2DK5A

Solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
publication title Solution structure of Winged-Helix domain in RNA polymerase III 39KDa polypeptide
rcsb
source organism Homo sapiens
total genus 14
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk5A01
2DAOA 3C1DA 2L4MA 3LA7A 3KETA 1O7LA 3F3XA 3HRSA 2VE9A 4M74A 1LDJA 4ETSA 5D5UB 4UHTA 4IF4A 1TW2A 1CF7A 2XVCA 1RUOA 1ON1A 2O6GE 2GA2A 1MDMB 1BI1A 1FP1D 1J9IA 3V7SA 2A69F 5DYMA 2F5DA 3BZ6A 2QWWA 5FLXK 1L3LA 2ZNZA 4P55A 4XLNF 3CUQC 3HYIA 4EJUA 3SZTA 3E6MA 3L9FA 4ZYHA 3EDPA 5DD4A 4LG0A 1HW2A 3E5QA 4ZYEA 3HIFA 3KFWX 3F22A 4HV6A 1LEAA 5LHGA 3MZHA 3GF2A 2HEOA 4A6DA 5LBQA 2FU4A 5FB2A 3R4KA 3E5XA 5DEQA 1SAXA 1STZA 1FP2A 3D0SA 2RVCA 4A5NA 3OV8A 3HSFA 5HS8A 3QU6A 1SD4A 2D45A 1K78A 4ZZDA 2GQQA 1ZG3A 3DP7A 5L3FA 3J7AO 3CTAA 1T38A 2QZ8A 4WCGA 4Y15A 2HOEA 4MNUA 4FT8A 3NQOA 4LLLA 1XB4A 2P5KA 1VTNC 2XAJA 4HQEA 3VOEA 4DQ2A 1QZZA 1OMIA 3V8KA 1X3UA 3BJOA 2JPCA 4M71A 2IP2A 2V1DA 2HKOA 4I02A 5D8KB 3FMRA 4BHBA 1FBSA 2ZO4A 1FC3A 3WGGA 4O3MA 1OYWA 5HDKA 3T8RA 2R7DA 3I4PA 1GVJA 2G7HA 4M72A 1U5TC 1ULYA 1EH7A 5A2QK 4R1HA 1B9MA 2FNAA 2NAZA 5CJ9A 2VN2A 1S7OA 4KIBA 5D4RA 2K86A 3AAFA 1ZH5A 4RB1A 4EQQA 2EV5A 2BYVE 2M30A 2STWA 5K5OA 3N4MA 3E97A 3M7GA 1YS7A 1QPMA 2Q0OA 4GGGA 1YTYA 2OZUA 2XGXA 5DCFA 2QQBA 2OU2A 4Y13A 5HS7A 3C7JA 3KZYA 1XDSA 2BBYA 2A61A 4EJTA 1D5VA 4EJWA 2M8EA 4H0EA 2UXXA 2PFBA 3KP5A 1KU2A 3KE2A 5ICGA 4BHCA 2ZFWA 5LHIA 2PEXA 3FM3A 2GIVA 4BH9A 1LNWA 2XRNA 1LEBA 4PCQA 1O3SA 2K27A 2GWRA 1JHHA 1R7JA 4YFNF 3MZYA 2GA1A 2ESHA 1LVAA 1R23A 2B0LA 3MAJA 2RV8A 3FXRA 1SMYF 3GLXA 1REPC 2WTEA 5IT9K 3CLOA 4OIOF 4UV8A 5AIPA 2EB7A 5CVVA 2ZKZA 1FYKA 1ZG5A 4OU0A 1E2XA 2W57A 4KFCA 3ECOA 5BPIA 2A68F 1CGPA 3CUQB 3E5UA 1JHFA 3CO7C 4EGZA 2P6SA 4MQ9F 4ENNA 3O3KA 3QRFF 3ZMVA 4FX4A 2JRTA 1IN7A 1BM9A 4UNOA 4M6XA 3PQJA 2G7UA 4B09A 4HW0A 3L7WA 4RGUA 2Y0MA 5F6FA 3K0LA 3FWEA 4QWQA 1YO5C 4CDGA 2RKHA 2GZWA 3K9TA 3ZQ7A 3FM5A 5JR3A 1USTA 5HLIA 2VONA 5H6QA 4LK0F 1YW7A 5HS9A 1HW1A 1MJ9A 1KQ9A 3O2PE 4QLCU 1G3TA 4M6YA 1W7PB 4KNYA 1R22A 3E6DA 2GXGA 3BOQA 3NEUA 1IRGA 2CW0F 2OAZA 1P4WA 4XLPF 4UXNA 4RAZA 2XKOA 1DUXC 4P9UA 2TDXA 2D1VA 1QZYA 4G7HF 3GFIA 5FD6A 1KA8A 4UVAA 1ZARA 1FSHA 4N9IA 4XSXF 3QPHA 3RYPA 3GFJA 2XAQA 4L0ZB 3Q9VA 3TDUC 2XAFA 1RZ4A 3R0JA 1I5ZA 5ILSA 4GO1A 3K1PA 1LQ1A 1BIBA 1OYIA 4RB2C 5ILUA 5JHUA 1HKSA 3ROUA 1ON2A 5D8LB 1KU9A 1U5TB 5FFZA 3JW4A 3RDIA 4MTEA 5E1XA 2ELHA 1EH8A 1YIOA 3O6BB 4RB3C 3F8CA 1XGOA 3M8EA 4LLNA 3DXJF 2G9WA 1ZRCA 3DF8A 5FFXA 2VODA 4ENJA 4EGYA 1R1UA 2VBZA 3BP8A 2Y48A 1W5TA 4Z2YA 1KYWA 1E17A 3WTSC 1XDUA 3M9AA 3BROA 1XGSA 4HLYA 3DPTA 4XRFA 1SD5A 3B02A 3JSPA 1P6RA 2HYGD 4IXAA 4XBFA 1ZAOA 1FWZA 1J75A 4KYWA 3FF5A 3G73A 5E1ZB 3T0YA 2FE3A 3H92A 1QGPA 2NRAC 3EETA 2EK5A 2F2EA 4PGGA 2MLGA 2CSOA 3DPLC 5LGNA 1FPQA 3KEOA 3PFIA 1MDMA 1ZHFA 1R1TA 4M9SA 2MBFA 2JSCA 1USSA 2W25A 1FYMA 3DV8A 4ZH4F 5JI6A 1SFEA 1T98A 3CJNA 3I54A 5K5RA 4HDUA 3T5XA 2FQ3A 4KIFA 4NB5A 4WXHA 3VEPA 3KP7A 5JVTA 5K5QA 1RUNA 2MA3A 5BPDA 5AIQA 2DTRA 2OD5A 3FMSA 3LA2A 4KT5C 3I64A 4IRHA 3WTTC 2XASA 4Q47A 4EVIA 3K1NA 4TV7A 1BN5A 3QU3A 5DUKA 4IHSA 5LLQA 1FLIA 2E1NA 4Y17A 2EFNA 3RKXA 4ZYGA 5F64A 2KIMA 4MHGA 3F23A 3JTGA 3K1MA 4U88A 2HGCA 1TW3A 2OQGA 3WODF 2X0LA 2EV6A 3JSOA 4BNCA 4LFUA 3QP5A 5ERIA 2XV4S 3FHZA 1O7FA 3LFKA 3P9KA 3LAPA 1RNLA 1DPRA 1YW9A 3ABTA 4P96A 4UUVA 2VC0A 2JPBA 1TLHB 1YFHA 2MLKA 3V8LA 2VBXA 3BWGA 3CUOA 5L3CA 4HYEA 3IWFA 3BY6A 2PMUA 3FX3A 1XGMA 2NNYA 5D5XB 2DK8A 1U6GA 4Q4ZF 5L3DA 4DNCA 1A04A 5LEJA 2EA4A 1YG2A 3R61A 5E20A 5J8CA 2H27A 4N9HA 3KCCA 1S7AA 3JTHA 3V8JA 4O5VA 4U0VA 2BE5F 1B4AA 1U8RA 2IJLA 4B8XA 5DCMA 1KU3A 3WG9A 2M45A 4CO8A 2V1UA 1G3WA 3ZN0A 3R0AA 3R6SA 1ZRFA 3BPXA 1BIAA 1EH6A 4L5JA 2DLLA 5HLGA 4I0BA 2O0YA 3KP6A 1F1ZA 1IN6A 3W6KB 1IXSB 4N0BA 2HKXA 4RAYA 1RI7A 4OIPF 2VE8A 3TKYA 1XN7A 2NYXA 4HX7A 4RB0A 2QYOA 3GYHX 2KRFA 3WE3A 2MC3A 3V7RA 3QOPA 2P7VB 1ONVA 1MGTA 4HBLA 3DQVC 1F4KA 3C18A 3SQNA 3ULQB 1SFXA 1BI2A 2UZKA 1Z7UA 2EV0A 4CZZA 2Z3YA 2V6CA 1ZG1A 4MEYF 1TQMA 4S05A 1PP7U 4KDPA 5L3BA 2EA2A 1OYYA 3JAMZ 1TTYA 4WXDA 3GEZA 1LDKB 2FSWA 1ZRDA 3WTWC 3TQNA 1CF7B 5FO5A 4EJOA 4G6DA 2O61A 2PN6A 1KQ0A 1J2XA 2QUFA 1T2KA 2XAGA 1TNTA 2O8XA 3TO7A 3WTZA 4KMUX 2EWNA 3GZ6A 1WSUA 5L3GA 2PJPA 2JTVA 1V3FA 4LG0B 2ZMEA 2W85A 5HDNA 2LNBA 1F9NA 2RGVA 2AS5F 3ZMZA 3LAJA 5D6EA 3EYYA 1IN8A 1W7PA 3M8FA 1FBUA 5D4SA 2Q8KA 4S04A 5DUIA 1BBYA 3KP3A 3F21A 2HQRA 3HHGA 1O3QA 1LJ9A 2FRHA 2H94A 2VT3A 2HYFA 4HZFA 3HRTA 3CDHA 2ISZA 4BXUA 2LF7A 4CHUA 1XMAA 3ML6A 3FMQA 3C3WA 1UHWA 2A6HF 3SZPA 5HOOA 1HKQA 2EFWA 1J0RA 3M1EA 1R58A 5ICCA 1FBQA 2COMA 2ZNYA 3TO6A 2EFOA 3L00A 1YLFA 5BS6A 2KJBA 5LRSA 1U5TA 2KIFA 3T1BA 4CICA 4M73A 4WF2A 4EJVA 3ZMUA 1D3YA 3RKWA 4LLGF 4YFXF 1QQIA 3MFKA 2M87A 2MH2A 1P4XA 4YIFA 2QBYA 2BGCA 2FEZA 4D0PA 2QQAA 2ACJA 4G7ZF 1BC8C 1SFUA 3RKYA 2YX4A 4HV5A 4L9NA 1I1SA 1HSTA 3FXUA 1F5TA 4KA4A 4HQMA 3U1DA 4U7DA 3L09A 5F1RA 4M9XA 3WTYC 1OR7A 2PG4A 5LGTA 3F6VA 1DDNA 5EEHA 1Y0UA 4RGRA 4HF1A 2K02A 2ZCWA 2DI3A 2CG4A 2IA0A 4F7ZA 4HDVA 1MZBA 1GHCA 3MEXA 3E6CC 5DDGA 5TJJA 2LKPA 2L3DA 1XGNA 1BI0A 4A2UA 3N97A 4LJZF 2FF4A 3Q5FA 2WV0A 2DO7A 5DV5A 2L4AA 4EM0B 2XIGA 2IT0A 2HDCA 1KYZA 3U9GA 4PGHA 5E8IA 4R79A 4U7BA 2C6YA 3RIRA 1AWCA 1YS6A 1UFMA 3DFGA 4YFKF 5BMZA 2NNNA 4XSZF 3GX4X 2CYYA 3HTSB 1B59A 2ESNA 2KKOA 4YG2F 5CVJA 4LK1F 2OQRA 1IUYA 2RDPA 3V7CA 4P9FA 3HUGA 3H3ZA 3HSEA 1XCBA 3ECHA 2BEOA 2A07F 1FYLA 4G8XA 4HAMA 1J7KA 2D1HA 5FGMA 1U2WA 1XSXA 3JAMK 3FZVA 1IN5A 1SMTA 2VXZA 1HXDA 2BV6A 4EV0A 3IKTA 1FNNA 2CQKA 5D5WB 1QNTA 2R7FA 4M9ZA 2F5FA 3W6JB 2LSOA 4BHPA 2P7CB 2ETHA 1Z6RA 5KK1A 2KJCA 2J5OA 1TNSA 4AVPA 1W7PD 2XUBA 4G9YA 2FA5A 1XMKA 3TGNA 3F8FA 4L9TA 2Z99A 1PDNC 3SXYA 5J8FA 3RTRA 5CVUA 5A2QZ 3GFMA 4R8HA 2WWYA 1K79A 4KICA 4IJAA 1T6SA 4AIHA 2DFIA 4GYGA 2D2WA 1IRFA 2DU9A 2P4WA 2ZJ2A 3I58A 3EUHA 2XKPA 1TBXA 4LGWA 4ZYDA 4HOBA 2RC4A 3P9IA 3J81Z 3IWZA 4IRGA 1U78A 3KEQA 1JE8A 1YYVA 5CYVA 5K1YA 3DKWA 2M1BA 5IT3A 2A5YB 1MKMA 2XHKA 1PUEE 2V1XA 5D6FA 3WU0A 2XAHA 4CXFA 1SD6A 2JZYA 5E1WA 2FBKA 3T8TA 5J6XA 3WTUC 3SHFA 2W24A 3V4GA 1WRJA 1G4DA 2HZTA 5E18F 1YQAA 1R1VA 4IVNA 4NHJA 3ELKA 4PZJA 2YSRA 2GXBA 1IF1A 4CGZA 4IPAA 1HW5A 1WI9A 4AD9A 3HRMA 3GXOA 3VB2A 3HHHA 4Q48A 3I71A 2J5PA 5DD8A 3P7NA 5LHHA 2ZXJA 5JFRA 3I59B 1Z6TA 3WGHA 2A3SA 1D8KA 2X4HA 3TOBA 1S29A 2WC2A 5H20A 3ZMTA 4U0YA 5FD5A 4GCVA 6PAXA 1ZLKA 1SD7A 5AONA 4EM2A 2QVOA 4O6JA 3IRQA 4KIGA 4KUMA 3HSRA 4MGRA 1HQCA 2L02A 3GW2A 3LSTA 3ZN1A 2IW5A 2RNJA 5BQTA 2YR2A 3MCZA 1S6LA 1T0FA 4EM1A 2YPRA 2Z33A 2W84A 2JT1A 3B73A 3GZ5A 2HTJA 3WE2A 5CVIA 1S3JA 1B9NA 4L9VA 4BAYA 2IA1A 1S8NA 1FOKA 4L5IA 4FHTA 3H3UA 4WWCA 4HA8A 4WK8F 3WTVC 4RGXA 1J5YA 1P2FA 4ZZLA 4BQAA 4L0YB 1HKTA 3G3ZA 4ENMA 1ZYRF 4Q5SF 1TQIA 2HTSA 2DK5A 1FT9A 1QO0D 2DQLA 3NRVA 2P6TA 3F8NA 1AOYA 2FBIA 3U2RA 3GVAA 1QBJA 4A0ZA 1KGSA 2H09A 4ASNA 4K2EA 1ZGJA 1B6AA 1WQ2A 2P5VA 4KN7X 1EV7A 1MD0A 2FXAA 3E6BA 1KU7A 4AWXB 2O03A 2VOPA 3DEUA 2RQPA 4HF2A 4RS8A 1MJAA 1I6XA 4HX4A 2FMYA 1XSVA 3CUQA 2E1CA 2HQNA 4JK1X 2DW4A 4I2OA 2OZ6A 1MJBA 1ZREA 3KLNA 4A6EA 2QQ9A 4LB5A 3LQQA 2Z5UA 4G94A 2PLYA 4E70A 3ZPLA 5LRRA 3TO9A 4ESBA 1ZN2A 3QAHA 4CYDA 3P9CA 2Y75A 4OIRF 4A0XA 4FX0A 5LEKA 3LQRA 3BPVA 1HSJA 2V79A 5DCMB 2PI0A 3RPUA 4P5OA 1B1BA 5D5VB 2R3SA 3WU1B 1H9TA 1TQPA 2CFXA 1Q1HA 1U3EM 5TRDA 3ZP5A 1K7AA 5KVRA 1PP8F 1G6NA 1Z05A 1DPUA 3F72A 5E8GA 3BJAA 1I27A 2MD5A 3J81K 2P5LC 1FY7A 2VC1A 4MEXF 2CWEA 3PQKA 1GXQA 3HRUA 4WXCA 1K78B 2ISYA 3QP6A 2GAUA 5HLHA 3HTUA 1H9GA 3FXQA 3GWZA 2DPUA 3CO6C 4HLXA 1ZGAA 4A0YA 5HVQC 2NS0A 2FOKA 4OMZA 5L3EA 5E17F 1FX7A 3F8MA 3J80Z 3MQ0A 4OMYA 3K2ZA 1UHMA 1RIOH 1IXRC 1O57A 3ZMDA 2V9VA 3WGIA 4MQVA 3RPQA 4ENKA 4OOIA 3L2CA 4YIIA 3WTXC 5HDGA 1I1GA 2UWMA 3TDZC 3EQLF 5H6RA 5ICEA 2F5CA 2VT2A 5EEGA 4A5MA 1Z9CA 4I98B 1K6OA 2HFHA 3BJ6A 1O3TA 4JQFA 4AIJA 3IRRA 1V4RA 3IKVA 1OKRA 3BDDA 2Q2EA 4I09A 2ZMEB 2AXLA 2RN7A 3E3VA 1IZ1A 1WKMA 2ZBKA 3ABUA 2HWVA 1Z91A 1ODDA 4LD5A 3S2WA 2CO5A 4ESJA 2K4JA 5FLXZ 4MTDA 1BI3A 2YU3A 1IN4A 1R5GA 2E7XA 4PDKA 1LB2A 2YX7A 4I01A 3LA3A 2PMHA 3F6OA 1IW7F 2EFPA 4KN4X 1DP7P 2PQ8A 4UVCA 4IRIA 1GXPA 3I5UA 3OOPA 5ILVA 1HBXG 2KIUA 4NQWA 2H6BA 2CGPA 1KQ8A 1Z1DA 2K4BA 3RYRA 2IPQX 2P8TA 1H0MA 3HOTA 3IC7A 1G3SA 3KZZA 2EJRA 1C0WA 2ADUA 5ED4A 3RJPA 4UVBA 1L0OC 3KLOA 1JGSA 2IVMA 1G3YA 1BOAA 1IAWA 2VBYA 3KP2A 4AIKA 3ERED 2Z9OA 4HX8A 2F5EA 3D5LA 3SFZA 4A12A 3IHUA 3RI4A 4OIQF 4KMFA 2QBYB 2STTA 4U0WA 2DBBA 1WWXA 1IXCA 4G6QA 2VBWA 1OPCA 2EFQA 3TOAA 4L18B 3COAC 2K7LA 2OBPA 1W4MA 3ISPA 3I59A 4OINF 3KP4A 1BC7C 5CLSA 4ESFA 2DT5A 4I7HA 3EYIA 2FMLA 1J59A 2L54A 4UV9A 2DPDA 3HOSA 3GFLA 2QM3A 2O3FA 1R36A 1UCRA 3F8BA 5BOXA 2FBHA 2FNPA 4RGSA 4LMYA 1P92A 2UXNA 3IL2A 3Q9SA 4HF0A 2H6CA 3ZMSA 1R5HA 4WX9A 4I0AA 2L01A 1FSEA 2HR3A 2LF8A 1XD7A 1LDDA 4ON0A 1BJAA 3I53A 4G7OF 3QPTA 3R60A 4L9JA 2IRFG 1D8JA 3VODA 3K69A 5CVRA 2VOOA 1O3RA 3J80K 2IA2A 2OA4A 4EMSA 1R00A 2HS5A 1XSDA 5LGUA 4BYYA 4JBAA 1P4AA 2PBIA 1YW8A 2LDUA 1XCVA 3GO5A 2XROA 2M5WA 3I0TA 5IT9Z 1JXSA 2MH9A 2QENA 3LWFA 1NHAA 5ICFA 4IHTA 1ZLJA 2QLZA 3MWMA 1UB9A 4GYIA 1T39A 2E7WA 3GUDA 4LB6B 2DQRA 1FZPB 3VFZA 2A6EF 4GXOA 1W5SA 3REOA
chains in the Genus database with same CATH superfamily
3H9GA 1IDZA 2DAOA 3C1DA 2L4MA 2CV1A 3LA7A 4F92B 3KETA 1AA7A 1O7LA 3F3XA 3HRSA 2VE9A 1HC8A 4F55A 3CJRB 4M74A 1LDJA 4ETSA 4IO9F 2HI3A 5D5UB 3V42A 2LOOA 4UHTA 3MN2A 3U1KA 4IF4A 2F48A 1TW2A 3GLLA 1CF7A 2XVCA 2K9NA 1RUOA 1ON1A 2O6GE 2GA2A 3BR1A 1MDMB 2BHYA 5F08A 4BE2A 4XNFA 5IYDJ 1BI1A 1FP1D 1J9IA 2MYSA 2DA6A 3V7SA 2A69F 5DYMA 2AO9A 1QVTA 2F5DA 3BZ6A 2QWWA 3BLYA 5IPAA 5FLXK 1MMAA 1WPKA 1L3LA 2ZNZA 2XF7A 4A3KJ 4P55A 4F3QA 4XLNF 3CUQC 3BR3A 3HYIA 1QU3A 2JMWA 1JJ8C 4F93B 5FKMA 2OJED 1MW7A 4EJUA 1Z77A 3MKZA 3CJQB 4MIMA 3SZTA 3E6MA 3L9FA 4HRIA 4EEFG 3JRCA 1VQ9I 4ZYHA 3EDPA 5DD4A 5LD2C 4LG0A 4ZDLA 1X58A 1HW2A 3E5QA 4IHVA 4ZYEA 3HIFA 2R7UA 3KFWX 2LBFB 3F22A 4IZZA 4HV6A 4BXXJ 3I4NJ 3A1YA 1DU0A 1LEAA 3H5RA 5LHGA 3TP3A 4DGWB 3MZHA 2A6TA 3GF2A 1W0TA 2HEOA 4A6DA 2H1LA 5LBQA 3H1CA 4HSTA 2FU4A 3S3NA 5FB2A 3R4KA 3E5XA 5DEQA 3CCQI 4NDLA 1PJRA 3TW6A 3S2HJ 2ZMEC 3B6AA 3O8GA 2GIZA 4RBOA 1SAXA 2L7KA 3OYCA 1GV5A 1STZA 1FP2A 2O5RA 2CFOA 3D0SA 2RVCA 4A5NA 3OV8A 3HSFA 2DODA 5HS8A 2F4MB 3QU6A 3DTKA 1SD4A 2D45A 1K78A 4UUSB 3E0JB 2I10A 4ZZDA 3K70C 2GQQA 3TMOA 1ZG3A 3K4KA 3DP7A 5L3FA 3J7AO 3CTAA 1T38A 1G59A 2QZ8A 2X6XA 2CV0A 4WCGA 4D7MA 4Y15A 4P1WA 3RKQA 2HOEA 3CF5F 4MNUA 3LOCA 4FT8A 3NQOA 4LLLA 1XB4A 2P5KA 1VTNC 2JJ7A 3GZNB 4JX6A 2XAJA 4HQEA 2LRDA 3ZQGA 3VOEA 4DQ2A 1MSEC 3LSGA 1QZZA 5J1RA 1OMIA 2EZKA 3V8KA 2R4GA 1LVKA 4LIVA 2K3PA 1Y1WJ 5GADJ 1X3UA 3BJOA 2JPCA 4M71A 2IP2A 1NG7A 2KP6A 3BTIA 1A6QA 5E3OA 2V1DA 2HKOA 4I02A 2VKEA 5D8KB 4QSHA 3FMRA 2PJRA 4XLEA 4BHBA 1FBSA 2ZO4A 1FC3A 3WGGA 5B3SH 4O3MA 4DJAA 1APLC 1OYWA 2VKVA 3LSKA 5HDKA 1TP4A 3T8RA 1V5GA 1OCTC 2R7DA 3I4PA 2DYRH 3MD2A 1X3WB 1GVJA 2G7HA 1T08B 4M72A 3QOEA 1U5TC 1ULYA 4BU2A 1EH7A 1I50J 3LSHA 3HPGA 3BZKA 2DFHA 5A2QK 4R1HA 1B9MA 2FNAA 2DA7A 2NAZA 2VN2A 5CJ9A 3CCVI 1S7OA 4KIBA 1FIAA 5D4RA 2K86A 3AAFA 1ZH5A 2OCEA 2HPMA 4RB1A 1ZK8A 4EQQA 4Z6YA 2EV5A 2QCOA 3AL0B 2M0MA 3UR3C 3HJEA 2BYVE 2M30A 3H0GJ 2STWA 1MBKA 1XG1A 5K5OA 2R7XA 3NAUA 1TT5B 3HOXJ 3N4MA 3S16J 2VJ5A 3E97A 3ASNH 4FTHA 3M7GA 1YS7A 2Z1DA 1QPMA 1FOWA 2Q0OA 4GGGA 4BY1J 1MBGA 1YTYA 1Z67A 3A2KA 3D1NI 2OZUA 2XGXA 5DCFA 2QQBA 4V2FA 2OU2A 4Y13A 5HS7A 3PIPF 2DA1A 3C7JA 3KZYA 1XDSA 2BBYA 3M07A 2A61A 4EJTA 1D5VA 2VIXA 3CC7I 3CESA 5J4YA 2V6EA 3OSFA 1OR7C 2M8EA 4EJWA 4CSWA 4H0EA 2E71A 2UXXA 2PFBA 3KP5A 1KU2A 3KE2A 3HPHA 5ICGA 4C2UA 