2GXGA

Crystal structure of emrr homolog from hyperthermophilic archaea sulfolobus tokodaii strain7
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
140
structure length
140
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal structure of archaeal homolog of multi drug resistance repressor protein, EmrR, from hyperthermophilic archaea Sulfolobus tokodaii strain7
rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 58
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gxgA00
2OU2A 2K86A 4LMYA 3I53A 2QQBA 3KE2A 2QBYA 4YIIA 1ZRFA 1YIOA 1ZREA 5AONA 5FLXZ 1U2WA 2PJPA 1XMKA 1J9IA 3LA2A 1QO0D 1BC7C 4HLXA 3H3UA 3FZVA 5D4SA 3V8KA 1U8RA 3G73A 1U5TB 1TNTA 4LK0F 1J2XA 3L7WA 3NRVA 3BPXA 3BJ6A 3B73A 2BBYA 1V3FA 3HRUA 4G9YA 2QVOA 3TO6A 1C0WA 1ZAOA 1BI3A 3L09A 4YIFA 4MEXF 1XGOA 1KA8A 3WGHA 1R00A 1YQAA 1FT9A 3QOPA 4A6EA 4UVAA 2H6CA 2HKXA 3CJNA 1K78A 3WODF 2D45A 2BV6A 4EM0B 2V1UA 4HA8A 5JHUA 3LAJA 3DP7A 1G4DA 1ULYA 2DI3A 2HR3A 2QENA 3ECOA 1ZGAA 3VEPA 1OPCA 5BOXA 2HZTA 1O7FA 4AWXB 3DXJF 2VOOA 2E1NA 4I0BA 2GZWA 4R1HA 3P9IA 3CO6C 2VC1A 2HQNA 2XAGA 5L3FA 4ENJA 1HKQA 1F9NA 3TGNA 3ISPA 1HKTA 2R7FA 3MZYA 2Q0OA 3K69A 2HYGD 5H6QA 1D8KA 2XRNA 4CDGA 4EQQA 4LGWA 4S05A 3JAMZ 1F4KA 3ZMTA 3HRMA 1TLHB 4GYIA 1WI9A 2ZJ2A 5D5VB 5JI6A 5LHIA 4GGGA 3RYPA 3BJAA 3IRRA 2DTRA 2FMLA 4IPAA 1FBSA 5ILVA 2VBZA 2EFQA 1W5TA 4WX9A 1CF7A 4OOIA 5BQTA 4OMZA 1GVJA 2ETHA 1FBQA 1MKMA 5TJJA 3Q9VA 3J81Z 1PDNC 2LSOA 3I64A 1TTYA 2EA4A 3TQNA 4EV0A 2IVMA 1ZGJA 5HLGA 4R79A 1K6OA 2PN6A 2OA4A 3RTRA 3FX3A 2WWYA 1ODDA 4UHTA 1WQ2A 3RKWA 2PBIA 3KLOA 4MGRA 5AIPA 1I1GA 2FBHA 2WC2A 4O3MA 3ZN1A 2QQAA 1SFEA 4XSXF 5HVQC 2EA2A 4I02A 4WWCA 3CO7C 3K1NA 4EGYA 3FMSA 4BAYA 3EDPA 4P96A 5D4RA 2FNPA 1XDSA 5F1RA 4U0WA 2DAOA 5HDKA 5D5UB 3MWMA 3F8CA 3F8BA 4GCVA 4U7DA 4I09A 2G9WA 1D8JA 3F8FA 2DW4A 1YYVA 2GXBA 2JT1A 2V1XA 5ICFA 3K1PA 3DV8A 1T0FA 3D5LA 1IZ1A 4MNUA 3F6VA 5DUIA 4PGHA 4A0XA 2XKOA 1LDJA 2K02A 5LGTA 1PUEE 3TOAA 3WU0A 2WV0A 5FD6A 1ZYRF 3V8LA 1MJAA 1Z7UA 1ZARA 1IN4A 1BIBA 3Q9SA 4M9XA 4Q47A 2VC0A 4KIGA 4OIRF 3RKXA 3BP8A 1HKSA 1BI1A 3GFLA 5FB2A 3KETA 2CQKA 3DKWA 1HQCA 3ABUA 4HX4A 1IUYA 2DFIA 4U7BA 2ZFWA 4KN4X 1T98A 3SFZA 5JVTA 4CYDA 4KYWA 4ZYGA 4IXAA 1ON2A 1USTA 3QP6A 2XAFA 3RPUA 2CWEA 3CTAA 2O0YA 3LA3A 2JTVA 1SAXA 3R0JA 2NRAC 2GAUA 3C3WA 1R22A 3FWEA 3WTVC 2QYOA 2L4AA 4WCGA 2PMHA 1XSDA 5HLIA 1IXCA 2OAZA 1EH6A 1Z1DA 3P9KA 5EEHA 1T6SA 3FM5A 3RIRA 2VOPA 5EEGA 1RZ4A 1P4XA 1W7PB 4S04A 2JPCA 5KVRA 5E8GA 2IJLA 3D0SA 4HF0A 2ZMEA 3ZMSA 5CYVA 4L18B 2KKOA 5F64A 3R6SA 3ZQ7A 1R1TA 3CDHA 4ZYEA 3T1BA 3I54A 1LEAA 4HLYA 3EETA 2VN2A 1P2FA 4O5VA 3SHFA 4M71A 2BYVE 2W85A 3TOBA 3FXUA 1BBYA 2ZNYA 4HQMA 1BI0A 1FP1D 1OYYA 2M1BA 2A6HF 1UHMA 2FEZA 2GA1A 2VXZA 3IKVA 1Q1HA 3M1EA 2HKOA 4G8XA 2VT2A 1O3QA 1WSUA 1J59A 3V7CA 3QPHA 5HDNA 3SZTA 3QP5A 1DDNA 2EFPA 2FOKA 1UFMA 3IWZA 3PFIA 4EM1A 3I59A 4NHJA 3EUHA 3IL2A 3L9FA 1TW3A 3MAJA 2A68F 4BHBA 4HDUA 4XBFA 2H09A 4L5IA 3E5QA 3U2RA 5E1ZB 3E6CC 4ENKA 1JGSA 4FHTA 2MLKA 2YR2A 4Z2YA 5LEKA 4A6DA 2BEOA 1J0RA 1VTNC 1YG2A 4OIOF 1FZPB 2GQQA 1KU9A 1U6GA 1G6NA 1RI7A 4A0ZA 1B4AA 4B09A 3I0TA 2M8EA 2L54A 1ZRDA 1D5VA 1S7AA 2HTJA 3BDDA 3TKYA 3PQJA 2VE8A 4YFKF 5BPIA 4EGZA 2CGPA 2OBPA 2FNAA 4GYGA 5LEJA 4L9NA 2G7UA 2IPQX 1MZBA 1RUNA 4Y13A 1WRJA 1U3EM 4HF1A 1Z05A 4OMYA 4ENNA 4RB1A 3E6DA 1RNLA 2CSOA 1HSJA 1O3SA 1R36A 2EB7A 1XCVA 4BYYA 1XDUA 1Z9CA 1FY7A 5E1XA 5J8CA 3QPTA 2UWMA 3QAHA 2FA5A 2ISZA 3J7AO 1ZLKA 1YW9A 2R3SA 3JSOA 3KEQA 2FBIA 3RPQA 1AOYA 3P7NA 4UV8A 1O7LA 3LAPA 1T2KA 3MQ0A 3EYIA 3ZP5A 2W25A 2AXLA 4XLPF 3REOA 2O6GE 4IHSA 1K78B 3JAMK 3RYRA 4HAMA 1W4MA 4E70A 3QU3A 1GXQA 4M74A 2OQGA 3KP5A 4YFXF 1RUOA 3L00A 3DPLC 2EK5A 1OMIA 4KIBA 1HSTA 5FD5A 3J81K 4MHGA 1QQIA 3NQOA 3O6BB 2ADUA 3BJOA 1ZH5A 4OIQF 2RQPA 3HIFA 3WU1B 1TNSA 3R61A 3OV8A 3L2CA 3E6MA 1S29A 4HX8A 3BZ6A 4IF4A 1EV7A 2H6BA 4LJZF 3ECHA 2ISYA 4BHPA 1TQPA 3CLOA 2ZBKA 2FQ3A 4P5OA 2FF4A 3S2WA 5LRSA 4EVIA 1KU2A 4GO1A 2YPRA 2O61A 5LBQA 3E97A 1R1UA 2J5OA 2CO5A 3I5UA 1MDMA 1XB4A 1LVAA 2NS0A 3GF2A 3VOEA 3E5XA 5HS9A 1CF7B 2DK5A 5E18F 2KJCA 3FXQA 5F6FA 4LLNA 2EFNA 3HHGA 3NEUA 4UV9A 4CHUA 3GUDA 1MJBA 4LG0B 4U88A 1L3LA 5IT9K 2Z5UA 2O3FA 2EFOA 4G6QA 4RGUA 1LEBA 2X4HA 1STZA 4HW0A 3CUQA 4EJTA 5ERIA 2E1CA 4BQAA 2GXGA 3E6BA 5E17F 2J5PA 2E7XA 2HFHA 1LDDA 5E8IA 1SFXA 2M30A 2QQ9A 1ZG3A 4Y15A 2NNYA 3F21A 4H0EA 2L01A 1XSXA 3EQLF 1F1ZA 1IW7F 4NQWA 4BHCA 2NAZA 2BE5F 1SMYF 5D5WB 4M9SA 2Q8KA 3ZPLA 5DDGA 2IRFG 3N97A 4BH9A 1CGPA 3PQKA 2HDCA 1UCRA 5FO5A 2FU4A 1BM9A 4PDKA 3VB2A 1SD4A 3WG9A 3HUGA 3V4GA 2V6CA 4PGGA 1H9GA 1HW5A 1FX7A 3C7JA 4RB0A 2W57A 4G7OF 2JRTA 1W7PD 4L5JA 3KEOA 4P9FA 1BJAA 4M73A 4I7HA 3I71A 3C1DA 5LGNA 2F2EA 5D5XB 5BS6A 4YG2F 4EJOA 1QZZA 1XN7A 1XSVA 1TW2A 1JHHA 4KIFA 2XIGA 3F8NA 3W6KB 5IT9Z 2RDPA 2RVCA 3ULQB 3MFKA 2G7HA 5D6FA 2DT5A 5L3EA 2FSWA 3GW2A 2O8XA 1OKRA 3F6OA 1IN7A 1BI2A 3JTHA 1FPQA 1USSA 4HQEA 2E7WA 3HSFA 5E20A 3COAC 4AIJA 4K2EA 4XRFA 3LQRA 1ZG1A 3E3VA 3KZYA 5AIQA 2XASA 3HOTA 4CZZA 4A2UA 4D0PA 2Y75A 1PP8F 1X3UA 2HGCA 1IXSB 1B1BA 3GFMA 4PCQA 2ESNA 2MH9A 1IRFA 2F5FA 1KYWA 4AD9A 2KJBA 5K5RA 5TRDA 2DLLA 2A5YB 1BN5A 3HTSB 2PEXA 3R0AA 4KA4A 5L3GA 5CVRA 4G6DA 1I5ZA 4KICA 5CLSA 3RI4A 3F72A 5A2QK 3SZPA 3H92A 5HLHA 2XROA 4I98B 3KP7A 4KMFA 1O57A 5ICCA 4M72A 2MBFA 1LB2A 1L0OC 5D8KB 1MJ9A 3T8TA 4HOBA 2DK8A 3CUOA 3JTGA 4L9JA 4FX0A 1HBXG 5H20A 3N4MA 3DEUA 2PQ8A 2VE9A 1J5YA 1HW2A 3I59B 3WTTC 2K4JA 2DBBA 5K5OA 1W7PA 3FHZA 5CVUA 4RGXA 1YS7A 5L3BA 4IRIA 1KYZA 2HTSA 1B9NA 2P5LC 2Z99A 4MQ9F 2CFXA 4EJVA 1S6LA 3GFIA 2XAQA 1G3WA 2A61A 2JSCA 4ZYDA 1F5TA 5ICGA 3H3ZA 3KP2A 4M9ZA 1ZRCA 3K1MA 2VBWA 5ED4A 5KK1A 1SD7A 1BIAA 3DPTA 4Y17A 2HS5A 3KZZA 5ILSA 4IVNA 5DCMA 2QZ8A 1J7KA 3R60A 4KT5C 2MLGA 3M9AA 5A2QZ 2IT0A 4IHTA 2RGVA 4ESFA 3WE3A 3WTYC 1R1VA 4IRHA 2NYXA 2P6TA 4A0YA 3WTXC 2P7VB 2MA3A 3KP3A 2PI0A 1KQ8A 3J80K 4G7ZF 2Z9OA 3DFGA 1QNTA 1KGSA 3V8JA 3TO9A 4G94A 5K1YA 1R5HA 4UUVA 4RAYA 1OYWA 2STWA 3GWZA 4MTDA 2Q2EA 5IT3A 3RKYA 2DU9A 3ZN0A 3GVAA 3KP6A 2V1DA 4EJWA 4RB3C 3VFZA 1FWZA 2L4MA 2P5KA 2QBYB 1I1SA 1FYKA 2RN7A 1EH8A 5LLQA 2Z33A 4HZFA 4L0YB 1R7JA 3K2ZA 4ESJA 2FE3A 2CW0F 3W6JB 5J8FA 4HX7A 3LFKA 2EV6A 5D6EA 5K5QA 1JHFA 5E1WA 5L3DA 1K79A 2HEOA 2EWNA 1FC3A 2UXNA 2A6EF 3E5UA 2FMYA 1XCBA 5FFZA 3FM3A 4CICA 4A12A 1FYMA 1SMTA 2QM3A 4HF2A 1FNNA 3WTSC 1YTYA 2RC4A 1ZLJA 4LLGF 4N0BA 3AAFA 2EV0A 1KQ9A 5L3CA 1AWCA 3CUQC 2HYFA 3O2PE 3RDIA 3DF8A 4P9UA 2ZCWA 1XD7A 2EJRA 4KMUX 2L02A 1FSEA 2A3SA 5CJ9A 1R23A 3F8MA 3HRTA 3J80Z 2AS5F 3ROUA 2FBKA 3WGIA 5D8LB 4GXOA 1D3YA 4HV6A 3EYYA 1DPRA 1TBXA 3I4PA 1NHAA 1WWXA 2TDXA 3FMQA 1H9TA 1P6RA 2FXAA 2Y0MA 5LHHA 2C6YA 1HW1A 1BC8C 3FF5A 2YU3A 4EJUA 4BNCA 2IP2A 3K0LA 1KU3A 1R58A 3ZMVA 1RIOH 1U5TA 1MDMB 1YLFA 3FXRA 3KFWX 1QGPA 3SXYA 4LB5A 2MC3A 4RGSA 3ELKA 4YFNF 4O6JA 4U0YA 4KFCA 3TO7A 1U78A 2YX7A 2XHKA 1SD6A 3BPVA 3HSEA 2MH2A 1W5SA 2P5VA 1IXRC 4JK1X 3GYHX 4HV5A 4ZZLA 2IA1A 1ZN2A 2P6SA 4IJAA 1I27A 2EFWA 1Z6RA 2M87A 3ABTA 4UVBA 4UXNA 3CUQB 3GFJA 2H27A 2D1VA 4AIKA 2M45A 3K9TA 4IRGA 3RJPA 4EMSA 2OD5A 2YSRA 4N9IA 5FGMA 3WTUC 3F22A 1KU7A 4F7ZA 5LHGA 4L9VA 1IF1A 5CVJA 4NB5A 2X0LA 2XKPA 3ERED 2B0LA 1HXDA 3FMRA 4FX4A 2PFBA 1J75A 2PLYA 4MEYF 3OOPA 1BOAA 3WTWC 2KRFA 4LFUA 2QWWA 2VONA 4PZJA 3G3ZA 4Q48A 3IHUA 2M5WA 2LF7A 1SFUA 5LRRA 2OQRA 3KLNA 3T8RA 4WK8F 2QLZA 3HSRA 2KIUA 3GO5A 1ON1A 5ILUA 1OR7A 4UNOA 2HQRA 5LGUA 1S7OA 5JFRA 6PAXA 1FBUA 3BY6A 1P4AA 2DPUA 2L3DA 4L9TA 4MQVA 3T0YA 1A04A 4LG0A 4ASNA 4ENMA 2ZXJA 5DV5A 4LB6B 2XUBA 1Z6TA 2A69F 4FT8A 2GWRA 2VT3A 1GHCA 2OZUA 5DD8A 5J6XA 3MZHA 2HOEA 2EV5A 4WF2A 2UXXA 1G3YA 3HRSA 1FYLA 2R7DA 2JZYA 1LDKB 3GX4X 1XGNA 2P8TA 2K7LA 2UZKA 1FLIA 1XGSA 3KCCA 2FRHA 1O3TA 1S8NA 1IN5A 3HOSA 4RB2C 2QUFA 2PMUA 1E17A 1FSHA 2ESHA 3F23A 5HS7A 3Q5FA 1UB9A 4AIHA 3IWFA 1SD5A 3QU6A 1G3TA 1FOKA 5HOOA 1DUXC 4HDVA 4G7HF 3MEXA 1T38A 4KDPA 4L0ZB 4I01A 2D1HA 3BOQA 4TV7A 2KIFA 2IA2A 2DQRA 2LF8A 3HYIA 2COMA 1LQ1A 1XGMA 4I0AA 4DNCA 1MD0A 1IN6A 2LNBA 2XAHA 1G3SA 2IA0A 4XLNF 3WE2A 4ESBA 2ZMEB 2XVCA 1YS6A 1OYIA 5BMZA 5CVIA 4DQ2A 3O3KA 1ONVA 1ZG5A 1TQMA 1H0MA 1UHWA 3U9GA 3IKTA 5DUKA 2XAJA 2DO7A 2DQLA 4OIPF 2VBXA 1P4WA 3LSTA 2A07F 5HS8A 3M8EA 3V7RA 3BROA 4ZYHA 2RKHA 4KN7X 1LJ9A 5DD4A 1B59A 1Y0UA 3LWFA 4P55A 1JE8A 5DEQA 1YO5C 3GZ5A 4U0VA 1DPUA 4M6XA 1S3JA 2KIMA 2CG4A 2W84A 1LNWA 3LQQA 4A5MA 2NNNA 3QRFF 2IW5A 4HBLA 1EH7A 4LK1F 3JSPA 4RGRA 3R4KA 1GXPA 1Z91A 4I2OA 3ML6A 4XSZF 2BGCA 2K27A 4RS8A 1O3RA 1REPC 4ETSA 2VBYA 4AVPA 3TDZC 5HDGA 1B9MA 3F3XA 5FFXA 1V4RA 4OINF 4KUMA 3U1DA 1E2XA 1YW8A 1K7AA 2K4BA 5DCMB 1IN8A 1I6XA 2F5EA 2OZ6A 4JBAA 1QPMA 4HYEA 5ICEA 1XMAA 3P9CA 4JQFA 2LKPA 2GA2A 3HTUA 4LLLA 1IRGA 3MCZA 4CXFA 1ZHFA 1QBJA 1T39A 4OU0A 2P7CB 5JR3A 2LDUA 4B8XA 1DP7P 3GXOA 4BXUA 3GLXA 1TQIA 4A5NA 3HHHA 2ELHA 3GZ6A 2ZO4A 4M6YA 3VODA 4MTEA 1MGTA 2STTA 2VODA 3DQVC 4LD5A 4EM2A 2GIVA 3ZMZA 4KNYA 3TDUC 2F5DA 3SQNA 4N9HA 5H6RA 5FLXK 1R5GA 2CYYA 1KQ0A 2WTEA 2W24A 2XGXA 2ZNZA 2PG4A 5CVVA 1PP7U 4WXCA 1U5TC 2RV8A 3LA7A 5DYMA 4UVCA 3ZMDA 2DPDA 1WKMA 3T5XA 2H94A 1YFHA 4Q5SF 4RAZA 3WTZA 2P4WA 3C18A 2RNJA 4Q4ZF 1YW7A 1QZYA 3M8FA 2ACJA 2MD5A 1JXSA 4R8HA 3GEZA 2V79A 4WXHA 4ON0A 4WXDA 5DCFA 2XV4S 3I58A 2D2WA 3BWGA 2O03A 2Z3YA 2ZKZA 3KP4A 3V7SA 1P92A 2V9VA 2YX4A 2Y48A 4CO8A 5BPDA 4CGZA 3M7GA 1B6AA 2JPBA 3WGGA 3B02A 4QLCU 1FP2A 4ZZDA 1IAWA 2F5CA 2HWVA 3ZMUA 4ZH4F 3IC7A 4QWQA 3IRQA 3JW4A
chains in the Genus database with same CATH superfamily
2VQCA 2OU2A 2K86A 4LMYA 2KDZA 3QYFA 2PMZN 1IGNA 1X4PA 1OCTC 2Y2ZA 3I53A 2QQBA 4BS9A 3KE2A 3L2WA 4YIIA 4FCYA 2QBYA 1H8AC 3V42A 3LFUA 1PYVA 3FXLA 3A01A 4PSXA 1ZRFA 1YIOA 1IV6A 1G2HA 4EATA 1ZREA 3KPHA 5AONA 5FLXZ 1MNDA 1U2WA 3HKZN 2E1MB 2PJPA 1XMKA 1J9IA 2V26A 5FROA 3LA2A 2K5CA 1QO0D 2O8KA 1EJ9A 1GV5A 1BC7C 4HLXA 3H3UA 1BA5A 3FZVA 5D4SA 3V8KA 1U8RA 4XIDA 3G73A 1U5TB 1TNTA 2XF7A 4LK0F 4BQOA 1J2XA 3L7WA 4F91B 3NRVA 2BY2A 2X1EA 3BPXA 3BJ6A 3B73A 2CQ7A 3AG2H 2BBYA 1V3FA 2LREA 3HRUA 4G9YA 4AC0A 1LE8A 2QVOA 4MIMA 3TO6A 2DFHA 1BW5A 4V2GA 1C0WA 3JRCA 1ZAOA 1ZELA 1BI3A 3L09A 4LOCA 4YIFA 5FKKA 4MEXF 1XGOA 3S32A 3ZXSA 2B9SA 1KA8A 2ZSIB 3WGHA 1R00A 1YQAA 3OYJA 1X3WB 1FT9A 3QOPA 4N4OB 1NH3A 2ZXIA 4A6EA 2BVMA 4UVAA 2H6CA 2RREA 4D5CA 2QCOA 5IY5H 1TZLA 3M1CA 2OTLI 5DTDA 1GLNA 2HKXA 2M7BA 2I5UA 3W3CA 3CJNA 2JSPA 1K78A 2OTJI 3HGGA 3WODF 4BACA 3BC8A 2D45A 1YRNB 1DP3A 1D5YA 2BV6A 4YELA 5F04A 3A1YA 4EM0B 3PIOF 4B4CA 1IDYA 3HEFA 2V1UA 1U0JA 4HA8A 5JHUA 3LAJA 2DN0A 2NVUB 5LFAA 2TRTA 3DP7A 4UUTA 1G4DA 1ULYA 2DI3A 2HR3A 2NXNB 2QENA 3ECOA 1ZGAA 2UV1A 1Z21A 1E0EA 3VEPA 3GTPJ 1OPCA 2HOTA 1XS9A 5BOXA 3N05A 2HZTA 5E79C 1O7FA 4AWXB 2JJ7A 3DXJF 2VOOA 2E1NA 4I0BA 2GZWA 4E7JA 3FKIJ 2CQNA 4R1HA 1Y0NA 3P9IA 2E2HJ 3A0HC 2ICWG 3CO6C 2VC1A 3OIQA 2HQNA 2XAGA 5L3FA 3W2AA 3MKLA 3GTGJ 1B72B 4A3MJ 3UR3C 3S1RJ 2GM4A 4ENJA 1HKQA 3CCSI 2XB0X 3K70D 1F9NA 2ID3A 2HPMA 3I4NJ 1V5FA 3TGNA 1W5CC 5FKLA 2EPFA 3ISPA 3QQAA 1W0TA 5IP6A 4AYBA 1HKTA 2R7FA 3MZYA 3L2QA 4A3CJ 4ABZA 5CQGA 2Q0OA 2RQQA 3K70C 3K69A 3BG9A 2HYGD 5H6QA 2LTPA 2VJIA 1D8KA 2XRNA 1VQ8I 3DEEA 4HG2A 4CDGA 1TC3C 4DJAA 4EQQA 4LGWA 2FX0A 3VSLA 4XLAA 2IEKA 4OAZA 4S05A 1QVTA 4BKXA 5IPAA 3JAMZ 3K4KA 1F4KA 3CCEI 3ZMTA 3HRMA 1TLHB 3OIOA 4GYIA 2DFFA 2OCEA 1WI9A 2ZJ2A 3S14J 5D5VB 5JI6A 5LHIA 1IJWC 4GGGA 3RYPA 3OYGA 3BJAA 5EEAA 3IRRA 3RPUD 3PSIA 1MSEC 2DTRA 2FMLA 4IPAA 1FBSA 3M3YJ 5ILVA 2M8GX 4DYRA 2VBZA 2EFQA 1W5TA 2W1OA 4WX9A 4DZJA 5B1BH 1CF7A 4OOIA 5BQTA 1BL0A 2JA5J 4B3AA 4OMZA 1GVJA 2ETHA 1V5EA 2R92J 4BXXJ 2X6WA 1GUUA 3L2UA 1ZK8A 3PFYA 1FBQA 1MKMA 1TT5B 5TJJA 3I56I 3Q9VA 2ZFUA 3MMYB 3J81Z 2XGDA 1PDNC 1IRXA 2DMQA 