2GXGA

Crystal structure of emrr homolog from hyperthermophilic archaea sulfolobus tokodaii strain7
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
140
structure length
140
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal structure of archaeal homolog of multi drug resistance repressor protein, EmrR, from hyperthermophilic archaea Sulfolobus tokodaii strain7
rcsb
source organism Sulfolobus tokodaii
total genus 58
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gxgA00
1RNLA 4LK0F 2NAZA 2FRHA 1DPRA 3WTWC 3WGHA 3GUDA 4KFCA 5HDNA 1ULYA 3DP7A 1C0WA 2FQ3A 5H6RA 2EV0A 4LFUA 2O0YA 3BP8A 3B02A 3MEXA 4KIGA 3DF8A 1YO5C 4LB5A 2VT3A 2YPRA 2VOPA 2UWMA 4M9XA 1DPUA 1TTYA 3DEUA 2P7CB 2CWEA 2G7HA 2ZJ2A 2KJCA 4ZYGA 3PQJA 4ZZDA 3QAHA 1MJBA 3T8TA 3VODA 1D8JA 2P5VA 3I53A 3CO7C 1W7PB 1QPMA 4JQFA 2RC4A 1HW2A 1T6SA 1R7JA 3QP6A 3TDUC 3BROA 3JAMK 2CW0F 1SAXA 3IWFA 4YG2F 3W6JB 1FSHA 1H0MA 4RB1A 2XRNA 1YQAA 1UCRA 2ZO4A 2EFQA 2RGVA 1MDMA 1T2KA 2A07F 2QQ9A 3IHUA 1LDKB 5BOXA 1PDNC 3PFIA 4CZZA 4XBFA 2Q2EA 4ENJA 4KIBA 4GYIA 1BC7C 2EFWA 1FYKA 3O3KA 3F21A 1VTNC 1LDJA 2P8TA 3TGNA 1OKRA 5E8GA 3I54A 3BZ6A 2WTEA 2KKOA 1F9NA 1ZH5A 2DQRA 1V3FA 4H0EA 3QP5A 1OR7A 3ZMDA 5LLQA 3IKVA 2PMUA 3ECOA 3H92A 2HFHA 2KIFA 2FMYA 3FMRA 3QRFF 2F5DA 4XSZF 2MLKA 4OINF 3F8BA 1Z7UA 1IXCA 2Z5UA 5LEKA 3COAC 3HRMA 3WGIA 4A5NA 3R4KA 5DV5A 5D5UB 3LA7A 1R22A 4HZFA 2EFNA 3RJPA 1FBQA 3VOEA 4M72A 2WWYA 2XUBA 2KIUA 3DKWA 4RB0A 1F5TA 3BJAA 4I09A 2ISYA 1BIBA 4ENMA 1BIAA 2D1VA 4PZJA 3WGGA 2FNAA 2XAGA 3GZ5A 1S3JA 1FX7A 2J5PA 5D5WB 2L4MA 3TKYA 5LGUA 3V8LA 1O57A 2EK5A 4ETSA 2PMHA 4CGZA 3V7CA 4Q48A 3TO6A 3HHGA 2RVCA 3Q9VA 1I1SA 2OAZA 2NS0A 1PP7U 2W85A 1Z6TA 2DFIA 1TLHB 3M8EA 5LRRA 5FFZA 3TOAA 3GFMA 1S8NA 1G3YA 4Y15A 3SHFA 1O7LA 2HQNA 1I6XA 3H3UA 2FMLA 1I5ZA 3J80K 2QQAA 4GO1A 3MAJA 4MQ9F 4BYYA 1IXSB 4KIFA 2JRTA 3IC7A 1B9NA 5DD4A 4BH9A 2K7LA 2TDXA 4OMZA 3FF5A 4HYEA 2PFBA 1XD7A 2VODA 2D1HA 2VONA 5ED4A 1YS6A 4MEYF 4LG0A 2DPDA 2L3DA 2WV0A 3FM3A 2PQ8A 4WF2A 3ML6A 4L5IA 3T1BA 4A6EA 1CF7B 1QGPA 2O3FA 5ICFA 3C1DA 3HSRA 4A5MA 2DK8A 1G6NA 2D45A 3ZMTA 5JI6A 1OPCA 2JPBA 2E1NA 4EJTA 1BBYA 1YW8A 1H9GA 1K6OA 5LBQA 2LNBA 3LA3A 1FWZA 4UVCA 3WTXC 2O6GE 1OYIA 4CO8A 1U6GA 3QPTA 4YFXF 1ZHFA 4RGSA 2EFOA 2AXLA 5ICGA 1PUEE 2M8EA 4YFKF 1KQ0A 5H20A 2STTA 1L3LA 4WXCA 3R6SA 1KYZA 2P4WA 1SD4A 1WI9A 1FZPB 1K7AA 1G3TA 4UVAA 2OD5A 2QWWA 2P7VB 4ESFA 3WTVC 2GA2A 3B73A 2J5OA 1I1GA 3K9TA 5FLXZ 3N97A 2KJBA 1OMIA 2HYGD 4WXDA 2PN6A 2DTRA 2CYYA 5E18F 4BHBA 5HLHA 3V8KA 3E6MA 4Z2YA 3KLOA 3FXRA 3EDPA 1ZRCA 5D5XB 2V1XA 5L3GA 2RV8A 3IRQA 1AWCA 3SXYA 3HUGA 1RUNA 2P5LC 4GYGA 3QU3A 4EJVA 5FO5A 3KP7A 4P5OA 1WKMA 1MGTA 4HDVA 4G9YA 4L5JA 1FPQA 2V79A 3I58A 5E1WA 5L3CA 4M6YA 3HTUA 2XAFA 2K27A 2P6SA 2FSWA 5DUIA 5KK1A 2VC1A 1YG2A 4I01A 2E1CA 2DAOA 2IJLA 2LDUA 2Z33A 3BY6A 2Z3YA 2MBFA 2EA2A 1OYYA 1HQCA 1XGMA 1IN4A 2VBZA 3G3ZA 5HS8A 1JGSA 2FA5A 1HKQA 2XIGA 3R0JA 1FC3A 3RKXA 1WQ2A 4YIIA 3N4MA 3OOPA 4FHTA 2NNYA 2HR3A 2NYXA 2MH2A 2H94A 3HHHA 4N9HA 1XB4A 4G7HF 1Y0UA 3T5XA 1B4AA 3EYIA 3FHZA 4EMSA 4KDPA 5JFRA 3ECHA 4A2UA 3E5UA 2EV6A 2HS5A 3ABTA 3P9KA 1P4AA 2UXXA 1ZLJA 4MNUA 1YIOA 3K2ZA 1SD7A 4P9UA 4RGXA 4RGRA 3I4PA 5HVQC 4KUMA 3E5XA 2DT5A 1LEAA 5DDGA 2HQRA 4P9FA 5CJ9A 1P92A 1DUXC 2PI0A 1ZRDA 2IVMA 1USTA 5CLSA 1OYWA 4EM1A 4L0ZB 2M45A 4UUVA 3HRTA 5AONA 2A6EF 2VE8A 4LG0B 1HSTA 1YFHA 3F6VA 4FX4A 1RZ4A 2Y75A 2A68F 3U9GA 5EEGA 4AIJA 4OIRF 5HLGA 1JHHA 3FZVA 5HLIA 1KU2A 2NRAC 1WRJA 2DPUA 5J8FA 5DCMB 5D4SA 3I64A 2FU4A 3EETA 3KEQA 3I5UA 4U0VA 1GXPA 4ASNA 1B6AA 1PP8F 1YTYA 5HDKA 2LKPA 3F8NA 4OU0A 1O3TA 1K78A 3J81Z 1BC8C 1U3EM 1BM9A 3CUQA 1LEBA 1STZA 2RKHA 5IT9K 4LGWA 5HS9A 2QYOA 1QO0D 5TJJA 5DEQA 4KICA 2GWRA 3HYIA 3TDZC 3E6CC 4E70A 3F6OA 2ETHA 3MCZA 2XROA 2FE3A 3ZMVA 1IN8A 5CVIA 1X3UA 2YX4A 3WTYC 5E20A 1SFXA 3IKTA 3DQVC 2H27A 4UHTA 2QBYB 3HOSA 3M8FA 5LGTA 1MKMA 5F64A 2O61A 2M1BA 3PQKA 1O3QA 4IJAA 4MEXF 3WTUC 1BI0A 4LLLA 1L0OC 3NQOA 1XGSA 2QZ8A 3GO5A 1USSA 4RB2C 2VBXA 2R7DA 4EJWA 3JSOA 3ZMSA 2X0LA 2L01A 1I27A 1U5TA 2BBYA 1SMTA 1JHFA 1KU3A 2A5YB 2FBHA 4MHGA 1Z1DA 4OOIA 2QLZA 1F1ZA 3I59B 5FLXK 4UNOA 4LJZF 4NHJA 2EFPA 2VBYA 4UV8A 2QUFA 5JR3A 4S04A 1LB2A 2M30A 4YFNF 1BOAA 5BMZA 5H6QA 5FB2A 1R58A 4LB6B 2R7FA 2F2EA 3FMQA 2FEZA 3WE3A 3P7NA 2HEOA 2XHKA 2MH9A 1T98A 5DCFA 4WCGA 3G73A 2ZMEA 4RS8A 3RKYA 3LWFA 2DI3A 2EA4A 3Q5FA 1IRFA 3M9AA 2W25A 4I2OA 3LQQA 5FFXA 1UHWA 4DNCA 1GXQA 2LSOA 2BYVE 5DUKA 1IF1A 3DFGA 2W57A 4Q47A 1XGOA 2E7WA 2HWVA 1Z9CA 2YU3A 4FX0A 3TOBA 5L3FA 4ENKA 3GFLA 3WTTC 3Q9SA 3M7GA 3ULQB 2FXAA 2EJRA 1XSXA 1LNWA 2AS5F 4AVPA 3JTGA 5J6XA 4KYWA 2ESNA 2OQRA 2F5CA 5D6FA 5E1ZB 1HKSA 4N0BA 3HRUA 5LGNA 5D8KB 3DPTA 2COMA 2YSRA 3RDIA 1T38A 2DBBA 3I0TA 2DU9A 4BXUA 2L54A 2VT2A 4PDKA 3GF2A 4U7DA 1S7AA 3V7RA 1HSJA 3CUQC 2Q8KA 4LLNA 3SFZA 4EV0A 4UXNA 1R5HA 1UB9A 3K0LA 4Y13A 4EGZA 1J0RA 3E5QA 1FNNA 1WSUA 3AAFA 4O5VA 2ZNYA 1BI1A 5IT9Z 5IT3A 2IRFG 2DK5A 4JBAA 3LSTA 3FXUA 3L09A 2QENA 3CUQB 5K5RA 3HSEA 4G8XA 2MD5A 3ISPA 1R1TA 2ELHA 1R1UA 1HXDA 1D8KA 1IN5A 3KEOA 1QZZA 1S7OA 3FXQA 5ERIA 2F5FA 2CSOA 3SQNA 2VC0A 2JT1A 1D3YA 1W5TA 3QPHA 4KT5C 2K86A 1DP7P 3MQ0A 1KA8A 2LF8A 3F23A 1JE8A 4GXOA 5AIQA 1P4XA 3CJNA 2W24A 1MDMB 2OBPA 3WG9A 3J81K 3P9IA 3WE2A 2XAHA 4O6JA 1IZ1A 1ZGJA 4O3MA 4L9JA 4G7ZF 3CO6C 4MTEA 2STWA 1QNTA 2RQPA 3TO9A 3GW2A 4EJUA 1ZAOA 3RKWA 3MWMA 3RTRA 3KP4A 5L3DA 3GXOA 1U2WA 4Q4ZF 2XASA 5HOOA 1W4MA 5ILUA 1YLFA 4EVIA 2IA0A 4XRFA 1KYWA 5D6EA 2IA2A 1W7PA 4BAYA 2GAUA 1B1BA 1K79A 1ZG1A 3WU0A 4KA4A 4GGGA 4LMYA 3EUHA 4P55A 2PLYA 2ZKZA 1RIOH 2H6BA 3C3WA 1J5YA 4M9SA 2VBWA 3MFKA 2DQLA 1R1VA 1IUYA 1G3WA 4G6DA 4RB3C 4WK8F 4M74A 3L2CA 1IN6A 2H6CA 5LHHA 1J75A 4A12A 3EYYA 4AIHA 4XLPF 3NRVA 1MD0A 3KFWX 4DQ2A 2FF4A 3LFKA 3K1MA 1BJAA 1QZYA 3SZTA 2IA1A 3RPUA 4XLNF 4R79A 3GFJA 5CVUA 4HF1A 1FY7A 4A6DA 1CGPA 2E7XA 1XCBA 1T0FA 4G94A 3ZN1A 3ROUA 3L00A 2KIMA 1KQ8A 3DXJF 5ILVA 5HDGA 3K1NA 2L02A 1KU9A 4EJOA 3T0YA 2ISZA 2D2WA 3TQNA 4G7OF 1BN5A 2GXBA 1MJAA 2ACJA 2A61A 3ZMUA 1SFEA 1G3SA 2GXGA 1ZG3A 2HOEA 2HDCA 1IRGA 5CVRA 4HF2A 5AIPA 4IF4A 4IHSA 5DYMA 2HTSA 3WODF 4JK1X 4EQQA 2M87A 4MGRA 1FYLA 2IP2A 1H9TA 2CFXA 3E97A 4KN7X 1SMYF 2HZTA 2YX7A 3FMSA 1XSDA 3L9FA 4HLXA 5HS7A 3KP2A 3U2RA 1YW7A 1SFUA 5K5QA 2NNNA 1IW7F 1T39A 3KZZA 1D5VA 4HF0A 3ELKA 5F6FA 4EM2A 4UV9A 3R60A 3E6DA 5E1XA 2ZBKA 1RI7A 3DV8A 3F72A 4HQMA 4HV6A 2ZNZA 1S6LA 3KE2A 3T8RA 3K69A 4I0AA 5BS6A 4I98B 2B0LA 4OIQF 4Y17A 1G4DA 5E8IA 2YR2A 5D5VB 2IPQX 1NHAA 1KU7A 2P5KA 4KNYA 4AD9A 2BV6A 1XGNA 2BE5F 3GFIA 3FX3A 4HX4A 2JTVA 4HV5A 3JW4A 3GYHX 4ON0A 5DD8A 3MZHA 1CF7A 1UFMA 1R36A 2DW4A 3I71A 1B59A 3F3XA 3LA2A 4L18B 4IRHA 1FOKA 1FT9A 3ZMZA 5ICEA 1WWXA 4KMFA 1B9MA 2K02A 4IHTA 4KN4X 1SD5A 3O6BB 1YYVA 3BJ6A 1AOYA 4ESJA 5A2QZ 2MA3A 4CXFA 1TQPA 3D5LA 1LJ9A 2GIVA 1ZYRF 1FP2A 3D0SA 2UZKA 1LQ1A 1S29A 2PG4A 3LAJA 4IPAA 4HX7A 3KETA 1U78A 2MC3A 2A69F 2OQGA 4XSXF 4D0PA 1XMAA 2ADUA 4IRIA 4LLGF 3QOPA 1HW1A 2G7UA 3F22A 1Q1HA 4B09A 2ESHA 5LRSA 3OV8A 3W6KB 3IRRA 4L0YB 2CGPA 4AIKA 1IAWA 4HA8A 4P96A 4K2EA 4RGUA 1FLIA 3F8FA 1ON2A 1P2FA 2V9VA 5CVJA 4G6QA 3HSFA 4YIFA 4A0ZA 1RUOA 2QM3A 3RYRA 2IT0A 4IVNA 4NQWA 2QQBA 4QWQA 2K4BA 2R3SA 4LD5A 2HTJA 3GX4X 3DPLC 1IN7A 3RIRA 2FBKA 4HQEA 4HBLA 3EQLF 2JZYA 1IXRC 4N9IA 2A3SA 5LEJA 1FSEA 5TRDA 1YS7A 4BQAA 1E2XA 3L7WA 3GVAA 4HAMA 4U7BA 3IWZA 2QVOA 2Z9OA 2PJPA 5E17F 3HOTA 2XKPA 4I7HA 3F8CA 4L9NA 2Y48A 2V1UA 1J7KA 4IRGA 1XDSA 2LF7A 3M1EA 1MZBA 4BHPA 2A6HF 5D8LB 2GA1A 3HIFA 3LQRA 3KCCA 3FM5A 5JHUA 2WC2A 1ZLKA 1EH8A 5CVVA 5L3BA 5ICCA 4MTDA 3JSPA 3S2WA 3R61A 4I0BA 3GWZA 4FT8A 2Y0MA 2GQQA 1EH6A 4M73A 3GEZA 2VN2A 5K5OA 5LHGA 1ZREA 1O3SA 4L9VA 5D4RA 1BI3A 3H3ZA 1Z05A 3NEUA 1K78B 2CQKA 3IL2A 2RNJA 1R23A 2ZFWA 1DDNA 2FNPA 4BNCA 1F4KA 1P6RA 4KMUX 3ABUA 3KP3A 3R0AA 4AWXB 2V6CA 4HDUA 1O7FA 1HW5A 2OZUA 2KRFA 1XMKA 2DLLA 4GCVA 2VXZA 3WU1B 4M71A 5ILSA 3RI4A 2V1DA 4EGYA 3HTSB 1J9IA 1TW3A 3HRSA 1MJ9A 2PEXA 1W5SA 1V4RA 3SZPA 4CICA 2Q0OA 3JAMZ 1U5TC 5DCMA 4S05A 4IXAA 1TQMA 4PGHA 2M5WA 1GHCA 4HLYA 4ZH4F 2OZ6A 1HKTA 5CYVA 4HOBA 1FYMA 4ENNA 4U0WA 1QBJA 4U88A 4ZYHA 2HGCA 2X4HA 1U5TB 2GZWA 1Z91A 4LK1F 5BPDA 2XAJA 2OU2A 3F8MA 2FBIA 2XVCA 3K1PA 3BPXA 5BQTA 2XGXA 3KP6A 4R8HA 2HYFA 2ZCWA 3REOA 1FBUA 1LDDA 2K4JA 3VFZA 2FOKA 3MZYA 3KLNA 6PAXA 2O8XA 5JVTA 2XKOA 1ZARA 2BEOA 2QBYA 3WTSC 1JXSA 1XN7A 3CUOA 2UXNA 3GLXA 4ESBA 2CO5A 1R00A 2VOOA 1XDUA 1ON1A 4Q5SF 3VEPA 5A2QK 2PBIA 2CG4A 3BJOA 3BWGA 2RN7A 3O2PE 1EV7A 3P9CA 3BDDA 3FWEA 4B8XA 1KQ9A 2IW5A 3BPVA 2ZMEB 1ZG5A 1J59A 2XAQA 4PCQA 5KVRA 4L9TA 4TV7A 4ZYDA 3I59A 5FGMA 2XV4S 3V4GA 1P4WA 1UHMA 2HKOA 2DO7A 3ERED 4M6XA 1ODDA 3ZQ7A 2VE9A 1GVJA 2EWNA 3BOQA 4HW0A 1TQIA 1EH7A 3GZ6A 1LVAA 4R1HA 5BPIA 4NB5A 1KGSA 2W84A 4CYDA 4MQVA 4UVBA 4WX9A 4U0YA 4QLCU 2G9WA 2OA4A 1SD6A 3U1DA 5J8CA 1E17A 2BGCA 1QQIA 5FD6A 2F5EA 1FBSA 2P6TA 4OIPF 2HKXA 5L3EA 4WXHA 3ZN0A 4F7ZA 1ZRFA 1FP1D 3TO7A 2Z99A 3QU6A 1W7PD 2MLGA 1TBXA 3JTHA 2ZXJA 3RPQA 3J80Z 4M9ZA 3LAPA 1ZN2A 5FD5A 3WTZA 1HBXG 4ZYEA 1U8RA 4WWCA 1BI2A 4A0YA 1J2XA 1Z6RA 3KZYA 1XSVA 5EEHA 2RDPA 5F1RA 2H09A 3E3VA 3VB2A 2JPCA 1ONVA 3C18A 1YW9A 2O03A 4A0XA 2C6YA 5K1YA 3CTAA 1REPC 2L4AA 1R5GA 4PGGA 2EB7A 3V7SA 3ZP5A 3ZPLA 1TNSA 4RAYA 1TW2A 4OMYA 1O3RA 3J7AO 1A04A 4EM0B 4CHUA 4OIOF 4CDGA 3V8JA 4BHCA 1TNTA 2EV5A 5LHIA 3CDHA 2JSCA 4RAZA 3E6BA 4HX8A 4ZZLA 1XCVA 3C7JA 3KP5A 3RYPA 3CLOA 1ZGAA 4I02A
chains in the Genus database with same CATH superfamily
4B3AA 1RNLA 4LK0F 1N78A 2NAZA 2FRHA 1DPRA 3WTWC 3WGHA 3GUDA 3FXKA 4KFCA 5HDNA 1ULYA 1SAUA 2P0WA 3DP7A 1C0WA 2FQ3A 1T33A 5H6RA 2EV0A 4LFUA 2O0YA 3BP8A 1WGXA 3B02A 3MEXA 2EILH 4KIGA 3QYFA 3DF8A 5FKLA 1YO5C 1GV5A 4B47A 4LB5A 2VT3A 1YOVB 2E1MB 3M8JA 2YPRA 2VOPA 1DU6A 2UWMA 3OYLA 4A3MJ 1LFUP 3IAS2 4M9XA 4P1WA 1DPUA 1S72I 1TTYA 5IP9J 2XGCA 3MZ8A 5J3LA 1WHUA 3A1YA 3DEUA 4RLQA 2CWEA 2P7CB 5KAIC 2G7HA 2ZJ2A 1VFCA 2LBFA 3A4CA 4CCKA 2B63J 2MSYA 2BW3B 4M3DA 3EUHC 2KJCA 4ZYGA 1BOBA 2VJJA 1N77A 3L2QA 2JA8J 3PQJA 4ZZDA 2FUG2 2CUFA 3QAHA 3FXLA 1ORKA 1MJBA 4BQNA 1MMNA 4XKWA 3H9GA 3SEZA 3T8TA 3VODA 3P5JA 1NK3P 2P5VA 3I53A 1D8JA 1XPXA 3CO7C 1W7PB 1QPMA 4KT6A 4JQFA 2RC4A 1HW2A 1T6SA 2AO9A 1R7JA 3QP6A 3TDUC 2RNGA 1S5LC 1T08B 3BROA 2ZC2A 1JTYA 3JAMK 3DBLB 2CW0F 1SAXA 3IWFA 3OSFA 4YG2F 1Q1VA 3W6JB 3I56I 1JKRC 4RAGA 1FSHA 2WAQA 1H0MA 2KQRA 4RB1A 1VQNI 4CCMA 2XRNA 1YQAA 4IEJA 1UCRA 4BUPA 5C4JJ 2ZO4A 4BU2A 1QA6A 2EFQA 2RGVA 2R7VA 1MDMA 1T2KA 2A07F 1T0FC 2QQ9A 1QHHD 3IHUA 1LDKB 4M3FA 5BOXA 1PDNC 1MW7A 2HDWA 4FTHA 3PFIA 1H8AC 3MMYB 4UY8I 4CZZA 1YIJI 1NH3A 4XBFA 2Q2EA 1AHDP 4ENJA 4DW6A 1YX5A 4KIBA 4GYIA 1BC7C 2EFWA 3GTJJ 1FYKA 3O3KA 5EEAA 3OYAA 3F21A 1ETKA 1VTNC 3HKZA 1LDJA 2P8TA 3TGNA 2QKMB 1OKRA 4E7JA 4J19A 3CCLI 1N25A 5E8GA 2L9NA 3HOUJ 3D1NI 4A3FJ 3IAM2 3I54A 3RSNA 3BZ6A 1W1WE 2WTEA 2KKOA 3ABKH 1F9NA 4CZCA 1ZH5A 2DQRA 1V3FA 1YRNA 1I50J 4H0EA 3QP5A 1OR7A 1X4OA 5F1JA 3ZMDA 2ZXWH 2QA4I 5LLQA 3IKVA 1JUSA 2P81A 2PMUA 2NOJB 3ECOA 3H92A 4RM2A 2HFHA 2KIFA 2FMYA 3FMRA 1HDDC 3QRFF 4CCLA 2F5DA 3OS2A 4XSZF 2MLKA 4OINF 3F8BA 3GLLA 1Z7UA 4ZDPA 1IXCA 3DKYA 2Z5UA 5BNGA 3M07A 5LEKA 1JJ6C 1W36C 3COAC 2JVGA 1RRJA 3HGYA 3HRMA 2HXOA 3WGIA 4RDUA 3L2RA 5J1RA 4A5NA 3R4KA 5DV5A 4AIDA 5D5UB 3LA7A 1IRZA 1R22A 3CCEI 4HZFA 3GMEA 2EFNA 3S93A 3RJPA 5GADJ 1WJDA 1FBQA 2BVMA 2JJ7A 3VOEA 4M72A 4EATA 1E3HA 2WWYA 2XUBA 2KIUA 3DKWA 2L7ZA 5JLXA 4RB0A 1F5TA 4AVZA 3BJAA 4I09A 2ISYA 1BIBA 4ENMA 4A3IJ 2NS7A 1BIAA 2D1VA 4PZJA 3WGGA 2FNAA 2XAGA 3Q3SA 3GZ5A 3LSHA 3FK6A 1AKHB 2F5VA 1S3JA 1FX7A 2J5PA 5D5WB 2L4MA 3TKYA 2XGDA 5J4YA 3SYTA 5LGUA 2M34A 4E4HA 3V8LA 1JUPA 1TWHJ 5CKTA 4A93J 1O57A 