2DK5A

Solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
publication title Solution structure of Winged-Helix domain in RNA polymerase III 39KDa polypeptide
rcsb
source organism Homo sapiens
molecule tags Translation, transferase
total genus 14
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk5A01
3K0LA 1ZYRF 2O03A 1ODDA 2K7LA 2VBZA 3RKYA 4ZYDA 2HYGD 4LMYA 2Q2EA 3JTHA 4XLPF 4HAMA 2EA4A 4EMSA 4I09A 1SD7A 1ON1A 4IXAA 4EJUA 1SAXA 3KP6A 3M7GA 4LGWA 4GYIA 1T39A 4M73A 2Z9OA 5DYMA 2DW4A 4RB2C 2MA3A 1HKTA 3GXOA 4MNUA 1S6LA 3JAMK 1QNTA 1BI3A 1OR7A 1UHWA 1FBQA 4LJZF 2XRNA 4HV5A 1W7PB 1FP2A 2NYXA 4M6XA 1LEBA 1KU3A 3Q9VA 2GZWA 2GXGA 5E8GA 4B09A 4BH9A 3IC7A 4EGYA 1BI2A 4LD5A 1KYWA 1W7PD 4LK1F 5FO5A 1MDMA 4GGGA 5L3DA 2RN7A 1XGMA 5L3GA 5HOOA 3L9FA 4S04A 5LGNA 4L5JA 2K4BA 1F1ZA 2M45A 1Z91A 5JFRA 2STWA 3RKXA 4OIPF 4BHBA 4G7OF 4IF4A 1Z1DA 1OKRA 1FBSA 4IPAA 1ZN2A 2W57A 3F6OA 1DUXC 4A2UA 2EWNA 4BHPA 1MGTA 3RYRA 1XDUA 3NQOA 3U1DA 1Y0UA 5D8LB 3LQRA 5D5XB 1DDNA 4MEYF 4BXUA 4UVAA 4UVCA 3JTGA 2L02A 5H20A 1MKMA 2V1DA 3R60A 4P96A 2ETHA 1RZ4A 4HF2A 3O2PE 2P7VB 5DD8A 1H9GA 4RAYA 2PMHA 3BJ6A 1YG2A 2TDXA 2MD5A 1IN8A 1XGOA 2M5WA 3P9CA 4ENKA 1BC8C 4HDUA 5K5OA 4U0WA 3FF5A 2ZCWA 3T0YA 1P2FA 1YQAA 1LDKB 1H0MA 3MEXA 3RTRA 5K1YA 3O3KA 4M9ZA 1D8JA 5LHHA 3FWEA 2DU9A 3I64A 3M8FA 2H6BA 1HBXG 2RQPA 4O5VA 2XV4S 5D8KB 4MEXF 1L0OC 2A68F 3PQJA 3WG9A 2Z99A 1T0FA 5L3FA 2PQ8A 4JK1X 1CGPA 5A2QK 1LB2A 3SZPA 4WX9A 2EFQA 1B1BA 4HZFA 5BS6A 2RNJA 5TRDA 3WGHA 2OZ6A 2FMLA 3HTUA 1HQCA 3EETA 3ZN1A 2ZMEB 3CO7C 4IRIA 5L3BA 2VBWA 2YR2A 2F5CA 1RIOH 1MJAA 3QU3A 3GLXA 1UFMA 2HFHA 2MLKA 3HIFA 3WTTC 5D5VB 5FFZA 4KIBA 2MBFA 3K1NA 5DEQA 2RGVA 3WTVC 5E8IA 2KRFA 4IRGA 3RIRA 3K1MA 4D0PA 1JHFA 3RPUA 2NS0A 3VOEA 3RDIA 1K6OA 2PI0A 4OIRF 3T8RA 3F8MA 1FSEA 2FEZA 4OU0A 1P4XA 5BQTA 2YPRA 4XRFA 3CTAA 4DQ2A 5ICFA 3TO9A 3BY6A 2OBPA 2FMYA 4EJWA 2K4JA 2HZTA 4HX7A 4UUVA 3ISPA 2V1XA 1PDNC 4N9IA 3U9GA 4LK0F 5ERIA 3LAPA 2P6TA 2AXLA 3GEZA 3HSEA 1ZGJA 4PGGA 1G3WA 3TGNA 4LFUA 1AOYA 3WTUC 3TO6A 2W24A 4WWCA 2RDPA 1KU2A 3ROUA 1XCVA 1D5VA 2PMUA 2CO5A 1S7AA 3QP6A 5FD5A 1KU9A 1NHAA 4GXOA 1W5TA 4KIGA 3F72A 5D5UB 3WU1B 4CGZA 2XAQA 3COAC 3BJOA 2Z5UA 3LQQA 5DCMB 1SFUA 1WKMA 4HLXA 2W84A 1R5HA 3M9AA 1ON2A 1FPQA 3I71A 4YIFA 3B02A 3JAMZ 5AONA 5EEHA 1H9TA 3ULQB 1KQ8A 2DLLA 1MJBA 4UV8A 1J7KA 2FQ3A 4BQAA 2DT5A 1UB9A 1F4KA 1FOKA 1KA8A 1OMIA 4CO8A 4PCQA 1I1SA 2P8TA 2JSCA 3LA2A 3ZMTA 2D45A 4RGUA 2FOKA 1XD7A 2DO7A 3BOQA 2NNYA 1J75A 4AD9A 1SD6A 3WTXC 1J0RA 2HWVA 2FBHA 4M72A 3KZZA 1QZZA 3FHZA 4Y13A 3WODF 5TJJA 4O3MA 5DCMA 2CGPA 1JXSA 2M8EA 1FBUA 1YW7A 2FSWA 4Q47A 3O6BB 5HLIA 3HRUA 5LEKA 5CVVA 5K5RA 1FYLA 3TOBA 4K2EA 1U6GA 5D6FA 1SFXA 2IA0A 1R1UA 3H92A 5CVUA 3WE3A 1USSA 3G73A 2KIFA 1IN4A 4G6DA 4GO1A 4I0BA 1ZG1A 2Q0OA 4U7DA 1XMAA 1K78A 2ADUA 1E2XA 3GO5A 2HEOA 1U5TB 3PQKA 4I2OA 3CO6C 3RJPA 4EJVA 1QO0D 1F9NA 1QPMA 3F8CA 4ZYGA 4P55A 4YFNF 4A0ZA 3KETA 4CDGA 4LG0A 1LDJA 3R6SA 1LQ1A 4IJAA 5HDNA 4OOIA 4BNCA 1PUEE 4WXCA 3F3XA 2L3DA 4MQ9F 4LB5A 2HS5A 3GFLA 1MD0A 1Z7UA 1XSVA 1MZBA 1XN7A 2QQBA 1RUNA 4EJOA 3BZ6A 3IHUA 1I5ZA 4OMYA 4EJTA 3GFJA 5A2QZ 2OZUA 2IT0A 2BBYA 1FT9A 2HYFA 5E1ZB 1BC7C 1YW8A 4HA8A 4BYYA 1J9IA 3OOPA 3WTYC 4WCGA 4B8XA 3V7SA 1KYZA 3KFWX 3V4GA 1SMYF 5J6XA 3J80K 1P4WA 2IVMA 2LNBA 3CUQC 3AAFA 3ZN0A 4EGZA 4ASNA 1MDMB 3OV8A 1TNSA 1SFEA 2E1NA 2QWWA 1KU7A 1PP7U 5KVRA 2MH9A 3TDZC 4I02A 4XSXF 3E97A 4KFCA 5FGMA 3I59A 1U78A 3TO7A 4FT8A 2YX4A 3I54A 4ZYHA 1LEAA 5D4SA 1BI0A 2BEOA 4HOBA 4I98B 4EM0B 2JPCA 1LDDA 1ZLJA 3HRTA 2VT3A 3J7AO 2R7DA 2H94A 1EH8A 3VEPA 5FB2A 4LLNA 1R1VA 2J5PA 3GWZA 4A6EA 1CF7A 1D8KA 5DD4A 2F5FA 1V3FA 2MH2A 2FRHA 1QGPA 2A5YB 4CYDA 4Q4ZF 2PN6A 2EB7A 4CZZA 2ESHA 5IT3A 4G7ZF 1EH6A 3MCZA 5HS8A 3DQVC 3P7NA 2W25A 2XAJA 1ZG5A 3HSRA 2HQNA 1OYYA 3LA3A 2CQKA 1ZRDA 4IHTA 1BM9A 1JHHA 3HOSA 5DV5A 2HGCA 3M1EA 3KEOA 1ONVA 3GZ5A 1FWZA 1HKSA 3IWZA 3V8KA 2YU3A 4EV0A 2DFIA 1WRJA 3IKTA 2ZXJA 4BHCA 4YG2F 1FLIA 3HOTA 3MZYA 1C0WA 4PGHA 2QM3A 3BJAA 3DPTA 2QQAA 1ZG3A 3EYYA 3GVAA 2ZNZA 5J8CA 2X4HA 3FM3A 1TW3A 4L9JA 2DK5A 2M1BA 2F2EA 2EA2A 3GX4X 2G7HA 1B6AA 1DPRA 1HW1A 1R00A 1U2WA 4RB1A 3M8EA 4A12A 3WE2A 3L00A 1HW2A 2VE8A 3WGGA 2RVCA 2UXXA 4MGRA 4OINF 3Q5FA 3W6JB 3I0TA 3LFKA 2BYVE 5HVQC 3K69A 1BI1A 4AIJA 4NHJA 1YLFA 2PJPA 3I53A 2EJRA 4LLLA 3E5UA 3V7CA 5K5QA 2LSOA 1B9NA 2C6YA 4M9XA 3SXYA 5LHIA 2JRTA 2M30A 4EM1A 2AS5F 3F8NA 5FLXK 3DFGA 1W5SA 4G94A 2XASA 3GW2A 3IRRA 1V4RA 2W85A 4OIQF 3RI4A 1T2KA 2V1UA 4A0YA 1FYKA 1RNLA 4ON0A 4ZYEA 2JT1A 2KJBA 4KN4X 4Q48A 2QLZA 3W6KB 2L01A 6PAXA 1HKQA 1R1TA 3I58A 3E6BA 1ZLKA 3CUOA 4ETSA 4HDVA 4HQMA 2ZBKA 1TNTA 4L9NA 5DUIA 4L0ZB 2UZKA 1O3SA 3SZTA 4RB3C 3CJNA 3K2ZA 1L3LA 4HW0A 3H3ZA 4ESFA 1J59A 4P9FA 3FXUA 2LDUA 4KMUX 2F5EA 1K79A 5DUKA 3E3VA 2A69F 2RV8A 5E18F 3SQNA 5AIQA 2HR3A 3ZPLA 2DAOA 3MZHA 3WTZA 1OYWA 2EFWA 4QLCU 1YW9A 3CDHA 4N9HA 2XIGA 3HRSA 1A04A 4Y15A 2VC0A 2DQLA 5DDGA 3WGIA 2K86A 1S7OA 4ESBA 4OMZA 3HHGA 2VOPA 4Y17A 4CHUA 4S05A 2CSOA 3E5QA 5JVTA 1T6SA 4LB6B 1IXRC 4MTEA 1R23A 3LSTA 3HHHA 2EFNA 1SD4A 3QOPA 3GF2A 4GCVA 1B4AA 1XB4A 3J80Z 3BPVA 4CICA 1FX7A 2WV0A 2PG4A 1P92A 1G4DA 4KUMA 1JGSA 2HKXA 1E17A 3ECOA 4ENNA 3KP7A 5ICGA 1IN5A 2IW5A 5LBQA 1ZGAA 1ZRCA 3FMSA 3IWFA 5FD6A 1R22A 4DNCA 1FY7A 3FXRA 3H3UA 1XGNA 3ZQ7A 1ZREA 3WTWC 2CWEA 4HV6A 1D3YA 3T8TA 4IHSA 5D5WB 2KIUA 2QBYA 4N0BA 3KCCA 2FE3A 3CUQA 1O3QA 4WF2A 2COMA 2QENA 4YFXF 2A6HF 2JPBA 3REOA 3R0AA 1YS7A 4TV7A 3N4MA 3KP5A 1I6XA 2VE9A 1K78B 2NAZA 2PFBA 4I0AA 1SD5A 5CYVA 2V79A 1R7JA 4QWQA 1BOAA 2FA5A 1WI9A 3K1PA 2J5OA 2XAGA 4AVPA 3MWMA 1IRGA 1O7FA 4LG0B 1Z9CA 3E6CC 1FNNA 2HTJA 1IXSB 2OAZA 4U0VA 2V9VA 1HSTA 3DF8A 4KA4A 4BAYA 1K7AA 4UXNA 2E7XA 1P4AA 2A61A 2VN2A 4I7HA 1R36A 1ZARA 1I1GA 1KQ9A 3FM5A 2NRAC 4RGSA 5D4RA 3JSOA 1FC3A 3I5UA 4UVBA 3C1DA 1O57A 5CLSA 3S2WA 2EV0A 5L3EA 3JSPA 2OQRA 1QBJA 3TDUC 1I27A 2ZFWA 2VC1A 3QPHA 2FNAA 1ZRFA 5BMZA 2EFPA 2FF4A 2DQRA 5JR3A 2OD5A 4XSZF 1HXDA 3F6VA 2E7WA 4KMFA 1BJAA 2DPUA 4KT5C 1O7LA 3I59B 5CVJA 2XHKA 2EFOA 3G3ZA 4R1HA 4EM2A 3EDPA 3C18A 1F5TA 5L3CA 2XVCA 4RGRA 2MLGA 5FLXZ 2ZJ2A 4HX8A 4R79A 2Y0MA 3PFIA 3IL2A 2OQGA 2OA4A 5LEJA 1DP7P 1ZHFA 5KK1A 4KYWA 2P5KA 2P5VA 2GWRA 1FZPB 1YTYA 3HYIA 3ZMVA 1CF7B 4KDPA 2CG4A 3QAHA 1FSHA 2UXNA 4A6DA 1MJ9A 1TW2A 3V8LA 2QYOA 5IT9K 3ZMZA 4M6YA 4YIIA 3QPTA 2EV6A 2G7UA 5BPIA 5ILSA 2XKPA 4R8HA 4AIHA 2IPQX 4ESJA 5HS9A 2ISYA 1G3SA 2IRFG 1TQPA 2YX7A 1GXPA 2XROA 3KP2A 1IN6A 4P9UA 4WK8F 2CYYA 3KP4A 3JW4A 4A5MA 1J5YA 3NRVA 5D6EA 1S3JA 5HLGA 1B59A 1GHCA 4IRHA 3SFZA 4NB5A 1GXQA 1Z6TA 1USTA 3LWFA 2BE5F 2O61A 5E1WA 3KZYA 1BBYA 5LRSA 1G6NA 4A0XA 2GA2A 3TQNA 4ZZDA 3BPXA 4Q5SF 3DEUA 4NQWA 4F7ZA 1Z05A 2ZNYA 1YIOA 2M87A 2OU2A 3KEQA 1TLHB 2Y48A 3D0SA 3P9IA 3J81K 4ZZLA 3GYHX 3F22A 4ZH4F 4ENJA 5ICEA 5ILUA 2Z33A 2VODA 3MQ0A 3NEUA 4U88A 2VBYA 4HX4A 3L2CA 1KQ0A 2UWMA 1YFHA 2H09A 1X3UA 2WTEA 2HQRA 3FZVA 2ESNA 4EVIA 2VXZA 1XSDA 5LHGA 1LNWA 3L09A 1G3YA 3DPLC 1EV7A 3T1BA 2VBXA 4G7HF 3KLOA 2QUFA 3RKWA 2H27A 4CXFA 2P5LC 5CVRA 3R4KA 3WU0A 2O6GE 2O3FA 1W7PA 3N97A 3ECHA 2K02A 1IUYA 2Z3YA 2YSRA 1IRFA 2IA2A 1R5GA 1XCBA 3R0JA 4FX4A 3ZMDA 1BIAA 1IF1A 2PLYA 1TTYA 3LAJA 2GIVA 4HLYA 1Q1HA 1W4MA 3C3WA 2Y75A 2LKPA 1XSXA 2O0YA 1U5TC 3U2RA 3QRFF 2GXBA 1IAWA 2A6EF 4M74A 3ZMUA 3DP7A 4HBLA 2FBKA 1RUOA 1YYVA 4IVNA 4JQFA 5CVIA 4EQQA 3FXQA 2D2WA 2JTVA 3VB2A 3L7WA 4MTDA 3P9KA 1AWCA 1KGSA 1YS6A 3V8JA 3CLOA 2HTSA 2L54A 4WXHA 3ELKA 2KKOA 1WWXA 3TKYA 2P7CB 4AIKA 3F21A 2GA1A 2P4WA 1B9MA 2B0LA 1IW7F 3V7RA 3ABTA 2X0LA 2ACJA 5AIPA 3B73A 2DPDA 5E17F 1SMTA 5F64A 3IRQA 2H6CA 4P5OA 3E6MA 3SHFA 4L5IA 4UV9A 3TOAA 1QQIA 5F6FA 4MHGA 2WWYA 3RYPA 2D1HA 4UHTA 1O3RA 1STZA 2QVOA 2LF8A 5CJ9A 2FU4A 2PBIA 5FFXA 4FX0A 5LGUA 2L4AA 1U8RA 2XKOA 3HTSB 2Q8KA 4XLNF 5HDGA 3E5XA 2VONA 2JZYA 5F1RA 3BWGA 4M71A 2QQ9A 3ML6A 4OIOF 1JE8A 1IN7A 5JI6A 1P6RA 4XBFA 3GFIA 2QBYB 1RI7A 2ZMEA 1LJ9A 3CUQB 1HW5A 4RS8A 1LVAA 4GYGA 1UCRA 5JHUA 3FMRA 3FMQA 3F23A 1TQMA 5IT9Z 4L9TA 1TBXA 2KIMA 2QZ8A 1XMKA 3E6DA 3DKWA 4LLGF 1OYIA 4RGXA 1IZ1A 2FBIA 2HDCA 2ZKZA 4PDKA 2XAFA 2FNPA 1Z6RA 3ABUA 2CFXA 3I4PA 2KJCA 5ED4A 1T98A 4L0YB 2PEXA 3D5LA 4E70A 3EUHA 1ULYA 3HRMA 2ELHA 2VOOA 3IKVA 1S29A 1S8NA 4HYEA 3MAJA 1BN5A 4PZJA 1VTNC 1O3TA 1TQIA 4RAZA 5BOXA 2RKHA 2VT2A 4FHTA 5HDKA 4L18B 1WQ2A 4U7BA 4JBAA 3F8FA 3KLNA 1T38A 5ILVA 3LA7A 4G9YA 3EYIA 2WC2A 5E20A 2IP2A 3DV8A 1PP8F 4YFKF 2DK8A 3ZP5A 1XDSA 2R7FA 1QZYA 4WXDA 5HS7A 2STTA 2R3SA 3GZ6A 4O6JA 1U3EM 5DCFA 3C7JA 1GVJA 1BIBA 5LGTA 2XGXA 2EK5A 3J81Z 1R58A 3EQLF 4HQEA 1J2XA 2HKOA 4HF0A 1XGSA 2A3SA 1G3TA 2DI3A 2F5DA 3BDDA 2HOEA 1UHMA 5EEGA 2XUBA 4ENMA 4HF1A 2IA1A 4I01A 3FX3A 2IJLA 2D1VA 2CW0F 2EV5A 5HLHA 4L9VA 2O8XA 1FYMA 2A07F 4UNOA 2GAUA 4KICA 3F8BA 3VFZA 5E1XA 5LRRA 4MQVA 5H6QA 3MFKA 2NNNA 4RB0A 5LLQA 3QP5A 4G6QA 2DTRA 4Z2YA 2MC3A 3GFMA 4H0EA 1REPC 3T5XA 1DPUA 1YO5C 1OPCA 5BPDA 4G8XA 3KE2A 1ZH5A 2BGCA 2E1CA 2ZO4A 3QU6A 2ISZA 2DBBA 2FXAA 2BV6A 5ICCA 2P6SA 2G9WA 2GQQA 4KIFA 1HSJA 3KP3A 4U0YA 3ERED 2RC4A 3HSFA 1WSUA 1ZAOA 3R61A 2L4MA 2XAHA 3DXJF 5J8FA 5H6RA 3HUGA 3Q9SA 4M9SA 3K9TA 4KN7X 3ZMSA 3VODA 3RPQA 2LF7A 4AWXB 3WTSC 1EH7A 3BROA 1IXCA 4KNYA 4A5NA 1U5TA 2V6CA 3GUDA 1FP1D 3BP8A 2K27A
chains in the Genus database with same CATH superfamily
3K0LA 2W4SA 5J3LA 4YIRX 1ZYRF 2O03A 1ODDA 2K7LA 2VBZA 3RKYA 4ZYDA 2HYGD 4LMYA 1VQ4I 2Q2EA 3JTHA 4XLPF 4HAMA 2EA4A 4EMSA 4I09A 3K70C 1SD7A 1ON1A 3DLAA 2V26A 4IXAA 2RQQA 3H0DA 4EJUA 1SAXA 2BOLA 1MMNA 3KP6A 1JJ6C 3O8HA 4E7JA 3M7GA 2XGDA 4LGWA 4FQGA 4GYIA 1T39A 4M73A 2VQHA 2Z9OA 5DYMA 2GIZA 2DW4A 1RRJA 4RB2C 2MA3A 1HKTA 3GXOA 3MVPA 4BE1A 3CCRI 4MNUA 3GCMA 1S6LA 3JAMK 1QNTA 5F08A 3QPLA 1T08B 4IHWA 1D1CA 4XRMA 1BI3A 1OR7A 4V19K 5IP7J 3H5AA 1JKRC 1B72B 1UHWA 1FBQA 4LJZF 2XRNA 4HV5A 3BT9A 1W7PB 5F0FA 1FP2A 2NYXA 4BQNA 4M6XA 2RAEA 1R5ID 2BW3B 1LEBA 1KU3A 3Q9VA 1QHHD 4XN0A 3CCEI 2GZWA 2GXGA 2ZC2A 2PX9A 1JUPA 5F0CA 2M7BA 4NDLA 3HOWJ 5E8GA 3ZQQA 4B09A 3AG1H 3QPSA 4BH9A 3IC7A 4M3BA 3CMEI 1VQOI 1WH5A 1K83J 4EGYA 1BI2A 2FJ1A 1KYWA 1W7PD 4LD5A 4LK1F 5FO5A 2E36A 2OTJI 1MDMA 4GGGA 5L3DA 2RN7A 1XGMA 1A36A 3HC7A 5L3GA 5HOOA 3L9FA 4S04A 3G1LA 2VQGA 3PO2J 5LGNA 2R7ZJ 4L5JA 4ZDOA 1XG1A 3K2AA 5IYDJ 1YOVB 2IS2A 4IQJA 2K4BA 3LSIA 1F1ZA 2M45A 1Z91A 2DFFA 2M4KA 5JFRA 2I8DA 2STWA 3RKXA 3G1MA 4OIPF 1VI0A 4BHBA 2HOTA 3JRBA 2HQAA 3OYFA 2F4MB 4G7OF 1DP3A 4IF4A 1Z1DA 3H1CA 1OKRA 4XQFA 1FBSA 4IPAA 1ZN2A 2W57A 3F6OA 1DUXC 3CF2A 4A2UA 2EWNA 4PFOA 4BHPA 1MGTA 3RYRA 1XDUA 3NQOA 1ENHA 3U1DA 1Y0UA 5D8LB 3OL3A 3LQRA 5D5XB 1DDNA 4MEYF 4ITVA 4BXUA 4UVAA 4UVCA 3JTGA 2L02A 1MBKA 1HLVA 1G8XA 3QWLA 5H20A 1T95A 1MKMA 2V1DA 3R60A 4P96A 2ETHA 1RZ4A 4HF2A 3K6GA 2P7VB 3O2PE 3CC4I 5DD8A 1H9GA 4RAYA 2PMHA 3BJ6A 2EBIA 1YG2A 2TDXA 4CA0A 2MD5A 1IN8A 2DMPA 2Z2SB 3PUFA 1VQMI 1XGOA 2M5WA 3P9CA 4ENKA 2M9HA 4HDUA 1BC8C 1I6HJ 2CW7A 5K5OA 2FOWA 3UR3C 4U0WA 3FF5A 2ZCWA 3T0YA 2XB5A 1P2FA 1YQAA 5EDNA 1LDKB 2B7EA 3ABMH 3ZRGA 1H0MA 2FUG2 1Y1VJ 1I3QJ 3MEXA 3RTRA 5K1YA 1UZCA 5J4VA 2DXIA 1HOMA 5EGOA 1XX5A 2HXIA 3O3KA 3JRHA 4XLEA 3OMYA 4M9ZA 1Y6IA 1D8JA 3HZJA 4A3CJ 5LHHA 3FWEA 2DU9A 4YRVA 3I64A 2ME6A 3OY9A 1VQKI 3FKIJ 3LSHA 3M8FA 2R4GA 3DEEA 2H6BA 5GTHC 1HBXG 4F92B 1UHSA 2V6EA 3HPGA 2RQPA 4O5VA 2XV4S 1MNEA 2DCEA 4BJ6C 2ZJRF 1GUUA 2OPTA 5D8KB 2DA6A 2K9NA 4MEXF 1L0OC 4A3KJ 2A68F 5IOZA 1B8IB 3PQJA 2ID6A 4Y3OA 3WG9A 3NARA 3JRAA 1JT6A 3WHBA 2Z99A 1T0FA 4ABZA 2XGCA 1BJZA 5L3FA 3A03A 2PQ8A 4JK1X 1CGPA 1HDDC 5A2QK 2AHQA 1X19A 1LB2A 1APLC 3SZPA 4WX9A 2IS1A 1T8IA 2EFQA 4DYRA 1B1BA 4HZFA 5BS6A 4BS9A 1AU7A 2RNJA 5TRDA 3WGHA 2OZ6A 1SVOA 2EPFA 2FMLA 3HTUA 