2MSYA

Solution structure of hox homeodomain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
ANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein Hox-C9
publication title Structural insight into the interaction between the Hox and HMGB1 and understanding of the HMGB1-enhancing effect of Hox-DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2msyA00
3HOXJ 1AU7A 1FTZA 4M3GA 2FD5A 2CRGA 2VKVA 4A93J 2X48A 1JT6A 4BBSJ 1LFUP 3L1PA 3HOVJ 2Y0SN 1TWAJ 1MNMC 1AKHB 5IYCJ 3FKIJ 3OSFA 1VNDA 1B8IB 2K9QA 2MSYA 1FIPA 3HEFA 5IYDJ 2EH3A 1VF9A 3NARA 5C3EJ 2CU7A 2EQRA 1U8BA 2I10A 4M3DA 2L9RA 4JX6A 3IV5A 2XPVA 1F43A 3BTIA 1LFBA 2H8RA 5M5WJ 4A69C 1WCMJ 3IH4A 1RPWA 3Q0VA 3JRAA 3S16J 3CDLA 5EGOA 3RZDJ 4CYCB 3GTOJ 4B3AA 2EZLA 5M5XJ 4IHXA 1JKQC 1Z0XA 1XS9A 2DA7A 2AHQA 3B6CA 3BQYA 2NVYJ 4BKXA 3IH2A 3PO2J 2HQ5A 1JUMA 1G2HA 4A3LJ 4XRSA 2Y9ZA 4BY1J 2LKXA 1DU0A 2LK2A 4C2MJ 1WH7A 2NVQJ 3QQAA 4IHWA 5J1UA 5GPAA 2JWTA 1JJ8C 3GTQJ 2IAIA 2MGQA 1RESA 4M3FA 5GPCA 1TWFJ 1QVUA 5BNGA 1BW5A 2XGCA 1TWHJ 4A3GJ 1ETOA 3FK6A 2LD5A 3B6AA 2XSDC 2ID3A 4D5CA 4UUSA 4XRSG 2DMQA 2R93J 1JJ6C 3GTMJ 3MVPA 5K7FA 5HODA 3PM1A 2JN6A 2XB5A 1WGXA 1MBEA 5EG0B 2QCOA 1QPIA 2LTPA 5J1RA 2GM4A 3DEWA 5C4JJ 4QTRA 2R5YA 2LY9A 1VFCA 4MFEA 3ZQLA 5EYRA 1I50J 3BR0A 4XRMA 2JA7J 4DW6A 3LSPA 5C44J 1K61A 3S2HJ 3Q3SA 4A3BJ 2E1OA 2N8GA 4DZPA 5FKOA 3BQZA 3ZQHA 2ME0A 4D7NA 5IPAA 2JMWA 2HOAA 3QPLA 2HDDA 2OPTA 3GTLJ 2DA3A 2E2JJ 3GTGJ 5IP6A 4A3CJ 1ORKA 1ETYA 4D7MA 1U78A 4XIDA 4IEJA 2D5VA 4RBOA 2ECCA 1EF4A 5C4XJ 5DTDA 3FIWA 3LSJA 3I4MJ 2NS8A 5FKKA 2WAQN 3TW7A 2OF7A 4Y7NJ 1MBHA 1Y1WJ 3LSRA 5EGOB 2WV1A 1W0TA 2FQ4A 2COBA 4HNVA 2R7ZJ 4JX4A 3W6VA 2IBDA 2CQQA 5DS9A 2L7MP 1BW6A 5FLMJ 1HLVA 3WHCA 5F04A 1HCRA 2Y2ZA 4C3JJ 1RKTA 2XGEA 2EBIA 2FX0A 3OOUA 3HB9A 3GBGA 5M3MJ 2H1KA 3H3VK 1IRZA 2DA1A 1JKRC 4V2FA 2WB1N 3SFIA 2Y30A 2K40A 2HXOA 4IHYA 4MFDA 1BJZA 3FISA 1B72A 3JRHA 1H8AC 1MSFC 2DA6A 3C2BA 3JRIA 1ZK8A 1T33A 4I76A 4V2GA 1QRYA 3LNQA 3BG3A 3BTCA 3HOZJ 5FLVA 2LP0A 1YRNA 1IG7A 4UUSB 2QF7A 3JRBA 2DA2A 3IH3A 3HOYJ 1UHSA 3CCYA 3BTLA 3S2DJ 1RKWA 3G1OA 2X9DA 3ZQFA 1A6IA 2HXIA 2LFBA 3BR2A 3BG9A 4AUXA 1HDPA 4B4CA 4QIWN 2MG4A 2M34A 2DMTA 5M5YJ 2R5YB 3PO3J 2YUSA 2G0EA 3S15J 4M6VA 2DA4A 2DMUA 1H89C 2JA5J 3DCFA 5J3LA 4MO7A 5E3LA 4GFBA 5E3OA 4X6AJ 3O8HA 2DN0A 2LR8A 3A02A 1GUUA 1XC5A 1TC3C 5IOYA 3F0CA 3GTPJ 5F1JA 3A01B 2K9SA 4A3DJ 1MH3A 3JR9A 5K7ZA 1GDTA 3E7LA 4FISA 3OIOA 3M3YJ 4XICA 5GP9A 1JT0A 3K7AJ 5IYBJ 2XGDA 2DMPA 3JRGA 2YU9J 4A3KJ 1U9NA 4D5FA 2FJ1A 4C3IJ 1F36A 1ETWA 1MH4A 1MSEC 3BTJA 4AYBN 4JP0A 1VI0A 1P7IA 5EZGA 1FEXA 2M9HA 2XPWA 1Q1VA 2DTZA 1D5YA 2ME6A 1S7EA 1PUFB 3G1LA 4I6ZA 1JTXA 5IP7J 1W0UA 4LOCA 4A3MJ 5J1YA 2HYJA 3LSGA 1OFCX 5FKMA 1FTTA 1B72B 1MBKA 1K83J 1P7JA 1XG1A 1JUPA 2CQXA 2GLOA 1BL0A 1JGGA 2CUEA 2NVXJ 2JK3A 3Q0WA 1YRNB 4W97A 1IUFA 3WHBA 1FIAA 5IOZA 2O9LA 1HF0A 1ZGWA 4UUTA 2CUFA 2JA6J 3A01A 2EZIA 1NK3P 1SANA 3UKGA 1IV6A 2E2IJ 1HDDC 2ECBA 1T56A 3RZOJ 3TEDA 2KT0A 4M3EA 3JREA 1R9TJ 2EZKA 3TW6A 2DMNA 3H0GJ 2NS7A 2TCTA 1MBJA 1PUFA 1IGNA 3BR1A 2HOSA 4BBRJ 3A03A 1RR7A 1IJWC 3FK7A 4AC0A 1IDYA 1SFOJ 2TRTA 3RKQA 2DA5A 2LVSA 3BR3A 2EZHA 3ZQGA 2P81A 2L7FP 2Y31A 4ABZA 2O7OA 2XPUA 1I3QJ 2CJJA 3HKZN 3S1NJ 3SJMA 2VUMJ 5F27A 3MKLA 1TWGJ 3O8GA 5JLWA 2R92J 1Y1VJ 1GV5A 1WH5A 1ETQA 4W1UA 4JYKA 1OCTC 9ANTA 1WPKA 1OJLA 5F0FA 1POGA 4JX5A 1A5JA 2HOTA 4FE4A 3SDGA 3ZOBA 1ZQ3P 3NAUA 2O8KA 1GVDA 5E3MA 1ETVA 1LE8A 2L0KA 2JA8J 1FJLA 4A3FJ 4A3IJ 3TP3A 2XRLA 1X2NA 1NK2P 2R5ZA 3HGGA 4DYRA 2GBYA 4MIMA 3HBLA 4C3HJ 2B63J 3M4OJ 3GTJJ 4BY7J 1QVTA 2M0CA 4IHVA 3S1MJ 5F0HA 4FTHA 4L5EA 3BR6A 3JRCA 5FJ8J 3BT9A 3Q0UA 5JLXA 5FKLA 3MN2A 2M8GX 5M3FJ 1JKPC 1ETXA 1E3OC 1ENHA 3HGYA 2LLKA 1UMQA 2K9NA 3HOWJ 5IP9J 5K7HA 4J19A 2VI6A 4G12A 5E3NA 5EEAA 1H88C 4Y52J 4M3BA 3S17J 4NDLA 1APLC 4A3JJ 3G1MA 4RDUA 1AKHA 1B8IA 4FE7A 1MBGA 1AHDP 3D1NI 3S1RJ 2VKEA 1I6HJ 3ZQIA 4X1EA 3OSGA 1U9OA 3HM5A 3K2AA 1ZR2A 3VPRA 1NTCA 1HOMA 3LOCA 2XB0X 1X58A 3QPSA 1ZR4A 1TWCJ 4BXXJ 2DJNA 1Z77A 2Y9YA 2ELKA 3JRFA 2RAEA 5FKNA 2NOGA 2X6OA 5F08A 4CYCA 4FCYA 3HDDA 1OCPA 1DU6A 3S14J 3S1QJ 1GV2A 2NVTJ 4MLOA 5F0CA 3CQZJ 2HI3A 5EDNA 2KDZA 4EEFG 2W48A 2M2EA 1BA5A 1LE8B 1JTYA 1MBFA 3BR5A 1RETA 1WI3A 4DYCA 1GT0C 3TP0A 3HOUJ 3ZQCA 4A3EJ 1JUSA 2ZB9A 4S0HB 3I4NJ 2JJ7A 2R5ZB 1ETKA 3BG5A 1UG2A 2ID6A 1IC8A 5EF6A 1ZKGA 3RQIA 1CQTA 1JKOC 1ITYA 1IDZA 2PMZN 2AO9A 1O4XA 1X2MA 4B1RA 4DYQA 4QSHA 2YS9A 5EZHA 3CMYA 4XK4A 2L7ZA 3JRDA 2E19A 2E2HJ 2IEKA 2VPRA 3GTKJ 4DZJA 2R0QC 1ZTRA 5EG0A 2MW8A
chains in the Genus database with same CATH superfamily
2XAHA 3EDPA 1BJAA 3R6SA 4WXHA 3HSEA 2LG4A 2HKXA 4UB6C 3DV8A 2X48A 3F8MA 5JVGF 1OLTA 3BJ6A 3SZGA 3OS1A 3HOVJ 3D5SC 2Y0SN 1TWAJ 1EH6A 2ICWG 4ESBA 3FMQA 3I0TA 3WU1B 5IYCJ 1AKHB 1VNDA 2MC4A 2K9QA 4MQVA 2H8WA 1QPMA 4KICA 3H3UA 4PGGA 1VF9A 4FT8A 1N75A 3P9KA 4XLPF 5A2QZ 1I1GA 1D0XA 3BTIA 3QYEA 4LIUA 3WTXC 3Q9VA 2CV0A 2VOOA 3HKZA 2VQLA 2VE8A 5BQTA 4G8XA 2E71A 3TDUC 2DYSH 5TRDA 2HDCA 3GTOJ 1HA8A 1ZHFA 3KP4A 1FOWA 4GO1A 1WZ2A 4XLFA 3OWTA 2PN6A 2BXZA 2OQGA 2JUGA 4KIFA 2LKXA 1DU0A 2XAGA 1P4XA 2MFZA 5J1UA 5E17F 2JWTA 1JJ8C 2E5NA 1ZRFA 2HEOA 2VJ4A 3JSPA 1R58A 4HZFA 5GPCA 1EJ9A 1ON1A 3FXJA 4PFPA 1I6XA 3BJOA 2LKPA 1KYZA 1MNEA 3A1YA 1IN7A 2GWRA 2CQ7A 2LD5A 5FRMA 1VQNI 5K7FA 4FX0A 1IO2A 3KPHA 2P0WA 3PUBA 2JN6A 2XB5A 2FF4A 2W1OA 1MBEA 1USSA 4DQ2A 1VQOI 1QPIA 4KFCA 1KONA 1O3TA 2XF5A 1QU3A 1IN5A 3RI4A 4HBLA 4MFEA 3ZQLA 4XRMA 2P5LC 4DW6A 1WJEA 2G9WA 3I58A 3B73A 2E1OA 1RUNA 3ZQHA 1SVMA 2GIZA 4D7NA 4F93B 2NVUB 2JMWA 3LA2A 1QGPA 2OPTA 1VQPI 2KJBA 2QM3A 2XUBA 5FD5A 1ETYA 2KIMA 5LHHA 3M1CA 4ZYGA 1U78A 4R79A 3WODF 1CF7B 4PFOA 5FLXZ 2M1BA 3JTHA 4YFXF 4LLNA 4ESFA 1EF4A 1FY7A 4O5VA 3DTIA 2QKLB 3RQ4A 2EILH 3FIWA 3UR3C 2E60A 1FBUA 3HC7A 4KDPA 2IT0A 3TW7A 5CQEA 2OF7A 4Y7NJ 1G3YA 4L0ZB 1YLFA 2IPQX 5ILVA 4Y4RA 5EGOB 2K3PA 1HBXG 2FQ4A 2QQ9A 5KHDA 2J5OA 3FX3A 4JX4A 1HCRA 1RZ4A 2Z16A 1LB2A 4RA2A 1K6OA 4BQOA 4C3JJ 2EBIA 3I54A 2QBYB 3H3VK 4L5JA 2DA1A 2V1XA 4EGZA 1FC3A 2F5CA 2TDXA 1Q1HA 3F8FA 4V2FA 4G6TB 5FROA 3FXRA 2HXOA 2WTEA 3LMMA 3FISA 1KQ0A 5J40A 2VIXA 3ABKH 3SDBA 1H8AC 3CP2A 2HVSA 1XGMA 3JRIA 2W25A 3K4BA 2RC4A 1V5GA 1FP1D 4XNFA 4UUSB 3UNGC 4HF1A 1KU9A 1DGRM 2L2OA 3IH3A 1J59A 1UHSA 2MH2A 2LBFB 3G1OA 2LH9A 1QBJA 1IXSB 2HXIA 3FXUA 3BG9A 5ICGA 2MG4A 4XLEA 3P7NA 1SD6A 1U6GA 4XOTA 3WTYC 3ABLH 2R7QA 3TQNA 3PO3J 1Y39A 1BIBA 4M6VA 4RGRA 3R61A 1OR7A 1BI3A 3ABMH 4J01A 4BQAA 3O8HA 2DN0A 3C2GA 1VTNC 5KAFC 3L2WA 2CFXA 1XC5A 4I98B 1TC3C 1K79A 3NEUA 4CCNA 5DDGA 1YI2I 4I09A 3CCSI 3HXLA 1OISA 2K9SA 1Y0NA 3E7LA 3CF2A 1Z6RA 4KA4A 3OYHA 3M3YJ 2MD0A 1QA6A 3P9CA 2CYYA 2EIKH 3GXOA 1U9NA 2F5VA 2BY3A 3KEYA 2OQRA 2CQNA 4HPQA 3RCOA 3QP6A 1F36A 1UZCA 2XAQA 1V5EA 1YYVA 4JP0A 1W7PA 3K0LA 1Q1VA 4N0BA 1U5TA 2OTJI 1D5YA 1FNNA 3OIPA 4IXAA 2BBYA 4BDYA 3ELKA 1S7AA 3GCMA 3HUGA 4NC7A 1S7OA 3RJPA 2VPLA 2NS0A 1FTTA 1B72B 3DU5A 1MBKA 1K83J 1IN6A 1XG1A 4KITB 4HX8A 2A68F 2M30A 4EGYA 2KIQA 2WA0A 4H0EA 4M6XA 4EVIA 2BW3A 3RYRA 5IOZA 3R0AA 1PVEA 3CJQB 4LGWA 1HF0A 4UUTA 4F3QA 5DCMA 3A01A 3MMYB 1D0YA 3J7ZI 4BUPA 1SANA 3CCLI 4XKWA 1TL8A 1VQ4I 3FXQA 3RIRA 2KJCA 2HVQA 1HDDC 2ECBA 1T56A 1FMWA 3S3NA 3ULQB 2DCEA 4WXDA 4IOCF 1SVLA 4PJMA 3ASOH 4M3EA 3KZZA 3TW6A 3E6BA 5BS6A 3WGGA 5LLQA 3PIOF 3KE2A 3DLLF 3H0GJ 2COMA 1K7AA 5LGNA 4RAGA 4ZZLA 4Y15A 3HOSA 1ZG1A 2AQFA 5J8FA 3GFIA 4I01A 4XKCA 1PUFA 1MIJA 4BBRJ 2M8EA 1R5ID 1LEAA 1RR7A 1IJWC 3LSKA 4DBQA 1PP8F 1IDYA 1PDNC 2K9LA 5JFRA 2QVOA 3C2HA 5H6QA 2EZHA 5JHFA 3OIQA 2L3DA 2XPUA 3KFWX 3I56I 2RNGA 1WRJA 4E7JA 1WSUA 3WTVC 5AIPA 3S1NJ 3GF2A 4E7LA 1B6AA 4BEHB 4NQWA 2V9VA 2OU2A 3D0SA 3GEZA 2K86A 4AIKA 4WCGA 2UWMA 4HDUA 1ETQA 2E5ZA 4S04A 4OIPF 3LQQA 3R0JA 5K5QA 1OCTC 2L7KA 3B02A 2XF6A 3RPQA 1HW2A 2XF7A 2IJLA 4JX5A 1G6NA 1KA8A 3PFYA 2R7DA 1VQ5I 3SDGA 4S05A 