2GXGA

Crystal structure of emrr homolog from hyperthermophilic archaea sulfolobus tokodaii strain7
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
140
structure length
140
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal homolog of multi drug resistance repressor protein, EmrR, from hyperthermophilic archaea Sulfolobus tokodaii strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
total genus 58
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gxgA00
2PBIA 3O3KA 4AIJA 1O7FA 4XBFA 2RVCA 4BHPA 2ZNYA 4M9SA 3CUQA 2RV8A 1TW3A 2GWRA 4L9TA 4HV6A 3MFKA 5F64A 2M8EA 2LF8A 4PGGA 3TOBA 5FB2A 4OMZA 4KIGA 5HDNA 4LG0B 5CVJA 4WK8F 2XAJA 3E5XA 3LWFA 2JRTA 1IRFA 4DQ2A 3L09A 3QP5A 4EGZA 3K1MA 4MQVA 4UV8A 2D45A 3KEQA 4U0WA 3HRSA 1WSUA 1J59A 2DQLA 4GYGA 1S8NA 2W24A 2QYOA 2XAHA 3DPTA 1UFMA 3GEZA 2FXAA 5K5OA 1LJ9A 4JQFA 2DK5A 2EFOA 4G8XA 2VN2A 3MAJA 1G3TA 4Q5SF 4Y17A 1T2KA 4WX9A 3FXQA 2KIMA 2P8TA 4KA4A 3N97A 2CQKA 3OOPA 1X3UA 3WTXC 5J8CA 1BM9A 1P6RA 4P96A 2Y75A 1BOAA 3KP2A 3K1NA 1FYLA 5CLSA 1FYMA 3FMQA 1ZREA 4ZYEA 3H3UA 3TDZC 5LGTA 1FC3A 4HZFA 5K5RA 1NHAA 3E6MA 1T39A 5AIQA 1IF1A 1YIOA 2HTSA 1QGPA 2DAOA 4XLNF 4Q4ZF 3HRTA 1Q1HA 2O8XA 1O3QA 1O3RA 2Z9OA 4EM0B 3QPHA 1D5VA 1U8RA 1W7PB 4AWXB 4B8XA 2HQNA 2NAZA 4U0VA 1ULYA 5LHIA 1LDJA 1OYIA 2FOKA 2HKOA 4FHTA 1G3YA 3J80K 3HUGA 5ICEA 1Z7UA 1R5GA 2IPQX 3DEUA 1HBXG 1OR7A 1T98A 1PP8F 3FZVA 1BJAA 6PAXA 3KCCA 1HXDA 4CYDA 1G4DA 5D8LB 3WGGA 1HKTA 3QOPA 2DPDA 2W84A 2M30A 2ZXJA 5TJJA 1IN5A 4XSZF 2VC1A 4UV9A 4AVPA 3GZ6A 1KU9A 3CUOA 2W57A 1T38A 2K7LA 2V9VA 4UVAA 3QP6A 1DPUA 3BROA 3O6BB 1ZGJA 4A0ZA 3ROUA 4Y15A 1D8KA 2WWYA 2VBXA 5H6RA 2DLLA 3CLOA 5L3GA 2YPRA 4D0PA 4XLPF 1HSJA 3F23A 5KVRA 1IN6A 1QZZA 3LA2A 1HSTA 1LEAA 3GFLA 3DXJF 4HX7A 1HKQA 1YW7A 1QBJA 2FF4A 3BJ6A 4CO8A 1BIAA 2VE9A 2V1DA 4MTEA 2ESHA 3SZPA 1SMTA 5DCMB 2EB7A 4WCGA 2B0LA 2JPCA 3LFKA 5HVQC 3C3WA 4EGYA 5CVUA 2DU9A 2EV6A 4Q48A 5CYVA 2V6CA 2E1CA 1OMIA 1T0FA 2QM3A 4ENKA 4YIFA 4I01A 4UVCA 2DQRA 2STWA 1U6GA 4OU0A 1R1TA 2VBYA 4Z2YA 2HYGD 3RPUA 5H6QA 3IL2A 3F6OA 3CJNA 2JT1A 2O03A 3F3XA 1I1GA 1P4XA 2Z33A 5E8GA 3RIRA 2L01A 4BNCA 3U9GA 3REOA 4IVNA 4G9YA 3BJAA 2IP2A 3TOAA 1J0RA 2EV5A 4FX0A 2LKPA 1XMKA 4HDUA 1QPMA 3RYRA 3J7AO 5HS8A 2ZJ2A 3F8CA 1EV7A 2K02A 1W5TA 2KJBA 4XRFA 4HF1A 1IXRC 5IT3A 4EM2A 2L4MA 1U5TB 2LNBA 1HW2A 2J5PA 2XVCA 4ASNA 1OPCA 1H9GA 5D5UB 5DD8A 2STTA 1R58A 5LBQA 2PJPA 4M73A 3HTUA 4ESFA 1J9IA 3E5UA 4LG0A 1ZH5A 2VOOA 1WWXA 1XSXA 2A6EF 4MQ9F 4WXCA 5H20A 1TNSA 1WKMA 4BXUA 5L3DA 1YTYA 4AD9A 4GGGA 3ABUA 2XKPA 3ZMVA 4OINF 3SQNA 2Q0OA 2VOPA 2X4HA 1USTA 3FF5A 3ZP5A 3R4KA 4YFNF 5D5WB 3KZYA 2QBYB 1YW8A 1HKSA 4HX8A 1LVAA 1B9MA 5LEKA 4KMFA 4WXHA 2DFIA 1AOYA 4LFUA 3V7RA 4NQWA 1MJBA 4L18B 2VBZA 4IRGA 1I27A 1ON2A 4MGRA 1SD4A 1LEBA 5ILVA 3QAHA 5L3BA 3LAJA 4OOIA 3HIFA 2QBYA 4I7HA 1R7JA 3BWGA 2FQ3A 2ADUA 4G6DA 3RI4A 5CVRA 3WTYC 1S7AA 1OYWA 1FYKA 1V4RA 3FXRA 3VOEA 2D2WA 2NYXA 2PLYA 5BPDA 1ZG3A 4IHTA 3HRUA 4JBAA 1F1ZA 3QPTA 2RGVA 1YG2A 5LRSA 2JPBA 5FFZA 3BDDA 2FRHA 1FT9A 2EFQA 2O3FA 2YR2A 4HDVA 1ON1A 3RYPA 3FMRA 2E7XA 3J81Z 1JXSA 4HAMA 1QZYA 2D1VA 1SAXA 3I53A 2COMA 3TO7A 4ESJA 2FA5A 1MGTA 5DYMA 4ENMA 3ZMUA 1E17A 3M8FA 3EYYA 2NNYA 2HQRA 2GZWA 4L0YB 3W6KB 3CDHA 3L9FA 1U5TC 3IC7A 4HA8A 4KIFA 3RKXA 3C18A 1XCBA 4L9NA 4LJZF 3GX4X 1REPC 1IXSB 4A0XA 1BI1A 2IA2A 4ENNA 5L3FA 5HS9A 1KU7A 1WRJA 3COAC 1CF7A 4ESBA 3QU6A 2OBPA 4WWCA 1K78B 3SHFA 3P9KA 2XIGA 4IRHA 5E1XA 3IWFA 1XDUA 1GVJA 4P55A 3U1DA 1LB2A 5FLXK 2PI0A 3KP4A 5D6EA 1V3FA 4WF2A 3EUHA 2CFXA 4EM1A 2A61A 3ULQB 3CO6C 5LRRA 1TQPA 3M8EA 2JZYA 2D1HA 4EJTA 3IRQA 3F8NA 2IRFG 3EDPA 4HX4A 2P4WA 1KU3A 4UNOA 4U88A 2MD5A 2L54A 3LSTA 2ISYA 3ERED 4UXNA 4FX4A 3P7NA 3NEUA 3HSRA 1SFUA 3FX3A 3KEOA 4MNUA 2PG4A 5BS6A 1XD7A 1B6AA 2QQBA 2L02A 3KP6A 2GXGA 3HYIA 2CG4A 1MDMB 3HHGA 4LMYA 5F1RA 2HWVA 2BYVE 4IJAA 4I98B 3W6JB 2EWNA 1G3WA 1ZG1A 4RS8A 3AAFA 2P6SA 4P9UA 3ZN0A 3KP3A 1J2XA 1ZHFA 2BEOA 1Z1DA 5TRDA 1Z05A 1S7OA 3FM5A 4M6YA 2DT5A 5E1WA 3WGIA 1ZYRF 3ZMDA 1TQMA 4P9FA 5LHHA 4H0EA 4UUVA 1KQ0A 2K4BA 3H3ZA 5E1ZB 5J6XA 1UB9A 1FZPB 4EJVA 3HOTA 1FBSA 3JSOA 3MEXA 2PN6A 2VT2A 1IXCA 4O5VA 1USSA 4EJOA 3CUQB 1SFXA 4KDPA 1J5YA 5HDKA 2FMLA 1YQAA 3V7CA 3GVAA 2GAUA 4HV5A 1ODDA 4P5OA 3R6SA 4PGHA 4F7ZA 5LHGA 2H6CA 3DF8A 3ZMTA 4G7HF 4OIOF 2A07F 2XV4S 1MJAA 4JK1X 3QRFF 3E6DA 3V8JA 3VFZA 1KYZA 4ZH4F 3MQ0A 5L3EA 2HFHA 2QVOA 1RZ4A 1U5TA 3S2WA 1RNLA 4G7ZF 1XMAA 1R5HA 3BZ6A 4G7OF 5E20A 2FMYA 2X0LA 2RKHA 1TQIA 4ZYGA 3LAPA 2XAGA 1IUYA 1Y0UA 3HRMA 5DDGA 4O6JA 1KQ9A 1R36A 1BIBA 4NHJA 2R7DA 2UXXA 4EQQA 3R0JA 3KFWX 3KZZA 3RJPA 2VXZA 4EV0A 5DCMA 3WTVC 3HSEA 1BI2A 2VE8A 3TKYA 4A6EA 3G3ZA 1FLIA 4GXOA 3KLNA 4RB1A 4LB5A 2KKOA 1ZRFA 1DPRA 2MH9A 4R1HA 4K2EA 4S05A 2HDCA 4LLLA 3RKWA 1YS7A 4ETSA 2JTVA 4M9XA 3J80Z 3RPQA 1BI0A 4ZZDA 5ERIA 1XB4A 3ZN1A 1DDNA 5D4RA 1YW9A 2HTJA 1TTYA 3GUDA 1FSHA 4BQAA 1ONVA 4A6DA 5L3CA 5J8FA 3K9TA 3WU0A 3P9IA 1WI9A 2Q8KA 1XGMA 1S29A 3C1DA 5E8IA 5DCFA 4EJWA 4LD5A 4GYIA 3WTZA 1I6XA 3ZMZA 2M45A 1EH7A 3JTGA 3K69A 2ZMEB 4OMYA 5KK1A 1IN4A 4KN7X 2EA4A 1ZARA 4BHBA 5JFRA 2OZUA 3T0YA 4HLXA 1MJ9A 1LNWA 3V8LA 1W7PA 2GA1A 3G73A 3TO9A 1XN7A 5F6FA 3L00A 1B59A 3EETA 3RKYA 2YSRA 1F9NA 3H92A 3PQKA 3I59B 5JI6A 4I2OA 2XAQA 1RUOA 2FBHA 2ZFWA 1ZN2A 1GXQA 1OYYA 2J5OA 1UHWA 4BH9A 3FM3A 1ZLKA 2HGCA 3BOQA 1OKRA 2FBKA 2M1BA 2UXNA 4G6QA 3BPXA 1F5TA 1GHCA 3NQOA 3I64A 4LLGF 1KGSA 1A04A 5D5VB 3VODA 4B09A 1K78A 3SFZA 1Z9CA 3VEPA 3N4MA 2KIUA 2ACJA 2ISZA 1BC7C 2DK8A 1PUEE 5K1YA 2EV0A 3F72A 4M9ZA 2AS5F 2VT3A 1S6LA 5CJ9A 3LA3A 5AIPA 2BGCA 3EQLF 1WQ2A 1DP7P 2Z5UA 2ZBKA 2CO5A 2K4JA 1MKMA 1H9TA 1FX7A 3L7WA 3WE3A 3GWZA 2AXLA 3IKVA 1D3YA 2MA3A 1XCVA 5D6FA 2FSWA 2PMHA 1AWCA 2MBFA 1I1SA 3E6BA 2IT0A 2OU2A 3D5LA 3B02A 1KYWA 4I0BA 3B73A 3V7SA 4ZYDA 4M72A 3I4PA 1U78A 2FBIA 3MZYA 3CUQC 1XGSA 1T6SA 4L5JA 2OD5A 1YYVA 2EFNA 1SD7A 4RGSA 2HZTA 5FGMA 2CYYA 4CICA 2M87A 2QUFA 2ZO4A 2VONA 1SD5A 2F5EA 4RAYA 1P4AA 4HQMA 4BYYA 2QQ9A 4S04A 1FSEA 1CGPA 4RB3C 1QNTA 3LQRA 1IZ1A 4R79A 3DV8A 1UCRA 5HDGA 2DBBA 3FHZA 4HQEA 1JHHA 1R1VA 5A2QZ 3HOSA 3E97A 3FWEA 2FNPA 1K7AA 2A68F 3KLOA 3IKTA 1JHFA 3QU3A 2UZKA 1G6NA 2G9WA 2OQRA 4I09A 2GXBA 2EFPA 4HYEA 1C0WA 2P6TA 5AONA 2C6YA 4GO1A 4O3MA 1QO0D 3GW2A 3TGNA 3GF2A 4Q47A 3WGHA 5EEGA 4KN4X 3VB2A 1XSDA 4GCVA 4A0YA 4LK0F 4A5NA 3ABTA 2H27A 2FE3A 3R0AA 5HLHA 3TQNA 5BPIA 1LDKB 2L4AA 4I0AA 2IVMA 2BV6A 3I0TA 1ZAOA 2XASA 5ILUA 2HR3A 5FFXA 1MD0A 2A6HF 2IA0A 2IW5A 4MTDA 3KP5A 2H94A 3F8BA 3GO5A 3IRRA 4MEYF 3JSPA 2E7WA 5D8KB 3ISPA 2VC0A 4CDGA 1B1BA 2RNJA 2V79A 2FNAA 3I71A 2LF7A 4UVBA 1EH6A 3ZPLA 5EEHA 4KIBA 3WTTC 4CHUA 1YFHA 3CTAA 2P5LC 3BPVA 2HS5A 2P7CB 3GFMA 1IAWA 1ZRCA 5BQTA 4M6XA 1B4AA 3E6CC 2VBWA 2P5VA 1XSVA 2XRNA 5BOXA 1W7PD 1RIOH 1G3SA 3Q9SA 1TBXA 2BBYA 2GQQA 2P5KA 4KUMA 4TV7A 2ZNZA 1R00A 2ESNA 1ZLJA 5HS7A 1W4MA 1GXPA 3BP8A 1EH8A 2LDUA 4IXAA 4KT5C 4EVIA 2A69F 1LDDA 4L0ZB 3C7JA 2CGPA 4IHSA 1R1UA 4AIHA 4NB5A 1BC8C 4MEXF 3T8TA 2Y48A 4YG2F 5CVIA 2JSCA 4ZZLA 3JAMZ 1FWZA 4U0YA 3GXOA 3T1BA 2Q2EA 2QWWA 4CGZA 3HHHA 3T8RA 5FLXZ 2QENA 3TO6A 2DTRA 5LEJA 1Z91A 2OQGA 1L3LA 4L9JA 2HKXA 2MH2A 2A3SA 2VODA 3JAMK 3NRVA 2K86A 1XDSA 4R8HA 1MZBA 3KP7A 1K6OA 2PMUA 3EYIA 2EA2A 3JTHA 3E3VA 2KIFA 1BI3A 4RGUA 4I02A 2G7UA 2OAZA 1SD6A 3MCZA 1P92A 2MLKA 5BMZA 2ZCWA 5LLQA 4OIPF 3OV8A 1YLFA 2IJLA 2EFWA 1XGNA 2BE5F 1PP7U 1P4WA 2V1XA 1IN8A 2MLGA 4LB6B 3BY6A 1HW1A 3RTRA 5LGUA 1TLHB 5IT9Z 3PQJA 2EJRA 2Y0MA 3SXYA 4RB2C 1FPQA 2P7VB 2W85A 3DPLC 4QWQA 2PFBA 4XSXF 4HOBA 2XROA 4PZJA 1IN7A 1R23A 5DEQA 1FP1D 4IF4A 4UHTA 2A5YB 4OIRF 1Z6TA 4N9IA 1YS6A 4YIIA 4N0BA 2NRAC 2ZMEA 1XGOA 2ETHA 2O6GE 2MC3A 3SZTA 3F22A 2WC2A 2XHKA 2OZ6A 1HQCA 4BAYA 4E70A 4A5MA 2TDXA 5ILSA 4KMUX 4M74A 1IW7F 2CWEA 3I58A 1LQ1A 4DNCA 2DPUA 3F21A 3LQQA 3KE2A 1PDNC 3F6VA 3GFJA 5E18F 1VTNC 1W5SA 3K1PA 5FD6A 2HOEA 5ICCA 5HLGA 3WG9A 1STZA 2XGXA 3GFIA 1ZGAA 1KQ8A 4HF0A 4ENJA 3ECOA 1DUXC 1FOKA 3U2RA 1E2XA 1SFEA 3ECHA 4EMSA 2HEOA 4FT8A 5HLIA 5JHUA 2GIVA 4A2UA 4QLCU 2IA1A 3MWMA 3PFIA 2EK5A 2GA2A 3DFGA 4RGRA 3I54A 3WTUC 4CZZA 4KFCA 2R7FA 3JW4A 1QQIA 3F8FA 1MDMA 3FMSA 5DV5A 1H0MA 1BN5A 1L0OC 4HW0A 4BHCA 1O3TA 2RDPA 2ZKZA 1I5ZA 5ICFA 4LLNA 4WXDA 2CW0F 4HF2A 2XAFA 3O2PE 3I5UA 2DO7A 1BBYA 1FBQA 2PQ8A 4LGWA 3CO7C 3T5XA 2E1NA 2XUBA 2R3SA 3L2CA 4HLYA 1O57A 2QLZA 2YU3A 3DP7A 3M1EA 4HBLA 4OIQF 4CXFA 1KU2A 1FY7A 2DW4A 5D5XB 2F5DA 1R22A 5D4SA 2DI3A 1D8JA 1F4KA 4U7BA 4MHGA 1UHMA 2M5WA 2K27A 3ML6A 1ZRDA 3V8KA 4LK1F 4RAZA 1J75A 5ED4A 4U7DA 5FO5A 4L9VA 4Y13A 1U3EM 2FU4A 1U2WA 2FEZA 5K5QA 5A2QK 2YX4A 5FD5A 2H6BA 4KICA 5DUKA 2V1UA 3R61A 2F2EA 2QQAA 2QZ8A 2CSOA 5DUIA 1FNNA 2W25A 3V4GA 2PEXA 4A12A 2F5CA 2KRFA 3GLXA 4L5IA 5ICGA 3I59A 5HOOA 3WE2A 4KYWA 1B9NA 2G7HA 1FP2A 4M71A 2Z3YA 4G94A 3MZHA 1RI7A 4RB0A 3WTWC 3IWZA 4EJUA 4ZYHA 3K2ZA 2RQPA 1JGSA 3FXUA 4ON0A 2WTEA 3M7GA 4IRIA 1P2FA 5JR3A 3ZMSA 4PCQA 3ELKA 3KETA 3GZ5A 4AIKA 2F5FA 5JVTA 3GYHX 2RC4A 1ZG5A 5E17F 1RUNA 3R60A 3IHUA 5DD4A 3WTSC 4N9HA 1KA8A 2Z99A 2OA4A 4YFKF 1SMYF 3P9CA 1IRGA 1FBUA 3HTSB 1HW5A 1O7LA 2NS0A 3WODF 1TW2A 4YFXF 3J81K 4PDKA 2YX7A 1YO5C 1J7KA 3DQVC 4RGXA 3Q5FA 2O61A 2HYFA 3RDIA 1TNTA 3BJOA 3LA7A 1Z6RA 2L3DA 3D0SA 2LSOA 2H09A 1O3SA 2KJCA 2XKOA 3M9AA 5LGNA 3F8MA 3WU1B 3HSFA 1JE8A 4KNYA 2WV0A 1K79A 2RN7A 3DKWA 2NNNA 5IT9K 2UWMA 4IPAA 3K0LA 3Q9VA 3TDUC 5CVVA 1S3JA 1CF7B 2O0YA 2ELHA 3ZQ7A 3E5QA
chains in the Genus database with same CATH superfamily
3RQIA 3SEZA 4CYCA 2PBIA 3O3KA 4AIJA 1O7FA 4L5EA 4XBFA 3ABKH 1ETWA 2RVCA 3HB9A 2F4IA 2M34A 3AG4H 4BHPA 2ZNYA 1ETQA 1OR7C 4M9SA 4HPQA 3CUQA 1GV5A 1VQKI 1POGA 2RV8A 1XTAA 1TW3A 2GWRA 1X4PA 4L9TA 3QODA 1JJ8C 2IGNA 4HV6A 3M07A 2K3PA 3CCYA 1WJFA 5F64A 2M8EA 3MFKA 3OYBA 5DM7F 2DFHA 2FJ1A 2LF8A 5C4JJ 2BY0A 4PGGA 3TOBA 2VKDA 1HA8A 3SDGA 5FB2A 2VJIA 1YRNB 4OMZA 4KIGA 5HDNA 4LG0B 5FRMA 5CVJA 4WK8F 2XAJA 3E5XA 1IDYA 3LWFA 1RETA 2E35A 2JRTA 1EKEA 1IRFA 3B6AA 4JX4A 4DQ2A 3L09A 1PUFA 1ERDA 3QP5A 4EGZA 2IXSA 3K1MA 4MQVA 2DTZA 4UV8A 4YELA 2D45A 3BR2A 1JUMA 2HZDA 3IH3A 2KQRA 2Y0SN 3KEQA 4ZDLA 3H9GA 4U0WA 3HRSA 1KZHA 3FK7A 1WSUA 1J59A 2DQLA 3BTIA 2RREA 1RR7A 3OMYA 4GYGA 2BY2A 1MNEA 1S8NA 2W24A 2QYOA 3Q0WA 2V6EA 4C30A 1YJWI 2JSPA 2XAHA 3HGYA 3DPTA 2CJJA 1R71A 4KT6A 2E2JJ 1UFMA 3GEZA 2FXAA 2BOLA 3HPHA 4PJJA 5K5OA 1LJ9A 1WGXA 4RDUA 4JQFA 2DK5A 4ANJA 2EFOA 2V4JC 2N8GA 4G8XA 3JRHA 5C4XJ 2VN2A 3MAJA 5FKLA 1N78A 5M5YJ 3OYLA 1I39A 1G3TA 2JK3A 4IOAF 3I4NJ 2E19A 4Q5SF 2ZMEC 4Y17A 4X1EA 4NC8A 2QCOA 1T2KA 4WX9A 3FXQA 5IYBJ 2KIMA 2P8TA 4ZJZA 1W36D 3CJRB 4KA4A 3N97A 5B1BH 1JTXA 2CQKA 4LG3A 3OOPA 1X3UA 2L9NA 3NARA 3WTXC 5J8CA 3L2RA 1BM9A 1VQ9I 3W6VA 3OL4A 2Z2SB 1IUFA 1P6RA 4P96A 2Y75A 1BOAA 1MBKA 4X6AJ 3KP2A 3K1NA 3H0DA 2VI6A 3RPUD 3BCAA 1FYLA 3AG3H 5CLSA 1FYMA 3S15J 3FMQA 1ZREA 4ZYEA 3BR6A 3H3UA 3TDZC 4IHXA 4I76A 2I10A 5LGTA 1FC3A 4HZFA 5E79C 5K5RA 1NHAA 3E6MA 2OUMA 1T39A 5AIQA 1LPQA 1IF1A 1RESA 1YIOA 5EYRA 2HTSA 1QGPA 3HKZN 2DA6A 3K4JA 2DAOA 5FKMA 4QPOA 4XLNF 4Q4ZF 2HOSA 1OJLA 1JUPA 3HRTA 3TW6A 1Q1HA 2O8XA 1JT0A 1ZK8A 1O3QA 1O3RA 2Z9OA 5GP9A 1MMNA 2ECBA 3K4CA 2M0CA 1ZKGA 4EM0B 3QPHA 1W0TA 1XC5A 1D5VA 1UHSA 1U8RA 1W7PB 4AWXB 4BJ5C 4XOPA 4B8XA 1WVRA 2HQNA 3Q0VA 3LOCA 2NAZA 4U0VA 5GTIC 1ULYA 1OCRH 3K10A 2CRGA 3DTIA 3M8JA 5LHIA 3LSIA 3HL2A 1LDJA 1FJLA 4BY7J 1OYIA 2FOKA 2HKOA 4CYCB 4FHTA 4Y52J 1G3YA 3J80K 3HUGA 5DS9A 4RM3A 2DA2A 2LBFA 5ICEA 1Z7UA 2WB1N 1R5GA 2IPQX 3DEUA 4A3FJ 1HBXG 3HC7A 4BGDA 1MSFC 1OR7A 1T98A 1PP8F 3FZVA 1IV6A 3HDDA 2EZKA 2DXIA 1BJAA 2JA8J 4HNVA 6PAXA 3KCCA 1HXDA 2QSGX 1B8IA 2CW7A 4XLFA 2EINH 4CCMA 4CYDA 4E7SA 1G4DA 5D8LB 3WGGA 1HKTA 4UB6C 3A2KA 