1HQCA 3EETA 2HVSA 3JRDA 1V55H 3ZQHA 3S93A 1S9HA 3ZN1A 2ZMEB 3CO7C 4IRIA 5L3BA 1FMVA 2VBWA 2QF7A 2OC6A 2WADA 2F5CA 2YR2A 3JR9A 1RIOH 1FTTA 1MJAA 1R49A 1IUFA 2Y31A 3QU3A 3Q0UA 3GTPJ 3GLXA 4J01A 2H8RA 1UFMA 2HFHA 1HC8A 2G0EA 1WVRA 1AA7A 1MNDA 1UG2A 1JI8A 2MLKA 2DOEA 3HIFA 2AXTC 3WTTC 2K9MA 1RKTA 1T56A 3DKYA 5JLXA 5D5VB 5FFZA 4KIBA 2MBFA 3K1NA 5DEQA 3TMOA 2L7MP 1WPKA 2RGVA 3WTVC 1YJWI 5E8IA 2KRFA 4IRGA 1A35A 1ORKA 3RIRA 1TZLA 4M3EA 4ANJA 4KT6A 3CMYA 1D5YA 3K1MA 4IHYA 5B1AH 4D0PA 3V42A 1JHFA 3RPUA 2NS0A 3VOEA 3RDIA 3S2HJ 2M0CA 1K6OA 2PI0A 4OIRF 1B8IA 3BQYA 1NH3A 3T8RA 3HPHA 3F8MA 3G1OA 1FSEA 2FEZA 3CD6I 4OU0A 1P4XA 1WJAA 3BLYA 5BQTA 2DYSH 2R7XA 2YPRA 4XRFA 3QODA 3ZXSA 1JJ8C 2GXAA 3CTAA 5EYRA 1IRZA 4DQ2A 1JKOC 2DYRH 1UMQA 5ICFA 1W36D 2LTPA 4QSHA 4PJJA 2O9LA 3S8PA 4ZTFA 1UJ8A 3HEFA 4RAGA 5J1RA 2HOSA 3OYMA 3TO9A 2GM4A 3CJTB 3HM5A 3BY6A 4HSTA 2OBPA 3F9KA 3KYDB 4PJNA 2FMYA 4EJWA 1WJBA 2K4JA 3SZGA 3WHCA 4Z6YA 5IP6A 2HZTA 4HX7A 4UUVA 3ISPA 2V1XA 3S3OA 1YJ9I 1PDNC 2Y9YA 4N9IA 2JMWA 1WI3A 3U9GA 4LK0F 5ERIA 1MSFC 3LAPA 2P6TA 5EZGA 2AXLA 3GEZA 2LBFB 2HI3A 3HSEA 3BG7A 2JA2A 4JOMA 2W00A 2A05A 1G2HA 1ZGJA 4EEFG 4FETA 2YU9J 4PGGA 1G3WA 3HGYA 3TGNA 3OYCA 1ZR2A 4LFUA 3M4OJ 1AOYA 3WTUC 3TO6A 2W24A 4WWCA 2XDVA 2L9SA 1VQNI 2R5YA 2RDPA 2E60A 1KU2A 3ROUA 1XCVA 3IUOA 4C2TA 1D5VA 2PMUA 2CO5A 1S7AA 1IG7A 3QP6A 5FD5A 2ZXIA 1KU9A 1NHAA 3BTLA 4GXOA 4C2UA 3BCAA 1W5TA 4KIGA 3A01B 3F72A 2ZJPF 1BA5A 4PJ0C 4IQ4A 3I9V2 5D5UB 4F52A 3WU1B 2B9SA 1Z7LA 2X48A 4CGZA 2HOAA 2XAQA 4BE0A 1K4TA 3JRFA 3COAC 3BJOA 3SEQA 2Z5UA 1FMWA 1X58A 2F4OB 2JVHA 4GRIA 3L2VA 3LQQA 5DCMB 1Y8QB 1FTZA 1I3AA 2VKVA 1SFUA 1WKMA 4JX6A 1NK3P 4HLXA 2W84A 4I6ZA 1QA6A 1R5HA 3FISA 2JRMA 3M9AA 1MH3A 3OS0A 4A3EJ 1ON2A 1FPQA 1AKHB 3I71A 4YIFA 3B02A 2BZTA 3JAMZ 5AONA 2ZSHB 1TWGJ 5EEHA 1H9TA 2JA5J 3ULQB 1KQ8A 1ETVA 2DLLA 1MJBA 1YX5A 4UV8A 4GFBA 1J7KA 2FQ3A 4BQAA 4XRSA 2DT5A 1UB9A 3P5JA 4B43A 1F4KA 1FOKA 2KPMA 5DTDA 5B3SH 3J7ZI 3Q3SA 3TP0A 5LFAA 1KA8A 1OMIA 2K5CA 4EATA 2X9DA 5GTIC 4CO8A 2IS4A 4PCQA 4ZDPA 1I1SA 2E1OA 2P8TA 2JSCA 2V7FA 4XLHA 3L2WA 3LA2A 3ZMTA 3I4NJ 2D45A 2JA6J 2Y69H 4RGUA 2FOKA 2X6OA 3AL0B 1X1PA 2EH3A 1XD7A 3A4CA 2DO7A 2W82A 3BOQA 3HGGA 1U8BA 2JA7J 2NNYA 1J75A 4AD9A 1SD6A 2JQ7A 2IGNA 3VWBA 3WTXC 3BTIA 2E35A 3CZ6A 1J0RA 2HWVA 2FBHA 4M72A 3KZZA 3SJMA 1QZZA 3FHZA 3S1RJ 4Y13A 3WODF 5TJJA 4O3MA 4IL6C 2KHMA 2LREA 2M34A 1YRNB 5DCMA 1Y1WJ 2GBYA 2CGPA 2CV1A 1JXSA 3MD2A 4E7SA 3FXKA 4XLCA 2M8EA 3ONQA 1FBUA 1YW7A 2FSWA 1TWFJ 2KRCA 5IPAA 1H8AC 1BW5A 4Q47A 2QKMB 3O6BB 2VI6A 5HLIA 1LKXA 3HBLA 3HRUA 5LEKA 5CVVA 5K5RA 4FCYA 1FYLA 3TOBA 2E5NA 1MMGA 1ZQ3P 4K2EA 2XF6A 5DM7F 1U6GA 3OYEA 5D6FA 1SFXA 2IA0A 1ITYA 1R1UA 3JCUC 2V9PA 3H92A 1RESA 5CVUA 2DMUA 1ERDA 1OCCH 2CUJA 3WE3A 2BY3A 1USSA 2MC4A 3G73A 4A3IJ 2KIFA 1IN4A 4G6DA 4GO1A 2BY1A 4I0BA 2KDZA 1ZG1A 3ZQLA 2Q0OA 1QPIA 4U7DA 3L2RA 1XMAA 1YHQI 1K78A 2ADUA 1E2XA 3GO5A 2HEOA 1U5TB 3PQKA 3CCLI 3ASOH 2E34A 4I2OA 2XF7A 3CO6C 3RJPA 4EJVA 1QO0D 4IEJA 1F9NA 2R7WA 1OCRH 2JWTA 1QPMA 3F8CA 2Q2EB 1RETA 2DDBA 3A1YA 4P55A 4ZYGA 5FKMA 4G6TB 3BR5A 3CCJI 4B44A 2E1MB 1OQYA 2MG4A 4YFNF 2Q1ZB 4A0ZA 3KETA 4DZJA 4CDGA 4LG0A 1LDJA 5J1UA 3IH4A 3NWSA 2H1LA 3R6SA 3CCSI 1LQ1A 3C2GA 1VQ5I 3FXJA 4QTRA 3GMEA 4QIWN 2XSDC 4IJAA 2L5QA 4II2A 4OOIA 5HDNA 1PUEE 4BNCA 3ZQFA 3BQZA 3LSKA 5GAHJ 4IX7A 5FROA 4WXCA 3F3XA 4UY8I 2L3DA 4MQ9F 1VQ7I 1ETKA 4LB5A 2HS5A 3GFLA 1F43A 3ESWB 1MD0A 1Z7UA 1XSVA 2KQRA 1MZBA 1XN7A 2QQBA 1RUNA 4EJOA 3BZ6A 1MMAA 3I4MJ 3IHUA 1I5ZA 4OMYA 4EJTA 3GFJA 4UUTA 5A2QZ 2HVRA 2WY7Q 3TW7A 2OZUA 2IT0A 2BBYA 4JX4A 1FT9A 3ERMA 1MSEC 2HYFA 2LYCA 2DA5A 1R6RA 5E1ZB 1BC7C 3K4KA 4A3DJ 1YW8A 4HA8A 4BYYA 1XTAA 4NUBA 3RCOA 1J9IA 4B4CA 2YUSA 4ZTJA 5C4JJ 3OOPA 3WTYC 2VJJA 4YELA 3AG3H 4B8XA 4WCGA 3V7SA 4D5CA 1KYZA 3KFWX 5CKTA 3V4GA 1SMYF 1FOYA 2IEKA 5IYCJ 3JREA 3EPZA 5J6XA 3PNYA 2LC2A 2W1OA 3J80K 1P4WA 2IVMA 4L5EA 3OIQA 2LNBA 3CUQC 3AAFA 1YJNI 3ZN0A 3K4NA 4EGZA 4ASNA 3SDBA 1JTYA 2RREA 3GLLA 4UUSB 1MDMB 3QOEA 1BR4A 3KYCB 4XL9A 1PUFB 3OV8A 1TNSA 1SFEA 2E1NA 5FLMJ 2QWWA 1KU7A 3OIOA 1OCTC 1PP7U 5KVRA 2ZXHA 1XPXA 5K7FA 3VYTB 2MH9A 3W2VA 3TDZC 4I02A 4XSXF 3E97A 3TEDA 4KFCA 4FASD 2CS3A 1U0JA 2NVUB 3DBHB 5FGMA 3I59A 2KT0A 1U78A 4IHXA 3TO7A 3PSFA 4FT8A 1QRYA 2LK2A 2LRDA 2YX4A 3I54A 2VPRA 1LEAA 4ZYHA 5D4SA 4XRSG 3TL4X 1BI0A 2BEOA 1GVDA 1WJCA 3H9JA 4HOBA 4I98B 4HEA2 2HDDA 4EM0B 2WY8Q 2JPCA 1LDDA 5EF6A 1ZLJA 3HRTA 2VT3A 3J7AO 1YE9A 2R7DA 1TT5B 4CH7A 2H94A 1EH8A 3VEPA 3L1PA 5FB2A 2HQ5A 4LLNA 1R1VA 2J5PA 3GWZA 4A93J 3OL4A 4A6EA 3A02A 2L0KA 3QQAA 2HNHA 1D8KA 1ZK8A 1CF7A 1I39A 3CLQA 5DD4A 5EZHA 2F5FA 3B6AA 3HXLA 5KCMA 1V3FA 2K85A 2MH2A 2FRHA 1QGPA 2A5YB 4CYDA 4Q4ZF 4IOCF 2PN6A 4C3JJ 2EB7A 4CZZA 3QYBA 2ESHA 2GOMA 5IT3A 2QQ8A 4G7ZF 1EH6A 3MCZA 5HS8A 1ACIA 3DQVC 3BG6A 2V4JC 2XAJA 2W25A 3P7NA 4UUSA 1ZG5A 4FTHA 1WFXA 3HSRA 1PUFA 1QZEA 5FRMA 3OSGA 4D9JA 1VFCA 2XGEA 2HQNA 4F55A 1OYYA 2XC7A 2H1KA 3LA3A 5EGOB 2CQKA 1ZRDA 4IHTA 2VQLA 1BM9A 1JHHA 3S3MA 3HOSA 5DV5A 2CQ7A 2HGCA 3M1EA 3S1NJ 1OFCX 2Y0SA 1A31A 4CSWA 2EQRA 2LLKA 2DN0A 3FDYA 3KEOA 1ONVA 3TW6A 3GZ5A 5JVGF 4BDYA 1UG0A 1FWZA 1HKSA 3IWZA 3V8KA 2YU3A 4EV0A 2DFIA 3CESA 1WRJA 3IKTA 3S16J 2ZXJA 3DPUA 4BHCA 4YG2F 4MO7A 1FLIA 3H0GJ 2OTLI 3HOTA 2NOGA 3MZYA 1C0WA 1ZGWA 4PGHA 2QM3A 3D5SC 3BJAA 3DPTA 1LVKA 2QQAA 4X1EA 1ZG3A 4D7NA 3EYYA 1GV2A 4BL0B 3GVAA 4AVZA 2ZNZA 3K4MA 5J8CA 2X4HA 4XONA 3FM3A 2BY2A 3A0BC 1TW3A 1W5CC 3MKWB 3LSJA 3VPRA 2HU9A 4L9JA 2DK5A 4RLQA 2M1BA 2F2EA 3M07A 2EA2A 3GX4X 2G7HA 1B6AA 1DPRA 1HW1A 2H8WA 1R00A 1U2WA 4RB1A 3M8EA 4A12A 3WE2A 2DMTA 2IGKA 3L00A 2KIQA 1HW2A 2VE8A 4PK4A 4B3XA 3WGGA 2EIJH 3U1KA 2RVCA 2UXXA 4MGRA 5HODA 3OYDA 2CMPA 2IGOA 4OINF 2NXNB 3KX2A 3Q5FA 1UELB 5E3OA 3W6JB 3H9QA 3I0TA 5E3MA 3LFKA 1U9NA 2BYVE 1DGRM 5HVQC 3K69A 1POGA 1BI1A 3M8JA 4BJTA 1WHUA 4BBSJ 2VKDA 5M5XJ 4AIJA 4NHJA 2V9KA 1N75A 1YLFA 2PJPA 3I53A 2EJRA 4LLLA 3E5UA 3V7CA 5K5QA 4KISA 2LSOA 1B9NA 2C6YA 4DGWB 4DZPA 1D0ZA 4M9XA 3SXYA 3BG5A 2QSFX 4BXFA 2JRTA 5LHIA 2M30A 4F3QA 4EM1A 2AS5F 1MBFA 3F8NA 1FEXA 3HL2A 5FLXK 1J09A 1W5SA 3DFGA 4G94A 2KLOA 2HPIA 2O7OA 2XASA 3GW2A 3GTKJ 4OWRB 1IGNA 3IRRA 1V4RA 2W85A 4OIQF 4D5FA 3RI4A 1T2KA 1GT0C 2V1UA 3RPUD 3DCFA 4A0YA 1FYKA 1RNLA 4ON0A 4ZYEA 2CFOA 2JT1A 2KJBA 4KN4X 3SDGA 2YS9A 2NS8A 4Q48A 1ETWA 2QLZA 4A3BJ 3W6KB 2DDAA 2L01A 3DBRB 3CP2A 2Y9ZA 4NC6A 4W1UA 6PAXA 1HKQA 1DQUA 1R1TA 3I58A 3E6BA 3LSMA 1LPQA 3GTJJ 1ZLKA 3CUOA 3JRCA 4ETSA 4HDVA 4HQMA 2ZBKA 2E2JJ 1LUJB 1TNTA 4L9NA 1W0UA 5DUIA 4L0ZB 2EIMH 3HKZA 2UZKA 2V1NA 1O3SA 3SZTA 4RB3C 3CJNA 2BVMA 1PVEA 4KITB 3K2ZA 3OYKA 1R4NB 1L3LA 1BW6A 4HW0A 2EIKH 3H3ZA 2Y30A 4E7LA 4CCLA 5IYBJ 4ESFA 3DTEA 1W1WE 2VQCA 1J59A 3JRIA 4P9FA 3FXUA 2LDUA 4A3LJ 3C2BA 3TP3A 1V5FA 4KMUX 2VLAA 3FK6A 2F5EA 3RZDJ 1K79A 4LOCA 2R5YB 5M5WJ 5DUKA 2M7AA 4IZZA 3DU6A 3E3VA 4C30A 5KHDA 2A69F 1MIJA 2RV8A 3MKYB 5E18F 3SQNA 5AIQA 3HOVJ 2HR3A 3ZPLA 2HDWA 4ZC3A 2DAOA 2LP0A 3CCMI 3FK7A 3WTZA 5GADJ 3BCBA 2BXZA 3GBGA 4XORA 2BHZA 3MZHA 1JUMA 1OYWA 4E7KA 3HOYJ 2VJ4A 2XAUA 3OWTA 4QLCU 1YW9A 2EFWA 3CDHA 3BZCA 4N9HA 4JX5A 1IC8A 2XIGA 4XKWA 1YI2I 4Y33A 5HNFA 2CUEA 3HRSA 1A04A 2TRTA 2W7NA 2VJ5A 1FOWA 4CUGA 1JTXA 4UB6C 4Y15A 3G2BA 5CQEA 2DJNA 2VC0A 2DQLA 2L7KA 3E7LA 5DDGA 3PJRA 2R7UA 4CCKA 3H5RA 3WGIA 2K86A 1S7OA 1LE8A 5KAIC 4ESBA 1P9QC 4OMZA 2OJED 3AG4H 3HHGA 2VOPA 4Y17A 4CHUA 3LNQA 1WJFA 3E0JB 4S05A 4A3FJ 2CSOA 2X1EA 3E5QA 5JVTA 1T6SA 4LB6B 4XLFA 1IXRC 4MTEA 3BZKA 1R23A 2VXDA 3LSTA 5F04A 3HHHA 2EFNA 2LR8A 1SD4A 3QOPA 1Z3XA 3G71I 2CV0A 3JRGA 4NNJA 3GF2A 4GCVA 1B4AA 1XB4A 3J80Z 5GPAA 3BPVA 3WG7H 4CICA 1FX7A 2WV0A 4BDZA 2PG4A 2R93J 5J47A 1P92A 4A3JJ 1G4DA 2VL8A 1OLTA 4KUMA 1JGSA 2HKXA 4BQQA 1E17A 1QU3A 3ECOA 4RM2A 5JLWA 3BG9A 5F27A 1ZKGA 3AKZA 4ENNA 3CCVI 3KP7A 3LMMA 4LG3A 5ICGA 3K70D 3S1QJ 5B66C 1IN5A 3HJEA 2EZLA 2W48A 4N4NB 1R9TJ 2XF5A 4A69C 2IW5A 5LBQA 3DU5A 2R7QA 1ZGAA 4ZYAA 1ZRCA 3FMSA 2JJ7A 2LKSA 1X2MA 3IWFA 3FXLA 4UB8C 5FD6A 1S72I 1R22A 2KDOA 4DNCA 4CCNA 5IP9J 1FY7A 2P0WA 3FXRA 3H3UA 5GAEJ 1XGNA 3ZQ7A 1ZREA 3I3LA 2R92J 3WTWC 2CWEA 3MMYB 4HV6A 4XKBA 3S17J 1D3YA 2VASA 4BE2A 3T8TA 4M3DA 2JK3A 2WAFA 1D0YA 1OCOH 1A6IA 4CZCA 3OYNA 4IHSA 1A6QA 2EINH 1QVTA 3Q0VA 5D5WB 2L9NA 2KIUA 2QBYA 1Z77A 3G6EI 4N0BA 5CQGA 3KCCA 2FE3A 3CUQA 1O3QA 2LVSA 4WF2A 2COMA 3BTCA 2QENA 4YFXF 2A6HF 3H9GA 4F93B 2CW8A 3H3VK 2JPBA 3REOA 1R71A 3R0AA 1YS7A 4TV7A 3N4MA 3KP5A 1I6XA 2VE9A 3DLLF 4B48A 2NAZA 1K78B 4AYBA 2PFBA 4I0AA 1SD5A 2GOXB 5CYVA 2V79A 1R7JA 2I10A 2JUGA 2DA4A 4QWQA 1OISA 1X1AA 2LY1A 2DMNA 3DTIA 5E3LA 4Y52J 2MD0A 2VKHA 4BXXJ 1BOAA 3CJRB 2FA5A 1WI9A 3K1PA 2VIXA 1RR8C 3H35A 3DEWA 4HNUA 1O4XA 2J5OA 2XAGA 4AVPA 5FLVA 2L2OA 3RZOJ 1N25A 3MWMA 5DS9A 1IRGA 4BGDA 4RA2A 2NVTJ 2CQXA 1PYVA 3SFIA 1O7FA 3BC8A 4FE4A 4LG0B 1Z9CA 1BR1A 2FQ4A 3E6CC 1FNNA 2HTJA 3VYSB 1IXSB 1FOXA 1F36A 2DT6A 3C2HA 5E79C 2Z16A 1ETQA 3AG2H 3W2AA 3KPHA 1NG7A 4ZDLA 2OAZA 4U0VA 1DU0A 2V9VA 2ZJQF 1FIPA 5C44J 3DWLE 1S5LC 4U87A 5E3NA 1QVUA 2IXSA 3BTJA 2QSHX 1HSTA 3DF8A 4KA4A 4BAYA 3PIOF 1K7AA 4UXNA 2E7XA 1P4AA 5IY5H 1WGXA 1WH7A 1OJLA 1SFKA 5TISC 4D7MA 2XSJC 2A61A 2VN2A 4I7HA 4PJMA 1R36A 1ZARA 3OOUA 3GZNB 4C3HJ 1X1DA 1I1GA 1KQ9A 3IV5A 1Q1VA 3FM5A 2NRAC 3Q0WA 4RGSA 5D4RA 2COBA 3JSOA 1E3OC 1FC3A 3DTKA 2F5VA 3I5UA 4UVBA 3C1DA 1O57A 5CLSA 2K3PA 3S2WA 3CP8A 2EV0A 5L3EA 3JSPA 2OQRA 1QBJA 3MN2A 3TDUC 1I27A 1Y39A 2ZFWA 1K61A 4XN3A 2ZMEC 2VC1A 3QPHA 2OCCH 2FNAA 1ZRFA 3O8GA 4XM3A 5BMZA 3H36A 3W3CA 3CCYA 2EFPA 3OYJA 2FF4A 1N77A 2DQRA 3OS2A 3LSGA 5JR3A 2OD5A 4XSZF 4DYQA 1HXDA 3F6VA 1TWCJ 2E7WA 4CCMA 1KONA 3L2QA 4KMFA 1BJAA 2DPUA 4KT5C 1O7LA 3I59B 5CVJA 5J40A 2XHKA 2DOFA 1EF4A 4M3GA 2BY0A 2EFOA 3G3ZA 4R1HA 4EM2A 3EDPA 3C18A 3RQIA 5L3CA 1F5TA 2XVCA 4RGRA 2CUZA 2MLGA 3VSLA 5CPRB 5FLXZ 3PIPF 2MSYA 1VQ6I 3ZQIA 2ZJ2A 2O5RA 2LY2A 2R5ZA 3CC7I 4LIVA 1W36C 2LMDA 4HX8A 4PSWA 4R79A 2Y0MA 3PFIA 1H88C 3FBNB 3IL2A 3CDLA 2GLOA 3HOZJ 2OQGA 3MKLA 2OA4A 5LEJA 1DP7P 1ZHFA 5KK1A 1D1BA 1ZR4A 3EUHC 4KYWA 2P5KA 2P5VA 3B6CA 1W0TA 2GWRA 2ECCA 2BHYA 3IAM2 4H4KC 1FZPB 2Z1DA 3K4JA 3HYIA 1YTYA 3ZMVA 1CF7B 2QSGX 2RNGA 4KDPA 2CG4A 2D5VA 2VUMJ 3QAHA 1FSHA 2UXNA 4A6DA 2LFBA 2Y0SN 1MJ9A 2L7FP 4LIUA 2CQNA 2R7SA 1TW2A 1DU6A 2MGQA 3V8LA 2HPMA 4PFPA 4AC0A 2X6WA 2QYOA 5IT9K 1TWAJ 3ABLH 3ZMZA 1VQ9I 4ZJZA 4HRIA 4M6YA 4YIIA 3QPTA 4A3MJ 2EV6A 2MFZA 2G7UA 5BPIA 3G4SI 5ILSA 1N78A 2XKPA 4R8HA 1HF0A 2EZKA 4AIHA 5JHFA 4V2FA 2IPQX 4ESJA 2O8KA 5HS9A 1X4OA 2MABA 4DIQA 2ISYA 1G3SA 4C2MJ 2IRFG 1V5GA 3MKZA 1TQPA 3CJQB 2YX7A 2M2EA 1GXPA 2XROA 3KP2A 1IN6A 3ZQCA 2K40A 4P9UA 4CCJA 2K9QA 1K6YA 2BVLA 4WK8F 1U9OA 2Y2ZA 2CYYA 3FKJA 4B1RA 4E7HA 3BR2A 3I55I 3KP4A 1XC5A 3JW4A 4LITA 3HDDA 3IP4B 1ZELA 4A5MA 1J5YA 1EJ9A 3OS1A 3UKGA 3NRVA 5D6EA 1S3JA 3CF5F 5HLGA 1B59A 2R0QC 1GHCA 1RPWA 4IRHA 3SFZA 4NB5A 1GXQA 1Z6TA 4E7ZA 1USTA 2ZXWH 1NG6A 5FRNA 3LWFA 2DMQA 2BE5F 4XICA 2O61A 5E1WA 3KZYA 5GPCA 2AQFA 1BBYA 3VDXA 5LRSA 1G6NA 4A0XA 2KMUA 3FXOA 2GA2A 3TQNA 4ZZDA 4HNVA 1Z67A 1MBJA 3WU2C 2EZHA 3BPXA 2NVQJ 2EILH 4Q5SF 1A5JA 4NBQA 1HA8A 1TWHJ 3LL7A 2HVQA 1TC3C 3DEUA 4NQWA 4F7ZA 1Z05A 2ZNYA 1YIOA 3BR3A 2M87A 4B47A 2OU2A 4Y7NJ 1ZTRA 5F1JA 1BR2A 1Z21A 4BEHB 3KEQA 1TLHB 2JN6A 1SC7A 3VYRB 3PSIA 3LSPA 2EZIA 4XOTA 1X4PA 3GTGJ 4B3AA 2Y48A 3RQ4A 3D0SA 2ME0A 4MLOA 1P7JA 3VYUB 3P9IA 3E1SA 4ZZLA 3J81K 3GYHX 4ZH4F 3F22A 3PUBA 5EEAA 4ENJA 5ICEA 5ILUA 5DM6F 2ZB9A 5EJCA 3OYLA 3D1NI 2Z33A 1XS9A 2CQQA 2VODA 3MQ0A 1X3ZB 3NEUA 3AL0C 4U88A 2VBYA 4HX4A 3L2CA 3QYEA 1KQ0A 2OCEA 1E3HA 2IGMA 3DBLB 4RDUA 4CYCB 4PJLA 2UWMA 1YFHA 4AM3A 2H09A 1X3UA 1YIJI 2WTEA 2HQRA 