2DK5A

Solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Winged-Helix domain in RNA polymerase III 39KDa polypeptide
rcsb
source organism Homo sapiens
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
total genus 14
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk5A01
3IC7A 4KFCA 2E1CA 1X3UA 3EQLF 5TJJA 1OYYA 5D6EA 2H94A 3N4MA 3I0TA 2M30A 4U0VA 2Z33A 2EV5A 3JAMK 2OQRA 2P8TA 1F1ZA 1IN8A 4XRFA 3JTHA 3KZYA 3HRUA 2GA2A 1WSUA 1XCBA 3TOAA 1T0FA 5HS7A 3PQKA 2Q2EA 3WODF 2ESNA 3LSTA 1LDKB 3WTXC 3ZN1A 1TLHB 3ERED 1EV7A 5D5VB 2PJPA 2QVOA 4UVCA 2R7DA 1ZH5A 2MH9A 2Q8KA 1PUEE 3ZPLA 5F64A 3C7JA 5HDGA 3F6OA 3DKWA 3ZQ7A 1YYVA 2IP2A 1S6LA 1GXPA 4OIOF 3TOBA 3C3WA 6PAXA 2DT5A 1QZYA 5DCMB 4TV7A 2W85A 2BGCA 4LG0A 1ZN2A 2VT3A 3WGHA 4HZFA 4AIJA 4AWXB 5J6XA 3GYHX 4CXFA 4HV6A 4PGHA 5LHHA 2BBYA 1Y0UA 5LGUA 4ON0A 3J80Z 1T2KA 2B0LA 3WGGA 4A5NA 3V8LA 4ASNA 4A0XA 1CF7B 4CGZA 3MQ0A 3LA3A 1XD7A 3TO7A 2MH2A 4LJZF 2VODA 4EMSA 3GXOA 5K5OA 3C1DA 2DPUA 4N9IA 4L0YB 2PBIA 3JAMZ 1HKTA 2QWWA 3GLXA 1ZLJA 5FD5A 3ZP5A 2EB7A 3RIRA 1ZGAA 3M8FA 4WX9A 4AIHA 2HDCA 2VBXA 1ZAOA 3KP4A 1XGNA 3FWEA 1W7PB 2EFNA 4BNCA 5HVQC 5ERIA 4AIKA 3TO9A 2QQ9A 3KE2A 3V4GA 3DPLC 4FX4A 5E1ZB 1XGSA 3FZVA 3V7CA 2PG4A 3TO6A 4JQFA 2V6CA 1UHWA 1SFXA 1YFHA 4PDKA 2Z99A 4IVNA 2LNBA 2M45A 2DW4A 1ZRCA 1LEBA 1IN6A 2YX7A 2LKPA 1QZZA 1I27A 1KQ8A 2LDUA 5D6FA 3R61A 4EJOA 2O3FA 1KU9A 4EVIA 2L01A 2PMUA 2P7CB 3I53A 2ELHA 1ZRFA 3QU3A 1R36A 4A2UA 2L3DA 3L00A 4L9TA 5K5RA 2E7WA 3NEUA 3O3KA 2DTRA 2W84A 4I0BA 4RGUA 4M9SA 1FSHA 2ISZA 2JT1A 3IKTA 2MBFA 5F6FA 1SD5A 1BIAA 5JVTA 3QP6A 2QQAA 1SD4A 2CSOA 2UWMA 4KDPA 3KP2A 4FHTA 4MGRA 3R4KA 1ZGJA 1HW5A 4A0ZA 2YU3A 1Z91A 1UHMA 4B09A 4HOBA 4UVAA 3U1DA 4Q5SF 1Q1HA 3ZMTA 1S7AA 4ENKA 2F5DA 2GXBA 1MKMA 1U78A 3KETA 3FMSA 2AXLA 1IW7F 3E5XA 2XAHA 1TQPA 1QNTA 1FZPB 5CVRA 1SFUA 1IN5A 1RZ4A 3K1MA 5IT9K 3V8KA 2JPCA 1O7LA 3CLOA 3RKXA 2XAGA 4I2OA 2FE3A 2DK5A 5DCFA 3F8NA 4ETSA 4U0WA 2STTA 3LFKA 3E6CC 1XSXA 1QQIA 1R5GA 2M87A 4XBFA 1OYWA 4H0EA 2GZWA 4QWQA 3I71A 1QPMA 4A5MA 3GX4X 1I6XA 2HS5A 3HOSA 2DU9A 4M9ZA 1XDSA 3BP8A 1R00A 1ZRDA 5EEGA 2LF7A 1D8KA 1OKRA 4G7OF 2Y0MA 4RS8A 2VC1A 3FMRA 4P9FA 4QLCU 3L7WA 3ABUA 3E6MA 5L3EA 4ESFA 4R8HA 4KN7X 1MJBA 3QPTA 2JPBA 3BJAA 1ZG1A 2UZKA 4HF0A 4KUMA 1IUYA 2QUFA 1EH6A 5E8GA 3W6KB 4HQEA 1BC7C 3EYIA 4IRIA 3HHHA 4L5IA 2NYXA 3R6SA 1G3WA 4RB0A 3TGNA 3K1NA 4S04A 3TDZC 4UNOA 2R7FA 3VOEA 2PQ8A 3COAC 5D5UB 4ESBA 4UVBA 2DBBA 2QZ8A 5DDGA 5E18F 3FMQA 3E5UA 2Y75A 4BHPA 4ZYHA 1HBXG 1PP8F 1P4AA 4XSZF 1KU3A 1ULYA 4IF4A 3WE2A 2D1VA 4UV8A 3I4PA 2K02A 4RGXA 4HV5A 1TTYA 2EFQA 3TDUC 1FPQA 2HGCA 1O57A 1UCRA 3L09A 4MNUA 1SD7A 2FSWA 5KK1A 1RUNA 3RYRA 2ZJ2A 2WWYA 2FQ3A 4G9YA 4N0BA 2OQGA 5CLSA 1H9TA 5HLHA 3EUHA 2P5VA 3BY6A 3T8TA 1WWXA 1T98A 1ZYRF 1CF7A 3E6BA 1RNLA 2J5PA 2VT2A 2DK8A 1I1SA 5JFRA 4MEXF 3HHGA 4Y17A 4BHBA 4M71A 4R1HA 2K86A 3HTUA 1BI2A 4YIFA 3M8EA 1J2XA 3SXYA 3GFMA 3WU0A 4OMYA 1XN7A 2L4MA 4O3MA 2PN6A 2RN7A 3FXUA 3NQOA 3LWFA 4IHTA 4EJTA 3F6VA 2FBKA 4HW0A 4XLNF 4YFNF 1HSJA 2ADUA 1W7PD 2OD5A 1U8RA 1LB2A 3KP3A 2VOPA 1SAXA 3MWMA 4I98B 4WK8F 1JXSA 3W6JB 4RB3C 1FP1D 1K7AA 3HYIA 2XVCA 1BBYA 1XMAA 5E17F 2CW0F 2ACJA 3HRSA 1IF1A 1SFEA 1B1BA 3EDPA 1USSA 1E17A 1IN4A 4ZYEA 2VN2A 2NNYA 3IRRA 1IRGA 2HR3A 3DEUA 3T5XA 2G7HA 1HW1A 1J7KA 4D0PA 1GHCA 1F9NA 4EV0A 3FXQA 5HS9A 5LGTA 2OBPA 5CVUA 5E8IA 1YQAA 3HSFA 3RPQA 2DI3A 2FMYA 1P6RA 1G4DA 3F72A 2VE9A 5CVJA 2RC4A 1HSTA 1ODDA 3SFZA 4A0YA 1YTYA 2O61A 3ECOA 4LMYA 1B4AA 2FBHA 2DLLA 4IRHA 2DPDA 1BC8C 5BOXA 2V1XA 2XUBA 4EJWA 2TDXA 2EWNA 2UXNA 4UUVA 2F5FA 4HDUA 1FOKA 4MEYF 1FYLA 3HSRA 4MQ9F 4M6YA 2A6EF 3BJOA 2IPQX 4I01A 2BEOA 2Z3YA 3JTGA 2YSRA 3CO7C 2FNPA 3HRTA 4XLPF 5FLXZ 4WWCA 4KT5C 1TNSA 3F21A 3MFKA 5D8KB 4ENMA 1R1TA 1J5YA 2A07F 4HBLA 2VXZA 1F4KA 2ZO4A 2OA4A 4JK1X 5LRSA 1RI7A 1CGPA 3KCCA 3GFJA 1WI9A 4MTEA 3GFLA 3WTWC 3T0YA 3LA2A 2IVMA 5L3GA 1OMIA 1XMKA 1XSVA 1J75A 2Y48A 2XAFA 4ENJA 3RDIA 1ZHFA 1IAWA 1U6GA 2NAZA 4LLLA 5J8FA 5D4RA 3GZ6A 1BN5A 3H3UA 1I5ZA 4M73A 4LLNA 2IJLA 1UFMA 3BWGA 3ULQB 1PP7U 3AAFA 1YS6A 1LVAA 3H92A 3FHZA 3O2PE 1LEAA 4MTDA 2OAZA 3KP5A 1QGPA 4O5VA 4CO8A 3DFGA 2CO5A 1DPUA 2YX4A 3I54A 5HLGA 2PFBA 4OIQF 3P9IA 1LDJA 3M7GA 1KU2A 2LF8A 4LLGF 5BPDA 3RI4A 4LFUA 2PEXA 1DDNA 2IA0A 1ON2A 2EV0A 4EJUA 4M72A 1L3LA 3QPHA 4KN4X 3KEOA 3EETA 2FF4A 1ZARA 5HDKA 1R22A 1TNTA 2H6BA 4PCQA 3QU6A 2YPRA 3IWFA 4EGYA 1K6OA 1WRJA 4WCGA 1WKMA 4M6XA 3F3XA 3WTVC 2GWRA 2EA2A 2ZXJA 3BJ6A 4ESJA 2VC0A 1R1UA 2FXAA 4NHJA 4HAMA 1MJ9A 3RPUA 3VB2A 4L18B 3ECHA 1ON1A 1YIOA 4EM2A 2PMHA 2P4WA 2BV6A 1FYMA 1MZBA 2A61A 2ZFWA 5JR3A 2P7VB 5DYMA 2J5OA 5IT9Z 5LHGA 2G9WA 4M9XA 3U9GA 5D5WB 2A6HF 2QBYB 1FLIA 1S3JA 5A2QZ 1TQMA 4O6JA 4P96A 2MC3A 5A2QK 3RKWA 2V1UA 2JZYA 2KJCA 4HLYA 2H27A 1MDMA 5D4SA 4DQ2A 2ZNYA 1BJAA 4IRGA 3E5QA 2HQRA 4KYWA 1T6SA 2O8XA 5H6QA 1HKSA 4ZYGA 2AS5F 3QAHA 1O3TA 3GO5A 3QP5A 5ICCA 3ZMSA 3FM3A 1B9MA 5ED4A 5HDNA 1SD6A 3T1BA 2PLYA 1QBJA 1K78A 3N97A 2UXXA 1STZA 4P55A 1OR7A 3PFIA 5ICEA 2H09A 2CGPA 2QBYA 2M5WA 1TW3A 4CZZA 5FD6A 1OYIA 1U2WA 4EM0B 3KLNA 2YR2A 4A6DA 5LEKA 3WTZA 2P5KA 3MZYA 4IJAA 4RAYA 3U2RA 4IPAA 2A5YB 5ILUA 3REOA 3RJPA 3WG9A 3I59A 4NQWA 2VBZA 4EJVA 3CJNA 4BAYA 3VEPA 5ILSA 3KZZA 5H6RA 1W4MA 2K4JA 1MGTA 2EFWA 3ZMUA 3D0SA 1LDDA 2EA4A 2F2EA 4CDGA 3ML6A 1XSDA 1JHHA 2XASA 1JGSA 1FBUA 1YLFA 4HLXA 2MLKA 4RGRA 4KIBA 2GIVA 3P9CA 2WV0A 1BI1A 3GUDA 3IRQA 3IWZA 1A04A 2KIMA 1U5TC 4EM1A 3CUOA 2VE8A 2GAUA 4HF2A 5EEHA 5LRRA 4YFXF 4UV9A 2MA3A 2EK5A 3J7AO 3QRFF 2QLZA 3GVAA 4BH9A 2P6TA 5L3FA 5ICGA 5E20A 4BYYA 1OPCA 4KA4A 2FBIA 3V8JA 2O6GE 2BYVE 5DD8A 4GO1A 2FA5A 1IN7A 1GXQA 4G7HF 1EH7A 1P2FA 2OU2A 1FBSA 2A68F 3KFWX 3GFIA 2P6SA 4G6DA 2RGVA 3ABTA 5F1RA 5D8LB 1B6AA 3HIFA 2CFXA 4M74A 2HKXA 2XIGA 2KIFA 2R3SA 2W57A 2ZCWA 4UXNA 3K69A 4YFKF 4K2EA 2A69F 3CUQC 3KP6A 3WTTC 2ZMEB 2NRAC 1U3EM 1WQ2A 4XSXF 5FFXA 3WTUC 3L9FA 1HQCA 4S05A 4RAZA 5CVIA 1TQIA 1FY7A 5BQTA 1ZG5A 1B9NA 1HKQA 3TQNA 1ZG3A 4HX8A 5DV5A 3RTRA 1IZ1A 1XDUA 1HXDA 3F8MA 4A12A 4Q4ZF 4FT8A 2FEZA 3FX3A 1E2XA 3J81K 4DNCA 2EJRA 3BOQA 2GA1A 4ZH4F 1DP7P 2KJBA 1UB9A 5BPIA 1EH8A 1U5TB 1U5TA 4MQVA 5KVRA 3I58A 3FF5A 2Q0OA 3PQJA 1J59A 4HX4A 3HOTA 3ZMDA 1TBXA 3RKYA 2HEOA 4CHUA 5AIQA 4KIFA 2V79A 1FBQA 2O0YA 3Q9SA 3DF8A 3E6DA 1BOAA 2C6YA 5LLQA 2ZKZA 2IA2A 4KNYA 3KLOA 2XHKA 5BMZA 4L0ZB 3P9KA 4BQAA 4YG2F 4HYEA 3J80K 4WXHA 2IRFG 2RQPA 2GXGA 2NS0A 4HA8A 3MCZA 5CVVA 1S8NA 2L54A 4Y13A 2G7UA 3GEZA 2F5EA 3VODA 4PZJA 2VBYA 4E70A 2DFIA 1K78B 3Q9VA 2MLGA 4Q47A 1KGSA 2M8EA 1AWCA 1USTA 4L9NA 2WC2A 4HX7A 3OOPA 2ZBKA 5BS6A 2IA1A 5J8CA 1KQ9A 2HFHA 1W7PA 1KA8A 4LG0B 4GXOA 5FFZA 2FU4A 4F7ZA 2K4BA 2IT0A 4UHTA 2KRFA 2QENA 2KKOA 4AVPA 3GW2A 1O3RA 2XAJA 3FXRA 4U7BA 1Z7UA 1B59A 3WGIA 4KICA 4IXAA 3Q5FA 3WE3A 1TW2A 2XAQA 5JI6A 3ROUA 1KYWA 3LQQA 1SMYF 5LHIA 1GVJA 2Z9OA 2EV6A 4LB6B 2V1DA 2XKOA 1FP2A 4LD5A 4Y15A 4GCVA 1Z05A 4ZZDA 2VBWA 3GZ5A 4GYIA 3SHFA 1D3YA 5DUKA 2HTSA 1YS7A 4B8XA 2BE5F 4U88A 1W5TA 4EQQA 3ZN0A 3DV8A 2NNNA 3BROA 1NHAA 3LAJA 1IXCA 3G3ZA 3JSPA 3I5UA 3CTAA 5AONA 1MD0A 2V9VA 1R1VA 3NRVA 5DEQA 5ICFA 4G8XA 1XCVA 1Z9CA 3ZMVA 1RIOH 1YW7A 2RVCA 1JE8A 3I64A 2ETHA 3LQRA 1FC3A 2FNAA 4L9VA 3HUGA 1V4RA 1V3FA 5K5QA 2PI0A 1FYKA 4Z2YA 3G73A 4G7ZF 2K7LA 2CG4A 4P9UA 1REPC 3JW4A 3F22A 3J81Z 3CDHA 2X0LA 4P5OA 3WTSC 3CUQB 3KEQA 1KQ0A 3F23A 3IL2A 3K0LA 4WF2A 3DP7A 3BZ6A 2QYOA 5HLIA 1VTNC 3HSEA 4I02A 2D1HA 4R79A 2HWVA 3RYPA 5FO5A 3TKYA 2IW5A 2RDPA 2K27A 3HTSB 3R60A 2HOEA 2RNJA 2CYYA 1BIBA 5CJ9A 1KU7A 2COMA 4RB2C 2P5LC 2EFPA 5L3BA 4Q48A 2DQLA 1FNNA 1XGOA 1D8JA 4U0YA 1IXSB 1O3QA 2D45A 3H3ZA 3R0AA 1D5VA 3VFZA 5LBQA 3IHUA 2Z5UA 4BXUA 1H9GA 4RB1A 4I7HA 1YW9A 1YW8A 1KYZA 4LK1F 3F8FA 1HW2A 4CYDA 3WTYC 4ENNA 1I1GA 2DAOA 3JSOA 3E97A 3V7RA 2F5CA 5ILVA 3EYYA 2QQBA 3I59B 4G94A 3D5LA 4LGWA 1AOYA 3ELKA 1R7JA 3M1EA 4ZYDA 4OOIA 2HYFA 1LJ9A 2E7XA 3V7SA 5D5XB 1QO0D 4GGGA 1BM9A 2QM3A 3CO6C 2LSOA 2L4AA 1K79A 2HKOA 3MZHA 1P4XA 2DQRA 5HS8A 5TRDA 1SMTA 5FLXK 4MHGA 2WTEA 2STWA 5DUIA 2FMLA 2W25A 3C18A 1R5HA 2HQNA 3MAJA 1DUXC 4ZZLA 2D2WA 1PDNC 5DD4A 4KMUX 4OU0A 3LAPA 2ISYA 1LQ1A 3QOPA 2HTJA 1BI3A 5HOOA 3K1PA 1Z1DA 1ZREA 4LK0F 3DXJF 2CQKA 3SQNA 1T38A 1Z6RA 5IT3A 3P7NA 1YO5C 1G3SA 3O6BB 3ISPA 4G6QA 1S7OA 2O03A 1W5SA 5AIPA 2FRHA 3GF2A 4WXCA 3BPXA 5CYVA 2M1BA 2W24A 1R58A 3OV8A 1S29A 1L0OC 4I0AA 2CWEA 3ZMZA 4LB5A 2HZTA 3L2CA 3B02A 3HRMA 4WXDA 4YIIA 1G6NA 1DPRA 1FWZA 1R23A 2RV8A 2XV4S 1G3TA 3SZPA 4A6EA 1IXRC 1XGMA 2KIUA 2VOOA 3S2WA 3DPTA 2GQQA 2ESHA 2FOKA 4KIGA 4HDVA 2DO7A 5E1XA 3SZTA 1O3SA 1IRFA 3R0JA 1FX7A 5H20A 4IHSA 2JRTA 3T8RA 2EFOA 4L5JA 1C0WA 4U7DA 5DCMA 2ZMEA 2H6CA 3BPVA 1BI0A 1RUOA 5K1YA 1JHFA 5FB2A 5LGNA 2XROA 4I09A 4BHCA 1T39A 3WU1B 4EGZA 3IKVA 1J9IA 2HYGD 2JSCA 3MEXA 2JTVA 3GWZA 3BDDA 3LA7A 5LEJA 3B73A 2RKHA 2E1NA 3F8BA 2XRNA 2XKPA 1FT9A 1O7FA 1LNWA 4OMZA 5L3CA 5JHUA 5L3DA 3CUQA 3E3VA 1J0RA 2ZNZA 1MJAA 3DQVC 3FM5A 1H0MA 1FSEA 4JBAA 2VONA 4RGSA 2X4HA 5FGMA 3K9TA 4L9JA 1YG2A 1F5TA 1P92A 1P4WA 4HQMA 4KMFA 4NB5A 4GYGA 2L02A 4AD9A 4CICA 3KP7A 2OZ6A 2MD5A 2A3SA 3F8CA 1XB4A 1MDMB 4N9HA 1G3YA 3K2ZA 5E1WA 4FX0A 1ZLKA 1ONVA 4PGGA 4OIRF 1Z6TA 4OIPF 4OINF 4HF1A 2XGXA 2OZUA 3M9AA
chains in the Genus database with same CATH superfamily
3IC7A 4KFCA 4CCNA 4UB8C 2E1CA 1ERDA 1X3UA 3EQLF 5TJJA 3S3MA 1OYYA 5K7HA 3JREA 4I76A 1DU6A 1T8IA 5D6EA 1XG1A 4N4OB 2H94A 3N4MA 3I0TA 2M30A 4U0VA 2DMPA 2Z33A 2EV5A 2L7ZA 1DGWY 5HNHA 3JAMK 3LSPA 2X85A 2CJJA 4ITVA 2OQRA 2YS9A 2P8TA 4XK4A 1OQYA 1RRJA 1F1ZA 1IN8A 4XRFA 3JTHA 3KZYA 1RR8C 3KYLA 4E7LA 2X1EA 3QOEA 4YIRX 3HRUA 2GA2A 3BR1A 4H4KC 1WSUA 1XCBA 3TOAA 4PFPA 3OSGA 1T0FA 4FTHA 4S0HB 3LSHA 3K4JA 5HS7A 5J1YA 3HZJA 1WPKA 3PQKA 1LFPA 3IP4B 2Q2EA 3WODF 2E71A 3B6AA 1X1BA 2ESNA 4QPQA 3LSTA 3CZ6A 1FMWA 1LDKB 1YOVB 1RETA 1OFCX 3WTXC 1SFOJ 3ZN1A 1TLHB 1Z3XA 3ERED 1EV7A 5D5VB 2PJPA 5GAHJ 3HKZN 2DA1A 2QVOA 4UVCA 2R7DA 1ZH5A 2MH9A 2Q8KA 1PUEE 1W5CC 3WU2C 3ZPLA 5F64A 3C7JA 3KZIC 5HDGA 3F6OA 1VQ6I 3DKWA 3ZRGA 1UMQA 3ZQ7A 3JRAA 1JUPA 5IYDJ 4UY8I 1YYVA 3M3YJ 2HPIA 2IP2A 1S6LA 1U8BA 1GXPA 2X6OA 4OIOF 4NC7A 1YJNI 4IOAF 3TOBA 4XRMA 3C3WA 4XRSA 6PAXA 2DT5A 1QZYA 5DCMB 3VYSB 4TV7A 3FXLA 2W85A 2BGCA 3AG1H 4LG0A 4DIQA 1D5YA 2LKXA 2WBMA 2X1CA 1FEXA 1ZN2A 2FUG2 2VT3A 4E7KA 3BG6A 3WGHA 4HZFA 4AIJA 2DMTA 4AWXB 5J6XA 2VIXA 3GYHX 4CXFA 4IQ4A 2DJIA 1MSFC 4HV6A 4PGHA 2LR8A 3G1LA 5IOZA 5LHHA 2BBYA 3Q0VA 1IV6A 4IEJA 1Y0UA 5LGUA 2KLOA 1S7EA 4ON0A 2XGDA 4BXXJ 3J80Z 3H0GJ 1N25A 1T2KA 2B0LA 3EUKL 3WGGA 4A5NA 3V8LA 4ASNA 3PL8A 3ESWB 2RAEA 1X2MA 2VJJA 4A0XA 3MKYB 3E7LA 1CF7B 4CGZA 5FRMA 3MQ0A 3LA3A 3LSJA 1XD7A 2DODA 2XAUA 3K7AJ 3OWTA 3JRGA 3TO7A 2MH2A 1HDDC 4BS9A 3DLLF 2HXOA 1N78A 4LJZF 3BT9A 2VODA 4BEHA 2K3PA 4EMSA 4XNFA 3GXOA 5K5OA 2P0WA 3C1DA 1PUFA 2DPUA 4N9IA 1B8IB 4X1EA 4L0YB 2X9DA 2PBIA 3JAMZ 1HKTA 2QWWA 4NQWB 3RZOJ 3GLXA 1ZLJA 1ETXA 2WAEA 2KZVA 4PJ0C 5FD5A 3ZP5A 2EB7A 3RIRA 3SFIA 2RQQA 1ZGAA 4II2A 9ANTA 3JRHA 4HPQA 3OYLA 3M8FA 4MO7A 3OYDA 4WX9A 4AIHA 2HDCA 2VBXA 2EH3A 1ZAOA 1Z3YA 3KP4A 1YI2I 1XGNA 3FWEA 1TWAJ 1W7PB 1Y39A 2EFNA 2ID3A 2M4GA 4BNCA 3MVPA 5HVQC 5EEAA 5ERIA 1HDPA 4LITA 1ETOA 4AIKA 5C4XJ 2R7QA 3TO9A 3GTPJ 2QQ9A 5E3LA 3M07A 3KE2A 3V4GA 3DPLC 4FX4A 2ZXHA 5E1ZB 1XGSA 2OPTA 3BR6A 5M5YJ 3OIOA 1SANA 1NG7A 3FZVA 3V7CA 2PG4A 1VZ0A 3TO6A 4XR6A 4JQFA 1SAUA 4JX4A 2O5RA 2V6CA 1UHWA 1SFXA 1Y56A 1YFHA 4PDKA 2Z99A 4IVNA 3S1RJ 2HQ5A 3JRIA 2K9SA 2LNBA 2M45A 2DW4A 1ZRCA 1HF0A 4RAFA 1LEBA 5DS9A 3H36A 4UB6C 1IN6A 4BUPA 3BLYA 2YX7A 2LKPA 4QIWN 1QZZA 1I27A 1MBJA 1KQ8A 2LDUA 1U0JA 1WCMJ 1ZR4A 1RKWA 5D6FA 3R61A 4EJOA 2O3FA 1KU9A 4EVIA 