2LSOA 3I64A 2Q1ZB 4XKBA 5M5YJ 1TTYA 2EA4A 3TQNA 1W36C 4EV0A 1VQ7I 1TWFJ 2IVMA 1ZGJA 5HLGA 2OUMA 4R79A 1K6OA 3A2KA 2PN6A 1QHGA 2OA4A 3RTRA 3FX3A 4H4KC 2WWYA 2XPVA 4Y33A 1ODDA 4UHTA 1WQ2A 2E34A 4G6TB 3QYBA 3RKWA 1YJWI 2PBIA 3KX2A 3KLOA 4F55A 2LP0A 3ZQIA 4MGRA 1FOYA 4F92B 2LK2A 5AIPA 4FE7A 1I1GA 3HL2A 1OJLA 4PFPA 2ELJA 4DBQA 3BCBA 2JA6J 4BXFA 2FBHA 2WC2A 4HPQA 4O3MA 1ETOA 4HEA2 3ZN1A 2E71A 2PJRB 2QQAA 1SFEA 4XSXF 4QSHA 5IYDJ 1I39A 5HVQC 2EA2A 2KHMA 1RKTA 2V1NA 4I02A 5B66C 3FBIB 4DZPA 4WWCA 5EGOB 2ME0A 3CO7C 3K1NA 1IO2A 1RPWA 4EGYA 2HXIA 2PMZA 1OFCX 3FMSA 1QVUA 4BAYA 1YX3A 3EDPA 4P96A 5D4RA 2FNPA 1XDSA 5F1RA 4U0WA 1WZ2A 2DAOA 5HDKA 4C3IJ 3DU6A 2BHZA 5D5UB 3HZJA 5KHDA 1YHQI 3MWMA 4JYKA 3HOYJ 3F8CA 1X19A 1XX5A 3F8BA 4GCVA 4U7DA 1MSFC 4GFBA 1MMGA 3CQZJ 4I09A 2G9WA 4M6VA 3CCQI 3F8FA 1D8JA 4QIWN 4CH7A 2DW4A 1VQPI 3HKZA 2KISA 3OYAA 2O9LA 4UY8I 1YYVA 3LOCA 2CV0A 2GXBA 2JT1A 2V1XA 3DKYA 5ICFA 3K1PA 1X4OA 4A3BJ 3DV8A 1T0FA 3D5LA 3CF2A 1KONA 5TISC 1D0ZA 2HDDA 1IZ1A 4MNUA 3F6VA 4HSTA 4PJNA 4LIUA 5DUIA 1N78A 4PGHA 3WU2C 4A0XA 2XKOA 2JWTA 1WJAA 1LDJA 2K02A 5LGTA 3CJRB 1YOVB 1PUEE 3TOAA 4PFOA 3HB9A 2R5ZB 3CMAI 3WU0A 1MH4A 2WV0A 9ANTA 4N4NB 2CU7A 5FD6A 1ZYRF 4XR6A 3V8LA 1MJAA 1Z7UA 1ZARA 4LG3A 1FJLA 1IN4A 1BIBA 3Q9SA 4M9XA 4Q47A 4C2TA 2VC0A 1GV2A 4KIGA 4OIRF 3RKXA 3BP8A 1HKSA 1BI1A 3GFLA 5FB2A 3GLLA 3KETA 2CQKA 3DKWA 1HQCA 2A05A 3ABUA 4HX4A 3NWSA 3H35A 4IHYA 1IUYA 2XAUA 2K9SA 3OYKA 2DFIA 4NC7A 4RLQA 3VYTB 2ZFWA 4KN4X 1T98A 4U7BA 3SFZA 5JVTA 4CYDA 4KYWA 2KRHA 4XRSG 2XSDC 4XRSA 1MBJA 1UZCA 4ZYGA 1SC7A 4A3GJ 4E6KG 3BCAA 1NG6A 4IXAA 1ON2A 2L9NA 4JOMA 1USTA 3QP6A 2XAFA 3RPUA 1PJRA 1ZQ3P 1LFUP 4W1UA 3ZOBA 2CWEA 3CTAA 4BL0B 2R7RA 2O0YA 3S16J 3LA3A 2JTVA 3RZOJ 1SAXA 3R0JA 3PO3J 1TWAJ 2NRAC 2GAUA 3C3WA 1R22A 4NUBA 3FWEA 3WTVC 2QYOA 2L4AA 3ASOH 2PMHA 4WCGA 1XSDA 5HLIA 1IXCA 2OAZA 1XPXA 1EH6A 1Z1DA 3P9KA 5EEHA 1T6SA 1WGXA 2Z2SB 3FM5A 3RIRA 3H5RA 4BUPA 2VOPA 5EEGA 1JT0A 2AXTC 1RZ4A 1P4XA 2H8RA 1W7PB 3BR5A 3SFIA 4S04A 2Y9ZA 2CUFA 2WADA 4XM3A 2JPCA 5KVRA 5E8GA 2M9HA 2IJLA 3D0SA 2DYSH 2DA1A 1WHUA 3LSJA 3WHCA 2DCEA 4HF0A 2ZMEA 4J01A 5GAHJ 3ZMSA 5CYVA 1Z0XA 4L18B 4B48A 2KKOA 3ZQLA 5F64A 3R6SA 2JA2A 3ZQ7A 3TP3A 4BQQA 1R1TA 3CDHA 4ZYEA 4BU2A 3T1BA 3I54A 5F0FA 1LEAA 3ABMH 4HLYA 3EETA 2K9LA 1V55H 1BOBA 1W0UA 2VN2A 1UAAA 1P2FA 4O5VA 2QKMB 3HXLA 3SHFA 4M71A 2BYVE 2W85A 3TOBA 3FXUA 1BBYA 2EIJH 1I3AA 2ZNYA 3CCJI 4HQMA 1RR8C 2DJIA 2ECBA 4E4HA 2JMWA 1BI0A 3IP4B 1FTTA 1F36A 1FP1D 1SVOA 2M7AA 1OYYA 2M1BA 4Y52J 3J7AY 3H3VK 1A5JA 2OCCH 4XN0A 2VXDA 2A6HF 1TWHJ 1UHMA 2FEZA 2GA1A 1OLTA 2VXZA 1Q1HA 3FKJA 3IKVA 2FJ1A 2DXIA 3M1EA 2HKOA 4G8XA 5J1YA 2VT2A 4I76A 4KT6A 2F4OB 1O3QA 1WSUA 1J59A 1E3PA 3V7CA 3QPHA 1FMWA 2R5YB 4E7KA 4J00A 2DT6A 2DFEA 5HDNA 3SZTA 3QP5A 1JKQC 3G71I 1DDNA 2EFPA 4B1RA 1E3HA 2FOKA 1OCCH 3DKXA 2Q2EB 1UFMA 3H0GJ 2DDBA 4D9JA 1K6YA 3HDDA 1QZEA 2FUG2 3IWZA 3PFIA 4EM1A 3I59A 4F52A 1ZR2A 4NHJA 5HNHA 1R5ID 2E2IJ 3M4OJ 3EUHA 4RBOA 3IL2A 3FXJA 3L9FA 1TW3A 3S1NJ 1SVMA 3MAJA 2X6XA 1WH7A 2A68F 2R7SA 4BHBA 4HDUA 4XBFA 3AL0B 2H09A 4L5IA 3E5QA 5EDNA 1N77A 3U2RA 1Q1VA 5E1ZB 2R7WA 3L2VA 3UKGA 1MNEA 1WJ5A 3GTMJ 2DDAA 3E6CC 3O8HA 5M5WJ 1VQ4I 3RQ4A 1E3OC 3MD2A 2BW3B 4ENKA 1R71A 3CCYA 1JGSA 4FHTA 2MLKA 4JP0A 2YR2A 3I4MJ 4Z2YA 1B8IA 5LEKA 1YIJI 4A6DA 2ZSHB 2BEOA 3VDXA 3U1KA 1J0RA 1VTNC 2L7FP 2RNGA 1YG2A 2F4MB 4OIOF 1FZPB 2DT7B 2GQQA 1KU9A 1U6GA 1G6NA 1MBHA 1RI7A 4A0ZA 4XORA 3KYDB 2DA7A 2X51A 1T08B 2V9KA 2E2JJ 4M3BA 1VQ5I 1B4AA 4BGDA 3CCRI 4B09A 2GIZA 3JCUC 2JA8J 3I0TA 3K4LA 1PUFA 2M8EA 3DBRB 2L54A 1RKWA 3EUKL 5DS9A 1ZRDA 1D5VA 1S7AA 2HTJA 1VNDA 3BDDA 3FXKA 3TKYA 3PQJA 5F1JA 2COBA 1VQNI 4PJ0C 3A01B 2VE8A 4YFKF 1WJBA 2E1OA 5BPIA 4EGZA 3BR1A 4XOPA 3CMYA 2CGPA 2OBPA 2K9MA 2FNAA 4YRVA 4GYGA 5LEJA 3MZ8A 2NVTJ 3K10A 4L9NA 4F3QA 2G7UA 2IPQX 1MZBA 2L7MP 2PX9A 1RUNA 2KZVA 4Y13A 1WRJA 1U3EM 1NTCA 4DYCA 3CC4I 2BHYA 4D5FA 4HF1A 3G4SI 1Z05A 2V9PA 4CCLA 4OMYA 4ENNA 4RB1A 3E6DA 1RNLA 2CSOA 1HSJA 2HOAA 3DLAA 3BG7A 1O3SA 3HOWJ 1A36A 1R36A 1X58A 2EB7A 4XQFA 1Y8RB 2AQEA 1XCVA 3G1MA 3H0DA 1LE8B 4BYYA 1XDUA 1Z9CA 1FY7A 5E1XA 4MFDA 3S8PA 2F48A 3PM1A 2GOXB 1H89C 3KIOA 5J8CA 3QPTA 2UWMA 3QAHA 2FA5A 1RETA 1ZTRA 3IV5A 2ISZA 3A03A 1NK2P 3J7AO 2BY3A 1YW9A 2R3SA 4D7MA 2VLAA 1ZLKA 1BW6A 3CMMA 3KEQA 3JSOA 3OYLA 2FBIA 3ERMA 3RPQA 1AOYA 2CV1A 3P7NA 4UV8A 3DEWA 1O7LA 3GCMA 3J7YJ 3LAPA 1T2KA 3MQ0A 3L1PA 3EYIA 3ZP5A 2W25A 2AXLA 4XLPF 2L9RA 2X9DA 3REOA 3ZQHA 2O6GE 2Z16A 3CESA 1X2MA 4IHSA 1K78B 3JAMK 2QKLB 2LBFA 2YU9J 1SVLA 3RYRA 1I6HJ 3H5NA 2FQ4A 4HAMA 1W4MA 4E70A 4MFEA 2GLOA 3LSMA 2H8WA 3EUAA 3QU3A 1V5GA 2TCTA 4IO9F 1GXQA 2JVGA 4M74A 1IG7A 3W2VA 2OQGA 3KP5A 4D1QA 4IOCF 1AU7A 4MO7A 1VQLI 1Z67A 4YFXF 3CCVI 1RUOA 3L00A 2QSFX 1EA3A 3DPLC 3BZCA 2BOLA 2WY7Q 2EK5A 2LOOA 1OMIA 4OAYA 4KIBA 1HSTA 4E7ZA 2HZDA 5FD5A 3J81K 3JRGA 3SJMA 4MHGA 1QQIA 3M8JA 3MN2A 5IYBJ 3NQOA 1FTZA 2VPRA 3O6BB 2ADUA 3BJOA 1ZH5A 2A5WA 2HXOA 4OIQF 2V6EA 2RQPA 3HIFA 2NVQJ 3BT9A 5KNLA 3TW6A 3WU1B 4XRMA 1TNSA 3R61A 2DMTA 2M4GA 2NS8A 3OV8A 5CPRB 3L2CA 3E6MA 2IS4A 1S29A 2YUSA 2VUMJ 4HX8A 3HOVJ 3BZ6A 5EG0A 4IF4A 1EV7A 2HDWA 2H6BA 4LJZF 3BR6A 3PIPF 3QOEA 3A0BC 4P1WA 3ECHA 3CDIA 2ISYA 2BXZA 4BHPA 1TQPA 3CJQB 3CLOA 2EILH 2VB6A 5B3SH 2ZBKA 1I3QJ 2FQ3A 4P5OA 2FF4A 3S2WA 5LRSA 4EVIA 3LNQA 1T0FC 4IZZA 4A3EJ 1KU2A 1TP4A 4A69C 4GO1A 2YPRA 3K7AJ 3GTQJ 4LITA 2O61A 3CP2A 2GBYA 2KQRA 4B43A 5LBQA 1IV8A 3E97A 3JRHA 1R1UA 2VJ4A 2J5OA 4DGWB 2CO5A 3I5UA 3RCOA 2HQAA 1MDMA 4NC8A 1NK3P 2QSGX 3OIPA 1XB4A 4XNFA 1LVAA 2CUEA 2NS0A 3GF2A 3VOEA 3E5XA 3FHNA 3K6GA 5HS9A 1JI8A 1CF7B 2DK5A 3D5SC 3FXOA 4CCKA 5E18F 2GOMA 2KJCA 4BE0A 2KRCA 3FXQA 5F6FA 4LLNA 2EFNA 3QPLA 3HHGA 3NEUA 4UV9A 4CCMA 2IAIA 4CHUA 3GUDA 3BR2A 1MJBA 2ECCA 4XLFA 4LG0B 4U88A 1ITYA 3ZCOA 2W82A 2WAQA 3ZR8X 1L3LA 5IT9K 1JGGA 3LL7A 1R4NB 2Z5UA 1SANA 3AG3H 2O3FA 2EFOA 4G6QA 2R7OA 5FRMA 3IH2A 4RGUA 1LEBA 1WJEA 2X4HA 1S9HA 1STZA 4HW0A 3CUQA 4EJTA 5ERIA 2E1CA 1WJCA 4LIVA 3CMEI 4BQAA 2GXGA 3E6BA 5EF6A 4AM3A 5E17F 5F08A 1ETWA 2J5PA 3FBNB 3CCMI 1A6IA 2E7XA 2HFHA 1LDDA 2M3AA 5KAIC 5JLWA 3HOUJ 1FIAA 5M3FJ 5E8IA 1QPIA 1BR2A 2W00A 3LSPA 1WJDA 3B6AA 2R7ZJ 1SFXA 2M30A 2QQ9A 1TWGJ 1T8IA 2XF6A 3LSKA 1ZG3A 3J7ZI 3M07A 2LKXA 4Y15A 2NNYA 3F21A 4H0EA 2L01A 1XSXA 2HNHA 3EQLF 1F1ZA 1UG0A 1IW7F 4NQWA 2NVYJ 1FOWA 4BHCA 2NAZA 1Z3XA 2BE5F 3G6EI 1SMYF 5D5WB 4M9SA 2Q8KA 3ZPLA 3G1OA 2LC2A 5DDGA 2IRFG 2IGNA 2VASA 2ZMEC 3BLYA 3N97A 4BH9A 3PJRA 4IHXA 3TW7A 1MMSA 1CGPA 3PQKA 2MC4A 1MH3A 2R0QC 1UCRA 3HPGA 1N75A 4BEHA 5FO5A 2HDCA 3CD6I 2K3PA 2FU4A 1BM9A 2HOSA 3OYNA 4PDKA 3VB2A 1AHDP 3S15J 4RM2A 1SD4A 3JREA 2DA6A 3TEDA 2F5VA 5KAFC 3HJEA 3S1MJ 5GP9A 2CRGA 3WG9A 1HC8A 3HUGA 3V4GA 2V6CA 4PGGA 3BTJA 1H9GA 3W6VA 1HW5A 1FX7A 3C7JA 2MFZA 4RB0A 2W57A 2X85A 2IGKA 4G7OF 4L5EA 1DQUA 4IHWA 2LD5A 3JRDA 2JRTA 1W7PD 4L5JA 3KEOA 4P9FA 1BJAA 4M73A 1FOXA 1ORKA 4I7HA 3I71A 3C1DA 4NC6A 5LGNA 2F2EA 5D5XB 2XGEA 5BS6A 4YG2F 4EJOA 1QZZA 2R7UA 1XN7A 2ELKA 2WBMA 1XSVA 2DTZA 3OR1C 2R7VA 1BR4A 3OYDA 1MBFA 1TW2A 1Y1WJ 1FMVA 3GMEA 1PVEA 5K7ZA 1JHHA 2W7NA 4KIFA 2XIGA 2VIXA 2QA4I 2D5VA 2B7EA 3F8NA 3NWTA 2RDPA 2RVCA 3W6KB 5IT9Z 3ULQB 3MFKA 4IQ4A 1ETVA 2DJNA 2G7HA 1AKHB 5D6FA 5EZGA 1ETKA 3JRIA 2JN6A 2DT5A 2VPLA 2ZC2A 4CUGA 3K4MA 3DWLE 5L3EA 1ZR4A 3ONQA 1HCRA 1JUSA 2Y69H 2FSWA 3GW2A 1LUJB 2O8XA 1OKRA 2Y9YA 4XLCA 3F6OA 3RZDJ 1IN7A 1BI2A 3EUHC 3JTHA 1FPQA 1USSA 4HQEA 2KZGA 2E7WA 2V4JC 3HSFA 2BXYA 5E20A 3CLQA 2HPIA 3COAC 1IUFA 4Z6YA 1UHSA 4DYQA 4AIJA 4K2EA 4XRFA 3LSIA 2CQXA 3LQRA 4CZCA 4FASD 1ZG1A 3E3VA 3KZYA 5AIQA 2IS6A 2XASA 3HOTA 3A4CA 4CZZA 4A2UA 3BQZA 3ESWB 2X1DA 2Y0SN 4D0PA 2IGMA 2Y75A 1PP8F 1X3UA 2YS9A 2HGCA 1SFOJ 3F9KA 3GTJJ 5F0HA 1IXSB 1RESA 1B1BA 3GFMA 4PCQA 1R4MB 4HRIA 2HVQA 2ESNA 2MH9A 1BJZA 4A3JJ 1IRFA 2F5FA 1KYWA 4AD9A 2KJBA 3BG6A 5K5RA 5TRDA 2DLLA 1SFKA 2A5YB 1BN5A 1ZGWA 3HTSB 2PEXA 5J1UA 3CP8A 3R0AA 2CFOA 4KA4A 1FIPA 3PNYA 5L3GA 1VFCA 5CVRA 4G6DA 1I5ZA 2L9SA 3KYCB 4KICA 5CLSA 4YIRX 3RI4A 3F72A 2CS3A 5A2QK 3SZPA 3H92A 1MMNA 3EPZA 1XC5A 1WPKA 5HLHA 2XROA 1MNMC 4I98B 3KP7A 4KMFA 3CCUI 1O57A 1HLVA 2OJED 5ICCA 4M72A 2A6TA 2MBFA 3Q0UA 4BQNA 1X1CA 2WB1N 1LB2A 1L0OC 5D8KB 3S3NA 3GZNB 3FK6A 4IOAF 1VQMI 1TL8A 1G8XA 4ZDPA 4JX5A 2ZJPF 3G2BA 1F43A 2OC6A 1MMAA 1EF4A 2WV1A 2X6YA 2DA3A 5EYRA 3H5AA 1MJ9A 1Z7LA 3T8TA 4HOBA 1ACIA 2DK8A 3CUOA 3JTGA 4L9JA 3DBLB 3S93A 3Q0VA 2AHQA 4FX0A 1VQKI 4J19A 2HVRA 5JHFA 2L0KA 2ZXHA 3CZ6A 2XRLA 3HM5A 1HBXG 2AQFA 2OPTA 1W1WE 4DW6A 5H20A 3N4MA 3LSRA 3DEUA 2PQ8A 2VE9A 4Y7NJ 5C4XJ 1J5YA 1HW2A 3PUFA 3I59B 3K4CA 3WTTC 2K4JA 2DBBA 5K5OA 1EKEA 1W7PA 3FHZA 5CVUA 2Y31A 4BBSJ 4RGXA 1YS7A 1DGRM 5L3BA 4IRIA 1SAUA 4X0GA 5E3NA 1KYZA 2JUCA 2HTSA 1B9NA 2P5LC 2Z99A 4MQ9F 3RKQA 2CFXA 4EJVA 1S6LA 3GFIA 2XAQA 1G3WA 2I8DA 2A61A 2JSCA 3DTIA 4U87A 4ZYDA 1F5TA 5ICGA 4C3HJ 3H3ZA 3KP2A 3D5RC 4M9ZA 1ZRCA 2EZKA 3K1MA 2M0CA 2VBWA 5ED4A 5KK1A 1B8IB 1MBGA 1SD7A 3CF5F 3KZIC 5J1RA 1BIAA 3DPTA 4HSRA 4ZJZA 1P9QC 4Y17A 5EJCA 1OQYA 1X2NA 2HYJA 4GRIA 2HS5A 3BR0A 3FISA 3KZZA 4IVNA 5ILSA 1A35A 3AG1H 3MKYB 5DCMA 2QZ8A 3VYRB 2UUZA 4XICA 4BDYA 2MG4A 1J7KA 2DA2A 3R60A 1Y8QB 2WAQN 4KJZA 1OISA 5J47A 4KT5C 2MLGA 3M9AA 4CYCA 2XDVA 4PK4A 3OSFA 2KDOA 5A2QZ 2IT0A 5H2FC 4IHTA 2E19A 2RGVA 3TP0A 5GPAA 4ESFA 3WE3A 3WTYC 1R1VA 1LKXA 1WH5A 2DA4A 4IRHA 2WA0A 1PUFB 4HNUA 2NYXA 1ENHA 2HQ5A 2P6TA 4A0YA 3WTXC 2P7VB 3IUOA 2F4IA 1S72I 2MA3A 3KP3A 3FK7A 2PI0A 1KQ8A 3OMYA 5FKNA 5J3LA 3J80K 1MBKA 4G7ZF 2Z9OA 3DFGA 1QNTA 1G59A 1KGSA 5J4YA 3V8JA 2VKDA 3TO9A 2KP6A 4G94A 5K1YA 4QTRA 3WHBA 2DMPA 2W4SA 4FQGA 1R5HA 3P5JA 4RAYA 2K40A 4UUVA 1T33A 1OYWA 2STWA 3GWZA 1M1EB 3ZRGA 2Q2EA 5FLMJ 4MTDA 4V19K 2KPMA 3F0CA 5IT3A 1UELB 3MKWB 2NOGA 3RKYA 2E5ZA 2DU9A 3ZN0A 1JT6A 2Z1DA 3GVAA 3KP6A 2E60A 2V1DA 1QU3A 4EJWA 4RAGA 4RB3C 1S5LC 3VFZA 1FWZA 4M3EA 2L4MA 2P5KA 2QBYB 1I1SA 2CUJA 3S17J 1FYKA 1X1AA 2RN7A 2CW7A 1EH8A 2V7FA 5LLQA 3DLLF 2Z33A 2HVSA 2WAEA 4HZFA 4L0YB 1R7JA 3K2ZA 4IEJA 4ESJA 2FE3A 2CW0F 3W6JB 4CCNA 5J8FA 1VF9A 4HX7A 1DU6A 3LFKA 3D1NI 2LR8A 2O7OA 2EV6A 2EH3A 2NS7A 5D6EA 2OF7A 5K5QA 1JHFA 5E1WA 3NAUA 5L3DA 1K79A 1HOMA 4BE1A 2EWNA 2HEOA 1FC3A 2UXNA 2A6EF 3E5UA 2FMYA 1XCBA 5FFZA 3FM3A 1IDZA 4CICA 4A12A 4G12A 3QODA 1VQ9I 1FYMA 1SMTA 1X1BA 2QM3A 1LPQA 1FNNA 3WTSC 4HF2A 1I50J 2M0MA 4UB8C 1YTYA 2RC4A 1ZLJA 4LLGF 3JRFA 2LYCA 4N0BA 3AAFA 2EV0A 1KQ9A 2O5RA 2LBFB 3HOZJ 2LY9A 5L3CA 3QYEA 3PUBA 2LMDA 1JKOC 4UUSA 1AWCA 4ZC3A 3CUQC 2HYFA 2Y0SA 2LKSA 3O2PE 3RDIA 1T95A 3DF8A 2QEXI 1LFBA 2LRDA 3U21A 3C2BA 4P9UA 2ZCWA 1XD7A 2EJRA 3Q0WA 1JUMA 3TMOA 4KMUX 2L02A 1JKPC 4PJMA 1A6QA 1FSEA 4GDFA 2WAFA 3NARA 1OR7C 3B6CA 2A3SA 3QWLA 1GT0C 5CJ9A 2HU9A 1R23A 5HNFA 4NNJA 3OYMA 3F8MA 3VYSB 3HRTA 3J80Z 4FISA 1YJNI 2NVXJ 3H1CA 4E7IA 2X48A 1WCMJ 2ZJRF 2AS5F 3ROUA 2FOWA 4BY1J 2FBKA 5HODA 3WGIA 2Y30A 5M5XJ 5J4VA 1UJ8A 5D8LB 4GXOA 5IP7J 2VL8A 2QQ8A 1D3YA 4HV6A 3EYYA 1HF0A 4QPQA 1DPRA 1TBXA 5EG0B 1RC9A 2WB1A 3I4PA 1NHAA 2QF7A 1WWXA 2TDXA 3FMQA 1H9TA 5K7FA 1ETXA 3LSGA 1P6RA 2FXAA 2Y0MA 5LHHA 1J09A 2LY2A 2C6YA 1HW1A 4D7NA 1BC8C 3C2HA 3FF5A 2YU3A 4XOTA 1JKRC 2EZHA 2DOFA 2KMUA 3LSHA 4EJUA 2JK3A 5E3MA 1YJ9I 4BNCA 2IP2A 3K0LA 3JR9A 1KU3A 3BQYA 1R58A 3ZMVA 3HBLA 1RIOH 1U5TA 3OYHA 4BE2A 1MDMB 5C4JJ 2WY8Q 3E1SA 1VQOI 1YLFA 3FXRA 3FIWA 1QGPA 1Y1VJ 2R7QA 3KFWX 3SXYA 4XKCA 5C3EJ 4LB5A 3ZQFA 1LFPA 4X6AJ 1ETYA 2MC3A 4KITB 2MYSA 4AUXA 4RGSA 3ELKA 4EEFG 1D0XA 1APLC 3GTLJ 4DIQA 5GTIC 4YFNF 4O6JA 4U0YA 4KFCA 3TO7A 1U78A 2YX7A 1MIJA 2XHKA 2LLKA 1SD6A 4XONA 5FKMA 3BPVA 3HSEA 2MH2A 1W5SA 2P5VA 1IXRC 3PNTA 4JK1X 4HV5A 4ZZLA 3GYHX 3BR3A 2IA1A 1ZN2A 2P6SA 2KFDA 