2CW7A 3OL4A 3CMYA 4BHCA 2ZFWA 5LHIA 4BBSJ 2PEXA 3FM3A 2GIVA 5FKOA 4BH9A 3PSIA 1H88C 3D5SC 2EINH 1JTYA 2CQXA 3H9JA 1LNWA 2XRNA 1LEBA 1B72B 4PCQA 1O3SA 1WJFA 2K27A 2GWRA 1S5LC 3CMMA 1JHHA 1TC3C 1R7JA 3OYDA 4YFNF 3DTEA 2Y9YA 3MZYA 4ZTFA 2DMUA 2GA1A 1IDYA 3OR2C 2ESHA 1LVAA 1R23A 1ETXA 1OLTA 2B0LA 2KISA 3MAJA 2RV8A 3OY9A 3FXRA 1ERDA 1X4OA 1W1WE 4MFEA 2Y9ZA 1BOBA 3LMMA 1SMYF 3GLXA 4XLAA 1REPC 2WTEA 5IT9K 2K85A 2XF6A 3CLOA 1E3OC 1YX5A 4OIOF 4UV8A 5AIPA 4AVZA 2EB7A 5CVVA 3BT9A 4QPQA 2DMPA 2ZKZA 4XR6A 1FYKA 3KIOA 1ZG5A 4OU0A 1E2XA 2W57A 4KFCA 2YS9A 3ECOA 5BPIA 2A68F 1P7IA 4MO7A 5TISC 3CUQB 1CGPA 3E5UA 1JHFA 3CO7C 3DKYA 4RAGA 2EIJH 1D0YA 3M8JA 4EGZA 2P6SA 2DA3A 2HQ5A 3AG3H 2E2JJ 2LMDA 4MQ9F 4CZCA 4ENNA 1ZQ3P 4X6AJ 3O3KA 3QRFF 1UELB 3HDDA 3ZMVA 3OMYA 4FX4A 1QPIA 1MBHA 3KYLA 2JRTA 1IN7A 1BM9A 4UNOA 4M6XA 3PQJA 2G7UA 1OQYA 1PUFA 1RKTA 4XOPA 3ZQQA 4B09A 4HW0A 3L7WA 1BR1A 4RGUA 2R7SA 2Y0MA 3BG5A 5C4XJ 5F6FA 1IV8A 4I6ZA 1ETQA 3K0LA 3FWEA 4QWQA 2WAQN 1QA6A 1YO5C 4CDGA 4J19A 2RKHA 2GZWA 3K9TA 3ZQ7A 3FM5A 5JR3A 5FROA 1USTA 3S1MJ 3UKGA 4C3HJ 5HLIA 2VONA 2KIQA 2MW8A 5H6QA 4LK0F 2OV7A 1Y0NA 1YW7A 5HS9A 1XTAA 1HW1A 1MJ9A 1RR8C 1KQ9A 3O2PE 4W97A 4QLCU 1G3TA 4M6YA 1W7PB 4YELA 3HG9A 4KNYA 1R22A 2CJJA 3E6DA 2GXGA 3BOQA 3H9QA 3NEUA 3OYLA 3G4SI 1IRGA 2XGDA 5F27A 4A3IJ 4CYCB 2CW0F 1UZCA 1HDDC 2OAZA 1P4WA 4XLPF 4UXNA 2LR8A 4RAZA 4A3JJ 2XKOA 1R49A 4P9UA 1DUXC 2NOGA 4JOMA 3TEDA 2TDXA 3GTJJ 2HQAA 4A3BJ 3L1PA 2IXSA 2D1VA 1QZYA 4XM3A 4G7HF 3GFIA 1FOYA 5FD6A 1JKPC 1KA8A 3DEEA 3O8HA 5F0HA 4V2GA 4DYQA 4UVAA 1ZARA 4A3DJ 1FSHA 2DMQA 4N9IA 5EG0B 4XSXF 3FISA 5F0CA 2E1MC 3QPHA 5GP9A 3QPLA 3RYPA 3GFJA 3SDBA 4BACA 3DBHB 3RSNA 2XAQA 4XK4A 4L0ZB 3Q9VA 3TDUC 1A6IA 4OAYA 2XAFA 1RZ4A 1SFKA 3R0JA 1I5ZA 4F91B 4DBQA 5ILSA 1K61A 1X19A 4GO1A 3FDYA 2VJ4A 3K1PA 1TT0A 1LQ1A 1BIBA 1K4SA 1OYIA 2UUZA 4RB2C 5ILUA 1X4PA 5JHUA 1T33A 3IAM2 3OL3A 2VKDA 3S93A 9ANTA 4XRSG 1HKSA 4NNJA 3K4CA 3MVPA 3EUHC 3ROUA 2GBYA 2GM4A 1ON2A 4B44A 5D8LB 1KU9A 1U5TB 5FFZA 3JW4A 3RDIA 1WH5A 2AHQA 3TP0A 4MTEA 3OS1A 3WHCA 5KNLA 5E1XA 3G1LA 2HOTA 4XRSA 2ELHA 5EGOB 4ZDOA 3ZQFA 3BG7A 4B48A 1EH8A 5JLXA 1YIOA 1ENHA 3O6BB 4RB3C 3F8CA 1XGOA 3M8EA 4AC0A 2BOLA 4LLNA 3DXJF 2G9WA 1ZRCA 3DF8A 3DBLB 5FFXA 1S72I 2VODA 4ENJA 3K2AA 2VPLA 4EGYA 1J09A 1R1UA 2R5YA 4QTRA 3ABLH 3RPUD 2DYSH 3L2QA 3SYTA 1MH3A 1BW5A 2VBZA 3BP8A 3MKLA 2Y48A 2ZB9A 1T56A 1W5TA 4Z2YA 1KYWA 1E17A 1D1CA 3WTSC 3CMAI 4FISA 2QSFX 1XDUA 3M9AA 1VI0A 4QPOA 3BROA 3IH4A 1XGSA 4HLYA 2VL8A 2EQRA 1D1BA 3A01A 3ABKH 3DPTA 1MMDA 4XRFA 1SD5A 3B02A 3JSPA 4RM3A 4IHXA 1P6RA 2HYGD 3G1MA 3KYDB 1GDTA 4IQJA 4I76A 3I4MJ 4IXAA 1U0JA 2Q2EB 4XBFA 2L7MP 2PMZA 1ZAOA 2E19A 1FWZA 4RMNA 1J75A 4KYWA 4PFOA 4AUXA 3FF5A 5M3MJ 2I8DA 3G73A 1ETWA 1GVDA 5E1ZB 3T0YA 2FE3A 3H92A 2BY3A 4OWRB 2HXIA 4IKFA 1QGPA 3IUOA 2NRAC 3GTKJ 3EETA 2EK5A 2F2EA 4PGGA 1JUPA 4JX5A 4XKVA 5EZHA 2MLGA 2CSOA 1NK2P 1UJ8A 3DPLC 5LGNA 1JTXA 2DT6A 1FPQA 3S2DJ 3KEOA 3PFIA 1MDMA 1LE8B 3RZOJ 1ZHFA 2HU9A 1R1TA 4NBQA 3DPUA 3L2VA 2HNHA 4M9SA 2M9HA 3NARA 2MBFA 5CKTA 3CF2A 2JSCA 1USSA 2W25A 1KZHA 4E4HA 1FYMA 3DV8A 4ZH4F 5JI6A 1SFEA 1T98A 3CJNA 3DU6A 3QYEA 4YEJA 2V9PA 4XOTA 3I54A 5K5RA 1ZR4A 4HDUA 1G8XA 3T5XA 3S1QJ 2FQ3A 2LREA 4KIFA 1FTTA 2X6YA 4NB5A 2XPWA 4WXHA 3VEPA 3KP7A 5JVTA 2MGQA 5K5QA 1RUNA 2MA3A 2LKXA 2OUMA 2CW8A 1X2NA 1T0FC 1YRNA 2OCCH 2WY8Q 1I39A 5BPDA 1A31A 1A36A 4LG3A 3M4OJ 2F5VA 5AIQA 2E5ZA 2BXYA 2LBFA 2DTRA 2MSYA 2OD5A 3FMSA 3LA2A 4KT5C 2VQGA 3I64A 4IRHA 3SEQA 3WTTC 2XASA 1IRZA 4Q47A 4M6VA 2X1DA 4EVIA 3K1NA 1JUSA 4TV7A 2LD5A 2DDAA 1BN5A 4Y33A 3S3MA 3QU3A 5DUKA 4IHSA 3HUGB 3ONQA 5LLQA 1FLIA 2E1NA 1EJ9A 4BQQA 4Y17A 2EFNA 3RKXA 4DYCA 4ZYGA 2QEXI 5F64A 2KIMA 4MHGA 2NXNB 1UHSA 3TL4X 1Z0XA 2DOFA 4E7LA 2AXTC 3F23A 3JTGA 2JSPA 3KYCB 3K1MA 4U88A 2HGCA 1TW3A 2OQGA 2MABA 2OTLI 3WODF 1Z21A 2X0LA 3VSKA 3CCMI 2EV6A 2R92J 3JSOA 2R7ZJ 4BNCA 3I9V2 4LITA 3OYFA 3OR1C 4LFUA 2ELJA 2LVSA 1ZGWA 3F0CA 3QP5A 5ERIA 3ZGKA 4BJ5C 2XV4S 4M3GA 3FHZA 1O7FA 3LFKA 3P9KA 5JVGF 1AKHB 3LAPA 3DLAA 1RNLA 3BCBA 1DPRA 1XX5A 3ZR8X 1YW9A 3ABTA 3E1SA 4P96A 4UUVA 2VC0A 2JPBA 3GMEA 1TLHB 3I55I 2X9DA 1YFHA 4UB8C 2MLKA 3V8LA 4BUPA 2VBXA 4KISA 3BWGA 1WI3A 3CUOA 5L3CA 4HYEA 3DCFA 2B9SA 3IWFA 3H35A 2BVMA 2PMUA 3BY6A 3FX3A 5KCMA 1XGMA 2NNYA 2FUG2 5D5XB 5B1AH 4E7IA 3C2GA 1IG7A 2DK8A 1U6GA 2E1MB 3SJMA 2DFFA 2JUCA 2DA2A 4Q4ZF 1W0UA 2KQRA 5L3DA 4DNCA 1A04A 1SVLA 2DMNA 2EZHA 4DBRA 1OCPA 5LEJA 2EA4A 1YG2A 1RR7A 3R61A 5E20A 1FOXA 2DJNA 4BJ6C 5J8CA 3JRFA 2H27A 2K9LA 4N9HA 3KCCA 1S7AA 3KX2A 5B1BH 4DYRA 3JTHA 3V8JA 4O5VA 4U0VA 2BE5F 1B4AA 2RQQA 3HXLA 2VQLA 1U8RA 1OCCH 1S7EA 3IH3A 2IJLA 4B8XA 1QRYA 1V5EA 4C2TA 2X6OA 5IOYA 5DCMA 1KU3A 3WG9A 2M45A 3K4LA 4CO8A 2V1UA 4L5EA 1SEUA 3CP2A 2LTPA 2HDDA 1G3WA 3ZN0A 3R0AA 5F0FA 3R6SA 1ZRFA 2R7TA 3BPXA 3I56I 2N8GA 1WJ5A 3AG4H 4M3FA 1BIAA 1EH6A 1Z7LA 1FIPA 4AIDA 2R5ZB 4L5JA 2DLLA 5HLGA 4I0BA 3KEYA 3VYSB 2O0YA 3S15J 5GAEJ 3KP6A 1F1ZA 1IN6A 3W6KB 3CCLI 3GTGJ 2QGUA 2DA4A 1IXSB 1D1AA 3AG1H 2FX0A 4N0BA 3MKWB 2HKXA 4RAYA 1RI7A 2TCTA 4D5CA 2F4OB 5FRNA 4BDYA 2M0CA 4PSXA 4PJMA 4OIPF 3BR2A 4ZYAA 3UNGC 2VE8A 3TKYA 1XN7A 4IHWA 2HOAA 2NYXA 4HX7A 4RB0A 4E7KA 1JKOC 2QYOA 2KDZA 2KRFA 3GYHX 3IH2A 3WE3A 2MC3A 3V7RA 3PUFA 3QOPA 2P7VB 2JRMA 3ZQCA 1ONVA 2XDVA 4PJJA 1MGTA 4HBLA 2V4JC 3DQVC 1F4KA 3C18A 1ZKGA 1V54H 4GFBA 3SQNA 3OYIA 1K4TA 1H8AC 1D0ZA 1X2MA 3S32A 2ZJQF 1VQOI 1BR2A 3QODA 3U21A 2O7OA 3ULQB 1SFXA 1BI2A 2UZKA 1Z7UA 3ZQHA 2X1CA 2EV0A 3CQZJ 4CZZA 3VYTB 2E34A 2IS6A 2Z3YA 1MBFA 1YX3A 2EILH 2V6CA 5HNFA 1ZG1A 4MEYF 1TQMA 4S05A 2IGOA 3QPSA 3QQAA 3GTOJ 5HODA 1PP7U 2NS7A 4KDPA 3W6VA 3HEFA 3S3OA 2XPUA 5L3BA 2GLOA 3CDLA 2EA2A 4XN3A 2A5WA 2I5UA 1OYYA 1N25A 4HPQA 4CCNA 1IUFA 1Q1VA 3JAMZ 2DOEA 1TTYA 4WXDA 3GEZA 1LDKB 2FSWA 2Q1ZB 1ZRDA 1JGGA 4CCKA 3WTWC 3TQNA 1CF7B 3FK6A 2K9SA 5FO5A 3ASOH 2EIKH 1Y8QB 2V1NA 4EJOA 4G6DA 2O61A 2PN6A 5EEAA 2JK3A 2NVUB 1R6RA 1KQ0A 1J2XA 3PNYA 1T8IA 3C2HA 2QUFA 2ZXHA 4YRVA 3RZDJ 1T2KA 2XAGA 1TNTA 4FETA 3EUAA 2ZSIB 2O8XA 1EF4A 2F6CA 5GAHJ 3TO7A 1IV6A 3WTZA 1F43A 4I99C 3FKIJ 4KMUX 5EDNA 1MBJA 2M2EA 1MNEA 3Q0UA 2EWNA 5J1YA 3GZ6A 1WSUA 3PSFA 5L3GA 2PJPA 4BQNA 2JTVA 2OF7A 5IP7J 3GBGA 1V3FA 3LSRA 2L9VA 2ZMEA 5B66C 4LG0B 2W85A 5HDNA 2RNGA 2WA0A 1RETA 2ID3A 2LNBA 2Y69H 1F9NA 1YJ9I 2RGVA 2AS5F 1VQKI 1YJWI 3ZMZA 3LAJA 2WBMA 5D6EA 3EYYA 1E3PA 1IN8A 1W7PA 3M8FA 1ZR2A 1I3QJ 3CDIA 1FBUA 5D4SA 4BE1A 3S8PA 3CLQA 1DP3A 2HDWA 5IP9J 2Q8KA 1FEXA 3CCJI 4S04A 5DUIA 3PM1A 1BBYA 2RREA 3KP3A 2VJJA 3K10A 3F21A 1WH7A 2HQRA 3HHGA 1O3QA 1LJ9A 2LKSA 2MC4A 1B8IB 2FRHA 2H94A 2VT3A 3CCRI 2Y0SN 2HYFA 3OS2A 4HZFA 3HRTA 3CDHA 2ISZA 1I6HJ 4BXUA 3ZOBA 2LF7A 2HYJA 3DTIA 4ZJZA 4CHUA 1XMAA 3ML6A 3FMQA 4B3XA 2PMZN 3C3WA 1UHWA 1WZ2A 2OTJI 2A6HF 3SZPA 5FLVA 1X3ZB 2QKLB 1WCMJ 2V26A 1HKQA 5HOOA 1IGNA 1TL8A 3GTQJ 3WU2C 2EFWA 1J0RA 1X1PA 1JT0A 2B63J 3M1EA 1TZLA 3DEWA 1F36A 4XN0A 1R58A 3DWLE 2VB6A 5ICCA 2KT0A 1FBQA 2NS8A 2COMA 1Y56A 2ZNYA 3TO6A 1TWFJ 3ESWB 2EFOA 3L00A 1YLFA 4M3BA 1VQLI 5BS6A 2KJBA 3OIPA 5KAIC 5C44J 5LRSA 1U5TA 4V19K 2NVYJ 1UMQA 2KIFA 3T1BA 1IO2A 2PJRB 1NH3A 3RCOA 4CICA 4C3IJ 4M73A 3OSGA 1ZELA 4WF2A 4EJVA 3ZMUA 1D3YA 5EGOA 1SANA 3RKWA 1VZ0A 4AU7A 3K4MA 1TWGJ 2IGKA 3HGGA 4LLGF 4YFXF 4A3MJ 1QQIA 4EATA 4II3A 1PVEA 1WJEA 4RM2A 3LSIA 3MFKA 2M87A 5GPCA 4MLOA 4BXFA 4C3JJ 2MH2A 1P4XA 2ME6A 4YIFA 2QBYA 2BGCA 4BGDA 2R7WA 2K9QA 2FEZA 4D0PA 2QQAA 3HKZN 3W2WA 1JKRC 2ACJA 4G7ZF 1BC8C 1Y39A 1SFUA 3RKYA 2YX4A 2EZLA 4HV5A 3A0HC 4L9NA 5J4VA 1I1SA 2ELKA 1HSTA 2IS2A 2L5QA 3F9KA 3FXUA 1BL0A 1F5TA 4KA4A 2W00A 4HQMA 3U1DA 1UG0A 4U7DA 3L09A 5F1RA 4M9XA 2L9NA 3WTYC 2BY0A 3BQZA 1OR7A 2PG4A 5LGTA 3PFYA 1JUMA 3F6VA 2PX9A 3OYHA 1DDNA 5EEHA 3PNVA 3SFIA 1Y0UA 4AYBA 4RGRA 4HF1A 2K02A 2ZCWA 3SDGA 4BL0B 2DI3A 4KITB 2CG4A 2IA0A 4F7ZA 5F1JA 2XB0X 5DTDA 3BQYA 1MZBA 4HDVA 3MEXA 1GHCA 3E6CC 2ECBA 5DDGA 1R4NB 5TJJA 1BJZA 2LKPA 2L3DA 1XGNA 1BI0A 2BW3B 4A2UA 1LE8A 3N97A 4LJZF 2FF4A 3Q5FA 2WV0A 2DO7A 2ZXIA 5DV5A 2L4AA 4EM0B 2GOXB 2XIGA 4C9YA 2IT0A 2HDCA 3IAS2 1KYZA 2QQ8A 3A4CA 4OAZA 3ABMH 2V9KA 1OCOH 4PGHA 3U9GA 5E8IA 2QF7A 4R79A 4U7BA 3RIRA 1AWCA 1YS6A 2XB5A 4CUGA 2C6YA 3LNQA 1UFMA 4DZJA 4E7HA 1ETOA 3DFGA 3H5NA 4YFKF 3GTLJ 2CMPA 5BMZA 3VYRB 2CS3A 3HGYA 1VQ5I 1VQPI 2NNNA 2EZIA 4XSZF 3GX4X 4ZTJA 2CYYA 1RRJA 1SVOA 2E2IJ 2ZJPF 2NOJB 3HTSB 1B59A 2ESNA 2KKOA 4YG2F 5CVJA 3S14J 3FHNA 4LK1F 1IJWC 1QHGA 2OQRA 1IUYA 1OJLA 2E5NA 2RDPA 3V7CA 2Y30A 2ECCA 3FBNB 4P9FA 3K4NA 3OS0A 3JRAA 3HUGA 2IS4A 3H3ZA 3HSEA 2ZXWH 1WHUA 1XCBA 3ECHA 1MBEA 2BEOA 2E36A 2BY1A 2A07F 1FYLA 1D0XA 1YOVB 3LSPA 1HDPA 4G8XA 1HCRA 4HAMA 2R7OA 1J7KA 4E7SA 2D1HA 5FGMA 1U2WA 1XSXA 3JAMK 2H1KA 3FZVA 5CQEA 2JN6A 3OYGA 1IN5A 1N75A 1SMTA 4XKBA 2VXZA 3C2BA 2ZFUA 1LKXA 2DOAA 1HXDA 2UV1A 2BV6A 4EV0A 3IKTA 1FNNA 2CQKA 2JA5J 1R71A 3QYBA 5D5WB 1QNTA 2R7FA 2XPVA 4GRIA 2DXIA 1RESA 3MKYB 3PJRA 2K40A 4M9ZA 1IC8A 5IOZA 2F5FA 3W6JB 2LSOA 2DN0A 4BHPA 2P7CB 4RAFA 2KMUA 2ETHA 1SC7A 1UG2A 2IEKA 1Z6RA 5KK1A 2KJCA 4BEHB 2X1EA 4B1RA 1VF9A 3PIOF 2J5OA 1TNSA 5HLTA 4AVPA 1W7PD 2XUBA 4G9YA 3NWSA 2FA5A 3CCYA 2FD5A 1ETVA 1XMKA 3TGNA 4HNVA 3F8FA 3VPRA 1P7JA 4L9TA 3A0BC 4CCLA 4IOAF 3S1RJ 2Z99A 2QA4I 1S9HA 1Y6IA 4UY8I 1PDNC 3L2WA 3HOVJ 4PUSA 4B47A 3SXYA 3VDXA 3JR9A 5J8FA 3RTRA 5CVUA 5A2QZ 1LFPA 2DCEA 1Y8RB 3GFMA 2KHMA 4XLFA 4R8HA 2WWYA 2TRTA 1K79A 3S17J 4KICA 4DOZA 3SZGA 2HZDA 4IJAA 1VNDA 1T6SA 4AIHA 3HOYJ 1VQ7I 3Q0WA 2DFIA 3FXKA 2JVHA 4GYGA 2D2WA 1IRFA 1GUUA 2BHZA 4NQWB 5M5XJ 2EPFA 1ETKA 2DU9A 2P4WA 2ZJ2A 2P0WA 3I58A 3ZRGA 3OYNA 2H8WA 4Y7NJ 3EUHA 4B4CA 2BZTA 4CH7A 5DM6F 2XKPA 5BNGA 1TBXA 4LGWA 4ZYDA 4HOBA 2RC4A 3BCAA 4FCYA 3P9IA 3J81Z 5E3LA 3IWZA 2CUZA 4IRGA 1U78A 3KEQA 3RQIA 4QIWN 3H0DA 1JE8A 1YYVA 5CYVA 5K1YA 3DKWA 3K7AJ 2M1BA 1M1EB 2FOWA 1XC5A 2WV1A 1MNDA 5IT3A 2A5YB 1MKMA 1ZTRA 4XIDA 4A3EJ 1R4MB 1HOMA 2XHKA 1PUEE 2WAQA 1ITYA 4BBRJ 5JHFA 1MMNA 2V1XA 5D6FA 3WU0A 2XAHA 5HNHA 3J7YJ 3EPZA 2EIMH 1YIJI 3OYMA 3I3LA 2K3FA 3MMYB 4CXFA 1SD6A 1U9NA 2JZYA 3OIOA 5E1WA 2FBKA 3T8TA 5J6XA 3WTUC 3SHFA 2W24A 3V4GA 2R93J 4UUSA 2HVRA 4E6KG 1WRJA 1G4DA 1E0EA 2HZTA 4BY7J 5E18F 4D9JA 5FKKA 1YQAA 2JA2A 1R1VA 2V7FA 3M1CA 2DA5A 4IVNA 4BE0A 4NHJA 3ELKA 3TBIA 4PZJA 2YSRA 1WJBA 2GXBA 1IF1A 4CGZA 4IPAA 2W48A 1HW5A 2KRCA 1WI9A 2E2HJ 4AD9A 3HRMA 3GXOA 3VB2A 2X51A 5KHDA 3HHHA 4Q48A 5M3FJ 3I71A 4IOCF 2J5PA 5DD8A 1VQ4I 1YJNI 3P7NA 5LHHA 1GV2A 1LFBA 2ZXJA 2CH0A 5JFRA 3I59B 1Z6TA 3WGHA 3OOUA 2A3SA 4HSRA 1D8KA 2X4HA 3TOBA 2CQ7A 3OIQA 4FE4A 1S29A 2WC2A 3Q3SA 5H20A 3ZMTA 4DIQA 1H89C 2DTZA 4U0YA 2L2OA 3VYUB 4UB6C 5FD5A 2XF5A 4GCVA 4D5FA 1TWAJ 3GTPJ 6PAXA 1ZLKA 1SD7A 5AONA 1YI2I 4EM2A 3G2BA 2QVOA 4N4NB 4O6JA 2IAIA 2KLOA 2BVLA 3J7ZI 4JX4A 3IRQA 3PUBA 4KIGA 1R9TJ 4M3DA 4KUMA 1V55H 5EJCA 3HSRA 5DS9A 4MGRA 3Q0VA 1Z3YA 1HQCA 2BXZA 3CC4I 2L02A 4RLQA 4G6TB 3GW2A 4ABZA 2G0EA 2VXDA 5LFAA 3GCMA 3LSTA 3ZN1A 2IW5A 2RNJA 2R7QA 5BQTA 2YR2A 3MCZA 1S6LA 2A05A 5KAFC 3AG2H 3BG6A 2XSDC 1T0FA 2GXAA 4EM1A 2O8KA 2LYCA 2YPRA 3W2VA 5FRMA 2Z33A 1FTZA 2W84A 2R7RA 2AQEA 2MFZA 2JT1A 3B73A 3CMEI 3ZQLA 2JWTA 3GZ5A 4KT6A 4JYKA 2KZVA 2HTJA 3WE2A 5CVIA 1S3JA 1B9NA 5CQGA 4NC8A 3DU5A 2KL4A 3HC7A 4L9VA 4BAYA 5FJ8J 2IGNA 4RA2A 1HLVA 1YRNB 2IA1A 2BY2A 4D7NA 3L2UA 1KONA 1S8NA 1FOKA 4L5IA 4A69C 4FHTA 5FLMJ 3H3UA 1K6YA 4WWCA 4HA8A 4B43A 4WK8F 2ICWG 1OCRH 4ZC3A 3WTVC 4RGXA 2JQ7A 1BR4A 1J5YA 1P2FA 2ZC2A 4ZZLA 4BQAA 4L0YB 1HKTA 3G3ZA 3JRBA 4E7ZA 4IX7A 1I3AA 4ENMA 4NC6A 1ZYRF 4XMYA 2HXOA 3J7AY 4Q5SF 1TQIA 2HTSA 3BG9A 2M8GX 3FKJA 2DK5A 1FT9A 4J00A 4ZDPA 1VFCA 1QO0D 2DQLA 3NRVA 2P6TA 1SFOJ 1IRXA 3F8NA 3BR5A 