2EK5A 1JT0A 1VQ5I 4ETSA 2PMHA 1BW6A 4CGZA 3V7CA 2E5ZA 4Q48A 3TO6A 2OUMA 3HHGA 2RVCA 3Q9VA 4XONA 1I1SA 5E3MA 3OYCA 2OAZA 2NS0A 1PP7U 2K40A 2W85A 4XNFA 1Z6TA 2DFIA 1TLHB 3M8EA 4II2A 5LRRA 4BL0B 2OCEA 5FFZA 5HLTA 2WADA 3ERMA 3TOAA 3GFMA 1APLC 4A3LJ 1S8NA 2K9QA 5EGOA 5C44J 9ANTA 1G3YA 4Y15A 2XF5A 3SHFA 2QSFX 4DZPA 3NWSA 2V1NA 5IP7J 4X0GA 3QQAA 1O7LA 2I8DA 2HQNA 2JSPA 1I6XA 3H3UA 2FMLA 1I5ZA 4CCOA 2HVRA 3QODA 3J80K 1MBEA 2QQAA 4GO1A 3MAJA 2MW8A 3H1CA 1RPWA 4MQ9F 1H89C 2NVXJ 4HEA2 1FMWA 4XN3A 3LMMA 4BYYA 1IXSB 4KIFA 2X6OA 1F43A 2B7EA 2JRTA 2ZXIA 3HOYJ 2JA6J 3IC7A 1B9NA 1P9QC 2WAEA 5DD4A 4BH9A 1MBFA 4GRIA 1UG0A 2K7LA 2GBYA 2TDXA 4OMZA 3FF5A 4HYEA 2PFBA 1XD7A 1DU0A 2BHYA 3GZNB 2DMTA 1LFBA 2M7AA 2X9DA 2D1HA 3Q0UA 2VODA 1D0ZA 3S16J 2VONA 5ED4A 1YS6A 1I3QJ 3A02A 4MEYF 4LG0A 1AU7A 3QWLA 2DPDA 2L3DA 4AU7A 2WV0A 3BR6A 4MO7A 3FM3A 4BKXA 2PQ8A 4WF2A 3ML6A 2XB5A 2HQAA 4L5IA 3OIQA 4DJAA 3T1BA 3U1KA 4A6EA 2DA2A 1CF7B 2EINH 2XSJC 1QGPA 5GP9A 2R5ZB 2Z16A 2O3FA 5ICFA 3C1DA 3HSRA 3BQZA 4A5MA 2DK8A 1G6NA 2MABA 2D45A 3ZMTA 5FROA 5JI6A 1D0YA 1OPCA 2JPBA 3UNGC 4D5CA 4X1EA 2E1NA 4I99C 4EJTA 1BBYA 4NC6A 1YW8A 3H36A 1H9GA 3K4CA 1K6OA 2CJJA 4CUGA 5LBQA 2LNBA 4I6ZA 3LA3A 4BY7J 1FWZA 5F08A 3CD6I 3S8PA 3FXMA 3ZQGA 4UVCA 3WTXC 3NAUA 2O6GE 4B48A 1OYIA 1ZGWA 4CO8A 3H3VK 1U6GA 3QPTA 2KISA 2F4OB 5EF6A 1RKWA 4YFXF 1ZHFA 5M5YJ 4RGSA 2EFOA 4BJ6C 2AXLA 1A6QA 1PYVA 5ICGA 1PUEE 2DTZA 2M8EA 4IHXA 4OWRB 4YFKF 1KQ0A 5H20A 2STTA 4UUSA 1L3LA 4WXCA 3K6GA 3R6SA 5GAGJ 3BT9A 3DEWA 1W0UA 1KYZA 3CQZJ 2P4WA 1SD4A 1WI9A 3CJQB 5F0CA 1FZPB 2HDDA 1K7AA 1G3TA 4UVAA 3BTIA 3K4MA 2OD5A 2QWWA 2P7VB 4ESFA 4XR6A 5J47A 3S32A 3WTVC 1DP3A 4NC7A 2GA2A 2NOGA 2Q2EB 3B73A 2BY3A 1I1GA 2J5OA 3K9TA 4E7SA 3CZ6A 3KEYA 5FLXZ 3N97A 4IL6C 3G4SI 2KJBA 1OMIA 3CDLA 3OL3A 3ZQIA 2HYGD 3OYJA 2NVQJ 3W2AA 3HOZJ 4JX6A 4WXDA 4C3JJ 2PN6A 2XB0X 1R9TJ 2DTRA 2R0QC 2CYYA 5E18F 4BHBA 5HLHA 3V8KA 3E6MA 4Z2YA 2V6EA 3KLOA 3FXRA 3EDPA 1ZRCA 4NC8A 5D5XB 2V1XA 1YRNB 4PK4A 2R7TA 5L3GA 4QIWN 2RV8A 4B4CA 5FKKA 3IRQA 1AWCA 3SXYA 4E7KA 3HUGA 4HSRA 5IYCJ 1RUNA 3RQ4A 4C3HJ 4IHVA 2WV1A 2IGOA 2VQCA 4M6VA 5B1AH 1X1DA 3I9V2 2P5LC 4GYGA 3QU3A 3ABLH 1X4PA 3HGGA 2E2IJ 4EJVA 5FO5A 3KP7A 1HLVA 4P5OA 1WKMA 1MGTA 4HG2A 4NQWB 3SDGA 3K4JA 4HDVA 1B8IA 3TEDA 2E2HJ 1ITYA 3OMYA 4G9YA 2O5RA 4L5JA 2OTLI 1FPQA 2V79A 3I58A 4GFBA 1Y8RB 3AG2H 5E1WA 3BG3A 5L3CA 4M6YA 4D1QA 3HTUA 2XAFA 2K27A 4ANJA 1F36A 2P6SA 2FSWA 5DUIA 2E36A 5KK1A 2R7OA 2VC1A 4XKCA 1YG2A 3ZR8X 4GDFA 1FTZA 4I01A 2E1CA 2DAOA 1LE8A 2IJLA 2LDUA 2XPUA 3BY6A 2Z33A 2Z3YA 2MBFA 3S1QJ 3G1MA 3OYNA 2L5QA 2EA2A 2VB6A 1OYYA 1HQCA 4C3IJ 1XGMA 1IN4A 1BJZA 2CUJA 4LOCA 2UV1A 3JRBA 2VBZA 2IS1A 3G3ZA 2O9LA 5HS8A 2L0KA 1MNMC 1JGSA 1EJ9A 1VQ7I 1TWFJ 2FA5A 1HKQA 2XIGA 2QSGX 2JA2A 3R0JA 4D7NA 1FC3A 5HNHA 2O8KA 3S3MA 2WA0A 3RKXA 1WQ2A 4YIIA 1MSFC 1A6IA 3N4MA 2O7OA 3OOPA 4FHTA 3DCFA 2NNYA 2HR3A 2PJRA 2NYXA 2EH3A 1VQMI 1IDYA 2H94A 2MH2A 2LK2A 2DOAA 3HHHA 4LIVA 4ZC3A 3C2BA 5LD2C 4BXFA 4RBOA 1AA7A 4N9HA 1XB4A 4G7HF 1Y0UA 3T5XA 1NG7A 1B4AA 4S0HB 3EYIA 3FHZA 4EMSA 4KDPA 5JFRA 1G2HA 3QPSA 2R7RA 1ZK8A 3ECHA 4A2UA 3E5UA 4XICA 2EV6A 2GLOA 2Y0SN 3HJEA 4AUXA 2HS5A 3ABTA 3RZOJ 3P9KA 2DCEA 3H0DA 2B9SA 3HPGA 3LSKA 1WH7A 1FJLA 1P4AA 2KMUA 2UXXA 4DZJA 1ZLJA 2DMPA 2NVTJ 1X58A 2L7MP 4MNUA 1YIOA 4DYCA 1VF9A 2JN6A 2LY2A 3K2ZA 1SD7A 3X2QH 1ERDA 4P9UA 3OR2C 4RGXA 1D1BA 4RGRA 3I4PA 1NG6A 5HVQC 4XMYA 4KUMA 2W1OA 3E5XA 2DT5A 4IQJA 1LEAA 1TC3C 5DDGA 3PSFA 2HQRA 4P9FA 2CUEA 2R5YB 3K10A 5CJ9A 4Y33A 1P92A 1DUXC 2PI0A 1ZRDA 2IVMA 2ME6A 2KT0A 3K70D 4G12A 1USTA 2EZIA 3C2GA 5CLSA 3BR5A 1OYWA 2VPRA 2DT6A 3G71I 4EM1A 4L0ZB 2M45A 4UUVA 1OCPA 3HRTA 5AONA 2A6EF 2VE8A 4LG0B 3BQYA 2NVUB 1SEUA 1G59A 1HSTA 3OIOA 5M5XJ 1YFHA 3F6VA 1T95A 4FX4A 4E7HA 4XQFA 1RZ4A 1X3ZB 4B1RA 1ETYA 3TL4X 2Y75A 4BQQA 3NWTA 4PJNA 2A68F 3OS1A 1D5YA 3U9GA 5EEGA 2K9LA 1B72A 1R49A 1E3PA 4AIJA 2E1MC 3HOVJ 3SJMA 2EIMH 4OIRF 2IBDA 5HLGA 1JHHA 3FZVA 1HCRA 5HLIA 1KU2A 2NRAC 3IH3A 1WRJA 2XPWA 2XSDC 2E1OA 2DPUA 5J8FA 2AHQA 3S1MJ 4AM3A 3C2HA 2HOSA 3M1CA 5DCMB 5D4SA 3I64A 2ZFUA 4XOPA 3S15J 1FOWA 2FU4A 3EETA 3KEQA 3I5UA 4U0VA 1K83J 1VZ0A 1GXPA 3DU5A 1QVUA 3LFUA 4ASNA 1B6AA 3IP4B 1PP8F 2BY0A 4ABZA 1YTYA 3S1NJ 5HDKA 4BEHA 2LKPA 3F8NA 3W6VA 5HODA 4OU0A 1O3TA 1K78A 1QRYA 2LMDA 3J81Z 4E7IA 1BC8C 2XF7A 1U3EM 1JT6A 1LKXA 1HC8A 3CC7I 1P7IA 1R5ID 2CQNA 2VL8A 3BR1A 3VWBA 1BM9A 1DGWY 3CUQA 3BR2A 4X6AJ 1LEBA 1STZA 2RKHA 1SVOA 5IT9K 4A3DJ 1GUUA 4UUSB 4LGWA 5HS9A 2QYOA 1QO0D 5TJJA 2OJED 5DEQA 4KICA 1R4NB 2GWRA 3HYIA 3TDZC 3E6CC 4E70A 2EQRA 4DIQA 3HM5A 1JKOC 3F6OA 3I4MJ 1V5EA 2ETHA 4DOZA 3MCZA 2XF6A 2XROA 3RZDJ 2FE3A 2DOEA 3ZMVA 2HNHA 4PUSA 1IN8A 3IV5A 2W4SA 3DEEA 3KX2A 5CVIA 2V4JC 1X3UA 2YX4A 2IEKA 3WTYC 2R7ZJ 3DBRB 5E20A 1SFXA 1R4MB 3DQVC 3IKTA 3PM1A 1H88C 1BL0A 1GVDA 2H27A 1OLTA 4UHTA 3TW6A 2QBYB 3HOSA 3M8FA 5LGTA 1MBHA 1MKMA 3CC2I 3K70C 2M4GA 5F64A 4XM3A 4J00A 1Y8QB 2O61A 4F3QA 2M1BA 2QF7A 3PQKA 1ETWA 4IJAA 1O3QA 3K7AJ 3WTUC 1YHQI 3JRFA 1BI0A 4YEJA 2ELKA 4LLLA 5KCMA 1L0OC 2XRLA 3NQOA 2Y30A 1XGSA 2QZ8A 3CLQA 2VXDA 3NARA 3GO5A 2LKXA 3OSGA 2KFDA 4L5EA 2KZGA 5FKNA 3OYDA 1USSA 3LSPA 2JK3A 1XTAA 1BR1A 4RB2C 2ID3A 2VBXA 3TW7A 3J7ZI 2R7DA 5GTIC 4EJWA 5DS9A 2H8RA 5LFAA 3JSOA 3ZMSA 5J40A 2X0LA 2L01A 1I27A 1U5TA 2BBYA 1SMTA 1JHFA 5JLWA 3LSRA 4V19K 1KU3A 1BR2A 2A5YB 2FBHA 4MHGA 1Z1DA 1WI3A 2VKDA 4OOIA 4G6TB 2QLZA 4ZTFA 4A3JJ 1F1ZA 2JQ7A 3I59B 4H4KC 4YRVA 1LE8B 2CV1A 5FLXK 2DA7A 4UNOA 5CPRB 4LJZF 4NHJA 2EFPA 4QPQA 2X1CA 2OV7A 4FQGA 3FHNA 2VBYA 3W2WA 4UV8A 5GAHJ 2QUFA 2BXZA 2CQ7A 4ZJZA 3N05A 5JR3A 2M2EA 1X3WB 4S04A 4ZTJA 5EG0A 1LB2A 4C2MJ 2M30A 4YFNF 2LYCA 1BOAA 3SEQA 1PUFA 1FIAA 3PNYA 4MFDA 1W5CC 1UZCA 4Y4RA 3ASNH 5BMZA 1A35A 3H9JA 5H6QA 4IOCF 1YITI 2GM4A 5FB2A 3FIWA 2CUZA 1R58A 4LB6B 1VQ9I 2R7FA 2F2EA 3FMQA 2QQ8A 2FEZA 2DXIA 2X6WA 3WE3A 2K9SA 2JA7J 3P7NA 2DMNA 2KRCA 2HEOA 2XHKA 2MH9A 1FOYA 1T98A 2FQ4A 5DCFA 4ZDLA 4WCGA 3G73A 2Y9YA 4ITVA 2ZMEA 4RS8A 1DGRM 2K9MA 3OR1C 3RKYA 5DTDA 3K4KA 2RAEA 3LWFA 2DI3A 2EA4A 3WHBA 5HNFA 2LC2A 2IGNA 2JMWA 3E1SA 3Q5FA 1IRFA 3M9AA 3CDIA 2W25A 2E34A 1OCOH 4I2OA 3LOCA 3LQQA 1SFOJ 1IV8A 4W1UA 4C30A 1LPQA 1VQ4I 3HEFA 3O8GA 4MLOA 5FFXA 5K7ZA 2IXSA 1UHWA 4BE2A 3F9KA 4DNCA 3OYIA 1GXQA 2DN0A 2LSOA 1BW5A 4LITA 3ZQCA 4IX7A 2KDOA 3CJTB 1NK2P 2BYVE 3KYCB 5JHFA 1RC9A 1OJLA 1Z77A 5DUKA 1IF1A 2DMQA 1ZTRA 3DFGA 3ESWB 3S3NA 2W57A 4Q47A 1VQ8I 4RAFA 3HC7A 3ZQFA 1ETXA 1XGOA 2E7WA 5IPAA 3GTKJ 3QYEA 3OYBA 2HWVA 3S17J 2L9SA 3H5NA 1Z9CA 2JVHA 2E35A 2YU3A 4FX0A 3TOBA 3UKGA 1WJ5A 5L3FA 2VASA 4ENKA 3GFLA 3WTTC 3Q9SA 2W00A 3M7GA 1FMVA 2FXAA 2EJRA 3ULQB 1XSXA 1LNWA 5K7HA 2AS5F 4AVPA 1BA5A 3JTGA 5J6XA 4KYWA 2ESNA 3OYGA 2DODA 2OQRA 2DFHA 2F5CA 5D6FA 2EZKA 1T56A 5E1ZB 2ELJA 2IS4A 2QSHX 2A5WA 1HKSA 4N0BA 2IS6A 1HF0A 3HRUA 5LGNA 4JOMA 4BY1J 1HA8A 5D8KB 1MH4A 3DPTA 3ZXSA 2COMA 2YSRA 3RDIA 1B72B 2WY7Q 1T38A 2DBBA 3I0TA 2DU9A 4BXUA 3AKZA 2L54A 2WB1N 3MKLA 2F48A 2VT2A 5J4VA 4PDKA 3GF2A 4ZDOA 4U7DA 1S7AA 3V7RA 1HSJA 3CUQC 3ABMH 2Q8KA 4XLAA 4LLNA 3SFZA 2DA1A 4EV0A 2BY1A 3BZCA 3CESA 2CV0A 1GT0C 4UXNA 2V7FA 1R5HA 3O8HA 1D0XA 1UB9A 3K0LA 4AYBA 4Y13A 4EGZA 1J0RA 3E5QA 1FNNA 2CW7A 1WSUA 3HOXJ 3BR0A 3AAFA 2DYRH 4O5VA 2ZNYA 1BI1A 5IT9Z 4BJ5C 5KAFC 4YIRX 5IT3A 1MNEA 2IRFG 4QSHA 2DK5A 4JBAA 2KPMA 3LSTA 2OTJI 1X1BA 3FXUA 5CQGA 3L09A 1SC7A 4V2FA 2QENA 2DT7B 3CUQB 1XX5A 4LG3A 2LBFB 3VSKA 1TWAJ 5K5RA 1CQTA 3HSEA 4G8XA 3CCRI 2MD5A 1ACIA 3ISPA 1EA3A 1WZ2A 1R1TA 2ELHA 5DM6F 1R1UA 2H1KA 1IDZA 3HZJA 1WJCA 1HXDA 4II3A 1QZEA 2DMUA 1D8KA 2R7XA 1IN5A 1SVMA 3KEOA 1QZZA 1S7OA 3FXQA 2W7NA 3FBIB 5ERIA 4JYKA 2F5FA 2CSOA 2LD5A 3SQNA 2VC0A 4FE4A 2JT1A 1D3YA 2MYSA 1W5TA 3QPHA 4KT5C 5B1BH 3PJRA 2K86A 3KPHA 1DP7P 3MQ0A 1KA8A 3A0BC 3IH4A 2E5NA 2GOXB 2LF8A 3MKZA 4A69C 3KZIC 3F23A 4OAYA 4M3EA 1JE8A 1MMSA 2X51A 1XC5A 2XDVA 2VJ5A 4MFEA 1WH5A 3VYRB 4GXOA 5AIQA 3HOWJ 1P4XA 2VJ4A 3CJNA 2ECCA 2W24A 4LIUA 1MDMB 2OBPA 4Y52J 1WCMJ 3WG9A 3P9IA 3WE2A 3J81K 2XAHA 4O6JA 3S2DJ 2TRTA 3CCQI 1IZ1A 1ZGJA 4O3MA 4L9JA 2FOWA 1VQLI 1K61A 3HXLA 4G7ZF 3CO6C 1Y39A 2IGMA 4MTEA 2STWA 1QNTA 2RQPA 3TO9A 4JX4A 1OR7C 2X6XA 3GW2A 2GOMA 2R4GA 4EJUA 1ZAOA 2M4KA 3MWMA 3RKWA 3RTRA 3KP4A 5L3DA 2BW3A 3GXOA 1DQUA 3H35A 1U2WA 4PSWA 4Q4ZF 4IHYA 2R7UA 1K4TA 2XASA 5HOOA 2BY2A 1W4MA 1YJ9I 4KJZA 5ILUA 1YLFA 2QGUA 2X1EA 2KRHA 4EVIA 5KHDA 2IA0A 4XRFA 1KYWA 5D6EA 3PUBA 2IA2A 3DTIA 1W7PA 4XLFA 3W3CA 1UG2A 2DA4A 4BAYA 4BE1A 2GAUA 4BBSJ 1B1BA 1K79A 1ZG1A 3WU0A 4KA4A 4GGGA 5FLVA 2CV2A 4XRSG 4LMYA 3EUHA 4P55A 2PLYA 2ZKZA 1RIOH 2H6BA 1KZHA 3C3WA 1J5YA 2KDZA 1PUFB 1OCZH 1A31A 4M9SA 1MNDA 2LRDA 2L7KA 2VBWA 4XKVA 3MFKA 2DQLA 3KIOA 3SZGA 1R1VA 1IUYA 1G3WA 4G6DA 4RB3C 3SFIA 1MH3A 4M74A 4WK8F 3L2CA 1SANA 2VPLA 1IN6A 2H6CA 2PMZN 5LHHA 1J75A 2IGKA 1GV2A 4A12A 3EYYA 1I39A 4AIHA 3PFYA 1ZELA 3NRVA 1JTXA 4XLPF 1MD0A 3KFWX 2ZJRF 2L2OA 5FRNA 4V2GA 5F04A 4DQ2A 5GPAA 2FF4A 3LFKA 3K1MA 3OYEA 3BTLA 1BJAA 1QZYA 2KP6A 3B6CA 3BTCA 3SZTA 3CP2A 4DYQA 2IA1A 3VDXA 2YS9A 1EF4A 1QVTA 3RPUA 4XLNF 3ZQQA 4R79A 3GFJA 2CRGA 4MIMA 5CVUA 1FY7A 3VPRA 3MVPA 4A6DA 1CGPA 4HF1A 2E7XA 2WAFA 4Y7NJ 1XCBA 3CCJI 1JUMA 1T0FA 3A2KA 2L7FP 4G94A 4I76A 1V5FA 3ZN1A 2GIZA 4M3BA 1V54H 2HPIA 3BC8A 3ROUA 2FX0A 1E3OC 2OCCH 3L00A 2KIMA 1RKTA 1XG1A 2LREA 1KQ8A 3DXJF 5ILVA 5HDGA 2DDBA 3K1NA 2L02A 1KU9A 4EJOA 3T0YA 2ISZA 2D2WA 3TQNA 4G7OF 3BCAA 1BN5A 2GXBA 1MJAA 1IJWC 2ACJA 2K3FA 4UB8C 2A61A 1RR8C 1Y6IA 2Y0SA 3ZMUA 3DU6A 3VYSB 4BBRJ 3TP3A 2H8WA 5CQEA 1X1AA 1SFEA 1U9NA 3JREA 2COBA 1G3SA 1UELB 2GXGA 1RETA 1J09A 3FISA 5EYRA 1YJNI 3HBLA 5EGOB 1ZG3A 2HOEA 4IOAF 2HDCA 1IRGA 5CVRA 4HF2A 4XLEA 1MMGA 2LH9A 3CMAI 1ZR4A 5AIPA 3L1PA 2R7SA 4IF4A 4IHSA 3OY9A 4C2TA 5GPCA 2YU9J 1KONA 5DYMA 2HTSA 3WODF 2VQHA 4JK1X 4EQQA 4A3BJ 2M87A 4MGRA 3PO3J 3FK7A 1FYLA 4N4OB 5EDNA 2M3AA 2IP2A 1H9TA 2CFXA 4AC0A 3E97A 2DJIA 5EZGA 4KN7X 4CSWA 3BG6A 4F52A 3L2WA 2HPMA 1SMYF 2HZTA 2X85A 4HNTA 4IO9F 3GTQJ 2X1DA 2YX7A 1YX3A 3FMSA 1XSDA 1MIJA 2CQXA 3GTLJ 3L9FA 4N4NB 2XAUA 1Z0XA 5TGTA 4FCYA 2D5VA 4HLXA 3I55I 3LSMA 4HPQA 3ZRGA 5HS7A 3KP2A 3U2RA 1YW7A 5K7FA 5F0FA 2OC6A 2Y69H 3AG3H 1SFUA 4FISA 4M3GA 1Z67A 1TL8A 5K5QA 2NNNA 1TWGJ 2R7QA 1S9HA 1IW7F 1T39A 3KZZA 3I4NJ 2LP0A 1D5VA 4KITB 2KLOA 3ELKA 4HF0A 5F6FA 4EM2A 4UV9A 2HZDA 2Z1DA 3R60A 2AXTC 3E6DA 5E1XA 3K4BA 3ZCOA 2ZBKA 2E71A 2VUMJ 1RI7A 3DBHB 3DV8A 3F72A 4F93B 3KYDB 2BOLA 4HQMA 4HV6A 2ZNZA 1S6LA 5E79C 3KE2A 3T8RA 3RQIA 3K69A 2AQFA 4I0AA 5BS6A 2ICWG 2LY9A 4I98B 2MG4A 3G1LA 2VKVA 3QYBA 1O4XA 4NBQA 2B0LA 3GTPJ 1OCRH 4HSTA 3CC4I 2X6YA 4OIQF 1QPIA 4Y17A 4CYCA 1G4DA 3AL0C 5E8IA 3OYFA 2YR2A 3H5RA 5D5VB 4XIDA 3CF2A 2IPQX 1NHAA 1WFXA 3ASOH 1KU7A 2FD5A 4XORA 3OS0A 2P5KA 4KNYA 4AD9A 4OAZA 2BV6A 3BTJA 1XGNA 1Y56A 2E60A 2KZVA 2BE5F 4BDYA 3GFIA 2VQLA 3BZKA 5F0HA 3FX3A 4HX4A 2JTVA 2M7BA 4HV5A 3JW4A 3JRDA 3GYHX 4ON0A 3CMEI 2EBIA 5DD8A 3MZHA 1CF7A 2R5ZA 3AL0B 4BS9A 1UFMA 4E6KG 2R93J 1R36A 2DW4A 3I71A 1W36D 1B59A 3BG5A 3F3XA 1UHSA 3LA2A 1WJFA 2W48A 4L18B 2DOFA 4IRHA 1FOKA 2AQEA 1FT9A 2LKSA 3ZMZA 4DYRA 5ICEA 1GLNA 4C9YA 3DWLE 4QPOA 1WWXA 2VQGA 4KMFA 1B9MA 2XC7A 2K02A 1WJBA 4IHTA 2IS2A 2EZLA 4KN4X 2QEXI 1SD5A 3HUGB 1MMAA 1G8XA 3O6BB 1YYVA 3BJ6A 1AOYA 5FLMJ 4ESJA 5A2QZ 2MA3A 4JX5A 4CXFA 1MBJA 1TQPA 5M5WJ 1Y1WJ 4BXXJ 1Y0NA 3D5LA 1D1AA 1LJ9A 3MD2A 2GIVA 3ZQLA 1ZYRF 4NUBA 1FP2A 3BR3A 3D0SA 2WAQN 1B8IB 1ETOA 2UZKA 1LQ1A 1S29A 2PG4A 3LAJA 2RREA 4HX7A 4IPAA 3KETA 1U78A 2Y9ZA 2MC3A 3S2HJ 2L9VA 5E3OA 4IHWA 2IAIA 2A69F 2OQGA 2V9PA 4F92B 2DFFA 3TP0A 3UR3C 4XLHA 3MKWB 4XSXF 4D0PA 1VQOI 1ETQA 1XMAA 1OCCH 2ADUA 4IRIA 3PUFA 4JP0A 2ZJQF 4LLGF 1V55H 