2DK5A

Solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Winged-Helix domain in RNA polymerase III 39KDa polypeptide
rcsb
source organism Homo sapiens
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
total genus 14
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk5A01
3ELKA 5FB2A 1XGOA 1PP8F 2W84A 3HIFA 2LNBA 1O3SA 1IRGA 4KDPA 4K2EA 4AIHA 4OIPF 4HDUA 2NNYA 5BMZA 1O7FA 2HWVA 2B0LA 2FBIA 2JZYA 1FY7A 2R7DA 2CGPA 1DP7P 1AWCA 3TOBA 1BIBA 4U7DA 3EQLF 2CQKA 2OU2A 1B9MA 2M30A 1LDKB 2FEZA 3Q9SA 3V8LA 1XDUA 4AIJA 2RKHA 2P8TA 4PGGA 1TTYA 2DQRA 4ZZLA 2W57A 4YFNF 1FNNA 2P5KA 3ABTA 1HSJA 4Y15A 4I2OA 1R1TA 1W5SA 2NYXA 3C18A 4N0BA 2ZKZA 3COAC 1DPUA 1P4WA 4ENKA 2PN6A 2W24A 3TO9A 3WGHA 1JE8A 1QGPA 4AD9A 3ZMDA 2IA2A 5E1ZB 2HYFA 3E3VA 4IHTA 1FPQA 3WU0A 2P5VA 4BH9A 3NRVA 2ZNZA 3BPXA 1WKMA 5AIPA 4HA8A 2PG4A 1TNSA 4LB6B 3QOPA 5HLIA 4Z2YA 1O3TA 2PLYA 4ENNA 4UXNA 2VBWA 1S7OA 5EEHA 4KIBA 5LHGA 1LB2A 4L18B 4HF0A 3J7AO 5DDGA 5F64A 4L9JA 4L9VA 4LJZF 5FLXZ 1T6SA 1PUEE 1L0OC 2OD5A 2R7FA 4GO1A 3WGGA 4OMZA 3F72A 1BIAA 2Q2EA 4M6XA 1TBXA 2FOKA 2CWEA 1MD0A 1IN6A 1ULYA 1FYMA 2EFOA 2DW4A 3SHFA 4A0XA 5D4RA 1BM9A 3F23A 2IP2A 2UZKA 3I4PA 3WE2A 2NRAC 1J59A 1D8JA 2GXGA 1YO5C 3TDZC 4U0VA 1FBSA 5K1YA 4DQ2A 4A0YA 5H20A 1BN5A 5ILVA 2VT3A 2BBYA 3JTGA 3P9CA 1F9NA 2HKOA 2VBYA 2RV8A 4DNCA 5D5XB 4QWQA 3EYYA 4LFUA 4ZYGA 2YX7A 3FMRA 3FX3A 2DI3A 5JHUA 2L3DA 3E6CC 2MA3A 2UXXA 5D8LB 3R6SA 2HOEA 1LEBA 2EA4A 5HVQC 4HDVA 5A2QZ 4BHBA 5D5UB 3FMQA 3MCZA 2K4BA 1J5YA 1P92A 1HKSA 2XVCA 5CVJA 2VXZA 1R36A 5LEJA 2Z3YA 4XLNF 3RIRA 1G3WA 5F1RA 4EMSA 3BZ6A 3RYPA 3SZTA 5ICCA 4EQQA 1ZH5A 3IKTA 3AAFA 3ML6A 4OMYA 2HZTA 3PQKA 2DU9A 3R0AA 3M1EA 1MDMA 1KYWA 1U8RA 1S7AA 5CJ9A 2O03A 2F5FA 4A2UA 1FX7A 1XCVA 1U6GA 5L3DA 4I02A 5HLGA 3QPTA 2STTA 4G6QA 3I54A 1R5HA 2XRNA 1G3YA 1WWXA 1Z91A 1ZGJA 3HSFA 4UV9A 2CSOA 1W7PB 2GIVA 4BAYA 3BWGA 1TW2A 2LF8A 1PP7U 4HAMA 1OYIA 3CTAA 2A3SA 1FSEA 2L01A 2XGXA 3HHGA 1O3RA 1KU2A 3TDUC 3I64A 1P4XA 4RGUA 4IXAA 1T38A 4ETSA 3RI4A 5BOXA 3VB2A 5JI6A 1UHMA 4IHSA 3IWFA 4TV7A 3GWZA 1XGMA 2OZUA 2BYVE 4L5IA 1MKMA 1MGTA 1Z6TA 5HOOA 3K1MA 4BXUA 4G7ZF 4KFCA 4RGSA 2VE9A 4P55A 2QLZA 3P9KA 2MD5A 4HOBA 4WXCA 4EJUA 2HDCA 1KGSA 2KRFA 2XKOA 3BPVA 5CYVA 1XDSA 5K5OA 1QBJA 2BV6A 2QM3A 3E5QA 5DUIA 3GLXA 4HQEA 2X4HA 2ZMEB 2H27A 2OAZA 1FZPB 3K1NA 3FXRA 2YPRA 3SFZA 2QQAA 5CVVA 2EV0A 4R79A 2PJPA 4PZJA 3GUDA 3M8EA 3TKYA 2P6SA 4OIRF 2QBYA 1J0RA 3DP7A 5ILUA 4KMFA 4G7OF 1XD7A 4G6DA 1LNWA 3V8KA 2FU4A 3BDDA 1TW3A 5BPDA 5FGMA 2H6BA 2ACJA 2ETHA 4LMYA 4P9UA 3REOA 1I1SA 5DYMA 3D5LA 4RB2C 2G7HA 4A5NA 2M1BA 1KU9A 1LVAA 4YG2F 3I5UA 3ECOA 1FBUA 2PMUA 4HF1A 1IN7A 3LAJA 3CLOA 2OBPA 2KIMA 2DT5A 3K0LA 5ICFA 1LJ9A 1BBYA 4KMUX 1HKQA 2K27A 2JPCA 2JT1A 3KP7A 4HZFA 3HTUA 4ASNA 2GQQA 4YFKF 1OYWA 2XROA 1REPC 3V4GA 4G8XA 1LDDA 3KZZA 2KIFA 5FD6A 3I59A 4RGXA 3KZYA 1B4AA 2FF4A 1GVJA 5EEGA 2OQGA 3CDHA 3ISPA 1XSDA 1Z7UA 1A04A 3I59B 5IT3A 1ZN2A 2Q8KA 5JR3A 1Z1DA 1F1ZA 3ZPLA 3FF5A 1ZG3A 1IN4A 2Y75A 2FA5A 3LFKA 2MLKA 4WCGA 2E7XA 4U0WA 3WGIA 1S3JA 5LGTA 2C6YA 2QUFA 2VONA 2YU3A 2EFQA 2IW5A 3H92A 1NHAA 4Y17A 1K6OA 2FE3A 3RPQA 3T1BA 4G9YA 4N9HA 1S6LA 1QPMA 4ZYHA 4EGYA 1SD7A 2QQ9A 2A69F 2QYOA 1QQIA 4EJWA 2GXBA 4WWCA 1YS7A 4XSZF 2PBIA 3MZYA 4BQAA 4YIFA 1J75A 4ZZDA 5A2QK 3IHUA 1Z05A 1Q1HA 4ZYEA 4I7HA 1PDNC 2OZ6A 2JRTA 2ESHA 1YYVA 1U5TB 2E1CA 1J7KA 3HHHA 4WF2A 3E6BA 1T0FA 3T5XA 2A6EF 2ADUA 3E6DA 4Q4ZF 5HDGA 3OOPA 3CUQC 2EFNA 1K7AA 1JHHA 2H09A 4EV0A 4GXOA 2QWWA 4CXFA 3T8TA 4EM1A 1WI9A 2HR3A 4GYIA 3ZMTA 4RB3C 2VOOA 3DKWA 5HS7A 2Z99A 2IT0A 1ZRCA 1FP2A 3IC7A 3HOSA 3K69A 4OU0A 5LLQA 3KCCA 1MDMB 2HS5A 3RDIA 3W6KB 5ED4A 5E8IA 4U7BA 5KK1A 1DPRA 5LEKA 2Z9OA 5DEQA 3GVAA 1MJAA 3M8FA 1HBXG 4YIIA 4ZYDA 3ZP5A 5CVIA 3F3XA 1IXSB 4IJAA 2CW0F 1UFMA 3F8FA 2DK8A 2RQPA 4O3MA 1V3FA 3N4MA 4M71A 3HRTA 3C3WA 3FWEA 1RIOH 2ZXJA 3F22A 2UWMA 2L4MA 1RI7A 3BOQA 1U5TA 4I0BA 4OIOF 2BEOA 2DBBA 3GF2A 4D0PA 1EH7A 1GXPA 2FSWA 1MJBA 1SFUA 1JXSA 3RKYA 3LA2A 3G73A 3O6BB 2P5LC 4MEXF 2IPQX 2V79A 2FNAA 4L9NA 4XSXF 1R23A 4YFXF 4BNCA 3F8BA 3U1DA 4RAZA 4NB5A 3F21A 2MH2A 4A6DA 3ZMVA 4L9TA 5D5VB 4BYYA 2GA1A 1W7PA 4CGZA 2Z5UA 2COMA 3P7NA 4UVCA 5L3CA 1FC3A 3FXQA 2K02A 2V9VA 1F4KA 5ICGA 2HTJA 4MEYF 1TLHB 2VC0A 4Q47A 2Q0OA 2M8EA 5HDKA 2ZO4A 4S05A 1K78A 3LSTA 5K5RA 4EJVA 2W25A 3RTRA 1ZG1A 1Y0UA 3RKXA 2ZNYA 2H6CA 1ZRFA 4I98B 3V7RA 2BGCA 4KNYA 1KU3A 5IT9Z 2L54A 4LK0F 4MNUA 4LK1F 2VODA 2G9WA 2F5CA 3QRFF 4M72A 2VC1A 2RDPA 4P9FA 3S2WA 1FOKA 1ODDA 4HLYA 1I5ZA 1SAXA 1G6NA 1BI0A 1G4DA 2IRFG 2EFPA 1B9NA 1EH8A 3R4KA 2HQRA 1T39A 1ZHFA 1FYKA 2EV5A 2ZJ2A 1SMYF 2F5EA 2P7VB 3GX4X 3HUGA 3WU1B 1D8KA 2JTVA 4L5JA 1CF7B 1LEAA 3Q5FA 1FWZA 4LGWA 4M9SA 4KA4A 1USSA 1Z6RA 3J81K 2VOPA 3ECHA 3BJOA 4MGRA 4AWXB 2QENA 1I1GA 2LKPA 4IRIA 3LQRA 1D5VA 1XGSA 5E18F 4RAYA 4CHUA 3JSPA 3TO6A 2XHKA 4O5VA 1KU7A 5HLHA 3B73A 4GCVA 5LRRA 2JSCA 2VT2A 4EVIA 5TRDA 4R1HA 3GXOA 1JGSA 5LHHA 3VEPA 2FMLA 3KFWX 1X3UA 1J2XA 2IA0A 3V8JA 2YX4A 1XGNA 1CGPA 3DPTA 4M9XA 1GXQA 2VE8A 3TQNA 1XMAA 3GFIA 2Y0MA 4HLXA 4XRFA 1P6RA 3RJPA 1QO0D 2HTSA 3ZQ7A 1ZGAA 4AVPA 3RKWA 1HW5A 2K4JA 1QZYA 3DEUA 1TNTA 1UCRA 1R58A 3F8MA 2VN2A 1IN8A 2E7WA 3R60A 1B1BA 4UNOA 1W7PD 1SFEA 3L2CA 1SD5A 1ZRDA 1ON2A 1G3TA 2XIGA 5DCMB 2ZFWA 3M9AA 3D0SA 4AIKA 4N9IA 3LWFA 2RNJA 1UHWA 4G7HF 4UV8A 4HX7A 2A5YB 2FBHA 3FXUA 4IVNA 1BC7C 2IVMA 4WXDA 2HEOA 4KUMA 4KIGA 5E1WA 4HV5A 2D1HA 5CLSA 1UB9A 2DQLA 3OV8A 2BE5F 5TJJA 3SQNA 2RC4A 3VODA 5LBQA 4KN7X 3E5UA 3RYRA 3R61A 4LB5A 2P6TA 4KT5C 5E1XA 3DQVC 3TOAA 3E5XA 3EDPA 2XAFA 5K5QA 5FFXA 1R7JA 5H6RA 3U2RA 1BI2A 4RS8A 3JSOA 3EYIA 3L09A 2J5OA 1YS6A 1OPCA 2FRHA 2A07F 3MWMA 5D5WB 2ZBKA 1IRFA 1WRJA 2PMHA 4JK1X 3KP4A 1XMKA 3VFZA 1U5TC 5ILSA 4O6JA 1RZ4A 5L3GA 2O61A 2CO5A 2KIUA 3BJAA 4A12A 2KKOA 3BJ6A 4P5OA 5J8CA 2ISYA 3T8RA 3LAPA 3GFLA 2HQNA 1OR7A 2D1VA 2OA4A 3PQJA 1LQ1A 1R22A 3KLOA 1O7LA 1XCBA 3Q9VA 2O3FA 4BHCA 1SD4A 4EJTA 1OMIA 1QZZA 3BROA 3U9GA 1RUOA 3QP5A 4ESBA 1ZARA 2PFBA 3DXJF 3DV8A 1HKTA 3I0TA 4NQWA 2F5DA 1FLIA 3J80K 1KQ8A 3PFIA 4HW0A 5E17F 2LF7A 3KETA 2FXAA 3VOEA 2WC2A 4G94A 5JFRA 4BHPA 5HS8A 3ABUA 4A0ZA 1FSHA 4A5MA 4ESJA 3ROUA 5DCFA 3JAMZ 3MAJA 4FHTA 1P4AA 4I09A 3RPUA 4CICA 2PI0A 1GHCA 1JHFA 4RB0A 1IAWA 4UVBA 3LA7A 2QVOA 4HBLA 3F8CA 1SD6A 1Z9CA 4MQVA 3DPLC 2A68F 2YSRA 4RB1A 3DFGA 1YTYA 1QNTA 2M45A 4MQ9F 3HRUA 4HV6A 3GO5A 5FFZA 5BPIA 2HKXA 5LGNA 1TQPA 1G3SA 3BP8A 2GAUA 2XAJA 1SMTA 2Z33A 1TQMA 1DDNA 3L9FA 3WTXC 3NQOA 3WTZA 5JVTA 5E8GA 3ZMZA 1HQCA 1S8NA 4WXHA 2EWNA 5BQTA 1YQAA 2X0LA 5DUKA 2UXNA 4Q48A 4UVAA 4ZH4F 2L02A 4GYGA 1J9IA 1BJAA 3F6VA 2AS5F 2WV0A 3MEXA 2VBXA 2V1UA 2A6HF 4F7ZA 2DPUA 4ON0A 3CUQA 4ESFA 3KEQA 2P7CB 4A6EA 1MZBA 1V4RA 2O6GE 2CFXA 3O2PE 2W85A 2XV4S 4HQMA 1R1UA 4MHGA 2K7LA 4EGZA 4E70A 3GEZA 3IWZA 3E97A 2L4AA 5AONA 2CG4A 3H3ZA 1P2FA 4JQFA 3W6JB 1IN5A 1ZAOA 2H94A 3DF8A 1T2KA 2V1XA 3GW2A 4M74A 3LA3A 4OINF 1B6AA 3L00A 3F8NA 2D45A 1HSTA 1XSVA 1YW9A 1L3LA 5J6XA 2GWRA 3TGNA 3WTTC 5IT9K 1KA8A 2XAHA 1AOYA 3CUOA 1H9GA 2JPBA 2P4WA 1SFXA 1YG2A 3N97A 3J80Z 1WSUA 3HYIA 2NS0A 1XSXA 3SZPA 3FMSA 1IXCA 4UHTA 1EH6A 2WTEA 2PEXA 4IF4A 3WTSC 2HGCA 4WK8F 3NEUA 2RN7A 3ZMSA 1TQIA 3IRQA 5F6FA 2XKPA 3KEOA 1ZG5A 2GA2A 4LG0A 3O3KA 4M9ZA 3IRRA 4IRGA 1E2XA 4LD5A 1YW8A 4IPAA 3HSRA 3JW4A 1HW2A 3GFMA 3WTWC 4M73A 3ZN1A 2PQ8A 3IKVA 1I27A 3L7WA 2LDUA 4B8XA 1R5GA 1IF1A 1VTNC 2J5PA 2O8XA 4KICA 1U3EM 4HX4A 3CUQB 2EA2A 2ZMEA 1IZ1A 4GGGA 3FHZA 1YLFA 5CVRA 2M87A 4CZZA 1OKRA 2FQ3A 4HX8A 4NHJA 3C1DA 1RNLA 2ELHA 5AIQA 2F2EA 2OQRA 3WG9A 3QAHA 4EM0B 3J81Z 3FZVA 2RVCA 4LLNA 2NAZA 5FO5A 5FLXK 2K86A 5DCMA 3H3UA 3HTSB 4JBAA 3CO6C 4ENJA 4R8HA 2DK5A 2KJCA 1BI1A 2FNPA 3M7GA 1FYLA 1OYYA 5LGUA 2XAGA 5J8FA 3GZ5A 1KQ9A 5DD8A 1BI3A 4FT8A 5E20A 2O0YA 3WE3A 4L0ZB 4B09A 1U2WA 3EUHA 1O57A 4XLPF 3QP6A 2QQBA 2MC3A 1RUNA 5CVUA 4EJOA 4Q5SF 2M5WA 4HYEA 1ZLKA 1IW7F 1LDJA 3I71A 4PCQA 2CYYA 4IRHA 2WWYA 2Y48A 1ZLJA 3WTYC 1ONVA 5D6EA 1WQ2A 4M6YA 2MLGA 2R3SA 1E17A 2LSOA 5LRSA 3HOTA 4MTEA 1YFHA 4XBFA 3JTHA 2EFWA 4LG0B 2EB7A 5KVRA 3V7CA 3ZMUA 1STZA 1I6XA 1ZYRF 2GZWA 3ERED 4I01A 1YIOA 5L3BA 3F6OA 3MQ0A 2DFIA 3GZ6A 1D3YA 3FM3A 4U88A 5HS9A 3GYHX 2RGVA 2ISZA 1XN7A 4U0YA 3G3ZA 5HDNA 3V7SA 3KP2A 3ULQB 2XASA 3B02A 4KN4X 2XUBA 5FD5A 2EV6A 4QLCU 1H0MA 1FT9A 1T98A 3EETA 4RGRA 1H9TA 4LLLA 3GFJA 2YR2A 1B59A 1IUYA 3TO7A 3BY6A 3SXYA 5D8KB 2ESNA 3QU3A 2HYGD 3MFKA 1BC8C 3KP5A 4L0YB 3QPHA 2STWA 2QZ8A 3LQQA 3KP6A 3I53A 2E1NA 3CO7C 2IJLA 2NNNA 3K2ZA 4P96A 1O3QA 4CDGA 3HRSA 4PDKA 5L3EA 3QU6A 1W5TA 2DPDA 5LHIA 4I0AA 2D2WA 4H0EA 4S04A 4OOIA 4FX4A 2A61A 2QBYB 4HF2A 4WX9A 4UUVA 4EM2A 1KQ0A 2ZCWA 5D4SA 5ICEA 2AXLA 1YW7A 1U78A 1FP1D 1USTA 2MBFA 1FBQA 4CYDA 3K9TA 2FMYA 2HFHA 1CF7A 2IA1A 1KYZA 2XAQA 3KE2A 5DD4A 4KIFA 1BOAA 1MJ9A 1K79A 3HRMA 4PGHA 4MTDA 2FBKA 2TDXA 3FM5A 2DTRA 2DLLA 1K78B 3JAMK 3R0JA 3T0YA 3K1PA 2DAOA 2G7UA 4OIQF 5D6FA 5L3FA 3WTVC 1XB4A 5H6QA 2V1DA 1EV7A 6PAXA 2VBZA 3IL2A 4FX0A 4CO8A 3KP3A 3E6MA 4ENMA 1S29A 3CJNA 1F5TA 5DV5A 3WODF 5ERIA 3KLNA 1ON1A 1IXRC 3HSEA 1R00A 2MH9A 2EJRA 4Y13A 3I58A 1C0WA 3P9IA 2V6CA 3ZN0A 1ZREA 3C7JA 3MZHA 2DO7A 1HXDA 1R1VA 3WTUC 2EK5A 1W4MA 4LLGF 1HW1A 1DUXC 2KJBA 4KYWA 5BS6A
chains in the Genus database with same CATH superfamily
1AA7A 3ELKA 5FB2A 1XGOA 1PP8F 4DZPA 2OV7A 1IGNA 4E7JA 3GTMJ 4J01A 2W84A 3HIFA 3S14J 1TWFJ 4A3CJ 1ETOA 2HI3A 2LNBA 1O3SA 1AKHB 1IRGA 2OPTA 4KDPA 2Z2SB 1W0TA 4K2EA 3MMYB 3K70C 4AIHA 3H36A 1VNDA 1VQ4I 1TT0A 3FKIJ 3IAS2 2HDDA 2V6EA 4OIPF 2M3AA 2HOSA 4HDUA 3S1RJ 2WBMA 2MD0A 2DOAA 1W36C 2NNYA 5BMZA 1O7FA 4PK4A 2E1MB 2HWVA 4BY7J 2B0LA 2FBIA 2JZYA 1OCZH 3AG2H 4BQNA 3CMMA 4IO9F 1OQYA 3TW6A 2Y0SA 1FY7A 2R7DA 3FK7A 2CGPA 3HC7A 5EG0A 5FRMA 3FHNA 1DP7P 3FXJA 1AWCA 4Y33A 3TOBA 1BIBA 4U7DA 3EQLF 2FD5A 4MLOA 3L2RA 2GLOA 3SYTA 2CQKA 2OU2A 3JRGA 1B9MA 2RNGA 3CP8A 2M30A 1LDKB 5EDNA 3ERMA 2FEZA 3Q9SA 3V8LA 2EINH 1XDUA 4AIJA 2XSDC 2RKHA 2P8TA 3HZJA 5GTHC 2R7TA 3N05A 3K6GA 4PGGA 3DKYA 2L9RA 2ZMEC 5J3LA 2W1OA 1TTYA 2DQRA 4ZZLA 2W57A 3VSKA 2GM4A 3M8JA 4YFNF 3E0JB 1FNNA 2Y30A 1RESA 2P5KA 3ABTA 1HSJA 5FKKA 2L9VA 3G1MA 4Y15A 5EG0B 2R7UA 3O8GA 3LL7A 3W2WA 1R5ID 4I2OA 2XGEA 4IHVA 1R1TA 4C3IJ 1W5SA 4A3FJ 3CCVI 1LPQA 3HOUJ 4UB8C 3BLYA 2NYXA 3C18A 2CUJA 2ZKZA 4N0BA 3COAC 1DPUA 1P4WA 1LVKA 2JVGA 3LSMA 1KONA 2Z1DA 2VUMJ 5M5XJ 4ENKA 2PN6A 1X1CA 1Y1VJ 2W24A 1IRXA 4JX6A 3D1NI 2O9LA 4LIUA 3TO9A 3WGHA 4BE2A 1JE8A 1B8IB 1QGPA 3VPRA 1WJBA 3H5RA 4AD9A 2WY7Q 4XK4A 3ZMDA 4B4CA 5B66C 2IA2A 5E1ZB 5GTIC 5FLVA 2HYFA 3E3VA 3CMAI 4IHTA 1FTTA 1FPQA 3BG7A 3WU0A 1HC8A 2DA1A 2P5VA 2X1EA 2BZTA 4BH9A 3NRVA 3PSFA 2ZNZA 3BPXA 3L1PA 1WKMA 5AIPA 2VKDA 2BY0A 4HA8A 3JRBA 3WHCA 3MKWB 1BA5A 1W0UA 2PG4A 1TNSA 4LB6B 3QOPA 5HLIA 4Z2YA 1O3TA 1V5FA 2O7OA 2PLYA 3S2HJ 4ENNA 4UXNA 2VBWA 1GV2A 3CDIA 3PNYA 5B1BH 1S7OA 4XR6A 5EEHA 4KIBA 1W36D 3G1OA 5LHGA 3HPHA 1LB2A 4L18B 1ETXA 4HF0A 3J7AO 5DDGA 5M5WJ 5F64A 4L9JA 1OCCH 2DJIA 2K3FA 1ETWA 1ERDA 2XAUA 4L9VA 3Q0VA 3TW7A 3OS2A 4LJZF 4G6TB 5FLXZ 2EPFA 2ICWG 3OSFA 1T6SA 3U21A 1PUEE 1L0OC 2OD5A 3EUAA 5IP9J 3RSNA 4B44A 5FLMJ 2R7FA 4GO1A 5E3LA 3WGGA 1VQ9I 3I55I 3S1MJ 2DMUA 4OMZA 1VZ0A 1B72A 1I3AA 1V5EA 3F72A 1BIAA 2Q2EA 4M6XA 5J4YA 1TBXA 2FOKA 2CWEA 3K7AJ 1MD0A 3LSPA 4XKWA 2B63J 1PJRA 1IN6A 3LSKA 3ZOBA 1ULYA 2X6WA 3QPSA 3A01A 3A0HC 4E6KG 1X2NA 1FYMA 1ITYA 2EFOA 2DW4A 3SHFA 4CYCA 3A2KA 1GVDA 4A0XA 1D1BA 2FOWA 1RPWA 1MH4A 2V4JC 2FX0A 5D4RA 3J7ZI 1BM9A 3F23A 1YJNI 2IP2A 3CCLI 2W4SA 2UZKA 1NTCA 3FXOA 3I4PA 2DCEA 3WE2A 2DJNA 2NRAC 2E60A 3F9KA 1J59A 2NS8A 3G2BA 4JYKA 4II3A 1D8JA 2Y9YA 2GXGA 1YO5C 2L7FP 4BXXJ 3TDZC 2R7SA 4U0VA 