4JX6A 3QOPA 2DPDA 2W84A 3M4OJ 2M30A 2ZXJA 1V5EA 2V1NA 5TJJA 1IN5A 2LR8A 4XSZF 4Y7NJ 1V5FA 3PJRA 2VC1A 2VB6A 4FETA 4UV9A 1WI3A 4AVPA 3GZ6A 1KU9A 1RKTA 3FIWA 4BACA 3CUOA 2JJ7A 4UUSB 2W57A 1MBGA 1D1AA 1T38A 2O7OA 1X1DA 2K7LA 3LSHA 2V9VA 1R49A 4UVAA 1H8AC 4E7KA 4CSWA 2BY1A 5DM6F 3QP6A 5J40A 1DPUA 2GOXB 2DYRH 3BR1A 3BROA 3O6BB 1ZGJA 2DMNA 4A0ZA 3ROUA 3QWLA 1VF9A 4Y15A 4NC6A 1D8KA 2WWYA 3A0BC 4AYBN 2VBXA 3EUHC 2OCCH 4BDZA 3MKLA 5FRNA 5H6RA 2DLLA 3CLOA 3ZQFA 3L2VA 3CF5F 5L3GA 2YPRA 4D0PA 3HM5A 4XLPF 1HSJA 2R7SA 3F23A 2ECCA 5KVRA 5M3MJ 1IN6A 2K3FA 1B8IB 4UUTA 5KAFC 4FE4A 3LSMA 1QZZA 1YX3A 3LA2A 2BXZA 1HC8A 1KONA 1HSTA 1LEAA 3GFLA 3HGGA 1ZR2A 3DXJF 5M3FJ 3OL3A 3K6GA 4HX7A 1HKQA 2LG4A 3QQAA 1YW7A 1R4MB 1QBJA 2FF4A 3BJ6A 4CO8A 1BIAA 1WJ5A 2VE9A 2V1DA 2JN6A 4MTEA 5GAHJ 2ESHA 1VQMI 2KZVA 3GTMJ 3SZPA 1Z67A 2JVGA 4CCKA 1SMTA 5DCMB 2EB7A 3CP2A 3G2BA 3RSNA 4WCGA 2B0LA 2JPCA 3LFKA 2LK2A 5HVQC 3C3WA 2ID6A 2HOAA 4EGYA 4IQJA 1V55H 1IDZA 5CVUA 2DU9A 3DWLE 2EV6A 2Q2EB 2EZIA 1EJ9A 4Q48A 5CYVA 1D0XA 1AU7A 2V6CA 2E1CA 2GM4A 1OMIA 4BQQA 1BR4A 1K6YA 3I55I 1T0FA 3CDIA 2QM3A 1W0UA 1D0ZA 1SVLA 4ENKA 2HVSA 4YIFA 4I01A 3K4KA 4UVCA 5CQGA 2W1OA 3BG9A 2DCEA 2DQRA 2BW3A 2DA4A 2STWA 1U6GA 4CCNA 3I56I 3QYFA 1MH4A 1GUUA 4OU0A 1R1TA 4XM3A 2VBYA 4Z2YA 2HYGD 3RPUA 3MN2A 5H6QA 3IL2A 1A5JA 3F6OA 4IX7A 1JUSA 3CJNA 2QSFX 2HPIA 2FD5A 2W00A 3CF2A 1QZEA 2JT1A 2O03A 2M9HA 1I1GA 1P4XA 3F3XA 2LBFB 3SZGA 1SFOJ 3CJTB 2Z33A 5E8GA 4NBQA 3RIRA 5B66C 2L01A 3S3NA 4XK4A 3FXMA 4CCOA 1TWGJ 3DBLB 4BNCA 3U9GA 4D9JA 3REOA 5E3OA 3BT9A 2FX0A 1R4NB 3OYCA 4IVNA 4G9YA 3BJAA 2IP2A 4A3LJ 3TOAA 1J0RA 2EV5A 4FISA 4FX0A 3RKQA 2LKPA 3BG5A 1XMKA 4HDUA 1QPMA 1TP4A 4M3FA 1ZQ3P 3GTKJ 4IEJA 2NS8A 1B72A 2M7AA 1JKQC 3RYRA 3CCJI 1X1CA 3H9JA 3J7AO 5HS8A 4XIDA 4DBRA 4D5CA 2D5VA 2ZJ2A 1FTZA 3F8CA 3ZR8X 1GVDA 3G1MA 4QTRA 1XPXA 1EV7A 5F08A 2K02A 3PUFA 4AC0A 1VQ7I 4A3CJ 1W5TA 2KJBA 4XRFA 4HF1A 1IXRC 2L4MA 4EM2A 5IT3A 1U5TB 2LNBA 1HW2A 3UNGC 2J5PA 2XVCA 4ASNA 1OPCA 3TL4X 3S3MA 3FHNA 1H9GA 2DYSH 3QPSA 4QIWN 5D5UB 1HF0A 2DOEA 5DD8A 2STTA 1R58A 4FE7A 5LBQA 2PJPA 4M6VA 2VJ4A 4S0HB 3TP0A 4GFBA 1S9HA 4M73A 3HTUA 4ESFA 1J9IA 2GLOA 3E5UA 1NTCA 4LG0A 1MBEA 1ZH5A 2VOOA 2ZSHB 3BZKA 1WWXA 1XSXA 2A6EF 4MQ9F 2NXNB 4WXCA 5H20A 1TNSA 3L1PA 1WKMA 1JT6A 4BXUA 1LE8A 5L3DA 4RAGA 3KZIC 1YTYA 4AD9A 2R4GA 4BU2A 4GGGA 3ABUA 5J1UA 1DU6A 1UZCA 2XKPA 3ZMVA 2VLAA 1ZGWA 4OINF 3JRIA 2E60A 3SQNA 2Q0OA 3K4BA 2VOPA 2X4HA 1USTA 3FF5A 2CH0A 3ZP5A 2DN0A 3R4KA 4YFNF 1ZR4A 5D5WB 4YRVA 3KZYA 3PNVA 2QBYB 3A4CA 1YW8A 1HKSA 2RNGA 4HX8A 3W2AA 4A3JJ 3CC2I 2R7UA 3IP4B 1LVAA 2Z1DA 2PMZN 1B9MA 5LEKA 4KMFA 5FLMJ 4WXHA 2DFIA 4E7HA 1AOYA 4BE0A 4LFUA 3V7RA 1QHGA 4Y3OA 3HEFA 4MO7A 4NQWA 1MJBA 4L18B 1OISA 1ENHA 2BHYA 1GLNA 2MD0A 5LD2C 2VBZA 1YRNA 1XG1A 4IRGA 4XKBA 4F91B 2W7NA 1JKOC 4NDLA 5TISC 1WJAA 1I27A 3IUOA 4UY8I 1JGGA 1ON2A 4MGRA 1SD4A 4ZTJA 1LEBA 4BUPA 2P0WA 4IL6C 2IS1A 5ILVA 3LSJA 3QAHA 5L3BA 3LAJA 4NNJA 4OOIA 3HIFA 1T95A 2BW3B 5B5EC 2QBYA 4JYKA 4I7HA 2M4GA 1R7JA 5B1AH 3BWGA 1APLC 2XSJC 2FQ3A 2ADUA 4G6DA 3RI4A 5CVRA 1D0YA 3WTYC 1S7AA 2V9PA 3A03A 4CUGA 3VPRA 2ZFUA 2R7TA 1OYWA 3DTKA 1FYKA 3S1MJ 1V4RA 4B47A 3FXRA 3VOEA 2D2WA 2NYXA 2GOMA 5K7HA 2PLYA 1R5ID 4CCLA 2L9VA 3GTLJ 5BPDA 1ZG3A 2JA5J 4IHTA 4Y33A 3HRUA 2W82A 4JBAA 3ZQQA 1F1ZA 2GIZA 1K83J 3QPTA 2RGVA 1YG2A 2PJRA 2HVQA 5KHDA 2CUEA 1YOVB 5LRSA 2JPBA 3OYNA 2QF7A 5FFZA 1WJBA 3BDDA 2LC2A 3HBLA 2FRHA 1FT9A 2EFQA 3MD2A 3FXKA 2WADA 2O3FA 2LP0A 2YR2A 4HDVA 3C2BA 4Y4RA 1ON1A 3ASNH 3RYPA 5JLWA 3FMRA 2E7XA 4XMYA 1RC9A 2DT7B 2L7ZA 3J81Z 1JXSA 4HAMA 2HQAA 1QZYA 2D1VA 4E7JA 1GV2A 3FK6A 2E36A 1SAXA 3I53A 1MNDA 2NOJB 2XGCA 2COMA 3FKIJ 3TO7A 2ZJRF 4ESJA 3DEEA 2FA5A 1MGTA 5J4YA 5DYMA 4ENMA 4A3IJ 4OAZA 3VSKA 3ZMUA 1E17A 3M8FA 3BR0A 4DYRA 3EYYA 4IHVA 3CCRI 2NNYA 2HQRA 3CC4I 2GZWA 4L0YB 3W6KB 2XF7A 2DFEA 3CDHA 3L9FA 3TW7A 4B43A 3E1SA 2DFFA 2MC4A 3PM1A 4IOCF 1U5TC 2CV1A 3IC7A 4HA8A 1ORKA 4KIFA 2WBMA 3RKXA 3C18A 3BG3A 1XCBA 4L9NA 4LJZF 3GX4X 1A35A 1REPC 1IXSB 4F3QA 4A0XA 3ZQCA 4ZDPA 1BI1A 1BW5A 1D1CA 2IA2A 4ENNA 2KDOA 3AL0C 2HXOA 2G0EA 3C2HA 3CLQA 2VQHA 5L3FA 5HS9A 1ZELA 3TP3A 4P1WA 3OYDA 1KU7A 1WRJA 3COAC 3GTGJ 1W1WE 3HZJA 1CF7A 4ESBA 1VQNI 4M3EA 3QU6A 2R5ZB 2MYSA 2OBPA 4WWCA 1K78B 3SHFA 2K40A 4BBSJ 3P9KA 2XIGA 4IRHA 5E1XA 2VQCA 2KL4A 3FXOA 3IWFA 5EDNA 1XDUA 2LRDA 2WAQA 1GVJA 4ZTFA 4P55A 1HDDC 3M3YJ 3U1DA 5GTHC 1LB2A 2ELKA 3JRDA 4DIQA 5FLXK 4HEA2 2PI0A 3VYSB 3HOUJ 1X4OA 3KP4A 5D6EA 5JLXA 3E0JB 1OCOH 3A01A 5J1YA 4V2FA 3SFIA 1V3FA 5C44J 3VDXA 1NG7A 2X6YA 3EUHA 1OCPA 4WF2A 4A3BJ 2CFXA 2QKLB 4EM1A 3F0CA 2A61A 3ULQB 3I9V2 2AHQA 1T0FC 4RLFA 1HOMA 3CO6C 5LRRA 1TQPA 3M8EA 2JZYA 1SAUA 3CCQI 3OYGA 2D1HA 4EJTA 1T8IA 3SDBA 3IRQA 2DDAA 2DMQA 3F8NA 2QGUA 2IRFG 3EDPA 4F93B 3KYCB 4HX4A 4YIRX 2P4WA 5IP7J 1KU3A 4UNOA 4U88A 2MD5A 1TT5B 5TGTA 2E2HJ 2L54A 3LSTA 3OYHA 5J1RA 2ISYA 3P5JA 3BTJA 3ERED 5FKNA 2X6XA 2H8RA 2KLOA 2UV1A 4UXNA 1I3AA 4FX4A 2VIXA 3P7NA 3NEUA 3HSRA 3EUAA 1FEXA 1K4SA 3OYFA 2V26A 1SFUA 1ETYA 1TT0A 3FX3A 5DTDA 3KEOA 2CUZA 4MNUA 2PG4A 3LFUA 4E7IA 5BS6A 1ETVA 1XD7A 3OS0A 1B6AA 2QQBA 3OWTA 2M8GX 2L02A 3KP6A 2GXGA 5J47A 5EGOA 3HYIA 2AXTC 2CG4A 1MDMB 3HHGA 2ZB9A 4LMYA 5F1RA 2HWVA 2BYVE 1PYVA 2YUSA 4IJAA 2E1OA 4I98B 3W6JB 1Y1WJ 2EWNA 3HUGB 4HSTA 4XRSA 1G3WA 1ZG1A 3JREA 4RS8A 3L2WA 3AAFA 4B3XA 2P6SA 4P9UA 3ZN0A 3BG7A 4C3IJ 3CZ6A 4BJTA 3KP3A 2TRTA 1J2XA 1ZHFA 1SFKA 2ZXIA 4RBOA 1ACIA 4OWRB 2BEOA 1Z1DA 5TRDA 1Z05A 1S7OA 3FM5A 4FASD 1SC7A 4M6YA 2DT5A 5E1WA 3WGIA 1ZYRF 3ZMDA 1TQMA 1MBHA 2E34A 4P9FA 4D7MA 5LHHA 2CW8A 2E71A 5BNGA 2M7BA 4PJMA 4H0EA 4UUVA 1KQ0A 2K4BA 3WG7H 2LOOA 2MG4A 3H3ZA 3I4MJ 4NUBA 2EIMH 5E1ZB 5J6XA 1UB9A 5EF6A 1FZPB 2COBA 1UMQA 4EJVA 3OS2A 4XORA 1X19A 3HOTA 1FBSA 2LLKA 3JSOA 2B63J 2FQ4A 3SYTA 3H36A 3FXJA 3MEXA 2R7WA 3CD6I 2PN6A 3VSLA 2VT2A 1DQUA 2EQRA 3A02A 3V42A 2L7MP 1IG7A 1IXCA 4AVZA 4BEHB 3S3OA 5EG0A 4O5VA 1USSA 4XLEA 4EJOA 2NS7A 4GDFA 3CUQB 1VQ6I 1SFXA 4KDPA 1J5YA 5HDKA 2FMLA 1WH5A 1YQAA 3V7CA 4A3EJ 3GVAA 2LY9A 1UG2A 3H5RA 2VKEA 2AO9A 2GAUA 2Z16A 3AL0B 4BBRJ 4HV5A 1ODDA 4P5OA 5EEAA 2Q1ZB 3GLLA 4AUXA 3ERMA 2VKVA 1Y56A 2XGEA 5F27A 1IGNA 2MSYA 3R6SA 4PGHA 1S5LC 4F7ZA 5LHGA 2H6CA 3DF8A 3ZMTA 4G7HF 4OIOF 2A07F 3GBGA 3LNQA 2Y9YA 2XV4S 2BVMA 1MJAA 3H1CA 4ZC3A 5K7FA 4BQOA 4JK1X 4RMNA 3QRFF 2HOTA 3AFHA 3E6DA 3V8JA 3KIOA 3VFZA 1KYZA 2KISA 4ZH4F 3MQ0A 1F36A 3E7LA 5L3EA 2HFHA 2QVOA 1RZ4A 2XPVA 5FLVA 2ELJA 2VPLA 1U5TA 3S2WA 1PUFB 1RNLA 4G7ZF 2DA5A 1E0EA 4JOMA 1XMAA 2TCTA 1R5HA 3BZ6A 4XOTA 4G7OF 1UJ8A 5E20A 4C9YA 4BY1J 3RZOJ 2FMYA 2X0LA 2A5WA 2RKHA 1O4XA 1TQIA 2E2IJ 1TWFJ 2VKHA 2NVTJ 4IO9F 4ZYGA 1AKHB 5GPAA 3LAPA 2XAGA 2K5CA 1IUYA 1Y0UA 3HRMA 2EZHA 5DDGA 4O6JA 2CQXA 1KQ9A 1R36A 2IGKA 4RA2A 4FTHA 1OCCH 1BIBA 4HSRA 1B72B 1Y8QB 4NHJA 1TL8A 1I50J 3RCOA 5GAGJ 2R7DA 2UXXA 4EQQA 4RM2A 5GPCA 1Z3YA 2UUZA 3R0JA 1LFBA 3KFWX 1JI8A 3KZZA 4MFDA 3A1YA 3HXLA 2X85A 1LVKA 3RJPA 2R5YB 3BR5A 4HRIA 1T33A 3J7ZI 2VXZA 4EV0A 5DCMA 3WTVC 1LFPA 3HSEA 1BI2A 2VE8A 3TKYA 4F55A 2CUFA 3O8HA 3HG9A 2H1KA 3QYBA 4A6EA 3G3ZA 2LMDA 1FLIA 4Z6YA 1WJEA 1WJCA 4GXOA 2F48A 3N05A 3KLNA 4RB1A 4LB5A 2KKOA 1ZRFA 1DPRA 2KZGA 2MH9A 4R1HA 2DA1A 5KNLA 1T08B 2MGQA 4K2EA 4F92B 2L5QA 4S05A 2HDCA 3ABMH 5F04A 2L2OA 4I6ZA 4LLLA 1DP3A 5J4VA 4DGWB 3RKWA 1YS7A 4ETSA 2JTVA 3MKZA 4M9XA 4NC7A 3RPQA 3J80Z 1BI0A 4ZZDA 5ERIA 3M1CA 2CU7A 2M0MA 1XB4A 1OCTC 4B48A 1GDTA 3ZN1A 1DDNA 4FQGA 5D4RA 1YW9A 2EIJH 2HTJA 1MBJA 1TTYA 3GUDA 1A6IA 2L0KA 1FSHA 2H1LA 4BQAA 1ONVA 4A6DA 5L3CA 5J8FA 3FXLA 4XKWA 3RQ4A 4DYQA 2BVLA 3K9TA 3WU0A 1YITI 1Z21A 1HLVA 3S1RJ 3P9IA 5FKKA 4EEFG 4X0GA 1WI9A 2Q8KA 5EJCA 1XGMA 1S29A 3C1DA 3ZOBA 5E8IA 3CC7I 5DCFA 2ZXHA 2KMUA 4EJWA 4LD5A 4GYIA 3WTZA 3CMMA 1I6XA 1G59A 4ITVA 3OY9A 3ZMZA 2M3AA 2M45A 1XX5A 4PSXA 1UAAA 1EH7A 2VQLA 2LFBA 4LIVA 3SEQA 2HVRA 2EZLA 3U21A 4PK4A 3JTGA 3K69A 2ZMEB 3GTPJ 4OMYA 2IS2A 5KK1A 1S72I 2OTLI 1IN4A 2L9SA 4KN7X 3W3CA 2XF6A 1NK2P 2EA4A 1ZARA 4BHBA 3VYRB 5JFRA 2WY8Q 2BZTA 2OZUA 3T0YA 4PJ0C 4HLXA 1MJ9A 1LNWA 3V8LA 1XMXA 5LFAA 1YI2I 3DTEA 1V54H 1W7PA 2GA1A 3C2GA 1VQ5I 4IHWA 1QU3A 2GXAA 3G73A 2MW8A 3CMAI 3TO9A 1XN7A 1MBFA 3KPHA 4N4NB 5F6FA 4EATA 5EZHA 3L00A 4PJLA 1B59A 9ANTA 3EETA 4J19A 3ZQHA 3RKYA 2YSRA 4UUSA 1F9NA 3H92A 3PNTA 3PQKA 3I59B 5JI6A 2EILH 4I2OA 3NAUA 2XAQA 3TMOA 1RUOA 2FBHA 2ZFWA 5IY5H 4I99C 1ZN2A 1GXQA 1OYYA 1DU0A 2J5OA 1UHWA 4BH9A 3FM3A 1UELB 2EH3A 1ZLKA 2E1MC 2A6TA 3DLLF 2HGCA 3BOQA 1ETXA 1OKRA 2VQGA 2FBKA 2M1BA 2X51A 2BHZA 2UXNA 5FKOA 3PSFA 1Y8RB 4QPQA 4G6QA 3BPXA 1F5TA 1GHCA 3NQOA 3I64A 4LLGF 4FCYA 1KGSA 4PFPA 4UB8C 2HNHA 1A04A 3OYEA 5D5VB 2P81A 3G1LA 2KFDA 2RAEA 3VODA 4B09A 1K61A 2R5ZA 3OS1A 4BE1A 1K78A 3SFZA 1Z9CA 3VEPA 3N4MA 2KIUA 2ACJA 4AU7A 2LTPA 2ISZA 1X3ZB 1BC7C 2DK8A 1TWAJ 1PUEE 5K1YA 2EV0A 3F72A 1Z77A 4M9ZA 2AS5F 2ZXWH 2LVSA 1N77A 3K2AA 2VT3A 1S6LA 3QYEA 5CJ9A 3LA3A 5AIPA 2BGCA 3EQLF 1WQ2A 1MNMC 1DP7P 4C3JJ 2XB5A 2WAFA 2Z5UA 3JRFA 3LSKA 2ZBKA 1VQPI 2CO5A 2R93J 2K4JA 1MKMA 1H9TA 1AHDP 2JUGA 1FX7A 1PJRA 3L7WA 3WE3A 1A36A 1ZTRA 3EPZA 3GWZA 2AXLA 2NVQJ 2YU9J 3IKVA 1D3YA 2MA3A 1XCVA 3W2VA 4XL9A 5D6FA 3SJMA 2FSWA 2PMHA 2ZC2A 3GZNB 1AWCA 2MBFA 3PNYA 1I1SA 2IEKA 2M2EA 3E6BA 2IT0A 2OU2A 4XQFA 3D5LA 3B02A 2R0QC 1KYWA 3CCSI 1LUJB 2HXIA 3KYDB 1MMSA 4XICA 2DA3A 1MMDA 4I0BA 4YEJA 3B73A 3V7SA 3ESWB 4M72A 4ZYDA 2VXDA 3I4PA 1U78A 2FBIA 3MZYA 3CUQC 4G12A 1XGSA 3AKZA 4M3DA 1T6SA 4A3MJ 4N4OB 4L5JA 2OD5A 2KDZA 1YYVA 2EFNA 1JKPC 1I6HJ 1SD7A 3VYTB 3H9QA 4RGSA 2HZTA 4IHYA 1WHUA 5FGMA 2LH9A 1GT0C 2CYYA 1RR8C 4CICA 2M87A 2QUFA 2ZO4A 2EIKH 2VONA 2JA6J 2F5VA 1IO2A 1SD5A 1V5GA 4IZZA 4C2MJ 1R6RA 2HU9A 2F5EA 4RAYA 1P4AA 4RLQA 4BKXA 4HQMA 2RQQA 2LYCA 2QQ9A 4BYYA 3S1NJ 4S04A 1JJ6C 1TWHJ 2DOFA 2XB0X 5B3SH 2QQ8A 1FSEA 3DEWA 4RB3C 1CGPA 1QNTA 3LQRA 1IZ1A 4R79A 1OCZH 3H3VK 4BXXJ 3DV8A 1UCRA 1M1EB 5HDGA 1Z0XA 2DBBA 3FHZA 3CESA 3NWTA 2PX9A 1JHHA 2LY2A 4HQEA 1R1VA 4KITB 5E3LA 4OAYA 3PL8A 1WFXA 2I8DA 2R7OA 5A2QZ 1NK3P 1VQLI 4RAFA 3HOSA 3J7AY 3E97A 2ME6A 2W48A 2QEXI 2ZJQF 3FWEA 3IV5A 2FNPA 2HDWA 2LKXA 3PO3J 2CQQA 2DDBA 3H5AA 1K7AA 2A68F 2L7KA 3KLOA 1OQYA 2LKSA 2OPTA 4HG2A 3IKTA 4A3DJ 2CMPA 1P7IA 3BLYA 1JHFA 3QU3A 2UZKA 1G6NA 1WCMJ 2G9WA 2R7ZJ 1BW6A 2OQRA 2X1EA 1CQTA 3DKXA 2JRMA 4I09A 2GXBA 4CCJA 2EFPA 4HYEA 1BJZA 1C0WA 3ZQLA 2P6TA 5AONA 2C6YA 4XR6A 4GO1A 4O3MA 3CCUI 1QO0D 4B4CA 3GW2A 3TGNA 3GF2A 5IPAA 1X1AA 5IOZA 4Q47A 1IRXA 2CV0A 3F9KA 3WGHA 3OSFA 5EEGA 4KN4X 2QSHX 5CQEA 1X3WB 1E3OC 4LIUA 4XRMA 2KRCA 3VB2A 4PUSA 5IYCJ 2H27A 3OIOA 3JRCA 3BTLA 5HNHA 1XSDA 4GCVA 3A01B 4A0YA 4LK0F 2CQ7A 2DMTA 4A5NA 3ABTA 4IQ4A 4M3BA 4U87A 4BL0B 2MABA 2FE3A 3BZCA 3R0AA 3TQNA 5HLHA 5BPIA 1LDKB 2L4AA 3ZXSA 4I0AA 3DU5A 2F4OB 3DBRB 2IVMA 2BV6A 3I0TA 1ZAOA 4BEHA 2XASA 5F0FA 5ILUA 2Y30A 2HR3A 4PJNA 5FFXA 1MD0A 2KHMA 1BOBA 4ZDOA 2A6HF 2IA0A 4XN0A 2IW5A 4LOCA 3OYAA 5HODA 3OYJA 2KRHA 3KP5A 4MTDA 2H94A 3F8BA 3GO5A 3ZQGA 3IRRA 2ME0A 4MEYF 4DBQA 3JSPA 1JTYA 2Y2ZA 2E7WA 2HQ5A 5M5XJ 3NWSA 5D8KB 3ISPA 1HDPA 2VC0A 4CDGA 1B1BA 2RNJA 3BC8A 2QKMB 2V79A 1E3HA 2ICWG 2FNAA 3Q0UA 4AM3A 2K9SA 3I71A 3L2UA 2LF7A 4UVBA 1EH6A 2HDDA 4F52A 3ZPLA 3QOEA 5EEHA 4KIBA 1VQOI 1BR1A 3WTTC 4KJZA 1FMVA 4CHUA 1YFHA 3CTAA 2P5LC 2JWTA 4W97A 3BPVA 2HS5A 5CPRB 3UR3C 1IRZA 1D1BA 3Q3SA 1IJWC 1U0JA 2P7CB 3GFMA 3LSRA 2DOAA 1IAWA 3HOYJ 1ZRCA 5BQTA 4M6XA 5IP9J 4AYBA 4JX5A 3I3LA 1B4AA 3E6CC 1N75A 2VBWA 1BR2A 4G6TB 2P5VA 3FBNB 3OYIA 1XSVA 4A3GJ 2XRNA 5BOXA 1W7PD 1RIOH 1G3SA 3Q9SA 4A3KJ 1TBXA 4PFOA 3S2DJ 3S17J 2VJ5A 2BBYA 2VPRA 1Z3XA 2GQQA 3FKJA 2KIQA 2P5KA 4KUMA 4TV7A 4C3HJ 2ZNZA 2ZJPF 3WU2C 3H5NA 1R00A 3JRAA 