2DK5A

Solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Winged-Helix domain in RNA polymerase III 39KDa polypeptide
rcsb
source organism Homo sapiens
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
total genus 14
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk5A01
4LGWA 1H9TA 3WG9A 5KK1A 1J9IA 1I5ZA 3ZMTA 2Q2EA 4I09A 1HKTA 1FYMA 2DBBA 1XMAA 4L9NA 2EK5A 5TRDA 1BM9A 1BBYA 4HDUA 2HZTA 1QQIA 1STZA 2JTVA 1LEAA 2R7FA 3HHHA 1IZ1A 1NHAA 2VN2A 1O7LA 3I4PA 2RV8A 4K2EA 4RAYA 5AIQA 3RKXA 1TNSA 4IRHA 3P9CA 4HZFA 3T0YA 1U6GA 1X3UA 2HYFA 1YQAA 3CUQB 4HBLA 4BHBA 1I27A 1XGNA 2KIFA 1O3QA 2P5VA 5BPDA 2QQ9A 3K69A 3AAFA 3KLNA 4F7ZA 2JZYA 2A3SA 3CTAA 3GEZA 1UHWA 3I0TA 2EA2A 1TNTA 4M9XA 2PEXA 4HW0A 1R23A 2QQAA 1U5TA 2A6EF 4HX8A 3JSPA 4L5IA 3LWFA 3F8NA 1KU9A 3W6JB 1BI0A 1YG2A 5AONA 1P4XA 2HKXA 5E18F 1OYYA 4MNUA 5F1RA 4QLCU 3TKYA 1EV7A 1P4WA 4ASNA 1SMYF 2FNPA 4GYIA 1D5VA 3HRTA 3GFIA 5EEHA 1TQIA 2M8EA 2UWMA 2PFBA 1FLIA 3QPHA 2FMYA 4BAYA 4EJWA 4AIHA 4ENKA 4P5OA 5J6XA 2AS5F 2VC0A 2DQLA 2H94A 5E1WA 1K79A 4N0BA 2DPUA 3U1DA 2J5PA 5DD4A 2PLYA 2F5FA 4GXOA 5F6FA 5CYVA 3V8JA 2HQRA 3ZMVA 3DP7A 3F21A 4OIRF 3E5QA 2E1NA 4I0AA 5D8LB 2YR2A 3OV8A 2D45A 1L0OC 3LQRA 1XGSA 3P9IA 3WTUC 3ROUA 1YFHA 1J5YA 2MLKA 1W5TA 2ZKZA 1VTNC 5FLXZ 1MJBA 2BBYA 4AD9A 1RUOA 1MDMB 4E70A 1O3TA 2QVOA 1FBUA 3Q5FA 3ZP5A 5JI6A 2GIVA 3CDHA 4L9VA 2F5CA 5FGMA 3J80Z 1O3RA 1G3TA 5ICGA 3E6DA 3TGNA 4ZH4F 2L02A 5LRSA 1ZRDA 3R60A 3DF8A 4U0YA 5DEQA 1XGMA 1D8JA 1HKQA 1G6NA 2Z5UA 1OYIA 4IRIA 4UUVA 2VT3A 4A0XA 1KU7A 1MZBA 1U8RA 1XN7A 2XRNA 5D5WB 4UNOA 4QWQA 3HSEA 5ILVA 2W84A 2EFOA 2RN7A 4WCGA 3COAC 3K2ZA 3I64A 3RJPA 2H6CA 1CF7A 2C6YA 2HR3A 2ESHA 1B1BA 1S7OA 3LA2A 4CDGA 1T39A 3O2PE 3PFIA 1FZPB 4RB2C 1IN6A 1HSTA 4FX0A 2KKOA 2JSCA 2O61A 4OOIA 4NHJA 1P2FA 2DLLA 1CF7B 1MKMA 1R22A 1C0WA 3KP5A 2B0LA 1T98A 3EETA 2FMLA 1EH6A 2L01A 2XASA 1XMKA 5E17F 1FP2A 1S3JA 2FF4A 2MBFA 2DPDA 1V4RA 1D3YA 1XDSA 2NS0A 1BN5A 3BPXA 1J75A 1ZHFA 2DTRA 2OZ6A 1YS7A 3J7AO 1BJAA 1A04A 4A5NA 3HOTA 1E17A 3F8BA 3GF2A 5JVTA 3JTGA 3HRSA 3J81K 1XB4A 3SXYA 5D6EA 4LD5A 2YX7A 5DDGA 5H6RA 3WTTC 1ZRFA 1WRJA 5L3EA 3ZMDA 3GVAA 1E2XA 4HLXA 4EJOA 3MQ0A 3ISPA 5HS9A 1YO5C 1RNLA 2HEOA 2P6SA 4EM0B 1LQ1A 2LSOA 1MJ9A 4CICA 4FT8A 1UFMA 4BHCA 4M74A 1IXCA 3TQNA 1B59A 2EFWA 2OBPA 4IJAA 2KIMA 1R1VA 4OMZA 1HQCA 3WTSC 4I02A 2BEOA 5HS8A 4I98B 4UV8A 4G6DA 4Q5SF 3ERED 1IXSB 4A6EA 1YIOA 3S2WA 4G8XA 2DK5A 3MCZA 3LA3A 4NQWA 3BPVA 2KJBA 3HSRA 1QNTA 4HDVA 2Q8KA 1YYVA 5FB2A 2ZO4A 1FY7A 3CUQA 4NB5A 5L3BA 2D2WA 5LGTA 2XIGA 3KETA 3LAPA 5DCFA 1FYLA 4OIQF 1Z91A 2HWVA 3V4GA 1IN7A 4UVCA 3KP4A 2KIUA 4XSZF 2XAFA 3J81Z 2XROA 3RPUA 1B9NA 1R1TA 2HS5A 2Z9OA 4I0BA 5CVJA 4ZZLA 4Y13A 1OMIA 1ON1A 3E6BA 1YS6A 3Q9SA 4EQQA 4RB3C 1KYZA 3C1DA 5EEGA 2NAZA 5BMZA 2VOPA 1Z6TA 5ERIA 2EJRA 2KRFA 1USTA 3F22A 3KCCA 5JFRA 3I5UA 4O3MA 1HSJA 1HW1A 4HA8A 4L0YB 5J8FA 3VODA 5FO5A 1BIAA 4U0VA 3GUDA 2FBHA 4ZYHA 3G73A 5IT9K 2A69F 3DV8A 3J80K 4KN4X 3IRRA 3RYPA 2A5YB 1B4AA 3OOPA 1FT9A 3H92A 3F3XA 3TOBA 1UCRA 5ICCA 3HRMA 3KP6A 3SQNA 3GW2A 2IRFG 2WTEA 4XBFA 2WWYA 2RVCA 2MH9A 2STWA 5DUKA 1JE8A 4LJZF 5DCMA 3QU6A 3KZZA 4LG0A 1PP8F 2DW4A 3TDUC 2WC2A 2ZCWA 2CG4A 3GFJA 3F23A 3L00A 3FMQA 2NYXA 3L7WA 4O5VA 1QBJA 2XAHA 4Y17A 3WTVC 2F2EA 3B02A 2XVCA 3K1PA 5LGUA 2QBYB 3I53A 4CYDA 4WK8F 4EM1A 3V7SA 5FLXK 2E7XA 5DD8A 5DCMB 3VFZA 2X4HA 2P7CB 3TO6A 4GGGA 3V8KA 1YW9A 3M8EA 1Y0UA 5D4SA 2ZNYA 2VT2A 1SFEA 3K1NA 2O03A 4R1HA 4KN7X 3ZMSA 1I6XA 3F8FA 3SHFA 4BXUA 1UHMA 5CVRA 3ZN1A 3MEXA 2GZWA 5E20A 2E7WA 2K27A 2VBXA 2OQGA 3BOQA 4KMFA 3KP3A 2QLZA 1PP7U 3KP7A 3C18A 4EV0A 4HYEA 4ENNA 2GAUA 2NRAC 3WTXC 1ZH5A 4OU0A 1W7PA 2QENA 5K5QA 3FM3A 1FWZA 5BOXA 4Q47A 1USSA 1DUXC 1KGSA 4A5MA 1IRFA 5ILUA 4Q4ZF 2DT5A 4IHSA 5H6QA 4CGZA 2ACJA 4N9HA 2CYYA 1BIBA 1SD7A 3JSOA 5L3GA 1ZGAA 2PBIA 4S04A 2HQNA 2JRTA 1YW8A 1F5TA 2ISYA 2XKOA 1K78A 4MGRA 2IPQX 1R1UA 3FZVA 4LB6B 5LHGA 1R58A 1DPUA 3HSFA 1XSXA 5LEKA 4OMYA 5D5VB 3R6SA 4N9IA 2GXBA 3M7GA 4B8XA 3NQOA 1KU2A 5FFXA 2X0LA 1KQ9A 2M30A 5A2QK 3WTYC 4GO1A 2DK8A 2ZXJA 3CO6C 3F72A 2XGXA 2TDXA 4IRGA 3ZN0A 1O3SA 2ZMEB 2VONA 4XLPF 3LA7A 2Z3YA 4P55A 2LF7A 1MD0A 1F1ZA 3RYRA 3MZYA 3KP2A 1OYWA 1ZYRF 4HLYA 5HDGA 4YIIA 4YIFA 2IA2A 2D1VA 3RKYA 5BS6A 2P4WA 1R5GA 5HLGA 1SFUA 1KA8A 4FHTA 2GWRA 1SD6A 1U5TB 4G7HF 3D5LA 4L18B 3Q9VA 2RNJA 4ON0A 1JHFA 2BGCA 4ESBA 5HDKA 4M9SA 2HOEA 3M9AA 2E1CA 1ZG1A 3QU3A 1J59A 4WXCA 1B9MA 3T8RA 2LF8A 1YLFA 1IAWA 3DPLC 1AWCA 2AXLA 2XV4S 5D8KB 3GO5A 5ICFA 3E97A 2UXNA 4KNYA 4EMSA 4M72A 1WQ2A 1EH7A 3KEQA 2O6GE 1IUYA 1LEBA 1G3YA 1O57A 3WE3A 3K9TA 2M5WA 2IP2A 1QO0D 1REPC 1BC8C 1T38A 3IWZA 2V9VA 2NNNA 5L3FA 2P6TA 2WV0A 2GXGA 1TTYA 4LLLA 3RPQA 3FWEA 4U7DA 2EFQA 4LFUA 1SMTA 4HV5A 2VE9A 3MZHA 3KE2A 2XKPA 3VOEA 4PGHA 3H3ZA 3WU0A 4P96A 2L54A 1KU3A 4ENJA 3T8TA 4R8HA 3H3UA 2VODA 1DPRA 3EYIA 3JTHA 2JPBA 2G7UA 2DU9A 5HDNA 4IPAA 2QBYA 3L9FA 2A61A 4Q48A 3FXQA 2L4AA 2OU2A 4L9TA 1FBSA 4AVPA 3CLOA 3N97A 4MQVA 1HKSA 5BQTA 2FEZA 3IKVA 3R61A 1FSHA 5K5RA 1WSUA 5IT9Z 3LQQA 2R3SA 4WXHA 1DDNA 1SD5A 4MTDA 3T5XA 2VE8A 1FYKA 1XSVA 4I2OA 4BQAA 3U9GA 1ZLJA 1PUEE 2YSRA 4HF1A 3FF5A 4LB5A 5CVIA 1K6OA 1W4MA 4XSXF 4GYGA 2JT1A 3TO9A 2ZNZA 5D6FA 3K0LA 1J2XA 5LHIA 4EJVA 1FSEA 4I7HA 5ICEA 4KFCA 4PCQA 4Z2YA 3ML6A 5L3DA 3HTUA 5CJ9A 4LK0F 2P5KA 2QQBA 3LAJA 1P4AA 1LDJA 4M71A 2ZBKA 4EJTA 2V79A 1G3SA 4M6XA 3GZ5A 1OKRA 2OAZA 4EGZA 1K78B 2ETHA 1S7AA 5F64A 4TV7A 5AIPA 4AWXB 4EM2A 3RKWA 1ZN2A 5HOOA 3E3VA 2JPCA 2Z99A 3E6MA 4HX7A 5E1ZB 5KVRA 3NRVA 5LGNA 1RUNA 3V7RA 5CVVA 4IF4A 1S6LA 4AIJA 5J8CA 3BJOA 1WWXA 4YFNF 3KZYA 2A07F 5A2QZ 2QWWA 2M87A 2Q0OA 5HS7A 2PMHA 2CGPA 1MGTA 3RTRA 2EFPA 3CUOA 3BWGA 5LRRA 3DPTA 2RQPA 1W7PD 1P92A 2O3FA 2J5OA 2FU4A 1IRGA 4CO8A 4UXNA 2CWEA 1U78A 4KIBA 3FXRA 3DQVC 5LHHA 1FNNA 4KIGA 4RS8A 2HTJA 3I71A 4HF2A 2P8TA 4G94A 1BI1A 1HW2A 3FHZA 3PQJA 2LNBA 2PQ8A 2EB7A 1OPCA 4KDPA 2QUFA 1F9NA 2DAOA 3F6OA 1CGPA 4MEYF 3D0SA 5CLSA 4B09A 2EFNA 2Y75A 3SZTA 3CO7C 3F8MA 3EYYA 3E5XA 3TDZC 3VB2A 2R7DA 3M1EA 1BI3A 3QPTA 2XHKA 1I1SA 2RGVA 3BJAA 1ODDA 3VEPA 1SAXA 4HX4A 4UHTA 3RIRA 2QYOA 2F5DA 2EV5A 2OD5A 2F5EA 2D1HA 1FPQA 3LFKA 4GCVA 4A6DA 2HYGD 4RGXA 3V7CA 2OQRA 3FMRA 3ULQB 2BV6A 3IRQA 2W85A 4IXAA 4IHTA 4MTEA 2H6BA 4Y15A 1GVJA 3KEOA 4OINF 1W5SA 4I01A 1F4KA 2QZ8A 1U3EM 1FBQA 1LDDA 4AIKA 3IKTA 1J7KA 2RDPA 2Y48A 1ONVA 5K1YA 1S29A 3HHGA 2EWNA 1RI7A 1BOAA 3IHUA 1H0MA 1KQ0A 3BP8A 4WF2A 3I58A 1OR7A 1FC3A 1ZARA 4KT5C 3MFKA 5CVUA 1S8NA 2GQQA 3HIFA 4M73A 1J0RA 4KA4A 4H0EA 4R79A 2DO7A 1R36A 3ECOA 4JBAA 2KJCA 2YPRA 3DFGA 5DYMA 5DV5A 4EVIA 1XCBA 3ABTA 4LK1F 4ZYGA 3I54A 3WGHA 4JQFA 2VC1A 1K7AA 1O7FA 3BZ6A 1TBXA 1DP7P 3BDDA 2PN6A 4YG2F 2COMA 3BY6A 1XD7A 3KFWX 2XUBA 1ULYA 2ELHA 3QRFF 2DFIA 3P7NA 3R0AA 4MHGA 3G3ZA 1MDMA 4PGGA 2CFXA 1QGPA 2MC3A 1IF1A 2A68F 1HXDA 1G3WA 3I59A 4BYYA 4O6JA 4ZZDA 1TW3A 4LG0B 4G7OF 3E6CC 4YFKF 4HQEA 3QP5A 3TO7A 2FBIA 1T2KA 3JAMK 1ZLKA 2W57A 2STTA 1IXRC 2L3DA 1D8KA 3ECHA 3QP6A 2ISZA 1SD4A 5FD6A 4OIPF 5D4RA 1IN5A 3DEUA 2CO5A 4LMYA 2EA4A 3U2RA 2CQKA 2K7LA 2MD5A 3GFMA 2FXAA 1TQPA 4CHUA 3O3KA 2LDUA 2FRHA 1XDUA 4JK1X 2BE5F 4M9ZA 2K4BA 1QZYA 2V1UA 3T1BA 2PG4A 3WODF 4M6YA 4WX9A 1TW2A 1Z6RA 2VBYA 2PMUA 3FX3A 3L2CA 5H20A 2IW5A 4RAZA 3RI4A 3FXUA 5LBQA 2ADUA 2G9WA 4CXFA 1W7PB 2V6CA 1FP1D 3F6VA 2QM3A 5K5OA 1LB2A 1QZZA 1T6SA 5ED4A 1KYWA 3WU1B 1HW5A 3REOA 2UXXA 3HOSA 2Z33A 2VBZA 3B73A 4KYWA 3KLOA 3DXJF 2OZUA 1WI9A 3IC7A 3EUHA 2V1XA 1Z05A 5IT3A 4OIOF 6PAXA 1AOYA 2HTSA 2XAGA 1Q1HA 4MQ9F 4G9YA 2HDCA 5LEJA 1BI2A 3JAMZ 4CZZA 3GZ6A 4ESJA 2O8XA 3DKWA 5HVQC 3EDPA 1GXPA 3EQLF 1HBXG 3O6BB 4RGSA 4HOBA 4ESFA 1B6AA 3E5UA 4BH9A 2FNAA 4WWCA 2ZMEA 4DQ2A 4A0ZA 3WE2A 4S05A 1T0FA 2ZFWA 2XAQA 3C7JA 4IVNA 3MWMA 4UVBA 2IJLA 2BYVE 1LJ9A 2EV6A 1R00A 4WXDA 3V8LA 2IT0A 1GXQA 2HFHA 1XCVA 3C3WA 5FFZA 3W6KB 2CW0F 3GFLA 1TLHB 1EH8A 2W25A 2O0YA 3MAJA 3ABUA 5E1XA 4ETSA 2H27A 4HF0A 1TQMA 2VBWA 4EGYA 1WKMA 1ZRCA 1ZG3A 5LLQA 5E8GA 5D5UB 2NNYA 3R0JA 2FQ3A 4XRFA 1IN8A 3JW4A 4DNCA 4UV9A 2G7HA 3GWZA 3HUGA 2K02A 3PQKA 4RB0A 3K1MA 4ZYDA 4A12A 1ZAOA 2MA3A 4ENMA 5JHUA 3ELKA 2FSWA 3HYIA 5E8IA 2YX4A 2A6HF 2LKPA 4A2UA 2ZJ2A 4P9FA 5D5XB 1LDKB 4L9JA 3NEUA 1MJAA 5BPIA 2HGCA 2MLGA 3RDIA 4U88A 1ZREA 3CJNA 1IN4A 4KIFA 4LLGF 4YFXF 4KICA 3F8CA 1U2WA 1FX7A 3HTSB 2GA2A 1U5TC 3CUQC 2XAJA 4EJUA 1FOKA 3GYHX 1ON2A 3IL2A 5DUIA 3HRUA 2RKHA 2MH2A 1JHHA 3WGGA 1Z1DA 2EV0A 2OA4A 2Y0MA 3LSTA 3N4MA 4MEXF 4RB1A 2HKOA 2VXZA 3QAHA 3WTWC 1PDNC 3I59B 4PZJA 2CSOA 5L3CA 2IVMA 3IWFA 3GX4X 2GA1A 1I1GA 4HQMA 1BC7C 5ILSA 3L09A 1YTYA 2PI0A 4HAMA 1JXSA 3ZPLA 5HLIA 4G6QA 4PDKA 1V3FA 4U7BA 1ZG5A 2M45A 2FA5A 4U0WA 2W24A 5HLHA 3TOAA 4KUMA 2ESNA 1L3LA 2RC4A 3M8FA 1GHCA 1P6RA 2DI3A 3WTZA 1R5HA 2PJPA 2M1BA 2P7VB 4RGRA 2P5LC 1XGOA 2K4JA 2K86A 3QOPA 3BROA 1YW7A 3ZQ7A 1R7JA 4LLNA 1IW7F 2FOKA 1Z9CA 2IA0A 1H9GA 4P9UA 1KQ8A 3GXOA 2L4MA 1UB9A 1G4DA 1Z7UA 1SFXA 4KMUX 2UZKA 2YU3A 1RIOH 3P9KA 1XSDA 4D0PA 4BHPA 4XLNF 3R4KA 1JGSA 3WGIA 4L0ZB 2IA1A 3FMSA 4UVAA 4ZYEA 2DQRA 3BJ6A 2FE3A 4G7ZF 1LVAA 4HV6A 3FM5A 2H09A 5FD5A 1ZGJA 3SZPA 1RZ4A 3ZMZA 2VOOA 4FX4A 3SFZA 2FBKA 2V1DA 1QPMA 4BNCA 4RGUA 3ZMUA 1LNWA 5TJJA 3GLXA 5JR3A 4A0YA 4L5JA
chains in the Genus database with same CATH superfamily
3JCUC 3CCSI 4LGWA 4W97A 3PJRA 1H9TA 3WG9A 5KK1A 1J9IA 3BLYA 1I5ZA 5DM7F 2LKSA 3ZMTA 2Q2EA 3S93A 2EZKA 4I09A 1HKTA 5B66C 2HDDA 3OYLA 5E3LA 1JGGA 1FYMA 2R7OA 2DBBA 4M3EA 1K83J 1XMAA 2GOMA 4L9NA 1CQTA 2EK5A 2K5CA 3PFYA 3CCMI 5TRDA 1YI2I 1BM9A 1BBYA 4HDUA 1WJBA 1IV8A 2HZTA 2IAIA 1QQIA 1STZA 1JT0A 2JTVA 1LEAA 4IHWA 2R7FA 3A03A 1IZ1A 3HHHA 3SJMA 2Q1ZB 1OFCX 1NHAA 2DA7A 3OYDA 2VN2A 4A3EJ 2HXIA 1MMAA 2JK3A 5IYDJ 1O7LA 3I4PA 2RV8A 4K2EA 4RAYA 5AIQA 3ZQLA 2DYRH 3RKXA 1HDDC 2CUEA 1TNSA 3NAUA 4IRHA 5J40A 4BY7J 2HXOA 3P9CA 3JRBA 4HZFA 3T0YA 1N25A 1U6GA 4PUSA 1LFUP 1X3UA 2HYFA 1YQAA 3CUQB 4HBLA 4BEHB 1VF9A 4BHBA 1I27A 4JP0A 3M8JA 3G1LA 1XGNA 3IV5A 1X1DA 1JKQC 3I55I 5C4JJ 1AHDP 2KIFA 1O3QA 2P5VA 1JTYA 3AAFA 2QQ9A 3K69A 5IYBJ 3CCEI 3LSMA 5BPDA 3KLNA 2Y30A 3KYCB 4F7ZA 2JZYA 1QA6A 2A3SA 3CTAA 3S3OA 3GEZA 1UHWA 3I0TA 2HI3A 3D5RC 3CMEI 2EA2A 3KYDB 1TNTA 2LFBA 4M9XA 4PFPA 5GAEJ 1MNMC 2PEXA 4BUPA 3VSLA 4HW0A 1R23A 2QQAA 3CDIA 1U5TA 2A6EF 2KDZA 2FUG2 4HX8A 3JSPA 2B9SA 4L5IA 3LWFA 3KIOA 1TT0A 3F8NA 3ABKH 2IGNA 1KU9A 3W6JB 1BI0A 2VKDA 2O9LA 4PK4A 2V6EA 1YG2A 2VKVA 5AONA 1GV5A 2HNHA 3HGGA 4A3BJ 1P4XA 2GLOA 2HKXA 5E18F 3LSJA 1OYYA 3BQYA 4MNUA 5F1RA 1N78A 1PYVA 2LTPA 1JKOC 4QLCU 1I6HJ 3TKYA 4HNVA 3OSGA 1EV7A 1P4WA 5B5EC 4CCMA 5TGTA 4ITVA 4ASNA 3LSPA 1SMYF 2FNPA 3CD6I 4GYIA 1D5VA 2E5ZA 3HRTA 1WJFA 2BW3A 5EEHA 3GMEA 1TQIA 2F6CA 2X6OA 3GFIA 1P7JA 2VQLA 3VYSB 5FJ8J 3S32A 2M8EA 5TISC 2UWMA 2PFBA 2EIMH 2CV1A 1FLIA 3PNTA 3QPHA 1TWAJ 2AQFA 2FQ4A 2L9NA 3EUHC 2FMYA 2X48A 4A3IJ 4BAYA 4EJWA 4BDYA 4D7NA 3BR5A 4AIHA 2HVRA 4ENKA 3IP4B 1S9HA 4P5OA 5GTHC 5J6XA 4M3DA 3VYUB 3NWSA 3PM1A 2AS5F 1JUSA 4OAYA 5J4YA 1I50J 1FSHA 2FOWA 2DQLA 2VC0A 3BZKA 2R5YA 2H94A 5E1WA 1K79A 2LBFB 4N0BA 3ASNH 1ETYA 4A3FJ 2DPUA 2KMUA 3CZ6A 5M3MJ 3U1DA 4NC8A 5C3EJ 2K9SA 3UKGA 2J5PA 3PUFA 5DD4A 3RZOJ 2PLYA 3WHBA 4UUSB 1A31A 2F5FA 4GXOA 2JRMA 5F6FA 2F48A 1UG2A 1MBHA 2AHQA 5CYVA 1D1AA 3V8JA 3HPGA 5GP9A 2HQRA 1WJAA 1X19A 3ZMVA 3DP7A 3HOZJ 1EJ9A 2VIXA 3F21A 4OIRF 3H3VK 2XPUA 3SFIA 3E5QA 2E1NA 4I0AA 4IHXA 1HF0A 5D8LB 3G2BA 2YR2A 3OV8A 3CESA 2KRCA 2D45A 1WH7A 1OLTA 1L0OC 3LQRA 1X2MA 3DEEA 2QA4I 1XGSA 3P9IA 2ZXHA 4Y7NJ 3WTUC 3G1MA 4Y4RA 3ROUA 1YFHA 2JN6A 1WZ2A 1J5YA 2MLKA 1W5TA 2ZKZA 1VTNC 5FLXZ 3H5AA 1MJBA 2OPTA 1D1BA 2BBYA 5F04A 2NS7A 3IH4A 4AD9A 1RUOA 1MDMB 4E70A 