1FBSA 4IEJA 3DCFA 3DEEA 3PNVA 2O8KA 5K1YA 3E1SA 3CMYA 4DQ2A 4A0YA 5H20A 3OS1A 4V19K 3H9QA 2OC6A 1BN5A 2EZHA 5ILVA 2VT3A 2L2OA 2Z16A 4CA0A 2LP0A 2BBYA 3JTGA 3P9CA 1F9NA 2FQ4A 2HKOA 2VBYA 2RV8A 4DNCA 3H5NA 3VWBA 5K7FA 1Z7LA 1ZR2A 2EIMH 2DA3A 2E71A 3FBNB 5IP6A 2XF7A 5D5XB 4CYCB 4QWQA 3EYYA 4LFUA 4ZYGA 2YX7A 3FMRA 5KHDA 3FX3A 3SFIA 2DI3A 5JHUA 1JKQC 2L3DA 1BR4A 1WCMJ 3E6CC 3HKZN 2MA3A 1WJ5A 2UXXA 3H0DA 3OR1C 5D8LB 1UG2A 3R6SA 2BY3A 2HOEA 3VYSB 1LEBA 2EA4A 5HVQC 4A3EJ 3BR1A 4XN3A 4HDVA 5A2QZ 4HNUA 4BHBA 3BZKA 5D5UB 3FMQA 3L2VA 3MCZA 1IC8A 3BTJA 2ME6A 2K4BA 3DU6A 1NK3P 1J5YA 1P92A 3TBIA 3HOXJ 2M34A 1HKSA 4BY1J 2RQQA 2XVCA 1HF0A 1WJEA 1MBJA 5CVJA 3JRIA 2HVQA 3MKLA 3OYAA 2VXZA 3ABMH 1R36A 1ZELA 2QKLB 3BCAA 5LEJA 2H8RA 1N75A 2Z3YA 1R71A 3S1QJ 4XLNF 3RIRA 2R5YA 1G3WA 4CUGA 5F1RA 5J4VA 4EMSA 4DBQA 2OTLI 3BZ6A 5E79C 3LMMA 3GTJJ 3RYPA 5C44J 2KP6A 3SZTA 5ICCA 4EQQA 3LSJA 4XORA 1VQ7I 1ZH5A 1N25A 4JOMA 3IKTA 3OYFA 3AAFA 3ML6A 1U8BA 3AL0C 2COBA 4OMYA 2HZTA 5JLWA 3PQKA 5EF6A 2E5NA 2DU9A 3R0AA 2QKMB 3M1EA 1KYWA 1MDMA 1UMQA 1U8RA 5DTDA 5KAIC 1Z0XA 3OL4A 1S7AA 5CJ9A 2O03A 2F5FA 4GFBA 4UUSA 4A2UA 1FX7A 1XCVA 1U6GA 4IOCF 2IGNA 5FJ8J 5L3DA 4I02A 3OYCA 5HLGA 5C3EJ 3MN2A 3LSIA 3QPTA 3BC8A 3HGGA 3PM1A 1D1CA 4D5FA 2EZKA 1R9TJ 1JJ6C 3SJMA 2STTA 5H2FC 4G6QA 4Y3OA 1B8IA 2KISA 2F4IA 1JUSA 3I54A 1R5HA 1A36A 2XRNA 2DXIA 1G3YA 5EGOA 1WWXA 4A3DJ 3PIPF 1Z91A 5IY5H 4KT6A 1JTXA 1ZGJA 3TMOA 3HSFA 4UV9A 1MNMC 3BR3A 4M3FA 2CSOA 1W7PB 1X19A 2GIVA 2WAFA 4D1QA 4Y7NJ 4BAYA 3BWGA 2Y31A 1TW2A 2LF8A 4HSRA 1PP7U 2JWTA 4HAMA 1OYIA 4XLCA 4IL6C 3CTAA 2A3SA 2W48A 5C4JJ 1PUFA 3NWSA 5IOYA 1FSEA 2L01A 2VJ5A 3DBRB 4BUPA 2HQAA 2XGXA 3QYBA 5TISC 1DGWY 2AHQA 3HHGA 3CCSI 2EH3A 1KU2A 1O3RA 3TDUC 4X1EA 1TP4A 2ZSIB 1X3WB 3I64A 1P4XA 3FBIB 4RGUA 4X0GA 4RM3A 4IXAA 2LMDA 5HNFA 1OFCX 1T38A 4ETSA 3RI4A 5BOXA 3VB2A 5JI6A 3D5RC 2LD5A 1UHMA 4IHSA 4XN0A 2VKVA 3IWFA 4TV7A 3GWZA 1XGMA 3AL0B 1U9NA 1Z3XA 2PX9A 3HJEA 3OYHA 3RZOJ 2OZUA 2BYVE 4L5IA 1RR7A 1MKMA 3OIQA 1MGTA 2R7WA 1OJLA 1V5GA 1ZTRA 2VPRA 2IS6A 2E2HJ 1Z6TA 1FTZA 5HOOA 2NVTJ 4A3BJ 3K1MA 2Y69H 4BXUA 4G7ZF 4KISA 4KFCA 4RGSA 4BE1A 2VE9A 4P55A 2QLZA 1R4NB 1OCRH 2BW3B 4PJ0C 1EJ9A 3LSGA 1WPKA 3P9KA 1XTAA 4DYRA 5HNHA 2HXOA 3G6EI 2MD5A 4HOBA 4WXCA 3BG6A 1NG6A 4EJUA 2HDCA 5J1RA 3HDDA 2VPLA 2IAIA 3OYLA 1KGSA 2KRFA 2XKOA 5DM7F 4XRSG 3BPVA 5CYVA 1VQKI 1XDSA 5K5OA 1QBJA 1BR1A 3EUKL 4Y4RA 2BV6A 2QM3A 3E5QA 2K9LA 1X1PA 3RPUD 3MZ8A 1OISA 5DUIA 3G4SI 4NUBA 4F92B 3GLXA 4NC7A 4HQEA 2QA4I 1A31A 1WJCA 1S72I 1E3OC 2X4HA 2ZMEB 2H27A 2CFOA 2OAZA 2X1DA 2VQGA 1FZPB 4FE7A 1WJAA 1IJWC 1M1EB 2ZJRF 3K1NA 1W5CC 2LKXA 3FXRA 2YPRA 3SFZA 1SVMA 2LR8A 2QQAA 3JRAA 5CVVA 1Y8QB 3CCQI 1UAAA 2EV0A 2M4GA 4R79A 2LY9A 2PJPA 4PZJA 4W97A 3GUDA 3M8EA 3TKYA 5GADJ 2P6SA 3SEQA 4OIRF 2QBYA 1J0RA 3DP7A 5ILUA 1EA3A 4E7LA 4KMFA 4ZDOA 2E36A 3FXMA 3HBLA 4G7OF 1XD7A 4BACA 4G6DA 1PVEA 1LNWA 3V8KA 2FU4A 4UUSB 4QIWN 3WU2C 3BDDA 2JK3A 1X4PA 2XF5A 1TW3A 5BPDA 2CW8A 2LTPA 5FGMA 3FISA 4XMYA 3I56I 2TCTA 2H6BA 4PSWA 2ACJA 2ETHA 1HDPA 1WGXA 4LMYA 4CZCA 3I3LA 2XRLA 4P9UA 2IBDA 2DA5A 5EZHA 3REOA 1I1SA 2CV0A 5DYMA 3D5LA 9ANTA 4RB2C 2I5UA 4HRIA 3K4CA 2G7HA 3QYFA 4A5NA 3U1KA 4E7ZA 2NOJB 4XRMA 4MFDA 4D7MA 3BG5A 2M1BA 5J1YA 2K40A 1DU6A 1YITI 1KU9A 3S16J 3A01B 1LVAA 4YG2F 3UR3C 4XOTA 1RRJA 3I5UA 3ECOA 1J09A 4IHWA 1FBUA 2PMUA 3HKZA 4HF1A 4BU2A 1IN7A 1N78A 3X2QH 3LAJA 3CLOA 3QYEA 5FKLA 2KLOA 3HM5A 3OYBA 2OBPA 4E7HA 2KIMA 2LH9A 2DT5A 2V9KA 3K0LA 5FKNA 4EEFG 5ICFA 3OYKA 3OMYA 3TL4X 3SDBA 1LJ9A 1BBYA 4KMUX 1HKQA 3ASOH 3M3YJ 1VQPI 3CDLA 3VDXA 4JX5A 4B3AA 2K27A 4XKVA 2JPCA 1WH5A 4FISA 5C4XJ 2JT1A 1V54H 1X3ZB 5EEAA 1Y0NA 3KP7A 4HZFA 3GCMA 3HTUA 4ASNA 2GQQA 3AG1H 1D0YA 4YFKF 1FOWA 3W6VA 1OYWA 2EIJH 1VQ6I 2AO9A 2XROA 1REPC 1WH7A 3V4GA 4ZDPA 5IYCJ 3A4CA 4G8XA 1JTYA 1LDDA 1ZKGA 5GPAA 3KZZA 2VI6A 2CUEA 2KIFA 5FD6A 3I59A 5J47A 2ZB9A 1RKWA 4RGXA 3J7AY 4RBOA 3KZYA 5F0FA 1B4AA 2FF4A 2VQCA 1GVJA 5EEGA 2OQGA 3CDHA 4FASD 3ISPA 1XSDA 2IS4A 2HU9A 1Z7UA 3IV5A 1A04A 3I59B 5IT3A 3NARA 1ZN2A 2Q8KA 5JR3A 1SFOJ 1Z1DA 3AG3H 4B3XA 4QPOA 4OAYA 1F1ZA 3ZPLA 3FF5A 1ZG3A 1IN4A 2JQ7A 2LLKA 2Y75A 5LFAA 5JHFA 2FA5A 2KDOA 4M3GA 3LFKA 2K85A 4MIMA 2DDBA 3CCRI 2MLKA 4WCGA 2E7XA 4U0WA 3WGIA 1S3JA 4DOZA 5LGTA 2C6YA 2QUFA 2VONA 2YU3A 1VF9A 2EFQA 2IW5A 3H92A 1NHAA 4Y17A 3KYLA 1VQOI 1K6OA 5GP9A 2FE3A 3S3OA 3RPQA 3T1BA 1NH3A 4G9YA 1LFPA 4N9HA 1B72B 3S2DJ 1S6LA 1QPMA 4ZYHA 4EGYA 1IUFA 1YJWI 1SD7A 2QQ9A 2IS2A 2DN0A 2A69F 2QYOA 1QQIA 1P7IA 4EJWA 4RAGA 2CV1A 2GXBA 4WWCA 2AXTC 3H3VK 1YS7A 4XRSA 4XSZF 2PBIA 3CCYA 1QPIA 3MZYA 4BQAA 3ZQIA 5B5EC 3PUBA 4YIFA 1J75A 4ZZDA 3K4NA 5A2QK 2ELKA 3IHUA 1MMAA 1Z05A 1Q1HA 4ZYEA 3KEYA 4I7HA 1PDNC 2OZ6A 2AQEA 1G59A 2JRTA 4NNJA 2ESHA 1BOBA 1U5TB 1YYVA 3C2GA 2E1CA 2ZFUA 1J7KA 2JUGA 3CC4I 3HHHA 4WF2A 3E6BA 2OUMA 3K2AA 1T0FA 2KQRA 2LVSA 3T5XA 2A6EF 2VQLA 2H1KA 2ADUA 3E6DA 4MO7A 4Q4ZF 5HDGA 3OOPA 2B9SA 1DQUA 2L9NA 1LUJB 3CUQC 2EFNA 3OR2C 1K7AA 1JHHA 2H09A 1PUFB 3M4OJ 2XDVA 1E3PA 2DOEA 2LYCA 2ID3A 2E2JJ 1A5JA 4EV0A 4GXOA 2CS3A 2QWWA 5K7ZA 4CXFA 3T8TA 4EM1A 1WI9A 2WA0A 2HR3A 4GYIA 1H89C 3ZMTA 3ZQQA 2V1NA 2WAQN 4DYQA 4RB3C 2VOOA 3DKWA 5HS7A 4PFPA 2Z99A 2H1LA 4L5EA 2IT0A 3CLQA 1ZRCA 1G2HA 1FP2A 3SDGA 2ECCA 3BTCA 3IC7A 3VSLA 3HOSA 3K69A 4OU0A 1TWHJ 5LLQA 3KCCA 4XICA 1MDMB 5JLXA 3HGYA 1FEXA 1MIJA 1HA8A 2HS5A 3RDIA 3W6KB 5ED4A 5E8IA 2VJ4A 4U7BA 2VQHA 4JP0A 5KK1A 1DPRA 5LEKA 2Z9OA 3KPHA 5DEQA 3GVAA 1MJAA 2MG4A 3M8FA 1UZCA 1HBXG 1WJDA 4YIIA 1ETKA 4ZYDA 4A3GJ 2DA2A 2Y9ZA 3ZP5A 4AYBA 5CVIA 3OYDA 2EBIA 2R5ZB 3F3XA 1IXSB 4IJAA 2CW0F 2HNHA 2JMWA 2QQ8A 1UFMA 1JGGA 3F8FA 2DK8A 2RQPA 2M8GX 1V3FA 4O3MA 3N4MA 4ZDLA 1I39A 4M71A 3L2QA 3HRTA 3C2HA 1MNEA 3C3WA 1ZQ3P 2VB6A 3FWEA 1RIOH 2ZXJA 3ONQA 3F22A 2UWMA 3GTOJ 2L4MA 3HEFA 1RI7A 3BOQA 3ZXSA 4MFEA 1U5TA 4I0BA 1TWCJ 3BQZA 5GAEJ 4HNTA 4OIOF 2BEOA 2DBBA 3GF2A 4D0PA 1NK2P 3MVPA 1EH7A 3LNQA 3ZCOA 2NOGA 1GXPA 4U87A 2FSWA 3ABLH 1MJBA 1SFUA 1JXSA 3KZIC 3RKYA 5EGOB 1EKEA 3LA2A 5F27A 4CCNA 3O6BB 3G73A 1FIAA 2P5LC 1TWGJ 1N77A 1RR8C 3IH4A 4MEXF 4IX7A 2IPQX 2V79A 4C2MJ 2FNAA 4C2TA 1Z67A 4L9NA 4XSXF 1R23A 4YFXF 4ZTFA 2DYSH 4CH7A 2CU7A 4BNCA 2HXIA 2X51A 3F8BA 3U1DA 4RAZA 4NB5A 3HG9A 3F21A 2MH2A 4A6DA 3ZMVA 1SVLA 4HG2A 4L9TA 5HODA 5D5VB 1T56A 4BYYA 2GA1A 3DPUA 4M3EA 1W7PA 2M9HA 4CGZA 2ZXWH 2QSFX 2Z5UA 5EZGA 2W82A 2COMA 1Q1VA 3P7NA 1R6RA 4UVCA 1WJFA 2BXZA 5L3CA 1FC3A 3FXQA 4FETA 1QA6A 4A3IJ 2K02A 1HLVA 2V9VA 1MMGA 1F4KA 4YRVA 1ETQA 2GOXB 2HTJA 4MEYF 1TLHB 5ICGA 2JA6J 3OYJA 2VC0A 4Q47A 2Q0OA 2M8EA 1MBHA 4FTHA 5HDKA 5KNLA 2ZO4A 1JT6A 4RLFA 1T08B 4S05A 1K78A 4E7SA 3LSTA 4NC8A 5K5RA 2DOFA 3K4BA 4EJVA 3S93A 2W25A 3RTRA 1P9QC 1ZG1A 1VQMI 1Y0UA 1IG7A 3RKXA 2ZNYA 1SFKA 2BY2A 2H6CA 2JJ7A 1ZRFA 2ME0A 3H35A 5F1JA 1YI2I 2DMTA 4I98B 2BGCA 3V7RA 4YEJA 4KNYA 3FXLA 3TEDA 4NC6A 1KU3A 2DYRH 5IT9Z 2L54A 4LK0F 4MNUA 4LK1F 2VODA 2G9WA 4HPQA 3W2AA 2F5CA 1D0ZA 4BGDA 3QRFF 4M72A 2VC1A 2RDPA 4P9FA 3S2WA 1FOKA 4M6VA 1ODDA 4HLYA 1I5ZA 3OIPA 1G6NA 4PJLA 1SAXA 1BI0A 1G4DA 4IQJA 4I76A 3ZQGA 2IRFG 3VYTB 2EFPA 1B9NA 1Z21A 1EH8A 3R4KA 2HQRA 1T39A 2DA7A 1ACIA 1ZHFA 2JRMA 2EIKH 2MC4A 2V9PA 1FYKA 2EV5A 2ZJ2A 1SMYF 2F5EA 2KT0A 2KZVA 4BJ5C 3PO3J 3S17J 2P7VB 2JA2A 3GX4X 3CCMI 2BHYA 3DLLF 1KZHA 2ELJA 3HUGA 4AC0A 1D8KA 2JTVA 3WU1B 1A35A 4L5JA 1CF7B 2HPMA 1F36A 1JUMA 1LEAA 4BQOA 3Q5FA 1LFBA 1FWZA 4LGWA 4M9SA 4KA4A 1VI0A 5CKTA 3NWTA 4ABZA 1USSA 1Z6RA 3J81K 3IH2A 2VOPA 2X9DA 3SEZA 3ECHA 3BJOA 4MGRA 4ANJA 4AWXB 2QENA 1S5LC 1I1GA 5GAGJ 2LKPA 4JX4A 4IRIA 3LQRA 1BR2A 4BDYA 1D5VA 5JVGF 1XGSA 5E18F 1Y56A 1VQNI 1D1AA 4RAYA 4CHUA 1I50J 3JSPA 2EQRA 3TO6A 5F0HA 1MBGA 4DZJA 1SC7A 2XHKA 3OWTA 4O5VA 1KU7A 4PUSA 5HLHA 4DYCA 1Y1WJ 1LE8A 3B73A 3WHBA 1K6YA 2DA6A 4GCVA 4NDLA 5LRRA 2JSCA 2VT2A 3W3CA 4EVIA 3G71I 4BE0A 5TRDA 5EYRA 4R1HA 3GXOA 1JGSA 5LHHA 2CRGA 3VEPA 1YHQI 2DMQA 3OYNA 2KDZA 1APLC 1T33A 4RLQA 2FMLA 3KFWX 1X3UA 4XLFA 1J2XA 1QVUA 2IA0A 3V8JA 3FKJA 1IV6A 2QCOA 1TT5B 3RQIA 2XGDA 2YX4A 4G12A 4ZYAA 4QPQA 3C2BA 1XGNA 2IXSA 3CZ6A 1CGPA 3W2VA 3DPTA 1XPXA 1AU7A 4M9XA 2DT7B 1GXQA 2HZDA 2F6CA 1JT0A 3BR0A 4BEHA 1MBKA 2VE8A 3TQNA 3B6CA 1XMAA 4OWRB 3GFIA 1R49A 2R93J 2Y0MA 1MMDA 3DTIA 4HLXA 4XRFA 1P6RA 4HEA2 2QF7A 3GZNB 4V2GA 3RJPA 1QO0D 1X2MA 2HTSA 3ZQ7A 1ZGAA 3OOUA 4AVPA 1SEUA 2X48A 3RKWA 1HW5A 2K4JA 1OCTC 1QZYA 4OAZA 3DEUA 3BR5A 1BL0A 1TNTA 1UCRA 1R58A 4RAFA 3I4MJ 4A3MJ 1JUPA 3TP3A 3F8MA 2VN2A 4CCLA 3BR2A 1IN8A 2E7WA 4AM3A 1GT0C 3R60A 1SANA 3KX2A 1B1BA 4UNOA 1W7PD 1SFEA 3L2CA 2Y2ZA 1HOMA 4EATA 1SD5A 1ZRDA 1ON2A 2WAQA 1G3TA 1X1AA 2XIGA 5DCMB 4IQ4A 3S3MA 3CD6I 4BQQA 2ZJQF 4XL9A 2KZGA 2ZFWA 4BDZA 3M9AA 3D0SA 1TZLA 4KITB 4N9IA 2IGKA 4AIKA 3JR9A 3LWFA 2RNJA 1JI8A 1UHWA 4G7HF 4UV8A 4HX7A 2A5YB 5LD2C 3DU5A 2XPUA 2FBHA 3FXUA 4IVNA 3AFHA 1BC7C 2IVMA 4WXDA 4PJMA 2HEOA 4IHYA 4KUMA 4KIGA 5E1WA 4HV5A 2D1HA 5CLSA 2JN6A 1UB9A 2DQLA 2B7EA 5J40A 3OV8A 2BE5F 3S1NJ 5TJJA 3IUOA 1WFXA 4F52A 3SQNA 2RC4A 3VODA 5LBQA 2F5VA 1FMVA 2K9QA 3E5UA 2DFFA 4KN7X 3RYRA 3R61A 4A3JJ 3ZGKA 2JSPA 1NG7A 2P6TA 4LB5A 2HQ5A 1QVTA 3ESWB 4KT5C 5E1XA 3DQVC 3TOAA 3E5XA 3EDPA 2XAFA 1UJ8A 2RREA 1TL8A 5K5QA 5FFXA 2W7NA 1R7JA 5H6RA 1X58A 1Z3YA 3U2RA 1MSFC 1BI2A 4RS8A 3I9V2 4J19A 3HOYJ 2M4KA 4IHXA 1BW5A 3JSOA 2HOAA 3EYIA 3GBGA 2I8DA 3L09A 1XC5A 2J5OA 4HNVA 1YS6A 4IOAF 1OPCA 1O4XA 4GRIA 1XMXA 1E0EA 2FRHA 2A07F 3MWMA 3DTKA 2MGQA 4A3KJ 3FIWA 2XC7A 3LOCA 5D5WB 3CF5F 2ZBKA 2OCCH 3AKZA 1IRFA 2VXDA 1WRJA 5CQEA 2PMHA 4JK1X 3H1CA 1XMKA 3KP4A 3VFZA 4ITVA 2F4MB 1U5TC 2IEKA 5ILSA 4DIQA 4O6JA 2F48A 3CESA 1RZ4A 5L3GA 2O61A 2CO5A 2KIUA 3BJAA 2P81A 4A12A 1UHSA 3QQAA 2NS7A 4QTRA 1IDYA 2KKOA 3BJ6A 2ZJPF 2WY8Q 1K61A 4P5OA 2CJJA 3B6AA 2A05A 2ISYA 5J8CA 1HDDC 3T8RA 2CUFA 1UG0A 3LAPA 1UELB 3GFLA 3HB9A 3K4LA 1LE8B 1H88C 2HQNA 2PMZN 1OR7A 3A02A 1GLNA 2D1VA 2OA4A 3PQJA 3S3NA 1LQ1A 1HCRA 1R22A 3KLOA 2F4OB 1O7LA 3PFYA 4YELA 1YE9A 2HOTA 3V42A 2E1MC 1XCBA 3Q9VA 4I99C 2O3FA 1Z77A 4BHCA 1SD4A 4EJTA 1OMIA 1YOVB 3JRHA 2NVQJ 2P0WA 1QZZA 3BROA 1U0JA 2PJRB 4FQGA 2M2EA 2CUZA 1T8IA 2L9SA 1JJ8C 2M0MA 2ZXHA 3U9GA 2E34A 1RUOA 3L2WA 3QP5A 4Z6YA 4ESBA 1ZARA 1YJ9I 3DEWA 2PFBA 2LOOA 3OYEA 1E3HA 3DXJF 3DV8A 1HKTA 3CJQB 3I0TA 1AHDP 4NQWA 1A6IA 2F5DA 1FLIA 3H5AA 2BVLA 2HDWA 3J80K 1IO2A 3H9GA 1KQ8A 3PFIA 4HW0A 4II2A 2EZLA 4BJTA 5M5YJ 2L5QA 3OYGA 5E17F 4D5CA 2LF7A 3KETA 2FXAA 3VOEA 2WC2A 3GMEA 4BXFA 1JKPC 2LC2A 5IYDJ 2L7MP 4G94A 5JFRA 3E7LA 3FDYA 2X6YA 2XSJC 2NVXJ 4BHPA 4P1WA 5EJCA 4A69C 5HS8A 1RKTA 1W1WE 3ABUA 4PJJA 2GOMA 4A0ZA 1FSHA 1WI3A 4IZZA 4A5MA 1BJZA 4GDFA 2WV1A 4ESJA 1MMSA 3ROUA 5DCFA 3JAMZ 5IPAA 2X6XA 3MAJA 4FHTA 2CQXA 3JRDA 3MKYB 1WVRA 1P4AA 1X1DA 4I09A 4UUTA 3RPUA 3EUHC 2OJED 4CICA 4CCOA 2PI0A 2R7RA 1GHCA 3HUGB 1JHFA 4ZJZA 4RB0A 1I6HJ 4LG3A 1IAWA 3ZQFA 3RQ4A 3OL3A 4UVBA 4NBQA 3LA7A 3HOVJ 1ZK8A 2QVOA 4HBLA 2A6TA 3F8CA 5F08A 1SD6A 1Z9CA 1P7JA 4M3BA 3JCUC 2PMZA 3S15J 4MQVA 4UY8I 1XX5A 2RAEA 2EZIA 4XKBA 5B3SH 4BBRJ 1Y6IA 2A68F 2YSRA 3DPLC 2X85A 4RB1A 3DFGA 1YTYA 1QNTA 2M45A 4MQ9F 3JRCA 2Q2EB 2FJ1A 3HRUA 4HV6A 2BXYA 2O5RA 3GO5A 3DTEA 5FFZA 5BPIA 3H0GJ 2HKXA 2JUCA 5LGNA 1TQPA 1G3SA 3BP8A 2GAUA 3QWLA 2KRCA 4C3JJ 2YUSA 2XAJA 1SMTA 1IRZA 2H8WA 2GIZA 3BTIA 4D9JA 1ZR4A 4PSXA 2LY2A 4DW6A 2Z33A 1QU3A 4C3HJ 3OS0A 3HXLA 3I4NJ 1TQMA 1DDNA 2VJIA 3CF2A 3L9FA 3WTXC 3NQOA 1SVOA 2CH0A 4I6ZA 1RC9A 3WTZA 5M3MJ 5JVTA 2R7OA 4M3DA 4B1RA 5E8GA 3ZMZA 1MBFA 2NVUB 3NAUA 1HQCA 1S8NA 2IGOA 4WXHA 2NXNB 2LKSA 2EWNA 5BQTA 3GTPJ 1YQAA 2X0LA 5DUKA 2EILH 2UXNA 4Q48A 1POGA 4UVAA 2ZC2A 3AG4H 3Q0UA 4ZH4F 2L02A 4GYGA 1J9IA 1BJAA 3F6VA 4F55A 2WV0A 2AS5F 