2R5YA 2L01A 1AHDP 2QSFX 2PMUA 2HOSA 2P7CB 4IKFA 3PUFA 3CMYA 2DA7A 2K3FA 3I53A 3HGYA 2ELHA 1ZRFA 3A0HC 3OOUA 1R36A 2JK3A 3QU3A 4A2UA 2L3DA 5KAIC 3L00A 4L9TA 2KHMA 3PSFA 4YEJA 3S93A 5K5RA 2E7WA 3NEUA 3O3KA 2DTRA 2W84A 4I0BA 4RGUA 5EG0A 5FKLA 4M9SA 5EG0B 1FSHA 2ISZA 2JT1A 2QA4I 1LE8B 3IKTA 2MBFA 1Z0XA 3S14J 5F6FA 3JRBA 4RMNA 3RQ4A 1SD5A 2Y30A 1BIAA 5JVTA 1VQ9I 3G1MA 2ZSIB 2QQAA 3ASNH 1SD4A 3QP6A 3PNVA 2CSOA 4AYBN 4Y3OA 2UWMA 2VKHA 4KDPA 3KP2A 4FHTA 4MGRA 2XPUA 3N05A 3R4KA 1ZGJA 1B72A 1HW5A 4A0ZA 2R93J 2YU3A 4M3EA 1Z91A 1UHMA 2FX0A 4B09A 2XB0X 1UJ8A 1D0YA 4HOBA 4UVAA 3U1DA 4Q5SF 1Q1HA 1CQTA 2LC2A 2ID6A 3G2BA 3ZMTA 1S7AA 4ENKA 2F5DA 3DU5A 3BZKA 1AU7A 2GXBA 1MKMA 1U78A 1Y6IA 3W2AA 3KETA 3FMSA 2NVUB 2AXLA 1IW7F 3E5XA 4A93J 1IG7A 2QSHX 2XAHA 1TQPA 1E0EA 1QNTA 1FZPB 3SDBA 2BZTA 5CPRB 2W4SA 2KFDA 5IOYA 1MNDA 3PIOF 5CVRA 4AUXA 1R6RA 4OAYA 4RM2A 1SFUA 1IN5A 2EZIA 1RZ4A 1X58A 4XLHA 3A01B 2DFFA 3K1MA 4XL9A 5IT9K 3V8KA 2JPCA 5C3EJ 1O7LA 1WJEA 3CLOA 3RKXA 2IGKA 2XAGA 4I2OA 3HOZJ 3VSLA 2FE3A 4X6AJ 4D5FA 2DK5A 3Q0WA 5DCFA 3F8NA 4ETSA 1Z21A 1R71A 4GDFA 4U0WA 4FISA 2AQEA 3HGGA 2STTA 3LFKA 2KL4A 3FHNA 3E6CC 4E7HA 1XSXA 3HPGA 2R7SA 1QQIA 4FCYA 2WY8Q 1TWCJ 1QVUA 1R5GA 1JKRC 2F6CA 2M87A 4XBFA 1OYWA 4H0EA 2H8WA 2GZWA 4QWQA 4RM3A 3I71A 1QPMA 3P5JA 4NC8A 4A5MA 3GX4X 3M1CA 2HDDA 1I6XA 3B6CA 2VQLA 2HS5A 3HOSA 2DU9A 2MYSA 4M9ZA 3S15J 2H1LA 1XDSA 1BW5A 3BP8A 1R5ID 3MZ8A 4XIDA 3CCRI 1R00A 4F3QA 2XF6A 1TZLA 4PUSA 2BVMA 4BJ6C 1ZRDA 1A5JA 5EEGA 2LF7A 4A3BJ 1F43A 3FBNB 4V2FA 1D8KA 4B1RA 1OKRA 2R0QC 4G7OF 3HEFA 2Y0MA 4II3A 4RS8A 2VC1A 3FMRA 4P9FA 4QLCU 2NVQJ 2JSPA 3ZQHA 3L7WA 3ABUA 3E6MA 4CCKA 3LSGA 5L3EA 4ESFA 4L5EA 1ZR2A 2I10A 3TBIA 4R8HA 4KN7X 3AL0B 4UUSA 1U9OA 2TCTA 3CMAI 3SYTA 1MJBA 3QPTA 3F0CA 2JPBA 3BJAA 4CYCA 1ZG1A 2UZKA 4HF0A 3LSIA 1XPXA 4KUMA 5EF6A 1IUYA 1UG2A 5J47A 2QUFA 2F48A 2R5ZB 4XKWA 2W7NA 1EH6A 3I9V2 5E8GA 3W6KB 4RDUA 3X2QH 4HQEA 1BC7C 3EYIA 4IRIA 2WAQN 2VUMJ 5EGOA 1VQPI 3HHHA 4L5IA 1OCPA 2NYXA 3R6SA 1G3WA 1I50J 3FK6A 4RB0A 3TGNA 5E79C 2BY2A 3K1NA 4S04A 3TDZC 3GTMJ 2ECBA 4OAZA 4UNOA 1OLTA 2R7FA 3JR9A 4NNJA 2JJ7A 4BDZA 3VOEA 2OF7A 2CRGA 2PQ8A 3COAC 5D5UB 2CQ7A 2E1MC 4ESBA 4UVBA 2DBBA 2QZ8A 3K4MA 4NBQA 2VPRA 5DDGA 4RBOA 3FMQA 5E18F 3E5UA 2Y75A 4BHPA 3JRCA 4ZYHA 1ETKA 2OUMA 2VXDA 4AC0A 2HI3A 1P4AA 3C2GA 4XSZF 1PP8F 1HBXG 3TL4X 1G2HA 1OJLA 5F0FA 1KU3A 1ULYA 4IF4A 5J40A 3WE2A 2D1VA 4UV8A 3HBLA 2DMUA 2K02A 3I4PA 5EYRA 4RGXA 4BGDA 4HV5A 1TTYA 1IC8A 2VJIA 4LOCA 3CC2I 2M34A 2Y69H 2EFQA 5JHFA 1GUUA 2CV0A 3TDUC 1FPQA 1JGGA 2HGCA 3FXKA 4A3MJ 2ZXIA 3M8JA 1O57A 3OYGA 3A02A 1UCRA 3L09A 4MNUA 1SD7A 4DZJA 2F5VA 2FSWA 5KK1A 1RUNA 3RYRA 2ZJ2A 3ZQGA 2WWYA 5EZGA 4C3IJ 2FQ3A 4G9YA 3FDYA 2R7VA 4N0BA 1S72I 2OQGA 5GTHC 5CLSA 1H9TA 3KPHA 1VFCA 5HLHA 3EUHA 2VL8A 2P5VA 3LMMA 2V26A 3BY6A 5LD2C 3U21A 3T8TA 4BL0B 3S2DJ 3PFYA 4J19A 2L9VA 3HB9A 3FIWA 1WWXA 4J01A 2NS7A 4IZZA 1T98A 1ZYRF 3K4BA 1CF7A 4AIDA 2Y31A 3E6BA 1HCRA 1RNLA 2J5PA 2VT2A 2DK8A 1I1SA 3H9GA 5JFRA 1N77A 4MEXF 3HHGA 4QTRA 3CD6I 4Y17A 2QGUA 4BHBA 3J7YJ 4M71A 4R1HA 3GTQJ 2K86A 3HTUA 1BI2A 4YIFA 3M8EA 2LREA 2DMQA 1J2XA 3SXYA 2WB1A 2KZGA 3GFMA 5C44J 1MNMC 3WU0A 3VYTB 4OMYA 2XPVA 1XN7A 2L4MA 3BQYA 4O3MA 3SJMA 2PN6A 2RN7A 3FXUA 3NQOA 1FIAA 1WJCA 4MIMA 2X1DA 2KT0A 4KITB 3LWFA 4HEA2 2HOTA 4IHTA 1UG0A 4EJTA 3ZXSA 3F6VA 2FBKA 3U1KA 2BHZA 4M6VA 4HW0A 3OYNA 2VQGA 3CCEI 1AKHA 4XMYA 3VYUB 4XLNF 4YFNF 2K9LA 3NWSA 1VQOI 1PVEA 2X6XA 3CDIA 1HSJA 2ADUA 1W7PD 2OD5A 1U8RA 1LB2A 3KP3A 2E1OA 2QF7A 2JVGA 3ZGKA 1SAXA 2VASA 3MWMA 4KT6A 4I98B 4WK8F 1JXSA 3E0JB 5HLTA 3W6JB 4V19K 3OIQA 4GRIA 4RB3C 3I4NJ 1FP1D 1K7AA 2W1OA 3HYIA 2XVCA 2Y9YA 1BBYA 1XMAA 4C3JJ 1MH4A 5E17F 1OCRH 2R7WA 2CW0F 1Z77A 2ACJA 3HRSA 2VLAA 1IF1A 1SFEA 2LOOA 1B1BA 2R92J 2KISA 3EDPA 1USSA 1E17A 1IN4A 4ZYEA 2VN2A 2NNYA 2LH9A 3HOUJ 1EF4A 3IRRA 1ZGWA 1IRGA 2HR3A 3DEUA 1RESA 3SEQA 2CH0A 3H35A 4B4CA 2HNHA 3FXMA 3OYHA 3T5XA 2FOWA 3D1NI 2G7HA 1HW1A 1J7KA 4D0PA 1GHCA 1F9NA 3FKIJ 4BXFA 2R5YB 1ITYA 2L2OA 4EV0A 3FXQA 5HS9A 5LGTA 2OBPA 2OC6A 1WZ2A 3LSRA 5CVUA 2HXIA 1TP4A 3K6GA 2XSDC 2WV1A 2PJRB 5E8IA 1YQAA 4AU7A 3HSFA 2NVYJ 3RPQA 2CQQA 2DI3A 4CUGA 1FOYA 1NTCA 3UKGA 1HLVA 2FMYA 1P6RA 1X3WB 1G4DA 3F72A 2GXAA 1TWHJ 2M2EA 2VE9A 5CVJA 1AKHB 2RC4A 2JA8J 3NWTA 1HSTA 1ODDA 3K70D 3SFZA 2ZFUA 4A0YA 2IXSA 1YTYA 2O61A 3ECOA 4LMYA 5J4VA 2BW3B 3OYFA 3PUBA 2VJ5A 2CQNA 1B4AA 2WA0A 2FBHA 2DLLA 2CU7A 4IRHA 2Z1DA 5F27A 3OYIA 2IS6A 2DPDA 1X4PA 1BC8C 5BOXA 1R9TJ 5CKTA 2N8GA 2V1XA 2ZSHB 3KEYA 1JJ8C 3UR3C 3ZOBA 2ME0A 2XUBA 4EJWA 2TDXA 2EWNA 2UXNA 4UUVA 2F5FA 4HDUA 5CQGA 1FOKA 4MEYF 4ABZA 4CCOA 1FYLA 3PO2J 1BR4A 2EZLA 3HSRA 4MQ9F 4M6YA 2A6EF 1VQMI 1JUMA 3BJOA 2IPQX 3GTLJ 4I01A 2Z3YA 2BEOA 3JTGA 2R7XA 3AG3H 3OS0A 3AG2H 2LP0A 2YSRA 1VQ5I 3CO7C 2CW7A 2FNPA 2FQ4A 3HRTA 2PMZA 4XLPF 3AL0C 5FLXZ 4WWCA 3IH4A 4KT5C 1JUSA 1NG6A 1TNSA 2EILH 3F21A 3CESA 4BJTA 4IO9F 3MFKA 2OJED 2LY9A 5D8KB 4ENMA 1R1TA 1J5YA 1MBFA 2A07F 4HBLA 2VXZA 1YJWI 1F4KA 1JKQC 2ZO4A 2OA4A 4M3DA 1WJBA 2JMWA 4JK1X 5LRSA 1RI7A 4F93B 4F91B 2Y0SA 3JRDA 4HG2A 1CGPA 3L1PA 3KCCA 2DOEA 3GFJA 1WI9A 2D5VA 4MTEA 3GFLA 2ZC2A 3CJRB 3OR1C 3WTWC 3T0YA 2KQRA 1GDTA 3LA2A 2LMDA 3DKXA 5B1AH 4BEHB 3S32A 3A1YA 1O4XA 1P7JA 2IVMA 5L3GA 1OMIA 1XMKA 1EJ9A 1XSVA 5EDNA 1W0TA 1J75A 2Y48A 4DBRA 2XAFA 4ENJA 2OTLI 3RDIA 1ZHFA 1IAWA 1U6GA 2NAZA 2M7AA 4LLLA 5J8FA 1OCCH 2EIJH 2JRMA 5D4RA 3GZ6A 1BN5A 1XX5A 3H3UA 1I5ZA 1LPQA 2R7OA 4M73A 4LLNA 4C2MJ 2IJLA 1UFMA 3BWGA 1BW6A 3ULQB 4NDLA 1PP7U 3AAFA 1YS6A 4DBQA 2MG4A 1LVAA 3C2HA 2MABA 3H92A 2AHQA 3FHZA 3O2PE 1LEAA 4MTDA 3TP3A 2OAZA 3HC7A 3KP5A 1ZELA 1QGPA 2LVSA 4O5VA 3IAS2 3OS1A 1H89C 4CO8A 2R7ZJ 1IGNA 2DYRH 1ETWA 3DFGA 2CO5A 1NK2P 3V42A 1ZQ3P 1DPUA 1Z7LA 2YX4A 3I54A 5HLGA 2XGEA 2G0EA 3HUGB 4Y33A 1PUFB 2KIQA 1BJZA 2PFBA 4OIQF 3P9IA 1LDJA 3PNYA 4IQJA 3M7GA 4XOTA 4JX6A 1KU2A 2L9NA 2LF8A 3BCAA 4LLGF 5BPDA 5GAEJ 1MMNA 5CQEA 1MH3A 3CQZJ 3RI4A 4ZDPA 3CLQA 3IH3A 1W1WE 2PEXA 4LFUA 4BKXA 3OYBA 1SVLA 1DDNA 2HVRA 4HSTA 1T08B 4XORA 2IA0A 1JTXA 1ON2A 2EV0A 4EJUA 4M72A 1L3LA 4DJAA 5FKKA 3QPHA 4KN4X 3KEOA 2DCEA 3EETA 4ZTFA 4FE4A 3OL4A 2FF4A 2E60A 5B5EC 1LFUP 1ZARA 4B47A 5HDKA 2NVTJ 1R22A 1TNTA 2H6BA 3DCFA 2E2JJ 4PCQA 3QU6A 2YPRA 3VWBA 4IL6C 3IWFA 3K4KA 4EGYA 4E4HA 1K6OA 1WRJA 5GPCA 4WCGA 1WKMA 2AO9A 4XN0A 3FXOA 3K10A 4M6XA 2OCCH 2WAQA 5J4YA 3F3XA 3WTVC 2GWRA 2EA2A 3OYJA 3CMMA 2ZXJA 2CUEA 3BJ6A 4ESJA 1GLNA 2VC0A 1R1UA 2FXAA 4NHJA 4HAMA 1Z67A 3H5NA 3W2WA 3DBLB 2KRCA 1MJ9A 2L9RA 2O7OA 1I39A 3CJTB 3RPUA 2V6EA 3VB2A 4L18B 3ECHA 1ON1A 3CF2A 3HOYJ 3S1NJ 1JKPC 3S2HJ 1YIOA 3S16J 1YX5A 4N4NB 4EM2A 2PMHA 3BG9A 4DYQA 1EKEA 4W97A 2ZJRF 3TEDA 2P4WA 5EZHA 2BV6A 4A3EJ 1WJFA 3DEWA 1G59A 1FYMA 5M3MJ 1MZBA 2A61A 2ZFWA 1WHUA 5JR3A 3W2VA 2DMNA 2P7VB 5DYMA 4XICA 2J5OA 1FTZA 3EUAA 5DTDA 3VPRA 5IT9Z 3DTKA 1E3OC 4BU2A 5LHGA 2G9WA 2YU9J 1WH5A 4M9XA 4HNVA 3U9GA 5D5WB 2A6HF 2GBYA 1W36D 2V7FA 2QBYB 4XM3A 1FLIA 2JA5J 3BTLA 1S3JA 5A2QZ 1TQMA 4O6JA 3LOCA 4P96A 4XLAA 3S3NA 3HG9A 3A0BC 5GAGJ 3JCUC 2MC3A 2NOGA 3HDDA 3ZCOA 4HRIA 5A2QK 3EPZA 2E1MB 3RKWA 2V1UA 2JZYA 2KJCA 1OCTC 3CC4I 3A03A 2V4JC 4HLYA 2H27A 1MDMA 2E5NA 2IBDA 5D4SA 4DQ2A 1X1CA 2ZNYA 4XRSG 4FE7A 1BJAA 4IRGA 4BACA 2RREA 2E2HJ 3E5QA 2HQRA 3LNQA 2NS8A 1T6SA 2DXIA 4KYWA 1WFXA 1BL0A 3WHBA 2HVSA 2O8XA 5H6QA 1HKSA 4ZYGA 4Z6YA 2LBFB 2K5CA 3QAHA 2AS5F 1O3TA 3GO5A 3RZDJ 2A5WA 2K9NA 2AQFA 1U9NA 3QP5A 5ICCA 4G6TB 3ZMSA 3FM3A 3CF5F 1VQNI 1B9MA 5ED4A 4EATA 4QPOA 2VOPA 5HDNA 1SD6A 3ABKH 3H5AA 3T1BA 2PLYA 3D5SC 4FQGA 4FASD 1QBJA 1K78A 2XPWA 3N97A 3K4NA 3LFUA 1TWFJ 2UXXA 3DU6A 2FD5A 1STZA 5HODA 5H2FC 4CZCA 1ORKA 3CCJI 4BQQA 4P55A 3HL2A 1OR7A 3HOVJ 1UELB 3PFIA 5ICEA 1IRXA 2R5ZA 1IDZA 2H09A 3IH2A 4XONA 5J1UA 3QODA 1YE9A 2OTJI 2CGPA 2QBYA 2M5WA 1RR7A 1TW3A 4CZZA 3BG7A 5FD6A 2L7FP 3M4OJ 1OYIA 1U2WA 5IP9J 2HU9A 5JVGF 4XKBA 1WVRA 4EM0B 3S17J 3K4CA 3KLNA 1ENHA 2OCEA 2YR2A 4A6DA 4IHWA 4E7ZA 3IAM2 5KCMA 5FKMA 1NK3P 4CYCB 5IP7J 5LEKA 3W3CA 3WTZA 2P5KA 3MZYA 4IJAA 4CCLA 4RAYA 2VKEA 3U2RA 4ZDOA 4IPAA 5B1BH 3OIPA 4JYKA 2A5YB 3OYAA 5ILUA 4CH7A 5BNGA 3REOA 3RJPA 3WG9A 3I59A 5GPAA 3FK7A 4NQWA 2JUGA 4CCMA 1WJ5A 3ABMH 3CCUI 2GOXB 2VBZA 4EJVA 1SC7A 2VB6A 3CJNA 4BAYA 3CP2A 3VEPA 5ILSA 4J00A 1VI0A 2QEXI 3H9JA 1K83J 3KZZA 5H6RA 1W4MA 4A69C 1VQKI 1GV5A 3H9QA 2K4JA 2BVLA 1MGTA 2XRLA 2EFWA 4ZTJA 2LKSA 3ZMUA 3L2WA 3D0SA 1LDDA 3CCYA 2EA4A 2F4MB 1PYVA 2F2EA 4CDGA 3ML6A 1XSDA 1JHHA 3UNGC 2XASA 5F04A 3VDXA 1JGSA 1FBUA 2VKDA 1YLFA 2M0CA 3OS2A 4XOPA 1X1PA 2GIZA 4HLXA 2MLKA 4RGRA 5EJCA 4KIBA 4A3IJ 2B9SA 2GIVA 3P9CA 2WY7Q 5M3FJ 1P7IA 2WV0A 1BI1A 3GUDA 4UUSB 4IHVA 4PFOA 4A3GJ 3IRQA 3IWZA 2IEKA 3L2QA 3G1OA 2DOFA 5IY5H 2CUFA 2M3AA 3I3LA 1A04A 2KIMA 1U5TC 1Y8RB 4QSHA 1UZCA 4EM1A 3TW7A 3CUOA 5FROA 5FLVA 3GTKJ 3HOXJ 3Q3SA 1OCOH 2R4GA 2DFEA 3S1QJ 4A3KJ 5IYCJ 2VE8A 2GAUA 4HF2A 1P9QC 5EEHA 5LRRA 4YFXF 5EGOB 4UV9A 2MA3A 4W1UA 2EK5A 3MD2A 3J7AO 1RC9A 3QRFF 4BQNA 2QLZA 2EBIA 3GVAA 1VNDA 2P6TA 4BH9A 2EZHA 5L3FA 3RQIA 5ICGA 1ETQA 5E20A 4BYYA 1OPCA 2Q1ZB 2ZJQF 4LIVA 2GM4A 4KA4A 2FBIA 3HKZA 3V8JA 1BR1A 4U87A 4F55A 3K70C 2O6GE 2BYVE 4PSWA 2MW8A 3OYKA 5DD8A 4GO1A 3MKWB 1WH7A 2FA5A 2XF7A 3OMYA 2CUJA 1IN7A 4ANJA 1A31A 1GXQA 4G7HF 1EH7A 1Y8QB 1P2FA 3NARA 3FXJA 2B7EA 1XS9A 2OU2A 3JRFA 1FBSA 2A68F 3KFWX 2LLKA 2GOMA 2JUCA 1V54H 3VSKA 2IGMA 4CCJA 3GFIA 5TGTA 5F0HA 2P6SA 4G6DA 1F36A 1MIJA 2RGVA 3ABTA 3O8HA 2JWTA 3BG3A 4C2UA 3L2UA 5F1RA 4BE2A 3G6EI 5D8LB 1B6AA 3ERMA 4JP0A 1GV2A 3HIFA 2CFXA 2Y0SN 3J7ZI 3BQZA 2BXYA 4M74A 1I3QJ 2HKXA 2VQCA 3J7AY 2XIGA 2KIFA 3CC7I 3RSNA 4FETA 2R3SA 3H5RA 2W57A 2MFZA 3HOWJ 2ZCWA 2M0MA 4NUBA 4UXNA 3ZQFA 3CCQI 3K69A 2AXTC 2BY3A 4RA2A 4K2EA 4YFKF 2ZJPF 2A69F 3CUQC 3KP6A 3Q0UA 3WTTC 1QA6A 1A35A 2ZMEB 5K7ZA 2NRAC 1LVKA 1U3EM 1WQ2A 4XSXF 5FFXA 2JA7J 3WTUC 3L9FA 1HA8A 1FTTA 1HQCA 3MN2A 4S05A 2KMUA 2JN6A 3OYCA 3OY9A 4RAZA 3C2BA 1LUJB 5CVIA 1TQIA 1FY7A 5BQTA 1ZG5A 1B9NA 1HKQA 1X3ZB 3TQNA 1POGA 2OV7A 5JLXA 1ZG3A 4C3HJ 4HX8A 2QCOA 1QHHD 5DV5A 3BTCA 2XF5A 1RPWA 3RTRA 1IZ1A 1XDUA 1JI8A 3QQAA 1HXDA 3F8MA 4A12A 3ZQCA 3SDGA 4Q4ZF 3BTJA 2QKLB 4FT8A 2FEZA 3FX3A 2JVHA 1E2XA 1QPIA 3J81K 1G8XA 2NOJB 1XTAA 1S9HA 2DOAA 4DNCA 3GLLA 4C30A 2EJRA 3BOQA 2GA1A 4ZH4F 1Q1VA 1DP7P 2I8DA 1SFKA 2KJBA 5GP9A 1YRNB 1BR2A 1UB9A 5GADJ 5BPIA 1EH8A 2EQRA 1U5TB 1U5TA 4MQVA 5KVRA 3I58A 3FF5A 2Q0OA 1ZKGA 5IPAA 3PM1A 2HVQA 3PQJA 3BR5A 1J59A 4HX4A 3HOTA 3ZMDA 1TBXA 3RKYA 3BR3A 2HEOA 4CHUA 5AIQA 4KIFA 2BHYA 1IRZA 1ETYA 1FBQA 2V79A 3OL3A 1A36A 3S1MJ 2O0YA 2LRDA 3Q9SA 2Z2SB 3OYMA 3DF8A 1K4SA 3E6DA 3H3VK 1BOAA 3OYEA 4PJLA 5LLQA 2C6YA 2Q2EB 2ZKZA 2Y9ZA 2IA2A 2QQ8A 4KNYA 1W36C 1LFBA 4PJMA 3AKZA 3HPHA 3KLOA 2XHKA 2CV1A 5BMZA 4L0ZB 3P9KA 3WHCA 4BQAA 3HXLA 1VQLI 4YG2F 4HYEA 3FKJA 2DTZA 3J80K 1MBHA 4RAGA 4WXHA 4ZJZA 2RQPA 2IRFG 2W00A 1H88C 1LE8A 2GXGA 1JKOC 2NS0A 4HA8A 3GZNB 1NH3A 2DA6A 3MCZA 4PSXA 5CVVA 1S8NA 2L54A 4E7JA 3L2RA 4Y13A 3ZQLA 2G7UA 3GEZA 1Y0NA 2F5EA 3VODA 3CJQB 4PZJA 2VBYA 3CDLA 4E70A 5IP6A 3QWLA 2DFIA 5M5XJ 1WJDA 1K78B 2L0KA 1JT0A 2DA2A 2O8KA 3Q9VA 2MLGA 4KJZA 4Q47A 1KGSA 2M8EA 4YELA 1AWCA 1X1DA 5IYBJ 1USTA 2CFOA 2PX9A 2Y2ZA 4L9NA 1FIPA 2WC2A 4HX7A 2IAIA 3OOPA 2ZBKA 5BS6A 2IA1A 5J8CA 1KQ9A 2HFHA 1FJLA 1W7PA 1KA8A 1QVTA 4LG0B 4GXOA 5FFZA 2V9PA 1N75A 2FU4A 4F7ZA 2K4BA 2IT0A 4UHTA 2L5QA 4M3BA 3FISA 2DT7B 2KRFA 2QENA 2KKOA 2QKMB 4AVPA 3GW2A 1O3RA 2PMZN 2XAJA 3FXRA 4U7BA 2PJRA 1Z7UA 1B59A 4DW6A 5TISC 3IUOA 4MFDA 3WGIA 4KICA 1LKXA 1D1AA 4HNTA 3W6VA 4IXAA 3Q5FA 3WE3A 2KP6A 1TW2A 2XAQA 5JI6A 3ROUA 1KYWA 3LQQA 1SMYF 1Y1VJ 5LHIA 1GVJA 1XMXA 2Z9OA 2EV6A 4LB6B 