1B8IA 2MG4A 3W3CA 1AOYA 2FBIA 3U2RA 4BDZA 3GVAA 1B72A 1QBJA 4A0ZA 1KGSA 3AKZA 1BW6A 3KPHA 3A03A 2LG4A 2H09A 2YUSA 4ASNA 1VQNI 5J40A 3HBLA 4K2EA 1ZGJA 1B6AA 4FASD 1Z3XA 2VKHA 1WQ2A 2M4KA 4AYBN 5C4JJ 2P5VA 1VQMI 1CQTA 5GPAA 4KN7X 4LOCA 1EV7A 3OYAA 4BJTA 1MD0A 2FXAA 3E6BA 1KU7A 4AWXB 3S1NJ 2M34A 3FXLA 2O03A 2OC6A 1OCZH 4XKCA 3CJTB 4XL9A 2VOPA 3DEUA 2RQPA 2IBDA 2W82A 3AFHA 2JUGA 4HF2A 4RS8A 2IGMA 2LH9A 1MJAA 1I6XA 4HX4A 3VWBA 2FMYA 1XSVA 3CUQA 2E1CA 4HEA2 2WY7Q 2HQNA 2K5CA 4JK1X 2DW4A 5E3NA 4I2OA 2OZ6A 4XQFA 3OYJA 2XGCA 4C2MJ 1MJBA 2WB1A 1ZREA 2JVGA 3KLNA 4A6EA 4PJLA 2QQ9A 4LB5A 3LQQA 4NC7A 2Z5UA 4G94A 2PLYA 4E70A 1N77A 4IL6C 3ZPLA 3FXMA 3QYFA 2P81A 1P9QC 5LRRA 2VQCA 3TO9A 4ESBA 4RLFA 2O9LA 3H36A 1ZN2A 3QAHA 2X6WA 4CYDA 3OYKA 3HL2A 3P9CA 2Y75A 3EUKL 4OIRF 2Y2ZA 2VQHA 4A0XA 3LSJA 4FX0A 4B3AA 1RPWA 5LEKA 3LQRA 3LFUA 3BPVA 2LC2A 3CD6I 1HSJA 2V79A 5DCMB 2PI0A 3RPUA 4P5OA 2R0QC 1B1BA 2QSHX 5D5VB 1O4XA 2R3SA 3JCUC 3WU1B 1H9TA 1TQPA 2M7AA 1MMGA 2IS1A 2CFXA 1Q1HA 5K7FA 4CYCA 1V5FA 1U3EM 5TRDA 1EA3A 2QSGX 3ZP5A 1ACIA 4DZPA 1K7AA 2NVTJ 3IV5A 5KVRA 1PP8F 2QKMB 1AHDP 1G6NA 1Z05A 4ANJA 1RKWA 2LFBA 4GDFA 1DPUA 3JRDA 4HNUA 3BG3A 3F72A 4BS9A 5E8GA 3BJAA 5K7HA 1I27A 2MD5A 4U87A 3J81K 2P5LC 3A02A 1FY7A 2VC1A 4MEXF 2CWEA 1BA5A 2RAEA 2KZGA 3PQKA 1GXQA 5E79C 3HRUA 4WXCA 3L2RA 2E35A 1K78B 2LP0A 5GTIC 5IY5H 2ISYA 1XMXA 2BW3A 5EG0A 4X0GA 3QP6A 1G2HA 3DKXA 2GAUA 5HLHA 5FKNA 4NUBA 2VUMJ 3VSLA 2R7VA 2WAEA 3HTUA 2COBA 3N05A 1H9GA 1PYVA 3FXQA 3GWZA 4XKWA 2B7EA 3WHBA 4CA0A 2DPUA 3CO6C 4HLXA 1ZGAA 4A0YA 2L0KA 5TGTA 5HVQC 2NS0A 4PK4A 2CUFA 2VASA 2FOKA 1OFCX 1QZEA 4FQGA 4PFPA 4OMZA 1MH4A 1D5YA 2DJIA 5L3EA 3CCUI 5IP6A 4XRMA 4UUTA 5E17F 2W7NA 2LY1A 1FX7A 3F8MA 3J80Z 3MQ0A 3K4BA 4OMYA 1JI8A 3K2ZA 1UHMA 4H4KC 1RIOH 1IXRC 1O57A 3ZMDA 3LSMA 4XLCA 2V9VA 2WAFA 3WGIA 4MQVA 2VLAA 3RPQA 4ENKA 1XPXA 5M5YJ 4OOIA 3L2CA 3DBRB 1Y1VJ 3GTMJ 1WFXA 3H3VK 4YIIA 3WTXC 3OWTA 5HDGA 2L9SA 1I1GA 2UWMA 3M3YJ 2CQQA 4F52A 3TDZC 2D5VA 2XSJC 4IHYA 3EQLF 5H6RA 2HOSA 4KJZA 3HOUJ 1TWCJ 5M5WJ 4G12A 3FBIB 2DDBA 5ICEA 2LK2A 4N4OB 3CCSI 2F5CA 4PJ0C 5GTHC 3BZCA 3TW7A 5B5EC 1TWHJ 2VT2A 5F04A 5EEGA 1W36D 4A5MA 3PO2J 1MMSA 2X85A 4II2A 4I98B 2LY2A 1Z9CA 1K6OA 3JRIA 2HFHA 2CV2A 4RDUA 4JP0A 3B6CA 5K7ZA 3BJ6A 1O3TA 2ZJRF 4JQFA 4CCOA 2XAUA 2XC7A 4AIJA 3IRRA 1V4RA 1DU6A 3IKVA 1OKRA 4FE7A 5J3LA 3BDDA 2Q2EA 4I09A 2ZMEB 1A35A 2AXLA 2RN7A 3E3VA 1IZ1A 4A93J 1WKMA 4BEHA 2ZBKA 2F4IA 1JT6A 1WJAA 3ABUA 2HWVA 3D5RC 3NWTA 1JKQC 2KFDA 1Z91A 3FXOA 1ODDA 2AQFA 4LD5A 3S2WA 3K4JA 2E60A 2CO5A 4ESJA 2K4JA 2GOMA 4PSWA 5FLXZ 1OISA 4MTDA 1BI3A 2YU3A 1IN4A 5IYCJ 2Y31A 3LL7A 4E7JA 3CC2I 1LFUP 1R5GA 2E7XA 1MNMC 4PDKA 1LB2A 2KPMA 2YX7A 3HOZJ 4I01A 3LA3A 1E3HA 2PMHA 3F6OA 3RQ4A 3OYEA 2KDOA 1IW7F 3ZXSA 1QHHD 3X2QH 3JREA 2EFPA 3BR6A 4KN4X 1DP7P 2LLKA 2M3AA 4ITVA 2PQ8A 3OYBA 4UVCA 4IRIA 2WADA 1T95A 3ZCOA 1HA8A 1GXPA 3I5UA 3OOPA 2ID6A 2L7ZA 5ILVA 3HOWJ 4CCMA 1HBXG 2KIUA 4NQWA 2ME0A 1K83J 2K9MA 2H6BA 2CGPA 1HF0A 1KQ8A 1Z1DA 2K4BA 3RYRA 2IPQX 1QVUA 2P8TA 2M7BA 2MD0A 1H0MA 2Z2SB 3HOTA 3IC7A 1G3SA 3JRHA 3E7LA 3P5JA 3KZZA 5DM7F 5EF6A 1LPQA 3BTLA 2EJRA 2CUEA 4PJNA 1C0WA 2ADUA 5ED4A 2XRLA 2EBIA 1SVMA 1UAAA 3RJPA 2E1OA 4UVBA 5J1UA 3HZJA 1L0OC 3KLOA 1JGSA 1DGRM 1EKEA 3IP4B 2IVMA 5EYRA 1G3YA 1BOAA 1FMWA 4Y4RA 5C3EJ 2FJ1A 1IAWA 2VBYA 1YITI 2W1OA 2YU9J 5J47A 2KRHA 3KP2A 1VQ6I 3G71I 4AIKA 3HM5A 3ERED 4A3GJ 1X1DA 2Z9OA 3MZ8A 1WVRA 4MFDA 4BQOA 3CCEI 4HX8A 1PUFB 4LIUA 3WG7H 2F5EA 1W5CC 3D5LA 1RC9A 3SFZA 1DQUA 4A12A 1FMVA 3KZIC 3IHUA 3RI4A 4OIQF 4KMFA 4DW6A 2QBYB 1MIJA 1X1CA 1ORKA 2STTA 1WJCA 4U0WA 4A3LJ 1X1AA 3BTCA 2DBBA 1A5JA 1WWXA 5IYBJ 1AKHA 1IXCA 4X1EA 4G6QA 2VBWA 1OPCA 2VPRA 2EFQA 1NTCA 3PL8A 3TOAA 4L18B 2OPTA 2W4SA 5FKLA 2JA7J 3COAC 2K7LA 2OBPA 2DFEA 2Y0SA 1W4MA 4D1QA 1U8BA 3ISPA 3JRGA 2X48A 3I59A 4OINF 3KP4A 1BC7C 2CUJA 4CCJA 3FXJA 5CLSA 2L9RA 4ESFA 4XLHA 2DT7B 2M4GA 3K70D 2EH3A 2DT5A 1GT0C 4I7HA 1DGWY 1X1BA 3EYIA 2HVSA 1R5ID 4A3FJ 1JJ6C 4C30A 2FMLA 2CQNA 1J59A 2L54A 3SEZA 4Y3OA 3DLLF 4UV9A 2DPDA 3HOSA 4A3CJ 3GFLA 2QM3A 4XICA 2JA6J 3FIWA 2O3FA 1R36A 1UCRA 3ERMA 3F8BA 5BOXA 2FBHA 2FNPA 4RGSA 1SAUA 4LMYA 1P92A 2UXNA 3IL2A 3Q9SA 4HF0A 2H6CA 4IQ4A 3ZMSA 1FJLA 2HVQA 5GAGJ 3CZ6A 5JLWA 1R5HA 5EZGA 4HG2A 2FQ4A 4WX9A 3H5AA 4I0AA 1GLNA 2JA8J 2LY9A 5H2FC 2CU7A 1N78A 2L01A 1FSEA 2HR3A 2WB1N 2R5ZA 3PO3J 3K6GA 1WJDA 2LF8A 1XD7A 1LDDA 3CP8A 4ON0A 3W2AA 3HB9A 2NVQJ 1BJAA 3I53A 3G6EI 2HPIA 5E3MA 4G7OF 2XGEA 3QPTA 3R60A 4L9JA 2IRFG 1D8JA 3VODA 1YE9A 4HNTA 1W36C 3K69A 3HKZA 5CVRA 1YHQI 2VOOA 4W1UA 3AL0C 4M3EA 4AM3A 4YIRX 1O3RA 1VQ8I 3PNTA 1LUJB 4XORA 2L7FP 3J80K 2IA2A 2OA4A 4EMSA 1R00A 1POGA 5CPRB 2HS5A 1XSDA 4Y52J 5LGUA 4J01A 4IEJA 3ZQIA 4BYYA 2CRGA 4JBAA 4XONA 1P4AA 4BKXA 2PBIA 1MSFC 1NK3P 2VJIA 1AU7A 3G1OA 2NVXJ 1YW8A 2VI6A 3BC8A 2LDUA 2R5YB 1XCVA 4S0HB 3GO5A 2XROA 2M5WA 3BTJA 3I0TA 1XS9A 5IT9Z 3FK7A 1JXSA 1U9OA 2MH9A 2QENA 3LWFA 1NHAA 2DMTA 5ICFA 2ZSHB 3BR0A 1ETYA 1ZLJA 4IHTA 2QLZA 3MWMA 1UB9A 4GYIA 3A01B 1T39A 2E7WA 3GUDA 4LB6B 1NG6A 2Z16A 2DQRA 1FZPB 3VFZA 2A6EF 3QWLA 4GXOA 2H8RA 1W5SA 3REOA 1WGXA
chains in the Genus database with same CATH topology
2DAOA 3C1DA 2L4MA 3LA7A 3KETA 1O7LA 3F3XA 3HRSA 2VE9A 4M74A 1LDJA 4ETSA 5D5UB 4UHTA 4IF4A 1TW2A 1CF7A 2XVCA 1RUOA 1ON1A 2O6GE 2GA2A 1MDMB 1BI1A 1FP1D 1J9IA 3V7SA 2A69F 5DYMA 2F5DA 3BZ6A 2QWWA 5FLXK 1L3LA 2ZNZA 4P55A 4XLNF 3CUQC 3HYIA 4EJUA 3SZTA 3E6MA 3L9FA 4ZYHA 3EDPA 5DD4A 4LG0A 1HW2A 3E5QA 4ZYEA 3HIFA 3KFWX 3F22A 4HV6A 1LEAA 5LHGA 3MZHA 3GF2A 2HEOA 4A6DA 5LBQA 2FU4A 5FB2A 3R4KA 3E5XA 5DEQA 1SAXA 1STZA 1FP2A 3D0SA 2RVCA 4A5NA 3OV8A 3HSFA 5HS8A 3QU6A 1SD4A 2D45A 1K78A 4ZZDA 2GQQA 1ZG3A 3DP7A 5L3FA 3J7AO 3CTAA 1T38A 2QZ8A 4WCGA 4Y15A 2HOEA 4MNUA 4FT8A 3NQOA 4LLLA 1XB4A 2P5KA 1VTNC 2XAJA 4HQEA 3VOEA 4DQ2A 1QZZA 1OMIA 3V8KA 1X3UA 3BJOA 2JPCA 4M71A 2IP2A 2V1DA 2HKOA 4I02A 5D8KB 3FMRA 4BHBA 1FBSA 2ZO4A 1FC3A 3WGGA 4O3MA 1OYWA 5HDKA 3T8RA 2R7DA 3I4PA 1GVJA 2G7HA 4M72A 1U5TC 1ULYA 1EH7A 5A2QK 4R1HA 1B9MA 2FNAA 2NAZA 5CJ9A 2VN2A 1S7OA 4KIBA 5D4RA 2K86A 3AAFA 1ZH5A 4RB1A 4EQQA 2EV5A 2BYVE 2M30A 2STWA 5K5OA 3N4MA 3E97A 3M7GA 1YS7A 1QPMA 2Q0OA 4GGGA 1YTYA 2OZUA 2XGXA 5DCFA 2QQBA 2OU2A 4Y13A 5HS7A 3C7JA 3KZYA 1XDSA 2BBYA 2A61A 4EJTA 1D5VA 4EJWA 2M8EA 4H0EA 2UXXA 2PFBA 3KP5A 1KU2A 3KE2A 5ICGA 4BHCA 2ZFWA 5LHIA 2PEXA 3FM3A 2GIVA 4BH9A 1LNWA 2XRNA 1LEBA 4PCQA 1O3SA 2K27A 2GWRA 1JHHA 1R7JA 4YFNF 3MZYA 2GA1A 2ESHA 1LVAA 1R23A 2B0LA 3MAJA 2RV8A 3FXRA 1SMYF 3GLXA 1REPC 2WTEA 5IT9K 3CLOA 4OIOF 4UV8A 5AIPA 2EB7A 5CVVA 2ZKZA 1FYKA 1ZG5A 4OU0A 1E2XA 2W57A 4KFCA 3ECOA 5BPIA 2A68F 1CGPA 3CUQB 3E5UA 1JHFA 3CO7C 4EGZA 2P6SA 4MQ9F 4ENNA 3O3KA 3QRFF 3ZMVA 4FX4A 2JRTA 1IN7A 1BM9A 4UNOA 4M6XA 3PQJA 2G7UA 4B09A 4HW0A 3L7WA 4RGUA 2Y0MA 5F6FA 3K0LA 3FWEA 4QWQA 1YO5C 4CDGA 2RKHA 2GZWA 3K9TA 3ZQ7A 3FM5A 5JR3A 1USTA 5HLIA 2VONA 5H6QA 4LK0F 1YW7A 5HS9A 1HW1A 1MJ9A 1KQ9A 3O2PE 4QLCU 1G3TA 4M6YA 1W7PB 4KNYA 1R22A 3E6DA 2GXGA 3BOQA 3NEUA 1IRGA 2CW0F 2OAZA 1P4WA 4XLPF 4UXNA 4RAZA 2XKOA 1DUXC 4P9UA 2TDXA 2D1VA 1QZYA 4G7HF 3GFIA 5FD6A 1KA8A 4UVAA 1ZARA 1FSHA 4N9IA 4XSXF 3QPHA 3RYPA 3GFJA 2XAQA 4L0ZB 3Q9VA 3TDUC 2XAFA 1RZ4A 3R0JA 1I5ZA 5ILSA 4GO1A 3K1PA 1LQ1A 1BIBA 1OYIA 4RB2C 5ILUA 5JHUA 1HKSA 3ROUA 1ON2A 5D8LB 1KU9A 1U5TB 5FFZA 3JW4A 3RDIA 4MTEA 5E1XA 2ELHA 1EH8A 1YIOA 3O6BB 4RB3C 3F8CA 1XGOA 3M8EA 4LLNA 3DXJF 2G9WA 1ZRCA 3DF8A 5FFXA 2VODA 4ENJA 4EGYA 1R1UA 2VBZA 3BP8A 2Y48A 1W5TA 4Z2YA 1KYWA 1E17A 3WTSC 1XDUA 3M9AA 3BROA 1XGSA 4HLYA 3DPTA 4XRFA 1SD5A 3B02A 3JSPA 1P6RA 2HYGD 4IXAA 4XBFA 1ZAOA 1FWZA 1J75A 4KYWA 3FF5A 3G73A 5E1ZB 3T0YA 2FE3A 3H92A 1QGPA 2NRAC 3EETA 2EK5A 2F2EA 4PGGA 2MLGA 2CSOA 3DPLC 5LGNA 1FPQA 3KEOA 3PFIA 1MDMA 1ZHFA 1R1TA 4M9SA 2MBFA 2JSCA 1USSA 2W25A 1FYMA 3DV8A 4ZH4F 5JI6A 1SFEA 1T98A 3CJNA 3I54A 5K5RA 4HDUA 3T5XA 2FQ3A 4KIFA 4NB5A 4WXHA 3VEPA 3KP7A 5JVTA 5K5QA 1RUNA 2MA3A 5BPDA 5AIQA 2DTRA 2OD5A 3FMSA 3LA2A 4KT5C 3I64A 4IRHA 3WTTC 2XASA 4Q47A 4EVIA 3K1NA 4TV7A 1BN5A 3QU3A 5DUKA 4IHSA 5LLQA 1FLIA 2E1NA 4Y17A 2EFNA 3RKXA 4ZYGA 5F64A 2KIMA 4MHGA 3F23A 3JTGA 3K1MA 4U88A 2HGCA 1TW3A 2OQGA 3WODF 2X0LA 2EV6A 3JSOA 4BNCA 4LFUA 3QP5A 5ERIA 2XV4S 3FHZA 1O7FA 3LFKA 3P9KA 3LAPA 1RNLA 1DPRA 1YW9A 3ABTA 4P96A 4UUVA 2VC0A 2JPBA 1TLHB 1YFHA 2MLKA 3V8LA 2VBXA 3BWGA 3CUOA 5L3CA 4HYEA 3IWFA 3BY6A 2PMUA 3FX3A 1XGMA 2NNYA 5D5XB 2DK8A 1U6GA 4Q4ZF 5L3DA 4DNCA 1A04A 5LEJA 2EA4A 1YG2A 3R61A 5E20A 5J8CA 2H27A 4N9HA 3KCCA 1S7AA 3JTHA 3V8JA 4O5VA 4U0VA 2BE5F 1B4AA 1U8RA 2IJLA 4B8XA 5DCMA 1KU3A 3WG9A 2M45A 4CO8A 2V1UA 1G3WA 3ZN0A 3R0AA 3R6SA 1ZRFA 3BPXA 1BIAA 1EH6A 4L5JA 2DLLA 5HLGA 4I0BA 2O0YA 3KP6A 1F1ZA 1IN6A 3W6KB 1IXSB 4N0BA 2HKXA 4RAYA 1RI7A 4OIPF 2VE8A 3TKYA 1XN7A 2NYXA 4HX7A 4RB0A 2QYOA 3GYHX 2KRFA 3WE3A 2MC3A 3V7RA 3QOPA 2P7VB 1ONVA 1MGTA 4HBLA 3DQVC 1F4KA 3C18A 3SQNA 3ULQB 1SFXA 1BI2A 2UZKA 1Z7UA 2EV0A 4CZZA 2Z3YA 2V6CA 1ZG1A 4MEYF 1TQMA 4S05A 1PP7U 4KDPA 5L3BA 2EA2A 1OYYA 3JAMZ 1TTYA 4WXDA 3GEZA 1LDKB 2FSWA 1ZRDA 3WTWC 3TQNA 1CF7B 5FO5A 4EJOA 4G6DA 2O61A 2PN6A 1KQ0A 1J2XA 2QUFA 1T2KA 2XAGA 1TNTA 2O8XA 3TO7A 3WTZA 4KMUX 2EWNA 3GZ6A 1WSUA 5L3GA 2PJPA 2JTVA 1V3FA 4LG0B 2ZMEA 2W85A 5HDNA 2LNBA 1F9NA 2RGVA 2AS5F 3ZMZA 3LAJA 5D6EA 3EYYA 1IN8A 1W7PA 3M8FA 1FBUA 5D4SA 2Q8KA 4S04A 5DUIA 1BBYA 3KP3A 3F21A 2HQRA 3HHGA 1O3QA 1LJ9A 2FRHA 2H94A 2VT3A 2HYFA 4HZFA 3HRTA 3CDHA 2ISZA 4BXUA 2LF7A 4CHUA 1XMAA 3ML6A 3FMQA 3C3WA 1UHWA 2A6HF 3SZPA 5HOOA 1HKQA 2EFWA 1J0RA 3M1EA 1R58A 5ICCA 1FBQA 2COMA 2ZNYA 3TO6A 2EFOA 3L00A 1YLFA 5BS6A 2KJBA 5LRSA 1U5TA 2KIFA 3T1BA 4CICA 4M73A 4WF2A 4EJVA 3ZMUA 1D3YA 3RKWA 4LLGF 4YFXF 1QQIA 3MFKA 2M87A 2MH2A 1P4XA 4YIFA 2QBYA 2BGCA 2FEZA 4D0PA 2QQAA 2ACJA 4G7ZF 1BC8C 1SFUA 3RKYA 2YX4A 4HV5A 4L9NA 1I1SA 1HSTA 3FXUA 1F5TA 4KA4A 4HQMA 3U1DA 4U7DA 3L09A 5F1RA 4M9XA 3WTYC 1OR7A 2PG4A 5LGTA 3F6VA 1DDNA 5EEHA 1Y0UA 4RGRA 4HF1A 2K02A 2ZCWA 2DI3A 2CG4A 2IA0A 4F7ZA 4HDVA 1MZBA 1GHCA 3MEXA 3E6CC 5DDGA 5TJJA 2LKPA 2L3DA 1XGNA 1BI0A 4A2UA 3N97A 4LJZF 2FF4A 3Q5FA 2WV0A 2DO7A 5DV5A 2L4AA 4EM0B 2XIGA 2IT0A 2HDCA 1KYZA 3U9GA 4PGHA 5E8IA 4R79A 4U7BA 2C6YA 3RIRA 1AWCA 1YS6A 1UFMA 3DFGA 4YFKF 5BMZA 2NNNA 4XSZF 3GX4X 2CYYA 3HTSB 1B59A 2ESNA 2KKOA 4YG2F 5CVJA 4LK1F 2OQRA 1IUYA 2RDPA 3V7CA 4P9FA 3HUGA 3H3ZA 3HSEA 1XCBA 3ECHA 2BEOA 2A07F 1FYLA 4G8XA 4HAMA 1J7KA 2D1HA 5FGMA 1U2WA 1XSXA 3JAMK 3FZVA 1IN5A 1SMTA 2VXZA 1HXDA 2BV6A 4EV0A 3IKTA 1FNNA 2CQKA 5D5WB 1QNTA 2R7FA 4M9ZA 2F5FA 3W6JB 2LSOA 4BHPA 2P7CB 2ETHA 1Z6RA 5KK1A 2KJCA 2J5OA 1TNSA 4AVPA 1W7PD 2XUBA 4G9YA 2FA5A 1XMKA 3TGNA 3F8FA 4L9TA 2Z99A 1PDNC 3SXYA 5J8FA 3RTRA 5CVUA 5A2QZ 3GFMA 4R8HA 2WWYA 1K79A 4KICA 4IJAA 1T6SA 4AIHA 2DFIA 4GYGA 2D2WA 1IRFA 2DU9A 2P4WA 2ZJ2A 3I58A 3EUHA 2XKPA 1TBXA 4LGWA 4ZYDA 4HOBA 2RC4A 3P9IA 3J81Z 3IWZA 4IRGA 1U78A 3KEQA 1JE8A 1YYVA 5CYVA 5K1YA 3DKWA 2M1BA 5IT3A 2A5YB 1MKMA 2XHKA 1PUEE 2V1XA 5D6FA 3WU0A 2XAHA 4CXFA 1SD6A 2JZYA 5E1WA 2FBKA 3T8TA 5J6XA 3WTUC 3SHFA 2W24A 3V4GA 1WRJA 1G4DA 2HZTA 5E18F 1YQAA 1R1VA 4IVNA 4NHJA 3ELKA 4PZJA 2YSRA 2GXBA 1IF1A 4CGZA 4IPAA 1HW5A 1WI9A 4AD9A 3HRMA 3GXOA 3VB2A 3HHHA 4Q48A 3I71A 2J5PA 5DD8A 3P7NA 5LHHA 2ZXJA 5JFRA 3I59B 1Z6TA 3WGHA 2A3SA 1D8KA 2X4HA 3TOBA 1S29A 2WC2A 5H20A 3ZMTA 4U0YA 5FD5A 4GCVA 6PAXA 1ZLKA 1SD7A 5AONA 4EM2A 2QVOA 4O6JA 3IRQA 4KIGA 4KUMA 3HSRA 4MGRA 1HQCA 2L02A 3GW2A 3LSTA 3ZN1A 2IW5A 2RNJA 5BQTA 2YR2A 3MCZA 1S6LA 1T0FA 4EM1A 2YPRA 2Z33A 2W84A 2JT1A 3B73A 3GZ5A 2HTJA 3WE2A 5CVIA 1S3JA 1B9NA 4L9VA 4BAYA 2IA1A 1S8NA 1FOKA 4L5IA 4FHTA 3H3UA 4WWCA 4HA8A 4WK8F 