1O3TA 4CCOA 2QVOA 1FBUA 3Q5FA 4ZYAA 3ZP5A 4CCKA 1YJ9I 5JI6A 3HDDA 4I6ZA 2GIVA 3CDHA 3PSIA 4L9VA 4ZDOA 2F5CA 5FGMA 1X58A 3J80Z 1O3RA 1GT0C 1G3TA 5ICGA 3C2GA 2I10A 3BG3A 1MMGA 3E6DA 3TGNA 4ZH4F 1AU7A 2L02A 3A0HC 5LRSA 1ZRDA 2JVGA 2K9MA 2DA4A 4BY1J 2VL8A 4EEFG 1BA5A 4E7HA 3R60A 3DF8A 4U0YA 3PO2J 5DEQA 1XGMA 4XR6A 1N77A 1D8JA 1HKQA 2L7ZA 1G6NA 3NWTA 3G71I 3Q0UA 2Z5UA 1PUFA 2MC4A 1OYIA 1MMNA 4IRIA 1O4XA 4UUVA 2VT3A 3A0BC 3HOUJ 4A0XA 1KU7A 1MZBA 1U8RA 1XN7A 3K4KA 1VQ5I 2XRNA 4FCYA 5D5WB 4UNOA 4QWQA 3HSEA 1MH4A 5ILVA 3F9KA 2W84A 2L2OA 2EFOA 1Y0NA 2RN7A 3AFHA 1V5GA 3MMYB 4WCGA 1FIPA 3HB9A 1S72I 4XQFA 3COAC 3RSNA 2PMZN 3K2ZA 3ABLH 3I64A 3DU5A 4ABZA 3RJPA 2H6CA 1CF7A 3CMMA 2V7FA 3HM5A 2C6YA 5JLWA 2HR3A 2DXIA 2ESHA 1B1BA 1S7OA 1UJ8A 3DU6A 3OYGA 3LA2A 3OIQA 4CDGA 1VQLI 1G8XA 1T39A 3O2PE 3A4CA 4DYQA 3RKQA 2EZHA 3HOYJ 5JLXA 3PFIA 3PNVA 1FZPB 2CRGA 2JSPA 4RB2C 1IN6A 3GTQJ 3BR2A 1LFBA 1HSTA 4FX0A 2KKOA 4J01A 2R7UA 1XMXA 3BG5A 4FQGA 3VPRA 2JSCA 2O61A 2HQAA 4OOIA 4NHJA 1P2FA 4FE4A 3S1QJ 4ANJA 2HU9A 1GLNA 1X4PA 5GAGJ 3ZRGA 5EZHA 5E3NA 2LK2A 3OL3A 4XLCA 2DLLA 1CF7B 1MKMA 1R22A 3CCYA 1C0WA 3KP5A 1YHQI 1TWCJ 2B0LA 2IS4A 1Z7LA 1T98A 3EETA 4YELA 2FMLA 3PUBA 1EH6A 2L01A 3E0JB 2XASA 1XMKA 3DBHB 5E17F 2LY9A 1FP2A 1S3JA 2E2JJ 2FF4A 3TP0A 4YIRX 2HVQA 1EKEA 4UUTA 2MBFA 5FROA 2DPDA 1V4RA 1D3YA 4BEHA 2XF5A 1XDSA 2E35A 2NS0A 1BN5A 4GRIA 3BPXA 1J75A 3DBLB 2ZB9A 1ZHFA 1YOVB 4NNJA 2DTRA 3J7AY 2OZ6A 1YS7A 2JA2A 3J7AO 3A01A 1BJAA 1IUFA 1A04A 4A93J 3HBLA 4A5NA 5EEAA 3HOTA 2V9KA 1E17A 3F8BA 3ESWB 1X3ZB 3GF2A 3U21A 2MABA 3FXOA 3IH3A 5JVTA 3JTGA 3TEDA 3EUKL 3HRSA 3J81K 1VQ8I 1MW7A 5GPCA 1NK2P 1XB4A 3SXYA 5D6EA 2HPMA 4LD5A 2YX7A 3OR2C 5DDGA 3J7YJ 5H6RA 3WTTC 1ZRFA 3JRAA 1WRJA 1X1BA 4XLEA 5L3EA 3ZMDA 3GVAA 1E2XA 4HLXA 3HOXJ 4EJOA 3MQ0A 3ISPA 5HS9A 1YO5C 1RNLA 2HEOA 2P6SA 4HSRA 2ZXWH 3E1SA 4EM0B 1LQ1A 1IRXA 2LSOA 4G12A 1MJ9A 1WJEA 5IOZA 1YE9A 4CICA 2XPVA 2VPRA 4S0HB 4FT8A 1UFMA 2BVLA 4BHCA 3H0DA 4C3IJ 3FK6A 3K2AA 3GCMA 4NQWB 3VYTB 4M74A 2NS8A 4DW6A 1IXCA 1MNEA 3TQNA 4AYBA 1LE8B 1B59A 3D5SC 3JRIA 3MN2A 5C44J 2EFWA 2Y0SN 3DCFA 2OBPA 2XSJC 4IJAA 2ZC2A 2KIMA 4D5CA 1R1VA 4OMZA 4PJNA 1VQ4I 1HQCA 3CF2A 3DLLF 3WTSC 3G1OA 4I02A 4BACA 2BEOA 1Z0XA 5HS8A 4I98B 4UV8A 2Z2SB 4G6DA 3QOEA 4Q5SF 3ERED 3BR1A 3H5RA 1IXSB 1NG6A 3UNGC 2R7RA 4A6EA 1H8AC 1YIOA 3SEZA 3S2WA 4G8XA 2DK5A 3MCZA 3LA3A 3W6VA 2NVQJ 2R5YB 4NQWA 5IP7J 3L2UA 1WH5A 3BPVA 2KJBA 3X2QH 4MO7A 3A2KA 3HOWJ 4C2TA 4C2MJ 1FTTA 3HSRA 1QNTA 1OCOH 1WVRA 2KT0A 1AKHB 4HDVA 2Q8KA 3O8GA 2O5RA 1YYVA 2E5NA 5FB2A 4LIUA 3L1PA 2XGEA 2ZO4A 2DDBA 1FY7A 3BG9A 4IQJA 3CUQA 1IDYA 4NB5A 4ZTFA 1WHUA 2DOAA 4F91B 4G6TB 5L3BA 2X1CA 2D2WA 4DZJA 5J3LA 3S2DJ 4CA0A 2M4KA 5LGTA 2XIGA 3KETA 2RAEA 1QRYA 3FIWA 2JA8J 4C3JJ 1QPIA 3LAPA 5DCFA 1WCMJ 1FYLA 4OIQF 1Z91A 2CUJA 1UAAA 2F4OB 2HWVA 5KCMA 3V4GA 4BQOA 1IN7A 3L2VA 4UVCA 2VJJA 3KP4A 3H9QA 2VI6A 5F0CA 1W0TA 2KIUA 1X1PA 2OTLI 4XSZF 2XAFA 3J81Z 2XROA 1TWGJ 3RPUA 1B9NA 1R1TA 2CU7A 2HS5A 2Z9OA 4I0BA 5CVJA 2O7OA 3CC2I 4ZZLA 1FOXA 4Y13A 1OMIA 1IV6A 1ON1A 3E6BA 1YS6A 3OOUA 3Q9SA 4EQQA 2EH3A 2P0WA 3JRDA 4RB3C 1KYZA 3C1DA 5EEGA 4DJAA 2NAZA 5BMZA 2VOPA 1Z6TA 5ERIA 1MBKA 2EJRA 1U8BA 2KRFA 1USTA 3F22A 3KCCA 5JFRA 3I5UA 4O3MA 3MKYB 1SC7A 1FMWA 1BJZA 3W2VA 3HJEA 1HSJA 1HW1A 2M4GA 4HA8A 4XMYA 5B3SH 4L0YB 1GUUA 3U1KA 1JUMA 5J8FA 3VODA 2GOXB 2H1LA 5FO5A 1BIAA 4U0VA 5FKKA 3GUDA 2FBHA 5KHDA 5KAFC 4ZYHA 3G73A 5IT9K 2A69F 2ZJPF 3DV8A 3QPLA 3J80K 4KN4X 3IRRA 4CUGA 2IS2A 2IS6A 3RYPA 1MMSA 1I3AA 2A5YB 3HL2A 1B4AA 2L7MP 3OOPA 1FT9A 2BXZA 2UV1A 4JX6A 2P81A 3H92A 5F08A 4IL6C 4XORA 3F3XA 4RA2A 3TOBA 2JVHA 2YUSA 1UCRA 5ICCA 3QYEA 3HRMA 3KP6A 3SQNA 3GW2A 2IRFG 2ECBA 2WTEA 4XBFA 2WWYA 2AO9A 2RVCA 2MH9A 2PJRB 2STWA 2R0QC 5DUKA 3PL8A 3M4OJ 1JE8A 1DP3A 1IDZA 3IUOA 4LJZF 2BHZA 5EZGA 2DFEA 5DCMA 3QU6A 2K9NA 3KZZA 4LG0A 3DPUA 1PP8F 2LREA 2DW4A 3DTKA 3TDUC 2WC2A 2ZCWA 4H4KC 2LBFA 2CG4A 1JJ8C 3GFJA 3F23A 1DU6A 4LOCA 2K9QA 1RKTA 3L00A 4II3A 3FBIB 2CQ7A 3CCQI 2OTJI 2PX9A 3FMQA 2NYXA 4PJLA 4B47A 3L7WA 4O5VA 1QBJA 2XAHA 1FIAA 4Y17A 1MIJA 3LSGA 4ZDPA 4KISA 3WTVC 2F2EA 3B02A 1K4SA 2XVCA 2ELJA 3AKZA 4JYKA 1ORKA 3K1PA 5LGUA 3K7AJ 2QBYB 3I53A 2G0EA 3GTLJ 1ETKA 1RETA 3ABMH 4CYDA 4WK8F 4EM1A 3V7SA 5FLXK 2E7XA 5DD8A 5DCMB 3VFZA 2X4HA 2P7CB 3DLAA 3G4SI 4M3FA 5IOYA 1LVKA 1A6IA 3TO6A 4GGGA 3V8KA 1YW9A 3OWTA 3M8EA 4BXFA 2OCCH 1Y0UA 1H89C 1XTAA 3K4NA 5D4SA 3CMAI 2ZNYA 2VT2A 1SFEA 3QQAA 3K1NA 2O03A 4R1HA 4KN7X 1VZ0A 3ZMSA 1I6XA 3F8FA 3L2QA 3SHFA 4RM2A 4BXUA 1UHMA 1R49A 3CJTB 5CVRA 3ZN1A 4DZPA 3MEXA 2GZWA 5E20A 2DFHA 1QZEA 2E7WA 4UB8C 2K27A 2JA7J 2VBXA 2OQGA 4D7MA 1Z77A 3VWBA 3BOQA 2KHMA 3KP3A 4KMFA 2QLZA 4E7LA 2ZMEC 1PP7U 3KP7A 3C18A 2EIKH 1K6YA 4EV0A 4E7JA 1D0YA 4HYEA 4ENNA 5JHFA 2GAUA 2V9PA 3WTXC 2NRAC 1ZH5A 4OU0A 1W7PA 2M2EA 4M3BA 3BTCA 5K7FA 4BXXJ 2Y9ZA 2QENA 5K5QA 3FM3A 1FWZA 2HOAA 2KPMA 2CQNA 4LITA 4Q47A 2WBMA 5E3MA 5BOXA 5B1BH 1USSA 2LY1A 1DUXC 3K4JA 9ANTA 1MBFA 4N4NB 1KGSA 1SVLA 4XLFA 4A5MA 3W2WA 1IRFA 5ILUA 4Q4ZF 2DT5A 1TT5B 3FXMA 4KT6A 4IHSA 5H6QA 4CGZA 2KZGA 3OYMA 1MH3A 3ASOH 2ACJA 4FTHA 4N9HA 2CYYA 5FLMJ 1T8IA 1BIBA 1SD7A 3JSOA 1APLC 1BOBA 5L3GA 1LKXA 2BVMA 1ZGAA 3NARA 2PBIA 4S04A 3V42A 2HQNA 2JRTA 1YW8A 2CUZA 1F5TA 2ISYA 1WI3A 2XKOA 1K78A 1VI0A 4MGRA 2IPQX 2DMPA 1ENHA 2NVXJ 1R1UA 1ETOA 1NTCA 4V2GA 3FZVA 4LB6B 2XF7A 2L9RA 4OWRB 5LHGA 1R58A 1DPUA 1P7IA 3DTEA 4A3GJ 3HSFA 1XSXA 4I76A 4DGWB 1XC5A 5LEKA 2FX0A 4OMYA 5D5VB 3HEFA 1GVDA 3R6SA 4N9IA 4D9JA 3M07A 5H2FC 5EF6A 2BHYA 3M7GA 2GXBA 4B8XA 1A35A 3NQOA 1KU2A 5FFXA 2X0LA 1IC8A 4Y52J 2KQRA 1KQ9A 1MBJA 2L7FP 2M30A 5A2QK 3WTYC 1XG1A 4GO1A 2ZXJA 2DK8A 2XPWA 5B1AH 4F92B 3CO6C 3F72A 4X0GA 2XGXA 2TDXA 4MLOA 4IRGA 3ZN0A 1O3SA 2JA6J 2ZMEB 2VONA 1FMVA 2BY0A 3TW6A 4XLPF 1W36C 3LA7A 5KNLA 2Z3YA 4P55A 2LF7A 5F1JA 1MD0A 3S1MJ 1F1ZA 3RYRA 3MZYA 3KP2A 3W2AA 1OYWA 3Q3SA 1ZYRF 4HLYA 5HDGA 2B63J 4YIIA 4YIFA 2IA2A 3PNYA 2ZSHB 4FE7A 2D1VA 2AQEA 5GADJ 4E4HA 3RKYA 5BS6A 3I4MJ 1Y8RB 2P4WA 3K70D 2EIJH 2DT6A 1R5GA 2OV7A 4HNTA 4I99C 3PO3J 5HLGA 1SFUA 3TL4X 1YX3A 3CLQA 1KA8A 4FHTA 2GWRA 2KDOA 2ME0A 3RCOA 1SD6A 1OCPA 4RMNA 3MKZA 4L5EA 1A6QA 1VNDA 2QSGX 1U5TB 4G7HF 1T56A 1HLVA 2WAEA 5IYCJ 1XX5A 3D5LA 3FXKA 5DM6F 1MBGA 1OCTC 1FJLA 3Q9VA 4ON0A 2RNJA 2QKLB 4L18B 1JHFA 2BGCA 4ESBA 5HDKA 4M9SA 3K70C 3I9V2 3C2HA 3FHNA 2KFDA 3CJQB 2HOEA 2X6YA 5HLTA 3M9AA 1B72B 2NVYJ 3JRGA 2E1CA 2KRHA 1V5EA 4AVZA 3F0CA 1ZG1A 2GM4A 1OR7C 4DIQA 2WADA 4HNUA 4ZDLA 4A3LJ 2R7SA 3QU3A 1J59A 4WXCA 3ZQHA 1B9MA 2WV1A 2CJJA 3T8RA 2LF8A 1YLFA 2JWTA 1IAWA 3DPLC 2CQXA 1AWCA 1HC8A 2O8KA 5F27A 2AXLA 2DTZA 2XV4S 5D8KB 3GO5A 2OJED 5ICFA 1R4MB 2K3FA 5GTIC 1SAUA 2F4IA 3CC7I 3OYKA 5DTDA 3E97A 2UXNA 3SDGA 4KNYA 4XNFA 4EMSA 4M72A 3LSIA 2EBIA 1WQ2A 3B6AA 3HGYA 1EH7A 3KEQA 1MSFC 2O6GE 1FTZA 4PJ0C 3M1CA 1NG7A 1IUYA 3Q0WA 1LEBA 1G3YA 1O57A 3WE3A 1B8IB 3K9TA 5J4VA 2M5WA 2JMWA 4J00A 2A05A 4JX4A 2IP2A 2X1DA 2LY2A 3ZXSA 4E7ZA 1QO0D 1REPC 1BC8C 1T38A 3IWZA 5EDNA 2YS9A 2V9VA 2W4SA 3PIPF 2FD5A 2M0MA 4JX5A 2NNNA 3HG9A 5L3FA 2P6TA 1VQ9I 2EPFA 2WV0A 2GXGA 1TTYA 4LLLA 3RPQA 3FWEA 3LL7A 2EFQA 4U7DA 4UUSA 1VQMI 4LFUA 1TC3C 1SMTA 4HV5A 1Y39A 4MFEA 3ONQA 3ZQGA 2VE9A 3CF5F 3MZHA 1DQUA 3CCUI 3BZCA 3KE2A 4XK4A 2XKPA 1D5YA 3VOEA 3OYAA 4PGHA 3A1YA 3DEWA 3H3ZA 4P96A 2L54A 3WU0A 3S3NA 2R5ZB 3GTJJ 1KU3A 4NC7A 4CCJA 4C9YA 4J19A 4ENJA 4IHYA 3T8TA 4F52A 4AM3A 1WJ5A 1AKHA 4R8HA 2DA5A 2DOEA 5GPAA 2DJIA 2NVTJ 3H3UA 4ZJZA 2JUGA 2VODA 2Y31A 4PSWA 2H8WA 3ZQIA 1DPRA 3EYIA 3JTHA 2JPBA 2G7UA 4NC6A 4BBRJ 3OS2A 2DU9A 5HDNA 3JREA 3LSKA 4IPAA 1LPQA 2QBYA 3TP3A 1A36A 1T08B 4B3XA 3MKLA 2EILH 2EQRA 2R7ZJ 1FEXA 3L9FA 2A61A 4Q48A 1SFOJ 3FXQA 2HOSA 1MNDA 3SEQA 2R92J 2L4AA 3K4BA 3H5NA 1M1EB 1SFKA 2OU2A 2R93J 3S8PA 4L9TA 3VDXA 1FBSA 3FDYA 4AVPA 3CLOA 2BZTA 3S1RJ 3N97A 4MQVA 1Z3YA 1HKSA 2VQHA 1W1WE 2BOLA 2FEZA 3IKVA 3R61A 5BQTA 5K5RA 1WSUA 3LQQA 5IT9Z 2R3SA 4WXHA 4BGDA 1DDNA 1SD5A 4V19K 5LFAA 4MTDA 3T5XA 1ERDA 2VE8A 1FYKA 4IX7A 1XSVA 4QSHA 1ACIA 4I2OA 4BQAA 1UZCA 3U9GA 1SANA 1ZLJA 3DKXA 4C30A 1PUEE 2YSRA 5CKTA 2GXAA 4HF1A 1SVOA 3FF5A 4LB5A 3HZJA 5CVIA 1K6OA 2HQ5A 2CV2A 3BC8A 4XLAA 1W4MA 4A3KJ 1UELB 2QSFX 4XSXF 4GYGA 3MKWB 2JT1A 2PMZA 3TO9A 4LG3A 2ZNZA 5D6FA 3OYNA 3K0LA 1J2XA 5LHIA 3JRCA 2VPLA 4EJVA 2Y9YA 2QQ8A 1FSEA 4I7HA 1BL0A 3UR3C 4BS9A 1TWHJ 5ICEA 4RLQA 3HOVJ 4KFCA 4PCQA 3VSKA 5EG0A 2E2HJ 4Z2YA 3ZQQA 3ML6A 2WAQA 4BDZA 5L3DA 3HTUA 2E60A 2XF6A 2L9SA 4LK0F 5CJ9A 2P5KA 2QQBA 3LAJA 2LKXA 2XGCA 3CQZJ 1P4AA 1LDJA 4E7KA 4M71A 4D1QA 2ZBKA 4ZTJA 1MBEA 3MD2A 2EZIA 4EJTA 2V79A 1G3SA 2PJRA 2EZLA 4M6XA 3GZ5A 3PIOF 1OKRA 2OAZA 4DBRA 3CCJI 1ZR2A 3K4MA 1WFXA 1ZK8A 2W48A 4EGZA 1K78B 1S7AA 2ETHA 3C2BA 1QHGA 3TW7A 1LFPA 5F64A 1I3QJ 4TV7A 3H9JA 5AIPA 3GLLA 1BR2A 4AWXB 2DCEA 4EM2A 3RKWA 1ZN2A 5DS9A 2VUMJ 2YU9J 1RR8C 1UMQA 5HOOA 3QODA 3E3VA 4IOAF 2JPCA 2Z99A 3BT9A 3BCBA 3I3LA 3E6MA 4HX7A 3E7LA 4XN0A 5E1ZB 4MFDA 5KVRA 3NRVA 3EPZA 5LGNA 1BR1A 1R6RA 3V7RA 5CVVA 4IF4A 3ZQFA 3RPUD 1W0UA 1RUNA 1S6LA 2E1OA 5J8CA 4AIJA 3BJOA 4B3AA 1ZGWA 2CH0A 2IBDA 1WWXA 3JR9A 1R71A 3KX2A 4YFNF 3KZYA 2A07F 5A2QZ 2BY2A 2QWWA 2M87A 2Q0OA 2LC2A 2PMHA 5HS7A 2CGPA 1MGTA 2LVSA 4PSXA 3RTRA 2EFPA 2ZXIA 2X1EA 3CUOA 3BWGA 5LRRA 2ZJQF 3DPTA 5EYRA 2RQPA 1W7PD 2DFFA 4YRVA 2FJ1A 3CCVI 1P92A 2O3FA 2DMTA 2J5OA 4F55A 3A01B 1X2NA 2FU4A 2DA2A 1J09A 3CJRB 1IRGA 4CO8A 4UXNA 2CWEA 1U78A 4KIBA 2LD5A 3FXRA 3DQVC 3HKZN 5LHHA 1FNNA 4A3DJ 4XRSG 2CW7A 3OY9A 1OCRH 4KIGA 1VQ6I 1Y1WJ 2LLKA 2IS1A 2I8DA 4RS8A 2HTJA 3DKYA 3I71A 2ME6A 2R7VA 4HF2A 2DODA 3H9GA 1S7EA 2P8TA 4G94A 3K6GA 1YRNA 3OSFA 1BI1A 1ZTRA 4HSTA 1HW2A 2CFOA 4UY8I 2CMPA 4IZZA 3FHZA 2IGOA 4DYCA 1F36A 3PQJA 2NXNB 5E79C 2ICWG 1DGRM 1Z3XA 2L5QA 2LNBA 2PQ8A 1FOYA 1OPCA 2EB7A 2M7AA 3AG1H 2DN0A 3TBIA 4KDPA 5E3OA 2VJ4A 5M5YJ 2B7EA 2DMQA 2QUFA 1F9NA 2DAOA 2VKEA 1V55H 4XKBA 2XSDC 3F6OA 1CGPA 2NVUB 3MVPA 2L7KA 5J1RA 3OIPA 4MEYF 1LE8A 3D0SA 5CLSA 3RZDJ 1VQNI 3GTGJ 3OYBA 4B09A 2EFNA 2Y75A 3SZTA 4BQNA 2F5VA 2L9VA 4HPQA 3L2RA 3I56I 3BTJA 3CO7C 1E0EA 4B43A 3F8MA 1G59A 3EYYA 3E5XA 3TDZC 3VB2A 1U9OA 1WPKA 3H0GJ 2LR8A 3MZ8A 4A3MJ 1VFCA 1ZKGA 2R7DA 3M1EA 5CQGA 1BI3A 2XB0X 3QPTA 2E36A 2XHKA 5IY5H 4B4CA 3BG6A 1ITYA 3QWLA 1I1SA 4QPOA 2RGVA 1VQ7I 3BJAA 1ODDA 3VEPA 2JUCA 2WB1A 4HX4A 4UHTA 1MMDA 3RIRA 1SAXA 4HEA2 4XKWA 2QYOA 2F4MB 2F5DA 2XGDA 4IO9F 2EV5A 2OD5A 3RQIA 2F5EA 2D1HA 1FPQA 3LFKA 4GCVA 4A6DA 2HYGD 4CYCA 3OR1C 4RGXA 3V7CA 2OQRA 3FMRA 3ULQB 2BV6A 3IRQA 2E34A 2W85A 4IXAA 4IHTA 4MTEA 2OF7A 2H6BA 4QTRA 4Y15A 1GVJA 3KEOA 1WJCA 1RRJA 2HZDA 4OINF 3SYTA 1W5SA 3LFUA 2HOTA 4I01A 3GBGA 1F4KA 4A69C 2KZVA 3OS1A 3Q0VA 2KIQA 2QZ8A 3VYRB 2W82A 4EATA 2XDVA 1U3EM 3HC7A 1FBQA 1PJRA 5HNHA 1YX5A 1LDDA 4AIKA 4M6VA 3IKTA 2V26A 1J7KA 2RDPA 2Y48A 3K10A 1ONVA 4BJ5C 1S29A 3H36A 5K1YA 3HHGA 3OL4A 2EWNA 1VQPI 1RI7A 4IHVA 1VQKI 2A5WA 1G2HA 4W1UA 1JUPA 1BOAA 2IGKA 4XRMA 1TP4A 2A6TA 3IHUA 1H0MA 1X1CA 1KQ0A 3AG3H 3BP8A 4C2UA 4WF2A 2RQQA 3I58A 1OR7A 1FC3A 4CCNA 1ZARA 3S16J 4KT5C 3MFKA 5CVUA 4XOTA 1S8NA 2GQQA 3DTIA 3IH2A 2QGUA 2GBYA 3TMOA 4BQQA 3HIFA 2EINH 3GZNB 4M73A 3KYLA 1J0RA 4KA4A 4H0EA 4R79A 2R7WA 2DO7A 1R36A 4XIDA 1X4OA 3A02A 1WJDA 3ECOA 3AG4H 4JBAA 1UG0A 2KJCA 2YPRA 3DFGA 5DYMA 1VQOI 5K7HA 5DV5A 1IJWC 1HCRA 1ETXA 1A5JA 4EVIA 1XCBA 3ABTA 4LK1F 3DWLE 3I54A 3WGHA 4JQFA 4ZYGA 1BW6A 2JQ7A 2VC1A 1K7AA 1O7FA 3BZ6A 2M7BA 1TBXA 1DP7P 3KZIC 3S17J 4CZCA 3BDDA 4KITB 3WG7H 4Y3OA 3CMYA 2PN6A 4QPQA 4YG2F 2COMA 3BY6A 4AC0A 4RAGA 1XD7A 3KFWX 1IRZA 2XUBA 1ULYA 2ELHA 3DBRB 3QRFF 2DFIA 3P7NA 3R0AA 2COBA 4MHGA 4X6AJ 3G3ZA 3BR3A 5IP9J 2IXSA 1MDMA 