2R7UA 2K40A 2V1DA 1FP2A 1WI3A 2XKOA 2L7MP 4LD5A 4Y15A 1K4TA 1DU0A 4GCVA 1Z05A 4AM3A 4DYCA 4X0GA 2EINH 2B63J 1ETVA 5FRNA 1VF9A 1AA7A 4ZZDA 2VBWA 3GZ5A 4GYIA 4HNUA 3SHFA 3CCVI 1K61A 3MKLA 1D3YA 5DUKA 3VYRB 2HTSA 1YS7A 4B8XA 5M5WJ 2BE5F 1ZTRA 4U88A 1W5TA 4EQQA 3ZN0A 4D9JA 1RKTA 2NNNA 3BROA 1NHAA 3DV8A 3LAJA 1IXCA 3G3ZA 3JSPA 3I5UA 3CTAA 4UUTA 5AONA 1MD0A 2V9VA 3A4CA 1R1VA 2FJ1A 3CMEI 3NRVA 5J3LA 5KAFC 1BA5A 2KDZA 5DEQA 2CW8A 1A6IA 2Z16A 5ICFA 2ME6A 2E36A 2K9QA 4G8XA 1XCVA 2EIMH 3ZMVA 4BE0A 4D5CA 1YW7A 1Z9CA 1RIOH 2L7KA 2DN0A 2RVCA 1JE8A 2QSGX 2H8RA 4ZDLA 4I6ZA 1HOMA 4B44A 3PO3J 3QYBA 4DZPA 2E19A 3AFHA 2YUSA 3I64A 2ETHA 3LQRA 1FC3A 2FNAA 2ELKA 4LG3A 4BBSJ 4L9VA 2K85A 3HUGA 3BTIA 1V4RA 3DLAA 1V3FA 5KHDA 1D0ZA 5K5QA 4F92B 3LL7A 1T56A 2PI0A 1FYKA 1YX3A 4B48A 4Z2YA 3G73A 3QPLA 4G7ZF 2K7LA 3DBHB 2CG4A 4P9UA 1REPC 2L9SA 3JW4A 4RLFA 3F22A 2COBA 2IGOA 4LIUA 2XGCA 3J81Z 3CDHA 2X0LA 4P5OA 3GMEA 4GFBA 1X2NA 3KYCB 3SZGA 1MBKA 2NXNB 2ZXWH 3WTSC 3OR2C 3CUQB 2ZMEC 3FBIB 2IGNA 2P81A 3DKYA 1KQ0A 3KEQA 3F23A 5DM7F 3IL2A 3K0LA 4WF2A 1TT5B 3DP7A 3BZ6A 2MGQA 2QYOA 2DJNA 3OSFA 4Y52J 1MBGA 1APLC 1T0FC 5HLIA 1VTNC 3HSEA 4I02A 5KNLA 2XC7A 2D1HA 4R79A 4Y7NJ 2HWVA 3RYPA 2LD5A 5FO5A 1I6HJ 1VQ4I 1EA3A 3TKYA 4IOCF 3A2KA 3ASOH 4YRVA 3GTJJ 1UAAA 3DPUA 5F0CA 1T95A 1Y1WJ 2IW5A 5FKNA 2X48A 1PJRA 2BW3A 3I55I 2RDPA 2DFHA 2K27A 3HTSB 1QU3A 1D1BA 3R60A 2HOEA 4BBRJ 2RNJA 2XB5A 4BJ5C 2F4IA 2BOLA 2I5UA 2CYYA 2UUZA 1BIBA 5CJ9A 2CQXA 2COMA 4RB2C 1KU7A 2KDOA 4BE1A 2P5LC 2EFPA 1TWGJ 5L3BA 4BDYA 4Q48A 1D0XA 1ZK8A 2DQLA 2DYSH 1FNNA 1XGOA 1D8JA 1E3PA 4PJJA 1YRNA 4U0YA 2X6YA 4A3CJ 5GTIC 1IUFA 1IXSB 3GBGA 1O3QA 2CMPA 2D45A 3H3ZA 3R0AA 2H1KA 1ACIA 1D5VA 5FKOA 3VFZA 5LBQA 3BZCA 3IHUA 4EEFG 2Z5UA 4BXUA 2ELJA 2E34A 1H9GA 5E3NA 4RB1A 4I7HA 2R7RA 5F1JA 1V5FA 2V9KA 2JQ7A 3PJRA 1YW9A 4V2GA 4AVZA 1YW8A 1KYZA 3PNTA 4LK1F 3AG4H 1QRYA 3F8FA 4ZC3A 1HW2A 1KZHA 3EUHC 4CYDA 3WTYC 4ENNA 3F9KA 3BCBA 1I1GA 5FLMJ 4DOZA 2DAOA 3JSOA 3E97A 3IV5A 2HPMA 3V7RA 1GT0C 2F5CA 5K7FA 5ILVA 3PSIA 3EYYA 2QQBA 3I59B 4G94A 3D5LA 3RKQA 4IHYA 4LGWA 1AOYA 3CCLI 5JLWA 3ELKA 1R7JA 2M9HA 3M1EA 4ZYDA 4OOIA 2UV1A 1OISA 2ECCA 2HYFA 1QHGA 2V1NA 2ZB9A 1SVOA 4BY1J 1LJ9A 2E7XA 1DGRM 4XQFA 3V7SA 4IX7A 5D5XB 1QO0D 5E3MA 1DP3A 3QPSA 4GGGA 1BM9A 1IJWC 4NC6A 3CCSI 1M1EB 2QM3A 3GCMA 5B3SH 3DWLE 2W48A 2KPMA 2LSOA 3CO6C 2DT6A 3ZQIA 2L4AA 1VQ7I 5J1RA 1K79A 2HKOA 4M3GA 3MZHA 4BY7J 2WAFA 1P4XA 2DQRA 3H1CA 4JX5A 2MC4A 1J09A 2MD0A 5HS8A 5TRDA 1SMTA 2EIKH 5FLXK 4MHGA 2WTEA 2STWA 5DUIA 3BR2A 3L2VA 3ABLH 1MMDA 2FMLA 2W25A 3S8PA 3C18A 1R5HA 1X4OA 2E2IJ 3DTIA 2HQNA 1MMGA 5DM6F 3MAJA 1DUXC 4ZZLA 3TMOA 2JA2A 2DA3A 1QZEA 2D2WA 1PDNC 2K9MA 1E3HA 5DD4A 4KMUX 4OU0A 3LAPA 1MMSA 3O8GA 2ISYA 4XLFA 4DYRA 2A6TA 1LQ1A 2JA6J 2IS2A 3QOPA 1JT6A 4RLQA 2LYCA 4XKVA 2HTJA 4PJNA 5HNFA 3HJEA 1BI3A 2VKVA 5HOOA 3K1PA 1Z1DA 4G12A 1ZREA 4LK0F 3DXJF 1JTYA 4PK4A 4E7SA 1MW7A 2CQKA 2LBFA 1KONA 3I4MJ 3SQNA 4B3AA 2LFBA 3G4SI 3I56I 2LG4A 2BY0A 1T38A 4A3FJ 2VQHA 1IV8A 3KYDB 3MKZA 1Z6RA 2XDVA 5IT3A 2HOAA 3P7NA 1YO5C 2CUZA 2E5ZA 1G3SA 2M8GX 4BQOA 4A3DJ 3NAUA 3O6BB 1VQ8I 3GTGJ 3ISPA 5FJ8J 4G6QA 1R4MB 2F4OB 2BXZA 1TC3C 2WADA 1S7OA 4Y4RA 1TT0A 2O03A 1H8AC 1V5GA 1W5SA 2EZKA 5AIPA 2FRHA 4XN3A 1YHQI 3GF2A 4WXCA 3BPXA 3K2AA 5CYVA 2M1BA 2W24A 2E35A 1R58A 2RNGA 3D5RC 4CSWA 3OV8A 1S29A 1L0OC 4I0AA 2DDBA 2DA5A 2CWEA 2X6WA 4JOMA 1A6QA 3ZMZA 1SEUA 3PIPF 3SEZA 4LB5A 1K6YA 2HZTA 3L2CA 3B02A 3HRMA 4WXDA 4YIIA 2XV4S 1DPRA 1FWZA 1G6NA 1R23A 2RV8A 4XLEA 1G3TA 3ZQQA 4B43A 2HYJA 1R49A 1WGXA 3CP8A 3SZPA 4A6EA 1IXRC 3HM5A 4B3XA 4A3JJ 1XGMA 2KIUA 2VOOA 3S2WA 3DPTA 1WJAA 2ESHA 2GQQA 3CCMI 2IS4A 1S5LC 4DGWB 1B8IA 4KISA 2X51A 2A05A 2FOKA 4I99C 4KIGA 4ZYAA 4HDVA 2DO7A 3QYEA 2DA4A 4XLCA 3RPUD 1UHSA 5E1XA 3SZTA 3WG7H 1IRFA 1OR7C 1O3SA 4CA0A 3KX2A 2DDAA 3R0JA 1FX7A 5H20A 4IHSA 2JRTA 2BY1A 3T8RA 2EFOA 1SVMA 1FOWA 4L5JA 1C0WA 1FMVA 3QYFA 4U7DA 4XKCA 2M4KA 1YIJI 5DCMA 4D7NA 2M7BA 2ZMEA 2WB1N 1GVDA 1MMAA 2H6CA 2HQAA 2MSYA 3A01A 2LTPA 3BPVA 2VPLA 2TRTA 1BI0A 1RUOA 5K1YA 1JHFA 5FB2A 1BOBA 3RCOA 1IO2A 5LFAA 5LGNA 2XROA 1D1CA 3BG5A 1YITI 4I09A 4BHCA 2LY1A 2LK2A 1T39A 1R4NB 3WU1B 4EGZA 1JJ6C 2VI6A 3IKVA 3DBRB 1J9IA 2HYGD 2JSCA 3GTOJ 3MEXA 2JTVA 3GWZA 2EPFA 3BDDA 3LA7A 3LSKA 1V55H 5LEJA 3B73A 2IS1A 2RKHA 3TW6A 2E1NA 2CS3A 3F8BA 2W82A 3KIOA 1TL8A 3ONQA 2XRNA 4P1WA 1MBEA 2XKPA 3BC8A 1FT9A 1IDYA 1O7FA 1LNWA 1V5EA 4E6KG 4OMZA 3ZR8X 5E3OA 5L3CA 5JHUA 5L3DA 3CUQA 4C9YA 3MMYB 3E3VA 4MLOA 1X1AA 1J0RA 2VJ4A 1X19A 2ZNZA 1MJAA 3BR0A 3G71I 2HDWA 1XC5A 3DQVC 3FM5A 1H0MA 1YJ9I 1FSEA 4JBAA 2VONA 3TP0A 1MNEA 4RGSA 3S3OA 2X4HA 1OCZH 5FGMA 4F52A 3E1SA 3K9TA 1MSEC 4L9JA 4C2TA 4MFEA 1YG2A 5C4JJ 1P92A 5B66C 3DEEA 1F5TA 5F08A 2LY2A 2NVXJ 2R7TA 1P4WA 4HQMA 3H0DA 4KMFA 4NB5A 4GYGA 2ICWG 2L02A 2KRHA 4D1QA 1W0UA 2HZDA 4AD9A 4M3FA 4CICA 3KP7A 2OZ6A 2MD5A 3K4LA 4A3LJ 2A3SA 3F8CA 1I3AA 1XB4A 2GLOA 1T33A 1MDMB 1DQUA 4N9HA 2CV2A 1G3YA 3K2ZA 5E1WA 2XSJC 1B72B 3LSMA 4FX0A 4HSRA 4E7IA 1ZLKA 4IHXA 1ONVA 4PGGA 1FOXA 4OIRF 1Z6TA 4OIPF 4OINF 1HC8A 4D7MA 2XGXA 2OZUA 2O9LA 4HF1A 3M9AA 4OWRB 4AYBA 3DTEA
chains in the Genus database with same CATH topology
3IC7A 4KFCA 2E1CA 1X3UA 3EQLF 5TJJA 1OYYA 5D6EA 2H94A 3N4MA 3I0TA 2M30A 4U0VA 2Z33A 2EV5A 3JAMK 2OQRA 2P8TA 1F1ZA 1IN8A 4XRFA 3JTHA 3KZYA 3HRUA 2GA2A 1WSUA 1XCBA 3TOAA 1T0FA 5HS7A 3PQKA 2Q2EA 3WODF 2ESNA 3LSTA 1LDKB 3WTXC 3ZN1A 1TLHB 3ERED 1EV7A 5D5VB 2PJPA 2QVOA 4UVCA 2R7DA 1ZH5A 2MH9A 2Q8KA 1PUEE 3ZPLA 5F64A 3C7JA 5HDGA 3F6OA 3DKWA 3ZQ7A 1YYVA 2IP2A 1S6LA 1GXPA 4OIOF 3TOBA 3C3WA 6PAXA 2DT5A 1QZYA 5DCMB 4TV7A 2W85A 2BGCA 4LG0A 1ZN2A 2VT3A 3WGHA 4HZFA 4AIJA 4AWXB 5J6XA 3GYHX 4CXFA 4HV6A 4PGHA 5LHHA 2BBYA 1Y0UA 5LGUA 4ON0A 3J80Z 1T2KA 2B0LA 3WGGA 4A5NA 3V8LA 4ASNA 4A0XA 1CF7B 4CGZA 3MQ0A 3LA3A 1XD7A 3TO7A 2MH2A 4LJZF 2VODA 4EMSA 3GXOA 5K5OA 3C1DA 2DPUA 4N9IA 4L0YB 2PBIA 3JAMZ 1HKTA 2QWWA 3GLXA 1ZLJA 5FD5A 3ZP5A 2EB7A 3RIRA 1ZGAA 3M8FA 4WX9A 4AIHA 2HDCA 2VBXA 1ZAOA 3KP4A 1XGNA 3FWEA 1W7PB 2EFNA 4BNCA 5HVQC 5ERIA 4AIKA 3TO9A 2QQ9A 3KE2A 3V4GA 3DPLC 4FX4A 5E1ZB 1XGSA 3FZVA 3V7CA 2PG4A 3TO6A 4JQFA 2V6CA 1UHWA 1SFXA 1YFHA 4PDKA 2Z99A 4IVNA 2LNBA 2M45A 2DW4A 1ZRCA 1LEBA 1IN6A 2YX7A 2LKPA 1QZZA 1I27A 1KQ8A 2LDUA 5D6FA 3R61A 4EJOA 2O3FA 1KU9A 4EVIA 2L01A 2PMUA 2P7CB 3I53A 2ELHA 1ZRFA 3QU3A 1R36A 4A2UA 2L3DA 3L00A 4L9TA 5K5RA 2E7WA 3NEUA 3O3KA 2DTRA 2W84A 4I0BA 4RGUA 4M9SA 1FSHA 2ISZA 2JT1A 3IKTA 2MBFA 5F6FA 1SD5A 1BIAA 5JVTA 3QP6A 2QQAA 1SD4A 2CSOA 2UWMA 4KDPA 3KP2A 4FHTA 4MGRA 3R4KA 1ZGJA 1HW5A 4A0ZA 2YU3A 1Z91A 1UHMA 4B09A 4HOBA 4UVAA 3U1DA 4Q5SF 1Q1HA 3ZMTA 1S7AA 4ENKA 2F5DA 2GXBA 1MKMA 1U78A 3KETA 3FMSA 2AXLA 1IW7F 3E5XA 2XAHA 1TQPA 1QNTA 1FZPB 5CVRA 1SFUA 1IN5A 1RZ4A 3K1MA 5IT9K 3V8KA 2JPCA 1O7LA 3CLOA 3RKXA 2XAGA 4I2OA 2FE3A 2DK5A 5DCFA 3F8NA 4ETSA 4U0WA 2STTA 3LFKA 3E6CC 1XSXA 1QQIA 1R5GA 2M87A 4XBFA 1OYWA 4H0EA 2GZWA 4QWQA 3I71A 1QPMA 4A5MA 3GX4X 1I6XA 2HS5A 3HOSA 2DU9A 4M9ZA 1XDSA 3BP8A 1R00A 1ZRDA 5EEGA 2LF7A 1D8KA 1OKRA 4G7OF 2Y0MA 4RS8A 2VC1A 3FMRA 4P9FA 4QLCU 3L7WA 3ABUA 3E6MA 5L3EA 4ESFA 4R8HA 4KN7X 1MJBA 3QPTA 2JPBA 3BJAA 1ZG1A 2UZKA 4HF0A 4KUMA 1IUYA 2QUFA 1EH6A 5E8GA 3W6KB 4HQEA 1BC7C 3EYIA 4IRIA 3HHHA 4L5IA 2NYXA 3R6SA 1G3WA 4RB0A 3TGNA 3K1NA 4S04A 3TDZC 4UNOA 2R7FA 3VOEA 2PQ8A 3COAC 5D5UB 4ESBA 4UVBA 2DBBA 2QZ8A 5DDGA 5E18F 3FMQA 3E5UA 2Y75A 4BHPA 4ZYHA 1HBXG 1PP8F 1P4AA 4XSZF 1KU3A 1ULYA 4IF4A 3WE2A 2D1VA 4UV8A 3I4PA 2K02A 4RGXA 4HV5A 1TTYA 2EFQA 3TDUC 1FPQA 2HGCA 1O57A 1UCRA 3L09A 4MNUA 1SD7A 2FSWA 5KK1A 1RUNA 3RYRA 2ZJ2A 2WWYA 2FQ3A 4G9YA 4N0BA 2OQGA 5CLSA 1H9TA 5HLHA 3EUHA 2P5VA 3BY6A 3T8TA 1WWXA 1T98A 1ZYRF 1CF7A 3E6BA 1RNLA 2J5PA 2VT2A 2DK8A 1I1SA 5JFRA 4MEXF 3HHGA 4Y17A 4BHBA 4M71A 4R1HA 2K86A 3HTUA 1BI2A 4YIFA 3M8EA 1J2XA 3SXYA 3GFMA 3WU0A 4OMYA 1XN7A 2L4MA 4O3MA 2PN6A 2RN7A 3FXUA 3NQOA 3LWFA 4IHTA 4EJTA 3F6VA 2FBKA 4HW0A 4XLNF 4YFNF 1HSJA 2ADUA 1W7PD 2OD5A 1U8RA 1LB2A 3KP3A 2VOPA 1SAXA 3MWMA 4I98B 4WK8F 1JXSA 3W6JB 4RB3C 1FP1D 1K7AA 3HYIA 2XVCA 1BBYA 1XMAA 5E17F 2CW0F 2ACJA 3HRSA 1IF1A 1SFEA 1B1BA 3EDPA 1USSA 1E17A 1IN4A 4ZYEA 2VN2A 2NNYA 3IRRA 1IRGA 2HR3A 3DEUA 3T5XA 2G7HA 1HW1A 1J7KA 4D0PA 1GHCA 1F9NA 4EV0A 3FXQA 5HS9A 5LGTA 2OBPA 5CVUA 5E8IA 1YQAA 3HSFA 3RPQA 2DI3A 2FMYA 1P6RA 1G4DA 3F72A 2VE9A 5CVJA 2RC4A 1HSTA 1ODDA 3SFZA 4A0YA 1YTYA 2O61A 3ECOA 4LMYA 1B4AA 2FBHA 2DLLA 4IRHA 2DPDA 1BC8C 5BOXA 2V1XA 2XUBA 4EJWA 2TDXA 2EWNA 2UXNA 4UUVA 2F5FA 4HDUA 1FOKA 4MEYF 1FYLA 3HSRA 4MQ9F 4M6YA 2A6EF 3BJOA 2IPQX 4I01A 2BEOA 2Z3YA 3JTGA 2YSRA 3CO7C 2FNPA 3HRTA 4XLPF 5FLXZ 4WWCA 4KT5C 1TNSA 3F21A 3MFKA 5D8KB 4ENMA 1R1TA 1J5YA 2A07F 4HBLA 2VXZA 1F4KA 2ZO4A 2OA4A 4JK1X 5LRSA 1RI7A 1CGPA 3KCCA 3GFJA 1WI9A 4MTEA 3GFLA 3WTWC 3T0YA 3LA2A 2IVMA 5L3GA 1OMIA 1XMKA 1XSVA 1J75A 2Y48A 2XAFA 4ENJA 3RDIA 1ZHFA 1IAWA 1U6GA 2NAZA 4LLLA 5J8FA 5D4RA 3GZ6A 1BN5A 3H3UA 1I5ZA 4M73A 4LLNA 2IJLA 1UFMA 3BWGA 3ULQB 1PP7U 3AAFA 1YS6A 1LVAA 3H92A 3FHZA 3O2PE 1LEAA 4MTDA 2OAZA 3KP5A 1QGPA 4O5VA 4CO8A 3DFGA 2CO5A 1DPUA 2YX4A 3I54A 5HLGA 2PFBA 4OIQF 3P9IA 1LDJA 3M7GA 1KU2A 2LF8A 4LLGF 5BPDA 3RI4A 4LFUA 2PEXA 1DDNA 2IA0A 1ON2A 2EV0A 4EJUA 4M72A 1L3LA 3QPHA 4KN4X 3KEOA 3EETA 2FF4A 1ZARA 5HDKA 1R22A 1TNTA 2H6BA 4PCQA 3QU6A 2YPRA 3IWFA 4EGYA 1K6OA 1WRJA 4WCGA 1WKMA 4M6XA 3F3XA 3WTVC 2GWRA 2EA2A 2ZXJA 3BJ6A 4ESJA 2VC0A 1R1UA 2FXAA 4NHJA 4HAMA 1MJ9A 3RPUA 3VB2A 4L18B 3ECHA 1ON1A 1YIOA 4EM2A 2PMHA 2P4WA 2BV6A 1FYMA 1MZBA 2A61A 2ZFWA 5JR3A 2P7VB 5DYMA 2J5OA 5IT9Z 5LHGA 2G9WA 4M9XA 3U9GA 5D5WB 2A6HF 2QBYB 1FLIA 1S3JA 5A2QZ 1TQMA 4O6JA 4P96A 2MC3A 5A2QK 3RKWA 2V1UA 2JZYA 2KJCA 4HLYA 2H27A 1MDMA 5D4SA 4DQ2A 2ZNYA 1BJAA 4IRGA 3E5QA 2HQRA 4KYWA 1T6SA 2O8XA 5H6QA 1HKSA 4ZYGA 2AS5F 3QAHA 1O3TA 3GO5A 3QP5A 5ICCA 3ZMSA 3FM3A 1B9MA 5ED4A 5HDNA 1SD6A 3T1BA 2PLYA 1QBJA 1K78A 3N97A 2UXXA 1STZA 4P55A 1OR7A 3PFIA 5ICEA 2H09A 2CGPA 2QBYA 2M5WA 1TW3A 4CZZA 5FD6A 1OYIA 1U2WA 4EM0B 3KLNA 2YR2A 4A6DA 5LEKA 3WTZA 2P5KA 3MZYA 4IJAA 4RAYA 3U2RA 4IPAA 2A5YB 5ILUA 3REOA 3RJPA 3WG9A 3I59A 4NQWA 2VBZA 4EJVA 3CJNA 4BAYA 3VEPA 5ILSA 3KZZA 5H6RA 1W4MA 2K4JA 1MGTA 2EFWA 3ZMUA 3D0SA 1LDDA 2EA4A 2F2EA 4CDGA 3ML6A 1XSDA 1JHHA 2XASA 1JGSA 1FBUA 1YLFA 4HLXA 2MLKA 4RGRA 4KIBA 2GIVA 3P9CA 2WV0A 1BI1A 3GUDA 3IRQA 3IWZA 1A04A 2KIMA 1U5TC 4EM1A 3CUOA 2VE8A 2GAUA 4HF2A 5EEHA 5LRRA 4YFXF 4UV9A 2MA3A 2EK5A 3J7AO 3QRFF 2QLZA 3GVAA 4BH9A 2P6TA 5L3FA 5ICGA 5E20A 4BYYA 1OPCA 4KA4A 2FBIA 3V8JA 2O6GE 2BYVE 5DD8A 4GO1A 2FA5A 1IN7A 1GXQA 4G7HF 1EH7A 1P2FA 2OU2A 1FBSA 2A68F 3KFWX 3GFIA 2P6SA 4G6DA 2RGVA 3ABTA 5F1RA 5D8LB 1B6AA 3HIFA 2CFXA 4M74A 2HKXA 2XIGA 2KIFA 2R3SA 2W57A 2ZCWA 4UXNA 3K69A 4YFKF 4K2EA 2A69F 3CUQC 3KP6A 3WTTC 2ZMEB 2NRAC 1U3EM 1WQ2A 4XSXF 5FFXA 3WTUC 3L9FA 1HQCA 4S05A 4RAZA 5CVIA 1TQIA 1FY7A 5BQTA 1ZG5A 1B9NA 1HKQA 3TQNA 1ZG3A 4HX8A 5DV5A 3RTRA 1IZ1A 1XDUA 1HXDA 3F8MA 4A12A 4Q4ZF 4FT8A 2FEZA 3FX3A 1E2XA 3J81K 4DNCA 2EJRA 3BOQA 2GA1A 4ZH4F 1DP7P 2KJBA 1UB9A 5BPIA 1EH8A 1U5TB 1U5TA 4MQVA 5KVRA 3I58A 3FF5A 2Q0OA 3PQJA 1J59A 4HX4A 3HOTA 3ZMDA 1TBXA 3RKYA 2HEOA 4CHUA 5AIQA 4KIFA 2V79A 1FBQA 2O0YA 3Q9SA 3DF8A 3E6DA 1BOAA 2C6YA 5LLQA 2ZKZA 2IA2A 4KNYA 3KLOA 2XHKA 5BMZA 4L0ZB 3P9KA 4BQAA 4YG2F 4HYEA 3J80K 4WXHA 2IRFG 2RQPA 2GXGA 2NS0A 4HA8A 3MCZA 5CVVA 1S8NA 2L54A 4Y13A 2G7UA 3GEZA 2F5EA 3VODA 4PZJA 2VBYA 4E70A 2DFIA 1K78B 3Q9VA 2MLGA 4Q47A 1KGSA 2M8EA 1AWCA 1USTA 4L9NA 2WC2A 4HX7A 3OOPA 2ZBKA 5BS6A 2IA1A 5J8CA 1KQ9A 2HFHA 1W7PA 1KA8A 4LG0B 4GXOA 5FFZA 2FU4A 4F7ZA 2K4BA 2IT0A 4UHTA 2KRFA 2QENA 2KKOA 4AVPA 