2MABA 1QZEA 3MEXA 2VBXA 2XPWA 3M1CA 2V1UA 2A6HF 4XM3A 1PYVA 2K9SA 4F7ZA 5IOZA 4ON0A 2QEXI 1ZGWA 3CUQA 2DPUA 4ESFA 4XIDA 2DTZA 3KEQA 4CSWA 2P7CB 4A6EA 3F0CA 1MZBA 1ETVA 1V4RA 3A03A 2O6GE 2CFXA 3UKGA 3O2PE 2M7BA 2W85A 2XV4S 4HQMA 2K9MA 1X1BA 1R1UA 2NVYJ 1DP3A 2ID6A 4MHGA 1R4MB 2K7LA 3CQZJ 4EGZA 1Y39A 4E70A 3GEZA 3IWZA 3BT9A 1H8AC 3E97A 1S7EA 4DBRA 2A5WA 2L4AA 4E7IA 2JA7J 3PO2J 5AONA 2CG4A 3H3ZA 1P2FA 4HSTA 3BZCA 4JQFA 3PSIA 2LREA 3W6JB 3BCBA 1IN5A 1ZAOA 2H94A 3DF8A 1T2KA 2V1XA 3GW2A 2BHZA 1S9HA 4M74A 2MW8A 3LA3A 4OINF 1B6AA 3L00A 3F8NA 5KCMA 1MH3A 2D45A 1HSTA 1XSVA 2LK2A 1YW9A 1L3LA 2DT6A 2E1OA 5J6XA 2GWRA 3TGNA 3WTTC 5IT9K 3QPLA 1KA8A 2XAHA 1AOYA 2WAEA 3CUOA 3OIOA 1SAUA 1MSEC 1H9GA 2CMPA 2JPBA 2P4WA 2CQQA 2XGCA 1SFXA 1YG2A 3N97A 3J80Z 1WSUA 2VKEA 3HYIA 3GTLJ 2NS0A 1XSXA 4BBSJ 3SZPA 3FMSA 1IXCA 4UHTA 3HOWJ 1VFCA 3ZQCA 1EH6A 2WB1N 2WTEA 2CQNA 2PEXA 3O8HA 4LIVA 2LG4A 2YU9J 4AIDA 2XF6A 2W00A 4IF4A 3WTSC 4XLEA 2HGCA 5FKMA 5FKOA 4WK8F 2PJRA 3NEUA 4X6AJ 2RN7A 4Y52J 3ZMSA 2KFDA 1TQIA 3IH3A 3IRQA 3Q0WA 5F6FA 2XKPA 2VIXA 3KEOA 1ZG5A 2GA2A 4LG0A 3O3KA 5K7HA 1IDZA 2CW7A 4M9ZA 4BL0B 3IRRA 1BW6A 4IRGA 3L2UA 4CCMA 2R0QC 2R7VA 1E2XA 4AVZA 4LD5A 1YW8A 4IPAA 3HSRA 1MBEA 1D0XA 3JW4A 3BG9A 1HW2A 3GLLA 3GFMA 3WTWC 2QGUA 4M73A 3K4JA 3ZN1A 3DLAA 2PQ8A 4FE4A 3IKVA 1A6QA 1I27A 3L7WA 2LDUA 4B8XA 4C30A 1ETYA 1R5GA 3KYCB 1IF1A 3OYMA 2OCEA 3BR6A 1WZ2A 4F91B 1D5YA 4XKCA 3GTGJ 3GTQJ 1VTNC 2J5PA 2R7QA 2O8XA 3VYUB 2MFZA 3IP4B 4KICA 1U3EM 4HX4A 3CUQB 3DKXA 3D5SC 2VL8A 2JA5J 2WB1A 2HYJA 4B43A 5GPCA 2EA2A 4A93J 2ZMEA 1OCOH 1IZ1A 4GGGA 2KL4A 3FHZA 2E19A 1YLFA 2E2IJ 5CVRA 2M87A 4CZZA 3CCEI 1OKRA 2FQ3A 4HX8A 2DMNA 4AU7A 4NHJA 3C1DA 3SZGA 3LSHA 1RNLA 2ELHA 5AIQA 2F2EA 1FOXA 4IKFA 4XOPA 1AKHA 1XS9A 2R7XA 3ASNH 2OQRA 3WG9A 1MMNA 4W1UA 3QAHA 3A0BC 4EM0B 3ZRGA 3J81Z 3FZVA 2RVCA 5IYBJ 4LLNA 1TC3C 2MSYA 2NAZA 5FO5A 5FLXK 4RM2A 2XB0X 3CJRB 1X4OA 2K86A 5DCMA 5GAHJ 4S0HB 3H3UA 3CJTB 3HTSB 2K3PA 1YRNA 3ABKH 4JBAA 3CO6C 4ENJA 4R8HA 4AYBN 2DK5A 2KJCA 2MYSA 1BI1A 3ZQHA 2FNPA 1FMWA 3M7GA 3CCUI 1FYLA 1OYYA 1VQLI 1MW7A 3KYDB 5LGUA 2KPMA 2XAGA 2M7AA 3UNGC 3HL2A 2R7ZJ 3ZR8X 5J8FA 1K4SA 3GZ5A 1K83J 3FXKA 2XPVA 1KQ9A 4LITA 1JKRC 5DD8A 2N8GA 1BI3A 3M07A 2LBFA 4FT8A 2L7ZA 2VLAA 2LY1A 5E20A 3VYRB 3CC7I 2O0YA 3WE3A 2CV2A 4L0ZB 1U9OA 5DM6F 4B09A 2E5ZA 1U2WA 3EUHA 1O57A 2BOLA 4XLPF 1Y8RB 1K4TA 2VKHA 3QP6A 2QQBA 2MC3A 2VASA 5F0CA 2DODA 1RUNA 3PJRA 5CVUA 2K9NA 4LOCA 4EJOA 4Q5SF 2M5WA 4RMNA 4HYEA 3LSRA 1ZLKA 3RZDJ 1IW7F 1LDJA 4XNFA 5IP7J 2V7FA 1DGRM 1FIPA 3I71A 4PCQA 2OTJI 2CYYA 2L7KA 4IRHA 2WWYA 2Y48A 2L0KA 1ZLJA 3A1YA 1ONVA 3WTYC 5D6EA 1WQ2A 4AUXA 3GTKJ 3LFUA 4M6YA 3K4MA 1OCPA 2MLGA 3PIOF 2HPIA 1YIJI 2R3SA 1G8XA 2LSOA 3MD2A 3PL8A 1E17A 2OF7A 5LRSA 3HOTA 2Q1ZB 4MTEA 2KRHA 1YFHA 4XBFA 3JTHA 5E3OA 4UB6C 2EFWA 2R5ZA 4D7NA 4LG0B 1LKXA 2EB7A 5KVRA 3V7CA 3ZMUA 1STZA 2KHMA 3Q3SA 3BG3A 2I10A 1QRYA 3BQYA 1I6XA 1ZYRF 5FROA 2K5CA 5FRNA 2KMUA 2GZWA 3ERED 1ENHA 1YIOA 4I01A 5L3BA 3F6OA 4XQFA 3MQ0A 3K4KA 4C9YA 2DFIA 1T95A 3GZ6A 1WHUA 3CMEI 1D3YA 4RA2A 1XG1A 3FM3A 4U88A 2DFHA 5HS9A 3GYHX 2RGVA 5E3MA 3OYIA 2ISZA 1VQ8I 2LRDA 1FJLA 4BJ6C 3EPZA 1XN7A 1I3QJ 4U0YA 3G3ZA 3DBHB 5HDNA 3V7SA 3KP2A 3ULQB 2AQFA 3FK6A 2XASA 3B02A 4KN4X 2XUBA 5FD5A 2EV6A 4F93B 4QLCU 1H0MA 4PFOA 1FT9A 4E7KA 1T98A 2GBYA 3EETA 4RGRA 1QHHD 3JREA 1H9TA 4LLLA 3GFJA 2DMPA 2YR2A 1F43A 2ZSHB 1B59A 3QODA 1IUYA 3TO7A 3BY6A 4V2FA 5M3FJ 3SXYA 5D8KB 2ESNA 2QSHX 3QU3A 2HYGD 3MFKA 1BC8C 2QSGX 3KP5A 4L0YB 2UUZA 3QPHA 2STWA 5HLTA 4N4OB 2QZ8A 2DDAA 2V26A 3LQQA 3KP6A 3RKQA 2GXAA 3CC2I 3I53A 1T0FC 2E35A 2DFEA 2X6OA 2E1NA 4PJNA 1TWAJ 2IJLA 3CO7C 2NNNA 1OLTA 4CCJA 3K2ZA 4P96A 1O3QA 4CDGA 3HRSA 4B48A 4PDKA 5L3EA 3QU6A 1IV8A 1VQ5I 2JA8J 4BKXA 3BTLA 1W5TA 5J1UA 2IGMA 5LHIA 2DPDA 4I0AA 2D2WA 2HVRA 4DGWB 4N4NB 4H0EA 4S04A 4ZTJA 4OOIA 4FX4A 4QSHA 1DU0A 3CP2A 3K70D 2X1CA 2A61A 2QBYB 4HF2A 1V55H 1QHGA 3IAM2 3TP0A 4WX9A 2ECBA 1YRNB 4UUVA 4EM2A 1KQ0A 2ZCWA 2G0EA 1FOYA 2BVMA 3PUFA 5D4SA 5ICEA 2AXLA 1YW7A 1U78A 1FP1D 4RDUA 1GV5A 1USTA 2CQ7A 1FBQA 1MNDA 2MBFA 4XLHA 4CYDA 3KIOA 3K9TA 2FMYA 2HFHA 4J00A 1CF7A 2IA1A 4ZC3A 1KYZA 3CCJI 2XAQA 3KE2A 5DD4A 4KIFA 2D5VA 3OY9A 3ZQLA 3PNTA 1BOAA 4FCYA 1MJ9A 4BEHB 2BW3A 2UV1A 1K79A 3K10A 2Y0SN 3HRMA 4PGHA 4MTDA 2IS1A 2FBKA 2TDXA 3FM5A 2DTRA 1CQTA 5TGTA 2R4GA 3RCOA 2DLLA 1K78B 3JAMK 3R0JA 5DS9A 4C2UA 3T0YA 3K1PA 2XB5A 5CPRB 2DAOA 2G7UA 5F04A 5D6FA 4OIQF 1OR7C 2JVHA 5L3FA 2R92J 4KJZA 3WTVC 1XB4A 4CCKA 5H6QA 1GUUA 3P5JA 2M0CA 2V1DA 3S32A 4B47A 1EV7A 6PAXA 3J7YJ 2VBZA 3IL2A 4FX0A 2TRTA 4CO8A 3KP3A 1JKOC 3HOZJ 3E6MA 4ENMA 3HPGA 1YX5A 1S29A 3DWLE 4YIRX 4H4KC 3QOEA 3CJNA 3JRFA 4NQWB 1F5TA 5DV5A 2LBFB 1YX3A 5E3NA 4E4HA 3S8PA 3WODF 5ERIA 3G1LA 2R5YB 2WADA 2KIQA 5B1AH 3KLNA 4BS9A 1ON1A 1IXRC 2HVSA 3HSEA 1R00A 2YS9A 2ZXIA 1ORKA 3DBLB 5BNGA 2MH9A 4DJAA 1LFUP 2EJRA 4Y13A 3I58A 1C0WA 2BY1A 3P9IA 2V6CA 3ZN0A 2FUG2 4XONA 3C7JA 1ZREA 3MZHA 5CQGA 2DO7A 2LFBA 3MKZA 1HXDA 1R1VA 3WTUC 1EF4A 2EK5A 3OSGA 4A3LJ 4F3QA 1W4MA 1RETA 4LLGF 1HW1A 5KAFC 3H9JA 1DUXC 2KJBA 4XLAA 4KYWA 3WG7H 5BS6A 2DA4A 2VJJA 1GDTA
chains in the Genus database with same CATH topology
3ELKA 5FB2A 1XGOA 1PP8F 2W84A 3HIFA 2LNBA 1O3SA 1IRGA 4KDPA 4K2EA 4AIHA 4OIPF 4HDUA 2NNYA 5BMZA 1O7FA 2HWVA 2B0LA 2FBIA 2JZYA 1FY7A 2R7DA 2CGPA 1DP7P 1AWCA 3TOBA 1BIBA 4U7DA 3EQLF 2CQKA 2OU2A 1B9MA 2M30A 1LDKB 2FEZA 3Q9SA 3V8LA 1XDUA 4AIJA 2RKHA 2P8TA 4PGGA 1TTYA 2DQRA 4ZZLA 2W57A 4YFNF 1FNNA 2P5KA 3ABTA 1HSJA 4Y15A 4I2OA 1R1TA 1W5SA 2NYXA 3C18A 4N0BA 2ZKZA 3COAC 1DPUA 1P4WA 4ENKA 2PN6A 2W24A 3TO9A 3WGHA 1JE8A 1QGPA 4AD9A 3ZMDA 2IA2A 5E1ZB 2HYFA 3E3VA 4IHTA 1FPQA 3WU0A 2P5VA 4BH9A 3NRVA 2ZNZA 3BPXA 1WKMA 5AIPA 4HA8A 2PG4A 1TNSA 4LB6B 3QOPA 5HLIA 4Z2YA 1O3TA 2PLYA 4ENNA 4UXNA 2VBWA 1S7OA 5EEHA 4KIBA 5LHGA 1LB2A 4L18B 4HF0A 3J7AO 5DDGA 5F64A 4L9JA 4L9VA 4LJZF 5FLXZ 1T6SA 1PUEE 1L0OC 2OD5A 2R7FA 4GO1A 3WGGA 4OMZA 3F72A 1BIAA 2Q2EA 4M6XA 1TBXA 2FOKA 2CWEA 1MD0A 1IN6A 1ULYA 1FYMA 2EFOA 2DW4A 3SHFA 4A0XA 5D4RA 1BM9A 3F23A 2IP2A 2UZKA 3I4PA 3WE2A 2NRAC 1J59A 1D8JA 2GXGA 1YO5C 3TDZC 4U0VA 1FBSA 5K1YA 4DQ2A 4A0YA 5H20A 1BN5A 5ILVA 2VT3A 2BBYA 3JTGA 3P9CA 1F9NA 2HKOA 2VBYA 2RV8A 4DNCA 5D5XB 4QWQA 3EYYA 4LFUA 4ZYGA 2YX7A 3FMRA 3FX3A 2DI3A 5JHUA 2L3DA 3E6CC 2MA3A 2UXXA 5D8LB 3R6SA 2HOEA 1LEBA 2EA4A 5HVQC 4HDVA 5A2QZ 4BHBA 5D5UB 3FMQA 3MCZA 2K4BA 1J5YA 1P92A 1HKSA 2XVCA 5CVJA 2VXZA 1R36A 5LEJA 2Z3YA 4XLNF 3RIRA 1G3WA 5F1RA 4EMSA 3BZ6A 3RYPA 3SZTA 5ICCA 4EQQA 1ZH5A 3IKTA 3AAFA 3ML6A 4OMYA 2HZTA 3PQKA 2DU9A 3R0AA 3M1EA 1MDMA 1KYWA 1U8RA 1S7AA 5CJ9A 2O03A 2F5FA 4A2UA 1FX7A 1XCVA 1U6GA 5L3DA 4I02A 5HLGA 3QPTA 2STTA 4G6QA 3I54A 1R5HA 2XRNA 1G3YA 1WWXA 1Z91A 1ZGJA 3HSFA 4UV9A 2CSOA 1W7PB 2GIVA 4BAYA 3BWGA 1TW2A 2LF8A 1PP7U 4HAMA 1OYIA 3CTAA 2A3SA 1FSEA 2L01A 2XGXA 3HHGA 1O3RA 1KU2A 3TDUC 3I64A 1P4XA 4RGUA 4IXAA 1T38A 4ETSA 3RI4A 5BOXA 3VB2A 5JI6A 1UHMA 4IHSA 3IWFA 4TV7A 3GWZA 1XGMA 2OZUA 2BYVE 4L5IA 1MKMA 1MGTA 1Z6TA 5HOOA 3K1MA 4BXUA 4G7ZF 4KFCA 4RGSA 2VE9A 4P55A 2QLZA 3P9KA 2MD5A 4HOBA 4WXCA 4EJUA 2HDCA 1KGSA 2KRFA 2XKOA 3BPVA 5CYVA 1XDSA 5K5OA 1QBJA 2BV6A 2QM3A 3E5QA 5DUIA 3GLXA 4HQEA 2X4HA 2ZMEB 2H27A 2OAZA 1FZPB 3K1NA 3FXRA 2YPRA 3SFZA 2QQAA 5CVVA 2EV0A 4R79A 2PJPA 4PZJA 3GUDA 3M8EA 3TKYA 2P6SA 4OIRF 2QBYA 1J0RA 3DP7A 5ILUA 4KMFA 4G7OF 1XD7A 4G6DA 1LNWA 3V8KA 2FU4A 3BDDA 1TW3A 5BPDA 5FGMA 2H6BA 2ACJA 2ETHA 4LMYA 4P9UA 3REOA 1I1SA 5DYMA 3D5LA 4RB2C 2G7HA 4A5NA 2M1BA 1KU9A 1LVAA 4YG2F 3I5UA 3ECOA 1FBUA 2PMUA 4HF1A 1IN7A 3LAJA 3CLOA 2OBPA 2KIMA 2DT5A 3K0LA 5ICFA 1LJ9A 1BBYA 4KMUX 1HKQA 2K27A 2JPCA 2JT1A 3KP7A 4HZFA 3HTUA 4ASNA 2GQQA 4YFKF 1OYWA 2XROA 1REPC 3V4GA 4G8XA 1LDDA 3KZZA 2KIFA 5FD6A 3I59A 4RGXA 3KZYA 1B4AA 2FF4A 1GVJA 5EEGA 2OQGA 3CDHA 3ISPA 1XSDA 1Z7UA 1A04A 3I59B 5IT3A 1ZN2A 2Q8KA 5JR3A 1Z1DA 1F1ZA 3ZPLA 3FF5A 1ZG3A 1IN4A 2Y75A 2FA5A 3LFKA 2MLKA 4WCGA 2E7XA 4U0WA 3WGIA 1S3JA 5LGTA 2C6YA 2QUFA 2VONA 2YU3A 2EFQA 2IW5A 3H92A 1NHAA 4Y17A 1K6OA 2FE3A 3RPQA 3T1BA 4G9YA 4N9HA 1S6LA 1QPMA 4ZYHA 4EGYA 1SD7A 2QQ9A 2A69F 2QYOA 1QQIA 4EJWA 2GXBA 4WWCA 1YS7A 4XSZF 2PBIA 3MZYA 4BQAA 4YIFA 1J75A 4ZZDA 5A2QK 3IHUA 1Z05A 1Q1HA 4ZYEA 4I7HA 1PDNC 2OZ6A 2JRTA 2ESHA 1YYVA 1U5TB 2E1CA 1J7KA 3HHHA 4WF2A 3E6BA 1T0FA 3T5XA 2A6EF 2ADUA 3E6DA 4Q4ZF 5HDGA 3OOPA 3CUQC 2EFNA 1K7AA 1JHHA 2H09A 4EV0A 4GXOA 2QWWA 4CXFA 3T8TA 4EM1A 1WI9A 2HR3A 4GYIA 3ZMTA 4RB3C 2VOOA 3DKWA 5HS7A 2Z99A 2IT0A 1ZRCA 1FP2A 3IC7A 3HOSA 3K69A 4OU0A 5LLQA 3KCCA 1MDMB 2HS5A 3RDIA 3W6KB 5ED4A 5E8IA 4U7BA 5KK1A 1DPRA 5LEKA 2Z9OA 5DEQA 3GVAA 1MJAA 3M8FA 1HBXG 4YIIA 4ZYDA 3ZP5A 5CVIA 3F3XA 1IXSB 4IJAA 2CW0F 1UFMA 3F8FA 2DK8A 2RQPA 4O3MA 1V3FA 3N4MA 4M71A 3HRTA 3C3WA 3FWEA 1RIOH 2ZXJA 3F22A 2UWMA 2L4MA 1RI7A 3BOQA 1U5TA 4I0BA 4OIOF 2BEOA 2DBBA 3GF2A 4D0PA 1EH7A 1GXPA 2FSWA 1MJBA 1SFUA 1JXSA 3RKYA 3LA2A 3G73A 3O6BB 2P5LC 4MEXF 2IPQX 2V79A 2FNAA 4L9NA 4XSXF 1R23A 4YFXF 4BNCA 3F8BA 3U1DA 4RAZA 4NB5A 3F21A 2MH2A 4A6DA 3ZMVA 4L9TA 5D5VB 4BYYA 2GA1A 1W7PA 4CGZA 2Z5UA 2COMA 3P7NA 4UVCA 5L3CA 1FC3A 3FXQA 2K02A 2V9VA 1F4KA 5ICGA 2HTJA 4MEYF 1TLHB 2VC0A 4Q47A 2Q0OA 2M8EA 5HDKA 2ZO4A 4S05A 1K78A 3LSTA 5K5RA 4EJVA 2W25A 3RTRA 1ZG1A 1Y0UA 3RKXA 2ZNYA 2H6CA 1ZRFA 4I98B 3V7RA 2BGCA 4KNYA 1KU3A 5IT9Z 2L54A 4LK0F 4MNUA 4LK1F 2VODA 2G9WA 2F5CA 3QRFF 4M72A 2VC1A 2RDPA 4P9FA 3S2WA 1FOKA 1ODDA 4HLYA 1I5ZA 1SAXA 1G6NA 1BI0A 1G4DA 2IRFG 2EFPA 1B9NA 1EH8A 3R4KA 2HQRA 1T39A 1ZHFA 1FYKA 2EV5A 2ZJ2A 1SMYF 2F5EA 2P7VB 3GX4X 3HUGA 3WU1B 1D8KA 2JTVA 4L5JA 1CF7B 1LEAA 3Q5FA 1FWZA 4LGWA 4M9SA 4KA4A 1USSA 1Z6RA 3J81K 2VOPA 3ECHA 3BJOA 4MGRA 4AWXB 2QENA 1I1GA 2LKPA 4IRIA 3LQRA 1D5VA 1XGSA 5E18F 4RAYA 4CHUA 3JSPA 3TO6A 2XHKA 4O5VA 1KU7A 5HLHA 3B73A 4GCVA 5LRRA 2JSCA 2VT2A 4EVIA 5TRDA 4R1HA 3GXOA 1JGSA 5LHHA 3VEPA 2FMLA 3KFWX 1X3UA 1J2XA 2IA0A 3V8JA 2YX4A 1XGNA 1CGPA 3DPTA 4M9XA 1GXQA 2VE8A 3TQNA 1XMAA 3GFIA 2Y0MA 4HLXA 4XRFA 1P6RA 3RJPA 1QO0D 2HTSA 3ZQ7A 1ZGAA 4AVPA 3RKWA 1HW5A 2K4JA 1QZYA 3DEUA 1TNTA 1UCRA 1R58A 3F8MA 2VN2A 1IN8A 2E7WA 3R60A 1B1BA 4UNOA 1W7PD 1SFEA 3L2CA 1SD5A 1ZRDA 1ON2A 1G3TA 2XIGA 5DCMB 2ZFWA 3M9AA 3D0SA 4AIKA 4N9IA 3LWFA 2RNJA 1UHWA 4G7HF 4UV8A 4HX7A 2A5YB 2FBHA 3FXUA 4IVNA 1BC7C 2IVMA 4WXDA 2HEOA 4KUMA 4KIGA 5E1WA 4HV5A 2D1HA 5CLSA 1UB9A 2DQLA 3OV8A 2BE5F 5TJJA 3SQNA 2RC4A 3VODA 5LBQA 4KN7X 3E5UA 3RYRA 3R61A 4LB5A 2P6TA 4KT5C 5E1XA 3DQVC 3TOAA 3E5XA 3EDPA 2XAFA 5K5QA 5FFXA 1R7JA 5H6RA 3U2RA 1BI2A 4RS8A 3JSOA 3EYIA 3L09A 2J5OA 1YS6A 1OPCA 2FRHA 2A07F 3MWMA 5D5WB 2ZBKA 1IRFA 1WRJA 2PMHA 4JK1X 3KP4A 1XMKA 3VFZA 1U5TC 5ILSA 4O6JA 1RZ4A 5L3GA 2O61A 2CO5A 2KIUA 3BJAA 4A12A 2KKOA 3BJ6A 4P5OA 5J8CA 2ISYA 3T8RA 3LAPA 3GFLA 2HQNA 1OR7A 2D1VA 2OA4A 3PQJA 1LQ1A 1R22A 3KLOA 1O7LA 1XCBA 3Q9VA 2O3FA 4BHCA 1SD4A 4EJTA 1OMIA 1QZZA 3BROA 3U9GA 1RUOA 3QP5A 4ESBA 1ZARA 2PFBA 3DXJF 3DV8A 1HKTA 3I0TA 4NQWA 2F5DA 1FLIA 3J80K 1KQ8A 3PFIA 4HW0A 5E17F 2LF7A 3KETA 2FXAA 3VOEA 2WC2A 4G94A 5JFRA 4BHPA 5HS8A 3ABUA 4A0ZA 1FSHA 4A5MA 4ESJA 3ROUA 5DCFA 3JAMZ 3MAJA 4FHTA 1P4AA 4I09A 3RPUA 4CICA 2PI0A 1GHCA 1JHFA 4RB0A 1IAWA 4UVBA 3LA7A 2QVOA 4HBLA 3F8CA 1SD6A 1Z9CA 4MQVA 3DPLC 2A68F 2YSRA 4RB1A 3DFGA 1YTYA 1QNTA 2M45A 4MQ9F 3HRUA 4HV6A 3GO5A 5FFZA 5BPIA 2HKXA 5LGNA 1TQPA 1G3SA 3BP8A 2GAUA 2XAJA 1SMTA 2Z33A 1TQMA 1DDNA 3L9FA 3WTXC 3NQOA 3WTZA 5JVTA 5E8GA 3ZMZA 1HQCA 1S8NA 4WXHA 2EWNA 5BQTA 1YQAA 2X0LA 5DUKA 2UXNA 4Q48A 4UVAA 4ZH4F 2L02A 4GYGA 1J9IA 1BJAA 3F6VA 2AS5F 2WV0A 3MEXA 2VBXA 2V1UA 2A6HF 4F7ZA 2DPUA 4ON0A 3CUQA 4ESFA 3KEQA 2P7CB 4A6EA 1MZBA 