2ESNA 1ZLJA 4MIMA 5HS7A 1U9OA 1XS9A 1VQ4I 1W4MA 1DGWY 1GXPA 3BP8A 3DBHB 3S14J 1EH8A 2LDUA 4IXAA 4BJ6C 4KT5C 2K9NA 4EVIA 2A69F 1LDDA 2R92J 4L0ZB 5C3EJ 3C7JA 2CGPA 4IHSA 1R1UA 4AIHA 4NB5A 3GTOJ 3BCBA 1BC8C 4AIDA 3KYLA 5JVGF 2HI3A 4MEXF 3T8TA 2Y48A 3CJQB 4YG2F 3RZDJ 2GBYA 3HPGA 3VWBA 5CVIA 3L2QA 2JSCA 4ZZLA 3HOWJ 5M5WJ 3JAMZ 2EPFA 2KP6A 1FWZA 2EBIA 3ZRGA 4U0YA 1A6QA 3GXOA 3T1BA 1MSEC 2Q2EA 2CS3A 3MMYB 2QWWA 2XPWA 4CGZA 3BQYA 3JCUC 3HHHA 3T8RA 2XC7A 2CUJA 5FLXZ 2QENA 3TO6A 2DTRA 5LEJA 2R7RA 1Z91A 3D1NI 2WV1A 2OQGA 1L3LA 1I3QJ 2CV2A 2DT6A 4L9JA 1AA7A 1G8XA 1Q1VA 2HKXA 2MH2A 2A3SA 2QA4I 2VODA 3JAMK 4II2A 1P7JA 3NRVA 3CMEI 2K86A 1QPIA 1U8BA 3CCLI 5HLTA 1XDSA 4R8HA 1MZBA 2K9LA 3BG6A 3D5SC 3KP7A 1OFCX 3CMYA 1K6OA 2PMUA 3EYIA 2EA2A 3JTHA 3E3VA 2KIFA 1X1BA 1BI3A 2XDVA 3HKZA 3OIQA 4RGUA 1S7EA 2Y9ZA 4XONA 4I02A 2G7UA 1N25A 2OAZA 1FTTA 2X1CA 3FBIB 5FJ8J 4JP0A 1SD6A 3S93A 2JUCA 3S8PA 3MCZA 2E5ZA 1QHHD 1P92A 2MLKA 3GMEA 2F6CA 5BMZA 2JA7J 2ZCWA 3ONQA 5LLQA 4OIPF 3LSGA 3OV8A 1YLFA 2IJLA 2CFOA 1QA6A 2EFWA 1XGNA 2BE5F 2NVXJ 2AQFA 1PP7U 3FDYA 1P4WA 4BXFA 2O9LA 2V1XA 3QPLA 1IN8A 1SVOA 5F1JA 2MLGA 2OCEA 2HYJA 1D5YA 4LB6B 3BY6A 2M4KA 4BDYA 1HW1A 3RTRA 3MVPA 5LGUA 1TLHB 5IT9Z 3G6EI 1HCRA 3PQJA 3K4MA 1F43A 2EJRA 2Y0MA 4II3A 3SXYA 2HPMA 4RB2C 1RPWA 5F0CA 5K7ZA 1FPQA 2P7VB 2W85A 3DPLC 3ZQIA 4QWQA 3MKYB 4A69C 2PFBA 2BXYA 2IS4A 4V19K 4XSXF 4HOBA 5HNFA 2XROA 4PZJA 1IN7A 1R23A 2DJIA 2PMZA 2WAQN 5DEQA 4ABZA 3K70D 1FP1D 2WAEA 4IF4A 4UHTA 3HOZJ 2VL8A 4XNFA 2A5YB 4OIRF 1VI0A 1Z6TA 1X1PA 4N9IA 4J01A 3W2WA 5GADJ 3K4LA 1YS6A 4YIIA 4N0BA 2DJNA 3G4SI 2NRAC 2ZMEA 1XGOA 3IAM2 2PJRB 2ETHA 2DA7A 2O6GE 2MC3A 3SZTA 3F22A 2WC2A 2XHKA 2X6OA 1IV8A 3IAS2 2BY3A 4KISA 2DMPA 2AQEA 2MFZA 2OZ6A 5IOYA 3G71I 2JMWA 1HQCA 4BAYA 4E70A 4A5MA 4HNTA 2TDXA 1Z7LA 5ILSA 5E3NA 1YHQI 3KEYA 4KMUX 4M74A 5E3MA 1IW7F 3ZCOA 4B1RA 3OR1C 1FOXA 2CWEA 3I58A 3OSGA 3PFYA 4W1UA 2XSDC 1LQ1A 1FIAA 4DNCA 2DPUA 3F21A 1T56A 2R7QA 3LQQA 2W4SA 3KE2A 4XLCA 3F6VA 1PDNC 5JHFA 3GFJA 2Y31A 3HOVJ 3ZGKA 2NVYJ 1VFCA 3H0GJ 2JVHA 5E18F 2R7XA 1VTNC 3JRBA 1W5SA 3IH4A 4ZYAA 3K1PA 2XGDA 3WHCA 4A93J 5FD6A 4CZCA 2HOEA 5ICCA 1NH3A 1TWCJ 5HLGA 3WG9A 1STZA 2XGXA 3ASOH 3CDLA 3GFIA 1UG0A 2K85A 1YE9A 5GAEJ 1ZGAA 1KQ8A 1MH3A 4HF0A 1LFUP 4ENJA 3ECOA 1DUXC 1FOKA 3U2RA 1E2XA 2I5UA 1SFEA 3ECHA 2V7FA 4EMSA 3E5QA 2HEOA 4FT8A 3ABLH 1FOYA 2F4MB 2FUG2 5HLIA 3OYMA 5JHUA 2GIVA 4A2UA 1E3PA 4QLCU 4QSHA 4V2GA 4E7LA 2IA1A 3MWMA 3PFIA 3OIPA 4J00A 1Y1VJ 5CKTA 2XPUA 3LL7A 3MKWB 1OLTA 2JA2A 2EK5A 2VJJA 2GA2A 3DFGA 1VQ8I 4XLHA 3CCMI 2DODA 4RGRA 1J09A 4BQNA 3TEDA 2OTJI 3I54A 1QRYA 4CA0A 1EF4A 1FOWA 3EUKL 4E4HA 3WTUC 4CZZA 1MW7A 1LE8B 4C2TA 4KFCA 3KX2A 2O8KA 2R7FA 3JW4A 1QQIA 2Y0SA 3F8FA 1MDMA 3FMSA 4XLAA 5DV5A 4LITA 2VUMJ 3PIOF 2B7EA 1H0MA 1BN5A 2L9RA 2KT0A 3B6CA 3CQZJ 1L0OC 3CP8A 3AG1H 4HW0A 4BHCA 3U1KA 1Y6IA 1O3TA 2IGMA 5EG0B 2RDPA 2Y69H 2ZKZA 1I5ZA 2X1DA 5ICFA 1H88C 4LLNA 2WA0A 3OYKA 4WXDA 3BTCA 2CW0F 3S16J 2XAUA 4HF2A 2XAFA 3O2PE 3I5UA 2DO7A 1TC3C 1BBYA 1P9QC 1FBQA 3TBIA 2PQ8A 4LGWA 3CO7C 2IBDA 3S32A 3T5XA 1ETOA 2E1NA 2OF7A 2XUBA 4D1QA 2WB1A 2K9MA 2R3SA 3FISA 3L2CA 4HLYA 2X48A 1O57A 2L7FP 2QLZA 5J3LA 2YU3A 4XN3A 2WY7Q 3DP7A 3PIPF 5EGOB 1A31A 3M1EA 4HBLA 3GCMA 4OIQF 3HJEA 4E6KG 3PSIA 4CXFA 1KU2A 1FY7A 3OOUA 2DW4A 2XF5A 4HNUA 1LKXA 2DMUA 1RRJA 5D5XB 3S2HJ 3GTJJ 1YJNI 1W36C 2F5DA 1R22A 3MZ8A 5F0HA 5D4SA 2DI3A 1D8JA 1QVTA 1F4KA 1U9NA 2VASA 1K4TA 4DZPA 4U7BA 2JQ7A 4MHGA 1UHMA 3LMMA 5EZGA 2M5WA 2K27A 3CCEI 3ML6A 2XRLA 1ZRDA 3V8KA 4LK1F 4RAZA 4B3AA 3UKGA 1PVEA 1J75A 5ED4A 3GTQJ 4U7DA 5FO5A 1H89C 3DLAA 3BQZA 1TZLA 4L9VA 4Y13A 3CCVI 1U3EM 2FU4A 1U2WA 2NVUB 2X6WA 2FEZA 2E5NA 5K5QA 5A2QK 3VYUB 2OV7A 1X2NA 4DZJA 1DGRM 2YX4A 2H6BA 2ZSIB 3O8GA 4KICA 4XKVA 2KPMA 5DUKA 5FD5A 2V1UA 3R61A 4MLOA 2F2EA 2QQAA 4DOZA 2QZ8A 4IKFA 1VNDA 1YIJI 1X58A 2CSOA 5DUIA 1FNNA 2W25A 3V4GA 2PEXA 2E1MB 4DJAA 4A12A 2F5CA 2KRFA 3GLXA 4L5IA 5ICGA 3I59A 5HOOA 3WHBA 3WE2A 3A0HC 4D5FA 4KYWA 1B9NA 3DU6A 1Y39A 4D7NA 2G7HA 2IS6A 2CQNA 3S1QJ 1MMAA 4XKCA 1FP2A 1EA3A 1FIPA 3OR2C 3J7YJ 4M71A 2Z3YA 4CH7A 3K70C 2OC6A 4G94A 3MZHA 1RI7A 1ITYA 4RB0A 3HOXJ 3WTWC 3IWZA 4BS9A 4EJUA 5H2FC 4ZYHA 1FMWA 3K2ZA 3PO2J 2RQPA 1Y0NA 2OJED 1YJ9I 1JGSA 3FXUA 4H4KC 2X9DA 4ON0A 1YX5A 2YS9A 2WTEA 3M7GA 4IRIA 1P2FA 1G2HA 1SANA 5JR3A 3ZMSA 4PCQA 4MFEA 2V9KA 2H8WA 3D5RC 4PSWA 3ELKA 4XRSG 3KETA 2FOWA 3GZ5A 3IH2A 1SEUA 4AIKA 2F5FA 2O5RA 5JVTA 2LREA 3GYHX 1MIJA 2RC4A 1ZG5A 5FROA 3JR9A 5E17F 1RUNA 4C2UA 2LY1A 3R60A 3IHUA 1R9TJ 2A05A 3X2QH 2R5YA 5IYDJ 5DD4A 3WTSC 5IP6A 4GRIA 4N9HA 2B9SA 1KA8A 2Z99A 2OA4A 4YFKF 1SMYF 3ZQ7A 3P9CA 5KAIC 1IRGA 3DKYA 1FBUA 3HTSB 1HW5A 1O7LA 2NS0A 3WODF 1TW2A 4YFXF 4DYCA 3J81K 4PDKA 3JRGA 2IGOA 4M3GA 2ID3A 2YX7A 1W5CC 4DW6A 1ETKA 1YO5C 1J7KA 3DQVC 3DPUA 4RGXA 1QVUA 1WJDA 3Q5FA 2O61A 2IAIA 2HYFA 3RDIA 1TNTA 3BJOA 1WPKA 1NG6A 1VZ0A 1WH7A 1Z6RA 3LA7A 2R7VA 1IC8A 2L3DA 2K9QA 3K7AJ 3D0SA 4B44A 2LSOA 1AKHA 4NQWB 5KCMA 2H09A 3K4NA 3DCFA 4BE2A 1O3SA 2KJCA 2XKOA 3M9AA 3PUBA 5LGNA 3F8MA 3LSPA 1SVMA 3WU1B 3HSFA 1JE8A 3G1OA 4KNYA 2WV0A 1K79A 2RN7A 3DKWA 2NNNA 5IT9K 2UWMA 4IPAA 3K0LA 1BA5A 3Q9VA 1RKWA 3TDUC 2LD5A 2NOGA 5CVVA 3BR3A 1X2MA 1S3JA 2O0YA 1CF7B 2ELHA 1JKRC 1MMGA 1BL0A 1WZ2A 3AG2H 4E7ZA 3H35A
chains in the Genus database with same CATH topology
2PBIA 3O3KA 4AIJA 1O7FA 4XBFA 2RVCA 4BHPA 2ZNYA 4M9SA 3CUQA 2RV8A 1TW3A 2GWRA 4L9TA 4HV6A 3MFKA 5F64A 2M8EA 2LF8A 4PGGA 3TOBA 5FB2A 4OMZA 4KIGA 5HDNA 4LG0B 5CVJA 4WK8F 2XAJA 3E5XA 3LWFA 2JRTA 1IRFA 4DQ2A 3L09A 3QP5A 4EGZA 3K1MA 4MQVA 4UV8A 2D45A 3KEQA 4U0WA 3HRSA 1WSUA 1J59A 2DQLA 4GYGA 1S8NA 2W24A 2QYOA 2XAHA 3DPTA 1UFMA 3GEZA 2FXAA 5K5OA 1LJ9A 4JQFA 2DK5A 2EFOA 4G8XA 2VN2A 3MAJA 1G3TA 4Q5SF 4Y17A 1T2KA 4WX9A 3FXQA 2KIMA 2P8TA 4KA4A 3N97A 2CQKA 3OOPA 1X3UA 3WTXC 5J8CA 1BM9A 1P6RA 4P96A 2Y75A 1BOAA 3KP2A 3K1NA 1FYLA 5CLSA 1FYMA 3FMQA 1ZREA 4ZYEA 3H3UA 3TDZC 5LGTA 1FC3A 4HZFA 5K5RA 1NHAA 3E6MA 1T39A 5AIQA 1IF1A 1YIOA 2HTSA 1QGPA 2DAOA 4XLNF 4Q4ZF 3HRTA 1Q1HA 2O8XA 1O3QA 1O3RA 2Z9OA 4EM0B 3QPHA 1D5VA 1U8RA 1W7PB 4AWXB 4B8XA 2HQNA 2NAZA 4U0VA 1ULYA 5LHIA 1LDJA 1OYIA 2FOKA 2HKOA 4FHTA 1G3YA 3J80K 3HUGA 5ICEA 1Z7UA 1R5GA 2IPQX 3DEUA 1HBXG 1OR7A 1T98A 1PP8F 3FZVA 1BJAA 6PAXA 3KCCA 1HXDA 4CYDA 1G4DA 5D8LB 3WGGA 1HKTA 3QOPA 2DPDA 2W84A 2M30A 2ZXJA 5TJJA 1IN5A 4XSZF 2VC1A 4UV9A 4AVPA 3GZ6A 1KU9A 3CUOA 2W57A 1T38A 2K7LA 2V9VA 4UVAA 3QP6A 1DPUA 3BROA 3O6BB 1ZGJA 4A0ZA 3ROUA 4Y15A 1D8KA 2WWYA 2VBXA 5H6RA 2DLLA 3CLOA 5L3GA 2YPRA 4D0PA 4XLPF 1HSJA 3F23A 5KVRA 1IN6A 1QZZA 3LA2A 1HSTA 1LEAA 3GFLA 3DXJF 4HX7A 1HKQA 1YW7A 1QBJA 2FF4A 3BJ6A 4CO8A 1BIAA 2VE9A 2V1DA 4MTEA 2ESHA 3SZPA 1SMTA 5DCMB 2EB7A 4WCGA 2B0LA 2JPCA 3LFKA 5HVQC 3C3WA 4EGYA 5CVUA 2DU9A 2EV6A 4Q48A 5CYVA 2V6CA 2E1CA 1OMIA 1T0FA 2QM3A 4ENKA 4YIFA 4I01A 4UVCA 2DQRA 2STWA 1U6GA 4OU0A 1R1TA 2VBYA 4Z2YA 2HYGD 3RPUA 5H6QA 3IL2A 3F6OA 3CJNA 2JT1A 2O03A 3F3XA 1I1GA 1P4XA 2Z33A 5E8GA 3RIRA 2L01A 4BNCA 3U9GA 3REOA 4IVNA 4G9YA 3BJAA 2IP2A 3TOAA 1J0RA 2EV5A 4FX0A 2LKPA 1XMKA 4HDUA 1QPMA 3RYRA 3J7AO 5HS8A 2ZJ2A 3F8CA 1EV7A 2K02A 1W5TA 2KJBA 4XRFA 4HF1A 1IXRC 5IT3A 4EM2A 2L4MA 1U5TB 2LNBA 1HW2A 2J5PA 2XVCA 4ASNA 1OPCA 1H9GA 5D5UB 5DD8A 2STTA 1R58A 5LBQA 2PJPA 4M73A 3HTUA 4ESFA 1J9IA 3E5UA 4LG0A 1ZH5A 2VOOA 1WWXA 1XSXA 2A6EF 4MQ9F 4WXCA 5H20A 1TNSA 1WKMA 4BXUA 5L3DA 1YTYA 4AD9A 4GGGA 3ABUA 2XKPA 3ZMVA 4OINF 3SQNA 2Q0OA 2VOPA 2X4HA 1USTA 3FF5A 3ZP5A 3R4KA 4YFNF 5D5WB 3KZYA 2QBYB 1YW8A 1HKSA 4HX8A 1LVAA 1B9MA 5LEKA 4KMFA 4WXHA 2DFIA 1AOYA 4LFUA 3V7RA 4NQWA 1MJBA 4L18B 2VBZA 4IRGA 1I27A 1ON2A 4MGRA 1SD4A 1LEBA 5ILVA 3QAHA 5L3BA 3LAJA 4OOIA 3HIFA 2QBYA 4I7HA 1R7JA 3BWGA 2FQ3A 2ADUA 4G6DA 3RI4A 5CVRA 3WTYC 1S7AA 1OYWA 1FYKA 1V4RA 3FXRA 3VOEA 2D2WA 2NYXA 2PLYA 5BPDA 1ZG3A 4IHTA 3HRUA 4JBAA 1F1ZA 3QPTA 2RGVA 1YG2A 5LRSA 2JPBA 5FFZA 3BDDA 2FRHA 1FT9A 2EFQA 2O3FA 2YR2A 4HDVA 1ON1A 3RYPA 3FMRA 2E7XA 3J81Z 1JXSA 4HAMA 1QZYA 2D1VA 1SAXA 3I53A 2COMA 3TO7A 4ESJA 2FA5A 1MGTA 5DYMA 4ENMA 3ZMUA 1E17A 3M8FA 3EYYA 2NNYA 2HQRA 2GZWA 4L0YB 3W6KB 3CDHA 3L9FA 1U5TC 3IC7A 4HA8A 4KIFA 3RKXA 3C18A 1XCBA 4L9NA 4LJZF 3GX4X 1REPC 1IXSB 4A0XA 1BI1A 2IA2A 4ENNA 5L3FA 5HS9A 1KU7A 1WRJA 3COAC 1CF7A 4ESBA 3QU6A 2OBPA 4WWCA 1K78B 3SHFA 3P9KA 2XIGA 4IRHA 5E1XA 3IWFA 1XDUA 1GVJA 4P55A 3U1DA 1LB2A 5FLXK 2PI0A 3KP4A 5D6EA 1V3FA 4WF2A 3EUHA 2CFXA 4EM1A 2A61A 3ULQB 3CO6C 5LRRA 1TQPA 3M8EA 2JZYA 2D1HA 4EJTA 3IRQA 3F8NA 2IRFG 3EDPA 4HX4A 2P4WA 1KU3A 4UNOA 4U88A 2MD5A 2L54A 3LSTA 2ISYA 3ERED 4UXNA 4FX4A 3P7NA 3NEUA 3HSRA 1SFUA 3FX3A 3KEOA 4MNUA 2PG4A 5BS6A 1XD7A 1B6AA 2QQBA 2L02A 3KP6A 2GXGA 3HYIA 2CG4A 1MDMB 3HHGA 4LMYA 5F1RA 2HWVA 2BYVE 4IJAA 4I98B 3W6JB 2EWNA 1G3WA 1ZG1A 4RS8A 3AAFA 2P6SA 4P9UA 3ZN0A 3KP3A 1J2XA 1ZHFA 2BEOA 1Z1DA 5TRDA 1Z05A 1S7OA 3FM5A 4M6YA 2DT5A 5E1WA 3WGIA 1ZYRF 3ZMDA 1TQMA 4P9FA 5LHHA 4H0EA 4UUVA 1KQ0A 2K4BA 3H3ZA 5E1ZB 5J6XA 1UB9A 1FZPB 4EJVA 3HOTA 1FBSA 3JSOA 3MEXA 2PN6A 2VT2A 1IXCA 4O5VA 1USSA 4EJOA 3CUQB 1SFXA 4KDPA 1J5YA 5HDKA 2FMLA 1YQAA 3V7CA 3GVAA 2GAUA 4HV5A 1ODDA 4P5OA 3R6SA 4PGHA 4F7ZA 5LHGA 2H6CA 3DF8A 3ZMTA 4G7HF 4OIOF 2A07F 2XV4S 1MJAA 4JK1X 3QRFF 3E6DA 3V8JA 3VFZA 1KYZA 4ZH4F 3MQ0A 5L3EA 2HFHA 2QVOA 1RZ4A 1U5TA 3S2WA 1RNLA 4G7ZF 1XMAA 1R5HA 3BZ6A 4G7OF 5E20A 2FMYA 2X0LA 2RKHA 1TQIA 4ZYGA 3LAPA 2XAGA 1IUYA 1Y0UA 3HRMA 5DDGA 4O6JA 1KQ9A 1R36A 1BIBA 4NHJA 2R7DA 2UXXA 4EQQA 3R0JA 3KFWX 3KZZA 3RJPA 2VXZA 4EV0A 5DCMA 3WTVC 3HSEA 1BI2A 2VE8A 3TKYA 4A6EA 3G3ZA 1FLIA 4GXOA 3KLNA 4RB1A 4LB5A 2KKOA 1ZRFA 1DPRA 2MH9A 4R1HA 4K2EA 4S05A 2HDCA 4LLLA 3RKWA 1YS7A 4ETSA 2JTVA 4M9XA 3J80Z 3RPQA 1BI0A 4ZZDA 5ERIA 1XB4A 3ZN1A 1DDNA 5D4RA 1YW9A 2HTJA 1TTYA 3GUDA 1FSHA 4BQAA 1ONVA 4A6DA 5L3CA 5J8FA 3K9TA 3WU0A 3P9IA 1WI9A 2Q8KA 1XGMA 1S29A 3C1DA 5E8IA 5DCFA 4EJWA 4LD5A 4GYIA 3WTZA 1I6XA 3ZMZA 2M45A 1EH7A 3JTGA 3K69A 2ZMEB 4OMYA 5KK1A 1IN4A 4KN7X 2EA4A 1ZARA 4BHBA 5JFRA 2OZUA 3T0YA 4HLXA 1MJ9A 1LNWA 3V8LA 1W7PA 2GA1A 3G73A 3TO9A 1XN7A 5F6FA 3L00A 1B59A 3EETA 3RKYA 2YSRA 1F9NA 3H92A 3PQKA 3I59B 5JI6A 4I2OA 2XAQA 1RUOA 2FBHA 2ZFWA 1ZN2A 1GXQA 1OYYA 2J5OA 1UHWA 4BH9A 3FM3A 1ZLKA 2HGCA 3BOQA 1OKRA 2FBKA 2M1BA 2UXNA 4G6QA 3BPXA 1F5TA 1GHCA 3NQOA 3I64A 4LLGF 1KGSA 1A04A 5D5VB 3VODA 4B09A 1K78A 3SFZA 1Z9CA 3VEPA 3N4MA 2KIUA 2ACJA 2ISZA 1BC7C 2DK8A 1PUEE 5K1YA 2EV0A 3F72A 4M9ZA 2AS5F 2VT3A 1S6LA 5CJ9A 3LA3A 5AIPA 2BGCA 3EQLF 1WQ2A 1DP7P 2Z5UA 2ZBKA 2CO5A 2K4JA 1MKMA 1H9TA 1FX7A 3L7WA 3WE3A 3GWZA 2AXLA 3IKVA 1D3YA 2MA3A 1XCVA 5D6FA 2FSWA 2PMHA 1AWCA 2MBFA 1I1SA 3E6BA 2IT0A 2OU2A 3D5LA 3B02A 1KYWA 4I0BA 3B73A 3V7SA 4ZYDA 4M72A 3I4PA 1U78A 2FBIA 3MZYA 3CUQC 1XGSA 1T6SA 4L5JA 2OD5A 1YYVA 2EFNA 1SD7A 4RGSA 2HZTA 5FGMA 2CYYA 4CICA 2M87A 2QUFA 2ZO4A 2VONA 1SD5A 2F5EA 4RAYA 1P4AA 4HQMA 4BYYA 2QQ9A 4S04A 1FSEA 1CGPA 4RB3C 1QNTA 3LQRA 1IZ1A 4R79A 3DV8A 1UCRA 5HDGA 2DBBA 3FHZA 4HQEA 1JHHA 1R1VA 5A2QZ 3HOSA 3E97A 3FWEA 2FNPA 1K7AA 2A68F 3KLOA 3IKTA 1JHFA 3QU3A 2UZKA 1G6NA 2G9WA 2OQRA 4I09A 2GXBA 2EFPA 4HYEA 1C0WA 2P6TA 5AONA 2C6YA 4GO1A 4O3MA 1QO0D 3GW2A 3TGNA 3GF2A 4Q47A 3WGHA 5EEGA 4KN4X 3VB2A 1XSDA 4GCVA 4A0YA 4LK0F 4A5NA 3ABTA 2H27A 2FE3A 3R0AA 5HLHA 3TQNA 5BPIA 1LDKB 2L4AA 4I0AA 2IVMA 2BV6A 3I0TA 1ZAOA 2XASA 5ILUA 2HR3A 5FFXA 1MD0A 2A6HF 2IA0A 2IW5A 4MTDA 3KP5A 2H94A 3F8BA 3GO5A 3IRRA 4MEYF 3JSPA 2E7WA 5D8KB 3ISPA 2VC0A 4CDGA 1B1BA 2RNJA 2V79A 2FNAA 3I71A 2LF7A 4UVBA 1EH6A 3ZPLA 5EEHA 4KIBA 3WTTC 4CHUA 1YFHA 3CTAA 2P5LC 3BPVA 2HS5A 2P7CB 3GFMA 1IAWA 1ZRCA 5BQTA 4M6XA 1B4AA 3E6CC 2VBWA 2P5VA 1XSVA 2XRNA 5BOXA 1W7PD 1RIOH 1G3SA 