3GW2A 1O3RA 2XAJA 3FXRA 4U7BA 1Z7UA 1B59A 3WGIA 4KICA 4IXAA 3Q5FA 3WE3A 1TW2A 2XAQA 5JI6A 3ROUA 1KYWA 3LQQA 1SMYF 5LHIA 1GVJA 2Z9OA 2EV6A 4LB6B 2V1DA 2XKOA 1FP2A 4LD5A 4Y15A 4GCVA 1Z05A 4ZZDA 2VBWA 3GZ5A 4GYIA 3SHFA 1D3YA 5DUKA 2HTSA 1YS7A 4B8XA 2BE5F 4U88A 1W5TA 4EQQA 3ZN0A 3DV8A 2NNNA 3BROA 1NHAA 3LAJA 1IXCA 3G3ZA 3JSPA 3I5UA 3CTAA 5AONA 1MD0A 2V9VA 1R1VA 3NRVA 5DEQA 5ICFA 4G8XA 1XCVA 1Z9CA 3ZMVA 1RIOH 1YW7A 2RVCA 1JE8A 3I64A 2ETHA 3LQRA 1FC3A 2FNAA 4L9VA 3HUGA 1V4RA 1V3FA 5K5QA 2PI0A 1FYKA 4Z2YA 3G73A 4G7ZF 2K7LA 2CG4A 4P9UA 1REPC 3JW4A 3F22A 3J81Z 3CDHA 2X0LA 4P5OA 3WTSC 3CUQB 3KEQA 1KQ0A 3F23A 3IL2A 3K0LA 4WF2A 3DP7A 3BZ6A 2QYOA 5HLIA 1VTNC 3HSEA 4I02A 2D1HA 4R79A 2HWVA 3RYPA 5FO5A 3TKYA 2IW5A 2RDPA 2K27A 3HTSB 3R60A 2HOEA 2RNJA 2CYYA 1BIBA 5CJ9A 1KU7A 2COMA 4RB2C 2P5LC 2EFPA 5L3BA 4Q48A 2DQLA 1FNNA 1XGOA 1D8JA 4U0YA 1IXSB 1O3QA 2D45A 3H3ZA 3R0AA 1D5VA 3VFZA 5LBQA 3IHUA 2Z5UA 4BXUA 1H9GA 4RB1A 4I7HA 1YW9A 1YW8A 1KYZA 4LK1F 3F8FA 1HW2A 4CYDA 3WTYC 4ENNA 1I1GA 2DAOA 3JSOA 3E97A 3V7RA 2F5CA 5ILVA 3EYYA 2QQBA 3I59B 4G94A 3D5LA 4LGWA 1AOYA 3ELKA 1R7JA 3M1EA 4ZYDA 4OOIA 2HYFA 1LJ9A 2E7XA 3V7SA 5D5XB 1QO0D 4GGGA 1BM9A 2QM3A 3CO6C 2LSOA 2L4AA 1K79A 2HKOA 3MZHA 1P4XA 2DQRA 5HS8A 5TRDA 1SMTA 5FLXK 4MHGA 2WTEA 2STWA 5DUIA 2FMLA 2W25A 3C18A 1R5HA 2HQNA 3MAJA 1DUXC 4ZZLA 2D2WA 1PDNC 5DD4A 4KMUX 4OU0A 3LAPA 2ISYA 1LQ1A 3QOPA 2HTJA 1BI3A 5HOOA 3K1PA 1Z1DA 1ZREA 4LK0F 3DXJF 2CQKA 3SQNA 1T38A 1Z6RA 5IT3A 3P7NA 1YO5C 1G3SA 3O6BB 3ISPA 4G6QA 1S7OA 2O03A 1W5SA 5AIPA 2FRHA 3GF2A 4WXCA 3BPXA 5CYVA 2M1BA 2W24A 1R58A 3OV8A 1S29A 1L0OC 4I0AA 2CWEA 3ZMZA 4LB5A 2HZTA 3L2CA 3B02A 3HRMA 4WXDA 4YIIA 1G6NA 1DPRA 1FWZA 1R23A 2RV8A 2XV4S 1G3TA 3SZPA 4A6EA 1IXRC 1XGMA 2KIUA 2VOOA 3S2WA 3DPTA 2GQQA 2ESHA 2FOKA 4KIGA 4HDVA 2DO7A 5E1XA 3SZTA 1O3SA 1IRFA 3R0JA 1FX7A 5H20A 4IHSA 2JRTA 3T8RA 2EFOA 4L5JA 1C0WA 4U7DA 5DCMA 2ZMEA 2H6CA 3BPVA 1BI0A 1RUOA 5K1YA 1JHFA 5FB2A 5LGNA 2XROA 4I09A 4BHCA 1T39A 3WU1B 4EGZA 3IKVA 1J9IA 2HYGD 2JSCA 3MEXA 2JTVA 3GWZA 3BDDA 3LA7A 5LEJA 3B73A 2RKHA 2E1NA 3F8BA 2XRNA 2XKPA 1FT9A 1O7FA 1LNWA 4OMZA 5L3CA 5JHUA 5L3DA 3CUQA 3E3VA 1J0RA 2ZNZA 1MJAA 3DQVC 3FM5A 1H0MA 1FSEA 4JBAA 2VONA 4RGSA 2X4HA 5FGMA 3K9TA 4L9JA 1YG2A 1F5TA 1P92A 1P4WA 4HQMA 4KMFA 4NB5A 4GYGA 2L02A 4AD9A 4CICA 3KP7A 2OZ6A 2MD5A 2A3SA 3F8CA 1XB4A 1MDMB 4N9HA 1G3YA 3K2ZA 5E1WA 4FX0A 1ZLKA 1ONVA 4PGGA 4OIRF 1Z6TA 4OIPF 4OINF 4HF1A 2XGXA 2OZUA 3M9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC7 A;  4KFC A;  2E1C A;  1X3U A;  3EQL F;  5TJJ A;  1OYY A;  5D6E A;  2H94 A;  3N4M A;  3I0T A;  2M30 A;  4U0V A;  2Z33 A;  2EV5 A;  3JAM K;  2OQR A;  2P8T A;  1F1Z A;  1IN8 A;  4XRF A;  3JTH A;  3KZY A;  3HRU A;  2GA2 A;  1WSU A;  1XCB A;  3TOA A;  1T0F A;  5HS7 A;  3PQK A;  2Q2E A;  3WOD F;  2ESN A;  3LST A;  1LDK B;  3WTX C;  3ZN1 A;  1TLH B;  3ERE D;  1EV7 A;  5D5V B;  2PJP A;  2QVO A;  4UVC A;  2R7D A;  1ZH5 A;  2MH9 A;  2Q8K A;  1PUE E;  3ZPL A;  5F64 A;  3C7J A;  5HDG A;  3F6O A;  3DKW A;  3ZQ7 A;  1YYV A;  2IP2 A;  1S6L A;  1GXP A;  4OIO F;  3TOB A;  3C3W A;  6PAX A;  2DT5 A;  1QZY A;  5DCM B;  4TV7 A;  2W85 A;  2BGC A;  4LG0 A;  1ZN2 A;  2VT3 A;  3WGH A;  4HZF A;  4AIJ A;  4AWX B;  5J6X A;  3GYH X;  4CXF A;  4HV6 A;  4PGH A;  5LHH A;  2BBY A;  1Y0U A;  5LGU A;  4ON0 A;  3J80 Z;  1T2K A;  2B0L A;  3WGG A;  4A5N A;  3V8L A;  4ASN A;  4A0X A;  1CF7 B;  4CGZ A;  3MQ0 A;  3LA3 A;  1XD7 A;  3TO7 A;  2MH2 A;  4LJZ F;  2VOD A;  4EMS A;  3GXO A;  5K5O A;  3C1D A;  2DPU A;  4N9I A;  4L0Y B;  2PBI A;  3JAM Z;  1HKT A;  2QWW A;  3GLX A;  1ZLJ A;  5FD5 A;  3ZP5 A;  2EB7 A;  3RIR A;  1ZGA A;  3M8F A;  4WX9 A;  4AIH A;  2HDC A;  2VBX A;  1ZAO A;  3KP4 A;  1XGN A;  3FWE A;  1W7P B;  2EFN A;  4BNC A;  5HVQ C;  5ERI A;  4AIK A;  3TO9 A;  2QQ9 A;  3KE2 A;  3V4G A;  3DPL C;  4FX4 A;  5E1Z B;  1XGS A;  3FZV A;  3V7C A;  2PG4 A;  3TO6 A;  4JQF A;  2V6C A;  1UHW A;  1SFX A;  1YFH A;  4PDK A;  2Z99 A;  4IVN A;  2LNB A;  2M45 A;  2DW4 A;  1ZRC A;  1LEB A;  1IN6 A;  2YX7 A;  2LKP A;  1QZZ A;  1I27 A;  1KQ8 A;  2LDU A;  5D6F A;  3R61 A;  4EJO A;  2O3F A;  1KU9 A;  4EVI A;  2L01 A;  2PMU A;  2P7C B;  3I53 A;  2ELH A;  1ZRF A;  3QU3 A;  1R36 A;  4A2U A;  2L3D A;  3L00 A;  4L9T A;  5K5R A;  2E7W A;  3NEU A;  3O3K A;  2DTR A;  2W84 A;  4I0B A;  4RGU A;  4M9S A;  1FSH A;  2ISZ A;  2JT1 A;  3IKT A;  2MBF A;  5F6F A;  1SD5 A;  1BIA A;  5JVT A;  3QP6 A;  2QQA A;  1SD4 A;  2CSO A;  2UWM A;  4KDP A;  3KP2 A;  4FHT A;  4MGR A;  3R4K A;  1ZGJ A;  1HW5 A;  4A0Z A;  2YU3 A;  1Z91 A;  1UHM A;  4B09 A;  4HOB A;  4UVA A;  3U1D A;  4Q5S F;  1Q1H A;  3ZMT A;  1S7A A;  4ENK A;  2F5D A;  2GXB A;  1MKM A;  1U78 A;  3KET A;  3FMS A;  2AXL A;  1IW7 F;  3E5X A;  2XAH A;  1TQP A;  1QNT A;  1FZP B;  5CVR A;  1SFU A;  1IN5 A;  1RZ4 A;  3K1M A;  5IT9 K;  3V8K A;  2JPC A;  1O7L A;  3CLO A;  3RKX A;  2XAG A;  4I2O A;  2FE3 A;  2DK5 A;  5DCF A;  3F8N A;  4ETS A;  4U0W A;  2STT A;  3LFK A;  3E6C C;  1XSX A;  1QQI A;  1R5G A;  2M87 A;  4XBF A;  1OYW A;  4H0E A;  2GZW A;  4QWQ A;  3I71 A;  1QPM A;  4A5M A;  3GX4 X;  1I6X A;  2HS5 A;  3HOS A;  2DU9 A;  4M9Z A;  1XDS A;  3BP8 A;  1R00 A;  1ZRD A;  5EEG A;  2LF7 A;  1D8K A;  1OKR A;  4G7O F;  2Y0M A;  4RS8 A;  2VC1 A;  3FMR A;  4P9F A;  4QLC U;  3L7W A;  3ABU A;  3E6M A;  5L3E A;  4ESF A;  4R8H A;  4KN7 X;  1MJB A;  3QPT A;  2JPB A;  3BJA A;  1ZG1 A;  2UZK A;  4HF0 A;  4KUM A;  1IUY A;  2QUF A;  1EH6 A;  5E8G A;  3W6K B;  4HQE A;  1BC7 C;  3EYI A;  4IRI A;  3HHH A;  4L5I A;  2NYX A;  3R6S A;  1G3W A;  4RB0 A;  3TGN A;  3K1N A;  4S04 A;  3TDZ C;  4UNO A;  2R7F A;  3VOE A;  2PQ8 A;  3COA C;  5D5U B;  4ESB A;  4UVB A;  2DBB A;  2QZ8 A;  5DDG A;  5E18 F;  3FMQ A;  3E5U A;  2Y75 A;  4BHP A;  4ZYH A;  1HBX G;  1PP8 F;  1P4A A;  4XSZ F;  1KU3 A;  1ULY A;  4IF4 A;  3WE2 A;  2D1V A;  4UV8 A;  3I4P A;  2K02 A;  4RGX A;  4HV5 A;  1TTY A;  2EFQ A;  3TDU C;  1FPQ A;  2HGC A;  1O57 A;  1UCR A;  3L09 A;  4MNU A;  1SD7 A;  2FSW A;  5KK1 A;  1RUN A;  3RYR A;  2ZJ2 A;  2WWY A;  2FQ3 A;  4G9Y A;  4N0B A;  2OQG A;  5CLS A;  1H9T A;  5HLH A;  3EUH A;  2P5V A;  3BY6 A;  3T8T A;  1WWX A;  1T98 A;  1ZYR F;  1CF7 A;  3E6B A;  1RNL A;  2J5P A;  2VT2 A;  2DK8 A;  1I1S A;  5JFR A;  4MEX F;  3HHG A;  4Y17 A;  4BHB A;  4M71 A;  4R1H A;  2K86 A;  3HTU A;  1BI2 A;  4YIF A;  3M8E A;  1J2X A;  3SXY A;  3GFM A;  3WU0 A;  4OMY A;  1XN7 A;  2L4M A;  4O3M A;  2PN6 A;  2RN7 A;  3FXU A;  3NQO A;  3LWF A;  4IHT A;  4EJT A;  3F6V A;  2FBK A;  4HW0 A;  4XLN F;  4YFN F;  1HSJ A;  2ADU A;  1W7P D;  2OD5 A;  1U8R A;  1LB2 A;  3KP3 A;  2VOP A;  1SAX A;  3MWM A;  4I98 B;  4WK8 F;  1JXS A;  3W6J B;  4RB3 C;  1FP1 D;  1K7A A;  3HYI A;  2XVC A;  1BBY A;  1XMA A;  5E17 F;  2CW0 F;  2ACJ A;  3HRS A;  1IF1 A;  1SFE A;  1B1B A;  3EDP A;  1USS A;  1E17 A;  1IN4 A;  4ZYE A;  2VN2 A;  2NNY A;  3IRR A;  1IRG A;  2HR3 A;  3DEU A;  3T5X A;  2G7H A;  1HW1 A;  1J7K A;  4D0P A;  1GHC A;  1F9N A;  4EV0 A;  3FXQ A;  5HS9 A;  5LGT A;  2OBP A;  5CVU A;  5E8I A;  1YQA A;  3HSF A;  3RPQ A;  2DI3 A;  2FMY A;  1P6R A;  1G4D A;  3F72 A;  2VE9 A;  5CVJ A;  2RC4 A;  1HST A;  1ODD A;  3SFZ A;  4A0Y A;  1YTY A;  2O61 A;  3ECO A;  4LMY A;  1B4A A;  2FBH A;  2DLL A;  4IRH A;  2DPD A;  1BC8 C;  5BOX A;  2V1X A;  2XUB A;  4EJW A;  2TDX A;  2EWN A;  2UXN A;  4UUV A;  2F5F A;  4HDU A;  1FOK A;  4MEY F;  1FYL A;  3HSR A;  4MQ9 F;  4M6Y A;  2A6E F;  3BJO A;  2IPQ X;  4I01 A;  2BEO A;  2Z3Y A;  3JTG A;  2YSR A;  3CO7 C;  2FNP A;  3HRT A;  4XLP F;  5FLX Z;  4WWC A;  4KT5 C;  1TNS A;  3F21 A;  3MFK A;  5D8K B;  4ENM A;  1R1T A;  1J5Y A;  2A07 F;  4HBL A;  2VXZ A;  1F4K A;  2ZO4 A;  2OA4 A;  4JK1 X;  5LRS A;  1RI7 A;  1CGP A;  3KCC A;  3GFJ A;  1WI9 A;  4MTE A;  3GFL A;  3WTW C;  3T0Y A;  3LA2 A;  2IVM A;  5L3G A;  1OMI A;  1XMK A;  1XSV A;  1J75 A;  2Y48 A;  2XAF A;  4ENJ A;  3RDI A;  1ZHF A;  1IAW A;  1U6G A;  2NAZ A;  4LLL A;  5J8F A;  5D4R A;  3GZ6 A;  1BN5 A;  3H3U A;  1I5Z A;  4M73 A;  4LLN A;  2IJL A;  1UFM A;  3BWG A;  3ULQ B;  1PP7 U;  3AAF A;  1YS6 A;  1LVA A;  3H92 A;  3FHZ A;  3O2P E;  1LEA A;  4MTD A;  2OAZ A;  3KP5 A;  1QGP A;  4O5V A;  4CO8 A;  3DFG A;  2CO5 A;  1DPU A;  2YX4 A;  3I54 A;  5HLG A;  2PFB A;  4OIQ F;  3P9I A;  1LDJ A;  3M7G A;  1KU2 A;  2LF8 A;  4LLG F;  5BPD A;  3RI4 A;  4LFU A;  2PEX A;  1DDN A;  2IA0 A;  1ON2 A;  2EV0 A;  4EJU A;  4M72 A;  1L3L A;  3QPH A;  4KN4 X;  3KEO A;  3EET A;  2FF4 A;  1ZAR A;  5HDK A;  1R22 A;  1TNT A;  2H6B A;  4PCQ A;  3QU6 A;  2YPR A;  3IWF A;  4EGY A;  1K6O A;  1WRJ A;  4WCG A;  1WKM A;  4M6X A;  3F3X A;  3WTV C;  2GWR A;  2EA2 A;  2ZXJ A;  3BJ6 A;  4ESJ A;  2VC0 A;  1R1U A;  2FXA A;  4NHJ A;  4HAM A;  1MJ9 A;  3RPU A;  3VB2 A;  4L18 B;  3ECH A;  1ON1 A;  1YIO A;  4EM2 A;  2PMH A;  2P4W A;  2BV6 A;  1FYM A;  1MZB A;  2A61 A;  2ZFW A;  5JR3 A;  2P7V B;  5DYM A;  2J5O A;  5IT9 Z;  5LHG A;  2G9W A;  4M9X A;  3U9G A;  5D5W B;  2A6H F;  2QBY B;  1FLI A;  1S3J A;  5A2Q Z;  1TQM A;  4O6J A;  4P96 A;  2MC3 A;  5A2Q K;  3RKW A;  2V1U A;  2JZY A;  2KJC A;  4HLY A;  2H27 A;  1MDM A;  5D4S A;  4DQ2 A;  2ZNY A;  1BJA A;  4IRG A;  3E5Q A;  2HQR A;  4KYW A;  1T6S A;  2O8X A;  5H6Q A;  1HKS A;  4ZYG A;  2AS5 F;  3QAH A;  1O3T A;  3GO5 A;  3QP5 A;  5ICC A;  3ZMS A;  3FM3 A;  1B9M A;  5ED4 A;  5HDN A;  1SD6 A;  3T1B A;  2PLY A;  1QBJ A;  1K78 A;  3N97 A;  2UXX A;  1STZ A;  4P55 A;  1OR7 A;  3PFI A;  5ICE A;  2H09 A;  2CGP A;  2QBY A;  2M5W A;  1TW3 A;  4CZZ A;  5FD6 A;  1OYI A;  1U2W A;  4EM0 B;  3KLN A;  2YR2 A;  4A6D A;  5LEK A;  3WTZ A;  2P5K A;  3MZY A;  4IJA A;  4RAY A;  3U2R A;  4IPA A;  2A5Y B;  5ILU A;  3REO A;  3RJP A;  3WG9 A;  3I59 A;  4NQW A;  2VBZ A;  4EJV A;  3CJN A;  4BAY A;  3VEP A;  5ILS A;  3KZZ A;  5H6R A;  1W4M A;  2K4J A;  1MGT A;  2EFW A;  3ZMU A;  3D0S A;  1LDD A;  2EA4 A;  2F2E A;  4CDG A;  3ML6 A;  1XSD A;  1JHH A;  2XAS A;  1JGS A;  1FBU A;  1YLF A;  4HLX A;  2MLK A;  4RGR A;  4KIB A;  2GIV A;  3P9C A;  2WV0 A;  1BI1 A;  3GUD A;  3IRQ A;  3IWZ A;  1A04 A;  2KIM A;  1U5T C;  4EM1 A;  3CUO A;  2VE8 A;  2GAU A;  4HF2 A;  5EEH A;  5LRR A;  4YFX F;  4UV9 A;  2MA3 A;  2EK5 A;  3J7A O;  3QRF F;  2QLZ A;  3GVA A;  4BH9 A;  2P6T A;  5L3F A;  5ICG A;  5E20 A;  4BYY A;  1OPC A;  4KA4 A;  2FBI A;  3V8J A;  2O6G E;  2BYV E;  5DD8 A;  4GO1 A;  2FA5 A;  1IN7 A;  1GXQ A;  4G7H F;  1EH7 A;  1P2F A;  2OU2 A;  1FBS A;  2A68 F;  3KFW X;  3GFI A;  2P6S A;  4G6D A;  2RGV A;  3ABT A;  5F1R A;  5D8L B;  1B6A A;  3HIF A;  2CFX A;  4M74 A;  2HKX A;  2XIG A;  2KIF A;  2R3S A;  2W57 A;  2ZCW A;  4UXN A;  3K69 A;  4YFK F;  4K2E A;  2A69 F;  3CUQ C;  3KP6 A;  3WTT C;  2ZME B;  2NRA C;  1U3E M;  1WQ2 A;  4XSX F;  5FFX A;  3WTU C;  3L9F A;  1HQC A;  4S05 A;  4RAZ A;  5CVI A;  1TQI A;  1FY7 A;  5BQT A;  1ZG5 A;  1B9N A;  1HKQ A;  3TQN A;  1ZG3 A;  4HX8 A;  5DV5 A;  3RTR A;  1IZ1 A;  1XDU A;  1HXD A;  3F8M A;  4A12 A;  4Q4Z F;  4FT8 A;  2FEZ A;  3FX3 A;  1E2X A;  3J81 K;  4DNC A;  2EJR A;  3BOQ A;  2GA1 A;  4ZH4 F;  1DP7 P;  2KJB A;  1UB9 A;  5BPI A;  1EH8 A;  1U5T B;  1U5T A;  4MQV A;  5KVR A;  3I58 A;  3FF5 A;  2Q0O A;  3PQJ A;  1J59 A;  4HX4 A;  3HOT A;  3ZMD A;  1TBX A;  3RKY A;  2HEO A;  4CHU A;  5AIQ A;  4KIF A;  2V79 A;  1FBQ A;  2O0Y A;  3Q9S A;  3DF8 A;  3E6D A;  1BOA A;  2C6Y A;  5LLQ A;  2ZKZ A;  2IA2 A;  4KNY A;  3KLO A;  2XHK A;  5BMZ A;  4L0Z B;  