3WTVC 4RGXA 1J5YA 1P2FA 4ZZLA 4BQAA 4L0YB 1HKTA 3G3ZA 4ENMA 1ZYRF 4Q5SF 1TQIA 2HTSA 2DK5A 1FT9A 1QO0D 2DQLA 3NRVA 2P6TA 3F8NA 1AOYA 2FBIA 3U2RA 3GVAA 1QBJA 4A0ZA 1KGSA 2H09A 4ASNA 4K2EA 1ZGJA 1B6AA 1WQ2A 2P5VA 4KN7X 1EV7A 1MD0A 2FXAA 3E6BA 1KU7A 4AWXB 2O03A 2VOPA 3DEUA 2RQPA 4HF2A 4RS8A 1MJAA 1I6XA 4HX4A 2FMYA 1XSVA 3CUQA 2E1CA 2HQNA 4JK1X 2DW4A 4I2OA 2OZ6A 1MJBA 1ZREA 3KLNA 4A6EA 2QQ9A 4LB5A 3LQQA 2Z5UA 4G94A 2PLYA 4E70A 3ZPLA 5LRRA 3TO9A 4ESBA 1ZN2A 3QAHA 4CYDA 3P9CA 2Y75A 4OIRF 4A0XA 4FX0A 5LEKA 3LQRA 3BPVA 1HSJA 2V79A 5DCMB 2PI0A 3RPUA 4P5OA 1B1BA 5D5VB 2R3SA 3WU1B 1H9TA 1TQPA 2CFXA 1Q1HA 1U3EM 5TRDA 3ZP5A 1K7AA 5KVRA 1PP8F 1G6NA 1Z05A 1DPUA 3F72A 5E8GA 3BJAA 1I27A 2MD5A 3J81K 2P5LC 1FY7A 2VC1A 4MEXF 2CWEA 3PQKA 1GXQA 3HRUA 4WXCA 1K78B 2ISYA 3QP6A 2GAUA 5HLHA 3HTUA 1H9GA 3FXQA 3GWZA 2DPUA 3CO6C 4HLXA 1ZGAA 4A0YA 5HVQC 2NS0A 2FOKA 4OMZA 5L3EA 5E17F 1FX7A 3F8MA 3J80Z 3MQ0A 4OMYA 3K2ZA 1UHMA 1RIOH 1IXRC 1O57A 3ZMDA 2V9VA 3WGIA 4MQVA 3RPQA 4ENKA 4OOIA 3L2CA 4YIIA 3WTXC 5HDGA 1I1GA 2UWMA 3TDZC 3EQLF 5H6RA 5ICEA 2F5CA 2VT2A 5EEGA 4A5MA 1Z9CA 4I98B 1K6OA 2HFHA 3BJ6A 1O3TA 4JQFA 4AIJA 3IRRA 1V4RA 3IKVA 1OKRA 3BDDA 2Q2EA 4I09A 2ZMEB 2AXLA 2RN7A 3E3VA 1IZ1A 1WKMA 2ZBKA 3ABUA 2HWVA 1Z91A 1ODDA 4LD5A 3S2WA 2CO5A 4ESJA 2K4JA 5FLXZ 4MTDA 1BI3A 2YU3A 1IN4A 1R5GA 2E7XA 4PDKA 1LB2A 2YX7A 4I01A 3LA3A 2PMHA 3F6OA 1IW7F 2EFPA 4KN4X 1DP7P 2PQ8A 4UVCA 4IRIA 1GXPA 3I5UA 3OOPA 5ILVA 1HBXG 2KIUA 4NQWA 2H6BA 2CGPA 1KQ8A 1Z1DA 2K4BA 3RYRA 2IPQX 2P8TA 1H0MA 3HOTA 3IC7A 1G3SA 3KZZA 2EJRA 1C0WA 2ADUA 5ED4A 3RJPA 4UVBA 1L0OC 3KLOA 1JGSA 2IVMA 1G3YA 1BOAA 1IAWA 2VBYA 3KP2A 4AIKA 3ERED 2Z9OA 4HX8A 2F5EA 3D5LA 3SFZA 4A12A 3IHUA 3RI4A 4OIQF 4KMFA 2QBYB 2STTA 4U0WA 2DBBA 1WWXA 1IXCA 4G6QA 2VBWA 1OPCA 2EFQA 3TOAA 4L18B 3COAC 2K7LA 2OBPA 1W4MA 3ISPA 3I59A 4OINF 3KP4A 1BC7C 5CLSA 4ESFA 2DT5A 4I7HA 3EYIA 2FMLA 1J59A 2L54A 4UV9A 2DPDA 3HOSA 3GFLA 2QM3A 2O3FA 1R36A 1UCRA 3F8BA 5BOXA 2FBHA 2FNPA 4RGSA 4LMYA 1P92A 2UXNA 3IL2A 3Q9SA 4HF0A 2H6CA 3ZMSA 1R5HA 4WX9A 4I0AA 2L01A 1FSEA 2HR3A 2LF8A 1XD7A 1LDDA 4ON0A 1BJAA 3I53A 4G7OF 3QPTA 3R60A 4L9JA 2IRFG 1D8JA 3VODA 3K69A 5CVRA 2VOOA 1O3RA 3J80K 2IA2A 2OA4A 4EMSA 1R00A 2HS5A 1XSDA 5LGUA 4BYYA 4JBAA 1P4AA 2PBIA 1YW8A 2LDUA 1XCVA 3GO5A 2XROA 2M5WA 3I0TA 5IT9Z 1JXSA 2MH9A 2QENA 3LWFA 1NHAA 5ICFA 4IHTA 1ZLJA 2QLZA 3MWMA 1UB9A 4GYIA 1T39A 2E7WA 3GUDA 4LB6B 2DQRA 1FZPB 3VFZA 2A6EF 4GXOA 1W5SA 3REOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAO A;  3C1D A;  2L4M A;  3LA7 A;  3KET A;  1O7L A;  3F3X A;  3HRS A;  2VE9 A;  4M74 A;  1LDJ A;  4ETS A;  5D5U B;  4UHT A;  4IF4 A;  1TW2 A;  1CF7 A;  2XVC A;  1RUO A;  1ON1 A;  2O6G E;  2GA2 A;  1MDM B;  1BI1 A;  1FP1 D;  1J9I A;  3V7S A;  2A69 F;  5DYM A;  2F5D A;  3BZ6 A;  2QWW A;  5FLX K;  1L3L A;  2ZNZ A;  4P55 A;  4XLN F;  3CUQ C;  3HYI A;  4EJU A;  3SZT A;  3E6M A;  3L9F A;  4ZYH A;  3EDP A;  5DD4 A;  4LG0 A;  1HW2 A;  3E5Q A;  4ZYE A;  3HIF A;  3KFW X;  3F22 A;  4HV6 A;  1LEA A;  5LHG A;  3MZH A;  3GF2 A;  2HEO A;  4A6D A;  5LBQ A;  2FU4 A;  5FB2 A;  3R4K A;  3E5X A;  5DEQ A;  1SAX A;  1STZ A;  1FP2 A;  3D0S A;  2RVC A;  4A5N A;  3OV8 A;  3HSF A;  5HS8 A;  3QU6 A;  1SD4 A;  2D45 A;  1K78 A;  4ZZD A;  2GQQ A;  1ZG3 A;  3DP7 A;  5L3F A;  3J7A O;  3CTA A;  1T38 A;  2QZ8 A;  4WCG A;  4Y15 A;  2HOE A;  4MNU A;  4FT8 A;  3NQO A;  4LLL A;  1XB4 A;  2P5K A;  1VTN C;  2XAJ A;  4HQE A;  3VOE A;  4DQ2 A;  1QZZ A;  1OMI A;  3V8K A;  1X3U A;  3BJO A;  2JPC A;  4M71 A;  2IP2 A;  2V1D A;  2HKO A;  4I02 A;  5D8K B;  3FMR A;  4BHB A;  1FBS A;  2ZO4 A;  1FC3 A;  3WGG A;  4O3M A;  1OYW A;  5HDK A;  3T8R A;  2R7D A;  3I4P A;  1GVJ A;  2G7H A;  4M72 A;  1U5T C;  1ULY A;  1EH7 A;  5A2Q K;  4R1H A;  1B9M A;  2FNA A;  2NAZ A;  5CJ9 A;  2VN2 A;  1S7O A;  4KIB A;  5D4R A;  2K86 A;  3AAF A;  1ZH5 A;  4RB1 A;  4EQQ A;  2EV5 A;  2BYV E;  2M30 A;  2STW A;  5K5O A;  3N4M A;  3E97 A;  3M7G A;  1YS7 A;  1QPM A;  2Q0O A;  4GGG A;  1YTY A;  2OZU A;  2XGX A;  5DCF A;  2QQB A;  2OU2 A;  4Y13 A;  5HS7 A;  3C7J A;  3KZY A;  1XDS A;  2BBY A;  2A61 A;  4EJT A;  1D5V A;  4EJW A;  2M8E A;  4H0E A;  2UXX A;  2PFB A;  3KP5 A;  1KU2 A;  3KE2 A;  5ICG A;  4BHC A;  2ZFW A;  5LHI A;  2PEX A;  3FM3 A;  2GIV A;  4BH9 A;  1LNW A;  2XRN A;  1LEB A;  4PCQ A;  1O3S A;  2K27 A;  2GWR A;  1JHH A;  1R7J A;  4YFN F;  3MZY A;  2GA1 A;  2ESH A;  1LVA A;  1R23 A;  2B0L A;  3MAJ A;  2RV8 A;  3FXR A;  1SMY F;  3GLX A;  1REP C;  2WTE A;  5IT9 K;  3CLO A;  4OIO F;  4UV8 A;  5AIP A;  2EB7 A;  5CVV A;  2ZKZ A;  1FYK A;  1ZG5 A;  4OU0 A;  1E2X A;  2W57 A;  4KFC A;  3ECO A;  5BPI A;  2A68 F;  1CGP A;  3CUQ B;  3E5U A;  1JHF A;  3CO7 C;  4EGZ A;  2P6S A;  4MQ9 F;  4ENN A;  3O3K A;  3QRF F;  3ZMV A;  4FX4 A;  2JRT A;  1IN7 A;  1BM9 A;  4UNO A;  4M6X A;  3PQJ A;  2G7U A;  4B09 A;  4HW0 A;  3L7W A;  4RGU A;  2Y0M A;  5F6F A;  3K0L A;  3FWE A;  4QWQ A;  1YO5 C;  4CDG A;  2RKH A;  2GZW A;  3K9T A;  3ZQ7 A;  3FM5 A;  5JR3 A;  1UST A;  5HLI A;  2VON A;  5H6Q A;  4LK0 F;  1YW7 A;  5HS9 A;  1HW1 A;  1MJ9 A;  1KQ9 A;  3O2P E;  4QLC U;  1G3T A;  4M6Y A;  1W7P B;  4KNY A;  1R22 A;  3E6D A;  2GXG A;  3BOQ A;  3NEU A;  1IRG A;  2CW0 F;  2OAZ A;  1P4W A;  4XLP F;  4UXN A;  4RAZ A;  2XKO A;  1DUX C;  4P9U A;  2TDX A;  2D1V A;  1QZY A;  4G7H F;  3GFI A;  5FD6 A;  1KA8 A;  4UVA A;  1ZAR A;  1FSH A;  4N9I A;  4XSX F;  3QPH A;  3RYP A;  3GFJ A;  2XAQ A;  4L0Z B;  3Q9V A;  3TDU C;  2XAF A;  1RZ4 A;  3R0J A;  1I5Z A;  5ILS A;  4GO1 A;  3K1P A;  1LQ1 A;  1BIB A;  1OYI A;  4RB2 C;  5ILU A;  5JHU A;  1HKS A;  3ROU A;  1ON2 A;  5D8L B;  1KU9 A;  1U5T B;  5FFZ A;  3JW4 A;  3RDI A;  4MTE A;  5E1X A;  2ELH A;  1EH8 A;  1YIO A;  3O6B B;  4RB3 C;  3F8C A;  1XGO A;  3M8E A;  4LLN A;  3DXJ F;  2G9W A;  1ZRC A;  3DF8 A;  5FFX A;  2VOD A;  4ENJ A;  4EGY A;  1R1U A;  2VBZ A;  3BP8 A;  2Y48 A;  1W5T A;  4Z2Y A;  1KYW A;  1E17 A;  3WTS C;  1XDU A;  3M9A A;  3BRO A;  1XGS A;  4HLY A;  3DPT A;  4XRF A;  1SD5 A;  3B02 A;  3JSP A;  1P6R A;  2HYG D;  4IXA A;  4XBF A;  1ZAO A;  1FWZ A;  1J75 A;  4KYW A;  3FF5 A;  3G73 A;  5E1Z B;  3T0Y A;  2FE3 A;  3H92 A;  1QGP A;  2NRA C;  3EET A;  2EK5 A;  2F2E A;  4PGG A;  2MLG A;  2CSO A;  3DPL C;  5LGN A;  1FPQ A;  3KEO A;  3PFI A;  1MDM A;  1ZHF A;  1R1T A;  4M9S A;  2MBF A;  2JSC A;  1USS A;  2W25 A;  1FYM A;  3DV8 A;  4ZH4 F;  5JI6 A;  1SFE A;  1T98 A;  3CJN A;  3I54 A;  5K5R A;  4HDU A;  3T5X A;  2FQ3 A;  4KIF A;  4NB5 A;  4WXH A;  3VEP A;  3KP7 A;  5JVT A;  5K5Q A;  1RUN A;  2MA3 A;  5BPD A;  5AIQ A;  2DTR A;  2OD5 A;  3FMS A;  3LA2 A;  4KT5 C;  3I64 A;  4IRH A;  3WTT C;  2XAS A;  4Q47 A;  4EVI A;  3K1N A;  4TV7 A;  1BN5 A;  3QU3 A;  5DUK A;  4IHS A;  5LLQ A;  1FLI A;  2E1N A;  4Y17 A;  2EFN A;  3RKX A;  4ZYG A;  5F64 A;  2KIM A;  4MHG A;  3F23 A;  3JTG A;  3K1M A;  4U88 A;  2HGC A;  1TW3 A;  2OQG A;  3WOD F;  2X0L A;  2EV6 A;  3JSO A;  4BNC A;  4LFU A;  3QP5 A;  5ERI A;  2XV4 S;  3FHZ A;  1O7F A;  3LFK A;  3P9K A;  3LAP A;  1RNL A;  1DPR A;  1YW9 A;  3ABT A;  4P96 A;  4UUV A;  2VC0 A;  2JPB A;  1TLH B;  1YFH A;  2MLK A;  3V8L A;  2VBX A;  3BWG A;  3CUO A;  5L3C A;  4HYE A;  3IWF A;  3BY6 A;  2PMU A;  3FX3 A;  1XGM A;  2NNY A;  5D5X B;  2DK8 A;  1U6G A;  4Q4Z F;  5L3D A;  4DNC A;  1A04 A;  5LEJ A;  2EA4 A;  1YG2 A;  3R61 A;  5E20 A;  5J8C A;  2H27 A;  4N9H A;  3KCC A;  1S7A A;  3JTH A;  3V8J A;  4O5V A;  4U0V A;  2BE5 F;  1B4A A;  1U8R A;  2IJL A;  4B8X A;  5DCM A;  1KU3 A;  3WG9 A;  2M45 A;  4CO8 A;  2V1U A;  1G3W A;  3ZN0 A;  3R0A A;  3R6S A;  1ZRF A;  3BPX A;  1BIA A;  1EH6 A;  4L5J A;  2DLL A;  5HLG A;  4I0B A;  2O0Y A;  3KP6 A;  1F1Z A;  1IN6 A;  3W6K B;  1IXS B;  4N0B A;  2HKX A;  4RAY A;  1RI7 A;  4OIP F;  2VE8 A;  3TKY A;  1XN7 A;  2NYX A;  4HX7 A;  4RB0 A;  2QYO A;  3GYH X;  2KRF A;  3WE3 A;  2MC3 A;  3V7R A;  3QOP A;  2P7V B;  1ONV A;  1MGT A;  4HBL A;  3DQV C;  1F4K A;  3C18 A;  3SQN A;  3ULQ B;  1SFX A;  1BI2 A;  2UZK A;  1Z7U A;  2EV0 A;  4CZZ A;  2Z3Y A;  2V6C A;  1ZG1 A;  4MEY F;  1TQM A;  4S05 A;  1PP7 U;  4KDP A;  5L3B A;  2EA2 A;  1OYY A;  3JAM Z;  1TTY A;  4WXD A;  3GEZ A;  1LDK B;  2FSW A;  1ZRD A;  3WTW C;  3TQN A;  1CF7 B;  5FO5 A;  4EJO A;  4G6D A;  2O61 A;  2PN6 A;  1KQ0 A;  1J2X A;  2QUF A;  1T2K A;  2XAG A;  1TNT A;  2O8X A;  3TO7 A;  3WTZ A;  4KMU X;  2EWN A;  3GZ6 A;  1WSU A;  5L3G A;  2PJP A;  2JTV A;  1V3F A;  4LG0 B;  2ZME A;  2W85 A;  5HDN A;  2LNB A;  1F9N A;  2RGV A;  2AS5 F;  3ZMZ A;  3LAJ A;  5D6E A;  3EYY A;  1IN8 A;  1W7P A;  3M8F A;  1FBU A;  5D4S A;  2Q8K A;  4S04 A;  5DUI A;  1BBY A;  3KP3 A;  3F21 A;  2HQR A;  3HHG A;  1O3Q A;  1LJ9 A;  2FRH A;  2H94 A;  2VT3 A;  2HYF A;  4HZF A;  3HRT A;  3CDH A;  2ISZ A;  4BXU A;  2LF7 A;  4CHU A;  1XMA A;  3ML6 A;  3FMQ A;  3C3W A;  1UHW A;  2A6H F;  3SZP A;  5HOO A;  1HKQ A;  2EFW A;  1J0R A;  3M1E A;  1R58 A;  5ICC A;  1FBQ A;  2COM A;  2ZNY A;  3TO6 A;  2EFO A;  3L00 A;  1YLF A;  5BS6 A;  2KJB A;  5LRS A;  1U5T A;  2KIF A;  3T1B A;  4CIC A;  4M73 A;  4WF2 A;  4EJV A;  3ZMU A;  1D3Y A;  3RKW A;  4LLG F;  4YFX F;  1QQI A;  3MFK A;  2M87 A;  2MH2 A;  1P4X A;  4YIF A;  2QBY A;  2BGC A;  2FEZ A;  4D0P A;  2QQA A;  2ACJ A;  4G7Z F;  1BC8 C;  1SFU A;  3RKY A;  2YX4 A;  4HV5 A;  4L9N A;  1I1S A;  1HST A;  3FXU A;  1F5T A;  4KA4 A;  4HQM A;  3U1D A;  4U7D A;  3L09 A;  5F1R A;  4M9X A;  3WTY C;  1OR7 A;  2PG4 A;  5LGT A;  3F6V A;  1DDN A;  5EEH A;  1Y0U A;  4RGR A;  4HF1 A;  2K02 A;  2ZCW A;  2DI3 A;  2CG4 A;  2IA0 A;  4F7Z A;  4HDV A;  1MZB A;  1GHC A;  3MEX A;  3E6C C;  5DDG A;  5TJJ A;  2LKP A;  2L3D A;  1XGN A;  1BI0 A;  4A2U A;  3N97 A;  4LJZ F;  2FF4 A;  3Q5F A;  2WV0 A;  2DO7 A;  5DV5 A;  2L4A A;  4EM0 B;  2XIG A;  2IT0 A;  2HDC A;  1KYZ A;  3U9G A;  4PGH A;  5E8I A;  4R79 A;  4U7B A;  2C6Y A;  3RIR A;  1AWC A;  1YS6 A;  1UFM A;  3DFG A;  4YFK F;  5BMZ A;  2NNN A;  4XSZ F;  3GX4 X;  2CYY A;  3HTS B;  1B59 A;  2ESN A;  2KKO A;  4YG2 F;  5CVJ A;  4LK1 F;  2OQR A;  1IUY A;  2RDP A;  3V7C A;  4P9F A;  3HUG A;  3H3Z A;  3HSE A;  1XCB A;  3ECH A;  2BEO A;  2A07 F;  1FYL A;  4G8X A;  4HAM A;  1J7K A;  2D1H A;  5FGM A;  1U2W A;  1XSX A;  3JAM K;  3FZV A;  1IN5 A;  1SMT A;  2VXZ A;  1HXD A;  2BV6 A;  4EV0 A;  3IKT A;  1FNN A;  2CQK A;  5D5W B;  1QNT A;  2R7F A;  4M9Z A;  2F5F A;  3W6J B;  2LSO A;  4BHP A;  2P7C B;  2ETH A;  1Z6R A;  5KK1 A;  2KJC A;  2J5O A;  1TNS A;  4AVP A;  1W7P D;  2XUB A;  4G9Y A;  2FA5 A;  1XMK A;  3TGN A;  3F8F A;  4L9T A;  2Z99 A;  1PDN C;  3SXY A;  5J8F A;  3RTR A;  5CVU A;  5A2Q Z;  3GFM A;  4R8H A;  2WWY A;  1K79 A;  4KIC A;  4IJA A;  1T6S A;  4AIH A;  2DFI A;  4GYG A;  2D2W A;  1IRF A;  2DU9 A;  2P4W A;  2ZJ2 A;  3I58 A;  3EUH A;  2XKP A;  1TBX A;  4LGW A;  4ZYD A;  4HOB A;  2RC4 A;  3P9I A;  3J81 Z;  3IWZ A;  4IRG A;  1U78 A;  3KEQ A;  1JE8 A;  1YYV A;  5CYV A;  5K1Y A;  3DKW A;  2M1B A;  5IT3 A;  2A5Y B;  1MKM A;  2XHK A;  1PUE E;  2V1X A;  5D6F A;  3WU0 A;  2XAH A;  4CXF A;  1SD6 A;  2JZY A;  5E1W A;  2FBK A;  3T8T A;  5J6X A;  3WTU C;  3SHF A;  2W24 A;  3V4G A;  1WRJ A;  1G4D A;  2HZT A;  5E18 F;  1YQA A;  1R1V A;  4IVN A;  4NHJ A;  3ELK A;  4PZJ A;  2YSR A;  2GXB A;  1IF1 A;  4CGZ A;  4IPA A;  1HW5 A;  1WI9 A;  4AD9 A;  3HRM A;  3GXO A;  3VB2 A;  3HHH A;  4Q48 A;  3I71 A;  2J5P A;  5DD8 A;  3P7N A;  5LHH A;  2ZXJ A;  5JFR A;  3I59 B;  1Z6T A;  3WGH A;  2A3S A;  1D8K A;  