1V4RA 2O6GE 2CFXA 3O2PE 2W85A 2XV4S 4HQMA 1R1UA 4MHGA 2K7LA 4EGZA 4E70A 3GEZA 3IWZA 3E97A 2L4AA 5AONA 2CG4A 3H3ZA 1P2FA 4JQFA 3W6JB 1IN5A 1ZAOA 2H94A 3DF8A 1T2KA 2V1XA 3GW2A 4M74A 3LA3A 4OINF 1B6AA 3L00A 3F8NA 2D45A 1HSTA 1XSVA 1YW9A 1L3LA 5J6XA 2GWRA 3TGNA 3WTTC 5IT9K 1KA8A 2XAHA 1AOYA 3CUOA 1H9GA 2JPBA 2P4WA 1SFXA 1YG2A 3N97A 3J80Z 1WSUA 3HYIA 2NS0A 1XSXA 3SZPA 3FMSA 1IXCA 4UHTA 1EH6A 2WTEA 2PEXA 4IF4A 3WTSC 2HGCA 4WK8F 3NEUA 2RN7A 3ZMSA 1TQIA 3IRQA 5F6FA 2XKPA 3KEOA 1ZG5A 2GA2A 4LG0A 3O3KA 4M9ZA 3IRRA 4IRGA 1E2XA 4LD5A 1YW8A 4IPAA 3HSRA 3JW4A 1HW2A 3GFMA 3WTWC 4M73A 3ZN1A 2PQ8A 3IKVA 1I27A 3L7WA 2LDUA 4B8XA 1R5GA 1IF1A 1VTNC 2J5PA 2O8XA 4KICA 1U3EM 4HX4A 3CUQB 2EA2A 2ZMEA 1IZ1A 4GGGA 3FHZA 1YLFA 5CVRA 2M87A 4CZZA 1OKRA 2FQ3A 4HX8A 4NHJA 3C1DA 1RNLA 2ELHA 5AIQA 2F2EA 2OQRA 3WG9A 3QAHA 4EM0B 3J81Z 3FZVA 2RVCA 4LLNA 2NAZA 5FO5A 5FLXK 2K86A 5DCMA 3H3UA 3HTSB 4JBAA 3CO6C 4ENJA 4R8HA 2DK5A 2KJCA 1BI1A 2FNPA 3M7GA 1FYLA 1OYYA 5LGUA 2XAGA 5J8FA 3GZ5A 1KQ9A 5DD8A 1BI3A 4FT8A 5E20A 2O0YA 3WE3A 4L0ZB 4B09A 1U2WA 3EUHA 1O57A 4XLPF 3QP6A 2QQBA 2MC3A 1RUNA 5CVUA 4EJOA 4Q5SF 2M5WA 4HYEA 1ZLKA 1IW7F 1LDJA 3I71A 4PCQA 2CYYA 4IRHA 2WWYA 2Y48A 1ZLJA 3WTYC 1ONVA 5D6EA 1WQ2A 4M6YA 2MLGA 2R3SA 1E17A 2LSOA 5LRSA 3HOTA 4MTEA 1YFHA 4XBFA 3JTHA 2EFWA 4LG0B 2EB7A 5KVRA 3V7CA 3ZMUA 1STZA 1I6XA 1ZYRF 2GZWA 3ERED 4I01A 1YIOA 5L3BA 3F6OA 3MQ0A 2DFIA 3GZ6A 1D3YA 3FM3A 4U88A 5HS9A 3GYHX 2RGVA 2ISZA 1XN7A 4U0YA 3G3ZA 5HDNA 3V7SA 3KP2A 3ULQB 2XASA 3B02A 4KN4X 2XUBA 5FD5A 2EV6A 4QLCU 1H0MA 1FT9A 1T98A 3EETA 4RGRA 1H9TA 4LLLA 3GFJA 2YR2A 1B59A 1IUYA 3TO7A 3BY6A 3SXYA 5D8KB 2ESNA 3QU3A 2HYGD 3MFKA 1BC8C 3KP5A 4L0YB 3QPHA 2STWA 2QZ8A 3LQQA 3KP6A 3I53A 2E1NA 3CO7C 2IJLA 2NNNA 3K2ZA 4P96A 1O3QA 4CDGA 3HRSA 4PDKA 5L3EA 3QU6A 1W5TA 2DPDA 5LHIA 4I0AA 2D2WA 4H0EA 4S04A 4OOIA 4FX4A 2A61A 2QBYB 4HF2A 4WX9A 4UUVA 4EM2A 1KQ0A 2ZCWA 5D4SA 5ICEA 2AXLA 1YW7A 1U78A 1FP1D 1USTA 2MBFA 1FBQA 4CYDA 3K9TA 2FMYA 2HFHA 1CF7A 2IA1A 1KYZA 2XAQA 3KE2A 5DD4A 4KIFA 1BOAA 1MJ9A 1K79A 3HRMA 4PGHA 4MTDA 2FBKA 2TDXA 3FM5A 2DTRA 2DLLA 1K78B 3JAMK 3R0JA 3T0YA 3K1PA 2DAOA 2G7UA 4OIQF 5D6FA 5L3FA 3WTVC 1XB4A 5H6QA 2V1DA 1EV7A 6PAXA 2VBZA 3IL2A 4FX0A 4CO8A 3KP3A 3E6MA 4ENMA 1S29A 3CJNA 1F5TA 5DV5A 3WODF 5ERIA 3KLNA 1ON1A 1IXRC 3HSEA 1R00A 2MH9A 2EJRA 4Y13A 3I58A 1C0WA 3P9IA 2V6CA 3ZN0A 1ZREA 3C7JA 3MZHA 2DO7A 1HXDA 1R1VA 3WTUC 2EK5A 1W4MA 4LLGF 1HW1A 1DUXC 2KJBA 4KYWA 5BS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ELK A;  5FB2 A;  1XGO A;  1PP8 F;  2W84 A;  3HIF A;  2LNB A;  1O3S A;  1IRG A;  4KDP A;  4K2E A;  4AIH A;  4OIP F;  4HDU A;  2NNY A;  5BMZ A;  1O7F A;  2HWV A;  2B0L A;  2FBI A;  2JZY A;  1FY7 A;  2R7D A;  2CGP A;  1DP7 P;  1AWC A;  3TOB A;  1BIB A;  4U7D A;  3EQL F;  2CQK A;  2OU2 A;  1B9M A;  2M30 A;  1LDK B;  2FEZ A;  3Q9S A;  3V8L A;  1XDU A;  4AIJ A;  2RKH A;  2P8T A;  4PGG A;  1TTY A;  2DQR A;  4ZZL A;  2W57 A;  4YFN F;  1FNN A;  2P5K A;  3ABT A;  1HSJ A;  4Y15 A;  4I2O A;  1R1T A;  1W5S A;  2NYX A;  3C18 A;  4N0B A;  2ZKZ A;  3COA C;  1DPU A;  1P4W A;  4ENK A;  2PN6 A;  2W24 A;  3TO9 A;  3WGH A;  1JE8 A;  1QGP A;  4AD9 A;  3ZMD A;  2IA2 A;  5E1Z B;  2HYF A;  3E3V A;  4IHT A;  1FPQ A;  3WU0 A;  2P5V A;  4BH9 A;  3NRV A;  2ZNZ A;  3BPX A;  1WKM A;  5AIP A;  4HA8 A;  2PG4 A;  1TNS A;  4LB6 B;  3QOP A;  5HLI A;  4Z2Y A;  1O3T A;  2PLY A;  4ENN A;  4UXN A;  2VBW A;  1S7O A;  5EEH A;  4KIB A;  5LHG A;  1LB2 A;  4L18 B;  4HF0 A;  3J7A O;  5DDG A;  5F64 A;  4L9J A;  4L9V A;  4LJZ F;  5FLX Z;  1T6S A;  1PUE E;  1L0O C;  2OD5 A;  2R7F A;  4GO1 A;  3WGG A;  4OMZ A;  3F72 A;  1BIA A;  2Q2E A;  4M6X A;  1TBX A;  2FOK A;  2CWE A;  1MD0 A;  1IN6 A;  1ULY A;  1FYM A;  2EFO A;  2DW4 A;  3SHF A;  4A0X A;  5D4R A;  1BM9 A;  3F23 A;  2IP2 A;  2UZK A;  3I4P A;  3WE2 A;  2NRA C;  1J59 A;  1D8J A;  2GXG A;  1YO5 C;  3TDZ C;  4U0V A;  1FBS A;  5K1Y A;  4DQ2 A;  4A0Y A;  5H20 A;  1BN5 A;  5ILV A;  2VT3 A;  2BBY A;  3JTG A;  3P9C A;  1F9N A;  2HKO A;  2VBY A;  2RV8 A;  4DNC A;  5D5X B;  4QWQ A;  3EYY A;  4LFU A;  4ZYG A;  2YX7 A;  3FMR A;  3FX3 A;  2DI3 A;  5JHU A;  2L3D A;  3E6C C;  2MA3 A;  2UXX A;  5D8L B;  3R6S A;  2HOE A;  1LEB A;  2EA4 A;  5HVQ C;  4HDV A;  5A2Q Z;  4BHB A;  5D5U B;  3FMQ A;  3MCZ A;  2K4B A;  1J5Y A;  1P92 A;  1HKS A;  2XVC A;  5CVJ A;  2VXZ A;  1R36 A;  5LEJ A;  2Z3Y A;  4XLN F;  3RIR A;  1G3W A;  5F1R A;  4EMS A;  3BZ6 A;  3RYP A;  3SZT A;  5ICC A;  4EQQ A;  1ZH5 A;  3IKT A;  3AAF A;  3ML6 A;  4OMY A;  2HZT A;  3PQK A;  2DU9 A;  3R0A A;  3M1E A;  1MDM A;  1KYW A;  1U8R A;  1S7A A;  5CJ9 A;  2O03 A;  2F5F A;  4A2U A;  1FX7 A;  1XCV A;  1U6G A;  5L3D A;  4I02 A;  5HLG A;  3QPT A;  2STT A;  4G6Q A;  3I54 A;  1R5H A;  2XRN A;  1G3Y A;  1WWX A;  1Z91 A;  1ZGJ A;  3HSF A;  4UV9 A;  2CSO A;  1W7P B;  2GIV A;  4BAY A;  3BWG A;  1TW2 A;  2LF8 A;  1PP7 U;  4HAM A;  1OYI A;  3CTA A;  2A3S A;  1FSE A;  2L01 A;  2XGX A;  3HHG A;  1O3R A;  1KU2 A;  3TDU C;  3I64 A;  1P4X A;  4RGU A;  4IXA A;  1T38 A;  4ETS A;  3RI4 A;  5BOX A;  3VB2 A;  5JI6 A;  1UHM A;  4IHS A;  3IWF A;  4TV7 A;  3GWZ A;  1XGM A;  2OZU A;  2BYV E;  4L5I A;  1MKM A;  1MGT A;  1Z6T A;  5HOO A;  3K1M A;  4BXU A;  4G7Z F;  4KFC A;  4RGS A;  2VE9 A;  4P55 A;  2QLZ A;  3P9K A;  2MD5 A;  4HOB A;  4WXC A;  4EJU A;  2HDC A;  1KGS A;  2KRF A;  2XKO A;  3BPV A;  5CYV A;  1XDS A;  5K5O A;  1QBJ A;  2BV6 A;  2QM3 A;  3E5Q A;  5DUI A;  3GLX A;  4HQE A;  2X4H A;  2ZME B;  2H27 A;  2OAZ A;  1FZP B;  3K1N A;  3FXR A;  2YPR A;  3SFZ A;  2QQA A;  5CVV A;  2EV0 A;  4R79 A;  2PJP A;  4PZJ A;  3GUD A;  3M8E A;  3TKY A;  2P6S A;  4OIR F;  2QBY A;  1J0R A;  3DP7 A;  5ILU A;  4KMF A;  4G7O F;  1XD7 A;  4G6D A;  1LNW A;  3V8K A;  2FU4 A;  3BDD A;  1TW3 A;  5BPD A;  5FGM A;  2H6B A;  2ACJ A;  2ETH A;  4LMY A;  4P9U A;  3REO A;  1I1S A;  5DYM A;  3D5L A;  4RB2 C;  2G7H A;  4A5N A;  2M1B A;  1KU9 A;  1LVA A;  4YG2 F;  3I5U A;  3ECO A;  1FBU A;  2PMU A;  4HF1 A;  1IN7 A;  3LAJ A;  3CLO A;  2OBP A;  2KIM A;  2DT5 A;  3K0L A;  5ICF A;  1LJ9 A;  1BBY A;  4KMU X;  1HKQ A;  2K27 A;  2JPC A;  2JT1 A;  3KP7 A;  4HZF A;  3HTU A;  4ASN A;  2GQQ A;  4YFK F;  1OYW A;  2XRO A;  1REP C;  3V4G A;  4G8X A;  1LDD A;  3KZZ A;  2KIF A;  5FD6 A;  3I59 A;  4RGX A;  3KZY A;  1B4A A;  2FF4 A;  1GVJ A;  5EEG A;  2OQG A;  3CDH A;  3ISP A;  1XSD A;  1Z7U A;  1A04 A;  3I59 B;  5IT3 A;  1ZN2 A;  2Q8K A;  5JR3 A;  1Z1D A;  1F1Z A;  3ZPL A;  3FF5 A;  1ZG3 A;  1IN4 A;  2Y75 A;  2FA5 A;  3LFK A;  2MLK A;  4WCG A;  2E7X A;  4U0W A;  3WGI A;  1S3J A;  5LGT A;  2C6Y A;  2QUF A;  2VON A;  2YU3 A;  2EFQ A;  2IW5 A;  3H92 A;  1NHA A;  4Y17 A;  1K6O A;  2FE3 A;  3RPQ A;  3T1B A;  4G9Y A;  4N9H A;  1S6L A;  1QPM A;  4ZYH A;  4EGY A;  1SD7 A;  2QQ9 A;  2A69 F;  2QYO A;  1QQI A;  4EJW A;  2GXB A;  4WWC A;  1YS7 A;  4XSZ F;  2PBI A;  3MZY A;  4BQA A;  4YIF A;  1J75 A;  4ZZD A;  5A2Q K;  3IHU A;  1Z05 A;  1Q1H A;  4ZYE A;  4I7H A;  1PDN C;  2OZ6 A;  2JRT A;  2ESH A;  1YYV A;  1U5T B;  2E1C A;  1J7K A;  3HHH A;  4WF2 A;  3E6B A;  1T0F A;  3T5X A;  2A6E F;  2ADU A;  3E6D A;  4Q4Z F;  5HDG A;  3OOP A;  3CUQ C;  2EFN A;  1K7A A;  1JHH A;  2H09 A;  4EV0 A;  4GXO A;  2QWW A;  4CXF A;  3T8T A;  4EM1 A;  1WI9 A;  2HR3 A;  4GYI A;  3ZMT A;  4RB3 C;  2VOO A;  3DKW A;  5HS7 A;  2Z99 A;  2IT0 A;  1ZRC A;  1FP2 A;  3IC7 A;  3HOS A;  3K69 A;  4OU0 A;  5LLQ A;  3KCC A;  1MDM B;  2HS5 A;  3RDI A;  3W6K B;  5ED4 A;  5E8I A;  4U7B A;  5KK1 A;  1DPR A;  5LEK A;  2Z9O A;  5DEQ A;  3GVA A;  1MJA A;  3M8F A;  1HBX G;  4YII A;  4ZYD A;  3ZP5 A;  5CVI A;  3F3X A;  1IXS B;  4IJA A;  2CW0 F;  1UFM A;  3F8F A;  2DK8 A;  2RQP A;  4O3M A;  1V3F A;  3N4M A;  4M71 A;  3HRT A;  3C3W A;  3FWE A;  1RIO H;  2ZXJ A;  3F22 A;  2UWM A;  2L4M A;  1RI7 A;  3BOQ A;  1U5T A;  4I0B A;  4OIO F;  2BEO A;  2DBB A;  3GF2 A;  4D0P A;  1EH7 A;  1GXP A;  2FSW A;  1MJB A;  1SFU A;  1JXS A;  3RKY A;  3LA2 A;  3G73 A;  3O6B B;  2P5L C;  4MEX F;  2IPQ X;  2V79 A;  2FNA A;  4L9N A;  4XSX F;  1R23 A;  4YFX F;  4BNC A;  3F8B A;  3U1D A;  4RAZ A;  4NB5 A;  3F21 A;  2MH2 A;  4A6D A;  3ZMV A;  4L9T A;  5D5V B;  4BYY A;  2GA1 A;  1W7P A;  4CGZ A;  2Z5U A;  2COM A;  3P7N A;  4UVC A;  5L3C A;  1FC3 A;  3FXQ A;  2K02 A;  2V9V A;  1F4K A;  5ICG A;  2HTJ A;  4MEY F;  1TLH B;  2VC0 A;  4Q47 A;  2Q0O A;  2M8E A;  5HDK A;  2ZO4 A;  4S05 A;  1K78 A;  3LST A;  5K5R A;  4EJV A;  2W25 A;  3RTR A;  1ZG1 A;  1Y0U A;  3RKX A;  2ZNY A;  2H6C A;  1ZRF A;  4I98 B;  3V7R A;  2BGC A;  4KNY A;  1KU3 A;  5IT9 Z;  2L54 A;  4LK0 F;  4MNU A;  4LK1 F;  2VOD A;  2G9W A;  2F5C A;  3QRF F;  4M72 A;  2VC1 A;  2RDP A;  4P9F A;  3S2W A;  1FOK A;  1ODD A;  4HLY A;  1I5Z A;  1SAX A;  1G6N A;  1BI0 A;  1G4D A;  2IRF G;  2EFP A;  1B9N A;  1EH8 A;  3R4K A;  2HQR A;  1T39 A;  1ZHF A;  1FYK A;  2EV5 A;  2ZJ2 A;  1SMY F;  2F5E A;  2P7V B;  3GX4 X;  3HUG A;  3WU1 B;  1D8K A;  2JTV A;  4L5J A;  1CF7 B;  1LEA A;  3Q5F A;  1FWZ A;  4LGW A;  4M9S A;  4KA4 A;  1USS A;  1Z6R A;  3J81 K;  2VOP A;  3ECH A;  3BJO A;  4MGR A;  4AWX B;  2QEN A;  1I1G A;  2LKP A;  4IRI A;  3LQR A;  1D5V A;  1XGS A;  5E18 F;  4RAY A;  4CHU A;  3JSP A;  3TO6 A;  2XHK A;  4O5V A;  1KU7 A;  5HLH A;  3B73 A;  4GCV A;  5LRR A;  2JSC A;  2VT2 A;  4EVI A;  5TRD A;  4R1H A;  3GXO A;  1JGS A;  5LHH A;  3VEP A;  2FML A;  3KFW X;  1X3U A;  1J2X A;  2IA0 A;  3V8J A;  2YX4 A;  1XGN A;  1CGP A;  3DPT A;  4M9X A;  1GXQ A;  2VE8 A;  3TQN A;  1XMA A;  3GFI A;  2Y0M A;  4HLX A;  4XRF A;  1P6R A;  3RJP A;  1QO0 D;  2HTS A;  3ZQ7 A;  1ZGA A;  4AVP A;  3RKW A;  1HW5 A;  2K4J A;  1QZY A;  3DEU A;  1TNT A;  1UCR A;  1R58 A;  3F8M A;  2VN2 A;  1IN8 A;  2E7W A;  3R60 A;  1B1B A;  4UNO A;  1W7P D;  1SFE A;  3L2C A;  1SD5 A;  1ZRD A;  1ON2 A;  1G3T A;  2XIG A;  5DCM B;  2ZFW A;  3M9A A;  3D0S A;  4AIK A;  4N9I A;  3LWF A;  2RNJ A;  1UHW A;  4G7H F;  4UV8 A;  4HX7 A;  2A5Y B;  2FBH A;  3FXU A;  4IVN A;  1BC7 C;  2IVM A;  4WXD A;  2HEO A;  4KUM A;  4KIG A;  5E1W A;  4HV5 A;  2D1H A;  5CLS A;  1UB9 A;  2DQL A;  3OV8 A;  2BE5 F;  5TJJ A;  3SQN A;  2RC4 A;  3VOD A;  5LBQ A;  4KN7 X;  3E5U A;  3RYR A;  3R61 A;  4LB5 A;  2P6T A;  4KT5 C;  5E1X A;  3DQV C;  3TOA A;  3E5X A;  3EDP A;  2XAF A;  5K5Q A;  5FFX A;  1R7J A;  5H6R A;  3U2R A;  1BI2 A;  4RS8 A;  3JSO A;  3EYI A;  3L09 A;  2J5O A;  1YS6 A;  1OPC A;  2FRH A;  2A07 F;  3MWM A;  5D5W B;  2ZBK A;  1IRF A;  1WRJ A;  2PMH A;  4JK1 X;  3KP4 A;  1XMK A;  3VFZ A;  1U5T C;  5ILS A;  4O6J A;  1RZ4 A;  5L3G A;  2O61 A;  2CO5 A;  2KIU A;  3BJA A;  4A12 A;  2KKO A;  3BJ6 A;  4P5O A;  5J8C A;  2ISY A;  3T8R A;  3LAP A;  3GFL A;  2HQN A;  1OR7 A;  2D1V A;  2OA4 A;  3PQJ A;  1LQ1 A;  1R22 A;  3KLO A;  1O7L A;  1XCB A;  3Q9V A;  2O3F A;  4BHC A;  1SD4 A;  4EJT A;  1OMI A;  1QZZ A;  3BRO A;  3U9G A;  1RUO A;  3QP5 A;  4ESB A;  1ZAR A;  2PFB A;  3DXJ F;  3DV8 A;  1HKT A;  3I0T A;  4NQW A;  2F5D A;  1FLI A;  3J80 K;  1KQ8 A;  3PFI A;  4HW0 A;  5E17 F;  2LF7 A;  3KET A;  2FXA A;  3VOE A;  2WC2 A;  4G94 A;  5JFR A;  4BHP A;  5HS8 A;  3ABU A;  4A0Z A;  1FSH A;  4A5M A;  4ESJ A;  3ROU A;  5DCF A;  3JAM Z;  3MAJ A;  4FHT A;  1P4A A;  4I09 A;  3RPU A;  4CIC A;  2PI0 A;  1GHC A;  1JHF A;  4RB0 A;  1IAW A;  4UVB A;  3LA7 A;  2QVO A;  4HBL A;  3F8C A;  1SD6 A;  1Z9C A;  4MQV A;  3DPL C;  2A68 F;  2YSR A;  4RB1 A;  3DFG A;  1YTY A;  1QNT A;  2M45 A;  