B;  3WG9 A;  1XS9 A;  5FRO A;  1O57 A;  4KMU X;  3GCM A;  1HDP A;  5FKK A;  2C6Y A;  2QWW A;  1MJA A;  3R0J A;  2B63 J;  4EM1 A;  5J47 A;  2DMP A;  2KMU A;  4JBA A;  2VAS A;  1I5Z A;  4M3D A;  4NBQ A;  3EYI A;  5BS6 A;  4KJZ A;  1UG2 A;  2JQ7 A;  3SZG A;  3OYB A;  3PO3 J;  3QOE A;  3SJM A;  2EFN A;  5LEK A;  4ASN A;  1YE9 A;  3LSG A;  3CLO A;  2CH0 A;  2IA1 A;  2RN7 A;  2R3S A;  4KIG A;  3IWF A;  2WAQ A;  2DA7 A;  2GA1 A;  3CCR I;  2VL8 A;  3CUQ C;  2XRN A;  1MBJ A;  1XB4 A;  3KEQ A;  5EF6 A;  2XAG A;  4Y17 A;  5IPA A;  2DOF A;  1R5H A;  2IA2 A;  4NHJ A;  5HLI A;  4XBF A;  2LP0 A;  3L2U A;  3VPR A;  4LFU A;  4HEA 2;  2Z99 A;  5CLS A;  4XRM A;  1HQC A;  4BY7 J;  1Y6I A;  2E2I J;  1BA5 A;  2O03 A;  3KLO A;  2K4J A;  1IN8 A;  2P5V A;  2V9P A;  3I54 A;  4L0Y B;  2JJ7 A;  3QYB A;  2L5Q A;  1A36 A;  2XUB A;  2EPF A;  3ZN0 A;  5DYM A;  2JA5 J;  3SDG A;  3TW7 A;  3BJA A;  4EGY A;  2CW0 F;  1D0X A;  2P8T A;  3HTS B;  2Q2E B;  4RB0 A;  1IZ1 A;  4ENN A;  1YQA A;  1OR7 C;  3ABT A;  1LEB A;  3VDX A;  3PIP F;  1D1B A;  1R58 A;  4N4O B;  1BOA A;  1X2N A;  2BZT A;  4WWC A;  2OU2 A;  4G6Q A;  3JTH A;  4I7H A;  1K4S A;  2VE9 A;  3NQO A;  2QQB A;  2XAH A;  5LLQ A;  2V9K A;  3IC7 A;  1OYY A;  2XGE A;  4IEJ A;  1GV5 A;  1QZE A;  1OCZ H;  2BVM A;  2E7W A;  5EG0 B;  2R5Z A;  1I39 A;  2VIX A;  5C44 J;  2YS9 A;  1B4A A;  3GW2 A;  2EFW A;  5LGN A;  1I6X A;  1MSF C;  3CQZ J;  2GXB A;  1FTT A;  4M71 A;  5LBQ A;  2Z33 A;  4S04 A;  1HST A;  1S7O A;  2IVM A;  2UXX A;  2DOD A;  1ZAO A;  1P4A A;  3K10 A;  3PL8 A;  4M3F A;  1QZZ A;  2FD5 A;  3HYI A;  3ABU A;  3ZMT A;  1KQ9 A;  2HOT A;  2Z2S B;  4YIR X;  2QYO A;  4I0A A;  1P92 A;  1K4T A;  2BEO A;  2L01 A;  1ONV A;  5J1R A;  2K3F A;  1FLI A;  1E3H A;  1AWC A;  3ZQI A;  3KZI C;  2KPM A;  2PMU A;  4PCQ A;  2GZW A;  1K6Y A;  2R7T A;  4QPQ A;  1TLH B;  3CTA A;  1WJC A;  1XGN A;  4PSX A;  4Y33 A;  3I59 B;  4II2 A;  3HSF A;  4ZTJ A;  5FLV A;  2ZFW A;  3DKW A;  4A3F J;  2E1N A;  1O7F A;  3LSM A;  4B44 A;  2W82 A;  1BN5 A;  1F43 A;  4HA8 A;  1WH5 A;  3GWZ A;  1WHU A;  1JE8 A;  1G59 A;  1LKX A;  2X1E A;  2JSP A;  1Z67 A;  2L0K A;  3BTL A;  5E3M A;  4W1U A;  3QAH A;  4E7Z A;  1LPQ A;  2XAF A;  3KP2 A;  1P9Q C;  5FB2 A;  3E6C C;  2OD5 A;  5TRD A;  1IO2 A;  3Q0U A;  3NWS A;  5CKT A;  2E2J J;  5ICC A;  2R7V A;  3TO6 A;  5D4R A;  3K7A J;  4IHT A;  2BY2 A;  3WTT C;  2PJP A;  4L5I A;  3CO6 C;  1X1B A;  1QQI A;  3E1S A;  2EQR A;  5JLW A;  3B73 A;  1G6N A;  1PJR A;  4CZZ A;  1O3Q A;  3F8C A;  3ZMU A;  5EEG A;  1TWA J;  3SZT A;  4G7H F;  2M7B A;  4DW6 A;  5K7F A;  4HDV A;  1NH3 A;  2JA2 A;  3BTC A;  3OYI A;  3OYL A;  2CW8 A;  1FP1 D;  4IQ4 A;  4HYE A;  3ZQ7 A;  4ENM A;  2CQX A;  5TJJ A;  1F36 A;  1X4O A;  2XHK A;  1ENH A;  4D5F A;  3HHG A;  4FQG A;  2FQ4 A;  3RYR A;  3OR1 C;  1XSD A;  4XOR A;  1OCR H;  4J19 A;  2ZME C;  2DK5 A;  4ZYA A;  4AD9 A;  3OS1 A;  3PUF A;  1MH4 A;  5CYV A;  3VOD A;  2HVR A;  2O6G E;  3CCY A;  1J59 A;  3LFU A;  1A31 A;  3FXR A;  4OIQ F;  5LD2 C;  3OYG A;  1SC7 A;  4LG0 A;  4AVP A;  4CA0 A;  2M0M A;  5J4V A;  1I1G A;  2LKP A;  2R7S A;  3LQR A;  1Y1W J;  5KAF C;  3H9J A;  4LGW A;  1D8K A;  1RKW A;  5E8G A;  3W2V A;  5DM7 F;  1UHW A;  3BZC A;  5L3F A;  1QU3 A;  3BPX A;  1QA6 A;  2E71 A;  2FML A;  3JRA A;  1JJ8 C;  4IF4 A;  2IGO A;  2NVT J;  3A02 A;  2FBI A;  5H2F C;  2FNP A;  1ERD A;  4BAC A;  1YRN B;  2V4J C;  3Q0V A;  3OS2 A;  