2GXGA

Crystal structure of emrr homolog from hyperthermophilic archaea sulfolobus tokodaii strain7
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
140
structure length
140
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal structure of archaeal homolog of multi drug resistance repressor protein, EmrR, from hyperthermophilic archaea Sulfolobus tokodaii strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 58
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gxgA00
3LAPA 3JTGA 4HF2A 2A5YB 3C1DA 3SFZA 4KN7X 3W6KB 1BC7C 3KFWX 1YS7A 3TDUC 3NRVA 1I27A 1O3QA 2CQKA 3J80Z 4UXNA 4KMFA 5CVVA 3LA3A 4BHCA 2JPBA 1J75A 1ZARA 3DV8A 3RPQA 4IJAA 2H6CA 1R00A 4N0BA 1O3RA 3KZYA 4EV0A 3WTVC 4ZYHA 5DCMB 1HKTA 2CG4A 4G8XA 4AIKA 1MZBA 3MCZA 4AIHA 4LD5A 1ZG1A 4HOBA 2D1VA 3L7WA 5CYVA 4KMUX 4CXFA 1KA8A 4M74A 3RTRA 2H27A 1YW7A 2O8XA 3DF8A 4A6DA 4N9HA 3TO6A 1IXRC 2C6YA 5J8CA 4ESJA 3WGHA 1MJ9A 4ENNA 2ZNZA 1LEBA 1YW8A 4GGGA 5L3FA 1OYIA 5H6QA 2HKXA 2WWYA 3R60A 3FMRA 4YIFA 4HQEA 1HBXG 5BMZA 3WTTC 1SD6A 4JBAA 2PMUA 1TQIA 4A5NA 1SAXA 1H0MA 1UCRA 2FXAA 4FHTA 1S29A 5IT3A 2X0LA 5DDGA 1NHAA 1JE8A 3RKWA 1EH6A 1J59A 4GCVA 4D0PA 2BE5F 3JTHA 3V8JA 1LQ1A 2ZCWA 2HZTA 1Z1DA 2VE8A 2JT1A 3KEQA 3K2ZA 2NNYA 5JVTA 4CHUA 3LA2A 5ILUA 2A6HF 4N9IA 4RB1A 2XVCA 1BOAA 3H3UA 1DUXC 2YSRA 3IWZA 1ZN2A 4KDPA 1LNWA 2XKOA 3WG9A 3MZYA 1W7PA 2AS5F 5LRSA 1WSUA 1LJ9A 4NB5A 4WCGA 2W25A 3RYPA 3BROA 2FMLA 3O3KA 1J2XA 4EM0B 3GUDA 3HRTA 1FT9A 1IF1A 3E3VA 3TKYA 2HTJA 2NRAC 3GFMA 3P9KA 2VT2A 3L2CA 4KNYA 3G73A 2IA0A 2OQGA 3QU3A 4BYYA 1SMYF 3HUGA 3LQQA 2DQLA 3F72A 3ABTA 3WTWC 1JHHA 1I1GA 1XB4A 3TO9A 5E1XA 1T98A 4PCQA 2LKPA 4KT5C 5H6RA 4EJOA 3P9IA 3WODF 3F22A 3WE3A 2VT3A 3GW2A 5E18F 3GLXA 5CLSA 1S7AA 4EQQA 2HQNA 5CVJA 1BC8C 4EJWA 2DO7A 1ZYRF 2MD5A 4UHTA 3M8FA 1XMKA 2CO5A 4WXHA 6PAXA 1U2WA 3LQRA 3M8EA 4ZZLA 3N97A 1BIAA 2XAJA 1FOKA 2J5OA 5DCFA 1HW2A 3QAHA 2W85A 2EV0A 5ILVA 3F23A 3GFIA 3RJPA 5FFXA 1PDNC 2ESHA 5D6EA 1YFHA 4R79A 2RC4A 3RI4A 3M7GA 1DP7P 2D1HA 2EV5A 3ULQB 3BJ6A 3HTUA 3ZMUA 3CUOA 1B59A 2OA4A 3W6JB 1ZAOA 2XIGA 3N4MA 3FHZA 4HX4A 4BQAA 1KU3A 2E1NA 3H3ZA 2IP2A 1R58A 5LBQA 3E5XA 4FX4A 2OAZA 3FWEA 4LG0A 1DDNA 1QNTA 4P5OA 5HDGA 2DTRA 4HDVA 2QWWA 4EGZA 5DUKA 2FQ3A 4P9FA 3ABUA 3TGNA 2HR3A 3I64A 3R61A 2O61A 4HV5A 4RAZA 4HF1A 1O3SA 1H9TA 1JGSA 3BPVA 2UWMA 3KZZA 5AIPA 2HDCA 1U5TA 4EM1A 1C0WA 4IHTA 3R6SA 1U78A 4L0YB 5L3GA 2A69F 2L02A 4DNCA 2FMYA 1TNTA 2F5FA 4Y15A 5LGUA 3IC7A 4XRFA 4M73A 1QZYA 4HLYA 2L54A 2IW5A 5K1YA 4XLNF 2J5PA 2XAQA 1ULYA 3ML6A 3FMSA 1FPQA 5IT9K 5CJ9A 4M9XA 2VC1A 4LLLA 3K69A 3K1MA 1QBJA 4MGRA 3BJAA 1R22A 1R36A 2ESNA 4RGRA 2AXLA 4EGYA 2FNPA 4I09A 1UB9A 2D45A 2R7DA 3R0AA 1EH7A 2M45A 1BI2A 4CICA 2P5VA 1CF7B 2JRTA 1ZG3A 2UXNA 3U1DA 3ISPA 2IJLA 4OINF 3KP4A 3ZQ7A 2MH2A 1B1BA 1K78B 1Y0UA 4PGHA 1KQ0A 2F2EA 2Z9OA 3IKVA 4S04A 1LEAA 2DQRA 2FRHA 4U0VA 3JSOA 4I01A 1P2FA 2E7WA 3BPXA 3TOAA 1Z05A 3Q9VA 4BXUA 2JZYA 2K86A 1MJAA 2HWVA 5BPIA 3WTSC 1G3WA 1IZ1A 3K1NA 2JTVA 3CDHA 1XSXA 5L3CA 4WF2A 3HHGA 4UVCA 5JI6A 2XV4S 2V9VA 3FF5A 3U9GA 3I71A 2G7HA 3G3ZA 2YR2A 2ZFWA 1R1VA 3HSRA 4L18B 1HQCA 2VODA 3EQLF 2EFWA 3HRMA 4EJUA 1ZG5A 2MH9A 2EJRA 1ONVA 2QM3A 3I5UA 2QENA 2DT5A 3TQNA 2FNAA 1XCVA 1MKMA 4EM2A 2GZWA 5L3EA 1PP8F 1HSJA 1W4MA 1O7LA 4I02A 4LLGF 4ZYEA 4NQWA 2FBIA 3K9TA 4M71A 5JR3A 3V4GA 5IT9Z 5FFZA 4R1HA 2M8EA 3HYIA 3GXOA 1O7FA 1XD7A 1T6SA 5HS7A 3GZ5A 3F8MA 2WC2A 2PQ8A 2M5WA 5E17F 4DQ2A 1BI1A 1B6AA 1V3FA 5E8IA 4RGSA 3TDZC 1GXPA 3L9FA 2M87A 1GVJA 4ZZDA 4I0BA 5L3BA 4AWXB 2M1BA 4S05A 1OMIA 4OU0A 2TDXA 3T1BA 4ZH4F 2O0YA 4RB0A 4LGWA 2F5DA 2ZKZA 1X3UA 2LDUA 1OR7A 2DW4A 4F7ZA 2FBHA 4L5IA 3ERED 4MEXF 3IHUA 1FYKA 1OPCA 2QYOA 3O2PE 3BOQA 3GX4X 3D5LA 1ZREA 3E5UA 2IA2A 1TBXA 4ESBA 3F8NA 1FY7A 3CLOA 2IRFG 1CGPA 3CTAA 4KIGA 3FXUA 5BPDA 1ZLKA 3D0SA 4IRHA 2WV0A 3P9CA 4EVIA 1YO5C 4BH9A 1U8RA 2CFXA 4M6XA 4CYDA 5L3DA 4A0XA 3LWFA 3CUQA 4P9UA 2HYGD 1B9NA 2ZXJA 2Q2EA 4KA4A 3BZ6A 2EWNA 1F4KA 2MC3A 1E17A 4CO8A 3VFZA 2XAFA 5CVIA 3MWMA 1T0FA 4HBLA 4RB3C 2DPUA 4LK1F 2KIUA 1W5SA 5ICCA 2MBFA 5CVUA 3HHHA 1WI9A 5LLQA 2RDPA 4BAYA 4B8XA 4XBFA 1KQ9A 3HSFA 3ZN1A 4Z2YA 5LEKA 2A07F 4YG2F 4WX9A 1RNLA 3RKYA 2R7FA 1Z6RA 3JAMK 5HDNA 3VEPA 3Q5FA 1XN7A 4AIJA 3V8KA 1YYVA 2DPDA 1I5ZA 5DCMA 2IVMA 2GAUA 2G7UA 4LFUA 3T8RA 5HOOA 2FSWA 2Z33A 2QLZA 1WKMA 2IT0A 5TJJA 4B09A 5ICGA 3COAC 4ASNA 3FM5A 3OV8A 2P4WA 1KU2A 2KRFA 1ZRCA 3I59B 4ETSA 3EDPA 5AONA 3WTYC 4A6EA 4OIQF 4LG0B 4YFXF 3R4KA 4GXOA 4E70A 3RPUA 4UV9A 5E1WA 3GWZA 3WU1B 1R5GA 4HA8A 2RVCA 1J5YA 4EMSA 2WTEA 3LA7A 1KYZA 3WTXC 2W24A 1UFMA 3J81K 4CZZA 4JQFA 1Q1HA 5HS9A 3BJOA 1WRJA 3GZ6A 2DFIA 4UVAA 2NAZA 1W7PD 4RS8A 4Q47A 2QBYB 4IHSA 1F9NA 2ISZA 1FNNA 1FSHA 3ZP5A 1BJAA 1YTYA 4PDKA 4I98B 3RDIA 1ZH5A 2MLKA 1SD7A 4UVBA 4U7DA 1R1UA 4G6DA 2DBBA 1FYMA 3F21A 3GVAA 3PFIA 4U7BA 2ISYA 3KCCA 3F8BA 1IRFA 3DPLC 2STWA 2XROA 3TO7A 4MQ9F 5F64A 3V7SA 2V1XA 1J7KA 2VONA 1YQAA 5D8KB 1P4XA 1I1SA 1RI7A 1K79A 4LLNA 4LMYA 4EJVA 3LFKA 3WTZA 2KJCA 4H0EA 1SFEA 2OZ6A 2DLLA 2GA1A 2H6BA 4IRGA 4KIBA 3IL2A 3ZMTA 2K02A 2HTSA 1IUYA 5KK1A 2P8TA 1YW9A 4HDUA 1DPUA 1SFUA 2H09A 2DAOA 2K7LA 1EH8A 1HXDA 1FWZA 4GYGA 2V6CA 2VN2A 1FSEA 4GO1A 4KYWA 4G7HF 4U88A 4WXCA 4Q4ZF 5E1ZB 2YU3A 1XSVA 4I2OA 3C3WA 4L9NA 1K6OA 3SHFA 5ICFA 2Q8KA 1RUOA 1ON2A 2QUFA 5LHGA 3DEUA 3L00A 1ZGAA 1D8KA 5FD6A 3DKWA 3J81Z 3E6DA 1W5TA 3M1EA 5D6FA 2PBIA 1IN5A 1TQMA 3BWGA 2X4HA 2RNJA 2HYFA 1SD4A 2P5LC 3HIFA 5KVRA 1OYWA 4G6QA 3ZPLA 2ZMEB 4AVPA 2ACJA 2KIFA 2NYXA 5J6XA 3MQ0A 4MTDA 2G9WA 1T38A 2GIVA 4LB6B 1PP7U 4OIRF 4CDGA 4PZJA 2EA4A 4TV7A 2FF4A 1RZ4A 2A61A 3DPTA 2O03A 3J80K 5HS8A 3ZMVA 1UHWA 2R3SA 1FC3A 1MDMB 3V8LA 1D8JA 5BS6A 1P6RA 1XGNA 4FT8A 3BDDA 2BEOA 3WGIA 3MEXA 1F1ZA 4KN4X 4MNUA 3KETA 2XKPA 4LJZF 2EFQA 2O3FA 4HZFA 3KP3A 1QO0D 3GF2A 2LNBA 2PI0A 5TRDA 1HW1A 2EA2A 3BP8A 3RYRA 1YIOA 4OIOF 2YX4A 2EFNA 3GO5A 2OBPA 4I0AA 4IPAA 2JPCA 3DXJF 4BNCA 5D5XB 1H9GA 2BGCA 4YIIA 4M6YA 5EEHA 4UUVA 1USTA 2V79A 2IPQX 3I53A 2LF7A 2Y75A 4G94A 2COMA 4L0ZB 2Z3YA 5DV5A 5JHUA 5F1RA 3E97A 5JFRA 2EFPA 1IW7F 1IXCA 3ZN0A 4K2EA 3V7CA 2Z99A 1DPRA 1HSTA 4O3MA 3FMQA 1ZRDA 2ZNYA 1MD0A 1TLHB 1Z7UA 1ZGJA 2DI3A 2P6SA 1FLIA 2ADUA 3QP5A 4HX8A 3QP6A 2QZ8A 5HLGA 1IN4A 4FX0A 2MA3A 1LDJA 1K78A 2PEXA 4U0WA 4QWQA 5LGTA 1QQIA 1OKRA 4A5MA 3FM3A 2GWRA 5DD8A 1BI0A 2H94A 4R8HA 4JK1X 4Y13A 2STTA 2XASA 3QPTA 3WGGA 3DP7A 1FBQA 4ON0A 1IAWA 4ESFA 1IN8A 2O6GE 3F6OA 1S8NA 1G3YA 4RAYA 4XSZF 3T8TA 3S2WA 1P4AA 3SZPA 4WK8F 1FYLA 1W7PB 2VBWA 2K4BA 2UZKA 2CSOA 5K5OA 3E6CC 1HW5A 3F8FA 1LDDA 3QU6A 1G4DA 5D5WB 2HQRA 1AOYA 1V4RA 3KLOA 3F8CA 2EB7A 3FXQA 3ZMZA 2QVOA 1USSA 1Z9CA 1J9IA 3H92A 3VOEA 5A2QK 1SMTA 4RGXA 2W84A 4A12A 1SFXA 1R7JA 3VODA 3WU0A 3PQKA 1PUEE 5D5VB 3ELKA 3R0JA 1KQ8A 3I4PA 4GYIA 1S7OA 3KEOA 3HOTA 4G7OF 1B4AA 2EK5A 4KICA 4U0YA 2Y0MA 4IXAA 4AD9A 4Q48A 1FBUA 3KP2A 2W57A 5DEQA 2A68F 1HKSA 4ENJA 3I0TA 1D3YA 3BY6A 1ZRFA 2YPRA 4L5JA 2ZBKA 3O6BB 3JSPA 1XMAA 2V1DA 3T5XA 4A0ZA 2HFHA 1IRGA 4EJTA 1IN6A 1O57A 4L9JA 3B73A 5FD5A 1REPC 2VOPA 3I58A 2M30A 2PG4A 2HEOA 1IN7A 1XSDA 2FOKA 3LSTA 1UHMA 2DU9A 1GHCA 1TW2A 2IA1A 3SQNA 2HS5A 3ZMDA 1XDSA 4KUMA 2XHKA 2EFOA 4HYEA 1AWCA 1YLFA 2DK5A 2PN6A 2VBXA 2Z5UA 5LHHA 5ED4A 3C18A 3Q9SA 1YS6A 2KJBA 2CGPA 1LVAA 1R1TA 2VXZA 3MZHA 1G3SA 5DD4A 2FA5A 2ZO4A 1I6XA 5LRRA 2VBYA 2XUBA 2PLYA 3GYHX 1L0OC 1O3TA 2HOEA 4WWCA 4CGZA 3E5QA 2P7CB 1G3TA 1FX7A 4HW0A 3DFGA 5D4SA 2QQAA 5CVRA 3PQJA 3T0YA 1Z91A 3IKTA 5A2QZ 1KU7A 2A3SA 3F3XA 1U5TC 5HLIA 3NEUA 5E8GA 3CO7C 4YFNF 2Y48A 5ILSA 4PGGA 2HKOA 1U5TB 4L9TA 2F5CA 2BBYA 1QGPA 2JSCA 3TOBA 4OMZA 4RB2C 4IVNA 3MFKA 1E2XA 1FP1D 5EEGA 4A2UA 2A6EF 4BHBA 4BHPA 5FGMA 5K5RA 3QRFF 2RGVA 2NS0A 1L3LA 3CO6C 1A04A 3E6BA 1BI3A 4G7ZF 2RV8A 1FZPB 3V7RA 3IWFA 5LGNA 4WXDA 2HGCA 1J0RA 3EYIA 1TW3A 2XRNA 4A0YA 2F5EA 1D5VA 1ZHFA 2QQBA 3ROUA 4HQMA 3JAMZ 2CWEA 3K0LA 1KGSA 5FB2A 3E6MA 3WE2A 2KIMA 5H20A 2VE9A 4O5VA 3ECOA 3KP7A 3FXRA 1U3EM 1K7AA 2XGXA 3EUHA 3EYYA 3P7NA 3I59A 4ENKA 3CJNA 2PJPA 1STZA 1S6LA 5D5UB 2LSOA 4HX7A 1QZZA 1ON1A 2ETHA 4HLXA 3GFLA 2VOOA 1R5HA 5HDKA 1R23A 3QPHA 4RGUA 1RUNA 3HRSA 3J7AO 3LAJA 1XDUA 2FBKA 2XAGA 1JXSA 2B0LA 4M9ZA 2CYYA 2KKOA 3U2RA 2L01A 2ELHA 4QLCU 1XCBA 3KP5A 4LK0F 4KFCA 4HF0A 4P96A 4XSXF 2QBYA 4ZYGA 1TQPA 2VBZA 5LHIA 1ODDA 1QPMA 3IRRA 5J8FA 1GXQA 2GXBA 4KIFA 1B9MA 4MQVA 5FLXK 5DYMA 3I54A 3ZMSA 4Y17A 4HV6A 2CW0F 2EV6A 5FO5A 2RN7A 1KU9A 2L3DA 2PFBA 5DUIA 4P55A 1U6GA 1KYWA 4IF4A 1XGOA 3KLNA 1WQ2A 3HTSB 1LB2A 1BN5A 4LB5A 4MTEA 2GQQA 1WWXA 4OOIA 2K27A 3REOA 1VTNC 3C7JA 1Z6TA 3HSEA 3HRUA 3JW4A 3GFJA 2D2WA 2LF8A 4O6JA 1RIOH 1T2KA 5D8LB 3NQOA 1BBYA 5AIQA 3GEZA 3FZVA 4ENMA 1FBSA 2QQ9A 2NNNA 1IXSB 3HOSA 2P6TA 4OIPF 2FE3A 2YX7A 2L4AA 4XLPF 5ICEA 1XGMA 4M72A 2Q0OA 3M9AA 2DK8A 4HAMA 5D4RA 1FP2A 1OYYA 3RKXA 3L09A 3EETA 5ERIA 3OOPA 1HKQA 3IRQA 2RQPA 3ECHA 4G9YA 1S3JA 1BM9A 2OD5A 3KE2A 4L9VA 2L4MA 2MLGA 2BYVE 1XGSA 4UNOA 4UV8A 3KP6A 2VC0A 3F6VA 1G6NA 3AAFA 3FX3A 4MEYF 1P4WA 2OU2A 1LDKB 2OQRA 1F5TA 2K4JA 3QOPA 1MGTA 2E1CA 2PMHA 4NHJA 2RKHA 5LEJA 2GXGA 5E20A 2GA2A 3VB2A 2P7VB 2UXXA 1ZLJA 1EV7A 3CUQC 2E7XA 3SXYA 1P92A 2FU4A 2ZMEA 3CUQB 2FEZA 4ZYDA 2OZUA 4YFKF 1BIBA 2XAHA 1CF7A 3DQVC 1TTYA 5BOXA 2BV6A 1JHFA 2P5KA 1SD5A 5HVQC 5FLXZ 5HLHA 5K5QA 4IRIA 4I7HA 4Q5SF 3SZTA 3B02A 1MJBA 4MHGA 3K1PA 4M9SA 3RIRA 4OMYA 1YG2A 1T39A 1TNSA 1MDMA 2ZJ2A 5F6FA 5BQTA 2V1UA 3WTUC 3MAJA
chains in the Genus database with same CATH superfamily
3SDGA 3LAPA 1OCPA 3JTGA 4HF2A 2A5YB 3C1DA 3SFZA 3PUFA 1LE8B 4GFBA 5GPAA 2R5ZB 4EEFG 3MKLA 4KN7X 4XKCA 3W6KB 3KFWX 1BC7C 2K9MA 1YS7A 5E3MA 3TDUC 3NRVA 1X4PA 2W4SA 1I27A 1R9TJ 1O3QA 2CQKA 5C3EJ 2KL4A 2CH0A 3J80Z 2DFEA 2DXIA 4UXNA 4A3FJ 2MC4A 4KMFA 3H3VK 5CVVA 3ZXSA 4IZZA 3LA3A 2WY7Q 4BHCA 2JPBA 4D9JA 1J75A 1ZARA 3DV8A 1GV5A 1WH7A 1BR4A 3FBIB 4IJAA 2IEKA 3RPQA 5J47A 2H6CA 1H89C 2AO9A 3BC8A 1W1WE 1R00A 2DJIA 1ETQA 2COBA 4N0BA 1O3RA 1A6IA 2R7WA 1Z21A 3KZYA 4EV0A 2B7EA 3WTVC 1NK3P 4ZYHA 5DCMB 2LP0A 1HKTA 1WHUA 3B6AA 2CG4A 4G8XA 3OYDA 4AIKA 2E2IJ 1MZBA 4I99C 2O5RA 3CQZJ 3MCZA 4AIHA 3A03A 5DM6F 3BTIA 4LD5A 1ZG1A 4M3BA 3VYRB 3CC2I 3CZ6A 4YELA 2DMQA 4KJZA 4HOBA 2D1VA 2DYSH 3HBLA 3L7WA 5CYVA 2WV1A 4XL9A 1WJEA 1SFOJ 2X48A 4KMUX 4XK4A 4CXFA 1KA8A 3W3CA 4M74A 3RTRA 4E7ZA 4CYCA 2H27A 3J7ZI 3J7AY 4ZYAA 4J19A 3S2HJ 1ORKA 3PUBA 1YW7A 2O8XA 3C2GA 3DF8A 4A6DA 4N9HA 3TO6A 1IXRC 2C6YA 5J8CA 2W7NA 4ESJA 2HDDA 1K4SA 3H36A 3WGHA 3I55I 1MJ9A 3K4BA 4ENNA 2YUSA 2ZNZA 2HPMA 4XR6A 2LBFB 2DDAA 1LEBA 1YW8A 4GGGA 5EYRA 5L3FA 1OYIA 5H6QA 2WADA 2HKXA 4QIWN 2WWYA 3HOXJ 3LSMA 1ETOA 3H35A 3K4NA 3R60A 3FMRA 4YIFA 4HQEA 1HBXG 2XPWA 5BMZA 2LVSA 2AHQA 4BU2A 3CJQB 3WTTC 1SD6A 4JBAA 2PMUA 1NTCA 1TQIA 1ZK8A 1TWCJ 3L1PA 2ID6A 2ZSIB 3FXKA 5M3FJ 4A5NA 4CCKA 1SAXA 2X6YA 1H0MA 1JKQC 2WB1N 2R7VA 1UCRA 2FXAA 4FHTA 4RM2A 2VQCA 4D5FA 2ME6A 5HLTA 3S8PA 1S29A 2KDOA 5IT3A 2QCOA 2X0LA 4XKWA 3G6EI 1QRYA 4IQ4A 5DDGA 1NHAA 1FMWA 1JE8A 3RKWA 1EH6A 4CUGA 1J59A 2CV1A 2KQRA 2UUZA 2CFOA 3LSGA 4GCVA 2Y9ZA 3OYGA 4D0PA 1W0UA 2BE5F 3JTHA 1DGWY 3V8JA 3F0CA 1N77A 2ZCWA 2HZTA 1LQ1A 1OCTC 2BOLA 2DT7B 1Z1DA 2VE8A 2JT1A 2FX0A 3KEQA 3S3NA 2CJJA 2EBIA 3K2ZA 2NNYA 5JVTA 4CHUA 3LA2A 5ILUA 1SVLA 2A6HF 3PM1A 4N9IA 4E7JA 4RB1A 2XVCA 2LMDA 3OYFA 1BOAA 3H3UA 3UKGA 1DUXC 1Z77A 2YSRA 3IWZA 3KYLA 2H8RA 1ZN2A 3QOEA 4KDPA 2DOAA 3JRFA 1RETA 1X2MA 1LNWA 2XKOA 2XC7A 3BR0A 3WG9A 3MZYA 1W7PA 2XDVA 2K85A 2ZSHB 1PUFA 2AS5F 5LRSA 1WSUA 2VKHA 1GUUA 1LJ9A 1T08B 3OL3A 4UUSA 1E3OC 1G59A 4YIRX 4NB5A 4WCGA 2W25A 1R5ID 3RYPA 2E2JJ 4HNTA 1ZR4A 3BROA 4IEJA 2FMLA 4XM3A 1U9OA 5B5EC 2DYRH 3O3KA 1VQ9I 1O4XA 1J2XA 2MGQA 1DU0A 