2CS3A 4PGGA 5EGOA 2CFXA 1QGPA 2MC3A 1X1AA 2L0KA 1IF1A 2A68F 1HXDA 1G3WA 2DMNA 1ETQA 3I59A 4BYYA 2QKMB 5J1YA 2VJ5A 4O6JA 2ELKA 2MW8A 1S5LC 4ZZDA 2W7NA 1TW3A 4LG0B 2E1MB 4G7OF 3E6CC 4YFKF 4HQEA 3LNQA 3QP5A 1TZLA 3FKJA 1HA8A 1JT6A 1B8IA 3TO7A 1TWFJ 3OIOA 2FBIA 1T2KA 3JAMK 2ZSIB 1ZLKA 1IO2A 3BQZA 2W57A 2STTA 1IXRC 2L3DA 2OC6A 1XS9A 1D8KA 3ECHA 3OYCA 3QP6A 3S3MA 4NDLA 2ISZA 1SD4A 4LIVA 3GTOJ 5FD6A 2W1OA 4OIPF 5EGOB 5D4RA 1IN5A 2CV0A 3DEUA 5EJCA 2CO5A 1V5FA 3J7ZI 1OCZH 4RBOA 5FLVA 4JOMA 3HXLA 4LMYA 2EA4A 3H35A 1D0ZA 3U2RA 1R9TJ 2CQKA 2K7LA 4BE2A 2MD5A 3GFMA 1T33A 1U9NA 2DOFA 2FXAA 1TQPA 4FASD 4CHUA 3O3KA 2LDUA 2FRHA 1HDPA 2XC7A 1XDUA 3BCAA 4FISA 4JK1X 5KAIC 5FRNA 3OYIA 2HVSA 3W3CA 3CCLI 2BE5F 4XRSA 4GDFA 3CDLA 2DMUA 2WA0A 2WB1N 4M9ZA 3GTKJ 2K4BA 3N05A 1QZYA 3BR6A 2H1KA 2V1UA 3T1BA 2JA5J 2PG4A 3WODF 3WU2C 4M6YA 4WX9A 4IQ4A 1TW2A 1Z6RA 2Y2ZA 4XN3A 4BJTA 4XONA 3CC4I 2VBYA 5HNFA 2PMUA 3FX3A 4UB6C 3L2CA 5H20A 2IW5A 4RAZA 5BNGA 3RI4A 5M5XJ 3M3YJ 3FXUA 5LBQA 3IAS2 3OS0A 1LUJB 4YEJA 2ZFUA 2ADUA 3BR0A 2DJNA 2G9WA 4CXFA 4AIDA 3B6CA 4FETA 2MYSA 1W7PB 2V6CA 1FP1D 3F6VA 1HOMA 2QM3A 2VB6A 5K5OA 1LB2A 1E3HA 1QZZA 1T6SA 5ED4A 2K9LA 2TCTA 3FXJA 1KYWA 5FKOA 2GIZA 2KISA 3WU1B 2HPIA 1HW5A 2UUZA 2Y69H 2Z16A 3REOA 3KPHA 4B1RA 2UXXA 4XKVA 3HOSA 2Z33A 2VBZA 1RC9A 1T95A 4RDUA 3D1NI 3B73A 4KYWA 3KLOA 1GV2A 2OZUA 3DXJF 2LH9A 1WI9A 1X3WB 3IC7A 4P1WA 2MG4A 3EUHA 2V1XA 2HDWA 1Z05A 4RLFA 5IT3A 4OIOF 6PAXA 4Z6YA 1AOYA 1JTXA 4E7SA 2HTSA 4DBQA 3RQ4A 4HG2A 4PFOA 1YJNI 2R7QA 2XAGA 1Q1HA 4N4OB 2X9DA 4G9YA 4MQ9F 1POGA 2HDCA 5LEJA 4II2A 2E2IJ 1BI2A 4NUBA 2MGQA 1Y8QB 2VKHA 2MD0A 4E7IA 2KLOA 1Z67A 2AXTC 3JAMZ 4BE1A 3L2WA 4A3JJ 1OQYA 5F0HA 4CZZA 3GZ6A 1DU0A 4ESJA 1JKPC 3K4LA 2O8XA 1ZQ3P 1QVTA 3DKWA 1EF4A 5HVQC 3EDPA 2V1NA 3QPSA 3LOCA 1GXPA 2BY1A 3EQLF 1W36D 1Y1VJ 1HBXG 3O6BB 3AL0C 4RGSA 4HOBA 5FKNA 1N75A 1B6AA 1FOWA 4ESFA 3E5UA 1RR7A 4BH9A 2FNAA 2DT7B 4WWCA 2IGMA 4XKCA 2ZMEA 4DQ2A 1KZHA 1UHSA 5JVGF 4A0ZA 3WE2A 4U87A 3JRFA 4S05A 2R7XA 4D5FA 5FKLA 1T0FA 5K7ZA 2ZFWA 2XAQA 3C7JA 4IVNA 3MWMA 4UVBA 4BKXA 2IJLA 2BYVE 1LJ9A 2EV6A 3FKIJ 1R00A 4ZC3A 1K4TA 4CH7A 2M0CA 1Z21A 4WXDA 3CCRI 1YJWI 3V8LA 1ZR4A 2IT0A 1GXQA 3ZQCA 2RNGA 2HFHA 1D0XA 1XCVA 3BTIA 3C3WA 5FFZA 3HUGB 2M34A 3W6KB 3I4NJ 2CW0F 3GFLA 2WY7Q 1TLHB 2OUMA 1EH8A 3S14J 5IPAA 5CPRB 1SVMA 3ZR8X 2W25A 3QYBA 2O0YA 3MAJA 3ABUA 5E1XA 1QU3A 1EA3A 4ETSA 2H27A 1D1CA 4HF0A 1TQMA 2VBWA 4EGYA 1WKMA 3KEYA 3OYFA 1ZRCA 1ZG3A 5LLQA 2VLAA 5E8GA 2Y0SA 5D5UB 2NNYA 1JJ6C 3R0JA 4AUXA 2FQ3A 4XRFA 1IN8A 4V2FA 3JW4A 4E6KG 1YITI 1BW5A 4XLHA 1XPXA 4IKFA 4DNCA 3OYJA 3CP8A 2WY8Q 2I5UA 2VQGA 4UV9A 2G7HA 3GWZA 2N8GA 3HUGA 2K02A 3PQKA 3BG7A 4RB0A 2WAFA 3K1MA 4ZYDA 4A12A 1DGWY 1ZAOA 2K40A 2MA3A 5JHUA 4ENMA 3ELKA 1B72A 5LD2C 2FSWA 3HYIA 5E8IA 2YX4A 4XICA 2A6HF 2LKPA 4A2UA 2LRDA 2X6WA 2ZJ2A 4P9FA 3CP2A 5D5XB 1LDKB 4L9JA 1OISA 3NEUA 1ETWA 1MJAA 5BPIA 1YRNB 2HGCA 2MLGA 1E3PA 4U88A 3RDIA 3CJNA 1ZREA 1WGXA 1IN4A 4KIFA 4LLGF 4YFXF 1F43A 4KICA 4PJMA 3F8CA 5M3FJ 1U2WA 4RM3A 4BBSJ 1FX7A 3HTSB 2GA2A 3O8HA 1T0FC 1U5TC 3CUQC 5C4XJ 1PVEA 2JJ7A 2DA3A 1E3OC 2XAJA 5CQEA 4EJUA 3GYHX 1FOKA 2BXYA 1GDTA 1ON2A 3IL2A 5DUIA 2MFZA 3HRUA 2RKHA 2X6XA 2MH2A 1JHHA 3WGGA 1NK3P 1BR4A 3FXLA 1Z1DA 4DYRA 5GAHJ 2BW3B 3LSHA 4AU7A 2EV0A 2OA4A 2Y0MA 3ZOBA 1Q1VA 3IAM2 2K3PA 3LSTA 3AG2H 5F0FA 4NBQA 2IEKA 2H8RA 5FRMA 3N4MA 4MEXF 1JI8A 2E1MC 4RB1A 3ERMA 3HPHA 1I39A 2HKOA 2VXZA 1PUFB 2LYCA 3QAHA 2KP6A 3S2HJ 1U0JA 2CUFA 1K61A 2KL4A 3WHCA 2M8GX 3WTWC 2ID3A 3BTLA 3H1CA 3QYFA 1PDNC 3S1NJ 3I59B 4PZJA 2XB5A 2CSOA 3OYEA 5L3CA 1OJLA 2IVMA 3IWFA 2K85A 4CYCB 3GX4X 2GA1A 3HKZA 1ZELA 2R5ZA 4BE0A 1I1GA 4HQMA 1BC7C 2CW8A 5ILSA 3G6EI 3L09A 3PSFA 2DA1A 1Y6IA 1YTYA 2OCEA 4HAMA 2PI0A 3SDBA 4QIWN 1P9QC 1JXSA 3ZPLA 5HLIA 1RESA 2LG4A 4PJJA 2V4JC 2DDAA 1KONA 4M3GA 2QSHX 4IEJA 4BJ6C 4G6QA 3S15J 4PDKA 3LMMA 5FKMA 1V3FA 1IG7A 4U7BA 1V54H 1ZG5A 2WAQN 2M45A 2FA5A 4U0WA 2LMDA 2W24A 5HLHA 3TOAA 2D5VA 4KUMA 2QEXI 2ESNA 4F93B 4XOPA 1R4NB 4RAFA 1L3LA 2RC4A 3M8FA 2NOGA 1GHCA 2R7TA 1RKWA 2X85A 5J1UA 4CSWA 4IOCF 1P6RA 1RPWA 2DI3A 2ZJRF 3WTZA 1R5HA 4XL9A 2PJPA 2M1BA 2P7VB 1QHHD 4RGRA 2P5LC 1W5CC 1XGOA 3FBNB 3AL0B 2XAUA 3SZGA 2K4JA 2K86A 3QOPA 3BROA 1YW7A 3ZQ7A 2CQQA 2ECCA 2M9HA 1R7JA 4AYBN 4LLNA 1IW7F 4B44A 2FOKA 2DYSH 1Z9CA 5IP6A 2IA0A 5J47A 4C3HJ 1H9GA 4P9UA 1KQ8A 3GXOA 4CCLA 3FISA 2VQCA 2L4MA 3EUAA 1UB9A 1G4DA 1Z7UA 1SFXA 4KMUX 2DA6A 3ZGKA 2UZKA 2MSYA 2YU3A 1YIJI 1R5ID 1RIOH 3P9KA 3GTPJ 2VXDA 1H88C 4HRIA 1XSDA 1Y56A 4D0PA 4BHPA 1JKRC 4OAZA 4XLNF 2BY3A 3FK7A 2LP0A 4DOZA 4MIMA 2XRLA 1JGSA 2LOOA 2Z1DA 3R4KA 3WGIA 3JRHA 2E71A 2E19A 4L0ZB 2IA1A 5HODA 5EG0B 3FMSA 4UVAA 4ZYEA 1ETVA 4BU2A 2DQRA 3BJ6A 1AA7A 2VASA 2FE3A 1NH3A 2NOJB 3ZCOA 4G7ZF 1LVAA 4HV6A 3FM5A 1IGNA 2H09A 5FD5A 4XM3A 4F3QA 4BL0B 5M5WJ 2R4GA 4GFBA 2QF7A 1ZGJA 2Q2EB 3SZPA 1RZ4A 1MSEC 2X51A 2ID6A 3ZMZA 4X1EA 2VOOA 4FX4A 2M3AA 2W00A 2TRTA 3SFZA 4A3CJ 2FBKA 2V1DA 2VJIA 1QPMA 4BNCA 3OMYA 4Y33A 4RGUA 3ZMUA 2RREA 1SEUA 1LNWA 4B48A 3GTMJ 1OCCH 3K4CA 5TJJA 3GLXA 3OYHA 2QCOA 5JR3A 4KJZA 3LSRA 4A0YA 4L5JA 1TL8A 2HYJA 1QVUA 3P5JA
chains in the Genus database with same CATH topology
4LGWA 1H9TA 3WG9A 5KK1A 1J9IA 1I5ZA 3ZMTA 2Q2EA 4I09A 1HKTA 1FYMA 2DBBA 1XMAA 4L9NA 2EK5A 5TRDA 1BM9A 1BBYA 4HDUA 2HZTA 1QQIA 1STZA 2JTVA 1LEAA 2R7FA 3HHHA 1IZ1A 1NHAA 2VN2A 1O7LA 3I4PA 2RV8A 4K2EA 4RAYA 5AIQA 3RKXA 1TNSA 4IRHA 3P9CA 4HZFA 3T0YA 1U6GA 1X3UA 2HYFA 1YQAA 3CUQB 4HBLA 4BHBA 1I27A 1XGNA 2KIFA 1O3QA 2P5VA 5BPDA 2QQ9A 3K69A 3AAFA 3KLNA 4F7ZA 2JZYA 2A3SA 3CTAA 3GEZA 1UHWA 3I0TA 2EA2A 1TNTA 4M9XA 2PEXA 4HW0A 1R23A 2QQAA 1U5TA 2A6EF 4HX8A 3JSPA 4L5IA 3LWFA 3F8NA 1KU9A 3W6JB 1BI0A 1YG2A 5AONA 1P4XA 2HKXA 5E18F 1OYYA 4MNUA 5F1RA 4QLCU 3TKYA 1EV7A 1P4WA 4ASNA 1SMYF 2FNPA 4GYIA 1D5VA 3HRTA 3GFIA 5EEHA 1TQIA 2M8EA 2UWMA 2PFBA 1FLIA 3QPHA 2FMYA 4BAYA 4EJWA 4AIHA 4ENKA 4P5OA 5J6XA 2AS5F 2VC0A 2DQLA 2H94A 5E1WA 1K79A 4N0BA 2DPUA 3U1DA 2J5PA 5DD4A 2PLYA 2F5FA 4GXOA 5F6FA 5CYVA 3V8JA 2HQRA 3ZMVA 3DP7A 3F21A 4OIRF 3E5QA 2E1NA 4I0AA 5D8LB 2YR2A 3OV8A 2D45A 1L0OC 3LQRA 1XGSA 3P9IA 3WTUC 3ROUA 1YFHA 1J5YA 2MLKA 1W5TA 2ZKZA 1VTNC 5FLXZ 1MJBA 2BBYA 4AD9A 1RUOA 1MDMB 4E70A 1O3TA 2QVOA 1FBUA 3Q5FA 3ZP5A 5JI6A 2GIVA 3CDHA 4L9VA 2F5CA 5FGMA 3J80Z 1O3RA 1G3TA 5ICGA 3E6DA 3TGNA 4ZH4F 2L02A 5LRSA 1ZRDA 3R60A 3DF8A 4U0YA 5DEQA 1XGMA 1D8JA 1HKQA 1G6NA 2Z5UA 1OYIA 4IRIA 4UUVA 2VT3A 4A0XA 1KU7A 1MZBA 1U8RA 1XN7A 2XRNA 5D5WB 4UNOA 4QWQA 3HSEA 5ILVA 2W84A 2EFOA 2RN7A 4WCGA 3COAC 3K2ZA 3I64A 3RJPA 2H6CA 1CF7A 2C6YA 2HR3A 2ESHA 1B1BA 1S7OA 3LA2A 4CDGA 1T39A 3O2PE 3PFIA 1FZPB 4RB2C 1IN6A 1HSTA 4FX0A 2KKOA 2JSCA 2O61A 4OOIA 4NHJA 1P2FA 2DLLA 1CF7B 1MKMA 1R22A 1C0WA 3KP5A 2B0LA 1T98A 3EETA 2FMLA 1EH6A 2L01A 2XASA 1XMKA 5E17F 1FP2A 1S3JA 2FF4A 2MBFA 2DPDA 1V4RA 1D3YA 1XDSA 2NS0A 1BN5A 3BPXA 1J75A 1ZHFA 2DTRA 2OZ6A 1YS7A 3J7AO 1BJAA 1A04A 4A5NA 3HOTA 1E17A 3F8BA 3GF2A 5JVTA 3JTGA 3HRSA 3J81K 1XB4A 3SXYA 5D6EA 4LD5A 2YX7A 5DDGA 5H6RA 3WTTC 1ZRFA 1WRJA 5L3EA 3ZMDA 3GVAA 1E2XA 4HLXA 4EJOA 3MQ0A 3ISPA 5HS9A 1YO5C 1RNLA 2HEOA 2P6SA 4EM0B 1LQ1A 2LSOA 1MJ9A 4CICA 4FT8A 1UFMA 4BHCA 4M74A 1IXCA 3TQNA 1B59A 2EFWA 2OBPA 4IJAA 2KIMA 1R1VA 4OMZA 1HQCA 3WTSC 4I02A 2BEOA 5HS8A 4I98B 4UV8A 4G6DA 4Q5SF 3ERED 1IXSB 4A6EA 1YIOA 3S2WA 4G8XA 2DK5A 3MCZA 3LA3A 4NQWA 3BPVA 2KJBA 3HSRA 1QNTA 4HDVA 2Q8KA 1YYVA 5FB2A 2ZO4A 1FY7A 3CUQA 4NB5A 5L3BA 2D2WA 5LGTA 2XIGA 3KETA 3LAPA 5DCFA 1FYLA 4OIQF 1Z91A 2HWVA 3V4GA 1IN7A 4UVCA 3KP4A 2KIUA 4XSZF 2XAFA 3J81Z 2XROA 3RPUA 1B9NA 1R1TA 2HS5A 2Z9OA 4I0BA 5CVJA 4ZZLA 4Y13A 1OMIA 1ON1A 3E6BA 1YS6A 3Q9SA 4EQQA 4RB3C 1KYZA 3C1DA 5EEGA 2NAZA 5BMZA 2VOPA 1Z6TA 5ERIA 2EJRA 2KRFA 1USTA 3F22A 3KCCA 5JFRA 3I5UA 4O3MA 1HSJA 1HW1A 4HA8A 4L0YB 5J8FA 3VODA 5FO5A 1BIAA 4U0VA 3GUDA 2FBHA 4ZYHA 3G73A 5IT9K 2A69F 3DV8A 3J80K 4KN4X 3IRRA 3RYPA 2A5YB 1B4AA 3OOPA 1FT9A 3H92A 3F3XA 3TOBA 1UCRA 5ICCA 3HRMA 3KP6A 3SQNA 3GW2A 2IRFG 2WTEA 4XBFA 2WWYA 2RVCA 2MH9A 2STWA 5DUKA 1JE8A 4LJZF 5DCMA 3QU6A 3KZZA 4LG0A 1PP8F 2DW4A 3TDUC 2WC2A 2ZCWA 2CG4A 3GFJA 3F23A 3L00A 3FMQA 2NYXA 3L7WA 4O5VA 1QBJA 2XAHA 4Y17A 3WTVC 2F2EA 3B02A 2XVCA 3K1PA 5LGUA 2QBYB 3I53A 4CYDA 4WK8F 4EM1A 3V7SA 5FLXK 2E7XA 5DD8A 5DCMB 3VFZA 2X4HA 2P7CB 3TO6A 4GGGA 3V8KA 1YW9A 3M8EA 1Y0UA 5D4SA 2ZNYA 2VT2A 1SFEA 3K1NA 2O03A 4R1HA 4KN7X 3ZMSA 1I6XA 3F8FA 3SHFA 4BXUA 1UHMA 5CVRA 3ZN1A 3MEXA 2GZWA 5E20A 2E7WA 2K27A 2VBXA 2OQGA 3BOQA 4KMFA 3KP3A 2QLZA 1PP7U 3KP7A 3C18A 4EV0A 4HYEA 4ENNA 2GAUA 2NRAC 3WTXC 1ZH5A 4OU0A 1W7PA 2QENA 5K5QA 3FM3A 1FWZA 5BOXA 4Q47A 1USSA 1DUXC 1KGSA 4A5MA 1IRFA 5ILUA 4Q4ZF 2DT5A 4IHSA 5H6QA 4CGZA 2ACJA 4N9HA 2CYYA 1BIBA 1SD7A 3JSOA 5L3GA 1ZGAA 2PBIA 4S04A 2HQNA 2JRTA 1YW8A 1F5TA 2ISYA 2XKOA 1K78A 4MGRA 2IPQX 1R1UA 3FZVA 4LB6B 5LHGA 1R58A 1DPUA 3HSFA 1XSXA 5LEKA 4OMYA 5D5VB 3R6SA 4N9IA 2GXBA 3M7GA 4B8XA 3NQOA 1KU2A 5FFXA 2X0LA 1KQ9A 2M30A 5A2QK 3WTYC 4GO1A 2DK8A 2ZXJA 3CO6C 3F72A 2XGXA 2TDXA 4IRGA 3ZN0A 1O3SA 2ZMEB 2VONA 4XLPF 3LA7A 2Z3YA 4P55A 2LF7A 1MD0A 1F1ZA 3RYRA 3MZYA 3KP2A 1OYWA 1ZYRF 4HLYA 5HDGA 4YIIA 4YIFA 2IA2A 2D1VA 3RKYA 5BS6A 2P4WA 1R5GA 5HLGA 1SFUA 1KA8A 4FHTA 2GWRA 1SD6A 1U5TB 4G7HF 3D5LA 4L18B 3Q9VA 2RNJA 4ON0A 1JHFA 2BGCA 4ESBA 5HDKA 4M9SA 2HOEA 3M9AA 2E1CA 1ZG1A 3QU3A 1J59A 4WXCA 1B9MA 3T8RA 2LF8A 1YLFA 1IAWA 3DPLC 1AWCA 2AXLA 2XV4S 5D8KB 3GO5A 5ICFA 3E97A 2UXNA 4KNYA 4EMSA 4M72A 1WQ2A 1EH7A 3KEQA 2O6GE 1IUYA 1LEBA 1G3YA 1O57A 3WE3A 3K9TA 2M5WA 2IP2A 1QO0D 1REPC 1BC8C 1T38A 3IWZA 2V9VA 2NNNA 5L3FA 2P6TA 2WV0A 2GXGA 1TTYA 4LLLA 3RPQA 3FWEA 4U7DA 2EFQA 4LFUA 1SMTA 4HV5A 2VE9A 3MZHA 3KE2A 2XKPA 3VOEA 4PGHA 3H3ZA 3WU0A 4P96A 2L54A 1KU3A 4ENJA 3T8TA 4R8HA 3H3UA 2VODA 1DPRA 3EYIA 3JTHA 2JPBA 2G7UA 2DU9A 5HDNA 4IPAA 2QBYA 3L9FA 2A61A 4Q48A 3FXQA 2L4AA 2OU2A 4L9TA 1FBSA 4AVPA 3CLOA 3N97A 4MQVA 1HKSA 5BQTA 2FEZA 3IKVA 3R61A 1FSHA 5K5RA 1WSUA 5IT9Z 3LQQA 2R3SA 4WXHA 1DDNA 1SD5A 4MTDA 3T5XA 2VE8A 1FYKA 1XSVA 4I2OA 4BQAA 3U9GA 1ZLJA 1PUEE 2YSRA 4HF1A 3FF5A 4LB5A 5CVIA 1K6OA 1W4MA 4XSXF 4GYGA 2JT1A 3TO9A 2ZNZA 5D6FA 3K0LA 1J2XA 5LHIA 4EJVA 1FSEA 4I7HA 5ICEA 4KFCA 4PCQA 4Z2YA 3ML6A 5L3DA 3HTUA 5CJ9A 4LK0F 2P5KA 2QQBA 3LAJA 1P4AA 1LDJA 4M71A 2ZBKA 4EJTA 2V79A 1G3SA 4M6XA 3GZ5A 1OKRA 2OAZA 4EGZA 1K78B 2ETHA 1S7AA 5F64A 4TV7A 5AIPA 4AWXB 4EM2A 3RKWA 1ZN2A 5HOOA 3E3VA 2JPCA 2Z99A 3E6MA 4HX7A 5E1ZB 5KVRA 3NRVA 5LGNA 1RUNA 3V7RA 5CVVA 4IF4A 1S6LA 4AIJA 5J8CA 3BJOA 1WWXA 4YFNF 3KZYA 2A07F 5A2QZ 2QWWA 2M87A 2Q0OA 5HS7A 2PMHA 2CGPA 1MGTA 3RTRA 2EFPA 3CUOA 3BWGA 5LRRA 3DPTA 2RQPA 1W7PD 1P92A 2O3FA 2J5OA 2FU4A 1IRGA 4CO8A 4UXNA 2CWEA 1U78A 4KIBA 3FXRA 3DQVC 5LHHA 1FNNA 4KIGA 4RS8A 2HTJA 3I71A 4HF2A 2P8TA 4G94A 1BI1A 1HW2A 3FHZA 3PQJA 2LNBA 2PQ8A 2EB7A 1OPCA 4KDPA 2QUFA 1F9NA 2DAOA 3F6OA 1CGPA 4MEYF 3D0SA 5CLSA 4B09A 2EFNA 2Y75A 3SZTA 3CO7C 3F8MA 3EYYA 3E5XA 3TDZC 3VB2A 2R7DA 3M1EA 1BI3A 3QPTA 2XHKA 1I1SA 2RGVA 3BJAA 1ODDA 3VEPA 1SAXA 4HX4A 4UHTA 3RIRA 2QYOA 2F5DA 2EV5A 2OD5A 2F5EA 2D1HA 1FPQA 3LFKA 4GCVA 4A6DA 2HYGD 4RGXA 3V7CA 2OQRA 3FMRA 3ULQB 2BV6A 3IRQA 2W85A 4IXAA 4IHTA 4MTEA 2H6BA 4Y15A 1GVJA 3KEOA 4OINF 1W5SA 4I01A 1F4KA 2QZ8A 1U3EM 1FBQA 1LDDA 4AIKA 3IKTA 1J7KA 2RDPA 2Y48A 1ONVA 5K1YA 1S29A 3HHGA 2EWNA 1RI7A 1BOAA 3IHUA 1H0MA 1KQ0A 3BP8A 4WF2A 3I58A 1OR7A 1FC3A 1ZARA 4KT5C 3MFKA 5CVUA 1S8NA 2GQQA 3HIFA 4M73A 1J0RA 4KA4A 4H0EA 4R79A 2DO7A 1R36A 3ECOA 4JBAA 2KJCA 2YPRA 3DFGA 5DYMA 5DV5A 4EVIA 1XCBA 3ABTA 4LK1F 4ZYGA 3I54A 3WGHA 4JQFA 2VC1A 1K7AA 1O7FA 3BZ6A 1TBXA 1DP7P 3BDDA 2PN6A 4YG2F 2COMA 