3P9K A;  4BQA A;  4YG2 F;  4HYE A;  3J80 K;  4WXH A;  2IRF G;  2RQP A;  2GXG A;  2NS0 A;  4HA8 A;  3MCZ A;  5CVV A;  1S8N A;  2L54 A;  4Y13 A;  2G7U A;  3GEZ A;  2F5E A;  3VOD A;  4PZJ A;  2VBY A;  4E70 A;  2DFI A;  1K78 B;  3Q9V A;  2MLG A;  4Q47 A;  1KGS A;  2M8E A;  1AWC A;  1UST A;  4L9N A;  2WC2 A;  4HX7 A;  3OOP A;  2ZBK A;  5BS6 A;  2IA1 A;  5J8C A;  1KQ9 A;  2HFH A;  1W7P A;  1KA8 A;  4LG0 B;  4GXO A;  5FFZ A;  2FU4 A;  4F7Z A;  2K4B A;  2IT0 A;  4UHT A;  2KRF A;  2QEN A;  2KKO A;  4AVP A;  3GW2 A;  1O3R A;  2XAJ A;  3FXR A;  4U7B A;  1Z7U A;  1B59 A;  3WGI A;  4KIC A;  4IXA A;  3Q5F A;  3WE3 A;  1TW2 A;  2XAQ A;  5JI6 A;  3ROU A;  1KYW A;  3LQQ A;  1SMY F;  5LHI A;  1GVJ A;  2Z9O A;  2EV6 A;  4LB6 B;  2V1D A;  2XKO A;  1FP2 A;  4LD5 A;  4Y15 A;  4GCV A;  1Z05 A;  4ZZD A;  2VBW A;  3GZ5 A;  4GYI A;  3SHF A;  1D3Y A;  5DUK A;  2HTS A;  1YS7 A;  4B8X A;  2BE5 F;  4U88 A;  1W5T A;  4EQQ A;  3ZN0 A;  3DV8 A;  2NNN A;  3BRO A;  1NHA A;  3LAJ A;  1IXC A;  3G3Z A;  3JSP A;  3I5U A;  3CTA A;  5AON A;  1MD0 A;  2V9V A;  1R1V A;  3NRV A;  5DEQ A;  5ICF A;  4G8X A;  1XCV A;  1Z9C A;  3ZMV A;  1RIO H;  1YW7 A;  2RVC A;  1JE8 A;  3I64 A;  2ETH A;  3LQR A;  1FC3 A;  2FNA A;  4L9V A;  3HUG A;  1V4R A;  1V3F A;  5K5Q A;  2PI0 A;  1FYK A;  4Z2Y A;  3G73 A;  4G7Z F;  2K7L A;  2CG4 A;  4P9U A;  1REP C;  3JW4 A;  3F22 A;  3J81 Z;  3CDH A;  2X0L A;  4P5O A;  3WTS C;  3CUQ B;  3KEQ A;  1KQ0 A;  3F23 A;  3IL2 A;  3K0L A;  4WF2 A;  3DP7 A;  3BZ6 A;  2QYO A;  5HLI A;  1VTN C;  3HSE A;  4I02 A;  2D1H A;  4R79 A;  2HWV A;  3RYP A;  5FO5 A;  3TKY A;  2IW5 A;  2RDP A;  2K27 A;  3HTS B;  3R60 A;  2HOE A;  2RNJ A;  2CYY A;  1BIB A;  5CJ9 A;  1KU7 A;  2COM A;  4RB2 C;  2P5L C;  2EFP A;  5L3B A;  4Q48 A;  2DQL A;  1FNN A;  1XGO A;  1D8J A;  4U0Y A;  1IXS B;  1O3Q A;  2D45 A;  3H3Z A;  3R0A A;  1D5V A;  3VFZ A;  5LBQ A;  3IHU A;  2Z5U A;  4BXU A;  1H9G A;  4RB1 A;  4I7H A;  1YW9 A;  1YW8 A;  1KYZ A;  4LK1 F;  3F8F A;  1HW2 A;  4CYD A;  3WTY C;  4ENN A;  1I1G A;  2DAO A;  3JSO A;  3E97 A;  3V7R A;  2F5C A;  5ILV A;  3EYY A;  2QQB A;  3I59 B;  4G94 A;  3D5L A;  4LGW A;  1AOY A;  3ELK A;  1R7J A;  3M1E A;  4ZYD A;  4OOI A;  2HYF A;  1LJ9 A;  2E7X A;  3V7S A;  5D5X B;  1QO0 D;  4GGG A;  1BM9 A;  2QM3 A;  3CO6 C;  2LSO A;  2L4A A;  1K79 A;  2HKO A;  3MZH A;  1P4X A;  2DQR A;  5HS8 A;  5TRD A;  1SMT A;  5FLX K;  4MHG A;  2WTE A;  2STW A;  5DUI A;  2FML A;  2W25 A;  3C18 A;  1R5H A;  2HQN A;  3MAJ A;  1DUX C;  4ZZL A;  2D2W A;  1PDN C;  5DD4 A;  4KMU X;  4OU0 A;  3LAP A;  2ISY A;  1LQ1 A;  3QOP A;  2HTJ A;  1BI3 A;  5HOO A;  3K1P A;  1Z1D A;  1ZRE A;  4LK0 F;  3DXJ F;  2CQK A;  3SQN A;  1T38 A;  1Z6R A;  5IT3 A;  3P7N A;  1YO5 C;  1G3S A;  3O6B B;  3ISP A;  4G6Q A;  1S7O A;  2O03 A;  1W5S A;  5AIP A;  2FRH A;  3GF2 A;  4WXC A;  3BPX A;  5CYV A;  2M1B A;  2W24 A;  1R58 A;  3OV8 A;  1S29 A;  1L0O C;  4I0A A;  2CWE A;  3ZMZ A;  4LB5 A;  2HZT A;  3L2C A;  3B02 A;  3HRM A;  4WXD A;  4YII A;  1G6N A;  1DPR A;  1FWZ A;  1R23 A;  2RV8 A;  2XV4 S;  1G3T A;  3SZP A;  4A6E A;  1IXR C;  1XGM A;  2KIU A;  2VOO A;  3S2W A;  3DPT A;  2GQQ A;  2ESH A;  2FOK A;  4KIG A;  4HDV A;  2DO7 A;  5E1X A;  3SZT A;  1O3S A;  1IRF A;  3R0J A;  1FX7 A;  5H20 A;  4IHS A;  2JRT A;  3T8R A;  2EFO A;  4L5J A;  1C0W A;  4U7D A;  5DCM A;  2ZME A;  2H6C A;  3BPV A;  1BI0 A;  1RUO A;  5K1Y A;  1JHF A;  5FB2 A;  5LGN A;  2XRO A;  4I09 A;  4BHC A;  1T39 A;  3WU1 B;  4EGZ A;  3IKV A;  1J9I A;  2HYG D;  2JSC A;  3MEX A;  2JTV A;  3GWZ A;  3BDD A;  3LA7 A;  5LEJ A;  3B73 A;  2RKH A;  2E1N A;  3F8B A;  2XRN A;  2XKP A;  1FT9 A;  1O7F A;  1LNW A;  4OMZ A;  5L3C A;  5JHU A;  5L3D A;  3CUQ A;  3E3V A;  1J0R A;  2ZNZ A;  1MJA A;  3DQV C;  3FM5 A;  1H0M A;  1FSE A;  4JBA A;  2VON A;  4RGS A;  2X4H A;  5FGM A;  3K9T A;  4L9J A;  1YG2 A;  1F5T A;  1P92 A;  1P4W A;  4HQM A;  4KMF A;  4NB5 A;  4GYG A;  2L02 A;  4AD9 A;  4CIC A;  3KP7 A;  2OZ6 A;  2MD5 A;  2A3S A;  3F8C A;  1XB4 A;  1MDM B;  4N9H A;  1G3Y A;  3K2Z A;  5E1W A;  4FX0 A;  1ZLK A;  1ONV A;  4PGG A;  4OIR F;  1Z6T A;  4OIP F;  4OIN F;  4HF1 A;  2XGX A;  2OZU A;  3M9A A; 
#chains in the Genus database with same CATH topology
 3IC7 A;  4KFC A;  4CCN A;  4UB8 C;  2E1C A;  1ERD A;  1X3U A;  3EQL F;  5TJJ A;  3S3M A;  1OYY A;  5K7H A;  3JRE A;  4I76 A;  1DU6 A;  1T8I A;  5D6E A;  1XG1 A;  4N4O B;  2H94 A;  3N4M A;  3I0T A;  2M30 A;  4U0V A;  2DMP A;  2Z33 A;  2EV5 A;  2L7Z A;  1DGW Y;  5HNH A;  3JAM K;  3LSP A;  2X85 A;  2CJJ A;  4ITV A;  2OQR A;  2YS9 A;  2P8T A;  4XK4 A;  1OQY A;  1RRJ A;  1F1Z A;  1IN8 A;  4XRF A;  3JTH A;  3KZY A;  1RR8 C;  3KYL A;  4E7L A;  2X1E A;  3QOE A;  4YIR X;  3HRU A;  2GA2 A;  3BR1 A;  4H4K C;  1WSU A;  1XCB A;  3TOA A;  4PFP A;  3OSG A;  1T0F A;  4FTH A;  4S0H B;  3LSH A;  3K4J A;  5HS7 A;  5J1Y A;  3HZJ A;  1WPK A;  3PQK A;  1LFP A;  3IP4 B;  2Q2E A;  3WOD F;  2E71 A;  3B6A A;  1X1B A;  2ESN A;  4QPQ A;  3LST A;  3CZ6 A;  1FMW A;  1LDK B;  1YOV B;  1RET A;  1OFC X;  3WTX C;  1SFO J;  3ZN1 A;  1TLH B;  1Z3X A;  3ERE D;  1EV7 A;  5D5V B;  2PJP A;  5GAH J;  3HKZ N;  2DA1 A;  2QVO A;  4UVC A;  2R7D A;  1ZH5 A;  2MH9 A;  2Q8K A;  1PUE E;  1W5C C;  3WU2 C;  3ZPL A;  5F64 A;  3C7J A;  3KZI C;  5HDG A;  3F6O A;  1VQ6 I;  3DKW A;  3ZRG A;  1UMQ A;  3ZQ7 A;  3JRA A;  1JUP A;  5IYD J;  4UY8 I;  1YYV A;  3M3Y J;  2HPI A;  2IP2 A;  1S6L A;  1U8B A;  1GXP A;  2X6O A;  4OIO F;  4NC7 A;  1YJN I;  4IOA F;  3TOB A;  4XRM A;  3C3W A;  4XRS A;  6PAX A;  2DT5 A;  1QZY A;  5DCM B;  3VYS B;  4TV7 A;  3FXL A;  2W85 A;  2BGC A;  3AG1 H;  4LG0 A;  4DIQ A;  1D5Y A;  2LKX A;  2WBM A;  2X1C A;  1FEX A;  1ZN2 A;  2FUG 2;  2VT3 A;  4E7K A;  3BG6 A;  3WGH A;  4HZF A;  4AIJ A;  2DMT A;  4AWX B;  5J6X A;  2VIX A;  3GYH X;  4CXF A;  4IQ4 A;  2DJI A;  1MSF C;  4HV6 A;  4PGH A;  2LR8 A;  3G1L A;  5IOZ A;  5LHH A;  2BBY A;  3Q0V A;  1IV6 A;  4IEJ A;  1Y0U A;  5LGU A;  2KLO A;  1S7E A;  4ON0 A;  2XGD A;  4BXX J;  3J80 Z;  3H0G J;  1N25 A;  1T2K A;  2B0L A;  3EUK L;  3WGG A;  4A5N A;  3V8L A;  4ASN A;  3PL8 A;  3ESW B;  2RAE A;  1X2M A;  2VJJ A;  4A0X A;  3MKY B;  3E7L A;  1CF7 B;  4CGZ A;  5FRM A;  3MQ0 A;  3LA3 A;  3LSJ A;  1XD7 A;  2DOD A;  2XAU A;  3K7A J;  3OWT A;  3JRG A;  3TO7 A;  2MH2 A;  1HDD C;  4BS9 A;  3DLL F;  2HXO A;  1N78 A;  4LJZ F;  3BT9 A;  2VOD A;  4BEH A;  2K3P A;  4EMS A;  4XNF A;  3GXO A;  5K5O A;  2P0W A;  3C1D A;  1PUF A;  2DPU A;  4N9I A;  1B8I B;  4X1E A;  4L0Y B;  2X9D A;  2PBI A;  3JAM Z;  1HKT A;  2QWW A;  4NQW B;  3RZO J;  3GLX A;  1ZLJ A;  1ETX A;  2WAE A;  2KZV A;  4PJ0 C;  5FD5 A;  3ZP5 A;  2EB7 A;  3RIR A;  3SFI A;  2RQQ A;  1ZGA A;  4II2 A;  9ANT A;  3JRH A;  4HPQ A;  3OYL A;  3M8F A;  4MO7 A;  3OYD A;  4WX9 A;  4AIH A;  2HDC A;  2VBX A;  2EH3 A;  1ZAO A;  1Z3Y A;  3KP4 A;  1YI2 I;  1XGN A;  3FWE A;  1TWA J;  1W7P B;  1Y39 A;  2EFN A;  2ID3 A;  2M4G A;  4BNC A;  3MVP A;  5HVQ C;  5EEA A;  5ERI A;  1HDP A;  4LIT A;  1ETO A;  4AIK A;  5C4X J;  2R7Q A;  3TO9 A;  3GTP J;  2QQ9 A;  5E3L A;  3M07 A;  3KE2 A;  3V4G A;  3DPL C;  4FX4 A;  2ZXH A;  5E1Z B;  1XGS A;  2OPT A;  3BR6 A;  5M5Y J;  3OIO A;  1SAN A;  1NG7 A;  3FZV A;  3V7C A;  2PG4 A;  1VZ0 A;  3TO6 A;  4XR6 A;  4JQF A;  1SAU A;  4JX4 A;  2O5R A;  2V6C A;  1UHW A;  1SFX A;  1Y56 A;  1YFH A;  4PDK A;  2Z99 A;  4IVN A;  3S1R J;  2HQ5 A;  3JRI A;  2K9S A;  2LNB A;  2M45 A;  2DW4 A;  1ZRC A;  1HF0 A;  4RAF A;  1LEB A;  5DS9 A;  3H36 A;  4UB6 C;  1IN6 A;  4BUP A;  3BLY A;  2YX7 A;  2LKP A;  4QIW N;  1QZZ A;  1I27 A;  1MBJ A;  1KQ8 A;  2LDU A;  1U0J A;  1WCM J;  1ZR4 A;  1RKW A;  5D6F A;  3R61 A;  4EJO A;  2O3F A;  1KU9 A;  4EVI A;  2R5Y A;  2L01 A;  1AHD P;  2QSF X;  2PMU A;  2HOS A;  2P7C B;  4IKF A;  3PUF A;  3CMY A;  2DA7 A;  2K3F A;  3I53 A;  3HGY A;  2ELH A;  1ZRF A;  3A0H C;  3OOU A;  1R36 A;  2JK3 A;  3QU3 A;  4A2U A;  2L3D A;  5KAI C;  3L00 A;  4L9T A;  2KHM A;  3PSF A;  4YEJ A;  3S93 A;  5K5R A;  2E7W A;  3NEU A;  3O3K A;  2DTR A;  2W84 A;  4I0B A;  4RGU A;  5EG0 A;  5FKL A;  4M9S A;  5EG0 B;  1FSH A;  2ISZ A;  2JT1 A;  2QA4 I;  1LE8 B;  3IKT A;  2MBF A;  1Z0X A;  3S14 J;  5F6F A;  3JRB A;  4RMN A;  3RQ4 A;  1SD5 A;  2Y30 A;  1BIA A;  5JVT A;  1VQ9 I;  3G1M A;  2ZSI B;  2QQA A;  3ASN H;  1SD4 A;  3QP6 A;  3PNV A;  2CSO A;  4AYB N;  4Y3O A;  2UWM A;  2VKH A;  4KDP A;  3KP2 A;  4FHT A;  4MGR A;  2XPU A;  3N05 A;  3R4K A;  1ZGJ A;  1B72 A;  1HW5 A;  4A0Z A;  2R93 J;  2YU3 A;  4M3E A;  1Z91 A;  1UHM A;  2FX0 A;  4B09 A;  2XB0 X;  1UJ8 A;  1D0Y A;  4HOB A;  4UVA A;  3U1D A;  4Q5S F;  1Q1H A;  1CQT A;  2LC2 A;  2ID6 A;  3G2B A;  3ZMT A;  1S7A A;  4ENK A;  2F5D A;  3DU5 A;  3BZK A;  1AU7 A;  2GXB A;  1MKM A;  1U78 A;  1Y6I A;  3W2A A;  3KET A;  3FMS A;  2NVU B;  2AXL A;  1IW7 F;  3E5X A;  4A93 J;  1IG7 A;  2QSH X;  2XAH A;  1TQP A;  1E0E A;  1QNT A;  1FZP B;  3SDB A;  2BZT A;  5CPR B;  2W4S A;  2KFD A;  5IOY A;  1MND A;  3PIO F;  5CVR A;  4AUX A;  1R6R A;  4OAY A;  4RM2 A;  1SFU A;  1IN5 A;  2EZI A;  1RZ4 A;  1X58 A;  4XLH A;  3A01 B;  2DFF A;  3K1M A;  4XL9 A;  5IT9 K;  3V8K A;  2JPC A;  5C3E J;  1O7L A;  1WJE A;  3CLO A;  3RKX A;  2IGK A;  2XAG A;  4I2O A;  3HOZ J;  3VSL A;  2FE3 A;  4X6A J;  4D5F A;  2DK5 A;  3Q0W A;  5DCF A;  3F8N A;  4ETS A;  1Z21 A;  1R71 A;  4GDF A;  4U0W A;  4FIS A;  2AQE A;  3HGG A;  2STT A;  3LFK A;  2KL4 A;  3FHN A;  3E6C C;  4E7H A;  1XSX A;  3HPG A;  2R7S A;  1QQI A;  4FCY A;  2WY8 Q;  1TWC J;  1QVU A;  1R5G A;  1JKR C;  2F6C A;  2M87 A;  4XBF A;  1OYW A;  4H0E A;  2H8W A;  2GZW A;  4QWQ A;  4RM3 A;  3I71 A;  1QPM A;  3P5J A;  4NC8 A;  4A5M A;  3GX4 X;  3M1C A;  2HDD A;  1I6X A;  3B6C A;  2VQL A;  2HS5 A;  3HOS A;  2DU9 A;  2MYS A;  4M9Z A;  3S15 J;  2H1L A;  1XDS A;  1BW5 A;  3BP8 A;  1R5I D;  3MZ8 A;  4XID A;  3CCR I;  1R00 A;  4F3Q A;  2XF6 A;  1TZL A;  4PUS A;  2BVM A;  4BJ6 C;  1ZRD A;  1A5J A;  5EEG A;  2LF7 A;  4A3B J;  1F43 A;  3FBN B;  4V2F A;  1D8K A;  4B1R A;  1OKR A;  2R0Q C;  4G7O F;  3HEF A;  2Y0M A;  4II3 A;  4RS8 A;  2VC1 A;  3FMR A;  4P9F A;  4QLC U;  2NVQ J;  2JSP A;  3ZQH A;  3L7W A;  3ABU A;  3E6M A;  4CCK A;  3LSG A;  5L3E A;  4ESF A;  4L5E A;  1ZR2 A;  2I10 A;  3TBI A;  4R8H A;  4KN7 X;  3AL0 B;  4UUS A;  1U9O A;  2TCT A;  3CMA I;  3SYT A;  1MJB A;  3QPT A;  3F0C A;  2JPB A;  3BJA A;  4CYC A;  1ZG1 A;  2UZK A;  4HF0 A;  3LSI A;  1XPX A;  4KUM A;  5EF6 A;  1IUY A;  1UG2 A;  5J47 A;  2QUF A;  2F48 A;  2R5Z B;  4XKW A;  2W7N A;  1EH6 A;  3I9V 2;  5E8G A;  3W6K B;  4RDU A;  3X2Q H;  4HQE A;  1BC7 C;  3EYI A;  4IRI A;  2WAQ N;  2VUM J;  5EGO A;  1VQP I;  3HHH A;  4L5I A;  1OCP A;  2NYX A;  3R6S A;  1G3W A;  1I50 J;  3FK6 A;  4RB0 A;  3TGN A;  5E79 C;  2BY2 A;  3K1N A;  4S04 A;  3TDZ C;  3GTM J;  2ECB A;  4OAZ A;  4UNO A;  1OLT A;  2R7F A;  3JR9 A;  4NNJ A;  2JJ7 A;  4BDZ A;  3VOE A;  2OF7 A;  2CRG A;  2PQ8 A;  3COA C;  5D5U B;  2CQ7 A;  2E1M C;  4ESB A;  4UVB A;  2DBB A;  2QZ8 A;  3K4M A;  4NBQ A;  2VPR A;  5DDG A;  4RBO A;  3FMQ A;  5E18 F;  3E5U A;  2Y75 A;  4BHP A;  3JRC A;  4ZYH A;  1ETK A;  2OUM A;  2VXD A;  4AC0 A;  2HI3 A;  1P4A A;  3C2G A;  4XSZ F;  1PP8 F;  1HBX G;  3TL4 X;  1G2H A;  1OJL A;  5F0F A;  1KU3 A;  1ULY A;  4IF4 A;  5J40 A;  3WE2 A;  2D1V A;  4UV8 A;  3HBL A;  2DMU A;  2K02 A;  3I4P A;  5EYR A;  4RGX A;  4BGD A;  4HV5 A;  1TTY A;  1IC8 A;  