2X4H A;  3TOB A;  1S29 A;  2WC2 A;  5H20 A;  3ZMT A;  4U0Y A;  5FD5 A;  4GCV A;  6PAX A;  1ZLK A;  1SD7 A;  5AON A;  4EM2 A;  2QVO A;  4O6J A;  3IRQ A;  4KIG A;  4KUM A;  3HSR A;  4MGR A;  1HQC A;  2L02 A;  3GW2 A;  3LST A;  3ZN1 A;  2IW5 A;  2RNJ A;  5BQT A;  2YR2 A;  3MCZ A;  1S6L A;  1T0F A;  4EM1 A;  2YPR A;  2Z33 A;  2W84 A;  2JT1 A;  3B73 A;  3GZ5 A;  2HTJ A;  3WE2 A;  5CVI A;  1S3J A;  1B9N A;  4L9V A;  4BAY A;  2IA1 A;  1S8N A;  1FOK A;  4L5I A;  4FHT A;  3H3U A;  4WWC A;  4HA8 A;  4WK8 F;  3WTV C;  4RGX A;  1J5Y A;  1P2F A;  4ZZL A;  4BQA A;  4L0Y B;  1HKT A;  3G3Z A;  4ENM A;  1ZYR F;  4Q5S F;  1TQI A;  2HTS A;  2DK5 A;  1FT9 A;  1QO0 D;  2DQL A;  3NRV A;  2P6T A;  3F8N A;  1AOY A;  2FBI A;  3U2R A;  3GVA A;  1QBJ A;  4A0Z A;  1KGS A;  2H09 A;  4ASN A;  4K2E A;  1ZGJ A;  1B6A A;  1WQ2 A;  2P5V A;  4KN7 X;  1EV7 A;  1MD0 A;  2FXA A;  3E6B A;  1KU7 A;  4AWX B;  2O03 A;  2VOP A;  3DEU A;  2RQP A;  4HF2 A;  4RS8 A;  1MJA A;  1I6X A;  4HX4 A;  2FMY A;  1XSV A;  3CUQ A;  2E1C A;  2HQN A;  4JK1 X;  2DW4 A;  4I2O A;  2OZ6 A;  1MJB A;  1ZRE A;  3KLN A;  4A6E A;  2QQ9 A;  4LB5 A;  3LQQ A;  2Z5U A;  4G94 A;  2PLY A;  4E70 A;  3ZPL A;  5LRR A;  3TO9 A;  4ESB A;  1ZN2 A;  3QAH A;  4CYD A;  3P9C A;  2Y75 A;  4OIR F;  4A0X A;  4FX0 A;  5LEK A;  3LQR A;  3BPV A;  1HSJ A;  2V79 A;  5DCM B;  2PI0 A;  3RPU A;  4P5O A;  1B1B A;  5D5V B;  2R3S A;  3WU1 B;  1H9T A;  1TQP A;  2CFX A;  1Q1H A;  1U3E M;  5TRD A;  3ZP5 A;  1K7A A;  5KVR A;  1PP8 F;  1G6N A;  1Z05 A;  1DPU A;  3F72 A;  5E8G A;  3BJA A;  1I27 A;  2MD5 A;  3J81 K;  2P5L C;  1FY7 A;  2VC1 A;  4MEX F;  2CWE A;  3PQK A;  1GXQ A;  3HRU A;  4WXC A;  1K78 B;  2ISY A;  3QP6 A;  2GAU A;  5HLH A;  3HTU A;  1H9G A;  3FXQ A;  3GWZ A;  2DPU A;  3CO6 C;  4HLX A;  1ZGA A;  4A0Y A;  5HVQ C;  2NS0 A;  2FOK A;  4OMZ A;  5L3E A;  5E17 F;  1FX7 A;  3F8M A;  3J80 Z;  3MQ0 A;  4OMY A;  3K2Z A;  1UHM A;  1RIO H;  1IXR C;  1O57 A;  3ZMD A;  2V9V A;  3WGI A;  4MQV A;  3RPQ A;  4ENK A;  4OOI A;  3L2C A;  4YII A;  3WTX C;  5HDG A;  1I1G A;  2UWM A;  3TDZ C;  3EQL F;  5H6R A;  5ICE A;  2F5C A;  2VT2 A;  5EEG A;  4A5M A;  1Z9C A;  4I98 B;  1K6O A;  2HFH A;  3BJ6 A;  1O3T A;  4JQF A;  4AIJ A;  3IRR A;  1V4R A;  3IKV A;  1OKR A;  3BDD A;  2Q2E A;  4I09 A;  2ZME B;  2AXL A;  2RN7 A;  3E3V A;  1IZ1 A;  1WKM A;  2ZBK A;  3ABU A;  2HWV A;  1Z91 A;  1ODD A;  4LD5 A;  3S2W A;  2CO5 A;  4ESJ A;  2K4J A;  5FLX Z;  4MTD A;  1BI3 A;  2YU3 A;  1IN4 A;  1R5G A;  2E7X A;  4PDK A;  1LB2 A;  2YX7 A;  4I01 A;  3LA3 A;  2PMH A;  3F6O A;  1IW7 F;  2EFP A;  4KN4 X;  1DP7 P;  2PQ8 A;  4UVC A;  4IRI A;  1GXP A;  3I5U A;  3OOP A;  5ILV A;  1HBX G;  2KIU A;  4NQW A;  2H6B A;  2CGP A;  1KQ8 A;  1Z1D A;  2K4B A;  3RYR A;  2IPQ X;  2P8T A;  1H0M A;  3HOT A;  3IC7 A;  1G3S A;  3KZZ A;  2EJR A;  1C0W A;  2ADU A;  5ED4 A;  3RJP A;  4UVB A;  1L0O C;  3KLO A;  1JGS A;  2IVM A;  1G3Y A;  1BOA A;  1IAW A;  2VBY A;  3KP2 A;  4AIK A;  3ERE D;  2Z9O A;  4HX8 A;  2F5E A;  3D5L A;  3SFZ A;  4A12 A;  3IHU A;  3RI4 A;  4OIQ F;  4KMF A;  2QBY B;  2STT A;  4U0W A;  2DBB A;  1WWX A;  1IXC A;  4G6Q A;  2VBW A;  1OPC A;  2EFQ A;  3TOA A;  4L18 B;  3COA C;  2K7L A;  2OBP A;  1W4M A;  3ISP A;  3I59 A;  4OIN F;  3KP4 A;  1BC7 C;  5CLS A;  4ESF A;  2DT5 A;  4I7H A;  3EYI A;  2FML A;  1J59 A;  2L54 A;  4UV9 A;  2DPD A;  3HOS A;  3GFL A;  2QM3 A;  2O3F A;  1R36 A;  1UCR A;  3F8B A;  5BOX A;  2FBH A;  2FNP A;  4RGS A;  4LMY A;  1P92 A;  2UXN A;  3IL2 A;  3Q9S A;  4HF0 A;  2H6C A;  3ZMS A;  1R5H A;  4WX9 A;  4I0A A;  2L01 A;  1FSE A;  2HR3 A;  2LF8 A;  1XD7 A;  1LDD A;  4ON0 A;  1BJA A;  3I53 A;  4G7O F;  3QPT A;  3R60 A;  4L9J A;  2IRF G;  1D8J A;  3VOD A;  3K69 A;  5CVR A;  2VOO A;  1O3R A;  3J80 K;  2IA2 A;  2OA4 A;  4EMS A;  1R00 A;  2HS5 A;  1XSD A;  5LGU A;  4BYY A;  4JBA A;  1P4A A;  2PBI A;  1YW8 A;  2LDU A;  1XCV A;  3GO5 A;  2XRO A;  2M5W A;  3I0T A;  5IT9 Z;  1JXS A;  2MH9 A;  2QEN A;  3LWF A;  1NHA A;  5ICF A;  4IHT A;  1ZLJ A;  2QLZ A;  3MWM A;  1UB9 A;  4GYI A;  1T39 A;  2E7W A;  3GUD A;  4LB6 B;  2DQR A;  1FZP B;  3VFZ A;  2A6E F;  4GXO A;  1W5S A;  3REO A; 
#chains in the Genus database with same CATH topology
 3H9G A;  1IDZ A;  2DAO A;  3C1D A;  2L4M A;  2CV1 A;  3LA7 A;  4F92 B;  3KET A;  1AA7 A;  1O7L A;  3F3X A;  3HRS A;  2VE9 A;  1HC8 A;  4F55 A;  3CJR B;  4M74 A;  1LDJ A;  4ETS A;  4IO9 F;  2HI3 A;  5D5U B;  3V42 A;  2LOO A;  4UHT A;  3MN2 A;  3U1K A;  4IF4 A;  2F48 A;  1TW2 A;  3GLL A;  1CF7 A;  2XVC A;  2K9N A;  1RUO A;  1ON1 A;  2O6G E;  2GA2 A;  3BR1 A;  1MDM B;  2BHY A;  5F08 A;  4BE2 A;  4XNF A;  5IYD J;  1BI1 A;  1FP1 D;  1J9I A;  2MYS A;  2DA6 A;  3V7S A;  2A69 F;  5DYM A;  2AO9 A;  1QVT A;  2F5D A;  3BZ6 A;  2QWW A;  3BLY A;  5IPA A;  5FLX K;  1MMA A;  1WPK A;  1L3L A;  2ZNZ A;  2XF7 A;  4A3K J;  4P55 A;  4F3Q A;  4XLN F;  3CUQ C;  3BR3 A;  3HYI A;  1QU3 A;  2JMW A;  1JJ8 C;  4F93 B;  5FKM A;  2OJE D;  1MW7 A;  4EJU A;  1Z77 A;  3MKZ A;  3CJQ B;  4MIM A;  3SZT A;  3E6M A;  3L9F A;  4HRI A;  4EEF G;  3JRC A;  1VQ9 I;  4ZYH A;  3EDP A;  5DD4 A;  5LD2 C;  4LG0 A;  4ZDL A;  1X58 A;  1HW2 A;  3E5Q A;  4IHV A;  4ZYE A;  3HIF A;  2R7U A;  3KFW X;  2LBF B;  3F22 A;  4IZZ A;  4HV6 A;  4BXX J;  3I4N J;  3A1Y A;  1DU0 A;  1LEA A;  3H5R A;  5LHG A;  3TP3 A;  4DGW B;  3MZH A;  2A6T A;  3GF2 A;  1W0T A;  2HEO A;  4A6D A;  2H1L A;  5LBQ A;  3H1C A;  4HST A;  2FU4 A;  3S3N A;  5FB2 A;  3R4K A;  3E5X A;  5DEQ A;  3CCQ I;  4NDL A;  1PJR A;  3TW6 A;  3S2H J;  2ZME C;  3B6A A;  3O8G A;  2GIZ A;  4RBO A;  1SAX A;  2L7K A;  3OYC A;  1GV5 A;  1STZ A;  1FP2 A;  2O5R A;  2CFO A;  3D0S A;  2RVC A;  4A5N A;  3OV8 A;  3HSF A;  2DOD A;  5HS8 A;  2F4M B;  3QU6 A;  3DTK A;  1SD4 A;  2D45 A;  1K78 A;  4UUS B;  3E0J B;  2I10 A;  4ZZD A;  3K70 C;  2GQQ A;  3TMO A;  1ZG3 A;  3K4K A;  3DP7 A;  5L3F A;  3J7A O;  3CTA A;  1T38 A;  1G59 A;  2QZ8 A;  2X6X A;  2CV0 A;  4WCG A;  4D7M A;  4Y15 A;  4P1W A;  3RKQ A;  2HOE A;  3CF5 F;  4MNU A;  3LOC A;  4FT8 A;  3NQO A;  4LLL A;  1XB4 A;  2P5K A;  1VTN C;  2JJ7 A;  3GZN B;  4JX6 A;  2XAJ A;  4HQE A;  2LRD A;  3ZQG A;  3VOE A;  4DQ2 A;  1MSE C;  3LSG A;  1QZZ A;  5J1R A;  1OMI A;  2EZK A;  3V8K A;  2R4G A;  1LVK A;  4LIV A;  2K3P A;  1Y1W J;  5GAD J;  1X3U A;  3BJO A;  2JPC A;  4M71 A;  2IP2 A;  1NG7 A;  2KP6 A;  3BTI A;  1A6Q A;  5E3O A;  2V1D A;  2HKO A;  4I02 A;  2VKE A;  5D8K B;  4QSH A;  3FMR A;  2PJR A;  4XLE A;  4BHB A;  1FBS A;  2ZO4 A;  1FC3 A;  3WGG A;  5B3S H;  4O3M A;  4DJA A;  1APL C;  1OYW A;  2VKV A;  3LSK A;  5HDK A;  1TP4 A;  3T8R A;  1V5G A;  1OCT C;  2R7D A;  3I4P A;  2DYR H;  3MD2 A;  1X3W B;  1GVJ A;  2G7H A;  1T08 B;  4M72 A;  3QOE A;  1U5T C;  1ULY A;  4BU2 A;  1EH7 A;  1I50 J;  3LSH A;  3HPG A;  3BZK A;  2DFH A;  5A2Q K;  4R1H A;  1B9M A;  2FNA A;  2DA7 A;  2NAZ A;  2VN2 A;  5CJ9 A;  3CCV I;  1S7O A;  4KIB A;  1FIA A;  5D4R A;  2K86 A;  3AAF A;  1ZH5 A;  2OCE A;  2HPM A;  4RB1 A;  1ZK8 A;  4EQQ A;  4Z6Y A;  2EV5 A;  2QCO A;  3AL0 B;  2M0M A;  3UR3 C;  3HJE A;  2BYV E;  2M30 A;  3H0G J;  2STW A;  1MBK A;  1XG1 A;  5K5O A;  2R7X A;  3NAU A;  1TT5 B;  3HOX J;  3N4M A;  3S16 J;  2VJ5 A;  3E97 A;  3ASN H;  4FTH A;  3M7G A;  1YS7 A;  2Z1D A;  1QPM A;  1FOW A;  2Q0O A;  4GGG A;  4BY1 J;  1MBG A;  1YTY A;  1Z67 A;  3A2K A;  3D1N I;  2OZU A;  2XGX A;  5DCF A;  2QQB A;  4V2F A;  2OU2 A;  4Y13 A;  5HS7 A;  3PIP F;  2DA1 A;  3C7J A;  3KZY A;  1XDS A;  2BBY A;  3M07 A;  2A61 A;  4EJT A;  1D5V A;  2VIX A;  3CC7 I;  3CES A;  5J4Y A;  2V6E A;  3OSF A;  1OR7 C;  2M8E A;  4EJW A;  4CSW A;  4H0E A;  2E71 A;  2UXX A;  2PFB A;  3KP5 A;  1KU2 A;  3KE2 A;  3HPH A;  5ICG A;  4C2U A;  2CW7 A;  3OL4 A;  3CMY A;  4BHC A;  2ZFW A;  5LHI A;  4BBS J;  2PEX A;  3FM3 A;  2GIV A;  5FKO A;  4BH9 A;  3PSI A;  1H88 C;  3D5S C;  2EIN H;  1JTY A;  2CQX A;  3H9J A;  1LNW A;  2XRN A;  1LEB A;  1B72 B;  4PCQ A;  1O3S A;  1WJF A;  2K27 A;  2GWR A;  1S5L C;  3CMM A;  1JHH A;  1TC3 C;  1R7J A;  3OYD A;  4YFN F;  3DTE A;  2Y9Y A;  3MZY A;  4ZTF A;  2DMU A;  2GA1 A;  1IDY A;  3OR2 C;  2ESH A;  1LVA A;  1R23 A;  1ETX A;  1OLT A;  2B0L A;  2KIS A;  3MAJ A;  2RV8 A;  3OY9 A;  3FXR A;  1ERD A;  1X4O A;  1W1W E;  4MFE A;  2Y9Z A;  1BOB A;  3LMM A;  1SMY F;  3GLX A;  4XLA A;  1REP C;  2WTE A;  5IT9 K;  2K85 A;  2XF6 A;  3CLO A;  1E3O C;  1YX5 A;  4OIO F;  4UV8 A;  5AIP A;  4AVZ A;  2EB7 A;  5CVV A;  3BT9 A;  4QPQ A;  2DMP A;  2ZKZ A;  4XR6 A;  1FYK A;  3KIO A;  1ZG5 A;  4OU0 A;  1E2X A;  2W57 A;  4KFC A;  2YS9 A;  3ECO A;  5BPI A;  2A68 F;  1P7I A;  4MO7 A;  5TIS C;  3CUQ B;  1CGP A;  3E5U A;  1JHF A;  3CO7 C;  3DKY A;  4RAG A;  2EIJ H;  1D0Y A;  3M8J A;  4EGZ A;  2P6S A;  2DA3 A;  2HQ5 A;  3AG3 H;  2E2J J;  2LMD A;  4MQ9 F;  4CZC A;  4ENN A;  1ZQ3 P;  4X6A J;  3O3K A;  3QRF F;  1UEL B;  3HDD A;  3ZMV A;  3OMY A;  4FX4 A;  1QPI A;  1MBH A;  3KYL A;  2JRT A;  1IN7 A;  1BM9 A;  4UNO A;  4M6X A;  3PQJ A;  2G7U A;  1OQY A;  1PUF A;  1RKT A;  4XOP A;  3ZQQ A;  4B09 A;  4HW0 A;  3L7W A;  1BR1 A;  4RGU A;  2R7S A;  2Y0M A;  3BG5 A;  5C4X J;  5F6F A;  1IV8 A;  4I6Z A;  1ETQ A;  3K0L A;  3FWE A;  4QWQ A;  2WAQ N;  1QA6 A;  1YO5 C;  4CDG A;  4J19 A;  2RKH A;  2GZW A;  3K9T A;  3ZQ7 A;  3FM5 A;  5JR3 A;  5FRO A;  1UST A;  3S1M J;  3UKG A;  4C3H J;  5HLI A;  2VON A;  2KIQ A;  2MW8 A;  5H6Q A;  4LK0 F;  2OV7 A;  1Y0N A;  1YW7 A;  5HS9 A;  1XTA A;  1HW1 A;  1MJ9 A;  1RR8 C;  1KQ9 A;  3O2P E;  4W97 A;  4QLC U;  1G3T A;  4M6Y A;  1W7P B;  4YEL A;  3HG9 A;  4KNY A;  1R22 A;  2CJJ A;  3E6D A;  2GXG A;  3BOQ A;  3H9Q A;  3NEU A;  3OYL A;  3G4S I;  1IRG A;  2XGD A;  5F27 A;  4A3I J;  4CYC B;  2CW0 F;  1UZC A;  1HDD C;  2OAZ A;  1P4W A;  4XLP F;  4UXN A;  2LR8 A;  4RAZ A;  4A3J J;  2XKO A;  1R49 A;  4P9U A;  1DUX C;  2NOG A;  4JOM A;  3TED A;  2TDX A;  3GTJ J;  2HQA A;  4A3B J;  3L1P A;  2IXS A;  2D1V A;  1QZY A;  4XM3 A;  4G7H F;  3GFI A;  1FOY A;  5FD6 A;  1JKP C;  1KA8 A;  3DEE A;  3O8H A;  5F0H A;  4V2G A;  4DYQ A;  4UVA A;  1ZAR A;  4A3D J;  1FSH A;  2DMQ A;  4N9I A;  5EG0 B;  4XSX F;  3FIS A;  5F0C A;  2E1M C;  3QPH A;  5GP9 A;  3QPL A;  3RYP A;  3GFJ A;  3SDB A;  4BAC A;  3DBH B;  3RSN A;  2XAQ A;  4XK4 A;  4L0Z B;  3Q9V A;  3TDU C;  1A6I A;  4OAY A;  2XAF A;  1RZ4 A;  1SFK A;  3R0J A;  1I5Z A;  4F91 B;  4DBQ A;  5ILS A;  1K61 A;  1X19 A;  4GO1 A;  3FDY A;  2VJ4 A;  3K1P A;  1TT0 A;  1LQ1 A;  1BIB A;  1K4S A;  1OYI A;  2UUZ A;  4RB2 C;  5ILU A;  1X4P A;  5JHU A;  1T33 A;  3IAM 2;  3OL3 A;  2VKD A;  3S93 A;  9ANT A;  4XRS G;  1HKS A;  4NNJ A;  3K4C A;  3MVP A;  3EUH C;  3ROU A;  2GBY A;  2GM4 A;  1ON2 A;  4B44 A;  5D8L B;  1KU9 A;  1U5T B;  5FFZ A;  3JW4 A;  3RDI A;  1WH5 A;  2AHQ A;  3TP0 A;  4MTE A;  3OS1 A;  3WHC A;  5KNL A;  5E1X A;  3G1L A;  2HOT A;  4XRS A;  2ELH A;  5EGO B;  4ZDO A;  3ZQF A;  3BG7 A;  4B48 A;  1EH8 A;  5JLX A;  1YIO A;  1ENH A;  3O6B B;  4RB3 C;  3F8C A;  1XGO A;  3M8E A;  4AC0 A;  2BOL A;  4LLN A;  3DXJ F;  2G9W A;  1ZRC A;  3DF8 A;  3DBL B;  5FFX A;  1S72 I;  2VOD A;  4ENJ A;  3K2A A;  2VPL A;  4EGY A;  1J09 A;  1R1U A;  2R5Y A;  4QTR A;  3ABL H;  3RPU D;  2DYS H;  3L2Q A;  3SYT A;  1MH3 A;  1BW5 A;  2VBZ A;  3BP8 A;  3MKL A;  2Y48 A;  2ZB9 A;  1T56 A;  1W5T A;  4Z2Y A;  1KYW A;  1E17 A;  1D1C A;  3WTS C;  3CMA I;  4FIS A;  2QSF X;  1XDU A;  3M9A A;  1VI0 A;  4QPO