3FZVA 5HLTA 2ESNA 4EVIA 1E3PA 1R4MB 2VXZA 3EUAA 1XSDA 3LSRA 5LHGA 1LNWA 3L09A 1KZHA 1G3YA 3HKZN 2E2IJ 3CQZJ 4HG2A 3DPLC 1EV7A 3T1BA 2VBXA 4G7HF 3KLOA 2OV7A 2QUFA 3MZ8A 4J00A 3KEYA 3RKWA 5FJ8J 2H27A 1EA3A 2LY9A 4BY7J 2L9VA 2CUFA 4CXFA 1Z3YA 4JYKA 4MIMA 2K9SA 2P5LC 5CVRA 3PNVA 3R4KA 3WU0A 4BKXA 1B72A 3PO3J 2O6GE 2O3FA 1W7PA 2KZGA 3N97A 2BW3A 3ECHA 2K02A 1IUYA 5K7ZA 2KRHA 2Z3YA 4IHVA 2YSRA 5FKKA 1IRFA 2IA2A 4BEHA 1R5GA 2A5WA 1XCBA 2DFHA 3LFUA 3R0JA 3KZIC 4AIDA 1MBEA 4FX4A 1BL0A 4XMYA 1WCMJ 3ZMDA 2DA7A 2LD5A 1BIAA 3ZGKA 1IF1A 1VQPI 2KL4A 3BR6A 2PLYA 1TL8A 1TTYA 3W2WA 3LAJA 2GIVA 4HLYA 1Q1HA 1W4MA 3C3WA 1VQLI 2NS7A 2Y75A 2LKPA 1XSXA 2NVYJ 2O0YA 1U5TC 3U2RA 4FE7A 3QRFF 3A0HC 1ETOA 4KJZA 2HZDA 4CYCA 2GXBA 1IAWA 2A6EF 4M74A 3ZMUA 3DP7A 4HBLA 2FBKA 1NK2P 2WBMA 4PSXA 3D5RC 1RUOA 1YYVA 4IVNA 2WB1N 2WV1A 4JQFA 3IH3A 5CVIA 4A3GJ 3GTOJ 4X6AJ 5IOYA 2E1MC 4EQQA 3FXQA 1P7IA 1QHGA 2D2WA 2JTVA 2KZVA 5FKNA 4HNTA 3VB2A 3L7WA 4MTDA 3P9KA 1AWCA 2LG4A 4FISA 3ZCOA 2B63J 1KGSA 1YS6A 3U21A 3V8JA 3CLOA 2HTSA 4OAZA 2L54A 4WXHA 3ELKA 1WJ5A 4X0GA 2WA0A 1WWXA 2KKOA 1M1EB 3TKYA 4JP0A 1LE8B 5BNGA 2NOJB 2P7CB 4AIKA 3FBIB 1AHDP 3F21A 4HSRA 4II3A 4I99C 2GA1A 2P4WA 1B9MA 1WJEA 2P81A 1MMSA 5KNLA 1LFPA 2B0LA 3TBIA 1IW7F 3PNTA 2R7OA 3V7RA 3ABTA 2X0LA 2KP6A 2ACJA 5AIPA 3B73A 2DPDA 5K7HA 5E17F 1SMTA 2M4GA 1OR7C 5F0HA 5F64A 3IRQA 2DJIA 2H6CA 2XB0X 4XNFA 4P5OA 2M0MA 2VJIA 2R7VA 3E6MA 3SHFA 1JKPC 4L5IA 9ANTA 3NWTA 4UV9A 4RLFA 2FX0A 2R7TA 2IS6A 3TOAA 1QQIA 4PUSA 5F6FA 4MHGA 2WWYA 1EKEA 3RYPA 3NAUA 2D1HA 4C9YA 4IOAF 4UHTA 2QA4I 2MW8A 1LFBA 2E71A 1STZA 2QVOA 3DKXA 2LF8A 5CJ9A 2XPWA 1O3RA 1WZ2A 2FU4A 1WJDA 2PBIA 5FFXA 3S3NA 4C3IJ 4Y4RA 5FKOA 4FX0A 4XOPA 5LGUA 2L4AA 2IBDA 1U8RA 2XKOA 2AQEA 2ICWG 3HTSB 2Q8KA 2DT7B 4XLNF 4MFEA 1TT0A 1BOBA 1Y8RB 4E4HA 5HDGA 3E5XA 2NVXJ 2VONA 2JZYA 4AYBN 5F1RA 3BWGA 4M71A 2I5UA 4E7IA 1X1BA 2QQ9A 3ML6A 4OIOF 2WB1A 1IN7A 1PJRA 3PL8A 1JE8A 2QGUA 5JI6A 1P6RA 4XBFA 3GFIA 2QBYB 1RI7A 2X6YA 3M1CA 1X2NA 1MBHA 5B1BH 4BU2A 1SVMA 2N8GA 5J1YA 2ZMEA 1LJ9A 3CUQB 1HW5A 4RS8A 1LVAA 2UV1A 1Y56A 4GYGA 1UCRA 1Y0NA 5JHUA 5EG0B 3I56I 1JGGA 3FMRA 3BG3A 2A6TA 3S2DJ 3FMQA 2CU7A 3CDIA 4BBRJ 1XMXA 4RM3A 3A2KA 3L2UA 3F23A 1TQMA 2F4IA 5IT9Z 4DOZA 4L9TA 3BR1A 1TBXA 2KIMA 4NC8A 2QZ8A 3OYIA 1XMKA 1RKWA 3E6DA 1JT0A 3DKWA 3OSFA 4LLGF 1ETYA 4XR6A 1OYIA 4RGXA 1IZ1A 1I50J 2ELJA 5J4YA 2FBIA 2HDCA 5TGTA 2TCTA 4V2GA 1VNDA 2ZKZA 4PDKA 3ZR8X 3KYLA 2XAFA 2FNPA 2KISA 2E2HJ 1HCRA 1Z6RA 2X6XA 3ABUA 4GDFA 3H5NA 1X1CA 2CFXA 1SEUA 3I4PA 3OYBA 2KJCA 5ED4A 3S1MJ 1T98A 2M8GX 4L0YB 3S15J 2DOAA 2PEXA 4QPOA 3D5LA 3HOUJ 2DA1A 4E70A 3EUHA 1IJWC 1G59A 1IO2A 1ULYA 3HRMA 3K4LA 4XKVA 1YITI 1K4SA 2ELHA 2VOOA 3IKVA 1V5EA 2CH0A 2M3AA 1S29A 1S8NA 4HYEA 4QPQA 3MAJA 2E5ZA 2CV2A 1BN5A 4PZJA 1VTNC 1O3TA 3CCQI 1SVLA 1TQIA 4RAZA 3F0CA 3RSNA 5BOXA 2RKHA 4XLAA 4RAFA 4XKCA 2BXYA 2VT2A 3IH2A 3PM1A 4FHTA 1RR7A 1IRXA 5HDKA 4RMNA 2R7RA 1LFUP 4L18B 1WQ2A 4U7BA 4JBAA 4N4OB 1T0FC 1MH4A 3F8FA 5EG0A 4HPQA 2IAIA 3KLNA 3HG9A 1FIAA 5ILVA 1T38A 3LA7A 3UNGC 3W6VA 4G12A 1JUSA 3K4BA 1CQTA 5FKLA 4G9YA 3EYIA 3ASNH 2WC2A 5E20A 2IP2A 3ZOBA 1GV5A 4DYCA 5HNHA 2QEXI 3DV8A 2LBFA 1VZ0A 1PP8F 1MMDA 4YFKF 3OR2C 4XK4A 2L7ZA 3J7YJ 2DK8A 3ZP5A 2X51A 1XDSA 2R7FA 1UAAA 1QZYA 5M3FJ 4W97A 4WXDA 5HS7A 3M3YJ 3OYGA 2STTA 2PMZN 2R3SA 3GZ6A 4E6KG 4IKFA 1IDYA 2XPVA 1D1AA 4O6JA 1U3EM 2OUMA 5DCFA 5B5EC 3C7JA 1GVJA 2X1DA 1BIBA 5GP9A 2HXOA 5LGTA 2XGXA 4DBRA 2EK5A 3J81Z 1R58A 3EQLF 2LOOA 4P1WA 2LKXA 4D1QA 4HQEA 1J2XA 3VSKA 2HKOA 2WAQN 2X1CA 3J7AY 2ZFUA 4HF0A 1IV8A 4J19A 3HB9A 1VQ8I 1XGSA 3S14J 2A3SA 1G3TA 1VF9A 2DI3A 4NC7A 3A01A 2F5DA 3GTQJ 3ZQGA 3BDDA 2HOEA 1UHMA 4M3FA 3FIWA 5EEGA 2F6CA 2XUBA 4MFDA 4BACA 4ENMA 2PJRB 2MYSA 4BY1J 2VKEA 4BUPA 4HF1A 2IA1A 4I01A 3FX3A 2IJLA 4F91B 3GTMJ 2D1VA 2R5ZB 2CW0F 2JUCA 2EV5A 5HLHA 4L9VA 2CJJA 2O8XA 1T33A 2ZSIB 2K9LA 2UUZA 1V54H 1FYMA 1AKHA 3SYTA 3CMAI 1MW7A 4S0HB 2L9RA 3OYHA 1H89C 2QCOA 2JSPA 2FD5A 1SFOJ 2A07F 4UNOA 2GAUA 1ETXA 4KICA 3F8BA 3VFZA 3K7AJ 3CC2I 5E1XA 4AU7A 5LRRA 4MQVA 5H6QA 4RBOA 1GLNA 5KAFC 3MFKA 2DTZA 5M5YJ 2NNNA 3OR1C 4RB0A 3SEZA 3QP5A 5LLQA 4G6QA 3HUGB 2DTRA 2KFDA 4Z2YA 1FJLA 2MC3A 4I76A 3CMMA 3GFMA 1IV6A 4H0EA 1GDTA 3OIPA 1JKQC 1REPC 2ID3A 2QKLB 1S7EA 2DA2A 3T5XA 3HOXJ 1DPUA 1YO5C 5M3MJ 1OPCA 1DGWY 5BPDA 4G8XA 5H2FC 3KE2A 4CCOA 4AUXA 5GAGJ 2E19A 3N05A 4XIDA 3OYAA 3QYFA 4DW6A 1ZH5A 2BGCA 2E1CA 2XPUA 2ZO4A 3QU6A 2ISZA 4IO9F 2ECBA 3EUKL 3X2QH 2DBBA 2PJRA 2JVGA 2FXAA 3IAS2 2BV6A 2K3FA 2PMZA 2OF7A 1YRNA 4YEJA 2HYJA 1OCZH 4DBQA 3FHNA 5ICCA 3CCUI 2P6SA 2DFEA 3KIOA 2CRGA 3PFYA 2G9WA 1YX3A 2GQQA 5LD2C 4KIFA 2DODA 4BJ5C 1Z0XA 1HSJA 3KP3A 4U0YA 2LH9A 2WAQA 3ERED 3RKQA 1MBGA 1SAUA 2RC4A 3HSFA 1WSUA 2JA8J 1ZAOA 2VPLA 3R61A 4BQOA 3FXMA 2L4MA 1TP4A 2VB6A 2XAHA 3DXJF 1SANA 3GTLJ 3K4CA 2X85A 5J8FA 2XRLA 1IDZA 3ABKH 1X3WB 2DA3A 5H6RA 5C4XJ 3HUGA 3Q9SA 1HDPA 4M9SA 2AO9A 3K9TA 4KN7X 3K10A 1NTCA 1D0XA 3BR0A 3S32A 1MNMC 3ZMSA 3VODA 4OAYA 3RPQA 3AFHA 2LF7A 4NQWB 4AWXB 2WAEA 3WTSC 1EH7A 3BROA 3LOCA 2ELKA 4M6VA 1E0EA 1IXCA 4KNYA 5C3EJ 2F48A 4A5NA 1U5TA 2V6CA 1RC9A 3GUDA 4DJAA 1FP1D 1OCPA 3BP8A 2K27A
chains in the Genus database with same CATH topology
3K0LA 1ZYRF 2O03A 1ODDA 2K7LA 2VBZA 3RKYA 4ZYDA 2HYGD 4LMYA 2Q2EA 3JTHA 4XLPF 4HAMA 2EA4A 4EMSA 4I09A 1SD7A 1ON1A 4IXAA 4EJUA 1SAXA 3KP6A 3M7GA 4LGWA 4GYIA 1T39A 4M73A 2Z9OA 5DYMA 2DW4A 4RB2C 2MA3A 1HKTA 3GXOA 4MNUA 1S6LA 3JAMK 1QNTA 1BI3A 1OR7A 1UHWA 1FBQA 4LJZF 2XRNA 4HV5A 1W7PB 1FP2A 2NYXA 4M6XA 1LEBA 1KU3A 3Q9VA 2GZWA 2GXGA 5E8GA 4B09A 4BH9A 3IC7A 4EGYA 1BI2A 4LD5A 1KYWA 1W7PD 4LK1F 5FO5A 1MDMA 4GGGA 5L3DA 2RN7A 1XGMA 5L3GA 5HOOA 3L9FA 4S04A 5LGNA 4L5JA 2K4BA 1F1ZA 2M45A 1Z91A 5JFRA 2STWA 3RKXA 4OIPF 4BHBA 4G7OF 4IF4A 1Z1DA 1OKRA 1FBSA 4IPAA 1ZN2A 2W57A 3F6OA 1DUXC 4A2UA 2EWNA 4BHPA 1MGTA 3RYRA 1XDUA 3NQOA 3U1DA 1Y0UA 5D8LB 3LQRA 5D5XB 1DDNA 4MEYF 4BXUA 4UVAA 4UVCA 3JTGA 2L02A 5H20A 1MKMA 2V1DA 3R60A 4P96A 2ETHA 1RZ4A 4HF2A 3O2PE 2P7VB 5DD8A 1H9GA 4RAYA 2PMHA 3BJ6A 1YG2A 2TDXA 2MD5A 1IN8A 1XGOA 2M5WA 3P9CA 4ENKA 1BC8C 4HDUA 5K5OA 4U0WA 3FF5A 2ZCWA 3T0YA 1P2FA 1YQAA 1LDKB 1H0MA 3MEXA 3RTRA 5K1YA 3O3KA 4M9ZA 1D8JA 5LHHA 3FWEA 2DU9A 3I64A 3M8FA 2H6BA 1HBXG 2RQPA 4O5VA 2XV4S 5D8KB 4MEXF 1L0OC 2A68F 3PQJA 3WG9A 2Z99A 1T0FA 5L3FA 2PQ8A 4JK1X 1CGPA 5A2QK 1LB2A 3SZPA 4WX9A 2EFQA 1B1BA 4HZFA 5BS6A 2RNJA 5TRDA 3WGHA 2OZ6A 2FMLA 3HTUA 1HQCA 3EETA 3ZN1A 2ZMEB 3CO7C 4IRIA 5L3BA 2VBWA 2YR2A 2F5CA 1RIOH 1MJAA 3QU3A 3GLXA 1UFMA 2HFHA 2MLKA 3HIFA 3WTTC 5D5VB 5FFZA 4KIBA 2MBFA 3K1NA 5DEQA 2RGVA 3WTVC 5E8IA 2KRFA 4IRGA 3RIRA 3K1MA 4D0PA 1JHFA 3RPUA 2NS0A 3VOEA 3RDIA 1K6OA 2PI0A 4OIRF 3T8RA 3F8MA 1FSEA 2FEZA 4OU0A 1P4XA 5BQTA 2YPRA 4XRFA 3CTAA 4DQ2A 5ICFA 3TO9A 3BY6A 2OBPA 2FMYA 4EJWA 2K4JA 2HZTA 4HX7A 4UUVA 3ISPA 2V1XA 1PDNC 4N9IA 3U9GA 4LK0F 5ERIA 3LAPA 2P6TA 2AXLA 3GEZA 3HSEA 1ZGJA 4PGGA 1G3WA 3TGNA 4LFUA 1AOYA 3WTUC 3TO6A 2W24A 4WWCA 2RDPA 1KU2A 3ROUA 1XCVA 1D5VA 2PMUA 2CO5A 1S7AA 3QP6A 5FD5A 1KU9A 1NHAA 4GXOA 1W5TA 4KIGA 3F72A 5D5UB 3WU1B 4CGZA 2XAQA 3COAC 3BJOA 2Z5UA 3LQQA 5DCMB 1SFUA 1WKMA 4HLXA 2W84A 1R5HA 3M9AA 1ON2A 1FPQA 3I71A 4YIFA 3B02A 3JAMZ 5AONA 5EEHA 1H9TA 3ULQB 1KQ8A 2DLLA 1MJBA 4UV8A 1J7KA 2FQ3A 4BQAA 2DT5A 1UB9A 1F4KA 1FOKA 1KA8A 1OMIA 4CO8A 4PCQA 1I1SA 2P8TA 2JSCA 3LA2A 3ZMTA 2D45A 4RGUA 2FOKA 1XD7A 2DO7A 3BOQA 2NNYA 1J75A 4AD9A 1SD6A 3WTXC 1J0RA 2HWVA 2FBHA 4M72A 3KZZA 1QZZA 3FHZA 4Y13A 3WODF 5TJJA 4O3MA 5DCMA 2CGPA 1JXSA 2M8EA 1FBUA 1YW7A 2FSWA 4Q47A 3O6BB 5HLIA 3HRUA 5LEKA 5CVVA 5K5RA 1FYLA 3TOBA 4K2EA 1U6GA 5D6FA 1SFXA 2IA0A 1R1UA 3H92A 5CVUA 3WE3A 1USSA 3G73A 2KIFA 1IN4A 4G6DA 4GO1A 4I0BA 1ZG1A 2Q0OA 4U7DA 1XMAA 1K78A 2ADUA 1E2XA 3GO5A 2HEOA 1U5TB 3PQKA 4I2OA 3CO6C 3RJPA 4EJVA 1QO0D 1F9NA 1QPMA 3F8CA 4ZYGA 4P55A 4YFNF 4A0ZA 3KETA 4CDGA 4LG0A 1LDJA 3R6SA 1LQ1A 4IJAA 5HDNA 4OOIA 4BNCA 1PUEE 4WXCA 3F3XA 2L3DA 4MQ9F 4LB5A 2HS5A 3GFLA 1MD0A 1Z7UA 1XSVA 1MZBA 1XN7A 2QQBA 1RUNA 4EJOA 3BZ6A 3IHUA 1I5ZA 4OMYA 4EJTA 3GFJA 5A2QZ 2OZUA 2IT0A 2BBYA 1FT9A 2HYFA 5E1ZB 1BC7C 1YW8A 4HA8A 4BYYA 1J9IA 3OOPA 3WTYC 4WCGA 4B8XA 3V7SA 1KYZA 3KFWX 3V4GA 1SMYF 5J6XA 3J80K 1P4WA 2IVMA 2LNBA 3CUQC 3AAFA 3ZN0A 4EGZA 4ASNA 1MDMB 3OV8A 1TNSA 1SFEA 2E1NA 2QWWA 1KU7A 1PP7U 5KVRA 2MH9A 3TDZC 4I02A 4XSXF 3E97A 4KFCA 5FGMA 3I59A 1U78A 3TO7A 4FT8A 2YX4A 3I54A 4ZYHA 1LEAA 5D4SA 1BI0A 2BEOA 4HOBA 4I98B 4EM0B 2JPCA 1LDDA 1ZLJA 3HRTA 2VT3A 3J7AO 2R7DA 2H94A 1EH8A 3VEPA 5FB2A 4LLNA 1R1VA 2J5PA 3GWZA 4A6EA 1CF7A 1D8KA 5DD4A 2F5FA 1V3FA 2MH2A 2FRHA 1QGPA 2A5YB 4CYDA 4Q4ZF 2PN6A 2EB7A 4CZZA 2ESHA 5IT3A 4G7ZF 1EH6A 3MCZA 5HS8A 3DQVC 3P7NA 2W25A 2XAJA 1ZG5A 3HSRA 2HQNA 1OYYA 3LA3A 2CQKA 1ZRDA 4IHTA 1BM9A 1JHHA 3HOSA 5DV5A 2HGCA 3M1EA 3KEOA 1ONVA 3GZ5A 1FWZA 1HKSA 3IWZA 3V8KA 2YU3A 4EV0A 2DFIA 1WRJA 3IKTA 2ZXJA 4BHCA 4YG2F 1FLIA 3HOTA 3MZYA 1C0WA 4PGHA 2QM3A 3BJAA 3DPTA 2QQAA 1ZG3A 3EYYA 3GVAA 2ZNZA 5J8CA 2X4HA 3FM3A 1TW3A 4L9JA 2DK5A 2M1BA 2F2EA 2EA2A 3GX4X 2G7HA 1B6AA 1DPRA 1HW1A 1R00A 1U2WA 4RB1A 3M8EA 4A12A 3WE2A 3L00A 1HW2A 2VE8A 3WGGA 2RVCA 2UXXA 4MGRA 4OINF 3Q5FA 3W6JB 3I0TA 3LFKA 2BYVE 5HVQC 3K69A 1BI1A 4AIJA 4NHJA 1YLFA 2PJPA 3I53A 2EJRA 4LLLA 3E5UA 3V7CA 5K5QA 2LSOA 1B9NA 2C6YA 4M9XA 3SXYA 5LHIA 2JRTA 2M30A 4EM1A 2AS5F 3F8NA 5FLXK 3DFGA 1W5SA 4G94A 2XASA 3GW2A 3IRRA 1V4RA 2W85A 4OIQF 3RI4A 1T2KA 2V1UA 4A0YA 1FYKA 1RNLA 4ON0A 4ZYEA 2JT1A 2KJBA 4KN4X 4Q48A 2QLZA 3W6KB 2L01A 6PAXA 1HKQA 1R1TA 3I58A 3E6BA 1ZLKA 3CUOA 4ETSA 4HDVA 4HQMA 2ZBKA 1TNTA 4L9NA 5DUIA 4L0ZB 2UZKA 1O3SA 3SZTA 4RB3C 3CJNA 3K2ZA 1L3LA 4HW0A 3H3ZA 4ESFA 1J59A 4P9FA 3FXUA 2LDUA 4KMUX 2F5EA 1K79A 5DUKA 3E3VA 2A69F 2RV8A 5E18F 3SQNA 5AIQA 2HR3A 3ZPLA 2DAOA 3MZHA 3WTZA 1OYWA 2EFWA 4QLCU 1YW9A 3CDHA 4N9HA 2XIGA 3HRSA 1A04A 4Y15A 2VC0A 2DQLA 5DDGA 3WGIA 2K86A 1S7OA 4ESBA 4OMZA 3HHGA 2VOPA 4Y17A 4CHUA 4S05A 2CSOA 3E5QA 5JVTA 1T6SA 4LB6B 1IXRC 4MTEA 1R23A 3LSTA 3HHHA 2EFNA 1SD4A 3QOPA 3GF2A 4GCVA 1B4AA 1XB4A 3J80Z 3BPVA 4CICA 1FX7A 2WV0A 2PG4A 1P92A 1G4DA 4KUMA 1JGSA 2HKXA 1E17A 3ECOA 4ENNA 3KP7A 5ICGA 1IN5A 2IW5A 5LBQA 1ZGAA 1ZRCA 3FMSA 3IWFA 5FD6A 1R22A 4DNCA 1FY7A 3FXRA 3H3UA 1XGNA 3ZQ7A 1ZREA 3WTWC 2CWEA 4HV6A 1D3YA 3T8TA 4IHSA 5D5WB 2KIUA 2QBYA 4N0BA 3KCCA 2FE3A 3CUQA 1O3QA 4WF2A 2COMA 2QENA 4YFXF 2A6HF 2JPBA 3REOA 3R0AA 1YS7A 4TV7A 3N4MA 3KP5A 1I6XA 2VE9A 1K78B 2NAZA 2PFBA 4I0AA 1SD5A 5CYVA 2V79A 1R7JA 4QWQA 1BOAA 2FA5A 1WI9A 3K1PA 2J5OA 2XAGA 4AVPA 3MWMA 1IRGA 1O7FA 4LG0B 1Z9CA 3E6CC 1FNNA 2HTJA 1IXSB 2OAZA 4U0VA 2V9VA 1HSTA 3DF8A 4KA4A 4BAYA 1K7AA 4UXNA 2E7XA 1P4AA 2A61A 2VN2A 4I7HA 1R36A 1ZARA 1I1GA 1KQ9A 3FM5A 2NRAC 4RGSA 5D4RA 3JSOA 1FC3A 3I5UA 4UVBA 3C1DA 1O57A 5CLSA 3S2WA 2EV0A 5L3EA 3JSPA 2OQRA 1QBJA 3TDUC 1I27A 2ZFWA 2VC1A 3QPHA 2FNAA 1ZRFA 5BMZA 2EFPA 2FF4A 2DQRA 5JR3A 2OD5A 4XSZF 1HXDA 3F6VA 2E7WA 4KMFA 1BJAA 2DPUA 4KT5C 1O7LA 3I59B 5CVJA 2XHKA 2EFOA 3G3ZA 4R1HA 4EM2A 3EDPA 3C18A 1F5TA 5L3CA 2XVCA 4RGRA 2MLGA 5FLXZ 2ZJ2A 4HX8A 4R79A 2Y0MA 3PFIA 3IL2A 2OQGA 2OA4A 5LEJA 1DP7P 1ZHFA 5KK1A 4KYWA 2P5KA 2P5VA 2GWRA 1FZPB 1YTYA 3HYIA 3ZMVA 1CF7B 4KDPA 2CG4A 3QAHA 1FSHA 2UXNA 4A6DA 1MJ9A 1TW2A 3V8LA 2QYOA 5IT9K 3ZMZA 4M6YA 4YIIA 3QPTA 2EV6A 2G7UA 5BPIA 5ILSA 2XKPA 4R8HA 4AIHA 2IPQX 4ESJA 5HS9A 2ISYA 1G3SA 2IRFG 1TQPA 2YX7A 1GXPA 2XROA 3KP2A 1IN6A 4P9UA 4WK8F 2CYYA 3KP4A 3JW4A 4A5MA 1J5YA 3NRVA 5D6EA 1S3JA 5HLGA 1B59A 1GHCA 4IRHA 3SFZA 4NB5A 1GXQA 1Z6TA 1USTA 3LWFA 2BE5F 2O61A 5E1WA 3KZYA 1BBYA 5LRSA 1G6NA 4A0XA 2GA2A 3TQNA 4ZZDA 3BPXA 4Q5SF 3DEUA 4NQWA 4F7ZA 1Z05A 2ZNYA 1YIOA 