3QOPA 3FKIJ 1HW1A 1JKPC 2M8GX 2G7UA 4E7ZA 3DPUA 3F22A 4CH7A 1ENHA 1VI0A 4XKBA 1Q1HA 4B09A 2BHZA 2ESHA 5LRSA 3HKZN 3OV8A 3W6KB 1RESA 1N75A 1POGA 2DA3A 3IRRA 4L0YB 2CGPA 4AIKA 1IAWA 4HA8A 4P96A 2PJRB 4K2EA 4RGUA 2KIQA 1FLIA 3RKQA 3F8FA 2HYJA 1ON2A 5FKMA 4XOTA 1P2FA 3JRGA 4E7LA 2V9VA 5CVJA 4PSXA 4G6QA 3HSFA 2ZSHB 4A0ZA 4YIFA 1RUOA 3ZQHA 2QM3A 3DLLF 2CS3A 3RYRA 2IT0A 1E0EA 4IVNA 1D1CA 4NQWA 2QQBA 4MEXF 4QWQA 4PJJA 2K4BA 2R3SA 1IC8A 2EIKH 2HTJA 4LD5A 2E2JJ 3GX4X 3S3OA 3DPLC 1IN7A 4B44A 1MMDA 2BXYA 3CCSI 3RCOA 3RIRA 2FBKA 4HQEA 2DYSH 1IUFA 4HBLA 1YI2I 3EQLF 4IKFA 1TP4A 2JZYA 1IXRC 4N9IA 3CCUI 4BACA 4A3CJ 2A3SA 2TCTA 5LEJA 1FSEA 1WPKA 3BG7A 5TRDA 1ZQ3P 1ZKGA 1YS7A 1VQ6I 4BQAA 1E2XA 3CCVI 3L7WA 3GVAA 4CA0A 5E3NA 3JR9A 1OCTC 2I5UA 4IQ4A 2HOTA 4HAMA 4U7BA 2JUGA 3IWZA 5IY5H 2QVOA 2Z9OA 2PJPA 5E17F 4A3KJ 1FIPA 3HOTA 2XKPA 2LVSA 4I7HA 3F8CA 4L9NA 1TT5B 3CMYA 3HL2A 3FXJA 2Y48A 3WU2C 2V1UA 3OIPA 1JI8A 3H9QA 1TWCJ 2N8GA 4BGDA 1J7KA 4IRGA 3PSIA 4FETA 1XDSA 2LF7A 2ME0A 1MZBA 3M1EA 4BHPA 2A6HF 5D8LB 1IO2A 2GA1A 1MBGA 2E19A 3HIFA 3LQRA 1Z3XA 3KCCA 3QOEA 3FM5A 5B5EC 5JHUA 3FDYA 2WC2A 1X2MA 1WJAA 3WHCA 1ZLKA 1EH8A 3CJRB 2F4MB 5CVVA 3A01A 4CCJA 5L3BA 4BE0A 1Y1VJ 3EPZA 3BCBA 5ICCA 4MTDA 3JSPA 4W97A 2BZTA 3S2WA 1SVLA 2WB1A 3R61A 3WG7H 2LTPA 4HRIA 2HU9A 4I0BA 3GWZA 3TBIA 4FT8A 2Y0MA 1MSEC 2DDAA 2Q1ZB 2DA6A 2GQQA 1P7JA 1EH6A 2NXNB 4M73A 4NNJA 4XL9A 3GEZA 2K9NA 3G1OA 4BJTA 2ZJPF 3CCMI 4FE7A 2VN2A 3A03A 3PNVA 4B43A 5LHGA 5K5OA 1A5JA 2VKHA 1GDTA 1UJ8A 1ZREA 4Z6YA 3OWTA 5IOYA 5FKOA 2HOAA 5IP6A 3GTMJ 3LNQA 1FOXA 3J7AY 3Q0VA 1O3SA 4L9VA 3TMOA 1I3AA 5D4RA 2CMPA 2MC4A 1FTTA 1BI3A 3H3ZA 1QHGA 1Z05A 5TISC 3NEUA 3ZOBA 3E7LA 4BEHB 1K78B 2EZHA 2QCOA 2CQKA 3IL2A 2R5YA 1IRXA 3H5AA 5EZHA 3IUOA 2RNJA 1R23A 3JCUC 4CYCB 2ZFWA 3FBNB 5IOZA 1DDNA 2FNPA 4BNCA 2R92J 1F4KA 1P6RA 4RMNA 4KMUX 3ABUA 3KP3A 3R0AA 3K2AA 2DA5A 2KL4A 4AWXB 2V6CA 4HDUA 1O7FA 3OYKA 1HW5A 3E0JB 1YJWI 2OZUA 3JRIA 1TT0A 2KRFA 4AYBN 3PIPF 1XMKA 2DLLA 2OF7A 4GCVA 4PJLA 2VXZA 3WU1B 3L2UA 1I6HJ 4M71A 1IGNA 2VI6A 5ILSA 1WVRA 1XMXA 3HB9A 3RI4A 4F91B 4A3GJ 2G0EA 2UUZA 2V1DA 3AFHA 4EGYA 3HTSB 2M9HA 1J9IA 2DFEA 2CU7A 1TW3A 4J01A 3HRSA 4D5FA 3A0HC 1MJ9A 2PEXA 1W5SA 4B3XA 1V4RA 3EUKL 3M4OJ 3SZPA 2XPVA 3DTKA 4CICA 2Q0OA 3JAMZ 1U5TC 5DCMA 5GTHC 4S05A 4D9JA 4IXAA 1TQMA 4PGHA 3OYHA 2M5WA 3JRHA 1GHCA 3LSGA 5M3MJ 4HLYA 4ZH4F 2OZ6A 1MBKA 1W0TA 3LSJA 3ZGKA 1HKTA 5CYVA 1QU3A 3JRAA 1R6RA 3EUAA 3HG9A 5M3FJ 1OQYA 4HOBA 3QPLA 1FYMA 4YELA 2V26A 4ENNA 4U0WA 1XS9A 1QBJA 4U88A 4ZYHA 2HGCA 5F27A 2X4HA 1U5TB 2GZWA 1Z91A 4LK1F 5BPDA 1PJRA 2XAJA 1X1CA 2A6TA 2OU2A 3OYMA 4DBRA 3F8MA 3HDDA 2FBIA 2XVCA 3K1PA 3OOUA 4XRSA 1JKQC 2I10A 3BPXA 3DLAA 1IG7A 5BQTA 3DKXA 4XK4A 4XN0A 2PX9A 3PNTA 2XGXA 3KP6A 2A05A 1ETVA 3J7YJ 5FJ8J 2CH0A 4R8HA 2HYFA 2ZCWA 3V42A 3REOA 4C2UA 1FBUA 1UMQA 2LR8A 1X2NA 2Z2SB 1LDDA 1YE9A 2K4JA 1SFKA 3VFZA 5KNLA 2FOKA 3MZYA 3KLNA 2LG4A 3G6EI 1VQKI 1PVEA 6PAXA 2F6CA 1LVKA 5DM7F 2O8XA 2LOOA 3B6AA 1K4SA 3F0CA 2YUSA 4PJ0C 5JVTA 2XKOA 1ZARA 1U0JA 2BEOA 5EG0B 2QBYA 3WTSC 4PJMA 2JRMA 3LSIA 1EKEA 2DJNA 1JXSA 1XN7A 3CUOA 3MKYB 2UXNA 3GLXA 3SDBA 5GAEJ 2ZMEC 5B66C 2PMZA 5FRMA 3MN2A 3AG1H 4ESBA 2CO5A 5IYDJ 3W2VA 1R00A 5J1YA 2VOOA 1XDUA 2HI3A 1ON1A 3I3LA 3M3YJ 4Q5SF 3VEPA 5A2QK 3OL4A 2PBIA 2CG4A 2VIXA 3BJOA 3BWGA 2H1LA 1Z3YA 1VQPI 2RN7A 4NDLA 1BR4A 1VNDA 2VJIA 2HVQA 3O2PE 1EV7A 3P9CA 4QTRA 3BDDA 3FWEA 2HQ5A 4B8XA 1KQ9A 2VLAA 5C3EJ 2IW5A 3BPVA 2ZMEB 4EEFG 1UAAA 1ZG5A 1J59A 4DGWB 2EIJH 2XAQA 4PCQA 5KVRA 3GTOJ 4L9TA 4TV7A 2JUCA 3I59A 4ZYDA 5FGMA 2XV4S 3V4GA 1M1EB 2EPFA 1P4WA 4RM3A 5J1UA 1UHMA 2HKOA 2DO7A 2L9RA 3ERED 4M6XA 1ODDA 3ZQ7A 2VE9A 4UB6C 1GVJA 5IYBJ 2EWNA 3JRCA 1Z21A 3BOQA 4HW0A 1FEXA 1TQIA 4ZYAA 1EH7A 1RR7A 3GZ6A 2M0MA 1LVAA 3GBGA 4R1HA 2Y31A 5BPIA 3K4LA 4HNVA 4NB5A 3K4NA 1KGSA 2W84A 4CYDA 1T8IA 4MQVA 4UVBA 4DBQA 4WX9A 1WJEA 3H0GJ 4U0YA 3CCYA 4QLCU 3LL7A 2G9WA 1S7EA 4RA2A 2OA4A 1K6YA 2XGEA 2ID6A 1SD6A 1OFCX 3L2VA 2WBMA 3U1DA 5J8CA 1E17A 2BGCA 1QQIA 5FD6A 2F5EA 1FBSA 2LLKA 2P6TA 2VKEA 4OIPF 4RLFA 2GXAA 2HKXA 2MGQA 5EJCA 2CW8A 5L3EA 4WXHA 3ZN0A 4F7ZA 5JVGF 1ZRFA 2K3PA 3PIOF 2RQQA 3BLYA 3GTGJ 2M0CA 1FP1D 4HNUA 2LY1A 3KYLA 2MD0A 3TO7A 2Z99A 3A01B 3QU6A 1W7PD 4FASD 2MLGA 1TBXA 2R7WA 4PFOA 3JTHA 3IH2A 4BDZA 2OPTA 3ONQA 1V5GA 2ZXJA 3RPQA 3J80Z 4M9ZA 3LAPA 3GCMA 1ZN2A 5FD5A 3WTZA 4KISA 1HBXG 2HXIA 4ZYEA 1U8RA 2JA5J 4WWCA 3U21A 1BI2A 3Q0WA 1AKHA 1LFPA 2ZXHA 1IV6A 2W82A 4CCNA 2LFBA 3G2BA 2K5CA 2ZB9A 2JWTA 4A3EJ 3S14J 4A0YA 1J2XA 1Z6RA 3KZYA 1XSVA 5EEHA 2RDPA 5F1RA 2H09A 3E3VA 2X48A 3VB2A 2JPCA 2WY8Q 1ONVA 2BVLA 1JGGA 2KHMA 3AG4H 3C18A 4BQOA 1YW9A 2QKLB 2O03A 4A0XA 2HVSA 2C6YA 5K1YA 3CTAA 5E3LA 1U8BA 1REPC 2L4AA 1R5GA 4XLCA 5H2FC 4PGGA 2EB7A 4UUTA 2ZSIB 3V7SA 1X19A 2FJ1A 4IZZA 4XRMA 1TNSA 3ZP5A 2F4IA 3ZPLA 4RAYA 3D5RC 3RPUD 3VYTB 3CF5F 1TW2A 4OMYA 3VYUB 3FKJA 1O3RA 3J7AO 1U9OA 4PFPA 1OISA 3PL8A 3CMMA 3D5SC 5B3SH 1A36A 3CP8A 1A04A 3PO2J 3S1RJ 4EM0B 4CHUA 2CQQA 4D7MA 4OIOF 4CDGA 2CFOA 3V8JA 1ZR2A 4BHCA 3HPHA 1TNTA 2NS8A 4Y3OA 2MFZA 1NTCA 2NVYJ 4F55A 2EV5A 2K85A 1R71A 3DTEA 5LHIA 2ECBA 2Y2ZA 3CDHA 1LUJB 2JSCA 3FXOA 4RAZA 1HOMA 3E6BA 4U87A 1HDPA 1TZLA 1Z7LA 1JJ8C 4HX8A 5C4XJ 4ZZLA 1XCVA 2V9KA 1X1PA 3C7JA 3BG9A 3KP5A 3RYPA 3CLOA 1ZGAA 4I02A 3VSLA
chains in the Genus database with same CATH topology
1RNLA 4LK0F 2NAZA 2FRHA 1DPRA 3WTWC 3WGHA 3GUDA 4KFCA 5HDNA 1ULYA 3DP7A 1C0WA 2FQ3A 5H6RA 2EV0A 4LFUA 2O0YA 3BP8A 3B02A 3MEXA 4KIGA 3DF8A 1YO5C 4LB5A 2VT3A 2YPRA 2VOPA 2UWMA 4M9XA 1DPUA 1TTYA 3DEUA 2P7CB 2CWEA 2G7HA 2ZJ2A 2KJCA 4ZYGA 3PQJA 4ZZDA 3QAHA 1MJBA 3T8TA 3VODA 1D8JA 2P5VA 3I53A 3CO7C 1W7PB 1QPMA 4JQFA 2RC4A 1HW2A 1T6SA 1R7JA 3QP6A 3TDUC 3BROA 3JAMK 2CW0F 1SAXA 3IWFA 4YG2F 3W6JB 1FSHA 1H0MA 4RB1A 2XRNA 1YQAA 1UCRA 2ZO4A 2EFQA 2RGVA 1MDMA 1T2KA 2A07F 2QQ9A 3IHUA 1LDKB 5BOXA 1PDNC 3PFIA 4CZZA 4XBFA 2Q2EA 4ENJA 4KIBA 4GYIA 1BC7C 2EFWA 1FYKA 3O3KA 3F21A 1VTNC 1LDJA 2P8TA 3TGNA 1OKRA 5E8GA 3I54A 3BZ6A 2WTEA 2KKOA 1F9NA 1ZH5A 2DQRA 1V3FA 4H0EA 3QP5A 1OR7A 3ZMDA 5LLQA 3IKVA 2PMUA 3ECOA 3H92A 2HFHA 2KIFA 2FMYA 3FMRA 3QRFF 2F5DA 4XSZF 2MLKA 4OINF 3F8BA 1Z7UA 1IXCA 2Z5UA 5LEKA 3COAC 3HRMA 3WGIA 4A5NA 3R4KA 5DV5A 5D5UB 3LA7A 1R22A 4HZFA 2EFNA 3RJPA 1FBQA 3VOEA 4M72A 2WWYA 2XUBA 2KIUA 3DKWA 4RB0A 1F5TA 3BJAA 4I09A 2ISYA 1BIBA 4ENMA 1BIAA 2D1VA 4PZJA 3WGGA 2FNAA 2XAGA 3GZ5A 1S3JA 1FX7A 2J5PA 5D5WB 2L4MA 3TKYA 5LGUA 3V8LA 1O57A 2EK5A 4ETSA 2PMHA 4CGZA 3V7CA 4Q48A 3TO6A 3HHGA 2RVCA 3Q9VA 1I1SA 2OAZA 2NS0A 1PP7U 2W85A 1Z6TA 2DFIA 1TLHB 3M8EA 5LRRA 5FFZA 3TOAA 3GFMA 1S8NA 1G3YA 4Y15A 3SHFA 1O7LA 2HQNA 1I6XA 3H3UA 2FMLA 1I5ZA 3J80K 2QQAA 4GO1A 3MAJA 4MQ9F 4BYYA 1IXSB 4KIFA 2JRTA 3IC7A 1B9NA 5DD4A 4BH9A 2K7LA 2TDXA 4OMZA 3FF5A 4HYEA 2PFBA 1XD7A 2VODA 2D1HA 2VONA 5ED4A 1YS6A 4MEYF 4LG0A 2DPDA 2L3DA 2WV0A 3FM3A 2PQ8A 4WF2A 3ML6A 4L5IA 3T1BA 4A6EA 1CF7B 1QGPA 2O3FA 5ICFA 3C1DA 3HSRA 4A5MA 2DK8A 1G6NA 2D45A 3ZMTA 5JI6A 1OPCA 2JPBA 2E1NA 4EJTA 1BBYA 1YW8A 1H9GA 1K6OA 5LBQA 2LNBA 3LA3A 1FWZA 4UVCA 3WTXC 2O6GE 1OYIA 4CO8A 1U6GA 3QPTA 4YFXF 1ZHFA 4RGSA 2EFOA 2AXLA 5ICGA 1PUEE 2M8EA 4YFKF 1KQ0A 5H20A 2STTA 1L3LA 4WXCA 3R6SA 1KYZA 2P4WA 1SD4A 1WI9A 1FZPB 1K7AA 1G3TA 4UVAA 2OD5A 2QWWA 2P7VB 4ESFA 3WTVC 2GA2A 3B73A 2J5OA 1I1GA 3K9TA 5FLXZ 3N97A 2KJBA 1OMIA 2HYGD 4WXDA 2PN6A 2DTRA 2CYYA 5E18F 4BHBA 5HLHA 3V8KA 3E6MA 4Z2YA 3KLOA 3FXRA 3EDPA 1ZRCA 5D5XB 2V1XA 5L3GA 2RV8A 3IRQA 1AWCA 3SXYA 3HUGA 1RUNA 2P5LC 4GYGA 3QU3A 4EJVA 5FO5A 3KP7A 4P5OA 1WKMA 1MGTA 4HDVA 4G9YA 4L5JA 1FPQA 2V79A 3I58A 5E1WA 5L3CA 4M6YA 3HTUA 2XAFA 2K27A 2P6SA 2FSWA 5DUIA 5KK1A 2VC1A 1YG2A 4I01A 2E1CA 2DAOA 2IJLA 2LDUA 2Z33A 3BY6A 2Z3YA 2MBFA 2EA2A 1OYYA 1HQCA 1XGMA 1IN4A 2VBZA 3G3ZA 5HS8A 1JGSA 2FA5A 1HKQA 2XIGA 3R0JA 1FC3A 3RKXA 1WQ2A 4YIIA 3N4MA 3OOPA 4FHTA 2NNYA 2HR3A 2NYXA 2MH2A 2H94A 3HHHA 4N9HA 1XB4A 4G7HF 1Y0UA 3T5XA 1B4AA 3EYIA 3FHZA 4EMSA 4KDPA 5JFRA 3ECHA 4A2UA 3E5UA 2EV6A 2HS5A 3ABTA 3P9KA 1P4AA 2UXXA 1ZLJA 4MNUA 1YIOA 3K2ZA 1SD7A 4P9UA 4RGXA 4RGRA 3I4PA 5HVQC 4KUMA 3E5XA 2DT5A 1LEAA 5DDGA 2HQRA 4P9FA 5CJ9A 1P92A 1DUXC 2PI0A 1ZRDA 2IVMA 1USTA 5CLSA 1OYWA 4EM1A 4L0ZB 2M45A 4UUVA 3HRTA 5AONA 2A6EF 2VE8A 4LG0B 1HSTA 1YFHA 3F6VA 4FX4A 1RZ4A 2Y75A 2A68F 3U9GA 5EEGA 4AIJA 4OIRF 5HLGA 1JHHA 3FZVA 5HLIA 1KU2A 2NRAC 1WRJA 2DPUA 5J8FA 5DCMB 5D4SA 3I64A 2FU4A 3EETA 3KEQA 3I5UA 4U0VA 1GXPA 4ASNA 1B6AA 1PP8F 1YTYA 5HDKA 2LKPA 3F8NA 4OU0A 1O3TA 1K78A 3J81Z 1BC8C 1U3EM 1BM9A 3CUQA 1LEBA 1STZA 2RKHA 5IT9K 4LGWA 5HS9A 2QYOA 1QO0D 5TJJA 5DEQA 4KICA 2GWRA 3HYIA 3TDZC 3E6CC 4E70A 3F6OA 2ETHA 3MCZA 2XROA 2FE3A 3ZMVA 1IN8A 5CVIA 1X3UA 2YX4A 3WTYC 5E20A 1SFXA 3IKTA 3DQVC 2H27A 4UHTA 2QBYB 3HOSA 3M8FA 5LGTA 1MKMA 5F64A 2O61A 2M1BA 3PQKA 1O3QA 4IJAA 4MEXF 3WTUC 1BI0A 4LLLA 1L0OC 3NQOA 1XGSA 2QZ8A 3GO5A 1USSA 4RB2C 2VBXA 2R7DA 4EJWA 3JSOA 3ZMSA 2X0LA 2L01A 1I27A 1U5TA 2BBYA 1SMTA 1JHFA 1KU3A 2A5YB 2FBHA 4MHGA 1Z1DA 4OOIA 2QLZA 1F1ZA 3I59B 5FLXK 4UNOA 4LJZF 4NHJA 2EFPA 2VBYA 4UV8A 2QUFA 5JR3A 4S04A 1LB2A 2M30A 4YFNF 1BOAA 5BMZA 5H6QA 5FB2A 1R58A 4LB6B 2R7FA 2F2EA 3FMQA 2FEZA 3WE3A 3P7NA 2HEOA 2XHKA 2MH9A 1T98A 5DCFA 4WCGA 3G73A 2ZMEA 4RS8A 3RKYA 3LWFA 2DI3A 2EA4A 3Q5FA 1IRFA 3M9AA 2W25A 4I2OA 3LQQA 5FFXA 1UHWA 4DNCA 1GXQA 2LSOA 2BYVE 5DUKA 1IF1A 3DFGA 2W57A 4Q47A 1XGOA 2E7WA 2HWVA 1Z9CA 2YU3A 4FX0A 3TOBA 5L3FA 4ENKA 3GFLA 3WTTC 3Q9SA 3M7GA 3ULQB 2FXAA 2EJRA 1XSXA 1LNWA 2AS5F 4AVPA 3JTGA 5J6XA 4KYWA 2ESNA 2OQRA 2F5CA 5D6FA 5E1ZB 1HKSA 4N0BA 3HRUA 5LGNA 5D8KB 3DPTA 2COMA 2YSRA 3RDIA 1T38A 2DBBA 3I0TA 2DU9A 4BXUA 2L54A 2VT2A 4PDKA 3GF2A 4U7DA 1S7AA 3V7RA 1HSJA 3CUQC 2Q8KA 4LLNA 3SFZA 4EV0A 4UXNA 1R5HA 1UB9A 3K0LA 4Y13A 4EGZA 1J0RA 3E5QA 1FNNA 1WSUA 3AAFA 4O5VA 2ZNYA 1BI1A 5IT9Z 5IT3A 2IRFG 2DK5A 4JBAA 3LSTA 3FXUA 3L09A 2QENA 3CUQB 5K5RA 3HSEA 4G8XA 2MD5A 3ISPA 1R1TA 2ELHA 1R1UA 1HXDA 1D8KA 1IN5A 3KEOA 1QZZA 1S7OA 3FXQA 5ERIA 2F5FA 2CSOA 3SQNA 2VC0A 2JT1A 1D3YA 1W5TA 3QPHA 4KT5C 2K86A 1DP7P 3MQ0A 1KA8A 2LF8A 3F23A 1JE8A 4GXOA 5AIQA 1P4XA 3CJNA 2W24A 1MDMB 2OBPA 3WG9A 3J81K 3P9IA 3WE2A 2XAHA 4O6JA 1IZ1A 1ZGJA 4O3MA 4L9JA 4G7ZF 3CO6C 4MTEA 2STWA 1QNTA 2RQPA 3TO9A 3GW2A 4EJUA 1ZAOA 3RKWA 3MWMA 3RTRA 3KP4A 5L3DA 3GXOA 1U2WA 4Q4ZF 2XASA 5HOOA 1W4MA 5ILUA 1YLFA 4EVIA 2IA0A 4XRFA 1KYWA 5D6EA 2IA2A 1W7PA 4BAYA 2GAUA 1B1BA 1K79A 1ZG1A 3WU0A 4KA4A 4GGGA 4LMYA 3EUHA 4P55A 2PLYA 2ZKZA 1RIOH 2H6BA 3C3WA 1J5YA 4M9SA 2VBWA 3MFKA 2DQLA 1R1VA 1IUYA 1G3WA 4G6DA 4RB3C 4WK8F 4M74A 3L2CA 1IN6A 2H6CA 5LHHA 1J75A 4A12A 3EYYA 4AIHA 4XLPF 3NRVA 1MD0A 3KFWX 4DQ2A 2FF4A 3LFKA 3K1MA 1BJAA 1QZYA 3SZTA 2IA1A 3RPUA 4XLNF 4R79A 3GFJA 5CVUA 4HF1A 1FY7A 4A6DA 1CGPA 2E7XA 1XCBA 1T0FA 4G94A 3ZN1A 3ROUA 3L00A 2KIMA 1KQ8A 3DXJF 5ILVA 5HDGA 3K1NA 2L02A 1KU9A 4EJOA 3T0YA 2ISZA 2D2WA 3TQNA 4G7OF 1BN5A 2GXBA 1MJAA 2ACJA 2A61A 3ZMUA 1SFEA 1G3SA 2GXGA 1ZG3A 2HOEA 2HDCA 1IRGA 5CVRA 4HF2A 5AIPA 4IF4A 4IHSA 5DYMA 2HTSA 3WODF 4JK1X 4EQQA 2M87A 4MGRA 1FYLA 2IP2A 1H9TA 2CFXA 3E97A 4KN7X 1SMYF 2HZTA 2YX7A 3FMSA 1XSDA 3L9FA 4HLXA 5HS7A 3KP2A 3U2RA 1YW7A 1SFUA 5K5QA 2NNNA 1IW7F 1T39A 3KZZA 1D5VA 4HF0A 3ELKA 5F6FA 4EM2A 4UV9A 3R60A 3E6DA 5E1XA 2ZBKA 1RI7A 3DV8A 3F72A 4HQMA 4HV6A 2ZNZA 1S6LA 3KE2A 3T8RA 3K69A 4I0AA 5BS6A 4I98B 2B0LA 4OIQF 4Y17A 1G4DA 5E8IA 2YR2A 5D5VB 2IPQX 1NHAA 1KU7A 2P5KA 4KNYA 4AD9A 2BV6A 1XGNA 2BE5F 3GFIA 3FX3A 4HX4A 2JTVA 4HV5A 3JW4A 3GYHX 4ON0A 5DD8A 3MZHA 1CF7A 1UFMA 1R36A 2DW4A 3I71A 1B59A 3F3XA 3LA2A 4L18B 4IRHA 1FOKA 1FT9A 3ZMZA 5ICEA 1WWXA 4KMFA 1B9MA 2K02A 4IHTA 4KN4X 1SD5A 3O6BB 1YYVA 3BJ6A 1AOYA 4ESJA 5A2QZ 