3Q9SA 1TBXA 2BBYA 2GQQA 2P5KA 4KUMA 4TV7A 2ZNZA 1R00A 2ESNA 1ZLJA 5HS7A 1W4MA 1GXPA 3BP8A 1EH8A 2LDUA 4IXAA 4KT5C 4EVIA 2A69F 1LDDA 4L0ZB 3C7JA 2CGPA 4IHSA 1R1UA 4AIHA 4NB5A 1BC8C 4MEXF 3T8TA 2Y48A 4YG2F 5CVIA 2JSCA 4ZZLA 3JAMZ 1FWZA 4U0YA 3GXOA 3T1BA 2Q2EA 2QWWA 4CGZA 3HHHA 3T8RA 5FLXZ 2QENA 3TO6A 2DTRA 5LEJA 1Z91A 2OQGA 1L3LA 4L9JA 2HKXA 2MH2A 2A3SA 2VODA 3JAMK 3NRVA 2K86A 1XDSA 4R8HA 1MZBA 3KP7A 1K6OA 2PMUA 3EYIA 2EA2A 3JTHA 3E3VA 2KIFA 1BI3A 4RGUA 4I02A 2G7UA 2OAZA 1SD6A 3MCZA 1P92A 2MLKA 5BMZA 2ZCWA 5LLQA 4OIPF 3OV8A 1YLFA 2IJLA 2EFWA 1XGNA 2BE5F 1PP7U 1P4WA 2V1XA 1IN8A 2MLGA 4LB6B 3BY6A 1HW1A 3RTRA 5LGUA 1TLHB 5IT9Z 3PQJA 2EJRA 2Y0MA 3SXYA 4RB2C 1FPQA 2P7VB 2W85A 3DPLC 4QWQA 2PFBA 4XSXF 4HOBA 2XROA 4PZJA 1IN7A 1R23A 5DEQA 1FP1D 4IF4A 4UHTA 2A5YB 4OIRF 1Z6TA 4N9IA 1YS6A 4YIIA 4N0BA 2NRAC 2ZMEA 1XGOA 2ETHA 2O6GE 2MC3A 3SZTA 3F22A 2WC2A 2XHKA 2OZ6A 1HQCA 4BAYA 4E70A 4A5MA 2TDXA 5ILSA 4KMUX 4M74A 1IW7F 2CWEA 3I58A 1LQ1A 4DNCA 2DPUA 3F21A 3LQQA 3KE2A 1PDNC 3F6VA 3GFJA 5E18F 1VTNC 1W5SA 3K1PA 5FD6A 2HOEA 5ICCA 5HLGA 3WG9A 1STZA 2XGXA 3GFIA 1ZGAA 1KQ8A 4HF0A 4ENJA 3ECOA 1DUXC 1FOKA 3U2RA 1E2XA 1SFEA 3ECHA 4EMSA 2HEOA 4FT8A 5HLIA 5JHUA 2GIVA 4A2UA 4QLCU 2IA1A 3MWMA 3PFIA 2EK5A 2GA2A 3DFGA 4RGRA 3I54A 3WTUC 4CZZA 4KFCA 2R7FA 3JW4A 1QQIA 3F8FA 1MDMA 3FMSA 5DV5A 1H0MA 1BN5A 1L0OC 4HW0A 4BHCA 1O3TA 2RDPA 2ZKZA 1I5ZA 5ICFA 4LLNA 4WXDA 2CW0F 4HF2A 2XAFA 3O2PE 3I5UA 2DO7A 1BBYA 1FBQA 2PQ8A 4LGWA 3CO7C 3T5XA 2E1NA 2XUBA 2R3SA 3L2CA 4HLYA 1O57A 2QLZA 2YU3A 3DP7A 3M1EA 4HBLA 4OIQF 4CXFA 1KU2A 1FY7A 2DW4A 5D5XB 2F5DA 1R22A 5D4SA 2DI3A 1D8JA 1F4KA 4U7BA 4MHGA 1UHMA 2M5WA 2K27A 3ML6A 1ZRDA 3V8KA 4LK1F 4RAZA 1J75A 5ED4A 4U7DA 5FO5A 4L9VA 4Y13A 1U3EM 2FU4A 1U2WA 2FEZA 5K5QA 5A2QK 2YX4A 5FD5A 2H6BA 4KICA 5DUKA 2V1UA 3R61A 2F2EA 2QQAA 2QZ8A 2CSOA 5DUIA 1FNNA 2W25A 3V4GA 2PEXA 4A12A 2F5CA 2KRFA 3GLXA 4L5IA 5ICGA 3I59A 5HOOA 3WE2A 4KYWA 1B9NA 2G7HA 1FP2A 4M71A 2Z3YA 4G94A 3MZHA 1RI7A 4RB0A 3WTWC 3IWZA 4EJUA 4ZYHA 3K2ZA 2RQPA 1JGSA 3FXUA 4ON0A 2WTEA 3M7GA 4IRIA 1P2FA 5JR3A 3ZMSA 4PCQA 3ELKA 3KETA 3GZ5A 4AIKA 2F5FA 5JVTA 3GYHX 2RC4A 1ZG5A 5E17F 1RUNA 3R60A 3IHUA 5DD4A 3WTSC 4N9HA 1KA8A 2Z99A 2OA4A 4YFKF 1SMYF 3P9CA 1IRGA 1FBUA 3HTSB 1HW5A 1O7LA 2NS0A 3WODF 1TW2A 4YFXF 3J81K 4PDKA 2YX7A 1YO5C 1J7KA 3DQVC 4RGXA 3Q5FA 2O61A 2HYFA 3RDIA 1TNTA 3BJOA 3LA7A 1Z6RA 2L3DA 3D0SA 2LSOA 2H09A 1O3SA 2KJCA 2XKOA 3M9AA 5LGNA 3F8MA 3WU1B 3HSFA 1JE8A 4KNYA 2WV0A 1K79A 2RN7A 3DKWA 2NNNA 5IT9K 2UWMA 4IPAA 3K0LA 3Q9VA 3TDUC 5CVVA 1S3JA 1CF7B 2O0YA 2ELHA 3ZQ7A 3E5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBI A;  3O3K A;  4AIJ A;  1O7F A;  4XBF A;  2RVC A;  4BHP A;  2ZNY A;  4M9S A;  3CUQ A;  2RV8 A;  1TW3 A;  2GWR A;  4L9T A;  4HV6 A;  3MFK A;  5F64 A;  2M8E A;  2LF8 A;  4PGG A;  3TOB A;  5FB2 A;  4OMZ A;  4KIG A;  5HDN A;  4LG0 B;  5CVJ A;  4WK8 F;  2XAJ A;  3E5X A;  3LWF A;  2JRT A;  1IRF A;  4DQ2 A;  3L09 A;  3QP5 A;  4EGZ A;  3K1M A;  4MQV A;  4UV8 A;  2D45 A;  3KEQ A;  4U0W A;  3HRS A;  1WSU A;  1J59 A;  2DQL A;  4GYG A;  1S8N A;  2W24 A;  2QYO A;  2XAH A;  3DPT A;  1UFM A;  3GEZ A;  2FXA A;  5K5O A;  1LJ9 A;  4JQF A;  2DK5 A;  2EFO A;  4G8X A;  2VN2 A;  3MAJ A;  1G3T A;  4Q5S F;  4Y17 A;  1T2K A;  4WX9 A;  3FXQ A;  2KIM A;  2P8T A;  4KA4 A;  3N97 A;  2CQK A;  3OOP A;  1X3U A;  3WTX C;  5J8C A;  1BM9 A;  1P6R A;  4P96 A;  2Y75 A;  1BOA A;  3KP2 A;  3K1N A;  1FYL A;  5CLS A;  1FYM A;  3FMQ A;  1ZRE A;  4ZYE A;  3H3U A;  3TDZ C;  5LGT A;  1FC3 A;  4HZF A;  5K5R A;  1NHA A;  3E6M A;  1T39 A;  5AIQ A;  1IF1 A;  1YIO A;  2HTS A;  1QGP A;  2DAO A;  4XLN F;  4Q4Z F;  3HRT A;  1Q1H A;  2O8X A;  1O3Q A;  1O3R A;  2Z9O A;  4EM0 B;  3QPH A;  1D5V A;  1U8R A;  1W7P B;  4AWX B;  4B8X A;  2HQN A;  2NAZ A;  4U0V A;  1ULY A;  5LHI A;  1LDJ A;  1OYI A;  2FOK A;  2HKO A;  4FHT A;  1G3Y A;  3J80 K;  3HUG A;  5ICE A;  1Z7U A;  1R5G A;  2IPQ X;  3DEU A;  1HBX G;  1OR7 A;  1T98 A;  1PP8 F;  3FZV A;  1BJA A;  6PAX A;  3KCC A;  1HXD A;  4CYD A;  1G4D A;  5D8L B;  3WGG A;  1HKT A;  3QOP A;  2DPD A;  2W84 A;  2M30 A;  2ZXJ A;  5TJJ A;  1IN5 A;  4XSZ F;  2VC1 A;  4UV9 A;  4AVP A;  3GZ6 A;  1KU9 A;  3CUO A;  2W57 A;  1T38 A;  2K7L A;  2V9V A;  4UVA A;  3QP6 A;  1DPU A;  3BRO A;  3O6B B;  1ZGJ A;  4A0Z A;  3ROU A;  4Y15 A;  1D8K A;  2WWY A;  2VBX A;  5H6R A;  2DLL A;  3CLO A;  5L3G A;  2YPR A;  4D0P A;  4XLP F;  1HSJ A;  3F23 A;  5KVR A;  1IN6 A;  1QZZ A;  3LA2 A;  1HST A;  1LEA A;  3GFL A;  3DXJ F;  4HX7 A;  1HKQ A;  1YW7 A;  1QBJ A;  2FF4 A;  3BJ6 A;  4CO8 A;  1BIA A;  2VE9 A;  2V1D A;  4MTE A;  2ESH A;  3SZP A;  1SMT A;  5DCM B;  2EB7 A;  4WCG A;  2B0L A;  2JPC A;  3LFK A;  5HVQ C;  3C3W A;  4EGY A;  5CVU A;  2DU9 A;  2EV6 A;  4Q48 A;  5CYV A;  2V6C A;  2E1C A;  1OMI A;  1T0F A;  2QM3 A;  4ENK A;  4YIF A;  4I01 A;  4UVC A;  2DQR A;  2STW A;  1U6G A;  4OU0 A;  1R1T A;  2VBY A;  4Z2Y A;  2HYG D;  3RPU A;  5H6Q A;  3IL2 A;  3F6O A;  3CJN A;  2JT1 A;  2O03 A;  3F3X A;  1I1G A;  1P4X A;  2Z33 A;  5E8G A;  3RIR A;  2L01 A;  4BNC A;  3U9G A;  3REO A;  4IVN A;  4G9Y A;  3BJA A;  2IP2 A;  3TOA A;  1J0R A;  2EV5 A;  4FX0 A;  2LKP A;  1XMK A;  4HDU A;  1QPM A;  3RYR A;  3J7A O;  5HS8 A;  2ZJ2 A;  3F8C A;  1EV7 A;  2K02 A;  1W5T A;  2KJB A;  4XRF A;  4HF1 A;  1IXR C;  5IT3 A;  4EM2 A;  2L4M A;  1U5T B;  2LNB A;  1HW2 A;  2J5P A;  2XVC A;  4ASN A;  1OPC A;  1H9G A;  5D5U B;  5DD8 A;  2STT A;  1R58 A;  5LBQ A;  2PJP A;  4M73 A;  3HTU A;  4ESF A;  1J9I A;  3E5U A;  4LG0 A;  1ZH5 A;  2VOO A;  1WWX A;  1XSX A;  2A6E F;  4MQ9 F;  4WXC A;  5H20 A;  1TNS A;  1WKM A;  4BXU A;  5L3D A;  1YTY A;  4AD9 A;  4GGG A;  3ABU A;  2XKP A;  3ZMV A;  4OIN F;  3SQN A;  2Q0O A;  2VOP A;  2X4H A;  1UST A;  3FF5 A;  3ZP5 A;  3R4K A;  4YFN F;  5D5W B;  3KZY A;  2QBY B;  1YW8 A;  1HKS A;  4HX8 A;  1LVA A;  1B9M A;  5LEK A;  4KMF A;  4WXH A;  2DFI A;  1AOY A;  4LFU A;  3V7R A;  4NQW A;  1MJB A;  4L18 B;  2VBZ A;  4IRG A;  1I27 A;  1ON2 A;  4MGR A;  1SD4 A;  1LEB A;  5ILV A;  3QAH A;  5L3B A;  3LAJ A;  4OOI A;  3HIF A;  2QBY A;  4I7H A;  1R7J A;  3BWG A;  2FQ3 A;  2ADU A;  4G6D A;  3RI4 A;  5CVR A;  3WTY C;  1S7A A;  1OYW A;  1FYK A;  1V4R A;  3FXR A;  3VOE A;  2D2W A;  2NYX A;  2PLY A;  5BPD A;  1ZG3 A;  4IHT A;  3HRU A;  4JBA A;  1F1Z A;  3QPT A;  2RGV A;  1YG2 A;  5LRS A;  2JPB A;  5FFZ A;  3BDD A;  2FRH A;  1FT9 A;  2EFQ A;  2O3F A;  2YR2 A;  4HDV A;  1ON1 A;  3RYP A;  3FMR A;  2E7X A;  3J81 Z;  1JXS A;  4HAM A;  1QZY A;  2D1V A;  1SAX A;  3I53 A;  2COM A;  3TO7 A;  4ESJ A;  2FA5 A;  1MGT A;  5DYM A;  4ENM A;  3ZMU A;  1E17 A;  3M8F A;  3EYY A;  2NNY A;  2HQR A;  2GZW A;  4L0Y B;  3W6K B;  3CDH A;  3L9F A;  1U5T C;  3IC7 A;  4HA8 A;  4KIF A;  3RKX A;  3C18 A;  1XCB A;  4L9N A;  4LJZ F;  3GX4 X;  1REP C;  1IXS B;  4A0X A;  1BI1 A;  2IA2 A;  4ENN A;  5L3F A;  5HS9 A;  1KU7 A;  1WRJ A;  3COA C;  1CF7 A;  4ESB A;  3QU6 A;  2OBP A;  4WWC A;  1K78 B;  3SHF A;  3P9K A;  2XIG A;  4IRH A;  5E1X A;  3IWF A;  1XDU A;  1GVJ A;  4P55 A;  3U1D A;  1LB2 A;  5FLX K;  2PI0 A;  3KP4 A;  5D6E A;  1V3F A;  4WF2 A;  3EUH A;  2CFX A;  4EM1 A;  2A61 A;  3ULQ B;  3CO6 C;  5LRR A;  1TQP A;  3M8E A;  2JZY A;  2D1H A;  4EJT A;  3IRQ A;  3F8N A;  2IRF G;  3EDP A;  4HX4 A;  2P4W A;  1KU3 A;  4UNO A;  4U88 A;  2MD5 A;  2L54 A;  3LST A;  2ISY A;  3ERE D;  4UXN A;  4FX4 A;  3P7N A;  3NEU A;  3HSR A;  1SFU A;  3FX3 A;  3KEO A;  4MNU A;  2PG4 A;  5BS6 A;  1XD7 A;  1B6A A;  2QQB A;  2L02 A;  3KP6 A;  2GXG A;  3HYI A;  2CG4 A;  1MDM B;  3HHG A;  4LMY A;  5F1R A;  2HWV A;  2BYV E;  4IJA A;  4I98 B;  3W6J B;  2EWN A;  1G3W A;  1ZG1 A;  4RS8 A;  3AAF A;  2P6S A;  4P9U A;  3ZN0 A;  3KP3 A;  1J2X A;  1ZHF A;  2BEO A;  1Z1D A;  5TRD A;  1Z05 A;  1S7O A;  3FM5 A;  4M6Y A;  2DT5 A;  5E1W A;  3WGI A;  1ZYR F;  3ZMD A;  1TQM A;  4P9F A;  5LHH A;  4H0E A;  4UUV A;  1KQ0 A;  2K4B A;  3H3Z A;  5E1Z B;  5J6X A;  1UB9 A;  1FZP B;  4EJV A;  3HOT A;  1FBS A;  3JSO A;  3MEX A;  2PN6 A;  2VT2 A;  1IXC A;  4O5V A;  1USS A;  4EJO A;  3CUQ B;  1SFX A;  4KDP A;  1J5Y A;  5HDK A;  2FML A;  1YQA A;  3V7C A;  3GVA A;  2GAU A;  4HV5 A;  1ODD A;  4P5O A;  3R6S A;  4PGH A;  4F7Z A;  5LHG A;  2H6C A;  3DF8 A;  3ZMT A;  4G7H F;  4OIO F;  2A07 F;  2XV4 S;  1MJA A;  4JK1 X;  3QRF F;  3E6D A;  3V8J A;  3VFZ A;  1KYZ A;  4ZH4 F;  3MQ0 A;  5L3E A;  2HFH A;  2QVO A;  1RZ4 A;  1U5T A;  3S2W A;  1RNL A;  4G7Z F;  1XMA A;  1R5H A;  3BZ6 A;  4G7O F;  5E20 A;  2FMY A;  2X0L A;  2RKH A;  1TQI A;  4ZYG A;  3LAP A;  2XAG A;  1IUY A;  1Y0U A;  3HRM A;  5DDG A;  4O6J A;  1KQ9 A;  1R36 A;  1BIB A;  4NHJ A;  2R7D A;  2UXX A;  4EQQ A;  3R0J A;  3KFW X;  3KZZ A;  3RJP A;  2VXZ A;  4EV0 A;  5DCM A;  3WTV C;  3HSE A;  1BI2 A;  2VE8 A;  3TKY A;  4A6E A;  3G3Z A;  1FLI A;  4GXO A;  3KLN A;  4RB1 A;  4LB5 A;  2KKO A;  1ZRF A;  1DPR A;  2MH9 A;  4R1H A;  4K2E A;  4S05 A;  2HDC A;  4LLL A;  3RKW A;  1YS7 A;  4ETS A;  2JTV A;  4M9X A;  3J80 Z;  3RPQ A;  1BI0 A;  4ZZD A;  5ERI A;  1XB4 A;  3ZN1 A;  1DDN A;  5D4R A;  1YW9 A;  2HTJ A;  1TTY A;  3GUD A;  1FSH A;  4BQA A;  1ONV A;  4A6D A;  5L3C A;  5J8F A;  3K9T A;  3WU0 A;  3P9I A;  1WI9 A;  2Q8K A;  1XGM A;  1S29 A;  3C1D A;  5E8I A;  5DCF A;  4EJW A;  4LD5 A;  4GYI A;  3WTZ A;  1I6X A;  3ZMZ A;  2M45 A;  1EH7 A;  3JTG A;  3K69 A;  2ZME B;  4OMY A;  5KK1 A;  1IN4 A;  4KN7 X;  2EA4 A;  1ZAR A;  4BHB A;  5JFR A;  2OZU A;  3T0Y A;  4HLX A;  1MJ9 A;  1LNW A;  3V8L A;  1W7P A;  2GA1 A;  3G73 A;  3TO9 A;  1XN7 A;  5F6F A;  3L00 A;  1B59 A;  3EET A;  3RKY A;  2YSR A;  1F9N A;  3H92 A;  3PQK A;  3I59 B;  5JI6 A;  4I2O A;  2XAQ A;  1RUO A;  2FBH A;  2ZFW A;  1ZN2 A;  1GXQ A;  1OYY A;  2J5O A;  1UHW A;  4BH9 A;  3FM3 A;  1ZLK A;  2HGC A;  3BOQ A;  1OKR A;  2FBK A;  2M1B A;  2UXN A;  4G6Q A;  3BPX A;  1F5T A;  1GHC A;  3NQO A;  3I64 A;  4LLG F;  1KGS A;  1A04 A;  5D5V B;  3VOD A;  4B09 A;  1K78 A;  3SFZ A;  1Z9C A;  3VEP A;  3N4M A;  2KIU A;  2ACJ A;  2ISZ A;  1BC7 C;  2DK8 A;  1PUE E;  5K1Y A;  2EV0 A;  3F72 A;  4M9Z A;  2AS5 F;  2VT3 A;  1S6L A;  5CJ9 A;  3LA3 A;  5AIP A;  2BGC A;  3EQL F;  1WQ2 A;  1DP7 P;  2Z5U A;  2ZBK A;  2CO5 A;  2K4J A;  1MKM A;  1H9T A;  1FX7 A;  3L7W A;  3WE3 A;  3GWZ A;  2AXL A;  3IKV A;  1D3Y A;  2MA3 A;  1XCV A;  5D6F A;  2FSW A;  2PMH A;  1AWC A;  2MBF A;  1I1S A;  3E6B A;  2IT0 A;  2OU2 A;  3D5L A;  3B02 A;  1KYW A;  4I0B A;  3B73 A;  3V7S A;  4ZYD A;  4M72 A;  3I4P A;  1U78 A;  2FBI A;  3MZY A;  3CUQ C;  1XGS A;  1T6S A;  4L5J A;  2OD5 A;  1YYV A;  2EFN A;  1SD7 A;  4RGS A;  2HZT A;  5FGM A;  2CYY A;  4CIC A;  2M87 A;  2QUF A;  2ZO4 A;  2VON A;  1SD5 A;  2F5E A;  4RAY A;  1P4A A;  4HQM A;  4BYY A;  2QQ9 A;  4S04 A;  1FSE A;  1CGP A;  4RB3 C;  1QNT A;  3LQR A;  1IZ1 A;  4R79 A;  3DV8 A;  1UCR A;  5HDG A;  2DBB A;  3FHZ A;  4HQE A;  1JHH A;  1R1V A;  5A2Q Z;  3HOS A;  3E97 A;  3FWE A;  2FNP A;  1K7A A;  2A68 F;  3KLO A;  3IKT A;  1JHF A;  3QU3 A;  2UZK A;  1G6N A;  2G9W A;  2OQR A;  4I09 A;  2GXB A;  2EFP A;  4HYE A;  1C0W A;  2P6T A;  5AON A;  2C6Y A;  4GO1 A;  4O3M A;  1QO0 D;  3GW2 A;  3TGN A;  3GF2 A;  4Q47 A;  3WGH A;  5EEG A;  4KN4 X;  3VB2 A;  1XSD A;  4GCV A;  4A0Y A;  4LK0 F;  4A5N A;  3ABT A;  2H27 A;  2FE3 A;  3R0A A;  5HLH A;  3TQN A;  5BPI A;  1LDK B;  2L4A A;  4I0A A;  2IVM A;  2BV6 A;  3I0T A;  1ZAO A;  2XAS A;  5ILU A;  2HR3 A;  5FFX A;  1MD0 A;  2A6H F;  2IA0 A;  2IW5 A;  4MTD