2RDPA 3K4MA 2DFFA 3KZIC 4G6DA 1STZA 4UB8C 4ZYAA 2HVRA 4BQNA 2J5PA 2JA8J 3CUQC 3L2RA 4A3FJ 1FJLA 2R4GA 2HDWA 2OBPA 3BY6A 3E6MA 4HX4A 5LEKA 4BH9A 1X2NA 1H9TA 1J75A 2V9PA 2B9SA 2DFEA 1UCRA 4CHUA 3EYYA 1HC8A 1OKRA 1EH8A 2V1DA 3BOQA 4C3HJ 3M4OJ 4UV8A 1FOKA 2K27A 3H5AA 3ROUA 5B3SH 2ZKZA 3PJRA 5D5WB 3DF8A 5F0HA 4FTHA 2VLAA 2X1CA 4A5MA 2VBWA 3LAJA 5FJ8J 3BT9A 3GW2A 2VC0A 2A5YB 2Y0MA 5B1AH 4KT6A 2V1NA 4Y17A 2ZJRF 3KLOA 4BXFA 1JKPC 4OAZA 4EM1A 2H6CA 2V1UA 3HGYA 4R1HA 2PMUA 5DD4A 2X85A 5HDGA 1JHHA 5GTHC 3N97A 5IP9J 5K7HA 4J19A 3WG7H 1I5ZA 1OYYA 4M3BA 4L9NA 1APLC 4HNTA 4A3JJ 1XTAA 1AKHA 2ZXIA 5D4SA 3MAJA 1MBGA 2VKEA 3K2AA 2ELHA 3VODA 2EV6A 2P7CB 4HOBA 1KU3A 4DIQA 1PYVA 3CTAA 2WWYA 2STWA 5LGUA 2JPBA 4UNOA 3FMRA 5LEJA 2EA2A 1BR4A 2PQ8A 3PFIA 2A05A 2DJNA 3W6KB 2OD5A 2NNYA 2EWNA 1K4TA 4ZDPA 4UXNA 2ELKA 3GWZA 3JRFA 3FM3A 2NOGA 2X6OA 4FCYA 4UVCA 3CC4I 1G3SA 4AVPA 5IT9Z 2CS3A 5E8GA 3OYDA 2H09A 2W85A 4MTEA 1FYLA 3AG3H 3S14J 4CUGA 4RB3C 3S1QJ 1XMXA 4P9UA 4G7OF 3JW4A 4X0GA 3H5RA 3BDDA 5EDNA 2IGNA 3M8FA 2HPMA 4B47A 2Q2EB 1LE8B 1JTYA 3I71A 2VBXA 1WI3A 2EJRA 2H6BA 3M07A 1RI7A 1XB4A 2QYOA 2ZJPF 1JUSA 3K4CA 1XPXA 2R7UA 1ZREA 5H2FC 3I4NJ 1D5VA 2JJ7A 4GGGA 5J6XA 2R5ZB 3BG5A 4II3A 2ID6A 1G4DA 5EF6A 1ZKGA 1IAWA 2PJRB 1CQTA 4XR6A 2VJIA 1IDZA 2KZVA 1O4XA 5BPDA 4B1RA 2VE9A 1BC7C 5EZHA 4XK4A 1I1SA 2LYCA 2E2HJ 2P4WA 4KIBA 2JZYA 2R0QC 2G7UA 4GYGA 5E79C 1B1BA 3OYMA 2LY2A 3KEQA 1LDDA 3NQOA 4XQFA 2CRGA 3GFLA 1JE8A 1JT6A 1YW7A 3F72A 3L1PA 3J80K 4P96A 1RRJA 2ZXWH 4L0YB 4ETSA 1SMTA 1XGOA 5GAHJ 1MZBA 3TO9A 1B8IB 2HGCA 4A6DA 2HR3A 2WB1A 2HPIA 2M3AA 4XSZF 1J7KA 1U8BA 2M0MA 4M3DA 2L4MA 4LG0A 4LLGF 2XPVA 3CJTB 1WHUA 5M5WJ 4A69C 4KNYA 1TTYA 2MBFA 2LREA 3Q0VA 3VFZA 3JRAA 2GXBA 3S16J 2E35A 4YIRX 3CDLA 5EGOA 3WTSC 1FSEA 1Z21A 4CYCB 3SEZA 2EZLA 3H0DA 2LDUA 5M5XJ 3HJEA 1JKQC 4BU2A 4P1WA 4CO8A 4Y3OA 3GFJA 1ZRCA 2IRFG 3G2BA 3M1EA 3B6CA 2H94A 1I27A 5E8IA 2NVYJ 1R1VA 3IH2A 1YW8A 1W7PD 1OYIA 5CLSA 4ENKA 1G2HA 2LSOA 2KL4A 4KN4X 4EM0B 5ICCA 1ZGJA 2RQPA 1XDUA 5FB2A 1X3WB 5E1WA 2KZGA 2GAUA 2PX9A 5HS8A 4C2MJ 3E97A 3QQAA 5DEQA 5D6FA 3V8LA 3IC7A 2WADA 1FSHA 3VWBA 1BN5A 1DDNA 1H0MA 1VQ7I 5BPIA 5BNGA 2DT7B 2XGCA 1LPQA 1TWHJ 1SMYF 2DFIA 4YELA 1G3WA 3A4CA 2ID3A 4IJAA 4D5CA 4XRSG 2DMQA 4UUSA 3MVPA 3FBNB 3PM1A 1XSVA 1R7JA 2LBFA 2V6CA 4IHTA 4QWQA 5EG0B 2OC6A 5J1RA 3MFKA 2YPRA 3C3WA 3H1CA 4M9SA 4KN7X 3DEWA 4HW0A 4QTRA 2LY9A 3REOA 2ZMEB 5EYRA 3I59B 5F64A 3BR0A 1ONVA 3NWSA 4I7HA 3MWMA 4ESJA 2FE3A 5C44J 2EPFA 4PUSA 3CC7I 4F7ZA 1BM9A 3Q3SA 3L2UA 4ITVA 4IRHA 1XSDA 2VKHA 3E5UA 3EYIA 2R7FA 2A61A 5IPAA 2HOAA 3GUDA 2HDDA 2HQAA 2DA3A 1ERDA 4KJZA 4A3CJ 2IA2A 4EMSA 1ZG5A 5K1YA 2D5VA 2GXAA 1QZEA 4E7IA 3QP5A 2X6XA 4RBOA 3F21A 2A6EF 2GXGA 5L3BA 1IRGA 1V3FA 2L9NA 2NS8A 5FKKA 2JRTA 1R71A 1ZELA 1BOAA 2WAQN 4XLHA 3I4MJ 1TT5B 4EV0A 5LHIA 5JVTA 2ZBKA 2OJED 4WWCA 3DKYA 1RIOH 4HYEA 4HNVA 2R7ZJ 5DM7F 2IBDA 3GZ6A 2KRHA 2ESHA 5FLMJ 2ZFWA 3DPUA 3WHCA 5F04A 4BE1A 2Y2ZA 4C2UA 2XGEA 2H1KA 3O2PE 3HB9A 5FO5A 1U2WA 3SZPA 3OYEA 3R4KA 1XGSA 1JKRC 1SFXA 5B66C 1Z3XA 2CV1A 3JAMK 2K40A 2P5KA 3DU6A 4YG2F 1X3UA 4WF2A 1ODDA 3OYLA 1LUJB 3MKZA 1B72A 2PMHA 1MSFC 2YX4A 3C2BA 1ZK8A 4I76A 3LNQA 3BTCA 4O6JA 4B09A 1TQMA 2LY1A 2ZO4A 1YO5C 1T38A 4BAYA 3U9GA 5TJJA 1UHMA 3CCYA 3CCEI 3RPUA 1RKWA 1EKEA 3K1PA 2WAEA 2D2WA 3KZYA 4TV7A 4GDFA 2ELJA 1HDPA 3FXLA 3DEEA 2ZSHB 4HQMA 2WY8Q 3ECOA 3I4PA 4AVZA 3K1NA 3KYDB 4RB1A 2DMUA 3H35A 2JA5J 2Q0OA 4IF4A 4P5OA 3WU2C 5J3LA 3WU0A 3QYFA 5E3OA 3L9FA 4X6AJ 1KZHA 1D1CA 2LR8A 1PP7U 1AA7A 2ISZA 5IOYA 5D4RA 5ICFA 1NG7A 2EFQA 1TQPA 3F6OA 1MD0A 2HYGD 1WJBA 1R6RA 1I39A 1MH3A 3CESA 3J81K 3JR9A 1GDTA 3BCBA 4UV9A 3IKTA 2FNPA 3IWZA 1YG2A 1EA3A 5GP9A 4M71A 1QZYA 1BC8C 3K7AJ 5IYBJ 4NB5A 4L9TA 1FP2A 3HG9A 1TLHB 4BEHA 1LVKA 4C3IJ 3K4KA 1MH4A 1G3TA 1VI0A 1VZ0A 4AYBN 5EZGA 2KQRA 3MQ0A 4IX7A 2PLYA 1FEXA 2XIGA 4EJTA 2DTZA 2HZDA 4HV6A 2ME6A 3FBIB 1XDSA 1B59A 2VQGA 4A3MJ 1FOYA 4YRVA 2ZJ2A 4CH7A 2LKSA 5FKMA 2RKHA 3OMYA 1Z9CA 1FYKA 2RNJA 6PAXA 2W00A 1JGGA 2I8DA 3PSIA 2YSRA 2FMYA 5FD6A 1B9NA 1UFMA 3RDIA 4EQQA 4A0XA 1YRNB 1IUFA 1FIAA 3FXMA 5CYVA 2R7RA 1ZGWA 1YX5A 4UHTA 5GADJ 2EIMH 1K78A 1YTYA 4II2A 3DTKA 1ON2A 3ZMVA 3UKGA 3OYJA 1IV6A 4XMYA 4MQ9F 3MKWB 3H9QA 1T95A 3ZQ7A 3RZOJ 1O7FA 1A35A 5EEHA 2Q1ZB 4K2EA 2CUJA 3JREA 2M4GA 3AKZA 2NS7A 3DBHB 2R7WA 1LEBA 2DYRH 3LFKA 3KLNA 2F4IA 4U0YA 5KAIC 3ASNH 4YFNF 1V55H 1ZG3A 2Z33A 3J7YJ 4HAMA 3FXOA 4OWRB 2HOEA 2V9KA 5ERIA 1SEUA 2JSCA 4AC0A 1R1UA 1J5YA 2QWWA 3MEXA 3OYBA 4CGZA 2ISYA 1IRXA 2IW5A 2HQRA 2Y31A 1VQ8I 4D1QA 1I3QJ 2DPDA 2QQBA 1IUYA 4ZZDA 2LRDA 1F5TA 2DXIA 3A0BC 3OS2A 2BZTA 1D8KA 5DYMA 2VUMJ 2F5DA 5F27A 3MKLA 1Z3YA 3NRVA 3O8GA 5JLWA 5FRNA 2XC7A 2JT1A 2Y48A 2GA2A 3OYFA 1SFKA 4R8HA 1OR7C 1P9QC 1WH5A 3T8RA 2ZXHA 4HLYA 4JYKA 3M8JA 2I5UA 4ZC3A 3ZMTA 3MKYB 5F0FA 1POGA 1MMSA 2ETHA 5ILUA 3PQKA 3U2RA 2VJJA 1GXPA 2K02A 5HS7A 3NAUA 1MJAA 1PJRA 1LE8A 3AL0C 1YX3A 4N9IA 3COAC 2RV8A 5HNHA 3P5JA 4IKFA 2Y0SA 1WJCA 2R5ZA 5B5EC 3TO7A 4Z6YA 4CCOA 2GOMA 4FHTA 2GBYA 1EH7A 2JRMA 3HBLA 2B63J 4G94A 3GTJJ 2UUZA 4CZZA 2Q8KA 3S8PA 1ZYRF 2M87A 4IHVA 1UHWA 4OMYA 3N4MA 2QQ8A 1U5TC 4L5IA 3V4GA 2DQLA 5FFZA 3CCMI 4CICA 1IW7F 3Q0UA 5FGMA 1VQKI 2FBIA 4E7SA 1FBSA 2M8GX 3OYGA 2QZ8A 2O5RA 4P9FA 1E3OC 1Y6IA 1UMQA 1W1WE 1BR2A 3HRSA 2VI6A 1N25A 3T8TA 4WX9A 4Y52J 5HLIA 3GLXA 3OS0A 4B48A 4RDUA 3QU6A 1QO0D 3RTRA 1B8IA 3KP6A 3D1NI 3S1RJ 1I6HJ 4HX7A 1QNTA 4CCMA 3HM5A 1U8RA 4OAYA 4C30A 5CPRB 1D0ZA 4CCKA 1Y0UA 1T08B 4HF0A 3V7SA 1X58A 3MZYA 1ZAOA 1TNSA 1Z1DA 5B1BH 3K10A 4EATA 2HYFA 4BXXJ 4EJWA 3QODA 1Z77A 1OCRH 1MNDA 2VC1A 4XSXF 4U88A 1P6RA 3E3VA 3H9JA 2D45A 4CYCA 4KMUX 3QOPA 4HEA2 1U0JA 1DU6A 3OYNA 4L18B 1A6QA 3IRRA 3KP7A 3WGHA 4XONA 2XAJA 2A07F 4LJZF 4PDKA 3W2WA 2E1MC 3AG1H 1OCCH 4UY8I 5DCFA 3HSFA 2R7XA 2HS5A 4ZTJA 4LB5A 3DKXA 2VL8A 4FX4A 5LRRA 4DYCA 3HOUJ 2Z2SB 3OYCA 3ZQCA 2ZB9A 1FOXA 3L2VA 4O3MA 3KCCA 4OIRF 1GLNA 1D1BA 4FQGA 3T0YA 1QZZA 1UG2A 2BGCA 2AXTC 2DAOA 4CXFA 2BE5F 5DV5A 2H1LA 3RQIA 2XSJC 3V8KA 1PUEE 4GYIA 2OCEA 1W5SA 1D1AA 2AO9A 2PMZN 4RAYA 4DYQA 2V6EA 2NAZA 3VYSB 2F48A 1A31A 5HVQC 1E17A 2L7ZA 3PL8A 2KKOA 3QPTA 3WTZA 3G73A 2IEKA 2VPRA 2XHKA 3KETA 1ZTRA 5LRSA 5EG0A 2RREA 1H9GA 3J7AY 3HTUA 2WC2A 3HOXJ 4LFUA 1FTZA 2IGKA 4M3GA 2FD5A 4BJTA 2CMPA 1XCVA 1K4SA 4A93J 3ZP5A 2ZMEA 4QPOA 2VB6A 3HRTA 3I59A 4LG3A 4BBSJ 4LITA 3DPLC 2JUCA 4MTDA 1L0OC 1SD7A 1MNMC 3GYHX 3AG2H 3FKIJ 3OSFA 1R23A 1FIPA 2B0LA 3O3KA 3ZGKA 4A6EA 3HEFA 4JK1X 3E6CC 4CSWA 2PFBA 3OY9A 3NARA 5C3EJ 2CU7A 2EQRA 2L9RA 4JX6A 5DUKA 1F43A 4XBFA 4BYYA 2H8RA 2JVGA 5HNFA 5TGTA 2X6WA 4G7HF 3L2QA 2XKPA 2XRNA 3F3XA 1SD5A 2GQQA 3RZDJ 2R7OA 1YIJI 3BZCA 2M7AA 4B3AA 2DJIA 2KFDA 4IQJA 2ZSIB 1XCBA 5GAEJ 1XS9A 4NC8A 3U1DA 2KISA 3BQYA 2Z99A 1XSXA 1X1AA 3SFZA 2HQ5A 2K9MA 2KP6A 3NWTA 4XLNF 3JTGA 1BOBA 3K2ZA 1E3PA 2DBBA 4BY1J 1P4WA 2LK2A 1RR8C 2F5FA 4RAFA 4IHWA 1T6SA 5GPAA 2NRAC 2IAIA 1GXQA 2BHYA 2KPMA 1MMNA 1TNTA 2MGQA 4I02A 4PSWA 1TWFJ 2DDAA 5DM6F 1U3EM 3OL3A 2MC3A 3MCZA 2VXZA 3AFHA 4DBRA 3FK6A 4IRIA 2XSDC 3GTMJ 5CVRA 2DI3A 5HOOA 2EFNA 2O8XA 1E3HA 2HKOA 1IN8A 4Q5SF 1MDMB 3K6GA 1O3QA 4FETA 1DP7P 2GM4A 4NC6A 4AM3A 1LDJA 1BR1A 1Z7UA 1I50J 2JA7J 3LSPA 3IUOA 1KU7A 1UJ8A 2UZKA 3PNVA 4M72A 3L09A 3S2HJ 4A3BJ 2D1HA 3BQZA 3SEQA 2EINH 3QPLA 3GTLJ 4LK0F 2E2JJ 3GTGJ 4CCLA 1ZRDA 1IN4A 3VB2A 1ORKA 4XLCA 5FFXA 2ECCA 3RKYA 5J47A 5E20A 5C4XJ 2F2EA 5DTDA 3S3MA 3LSJA 5D5UB 2X1EA 2H27A 3CO6C 3LSRA 3U21A 4KISA 4G9YA 5DUIA 1W0TA 2QKMB 2COBA 3A2KA 2AXLA 3W6VA 2CQQA 2XDVA 4PJ0C 2RQQA 5JR3A 3F22A 2L7MP 1BW6A 3EUHA 1HLVA 2CQKA 1F4KA 1J9IA 2FX0A 3OOUA 1VQ6I 4WK8F 1IRZA 2VOPA 3OR2C 4Y13A 3ZMDA 4UVAA 3I64A 3SFIA 4IHYA 1BJZA 2UV1A 1S3JA 3KX2A 1R36A 2ADUA 1YIOA 2BV6A 4RLQA 3JRHA 5CJ9A 2A3SA 1HW1A 2DA6A 2DLLA 2JSPA 5J4VA 4OOIA 1T33A 4V2GA 1QRYA 3BG3A 3G6EI 4A12A 