1E2X A;  1Y8Q B;  1QZY A;  3MFK A;  3BR0 A;  1Z1D A;  2TDX A;  2G0E A;  1F5T A;  3SHF A;  4CCL A;  2EK5 A;  1VND A;  3DQV C;  1VZ0 A;  1KYZ A;  2M8E A;  2F48 A;  2EFQ A;  3HKZ A;  2YX7 A;  2ZNY A;  1D5V A;  1JHF A;  2QKL B;  3RQ4 A;  1U2W A;  3P9K A;  4IRI A;  5DEQ A;  1NK2 P;  3GFM A;  2VPL A;  2ECC A;  5AIP A;  4E7L A;  1IJW C;  4ZYH A;  2VN2 A;  2ZSI B;  4UUS B;  5HLH A;  2DTZ A;  2XPW A;  3BCA A;  3RPU A;  1SMT A;  1KU9 A;  1KGS A;  2HPM A;  2ELK A;  3VYT B;  3JAM Z;  2VT3 A;  3RKX A;  2DXI A;  4M73 A;  2NVU B;  4UV9 A;  2YSR A;  1JT6 A;  5J3L A;  1V4R A;  2VUM J;  4P9U A;  2FNA A;  4PFO A;  3GVA A;  4NB5 A;  3BC8 A;  3CF5 F;  4PJM A;  1TQM A;  2ME6 A;  1WPK A;  2R93 J;  2D1V A;  2ZJR F;  2L2O A;  5HNF A;  3DEW A;  1B8I B;  5H6Q A;  1T0F A;  5IP7 J;  2LF8 A;  1DP7 P;  1OCT C;  5HDG A;  1TW2 A;  3O8H A;  5FKL A;  1YW9 A;  2IA0 A;  1UJ8 A;  3L2V A;  2Y9Y A;  2FU4 A;  2HPI A;  3E97 A;  3WE2 A;  4RBO A;  1L3L A;  3F8N A;  1BM9 A;  4MO7 A;  3NAU A;  4FIS A;  1U9O A;  3K1N A;  1IUF A;  1L0O C;  4TV7 A;  3BJ6 A;  3RPU D;  5JR3 A;  3LSH A;  4U87 A;  1BL0 A;  4Z2Y A;  5L3E A;  3OYJ A;  4ABZ A;  4C30 A;  2HYF A;  2PN6 A;  3K70 D;  3L09 A;  3FHZ A;  3BG6 A;  1QGP A;  4AID A;  3HTU A;  1DU6 A;  2HQ5 A;  4O5V A;  2R7D A;  3J7Z I;  4UNO A;  4AYB N;  1N77 A;  2VKV A;  2CU7 A;  3H92 A;  1FYL A;  2M8G X;  4ZDP A;  1VQL I;  3ZOB A;  4A3G J;  3PSI A;  2ZBK A;  3DBH B;  1HSJ A;  1S8N A;  2QLZ A;  5KK1 A;  1CQT A;  4BQN A;  2DOA A;  2W4S A;  1B72 A;  2DA6 A;  1ZHF A;  2XPV A;  3OIP A;  4HDU A;  3QPT A;  1Y39 A;  5JI6 A;  1BI2 A;  2UZK A;  4L0Z B;  1BW6 A;  1U6G A;  3S1N J;  2AS5 F;  4PFP A;  2LG4 A;  1O3T A;  1ZRF A;  1TNT A;  4FAS D;  2JWT A;  5ICG A;  4ESJ A;  2ESN A;  3KP6 A;  2QQ8 A;  3E3V A;  4A2U A;  2KIQ A;  4A69 C;  2L7M P;  4QWQ A;  1Z05 A;  3JAM K;  2NNY A;  2IW5 A;  1T98 A;  5B1A H;  3K4K A;  3D5L A;  5D5X B;  1FSE A;  1ETV A;  4XK4 A;  3HL2 A;  2V7F A;  1QPM A;  1TNS A;  2DW4 A;  4PGH A;  2CUF A;  1SVM A;  5EG0 A;  2L7K A;  2B7E A;  1E3O C;  3FK6 A;  1WI3 A;  5EYR A;  1OKR A;  1XN7 A;  2EIJ H;  2MD0 A;  2X1D A;  4BE1 A;  3H3V K;  1MGT A;  2HKO A;  2VQC A;  2LF7 A;  3QP5 A;  5HS9 A;  2LK2 A;  3K9T A;  2X6W A;  4BQO A;  2VLA A;  1RR7 A;  4EAT A;  3CMM A;  5F64 A;  3M3Y J;  3CCS I;  4HNV A;  4HZF A;  1D1C A;  2CQ7 A;  2F4O B;  4BHC A;  1BJZ A;  5HNH A;  3CMA I;  2GLO A;  3I4P A;  4BXU A;  3KCC A;  4PJL A;  4M6Y A;  5E1Z B;  3HOS A;  4A93 J;  1B6A A;  1A6Q A;  1XSV A;  2QSH X;  1ON2 A;  3HGY A;  5IOZ A;  4U0V A;  3KET A;  3KX2 A;  4JX5 A;  4OMZ A;  1Y8R B;  1V55 H;  3SQN A;  4H0E A;  2M5W A;  3DBL B;  2EWN A;  2NS0 A;  1PDN C;  2VXD A;  2IP2 A;  3GX4 X;  1EV7 A;  4DYC A;  3LL7 A;  4PGG A;  5M5X J;  4U0Y A;  1FBS A;  3HEF A;  3ROU A;  5FD6 A;  5BOX A;  4A0Y A;  5ICE A;  4X6A J;  3BG7 A;  3PFY A;  3K2A A;  1WCM J;  1Z77 A;  5IYC J;  1H9T A;  1K7A A;  4UB6 C;  4ZTF A;  1BIA A;  2V79 A;  1G4D A;  3CD6 I;  4KA4 A;  2A6E F;  1HXD A;  3KYC B;  4RGS A;  2PI0 A;  5EEH A;  2R5Z B;  4IZZ A;  1S72 I;  2G7H A;  4R1H A;  3TDU C;  4A3J J;  2BHY A;  3KE2 A;  2KQR A;  2LFB A;  1O7L A;  3HPG A;  3IRR A;  1WZ2 A;  5KHD A;  4HAM A;  4O6J A;  3GO5 A;  2IS2 A;  4V19 K;  4RGX A;  3FXU A;  2KL4 A;  3FMR A;  4N0B A;  4BU2 A;  2HI3 A;  3GZ5 A;  3NAR A;  4XNF A;  5D5U B;  1BC8 C;  4HNT A;  2DPU A;  2PG4 A;  1ZRC A;  1ZQ3 P;  3BPV A;  5CQE A;  2E5N A;  3DXJ F;  5C4X J;  3KYD B;  2YR2 A;  