A;  3KP5 A;  2H94 A;  3F8B A;  3GO5 A;  3IRR A;  4MEY F;  3JSP A;  2E7W A;  5D8K B;  3ISP A;  2VC0 A;  4CDG A;  1B1B A;  2RNJ A;  2V79 A;  2FNA A;  3I71 A;  2LF7 A;  4UVB A;  1EH6 A;  3ZPL A;  5EEH A;  4KIB A;  3WTT C;  4CHU A;  1YFH A;  3CTA A;  2P5L C;  3BPV A;  2HS5 A;  2P7C B;  3GFM A;  1IAW A;  1ZRC A;  5BQT A;  4M6X A;  1B4A A;  3E6C C;  2VBW A;  2P5V A;  1XSV A;  2XRN A;  5BOX A;  1W7P D;  1RIO H;  1G3S A;  3Q9S A;  1TBX A;  2BBY A;  2GQQ A;  2P5K A;  4KUM A;  4TV7 A;  2ZNZ A;  1R00 A;  2ESN A;  1ZLJ A;  5HS7 A;  1W4M A;  1GXP A;  3BP8 A;  1EH8 A;  2LDU A;  4IXA A;  4KT5 C;  4EVI A;  2A69 F;  1LDD A;  4L0Z B;  3C7J A;  2CGP A;  4IHS A;  1R1U A;  4AIH A;  4NB5 A;  1BC8 C;  4MEX F;  3T8T A;  2Y48 A;  4YG2 F;  5CVI A;  2JSC A;  4ZZL A;  3JAM Z;  1FWZ A;  4U0Y A;  3GXO A;  3T1B A;  2Q2E A;  2QWW A;  4CGZ A;  3HHH A;  3T8R A;  5FLX Z;  2QEN A;  3TO6 A;  2DTR A;  5LEJ A;  1Z91 A;  2OQG A;  1L3L A;  4L9J A;  2HKX A;  2MH2 A;  2A3S A;  2VOD A;  3JAM K;  3NRV A;  2K86 A;  1XDS A;  4R8H A;  1MZB A;  3KP7 A;  1K6O A;  2PMU A;  3EYI A;  2EA2 A;  3JTH A;  3E3V A;  2KIF A;  1BI3 A;  4RGU A;  4I02 A;  2G7U A;  2OAZ A;  1SD6 A;  3MCZ A;  1P92 A;  2MLK A;  5BMZ A;  2ZCW A;  5LLQ A;  4OIP F;  3OV8 A;  1YLF A;  2IJL A;  2EFW A;  1XGN A;  2BE5 F;  1PP7 U;  1P4W A;  2V1X A;  1IN8 A;  2MLG A;  4LB6 B;  3BY6 A;  1HW1 A;  3RTR A;  5LGU A;  1TLH B;  5IT9 Z;  3PQJ A;  2EJR A;  2Y0M A;  3SXY A;  4RB2 C;  1FPQ A;  2P7V B;  2W85 A;  3DPL C;  4QWQ A;  2PFB A;  4XSX F;  4HOB A;  2XRO A;  4PZJ A;  1IN7 A;  1R23 A;  5DEQ A;  1FP1 D;  4IF4 A;  4UHT A;  2A5Y B;  4OIR F;  1Z6T A;  4N9I A;  1YS6 A;  4YII A;  4N0B A;  2NRA C;  2ZME A;  1XGO A;  2ETH A;  2O6G E;  2MC3 A;  3SZT A;  3F22 A;  2WC2 A;  2XHK A;  2OZ6 A;  1HQC A;  4BAY A;  4E70 A;  4A5M A;  2TDX A;  5ILS A;  4KMU X;  4M74 A;  1IW7 F;  2CWE A;  3I58 A;  1LQ1 A;  4DNC A;  2DPU A;  3F21 A;  3LQQ A;  3KE2 A;  1PDN C;  3F6V A;  3GFJ A;  5E18 F;  1VTN C;  1W5S A;  3K1P A;  5FD6 A;  2HOE A;  5ICC A;  5HLG A;  3WG9 A;  1STZ A;  2XGX A;  3GFI A;  1ZGA A;  1KQ8 A;  4HF0 A;  4ENJ A;  3ECO A;  1DUX C;  1FOK A;  3U2R A;  1E2X A;  1SFE A;  3ECH A;  4EMS A;  2HEO A;  4FT8 A;  5HLI A;  5JHU A;  2GIV A;  4A2U A;  4QLC U;  2IA1 A;  3MWM A;  3PFI A;  2EK5 A;  2GA2 A;  3DFG A;  4RGR A;  3I54 A;  3WTU C;  4CZZ A;  4KFC A;  2R7F A;  3JW4 A;  1QQI A;  3F8F A;  1MDM A;  3FMS A;  5DV5 A;  1H0M A;  1BN5 A;  1L0O C;  4HW0 A;  4BHC A;  1O3T A;  2RDP A;  2ZKZ A;  1I5Z A;  5ICF A;  4LLN A;  4WXD A;  2CW0 F;  4HF2 A;  2XAF A;  3O2P E;  3I5U A;  2DO7 A;  1BBY A;  1FBQ A;  2PQ8 A;  4LGW A;  3CO7 C;  3T5X A;  2E1N A;  2XUB A;  2R3S A;  3L2C A;  4HLY A;  1O57 A;  2QLZ A;  2YU3 A;  3DP7 A;  3M1E A;  4HBL A;  4OIQ F;  4CXF A;  1KU2 A;  1FY7 A;  2DW4 A;  5D5X B;  2F5D A;  1R22 A;  5D4S A;  2DI3 A;  1D8J A;  1F4K A;  4U7B A;  4MHG A;  1UHM A;  2M5W A;  2K27 A;  3ML6 A;  1ZRD A;  3V8K A;  4LK1 F;  4RAZ A;  1J75 A;  5ED4 A;  4U7D A;  5FO5 A;  4L9V A;  4Y13 A;  1U3E M;  2FU4 A;  1U2W A;  2FEZ A;  5K5Q A;  5A2Q K;  2YX4 A;  5FD5 A;  2H6B A;  4KIC A;  5DUK A;  2V1U A;  3R61 A;  2F2E A;  2QQA A;  2QZ8 A;  2CSO A;  5DUI A;  1FNN A;  2W25 A;  3V4G A;  2PEX A;  4A12 A;  2F5C A;  2KRF A;  3GLX A;  4L5I A;  5ICG A;  3I59 A;  5HOO A;  3WE2 A;  4KYW A;  1B9N A;  2G7H A;  1FP2 A;  4M71 A;  2Z3Y A;  4G94 A;  3MZH A;  1RI7 A;  4RB0 A;  3WTW C;  3IWZ A;  4EJU A;  4ZYH A;  3K2Z A;  2RQP A;  1JGS A;  3FXU A;  4ON0 A;  2WTE A;  3M7G A;  4IRI A;  1P2F A;  5JR3 A;  3ZMS A;  4PCQ A;  3ELK A;  3KET A;  3GZ5 A;  4AIK A;  2F5F A;  5JVT A;  3GYH X;  2RC4 A;  1ZG5 A;  5E17 F;  1RUN A;  3R60 A;  3IHU A;  5DD4 A;  3WTS C;  4N9H A;  1KA8 A;  2Z99 A;  2OA4 A;  4YFK F;  1SMY F;  3P9C A;  1IRG A;  1FBU A;  3HTS B;  1HW5 A;  1O7L A;  2NS0 A;  3WOD F;  1TW2 A;  4YFX F;  3J81 K;  4PDK A;  2YX7 A;  1YO5 C;  1J7K A;  3DQV C;  4RGX A;  3Q5F A;  2O61 A;  2HYF A;  3RDI A;  1TNT A;  3BJO A;  3LA7 A;  1Z6R A;  2L3D A;  3D0S A;  2LSO A;  2H09 A;  1O3S A;  2KJC A;  2XKO A;  3M9A A;  5LGN A;  3F8M A;  3WU1 B;  3HSF A;  1JE8 A;  4KNY A;  2WV0 A;  1K79 A;  2RN7 A;  3DKW A;  2NNN A;  5IT9 K;  2UWM A;  4IPA A;  3K0L A;  3Q9V A;  3TDU C;  5CVV A;  1S3J A;  1CF7 B;  2O0Y A;  2ELH A;  3ZQ7 A;  3E5Q A; 
#chains in the Genus database with same CATH topology
 3RQI A;  3SEZ A;  4CYC A;  2PBI A;  3O3K A;  4AIJ A;  1O7F A;  4L5E A;  4XBF A;  3ABK H;  1ETW A;  2RVC A;  3HB9 A;  2F4I A;  2M34 A;  3AG4 H;  4BHP A;  2ZNY A;  1ETQ A;  1OR7 C;  4M9S A;  4HPQ A;  3CUQ A;  1GV5 A;  1VQK I;  1POG A;  2RV8 A;  1XTA A;  1TW3 A;  2GWR A;  1X4P A;  4L9T A;  3QOD A;  1JJ8 C;  2IGN A;  4HV6 A;  3M07 A;  2K3P A;  3CCY A;  1WJF A;  5F64 A;  2M8E A;  3MFK A;  3OYB A;  5DM7 F;  2DFH A;  2FJ1 A;  2LF8 A;  5C4J J;  2BY0 A;  4PGG A;  3TOB A;  2VKD A;  1HA8 A;  3SDG A;  5FB2 A;  2VJI A;  1YRN B;  4OMZ A;  4KIG A;  5HDN A;  4LG0 B;  5FRM A;  5CVJ A;  4WK8 F;  2XAJ A;  3E5X A;  1IDY A;  3LWF A;  1RET A;  2E35 A;  2JRT A;  1EKE A;  1IRF A;  3B6A A;  4JX4 A;  4DQ2 A;  3L09 A;  1PUF A;  1ERD A;  3QP5 A;  4EGZ A;  2IXS A;  3K1M A;  4MQV A;  2DTZ A;  4UV8 A;  4YEL A;  2D45 A;  3BR2 A;  1JUM A;  2HZD A;  3IH3 A;  2KQR A;  2Y0S N;  3KEQ A;  4ZDL A;  3H9G A;  4U0W A;  3HRS A;  1KZH A;  3FK7 A;  1WSU A;  1J59 A;  2DQL A;  3BTI A;  2RRE A;  1RR7 A;  3OMY A;  4GYG A;  2BY2 A;  1MNE A;  1S8N A;  2W24 A;  2QYO A;  3Q0W A;  2V6E A;  4C30 A;  1YJW I;  2JSP A;  2XAH A;  3HGY A;  3DPT A;  2CJJ A;  1R71 A;  4KT6 A;  2E2J J;  1UFM A;  3GEZ A;  2FXA A;  2BOL A;  3HPH A;  4PJJ A;  5K5O A;  1LJ9 A;  1WGX A;  4RDU A;  4JQF A;  2DK5 A;  4ANJ A;  2EFO A;  2V4J C;  2N8G A;  4G8X A;  3JRH A;  5C4X J;  2VN2 A;  3MAJ A;  5FKL A;  1N78 A;  5M5Y J;  3OYL A;  1I39 A;  1G3T A;  2JK3 A;  4IOA F;  3I4N J;  2E19 A;  4Q5S F;  2ZME C;  4Y17 A;  4X1E A;  4NC8 A;  2QCO A;  1T2K A;  4WX9 A;  3FXQ A;  5IYB J;  2KIM A;  2P8T A;  4ZJZ A;  1W36 D;  3CJR B;  4KA4 A;  3N97 A;  5B1B H;  1JTX A;  2CQK A;  4LG3 A;  3OOP A;  1X3U A;  2L9N A;  3NAR A;  3WTX C;  5J8C A;  3L2R A;  1BM9 A;  1VQ9 I;  3W6V A;  3OL4 A;  2Z2S B;  1IUF A;  1P6R A;  4P96 A;  2Y75 A;  1BOA A;  1MBK A;  4X6A J;  3KP2 A;  3K1N A;  3H0D A;  2VI6 A;  3RPU D;  3BCA A;  1FYL A;  3AG3 H;  5CLS A;  1FYM A;  3S15 J;  3FMQ A;  1ZRE A;  4ZYE A;  3BR6 A;  3H3U A;  3TDZ C;  4IHX A;  4I76 A;  2I10 A;  5LGT A;  1FC3 A;  4HZF A;  5E79 C;  5K5R A;  1NHA A;  3E6M A;  2OUM A;  1T39 A;  5AIQ A;  1LPQ A;  1IF1 A;  1RES A;  1YIO A;  5EYR A;  2HTS A;  1QGP A;  3HKZ N;  2DA6 A;  3K4J A;  2DAO A;  5FKM A;  4QPO A;  4XLN F;  4Q4Z F;  2HOS A;  1OJL A;  1JUP A;  3HRT A;  3TW6 A;  1Q1H A;  2O8X A;  1JT0 A;  1ZK8 A;  1O3Q A;  1O3R A;  2Z9O A;  5GP9 A;  1MMN A;  2ECB A;  3K4C A;  2M0C A;  1ZKG A;  4EM0 B;  3QPH A;  1W0T A;  1XC5 A;  1D5V A;  1UHS A;  1U8R A;  1W7P B;  4AWX B;  4BJ5 C;  4XOP A;  4B8X A;  1WVR A;  2HQN A;  3Q0V A;  3LOC A;  2NAZ A;  4U0V A;  5GTI C;  1ULY A;  1OCR H;  3K10 A;  2CRG A;  3DTI A;  3M8J A;  5LHI A;  3LSI A;  3HL2 A;  1LDJ A;  1FJL A;  4BY7 J;  1OYI A;  2FOK A;  2HKO A;  4CYC B;  4FHT A;  4Y52 J;  1G3Y A;  3J80 K;  3HUG A;  5DS9 A;  4RM3 A;  2DA2 A;  2LBF A;  5ICE A;  1Z7U A;  2WB1 N;  1R5G A;  2IPQ X;  3DEU A;  4A3F J;  1HBX G;  3HC7 A;  4BGD A;  1MSF C;  1OR7 A;  1T98 A;  1PP8 F;  3FZV A;  1IV6 A;  3HDD A;  2EZK A;  2DXI A;  1BJA A;  2JA8 J;  4HNV A;  6PAX A;  3KCC A;  1HXD A;  2QSG X;  1B8I A;  2CW7 A;  4XLF A;  2EIN H;  4CCM A;  4CYD A;  4E7S A;  1G4D A;  5D8L B;  3WGG A;  1HKT A;  4UB6 C;  3A2K A;  4JX6 A;  3QOP A;  2DPD A;  2W84 A;  3M4O J;  2M30 A;  2ZXJ A;  1V5E A;  2V1N A;  5TJJ A;  1IN5 A;  2LR8 A;  4XSZ F;  4Y7N J;  1V5F A;  3PJR A;  2VC1 A;  2VB6 A;  4FET A;  4UV9 A;  1WI3 A;  4AVP A;  3GZ6 A;  1KU9 A;  1RKT A;  3FIW A;  4BAC A;  3CUO A;  2JJ7 A;  4UUS B;  2W57 A;  1MBG A;  1D1A A;  1T38 A;  2O7O A;  1X1D A;  2K7L A;  3LSH A;  2V9V A;  1R49 A;  4UVA A;  1H8A C;  4E7K A;  4CSW A;  2BY1 A;  5DM6 F;  3QP6 A;  5J40 A;  1DPU A;  2GOX B;  2DYR H;  3BR1 A;  3BRO A;  3O6B B;  1ZGJ A;  2DMN A;  4A0Z A;  3ROU A;  3QWL A;  1VF9 A;  4Y15 A;  4NC6 A;  1D8K A;  2WWY A;  3A0B C;  4AYB N;  2VBX A;  3EUH C;  2OCC H;  4BDZ A;  3MKL A;  5FRN A;  5H6R A;  2DLL A;  3CLO A;  3ZQF A;  3L2V A;  3CF5 F;  5L3G A;  2YPR A;  4D0P A;  3HM5 A;  4XLP F;  1HSJ A;  2R7S A;  3F23 A;  2ECC A;  5KVR A;  5M3M J;  1IN6 A;  2K3F A;  1B8I B;  4UUT A;  5KAF C;  4FE4 A;  3LSM A;  1QZZ A;  1YX3 A;  3LA2 A;  2BXZ A;  1HC8 A;  1KON A;  1HST A;  1LEA A;  3GFL A;  3HGG A;  1ZR2 A;  3DXJ F;  5M3F J;  3OL3 A;  3K6G A;  4HX7 A;  1HKQ A;  2LG4 A;  3QQA A;  1YW7 A;  1R4M B;  1QBJ A;  2FF4 A;  3BJ6 A;  4CO8 A;  1BIA A;  1WJ5 A;  2VE9 A;  2V1D A;  2JN6 A;  4MTE A;  5GAH J;  2ESH A;  1VQM I;  2KZV A;  3GTM J;  3SZP A;  1Z67 A;  2JVG A;  4CCK A;  1SMT A;  5DCM B;  2EB7 A;  3CP2 A;  3G2B A;  3RSN A;  4WCG A;  2B0L A;  2JPC A;  3LFK A;  2LK2 A;  5HVQ C;  3C3W A;  2ID6 A;  2HOA A;  4EGY A;  4IQJ A;  1V55 H;  1IDZ A;  5CVU A;  2DU9 A;  3DWL E;  2EV6 A;  2Q2E B;  2EZI A;  1EJ9 A;  4Q48 A;  5CYV A;  1D0X A;  1AU7 A;  2V6C A;  2E1C A;  2GM4 A;  1OMI A;  4BQQ A;  1BR4 A;  1K6Y A;  3I55 I;  1T0F A;  3CDI A;  2QM3 A;  1W0U A;  1D0Z A;  1SVL A;  4ENK A;  2HVS A;  4YIF A;  4I01 A;  3K4K A;  4UVC A;  5CQG A;  2W1O A;  3BG9 A;  2DCE A;  2DQR A;  2BW3 A;  2DA4 A;  2STW A;  1U6G A;  4CCN A;  3I56 I;  3QYF A;  1MH4 A;  1GUU A;  4OU0 A;  1R1T A;  4XM3 A;  2VBY A;  4Z2Y A;  2HYG D;  3RPU A;  3MN2 A;  5H6Q A;  3IL2 A;  1A5J A;  3F6O A;  4IX7 A;  1JUS A;  3CJN A;  2QSF X;  2HPI A;  2FD5 A;  2W00 A;  3CF2 A;  1QZE A;  2JT1 A;  2O03 A;  2M9H A;  1I1G A;  1P4X A;  3F3X A;  2LBF B;  3SZG A;  1SFO J;  3CJT B;  2Z33 A;  5E8G A;  4NBQ A;  3RIR A;  5B66 C;  2L01 A;  3S3N A;  4XK4 A;  3FXM A;  4CCO A;  1TWG J;  3DBL B;  4BNC A;  3U9G A;  4D9J A;  3REO A;  5E3O A;  3BT9 A;  2FX0 A;  1R4N B;  3OYC A;  4IVN A;  4G9Y A;  3BJA A;  2IP2 A;  4A3L J;  3TOA A;  1J0R A;  2EV5 A;  4FIS A;  4FX0 A;  3RKQ A;  2LKP A;  3BG5 A;  1XMK A;  4HDU A;  1QPM A;  1TP4 A;  4M3F A;  1ZQ3 P;  3GTK J;  4IEJ A;  2NS8 A;  1B72 A;  2M7A A;  1JKQ C;  3RYR A;  3CCJ I;  1X1C A;  3H9J A;  3J7A O;  5HS8 A;  4XID A;  4DBR A;  4D5C A;  2D5V A;  2ZJ2 A;  1FTZ A;  3F8C A;  3ZR8 X;  1GVD A;  3G1M A;  4QTR A;  1XPX A;  1EV7 A;  5F08 A;  2K02 A;  3PUF A;  4AC0 A;  1VQ7 I;  4A3C J;  1W5T A;  2KJB A;  4XRF A;  4HF1 A;  1IXR C;  2L4M A;  4EM2 A;  5IT3 A;  1U5T B;  2LNB A;  1HW2 A;  3UNG C;  2J5P A;  2XVC A;  4ASN A;  1OPC A;  3TL4 X;  3S3M A;  3FHN A;  1H9G A;  2DYS H;  3QPS A;  4QIW N;  5D5U B;  1HF0 A;  2DOE A;  5DD8 A;  2STT A;  1R58 A;  4FE7 A;  5LBQ A;  2PJP A;  4M6V A;  2VJ4 A;  4S0H B;  3TP0 A;  4GFB A;  1S9H A;  4M73 A;  3HTU A;  4ESF A;  1J9I A;  2GLO A;  3E5U A;  1NTC A;  4LG0 A;  1MBE A;  1ZH5 A;  2VOO A;  2ZSH B;  3BZK A;  1WWX A;  1XSX A;  2A6E F;  4MQ9 F;  2NXN B;  4WXC A;  5H20 A;  1TNS A;  3L1P A;  1WKM A;  1JT6 A;  4BXU A;  1LE8 A;  5L3D A;  4RAG A;  3KZI C;  1YTY A;  4AD9 A;  2R4G A;  4BU2 A;  4GGG A;  3ABU A;  5J1U A;  1DU6 A;  1UZC A;  2XKP A;  3ZMV A;  2VLA A;  1ZGW A;  4OIN F;  3JRI A;  2E60 A;  3SQN A;  2Q0O A;  3K4B A;  2VOP A;  2X4H A;  1UST A;  3FF5 A;  2CH0 A;  3ZP5 A;  2DN0 A;  3R4K A;  4YFN F;  1ZR4 A;  5D5W B;  4YRV A;  3KZY A;  3PNV A;  2QBY B;  3A4C A;  1YW8 A;  1HKS A;  2RNG A;  4HX8 A;  3W2A A;  4A3J J;  3CC2 I;  2R7U A;  3IP4 B;  