1R4NB 3HOZJ 1A04A 1R1TA 2LP0A 3ZXSA 4HSRA 1YRNA 1X1PA 3H3ZA 3EUAA 4QLCU 2ZJQF 4CZCA 2CO5A 2JPCA 2HTSA 3M9AA 3OYAA 1CF7A 2PMZA 1X1CA 2X9DA 1ZN2A 3WTUC 5ED4A 3DTEA 1P2FA 2LFBA 5GAGJ 4ZYHA 3BR2A 4UUVA 4B4CA 2M34A 1Z05A 1Z67A 2R5YB 3LA7A 4EJOA 1C0WA 2G0EA 1KU2A 2FA5A 1WJDA 4M74A 2P6SA 2DA4A 1H89C 2KMUA 5K5OA 4MO7A 4GFBA 2O6GE 3CCQI 4LB6B 1EV7A 4AIHA 1ULYA 2OCCH 2QBYA 3CJRB 4GCVA 3F0CA 4AIDA 5KNLA 5A2QK 1T0FA 3A01B 3K4LA 4XLAA 3U1KA 4U0VA 3LAPA 1X4OA 4ASNA 2BY1A 4KMFA 4J00A 4XICA 3DBLB 1JT0A 3F8CA 3F8BA 3BG7A 3EPZA 2XGDA 4A3KJ 4D5FA 5D8KB 2E7XA 2FJ1A 3RYPA 3KP5A 1F9NA 3BROA 2DODA 3BTJA 5L3GA 2M9HA 2FXAA 2XPWA 3P9IA 4E4HA 2IVMA 2Z5UA 1S7EA 1PUFB 4WXCA 3G1LA 4I6ZA 2FNAA 3QWLA 1JTXA 2NYXA 5IP7J 3QRFF 1CGPA 1YJ9I 4LOCA 4M9XA 2HYJA 4XKBA 2EIJH 5J8CA 2X1DA 3ZR8X 3BPXA 3LSGA 5L3EA 1OFCX 3G3ZA 4IPAA 3DQVC 3L7WA 2RVCA 1JUPA 1RNLA 2CQXA 3H9GA 3SHFA 3ESWB 2GLOA 1BL0A 5CVIA 2V7FA 1OCOH 2NVXJ 4LK1F 2JQ7A 3Q0WA 5JHUA 3TOAA 1AWCA 4W97A 1W4MA 1WI9A 2O9LA 1F1ZA 1R22A 4F91B 2GIVA 3HIFA 4ZH4F 2EZIA 1W36D 1NK3P 2QUFA 2PBIA 1R00A 4XN0A 4I0BA 3K69A 1YHQI 1NG6A 2BVLA 2G7HA 4EM2A 4F92B 4ZYDA 3TEDA 2L54A 3DFGA 2B7EA 2E7WA 3OR1C 3V42A 4H4KC 1YJWI 2DMNA 3FZVA 3SQNA 4XL9A 1SFUA 2LMDA 1W5CC 2FBHA 2IGMA 2TCTA 3K4NA 2ZC2A 2HQNA 5CKTA 4ENMA 4YIIA 3W2VA 3BR1A 2HOSA 2EV5A 4MNUA 5FLXK 3TBIA 3A03A 3E6DA 3FK7A 2MYSA 2Z1DA 3FDYA 2XGXA 3K9TA 1HW5A 2L9VA 3CUQB 3KYCB 4HLXA 3V7RA 3RKQA 1SFOJ 2LVSA 1MGTA 2LF7A 4PJLA 4IOAF 2W7NA 3VYRB 2DDBA 4ABZA 2L7FP 3PIPF 3CLQA 1FLIA 1R49A 3ZN0A 3K4JA 4IO9F 1BI0A 3WE3A 3MZ8A 4UVBA 1TWGJ 1FPQA 4CDGA 3WGIA 2MABA 1S9HA 2F4MB 2BY2A 4MEYF 2VQCA 4HNUA 1GV5A 1T8IA 3PQJA 5F6FA 2VT2A 3CDHA 4W1UA 4HA8A 3WE2A 2KIUA 2K7LA 1WPKA 4EJVA 1OJLA 2XAFA 2OUMA 1WWXA 2QA4I 4V19K 2VQHA 4MGRA 3TKYA 1TP4A 3I9V2 1A5JA 2HOTA 1LKXA 1ZQ3P 3ZOBA 4IHSA 1MKMA 3GO5A 2O8KA 1GVDA 3BWGA 3S2WA 2CW8A 3CMAI 1ETVA 2HNHA 3ONQA 2XROA 1KYWA 2CWEA 5E1ZB 4YIFA 2XRLA 5E1XA 4CYDA 4C2TA 3J7AO 3VYTB 1NK2P 3LA3A 2HZTA 3HGGA 2IS4A 1E0EA 1IRFA 2JTVA 2FMLA 4ZDOA 3GVAA 4BY7J 2CW7A 4E7ZA 1T39A 3TGNA 3CLOA 1YOVB 4BE2A 4DJAA 3S1MJ 4RM3A 1T2KA 2BVMA 2VBZA 4L5EA 3GZ5A 3JRCA 2LOOA 3TO6A 3CC2I 5D8LB 4ZDLA 5JLXA 2M5WA 3BZ6A 2QENA 4BQQA 5KCMA 1UB9A 3MN2A 3FKJA 3LSTA 3G71I 5M3FJ 1N77A 3CMEI 3Q5FA 5GTIC 4RS8A 1DUXC 1J2XA 2LLKA 2K9NA 3HOWJ 4A0YA 3DLAA 4GRIA 3X2QH 4NNJA 3BLYA 3ZQQA 3KYLA 4G12A 5E3NA 5EEAA 1XMAA 1H88C 5HLGA 4YFKF 2A6HF 3IKVA 3VEPA 3G1MA 2K85A 2GOXB 2C6YA 4FE7A 3DXJF 1ZH5A 3HHGA 3OSGA 1U9OA 2WV0A 2L5QA 2P8TA 4N4OB 4XOPA 3VPRA 4DGWB 1OPCA 2P6TA 1HOMA 3LOCA 2XB0X 3QPSA 1BI1A 1KQ9A 1ZR4A 4U7BA 2EK5A 2QGUA 2R7VA 3SZTA 1O3SA 2E1CA 2Y9YA 2R3SA 2RAEA 5FKNA 1WJAA 1X1BA 2AQEA 5F08A 5D5VB 2PI0A 3HDDA 1V5FA 4CA0A 1IXCA 2QLZA 5L3CA 3CUOA 5EEGA 1GV2A 2PJPA 4MLOA 5F0CA 5L3FA 2KDZA 3PNYA 2ESNA 3DWLE 1X1DA 2L01A 2FUG2 1SAUA 1BA5A 1ZGAA 1MBFA 3BR5A 1RETA 2FOWA 3VSLA 2YR2A 1GT0C 3QPHA 3TP0A 1DPUA 4LG0B 1FWZA 4A3EJ 3S3OA 4P55A 4S0HB 2VKDA 1ETKA 1MW7A 2E36A 2FOKA 3VDXA 3JAMZ 3FHZA 5CVVA 4XN3A 1P4AA 4PZJA 4BE0A 2VT3A 5IY5H 1IC8A 1Y8RB 2PEXA 1JKOC 1LNWA 3HYIA 1XGNA 1X2MA 4QSHA 5BOXA 3H5NA 2IGOA 3H36A 3KP3A 3ZMZA 3JRDA 3CMMA 2E19A 2EFWA 2GZWA 1SFEA 1UELB 4DZJA 2WAQA 4KT5C 1R5GA 1MDMA 4LLLA 1TZLA 2MW8A 3FM5A 1AU7A 5J4YA 2VKVA 3RSNA 3F23A 1JGSA 3DP7A 3HOTA 1HSTA 1LFUP 4BNCA 4QPQA 3PUFA 2R7TA 1N78A 3E0JB 2QSHX 4BHCA 1IV8A 3QAHA 3DEUA 2MSYA 3CCJI 2P5VA 3HPGA 3TMOA 5IYDJ 4PJNA 2EH3A 2Q2EA 2I10A 1G8XA 4BDZA 1FZPB 3IV5A 1SD4A 3I3LA 3K70D 1LFBA 2OZ6A 3J81Z 3F8NA 1WCMJ 3IH4A 4GXOA 1YITI 1RPWA 3ERED 2YU3A 3OOPA 2PJRA 3SYTA 1G59A 5EJCA 3F6VA 4IHXA 1XX5A 3PNTA 1Z0XA 4Z2YA 3K1MA 3E5QA 3CD6I 3Q9SA 2DA7A 2AHQA 3CCRI 4BKXA 3EETA 4BJ6C 1FYMA 3IHUA 3PO2J 3GFMA 1FBQA 1JUMA 2VXDA 4A3LJ 4XRSA 2Y9ZA 2AS5F 2M4KA 4BHBA 2DOEA 4A5NA 5HS9A 2O61A 2ZFUA 2QSGX 5D6EA 2IXSA 4JOMA 1WH7A 2NVQJ 3FMSA 2V26A 3G4SI 4RGUA 3GTQJ 4NHJA 2VONA 1RESA 4M3FA 2E1NA 4LMYA 5IT3A 1QVUA 1BW5A 4EJUA 4U7DA 3TL4X 4E7HA 4A3GJ 3D5LA 1ETOA 4M9ZA 3B6AA 1TT0A 2R93J 1JJ6C 4HG2A 2W57A 2HFHA 2M7BA 1TQIA 5HODA 3AG4H 1Y8QB 1WGXA 3O6BB 4JQFA 2X51A 2QCOA 3HRUA 2XAUA 1E2XA 2LTPA 4RMNA 4A0ZA 2L02A 2O0YA 3HL2A 2VODA 1HKTA 5C4JJ 3ZCOA 2R5YA 1VFCA 4D9JA 1TW3A 3GZNB 3ABUA 4IQ4A 4B8XA 4PCQA 4HF2A 2EB7A 3FF5A 4AYBA 1UG0A 1V4RA 1K61A 1HSJA 2N8GA 2X6YA 4DZPA 2V79A 5FKOA 2ME0A 2M45A 2ACJA 1W36C 3ISPA 5IP6A 4ANJA 3WTTC 2BY0A 5HDNA 1R5HA 1Z7LA 1LQ1A 4D7MA 2D1VA 4XIDA 1J09A 4IEJA 3HZJA 2EV0A 2GA1A 3W3CA 4G7ZF 1VQMI 3RKXA 1D8JA 2XKOA 1WQ2A 2FRHA 4XKVA 5F1RA 4U87A 3H92A 1VQ9I 3HRMA 1MBHA 1Y1WJ 4OU0A 5CVUA 5IT9K 2OTLI 1USTA 1A36A 3F9KA 4HDVA 5LD2C 4LD5A 2WV1A 2DQRA 2NOJB 4Q48A 1YQAA 2NXNB 5DS9A 1YS6A 3BJAA 3FWEA 5CQGA 3GLLA 2ZMEC 1RC9A 2ZNYA 4L9JA 1RKTA 1S8NA 1YW9A 3RPUD 3C1DA 3GBGA 3BZKA 5M3MJ 4ZYEA 3HTSB 2ZXJA 3S93A 1L3LA 1AOYA 5AONA 1GVJA 2WB1N 2BEOA 2Y30A 4MFDA 5LBQA 2QSFX 4IVNA 3E5XA 2W24A 5CVJA 4RAZA 1Z6TA 4HQEA 1B4AA 2LC2A 1HQCA 2CW0F 1ZLKA 1K6YA 3VOEA 1JXSA 1HXDA 5FLVA 2RN7A 3CF5F 3OYIA 4I0AA 1IG7A 3D5RC 1BI2A 1DPRA 2QF7A 3JRBA 2FEZA 4D0PA 2DA2A 3HOYJ 2K4JA 3BTLA 4IRGA 2LF8A 2CV2A 3S2DJ 3ZQFA 2KLOA 3IWFA 1FX7A 4NBQA 1A6IA 1QHGA 3BPVA 2CSOA 3KIOA 4AUXA 2V4JC 4ENNA 4QIWN 2KRFA 2JA2A 4ZTFA 4RGSA 2DOAA 2DMTA 5M5YJ 1IF1A 5HLHA 2EA4A 2DK5A 1TW2A 3LWFA 3WG9A 2YUSA 3CZ6A 3S15J 2MH9A 1LJ9A 4F55A 1Y56A 2DU9A 3DCFA 5E3LA 2CG4A 2FSWA 4NUBA 2MLKA 3CJNA 1O3RA 1S5LC 1BIAA 1WVRA 1GUUA 1S29A 2A69F 3A02A 5H20A 1UAAA 2DFHA 3GTPJ 3M7GA 1JHFA 5F1JA 5DD8A 5K5RA 1K78B 4A3DJ 3CUQA 5K7ZA 5HLTA 4FISA 2A6TA 3OIOA 3CCVI 1O7LA 2HU9A 1MMGA 2KIFA 4MHGA 2DMPA 2HTJA 3V7CA 3JRGA 2YU9J 3L00A 3AAFA 3IL2A 1DGWY 1SVOA 2MLGA 3T5XA 4OIQF 4HV5A 1ACIA 2E34A 2QEXI 1GHCA 1ETWA 1MSEC 5TISC 1P7IA 1SAXA 5H6RA 3BP8A 4ON0A 3WTWC 1V54H 4HRIA 2OA4A 1YFHA 3A0HC 2MA3A 2OV7A 5JI6A 4BJ5C 1W0UA 4Q4ZF 3W2AA 3RKWA 5J1YA 2HWVA 2K3FA 3E1SA 4A2UA 2BYVE 2BOLA 1FT9A 2PG4A 3C18A 2DO7A 3OV8A 1P7JA 5ICEA 1LVAA 3EUKL 2OZUA 2CUEA 3HPHA 5ILSA 1R4MB 2JK3A 3QU3A 2CUZA 2STTA 3WHBA 3LFUA 3I53A 1NH3A 5KK1A 1MJ9A 2CUFA 2JA6J 1QQIA 3M8EA 3LSMA 3ZN1A 3BCAA 3I5UA 2WBMA 2VBYA 3EUHC 2WAFA 2E2IJ 3FHNA 1KQ8A 1W5TA 2RGVA 3DPTA 2KT0A 2VASA 3T1BA 3IAM2 1R9TJ 2EZKA 2EFOA 2W82A 3ECHA 2UXXA 5L3DA 2IA0A 2UXNA 2KHMA 2Z9OA 4XRFA 3SXYA 3L2CA 1MBJA 1WJFA 1IGNA 2MD5A 1OQYA 4E70A 1LDKB 4ENJA 4M73A 3VSKA 1TBXA 3JSOA 3AL0B 2CH0A 3ERMA 1VQLI 2TRTA 2DA5A 2W4SA 3CDIA 4PGHA 3TOBA 3BR3A 3ZQGA 1B9MA 2P81A 2O7OA 2K4BA 1P92A 2CGPA 1XD7A 2CJJA 3HKZN 3SJMA 2JVHA 2ZNZA 2KDOA 3I55I 1DQUA 2FBKA 2VN2A 1W7PB 4OIOF 2R92J 1Y1VJ 1U5TB 4RB2C 4AIJA 3MZHA 9ANTA 4HSTA 5LFAA 2XASA 3PSFA 1OCZH 1KGSA 3HUGB 4G6QA 4L9VA 2NNNA 4RB0A 1D3YA 4XM3A 4PK4A 1REPC 1WJ5A 4FE4A 3KP2A 4AWXB 4YEJA 5E18F 1MJBA 4PSXA 3K70C 1T0FC 5E3MA 4B3XA 4B44A 2L0KA 1YJNI 4A3IJ 3TP3A 4AU7A 3ZMSA 1S6LA 5AIQA 4DOZA 3IAS2 1I3AA 1M1EB 2BW3B 3KEOA 2L9SA 4DYRA 2EFPA 4RGXA 2IP2A 4N4NB 2IA1A 5DCMB 4MIMA 1O57A 1WFXA 1Z91A 4IZZA 3LL7A 1QVTA 2F5EA 4RLFA 2DTRA 2M0CA 2DT6A 2XV4S 4U0WA 4I2OA 3BR6A 3GX4X 1HKSA 2BXYA 4C9YA 5FKLA 4M6YA 4ZJZA 1ETXA 4AD9A 2Y69H 1RUOA 1ENHA 3ZPLA 1DP3A 2XVCA 4KUMA 1XN7A 2DK8A 3BG6A 2DW4A 2E1MB 1X3ZB 2VJ5A 3GMEA 3ABTA 3IRQA 2DOFA 3S17J 4NDLA 1QHHD 1OMIA 4OINF 4JBAA 2ZCWA 3LSHA 4LIVA 3HHHA 5KVRA 1AHDP 4KIGA 4PJJA 3ZQIA 1IZ1A 4X1EA 3ZRGA 1WKMA 3IP4B 2X0LA 1ZR2A 1NTCA 2P7VB 1FMVA 3DKWA 3N05A 4F52A 1YS7A 4Q47A 3HSRA 2QQAA 4NQWB 1TWCJ 2R7SA 2IS1A 1IXRC 4Y33A 4BL0B 1YE9A 2Y75A 3VYUB 1SC7A 2W84A 5LGTA 4E7KA 4KYWA 5BMZA 3QOEA 5LHGA 1OCPA 1XMKA 1X19A 1LFPA 2WY7Q 2NVTJ 3R60A 1T98A 2F6CA 3ZMUA 2Z3YA 3FXKA 3LSIA 3CQZJ 2CFOA 2HI3A 3V8JA 4EEFG 2W48A 2FQ3A 4BHPA 4FASD 2M2EA 4I99C 2X4HA 4BS9A 3TDZC 3W6JB 3S32A 1S72I 2LNBA 2IS2A 2O03A 2OAZA 3C7JA 3EQLF 1NHAA 1X4PA 3MD2A 2IS6A 2BHZA 4DNCA 2DT5A 3LQRA 1MMDA 3CCUI 4CCJA 2A5WA 1ZARA 4OMZA 1HKQA 2FU4A 2K5CA 1MMAA 3JCUC 4BXUA 3J80Z 3OYKA 4BACA 4MEXF 3DBRB 2L4AA 3CP8A 4E6KG 1ITYA 3OL4A 4IL6C 2DPUA 1J0RA 1OYWA 2F4OB 5HDKA 2YS9A 2KRCA 3CMYA 1JI8A 5D5XB 4N9HA 3BC8A 3CO7C 4B43A 1BBYA 1ZLJA 3GTKJ 2YX7A 4RM2A 3QYBA 3ML6A 4XORA 4BGDA 2O3FA