4MEX F;  2LD5 A;  2ELH A;  5J1U A;  3K4C A;  1VQ5 I;  4B8X A;  3GTQ J;  2RRE A;  3OS0 A;  2DDA A;  5GTI C;  3CCQ I;  2EBI A;  2MLG A;  2PMZ N;  2Y0M A;  2W24 A;  4KIB A;  4MTD A;  2XB5 A;  4CYC B;  1STZ A;  5FKN A;  1IC8 A;  2FJ1 A;  2OA4 A;  4RGR A;  1U5T C;  5F27 A;  4XQF A;  1YX3 A;  2LOO A;  5DDG A;  2NYX A;  4ENJ A;  4ENK A;  1LB2 A;  2M34 A;  4FX0 A;  3HC7 A;  1WSU A;  2LY1 A;  2RGV A;  4Q5S F;  2Z3Y A;  1VI0 A;  3P5J A;  5J6X A;  1A35 A;  1RET A;  3DFG A;  5TIS C;  4BDZ A;  1XC5 A;  2QVO A;  2R7O A;  5C3E J;  1R23 A;  3EDP A;  1R4N B;  4ZYG A;  4LLL A;  5F0F A;  2I5U A;  3DPL C;  4G8X A;  1HLV A;  2G9W A;  5IYB J;  5GP9 A;  2ZKZ A;  4E70 A;  3HZJ A;  3G1L A;  1P7I A;  3H36 A;  1ODD A;  2VBW A;  1OYW A;  2VQL A;  1R49 A;  2LLK A;  2B9S A;  2KKO A;  2MA3 A;  4PJN A;  2NVX J;  2EH3 A;  2HVQ A;  2ZXW H;  1WJ5 A;  4MNU A;  4L5E A;  3GTP J;  3HBL A;  2PBI A;  3BRO A;  2WAQ N;  4A3K J;  2M1B A;  5LHH A;  5AIQ A;  1K6O A;  1YRN A;  3OYF A;  2XRL A;  2PX9 A;  4HLX A;  5CVV A;  5CVU A;  1QNT A;  1H0M A;  3AG4 H;  2HDD A;  2N8G A;  1VQM I;  2BHZ A;  3ISP A;  2DA5 A;  2CUE A;  1JTX A;  2E19 A;  1GLN A;  3DPT A;  3WGI A;  1RPW A;  1W36 D;  1BI1 A;  1S3J A;  3QOP A;  4A12 A;  2LKX A;  1NG6 A;  1UAA A;  2IAI A;  4GFB A;  2ID3 A;  2YU3 A;  2JTV A;  3T5X A;  4GDF A;  2E60 A;  2JRM A;  2K9L A;  3L00 A;  3O8G A;  1A04 A;  4IKF A;  3RTR A;  4PSW A;  4QLC U;  3LSP A;  2BXZ A;  4LG0 B;  1W7P A;  1P6R A;  2J5O A;  2NXN B;  5HLG A;  1X3Z B;  1I3A A;  2JK3 A;  4EVI A;  1G3T A;  3H9G A;  2HQR A;  1I27 A;  1Z91 A;  1E3P A;  2RAE A;  5KVR A;  3Q0W A;  3IH3 A;  3CC4 I;  2HGC A;  2W00 A;  3V42 A;  1JJ6 C;  4MQ9 F;  2P5L C;  3K4M A;  3OIO A;  1W5C C;  1G3Y A;  2JT1 A;  1T0F C;  4RMN A;  1IN4 A;  3OMY A;  1YHQ I;  4LIV A;  2I10 A;  2X51 A;  2VOO A;  2LVS A;  2L54 A;  2VBX A;  2WV0 A;  1XGM A;  4BL0 B;  2XPU A;  3OOU A;  3HRU A;  4KIC A;  3BR2 A;  4LG3 A;  5LGT A;  4UUV A;  3K1P A;  1LNW A;  5GAG J;  4Y4R A;  5GPA A;  1FMV A;  4JX4 A;  1KU2 A;  3IHU A;  4B48 A;  4D7N A;  4XL9 A;  4CCJ A;  4ZH4 F;  2L02 A;  2RNG A;  3SXY A;  3WE3 A;  2FA5 A;  2HNH A;  2K40 A;  3L2C A;  2CYY A;  3HXL A;  2GXA A;  4F55 A;  3ZQC A;  3S15 J;  2O8X A;  4A5M A;  3V8K A;  1EH6 A;  2HYG D;  4XLC A;  1X3W B;  3NEU A;  1UCR A;  1TWH J;  3G2B A;  4ESF A;  1SAX A;  3VSK A;  4ZJZ A;  3GFI A;  3FF5 A;  5L3B A;  2GOX B;  5HVQ C;  3L2Q A;  2FE3 A;  2V1D A;  3A4C A;  3I58 A;  4MFE A;  4IX7 A;  3I4M J;  2K02 A;  4PDK A;  4H4K C;  1FOW A;  1QVT A;  5C4J J;  3TMO A;  1XCV A;  2FSW A;  3FXJ A;  5J4Y A;  3TED A;  3TW6 A;  2DJI A;  5F1J A;  1H8A C;  1B59 A;  2IS4 A;  3H3Z A;  1IXR C;  3FMQ A;  3C18 A;  5FRM A;  1ETW A;  3OYD A;  4KNY A;  2HEO A;  1ACI A;  2XSD C;  3U9G A;  2LYC A;  3T8T A;  3HDD A;  4PJJ A;  3ECH A;  2EIL H;  3OWT A;  2HOE A;  2OCC H;  3FXL A;  2XAS A;  1RES A;  4R8H A;  5LGU A;  3CZ6 A;  1HW2 A;  3ML6 A;  5J8C A;  1DPR A;  5JLX A;  3GLL A;  1EKE A;  4L9J A;  4HNU A;  4DZJ A;  1IRX A;  1WJF A;  3EUK L;  3A2K A;  5BQT A;  4BHP A;  1HKS A;  2DMT A;  4LIU A;  2X6Y A;  4F93 B;  1RZ4 A;  2QCO A;  2V1X A;  4YG2 F;  3D1N I;  2VXZ A;  3BR1 A;  5J1Y A;  3WTS C;  3HOX J;  2XF5 A;  1B72 B;  3FX3 A;  2MLK A;  3FKI J;  1F1Z A;  3LA7 A;  4MEY F;  3W2W A;  3WU2 C;  2K3P A;  1RIO H;  5D5W B;  1AKH A;  3VWB A;  4M3G A;  3IUO A;  1T39 A;  2GXG A;  1MMS A;  3J80 K;  1VQ7 I;  4WXD A;  1QVU A;  2ZJQ F;  3G1O A;  4MFD