2MA3A 4CXFA 1TQPA 3D5LA 1LJ9A 2GIVA 1ZYRF 1FP2A 3D0SA 2UZKA 1LQ1A 1S29A 2PG4A 3LAJA 4IPAA 4HX7A 3KETA 1U78A 2MC3A 2A69F 2OQGA 4XSXF 4D0PA 1XMAA 2ADUA 4IRIA 4LLGF 3QOPA 1HW1A 2G7UA 3F22A 1Q1HA 4B09A 2ESHA 5LRSA 3OV8A 3W6KB 3IRRA 4L0YB 2CGPA 4AIKA 1IAWA 4HA8A 4P96A 4K2EA 4RGUA 1FLIA 3F8FA 1ON2A 1P2FA 2V9VA 5CVJA 4G6QA 3HSFA 4YIFA 4A0ZA 1RUOA 2QM3A 3RYRA 2IT0A 4IVNA 4NQWA 2QQBA 4QWQA 2K4BA 2R3SA 4LD5A 2HTJA 3GX4X 3DPLC 1IN7A 3RIRA 2FBKA 4HQEA 4HBLA 3EQLF 2JZYA 1IXRC 4N9IA 2A3SA 5LEJA 1FSEA 5TRDA 1YS7A 4BQAA 1E2XA 3L7WA 3GVAA 4HAMA 4U7BA 3IWZA 2QVOA 2Z9OA 2PJPA 5E17F 3HOTA 2XKPA 4I7HA 3F8CA 4L9NA 2Y48A 2V1UA 1J7KA 4IRGA 1XDSA 2LF7A 3M1EA 1MZBA 4BHPA 2A6HF 5D8LB 2GA1A 3HIFA 3LQRA 3KCCA 3FM5A 5JHUA 2WC2A 1ZLKA 1EH8A 5CVVA 5L3BA 5ICCA 4MTDA 3JSPA 3S2WA 3R61A 4I0BA 3GWZA 4FT8A 2Y0MA 2GQQA 1EH6A 4M73A 3GEZA 2VN2A 5K5OA 5LHGA 1ZREA 1O3SA 4L9VA 5D4RA 1BI3A 3H3ZA 1Z05A 3NEUA 1K78B 2CQKA 3IL2A 2RNJA 1R23A 2ZFWA 1DDNA 2FNPA 4BNCA 1F4KA 1P6RA 4KMUX 3ABUA 3KP3A 3R0AA 4AWXB 2V6CA 4HDUA 1O7FA 1HW5A 2OZUA 2KRFA 1XMKA 2DLLA 4GCVA 2VXZA 3WU1B 4M71A 5ILSA 3RI4A 2V1DA 4EGYA 3HTSB 1J9IA 1TW3A 3HRSA 1MJ9A 2PEXA 1W5SA 1V4RA 3SZPA 4CICA 2Q0OA 3JAMZ 1U5TC 5DCMA 4S05A 4IXAA 1TQMA 4PGHA 2M5WA 1GHCA 4HLYA 4ZH4F 2OZ6A 1HKTA 5CYVA 4HOBA 1FYMA 4ENNA 4U0WA 1QBJA 4U88A 4ZYHA 2HGCA 2X4HA 1U5TB 2GZWA 1Z91A 4LK1F 5BPDA 2XAJA 2OU2A 3F8MA 2FBIA 2XVCA 3K1PA 3BPXA 5BQTA 2XGXA 3KP6A 4R8HA 2HYFA 2ZCWA 3REOA 1FBUA 1LDDA 2K4JA 3VFZA 2FOKA 3MZYA 3KLNA 6PAXA 2O8XA 5JVTA 2XKOA 1ZARA 2BEOA 2QBYA 3WTSC 1JXSA 1XN7A 3CUOA 2UXNA 3GLXA 4ESBA 2CO5A 1R00A 2VOOA 1XDUA 1ON1A 4Q5SF 3VEPA 5A2QK 2PBIA 2CG4A 3BJOA 3BWGA 2RN7A 3O2PE 1EV7A 3P9CA 3BDDA 3FWEA 4B8XA 1KQ9A 2IW5A 3BPVA 2ZMEB 1ZG5A 1J59A 2XAQA 4PCQA 5KVRA 4L9TA 4TV7A 4ZYDA 3I59A 5FGMA 2XV4S 3V4GA 1P4WA 1UHMA 2HKOA 2DO7A 3ERED 4M6XA 1ODDA 3ZQ7A 2VE9A 1GVJA 2EWNA 3BOQA 4HW0A 1TQIA 1EH7A 3GZ6A 1LVAA 4R1HA 5BPIA 4NB5A 1KGSA 2W84A 4CYDA 4MQVA 4UVBA 4WX9A 4U0YA 4QLCU 2G9WA 2OA4A 1SD6A 3U1DA 5J8CA 1E17A 2BGCA 1QQIA 5FD6A 2F5EA 1FBSA 2P6TA 4OIPF 2HKXA 5L3EA 4WXHA 3ZN0A 4F7ZA 1ZRFA 1FP1D 3TO7A 2Z99A 3QU6A 1W7PD 2MLGA 1TBXA 3JTHA 2ZXJA 3RPQA 3J80Z 4M9ZA 3LAPA 1ZN2A 5FD5A 3WTZA 1HBXG 4ZYEA 1U8RA 4WWCA 1BI2A 4A0YA 1J2XA 1Z6RA 3KZYA 1XSVA 5EEHA 2RDPA 5F1RA 2H09A 3E3VA 3VB2A 2JPCA 1ONVA 3C18A 1YW9A 2O03A 4A0XA 2C6YA 5K1YA 3CTAA 1REPC 2L4AA 1R5GA 4PGGA 2EB7A 3V7SA 3ZP5A 3ZPLA 1TNSA 4RAYA 1TW2A 4OMYA 1O3RA 3J7AO 1A04A 4EM0B 4CHUA 4OIOF 4CDGA 3V8JA 4BHCA 1TNTA 2EV5A 5LHIA 3CDHA 2JSCA 4RAZA 3E6BA 4HX8A 4ZZLA 1XCVA 3C7JA 3KP5A 3RYPA 3CLOA 1ZGAA 4I02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNL A;  4LK0 F;  2NAZ A;  2FRH A;  1DPR A;  3WTW C;  3WGH A;  3GUD A;  4KFC A;  5HDN A;  1ULY A;  3DP7 A;  1C0W A;  2FQ3 A;  5H6R A;  2EV0 A;  4LFU A;  2O0Y A;  3BP8 A;  3B02 A;  3MEX A;  4KIG A;  3DF8 A;  1YO5 C;  4LB5 A;  2VT3 A;  2YPR A;  2VOP A;  2UWM A;  4M9X A;  1DPU A;  1TTY A;  3DEU A;  2P7C B;  2CWE A;  2G7H A;  2ZJ2 A;  2KJC A;  4ZYG A;  3PQJ A;  4ZZD A;  3QAH A;  1MJB A;  3T8T A;  3VOD A;  1D8J A;  2P5V A;  3I53 A;  3CO7 C;  1W7P B;  1QPM A;  4JQF A;  2RC4 A;  1HW2 A;  1T6S A;  1R7J A;  3QP6 A;  3TDU C;  3BRO A;  3JAM K;  2CW0 F;  1SAX A;  3IWF A;  4YG2 F;  3W6J B;  1FSH A;  1H0M A;  4RB1 A;  2XRN A;  1YQA A;  1UCR A;  2ZO4 A;  2EFQ A;  2RGV A;  1MDM A;  1T2K A;  2A07 F;  2QQ9 A;  3IHU A;  1LDK B;  5BOX A;  1PDN C;  3PFI A;  4CZZ A;  4XBF A;  2Q2E A;  4ENJ A;  4KIB A;  4GYI A;  1BC7 C;  2EFW A;  1FYK A;  3O3K A;  3F21 A;  1VTN C;  1LDJ A;  2P8T A;  3TGN A;  1OKR A;  5E8G A;  3I54 A;  3BZ6 A;  2WTE A;  2KKO A;  1F9N A;  1ZH5 A;  2DQR A;  1V3F A;  4H0E A;  3QP5 A;  1OR7 A;  3ZMD A;  5LLQ A;  3IKV A;  2PMU A;  3ECO A;  3H92 A;  2HFH A;  2KIF A;  2FMY A;  3FMR A;  3QRF F;  2F5D A;  4XSZ F;  2MLK A;  4OIN F;  3F8B A;  1Z7U A;  1IXC A;  2Z5U A;  5LEK A;  3COA C;  3HRM A;  3WGI A;  4A5N A;  3R4K A;  5DV5 A;  5D5U B;  3LA7 A;  1R22 A;  4HZF A;  2EFN A;  3RJP A;  1FBQ A;  3VOE A;  4M72 A;  2WWY A;  2XUB A;  2KIU A;  3DKW A;  4RB0 A;  1F5T A;  3BJA A;  4I09 A;  2ISY A;  1BIB A;  4ENM A;  1BIA A;  2D1V A;  4PZJ A;  3WGG A;  2FNA A;  2XAG A;  3GZ5 A;  1S3J A;  1FX7 A;  2J5P A;  5D5W B;  2L4M A;  3TKY A;  5LGU A;  3V8L A;  1O57 A;  2EK5 A;  4ETS A;  2PMH A;  4CGZ A;  3V7C A;  4Q48 A;  3TO6 A;  3HHG A;  2RVC A;  3Q9V A;  1I1S A;  2OAZ A;  2NS0 A;  1PP7 U;  2W85 A;  1Z6T A;  2DFI A;  1TLH B;  3M8E A;  5LRR A;  5FFZ A;  3TOA A;  3GFM A;  1S8N A;  1G3Y A;  4Y15 A;  3SHF A;  1O7L A;  2HQN A;  1I6X A;  3H3U A;  2FML A;  1I5Z A;  3J80 K;  2QQA A;  4GO1 A;  3MAJ A;  4MQ9 F;  4BYY A;  1IXS B;  4KIF A;  2JRT A;  3IC7 A;  1B9N A;  5DD4 A;  4BH9 A;  2K7L A;  2TDX A;  4OMZ A;  3FF5 A;  4HYE A;  2PFB A;  1XD7 A;  2VOD A;  2D1H A;  2VON A;  5ED4 A;  1YS6 A;  4MEY F;  4LG0 A;  2DPD A;  2L3D A;  2WV0 A;  3FM3 A;  2PQ8 A;  4WF2 A;  3ML6 A;  4L5I A;  3T1B A;  4A6E A;  1CF7 B;  1QGP A;  2O3F A;  5ICF A;  3C1D A;  3HSR A;  4A5M A;  2DK8 A;  1G6N A;  2D45 A;  3ZMT A;  5JI6 A;  1OPC A;  2JPB A;  2E1N A;  4EJT A;  1BBY A;  1YW8 A;  1H9G A;  1K6O A;  5LBQ A;  2LNB A;  3LA3 A;  1FWZ A;  4UVC A;  3WTX C;  2O6G E;  1OYI A;  4CO8 A;  1U6G A;  3QPT A;  4YFX F;  1ZHF A;  4RGS A;  2EFO A;  2AXL A;  5ICG A;  1PUE E;  2M8E A;  4YFK F;  1KQ0 A;  5H20 A;  2STT A;  1L3L A;  4WXC A;  3R6S A;  1KYZ A;  2P4W A;  1SD4 A;  1WI9 A;  1FZP B;  1K7A A;  1G3T A;  4UVA A;  2OD5 A;  2QWW A;  2P7V B;  4ESF A;  3WTV C;  2GA2 A;  3B73 A;  2J5O A;  1I1G A;  3K9T A;  5FLX Z;  3N97 A;  2KJB A;  1OMI A;  2HYG D;  4WXD A;  2PN6 A;  2DTR A;  2CYY A;  5E18 F;  4BHB A;  5HLH A;  3V8K A;  3E6M A;  4Z2Y A;  3KLO A;  3FXR A;  3EDP A;  1ZRC A;  5D5X B;  2V1X A;  5L3G A;  2RV8 A;  3IRQ A;  1AWC A;  3SXY A;  3HUG A;  1RUN A;  2P5L C;  4GYG A;  3QU3 A;  4EJV A;  5FO5 A;  3KP7 A;  4P5O A;  1WKM A;  1MGT A;  4HDV A;  4G9Y A;  4L5J A;  1FPQ A;  2V79 A;  3I58 A;  5E1W A;  5L3C A;  4M6Y A;  3HTU A;  2XAF A;  2K27 A;  2P6S A;  2FSW A;  5DUI A;  5KK1 A;  2VC1 A;  1YG2 A;  4I01 A;  2E1C A;  2DAO A;  2IJL A;  2LDU A;  2Z33 A;  3BY6 A;  2Z3Y A;  2MBF A;  2EA2 A;  1OYY A;  1HQC A;  1XGM A;  1IN4 A;  2VBZ A;  3G3Z A;  5HS8 A;  1JGS A;  2FA5 A;  1HKQ A;  2XIG A;  3R0J A;  1FC3 A;  3RKX A;  1WQ2 A;  4YII A;  3N4M A;  3OOP A;  4FHT A;  2NNY A;  2HR3 A;  2NYX A;  2MH2 A;  2H94 A;  3HHH A;  4N9H A;  1XB4 A;  4G7H F;  1Y0U A;  3T5X A;  1B4A A;  3EYI A;  3FHZ A;  4EMS A;  4KDP A;  5JFR A;  3ECH A;  4A2U A;  3E5U A;  2EV6 A;  2HS5 A;  3ABT A;  3P9K A;  1P4A A;  2UXX A;  1ZLJ A;  4MNU A;  1YIO A;  3K2Z A;  1SD7 A;  4P9U A;  4RGX A;  4RGR A;  3I4P A;  5HVQ C;  4KUM A;  3E5X A;  2DT5 A;  1LEA A;  5DDG A;  2HQR A;  4P9F A;  5CJ9 A;  1P92 A;  1DUX C;  2PI0 A;  1ZRD A;  2IVM A;  1UST A;  5CLS A;  1OYW A;  4EM1 A;  4L0Z B;  2M45 A;  4UUV A;  3HRT A;  5AON A;  2A6E F;  2VE8 A;  4LG0 B;  1HST A;  1YFH A;  3F6V A;  4FX4 A;  1RZ4 A;  2Y75 A;  2A68 F;  3U9G A;  5EEG A;  4AIJ A;  4OIR F;  5HLG A;  1JHH A;  3FZV A;  5HLI A;  1KU2 A;  2NRA C;  1WRJ A;  2DPU A;  5J8F A;  5DCM B;  5D4S A;  3I64 A;  2FU4 A;  3EET A;  3KEQ A;  3I5U A;  4U0V A;  1GXP A;  4ASN A;  1B6A A;  1PP8 F;  1YTY A;  5HDK A;  2LKP A;  3F8N A;  4OU0 A;  1O3T A;  1K78 A;  3J81 Z;  1BC8 C;  1U3E M;  1BM9 A;  3CUQ A;  1LEB A;  1STZ A;  2RKH A;  5IT9 K;  4LGW A;  5HS9 A;  2QYO A;  1QO0 D;  5TJJ A;  5DEQ A;  4KIC A;  2GWR A;  3HYI A;  3TDZ C;  3E6C C;  4E70 A;  3F6O A;  2ETH A;  3MCZ A;  2XRO A;  2FE3 A;  3ZMV A;  1IN8 A;  5CVI A;  1X3U A;  2YX4 A;  3WTY C;  5E20 A;  1SFX A;  3IKT A;  3DQV C;  2H27 A;  4UHT A;  2QBY B;  3HOS A;  3M8F A;  5LGT A;  1MKM A;  5F64 A;  2O61 A;  2M1B A;  3PQK A;  1O3Q A;  4IJA A;  4MEX F;  3WTU C;  1BI0 A;  4LLL A;  1L0O C;  3NQO A;  1XGS A;  2QZ8 A;  3GO5 A;  1USS A;  4RB2 C;  2VBX A;  2R7D A;  4EJW A;  3JSO A;  3ZMS A;  2X0L A;  2L01 A;  1I27 A;  1U5T A;  2BBY A;  1SMT A;  1JHF A;  1KU3 A;  2A5Y B;  2FBH A;  4MHG A;  1Z1D A;  4OOI A;  2QLZ A;  1F1Z A;  3I59 B;  5FLX K;  4UNO A;  4LJZ F;  4NHJ A;  2EFP A;  2VBY A;  4UV8 A;  2QUF A;  5JR3 A;  4S04 A;  1LB2 A;  2M30 A;  4YFN F;  1BOA A;  5BMZ A;  5H6Q A;  5FB2 A;  1R58 A;  4LB6 B;  2R7F A;  2F2E A;  3FMQ A;  2FEZ A;  3WE3 A;  3P7N A;  2HEO A;  2XHK A;  2MH9 A;  1T98 A;  5DCF A;  4WCG A;  3G73 A;  2ZME A;  4RS8 A;  3RKY A;  3LWF A;  2DI3 A;  2EA4 A;  3Q5F A;  1IRF A;  3M9A A;  2W25 A;  4I2O A;  3LQQ A;  5FFX A;  1UHW A;  4DNC A;  1GXQ A;  2LSO A;  2BYV E;  5DUK A;  1IF1 A;  3DFG A;  2W57 A;  4Q47 A;  1XGO A;  2E7W A;  2HWV A;  1Z9C A;  2YU3 A;  4FX0 A;  3TOB A;  5L3F A;  4ENK A;  3GFL A;  3WTT C;  3Q9S A;  3M7G A;  3ULQ B;  2FXA A;  2EJR A;  1XSX A;  1LNW A;  2AS5 F;  4AVP A;  3JTG A;  5J6X A;  4KYW A;  2ESN A;  2OQR A;  2F5C A;  5D6F A;  5E1Z B;  1HKS A;  4N0B A;  3HRU A;  5LGN A;  5D8K B;  3DPT A;  2COM A;  2YSR A;  3RDI A;  1T38 A;  2DBB A;  3I0T A;  2DU9 A;  4BXU A;  2L54 A;  2VT2 A;  4PDK A;  3GF2 A;  4U7D A;  1S7A A;  3V7R A;  1HSJ A;  3CUQ C;  2Q8K A;  4LLN A;  3SFZ A;  4EV0 A;  4UXN A;  1R5H A;  1UB9 A;  3K0L A;  4Y13 A;  4EGZ A;  1J0R A;  3E5Q A;  1FNN A;  1WSU A;  3AAF A;  4O5V A;  2ZNY A;  1BI1 A;  5IT9 Z;  5IT3 A;  2IRF G;  2DK5 A;  4JBA A;  3LST A;  3FXU A;  3L09 A;  2QEN A;  3CUQ B;  5K5R A;  3HSE A;  4G8X A;  2MD5 A;  3ISP A;  1R1T A;  2ELH A;  1R1U A;  1HXD A;  1D8K A;  1IN5 A;  3KEO A;  1QZZ A;  1S7O A;  3FXQ A;  5ERI A;  2F5F A;  2CSO A;  3SQN A;  2VC0 A;  2JT1 A;  1D3Y A;  1W5T A;  3QPH A;  4KT5 C;  2K86 A;  1DP7 P;  3MQ0 A;  1KA8 A;  2LF8 A;  3F23 A;  1JE8 A;  4GXO A;  5AIQ A;  1P4X A;  3CJN A;  2W24 A;  1MDM B;  2OBP A;  3WG9 A;  3J81 K;  3P9I A;  3WE2 A;  2XAH A;  4O6J A;  1IZ1 A;  1ZGJ A;  4O3M A;  4L9J A;  4G7Z F;  3CO6 C;  4MTE A;  2STW A;  1QNT A;  2RQP A;  3TO9 A;  3GW2 A;  4EJU A;  1ZAO A;  3RKW A;  3MWM A;  3RTR A;  3KP4 A;  5L3D A;  3GXO A;  1U2W A;  4Q4Z F;  2XAS A;  5HOO A;  1W4M A;  5ILU A;  1YLF A;  4EVI A;  2IA0 A;  4XRF A;  1KYW A;  5D6E A;  2IA2 A;  1W7P A;  4BAY A;  2GAU A;  1B1B A;  1K79 A;  1ZG1 A;  3WU0 A;  4KA4 A;  4GGG A;  4LMY A;  3EUH A;  4P55 A;  2PLY A;  2ZKZ A;  1RIO H;  2H6B A;  3C3W A;  1J5Y A;  4M9S A;  2VBW A;  3MFK A;  2DQL A;  1R1V A;  1IUY A;  1G3W A;  4G6D A;  4RB3 C;  4WK8 F;  4M74 A;  3L2C A;  1IN6 A;  2H6C A;  5LHH A;  1J75 A;  4A12 A;  3EYY A;  4AIH A;  4XLP F;  3NRV A;  1MD0 A;  3KFW X;  4DQ2 A;  2FF4 A;  3LFK A;  3K1M A;  1BJA A;  1QZY A;  3SZT A;  2IA1 A;  3RPU A;  4XLN F;  4R79 A;  3GFJ A;  5CVU A;  4HF1 A;  1FY7 A;  4A6D A;  1CGP A;  2E7X A;  1XCB A;  1T0F A;  4G94 A;  3ZN1 A;  3ROU A;  3L00 A;  2KIM A;  1KQ8 A;  3DXJ F;  5ILV A;  5HDG A;  3K1N A;  2L02 A;  1KU9 A;  4EJO A;  3T0Y A;  2ISZ A;  2D2W A;  3TQN A;  4G7O F;  1BN5 A;  2GXB A;  1MJA A;  2ACJ A;  2A61 A;  3ZMU A;  1SFE A;  1G3S A;  2GXG A;  1ZG3 A;  2HOE A;  2HDC A;  1IRG A;  5CVR A;  4HF2 A;  5AIP A;  4IF4 A;  4IHS A;  5DYM A;  2HTS A;  3WOD F;  4JK1 X;  4EQQ A;  2M87 A;  4MGR A;  1FYL A;  2IP2 A;  1H9T A;  2CFX A;  3E97 A;  4KN7 X;  1SMY F;  2HZT A;  2YX7 A;  3FMS A;  1XSD A;  3L9F A;  4HLX A;  5HS7 A;  3KP2 A;  3U2R A;  1YW7 A;  1SFU A;  5K5Q A;  2NNN A;  1IW7 F;  1T39 A;  3KZZ A;  1D5V A;  4HF0 A;  3ELK A;  5F6F A;  4EM2 A;  4UV9 A;  3R60 A;  3E6D A;  5E1X A;  2ZBK A;  1RI7 A;  3DV8 A;  3F72 A;  4HQM A;  4HV6 A;  2ZNZ A;  1S6L A;  3KE2 A;  3T8R A;  3K69 A;  4I0A A;  5BS6 A;  4I98 B;  2B0L A;  4OIQ F;  4Y17 A;  1G4D A;  5E8I A;  2YR2 A;  5D5V