3BY6A 1XD7A 3KFWX 2XUBA 1ULYA 2ELHA 3QRFF 2DFIA 3P7NA 3R0AA 4MHGA 3G3ZA 1MDMA 4PGGA 2CFXA 1QGPA 2MC3A 1IF1A 2A68F 1HXDA 1G3WA 3I59A 4BYYA 4O6JA 4ZZDA 1TW3A 4LG0B 4G7OF 3E6CC 4YFKF 4HQEA 3QP5A 3TO7A 2FBIA 1T2KA 3JAMK 1ZLKA 2W57A 2STTA 1IXRC 2L3DA 1D8KA 3ECHA 3QP6A 2ISZA 1SD4A 5FD6A 4OIPF 5D4RA 1IN5A 3DEUA 2CO5A 4LMYA 2EA4A 3U2RA 2CQKA 2K7LA 2MD5A 3GFMA 2FXAA 1TQPA 4CHUA 3O3KA 2LDUA 2FRHA 1XDUA 4JK1X 2BE5F 4M9ZA 2K4BA 1QZYA 2V1UA 3T1BA 2PG4A 3WODF 4M6YA 4WX9A 1TW2A 1Z6RA 2VBYA 2PMUA 3FX3A 3L2CA 5H20A 2IW5A 4RAZA 3RI4A 3FXUA 5LBQA 2ADUA 2G9WA 4CXFA 1W7PB 2V6CA 1FP1D 3F6VA 2QM3A 5K5OA 1LB2A 1QZZA 1T6SA 5ED4A 1KYWA 3WU1B 1HW5A 3REOA 2UXXA 3HOSA 2Z33A 2VBZA 3B73A 4KYWA 3KLOA 3DXJF 2OZUA 1WI9A 3IC7A 3EUHA 2V1XA 1Z05A 5IT3A 4OIOF 6PAXA 1AOYA 2HTSA 2XAGA 1Q1HA 4MQ9F 4G9YA 2HDCA 5LEJA 1BI2A 3JAMZ 4CZZA 3GZ6A 4ESJA 2O8XA 3DKWA 5HVQC 3EDPA 1GXPA 3EQLF 1HBXG 3O6BB 4RGSA 4HOBA 4ESFA 1B6AA 3E5UA 4BH9A 2FNAA 4WWCA 2ZMEA 4DQ2A 4A0ZA 3WE2A 4S05A 1T0FA 2ZFWA 2XAQA 3C7JA 4IVNA 3MWMA 4UVBA 2IJLA 2BYVE 1LJ9A 2EV6A 1R00A 4WXDA 3V8LA 2IT0A 1GXQA 2HFHA 1XCVA 3C3WA 5FFZA 3W6KB 2CW0F 3GFLA 1TLHB 1EH8A 2W25A 2O0YA 3MAJA 3ABUA 5E1XA 4ETSA 2H27A 4HF0A 1TQMA 2VBWA 4EGYA 1WKMA 1ZRCA 1ZG3A 5LLQA 5E8GA 5D5UB 2NNYA 3R0JA 2FQ3A 4XRFA 1IN8A 3JW4A 4DNCA 4UV9A 2G7HA 3GWZA 3HUGA 2K02A 3PQKA 4RB0A 3K1MA 4ZYDA 4A12A 1ZAOA 2MA3A 4ENMA 5JHUA 3ELKA 2FSWA 3HYIA 5E8IA 2YX4A 2A6HF 2LKPA 4A2UA 2ZJ2A 4P9FA 5D5XB 1LDKB 4L9JA 3NEUA 1MJAA 5BPIA 2HGCA 2MLGA 3RDIA 4U88A 1ZREA 3CJNA 1IN4A 4KIFA 4LLGF 4YFXF 4KICA 3F8CA 1U2WA 1FX7A 3HTSB 2GA2A 1U5TC 3CUQC 2XAJA 4EJUA 1FOKA 3GYHX 1ON2A 3IL2A 5DUIA 3HRUA 2RKHA 2MH2A 1JHHA 3WGGA 1Z1DA 2EV0A 2OA4A 2Y0MA 3LSTA 3N4MA 4MEXF 4RB1A 2HKOA 2VXZA 3QAHA 3WTWC 1PDNC 3I59B 4PZJA 2CSOA 5L3CA 2IVMA 3IWFA 3GX4X 2GA1A 1I1GA 4HQMA 1BC7C 5ILSA 3L09A 1YTYA 2PI0A 4HAMA 1JXSA 3ZPLA 5HLIA 4G6QA 4PDKA 1V3FA 4U7BA 1ZG5A 2M45A 2FA5A 4U0WA 2W24A 5HLHA 3TOAA 4KUMA 2ESNA 1L3LA 2RC4A 3M8FA 1GHCA 1P6RA 2DI3A 3WTZA 1R5HA 2PJPA 2M1BA 2P7VB 4RGRA 2P5LC 1XGOA 2K4JA 2K86A 3QOPA 3BROA 1YW7A 3ZQ7A 1R7JA 4LLNA 1IW7F 2FOKA 1Z9CA 2IA0A 1H9GA 4P9UA 1KQ8A 3GXOA 2L4MA 1UB9A 1G4DA 1Z7UA 1SFXA 4KMUX 2UZKA 2YU3A 1RIOH 3P9KA 1XSDA 4D0PA 4BHPA 4XLNF 3R4KA 1JGSA 3WGIA 4L0ZB 2IA1A 3FMSA 4UVAA 4ZYEA 2DQRA 3BJ6A 2FE3A 4G7ZF 1LVAA 4HV6A 3FM5A 2H09A 5FD5A 1ZGJA 3SZPA 1RZ4A 3ZMZA 2VOOA 4FX4A 3SFZA 2FBKA 2V1DA 1QPMA 4BNCA 4RGUA 3ZMUA 1LNWA 5TJJA 3GLXA 5JR3A 4A0YA 4L5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LGW A;  1H9T A;  3WG9 A;  5KK1 A;  1J9I A;  1I5Z A;  3ZMT A;  2Q2E A;  4I09 A;  1HKT A;  1FYM A;  2DBB A;  1XMA A;  4L9N A;  2EK5 A;  5TRD A;  1BM9 A;  1BBY A;  4HDU A;  2HZT A;  1QQI A;  1STZ A;  2JTV A;  1LEA A;  2R7F A;  3HHH A;  1IZ1 A;  1NHA A;  2VN2 A;  1O7L A;  3I4P A;  2RV8 A;  4K2E A;  4RAY A;  5AIQ A;  3RKX A;  1TNS A;  4IRH A;  3P9C A;  4HZF A;  3T0Y A;  1U6G A;  1X3U A;  2HYF A;  1YQA A;  3CUQ B;  4HBL A;  4BHB A;  1I27 A;  1XGN A;  2KIF A;  1O3Q A;  2P5V A;  5BPD A;  2QQ9 A;  3K69 A;  3AAF A;  3KLN A;  4F7Z A;  2JZY A;  2A3S A;  3CTA A;  3GEZ A;  1UHW A;  3I0T A;  2EA2 A;  1TNT A;  4M9X A;  2PEX A;  4HW0 A;  1R23 A;  2QQA A;  1U5T A;  2A6E F;  4HX8 A;  3JSP A;  4L5I A;  3LWF A;  3F8N A;  1KU9 A;  3W6J B;  1BI0 A;  1YG2 A;  5AON A;  1P4X A;  2HKX A;  5E18 F;  1OYY A;  4MNU A;  5F1R A;  4QLC U;  3TKY A;  1EV7 A;  1P4W A;  4ASN A;  1SMY F;  2FNP A;  4GYI A;  1D5V A;  3HRT A;  3GFI A;  5EEH A;  1TQI A;  2M8E A;  2UWM A;  2PFB A;  1FLI A;  3QPH A;  2FMY A;  4BAY A;  4EJW A;  4AIH A;  4ENK A;  4P5O A;  5J6X A;  2AS5 F;  2VC0 A;  2DQL A;  2H94 A;  5E1W A;  1K79 A;  4N0B A;  2DPU A;  3U1D A;  2J5P A;  5DD4 A;  2PLY A;  2F5F A;  4GXO A;  5F6F A;  5CYV A;  3V8J A;  2HQR A;  3ZMV A;  3DP7 A;  3F21 A;  4OIR F;  3E5Q A;  2E1N A;  4I0A A;  5D8L B;  2YR2 A;  3OV8 A;  2D45 A;  1L0O C;  3LQR A;  1XGS A;  3P9I A;  3WTU C;  3ROU A;  1YFH A;  1J5Y A;  2MLK A;  1W5T A;  2ZKZ A;  1VTN C;  5FLX Z;  1MJB A;  2BBY A;  4AD9 A;  1RUO A;  1MDM B;  4E70 A;  1O3T A;  2QVO A;  1FBU A;  3Q5F A;  3ZP5 A;  5JI6 A;  2GIV A;  3CDH A;  4L9V A;  2F5C A;  5FGM A;  3J80 Z;  1O3R A;  1G3T A;  5ICG A;  3E6D A;  3TGN A;  4ZH4 F;  2L02 A;  5LRS A;  1ZRD A;  3R60 A;  3DF8 A;  4U0Y A;  5DEQ A;  1XGM A;  1D8J A;  1HKQ A;  1G6N A;  2Z5U A;  1OYI A;  4IRI A;  4UUV A;  2VT3 A;  4A0X A;  1KU7 A;  1MZB A;  1U8R A;  1XN7 A;  2XRN A;  5D5W B;  4UNO A;  4QWQ A;  3HSE A;  5ILV A;  2W84 A;  2EFO A;  2RN7 A;  4WCG A;  3COA C;  3K2Z A;  3I64 A;  3RJP A;  2H6C A;  1CF7 A;  2C6Y A;  2HR3 A;  2ESH A;  1B1B A;  1S7O A;  3LA2 A;  4CDG A;  1T39 A;  3O2P E;  3PFI A;  1FZP B;  4RB2 C;  1IN6 A;  1HST A;  4FX0 A;  2KKO A;  2JSC A;  2O61 A;  4OOI A;  4NHJ A;  1P2F A;  2DLL A;  1CF7 B;  1MKM A;  1R22 A;  1C0W A;  3KP5 A;  2B0L A;  1T98 A;  3EET A;  2FML A;  1EH6 A;  2L01 A;  2XAS A;  1XMK A;  5E17 F;  1FP2 A;  1S3J A;  2FF4 A;  2MBF A;  2DPD A;  1V4R A;  1D3Y A;  1XDS A;  2NS0 A;  1BN5 A;  3BPX A;  1J75 A;  1ZHF A;  2DTR A;  2OZ6 A;  1YS7 A;  3J7A O;  1BJA A;  1A04 A;  4A5N A;  3HOT A;  1E17 A;  3F8B A;  3GF2 A;  5JVT A;  3JTG A;  3HRS A;  3J81 K;  1XB4 A;  3SXY A;  5D6E A;  4LD5 A;  2YX7 A;  5DDG A;  5H6R A;  3WTT C;  1ZRF A;  1WRJ A;  5L3E A;  3ZMD A;  3GVA A;  1E2X A;  4HLX A;  4EJO A;  3MQ0 A;  3ISP A;  5HS9 A;  1YO5 C;  1RNL A;  2HEO A;  2P6S A;  4EM0 B;  1LQ1 A;  2LSO A;  1MJ9 A;  4CIC A;  4FT8 A;  1UFM A;  4BHC A;  4M74 A;  1IXC A;  3TQN A;  1B59 A;  2EFW A;  2OBP A;  4IJA A;  2KIM A;  1R1V A;  4OMZ A;  1HQC A;  3WTS C;  4I02 A;  2BEO A;  5HS8 A;  4I98 B;  4UV8 A;  4G6D A;  4Q5S F;  3ERE D;  1IXS B;  4A6E A;  1YIO A;  3S2W A;  4G8X A;  2DK5 A;  3MCZ A;  3LA3 A;  4NQW A;  3BPV A;  2KJB A;  3HSR A;  1QNT A;  4HDV A;  2Q8K A;  1YYV A;  5FB2 A;  2ZO4 A;  1FY7 A;  3CUQ A;  4NB5 A;  5L3B A;  2D2W A;  5LGT A;  2XIG A;  3KET A;  3LAP A;  5DCF A;  1FYL A;  4OIQ F;  1Z91 A;  2HWV A;  3V4G A;  1IN7 A;  4UVC A;  3KP4 A;  2KIU A;  4XSZ F;  2XAF A;  3J81 Z;  2XRO A;  3RPU A;  1B9N A;  1R1T A;  2HS5 A;  2Z9O A;  4I0B A;  5CVJ A;  4ZZL A;  4Y13 A;  1OMI A;  1ON1 A;  3E6B A;  1YS6 A;  3Q9S A;  4EQQ A;  4RB3 C;  1KYZ A;  3C1D A;  5EEG A;  2NAZ A;  5BMZ A;  2VOP A;  1Z6T A;  5ERI A;  2EJR A;  2KRF A;  1UST A;  3F22 A;  3KCC A;  5JFR A;  3I5U A;  4O3M A;  1HSJ A;  1HW1 A;  4HA8 A;  4L0Y B;  5J8F A;  3VOD A;  5FO5 A;  1BIA A;  4U0V A;  3GUD A;  2FBH A;  4ZYH A;  3G73 A;  5IT9 K;  2A69 F;  3DV8 A;  3J80 K;  4KN4 X;  3IRR A;  3RYP A;  2A5Y B;  1B4A A;  3OOP A;  1FT9 A;  3H92 A;  3F3X A;  3TOB A;  1UCR A;  5ICC A;  3HRM A;  3KP6 A;  3SQN A;  3GW2 A;  2IRF G;  2WTE A;  4XBF A;  2WWY A;  2RVC A;  2MH9 A;  2STW A;  5DUK A;  1JE8 A;  4LJZ F;  5DCM A;  3QU6 A;  3KZZ A;  4LG0 A;  1PP8 F;  2DW4 A;  3TDU C;  2WC2 A;  2ZCW A;  2CG4 A;  3GFJ A;  3F23 A;  3L00 A;  3FMQ A;  2NYX A;  3L7W A;  4O5V A;  1QBJ A;  2XAH A;  4Y17 A;  3WTV C;  2F2E A;  3B02 A;  2XVC A;  3K1P A;  5LGU A;  2QBY B;  3I53 A;  4CYD A;  4WK8 F;  4EM1 A;  3V7S A;  5FLX K;  2E7X A;  5DD8 A;  5DCM B;  3VFZ A;  2X4H A;  2P7C B;  3TO6 A;  4GGG A;  3V8K A;  1YW9 A;  3M8E A;  1Y0U A;  5D4S A;  2ZNY A;  2VT2 A;  1SFE A;  3K1N A;  2O03 A;  4R1H A;  4KN7 X;  3ZMS A;  1I6X A;  3F8F A;  3SHF A;  4BXU A;  1UHM A;  5CVR A;  3ZN1 A;  3MEX A;  2GZW A;  5E20 A;  2E7W A;  2K27 A;  2VBX A;  2OQG A;  3BOQ A;  4KMF A;  3KP3 A;  2QLZ A;  1PP7 U;  3KP7 A;  3C18 A;  4EV0 A;  4HYE A;  4ENN A;  2GAU A;  2NRA C;  3WTX C;  1ZH5 A;  4OU0 A;  1W7P A;  2QEN A;  5K5Q A;  3FM3 A;  1FWZ A;  5BOX A;  4Q47 A;  1USS A;  1DUX C;  1KGS A;  4A5M A;  1IRF A;  5ILU A;  4Q4Z F;  2DT5 A;  4IHS A;  5H6Q A;  4CGZ A;  2ACJ A;  4N9H A;  2CYY A;  1BIB A;  1SD7 A;  3JSO A;  5L3G A;  1ZGA A;  2PBI A;  4S04 A;  2HQN A;  2JRT A;  1YW8 A;  1F5T A;  2ISY A;  2XKO A;  1K78 A;  4MGR A;  2IPQ X;  1R1U A;  3FZV A;  4LB6 B;  5LHG A;  1R58 A;  1DPU A;  3HSF A;  1XSX A;  5LEK A;  4OMY A;  5D5V B;  3R6S A;  4N9I A;  2GXB A;  3M7G A;  4B8X A;  3NQO A;  1KU2 A;  5FFX A;  2X0L A;  1KQ9 A;  2M30 A;  5A2Q K;  3WTY C;  4GO1 A;  2DK8 A;  2ZXJ A;  3CO6 C;  3F72 A;  2XGX A;  2TDX A;  4IRG A;  3ZN0 A;  1O3S A;  2ZME B;  2VON A;  4XLP F;  3LA7 A;  2Z3Y A;  4P55 A;  2LF7 A;  1MD0 A;  1F1Z A;  3RYR A;  3MZY A;  3KP2 A;  1OYW A;  1ZYR F;  4HLY A;  5HDG A;  4YII A;  4YIF A;  2IA2 A;  2D1V A;  3RKY A;  5BS6 A;  2P4W A;  1R5G A;  5HLG A;  1SFU A;  1KA8 A;  4FHT A;  2GWR A;  1SD6 A;  1U5T B;  4G7H F;  3D5L A;  4L18 B;  3Q9V A;  2RNJ A;  4ON0 A;  1JHF A;  2BGC A;  4ESB A;  5HDK A;  4M9S A;  2HOE A;  3M9A A;  2E1C A;  1ZG1 A;  3QU3 A;  1J59 A;  4WXC A;  1B9M A;  3T8R A;  2LF8 A;  1YLF A;  1IAW A;  3DPL C;  1AWC A;  2AXL A;  2XV4 S;  5D8K B;  3GO5 A;  5ICF A;  3E97 A;  2UXN A;  4KNY A;  4EMS A;  4M72 A;  1WQ2 A;  1EH7 A;  3KEQ A;  2O6G E;  1IUY A;  1LEB A;  1G3Y A;  1O57 A;  3WE3 A;  3K9T A;  2M5W A;  2IP2 A;  1QO0 D;  1REP C;  1BC8 C;  1T38 A;  3IWZ A;  2V9V A;  2NNN A;  5L3F A;  2P6T A;  2WV0 A;  2GXG A;  1TTY A;  4LLL A;  3RPQ A;  3FWE A;  4U7D A;  2EFQ A;  4LFU A;  1SMT A;  4HV5 A;  2VE9 A;  3MZH A;  3KE2 A;  2XKP A;  3VOE A;  4PGH A;  3H3Z A;  3WU0 A;  4P96 A;  2L54 A;  1KU3 A;  4ENJ A;  3T8T A;  4R8H A;  3H3U A;  2VOD A;  1DPR A;  3EYI A;  3JTH A;  2JPB A;  2G7U A;  2DU9 A;  5HDN A;  4IPA A;  2QBY A;  3L9F A;  2A61 A;  4Q48 A;  3FXQ A;  2L4A A;  2OU2 A;  4L9T A;  1FBS A;  4AVP A;  3CLO A;  3N97 A;  4MQV A;  1HKS A;  5BQT A;  2FEZ A;  3IKV A;  3R61 A;  1FSH A;  5K5R A;  1WSU A;  5IT9 Z;  3LQQ A;  2R3S A;  4WXH A;  1DDN A;  1SD5 A;  4MTD A;  3T5X A;  2VE8 A;  1FYK A;  1XSV A;  4I2O A;  4BQA A;  3U9G A;  1ZLJ A;  1PUE E;  2YSR A;  4HF1 A;  3FF5 A;  4LB5 A;  5CVI A;  1K6O A;  1W4M A;  4XSX F;  4GYG A;  2JT1 A;  3TO9 A;  2ZNZ A;  5D6F A;  3K0L A;  1J2X A;  5LHI A;  4EJV A;  1FSE A;  4I7H A;  5ICE A;  4KFC A;  4PCQ A;  4Z2Y A;  3ML6 A;  5L3D A;  3HTU A;  5CJ9 A;  4LK0 F;  2P5K A;  2QQB A;  3LAJ A;  1P4A A;  1LDJ A;  4M71 A;  2ZBK A;  4EJT A;  2V79 A;  1G3S A;  4M6X A;  3GZ5 A;  1OKR A;  2OAZ A;  4EGZ A;  1K78 B;  2ETH A;  1S7A A;  5F64 A;  4TV7 A;  5AIP A;  4AWX B;  4EM2 A;  3RKW A;  1ZN2 A;  5HOO A;  3E3V A;  2JPC A;  2Z99 A;  3E6M A;  4HX7 A;  5E1Z B;  5KVR A;  3NRV A;  5LGN A;  1RUN A;  3V7R A;  5CVV A;  4IF4 A;  1S6L A;  4AIJ A;  5J8C A;  3BJO A;  1WWX A;  4YFN F;  3KZY A;  2A07 F;  5A2Q Z;  2QWW A;  2M87 A;  2Q0O A;  5HS7 A;  2PMH A;  2CGP A;  1MGT A;  3RTR A;  2EFP A;  3CUO A;  3BWG A;  5LRR A;  3DPT A;  2RQP A;  1W7P D;  1P92 A;  2O3F A;  2J5O A;  2FU4 A;  1IRG A;  4CO8 A;  4UXN A;  2CWE A;  1U78 A;  4KIB A;  3FXR A;  3DQV C;  5LHH A;  1FNN A;  4KIG A;  4RS8 A;  2HTJ A;  3I71 A;  4HF2 A;  2P8T A;  4G94 A;  1BI1 A;  1HW2 A;  3FHZ A;  3PQJ A;  2LNB A;  2PQ8 A;  2EB7 A;  1OPC A;  4KDP A;  2QUF A;  1F9N A;  2DAO A;  3F6O A;  1CGP A;  4MEY F;  3D0S A;  5CLS A;  4B09 A;  2EFN A;  2Y75 A;  3SZT A;  3CO7 C;  3F8M A;  3EYY A;  3E5X A;  3TDZ C;  3VB2 A;  2R7D A;  3M1E A;  1BI3 A;  3QPT A;  2XHK A;  1I1S A;  2RGV A;  3BJA A;  1ODD A;  3VEP A;  1SAX A;  4HX4 A;  4UHT A;  3RIR A;  2QYO A;  2F5D A;  2EV5 A;  2OD5 A;  2F5E A;  2D1H A;  1FPQ A;  3LFK A;  4GCV A;  4A6D A;  2HYG D;  4RGX A;  3V7C A;  2OQR A;  3FMR A;  3ULQ B;  2BV6 A;  3IRQ A;  2W85 A;  4IXA A;  4IHT A;  4MTE A;  2H6B A;  4Y15 A;  1GVJ A;  3KEO A;  4OIN F;  1W5S A;  4I01 A;  1F4K A;  2QZ8 A;  1U3E M;  1FBQ A;  1LDD A;  4AIK A;  3IKT A;  1J7K A;  