2M87A 2OU2A 3KEQA 1TLHB 2Y48A 3D0SA 3P9IA 3J81K 4ZZLA 3GYHX 3F22A 4ZH4F 4ENJA 5ICEA 5ILUA 2Z33A 2VODA 3MQ0A 3NEUA 4U88A 2VBYA 4HX4A 3L2CA 1KQ0A 2UWMA 1YFHA 2H09A 1X3UA 2WTEA 2HQRA 3FZVA 2ESNA 4EVIA 2VXZA 1XSDA 5LHGA 1LNWA 3L09A 1G3YA 3DPLC 1EV7A 3T1BA 2VBXA 4G7HF 3KLOA 2QUFA 3RKWA 2H27A 4CXFA 2P5LC 5CVRA 3R4KA 3WU0A 2O6GE 2O3FA 1W7PA 3N97A 3ECHA 2K02A 1IUYA 2Z3YA 2YSRA 1IRFA 2IA2A 1R5GA 1XCBA 3R0JA 4FX4A 3ZMDA 1BIAA 1IF1A 2PLYA 1TTYA 3LAJA 2GIVA 4HLYA 1Q1HA 1W4MA 3C3WA 2Y75A 2LKPA 1XSXA 2O0YA 1U5TC 3U2RA 3QRFF 2GXBA 1IAWA 2A6EF 4M74A 3ZMUA 3DP7A 4HBLA 2FBKA 1RUOA 1YYVA 4IVNA 4JQFA 5CVIA 4EQQA 3FXQA 2D2WA 2JTVA 3VB2A 3L7WA 4MTDA 3P9KA 1AWCA 1KGSA 1YS6A 3V8JA 3CLOA 2HTSA 2L54A 4WXHA 3ELKA 2KKOA 1WWXA 3TKYA 2P7CB 4AIKA 3F21A 2GA1A 2P4WA 1B9MA 2B0LA 1IW7F 3V7RA 3ABTA 2X0LA 2ACJA 5AIPA 3B73A 2DPDA 5E17F 1SMTA 5F64A 3IRQA 2H6CA 4P5OA 3E6MA 3SHFA 4L5IA 4UV9A 3TOAA 1QQIA 5F6FA 4MHGA 2WWYA 3RYPA 2D1HA 4UHTA 1O3RA 1STZA 2QVOA 2LF8A 5CJ9A 2FU4A 2PBIA 5FFXA 4FX0A 5LGUA 2L4AA 1U8RA 2XKOA 3HTSB 2Q8KA 4XLNF 5HDGA 3E5XA 2VONA 2JZYA 5F1RA 3BWGA 4M71A 2QQ9A 3ML6A 4OIOF 1JE8A 1IN7A 5JI6A 1P6RA 4XBFA 3GFIA 2QBYB 1RI7A 2ZMEA 1LJ9A 3CUQB 1HW5A 4RS8A 1LVAA 4GYGA 1UCRA 5JHUA 3FMRA 3FMQA 3F23A 1TQMA 5IT9Z 4L9TA 1TBXA 2KIMA 2QZ8A 1XMKA 3E6DA 3DKWA 4LLGF 1OYIA 4RGXA 1IZ1A 2FBIA 2HDCA 2ZKZA 4PDKA 2XAFA 2FNPA 1Z6RA 3ABUA 2CFXA 3I4PA 2KJCA 5ED4A 1T98A 4L0YB 2PEXA 3D5LA 4E70A 3EUHA 1ULYA 3HRMA 2ELHA 2VOOA 3IKVA 1S29A 1S8NA 4HYEA 3MAJA 1BN5A 4PZJA 1VTNC 1O3TA 1TQIA 4RAZA 5BOXA 2RKHA 2VT2A 4FHTA 5HDKA 4L18B 1WQ2A 4U7BA 4JBAA 3F8FA 3KLNA 1T38A 5ILVA 3LA7A 4G9YA 3EYIA 2WC2A 5E20A 2IP2A 3DV8A 1PP8F 4YFKF 2DK8A 3ZP5A 1XDSA 2R7FA 1QZYA 4WXDA 5HS7A 2STTA 2R3SA 3GZ6A 4O6JA 1U3EM 5DCFA 3C7JA 1GVJA 1BIBA 5LGTA 2XGXA 2EK5A 3J81Z 1R58A 3EQLF 4HQEA 1J2XA 2HKOA 4HF0A 1XGSA 2A3SA 1G3TA 2DI3A 2F5DA 3BDDA 2HOEA 1UHMA 5EEGA 2XUBA 4ENMA 4HF1A 2IA1A 4I01A 3FX3A 2IJLA 2D1VA 2CW0F 2EV5A 5HLHA 4L9VA 2O8XA 1FYMA 2A07F 4UNOA 2GAUA 4KICA 3F8BA 3VFZA 5E1XA 5LRRA 4MQVA 5H6QA 3MFKA 2NNNA 4RB0A 5LLQA 3QP5A 4G6QA 2DTRA 4Z2YA 2MC3A 3GFMA 4H0EA 1REPC 3T5XA 1DPUA 1YO5C 1OPCA 5BPDA 4G8XA 3KE2A 1ZH5A 2BGCA 2E1CA 2ZO4A 3QU6A 2ISZA 2DBBA 2FXAA 2BV6A 5ICCA 2P6SA 2G9WA 2GQQA 4KIFA 1HSJA 3KP3A 4U0YA 3ERED 2RC4A 3HSFA 1WSUA 1ZAOA 3R61A 2L4MA 2XAHA 3DXJF 5J8FA 5H6RA 3HUGA 3Q9SA 4M9SA 3K9TA 4KN7X 3ZMSA 3VODA 3RPQA 2LF7A 4AWXB 3WTSC 1EH7A 3BROA 1IXCA 4KNYA 4A5NA 1U5TA 2V6CA 3GUDA 1FP1D 3BP8A 2K27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0L A;  1ZYR F;  2O03 A;  1ODD A;  2K7L A;  2VBZ A;  3RKY A;  4ZYD A;  2HYG D;  4LMY A;  2Q2E A;  3JTH A;  4XLP F;  4HAM A;  2EA4 A;  4EMS A;  4I09 A;  1SD7 A;  1ON1 A;  4IXA A;  4EJU A;  1SAX A;  3KP6 A;  3M7G A;  4LGW A;  4GYI A;  1T39 A;  4M73 A;  2Z9O A;  5DYM A;  2DW4 A;  4RB2 C;  2MA3 A;  1HKT A;  3GXO A;  4MNU A;  1S6L A;  3JAM K;  1QNT A;  1BI3 A;  1OR7 A;  1UHW A;  1FBQ A;  4LJZ F;  2XRN A;  4HV5 A;  1W7P B;  1FP2 A;  2NYX A;  4M6X A;  1LEB A;  1KU3 A;  3Q9V A;  2GZW A;  2GXG A;  5E8G A;  4B09 A;  4BH9 A;  3IC7 A;  4EGY A;  1BI2 A;  4LD5 A;  1KYW A;  1W7P D;  4LK1 F;  5FO5 A;  1MDM A;  4GGG A;  5L3D A;  2RN7 A;  1XGM A;  5L3G A;  5HOO A;  3L9F A;  4S04 A;  5LGN A;  4L5J A;  2K4B A;  1F1Z A;  2M45 A;  1Z91 A;  5JFR A;  2STW A;  3RKX A;  4OIP F;  4BHB A;  4G7O F;  4IF4 A;  1Z1D A;  1OKR A;  1FBS A;  4IPA A;  1ZN2 A;  2W57 A;  3F6O A;  1DUX C;  4A2U A;  2EWN A;  4BHP A;  1MGT A;  3RYR A;  1XDU A;  3NQO A;  3U1D A;  1Y0U A;  5D8L B;  3LQR A;  5D5X B;  1DDN A;  4MEY F;  4BXU A;  4UVA A;  4UVC A;  3JTG A;  2L02 A;  5H20 A;  1MKM A;  2V1D A;  3R60 A;  4P96 A;  2ETH A;  1RZ4 A;  4HF2 A;  3O2P E;  2P7V B;  5DD8 A;  1H9G A;  4RAY A;  2PMH A;  3BJ6 A;  1YG2 A;  2TDX A;  2MD5 A;  1IN8 A;  1XGO A;  2M5W A;  3P9C A;  4ENK A;  1BC8 C;  4HDU A;  5K5O A;  4U0W A;  3FF5 A;  2ZCW A;  3T0Y A;  1P2F A;  1YQA A;  1LDK B;  1H0M A;  3MEX A;  3RTR A;  5K1Y A;  3O3K A;  4M9Z A;  1D8J A;  5LHH A;  3FWE A;  2DU9 A;  3I64 A;  3M8F A;  2H6B A;  1HBX G;  2RQP A;  4O5V A;  2XV4 S;  5D8K B;  4MEX F;  1L0O C;  2A68 F;  3PQJ A;  3WG9 A;  2Z99 A;  1T0F A;  5L3F A;  2PQ8 A;  4JK1 X;  1CGP A;  5A2Q K;  1LB2 A;  3SZP A;  4WX9 A;  2EFQ A;  1B1B A;  4HZF A;  5BS6 A;  2RNJ A;  5TRD A;  3WGH A;  2OZ6 A;  2FML A;  3HTU A;  1HQC A;  3EET A;  3ZN1 A;  2ZME B;  3CO7 C;  4IRI A;  5L3B A;  2VBW A;  2YR2 A;  2F5C A;  1RIO H;  1MJA A;  3QU3 A;  3GLX A;  1UFM A;  2HFH A;  2MLK A;  3HIF A;  3WTT C;  5D5V B;  5FFZ A;  4KIB A;  2MBF A;  3K1N A;  5DEQ A;  2RGV A;  3WTV C;  5E8I A;  2KRF A;  4IRG A;  3RIR A;  3K1M A;  4D0P A;  1JHF A;  3RPU A;  2NS0 A;  3VOE A;  3RDI A;  1K6O A;  2PI0 A;  4OIR F;  3T8R A;  3F8M A;  1FSE A;  2FEZ A;  4OU0 A;  1P4X A;  5BQT A;  2YPR A;  4XRF A;  3CTA A;  4DQ2 A;  5ICF A;  3TO9 A;  3BY6 A;  2OBP A;  2FMY A;  4EJW A;  2K4J A;  2HZT A;  4HX7 A;  4UUV A;  3ISP A;  2V1X A;  1PDN C;  4N9I A;  3U9G A;  4LK0 F;  5ERI A;  3LAP A;  2P6T A;  2AXL A;  3GEZ A;  3HSE A;  1ZGJ A;  4PGG A;  1G3W A;  3TGN A;  4LFU A;  1AOY A;  3WTU C;  3TO6 A;  2W24 A;  4WWC A;  2RDP A;  1KU2 A;  3ROU A;  1XCV A;  1D5V A;  2PMU A;  2CO5 A;  1S7A A;  3QP6 A;  5FD5 A;  1KU9 A;  1NHA A;  4GXO A;  1W5T A;  4KIG A;  3F72 A;  5D5U B;  3WU1 B;  4CGZ A;  2XAQ A;  3COA C;  3BJO A;  2Z5U A;  3LQQ A;  5DCM B;  1SFU A;  1WKM A;  4HLX A;  2W84 A;  1R5H A;  3M9A A;  1ON2 A;  1FPQ A;  3I71 A;  4YIF A;  3B02 A;  3JAM Z;  5AON A;  5EEH A;  1H9T A;  3ULQ B;  1KQ8 A;  2DLL A;  1MJB A;  4UV8 A;  1J7K A;  2FQ3 A;  4BQA A;  2DT5 A;  1UB9 A;  1F4K A;  1FOK A;  1KA8 A;  1OMI A;  4CO8 A;  4PCQ A;  1I1S A;  2P8T A;  2JSC A;  3LA2 A;  3ZMT A;  2D45 A;  4RGU A;  2FOK A;  1XD7 A;  2DO7 A;  3BOQ A;  2NNY A;  1J75 A;  4AD9 A;  1SD6 A;  3WTX C;  1J0R A;  2HWV A;  2FBH A;  4M72 A;  3KZZ A;  1QZZ A;  3FHZ A;  4Y13 A;  3WOD F;  5TJJ A;  4O3M A;  5DCM A;  2CGP A;  1JXS A;  2M8E A;  1FBU A;  1YW7 A;  2FSW A;  4Q47 A;  3O6B B;  5HLI A;  3HRU A;  5LEK A;  5CVV A;  5K5R A;  1FYL A;  3TOB A;  4K2E A;  1U6G A;  5D6F A;  1SFX A;  2IA0 A;  1R1U A;  3H92 A;  5CVU A;  3WE3 A;  1USS A;  3G73 A;  2KIF A;  1IN4 A;  4G6D A;  4GO1 A;  4I0B A;  1ZG1 A;  2Q0O A;  4U7D A;  1XMA A;  1K78 A;  2ADU A;  1E2X A;  3GO5 A;  2HEO A;  1U5T B;  3PQK A;  4I2O A;  3CO6 C;  3RJP A;  4EJV A;  1QO0 D;  1F9N A;  1QPM A;  3F8C A;  4ZYG A;  4P55 A;  4YFN F;  4A0Z A;  3KET A;  4CDG A;  4LG0 A;  1LDJ A;  3R6S A;  1LQ1 A;  4IJA A;  5HDN A;  4OOI A;  4BNC A;  1PUE E;  4WXC A;  3F3X A;  2L3D A;  4MQ9 F;  4LB5 A;  2HS5 A;  3GFL A;  1MD0 A;  1Z7U A;  1XSV A;  1MZB A;  1XN7 A;  2QQB A;  1RUN A;  4EJO A;  3BZ6 A;  3IHU A;  1I5Z A;  4OMY A;  4EJT A;  3GFJ A;  5A2Q Z;  2OZU A;  2IT0 A;  2BBY A;  1FT9 A;  2HYF A;  5E1Z B;  1BC7 C;  1YW8 A;  4HA8 A;  4BYY A;  1J9I A;  3OOP A;  3WTY C;  4WCG A;  4B8X A;  3V7S A;  1KYZ A;  3KFW X;  3V4G A;  1SMY F;  5J6X A;  3J80 K;  1P4W A;  2IVM A;  2LNB A;  3CUQ C;  3AAF A;  3ZN0 A;  4EGZ A;  4ASN A;  1MDM B;  3OV8 A;  1TNS A;  1SFE A;  2E1N A;  2QWW A;  1KU7 A;  1PP7 U;  5KVR A;  2MH9 A;  3TDZ C;  4I02 A;  4XSX F;  3E97 A;  4KFC A;  5FGM A;  3I59 A;  1U78 A;  3TO7 A;  4FT8 A;  2YX4 A;  3I54 A;  4ZYH A;  1LEA A;  5D4S A;  1BI0 A;  2BEO A;  4HOB A;  4I98 B;  4EM0 B;  2JPC A;  1LDD A;  1ZLJ A;  3HRT A;  2VT3 A;  3J7A O;  2R7D A;  2H94 A;  1EH8 A;  3VEP A;  5FB2 A;  4LLN A;  1R1V A;  2J5P A;  3GWZ A;  4A6E A;  1CF7 A;  1D8K A;  5DD4 A;  2F5F A;  1V3F A;  2MH2 A;  2FRH A;  1QGP A;  2A5Y B;  4CYD A;  4Q4Z F;  2PN6 A;  2EB7 A;  4CZZ A;  2ESH A;  5IT3 A;  4G7Z F;  1EH6 A;  3MCZ A;  5HS8 A;  3DQV C;  3P7N A;  2W25 A;  2XAJ A;  1ZG5 A;  3HSR A;  2HQN A;  1OYY A;  3LA3 A;  2CQK A;  1ZRD A;  4IHT A;  1BM9 A;  1JHH A;  3HOS A;  5DV5 A;  2HGC A;  3M1E A;  3KEO A;  1ONV A;  3GZ5 A;  1FWZ A;  1HKS A;  3IWZ A;  3V8K A;  2YU3 A;  4EV0 A;  2DFI A;  1WRJ A;  3IKT A;  2ZXJ A;  4BHC A;  4YG2 F;  1FLI A;  3HOT A;  3MZY A;  1C0W A;  4PGH A;  2QM3 A;  3BJA A;  3DPT A;  2QQA A;  1ZG3 A;  3EYY A;  3GVA A;  2ZNZ A;  5J8C A;  2X4H A;  3FM3 A;  1TW3 A;  4L9J A;  2DK5 A;  2M1B A;  2F2E A;  2EA2 A;  3GX4 X;  2G7H A;  1B6A A;  1DPR A;  1HW1 A;  1R00 A;  1U2W A;  4RB1 A;  3M8E A;  4A12 A;  3WE2 A;  3L00 A;  1HW2 A;  2VE8 A;  3WGG A;  2RVC A;  2UXX A;  4MGR A;  4OIN F;  3Q5F A;  3W6J B;  3I0T A;  3LFK A;  2BYV E;  5HVQ C;  3K69 A;  1BI1 A;  4AIJ A;  4NHJ A;  1YLF A;  2PJP A;  3I53 A;  2EJR A;  4LLL A;  3E5U A;  3V7C A;  5K5Q A;  2LSO A;  1B9N A;  2C6Y A;  4M9X A;  3SXY A;  5LHI A;  2JRT A;  2M30 A;  4EM1 A;  2AS5 F;  3F8N A;  5FLX K;  3DFG A;  1W5S A;  4G94 A;  2XAS A;  3GW2 A;  3IRR A;  1V4R A;  2W85 A;  4OIQ F;  3RI4 A;  1T2K A;  2V1U A;  4A0Y A;  1FYK A;  1RNL A;  4ON0 A;  4ZYE A;  2JT1 A;  2KJB A;  4KN4 X;  4Q48 A;  2QLZ A;  3W6K B;  2L01 A;  6PAX A;  1HKQ A;  1R1T A;  3I58 A;  3E6B A;  1ZLK A;  3CUO A;  4ETS A;  4HDV A;  4HQM A;  2ZBK A;  1TNT A;  4L9N A;  5DUI A;  4L0Z B;  2UZK A;  1O3S A;  3SZT A;  4RB3 C;  3CJN A;  3K2Z A;  1L3L A;  4HW0 A;  3H3Z A;  4ESF A;  1J59 A;  4P9F A;  3FXU A;  2LDU A;  4KMU X;  2F5E A;  1K79 A;  5DUK A;  3E3V A;  2A69 F;  2RV8 A;  5E18 F;  3SQN A;  5AIQ A;  2HR3 A;  3ZPL A;  2DAO A;  3MZH A;  3WTZ A;  1OYW A;  2EFW A;  4QLC U;  1YW9 A;  3CDH A;  4N9H A;  2XIG A;  3HRS A;  1A04 A;  4Y15 A;  2VC0 A;  2DQL A;  5DDG A;  3WGI A;  2K86 A;  1S7O A;  4ESB A;  4OMZ A;  3HHG A;  2VOP A;  4Y17 A;  4CHU A;  4S05 A;  2CSO A;  3E5Q A;  5JVT A;  1T6S A;  4LB6 B;  1IXR C;  4MTE A;  1R23 A;  3LST A;  3HHH A;  2EFN A;  1SD4 A;  3QOP A;  3GF2 A;  4GCV A;  1B4A A;  1XB4 A;  3J80 Z;  3BPV A;  4CIC A;  1FX7 A;  2WV0 A;  2PG4 A;  1P92 A;  1G4D A;  4KUM A;  1JGS A;  2HKX A;  1E17 A;  3ECO A;  4ENN A;  3KP7 A;  5ICG A;  1IN5 A;  2IW5 A;  5LBQ A;  1ZGA A;  1ZRC A;  3FMS A;  3IWF A;  5FD6 A;  1R22 A;  4DNC A;  1FY7 A;  3FXR A;  3H3U A;  1XGN A;  3ZQ7 A;  1ZRE A;  3WTW C;  2CWE A;  4HV6 A;  1D3Y A;  3T8T A;  4IHS A;  5D5W B;  2KIU A;  2QBY A;  4N0B A;  3KCC A;  2FE3 A;  3CUQ A;  1O3Q A;  4WF2 A;  2COM A;  2QEN A;  4YFX F;  2A6H F;  2JPB A;  3REO A;  3R0A A;  1YS7 A;  4TV7 A;  3N4M A;  3KP5 A;  1I6X A;  2VE9 A;  1K78 B;  2NAZ A;  2PFB A;  4I0A A;  1SD5 A;  5CYV A;  2V79 A;  1R7J A;  4QWQ A;  1BOA A;  2FA5 A;  1WI9 A;  3K1P A;  2J5O A;  2XAG A;  4AVP A;  3MWM A;  1IRG A;  1O7F A;  4LG0 B;  1Z9C A;  3E6C C;  1FNN A;  2HTJ A;  1IXS B;  2OAZ A;  4U0V A;  2V9V A;  1HST A;  3DF8 A;  4KA4 A;  4BAY A;  1K7A A;  4UXN A;  2E7X A;  1P4A A;  2A61 A;  2VN2 A;  4I7H A;  1R36 A;  1ZAR A;  1I1G A;  1KQ9 A;  3FM5 A;  2NRA C;  4RGS A;  5D4R A;  3JSO A;  1FC3 A;  3I5U A;  4UVB A;  3C1D A;  1O57 A;  5CLS A;  3S2W A;  2EV0 A;  5L3E A;  3JSP A;  2OQR A;  1QBJ A;  3TDU C;  1I27 A;  2ZFW A;  2VC1 A;  3QPH A;  2FNA A;  1ZRF A;  5BMZ A;  2EFP A;  2FF4 A;  2DQR A;  5JR3 A;  2OD5 A;  4XSZ F;  1HXD A;  3F6V A;  2E7W A;  4KMF A;  1BJA A;  2DPU A;  4KT5 C;  1O7L A;  3I59 B;  5CVJ A;  2XHK A;  2EFO A;  3G3Z A;  4R1H A;  4EM2 A;  3EDP A;  3C18 A;  1F5T A;  5L3C A;  2XVC A;  4RGR A;  2MLG A;  5FLX Z;  2ZJ2 A;  4HX8 A;  4R79 A;  2Y0M A;  3PFI A;  3IL2 A;  2OQG A;  2OA4 A;  5LEJ A;  1DP7 P;  1ZHF A;  5KK1 A;  4KYW A;  2P5K A;  2P5V A;  2GWR A;  1FZP B;  1YTY A;  3HYI A;  3ZMV A;  1CF7 B;  4KDP A;  2CG4 A;  3QAH A;  1FSH A;  2UXN A;  4A6D A;  1MJ9 A;  1TW2 A;  3V8L A;  2QYO A;  5IT9 K;  3ZMZ A;  4M6Y A;  4YII A;  3QPT A;  2EV6 A;  2G7U A;  5BPI A;  5ILS