4EM0B 3GUDA 1G2HA 4PK4A 1U9NA 1UELB 4BGDA 2GXAA 3HRTA 1FT9A 1IF1A 3E3VA 3KZIC 3TKYA 2HTJA 2NRAC 3GFMA 4QPOA 3P9KA 1WJBA 1QA6A 3LMMA 2VT2A 3L2CA 4KNYA 5C4JJ 3G73A 3DEWA 5IP6A 1MBFA 2IA0A 4JP0A 2OQGA 3QU3A 4BYYA 1SMYF 3S32A 4RLQA 3HUGA 3LQQA 2DQLA 4MIMA 4PFOA 3F72A 3ABTA 3WTWC 1JHHA 5JHFA 1I1GA 1UAAA 1XB4A 2WAQN 3TO9A 2QEXI 2VJ4A 3CC4I 5E1XA 3H9GA 3FHNA 1T98A 2P81A 2BY0A 2GM4A 2MYSA 4PCQA 2V26A 2LKPA 5IY5H 3BCAA 4KT5C 5H6RA 4EJOA 1NH3A 2JN6A 3P9IA 2OC6A 3WODF 3MKWB 3F22A 3WE3A 1X58A 1ZKGA 2VT3A 1LFBA 3GW2A 5E18F 3GLXA 2W00A 3CDIA 5CLSA 2LOOA 1S7AA 4EQQA 1ACIA 2Y30A 1FEXA 2HQNA 4FCYA 5CVJA 1BC8C 4EJWA 3LL7A 2DO7A 1ZYRF 2MD5A 1V5GA 4UHTA 3O8HA 5B66C 3M8FA 2XB5A 2VJIA 5CQGA 5KAIC 1HCRA 1XMKA 2CO5A 2LH9A 4WXHA 1VQMI 6PAXA 1U2WA 2Y0SA 3LFUA 3LQRA 1WVRA 3M8EA 4ZZLA 3N97A 2BW3B 4Y52J 3HGYA 1BIAA 2XAJA 2DCEA 3RSNA 1FOKA 1KZHA 2IBDA 2J5OA 5DCFA 1HW2A 2QSHX 1T8IA 5F27A 3QAHA 2W85A 3NAUA 2EV0A 5ILVA 3F23A 3PL8A 3RJPA 4B48A 3GFIA 5FFXA 1FIPA 1PDNC 2ESHA 5D6EA 1YFHA 2V1NA 4R79A 3OS0A 1P9QC 4DJAA 2RC4A 3RI4A 2F4OB 1IV6A 1POGA 3WHBA 2E60A 3M7GA 1DP7P 2D1HA 2EV5A 4DW6A 4PSWA 3TBIA 4PJMA 3CMAI 4JX4A 3ULQB 3I4NJ 4AU7A 2X6XA 2ZXIA 1ZGWA 1R6RA 3BJ6A 3HTUA 3ZMUA 3LSRA 3CUOA 1B59A 4IQJA 2H1KA 3BT9A 2OA4A 2R7TA 3W6JB 1ZAOA 2HU9A 2XIGA 3N4MA 2EZKA 3FHZA 2Y31A 4HX4A 4BQAA 2R7RA 1KU3A 2E1NA 3AG3H 3H3ZA 3DTEA 3HGGA 2IP2A 1R58A 5LBQA 5IYCJ 1IG7A 4XLHA 2F4MB 3E5XA 3E1SA 4KT6A 4FX4A 4HRIA 2OAZA 3FWEA 4LG0A 1DDNA 1QNTA 1AA7A 4P5OA 5HDGA 2DTRA 4HDVA 2OTLI 3EUAA 2QWWA 5E3OA 1H8AC 4EGZA 4XORA 5DUKA 2FQ3A 2BY2A 4KISA 4P9FA 3K6GA 2OF7A 3W2WA 2V9PA 3ABUA 1ETKA 3AG4H 1Z7LA 3TGNA 2HR3A 1X2NA 1VQNI 3DKYA 3I64A 3CP2A 3R61A 4ZDPA 5IP9J 1TWAJ 3ZQHA 2XRLA 1VQPI 4CCJA 1T33A 2O61A 4CCNA 2CW8A 4HV5A 2IGMA 4RAZA 4HF1A 4AUXA 1O3SA 1H9TA 1JGSA 3BPVA 2CQNA 2RNGA 2X1DA 2UWMA 4BJTA 5M5XJ 3KZZA 5AIPA 3I4MJ 5GTIC 2HDCA 1U5TA 4EM1A 1D0XA 4PFPA 1Y8QB 1C0WA 4AC0A 4IHTA 2JA8J 2LK2A 3R6SA 1U78A 4OAYA 4L0YB 5L3GA 2A69F 2L02A 3S16J 4DNCA 5FROA 2FMYA 1TNTA 1FOYA 2F5FA 4XOPA 4Y15A 5LGUA 3IC7A 4XRFA 4MFEA 1MIJA 3CCEI 1VFCA 3L2RA 4M73A 1QZYA 4HLYA 3CP8A 2L54A 2IW5A 5K1YA 2L9RA 4ZDLA 4XLNF 2J5PA 2XAQA 1I39A 4Y7NJ 2MW8A 1ULYA 3ML6A 3FMSA 4E7HA 1FPQA 5IT9K 5CJ9A 4M9XA 2ZXHA 2VC1A 3EUKL 4LLLA 3K69A 4AM3A 3K1MA 4HSTA 1QBJA 2E34A 4MGRA 3BJAA 1R22A 4PUSA 1R36A 1HF0A 2ESNA 4IHXA 4RGRA 3DBRB 4G6TB 2AXLA 3QWLA 4A3LJ 4EGYA 5EGOA 2FNPA 4I09A 3S17J 1UB9A 3K4JA 2QSFX 2JVHA 3M8JA 3SEQA 2D45A 2KLOA 2R7DA 2K9NA 2M9HA 3R0AA 1EH7A 3H9QA 2M45A 1YX5A 1BI2A 4RBOA 4CZCA 4CICA 2P5VA 1CF7B 2JRTA 1ZG3A 3VYUB 2UXNA 3U1DA 3ISPA 2IJLA 4OINF 3KP4A 4BDYA 3ZGKA 3ZQ7A 3QPSA 2MH2A 1B1BA 1MBGA 5DS9A 1K78B 1RPWA 1Y0UA 2K9SA 4PGHA 5J3LA 1KQ0A 3LSHA 2F2EA 2Z9OA 4D5CA 3IKVA 4S04A 2Z16A 1LEAA 2DQRA 2Y69H 3H0GJ 2FRHA 3OYKA 2EZLA 3A2KA 2CQ7A 4U0VA 3GBGA 2OTJI 1Z0XA 3JSOA 4X6AJ 3GTMJ 2JMWA 3OSGA 4I01A 1P2FA 2E7WA 3CCVI 3BPXA 4XOTA 3UNGC 2CQXA 4XLCA 3TOAA 3OYEA 4I6ZA 1Z05A 3OMYA 2BY1A 3CCYA 5GAEJ 1UJ8A 1Y56A 3Q9VA 4BXUA 2JZYA 3OYLA 2K86A 4M3EA 1MJAA 2HWVA 3ZOBA 1ETYA 5BPIA 3WTSC 4ZDOA 1G3WA 3IH4A 3RCOA 1IZ1A 3K1NA 4A93J 2JTVA 3ZRGA 1XS9A 4DIQA 3VYSB 4Y4RA 3CDHA 1XSXA 5L3CA 4WF2A 4ZTJA 3HHGA 4UVCA 3M4OJ 3A0BC 4FISA 4D7MA 4AYBA 1EKEA 2NS8A 5JI6A 4U87A 2VKDA 2XV4S 2R5YB 4BEHB 2LD5A 2V9VA 2XSDC 1P7IA 3FF5A 3U9GA 3G4SI 1ITYA 4D1QA 3I71A 3RQIA 2G7HA 3L2UA 1XG1A 4DGWB 3G3ZA 2YR2A 2ZFWA 1R1VA 3HSRA 4L18B 1FIAA 1HQCA 2VODA 3EQLF 2EFWA 4LG3A 4E7SA 1QU3A 4B3XA 3A02A 3HRMA 4EJUA 1ZG5A 2MH9A 2JA2A 3PNYA 2EJRA 3MKZA 1ONVA 1NG6A 1GVDA 2QM3A 2FUG2 4IOAF 3I5UA 4XQFA 2QENA 2DT5A 3BCBA 4Y3OA 1XPXA 3H5AA 3TQNA 1Y6IA 2FNAA 3CCUI 4A3MJ 1CQTA 2R7UA 1XCVA 1ENHA 1MKMA 3LOCA 4EM2A 4FTHA 2GZWA 5L3EA 1PP8F 2ZXWH 1HSJA 1W4MA 1O7LA 1JTYA 4I02A 4LLGF 1WPKA 3FKJA 2R7OA 4E7KA 4C3IJ 4ZYEA 4NQWA 3KPHA 1TT0A 4C2MJ 3JR9A 2FBIA 2M7BA 3K9TA 4M71A 5JR3A 3V4GA 5IT9Z 4DYRA 4Z6YA 4UB6C 4C30A 5FFZA 4F55A 1LUJB 5FJ8J 4R1HA 2M8EA 3HYIA 3GXOA 3A01B 1W5CC 1O7FA 1XD7A 1T6SA 2KRHA 3GZ5A 2GBYA 5HS7A 1FTTA 3F8MA 2WC2A 3I56I 1T56A 3PNVA 2PQ8A 2JWTA 5EG0A 3DCFA 3ZQFA 2M5WA 3JRHA 3H0DA 2L7MP 4FQGA 2R92J 5E17F 5HNHA 3DTKA 4DQ2A 1BI1A 1B6AA 1V3FA 5E8IA 4RGSA 3TDZC 3K2AA 1GXPA 2WBMA 3L9FA 1GDTA 2ZC2A 2M87A 2QKLB 1GVJA 3OWTA 4ZZDA 2KT0A 4I0BA 3W2VA 2HPIA 5L3BA 1EJ9A 2LRDA 2X1EA 1B72A 1JT0A 1A35A 2IGOA 2Y2ZA 4AWXB 1S5LC 2LYCA 3G71I 4BACA 1WJCA 4BJ6C 2M1BA 1IRZA 4S05A 1OMIA 4OU0A 5DM7F 3SFIA 2TDXA 3T1BA 4ZH4F 5M5WJ 2O0YA 4RB0A 4LGWA 2F5DA 4BY7J 2MSYA 2ZKZA 1X3UA 2IGKA 2LDUA 1OR7A 2DW4A 3HB9A 4F7ZA 5K7ZA 3VSKA 4B44A 4M3FA 3TMOA 1MW7A 4JYKA 4A3DJ 3BR6A 3CMMA 2FBHA 4L5IA 3ERED 4MEXF 3IHUA 3MVPA 1FYKA 4IHWA 1RR7A 3PSFA 1OPCA 2QYOA 4X1EA 3O2PE 3BOQA 3GX4X 3D5LA 1A5JA 1ZREA 3E7LA 1PYVA 3E5UA 2IA2A 1JKOC 5FLMJ 1TBXA 4ESBA 3F8NA 1FY7A 3CLOA 4BDZA 5KNLA 2IRFG 5CQEA 1CGPA 3CTAA 1Z3XA 4KIGA 4N4NB 3OL4A 2L9VA 3TW6A 3FXUA 4XICA 5BPDA 1VQ8I 1ZLKA 3D0SA 5BNGA 5KAFC 4IRHA 2DA7A 2JSPA 1BW5A 1V54H 1NG7A 5E3LA 3KYDB 5FRMA 3GTPJ 2WV0A 3LSJA 4Y33A 3G1LA 3P9CA 1BJZA 4NC7A 4EVIA 4II3A 1YO5C 4BH9A 1U8RA 4XKVA 2JRMA 5EZGA 2CFXA 3S1RJ 4M6XA 4CYDA 5L3DA 1VQ6I 3PO3J 1DU6A 4A0XA 1HA8A 3LWFA 2ZJQF 2ZJRF 3CUQA 2DODA 1Y8RB 3AG2H 2HYGD 4P9UA 2NVQJ 2E1MC 1B9NA 1XX5A 2ZXJA 1X1BA 4XIDA 1WJAA 2Q2EA 1S9HA 1WJ5A 4KA4A 2K5CA 2QSGX 3BZ6A 3S93A 3SYTA 2EWNA 3B6CA 3HOZJ 2E1MB 1F4KA 2MC3A 1E17A 4CO8A 2R7SA 3VFZA 1RKWA 2XAFA 5CVIA 1A6QA 3MWMA 3CMYA 1T0FA 4BQQA 1W36D 1TC3C 2IGNA 1YJWI 2WAEA 3OR1C 4HBLA 4RB3C 2DOEA 3FBNB 2DPUA 4LK1F 2KIUA 4G12A 1W5SA 5ICCA 2MBFA 3RQ4A 2E1OA 1B8IA 5J4VA 4PJLA 2JK3A 5CVUA 4X0GA 2VQLA 3HHHA 4FETA 3CCMI 1WI9A 5LLQA 1LE8A 4XNFA 5J1UA 2RDPA 2CUZA 4BAYA 4B8XA 4XBFA 1KQ9A 1JUSA 3OIOA 3CLQA 2CUEA 3HSFA 3ZN1A 4Z2YA 2R93J 2EQRA 3CMEI 5LEKA 4XRSG 5IYBJ 2A07F 2KZGA 4YG2F 2O9LA 3FK6A 3BQYA 4WX9A 1RNLA 3RKYA 1D0ZA 3IAM2 1OLTA 2R7FA 1Z6RA 2AXTC 3JAMK 1WJFA 2W1OA 4B4CA 3Q3SA 5HDNA 3VEPA 3Q5FA 1XN7A 4CH7A 4AIJA 3S1MJ 3NWSA 2IAIA 4ITVA 3V8KA 2VIXA 3ABLH 1YYVA 2A6TA 2DPDA 1P7JA 5K7HA 1I5ZA 5DCMA 2IVMA 5DTDA 1MSFC 1YIJI 3MD2A 2E35A 3QODA 4BS9A 2GAUA 2X9DA 2VI6A 2R7ZJ 2VUMJ 2G7UA 5E79C 4LFUA 4B1RA 3L2WA 3T8RA 5HOOA 1H88C 2X51A 4GDFA 2KP6A 2FSWA 1TP4A 3ZCOA 4BUPA 2Z33A 2Y0SN 2QLZA 2DMNA 1OISA 1WKMA 2IT0A 5IOYA 5TJJA 3EUHC 4B09A 5ICGA 1JJ6C 3COAC 4ASNA 3IH2A 3EPZA 3FM5A 4F52A 3HL2A 3BR5A 1EF4A 4XLAA 2CRGA 3OV8A 2P4WA 5EJCA 2M0CA 1KU2A 1IDYA 2KRFA 1ZRCA 2HDWA 2DJNA 3I59B 2DA1A 1QHHD 4ETSA 4RMNA 3EDPA 5AONA 4E4HA 3WTYC 2AQEA 4A3BJ 4W97A 4A6EA 4OIQF 4LG0B 4YFXF 2CUFA 2DA3A 1QPIA 2GOXB 5FRNA 3R4KA 4GXOA 3VDXA 2WA0A 1BR1A 4E70A 5KHDA 3RPUA 1WH5A 2CW7A 1JKRC 1I6HJ 4UV9A 3HM5A 2D5VA 5E1WA 3GWZA 3WU1B 1R4NB 1R5GA 4HA8A 4LOCA 2RVCA 1J5YA 4EMSA 2WTEA 3LA7A 2BVMA 1KYZA 3V42A 3WTXC 2W24A 3M1CA 1UFMA 1VZ0A 3J81K 2VQGA 1AKHB 3HPGA 4CZZA 1DQUA 4JQFA 1Q1HA 5HS9A 3BJOA 1WRJA 3KX2A 1VQOI 3CJTB 3GZ6A 2DFIA 5F0HA 4UVAA 4M3GA 9ANTA 2NAZA 2RQQA 1W7PD 3BTLA 1E3PA 4RS8A 2LTPA 4Q47A 2QBYB 4IHSA 1FTZA 1F9NA 2PJRB 3BZCA 4BE2A 3GTJJ 2OJED 2ISZA 1KONA 1FNNA 3HXLA 2HQ5A 4P1WA 4HNUA 4A69C 1FSHA 2HVQA 1BJAA 3BTCA 3ZP5A 2NOGA 2GOMA 2EH3A 2W82A 4PDKA 1YTYA 3MN2A 2KMUA 4I98B 5KCMA 3RDIA 2PMZA 1ZH5A 3HJEA 2JUCA 1B8IB 3MAJA 2LG4A 3K4LA 2MLKA 1SD7A 1UZCA 3TEDA 4UVBA 1R1UA 4G6DA 3CF2A 2DBBA 4U7DA 1YJ9I 1FYMA 3F21A 1VQ7I 3GVAA 3PFIA 4CCMA 4XRSA 4U7BA 1DGRM 2ISYA 5F0FA 4CCLA 3KCCA 3F8BA 1IRFA 3DPLC 2CQQA 5GAGJ 2XROA 3TO7A 3HZJA 4MQ9F 3QYFA 5F64A 2STWA 3V7SA 4XLEA 2L9SA 1YITI 2V1XA 2P0WA 1J7KA 1MMNA 2VONA 2HYJA 4AVZA 4IHYA 1YQAA 5D8KB 1P4XA 2DMUA 1D5YA 1I1SA 1ERDA 1RI7A 1I3QJ 1K79A 4C3HJ 4LLNA 2QA4I 1VQKI 4LMYA 4EJVA 1U0JA 1ZELA 3LFKA 4HSRA 3BG9A 3WTZA 4E6KG 2KJCA 3BTJA 1SFEA 4H0EA 4B43A 1ETXA 2OZ6A 2DLLA 2GA1A 2H6BA 3BG7A 4IRGA 2M8GX 1SANA 4KIBA 2LC2A 3IL2A 2KRCA 2CU7A 3ZMTA 2H1LA 2K02A 2V6EA 2HTSA 1TZLA 1IUYA 5KK1A 1MH4A 4IHVA 4A3GJ 2P8TA 5E3NA 1IDZA 1YW9A 4HDUA 1HOMA 4NC8A 1SFUA 4II2A 1DPUA 3LSPA 1A36A 4FE7A 1Y0NA 2H09A 2DAOA 2K7LA 2XPVA 1EH8A 4BBRJ 4H4KC 2X85A 1HXDA 1UG2A 1FWZA 4GYGA 1J09A 2V6CA 2V9KA 2VN2A 1FSEA 4GO1A 4KYWA 3MKYB 4U88A 4G7HF 4DYQA 2VXDA 2DOFA 2ZB9A 2JA6J 4WXCA 4Q4ZF 5E1ZB 5HODA 4ZTFA 1JJ8C 1M1EB 2DA2A 2DA6A 2YU3A 3GZNB 4LIUA 2R0QC 1XSVA 5IPAA 4I2OA 1D1AA 3RKQA 3TL4X 4ANJA 2L2OA 3C3WA 4L9NA 4XONA 1K6OA 2X1CA 4NDLA 1HDDC 1ZTRA 3SHFA 4BE0A 3OSFA 5ICFA 1WI3A 1YRNB 2Q8KA 2HI3A 3ONQA 1RUOA 1ON2A 2QUFA 4M6VA 2FOWA 5LHGA 2MG4A 3DEUA 2JQ7A 3L00A 1ZGAA 3PFYA 2DN0A 1HC8A 4MFDA 1D8KA 5FD6A 1QHGA 3DKWA 3J81Z 2B63J 3E6DA 1W5TA 2QF7A 2V7FA 3M1EA 5D6FA 2ZMEC 2PBIA 1IN5A 1TQMA 3ASOH 2IS2A 4C3JJ 3BWGA 2X4HA 2RNJA 2HYFA 1TWGJ 1SD4A 3N05A 2P5LC 3K4KA 2K40A 3HIFA 5KVRA 4BXFA 1OYWA 1JTXA 4G6QA 2M0MA 3ZPLA 1X1AA 4BBSJ 2M2EA 2ZMEB 4AYBN 4AVPA 4L5EA 5FKKA 3QPLA 2ACJA 1Y39A 3OYMA 2KIFA 2NYXA 1TWFJ 2ID3A 4JOMA 3BR3A 5J6XA 3MQ0A 4MTDA 2G9WA 1T38A 3SZGA 1VQ5I 2GIVA 4LB6B 1PP7U 1VQ4I 3GTKJ 2DDBA 4OIRF 3A0HC 4CDGA 4PZJA 1Y1VJ 2EA4A 2FF4A 1RZ4A 1QVTA 4TV7A 2A61A 1MMAA 5LD2C 4NBQA 3DPTA 2O03A 3BR2A 1YX3A 4BQNA 3J80K 4CA0A 3RZOJ 5HS8A 2KIQA 3ZMVA 3PSIA 4AIDA 1UHWA 2R3SA 1FC3A 1IO2A 4XLFA 3V8LA 1MDMB 4BJ5C 1D8JA 5BS6A 2OPTA 1P6RA 4UY8I 1XGNA 2JVGA 3H5NA 2OCEA 3OS1A 3OR2C 4FT8A 2L7FP 3BDDA 2BEOA 3WGIA 1W36C 4A3CJ 2LKSA 3MEXA 1F1ZA 4KN4X 2WY8Q 1BW6A 3AL0C 4MNUA 1BA5A 3KETA 2XKPA 4LJZF 2EFQA 2O3FA 4HZFA 2RREA 3KP3A 1QO0D 3GF2A 4BKXA 2LNBA 2L5QA 2PI0A 3AL0B 1V5FA 5TRDA 1HW1A 2EA2A 3GTQJ 3BP8A 1MNEA 2M4GA 3RYRA 1YIOA 1A31A 4OIOF 2EIMH 5F1JA 1OJLA 1JT6A 2EFNA 2YX4A 3RZDJ 4BXXJ 3GO5A 5FKNA 2VJJA 3S1NJ 5TISC 2OBPA 2BVLA 3DWLE 3AG1H 4I0AA 2L7KA 5B3SH 3I3LA 5M3MJ 4IPAA 2JPCA 2OUMA 3DXJF 4BNCA 2L7ZA 5D5XB 2QKMB 3BG6A 1H9GA 3HOWJ 2BGCA 5J1RA 1MNDA 4YIIA 1MBJA 4M6YA 2F5VA 2E36A 5EEHA 1DP3A 2E5ZA 1MBKA 1YJNI 4FE4A 1N78A 4CYCB 4UUVA 2EIKH 4BE1A 4LITA 1USTA 2V79A 4XN3A 2VPLA 2IPQX 3I53A 2LF7A 2Y75A 4ZJZA 4G94A 3S2DJ 2JUGA 4HNVA 1S7EA 2COMA 2LFBA 4L0ZB 2ELKA 2Z3YA 3O8GA 5DV5A 5TGTA 1UHSA 5JHUA 5F1RA 2NVYJ 3E97A 2EFPA 5JFRA 5J1YA 1U8BA 2XF7A 3FIWA 1IW7F 1IXCA 3ZN0A 3CJRB 4K2EA 3DEEA 5LFAA 3V7CA 1WCMJ 2Q1ZB 2BHYA 2LY9A 2Z99A 1DPRA 1HSTA 2EINH 2EILH 4O3MA 3FMQA 2KFDA 5H2FC 3SEZA 1ZRDA 3S14J 2ZNYA 3IV5A 1MD0A 4DBQA 1D0YA 2ICWG 1TLHB 1Z7UA 1ZGJA 2DI3A 2P6SA 3DTIA 1FLIA 2ADUA 4CCOA 3QP5A 3S3OA 4HX8A 3QP6A 1T0FC 2QZ8A 5HLGA 1IN4A 4FX0A 3GTLJ 2MA3A 3C2HA 2NOJB 1LDJA 1K78A 2PEXA 4U0WA 4QWQA 5LGTA 1SAUA 1IGNA 5EZHA 1QQIA 3S1QJ 3OYIA 1OKRA 4A5MA 3FM3A 1TWHJ 2GWRA 5DD8A 1EA3A 4RAFA 5CKTA 5F08A 3AFHA 1BI0A 2H94A 5GP9A 4F91B 4R8HA 3G1OA 2LREA 5M5YJ 4JK1X 4Y13A 2STTA 4DBRA 2XASA 5C4XJ 3QPTA 1JKPC 3OYBA 2NVUB 3WGGA 3L2VA 3DP7A 3D5RC 3FXOA 3GTOJ 1APLC 3AKZA 1FBQA 4ON0A 1IAWA 4ESFA 1Z67A 1IN8A 2O6GE 3F6OA 2XB0X 2CMPA 3Q0UA 1S8NA 3HDDA 1G3YA 4XN0A 3F9KA 4RAYA 4XSZF 4ZC3A 3T8TA 3S2WA 1P4AA 3D5SC 3SZPA 4WK8F 1FYLA 1W7PB 1ZR2A 1LVKA 1OCRH 2M7AA 3H1CA 2IS1A 1PUFB 3K10A 3OIQA 1RC9A 2VBWA 5IP7J 2K4BA 4UUSB 2CSOA 2UZKA 5K5OA 3E6CC 2B9SA 2R7QA 1HW5A 3F8FA 1LDDA 3QU6A 1G4DA 2R5YA 4RA2A 4BEHA 5D5WB 2HQRA 5K7FA 1ETVA 2A5WA 2JJ7A 2XPUA 4PSXA 4FASD 2IS6A 2O8KA 3BQZA 2HQAA 3GLLA 1AOYA 2E71A 1V4RA 3KLOA 3F8CA 2EB7A 1JGGA 3FXQA 1G8XA 3ZMZA 2ME0A 3SDBA 3DLAA 2QVOA 1OCCH 1USSA 1V5EA 1Z9CA 2JA5J 3H92A 3VOEA 5A2QK 1FOXA 1J9IA 1SMTA 4RGXA 3G2BA 2H8WA 1TL8A 3CDLA 3HEFA 3X2QH 3HUGB 2W84A 3Q0VA 4DYCA 3JRCA 4A12A 4F3QA 2OCCH 1FMVA 3HPHA 2BY3A 4J01A 1LFUP 1SFXA 1R7JA 2OV7A 3VODA 3WU0A 1OCOH 3PQKA 3IP4B 3JCUC 3VPRA 1PUEE 5D5VB 3ELKA 3R0JA 3ZQGA 1KQ8A 3I4PA 4GYIA 1S7OA 2DA5A 4J00A 3KEOA 3HOTA 4G7OF 1VNDA 2YS9A 2UV1A 2BHZA 1B4AA 2EK5A 4KICA 4U0YA 4NUBA 1K4TA 2Y0MA 3ERMA 4IXAA 4AD9A 3QYEA 4Q48A 2HOAA 