A;  3W6V A;  2O0Y A;  4KFC A;  2BXY A;  2P6T A;  3TKY A;  4A3L J;  2OTJ I;  1QPI A;  3OYK A;  3CO7 C;  2DI3 A;  3QQA A;  2XAJ A;  1WGX A;  1NK3 P;  4XLN F;  5E1X A;  1S6L A;  1VFC A;  5FGM A;  3KEO A;  4HOB A;  2CS3 A;  1AOY A;  4ZDL A;  2XRO A;  4BJ6 C;  4M3E A;  2GQQ A;  1D1A A;  2RKH A;  1ZAR A;  2MBF A;  1RUN A;  5LRS A;  1LDK B;  9ANT A;  4LD5 A;  4EM2 A;  1R4M B;  2LH9 A;  3W3C A;  3QYE A;  1ZK8 A;  4DQ2 A;  2CFX A;  2DFF A;  2DT6 A;  5HS7 A;  1F4K A;  2JA7 J;  1XX5 A;  1OQY A;  2JZY A;  3CP8 A;  3V7R A;  3OYE A;  4XKC A;  4WXH A;  3HKZ N;  2Y0S A;  3UR3 C;  2L9S A;  1T08 B;  4AM3 A;  2R92 J;  4EM0 B;  3JRC A;  2M2E A;  2OQG A;  3WU1 B;  3QYF A;  2KJB A;  1Q1V A;  4CXF A;  1FP2 A;  1HF0 A;  3KEY A;  4ZYD A;  1MW7 A;  2MSY A;  3KZY A;  4ESB A;  3W2A A;  2LRE A;  1S7A A;  2KP6 A;  2RC4 A;  3F8F A;  4BBR J;  4CYC A;  1Z21 A;  1MBF A;  4AUX A;  5HOO A;  4HF1 A;  2KRC A;  4DNC A;  2OCE A;  4DYR A;  3N97 A;  4WF2 A;  4IXA A;  2I8D A;  2KRF A;  1IGN A;  3J7A Y;  3MWM A;  4A3M J;  2BVL A;  1W36 C;  3S17 J;  2MH9 A;  4CCM A;  1R1U A;  3ZMS A;  4G12 A;  4E4H A;  3K4B A;  1AA7 A;  5FJ8 J;  1ETK A;  1FNN A;  3MQ0 A;  1LDJ A;  5ICF A;  1KZH A;  4BY1 J;  4HX7 A;  4IHS A;  3BLY A;  2COM A;  2G7U A;  4R79 A;  3H5N A;  2IRF G;  5CJ9 A;  1FSH A;  3H3U A;  2VT2 A;  2FF4 A;  2CRG A;  4HST A;  2HFH A;  3R0A A;  2M4G A;  2RV8 A;  4OU0 A;  1LVA A;  1H9G A;  1YI2 I;  2R7W A;  2DAO A;  4X1E A;  3KP5 A;  3H5A A;  1UMQ A;  3T0Y A;  1K83 J;  4D7M A;  3F3X A;  4BGD A;  4A3B J;  4HF2 A;  4XN3 A;  3DWL E;  2JA8 J;  5L3D A;  3RZD J;  4U7D A;  1A5J A;  5IYD J;  2M4K A;  4ETS A;  3RKW A;  1CF7 A;  3CP2 A;  2A6T A;  3HIF A;  2VJ4 A;  2H09 A;  2HZT A;  1FOY A;  1ZN2 A;  4E7K A;  3EUH C;  1KU3 A;  3K2Z A;  2AQF A;  1FIA A;  3G73 A;  4BEH B;  4BE2 A;  1S5L C;  3GFJ A;  4M9Z A;  2O3F A;  3P9C A;  4L9T A;  3S2W A;  4OAY A;  5EJC A;  4YEL A;  1IUY A;  2QA4 I;  2E35 A;  4HV5 A;  4G6T B;  2KJC A;  2AHQ A;  1PP7 U;  4XOP A;  4CCN A;  2DBB A;  2IJL A;  5IP9 J;  2XKO A;  2EB7 A;  4NC7 A;  1ULY A;  1VQ9 I;  1SD5 A;  4WK8 F;  3GTG J;  4UVA A;  1U78 A;  4B43 A;  1QRY A;  2AO9 A;  2DA1 A;  1W0T A;  3TO9 A;  1YW7 A;  3ABL H;  2E1C A;  3MD2 A;  4CUG A;  3JTG A;  3DLL F;  4RLQ A;  3GXO A;  2XGD A;  2XAU A;  3LSI A;  3TOA A;  2DJN A;  1APL C;  4Z6Y A;  4EJO A;  3JW4 A;  1MSE C;  2Z9O A;  3A0H C;  1R00 A;  2K85 A;  2RNJ A;  4LB5 A;  4G94 A;  4KIF A;  1VQ8 I;  2PFB A;  1QBJ A;  4BQA A;  3V7S A;  1IN7 A;  2D1H A;  3D0S A;  2MGQ A;  2Q1Z B;  4I99 C;  5M3F J;  2EFO A;  3C1D A;  4GYI A;  3ONQ A;  4PJ0 C;  3WTV C;  2M30 A;  1JGS A;  1AHD P;  3QPH A;  1SFX A;  3DV8 A;  1DQU A;  1FC3 A;  3S32 A;  2P0W A;  2HQA A;  1F9N A;  3CCJ I;  1UHM A;  4XLE A;  3U2R A;  1W7P B;  5A2Q Z;  3CC2 I;  4KT5 C;  3A1Y A;  1R7J A;  1MZB A;  3F8B A;  4IL6 C;  4BH9 A;  4XSZ F;  4WCG A;  4I09 A;  4DZP A;  2EJR A;  2HXI A;  2P6S A;  4NQW B;  2A05 A;  1HOM A;  1R1T A;  1QO0 D;  4XLA A;  2V26 A;  5FO5 A;  2ADU A;  4E6K G;  2H27 A;  3G4S I;  2M9H A;  2NVY J;  3BY6 A;  3M07 A;  4YEJ A;  3QWL A;  4NUB A;  2ID6 A;  1ZLJ A;  4UHT A;  5K5Q A;  2MG4 A;  2IPQ X;  2X6O A;  2X6X A;  1FWZ A;  3ZXS A;  1RUO A;  2HYJ A;  1ETY A;  3BP8 A;  1ZKG A;  3RIR A;  2MC4 A;  4IRH A;  4OIN F;  3MKL A;  2KIU A;  1JTY A;  3AKZ A;  2X1C A;  1TT5 B;  2DDB A;  5DS9 A;  1TL8 A;  4LB6 B;  1T95 A;  1ZRE A;  1DDN A;  3AG3 H;  4G7O F;  1XMK A;  3FM3 A;  2OAZ A;  