2RDP A;  2Y48 A;  1ONV A;  5K1Y A;  1S29 A;  3HHG A;  2EWN A;  1RI7 A;  1BOA A;  3IHU A;  1H0M A;  1KQ0 A;  3BP8 A;  4WF2 A;  3I58 A;  1OR7 A;  1FC3 A;  1ZAR A;  4KT5 C;  3MFK A;  5CVU A;  1S8N A;  2GQQ A;  3HIF A;  4M73 A;  1J0R A;  4KA4 A;  4H0E A;  4R79 A;  2DO7 A;  1R36 A;  3ECO A;  4JBA A;  2KJC A;  2YPR A;  3DFG A;  5DYM A;  5DV5 A;  4EVI A;  1XCB A;  3ABT A;  4LK1 F;  4ZYG A;  3I54 A;  3WGH A;  4JQF A;  2VC1 A;  1K7A A;  1O7F A;  3BZ6 A;  1TBX A;  1DP7 P;  3BDD A;  2PN6 A;  4YG2 F;  2COM A;  3BY6 A;  1XD7 A;  3KFW X;  2XUB A;  1ULY A;  2ELH A;  3QRF F;  2DFI A;  3P7N A;  3R0A A;  4MHG A;  3G3Z A;  1MDM A;  4PGG A;  2CFX A;  1QGP A;  2MC3 A;  1IF1 A;  2A68 F;  1HXD A;  1G3W A;  3I59 A;  4BYY A;  4O6J A;  4ZZD A;  1TW3 A;  4LG0 B;  4G7O F;  3E6C C;  4YFK F;  4HQE A;  3QP5 A;  3TO7 A;  2FBI A;  1T2K A;  3JAM K;  1ZLK A;  2W57 A;  2STT A;  1IXR C;  2L3D A;  1D8K A;  3ECH A;  3QP6 A;  2ISZ A;  1SD4 A;  5FD6 A;  4OIP F;  5D4R A;  1IN5 A;  3DEU A;  2CO5 A;  4LMY A;  2EA4 A;  3U2R A;  2CQK A;  2K7L A;  2MD5 A;  3GFM A;  2FXA A;  1TQP A;  4CHU A;  3O3K A;  2LDU A;  2FRH A;  1XDU A;  4JK1 X;  2BE5 F;  4M9Z A;  2K4B A;  1QZY A;  2V1U A;  3T1B A;  2PG4 A;  3WOD F;  4M6Y A;  4WX9 A;  1TW2 A;  1Z6R A;  2VBY A;  2PMU A;  3FX3 A;  3L2C A;  5H20 A;  2IW5 A;  4RAZ A;  3RI4 A;  3FXU A;  5LBQ A;  2ADU A;  2G9W A;  4CXF A;  1W7P B;  2V6C A;  1FP1 D;  3F6V A;  2QM3 A;  5K5O A;  1LB2 A;  1QZZ A;  1T6S A;  5ED4 A;  1KYW A;  3WU1 B;  1HW5 A;  3REO A;  2UXX A;  3HOS A;  2Z33 A;  2VBZ A;  3B73 A;  4KYW A;  3KLO A;  3DXJ F;  2OZU A;  1WI9 A;  3IC7 A;  3EUH A;  2V1X A;  1Z05 A;  5IT3 A;  4OIO F;  6PAX A;  1AOY A;  2HTS A;  2XAG A;  1Q1H A;  4MQ9 F;  4G9Y A;  2HDC A;  5LEJ A;  1BI2 A;  3JAM Z;  4CZZ A;  3GZ6 A;  4ESJ A;  2O8X A;  3DKW A;  5HVQ C;  3EDP A;  1GXP A;  3EQL F;  1HBX G;  3O6B B;  4RGS A;  4HOB A;  4ESF A;  1B6A A;  3E5U A;  4BH9 A;  2FNA A;  4WWC A;  2ZME A;  4DQ2 A;  4A0Z A;  3WE2 A;  4S05 A;  1T0F A;  2ZFW A;  2XAQ A;  3C7J A;  4IVN A;  3MWM A;  4UVB A;  2IJL A;  2BYV E;  1LJ9 A;  2EV6 A;  1R00 A;  4WXD A;  3V8L A;  2IT0 A;  1GXQ A;  2HFH A;  1XCV A;  3C3W A;  5FFZ A;  3W6K B;  2CW0 F;  3GFL A;  1TLH B;  1EH8 A;  2W25 A;  2O0Y A;  3MAJ A;  3ABU A;  5E1X A;  4ETS A;  2H27 A;  4HF0 A;  1TQM A;  2VBW A;  4EGY A;  1WKM A;  1ZRC A;  1ZG3 A;  5LLQ A;  5E8G A;  5D5U B;  2NNY A;  3R0J A;  2FQ3 A;  4XRF A;  1IN8 A;  3JW4 A;  4DNC A;  4UV9 A;  2G7H A;  3GWZ A;  3HUG A;  2K02 A;  3PQK A;  4RB0 A;  3K1M A;  4ZYD A;  4A12 A;  1ZAO A;  2MA3 A;  4ENM A;  5JHU A;  3ELK A;  2FSW A;  3HYI A;  5E8I A;  2YX4 A;  2A6H F;  2LKP A;  4A2U A;  2ZJ2 A;  4P9F A;  5D5X B;  1LDK B;  4L9J A;  3NEU A;  1MJA A;  5BPI A;  2HGC A;  2MLG A;  3RDI A;  4U88 A;  1ZRE A;  3CJN A;  1IN4 A;  4KIF A;  4LLG F;  4YFX F;  4KIC A;  3F8C A;  1U2W A;  1FX7 A;  3HTS B;  2GA2 A;  1U5T C;  3CUQ C;  2XAJ A;  4EJU A;  1FOK A;  3GYH X;  1ON2 A;  3IL2 A;  5DUI A;  3HRU A;  2RKH A;  2MH2 A;  1JHH A;  3WGG A;  1Z1D A;  2EV0 A;  2OA4 A;  2Y0M A;  3LST A;  3N4M A;  4MEX F;  4RB1 A;  2HKO A;  2VXZ A;  3QAH A;  3WTW C;  1PDN C;  3I59 B;  4PZJ A;  2CSO A;  5L3C A;  2IVM A;  3IWF A;  3GX4 X;  2GA1 A;  1I1G A;  4HQM A;  1BC7 C;  5ILS A;  3L09 A;  1YTY A;  2PI0 A;  4HAM A;  1JXS A;  3ZPL A;  5HLI A;  4G6Q A;  4PDK A;  1V3F A;  4U7B A;  1ZG5 A;  2M45 A;  2FA5 A;  4U0W A;  2W24 A;  5HLH A;  3TOA A;  4KUM A;  2ESN A;  1L3L A;  2RC4 A;  3M8F A;  1GHC A;  1P6R A;  2DI3 A;  3WTZ A;  1R5H A;  2PJP A;  2M1B A;  2P7V B;  4RGR A;  2P5L C;  1XGO A;  2K4J A;  2K86 A;  3QOP A;  3BRO A;  1YW7 A;  3ZQ7 A;  1R7J A;  4LLN A;  1IW7 F;  2FOK A;  1Z9C A;  2IA0 A;  1H9G A;  4P9U A;  1KQ8 A;  3GXO A;  2L4M A;  1UB9 A;  1G4D A;  1Z7U A;  1SFX A;  4KMU X;  2UZK A;  2YU3 A;  1RIO H;  3P9K A;  1XSD A;  4D0P A;  4BHP A;  4XLN F;  3R4K A;  1JGS A;  3WGI A;  4L0Z B;  2IA1 A;  3FMS A;  4UVA A;  4ZYE A;  2DQR A;  3BJ6 A;  2FE3 A;  4G7Z F;  1LVA A;  4HV6 A;  3FM5 A;  2H09 A;  5FD5 A;  1ZGJ A;  3SZP A;  1RZ4 A;  3ZMZ A;  2VOO A;  4FX4 A;  3SFZ A;  2FBK A;  2V1D A;  1QPM A;  4BNC A;  4RGU A;  3ZMU A;  1LNW A;  5TJJ A;  3GLX A;  5JR3 A;  4A0Y A;  4L5J A; 
#chains in the Genus database with same CATH topology
 3JCU C;  3CCS I;  4LGW A;  4W97 A;  3PJR A;  1H9T A;  3WG9 A;  5KK1 A;  1J9I A;  3BLY A;  1I5Z A;  5DM7 F;  2LKS A;  3ZMT A;  2Q2E A;  3S93 A;  2EZK A;  4I09 A;  1HKT A;  5B66 C;  2HDD A;  3OYL A;  5E3L A;  1JGG A;  1FYM A;  2R7O A;  2DBB A;  4M3E A;  1K83 J;  1XMA A;  2GOM A;  4L9N A;  1CQT A;  2EK5 A;  2K5C A;  3PFY A;  3CCM I;  5TRD A;  1YI2 I;  1BM9 A;  1BBY A;  4HDU A;  1WJB A;  1IV8 A;  2HZT A;  2IAI A;  1QQI A;  1STZ A;  1JT0 A;  2JTV A;  1LEA A;  4IHW A;  2R7F A;  3A03 A;  1IZ1 A;  3HHH A;  3SJM A;  2Q1Z B;  1OFC X;  1NHA A;  2DA7 A;  3OYD A;  2VN2 A;  4A3E J;  2HXI A;  1MMA A;  2JK3 A;  5IYD J;  1O7L A;  3I4P A;  2RV8 A;  4K2E A;  4RAY A;  5AIQ A;  3ZQL A;  2DYR H;  3RKX A;  1HDD C;  2CUE A;  1TNS A;  3NAU A;  4IRH A;  5J40 A;  4BY7 J;  2HXO A;  3P9C A;  3JRB A;  4HZF A;  3T0Y A;  1N25 A;  1U6G A;  4PUS A;  1LFU P;  1X3U A;  2HYF A;  1YQA A;  3CUQ B;  4HBL A;  4BEH B;  1VF9 A;  4BHB A;  1I27 A;  4JP0 A;  3M8J A;  3G1L A;  1XGN A;  3IV5 A;  1X1D A;  1JKQ C;  3I55 I;  5C4J J;  1AHD P;  2KIF A;  1O3Q A;  2P5V A;  1JTY A;  3AAF A;  2QQ9 A;  3K69 A;  5IYB J;  3CCE I;  3LSM A;  5BPD A;  3KLN A;  2Y30 A;  3KYC B;  4F7Z A;  2JZY A;  1QA6 A;  2A3S A;  3CTA A;  3S3O A;  3GEZ A;  1UHW A;  3I0T A;  2HI3 A;  3D5R C;  3CME I;  2EA2 A;  3KYD B;  1TNT A;  2LFB A;  4M9X A;  4PFP A;  5GAE J;  1MNM C;  2PEX A;  4BUP A;  3VSL A;  4HW0 A;  1R23 A;  2QQA A;  3CDI A;  1U5T A;  2A6E F;  2KDZ A;  2FUG 2;  4HX8 A;  3JSP A;  2B9S A;  4L5I A;  3LWF A;  3KIO A;  1TT0 A;  3F8N A;  3ABK H;  2IGN A;  1KU9 A;  3W6J B;  1BI0 A;  2VKD A;  2O9L A;  4PK4 A;  2V6E A;  1YG2 A;  2VKV A;  5AON A;  1GV5 A;  2HNH A;  3HGG A;  4A3B J;  1P4X A;  2GLO A;  2HKX A;  5E18 F;  3LSJ A;  1OYY A;  3BQY A;  4MNU A;  5F1R A;  1N78 A;  1PYV A;  2LTP A;  1JKO C;  4QLC U;  1I6H J;  3TKY A;  4HNV A;  3OSG A;  1EV7 A;  1P4W A;  5B5E C;  4CCM A;  5TGT A;  4ITV A;  4ASN A;  3LSP A;  1SMY F;  2FNP A;  3CD6 I;  4GYI A;  1D5V A;  2E5Z A;  3HRT A;  1WJF A;  2BW3 A;  5EEH A;  3GME A;  1TQI A;  2F6C A;  2X6O A;  3GFI A;  1P7J A;  2VQL A;  3VYS B;  5FJ8 J;  3S32 A;  2M8E A;  5TIS C;  2UWM A;  2PFB A;  2EIM H;  2CV1 A;  1FLI A;  3PNT A;  3QPH A;  1TWA J;  2AQF A;  2FQ4 A;  2L9N A;  3EUH C;  2FMY A;  2X48 A;  4A3I J;  4BAY A;  4EJW A;  4BDY A;  4D7N A;  3BR5 A;  4AIH A;  2HVR A;  4ENK A;  3IP4 B;  1S9H A;  4P5O A;  5GTH C;  5J6X A;  4M3D A;  3VYU B;  3NWS A;  3PM1 A;  2AS5 F;  1JUS A;  4OAY A;  5J4Y A;  1I50 J;  1FSH A;  2FOW A;  2DQL A;  2VC0 A;  3BZK A;  2R5Y A;  2H94 A;  5E1W A;  1K79 A;  2LBF B;  4N0B A;  3ASN H;  1ETY A;  4A3F J;  2DPU A;  2KMU A;  3CZ6 A;  5M3M J;  3U1D A;  4NC8 A;  5C3E J;  2K9S A;  3UKG A;  2J5P A;  3PUF A;  5DD4 A;  3RZO J;  2PLY A;  3WHB A;  4UUS B;  1A31 A;  2F5F A;  4GXO A;  2JRM A;  5F6F A;  2F48 A;  1UG2 A;  1MBH A;  2AHQ A;  5CYV A;  1D1A A;  3V8J A;  3HPG A;  5GP9 A;  2HQR A;  1WJA A;  1X19 A;  3ZMV A;  3DP7 A;  3HOZ J;  1EJ9 A;  2VIX A;  3F21 A;  4OIR F;  3H3V K;  2XPU A;  3SFI A;  3E5Q A;  2E1N A;  4I0A A;  4IHX A;  1HF0 A;  5D8L B;  3G2B A;  2YR2 A;  3OV8 A;  3CES A;  2KRC A;  2D45 A;  1WH7 A;  1OLT A;  1L0O C;  3LQR A;  1X2M A;  3DEE A;  2QA4 I;  1XGS A;  3P9I A;  2ZXH A;  4Y7N J;  3WTU C;  3G1M A;  4Y4R A;  3ROU A;  1YFH A;  2JN6 A;  1WZ2 A;  1J5Y A;  2MLK A;  1W5T A;  2ZKZ A;  1VTN C;  5FLX Z;  3H5A A;  1MJB A;  2OPT A;  1D1B A;  2BBY A;  5F04 A;  2NS7 A;  3IH4 A;  4AD9 A;  1RUO A;  1MDM B;  4E70 A;  1O3T A;  4CCO A;  2QVO A;  1FBU A;  3Q5F A;  4ZYA A;  3ZP5 A;  4CCK A;  1YJ9 I;  5JI6 A;  3HDD A;  4I6Z A;  2GIV A;  3CDH A;  3PSI A;  4L9V A;  4ZDO A;  2F5C A;  5FGM A;  1X58 A;  3J80 Z;  1O3R A;  1GT0 C;  1G3T A;  5ICG A;  3C2G A;  2I10 A;  3BG3 A;  1MMG A;  3E6D A;  3TGN A;  4ZH4 F;  1AU7 A;  2L02 A;  3A0H C;  5LRS A;  1ZRD A;  2JVG A;  2K9M A;  2DA4 A;  4BY1 J;  2VL8 A;  4EEF G;  1BA5 A;  4E7H A;  3R60 A;  3DF8 A;  4U0Y A;  3PO2 J;  5DEQ A;  1XGM A;  4XR6 A;  1N77 A;  1D8J A;  1HKQ A;  2L7Z A;  1G6N A;  3NWT A;  3G71 I;  3Q0U A;  2Z5U A;  1PUF A;  2MC4 A;  1OYI A;  1MMN A;  4IRI A;  1O4X A;  4UUV A;  2VT3 A;  3A0B C;  3HOU J;  4A0X A;  1KU7 A;  1MZB A;  1U8R A;  1XN7 A;  3K4K A;  1VQ5 I;  2XRN A;  4FCY A;  5D5W B;  4UNO A;  4QWQ A;  3HSE A;  1MH4 A;  5ILV A;  3F9K A;  2W84 A;  2L2O A;  2EFO A;  1Y0N A;  2RN7 A;  3AFH A;  1V5G A;  3MMY B;  4WCG A;  1FIP A;  3HB9 A;  1S72 I;  4XQF A;  3COA C;  3RSN A;  2PMZ N;  3K2Z A;  3ABL H;  3I64 A;  3DU5 A;  4ABZ A;  3RJP A;  2H6C A;  1CF7 A;  3CMM A;  2V7F A;  3HM5 A;  2C6Y A;  5JLW A;  2HR3 A;  2DXI A;  2ESH A;  1B1B A;  1S7O A;  1UJ8 A;  3DU6 A;  3OYG A;  3LA2 A;  3OIQ A;  4CDG A;  1VQL I;  1G8X A;  1T39 A;  3O2P E;  3A4C A;  4DYQ A;  3RKQ A;  2EZH A;  3HOY J;  5JLX A;  3PFI A;  3PNV A;  1FZP B;  2CRG A;  2JSP A;  4RB2 C;  1IN6 A;  3GTQ J;  3BR2 A;  1LFB A;  1HST A;  4FX0 A;  2KKO A;  4J01 A;  2R7U A;  1XMX A;  3BG5 A;  4FQG A;  3VPR A;  2JSC A;  2O61 A;  2HQA A;  4OOI A;  4NHJ A;  1P2F A;  4FE4 A;  3S1Q J;  4ANJ A;  2HU9 A;  1GLN A;  1X4P A;  5GAG J;  3ZRG A;  5EZH A;  5E3N A;  2LK2 A;  3OL3 A;  4XLC A;  2DLL A;  1CF7 B;  1MKM A;  1R22 A;  3CCY A;  1C0W A;  3KP5 A;  1YHQ I;  1TWC J;  2B0L A;  2IS4 A;  1Z7L A;  1T98 A;  3EET A;  4YEL A;  2FML A;  3PUB A;  1EH6 A;  2L01 A;  3E0J B;  2XAS A;  1XMK A;  3DBH B;  5E17 F;  2LY9 A;  1FP2 A;  1S3J A;  2E2J J;  2FF4 A;  3TP0 A;  4YIR X;  2HVQ A;  1EKE A;  4UUT A;  2MBF A;  5FRO A;  2DPD A;  1V4R A;  1D3Y A;  4BEH A;  2XF5 A;  1XDS A;  2E35 A;  2NS0 A;  1BN5 A;  4GRI A;  3BPX A;  1J75 A;  3DBL B;  2ZB9 A;  1ZHF A;  1YOV B;  4NNJ A;  2DTR A;  3J7A Y;  2OZ6 A;  1YS7 A;  2JA2 A;  3J7A O;  3A01 A;  1BJA A;  1IUF A;  1A04 A;  4A93 J;  3HBL A;  4A5N A;  5EEA A;  3HOT A;  2V9K A;  1E17 A;  3F8B A;  3ESW B;  1X3Z B;  3GF2 A;  3U21 A;  2MAB A;  3FXO A;  3IH3 A;  5JVT A;  3JTG A;  3TED A;  3EUK L;  3HRS A;  3J81 K;  1VQ8 I;  1MW7 A;  5GPC A;  1NK2 P;  1XB4 A;  3SXY A;  5D6E A;  2HPM A;  4LD5 A;  2YX7 A;  3OR2 C;  5DDG A;  3J7Y J;  5H6R A;  3WTT C;  1ZRF A;  3JRA A;  1WRJ A;  1X1B A;  4XLE A;  5L3E A;  3ZMD A;  3GVA A;  1E2X A;  4HLX A;  3HOX J;  4EJO A;  3MQ0 A;  3ISP A;  5HS9 A;  1YO5 C;  1RNL A;  2HEO A;  2P6S A;  4HSR A;  2ZXW H;  3E1S A;  4EM0 B;  1LQ1 A;  1IRX A;  2LSO A;  4G12 A;  1MJ9 A;  1WJE A;  5IOZ A;  1YE9 A;  4CIC A;  2XPV A;  2VPR A;  4S0H B;  4FT8 A;  1UFM A;  2BVL A;  4BHC A;  3H0D A;  4C3I J;  3FK6 A;  3K2A A;  3GCM A;  4NQW B;  3VYT B;  4M74 A;  2NS8 A;  4DW6 A;  1IXC A;  1MNE A;  3TQN A;  4AYB A;  1LE8 B;  1B59 A;  3D5S C;  3JRI A;  3MN2 A;  5C44 J;  2EFW A;  2Y0S N;  3DCF A;  2OBP A;  2XSJ C;  4IJA A;  2ZC2 A;  2KIM A;  4D5C A;  1R1V A;  4OMZ A;  4PJN A;  1VQ4 I;  1HQC A;  3CF2 A;  3DLL F;  3WTS C;  3G1O A;  4I02 A;  4BAC A;  2BEO A;  1Z0X A;  5HS8 A;  4I98 B;  4UV8 A;  2Z2S B;  4G6D A;  3QOE A;  4Q5S F;  3ERE D;  3BR1 A;  3H5R A;  1IXS B;  1NG6 A;  3UNG C;  2R7R A;  4A6E A;  1H8A C;  1YIO A;  3SEZ A;  3S2W A;  4G8X A;  2DK5 A;  3MCZ A;  3LA3 A;  3W6V A;  2NVQ J;  2R5Y B;  4NQW A;  5IP7 J;  3L2U A;  1WH5 A;  3BPV A;  2KJB A;  3X2Q H;  4MO7 A;  3A2K A;  3HOW J;  4C2T A;  4C2M J;  1FTT A;  