2KISA 1FBUA 2AQFA 2M34A 3KP2A 2W57A 5DEQA 4NC6A 2A68F 3A01A 2TCTA 1HKSA 4ENJA 3ZQLA 3I0TA 2BXYA 5GTHC 1D3YA 3BY6A 4PJJA 1ZRFA 1RESA 2YPRA 4OWRB 3K70C 4L5JA 1YOVB 4V2FA 1K61A 2ZBKA 3A4CA 3KEYA 3O6BB 2R5ZA 3JSPA 1XMAA 2XGDA 3S15J 2V1DA 3E0JB 3T5XA 2GIZA 4A0ZA 3OY9A 2HFHA 4HPQA 4NNJA 4S0HB 2LKXA 1IRGA 4EJTA 1IN6A 1O57A 4L9JA 3B73A 5FD5A 2F4IA 3QYBA 4HG2A 1OCZH 2DFFA 2CV2A 2KDZA 1REPC 4IKFA 2VOPA 3BLYA 5C44J 3I58A 2I8DA 1Q1VA 5B1BH 3DU5A 2M30A 2PG4A 2HEOA 1IN7A 3PIPF 1WFXA 1XSDA 2FOKA 3NWTA 2KPMA 3LSTA 1UHMA 2DU9A 1GHCA 4QPQA 3JRAA 3JRDA 3QQAA 3CCQI 1TW2A 2IA1A 3SQNA 4C9YA 2HS5A 2KZVA 3ZMDA 1XDSA 4KUMA 4BY1J 4C2TA 1SVMA 2XHKA 2HVSA 2EFOA 4M3DA 4HYEA 1AWCA 4V19K 1JUMA 5J40A 1YLFA 2R7XA 4DOZA 2DK5A 2PN6A 2VBXA 2LY1A 1SFKA 3DKXA 2ELJA 3HOVJ 3DLLF 2Z5UA 5LHHA 5ED4A 4MLOA 4RM3A 2WB1A 3W6VA 3C18A 3Q9SA 1SEUA 4ABZA 1YS6A 2KJBA 2CGPA 1LVAA 1R1TA 2VXZA 2BXZA 3MZHA 2K3PA 1AU7A 3M3YJ 5IOZA 1G3SA 2HZDA 3ASNH 2LBFA 3CCLI 1R4MB 2PMZN 5DD4A 2FA5A 5FKOA 2ZO4A 1I6XA 2M3AA 5LRRA 2VBYA 4D7NA 2XUBA 2PLYA 3GYHX 2HNHA 1L0OC 1O3TA 2HOEA 4WWCA 1WGXA 3TP0A 4CGZA 3E5QA 2P7CB 1G3TA 1FX7A 4HW0A 1WJDA 3DFGA 5D4SA 2ZFUA 2QQAA 3H9JA 5CVRA 1SVOA 4IOCF 1VI0A 3PQJA 4OAZA 3FK7A 2VJ5A 3K7AJ 3T0YA 1Z91A 3IKTA 5A2QZ 4A3EJ 2FQ4A 1KU7A 2A3SA 1QZEA 1U5TC 3F3XA 5HLIA 3NEUA 1UMQA 5E8GA 2I5UA 3OYHA 3CO7C 4YFNF 2Y48A 3G1MA 2VKEA 5ILSA 4PGGA 2HKOA 3LNQA 1U5TB 4L9TA 2RAEA 2F5CA 2BBYA 1QGPA 3HG9A 3HOUJ 2DMTA 2JSCA 3TOBA 1X1DA 2O7OA 4OMZA 1S72I 4RB2C 4IVNA 3MFKA 1IUFA 1D1CA 3WU2C 1LPQA 4RAGA 4MO7A 1E2XA 1FP1D 3HOYJ 5FKLA 1UG0A 5EEGA 4A2UA 2A6EF 1I3AA 3LSIA 4BHBA 4BHPA 1X19A 5FGMA 5K5RA 1F43A 2VLAA 2K3FA 1XC5A 2MFZA 3HKZN 3GTGJ 3QRFF 2JA7J 2RGVA 2NS0A 4PJNA 1L3LA 3CO6C 1A04A 3E6BA 1BI3A 4G7ZF 2QGUA 2MD0A 2VQHA 2RV8A 1FZPB 1TT5B 2NS7A 2L0KA 1XMXA 1HDPA 4LIVA 3V7RA 5EF6A 3IWFA 4F92B 2M4KA 1X4OA 1FOWA 3ABMH 1K83J 2DMPA 5LGNA 1RRJA 4WXDA 1AHDP 2WAQA 2HGCA 1FJLA 1J0RA 4W1UA 3ZR8X 3VWBA 3EYIA 1TW3A 2XRNA 5EGOB 2K9LA 4UB8C 4A0YA 3FDYA 2LY2A 1OFCX 2F5EA 1D5VA 2LLKA 3PNTA 3FISA 4BQOA 1ZHFA 2L9NA 2QQBA 3ROUA 4HQMA 3JAMZ 2CWEA 3K0LA 4CSWA 1KGSA 5FKMA 5FB2A 3E6MA 3WE2A 2KIMA 4B47A 5H20A 1GLNA 2VE9A 4O5VA 3ECOA 3KP7A 5JLXA 4UUTA 3FXRA 3U1KA 1U3EM 1ZQ3P 1K7AA 3RPUD 1X3ZB 2XGXA 2MABA 3EUHA 3GCMA 3EYYA 1RR8C 3OIPA 2KHMA 3P7NA 2XGEA 3JREA 2XAUA 3I59A 3PO2J 2BZTA 3NARA 4F93B 4ENKA 1IV8A 2LR8A 3CJNA 4XRMA 3M07A 1PJRA 3SJMA 3CESA 2PJPA 1STZA 1S6LA 5GAHJ 3HKZA 1YI2I 3JRBA 5D5UB 1VQLI 2LSOA 2IXSA 3K70D 4HX7A 1QZZA 2F48A 2K9QA 2VKVA 1ON1A 2ETHA 4HLXA 3GFLA 2HOSA 2VOOA 3MZ8A 3A1YA 4BL0B 1YHQI 3ESWB 1R5HA 2I10A 5HDKA 2Z2SB 1R23A 3DBHB 5EEAA 3QPHA 4RGUA 1RUNA 3HRSA 3J7AO 3OYNA 3LAJA 5JLWA 3CC7I 1XDUA 3BG5A 4XKBA 2HXOA 2FBKA 2N8GA 2XAGA 3OYAA 2R4GA 1AKHA 3FKIJ 1JXSA 2B0LA 4M9ZA 2CYYA 2KKOA 3U2RA 3TW7A 1WZ2A 2A05A 1F36A 2Y9YA 2L01A 2ELHA 4DZJA 4QLCU 2HOTA 1XCBA 3KP5A 1Z3YA 4LK0F 4KFCA 4HF0A 4P96A 4XSXF 2BW3A 2QBYA 4ZYGA 2X6OA 3OS2A 2PJRA 1TQPA 2ECCA 2TRTA 2VBZA 5LHIA 1ODDA 1QPMA 3IRRA 3Q0WA 5J8FA 4GRIA 1GXQA 2GXBA 4KIFA 1B9MA 4MQVA 1BL0A 3CCRI 3LSKA 3IUOA 5GPCA 5FLXK 2E5NA 5DYMA 3I54A 4IL6C 3CCSI 3VYTB 2EPFA 2EIJH 2DA4A 3ZQIA 3ZMSA 2ECBA 2XF5A 4Y17A 4HV6A 2CW0F 2EV6A 5FO5A 2Z1DA 4V2GA 3TP3A 2RN7A 1KU9A 2L3DA 3CCJI 2DFHA 2PFBA 3WTUC 2VB6A 4B3AA 5DUIA 1V55H 4P55A 1N75A 3KYCB 1U6GA 1KYWA 4IF4A 1XGOA 2VL8A 3KLNA 1BR2A 1WQ2A 1LFPA 3HTSB 4JX5A 3DPUA 1Y1WJ 4HEA2 2IS4A 3BR1A 1LB2A 1X3WB 1BN5A 4LB5A 4RDUA 1BOBA 4MTEA 4JX6A 2GQQA 1WWXA 4OOIA 4NQWB 4KITB 2K27A 2XF6A 3D1NI 3REOA 3OYCA 4N4OB 1VTNC 3C7JA 2CUJA 2VPRA 1Z6TA 3HSEA 5CPRB 2WAFA 3HRUA 5J4YA 3JW4A 3GFJA 2D2WA 2LF8A 4O6JA 4DZPA 1RIOH 2E19A 1T2KA 4YEJA 5D8LB 3ZQCA 4E7IA 3CF5F 3IAS2 1BBYA 3NQOA 1VF9A 5AIQA 3WG7H 3GEZA 3FZVA 4ENMA 4A3KJ 1FBSA 5EG0B 3JRIA 4I76A 2QQ9A 2QQ8A 2NNNA 3U21A 1IXSB 1OQYA 3HOSA 2P6TA 3KIOA 4OIPF 2DTZA 2FE3A 1MH3A 2YX7A 2L4AA 4XLPF 5ICEA 2EZHA 1JUPA 4PJ0C 1XGMA 4M72A 2Q0OA 1LKXA 2V4JC 3M9AA 2EZIA 5F04A 3WHCA 3MMYB 2DK8A 4HAMA 5D4RA 1FP2A 2YU9J 4YRVA 1B72B 1OYYA 1YE9A 3RKXA 3L09A 3EETA 1OR7C 2W48A 5ERIA 3I9V2 2G0EA 3OOPA 1HKQA 1K6YA 4A3IJ 3IRQA 3JRGA 2RQPA 2HVRA 3ECHA 4G9YA 1S3JA 4QTRA 2F6CA 1MMDA 3FXMA 4C2UA 3GMEA 1MMGA 1BM9A 3IH3A 2PX9A 1MMSA 2OD5A 3VSLA 3FXLA 3KE2A 4L9VA 2L4MA 2CV0A 2MLGA 5B1AH 2BYVE 2CS3A 1JI8A 1XGSA 4UNOA 5IYDJ 4UV8A 5F0CA 3KP6A 3ZQQA 2XGCA 5JVGF 3OYJA 3S3MA 5FLVA 5EDNA 2VC0A 2NVXJ 3F6VA 1XTAA 1G6NA 1YRNA 2DT6A 3AAFA 3FX3A 4MEYF 4IX7A 2NVTJ 1P4WA 2OU2A 1LDKB 2OQRA 1E3HA 3HC7A 1F5TA 2K4JA 1D1BA 1IC8A 3QOPA 2E2HJ 1MGTA 2E1CA 2PMHA 2HXIA 1MSEC 4NHJA 2RKHA 5LEJA 1W0TA 2GXGA 5E20A 2GA2A 3VB2A 3BG3A 3K4CA 4XMYA 2P7VB 3K4MA 3P5JA 5HNFA 3PIOF 1GT0C 2UXXA 1ZLJA 1EV7A 2FD5A 3CUQC 4IO9F 1HLVA 2E7XA 1PVEA 3SXYA 2FJ1A 3OOUA 1P92A 1NK2P 3W2AA 2FU4A 2XSJC 1R71A 1IJWC 2ZMEA 3CUQB 2FEZA 4ZYDA 2OZUA 4YFKF 1BIBA 2XAHA 2Q2EB 1CF7A 3J7YJ 1E0EA 3DQVC 1TTYA 5BOXA 1QVUA 3H5RA 3CD6I 1MBHA 1SC7A 2BV6A 1JHFA 2NXNB 2P5KA 5GADJ 3UR3C 1SD5A 5HVQC 5FLXZ 4EATA 2GLOA 3PJRA 4QSHA 2VASA 3L2QA 1R49A 5HLHA 5K5QA 4IRIA 4I7HA 1X1CA 3ABKH 4A3JJ 4Q5SF 1ETWA 1N25A 3SZTA 3B02A 1MJBA 3DU6A 3K1PA 4MHGA 4E7LA 3FXJA 3BZKA 1I50J 4M9SA 3RIRA 4RLFA 1MNMC 4OMYA 1T95A 1YG2A 2X6WA 2ZJPF 1T39A 1TNSA 1MDMA 1RKTA 2ZJ2A 1X1PA 5F6FA 1MBEA 5BQTA 2V1UA 1IRXA 1GV2A 3C2BA 3DBLB
chains in the Genus database with same CATH topology
3LAPA 3JTGA 4HF2A 2A5YB 3C1DA 3SFZA 4KN7X 3W6KB 1BC7C 3KFWX 1YS7A 3TDUC 3NRVA 1I27A 1O3QA 2CQKA 3J80Z 4UXNA 4KMFA 5CVVA 3LA3A 4BHCA 2JPBA 1J75A 1ZARA 3DV8A 3RPQA 4IJAA 2H6CA 1R00A 4N0BA 1O3RA 3KZYA 4EV0A 3WTVC 4ZYHA 5DCMB 1HKTA 2CG4A 4G8XA 4AIKA 1MZBA 3MCZA 4AIHA 4LD5A 1ZG1A 4HOBA 2D1VA 3L7WA 5CYVA 4KMUX 4CXFA 1KA8A 4M74A 3RTRA 2H27A 1YW7A 2O8XA 3DF8A 4A6DA 4N9HA 3TO6A 1IXRC 2C6YA 5J8CA 4ESJA 3WGHA 1MJ9A 4ENNA 2ZNZA 1LEBA 1YW8A 4GGGA 5L3FA 1OYIA 5H6QA 2HKXA 2WWYA 3R60A 3FMRA 4YIFA 4HQEA 1HBXG 5BMZA 3WTTC 1SD6A 4JBAA 2PMUA 1TQIA 4A5NA 1SAXA 1H0MA 1UCRA 2FXAA 4FHTA 1S29A 5IT3A 2X0LA 5DDGA 1NHAA 1JE8A 3RKWA 1EH6A 1J59A 4GCVA 4D0PA 2BE5F 3JTHA 3V8JA 1LQ1A 2ZCWA 2HZTA 1Z1DA 2VE8A 2JT1A 3KEQA 3K2ZA 2NNYA 5JVTA 4CHUA 3LA2A 5ILUA 2A6HF 4N9IA 4RB1A 2XVCA 1BOAA 3H3UA 1DUXC 2YSRA 3IWZA 1ZN2A 4KDPA 1LNWA 2XKOA 3WG9A 3MZYA 1W7PA 2AS5F 5LRSA 1WSUA 1LJ9A 4NB5A 4WCGA 2W25A 3RYPA 3BROA 2FMLA 3O3KA 1J2XA 4EM0B 3GUDA 3HRTA 1FT9A 1IF1A 3E3VA 3TKYA 2HTJA 2NRAC 3GFMA 3P9KA 2VT2A 3L2CA 4KNYA 3G73A 2IA0A 2OQGA 3QU3A 4BYYA 1SMYF 3HUGA 3LQQA 2DQLA 3F72A 3ABTA 3WTWC 1JHHA 1I1GA 1XB4A 3TO9A 5E1XA 1T98A 4PCQA 2LKPA 4KT5C 5H6RA 4EJOA 3P9IA 3WODF 3F22A 3WE3A 2VT3A 3GW2A 5E18F 3GLXA 5CLSA 1S7AA 4EQQA 2HQNA 5CVJA 1BC8C 4EJWA 2DO7A 1ZYRF 2MD5A 4UHTA 3M8FA 1XMKA 2CO5A 4WXHA 6PAXA 1U2WA 3LQRA 3M8EA 4ZZLA 3N97A 1BIAA 2XAJA 1FOKA 2J5OA 5DCFA 1HW2A 3QAHA 2W85A 2EV0A 5ILVA 3F23A 3GFIA 3RJPA 5FFXA 1PDNC 2ESHA 5D6EA 1YFHA 4R79A 2RC4A 3RI4A 3M7GA 1DP7P 2D1HA 2EV5A 3ULQB 3BJ6A 3HTUA 3ZMUA 3CUOA 1B59A 2OA4A 3W6JB 1ZAOA 2XIGA 3N4MA 3FHZA 4HX4A 4BQAA 1KU3A 2E1NA 3H3ZA 2IP2A 1R58A 5LBQA 3E5XA 4FX4A 2OAZA 3FWEA 4LG0A 1DDNA 1QNTA 4P5OA 5HDGA 2DTRA 4HDVA 2QWWA 4EGZA 5DUKA 2FQ3A 4P9FA 3ABUA 3TGNA 2HR3A 3I64A 3R61A 2O61A 4HV5A 4RAZA 4HF1A 1O3SA 1H9TA 1JGSA 3BPVA 2UWMA 3KZZA 5AIPA 2HDCA 1U5TA 4EM1A 1C0WA 4IHTA 3R6SA 1U78A 4L0YB 5L3GA 2A69F 2L02A 4DNCA 2FMYA 1TNTA 2F5FA 4Y15A 5LGUA 3IC7A 4XRFA 4M73A 1QZYA 4HLYA 2L54A 2IW5A 5K1YA 4XLNF 2J5PA 2XAQA 1ULYA 3ML6A 3FMSA 1FPQA 5IT9K 5CJ9A 4M9XA 2VC1A 4LLLA 3K69A 3K1MA 1QBJA 4MGRA 3BJAA 1R22A 1R36A 2ESNA 4RGRA 2AXLA 4EGYA 2FNPA 4I09A 1UB9A 2D45A 2R7DA 3R0AA 1EH7A 2M45A 1BI2A 4CICA 2P5VA 1CF7B 2JRTA 1ZG3A 2UXNA 3U1DA 3ISPA 2IJLA 4OINF 3KP4A 3ZQ7A 2MH2A 1B1BA 1K78B 1Y0UA 4PGHA 1KQ0A 2F2EA 2Z9OA 3IKVA 4S04A 1LEAA 2DQRA 2FRHA 4U0VA 3JSOA 4I01A 1P2FA 2E7WA 3BPXA 3TOAA 1Z05A 3Q9VA 4BXUA 2JZYA 2K86A 1MJAA 2HWVA 5BPIA 3WTSC 1G3WA 1IZ1A 3K1NA 2JTVA 3CDHA 1XSXA 5L3CA 4WF2A 3HHGA 4UVCA 5JI6A 2XV4S 2V9VA 3FF5A 3U9GA 3I71A 2G7HA 3G3ZA 2YR2A 2ZFWA 1R1VA 3HSRA 4L18B 1HQCA 2VODA 3EQLF 2EFWA 3HRMA 4EJUA 1ZG5A 2MH9A 2EJRA 1ONVA 2QM3A 3I5UA 2QENA 2DT5A 3TQNA 2FNAA 1XCVA 1MKMA 4EM2A 2GZWA 5L3EA 1PP8F 1HSJA 1W4MA 1O7LA 4I02A 4LLGF 4ZYEA 4NQWA 2FBIA 3K9TA 4M71A 5JR3A 3V4GA 5IT9Z 5FFZA 4R1HA 2M8EA 3HYIA 3GXOA 1O7FA 1XD7A 1T6SA 5HS7A 3GZ5A 3F8MA 2WC2A 2PQ8A 2M5WA 5E17F 4DQ2A 1BI1A 1B6AA 1V3FA 5E8IA 4RGSA 3TDZC 1GXPA 3L9FA 2M87A 1GVJA 4ZZDA 4I0BA 5L3BA 4AWXB 2M1BA 4S05A 1OMIA 4OU0A 2TDXA 3T1BA 4ZH4F 2O0YA 4RB0A 4LGWA 2F5DA 2ZKZA 1X3UA 2LDUA 1OR7A 2DW4A 4F7ZA 2FBHA 4L5IA 3ERED 4MEXF 3IHUA 1FYKA 1OPCA 2QYOA 3O2PE 3BOQA 3GX4X 3D5LA 1ZREA 3E5UA 2IA2A 1TBXA 4ESBA 3F8NA 1FY7A 3CLOA 2IRFG 1CGPA 3CTAA 4KIGA 3FXUA 5BPDA 1ZLKA 3D0SA 4IRHA 2WV0A 3P9CA 4EVIA 1YO5C 4BH9A 1U8RA 2CFXA 4M6XA 4CYDA 5L3DA 4A0XA 3LWFA 3CUQA 4P9UA 2HYGD 1B9NA 2ZXJA 2Q2EA 4KA4A 3BZ6A 2EWNA 1F4KA 2MC3A 1E17A 4CO8A 3VFZA 2XAFA 5CVIA 3MWMA 1T0FA 4HBLA 4RB3C 2DPUA 4LK1F 2KIUA 1W5SA 5ICCA 2MBFA 5CVUA 3HHHA 1WI9A 5LLQA 2RDPA 4BAYA 4B8XA 4XBFA 1KQ9A 3HSFA 3ZN1A 4Z2YA 5LEKA 2A07F 4YG2F 4WX9A 1RNLA 3RKYA 2R7FA 1Z6RA 3JAMK 5HDNA 3VEPA 3Q5FA 1XN7A 4AIJA 3V8KA 1YYVA 2DPDA 1I5ZA 5DCMA 2IVMA 2GAUA 2G7UA 4LFUA 3T8RA 5HOOA 2FSWA 2Z33A 2QLZA 1WKMA 2IT0A 5TJJA 4B09A 5ICGA 3COAC 4ASNA 3FM5A 3OV8A 2P4WA 1KU2A 2KRFA 1ZRCA 3I59B 4ETSA 3EDPA 5AONA 3WTYC 4A6EA 4OIQF 4LG0B 4YFXF 3R4KA 4GXOA 4E70A 3RPUA 4UV9A 5E1WA 3GWZA 3WU1B 1R5GA 4HA8A 2RVCA 1J5YA 4EMSA 2WTEA 3LA7A 1KYZA 3WTXC 2W24A 1UFMA 3J81K 4CZZA 4JQFA 1Q1HA 5HS9A 3BJOA 1WRJA 3GZ6A 2DFIA 4UVAA 2NAZA 1W7PD 4RS8A 4Q47A 2QBYB 4IHSA 1F9NA 2ISZA 1FNNA 1FSHA 3ZP5A 1BJAA 1YTYA 4PDKA 4I98B 3RDIA 1ZH5A 2MLKA 1SD7A 4UVBA 4U7DA 1R1UA 4G6DA 2DBBA 1FYMA 3F21A 3GVAA 3PFIA 4U7BA 2ISYA 3KCCA 3F8BA 1IRFA 3DPLC 2STWA 2XROA 3TO7A 4MQ9F 5F64A 3V7SA 2V1XA 1J7KA 2VONA 1YQAA 5D8KB 1P4XA 1I1SA 1RI7A 1K79A 4LLNA 4LMYA 4EJVA 3LFKA 3WTZA 2KJCA 4H0EA 1SFEA 2OZ6A 2DLLA 2GA1A 2H6BA 4IRGA 4KIBA 3IL2A 3ZMTA 2K02A 2HTSA 1IUYA 5KK1A 2P8TA 1YW9A 4HDUA 1DPUA 1SFUA 2H09A 2DAOA 2K7LA 1EH8A 1HXDA 1FWZA 4GYGA 2V6CA 2VN2A 1FSEA 4GO1A 4KYWA 4G7HF 4U88A 4WXCA 4Q4ZF 5E1ZB 2YU3A 1XSVA 4I2OA 3C3WA 4L9NA 1K6OA 3SHFA 5ICFA 2Q8KA 1RUOA 1ON2A 2QUFA 5LHGA 3DEUA 3L00A 1ZGAA 1D8KA 5FD6A 3DKWA 3J81Z 3E6DA 1W5TA 3M1EA 5D6FA 2PBIA 1IN5A 1TQMA 3BWGA 2X4HA 2RNJA 2HYFA 1SD4A 2P5LC 3HIFA 5KVRA 1OYWA 4G6QA 3ZPLA 2ZMEB 4AVPA 2ACJA 2KIFA 2NYXA 5J6XA 3MQ0A 4MTDA 2G9WA 1T38A 2GIVA 4LB6B 1PP7U 4OIRF 4CDGA 4PZJA 2EA4A 4TV7A 2FF4A 1RZ4A 2A61A 3DPTA 2O03A 3J80K 5HS8A 3ZMVA 1UHWA 2R3SA 1FC3A 1MDMB 3V8LA 1D8JA 5BS6A 1P6RA 1XGNA 4FT8A 3BDDA 2BEOA 3WGIA 3MEXA 1F1ZA 4KN4X 4MNUA 3KETA 2XKPA 4LJZF 2EFQA 2O3FA 4HZFA 3KP3A 1QO0D 3GF2A 2LNBA 2PI0A 5TRDA 1HW1A 2EA2A 3BP8A 3RYRA 1YIOA 4OIOF 2YX4A 2EFNA 3GO5A 2OBPA 4I0AA 4IPAA 2JPCA 3DXJF 4BNCA 5D5XB 1H9GA 2BGCA 4YIIA 4M6YA 5EEHA 4UUVA 1USTA 2V79A 2IPQX 3I53A 2LF7A 2Y75A 4G94A 2COMA 4L0ZB 2Z3YA 5DV5A 5JHUA 5F1RA 3E97A 5JFRA 2EFPA 1IW7F 1IXCA 3ZN0A 4K2EA 3V7CA 2Z99A 1DPRA 1HSTA 4O3MA 3FMQA 1ZRDA 2ZNYA 1MD0A 1TLHB 1Z7UA 1ZGJA 2DI3A 2P6SA 1FLIA 2ADUA 3QP5A 4HX8A 3QP6A 2QZ8A 5HLGA 1IN4A 4FX0A 2MA3A 1LDJA 1K78A 2PEXA 4U0WA 4QWQA 5LGTA 1QQIA 1OKRA 4A5MA 3FM3A 2GWRA 5DD8A 1BI0A 2H94A 4R8HA 4JK1X 4Y13A 2STTA 2XASA 3QPTA 3WGGA 3DP7A 1FBQA 4ON0A 1IAWA 4ESFA 1IN8A 2O6GE 3F6OA 1S8NA 1G3YA 4RAYA 4XSZF 3T8TA 3S2WA 1P4AA 3SZPA 4WK8F 1FYLA 1W7PB 2VBWA 2K4BA 2UZKA 2CSOA 5K5OA 3E6CC 1HW5A 3F8FA 1LDDA 3QU6A 1G4DA 5D5WB 2HQRA 1AOYA 1V4RA 3KLOA 3F8CA 2EB7A 3FXQA 3ZMZA 2QVOA 1USSA 1Z9CA 1J9IA 3H92A 3VOEA 5A2QK 1SMTA 4RGXA 2W84A 4A12A 1SFXA 1R7JA 3VODA 3WU0A 3PQKA 1PUEE 5D5VB 3ELKA 3R0JA 1KQ8A 3I4PA 4GYIA 