2ESH A;  3DKY A;  3IV5 A;  1Y1V J;  2EV5 A;  3R6S A;  3K6G A;  1TBX A;  1JKR C;  3P9I A;  2KDO A;  3AL0 C;  1X1P A;  1S29 A;  3ZCO A;  3EQL F;  2CUZ A;  2VC1 A;  3BG3 A;  4JQF A;  1IG7 A;  4U0W A;  2BY1 A;  3ZQH A;  2ACJ A;  1WFX A;  3OY9 A;  2P7C B;  5E8I A;  4HPQ A;  2VB6 A;  1V5E A;  2LDU A;  3T8R A;  3O2P E;  3K0L A;  3MKZ A;  1LFB A;  5A2Q K;  3CJN A;  1NTC A;  4LOC A;  1GDT A;  1Z7L A;  2WAF A;  2WB1 A;  1B1B A;  2DPD A;  1MKM A;  2XGC A;  3HJE A;  3ZQQ A;  1RKT A;  3FKJ A;  3HHH A;  2FXA A;  4MQV A;  4I76 A;  4MTE A;  1MMG A;  3K4L A;  1ZYR F;  1IV8 A;  2KHM A;  3LSK A;  3VEP A;  2DMU A;  3J81 Z;  2EZH A;  3S2D J;  3RI4 A;  2F5D A;  3BT9 A;  3FXM A;  5LFA A;  2M0C A;  4RAF A;  3U1K A;  3LSJ A;  4M74 A;  3ZRG A;  5H20 A;  2CQN A;  4LIT A;  3AFH A;  4L18 B;  5LHG A;  3WOD F;  1S9H A;  6PAX A;  1SFU A;  3AL0 B;  5GAH J;  3H0D A;  1WQ2 A;  1XG1 A;  4Q4Z F;  1FT9 A;  3HB9 A;  2VBZ A;  3FBI B;  5CVR A;  3A03 A;  2IS1 A;  3RDI A;  2R7U A;  5IY5 H;  4BJT A;  1AKH B;  3TP0 A;  1FOK A;  2DA3 A;  2KIM A;  2L7F P;  3M8E A;  3J7A O;  3FIS A;  2P81 A;  3HOV J;  4IJA A;  2OF7 A;  3S93 A;  2GWR A;  4XRS A;  2O61 A;  3MMY B;  3CCU I;  2DYR H;  5J40 A;  1RI7 A;  3DKX A;  2W48 A;  2UUZ A;  3E0J B;  2V1N A;  4FTH A;  2Y2Z A;  4C2M J;  1I3Q J;  2HVS A;  2GA2 A;  1J75 A;  2GIV A;  1IXC A;  2VOP A;  1TQI A;  2WAD A;  2STT A;  4B3A A;  4XLP F;  3SZP A;  1GUU A;  2HWV A;  3CF2 A;  3TO7 A;  4IRG A;  4C2T A;  1TW3 A;  4DJA A;  3MAJ A;  4V2G A;  3PQJ A;  3QU3 A;  5IT9 Z;  1MH3 A;  5BPI A;  4YRV A;  4J00 A;  1WH7 A;  3BR3 A;  3RQI A;  5FRN A;  1GVJ A;  3R61 A;  3S1Q J;  3JSO A;  2QSG X;  3RYP A;  1UHS A;  1R71 A;  5E3L A;  2TCT A;  1REP C;  2A3S A;  5JVG F;  5D8K B;  2W84 A;  4UXN A;  3S3N A;  1XGS A;  2H1K A;  3LA2 A;  3R60 A;  1ETX A;  1K79 A;  3IAM 2;  4Q48 A;  3LFK A;  3SYT A;  2P4W A;  4I01 A;  1XD7 A;  3J81 K;  3GTO J;  3GLX A;  2L9N A;  4HQE A;  2PJR A;  3LWF A;  1BI3 A;  4EQQ A;  2HDW A;  1ZG3 A;  1S7E A;  5FLX Z;  2IS6 A;  2HOA A;  2JUG A;  4V2F A;  1LE8 A;  4JX6 A;  1IF1 A;  4A3I J;  3WTU C;  1R9T J;  2VJI A;  2R0Q C;  3OYN A;  1YS6 A;  2QZ8 A;  3CUO A;  1FIP A;  1LFU P;  1XDU A;  1YJN I;  4NC6 A;  3WTX C;  2A5Y B;  4W97 A;  1W5S A;  3FK7 A;  4XLH A;  1OFC X;  2DQR A;  4BEH A;  1UFM A;  1ORK A;  2LNB A;  2NS7 A;  1EH7 A;  2QBY B;  1J7K A;  4WXC A;  5DV5 A;  5EZH A;  2X85 A;  1JKQ C;  3C3W A;  1YIJ I;  1I50 J;  2CV0 A;  3OV8 A;  2ELJ A;  1MD0 A;  4XIC A;  1UST A;  4KYW A;  4XRF A;  4S05 A;  1PYV A;  5ILS A;  5DTD A;  1SFE A;  2BGC A;  2R7Q A;  4I2O A;  4AC0 A;  4IHV A;  3BOQ A;  3ZR8 X;  5HS8 A;  3GTJ J;  1ZGJ A;  4ZC3 A;  2BYV E;  2HR3 A;  5KCM A;  3G71 I;  3VB2 A;  3W6J B;  1FPQ A;  4CZC A;  2JN6 A;  4RB3 C;  3QOD A;  1ZR2 A;  1X1C A;  2H1L A;  2COB A;  1CF7 B;  1SVO A;  3E6M A;  2YPR A;  2OBP A;  1R36 A;  1TTY A;  5D8L B;  2FBH A;  2O5R A;  2HOS A;  1T6S A;  1WKM A;  2QEX I;  1YX5 A;  2R7F A;  3HSR A;  2KT0 A;  3L2W A;  2QQ9 A;  3DTE A;  2XSJ C;  2BV6 A;  5DUI A;  2WTE A;  3I55 I;  3BCB A;  4N9H A;  1VQK I;  4RAY A;  3S3M A;  4HX8 A;  1IW7 F;  3U1D A;  4L9N A;  2EZI A;  2W1O A;  5L3C A;  2A07 F;  3OR2 C;  3ZGK A;  1WVR A;  2WWY A;  4L9V A;  5D6F A;  5IP6 A;  1U0J A;  3TOB A;  4EEF G;  3K70 C;  4EMS A;  3IRQ A;  3GFL A;  4EGZ A;  2L7Z A;  1JGG A;  2H94 A;  1R22 A;  1X3U A;  2DFH A;  2WY8 Q;  3JRB A;  2LY2 A;  1DUX C;  4HBL A;  3WG7 H;  5LHI A;  5D5V B;  1FY7 