4MQ9 F;  3HRU A;  4HV6 A;  3GO5 A;  5FFZ A;  5BPI A;  2HKX A;  5LGN A;  1TQP A;  1G3S A;  3BP8 A;  2GAU A;  2XAJ A;  1SMT A;  2Z33 A;  1TQM A;  1DDN A;  3L9F A;  3WTX C;  3NQO A;  3WTZ A;  5JVT A;  5E8G A;  3ZMZ A;  1HQC A;  1S8N A;  4WXH A;  2EWN A;  5BQT A;  1YQA A;  2X0L A;  5DUK A;  2UXN A;  4Q48 A;  4UVA A;  4ZH4 F;  2L02 A;  4GYG A;  1J9I A;  1BJA A;  3F6V A;  2AS5 F;  2WV0 A;  3MEX A;  2VBX A;  2V1U A;  2A6H F;  4F7Z A;  2DPU A;  4ON0 A;  3CUQ A;  4ESF A;  3KEQ A;  2P7C B;  4A6E A;  1MZB A;  1V4R A;  2O6G E;  2CFX A;  3O2P E;  2W85 A;  2XV4 S;  4HQM A;  1R1U A;  4MHG A;  2K7L A;  4EGZ A;  4E70 A;  3GEZ A;  3IWZ A;  3E97 A;  2L4A A;  5AON A;  2CG4 A;  3H3Z A;  1P2F A;  4JQF A;  3W6J B;  1IN5 A;  1ZAO A;  2H94 A;  3DF8 A;  1T2K A;  2V1X A;  3GW2 A;  4M74 A;  3LA3 A;  4OIN F;  1B6A A;  3L00 A;  3F8N A;  2D45 A;  1HST A;  1XSV A;  1YW9 A;  1L3L A;  5J6X A;  2GWR A;  3TGN A;  3WTT C;  5IT9 K;  1KA8 A;  2XAH A;  1AOY A;  3CUO A;  1H9G A;  2JPB A;  2P4W A;  1SFX A;  1YG2 A;  3N97 A;  3J80 Z;  1WSU A;  3HYI A;  2NS0 A;  1XSX A;  3SZP A;  3FMS A;  1IXC A;  4UHT A;  1EH6 A;  2WTE A;  2PEX A;  4IF4 A;  3WTS C;  2HGC A;  4WK8 F;  3NEU A;  2RN7 A;  3ZMS A;  1TQI A;  3IRQ A;  5F6F A;  2XKP A;  3KEO A;  1ZG5 A;  2GA2 A;  4LG0 A;  3O3K A;  4M9Z A;  3IRR A;  4IRG A;  1E2X A;  4LD5 A;  1YW8 A;  4IPA A;  3HSR A;  3JW4 A;  1HW2 A;  3GFM A;  3WTW C;  4M73 A;  3ZN1 A;  2PQ8 A;  3IKV A;  1I27 A;  3L7W A;  2LDU A;  4B8X A;  1R5G A;  1IF1 A;  1VTN C;  2J5P A;  2O8X A;  4KIC A;  1U3E M;  4HX4 A;  3CUQ B;  2EA2 A;  2ZME A;  1IZ1 A;  4GGG A;  3FHZ A;  1YLF A;  5CVR A;  2M87 A;  4CZZ A;  1OKR A;  2FQ3 A;  4HX8 A;  4NHJ A;  3C1D A;  1RNL A;  2ELH A;  5AIQ A;  2F2E A;  2OQR A;  3WG9 A;  3QAH A;  4EM0 B;  3J81 Z;  3FZV A;  2RVC A;  4LLN A;  2NAZ A;  5FO5 A;  5FLX K;  2K86 A;  5DCM A;  3H3U A;  3HTS B;  4JBA A;  3CO6 C;  4ENJ A;  4R8H A;  2DK5 A;  2KJC A;  1BI1 A;  2FNP A;  3M7G A;  1FYL A;  1OYY A;  5LGU A;  2XAG A;  5J8F A;  3GZ5 A;  1KQ9 A;  5DD8 A;  1BI3 A;  4FT8 A;  5E20 A;  2O0Y A;  3WE3 A;  4L0Z B;  4B09 A;  1U2W A;  3EUH A;  1O57 A;  4XLP F;  3QP6 A;  2QQB A;  2MC3 A;  1RUN A;  5CVU A;  4EJO A;  4Q5S F;  2M5W A;  4HYE A;  1ZLK A;  1IW7 F;  1LDJ A;  3I71 A;  4PCQ A;  2CYY A;  4IRH A;  2WWY A;  2Y48 A;  1ZLJ A;  3WTY C;  1ONV A;  5D6E A;  1WQ2 A;  4M6Y A;  2MLG A;  2R3S A;  1E17 A;  2LSO A;  5LRS A;  3HOT A;  4MTE A;  1YFH A;  4XBF A;  3JTH A;  2EFW A;  4LG0 B;  2EB7 A;  5KVR A;  3V7C A;  3ZMU A;  1STZ A;  1I6X A;  1ZYR F;  2GZW A;  3ERE D;  4I01 A;  1YIO A;  5L3B A;  3F6O A;  3MQ0 A;  2DFI A;  3GZ6 A;  1D3Y A;  3FM3 A;  4U88 A;  5HS9 A;  3GYH X;  2RGV A;  2ISZ A;  1XN7 A;  4U0Y A;  3G3Z A;  5HDN A;  3V7S A;  3KP2 A;  3ULQ B;  2XAS A;  3B02 A;  4KN4 X;  2XUB A;  5FD5 A;  2EV6 A;  4QLC U;  1H0M A;  1FT9 A;  1T98 A;  3EET A;  4RGR A;  1H9T A;  4LLL A;  3GFJ A;  2YR2 A;  1B59 A;  1IUY A;  3TO7 A;  3BY6 A;  3SXY A;  5D8K B;  2ESN A;  3QU3 A;  2HYG D;  3MFK A;  1BC8 C;  3KP5 A;  4L0Y B;  3QPH A;  2STW A;  2QZ8 A;  3LQQ A;  3KP6 A;  3I53 A;  2E1N A;  3CO7 C;  2IJL A;  2NNN A;  3K2Z A;  4P96 A;  1O3Q A;  4CDG A;  3HRS A;  4PDK A;  5L3E A;  3QU6 A;  1W5T A;  2DPD A;  5LHI A;  4I0A A;  2D2W A;  4H0E A;  4S04 A;  4OOI A;  4FX4 A;  2A61 A;  2QBY B;  4HF2 A;  4WX9 A;  4UUV A;  4EM2 A;  1KQ0 A;  2ZCW A;  5D4S A;  5ICE A;  2AXL A;  1YW7 A;  1U78 A;  1FP1 D;  1UST A;  2MBF A;  1FBQ A;  4CYD A;  3K9T A;  2FMY A;  2HFH A;  1CF7 A;  2IA1 A;  1KYZ A;  2XAQ A;  3KE2 A;  5DD4 A;  4KIF A;  1BOA A;  1MJ9 A;  1K79 A;  3HRM A;  4PGH A;  4MTD A;  2FBK A;  2TDX A;  3FM5 A;  2DTR A;  2DLL A;  1K78 B;  3JAM K;  3R0J A;  3T0Y A;  3K1P A;  2DAO A;  2G7U A;  4OIQ F;  5D6F A;  5L3F A;  3WTV C;  1XB4 A;  5H6Q A;  2V1D A;  1EV7 A;  6PAX A;  2VBZ A;  3IL2 A;  4FX0 A;  4CO8 A;  3KP3 A;  3E6M A;  4ENM A;  1S29 A;  3CJN A;  1F5T A;  5DV5 A;  3WOD F;  5ERI A;  3KLN A;  1ON1 A;  1IXR C;  3HSE A;  1R00 A;  2MH9 A;  2EJR A;  4Y13 A;  3I58 A;  1C0W A;  3P9I A;  2V6C A;  3ZN0 A;  1ZRE A;  3C7J A;  3MZH A;  2DO7 A;  1HXD A;  1R1V A;  3WTU C;  2EK5 A;  1W4M A;  4LLG F;  1HW1 A;  1DUX C;  2KJB A;  4KYW A;  5BS6 A; 
#chains in the Genus database with same CATH topology
 1AA7 A;  3ELK A;  5FB2 A;  1XGO A;  1PP8 F;  4DZP A;  2OV7 A;  1IGN A;  4E7J A;  3GTM J;  4J01 A;  2W84 A;  3HIF A;  3S14 J;  1TWF J;  4A3C J;  1ETO A;  2HI3 A;  2LNB A;  1O3S A;  1AKH B;  1IRG A;  2OPT A;  4KDP A;  2Z2S B;  1W0T A;  4K2E A;  3MMY B;  3K70 C;  4AIH A;  3H36 A;  1VND A;  1VQ4 I;  1TT0 A;  3FKI J;  3IAS 2;  2HDD A;  2V6E A;  4OIP F;  2M3A A;  2HOS A;  4HDU A;  3S1R J;  2WBM A;  2MD0 A;  2DOA A;  1W36 C;  2NNY A;  5BMZ A;  1O7F A;  4PK4 A;  2E1M B;  2HWV A;  4BY7 J;  2B0L A;  2FBI A;  2JZY A;  1OCZ H;  3AG2 H;  4BQN A;  3CMM A;  4IO9 F;  1OQY A;  3TW6 A;  2Y0S A;  1FY7 A;  2R7D A;  3FK7 A;  2CGP A;  3HC7 A;  5EG0 A;  5FRM A;  3FHN A;  1DP7 P;  3FXJ A;  1AWC A;  4Y33 A;  3TOB A;  1BIB A;  4U7D A;  3EQL F;  2FD5 A;  4MLO A;  3L2R A;  2GLO A;  3SYT A;  2CQK A;  2OU2 A;  3JRG A;  1B9M A;  2RNG A;  3CP8 A;  2M30 A;  1LDK B;  5EDN A;  3ERM A;  2FEZ A;  3Q9S A;  3V8L A;  2EIN H;  1XDU A;  4AIJ A;  2XSD C;  2RKH A;  2P8T A;  3HZJ A;  5GTH C;  2R7T A;  3N05 A;  3K6G A;  4PGG A;  3DKY A;  2L9R A;  2ZME C;  5J3L A;  2W1O A;  1TTY A;  2DQR A;  4ZZL A;  2W57 A;  3VSK A;  2GM4 A;  3M8J A;  4YFN F;  3E0J B;  1FNN A;  2Y30 A;  1RES A;  2P5K A;  3ABT A;  1HSJ A;  5FKK A;  2L9V A;  3G1M A;  4Y15 A;  5EG0 B;  2R7U A;  3O8G A;  3LL7 A;  3W2W A;  1R5I D;  4I2O A;  2XGE A;  4IHV A;  1R1T A;  4C3I J;  1W5S A;  4A3F J;  3CCV I;  1LPQ A;  3HOU J;  4UB8 C;  3BLY A;  2NYX A;  3C18 A;  2CUJ A;  2ZKZ A;  4N0B A;  3COA C;  1DPU A;  1P4W A;  1LVK A;  2JVG A;  3LSM A;  1KON A;  2Z1D A;  2VUM J;  5M5X J;  4ENK A;  2PN6 A;  1X1C A;  1Y1V J;  2W24 A;  1IRX A;  4JX6 A;  3D1N I;  2O9L A;  4LIU A;  3TO9 A;  3WGH A;  4BE2 A;  1JE8 A;  1B8I B;  1QGP A;  3VPR A;  1WJB A;  3H5R A;  4AD9 A;  2WY7 Q;  4XK4 A;  3ZMD A;  4B4C A;  5B66 C;  2IA2 A;  5E1Z B;  5GTI C;  5FLV A;  2HYF A;  3E3V A;  3CMA I;  4IHT A;  1FTT A;  1FPQ A;  3BG7 A;  3WU0 A;  1HC8 A;  2DA1 A;  2P5V A;  2X1E A;  2BZT A;  4BH9 A;  3NRV A;  3PSF A;  2ZNZ A;  3BPX A;  3L1P A;  1WKM A;  5AIP A;  2VKD A;  2BY0 A;  4HA8 A;  3JRB A;  3WHC A;  3MKW B;  1BA5 A;  1W0U A;  2PG4 A;  1TNS A;  4LB6 B;  3QOP A;  5HLI A;  4Z2Y A;  1O3T A;  1V5F A;  2O7O A;  2PLY A;  3S2H J;  4ENN A;  4UXN A;  2VBW A;  1GV2 A;  3CDI A;  3PNY A;  5B1B H;  1S7O A;  4XR6 A;  5EEH A;  4KIB A;  1W36 D;  3G1O A;  5LHG A;  3HPH A;  1LB2 A;  4L18 B;  1ETX A;  4HF0 A;  3J7A O;  5DDG A;  5M5W J;  5F64 A;  4L9J A;  1OCC H;  2DJI A;  2K3F A;  1ETW A;  1ERD A;  2XAU A;  4L9V A;  3Q0V A;  3TW7 A;  3OS2 A;  4LJZ F;  4G6T B;  5FLX Z;  2EPF A;  2ICW G;  3OSF A;  1T6S A;  3U21 A;  1PUE E;  1L0O C;  2OD5 A;  3EUA A;  5IP9 J;  3RSN A;  4B44 A;  5FLM J;  2R7F A;  4GO1 A;  5E3L A;  3WGG A;  1VQ9 I;  3I55 I;  3S1M J;  2DMU A;  4OMZ A;  1VZ0 A;  1B72 A;  1I3A A;  1V5E A;  3F72 A;  1BIA A;  2Q2E A;  4M6X A;  5J4Y A;  1TBX A;  2FOK A;  2CWE A;  3K7A J;  1MD0 A;  3LSP A;  4XKW A;  2B63 J;  1PJR A;  1IN6 A;  3LSK A;  3ZOB A;  1ULY A;  2X6W A;  3QPS A;  3A01 A;  3A0H C;  4E6K G;  1X2N A;  1FYM A;  1ITY A;  2EFO A;  2DW4 A;  3SHF A;  4CYC A;  3A2K A;  1GVD A;  4A0X A;  1D1B A;  2FOW A;  1RPW A;  1MH4 A;  2V4J C;  2FX0 A;  5D4R A;  3J7Z I;  1BM9 A;  3F23 A;  1YJN I;  2IP2 A;  3CCL I;  2W4S A;  2UZK A;  1NTC A;  3FXO A;  3I4P A;  2DCE A;  3WE2 A;  2DJN A;  2NRA C;  2E60 A;  3F9K A;  1J59 A;  2NS8 A;  3G2B A;  4JYK A;  4II3 A;  1D8J A;  2Y9Y A;  2GXG A;  1YO5 C;  2L7F P;  4BXX J;  3TDZ C;  2R7S A;  4U0V A;  1FBS A;  4IEJ A;  3DCF A;  3DEE A;  3PNV A;  2O8K A;  5K1Y A;  3E1S A;  3CMY A;  4DQ2 A;  4A0Y A;  5H20 A;  3OS1 A;  4V19 K;  3H9Q A;  2OC6 A;  1BN5 A;  2EZH A;  5ILV A;  2VT3 A;  2L2O A;  2Z16 A;  4CA0 A;  2LP0 A;  2BBY A;  3JTG A;  3P9C A;  1F9N A;  2FQ4 A;  2HKO A;  2VBY A;  2RV8 A;  4DNC A;  3H5N A;  3VWB A;  5K7F A;  1Z7L A;  1ZR2 A;  2EIM H;  2DA3 A;  2E71 A;  3FBN B;  5IP6 A;  2XF7 A;  5D5X B;  4CYC B;  4QWQ A;  3EYY A;  4LFU A;  4ZYG A;  2YX7 A;  3FMR A;  5KHD A;  3FX3 A;  3SFI A;  2DI3 A;  5JHU A;  1JKQ C;  2L3D A;  1BR4 A;  1WCM J;  3E6C C;  3HKZ N;  2MA3 A;  1WJ5 A;  2UXX A;  3H0D A;  3OR1 C;  5D8L B;  1UG2 A;  3R6S A;  2BY3 A;  2HOE A;  3VYS B;  1LEB A;  2EA4 A;  5HVQ C;  4A3E J;  3BR1 A;  4XN3 A;  4HDV A;  5A2Q Z;  4HNU A;  4BHB A;  3BZK A;  5D5U B;  3FMQ A;  3L2V A;  3MCZ A;  1IC8 A;  3BTJ A;  2ME6 A;  2K4B A;  3DU6 A;  1NK3 P;  1J5Y A;  1P92 A;  3TBI A;  3HOX J;  2M34 A;  1HKS A;  4BY1 J;  2RQQ A;  2XVC A;  1HF0 A;  1WJE A;  1MBJ A;  5CVJ A;  3JRI A;  2HVQ A;  3MKL A;  3OYA A;  2VXZ A;  3ABM H;  1R36 A;  1ZEL A;  2QKL B;  3BCA A;  5LEJ A;  2H8R A;  1N75 A;  2Z3Y A;  1R71 A;  3S1Q J;  4XLN F;  3RIR A;  2R5Y A;  1G3W A;  4CUG A;  5F1R A;  5J4V A;  4EMS A;  4DBQ A;  2OTL I;  3BZ6 A;  5E79 C;  3LMM A;  3GTJ J;  3RYP A;  5C44 J;  2KP6 A;  3SZT A;  5ICC A;  4EQQ A;  3LSJ A;  4XOR A;  1VQ7 I;  1ZH5 A;  1N25 A;  4JOM A;  3IKT A;  3OYF A;  3AAF A;  3ML6 A;  1U8B A;  3AL0 C;  2COB A;  4OMY A;  2HZT A;  5JLW A;  3PQK A;  5EF6 A;  2E5N A;  2DU9 A;  3R0A A;  2QKM B;  3M1E A;  1KYW A;  1MDM A;  1UMQ A;  1U8R A;  5DTD A;  5KAI C;  1Z0X A;  3OL4 A;  1S7A A;  5CJ9 A;  2O03 A;  2F5F A;  4GFB A;  4UUS A;  4A2U A;  1FX7 A;  1XCV A;  1U6G A;  4IOC F;  2IGN A;  5FJ8 J;  5L3D A;  4I02 A;  3OYC A;  5HLG A;  5C3E J;  3MN2 A;  3LSI A;  3QPT A;  3BC8 A;  3HGG A;  3PM1 A;  1D1C A;  4D5F A;  2EZK A;  1R9T J;  1JJ6 C;  3SJM A;  2STT A;  5H2F C;  4G6Q A;  4Y3O A;  1B8I A;  2KIS A;  2F4I A;  1JUS A;  3I54 A;  1R5H A;  1A36 A;  2XRN A;  2DXI A;  1G3Y A;  5EGO A;  1WWX A;  4A3D J;  3PIP F;  1Z91 A;  5IY5 H;  4KT6 A;  1JTX A;  1ZGJ A;  3TMO A;  3HSF A;  4UV9 A;  1MNM C;  3BR3 A;  4M3F A;  2CSO A;  1W7P B;  1X19 A;  2GIV A;  2WAF A;  4D1Q A;  4Y7N J;  4BAY A;  3BWG A;  2Y31 A;  1TW2 A;  2LF8 A;  4HSR A;  1PP7 U;  2JWT A;  4HAM A;  1OYI A;  4XLC A;  4IL6 C;  3CTA A;  2A3S A;  2W48 A;  5C4J J;  1PUF A;  3NWS A;  5IOY A;  1FSE A;  2L01 A;  2VJ5 A;  3DBR B;  4BUP A;  2HQA A;  2XGX A;  3QYB A;  5TIS C;  1DGW Y;  2AHQ A;  3HHG A;  3CCS I;  2EH3 A;  1KU2 A;  1O3R A;  3TDU C;  4X1E A;  1TP4 A;  2ZSI B;  1X3W B;  3I64 A;  1P4X A;  3FBI B;  4RGU A;  4X0G A;  4RM3 A;  4IXA A;  2LMD A;  5HNF A;  1OFC X;  1T38 A;  4ETS A;  3RI4 A;  5BOX A;  3VB2 A;  5JI6 A;  3D5R C;  2LD5 A;  1UHM A;  4IHS A;  4XN0 A;  2VKV A;  3IWF A;  4TV7 A;  3GWZ A;  1XGM A;  3AL0 B;  1U9N A;  1Z3X A;  2PX9 A;  3HJE A;  3OYH A;  3RZO J;  2OZU A;  2BYV E;  4L5I A;  1RR7 A;  1MKM A;  3OIQ A;  1MGT A;  2R7W A;  1OJL A;  1V5G A;  1ZTR A;  2VPR A;  2IS6 A;  2E2H J;  1Z6T A;  1FTZ A;  5HOO A;  2NVT J;  4A3B J;  3K1M A;  2Y69 H;  4BXU A;  4G7Z F;  4KIS A;  4KFC A;  4RGS A;  4BE1 A;  2VE9 A;  4P55 A;  2QLZ A;  1R4N B;  1OCR H;  2BW3 B;  4PJ0 C;  1EJ9 A;  3LSG A;  1WPK A;  3P9K A;  1XTA A;  4DYR A;  5HNH A;  2HXO A;  3G6E I;  2MD5 A;  4HOB A;  4WXC A;  3BG6 A;  1NG6 A;  4EJU A;  2HDC A;  5J1R A;  3HDD A;  2VPL A;  2IAI A;  3OYL A;  1KGS A;  2KRF A;  2XKO A;  5DM7 F;  4XRS G;  3BPV A;  5CYV A;  1VQK I;  1XDS A;  5K5O A;  1QBJ A;  1BR1 A;  3EUK L;  4Y4R A;  2BV6 A;  2QM3 A;  3E5Q A;  2K9L A;  1X1P A;  3RPU D;  3MZ8 A;  1OIS A;  5DUI A;  3G4S I;  4NUB A;  