3HSR A;  1QNT A;  1OCO H;  1WVR A;  2KT0 A;  1AKH B;  4HDV A;  2Q8K A;  3O8G A;  2O5R A;  1YYV A;  2E5N A;  5FB2 A;  4LIU A;  3L1P A;  2XGE A;  2ZO4 A;  2DDB A;  1FY7 A;  3BG9 A;  4IQJ A;  3CUQ A;  1IDY A;  4NB5 A;  4ZTF A;  1WHU A;  2DOA A;  4F91 B;  4G6T B;  5L3B A;  2X1C A;  2D2W A;  4DZJ A;  5J3L A;  3S2D J;  4CA0 A;  2M4K A;  5LGT A;  2XIG A;  3KET A;  2RAE A;  1QRY A;  3FIW A;  2JA8 J;  4C3J J;  1QPI A;  3LAP A;  5DCF A;  1WCM J;  1FYL A;  4OIQ F;  1Z91 A;  2CUJ A;  1UAA A;  2F4O B;  2HWV A;  5KCM A;  3V4G A;  4BQO A;  1IN7 A;  3L2V A;  4UVC A;  2VJJ A;  3KP4 A;  3H9Q A;  2VI6 A;  5F0C A;  1W0T A;  2KIU A;  1X1P A;  2OTL I;  4XSZ F;  2XAF A;  3J81 Z;  2XRO A;  1TWG J;  3RPU A;  1B9N A;  1R1T A;  2CU7 A;  2HS5 A;  2Z9O A;  4I0B A;  5CVJ A;  2O7O A;  3CC2 I;  4ZZL A;  1FOX A;  4Y13 A;  1OMI A;  1IV6 A;  1ON1 A;  3E6B A;  1YS6 A;  3OOU A;  3Q9S A;  4EQQ A;  2EH3 A;  2P0W A;  3JRD A;  4RB3 C;  1KYZ A;  3C1D A;  5EEG A;  4DJA A;  2NAZ A;  5BMZ A;  2VOP A;  1Z6T A;  5ERI A;  1MBK A;  2EJR A;  1U8B A;  2KRF A;  1UST A;  3F22 A;  3KCC A;  5JFR A;  3I5U A;  4O3M A;  3MKY B;  1SC7 A;  1FMW A;  1BJZ A;  3W2V A;  3HJE A;  1HSJ A;  1HW1 A;  2M4G A;  4HA8 A;  4XMY A;  5B3S H;  4L0Y B;  1GUU A;  3U1K A;  1JUM A;  5J8F A;  3VOD A;  2GOX B;  2H1L A;  5FO5 A;  1BIA A;  4U0V A;  5FKK A;  3GUD A;  2FBH A;  5KHD A;  5KAF C;  4ZYH A;  3G73 A;  5IT9 K;  2A69 F;  2ZJP F;  3DV8 A;  3QPL A;  3J80 K;  4KN4 X;  3IRR A;  4CUG A;  2IS2 A;  2IS6 A;  3RYP A;  1MMS A;  1I3A A;  2A5Y B;  3HL2 A;  1B4A A;  2L7M P;  3OOP A;  1FT9 A;  2BXZ A;  2UV1 A;  4JX6 A;  2P81 A;  3H92 A;  5F08 A;  4IL6 C;  4XOR A;  3F3X A;  4RA2 A;  3TOB A;  2JVH A;  2YUS A;  1UCR A;  5ICC A;  3QYE A;  3HRM A;  3KP6 A;  3SQN A;  3GW2 A;  2IRF G;  2ECB A;  2WTE A;  4XBF A;  2WWY A;  2AO9 A;  2RVC A;  2MH9 A;  2PJR B;  2STW A;  2R0Q C;  5DUK A;  3PL8 A;  3M4O J;  1JE8 A;  1DP3 A;  1IDZ A;  3IUO A;  4LJZ F;  2BHZ A;  5EZG A;  2DFE A;  5DCM A;  3QU6 A;  2K9N A;  3KZZ A;  4LG0 A;  3DPU A;  1PP8 F;  2LRE A;  2DW4 A;  3DTK A;  3TDU C;  2WC2 A;  2ZCW A;  4H4K C;  2LBF A;  2CG4 A;  1JJ8 C;  3GFJ A;  3F23 A;  1DU6 A;  4LOC A;  2K9Q A;  1RKT A;  3L00 A;  4II3 A;  3FBI B;  2CQ7 A;  3CCQ I;  2OTJ I;  2PX9 A;  3FMQ A;  2NYX A;  4PJL A;  4B47 A;  3L7W A;  4O5V A;  1QBJ A;  2XAH A;  1FIA A;  4Y17 A;  1MIJ A;  3LSG A;  4ZDP A;  4KIS A;  3WTV C;  2F2E A;  3B02 A;  1K4S A;  2XVC A;  2ELJ A;  3AKZ A;  4JYK A;  1ORK A;  3K1P A;  5LGU A;  3K7A J;  2QBY B;  3I53 A;  2G0E A;  3GTL J;  1ETK A;  1RET A;  3ABM H;  4CYD A;  4WK8 F;  4EM1 A;  3V7S A;  5FLX K;  2E7X A;  5DD8 A;  5DCM B;  3VFZ A;  2X4H A;  2P7C B;  3DLA A;  3G4S I;  4M3F A;  5IOY A;  1LVK A;  1A6I A;  3TO6 A;  4GGG A;  3V8K A;  1YW9 A;  3OWT A;  3M8E A;  4BXF A;  2OCC H;  1Y0U A;  1H89 C;  1XTA A;  3K4N A;  5D4S A;  3CMA I;  2ZNY A;  2VT2 A;  1SFE A;  3QQA A;  3K1N A;  2O03 A;  4R1H A;  4KN7 X;  1VZ0 A;  3ZMS A;  1I6X A;  3F8F A;  3L2Q A;  3SHF A;  4RM2 A;  4BXU A;  1UHM A;  1R49 A;  3CJT B;  5CVR A;  3ZN1 A;  4DZP A;  3MEX A;  2GZW A;  5E20 A;  2DFH A;  1QZE A;  2E7W A;  4UB8 C;  2K27 A;  2JA7 J;  2VBX A;  2OQG A;  4D7M A;  1Z77 A;  3VWB A;  3BOQ A;  2KHM A;  3KP3 A;  4KMF A;  2QLZ A;  4E7L A;  2ZME C;  1PP7 U;  3KP7 A;  3C18 A;  2EIK H;  1K6Y A;  4EV0 A;  4E7J A;  1D0Y A;  4HYE A;  4ENN A;  5JHF A;  2GAU A;  2V9P A;  3WTX C;  2NRA C;  1ZH5 A;  4OU0 A;  1W7P A;  2M2E A;  4M3B A;  3BTC A;  5K7F A;  4BXX J;  2Y9Z A;  2QEN A;  5K5Q A;  3FM3 A;  1FWZ A;  2HOA A;  2KPM A;  2CQN A;  4LIT A;  4Q47 A;  2WBM A;  5E3M A;  5BOX A;  5B1B H;  1USS A;  2LY1 A;  1DUX C;  3K4J A;  9ANT A;  1MBF A;  4N4N B;  1KGS A;  1SVL A;  4XLF A;  4A5M A;  3W2W A;  1IRF A;  5ILU A;  4Q4Z F;  2DT5 A;  1TT5 B;  3FXM A;  4KT6 A;  4IHS A;  5H6Q A;  4CGZ A;  2KZG A;  3OYM A;  1MH3 A;  3ASO H;  2ACJ A;  4FTH A;  4N9H A;  2CYY A;  5FLM J;  1T8I A;  1BIB A;  1SD7 A;  3JSO A;  1APL C;  1BOB A;  5L3G A;  1LKX A;  2BVM A;  1ZGA A;  3NAR A;  2PBI A;  4S04 A;  3V42 A;  2HQN A;  2JRT A;  1YW8 A;  2CUZ A;  1F5T A;  2ISY A;  1WI3 A;  2XKO A;  1K78 A;  1VI0 A;  4MGR A;  2IPQ X;  2DMP A;  1ENH A;  2NVX J;  1R1U A;  1ETO A;  1NTC A;  4V2G A;  3FZV A;  4LB6 B;  2XF7 A;  2L9R A;  4OWR B;  5LHG A;  1R58 A;  1DPU A;  1P7I A;  3DTE A;  4A3G J;  3HSF A;  1XSX A;  4I76 A;  4DGW B;  1XC5 A;  5LEK A;  2FX0 A;  4OMY A;  5D5V B;  3HEF A;  1GVD A;  3R6S A;  4N9I A;  4D9J A;  3M07 A;  5H2F C;  5EF6 A;  2BHY A;  3M7G A;  2GXB A;  4B8X A;  1A35 A;  3NQO A;  1KU2 A;  5FFX A;  2X0L A;  1IC8 A;  4Y52 J;  2KQR A;  1KQ9 A;  1MBJ A;  2L7F P;  2M30 A;  5A2Q K;  3WTY C;  1XG1 A;  4GO1 A;  2ZXJ A;  2DK8 A;  2XPW A;  5B1A H;  4F92 B;  3CO6 C;  3F72 A;  4X0G A;  2XGX A;  2TDX A;  4MLO A;  4IRG A;  3ZN0 A;  1O3S A;  2JA6 J;  2ZME B;  2VON A;  1FMV A;  2BY0 A;  3TW6 A;  4XLP F;  1W36 C;  3LA7 A;  5KNL A;  2Z3Y A;  4P55 A;  2LF7 A;  5F1J A;  1MD0 A;  3S1M J;  1F1Z A;  3RYR A;  3MZY A;  3KP2 A;  3W2A A;  1OYW A;  3Q3S A;  1ZYR F;  4HLY A;  5HDG A;  2B63 J;  4YII A;  4YIF A;  2IA2 A;  3PNY A;  2ZSH B;  4FE7 A;  2D1V A;  2AQE A;  5GAD J;  4E4H A;  3RKY A;  5BS6 A;  3I4M J;  1Y8R B;  2P4W A;  3K70 D;  2EIJ H;  2DT6 A;  1R5G A;  2OV7 A;  4HNT A;  4I99 C;  3PO3 J;  5HLG A;  1SFU A;  3TL4 X;  1YX3 A;  3CLQ A;  1KA8 A;  4FHT A;  2GWR A;  2KDO A;  2ME0 A;  3RCO A;  1SD6 A;  1OCP A;  4RMN A;  3MKZ A;  4L5E A;  1A6Q A;  1VND A;  2QSG X;  1U5T B;  4G7H F;  1T56 A;  1HLV A;  2WAE A;  5IYC J;  1XX5 A;  3D5L A;  3FXK A;  5DM6 F;  1MBG A;  1OCT C;  1FJL A;  3Q9V A;  4ON0 A;  2RNJ A;  2QKL B;  4L18 B;  1JHF A;  2BGC A;  4ESB A;  5HDK A;  4M9S A;  3K70 C;  3I9V 2;  3C2H A;  3FHN A;  2KFD A;  3CJQ B;  2HOE A;  2X6Y A;  5HLT A;  3M9A A;  1B72 B;  2NVY J;  3JRG A;  2E1C A;  2KRH A;  1V5E A;  4AVZ A;  3F0C A;  1ZG1 A;  2GM4 A;  1OR7 C;  4DIQ A;  2WAD A;  4HNU A;  4ZDL A;  4A3L J;  2R7S A;  3QU3 A;  1J59 A;  4WXC A;  3ZQH A;  1B9M A;  2WV1 A;  2CJJ A;  3T8R A;  2LF8 A;  1YLF A;  2JWT A;  1IAW A;  3DPL C;  2CQX A;  1AWC A;  1HC8 A;  2O8K A;  5F27 A;  2AXL A;  2DTZ A;  2XV4 S;  5D8K B;  3GO5 A;  2OJE D;  5ICF A;  1R4M B;  2K3F A;  5GTI C;  1SAU A;  2F4I A;  3CC7 I;  3OYK A;  5DTD A;  3E97 A;  2UXN A;  3SDG A;  4KNY A;  4XNF A;  4EMS A;  4M72 A;  3LSI A;  2EBI A;  1WQ2 A;  3B6A A;  3HGY A;  1EH7 A;  3KEQ A;  1MSF C;  2O6G E;  1FTZ A;  4PJ0 C;  3M1C A;  1NG7 A;  1IUY A;  3Q0W A;  1LEB A;  1G3Y A;  1O57 A;  3WE3 A;  1B8I B;  3K9T A;  5J4V A;  2M5W A;  2JMW A;  4J00 A;  2A05 A;  4JX4 A;  2IP2 A;  2X1D A;  2LY2 A;  3ZXS A;  4E7Z A;  1QO0 D;  1REP C;  1BC8 C;  1T38 A;  3IWZ A;  5EDN A;  2YS9 A;  2V9V A;  2W4S A;  3PIP F;  2FD5 A;  2M0M A;  4JX5 A;  2NNN A;  3HG9 A;  5L3F A;  2P6T A;  1VQ9 I;  2EPF A;  2WV0 A;  2GXG A;  1TTY A;  4LLL A;  3RPQ A;  3FWE A;  3LL7 A;  2EFQ A;  4U7D A;  4UUS A;  1VQM I;  4LFU A;  1TC3 C;  1SMT A;  4HV5 A;  1Y39 A;  4MFE A;  3ONQ A;  3ZQG A;  2VE9 A;  3CF5 F;  3MZH A;  1DQU A;  3CCU I;  3BZC A;  3KE2 A;  4XK4 A;  2XKP A;  1D5Y A;  3VOE A;  3OYA A;  4PGH A;  3A1Y A;  3DEW A;  3H3Z A;  4P96 A;  2L54 A;  3WU0 A;  3S3N A;  2R5Z B;  3GTJ J;  1KU3 A;  4NC7 A;  4CCJ A;  4C9Y A;  4J19 A;  4ENJ A;  4IHY A;  3T8T A;  4F52 A;  4AM3 A;  1WJ5 A;  1AKH A;  4R8H A;  2DA5 A;  2DOE A;  5GPA A;  2DJI A;  2NVT J;  3H3U A;  4ZJZ A;  2JUG A;  2VOD A;  2Y31 A;  4PSW A;  2H8W A;  3ZQI A;  1DPR A;  3EYI A;  3JTH A;  2JPB A;  2G7U A;  4NC6 A;  4BBR J;  3OS2 A;  2DU9 A;  5HDN A;  3JRE A;  3LSK A;  4IPA A;  1LPQ A;  2QBY A;  3TP3 A;  1A36 A;  1T08 B;  4B3X A;  3MKL A;  2EIL H;  2EQR A;  2R7Z J;  1FEX A;  3L9F A;  2A61 A;  4Q48 A;  1SFO J;  3FXQ A;  2HOS A;  1MND A;  3SEQ A;  2R92 J;  2L4A A;  3K4B A;  3H5N A;  1M1E B;  1SFK A;  2OU2 A;  2R93 J;  3S8P A;  4L9T A;  3VDX A;  1FBS A;  3FDY A;  4AVP A;  3CLO A;  2BZT A;  3S1R J;  3N97 A;  4MQV A;  1Z3Y A;  1HKS A;  2VQH A;  1W1W E;  2BOL A;  2FEZ A;  3IKV A;  3R61 A;  5BQT A;  5K5R A;  1WSU A;  3LQQ A;  5IT9 Z;  2R3S A;  4WXH A;  4BGD A;  1DDN A;  1SD5 A;  4V19 K;  5LFA A;  4MTD A;  3T5X A;  1ERD A;  2VE8 A;  1FYK A;  4IX7 A;  1XSV A;  4QSH A;  1ACI A;  4I2O A;  4BQA A;  1UZC A;  3U9G A;  1SAN A;  1ZLJ A;  3DKX A;  4C30 A;  1PUE E;  2YSR A;  5CKT A;  2GXA A;  4HF1 A;  1SVO A;  3FF5 A;  4LB5 A;  3HZJ A;  5CVI A;  1K6O A;  2HQ5 A;  2CV2 A;  3BC8 A;  4XLA A;  1W4M A;  4A3K J;  1UEL B;  2QSF X;  4XSX F;  4GYG A;  3MKW B;  2JT1 A;  2PMZ A;  3TO9 A;  4LG3 A;  2ZNZ A;  5D6F A;  3OYN A;  3K0L A;  1J2X A;  5LHI A;  3JRC A;  2VPL A;  4EJV A;  2Y9Y A;  2QQ8 A;  1FSE A;  4I7H A;  1BL0 A;  3UR3 C;  4BS9 A;  1TWH J;  5ICE A;  4RLQ A;  3HOV J;  4KFC A;  4PCQ A;  3VSK A;  5EG0 A;  2E2H J;  4Z2Y A;  3ZQQ A;  3ML6 A;  2WAQ A;  4BDZ A;  5L3D A;  3HTU A;  2E60 A;  2XF6 A;  2L9S A;  4LK0 F;  5CJ9 A;  2P5K A;  2QQB A;  3LAJ A;  2LKX A;  2XGC A;  3CQZ J;  1P4A A;  1LDJ A;  4E7K A;  4M71 A;  4D1Q A;  2ZBK A;  4ZTJ A;  1MBE A;  3MD2 A;  2EZI A;  4EJT A;  2V79 A;  1G3S A;  2PJR A;  2EZL A;  4M6X A;  3GZ5 A;  3PIO F;  1OKR A;  2OAZ A;  4DBR A;  3CCJ I;  1ZR2 A;  3K4M A;  1WFX A;  1ZK8 A;  2W48 A;  4EGZ A;  1K78 B;  1S7A A;  2ETH A;  3C2B A;  1QHG A;  3TW7 A;  1LFP A;  5F64 A;  1I3Q J;  4TV7 A;  3H9J A;  5AIP A;  3GLL A;  1BR2 A;  4AWX B;  2DCE A;  4EM2 A;  3RKW A;  1ZN2 A;  5DS9 A;  2VUM J;  2YU9 J;  1RR8 C;  1UMQ A;  5HOO A;  3QOD A;  3E3V A;  4IOA F;  2JPC A;  2Z99 A;  3BT9 A;  3BCB A;  3I3L A;  3E6M A;  4HX7 A;  3E7L A;  4XN0 A;  5E1Z B;  4MFD A;  5KVR A;  3NRV A;  3EPZ A;  5LGN A;  1BR1 A;  1R6R A;  3V7R A;  5CVV A;  4IF4 A;  3ZQF A;  3RPU D;  1W0U A;  1RUN A;  1S6L A;  2E1O A;  5J8C A;  4AIJ A;  3BJO A;  4B3A A;  1ZGW A;  2CH0 A;  2IBD A;  1WWX A;  3JR9 A;  1R71 A;  3KX2 A;  4YFN F;  3KZY A;  2A07 F;  5A2Q Z;  2BY2 A;  2QWW A;  2M87 A;  2Q0O A;  2LC2 A;  2PMH A;  5HS7 A;  2CGP A;  1MGT A;  2LVS A;  4PSX A;  3RTR A;  2EFP A;  2ZXI A;  2X1E A;  3CUO A;  3BWG A;  5LRR A;  2ZJQ F;  3DPT A;  5EYR A;  2RQP A;  1W7P D;  2DFF A;  4YRV A;  2FJ1 A;  3CCV I;  1P92 A;  2O3F A;  2DMT A;  2J5O A;  4F55 A;  3A01 B;  1X2N A;  2FU4 A;  2DA2 A;  1J09 A;  3CJR B;  1IRG A;  4CO8 A;  4UXN A;  2CWE A;  1U78 A;  4KIB A;  2LD5 A;  3FXR A;  3DQV C;  3HKZ N;  5LHH A;  1FNN A;  4A3D J;  4XRS G;  2CW7 A;  3OY9 A;  1OCR H;  4KIG A;  1VQ6 I;  1Y1W J;  2LLK A;  2IS1 A;  2I8D A;  4RS8 A;  2HTJ A;  3DKY A;  3I71 A;  2ME6 A;  2R7V A;  4HF2 A;  2DOD A;  3H9G A;  1S7E A;  2P8T A;  4G94 A;  3K6G A;  1YRN A;  3OSF A;  1BI1 A;  1ZTR A;  4HST A;  1HW2 A;  2CFO A;  4UY8 I;  2CMP A;  4IZZ A;  3FHZ A;  2IGO A;  4DYC A;  1F36 A;  3PQJ A;  2NXN B;  5E79 C;  2ICW G;  1DGR M;  1Z3X A;  2L5Q A;  2LNB A;  2PQ8 A;  1FOY A;  1OPC A;  2EB7 A;  2M7A A;  3AG1 H;  2DN0 A;  3TBI A;  4KDP A;  5E3O A;  2VJ4 A;  5M5Y J;  2B7E A;  2DMQ A;  2QUF A;  1F9N A;  2DAO A;  2VKE A;  1V55 H;  4XKB A;  2XSD C;  3F6O A;  1CGP A;  2NVU B;  3MVP A;  2L7K A;  5J1R A;  3OIP A;  4MEY F;  1LE8 A;  3D0S A;  5CLS A;  3RZD J;  1VQN I;  3GTG J;  3OYB A;  4B09 A;  2EFN A;  2Y75 A;  3SZT A;  4BQN A;  2F5V A;  2L9V A;  4HPQ A;  3L2R A;  3I56 I;  3BTJ A;  3CO7 C;  1E0E A;  4B43 A;  3F8M A;  1G59 A;  3EYY A;  3E5X A;  3TDZ C;  3VB2 A;  1U9O A;  1WPK A;  3H0G J;  2LR8 A;  3MZ8 A;  4A3M J;  1VFC A;  1ZKG A;  2R7D A;  3M1E A;  5CQG A;  1BI3 A;  2XB0 X;  3QPT A;  2E36 A;  2XHK A;  5IY5 H;  4B4C A;  3BG6 A;  1ITY A;  3QWL A;  1I1S A;  4QPO A;  2RGV