A;  4NQW A;  3ASN H;  1YFH A;  2ETH A;  3BWG A;  4O3M A;  1POG A;  2EFP A;  4D9J A;  3MZ8 A;  1LEA A;  1YS7 A;  2PMH A;  3CDI A;  1SFK A;  2Y48 A;  2ZSH B;  3H9Q A;  3BZ6 A;  5LEJ A;  3U21 A;  4DBR A;  3H1C A;  2GOM A;  4MLO A;  4RB1 A;  2M7A A;  1FYM A;  1X1A A;  2DTR A;  4RM2 A;  2ZO4 A;  2CW7 A;  5FKO A;  3PIO F;  4NDL A;  1TWF J;  2OC6 A;  1W7P D;  4ZYE A;  2Y0S N;  4XMY A;  2NOG A;  2BE5 F;  1OMI A;  3QRF F;  3IKT A;  5FLM J;  3Q9S A;  3UNG C;  2OPT A;  3ASO H;  3BTJ A;  2A5W A;  3HG9 A;  2F6C A;  3B02 A;  5KNL A;  1SD4 A;  2D2W A;  2R5Y A;  3KP3 A;  1XPX A;  1R5G A;  4KMF A;  4M6V A;  3OYC A;  1KA8 A;  4IHW A;  2VJ5 A;  3I5U A;  1YLF A;  1JI8 A;  2PEX A;  4YFN F;  2CUJ A;  1ZG1 A;  3JR9 A;  1Z6R A;  2KIF A;  4XKV A;  2X48 A;  3MKY B;  4ZDO A;  4GO1 A;  4XKB A;  5M5Y J;  2ZCW A;  2DA2 A;  4RA2 A;  2R7R A;  4Y52 J;  5JHF A;  4IHX A;  4IOC F;  3CC7 I;  2ZXH A;  5DUK A;  1SMY F;  1FX7 A;  3PM1 A;  2Q8K A;  3OYA A;  1ZLK A;  3SFI A;  2DFE A;  2QQA A;  3EPZ A;  3A01 B;  1M1E B;  3MKW B;  3OL4 A;  4X0G A;  4E7H A;  2YUS A;  3ULQ B;  3EET A;  1DU0 A;  3I9V 2;  1A6I A;  3WGG A;  1VQ6 I;  3ZN1 A;  1LQ1 A;  1YO5 C;  3E6D A;  4CSW A;  2W57 A;  2Z5U A;  1D5Y A;  1XGO A;  3PNT A;  1N78 A;  2UXN A;  1X58 A;  2L9V A;  3PSF A;  1J0R A;  3C2B A;  2A68 F;  2EV6 A;  2MC3 A;  1ZEL A;  1JUM A;  1WJB A;  1TT0 A;  3V8J A;  4FE7 A;  3V4G A;  3HOZ J;  4C9Y A;  4RGU A;  3OSG A;  3OIQ A;  3E6B A;  3HSE A;  3O6B B;  3M8F A;  5AON A;  3HRS A;  4CH7 A;  3RKQ A;  3BQZ A;  3L9F A;  5E20 A;  4DYQ A;  2AXL A;  1V3F A;  2LC2 A;  1P2F A;  4A3E J;  3JRE A;  3GME A;  4CHU A;  4CDG A;  5GAE J;  4CGZ A;  3CDH A;  3OL3 A;  3KPH A;  2HQN A;  4WX9 A;  4CCO A;  3CCV I;  3LAJ A;  1BR1 A;  4G6D A;  3E5X A;  2F5F A;  1MMD A;  1MMN A;  3CJR B;  1YG2 A;  1OCO H;  5CVI A;  2MD5 A;  3QP6 A;  1OLT A;  2DCE A;  4FHT A;  1K61 A;  3LOC A;  3M8J A;  4GGG A;  4I0B A;  4OWR B;  4XM3 A;  3TBI A;  2FQ3 A;  2DOE A;  3G3Z A;  1P4W A;  2DFI A;  4AU7 A;  4GXO A;  2JUC A;  1OJL A;  3FZV A;  1HKQ A;  1IDZ A;  2AXT C;  3LST A;  3KFW X;  4P55 A;  3M9A A;  2DK8 A;  1WI9 A;  3DBR B;  3PO2 J;  3HGG A;  3OOP A;  1SD6 A;  3F6V A;  1QHG A;  3C2G A;  4KN4 X;  4BE0 A;  4OIO F;  1ZH5 A;  4FET A;  1H88 C;  2IGK A;  2M3A A;  4MHG A;  2FEZ A;  2HS5 A;  3I64 A;  4CCK A;  3IL2 A;  2L3D A;  2LTP A;  5GPC A;  3VSL A;  2DMQ A;  3GYH X;  1W0U A;  2JVG A;  2R7X A;  2XC7 A;  5BPD A;  1O3S A;  1X1D A;  2XKP A;  5K1Y A;  2FBK A;  4II3 A;  3CME I;  1SAU A;  4RS8 A;  4QTR A;  4M9X A;  1E17 A;  2IXS A;  2F5C A;  3CUQ B;  2OQR A;  3EUA A;  1BIB A;  1U3E M;  1GXQ A;  3ELK A;  2JPC A;  1B9M A;  5DD4 A;  5JVT A;  1UZC A;  3EYY A;  5DCM A;  1FOX A;  2EZK A;  3GTK J;  1W1W E;  1MBG A;  3KZZ A;  2F5E A;  4EV0 A;  1V5G A;  5BMZ A;  4UUT A;  4XLF A;  2VKD A;  1IN5 A;  2ICW G;  3CJQ B;  2BW3 B;  1JUS A;  4M6X A;  3TGN A;  1HW5 A;  4YII A;  4BJ5 C;  4QPO A;  3I4N J;  3T1B A;  3M1E A;  2STW A;  4XON A;  1JKO C;  2XVC A;  5F08 A;  2VKH A;  2VJJ A;  2DA4 A;  4HF0 A;  4IOA F;  4NNJ A;  3ZMV A;  5E3N A;  2XIG A;  4ITV A;  3QPL A;  3DF8 A;  3ZP5 A;  4Y7N J;  4LJZ F;  2QBY A;  4KT6 A;  3H5R A;  4M3B A;  2CG4 A;  3NWT A;  3Q9V A;  1FBU A;  5CQG A;  5L3G A;  3WTY C;  5HLT A;  3K4N A;  2E2H J;  4UV8 A;  2V6E A;  4JOM A;  2QUF A;  3JRI A;  1MIJ A;  2V1U A;  3E5Q A;  3GTM J;  3J7Y J;  2CFO A;  1YJ9 I;  1ZRD A;  1DPU A;  2QEN A;  2BY0 A;  3PUB A;  2Y9Z A;  3FDY A;  3V8L A;  2EA4 A;  3FBN B;  1MBK A;  4BUP A;  2MH2 A;  2V9V A;  3FHN A;  3VYS B;  2R4G A;  2PJR B;  3ZPL A;  1JHH A;  2K27 A;  2V6C A;  1PUF A;  3HUG B;  2Z1D A;  1IRZ A;  2OV7 A;  4QIW N;  1RNL A;  5JHU A;  1OPC A;  1LE8 B;  2VOD A;  1W5T A;  3VFZ A;  3KP4 A;  1MDM A;  1FYK A;  2KRH A;  5F0H A;  4Y3O A;  1U9N A;  3DEU A;  1SFO J;  2WC2 A;  2MYS A;  3P7N A;  2X4H A;  1TP4 A;  2J5P A; 