1LVA A;  2Z1D A;  2PMZ N;  1B9M A;  5LEK A;  4KMF A;  5FLM J;  4WXH A;  2DFI A;  4E7H A;  1AOY A;  4BE0 A;  4LFU A;  3V7R A;  1QHG A;  4Y3O A;  3HEF A;  4MO7 A;  4NQW A;  1MJB A;  4L18 B;  1OIS A;  1ENH A;  2BHY A;  1GLN A;  2MD0 A;  5LD2 C;  2VBZ A;  1YRN A;  1XG1 A;  4IRG A;  4XKB A;  4F91 B;  2W7N A;  1JKO C;  4NDL A;  5TIS C;  1WJA A;  1I27 A;  3IUO A;  4UY8 I;  1JGG A;  1ON2 A;  4MGR A;  1SD4 A;  4ZTJ A;  1LEB A;  4BUP A;  2P0W A;  4IL6 C;  2IS1 A;  5ILV A;  3LSJ A;  3QAH A;  5L3B A;  3LAJ A;  4NNJ A;  4OOI A;  3HIF A;  1T95 A;  2BW3 B;  5B5E C;  2QBY A;  4JYK A;  4I7H A;  2M4G A;  1R7J A;  5B1A H;  3BWG A;  1APL C;  2XSJ C;  2FQ3 A;  2ADU A;  4G6D A;  3RI4 A;  5CVR A;  1D0Y A;  3WTY C;  1S7A A;  2V9P A;  3A03 A;  4CUG A;  3VPR A;  2ZFU A;  2R7T A;  1OYW A;  3DTK A;  1FYK A;  3S1M J;  1V4R A;  4B47 A;  3FXR A;  3VOE A;  2D2W A;  2NYX A;  2GOM A;  5K7H A;  2PLY A;  1R5I D;  4CCL A;  2L9V A;  3GTL J;  5BPD A;  1ZG3 A;  2JA5 J;  4IHT A;  4Y33 A;  3HRU A;  2W82 A;  4JBA A;  3ZQQ A;  1F1Z A;  2GIZ A;  1K83 J;  3QPT A;  2RGV A;  1YG2 A;  2PJR A;  2HVQ A;  5KHD A;  2CUE A;  1YOV B;  5LRS A;  2JPB A;  3OYN A;  2QF7 A;  5FFZ A;  1WJB A;  3BDD A;  2LC2 A;  3HBL A;  2FRH A;  1FT9 A;  2EFQ A;  3MD2 A;  3FXK A;  2WAD A;  2O3F A;  2LP0 A;  2YR2 A;  4HDV A;  3C2B A;  4Y4R A;  1ON1 A;  3ASN H;  3RYP A;  5JLW A;  3FMR A;  2E7X A;  4XMY A;  1RC9 A;  2DT7 B;  2L7Z A;  3J81 Z;  1JXS A;  4HAM A;  2HQA A;  1QZY A;  2D1V A;  4E7J A;  1GV2 A;  3FK6 A;  2E36 A;  1SAX A;  3I53 A;  1MND A;  2NOJ B;  2XGC A;  2COM A;  3FKI J;  3TO7 A;  2ZJR F;  4ESJ A;  3DEE A;  2FA5 A;  1MGT A;  5J4Y A;  5DYM A;  4ENM A;  4A3I J;  4OAZ A;  3VSK A;  3ZMU A;  1E17 A;  3M8F A;  3BR0 A;  4DYR A;  3EYY A;  4IHV A;  3CCR I;  2NNY A;  2HQR A;  3CC4 I;  2GZW A;  4L0Y B;  3W6K B;  2XF7 A;  2DFE A;  3CDH A;  3L9F A;  3TW7 A;  4B43 A;  3E1S A;  2DFF A;  2MC4 A;  3PM1 A;  4IOC F;  1U5T C;  2CV1 A;  3IC7 A;  4HA8 A;  1ORK A;  4KIF A;  2WBM A;  3RKX A;  3C18 A;  3BG3 A;  1XCB A;  4L9N A;  4LJZ F;  3GX4 X;  1A35 A;  1REP C;  1IXS B;  4F3Q A;  4A0X A;  3ZQC A;  4ZDP A;  1BI1 A;  1BW5 A;  1D1C A;  2IA2 A;  4ENN A;  2KDO A;  3AL0 C;  2HXO A;  2G0E A;  3C2H A;  3CLQ A;  2VQH A;  5L3F A;  5HS9 A;  1ZEL A;  3TP3 A;  4P1W A;  3OYD A;  1KU7 A;  1WRJ A;  3COA C;  3GTG J;  1W1W E;  3HZJ A;  1CF7 A;  4ESB A;  1VQN I;  4M3E A;  3QU6 A;  2R5Z B;  2MYS A;  2OBP A;  4WWC A;  1K78 B;  3SHF A;  2K40 A;  4BBS J;  3P9K A;  2XIG A;  4IRH A;  5E1X A;  2VQC A;  2KL4 A;  3FXO A;  3IWF A;  5EDN A;  1XDU A;  2LRD A;  2WAQ A;  1GVJ A;  4ZTF A;  4P55 A;  1HDD C;  3M3Y J;  3U1D A;  5GTH C;  1LB2 A;  2ELK A;  3JRD A;  4DIQ A;  5FLX K;  4HEA 2;  2PI0 A;  3VYS B;  3HOU J;  1X4O A;  3KP4 A;  5D6E A;  5JLX A;  3E0J B;  1OCO H;  3A01 A;  5J1Y A;  4V2F A;  3SFI A;  1V3F A;  5C44 J;  3VDX A;  1NG7 A;  2X6Y A;  3EUH A;  1OCP A;  4WF2 A;  4A3B J;  2CFX A;  2QKL B;  4EM1 A;  3F0C A;  2A61 A;  3ULQ B;  3I9V 2;  2AHQ A;  1T0F C;  4RLF A;  1HOM A;  3CO6 C;  5LRR A;  1TQP A;  3M8E A;  2JZY A;  1SAU A;  3CCQ I;  3OYG A;  2D1H A;  4EJT A;  1T8I A;  3SDB A;  3IRQ A;  2DDA A;  2DMQ A;  3F8N A;  2QGU A;  2IRF G;  3EDP A;  4F93 B;  3KYC B;  4HX4 A;  4YIR X;  2P4W A;  5IP7 J;  1KU3 A;  4UNO A;  4U88 A;  2MD5 A;  1TT5 B;  5TGT A;  2E2H J;  2L54 A;  3LST A;  3OYH A;  5J1R A;  2ISY A;  3P5J A;  3BTJ A;  3ERE D;  5FKN A;  2X6X A;  2H8R A;  2KLO A;  2UV1 A;  4UXN A;  1I3A A;  4FX4 A;  2VIX A;  3P7N A;  3NEU A;  3HSR A;  3EUA A;  1FEX A;  1K4S A;  3OYF A;  2V26 A;  1SFU A;  1ETY A;  1TT0 A;  3FX3 A;  5DTD A;  3KEO A;  2CUZ A;  4MNU A;  2PG4 A;  3LFU A;  4E7I A;  5BS6 A;  1ETV A;  1XD7 A;  3OS0 A;  1B6A A;  2QQB A;  3OWT A;  2M8G X;  2L02 A;  3KP6 A;  2GXG A;  5J47 A;  5EGO A;  3HYI A;  2AXT C;  2CG4 A;  1MDM B;  3HHG A;  2ZB9 A;  4LMY A;  5F1R A;  2HWV A;  2BYV E;  1PYV A;  2YUS A;  4IJA A;  2E1O A;  4I98 B;  3W6J B;  1Y1W J;  2EWN A;  3HUG B;  4HST A;  4XRS A;  1G3W A;  1ZG1 A;  3JRE A;  4RS8 A;  3L2W A;  3AAF A;  4B3X A;  2P6S A;  4P9U A;  3ZN0 A;  3BG7 A;  4C3I J;  3CZ6 A;  4BJT A;  3KP3 A;  2TRT A;  1J2X A;  1ZHF A;  1SFK A;  2ZXI A;  4RBO A;  1ACI A;  4OWR B;  2BEO A;  1Z1D A;  5TRD A;  1Z05 A;  1S7O A;  3FM5 A;  4FAS D;  1SC7 A;  4M6Y A;  2DT5 A;  5E1W A;  3WGI A;  1ZYR F;  3ZMD A;  1TQM A;  1MBH A;  2E34 A;  4P9F A;  4D7M A;  5LHH A;  2CW8 A;  2E71 A;  5BNG A;  2M7B A;  4PJM A;  4H0E A;  4UUV A;  1KQ0 A;  2K4B A;  3WG7 H;  2LOO A;  2MG4 A;  3H3Z A;  3I4M J;  4NUB A;  2EIM H;  5E1Z B;  5J6X A;  1UB9 A;  5EF6 A;  1FZP B;  2COB A;  1UMQ A;  4EJV A;  3OS2 A;  4XOR A;  1X19 A;  3HOT A;  1FBS A;  2LLK A;  3JSO A;  2B63 J;  2FQ4 A;  3SYT A;  3H36 A;  3FXJ A;  3MEX A;  2R7W A;  3CD6 I;  2PN6 A;  3VSL A;  2VT2 A;  1DQU A;  2EQR A;  3A02 A;  3V42 A;  2L7M P;  1IG7 A;  1IXC A;  4AVZ A;  4BEH B;  3S3O A;  5EG0 A;  4O5V A;  1USS A;  4XLE A;  4EJO A;  2NS7 A;  4GDF A;  3CUQ B;  1VQ6 I;  1SFX A;  4KDP A;  1J5Y A;  5HDK A;  2FML A;  1WH5 A;  1YQA A;  3V7C A;  4A3E J;  3GVA A;  2LY9 A;  1UG2 A;  3H5R A;  2VKE A;  2AO9 A;  2GAU A;  2Z16 A;  3AL0 B;  4BBR J;  4HV5 A;  1ODD A;  4P5O A;  5EEA A;  2Q1Z B;  3GLL A;  4AUX A;  3ERM A;  2VKV A;  1Y56 A;  2XGE A;  5F27 A;  1IGN A;  2MSY A;  3R6S A;  4PGH A;  1S5L C;  4F7Z A;  5LHG A;  2H6C A;  3DF8 A;  3ZMT A;  4G7H F;  4OIO F;  2A07 F;  3GBG A;  3LNQ A;  2Y9Y A;  2XV4 S;  2BVM A;  1MJA A;  3H1C A;  4ZC3 A;  5K7F A;  4BQO A;  4JK1 X;  4RMN A;  3QRF F;  2HOT A;  3AFH A;  3E6D A;  3V8J A;  3KIO A;  3VFZ A;  1KYZ A;  2KIS A;  4ZH4 F;  3MQ0 A;  1F36 A;  3E7L A;  5L3E A;  2HFH A;  2QVO A;  1RZ4 A;  2XPV A;  5FLV A;  2ELJ A;  2VPL A;  1U5T A;  3S2W A;  1PUF B;  1RNL A;  4G7Z F;  2DA5 A;  1E0E A;  4JOM A;  1XMA A;  2TCT A;  1R5H A;  3BZ6 A;  4XOT A;  4G7O F;  1UJ8 A;  5E20 A;  4C9Y A;  4BY1 J;  3RZO J;  2FMY A;  2X0L A;  2A5W A;  2RKH A;  1O4X A;  1TQI A;  2E2I J;  1TWF J;  2VKH A;  2NVT J;  4IO9 F;  4ZYG A;  1AKH B;  5GPA A;  3LAP A;  2XAG A;  2K5C A;  1IUY A;  1Y0U A;  3HRM A;  2EZH A;  5DDG A;  4O6J A;  2CQX A;  1KQ9 A;  1R36 A;  2IGK A;  4RA2 A;  4FTH A;  1OCC H;  1BIB A;  4HSR A;  1B72 B;  1Y8Q B;  4NHJ A;  1TL8 A;  1I50 J;  3RCO A;  5GAG J;  2R7D A;  2UXX A;  4EQQ A;  4RM2 A;  5GPC A;  1Z3Y A;  2UUZ A;  3R0J A;  1LFB A;  3KFW X;  1JI8 A;  3KZZ A;  4MFD A;  3A1Y A;  3HXL A;  2X85 A;  1LVK A;  3RJP A;  2R5Y B;  3BR5 A;  4HRI A;  1T33 A;  3J7Z I;  2VXZ A;  4EV0 A;  5DCM A;  3WTV C;  1LFP A;  3HSE A;  1BI2 A;  2VE8 A;  3TKY A;  4F55 A;  2CUF A;  3O8H A;  3HG9 A;  2H1K A;  3QYB A;  4A6E A;  3G3Z A;  2LMD A;  1FLI A;  4Z6Y A;  1WJE A;  1WJC A;  4GXO A;  2F48 A;  3N05 A;  3KLN A;  4RB1 A;  4LB5 A;  2KKO A;  1ZRF A;  1DPR A;  2KZG A;  2MH9 A;  4R1H A;  2DA1 A;  5KNL A;  1T08 B;  2MGQ A;  4K2E A;  4F92 B;  2L5Q A;  4S05 A;  2HDC A;  3ABM H;  5F04 A;  2L2O A;  4I6Z A;  4LLL A;  1DP3 A;  5J4V A;  4DGW B;  3RKW A;  1YS7 A;  4ETS A;  2JTV A;  3MKZ A;  4M9X A;  4NC7 A;  3RPQ A;  3J80 Z;  1BI0 A;  4ZZD A;  5ERI A;  3M1C A;  2CU7 A;  2M0M A;  1XB4 A;  1OCT C;  4B48 A;  1GDT A;  3ZN1 A;  1DDN A;  4FQG A;  5D4R A;  1YW9 A;  2EIJ H;  2HTJ A;  1MBJ A;  1TTY A;  3GUD A;  1A6I A;  2L0K A;  1FSH A;  2H1L A;  4BQA A;  1ONV A;  4A6D A;  5L3C A;  5J8F A;  3FXL A;  4XKW A;  3RQ4 A;  4DYQ A;  2BVL A;  3K9T A;  3WU0 A;  1YIT I;  1Z21 A;  1HLV A;  3S1R J;  3P9I A;  5FKK A;  4EEF G;  4X0G A;  1WI9 A;  2Q8K A;  5EJC A;  1XGM A;  1S29 A;  3C1D A;  3ZOB A;  5E8I A;  3CC7 I;  5DCF A;  2ZXH A;  2KMU A;  4EJW A;  4LD5 A;  4GYI A;  3WTZ A;  3CMM A;  1I6X A;  1G59 A;  4ITV A;  3OY9 A;  3ZMZ A;  2M3A A;  2M45 A;  1XX5 A;  4PSX A;  1UAA A;  1EH7 A;  2VQL A;  2LFB A;  4LIV A;  3SEQ A;  2HVR A;  2EZL A;  3U21 A;  4PK4 A;  3JTG A;  3K69 A;  2ZME B;  3GTP J;  4OMY A;  2IS2 A;  5KK1 A;  1S72 I;  2OTL I;  1IN4 A;  2L9S A;  4KN7 X;  3W3C A;  2XF6 A;  1NK2 P;  2EA4 A;  1ZAR A;  4BHB A;  3VYR B;  5JFR A;  2WY8 Q;  2BZT A;  2OZU A;  3T0Y A;  4PJ0 C;  4HLX A;  1MJ9 A;  1LNW A;  3V8L A;  1XMX A;  5LFA A;  1YI2 I;  3DTE A;  1V54 H;  1W7P A;  2GA1 A;  3C2G A;  1VQ5 I;  4IHW A;  1QU3 A;  2GXA A;  3G73 A;  2MW8 A;  3CMA I;  3TO9 A;  1XN7 A;  1MBF A;  3KPH A;  4N4N B;  5F6F A;  4EAT A;  5EZH A;  3L00 A;  4PJL A;  1B59 A;  9ANT A;  3EET A;  4J19 A;  3ZQH A;  3RKY A;  2YSR A;  4UUS A;  1F9N A;  3H92 A;  3PNT A;  3PQK A;  3I59 B;  5JI6 A;  2EIL H;  4I2O A;  3NAU A;  2XAQ A;  3TMO A;  1RUO A;  2FBH A;  2ZFW A;  5IY5 H;  4I99 C;  1ZN2 A;  1GXQ A;  1OYY A;  1DU0 A;  2J5O A;  1UHW A;  4BH9 A;  3FM3 A;  1UEL B;  2EH3 A;  1ZLK A;  2E1M C;  2A6T A;  3DLL F;  2HGC A;  3BOQ A;  1ETX A;  1OKR A;  2VQG A;  2FBK A;  2M1B A;  2X51 A;  2BHZ A;  2UXN A;  5FKO A;  3PSF A;  1Y8R B;  4QPQ A;  4G6Q A;  3BPX A;  1F5T A;  1GHC A;  3NQO A;  3I64 A;  4LLG F;  4FCY A;  1KGS A;  4PFP A;  4UB8 C;  2HNH A;  1A04 A;  3OYE A;  5D5V B;  2P81 A;  3G1L A;  2KFD A;  2RAE A;  3VOD A;  4B09 A;  1K61 A;  2R5Z A;  3OS1 A;  4BE1 A;  1K78 A;  3SFZ A;  1Z9C A;  3VEP A;  3N4M A;  2KIU A;  2ACJ A;  4AU7 A;  2LTP A;  2ISZ A;  1X3Z B;  1BC7 C;  2DK8 A;  1TWA J;  1PUE E;  5K1Y A;  2EV0 A;  3F72 A;  1Z77 A;  4M9Z A;  2AS5 F;  2ZXW H;  2LVS A;  1N77 A;  3K2A A;  2VT3 A;  1S6L A;  3QYE A;  5CJ9 A;  3LA3 A;  5AIP A;  2BGC A;  3EQL F;  1WQ2 A;  1MNM C;  1DP7 P;  4C3J J;  2XB5 A;  2WAF A;  2Z5U A;  3JRF A;  3LSK A;  2ZBK A;  1VQP I;  2CO5 A;  2R93 J;  2K4J A;  1MKM A;  1H9T A;  1AHD P;  2JUG A;  1FX7 A;  1PJR A;  3L7W A;  3WE3 A;  1A36 A;  1ZTR A;  3EPZ A;  3GWZ A;  2AXL A;  2NVQ J;  2YU9 J;  3IKV A;  1D3Y A;  2MA3 A;  1XCV A;  3W2V A;  4XL9 A;  5D6F A;  3SJM A;  2FSW A;  2PMH A;  2ZC2 A;  3GZN B;  1AWC A;  2MBF A;  3PNY A;  1I1S A;  2IEK A;  2M2E A;  3E6B A;  2IT0 A;  2OU2 A;  4XQF A;  3D5L A;  3B02 A;  2R0Q C;  1KYW A;  3CCS I;  1LUJ B;  2HXI A;  3KYD B;  1MMS A;  4XIC A;  2DA3 A;  1MMD A;  4I0B A;  4YEJ A;  3B73 A;  3V7S A;  3ESW B;  4M72 A;  4ZYD A;  2VXD A;  3I4P A;  1U78 A;  2FBI A;  3MZY A;  3CUQ C;  4G12 A;  1XGS A;  3AKZ A;  4M3D A;  1T6S A;  4A3M J;  4N4O B;  4L5J A;  2OD5 A;  2KDZ A;  1YYV A;  2EFN A;  1JKP C;  1I6H J;  1SD7 A;  3VYT B;  3H9Q A;  4RGS A;  2HZT A;  4IHY A;  1WHU A;  5FGM A;  2LH9 A;  1GT0 C;  2CYY A;  1RR8 C;  4CIC A;  2M87 A;  2QUF A;  2ZO4 A;  2EIK H;  2VON A;  2JA6 J;  2F5V A;  1IO2 A;  1SD5 A;  1V5G A;  4IZZ A;  4C2M J;  1R6R A;  2HU9 A;  2F5E A;  4RAY A;  1P4A A;  4RLQ A;  4BKX A;  4HQM A;  2RQQ A;  2LYC A;  2QQ9 A;  4BYY A;  3S1N J;  4S04 A;  1JJ6 C;  1TWH J;  2DOF A;  2XB0 X;  5B3S H;  2QQ8 A;  1FSE A;  3DEW A;  4RB3 C;  1CGP A;  1QNT A;  3LQR A;  1IZ1 A;  4R79 A;  1OCZ H;  3H3V K;  4BXX J;  3DV8 A;  1UCR A;  1M1E B;  5HDG A;  1Z0X A;  2DBB A;  3FHZ A;  3CES A;  3NWT A;  2PX9 A;  1JHH A;  2LY2 A;  4HQE A;  1R1V A;  4KIT B;  5E3L A;  4OAY A;  3PL8 A;  1WFX A;  2I8D A;  2R7O A;  5A2Q Z;  1NK3 P;  1VQL I;  4RAF A;  3HOS A;  3J7A Y;  3E97 A;  2ME6 A;  2W48 A;  2QEX I;  2ZJQ F;  3FWE A;  3IV5 A;  2FNP A;  2HDW A;  2LKX A;  3PO3 J;  2CQQ A;  2DDB A;  3H5A A;  1K7A A;  2A68 F;  2L7K A;  3KLO A;  1OQY A;  2LKS A;  2OPT A;  4HG2 A;  3IKT A;  4A3D J;  2CMP A;  1P7I A;  3BLY A;  1JHF A;  3QU3 A;  2UZK A;  1G6N A;  1WCM J;  2G9W A;  2R7Z J;  1BW6 A;  2OQR A;  2X1E A;  1CQT A;  3DKX A;  2JRM A;  4I09 A;  2GXB A;  4CCJ A;  2EFP A;  4HYE A;  1BJZ A;  1C0W A;  3ZQL A;  2P6T A;  5AON A;  2C6Y A;  4XR6 A;  4GO1 A;  4O3M A;  3CCU I;  1QO0 D;  4B4C A;  