A;  3BRO A;  3IH4 A;  1XGS A;  4HLY A;  2VL8 A;  2EQR A;  1D1B A;  3A01 A;  3ABK H;  3DPT A;  1MMD A;  4XRF A;  1SD5 A;  3B02 A;  3JSP A;  4RM3 A;  4IHX A;  1P6R A;  2HYG D;  3G1M A;  3KYD B;  1GDT A;  4IQJ A;  4I76 A;  3I4M J;  4IXA A;  1U0J A;  2Q2E B;  4XBF A;  2L7M P;  2PMZ A;  1ZAO A;  2E19 A;  1FWZ A;  4RMN A;  1J75 A;  4KYW A;  4PFO A;  4AUX A;  3FF5 A;  5M3M J;  2I8D A;  3G73 A;  1ETW A;  1GVD A;  5E1Z B;  3T0Y A;  2FE3 A;  3H92 A;  2BY3 A;  4OWR B;  2HXI A;  4IKF A;  1QGP A;  3IUO A;  2NRA C;  3GTK J;  3EET A;  2EK5 A;  2F2E A;  4PGG A;  1JUP A;  4JX5 A;  4XKV A;  5EZH A;  2MLG A;  2CSO A;  1NK2 P;  1UJ8 A;  3DPL C;  5LGN A;  1JTX A;  2DT6 A;  1FPQ A;  3S2D J;  3KEO A;  3PFI A;  1MDM A;  1LE8 B;  3RZO J;  1ZHF A;  2HU9 A;  1R1T A;  4NBQ A;  3DPU A;  3L2V A;  2HNH A;  4M9S A;  2M9H A;  3NAR A;  2MBF A;  5CKT A;  3CF2 A;  2JSC A;  1USS A;  2W25 A;  1KZH A;  4E4H A;  1FYM A;  3DV8 A;  4ZH4 F;  5JI6 A;  1SFE A;  1T98 A;  3CJN A;  3DU6 A;  3QYE A;  4YEJ A;  2V9P A;  4XOT A;  3I54 A;  5K5R A;  1ZR4 A;  4HDU A;  1G8X A;  3T5X A;  3S1Q J;  2FQ3 A;  2LRE A;  4KIF A;  1FTT A;  2X6Y A;  4NB5 A;  2XPW A;  4WXH A;  3VEP A;  3KP7 A;  5JVT A;  2MGQ A;  5K5Q A;  1RUN A;  2MA3 A;  2LKX A;  2OUM A;  2CW8 A;  1X2N A;  1T0F C;  1YRN A;  2OCC H;  2WY8 Q;  1I39 A;  5BPD A;  1A31 A;  1A36 A;  4LG3 A;  3M4O J;  2F5V A;  5AIQ A;  2E5Z A;  2BXY A;  2LBF A;  2DTR A;  2MSY A;  2OD5 A;  3FMS A;  3LA2 A;  4KT5 C;  2VQG A;  3I64 A;  4IRH A;  3SEQ A;  3WTT C;  2XAS A;  1IRZ A;  4Q47 A;  4M6V A;  2X1D A;  4EVI A;  3K1N A;  1JUS A;  4TV7 A;  2LD5 A;  2DDA A;  1BN5 A;  4Y33 A;  3S3M A;  3QU3 A;  5DUK A;  4IHS A;  3HUG B;  3ONQ A;  5LLQ A;  1FLI A;  2E1N A;  1EJ9 A;  4BQQ A;  4Y17 A;  2EFN A;  3RKX A;  4DYC A;  4ZYG A;  2QEX I;  5F64 A;  2KIM A;  4MHG A;  2NXN B;  1UHS A;  3TL4 X;  1Z0X A;  2DOF A;  4E7L A;  2AXT C;  3F23 A;  3JTG A;  2JSP A;  3KYC B;  3K1M A;  4U88 A;  2HGC A;  1TW3 A;  2OQG A;  2MAB A;  2OTL I;  3WOD F;  1Z21 A;  2X0L A;  3VSK A;  3CCM I;  2EV6 A;  2R92 J;  3JSO A;  2R7Z J;  4BNC A;  3I9V 2;  4LIT A;  3OYF A;  3OR1 C;  4LFU A;  2ELJ A;  2LVS A;  1ZGW A;  3F0C A;  3QP5 A;  5ERI A;  3ZGK A;  4BJ5 C;  2XV4 S;  4M3G A;  3FHZ A;  1O7F A;  3LFK A;  3P9K A;  5JVG F;  1AKH B;  3LAP A;  3DLA A;  1RNL A;  3BCB A;  1DPR A;  1XX5 A;  3ZR8 X;  1YW9 A;  3ABT A;  3E1S A;  4P96 A;  4UUV A;  2VC0 A;  2JPB A;  3GME A;  1TLH B;  3I55 I;  2X9D A;  1YFH A;  4UB8 C;  2MLK A;  3V8L A;  4BUP A;  2VBX A;  4KIS A;  3BWG A;  1WI3 A;  3CUO A;  5L3C A;  4HYE A;  3DCF A;  2B9S A;  3IWF A;  3H35 A;  2BVM A;  2PMU A;  3BY6 A;  3FX3 A;  5KCM A;  1XGM A;  2NNY A;  2FUG 2;  5D5X B;  5B1A H;  4E7I A;  3C2G A;  1IG7 A;  2DK8 A;  1U6G A;  2E1M B;  3SJM A;  2DFF A;  2JUC A;  2DA2 A;  4Q4Z F;  1W0U A;  2KQR A;  5L3D A;  4DNC A;  1A04 A;  1SVL A;  2DMN A;  2EZH A;  4DBR A;  1OCP A;  5LEJ A;  2EA4 A;  1YG2 A;  1RR7 A;  3R61 A;  5E20 A;  1FOX A;  2DJN A;  4BJ6 C;  5J8C A;  3JRF A;  2H27 A;  2K9L A;  4N9H A;  3KCC A;  1S7A A;  3KX2 A;  5B1B H;  4DYR A;  3JTH A;  3V8J A;  4O5V A;  4U0V A;  2BE5 F;  1B4A A;  2RQQ A;  3HXL A;  2VQL A;  1U8R A;  1OCC H;  1S7E A;  3IH3 A;  2IJL A;  4B8X A;  1QRY A;  1V5E A;  4C2T A;  2X6O A;  5IOY A;  5DCM A;  1KU3 A;  3WG9 A;  2M45 A;  3K4L A;  4CO8 A;  2V1U A;  4L5E A;  1SEU A;  3CP2 A;  2LTP A;  2HDD A;  1G3W A;  3ZN0 A;  3R0A A;  5F0F A;  3R6S A;  1ZRF A;  2R7T A;  3BPX A;  3I56 I;  2N8G A;  1WJ5 A;  3AG4 H;  4M3F A;  1BIA A;  1EH6 A;  1Z7L A;  1FIP A;  4AID A;  2R5Z B;  4L5J A;  2DLL A;  5HLG A;  4I0B A;  3KEY A;  3VYS B;  2O0Y A;  3S15 J;  5GAE J;  3KP6 A;  1F1Z A;  1IN6 A;  3W6K B;  3CCL I;  3GTG J;  2QGU A;  2DA4 A;  1IXS B;  1D1A A;  3AG1 H;  2FX0 A;  4N0B A;  3MKW B;  2HKX A;  4RAY A;  1RI7 A;  2TCT A;  4D5C A;  2F4O B;  5FRN A;  4BDY A;  2M0C A;  4PSX A;  4PJM A;  4OIP F;  3BR2 A;  4ZYA A;  3UNG C;  2VE8 A;  3TKY A;  1XN7 A;  4IHW A;  2HOA A;  2NYX A;  4HX7 A;  4RB0 A;  4E7K A;  1JKO C;  2QYO A;  2KDZ A;  2KRF A;  3GYH X;  3IH2 A;  3WE3 A;  2MC3 A;  3V7R A;  3PUF A;  3QOP A;  2P7V B;  2JRM A;  3ZQC A;  1ONV A;  2XDV A;  4PJJ A;  1MGT A;  4HBL A;  2V4J C;  3DQV C;  1F4K A;  3C18 A;  1ZKG A;  1V54 H;  4GFB A;  3SQN A;  3OYI A;  1K4T A;  1H8A C;  1D0Z A;  1X2M A;  3S32 A;  2ZJQ F;  1VQO I;  1BR2 A;  3QOD A;  3U21 A;  2O7O A;  3ULQ B;  1SFX A;  1BI2 A;  2UZK A;  1Z7U A;  3ZQH A;  2X1C A;  2EV0 A;  3CQZ J;  4CZZ A;  3VYT B;  2E34 A;  2IS6 A;  2Z3Y A;  1MBF A;  1YX3 A;  2EIL H;  2V6C A;  5HNF A;  1ZG1 A;  4MEY F;  1TQM A;  4S05 A;  2IGO A;  3QPS A;  3QQA A;  3GTO J;  5HOD A;  1PP7 U;  2NS7 A;  4KDP A;  3W6V A;  3HEF A;  3S3O A;  2XPU A;  5L3B A;  2GLO A;  3CDL A;  2EA2 A;  4XN3 A;  2A5W A;  2I5U A;  1OYY A;  1N25 A;  4HPQ A;  4CCN A;  1IUF A;  1Q1V A;  3JAM Z;  2DOE A;  1TTY A;  4WXD A;  3GEZ A;  1LDK B;  2FSW A;  2Q1Z B;  1ZRD A;  1JGG A;  4CCK A;  3WTW C;  3TQN A;  1CF7 B;  3FK6 A;  2K9S A;  5FO5 A;  3ASO H;  2EIK H;  1Y8Q B;  2V1N A;  4EJO A;  4G6D A;  2O61 A;  2PN6 A;  5EEA A;  2JK3 A;  2NVU B;  1R6R A;  1KQ0 A;  1J2X A;  3PNY A;  1T8I A;  3C2H A;  2QUF A;  2ZXH A;  4YRV A;  3RZD J;  1T2K A;  2XAG A;  1TNT A;  4FET A;  3EUA A;  2ZSI B;  2O8X A;  1EF4 A;  2F6C A;  5GAH J;  3TO7 A;  1IV6 A;  3WTZ A;  1F43 A;  4I99 C;  3FKI J;  4KMU X;  5EDN A;  1MBJ A;  2M2E A;  1MNE A;  3Q0U A;  2EWN A;  5J1Y A;  3GZ6 A;  1WSU A;  3PSF A;  5L3G A;  2PJP A;  4BQN A;  2JTV A;  2OF7 A;  5IP7 J;  3GBG A;  1V3F A;  3LSR A;  2L9V A;  2ZME A;  5B66 C;  4LG0 B;  2W85 A;  5HDN A;  2RNG A;  2WA0 A;  1RET A;  2ID3 A;  2LNB A;  2Y69 H;  1F9N A;  1YJ9 I;  2RGV A;  2AS5 F;  1VQK I;  1YJW I;  3ZMZ A;  3LAJ A;  2WBM A;  5D6E A;  3EYY A;  1E3P A;  1IN8 A;  1W7P A;  3M8F A;  1ZR2 A;  1I3Q J;  3CDI A;  1FBU A;  5D4S A;  4BE1 A;  3S8P A;  3CLQ A;  1DP3 A;  2HDW A;  5IP9 J;  2Q8K A;  1FEX A;  3CCJ I;  4S04 A;  5DUI A;  3PM1 A;  1BBY A;  2RRE A;  3KP3 A;  2VJJ A;  3K10 A;  3F21 A;  1WH7 A;  2HQR A;  3HHG A;  1O3Q A;  1LJ9 A;  2LKS A;  2MC4 A;  1B8I B;  2FRH A;  2H94 A;  2VT3 A;  3CCR I;  2Y0S N;  2HYF A;  3OS2 A;  4HZF A;  3HRT A;  3CDH A;  2ISZ A;  1I6H J;  4BXU A;  3ZOB A;  2LF7 A;  2HYJ A;  3DTI A;  4ZJZ A;  4CHU A;  1XMA A;  3ML6 A;  3FMQ A;  4B3X A;  2PMZ N;  3C3W A;  1UHW A;  1WZ2 A;  2OTJ I;  2A6H F;  3SZP A;  5FLV A;  1X3Z B;  2QKL B;  1WCM J;  2V26 A;  1HKQ A;  5HOO A;  1IGN A;  1TL8 A;  3GTQ J;  3WU2 C;  2EFW A;  1J0R A;  1X1P A;  1JT0 A;  2B63 J;  3M1E A;  1TZL A;  3DEW A;  1F36 A;  4XN0 A;  1R58 A;  3DWL E;  2VB6 A;  5ICC A;  2KT0 A;  1FBQ A;  2NS8 A;  2COM A;  1Y56 A;  2ZNY A;  3TO6 A;  1TWF J;  3ESW B;  2EFO A;  3L00 A;  1YLF A;  4M3B A;  1VQL I;  5BS6 A;  2KJB A;  3OIP A;  5KAI C;  5C44 J;  5LRS A;  1U5T A;  4V19 K;  2NVY J;  1UMQ A;  2KIF A;  3T1B A;  1IO2 A;  2PJR B;  1NH3 A;  3RCO A;  4CIC A;  4C3I J;  4M73 A;  3OSG A;  1ZEL A;  4WF2 A;  4EJV A;  3ZMU A;  1D3Y A;  5EGO A;  1SAN A;  3RKW A;  1VZ0 A;  4AU7 A;  3K4M A;  1TWG J;  2IGK A;  3HGG A;  4LLG F;  4YFX F;  4A3M J;  1QQI A;  4EAT A;  4II3 A;  1PVE A;  1WJE A;  4RM2 A;  3LSI A;  3MFK A;  2M87 A;  5GPC A;  4MLO A;  4BXF A;  4C3J J;  2MH2 A;  1P4X A;  2ME6 A;  4YIF A;  2QBY A;  2BGC A;  4BGD A;  2R7W A;  2K9Q A;  2FEZ A;  4D0P A;  2QQA A;  3HKZ N;  3W2W A;  1JKR C;  2ACJ A;  4G7Z F;  1BC8 C;  1Y39 A;  1SFU A;  3RKY A;  2YX4 A;  2EZL A;  4HV5 A;  3A0H C;  4L9N A;  5J4V A;  1I1S A;  2ELK A;  1HST A;  2IS2 A;  2L5Q A;  3F9K A;  3FXU A;  1BL0 A;  1F5T A;  4KA4 A;  2W00 A;  4HQM A;  3U1D A;  1UG0 A;  4U7D A;  3L09 A;  5F1R A;  4M9X A;  2L9N A;  3WTY C;  2BY0 A;  3BQZ A;  1OR7 A;  2PG4 A;  5LGT A;  3PFY A;  1JUM A;  3F6V A;  2PX9 A;  3OYH A;  1DDN A;  5EEH A;  3PNV A;  3SFI A;  1Y0U A;  4AYB A;  4RGR A;  4HF1 A;  2K02 A;  2ZCW A;  3SDG A;  4BL0 B;  2DI3 A;  4KIT B;  2CG4 A;  2IA0 A;  4F7Z A;  5F1J A;  2XB0 X;  5DTD A;  3BQY A;  1MZB A;  4HDV A;  3MEX A;  1GHC A;  3E6C C;  2ECB A;  5DDG A;  1R4N B;  5TJJ A;  1BJZ A;  2LKP A;  2L3D A;  1XGN A;  1BI0 A;  2BW3 B;  4A2U A;  1LE8 A;  3N97 A;  4LJZ F;  2FF4 A;  3Q5F A;  2WV0 A;  2DO7 A;  2ZXI A;  5DV5 A;  2L4A A;  4EM0 B;  2GOX B;  2XIG A;  4C9Y A;  2IT0 A;  2HDC A;  3IAS 2;  1KYZ A;  2QQ8 A;  3A4C A;  4OAZ A;  3ABM H;  2V9K A;  1OCO H;  4PGH A;  3U9G A;  5E8I A;  2QF7 A;  4R79 A;  4U7B A;  3RIR A;  1AWC A;  1YS6 A;  2XB5 A;  4CUG A;  2C6Y A;  3LNQ A;  1UFM A;  4DZJ A;  4E7H A;  1ETO A;  3DFG A;  3H5N A;  4YFK F;  3GTL J;  2CMP A;  5BMZ A;  3VYR B;  2CS3 A;  3HGY A;  1VQ5 I;  1VQP I;  2NNN A;  2EZI A;  4XSZ F;  3GX4 X;  4ZTJ A;  2CYY A;  1RRJ A;  1SVO A;  2E2I J;  2ZJP F;  2NOJ B;  3HTS B;  1B59 A;  2ESN A;  2KKO A;  4YG2 F;  5CVJ A;  3S14 J;  3FHN A;  4LK1 F;  1IJW C;  1QHG A;  2OQR A;  1IUY A;  1OJL A;  2E5N A;  2RDP A;  3V7C A;  2Y30 A;  2ECC A;  3FBN B;  4P9F A;  3K4N A;  3OS0 A;  3JRA A;  3HUG A;  2IS4 A;  3H3Z A;  3HSE A;  2ZXW H;  1WHU A;  1XCB A;  3ECH A;  1MBE A;  2BEO A;  2E36 A;  2BY1 A;  2A07 F;  1FYL A;  1D0X A;  1YOV B;  3LSP A;  1HDP A;  4G8X A;  1HCR A;  4HAM A;  2R7O A;  1J7K A;  4E7S A;  2D1H A;  5FGM A;  1U2W A;  1XSX A;  3JAM K;  2H1K A;  3FZV A;  5CQE A;  2JN6 A;  3OYG A;  1IN5 A;  1N75 A;  1SMT A;  4XKB A;  2VXZ A;  3C2B A;  2ZFU A;  1LKX A;  2DOA A;  1HXD A;  2UV1 A;  2BV6 A;  4EV0 A;  3IKT A;  1FNN A;  2CQK A;  2JA5 J;  1R71 A;  3QYB A;  5D5W B;  1QNT A;  2R7F A;  2XPV A;  4GRI A;  2DXI A;  1RES A;  3MKY B;  3PJR A;  2K40 A;  4M9Z A;  1IC8 A;  5IOZ A;  2F5F A;  3W6J B;  2LSO A;  2DN0 A;  4BHP A;  2P7C B;  4RAF A;  2KMU A;  2ETH A;  1SC7 A;  1UG2 A;  2IEK A;  1Z6R A;  5KK1 A;  2KJC A;  4BEH B;  2X1E A;  4B1R A;  1VF9 A;  3PIO F;  2J5O A;  1TNS A;  5HLT A;  4AVP A;  1W7P D;  2XUB A;  4G9Y A;  3NWS A;  2FA5 A;  3CCY A;  2FD5 A;  1ETV A;  1XMK A;  3TGN A;  4HNV A;  3F8F A;  3VPR A;  1P7J A;  4L9T A;  3A0B C;  4CCL A;  4IOA F;  3S1R J;  2Z99 A;  2QA4 I;  1S9H A;  1Y6I A;  4UY8 I;  1PDN C;  3L2W A;  3HOV J;  4PUS A;  4B47 A;  3SXY A;  3VDX A;  3JR9 A;  5J8F A;  3RTR A;  5CVU A;  5A2Q Z;  1LFP A;  2DCE A;  1Y8R B;  3GFM A;  2KHM A;  4XLF A;  4R8H A;  2WWY A;  2TRT A;  1K79 A;  3S17 J;  4KIC A;  4DOZ A;  3SZG A;  2HZD A;  4IJA A;  1VND A;  1T6S A;  4AIH A;  3HOY J;  1VQ7 I;  3Q0W A;  2DFI A;  3FXK A;  2JVH A;  4GYG A;  2D2W A;  1IRF A;  1GUU A;  2BHZ A;  4NQW B;  5M5X J;  2EPF A;  1ETK A;  2DU9 A;  2P4W A;  2ZJ2 A;  2P0W A;  3I58 A;  3ZRG A;  3OYN A;  2H8W A;  4Y7N J;  3EUH A;  4B4C A;  2BZT A;  4CH7 A;  5DM6 F;  2XKP A;  5BNG A;  1TBX A;  4LGW A;  4ZYD A;  4HOB A;  2RC4 A;  3BCA A;  4FCY A;  3P9I A;  3J81 Z;  5E3L A;  3IWZ A;  2CUZ A;  4IRG A;  1U78 A;  3KEQ A;  3RQI A;  4QIW N;  3H0D A;  1JE8 A;  1YYV A;  5CYV A;  5K1Y A;  3DKW A;  3K7A J;  2M1B A;  1M1E B;  2FOW A;  1XC5 A;  2WV1 A;  1MND A;  5IT3 A;  2A5Y B;  1MKM A;  1ZTR A;  4XID A;  4A3E J;  1R4M B;  1HOM A;  2XHK A;  1PUE E;  2WAQ A;  1ITY A;  4BBR J;  5JHF A;  1MMN A;  2V1X A;  5D6F A;  3WU0 A;  2XAH A;  5HNH A;  3J7Y J;  3EPZ A;  2EIM H;  1YIJ I;  3OYM A;  3I3L A;  2K3F A;  3MMY B;  4CXF A;  1SD6 A;  1U9N A;  2JZY A;  3OIO A;  5E1W A;  2FBK A;  3T8T A;  5J6X A;  3WTU C;  3SHF A;  2W24 A;  3V4G A;  2R93 J;  4UUS A;  2HVR A;  4E6K G;  1WRJ A;  1G4D A;  1E0E A;  2HZT A;  4BY7 J;  5E18 F;  4D9J A;  5FKK A;  1YQA A;  2JA2 A;  1R1V A;  2V7F A;  3M1C A;  2DA5 A;  4IVN A;  4BE0 A;  4NHJ A;  3ELK A;  3TBI A;  4PZJ A;  2YSR A;  1WJB