1HDPA 2VJJA 4IJAA 1I27A 2XSJC 2EFWA 4XK4A 1LVKA 4CSWA 1Z6RA 2M87A 3ABTA 2X1CA 4UVBA 1NG7A 4UXNA 3KYLA 1U9NA 3CUQB 2VKVA 1ZKGA 3GFJA 2H27A 2D1VA 4AIKA 1YRNA 2M45A 2K3FA 3K9TA 2EINH 3OS2A 4IRGA 1MMDA 3A02A 3RJPA 3CC2I 3OY9A 3SYTA 4EMSA 2OD5A 4ANJA 3BTCA 4C3JJ 3OR2C 3HOXJ 2YSRA 4N9IA 5FGMA 3WTUC 3F22A 1KU7A 2JRMA 4F7ZA 5LHGA 4L9VA 3HC7A 2P0WA 1K4SA 5CVJA 1IF1A 4II2A 4NB5A 2X0LA 3I3LA 4F93B 2XKPA 3ERED 2B0LA 2CQQA 1X1PA 1HXDA 3FMRA 5IYCJ 4FX4A 4IL6C 5GAGJ 3CCLI 2PFBA 5BNGA 1J75A 2PLYA 2CJJA 2VKHA 1HA8A 4MEYF 3S3OA 3OOPA 3PSFA 3DPUA 4ZTFA 5K7HA 4NQWB 1BOAA 3HG9A 4AIDA 3WTWC 2KRFA 4LFUA 2QWWA 4BJ6C 2VONA 3I9V2 4PZJA 2LFBA 3G3ZA 4Q48A 2L7ZA 3IHUA 2M5WA 4XL9A 2LF7A 1SFUA 1O4XA 1B72A 4YEJA 5LRRA 2DOAA 2EIMH 2OQRA 3KLNA 1WVRA 3T8RA 2QLZA 4WK8F 3HGYA 3HSRA 2KIUA 3GO5A 2G0EA 3H9JA 4BEHB 1ON1A 4II3A 3OYFA 5ILUA 1OR7A 2P81A 4UNOA 2HQRA 2E35A 3L2RA 5FLVA 5LGUA 1S7OA 2VQHA 5JFRA 1AA7A 5CQEA 2EIKH 1MBEA 4NDLA 3H36A 4XMYA 4DOZA 3ZQCA 6PAXA 1FBUA 3HUGB 3BY6A 1P4AA 1K61A 2DPUA 2L3DA 4L9TA 4MQVA 1JJ6C 3T0YA 3S3MA 1YITI 4B47A 4M3GA 4QPOA 4CA0A 1WJFA 1A04A 1R6RA 1W36D 4OWRB 4LG0A 1YI2I 1D0YA 4ASNA 4ENMA 2ZXJA 2VKEA 4A3LJ 1RR7A 5DV5A 2MW8A 5J40A 3AG4H 2F6CA 4Y4RA 2ME6A 1R9TJ 4LB6B 2XUBA 5FJ8J 3HPHA 1UMQA 1Z6TA 2A69F 4FT8A 1Y56A 3PNVA 1GVDA 3OL3A 2ID6A 2GWRA 2VJ5A 2VT3A 5E3OA 3GTKJ 1GHCA 3W2WA 3BTLA 2OZUA 1IC8A 4S0HB 3OL4A 3S2DJ 1Y39A 5DD8A 5J6XA 3JRAA 4A3FJ 3MZHA 2HOEA 1VI0A 2EV5A 4WF2A 4BBRJ 2KIQA 1OCPA 3DU5A 2UXXA 1D1BA 2M2EA 4V2FA 1G3YA 1X3ZB 1SEUA 1DGWY 1UG2A 2H1KA 3HRSA 4BJ5C 1P7JA 2XGCA 5FRNA 5M3MJ 4AU7A 2FD5A 1FYLA 3E7LA 1JTXA 2BVLA 2R7DA 2NOJB 5DM7F 4IHVA 2JZYA 1LDKB 3GX4X 1XGNA 2P8TA 5EZHA 3QPSA 2JVHA 2K7LA 2XB5A 2UZKA 1FLIA 1V54H 1XGSA 3KCCA 2QSHX 1H88C 1VQ6I 2FRHA 1O3TA 2GXAA 1S8NA 1IN5A 2K9QA 3MKZA 3HOSA 4RB2C 2QUFA 2KT0A 3OYEA 2LH9A 2PMUA 4IX7A 1E17A 1ERDA 1FSHA 2ESHA 3F23A 5HS7A 2JA7J 3BTIA 2H1LA 1UB9A 1U9OA 3Q5FA 3ABLH 1P7IA 5GAEJ 4RLFA 4AIHA 3IWFA 2PJRA 1SD5A 2K85A 3QU6A 1G3TA 1FOKA 4BY7J 5HOOA 1DUXC 2L5QA 2EQRA 4HDVA 2M34A 2ZB9A 4G7HF 3K4NA 5IOZA 4A3KJ 1JJ8C 3MEXA 1OCOH 1T38A 5EGOA 1YE9A 4KDPA 4L0ZB 4I01A 2D1HA 3BOQA 4E7LA 4BDZA 4M3FA 3RQIA 4TV7A 3AFHA 3JRBA 2KIFA 1N25A 2IA2A 3DBHB 2DQRA 4C30A 2DODA 3ZQGA 2LF8A 4XLEA 3RSNA 3OS0A 3HYIA 4IQJA 2COMA 1LQ1A 1XGMA 2LY1A 1S7EA 2CV2A 4I0AA 2MSYA 4JX4A 2ZXWH 2KLOA 4FE4A 2OV7A 1MD0A 4DNCA 1IN6A 3OWTA 2E5NA 3OS1A 2LNBA 2XAHA 1G3SA 3IH4A 2DMUA 2IA0A 4XLNF 1KZHA 2IGOA 2DYRH 3H9GA 4PJLA 3WE2A 3FDYA 2QGUA 3KEYA 3TL4X 4ITVA 1IRZA 2JUGA 1AKHA 4ESBA 1D1AA 2ZMEB 2K9NA 2XVCA 3OSGA 1YS6A 5JVGF 1OYIA 5BMZA 5CVIA 4DQ2A 3O3KA 1ONVA 3SZGA 5KCMA 1ZG5A 4KISA 3WG7H 1TQMA 1H0MA 2R5ZA 1UHWA 4HNVA 3U9GA 3IKTA 3CJTB 2IBDA 1ETQA 5DUKA 5E3LA 2XAJA 2DO7A 3BZKA 4FETA 5LD2C 2DQLA 4OIPF 2VBXA 1P4WA 3LSTA 4JX6A 3ZQQA 2A07F 5HS8A 2RAEA 3M8EA 1RRJA 4XKWA 3V7RA 3BROA 4ZYHA 2RKHA 4KN7X 1LJ9A 4XKVA 5DD4A 1D1CA 4RDUA 4A3DJ 3LMMA 2BZTA 5GPCA 1B59A 1Y0UA 3LWFA 2EZIA 4P55A 3AL0C 2IXSA 3SDBA 1JE8A 5DEQA 1YO5C 3GZ5A 4U0VA 1DPUA 4RA2A 3E0JB 4M6XA 2JQ7A 5DM6F 5C44J 1S3JA 2KIMA 2XPUA 2CG4A 2MABA 2W84A 4RAFA 1TWCJ 4PSWA 1LNWA 1QHHD 3LQQA 4A5MA 2NNNA 2LG4A 3QRFF 2R7XA 2IW5A 4HBLA 1EH7A 4LK1F 4C9YA 3JSPA 4RGRA 3OYCA 4B3XA 4AVZA 3R4KA 1WFXA 3OYIA 1GXPA 1QA6A 1Z91A 4I2OA 3ML6A 1Z3YA 1XTAA 2B63J 4ZDOA 1X1DA 3PL8A 3BG5A 4XSZF 2BGCA 3PO2J 2K27A 4RS8A 3VPRA 4Y3OA 1O3RA 1REPC 5TGTA 4ETSA 3AKZA 2VBYA 4AVPA 3TDZC 5HDGA 1B9MA 1XG1A 3F3XA 2M4KA 1XMXA 4CCOA 2HI3A 5FFXA 1V4RA 4B44A 5F0CA 2BY0A 4OINF 2EZLA 2DA5A 4KUMA 3U1DA 1E2XA 2IS2A 1YW8A 1K7AA 4FTHA 2K4BA 1OCZH 2LVSA 4RMNA 2X6OA 4PJJA 5DCMB 1IN8A 1I6XA 2F5EA 3S1QJ 2OZ6A 3G1LA 4JBAA 3VWBA 3K4BA 2R7TA 3GBGA 1QPMA 4HYEA 5CKTA 5ICEA 1XMAA 3P9CA 3IAS2 4JQFA 5F27A 2LKPA 2GA2A 3HTUA 4M3DA 4LLLA 4CYCB 3H9QA 5HLTA 3O8GA 1IRGA 3MCZA 4CXFA 1ZHFA 1U8BA 1QBJA 1T39A 1T56A 4OU0A 2KL4A 1HDDC 5JR3A 3FXMA 2P7CB 2CMPA 2LDUA 4B8XA 2BY1A 1DP7P 4I6ZA 4X1EA 3GXOA 4BXUA 3GLXA 2IS1A 1TQIA 4A5NA 3HHHA 2ELHA 2E36A 3IH3A 3GZ6A 3VYUB 2ZO4A 4M6YA 3VODA 3IAM2 1K83J 4MTEA 4AYBN 2AO9A 1MGTA 2STTA 1R49A 4C2MJ 2VODA 3DQVC 4UB6C 2CUZA 2VQLA 4LD5A 4EM2A 4NBQA 4DBRA 4XN3A 1FEXA 2VI6A 3DTEA 2GIVA 3ZMZA 4KNYA 3TDUC 1OCRH 2MD0A 3S2HJ 2F5DA 1BR1A 3SQNA 2E1MC 4BJTA 4N9HA 5H6RA 5FLXK 1R5GA 1CQTA 2CYYA 1YX5A 3ABKH 1KQ0A 2WTEA 5GADJ 2XPWA 2W24A 2XGXA 2ZNZA 4I99C 2PG4A 3C2GA 5CVVA 1PP7U 2R5YA 4WXCA 3TBIA 4PUSA 1WI3A 1U5TC 4XLHA 2RV8A 3LA7A 5DYMA 4UVCA 4W97A 2MGQA 3ZMDA 2DPDA 2DMNA 3VSKA 1WKMA 3T5XA 2H94A 2N8GA 4CCJA 1JUPA 1VZ0A 4ZTJA 2L2OA 1YFHA 3SEQA 4RAZA 5B5EC 4IKFA 3UNGC 3WTZA 4Q5SF 2P4WA 3C18A 2RNJA 2EBIA 4Q4ZF 1YW7A 5FKOA 3BG3A 1TT0A 1QZYA 1Y6IA 3M8FA 1Z77A 2ACJA 1QRYA 3K2AA 4A93J 5IP9J 2CW8A 1DU0A 2ZJQF 5B1AH 2MD5A 1JTYA 5JLXA 1JXSA 4R8HA 2DOEA 4E7HA 3GEZA 2L9VA 2V79A 3CC7I 4WXHA 4ON0A 4UUSB 3OYBA 4WXDA 5DCFA 2XV4S 3I58A 2D2WA 3BWGA 2O03A 4A3IJ 4ZYAA 2Z3YA 2ZKZA 3KP4A 3V7SA 2I10A 1P92A 2BW3A 3K4JA 3ZGKA 3MVPA 2V9VA 3SEZA 1K4TA 2YX4A 1A31A 5IOYA 2R4GA 2Y48A 3SDGA 4CO8A 3Q3SA 5BPDA 4C2UA 3I55I 3GTOJ 4ZDLA 4CGZA 1GDTA 3M7GA 2L7KA 2XF5A 1B6AA 2XC7A 2JPBA 3OOUA 5GTHC 3WGGA 3CDLA 3B02A 1MW7A 2W48A 3ASNH 4QLCU 4E7SA 1FP2A 4ZZDA 1IAWA 2CH0A 3X2QH 4MLOA 1POGA 2R93J 2F5CA 2HWVA 3ZMUA 4ZH4F 3IC7A 4QWQA 4HNTA 3IRQA 3DCFA 3DTKA 2VQGA 4RM3A 3JW4A
chains in the Genus database with same CATH topology
2OU2A 2K86A 4LMYA 3I53A 2QQBA 3KE2A 2QBYA 4YIIA 1ZRFA 1YIOA 1ZREA 5AONA 5FLXZ 1U2WA 2PJPA 1XMKA 1J9IA 3LA2A 1QO0D 1BC7C 4HLXA 3H3UA 3FZVA 5D4SA 3V8KA 1U8RA 3G73A 1U5TB 1TNTA 4LK0F 1J2XA 3L7WA 3NRVA 3BPXA 3BJ6A 3B73A 2BBYA 1V3FA 3HRUA 4G9YA 2QVOA 3TO6A 1C0WA 1ZAOA 1BI3A 3L09A 4YIFA 4MEXF 1XGOA 1KA8A 3WGHA 1R00A 1YQAA 1FT9A 3QOPA 4A6EA 4UVAA 2H6CA 2HKXA 3CJNA 1K78A 3WODF 2D45A 2BV6A 4EM0B 2V1UA 4HA8A 5JHUA 3LAJA 3DP7A 1G4DA 1ULYA 2DI3A 2HR3A 2QENA 3ECOA 1ZGAA 3VEPA 1OPCA 5BOXA 2HZTA 1O7FA 4AWXB 3DXJF 2VOOA 2E1NA 4I0BA 2GZWA 4R1HA 3P9IA 3CO6C 2VC1A 2HQNA 2XAGA 5L3FA 4ENJA 1HKQA 1F9NA 3TGNA 3ISPA 1HKTA 2R7FA 3MZYA 2Q0OA 3K69A 2HYGD 5H6QA 1D8KA 2XRNA 4CDGA 4EQQA 4LGWA 4S05A 3JAMZ 1F4KA 3ZMTA 3HRMA 1TLHB 4GYIA 1WI9A 2ZJ2A 5D5VB 5JI6A 5LHIA 4GGGA 3RYPA 3BJAA 3IRRA 2DTRA 2FMLA 4IPAA 1FBSA 5ILVA 2VBZA 2EFQA 1W5TA 4WX9A 1CF7A 4OOIA 5BQTA 4OMZA 1GVJA 2ETHA 1FBQA 1MKMA 5TJJA 3Q9VA 3J81Z 1PDNC 2LSOA 3I64A 1TTYA 2EA4A 3TQNA 4EV0A 2IVMA 1ZGJA 5HLGA 4R79A 1K6OA 2PN6A 2OA4A 3RTRA 3FX3A 2WWYA 1ODDA 4UHTA 1WQ2A 3RKWA 2PBIA 3KLOA 4MGRA 5AIPA 1I1GA 2FBHA 2WC2A 4O3MA 3ZN1A 2QQAA 1SFEA 4XSXF 5HVQC 2EA2A 4I02A 4WWCA 3CO7C 3K1NA 4EGYA 3FMSA 4BAYA 3EDPA 4P96A 5D4RA 2FNPA 1XDSA 5F1RA 4U0WA 2DAOA 5HDKA 5D5UB 3MWMA 3F8CA 3F8BA 4GCVA 4U7DA 4I09A 2G9WA 1D8JA 3F8FA 2DW4A 1YYVA 2GXBA 2JT1A 2V1XA 5ICFA 3K1PA 3DV8A 1T0FA 3D5LA 1IZ1A 4MNUA 3F6VA 5DUIA 4PGHA 4A0XA 2XKOA 1LDJA 2K02A 5LGTA 1PUEE 3TOAA 3WU0A 2WV0A 5FD6A 1ZYRF 3V8LA 1MJAA 1Z7UA 1ZARA 1IN4A 1BIBA 3Q9SA 4M9XA 4Q47A 2VC0A 4KIGA 4OIRF 3RKXA 3BP8A 1HKSA 1BI1A 3GFLA 5FB2A 3KETA 2CQKA 3DKWA 1HQCA 3ABUA 4HX4A 1IUYA 2DFIA 4U7BA 2ZFWA 4KN4X 1T98A 3SFZA 5JVTA 4CYDA 4KYWA 4ZYGA 4IXAA 1ON2A 1USTA 3QP6A 2XAFA 3RPUA 2CWEA 3CTAA 2O0YA 3LA3A 2JTVA 1SAXA 3R0JA 2NRAC 2GAUA 3C3WA 1R22A 3FWEA 3WTVC 2QYOA 2L4AA 4WCGA 2PMHA 1XSDA 5HLIA 1IXCA 2OAZA 1EH6A 1Z1DA 3P9KA 5EEHA 1T6SA 3FM5A 3RIRA 2VOPA 5EEGA 1RZ4A 1P4XA 1W7PB 4S04A 2JPCA 5KVRA 5E8GA 2IJLA 3D0SA 4HF0A 2ZMEA 3ZMSA 5CYVA 4L18B 2KKOA 5F64A 3R6SA 3ZQ7A 1R1TA 3CDHA 4ZYEA 3T1BA 3I54A 1LEAA 4HLYA 3EETA 2VN2A 1P2FA 4O5VA 3SHFA 4M71A 2BYVE 2W85A 3TOBA 3FXUA 1BBYA 2ZNYA 4HQMA 1BI0A 1FP1D 1OYYA 2M1BA 2A6HF 1UHMA 2FEZA 2GA1A 2VXZA 3IKVA 1Q1HA 3M1EA 2HKOA 4G8XA 2VT2A 1O3QA 1WSUA 1J59A 3V7CA 3QPHA 5HDNA 3SZTA 3QP5A 1DDNA 2EFPA 2FOKA 1UFMA 3IWZA 3PFIA 4EM1A 3I59A 4NHJA 3EUHA 3IL2A 3L9FA 1TW3A 3MAJA 2A68F 4BHBA 4HDUA 4XBFA 2H09A 4L5IA 3E5QA 3U2RA 5E1ZB 3E6CC 4ENKA 1JGSA 4FHTA 2MLKA 2YR2A 4Z2YA 5LEKA 4A6DA 2BEOA 1J0RA 1VTNC 1YG2A 4OIOF 1FZPB 2GQQA 1KU9A 1U6GA 1G6NA 1RI7A 4A0ZA 1B4AA 4B09A 3I0TA 2M8EA 2L54A 1ZRDA 1D5VA 1S7AA 2HTJA 3BDDA 3TKYA 3PQJA 2VE8A 4YFKF 5BPIA 4EGZA 2CGPA 2OBPA 2FNAA 4GYGA 5LEJA 4L9NA 2G7UA 2IPQX 1MZBA 1RUNA 4Y13A 1WRJA 1U3EM 4HF1A 1Z05A 4OMYA 4ENNA 4RB1A 3E6DA 1RNLA 2CSOA 1HSJA 1O3SA 1R36A 2EB7A 1XCVA 4BYYA 1XDUA 1Z9CA 1FY7A 5E1XA 5J8CA 3QPTA 2UWMA 3QAHA 2FA5A 2ISZA 3J7AO 1ZLKA 1YW9A 2R3SA 3JSOA 3KEQA 2FBIA 3RPQA 1AOYA 3P7NA 4UV8A 1O7LA 3LAPA 1T2KA 3MQ0A 3EYIA 3ZP5A 2W25A 2AXLA 4XLPF 3REOA 2O6GE 4IHSA 1K78B 3JAMK 3RYRA 4HAMA 1W4MA 4E70A 3QU3A 1GXQA 4M74A 2OQGA 3KP5A 4YFXF 1RUOA 3L00A 3DPLC 2EK5A 1OMIA 4KIBA 1HSTA 5FD5A 3J81K 4MHGA 1QQIA 3NQOA 3O6BB 2ADUA 3BJOA 1ZH5A 4OIQF 2RQPA 3HIFA 3WU1B 1TNSA 3R61A 3OV8A 3L2CA 3E6MA 1S29A 4HX8A 3BZ6A 4IF4A 1EV7A 2H6BA 4LJZF 3ECHA 2ISYA 4BHPA 1TQPA 3CLOA 2ZBKA 2FQ3A 4P5OA 2FF4A 3S2WA 5LRSA 4EVIA 1KU2A 4GO1A 2YPRA 2O61A 5LBQA 3E97A 1R1UA 2J5OA 2CO5A 3I5UA 1MDMA 1XB4A 1LVAA 2NS0A 3GF2A 3VOEA 3E5XA 5HS9A 1CF7B 2DK5A 5E18F 2KJCA 3FXQA 5F6FA 4LLNA 2EFNA 3HHGA 3NEUA 4UV9A 4CHUA 3GUDA 1MJBA 4LG0B 4U88A 1L3LA 5IT9K 2Z5UA 2O3FA 2EFOA 4G6QA 4RGUA 1LEBA 2X4HA 1STZA 4HW0A 3CUQA 4EJTA 5ERIA 2E1CA 4BQAA 2GXGA 3E6BA 5E17F 2J5PA 2E7XA 2HFHA 1LDDA 5E8IA 1SFXA 2M30A 2QQ9A 1ZG3A 4Y15A 2NNYA 3F21A 4H0EA 2L01A 1XSXA 3EQLF 1F1ZA 1IW7F 4NQWA 4BHCA 2NAZA 2BE5F 1SMYF 5D5WB 4M9SA 2Q8KA 3ZPLA 5DDGA 2IRFG 3N97A 4BH9A 1CGPA 3PQKA 2HDCA 1UCRA 5FO5A 2FU4A 1BM9A 4PDKA 3VB2A 1SD4A 3WG9A 3HUGA 3V4GA 2V6CA 4PGGA 1H9GA 1HW5A 1FX7A 3C7JA 4RB0A 2W57A 4G7OF 2JRTA 1W7PD 4L5JA 3KEOA 4P9FA 1BJAA 4M73A 4I7HA 3I71A 3C1DA 5LGNA 2F2EA 5D5XB 5BS6A 4YG2F 4EJOA 1QZZA 1XN7A 1XSVA 1TW2A 1JHHA 4KIFA 2XIGA 3F8NA 3W6KB 5IT9Z 2RDPA 2RVCA 3ULQB 3MFKA 2G7HA 5D6FA 2DT5A 5L3EA 2FSWA 3GW2A 2O8XA 1OKRA 3F6OA 1IN7A 1BI2A 3JTHA 1FPQA 1USSA 4HQEA 2E7WA 3HSFA 5E20A 3COAC 4AIJA 4K2EA 4XRFA 3LQRA 1ZG1A 3E3VA 3KZYA 5AIQA 2XASA 3HOTA 4CZZA 4A2UA 4D0PA 2Y75A 1PP8F 1X3UA 2HGCA 1IXSB 1B1BA 3GFMA 4PCQA 2ESNA 2MH9A 1IRFA 2F5FA 1KYWA 4AD9A 2KJBA 5K5RA 5TRDA 2DLLA 2A5YB 1BN5A 3HTSB 2PEXA 3R0AA 4KA4A 5L3GA 5CVRA 4G6DA 1I5ZA 4KICA 5CLSA 3RI4A 3F72A 5A2QK 3SZPA 3H92A 5HLHA 2XROA 4I98B 3KP7A 4KMFA 1O57A 5ICCA 4M72A 2MBFA 1LB2A 1L0OC 5D8KB 1MJ9A 3T8TA 4HOBA 2DK8A 3CUOA 3JTGA 4L9JA 4FX0A 1HBXG 5H20A 3N4MA 3DEUA 2PQ8A 2VE9A 1J5YA 1HW2A 3I59B 3WTTC 2K4JA 2DBBA 5K5OA 1W7PA 3FHZA 5CVUA 4RGXA 1YS7A 5L3BA 4IRIA 1KYZA 2HTSA 1B9NA 2P5LC 2Z99A 4MQ9F 2CFXA 4EJVA 1S6LA 3GFIA 2XAQA 1G3WA 2A61A 2JSCA 4ZYDA 1F5TA 5ICGA 3H3ZA 3KP2A 4M9ZA 1ZRCA 3K1MA 2VBWA 5ED4A 5KK1A 1SD7A 1BIAA 3DPTA 4Y17A 2HS5A 3KZZA 5ILSA 4IVNA 5DCMA 2QZ8A 1J7KA 3R60A 4KT5C 2MLGA 3M9AA 5A2QZ 2IT0A 4IHTA 2RGVA 4ESFA 3WE3A 3WTYC 1R1VA 4IRHA 2NYXA 2P6TA 4A0YA 3WTXC 2P7VB 2MA3A 3KP3A 2PI0A 1KQ8A 3J80K 4G7ZF 2Z9OA 3DFGA 1QNTA 1KGSA 3V8JA 3TO9A 4G94A 5K1YA 1R5HA 4UUVA 4RAYA 1OYWA 2STWA 3GWZA 4MTDA 2Q2EA 5IT3A 3RKYA 2DU9A 3ZN0A 3GVAA 3KP6A 2V1DA 4EJWA 4RB3C 3VFZA 1FWZA 2L4MA 2P5KA 2QBYB 1I1SA 1FYKA 2RN7A 1EH8A 5LLQA 2Z33A 4HZFA 4L0YB 1R7JA 3K2ZA 4ESJA 2FE3A 2CW0F 3W6JB 5J8FA 4HX7A 3LFKA 2EV6A 5D6EA 5K5QA 1JHFA 5E1WA 5L3DA 1K79A 2HEOA 2EWNA 1FC3A 2UXNA 2A6EF 3E5UA 2FMYA 1XCBA 5FFZA 3FM3A 4CICA 4A12A 1FYMA 1SMTA 2QM3A 4HF2A 1FNNA 3WTSC 1YTYA 2RC4A 1ZLJA 4LLGF 4N0BA 3AAFA 2EV0A 1KQ9A 5L3CA 1AWCA 3CUQC 2HYFA 3O2PE 3RDIA 3DF8A 4P9UA 2ZCWA 1XD7A 2EJRA 4KMUX 2L02A 1FSEA 2A3SA 5CJ9A 1R23A 3F8MA 3HRTA 3J80Z 2AS5F 3ROUA 2FBKA 3WGIA 5D8LB 4GXOA 1D3YA 4HV6A 3EYYA 1DPRA 1TBXA 3I4PA 1NHAA 1WWXA 2TDXA 3FMQA 1H9TA 1P6RA 2FXAA 2Y0MA 5LHHA 2C6YA 1HW1A 1BC8C 3FF5A 2YU3A 4EJUA 4BNCA 2IP2A 3K0LA 1KU3A 1R58A 3ZMVA 1RIOH 1U5TA 1MDMB 1YLFA 3FXRA 3KFWX 1QGPA 