2VJI A;  4LOC A;  3CC2 I;  2M34 A;  2Y69 H;  2EFQ A;  5JHF A;  1GUU A;  2CV0 A;  3TDU C;  1FPQ A;  1JGG A;  2HGC A;  3FXK A;  4A3M J;  2ZXI A;  3M8J A;  1O57 A;  3OYG A;  3A02 A;  1UCR A;  3L09 A;  4MNU A;  1SD7 A;  4DZJ A;  2F5V A;  2FSW A;  5KK1 A;  1RUN A;  3RYR A;  2ZJ2 A;  3ZQG A;  2WWY A;  5EZG A;  4C3I J;  2FQ3 A;  4G9Y A;  3FDY A;  2R7V A;  4N0B A;  1S72 I;  2OQG A;  5GTH C;  5CLS A;  1H9T A;  3KPH A;  1VFC A;  5HLH A;  3EUH A;  2VL8 A;  2P5V A;  3LMM A;  2V26 A;  3BY6 A;  5LD2 C;  3U21 A;  3T8T A;  4BL0 B;  3S2D J;  3PFY A;  4J19 A;  2L9V A;  3HB9 A;  3FIW A;  1WWX A;  4J01 A;  2NS7 A;  4IZZ A;  1T98 A;  1ZYR F;  3K4B A;  1CF7 A;  4AID A;  2Y31 A;  3E6B A;  1HCR A;  1RNL A;  2J5P A;  2VT2 A;  2DK8 A;  1I1S A;  3H9G A;  5JFR A;  1N77 A;  4MEX F;  3HHG A;  4QTR A;  3CD6 I;  4Y17 A;  2QGU A;  4BHB A;  3J7Y J;  4M71 A;  4R1H A;  3GTQ J;  2K86 A;  3HTU A;  1BI2 A;  4YIF A;  3M8E A;  2LRE A;  2DMQ A;  1J2X A;  3SXY A;  2WB1 A;  2KZG A;  3GFM A;  5C44 J;  1MNM C;  3WU0 A;  3VYT B;  4OMY A;  2XPV A;  1XN7 A;  2L4M A;  3BQY A;  4O3M A;  3SJM A;  2PN6 A;  2RN7 A;  3FXU A;  3NQO A;  1FIA A;  1WJC A;  4MIM A;  2X1D A;  2KT0 A;  4KIT B;  3LWF A;  4HEA 2;  2HOT A;  4IHT A;  1UG0 A;  4EJT A;  3ZXS A;  3F6V A;  2FBK A;  3U1K A;  2BHZ A;  4M6V A;  4HW0 A;  3OYN A;  2VQG A;  3CCE I;  1AKH A;  4XMY A;  3VYU B;  4XLN F;  4YFN F;  2K9L A;  3NWS A;  1VQO I;  1PVE A;  2X6X A;  3CDI A;  1HSJ A;  2ADU A;  1W7P D;  2OD5 A;  1U8R A;  1LB2 A;  3KP3 A;  2E1O A;  2QF7 A;  2JVG A;  3ZGK A;  1SAX A;  2VAS A;  3MWM A;  4KT6 A;  4I98 B;  4WK8 F;  1JXS A;  3E0J B;  5HLT A;  3W6J B;  4V19 K;  3OIQ A;  4GRI A;  4RB3 C;  3I4N J;  1FP1 D;  1K7A A;  2W1O A;  3HYI A;  2XVC A;  2Y9Y A;  1BBY A;  1XMA A;  4C3J J;  1MH4 A;  5E17 F;  1OCR H;  2R7W A;  2CW0 F;  1Z77 A;  2ACJ A;  3HRS A;  2VLA A;  1IF1 A;  1SFE A;  2LOO A;  1B1B A;  2R92 J;  2KIS A;  3EDP A;  1USS A;  1E17 A;  1IN4 A;  4ZYE A;  2VN2 A;  2NNY A;  2LH9 A;  3HOU J;  1EF4 A;  3IRR A;  1ZGW A;  1IRG A;  2HR3 A;  3DEU A;  1RES A;  3SEQ A;  2CH0 A;  3H35 A;  4B4C A;  2HNH A;  3FXM A;  3OYH A;  3T5X A;  2FOW A;  3D1N I;  2G7H A;  1HW1 A;  1J7K A;  4D0P A;  1GHC A;  1F9N A;  3FKI J;  4BXF A;  2R5Y B;  1ITY A;  2L2O A;  4EV0 A;  3FXQ A;  5HS9 A;  5LGT A;  2OBP A;  2OC6 A;  1WZ2 A;  3LSR A;  5CVU A;  2HXI A;  1TP4 A;  3K6G A;  2XSD C;  2WV1 A;  2PJR B;  5E8I A;  1YQA A;  4AU7 A;  3HSF A;  2NVY J;  3RPQ A;  2CQQ A;  2DI3 A;  4CUG A;  1FOY A;  1NTC A;  3UKG A;  1HLV A;  2FMY A;  1P6R A;  1X3W B;  1G4D A;  3F72 A;  2GXA A;  1TWH J;  2M2E A;  2VE9 A;  5CVJ A;  1AKH B;  2RC4 A;  2JA8 J;  3NWT A;  1HST A;  1ODD A;  3K70 D;  3SFZ A;  2ZFU A;  4A0Y A;  2IXS A;  1YTY A;  2O61 A;  3ECO A;  4LMY A;  5J4V A;  2BW3 B;  3OYF A;  3PUB A;  2VJ5 A;  2CQN A;  1B4A A;  2WA0 A;  2FBH A;  2DLL A;  2CU7 A;  4IRH A;  2Z1D A;  5F27 A;  3OYI A;  2IS6 A;  2DPD A;  1X4P A;  1BC8 C;  5BOX A;  1R9T J;  5CKT A;  2N8G A;  2V1X A;  2ZSH B;  3KEY A;  1JJ8 C;  3UR3 C;  3ZOB A;  2ME0 A;  2XUB A;  4EJW A;  2TDX A;  2EWN A;  2UXN A;  4UUV A;  2F5F A;  4HDU A;  5CQG A;  1FOK A;  4MEY F;  4ABZ A;  4CCO A;  1FYL A;  3PO2 J;  1BR4 A;  2EZL A;  3HSR A;  4MQ9 F;  4M6Y A;  2A6E F;  1VQM I;  1JUM A;  3BJO A;  2IPQ X;  3GTL J;  4I01 A;  2Z3Y A;  2BEO A;  3JTG A;  2R7X A;  3AG3 H;  3OS0 A;  3AG2 H;  2LP0 A;  2YSR A;  1VQ5 I;  3CO7 C;  2CW7 A;  2FNP A;  2FQ4 A;  3HRT A;  2PMZ A;  4XLP F;  3AL0 C;  5FLX Z;  4WWC A;  3IH4 A;  4KT5 C;  1JUS A;  1NG6 A;  1TNS A;  2EIL H;  3F21 A;  3CES A;  4BJT A;  4IO9 F;  3MFK A;  2OJE D;  2LY9 A;  5D8K B;  4ENM A;  1R1T A;  1J5Y A;  1MBF A;  2A07 F;  4HBL A;  2VXZ A;  1YJW I;  1F4K A;  1JKQ C;  2ZO4 A;  2OA4 A;  4M3D A;  1WJB A;  2JMW A;  4JK1 X;  5LRS A;  1RI7 A;  4F93 B;  4F91 B;  2Y0S A;  3JRD A;  4HG2 A;  1CGP A;  3L1P A;  3KCC A;  2DOE A;  3GFJ A;  1WI9 A;  2D5V A;  4MTE A;  3GFL A;  2ZC2 A;  3CJR B;  3OR1 C;  3WTW C;  3T0Y A;  2KQR A;  1GDT A;  3LA2 A;  2LMD A;  3DKX A;  5B1A H;  4BEH B;  3S32 A;  3A1Y A;  1O4X A;  1P7J A;  2IVM A;  5L3G A;  1OMI A;  1XMK A;  1EJ9 A;  1XSV A;  5EDN A;  1W0T A;  1J75 A;  2Y48 A;  4DBR A;  2XAF A;  4ENJ A;  2OTL I;  3RDI A;  1ZHF A;  1IAW A;  1U6G A;  2NAZ A;  2M7A A;  4LLL A;  5J8F A;  1OCC H;  2EIJ H;  2JRM A;  5D4R A;  3GZ6 A;  1BN5 A;  1XX5 A;  3H3U A;  1I5Z A;  1LPQ A;  2R7O A;  4M73 A;  4LLN A;  4C2M J;  2IJL A;  1UFM A;  3BWG A;  1BW6 A;  3ULQ B;  4NDL A;  1PP7 U;  3AAF A;  1YS6 A;  4DBQ A;  2MG4 A;  1LVA A;  3C2H A;  2MAB A;  3H92 A;  2AHQ A;  3FHZ A;  3O2P E;  1LEA A;  4MTD A;  3TP3 A;  2OAZ A;  3HC7 A;  3KP5 A;  1ZEL A;  1QGP A;  2LVS A;  4O5V A;  3IAS 2;  3OS1 A;  1H89 C;  4CO8 A;  2R7Z J;  1IGN A;  2DYR H;  1ETW A;  3DFG A;  2CO5 A;  1NK2 P;  3V42 A;  1ZQ3 P;  1DPU A;  1Z7L A;  2YX4 A;  3I54 A;  5HLG A;  2XGE A;  2G0E A;  3HUG B;  4Y33 A;  1PUF B;  2KIQ A;  1BJZ A;  2PFB A;  4OIQ F;  3P9I A;  1LDJ A;  3PNY A;  4IQJ A;  3M7G A;  4XOT A;  4JX6 A;  1KU2 A;  2L9N A;  2LF8 A;  3BCA A;  4LLG F;  5BPD A;  5GAE J;  1MMN A;  5CQE A;  1MH3 A;  3CQZ J;  3RI4 A;  4ZDP A;  3CLQ A;  3IH3 A;  1W1W E;  2PEX A;  4LFU A;  4BKX A;  3OYB A;  1SVL A;  1DDN A;  2HVR A;  4HST A;  1T08 B;  4XOR A;  2IA0 A;  1JTX A;  1ON2 A;  2EV0 A;  4EJU A;  4M72 A;  1L3L A;  4DJA A;  5FKK A;  3QPH A;  4KN4 X;  3KEO A;  2DCE A;  3EET A;  4ZTF A;  4FE4 A;  3OL4 A;  2FF4 A;  2E60 A;  5B5E C;  1LFU P;  1ZAR A;  4B47 A;  5HDK A;  2NVT J;  1R22 A;  1TNT A;  2H6B A;  3DCF A;  2E2J J;  4PCQ A;  3QU6 A;  2YPR A;  3VWB A;  4IL6 C;  3IWF A;  3K4K A;  4EGY A;  4E4H A;  1K6O A;  1WRJ A;  5GPC A;  4WCG A;  1WKM A;  2AO9 A;  4XN0 A;  3FXO A;  3K10 A;  4M6X A;  2OCC H;  2WAQ A;  5J4Y A;  3F3X A;  3WTV C;  2GWR A;  2EA2 A;  3OYJ A;  3CMM A;  2ZXJ A;  2CUE A;  3BJ6 A;  4ESJ A;  1GLN A;  2VC0 A;  1R1U A;  2FXA A;  4NHJ A;  4HAM A;  1Z67 A;  3H5N A;  3W2W A;  3DBL B;  2KRC A;  1MJ9 A;  2L9R A;  2O7O A;  1I39 A;  3CJT B;  3RPU A;  2V6E A;  3VB2 A;  4L18 B;  3ECH A;  1ON1 A;  3CF2 A;  3HOY J;  3S1N J;  1JKP C;  3S2H J;  1YIO A;  3S16 J;  1YX5 A;  4N4N B;  4EM2 A;  2PMH A;  3BG9 A;  4DYQ A;  1EKE A;  4W97 A;  2ZJR F;  3TED A;  2P4W A;  5EZH A;  2BV6 A;  4A3E J;  1WJF A;  3DEW A;  1G59 A;  1FYM A;  5M3M J;  1MZB A;  2A61 A;  2ZFW A;  1WHU A;  5JR3 A;  3W2V A;  2DMN A;  2P7V B;  5DYM A;  4XIC A;  2J5O A;  1FTZ A;  3EUA A;  5DTD A;  3VPR A;  5IT9 Z;  3DTK A;  1E3O C;  4BU2 A;  5LHG A;  2G9W A;  2YU9 J;  1WH5 A;  4M9X A;  4HNV A;  3U9G A;  5D5W B;  2A6H F;  2GBY A;  1W36 D;  2V7F A;  2QBY B;  4XM3 A;  1FLI A;  2JA5 J;  3BTL A;  1S3J A;  5A2Q Z;  1TQM A;  4O6J A;  3LOC A;  4P96 A;  4XLA A;  3S3N A;  3HG9 A;  3A0B C;  5GAG J;  3JCU C;  2MC3 A;  2NOG A;  3HDD A;  3ZCO A;  4HRI A;  5A2Q K;  3EPZ A;  2E1M B;  3RKW A;  2V1U A;  2JZY A;  2KJC A;  1OCT C;  3CC4 I;  3A03 A;  2V4J C;  4HLY A;  2H27 A;  1MDM A;  2E5N A;  2IBD A;  5D4S A;  4DQ2 A;  1X1C A;  2ZNY A;  4XRS G;  4FE7 A;  1BJA A;  4IRG A;  4BAC A;  2RRE A;  2E2H J;  3E5Q A;  2HQR A;  3LNQ A;  2NS8 A;  1T6S A;  2DXI A;  4KYW A;  1WFX A;  1BL0 A;  3WHB A;  2HVS A;  2O8X A;  5H6Q A;  1HKS A;  4ZYG A;  4Z6Y A;  2LBF B;  2K5C A;  3QAH A;  2AS5 F;  1O3T A;  3GO5 A;  3RZD J;  2A5W A;  2K9N A;  2AQF A;  1U9N A;  3QP5 A;  5ICC A;  4G6T B;  3ZMS A;  3FM3 A;  3CF5 F;  1VQN I;  1B9M A;  5ED4 A;  4EAT A;  4QPO A;  2VOP A;  5HDN A;  1SD6 A;  3ABK H;  3H5A A;  3T1B A;  2PLY A;  3D5S C;  4FQG A;  4FAS D;  1QBJ A;  1K78 A;  2XPW A;  3N97 A;  3K4N A;  3LFU A;  1TWF J;  2UXX A;  3DU6 A;  2FD5 A;  1STZ A;  5HOD A;  5H2F C;  4CZC A;  1ORK A;  3CCJ I;  4BQQ A;  4P55 A;  3HL2 A;  1OR7 A;  3HOV J;  1UEL B;  3PFI A;  5ICE A;  1IRX A;  2R5Z A;  1IDZ A;  2H09 A;  3IH2 A;  4XON A;  5J1U A;  3QOD A;  1YE9 A;  2OTJ I;  2CGP A;  2QBY A;  2M5W A;  1RR7 A;  1TW3 A;  4CZZ A;  3BG7 A;  5FD6 A;  2L7F P;  3M4O J;  1OYI A;  1U2W A;  5IP9 J;  2HU9 A;  5JVG F;  4XKB A;  1WVR A;  4EM0 B;  3S17 J;  3K4C A;  3KLN A;  1ENH A;  2OCE A;  2YR2 A;  4A6D A;  4IHW A;  4E7Z A;  3IAM 2;  5KCM A;  5FKM A;  1NK3 P;  4CYC B;  5IP7 J;  5LEK A;  3W3C A;  3WTZ A;  2P5K A;  3MZY A;  4IJA A;  4CCL A;  4RAY A;  2VKE A;  3U2R A;  4ZDO A;  4IPA A;  5B1B H;  3OIP A;  4JYK A;  2A5Y B;  3OYA A;  5ILU A;  4CH7 A;  5BNG A;  3REO A;  3RJP A;  3WG9 A;  3I59 A;  5GPA A;  3FK7 A;  4NQW A;  2JUG A;  4CCM A;  1WJ5 A;  3ABM H;  3CCU I;  2GOX B;  2VBZ A;  4EJV A;  1SC7 A;  2VB6 A;  3CJN A;  4BAY A;  3CP2 A;  3VEP A;  5ILS A;  4J00 A;  1VI0 A;  2QEX I;  3H9J A;  1K83 J;  3KZZ A;  5H6R A;  1W4M A;  4A69 C;  1VQK I;  1GV5 A;  3H9Q A;  2K4J A;  2BVL A;  1MGT A;  2XRL A;  2EFW A;  4ZTJ A;  2LKS A;  3ZMU A;  3L2W A;  3D0S A;  1LDD A;  3CCY A;  2EA4 A;  2F4M B;  1PYV A;  2F2E A;  4CDG A;  3ML6 A;  1XSD A;  1JHH A;  3UNG C;  2XAS A;  5F04 A;  3VDX A;  1JGS A;  1FBU A;  2VKD A;  1YLF A;  2M0C A;  3OS2 A;  4XOP A;  1X1P A;  2GIZ A;  4HLX A;  2MLK A;  4RGR A;  5EJC A;  4KIB A;  4A3I J;  2B9S A;  2GIV A;  3P9C A;  2WY7 Q;  5M3F J;  1P7I A;  2WV0 A;  1BI1 A;  3GUD A;  4UUS B;  4IHV A;  4PFO A;  4A3G J;  3IRQ A;  3IWZ A;  2IEK A;  3L2Q A;  3G1O A;  2DOF A;  5IY5 H;  2CUF A;  2M3A A;  3I3L A;  1A04 A;  2KIM A;  1U5T C;  1Y8R B;  4QSH A;  1UZC A;  4EM1 A;  3TW7 A;  3CUO A;  5FRO A;  5FLV A;  3GTK J;  3HOX J;  3Q3S A;  1OCO H;  2R4G A;  2DFE A;  3S1Q J;  4A3K J;  5IYC J;  2VE8 A;  2GAU A;  4HF2 A;  1P9Q C;  5EEH A;  5LRR A;  4YFX F;  5EGO B;  4UV9 A;  2MA3 A;  4W1U A;  2EK5 A;  3MD2 A;  3J7A O;  1RC9 A;  3QRF F;  4BQN A;  2QLZ A;  2EBI A;  3GVA A;  1VND A;  2P6T A;  4BH9 A;  2EZH A;  5L3F A;  3RQI A;  5ICG A;  1ETQ A;  5E20 A;  4BYY A;  1OPC A;  2Q1Z B;  2ZJQ F;  4LIV A;  2GM4 A;  4KA4 A;  2FBI A;  3HKZ A;  3V8J A;  1BR1 A;  4U87 A;  4F55 A;  3K70 C;  2O6G E;  2BYV E;  4PSW A;  2MW8 A;  3OYK A;  5DD8 A;  4GO1 A;  3MKW B;  1WH7 A;  2FA5 A;  2XF7 A;  3OMY A;  2CUJ A;  1IN7 A;  4ANJ A;  1A31 A;  1GXQ A;  4G7H F;  1EH7 A;  1Y8Q B;  1P2F A;  3NAR A;  3FXJ A;  2B7E A;  1XS9 A;  2OU2 A;  3JRF A;  1FBS A;  2A68 F;  3KFW X;  2LLK A;  2GOM A;  2JUC A;  1V54 H;  3VSK A;  2IGM A;  4CCJ A;  3GFI A;  5TGT A;  5F0H A;  2P6S A;  4G6D A;  1F36 A;  1MIJ A;  2RGV A;  3ABT A;  3O8H A;  2JWT A;  3BG3 A;  4C2U A;  3L2U A;  5F1R A;  4BE2 A;  3G6E I;  5D8L B;  1B6A A;  3ERM A;  4JP0 A;  1GV2 A;  3HIF A;  2CFX A;  2Y0S N;  3J7Z I;  3BQZ A;  2BXY A;  4M74 A;  1I3Q J;  2HKX A;  2VQC A;  3J7A Y;  2XIG A;  2KIF A;  3CC7 I;  3RSN A;  4FET A;  2R3S A;  3H5R A;  2W57 A;  2MFZ A;  3HOW J;  2ZCW A;  2M0M A;  4NUB A;  4UXN A;  3ZQF A;  3CCQ I;  3K69 A;  2AXT C;  2BY3 A;  4RA2 A;  4K2E A;  4YFK F;  2ZJP F;  2A69 F;  3CUQ C;  3KP6 A;  3Q0U A;  3WTT C;  1QA6 A;  1A35 A;  2ZME B;  5K7Z A;  2NRA C;  1LVK A;  1U3E M;  1WQ2 A;  4XSX F;  5FFX A;  2JA7 J;  3WTU C;  3L9F A;  1HA8 A;  1FTT A;  1HQC A;  3MN2 A;  4S05 A;  2KMU A;  2JN6 A;  3OYC A;  3OY9 A;  4RAZ A;  3C2B A;  1LUJ B;  5CVI A;  1TQI A;  1FY7 A;  5BQT A;  1ZG5 A;  1B9N A;  1HKQ A;  1X3Z B;  3TQN A;  1POG A;  2OV7 A;  5JLX A;  1ZG3 A;  4C3H J;  4HX8 A;  2QCO A;  1QHH D;  5DV5 A;  3BTC A;  2XF5 A;  1RPW A;  3RTR A;  1IZ1 A;  1XDU A;  1JI8 A;  3QQA A;  1HXD A;  3F8M A;  4A12 A;  3ZQC A;  3SDG A;  4Q4Z F;  3BTJ A;  2QKL B;  4FT8 A;  2FEZ A;  3FX3 A;  2JVH A;  1E2X A;  1QPI A;  3J81 K;  1G8X A;  2NOJ B;  1XTA A;  1S9H A;  2DOA A;  4DNC A;  3GLL A;  4C30 A;  2EJR A;  3BOQ A;  2GA1 A;  4ZH4 F;  1Q1V