chains in the Genus database with same CATH topology
3HOXJ 1AU7A 1FTZA 4M3GA 2FD5A 2CRGA 2VKVA 4A93J 2X48A 1JT6A 4BBSJ 1LFUP 3L1PA 3HOVJ 2Y0SN 1TWAJ 1MNMC 1AKHB 5IYCJ 3FKIJ 3OSFA 1VNDA 1B8IB 2K9QA 2MSYA 1FIPA 3HEFA 5IYDJ 2EH3A 1VF9A 3NARA 5C3EJ 2CU7A 2EQRA 1U8BA 2I10A 4M3DA 2L9RA 4JX6A 3IV5A 2XPVA 1F43A 3BTIA 1LFBA 2H8RA 5M5WJ 4A69C 1WCMJ 3IH4A 1RPWA 3Q0VA 3JRAA 3S16J 3CDLA 5EGOA 3RZDJ 4CYCB 3GTOJ 4B3AA 2EZLA 5M5XJ 4IHXA 1JKQC 1Z0XA 1XS9A 2DA7A 2AHQA 3B6CA 3BQYA 2NVYJ 4BKXA 3IH2A 3PO2J 2HQ5A 1JUMA 1G2HA 4A3LJ 4XRSA 2Y9ZA 4BY1J 2LKXA 1DU0A 2LK2A 4C2MJ 1WH7A 2NVQJ 3QQAA 4IHWA 5J1UA 5GPAA 2JWTA 1JJ8C 3GTQJ 2IAIA 2MGQA 1RESA 4M3FA 5GPCA 1TWFJ 1QVUA 5BNGA 1BW5A 2XGCA 1TWHJ 4A3GJ 1ETOA 3FK6A 2LD5A 3B6AA 2XSDC 2ID3A 4D5CA 4UUSA 4XRSG 2DMQA 2R93J 1JJ6C 3GTMJ 3MVPA 5K7FA 5HODA 3PM1A 2JN6A 2XB5A 1WGXA 1MBEA 5EG0B 2QCOA 1QPIA 2LTPA 5J1RA 2GM4A 3DEWA 5C4JJ 4QTRA 2R5YA 2LY9A 1VFCA 4MFEA 3ZQLA 5EYRA 1I50J 3BR0A 4XRMA 2JA7J 4DW6A 3LSPA 5C44J 1K61A 3S2HJ 3Q3SA 4A3BJ 2E1OA 2N8GA 4DZPA 5FKOA 3BQZA 3ZQHA 2ME0A 4D7NA 5IPAA 2JMWA 2HOAA 3QPLA 2HDDA 2OPTA 3GTLJ 2DA3A 2E2JJ 3GTGJ 5IP6A 4A3CJ 1ORKA 1ETYA 4D7MA 1U78A 4XIDA 4IEJA 2D5VA 4RBOA 2ECCA 1EF4A 5C4XJ 5DTDA 3FIWA 3LSJA 3I4MJ 2NS8A 5FKKA 2WAQN 3TW7A 2OF7A 4Y7NJ 1MBHA 1Y1WJ 3LSRA 5EGOB 2WV1A 1W0TA 2FQ4A 2COBA 4HNVA 2R7ZJ 4JX4A 3W6VA 2IBDA 2CQQA 5DS9A 2L7MP 1BW6A 5FLMJ 1HLVA 3WHCA 5F04A 1HCRA 2Y2ZA 4C3JJ 1RKTA 2XGEA 2EBIA 2FX0A 3OOUA 3HB9A 3GBGA 5M3MJ 2H1KA 3H3VK 1IRZA 2DA1A 1JKRC 4V2FA 2WB1N 3SFIA 2Y30A 2K40A 2HXOA 4IHYA 4MFDA 1BJZA 3FISA 1B72A 3JRHA 1H8AC 1MSFC 2DA6A 3C2BA 3JRIA 1ZK8A 1T33A 4I76A 4V2GA 1QRYA 3LNQA 3BG3A 3BTCA 3HOZJ 5FLVA 2LP0A 1YRNA 1IG7A 4UUSB 2QF7A 3JRBA 2DA2A 3IH3A 3HOYJ 1UHSA 3CCYA 3BTLA 3S2DJ 1RKWA 3G1OA 2X9DA 3ZQFA 1A6IA 2HXIA 2LFBA 3BR2A 3BG9A 4AUXA 1HDPA 4B4CA 4QIWN 2MG4A 2M34A 2DMTA 5M5YJ 2R5YB 3PO3J 2YUSA 2G0EA 3S15J 4M6VA 2DA4A 2DMUA 1H89C 2JA5J 3DCFA 5J3LA 4MO7A 5E3LA 4GFBA 5E3OA 4X6AJ 3O8HA 2DN0A 2LR8A 3A02A 1GUUA 1XC5A 1TC3C 5IOYA 3F0CA 3GTPJ 5F1JA 3A01B 2K9SA 4A3DJ 1MH3A 3JR9A 5K7ZA 1GDTA 3E7LA 4FISA 3OIOA 3M3YJ 4XICA 5GP9A 1JT0A 3K7AJ 5IYBJ 2XGDA 2DMPA 3JRGA 2YU9J 4A3KJ 1U9NA 4D5FA 2FJ1A 4C3IJ 1F36A 1ETWA 1MH4A 1MSEC 3BTJA 4AYBN 4JP0A 1VI0A 1P7IA 5EZGA 1FEXA 2M9HA 2XPWA 1Q1VA 2DTZA 1D5YA 2ME6A 1S7EA 1PUFB 3G1LA 4I6ZA 1JTXA 5IP7J 1W0UA 4LOCA 4A3MJ 5J1YA 2HYJA 3LSGA 1OFCX 5FKMA 1FTTA 1B72B 1MBKA 1K83J 1P7JA 1XG1A 1JUPA 2CQXA 2GLOA 1BL0A 1JGGA 2CUEA 2NVXJ 2JK3A 3Q0WA 1YRNB 4W97A 1IUFA 3WHBA 1FIAA 5IOZA 2O9LA 1HF0A 1ZGWA 4UUTA 2CUFA 2JA6J 3A01A 2EZIA 1NK3P 1SANA 3UKGA 1IV6A 2E2IJ 1HDDC 2ECBA 1T56A 3RZOJ 3TEDA 2KT0A 4M3EA 3JREA 1R9TJ 2EZKA 3TW6A 2DMNA 3H0GJ 2NS7A 2TCTA 1MBJA 1PUFA 1IGNA 3BR1A 2HOSA 4BBRJ 3A03A 1RR7A 1IJWC 3FK7A 4AC0A 1IDYA 1SFOJ 2TRTA 3RKQA 2DA5A 2LVSA 3BR3A 2EZHA 3ZQGA 2P81A 2L7FP 2Y31A 4ABZA 2O7OA 2XPUA 1I3QJ 2CJJA 3HKZN 3S1NJ 3SJMA 2VUMJ 5F27A 3MKLA 1TWGJ 3O8GA 5JLWA 2R92J 1Y1VJ 1GV5A 1WH5A 1ETQA 4W1UA 4JYKA 1OCTC 9ANTA 1WPKA 1OJLA 5F0FA 1POGA 4JX5A 1A5JA 2HOTA 4FE4A 3SDGA 3ZOBA 1ZQ3P 3NAUA 2O8KA 1GVDA 5E3MA 1ETVA 1LE8A 2L0KA 2JA8J 1FJLA 4A3FJ 4A3IJ 3TP3A 2XRLA 1X2NA 1NK2P 2R5ZA 3HGGA 4DYRA 2GBYA 4MIMA 3HBLA 4C3HJ 2B63J 3M4OJ 3GTJJ 4BY7J 1QVTA 2M0CA 4IHVA 3S1MJ 5F0HA 4FTHA 4L5EA 3BR6A 3JRCA 5FJ8J 3BT9A 3Q0UA 5JLXA 5FKLA 3MN2A 2M8GX 5M3FJ 1JKPC 1ETXA 1E3OC 1ENHA 3HGYA 2LLKA 1UMQA 2K9NA 3HOWJ 5IP9J 5K7HA 4J19A 2VI6A 4G12A 5E3NA 5EEAA 1H88C 4Y52J 4M3BA 3S17J 4NDLA 1APLC 4A3JJ 3G1MA 4RDUA 1AKHA 1B8IA 4FE7A 1MBGA 1AHDP 3D1NI 3S1RJ 2VKEA 1I6HJ 3ZQIA 4X1EA 3OSGA 1U9OA 3HM5A 3K2AA 1ZR2A 3VPRA 1NTCA 1HOMA 3LOCA 2XB0X 1X58A 3QPSA 1ZR4A 1TWCJ 4BXXJ 2DJNA 1Z77A 2Y9YA 2ELKA 3JRFA 2RAEA 5FKNA 2NOGA 2X6OA 5F08A 4CYCA 4FCYA 3HDDA 1OCPA 1DU6A 3S14J 3S1QJ 1GV2A 2NVTJ 4MLOA 5F0CA 3CQZJ 2HI3A 5EDNA 2KDZA 4EEFG 2W48A 2M2EA 1BA5A 1LE8B 1JTYA 1MBFA 3BR5A 1RETA 1WI3A 4DYCA 1GT0C 3TP0A 3HOUJ 3ZQCA 4A3EJ 1JUSA 2ZB9A 4S0HB 3I4NJ 2JJ7A 2R5ZB 1ETKA 3BG5A 1UG2A 2ID6A 1IC8A 5EF6A 1ZKGA 3RQIA 1CQTA 1JKOC 1ITYA 1IDZA 2PMZN 2AO9A 1O4XA 1X2MA 4B1RA 4DYQA 4QSHA 2YS9A 5EZHA 3CMYA 4XK4A 2L7ZA 3JRDA 2E19A 2E2HJ 2IEKA 2VPRA 3GTKJ 4DZJA 2R0QC 1ZTRA 5EG0A 2MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOX J;  1AU7 A;  1FTZ A;  4M3G A;  2FD5 A;  2CRG A;  2VKV A;  4A93 J;  2X48 A;  1JT6 A;  4BBS J;  1LFU P;  3L1P A;  3HOV J;  2Y0S N;  1TWA J;  1MNM C;  1AKH B;  5IYC J;  3FKI J;  3OSF A;  1VND A;  1B8I B;  2K9Q A;  2MSY A;  1FIP A;  3HEF A;  5IYD J;  2EH3 A;  1VF9 A;  3NAR A;  5C3E J;  2CU7 A;  2EQR A;  1U8B A;  2I10 A;  4M3D A;  2L9R A;  4JX6 A;  3IV5 A;  2XPV A;  1F43 A;  3BTI A;  1LFB A;  2H8R A;  5M5W J;  4A69 C;  1WCM J;  3IH4 A;  1RPW A;  3Q0V A;  3JRA A;  3S16 J;  3CDL A;  5EGO A;  3RZD J;  4CYC B;  3GTO J;  4B3A A;  2EZL A;  5M5X J;  4IHX A;  1JKQ C;  1Z0X A;  1XS9 A;  2DA7 A;  2AHQ A;  3B6C A;  3BQY A;  2NVY J;  4BKX A;  3IH2 A;  3PO2 J;  2HQ5 A;  1JUM A;  1G2H A;  4A3L J;  4XRS A;  2Y9Z A;  4BY1 J;  2LKX A;  1DU0 A;  2LK2 A;  4C2M J;  1WH7 A;  2NVQ J;  3QQA A;  4IHW A;  5J1U A;  5GPA A;  2JWT A;  1JJ8 C;  3GTQ J;  2IAI A;  2MGQ A;  1RES A;  4M3F A;  5GPC A;  1TWF J;  1QVU A;  5BNG A;  1BW5 A;  2XGC A;  1TWH J;  4A3G J;  1ETO A;  3FK6 A;  2LD5 A;  3B6A A;  2XSD C;  2ID3 A;  4D5C A;  4UUS A;  4XRS G;  2DMQ A;  2R93 J;  1JJ6 C;  3GTM J;  3MVP A;  5K7F A;  5HOD A;  3PM1 A;  2JN6 A;  2XB5 A;  1WGX A;  1MBE A;  5EG0 B;  2QCO A;  1QPI A;  2LTP A;  5J1R A;  2GM4 A;  3DEW A;  5C4J J;  4QTR A;  2R5Y A;  2LY9 A;  1VFC A;  4MFE A;  3ZQL A;  5EYR A;  1I50 J;  3BR0 A;  4XRM A;  2JA7 J;  4DW6 A;  3LSP A;  5C44 J;  1K61 A;  3S2H J;  3Q3S A;  4A3B J;  2E1O A;  2N8G A;  4DZP A;  5FKO A;  3BQZ A;  3ZQH A;  2ME0 A;  4D7N A;  5IPA A;  2JMW A;  2HOA A;  3QPL A;  2HDD A;  2OPT A;  3GTL J;  2DA3 A;  2E2J J;  3GTG J;  5IP6 A;  4A3C J;  1ORK A;  1ETY A;  4D7M A;  1U78 A;  4XID A;  4IEJ A;  2D5V A;  4RBO A;  2ECC A;  1EF4 A;  5C4X J;  5DTD A;  3FIW A;  3LSJ A;  3I4M J;  2NS8 A;  5FKK A;  2WAQ N;  3TW7 A;  2OF7 A;  4Y7N J;  1MBH A;  1Y1W J;  3LSR A;  5EGO B;  2WV1 A;  1W0T A;  2FQ4 A;  2COB A;  4HNV A;  2R7Z J;  4JX4 A;  3W6V A;  2IBD A;  2CQQ A;  5DS9 A;  2L7M P;  1BW6 A;  5FLM J;  1HLV A;  3WHC A;  5F04 A;  1HCR A;  2Y2Z A;  4C3J J;  1RKT A;  2XGE A;  2EBI A;  2FX0 A;  3OOU A;  3HB9 A;  3GBG A;  5M3M J;  2H1K A;  3H3V K;  1IRZ A;  2DA1 A;  1JKR C;  4V2F A;  2WB1 N;  3SFI A;  2Y30 A;  2K40 A;  2HXO A;  4IHY A;  4MFD A;  1BJZ A;  3FIS A;  1B72 A;  3JRH A;  1H8A C;  1MSF C;  2DA6 A;  3C2B A;  3JRI A;  1ZK8 A;  1T33 A;  4I76 A;  4V2G A;  1QRY A;  3LNQ A;  3BG3 A;  3BTC A;  3HOZ J;  5FLV A;  2LP0 A;  1YRN A;  1IG7 A;  4UUS B;  2QF7 A;  3JRB A;  2DA2 A;  3IH3 A;  3HOY J;  1UHS A;  3CCY A;  3BTL A;  3S2D J;  1RKW A;  3G1O A;  2X9D A;  3ZQF A;  1A6I A;  2HXI A;  2LFB A;  3BR2 A;  3BG9 A;  4AUX A;  1HDP A;  4B4C A;  4QIW N;  2MG4 A;  2M34 A;  2DMT A;  5M5Y J;  2R5Y B;  3PO3 J;  2YUS A;  2G0E A;  3S15 J;  4M6V A;  2DA4 A;  2DMU A;  1H89 C;  2JA5 J;  3DCF A;  5J3L A;  4MO7 A;  5E3L A;  4GFB A;  5E3O A;  4X6A J;  3O8H A;  2DN0 A;  2LR8 A;  3A02 A;  1GUU A;  1XC5 A;  1TC3 C;  5IOY A;  3F0C A;  3GTP J;  5F1J A;  3A01 B;  2K9S A;  4A3D J;  1MH3 A;  3JR9 A;  5K7Z A;  1GDT A;  3E7L A;  4FIS A;  3OIO A;  3M3Y J;  4XIC A;  5GP9 A;  1JT0 A;  3K7A J;  5IYB J;  2XGD A;  2DMP A;  3JRG A;  2YU9 J;  4A3K J;  1U9N A;  4D5F A;  2FJ1 A;  4C3I J;  1F36 A;  1ETW A;  1MH4 A;  1MSE C;  3BTJ A;  4AYB N;  4JP0 A;  1VI0 A;  1P7I A;  5EZG A;  1FEX