3SXYA 4LB5A 2MC3A 4RGSA 3ELKA 4YFNF 4O6JA 4U0YA 4KFCA 3TO7A 1U78A 2YX7A 2XHKA 1SD6A 3BPVA 3HSEA 2MH2A 1W5SA 2P5VA 1IXRC 4JK1X 3GYHX 4HV5A 4ZZLA 2IA1A 1ZN2A 2P6SA 4IJAA 1I27A 2EFWA 1Z6RA 2M87A 3ABTA 4UVBA 4UXNA 3CUQB 3GFJA 2H27A 2D1VA 4AIKA 2M45A 3K9TA 4IRGA 3RJPA 4EMSA 2OD5A 2YSRA 4N9IA 5FGMA 3WTUC 3F22A 1KU7A 4F7ZA 5LHGA 4L9VA 1IF1A 5CVJA 4NB5A 2X0LA 2XKPA 3ERED 2B0LA 1HXDA 3FMRA 4FX4A 2PFBA 1J75A 2PLYA 4MEYF 3OOPA 1BOAA 3WTWC 2KRFA 4LFUA 2QWWA 2VONA 4PZJA 3G3ZA 4Q48A 3IHUA 2M5WA 2LF7A 1SFUA 5LRRA 2OQRA 3KLNA 3T8RA 4WK8F 2QLZA 3HSRA 2KIUA 3GO5A 1ON1A 5ILUA 1OR7A 4UNOA 2HQRA 5LGUA 1S7OA 5JFRA 6PAXA 1FBUA 3BY6A 1P4AA 2DPUA 2L3DA 4L9TA 4MQVA 3T0YA 1A04A 4LG0A 4ASNA 4ENMA 2ZXJA 5DV5A 4LB6B 2XUBA 1Z6TA 2A69F 4FT8A 2GWRA 2VT3A 1GHCA 2OZUA 5DD8A 5J6XA 3MZHA 2HOEA 2EV5A 4WF2A 2UXXA 1G3YA 3HRSA 1FYLA 2R7DA 2JZYA 1LDKB 3GX4X 1XGNA 2P8TA 2K7LA 2UZKA 1FLIA 1XGSA 3KCCA 2FRHA 1O3TA 1S8NA 1IN5A 3HOSA 4RB2C 2QUFA 2PMUA 1E17A 1FSHA 2ESHA 3F23A 5HS7A 3Q5FA 1UB9A 4AIHA 3IWFA 1SD5A 3QU6A 1G3TA 1FOKA 5HOOA 1DUXC 4HDVA 4G7HF 3MEXA 1T38A 4KDPA 4L0ZB 4I01A 2D1HA 3BOQA 4TV7A 2KIFA 2IA2A 2DQRA 2LF8A 3HYIA 2COMA 1LQ1A 1XGMA 4I0AA 4DNCA 1MD0A 1IN6A 2LNBA 2XAHA 1G3SA 2IA0A 4XLNF 3WE2A 4ESBA 2ZMEB 2XVCA 1YS6A 1OYIA 5BMZA 5CVIA 4DQ2A 3O3KA 1ONVA 1ZG5A 1TQMA 1H0MA 1UHWA 3U9GA 3IKTA 5DUKA 2XAJA 2DO7A 2DQLA 4OIPF 2VBXA 1P4WA 3LSTA 2A07F 5HS8A 3M8EA 3V7RA 3BROA 4ZYHA 2RKHA 4KN7X 1LJ9A 5DD4A 1B59A 1Y0UA 3LWFA 4P55A 1JE8A 5DEQA 1YO5C 3GZ5A 4U0VA 1DPUA 4M6XA 1S3JA 2KIMA 2CG4A 2W84A 1LNWA 3LQQA 4A5MA 2NNNA 3QRFF 2IW5A 4HBLA 1EH7A 4LK1F 3JSPA 4RGRA 3R4KA 1GXPA 1Z91A 4I2OA 3ML6A 4XSZF 2BGCA 2K27A 4RS8A 1O3RA 1REPC 4ETSA 2VBYA 4AVPA 3TDZC 5HDGA 1B9MA 3F3XA 5FFXA 1V4RA 4OINF 4KUMA 3U1DA 1E2XA 1YW8A 1K7AA 2K4BA 5DCMB 1IN8A 1I6XA 2F5EA 2OZ6A 4JBAA 1QPMA 4HYEA 5ICEA 1XMAA 3P9CA 4JQFA 2LKPA 2GA2A 3HTUA 4LLLA 1IRGA 3MCZA 4CXFA 1ZHFA 1QBJA 1T39A 4OU0A 2P7CB 5JR3A 2LDUA 4B8XA 1DP7P 3GXOA 4BXUA 3GLXA 1TQIA 4A5NA 3HHHA 2ELHA 3GZ6A 2ZO4A 4M6YA 3VODA 4MTEA 1MGTA 2STTA 2VODA 3DQVC 4LD5A 4EM2A 2GIVA 3ZMZA 4KNYA 3TDUC 2F5DA 3SQNA 4N9HA 5H6RA 5FLXK 1R5GA 2CYYA 1KQ0A 2WTEA 2W24A 2XGXA 2ZNZA 2PG4A 5CVVA 1PP7U 4WXCA 1U5TC 2RV8A 3LA7A 5DYMA 4UVCA 3ZMDA 2DPDA 1WKMA 3T5XA 2H94A 1YFHA 4Q5SF 4RAZA 3WTZA 2P4WA 3C18A 2RNJA 4Q4ZF 1YW7A 1QZYA 3M8FA 2ACJA 2MD5A 1JXSA 4R8HA 3GEZA 2V79A 4WXHA 4ON0A 4WXDA 5DCFA 2XV4S 3I58A 2D2WA 3BWGA 2O03A 2Z3YA 2ZKZA 3KP4A 3V7SA 1P92A 2V9VA 2YX4A 2Y48A 4CO8A 5BPDA 4CGZA 3M7GA 1B6AA 2JPBA 3WGGA 3B02A 4QLCU 1FP2A 4ZZDA 1IAWA 2F5CA 2HWVA 3ZMUA 4ZH4F 3IC7A 4QWQA 3IRQA 3JW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU2 A;  2K86 A;  4LMY A;  3I53 A;  2QQB A;  3KE2 A;  2QBY A;  4YII A;  1ZRF A;  1YIO A;  1ZRE A;  5AON A;  5FLX Z;  1U2W A;  2PJP A;  1XMK A;  1J9I A;  3LA2 A;  1QO0 D;  1BC7 C;  4HLX A;  3H3U A;  3FZV A;  5D4S A;  3V8K A;  1U8R A;  3G73 A;  1U5T B;  1TNT A;  4LK0 F;  1J2X A;  3L7W A;  3NRV A;  3BPX A;  3BJ6 A;  3B73 A;  2BBY A;  1V3F A;  3HRU A;  4G9Y A;  2QVO A;  3TO6 A;  1C0W A;  1ZAO A;  1BI3 A;  3L09 A;  4YIF A;  4MEX F;  1XGO A;  1KA8 A;  3WGH A;  1R00 A;  1YQA A;  1FT9 A;  3QOP A;  4A6E A;  4UVA A;  2H6C A;  2HKX A;  3CJN A;  1K78 A;  3WOD F;  2D45 A;  2BV6 A;  4EM0 B;  2V1U A;  4HA8 A;  5JHU A;  3LAJ A;  3DP7 A;  1G4D A;  1ULY A;  2DI3 A;  2HR3 A;  2QEN A;  3ECO A;  1ZGA A;  3VEP A;  1OPC A;  5BOX A;  2HZT A;  1O7F A;  4AWX B;  3DXJ F;  2VOO A;  2E1N A;  4I0B A;  2GZW A;  4R1H A;  3P9I A;  3CO6 C;  2VC1 A;  2HQN A;  2XAG A;  5L3F A;  4ENJ A;  1HKQ A;  1F9N A;  3TGN A;  3ISP A;  1HKT A;  2R7F A;  3MZY A;  2Q0O A;  3K69 A;  2HYG D;  5H6Q A;  1D8K A;  2XRN A;  4CDG A;  4EQQ A;  4LGW A;  4S05 A;  3JAM Z;  1F4K A;  3ZMT A;  3HRM A;  1TLH B;  4GYI A;  1WI9 A;  2ZJ2 A;  5D5V B;  5JI6 A;  5LHI A;  4GGG A;  3RYP A;  3BJA A;  3IRR A;  2DTR A;  2FML A;  4IPA A;  1FBS A;  5ILV A;  2VBZ A;  2EFQ A;  1W5T A;  4WX9 A;  1CF7 A;  4OOI A;  5BQT A;  4OMZ A;  1GVJ A;  2ETH A;  1FBQ A;  1MKM A;  5TJJ A;  3Q9V A;  3J81 Z;  1PDN C;  2LSO A;  3I64 A;  1TTY A;  2EA4 A;  3TQN A;  4EV0 A;  2IVM A;  1ZGJ A;  5HLG A;  4R79 A;  1K6O A;  2PN6 A;  2OA4 A;  3RTR A;  3FX3 A;  2WWY A;  1ODD A;  4UHT A;  1WQ2 A;  3RKW A;  2PBI A;  3KLO A;  4MGR A;  5AIP A;  1I1G A;  2FBH A;  2WC2 A;  4O3M A;  3ZN1 A;  2QQA A;  1SFE A;  4XSX F;  5HVQ C;  2EA2 A;  4I02 A;  4WWC A;  3CO7 C;  3K1N A;  4EGY A;  3FMS A;  4BAY A;  3EDP A;  4P96 A;  5D4R A;  2FNP A;  1XDS A;  5F1R A;  4U0W A;  2DAO A;  5HDK A;  5D5U B;  3MWM A;  3F8C A;  3F8B A;  4GCV A;  4U7D A;  4I09 A;  2G9W A;  1D8J A;  3F8F A;  2DW4 A;  1YYV A;  2GXB A;  2JT1 A;  2V1X A;  5ICF A;  3K1P A;  3DV8 A;  1T0F A;  3D5L A;  1IZ1 A;  4MNU A;  3F6V A;  5DUI A;  4PGH A;  4A0X A;  2XKO A;  1LDJ A;  2K02 A;  5LGT A;  1PUE E;  3TOA A;  3WU0 A;  2WV0 A;  5FD6 A;  1ZYR F;  3V8L A;  1MJA A;  1Z7U A;  1ZAR A;  1IN4 A;  1BIB A;  3Q9S A;  4M9X A;  4Q47 A;  2VC0 A;  4KIG A;  4OIR F;  3RKX A;  3BP8 A;  1HKS A;  1BI1 A;  3GFL A;  5FB2 A;  3KET A;  2CQK A;  3DKW A;  1HQC A;  3ABU A;  4HX4 A;  1IUY A;  2DFI A;  4U7B A;  2ZFW A;  4KN4 X;  1T98 A;  3SFZ A;  5JVT A;  4CYD A;  4KYW A;  4ZYG A;  4IXA A;  1ON2 A;  1UST A;  3QP6 A;  2XAF A;  3RPU A;  2CWE A;  3CTA A;  2O0Y A;  3LA3 A;  2JTV A;  1SAX A;  3R0J A;  2NRA C;  2GAU A;  3C3W A;  1R22 A;  3FWE A;  3WTV C;  2QYO A;  2L4A A;  4WCG A;  2PMH A;  1XSD A;  5HLI A;  1IXC A;  2OAZ A;  1EH6 A;  1Z1D A;  3P9K A;  5EEH A;  1T6S A;  3FM5 A;  3RIR A;  2VOP A;  5EEG A;  1RZ4 A;  1P4X A;  1W7P B;  4S04 A;  2JPC A;  5KVR A;  5E8G A;  2IJL A;  3D0S A;  4HF0 A;  2ZME A;  3ZMS A;  5CYV A;  4L18 B;  2KKO A;  5F64 A;  3R6S A;  3ZQ7 A;  1R1T A;  3CDH A;  4ZYE A;  3T1B A;  3I54 A;  1LEA A;  4HLY A;  3EET A;  2VN2 A;  1P2F A;  4O5V A;  3SHF A;  4M71 A;  2BYV E;  2W85 A;  3TOB A;  3FXU A;  1BBY A;  2ZNY A;  4HQM A;  1BI0 A;  1FP1 D;  1OYY A;  2M1B A;  2A6H F;  1UHM A;  2FEZ A;  2GA1 A;  2VXZ A;  3IKV A;  1Q1H A;  3M1E A;  2HKO A;  4G8X A;  2VT2 A;  1O3Q A;  1WSU A;  1J59 A;  3V7C A;  3QPH A;  5HDN A;  3SZT A;  3QP5 A;  1DDN A;  2EFP A;  2FOK A;  1UFM A;  3IWZ A;  3PFI A;  4EM1 A;  3I59 A;  4NHJ A;  3EUH A;  3IL2 A;  3L9F A;  1TW3 A;  3MAJ A;  2A68 F;  4BHB A;  4HDU A;  4XBF A;  2H09 A;  4L5I A;  3E5Q A;  3U2R A;  5E1Z B;  3E6C C;  4ENK A;  1JGS A;  4FHT A;  2MLK A;  2YR2 A;  4Z2Y A;  5LEK A;  4A6D A;  2BEO A;  1J0R A;  1VTN C;  1YG2 A;  4OIO F;  1FZP B;  2GQQ A;  1KU9 A;  1U6G A;  1G6N A;  1RI7 A;  4A0Z A;  1B4A A;  4B09 A;  3I0T A;  2M8E A;  2L54 A;  1ZRD A;  1D5V A;  1S7A A;  2HTJ A;  3BDD A;  3TKY A;  3PQJ A;  2VE8 A;  4YFK F;  5BPI A;  4EGZ A;  2CGP A;  2OBP A;  2FNA A;  4GYG A;  5LEJ A;  4L9N A;  2G7U A;  2IPQ X;  1MZB A;  1RUN A;  4Y13 A;  1WRJ A;  1U3E M;  4HF1 A;  1Z05 A;  4OMY A;  4ENN A;  4RB1 A;  3E6D A;  1RNL A;  2CSO A;  1HSJ A;  1O3S A;  1R36 A;  2EB7 A;  1XCV A;  4BYY A;  1XDU A;  1Z9C A;  1FY7 A;  5E1X A;  5J8C A;  3QPT A;  2UWM A;  3QAH A;  2FA5 A;  2ISZ A;  3J7A O;  1ZLK A;  1YW9 A;  2R3S A;  3JSO A;  3KEQ A;  2FBI A;  3RPQ A;  1AOY A;  3P7N A;  4UV8 A;  1O7L A;  3LAP A;  1T2K A;  3MQ0 A;  3EYI A;  3ZP5 A;  2W25 A;  2AXL A;  4XLP F;  3REO A;  2O6G E;  4IHS A;  1K78 B;  3JAM K;  3RYR A;  4HAM A;  1W4M A;  4E70 A;  3QU3 A;  1GXQ A;  4M74 A;  2OQG A;  3KP5 A;  4YFX F;  1RUO A;  3L00 A;  3DPL C;  2EK5 A;  1OMI A;  4KIB A;  1HST A;  5FD5 A;  3J81 K;  4MHG A;  1QQI A;  3NQO A;  3O6B B;  2ADU A;  3BJO A;  1ZH5 A;  4OIQ F;  2RQP A;  3HIF A;  3WU1 B;  1TNS A;  3R61 A;  3OV8 A;  3L2C A;  3E6M A;  1S29 A;  4HX8 A;  3BZ6 A;  4IF4 A;  1EV7 A;  2H6B A;  4LJZ F;  3ECH A;  2ISY A;  4BHP A;  1TQP A;  3CLO A;  2ZBK A;  2FQ3 A;  4P5O A;  2FF4 A;  3S2W A;  5LRS A;  4EVI A;  1KU2 A;  4GO1 A;  2YPR A;  2O61 A;  5LBQ A;  3E97 A;  1R1U A;  2J5O A;  2CO5 A;  3I5U A;  1MDM A;  1XB4 A;  1LVA A;  2NS0 A;  3GF2 A;  3VOE A;  3E5X A;  5HS9 A;  1CF7 B;  2DK5 A;  5E18 F;  2KJC A;  3FXQ A;  5F6F A;  4LLN A;  2EFN A;  3HHG A;  3NEU A;  4UV9 A;  4CHU A;  3GUD A;  1MJB A;  4LG0 B;  4U88 A;  1L3L A;  5IT9 K;  2Z5U A;  2O3F A;  2EFO A;  4G6Q A;  4RGU A;  1LEB A;  2X4H A;  1STZ A;  4HW0 A;  3CUQ A;  4EJT A;  5ERI A;  2E1C A;  4BQA A;  2GXG A;  3E6B A;  5E17 F;  2J5P A;  2E7X A;  2HFH A;  1LDD A;  5E8I A;  1SFX A;  2M30 A;  2QQ9 A;  1ZG3 A;  4Y15 A;  2NNY A;  3F21 A;  4H0E A;  2L01 A;  1XSX A;  3EQL F;  1F1Z A;  1IW7 F;  4NQW A;  4BHC A;  2NAZ A;  2BE5 F;  1SMY F;  5D5W B;  4M9S A;  2Q8K A;  3ZPL A;  5DDG A;  2IRF G;  3N97 A;  4BH9 A;  1CGP A;  3PQK A;  2HDC A;  1UCR A;  5FO5 A;  2FU4 A;  1BM9 A;  4PDK A;  3VB2 A;  1SD4 A;  3WG9 A;  3HUG A;  3V4G A;  2V6C A;  4PGG A;  1H9G A;  1HW5 A;  1FX7 A;  3C7J A;  4RB0 A;  2W57 A;  4G7O F;  2JRT A;  1W7P D;  4L5J A;  3KEO A;  4P9F A;  1BJA A;  4M73 A;  4I7H A;  3I71 A;  3C1D A;  5LGN A;  2F2E A;  5D5X B;  5BS6 A;  4YG2 F;  4EJO A;  1QZZ A;  1XN7 A;  1XSV A;  1TW2 A;  1JHH A;  4KIF A;  2XIG A;  3F8N A;  3W6K B;  5IT9 Z;  2RDP A;  2RVC A;  3ULQ B;  3MFK A;  2G7H A;  5D6F A;  2DT5 A;  5L3E A;  2FSW A;  3GW2 A;  2O8X A;  1OKR A;  3F6O A;  1IN7 A;  1BI2 A;  3JTH A;  1FPQ A;  1USS A;  4HQE A;  2E7W A;  3HSF A;  5E20 A;  3COA C;  4AIJ A;  4K2E A;  4XRF A;  3LQR A;  1ZG1 A;  3E3V A;  3KZY A;  5AIQ A;  2XAS A;  3HOT A;  4CZZ A;  4A2U A;  4D0P A;  2Y75 A;  1PP8 F;  1X3U A;  2HGC A;  1IXS B;  1B1B A;  3GFM A;  4PCQ A;  2ESN A;  2MH9 A;  1IRF A;  2F5F A;  1KYW A;  4AD9 A;  2KJB A;  5K5R A;  5TRD A;  2DLL A;  2A5Y B;  1BN5 A;  3HTS B;  2PEX A;  3R0A A;  4KA4 A;  5L3G A;  5CVR A;  4G6D A;  1I5Z A;  4KIC A;  5CLS A;  3RI4 A;  3F72 A;  5A2Q K;  3SZP A;  3H92 A;  5HLH A;  2XRO A;  4I98 B;  3KP7 A;  4KMF A;  1O57 A;  5ICC A;  4M72 A;  2MBF A;  1LB2 A;  1L0O C;  5D8K B;  1MJ9 A;  3T8T A;  4HOB A;  2DK8 A;  3CUO A;  3JTG A;  4L9J A;  4FX0 A;  1HBX G;  5H20 A;  3N4M A;  3DEU A;  2PQ8 A;  2VE9 A;  1J5Y A;  1HW2 A;  3I59 B;  3WTT C;  2K4J A;  2DBB A;  5K5O A;  1W7P A;  3FHZ A;  5CVU A;  4RGX A;  1YS7 A;  5L3B A;  4IRI A;  1KYZ A;  2HTS A;  1B9N A;  2P5L C;  2Z99 A;  4MQ9 F;  2CFX A;  4EJV A;  1S6L A;  3GFI A;  2XAQ A;  1G3W A;  2A61 A;  2JSC A;  4ZYD A;  1F5T A;  5ICG A;  3H3Z A;  3KP2 A;  4M9Z A;  1ZRC A;  3K1M A;  2VBW A;  5ED4 A;  5KK1 A;  1SD7 A;  1BIA A;  3DPT A;  4Y17 A;  2HS5 A;  3KZZ A;  5ILS A;  4IVN A;  5DCM A;  2QZ8 A;  1J7K A;  3R60 A;  4KT5 C;  2MLG A;  3M9A A;  5A2Q Z;  2IT0 A;  4IHT A;  2RGV A;  4ESF A;  3WE3 A;  3WTY C;  1R1V A;  4IRH A;  2NYX A;  2P6T A;  4A0Y A;  3WTX C;  2P7V B;  2MA3 A;  3KP3 A;  2PI0 A;  1KQ8 A;  3J80 K;  4G7Z F;  2Z9O A;  3DFG A;  1QNT A;  1KGS A;  3V8J A;  3TO9 A;  4G94 A;  5K1Y A;  1R5H A;  4UUV A;  4RAY A;  1OYW A;  2STW A;  3GWZ A;  4MTD A;  2Q2E A;  5IT3 A;  3RKY A;  2DU9 A;  3ZN0 A;  3GVA A;  3KP6 A;  2V1D A;  4EJW A;  4RB3 C;  3VFZ A;  1FWZ A;  2L4M A;  2P5K A;  2QBY B;  1I1S A;  1FYK A;  2RN7 A;  1EH8 A;  5LLQ A;  2Z33 A;  4HZF A;  4L0Y B;  1R7J A;  3K2Z A;  4ESJ A;  2FE3 A;  2CW0 F;  3W6J B;  5J8F A;  4HX7 A;  3LFK A;  2EV6 A;  5D6E A;  5K5Q A;  1JHF A;  5E1W A;  5L3D A;  1K79 A;  2HEO A;  2EWN A;  1FC3 A;  2UXN A;  2A6E F;  3E5U A;  2FMY A;  1XCB A;  5FFZ A;  3FM3 A;  4CIC A;  4A12 A;  1FYM A;  1SMT A;  2QM3 A;  4HF2 A;  1FNN A;  3WTS C;  1YTY A;  2RC4 A;  1ZLJ A;  4LLG F;  4N0B A;  3AAF A;  2EV0 A;  1KQ9 A;  5L3C A;  1AWC A;  3CUQ C;  2HYF A;  3O2P E;  3RDI A;  3DF8 A;  4P9U A;  2ZCW A;  1XD7 A;  2EJR A;  4KMU X;  2L02 A;  1FSE A;  2A3S