4F92 B;  3GLX A;  4NC7 A;  4HQE A;  2QA4 I;  1A31 A;  1WJC A;  1S72 I;  1E3O C;  2X4H A;  2ZME B;  2H27 A;  2CFO A;  2OAZ A;  2X1D A;  2VQG A;  1FZP B;  4FE7 A;  1WJA A;  1IJW C;  1M1E B;  2ZJR F;  3K1N A;  1W5C C;  2LKX A;  3FXR A;  2YPR A;  3SFZ A;  1SVM A;  2LR8 A;  2QQA A;  3JRA A;  5CVV A;  1Y8Q B;  3CCQ I;  1UAA A;  2EV0 A;  2M4G A;  4R79 A;  2LY9 A;  2PJP A;  4PZJ A;  4W97 A;  3GUD A;  3M8E A;  3TKY A;  5GAD J;  2P6S A;  3SEQ A;  4OIR F;  2QBY A;  1J0R A;  3DP7 A;  5ILU A;  1EA3 A;  4E7L A;  4KMF A;  4ZDO A;  2E36 A;  3FXM A;  3HBL A;  4G7O F;  1XD7 A;  4BAC A;  4G6D A;  1PVE A;  1LNW A;  3V8K A;  2FU4 A;  4UUS B;  4QIW N;  3WU2 C;  3BDD A;  2JK3 A;  1X4P A;  2XF5 A;  1TW3 A;  5BPD A;  2CW8 A;  2LTP A;  5FGM A;  3FIS A;  4XMY A;  3I56 I;  2TCT A;  2H6B A;  4PSW A;  2ACJ A;  2ETH A;  1HDP A;  1WGX A;  4LMY A;  4CZC A;  3I3L A;  2XRL A;  4P9U A;  2IBD A;  2DA5 A;  5EZH A;  3REO A;  1I1S A;  2CV0 A;  5DYM A;  3D5L A;  9ANT A;  4RB2 C;  2I5U A;  4HRI A;  3K4C A;  2G7H A;  3QYF A;  4A5N A;  3U1K A;  4E7Z A;  2NOJ B;  4XRM A;  4MFD A;  4D7M A;  3BG5 A;  2M1B A;  5J1Y A;  2K40 A;  1DU6 A;  1YIT I;  1KU9 A;  3S16 J;  3A01 B;  1LVA A;  4YG2 F;  3UR3 C;  4XOT A;  1RRJ A;  3I5U A;  3ECO A;  1J09 A;  4IHW A;  1FBU A;  2PMU A;  3HKZ A;  4HF1 A;  4BU2 A;  1IN7 A;  1N78 A;  3X2Q H;  3LAJ A;  3CLO A;  3QYE A;  5FKL A;  2KLO A;  3HM5 A;  3OYB A;  2OBP A;  4E7H A;  2KIM A;  2LH9 A;  2DT5 A;  2V9K A;  3K0L A;  5FKN A;  4EEF G;  5ICF A;  3OYK A;  3OMY A;  3TL4 X;  3SDB A;  1LJ9 A;  1BBY A;  4KMU X;  1HKQ A;  3ASO H;  3M3Y J;  1VQP I;  3CDL A;  3VDX A;  4JX5 A;  4B3A A;  2K27 A;  4XKV A;  2JPC A;  1WH5 A;  4FIS A;  5C4X J;  2JT1 A;  1V54 H;  1X3Z B;  5EEA A;  1Y0N A;  3KP7 A;  4HZF A;  3GCM A;  3HTU A;  4ASN A;  2GQQ A;  3AG1 H;  1D0Y A;  4YFK F;  1FOW A;  3W6V A;  1OYW A;  2EIJ H;  1VQ6 I;  2AO9 A;  2XRO A;  1REP C;  1WH7 A;  3V4G A;  4ZDP A;  5IYC J;  3A4C A;  4G8X A;  1JTY A;  1LDD A;  1ZKG A;  5GPA A;  3KZZ A;  2VI6 A;  2CUE A;  2KIF A;  5FD6 A;  3I59 A;  5J47 A;  2ZB9 A;  1RKW A;  4RGX A;  3J7A Y;  4RBO A;  3KZY A;  5F0F A;  1B4A A;  2FF4 A;  2VQC A;  1GVJ A;  5EEG A;  2OQG A;  3CDH A;  4FAS D;  3ISP A;  1XSD A;  2IS4 A;  2HU9 A;  1Z7U A;  3IV5 A;  1A04 A;  3I59 B;  5IT3 A;  3NAR A;  1ZN2 A;  2Q8K A;  5JR3 A;  1SFO J;  1Z1D A;  3AG3 H;  4B3X A;  4QPO A;  4OAY A;  1F1Z A;  3ZPL A;  3FF5 A;  1ZG3 A;  1IN4 A;  2JQ7 A;  2LLK A;  2Y75 A;  5LFA A;  5JHF A;  2FA5 A;  2KDO A;  4M3G A;  3LFK A;  2K85 A;  4MIM A;  2DDB A;  3CCR I;  2MLK A;  4WCG A;  2E7X A;  4U0W A;  3WGI A;  1S3J A;  4DOZ A;  5LGT A;  2C6Y A;  2QUF A;  2VON A;  2YU3 A;  1VF9 A;  2EFQ A;  2IW5 A;  3H92 A;  1NHA A;  4Y17 A;  3KYL A;  1VQO I;  1K6O A;  5GP9 A;  2FE3 A;  3S3O A;  3RPQ A;  3T1B A;  1NH3 A;  4G9Y A;  1LFP A;  4N9H A;  1B72 B;  3S2D J;  1S6L A;  1QPM A;  4ZYH A;  4EGY A;  1IUF A;  1YJW I;  1SD7 A;  2QQ9 A;  2IS2 A;  2DN0 A;  2A69 F;  2QYO A;  1QQI A;  1P7I A;  4EJW A;  4RAG A;  2CV1 A;  2GXB A;  4WWC A;  2AXT C;  3H3V K;  1YS7 A;  4XRS A;  4XSZ F;  2PBI A;  3CCY A;  1QPI A;  3MZY A;  4BQA A;  3ZQI A;  5B5E C;  3PUB A;  4YIF A;  1J75 A;  4ZZD A;  3K4N A;  5A2Q K;  2ELK A;  3IHU A;  1MMA A;  1Z05 A;  1Q1H A;  4ZYE A;  3KEY A;  4I7H A;  1PDN C;  2OZ6 A;  2AQE A;  1G59 A;  2JRT A;  4NNJ A;  2ESH A;  1BOB A;  1U5T B;  1YYV A;  3C2G A;  2E1C A;  2ZFU A;  1J7K A;  2JUG A;  3CC4 I;  3HHH A;  4WF2 A;  3E6B A;  2OUM A;  3K2A A;  1T0F A;  2KQR A;  2LVS A;  3T5X A;  2A6E F;  2VQL A;  2H1K A;  2ADU A;  3E6D A;  4MO7 A;  4Q4Z F;  5HDG A;  3OOP A;  2B9S A;  1DQU A;  2L9N A;  1LUJ B;  3CUQ C;  2EFN A;  3OR2 C;  1K7A A;  1JHH A;  2H09 A;  1PUF B;  3M4O J;  2XDV A;  1E3P A;  2DOE A;  2LYC A;  2ID3 A;  2E2J J;  1A5J A;  4EV0 A;  4GXO A;  2CS3 A;  2QWW A;  5K7Z A;  4CXF A;  3T8T A;  4EM1 A;  1WI9 A;  2WA0 A;  2HR3 A;  4GYI A;  1H89 C;  3ZMT A;  3ZQQ A;  2V1N A;  2WAQ N;  4DYQ A;  4RB3 C;  2VOO A;  3DKW A;  5HS7 A;  4PFP A;  2Z99 A;  2H1L A;  4L5E A;  2IT0 A;  3CLQ A;  1ZRC A;  1G2H A;  1FP2 A;  3SDG A;  2ECC A;  3BTC A;  3IC7 A;  3VSL A;  3HOS A;  3K69 A;  4OU0 A;  1TWH J;  5LLQ A;  3KCC A;  4XIC A;  1MDM B;  5JLX A;  3HGY A;  1FEX A;  1MIJ A;  1HA8 A;  2HS5 A;  3RDI A;  3W6K B;  5ED4 A;  5E8I A;  2VJ4 A;  4U7B A;  2VQH A;  4JP0 A;  5KK1 A;  1DPR A;  5LEK A;  2Z9O A;  3KPH A;  5DEQ A;  3GVA A;  1MJA A;  2MG4 A;  3M8F A;  1UZC A;  1HBX G;  1WJD A;  4YII A;  1ETK A;  4ZYD A;  4A3G J;  2DA2 A;  2Y9Z A;  3ZP5 A;  4AYB A;  5CVI A;  3OYD A;  2EBI A;  2R5Z B;  3F3X A;  1IXS B;  4IJA A;  2CW0 F;  2HNH A;  2JMW A;  2QQ8 A;  1UFM A;  1JGG A;  3F8F A;  2DK8 A;  2RQP A;  2M8G X;  1V3F A;  4O3M A;  3N4M A;  4ZDL A;  1I39 A;  4M71 A;  3L2Q A;  3HRT A;  3C2H A;  1MNE A;  3C3W A;  1ZQ3 P;  2VB6 A;  3FWE A;  1RIO H;  2ZXJ A;  3ONQ A;  3F22 A;  2UWM A;  3GTO J;  2L4M A;  3HEF A;  1RI7 A;  3BOQ A;  3ZXS A;  4MFE A;  1U5T A;  4I0B A;  1TWC J;  3BQZ A;  5GAE J;  4HNT A;  4OIO F;  2BEO A;  2DBB A;  3GF2 A;  4D0P A;  1NK2 P;  3MVP A;  1EH7 A;  3LNQ A;  3ZCO A;  2NOG A;  1GXP A;  4U87 A;  2FSW A;  3ABL H;  1MJB A;  1SFU A;  1JXS A;  3KZI C;  3RKY A;  5EGO B;  1EKE A;  3LA2 A;  5F27 A;  4CCN A;  3O6B B;  3G73 A;  1FIA A;  2P5L C;  1TWG J;  1N77 A;  1RR8 C;  3IH4 A;  4MEX F;  4IX7 A;  2IPQ X;  2V79 A;  4C2M J;  2FNA A;  4C2T A;  1Z67 A;  4L9N A;  4XSX F;  1R23 A;  4YFX F;  4ZTF A;  2DYS H;  4CH7 A;  2CU7 A;  4BNC A;  2HXI A;  2X51 A;  3F8B A;  3U1D A;  4RAZ A;  4NB5 A;  3HG9 A;  3F21 A;  2MH2 A;  4A6D A;  3ZMV A;  1SVL A;  4HG2 A;  4L9T A;  5HOD A;  5D5V B;  1T56 A;  4BYY A;  2GA1 A;  3DPU A;  4M3E A;  1W7P A;  2M9H A;  4CGZ A;  2ZXW H;  2QSF X;  2Z5U A;  5EZG A;  2W82 A;  2COM A;  1Q1V A;  3P7N A;  1R6R A;  4UVC A;  1WJF A;  2BXZ A;  5L3C A;  1FC3 A;  3FXQ A;  4FET A;  1QA6 A;  4A3I J;  2K02 A;  1HLV A;  2V9V A;  1MMG A;  1F4K A;  4YRV A;  1ETQ A;  2GOX B;  2HTJ A;  4MEY F;  1TLH B;  5ICG A;  2JA6 J;  3OYJ A;  2VC0 A;  4Q47 A;  2Q0O A;  2M8E A;  1MBH A;  4FTH A;  5HDK A;  5KNL A;  2ZO4 A;  1JT6 A;  4RLF A;  1T08 B;  4S05 A;  1K78 A;  4E7S A;  3LST A;  4NC8 A;  5K5R A;  2DOF A;  3K4B A;  4EJV A;  3S93 A;  2W25 A;  3RTR A;  1P9Q C;  1ZG1 A;  1VQM I;  1Y0U A;  1IG7 A;  3RKX A;  2ZNY A;  1SFK A;  2BY2 A;  2H6C A;  2JJ7 A;  1ZRF A;  2ME0 A;  3H35 A;  5F1J A;  1YI2 I;  2DMT A;  4I98 B;  2BGC A;  3V7R A;  4YEJ A;  4KNY A;  3FXL A;  3TED A;  4NC6 A;  1KU3 A;  2DYR H;  5IT9 Z;  2L54 A;  4LK0 F;  4MNU A;  4LK1 F;  2VOD A;  2G9W A;  4HPQ A;  3W2A A;  2F5C A;  1D0Z A;  4BGD A;  3QRF F;  4M72 A;  2VC1 A;  2RDP A;  4P9F A;  3S2W A;  1FOK A;  4M6V A;  1ODD A;  4HLY A;  1I5Z A;  3OIP A;  1G6N A;  4PJL A;  1SAX A;  1BI0 A;  1G4D A;  4IQJ A;  4I76 A;  3ZQG A;  2IRF G;  3VYT B;  2EFP A;  1B9N A;  1Z21 A;  1EH8 A;  3R4K A;  2HQR A;  1T39 A;  2DA7 A;  1ACI A;  1ZHF A;  2JRM A;  2EIK H;  2MC4 A;  2V9P A;  1FYK A;  2EV5 A;  2ZJ2 A;  1SMY F;  2F5E A;  2KT0 A;  2KZV A;  4BJ5 C;  3PO3 J;  3S17 J;  2P7V B;  2JA2 A;  3GX4 X;  3CCM I;  2BHY A;  3DLL F;  1KZH A;  2ELJ A;  3HUG A;  4AC0 A;  1D8K A;  2JTV A;  3WU1 B;  1A35 A;  4L5J A;  1CF7 B;  2HPM A;  1F36 A;  1JUM A;  1LEA A;  4BQO A;  3Q5F A;  1LFB A;  1FWZ A;  4LGW A;  4M9S A;  4KA4 A;  1VI0 A;  5CKT A;  3NWT A;  4ABZ A;  1USS A;  1Z6R A;  3J81 K;  3IH2 A;  2VOP A;  2X9D A;  3SEZ A;  3ECH A;  3BJO A;  4MGR A;  4ANJ A;  4AWX B;  2QEN A;  1S5L C;  1I1G A;  5GAG J;  2LKP A;  4JX4 A;  4IRI A;  3LQR A;  1BR2 A;  4BDY A;  1D5V A;  5JVG F;  1XGS A;  5E18 F;  1Y56 A;  1VQN I;  1D1A A;  4RAY A;  4CHU A;  1I50 J;  3JSP A;  2EQR A;  3TO6 A;  5F0H A;  1MBG A;  4DZJ A;  1SC7 A;  2XHK A;  3OWT A;  4O5V A;  1KU7 A;  4PUS A;  5HLH A;  4DYC A;  1Y1W J;  1LE8 A;  3B73 A;  3WHB A;  1K6Y A;  2DA6 A;  4GCV A;  4NDL A;  5LRR A;  2JSC A;  2VT2 A;  3W3C A;  4EVI A;  3G71 I;  4BE0 A;  5TRD A;  5EYR A;  4R1H A;  3GXO A;  1JGS A;  5LHH A;  2CRG A;  3VEP A;  1YHQ I;  2DMQ A;  3OYN A;  2KDZ A;  1APL C;  1T33 A;  4RLQ A;  2FML A;  3KFW X;  1X3U A;  4XLF A;  1J2X A;  1QVU A;  2IA0 A;  3V8J A;  3FKJ A;  1IV6 A;  2QCO A;  1TT5 B;  3RQI A;  2XGD A;  2YX4 A;  4G12 A;  4ZYA A;  4QPQ A;  3C2B A;  1XGN A;  2IXS A;  3CZ6 A;  1CGP A;  3W2V A;  3DPT A;  1XPX A;  1AU7 A;  4M9X A;  2DT7 B;  1GXQ A;  2HZD A;  2F6C A;  1JT0 A;  3BR0 A;  4BEH A;  1MBK A;  2VE8 A;  3TQN A;  3B6C A;  1XMA A;  4OWR B;  3GFI A;  1R49 A;  2R93 J;  2Y0M A;  1MMD A;  3DTI A;  4HLX A;  4XRF A;  1P6R A;  4HEA 2;  2QF7 A;  3GZN B;  4V2G A;  3RJP A;  1QO0 D;  1X2M A;  2HTS A;  3ZQ7 A;  1ZGA A;  3OOU A;  4AVP A;  1SEU A;  2X48 A;  3RKW A;  1HW5 A;  2K4J A;  1OCT C;  1QZY A;  4OAZ A;  3DEU A;  3BR5 A;  1BL0 A;  1TNT A;  1UCR A;  1R58 A;  4RAF A;  3I4M J;  4A3M J;  1JUP A;  3TP3 A;  3F8M A;  2VN2 A;  4CCL A;  3BR2 A;  1IN8 A;  2E7W A;  4AM3 A;  1GT0 C;  3R60 A;  1SAN A;  3KX2 A;  1B1B A;  4UNO A;  1W7P D;  1SFE A;  3L2C A;  2Y2Z A;  1HOM A;  4EAT A;  1SD5 A;  1ZRD A;  1ON2 A;  2WAQ A;  1G3T A;  1X1A A;  2XIG A;  5DCM B;  4IQ4 A;  3S3M A;  3CD6 I;  4BQQ A;  2ZJQ F;  4XL9 A;  2KZG A;  2ZFW A;  4BDZ A;  3M9A A;  3D0S A;  1TZL A;  4KIT B;  4N9I A;  2IGK A;  4AIK A;  3JR9 A;  3LWF A;  2RNJ A;  1JI8 A;  1UHW A;  4G7H F;  4UV8 A;  4HX7 A;  2A5Y B;  5LD2 C;  3DU5 A;  2XPU A;  2FBH A;  3FXU A;  4IVN A;  3AFH A;  1BC7 C;  2IVM A;  4WXD A;  4PJM A;  2HEO A;  4IHY A;  4KUM A;  4KIG A;  5E1W A;  4HV5 A;  2D1H A;  5CLS A;  2JN6 A;  1UB9 A;  2DQL A;  2B7E A;  5J40 A;  3OV8 A;  2BE5 F;  3S1N J;  5TJJ A;  3IUO A;  1WFX A;  4F52 A;  3SQN A;  2RC4 A;  3VOD A;  5LBQ A;  2F5V A;  1FMV A;  2K9Q A;  3E5U A;  2DFF A;  4KN7 X;  3RYR A;  3R61 A;  4A3J J;  3ZGK A;  2JSP A;  1NG7 A;  2P6T A;  4LB5 A;  2HQ5 A;  1QVT A;  3ESW B;  4KT5 C;  5E1X A;  3DQV C;  3TOA A;  3E5X A;  3EDP A;  2XAF A;  1UJ8 A;  2RRE A;  1TL8 A;  5K5Q A;  5FFX A;  2W7N A;  1R7J A;  5H6R A;  1X58 A;  1Z3Y A;  3U2R A;  1MSF C;  1BI2 A;  4RS8 A;  3I9V 2;  4J19 A;  3HOY J;  2M4K A;  4IHX A;  1BW5 A;  3JSO A;  2HOA A;  3EYI A;  3GBG A;  2I8D A;  3L09 A;  1XC5 A;  2J5O A;  4HNV A;  1YS6 A;  4IOA F;  1OPC A;  1O4X A;  4GRI A;  1XMX A;  1E0E A;  2FRH A;  2A07 F;  3MWM A;  3DTK A;  2MGQ A;  4A3K J;  3FIW A;  2XC7 A;  3LOC A;  5D5W B;  3CF5 F;  2ZBK A;  2OCC H;  3AKZ A;  1IRF A;  2VXD A;  1WRJ A;  5CQE A;  2PMH A;  4JK1 X;  3H1C A;  1XMK A;  3KP4 A;  3VFZ A;  4ITV A;  2F4M B;  1U5T C;  2IEK A;  5ILS A;  4DIQ A;  4O6J A;  2F48 A;  3CES A;  1RZ4 A;  5L3G A;  2O61 A;  2CO5 A;  2KIU A;  3BJA A;  2P81 A;  4A12 A;  1UHS A;  3QQA A;  2NS7 A;  4QTR A;  1IDY A;  2KKO A;  3BJ6 A;  2ZJP F;  2WY8 Q;  1K61 A;  4P5O A;  2CJJ A;  3B6A A;  2A05 A;  2ISY A;  5J8C A;  1HDD C;  3T8R A;  2CUF A;  1UG0 A;  3LAP A;  1UEL B;  3GFL A;  3HB9 A;  3K4L A;  1LE8 B;  1H88 C;  2HQN A;  2PMZ N;  1OR7 A;  3A02 A;  1GLN A;  2D1V A;  2OA4 A;  3PQJ A;  3S3N A;  1LQ1 A;  1HCR A;  1R22 A;  3KLO A;  2F4O B;  1O7L A;  3PFY A;  4YEL A;  1YE9 A;  2HOT A;  3V42 A;  2E1M C;  1XCB A;  3Q9V A;  4I99 C;  2O3F A;  1Z77 A;  4BHC A;  1SD4 A;  4EJT A;  1OMI A;  1YOV B;  3JRH A;  2NVQ J;  2P0W A;  1QZZ A;  3BRO A;  1U0J A;  2PJR B;  4FQG A;  2M2E A;  2CUZ A;  1T8I A;  2L9S A;  1JJ8 C;  2M0M A;  2ZXH A;  3U9G A;  2E34 A;  1RUO A;  3L2W A;  3QP5 A;  4Z6Y A;  4ESB A;  1ZAR A;  1YJ9 I;  3DEW A;  2PFB A;  2LOO A;  3OYE A;  1E3H A;  3DXJ F;  3DV8 A;  1HKT A;  3CJQ B;  3I0T A;  1AHD P;  4NQW A;  1A6I A;  2F5D A;  1FLI