3GW2 A;  3TGN A;  3GF2 A;  5IPA A;  1X1A A;  5IOZ A;  4Q47 A;  1IRX A;  2CV0 A;  3F9K A;  3WGH A;  3OSF A;  5EEG A;  4KN4 X;  2QSH X;  5CQE A;  1X3W B;  1E3O C;  4LIU A;  4XRM A;  2KRC A;  3VB2 A;  4PUS A;  5IYC J;  2H27 A;  3OIO A;  3JRC A;  3BTL A;  5HNH A;  1XSD A;  4GCV A;  3A01 B;  4A0Y A;  4LK0 F;  2CQ7 A;  2DMT A;  4A5N A;  3ABT A;  4IQ4 A;  4M3B A;  4U87 A;  4BL0 B;  2MAB A;  2FE3 A;  3BZC A;  3R0A A;  3TQN A;  5HLH A;  5BPI A;  1LDK B;  2L4A A;  3ZXS A;  4I0A A;  3DU5 A;  2F4O B;  3DBR B;  2IVM A;  2BV6 A;  3I0T A;  1ZAO A;  4BEH A;  2XAS A;  5F0F A;  5ILU A;  2Y30 A;  2HR3 A;  4PJN A;  5FFX A;  1MD0 A;  2KHM A;  1BOB A;  4ZDO A;  2A6H F;  2IA0 A;  4XN0 A;  2IW5 A;  4LOC A;  3OYA A;  5HOD A;  3OYJ A;  2KRH A;  3KP5 A;  4MTD A;  2H94 A;  3F8B A;  3GO5 A;  3ZQG A;  3IRR A;  2ME0 A;  4MEY F;  4DBQ A;  3JSP A;  1JTY A;  2Y2Z A;  2E7W A;  2HQ5 A;  5M5X J;  3NWS A;  5D8K B;  3ISP A;  1HDP A;  2VC0 A;  4CDG A;  1B1B A;  2RNJ A;  3BC8 A;  2QKM B;  2V79 A;  1E3H A;  2ICW G;  2FNA A;  3Q0U A;  4AM3 A;  2K9S A;  3I71 A;  3L2U A;  2LF7 A;  4UVB A;  1EH6 A;  2HDD A;  4F52 A;  3ZPL A;  3QOE A;  5EEH A;  4KIB A;  1VQO I;  1BR1 A;  3WTT C;  4KJZ A;  1FMV A;  4CHU A;  1YFH A;  3CTA A;  2P5L C;  2JWT A;  4W97 A;  3BPV A;  2HS5 A;  5CPR B;  3UR3 C;  1IRZ A;  1D1B A;  3Q3S A;  1IJW C;  1U0J A;  2P7C B;  3GFM A;  3LSR A;  2DOA A;  1IAW A;  3HOY J;  1ZRC A;  5BQT A;  4M6X A;  5IP9 J;  4AYB A;  4JX5 A;  3I3L A;  1B4A A;  3E6C C;  1N75 A;  2VBW A;  1BR2 A;  4G6T B;  2P5V A;  3FBN B;  3OYI A;  1XSV A;  4A3G J;  2XRN A;  5BOX A;  1W7P D;  1RIO H;  1G3S A;  3Q9S A;  4A3K J;  1TBX A;  4PFO A;  3S2D J;  3S17 J;  2VJ5 A;  2BBY A;  2VPR A;  1Z3X A;  2GQQ A;  3FKJ A;  2KIQ A;  2P5K A;  4KUM A;  4TV7 A;  4C3H J;  2ZNZ A;  2ZJP F;  3WU2 C;  3H5N A;  1R00 A;  3JRA A;  2ESN A;  1ZLJ A;  4MIM A;  5HS7 A;  1U9O A;  1XS9 A;  1VQ4 I;  1W4M A;  1DGW Y;  1GXP A;  3BP8 A;  3DBH B;  3S14 J;  1EH8 A;  2LDU A;  4IXA A;  4BJ6 C;  4KT5 C;  2K9N A;  4EVI A;  2A69 F;  1LDD A;  2R92 J;  4L0Z B;  5C3E J;  3C7J A;  2CGP A;  4IHS A;  1R1U A;  4AIH A;  4NB5 A;  3GTO J;  3BCB A;  1BC8 C;  4AID A;  3KYL A;  5JVG F;  2HI3 A;  4MEX F;  3T8T A;  2Y48 A;  3CJQ B;  4YG2 F;  3RZD J;  2GBY A;  3HPG A;  3VWB A;  5CVI A;  3L2Q A;  2JSC A;  4ZZL A;  3HOW J;  5M5W J;  3JAM Z;  2EPF A;  2KP6 A;  1FWZ A;  2EBI A;  3ZRG A;  4U0Y A;  1A6Q A;  3GXO A;  3T1B A;  1MSE C;  2Q2E A;  2CS3 A;  3MMY B;  2QWW A;  2XPW A;  4CGZ A;  3BQY A;  3JCU C;  3HHH A;  3T8R A;  2XC7 A;  2CUJ A;  5FLX Z;  2QEN A;  3TO6 A;  2DTR A;  5LEJ A;  2R7R A;  1Z91 A;  3D1N I;  2WV1 A;  2OQG A;  1L3L A;  1I3Q J;  2CV2 A;  2DT6 A;  4L9J A;  1AA7 A;  1G8X A;  1Q1V A;  2HKX A;  2MH2 A;  2A3S A;  2QA4 I;  2VOD A;  3JAM K;  4II2 A;  1P7J A;  3NRV A;  3CME I;  2K86 A;  1QPI A;  1U8B A;  3CCL I;  5HLT A;  1XDS A;  4R8H A;  1MZB A;  2K9L A;  3BG6 A;  3D5S C;  3KP7 A;  1OFC X;  3CMY A;  1K6O A;  2PMU A;  3EYI A;  2EA2 A;  3JTH A;  3E3V A;  2KIF A;  1X1B A;  1BI3 A;  2XDV A;  3HKZ A;  3OIQ A;  4RGU A;  1S7E A;  2Y9Z A;  4XON A;  4I02 A;  2G7U A;  1N25 A;  2OAZ A;  1FTT A;  2X1C A;  3FBI B;  5FJ8 J;  4JP0 A;  1SD6 A;  3S93 A;  2JUC A;  3S8P A;  3MCZ A;  2E5Z A;  1QHH D;  1P92 A;  2MLK A;  3GME A;  2F6C A;  5BMZ A;  2JA7 J;  2ZCW A;  3ONQ A;  5LLQ A;  4OIP F;  3LSG A;  3OV8 A;  1YLF A;  2IJL A;  2CFO A;  1QA6 A;  2EFW A;  1XGN A;  2BE5 F;  2NVX J;  2AQF A;  1PP7 U;  3FDY A;  1P4W A;  4BXF A;  2O9L A;  2V1X A;  3QPL A;  1IN8 A;  1SVO A;  5F1J A;  2MLG A;  2OCE A;  2HYJ A;  1D5Y A;  4LB6 B;  3BY6 A;  2M4K A;  4BDY A;  1HW1 A;  3RTR A;  3MVP A;  5LGU A;  1TLH B;  5IT9 Z;  3G6E I;  1HCR A;  3PQJ A;  3K4M A;  1F43 A;  2EJR A;  2Y0M A;  4II3 A;  3SXY A;  2HPM A;  4RB2 C;  1RPW A;  5F0C A;  5K7Z A;  1FPQ A;  2P7V B;  2W85 A;  3DPL C;  3ZQI A;  4QWQ A;  3MKY B;  4A69 C;  2PFB A;  2BXY A;  2IS4 A;  4V19 K;  4XSX F;  4HOB A;  5HNF A;  2XRO A;  4PZJ A;  1IN7 A;  1R23 A;  2DJI A;  2PMZ A;  2WAQ N;  5DEQ A;  4ABZ A;  3K70 D;  1FP1 D;  2WAE A;  4IF4 A;  4UHT A;  3HOZ J;  2VL8 A;  4XNF A;  2A5Y B;  4OIR F;  1VI0 A;  1Z6T A;  1X1P A;  4N9I A;  4J01 A;  3W2W A;  5GAD J;  3K4L A;  1YS6 A;  4YII A;  4N0B A;  2DJN A;  3G4S I;  2NRA C;  2ZME A;  1XGO A;  3IAM 2;  2PJR B;  2ETH A;  2DA7 A;  2O6G E;  2MC3 A;  3SZT A;  3F22 A;  2WC2 A;  2XHK A;  2X6O A;  1IV8 A;  3IAS 2;  2BY3 A;  4KIS A;  2DMP A;  2AQE A;  2MFZ A;  2OZ6 A;  5IOY A;  3G71 I;  2JMW A;  1HQC A;  4BAY A;  4E70 A;  4A5M A;  4HNT A;  2TDX A;  1Z7L A;  5ILS A;  5E3N A;  1YHQ I;  3KEY A;  4KMU X;  4M74 A;  5E3M A;  1IW7 F;  3ZCO A;  4B1R A;  3OR1 C;  1FOX A;  2CWE A;  3I58 A;  3OSG A;  3PFY A;  4W1U A;  2XSD C;  1LQ1 A;  1FIA A;  4DNC A;  2DPU A;  3F21 A;  1T56 A;  2R7Q A;  3LQQ A;  2W4S A;  3KE2 A;  4XLC A;  3F6V A;  1PDN C;  5JHF A;  3GFJ A;  2Y31 A;  3HOV J;  3ZGK A;  2NVY J;  1VFC A;  3H0G J;  2JVH A;  5E18 F;  2R7X A;  1VTN C;  3JRB A;  1W5S A;  3IH4 A;  4ZYA A;  3K1P A;  2XGD A;  3WHC A;  4A93 J;  5FD6 A;  4CZC A;  2HOE A;  5ICC A;  1NH3 A;  1TWC J;  5HLG A;  3WG9 A;  1STZ A;  2XGX A;  3ASO H;  3CDL A;  3GFI A;  1UG0 A;  2K85 A;  1YE9 A;  5GAE J;  1ZGA A;  1KQ8 A;  1MH3 A;  4HF0 A;  1LFU P;  4ENJ A;  3ECO A;  1DUX C;  1FOK A;  3U2R A;  1E2X A;  2I5U A;  1SFE A;  3ECH A;  2V7F A;  4EMS A;  3E5Q A;  2HEO A;  4FT8 A;  3ABL H;  1FOY A;  2F4M B;  2FUG 2;  5HLI A;  3OYM A;  5JHU A;  2GIV A;  4A2U A;  1E3P A;  4QLC U;  4QSH A;  4V2G A;  4E7L A;  2IA1 A;  3MWM A;  3PFI A;  3OIP A;  4J00 A;  1Y1V J;  5CKT A;  2XPU A;  3LL7 A;  3MKW B;  1OLT A;  2JA2 A;  2EK5 A;  2VJJ A;  2GA2 A;  3DFG A;  1VQ8 I;  4XLH A;  3CCM I;  2DOD A;  4RGR A;  1J09 A;  4BQN A;  3TED A;  2OTJ I;  3I54 A;  1QRY A;  4CA0 A;  1EF4 A;  1FOW A;  3EUK L;  4E4H A;  3WTU C;  4CZZ A;  1MW7 A;  1LE8 B;  4C2T A;  4KFC A;  3KX2 A;  2O8K A;  2R7F A;  3JW4 A;  1QQI A;  2Y0S A;  3F8F A;  1MDM A;  3FMS A;  4XLA A;  5DV5 A;  4LIT A;  2VUM J;  3PIO F;  2B7E A;  1H0M A;  1BN5 A;  2L9R A;  2KT0 A;  3B6C A;  3CQZ J;  1L0O C;  3CP8 A;  3AG1 H;  4HW0 A;  4BHC A;  3U1K A;  1Y6I A;  1O3T A;  2IGM A;  5EG0 B;  2RDP A;  2Y69 H;  2ZKZ A;  1I5Z A;  2X1D A;  5ICF A;  1H88 C;  4LLN A;  2WA0 A;  3OYK A;  4WXD A;  3BTC A;  2CW0 F;  3S16 J;  2XAU A;  4HF2 A;  2XAF A;  3O2P E;  3I5U A;  2DO7 A;  1TC3 C;  1BBY A;  1P9Q C;  1FBQ A;  3TBI A;  2PQ8 A;  4LGW A;  3CO7 C;  2IBD A;  3S32 A;  3T5X A;  1ETO A;  2E1N A;  2OF7 A;  2XUB A;  4D1Q A;  2WB1 A;  2K9M A;  2R3S A;  3FIS A;  3L2C A;  4HLY A;  2X48 A;  1O57 A;  2L7F P;  2QLZ A;  5J3L A;  2YU3 A;  4XN3 A;  2WY7 Q;  3DP7 A;  3PIP F;  5EGO B;  1A31 A;  3M1E A;  4HBL A;  3GCM A;  4OIQ F;  3HJE A;  4E6K G;  3PSI A;  4CXF A;  1KU2 A;  1FY7 A;  3OOU A;  2DW4 A;  2XF5 A;  4HNU A;  1LKX A;  2DMU A;  1RRJ A;  5D5X B;  3S2H J;  3GTJ J;  1YJN I;  1W36 C;  2F5D A;  1R22 A;  3MZ8 A;  5F0H A;  5D4S A;  2DI3 A;  1D8J A;  1QVT A;  1F4K A;  1U9N A;  2VAS A;  1K4T A;  4DZP A;  4U7B A;  2JQ7 A;  4MHG A;  1UHM A;  3LMM A;  5EZG A;  2M5W A;  2K27 A;  3CCE I;  3ML6 A;  2XRL A;  1ZRD A;  3V8K A;  4LK1 F;  4RAZ A;  4B3A A;  3UKG A;  1PVE A;  1J75 A;  5ED4 A;  3GTQ J;  4U7D A;  5FO5 A;  1H89 C;  3DLA A;  3BQZ A;  1TZL A;  4L9V A;  4Y13 A;  3CCV I;  1U3E M;  2FU4 A;  1U2W A;  2NVU B;  2X6W A;  2FEZ A;  2E5N A;  5K5Q A;  5A2Q K;  3VYU B;  2OV7 A;  1X2N A;  4DZJ A;  1DGR M;  2YX4 A;  2H6B A;  2ZSI B;  3O8G A;  4KIC A;  4XKV A;  2KPM A;  5DUK A;  5FD5 A;  2V1U A;  3R61 A;  4MLO A;  2F2E A;  2QQA A;  4DOZ A;  2QZ8 A;  4IKF A;  1VND A;  1YIJ I;  1X58 A;  2CSO A;  5DUI A;  1FNN A;  2W25 A;  3V4G A;  2PEX A;  2E1M B;  4DJA A;  4A12 A;  2F5C A;  2KRF A;  3GLX A;  4L5I A;  5ICG A;  3I59 A;  5HOO A;  3WHB A;  3WE2 A;  3A0H C;  4D5F A;  4KYW A;  1B9N A;  3DU6 A;  1Y39 A;  4D7N A;  2G7H A;  2IS6 A;  2CQN A;  3S1Q J;  1MMA A;  4XKC A;  1FP2 A;  1EA3 A;  1FIP A;  3OR2 C;  3J7Y J;  4M71 A;  2Z3Y A;  4CH7 A;  3K70 C;  2OC6 A;  4G94 A;  3MZH A;  1RI7 A;  1ITY A;  4RB0 A;  3HOX J;  3WTW C;  3IWZ A;  4BS9 A;  4EJU A;  5H2F C;  4ZYH A;  1FMW A;  3K2Z A;  3PO2 J;  2RQP A;  1Y0N A;  2OJE D;  1YJ9 I;  1JGS A;  3FXU A;  4H4K C;  2X9D A;  4ON0 A;  1YX5 A;  2YS9 A;  2WTE A;  3M7G A;  4IRI A;  1P2F A;  1G2H A;  1SAN A;  5JR3 A;  3ZMS A;  4PCQ A;  4MFE A;  2V9K A;  2H8W A;  3D5R C;  4PSW A;  3ELK A;  4XRS G;  3KET A;  2FOW A;  3GZ5 A;  3IH2 A;  1SEU A;  4AIK A;  2F5F A;  2O5R A;  5JVT A;  2LRE A;  3GYH X;  1MIJ A;  2RC4 A;  1ZG5 A;  5FRO A;  3JR9 A;  5E17 F;  1RUN A;  4C2U A;  2LY1 A;  3R60 A;  3IHU A;  1R9T J;  2A05 A;  3X2Q H;  2R5Y A;  5IYD J;  5DD4 A;  3WTS C;  5IP6 A;  4GRI A;  4N9H A;  2B9S A;  1KA8 A;  2Z99 A;  2OA4 A;  4YFK F;  1SMY F;  3ZQ7 A;  3P9C A;  5KAI C;  1IRG A;  3DKY A;  1FBU A;  3HTS B;  1HW5 A;  1O7L A;  2NS0 A;  3WOD F;  1TW2 A;  4YFX F;  4DYC A;  3J81 K;  4PDK A;  3JRG A;  2IGO A;  4M3G A;  2ID3 A;  2YX7 A;  1W5C C;  4DW6 A;  1ETK A;  1YO5 C;  1J7K A;  3DQV C;  3DPU A;  4RGX A;  1QVU A;  1WJD A;  3Q5F A;  2O61 A;  2IAI A;  2HYF A;  3RDI A;  1TNT A;  3BJO A;  1WPK A;  1NG6 A;  1VZ0 A;  1WH7 A;  1Z6R A;  3LA7 A;  2R7V A;  1IC8 A;  2L3D A;  2K9Q A;  3K7A J;  3D0S A;  4B44 A;  2LSO A;  1AKH A;  4NQW B;  5KCM A;  2H09 A;  3K4N A;  3DCF A;  4BE2 A;  1O3S A;  2KJC A;  2XKO A;  3M9A A;  3PUB A;  5LGN A;  3F8M A;  3LSP A;  1SVM A;  3WU1 B;  3HSF A;  1JE8 A;  3G1O A;  4KNY A;  2WV0 A;  1K79 A;  2RN7 A;  3DKW A;  2NNN A;  5IT9 K;  2UWM A;  4IPA A;  3K0L A;  1BA5 A;  3Q9V A;  1RKW A;  3TDU C;  2LD5 A;  2NOG A;  5CVV A;  3BR3 A;  1X2M A;  1S3J A;  2O0Y A;  1CF7 B;  2ELH A;  1JKR C;  1MMG A;  1BL0 A;  1WZ2 A;  3AG2 H;  4E7Z A;  3H35 A; 
#chains in the Genus database with same CATH homology
 2PBI A;  3O3K A;  4AIJ A;  1O7F A;  4XBF A;  2RVC A;  4BHP A;  2ZNY A;  4M9S A;  3CUQ A;  2RV8 A;  1TW3 A;  2GWR A;  4L9T A;  4HV6 A;  3MFK A;  5F64 A;  2M8E A;  2LF8 A;  4PGG A;  3TOB A;  5FB2 A;  4OMZ A;  4KIG A;  5HDN A;  4LG0 B;  5CVJ A;  4WK8 F;  2XAJ A;  3E5X A;  3LWF A;  2JRT A;  1IRF A;  4DQ2 A;  3L09 A;  3QP5 A;  4EGZ A;  3K1M A;  4MQV A;  4UV8 A;  2D45 A;  3KEQ A;  4U0W A;  3HRS A;  1WSU A;  1J59 A;  2DQL A;  4GYG A;  1S8N A;  2W24 A;  2QYO A;  2XAH A;  3DPT A;  1UFM A;  3GEZ A;  2FXA A;  5K5O A;  1LJ9 A;  4JQF A;  2DK5 A;  2EFO A;  4G8X A;  2VN2 A;  3MAJ A;  1G3T A;  4Q5S F;  4Y17 A;  1T2K A;  4WX9 A;  3FXQ A;  2KIM A;  2P8T A;  4KA4 A;  3N97 A;  2CQK A;  3OOP A;  1X3U A;  3WTX C;  5J8C A;  1BM9 A;  1P6R A;  4P96 A;  2Y75 A;  1BOA A;  3KP2 A;  3K1N A;  1FYL A;  5CLS A;  1FYM A;  3FMQ A;  1ZRE A;  4ZYE A;  3H3U A;  3TDZ C;  5LGT A;  1FC3 A;  4HZF A;  5K5R A;  1NHA A;  3E6M A;  1T39 A;  5AIQ A;  1IF1 A;  1YIO A;  2HTS A;  1QGP A;  2DAO A;  4XLN F;  4Q4Z F;  3HRT A;  1Q1H A;  2O8X A;  1O3Q A;  1O3R A;  2Z9O A;  4EM0 B;  3QPH A;  1D5V A;  1U8R A;  1W7P B;  4AWX B;  4B8X A;  2HQN A;  2NAZ A;  4U0V A;  1ULY A;  5LHI A;  1LDJ A;  1OYI A;  2FOK A;  2HKO A;  4FHT A;  1G3Y A;  3J80 K;  3HUG A;  5ICE A;  1Z7U A;  1R5G A;  2IPQ X;  3DEU A;  1HBX G;  1OR7 A;  1T98 A;  1PP8 F;  3FZV A;  1BJA A;  6PAX A;  3KCC A;  1HXD A;  4CYD A;  1G4D A;  5D8L B;  3WGG A;  1HKT A;  3QOP A;  2DPD A;  2W84 A;  2M30 A;  2ZXJ A;  5TJJ A;  1IN5 A;  4XSZ F;  2VC1 A;  4UV9 A;  4AVP A;  3GZ6 A;  1KU9 A;  3CUO A;  2W57 A;  1T38 A;  2K7L A;  2V9V A;  4UVA A;  3QP6 A;  1DPU A;  3BRO A;  3O6B B;  1ZGJ A;  4A0Z A;  3ROU A;  4Y15 A;  1D8K A;  2WWY A;  2VBX