A;  1VQ7 I;  3BJA A;  1ODD A;  3VEP A;  2JUC A;  2WB1 A;  4HX4 A;  4UHT A;  1MMD A;  3RIR A;  1SAX A;  4HEA 2;  4XKW A;  2QYO A;  2F4M B;  2F5D A;  2XGD A;  4IO9 F;  2EV5 A;  2OD5 A;  3RQI A;  2F5E A;  2D1H A;  1FPQ A;  3LFK A;  4GCV A;  4A6D A;  2HYG D;  4CYC A;  3OR1 C;  4RGX A;  3V7C A;  2OQR A;  3FMR A;  3ULQ B;  2BV6 A;  3IRQ A;  2E34 A;  2W85 A;  4IXA A;  4IHT A;  4MTE A;  2OF7 A;  2H6B A;  4QTR A;  4Y15 A;  1GVJ A;  3KEO A;  1WJC A;  1RRJ A;  2HZD A;  4OIN F;  3SYT A;  1W5S A;  3LFU A;  2HOT A;  4I01 A;  3GBG A;  1F4K A;  4A69 C;  2KZV A;  3OS1 A;  3Q0V A;  2KIQ A;  2QZ8 A;  3VYR B;  2W82 A;  4EAT A;  2XDV A;  1U3E M;  3HC7 A;  1FBQ A;  1PJR A;  5HNH A;  1YX5 A;  1LDD A;  4AIK A;  4M6V A;  3IKT A;  2V26 A;  1J7K A;  2RDP A;  2Y48 A;  3K10 A;  1ONV A;  4BJ5 C;  1S29 A;  3H36 A;  5K1Y A;  3HHG A;  3OL4 A;  2EWN A;  1VQP I;  1RI7 A;  4IHV A;  1VQK I;  2A5W A;  1G2H A;  4W1U A;  1JUP A;  1BOA A;  2IGK A;  4XRM A;  1TP4 A;  2A6T A;  3IHU A;  1H0M A;  1X1C A;  1KQ0 A;  3AG3 H;  3BP8 A;  4C2U A;  4WF2 A;  2RQQ A;  3I58 A;  1OR7 A;  1FC3 A;  4CCN A;  1ZAR A;  3S16 J;  4KT5 C;  3MFK A;  5CVU A;  4XOT A;  1S8N A;  2GQQ A;  3DTI A;  3IH2 A;  2QGU A;  2GBY A;  3TMO A;  4BQQ A;  3HIF A;  2EIN H;  3GZN B;  4M73 A;  3KYL A;  1J0R A;  4KA4 A;  4H0E A;  4R79 A;  2R7W A;  2DO7 A;  1R36 A;  4XID A;  1X4O A;  3A02 A;  1WJD A;  3ECO A;  3AG4 H;  4JBA A;  1UG0 A;  2KJC A;  2YPR A;  3DFG A;  5DYM A;  1VQO I;  5K7H A;  5DV5 A;  1IJW C;  1HCR A;  1ETX A;  1A5J A;  4EVI A;  1XCB A;  3ABT A;  4LK1 F;  3DWL E;  3I54 A;  3WGH A;  4JQF A;  4ZYG A;  1BW6 A;  2JQ7 A;  2VC1 A;  1K7A A;  1O7F A;  3BZ6 A;  2M7B A;  1TBX A;  1DP7 P;  3KZI C;  3S17 J;  4CZC A;  3BDD A;  4KIT B;  3WG7 H;  4Y3O A;  3CMY A;  2PN6 A;  4QPQ A;  4YG2 F;  2COM A;  3BY6 A;  4AC0 A;  4RAG A;  1XD7 A;  3KFW X;  1IRZ A;  2XUB A;  1ULY A;  2ELH A;  3DBR B;  3QRF F;  2DFI A;  3P7N A;  3R0A A;  2COB A;  4MHG A;  4X6A J;  3G3Z A;  3BR3 A;  5IP9 J;  2IXS A;  1MDM A;  2CS3 A;  4PGG A;  5EGO A;  2CFX A;  1QGP A;  2MC3 A;  1X1A A;  2L0K A;  1IF1 A;  2A68 F;  1HXD A;  1G3W A;  2DMN A;  1ETQ A;  3I59 A;  4BYY A;  2QKM B;  5J1Y A;  2VJ5 A;  4O6J A;  2ELK A;  2MW8 A;  1S5L C;  4ZZD A;  2W7N A;  1TW3 A;  4LG0 B;  2E1M B;  4G7O F;  3E6C C;  4YFK F;  4HQE A;  3LNQ A;  3QP5 A;  1TZL A;  3FKJ A;  1HA8 A;  1JT6 A;  1B8I A;  3TO7 A;  1TWF J;  3OIO A;  2FBI A;  1T2K A;  3JAM K;  2ZSI B;  1ZLK A;  1IO2 A;  3BQZ A;  2W57 A;  2STT A;  1IXR C;  2L3D A;  2OC6 A;  1XS9 A;  1D8K A;  3ECH A;  3OYC A;  3QP6 A;  3S3M A;  4NDL A;  2ISZ A;  1SD4 A;  4LIV A;  3GTO J;  5FD6 A;  2W1O A;  4OIP F;  5EGO B;  5D4R A;  1IN5 A;  2CV0 A;  3DEU A;  5EJC A;  2CO5 A;  1V5F A;  3J7Z I;  1OCZ H;  4RBO A;  5FLV A;  4JOM A;  3HXL A;  4LMY A;  2EA4 A;  3H35 A;  1D0Z A;  3U2R A;  1R9T J;  2CQK A;  2K7L A;  4BE2 A;  2MD5 A;  3GFM A;  1T33 A;  1U9N A;  2DOF A;  2FXA A;  1TQP A;  4FAS D;  4CHU A;  3O3K A;  2LDU A;  2FRH A;  1HDP A;  2XC7 A;  1XDU A;  3BCA A;  4FIS A;  4JK1 X;  5KAI C;  5FRN A;  3OYI A;  2HVS A;  3W3C A;  3CCL I;  2BE5 F;  4XRS A;  4GDF A;  3CDL A;  2DMU A;  2WA0 A;  2WB1 N;  4M9Z A;  3GTK J;  2K4B A;  3N05 A;  1QZY A;  3BR6 A;  2H1K A;  2V1U A;  3T1B A;  2JA5 J;  2PG4 A;  3WOD F;  3WU2 C;  4M6Y A;  4WX9 A;  4IQ4 A;  1TW2 A;  1Z6R A;  2Y2Z A;  4XN3 A;  4BJT A;  4XON A;  3CC4 I;  2VBY A;  5HNF A;  2PMU A;  3FX3 A;  4UB6 C;  3L2C A;  5H20 A;  2IW5 A;  4RAZ A;  5BNG A;  3RI4 A;  5M5X J;  3M3Y J;  3FXU A;  5LBQ A;  3IAS 2;  3OS0 A;  1LUJ B;  4YEJ A;  2ZFU A;  2ADU A;  3BR0 A;  2DJN A;  2G9W A;  4CXF A;  4AID A;  3B6C A;  4FET A;  2MYS A;  1W7P B;  2V6C A;  1FP1 D;  3F6V A;  1HOM A;  2QM3 A;  2VB6 A;  5K5O A;  1LB2 A;  1E3H A;  1QZZ A;  1T6S A;  5ED4 A;  2K9L A;  2TCT A;  3FXJ A;  1KYW A;  5FKO A;  2GIZ A;  2KIS A;  3WU1 B;  2HPI A;  1HW5 A;  2UUZ A;  2Y69 H;  2Z16 A;  3REO A;  3KPH A;  4B1R A;  2UXX A;  4XKV A;  3HOS A;  2Z33 A;  2VBZ A;  1RC9 A;  1T95 A;  4RDU A;  3D1N I;  3B73 A;  4KYW A;  3KLO A;  1GV2 A;  2OZU A;  3DXJ F;  2LH9 A;  1WI9 A;  1X3W B;  3IC7 A;  4P1W A;  2MG4 A;  3EUH A;  2V1X A;  2HDW A;  1Z05 A;  4RLF A;  5IT3 A;  4OIO F;  6PAX A;  4Z6Y A;  1AOY A;  1JTX A;  4E7S A;  2HTS A;  4DBQ A;  3RQ4 A;  4HG2 A;  4PFO A;  1YJN I;  2R7Q A;  2XAG A;  1Q1H A;  4N4O B;  2X9D A;  4G9Y A;  4MQ9 F;  1POG A;  2HDC A;  5LEJ A;  4II2 A;  2E2I J;  1BI2 A;  4NUB A;  2MGQ A;  1Y8Q B;  2VKH A;  2MD0 A;  4E7I A;  2KLO A;  1Z67 A;  2AXT C;  3JAM Z;  4BE1 A;  3L2W A;  4A3J J;  1OQY A;  5F0H A;  4CZZ A;  3GZ6 A;  1DU0 A;  4ESJ A;  1JKP C;  3K4L A;  2O8X A;  1ZQ3 P;  1QVT A;  3DKW A;  1EF4 A;  5HVQ C;  3EDP A;  2V1N A;  3QPS A;  3LOC A;  1GXP A;  2BY1 A;  3EQL F;  1W36 D;  1Y1V J;  1HBX G;  3O6B B;  3AL0 C;  4RGS A;  4HOB A;  5FKN A;  1N75 A;  1B6A A;  1FOW A;  4ESF A;  3E5U A;  1RR7 A;  4BH9 A;  2FNA A;  2DT7 B;  4WWC A;  2IGM A;  4XKC A;  2ZME A;  4DQ2 A;  1KZH A;  1UHS A;  5JVG F;  4A0Z A;  3WE2 A;  4U87 A;  3JRF A;  4S05 A;  2R7X A;  4D5F A;  5FKL A;  1T0F A;  5K7Z A;  2ZFW A;  2XAQ A;  3C7J A;  4IVN A;  3MWM A;  4UVB A;  4BKX A;  2IJL A;  2BYV E;  1LJ9 A;  2EV6 A;  3FKI J;  1R00 A;  4ZC3 A;  1K4T A;  4CH7 A;  2M0C A;  1Z21 A;  4WXD A;  3CCR I;  1YJW I;  3V8L A;  1ZR4 A;  2IT0 A;  1GXQ A;  3ZQC A;  2RNG A;  2HFH A;  1D0X A;  1XCV A;  3BTI A;  3C3W A;  5FFZ A;  3HUG B;  2M34 A;  3W6K B;  3I4N J;  2CW0 F;  3GFL A;  2WY7 Q;  1TLH B;  2OUM A;  1EH8 A;  3S14 J;  5IPA A;  5CPR B;  1SVM A;  3ZR8 X;  2W25 A;  3QYB A;  2O0Y A;  3MAJ A;  3ABU A;  5E1X A;  1QU3 A;  1EA3 A;  4ETS A;  2H27 A;  1D1C A;  4HF0 A;  1TQM A;  2VBW A;  4EGY A;  1WKM A;  3KEY A;  3OYF A;  1ZRC A;  1ZG3 A;  5LLQ A;  2VLA A;  5E8G A;  2Y0S A;  5D5U B;  2NNY A;  1JJ6 C;  3R0J A;  4AUX A;  2FQ3 A;  4XRF A;  1IN8 A;  4V2F A;  3JW4 A;  4E6K G;  1YIT I;  1BW5 A;  4XLH A;  1XPX A;  4IKF A;  4DNC A;  3OYJ A;  3CP8 A;  2WY8 Q;  2I5U A;  2VQG A;  4UV9 A;  2G7H A;  3GWZ A;  2N8G A;  3HUG A;  2K02 A;  3PQK A;  3BG7 A;  4RB0 A;  2WAF A;  3K1M A;  4ZYD A;  4A12 A;  1DGW Y;  1ZAO A;  2K40 A;  2MA3 A;  5JHU A;  4ENM A;  3ELK A;  1B72 A;  5LD2 C;  2FSW A;  3HYI A;  5E8I A;  2YX4 A;  4XIC A;  2A6H F;  2LKP A;  4A2U A;  2LRD A;  2X6W A;  2ZJ2 A;  4P9F A;  3CP2 A;  5D5X B;  1LDK B;  4L9J A;  1OIS A;  3NEU A;  1ETW A;  1MJA A;  5BPI A;  1YRN B;  2HGC A;  2MLG A;  1E3P A;  4U88 A;  3RDI A;  3CJN A;  1ZRE A;  1WGX A;  1IN4 A;  4KIF A;  4LLG F;  4YFX F;  1F43 A;  4KIC A;  4PJM A;  3F8C A;  5M3F J;  1U2W A;  4RM3 A;  4BBS J;  1FX7 A;  3HTS B;  2GA2 A;  3O8H A;  1T0F C;  1U5T C;  3CUQ C;  5C4X J;  1PVE A;  2JJ7 A;  2DA3 A;  1E3O C;  2XAJ A;  5CQE A;  4EJU A;  3GYH X;  1FOK A;  2BXY A;  1GDT A;  1ON2 A;  3IL2 A;  5DUI A;  2MFZ A;  3HRU A;  2RKH A;  2X6X A;  2MH2 A;  1JHH A;  3WGG A;  1NK3 P;  1BR4 A;  3FXL A;  1Z1D A;  4DYR A;  5GAH J;  2BW3 B;  3LSH A;  4AU7 A;  2EV0 A;  2OA4 A;  2Y0M A;  3ZOB A;  1Q1V A;  3IAM 2;  2K3P A;  3LST A;  3AG2 H;  5F0F A;  4NBQ A;  2IEK A;  2H8R A;  5FRM A;  3N4M A;  4MEX F;  1JI8 A;  2E1M C;  4RB1 A;  3ERM A;  3HPH A;  1I39 A;  2HKO A;  2VXZ A;  1PUF B;  2LYC A;  3QAH A;  2KP6 A;  3S2H J;  1U0J A;  2CUF A;  1K61 A;  2KL4 A;  3WHC A;  2M8G X;  3WTW C;  2ID3 A;  3BTL A;  3H1C A;  3QYF A;  1PDN C;  3S1N J;  3I59 B;  4PZJ A;  2XB5 A;  2CSO A;  3OYE A;  5L3C A;  1OJL A;  2IVM A;  3IWF A;  2K85 A;  4CYC B;  3GX4 X;  2GA1 A;  3HKZ A;  1ZEL A;  2R5Z A;  4BE0 A;  1I1G A;  4HQM A;  1BC7 C;  2CW8 A;  5ILS A;  3G6E I;  3L09 A;  3PSF A;  2DA1 A;  1Y6I A;  1YTY A;  2OCE A;  4HAM A;  2PI0 A;  3SDB A;  4QIW N;  1P9Q C;  1JXS A;  3ZPL A;  5HLI A;  1RES A;  2LG4 A;  4PJJ A;  2V4J C;  2DDA A;  1KON A;  4M3G A;  2QSH X;  4IEJ A;  4BJ6 C;  4G6Q A;  3S15 J;  4PDK A;  3LMM A;  5FKM A;  1V3F A;  1IG7 A;  4U7B A;  1V54 H;  1ZG5 A;  2WAQ N;  2M45 A;  2FA5 A;  4U0W A;  2LMD A;  2W24 A;  5HLH A;  3TOA A;  2D5V A;  4KUM A;  2QEX I;  2ESN A;  4F93 B;  4XOP A;  1R4N B;  4RAF A;  1L3L A;  2RC4 A;  3M8F A;  2NOG A;  1GHC A;  2R7T A;  1RKW A;  2X85 A;  5J1U A;  4CSW A;  4IOC F;  1P6R A;  1RPW A;  2DI3 A;  2ZJR F;  3WTZ A;  1R5H A;  4XL9 A;  2PJP A;  2M1B A;  2P7V B;  1QHH D;  4RGR A;  2P5L C;  1W5C C;  1XGO A;  3FBN B;  3AL0 B;  2XAU A;  3SZG A;  2K4J A;  2K86 A;  3QOP A;  3BRO A;  1YW7 A;  3ZQ7 A;  2CQQ A;  2ECC A;  2M9H A;  1R7J A;  4AYB N;  4LLN A;  1IW7 F;  4B44 A;  2FOK A;  2DYS H;  1Z9C A;  5IP6 A;  2IA0 A;  5J47 A;  4C3H J;  1H9G A;  4P9U A;  1KQ8 A;  3GXO A;  4CCL A;  3FIS A;  2VQC A;  2L4M A;  3EUA A;  1UB9 A;  1G4D A;  1Z7U A;  1SFX A;  4KMU X;  2DA6 A;  3ZGK A;  2UZK A;  2MSY A;  2YU3 A;  1YIJ I;  1R5I D;  1RIO H;  3P9K A;  3GTP J;  2VXD A;  1H88 C;  4HRI A;  1XSD A;  1Y56 A;  4D0P A;  4BHP A;  1JKR C;  4OAZ A;  4XLN F;  2BY3 A;  3FK7 A;  2LP0 A;  4DOZ A;  4MIM A;  2XRL A;  1JGS A;  2LOO A;  2Z1D A;  3R4K A;  3WGI A;  3JRH A;  2E71 A;  2E19 A;  4L0Z B;  2IA1 A;  5HOD A;  5EG0 B;  3FMS A;  4UVA A;  4ZYE A;  1ETV A;  4BU2 A;  2DQR A;  3BJ6 A;  1AA7 A;  2VAS A;  2FE3 A;  1NH3 A;  2NOJ B;  3ZCO A;  4G7Z F;  1LVA A;  4HV6 A;  3FM5 A;  1IGN A;  2H09 A;  5FD5 A;  4XM3 A;  4F3Q A;  4BL0 B;  5M5W J;  2R4G A;  4GFB A;  2QF7 A;  1ZGJ A;  2Q2E B;  3SZP A;  1RZ4 A;  1MSE C;  2X51 A;  2ID6 A;  3ZMZ A;  4X1E A;  2VOO A;  4FX4 A;  2M3A A;  2W00 A;  2TRT A;  3SFZ A;  4A3C J;  2FBK A;  2V1D A;  2VJI A;  1QPM A;  4BNC A;  3OMY A;  4Y33 A;  4RGU A;  3ZMU A;  2RRE A;  1SEU A;  1LNW A;  4B48 A;  3GTM J;  1OCC H;  3K4C A;  5TJJ A;  3GLX A;  3OYH A;  2QCO A;  5JR3 A;  4KJZ A;  3LSR A;  4A0Y A;  4L5J A;  1TL8 A;  2HYJ A;  1QVU A;  3P5J A; 
#chains in the Genus database with same CATH homology
 4LGW A;  1H9T A;  3WG9 A;  5KK1 A;  1J9I A;  1I5Z A;  3ZMT A;  2Q2E A;  4I09 A;  1HKT A;  1FYM A;  2DBB A;  1XMA A;  4L9N A;  2EK5 A;  5TRD A;  1BM9 A;  1BBY A;  4HDU A;  2HZT A;  1QQI A;  1STZ A;  2JTV A;  1LEA A;  2R7F A;  3HHH A;  1IZ1 A;  1NHA A;  2VN2 A;  1O7L A;  3I4P A;  2RV8 A;  4K2E A;  4RAY A;  5AIQ A;  3RKX A;  1TNS A;  4IRH A;  3P9C A;  4HZF A;  3T0Y A;  1U6G A;  1X3U A;  2HYF A;  1YQA A;  3CUQ B;  4HBL A;  4BHB A;  1I27 A;  1XGN A;  2KIF A;  1O3Q A;  2P5V A;  5BPD A;  2QQ9 A;  3K69 A;  3AAF A;  3KLN A;  4F7Z A;  2JZY A;  2A3S A;  3CTA A;  3GEZ A;  1UHW A;  3I0T A;  2EA2 A;  1TNT A;  4M9X A;  2PEX A;  4HW0 A;  1R23 A;  2QQA A;  1U5T A;  2A6E F;  4HX8 A;  3JSP A;  4L5I A;  3LWF A;  3F8N A;  1KU9 A;  3W6J B;  1BI0 A;  1YG2 A;  5AON A;  1P4X A;  2HKX A;  5E18 F;  1OYY A;  4MNU A;  5F1R A;  4QLC U;  3TKY A;  1EV7 A;  1P4W A;  4ASN A;  1SMY F;  2FNP A;  4GYI A;  1D5V A;  3HRT A;  3GFI A;  5EEH A;  1TQI A;  2M8E A;  2UWM A;  2PFB A;  1FLI A;  3QPH A;  2FMY A;  4BAY A;  4EJW A;  4AIH A;  4ENK A;  4P5O A;  5J6X A;  2AS5 F;  2VC0 A;  2DQL A;  2H94 A;  5E1W A;  1K79 A;  4N0B A;  2DPU A;  3U1D A;  2J5P A;  5DD4 A;  2PLY A;  2F5F A;  4GXO A;  5F6F A;  5CYV A;  3V8J A;  2HQR A;  3ZMV A;  3DP7 A;  3F21 A;  4OIR F;  3E5Q A;  2E1N A;  4I0A A;  5D8L B;  2YR2 A;  3OV8 A;  2D45 A;  1L0O C;  3LQR A;  1XGS A;  3P9I A;  3WTU C;  3ROU A;  1YFH A;  1J5Y A;  2MLK A;  1W5T A;  2ZKZ A;  1VTN C;  5FLX Z;  1MJB A;  2BBY A;  4AD9 A;  1RUO A;  1MDM B;  4E70 A;  1O3T A;  2QVO A;  1FBU A;  3Q5F A;  3ZP5 A;  5JI6 A;  2GIV A;  3CDH A;  4L9V A;  2F5C A;  5FGM A;  3J80 Z;  1O3R A;  1G3T A;  5ICG A;  3E6D A;  3TGN A;  4ZH4 F;  2L02 A;  5LRS A;  1ZRD A;  3R60 A;  3DF8 A;  4U0Y