B;  2IPQ X;  1NHA A;  1KU7 A;  2P5K A;  4KNY A;  4AD9 A;  2BV6 A;  1XGN A;  2BE5 F;  3GFI A;  3FX3 A;  4HX4 A;  2JTV A;  4HV5 A;  3JW4 A;  3GYH X;  4ON0 A;  5DD8 A;  3MZH A;  1CF7 A;  1UFM A;  1R36 A;  2DW4 A;  3I71 A;  1B59 A;  3F3X A;  3LA2 A;  4L18 B;  4IRH A;  1FOK A;  1FT9 A;  3ZMZ A;  5ICE A;  1WWX A;  4KMF A;  1B9M A;  2K02 A;  4IHT A;  4KN4 X;  1SD5 A;  3O6B B;  1YYV A;  3BJ6 A;  1AOY A;  4ESJ A;  5A2Q Z;  2MA3 A;  4CXF A;  1TQP A;  3D5L A;  1LJ9 A;  2GIV A;  1ZYR F;  1FP2 A;  3D0S A;  2UZK A;  1LQ1 A;  1S29 A;  2PG4 A;  3LAJ A;  4IPA A;  4HX7 A;  3KET A;  1U78 A;  2MC3 A;  2A69 F;  2OQG A;  4XSX F;  4D0P A;  1XMA A;  2ADU A;  4IRI A;  4LLG F;  3QOP A;  1HW1 A;  2G7U A;  3F22 A;  1Q1H A;  4B09 A;  2ESH A;  5LRS A;  3OV8 A;  3W6K B;  3IRR A;  4L0Y B;  2CGP A;  4AIK A;  1IAW A;  4HA8 A;  4P96 A;  4K2E A;  4RGU A;  1FLI A;  3F8F A;  1ON2 A;  1P2F A;  2V9V A;  5CVJ A;  4G6Q A;  3HSF A;  4YIF A;  4A0Z A;  1RUO A;  2QM3 A;  3RYR A;  2IT0 A;  4IVN A;  4NQW A;  2QQB A;  4QWQ A;  2K4B A;  2R3S A;  4LD5 A;  2HTJ A;  3GX4 X;  3DPL C;  1IN7 A;  3RIR A;  2FBK A;  4HQE A;  4HBL A;  3EQL F;  2JZY A;  1IXR C;  4N9I A;  2A3S A;  5LEJ A;  1FSE A;  5TRD A;  1YS7 A;  4BQA A;  1E2X A;  3L7W A;  3GVA A;  4HAM A;  4U7B A;  3IWZ A;  2QVO A;  2Z9O A;  2PJP A;  5E17 F;  3HOT A;  2XKP A;  4I7H A;  3F8C A;  4L9N A;  2Y48 A;  2V1U A;  1J7K A;  4IRG A;  1XDS A;  2LF7 A;  3M1E A;  1MZB A;  4BHP A;  2A6H F;  5D8L B;  2GA1 A;  3HIF A;  3LQR A;  3KCC A;  3FM5 A;  5JHU A;  2WC2 A;  1ZLK A;  1EH8 A;  5CVV A;  5L3B A;  5ICC A;  4MTD A;  3JSP A;  3S2W A;  3R61 A;  4I0B A;  3GWZ A;  4FT8 A;  2Y0M A;  2GQQ A;  1EH6 A;  4M73 A;  3GEZ A;  2VN2 A;  5K5O A;  5LHG A;  1ZRE A;  1O3S A;  4L9V A;  5D4R A;  1BI3 A;  3H3Z A;  1Z05 A;  3NEU A;  1K78 B;  2CQK A;  3IL2 A;  2RNJ A;  1R23 A;  2ZFW A;  1DDN A;  2FNP A;  4BNC A;  1F4K A;  1P6R A;  4KMU X;  3ABU A;  3KP3 A;  3R0A A;  4AWX B;  2V6C A;  4HDU A;  1O7F A;  1HW5 A;  2OZU A;  2KRF A;  1XMK A;  2DLL A;  4GCV A;  2VXZ A;  3WU1 B;  4M71 A;  5ILS A;  3RI4 A;  2V1D A;  4EGY A;  3HTS B;  1J9I A;  1TW3 A;  3HRS A;  1MJ9 A;  2PEX A;  1W5S A;  1V4R A;  3SZP A;  4CIC A;  2Q0O A;  3JAM Z;  1U5T C;  5DCM A;  4S05 A;  4IXA A;  1TQM A;  4PGH A;  2M5W A;  1GHC A;  4HLY A;  4ZH4 F;  2OZ6 A;  1HKT A;  5CYV A;  4HOB A;  1FYM A;  4ENN A;  4U0W A;  1QBJ A;  4U88 A;  4ZYH A;  2HGC A;  2X4H A;  1U5T B;  2GZW A;  1Z91 A;  4LK1 F;  5BPD A;  2XAJ A;  2OU2 A;  3F8M A;  2FBI A;  2XVC A;  3K1P A;  3BPX A;  5BQT A;  2XGX A;  3KP6 A;  4R8H A;  2HYF A;  2ZCW A;  3REO A;  1FBU A;  1LDD A;  2K4J A;  3VFZ A;  2FOK A;  3MZY A;  3KLN A;  6PAX A;  2O8X A;  5JVT A;  2XKO A;  1ZAR A;  2BEO A;  2QBY A;  3WTS C;  1JXS A;  1XN7 A;  3CUO A;  2UXN A;  3GLX A;  4ESB A;  2CO5 A;  1R00 A;  2VOO A;  1XDU A;  1ON1 A;  4Q5S F;  3VEP A;  5A2Q K;  2PBI A;  2CG4 A;  3BJO A;  3BWG A;  2RN7 A;  3O2P E;  1EV7 A;  3P9C A;  3BDD A;  3FWE A;  4B8X A;  1KQ9 A;  2IW5 A;  3BPV A;  2ZME B;  1ZG5 A;  1J59 A;  2XAQ A;  4PCQ A;  5KVR A;  4L9T A;  4TV7 A;  4ZYD A;  3I59 A;  5FGM A;  2XV4 S;  3V4G A;  1P4W A;  1UHM A;  2HKO A;  2DO7 A;  3ERE D;  4M6X A;  1ODD A;  3ZQ7 A;  2VE9 A;  1GVJ A;  2EWN A;  3BOQ A;  4HW0 A;  1TQI A;  1EH7 A;  3GZ6 A;  1LVA A;  4R1H A;  5BPI A;  4NB5 A;  1KGS A;  2W84 A;  4CYD A;  4MQV A;  4UVB A;  4WX9 A;  4U0Y A;  4QLC U;  2G9W A;  2OA4 A;  1SD6 A;  3U1D A;  5J8C A;  1E17 A;  2BGC A;  1QQI A;  5FD6 A;  2F5E A;  1FBS A;  2P6T A;  4OIP F;  2HKX A;  5L3E A;  4WXH A;  3ZN0 A;  4F7Z A;  1ZRF A;  1FP1 D;  3TO7 A;  2Z99 A;  3QU6 A;  1W7P D;  2MLG A;  1TBX A;  3JTH A;  2ZXJ A;  3RPQ A;  3J80 Z;  4M9Z A;  3LAP A;  1ZN2 A;  5FD5 A;  3WTZ A;  1HBX G;  4ZYE A;  1U8R A;  4WWC A;  1BI2 A;  4A0Y A;  1J2X A;  1Z6R A;  3KZY A;  1XSV A;  5EEH A;  2RDP A;  5F1R A;  2H09 A;  3E3V A;  3VB2 A;  2JPC A;  1ONV A;  3C18 A;  1YW9 A;  2O03 A;  4A0X A;  2C6Y A;  5K1Y A;  3CTA A;  1REP C;  2L4A A;  1R5G A;  4PGG A;  2EB7 A;  3V7S A;  3ZP5 A;  3ZPL A;  1TNS A;  4RAY A;  1TW2 A;  4OMY A;  1O3R A;  3J7A O;  1A04 A;  4EM0 B;  4CHU A;  4OIO F;  4CDG A;  3V8J A;  4BHC A;  1TNT A;  2EV5 A;  5LHI A;  3CDH A;  2JSC A;  4RAZ A;  3E6B A;  4HX8 A;  4ZZL A;  1XCV A;  3C7J A;  3KP5 A;  3RYP A;  3CLO A;  1ZGA A;  4I02 A; 
#chains in the Genus database with same CATH topology
 4B3A A;  1RNL A;  4LK0 F;  1N78 A;  2NAZ A;  2FRH A;  1DPR A;  3WTW C;  3WGH A;  3GUD A;  3FXK A;  4KFC A;  5HDN A;  1ULY A;  1SAU A;  2P0W A;  3DP7 A;  1C0W A;  2FQ3 A;  1T33 A;  5H6R A;  2EV0 A;  4LFU A;  2O0Y A;  3BP8 A;  1WGX A;  3B02 A;  3MEX A;  2EIL H;  4KIG A;  3QYF A;  3DF8 A;  5FKL A;  1YO5 C;  1GV5 A;  4B47 A;  4LB5 A;  2VT3 A;  1YOV B;  2E1M B;  3M8J A;  2YPR A;  2VOP A;  1DU6 A;  2UWM A;  3OYL A;  4A3M J;  1LFU P;  3IAS 2;  4M9X A;  4P1W A;  1DPU A;  1S72 I;  1TTY A;  5IP9 J;  2XGC A;  3MZ8 A;  5J3L A;  1WHU A;  3A1Y A;  3DEU A;  4RLQ A;  2CWE A;  2P7C B;  5KAI C;  2G7H A;  2ZJ2 A;  1VFC A;  2LBF A;  3A4C A;  4CCK A;  2B63 J;  2MSY A;  2BW3 B;  4M3D A;  3EUH C;  2KJC A;  4ZYG A;  1BOB A;  2VJJ A;  1N77 A;  3L2Q A;  2JA8 J;  3PQJ A;  4ZZD A;  2FUG 2;  2CUF A;  3QAH A;  3FXL A;  1ORK A;  1MJB A;  4BQN A;  1MMN A;  4XKW A;  3H9G A;  3SEZ A;  3T8T A;  3VOD A;  3P5J A;  1NK3 P;  2P5V A;  3I53 A;  1D8J A;  1XPX A;  3CO7 C;  1W7P B;  1QPM A;  4KT6 A;  4JQF A;  2RC4 A;  1HW2 A;  1T6S A;  2AO9 A;  1R7J A;  3QP6 A;  3TDU C;  2RNG A;  1S5L C;  1T08 B;  3BRO A;  2ZC2 A;  1JTY A;  3JAM K;  3DBL B;  2CW0 F;  1SAX A;  3IWF A;  3OSF A;  4YG2 F;  1Q1V A;  3W6J B;  3I56 I;  1JKR C;  4RAG A;  1FSH A;  2WAQ A;  1H0M A;  2KQR A;  4RB1 A;  1VQN I;  4CCM A;  2XRN A;  1YQA A;  4IEJ A;  1UCR A;  4BUP A;  5C4J J;  2ZO4 A;  4BU2 A;  1QA6 A;  2EFQ A;  2RGV A;  2R7V A;  1MDM A;  1T2K A;  2A07 F;  1T0F C;  2QQ9 A;  1QHH D;  3IHU A;  1LDK B;  4M3F A;  5BOX A;  1PDN C;  1MW7 A;  2HDW A;  4FTH A;  3PFI A;  1H8A C;  3MMY B;  4UY8 I;  4CZZ A;  1YIJ I;  1NH3 A;  4XBF A;  2Q2E A;  1AHD P;  4ENJ A;  4DW6 A;  1YX5 A;  4KIB A;  4GYI A;  1BC7 C;  2EFW A;  3GTJ J;  1FYK A;  3O3K A;  5EEA A;  3OYA A;  3F21 A;  1ETK A;  1VTN C;  3HKZ A;  1LDJ A;  2P8T A;  3TGN A;  2QKM B;  1OKR A;  4E7J A;  4J19 A;  3CCL I;  1N25 A;  5E8G A;  2L9N A;  3HOU J;  3D1N I;  4A3F J;  3IAM 2;  3I54 A;  3RSN A;  3BZ6 A;  1W1W E;  2WTE A;  2KKO A;  3ABK H;  1F9N A;  4CZC A;  1ZH5 A;  2DQR A;  1V3F A;  1YRN A;  1I50 J;  4H0E A;  3QP5 A;  1OR7 A;  1X4O A;  5F1J A;  3ZMD A;  2ZXW H;  2QA4 I;  5LLQ A;  3IKV A;  1JUS A;  2P81 A;  2PMU A;  2NOJ B;  3ECO A;  3H92 A;  4RM2 A;  2HFH A;  2KIF A;  2FMY A;  3FMR A;  1HDD C;  3QRF F;  4CCL A;  2F5D A;  3OS2 A;  4XSZ F;  2MLK A;  4OIN F;  3F8B A;  3GLL A;  1Z7U A;  4ZDP A;  1IXC A;  3DKY A;  2Z5U A;  5BNG A;  3M07 A;  5LEK A;  1JJ6 C;  1W36 C;  3COA C;  2JVG A;  1RRJ A;  3HGY A;  3HRM A;  2HXO A;  3WGI A;  4RDU A;  3L2R A;  5J1R A;  4A5N A;  3R4K A;  5DV5 A;  4AID A;  5D5U B;  3LA7 A;  1IRZ A;  1R22 A;  3CCE I;  4HZF A;  3GME A;  2EFN A;  3S93 A;  3RJP A;  5GAD J;  1WJD A;  1FBQ A;  2BVM A;  2JJ7 A;  3VOE A;  4M72 A;  4EAT A;  1E3H A;  2WWY A;  2XUB A;  2KIU A;  3DKW A;  2L7Z A;  5JLX A;  4RB0 A;  1F5T A;  4AVZ A;  3BJA A;  4I09 A;  2ISY A;  1BIB A;  4ENM A;  4A3I J;  2NS7 A;  1BIA A;  2D1V A;  4PZJ A;  3WGG A;  2FNA A;  2XAG A;  3Q3S A;  3GZ5 A;  3LSH A;  3FK6 A;  1AKH B;  2F5V A;  1S3J A;  1FX7 A;  2J5P A;  5D5W B;  2L4M A;  3TKY A;  2XGD A;  5J4Y A;  3SYT A;  5LGU A;  2M34 A;  4E4H A;  3V8L A;  1JUP A;  1TWH J;  5CKT A;  4A93 J;  1O57 A;  2EK5 A;  1JT0 A;  1VQ5 I;  4ETS A;  2PMH A;  1BW6 A;  4CGZ A;  3V7C A;  2E5Z A;  4Q48 A;  3TO6 A;  2OUM A;  3HHG A;  2RVC A;  3Q9V A;  4XON A;  1I1S A;  5E3M A;  3OYC A;  2OAZ A;  2NS0 A;  1PP7 U;  2K40 A;  2W85 A;  4XNF A;  1Z6T A;  2DFI A;  1TLH B;  3M8E A;  4II2 A;  5LRR A;  4BL0 B;  2OCE A;  5FFZ A;  5HLT A;  2WAD A;  3ERM A;  3TOA A;  3GFM A;  1APL C;  4A3L J;  1S8N A;  2K9Q A;  5EGO A;  5C44 J;  9ANT A;  1G3Y A;  4Y15 A;  2XF5 A;  3SHF A;  2QSF X;  4DZP A;  3NWS A;  2V1N A;  5IP7 J;  4X0G A;  3QQA A;  1O7L A;  2I8D A;  2HQN A;  2JSP A;  1I6X A;  3H3U A;  2FML A;  1I5Z A;  4CCO A;  2HVR A;  3QOD A;  3J80 K;  1MBE A;  2QQA A;  4GO1 A;  3MAJ A;  2MW8 A;  3H1C A;  1RPW A;  4MQ9 F;  1H89 C;  2NVX J;  4HEA 2;  1FMW A;  4XN3 A;  3LMM A;  4BYY A;  1IXS B;  4KIF A;  2X6O A;  1F43 A;  2B7E A;  2JRT A;  2ZXI A;  3HOY J;  2JA6 J;  3IC7 A;  1B9N A;  1P9Q C;  2WAE A;  5DD4 A;  4BH9 A;  1MBF A;  4GRI A;  1UG0 A;  2K7L A;  2GBY A;  2TDX A;  4OMZ A;  3FF5 A;  4HYE A;  2PFB A;  1XD7 A;  1DU0 A;  2BHY A;  3GZN B;  2DMT A;  1LFB A;  2M7A A;  2X9D A;  2D1H A;  3Q0U A;  2VOD A;  1D0Z A;  3S16 J;  2VON A;  5ED4 A;  1YS6 A;  1I3Q J;  3A02 A;  4MEY F;  4LG0 A;  1AU7 A;  3QWL A;  2DPD A;  2L3D A;  4AU7 A;  2WV0 A;  3BR6 A;  4MO7 A;  3FM3 A;  4BKX A;  2PQ8 A;  4WF2 A;  3ML6 A;  2XB5 A;  2HQA A;  4L5I A;  3OIQ A;  4DJA A;  3T1B A;  3U1K A;  4A6E A;  2DA2 A;  1CF7 B;  2EIN H;  2XSJ C;  1QGP A;  5GP9 A;  2R5Z B;  2Z16 A;  2O3F A;  5ICF A;  3C1D A;  3HSR A;  3BQZ A;  4A5M A;  2DK8 A;  1G6N A;  2MAB A;  2D45 A;  3ZMT A;  5FRO A;  5JI6 A;  1D0Y A;  1OPC A;  2JPB A;  3UNG C;  4D5C A;  4X1E A;  2E1N A;  4I99 C;  4EJT A;  1BBY A;  4NC6 A;  1YW8 A;  3H36 A;  1H9G A;  3K4C A;  1K6O A;  2CJJ A;  4CUG A;  5LBQ A;  2LNB A;  4I6Z A;  3LA3 A;  4BY7 J;  1FWZ A;  5F08 A;  3CD6 I;  3S8P A;  3FXM A;  3ZQG A;  4UVC A;  3WTX C;  3NAU A;  2O6G E;  4B48 A;  1OYI A;  1ZGW A;  4CO8 A;  3H3V K;  1U6G A;  3QPT A;  2KIS A;  2F4O B;  5EF6 A;  1RKW A;  4YFX F;  1ZHF A;  5M5Y J;  4RGS A;  2EFO A;  4BJ6 C;  2AXL A;  1A6Q A;  1PYV A;  5ICG A;  1PUE E;  2DTZ A;  2M8E A;  4IHX A;  4OWR B;  4YFK F;  1KQ0 A;  5H20 A;  2STT A;  4UUS A;  1L3L A;  4WXC A;  3K6G A;  3R6S A;  5GAG J;  3BT9 A;  3DEW A;  1W0U A;  1KYZ A;  3CQZ J;  2P4W A;  1SD4 A;  1WI9 A;  3CJQ B;  5F0C A;  1FZP B;  2HDD A;  1K7A A;  1G3T A;  4UVA A;  3BTI A;  3K4M A;  2OD5 A;  2QWW A;  2P7V B;  4ESF A;  4XR6 A;  5J47 A;  3S32 A;  3WTV C;  1DP3 A;  4NC7 A;  2GA2 A;  2NOG A;  2Q2E B;  3B73 A;  2BY3 A;  1I1G A;  2J5O A;  3K9T A;  4E7S A;  3CZ6 A;  3KEY A;  5FLX Z;  3N97 A;  4IL6 C;  3G4S I;  2KJB A;  1OMI A;  3CDL A;  3OL3 A;  3ZQI A;  2HYG D;  3OYJ A;  2NVQ J;  3W2A A;  3HOZ J;  4JX6 A;  4WXD A;  4C3J J;  2PN6 A;  2XB0 X;  1R9T J;  2DTR A;  2R0Q C;  2CYY A;  5E18 F;  4BHB A;  5HLH A;  3V8K A;  3E6M A;  4Z2Y A;  2V6E A;  3KLO A;  3FXR A;  3EDP A;  1ZRC A;  4NC8 A;  5D5X B;  2V1X A;  1YRN B;  4PK4 A;  2R7T A;  5L3G A;  4QIW N;  2RV8 A;  4B4C A;  5FKK A;  3IRQ A;  1AWC A;  3SXY A;  4E7K A;  3HUG A;  4HSR A;  5IYC J;  1RUN A;  3RQ4 A;  4C3H J;  4IHV A;  2WV1 A;  2IGO A;  2VQC A;  4M6V A;  5B1A H;  1X1D A;  3I9V 2;  2P5L C;  4GYG A;  3QU3 A;  3ABL H;  1X4P A;  3HGG A;  2E2I J;  4EJV A;  5FO5 A;  3KP7 A;  1HLV A;  4P5O A;  1WKM A;  1MGT A;  4HG2 A;  4NQW B;  3SDG A;  3K4J A;  4HDV A;  1B8I A;  3TED A;  2E2H J;  1ITY A;  3OMY A;  4G9Y A;  2O5R A;  4L5J A;  2OTL I;  1FPQ A;  2V79 A;  3I58 A;  4GFB A;  1Y8R B;  3AG2 H;  5E1W A;  3BG3 A;  5L3C A;  4M6Y A;  4D1Q A;  3HTU A;  2XAF A;  2K27 A;  4ANJ A;  1F36 A;  2P6S A;  2FSW A;  5DUI A;  2E36 A;  5KK1 A;  2R7O A;  2VC1 A;  4XKC A;  1YG2 A;  3ZR8 X;  4GDF A;  1FTZ A;  4I01 A;  2E1C A;  2DAO A;  1LE8 A;  2IJL A;  2LDU A;  2XPU A;  3BY6 A;  2Z33 A;  2Z3Y A;  2MBF A;  3S1Q J;  3G1M A;  3OYN A;  2L5Q A;  2EA2 A;  2VB6 A;  1OYY