A;  3H5A A;  2BVL A;  2HDW A;  3J80 K;  1IO2 A;  3H9G A;  1KQ8 A;  3PFI A;  4HW0 A;  4II2 A;  2EZL A;  4BJT A;  5M5Y J;  2L5Q A;  3OYG A;  5E17 F;  4D5C A;  2LF7 A;  3KET A;  2FXA A;  3VOE A;  2WC2 A;  3GME A;  4BXF A;  1JKP C;  2LC2 A;  5IYD J;  2L7M P;  4G94 A;  5JFR A;  3E7L A;  3FDY A;  2X6Y A;  2XSJ C;  2NVX J;  4BHP A;  4P1W A;  5EJC A;  4A69 C;  5HS8 A;  1RKT A;  1W1W E;  3ABU A;  4PJJ A;  2GOM A;  4A0Z A;  1FSH A;  1WI3 A;  4IZZ A;  4A5M A;  1BJZ A;  4GDF A;  2WV1 A;  4ESJ A;  1MMS A;  3ROU A;  5DCF A;  3JAM Z;  5IPA A;  2X6X A;  3MAJ A;  4FHT A;  2CQX A;  3JRD A;  3MKY B;  1WVR A;  1P4A A;  1X1D A;  4I09 A;  4UUT A;  3RPU A;  3EUH C;  2OJE D;  4CIC A;  4CCO A;  2PI0 A;  2R7R A;  1GHC A;  3HUG B;  1JHF A;  4ZJZ A;  4RB0 A;  1I6H J;  4LG3 A;  1IAW A;  3ZQF A;  3RQ4 A;  3OL3 A;  4UVB A;  4NBQ A;  3LA7 A;  3HOV J;  1ZK8 A;  2QVO A;  4HBL A;  2A6T A;  3F8C A;  5F08 A;  1SD6 A;  1Z9C A;  1P7J A;  4M3B A;  3JCU C;  2PMZ A;  3S15 J;  4MQV A;  4UY8 I;  1XX5 A;  2RAE A;  2EZI A;  4XKB A;  5B3S H;  4BBR J;  1Y6I A;  2A68 F;  2YSR A;  3DPL C;  2X85 A;  4RB1 A;  3DFG A;  1YTY A;  1QNT A;  2M45 A;  4MQ9 F;  3JRC A;  2Q2E B;  2FJ1 A;  3HRU A;  4HV6 A;  2BXY A;  2O5R A;  3GO5 A;  3DTE A;  5FFZ A;  5BPI A;  3H0G J;  2HKX A;  2JUC A;  5LGN A;  1TQP A;  1G3S A;  3BP8 A;  2GAU A;  3QWL A;  2KRC A;  4C3J J;  2YUS A;  2XAJ A;  1SMT A;  1IRZ A;  2H8W A;  2GIZ A;  3BTI A;  4D9J A;  1ZR4 A;  4PSX A;  2LY2 A;  4DW6 A;  2Z33 A;  1QU3 A;  4C3H J;  3OS0 A;  3HXL A;  3I4N J;  1TQM A;  1DDN A;  2VJI A;  3CF2 A;  3L9F A;  3WTX C;  3NQO A;  1SVO A;  2CH0 A;  4I6Z A;  1RC9 A;  3WTZ A;  5M3M J;  5JVT A;  2R7O A;  4M3D A;  4B1R A;  5E8G A;  3ZMZ A;  1MBF A;  2NVU B;  3NAU A;  1HQC A;  1S8N A;  2IGO A;  4WXH A;  2NXN B;  2LKS A;  2EWN A;  5BQT A;  3GTP J;  1YQA A;  2X0L A;  5DUK A;  2EIL H;  2UXN A;  4Q48 A;  1POG A;  4UVA A;  2ZC2 A;  3AG4 H;  3Q0U A;  4ZH4 F;  2L02 A;  4GYG A;  1J9I A;  1BJA A;  3F6V A;  4F55 A;  2WV0 A;  2AS5 F;  2MAB A;  1QZE A;  3MEX A;  2VBX A;  2XPW A;  3M1C A;  2V1U A;  2A6H F;  4XM3 A;  1PYV A;  2K9S A;  4F7Z A;  5IOZ A;  4ON0 A;  2QEX I;  1ZGW A;  3CUQ A;  2DPU A;  4ESF A;  4XID A;  2DTZ A;  3KEQ A;  4CSW A;  2P7C B;  4A6E A;  3F0C A;  1MZB A;  1ETV A;  1V4R A;  3A03 A;  2O6G E;  2CFX A;  3UKG A;  3O2P E;  2M7B A;  2W85 A;  2XV4 S;  4HQM A;  2K9M A;  1X1B A;  1R1U A;  2NVY J;  1DP3 A;  2ID6 A;  4MHG A;  1R4M B;  2K7L A;  3CQZ J;  4EGZ A;  1Y39 A;  4E70 A;  3GEZ A;  3IWZ A;  3BT9 A;  1H8A C;  3E97 A;  1S7E A;  4DBR A;  2A5W A;  2L4A A;  4E7I A;  2JA7 J;  3PO2 J;  5AON A;  2CG4 A;  3H3Z A;  1P2F A;  4HST A;  3BZC A;  4JQF A;  3PSI A;  2LRE A;  3W6J B;  3BCB A;  1IN5 A;  1ZAO A;  2H94 A;  3DF8 A;  1T2K A;  2V1X A;  3GW2 A;  2BHZ A;  1S9H A;  4M74 A;  2MW8 A;  3LA3 A;  4OIN F;  1B6A A;  3L00 A;  3F8N A;  5KCM A;  1MH3 A;  2D45 A;  1HST A;  1XSV A;  2LK2 A;  1YW9 A;  1L3L A;  2DT6 A;  2E1O A;  5J6X A;  2GWR A;  3TGN A;  3WTT C;  5IT9 K;  3QPL A;  1KA8 A;  2XAH A;  1AOY A;  2WAE A;  3CUO A;  3OIO A;  1SAU A;  1MSE C;  1H9G A;  2CMP A;  2JPB A;  2P4W A;  2CQQ A;  2XGC A;  1SFX A;  1YG2 A;  3N97 A;  3J80 Z;  1WSU A;  2VKE A;  3HYI A;  3GTL J;  2NS0 A;  1XSX A;  4BBS J;  3SZP A;  3FMS A;  1IXC A;  4UHT A;  3HOW J;  1VFC A;  3ZQC A;  1EH6 A;  2WB1 N;  2WTE A;  2CQN A;  2PEX A;  3O8H A;  4LIV A;  2LG4 A;  2YU9 J;  4AID A;  2XF6 A;  2W00 A;  4IF4 A;  3WTS C;  4XLE A;  2HGC A;  5FKM A;  5FKO A;  4WK8 F;  2PJR A;  3NEU A;  4X6A J;  2RN7 A;  4Y52 J;  3ZMS A;  2KFD A;  1TQI A;  3IH3 A;  3IRQ A;  3Q0W A;  5F6F A;  2XKP A;  2VIX A;  3KEO A;  1ZG5 A;  2GA2 A;  4LG0 A;  3O3K A;  5K7H A;  1IDZ A;  2CW7 A;  4M9Z A;  4BL0 B;  3IRR A;  1BW6 A;  4IRG A;  3L2U A;  4CCM A;  2R0Q C;  2R7V A;  1E2X A;  4AVZ A;  4LD5 A;  1YW8 A;  4IPA A;  3HSR A;  1MBE A;  1D0X A;  3JW4 A;  3BG9 A;  1HW2 A;  3GLL A;  3GFM A;  3WTW C;  2QGU A;  4M73 A;  3K4J A;  3ZN1 A;  3DLA A;  2PQ8 A;  4FE4 A;  3IKV A;  1A6Q A;  1I27 A;  3L7W A;  2LDU A;  4B8X A;  4C30 A;  1ETY A;  1R5G A;  3KYC B;  1IF1 A;  3OYM A;  2OCE A;  3BR6 A;  1WZ2 A;  4F91 B;  1D5Y A;  4XKC A;  3GTG J;  3GTQ J;  1VTN C;  2J5P A;  2R7Q A;  2O8X A;  3VYU B;  2MFZ A;  3IP4 B;  4KIC A;  1U3E M;  4HX4 A;  3CUQ B;  3DKX A;  3D5S C;  2VL8 A;  2JA5 J;  2WB1 A;  2HYJ A;  4B43 A;  5GPC A;  2EA2 A;  4A93 J;  2ZME A;  1OCO H;  1IZ1 A;  4GGG A;  2KL4 A;  3FHZ A;  2E19 A;  1YLF A;  2E2I J;  5CVR A;  2M87 A;  4CZZ A;  3CCE I;  1OKR A;  2FQ3 A;  4HX8 A;  2DMN A;  4AU7 A;  4NHJ A;  3C1D A;  3SZG A;  3LSH A;  1RNL A;  2ELH A;  5AIQ A;  2F2E A;  1FOX A;  4IKF A;  4XOP A;  1AKH A;  1XS9 A;  2R7X A;  3ASN H;  2OQR A;  3WG9 A;  1MMN A;  4W1U A;  3QAH A;  3A0B C;  4EM0 B;  3ZRG A;  3J81 Z;  3FZV A;  2RVC A;  5IYB J;  4LLN A;  1TC3 C;  2MSY A;  2NAZ A;  5FO5 A;  5FLX K;  4RM2 A;  2XB0 X;  3CJR B;  1X4O A;  2K86 A;  5DCM A;  5GAH J;  4S0H B;  3H3U A;  3CJT B;  3HTS B;  2K3P A;  1YRN A;  3ABK H;  4JBA A;  3CO6 C;  4ENJ A;  4R8H A;  4AYB N;  2DK5 A;  2KJC A;  2MYS A;  1BI1 A;  3ZQH A;  2FNP A;  1FMW A;  3M7G A;  3CCU I;  1FYL A;  1OYY A;  1VQL I;  1MW7 A;  3KYD B;  5LGU A;  2KPM A;  2XAG A;  2M7A A;  3UNG C;  3HL2 A;  2R7Z J;  3ZR8 X;  5J8F A;  1K4S A;  3GZ5 A;  1K83 J;  3FXK A;  2XPV A;  1KQ9 A;  4LIT A;  1JKR C;  5DD8 A;  2N8G A;  1BI3 A;  3M07 A;  2LBF A;  4FT8 A;  2L7Z A;  2VLA A;  2LY1 A;  5E20 A;  3VYR B;  3CC7 I;  2O0Y A;  3WE3 A;  2CV2 A;  4L0Z B;  1U9O A;  5DM6 F;  4B09 A;  2E5Z A;  1U2W A;  3EUH A;  1O57 A;  2BOL A;  4XLP F;  1Y8R B;  1K4T A;  2VKH A;  3QP6 A;  2QQB A;  2MC3 A;  2VAS A;  5F0C A;  2DOD A;  1RUN A;  3PJR A;  5CVU A;  2K9N A;  4LOC A;  4EJO A;  4Q5S F;  2M5W A;  4RMN A;  4HYE A;  3LSR A;  1ZLK A;  3RZD J;  1IW7 F;  1LDJ A;  4XNF A;  5IP7 J;  2V7F A;  1DGR M;  1FIP A;  3I71 A;  4PCQ A;  2OTJ I;  2CYY A;  2L7K A;  4IRH A;  2WWY A;  2Y48 A;  2L0K A;  1ZLJ A;  3A1Y A;  1ONV A;  3WTY C;  5D6E A;  1WQ2 A;  4AUX A;  3GTK J;  3LFU A;  4M6Y A;  3K4M A;  1OCP A;  2MLG A;  3PIO F;  2HPI A;  1YIJ I;  2R3S A;  1G8X A;  2LSO A;  3MD2 A;  3PL8 A;  1E17 A;  2OF7 A;  5LRS A;  3HOT A;  2Q1Z B;  4MTE A;  2KRH A;  1YFH A;  4XBF A;  3JTH A;  5E3O A;  4UB6 C;  2EFW A;  2R5Z A;  4D7N A;  4LG0 B;  1LKX A;  2EB7 A;  5KVR A;  3V7C A;  3ZMU A;  1STZ A;  2KHM A;  3Q3S A;  3BG3 A;  2I10 A;  1QRY A;  3BQY A;  1I6X A;  1ZYR F;  5FRO A;  2K5C A;  5FRN A;  2KMU A;  2GZW A;  3ERE D;  1ENH A;  1YIO A;  4I01 A;  5L3B A;  3F6O A;  4XQF A;  3MQ0 A;  3K4K A;  4C9Y A;  2DFI A;  1T95 A;  3GZ6 A;  1WHU A;  3CME I;  1D3Y A;  4RA2 A;  1XG1 A;  3FM3 A;  4U88 A;  2DFH A;  5HS9 A;  3GYH X;  2RGV A;  5E3M A;  3OYI A;  2ISZ A;  1VQ8 I;  2LRD A;  1FJL A;  4BJ6 C;  3EPZ A;  1XN7 A;  1I3Q J;  4U0Y A;  3G3Z A;  3DBH B;  5HDN A;  3V7S A;  3KP2 A;  3ULQ B;  2AQF A;  3FK6 A;  2XAS A;  3B02 A;  4KN4 X;  2XUB A;  5FD5 A;  2EV6 A;  4F93 B;  4QLC U;  1H0M A;  4PFO A;  1FT9 A;  4E7K A;  1T98 A;  2GBY A;  3EET A;  4RGR A;  1QHH D;  3JRE A;  1H9T A;  4LLL A;  3GFJ A;  2DMP A;  2YR2 A;  1F43 A;  2ZSH B;  1B59 A;  3QOD A;  1IUY A;  3TO7 A;  3BY6 A;  4V2F A;  5M3F J;  3SXY A;  5D8K B;  2ESN A;  2QSH X;  3QU3 A;  2HYG D;  3MFK A;  1BC8 C;  2QSG X;  3KP5 A;  4L0Y B;  2UUZ A;  3QPH A;  2STW A;  5HLT A;  4N4O B;  2QZ8 A;  2DDA A;  2V26 A;  3LQQ A;  3KP6 A;  3RKQ A;  2GXA A;  3CC2 I;  3I53 A;  1T0F C;  2E35 A;  2DFE A;  2X6O A;  2E1N A;  4PJN A;  1TWA J;  2IJL A;  3CO7 C;  2NNN A;  1OLT A;  4CCJ A;  3K2Z A;  4P96 A;  1O3Q A;  4CDG A;  3HRS A;  4B48 A;  4PDK A;  5L3E A;  3QU6 A;  1IV8 A;  1VQ5 I;  2JA8 J;  4BKX A;  3BTL A;  1W5T A;  5J1U A;  2IGM A;  5LHI A;  2DPD A;  4I0A A;  2D2W A;  2HVR A;  4DGW B;  4N4N B;  4H0E A;  4S04 A;  4ZTJ A;  4OOI A;  4FX4 A;  4QSH A;  1DU0 A;  3CP2 A;  3K70 D;  2X1C A;  2A61 A;  2QBY B;  4HF2 A;  1V55 H;  1QHG A;  3IAM 2;  3TP0 A;  4WX9 A;  2ECB A;  1YRN B;  4UUV A;  4EM2 A;  1KQ0 A;  2ZCW A;  2G0E A;  1FOY A;  2BVM A;  3PUF A;  5D4S A;  5ICE A;  2AXL A;  1YW7 A;  1U78 A;  1FP1 D;  4RDU A;  1GV5 A;  1UST A;  2CQ7 A;  1FBQ A;  1MND A;  2MBF A;  4XLH A;  4CYD A;  3KIO A;  3K9T A;  2FMY A;  2HFH A;  4J00 A;  1CF7 A;  2IA1 A;  4ZC3 A;  1KYZ A;  3CCJ I;  2XAQ A;  3KE2 A;  5DD4 A;  4KIF A;  2D5V A;  3OY9 A;  3ZQL A;  3PNT A;  1BOA A;  4FCY A;  1MJ9 A;  4BEH B;  2BW3 A;  2UV1 A;  1K79 A;  3K10 A;  2Y0S N;  3HRM A;  4PGH A;  4MTD A;  2IS1 A;  2FBK A;  2TDX A;  3FM5 A;  2DTR A;  1CQT A;  5TGT A;  2R4G A;  3RCO A;  2DLL A;  1K78 B;  3JAM K;  3R0J A;  5DS9 A;  4C2U A;  3T0Y A;  3K1P A;  2XB5 A;  5CPR B;  2DAO A;  2G7U A;  5F04 A;  5D6F A;  4OIQ F;  1OR7 C;  2JVH A;  5L3F A;  2R92 J;  4KJZ A;  3WTV C;  1XB4 A;  4CCK A;  5H6Q A;  1GUU A;  3P5J A;  2M0C A;  2V1D A;  3S32 A;  4B47 A;  1EV7 A;  6PAX A;  3J7Y J;  2VBZ A;  3IL2 A;  4FX0 A;  2TRT A;  4CO8 A;  3KP3 A;  1JKO C;  3HOZ J;  3E6M A;  4ENM A;  3HPG A;  1YX5 A;  1S29 A;  3DWL E;  4YIR X;  4H4K C;  3QOE A;  3CJN A;  3JRF A;  4NQW B;  1F5T A;  5DV5 A;  2LBF B;  1YX3 A;  5E3N A;  4E4H A;  3S8P A;  3WOD F;  5ERI A;  3G1L A;  2R5Y B;  2WAD A;  2KIQ A;  5B1A H;  3KLN A;  4BS9 A;  1ON1 A;  1IXR C;  2HVS A;  3HSE A;  1R00 A;  2YS9 A;  2ZXI A;  1ORK A;  3DBL B;  5BNG A;  2MH9 A;  4DJA A;  1LFU P;  2EJR A;  4Y13 A;  3I58 A;  1C0W A;  2BY1 A;  3P9I A;  2V6C A;  3ZN0 A;  2FUG 2;  4XON A;  3C7J A;  1ZRE A;  3MZH A;  5CQG A;  2DO7 A;  2LFB A;  3MKZ A;  1HXD A;  1R1V A;  3WTU C;  1EF4 A;  2EK5 A;  3OSG A;  4A3L J;  4F3Q A;  1W4M A;  1RET A;  4LLG F;  1HW1 A;  5KAF C;  3H9J A;  1DUX C;  2KJB A;  4XLA A;  4KYW A;  3WG7 H;  5BS6 A;  2DA4 A;  2VJJ A;  1GDT A; 
#chains in the Genus database with same CATH homology
 3ELK A;  5FB2 A;  1XGO A;  1PP8 F;  2W84 A;  3HIF A;  2LNB A;  1O3S A;  1IRG A;  4KDP A;  4K2E A;  4AIH A;  4OIP F;  4HDU A;  2NNY A;  5BMZ A;  1O7F A;  2HWV A;  2B0L A;  2FBI A;  2JZY A;  1FY7 A;  2R7D A;  2CGP A;  1DP7 P;  1AWC A;  3TOB A;  1BIB A;  4U7D A;  3EQL F;  2CQK A;  2OU2 A;  1B9M A;  2M30 A;  1LDK B;  2FEZ A;  3Q9S A;  3V8L A;  1XDU A;  4AIJ A;  2RKH A;  2P8T A;  4PGG A;  1TTY A;  2DQR A;  4ZZL A;  2W57 A;  4YFN F;  1FNN A;  2P5K A;  3ABT A;  1HSJ A;  4Y15 A;  4I2O A;  1R1T A;  1W5S A;  2NYX A;  3C18 A;  4N0B A;  2ZKZ A;  3COA C;  1DPU A;  1P4W A;  4ENK A;  2PN6 A;  2W24 A;  3TO9 A;  3WGH A;  1JE8 A;  1QGP A;  4AD9 A;  3ZMD A;  2IA2 A;  5E1Z B;  2HYF A;  3E3V A;  4IHT A;  1FPQ A;  3WU0 A;  2P5V A;  4BH9 A;  3NRV A;  2ZNZ A;  3BPX A;  1WKM A;  5AIP A;  4HA8 A;  2PG4 A;  1TNS A;  4LB6 B;  3QOP A;  5HLI A;  4Z2Y A;  1O3T A;  2PLY A;  4ENN A;  4UXN A;  2VBW A;  1S7O A;  5EEH A;  4KIB A;  5LHG A;  1LB2 A;  4L18 B;  4HF0 A;  3J7A O;  5DDG A;  5F64 A;  4L9J A;  4L9V A;  4LJZ F;  5FLX Z;  1T6S A;  1PUE E;  1L0O C;  2OD5 A;  2R7F A;  4GO1 A;  3WGG A;  4OMZ A;  3F72 A;  1BIA A;  2Q2E A;  4M6X A;  1TBX A;  2FOK A;  2CWE A;  1MD0 A;  1IN6 A;  1ULY A;  1FYM A;  2EFO A;  2DW4 A;  3SHF A;  4A0X A;  5D4R A;  1BM9 A;  3F23 A;  2IP2 A;  2UZK A;  3I4P A;  3WE2 A;  2NRA C;  1J59 A;  1D8J A;  2GXG A;  1YO5 C;  3TDZ C;  4U0V A;  1FBS A;  5K1Y A;  4DQ2 A;  4A0Y A;  5H20 A;  1BN5 A;  5ILV A;  2VT3 A;  2BBY A;  3JTG A;  3P9C A;  1F9N A;  2HKO A;  2VBY A;  2RV8 A;  4DNC A;  5D5X B;  4QWQ A;  3EYY A;  4LFU A;  4ZYG A;  2YX7 A;  3FMR A;  3FX3 A;  2DI3 A;  5JHU A;  2L3D A;  3E6C C;  2MA3 A;  2UXX A;  5D8L B;  3R6S A;  2HOE A;  1LEB A;  2EA4 A;  5HVQ C;  4HDV A;  5A2Q