1S7OA 3KEOA 3HOTA 4G7OF 1B4AA 2EK5A 4KICA 4U0YA 2Y0MA 4IXAA 4AD9A 4Q48A 1FBUA 3KP2A 2W57A 5DEQA 2A68F 1HKSA 4ENJA 3I0TA 1D3YA 3BY6A 1ZRFA 2YPRA 4L5JA 2ZBKA 3O6BB 3JSPA 1XMAA 2V1DA 3T5XA 4A0ZA 2HFHA 1IRGA 4EJTA 1IN6A 1O57A 4L9JA 3B73A 5FD5A 1REPC 2VOPA 3I58A 2M30A 2PG4A 2HEOA 1IN7A 1XSDA 2FOKA 3LSTA 1UHMA 2DU9A 1GHCA 1TW2A 2IA1A 3SQNA 2HS5A 3ZMDA 1XDSA 4KUMA 2XHKA 2EFOA 4HYEA 1AWCA 1YLFA 2DK5A 2PN6A 2VBXA 2Z5UA 5LHHA 5ED4A 3C18A 3Q9SA 1YS6A 2KJBA 2CGPA 1LVAA 1R1TA 2VXZA 3MZHA 1G3SA 5DD4A 2FA5A 2ZO4A 1I6XA 5LRRA 2VBYA 2XUBA 2PLYA 3GYHX 1L0OC 1O3TA 2HOEA 4WWCA 4CGZA 3E5QA 2P7CB 1G3TA 1FX7A 4HW0A 3DFGA 5D4SA 2QQAA 5CVRA 3PQJA 3T0YA 1Z91A 3IKTA 5A2QZ 1KU7A 2A3SA 3F3XA 1U5TC 5HLIA 3NEUA 5E8GA 3CO7C 4YFNF 2Y48A 5ILSA 4PGGA 2HKOA 1U5TB 4L9TA 2F5CA 2BBYA 1QGPA 2JSCA 3TOBA 4OMZA 4RB2C 4IVNA 3MFKA 1E2XA 1FP1D 5EEGA 4A2UA 2A6EF 4BHBA 4BHPA 5FGMA 5K5RA 3QRFF 2RGVA 2NS0A 1L3LA 3CO6C 1A04A 3E6BA 1BI3A 4G7ZF 2RV8A 1FZPB 3V7RA 3IWFA 5LGNA 4WXDA 2HGCA 1J0RA 3EYIA 1TW3A 2XRNA 4A0YA 2F5EA 1D5VA 1ZHFA 2QQBA 3ROUA 4HQMA 3JAMZ 2CWEA 3K0LA 1KGSA 5FB2A 3E6MA 3WE2A 2KIMA 5H20A 2VE9A 4O5VA 3ECOA 3KP7A 3FXRA 1U3EM 1K7AA 2XGXA 3EUHA 3EYYA 3P7NA 3I59A 4ENKA 3CJNA 2PJPA 1STZA 1S6LA 5D5UB 2LSOA 4HX7A 1QZZA 1ON1A 2ETHA 4HLXA 3GFLA 2VOOA 1R5HA 5HDKA 1R23A 3QPHA 4RGUA 1RUNA 3HRSA 3J7AO 3LAJA 1XDUA 2FBKA 2XAGA 1JXSA 2B0LA 4M9ZA 2CYYA 2KKOA 3U2RA 2L01A 2ELHA 4QLCU 1XCBA 3KP5A 4LK0F 4KFCA 4HF0A 4P96A 4XSXF 2QBYA 4ZYGA 1TQPA 2VBZA 5LHIA 1ODDA 1QPMA 3IRRA 5J8FA 1GXQA 2GXBA 4KIFA 1B9MA 4MQVA 5FLXK 5DYMA 3I54A 3ZMSA 4Y17A 4HV6A 2CW0F 2EV6A 5FO5A 2RN7A 1KU9A 2L3DA 2PFBA 5DUIA 4P55A 1U6GA 1KYWA 4IF4A 1XGOA 3KLNA 1WQ2A 3HTSB 1LB2A 1BN5A 4LB5A 4MTEA 2GQQA 1WWXA 4OOIA 2K27A 3REOA 1VTNC 3C7JA 1Z6TA 3HSEA 3HRUA 3JW4A 3GFJA 2D2WA 2LF8A 4O6JA 1RIOH 1T2KA 5D8LB 3NQOA 1BBYA 5AIQA 3GEZA 3FZVA 4ENMA 1FBSA 2QQ9A 2NNNA 1IXSB 3HOSA 2P6TA 4OIPF 2FE3A 2YX7A 2L4AA 4XLPF 5ICEA 1XGMA 4M72A 2Q0OA 3M9AA 2DK8A 4HAMA 5D4RA 1FP2A 1OYYA 3RKXA 3L09A 3EETA 5ERIA 3OOPA 1HKQA 3IRQA 2RQPA 3ECHA 4G9YA 1S3JA 1BM9A 2OD5A 3KE2A 4L9VA 2L4MA 2MLGA 2BYVE 1XGSA 4UNOA 4UV8A 3KP6A 2VC0A 3F6VA 1G6NA 3AAFA 3FX3A 4MEYF 1P4WA 2OU2A 1LDKB 2OQRA 1F5TA 2K4JA 3QOPA 1MGTA 2E1CA 2PMHA 4NHJA 2RKHA 5LEJA 2GXGA 5E20A 2GA2A 3VB2A 2P7VB 2UXXA 1ZLJA 1EV7A 3CUQC 2E7XA 3SXYA 1P92A 2FU4A 2ZMEA 3CUQB 2FEZA 4ZYDA 2OZUA 4YFKF 1BIBA 2XAHA 1CF7A 3DQVC 1TTYA 5BOXA 2BV6A 1JHFA 2P5KA 1SD5A 5HVQC 5FLXZ 5HLHA 5K5QA 4IRIA 4I7HA 4Q5SF 3SZTA 3B02A 1MJBA 4MHGA 3K1PA 4M9SA 3RIRA 4OMYA 1YG2A 1T39A 1TNSA 1MDMA 2ZJ2A 5F6FA 5BQTA 2V1UA 3WTUC 3MAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAP A;  3JTG A;  4HF2 A;  2A5Y B;  3C1D A;  3SFZ A;  4KN7 X;  3W6K B;  1BC7 C;  3KFW X;  1YS7 A;  3TDU C;  3NRV A;  1I27 A;  1O3Q A;  2CQK A;  3J80 Z;  4UXN A;  4KMF A;  5CVV A;  3LA3 A;  4BHC A;  2JPB A;  1J75 A;  1ZAR A;  3DV8 A;  3RPQ A;  4IJA A;  2H6C A;  1R00 A;  4N0B A;  1O3R A;  3KZY A;  4EV0 A;  3WTV C;  4ZYH A;  5DCM B;  1HKT A;  2CG4 A;  4G8X A;  4AIK A;  1MZB A;  3MCZ A;  4AIH A;  4LD5 A;  1ZG1 A;  4HOB A;  2D1V A;  3L7W A;  5CYV A;  4KMU X;  4CXF A;  1KA8 A;  4M74 A;  3RTR A;  2H27 A;  1YW7 A;  2O8X A;  3DF8 A;  4A6D A;  4N9H A;  3TO6 A;  1IXR C;  2C6Y A;  5J8C A;  4ESJ A;  3WGH A;  1MJ9 A;  4ENN A;  2ZNZ A;  1LEB A;  1YW8 A;  4GGG A;  5L3F A;  1OYI A;  5H6Q A;  2HKX A;  2WWY A;  3R60 A;  3FMR A;  4YIF A;  4HQE A;  1HBX G;  5BMZ A;  3WTT C;  1SD6 A;  4JBA A;  2PMU A;  1TQI A;  4A5N A;  1SAX A;  1H0M A;  1UCR A;  2FXA A;  4FHT A;  1S29 A;  5IT3 A;  2X0L A;  5DDG A;  1NHA A;  1JE8 A;  3RKW A;  1EH6 A;  1J59 A;  4GCV A;  4D0P A;  2BE5 F;  3JTH A;  3V8J A;  1LQ1 A;  2ZCW A;  2HZT A;  1Z1D A;  2VE8 A;  2JT1 A;  3KEQ A;  3K2Z A;  2NNY A;  5JVT A;  4CHU A;  3LA2 A;  5ILU A;  2A6H F;  4N9I A;  4RB1 A;  2XVC A;  1BOA A;  3H3U A;  1DUX C;  2YSR A;  3IWZ A;  1ZN2 A;  4KDP A;  1LNW A;  2XKO A;  3WG9 A;  3MZY A;  1W7P A;  2AS5 F;  5LRS A;  1WSU A;  1LJ9 A;  4NB5 A;  4WCG A;  2W25 A;  3RYP A;  3BRO A;  2FML A;  3O3K A;  1J2X A;  4EM0 B;  3GUD A;  3HRT A;  1FT9 A;  1IF1 A;  3E3V A;  3TKY A;  2HTJ A;  2NRA C;  3GFM A;  3P9K A;  2VT2 A;  3L2C A;  4KNY A;  3G73 A;  2IA0 A;  2OQG A;  3QU3 A;  4BYY A;  1SMY F;  3HUG A;  3LQQ A;  2DQL A;  3F72 A;  3ABT A;  3WTW C;  1JHH A;  1I1G A;  1XB4 A;  3TO9 A;  5E1X A;  1T98 A;  4PCQ A;  2LKP A;  4KT5 C;  5H6R A;  4EJO A;  3P9I A;  3WOD F;  3F22 A;  3WE3 A;  2VT3 A;  3GW2 A;  5E18 F;  3GLX A;  5CLS A;  1S7A A;  4EQQ A;  2HQN A;  5CVJ A;  1BC8 C;  4EJW A;  2DO7 A;  1ZYR F;  2MD5 A;  4UHT A;  3M8F A;  1XMK A;  2CO5 A;  4WXH A;  6PAX A;  1U2W A;  3LQR A;  3M8E A;  4ZZL A;  3N97 A;  1BIA A;  2XAJ A;  1FOK A;  2J5O A;  5DCF A;  1HW2 A;  3QAH A;  2W85 A;  2EV0 A;  5ILV A;  3F23 A;  3GFI A;  3RJP A;  5FFX A;  1PDN C;  2ESH A;  5D6E A;  1YFH A;  4R79 A;  2RC4 A;  3RI4 A;  3M7G A;  1DP7 P;  2D1H A;  2EV5 A;  3ULQ B;  3BJ6 A;  3HTU A;  3ZMU A;  3CUO A;  1B59 A;  2OA4 A;  3W6J B;  1ZAO A;  2XIG A;  3N4M A;  3FHZ A;  4HX4 A;  4BQA A;  1KU3 A;  2E1N A;  3H3Z A;  2IP2 A;  1R58 A;  5LBQ A;  3E5X A;  4FX4 A;  2OAZ A;  3FWE A;  4LG0 A;  1DDN A;  1QNT A;  4P5O A;  5HDG A;  2DTR A;  4HDV A;  2QWW A;  4EGZ A;  5DUK A;  2FQ3 A;  4P9F A;  3ABU A;  3TGN A;  2HR3 A;  3I64 A;  3R61 A;  2O61 A;  4HV5 A;  4RAZ A;  4HF1 A;  1O3S A;  1H9T A;  1JGS A;  3BPV A;  2UWM A;  3KZZ A;  5AIP A;  2HDC A;  1U5T A;  4EM1 A;  1C0W A;  4IHT A;  3R6S A;  1U78 A;  4L0Y B;  5L3G A;  2A69 F;  2L02 A;  4DNC A;  2FMY A;  1TNT A;  2F5F A;  4Y15 A;  5LGU A;  3IC7 A;  4XRF A;  4M73 A;  1QZY A;  4HLY A;  2L54 A;  2IW5 A;  5K1Y A;  4XLN F;  2J5P A;  2XAQ A;  1ULY A;  3ML6 A;  3FMS A;  1FPQ A;  5IT9 K;  5CJ9 A;  4M9X A;  2VC1 A;  4LLL A;  3K69 A;  3K1M A;  1QBJ A;  4MGR A;  3BJA A;  1R22 A;  1R36 A;  2ESN A;  4RGR A;  2AXL A;  4EGY A;  2FNP A;  4I09 A;  1UB9 A;  2D45 A;  2R7D A;  3R0A A;  1EH7 A;  2M45 A;  1BI2 A;  4CIC A;  2P5V A;  1CF7 B;  2JRT A;  1ZG3 A;  2UXN A;  3U1D A;  3ISP A;  2IJL A;  4OIN F;  3KP4 A;  3ZQ7 A;  2MH2 A;  1B1B A;  1K78 B;  1Y0U A;  4PGH A;  1KQ0 A;  2F2E A;  2Z9O A;  3IKV A;  4S04 A;  1LEA A;  2DQR A;  2FRH A;  4U0V A;  3JSO A;  4I01 A;  1P2F A;  2E7W A;  3BPX A;  3TOA A;  1Z05 A;  3Q9V A;  4BXU A;  2JZY A;  2K86 A;  1MJA A;  2HWV A;  5BPI A;  3WTS C;  1G3W A;  1IZ1 A;  3K1N A;  2JTV A;  3CDH A;  1XSX A;  5L3C A;  4WF2 A;  3HHG A;  4UVC A;  5JI6 A;  2XV4 S;  2V9V A;  3FF5 A;  3U9G A;  3I71 A;  2G7H A;  3G3Z A;  2YR2 A;  2ZFW A;  1R1V A;  3HSR A;  4L18 B;  1HQC A;  2VOD A;  3EQL F;  2EFW A;  3HRM A;  4EJU A;  1ZG5 A;  2MH9 A;  2EJR A;  1ONV A;  2QM3 A;  3I5U A;  2QEN A;  2DT5 A;  3TQN A;  2FNA A;  1XCV A;  1MKM A;  4EM2 A;  2GZW A;  5L3E A;  1PP8 F;  1HSJ A;  1W4M A;  1O7L A;  4I02 A;  4LLG F;  4ZYE A;  4NQW A;  2FBI A;  3K9T A;  4M71 A;  5JR3 A;  3V4G A;  5IT9 Z;  5FFZ A;  4R1H A;  2M8E A;  3HYI A;  3GXO A;  1O7F A;  1XD7 A;  1T6S A;  5HS7 A;  3GZ5 A;  3F8M A;  2WC2 A;  2PQ8 A;  2M5W A;  5E17 F;  4DQ2 A;  1BI1 A;  1B6A A;  1V3F A;  5E8I A;  4RGS A;  3TDZ C;  1GXP A;  3L9F A;  2M87 A;  1GVJ A;  4ZZD A;  4I0B A;  5L3B A;  4AWX B;  2M1B A;  4S05 A;  1OMI A;  4OU0 A;  2TDX A;  3T1B A;  4ZH4 F;  2O0Y A;  4RB0 A;  4LGW A;  2F5D A;  2ZKZ A;  1X3U A;  2LDU A;  1OR7 A;  2DW4 A;  4F7Z A;  2FBH A;  4L5I A;  3ERE D;  4MEX F;  3IHU A;  1FYK A;  1OPC A;  2QYO A;  3O2P E;  3BOQ A;  3GX4 X;  3D5L A;  1ZRE A;  3E5U A;  2IA2 A;  1TBX A;  4ESB A;  3F8N A;  1FY7 A;  3CLO A;  2IRF G;  1CGP A;  3CTA A;  4KIG A;  3FXU A;  5BPD A;  1ZLK A;  3D0S A;  4IRH A;  2WV0 A;  3P9C A;  4EVI A;  1YO5 C;  4BH9 A;  1U8R A;  2CFX A;  4M6X A;  4CYD A;  5L3D A;  4A0X A;  3LWF A;  3CUQ A;  4P9U A;  2HYG D;  1B9N A;  2ZXJ A;  2Q2E A;  4KA4 A;  3BZ6 A;  2EWN A;  1F4K A;  2MC3 A;  1E17 A;  4CO8 A;  3VFZ A;  2XAF A;  5CVI A;  3MWM A;  1T0F A;  4HBL A;  4RB3 C;  2DPU A;  4LK1 F;  2KIU A;  1W5S A;  5ICC A;  2MBF A;  5CVU A;  3HHH A;  1WI9 A;  5LLQ A;  2RDP A;  4BAY A;  4B8X A;  4XBF A;  1KQ9 A;  3HSF A;  3ZN1 A;  4Z2Y A;  5LEK A;  2A07 F;  4YG2 F;  4WX9 A;  1RNL A;  3RKY A;  2R7F A;  1Z6R A;  3JAM K;  5HDN A;  3VEP A;  3Q5F A;  1XN7 A;  4AIJ A;  3V8K A;  1YYV A;  2DPD A;  1I5Z A;  5DCM A;  2IVM A;  2GAU A;  2G7U A;  4LFU A;  3T8R A;  5HOO A;  2FSW A;  2Z33 A;  2QLZ A;  1WKM A;  2IT0 A;  5TJJ A;  4B09 A;  5ICG A;  3COA C;  4ASN A;  3FM5 A;  3OV8 A;  2P4W A;  1KU2 A;  2KRF A;  1ZRC A;  3I59 B;  4ETS A;  3EDP A;  5AON A;  3WTY C;  4A6E A;  4OIQ F;  4LG0 B;  4YFX F;  3R4K A;  4GXO A;  4E70 A;  3RPU A;  4UV9 A;  5E1W A;  3GWZ A;  3WU1 B;  1R5G A;  4HA8 A;  2RVC A;  1J5Y A;  4EMS A;  2WTE A;  3LA7 A;  1KYZ A;  3WTX C;  2W24 A;  1UFM A;  3J81 K;  4CZZ A;  4JQF A;  1Q1H A;  5HS9 A;  3BJO A;  1WRJ A;  3GZ6 A;  2DFI A;  4UVA A;  2NAZ A;  1W7P D;  4RS8 A;  4Q47 A;  2QBY B;  4IHS A;  1F9N A;  2ISZ A;  1FNN A;  1FSH A;  3ZP5 A;  1BJA A;  1YTY A;  4PDK A;  4I98 B;  3RDI A;  1ZH5 A;  2MLK A;  1SD7 A;  4UVB A;  4U7D A;  1R1U A;  4G6D A;  2DBB A;  1FYM A;  3F21 A;  3GVA A;  3PFI A;  4U7B A;  2ISY A;  3KCC A;  3F8B A;  1IRF A;  3DPL C;  2STW A;  2XRO A;  3TO7 A;  4MQ9 F;  5F64 A;  3V7S A;  2V1X A;  1J7K A;  2VON A;  1YQA A;  5D8K B;  1P4X A;  1I1S A;  1RI7 A;  1K79 A;  4LLN A;  4LMY A;  4EJV A;  3LFK A;  3WTZ A;  2KJC A;  4H0E A;  1SFE A;  2OZ6 A;  2DLL A;  2GA1 A;  2H6B A;  4IRG A;  4KIB A;  3IL2 A;  3ZMT A;  2K02 A;  2HTS A;  1IUY A;  5KK1 A;  2P8T A;  1YW9 A;  4HDU A;  1DPU A;  1SFU A;  2H09 A;  2DAO A;  2K7L A;  1EH8 A;  1HXD A;  1FWZ A;  4GYG A;  2V6C A;  2VN2 A;  1FSE A;  4GO1 A;  4KYW A;  4G7H F;  4U88 A;  4WXC A;  4Q4Z F;  5E1Z B;  2YU3 A;  1XSV A;  4I2O A;  3C3W A;  4L9N A;  1K6O A;  3SHF A;  5ICF A;  2Q8K A;  1RUO A;  1ON2 A;  2QUF A;  5LHG A;  3DEU A;  3L00 A;  1ZGA A;  1D8K A;  5FD6 A;  3DKW A;  3J81 Z;  3E6D A;  1W5T A;  3M1E A;  5D6F A;  2PBI A;  1IN5 A;  1TQM A;  3BWG A;  2X4H A;  2RNJ A;  2HYF A;  1SD4 A;  2P5L C;  3HIF A;  5KVR A;  1OYW A;  4G6Q A;  3ZPL A;  2ZME B;  4AVP A;  2ACJ A;  2KIF A;  2NYX A;  5J6X A;  3MQ0 A;  4MTD A;  2G9W A;  1T38 A;  2GIV A;  4LB6 B;  1PP7 U;  4OIR F;  4CDG A;  4PZJ A;  2EA4 A;  4TV7 A;  2FF4 A;  1RZ4 A;  2A61 A;  3DPT A;  2O03 A;  3J80 K;  5HS8 A;  3ZMV A;  1UHW A;  2R3S A;  1FC3 A;  1MDM B;  3V8L A;  1D8J A;  5BS6 A;  1P6R A;  1XGN A;  4FT8 A;  3BDD A;  2BEO A;  3WGI A;  3MEX A;  1F1Z A;  4KN4 X;  4MNU A;  3KET A;  2XKP A;  4LJZ F;  2EFQ A;  2O3F A;  4HZF A;  3KP3 A;  1QO0 D;  3GF2 A;  2LNB A;  2PI0 A;  5TRD A;  1HW1 A;  2EA2 A;  3BP8 A;  3RYR A;  1YIO A;  4OIO F;  2YX4 A;  2EFN A;  3GO5 A;  2OBP A;  4I0A A;  4IPA A;  2JPC A;  3DXJ F;  4BNC A;  5D5X B;  1H9G A;  2BGC A;  4YII A;  4M6Y A;  5EEH A;  4UUV A;  1UST A;  2V79 A;  2IPQ X;  3I53 A;  2LF7 A;  2Y75 A;  4G94 A;  2COM A;  4L0Z B;  2Z3Y A;  5DV5 A;  5JHU A;  5F1R A;  3E97 A;  5JFR A;  2EFP A;  1IW7 F;  1IXC A;  3ZN0 A;  4K2E A;  3V7C A;  2Z99 A;  1DPR A;  1HST A;  4O3M A;  3FMQ A;  1ZRD A;  2ZNY A;  1MD0 A;  1TLH B;  1Z7U A;  1ZGJ A;  2DI3 A;  2P6S A;  1FLI A;  2ADU A;  3QP5 A;  4HX8 A;  3QP6 A;  2QZ8 A;  5HLG A;  1IN4 A;  4FX0 A;  2MA3 A;  1LDJ A;  1K78 A;  2PEX A;  4U0W A;  4QWQ A;  5LGT A;  1QQI A;  1OKR A;  4A5M A;  3FM3 A;  2GWR A;  5DD8 A;  1BI0 A;  2H94 A;  4R8H A;  4JK1 X;  4Y13 A;  2STT A;  2XAS A;  3QPT A;  3WGG A;  3DP7 A;  1FBQ A;  4ON0 A;  1IAW A;  4ESF A;  1IN8 A;  2O6G E;  3F6O A;  1S8N A;  1G3Y A;  4RAY A;  4XSZ F;  3T8T A;  3S2W A;  1P4A A;  3SZP A;  