A;  2M9H A;  2XPW A;  1Q1V A;  2DTZ A;  1D5Y A;  2ME6 A;  1S7E A;  1PUF B;  3G1L A;  4I6Z A;  1JTX A;  5IP7 J;  1W0U A;  4LOC A;  4A3M J;  5J1Y A;  2HYJ A;  3LSG A;  1OFC X;  5FKM A;  1FTT A;  1B72 B;  1MBK A;  1K83 J;  1P7J A;  1XG1 A;  1JUP A;  2CQX A;  2GLO A;  1BL0 A;  1JGG A;  2CUE A;  2NVX J;  2JK3 A;  3Q0W A;  1YRN B;  4W97 A;  1IUF A;  3WHB A;  1FIA A;  5IOZ A;  2O9L A;  1HF0 A;  1ZGW A;  4UUT A;  2CUF A;  2JA6 J;  3A01 A;  2EZI A;  1NK3 P;  1SAN A;  3UKG A;  1IV6 A;  2E2I J;  1HDD C;  2ECB A;  1T56 A;  3RZO J;  3TED A;  2KT0 A;  4M3E A;  3JRE A;  1R9T J;  2EZK A;  3TW6 A;  2DMN A;  3H0G J;  2NS7 A;  2TCT A;  1MBJ A;  1PUF A;  1IGN A;  3BR1 A;  2HOS A;  4BBR J;  3A03 A;  1RR7 A;  1IJW C;  3FK7 A;  4AC0 A;  1IDY A;  1SFO J;  2TRT A;  3RKQ A;  2DA5 A;  2LVS A;  3BR3 A;  2EZH A;  3ZQG A;  2P81 A;  2L7F P;  2Y31 A;  4ABZ A;  2O7O A;  2XPU A;  1I3Q J;  2CJJ A;  3HKZ N;  3S1N J;  3SJM A;  2VUM J;  5F27 A;  3MKL A;  1TWG J;  3O8G A;  5JLW A;  2R92 J;  1Y1V J;  1GV5 A;  1WH5 A;  1ETQ A;  4W1U A;  4JYK A;  1OCT C;  9ANT A;  1WPK A;  1OJL A;  5F0F A;  1POG A;  4JX5 A;  1A5J A;  2HOT A;  4FE4 A;  3SDG A;  3ZOB A;  1ZQ3 P;  3NAU A;  2O8K A;  1GVD A;  5E3M A;  1ETV A;  1LE8 A;  2L0K A;  2JA8 J;  1FJL A;  4A3F J;  4A3I J;  3TP3 A;  2XRL A;  1X2N A;  1NK2 P;  2R5Z A;  3HGG A;  4DYR A;  2GBY A;  4MIM A;  3HBL A;  4C3H J;  2B63 J;  3M4O J;  3GTJ J;  4BY7 J;  1QVT A;  2M0C A;  4IHV A;  3S1M J;  5F0H A;  4FTH A;  4L5E A;  3BR6 A;  3JRC A;  5FJ8 J;  3BT9 A;  3Q0U A;  5JLX A;  5FKL A;  3MN2 A;  2M8G X;  5M3F J;  1JKP C;  1ETX A;  1E3O C;  1ENH A;  3HGY A;  2LLK A;  1UMQ A;  2K9N A;  3HOW J;  5IP9 J;  5K7H A;  4J19 A;  2VI6 A;  4G12 A;  5E3N A;  5EEA A;  1H88 C;  4Y52 J;  4M3B A;  3S17 J;  4NDL A;  1APL C;  4A3J J;  3G1M A;  4RDU A;  1AKH A;  1B8I A;  4FE7 A;  1MBG A;  1AHD P;  3D1N I;  3S1R J;  2VKE A;  1I6H J;  3ZQI A;  4X1E A;  3OSG A;  1U9O A;  3HM5 A;  3K2A A;  1ZR2 A;  3VPR A;  1NTC A;  1HOM A;  3LOC A;  2XB0 X;  1X58 A;  3QPS A;  1ZR4 A;  1TWC J;  4BXX J;  2DJN A;  1Z77 A;  2Y9Y A;  2ELK A;  3JRF A;  2RAE A;  5FKN A;  2NOG A;  2X6O A;  5F08 A;  4CYC A;  4FCY A;  3HDD A;  1OCP A;  1DU6 A;  3S14 J;  3S1Q J;  1GV2 A;  2NVT J;  4MLO A;  5F0C A;  3CQZ J;  2HI3 A;  5EDN A;  2KDZ A;  4EEF G;  2W48 A;  2M2E A;  1BA5 A;  1LE8 B;  1JTY A;  1MBF A;  3BR5 A;  1RET A;  1WI3 A;  4DYC A;  1GT0 C;  3TP0 A;  3HOU J;  3ZQC A;  4A3E J;  1JUS A;  2ZB9 A;  4S0H B;  3I4N J;  2JJ7 A;  2R5Z B;  1ETK A;  3BG5 A;  1UG2 A;  2ID6 A;  1IC8 A;  5EF6 A;  1ZKG A;  3RQI A;  1CQT A;  1JKO C;  1ITY A;  1IDZ A;  2PMZ N;  2AO9 A;  1O4X A;  1X2M A;  4B1R A;  4DYQ A;  4QSH A;  2YS9 A;  5EZH A;  3CMY A;  4XK4 A;  2L7Z A;  3JRD A;  2E19 A;  2E2H J;  2IEK A;  2VPR A;  3GTK J;  4DZJ A;  2R0Q C;  1ZTR A;  5EG0 A;  2MW8 A; 
#chains in the Genus database with same CATH topology
 2XAH A;  3EDP A;  1BJA A;  3R6S A;  4WXH A;  3HSE A;  2LG4 A;  2HKX A;  4UB6 C;  3DV8 A;  2X48 A;  3F8M A;  5JVG F;  1OLT A;  3BJ6 A;  3SZG A;  3OS1 A;  3HOV J;  3D5S C;  2Y0S N;  1TWA J;  1EH6 A;  2ICW G;  4ESB A;  3FMQ A;  3I0T A;  3WU1 B;  5IYC J;  1AKH B;  1VND A;  2MC4 A;  2K9Q A;  4MQV A;  2H8W A;  1QPM A;  4KIC A;  3H3U A;  4PGG A;  1VF9 A;  4FT8 A;  1N75 A;  3P9K A;  4XLP F;  5A2Q Z;  1I1G A;  1D0X A;  3BTI A;  3QYE A;  4LIU A;  3WTX C;  3Q9V A;  2CV0 A;  2VOO A;  3HKZ A;  2VQL A;  2VE8 A;  5BQT A;  4G8X A;  2E71 A;  3TDU C;  2DYS H;  5TRD A;  2HDC A;  3GTO J;  1HA8 A;  1ZHF A;  3KP4 A;  1FOW A;  4GO1 A;  1WZ2 A;  4XLF A;  3OWT A;  2PN6 A;  2BXZ A;  2OQG A;  2JUG A;  4KIF A;  2LKX A;  1DU0 A;  2XAG A;  1P4X A;  2MFZ A;  5J1U A;  5E17 F;  2JWT A;  1JJ8 C;  2E5N A;  1ZRF A;  2HEO A;  2VJ4 A;  3JSP A;  1R58 A;  4HZF A;  5GPC A;  1EJ9 A;  1ON1 A;  3FXJ A;  4PFP A;  1I6X A;  3BJO A;  2LKP A;  1KYZ A;  1MNE A;  3A1Y A;  1IN7 A;  2GWR A;  2CQ7 A;  2LD5 A;  5FRM A;  1VQN I;  5K7F A;  4FX0 A;  1IO2 A;  3KPH A;  2P0W A;  3PUB A;  2JN6 A;  2XB5 A;  2FF4 A;  2W1O A;  1MBE A;  1USS A;  4DQ2 A;  1VQO I;  1QPI A;  4KFC A;  1KON A;  1O3T A;  2XF5 A;  1QU3 A;  1IN5 A;  3RI4 A;  4HBL A;  4MFE A;  3ZQL A;  4XRM A;  2P5L C;  4DW6 A;  1WJE A;  2G9W A;  3I58 A;  3B73 A;  2E1O A;  1RUN A;  3ZQH A;  1SVM A;  2GIZ A;  4D7N A;  4F93 B;  2NVU B;  2JMW A;  3LA2 A;  1QGP A;  2OPT A;  1VQP I;  2KJB A;  2QM3 A;  2XUB A;  5FD5 A;  1ETY A;  2KIM A;  5LHH A;  3M1C A;  4ZYG A;  1U78 A;  4R79 A;  3WOD F;  1CF7 B;  4PFO A;  5FLX Z;  2M1B A;  3JTH A;  4YFX F;  4LLN A;  4ESF A;  1EF4 A;  1FY7 A;  4O5V A;  3DTI A;  2QKL B;  3RQ4 A;  2EIL H;  3FIW A;  3UR3 C;  2E60 A;  1FBU A;  3HC7 A;  4KDP A;  2IT0 A;  3TW7 A;  5CQE A;  2OF7 A;  4Y7N J;  1G3Y A;  4L0Z B;  1YLF A;  2IPQ X;  5ILV A;  4Y4R A;  5EGO B;  2K3P A;  1HBX G;  2FQ4 A;  2QQ9 A;  5KHD A;  2J5O A;  3FX3 A;  4JX4 A;  1HCR A;  1RZ4 A;  2Z16 A;  1LB2 A;  4RA2 A;  1K6O A;  4BQO A;  4C3J J;  2EBI A;  3I54 A;  2QBY B;  3H3V K;  4L5J A;  2DA1 A;  2V1X A;  4EGZ A;  1FC3 A;  2F5C A;  2TDX A;  1Q1H A;  3F8F A;  4V2F A;  4G6T B;  5FRO A;  3FXR A;  2HXO A;  2WTE A;  3LMM A;  3FIS A;  1KQ0 A;  5J40 A;  2VIX A;  3ABK H;  3SDB A;  1H8A C;  3CP2 A;  2HVS A;  1XGM A;  3JRI A;  2W25 A;  3K4B A;  2RC4 A;  1V5G A;  1FP1 D;  4XNF A;  4UUS B;  3UNG C;  4HF1 A;  1KU9 A;  1DGR M;  2L2O A;  3IH3 A;  1J59 A;  1UHS A;  2MH2 A;  2LBF B;  3G1O A;  2LH9 A;  1QBJ A;  1IXS B;  2HXI A;  3FXU A;  3BG9 A;  5ICG A;  2MG4 A;  4XLE A;  3P7N A;  1SD6 A;  1U6G A;  4XOT A;  3WTY C;  3ABL H;  2R7Q A;  3TQN A;  3PO3 J;  1Y39 A;  1BIB A;  4M6V A;  4RGR A;  3R61 A;  1OR7 A;  1BI3 A;  3ABM H;  4J01 A;  4BQA A;  3O8H A;  2DN0 A;  3C2G A;  1VTN C;  5KAF C;  3L2W A;  2CFX A;  1XC5 A;  4I98 B;  1TC3 C;  1K79 A;  3NEU A;  4CCN A;  5DDG A;  1YI2 I;  4I09 A;  3CCS I;  3HXL A;  1OIS A;  2K9S A;  1Y0N A;  3E7L A;  3CF2 A;  1Z6R A;  4KA4 A;  3OYH A;  3M3Y J;  2MD0 A;  1QA6 A;  3P9C A;  2CYY A;  2EIK H;  3GXO A;  1U9N A;  2F5V A;  2BY3 A;  3KEY A;  2OQR A;  2CQN A;  4HPQ A;  3RCO A;  3QP6 A;  1F36 A;  1UZC A;  2XAQ A;  1V5E A;  1YYV A;  4JP0 A;  1W7P A;  3K0L A;  1Q1V A;  4N0B A;  1U5T A;  2OTJ I;  1D5Y A;  1FNN A;  3OIP A;  4IXA A;  2BBY A;  4BDY A;  3ELK A;  1S7A A;  3GCM A;  3HUG A;  4NC7 A;  1S7O A;  3RJP A;  2VPL A;  2NS0 A;  1FTT A;  1B72 B;  3DU5 A;  1MBK A;  1K83 J;  1IN6 A;  1XG1 A;  4KIT B;  4HX8 A;  2A68 F;  2M30 A;  4EGY A;  2KIQ A;  2WA0 A;  4H0E A;  4M6X A;  4EVI A;  2BW3 A;  3RYR A;  5IOZ A;  3R0A A;  1PVE A;  3CJQ B;  4LGW A;  1HF0 A;  4UUT A;  4F3Q A;  5DCM A;  3A01 A;  3MMY B;  1D0Y A;  3J7Z I;  4BUP A;  1SAN A;  3CCL I;  4XKW A;  1TL8 A;  1VQ4 I;  3FXQ A;  3RIR A;  2KJC A;  2HVQ A;  1HDD C;  2ECB A;  1T56 A;  1FMW A;  3S3N A;  3ULQ B;  2DCE A;  4WXD A;  4IOC F;  1SVL A;  4PJM A;  3ASO H;  4M3E A;  3KZZ A;  3TW6 A;  3E6B A;  5BS6 A;  3WGG A;  5LLQ A;  3PIO F;  3KE2 A;  3DLL F;  3H0G J;  2COM A;  1K7A A;  5LGN A;  4RAG A;  4ZZL A;  4Y15 A;  3HOS A;  1ZG1 A;  2AQF A;  5J8F A;  3GFI A;  4I01 A;  4XKC A;  1PUF A;  1MIJ A;  4BBR J;  2M8E A;  1R5I D;  1LEA A;  1RR7 A;  1IJW C;  3LSK A;  4DBQ A;  1PP8 F;  1IDY A;  1PDN C;  2K9L A;  5JFR A;  2QVO A;  3C2H A;  5H6Q A;  2EZH A;  5JHF A;  3OIQ A;  2L3D A;  2XPU A;  3KFW X;  3I56 I;  2RNG A;  1WRJ A;  4E7J A;  1WSU A;  3WTV C;  5AIP A;  3S1N J;  3GF2 A;  4E7L A;  1B6A A;  4BEH B;  4NQW A;  2V9V A;  2OU2 A;  3D0S A;  3GEZ A;  2K86 A;  4AIK A;  4WCG A;  2UWM A;  4HDU A;  1ETQ A;  2E5Z A;  4S04 A;  4OIP F;  3LQQ A;  3R0J A;  5K5Q A;  1OCT C;  2L7K A;  3B02 A;  2XF6 A;  3RPQ A;  1HW2 A;  2XF7 A;  2IJL A;  4JX5 A;  1G6N A;  1KA8 A;  3PFY A;  2R7D A;  1VQ5 I;  3SDG A;  4S05 A;  2RDP A;  3K4M A;  2DFF A;  3KZI C;  