A;  2GXB A;  1IF1 A;  4CGZ A;  4IPA A;  2W48 A;  1HW5 A;  2KRC A;  1WI9 A;  2E2H J;  4AD9 A;  3HRM A;  3GXO A;  3VB2 A;  2X51 A;  5KHD A;  3HHH A;  4Q48 A;  5M3F J;  3I71 A;  4IOC F;  2J5P A;  5DD8 A;  1VQ4 I;  1YJN I;  3P7N A;  5LHH A;  1GV2 A;  1LFB A;  2ZXJ A;  2CH0 A;  5JFR A;  3I59 B;  1Z6T A;  3WGH A;  3OOU A;  2A3S A;  4HSR A;  1D8K A;  2X4H A;  3TOB A;  2CQ7 A;  3OIQ A;  4FE4 A;  1S29 A;  2WC2 A;  3Q3S A;  5H20 A;  3ZMT A;  4DIQ A;  1H89 C;  2DTZ A;  4U0Y A;  2L2O A;  3VYU B;  4UB6 C;  5FD5 A;  2XF5 A;  4GCV A;  4D5F A;  1TWA J;  3GTP J;  6PAX A;  1ZLK A;  1SD7 A;  5AON A;  1YI2 I;  4EM2 A;  3G2B A;  2QVO A;  4N4N B;  4O6J A;  2IAI A;  2KLO A;  2BVL A;  3J7Z I;  4JX4 A;  3IRQ A;  3PUB A;  4KIG A;  1R9T J;  4M3D A;  4KUM A;  1V55 H;  5EJC A;  3HSR A;  5DS9 A;  4MGR A;  3Q0V A;  1Z3Y A;  1HQC A;  2BXZ A;  3CC4 I;  2L02 A;  4RLQ A;  4G6T B;  3GW2 A;  4ABZ A;  2G0E A;  2VXD A;  5LFA A;  3GCM A;  3LST A;  3ZN1 A;  2IW5 A;  2RNJ A;  2R7Q A;  5BQT A;  2YR2 A;  3MCZ A;  1S6L A;  2A05 A;  5KAF C;  3AG2 H;  3BG6 A;  2XSD C;  1T0F A;  2GXA A;  4EM1 A;  2O8K A;  2LYC A;  2YPR A;  3W2V A;  5FRM A;  2Z33 A;  1FTZ A;  2W84 A;  2R7R A;  2AQE A;  2MFZ A;  2JT1 A;  3B73 A;  3CME I;  3ZQL A;  2JWT A;  3GZ5 A;  4KT6 A;  4JYK A;  2KZV A;  2HTJ A;  3WE2 A;  5CVI A;  1S3J A;  1B9N A;  5CQG A;  4NC8 A;  3DU5 A;  2KL4 A;  3HC7 A;  4L9V A;  4BAY A;  5FJ8 J;  2IGN A;  4RA2 A;  1HLV A;  1YRN B;  2IA1 A;  2BY2 A;  4D7N A;  3L2U A;  1KON A;  1S8N A;  1FOK A;  4L5I A;  4A69 C;  4FHT A;  5FLM J;  3H3U A;  1K6Y A;  4WWC A;  4HA8 A;  4B43 A;  4WK8 F;  2ICW G;  1OCR H;  4ZC3 A;  3WTV C;  4RGX A;  2JQ7 A;  1BR4 A;  1J5Y A;  1P2F A;  2ZC2 A;  4ZZL A;  4BQA A;  4L0Y B;  1HKT A;  3G3Z A;  3JRB A;  4E7Z A;  4IX7 A;  1I3A A;  4ENM A;  4NC6 A;  1ZYR F;  4XMY A;  2HXO A;  3J7A Y;  4Q5S F;  1TQI A;  2HTS A;  3BG9 A;  2M8G X;  3FKJ A;  2DK5 A;  1FT9 A;  4J00 A;  4ZDP A;  1VFC A;  1QO0 D;  2DQL A;  3NRV A;  2P6T A;  1SFO J;  1IRX A;  3F8N A;  3BR5 A;  1B8I A;  2MG4 A;  3W3C A;  1AOY A;  2FBI A;  3U2R A;  4BDZ A;  3GVA A;  1B72 A;  1QBJ A;  4A0Z A;  1KGS A;  3AKZ A;  1BW6 A;  3KPH A;  3A03 A;  2LG4 A;  2H09 A;  2YUS A;  4ASN A;  1VQN I;  5J40 A;  3HBL A;  4K2E A;  1ZGJ A;  1B6A A;  4FAS D;  1Z3X A;  2VKH A;  1WQ2 A;  2M4K A;  4AYB N;  5C4J J;  2P5V A;  1VQM I;  1CQT A;  5GPA A;  4KN7 X;  4LOC A;  1EV7 A;  3OYA A;  4BJT A;  1MD0 A;  2FXA A;  3E6B A;  1KU7 A;  4AWX B;  3S1N J;  2M34 A;  3FXL A;  2O03 A;  2OC6 A;  1OCZ H;  4XKC A;  3CJT B;  4XL9 A;  2VOP A;  3DEU A;  2RQP A;  2IBD A;  2W82 A;  3AFH A;  2JUG A;  4HF2 A;  4RS8 A;  2IGM A;  2LH9 A;  1MJA A;  1I6X A;  4HX4 A;  3VWB A;  2FMY A;  1XSV A;  3CUQ A;  2E1C A;  4HEA 2;  2WY7 Q;  2HQN A;  2K5C A;  4JK1 X;  2DW4 A;  5E3N A;  4I2O A;  2OZ6 A;  4XQF A;  3OYJ A;  2XGC A;  4C2M J;  1MJB A;  2WB1 A;  1ZRE A;  2JVG A;  3KLN A;  4A6E A;  4PJL A;  2QQ9 A;  4LB5 A;  3LQQ A;  4NC7 A;  2Z5U A;  4G94 A;  2PLY A;  4E70 A;  1N77 A;  4IL6 C;  3ZPL A;  3FXM A;  3QYF A;  2P81 A;  1P9Q C;  5LRR A;  2VQC A;  3TO9 A;  4ESB A;  4RLF A;  2O9L A;  3H36 A;  1ZN2 A;  3QAH A;  2X6W A;  4CYD A;  3OYK A;  3HL2 A;  3P9C A;  2Y75 A;  3EUK L;  4OIR F;  2Y2Z A;  2VQH A;  4A0X A;  3LSJ A;  4FX0 A;  4B3A A;  1RPW A;  5LEK A;  3LQR A;  3LFU A;  3BPV A;  2LC2 A;  3CD6 I;  1HSJ A;  2V79 A;  5DCM B;  2PI0 A;  3RPU A;  4P5O A;  2R0Q C;  1B1B A;  2QSH X;  5D5V B;  1O4X A;  2R3S A;  3JCU C;  3WU1 B;  1H9T A;  1TQP A;  2M7A A;  1MMG A;  2IS1 A;  2CFX A;  1Q1H A;  5K7F A;  4CYC A;  1V5F A;  1U3E M;  5TRD A;  1EA3 A;  2QSG X;  3ZP5 A;  1ACI A;  4DZP A;  1K7A A;  2NVT J;  3IV5 A;  5KVR A;  1PP8 F;  2QKM B;  1AHD P;  1G6N A;  1Z05 A;  4ANJ A;  1RKW A;  2LFB A;  4GDF A;  1DPU A;  3JRD A;  4HNU A;  3BG3 A;  3F72 A;  4BS9 A;  5E8G A;  3BJA A;  5K7H A;  1I27 A;  2MD5 A;  4U87 A;  3J81 K;  2P5L C;  3A02 A;  1FY7 A;  2VC1 A;  4MEX F;  2CWE A;  1BA5 A;  2RAE A;  2KZG A;  3PQK A;  1GXQ A;  5E79 C;  3HRU A;  4WXC A;  3L2R A;  2E35 A;  1K78 B;  2LP0 A;  5GTI C;  5IY5 H;  2ISY A;  1XMX A;  2BW3 A;  5EG0 A;  4X0G A;  3QP6 A;  1G2H A;  3DKX A;  2GAU A;  5HLH A;  5FKN A;  4NUB A;  2VUM J;  3VSL A;  2R7V A;  2WAE A;  3HTU A;  2COB A;  3N05 A;  1H9G A;  1PYV A;  3FXQ A;  3GWZ A;  4XKW A;  2B7E A;  3WHB A;  4CA0 A;  2DPU A;  3CO6 C;  4HLX A;  1ZGA A;  4A0Y A;  2L0K A;  5TGT A;  5HVQ C;  2NS0 A;  4PK4 A;  2CUF A;  2VAS A;  2FOK A;  1OFC X;  1QZE A;  4FQG A;  4PFP A;  4OMZ A;  1MH4 A;  1D5Y A;  2DJI A;  5L3E A;  3CCU I;  5IP6 A;  4XRM A;  4UUT A;  5E17 F;  2W7N A;  2LY1 A;  1FX7 A;  3F8M A;  3J80 Z;  3MQ0 A;  3K4B A;  4OMY A;  1JI8 A;  3K2Z A;  1UHM A;  4H4K C;  1RIO H;  1IXR C;  1O57 A;  3ZMD A;  3LSM A;  4XLC A;  2V9V A;  2WAF A;  3WGI A;  4MQV A;  2VLA A;  3RPQ A;  4ENK A;  1XPX A;  5M5Y J;  4OOI A;  3L2C A;  3DBR B;  1Y1V J;  3GTM J;  1WFX A;  3H3V K;  4YII A;  3WTX C;  3OWT A;  5HDG A;  2L9S A;  1I1G A;  2UWM A;  3M3Y J;  2CQQ A;  4F52 A;  3TDZ C;  2D5V A;  2XSJ C;  4IHY A;  3EQL F;  5H6R A;  2HOS A;  4KJZ A;  3HOU J;  1TWC J;  5M5W J;  4G12 A;  3FBI B;  2DDB A;  5ICE A;  2LK2 A;  4N4O B;  3CCS I;  2F5C A;  4PJ0 C;  5GTH C;  3BZC A;  3TW7 A;  5B5E C;  1TWH J;  2VT2 A;  5F04 A;  5EEG A;  1W36 D;  4A5M A;  3PO2 J;  1MMS A;  2X85 A;  4II2 A;  4I98 B;  2LY2 A;  1Z9C A;  1K6O A;  3JRI A;  2HFH A;  2CV2 A;  4RDU A;  4JP0 A;  3B6C A;  5K7Z A;  3BJ6 A;  1O3T A;  2ZJR F;  4JQF A;  4CCO A;  2XAU A;  2XC7 A;  4AIJ A;  3IRR A;  1V4R A;  1DU6 A;  3IKV A;  1OKR A;  4FE7 A;  5J3L A;  3BDD A;  2Q2E A;  4I09 A;  2ZME B;  1A35 A;  2AXL A;  2RN7 A;  3E3V A;  1IZ1 A;  4A93 J;  1WKM A;  4BEH A;  2ZBK A;  2F4I A;  1JT6 A;  1WJA A;  3ABU A;  2HWV A;  3D5R C;  3NWT A;  1JKQ C;  2KFD A;  1Z91 A;  3FXO A;  1ODD A;  2AQF A;  4LD5 A;  3S2W A;  3K4J A;  2E60 A;  2CO5 A;  4ESJ A;  2K4J A;  2GOM A;  4PSW A;  5FLX Z;  1OIS A;  4MTD A;  1BI3 A;  2YU3 A;  1IN4 A;  5IYC J;  2Y31 A;  3LL7 A;  4E7J A;  3CC2 I;  1LFU P;  1R5G A;  2E7X A;  1MNM C;  4PDK A;  1LB2 A;  2KPM A;  2YX7 A;  3HOZ J;  4I01 A;  3LA3 A;  1E3H A;  2PMH A;  3F6O A;  3RQ4 A;  3OYE A;  2KDO A;  1IW7 F;  3ZXS A;  1QHH D;  3X2Q H;  3JRE A;  2EFP A;  3BR6 A;  4KN4 X;  1DP7 P;  2LLK A;  2M3A A;  4ITV A;  2PQ8 A;  3OYB A;  4UVC A;  4IRI A;  2WAD A;  1T95 A;  3ZCO A;  1HA8 A;  1GXP A;  3I5U A;  3OOP A;  2ID6 A;  2L7Z A;  5ILV A;  3HOW J;  4CCM A;  1HBX G;  2KIU A;  4NQW A;  2ME0 A;  1K83 J;  2K9M A;  2H6B A;  2CGP A;  1HF0 A;  1KQ8 A;  1Z1D A;  2K4B A;  3RYR A;  2IPQ X;  1QVU A;  2P8T A;  2M7B A;  2MD0 A;  1H0M A;  2Z2S B;  3HOT A;  3IC7 A;  1G3S A;  3JRH A;  3E7L A;  3P5J A;  3KZZ A;  5DM7 F;  5EF6 A;  1LPQ A;  3BTL A;  2EJR A;  2CUE A;  4PJN A;  1C0W A;  2ADU A;  5ED4 A;  2XRL A;  2EBI A;  1SVM A;  1UAA A;  3RJP A;  2E1O A;  4UVB A;  5J1U A;  3HZJ A;  1L0O C;  3KLO A;  1JGS A;  1DGR M;  1EKE A;  3IP4 B;  2IVM A;  5EYR A;  1G3Y A;  1BOA A;  1FMW A;  4Y4R A;  5C3E J;  2FJ1 A;  1IAW A;  2VBY A;  1YIT I;  2W1O A;  2YU9 J;  5J47 A;  2KRH A;  3KP2 A;  1VQ6 I;  3G71 I;  4AIK A;  3HM5 A;  3ERE D;  4A3G J;  1X1D A;  2Z9O A;  3MZ8 A;  1WVR A;  4MFD A;  4BQO A;  3CCE I;  4HX8 A;  1PUF B;  4LIU A;  3WG7 H;  2F5E A;  1W5C C;  3D5L A;  1RC9 A;  3SFZ A;  1DQU A;  4A12 A;  1FMV A;  3KZI C;  3IHU A;  3RI4 A;  4OIQ F;  4KMF A;  4DW6 A;  2QBY B;  1MIJ A;  1X1C A;  1ORK A;  2STT A;  1WJC A;  4U0W A;  4A3L J;  1X1A A;  3BTC A;  2DBB A;  1A5J A;  1WWX A;  5IYB J;  1AKH A;  1IXC A;  4X1E A;  4G6Q A;  2VBW A;  1OPC A;  2VPR A;  2EFQ A;  1NTC A;  3PL8 A;  3TOA A;  4L18 B;  2OPT A;  2W4S A;  5FKL A;  2JA7 J;  3COA C;  2K7L A;  2OBP A;  2DFE A;  2Y0S A;  1W4M A;  4D1Q A;  1U8B A;  3ISP A;  3JRG A;  2X48 A;  3I59 A;  4OIN F;  3KP4 A;  1BC7 C;  2CUJ A;  4CCJ A;  3FXJ A;  5CLS A;  2L9R A;  4ESF A;  4XLH A;  2DT7 B;  2M4G A;  3K70 D;  2EH3 A;  2DT5 A;  1GT0 C;  4I7H A;  1DGW Y;  1X1B A;  3EYI A;  2HVS A;  1R5I D;  4A3F J;  1JJ6 C;  4C30 A;  2FML A;  2CQN A;  1J59 A;  2L54 A;  3SEZ A;  4Y3O A;  3DLL F;  4UV9 A;  2DPD A;  3HOS A;  4A3C J;  3GFL A;  2QM3 A;  4XIC A;  2JA6 J;  3FIW A;  2O3F A;  1R36 A;  1UCR A;  3ERM A;  3F8B A;  5BOX A;  2FBH A;  2FNP A;  4RGS A;  1SAU A;  4LMY A;  1P92 A;  2UXN A;  3IL2 A;  3Q9S A;  4HF0 A;  2H6C A;  4IQ4 A;  3ZMS A;  1FJL A;  2HVQ A;  5GAG J;  3CZ6 A;  5JLW A;  1R5H A;  5EZG A;  4HG2 A;  2FQ4 A;  4WX9 A;  3H5A A;  4I0A A;  1GLN A;  2JA8 J;  2LY9 A;  5H2F C;  2CU7 A;  1N78 A;  2L01 A;  1FSE A;  2HR3 A;  2WB1 N;  2R5Z A;  3PO3 J;  3K6G A;  1WJD A;  2LF8 A;  1XD7 A;  1LDD A;  3CP8 A;  4ON0 A;  3W2A A;  3HB9 A;  2NVQ J;  1BJA A;  3I53 A;  3G6E I;  2HPI A;  5E3M A;  4G7O F;  2XGE A;  3QPT A;  3R60 A;  4L9J A;  2IRF G;  1D8J A;  3VOD A;  1YE9 A;  4HNT A;  1W36 C;  3K69 A;  3HKZ A;  5CVR A;  1YHQ I;  2VOO A;  4W1U A;  3AL0 C;  4M3E A;  4AM3 A;  4YIR X;  1O3R A;  1VQ8 I;  3PNT A;  1LUJ B;  4XOR A;  2L7F P;  3J80 K;  2IA2 A;  2OA4 A;  4EMS A;  1R00 A;  1POG A;  5CPR B;  2HS5 A;  1XSD A;  4Y52 J;  5LGU A;  4J01 A;  4IEJ A;  3ZQI A;  4BYY A;  2CRG A;  4JBA A;  4XON A;  1P4A A;  4BKX A;  2PBI A;  1MSF C;  1NK3 P;  2VJI A;  1AU7 A;  3G1O A;  2NVX J;  1YW8 A;  2VI6 A;  3BC8 A;  2LDU A;  2R5Y B;  1XCV A;  4S0H B;  3GO5 A;  2XRO A;  2M5W A;  3BTJ A;  3I0T A;  1XS9 A;  5IT9 Z;  3FK7 A;  1JXS A;  1U9O A;  2MH9 A;  2QEN A;  3LWF A;  1NHA A;  2DMT A;  5ICF A;  2ZSH B;  3BR0 A;  1ETY A;  1ZLJ A;  4IHT A;  2QLZ A;  3MWM A;  1UB9 A;  4GYI A;  3A01 B;  1T39 A;  2E7W A;  3GUD A;  4LB6 B;  1NG6 A;  2Z16 A;  2DQR A;  1FZP B;  3VFZ A;  2A6E F;  3QWL A;  4GXO A;  2H8R A;  1W5S A;  3REO A;  1WGX A; 
#chains in the Genus database with same CATH homology
 2DAO A;  3C1D A;  2L4M A;  3LA7 A;  3KET A;  1O7L A;  3F3X A;  3HRS A;  2VE9 A;  4M74 A;  1LDJ A;  4ETS A;  5D5U B;  4UHT A;  4IF4 A;  1TW2 A;  1CF7 A;  2XVC A;  1RUO A;  1ON1 A;  2O6G E;  2GA2 A;  1MDM B;  1BI1 A;  1FP1 D;  1J9I A;  3V7S A;  2A69 F;  5DYM A;  2F5D A;  3BZ6 A;  2QWW A;  5FLX K;  1L3L A;  2ZNZ A;  4P55 A;  4XLN F;  3CUQ C;  3HYI A;  4EJU A;  3SZT A;  3E6M A;  3L9F A;  4ZYH A;  3EDP A;  5DD4 A;  4LG0 A;  1HW2 A;  3E5Q A;  4ZYE A;  3HIF A;  3KFW X;  3F22 A;  4HV6 A;  1LEA A;  5LHG A;  3MZH A;  3GF2 A;  2HEO A;  4A6D A;  5LBQ A;  2FU4 A;  5FB2 A;  3R4K A;  3E5X A;  5DEQ A;  1SAX A;  1STZ A;  1FP2 A;  3D0S A;  2RVC A;  4A5N A;  3OV8 A;  3HSF A;  5HS8 A;  3QU6 A;  1SD4 A;  2D45 A;  1K78 A;  4ZZD A;  2GQQ A;  1ZG3 A;  3DP7 A;  5L3F A;  3J7A O;  3CTA A;  1T38 A;  2QZ8 A;  4WCG A;  4Y15 A;  2HOE A;  4MNU A;  4FT8 A;  3NQO A;  4LLL A;  1XB4 A;  2P5K A;  1VTN C;  2XAJ A;  4HQE A;  3VOE A;  4DQ2 A;  1QZZ A;  1OMI A;  3V8K A;  1X3U A;  3BJO A;  2JPC A;  4M71 A;  2IP2 A;  2V1D A;  2HKO A;  4I02 A;  5D8K B;  3FMR A;  4BHB A;  1FBS A;  2ZO4 A;  1FC3 A;  3WGG A;  4O3M A;  1OYW A;  5HDK A;  3T8R A;  2R7D A;  3I4P A;  1GVJ A;  2G7H A;  4M72 A;  1U5T C;  1ULY A;  1EH7 A;  5A2Q K;  4R1H A;  1B9M A;  2FNA A;  2NAZ A;  5CJ9 A;  2VN2 A;  1S7O A;  4KIB A;  5D4R A;  2K86 A;  3AAF A;  1ZH5 A;  4RB1 A;  4EQQ A;  2EV5 A;  2BYV E;  2M30 A;  2STW A;  5K5O A;  3N4M A;  3E97 A;  3M7G A;  1YS7 A;  1QPM A;  2Q0O A;  4GGG A;  1YTY A;  2OZU A;  2XGX A;  5DCF A;  2QQB A;  2OU2 A;  4Y13 A;  5HS7 A;  3C7J A;  3KZY A;  1XDS A;  2BBY A;  2A61 A;  4EJT A;  1D5V A;  4EJW A;  2M8E A;  4H0E A;  2UXX A;  2PFB A;  3KP5 A;  1KU2 A;  3KE2 A;  5ICG A;  4BHC A;  2ZFW A;  5LHI A;  2PEX