4WK8 F;  1FYL A;  1W7P B;  2VBW A;  2K4B A;  2UZK A;  2CSO A;  5K5O A;  3E6C C;  1HW5 A;  3F8F A;  1LDD A;  3QU6 A;  1G4D A;  5D5W B;  2HQR A;  1AOY A;  1V4R A;  3KLO A;  3F8C A;  2EB7 A;  3FXQ A;  3ZMZ A;  2QVO A;  1USS A;  1Z9C A;  1J9I A;  3H92 A;  3VOE A;  5A2Q K;  1SMT A;  4RGX A;  2W84 A;  4A12 A;  1SFX A;  1R7J A;  3VOD A;  3WU0 A;  3PQK A;  1PUE E;  5D5V B;  3ELK A;  3R0J A;  1KQ8 A;  3I4P A;  4GYI A;  1S7O A;  3KEO A;  3HOT A;  4G7O F;  1B4A A;  2EK5 A;  4KIC A;  4U0Y A;  2Y0M A;  4IXA A;  4AD9 A;  4Q48 A;  1FBU A;  3KP2 A;  2W57 A;  5DEQ A;  2A68 F;  1HKS A;  4ENJ A;  3I0T A;  1D3Y A;  3BY6 A;  1ZRF A;  2YPR A;  4L5J A;  2ZBK A;  3O6B B;  3JSP A;  1XMA A;  2V1D A;  3T5X A;  4A0Z A;  2HFH A;  1IRG A;  4EJT A;  1IN6 A;  1O57 A;  4L9J A;  3B73 A;  5FD5 A;  1REP C;  2VOP A;  3I58 A;  2M30 A;  2PG4 A;  2HEO A;  1IN7 A;  1XSD A;  2FOK A;  3LST A;  1UHM A;  2DU9 A;  1GHC A;  1TW2 A;  2IA1 A;  3SQN A;  2HS5 A;  3ZMD A;  1XDS A;  4KUM A;  2XHK A;  2EFO A;  4HYE A;  1AWC A;  1YLF A;  2DK5 A;  2PN6 A;  2VBX A;  2Z5U A;  5LHH A;  5ED4 A;  3C18 A;  3Q9S A;  1YS6 A;  2KJB A;  2CGP A;  1LVA A;  1R1T A;  2VXZ A;  3MZH A;  1G3S A;  5DD4 A;  2FA5 A;  2ZO4 A;  1I6X A;  5LRR A;  2VBY A;  2XUB A;  2PLY A;  3GYH X;  1L0O C;  1O3T A;  2HOE A;  4WWC A;  4CGZ A;  3E5Q A;  2P7C B;  1G3T A;  1FX7 A;  4HW0 A;  3DFG A;  5D4S A;  2QQA A;  5CVR A;  3PQJ A;  3T0Y A;  1Z91 A;  3IKT A;  5A2Q Z;  1KU7 A;  2A3S A;  3F3X A;  1U5T C;  5HLI A;  3NEU A;  5E8G A;  3CO7 C;  4YFN F;  2Y48 A;  5ILS A;  4PGG A;  2HKO A;  1U5T B;  4L9T A;  2F5C A;  2BBY A;  1QGP A;  2JSC A;  3TOB A;  4OMZ A;  4RB2 C;  4IVN A;  3MFK A;  1E2X A;  1FP1 D;  5EEG A;  4A2U A;  2A6E F;  4BHB A;  4BHP A;  5FGM A;  5K5R A;  3QRF F;  2RGV A;  2NS0 A;  1L3L A;  3CO6 C;  1A04 A;  3E6B A;  1BI3 A;  4G7Z F;  2RV8 A;  1FZP B;  3V7R A;  3IWF A;  5LGN A;  4WXD A;  2HGC A;  1J0R A;  3EYI A;  1TW3 A;  2XRN A;  4A0Y A;  2F5E A;  1D5V A;  1ZHF A;  2QQB A;  3ROU A;  4HQM A;  3JAM Z;  2CWE A;  3K0L A;  1KGS A;  5FB2 A;  3E6M A;  3WE2 A;  2KIM A;  5H20 A;  2VE9 A;  4O5V A;  3ECO A;  3KP7 A;  3FXR A;  1U3E M;  1K7A A;  2XGX A;  3EUH A;  3EYY A;  3P7N A;  3I59 A;  4ENK A;  3CJN A;  2PJP A;  1STZ A;  1S6L A;  5D5U B;  2LSO A;  4HX7 A;  1QZZ A;  1ON1 A;  2ETH A;  4HLX A;  3GFL A;  2VOO A;  1R5H A;  5HDK A;  1R23 A;  3QPH A;  4RGU A;  1RUN A;  3HRS A;  3J7A O;  3LAJ A;  1XDU A;  2FBK A;  2XAG A;  1JXS A;  2B0L A;  4M9Z A;  2CYY A;  2KKO A;  3U2R A;  2L01 A;  2ELH A;  4QLC U;  1XCB A;  3KP5 A;  4LK0 F;  4KFC A;  4HF0 A;  4P96 A;  4XSX F;  2QBY A;  4ZYG A;  1TQP A;  2VBZ A;  5LHI A;  1ODD A;  1QPM A;  3IRR A;  5J8F A;  1GXQ A;  2GXB A;  4KIF A;  1B9M A;  4MQV A;  5FLX K;  5DYM A;  3I54 A;  3ZMS A;  4Y17 A;  4HV6 A;  2CW0 F;  2EV6 A;  5FO5 A;  2RN7 A;  1KU9 A;  2L3D A;  2PFB A;  5DUI A;  4P55 A;  1U6G A;  1KYW A;  4IF4 A;  1XGO A;  3KLN A;  1WQ2 A;  3HTS B;  1LB2 A;  1BN5 A;  4LB5 A;  4MTE A;  2GQQ A;  1WWX A;  4OOI A;  2K27 A;  3REO A;  1VTN C;  3C7J A;  1Z6T A;  3HSE A;  3HRU A;  3JW4 A;  3GFJ A;  2D2W A;  2LF8 A;  4O6J A;  1RIO H;  1T2K A;  5D8L B;  3NQO A;  1BBY A;  5AIQ A;  3GEZ A;  3FZV A;  4ENM A;  1FBS A;  2QQ9 A;  2NNN A;  1IXS B;  3HOS A;  2P6T A;  4OIP F;  2FE3 A;  2YX7 A;  2L4A A;  4XLP F;  5ICE A;  1XGM A;  4M72 A;  2Q0O A;  3M9A A;  2DK8 A;  4HAM A;  5D4R A;  1FP2 A;  1OYY A;  3RKX A;  3L09 A;  3EET A;  5ERI A;  3OOP A;  1HKQ A;  3IRQ A;  2RQP A;  3ECH A;  4G9Y A;  1S3J A;  1BM9 A;  2OD5 A;  3KE2 A;  4L9V A;  2L4M A;  2MLG A;  2BYV E;  1XGS A;  4UNO A;  4UV8 A;  3KP6 A;  2VC0 A;  3F6V A;  1G6N A;  3AAF A;  3FX3 A;  4MEY F;  1P4W A;  2OU2 A;  1LDK B;  2OQR A;  1F5T A;  2K4J A;  3QOP A;  1MGT A;  2E1C A;  2PMH A;  4NHJ A;  2RKH A;  5LEJ A;  2GXG A;  5E20 A;  2GA2 A;  3VB2 A;  2P7V B;  2UXX A;  1ZLJ A;  1EV7 A;  3CUQ C;  2E7X A;  3SXY A;  1P92 A;  2FU4 A;  2ZME A;  3CUQ B;  2FEZ A;  4ZYD A;  2OZU A;  4YFK F;  1BIB A;  2XAH A;  1CF7 A;  3DQV C;  1TTY A;  5BOX A;  2BV6 A;  1JHF A;  2P5K A;  1SD5 A;  5HVQ C;  5FLX Z;  5HLH A;  5K5Q A;  4IRI A;  4I7H A;  4Q5S F;  3SZT A;  3B02 A;  1MJB A;  4MHG A;  3K1P A;  4M9S A;  3RIR A;  4OMY A;  1YG2 A;  1T39 A;  1TNS A;  1MDM A;  2ZJ2 A;  5F6F A;  5BQT A;  2V1U A;  3WTU C;  3MAJ A; 
#chains in the Genus database with same CATH topology
 3SDG A;  3LAP A;  1OCP A;  3JTG A;  4HF2 A;  2A5Y B;  3C1D A;  3SFZ A;  3PUF A;  1LE8 B;  4GFB A;  5GPA A;  2R5Z B;  4EEF G;  3MKL A;  4KN7 X;  4XKC A;  3W6K B;  3KFW X;  1BC7 C;  2K9M A;  1YS7 A;  5E3M A;  3TDU C;  3NRV A;  1X4P A;  2W4S A;  1I27 A;  1R9T J;  1O3Q A;  2CQK A;  5C3E J;  2KL4 A;  2CH0 A;  3J80 Z;  2DFE A;  2DXI A;  4UXN A;  4A3F J;  2MC4 A;  4KMF A;  3H3V K;  5CVV A;  3ZXS A;  4IZZ A;  3LA3 A;  2WY7 Q;  4BHC A;  2JPB A;  4D9J A;  1J75 A;  1ZAR A;  3DV8 A;  1GV5 A;  1WH7 A;  1BR4 A;  3FBI B;  4IJA A;  2IEK A;  3RPQ A;  5J47 A;  2H6C A;  1H89 C;  2AO9 A;  3BC8 A;  1W1W E;  1R00 A;  2DJI A;  1ETQ A;  2COB A;  4N0B A;  1O3R A;  1A6I A;  2R7W A;  1Z21 A;  3KZY A;  4EV0 A;  2B7E A;  3WTV C;  1NK3 P;  4ZYH A;  5DCM B;  2LP0 A;  1HKT A;  1WHU A;  3B6A A;  2CG4 A;  4G8X A;  3OYD A;  4AIK A;  2E2I J;  1MZB A;  4I99 C;  2O5R A;  3CQZ J;  3MCZ A;  4AIH A;  3A03 A;  5DM6 F;  3BTI A;  4LD5 A;  1ZG1 A;  4M3B A;  3VYR B;  3CC2 I;  3CZ6 A;  4YEL A;  2DMQ A;  4KJZ A;  4HOB A;  2D1V A;  2DYS H;  3HBL A;  3L7W A;  5CYV A;  2WV1 A;  4XL9 A;  1WJE A;  1SFO J;  2X48 A;  4KMU X;  4XK4 A;  4CXF A;  1KA8 A;  3W3C A;  4M74 A;  3RTR A;  4E7Z A;  4CYC A;  2H27 A;  3J7Z I;  3J7A Y;  4ZYA A;  4J19 A;  3S2H J;  1ORK A;  3PUB A;  1YW7 A;  2O8X A;  3C2G A;  3DF8 A;  4A6D A;  4N9H A;  3TO6 A;  1IXR C;  2C6Y A;  5J8C A;  2W7N A;  4ESJ A;  2HDD A;  1K4S A;  3H36 A;  3WGH A;  3I55 I;  1MJ9 A;  3K4B A;  4ENN A;  2YUS A;  2ZNZ A;  2HPM A;  4XR6 A;  2LBF B;  2DDA A;  1LEB A;  1YW8 A;  4GGG A;  5EYR A;  5L3F A;  1OYI A;  5H6Q A;  2WAD A;  2HKX A;  4QIW N;  2WWY A;  3HOX J;  3LSM A;  1ETO A;  3H35 A;  3K4N A;  3R60 A;  3FMR A;  4YIF A;  4HQE A;  1HBX G;  2XPW A;  5BMZ A;  2LVS A;  2AHQ A;  4BU2 A;  3CJQ B;  3WTT C;  1SD6 A;  4JBA A;  2PMU A;  1NTC A;  1TQI A;  1ZK8 A;  1TWC J;  3L1P A;  2ID6 A;  2ZSI B;  3FXK A;  5M3F J;  4A5N A;  4CCK A;  1SAX A;  2X6Y A;  1H0M A;  1JKQ C;  2WB1 N;  2R7V A;  1UCR A;  2FXA A;  4FHT A;  4RM2 A;  2VQC A;  4D5F A;  2ME6 A;  5HLT A;  3S8P A;  1S29 A;  2KDO A;  5IT3 A;  2QCO A;  2X0L A;  4XKW A;  3G6E I;  1QRY A;  4IQ4 A;  5DDG A;  1NHA A;  1FMW A;  1JE8 A;  3RKW A;  1EH6 A;  4CUG A;  1J59 A;  2CV1 A;  2KQR A;  2UUZ A;  2CFO A;  3LSG A;  4GCV A;  2Y9Z A;  3OYG A;  4D0P A;  1W0U A;  2BE5 F;  3JTH A;  1DGW Y;  3V8J A;  3F0C A;  1N77 A;  2ZCW A;  2HZT A;  1LQ1 A;  1OCT C;  2BOL A;  2DT7 B;  1Z1D A;  2VE8 A;  2JT1 A;  2FX0 A;  3KEQ A;  3S3N A;  2CJJ A;  2EBI A;  3K2Z A;  2NNY A;  5JVT A;  4CHU A;  3LA2 A;  5ILU A;  1SVL A;  2A6H F;  3PM1 A;  4N9I A;  4E7J A;  4RB1 A;  2XVC A;  2LMD A;  3OYF A;  1BOA A;  3H3U A;  3UKG A;  1DUX C;  1Z77 A;  2YSR A;  3IWZ A;  3KYL A;  2H8R A;  1ZN2 A;  3QOE A;  4KDP A;  2DOA A;  3JRF A;  1RET A;  1X2M A;  1LNW A;  2XKO A;  2XC7 A;  3BR0 A;  3WG9 A;  3MZY A;  1W7P A;  2XDV A;  2K85 A;  2ZSH B;  1PUF A;  2AS5 F;  5LRS A;  1WSU A;  2VKH A;  1GUU A;  1LJ9 A;  1T08 B;  3OL3 A;  4UUS A;  1E3O C;  1G59 A;  4YIR X;  4NB5 A;  4WCG A;  2W25 A;  1R5I D;  3RYP A;  2E2J J;  4HNT A;  1ZR4 A;  3BRO A;  4IEJ A;  2FML A;  4XM3 A;  1U9O A;  5B5E C;  2DYR H;  3O3K A;  1VQ9 I;  1O4X A;  1J2X A;  2MGQ A;  1DU0 A;  4EM0 B;  3GUD A;  1G2H A;  4PK4 A;  1U9N A;  1UEL B;  4BGD A;  2GXA A;  3HRT A;  1FT9 A;  1IF1 A;  3E3V A;  3KZI C;  3TKY A;  2HTJ A;  2NRA C;  3GFM A;  4QPO A;  3P9K A;  1WJB A;  1QA6 A;  3LMM A;  2VT2 A;  3L2C A;  4KNY A;  5C4J J;  3G73 A;  3DEW A;  5IP6 A;  1MBF A;  2IA0 A;  4JP0 A;  2OQG A;  3QU3 A;  4BYY A;  1SMY F;  3S32 A;  4RLQ A;  3HUG A;  3LQQ A;  2DQL A;  4MIM A;  4PFO A;  3F72 A;  3ABT A;  3WTW C;  1JHH A;  5JHF A;  1I1G A;  1UAA A;  1XB4 A;  2WAQ N;  3TO9 A;  2QEX I;  2VJ4 A;  3CC4 I;  5E1X A;  3H9G A;  3FHN A;  1T98 A;  2P81 A;  2BY0 A;  2GM4 A;  2MYS A;  4PCQ A;  2V26 A;  2LKP A;  5IY5 H;  3BCA A;  4KT5 C;  5H6R A;  4EJO A;  1NH3 A;  2JN6 A;  3P9I A;  2OC6 A;  3WOD F;  3MKW B;  3F22 A;  3WE3 A;  1X58 A;  1ZKG A;  2VT3 A;  1LFB A;  3GW2 A;  5E18 F;  3GLX A;  2W00 A;  3CDI A;  5CLS A;  2LOO A;  1S7A A;  4EQQ A;  1ACI A;  2Y30 A;  1FEX A;  2HQN A;  4FCY A;  5CVJ A;  1BC8 C;  4EJW A;  3LL7 A;  2DO7 A;  1ZYR F;  2MD5 A;  1V5G A;  4UHT A;  3O8H A;  5B66 C;  3M8F A;  2XB5 A;  2VJI A;  5CQG A;  5KAI C;  1HCR A;  1XMK A;  2CO5 A;  2LH9 A;  4WXH A;  1VQM I;  6PAX A;  1U2W A;  2Y0S A;  3LFU A;  3LQR A;  1WVR A;  3M8E A;  4ZZL A;  3N97 A;  2BW3 B;  4Y52 J;  3HGY A;  1BIA A;  2XAJ A;  2DCE A;  3RSN A;  1FOK A;  1KZH A;  2IBD A;  2J5O A;  5DCF A;  1HW2 A;  2QSH X;  1T8I A;  5F27 A;  3QAH A;  2W85 A;  3NAU A;  2EV0 A;  5ILV A;  3F23 A;  3PL8 A;  3RJP A;  4B48 A;  3GFI A;  5FFX A;  1FIP A;  1PDN C;  2ESH A;  5D6E A;  1YFH A;  2V1N A;  4R79 A;  3OS0 A;  1P9Q C;  4DJA A;  2RC4 A;  3RI4 A;  2F4O B;  1IV6 A;  1POG A;  3WHB A;  2E60 A;  3M7G A;  1DP7 P;  2D1H A;  2EV5 A;  4DW6 A;  4PSW A;  3TBI A;  4PJM A;  3CMA I;  4JX4 A;  3ULQ B;  3I4N J;  4AU7 A;  2X6X A;  2ZXI A;  1ZGW A;  1R6R A;  3BJ6 A;  3HTU A;  3ZMU A;  3LSR A;  3CUO A;  1B59 A;  4IQJ A;  2H1K A;  3BT9 A;  2OA4 A;  2R7T A;  3W6J B;  1ZAO A;  2HU9 A;  2XIG A;  3N4M A;  2EZK A;  3FHZ A;  2Y31 A;  4HX4 A;  4BQA A;  2R7R A;  1KU3 A;  2E1N A;  3AG3 H;  3H3Z A;  3DTE A;  3HGG A;  2IP2 A;  1R58 A;  5LBQ A;  5IYC J;  1IG7 A;  4XLH A;  2F4M B;  3E5X A;  3E1S A;  4KT6 A;  4FX4 A;  4HRI A;  2OAZ A;  3FWE A;  4LG0 A;  1DDN A;  1QNT A;  1AA7 A;  4P5O A;  5HDG A;  2DTR A;  4HDV A;  2OTL I;  3EUA A;  2QWW A;  5E3O A;  1H8A C;  4EGZ A;  4XOR A;  5DUK A;  2FQ3 A;  2BY2 A;  4KIS A;  4P9F A;  3K6G A;  2OF7 A;  3W2W A;  2V9P A;  3ABU A;  1ETK A;  3AG4 H;  1Z7L A;  3TGN A;  2HR3 A;  1X2N A;  1VQN I;  3DKY A;  3I64 A;  3CP2 A;  3R61 A;  4ZDP A;  5IP9 J;  1TWA J;  3ZQH A;  2XRL A;  1VQP I;  4CCJ A;  1T33 A;  2O61 A;  4CCN A;  2CW8 A;  4HV5 A;  2IGM A;  4RAZ A;  4HF1 A;  4AUX A;  1O3S A;  1H9T A;  1JGS A;  3BPV A;  2CQN A;  2RNG A;  2X1D A;  2UWM A;  4BJT A;  5M5X J;  3KZZ A;  5AIP A;  3I4M J;  5GTI C;  2HDC A;  1U5T A;  4EM1 A;  1D0X A;  4PFP A;  1Y8Q B;  1C0W A;  4AC0 A;  4IHT A;  2JA8 J;  2LK2 A;  3R6S A;  1U78 A;  4OAY A;  4L0Y B;  5L3G A;  2A69 F;  2L02 A;  3S16 J;  4DNC A;  5FRO A;  2FMY A;  1TNT A;  1FOY A;  2F5F A;  4XOP A;  4Y15 A;  5LGU A;  3IC7 A;  4XRF A;  4MFE A;  1MIJ A;  3CCE I;  1VFC A;  3L2R A;  4M73 A;  1QZY A;  4HLY A;  3CP8 A;  2L54 A;  2IW5 A;  5K1Y A;  2L9R A;  4ZDL A;  4XLN F;  2J5P A;  2XAQ A;  1I39 A;  4Y7N J;  2MW8 A;  1ULY A;  3ML6 A;  3FMS A;  4E7H A;  1FPQ A;  5IT9 K;  5CJ9 A;  4M9X A;  2ZXH A;  2VC1 A;  3EUK L;  4LLL A;  3K69 A;  4AM3 A;  3K1M A;  4HST A;  1QBJ A;  2E34 A;  4MGR A;  3BJA A;  1R22 A;  4PUS A;  1R36 A;  1HF0 A;  2ESN A;  4IHX A;  4RGR A;  3DBR B;  4G6T B;  2AXL A;  3QWL A;  4A3L J;  4EGY A;  5EGO A;  2FNP A;  4I09 A;  3S17 J;  1UB9 A;  3K4J A;  2QSF X;  2JVH A;  3M8J A;  3SEQ A;  2D45 A;  2KLO A;  2R7D A;  2K9N A;  2M9H A;  3R0A A;  1EH7 A;  3H9Q A;  2M45 A;  1YX5 A;  1BI2 A;  4RBO A;  4CZC A;  4CIC A;  2P5V A;  1CF7 B;  2JRT A;  1ZG3 A;  3VYU B;  2UXN A;  3U1D A;  3ISP A;  2IJL A;  4OIN F;  