Z;  4BHB A;  5D5U B;  3FMQ A;  3MCZ A;  2K4B A;  1J5Y A;  1P92 A;  1HKS A;  2XVC A;  5CVJ A;  2VXZ A;  1R36 A;  5LEJ A;  2Z3Y A;  4XLN F;  3RIR A;  1G3W A;  5F1R A;  4EMS A;  3BZ6 A;  3RYP A;  3SZT A;  5ICC A;  4EQQ A;  1ZH5 A;  3IKT A;  3AAF A;  3ML6 A;  4OMY A;  2HZT A;  3PQK A;  2DU9 A;  3R0A A;  3M1E A;  1MDM A;  1KYW A;  1U8R A;  1S7A A;  5CJ9 A;  2O03 A;  2F5F A;  4A2U A;  1FX7 A;  1XCV A;  1U6G A;  5L3D A;  4I02 A;  5HLG A;  3QPT A;  2STT A;  4G6Q A;  3I54 A;  1R5H A;  2XRN A;  1G3Y A;  1WWX A;  1Z91 A;  1ZGJ A;  3HSF A;  4UV9 A;  2CSO A;  1W7P B;  2GIV A;  4BAY A;  3BWG A;  1TW2 A;  2LF8 A;  1PP7 U;  4HAM A;  1OYI A;  3CTA A;  2A3S A;  1FSE A;  2L01 A;  2XGX A;  3HHG A;  1O3R A;  1KU2 A;  3TDU C;  3I64 A;  1P4X A;  4RGU A;  4IXA A;  1T38 A;  4ETS A;  3RI4 A;  5BOX A;  3VB2 A;  5JI6 A;  1UHM A;  4IHS A;  3IWF A;  4TV7 A;  3GWZ A;  1XGM A;  2OZU A;  2BYV E;  4L5I A;  1MKM A;  1MGT A;  1Z6T A;  5HOO A;  3K1M A;  4BXU A;  4G7Z F;  4KFC A;  4RGS A;  2VE9 A;  4P55 A;  2QLZ A;  3P9K A;  2MD5 A;  4HOB A;  4WXC A;  4EJU A;  2HDC A;  1KGS A;  2KRF A;  2XKO A;  3BPV A;  5CYV A;  1XDS A;  5K5O A;  1QBJ A;  2BV6 A;  2QM3 A;  3E5Q A;  5DUI A;  3GLX A;  4HQE A;  2X4H A;  2ZME B;  2H27 A;  2OAZ A;  1FZP B;  3K1N A;  3FXR A;  2YPR A;  3SFZ A;  2QQA A;  5CVV A;  2EV0 A;  4R79 A;  2PJP A;  4PZJ A;  3GUD A;  3M8E A;  3TKY A;  2P6S A;  4OIR F;  2QBY A;  1J0R A;  3DP7 A;  5ILU A;  4KMF A;  4G7O F;  1XD7 A;  4G6D A;  1LNW A;  3V8K A;  2FU4 A;  3BDD A;  1TW3 A;  5BPD A;  5FGM A;  2H6B A;  2ACJ A;  2ETH A;  4LMY A;  4P9U A;  3REO A;  1I1S A;  5DYM A;  3D5L A;  4RB2 C;  2G7H A;  4A5N A;  2M1B A;  1KU9 A;  1LVA A;  4YG2 F;  3I5U A;  3ECO A;  1FBU A;  2PMU A;  4HF1 A;  1IN7 A;  3LAJ A;  3CLO A;  2OBP A;  2KIM A;  2DT5 A;  3K0L A;  5ICF A;  1LJ9 A;  1BBY A;  4KMU X;  1HKQ A;  2K27 A;  2JPC A;  2JT1 A;  3KP7 A;  4HZF A;  3HTU A;  4ASN A;  2GQQ A;  4YFK F;  1OYW A;  2XRO A;  1REP C;  3V4G A;  4G8X A;  1LDD A;  3KZZ A;  2KIF A;  5FD6 A;  3I59 A;  4RGX A;  3KZY A;  1B4A A;  2FF4 A;  1GVJ A;  5EEG A;  2OQG A;  3CDH A;  3ISP A;  1XSD A;  1Z7U A;  1A04 A;  3I59 B;  5IT3 A;  1ZN2 A;  2Q8K A;  5JR3 A;  1Z1D A;  1F1Z A;  3ZPL A;  3FF5 A;  1ZG3 A;  1IN4 A;  2Y75 A;  2FA5 A;  3LFK A;  2MLK A;  4WCG A;  2E7X A;  4U0W A;  3WGI A;  1S3J A;  5LGT A;  2C6Y A;  2QUF A;  2VON A;  2YU3 A;  2EFQ A;  2IW5 A;  3H92 A;  1NHA A;  4Y17 A;  1K6O A;  2FE3 A;  3RPQ A;  3T1B A;  4G9Y A;  4N9H A;  1S6L A;  1QPM A;  4ZYH A;  4EGY A;  1SD7 A;  2QQ9 A;  2A69 F;  2QYO A;  1QQI A;  4EJW A;  2GXB A;  4WWC A;  1YS7 A;  4XSZ F;  2PBI A;  3MZY A;  4BQA A;  4YIF A;  1J75 A;  4ZZD A;  5A2Q K;  3IHU A;  1Z05 A;  1Q1H A;  4ZYE A;  4I7H A;  1PDN C;  2OZ6 A;  2JRT A;  2ESH A;  1YYV A;  1U5T B;  2E1C A;  1J7K A;  3HHH A;  4WF2 A;  3E6B A;  1T0F A;  3T5X A;  2A6E F;  2ADU A;  3E6D A;  4Q4Z F;  5HDG A;  3OOP A;  3CUQ C;  2EFN A;  1K7A A;  1JHH A;  2H09 A;  4EV0 A;  4GXO A;  2QWW A;  4CXF A;  3T8T A;  4EM1 A;  1WI9 A;  2HR3 A;  4GYI A;  3ZMT A;  4RB3 C;  2VOO A;  3DKW A;  5HS7 A;  2Z99 A;  2IT0 A;  1ZRC A;  1FP2 A;  3IC7 A;  3HOS A;  3K69 A;  4OU0 A;  5LLQ A;  3KCC A;  1MDM B;  2HS5 A;  3RDI A;  3W6K B;  5ED4 A;  5E8I A;  4U7B A;  5KK1 A;  1DPR A;  5LEK A;  2Z9O A;  5DEQ A;  3GVA A;  1MJA A;  3M8F A;  1HBX G;  4YII A;  4ZYD A;  3ZP5 A;  5CVI A;  3F3X A;  1IXS B;  4IJA A;  2CW0 F;  1UFM A;  3F8F A;  2DK8 A;  2RQP A;  4O3M A;  1V3F A;  3N4M A;  4M71 A;  3HRT A;  3C3W A;  3FWE A;  1RIO H;  2ZXJ A;  3F22 A;  2UWM A;  2L4M A;  1RI7 A;  3BOQ A;  1U5T A;  4I0B A;  4OIO F;  2BEO A;  2DBB A;  3GF2 A;  4D0P A;  1EH7 A;  1GXP A;  2FSW A;  1MJB A;  1SFU A;  1JXS A;  3RKY A;  3LA2 A;  3G73 A;  3O6B B;  2P5L C;  4MEX F;  2IPQ X;  2V79 A;  2FNA A;  4L9N A;  4XSX F;  1R23 A;  4YFX F;  4BNC A;  3F8B A;  3U1D A;  4RAZ A;  4NB5 A;  3F21 A;  2MH2 A;  4A6D A;  3ZMV A;  4L9T A;  5D5V B;  4BYY A;  2GA1 A;  1W7P A;  4CGZ A;  2Z5U A;  2COM A;  3P7N A;  4UVC A;  5L3C A;  1FC3 A;  3FXQ A;  2K02 A;  2V9V A;  1F4K A;  5ICG A;  2HTJ A;  4MEY F;  1TLH B;  2VC0 A;  4Q47 A;  2Q0O A;  2M8E A;  5HDK A;  2ZO4 A;  4S05 A;  1K78 A;  3LST A;  5K5R A;  4EJV A;  2W25 A;  3RTR A;  1ZG1 A;  1Y0U A;  3RKX A;  2ZNY A;  2H6C A;  1ZRF A;  4I98 B;  3V7R A;  2BGC A;  4KNY A;  1KU3 A;  5IT9 Z;  2L54 A;  4LK0 F;  4MNU A;  4LK1 F;  2VOD A;  2G9W A;  2F5C A;  3QRF F;  4M72 A;  2VC1 A;  2RDP A;  4P9F A;  3S2W A;  1FOK A;  1ODD A;  4HLY A;  1I5Z A;  1SAX A;  1G6N A;  1BI0 A;  1G4D A;  2IRF G;  2EFP A;  1B9N A;  1EH8 A;  3R4K A;  2HQR A;  1T39 A;  1ZHF A;  1FYK A;  2EV5 A;  2ZJ2 A;  1SMY F;  2F5E A;  2P7V B;  3GX4 X;  3HUG A;  3WU1 B;  1D8K A;  2JTV A;  4L5J A;  1CF7 B;  1LEA A;  3Q5F A;  1FWZ A;  4LGW A;  4M9S A;  4KA4 A;  1USS A;  1Z6R A;  3J81 K;  2VOP A;  3ECH A;  3BJO A;  4MGR A;  4AWX B;  2QEN A;  1I1G A;  2LKP A;  4IRI A;  3LQR A;  1D5V A;  1XGS A;  5E18 F;  4RAY A;  4CHU A;  3JSP A;  3TO6 A;  2XHK A;  4O5V A;  1KU7 A;  5HLH A;  3B73 A;  4GCV A;  5LRR A;  2JSC A;  2VT2 A;  4EVI A;  5TRD A;  4R1H A;  3GXO A;  1JGS A;  5LHH A;  3VEP A;  2FML A;  3KFW X;  1X3U A;  1J2X A;  2IA0 A;  3V8J A;  2YX4 A;  1XGN A;  1CGP A;  3DPT A;  4M9X A;  1GXQ A;  2VE8 A;  3TQN A;  1XMA A;  3GFI A;  2Y0M A;  4HLX A;  4XRF A;  1P6R A;  3RJP A;  1QO0 D;  2HTS A;  3ZQ7 A;  1ZGA A;  4AVP A;  3RKW A;  1HW5 A;  2K4J A;  1QZY A;  3DEU A;  1TNT A;  1UCR A;  1R58 A;  3F8M A;  2VN2 A;  1IN8 A;  2E7W A;  3R60 A;  1B1B A;  4UNO A;  1W7P D;  1SFE A;  3L2C A;  1SD5 A;  1ZRD A;  1ON2 A;  1G3T A;  2XIG A;  5DCM B;  2ZFW A;  3M9A A;  3D0S A;  4AIK A;  4N9I A;  3LWF A;  2RNJ A;  1UHW A;  4G7H F;  4UV8 A;  4HX7 A;  2A5Y B;  2FBH A;  3FXU A;  4IVN A;  1BC7 C;  2IVM A;  4WXD A;  2HEO A;  4KUM A;  4KIG A;  5E1W A;  4HV5 A;  2D1H A;  5CLS A;  1UB9 A;  2DQL A;  3OV8 A;  2BE5 F;  5TJJ A;  3SQN A;  2RC4 A;  3VOD A;  5LBQ A;  4KN7 X;  3E5U A;  3RYR A;  3R61 A;  4LB5 A;  2P6T A;  4KT5 C;  5E1X A;  3DQV C;  3TOA A;  3E5X A;  3EDP A;  2XAF A;  5K5Q A;  5FFX A;  1R7J A;  5H6R A;  3U2R A;  1BI2 A;  4RS8 A;  3JSO A;  3EYI A;  3L09 A;  2J5O A;  1YS6 A;  1OPC A;  2FRH A;  2A07 F;  3MWM A;  5D5W B;  2ZBK A;  1IRF A;  1WRJ A;  2PMH A;  4JK1 X;  3KP4 A;  1XMK A;  3VFZ A;  1U5T C;  5ILS A;  4O6J A;  1RZ4 A;  5L3G A;  2O61 A;  2CO5 A;  2KIU A;  3BJA A;  4A12 A;  2KKO A;  3BJ6 A;  4P5O A;  5J8C A;  2ISY A;  3T8R A;  3LAP A;  3GFL A;  2HQN A;  1OR7 A;  2D1V A;  2OA4 A;  3PQJ A;  1LQ1 A;  1R22 A;  3KLO A;  1O7L A;  1XCB A;  3Q9V A;  2O3F A;  4BHC A;  1SD4 A;  4EJT A;  1OMI A;  1QZZ A;  3BRO A;  3U9G A;  1RUO A;  3QP5 A;  4ESB A;  1ZAR A;  2PFB A;  3DXJ F;  3DV8 A;  1HKT A;  3I0T A;  4NQW A;  2F5D A;  1FLI A;  3J80 K;  1KQ8 A;  3PFI A;  4HW0 A;  5E17 F;  2LF7 A;  3KET A;  2FXA A;  3VOE A;  2WC2 A;  4G94 A;  5JFR A;  4BHP A;  5HS8 A;  3ABU A;  4A0Z A;  1FSH A;  4A5M A;  4ESJ A;  3ROU A;  5DCF A;  3JAM Z;  3MAJ A;  4FHT A;  1P4A A;  4I09 A;  3RPU A;  4CIC A;  2PI0 A;  1GHC A;  1JHF A;  4RB0 A;  1IAW A;  4UVB A;  3LA7 A;  2QVO A;  4HBL A;  3F8C A;  1SD6 A;  1Z9C A;  4MQV A;  3DPL C;  2A68 F;  2YSR A;  4RB1 A;  3DFG A;  1YTY A;  1QNT A;  2M45 A;  4MQ9 F;  3HRU A;  4HV6 A;  3GO5 A;  5FFZ A;  5BPI A;  2HKX A;  5LGN A;  1TQP A;  1G3S A;  3BP8 A;  2GAU A;  2XAJ A;  1SMT A;  2Z33 A;  1TQM A;  1DDN A;  3L9F A;  3WTX C;  3NQO A;  3WTZ A;  5JVT A;  5E8G A;  3ZMZ A;  1HQC A;  1S8N A;  4WXH A;  2EWN A;  5BQT A;  1YQA A;  2X0L A;  5DUK A;  2UXN A;  4Q48 A;  4UVA A;  4ZH4 F;  2L02 A;  4GYG A;  1J9I A;  1BJA A;  3F6V A;  2AS5 F;  2WV0 A;  3MEX A;  2VBX A;  2V1U A;  2A6H F;  4F7Z A;  2DPU A;  4ON0 A;  3CUQ A;  4ESF A;  3KEQ A;  2P7C B;  4A6E A;  1MZB A;  1V4R A;  2O6G E;  2CFX A;  3O2P E;  2W85 A;  2XV4 S;  4HQM A;  1R1U A;  4MHG A;  2K7L A;  4EGZ A;  4E70 A;  3GEZ A;  3IWZ A;  3E97 A;  2L4A A;  5AON A;  2CG4 A;  3H3Z A;  1P2F A;  4JQF A;  3W6J B;  1IN5 A;  1ZAO A;  2H94 A;  3DF8 A;  1T2K A;  2V1X A;  3GW2 A;  4M74 A;  3LA3 A;  4OIN F;  1B6A A;  3L00 A;  3F8N A;  2D45 A;  1HST A;  1XSV A;  1YW9 A;  1L3L A;  5J6X A;  2GWR A;  3TGN A;  3WTT C;  5IT9 K;  1KA8 A;  2XAH A;  1AOY A;  3CUO A;  1H9G A;  2JPB A;  2P4W A;  1SFX A;  1YG2 A;  3N97 A;  3J80 Z;  1WSU A;  3HYI A;  2NS0 A;  1XSX A;  3SZP A;  3FMS A;  1IXC A;  4UHT A;  1EH6 A;  2WTE A;  2PEX A;  4IF4 A;  3WTS C;  2HGC A;  4WK8 F;  3NEU A;  2RN7 A;  3ZMS A;  1TQI A;  3IRQ A;  5F6F A;  2XKP A;  3KEO A;  1ZG5 A;  2GA2 A;  4LG0 A;  3O3K A;  4M9Z A;  3IRR A;  4IRG A;  1E2X A;  4LD5 A;  1YW8 A;  4IPA A;  3HSR A;  3JW4 A;  1HW2 A;  3GFM A;  3WTW C;  4M73 A;  3ZN1 A;  2PQ8 A;  3IKV A;  1I27 A;  3L7W A;  2LDU A;  4B8X A;  1R5G A;  1IF1 A;  1VTN C;  2J5P A;  2O8X A;  4KIC A;  1U3E M;  4HX4 A;  3CUQ B;  2EA2 A;  2ZME A;  1IZ1 A;  4GGG A;  3FHZ A;  1YLF A;  5CVR A;  2M87 A;  4CZZ A;  1OKR A;  2FQ3 A;  4HX8 A;  4NHJ A;  3C1D A;  1RNL A;  2ELH A;  5AIQ A;  2F2E A;  2OQR A;  3WG9 A;  3QAH A;  4EM0 B;  3J81 Z;  3FZV A;  2RVC A;  4LLN A;  2NAZ A;  5FO5 A;  5FLX K;  2K86 A;  5DCM A;  3H3U A;  3HTS B;  4JBA A;  3CO6 C;  4ENJ A;  4R8H A;  2DK5 A;  2KJC A;  1BI1 A;  2FNP A;  3M7G A;  1FYL A;  1OYY A;  5LGU A;  2XAG A;  5J8F A;  3GZ5 A;  1KQ9 A;  5DD8 A;  1BI3 A;  4FT8 A;  5E20 A;  2O0Y A;  3WE3 A;  4L0Z B;  4B09 A;  1U2W A;  3EUH A;  1O57 A;  4XLP F;  3QP6 A;  2QQB A;  2MC3 A;  1RUN A;  5CVU A;  4EJO A;  4Q5S F;  2M5W A;  4HYE A;  1ZLK A;  1IW7 F;  1LDJ A;  3I71 A;  4PCQ A;  2CYY A;  4IRH A;  2WWY A;  2Y48 A;  1ZLJ A;  3WTY C;  1ONV A;  5D6E A;  1WQ2 A;  4M6Y A;  2MLG A;  2R3S A;  1E17 A;  2LSO A;  5LRS A;  3HOT A;  4MTE A;  1YFH A;  4XBF A;  3JTH A;  2EFW A;  4LG0 B;  2EB7 A;  5KVR A;  3V7C A;  3ZMU A;  1STZ A;  1I6X A;  1ZYR F;  2GZW A;  3ERE D;  4I01 A;  1YIO A;  5L3B A;  3F6O A;  3MQ0 A;  2DFI A;  3GZ6 A;  1D3Y A;  3FM3 A;  4U88 A;  5HS9 A;  3GYH X;  2RGV A;  2ISZ A;  1XN7 A;  4U0Y A;  3G3Z A;  5HDN A;  3V7S A;  3KP2 A;  3ULQ B;  2XAS A;  3B02 A;  4KN4 X;  2XUB A;  5FD5 A;  2EV6 A;  4QLC U;  1H0M A;  1FT9 A;  1T98 A;  3EET A;  4RGR A;  1H9T A;  4LLL A;  3GFJ A;  2YR2 A;  1B59 A;  1IUY A;  3TO7 A;  3BY6 A;  3SXY A;  5D8K B;  2ESN A;  3QU3 A;  2HYG D;  3MFK A;  1BC8 C;  3KP5 A;  4L0Y B;  3QPH A;  2STW A;  2QZ8 A;  3LQQ A;  3KP6 A;  3I53 A;  2E1N A;  3CO7 C;  2IJL A;  2NNN A;  3K2Z A;  4P96 A;  1O3Q A;  4CDG A;  3HRS A;  4PDK A;  5L3E A;  3QU6 A;  1W5T A;  2DPD A;  5LHI A;  4I0A A;  2D2W A;  4H0E A;  4S04 A;  4OOI A;  4FX4 A;  2A61 A;  2QBY B;  4HF2 A;  4WX9 A;  4UUV A;  4EM2 A;  1KQ0 A;  2ZCW A;  5D4S A;  5ICE A;  2AXL A;  1YW7 A;  1U78 A;  1FP1 D;  1UST A;  2MBF A;  1FBQ A;  4CYD A;  3K9T A;  2FMY A;  2HFH A;  1CF7 A;  2IA1 A;  1KYZ A;  2XAQ A;  3KE2 A;  5DD4 A;  4KIF A;  1BOA A;  1MJ9 A;  1K79 A;  3HRM A;  4PGH A;  4MTD A;  2FBK A;  2TDX A;  3FM5 A;  2DTR A;  2DLL A;  1K78 B;  3JAM K;  3R0J A;  3T0Y A;  3K1P A;  2DAO A;  2G7U A;  4OIQ F;  5D6F A;  5L3F A;  3WTV C;  1XB4 A;  5H6Q A;  2V1D A;  1EV7 A;  6PAX A;  2VBZ A;  3IL2 A;  4FX0 A;  4CO8 A;  3KP3 A;  3E6M A;  4ENM A;  1S29 A;  3CJN A;  1F5T A;  5DV5 A;  3WOD F;  5ERI A;  3KLN A;  1ON1 A;  1IXR C;  3HSE A;  1R00 A;  2MH9 A;  2EJR A;  4Y13 A;  3I58 A;  1C0W A;  3P9I A;  2V6C A;  3ZN0 A;  1ZRE A;  3C7J A;  3MZH A;  2DO7 A;  1HXD A;  1R1V A;  3WTU C;  2EK5 A;  1W4M A;  4LLG F;  1HW1 A;  1DUX C;  2KJB A;  4KYW A;  5BS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...