4G6D A;  1STZ A;  4UB8 C;  4ZYA A;  2HVR A;  4BQN A;  2J5P A;  2JA8 J;  3CUQ C;  3L2R A;  4A3F J;  1FJL A;  2R4G A;  2HDW A;  2OBP A;  3BY6 A;  3E6M A;  4HX4 A;  5LEK A;  4BH9 A;  1X2N A;  1H9T A;  1J75 A;  2V9P A;  2B9S A;  2DFE A;  1UCR A;  4CHU A;  3EYY A;  1HC8 A;  1OKR A;  1EH8 A;  2V1D A;  3BOQ A;  4C3H J;  3M4O J;  4UV8 A;  1FOK A;  2K27 A;  3H5A A;  3ROU A;  5B3S H;  2ZKZ A;  3PJR A;  5D5W B;  3DF8 A;  5F0H A;  4FTH A;  2VLA A;  2X1C A;  4A5M A;  2VBW A;  3LAJ A;  5FJ8 J;  3BT9 A;  3GW2 A;  2VC0 A;  2A5Y B;  2Y0M A;  5B1A H;  4KT6 A;  2V1N A;  4Y17 A;  2ZJR F;  3KLO A;  4BXF A;  1JKP C;  4OAZ A;  4EM1 A;  2H6C A;  2V1U A;  3HGY A;  4R1H A;  2PMU A;  5DD4 A;  2X85 A;  5HDG A;  1JHH A;  5GTH C;  3N97 A;  5IP9 J;  5K7H A;  4J19 A;  3WG7 H;  1I5Z A;  1OYY A;  4M3B A;  4L9N A;  1APL C;  4HNT A;  4A3J J;  1XTA A;  1AKH A;  2ZXI A;  5D4S A;  3MAJ A;  1MBG A;  2VKE A;  3K2A A;  2ELH A;  3VOD A;  2EV6 A;  2P7C B;  4HOB A;  1KU3 A;  4DIQ A;  1PYV A;  3CTA A;  2WWY A;  2STW A;  5LGU A;  2JPB A;  4UNO A;  3FMR A;  5LEJ A;  2EA2 A;  1BR4 A;  2PQ8 A;  3PFI A;  2A05 A;  2DJN A;  3W6K B;  2OD5 A;  2NNY A;  2EWN A;  1K4T A;  4ZDP A;  4UXN A;  2ELK A;  3GWZ A;  3JRF A;  3FM3 A;  2NOG A;  2X6O A;  4FCY A;  4UVC A;  3CC4 I;  1G3S A;  4AVP A;  5IT9 Z;  2CS3 A;  5E8G A;  3OYD A;  2H09 A;  2W85 A;  4MTE A;  1FYL A;  3AG3 H;  3S14 J;  4CUG A;  4RB3 C;  3S1Q J;  1XMX A;  4P9U A;  4G7O F;  3JW4 A;  4X0G A;  3H5R A;  3BDD A;  5EDN A;  2IGN A;  3M8F A;  2HPM A;  4B47 A;  2Q2E B;  1LE8 B;  1JTY A;  3I71 A;  2VBX A;  1WI3 A;  2EJR A;  2H6B A;  3M07 A;  1RI7 A;  1XB4 A;  2QYO A;  2ZJP F;  1JUS A;  3K4C A;  1XPX A;  2R7U A;  1ZRE A;  5H2F C;  3I4N J;  1D5V A;  2JJ7 A;  4GGG A;  5J6X A;  2R5Z B;  3BG5 A;  4II3 A;  2ID6 A;  1G4D A;  5EF6 A;  1ZKG A;  1IAW A;  2PJR B;  1CQT A;  4XR6 A;  2VJI A;  1IDZ A;  2KZV A;  1O4X A;  5BPD A;  4B1R A;  2VE9 A;  1BC7 C;  5EZH A;  4XK4 A;  1I1S A;  2LYC A;  2E2H J;  2P4W A;  4KIB A;  2JZY A;  2R0Q C;  2G7U A;  4GYG A;  5E79 C;  1B1B A;  3OYM A;  2LY2 A;  3KEQ A;  1LDD A;  3NQO A;  4XQF A;  2CRG A;  3GFL A;  1JE8 A;  1JT6 A;  1YW7 A;  3F72 A;  3L1P A;  3J80 K;  4P96 A;  1RRJ A;  2ZXW H;  4L0Y B;  4ETS A;  1SMT A;  1XGO A;  5GAH J;  1MZB A;  3TO9 A;  1B8I B;  2HGC A;  4A6D A;  2HR3 A;  2WB1 A;  2HPI A;  2M3A A;  4XSZ F;  1J7K A;  1U8B A;  2M0M A;  4M3D A;  2L4M A;  4LG0 A;  4LLG F;  2XPV A;  3CJT B;  1WHU A;  5M5W J;  4A69 C;  4KNY A;  1TTY A;  2MBF A;  2LRE A;  3Q0V A;  3VFZ A;  3JRA A;  2GXB A;  3S16 J;  2E35 A;  4YIR X;  3CDL A;  5EGO A;  3WTS C;  1FSE A;  1Z21 A;  4CYC B;  3SEZ A;  2EZL A;  3H0D A;  2LDU A;  5M5X J;  3HJE A;  1JKQ C;  4BU2 A;  4P1W A;  4CO8 A;  4Y3O A;  3GFJ A;  1ZRC A;  2IRF G;  3G2B A;  3M1E A;  3B6C A;  2H94 A;  1I27 A;  5E8I A;  2NVY J;  1R1V A;  3IH2 A;  1YW8 A;  1W7P D;  1OYI A;  5CLS A;  4ENK A;  1G2H A;  2LSO A;  2KL4 A;  4KN4 X;  4EM0 B;  5ICC A;  1ZGJ A;  2RQP A;  1XDU A;  5FB2 A;  1X3W B;  5E1W A;  2KZG A;  2GAU A;  2PX9 A;  5HS8 A;  4C2M J;  3E97 A;  3QQA A;  5DEQ A;  5D6F A;  3V8L A;  3IC7 A;  2WAD A;  1FSH A;  3VWB A;  1BN5 A;  1DDN A;  1H0M A;  1VQ7 I;  5BPI A;  5BNG A;  2DT7 B;  2XGC A;  1LPQ A;  1TWH J;  1SMY F;  2DFI A;  4YEL A;  1G3W A;  3A4C A;  2ID3 A;  4IJA A;  4D5C A;  4XRS G;  2DMQ A;  4UUS A;  3MVP A;  3FBN B;  3PM1 A;  1XSV A;  1R7J A;  2LBF A;  2V6C A;  4IHT A;  4QWQ A;  5EG0 B;  2OC6 A;  5J1R A;  3MFK A;  2YPR A;  3C3W A;  3H1C A;  4M9S A;  4KN7 X;  3DEW A;  4HW0 A;  4QTR A;  2LY9 A;  3REO A;  2ZME B;  5EYR A;  3I59 B;  5F64 A;  3BR0 A;  1ONV A;  3NWS A;  4I7H A;  3MWM A;  4ESJ A;  2FE3 A;  5C44 J;  2EPF A;  4PUS A;  3CC7 I;  4F7Z A;  1BM9 A;  3Q3S A;  3L2U A;  4ITV A;  4IRH A;  1XSD A;  2VKH A;  3E5U A;  3EYI A;  2R7F A;  2A61 A;  5IPA A;  2HOA A;  3GUD A;  2HDD A;  2HQA A;  2DA3 A;  1ERD A;  4KJZ A;  4A3C J;  2IA2 A;  4EMS A;  1ZG5 A;  5K1Y A;  2D5V A;  2GXA A;  1QZE A;  4E7I A;  3QP5 A;  2X6X A;  4RBO A;  3F21 A;  2A6E F;  2GXG A;  5L3B A;  1IRG A;  1V3F A;  2L9N A;  2NS8 A;  5FKK A;  2JRT A;  1R71 A;  1ZEL A;  1BOA A;  2WAQ N;  4XLH A;  3I4M J;  1TT5 B;  4EV0 A;  5LHI A;  5JVT A;  2ZBK A;  2OJE D;  4WWC A;  3DKY A;  1RIO H;  4HYE A;  4HNV A;  2R7Z J;  5DM7 F;  2IBD A;  3GZ6 A;  2KRH A;  2ESH A;  5FLM J;  2ZFW A;  3DPU A;  3WHC A;  5F04 A;  4BE1 A;  2Y2Z A;  4C2U A;  2XGE A;  2H1K A;  3O2P E;  3HB9 A;  5FO5 A;  1U2W A;  3SZP A;  3OYE A;  3R4K A;  1XGS A;  1JKR C;  1SFX A;  5B66 C;  1Z3X A;  2CV1 A;  3JAM K;  2K40 A;  2P5K A;  3DU6 A;  4YG2 F;  1X3U A;  4WF2 A;  1ODD A;  3OYL A;  1LUJ B;  3MKZ A;  1B72 A;  2PMH A;  1MSF C;  2YX4 A;  3C2B A;  1ZK8 A;  4I76 A;  3LNQ A;  3BTC A;  4O6J A;  4B09 A;  1TQM A;  2LY1 A;  2ZO4 A;  1YO5 C;  1T38 A;  4BAY A;  3U9G A;  5TJJ A;  1UHM A;  3CCY A;  3CCE I;  3RPU A;  1RKW A;  1EKE A;  3K1P A;  2WAE A;  2D2W A;  3KZY A;  4TV7 A;  4GDF A;  2ELJ A;  1HDP A;  3FXL A;  3DEE A;  2ZSH B;  4HQM A;  2WY8 Q;  3ECO A;  3I4P A;  4AVZ A;  3K1N A;  3KYD B;  4RB1 A;  2DMU A;  3H35 A;  2JA5 J;  2Q0O A;  4IF4 A;  4P5O A;  3WU2 C;  5J3L A;  3WU0 A;  3QYF A;  5E3O A;  3L9F A;  4X6A J;  1KZH A;  1D1C A;  2LR8 A;  1PP7 U;  1AA7 A;  2ISZ A;  5IOY A;  5D4R A;  5ICF A;  1NG7 A;  2EFQ A;  1TQP A;  3F6O A;  1MD0 A;  2HYG D;  1WJB A;  1R6R A;  1I39 A;  1MH3 A;  3CES A;  3J81 K;  3JR9 A;  1GDT A;  3BCB A;  4UV9 A;  3IKT A;  2FNP A;  3IWZ A;  1YG2 A;  1EA3 A;  5GP9 A;  4M71 A;  1QZY A;  1BC8 C;  3K7A J;  5IYB J;  4NB5 A;  4L9T A;  1FP2 A;  3HG9 A;  1TLH B;  4BEH A;  1LVK A;  4C3I J;  3K4K A;  1MH4 A;  1G3T A;  1VI0 A;  1VZ0 A;  4AYB N;  5EZG A;  2KQR A;  3MQ0 A;  4IX7 A;  2PLY A;  1FEX A;  2XIG A;  4EJT A;  2DTZ A;  2HZD A;  4HV6 A;  2ME6 A;  3FBI B;  1XDS A;  1B59 A;  2VQG A;  4A3M J;  1FOY A;  4YRV A;  2ZJ2 A;  4CH7 A;  2LKS A;  5FKM A;  2RKH A;  3OMY A;  1Z9C A;  1FYK A;  2RNJ A;  6PAX A;  2W00 A;  1JGG A;  2I8D A;  3PSI A;  2YSR A;  2FMY A;  5FD6 A;  1B9N A;  1UFM A;  3RDI A;  4EQQ A;  4A0X A;  1YRN B;  1IUF A;  1FIA A;  3FXM A;  5CYV A;  2R7R A;  1ZGW A;  1YX5 A;  4UHT A;  5GAD J;  2EIM H;  1K78 A;  1YTY A;  4II2 A;  3DTK A;  1ON2 A;  3ZMV A;  3UKG A;  3OYJ A;  1IV6 A;  4XMY A;  4MQ9 F;  3MKW B;  3H9Q A;  1T95 A;  3ZQ7 A;  3RZO J;  1O7F A;  1A35 A;  5EEH A;  2Q1Z B;  4K2E A;  2CUJ A;  3JRE A;  2M4G A;  3AKZ A;  2NS7 A;  3DBH B;  2R7W A;  1LEB A;  2DYR H;  3LFK A;  3KLN A;  2F4I A;  4U0Y A;  5KAI C;  3ASN H;  4YFN F;  1V55 H;  1ZG3 A;  2Z33 A;  3J7Y J;  4HAM A;  3FXO A;  4OWR B;  2HOE A;  2V9K A;  5ERI A;  1SEU A;  2JSC A;  4AC0 A;  1R1U A;  1J5Y A;  2QWW A;  3MEX A;  3OYB A;  4CGZ A;  2ISY A;  1IRX A;  2IW5 A;  2HQR A;  2Y31 A;  1VQ8 I;  4D1Q A;  1I3Q J;  2DPD A;  2QQB A;  1IUY A;  4ZZD A;  2LRD A;  1F5T A;  2DXI A;  3A0B C;  3OS2 A;  2BZT A;  1D8K A;  5DYM A;  2VUM J;  2F5D A;  5F27 A;  3MKL A;  1Z3Y A;  3NRV A;  3O8G A;  5JLW A;  5FRN A;  2XC7 A;  2JT1 A;  2Y48 A;  2GA2 A;  3OYF A;  1SFK A;  4R8H A;  1OR7 C;  1P9Q C;  1WH5 A;  3T8R A;  2ZXH A;  4HLY A;  4JYK A;  3M8J A;  2I5U A;  4ZC3 A;  3ZMT A;  3MKY B;  5F0F A;  1POG A;  1MMS A;  2ETH A;  5ILU A;  3PQK A;  3U2R A;  2VJJ A;  1GXP A;  2K02 A;  5HS7 A;  3NAU A;  1MJA A;  1PJR A;  1LE8 A;  3AL0 C;  1YX3 A;  4N9I A;  3COA C;  2RV8 A;  5HNH A;  3P5J A;  4IKF A;  2Y0S A;  1WJC A;  2R5Z A;  5B5E C;  3TO7 A;  4Z6Y A;  4CCO A;  2GOM A;  4FHT A;  2GBY A;  1EH7 A;  2JRM A;  3HBL A;  2B63 J;  4G94 A;  3GTJ J;  2UUZ A;  4CZZ A;  2Q8K A;  3S8P A;  1ZYR F;  2M87 A;  4IHV A;  1UHW A;  4OMY A;  3N4M A;  2QQ8 A;  1U5T C;  4L5I A;  3V4G A;  2DQL A;  5FFZ A;  3CCM I;  4CIC A;  1IW7 F;  3Q0U A;  5FGM A;  1VQK I;  2FBI A;  4E7S A;  1FBS A;  2M8G X;  3OYG