A;  2XKP A;  4R8H A;  4AIH A;  2IPQ X;  4ESJ A;  5HS9 A;  2ISY A;  1G3S A;  2IRF G;  1TQP A;  2YX7 A;  1GXP A;  2XRO A;  3KP2 A;  1IN6 A;  4P9U A;  4WK8 F;  2CYY A;  3KP4 A;  3JW4 A;  4A5M A;  1J5Y A;  3NRV A;  5D6E A;  1S3J A;  5HLG A;  1B59 A;  1GHC A;  4IRH A;  3SFZ A;  4NB5 A;  1GXQ A;  1Z6T A;  1UST A;  3LWF A;  2BE5 F;  2O61 A;  5E1W A;  3KZY A;  1BBY A;  5LRS A;  1G6N A;  4A0X A;  2GA2 A;  3TQN A;  4ZZD A;  3BPX A;  4Q5S F;  3DEU A;  4NQW A;  4F7Z A;  1Z05 A;  2ZNY A;  1YIO A;  2M87 A;  2OU2 A;  3KEQ A;  1TLH B;  2Y48 A;  3D0S A;  3P9I A;  3J81 K;  4ZZL A;  3GYH X;  3F22 A;  4ZH4 F;  4ENJ A;  5ICE A;  5ILU A;  2Z33 A;  2VOD A;  3MQ0 A;  3NEU A;  4U88 A;  2VBY A;  4HX4 A;  3L2C A;  1KQ0 A;  2UWM A;  1YFH A;  2H09 A;  1X3U A;  2WTE A;  2HQR A;  3FZV A;  2ESN A;  4EVI A;  2VXZ A;  1XSD A;  5LHG A;  1LNW A;  3L09 A;  1G3Y A;  3DPL C;  1EV7 A;  3T1B A;  2VBX A;  4G7H F;  3KLO A;  2QUF A;  3RKW A;  2H27 A;  4CXF A;  2P5L C;  5CVR A;  3R4K A;  3WU0 A;  2O6G E;  2O3F A;  1W7P A;  3N97 A;  3ECH A;  2K02 A;  1IUY A;  2Z3Y A;  2YSR A;  1IRF A;  2IA2 A;  1R5G A;  1XCB A;  3R0J A;  4FX4 A;  3ZMD A;  1BIA A;  1IF1 A;  2PLY A;  1TTY A;  3LAJ A;  2GIV A;  4HLY A;  1Q1H A;  1W4M A;  3C3W A;  2Y75 A;  2LKP A;  1XSX A;  2O0Y A;  1U5T C;  3U2R A;  3QRF F;  2GXB A;  1IAW A;  2A6E F;  4M74 A;  3ZMU A;  3DP7 A;  4HBL A;  2FBK A;  1RUO A;  1YYV A;  4IVN A;  4JQF A;  5CVI A;  4EQQ A;  3FXQ A;  2D2W A;  2JTV A;  3VB2 A;  3L7W A;  4MTD A;  3P9K A;  1AWC A;  1KGS A;  1YS6 A;  3V8J A;  3CLO A;  2HTS A;  2L54 A;  4WXH A;  3ELK A;  2KKO A;  1WWX A;  3TKY A;  2P7C B;  4AIK A;  3F21 A;  2GA1 A;  2P4W A;  1B9M A;  2B0L A;  1IW7 F;  3V7R A;  3ABT A;  2X0L A;  2ACJ A;  5AIP A;  3B73 A;  2DPD A;  5E17 F;  1SMT A;  5F64 A;  3IRQ A;  2H6C A;  4P5O A;  3E6M A;  3SHF A;  4L5I A;  4UV9 A;  3TOA A;  1QQI A;  5F6F A;  4MHG A;  2WWY A;  3RYP A;  2D1H A;  4UHT A;  1O3R A;  1STZ A;  2QVO A;  2LF8 A;  5CJ9 A;  2FU4 A;  2PBI A;  5FFX A;  4FX0 A;  5LGU A;  2L4A A;  1U8R A;  2XKO A;  3HTS B;  2Q8K A;  4XLN F;  5HDG A;  3E5X A;  2VON A;  2JZY A;  5F1R A;  3BWG A;  4M71 A;  2QQ9 A;  3ML6 A;  4OIO F;  1JE8 A;  1IN7 A;  5JI6 A;  1P6R A;  4XBF A;  3GFI A;  2QBY B;  1RI7 A;  2ZME A;  1LJ9 A;  3CUQ B;  1HW5 A;  4RS8 A;  1LVA A;  4GYG A;  1UCR A;  5JHU A;  3FMR A;  3FMQ A;  3F23 A;  1TQM A;  5IT9 Z;  4L9T A;  1TBX A;  2KIM A;  2QZ8 A;  1XMK A;  3E6D A;  3DKW A;  4LLG F;  1OYI A;  4RGX A;  1IZ1 A;  2FBI A;  2HDC A;  2ZKZ A;  4PDK A;  2XAF A;  2FNP A;  1Z6R A;  3ABU A;  2CFX A;  3I4P A;  2KJC A;  5ED4 A;  1T98 A;  4L0Y B;  2PEX A;  3D5L A;  4E70 A;  3EUH A;  1ULY A;  3HRM A;  2ELH A;  2VOO A;  3IKV A;  1S29 A;  1S8N A;  4HYE A;  3MAJ A;  1BN5 A;  4PZJ A;  1VTN C;  1O3T A;  1TQI A;  4RAZ A;  5BOX A;  2RKH A;  2VT2 A;  4FHT A;  5HDK A;  4L18 B;  1WQ2 A;  4U7B A;  4JBA A;  3F8F A;  3KLN A;  1T38 A;  5ILV A;  3LA7 A;  4G9Y A;  3EYI A;  2WC2 A;  5E20 A;  2IP2 A;  3DV8 A;  1PP8 F;  4YFK F;  2DK8 A;  3ZP5 A;  1XDS A;  2R7F A;  1QZY A;  4WXD A;  5HS7 A;  2STT A;  2R3S A;  3GZ6 A;  4O6J A;  1U3E M;  5DCF A;  3C7J A;  1GVJ A;  1BIB A;  5LGT A;  2XGX A;  2EK5 A;  3J81 Z;  1R58 A;  3EQL F;  4HQE A;  1J2X A;  2HKO A;  4HF0 A;  1XGS A;  2A3S A;  1G3T A;  2DI3 A;  2F5D A;  3BDD A;  2HOE A;  1UHM A;  5EEG A;  2XUB A;  4ENM A;  4HF1 A;  2IA1 A;  4I01 A;  3FX3 A;  2IJL A;  2D1V A;  2CW0 F;  2EV5 A;  5HLH A;  4L9V A;  2O8X A;  1FYM A;  2A07 F;  4UNO A;  2GAU A;  4KIC A;  3F8B A;  3VFZ A;  5E1X A;  5LRR A;  4MQV A;  5H6Q A;  3MFK A;  2NNN A;  4RB0 A;  5LLQ A;  3QP5 A;  4G6Q A;  2DTR A;  4Z2Y A;  2MC3 A;  3GFM A;  4H0E A;  1REP C;  3T5X A;  1DPU A;  1YO5 C;  1OPC A;  5BPD A;  4G8X A;  3KE2 A;  1ZH5 A;  2BGC A;  2E1C A;  2ZO4 A;  3QU6 A;  2ISZ A;  2DBB A;  2FXA A;  2BV6 A;  5ICC A;  2P6S A;  2G9W A;  2GQQ A;  4KIF A;  1HSJ A;  3KP3 A;  4U0Y A;  3ERE D;  2RC4 A;  3HSF A;  1WSU A;  1ZAO A;  3R61 A;  2L4M A;  2XAH A;  3DXJ F;  5J8F A;  5H6R A;  3HUG A;  3Q9S A;  4M9S A;  3K9T A;  4KN7 X;  3ZMS A;  3VOD A;  3RPQ A;  2LF7 A;  4AWX B;  3WTS C;  1EH7 A;  3BRO A;  1IXC A;  4KNY A;  4A5N A;  1U5T A;  2V6C A;  3GUD A;  1FP1 D;  3BP8 A;  2K27 A; 
#chains in the Genus database with same CATH topology
 3K0L A;  2W4S A;  5J3L A;  4YIR X;  1ZYR F;  2O03 A;  1ODD A;  2K7L A;  2VBZ A;  3RKY A;  4ZYD A;  2HYG D;  4LMY A;  1VQ4 I;  2Q2E A;  3JTH A;  4XLP F;  4HAM A;  2EA4 A;  4EMS A;  4I09 A;  3K70 C;  1SD7 A;  1ON1 A;  3DLA A;  2V26 A;  4IXA A;  2RQQ A;  3H0D A;  4EJU A;  1SAX A;  2BOL A;  1MMN A;  3KP6 A;  1JJ6 C;  3O8H A;  4E7J A;  3M7G A;  2XGD A;  4LGW A;  4FQG A;  4GYI A;  1T39 A;  4M73 A;  2VQH A;  2Z9O A;  5DYM A;  2GIZ A;  2DW4 A;  1RRJ A;  4RB2 C;  2MA3 A;  1HKT A;  3GXO A;  3MVP A;  4BE1 A;  3CCR I;  4MNU A;  3GCM A;  1S6L A;  3JAM K;  1QNT A;  5F08 A;  3QPL A;  1T08 B;  4IHW A;  1D1C A;  4XRM A;  1BI3 A;  1OR7 A;  4V19 K;  5IP7 J;  3H5A A;  1JKR C;  1B72 B;  1UHW A;  1FBQ A;  4LJZ F;  2XRN A;  4HV5 A;  3BT9 A;  1W7P B;  5F0F A;  1FP2 A;  2NYX A;  4BQN A;  4M6X A;  2RAE A;  1R5I D;  2BW3 B;  1LEB A;  1KU3 A;  3Q9V A;  1QHH D;  4XN0 A;  3CCE I;  2GZW A;  2GXG A;  2ZC2 A;  2PX9 A;  1JUP A;  5F0C A;  2M7B A;  4NDL A;  3HOW J;  5E8G A;  3ZQQ A;  4B09 A;  3AG1 H;  3QPS A;  4BH9 A;  3IC7 A;  4M3B A;  3CME I;  1VQO I;  1WH5 A;  1K83 J;  4EGY A;  1BI2 A;  2FJ1 A;  1KYW A;  1W7P D;  4LD5 A;  4LK1 F;  5FO5 A;  2E36 A;  2OTJ I;  1MDM A;  4GGG A;  5L3D A;  2RN7 A;  1XGM A;  1A36 A;  3HC7 A;  5L3G A;  5HOO A;  3L9F A;  4S04 A;  3G1L A;  2VQG A;  3PO2 J;  5LGN A;  2R7Z J;  4L5J A;  4ZDO A;  1XG1 A;  3K2A A;  5IYD J;  1YOV B;  2IS2 A;  4IQJ A;  2K4B A;  3LSI A;  1F1Z A;  2M45 A;  1Z91 A;  2DFF A;  2M4K A;  5JFR A;  2I8D A;  2STW A;  3RKX A;  3G1M A;  4OIP F;  1VI0 A;  4BHB A;  2HOT A;  3JRB A;  2HQA A;  3OYF A;  2F4M B;  4G7O F;  1DP3 A;  4IF4 A;  1Z1D A;  3H1C A;  1OKR A;  4XQF A;  1FBS A;  4IPA A;  1ZN2 A;  2W57 A;  3F6O A;  1DUX C;  3CF2 A;  4A2U A;  2EWN A;  4PFO A;  4BHP A;  1MGT A;  3RYR A;  1XDU A;  3NQO A;  1ENH A;  3U1D A;  1Y0U A;  5D8L B;  3OL3 A;  3LQR A;  5D5X B;  1DDN A;  4MEY F;  4ITV A;  4BXU A;  4UVA A;  4UVC A;  3JTG A;  2L02 A;  1MBK A;  1HLV A;  1G8X A;  3QWL A;  5H20 A;  1T95 A;  1MKM A;  2V1D A;  3R60 A;  4P96 A;  2ETH A;  1RZ4 A;  4HF2 A;  3K6G A;  2P7V B;  3O2P E;  3CC4 I;  5DD8 A;  1H9G A;  4RAY A;  2PMH A;  3BJ6 A;  2EBI A;  1YG2 A;  2TDX A;  4CA0 A;  2MD5 A;  1IN8 A;  2DMP A;  2Z2S B;  3PUF A;  1VQM I;  1XGO A;  2M5W A;  3P9C A;  4ENK A;  2M9H A;  4HDU A;  1BC8 C;  1I6H J;  2CW7 A;  5K5O A;  2FOW A;  3UR3 C;  4U0W A;  3FF5 A;  2ZCW A;  3T0Y A;  2XB5 A;  1P2F A;  1YQA A;  5EDN A;  1LDK B;  2B7E A;  3ABM H;  3ZRG A;  1H0M A;  2FUG 2;  1Y1V J;  1I3Q J;  3MEX A;  3RTR A;  5K1Y A;  1UZC A;  5J4V A;  2DXI A;  1HOM A;  5EGO A;  1XX5 A;  2HXI A;  3O3K A;  3JRH A;  4XLE A;  3OMY A;  4M9Z A;  1Y6I A;  1D8J A;  3HZJ A;  4A3C J;  5LHH A;  3FWE A;  2DU9 A;  4YRV A;  3I64 A;  2ME6 A;  3OY9 A;  1VQK I;  3FKI J;  3LSH A;  3M8F A;  2R4G A;  3DEE A;  2H6B A;  5GTH C;  1HBX G;  4F92 B;  1UHS A;  2V6E A;  3HPG A;  2RQP A;  4O5V A;  2XV4 S;  1MNE A;  2DCE A;  4BJ6 C;  2ZJR F;  1GUU A;  2OPT A;  5D8K B;  2DA6 A;  2K9N A;  4MEX F;  1L0O C;  4A3K J;  2A68 F;  5IOZ A;  1B8I B;  3PQJ A;  2ID6 A;  4Y3O A;  3WG9 A;  3NAR A;  3JRA A;  1JT6 A;  3WHB A;  2Z99 A;  1T0F A;  4ABZ A;  2XGC A;  1BJZ A;  5L3F A;  3A03 A;  2PQ8 A;  4JK1 X;  1CGP A;  1HDD C;  5A2Q K;  2AHQ A;  1X19 A;  1LB2 A;  1APL C;  3SZP A;  4WX9 A;  2IS1 A;  1T8I A;  2EFQ A;  4DYR A;  1B1B A;  4HZF A;  5BS6 A;  4BS9 A;  1AU7 A;  2RNJ A;  5TRD A;  3WGH A;  2OZ6 A;  1SVO A;  2EPF A;  2FML A;  3HTU A;  1HQC A;  3EET A;  2HVS A;  3JRD A;  1V55 H;  3ZQH A;  3S93 A;  1S9H A;  3ZN1 A;  2ZME B;  3CO7 C;  4IRI A;  5L3B A;  1FMV A;  2VBW A;  2QF7 A;  2OC6 A;  2WAD A;  2F5C A;  2YR2 A;  3JR9 A;  1RIO H;  1FTT A;  1MJA A;  1R49 A;  1IUF A;  2Y31 A;  3QU3 A;  3Q0U A;  3GTP J;  3GLX A;  4J01 A;  2H8R A;  1UFM A;  2HFH A;  1HC8 A;  2G0E A;  1WVR A;  1AA7 A;  1MND A;  1UG2 A;  1JI8 A;  2MLK A;  2DOE A;  3HIF A;  2AXT C;  3WTT C;  2K9M A;  1RKT A;  1T56 A;  3DKY A;  5JLX A;  5D5V B;  5FFZ A;  4KIB A;  2MBF A;  3K1N A;  5DEQ A;  3TMO A;  2L7M P;  1WPK A;  2RGV A;  3WTV C;  1YJW I;  5E8I A;  2KRF A;  4IRG A;  1A35 A;  1ORK A;  3RIR A;  1TZL A;  4M3E A;  4ANJ A;  4KT6 A;  3CMY A;  1D5Y A;  3K1M A;  4IHY A;  5B1A H;  4D0P A;  3V42 A;  1JHF A;  3RPU A;  2NS0 A;  3VOE A;  3RDI A;  3S2H J;  2M0C A;  1K6O A;  2PI0 A;  4OIR F;  1B8I A;  3BQY A;  1NH3 A;  3T8R A;  3HPH A;  3F8M A;  3G1O A;  1FSE A;  2FEZ A;  3CD6 I;  4OU0 A;  1P4X A;  1WJA A;  3BLY A;  5BQT A;  2DYS H;  2R7X A;  2YPR A;  4XRF A;  3QOD A;  3ZXS A;  1JJ8 C;  2GXA A;  3CTA A;  5EYR A;  1IRZ A;  4DQ2 A;  1JKO C;  2DYR H;  1UMQ A;  5ICF A;  1W36 D;  2LTP A;  4QSH A;  4PJJ A;  2O9L A;  3S8P A;  4ZTF A;  1UJ8 A;  3HEF A;  4RAG A;  5J1R A;  2HOS A;  3OYM A;  3TO9 A;  2GM4 A;  3CJT B;  3HM5 A;  3BY6 A;  4HST A;  2OBP A;  3F9K A;  3KYD B;  4PJN A;  2FMY A;  4EJW A;  1WJB A;  2K4J A;  3SZG A;  3WHC A;  4Z6Y A;  5IP6 A;  2HZT A;  4HX7 A;  4UUV A;  3ISP A;  2V1X A;  3S3O A;  1YJ9 I;  1PDN C;  2Y9Y A;  4N9I A;  2JMW A;  1WI3 A;  3U9G A;  4LK0 F;  5ERI A;  1MSF C;  3LAP A;  2P6T A;  5EZG A;  2AXL A;  3GEZ A;  2LBF B;  2HI3 A;  3HSE A;  3BG7 A;  2JA2 A;  4JOM A;  2W00 A;  2A05 A;  1G2H A;  1ZGJ A;  4EEF G;  4FET A;  2YU9 J;  4PGG A;  1G3W A;  3HGY A;  3TGN A;  3OYC A;  1ZR2 A;  4LFU A;  3M4O J;  1AOY A;  3WTU C;  3TO6 A;  2W24 A;  4WWC A;  2XDV A;  2L9S A;  1VQN I;  2R5Y A;  2RDP A;  2E60 A;  1KU2 A;  3ROU A;  1XCV A;  3IUO A;  4C2T A;  1D5V A;  2PMU A;  2CO5 A;  1S7A A;  1IG7 A;  3QP6 A;  5FD5 A;  2ZXI A;  1KU9 A;  1NHA A;  3BTL A;  4GXO A;  4C2U A;  3BCA A;  1W5T A;  4KIG A;  3A01 B;  3F72 A;  2ZJP F;  1BA5 A;  4PJ0 C;  4IQ4 A;  3I9V 2;  5D5U B;  4F52 A;  3WU1 B;  2B9S A;  1Z7L A;  2X48 A;  4CGZ A;  2HOA A;  2XAQ A;  4BE0 A;  1K4T A;  3JRF A;  3COA C;  3BJO A;  3SEQ A;  2Z5U A;  1FMW A;  1X58 A;  2F4O B;  2JVH A;  4GRI A;  3L2V A;  3LQQ A;  5DCM B;  1Y8Q B;  1FTZ A;  1I3A A;  2VKV A;  1SFU A;  1WKM A;  4JX6 A;  1NK3 P;  4HLX A;  2W84 A;  4I6Z A;  1QA6 A;  1R5H A;  3FIS A;  2JRM A;  3M9A A;  1MH3 A;  3OS0 A;  4A3E J;  1ON2 A;  1FPQ A;  1AKH B;  3I71 A;  4YIF A;  3B02 A;  2BZT A;  3JAM Z;  5AON A;  2ZSH B;  1TWG J;  5EEH A;  1H9T A;  2JA5 J;  3ULQ B;  1KQ8 A;  1ETV A;  2DLL A;  1MJB A;  1YX5 A;  4UV8 A;  4GFB A;  1J7K A;  2FQ3 A;  4BQA A;  4XRS A;  2DT5 A;  1UB9 A;  3P5J A;  4B43 A;  1F4K A;  1FOK A;  2KPM A;  5DTD A;  5B3S H;  3J7Z I;  3Q3S A;  3TP0 A;  5LFA A;  1KA8 A;  1OMI A;  2K5C A;  4EAT A;  2X9D A;  5GTI C;  4CO8 A;  2IS4 A;  4PCQ A;  4ZDP A;  1I1S A;  2E1O A;  2P8T A;  2JSC A;  2V7F A;  4XLH A;  3L2W A;  3LA2 A;  3ZMT A;  3I4N J;  2D45 A;  2JA6 J;  2Y69 H;  4RGU A;  2FOK A;  2X6O A;  3AL0 B;  1X1P A;  2EH3 A;  1XD7 A;  3A4C A;  2DO7 A;  2W82 A;  3BOQ A;  3HGG A;  1U8B A;  2JA7 J;  2NNY A;  1J75 A;  4AD9 A;  1SD6 A;  2JQ7 A;  2IGN A;  3VWB A;  3WTX C;  3BTI A;  2E35 A;  3CZ6 A;  1J0R A;  2HWV A;  2FBH A;  4M72 A;  3KZZ A;  3SJM A;  1QZZ A;  3FHZ A;  3S1R J;  4Y13 A;  3WOD F;  5TJJ A;  4O3M A;  4IL6 C;  2KHM A;  2LRE A;  2M34 A;  1YRN B;  5DCM A;  1Y1W J;  2GBY A;  2CGP A;  2CV1 A;  1JXS A;  3MD2 A;  4E7S A;  3FXK A;  4XLC A;  2M8E A;  3ONQ A;  1FBU A;  1YW7 A;  2FSW A;  1TWF J;  2KRC A;  5IPA A;  1H8A C;  1BW5 A;  4Q47 A;  2QKM B;  3O6B B;  2VI6 A;  5HLI A;  1LKX A;  3HBL A;  3HRU A;  5LEK A;  5CVV A;  5K5R A;  4FCY A;  1FYL A;  3TOB A;  2E5N A;  1MMG A;  1ZQ3 P;  4K2E A;  2XF6 A;  5DM7 F;  1U6G A;  3OYE A;  5D6F A;  1SFX A;  2IA0 A;  1ITY A;  1R1U A;  3JCU C;  2V9P A;  3H92 A;  1RES A;  5CVU A;  2DMU A;  1ERD A;  1OCC H;  2CUJ A;  3WE3 A;  2BY3 A;  1USS A;  2MC4 A;  3G73 A;  4A3I J;  2KIF A;  1IN4 A;  4G6D A;  4GO1 A;  2BY1 A;  4I0B A;  2KDZ A;  1ZG1 A;  3ZQL A;  2Q0O A;  1QPI A;  4U7D A;  3L2R A;  1XMA A;  1YHQ I;  1K78 A;  2ADU A;  1E2X A;  3GO5 A;  2HEO A;  1U5T B;  3PQK A;  3CCL I;  3ASO H;  2E34 A;  4I2O A;  2XF7 A;  3CO6 C;  3RJP A;  4EJV A;  1QO0 D;  4IEJ A;  1F9N A;  2R7W A;  1OCR H;  2JWT A;  1QPM A;  3F8C A;  2Q2E B;  1RET A;  2DDB A;  3A1Y A;  4P55 A;  4ZYG A;  5FKM A;  4G6T B;  3BR5 A;  3CCJ I;  4B44 A;  2E1M B;  1OQY A;  2MG4 A;  4YFN F;  2Q1Z B;  4A0Z A;  3KET A;  4DZJ A;  4CDG A;  4LG0 A;  1LDJ A;  5J1U A;  3IH4 A;  3NWS A;  2H1L A;  3R6S A;  3CCS I;  1LQ1 A;  3C2G A;  1VQ5 I;  3FXJ A;  4QTR A;  3GME A;  4QIW N;  2XSD C;  4IJA A;  2L5Q A;  4II2 A;  4OOI A;  5HDN A;  1PUE E;  4BNC A;  3ZQF A;  3BQZ A;  3LSK A;  5GAH J;  4IX7 A;  5FRO A;  4WXC A;  3F3X A;  4UY8 I;  2L3D A;  4MQ9 F;  1VQ7 I;  1ETK A;  4LB5 A;  2HS5 A;  3GFL A;  1F43 A;  3ESW B;  1MD0 A;  1Z7U A;  1XSV A;  2KQR A;  1MZB A;  1XN7 A;  2QQB A;  1RUN A;  4EJO A;  3BZ6 A;  1MMA A;  3I4M J;  3IHU A;  1I5Z A;  4OMY A;  4EJT A;  3GFJ A;  4UUT A;  5A2Q Z;  2HVR A;  2WY7 Q;  3TW7 A;  2OZU A;  2IT0 A;  2BBY A;  4JX4 A;  1FT9 A;  3ERM A;  1MSE C;  2HYF A;  2LYC A;  2DA5 A;  1R6R A;  5E1Z B;  1BC7 C;  3K4K A;  4A3D J;  1YW8 A;  4HA8 A;  4BYY A;  1XTA A;  4NUB A;  3RCO A;  1J9I A;  4B4C A;  2YUS A;  4ZTJ A;  5C4J J;  3OOP A;  3WTY C;  2VJJ A;  4YEL A;  3AG3 H;  4B8X A;  4WCG A;  3V7S A;  4D5C A;  1KYZ A;  3KFW X;  5CKT A;  3V4G A;  1SMY F;  1FOY A;  2IEK A;  5IYC J;  3JRE A;  3EPZ A;  5J6X A;  3PNY A;  2LC2 A;  2W1O A;  3J80 K;  1P4W A;  2IVM A;  4L5E A;  3OIQ A;  2LNB A;  3CUQ C;  3AAF A;  1YJN I;  3ZN0 A;  3K4N A;  4EGZ A;  4ASN A;  3SDB A;  1JTY A;  2RRE A;  3GLL A;  4UUS B;  1MDM B;  3QOE A;  1BR4 A;  3KYC B;  4XL9 A;  1PUF B;  3OV8 A;  1TNS A;  1SFE A;  2E1N A;  5FLM J;  2QWW A;  1KU7 A;  3OIO A;  1OCT C;  1PP7 U;  5KVR A;  2ZXH A;  1XPX A;  5K7F A;  3VYT B;  2MH9 A;  3W2V A;  3TDZ C;  4I02 A;  4XSX F;  3E97 A;  3TED A;  4KFC A;  4FAS D;  2CS3 A;  1U0J A;  2NVU B;  3DBH B;  5FGM A;  3I59 A;  2KT0 A;  1U78 A;  4IHX A;  3TO7 A;  3PSF A;  4FT8 A;  1QRY A;  2LK2 A;  2LRD A;  2YX4 A;  3I54 A;  2VPR A;  1LEA A;  4ZYH A;  5D4S A;  4XRS G;  3TL4 X;  1BI0 A;  2BEO A;  1GVD A;  1WJC A;  3H9J A;  4HOB A;  4I98 B;  4HEA 2;  2HDD A;  4EM0 B;  2WY8 Q;  2JPC A;  1LDD A;  5EF6 A;  1ZLJ A;  3HRT A;  2VT3 A;  3J7A O;  1YE9 A;  2R7D A;  1TT5 B;  4CH7 A;  2H94 A;  1EH8 A;  3VEP A;  3L1P A;  5FB2 A;  2HQ5 A;  4LLN A;  1R1V A;  2J5P A;  3GWZ A;  4A93 J;  3OL4 A;  4A6E A;  3A02 A;  2L0K A;  3QQA A;  2HNH A;  1D8K A;  1ZK8 A;  1CF7 A;  1I39 A;  3CLQ A;  5DD4 A;  5EZH A;  2F5F A;  3B6A A;  3HXL A;  5KCM A;  1V3F A;  2K85 A;  2MH2 A;  2FRH A;  1QGP A;  2A5Y B;  4CYD A;  4Q4Z F;  4IOC F;  2PN6 A;  4C3J J;  2EB7 A;  4CZZ A;  3QYB A;  2ESH A;  2GOM A;  5IT3 A;  2QQ8 A;  4G7Z F;  1EH6 A;  3MCZ A;  5HS8 A;  1ACI A;  3DQV C;  3BG6 A;  2V4J C;  2XAJ A;  2W25 A;  3P7N A;  4UUS A;  1ZG5 A;  4FTH A;  1WFX A;  3HSR A;  1PUF A;  1QZE A;  5FRM A;  3OSG A;  4D9J A;  1VFC A;  2XGE A;  2HQN A;  4F55 A;  1OYY A;  2XC7 A;  2H1K A;  3LA3 A;  5EGO B;  2CQK A;  1ZRD A;  4IHT A;  2VQL A;  1BM9 A;  1JHH A;  3S3M A;  3HOS A;  5DV5 A;  2CQ7 A;  2HGC A;  3M1E A;  3S1N J;  1OFC X;  2Y0S A;  1A31 A;  4CSW A;  2EQR A;  2LLK A;  2DN0 A;  3FDY A;  3KEO A;  1ONV A;  3TW6 A;  3GZ5 A;  5JVG F;  4BDY A;  1UG0 A;  1FWZ A;  1HKS A;  3IWZ A;  3V8K A;  2YU3 A;  4EV0 A;  2DFI A;  3CES A;  1WRJ A;  3IKT A;  3S16 J;  2ZXJ A;  3DPU A;  4BHC A;  4YG2 F;  4MO7 A;  1FLI A;  3H0G J;  2OTL I;  3HOT A;  2NOG A;  3MZY A;  1C0W A;  1ZGW A;  4PGH A;  2QM3 A;  3D5S C;  3BJA A;  3DPT A;  1LVK A;  2QQA A;  4X1E A;  1ZG3 A;  4D7N A;  3EYY A;  1GV2 A;  4BL0 B;  3GVA A;  4AVZ A;  2ZNZ A;  3K4M A;  5J8C A;  2X4H A;  4XON A;  3FM3 A;  2BY2 A;  3A0B C;  1TW3 A;  1W5C C;  3MKW B;  3LSJ A;  3VPR A;  2HU9 A;  4L9J A;  2DK5 A;  4RLQ A;  2M1B A;  2F2E A;  3M07 A;  2EA2 A;  3GX4 X;  2G7H A;  1B6A A;  1DPR A;  1HW1 A;  2H8W A;  1R00 A;  1U2W A;  4RB1 A;  3M8E A;  4A12 A;  3WE2 A;  2DMT A;  2IGK A;  3L00 A;  2KIQ A;  1HW2 A;  2VE8 A;  4PK4 A;  4B3X A;  3WGG A;  2EIJ H;  3U1K A;  2RVC A;  2UXX A;  4MGR A;  5HOD A;  3OYD A;  2CMP A;  2IGO A;  4OIN F;  2NXN B;  3KX2 A;  3Q5F A;  1UEL B;  5E3O A;  3W6J B;  3H9Q A;  3I0T A;  5E3M A;  3LFK A;  1U9N A;  2BYV E;  1DGR M;  5HVQ C;  3K69 A;  1POG A;  1BI1 A;  3M8J A;  4BJT A;  1WHU A;  4BBS J;  2VKD A;  5M5X J;  4AIJ A;  4NHJ A;  2V9K A;  1N75 A;  1YLF A;  2PJP A;  3I53 A;  2EJR A;  4LLL A;  3E5U A;  3V7C A;  5K5Q A;  4KIS A;  2LSO A;  1B9N A;  2C6Y A;  4DGW B;  4DZP A;  1D0Z A;  4M9X A;  3SXY A;  3BG5 A;  2QSF X;  4BXF A;  2JRT A;  5LHI A;  2M30 A;  4F3Q A;  4EM1 A;  2AS5 F;  1MBF A;  3F8N A;  1FEX A;  3HL2 A;  5FLX K;  1J09 A;  1W5S A;  3DFG A;  4G94 A;  2KLO A;  2HPI A;  2O7O A;  2XAS A;  3GW2 A;  3GTK J;  4OWR B;  1IGN A;  3IRR A;  1V4R A;  2W85 A;  4OIQ F;  4D5F A;  3RI4 A;  1T2K A;  1GT0 C;  2V1U A;  3RPU D;  3DCF A;  4A0Y A;  1FYK A;  1RNL A;  4ON0 A;  4ZYE A;  2CFO A;  2JT1 A;  2KJB A;  4KN4 X;  3SDG A;  2YS9 A;  2NS8 A;  4Q48 A;  1ETW A;  2QLZ A;  4A3B J;  3W6K B;  2DDA A;  2L01 A;  3DBR B;  3CP2 A;  2Y9Z A;  4NC6 A;  4W1U A;  6PAX A;  1HKQ A;  1DQU A;  1R1T A;  3I58 A;  3E6B A;  3LSM A;  1LPQ A;  3GTJ J;  1ZLK A;  3CUO A;  3JRC A;  4ETS A;  4HDV A;  4HQM A;  2ZBK A;  2E2J J;  1LUJ B;  1TNT A;  4L9N A;  1W0U A;  5DUI A;  4L0Z B;  2EIM H;  3HKZ A;  2UZK A;  2V1N A;  1O3S A;  3SZT A;  4RB3 C;  3CJN A;  2BVM A;  1PVE A;  4KIT B;  3K2Z A;  3OYK A;  1R4N B;  1L3L A;  1BW6 A;  4HW0 A;  2EIK H;  3H3Z A;  2Y30 A;  4E7L A;  4CCL A;  5IYB J;  4ESF A;  3DTE A;  1W1W E;  2VQC A;  1J59 A;  3JRI A;  4P9F A;  3FXU A;  2LDU A;  4A3L J;  3C2B A;  3TP3 A;  1V5F A;  4KMU X;  2VLA A;  3FK6 A;  2F5E A;  3RZD J;  1K79 A;  4LOC A;  2R5Y B;  5M5W J;  5DUK A;  2M7A A;  4IZZ A;  3DU6 A;  3E3V A;  4C30 A;  5KHD A;  2A69 F;  1MIJ A;  2RV8 A;  3MKY B;  5E18 F;  3SQN A;  5AIQ A;  3HOV J;  2HR3 A;  3ZPL A;  2HDW A;  4ZC3 A;  2DAO A;  2LP0 A;  3CCM I;  3FK7 A;  3WTZ A;  5GAD J;  3BCB A;  2BXZ A;  3GBG A;  4XOR A;  2BHZ A;  3MZH A;  1JUM A;  1OYW A;  4E7K A;  3HOY J;  2VJ4 A;  2XAU A;  3OWT A;  4QLC U;  1YW9 A;  2EFW A;  3CDH A;  3BZC A;  4N9H A;  4JX5 A;  1IC8 A;  2XIG A;  4XKW A;  1YI2 I;  4Y33 A;  5HNF A;  2CUE A;  3HRS A;  1A04 A;  2TRT A;  2W7N A;  2VJ5 A;  1FOW A;  4CUG A;  1JTX A;  4UB6 C;  4Y15 A;  3G2B A;  5CQE A;  2DJN A;  2VC0 A;  2DQL A;  2L7K A;  3E7L A;  5DDG A;  3PJR A;  2R7U A;  4CCK A;  3H5R A;  3WGI A;  2K86 A;  1S7O A;  1LE8 A;  5KAI C;  4ESB A;  1P9Q C;  4OMZ A;  2OJE D;  3AG4 H;  3HHG A;  2VOP A;  4Y17 A;  4CHU A;  3LNQ A;  1WJF A;  3E0J B;  4S05 A;  4A3F J;  2CSO A;  2X1E A;  3E5Q A;  5JVT A;  1T6S A;  4LB6 B;  4XLF A;  1IXR C;  4MTE A;  3BZK A;  1R23 A;  2VXD A;  3LST A;  5F04 A;  3HHH A;  2EFN A;  2LR8 A;  1SD4 A;  3QOP A;  1Z3X A;  3G71 I;  2CV0 A;  3JRG A;  4NNJ A;  3GF2 A;  4GCV A;  1B4A A;  1XB4 A;  3J80 Z;  5GPA A;  3BPV A;  3WG7 H;  4CIC A;  1FX7 A;  2WV0 A;  4BDZ A;  2PG4 A;  2R93 J;  5J47 A;  1P92 A;  4A3J J;  1G4D A;  2VL8 A;  1OLT A;  4KUM A;  1JGS A;  2HKX A;  4BQQ A;  1E17 A;  1QU3 A;  3ECO A;  4RM2 A;  5JLW A;  3BG9 A;  5F27 A;  1ZKG A;  3AKZ A;  4ENN A;  3CCV I;  3KP7 A;  3LMM A;  4LG3 A;  5ICG A;  3K70 D;  3S1Q J;  5B66 C;  1IN5 A;  3HJE A;  2EZL A;  2W48 A;  4N4N B;  1R9T J;  2XF5 A;  4A69 C;  2IW5 A;  5LBQ A;  3DU5 A;  2R7Q A;  1ZGA A;  4ZYA A;  1ZRC A;  3FMS A;  2JJ7 A;  2LKS A;  1X2M A;  3IWF A;  3FXL A;  4UB8 C;  5FD6 A;  1S72 I;  1R22 A;  2KDO A;  4DNC A;  4CCN A;  5IP9 J;  1FY7 A;  2P0W A;  3FXR A;  3H3U A;  5GAE J;  1XGN A;  3ZQ7 A;  1ZRE A;  3I3L A;  2R92 J;  3WTW C;  2CWE A;  3MMY B;  4HV6 A;  4XKB A;  3S17 J;  1D3Y A;  2VAS A;  4BE2 A;  3T8T A;  4M3D A;  2JK3 A;  2WAF A;  1D0Y A;  1OCO H;  1A6I A;  4CZC A;  3OYN A;  4IHS A;  1A6Q A;  2EIN H;  1QVT A;  3Q0V A;  5D5W B;  2L9N A;  2KIU A;  2QBY A;  1Z77 A;  3G6E I;  4N0B A;  5CQG A;  3KCC A;  2FE3 A;  3CUQ A;  1O3Q A;  2LVS A;  4WF2 A;  2COM A;  3BTC A;  2QEN A;  4YFX F;  2A6H F;  3H9G A;  4F93 B;  2CW8 A;  3H3V K;  2JPB A;  3REO A;  1R71 A;  3R0A A;  1YS7 A;  4TV7 A;  3N4M A;  3KP5 A;  1I6X A;  2VE9 A;  3DLL F;  4B48 A;  2NAZ A;  1K78 B;  4AYB A;  2PFB A;  4I0A A;  1SD5 A;  2GOX B;  5CYV A;  2V79 A;  1R7J A;  2I10 A;  2JUG A;  2DA4 A;  4QWQ A;  1OIS A;  1X1A A;  2LY1 A;  2DMN A;  3DTI A;  5E3L A;  4Y52 J;  2MD0 A;  2VKH A;  4BXX J;  1BOA A;  3CJR B;  2FA5 A;  1WI9 A;  3K1P A;  2VIX A;  1RR8 C;  3H35 A;  3DEW A;  4HNU A;  1O4X A;  2J5O A;  2XAG A;  4AVP A;  5FLV A;  2L2O A;  3RZO J;  1N25 A;  3MWM A;  5DS9 A;  1IRG A;  4BGD A;  4RA2 A;  2NVT J;  2CQX A;  1PYV A;  3SFI A;  1O7F A;  3BC8 A;  4FE4 A;  4LG0 B;  1Z9C A;  1BR1 A;  2FQ4 A;  3E6C C;  1FNN A;  2HTJ A;  3VYS B;  1IXS B;  1FOX A;  1F36 A;  2DT6 A;  3C2H A;  5E79 C;  2Z16 A;  1ETQ A;  3AG2 H;  3W2A A;  3KPH A;  1NG7 A;  4ZDL A;  2OAZ A;  4U0V A;  1DU0 A;  2V9V A;  2ZJQ F;  1FIP A;  5C44 J;  3DWL E;  1S5L C;  4U87 A;  5E3N A;  1QVU A;  2IXS A;  3BTJ A;  2QSH X;  1HST A;  3DF8 A;  4KA4 A;  4BAY A;  3PIO F;  1K7A A;  4UXN A;  2E7X A;  1P4A A;  5IY5 H;  1WGX A;  1WH7 A;  1OJL A;  1SFK A;  5TIS C;  4D7M A;  2XSJ C;  2A61 A;  2VN2 A;  4I7H A;  4PJM A;  1R36 A;  1ZAR A;  3OOU A;  3GZN B;  4C3H J;  1X1D A;  1I1G A;  1KQ9 A;  3IV5 A;  1Q1V A;  3FM5 A;  2NRA C;  3Q0W A;  4RGS A;  5D4R A;  2COB A;  3JSO A;  1E3O C;  1FC3 A;  3DTK A;  2F5V A;  3I5U A;  4UVB A;  3C1D A;  1O57 A;  5CLS A;  2K3P A;  3S2W A;  3CP8 A;  2EV0 A;  5L3E A;  3JSP A;  2OQR A;  1QBJ A;  3MN2 A;  3TDU C;  1I27 A;  1Y39 A;  2ZFW A;  1K61 A;  4XN3 A;  2ZME C;  2VC1 A;  3QPH A;  2OCC H;  2FNA A;  1ZRF A;  3O8G A;  4XM3 A;  5BMZ A;  3H36 A;  3W3C A;  3CCY A;  2EFP A;  3OYJ A;  2FF4 A;  1N77 A;  2DQR A;  3OS2 A;  3LSG A;  5JR3 A;  2OD5 A;  4XSZ F;  4DYQ A;  1HXD A;  3F6V A;  1TWC J;  2E7W A;  4CCM A;  1KON A;  3L2Q A;  4KMF A;  1BJA A;  2DPU A;  4KT5 C;  1O7L A;  3I59 B;  5CVJ A;  5J40 A;  2XHK A;  2DOF A;  1EF4 A;  4M3G A;  2BY0 A;  2EFO A;  3G3Z A;  4R1H A;  4EM2 A;  3EDP A;  3C18 A;  3RQI A;  5L3C A;  1F5T A;  2XVC A;  4RGR A;  2CUZ A;  2MLG A;  3VSL A;  5CPR B;  5FLX Z;  3PIP F;  2MSY A;  1VQ6 I;  3ZQI A;  2ZJ2 A;  2O5R A;  2LY2 A;  2R5Z A;  3CC7 I;  4LIV A;  1W36 C;  2LMD A;  4HX8 A;  4PSW A;  4R79 A;  2Y0M A;  3PFI A;  1H88 C;  3FBN B;  3IL2 A;  3CDL A;  2GLO A;  3HOZ J;  2OQG A;  3MKL A;  2OA4 A;  5LEJ A;  1DP7 P;  1ZHF A;  5KK1 A;  1D1B A;  1ZR4 A;  3EUH C;  4KYW A;  2P5K A;  2P5V A;  3B6C A;  1W0T A;  2GWR A;  2ECC A;  2BHY A;  3IAM 2;  4H4K C;  1FZP B;  2Z1D A;  3K4J A;  3HYI A;  1YTY A;  3ZMV A;  1CF7 B;  2QSG X;  2RNG A;  4KDP A;  2CG4 A;  2D5V A;  2VUM J;  3QAH A;  1FSH A;  2UXN A;  4A6D A;  2LFB A;  2Y0S N;  1MJ9 A;  2L7F P;  4LIU A;  2CQN A;  2R7S A;  1TW2 A;  1DU6 A;  2MGQ A;  3V8L A;  2HPM A;  4PFP