A;  5CJ9 A;  1R23 A;  3F8M A;  3HRT A;  3J80 Z;  2AS5 F;  3ROU A;  2FBK A;  3WGI A;  5D8L B;  4GXO A;  1D3Y A;  4HV6 A;  3EYY A;  1DPR A;  1TBX A;  3I4P A;  1NHA A;  1WWX A;  2TDX A;  3FMQ A;  1H9T A;  1P6R A;  2FXA A;  2Y0M A;  5LHH A;  2C6Y A;  1HW1 A;  1BC8 C;  3FF5 A;  2YU3 A;  4EJU A;  4BNC A;  2IP2 A;  3K0L A;  1KU3 A;  1R58 A;  3ZMV A;  1RIO H;  1U5T A;  1MDM B;  1YLF A;  3FXR A;  3KFW X;  1QGP A;  3SXY A;  4LB5 A;  2MC3 A;  4RGS A;  3ELK A;  4YFN F;  4O6J A;  4U0Y A;  4KFC A;  3TO7 A;  1U78 A;  2YX7 A;  2XHK A;  1SD6 A;  3BPV A;  3HSE A;  2MH2 A;  1W5S A;  2P5V A;  1IXR C;  4JK1 X;  3GYH X;  4HV5 A;  4ZZL A;  2IA1 A;  1ZN2 A;  2P6S A;  4IJA A;  1I27 A;  2EFW A;  1Z6R A;  2M87 A;  3ABT A;  4UVB A;  4UXN A;  3CUQ B;  3GFJ A;  2H27 A;  2D1V A;  4AIK A;  2M45 A;  3K9T A;  4IRG A;  3RJP A;  4EMS A;  2OD5 A;  2YSR A;  4N9I A;  5FGM A;  3WTU C;  3F22 A;  1KU7 A;  4F7Z A;  5LHG A;  4L9V A;  1IF1 A;  5CVJ A;  4NB5 A;  2X0L A;  2XKP A;  3ERE D;  2B0L A;  1HXD A;  3FMR A;  4FX4 A;  2PFB A;  1J75 A;  2PLY A;  4MEY F;  3OOP A;  1BOA A;  3WTW C;  2KRF A;  4LFU A;  2QWW A;  2VON A;  4PZJ A;  3G3Z A;  4Q48 A;  3IHU A;  2M5W A;  2LF7 A;  1SFU A;  5LRR A;  2OQR A;  3KLN A;  3T8R A;  4WK8 F;  2QLZ A;  3HSR A;  2KIU A;  3GO5 A;  1ON1 A;  5ILU A;  1OR7 A;  4UNO A;  2HQR A;  5LGU A;  1S7O A;  5JFR A;  6PAX A;  1FBU A;  3BY6 A;  1P4A A;  2DPU A;  2L3D A;  4L9T A;  4MQV A;  3T0Y A;  1A04 A;  4LG0 A;  4ASN A;  4ENM A;  2ZXJ A;  5DV5 A;  4LB6 B;  2XUB A;  1Z6T A;  2A69 F;  4FT8 A;  2GWR A;  2VT3 A;  1GHC A;  2OZU A;  5DD8 A;  5J6X A;  3MZH A;  2HOE A;  2EV5 A;  4WF2 A;  2UXX A;  1G3Y A;  3HRS A;  1FYL A;  2R7D A;  2JZY A;  1LDK B;  3GX4 X;  1XGN A;  2P8T A;  2K7L A;  2UZK A;  1FLI A;  1XGS A;  3KCC A;  2FRH A;  1O3T A;  1S8N A;  1IN5 A;  3HOS A;  4RB2 C;  2QUF A;  2PMU A;  1E17 A;  1FSH A;  2ESH A;  3F23 A;  5HS7 A;  3Q5F A;  1UB9 A;  4AIH A;  3IWF A;  1SD5 A;  3QU6 A;  1G3T A;  1FOK A;  5HOO A;  1DUX C;  4HDV A;  4G7H F;  3MEX A;  1T38 A;  4KDP A;  4L0Z B;  4I01 A;  2D1H A;  3BOQ A;  4TV7 A;  2KIF A;  2IA2 A;  2DQR A;  2LF8 A;  3HYI A;  2COM A;  1LQ1 A;  1XGM A;  4I0A A;  4DNC A;  1MD0 A;  1IN6 A;  2LNB A;  2XAH A;  1G3S A;  2IA0 A;  4XLN F;  3WE2 A;  4ESB A;  2ZME B;  2XVC A;  1YS6 A;  1OYI A;  5BMZ A;  5CVI A;  4DQ2 A;  3O3K A;  1ONV A;  1ZG5 A;  1TQM A;  1H0M A;  1UHW A;  3U9G A;  3IKT A;  5DUK A;  2XAJ A;  2DO7 A;  2DQL A;  4OIP F;  2VBX A;  1P4W A;  3LST A;  2A07 F;  5HS8 A;  3M8E A;  3V7R A;  3BRO A;  4ZYH A;  2RKH A;  4KN7 X;  1LJ9 A;  5DD4 A;  1B59 A;  1Y0U A;  3LWF A;  4P55 A;  1JE8 A;  5DEQ A;  1YO5 C;  3GZ5 A;  4U0V A;  1DPU A;  4M6X A;  1S3J A;  2KIM A;  2CG4 A;  2W84 A;  1LNW A;  3LQQ A;  4A5M A;  2NNN A;  3QRF F;  2IW5 A;  4HBL A;  1EH7 A;  4LK1 F;  3JSP A;  4RGR A;  3R4K A;  1GXP A;  1Z91 A;  4I2O A;  3ML6 A;  4XSZ F;  2BGC A;  2K27 A;  4RS8 A;  1O3R A;  1REP C;  4ETS A;  2VBY A;  4AVP A;  3TDZ C;  5HDG A;  1B9M A;  3F3X A;  5FFX A;  1V4R A;  4OIN F;  4KUM A;  3U1D A;  1E2X A;  1YW8 A;  1K7A A;  2K4B A;  5DCM B;  1IN8 A;  1I6X A;  2F5E A;  2OZ6 A;  4JBA A;  1QPM A;  4HYE A;  5ICE A;  1XMA A;  3P9C A;  4JQF A;  2LKP A;  2GA2 A;  3HTU A;  4LLL A;  1IRG A;  3MCZ A;  4CXF A;  1ZHF A;  1QBJ A;  1T39 A;  4OU0 A;  2P7C B;  5JR3 A;  2LDU A;  4B8X A;  1DP7 P;  3GXO A;  4BXU A;  3GLX A;  1TQI A;  4A5N A;  3HHH A;  2ELH A;  3GZ6 A;  2ZO4 A;  4M6Y A;  3VOD A;  4MTE A;  1MGT A;  2STT A;  2VOD A;  3DQV C;  4LD5 A;  4EM2 A;  2GIV A;  3ZMZ A;  4KNY A;  3TDU C;  2F5D A;  3SQN A;  4N9H A;  5H6R A;  5FLX K;  1R5G A;  2CYY A;  1KQ0 A;  2WTE A;  2W24 A;  2XGX A;  2ZNZ A;  2PG4 A;  5CVV A;  1PP7 U;  4WXC A;  1U5T C;  2RV8 A;  3LA7 A;  5DYM A;  4UVC A;  3ZMD A;  2DPD A;  1WKM A;  3T5X A;  2H94 A;  1YFH A;  4Q5S F;  4RAZ A;  3WTZ A;  2P4W A;  3C18 A;  2RNJ A;  4Q4Z F;  1YW7 A;  1QZY A;  3M8F A;  2ACJ A;  2MD5 A;  1JXS A;  4R8H A;  3GEZ A;  2V79 A;  4WXH A;  4ON0 A;  4WXD A;  5DCF A;  2XV4 S;  3I58 A;  2D2W A;  3BWG A;  2O03 A;  2Z3Y A;  2ZKZ A;  3KP4 A;  3V7S A;  1P92 A;  2V9V A;  2YX4 A;  2Y48 A;  4CO8 A;  5BPD A;  4CGZ A;  3M7G A;  1B6A A;  2JPB A;  3WGG A;  3B02 A;  4QLC U;  1FP2 A;  4ZZD A;  1IAW A;  2F5C A;  2HWV A;  3ZMU A;  4ZH4 F;  3IC7 A;  4QWQ A;  3IRQ A;  3JW4 A; 
#chains in the Genus database with same CATH topology
 2VQC A;  2OU2 A;  2K86 A;  4LMY A;  2KDZ A;  3QYF A;  2PMZ N;  1IGN A;  1X4P A;  1OCT C;  2Y2Z A;  3I53 A;  2QQB A;  4BS9 A;  3KE2 A;  3L2W A;  4YII A;  4FCY A;  2QBY A;  1H8A C;  3V42 A;  3LFU A;  1PYV A;  3FXL A;  3A01 A;  4PSX A;  1ZRF A;  1YIO A;  1IV6 A;  1G2H A;  4EAT A;  1ZRE A;  3KPH A;  5AON A;  5FLX Z;  1MND A;  1U2W A;  3HKZ N;  2E1M B;  2PJP A;  1XMK A;  1J9I A;  2V26 A;  5FRO A;  3LA2 A;  2K5C A;  1QO0 D;  2O8K A;  1EJ9 A;  1GV5 A;  1BC7 C;  4HLX A;  3H3U A;  1BA5 A;  3FZV A;  5D4S A;  3V8K A;  1U8R A;  4XID A;  3G73 A;  1U5T B;  1TNT A;  2XF7 A;  4LK0 F;  4BQO A;  1J2X A;  3L7W A;  4F91 B;  3NRV A;  2BY2 A;  2X1E A;  3BPX A;  3BJ6 A;  3B73 A;  2CQ7 A;  3AG2 H;  2BBY A;  1V3F A;  2LRE A;  3HRU A;  4G9Y A;  4AC0 A;  1LE8 A;  2QVO A;  4MIM A;  3TO6 A;  2DFH A;  1BW5 A;  4V2G A;  1C0W A;  3JRC A;  1ZAO A;  1ZEL A;  1BI3 A;  3L09 A;  4LOC A;  4YIF A;  5FKK A;  4MEX F;  1XGO A;  3S32 A;  3ZXS A;  2B9S A;  1KA8 A;  2ZSI B;  3WGH A;  1R00 A;  1YQA A;  3OYJ A;  1X3W B;  1FT9 A;  3QOP A;  4N4O B;  1NH3 A;  2ZXI A;  4A6E A;  2BVM A;  4UVA A;  2H6C A;  2RRE A;  4D5C A;  2QCO A;  5IY5 H;  1TZL A;  3M1C A;  2OTL I;  5DTD A;  1GLN A;  2HKX A;  2M7B A;  2I5U A;  3W3C A;  3CJN A;  2JSP A;  1K78 A;  2OTJ I;  3HGG A;  3WOD F;  4BAC A;  3BC8 A;  2D45 A;  1YRN B;  1DP3 A;  1D5Y A;  2BV6 A;  4YEL A;  5F04 A;  3A1Y A;  4EM0 B;  3PIO F;  4B4C A;  1IDY A;  3HEF A;  2V1U A;  1U0J A;  4HA8 A;  5JHU A;  3LAJ A;  2DN0 A;  2NVU B;  5LFA A;  2TRT A;  3DP7 A;  4UUT A;  1G4D A;  1ULY A;  2DI3 A;  2HR3 A;  2NXN B;  2QEN A;  3ECO A;  1ZGA A;  2UV1 A;  1Z21 A;  1E0E A;  3VEP A;  3GTP J;  1OPC A;  2HOT A;  1XS9 A;  5BOX A;  3N05 A;  2HZT A;  5E79 C;  1O7F A;  4AWX B;  2JJ7 A;  3DXJ F;  2VOO A;  2E1N A;  4I0B A;  2GZW A;  4E7J A;  3FKI J;  2CQN A;  4R1H A;  1Y0N A;  3P9I A;  2E2H J;  3A0H C;  2ICW G;  3CO6 C;  2VC1 A;  3OIQ A;  2HQN A;  2XAG A;  5L3F A;  3W2A A;  3MKL A;  3GTG J;  1B72 B;  4A3M J;  3UR3 C;  3S1R J;  2GM4 A;  4ENJ A;  1HKQ A;  3CCS I;  2XB0 X;  3K70 D;  1F9N A;  2ID3 A;  2HPM A;  3I4N J;  1V5F A;  3TGN A;  1W5C C;  5FKL A;  2EPF A;  3ISP A;  3QQA A;  1W0T A;  5IP6 A;  4AYB A;  1HKT A;  2R7F A;  3MZY A;  3L2Q A;  4A3C J;  4ABZ A;  5CQG A;  2Q0O A;  2RQQ A;  3K70 C;  3K69 A;  3BG9 A;  2HYG D;  5H6Q A;  2LTP A;  2VJI A;  1D8K A;  2XRN A;  1VQ8 I;  3DEE A;  4HG2 A;  4CDG A;  1TC3 C;  4DJA A;  4EQQ A;  4LGW A;  2FX0 A;  3VSL A;  4XLA A;  2IEK A;  4OAZ A;  4S05 A;  1QVT A;  4BKX A;  5IPA A;  3JAM Z;  3K4K A;  1F4K A;  3CCE I;  3ZMT A;  3HRM A;  1TLH B;  3OIO A;  4GYI A;  2DFF A;  2OCE A;  1WI9 A;  2ZJ2 A;  3S14 J;  5D5V B;  5JI6 A;  5LHI A;  1IJW C;  4GGG A;  3RYP A;  3OYG A;  3BJA A;  5EEA A;  3IRR A;  3RPU D;  3PSI A;  1MSE C;  2DTR A;  2FML A;  4IPA A;  1FBS A;  3M3Y J;  5ILV A;  2M8G X;  4DYR A;  2VBZ A;  2EFQ A;  1W5T A;  2W1O A;  4WX9 A;  4DZJ A;  5B1B H;  1CF7 A;  4OOI A;  5BQT A;  1BL0 A;  2JA5 J;  4B3A A;  4OMZ A;  1GVJ A;  2ETH A;  1V5E A;  2R92 J;  4BXX J;  2X6W A;  1GUU A;  3L2U A;  1ZK8 A;  3PFY A;  1FBQ A;  1MKM A;  1TT5 B;  5TJJ A;  3I56 I;  3Q9V A;  2ZFU A;  3MMY B;  3J81 Z;  2XGD A;  1PDN C;  1IRX A;  2DMQ A;  2LSO A;  3I64 A;  2Q1Z B;  4XKB A;  5M5Y J;  1TTY A;  2EA4 A;  3TQN A;  1W36 C;  4EV0 A;  1VQ7 I;  1TWF J;  2IVM A;  1ZGJ A;  5HLG A;  2OUM A;  4R79 A;  1K6O A;  3A2K A;  2PN6 A;  1QHG A;  2OA4 A;  3RTR A;  3FX3 A;  4H4K C;  2WWY A;  2XPV A;  4Y33 A;  1ODD A;  4UHT A;  1WQ2 A;  2E34 A;  4G6T B;  3QYB A;  3RKW A;  1YJW I;  2PBI A;  3KX2 A;  3KLO A;  4F55 A;  2LP0 A;  3ZQI A;  4MGR A;  1FOY A;  4F92 B;  2LK2 A;  5AIP A;  4FE7 A;  1I1G A;  3HL2 A;  1OJL A;  4PFP A;  2ELJ A;  4DBQ A;  3BCB A;  2JA6 J;  4BXF A;  2FBH A;  2WC2 A;  4HPQ A;  4O3M A;  1ETO A;  4HEA 2;  3ZN1 A;  2E71 A;  2PJR B;  2QQA A;  1SFE A;  4XSX F;  4QSH A;  5IYD J;  1I39 A;  5HVQ C;  2EA2 A;  2KHM A;  1RKT A;  2V1N A;  4I02 A;  5B66 C;  3FBI B;  4DZP A;  4WWC A;  5EGO B;  2ME0 A;  3CO7 C;  3K1N A;  1IO2 A;  1RPW A;  4EGY A;  2HXI A;  2PMZ A;  1OFC X;  3FMS A;  1QVU A;  4BAY A;  1YX3 A;  3EDP A;  4P96 A;  5D4R A;  2FNP A;  1XDS A;  5F1R A;  4U0W A;  1WZ2 A;  2DAO A;  5HDK A;  4C3I J;  3DU6 A;  2BHZ A;  5D5U B;  3HZJ A;  5KHD A;  1YHQ I;  3MWM A;  4JYK A;  3HOY J;  3F8C A;  1X19 A;  1XX5 A;  3F8B A;  4GCV A;  4U7D A;  1MSF C;  4GFB A;  1MMG A;  3CQZ J;  4I09 A;  2G9W A;  4M6V A;  3CCQ I;  3F8F A;  1D8J A;  4QIW N;  4CH7 A;  2DW4 A;  1VQP I;  3HKZ A;  2KIS A;  3OYA A;  2O9L A;  4UY8 I;  1YYV A;  3LOC A;  2CV0 A;  2GXB A;  2JT1 A;  2V1X A;  3DKY A;  5ICF A;  3K1P A;  1X4O A;  4A3B J;  3DV8 A;  1T0F A;  3D5L A;  3CF2 A;  1KON A;  5TIS C;  1D0Z A;  2HDD A;  1IZ1 A;  4MNU A;  3F6V A;  4HST A;  4PJN A;  4LIU A;  5DUI A;  1N78 A;  4PGH A;  3WU2 C;  4A0X A;  2XKO A;  2JWT A;  1WJA A;  1LDJ A;  2K02 A;  5LGT A;  3CJR B;  1YOV B;  1PUE E;  3TOA A;  4PFO A;  3HB9 A;  2R5Z B;  3CMA I;  3WU0 A;  1MH4 A;  2WV0 A;  9ANT A;  4N4N B;  2CU7 A;  5FD6 A;  1ZYR F;  4XR6 A;  3V8L A;  1MJA A;  1Z7U A;  1ZAR A;  4LG3 A;  1FJL A;  1IN4 A;  1BIB A;  3Q9S A;  4M9X A;  4Q47 A;  4C2T A;  2VC0 A;  1GV2 A;  4KIG A;  4OIR F;  3RKX A;  3BP8 A;  1HKS A;  1BI1 A;  3GFL A;  5FB2 A;  3GLL A;  3KET A;  2CQK A;  3DKW A;  1HQC A;  2A05 A;  3ABU A;  4HX4 A;  3NWS A;  3H35 A;  4IHY A;  1IUY A;  2XAU A;  2K9S A;  3OYK A;  2DFI A;  4NC7 A;  4RLQ A;  3VYT B;  2ZFW A;  4KN4 X;  1T98 A;  4U7B A;  3SFZ A;  5JVT A;  4CYD A;  4KYW A;  2KRH A;  4XRS G;  2XSD C;  4XRS A;  1MBJ A;  1UZC A;  4ZYG A;  1SC7 A;  4A3G J;  4E6K G;  3BCA A;  1NG6 A;  4IXA A;  1ON2 A;  2L9N A;  4JOM A;  1UST A;  3QP6 A;  2XAF A;  3RPU A;  1PJR A;  1ZQ3 P;  1LFU P;  4W1U A;  3ZOB A;  2CWE A;  3CTA A;  4BL0 B;  2R7R A;  2O0Y A;  3S16 J;  3LA3 A;  2JTV A;  3RZO J;  1SAX A;  3R0J A;  3PO3 J;  1TWA J;  2NRA C;  2GAU A;  3C3W A;  1R22 A;  4NUB A;  3FWE A;  3WTV C;  2QYO A;  2L4A A;  3ASO H;  2PMH A;  4WCG A;  1XSD A;  5HLI A;  1IXC A;  2OAZ A;  1XPX A;  1EH6 A;  1Z1D A;  3P9K A;  5EEH A;  1T6S A;  1WGX A;  2Z2S B;  3FM5 A;  3RIR A;  3H5R A;  4BUP A;  2VOP A;  5EEG A;  1JT0 A;  2AXT C;  1RZ4 A;  1P4X A;  2H8R A;  1W7P B;  3BR5 A;  3SFI A;  4S04 A;  2Y9Z A;  2CUF A;  2WAD A;  4XM3 A;  2JPC A;  5KVR A;  5E8G A;  2M9H A;  2IJL A;  3D0S A;  2DYS H;  2DA1 A;  1WHU A;  3LSJ A;  3WHC A;  2DCE A;  4HF0 A;  2ZME A;  4J01 A;  5GAH J;  3ZMS A;  5CYV A;  1Z0X A;  4L18 B;  4B48 A;  2KKO A;  3ZQL A;  5F64 A;  3R6S A;  2JA2 A;  3ZQ7 A;  3TP3 A;  4BQQ A;  1R1T A;  3CDH A;  4ZYE A;  4BU2 A;  3T1B A;  3I54 A;  5F0F A;  1LEA A;  3ABM H;  4HLY A;  3EET A;  2K9L A;  1V55 H;  1BOB A;  1W0U A;  2VN2 A;  1UAA A;  1P2F A;  4O5V A;  2QKM B;  3HXL A;  3SHF A;  4M71 A;  2BYV E;  2W85 A;  3TOB A;  3FXU A;  1BBY A;  2EIJ H;  1I3A A;  2ZNY A;  3CCJ I;  4HQM A;  1RR8 C;  2DJI A;  2ECB A;  4E4H A;  2JMW A;  1BI0 A;  3IP4 B;  1FTT A;  1F36 A;  1FP1 D;  1SVO A;  2M7A A;  1OYY A;  2M1B A;  4Y52 J;  3J7A Y;  3H3V K;  1A5J A;  2OCC H;  4XN0 A;  2VXD A;  2A6H F;  1TWH J;  1UHM A;  2FEZ A;  2GA1 A;  1OLT A;  2VXZ A;  1Q1H A;  3FKJ A;  3IKV A;  2FJ1 A;  2DXI A;  3M1E A;  2HKO A;  4G8X A;  5J1Y A;  2VT2 A;  4I76 A;  4KT6 A;  2F4O B;  1O3Q A;  1WSU A;  1J59 A;  1E3P A;  3V7C A;  3QPH A;  1FMW A;  2R5Y B;  4E7K A;  4J00 A;  2DT6 A;  2DFE A;  5HDN A;  3SZT A;  3QP5 A;  1JKQ C;  3G71 I;  1DDN A;  2EFP A;  4B1R A;  1E3H A;  2FOK A;  1OCC H;  3DKX A;  2Q2E B;  1UFM A;  3H0G J;  2DDB A;  4D9J A;  1K6Y A;  3HDD A;  1QZE A;  2FUG 2;  3IWZ A;  3PFI A;  4EM1 A;  3I59 A;  4F52 A;  1ZR2 A;  4NHJ A;  5HNH A;  1R5I D;  2E2I J;  3M4O J;  3EUH A;  4RBO A;  3IL2 A;  3FXJ A;  3L9F A;  1TW3 A;  3S1N J;  1SVM A;  3MAJ A;  2X6X A;  1WH7 A;  2A68 F;  2R7S A;  4BHB A;  4HDU A;  4XBF A;  3AL0 B;  2H09 A;  4L5I A;  3E5Q A;  5EDN A;  1N77 A;  3U2R A;  1Q1V A;  5E1Z B;  2R7W A;  3L2V A;  3UKG A;  1MNE A;  1WJ5 A;  3GTM J;  2DDA A;  3E6C C;  3O8H A;  5M5W J;  1VQ4 I;  3RQ4 A;  1E3O C;  3MD2 A;  2BW3 B;  4ENK A;  1R71 A;  3CCY A;  1JGS A;  4FHT A;  2MLK A;  4JP0 A;  2YR2 A;  3I4M J;  4Z2Y A;  1B8I A;  5LEK A;  1YIJ I;  4A6D A;  2ZSH B;  2BEO A;  3VDX A;  3U1K A;  1J0R A;  1VTN C;  2L7F P;  2RNG A;  1YG2 A;  2F4M B;  4OIO F;  1FZP B;  2DT7 B;  2GQQ A;  1KU9 A;  1U6G A;  1G6N A;  1MBH A;  1RI7 A;  4A0Z A;  4XOR A;  3KYD B;  2DA7 A;  2X51 A;  1T08 B;  2V9K A;  2E2J J;  4M3B A;  1VQ5 I;  1B4A A;  4BGD A;  3CCR I;  4B09 A;  2GIZ A;  3JCU C;  2JA8 J;  3I0T A;  3K4L A;  1PUF A;  2M8E A;  3DBR B;  2L54 A;  1RKW A;  3EUK L;  5DS9 A;  1ZRD A;  1D5V A;  1S7A A;  2HTJ A;  1VND A;  3BDD A;  3FXK A;  3TKY A;  3PQJ A;  5F1J A;  2COB A;  1VQN I;  4PJ0 C;  3A01 B;  2VE8 A;  4YFK F;  1WJB A;  2E1O A;  5BPI A;  4EGZ A;  3BR1 A;  4XOP A;  3CMY A;  2CGP A;  2OBP A;  2K9M A;  2FNA A;  4YRV A;  4GYG A;  5LEJ A;  3MZ8 A;  2NVT J;  3K10 A;  4L9N A;  4F3Q A;  2G7U A;  2IPQ X;  1MZB A;  2L7M P;  2PX9 A;  1RUN A;  2KZV A;  4Y13 A;  1WRJ A;  1U3E M;  1NTC A;  4DYC A;  3CC4 I;  2BHY A;  4D5F A;  4HF1 A;  3G4S I;  1Z05 A;  2V9P A;  4CCL A;  4OMY A;  4ENN A;  4RB1 A;  3E6D A;  1RNL A;  2CSO A;  1HSJ A;  2HOA A;  3DLA A;  3BG7 A;  1O3S A;  3HOW J;  1A36 A;  1R36 A;  1X58 A;  2EB7 A;  4XQF A;  1Y8R B;  2AQE A;  1XCV A;  3G1M A;  3H0D A;  1LE8 B;  4BYY A;  1XDU A;  1Z9C A;  1FY7 A;  5E1X A;  4MFD A;  3S8P A;  2F48 A;  3PM1 A;  2GOX B;  1H89 C;  3KIO A;  5J8C A;  3QPT A;  2UWM A;  3QAH A;  2FA5 A;  1RET A;  1ZTR A;  3IV5 A;  2ISZ A;  3A03 A;  1NK2 P;  3J7A O;  2BY3 A;  1YW9 A;  2R3S A;  4D7M A;  2VLA A;  1ZLK A;  1BW6 A;  3CMM A;  3KEQ A;  3JSO A;  3OYL A;  2FBI A;  3ERM A;  3RPQ A;  1AOY A;  2CV1 A;  3P7N A;  4UV8 A;  3DEW A;  1O7L A;  3GCM A;  3J7Y J;  3LAP A;  1T2K A;  3MQ0 A;  3L1P A;  3EYI A;  3ZP5 A;  2W25 A;  2AXL A;  4XLP F;  2L9R A;  2X9D A;  3REO A;  3ZQH A;  2O6G E;  2Z16 A;  3CES A;  1X2M A;  4IHS A;  1K78 B;  3JAM K;  2QKL B;  2LBF A;  2YU9 J;  1SVL A;  3RYR A;  1I6H J;  3H5N A;  2FQ4 A;  4HAM A;  1W4M A;  4E70 A;  4MFE A;  2GLO A;  3LSM A;  2H8W A;  3EUA A;  3QU3 A;  1V5G A;  2TCT A;  4IO9 F;  1GXQ A;  2JVG A;  4M74 A;  1IG7 A;  3W2V A;  2OQG A;  3KP5 A;  4D1Q A;  4IOC F;  1AU7 A;  4MO7 A;  1VQL I;  1Z67 A;  4YFX F;  3CCV I;  1RUO A;  3L00 A;  2QSF X;  1EA3 A;  3DPL C;  3BZC A;  2BOL A;  2WY7 Q;  2EK5 A;  2LOO A;  1OMI A;  4OAY A;  4KIB A;  1HST A;  4E7Z A;  2HZD A;  5FD5 A;  3J81 K;  3JRG A;  3SJM A;  4MHG A;  1QQI A;  3M8J A;  3MN2 A;  5IYB J;  3NQO A;  1FTZ A;  2VPR A;  3O6B B;  2ADU A;  3BJO A;  1ZH5 A;  2A5W A;  2HXO A;  4OIQ F;  2V6E A;  2RQP A;  3HIF A;  2NVQ J;  3BT9 A;  5KNL A;  3TW6 A;  3WU1 B;  4XRM A;  1TNS A;  3R61 A;  2DMT A;  2M4G A;  2NS8 A;  3OV8 A;  5CPR B;  3L2C A;  3E6M A;  2IS4 A;  1S29 A;  2YUS A;  2VUM J;  4HX8 A;  3HOV J;  3BZ6 A;  5EG0 A;  4IF4 A;  1EV7 A;  2HDW A;  2H6B A;  4LJZ F;  3BR6 A;  3PIP F;  3QOE A;  3A0B C;  4P1W A;  3ECH A;  3CDI A;  2ISY A;  2BXZ A;  4BHP A;  1TQP A;  3CJQ B;  3CLO A;  2EIL H;  2VB6 A;  5B3S H;  2ZBK A;  1I3Q J;  2FQ3 A;  4P5O A;  2FF4 A;  3S2W A;  5LRS A;  4EVI A;  3LNQ A;  1T0F C;  4IZZ A;  4A3E J;  1KU2 A;  1TP4 A;  4A69 C;  4GO1 A;  2YPR A;  3K7A J;  3GTQ J;  4LIT A;  2O61 A;  3CP2 A;  2GBY A;  2KQR A;  4B43 A;  5LBQ A;  1IV8 A;  3E97 A;  3JRH A;  1R1U A;  2VJ4 A;  2J5O A;  4DGW B;  2CO5 A;  3I5U A;  3RCO A;  2HQA A;  1MDM A;  4NC8 A;  1NK3 P;  2QSG X;  3OIP A;  1XB4 A;  4XNF A;  1LVA A;  2CUE A;  2NS0 A;  3GF2 A;  3VOE A;  3E5X A;  3FHN A;  3K6G A;  5HS9 A;  1JI8 A;  1CF7 B;  2DK5 A;  3D5S C;  3FXO A;  4CCK A;  5E18 F;  2GOM A;  2KJC A;  4BE0 A;  2KRC A;  3FXQ A;  5F6F A;  4LLN A;  2EFN A;  3QPL A;  3HHG A;  3NEU A;  4UV9 A;  4CCM A;  2IAI A;  4CHU A;  3GUD A;  3BR2 A;  1MJB A;  2ECC A;  4XLF A;  4LG0 B;  4U88 A;  1ITY A;  3ZCO A;  2W82 A;  2WAQ A;  3ZR8 X;  1L3L A;  5IT9 K;  1JGG A;  3LL7 A;  1R4N B;  2Z5U A;  1SAN A;  3AG3 H;  2O3F A;  2EFO A;  4G6Q A;  2R7O A;  5FRM A;  3IH2 A;  4RGU A;  1LEB A;  1WJE A;  2X4H A;  1S9H A;  1STZ A;  4HW0 A;  3CUQ A;  4EJT A;  5ERI A;  2E1C A;  1WJC A;  4LIV A;  3CME I;  4BQA A;  2GXG A;  3E6B A;  5EF6 A;  4AM3 A;  5E17 F;  5F08 A;  1ETW A;  2J5P A;  3FBN B;  3CCM I;  1A6I A;  2E7X A;  2HFH A;  1LDD A;  2M3A A;  5KAI C;  5JLW A;  3HOU J;  1FIA A;  5M3F J;  5E8I A;  1QPI A;  1BR2 A;  2W00 A;  3LSP A;  1WJD A;  3B6A A;  2R7Z J;  1SFX A;  2M30 A;  2QQ9 A;  1TWG J;  1T8I A;  2XF6 A;  3LSK A;  1ZG3 A;  3J7Z I;  3M07 A;  2LKX A;  4Y15 A;  2NNY A;  3F21 A;  4H0E A;  2L01 A;  1XSX A;  2HNH A;  3EQL F;  1F1Z A;  1UG0 A;  1IW7 F;  4NQW A;  2NVY J;  1FOW A;  4BHC A;  2NAZ A;  1Z3X A;  2BE5 F;  3G6E I;  1SMY F;  5D5W B;  4M9S A;  2Q8K A;  3ZPL A;  3G1O A;  2LC2 A;  5DDG A;  2IRF G;  2IGN A;  2VAS A;  2ZME C;  3BLY A;  3N97 A;  4BH9 A;  3PJR A;  4IHX A;  3TW7 A;  1MMS A;  1CGP A;  3PQK A;  2MC4 A;  1MH3 A;  2R0Q C;  1UCR A;  3HPG A;  1N75 A;  4BEH A;  5FO5 A;  2HDC A;  3CD6 I;  2K3P A;  2FU4 A;  1BM9 A;  2HOS A;  3OYN A;  4PDK A;  3VB2 A;  1AHD P;  3S15 J;  4RM2 A;  1SD4 A;  3JRE A;  2DA6 A;  3TED A;  2F5V A;  5KAF C;  3HJE A;  3S1M J;  5GP9 A;  2CRG A;  3WG9 A;  1HC8 A;  3HUG A;  3V4G A;  2V6C A;  4PGG A;  3BTJ A;  1H9G A;  3W6V A;  1HW5 A;  1FX7 A;  3C7J A;  2MFZ A;  4RB0 A;  2W57 A;  2X85 A;  2IGK A;  4G7O F;  4L5E A;  1DQU A;  4IHW A;  2LD5 A;  3JRD A;  2JRT A;  1W7P D;  4L5J A;  3KEO A;  4P9F A;  1BJA A;  4M73 A;  1FOX A;  1ORK A;  4I7H A;  3I71 A;  3C1D A;  4NC6 A;  5LGN A;  2F2E A;  5D5X B;  2XGE A;  5BS6 A;  4YG2 F;  4EJO A;  1QZZ A;  2R7U A;  1XN7 A;  2ELK A;  2WBM A;  1XSV A;  2DTZ A;  3OR1 C;  2R7V A;  1BR4 A;  3OYD A;  1MBF A;  1TW2 A;  1Y1W J;  1FMV A;  3GME A;  1PVE A;  5K7Z A;  1JHH A;  2W7N A;  4KIF A;  2XIG A;  2VIX A;  2QA4 I;  2D5V A;  2B7E A;  3F8N A;  3NWT A;  2RDP A;  2RVC A;  3W6K B;  5IT9 Z;  3ULQ B;  3MFK A;  4IQ4 A;  1ETV A;  2DJN A;  2G7H A;  1AKH B;  5D6F A;  5EZG A;  1ETK A;  3JRI A;  2JN6 A;  2DT5 A;  2VPL A;  2ZC2 A;  4CUG A;  3K4M A;  3DWL E;  5L3E A;  1ZR4 A;  3ONQ A;  1HCR A;  1JUS A;  2Y69 H;  2FSW A;  3GW2 A;  1LUJ B;  2O8X A;  1OKR A;  2Y9Y A;  4XLC A;  3F6O A;  3RZD J;  1IN7 A;  1BI2 A;  3EUH C;  3JTH A;  1FPQ A;  1USS A;  4HQE A;  2KZG A;  2E7W A;  2V4J C;  3HSF A;  2BXY A;  5E20 A;  3CLQ A;  2HPI A;  3COA C;  1IUF A;  4Z6Y A;  1UHS A;  4DYQ A;  4AIJ A;  4K2E A;  4XRF A;  3LSI A;  2CQX A;  3LQR A;  4CZC A;  4FAS D;  1ZG1 A;  3E3V A;  3KZY A;  5AIQ A;  2IS6 A;  2XAS A;  3HOT A;  3A4C A;  4CZZ A;  4A2U A;  3BQZ A;  3ESW B;  2X1D A;  2Y0S N;  4D0P A;  2IGM A;  2Y75 A;  1PP8 F;  1X3U A;  2YS9 A;  2HGC A;  1SFO J;  3F9K A;  3GTJ J;  5F0H A;  1IXS B;  1RES A;  1B1B A;  3GFM A;  4PCQ A;  1R4M B;  4HRI A;  2HVQ A;  2ESN A;  2MH9 A;  1BJZ A;  4A3J J;  1IRF A;  2F5F A;  1KYW A;  4AD9 A;  2KJB A;  3BG6 A;  5K5R A;  5TRD A;  2DLL A;  1SFK A;  2A5Y B;  1BN5 A;  1ZGW A;  3HTS B;  2PEX A;  5J1U A;  3CP8 A;  3R0A A;  2CFO A;  4KA4 A;  1FIP A;  3PNY A;  5L3G A;  1VFC A;  5CVR A;  4G6D A;  1I5Z A;  2L9S A;  3KYC B;  4KIC A;  5CLS A;  4YIR X;  3RI4 A;  3F72 A;  2CS3 A;  5A2Q K;  3SZP A;  3H92 A;  1MMN A;  3EPZ A;  1XC5 A;  1WPK A;  5HLH A;  2XRO A;  1MNM C;  4I98 B;  3KP7 A;  4KMF A;  3CCU I;  1O57 A;  1HLV A;  2OJE D;  5ICC A;  4M72 A;  2A6T A;  2MBF A;  3Q0U A;  4BQN A;  1X1C A;  2WB1 N;  1LB2 A;  1L0O C;  5D8K B;  3S3N A;  3GZN B;  3FK6 A;  4IOA F;  1VQM I;  1TL8 A;  1G8X A;  4ZDP A;  4JX5 A;  2ZJP F;  3G2B A;  1F43 A;  2OC6 A;  1MMA A;  1EF4 A;  2WV1 A;  2X6Y A;  2DA3 A;  5EYR A;  3H5A A;  1MJ9 A;  1Z7L A;  3T8T A;  4HOB A;  1ACI A;  2DK8 A;  3CUO A;  3JTG A;  4L9J A;  3DBL B;  3S93 A;  3Q0V A;  2AHQ A;  4FX0 A;  1VQK I;  4J19 A;  2HVR A;  5JHF A;  2L0K A;  2ZXH A;  3CZ6 A;  2XRL A;  3HM5 A;  1HBX G;  2AQF A;  2OPT A;  1W1W E;  4DW6 A;  5H20 A;  3N4M A;  3LSR A;  3DEU A;  2PQ8 A;  2VE9 A;  4Y7N J;  5C4X J;  1J5Y A;  1HW2 A;  3PUF A;  3I59 B;  3K4C A;  3WTT C;  2K4J A;  2DBB A;  5K5O A;  1EKE A;  1W7P A;  3FHZ A;  5CVU A;  2Y31 A;  4BBS J;  4RGX A;  1YS7 A;  1DGR M;  5L3B A;  4IRI A;  1SAU A;  4X0G A;  5E3N A;  1KYZ A;  2JUC A;  2HTS A;  1B9N A;  2P5L C;  2Z99 A;  4MQ9 F;  3RKQ A;  2CFX A;  4EJV A;  1S6L A;  3GFI A;  2XAQ A;  1G3W A;  2I8D A;  2A61 A;  2JSC A;  3DTI A;  4U87 A;  4ZYD A;  1F5T A;  5ICG A;  4C3H J;  3H3Z A;  3KP2 A;  3D5R C;  4M9Z A;  1ZRC A;  2EZK A;  3K1M A;  2M0C A;  2VBW A;  5ED4 A;  5KK1 A;  1B8I B;  1MBG A;  1SD7 A;  3CF5 F;  3KZI C;  5J1R A;  1BIA A;  3DPT A;  4HSR A;  4ZJZ A;  1P9Q C;  4Y17 A;  5EJC A;  1OQY A;  1X2N A;  2HYJ A;  4GRI A;  2HS5 A;  3BR0 A;  3FIS A;  3KZZ A;  4IVN A;  5ILS A;  1A35 A;  3AG1 H;  3MKY B;  5DCM A;  2QZ8 A;  3VYR B;  2UUZ A;  4XIC A;  4BDY A;  2MG4 A;  1J7K A;  2DA2 A;  3R60 A;  1Y8Q B;  2WAQ N;  4KJZ A;  1OIS A;  5J47 A;  4KT5 C;  2MLG A;  3M9A A;  4CYC A;  2XDV A;  4PK4 A;  3OSF A;  2KDO A;  5A2Q Z;  2IT0 A;  5H2F C;  4IHT A;  2E19 A;  2RGV A;  3TP0 A;  5GPA A;  4ESF A;  3WE3 A;  3WTY C;  1R1V A;  1LKX A;  1WH5 A;  2DA4 A;  4IRH A;  2WA0 A;  1PUF B;  4HNU A;  2NYX A;  1ENH A;  2HQ5 A;  2P6T A;  4A0Y A;  3WTX C;  2P7V B;  3IUO A;  2F4I A;  1S72 I;  2MA3 A;  3KP3 A;  3FK7 A;  2PI0 A;  1KQ8 A;  3OMY A;  5FKN A;  5J3L A;  3J80 K;  1MBK A;  4G7Z F;  2Z9O A;  3DFG A;  1QNT A;  1G59 A;  1KGS A;  5J4Y A;  3V8J A;  2VKD A;  3TO9 A;  2KP6 A;  4G94 A;  5K1Y A;  4QTR A;  3WHB A;  2DMP A;  2W4S A;  4FQG A;  1R5H A;  3P5J A;  4RAY A;  2K40 A;  4UUV A;  1T33 A;  1OYW A;  2STW A;  3GWZ A;  1M1E B;  3ZRG A;  2Q2E A;  5FLM J;  4MTD A;  4V19 K;  2KPM A;  3F0C A;  5IT3 A;  1UEL B;  3MKW B;  2NOG A;  3RKY A;  2E5Z A;  2DU9 A;  3ZN0 A;  1JT6 A;  2Z1D A;  3GVA A;  3KP6 A;  2E60 A;  2V1D A;  1QU3 A;  4EJW A;  4RAG A;  4RB3 C;  1S5L C;  3VFZ A;  1FWZ A;  4M3E A;  2L4M A;  2P5K A;  2QBY B;  1I1S A;  2CUJ A;  3S17 J;  1FYK A;  1X1A A;  2RN7 A;  2CW7 A;  1EH8 A;  2V7F A;  5LLQ A;  3DLL F;  2Z33 A;  2HVS A;  2WAE A;  4HZF A;  4L0Y B;  1R7J A;  3K2Z A;  4IEJ A;  4ESJ A;  2FE3 A;  2CW0 F;  3W6J B;  4CCN A;  5J8F A;  1VF9 A;  4HX7 A;  1DU6 A;  3LFK A;  3D1N I;  2LR8 A;  2O7O A;  2EV6 A;  2EH3 A;  2NS7 A;  5D6E A;  2OF7 A;  5K5Q A;  1JHF A;  5E1W A;  3NAU A;  5L3D A;  1K79 A;  1HOM A;  4BE1 A;  2EWN A;  2HEO A;  1FC3 A;  2UXN A;  2A6E F;  3E5U A;  2FMY A;  1XCB A;  5FFZ A;  3FM3 A;  1IDZ A;  4CIC A;  4A12 A;  4G12 A;  3QOD A;  1VQ9 I;  1FYM A;  1SMT A;  1X1B A;  2QM3 A;  1LPQ A;  1FNN A;  3WTS C;  4HF2 A;  1I50 J;  2M0M A;  4UB8 C;  1YTY A;  2RC4 A;  1ZLJ A;  4LLG F;  3JRF A;  2LYC A;  4N0B A;  3AAF A;  2EV0 A;  1KQ9 A;  2O5R A;  2LBF