A;  1HQC A;  4C3I J;  1XGM A;  1IN4 A;  1BJZ A;  2CUJ A;  4LOC A;  2UV1 A;  3JRB A;  2VBZ A;  2IS1 A;  3G3Z A;  2O9L A;  5HS8 A;  2L0K A;  1MNM C;  1JGS A;  1EJ9 A;  1VQ7 I;  1TWF J;  2FA5 A;  1HKQ A;  2XIG A;  2QSG X;  2JA2 A;  3R0J A;  4D7N A;  1FC3 A;  5HNH A;  2O8K A;  3S3M A;  2WA0 A;  3RKX A;  1WQ2 A;  4YII A;  1MSF C;  1A6I A;  3N4M A;  2O7O A;  3OOP A;  4FHT A;  3DCF A;  2NNY A;  2HR3 A;  2PJR A;  2NYX A;  2EH3 A;  1VQM I;  1IDY A;  2H94 A;  2MH2 A;  2LK2 A;  2DOA A;  3HHH A;  4LIV A;  4ZC3 A;  3C2B A;  5LD2 C;  4BXF A;  4RBO A;  1AA7 A;  4N9H A;  1XB4 A;  4G7H F;  1Y0U A;  3T5X A;  1NG7 A;  1B4A A;  4S0H B;  3EYI A;  3FHZ A;  4EMS A;  4KDP A;  5JFR A;  1G2H A;  3QPS A;  2R7R A;  1ZK8 A;  3ECH A;  4A2U A;  3E5U A;  4XIC A;  2EV6 A;  2GLO A;  2Y0S N;  3HJE A;  4AUX A;  2HS5 A;  3ABT A;  3RZO J;  3P9K A;  2DCE A;  3H0D A;  2B9S A;  3HPG A;  3LSK A;  1WH7 A;  1FJL A;  1P4A A;  2KMU A;  2UXX A;  4DZJ A;  1ZLJ A;  2DMP A;  2NVT J;  1X58 A;  2L7M P;  4MNU A;  1YIO A;  4DYC A;  1VF9 A;  2JN6 A;  2LY2 A;  3K2Z A;  1SD7 A;  3X2Q H;  1ERD A;  4P9U A;  3OR2 C;  4RGX A;  1D1B A;  4RGR A;  3I4P A;  1NG6 A;  5HVQ C;  4XMY A;  4KUM A;  2W1O A;  3E5X A;  2DT5 A;  4IQJ A;  1LEA A;  1TC3 C;  5DDG A;  3PSF A;  2HQR A;  4P9F A;  2CUE A;  2R5Y B;  3K10 A;  5CJ9 A;  4Y33 A;  1P92 A;  1DUX C;  2PI0 A;  1ZRD A;  2IVM A;  2ME6 A;  2KT0 A;  3K70 D;  4G12 A;  1UST A;  2EZI A;  3C2G A;  5CLS A;  3BR5 A;  1OYW A;  2VPR A;  2DT6 A;  3G71 I;  4EM1 A;  4L0Z B;  2M45 A;  4UUV A;  1OCP A;  3HRT A;  5AON A;  2A6E F;  2VE8 A;  4LG0 B;  3BQY A;  2NVU B;  1SEU A;  1G59 A;  1HST A;  3OIO A;  5M5X J;  1YFH A;  3F6V A;  1T95 A;  4FX4 A;  4E7H A;  4XQF A;  1RZ4 A;  1X3Z B;  4B1R A;  1ETY A;  3TL4 X;  2Y75 A;  4BQQ A;  3NWT A;  4PJN A;  2A68 F;  3OS1 A;  1D5Y A;  3U9G A;  5EEG A;  2K9L A;  1B72 A;  1R49 A;  1E3P A;  4AIJ A;  2E1M C;  3HOV J;  3SJM A;  2EIM H;  4OIR F;  2IBD A;  5HLG A;  1JHH A;  3FZV A;  1HCR A;  5HLI A;  1KU2 A;  2NRA C;  3IH3 A;  1WRJ A;  2XPW A;  2XSD C;  2E1O A;  2DPU A;  5J8F A;  2AHQ A;  3S1M J;  4AM3 A;  3C2H A;  2HOS A;  3M1C A;  5DCM B;  5D4S A;  3I64 A;  2ZFU A;  4XOP A;  3S15 J;  1FOW A;  2FU4 A;  3EET A;  3KEQ A;  3I5U A;  4U0V A;  1K83 J;  1VZ0 A;  1GXP A;  3DU5 A;  1QVU A;  3LFU A;  4ASN A;  1B6A A;  3IP4 B;  1PP8 F;  2BY0 A;  4ABZ A;  1YTY A;  3S1N J;  5HDK A;  4BEH A;  2LKP A;  3F8N A;  3W6V A;  5HOD A;  4OU0 A;  1O3T A;  1K78 A;  1QRY A;  2LMD A;  3J81 Z;  4E7I A;  1BC8 C;  2XF7 A;  1U3E M;  1JT6 A;  1LKX A;  1HC8 A;  3CC7 I;  1P7I A;  1R5I D;  2CQN A;  2VL8 A;  3BR1 A;  3VWB A;  1BM9 A;  1DGW Y;  3CUQ A;  3BR2 A;  4X6A J;  1LEB A;  1STZ A;  2RKH A;  1SVO A;  5IT9 K;  4A3D J;  1GUU A;  4UUS B;  4LGW A;  5HS9 A;  2QYO A;  1QO0 D;  5TJJ A;  2OJE D;  5DEQ A;  4KIC A;  1R4N B;  2GWR A;  3HYI A;  3TDZ C;  3E6C C;  4E70 A;  2EQR A;  4DIQ A;  3HM5 A;  1JKO C;  3F6O A;  3I4M J;  1V5E A;  2ETH A;  4DOZ A;  3MCZ A;  2XF6 A;  2XRO A;  3RZD J;  2FE3 A;  2DOE A;  3ZMV A;  2HNH A;  4PUS A;  1IN8 A;  3IV5 A;  2W4S A;  3DEE A;  3KX2 A;  5CVI A;  2V4J C;  1X3U A;  2YX4 A;  2IEK A;  3WTY C;  2R7Z J;  3DBR B;  5E20 A;  1SFX A;  1R4M B;  3DQV C;  3IKT A;  3PM1 A;  1H88 C;  1BL0 A;  1GVD A;  2H27 A;  1OLT A;  4UHT A;  3TW6 A;  2QBY B;  3HOS A;  3M8F A;  5LGT A;  1MBH A;  1MKM A;  3CC2 I;  3K70 C;  2M4G A;  5F64 A;  4XM3 A;  4J00 A;  1Y8Q B;  2O61 A;  4F3Q A;  2M1B A;  2QF7 A;  3PQK A;  1ETW A;  4IJA A;  1O3Q A;  3K7A J;  3WTU C;  1YHQ I;  3JRF A;  1BI0 A;  4YEJ A;  2ELK A;  4LLL A;  5KCM A;  1L0O C;  2XRL A;  3NQO A;  2Y30 A;  1XGS A;  2QZ8 A;  3CLQ A;  2VXD A;  3NAR A;  3GO5 A;  2LKX A;  3OSG A;  2KFD A;  4L5E A;  2KZG A;  5FKN A;  3OYD A;  1USS A;  3LSP A;  2JK3 A;  1XTA A;  1BR1 A;  4RB2 C;  2ID3 A;  2VBX A;  3TW7 A;  3J7Z I;  2R7D A;  5GTI C;  4EJW A;  5DS9 A;  2H8R A;  5LFA A;  3JSO A;  3ZMS A;  5J40 A;  2X0L A;  2L01 A;  1I27 A;  1U5T A;  2BBY A;  1SMT A;  1JHF A;  5JLW A;  3LSR A;  4V19 K;  1KU3 A;  1BR2 A;  2A5Y B;  2FBH A;  4MHG A;  1Z1D A;  1WI3 A;  2VKD A;  4OOI A;  4G6T B;  2QLZ A;  4ZTF A;  4A3J J;  1F1Z A;  2JQ7 A;  3I59 B;  4H4K C;  4YRV A;  1LE8 B;  2CV1 A;  5FLX K;  2DA7 A;  4UNO A;  5CPR B;  4LJZ F;  4NHJ A;  2EFP A;  4QPQ A;  2X1C A;  2OV7 A;  4FQG A;  3FHN A;  2VBY A;  3W2W A;  4UV8 A;  5GAH J;  2QUF A;  2BXZ A;  2CQ7 A;  4ZJZ A;  3N05 A;  5JR3 A;  2M2E A;  1X3W B;  4S04 A;  4ZTJ A;  5EG0 A;  1LB2 A;  4C2M J;  2M30 A;  4YFN F;  2LYC A;  1BOA A;  3SEQ A;  1PUF A;  1FIA A;  3PNY A;  4MFD A;  1W5C C;  1UZC A;  4Y4R A;  3ASN H;  5BMZ A;  1A35 A;  3H9J A;  5H6Q A;  4IOC F;  1YIT I;  2GM4 A;  5FB2 A;  3FIW A;  2CUZ A;  1R58 A;  4LB6 B;  1VQ9 I;  2R7F A;  2F2E A;  3FMQ A;  2QQ8 A;  2FEZ A;  2DXI A;  2X6W A;  3WE3 A;  2K9S A;  2JA7 J;  3P7N A;  2DMN A;  2KRC A;  2HEO A;  2XHK A;  2MH9 A;  1FOY A;  1T98 A;  2FQ4 A;  5DCF A;  4ZDL A;  4WCG A;  3G73 A;  2Y9Y A;  4ITV A;  2ZME A;  4RS8 A;  1DGR M;  2K9M A;  3OR1 C;  3RKY A;  5DTD A;  3K4K A;  2RAE A;  3LWF A;  2DI3 A;  2EA4 A;  3WHB A;  5HNF A;  2LC2 A;  2IGN A;  2JMW A;  3E1S A;  3Q5F A;  1IRF A;  3M9A A;  3CDI A;  2W25 A;  2E34 A;  1OCO H;  4I2O A;  3LOC A;  3LQQ A;  1SFO J;  1IV8 A;  4W1U A;  4C30 A;  1LPQ A;  1VQ4 I;  3HEF A;  3O8G A;  4MLO A;  5FFX A;  5K7Z A;  2IXS A;  1UHW A;  4BE2 A;  3F9K A;  4DNC A;  3OYI A;  1GXQ A;  2DN0 A;  2LSO A;  1BW5 A;  4LIT A;  3ZQC A;  4IX7 A;  2KDO A;  3CJT B;  1NK2 P;  2BYV E;  3KYC B;  5JHF A;  1RC9 A;  1OJL A;  1Z77 A;  5DUK A;  1IF1 A;  2DMQ A;  1ZTR A;  3DFG A;  3ESW B;  3S3N A;  2W57 A;  4Q47 A;  1VQ8 I;  4RAF A;  3HC7 A;  3ZQF A;  1ETX A;  1XGO A;  2E7W A;  5IPA A;  3GTK J;  3QYE A;  3OYB A;  2HWV A;  3S17 J;  2L9S A;  3H5N A;  1Z9C A;  2JVH A;  2E35 A;  2YU3 A;  4FX0 A;  3TOB A;  3UKG A;  1WJ5 A;  5L3F A;  2VAS A;  4ENK A;  3GFL A;  3WTT C;  3Q9S A;  2W00 A;  3M7G A;  1FMV A;  2FXA A;  2EJR A;  3ULQ B;  1XSX A;  1LNW A;  5K7H A;  2AS5 F;  4AVP A;  1BA5 A;  3JTG A;  5J6X A;  4KYW A;  2ESN A;  3OYG A;  2DOD A;  2OQR A;  2DFH A;  2F5C A;  5D6F A;  2EZK A;  1T56 A;  5E1Z B;  2ELJ A;  2IS4 A;  2QSH X;  2A5W A;  1HKS A;  4N0B A;  2IS6 A;  1HF0 A;  3HRU A;  5LGN A;  4JOM A;  4BY1 J;  1HA8 A;  5D8K B;  1MH4 A;  3DPT A;  3ZXS A;  2COM A;  2YSR A;  3RDI A;  1B72 B;  2WY7 Q;  1T38 A;  2DBB A;  3I0T A;  2DU9 A;  4BXU A;  3AKZ A;  2L54 A;  2WB1 N;  3MKL A;  2F48 A;  2VT2 A;  5J4V A;  4PDK A;  3GF2 A;  4ZDO A;  4U7D A;  1S7A A;  3V7R A;  1HSJ A;  3CUQ C;  3ABM H;  2Q8K A;  4XLA A;  4LLN A;  3SFZ A;  2DA1 A;  4EV0 A;  2BY1 A;  3BZC A;  3CES A;  2CV0 A;  1GT0 C;  4UXN A;  2V7F A;  1R5H A;  3O8H A;  1D0X A;  1UB9 A;  3K0L A;  4AYB A;  4Y13 A;  4EGZ A;  1J0R A;  3E5Q A;  1FNN A;  2CW7 A;  1WSU A;  3HOX J;  3BR0 A;  3AAF A;  2DYR H;  4O5V A;  2ZNY A;  1BI1 A;  5IT9 Z;  4BJ5 C;  5KAF C;  4YIR X;  5IT3 A;  1MNE A;  2IRF G;  4QSH A;  2DK5 A;  4JBA A;  2KPM A;  3LST A;  2OTJ I;  1X1B A;  3FXU A;  5CQG A;  3L09 A;  1SC7 A;  4V2F A;  2QEN A;  2DT7 B;  3CUQ B;  1XX5 A;  4LG3 A;  2LBF B;  3VSK A;  1TWA J;  5K5R A;  1CQT A;  3HSE A;  4G8X A;  3CCR I;  2MD5 A;  1ACI A;  3ISP A;  1EA3 A;  1WZ2 A;  1R1T A;  2ELH A;  5DM6 F;  1R1U A;  2H1K A;  1IDZ A;  3HZJ A;  1WJC A;  1HXD A;  4II3 A;  1QZE A;  2DMU A;  1D8K A;  2R7X A;  1IN5 A;  1SVM A;  3KEO A;  1QZZ A;  1S7O A;  3FXQ A;  2W7N A;  3FBI B;  5ERI A;  4JYK A;  2F5F A;  2CSO A;  2LD5 A;  3SQN A;  2VC0 A;  4FE4 A;  2JT1 A;  1D3Y A;  2MYS A;  1W5T A;  3QPH A;  4KT5 C;  5B1B H;  3PJR A;  2K86 A;  3KPH A;  1DP7 P;  3MQ0 A;  1KA8 A;  3A0B C;  3IH4 A;  2E5N A;  2GOX B;  2LF8 A;  3MKZ A;  4A69 C;  3KZI C;  3F23 A;  4OAY A;  4M3E A;  1JE8 A;  1MMS A;  2X51 A;  1XC5 A;  2XDV A;  2VJ5 A;  4MFE A;  1WH5 A;  3VYR B;  4GXO A;  5AIQ A;  3HOW J;  1P4X A;  2VJ4 A;  3CJN A;  2ECC A;  2W24 A;  4LIU A;  1MDM B;  2OBP A;  4Y52 J;  1WCM J;  3WG9 A;  3P9I A;  3WE2 A;  3J81 K;  2XAH A;  4O6J A;  3S2D J;  2TRT A;  3CCQ I;  1IZ1 A;  1ZGJ A;  4O3M A;  4L9J A;  2FOW A;  1VQL I;  1K61 A;  3HXL A;  4G7Z F;  3CO6 C;  1Y39 A;  2IGM A;  4MTE A;  2STW A;  1QNT A;  2RQP A;  3TO9 A;  4JX4 A;  1OR7 C;  2X6X A;  3GW2 A;  2GOM A;  2R4G A;  4EJU A;  1ZAO A;  2M4K A;  3MWM A;  3RKW A;  3RTR A;  3KP4 A;  5L3D A;  2BW3 A;  3GXO A;  1DQU A;  3H35 A;  1U2W A;  4PSW A;  4Q4Z F;  4IHY A;  2R7U A;  1K4T A;  2XAS A;  5HOO A;  2BY2 A;  1W4M A;  1YJ9 I;  4KJZ A;  5ILU A;  1YLF A;  2QGU A;  2X1E A;  2KRH A;  4EVI A;  5KHD A;  2IA0 A;  4XRF A;  1KYW A;  5D6E A;  3PUB A;  2IA2 A;  3DTI A;  1W7P A;  4XLF A;  3W3C A;  1UG2 A;  2DA4 A;  4BAY A;  4BE1 A;  2GAU A;  4BBS J;  1B1B A;  1K79 A;  1ZG1 A;  3WU0 A;  4KA4 A;  4GGG A;  5FLV A;  2CV2 A;  4XRS G;  4LMY A;  3EUH A;  4P55 A;  2PLY A;  2ZKZ A;  1RIO H;  2H6B A;  1KZH A;  3C3W A;  1J5Y A;  2KDZ A;  1PUF B;  1OCZ H;  1A31 A;  4M9S A;  1MND A;  2LRD A;  2L7K A;  2VBW A;  4XKV A;  3MFK A;  2DQL A;  3KIO A;  3SZG A;  1R1V A;  1IUY A;  1G3W A;  4G6D A;  4RB3 C;  3SFI A;  1MH3 A;  4M74 A;  4WK8 F;  3L2C A;  1SAN A;  2VPL A;  1IN6 A;  2H6C A;  2PMZ N;  5LHH A;  1J75 A;  2IGK A;  1GV2 A;  4A12 A;  3EYY A;  1I39 A;  4AIH A;  3PFY A;  1ZEL A;  3NRV A;  1JTX A;  4XLP F;  1MD0 A;  3KFW X;  2ZJR F;  2L2O A;  5FRN A;  4V2G A;  5F04 A;  4DQ2 A;  5GPA A;  2FF4 A;  3LFK A;  3K1M A;  3OYE A;  3BTL A;  1BJA A;  1QZY A;  2KP6 A;  3B6C A;  3BTC A;  3SZT A;  3CP2 A;  4DYQ A;  2IA1 A;  3VDX A;  2YS9 A;  1EF4 A;  1QVT A;  3RPU A;  4XLN F;  3ZQQ A;  4R79 A;  3GFJ A;  2CRG A;  4MIM A;  5CVU A;  1FY7 A;  3VPR A;  3MVP A;  4A6D A;  1CGP A;  4HF1 A;  2E7X A;  2WAF A;  4Y7N J;  1XCB A;  3CCJ I;  1JUM A;  1T0F A;  3A2K A;  2L7F P;  4G94 A;  4I76 A;  1V5F A;  3ZN1 A;  2GIZ A;  4M3B A;  1V54 H;  2HPI A;  3BC8 A;  3ROU A;  2FX0 A;  1E3O C;  2OCC H;  3L00 A;  2KIM A;  1RKT A;  1XG1 A;  2LRE A;  1KQ8 A;  3DXJ F;  5ILV A;  5HDG A;  2DDB A;  3K1N A;  2L02 A;  1KU9 A;  4EJO A;  3T0Y A;  2ISZ A;  2D2W A;  3TQN A;  4G7O F;  3BCA A;  1BN5 A;  2GXB A;  1MJA A;  1IJW C;  2ACJ A;  2K3F A;  4UB8 C;  2A61 A;  1RR8 C;  1Y6I A;  2Y0S A;  3ZMU A;  3DU6 A;  3VYS B;  4BBR J;  3TP3 A;  2H8W A;  5CQE A;  1X1A A;  1SFE A;  1U9N A;  3JRE A;  2COB A;  1G3S A;  1UEL B;  2GXG A;  1RET A;  1J09 A;  3FIS A;  5EYR A;  1YJN I;  3HBL A;  5EGO B;  1ZG3 A;  2HOE A;  4IOA F;  2HDC A;  1IRG A;  5CVR A;  4HF2 A;  4XLE A;  1MMG A;  2LH9 A;  3CMA I;  1ZR4 A;  5AIP A;  3L1P A;  2R7S A;  4IF4 A;  4IHS A;  3OY9 A;  4C2T A;  5GPC A;  2YU9 J;  1KON A;  5DYM A;  2HTS A;  3WOD F;  2VQH A;  4JK1 X;  4EQQ A;  4A3B J;  2M87 A;  4MGR A;  3PO3 J;  3FK7 A;  1FYL A;  4N4O B;  5EDN A;  2M3A A;  2IP2 A;  1H9T A;  2CFX A;  4AC0 A;  3E97 A;  2DJI A;  5EZG A;  4KN7 X;  4CSW A;  3BG6 A;  4F52 A;  3L2W A;  2HPM A;  1SMY F;  2HZT A;  2X85 A;  4HNT A;  4IO9 F;  3GTQ J;  2X1D A;  2YX7 A;  1YX3 A;  3FMS A;  1XSD A;  1MIJ A;  2CQX A;  3GTL J;  3L9F A;  4N4N B;  2XAU A;  1Z0X A;  5TGT A;  4FCY A;  2D5V A;  4HLX A;  3I55 I;  3LSM A;  4HPQ A;  3ZRG A;  5HS7 A;  3KP2 A;  3U2R A;  1YW7 A;  5K7F A;  5F0F A;  2OC6 A;  2Y69 H;  3AG3 H;  1SFU A;  4FIS A;  4M3G A;  1Z67 A;  1TL8 A;  5K5Q A;  2NNN A;  1TWG J;  2R7Q A;  1S9H A;  1IW7 F;  1T39 A;  3KZZ A;  3I4N J;  2LP0 A;  1D5V A;  4KIT B;  2KLO A;  3ELK A;  4HF0 A;  5F6F A;  4EM2 A;  4UV9 A;  2HZD A;  2Z1D A;  3R60 A;  2AXT C;  3E6D A;  5E1X A;  3K4B A;  3ZCO A;  2ZBK A;  2E71 A;  2VUM J;  1RI7 A;  3DBH B;  3DV8 A;  3F72 A;  4F93 B;  3KYD