#chains in the Genus database with same CATH homology
 3MKZ A;  1YE9 A;  3LSG A;  2CH0 A;  1NG7 A;  2HZD A;  3PNV A;  1Z7L A;  2WAF A;  2WB1 A;  3DTK A;  2WAQ A;  2VQL A;  2VL8 A;  1LVK A;  4PJN A;  3ZQQ A;  1BOB A;  3FKJ A;  2HVQ A;  1WJ5 A;  3L2U A;  1MMG A;  3K4L A;  3S8P A;  4HEA 2;  2KHM A;  3LSK A;  4OAZ A;  3OYF A;  1Y6I A;  1DGR M;  1FMW A;  5LFA A;  3SEZ A;  3ZRG A;  3QYB A;  4LIT A;  3AFH A;  2L5Q A;  1GLN A;  3DPT A;  1W36 D;  1E0E A;  1S9H A;  1D0X A;  2CMP A;  3AL0 B;  3PJR A;  1NG6 A;  1UAA A;  2Q2E B;  3H0D A;  4DOZ A;  2E60 A;  2K9L A;  1OR7 C;  3FBI B;  3VDX A;  2IS1 A;  2R7U A;  4IKF A;  3RTR A;  1D1B A;  4PSW A;  4N4O B;  4BJT A;  3H9G A;  2E5Z A;  3S93 A;  3MMY B;  2V9K A;  3DKX A;  4PUS A;  2UUZ A;  3E0J B;  2V1N A;  2W00 A;  2BVM A;  3V42 A;  2HVS A;  3K4M A;  2VIX A;  1T0F C;  4RMN A;  3OMY A;  4LIV A;  2WAD A;  2X51 A;  1X4P A;  3CF2 A;  4C2T A;  4BL0 B;  4DJA A;  1UEL B;  1R6R A;  3OOU A;  3N05 A;  4F52 A;  4YRV A;  4J00 A;  4LG3 A;  5FRN A;  3K10 A;  3PL8 A;  4Y4R A;  1FMV A;  3H35 A;  4B48 A;  4XL9 A;  4CCJ A;  2Z2S B;  2RNG A;  4B47 A;  2HNH A;  2E1M C;  2LBF B;  3HXL A;  3S3N A;  4F55 A;  1Y56 A;  2KPM A;  3IAM 2;  3SYT A;  4XLC A;  1K6Y A;  2WAE A;  2R7T A;  4QPQ A;  2L9N A;  2PJR A;  1WJC A;  3G2B A;  1LFP A;  4PSX A;  4Y33 A;  2HDW A;  4II2 A;  2LRD A;  2ZXI A;  3VSK A;  4ZJZ A;  4ZTJ A;  2Z16 A;  2GOX B;  5HVQ C;  3L2Q A;  2IS6 A;  2JUG A;  3A4C A;  4IX7 A;  3LSM A;  4RLF A;  2W82 A;  4B44 A;  4H4K C;  3RCO A;  3D5S C;  3TMO A;  2VJI A;  3OYN A;  1G59 A;  1LKX A;  2CV1 A;  2X1E A;  1J09 A;  2JSP A;  4XLH A;  3C2H A;  4E7Z A;  4BEH A;  2DJI A;  4D1Q A;  1P9Q C;  2IS4 A;  4DGW B;  3NWS A;  5FRM A;  3TL4 X;  5CKT A;  4BXF A;  3OYD A;  2R7V A;  2X85 A;  4U7B A;  4E7S A;  1X19 A;  2LYC A;  1X1B A;  3E1S A;  4PJJ A;  2CV0 A;  2ELJ A;  3OWT A;  1PJR A;  2F4I A;  4KIT B;  3CZ6 A;  2M7B A;  4NC8 A;  4J01 A;  2HU9 A;  2QKM B;  1PYV A;  3IP4 B;  1MMA A;  3K4J A;  1KON A;  1QHH D;  4HNU A;  2JA2 A;  2E1M B;  3OYI A;  3OYL A;  2R7Q A;  1IRX A;  1WJF A;  2CW8 A;  3EUK L;  4IQ4 A;  3ZR8 X;  3A2K A;  3GBG A;  4ZC3 A;  1X4O A;  4F92 B;  5KCM A;  4LIU A;  2X6Y A;  3DEE A;  4F93 B;  3OR1 C;  4CZC A;  1UG0 A;  4XOR A;  3QOD A;  4AVZ A;  1X1C A;  2VXZ A;  1DGW Y;  4ZYA A;  3OS1 A;  2WA0 A;  2XF5 A;  2HVR A;  3W2W A;  3F9K A;  3LFU A;  2O5R A;  2K3P A;  5LD2 C;  1YX5 A;  2IGM A;  3VWB A;  3OYG A;  3L2W A;  3DTE A;  4CA0 A;  2XSJ C;  2M0M A;  4B3X A;  3IUO A;  2R7S A;  3BCB A;  3S3M A;  1BR2 A;  2KZV A;  1MND A;  4P1W A;  3H9J A;  4E7J A;  2W1O A;  4DIQ A;  3OR2 C;  3W2V A;  3ZGK A;  1QU3 A;  1WJA A;  1U0J A;  2VQH A;  2IGO A;  3OYK A;  2CV2 A;  3K70 C;  4XOT A;  3HPH A;  1ERD A;  4BAC A;  2V4J C;  3SDB A;  4RM3 A;  3OS2 A;  2WY8 Q;  2CS3 A;  2LY2 A;  4ZDL A;  4BJ6 C;  3DTI A;  1D1A A;  4CCL A;  3DQV C;  1VZ0 A;  2BW3 A;  2OUM A;  1LDK B;  1DP3 A;  4BDY A;  2LH9 A;  3HKZ A;  3W3C A;  3QYE A;  4D9J A;  5CPR B;  1D0Z A;  2DT6 A;  2QKL B;  3RQ4 A;  2VPL A;  