3KP4 A;  4BDY A;  3ZGK A;  3ZQ7 A;  3QPS A;  2MH2 A;  1B1B A;  1MBG A;  5DS9 A;  1K78 B;  1RPW A;  1Y0U A;  2K9S A;  4PGH A;  5J3L A;  1KQ0 A;  3LSH A;  2F2E A;  2Z9O A;  4D5C A;  3IKV A;  4S04 A;  2Z16 A;  1LEA A;  2DQR A;  2Y69 H;  3H0G J;  2FRH A;  3OYK A;  2EZL A;  3A2K A;  2CQ7 A;  4U0V A;  3GBG A;  2OTJ I;  1Z0X A;  3JSO A;  4X6A J;  3GTM J;  2JMW A;  3OSG A;  4I01 A;  1P2F A;  2E7W A;  3CCV I;  3BPX A;  4XOT A;  3UNG C;  2CQX A;  4XLC A;  3TOA A;  3OYE A;  4I6Z A;  1Z05 A;  3OMY A;  2BY1 A;  3CCY A;  5GAE J;  1UJ8 A;  1Y56 A;  3Q9V A;  4BXU A;  2JZY A;  3OYL A;  2K86 A;  4M3E A;  1MJA A;  2HWV A;  3ZOB A;  1ETY A;  5BPI A;  3WTS C;  4ZDO A;  1G3W A;  3IH4 A;  3RCO A;  1IZ1 A;  3K1N A;  4A93 J;  2JTV A;  3ZRG A;  1XS9 A;  4DIQ A;  3VYS B;  4Y4R A;  3CDH A;  1XSX A;  5L3C A;  4WF2 A;  4ZTJ A;  3HHG A;  4UVC A;  3M4O J;  3A0B C;  4FIS A;  4D7M A;  4AYB A;  1EKE A;  2NS8 A;  5JI6 A;  4U87 A;  2VKD A;  2XV4 S;  2R5Y B;  4BEH B;  2LD5 A;  2V9V A;  2XSD C;  1P7I A;  3FF5 A;  3U9G A;  3G4S I;  1ITY A;  4D1Q A;  3I71 A;  3RQI A;  2G7H A;  3L2U A;  1XG1 A;  4DGW B;  3G3Z A;  2YR2 A;  2ZFW A;  1R1V A;  3HSR A;  4L18 B;  1FIA A;  1HQC A;  2VOD A;  3EQL F;  2EFW A;  4LG3 A;  4E7S A;  1QU3 A;  4B3X A;  3A02 A;  3HRM A;  4EJU A;  1ZG5 A;  2MH9 A;  2JA2 A;  3PNY A;  2EJR A;  3MKZ A;  1ONV A;  1NG6 A;  1GVD A;  2QM3 A;  2FUG 2;  4IOA F;  3I5U A;  4XQF A;  2QEN A;  2DT5 A;  3BCB A;  4Y3O A;  1XPX A;  3H5A A;  3TQN A;  1Y6I A;  2FNA A;  3CCU I;  4A3M J;  1CQT A;  2R7U A;  1XCV A;  1ENH A;  1MKM A;  3LOC A;  4EM2 A;  4FTH A;  2GZW A;  5L3E A;  1PP8 F;  2ZXW H;  1HSJ A;  1W4M A;  1O7L A;  1JTY A;  4I02 A;  4LLG F;  1WPK A;  3FKJ A;  2R7O A;  4E7K A;  4C3I J;  4ZYE A;  4NQW A;  3KPH A;  1TT0 A;  4C2M J;  3JR9 A;  2FBI A;  2M7B A;  3K9T A;  4M71 A;  5JR3 A;  3V4G A;  5IT9 Z;  4DYR A;  4Z6Y A;  4UB6 C;  4C30 A;  5FFZ A;  4F55 A;  1LUJ B;  5FJ8 J;  4R1H A;  2M8E A;  3HYI A;  3GXO A;  3A01 B;  1W5C C;  1O7F A;  1XD7 A;  1T6S A;  2KRH A;  3GZ5 A;  2GBY A;  5HS7 A;  1FTT A;  3F8M A;  2WC2 A;  3I56 I;  1T56 A;  3PNV A;  2PQ8 A;  2JWT A;  5EG0 A;  3DCF A;  3ZQF A;  2M5W A;  3JRH A;  3H0D A;  2L7M P;  4FQG A;  2R92 J;  5E17 F;  5HNH A;  3DTK A;  4DQ2 A;  1BI1 A;  1B6A A;  1V3F A;  5E8I A;  4RGS A;  3TDZ C;  3K2A A;  1GXP A;  2WBM A;  3L9F A;  1GDT A;  2ZC2 A;  2M87 A;  2QKL B;  1GVJ A;  3OWT A;  4ZZD A;  2KT0 A;  4I0B A;  3W2V A;  2HPI A;  5L3B A;  1EJ9 A;  2LRD A;  2X1E A;  1B72 A;  1JT0 A;  1A35 A;  2IGO A;  2Y2Z A;  4AWX B;  1S5L C;  2LYC A;  3G71 I;  4BAC A;  1WJC A;  4BJ6 C;  2M1B A;  1IRZ A;  4S05 A;  1OMI A;  4OU0 A;  5DM7 F;  3SFI A;  2TDX A;  3T1B A;  4ZH4 F;  5M5W J;  2O0Y A;  4RB0 A;  4LGW A;  2F5D A;  4BY7 J;  2MSY A;  2ZKZ A;  1X3U A;  2IGK A;  2LDU A;  1OR7 A;  2DW4 A;  3HB9 A;  4F7Z A;  5K7Z A;  3VSK A;  4B44 A;  4M3F A;  3TMO A;  1MW7 A;  4JYK A;  4A3D J;  3BR6 A;  3CMM A;  2FBH A;  4L5I A;  3ERE D;  4MEX F;  3IHU A;  3MVP A;  1FYK A;  4IHW A;  1RR7 A;  3PSF A;  1OPC A;  2QYO A;  4X1E A;  3O2P E;  3BOQ A;  3GX4 X;  3D5L A;  1A5J A;  1ZRE A;  3E7L A;  1PYV A;  3E5U A;  2IA2 A;  1JKO C;  5FLM J;  1TBX A;  4ESB A;  3F8N A;  1FY7 A;  3CLO A;  4BDZ A;  5KNL A;  2IRF G;  5CQE A;  1CGP A;  3CTA A;  1Z3X A;  4KIG A;  4N4N B;  3OL4 A;  2L9V A;  3TW6 A;  3FXU A;  4XIC A;  5BPD A;  1VQ8 I;  1ZLK A;  3D0S A;  5BNG A;  5KAF C;  4IRH A;  2DA7 A;  2JSP A;  1BW5 A;  1V54 H;  1NG7 A;  5E3L A;  3KYD B;  5FRM A;  3GTP J;  2WV0 A;  3LSJ A;  4Y33 A;  3G1L A;  3P9C A;  1BJZ A;  4NC7 A;  4EVI A;  4II3 A;  1YO5 C;  4BH9 A;  1U8R A;  4XKV A;  2JRM A;  5EZG A;  2CFX A;  3S1R J;  4M6X A;  4CYD A;  5L3D A;  1VQ6 I;  3PO3 J;  1DU6 A;  4A0X A;  1HA8 A;  3LWF A;  2ZJQ F;  2ZJR F;  3CUQ A;  2DOD A;  1Y8R B;  3AG2 H;  2HYG D;  4P9U A;  2NVQ J;  2E1M C;  1B9N A;  1XX5 A;  2ZXJ A;  1X1B A;  4XID A;  1WJA A;  2Q2E A;  1S9H A;  1WJ5 A;  4KA4 A;  2K5C A;  2QSG X;  3BZ6 A;  3S93 A;  3SYT A;  2EWN A;  3B6C A;  3HOZ J;  2E1M B;  1F4K A;  2MC3 A;  1E17 A;  4CO8 A;  2R7S A;  3VFZ A;  1RKW A;  2XAF A;  5CVI A;  1A6Q A;  3MWM A;  3CMY A;  1T0F A;  4BQQ A;  1W36 D;  1TC3 C;  2IGN A;  1YJW I;  2WAE A;  3OR1 C;  4HBL A;  4RB3 C;  2DOE A;  3FBN B;  2DPU A;  4LK1 F;  2KIU A;  4G12 A;  1W5S A;  5ICC A;  2MBF A;  3RQ4 A;  2E1O A;  1B8I A;  5J4V A;  4PJL A;  2JK3 A;  5CVU A;  4X0G A;  2VQL A;  3HHH A;  4FET A;  3CCM I;  1WI9 A;  5LLQ A;  1LE8 A;  4XNF A;  5J1U A;  2RDP A;  2CUZ A;  4BAY A;  4B8X A;  4XBF A;  1KQ9 A;  1JUS A;  3OIO A;  3CLQ A;  2CUE A;  3HSF A;  3ZN1 A;  4Z2Y A;  2R93 J;  2EQR A;  3CME I;  5LEK A;  4XRS G;  5IYB J;  2A07 F;  2KZG A;  4YG2 F;  2O9L A;  3FK6 A;  3BQY A;  4WX9 A;  1RNL A;  3RKY A;  1D0Z A;  3IAM 2;  1OLT A;  2R7F A;  1Z6R A;  2AXT C;  3JAM K;  1WJF A;  2W1O A;  4B4C A;  3Q3S A;  5HDN A;  3VEP A;  3Q5F A;  1XN7 A;  4CH7 A;  4AIJ A;  3S1M J;  3NWS A;  2IAI A;  4ITV A;  3V8K A;  2VIX A;  3ABL H;  1YYV A;  2A6T A;  2DPD A;  1P7J A;  5K7H A;  1I5Z A;  5DCM A;  2IVM A;  5DTD A;  1MSF C;  1YIJ I;  3MD2 A;  2E35 A;  3QOD A;  4BS9 A;  2GAU A;  2X9D A;  2VI6 A;  2R7Z J;  2VUM J;  2G7U A;  5E79 C;  4LFU A;  4B1R A;  3L2W A;  3T8R A;  5HOO A;  1H88 C;  2X51 A;  4GDF A;  2KP6 A;  2FSW A;  1TP4 A;  3ZCO A;  4BUP A;  2Z33 A;  2Y0S N;  2QLZ A;  2DMN A;  1OIS A;  1WKM A;  2IT0 A;  5IOY A;  5TJJ A;  3EUH C;  4B09 A;  5ICG A;  1JJ6 C;  3COA C;  4ASN A;  3IH2 A;  3EPZ A;  3FM5 A;  4F52 A;  3HL2 A;  3BR5 A;  1EF4 A;  4XLA A;  2CRG A;  3OV8 A;  2P4W A;  5EJC A;  2M0C A;  1KU2 A;  1IDY A;  2KRF A;  1ZRC A;  2HDW A;  2DJN A;  3I59 B;  2DA1 A;  1QHH D;  4ETS A;  4RMN A;  3EDP A;  5AON A;  4E4H A;  3WTY C;  2AQE A;  4A3B J;  4W97 A;  4A6E A;  4OIQ F;  4LG0 B;  4YFX F;  2CUF A;  2DA3 A;  1QPI A;  2GOX B;  5FRN A;  3R4K A;  4GXO A;  3VDX A;  2WA0 A;  1BR1 A;  4E70 A;  5KHD A;  3RPU A;  1WH5 A;  2CW7 A;  1JKR C;  1I6H J;  4UV9 A;  3HM5 A;  2D5V A;  5E1W A;  3GWZ A;  3WU1 B;  1R4N B;  1R5G A;  4HA8 A;  4LOC A;  2RVC A;  1J5Y A;  4EMS A;  2WTE A;  3LA7 A;  2BVM A;  1KYZ A;  3V42 A;  3WTX C;  2W24 A;  3M1C A;  1UFM A;  1VZ0 A;  3J81 K;  2VQG A;  1AKH B;  3HPG A;  4CZZ A;  1DQU A;  4JQF A;  1Q1H A;  5HS9 A;  3BJO A;  1WRJ A;  3KX2 A;  1VQO I;  3CJT B;  3GZ6 A;  2DFI A;  5F0H A;  4UVA A;  4M3G A;  9ANT A;  2NAZ A;  2RQQ A;  1W7P D;  3BTL A;  1E3P A;  4RS8 A;  2LTP A;  4Q47 A;  2QBY B;  4IHS A;  1FTZ A;  1F9N A;  2PJR B;  3BZC A;  4BE2 A;  3GTJ J;  2OJE D;  2ISZ A;  1KON A;  1FNN A;  3HXL A;  2HQ5 A;  4P1W A;  4HNU A;  4A69 C;  1FSH A;  2HVQ A;  1BJA A;  3BTC A;  3ZP5 A;  2NOG A;  2GOM A;  2EH3 A;  2W82 A;  4PDK A;  1YTY A;  3MN2 A;  2KMU A;  4I98 B;  5KCM A;  3RDI A;  2PMZ A;  1ZH5 A;  3HJE A;  2JUC A;  1B8I B;  3MAJ A;  2LG4 A;  3K4L A;  2MLK A;  1SD7 A;  1UZC A;  3TED A;  4UVB A;  1R1U A;  4G6D A;  3CF2 A;  2DBB A;  4U7D A;  1YJ9 I;  1FYM A;  3F21 A;  1VQ7 I;  3GVA A;  3PFI A;  4CCM A;  4XRS A;  4U7B A;  1DGR M;  2ISY A;  5F0F A;  4CCL A;  3KCC A;  3F8B A;  1IRF A;  3DPL C;  2CQQ A;  5GAG J;  2XRO A;  3TO7 A;  3HZJ A;  4MQ9 F;  3QYF A;  5F64 A;  2STW A;  3V7S A;  4XLE A;  2L9S A;  1YIT I;  2V1X A;  2P0W A;  1J7K A;  1MMN A;  2VON A;  2HYJ A;  4AVZ A;  4IHY A;  1YQA A;  5D8K B;  1P4X A;  2DMU A;  1D5Y A;  1I1S A;  1ERD A;  1RI7 A;  1I3Q J;  1K79 A;  4C3H J;  4LLN A;  2QA4 I;  1VQK I;  4LMY A;  4EJV A;  1U0J A;  1ZEL A;  3LFK A;  4HSR A;  3BG9 A;  3WTZ A;  4E6K G;  2KJC A;  3BTJ A;  1SFE A;  4H0E A;  4B43 A;  1ETX A;  2OZ6 A;  2DLL A;  2GA1 A;  2H6B A;  3BG7 A;  4IRG A;  2M8G X;  1SAN A;  4KIB A;  2LC2 A;  3IL2 A;  2KRC A;  2CU7 A;  3ZMT A;  2H1L A;  2K02 A;  2V6E A;  2HTS A;  1TZL A;  1IUY A;  5KK1 A;  1MH4 A;  4IHV A;  4A3G J;  2P8T A;  5E3N A;  1IDZ A;  1YW9 A;  4HDU A;  1HOM A;  4NC8 A;  1SFU A;  4II2 A;  1DPU A;  3LSP A;  1A36 A;  4FE7 A;  1Y0N A;  2H09 A;  2DAO A;  2K7L A;  2XPV A;  1EH8 A;  4BBR J;  4H4K C;  2X85 A;  1HXD A;  1UG2 A;  1FWZ A;  4GYG A;  1J09 A;  2V6C A;  2V9K A;  2VN2 A;  1FSE A;  4GO1 A;  4KYW A;  3MKY B;  4U88 A;  4G7H F;  4DYQ A;  2VXD A;  2DOF A;  2ZB9 A;  2JA6 J;  4WXC A;  4Q4Z F;  5E1Z B;  5HOD A;  4ZTF A;  1JJ8 C;  1M1E B;  2DA2 A;  2DA6 A;  2YU3 A;  3GZN B;  4LIU A;  2R0Q C;  1XSV A;  5IPA A;  4I2O A;  1D1A A;  3RKQ A;  3TL4 X;  4ANJ A;  2L2O A;  3C3W A;  4L9N A;  4XON A;  1K6O A;  2X1C A;  4NDL A;  1HDD C;  1ZTR A;  3SHF A;  4BE0 A;  3OSF A;  5ICF A;  1WI3 A;  1YRN B;  2Q8K A;  2HI3 A;  3ONQ A;  1RUO A;  1ON2 A;  2QUF A;  4M6V A;  2FOW A;  5LHG A;  2MG4 A;  3DEU A;  2JQ7 A;  3L00 A;  1ZGA A;  3PFY A;  2DN0 A;  1HC8 A;  4MFD A;  1D8K A;  5FD6 A;  1QHG A;  3DKW A;  3J81 Z;  2B63 J;  3E6D A;  1W5T A;  2QF7 A;  2V7F A;  3M1E A;  5D6F A;  2ZME C;  2PBI A;  1IN5 A;  1TQM A;  3ASO H;  2IS2 A;  4C3J J;  3BWG A;  2X4H A;  2RNJ A;  2HYF A;  1TWG J;  1SD4 A;  3N05 A;  2P5L C;  3K4K A;  2K40 A;  3HIF A;  5KVR A;  4BXF A;  1OYW A;  1JTX A;  4G6Q A;  2M0M A;  3ZPL A;  1X1A A;  4BBS J;  2M2E A;  2ZME B;  4AYB N;  4AVP A;  4L5E A;  5FKK A;  3QPL A;  2ACJ A;  1Y39 A;  3OYM A;  2KIF A;  2NYX A;  1TWF J;  2ID3 A;  4JOM A;  3BR3 A;  5J6X A;  3MQ0 A;  4MTD A;  2G9W A;  1T38 A;  3SZG A;  1VQ5 I;  2GIV A;  4LB6 B;  1PP7 U;  1VQ4 I;  3GTK J;  2DDB A;  4OIR F;  3A0H C;  4CDG A;  4PZJ A;  1Y1V J;  2EA4 A;  2FF4 A;  1RZ4 A;  1QVT A;  4TV7 A;  2A61 A;  1MMA A;  5LD2 C;  4NBQ A;  3DPT A;  2O03 A;  3BR2 A;  1YX3 A;  4BQN A;  3J80 K;  4CA0 A;  3RZO J;  5HS8 A;  2KIQ A;  3ZMV A;  3PSI A;  4AID A;  1UHW A;  2R3S A;  1FC3 A;  1IO2 A;  4XLF A;  3V8L A;  1MDM B;  4BJ5 C;  1D8J A;  5BS6 A;  2OPT A;  1P6R A;  4UY8 I;  1XGN A;  2JVG A;  3H5N A;  2OCE A;  3OS1 A;  3OR2 C;  4FT8 A;  2L7F P;  3BDD A;  2BEO A;  3WGI A;  1W36 C;  4A3C J;  2LKS A;  3MEX A;  1F1Z A;  4KN4 X;  2WY8 Q;  1BW6 A;  3AL0 C;  4MNU A;  1BA5 A;  3KET A;  2XKP A;  4LJZ F;  2EFQ A;  2O3F A;  4HZF A;  2RRE A;  3KP3 A;  1QO0 D;  3GF2 A;  4BKX A;  2LNB A;  2L5Q A;  2PI0 A;  3AL0 B;  1V5F A;  5TRD A;  1HW1 A;  2EA2 A;  3GTQ J;  3BP8 A;  1MNE A;  2M4G A;  3RYR A;  1YIO A;  1A31 A;  4OIO F;  2EIM H;  5F1J A;  1OJL A;  1JT6 A;  2EFN A;  2YX4 A;  3RZD J;  4BXX J;  3GO5 A;  5FKN A;  2VJJ A;  3S1N J;  5TIS C;  2OBP A;  2BVL A;  3DWL E;  3AG1 H;  4I0A A;  2L7K A;  5B3S H;  3I3L A;  5M3M J;  4IPA A;  2JPC A;  2OUM A;  3DXJ F;  4BNC A;  2L7Z A;  5D5X B;  2QKM B;  3BG6 A;  1H9G A;  3HOW J;  2BGC A;  5J1R A;  1MND A;  4YII A;  1MBJ A;  4M6Y A;  2F5V A;  2E36 A;  5EEH A;  1DP3 A;  2E5Z A;  1MBK A;  1YJN I;  4FE4 A;  1N78 A;  4CYC B;  4UUV A;  2EIK H;  4BE1 A;  4LIT A;  1UST A;  2V79 A;  4XN3 A;  2VPL A;  2IPQ X;  3I53 A;  2LF7 A;  2Y75 A;  4ZJZ A;  4G94 A;  3S2D J;  2JUG A;  4HNV A;  1S7E A;  2COM A;  2LFB A;  4L0Z B;  2ELK A;  2Z3Y A;  3O8G A;  5DV5 A;  5TGT A;  1UHS A;  5JHU A;  5F1R A;  2NVY J;  3E97 A;  2EFP A;  5JFR A;  5J1Y A;  1U8B A;  2XF7 A;  3FIW A;  1IW7 F;  1IXC A;  3ZN0 A;  3CJR B;  4K2E A;  3DEE A;  5LFA A;  3V7C A;  1WCM J;  2Q1Z B;  2BHY A;  2LY9 A;  2Z99 A;  1DPR A;  1HST A;  2EIN H;  2EIL H;  4O3M A;  3FMQ A;  2KFD A;  5H2F C;  3SEZ A;  1ZRD A;  3S14 J;  2ZNY A;  3IV5 A;  1MD0 A;  4DBQ A;  1D0Y A;  2ICW G;  1TLH B;  1Z7U A;  1ZGJ A;  2DI3 A;  2P6S A;  3DTI A;  1FLI A;  2ADU A;  4CCO A;  3QP5 A;  3S3O A;  4HX8 A;  3QP6 A;  1T0F C;  2QZ8 A;  5HLG A;  1IN4 A;  4FX0 A;  3GTL J;  2MA3 A;  3C2H A;  2NOJ B;  1LDJ A;  1K78 A;  2PEX A;  4U0W A;  4QWQ A;  5LGT A;  1SAU A;  1IGN A;  5EZH