A;  4AC0 A;  2X6W A;  2QYO A;  5IT9 K;  1TWA J;  3ABL H;  3ZMZ A;  1VQ9 I;  4ZJZ A;  4HRI A;  4M6Y A;  4YII A;  3QPT A;  4A3M J;  2EV6 A;  2MFZ A;  2G7U A;  5BPI A;  3G4S I;  5ILS A;  1N78 A;  2XKP A;  4R8H A;  1HF0 A;  2EZK A;  4AIH A;  5JHF A;  4V2F A;  2IPQ X;  4ESJ A;  2O8K A;  5HS9 A;  1X4O A;  2MAB A;  4DIQ A;  2ISY A;  1G3S A;  4C2M J;  2IRF G;  1V5G A;  3MKZ A;  1TQP A;  3CJQ B;  2YX7 A;  2M2E A;  1GXP A;  2XRO A;  3KP2 A;  1IN6 A;  3ZQC A;  2K40 A;  4P9U A;  4CCJ A;  2K9Q A;  1K6Y A;  2BVL A;  4WK8 F;  1U9O A;  2Y2Z A;  2CYY A;  3FKJ A;  4B1R A;  4E7H A;  3BR2 A;  3I55 I;  3KP4 A;  1XC5 A;  3JW4 A;  4LIT A;  3HDD A;  3IP4 B;  1ZEL A;  4A5M A;  1J5Y A;  1EJ9 A;  3OS1 A;  3UKG A;  3NRV A;  5D6E A;  1S3J A;  3CF5 F;  5HLG A;  1B59 A;  2R0Q C;  1GHC A;  1RPW A;  4IRH A;  3SFZ A;  4NB5 A;  1GXQ A;  1Z6T A;  4E7Z A;  1UST A;  2ZXW H;  1NG6 A;  5FRN A;  3LWF A;  2DMQ A;  2BE5 F;  4XIC A;  2O61 A;  5E1W A;  3KZY A;  5GPC A;  2AQF A;  1BBY A;  3VDX A;  5LRS A;  1G6N A;  4A0X A;  2KMU A;  3FXO A;  2GA2 A;  3TQN A;  4ZZD A;  4HNV A;  1Z67 A;  1MBJ A;  3WU2 C;  2EZH A;  3BPX A;  2NVQ J;  2EIL H;  4Q5S F;  1A5J A;  4NBQ A;  1HA8 A;  1TWH J;  3LL7 A;  2HVQ A;  1TC3 C;  3DEU A;  4NQW A;  4F7Z A;  1Z05 A;  2ZNY A;  1YIO A;  3BR3 A;  2M87 A;  4B47 A;  2OU2 A;  4Y7N J;  1ZTR A;  5F1J A;  1BR2 A;  1Z21 A;  4BEH B;  3KEQ A;  1TLH B;  2JN6 A;  1SC7 A;  3VYR B;  3PSI A;  3LSP A;  2EZI A;  4XOT A;  1X4P A;  3GTG J;  4B3A A;  2Y48 A;  3RQ4 A;  3D0S A;  2ME0 A;  4MLO A;  1P7J A;  3VYU B;  3P9I A;  3E1S A;  4ZZL A;  3J81 K;  3GYH X;  4ZH4 F;  3F22 A;  3PUB A;  5EEA A;  4ENJ A;  5ICE A;  5ILU A;  5DM6 F;  2ZB9 A;  5EJC A;  3OYL A;  3D1N I;  2Z33 A;  1XS9 A;  2CQQ A;  2VOD A;  3MQ0 A;  1X3Z B;  3NEU A;  3AL0 C;  4U88 A;  2VBY A;  4HX4 A;  3L2C A;  3QYE A;  1KQ0 A;  2OCE A;  1E3H A;  2IGM A;  3DBL B;  4RDU A;  4CYC B;  4PJL A;  2UWM A;  1YFH A;  4AM3 A;  2H09 A;  1X3U A;  1YIJ I;  2WTE A;  2HQR A;  3FZV A;  5HLT A;  2ESN A;  4EVI A;  1E3P A;  1R4M B;  2VXZ A;  3EUA A;  1XSD A;  3LSR A;  5LHG A;  1LNW A;  3L09 A;  1KZH A;  1G3Y A;  3HKZ N;  2E2I J;  3CQZ J;  4HG2 A;  3DPL C;  1EV7 A;  3T1B A;  2VBX A;  4G7H F;  3KLO A;  2OV7 A;  2QUF A;  3MZ8 A;  4J00 A;  3KEY A;  3RKW A;  5FJ8 J;  2H27 A;  1EA3 A;  2LY9 A;  4BY7 J;  2L9V A;  2CUF A;  4CXF A;  1Z3Y A;  4JYK A;  4MIM A;  2K9S A;  2P5L C;  5CVR A;  3PNV A;  3R4K A;  3WU0 A;  4BKX A;  1B72 A;  3PO3 J;  2O6G E;  2O3F A;  1W7P A;  2KZG A;  3N97 A;  2BW3 A;  3ECH A;  2K02 A;  1IUY A;  5K7Z A;  2KRH A;  2Z3Y A;  4IHV A;  2YSR A;  5FKK A;  1IRF A;  2IA2 A;  4BEH A;  1R5G A;  2A5W A;  1XCB A;  2DFH A;  3LFU A;  3R0J A;  3KZI C;  4AID A;  1MBE A;  4FX4 A;  1BL0 A;  4XMY A;  1WCM J;  3ZMD A;  2DA7 A;  2LD5 A;  1BIA A;  3ZGK A;  1IF1 A;  1VQP I;  2KL4 A;  3BR6 A;  2PLY A;  1TL8 A;  1TTY A;  3W2W A;  3LAJ A;  2GIV A;  4HLY A;  1Q1H A;  1W4M A;  3C3W A;  1VQL I;  2NS7 A;  2Y75 A;  2LKP A;  1XSX A;  2NVY J;  2O0Y A;  1U5T C;  3U2R A;  4FE7 A;  3QRF F;  3A0H C;  1ETO A;  4KJZ A;  2HZD A;  4CYC A;  2GXB A;  1IAW A;  2A6E F;  4M74 A;  3ZMU A;  3DP7 A;  4HBL A;  2FBK A;  1NK2 P;  2WBM A;  4PSX A;  3D5R C;  1RUO A;  1YYV A;  4IVN A;  2WB1 N;  2WV1 A;  4JQF A;  3IH3 A;  5CVI A;  4A3G J;  3GTO J;  4X6A J;  5IOY A;  2E1M C;  4EQQ A;  3FXQ A;  1P7I A;  1QHG A;  2D2W A;  2JTV A;  2KZV A;  5FKN A;  4HNT A;  3VB2 A;  3L7W A;  4MTD A;  3P9K A;  1AWC A;  2LG4 A;  4FIS A;  3ZCO A;  2B63 J;  1KGS A;  1YS6 A;  3U21 A;  3V8J A;  3CLO A;  2HTS A;  4OAZ A;  2L54 A;  4WXH A;  3ELK A;  1WJ5 A;  4X0G A;  2WA0 A;  1WWX A;  2KKO A;  1M1E B;  3TKY A;  4JP0 A;  1LE8 B;  5BNG A;  2NOJ B;  2P7C B;  4AIK A;  3FBI B;  1AHD P;  3F21 A;  4HSR A;  4II3 A;  4I99 C;  2GA1 A;  2P4W A;  1B9M A;  1WJE A;  2P81 A;  1MMS A;  5KNL A;  1LFP A;  2B0L A;  3TBI A;  1IW7 F;  3PNT A;  2R7O A;  3V7R A;  3ABT A;  2X0L A;  2KP6 A;  2ACJ A;  5AIP A;  3B73 A;  2DPD A;  5K7H A;  5E17 F;  1SMT A;  2M4G A;  1OR7 C;  5F0H A;  5F64 A;  3IRQ A;  2DJI A;  2H6C A;  2XB0 X;  4XNF A;  4P5O A;  2M0M A;  2VJI A;  2R7V A;  3E6M A;  3SHF A;  1JKP C;  4L5I A;  9ANT A;  3NWT A;  4UV9 A;  4RLF A;  2FX0 A;  2R7T A;  2IS6 A;  3TOA A;  1QQI A;  4PUS A;  5F6F A;  4MHG A;  2WWY A;  1EKE A;  3RYP A;  3NAU A;  2D1H A;  4C9Y A;  4IOA F;  4UHT A;  2QA4 I;  2MW8 A;  1LFB A;  2E71 A;  1STZ A;  2QVO A;  3DKX A;  2LF8 A;  5CJ9 A;  2XPW A;  1O3R A;  1WZ2 A;  2FU4 A;  1WJD A;  2PBI A;  5FFX A;  3S3N A;  4C3I J;  4Y4R A;  5FKO A;  4FX0 A;  4XOP A;  5LGU A;  2L4A A;  2IBD A;  1U8R A;  2XKO A;  2AQE A;  2ICW G;  3HTS B;  2Q8K A;  2DT7 B;  4XLN F;  4MFE A;  1TT0 A;  1BOB A;  1Y8R B;  4E4H A;  5HDG A;  3E5X A;  2NVX J;  2VON A;  2JZY A;  4AYB N;  5F1R A;  3BWG A;  4M71 A;  2I5U A;  4E7I A;  1X1B A;  2QQ9 A;  3ML6 A;  4OIO F;  2WB1 A;  1IN7 A;  1PJR A;  3PL8 A;  1JE8 A;  2QGU A;  5JI6 A;  1P6R A;  4XBF A;  3GFI A;  2QBY B;  1RI7 A;  2X6Y A;  3M1C A;  1X2N A;  1MBH A;  5B1B H;  4BU2 A;  1SVM A;  2N8G A;  5J1Y A;  2ZME A;  1LJ9 A;  3CUQ B;  1HW5 A;  4RS8 A;  1LVA A;  2UV1 A;  1Y56 A;  4GYG A;  1UCR A;  1Y0N A;  5JHU A;  5EG0 B;  3I56 I;  1JGG A;  3FMR A;  3BG3 A;  2A6T A;  3S2D J;  3FMQ A;  2CU7 A;  3CDI A;  4BBR J;  1XMX A;  4RM3 A;  3A2K A;  3L2U A;  3F23 A;  1TQM A;  2F4I A;  5IT9 Z;  4DOZ A;  4L9T A;  3BR1 A;  1TBX A;  2KIM A;  4NC8 A;  2QZ8 A;  3OYI A;  1XMK A;  1RKW A;  3E6D A;  1JT0 A;  3DKW A;  3OSF A;  4LLG F;  1ETY A;  4XR6 A;  1OYI A;  4RGX A;  1IZ1 A;  1I50 J;  2ELJ A;  5J4Y A;  2FBI A;  2HDC A;  5TGT A;  2TCT A;  4V2G A;  1VND A;  2ZKZ A;  4PDK A;  3ZR8 X;  3KYL A;  2XAF A;  2FNP A;  2KIS A;  2E2H J;  1HCR A;  1Z6R A;  2X6X A;  3ABU A;  4GDF A;  3H5N A;  1X1C A;  2CFX A;  1SEU A;  3I4P A;  3OYB A;  2KJC A;  5ED4 A;  3S1M J;  1T98 A;  2M8G X;  4L0Y B;  3S15 J;  2DOA A;  2PEX A;  4QPO A;  3D5L A;  3HOU J;  2DA1 A;  4E70 A;  3EUH A;  1IJW C;  1G59 A;  1IO2 A;  1ULY A;  3HRM A;  3K4L A;  4XKV A;  1YIT I;  1K4S A;  2ELH A;  2VOO A;  3IKV A;  1V5E A;  2CH0 A;  2M3A A;  1S29 A;  1S8N A;  4HYE A;  4QPQ A;  3MAJ A;  2E5Z A;  2CV2 A;  1BN5 A;  4PZJ A;  1VTN C;  1O3T A;  3CCQ I;  1SVL A;  1TQI A;  4RAZ A;  3F0C A;  3RSN A;  5BOX A;  2RKH A;  4XLA A;  4RAF A;  4XKC A;  2BXY A;  2VT2 A;  3IH2 A;  3PM1 A;  4FHT A;  1RR7 A;  1IRX A;  5HDK A;  4RMN A;  2R7R A;  1LFU P;  4L18 B;  1WQ2 A;  4U7B A;  4JBA A;  4N4O B;  1T0F C;  1MH4 A;  3F8F A;  5EG0 A;  4HPQ A;  2IAI A;  3KLN A;  3HG9 A;  1FIA A;  5ILV A;  1T38 A;  3LA7 A;  3UNG C;  3W6V A;  4G12 A;  1JUS A;  3K4B A;  1CQT A;  5FKL A;  4G9Y A;  3EYI A;  3ASN H;  2WC2 A;  5E20 A;  2IP2 A;  3ZOB A;  1GV5 A;  4DYC A;  5HNH A;  2QEX I;  3DV8 A;  2LBF A;  1VZ0 A;  1PP8 F;  1MMD A;  4YFK F;  3OR2 C;  4XK4 A;  2L7Z A;  3J7Y J;  2DK8 A;  3ZP5 A;  2X51 A;  1XDS A;  2R7F A;  1UAA A;  1QZY A;  5M3F J;  4W97 A;  4WXD A;  5HS7 A;  3M3Y J;  3OYG A;  2STT A;  2PMZ N;  2R3S A;  3GZ6 A;  4E6K G;  4IKF A;  1IDY A;  2XPV A;  1D1A A;  4O6J A;  1U3E M;  2OUM A;  5DCF A;  5B5E C;  3C7J A;  1GVJ A;  2X1D A;  1BIB A;  5GP9 A;  2HXO A;  5LGT A;  2XGX A;  4DBR A;  2EK5 A;  3J81 Z;  1R58 A;  3EQL F;  2LOO A;  4P1W A;  2LKX A;  4D1Q A;  4HQE A;  1J2X A;  3VSK A;  2HKO A;  2WAQ N;  2X1C A;  3J7A Y;  2ZFU A;  4HF0 A;  1IV8 A;  4J19 A;  3HB9 A;  1VQ8 I;  1XGS A;  3S14 J;  2A3S A;  1G3T A;  1VF9 A;  2DI3 A;  4NC7 A;  3A01 A;  2F5D A;  3GTQ J;  3ZQG A;  3BDD A;  2HOE A;  1UHM A;  4M3F A;  3FIW A;  5EEG A;  2F6C A;  2XUB A;  4MFD A;  4BAC A;  4ENM A;  2PJR B;  2MYS A;  4BY1 J;  2VKE A;  4BUP A;  4HF1 A;  2IA1 A;  4I01 A;  3FX3 A;  2IJL A;  4F91 B;  3GTM J;  2D1V A;  2R5Z B;  2CW0 F;  2JUC A;  2EV5 A;  5HLH A;  4L9V A;  2CJJ A;  2O8X A;  1T33 A;  2ZSI B;  2K9L A;  2UUZ A;  1V54 H;  1FYM A;  1AKH A;  3SYT A;  3CMA I;  1MW7 A;  4S0H B;  2L9R A;  3OYH A;  1H89 C;  2QCO A;  2JSP A;  2FD5 A;  1SFO J;  2A07 F;  4UNO A;  2GAU A;  1ETX A;  4KIC A;  3F8B A;  3VFZ A;  3K7A J;  3CC2 I;  5E1X A;  4AU7 A;  5LRR A;  4MQV A;  5H6Q A;  4RBO A;  1GLN A;  5KAF C;  3MFK A;  2DTZ A;  5M5Y J;  2NNN A;  3OR1 C;  4RB0 A;  3SEZ A;  3QP5 A;  5LLQ A;  4G6Q A;  3HUG B;  2DTR A;  2KFD A;  4Z2Y A;  1FJL A;  2MC3 A;  4I76 A;  3CMM A;  3GFM A;  1IV6 A;  4H0E A;  1GDT A;  3OIP A;  1JKQ C;  1REP C;  2ID3 A;  2QKL B;  1S7E A;  2DA2 A;  3T5X A;  3HOX J;  1DPU A;  1YO5 C;  5M3M J;  1OPC A;  1DGW Y;  5BPD A;  4G8X A;  5H2F C;  3KE2 A;  4CCO A;  4AUX A;  5GAG J;  2E19 A;  3N05 A;  4XID A;  3OYA A;  3QYF A;  4DW6 A;  1ZH5 A;  2BGC A;  2E1C A;  2XPU A;  2ZO4 A;  3QU6 A;  2ISZ A;  4IO9 F;  2ECB A;  3EUK L;  3X2Q H;  2DBB A;  2PJR A;  2JVG A;  2FXA A;  3IAS 2;  2BV6 A;  2K3F A;  2PMZ A;  2OF7 A;  1YRN A;  4YEJ A;  2HYJ A;  1OCZ H;  4DBQ A;  3FHN A;  5ICC A;  3CCU I;  2P6S A;  2DFE A;  3KIO A;  2CRG A;  3PFY A;  2G9W A;  1YX3 A;  2GQQ A;  5LD2 C;  4KIF A;  2DOD A;  4BJ5 C;  1Z0X A;  1HSJ A;  3KP3 A;  4U0Y A;  2LH9 A;  2WAQ A;  3ERE D;  3RKQ A;  1MBG A;  1SAU A;  2RC4 A;  3HSF A;  1WSU A;  2JA8 J;  1ZAO A;  2VPL A;  3R61 A;  4BQO A;  3FXM A;  2L4M A;  1TP4 A;  2VB6 A;  2XAH A;  3DXJ F;  1SAN A;  3GTL J;  3K4C A;  2X85 A;  5J8F A;  2XRL A;  1IDZ A;  3ABK H;  1X3W B;  2DA3 A;  5H6R A;  5C4X J;  3HUG A;  3Q9S A;  1HDP A;  4M9S A;  2AO9 A;  3K9T A;  4KN7 X;  3K10 A;  1NTC A;  1D0X A;  3BR0 A;  3S32 A;  1MNM C;  3ZMS A;  3VOD A;  4OAY A;  3RPQ A;  3AFH A;  2LF7 A;  4NQW B;  4AWX B;  2WAE A;  3WTS C;  1EH7 A;  3BRO A;  3LOC A;  2ELK A;  4M6V A;  1E0E A;  1IXC A;  4KNY A;  5C3E J;  2F48 A;  4A5N A;  1U5T A;  2V6C A;  1RC9 A;  3GUD A;  4DJA A;  1FP1 D;  1OCP A;  3BP8 A;  2K27 A; 
#chains in the Genus database with same CATH homology
 3K0L A;  1ZYR F;  2O03 A;  1ODD A;  2K7L A;  2VBZ A;  3RKY A;  4ZYD A;  2HYG D;  4LMY A;  2Q2E A;  3JTH A;  4XLP F;  4HAM A;  2EA4 A;  4EMS A;  4I09 A;  1SD7 A;  1ON1 A;  4IXA A;  4EJU A;  1SAX A;  3KP6 A;  3M7G A;  4LGW A;  4GYI A;  1T39 A;  4M73 A;  2Z9O A;  5DYM A;  2DW4 A;  4RB2 C;  2MA3 A;  1HKT A;  3GXO A;  4MNU A;  1S6L A;  3JAM K;  1QNT A;  1BI3 A;  1OR7 A;  1UHW A;  1FBQ A;  4LJZ F;  2XRN A;  4HV5 A;  1W7P B;  1FP2 A;  2NYX A;  4M6X A;  1LEB A;  1KU3 A;  3Q9V A;  2GZW A;  2GXG A;  5E8G A;  4B09 A;  4BH9 A;  3IC7 A;  4EGY A;  1BI2 A;  4LD5 A;  1KYW A;  1W7P D;  4LK1 F;  5FO5 A;  1MDM A;  4GGG A;  5L3D A;  2RN7 A;  1XGM A;  5L3G A;  5HOO A;  3L9F A;  4S04 A;  5LGN A;  4L5J A;  2K4B A;  1F1Z A;  2M45 A;  1Z91 A;  5JFR A;  2STW A;  3RKX A;  4OIP F;  4BHB A;  4G7O F;  4IF4 A;  1Z1D A;  1OKR A;  1FBS A;  4IPA A;  1ZN2 A;  2W57 A;  3F6O A;  1DUX C;  4A2U A;  2EWN A;  4BHP A;  1MGT A;  3RYR A;  1XDU A;  3NQO A;  3U1D A;  1Y0U A;  5D8L B;  3LQR A;  5D5X B;  1DDN A;  4MEY F;  4BXU A;  4UVA A;  4UVC A;  3JTG A;  2L02 A;  5H20 A;  1MKM A;  2V1D A;  3R60 A;  4P96 A;  2ETH A;  1RZ4 A;  4HF2 A;  3O2P E;  2P7V B;  5DD8 A;  1H9G A;  4RAY A;  2PMH A;  3BJ6 A;  1YG2 A;  2TDX A;  2MD5 A;  1IN8 A;  1XGO A;  2M5W A;  3P9C A;  4ENK A;  1BC8 C;  4HDU A;  5K5O A;  4U0W A;  3FF5 A;  2ZCW A;  3T0Y A;  1P2F A;  1YQA A;  1LDK B;  1H0M A;  3MEX A;  3RTR A;  5K1Y A;  3O3K A;  4M9Z A;  1D8J A;  5LHH A;  3FWE A;  2DU9 A;  3I64 A;  3M8F A;  2H6B A;  1HBX G;  2RQP A;  4O5V A;  2XV4 S;  5D8K B;  4MEX F;  1L0O C;  2A68 F;  3PQJ A;  3WG9 A;  2Z99 A;  1T0F A;  5L3F A;  2PQ8 A;  4JK1 X;  1CGP A;  5A2Q K;  1LB2 A;  3SZP A;  4WX9 A;  2EFQ A;  1B1B A;  4HZF A;  5BS6 A;  2RNJ A;  