B;  2BOL A;  4HQM A;  4HV6 A;  2ZNZ A;  1S6L A;  5E79 C;  3KE2 A;  3T8R A;  3RQI A;  3K69 A;  2AQF A;  4I0A A;  5BS6 A;  2ICW G;  2LY9 A;  4I98 B;  2MG4 A;  3G1L A;  2VKV A;  3QYB A;  1O4X A;  4NBQ A;  2B0L A;  3GTP J;  1OCR H;  4HST A;  3CC4 I;  2X6Y A;  4OIQ F;  1QPI A;  4Y17 A;  4CYC A;  1G4D A;  3AL0 C;  5E8I A;  3OYF A;  2YR2 A;  3H5R A;  5D5V B;  4XID A;  3CF2 A;  2IPQ X;  1NHA A;  1WFX A;  3ASO H;  1KU7 A;  2FD5 A;  4XOR A;  3OS0 A;  2P5K A;  4KNY A;  4AD9 A;  4OAZ A;  2BV6 A;  3BTJ A;  1XGN A;  1Y56 A;  2E60 A;  2KZV A;  2BE5 F;  4BDY A;  3GFI A;  2VQL A;  3BZK A;  5F0H A;  3FX3 A;  4HX4 A;  2JTV A;  2M7B A;  4HV5 A;  3JW4 A;  3JRD A;  3GYH X;  4ON0 A;  3CME I;  2EBI A;  5DD8 A;  3MZH A;  1CF7 A;  2R5Z A;  3AL0 B;  4BS9 A;  1UFM A;  4E6K G;  2R93 J;  1R36 A;  2DW4 A;  3I71 A;  1W36 D;  1B59 A;  3BG5 A;  3F3X A;  1UHS A;  3LA2 A;  1WJF A;  2W48 A;  4L18 B;  2DOF A;  4IRH A;  1FOK A;  2AQE A;  1FT9 A;  2LKS A;  3ZMZ A;  4DYR A;  5ICE A;  1GLN A;  4C9Y A;  3DWL E;  4QPO A;  1WWX A;  2VQG A;  4KMF A;  1B9M A;  2XC7 A;  2K02 A;  1WJB A;  4IHT A;  2IS2 A;  2EZL A;  4KN4 X;  2QEX I;  1SD5 A;  3HUG B;  1MMA A;  1G8X A;  3O6B B;  1YYV A;  3BJ6 A;  1AOY A;  5FLM J;  4ESJ A;  5A2Q Z;  2MA3 A;  4JX5 A;  4CXF A;  1MBJ A;  1TQP A;  5M5W J;  1Y1W J;  4BXX J;  1Y0N A;  3D5L A;  1D1A A;  1LJ9 A;  3MD2 A;  2GIV A;  3ZQL A;  1ZYR F;  4NUB A;  1FP2 A;  3BR3 A;  3D0S A;  2WAQ N;  1B8I B;  1ETO A;  2UZK A;  1LQ1 A;  1S29 A;  2PG4 A;  3LAJ A;  2RRE A;  4HX7 A;  4IPA A;  3KET A;  1U78 A;  2Y9Z A;  2MC3 A;  3S2H J;  2L9V A;  5E3O A;  4IHW A;  2IAI A;  2A69 F;  2OQG A;  2V9P A;  4F92 B;  2DFF A;  3TP0 A;  3UR3 C;  4XLH A;  3MKW B;  4XSX F;  4D0P A;  1VQO I;  1ETQ A;  1XMA A;  1OCC H;  2ADU A;  4IRI A;  3PUF A;  4JP0 A;  2ZJQ F;  4LLG F;  1V55 H;  3QOP A;  3FKI J;  1HW1 A;  1JKP C;  2M8G X;  2G7U A;  4E7Z A;  3DPU A;  3F22 A;  4CH7 A;  1ENH A;  1VI0 A;  4XKB A;  1Q1H A;  4B09 A;  2BHZ A;  2ESH A;  5LRS A;  3HKZ N;  3OV8 A;  3W6K B;  1RES A;  1N75 A;  1POG A;  2DA3 A;  3IRR A;  4L0Y B;  2CGP A;  4AIK A;  1IAW A;  4HA8 A;  4P96 A;  2PJR B;  4K2E A;  4RGU A;  2KIQ A;  1FLI A;  3RKQ A;  3F8F A;  2HYJ A;  1ON2 A;  5FKM A;  4XOT A;  1P2F A;  3JRG A;  4E7L A;  2V9V A;  5CVJ A;  4PSX A;  4G6Q A;  3HSF A;  2ZSH B;  4A0Z A;  4YIF A;  1RUO A;  3ZQH A;  2QM3 A;  3DLL F;  2CS3 A;  3RYR A;  2IT0 A;  1E0E A;  4IVN A;  1D1C A;  4NQW A;  2QQB A;  4MEX F;  4QWQ A;  4PJJ A;  2K4B A;  2R3S A;  1IC8 A;  2EIK H;  2HTJ A;  4LD5 A;  2E2J J;  3GX4 X;  3S3O A;  3DPL C;  1IN7 A;  4B44 A;  1MMD A;  2BXY A;  3CCS I;  3RCO A;  3RIR A;  2FBK A;  4HQE A;  2DYS H;  1IUF A;  4HBL A;  1YI2 I;  3EQL F;  4IKF A;  1TP4 A;  2JZY A;  1IXR C;  4N9I A;  3CCU I;  4BAC A;  4A3C J;  2A3S A;  2TCT A;  5LEJ A;  1FSE A;  1WPK A;  3BG7 A;  5TRD A;  1ZQ3 P;  1ZKG A;  1YS7 A;  1VQ6 I;  4BQA A;  1E2X A;  3CCV I;  3L7W A;  3GVA A;  4CA0 A;  5E3N A;  3JR9 A;  1OCT C;  2I5U A;  4IQ4 A;  2HOT A;  4HAM A;  4U7B A;  2JUG A;  3IWZ A;  5IY5 H;  2QVO A;  2Z9O A;  2PJP A;  5E17 F;  4A3K J;  1FIP A;  3HOT A;  2XKP A;  2LVS A;  4I7H A;  3F8C A;  4L9N A;  1TT5 B;  3CMY A;  3HL2 A;  3FXJ A;  2Y48 A;  3WU2 C;  2V1U A;  3OIP A;  1JI8 A;  3H9Q A;  1TWC J;  2N8G A;  4BGD A;  1J7K A;  4IRG A;  3PSI A;  4FET A;  1XDS A;  2LF7 A;  2ME0 A;  1MZB A;  3M1E A;  4BHP A;  2A6H F;  5D8L B;  1IO2 A;  2GA1 A;  1MBG A;  2E19 A;  3HIF A;  3LQR A;  1Z3X A;  3KCC A;  3QOE A;  3FM5 A;  5B5E C;  5JHU A;  3FDY A;  2WC2 A;  1X2M A;  1WJA A;  3WHC A;  1ZLK A;  1EH8 A;  3CJR B;  2F4M B;  5CVV A;  3A01 A;  4CCJ A;  5L3B A;  4BE0 A;  1Y1V J;  3EPZ A;  3BCB A;  5ICC A;  4MTD A;  3JSP A;  4W97 A;  2BZT A;  3S2W A;  1SVL A;  2WB1 A;  3R61 A;  3WG7 H;  2LTP A;  4HRI A;  2HU9 A;  4I0B A;  3GWZ A;  3TBI A;  4FT8 A;  2Y0M A;  1MSE C;  2DDA A;  2Q1Z B;  2DA6 A;  2GQQ A;  1P7J A;  1EH6 A;  2NXN B;  4M73 A;  4NNJ A;  4XL9 A;  3GEZ A;  2K9N A;  3G1O A;  4BJT A;  2ZJP F;  3CCM I;  4FE7 A;  2VN2 A;  3A03 A;  3PNV A;  4B43 A;  5LHG A;  5K5O A;  1A5J A;  2VKH A;  1GDT A;  1UJ8 A;  1ZRE A;  4Z6Y A;  3OWT A;  5IOY A;  5FKO A;  2HOA A;  5IP6 A;  3GTM J;  3LNQ A;  1FOX A;  3J7A Y;  3Q0V A;  1O3S A;  4L9V A;  3TMO A;  1I3A A;  5D4R A;  2CMP A;  2MC4 A;  1FTT A;  1BI3 A;  3H3Z A;  1QHG A;  1Z05 A;  5TIS C;  3NEU A;  3ZOB A;  3E7L A;  4BEH B;  1K78 B;  2EZH A;  2QCO A;  2CQK A;  3IL2 A;  2R5Y A;  1IRX A;  3H5A A;  5EZH A;  3IUO A;  2RNJ A;  1R23 A;  3JCU C;  4CYC B;  2ZFW A;  3FBN B;  5IOZ A;  1DDN A;  2FNP A;  4BNC A;  2R92 J;  1F4K A;  1P6R A;  4RMN A;  4KMU X;  3ABU A;  3KP3 A;  3R0A A;  3K2A A;  2DA5 A;  2KL4 A;  4AWX B;  2V6C A;  4HDU A;  1O7F A;  3OYK A;  1HW5 A;  3E0J B;  1YJW I;  2OZU A;  3JRI A;  1TT0 A;  2KRF A;  4AYB N;  3PIP F;  1XMK A;  2DLL A;  2OF7 A;  4GCV A;  4PJL A;  2VXZ A;  3WU1 B;  3L2U A;  1I6H J;  4M71 A;  1IGN A;  2VI6 A;  5ILS A;  1WVR A;  1XMX A;  3HB9 A;  3RI4 A;  4F91 B;  4A3G J;  2G0E A;  2UUZ A;  2V1D A;  3AFH A;  4EGY A;  3HTS B;  2M9H A;  1J9I A;  2DFE A;  2CU7 A;  1TW3 A;  4J01 A;  3HRS A;  4D5F A;  3A0H C;  1MJ9 A;  2PEX A;  1W5S A;  4B3X A;  1V4R A;  3EUK L;  3M4O J;  3SZP A;  2XPV A;  3DTK A;  4CIC A;  2Q0O A;  3JAM Z;  1U5T C;  5DCM A;  5GTH C;  4S05 A;  4D9J A;  4IXA A;  1TQM A;  4PGH A;  3OYH A;  2M5W A;  3JRH A;  1GHC A;  3LSG A;  5M3M J;  4HLY A;  4ZH4 F;  2OZ6 A;  1MBK A;  1W0T A;  3LSJ A;  3ZGK A;  1HKT A;  5CYV A;  1QU3 A;  3JRA A;  1R6R A;  3EUA A;  3HG9 A;  5M3F J;  1OQY A;  4HOB A;  3QPL A;  1FYM A;  4YEL A;  2V26 A;  4ENN A;  4U0W A;  1XS9 A;  1QBJ A;  4U88 A;  4ZYH A;  2HGC A;  5F27 A;  2X4H A;  1U5T B;  2GZW A;  1Z91 A;  4LK1 F;  5BPD A;  1PJR A;  2XAJ A;  1X1C A;  2A6T A;  2OU2 A;  3OYM A;  4DBR A;  3F8M A;  3HDD A;  2FBI A;  2XVC A;  3K1P A;  3OOU A;  4XRS A;  1JKQ C;  2I10 A;  3BPX A;  3DLA A;  1IG7 A;  5BQT A;  3DKX A;  4XK4 A;  4XN0 A;  2PX9 A;  3PNT A;  2XGX A;  3KP6 A;  2A05 A;  1ETV A;  3J7Y J;  5FJ8 J;  2CH0 A;  4R8H A;  2HYF A;  2ZCW A;  3V42 A;  3REO A;  4C2U A;  1FBU A;  1UMQ A;  2LR8 A;  1X2N A;  2Z2S B;  1LDD A;  1YE9 A;  2K4J A;  1SFK A;  3VFZ A;  5KNL A;  2FOK A;  3MZY A;  3KLN A;  2LG4 A;  3G6E I;  1VQK I;  1PVE A;  6PAX A;  2F6C A;  1LVK A;  5DM7 F;  2O8X A;  2LOO A;  3B6A A;  1K4S A;  3F0C A;  2YUS A;  4PJ0 C;  5JVT A;  2XKO A;  1ZAR A;  1U0J A;  2BEO A;  5EG0 B;  2QBY A;  3WTS C;  4PJM A;  2JRM A;  3LSI A;  1EKE A;  2DJN A;  1JXS A;  1XN7 A;  3CUO A;  3MKY B;  2UXN A;  3GLX A;  3SDB A;  5GAE J;  2ZME C;  5B66 C;  2PMZ A;  5FRM A;  3MN2 A;  3AG1 H;  4ESB A;  2CO5 A;  5IYD J;  3W2V A;  1R00 A;  5J1Y A;  2VOO A;  1XDU A;  2HI3 A;  1ON1 A;  3I3L A;  3M3Y J;  4Q5S F;  3VEP A;  5A2Q K;  3OL4 A;  2PBI A;  2CG4 A;  2VIX A;  3BJO A;  3BWG A;  2H1L A;  1Z3Y A;  1VQP I;  2RN7 A;  4NDL A;  1BR4 A;  1VND A;  2VJI A;  2HVQ A;  3O2P E;  1EV7 A;  3P9C A;  4QTR A;  3BDD A;  3FWE A;  2HQ5 A;  4B8X A;  1KQ9 A;  2VLA A;  5C3E J;  2IW5 A;  3BPV A;  2ZME B;  4EEF G;  1UAA A;  1ZG5 A;  1J59 A;  4DGW B;  2EIJ H;  2XAQ A;  4PCQ A;  5KVR A;  3GTO J;  4L9T A;  4TV7 A;  2JUC A;  3I59 A;  4ZYD A;  5FGM A;  2XV4 S;  3V4G A;  1M1E B;  2EPF A;  1P4W A;  4RM3 A;  5J1U A;  1UHM A;  2HKO A;  2DO7 A;  2L9R A;  3ERE D;  4M6X A;  1ODD A;  3ZQ7 A;  2VE9 A;  4UB6 C;  1GVJ A;  5IYB J;  2EWN A;  3JRC A;  1Z21 A;  3BOQ A;  4HW0 A;  1FEX A;  1TQI A;  4ZYA A;  1EH7 A;  1RR7 A;  3GZ6 A;  2M0M A;  1LVA A;  3GBG A;  4R1H A;  2Y31 A;  5BPI A;  3K4L A;  4HNV A;  4NB5 A;  3K4N A;  1KGS A;  2W84 A;  4CYD A;  1T8I A;  4MQV A;  4UVB A;  4DBQ A;  4WX9 A;  1WJE A;  3H0G J;  4U0Y A;  3CCY A;  4QLC U;  3LL7 A;  2G9W A;  1S7E A;  4RA2 A;  2OA4 A;  1K6Y A;  2XGE A;  2ID6 A;  1SD6 A;  1OFC X;  3L2V A;  2WBM A;  3U1D A;  5J8C A;  1E17 A;  2BGC A;  1QQI A;  5FD6 A;  2F5E A;  1FBS A;  2LLK A;  2P6T A;  2VKE A;  4OIP F;  4RLF A;  2GXA A;  2HKX A;  2MGQ A;  5EJC A;  2CW8 A;  5L3E A;  4WXH A;  3ZN0 A;  4F7Z A;  5JVG F;  1ZRF A;  2K3P A;  3PIO F;  2RQQ A;  3BLY A;  3GTG J;  2M0C A;  1FP1 D;  4HNU A;  2LY1 A;  3KYL A;  2MD0 A;  3TO7 A;  2Z99 A;  3A01 B;  3QU6 A;  1W7P D;  4FAS D;  2MLG A;  1TBX A;  2R7W A;  4PFO A;  3JTH A;  3IH2 A;  4BDZ A;  2OPT A;  3ONQ A;  1V5G A;  2ZXJ A;  3RPQ A;  3J80 Z;  4M9Z A;  3LAP A;  3GCM A;  1ZN2 A;  5FD5 A;  3WTZ A;  4KIS A;  1HBX G;  2HXI A;  4ZYE A;  1U8R A;  2JA5 J;  4WWC A;  3U21 A;  1BI2 A;  3Q0W A;  1AKH A;  1LFP A;  2ZXH A;  1IV6 A;  2W82 A;  4CCN A;  2LFB A;  3G2B A;  2K5C A;  2ZB9 A;  2JWT A;  4A3E J;  3S14 J;  4A0Y A;  1J2X A;  1Z6R A;  3KZY A;  1XSV A;  5EEH A;  2RDP A;  5F1R A;  2H09 A;  3E3V A;  2X48 A;  3VB2 A;  2JPC A;  2WY8 Q;  1ONV A;  2BVL A;  1JGG A;  2KHM A;  3AG4 H;  3C18 A;  4BQO A;  1YW9 A;  2QKL B;  2O03 A;  4A0X A;  2HVS A;  2C6Y A;  5K1Y A;  3CTA A;  5E3L A;  1U8B A;  1REP C;  2L4A A;  1R5G A;  4XLC A;  5H2F C;  4PGG A;  2EB7 A;  4UUT A;  2ZSI B;  3V7S A;  1X19 A;  2FJ1 A;  4IZZ A;  4XRM A;  1TNS A;  3ZP5 A;  2F4I A;  3ZPL A;  4RAY A;  3D5R C;  3RPU D;  3VYT B;  3CF5 F;  1TW2 A;  4OMY A;  3VYU B;  3FKJ A;  1O3R A;  3J7A O;  1U9O A;  4PFP A;  1OIS A;  3PL8 A;  3CMM A;  3D5S C;  5B3S H;  1A36 A;  3CP8 A;  1A04 A;  3PO2 J;  3S1R J;  4EM0 B;  4CHU A;  2CQQ A;  4D7M A;  4OIO F;  4CDG A;  2CFO A;  3V8J A;  1ZR2 A;  4BHC A;  3HPH A;  1TNT A;  2NS8 A;  4Y3O A;  2MFZ A;  1NTC A;  2NVY J;  4F55 A;  2EV5 A;  2K85 A;  1R71 A;  3DTE A;  5LHI A;  2ECB A;  2Y2Z A;  3CDH A;  1LUJ B;  2JSC A;  3FXO A;  4RAZ A;  1HOM A;  3E6B A;  4U87 A;  1HDP A;  1TZL A;  1Z7L A;  1JJ8 C;  4HX8 A;  5C4X J;  4ZZL A;  1XCV A;  2V9K A;  1X1P A;  3C7J A;  3BG9 A;  3KP5 A;  3RYP A;  3CLO A;  1ZGA A;  4I02 A;  3VSL A; 
#chains in the Genus database with same CATH homology
 1RNL A;  4LK0 F;  2NAZ A;  2FRH A;  1DPR A;  3WTW C;  3WGH A;  3GUD A;  4KFC A;  5HDN A;  1ULY A;  3DP7 A;  1C0W A;  2FQ3 A;  5H6R A;  2EV0 A;  4LFU A;  2O0Y A;  3BP8 A;  3B02 A;  3MEX A;  4KIG A;  3DF8 A;  1YO5 C;  4LB5 A;  2VT3 A;  2YPR A;  2VOP A;  2UWM A;  4M9X A;  1DPU A;  1TTY A;  3DEU A;  2P7C B;  2CWE A;  2G7H A;  2ZJ2 A;  2KJC A;  4ZYG A;  3PQJ A;  4ZZD A;  3QAH A;  1MJB A;  3T8T A;  3VOD A;  1D8J A;  2P5V A;  3I53 A;  3CO7 C;  1W7P B;  1QPM A;  4JQF A;  2RC4 A;  1HW2 A;  1T6S A;  1R7J A;  3QP6 A;  3TDU C;  3BRO A;  3JAM K;  2CW0 F;  1SAX A;  3IWF A;  4YG2 F;  3W6J B;  1FSH A;  1H0M A;  4RB1 A;  2XRN A;  1YQA A;  1UCR A;  2ZO4 A;  2EFQ A;  2RGV A;  1MDM A;  1T2K A;  2A07 F;  2QQ9 A;  3IHU A;  1LDK B;  5BOX A;  1PDN C;  3PFI A;  4CZZ A;  4XBF A;  2Q2E A;  4ENJ A;  4KIB A;  4GYI A;  1BC7 C;  2EFW A;  1FYK A;  3O3K A;  3F21 A;  1VTN C;  1LDJ A;  2P8T A;  3TGN A;  1OKR A;  5E8G A;  3I54 A;  3BZ6 A;  2WTE A;  2KKO A;  1F9N A;  1ZH5 A;  2DQR A;  1V3F A;  4H0E A;  3QP5 A;  1OR7 A;  3ZMD A;  5LLQ A;  3IKV A;  2PMU A;  3ECO A;  3H92 A;  2HFH A;  2KIF A;  2FMY A;  3FMR A;  3QRF F;  2F5D A;  4XSZ F;  2MLK A;  4OIN F;  3F8B A;  1Z7U A;  1IXC A;  2Z5U A;  5LEK A;  3COA C;  3HRM A;  3WGI A;  4A5N A;  3R4K A;  5DV5 A;  5D5U B;  3LA7 A;  1R22 A;  4HZF A;  2EFN A;  3RJP A;  1FBQ A;  3VOE A;  4M72 A;  2WWY A;  2XUB A;  2KIU A;  3DKW A;  4RB0 A;  1F5T A;  3BJA A;  4I09 A;  2ISY A;  1BIB A;  4ENM A;  1BIA A;  2D1V A;  4PZJ A;  3WGG A;  2FNA A;  2XAG A;  3GZ5 A;  1S3J A;  1FX7 A;  2J5P A;  5D5W B;  2L4M A;  3TKY A;  5LGU A;  3V8L A;  1O57 A;  2EK5 A;  4ETS A;  2PMH A;  4CGZ A;  3V7C A;  4Q48 A;  3TO6 A;  3HHG A;  2RVC A;  3Q9V A;  1I1S