A;  1QQI A;  3S1Q J;  3OYI A;  1OKR A;  4A5M A;  3FM3 A;  1TWH J;  2GWR A;  5DD8 A;  1EA3 A;  4RAF A;  5CKT A;  5F08 A;  3AFH A;  1BI0 A;  2H94 A;  5GP9 A;  4F91 B;  4R8H A;  3G1O A;  2LRE A;  5M5Y J;  4JK1 X;  4Y13 A;  2STT A;  4DBR A;  2XAS A;  5C4X J;  3QPT A;  1JKP C;  3OYB A;  2NVU B;  3WGG A;  3L2V A;  3DP7 A;  3D5R C;  3FXO A;  3GTO J;  1APL C;  3AKZ A;  1FBQ A;  4ON0 A;  1IAW A;  4ESF A;  1Z67 A;  1IN8 A;  2O6G E;  3F6O A;  2XB0 X;  2CMP A;  3Q0U A;  1S8N A;  3HDD A;  1G3Y A;  4XN0 A;  3F9K A;  4RAY A;  4XSZ F;  4ZC3 A;  3T8T A;  3S2W A;  1P4A A;  3D5S C;  3SZP A;  4WK8 F;  1FYL A;  1W7P B;  1ZR2 A;  1LVK A;  1OCR H;  2M7A A;  3H1C A;  2IS1 A;  1PUF B;  3K10 A;  3OIQ A;  1RC9 A;  2VBW A;  5IP7 J;  2K4B A;  4UUS B;  2CSO A;  2UZK A;  5K5O A;  3E6C C;  2B9S A;  2R7Q A;  1HW5 A;  3F8F A;  1LDD A;  3QU6 A;  1G4D A;  2R5Y A;  4RA2 A;  4BEH A;  5D5W B;  2HQR A;  5K7F A;  1ETV A;  2A5W A;  2JJ7 A;  2XPU A;  4PSX A;  4FAS D;  2IS6 A;  2O8K A;  3BQZ A;  2HQA A;  3GLL A;  1AOY A;  2E71 A;  1V4R A;  3KLO A;  3F8C A;  2EB7 A;  1JGG A;  3FXQ A;  1G8X A;  3ZMZ A;  2ME0 A;  3SDB A;  3DLA A;  2QVO A;  1OCC H;  1USS A;  1V5E A;  1Z9C A;  2JA5 J;  3H92 A;  3VOE A;  5A2Q K;  1FOX A;  1J9I A;  1SMT A;  4RGX A;  3G2B A;  2H8W A;  1TL8 A;  3CDL A;  3HEF A;  3X2Q H;  3HUG B;  2W84 A;  3Q0V A;  4DYC A;  3JRC A;  4A12 A;  4F3Q A;  2OCC H;  1FMV A;  3HPH A;  2BY3 A;  4J01 A;  1LFU P;  1SFX A;  1R7J A;  2OV7 A;  3VOD A;  3WU0 A;  1OCO H;  3PQK A;  3IP4 B;  3JCU C;  3VPR A;  1PUE E;  5D5V B;  3ELK A;  3R0J A;  3ZQG A;  1KQ8 A;  3I4P A;  4GYI A;  1S7O A;  2DA5 A;  4J00 A;  3KEO A;  3HOT A;  4G7O F;  1VND A;  2YS9 A;  2UV1 A;  2BHZ A;  1B4A A;  2EK5 A;  4KIC A;  4U0Y A;  4NUB A;  1K4T A;  2Y0M A;  3ERM A;  4IXA A;  4AD9 A;  3QYE A;  4Q48 A;  2HOA A;  2KIS A;  1FBU A;  2AQF A;  2M34 A;  3KP2 A;  2W57 A;  5DEQ A;  4NC6 A;  2A68 F;  3A01 A;  2TCT A;  1HKS A;  4ENJ A;  3ZQL A;  3I0T A;  2BXY A;  5GTH C;  1D3Y A;  3BY6 A;  4PJJ A;  1ZRF A;  1RES A;  2YPR A;  4OWR B;  3K70 C;  4L5J A;  1YOV B;  4V2F A;  1K61 A;  2ZBK A;  3A4C A;  3KEY A;  3O6B B;  2R5Z A;  3JSP A;  1XMA A;  2XGD A;  3S15 J;  2V1D A;  3E0J B;  3T5X A;  2GIZ A;  4A0Z A;  3OY9 A;  2HFH A;  4HPQ A;  4NNJ A;  4S0H B;  2LKX A;  1IRG A;  4EJT A;  1IN6 A;  1O57 A;  4L9J A;  3B73 A;  5FD5 A;  2F4I A;  3QYB A;  4HG2 A;  1OCZ H;  2DFF A;  2CV2 A;  2KDZ A;  1REP C;  4IKF A;  2VOP A;  3BLY A;  5C44 J;  3I58 A;  2I8D A;  1Q1V A;  5B1B H;  3DU5 A;  2M30 A;  2PG4 A;  2HEO A;  1IN7 A;  3PIP F;  1WFX A;  1XSD A;  2FOK A;  3NWT A;  2KPM A;  3LST A;  1UHM A;  2DU9 A;  1GHC A;  4QPQ A;  3JRA A;  3JRD A;  3QQA A;  3CCQ I;  1TW2 A;  2IA1 A;  3SQN A;  4C9Y A;  2HS5 A;  2KZV A;  3ZMD A;  1XDS A;  4KUM A;  4BY1 J;  4C2T A;  1SVM A;  2XHK A;  2HVS A;  2EFO A;  4M3D A;  4HYE A;  1AWC A;  4V19 K;  1JUM A;  5J40 A;  1YLF A;  2R7X A;  4DOZ A;  2DK5 A;  2PN6 A;  2VBX A;  2LY1 A;  1SFK A;  3DKX A;  2ELJ A;  3HOV J;  3DLL F;  2Z5U A;  5LHH A;  5ED4 A;  4MLO A;  4RM3 A;  2WB1 A;  3W6V A;  3C18 A;  3Q9S A;  1SEU A;  4ABZ A;  1YS6 A;  2KJB A;  2CGP A;  1LVA A;  1R1T A;  2VXZ A;  2BXZ A;  3MZH A;  2K3P A;  1AU7 A;  3M3Y J;  5IOZ A;  1G3S A;  2HZD A;  3ASN H;  2LBF A;  3CCL I;  1R4M B;  2PMZ N;  5DD4 A;  2FA5 A;  5FKO A;  2ZO4 A;  1I6X A;  2M3A A;  5LRR A;  2VBY A;  4D7N A;  2XUB A;  2PLY A;  3GYH X;  2HNH A;  1L0O C;  1O3T A;  2HOE A;  4WWC A;  1WGX A;  3TP0 A;  4CGZ A;  3E5Q A;  2P7C B;  1G3T A;  1FX7 A;  4HW0 A;  1WJD A;  3DFG A;  5D4S A;  2ZFU A;  2QQA A;  3H9J A;  5CVR A;  1SVO A;  4IOC F;  1VI0 A;  3PQJ A;  4OAZ A;  3FK7 A;  2VJ5 A;  3K7A J;  3T0Y A;  1Z91 A;  3IKT A;  5A2Q Z;  4A3E J;  2FQ4 A;  1KU7 A;  2A3S A;  1QZE A;  1U5T C;  3F3X A;  5HLI A;  3NEU A;  1UMQ A;  5E8G A;  2I5U A;  3OYH A;  3CO7 C;  4YFN F;  2Y48 A;  3G1M A;  2VKE A;  5ILS A;  4PGG A;  2HKO A;  3LNQ A;  1U5T B;  4L9T A;  2RAE A;  2F5C A;  2BBY A;  1QGP A;  3HG9 A;  3HOU J;  2DMT A;  2JSC A;  3TOB A;  1X1D A;  2O7O A;  4OMZ A;  1S72 I;  4RB2 C;  4IVN A;  3MFK A;  1IUF A;  1D1C A;  3WU2 C;  1LPQ A;  4RAG A;  4MO7 A;  1E2X A;  1FP1 D;  3HOY J;  5FKL A;  1UG0 A;  5EEG A;  4A2U A;  2A6E F;  1I3A A;  3LSI A;  4BHB A;  4BHP A;  1X19 A;  5FGM A;  5K5R A;  1F43 A;  2VLA A;  2K3F A;  1XC5 A;  2MFZ A;  3HKZ N;  3GTG J;  3QRF F;  2JA7 J;  2RGV A;  2NS0 A;  4PJN A;  1L3L A;  3CO6 C;  1A04 A;  3E6B A;  1BI3 A;  4G7Z F;  2QGU A;  2MD0 A;  2VQH A;  2RV8 A;  1FZP B;  1TT5 B;  2NS7 A;  2L0K A;  1XMX A;  1HDP A;  4LIV A;  3V7R A;  5EF6 A;  3IWF A;  4F92 B;  2M4K A;  1X4O A;  1FOW A;  3ABM H;  1K83 J;  2DMP A;  5LGN A;  1RRJ A;  4WXD A;  1AHD P;  2WAQ A;  2HGC A;  1FJL A;  1J0R A;  4W1U A;  3ZR8 X;  3VWB A;  3EYI A;  1TW3 A;  2XRN A;  5EGO B;  2K9L A;  4UB8 C;  4A0Y A;  3FDY A;  2LY2 A;  1OFC X;  2F5E A;  1D5V A;  2LLK A;  3PNT A;  3FIS A;  4BQO A;  1ZHF A;  2L9N A;  2QQB A;  3ROU A;  4HQM A;  3JAM Z;  2CWE A;  3K0L A;  4CSW A;  1KGS A;  5FKM A;  5FB2 A;  3E6M A;  3WE2 A;  2KIM A;  4B47 A;  5H20 A;  1GLN A;  2VE9 A;  4O5V A;  3ECO A;  3KP7 A;  5JLX A;  4UUT A;  3FXR A;  3U1K A;  1U3E M;  1ZQ3 P;  1K7A A;  3RPU D;  1X3Z B;  2XGX A;  2MAB A;  3EUH A;  3GCM A;  3EYY A;  1RR8 C;  3OIP A;  2KHM A;  3P7N A;  2XGE A;  3JRE A;  2XAU A;  3I59 A;  3PO2 J;  2BZT A;  3NAR A;  4F93 B;  4ENK A;  1IV8 A;  2LR8 A;  3CJN A;  4XRM A;  3M07 A;  1PJR A;  3SJM A;  3CES A;  2PJP A;  1STZ A;  1S6L A;  5GAH J;  3HKZ A;  1YI2 I;  3JRB A;  5D5U B;  1VQL I;  2LSO A;  2IXS A;  3K70 D;  4HX7 A;  1QZZ A;  2F48 A;  2K9Q A;  2VKV A;  1ON1 A;  2ETH A;  4HLX A;  3GFL A;  2HOS A;  2VOO A;  3MZ8 A;  3A1Y A;  4BL0 B;  1YHQ I;  3ESW B;  1R5H A;  2I10 A;  5HDK A;  2Z2S B;  1R23 A;  3DBH B;  5EEA A;  3QPH A;  4RGU A;  1RUN A;  3HRS A;  3J7A O;  3OYN A;  3LAJ A;  5JLW A;  3CC7 I;  1XDU A;  3BG5 A;  4XKB A;  2HXO A;  2FBK A;  2N8G A;  2XAG A;  3OYA A;  2R4G A;  1AKH A;  3FKI J;  1JXS A;  2B0L A;  4M9Z A;  2CYY A;  2KKO A;  3U2R A;  3TW7 A;  1WZ2 A;  2A05 A;  1F36 A;  2Y9Y A;  2L01 A;  2ELH A;  4DZJ A;  4QLC U;  2HOT A;  1XCB A;  3KP5 A;  1Z3Y A;  4LK0 F;  4KFC A;  4HF0 A;  4P96 A;  4XSX F;  2BW3 A;  2QBY A;  4ZYG A;  2X6O A;  3OS2 A;  2PJR A;  1TQP A;  2ECC A;  2TRT A;  2VBZ A;  5LHI A;  1ODD A;  1QPM A;  3IRR A;  3Q0W A;  5J8F A;  4GRI A;  1GXQ A;  2GXB A;  4KIF A;  1B9M A;  4MQV A;  1BL0 A;  3CCR I;  3LSK A;  3IUO A;  5GPC A;  5FLX K;  2E5N A;  5DYM A;  3I54 A;  4IL6 C;  3CCS I;  3VYT B;  2EPF A;  2EIJ H;  2DA4 A;  3ZQI A;  3ZMS A;  2ECB A;  2XF5 A;  4Y17 A;  4HV6 A;  2CW0 F;  2EV6 A;  5FO5 A;  2Z1D A;  4V2G A;  3TP3 A;  2RN7 A;  1KU9 A;  2L3D A;  3CCJ I;  2DFH A;  2PFB A;  3WTU C;  2VB6 A;  4B3A A;  5DUI A;  1V55 H;  4P55 A;  1N75 A;  3KYC B;  1U6G A;  1KYW A;  4IF4 A;  1XGO A;  2VL8 A;  3KLN A;  1BR2 A;  1WQ2 A;  1LFP A;  3HTS B;  4JX5 A;  3DPU A;  1Y1W J;  4HEA 2;  2IS4 A;  3BR1 A;  1LB2 A;  1X3W B;  1BN5 A;  4LB5 A;  4RDU A;  1BOB A;  4MTE A;  4JX6 A;  2GQQ A;  1WWX A;  4OOI A;  4NQW B;  4KIT B;  2K27 A;  2XF6 A;  3D1N I;  3REO A;  3OYC A;  4N4O B;  1VTN C;  3C7J A;  2CUJ A;  2VPR A;  1Z6T A;  3HSE A;  5CPR B;  2WAF A;  3HRU A;  5J4Y A;  3JW4 A;  3GFJ A;  2D2W A;  2LF8 A;  4O6J A;  4DZP A;  1RIO H;  2E19 A;  1T2K A;  4YEJ A;  5D8L B;  3ZQC A;  4E7I A;  3CF5 F;  3IAS 2;  1BBY A;  3NQO A;  1VF9 A;  5AIQ A;  3WG7 H;  3GEZ A;  3FZV A;  4ENM A;  4A3K J;  1FBS A;  5EG0 B;  3JRI A;  4I76 A;  2QQ9 A;  2QQ8 A;  2NNN A;  3U21 A;  1IXS B;  1OQY A;  3HOS A;  2P6T A;  3KIO A;  4OIP F;  2DTZ A;  2FE3 A;  1MH3 A;  2YX7 A;  2L4A A;  4XLP F;  5ICE A;  2EZH A;  1JUP A;  4PJ0 C;  1XGM A;  4M72 A;  2Q0O A;  1LKX A;  2V4J C;  3M9A A;  2EZI A;  5F04 A;  3WHC A;  3MMY B;  2DK8 A;  4HAM A;  5D4R A;  1FP2 A;  2YU9 J;  4YRV A;  1B72 B;  1OYY A;  1YE9 A;  3RKX A;  3L09 A;  3EET A;  1OR7 C;  2W48 A;  5ERI A;  3I9V 2;  2G0E A;  3OOP A;  1HKQ A;  1K6Y A;  4A3I J;  3IRQ A;  3JRG A;  2RQP A;  2HVR A;  3ECH A;  4G9Y A;  1S3J A;  4QTR A;  2F6C A;  1MMD A;  3FXM A;  4C2U A;  3GME A;  1MMG A;  1BM9 A;  3IH3 A;  2PX9 A;  1MMS A;  2OD5 A;  3VSL A;  3FXL A;  3KE2 A;  4L9V A;  2L4M A;  2CV0 A;  2MLG A;  5B1A H;  2BYV E;  2CS3 A;  1JI8 A;  1XGS A;  4UNO A;  5IYD J;  4UV8 A;  5F0C A;  3KP6 A;  3ZQQ A;  2XGC A;  5JVG F;  3OYJ A;  3S3M A;  5FLV A;  5EDN A;  2VC0 A;  2NVX J;  3F6V A;  1XTA A;  1G6N A;  1YRN A;  2DT6 A;  3AAF A;  3FX3 A;  4MEY F;  4IX7 A;  2NVT J;  1P4W A;  2OU2 A;  1LDK B;  2OQR A;  1E3H A;  3HC7 A;  1F5T A;  2K4J A;  1D1B A;  1IC8 A;  3QOP A;  2E2H J;  1MGT A;  2E1C A;  2PMH A;  2HXI A;  1MSE C;  4NHJ A;  2RKH A;  5LEJ A;  1W0T A;  2GXG A;  5E20 A;  2GA2 A;  3VB2 A;  3BG3 A;  3K4C A;  4XMY A;  2P7V B;  3K4M A;  3P5J A;  5HNF A;  3PIO F;  1GT0 C;  2UXX A;  1ZLJ A;  1EV7 A;  2FD5 A;  3CUQ C;  4IO9 F;  1HLV A;  2E7X A;  1PVE A;  3SXY A;  2FJ1 A;  3OOU A;  1P92 A;  1NK2 P;  3W2A A;  2FU4 A;  2XSJ C;  1R71 A;  1IJW C;  2ZME A;  3CUQ B;  2FEZ A;  4ZYD A;  2OZU A;  4YFK F;  1BIB A;  2XAH A;  2Q2E B;  1CF7 A;  3J7Y J;  1E0E A;  3DQV C;  1TTY A;  5BOX A;  1QVU A;  3H5R A;  3CD6 I;  1MBH A;  1SC7 A;  2BV6 A;  1JHF A;  2NXN B;  2P5K A;  5GAD J;  3UR3 C;  1SD5 A;  5HVQ C;  5FLX Z;  4EAT A;  2GLO A;  3PJR A;  4QSH A;  2VAS A;  3L2Q A;  1R49 A;  5HLH A;  5K5Q A;  4IRI A;  4I7H A;  1X1C A;  3ABK H;  4A3J J;  4Q5S F;  1ETW A;  1N25 A;  3SZT A;  3B02 A;  1MJB A;  3DU6 A;  3K1P A;  4MHG A;  4E7L A;  3FXJ A;  3BZK A;  1I50 J;  4M9S A;  3RIR A;  4RLF A;  1MNM C;  4OMY A;  1T95 A;  1YG2 A;  2X6W A;  2ZJP F;  1T39 A;  1TNS A;  1MDM A;  1RKT A;  2ZJ2 A;  1X1P A;  5F6F A;  1MBE A;  5BQT A;  2V1U A;  1IRX A;  1GV2 A;  3C2B A;  3DBL B; 
#chains in the Genus database with same CATH homology
 3LAP A;  3JTG A;  4HF2 A;  2A5Y B;  3C1D A;  3SFZ A;  4KN7 X;  3W6K B;  1BC7 C;  3KFW X;  1YS7 A;  3TDU C;  3NRV A;  1I27 A;  1O3Q A;  2CQK A;  3J80 Z;  4UXN A;  4KMF A;  5CVV A;  3LA3 A;  4BHC A;  2JPB A;  1J75 A;  1ZAR A;  3DV8 A;  3RPQ A;  4IJA A;  2H6C A;  1R00 A;  4N0B A;  1O3R A;  3KZY A;  4EV0 A;  3WTV C;  4ZYH A;  5DCM B;  1HKT A;  2CG4 A;  4G8X A;  4AIK A;  1MZB A;  3MCZ A;  4AIH A;  4LD5 A;  1ZG1 A;  4HOB A;  2D1V A;  3L7W A;  5CYV A;  4KMU X;  4CXF A;  1KA8 A;  4M74 A;  3RTR A;  2H27 A;  1YW7 A;  2O8X A;  3DF8 A;  4A6D A;  4N9H A;  3TO6 A;  1IXR C;  2C6Y A;  5J8C A;  4ESJ A;  3WGH A;  1MJ9 A;  4ENN A;  2ZNZ A;  1LEB A;  1YW8 A;  4GGG A;  5L3F A;  1OYI A;  5H6Q A;  2HKX A;  2WWY A;  3R60 A;  3FMR A;  4YIF A;  4HQE A;  1HBX G;  5BMZ A;  3WTT C;  1SD6 A;  4JBA A;  2PMU A;  1TQI A;  4A5N A;  1SAX A;  1H0M A;  1UCR A;  2FXA A;  4FHT A;  1S29 A;  5IT3 A;  2X0L A;  5DDG A;  1NHA A;  1JE8 A;  3RKW A;  1EH6 A;  1J59 A;  4GCV A;  4D0P A;  2BE5 F;  3JTH A;  3V8J A;  1LQ1 A;  2ZCW A;  2HZT A;  1Z1D A;  2VE8 A;  2JT1 A;  3KEQ A;  3K2Z A;  2NNY A;  5JVT A;  4CHU A;  3LA2 A;  5ILU A;  2A6H F;  4N9I A;  4RB1 A;  2XVC A;  1BOA A;  3H3U A;  1DUX C;  2YSR A;  3IWZ A;  1ZN2 A;  4KDP A;  1LNW A;  2XKO A;  3WG9 A;  3MZY A;  1W7P A;  2AS5 F;  5LRS A;  1WSU A;  1LJ9 A;  4NB5 A;  4WCG A;  2W25 A;  3RYP A;  3BRO A;  2FML A;  3O3K A;  1J2X A;  4EM0 B;  3GUD A;  3HRT A;  1FT9 A;  1IF1 A;  3E3V A;  3TKY A;  2HTJ A;  2NRA C;  3GFM A;  3P9K A;  2VT2 A;  3L2C A;  4KNY A;  3G73 A;  2IA0 A;  2OQG A;  3QU3 A;  4BYY A;  1SMY F;  3HUG A;  3LQQ A;  2DQL A;  3F72 A;  3ABT A;  3WTW C;  1JHH A;  1I1G A;  1XB4 A;  3TO9 A;  5E1X A;  1T98 A;  4PCQ A;  2LKP