A;  5DEQ A;  1XGM A;  1D8J A;  1HKQ A;  1G6N A;  2Z5U A;  1OYI A;  4IRI A;  4UUV A;  2VT3 A;  4A0X A;  1KU7 A;  1MZB A;  1U8R A;  1XN7 A;  2XRN A;  5D5W B;  4UNO A;  4QWQ A;  3HSE A;  5ILV A;  2W84 A;  2EFO A;  2RN7 A;  4WCG A;  3COA C;  3K2Z A;  3I64 A;  3RJP A;  2H6C A;  1CF7 A;  2C6Y A;  2HR3 A;  2ESH A;  1B1B A;  1S7O A;  3LA2 A;  4CDG A;  1T39 A;  3O2P E;  3PFI A;  1FZP B;  4RB2 C;  1IN6 A;  1HST A;  4FX0 A;  2KKO A;  2JSC A;  2O61 A;  4OOI A;  4NHJ A;  1P2F A;  2DLL A;  1CF7 B;  1MKM A;  1R22 A;  1C0W A;  3KP5 A;  2B0L A;  1T98 A;  3EET A;  2FML A;  1EH6 A;  2L01 A;  2XAS A;  1XMK A;  5E17 F;  1FP2 A;  1S3J A;  2FF4 A;  2MBF A;  2DPD A;  1V4R A;  1D3Y A;  1XDS A;  2NS0 A;  1BN5 A;  3BPX A;  1J75 A;  1ZHF A;  2DTR A;  2OZ6 A;  1YS7 A;  3J7A O;  1BJA A;  1A04 A;  4A5N A;  3HOT A;  1E17 A;  3F8B A;  3GF2 A;  5JVT A;  3JTG A;  3HRS A;  3J81 K;  1XB4 A;  3SXY A;  5D6E A;  4LD5 A;  2YX7 A;  5DDG A;  5H6R A;  3WTT C;  1ZRF A;  1WRJ A;  5L3E A;  3ZMD A;  3GVA A;  1E2X A;  4HLX A;  4EJO A;  3MQ0 A;  3ISP A;  5HS9 A;  1YO5 C;  1RNL A;  2HEO A;  2P6S A;  4EM0 B;  1LQ1 A;  2LSO A;  1MJ9 A;  4CIC A;  4FT8 A;  1UFM A;  4BHC A;  4M74 A;  1IXC A;  3TQN A;  1B59 A;  2EFW A;  2OBP A;  4IJA A;  2KIM A;  1R1V A;  4OMZ A;  1HQC A;  3WTS C;  4I02 A;  2BEO A;  5HS8 A;  4I98 B;  4UV8 A;  4G6D A;  4Q5S F;  3ERE D;  1IXS B;  4A6E A;  1YIO A;  3S2W A;  4G8X A;  2DK5 A;  3MCZ A;  3LA3 A;  4NQW A;  3BPV A;  2KJB A;  3HSR A;  1QNT A;  4HDV A;  2Q8K A;  1YYV A;  5FB2 A;  2ZO4 A;  1FY7 A;  3CUQ A;  4NB5 A;  5L3B A;  2D2W A;  5LGT A;  2XIG A;  3KET A;  3LAP A;  5DCF A;  1FYL A;  4OIQ F;  1Z91 A;  2HWV A;  3V4G A;  1IN7 A;  4UVC A;  3KP4 A;  2KIU A;  4XSZ F;  2XAF A;  3J81 Z;  2XRO A;  3RPU A;  1B9N A;  1R1T A;  2HS5 A;  2Z9O A;  4I0B A;  5CVJ A;  4ZZL A;  4Y13 A;  1OMI A;  1ON1 A;  3E6B A;  1YS6 A;  3Q9S A;  4EQQ A;  4RB3 C;  1KYZ A;  3C1D A;  5EEG A;  2NAZ A;  5BMZ A;  2VOP A;  1Z6T A;  5ERI A;  2EJR A;  2KRF A;  1UST A;  3F22 A;  3KCC A;  5JFR A;  3I5U A;  4O3M A;  1HSJ A;  1HW1 A;  4HA8 A;  4L0Y B;  5J8F A;  3VOD A;  5FO5 A;  1BIA A;  4U0V A;  3GUD A;  2FBH A;  4ZYH A;  3G73 A;  5IT9 K;  2A69 F;  3DV8 A;  3J80 K;  4KN4 X;  3IRR A;  3RYP A;  2A5Y B;  1B4A A;  3OOP A;  1FT9 A;  3H92 A;  3F3X A;  3TOB A;  1UCR A;  5ICC A;  3HRM A;  3KP6 A;  3SQN A;  3GW2 A;  2IRF G;  2WTE A;  4XBF A;  2WWY A;  2RVC A;  2MH9 A;  2STW A;  5DUK A;  1JE8 A;  4LJZ F;  5DCM A;  3QU6 A;  3KZZ A;  4LG0 A;  1PP8 F;  2DW4 A;  3TDU C;  2WC2 A;  2ZCW A;  2CG4 A;  3GFJ A;  3F23 A;  3L00 A;  3FMQ A;  2NYX A;  3L7W A;  4O5V A;  1QBJ A;  2XAH A;  4Y17 A;  3WTV C;  2F2E A;  3B02 A;  2XVC A;  3K1P A;  5LGU A;  2QBY B;  3I53 A;  4CYD A;  4WK8 F;  4EM1 A;  3V7S A;  5FLX K;  2E7X A;  5DD8 A;  5DCM B;  3VFZ A;  2X4H A;  2P7C B;  3TO6 A;  4GGG A;  3V8K A;  1YW9 A;  3M8E A;  1Y0U A;  5D4S A;  2ZNY A;  2VT2 A;  1SFE A;  3K1N A;  2O03 A;  4R1H A;  4KN7 X;  3ZMS A;  1I6X A;  3F8F A;  3SHF A;  4BXU A;  1UHM A;  5CVR A;  3ZN1 A;  3MEX A;  2GZW A;  5E20 A;  2E7W A;  2K27 A;  2VBX A;  2OQG A;  3BOQ A;  4KMF A;  3KP3 A;  2QLZ A;  1PP7 U;  3KP7 A;  3C18 A;  4EV0 A;  4HYE A;  4ENN A;  2GAU A;  2NRA C;  3WTX C;  1ZH5 A;  4OU0 A;  1W7P A;  2QEN A;  5K5Q A;  3FM3 A;  1FWZ A;  5BOX A;  4Q47 A;  1USS A;  1DUX C;  1KGS A;  4A5M A;  1IRF A;  5ILU A;  4Q4Z F;  2DT5 A;  4IHS A;  5H6Q A;  4CGZ A;  2ACJ A;  4N9H A;  2CYY A;  1BIB A;  1SD7 A;  3JSO A;  5L3G A;  1ZGA A;  2PBI A;  4S04 A;  2HQN A;  2JRT A;  1YW8 A;  1F5T A;  2ISY A;  2XKO A;  1K78 A;  4MGR A;  2IPQ X;  1R1U A;  3FZV A;  4LB6 B;  5LHG A;  1R58 A;  1DPU A;  3HSF A;  1XSX A;  5LEK A;  4OMY A;  5D5V B;  3R6S A;  4N9I A;  2GXB A;  3M7G A;  4B8X A;  3NQO A;  1KU2 A;  5FFX A;  2X0L A;  1KQ9 A;  2M30 A;  5A2Q K;  3WTY C;  4GO1 A;  2DK8 A;  2ZXJ A;  3CO6 C;  3F72 A;  2XGX A;  2TDX A;  4IRG A;  3ZN0 A;  1O3S A;  2ZME B;  2VON A;  4XLP F;  3LA7 A;  2Z3Y A;  4P55 A;  2LF7 A;  1MD0 A;  1F1Z A;  3RYR A;  3MZY A;  3KP2 A;  1OYW A;  1ZYR F;  4HLY A;  5HDG A;  4YII A;  4YIF A;  2IA2 A;  2D1V A;  3RKY A;  5BS6 A;  2P4W A;  1R5G A;  5HLG A;  1SFU A;  1KA8 A;  4FHT A;  2GWR A;  1SD6 A;  1U5T B;  4G7H F;  3D5L A;  4L18 B;  3Q9V A;  2RNJ A;  4ON0 A;  1JHF A;  2BGC A;  4ESB A;  5HDK A;  4M9S A;  2HOE A;  3M9A A;  2E1C A;  1ZG1 A;  3QU3 A;  1J59 A;  4WXC A;  1B9M A;  3T8R A;  2LF8 A;  1YLF A;  1IAW A;  3DPL C;  1AWC A;  2AXL A;  2XV4 S;  5D8K B;  3GO5 A;  5ICF A;  3E97 A;  2UXN A;  4KNY A;  4EMS A;  4M72 A;  1WQ2 A;  1EH7 A;  3KEQ A;  2O6G E;  1IUY A;  1LEB A;  1G3Y A;  1O57 A;  3WE3 A;  3K9T A;  2M5W A;  2IP2 A;  1QO0 D;  1REP C;  1BC8 C;  1T38 A;  3IWZ A;  2V9V A;  2NNN A;  5L3F A;  2P6T A;  2WV0 A;  2GXG A;  1TTY A;  4LLL A;  3RPQ A;  3FWE A;  4U7D A;  2EFQ A;  4LFU A;  1SMT A;  4HV5 A;  2VE9 A;  3MZH A;  3KE2 A;  2XKP A;  3VOE A;  4PGH A;  3H3Z A;  3WU0 A;  4P96 A;  2L54 A;  1KU3 A;  4ENJ A;  3T8T A;  4R8H A;  3H3U A;  2VOD A;  1DPR A;  3EYI A;  3JTH A;  2JPB A;  2G7U A;  2DU9 A;  5HDN A;  4IPA A;  2QBY A;  3L9F A;  2A61 A;  4Q48 A;  3FXQ A;  2L4A A;  2OU2 A;  4L9T A;  1FBS A;  4AVP A;  3CLO A;  3N97 A;  4MQV A;  1HKS A;  5BQT A;  2FEZ A;  3IKV A;  3R61 A;  1FSH A;  5K5R A;  1WSU A;  5IT9 Z;  3LQQ A;  2R3S A;  4WXH A;  1DDN A;  1SD5 A;  4MTD A;  3T5X A;  2VE8 A;  1FYK A;  1XSV A;  4I2O A;  4BQA A;  3U9G A;  1ZLJ A;  1PUE E;  2YSR A;  4HF1 A;  3FF5 A;  4LB5 A;  5CVI A;  1K6O A;  1W4M A;  4XSX F;  4GYG A;  2JT1 A;  3TO9 A;  2ZNZ A;  5D6F A;  3K0L A;  1J2X A;  5LHI A;  4EJV A;  1FSE A;  4I7H A;  5ICE A;  4KFC A;  4PCQ A;  4Z2Y A;  3ML6 A;  5L3D A;  3HTU A;  5CJ9 A;  4LK0 F;  2P5K A;  2QQB A;  3LAJ A;  1P4A A;  1LDJ A;  4M71 A;  2ZBK A;  4EJT A;  2V79 A;  1G3S A;  4M6X A;  3GZ5 A;  1OKR A;  2OAZ A;  4EGZ A;  1K78 B;  2ETH A;  1S7A A;  5F64 A;  4TV7 A;  5AIP A;  4AWX B;  4EM2 A;  3RKW A;  1ZN2 A;  5HOO A;  3E3V A;  2JPC A;  2Z99 A;  3E6M A;  4HX7 A;  5E1Z B;  5KVR A;  3NRV A;  5LGN A;  1RUN A;  3V7R A;  5CVV A;  4IF4 A;  1S6L A;  4AIJ A;  5J8C A;  3BJO A;  1WWX A;  4YFN F;  3KZY A;  2A07 F;  5A2Q Z;  2QWW A;  2M87 A;  2Q0O A;  5HS7 A;  2PMH A;  2CGP A;  1MGT A;  3RTR A;  2EFP A;  3CUO A;  3BWG A;  5LRR A;  3DPT A;  2RQP A;  1W7P D;  1P92 A;  2O3F A;  2J5O A;  2FU4 A;  1IRG A;  4CO8 A;  4UXN A;  2CWE A;  1U78 A;  4KIB A;  3FXR A;  3DQV C;  5LHH A;  1FNN A;  4KIG A;  4RS8 A;  2HTJ A;  3I71 A;  4HF2 A;  2P8T A;  4G94 A;  1BI1 A;  1HW2 A;  3FHZ A;  3PQJ A;  2LNB A;  2PQ8 A;  2EB7 A;  1OPC A;  4KDP A;  2QUF A;  1F9N A;  2DAO A;  3F6O A;  1CGP A;  4MEY F;  3D0S A;  5CLS A;  4B09 A;  2EFN A;  2Y75 A;  3SZT A;  3CO7 C;  3F8M A;  3EYY A;  3E5X A;  3TDZ C;  3VB2 A;  2R7D A;  3M1E A;  1BI3 A;  3QPT A;  2XHK A;  1I1S A;  2RGV A;  3BJA A;  1ODD A;  3VEP A;  1SAX A;  4HX4 A;  4UHT A;  3RIR A;  2QYO A;  2F5D A;  2EV5 A;  2OD5 A;  2F5E A;  2D1H A;  1FPQ A;  3LFK A;  4GCV A;  4A6D A;  2HYG D;  4RGX A;  3V7C A;  2OQR A;  3FMR A;  3ULQ B;  2BV6 A;  3IRQ A;  2W85 A;  4IXA A;  4IHT A;  4MTE A;  2H6B A;  4Y15 A;  1GVJ A;  3KEO A;  4OIN F;  1W5S A;  4I01 A;  1F4K A;  2QZ8 A;  1U3E M;  1FBQ A;  1LDD A;  4AIK A;  3IKT A;  1J7K A;  2RDP A;  2Y48 A;  1ONV A;  5K1Y A;  1S29 A;  3HHG A;  2EWN A;  1RI7 A;  1BOA A;  3IHU A;  1H0M A;  1KQ0 A;  3BP8 A;  4WF2 A;  3I58 A;  1OR7 A;  1FC3 A;  1ZAR A;  4KT5 C;  3MFK A;  5CVU A;  1S8N A;  2GQQ A;  3HIF A;  4M73 A;  1J0R A;  4KA4 A;  4H0E A;  4R79 A;  2DO7 A;  1R36 A;  3ECO A;  4JBA A;  2KJC A;  2YPR A;  3DFG A;  5DYM A;  5DV5 A;  4EVI A;  1XCB A;  3ABT A;  4LK1 F;  4ZYG A;  3I54 A;  3WGH A;  4JQF A;  2VC1 A;  1K7A A;  1O7F A;  3BZ6 A;  1TBX A;  1DP7 P;  3BDD A;  2PN6 A;  4YG2 F;  2COM A;  3BY6 A;  1XD7 A;  3KFW X;  2XUB A;  1ULY A;  2ELH A;  3QRF F;  2DFI A;  3P7N A;  3R0A A;  4MHG A;  3G3Z A;  1MDM A;  4PGG A;  2CFX A;  1QGP A;  2MC3 A;  1IF1 A;  2A68 F;  1HXD A;  1G3W A;  3I59 A;  4BYY A;  4O6J A;  4ZZD A;  1TW3 A;  4LG0 B;  4G7O F;  3E6C C;  4YFK F;  4HQE A;  3QP5 A;  3TO7 A;  2FBI A;  1T2K A;  3JAM K;  1ZLK A;  2W57 A;  2STT A;  1IXR C;  2L3D A;  1D8K A;  3ECH A;  3QP6 A;  2ISZ A;  1SD4 A;  5FD6 A;  4OIP F;  5D4R A;  1IN5 A;  3DEU A;  2CO5 A;  4LMY A;  2EA4 A;  3U2R A;  2CQK A;  2K7L A;  2MD5 A;  3GFM A;  2FXA A;  1TQP A;  4CHU A;  3O3K A;  2LDU A;  2FRH A;  1XDU A;  4JK1 X;  2BE5 F;  4M9Z A;  2K4B A;  1QZY A;  2V1U A;  3T1B A;  2PG4 A;  3WOD F;  4M6Y A;  4WX9 A;  1TW2 A;  1Z6R A;  2VBY A;  2PMU A;  3FX3 A;  3L2C A;  5H20 A;  2IW5 A;  4RAZ A;  3RI4 A;  3FXU A;  5LBQ A;  2ADU A;  2G9W A;  4CXF A;  1W7P B;  2V6C A;  1FP1 D;  3F6V A;  2QM3 A;  5K5O A;  1LB2 A;  1QZZ A;  1T6S A;  5ED4 A;  1KYW A;  3WU1 B;  1HW5 A;  3REO A;  2UXX A;  3HOS A;  2Z33 A;  2VBZ A;  3B73 A;  4KYW A;  3KLO A;  3DXJ F;  2OZU A;  1WI9 A;  3IC7 A;  3EUH A;  2V1X A;  1Z05 A;  5IT3 A;  4OIO F;  6PAX A;  1AOY A;  2HTS A;  2XAG A;  1Q1H A;  4MQ9 F;  4G9Y A;  2HDC A;  5LEJ A;  1BI2 A;  3JAM Z;  4CZZ A;  3GZ6 A;  4ESJ A;  2O8X A;  3DKW A;  5HVQ C;  3EDP A;  1GXP A;  3EQL F;  1HBX G;  3O6B B;  4RGS A;  4HOB A;  4ESF A;  1B6A A;  3E5U A;  4BH9 A;  2FNA A;  4WWC A;  2ZME A;  4DQ2 A;  4A0Z A;  3WE2 A;  4S05 A;  1T0F A;  2ZFW A;  2XAQ A;  3C7J A;  4IVN A;  3MWM A;  4UVB A;  2IJL A;  2BYV E;  1LJ9 A;  2EV6 A;  1R00 A;  4WXD A;  3V8L A;  2IT0 A;  1GXQ A;  2HFH A;  1XCV A;  3C3W A;  5FFZ A;  3W6K B;  2CW0 F;  3GFL A;  1TLH B;  1EH8 A;  2W25 A;  2O0Y A;  3MAJ A;  3ABU A;  5E1X A;  4ETS A;  2H27 A;  4HF0 A;  1TQM A;  2VBW A;  4EGY A;  1WKM A;  1ZRC A;  1ZG3 A;  5LLQ A;  5E8G A;  5D5U B;  2NNY A;  3R0J A;  2FQ3 A;  4XRF A;  1IN8 A;  3JW4 A;  4DNC A;  4UV9 A;  2G7H A;  3GWZ A;  3HUG A;  2K02 A;  3PQK A;  4RB0 A;  3K1M A;  4ZYD A;  4A12 A;  1ZAO A;  2MA3 A;  4ENM A;  5JHU A;  3ELK A;  2FSW A;  3HYI A;  5E8I A;  2YX4 A;  2A6H F;  2LKP A;  4A2U A;  2ZJ2 A;  4P9F A;  5D5X B;  1LDK B;  4L9J A;  3NEU A;  1MJA A;  5BPI A;  2HGC A;  2MLG A;  3RDI A;  4U88 A;  1ZRE A;  3CJN A;  1IN4 A;  4KIF A;  4LLG F;  4YFX F;  4KIC A;  3F8C A;  1U2W A;  1FX7 A;  3HTS B;  2GA2 A;  1U5T C;  3CUQ C;  2XAJ A;  4EJU A;  1FOK A;  3GYH X;  1ON2 A;  3IL2 A;  5DUI A;  3HRU A;  2RKH A;  2MH2 A;  1JHH A;  3WGG A;  1Z1D A;  2EV0 A;  2OA4 A;  2Y0M A;  3LST A;  3N4M A;  4MEX F;  4RB1 A;  2HKO A;  2VXZ A;  3QAH A;  3WTW C;  1PDN C;  3I59 B;  4PZJ A;  2CSO A;  5L3C A;  2IVM A;  3IWF A;  3GX4 X;  2GA1 A;  1I1G A;  4HQM A;  1BC7 C;  5ILS A;  3L09 A;  1YTY A;  2PI0 A;  4HAM A;  1JXS A;  3ZPL A;  5HLI A;  4G6Q A;  4PDK A;  1V3F A;  4U7B A;  1ZG5 A;  2M45 A;  2FA5 A;  4U0W A;  2W24 A;  5HLH A;  3TOA A;  4KUM A;  2ESN A;  1L3L A;  2RC4 A;  3M8F A;  1GHC A;  1P6R A;  2DI3 A;  3WTZ A;  1R5H A;  2PJP A;  2M1B A;  2P7V B;  4RGR A;  2P5L C;  1XGO A;  2K4J A;  2K86 A;  3QOP A;  3BRO A;  1YW7 A;  3ZQ7 A;  1R7J A;  4LLN A;  1IW7 F;  2FOK A;  1Z9C A;  2IA0 A;  1H9G A;  4P9U A;  1KQ8 A;  3GXO A;  2L4M A;  1UB9 A;  1G4D A;  1Z7U A;  1SFX A;  4KMU X;  2UZK A;  2YU3 A;  1RIO H;  3P9K A;  1XSD A;  4D0P A;  4BHP A;  4XLN F;  3R4K A;  1JGS A;  3WGI A;  4L0Z B;  2IA1 A;  3FMS A;  4UVA A;  4ZYE A;  2DQR A;  3BJ6 A;  2FE3 A;  4G7Z F;  1LVA A;  4HV6 A;  3FM5 A;  2H09 A;  5FD5 A;  1ZGJ A;  3SZP A;  1RZ4 A;  3ZMZ A;  2VOO A;  4FX4 A;  3SFZ A;  2FBK A;  2V1D A;  1QPM A;  4BNC A;  4RGU A;  3ZMU A;  1LNW A;  5TJJ A;  3GLX A;  5JR3 A;  4A0Y A;  4L5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...