3CP8 A;  1SFK A;  3OYE A;  4E7L A;  4XKC A;  2ZSH B;  3S3O A;  3H9Q A;  2Y0S A;  3UR3 C;  2L9S A;  2VQG A;  2ZSI B;  3U21 A;  4DBR A;  2GOM A;  4MLO A;  3IAS 2;  2M7A A;  1X1A A;  4RM2 A;  3BCA A;  2WY7 Q;  3QYF A;  2CW7 A;  2OC6 A;  2MFZ A;  3KEY A;  2HPM A;  4XMY A;  3VYT B;  1MW7 A;  2DXI A;  3W2A A;  2LRE A;  2KP6 A;  1Z21 A;  5HOO A;  2KRC A;  3UNG C;  4PFO A;  3BC8 A;  4N4N B;  2I8D A;  4PJM A;  2A5W A;  3HG9 A;  2F6C A;  5KNL A;  3J7A Y;  2L2O A;  2XF6 A;  2AQE A;  5HNF A;  2BOL A;  2BVL A;  3PNY A;  2NOJ B;  1W36 C;  2XF7 A;  3OYC A;  3HOT A;  2MAB A;  4CCM A;  2IGN A;  2RQQ A;  2VJ5 A;  4E4H A;  1JI8 A;  3K4B A;  2CUJ A;  1AA7 A;  4XKV A;  3L2V A;  4C2U A;  3MKY B;  4ZDO A;  2HPI A;  4XKB A;  3BLY A;  2R7R A;  4R79 A;  3H5N A;  5JHF A;  2W7N A;  3KYL A;  4HST A;  3RPU D;  2ZXH A;  3LSH A;  2M4G A;  4U87 A;  3OYA A;  4AYB A;  3DPU A;  3OYJ A;  3EPZ A;  4C30 A;  2R7W A;  3K70 D;  3H5A A;  3MKW B;  3BG6 A;  3OL4 A;  2FUG 2;  4X0G A;  4E7H A;  2K5C A;  2ZFU A;  4BGD A;  1BR4 A;  4HSR A;  1V5F A;  4XN3 A;  3DWL E;  3I9V 2;  4GRI A;  1N77 A;  2UV1 A;  4ZDP A;  2M4K A;  1MNE A;  4CSW A;  3LMM A;  3PSI A;  3CP2 A;  2A6T A;  2VJ4 A;  3PNT A;  4BQN A;  2DOA A;  2W4S A;  1N78 A;  4F3Q A;  4E7K A;  3EUH C;  3OIP A;  1HA8 A;  3PSF A;  2AQF A;  1ZEL A;  1WJB A;  1TT0 A;  4BEH B;  4C9Y A;  4BE2 A;  3OIQ A;  2LG4 A;  4PFP A;  3CES A;  3L2R A;  4CH7 A;  4FAS D;  4OAY A;  3VYR B;  4YEL A;  4E7I A;  2LC2 A;  4G6T B;  3K4K A;  1WJD A;  3OL3 A;  4XOP A;  4CCN A;  3D5L A;  3M1C A;  5TGT A;  4CCO A;  4NC7 A;  1BR1 A;  4P5O A;  2K9M A;  1MMD A;  1MMN A;  4B43 A;  3HL2 A;  3CJR B;  2V7F A;  1Z3X A;  2F5V A;  1WJE A;  3MD2 A;  4CUG A;  1OLT A;  2DCE A;  2L7K A;  4RLQ A;  2UWM A;  2XAU A;  3LSI A;  3I3L A;  3M8J A;  4OWR B;  2MD0 A;  2DT7 B;  2X1D A;  4XM3 A;  3TBI A;  4BE1 A;  3DU5 A;  4AU7 A;  2VQC A;  4F91 B;  2X6W A;  4BQO A;  2VLA A;  4EAT A;  3CMM A;  1QHG A;  3C2G A;  4BE0 A;  1D1C A;  4FET A;  2IGK A;  2M3A A;  2Q1Z B;  4IQJ A;  3OYH A;  4CCK A;  5HNH A;  4KIS A;  3VSL A;  4PJL A;  1EA3 A;  3ONQ A;  2JVG A;  3HOS A;  2XC7 A;  2R7X A;  2LBF A;  1X1D A;  4DBQ A;  4II3 A;  1DQU A;  3KX2 A;  1SAU A;  3SEQ A;  3S32 A;  2P0W A;  2HQA A;  1G8X A;  4XLE A;  2VXD A;  2IXS A;  3A1Y A;  3EUA A;  4XKW A;  3DLA A;  1TZL A;  3LL7 A;  4PK4 A;  3BG7 A;  3PFY A;  3OYM A;  4ZTF A;  4XR6 A;  1V5G A;  4XLF A;  2VKD A;  4NQW B;  3CJQ B;  2BW3 B;  4IZZ A;  4XLA A;  2V26 A;  4BJ5 C;  2KLO A;  4QPO A;  4E6K G;  3RSN A;  2KQR A;  3HPG A;  4XON A;  2VKH A;  2VJJ A;  4YEJ A;  5KHD A;  4NUB A;  4NNJ A;  2IS2 A;  4ITV A;  2KL4 A;  4BU2 A;  2X6X A;  2JVH A;  1D0Y A;  4XN0 A;  4KT6 A;  4HRI A;  4XNF A;  3H5R A;  3ZXS A;  4HNT A;  3NWT A;  5CQG A;  3DU6 A;  5HLT A;  3K4N A;  2MC4 A;  5CQE A;  2E5N A;  2XDV A;  3D5R C;  2V6E A;  4JOM A;  2PMZ A;  4ANJ A;  4BQQ A;  4HG2 A;  4BS9 A;  3AKZ A;  2X1C A;  3K4C A;  2CFO A;  1N75 A;  2RRE A;  1T95 A;  3OS0 A;  3PUB A;  3FDY A;  3FBN B;  4BUP A;  3VYU B;  3DKY A;  4XQF A;  3FHN A;  3VYS B;  2R4G A;  2PJR B;  3K6G A;  1YX3 A;  2LOO A;  2WBM A;  2KDO A;  5FRO A;  3AL0 C;  3HC7 A;  3HUG B;  2Z1D A;  2OV7 A;  3ZCO A;  2CUZ A;  2LY1 A;  4JQF A;  1WFX A;  3OY9 A;  4BDZ A;  2R7O A;  2KMU A;  4HPQ A;  2VAS A;  2KRH A;  4Y3O A;  4KJZ A;  2VB6 A;  1V5E A;  2MYS A;  3SZG A;  3OYB A;  3DPL C;  3QOE A;  1Z3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...