A;  4KT5 C;  5H6R A;  4EJO A;  3P9I A;  3WOD F;  3F22 A;  3WE3 A;  2VT3 A;  3GW2 A;  5E18 F;  3GLX A;  5CLS A;  1S7A A;  4EQQ A;  2HQN A;  5CVJ A;  1BC8 C;  4EJW A;  2DO7 A;  1ZYR F;  2MD5 A;  4UHT A;  3M8F A;  1XMK A;  2CO5 A;  4WXH A;  6PAX A;  1U2W A;  3LQR A;  3M8E A;  4ZZL A;  3N97 A;  1BIA A;  2XAJ A;  1FOK A;  2J5O A;  5DCF A;  1HW2 A;  3QAH A;  2W85 A;  2EV0 A;  5ILV A;  3F23 A;  3GFI A;  3RJP A;  5FFX A;  1PDN C;  2ESH A;  5D6E A;  1YFH A;  4R79 A;  2RC4 A;  3RI4 A;  3M7G A;  1DP7 P;  2D1H A;  2EV5 A;  3ULQ B;  3BJ6 A;  3HTU A;  3ZMU A;  3CUO A;  1B59 A;  2OA4 A;  3W6J B;  1ZAO A;  2XIG A;  3N4M A;  3FHZ A;  4HX4 A;  4BQA A;  1KU3 A;  2E1N A;  3H3Z A;  2IP2 A;  1R58 A;  5LBQ A;  3E5X A;  4FX4 A;  2OAZ A;  3FWE A;  4LG0 A;  1DDN A;  1QNT A;  4P5O A;  5HDG A;  2DTR A;  4HDV A;  2QWW A;  4EGZ A;  5DUK A;  2FQ3 A;  4P9F A;  3ABU A;  3TGN A;  2HR3 A;  3I64 A;  3R61 A;  2O61 A;  4HV5 A;  4RAZ A;  4HF1 A;  1O3S A;  1H9T A;  1JGS A;  3BPV A;  2UWM A;  3KZZ A;  5AIP A;  2HDC A;  1U5T A;  4EM1 A;  1C0W A;  4IHT A;  3R6S A;  1U78 A;  4L0Y B;  5L3G A;  2A69 F;  2L02 A;  4DNC A;  2FMY A;  1TNT A;  2F5F A;  4Y15 A;  5LGU A;  3IC7 A;  4XRF A;  4M73 A;  1QZY A;  4HLY A;  2L54 A;  2IW5 A;  5K1Y A;  4XLN F;  2J5P A;  2XAQ A;  1ULY A;  3ML6 A;  3FMS A;  1FPQ A;  5IT9 K;  5CJ9 A;  4M9X A;  2VC1 A;  4LLL A;  3K69 A;  3K1M A;  1QBJ A;  4MGR A;  3BJA A;  1R22 A;  1R36 A;  2ESN A;  4RGR A;  2AXL A;  4EGY A;  2FNP A;  4I09 A;  1UB9 A;  2D45 A;  2R7D A;  3R0A A;  1EH7 A;  2M45 A;  1BI2 A;  4CIC A;  2P5V A;  1CF7 B;  2JRT A;  1ZG3 A;  2UXN A;  3U1D A;  3ISP A;  2IJL A;  4OIN F;  3KP4 A;  3ZQ7 A;  2MH2 A;  1B1B A;  1K78 B;  1Y0U A;  4PGH A;  1KQ0 A;  2F2E A;  2Z9O A;  3IKV A;  4S04 A;  1LEA A;  2DQR A;  2FRH A;  4U0V A;  3JSO A;  4I01 A;  1P2F A;  2E7W A;  3BPX A;  3TOA A;  1Z05 A;  3Q9V A;  4BXU A;  2JZY A;  2K86 A;  1MJA A;  2HWV A;  5BPI A;  3WTS C;  1G3W A;  1IZ1 A;  3K1N A;  2JTV A;  3CDH A;  1XSX A;  5L3C A;  4WF2 A;  3HHG A;  4UVC A;  5JI6 A;  2XV4 S;  2V9V A;  3FF5 A;  3U9G A;  3I71 A;  2G7H A;  3G3Z A;  2YR2 A;  2ZFW A;  1R1V A;  3HSR A;  4L18 B;  1HQC A;  2VOD A;  3EQL F;  2EFW A;  3HRM A;  4EJU A;  1ZG5 A;  2MH9 A;  2EJR A;  1ONV A;  2QM3 A;  3I5U A;  2QEN A;  2DT5 A;  3TQN A;  2FNA A;  1XCV A;  1MKM A;  4EM2 A;  2GZW A;  5L3E A;  1PP8 F;  1HSJ A;  1W4M A;  1O7L A;  4I02 A;  4LLG F;  4ZYE A;  4NQW A;  2FBI A;  3K9T A;  4M71 A;  5JR3 A;  3V4G A;  5IT9 Z;  5FFZ A;  4R1H A;  2M8E A;  3HYI A;  3GXO A;  1O7F A;  1XD7 A;  1T6S A;  5HS7 A;  3GZ5 A;  3F8M A;  2WC2 A;  2PQ8 A;  2M5W A;  5E17 F;  4DQ2 A;  1BI1 A;  1B6A A;  1V3F A;  5E8I A;  4RGS A;  3TDZ C;  1GXP A;  3L9F A;  2M87 A;  1GVJ A;  4ZZD A;  4I0B A;  5L3B A;  4AWX B;  2M1B A;  4S05 A;  1OMI A;  4OU0 A;  2TDX A;  3T1B A;  4ZH4 F;  2O0Y A;  4RB0 A;  4LGW A;  2F5D A;  2ZKZ A;  1X3U A;  2LDU A;  1OR7 A;  2DW4 A;  4F7Z A;  2FBH A;  4L5I A;  3ERE D;  4MEX F;  3IHU A;  1FYK A;  1OPC A;  2QYO A;  3O2P E;  3BOQ A;  3GX4 X;  3D5L A;  1ZRE A;  3E5U A;  2IA2 A;  1TBX A;  4ESB A;  3F8N A;  1FY7 A;  3CLO A;  2IRF G;  1CGP A;  3CTA A;  4KIG A;  3FXU A;  5BPD A;  1ZLK A;  3D0S A;  4IRH A;  2WV0 A;  3P9C A;  4EVI A;  1YO5 C;  4BH9 A;  1U8R A;  2CFX A;  4M6X A;  4CYD A;  5L3D A;  4A0X A;  3LWF A;  3CUQ A;  4P9U A;  2HYG D;  1B9N A;  2ZXJ A;  2Q2E A;  4KA4 A;  3BZ6 A;  2EWN A;  1F4K A;  2MC3 A;  1E17 A;  4CO8 A;  3VFZ A;  2XAF A;  5CVI A;  3MWM A;  1T0F A;  4HBL A;  4RB3 C;  2DPU A;  4LK1 F;  2KIU A;  1W5S A;  5ICC A;  2MBF A;  5CVU A;  3HHH A;  1WI9 A;  5LLQ A;  2RDP A;  4BAY A;  4B8X A;  4XBF A;  1KQ9 A;  3HSF A;  3ZN1 A;  4Z2Y A;  5LEK A;  2A07 F;  4YG2 F;  4WX9 A;  1RNL A;  3RKY A;  2R7F A;  1Z6R A;  3JAM K;  5HDN A;  3VEP A;  3Q5F A;  1XN7 A;  4AIJ A;  3V8K A;  1YYV A;  2DPD A;  1I5Z A;  5DCM A;  2IVM A;  2GAU A;  2G7U A;  4LFU A;  3T8R A;  5HOO A;  2FSW A;  2Z33 A;  2QLZ A;  1WKM A;  2IT0 A;  5TJJ A;  4B09 A;  5ICG A;  3COA C;  4ASN A;  3FM5 A;  3OV8 A;  2P4W A;  1KU2 A;  2KRF A;  1ZRC A;  3I59 B;  4ETS A;  3EDP A;  5AON A;  3WTY C;  4A6E A;  4OIQ F;  4LG0 B;  4YFX F;  3R4K A;  4GXO A;  4E70 A;  3RPU A;  4UV9 A;  5E1W A;  3GWZ A;  3WU1 B;  1R5G A;  4HA8 A;  2RVC A;  1J5Y A;  4EMS A;  2WTE A;  3LA7 A;  1KYZ A;  3WTX C;  2W24 A;  1UFM A;  3J81 K;  4CZZ A;  4JQF A;  1Q1H A;  5HS9 A;  3BJO A;  1WRJ A;  3GZ6 A;  2DFI A;  4UVA A;  2NAZ A;  1W7P D;  4RS8 A;  4Q47 A;  2QBY B;  4IHS A;  1F9N A;  2ISZ A;  1FNN A;  1FSH A;  3ZP5 A;  1BJA A;  1YTY A;  4PDK A;  4I98 B;  3RDI A;  1ZH5 A;  2MLK A;  1SD7 A;  4UVB A;  4U7D A;  1R1U A;  4G6D A;  2DBB A;  1FYM A;  3F21 A;  3GVA A;  3PFI A;  4U7B A;  2ISY A;  3KCC A;  3F8B A;  1IRF A;  3DPL C;  2STW A;  2XRO A;  3TO7 A;  4MQ9 F;  5F64 A;  3V7S A;  2V1X A;  1J7K A;  2VON A;  1YQA A;  5D8K B;  1P4X A;  1I1S A;  1RI7 A;  1K79 A;  4LLN A;  4LMY A;  4EJV A;  3LFK A;  3WTZ A;  2KJC A;  4H0E A;  1SFE A;  2OZ6 A;  2DLL A;  2GA1 A;  2H6B A;  4IRG A;  4KIB A;  3IL2 A;  3ZMT A;  2K02 A;  2HTS A;  1IUY A;  5KK1 A;  2P8T A;  1YW9 A;  4HDU A;  1DPU A;  1SFU A;  2H09 A;  2DAO A;  2K7L A;  1EH8 A;  1HXD A;  1FWZ A;  4GYG A;  2V6C A;  2VN2 A;  1FSE A;  4GO1 A;  4KYW A;  4G7H F;  4U88 A;  4WXC A;  4Q4Z F;  5E1Z B;  2YU3 A;  1XSV A;  4I2O A;  3C3W A;  4L9N A;  1K6O A;  3SHF A;  5ICF A;  2Q8K A;  1RUO A;  1ON2 A;  2QUF A;  5LHG A;  3DEU A;  3L00 A;  1ZGA A;  1D8K A;  5FD6 A;  3DKW A;  3J81 Z;  3E6D A;  1W5T A;  3M1E A;  5D6F A;  2PBI A;  1IN5 A;  1TQM A;  3BWG A;  2X4H A;  2RNJ A;  2HYF A;  1SD4 A;  2P5L C;  3HIF A;  5KVR A;  1OYW A;  4G6Q A;  3ZPL A;  2ZME B;  4AVP A;  2ACJ A;  2KIF A;  2NYX A;  5J6X A;  3MQ0 A;  4MTD A;  2G9W A;  1T38 A;  2GIV A;  4LB6 B;  1PP7 U;  4OIR F;  4CDG A;  4PZJ A;  2EA4 A;  4TV7 A;  2FF4 A;  1RZ4 A;  2A61 A;  3DPT A;  2O03 A;  3J80 K;  5HS8 A;  3ZMV A;  1UHW A;  2R3S A;  1FC3 A;  1MDM B;  3V8L A;  1D8J A;  5BS6 A;  1P6R A;  1XGN A;  4FT8 A;  3BDD A;  2BEO A;  3WGI A;  3MEX A;  1F1Z A;  4KN4 X;  4MNU A;  3KET A;  2XKP A;  4LJZ F;  2EFQ A;  2O3F A;  4HZF A;  3KP3 A;  1QO0 D;  3GF2 A;  2LNB A;  2PI0 A;  5TRD A;  1HW1 A;  2EA2 A;  3BP8 A;  3RYR A;  1YIO A;  4OIO F;  2YX4 A;  2EFN A;  3GO5 A;  2OBP A;  4I0A A;  4IPA A;  2JPC A;  3DXJ F;  4BNC A;  5D5X B;  1H9G A;  2BGC A;  4YII A;  4M6Y A;  5EEH A;  4UUV A;  1UST A;  2V79 A;  2IPQ X;  3I53 A;  2LF7 A;  2Y75 A;  4G94 A;  2COM A;  4L0Z B;  2Z3Y A;  5DV5 A;  5JHU A;  5F1R A;  3E97 A;  5JFR A;  2EFP A;  1IW7 F;  1IXC A;  3ZN0 A;  4K2E A;  3V7C A;  2Z99 A;  1DPR A;  1HST A;  4O3M A;  3FMQ A;  1ZRD A;  2ZNY A;  1MD0 A;  1TLH B;  1Z7U A;  1ZGJ A;  2DI3 A;  2P6S A;  1FLI A;  2ADU A;  3QP5 A;  4HX8 A;  3QP6 A;  2QZ8 A;  5HLG A;  1IN4 A;  4FX0 A;  2MA3 A;  1LDJ A;  1K78 A;  2PEX A;  4U0W A;  4QWQ A;  5LGT A;  1QQI A;  1OKR A;  4A5M A;  3FM3 A;  2GWR A;  5DD8 A;  1BI0 A;  2H94 A;  4R8H A;  4JK1 X;  4Y13 A;  2STT A;  2XAS A;  3QPT A;  3WGG A;  3DP7 A;  1FBQ A;  4ON0 A;  1IAW A;  4ESF A;  1IN8 A;  2O6G E;  3F6O A;  1S8N A;  1G3Y A;  4RAY A;  4XSZ F;  3T8T A;  3S2W A;  1P4A A;  3SZP A;  4WK8 F;  1FYL A;  1W7P B;  2VBW A;  2K4B A;  2UZK A;  2CSO A;  5K5O A;  3E6C C;  1HW5 A;  3F8F A;  1LDD A;  3QU6 A;  1G4D A;  5D5W B;  2HQR A;  1AOY A;  1V4R A;  3KLO A;  3F8C A;  2EB7 A;  3FXQ A;  3ZMZ A;  2QVO A;  1USS A;  1Z9C A;  1J9I A;  3H92 A;  3VOE A;  5A2Q K;  1SMT A;  4RGX A;  2W84 A;  4A12 A;  1SFX A;  1R7J A;  3VOD A;  3WU0 A;  3PQK A;  1PUE E;  5D5V B;  3ELK A;  3R0J A;  1KQ8 A;  3I4P A;  4GYI A;  1S7O A;  3KEO A;  3HOT A;  4G7O F;  1B4A A;  2EK5 A;  4KIC A;  4U0Y A;  2Y0M A;  4IXA A;  4AD9 A;  4Q48 A;  1FBU A;  3KP2 A;  2W57 A;  5DEQ A;  2A68 F;  1HKS A;  4ENJ A;  3I0T A;  1D3Y A;  3BY6 A;  1ZRF A;  2YPR A;  4L5J A;  2ZBK A;  3O6B B;  3JSP A;  1XMA A;  2V1D A;  3T5X A;  4A0Z A;  2HFH A;  1IRG A;  4EJT A;  1IN6 A;  1O57 A;  4L9J A;  3B73 A;  5FD5 A;  1REP C;  2VOP A;  3I58 A;  2M30 A;  2PG4 A;  2HEO A;  1IN7 A;  1XSD A;  2FOK A;  3LST A;  1UHM A;  2DU9 A;  1GHC A;  1TW2 A;  2IA1 A;  3SQN A;  2HS5 A;  3ZMD A;  1XDS A;  4KUM A;  2XHK A;  2EFO A;  4HYE A;  1AWC A;  1YLF A;  2DK5 A;  2PN6 A;  2VBX A;  2Z5U A;  5LHH A;  5ED4 A;  3C18 A;  3Q9S A;  1YS6 A;  2KJB A;  2CGP A;  1LVA A;  1R1T A;  2VXZ A;  3MZH A;  1G3S A;  5DD4 A;  2FA5 A;  2ZO4 A;  1I6X A;  5LRR A;  2VBY A;  2XUB A;  2PLY A;  3GYH X;  1L0O C;  1O3T A;  2HOE A;  4WWC A;  4CGZ A;  3E5Q A;  2P7C B;  1G3T A;  1FX7 A;  4HW0 A;  3DFG A;  5D4S A;  2QQA A;  5CVR A;  3PQJ A;  3T0Y A;  1Z91 A;  3IKT A;  5A2Q Z;  1KU7 A;  2A3S A;  3F3X A;  1U5T C;  5HLI A;  3NEU A;  5E8G A;  3CO7 C;  4YFN F;  2Y48 A;  5ILS A;  4PGG A;  2HKO A;  1U5T B;  4L9T A;  2F5C A;  2BBY A;  1QGP A;  2JSC A;  3TOB A;  4OMZ A;  4RB2 C;  4IVN A;  3MFK A;  1E2X A;  1FP1 D;  5EEG A;  4A2U A;  2A6E F;  4BHB A;  4BHP A;  5FGM A;  5K5R A;  3QRF F;  2RGV A;  2NS0 A;  1L3L A;  3CO6 C;  1A04 A;  3E6B A;  1BI3 A;  4G7Z F;  2RV8 A;  1FZP B;  3V7R A;  3IWF A;  5LGN A;  4WXD A;  2HGC A;  1J0R A;  3EYI A;  1TW3 A;  2XRN A;  4A0Y A;  2F5E A;  1D5V A;  1ZHF A;  2QQB A;  3ROU A;  4HQM A;  3JAM Z;  2CWE A;  3K0L A;  1KGS A;  5FB2 A;  3E6M A;  3WE2 A;  2KIM A;  5H20 A;  2VE9 A;  4O5V A;  3ECO A;  3KP7 A;  3FXR A;  1U3E M;  1K7A A;  2XGX A;  3EUH A;  3EYY A;  3P7N A;  3I59 A;  4ENK A;  3CJN A;  2PJP A;  1STZ A;  1S6L A;  5D5U B;  2LSO A;  4HX7 A;  1QZZ A;  1ON1 A;  2ETH A;  4HLX A;  3GFL A;  2VOO A;  1R5H A;  5HDK A;  1R23 A;  3QPH A;  4RGU A;  1RUN A;  3HRS A;  3J7A O;  3LAJ A;  1XDU A;  2FBK A;  2XAG A;  1JXS A;  2B0L A;  4M9Z A;  2CYY A;  2KKO A;  3U2R A;  2L01 A;  2ELH A;  4QLC U;  1XCB A;  3KP5 A;  4LK0 F;  4KFC A;  4HF0 A;  4P96 A;  4XSX F;  2QBY A;  4ZYG A;  1TQP A;  2VBZ A;  5LHI A;  1ODD A;  1QPM A;  3IRR A;  5J8F A;  1GXQ A;  2GXB A;  4KIF A;  1B9M A;  4MQV A;  5FLX K;  5DYM A;  3I54 A;  3ZMS A;  4Y17 A;  4HV6 A;  2CW0 F;  2EV6 A;  5FO5 A;  2RN7 A;  1KU9 A;  2L3D A;  2PFB A;  5DUI A;  4P55 A;  1U6G A;  1KYW A;  4IF4 A;  1XGO A;  3KLN A;  1WQ2 A;  3HTS B;  1LB2 A;  1BN5 A;  4LB5 A;  4MTE A;  2GQQ A;  1WWX A;  4OOI A;  2K27 A;  3REO A;  1VTN C;  3C7J A;  1Z6T A;  3HSE A;  3HRU A;  3JW4 A;  3GFJ A;  2D2W A;  2LF8 A;  4O6J A;  1RIO H;  1T2K A;  5D8L B;  3NQO A;  1BBY A;  5AIQ A;  3GEZ A;  3FZV A;  4ENM A;  1FBS A;  2QQ9 A;  2NNN A;  1IXS B;  3HOS A;  2P6T A;  4OIP F;  2FE3 A;  2YX7 A;  2L4A A;  4XLP F;  5ICE A;  1XGM A;  4M72 A;  2Q0O A;  3M9A A;  2DK8 A;  4HAM A;  5D4R A;  1FP2 A;  1OYY A;  3RKX A;  3L09 A;  3EET A;  5ERI A;  3OOP A;  1HKQ A;  3IRQ A;  2RQP A;  3ECH A;  4G9Y A;  1S3J A;  1BM9 A;  2OD5 A;  3KE2 A;  4L9V A;  2L4M A;  2MLG A;  2BYV E;  1XGS A;  4UNO A;  4UV8 A;  3KP6 A;  2VC0 A;  3F6V A;  1G6N A;  3AAF A;  3FX3 A;  4MEY F;  1P4W A;  2OU2 A;  1LDK B;  2OQR A;  1F5T A;  2K4J A;  3QOP A;  1MGT A;  2E1C A;  2PMH A;  4NHJ A;  2RKH A;  5LEJ A;  2GXG A;  5E20 A;  2GA2 A;  3VB2 A;  2P7V B;  2UXX A;  1ZLJ A;  1EV7 A;  3CUQ C;  2E7X A;  3SXY A;  1P92 A;  2FU4 A;  2ZME A;  3CUQ B;  2FEZ A;  4ZYD A;  2OZU A;  4YFK F;  1BIB A;  2XAH A;  1CF7 A;  3DQV C;  1TTY A;  5BOX A;  2BV6 A;  1JHF A;  2P5K A;  1SD5 A;  5HVQ C;  5FLX Z;  5HLH A;  5K5Q A;  4IRI A;  4I7H A;  4Q5S F;  3SZT A;  3B02 A;  1MJB A;  4MHG A;  3K1P A;  4M9S A;  3RIR A;  4OMY A;  1YG2 A;  1T39 A;  1TNS A;  1MDM A;  2ZJ2 A;  5F6F A;  5BQT A;  2V1U A;  3WTU C;  3MAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...