B;  3HOZ J;  2LY9 A;  5L3C A;  3QYE A;  3PUB A;  2LMD A;  1JKO C;  4UUS A;  1AWC A;  4ZC3 A;  3CUQ C;  2HYF A;  2Y0S A;  2LKS A;  3O2P E;  3RDI A;  1T95 A;  3DF8 A;  2QEX I;  1LFB A;  2LRD A;  3U21 A;  3C2B A;  4P9U A;  2ZCW A;  1XD7 A;  2EJR A;  3Q0W A;  1JUM A;  3TMO A;  4KMU X;  2L02 A;  1JKP C;  4PJM A;  1A6Q A;  1FSE A;  4GDF A;  2WAF A;  3NAR A;  1OR7 C;  3B6C A;  2A3S A;  3QWL A;  1GT0 C;  5CJ9 A;  2HU9 A;  1R23 A;  5HNF A;  4NNJ A;  3OYM A;  3F8M A;  3VYS B;  3HRT A;  3J80 Z;  4FIS A;  1YJN I;  2NVX J;  3H1C A;  4E7I A;  2X48 A;  1WCM J;  2ZJR F;  2AS5 F;  3ROU A;  2FOW A;  4BY1 J;  2FBK A;  5HOD A;  3WGI A;  2Y30 A;  5M5X J;  5J4V A;  1UJ8 A;  5D8L B;  4GXO A;  5IP7 J;  2VL8 A;  2QQ8 A;  1D3Y A;  4HV6 A;  3EYY A;  1HF0 A;  4QPQ A;  1DPR A;  1TBX A;  5EG0 B;  1RC9 A;  2WB1 A;  3I4P A;  1NHA A;  2QF7 A;  1WWX A;  2TDX A;  3FMQ A;  1H9T A;  5K7F A;  1ETX A;  3LSG A;  1P6R A;  2FXA A;  2Y0M A;  5LHH A;  1J09 A;  2LY2 A;  2C6Y A;  1HW1 A;  4D7N A;  1BC8 C;  3C2H A;  3FF5 A;  2YU3 A;  4XOT A;  1JKR C;  2EZH A;  2DOF A;  2KMU A;  3LSH A;  4EJU A;  2JK3 A;  5E3M A;  1YJ9 I;  4BNC A;  2IP2 A;  3K0L A;  3JR9 A;  1KU3 A;  3BQY A;  1R58 A;  3ZMV A;  3HBL A;  1RIO H;  1U5T A;  3OYH A;  4BE2 A;  1MDM B;  5C4J J;  2WY8 Q;  3E1S A;  1VQO I;  1YLF A;  3FXR A;  3FIW A;  1QGP A;  1Y1V J;  2R7Q A;  3KFW X;  3SXY A;  4XKC A;  5C3E J;  4LB5 A;  3ZQF A;  1LFP A;  4X6A J;  1ETY A;  2MC3 A;  4KIT B;  2MYS A;  4AUX A;  4RGS A;  3ELK A;  4EEF G;  1D0X A;  1APL C;  3GTL J;  4DIQ A;  5GTI C;  4YFN F;  4O6J A;  4U0Y A;  4KFC A;  3TO7 A;  1U78 A;  2YX7 A;  1MIJ A;  2XHK A;  2LLK A;  1SD6 A;  4XON A;  5FKM A;  3BPV A;  3HSE A;  2MH2 A;  1W5S A;  2P5V A;  1IXR C;  3PNT A;  4JK1 X;  4HV5 A;  4ZZL A;  3GYH X;  3BR3 A;  2IA1 A;  1ZN2 A;  2P6S A;  2KFD A;  1HDP A;  2VJJ A;  4IJA A;  1I27 A;  2XSJ C;  2EFW A;  4XK4 A;  1LVK A;  4CSW A;  1Z6R A;  2M87 A;  3ABT A;  2X1C A;  4UVB A;  1NG7 A;  4UXN A;  3KYL A;  1U9N A;  3CUQ B;  2VKV A;  1ZKG A;  3GFJ A;  2H27 A;  2D1V A;  4AIK A;  1YRN A;  2M45 A;  2K3F A;  3K9T A;  2EIN H;  3OS2 A;  4IRG A;  1MMD A;  3A02 A;  3RJP A;  3CC2 I;  3OY9 A;  3SYT A;  4EMS A;  2OD5 A;  4ANJ A;  3BTC A;  4C3J J;  3OR2 C;  3HOX J;  2YSR A;  4N9I A;  5FGM A;  3WTU C;  3F22 A;  1KU7 A;  2JRM A;  4F7Z A;  5LHG A;  4L9V A;  3HC7 A;  2P0W A;  1K4S A;  5CVJ A;  1IF1 A;  4II2 A;  4NB5 A;  2X0L A;  3I3L A;  4F93 B;  2XKP A;  3ERE D;  2B0L A;  2CQQ A;  1X1P A;  1HXD A;  3FMR A;  5IYC J;  4FX4 A;  4IL6 C;  5GAG J;  3CCL I;  2PFB A;  5BNG A;  1J75 A;  2PLY A;  2CJJ A;  2VKH A;  1HA8 A;  4MEY F;  3S3O A;  3OOP A;  3PSF A;  3DPU A;  4ZTF A;  5K7H A;  4NQW B;  1BOA A;  3HG9 A;  4AID A;  3WTW C;  2KRF A;  4LFU A;  2QWW A;  4BJ6 C;  2VON A;  3I9V 2;  4PZJ A;  2LFB A;  3G3Z A;  4Q48 A;  2L7Z A;  3IHU A;  2M5W A;  4XL9 A;  2LF7 A;  1SFU A;  1O4X A;  1B72 A;  4YEJ A;  5LRR A;  2DOA A;  2EIM H;  2OQR A;  3KLN A;  1WVR A;  3T8R A;  2QLZ A;  4WK8 F;  3HGY A;  3HSR A;  2KIU A;  3GO5 A;  2G0E A;  3H9J A;  4BEH B;  1ON1 A;  4II3 A;  3OYF A;  5ILU A;  1OR7 A;  2P81 A;  4UNO A;  2HQR A;  2E35 A;  3L2R A;  5FLV A;  5LGU A;  1S7O A;  2VQH A;  5JFR A;  1AA7 A;  5CQE A;  2EIK H;  1MBE A;  4NDL A;  3H36 A;  4XMY A;  4DOZ A;  3ZQC A;  6PAX A;  1FBU A;  3HUG B;  3BY6 A;  1P4A A;  1K61 A;  2DPU A;  2L3D A;  4L9T A;  4MQV A;  1JJ6 C;  3T0Y A;  3S3M A;  1YIT I;  4B47 A;  4M3G A;  4QPO A;  4CA0 A;  1WJF A;  1A04 A;  1R6R A;  1W36 D;  4OWR B;  4LG0 A;  1YI2 I;  1D0Y A;  4ASN A;  4ENM A;  2ZXJ A;  2VKE A;  4A3L J;  1RR7 A;  5DV5 A;  2MW8 A;  5J40 A;  3AG4 H;  2F6C A;  4Y4R A;  2ME6 A;  1R9T J;  4LB6 B;  2XUB A;  5FJ8 J;  3HPH A;  1UMQ A;  1Z6T A;  2A69 F;  4FT8 A;  1Y56 A;  3PNV A;  1GVD A;  3OL3 A;  2ID6 A;  2GWR A;  2VJ5 A;  2VT3 A;  5E3O A;  3GTK J;  1GHC A;  3W2W A;  3BTL A;  2OZU A;  1IC8 A;  4S0H B;  3OL4 A;  3S2D J;  1Y39 A;  5DD8 A;  5J6X A;  3JRA A;  4A3F J;  3MZH A;  2HOE A;  1VI0 A;  2EV5 A;  4WF2 A;  4BBR J;  2KIQ A;  1OCP A;  3DU5 A;  2UXX A;  1D1B A;  2M2E A;  4V2F A;  1G3Y A;  1X3Z B;  1SEU A;  1DGW Y;  1UG2 A;  2H1K A;  3HRS A;  4BJ5 C;  1P7J A;  2XGC A;  5FRN A;  5M3M J;  4AU7 A;  2FD5 A;  1FYL A;  3E7L A;  1JTX A;  2BVL A;  2R7D A;  2NOJ B;  5DM7 F;  4IHV A;  2JZY A;  1LDK B;  3GX4 X;  1XGN A;  2P8T A;  5EZH A;  3QPS A;  2JVH A;  2K7L A;  2XB5 A;  2UZK A;  1FLI A;  1V54 H;  1XGS A;  3KCC A;  2QSH X;  1H88 C;  1VQ6 I;  2FRH A;  1O3T A;  2GXA A;  1S8N A;  1IN5 A;  2K9Q A;  3MKZ A;  3HOS A;  4RB2 C;  2QUF A;  2KT0 A;  3OYE A;  2LH9 A;  2PMU A;  4IX7 A;  1E17 A;  1ERD A;  1FSH A;  2ESH A;  3F23 A;  5HS7 A;  2JA7 J;  3BTI A;  2H1L A;  1UB9 A;  1U9O A;  3Q5F A;  3ABL H;  1P7I A;  5GAE J;  4RLF A;  4AIH A;  3IWF A;  2PJR A;  1SD5 A;  2K85 A;  3QU6 A;  1G3T A;  1FOK A;  4BY7 J;  5HOO A;  1DUX C;  2L5Q A;  2EQR A;  4HDV A;  2M34 A;  2ZB9 A;  4G7H F;  3K4N A;  5IOZ A;  4A3K J;  1JJ8 C;  3MEX A;  1OCO H;  1T38 A;  5EGO A;  1YE9 A;  4KDP A;  4L0Z B;  4I01 A;  2D1H A;  3BOQ A;  4E7L A;  4BDZ A;  4M3F A;  3RQI A;  4TV7 A;  3AFH A;  3JRB A;  2KIF A;  1N25 A;  2IA2 A;  3DBH B;  2DQR A;  4C30 A;  2DOD A;  3ZQG A;  2LF8 A;  4XLE A;  3RSN A;  3OS0 A;  3HYI A;  4IQJ A;  2COM A;  1LQ1 A;  1XGM A;  2LY1 A;  1S7E A;  2CV2 A;  4I0A A;  2MSY A;  4JX4 A;  2ZXW H;  2KLO A;  4FE4 A;  2OV7 A;  1MD0 A;  4DNC A;  1IN6 A;  3OWT A;  2E5N A;  3OS1 A;  2LNB A;  2XAH A;  1G3S A;  3IH4 A;  2DMU A;  2IA0 A;  4XLN F;  1KZH A;  2IGO A;  2DYR H;  3H9G A;  4PJL A;  3WE2 A;  3FDY A;  2QGU A;  3KEY A;  3TL4 X;  4ITV A;  1IRZ A;  2JUG A;  1AKH A;  4ESB A;  1D1A A;  2ZME B;  2K9N A;  2XVC A;  3OSG A;  1YS6 A;  5JVG F;  1OYI A;  5BMZ A;  5CVI A;  4DQ2 A;  3O3K A;  1ONV A;  3SZG A;  5KCM A;  1ZG5 A;  4KIS A;  3WG7 H;  1TQM A;  1H0M A;  2R5Z A;  1UHW A;  4HNV A;  3U9G A;  3IKT A;  3CJT B;  2IBD A;  1ETQ A;  5DUK A;  5E3L A;  2XAJ A;  2DO7 A;  3BZK A;  4FET A;  5LD2 C;  2DQL A;  4OIP F;  2VBX A;  1P4W A;  3LST A;  4JX6 A;  3ZQQ A;  2A07 F;  5HS8 A;  2RAE A;  3M8E A;  1RRJ A;  4XKW A;  3V7R A;  3BRO A;  4ZYH A;  2RKH A;  4KN7 X;  1LJ9 A;  4XKV A;  5DD4 A;  1D1C A;  4RDU A;  4A3D J;  3LMM A;  2BZT A;  5GPC A;  1B59 A;  1Y0U A;  3LWF A;  2EZI A;  4P55 A;  3AL0 C;  2IXS A;  3SDB A;  1JE8 A;  5DEQ A;  1YO5 C;  3GZ5 A;  4U0V A;  1DPU A;  4RA2 A;  3E0J B;  4M6X A;  2JQ7 A;  5DM6 F;  5C44 J;  1S3J A;  2KIM A;  2XPU A;  2CG4 A;  2MAB A;  2W84 A;  4RAF A;  1TWC J;  4PSW A;  1LNW A;  1QHH D;  3LQQ A;  4A5M A;  2NNN A;  2LG4 A;  3QRF F;  2R7X A;  2IW5 A;  4HBL A;  1EH7 A;  4LK1 F;  4C9Y A;  3JSP A;  4RGR A;  3OYC A;  4B3X A;  4AVZ A;  3R4K A;  1WFX A;  3OYI A;  1GXP A;  1QA6 A;  1Z91 A;  4I2O A;  3ML6 A;  1Z3Y A;  1XTA A;  2B63 J;  4ZDO A;  1X1D A;  3PL8 A;  3BG5 A;  4XSZ F;  2BGC A;  3PO2 J;  2K27 A;  4RS8 A;  3VPR A;  4Y3O A;  1O3R A;  1REP C;  5TGT A;  4ETS A;  3AKZ A;  2VBY A;  4AVP A;  3TDZ C;  5HDG A;  1B9M A;  1XG1 A;  3F3X A;  2M4K A;  1XMX A;  4CCO A;  2HI3 A;  5FFX A;  1V4R A;  4B44 A;  5F0C A;  2BY0 A;  4OIN F;  2EZL A;  2DA5 A;  4KUM A;  3U1D A;  1E2X A;  2IS2 A;  1YW8 A;  1K7A A;  4FTH A;  2K4B A;  1OCZ H;  2LVS A;  4RMN A;  2X6O A;  4PJJ A;  5DCM B;  1IN8 A;  1I6X A;  2F5E A;  3S1Q J;  2OZ6 A;  3G1L A;  4JBA A;  3VWB A;  3K4B A;  2R7T A;  3GBG A;  1QPM A;  4HYE A;  5CKT A;  5ICE A;  1XMA A;  3P9C A;  3IAS 2;  4JQF A;  5F27 A;  2LKP A;  2GA2 A;  3HTU A;  4M3D A;  4LLL A;  4CYC B;  3H9Q A;  5HLT A;  3O8G A;  1IRG A;  3MCZ A;  4CXF A;  1ZHF A;  1U8B A;  1QBJ A;  1T39 A;  1T56 A;  4OU0 A;  2KL4 A;  1HDD C;  5JR3 A;  3FXM A;  2P7C B;  2CMP A;  2LDU A;  4B8X A;  2BY1 A;  1DP7 P;  4I6Z A;  4X1E A;  3GXO A;  4BXU A;  3GLX A;  2IS1 A;  1TQI A;  4A5N A;  3HHH A;  2ELH A;  2E36 A;  3IH3 A;  3GZ6 A;  3VYU B;  2ZO4 A;  4M6Y A;  3VOD A;  3IAM 2;  1K83 J;  4MTE A;  4AYB N;  2AO9 A;  1MGT A;  2STT A;  1R49 A;  4C2M J;  2VOD A;  3DQV C;  4UB6 C;  2CUZ A;  2VQL A;  4LD5 A;  4EM2 A;  4NBQ A;  4DBR A;  4XN3 A;  1FEX A;  2VI6 A;  3DTE A;  2GIV A;  3ZMZ A;  4KNY A;  3TDU C;  1OCR H;  2MD0 A;  3S2H J;  2F5D A;  1BR1 A;  3SQN A;  2E1M C;  4BJT A;  4N9H A;  5H6R A;  5FLX K;  1R5G A;  1CQT A;  2CYY A;  1YX5 A;  3ABK H;  1KQ0 A;  2WTE A;  5GAD J;  2XPW A;  2W24 A;  2XGX A;  2ZNZ A;  4I99 C;  2PG4 A;  3C2G A;  5CVV A;  1PP7 U;  2R5Y A;  4WXC A;  3TBI A;  4PUS A;  1WI3 A;  1U5T C;  4XLH A;  2RV8 A;  3LA7 A;  5DYM A;  4UVC A;  4W97 A;  2MGQ A;  3ZMD A;  2DPD A;  2DMN A;  3VSK A;  1WKM A;  3T5X A;  2H94 A;  2N8G A;  4CCJ A;  1JUP A;  1VZ0 A;  4ZTJ A;  2L2O A;  1YFH A;  3SEQ A;  4RAZ A;  5B5E C;  4IKF A;  3UNG C;  3WTZ A;  4Q5S F;  2P4W A;  3C18 A;  2RNJ A;  2EBI A;  4Q4Z F;  1YW7 A;  5FKO A;  3BG3 A;  1TT0 A;  1QZY A;  1Y6I A;  3M8F A;  1Z77 A;  2ACJ A;  1QRY A;  3K2A A;  4A93 J;  5IP9 J;  2CW8 A;  1DU0 A;  2ZJQ F;  5B1A H;  2MD5 A;  1JTY A;  5JLX A;  1JXS A;  4R8H A;  2DOE A;  4E7H A;  3GEZ A;  2L9V A;  2V79 A;  3CC7 I;  4WXH A;  4ON0 A;  4UUS B;  3OYB A;  4WXD A;  5DCF A;  2XV4 S;  3I58 A;  2D2W A;  3BWG A;  2O03 A;  4A3I J;  4ZYA A;  2Z3Y A;  2ZKZ A;  3KP4 A;  3V7S A;  2I10 A;  1P92 A;  2BW3 A;  3K4J A;  3ZGK A;  3MVP A;  2V9V A;  3SEZ A;  1K4T A;  2YX4 A;  1A31 A;  5IOY A;  2R4G A;  2Y48 A;  3SDG A;  4CO8 A;  3Q3S A;  5BPD A;  4C2U A;  3I55 I;  3GTO J;  4ZDL A;  4CGZ A;  1GDT A;  3M7G A;  2L7K A;  2XF5 A;  1B6A A;  2XC7 A;  2JPB A;  3OOU A;  5GTH C;  3WGG A;  3CDL A;  3B02 A;  1MW7 A;  2W48 A;  3ASN H;  4QLC U;  4E7S A;  1FP2 A;  4ZZD A;  1IAW A;  2CH0 A;  3X2Q H;  4MLO A;  1POG A;  2R93 J;  2F5C A;  2HWV A;  3ZMU A;  4ZH4 F;  3IC7 A;  4QWQ A;  4HNT A;  3IRQ A;  3DCF A;  3DTK A;  2VQG A;  4RM3 A;  3JW4 A; 
#chains in the Genus database with same CATH homology
 2OU2 A;  2K86 A;  4LMY A;  3I53 A;  2QQB A;  3KE2 A;  2QBY A;  4YII A;  1ZRF A;  1YIO A;  1ZRE A;  5AON A;  5FLX Z;  1U2W A;  2PJP A;  1XMK A;  1J9I A;  3LA2 A;  1QO0 D;  1BC7 C;  4HLX A;  3H3U A;  3FZV A;  5D4S A;  3V8K A;  1U8R A;  3G73 A;  1U5T B;  1TNT A;  4LK0 F;  1J2X A;  3L7W A;  3NRV A;  3BPX A;  3BJ6 A;  3B73 A;  2BBY A;  1V3F A;  3HRU A;  4G9Y A;  2QVO A;  3TO6 A;  1C0W A;  1ZAO A;  1BI3 A;  3L09 A;  4YIF A;  4MEX F;  1XGO A;  1KA8 A;  3WGH A;  1R00 A;  1YQA A;  1FT9 A;  3QOP A;  4A6E A;  4UVA A;  2H6C A;  2HKX A;  3CJN A;  1K78 A;  3WOD F;  2D45 A;  2BV6 A;  4EM0 B;  2V1U A;  4HA8 A;  5JHU A;  3LAJ A;  3DP7 A;  1G4D A;  1ULY A;  2DI3 A;  2HR3 A;  2QEN A;  3ECO A;  1ZGA A;  3VEP A;  1OPC A;  5BOX A;  2HZT A;  1O7F A;  4AWX B;  3DXJ F;  2VOO A;  2E1N A;  4I0B A;  2GZW A;  4R1H A;  3P9I A;  3CO6 C;  2VC1 A;  2HQN A;  2XAG A;  5L3F A;  4ENJ A;  1HKQ A;  1F9N A;  3TGN A;  3ISP A;  1HKT A;  2R7F A;  3MZY A;  2Q0O A;  3K69 A;  2HYG D;  5H6Q A;  1D8K A;  2XRN A;  4CDG A;  4EQQ A;  4LGW A;  4S05 A;  3JAM Z;  1F4K A;  3ZMT A;  3HRM A;  1TLH B;  4GYI A;  1WI9 A;  2ZJ2 A;  5D5V B;  5JI6 A;  5LHI A;  4GGG A;  3RYP A;  3BJA A;  3IRR A;  2DTR A;  2FML A;  4IPA A;  1FBS A;  5ILV A;  2VBZ A;  2EFQ A;  1W5T A;  4WX9 A;  1CF7 A;  4OOI A;  5BQT A;  4OMZ A;  1GVJ A;  2ETH A;  1FBQ A;  1MKM A;  5TJJ A;  3Q9V A;  3J81 Z;  1PDN C;  2LSO A;  3I64 A;  1TTY A;  2EA4 A;  3TQN A;  4EV0 A;  2IVM A;  1ZGJ A;  5HLG A;  4R79 A;  1K6O A;  2PN6 A;  2OA4 A;  3RTR A;  3FX3 A;  2WWY A;  1ODD A;  4UHT A;  1WQ2 A;  3RKW A;  2PBI A;  3KLO A;  4MGR A;  5AIP A;  1I1G A;  2FBH A;  2WC2 A;  4O3M A;  3ZN1 A;  2QQA A;  1SFE A;  4XSX F;  5HVQ C;  2EA2 A;  4I02 