A;  1DP7 P;  2I8D A;  1SFK A;  2KJB A;  5GP9 A;  1YRN B;  1BR2 A;  1UB9 A;  5GAD J;  5BPI A;  1EH8 A;  2EQR A;  1U5T B;  1U5T A;  4MQV A;  5KVR A;  3I58 A;  3FF5 A;  2Q0O A;  1ZKG A;  5IPA A;  3PM1 A;  2HVQ A;  3PQJ A;  3BR5 A;  1J59 A;  4HX4 A;  3HOT A;  3ZMD A;  1TBX A;  3RKY A;  3BR3 A;  2HEO A;  4CHU A;  5AIQ A;  4KIF A;  2BHY A;  1IRZ A;  1ETY A;  1FBQ A;  2V79 A;  3OL3 A;  1A36 A;  3S1M J;  2O0Y A;  2LRD A;  3Q9S A;  2Z2S B;  3OYM A;  3DF8 A;  1K4S A;  3E6D A;  3H3V K;  1BOA A;  3OYE A;  4PJL A;  5LLQ A;  2C6Y A;  2Q2E B;  2ZKZ A;  2Y9Z A;  2IA2 A;  2QQ8 A;  4KNY A;  1W36 C;  1LFB A;  4PJM A;  3AKZ A;  3HPH A;  3KLO A;  2XHK A;  2CV1 A;  5BMZ A;  4L0Z B;  3P9K A;  3WHC A;  4BQA A;  3HXL A;  1VQL I;  4YG2 F;  4HYE A;  3FKJ A;  2DTZ A;  3J80 K;  1MBH A;  4RAG A;  4WXH A;  4ZJZ A;  2RQP A;  2IRF G;  2W00 A;  1H88 C;  1LE8 A;  2GXG A;  1JKO C;  2NS0 A;  4HA8 A;  3GZN B;  1NH3 A;  2DA6 A;  3MCZ A;  4PSX A;  5CVV A;  1S8N A;  2L54 A;  4E7J A;  3L2R A;  4Y13 A;  3ZQL A;  2G7U A;  3GEZ A;  1Y0N A;  2F5E A;  3VOD A;  3CJQ B;  4PZJ A;  2VBY A;  3CDL A;  4E70 A;  5IP6 A;  3QWL A;  2DFI A;  5M5X J;  1WJD A;  1K78 B;  2L0K A;  1JT0 A;  2DA2 A;  2O8K A;  3Q9V A;  2MLG A;  4KJZ A;  4Q47 A;  1KGS A;  2M8E A;  4YEL A;  1AWC A;  1X1D A;  5IYB J;  1UST A;  2CFO A;  2PX9 A;  2Y2Z A;  4L9N A;  1FIP A;  2WC2 A;  4HX7 A;  2IAI A;  3OOP A;  2ZBK A;  5BS6 A;  2IA1 A;  5J8C A;  1KQ9 A;  2HFH A;  1FJL A;  1W7P A;  1KA8 A;  1QVT A;  4LG0 B;  4GXO A;  5FFZ A;  2V9P A;  1N75 A;  2FU4 A;  4F7Z A;  2K4B A;  2IT0 A;  4UHT A;  2L5Q A;  4M3B A;  3FIS A;  2DT7 B;  2KRF A;  2QEN A;  2KKO A;  2QKM B;  4AVP A;  3GW2 A;  1O3R A;  2PMZ N;  2XAJ A;  3FXR A;  4U7B A;  2PJR A;  1Z7U A;  1B59 A;  4DW6 A;  5TIS C;  3IUO A;  4MFD A;  3WGI A;  4KIC A;  1LKX A;  1D1A A;  4HNT A;  3W6V A;  4IXA A;  3Q5F A;  3WE3 A;  2KP6 A;  1TW2 A;  2XAQ A;  5JI6 A;  3ROU A;  1KYW A;  3LQQ A;  1SMY F;  1Y1V J;  5LHI A;  1GVJ A;  1XMX A;  2Z9O A;  2EV6 A;  4LB6 B;  2R7U A;  2K40 A;  2V1D A;  1FP2 A;  1WI3 A;  2XKO A;  2L7M P;  4LD5 A;  4Y15 A;  1K4T A;  1DU0 A;  4GCV A;  1Z05 A;  4AM3 A;  4DYC A;  4X0G A;  2EIN H;  2B63 J;  1ETV A;  5FRN A;  1VF9 A;  1AA7 A;  4ZZD A;  2VBW A;  3GZ5 A;  4GYI A;  4HNU A;  3SHF A;  3CCV I;  1K61 A;  3MKL A;  1D3Y A;  5DUK A;  3VYR B;  2HTS A;  1YS7 A;  4B8X A;  5M5W J;  2BE5 F;  1ZTR A;  4U88 A;  1W5T A;  4EQQ A;  3ZN0 A;  4D9J A;  1RKT A;  2NNN A;  3BRO A;  1NHA A;  3DV8 A;  3LAJ A;  1IXC A;  3G3Z A;  3JSP A;  3I5U A;  3CTA A;  4UUT A;  5AON A;  1MD0 A;  2V9V A;  3A4C A;  1R1V A;  2FJ1 A;  3CME I;  3NRV A;  5J3L A;  5KAF C;  1BA5 A;  2KDZ A;  5DEQ A;  2CW8 A;  1A6I A;  2Z16 A;  5ICF A;  2ME6 A;  2E36 A;  2K9Q A;  4G8X A;  1XCV A;  2EIM H;  3ZMV A;  4BE0 A;  4D5C A;  1YW7 A;  1Z9C A;  1RIO H;  2L7K A;  2DN0 A;  2RVC A;  1JE8 A;  2QSG X;  2H8R A;  4ZDL A;  4I6Z A;  1HOM A;  4B44 A;  3PO3 J;  3QYB A;  4DZP A;  2E19 A;  3AFH A;  2YUS A;  3I64 A;  2ETH A;  3LQR A;  1FC3 A;  2FNA A;  2ELK A;  4LG3 A;  4BBS J;  4L9V A;  2K85 A;  3HUG A;  3BTI A;  1V4R A;  3DLA A;  1V3F A;  5KHD A;  1D0Z A;  5K5Q A;  4F92 B;  3LL7 A;  1T56 A;  2PI0 A;  1FYK A;  1YX3 A;  4B48 A;  4Z2Y A;  3G73 A;  3QPL A;  4G7Z F;  2K7L A;  3DBH B;  2CG4 A;  4P9U A;  1REP C;  2L9S A;  3JW4 A;  4RLF A;  3F22 A;  2COB A;  2IGO A;  4LIU A;  2XGC A;  3J81 Z;  3CDH A;  2X0L A;  4P5O A;  3GME A;  4GFB A;  1X2N A;  3KYC B;  3SZG A;  1MBK A;  2NXN B;  2ZXW H;  3WTS C;  3OR2 C;  3CUQ B;  2ZME C;  3FBI B;  2IGN A;  2P81 A;  3DKY A;  1KQ0 A;  3KEQ A;  3F23 A;  5DM7 F;  3IL2 A;  3K0L A;  4WF2 A;  1TT5 B;  3DP7 A;  3BZ6 A;  2MGQ A;  2QYO A;  2DJN A;  3OSF A;  4Y52 J;  1MBG A;  1APL C;  1T0F C;  5HLI A;  1VTN C;  3HSE A;  4I02 A;  5KNL A;  2XC7 A;  2D1H A;  4R79 A;  4Y7N J;  2HWV A;  3RYP A;  2LD5 A;  5FO5 A;  1I6H J;  1VQ4 I;  1EA3 A;  3TKY A;  4IOC F;  3A2K A;  3ASO H;  4YRV A;  3GTJ J;  1UAA A;  3DPU A;  5F0C A;  1T95 A;  1Y1W J;  2IW5 A;  5FKN A;  2X48 A;  1PJR A;  2BW3 A;  3I55 I;  2RDP A;  2DFH A;  2K27 A;  3HTS B;  1QU3 A;  1D1B A;  3R60 A;  2HOE A;  4BBR J;  2RNJ A;  2XB5 A;  4BJ5 C;  2F4I A;  2BOL A;  2I5U A;  2CYY A;  2UUZ A;  1BIB A;  5CJ9 A;  2CQX A;  2COM A;  4RB2 C;  1KU7 A;  2KDO A;  4BE1 A;  2P5L C;  2EFP A;  1TWG J;  5L3B A;  4BDY A;  4Q48 A;  1D0X A;  1ZK8 A;  2DQL A;  2DYS H;  1FNN A;  1XGO A;  1D8J A;  1E3P A;  4PJJ A;  1YRN A;  4U0Y A;  2X6Y A;  4A3C J;  5GTI C;  1IUF A;  1IXS B;  3GBG A;  1O3Q A;  2CMP A;  2D45 A;  3H3Z A;  3R0A A;  2H1K A;  1ACI A;  1D5V A;  5FKO A;  3VFZ A;  5LBQ A;  3BZC A;  3IHU A;  4EEF G;  2Z5U A;  4BXU A;  2ELJ A;  2E34 A;  1H9G A;  5E3N A;  4RB1 A;  4I7H A;  2R7R A;  5F1J A;  1V5F A;  2V9K A;  2JQ7 A;  3PJR A;  1YW9 A;  4V2G A;  4AVZ A;  1YW8 A;  1KYZ A;  3PNT A;  4LK1 F;  3AG4 H;  1QRY A;  3F8F A;  4ZC3 A;  1HW2 A;  1KZH A;  3EUH C;  4CYD A;  3WTY C;  4ENN A;  3F9K A;  3BCB A;  1I1G A;  5FLM J;  4DOZ A;  2DAO A;  3JSO A;  3E97 A;  3IV5 A;  2HPM A;  3V7R A;  1GT0 C;  2F5C A;  5K7F A;  5ILV A;  3PSI A;  3EYY A;  2QQB A;  3I59 B;  4G94 A;  3D5L A;  3RKQ A;  4IHY A;  4LGW A;  1AOY A;  3CCL I;  5JLW A;  3ELK A;  1R7J A;  2M9H A;  3M1E A;  4ZYD A;  4OOI A;  2UV1 A;  1OIS A;  2ECC A;  2HYF A;  1QHG A;  2V1N A;  2ZB9 A;  1SVO A;  4BY1 J;  1LJ9 A;  2E7X A;  1DGR M;  4XQF A;  3V7S A;  4IX7 A;  5D5X B;  1QO0 D;  5E3M A;  1DP3 A;  3QPS A;  4GGG A;  1BM9 A;  1IJW C;  4NC6 A;  3CCS I;  1M1E B;  2QM3 A;  3GCM A;  5B3S H;  3DWL E;  2W48 A;  2KPM A;  2LSO A;  3CO6 C;  2DT6 A;  3ZQI A;  2L4A A;  1VQ7 I;  5J1R A;  1K79 A;  2HKO A;  4M3G A;  3MZH A;  4BY7 J;  2WAF A;  1P4X A;  2DQR A;  3H1C A;  4JX5 A;  2MC4 A;  1J09 A;  2MD0 A;  5HS8 A;  5TRD A;  1SMT A;  2EIK H;  5FLX K;  4MHG A;  2WTE A;  2STW A;  5DUI A;  3BR2 A;  3L2V A;  3ABL H;  1MMD A;  2FML A;  2W25 A;  3S8P A;  3C18 A;  1R5H A;  1X4O A;  2E2I J;  3DTI A;  2HQN A;  1MMG A;  5DM6 F;  3MAJ A;  1DUX C;  4ZZL A;  3TMO A;  2JA2 A;  2DA3 A;  1QZE A;  2D2W A;  1PDN C;  2K9M A;  1E3H A;  5DD4 A;  4KMU X;  4OU0 A;  3LAP A;  1MMS A;  3O8G A;  2ISY A;  4XLF A;  4DYR A;  2A6T A;  1LQ1 A;  2JA6 J;  2IS2 A;  3QOP A;  1JT6 A;  4RLQ A;  2LYC A;  4XKV A;  2HTJ A;  4PJN A;  5HNF A;  3HJE A;  1BI3 A;  2VKV A;  5HOO A;  3K1P A;  1Z1D A;  4G12 A;  1ZRE A;  4LK0 F;  3DXJ F;  1JTY A;  4PK4 A;  4E7S A;  1MW7 A;  2CQK A;  2LBF A;  1KON A;  3I4M J;  3SQN A;  4B3A A;  2LFB A;  3G4S I;  3I56 I;  2LG4 A;  2BY0 A;  1T38 A;  4A3F J;  2VQH A;  1IV8 A;  3KYD B;  3MKZ A;  1Z6R A;  2XDV A;  5IT3 A;  2HOA A;  3P7N A;  1YO5 C;  2CUZ A;  2E5Z A;  1G3S A;  2M8G X;  4BQO A;  4A3D J;  3NAU A;  3O6B B;  1VQ8 I;  3GTG J;  3ISP A;  5FJ8 J;  4G6Q A;  1R4M B;  2F4O B;  2BXZ A;  1TC3 C;  2WAD A;  1S7O A;  4Y4R A;  1TT0 A;  2O03 A;  1H8A C;  1V5G A;  1W5S A;  2EZK A;  5AIP A;  2FRH A;  4XN3 A;  1YHQ I;  3GF2 A;  4WXC A;  3BPX A;  3K2A A;  5CYV A;  2M1B A;  2W24 A;  2E35 A;  1R58 A;  2RNG A;  3D5R C;  4CSW A;  3OV8 A;  1S29 A;  1L0O C;  4I0A A;  2DDB A;  2DA5 A;  2CWE A;  2X6W A;  4JOM A;  1A6Q A;  3ZMZ A;  1SEU A;  3PIP F;  3SEZ A;  4LB5 A;  1K6Y A;  2HZT A;  3L2C A;  3B02 A;  3HRM A;  4WXD A;  4YII A;  2XV4 S;  1DPR A;  1FWZ A;  1G6N A;  1R23 A;  2RV8 A;  4XLE A;  1G3T A;  3ZQQ A;  4B43 A;  2HYJ A;  1R49 A;  1WGX A;  3CP8 A;  3SZP A;  4A6E A;  1IXR C;  3HM5 A;  4B3X A;  4A3J J;  1XGM A;  2KIU A;  2VOO A;  3S2W A;  3DPT A;  1WJA A;  2ESH A;  2GQQ A;  3CCM I;  2IS4 A;  1S5L C;  4DGW B;  1B8I A;  4KIS A;  2X51 A;  2A05 A;  2FOK A;  4I99 C;  4KIG A;  4ZYA A;  4HDV A;  2DO7 A;  3QYE A;  2DA4 A;  4XLC A;  3RPU D;  1UHS A;  5E1X A;  3SZT A;  3WG7 H;  1IRF A;  1OR7 C;  1O3S A;  4CA0 A;  3KX2 A;  2DDA A;  3R0J A;  1FX7 A;  5H20 A;  4IHS A;  2JRT A;  2BY1 A;  3T8R A;  2EFO A;  1SVM A;  1FOW A;  4L5J A;  1C0W A;  1FMV A;  3QYF A;  4U7D A;  4XKC A;  2M4K A;  1YIJ I;  5DCM A;  4D7N A;  2M7B A;  2ZME A;  2WB1 N;  1GVD A;  1MMA A;  2H6C A;  2HQA A;  2MSY A;  3A01 A;  2LTP A;  3BPV A;  2VPL A;  2TRT A;  1BI0 A;  1RUO A;  5K1Y A;  1JHF A;  5FB2 A;  1BOB A;  3RCO A;  1IO2 A;  5LFA A;  5LGN A;  2XRO A;  1D1C A;  3BG5 A;  1YIT I;  4I09 A;  4BHC A;  2LY1 A;  2LK2 A;  1T39 A;  1R4N B;  3WU1 B;  4EGZ A;  1JJ6 C;  2VI6 A;  3IKV A;  3DBR B;  1J9I A;  2HYG D;  2JSC A;  3GTO J;  3MEX A;  2JTV A;  3GWZ A;  2EPF A;  3BDD A;  3LA7 A;  3LSK A;  1V55 H;  5LEJ A;  3B73 A;  2IS1 A;  2RKH A;  3TW6 A;  2E1N A;  2CS3 A;  3F8B A;  2W82 A;  3KIO A;  1TL8 A;  3ONQ A;  2XRN A;  4P1W A;  1MBE A;  2XKP A;  3BC8 A;  1FT9 A;  1IDY A;  1O7F A;  1LNW A;  1V5E A;  4E6K G;  4OMZ A;  3ZR8 X;  5E3O A;  5L3C A;  5JHU A;  5L3D A;  3CUQ A;  4C9Y A;  3MMY B;  3E3V A;  4MLO A;  1X1A A;  1J0R A;  2VJ4 A;  1X19 A;  2ZNZ A;  1MJA A;  3BR0 A;  3G71 I;  2HDW A;  1XC5 A;  3DQV C;  3FM5 A;  1H0M A;  1YJ9 I;  1FSE A;  4JBA A;  2VON A;  3TP0 A;  1MNE A;  4RGS A;  3S3O A;  2X4H A;  1OCZ H;  5FGM A;  4F52 A;  3E1S A;  3K9T A;  1MSE C;  4L9J A;  4C2T A;  4MFE A;  1YG2 A;  5C4J J;  1P92 A;  5B66 C;  3DEE A;  1F5T A;  5F08 A;  2LY2 A;  2NVX J;  2R7T A;  1P4W A;  4HQM A;  3H0D A;  4KMF A;  4NB5 A;  4GYG A;  2ICW G;  2L02 A;  2KRH A;  4D1Q A;  1W0U A;  2HZD A;  4AD9 A;  4M3F A;  4CIC A;  3KP7 A;  2OZ6 A;  2MD5 A;  3K4L A;  4A3L J;  2A3S A;  3F8C A;  1I3A A;  1XB4 A;  2GLO A;  1T33 A;  1MDM B;  1DQU A;  4N9H A;  2CV2 A;  1G3Y A;  3K2Z A;  5E1W A;  2XSJ C;  1B72 B;  3LSM A;  4FX0 A;  4HSR A;  4E7I A;  1ZLK A;  4IHX A;  1ONV A;  4PGG A;  1FOX A;  4OIR F;  1Z6T A;  4OIP F;  4OIN F;  1HC8 A;  4D7M A;  2XGX A;  2OZU A;  2O9L A;  4HF1 A;  3M9A A;  4OWR B;  4AYB A;  3DTE A; 
#chains in the Genus database with same CATH homology
 3IC7 A;  4KFC A;  2E1C A;  1X3U A;  3EQL F;  5TJJ A;  1OYY A;  5D6E A;  2H94 A;  3N4M A;  3I0T A;  2M30 A;  4U0V A;  2Z33 A;  2EV5 A;  3JAM K;  2OQR A;  2P8T A;  1F1Z A;  1IN8 A;  4XRF A;  3JTH A;  3KZY A;  3HRU A;  2GA2 A;  1WSU A;  1XCB A;  3TOA A;  1T0F A;  5HS7 A;  3PQK A;  2Q2E A;  3WOD F;  2ESN A;  3LST A;  1LDK B;  3WTX C;  3ZN1 A;  1TLH B;  3ERE D;  1EV7 A;  5D5V B;  2PJP A;  2QVO A;  4UVC A;  2R7D A;  1ZH5 A;  2MH9 A;  2Q8K A;  1PUE E;  3ZPL A;  5F64 A;  3C7J A;  5HDG A;  3F6O A;  3DKW A;  3ZQ7 A;  1YYV A;  2IP2 A;  1S6L A;  1GXP A;  4OIO F;  3TOB A;  3C3W A;  6PAX A;  2DT5 A;  1QZY A;  5DCM B;  4TV7 A;  2W85 A;  2BGC A;  4LG0 A;  1ZN2 A;  2VT3 A;  3WGH A;  4HZF A;  4AIJ A;  4AWX B;  5J6X A;  3GYH X;  4CXF A;  4HV6 A;  4PGH A;  5LHH A;  2BBY A;  1Y0U A;  5LGU A;  4ON0 A;  3J80 Z;  1T2K A;  2B0L A;  3WGG A;  4A5N A;  3V8L A;  4ASN A;  4A0X A;  1CF7 B;  4CGZ A;  3MQ0 A;  3LA3 A;  1XD7 A;  3TO7 A;  2MH2 A;  4LJZ F;  2VOD A;  4EMS A;  3GXO A;  5K5O A;  3C1D A;  2DPU A;  4N9I A;  4L0Y B;  2PBI A;  3JAM Z;  1HKT A;  2QWW A;  3GLX A;  1ZLJ A;  5FD5 A;  3ZP5 A;  2EB7 A;  3RIR A;  1ZGA A;  3M8F A;  4WX9 A;  4AIH A;  2HDC A;  2VBX A;  1ZAO A;  3KP4 A;  1XGN A;  3FWE A;  1W7P B;  2EFN A;  4BNC A;  5HVQ C;  5ERI A;  4AIK A;  3TO9 A;  2QQ9 A;  3KE2 A;  3V4G A;  3DPL C;  4FX4 A;  5E1Z B;  1XGS A;  3FZV A;  3V7C A;  2PG4 A;  3TO6 A;  4JQF A;  2V6C A;  1UHW A;  1SFX A;  1YFH A;  4PDK A;  2Z99 A;  4IVN A;  2LNB A;  2M45 A;  2DW4 A;  1ZRC A;  1LEB A;  1IN6 A;  2YX7 A;  2LKP A;  1QZZ A;  1I27 A;  1KQ8 A;  2LDU A;  5D6F A;  3R61 A;  4EJO A;  2O3F A;  1KU9 A;  4EVI A;  2L01 A;  2PMU A;  2P7C B;  3I53 A;  2ELH A;  1ZRF A;  3QU3 A;  1R36 A;  4A2U A;  2L3D A;  3L00 