A;  3FM3 A;  2GIV A;  4BH9 A;  1LNW A;  2XRN A;  1LEB A;  4PCQ A;  1O3S A;  2K27 A;  2GWR A;  1JHH A;  1R7J A;  4YFN F;  3MZY A;  2GA1 A;  2ESH A;  1LVA A;  1R23 A;  2B0L A;  3MAJ A;  2RV8 A;  3FXR A;  1SMY F;  3GLX A;  1REP C;  2WTE A;  5IT9 K;  3CLO A;  4OIO F;  4UV8 A;  5AIP A;  2EB7 A;  5CVV A;  2ZKZ A;  1FYK A;  1ZG5 A;  4OU0 A;  1E2X A;  2W57 A;  4KFC A;  3ECO A;  5BPI A;  2A68 F;  1CGP A;  3CUQ B;  3E5U A;  1JHF A;  3CO7 C;  4EGZ A;  2P6S A;  4MQ9 F;  4ENN A;  3O3K A;  3QRF F;  3ZMV A;  4FX4 A;  2JRT A;  1IN7 A;  1BM9 A;  4UNO A;  4M6X A;  3PQJ A;  2G7U A;  4B09 A;  4HW0 A;  3L7W A;  4RGU A;  2Y0M A;  5F6F A;  3K0L A;  3FWE A;  4QWQ A;  1YO5 C;  4CDG A;  2RKH A;  2GZW A;  3K9T A;  3ZQ7 A;  3FM5 A;  5JR3 A;  1UST A;  5HLI A;  2VON A;  5H6Q A;  4LK0 F;  1YW7 A;  5HS9 A;  1HW1 A;  1MJ9 A;  1KQ9 A;  3O2P E;  4QLC U;  1G3T A;  4M6Y A;  1W7P B;  4KNY A;  1R22 A;  3E6D A;  2GXG A;  3BOQ A;  3NEU A;  1IRG A;  2CW0 F;  2OAZ A;  1P4W A;  4XLP F;  4UXN A;  4RAZ A;  2XKO A;  1DUX C;  4P9U A;  2TDX A;  2D1V A;  1QZY A;  4G7H F;  3GFI A;  5FD6 A;  1KA8 A;  4UVA A;  1ZAR A;  1FSH A;  4N9I A;  4XSX F;  3QPH A;  3RYP A;  3GFJ A;  2XAQ A;  4L0Z B;  3Q9V A;  3TDU C;  2XAF A;  1RZ4 A;  3R0J A;  1I5Z A;  5ILS A;  4GO1 A;  3K1P A;  1LQ1 A;  1BIB A;  1OYI A;  4RB2 C;  5ILU A;  5JHU A;  1HKS A;  3ROU A;  1ON2 A;  5D8L B;  1KU9 A;  1U5T B;  5FFZ A;  3JW4 A;  3RDI A;  4MTE A;  5E1X A;  2ELH A;  1EH8 A;  1YIO A;  3O6B B;  4RB3 C;  3F8C A;  1XGO A;  3M8E A;  4LLN A;  3DXJ F;  2G9W A;  1ZRC A;  3DF8 A;  5FFX A;  2VOD A;  4ENJ A;  4EGY A;  1R1U A;  2VBZ A;  3BP8 A;  2Y48 A;  1W5T A;  4Z2Y A;  1KYW A;  1E17 A;  3WTS C;  1XDU A;  3M9A A;  3BRO A;  1XGS A;  4HLY A;  3DPT A;  4XRF A;  1SD5 A;  3B02 A;  3JSP A;  1P6R A;  2HYG D;  4IXA A;  4XBF A;  1ZAO A;  1FWZ A;  1J75 A;  4KYW A;  3FF5 A;  3G73 A;  5E1Z B;  3T0Y A;  2FE3 A;  3H92 A;  1QGP A;  2NRA C;  3EET A;  2EK5 A;  2F2E A;  4PGG A;  2MLG A;  2CSO A;  3DPL C;  5LGN A;  1FPQ A;  3KEO A;  3PFI A;  1MDM A;  1ZHF A;  1R1T A;  4M9S A;  2MBF A;  2JSC A;  1USS A;  2W25 A;  1FYM A;  3DV8 A;  4ZH4 F;  5JI6 A;  1SFE A;  1T98 A;  3CJN A;  3I54 A;  5K5R A;  4HDU A;  3T5X A;  2FQ3 A;  4KIF A;  4NB5 A;  4WXH A;  3VEP A;  3KP7 A;  5JVT A;  5K5Q A;  1RUN A;  2MA3 A;  5BPD A;  5AIQ A;  2DTR A;  2OD5 A;  3FMS A;  3LA2 A;  4KT5 C;  3I64 A;  4IRH A;  3WTT C;  2XAS A;  4Q47 A;  4EVI A;  3K1N A;  4TV7 A;  1BN5 A;  3QU3 A;  5DUK A;  4IHS A;  5LLQ A;  1FLI A;  2E1N A;  4Y17 A;  2EFN A;  3RKX A;  4ZYG A;  5F64 A;  2KIM A;  4MHG A;  3F23 A;  3JTG A;  3K1M A;  4U88 A;  2HGC A;  1TW3 A;  2OQG A;  3WOD F;  2X0L A;  2EV6 A;  3JSO A;  4BNC A;  4LFU A;  3QP5 A;  5ERI A;  2XV4 S;  3FHZ A;  1O7F A;  3LFK A;  3P9K A;  3LAP A;  1RNL A;  1DPR A;  1YW9 A;  3ABT A;  4P96 A;  4UUV A;  2VC0 A;  2JPB A;  1TLH B;  1YFH A;  2MLK A;  3V8L A;  2VBX A;  3BWG A;  3CUO A;  5L3C A;  4HYE A;  3IWF A;  3BY6 A;  2PMU A;  3FX3 A;  1XGM A;  2NNY A;  5D5X B;  2DK8 A;  1U6G A;  4Q4Z F;  5L3D A;  4DNC A;  1A04 A;  5LEJ A;  2EA4 A;  1YG2 A;  3R61 A;  5E20 A;  5J8C A;  2H27 A;  4N9H A;  3KCC A;  1S7A A;  3JTH A;  3V8J A;  4O5V A;  4U0V A;  2BE5 F;  1B4A A;  1U8R A;  2IJL A;  4B8X A;  5DCM A;  1KU3 A;  3WG9 A;  2M45 A;  4CO8 A;  2V1U A;  1G3W A;  3ZN0 A;  3R0A A;  3R6S A;  1ZRF A;  3BPX A;  1BIA A;  1EH6 A;  4L5J A;  2DLL A;  5HLG A;  4I0B A;  2O0Y A;  3KP6 A;  1F1Z A;  1IN6 A;  3W6K B;  1IXS B;  4N0B A;  2HKX A;  4RAY A;  1RI7 A;  4OIP F;  2VE8 A;  3TKY A;  1XN7 A;  2NYX A;  4HX7 A;  4RB0 A;  2QYO A;  3GYH X;  2KRF A;  3WE3 A;  2MC3 A;  3V7R A;  3QOP A;  2P7V B;  1ONV A;  1MGT A;  4HBL A;  3DQV C;  1F4K A;  3C18 A;  3SQN A;  3ULQ B;  1SFX A;  1BI2 A;  2UZK A;  1Z7U A;  2EV0 A;  4CZZ A;  2Z3Y A;  2V6C A;  1ZG1 A;  4MEY F;  1TQM A;  4S05 A;  1PP7 U;  4KDP A;  5L3B A;  2EA2 A;  1OYY A;  3JAM Z;  1TTY A;  4WXD A;  3GEZ A;  1LDK B;  2FSW A;  1ZRD A;  3WTW C;  3TQN A;  1CF7 B;  5FO5 A;  4EJO A;  4G6D A;  2O61 A;  2PN6 A;  1KQ0 A;  1J2X A;  2QUF A;  1T2K A;  2XAG A;  1TNT A;  2O8X A;  3TO7 A;  3WTZ A;  4KMU X;  2EWN A;  3GZ6 A;  1WSU A;  5L3G A;  2PJP A;  2JTV A;  1V3F A;  4LG0 B;  2ZME A;  2W85 A;  5HDN A;  2LNB A;  1F9N A;  2RGV A;  2AS5 F;  3ZMZ A;  3LAJ A;  5D6E A;  3EYY A;  1IN8 A;  1W7P A;  3M8F A;  1FBU A;  5D4S A;  2Q8K A;  4S04 A;  5DUI A;  1BBY A;  3KP3 A;  3F21 A;  2HQR A;  3HHG A;  1O3Q A;  1LJ9 A;  2FRH A;  2H94 A;  2VT3 A;  2HYF A;  4HZF A;  3HRT A;  3CDH A;  2ISZ A;  4BXU A;  2LF7 A;  4CHU A;  1XMA A;  3ML6 A;  3FMQ A;  3C3W A;  1UHW A;  2A6H F;  3SZP A;  5HOO A;  1HKQ A;  2EFW A;  1J0R A;  3M1E A;  1R58 A;  5ICC A;  1FBQ A;  2COM A;  2ZNY A;  3TO6 A;  2EFO A;  3L00 A;  1YLF A;  5BS6 A;  2KJB A;  5LRS A;  1U5T A;  2KIF A;  3T1B A;  4CIC A;  4M73 A;  4WF2 A;  4EJV A;  3ZMU A;  1D3Y A;  3RKW A;  4LLG F;  4YFX F;  1QQI A;  3MFK A;  2M87 A;  2MH2 A;  1P4X A;  4YIF A;  2QBY A;  2BGC A;  2FEZ A;  4D0P A;  2QQA A;  2ACJ A;  4G7Z F;  1BC8 C;  1SFU A;  3RKY A;  2YX4 A;  4HV5 A;  4L9N A;  1I1S A;  1HST A;  3FXU A;  1F5T A;  4KA4 A;  4HQM A;  3U1D A;  4U7D A;  3L09 A;  5F1R A;  4M9X A;  3WTY C;  1OR7 A;  2PG4 A;  5LGT A;  3F6V A;  1DDN A;  5EEH A;  1Y0U A;  4RGR A;  4HF1 A;  2K02 A;  2ZCW A;  2DI3 A;  2CG4 A;  2IA0 A;  4F7Z A;  4HDV A;  1MZB A;  1GHC A;  3MEX A;  3E6C C;  5DDG A;  5TJJ A;  2LKP A;  2L3D A;  1XGN A;  1BI0 A;  4A2U A;  3N97 A;  4LJZ F;  2FF4 A;  3Q5F A;  2WV0 A;  2DO7 A;  5DV5 A;  2L4A A;  4EM0 B;  2XIG A;  2IT0 A;  2HDC A;  1KYZ A;  3U9G A;  4PGH A;  5E8I A;  4R79 A;  4U7B A;  2C6Y A;  3RIR A;  1AWC A;  1YS6 A;  1UFM A;  3DFG A;  4YFK F;  5BMZ A;  2NNN A;  4XSZ F;  3GX4 X;  2CYY A;  3HTS B;  1B59 A;  2ESN A;  2KKO A;  4YG2 F;  5CVJ A;  4LK1 F;  2OQR A;  1IUY A;  2RDP A;  3V7C A;  4P9F A;  3HUG A;  3H3Z A;  3HSE A;  1XCB A;  3ECH A;  2BEO A;  2A07 F;  1FYL A;  4G8X A;  4HAM A;  1J7K A;  2D1H A;  5FGM A;  1U2W A;  1XSX A;  3JAM K;  3FZV A;  1IN5 A;  1SMT A;  2VXZ A;  1HXD A;  2BV6 A;  4EV0 A;  3IKT A;  1FNN A;  2CQK A;  5D5W B;  1QNT A;  2R7F A;  4M9Z A;  2F5F A;  3W6J B;  2LSO A;  4BHP A;  2P7C B;  2ETH A;  1Z6R A;  5KK1 A;  2KJC A;  2J5O A;  1TNS A;  4AVP A;  1W7P D;  2XUB A;  4G9Y A;  2FA5 A;  1XMK A;  3TGN A;  3F8F A;  4L9T A;  2Z99 A;  1PDN C;  3SXY A;  5J8F A;  3RTR A;  5CVU A;  5A2Q Z;  3GFM A;  4R8H A;  2WWY A;  1K79 A;  4KIC A;  4IJA A;  1T6S A;  4AIH A;  2DFI A;  4GYG A;  2D2W A;  1IRF A;  2DU9 A;  2P4W A;  2ZJ2 A;  3I58 A;  3EUH A;  2XKP A;  1TBX A;  4LGW A;  4ZYD A;  4HOB A;  2RC4 A;  3P9I A;  3J81 Z;  3IWZ A;  4IRG A;  1U78 A;  3KEQ A;  1JE8 A;  1YYV A;  5CYV A;  5K1Y A;  3DKW A;  2M1B A;  5IT3 A;  2A5Y B;  1MKM A;  2XHK A;  1PUE E;  2V1X A;  5D6F A;  3WU0 A;  2XAH A;  4CXF A;  1SD6 A;  2JZY A;  5E1W A;  2FBK A;  3T8T A;  5J6X A;  3WTU C;  3SHF A;  2W24 A;  3V4G A;  1WRJ A;  1G4D A;  2HZT A;  5E18 F;  1YQA A;  1R1V A;  4IVN A;  4NHJ A;  3ELK A;  4PZJ A;  2YSR A;  2GXB A;  1IF1 A;  4CGZ A;  4IPA A;  1HW5 A;  1WI9 A;  4AD9 A;  3HRM A;  3GXO A;  3VB2 A;  3HHH A;  4Q48 A;  3I71 A;  2J5P A;  5DD8 A;  3P7N A;  5LHH A;  2ZXJ A;  5JFR A;  3I59 B;  1Z6T A;  3WGH A;  2A3S A;  1D8K A;  2X4H A;  3TOB A;  1S29 A;  2WC2 A;  5H20 A;  3ZMT A;  4U0Y A;  5FD5 A;  4GCV A;  6PAX A;  1ZLK A;  1SD7 A;  5AON A;  4EM2 A;  2QVO A;  4O6J A;  3IRQ A;  4KIG A;  4KUM A;  3HSR A;  4MGR A;  1HQC A;  2L02 A;  3GW2 A;  3LST A;  3ZN1 A;  2IW5 A;  2RNJ A;  5BQT A;  2YR2 A;  3MCZ A;  1S6L A;  1T0F A;  4EM1 A;  2YPR A;  2Z33 A;  2W84 A;  2JT1 A;  3B73 A;  3GZ5 A;  2HTJ A;  3WE2 A;  5CVI A;  1S3J A;  1B9N A;  4L9V A;  4BAY A;  2IA1 A;  1S8N A;  1FOK A;  4L5I A;  4FHT A;  3H3U A;  4WWC A;  4HA8 A;  4WK8 F;  3WTV C;  4RGX A;  1J5Y A;  1P2F A;  4ZZL A;  4BQA A;  4L0Y B;  1HKT A;  3G3Z A;  4ENM A;  1ZYR F;  4Q5S F;  1TQI A;  2HTS A;  2DK5 A;  1FT9 A;  1QO0 D;  2DQL A;  3NRV A;  2P6T A;  3F8N A;  1AOY A;  2FBI A;  3U2R A;  3GVA A;  1QBJ A;  4A0Z A;  1KGS A;  2H09 A;  4ASN A;  4K2E A;  1ZGJ A;  1B6A A;  1WQ2 A;  2P5V A;  4KN7 X;  1EV7 A;  1MD0 A;  2FXA A;  3E6B A;  1KU7 A;  4AWX B;  2O03 A;  2VOP A;  3DEU A;  2RQP A;  4HF2 A;  4RS8 A;  1MJA A;  1I6X A;  4HX4 A;  2FMY A;  1XSV A;  3CUQ A;  2E1C A;  2HQN A;  4JK1 X;  2DW4 A;  4I2O A;  2OZ6 A;  1MJB A;  1ZRE A;  3KLN A;  4A6E A;  2QQ9 A;  4LB5 A;  3LQQ A;  2Z5U A;  4G94 A;  2PLY A;  4E70 A;  3ZPL A;  5LRR A;  3TO9 A;  4ESB A;  1ZN2 A;  3QAH A;  4CYD A;  3P9C A;  2Y75 A;  4OIR F;  4A0X A;  4FX0 A;  5LEK A;  3LQR A;  3BPV A;  1HSJ A;  2V79 A;  5DCM B;  2PI0 A;  3RPU A;  4P5O A;  1B1B A;  5D5V B;  2R3S A;  3WU1 B;  1H9T A;  1TQP A;  2CFX A;  1Q1H A;  1U3E M;  5TRD A;  3ZP5 A;  1K7A A;  5KVR A;  1PP8 F;  1G6N A;  1Z05 A;  1DPU A;  3F72 A;  5E8G A;  3BJA A;  1I27 A;  2MD5 A;  3J81 K;  2P5L C;  1FY7 A;  2VC1 A;  4MEX F;  2CWE A;  3PQK A;  1GXQ A;  3HRU A;  4WXC A;  1K78 B;  2ISY A;  3QP6 A;  2GAU A;  5HLH A;  3HTU A;  1H9G A;  3FXQ A;  3GWZ A;  2DPU A;  3CO6 C;  4HLX A;  1ZGA A;  4A0Y A;  5HVQ C;  2NS0 A;  2FOK A;  4OMZ A;  5L3E A;  5E17 F;  1FX7 A;  3F8M A;  3J80 Z;  3MQ0 A;  4OMY A;  3K2Z A;  1UHM A;  1RIO H;  1IXR C;  1O57 A;  3ZMD A;  2V9V A;  3WGI A;  4MQV A;  3RPQ A;  4ENK A;  4OOI A;  3L2C A;  4YII A;  3WTX C;  5HDG A;  1I1G A;  2UWM A;  3TDZ C;  3EQL F;  5H6R A;  5ICE A;  2F5C A;  2VT2 A;  5EEG A;  4A5M A;  1Z9C A;  4I98 B;  1K6O A;  2HFH A;  3BJ6 A;  1O3T A;  4JQF A;  4AIJ A;  3IRR A;  1V4R A;  3IKV A;  1OKR A;  3BDD A;  2Q2E A;  4I09 A;  2ZME B;  2AXL A;  2RN7 A;  3E3V A;  1IZ1 A;  1WKM A;  2ZBK A;  3ABU A;  2HWV A;  1Z91 A;  1ODD A;  4LD5 A;  3S2W A;  2CO5 A;  4ESJ A;  2K4J A;  5FLX Z;  4MTD A;  1BI3 A;  2YU3 A;  1IN4 A;  1R5G A;  2E7X A;  4PDK A;  1LB2 A;  2YX7 A;  4I01 A;  3LA3 A;  2PMH A;  3F6O A;  1IW7 F;  2EFP A;  4KN4 X;  1DP7 P;  2PQ8 A;  4UVC A;  4IRI A;  1GXP A;  3I5U A;  3OOP A;  5ILV A;  1HBX G;  2KIU A;  4NQW A;  2H6B A;  2CGP A;  1KQ8 A;  1Z1D A;  2K4B A;  3RYR A;  2IPQ X;  2P8T A;  1H0M A;  3HOT A;  3IC7 A;  1G3S A;  3KZZ A;  2EJR A;  1C0W A;  2ADU A;  5ED4 A;  3RJP A;  4UVB A;  1L0O C;  3KLO A;  1JGS A;  2IVM A;  1G3Y A;  1BOA A;  1IAW A;  2VBY A;  3KP2 A;  4AIK A;  3ERE D;  2Z9O A;  4HX8 A;  2F5E A;  3D5L A;  3SFZ A;  4A12 A;  3IHU A;  3RI4 A;  4OIQ F;  4KMF A;  2QBY B;  2STT A;  4U0W A;  2DBB A;  1WWX A;  1IXC A;  4G6Q A;  2VBW A;  1OPC A;  2EFQ A;  3TOA A;  4L18 B;  3COA C;  2K7L A;  2OBP A;  1W4M A;  3ISP A;  3I59 A;  4OIN F;  3KP4 A;  1BC7 C;  5CLS A;  4ESF A;  2DT5 A;  4I7H A;  3EYI A;  2FML A;  1J59 A;  2L54 A;  4UV9 A;  2DPD A;  3HOS A;  3GFL A;  2QM3 A;  2O3F A;  1R36 A;  1UCR A;  3F8B A;  5BOX A;  2FBH A;  2FNP A;  4RGS A;  4LMY A;  1P92 A;  2UXN A;  3IL2 A;  3Q9S A;  4HF0 A;  2H6C A;  3ZMS A;  1R5H A;  4WX9 A;  4I0A A;  2L01 A;  1FSE A;  2HR3 A;  2LF8 A;  1XD7 A;  1LDD A;  4ON0 A;  1BJA A;  3I53 A;  4G7O F;  3QPT A;  3R60 A;  4L9J A;  2IRF G;  1D8J A;  3VOD A;  3K69 A;  5CVR A;  2VOO A;  1O3R A;  3J80 K;  2IA2 A;  2OA4 A;  4EMS A;  1R00 A;  2HS5 A;  1XSD A;  5LGU A;  4BYY A;  4JBA A;  1P4A A;  2PBI A;  1YW8 A;  2LDU A;  1XCV A;  3GO5 A;  2XRO A;  2M5W A;  3I0T A;  5IT9 Z;  1JXS A;  2MH9 A;  2QEN A;  3LWF A;  1NHA A;  5ICF A;  4IHT A;  1ZLJ A;  2QLZ A;  3MWM A;  1UB9 A;  4GYI A;  1T39 A;  2E7W A;  3GUD A;  4LB6 B;  2DQR A;  1FZP B;  3VFZ A;  2A6E F;  4GXO A;  1W5S A;  3REO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...