A;  4WWC A;  3CO7 C;  3K1N A;  4EGY A;  3FMS A;  4BAY A;  3EDP A;  4P96 A;  5D4R A;  2FNP A;  1XDS A;  5F1R A;  4U0W A;  2DAO A;  5HDK A;  5D5U B;  3MWM A;  3F8C A;  3F8B A;  4GCV A;  4U7D A;  4I09 A;  2G9W A;  1D8J A;  3F8F A;  2DW4 A;  1YYV A;  2GXB A;  2JT1 A;  2V1X A;  5ICF A;  3K1P A;  3DV8 A;  1T0F A;  3D5L A;  1IZ1 A;  4MNU A;  3F6V A;  5DUI A;  4PGH A;  4A0X A;  2XKO A;  1LDJ A;  2K02 A;  5LGT A;  1PUE E;  3TOA A;  3WU0 A;  2WV0 A;  5FD6 A;  1ZYR F;  3V8L A;  1MJA A;  1Z7U A;  1ZAR A;  1IN4 A;  1BIB A;  3Q9S A;  4M9X A;  4Q47 A;  2VC0 A;  4KIG A;  4OIR F;  3RKX A;  3BP8 A;  1HKS A;  1BI1 A;  3GFL A;  5FB2 A;  3KET A;  2CQK A;  3DKW A;  1HQC A;  3ABU A;  4HX4 A;  1IUY A;  2DFI A;  4U7B A;  2ZFW A;  4KN4 X;  1T98 A;  3SFZ A;  5JVT A;  4CYD A;  4KYW A;  4ZYG A;  4IXA A;  1ON2 A;  1UST A;  3QP6 A;  2XAF A;  3RPU A;  2CWE A;  3CTA A;  2O0Y A;  3LA3 A;  2JTV A;  1SAX A;  3R0J A;  2NRA C;  2GAU A;  3C3W A;  1R22 A;  3FWE A;  3WTV C;  2QYO A;  2L4A A;  4WCG A;  2PMH A;  1XSD A;  5HLI A;  1IXC A;  2OAZ A;  1EH6 A;  1Z1D A;  3P9K A;  5EEH A;  1T6S A;  3FM5 A;  3RIR A;  2VOP A;  5EEG A;  1RZ4 A;  1P4X A;  1W7P B;  4S04 A;  2JPC A;  5KVR A;  5E8G A;  2IJL A;  3D0S A;  4HF0 A;  2ZME A;  3ZMS A;  5CYV A;  4L18 B;  2KKO A;  5F64 A;  3R6S A;  3ZQ7 A;  1R1T A;  3CDH A;  4ZYE A;  3T1B A;  3I54 A;  1LEA A;  4HLY A;  3EET A;  2VN2 A;  1P2F A;  4O5V A;  3SHF A;  4M71 A;  2BYV E;  2W85 A;  3TOB A;  3FXU A;  1BBY A;  2ZNY A;  4HQM A;  1BI0 A;  1FP1 D;  1OYY A;  2M1B A;  2A6H F;  1UHM A;  2FEZ A;  2GA1 A;  2VXZ A;  3IKV A;  1Q1H A;  3M1E A;  2HKO A;  4G8X A;  2VT2 A;  1O3Q A;  1WSU A;  1J59 A;  3V7C A;  3QPH A;  5HDN A;  3SZT A;  3QP5 A;  1DDN A;  2EFP A;  2FOK A;  1UFM A;  3IWZ A;  3PFI A;  4EM1 A;  3I59 A;  4NHJ A;  3EUH A;  3IL2 A;  3L9F A;  1TW3 A;  3MAJ A;  2A68 F;  4BHB A;  4HDU A;  4XBF A;  2H09 A;  4L5I A;  3E5Q A;  3U2R A;  5E1Z B;  3E6C C;  4ENK A;  1JGS A;  4FHT A;  2MLK A;  2YR2 A;  4Z2Y A;  5LEK A;  4A6D A;  2BEO A;  1J0R A;  1VTN C;  1YG2 A;  4OIO F;  1FZP B;  2GQQ A;  1KU9 A;  1U6G A;  1G6N A;  1RI7 A;  4A0Z A;  1B4A A;  4B09 A;  3I0T A;  2M8E A;  2L54 A;  1ZRD A;  1D5V A;  1S7A A;  2HTJ A;  3BDD A;  3TKY A;  3PQJ A;  2VE8 A;  4YFK F;  5BPI A;  4EGZ A;  2CGP A;  2OBP A;  2FNA A;  4GYG A;  5LEJ A;  4L9N A;  2G7U A;  2IPQ X;  1MZB A;  1RUN A;  4Y13 A;  1WRJ A;  1U3E M;  4HF1 A;  1Z05 A;  4OMY A;  4ENN A;  4RB1 A;  3E6D A;  1RNL A;  2CSO A;  1HSJ A;  1O3S A;  1R36 A;  2EB7 A;  1XCV A;  4BYY A;  1XDU A;  1Z9C A;  1FY7 A;  5E1X A;  5J8C A;  3QPT A;  2UWM A;  3QAH A;  2FA5 A;  2ISZ A;  3J7A O;  1ZLK A;  1YW9 A;  2R3S A;  3JSO A;  3KEQ A;  2FBI A;  3RPQ A;  1AOY A;  3P7N A;  4UV8 A;  1O7L A;  3LAP A;  1T2K A;  3MQ0 A;  3EYI A;  3ZP5 A;  2W25 A;  2AXL A;  4XLP F;  3REO A;  2O6G E;  4IHS A;  1K78 B;  3JAM K;  3RYR A;  4HAM A;  1W4M A;  4E70 A;  3QU3 A;  1GXQ A;  4M74 A;  2OQG A;  3KP5 A;  4YFX F;  1RUO A;  3L00 A;  3DPL C;  2EK5 A;  1OMI A;  4KIB A;  1HST A;  5FD5 A;  3J81 K;  4MHG A;  1QQI A;  3NQO A;  3O6B B;  2ADU A;  3BJO A;  1ZH5 A;  4OIQ F;  2RQP A;  3HIF A;  3WU1 B;  1TNS A;  3R61 A;  3OV8 A;  3L2C A;  3E6M A;  1S29 A;  4HX8 A;  3BZ6 A;  4IF4 A;  1EV7 A;  2H6B A;  4LJZ F;  3ECH A;  2ISY A;  4BHP A;  1TQP A;  3CLO A;  2ZBK A;  2FQ3 A;  4P5O A;  2FF4 A;  3S2W A;  5LRS A;  4EVI A;  1KU2 A;  4GO1 A;  2YPR A;  2O61 A;  5LBQ A;  3E97 A;  1R1U A;  2J5O A;  2CO5 A;  3I5U A;  1MDM A;  1XB4 A;  1LVA A;  2NS0 A;  3GF2 A;  3VOE A;  3E5X A;  5HS9 A;  1CF7 B;  2DK5 A;  5E18 F;  2KJC A;  3FXQ A;  5F6F A;  4LLN A;  2EFN A;  3HHG A;  3NEU A;  4UV9 A;  4CHU A;  3GUD A;  1MJB A;  4LG0 B;  4U88 A;  1L3L A;  5IT9 K;  2Z5U A;  2O3F A;  2EFO A;  4G6Q A;  4RGU A;  1LEB A;  2X4H A;  1STZ A;  4HW0 A;  3CUQ A;  4EJT A;  5ERI A;  2E1C A;  4BQA A;  2GXG A;  3E6B A;  5E17 F;  2J5P A;  2E7X A;  2HFH A;  1LDD A;  5E8I A;  1SFX A;  2M30 A;  2QQ9 A;  1ZG3 A;  4Y15 A;  2NNY A;  3F21 A;  4H0E A;  2L01 A;  1XSX A;  3EQL F;  1F1Z A;  1IW7 F;  4NQW A;  4BHC A;  2NAZ A;  2BE5 F;  1SMY F;  5D5W B;  4M9S A;  2Q8K A;  3ZPL A;  5DDG A;  2IRF G;  3N97 A;  4BH9 A;  1CGP A;  3PQK A;  2HDC A;  1UCR A;  5FO5 A;  2FU4 A;  1BM9 A;  4PDK A;  3VB2 A;  1SD4 A;  3WG9 A;  3HUG A;  3V4G A;  2V6C A;  4PGG A;  1H9G A;  1HW5 A;  1FX7 A;  3C7J A;  4RB0 A;  2W57 A;  4G7O F;  2JRT A;  1W7P D;  4L5J A;  3KEO A;  4P9F A;  1BJA A;  4M73 A;  4I7H A;  3I71 A;  3C1D A;  5LGN A;  2F2E A;  5D5X B;  5BS6 A;  4YG2 F;  4EJO A;  1QZZ A;  1XN7 A;  1XSV A;  1TW2 A;  1JHH A;  4KIF A;  2XIG A;  3F8N A;  3W6K B;  5IT9 Z;  2RDP A;  2RVC A;  3ULQ B;  3MFK A;  2G7H A;  5D6F A;  2DT5 A;  5L3E A;  2FSW A;  3GW2 A;  2O8X A;  1OKR A;  3F6O A;  1IN7 A;  1BI2 A;  3JTH A;  1FPQ A;  1USS A;  4HQE A;  2E7W A;  3HSF A;  5E20 A;  3COA C;  4AIJ A;  4K2E A;  4XRF A;  3LQR A;  1ZG1 A;  3E3V A;  3KZY A;  5AIQ A;  2XAS A;  3HOT A;  4CZZ A;  4A2U A;  4D0P A;  2Y75 A;  1PP8 F;  1X3U A;  2HGC A;  1IXS B;  1B1B A;  3GFM A;  4PCQ A;  2ESN A;  2MH9 A;  1IRF A;  2F5F A;  1KYW A;  4AD9 A;  2KJB A;  5K5R A;  5TRD A;  2DLL A;  2A5Y B;  1BN5 A;  3HTS B;  2PEX A;  3R0A A;  4KA4 A;  5L3G A;  5CVR A;  4G6D A;  1I5Z A;  4KIC A;  5CLS A;  3RI4 A;  3F72 A;  5A2Q K;  3SZP A;  3H92 A;  5HLH A;  2XRO A;  4I98 B;  3KP7 A;  4KMF A;  1O57 A;  5ICC A;  4M72 A;  2MBF A;  1LB2 A;  1L0O C;  5D8K B;  1MJ9 A;  3T8T A;  4HOB A;  2DK8 A;  3CUO A;  3JTG A;  4L9J A;  4FX0 A;  1HBX G;  5H20 A;  3N4M A;  3DEU A;  2PQ8 A;  2VE9 A;  1J5Y A;  1HW2 A;  3I59 B;  3WTT C;  2K4J A;  2DBB A;  5K5O A;  1W7P A;  3FHZ A;  5CVU A;  4RGX A;  1YS7 A;  5L3B A;  4IRI A;  1KYZ A;  2HTS A;  1B9N A;  2P5L C;  2Z99 A;  4MQ9 F;  2CFX A;  4EJV A;  1S6L A;  3GFI A;  2XAQ A;  1G3W A;  2A61 A;  2JSC A;  4ZYD A;  1F5T A;  5ICG A;  3H3Z A;  3KP2 A;  4M9Z A;  1ZRC A;  3K1M A;  2VBW A;  5ED4 A;  5KK1 A;  1SD7 A;  1BIA A;  3DPT A;  4Y17 A;  2HS5 A;  3KZZ A;  5ILS A;  4IVN A;  5DCM A;  2QZ8 A;  1J7K A;  3R60 A;  4KT5 C;  2MLG A;  3M9A A;  5A2Q Z;  2IT0 A;  4IHT A;  2RGV A;  4ESF A;  3WE3 A;  3WTY C;  1R1V A;  4IRH A;  2NYX A;  2P6T A;  4A0Y A;  3WTX C;  2P7V B;  2MA3 A;  3KP3 A;  2PI0 A;  1KQ8 A;  3J80 K;  4G7Z F;  2Z9O A;  3DFG A;  1QNT A;  1KGS A;  3V8J A;  3TO9 A;  4G94 A;  5K1Y A;  1R5H A;  4UUV A;  4RAY A;  1OYW A;  2STW A;  3GWZ A;  4MTD A;  2Q2E A;  5IT3 A;  3RKY A;  2DU9 A;  3ZN0 A;  3GVA A;  3KP6 A;  2V1D A;  4EJW A;  4RB3 C;  3VFZ A;  1FWZ A;  2L4M A;  2P5K A;  2QBY B;  1I1S A;  1FYK A;  2RN7 A;  1EH8 A;  5LLQ A;  2Z33 A;  4HZF A;  4L0Y B;  1R7J A;  3K2Z A;  4ESJ A;  2FE3 A;  2CW0 F;  3W6J B;  5J8F A;  4HX7 A;  3LFK A;  2EV6 A;  5D6E A;  5K5Q A;  1JHF A;  5E1W A;  5L3D A;  1K79 A;  2HEO A;  2EWN A;  1FC3 A;  2UXN A;  2A6E F;  3E5U A;  2FMY A;  1XCB A;  5FFZ A;  3FM3 A;  4CIC A;  4A12 A;  1FYM A;  1SMT A;  2QM3 A;  4HF2 A;  1FNN A;  3WTS C;  1YTY A;  2RC4 A;  1ZLJ A;  4LLG F;  4N0B A;  3AAF A;  2EV0 A;  1KQ9 A;  5L3C A;  1AWC A;  3CUQ C;  2HYF A;  3O2P E;  3RDI A;  3DF8 A;  4P9U A;  2ZCW A;  1XD7 A;  2EJR A;  4KMU X;  2L02 A;  1FSE A;  2A3S A;  5CJ9 A;  1R23 A;  3F8M A;  3HRT A;  3J80 Z;  2AS5 F;  3ROU A;  2FBK A;  3WGI A;  5D8L B;  4GXO A;  1D3Y A;  4HV6 A;  3EYY A;  1DPR A;  1TBX A;  3I4P A;  1NHA A;  1WWX A;  2TDX A;  3FMQ A;  1H9T A;  1P6R A;  2FXA A;  2Y0M A;  5LHH A;  2C6Y A;  1HW1 A;  1BC8 C;  3FF5 A;  2YU3 A;  4EJU A;  4BNC A;  2IP2 A;  3K0L A;  1KU3 A;  1R58 A;  3ZMV A;  1RIO H;  1U5T A;  1MDM B;  1YLF A;  3FXR A;  3KFW X;  1QGP A;  3SXY A;  4LB5 A;  2MC3 A;  4RGS A;  3ELK A;  4YFN F;  4O6J A;  4U0Y A;  4KFC A;  3TO7 A;  1U78 A;  2YX7 A;  2XHK A;  1SD6 A;  3BPV A;  3HSE A;  2MH2 A;  1W5S A;  2P5V A;  1IXR C;  4JK1 X;  3GYH X;  4HV5 A;  4ZZL A;  2IA1 A;  1ZN2 A;  2P6S A;  4IJA A;  1I27 A;  2EFW A;  1Z6R A;  2M87 A;  3ABT A;  4UVB A;  4UXN A;  3CUQ B;  3GFJ A;  2H27 A;  2D1V A;  4AIK A;  2M45 A;  3K9T A;  4IRG A;  3RJP A;  4EMS A;  2OD5 A;  2YSR A;  4N9I A;  5FGM A;  3WTU C;  3F22 A;  1KU7 A;  4F7Z A;  5LHG A;  4L9V A;  1IF1 A;  5CVJ A;  4NB5 A;  2X0L A;  2XKP A;  3ERE D;  2B0L A;  1HXD A;  3FMR A;  4FX4 A;  2PFB A;  1J75 A;  2PLY A;  4MEY F;  3OOP A;  1BOA A;  3WTW C;  2KRF A;  4LFU A;  2QWW A;  2VON A;  4PZJ A;  3G3Z A;  4Q48 A;  3IHU A;  2M5W A;  2LF7 A;  1SFU A;  5LRR A;  2OQR A;  3KLN A;  3T8R A;  4WK8 F;  2QLZ A;  3HSR A;  2KIU A;  3GO5 A;  1ON1 A;  5ILU A;  1OR7 A;  4UNO A;  2HQR A;  5LGU A;  1S7O A;  5JFR A;  6PAX A;  1FBU A;  3BY6 A;  1P4A A;  2DPU A;  2L3D A;  4L9T A;  4MQV A;  3T0Y A;  1A04 A;  4LG0 A;  4ASN A;  4ENM A;  2ZXJ A;  5DV5 A;  4LB6 B;  2XUB A;  1Z6T A;  2A69 F;  4FT8 A;  2GWR A;  2VT3 A;  1GHC A;  2OZU A;  5DD8 A;  5J6X A;  3MZH A;  2HOE A;  2EV5 A;  4WF2 A;  2UXX A;  1G3Y A;  3HRS A;  1FYL A;  2R7D A;  2JZY A;  1LDK B;  3GX4 X;  1XGN A;  2P8T A;  2K7L A;  2UZK A;  1FLI A;  1XGS A;  3KCC A;  2FRH A;  1O3T A;  1S8N A;  1IN5 A;  3HOS A;  4RB2 C;  2QUF A;  2PMU A;  1E17 A;  1FSH A;  2ESH A;  3F23 A;  5HS7 A;  3Q5F A;  1UB9 A;  4AIH A;  3IWF A;  1SD5 A;  3QU6 A;  1G3T A;  1FOK A;  5HOO A;  1DUX C;  4HDV A;  4G7H F;  3MEX A;  1T38 A;  4KDP A;  4L0Z B;  4I01 A;  2D1H A;  3BOQ A;  4TV7 A;  2KIF A;  2IA2 A;  2DQR A;  2LF8 A;  3HYI A;  2COM A;  1LQ1 A;  1XGM A;  4I0A A;  4DNC A;  1MD0 A;  1IN6 A;  2LNB A;  2XAH A;  1G3S A;  2IA0 A;  4XLN F;  3WE2 A;  4ESB A;  2ZME B;  2XVC A;  1YS6 A;  1OYI A;  5BMZ A;  5CVI A;  4DQ2 A;  3O3K A;  1ONV A;  1ZG5 A;  1TQM A;  1H0M A;  1UHW A;  3U9G A;  3IKT A;  5DUK A;  2XAJ A;  2DO7 A;  2DQL A;  4OIP F;  2VBX A;  1P4W A;  3LST A;  2A07 F;  5HS8 A;  3M8E A;  3V7R A;  3BRO A;  4ZYH A;  2RKH A;  4KN7 X;  1LJ9 A;  5DD4 A;  1B59 A;  1Y0U A;  3LWF A;  4P55 A;  1JE8 A;  5DEQ A;  1YO5 C;  3GZ5 A;  4U0V A;  1DPU A;  4M6X A;  1S3J A;  2KIM A;  2CG4 A;  2W84 A;  1LNW A;  3LQQ A;  4A5M A;  2NNN A;  3QRF F;  2IW5 A;  4HBL A;  1EH7 A;  4LK1 F;  3JSP A;  4RGR A;  3R4K A;  1GXP A;  1Z91 A;  4I2O A;  3ML6 A;  4XSZ F;  2BGC A;  2K27 A;  4RS8 A;  1O3R A;  1REP C;  4ETS A;  2VBY A;  4AVP A;  3TDZ C;  5HDG A;  1B9M A;  3F3X A;  5FFX A;  1V4R A;  4OIN F;  4KUM A;  3U1D A;  1E2X A;  1YW8 A;  1K7A A;  2K4B A;  5DCM B;  1IN8 A;  1I6X A;  2F5E A;  2OZ6 A;  4JBA A;  1QPM A;  4HYE A;  5ICE A;  1XMA A;  3P9C A;  4JQF A;  2LKP A;  2GA2 A;  3HTU A;  4LLL A;  1IRG A;  3MCZ A;  4CXF A;  1ZHF A;  1QBJ A;  1T39 A;  4OU0 A;  2P7C B;  5JR3 A;  2LDU A;  4B8X A;  1DP7 P;  3GXO A;  4BXU A;  3GLX A;  1TQI A;  4A5N A;  3HHH A;  2ELH A;  3GZ6 A;  2ZO4 A;  4M6Y A;  3VOD A;  4MTE A;  1MGT A;  2STT A;  2VOD A;  3DQV C;  4LD5 A;  4EM2 A;  2GIV A;  3ZMZ A;  4KNY A;  3TDU C;  2F5D A;  3SQN A;  4N9H A;  5H6R A;  5FLX K;  1R5G A;  2CYY A;  1KQ0 A;  2WTE A;  2W24 A;  2XGX A;  2ZNZ A;  2PG4 A;  5CVV A;  1PP7 U;  4WXC A;  1U5T C;  2RV8 A;  3LA7 A;  5DYM A;  4UVC A;  3ZMD A;  2DPD A;  1WKM A;  3T5X A;  2H94 A;  1YFH A;  4Q5S F;  4RAZ A;  3WTZ A;  2P4W A;  3C18 A;  2RNJ A;  4Q4Z F;  1YW7 A;  1QZY A;  3M8F A;  2ACJ A;  2MD5 A;  1JXS A;  4R8H A;  3GEZ A;  2V79 A;  4WXH A;  4ON0 A;  4WXD A;  5DCF A;  2XV4 S;  3I58 A;  2D2W A;  3BWG A;  2O03 A;  2Z3Y A;  2ZKZ A;  3KP4 A;  3V7S A;  1P92 A;  2V9V A;  2YX4 A;  2Y48 A;  4CO8 A;  5BPD A;  4CGZ A;  3M7G A;  1B6A A;  2JPB A;  3WGG A;  3B02 A;  4QLC U;  1FP2 A;  4ZZD A;  1IAW A;  2F5C A;  2HWV A;  3ZMU A;  4ZH4 F;  3IC7 A;  4QWQ A;  3IRQ A;  3JW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...