A;  4L9T A;  5K5R A;  2E7W A;  3NEU A;  3O3K A;  2DTR A;  2W84 A;  4I0B A;  4RGU A;  4M9S A;  1FSH A;  2ISZ A;  2JT1 A;  3IKT A;  2MBF A;  5F6F A;  1SD5 A;  1BIA A;  5JVT A;  3QP6 A;  2QQA A;  1SD4 A;  2CSO A;  2UWM A;  4KDP A;  3KP2 A;  4FHT A;  4MGR A;  3R4K A;  1ZGJ A;  1HW5 A;  4A0Z A;  2YU3 A;  1Z91 A;  1UHM A;  4B09 A;  4HOB A;  4UVA A;  3U1D A;  4Q5S F;  1Q1H A;  3ZMT A;  1S7A A;  4ENK A;  2F5D A;  2GXB A;  1MKM A;  1U78 A;  3KET A;  3FMS A;  2AXL A;  1IW7 F;  3E5X A;  2XAH A;  1TQP A;  1QNT A;  1FZP B;  5CVR A;  1SFU A;  1IN5 A;  1RZ4 A;  3K1M A;  5IT9 K;  3V8K A;  2JPC A;  1O7L A;  3CLO A;  3RKX A;  2XAG A;  4I2O A;  2FE3 A;  2DK5 A;  5DCF A;  3F8N A;  4ETS A;  4U0W A;  2STT A;  3LFK A;  3E6C C;  1XSX A;  1QQI A;  1R5G A;  2M87 A;  4XBF A;  1OYW A;  4H0E A;  2GZW A;  4QWQ A;  3I71 A;  1QPM A;  4A5M A;  3GX4 X;  1I6X A;  2HS5 A;  3HOS A;  2DU9 A;  4M9Z A;  1XDS A;  3BP8 A;  1R00 A;  1ZRD A;  5EEG A;  2LF7 A;  1D8K A;  1OKR A;  4G7O F;  2Y0M A;  4RS8 A;  2VC1 A;  3FMR A;  4P9F A;  4QLC U;  3L7W A;  3ABU A;  3E6M A;  5L3E A;  4ESF A;  4R8H A;  4KN7 X;  1MJB A;  3QPT A;  2JPB A;  3BJA A;  1ZG1 A;  2UZK A;  4HF0 A;  4KUM A;  1IUY A;  2QUF A;  1EH6 A;  5E8G A;  3W6K B;  4HQE A;  1BC7 C;  3EYI A;  4IRI A;  3HHH A;  4L5I A;  2NYX A;  3R6S A;  1G3W A;  4RB0 A;  3TGN A;  3K1N A;  4S04 A;  3TDZ C;  4UNO A;  2R7F A;  3VOE A;  2PQ8 A;  3COA C;  5D5U B;  4ESB A;  4UVB A;  2DBB A;  2QZ8 A;  5DDG A;  5E18 F;  3FMQ A;  3E5U A;  2Y75 A;  4BHP A;  4ZYH A;  1HBX G;  1PP8 F;  1P4A A;  4XSZ F;  1KU3 A;  1ULY A;  4IF4 A;  3WE2 A;  2D1V A;  4UV8 A;  3I4P A;  2K02 A;  4RGX A;  4HV5 A;  1TTY A;  2EFQ A;  3TDU C;  1FPQ A;  2HGC A;  1O57 A;  1UCR A;  3L09 A;  4MNU A;  1SD7 A;  2FSW A;  5KK1 A;  1RUN A;  3RYR A;  2ZJ2 A;  2WWY A;  2FQ3 A;  4G9Y A;  4N0B A;  2OQG A;  5CLS A;  1H9T A;  5HLH A;  3EUH A;  2P5V A;  3BY6 A;  3T8T A;  1WWX A;  1T98 A;  1ZYR F;  1CF7 A;  3E6B A;  1RNL A;  2J5P A;  2VT2 A;  2DK8 A;  1I1S A;  5JFR A;  4MEX F;  3HHG A;  4Y17 A;  4BHB A;  4M71 A;  4R1H A;  2K86 A;  3HTU A;  1BI2 A;  4YIF A;  3M8E A;  1J2X A;  3SXY A;  3GFM A;  3WU0 A;  4OMY A;  1XN7 A;  2L4M A;  4O3M A;  2PN6 A;  2RN7 A;  3FXU A;  3NQO A;  3LWF A;  4IHT A;  4EJT A;  3F6V A;  2FBK A;  4HW0 A;  4XLN F;  4YFN F;  1HSJ A;  2ADU A;  1W7P D;  2OD5 A;  1U8R A;  1LB2 A;  3KP3 A;  2VOP A;  1SAX A;  3MWM A;  4I98 B;  4WK8 F;  1JXS A;  3W6J B;  4RB3 C;  1FP1 D;  1K7A A;  3HYI A;  2XVC A;  1BBY A;  1XMA A;  5E17 F;  2CW0 F;  2ACJ A;  3HRS A;  1IF1 A;  1SFE A;  1B1B A;  3EDP A;  1USS A;  1E17 A;  1IN4 A;  4ZYE A;  2VN2 A;  2NNY A;  3IRR A;  1IRG A;  2HR3 A;  3DEU A;  3T5X A;  2G7H A;  1HW1 A;  1J7K A;  4D0P A;  1GHC A;  1F9N A;  4EV0 A;  3FXQ A;  5HS9 A;  5LGT A;  2OBP A;  5CVU A;  5E8I A;  1YQA A;  3HSF A;  3RPQ A;  2DI3 A;  2FMY A;  1P6R A;  1G4D A;  3F72 A;  2VE9 A;  5CVJ A;  2RC4 A;  1HST A;  1ODD A;  3SFZ A;  4A0Y A;  1YTY A;  2O61 A;  3ECO A;  4LMY A;  1B4A A;  2FBH A;  2DLL A;  4IRH A;  2DPD A;  1BC8 C;  5BOX A;  2V1X A;  2XUB A;  4EJW A;  2TDX A;  2EWN A;  2UXN A;  4UUV A;  2F5F A;  4HDU A;  1FOK A;  4MEY F;  1FYL A;  3HSR A;  4MQ9 F;  4M6Y A;  2A6E F;  3BJO A;  2IPQ X;  4I01 A;  2BEO A;  2Z3Y A;  3JTG A;  2YSR A;  3CO7 C;  2FNP A;  3HRT A;  4XLP F;  5FLX Z;  4WWC A;  4KT5 C;  1TNS A;  3F21 A;  3MFK A;  5D8K B;  4ENM A;  1R1T A;  1J5Y A;  2A07 F;  4HBL A;  2VXZ A;  1F4K A;  2ZO4 A;  2OA4 A;  4JK1 X;  5LRS A;  1RI7 A;  1CGP A;  3KCC A;  3GFJ A;  1WI9 A;  4MTE A;  3GFL A;  3WTW C;  3T0Y A;  3LA2 A;  2IVM A;  5L3G A;  1OMI A;  1XMK A;  1XSV A;  1J75 A;  2Y48 A;  2XAF A;  4ENJ A;  3RDI A;  1ZHF A;  1IAW A;  1U6G A;  2NAZ A;  4LLL A;  5J8F A;  5D4R A;  3GZ6 A;  1BN5 A;  3H3U A;  1I5Z A;  4M73 A;  4LLN A;  2IJL A;  1UFM A;  3BWG A;  3ULQ B;  1PP7 U;  3AAF A;  1YS6 A;  1LVA A;  3H92 A;  3FHZ A;  3O2P E;  1LEA A;  4MTD A;  2OAZ A;  3KP5 A;  1QGP A;  4O5V A;  4CO8 A;  3DFG A;  2CO5 A;  1DPU A;  2YX4 A;  3I54 A;  5HLG A;  2PFB A;  4OIQ F;  3P9I A;  1LDJ A;  3M7G A;  1KU2 A;  2LF8 A;  4LLG F;  5BPD A;  3RI4 A;  4LFU A;  2PEX A;  1DDN A;  2IA0 A;  1ON2 A;  2EV0 A;  4EJU A;  4M72 A;  1L3L A;  3QPH A;  4KN4 X;  3KEO A;  3EET A;  2FF4 A;  1ZAR A;  5HDK A;  1R22 A;  1TNT A;  2H6B A;  4PCQ A;  3QU6 A;  2YPR A;  3IWF A;  4EGY A;  1K6O A;  1WRJ A;  4WCG A;  1WKM A;  4M6X A;  3F3X A;  3WTV C;  2GWR A;  2EA2 A;  2ZXJ A;  3BJ6 A;  4ESJ A;  2VC0 A;  1R1U A;  2FXA A;  4NHJ A;  4HAM A;  1MJ9 A;  3RPU A;  3VB2 A;  4L18 B;  3ECH A;  1ON1 A;  1YIO A;  4EM2 A;  2PMH A;  2P4W A;  2BV6 A;  1FYM A;  1MZB A;  2A61 A;  2ZFW A;  5JR3 A;  2P7V B;  5DYM A;  2J5O A;  5IT9 Z;  5LHG A;  2G9W A;  4M9X A;  3U9G A;  5D5W B;  2A6H F;  2QBY B;  1FLI A;  1S3J A;  5A2Q Z;  1TQM A;  4O6J A;  4P96 A;  2MC3 A;  5A2Q K;  3RKW A;  2V1U A;  2JZY A;  2KJC A;  4HLY A;  2H27 A;  1MDM A;  5D4S A;  4DQ2 A;  2ZNY A;  1BJA A;  4IRG A;  3E5Q A;  2HQR A;  4KYW A;  1T6S A;  2O8X A;  5H6Q A;  1HKS A;  4ZYG A;  2AS5 F;  3QAH A;  1O3T A;  3GO5 A;  3QP5 A;  5ICC A;  3ZMS A;  3FM3 A;  1B9M A;  5ED4 A;  5HDN A;  1SD6 A;  3T1B A;  2PLY A;  1QBJ A;  1K78 A;  3N97 A;  2UXX A;  1STZ A;  4P55 A;  1OR7 A;  3PFI A;  5ICE A;  2H09 A;  2CGP A;  2QBY A;  2M5W A;  1TW3 A;  4CZZ A;  5FD6 A;  1OYI A;  1U2W A;  4EM0 B;  3KLN A;  2YR2 A;  4A6D A;  5LEK A;  3WTZ A;  2P5K A;  3MZY A;  4IJA A;  4RAY A;  3U2R A;  4IPA A;  2A5Y B;  5ILU A;  3REO A;  3RJP A;  3WG9 A;  3I59 A;  4NQW A;  2VBZ A;  4EJV A;  3CJN A;  4BAY A;  3VEP A;  5ILS A;  3KZZ A;  5H6R A;  1W4M A;  2K4J A;  1MGT A;  2EFW A;  3ZMU A;  3D0S A;  1LDD A;  2EA4 A;  2F2E A;  4CDG A;  3ML6 A;  1XSD A;  1JHH A;  2XAS A;  1JGS A;  1FBU A;  1YLF A;  4HLX A;  2MLK A;  4RGR A;  4KIB A;  2GIV A;  3P9C A;  2WV0 A;  1BI1 A;  3GUD A;  3IRQ A;  3IWZ A;  1A04 A;  2KIM A;  1U5T C;  4EM1 A;  3CUO A;  2VE8 A;  2GAU A;  4HF2 A;  5EEH A;  5LRR A;  4YFX F;  4UV9 A;  2MA3 A;  2EK5 A;  3J7A O;  3QRF F;  2QLZ A;  3GVA A;  4BH9 A;  2P6T A;  5L3F A;  5ICG A;  5E20 A;  4BYY A;  1OPC A;  4KA4 A;  2FBI A;  3V8J A;  2O6G E;  2BYV E;  5DD8 A;  4GO1 A;  2FA5 A;  1IN7 A;  1GXQ A;  4G7H F;  1EH7 A;  1P2F A;  2OU2 A;  1FBS A;  2A68 F;  3KFW X;  3GFI A;  2P6S A;  4G6D A;  2RGV A;  3ABT A;  5F1R A;  5D8L B;  1B6A A;  3HIF A;  2CFX A;  4M74 A;  2HKX A;  2XIG A;  2KIF A;  2R3S A;  2W57 A;  2ZCW A;  4UXN A;  3K69 A;  4YFK F;  4K2E A;  2A69 F;  3CUQ C;  3KP6 A;  3WTT C;  2ZME B;  2NRA C;  1U3E M;  1WQ2 A;  4XSX F;  5FFX A;  3WTU C;  3L9F A;  1HQC A;  4S05 A;  4RAZ A;  5CVI A;  1TQI A;  1FY7 A;  5BQT A;  1ZG5 A;  1B9N A;  1HKQ A;  3TQN A;  1ZG3 A;  4HX8 A;  5DV5 A;  3RTR A;  1IZ1 A;  1XDU A;  1HXD A;  3F8M A;  4A12 A;  4Q4Z F;  4FT8 A;  2FEZ A;  3FX3 A;  1E2X A;  3J81 K;  4DNC A;  2EJR A;  3BOQ A;  2GA1 A;  4ZH4 F;  1DP7 P;  2KJB A;  1UB9 A;  5BPI A;  1EH8 A;  1U5T B;  1U5T A;  4MQV A;  5KVR A;  3I58 A;  3FF5 A;  2Q0O A;  3PQJ A;  1J59 A;  4HX4 A;  3HOT A;  3ZMD A;  1TBX A;  3RKY A;  2HEO A;  4CHU A;  5AIQ A;  4KIF A;  2V79 A;  1FBQ A;  2O0Y A;  3Q9S A;  3DF8 A;  3E6D A;  1BOA A;  2C6Y A;  5LLQ A;  2ZKZ A;  2IA2 A;  4KNY A;  3KLO A;  2XHK A;  5BMZ A;  4L0Z B;  3P9K A;  4BQA A;  4YG2 F;  4HYE A;  3J80 K;  4WXH A;  2IRF G;  2RQP A;  2GXG A;  2NS0 A;  4HA8 A;  3MCZ A;  5CVV A;  1S8N A;  2L54 A;  4Y13 A;  2G7U A;  3GEZ A;  2F5E A;  3VOD A;  4PZJ A;  2VBY A;  4E70 A;  2DFI A;  1K78 B;  3Q9V A;  2MLG A;  4Q47 A;  1KGS A;  2M8E A;  1AWC A;  1UST A;  4L9N A;  2WC2 A;  4HX7 A;  3OOP A;  2ZBK A;  5BS6 A;  2IA1 A;  5J8C A;  1KQ9 A;  2HFH A;  1W7P A;  1KA8 A;  4LG0 B;  4GXO A;  5FFZ A;  2FU4 A;  4F7Z A;  2K4B A;  2IT0 A;  4UHT A;  2KRF A;  2QEN A;  2KKO A;  4AVP A;  3GW2 A;  1O3R A;  2XAJ A;  3FXR A;  4U7B A;  1Z7U A;  1B59 A;  3WGI A;  4KIC A;  4IXA A;  3Q5F A;  3WE3 A;  1TW2 A;  2XAQ A;  5JI6 A;  3ROU A;  1KYW A;  3LQQ A;  1SMY F;  5LHI A;  1GVJ A;  2Z9O A;  2EV6 A;  4LB6 B;  2V1D A;  2XKO A;  1FP2 A;  4LD5 A;  4Y15 A;  4GCV A;  1Z05 A;  4ZZD A;  2VBW A;  3GZ5 A;  4GYI A;  3SHF A;  1D3Y A;  5DUK A;  2HTS A;  1YS7 A;  4B8X A;  2BE5 F;  4U88 A;  1W5T A;  4EQQ A;  3ZN0 A;  3DV8 A;  2NNN A;  3BRO A;  1NHA A;  3LAJ A;  1IXC A;  3G3Z A;  3JSP A;  3I5U A;  3CTA A;  5AON A;  1MD0 A;  2V9V A;  1R1V A;  3NRV A;  5DEQ A;  5ICF A;  4G8X A;  1XCV A;  1Z9C A;  3ZMV A;  1RIO H;  1YW7 A;  2RVC A;  1JE8 A;  3I64 A;  2ETH A;  3LQR A;  1FC3 A;  2FNA A;  4L9V A;  3HUG A;  1V4R A;  1V3F A;  5K5Q A;  2PI0 A;  1FYK A;  4Z2Y A;  3G73 A;  4G7Z F;  2K7L A;  2CG4 A;  4P9U A;  1REP C;  3JW4 A;  3F22 A;  3J81 Z;  3CDH A;  2X0L A;  4P5O A;  3WTS C;  3CUQ B;  3KEQ A;  1KQ0 A;  3F23 A;  3IL2 A;  3K0L A;  4WF2 A;  3DP7 A;  3BZ6 A;  2QYO A;  5HLI A;  1VTN C;  3HSE A;  4I02 A;  2D1H A;  4R79 A;  2HWV A;  3RYP A;  5FO5 A;  3TKY A;  2IW5 A;  2RDP A;  2K27 A;  3HTS B;  3R60 A;  2HOE A;  2RNJ A;  2CYY A;  1BIB A;  5CJ9 A;  1KU7 A;  2COM A;  4RB2 C;  2P5L C;  2EFP A;  5L3B A;  4Q48 A;  2DQL A;  1FNN A;  1XGO A;  1D8J A;  4U0Y A;  1IXS B;  1O3Q A;  2D45 A;  3H3Z A;  3R0A A;  1D5V A;  3VFZ A;  5LBQ A;  3IHU A;  2Z5U A;  4BXU A;  1H9G A;  4RB1 A;  4I7H A;  1YW9 A;  1YW8 A;  1KYZ A;  4LK1 F;  3F8F A;  1HW2 A;  4CYD A;  3WTY C;  4ENN A;  1I1G A;  2DAO A;  3JSO A;  3E97 A;  3V7R A;  2F5C A;  5ILV A;  3EYY A;  2QQB A;  3I59 B;  4G94 A;  3D5L A;  4LGW A;  1AOY A;  3ELK A;  1R7J A;  3M1E A;  4ZYD A;  4OOI A;  2HYF A;  1LJ9 A;  2E7X A;  3V7S A;  5D5X B;  1QO0 D;  4GGG A;  1BM9 A;  2QM3 A;  3CO6 C;  2LSO A;  2L4A A;  1K79 A;  2HKO A;  3MZH A;  1P4X A;  2DQR A;  5HS8 A;  5TRD A;  1SMT A;  5FLX K;  4MHG A;  2WTE A;  2STW A;  5DUI A;  2FML A;  2W25 A;  3C18 A;  1R5H A;  2HQN A;  3MAJ A;  1DUX C;  4ZZL A;  2D2W A;  1PDN C;  5DD4 A;  4KMU X;  4OU0 A;  3LAP A;  2ISY A;  1LQ1 A;  3QOP A;  2HTJ A;  1BI3 A;  5HOO A;  3K1P A;  1Z1D A;  1ZRE A;  4LK0 F;  3DXJ F;  2CQK A;  3SQN A;  1T38 A;  1Z6R A;  5IT3 A;  3P7N A;  1YO5 C;  1G3S A;  3O6B B;  3ISP A;  4G6Q A;  1S7O A;  2O03 A;  1W5S A;  5AIP A;  2FRH A;  3GF2 A;  4WXC A;  3BPX A;  5CYV A;  2M1B A;  2W24 A;  1R58 A;  3OV8 A;  1S29 A;  1L0O C;  4I0A A;  2CWE A;  3ZMZ A;  4LB5 A;  2HZT A;  3L2C A;  3B02 A;  3HRM A;  4WXD A;  4YII A;  1G6N A;  1DPR A;  1FWZ A;  1R23 A;  2RV8 A;  2XV4 S;  1G3T A;  3SZP A;  4A6E A;  1IXR C;  1XGM A;  2KIU A;  2VOO A;  3S2W A;  3DPT A;  2GQQ A;  2ESH A;  2FOK A;  4KIG A;  4HDV A;  2DO7 A;  5E1X A;  3SZT A;  1O3S A;  1IRF A;  3R0J A;  1FX7 A;  5H20 A;  4IHS A;  2JRT A;  3T8R A;  2EFO A;  4L5J A;  1C0W A;  4U7D A;  5DCM A;  2ZME A;  2H6C A;  3BPV A;  1BI0 A;  1RUO A;  5K1Y A;  1JHF A;  5FB2 A;  5LGN A;  2XRO A;  4I09 A;  4BHC A;  1T39 A;  3WU1 B;  4EGZ A;  3IKV A;  1J9I A;  2HYG D;  2JSC A;  3MEX A;  2JTV A;  3GWZ A;  3BDD A;  3LA7 A;  5LEJ A;  3B73 A;  2RKH A;  2E1N A;  3F8B A;  2XRN A;  2XKP A;  1FT9 A;  1O7F A;  1LNW A;  4OMZ A;  5L3C A;  5JHU A;  5L3D A;  3CUQ A;  3E3V A;  1J0R A;  2ZNZ A;  1MJA A;  3DQV C;  3FM5 A;  1H0M A;  1FSE A;  4JBA A;  2VON A;  4RGS A;  2X4H A;  5FGM A;  3K9T A;  4L9J A;  1YG2 A;  1F5T A;  1P92 A;  1P4W A;  4HQM A;  4KMF A;  4NB5 A;  4GYG A;  2L02 A;  4AD9 A;  4CIC A;  3KP7 A;  2OZ6 A;  2MD5 A;  2A3S A;  3F8C A;  1XB4 A;  1MDM B;  4N9H A;  1G3Y A;  3K2Z A;  5E1W A;  4FX0 A;  1ZLK A;  1ONV A;  4PGG A;  4OIR F;  1Z6T A;  4OIP F;  4OIN F;  4HF1 A;  2XGX A;  2OZU A;  3M9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...