A;  2QZ8 A;  2O5R A;  4P9F A;  1E3O C;  1Y6I A;  1UMQ A;  1W1W E;  1BR2 A;  3HRS A;  2VI6 A;  1N25 A;  3T8T A;  4WX9 A;  4Y52 J;  5HLI A;  3GLX A;  3OS0 A;  4B48 A;  4RDU A;  3QU6 A;  1QO0 D;  3RTR A;  1B8I A;  3KP6 A;  3D1N I;  3S1R J;  1I6H J;  4HX7 A;  1QNT A;  4CCM A;  3HM5 A;  1U8R A;  4OAY A;  4C30 A;  5CPR B;  1D0Z A;  4CCK A;  1Y0U A;  1T08 B;  4HF0 A;  3V7S A;  1X58 A;  3MZY A;  1ZAO A;  1TNS A;  1Z1D A;  5B1B H;  3K10 A;  4EAT A;  2HYF A;  4BXX J;  4EJW A;  3QOD A;  1Z77 A;  1OCR H;  1MND A;  2VC1 A;  4XSX F;  4U88 A;  1P6R A;  3E3V A;  3H9J A;  2D45 A;  4CYC A;  4KMU X;  3QOP A;  4HEA 2;  1U0J A;  1DU6 A;  3OYN A;  4L18 B;  1A6Q A;  3IRR A;  3KP7 A;  3WGH A;  4XON A;  2XAJ A;  2A07 F;  4LJZ F;  4PDK A;  3W2W A;  2E1M C;  3AG1 H;  1OCC H;  4UY8 I;  5DCF A;  3HSF A;  2R7X A;  2HS5 A;  4ZTJ A;  4LB5 A;  3DKX A;  2VL8 A;  4FX4 A;  5LRR A;  4DYC A;  3HOU J;  2Z2S B;  3OYC A;  3ZQC A;  2ZB9 A;  1FOX A;  3L2V A;  4O3M A;  3KCC A;  4OIR F;  1GLN A;  1D1B A;  4FQG A;  3T0Y A;  1QZZ A;  1UG2 A;  2BGC A;  2AXT C;  2DAO A;  4CXF A;  2BE5 F;  5DV5 A;  2H1L A;  3RQI A;  2XSJ C;  3V8K A;  1PUE E;  4GYI A;  2OCE A;  1W5S A;  1D1A A;  2AO9 A;  2PMZ N;  4RAY A;  4DYQ A;  2V6E A;  2NAZ A;  3VYS B;  2F48 A;  1A31 A;  5HVQ C;  1E17 A;  2L7Z A;  3PL8 A;  2KKO A;  3QPT A;  3WTZ A;  3G73 A;  2IEK A;  2VPR A;  2XHK A;  3KET A;  1ZTR A;  5LRS A;  5EG0 A;  2RRE A;  1H9G A;  3J7A Y;  3HTU A;  2WC2 A;  3HOX J;  4LFU A;  1FTZ A;  2IGK A;  4M3G A;  2FD5 A;  4BJT A;  2CMP A;  1XCV A;  1K4S A;  4A93 J;  3ZP5 A;  2ZME A;  4QPO A;  2VB6 A;  3HRT A;  3I59 A;  4LG3 A;  4BBS J;  4LIT A;  3DPL C;  2JUC A;  4MTD A;  1L0O C;  1SD7 A;  1MNM C;  3GYH X;  3AG2 H;  3FKI J;  3OSF A;  1R23 A;  1FIP A;  2B0L A;  3O3K A;  3ZGK A;  4A6E A;  3HEF A;  4JK1 X;  3E6C C;  4CSW A;  2PFB A;  3OY9 A;  3NAR A;  5C3E J;  2CU7 A;  2EQR A;  2L9R A;  4JX6 A;  5DUK A;  1F43 A;  4XBF A;  4BYY A;  2H8R A;  2JVG A;  5HNF A;  5TGT A;  2X6W A;  4G7H F;  3L2Q A;  2XKP A;  2XRN A;  3F3X A;  1SD5 A;  2GQQ A;  3RZD J;  2R7O A;  1YIJ I;  3BZC A;  2M7A A;  4B3A A;  2DJI A;  2KFD A;  4IQJ A;  2ZSI B;  1XCB A;  5GAE J;  1XS9 A;  4NC8 A;  3U1D A;  2KIS A;  3BQY A;  2Z99 A;  1XSX A;  1X1A A;  3SFZ A;  2HQ5 A;  2K9M A;  2KP6 A;  3NWT A;  4XLN F;  3JTG A;  1BOB A;  3K2Z A;  1E3P A;  2DBB A;  4BY1 J;  1P4W A;  2LK2 A;  1RR8 C;  2F5F A;  4RAF A;  4IHW A;  1T6S A;  5GPA A;  2NRA C;  2IAI A;  1GXQ A;  2BHY A;  2KPM A;  1MMN A;  1TNT A;  2MGQ A;  4I02 A;  4PSW A;  1TWF J;  2DDA A;  5DM6 F;  1U3E M;  3OL3 A;  2MC3 A;  3MCZ A;  2VXZ A;  3AFH A;  4DBR A;  3FK6 A;  4IRI A;  2XSD C;  3GTM J;  5CVR A;  2DI3 A;  5HOO A;  2EFN A;  2O8X A;  1E3H A;  2HKO A;  1IN8 A;  4Q5S F;  1MDM B;  3K6G A;  1O3Q A;  4FET A;  1DP7 P;  2GM4 A;  4NC6 A;  4AM3 A;  1LDJ A;  1BR1 A;  1Z7U A;  1I50 J;  2JA7 J;  3LSP A;  3IUO A;  1KU7 A;  1UJ8 A;  2UZK A;  3PNV A;  4M72 A;  3L09 A;  3S2H J;  4A3B J;  2D1H A;  3BQZ A;  3SEQ A;  2EIN H;  3QPL A;  3GTL J;  4LK0 F;  2E2J J;  3GTG J;  4CCL A;  1ZRD A;  1IN4 A;  3VB2 A;  1ORK A;  4XLC A;  5FFX A;  2ECC A;  3RKY A;  5J47 A;  5E20 A;  5C4X J;  2F2E A;  5DTD A;  3S3M A;  3LSJ A;  5D5U B;  2X1E A;  2H27 A;  3CO6 C;  3LSR A;  3U21 A;  4KIS A;  4G9Y A;  5DUI A;  1W0T A;  2QKM B;  2COB A;  3A2K A;  2AXL A;  3W6V A;  2CQQ A;  2XDV A;  4PJ0 C;  2RQQ A;  5JR3 A;  3F22 A;  2L7M P;  1BW6 A;  3EUH A;  1HLV A;  2CQK A;  1F4K A;  1J9I A;  2FX0 A;  3OOU A;  1VQ6 I;  4WK8 F;  1IRZ A;  2VOP A;  3OR2 C;  4Y13 A;  3ZMD A;  4UVA A;  3I64 A;  3SFI A;  4IHY A;  1BJZ A;  2UV1 A;  1S3J A;  3KX2 A;  1R36 A;  2ADU A;  1YIO A;  2BV6 A;  4RLQ A;  3JRH A;  5CJ9 A;  2A3S A;  1HW1 A;  2DA6 A;  2DLL A;  2JSP A;  5J4V A;  4OOI A;  1T33 A;  4V2G A;  1QRY A;  3BG3 A;  3G6E I;  4A12 A;  1R4N B;  3HOZ J;  1A04 A;  1R1T A;  2LP0 A;  3ZXS A;  4HSR A;  1YRN A;  1X1P A;  3H3Z A;  3EUA A;  4QLC U;  2ZJQ F;  4CZC A;  2CO5 A;  2JPC A;  2HTS A;  3M9A A;  3OYA A;  1CF7 A;  2PMZ A;  1X1C A;  2X9D A;  1ZN2 A;  3WTU C;  5ED4 A;  3DTE A;  1P2F A;  2LFB A;  5GAG J;  4ZYH A;  3BR2 A;  4UUV A;  4B4C A;  2M34 A;  1Z05 A;  1Z67 A;  2R5Y B;  3LA7 A;  4EJO A;  1C0W A;  2G0E A;  1KU2 A;  2FA5 A;  1WJD A;  4M74 A;  2P6S A;  2DA4 A;  1H89 C;  2KMU A;  5K5O A;  4MO7 A;  4GFB A;  2O6G E;  3CCQ I;  4LB6 B;  1EV7 A;  4AIH A;  1ULY A;  2OCC H;  2QBY A;  3CJR B;  4GCV A;  3F0C A;  4AID A;  5KNL A;  5A2Q K;  1T0F A;  3A01 B;  3K4L A;  4XLA A;  3U1K A;  4U0V A;  3LAP A;  1X4O A;  4ASN A;  2BY1 A;  4KMF A;  4J00 A;  4XIC A;  3DBL B;  1JT0 A;  3F8C A;  3F8B A;  3BG7 A;  3EPZ A;  2XGD A;  4A3K J;  4D5F A;  5D8K B;  2E7X A;  2FJ1 A;  3RYP A;  3KP5 A;  1F9N A;  3BRO A;  2DOD A;  3BTJ A;  5L3G A;  2M9H A;  2FXA A;  2XPW A;  3P9I A;  4E4H A;  2IVM A;  2Z5U A;  1S7E A;  1PUF B;  4WXC A;  3G1L A;  4I6Z A;  2FNA A;  3QWL A;  1JTX A;  2NYX A;  5IP7 J;  3QRF F;  1CGP A;  1YJ9 I;  4LOC A;  4M9X A;  2HYJ A;  4XKB A;  2EIJ H;  5J8C A;  2X1D A;  3ZR8 X;  3BPX A;  3LSG A;  5L3E A;  1OFC X;  3G3Z A;  4IPA A;  3DQV C;  3L7W A;  2RVC A;  1JUP A;  1RNL A;  2CQX A;  3H9G A;  3SHF A;  3ESW B;  2GLO A;  1BL0 A;  5CVI A;  2V7F A;  1OCO H;  2NVX J;  4LK1 F;  2JQ7 A;  3Q0W A;  5JHU A;  3TOA A;  1AWC A;  4W97 A;  1W4M A;  1WI9 A;  2O9L A;  1F1Z A;  1R22 A;  4F91 B;  2GIV A;  3HIF A;  4ZH4 F;  2EZI A;  1W36 D;  1NK3 P;  2QUF A;  2PBI A;  1R00 A;  4XN0 A;  4I0B A;  3K69 A;  1YHQ I;  1NG6 A;  2BVL A;  2G7H A;  4EM2 A;  4F92 B;  4ZYD A;  3TED A;  2L54 A;  3DFG A;  2B7E A;  2E7W A;  3OR1 C;  3V42 A;  4H4K C;  1YJW I;  2DMN A;  3FZV A;  3SQN A;  4XL9 A;  1SFU A;  2LMD A;  1W5C C;  2FBH A;  2IGM A;  2TCT A;  3K4N A;  2ZC2 A;  2HQN A;  5CKT A;  4ENM A;  4YII A;  3W2V A;  3BR1 A;  2HOS A;  2EV5 A;  4MNU A;  5FLX K;  3TBI A;  3A03 A;  3E6D A;  3FK7 A;  2MYS A;  2Z1D A;  3FDY A;  2XGX A;  3K9T A;  1HW5 A;  2L9V A;  3CUQ B;  3KYC B;  4HLX A;  3V7R A;  3RKQ A;  1SFO J;  2LVS A;  1MGT A;  2LF7 A;  4PJL A;  4IOA F;  2W7N A;  3VYR B;  2DDB A;  4ABZ A;  2L7F P;  3PIP F;  3CLQ A;  1FLI A;  1R49 A;  3ZN0 A;  3K4J A;  4IO9 F;  1BI0 A;  3WE3 A;  3MZ8 A;  4UVB A;  1TWG J;  1FPQ A;  4CDG A;  3WGI A;  2MAB A;  1S9H A;  2F4M B;  2BY2 A;  4MEY F;  2VQC A;  4HNU A;  1GV5 A;  1T8I A;  3PQJ A;  5F6F A;  2VT2 A;  3CDH A;  4W1U A;  4HA8 A;  3WE2 A;  2KIU A;  2K7L A;  1WPK A;  4EJV A;  1OJL A;  2XAF A;  2OUM A;  1WWX A;  2QA4 I;  4V19 K;  2VQH A;  4MGR A;  3TKY A;  1TP4 A;  3I9V 2;  1A5J A;  2HOT A;  1LKX A;  1ZQ3 P;  3ZOB A;  4IHS A;  1MKM A;  3GO5 A;  2O8K A;  1GVD A;  3BWG A;  3S2W A;  2CW8 A;  3CMA I;  1ETV A;  2HNH A;  3ONQ A;  2XRO A;  1KYW A;  2CWE A;  5E1Z B;  4YIF A;  2XRL A;  5E1X A;  4CYD A;  4C2T A;  3J7A O;  3VYT B;  1NK2 P;  3LA3 A;  2HZT A;  3HGG A;  2IS4 A;  1E0E A;  1IRF A;  2JTV A;  2FML A;  4ZDO A;  3GVA A;  4BY7 J;  2CW7 A;  4E7Z A;  1T39 A;  3TGN A;  3CLO A;  1YOV B;  4BE2 A;  4DJA A;  3S1M J;  4RM3 A;  1T2K A;  2BVM A;  2VBZ A;  4L5E A;  3GZ5 A;  3JRC A;  2LOO A;  3TO6 A;  3CC2 I;  5D8L B;  4ZDL A;  5JLX A;  2M5W A;  3BZ6 A;  2QEN A;  4BQQ A;  5KCM A;  1UB9 A;  3MN2 A;  3FKJ A;  3LST A;  3G71 I;  5M3F J;  1N77 A;  3CME I;  3Q5F A;  5GTI C;  4RS8 A;  1DUX C;  1J2X A;  2LLK A;  2K9N A;  3HOW J;  4A0Y A;  3DLA A;  4GRI A;  3X2Q H;  4NNJ A;  3BLY A;  3ZQQ A;  3KYL A;  4G12 A;  5E3N A;  5EEA A;  1XMA A;  1H88 C;  5HLG A;  4YFK F;  2A6H F;  3IKV A;  3VEP A;  3G1M A;  2K85 A;  2GOX B;  2C6Y A;  4FE7 A;  3DXJ F;  1ZH5 A;  3HHG A;  3OSG A;  1U9O A;  2WV0 A;  2L5Q A;  2P8T A;  4N4O B;  4XOP A;  3VPR A;  4DGW B;  1OPC A;  2P6T A;  1HOM A;  3LOC A;  2XB0 X;  3QPS A;  1BI1 A;  1KQ9 A;  1ZR4 A;  4U7B A;  2EK5 A;  2QGU A;  2R7V