A;  2OAZ A;  2NS0 A;  1PP7 U;  2W85 A;  1Z6T A;  2DFI A;  1TLH B;  3M8E A;  5LRR A;  5FFZ A;  3TOA A;  3GFM A;  1S8N A;  1G3Y A;  4Y15 A;  3SHF A;  1O7L A;  2HQN A;  1I6X A;  3H3U A;  2FML A;  1I5Z A;  3J80 K;  2QQA A;  4GO1 A;  3MAJ A;  4MQ9 F;  4BYY A;  1IXS B;  4KIF A;  2JRT A;  3IC7 A;  1B9N A;  5DD4 A;  4BH9 A;  2K7L A;  2TDX A;  4OMZ A;  3FF5 A;  4HYE A;  2PFB A;  1XD7 A;  2VOD A;  2D1H A;  2VON A;  5ED4 A;  1YS6 A;  4MEY F;  4LG0 A;  2DPD A;  2L3D A;  2WV0 A;  3FM3 A;  2PQ8 A;  4WF2 A;  3ML6 A;  4L5I A;  3T1B A;  4A6E A;  1CF7 B;  1QGP A;  2O3F A;  5ICF A;  3C1D A;  3HSR A;  4A5M A;  2DK8 A;  1G6N A;  2D45 A;  3ZMT A;  5JI6 A;  1OPC A;  2JPB A;  2E1N A;  4EJT A;  1BBY A;  1YW8 A;  1H9G A;  1K6O A;  5LBQ A;  2LNB A;  3LA3 A;  1FWZ A;  4UVC A;  3WTX C;  2O6G E;  1OYI A;  4CO8 A;  1U6G A;  3QPT A;  4YFX F;  1ZHF A;  4RGS A;  2EFO A;  2AXL A;  5ICG A;  1PUE E;  2M8E A;  4YFK F;  1KQ0 A;  5H20 A;  2STT A;  1L3L A;  4WXC A;  3R6S A;  1KYZ A;  2P4W A;  1SD4 A;  1WI9 A;  1FZP B;  1K7A A;  1G3T A;  4UVA A;  2OD5 A;  2QWW A;  2P7V B;  4ESF A;  3WTV C;  2GA2 A;  3B73 A;  2J5O A;  1I1G A;  3K9T A;  5FLX Z;  3N97 A;  2KJB A;  1OMI A;  2HYG D;  4WXD A;  2PN6 A;  2DTR A;  2CYY A;  5E18 F;  4BHB A;  5HLH A;  3V8K A;  3E6M A;  4Z2Y A;  3KLO A;  3FXR A;  3EDP A;  1ZRC A;  5D5X B;  2V1X A;  5L3G A;  2RV8 A;  3IRQ A;  1AWC A;  3SXY A;  3HUG A;  1RUN A;  2P5L C;  4GYG A;  3QU3 A;  4EJV A;  5FO5 A;  3KP7 A;  4P5O A;  1WKM A;  1MGT A;  4HDV A;  4G9Y A;  4L5J A;  1FPQ A;  2V79 A;  3I58 A;  5E1W A;  5L3C A;  4M6Y A;  3HTU A;  2XAF A;  2K27 A;  2P6S A;  2FSW A;  5DUI A;  5KK1 A;  2VC1 A;  1YG2 A;  4I01 A;  2E1C A;  2DAO A;  2IJL A;  2LDU A;  2Z33 A;  3BY6 A;  2Z3Y A;  2MBF A;  2EA2 A;  1OYY A;  1HQC A;  1XGM A;  1IN4 A;  2VBZ A;  3G3Z A;  5HS8 A;  1JGS A;  2FA5 A;  1HKQ A;  2XIG A;  3R0J A;  1FC3 A;  3RKX A;  1WQ2 A;  4YII A;  3N4M A;  3OOP A;  4FHT A;  2NNY A;  2HR3 A;  2NYX A;  2MH2 A;  2H94 A;  3HHH A;  4N9H A;  1XB4 A;  4G7H F;  1Y0U A;  3T5X A;  1B4A A;  3EYI A;  3FHZ A;  4EMS A;  4KDP A;  5JFR A;  3ECH A;  4A2U A;  3E5U A;  2EV6 A;  2HS5 A;  3ABT A;  3P9K A;  1P4A A;  2UXX A;  1ZLJ A;  4MNU A;  1YIO A;  3K2Z A;  1SD7 A;  4P9U A;  4RGX A;  4RGR A;  3I4P A;  5HVQ C;  4KUM A;  3E5X A;  2DT5 A;  1LEA A;  5DDG A;  2HQR A;  4P9F A;  5CJ9 A;  1P92 A;  1DUX C;  2PI0 A;  1ZRD A;  2IVM A;  1UST A;  5CLS A;  1OYW A;  4EM1 A;  4L0Z B;  2M45 A;  4UUV A;  3HRT A;  5AON A;  2A6E F;  2VE8 A;  4LG0 B;  1HST A;  1YFH A;  3F6V A;  4FX4 A;  1RZ4 A;  2Y75 A;  2A68 F;  3U9G A;  5EEG A;  4AIJ A;  4OIR F;  5HLG A;  1JHH A;  3FZV A;  5HLI A;  1KU2 A;  2NRA C;  1WRJ A;  2DPU A;  5J8F A;  5DCM B;  5D4S A;  3I64 A;  2FU4 A;  3EET A;  3KEQ A;  3I5U A;  4U0V A;  1GXP A;  4ASN A;  1B6A A;  1PP8 F;  1YTY A;  5HDK A;  2LKP A;  3F8N A;  4OU0 A;  1O3T A;  1K78 A;  3J81 Z;  1BC8 C;  1U3E M;  1BM9 A;  3CUQ A;  1LEB A;  1STZ A;  2RKH A;  5IT9 K;  4LGW A;  5HS9 A;  2QYO A;  1QO0 D;  5TJJ A;  5DEQ A;  4KIC A;  2GWR A;  3HYI A;  3TDZ C;  3E6C C;  4E70 A;  3F6O A;  2ETH A;  3MCZ A;  2XRO A;  2FE3 A;  3ZMV A;  1IN8 A;  5CVI A;  1X3U A;  2YX4 A;  3WTY C;  5E20 A;  1SFX A;  3IKT A;  3DQV C;  2H27 A;  4UHT A;  2QBY B;  3HOS A;  3M8F A;  5LGT A;  1MKM A;  5F64 A;  2O61 A;  2M1B A;  3PQK A;  1O3Q A;  4IJA A;  4MEX F;  3WTU C;  1BI0 A;  4LLL A;  1L0O C;  3NQO A;  1XGS A;  2QZ8 A;  3GO5 A;  1USS A;  4RB2 C;  2VBX A;  2R7D A;  4EJW A;  3JSO A;  3ZMS A;  2X0L A;  2L01 A;  1I27 A;  1U5T A;  2BBY A;  1SMT A;  1JHF A;  1KU3 A;  2A5Y B;  2FBH A;  4MHG A;  1Z1D A;  4OOI A;  2QLZ A;  1F1Z A;  3I59 B;  5FLX K;  4UNO A;  4LJZ F;  4NHJ A;  2EFP A;  2VBY A;  4UV8 A;  2QUF A;  5JR3 A;  4S04 A;  1LB2 A;  2M30 A;  4YFN F;  1BOA A;  5BMZ A;  5H6Q A;  5FB2 A;  1R58 A;  4LB6 B;  2R7F A;  2F2E A;  3FMQ A;  2FEZ A;  3WE3 A;  3P7N A;  2HEO A;  2XHK A;  2MH9 A;  1T98 A;  5DCF A;  4WCG A;  3G73 A;  2ZME A;  4RS8 A;  3RKY A;  3LWF A;  2DI3 A;  2EA4 A;  3Q5F A;  1IRF A;  3M9A A;  2W25 A;  4I2O A;  3LQQ A;  5FFX A;  1UHW A;  4DNC A;  1GXQ A;  2LSO A;  2BYV E;  5DUK A;  1IF1 A;  3DFG A;  2W57 A;  4Q47 A;  1XGO A;  2E7W A;  2HWV A;  1Z9C A;  2YU3 A;  4FX0 A;  3TOB A;  5L3F A;  4ENK A;  3GFL A;  3WTT C;  3Q9S A;  3M7G A;  3ULQ B;  2FXA A;  2EJR A;  1XSX A;  1LNW A;  2AS5 F;  4AVP A;  3JTG A;  5J6X A;  4KYW A;  2ESN A;  2OQR A;  2F5C A;  5D6F A;  5E1Z B;  1HKS A;  4N0B A;  3HRU A;  5LGN A;  5D8K B;  3DPT A;  2COM A;  2YSR A;  3RDI A;  1T38 A;  2DBB A;  3I0T A;  2DU9 A;  4BXU A;  2L54 A;  2VT2 A;  4PDK A;  3GF2 A;  4U7D A;  1S7A A;  3V7R A;  1HSJ A;  3CUQ C;  2Q8K A;  4LLN A;  3SFZ A;  4EV0 A;  4UXN A;  1R5H A;  1UB9 A;  3K0L A;  4Y13 A;  4EGZ A;  1J0R A;  3E5Q A;  1FNN A;  1WSU A;  3AAF A;  4O5V A;  2ZNY A;  1BI1 A;  5IT9 Z;  5IT3 A;  2IRF G;  2DK5 A;  4JBA A;  3LST A;  3FXU A;  3L09 A;  2QEN A;  3CUQ B;  5K5R A;  3HSE A;  4G8X A;  2MD5 A;  3ISP A;  1R1T A;  2ELH A;  1R1U A;  1HXD A;  1D8K A;  1IN5 A;  3KEO A;  1QZZ A;  1S7O A;  3FXQ A;  5ERI A;  2F5F A;  2CSO A;  3SQN A;  2VC0 A;  2JT1 A;  1D3Y A;  1W5T A;  3QPH A;  4KT5 C;  2K86 A;  1DP7 P;  3MQ0 A;  1KA8 A;  2LF8 A;  3F23 A;  1JE8 A;  4GXO A;  5AIQ A;  1P4X A;  3CJN A;  2W24 A;  1MDM B;  2OBP A;  3WG9 A;  3J81 K;  3P9I A;  3WE2 A;  2XAH A;  4O6J A;  1IZ1 A;  1ZGJ A;  4O3M A;  4L9J A;  4G7Z F;  3CO6 C;  4MTE A;  2STW A;  1QNT A;  2RQP A;  3TO9 A;  3GW2 A;  4EJU A;  1ZAO A;  3RKW A;  3MWM A;  3RTR A;  3KP4 A;  5L3D A;  3GXO A;  1U2W A;  4Q4Z F;  2XAS A;  5HOO A;  1W4M A;  5ILU A;  1YLF A;  4EVI A;  2IA0 A;  4XRF A;  1KYW A;  5D6E A;  2IA2 A;  1W7P A;  4BAY A;  2GAU A;  1B1B A;  1K79 A;  1ZG1 A;  3WU0 A;  4KA4 A;  4GGG A;  4LMY A;  3EUH A;  4P55 A;  2PLY A;  2ZKZ A;  1RIO H;  2H6B A;  3C3W A;  1J5Y A;  4M9S A;  2VBW A;  3MFK A;  2DQL A;  1R1V A;  1IUY A;  1G3W A;  4G6D A;  4RB3 C;  4WK8 F;  4M74 A;  3L2C A;  1IN6 A;  2H6C A;  5LHH A;  1J75 A;  4A12 A;  3EYY A;  4AIH A;  4XLP F;  3NRV A;  1MD0 A;  3KFW X;  4DQ2 A;  2FF4 A;  3LFK A;  3K1M A;  1BJA A;  1QZY A;  3SZT A;  2IA1 A;  3RPU A;  4XLN F;  4R79 A;  3GFJ A;  5CVU A;  4HF1 A;  1FY7 A;  4A6D A;  1CGP A;  2E7X A;  1XCB A;  1T0F A;  4G94 A;  3ZN1 A;  3ROU A;  3L00 A;  2KIM A;  1KQ8 A;  3DXJ F;  5ILV A;  5HDG A;  3K1N A;  2L02 A;  1KU9 A;  4EJO A;  3T0Y A;  2ISZ A;  2D2W A;  3TQN A;  4G7O F;  1BN5 A;  2GXB A;  1MJA A;  2ACJ A;  2A61 A;  3ZMU A;  1SFE A;  1G3S A;  2GXG A;  1ZG3 A;  2HOE A;  2HDC A;  1IRG A;  5CVR A;  4HF2 A;  5AIP A;  4IF4 A;  4IHS A;  5DYM A;  2HTS A;  3WOD F;  4JK1 X;  4EQQ A;  2M87 A;  4MGR A;  1FYL A;  2IP2 A;  1H9T A;  2CFX A;  3E97 A;  4KN7 X;  1SMY F;  2HZT A;  2YX7 A;  3FMS A;  1XSD A;  3L9F A;  4HLX A;  5HS7 A;  3KP2 A;  3U2R A;  1YW7 A;  1SFU A;  5K5Q A;  2NNN A;  1IW7 F;  1T39 A;  3KZZ A;  1D5V A;  4HF0 A;  3ELK A;  5F6F A;  4EM2 A;  4UV9 A;  3R60 A;  3E6D A;  5E1X A;  2ZBK A;  1RI7 A;  3DV8 A;  3F72 A;  4HQM A;  4HV6 A;  2ZNZ A;  1S6L A;  3KE2 A;  3T8R A;  3K69 A;  4I0A A;  5BS6 A;  4I98 B;  2B0L A;  4OIQ F;  4Y17 A;  1G4D A;  5E8I A;  2YR2 A;  5D5V B;  2IPQ X;  1NHA A;  1KU7 A;  2P5K A;  4KNY A;  4AD9 A;  2BV6 A;  1XGN A;  2BE5 F;  3GFI A;  3FX3 A;  4HX4 A;  2JTV A;  4HV5 A;  3JW4 A;  3GYH X;  4ON0 A;  5DD8 A;  3MZH A;  1CF7 A;  1UFM A;  1R36 A;  2DW4 A;  3I71 A;  1B59 A;  3F3X A;  3LA2 A;  4L18 B;  4IRH A;  1FOK A;  1FT9 A;  3ZMZ A;  5ICE A;  1WWX A;  4KMF A;  1B9M A;  2K02 A;  4IHT A;  4KN4 X;  1SD5 A;  3O6B B;  1YYV A;  3BJ6 A;  1AOY A;  4ESJ A;  5A2Q Z;  2MA3 A;  4CXF A;  1TQP A;  3D5L A;  1LJ9 A;  2GIV A;  1ZYR F;  1FP2 A;  3D0S A;  2UZK A;  1LQ1 A;  1S29 A;  2PG4 A;  3LAJ A;  4IPA A;  4HX7 A;  3KET A;  1U78 A;  2MC3 A;  2A69 F;  2OQG A;  4XSX F;  4D0P A;  1XMA A;  2ADU A;  4IRI A;  4LLG F;  3QOP A;  1HW1 A;  2G7U A;  3F22 A;  1Q1H A;  4B09 A;  2ESH A;  5LRS A;  3OV8 A;  3W6K B;  3IRR A;  4L0Y B;  2CGP A;  4AIK A;  1IAW A;  4HA8 A;  4P96 A;  4K2E A;  4RGU A;  1FLI A;  3F8F A;  1ON2 A;  1P2F A;  2V9V A;  5CVJ A;  4G6Q A;  3HSF A;  4YIF A;  4A0Z A;  1RUO A;  2QM3 A;  3RYR A;  2IT0 A;  4IVN A;  4NQW A;  2QQB A;  4QWQ A;  2K4B A;  2R3S A;  4LD5 A;  2HTJ A;  3GX4 X;  3DPL C;  1IN7 A;  3RIR A;  2FBK A;  4HQE A;  4HBL A;  3EQL F;  2JZY A;  1IXR C;  4N9I A;  2A3S A;  5LEJ A;  1FSE A;  5TRD A;  1YS7 A;  4BQA A;  1E2X A;  3L7W A;  3GVA A;  4HAM A;  4U7B A;  3IWZ A;  2QVO A;  2Z9O A;  2PJP A;  5E17 F;  3HOT A;  2XKP A;  4I7H A;  3F8C A;  4L9N A;  2Y48 A;  2V1U A;  1J7K A;  4IRG A;  1XDS A;  2LF7 A;  3M1E A;  1MZB A;  4BHP A;  2A6H F;  5D8L B;  2GA1 A;  3HIF A;  3LQR A;  3KCC A;  3FM5 A;  5JHU A;  2WC2 A;  1ZLK A;  1EH8 A;  5CVV A;  5L3B A;  5ICC A;  4MTD A;  3JSP A;  3S2W A;  3R61 A;  4I0B A;  3GWZ A;  4FT8 A;  2Y0M A;  2GQQ A;  1EH6 A;  4M73 A;  3GEZ A;  2VN2 A;  5K5O A;  5LHG A;  1ZRE A;  1O3S A;  4L9V A;  5D4R A;  1BI3 A;  3H3Z A;  1Z05 A;  3NEU A;  1K78 B;  2CQK A;  3IL2 A;  2RNJ A;  1R23 A;  2ZFW A;  1DDN A;  2FNP A;  4BNC A;  1F4K A;  1P6R A;  4KMU X;  3ABU A;  3KP3 A;  3R0A A;  4AWX B;  2V6C A;  4HDU A;  1O7F A;  1HW5 A;  2OZU A;  2KRF A;  1XMK A;  2DLL A;  4GCV A;  2VXZ A;  3WU1 B;  4M71 A;  5ILS A;  3RI4 A;  2V1D A;  4EGY A;  3HTS B;  1J9I A;  1TW3 A;  3HRS A;  1MJ9 A;  2PEX A;  1W5S A;  1V4R A;  3SZP A;  4CIC A;  2Q0O A;  3JAM Z;  1U5T C;  5DCM A;  4S05 A;  4IXA A;  1TQM A;  4PGH A;  2M5W A;  1GHC A;  4HLY A;  4ZH4 F;  2OZ6 A;  1HKT A;  5CYV A;  4HOB A;  1FYM A;  4ENN A;  4U0W A;  1QBJ A;  4U88 A;  4ZYH A;  2HGC A;  2X4H A;  1U5T B;  2GZW A;  1Z91 A;  4LK1 F;  5BPD A;  2XAJ A;  2OU2 A;  3F8M A;  2FBI A;  2XVC A;  3K1P A;  3BPX A;  5BQT A;  2XGX A;  3KP6 A;  4R8H A;  2HYF A;  2ZCW A;  3REO A;  1FBU A;  1LDD A;  2K4J A;  3VFZ A;  2FOK A;  3MZY A;  3KLN A;  6PAX A;  2O8X A;  5JVT A;  2XKO A;  1ZAR A;  2BEO A;  2QBY A;  3WTS C;  1JXS A;  1XN7 A;  3CUO A;  2UXN A;  3GLX A;  4ESB A;  2CO5 A;  1R00 A;  2VOO A;  1XDU A;  1ON1 A;  4Q5S F;  3VEP A;  5A2Q K;  2PBI A;  2CG4 A;  3BJO A;  3BWG A;  2RN7 A;  3O2P E;  1EV7 A;  3P9C A;  3BDD A;  3FWE A;  4B8X A;  1KQ9 A;  2IW5 A;  3BPV A;  2ZME B;  1ZG5 A;  1J59 A;  2XAQ A;  4PCQ A;  5KVR A;  4L9T A;  4TV7 A;  4ZYD A;  3I59 A;  5FGM A;  2XV4 S;  3V4G A;  1P4W A;  1UHM A;  2HKO A;  2DO7 A;  3ERE D;  4M6X A;  1ODD A;  3ZQ7 A;  2VE9 A;  1GVJ A;  2EWN A;  3BOQ A;  4HW0 A;  1TQI A;  1EH7 A;  3GZ6 A;  1LVA A;  4R1H A;  5BPI A;  4NB5 A;  1KGS A;  2W84 A;  4CYD A;  4MQV A;  4UVB A;  4WX9 A;  4U0Y A;  4QLC U;  2G9W A;  2OA4 A;  1SD6 A;  3U1D A;  5J8C A;  1E17 A;  2BGC A;  1QQI A;  5FD6 A;  2F5E A;  1FBS A;  2P6T A;  4OIP F;  2HKX A;  5L3E A;  4WXH A;  3ZN0 A;  4F7Z A;  1ZRF A;  1FP1 D;  3TO7 A;  2Z99 A;  3QU6 A;  1W7P D;  2MLG A;  1TBX A;  3JTH A;  2ZXJ A;  3RPQ A;  3J80 Z;  4M9Z A;  3LAP A;  1ZN2 A;  5FD5 A;  3WTZ A;  1HBX G;  4ZYE A;  1U8R A;  4WWC A;  1BI2 A;  4A0Y A;  1J2X A;  1Z6R A;  3KZY A;  1XSV A;  5EEH A;  2RDP A;  5F1R A;  2H09 A;  3E3V A;  3VB2 A;  2JPC A;  1ONV A;  3C18 A;  1YW9 A;  2O03 A;  4A0X A;  2C6Y A;  5K1Y A;  3CTA A;  1REP C;  2L4A A;  1R5G A;  4PGG A;  2EB7 A;  3V7S A;  3ZP5 A;  3ZPL A;  1TNS A;  4RAY A;  1TW2 A;  4OMY A;  1O3R A;  3J7A O;  1A04 A;  4EM0 B;  4CHU A;  4OIO F;  4CDG A;  3V8J A;  4BHC A;  1TNT A;  2EV5 A;  5LHI A;  3CDH A;  2JSC A;  4RAZ A;  3E6B A;  4HX8 A;  4ZZL A;  1XCV A;  3C7J A;  3KP5 A;  3RYP A;  3CLO A;  1ZGA A;  4I02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...