5TRD A;  3WGH A;  2OZ6 A;  2FML A;  3HTU A;  1HQC A;  3EET A;  3ZN1 A;  2ZME B;  3CO7 C;  4IRI A;  5L3B A;  2VBW A;  2YR2 A;  2F5C A;  1RIO H;  1MJA A;  3QU3 A;  3GLX A;  1UFM A;  2HFH A;  2MLK A;  3HIF A;  3WTT C;  5D5V B;  5FFZ A;  4KIB A;  2MBF A;  3K1N A;  5DEQ A;  2RGV A;  3WTV C;  5E8I A;  2KRF A;  4IRG A;  3RIR A;  3K1M A;  4D0P A;  1JHF A;  3RPU A;  2NS0 A;  3VOE A;  3RDI A;  1K6O A;  2PI0 A;  4OIR F;  3T8R A;  3F8M A;  1FSE A;  2FEZ A;  4OU0 A;  1P4X A;  5BQT A;  2YPR A;  4XRF A;  3CTA A;  4DQ2 A;  5ICF A;  3TO9 A;  3BY6 A;  2OBP A;  2FMY A;  4EJW A;  2K4J A;  2HZT A;  4HX7 A;  4UUV A;  3ISP A;  2V1X A;  1PDN C;  4N9I A;  3U9G A;  4LK0 F;  5ERI A;  3LAP A;  2P6T A;  2AXL A;  3GEZ A;  3HSE A;  1ZGJ A;  4PGG A;  1G3W A;  3TGN A;  4LFU A;  1AOY A;  3WTU C;  3TO6 A;  2W24 A;  4WWC A;  2RDP A;  1KU2 A;  3ROU A;  1XCV A;  1D5V A;  2PMU A;  2CO5 A;  1S7A A;  3QP6 A;  5FD5 A;  1KU9 A;  1NHA A;  4GXO A;  1W5T A;  4KIG A;  3F72 A;  5D5U B;  3WU1 B;  4CGZ A;  2XAQ A;  3COA C;  3BJO A;  2Z5U A;  3LQQ A;  5DCM B;  1SFU A;  1WKM A;  4HLX A;  2W84 A;  1R5H A;  3M9A A;  1ON2 A;  1FPQ A;  3I71 A;  4YIF A;  3B02 A;  3JAM Z;  5AON A;  5EEH A;  1H9T A;  3ULQ B;  1KQ8 A;  2DLL A;  1MJB A;  4UV8 A;  1J7K A;  2FQ3 A;  4BQA A;  2DT5 A;  1UB9 A;  1F4K A;  1FOK A;  1KA8 A;  1OMI A;  4CO8 A;  4PCQ A;  1I1S A;  2P8T A;  2JSC A;  3LA2 A;  3ZMT A;  2D45 A;  4RGU A;  2FOK A;  1XD7 A;  2DO7 A;  3BOQ A;  2NNY A;  1J75 A;  4AD9 A;  1SD6 A;  3WTX C;  1J0R A;  2HWV A;  2FBH A;  4M72 A;  3KZZ A;  1QZZ A;  3FHZ A;  4Y13 A;  3WOD F;  5TJJ A;  4O3M A;  5DCM A;  2CGP A;  1JXS A;  2M8E A;  1FBU A;  1YW7 A;  2FSW A;  4Q47 A;  3O6B B;  5HLI A;  3HRU A;  5LEK A;  5CVV A;  5K5R A;  1FYL A;  3TOB A;  4K2E A;  1U6G A;  5D6F A;  1SFX A;  2IA0 A;  1R1U A;  3H92 A;  5CVU A;  3WE3 A;  1USS A;  3G73 A;  2KIF A;  1IN4 A;  4G6D A;  4GO1 A;  4I0B A;  1ZG1 A;  2Q0O A;  4U7D A;  1XMA A;  1K78 A;  2ADU A;  1E2X A;  3GO5 A;  2HEO A;  1U5T B;  3PQK A;  4I2O A;  3CO6 C;  3RJP A;  4EJV A;  1QO0 D;  1F9N A;  1QPM A;  3F8C A;  4ZYG A;  4P55 A;  4YFN F;  4A0Z A;  3KET A;  4CDG A;  4LG0 A;  1LDJ A;  3R6S A;  1LQ1 A;  4IJA A;  5HDN A;  4OOI A;  4BNC A;  1PUE E;  4WXC A;  3F3X A;  2L3D A;  4MQ9 F;  4LB5 A;  2HS5 A;  3GFL A;  1MD0 A;  1Z7U A;  1XSV A;  1MZB A;  1XN7 A;  2QQB A;  1RUN A;  4EJO A;  3BZ6 A;  3IHU A;  1I5Z A;  4OMY A;  4EJT A;  3GFJ A;  5A2Q Z;  2OZU A;  2IT0 A;  2BBY A;  1FT9 A;  2HYF A;  5E1Z B;  1BC7 C;  1YW8 A;  4HA8 A;  4BYY A;  1J9I A;  3OOP A;  3WTY C;  4WCG A;  4B8X A;  3V7S A;  1KYZ A;  3KFW X;  3V4G A;  1SMY F;  5J6X A;  3J80 K;  1P4W A;  2IVM A;  2LNB A;  3CUQ C;  3AAF A;  3ZN0 A;  4EGZ A;  4ASN A;  1MDM B;  3OV8 A;  1TNS A;  1SFE A;  2E1N A;  2QWW A;  1KU7 A;  1PP7 U;  5KVR A;  2MH9 A;  3TDZ C;  4I02 A;  4XSX F;  3E97 A;  4KFC A;  5FGM A;  3I59 A;  1U78 A;  3TO7 A;  4FT8 A;  2YX4 A;  3I54 A;  4ZYH A;  1LEA A;  5D4S A;  1BI0 A;  2BEO A;  4HOB A;  4I98 B;  4EM0 B;  2JPC A;  1LDD A;  1ZLJ A;  3HRT A;  2VT3 A;  3J7A O;  2R7D A;  2H94 A;  1EH8 A;  3VEP A;  5FB2 A;  4LLN A;  1R1V A;  2J5P A;  3GWZ A;  4A6E A;  1CF7 A;  1D8K A;  5DD4 A;  2F5F A;  1V3F A;  2MH2 A;  2FRH A;  1QGP A;  2A5Y B;  4CYD A;  4Q4Z F;  2PN6 A;  2EB7 A;  4CZZ A;  2ESH A;  5IT3 A;  4G7Z F;  1EH6 A;  3MCZ A;  5HS8 A;  3DQV C;  3P7N A;  2W25 A;  2XAJ A;  1ZG5 A;  3HSR A;  2HQN A;  1OYY A;  3LA3 A;  2CQK A;  1ZRD A;  4IHT A;  1BM9 A;  1JHH A;  3HOS A;  5DV5 A;  2HGC A;  3M1E A;  3KEO A;  1ONV A;  3GZ5 A;  1FWZ A;  1HKS A;  3IWZ A;  3V8K A;  2YU3 A;  4EV0 A;  2DFI A;  1WRJ A;  3IKT A;  2ZXJ A;  4BHC A;  4YG2 F;  1FLI A;  3HOT A;  3MZY A;  1C0W A;  4PGH A;  2QM3 A;  3BJA A;  3DPT A;  2QQA A;  1ZG3 A;  3EYY A;  3GVA A;  2ZNZ A;  5J8C A;  2X4H A;  3FM3 A;  1TW3 A;  4L9J A;  2DK5 A;  2M1B A;  2F2E A;  2EA2 A;  3GX4 X;  2G7H A;  1B6A A;  1DPR A;  1HW1 A;  1R00 A;  1U2W A;  4RB1 A;  3M8E A;  4A12 A;  3WE2 A;  3L00 A;  1HW2 A;  2VE8 A;  3WGG A;  2RVC A;  2UXX A;  4MGR A;  4OIN F;  3Q5F A;  3W6J B;  3I0T A;  3LFK A;  2BYV E;  5HVQ C;  3K69 A;  1BI1 A;  4AIJ A;  4NHJ A;  1YLF A;  2PJP A;  3I53 A;  2EJR A;  4LLL A;  3E5U A;  3V7C A;  5K5Q A;  2LSO A;  1B9N A;  2C6Y A;  4M9X A;  3SXY A;  5LHI A;  2JRT A;  2M30 A;  4EM1 A;  2AS5 F;  3F8N A;  5FLX K;  3DFG A;  1W5S A;  4G94 A;  2XAS A;  3GW2 A;  3IRR A;  1V4R A;  2W85 A;  4OIQ F;  3RI4 A;  1T2K A;  2V1U A;  4A0Y A;  1FYK A;  1RNL A;  4ON0 A;  4ZYE A;  2JT1 A;  2KJB A;  4KN4 X;  4Q48 A;  2QLZ A;  3W6K B;  2L01 A;  6PAX A;  1HKQ A;  1R1T A;  3I58 A;  3E6B A;  1ZLK A;  3CUO A;  4ETS A;  4HDV A;  4HQM A;  2ZBK A;  1TNT A;  4L9N A;  5DUI A;  4L0Z B;  2UZK A;  1O3S A;  3SZT A;  4RB3 C;  3CJN A;  3K2Z A;  1L3L A;  4HW0 A;  3H3Z A;  4ESF A;  1J59 A;  4P9F A;  3FXU A;  2LDU A;  4KMU X;  2F5E A;  1K79 A;  5DUK A;  3E3V A;  2A69 F;  2RV8 A;  5E18 F;  3SQN A;  5AIQ A;  2HR3 A;  3ZPL A;  2DAO A;  3MZH A;  3WTZ A;  1OYW A;  2EFW A;  4QLC U;  1YW9 A;  3CDH A;  4N9H A;  2XIG A;  3HRS A;  1A04 A;  4Y15 A;  2VC0 A;  2DQL A;  5DDG A;  3WGI A;  2K86 A;  1S7O A;  4ESB A;  4OMZ A;  3HHG A;  2VOP A;  4Y17 A;  4CHU A;  4S05 A;  2CSO A;  3E5Q A;  5JVT A;  1T6S A;  4LB6 B;  1IXR C;  4MTE A;  1R23 A;  3LST A;  3HHH A;  2EFN A;  1SD4 A;  3QOP A;  3GF2 A;  4GCV A;  1B4A A;  1XB4 A;  3J80 Z;  3BPV A;  4CIC A;  1FX7 A;  2WV0 A;  2PG4 A;  1P92 A;  1G4D A;  4KUM A;  1JGS A;  2HKX A;  1E17 A;  3ECO A;  4ENN A;  3KP7 A;  5ICG A;  1IN5 A;  2IW5 A;  5LBQ A;  1ZGA A;  1ZRC A;  3FMS A;  3IWF A;  5FD6 A;  1R22 A;  4DNC A;  1FY7 A;  3FXR A;  3H3U A;  1XGN A;  3ZQ7 A;  1ZRE A;  3WTW C;  2CWE A;  4HV6 A;  1D3Y A;  3T8T A;  4IHS A;  5D5W B;  2KIU A;  2QBY A;  4N0B A;  3KCC A;  2FE3 A;  3CUQ A;  1O3Q A;  4WF2 A;  2COM A;  2QEN A;  4YFX F;  2A6H F;  2JPB A;  3REO A;  3R0A A;  1YS7 A;  4TV7 A;  3N4M A;  3KP5 A;  1I6X A;  2VE9 A;  1K78 B;  2NAZ A;  2PFB A;  4I0A A;  1SD5 A;  5CYV A;  2V79 A;  1R7J A;  4QWQ A;  1BOA A;  2FA5 A;  1WI9 A;  3K1P A;  2J5O A;  2XAG A;  4AVP A;  3MWM A;  1IRG A;  1O7F A;  4LG0 B;  1Z9C A;  3E6C C;  1FNN A;  2HTJ A;  1IXS B;  2OAZ A;  4U0V A;  2V9V A;  1HST A;  3DF8 A;  4KA4 A;  4BAY A;  1K7A A;  4UXN A;  2E7X A;  1P4A A;  2A61 A;  2VN2 A;  4I7H A;  1R36 A;  1ZAR A;  1I1G A;  1KQ9 A;  3FM5 A;  2NRA C;  4RGS A;  5D4R A;  3JSO A;  1FC3 A;  3I5U A;  4UVB A;  3C1D A;  1O57 A;  5CLS A;  3S2W A;  2EV0 A;  5L3E A;  3JSP A;  2OQR A;  1QBJ A;  3TDU C;  1I27 A;  2ZFW A;  2VC1 A;  3QPH A;  2FNA A;  1ZRF A;  5BMZ A;  2EFP A;  2FF4 A;  2DQR A;  5JR3 A;  2OD5 A;  4XSZ F;  1HXD A;  3F6V A;  2E7W A;  4KMF A;  1BJA A;  2DPU A;  4KT5 C;  1O7L A;  3I59 B;  5CVJ A;  2XHK A;  2EFO A;  3G3Z A;  4R1H A;  4EM2 A;  3EDP A;  3C18 A;  1F5T A;  5L3C A;  2XVC A;  4RGR A;  2MLG A;  5FLX Z;  2ZJ2 A;  4HX8 A;  4R79 A;  2Y0M A;  3PFI A;  3IL2 A;  2OQG A;  2OA4 A;  5LEJ A;  1DP7 P;  1ZHF A;  5KK1 A;  4KYW A;  2P5K A;  2P5V A;  2GWR A;  1FZP B;  1YTY A;  3HYI A;  3ZMV A;  1CF7 B;  4KDP A;  2CG4 A;  3QAH A;  1FSH A;  2UXN A;  4A6D A;  1MJ9 A;  1TW2 A;  3V8L A;  2QYO A;  5IT9 K;  3ZMZ A;  4M6Y A;  4YII A;  3QPT A;  2EV6 A;  2G7U A;  5BPI A;  5ILS A;  2XKP A;  4R8H A;  4AIH A;  2IPQ X;  4ESJ A;  5HS9 A;  2ISY A;  1G3S A;  2IRF G;  1TQP A;  2YX7 A;  1GXP A;  2XRO A;  3KP2 A;  1IN6 A;  4P9U A;  4WK8 F;  2CYY A;  3KP4 A;  3JW4 A;  4A5M A;  1J5Y A;  3NRV A;  5D6E A;  1S3J A;  5HLG A;  1B59 A;  1GHC A;  4IRH A;  3SFZ A;  4NB5 A;  1GXQ A;  1Z6T A;  1UST A;  3LWF A;  2BE5 F;  2O61 A;  5E1W A;  3KZY A;  1BBY A;  5LRS A;  1G6N A;  4A0X A;  2GA2 A;  3TQN A;  4ZZD A;  3BPX A;  4Q5S F;  3DEU A;  4NQW A;  4F7Z A;  1Z05 A;  2ZNY A;  1YIO A;  2M87 A;  2OU2 A;  3KEQ A;  1TLH B;  2Y48 A;  3D0S A;  3P9I A;  3J81 K;  4ZZL A;  3GYH X;  3F22 A;  4ZH4 F;  4ENJ A;  5ICE A;  5ILU A;  2Z33 A;  2VOD A;  3MQ0 A;  3NEU A;  4U88 A;  2VBY A;  4HX4 A;  3L2C A;  1KQ0 A;  2UWM A;  1YFH A;  2H09 A;  1X3U A;  2WTE A;  2HQR A;  3FZV A;  2ESN A;  4EVI A;  2VXZ A;  1XSD A;  5LHG A;  1LNW A;  3L09 A;  1G3Y A;  3DPL C;  1EV7 A;  3T1B A;  2VBX A;  4G7H F;  3KLO A;  2QUF A;  3RKW A;  2H27 A;  4CXF A;  2P5L C;  5CVR A;  3R4K A;  3WU0 A;  2O6G E;  2O3F A;  1W7P A;  3N97 A;  3ECH A;  2K02 A;  1IUY A;  2Z3Y A;  2YSR A;  1IRF A;  2IA2 A;  1R5G A;  1XCB A;  3R0J A;  4FX4 A;  3ZMD A;  1BIA A;  1IF1 A;  2PLY A;  1TTY A;  3LAJ A;  2GIV A;  4HLY A;  1Q1H A;  1W4M A;  3C3W A;  2Y75 A;  2LKP A;  1XSX A;  2O0Y A;  1U5T C;  3U2R A;  3QRF F;  2GXB A;  1IAW A;  2A6E F;  4M74 A;  3ZMU A;  3DP7 A;  4HBL A;  2FBK A;  1RUO A;  1YYV A;  4IVN A;  4JQF A;  5CVI A;  4EQQ A;  3FXQ A;  2D2W A;  2JTV A;  3VB2 A;  3L7W A;  4MTD A;  3P9K A;  1AWC A;  1KGS A;  1YS6 A;  3V8J A;  3CLO A;  2HTS A;  2L54 A;  4WXH A;  3ELK A;  2KKO A;  1WWX A;  3TKY A;  2P7C B;  4AIK A;  3F21 A;  2GA1 A;  2P4W A;  1B9M A;  2B0L A;  1IW7 F;  3V7R A;  3ABT A;  2X0L A;  2ACJ A;  5AIP A;  3B73 A;  2DPD A;  5E17 F;  1SMT A;  5F64 A;  3IRQ A;  2H6C A;  4P5O A;  3E6M A;  3SHF A;  4L5I A;  4UV9 A;  3TOA A;  1QQI A;  5F6F A;  4MHG A;  2WWY A;  3RYP A;  2D1H A;  4UHT A;  1O3R A;  1STZ A;  2QVO A;  2LF8 A;  5CJ9 A;  2FU4 A;  2PBI A;  5FFX A;  4FX0 A;  5LGU A;  2L4A A;  1U8R A;  2XKO A;  3HTS B;  2Q8K A;  4XLN F;  5HDG A;  3E5X A;  2VON A;  2JZY A;  5F1R A;  3BWG A;  4M71 A;  2QQ9 A;  3ML6 A;  4OIO F;  1JE8 A;  1IN7 A;  5JI6 A;  1P6R A;  4XBF A;  3GFI A;  2QBY B;  1RI7 A;  2ZME A;  1LJ9 A;  3CUQ B;  1HW5 A;  4RS8 A;  1LVA A;  4GYG A;  1UCR A;  5JHU A;  3FMR A;  3FMQ A;  3F23 A;  1TQM A;  5IT9 Z;  4L9T A;  1TBX A;  2KIM A;  2QZ8 A;  1XMK A;  3E6D A;  3DKW A;  4LLG F;  1OYI A;  4RGX A;  1IZ1 A;  2FBI A;  2HDC A;  2ZKZ A;  4PDK A;  2XAF A;  2FNP A;  1Z6R A;  3ABU A;  2CFX A;  3I4P A;  2KJC A;  5ED4 A;  1T98 A;  4L0Y B;  2PEX A;  3D5L A;  4E70 A;  3EUH A;  1ULY A;  3HRM A;  2ELH A;  2VOO A;  3IKV A;  1S29 A;  1S8N A;  4HYE A;  3MAJ A;  1BN5 A;  4PZJ A;  1VTN C;  1O3T A;  1TQI A;  4RAZ A;  5BOX A;  2RKH A;  2VT2 A;  4FHT A;  5HDK A;  4L18 B;  1WQ2 A;  4U7B A;  4JBA A;  3F8F A;  3KLN A;  1T38 A;  5ILV A;  3LA7 A;  4G9Y A;  3EYI A;  2WC2 A;  5E20 A;  2IP2 A;  3DV8 A;  1PP8 F;  4YFK F;  2DK8 A;  3ZP5 A;  1XDS A;  2R7F A;  1QZY A;  4WXD A;  5HS7 A;  2STT A;  2R3S A;  3GZ6 A;  4O6J A;  1U3E M;  5DCF A;  3C7J A;  1GVJ A;  1BIB A;  5LGT A;  2XGX A;  2EK5 A;  3J81 Z;  1R58 A;  3EQL F;  4HQE A;  1J2X A;  2HKO A;  4HF0 A;  1XGS A;  2A3S A;  1G3T A;  2DI3 A;  2F5D A;  3BDD A;  2HOE A;  1UHM A;  5EEG A;  2XUB A;  4ENM A;  4HF1 A;  2IA1 A;  4I01 A;  3FX3 A;  2IJL A;  2D1V A;  2CW0 F;  2EV5 A;  5HLH A;  4L9V A;  2O8X A;  1FYM A;  2A07 F;  4UNO A;  2GAU A;  4KIC A;  3F8B A;  3VFZ A;  5E1X A;  5LRR A;  4MQV A;  5H6Q A;  3MFK A;  2NNN A;  4RB0 A;  5LLQ A;  3QP5 A;  4G6Q A;  2DTR A;  4Z2Y A;  2MC3 A;  3GFM A;  4H0E A;  1REP C;  3T5X A;  1DPU A;  1YO5 C;  1OPC A;  5BPD A;  4G8X A;  3KE2 A;  1ZH5 A;  2BGC A;  2E1C A;  2ZO4 A;  3QU6 A;  2ISZ A;  2DBB A;  2FXA A;  2BV6 A;  5ICC A;  2P6S A;  2G9W A;  2GQQ A;  4KIF A;  1HSJ A;  3KP3 A;  4U0Y A;  3ERE D;  2RC4 A;  3HSF A;  1WSU A;  1ZAO A;  3R61 A;  2L4M A;  2XAH A;  3DXJ F;  5J8F A;  5H6R A;  3HUG A;  3Q9S A;  4M9S A;  3K9T A;  4KN7 X;  3ZMS A;  3VOD A;  3RPQ A;  2LF7 A;  4AWX B;  3WTS C;  1EH7 A;  3BRO A;  1IXC A;  4KNY A;  4A5N A;  1U5T A;  2V6C A;  3GUD A;  1FP1 D;  3BP8 A;  2K27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...