A;  5H6R A;  2DLL A;  3CLO A;  5L3G A;  2YPR A;  4D0P A;  4XLP F;  1HSJ A;  3F23 A;  5KVR A;  1IN6 A;  1QZZ A;  3LA2 A;  1HST A;  1LEA A;  3GFL A;  3DXJ F;  4HX7 A;  1HKQ A;  1YW7 A;  1QBJ A;  2FF4 A;  3BJ6 A;  4CO8 A;  1BIA A;  2VE9 A;  2V1D A;  4MTE A;  2ESH A;  3SZP A;  1SMT A;  5DCM B;  2EB7 A;  4WCG A;  2B0L A;  2JPC A;  3LFK A;  5HVQ C;  3C3W A;  4EGY A;  5CVU A;  2DU9 A;  2EV6 A;  4Q48 A;  5CYV A;  2V6C A;  2E1C A;  1OMI A;  1T0F A;  2QM3 A;  4ENK A;  4YIF A;  4I01 A;  4UVC A;  2DQR A;  2STW A;  1U6G A;  4OU0 A;  1R1T A;  2VBY A;  4Z2Y A;  2HYG D;  3RPU A;  5H6Q A;  3IL2 A;  3F6O A;  3CJN A;  2JT1 A;  2O03 A;  3F3X A;  1I1G A;  1P4X A;  2Z33 A;  5E8G A;  3RIR A;  2L01 A;  4BNC A;  3U9G A;  3REO A;  4IVN A;  4G9Y A;  3BJA A;  2IP2 A;  3TOA A;  1J0R A;  2EV5 A;  4FX0 A;  2LKP A;  1XMK A;  4HDU A;  1QPM A;  3RYR A;  3J7A O;  5HS8 A;  2ZJ2 A;  3F8C A;  1EV7 A;  2K02 A;  1W5T A;  2KJB A;  4XRF A;  4HF1 A;  1IXR C;  5IT3 A;  4EM2 A;  2L4M A;  1U5T B;  2LNB A;  1HW2 A;  2J5P A;  2XVC A;  4ASN A;  1OPC A;  1H9G A;  5D5U B;  5DD8 A;  2STT A;  1R58 A;  5LBQ A;  2PJP A;  4M73 A;  3HTU A;  4ESF A;  1J9I A;  3E5U A;  4LG0 A;  1ZH5 A;  2VOO A;  1WWX A;  1XSX A;  2A6E F;  4MQ9 F;  4WXC A;  5H20 A;  1TNS A;  1WKM A;  4BXU A;  5L3D A;  1YTY A;  4AD9 A;  4GGG A;  3ABU A;  2XKP A;  3ZMV A;  4OIN F;  3SQN A;  2Q0O A;  2VOP A;  2X4H A;  1UST A;  3FF5 A;  3ZP5 A;  3R4K A;  4YFN F;  5D5W B;  3KZY A;  2QBY B;  1YW8 A;  1HKS A;  4HX8 A;  1LVA A;  1B9M A;  5LEK A;  4KMF A;  4WXH A;  2DFI A;  1AOY A;  4LFU A;  3V7R A;  4NQW A;  1MJB A;  4L18 B;  2VBZ A;  4IRG A;  1I27 A;  1ON2 A;  4MGR A;  1SD4 A;  1LEB A;  5ILV A;  3QAH A;  5L3B A;  3LAJ A;  4OOI A;  3HIF A;  2QBY A;  4I7H A;  1R7J A;  3BWG A;  2FQ3 A;  2ADU A;  4G6D A;  3RI4 A;  5CVR A;  3WTY C;  1S7A A;  1OYW A;  1FYK A;  1V4R A;  3FXR A;  3VOE A;  2D2W A;  2NYX A;  2PLY A;  5BPD A;  1ZG3 A;  4IHT A;  3HRU A;  4JBA A;  1F1Z A;  3QPT A;  2RGV A;  1YG2 A;  5LRS A;  2JPB A;  5FFZ A;  3BDD A;  2FRH A;  1FT9 A;  2EFQ A;  2O3F A;  2YR2 A;  4HDV A;  1ON1 A;  3RYP A;  3FMR A;  2E7X A;  3J81 Z;  1JXS A;  4HAM A;  1QZY A;  2D1V A;  1SAX A;  3I53 A;  2COM A;  3TO7 A;  4ESJ A;  2FA5 A;  1MGT A;  5DYM A;  4ENM A;  3ZMU A;  1E17 A;  3M8F A;  3EYY A;  2NNY A;  2HQR A;  2GZW A;  4L0Y B;  3W6K B;  3CDH A;  3L9F A;  1U5T C;  3IC7 A;  4HA8 A;  4KIF A;  3RKX A;  3C18 A;  1XCB A;  4L9N A;  4LJZ F;  3GX4 X;  1REP C;  1IXS B;  4A0X A;  1BI1 A;  2IA2 A;  4ENN A;  5L3F A;  5HS9 A;  1KU7 A;  1WRJ A;  3COA C;  1CF7 A;  4ESB A;  3QU6 A;  2OBP A;  4WWC A;  1K78 B;  3SHF A;  3P9K A;  2XIG A;  4IRH A;  5E1X A;  3IWF A;  1XDU A;  1GVJ A;  4P55 A;  3U1D A;  1LB2 A;  5FLX K;  2PI0 A;  3KP4 A;  5D6E A;  1V3F A;  4WF2 A;  3EUH A;  2CFX A;  4EM1 A;  2A61 A;  3ULQ B;  3CO6 C;  5LRR A;  1TQP A;  3M8E A;  2JZY A;  2D1H A;  4EJT A;  3IRQ A;  3F8N A;  2IRF G;  3EDP A;  4HX4 A;  2P4W A;  1KU3 A;  4UNO A;  4U88 A;  2MD5 A;  2L54 A;  3LST A;  2ISY A;  3ERE D;  4UXN A;  4FX4 A;  3P7N A;  3NEU A;  3HSR A;  1SFU A;  3FX3 A;  3KEO A;  4MNU A;  2PG4 A;  5BS6 A;  1XD7 A;  1B6A A;  2QQB A;  2L02 A;  3KP6 A;  2GXG A;  3HYI A;  2CG4 A;  1MDM B;  3HHG A;  4LMY A;  5F1R A;  2HWV A;  2BYV E;  4IJA A;  4I98 B;  3W6J B;  2EWN A;  1G3W A;  1ZG1 A;  4RS8 A;  3AAF A;  2P6S A;  4P9U A;  3ZN0 A;  3KP3 A;  1J2X A;  1ZHF A;  2BEO A;  1Z1D A;  5TRD A;  1Z05 A;  1S7O A;  3FM5 A;  4M6Y A;  2DT5 A;  5E1W A;  3WGI A;  1ZYR F;  3ZMD A;  1TQM A;  4P9F A;  5LHH A;  4H0E A;  4UUV A;  1KQ0 A;  2K4B A;  3H3Z A;  5E1Z B;  5J6X A;  1UB9 A;  1FZP B;  4EJV A;  3HOT A;  1FBS A;  3JSO A;  3MEX A;  2PN6 A;  2VT2 A;  1IXC A;  4O5V A;  1USS A;  4EJO A;  3CUQ B;  1SFX A;  4KDP A;  1J5Y A;  5HDK A;  2FML A;  1YQA A;  3V7C A;  3GVA A;  2GAU A;  4HV5 A;  1ODD A;  4P5O A;  3R6S A;  4PGH A;  4F7Z A;  5LHG A;  2H6C A;  3DF8 A;  3ZMT A;  4G7H F;  4OIO F;  2A07 F;  2XV4 S;  1MJA A;  4JK1 X;  3QRF F;  3E6D A;  3V8J A;  3VFZ A;  1KYZ A;  4ZH4 F;  3MQ0 A;  5L3E A;  2HFH A;  2QVO A;  1RZ4 A;  1U5T A;  3S2W A;  1RNL A;  4G7Z F;  1XMA A;  1R5H A;  3BZ6 A;  4G7O F;  5E20 A;  2FMY A;  2X0L A;  2RKH A;  1TQI A;  4ZYG A;  3LAP A;  2XAG A;  1IUY A;  1Y0U A;  3HRM A;  5DDG A;  4O6J A;  1KQ9 A;  1R36 A;  1BIB A;  4NHJ A;  2R7D A;  2UXX A;  4EQQ A;  3R0J A;  3KFW X;  3KZZ A;  3RJP A;  2VXZ A;  4EV0 A;  5DCM A;  3WTV C;  3HSE A;  1BI2 A;  2VE8 A;  3TKY A;  4A6E A;  3G3Z A;  1FLI A;  4GXO A;  3KLN A;  4RB1 A;  4LB5 A;  2KKO A;  1ZRF A;  1DPR A;  2MH9 A;  4R1H A;  4K2E A;  4S05 A;  2HDC A;  4LLL A;  3RKW A;  1YS7 A;  4ETS A;  2JTV A;  4M9X A;  3J80 Z;  3RPQ A;  1BI0 A;  4ZZD A;  5ERI A;  1XB4 A;  3ZN1 A;  1DDN A;  5D4R A;  1YW9 A;  2HTJ A;  1TTY A;  3GUD A;  1FSH A;  4BQA A;  1ONV A;  4A6D A;  5L3C A;  5J8F A;  3K9T A;  3WU0 A;  3P9I A;  1WI9 A;  2Q8K A;  1XGM A;  1S29 A;  3C1D A;  5E8I A;  5DCF A;  4EJW A;  4LD5 A;  4GYI A;  3WTZ A;  1I6X A;  3ZMZ A;  2M45 A;  1EH7 A;  3JTG A;  3K69 A;  2ZME B;  4OMY A;  5KK1 A;  1IN4 A;  4KN7 X;  2EA4 A;  1ZAR A;  4BHB A;  5JFR A;  2OZU A;  3T0Y A;  4HLX A;  1MJ9 A;  1LNW A;  3V8L A;  1W7P A;  2GA1 A;  3G73 A;  3TO9 A;  1XN7 A;  5F6F A;  3L00 A;  1B59 A;  3EET A;  3RKY A;  2YSR A;  1F9N A;  3H92 A;  3PQK A;  3I59 B;  5JI6 A;  4I2O A;  2XAQ A;  1RUO A;  2FBH A;  2ZFW A;  1ZN2 A;  1GXQ A;  1OYY A;  2J5O A;  1UHW A;  4BH9 A;  3FM3 A;  1ZLK A;  2HGC A;  3BOQ A;  1OKR A;  2FBK A;  2M1B A;  2UXN A;  4G6Q A;  3BPX A;  1F5T A;  1GHC A;  3NQO A;  3I64 A;  4LLG F;  1KGS A;  1A04 A;  5D5V B;  3VOD A;  4B09 A;  1K78 A;  3SFZ A;  1Z9C A;  3VEP A;  3N4M A;  2KIU A;  2ACJ A;  2ISZ A;  1BC7 C;  2DK8 A;  1PUE E;  5K1Y A;  2EV0 A;  3F72 A;  4M9Z A;  2AS5 F;  2VT3 A;  1S6L A;  5CJ9 A;  3LA3 A;  5AIP A;  2BGC A;  3EQL F;  1WQ2 A;  1DP7 P;  2Z5U A;  2ZBK A;  2CO5 A;  2K4J A;  1MKM A;  1H9T A;  1FX7 A;  3L7W A;  3WE3 A;  3GWZ A;  2AXL A;  3IKV A;  1D3Y A;  2MA3 A;  1XCV A;  5D6F A;  2FSW A;  2PMH A;  1AWC A;  2MBF A;  1I1S A;  3E6B A;  2IT0 A;  2OU2 A;  3D5L A;  3B02 A;  1KYW A;  4I0B A;  3B73 A;  3V7S A;  4ZYD A;  4M72 A;  3I4P A;  1U78 A;  2FBI A;  3MZY A;  3CUQ C;  1XGS A;  1T6S A;  4L5J A;  2OD5 A;  1YYV A;  2EFN A;  1SD7 A;  4RGS A;  2HZT A;  5FGM A;  2CYY A;  4CIC A;  2M87 A;  2QUF A;  2ZO4 A;  2VON A;  1SD5 A;  2F5E A;  4RAY A;  1P4A A;  4HQM A;  4BYY A;  2QQ9 A;  4S04 A;  1FSE A;  1CGP A;  4RB3 C;  1QNT A;  3LQR A;  1IZ1 A;  4R79 A;  3DV8 A;  1UCR A;  5HDG A;  2DBB A;  3FHZ A;  4HQE A;  1JHH A;  1R1V A;  5A2Q Z;  3HOS A;  3E97 A;  3FWE A;  2FNP A;  1K7A A;  2A68 F;  3KLO A;  3IKT A;  1JHF A;  3QU3 A;  2UZK A;  1G6N A;  2G9W A;  2OQR A;  4I09 A;  2GXB A;  2EFP A;  4HYE A;  1C0W A;  2P6T A;  5AON A;  2C6Y A;  4GO1 A;  4O3M A;  1QO0 D;  3GW2 A;  3TGN A;  3GF2 A;  4Q47 A;  3WGH A;  5EEG A;  4KN4 X;  3VB2 A;  1XSD A;  4GCV A;  4A0Y A;  4LK0 F;  4A5N A;  3ABT A;  2H27 A;  2FE3 A;  3R0A A;  5HLH A;  3TQN A;  5BPI A;  1LDK B;  2L4A A;  4I0A A;  2IVM A;  2BV6 A;  3I0T A;  1ZAO A;  2XAS A;  5ILU A;  2HR3 A;  5FFX A;  1MD0 A;  2A6H F;  2IA0 A;  2IW5 A;  4MTD A;  3KP5 A;  2H94 A;  3F8B A;  3GO5 A;  3IRR A;  4MEY F;  3JSP A;  2E7W A;  5D8K B;  3ISP A;  2VC0 A;  4CDG A;  1B1B A;  2RNJ A;  2V79 A;  2FNA A;  3I71 A;  2LF7 A;  4UVB A;  1EH6 A;  3ZPL A;  5EEH A;  4KIB A;  3WTT C;  4CHU A;  1YFH A;  3CTA A;  2P5L C;  3BPV A;  2HS5 A;  2P7C B;  3GFM A;  1IAW A;  1ZRC A;  5BQT A;  4M6X A;  1B4A A;  3E6C C;  2VBW A;  2P5V A;  1XSV A;  2XRN A;  5BOX A;  1W7P D;  1RIO H;  1G3S A;  3Q9S A;  1TBX A;  2BBY A;  2GQQ A;  2P5K A;  4KUM A;  4TV7 A;  2ZNZ A;  1R00 A;  2ESN A;  1ZLJ A;  5HS7 A;  1W4M A;  1GXP A;  3BP8 A;  1EH8 A;  2LDU A;  4IXA A;  4KT5 C;  4EVI A;  2A69 F;  1LDD A;  4L0Z B;  3C7J A;  2CGP A;  4IHS A;  1R1U A;  4AIH A;  4NB5 A;  1BC8 C;  4MEX F;  3T8T A;  2Y48 A;  4YG2 F;  5CVI A;  2JSC A;  4ZZL A;  3JAM Z;  1FWZ A;  4U0Y A;  3GXO A;  3T1B A;  2Q2E A;  2QWW A;  4CGZ A;  3HHH A;  3T8R A;  5FLX Z;  2QEN A;  3TO6 A;  2DTR A;  5LEJ A;  1Z91 A;  2OQG A;  1L3L A;  4L9J A;  2HKX A;  2MH2 A;  2A3S A;  2VOD A;  3JAM K;  3NRV A;  2K86 A;  1XDS A;  4R8H A;  1MZB A;  3KP7 A;  1K6O A;  2PMU A;  3EYI A;  2EA2 A;  3JTH A;  3E3V A;  2KIF A;  1BI3 A;  4RGU A;  4I02 A;  2G7U A;  2OAZ A;  1SD6 A;  3MCZ A;  1P92 A;  2MLK A;  5BMZ A;  2ZCW A;  5LLQ A;  4OIP F;  3OV8 A;  1YLF A;  2IJL A;  2EFW A;  1XGN A;  2BE5 F;  1PP7 U;  1P4W A;  2V1X A;  1IN8 A;  2MLG A;  4LB6 B;  3BY6 A;  1HW1 A;  3RTR A;  5LGU A;  1TLH B;  5IT9 Z;  3PQJ A;  2EJR A;  2Y0M A;  3SXY A;  4RB2 C;  1FPQ A;  2P7V B;  2W85 A;  3DPL C;  4QWQ A;  2PFB A;  4XSX F;  4HOB A;  2XRO A;  4PZJ A;  1IN7 A;  1R23 A;  5DEQ A;  1FP1 D;  4IF4 A;  4UHT A;  2A5Y B;  4OIR F;  1Z6T A;  4N9I A;  1YS6 A;  4YII A;  4N0B A;  2NRA C;  2ZME A;  1XGO A;  2ETH A;  2O6G E;  2MC3 A;  3SZT A;  3F22 A;  2WC2 A;  2XHK A;  2OZ6 A;  1HQC A;  4BAY A;  4E70 A;  4A5M A;  2TDX A;  5ILS A;  4KMU X;  4M74 A;  1IW7 F;  2CWE A;  3I58 A;  1LQ1 A;  4DNC A;  2DPU A;  3F21 A;  3LQQ A;  3KE2 A;  1PDN C;  3F6V A;  3GFJ A;  5E18 F;  1VTN C;  1W5S A;  3K1P A;  5FD6 A;  2HOE A;  5ICC A;  5HLG A;  3WG9 A;  1STZ A;  2XGX A;  3GFI A;  1ZGA A;  1KQ8 A;  4HF0 A;  4ENJ A;  3ECO A;  1DUX C;  1FOK A;  3U2R A;  1E2X A;  1SFE A;  3ECH A;  4EMS A;  2HEO A;  4FT8 A;  5HLI A;  5JHU A;  2GIV A;  4A2U A;  4QLC U;  2IA1 A;  3MWM A;  3PFI A;  2EK5 A;  2GA2 A;  3DFG A;  4RGR A;  3I54 A;  3WTU C;  4CZZ A;  4KFC A;  2R7F A;  3JW4 A;  1QQI A;  3F8F A;  1MDM A;  3FMS A;  5DV5 A;  1H0M A;  1BN5 A;  1L0O C;  4HW0 A;  4BHC A;  1O3T A;  2RDP A;  2ZKZ A;  1I5Z A;  5ICF A;  4LLN A;  4WXD A;  2CW0 F;  4HF2 A;  2XAF A;  3O2P E;  3I5U A;  2DO7 A;  1BBY A;  1FBQ A;  2PQ8 A;  4LGW A;  3CO7 C;  3T5X A;  2E1N A;  2XUB A;  2R3S A;  3L2C A;  4HLY A;  1O57 A;  2QLZ A;  2YU3 A;  3DP7 A;  3M1E A;  4HBL A;  4OIQ F;  4CXF A;  1KU2 A;  1FY7 A;  2DW4 A;  5D5X B;  2F5D A;  1R22 A;  5D4S A;  2DI3 A;  1D8J A;  1F4K A;  4U7B A;  4MHG A;  1UHM A;  2M5W A;  2K27 A;  3ML6 A;  1ZRD A;  3V8K A;  4LK1 F;  4RAZ A;  1J75 A;  5ED4 A;  4U7D A;  5FO5 A;  4L9V A;  4Y13 A;  1U3E M;  2FU4 A;  1U2W A;  2FEZ A;  5K5Q A;  5A2Q K;  2YX4 A;  5FD5 A;  2H6B A;  4KIC A;  5DUK A;  2V1U A;  3R61 A;  2F2E A;  2QQA A;  2QZ8 A;  2CSO A;  5DUI A;  1FNN A;  2W25 A;  3V4G A;  2PEX A;  4A12 A;  2F5C A;  2KRF A;  3GLX A;  4L5I A;  5ICG A;  3I59 A;  5HOO A;  3WE2 A;  4KYW A;  1B9N A;  2G7H A;  1FP2 A;  4M71 A;  2Z3Y A;  4G94 A;  3MZH A;  1RI7 A;  4RB0 A;  3WTW C;  3IWZ A;  4EJU A;  4ZYH A;  3K2Z A;  2RQP A;  1JGS A;  3FXU A;  4ON0 A;  2WTE A;  3M7G A;  4IRI A;  1P2F A;  5JR3 A;  3ZMS A;  4PCQ A;  3ELK A;  3KET A;  3GZ5 A;  4AIK A;  2F5F A;  5JVT A;  3GYH X;  2RC4 A;  1ZG5 A;  5E17 F;  1RUN A;  3R60 A;  3IHU A;  5DD4 A;  3WTS C;  4N9H A;  1KA8 A;  2Z99 A;  2OA4 A;  4YFK F;  1SMY F;  3P9C A;  1IRG A;  1FBU A;  3HTS B;  1HW5 A;  1O7L A;  2NS0 A;  3WOD F;  1TW2 A;  4YFX F;  3J81 K;  4PDK A;  2YX7 A;  1YO5 C;  1J7K A;  3DQV C;  4RGX A;  3Q5F A;  2O61 A;  2HYF A;  3RDI A;  1TNT A;  3BJO A;  3LA7 A;  1Z6R A;  2L3D A;  3D0S A;  2LSO A;  2H09 A;  1O3S A;  2KJC A;  2XKO A;  3M9A A;  5LGN A;  3F8M A;  3WU1 B;  3HSF A;  1JE8 A;  4KNY A;  2WV0 A;  1K79 A;  2RN7 A;  3DKW A;  2NNN A;  5IT9 K;  2UWM A;  4IPA A;  3K0L A;  3Q9V A;  3TDU C;  5CVV A;  1S3J A;  1CF7 B;  2O0Y A;  2ELH A;  3ZQ7 A;  3E5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...