A;  3SZT A;  1O3S A;  2E1C A;  2Y9Y A;  2R3S A;  2RAE A;  5FKN A;  1WJA A;  1X1B A;  2AQE A;  5F08 A;  5D5V B;  2PI0 A;  3HDD A;  1V5F A;  4CA0 A;  1IXC A;  2QLZ A;  5L3C A;  3CUO A;  5EEG A;  1GV2 A;  2PJP A;  4MLO A;  5F0C A;  5L3F A;  2KDZ A;  3PNY A;  2ESN A;  3DWL E;  1X1D A;  2L01 A;  2FUG 2;  1SAU A;  1BA5 A;  1ZGA A;  1MBF A;  3BR5 A;  1RET A;  2FOW A;  3VSL A;  2YR2 A;  1GT0 C;  3QPH A;  3TP0 A;  1DPU A;  4LG0 B;  1FWZ A;  4A3E J;  3S3O A;  4P55 A;  4S0H B;  2VKD A;  1ETK A;  1MW7 A;  2E36 A;  2FOK A;  3VDX A;  3JAM Z;  3FHZ A;  5CVV A;  4XN3 A;  1P4A A;  4PZJ A;  4BE0 A;  2VT3 A;  5IY5 H;  1IC8 A;  1Y8R B;  2PEX A;  1JKO C;  1LNW A;  3HYI A;  1XGN A;  1X2M A;  4QSH A;  5BOX A;  3H5N A;  2IGO A;  3H36 A;  3KP3 A;  3ZMZ A;  3JRD A;  3CMM A;  2E19 A;  2EFW A;  2GZW A;  1SFE A;  1UEL B;  4DZJ A;  2WAQ A;  4KT5 C;  1R5G A;  1MDM A;  4LLL A;  1TZL A;  2MW8 A;  3FM5 A;  1AU7 A;  5J4Y A;  2VKV A;  3RSN A;  3F23 A;  1JGS A;  3DP7 A;  3HOT A;  1HST A;  1LFU P;  4BNC A;  4QPQ A;  3PUF A;  2R7T A;  1N78 A;  3E0J B;  2QSH X;  4BHC A;  1IV8 A;  3QAH A;  3DEU A;  2MSY A;  3CCJ I;  2P5V A;  3HPG A;  3TMO A;  5IYD J;  4PJN A;  2EH3 A;  2Q2E A;  2I10 A;  1G8X A;  4BDZ A;  1FZP B;  3IV5 A;  1SD4 A;  3I3L A;  3K70 D;  1LFB A;  2OZ6 A;  3J81 Z;  3F8N A;  1WCM J;  3IH4 A;  4GXO A;  1YIT I;  1RPW A;  3ERE D;  2YU3 A;  3OOP A;  2PJR A;  3SYT A;  1G59 A;  5EJC A;  3F6V A;  4IHX A;  1XX5 A;  3PNT A;  1Z0X A;  4Z2Y A;  3K1M A;  3E5Q A;  3CD6 I;  3Q9S A;  2DA7 A;  2AHQ A;  3CCR I;  4BKX A;  3EET A;  4BJ6 C;  1FYM A;  3IHU A;  3PO2 J;  3GFM A;  1FBQ A;  1JUM A;  2VXD A;  4A3L J;  4XRS A;  2Y9Z A;  2AS5 F;  2M4K A;  4BHB A;  2DOE A;  4A5N A;  5HS9 A;  2O61 A;  2ZFU A;  2QSG X;  5D6E A;  2IXS A;  4JOM A;  1WH7 A;  2NVQ J;  3FMS A;  2V26 A;  3G4S I;  4RGU A;  3GTQ J;  4NHJ A;  2VON A;  1RES A;  4M3F A;  2E1N A;  4LMY A;  5IT3 A;  1QVU A;  1BW5 A;  4EJU A;  4U7D A;  3TL4 X;  4E7H A;  4A3G J;  3D5L A;  1ETO A;  4M9Z A;  3B6A A;  1TT0 A;  2R93 J;  1JJ6 C;  4HG2 A;  2W57 A;  2HFH A;  2M7B A;  1TQI A;  5HOD A;  3AG4 H;  1Y8Q B;  1WGX A;  3O6B B;  4JQF A;  2X51 A;  2QCO A;  3HRU A;  2XAU A;  1E2X A;  2LTP A;  4RMN A;  4A0Z A;  2L02 A;  2O0Y A;  3HL2 A;  2VOD A;  1HKT A;  5C4J J;  3ZCO A;  2R5Y A;  1VFC A;  4D9J A;  1TW3 A;  3GZN B;  3ABU A;  4IQ4 A;  4B8X A;  4PCQ A;  4HF2 A;  2EB7 A;  3FF5 A;  4AYB A;  1UG0 A;  1V4R A;  1K61 A;  1HSJ A;  2N8G A;  2X6Y A;  4DZP A;  2V79 A;  5FKO A;  2ME0 A;  2M45 A;  2ACJ A;  1W36 C;  3ISP A;  5IP6 A;  4ANJ A;  3WTT C;  2BY0 A;  5HDN A;  1R5H A;  1Z7L A;  1LQ1 A;  4D7M A;  2D1V A;  4XID A;  1J09 A;  4IEJ A;  3HZJ A;  2EV0 A;  2GA1 A;  3W3C A;  4G7Z F;  1VQM I;  3RKX A;  1D8J A;  2XKO A;  1WQ2 A;  2FRH A;  4XKV A;  5F1R A;  4U87 A;  3H92 A;  1VQ9 I;  3HRM A;  1MBH A;  1Y1W J;  4OU0 A;  5CVU A;  5IT9 K;  2OTL I;  1UST A;  1A36 A;  3F9K A;  4HDV A;  5LD2 C;  4LD5 A;  2WV1 A;  2DQR A;  2NOJ B;  4Q48 A;  1YQA A;  2NXN B;  5DS9 A;  1YS6 A;  3BJA A;  3FWE A;  5CQG A;  3GLL A;  2ZME C;  1RC9 A;  2ZNY A;  4L9J A;  1RKT A;  1S8N A;  1YW9 A;  3RPU D;  3C1D A;  3GBG A;  3BZK A;  5M3M J;  4ZYE A;  3HTS B;  2ZXJ A;  3S93 A;  1L3L A;  1AOY A;  5AON A;  1GVJ A;  2WB1 N;  2BEO A;  2Y30 A;  4MFD A;  5LBQ A;  2QSF X;  4IVN A;  3E5X A;  2W24 A;  5CVJ A;  4RAZ A;  1Z6T A;  4HQE A;  1B4A A;  2LC2 A;  1HQC A;  2CW0 F;  1ZLK A;  1K6Y A;  3VOE A;  1JXS A;  1HXD A;  5FLV A;  2RN7 A;  3CF5 F;  3OYI A;  4I0A A;  1IG7 A;  3D5R C;  1BI2 A;  1DPR A;  2QF7 A;  3JRB A;  2FEZ A;  4D0P A;  2DA2 A;  3HOY J;  2K4J A;  3BTL A;  4IRG A;  2LF8 A;  2CV2 A;  3S2D J;  3ZQF A;  2KLO A;  3IWF A;  1FX7 A;  4NBQ A;  1A6I A;  1QHG A;  3BPV A;  2CSO A;  3KIO A;  4AUX A;  2V4J C;  4ENN A;  4QIW N;  2KRF A;  2JA2 A;  4ZTF A;  4RGS A;  2DOA A;  2DMT A;  5M5Y J;  1IF1 A;  5HLH A;  2EA4 A;  2DK5 A;  1TW2 A;  3LWF A;  3WG9 A;  2YUS A;  3CZ6 A;  3S15 J;  2MH9 A;  1LJ9 A;  4F55 A;  1Y56 A;  2DU9 A;  3DCF A;  5E3L A;  2CG4 A;  2FSW A;  4NUB A;  2MLK A;  3CJN A;  1O3R A;  1S5L C;  1BIA A;  1WVR A;  1GUU A;  1S29 A;  2A69 F;  3A02 A;  5H20 A;  1UAA A;  2DFH A;  3GTP J;  3M7G A;  1JHF A;  5F1J A;  5DD8 A;  5K5R A;  1K78 B;  4A3D J;  3CUQ A;  5K7Z A;  5HLT A;  4FIS A;  2A6T A;  3OIO A;  3CCV I;  1O7L A;  2HU9 A;  1MMG A;  2KIF A;  4MHG A;  2DMP A;  2HTJ A;  3V7C A;  3JRG A;  2YU9 J;  3L00 A;  3AAF A;  3IL2 A;  1DGW Y;  1SVO A;  2MLG A;  3T5X A;  4OIQ F;  4HV5 A;  1ACI A;  2E34 A;  2QEX I;  1GHC A;  1ETW A;  1MSE C;  5TIS C;  1P7I A;  1SAX A;  5H6R A;  3BP8 A;  4ON0 A;  3WTW C;  1V54 H;  4HRI A;  2OA4 A;  1YFH A;  3A0H C;  2MA3 A;  2OV7 A;  5JI6 A;  4BJ5 C;  1W0U A;  4Q4Z F;  3W2A A;  3RKW A;  5J1Y A;  2HWV A;  2K3F A;  3E1S A;  4A2U A;  2BYV E;  2BOL A;  1FT9 A;  2PG4 A;  3C18 A;  2DO7 A;  3OV8 A;  1P7J A;  5ICE A;  1LVA A;  3EUK L;  2OZU A;  2CUE A;  3HPH A;  5ILS A;  1R4M B;  2JK3 A;  3QU3 A;  2CUZ A;  2STT A;  3WHB A;  3LFU A;  3I53 A;  1NH3 A;  5KK1 A;  1MJ9 A;  2CUF A;  2JA6 J;  1QQI A;  3M8E A;  3LSM A;  3ZN1 A;  3BCA A;  3I5U A;  2WBM A;  2VBY A;  3EUH C;  2WAF A;  2E2I J;  3FHN A;  1KQ8 A;  1W5T A;  2RGV A;  3DPT A;  2KT0 A;  2VAS A;  3T1B A;  3IAM 2;  1R9T J;  2EZK A;  2EFO A;  2W82 A;  3ECH A;  2UXX A;  5L3D A;  2IA0 A;  2UXN A;  2KHM A;  2Z9O A;  4XRF A;  3SXY A;  3L2C A;  1MBJ A;  1WJF A;  1IGN A;  2MD5 A;  1OQY A;  4E70 A;  1LDK B;  4ENJ A;  4M73 A;  3VSK A;  1TBX A;  3JSO A;  3AL0 B;  2CH0 A;  3ERM A;  1VQL I;  2TRT A;  2DA5 A;  2W4S A;  3CDI A;  4PGH A;  3TOB A;  3BR3 A;  3ZQG A;  1B9M A;  2P81 A;  2O7O A;  2K4B A;  1P92 A;  2CGP A;  1XD7 A;  2CJJ A;  3HKZ N;  3SJM A;  2JVH A;  2ZNZ A;  2KDO A;  3I55 I;  1DQU A;  2FBK A;  2VN2 A;  1W7P B;  4OIO F;  2R92 J;  1Y1V J;  1U5T B;  4RB2 C;  4AIJ A;  3MZH A;  9ANT A;  4HST A;  5LFA A;  2XAS A;  3PSF A;  1OCZ H;  1KGS A;  3HUG B;  4G6Q A;  4L9V A;  2NNN A;  4RB0 A;  1D3Y A;  4XM3 A;  4PK4 A;  1REP C;  1WJ5 A;  4FE4 A;  3KP2 A;  4AWX B;  4YEJ A;  5E18 F;  1MJB A;  4PSX A;  3K70 C;  1T0F C;  5E3M A;  4B3X A;  4B44 A;  2L0K A;  1YJN I;  4A3I J;  3TP3 A;  4AU7 A;  3ZMS A;  1S6L A;  5AIQ A;  4DOZ A;  3IAS 2;  1I3A A;  1M1E B;  2BW3 B;  3KEO A;  2L9S A;  4DYR A;  2EFP A;  4RGX A;  2IP2 A;  4N4N B;  2IA1 A;  5DCM B;  4MIM A;  1O57 A;  1WFX A;  1Z91 A;  4IZZ A;  3LL7 A;  1QVT A;  2F5E A;  4RLF A;  2DTR A;  2M0C A;  2DT6 A;  2XV4 S;  4U0W A;  4I2O A;  3BR6 A;  3GX4 X;  1HKS A;  2BXY A;  4C9Y A;  5FKL A;  4M6Y A;  4ZJZ A;  1ETX A;  4AD9 A;  2Y69 H;  1RUO A;  1ENH A;  3ZPL A;  1DP3 A;  2XVC A;  4KUM A;  1XN7 A;  2DK8 A;  3BG6 A;  2DW4 A;  2E1M B;  1X3Z B;  2VJ5 A;  3GME A;  3ABT A;  3IRQ A;  2DOF A;  3S17 J;  4NDL A;  1QHH D;  1OMI A;  4OIN F;  4JBA A;  2ZCW A;  3LSH A;  4LIV A;  3HHH A;  5KVR A;  1AHD P;  4KIG A;  4PJJ A;  3ZQI A;  1IZ1 A;  4X1E A;  3ZRG A;  1WKM A;  3IP4 B;  2X0L A;  1ZR2 A;  1NTC A;  2P7V B;  1FMV A;  3DKW A;  3N05 A;  4F52 A;  1YS7 A;  4Q47 A;  3HSR A;  2QQA A;  4NQW B;  1TWC J;  2R7S A;  2IS1 A;  1IXR C;  4Y33 A;  4BL0 B;  1YE9 A;  2Y75 A;  3VYU B;  1SC7 A;  2W84 A;  5LGT A;  4E7K A;  4KYW A;  5BMZ A;  3QOE A;  5LHG A;  1OCP A;  1XMK A;  1X19 A;  1LFP A;  2WY7 Q;  2NVT J;  3R60 A;  1T98 A;  2F6C A;  3ZMU A;  2Z3Y A;  3FXK A;  3LSI A;  3CQZ J;  2CFO A;  2HI3 A;  3V8J A;  4EEF G;  2W48 A;  2FQ3 A;  4BHP A;  4FAS D;  2M2E A;  4I99 C;  2X4H A;  4BS9 A;  3TDZ C;  3W6J B;  3S32 A;  1S72 I;  2LNB A;  2IS2 A;  2O03 A;  2OAZ A;  3C7J A;  3EQL F;  1NHA A;  1X4P A;  3MD2 A;  2IS6 A;  2BHZ A;  4DNC A;  2DT5 A;  3LQR A;  1MMD A;  3CCU I;  4CCJ A;  2A5W A;  1ZAR A;  4OMZ A;  1HKQ A;  2FU4 A;  2K5C A;  1MMA A;  3JCU C;  4BXU A;  3J80 Z;  3OYK A;  4BAC A;  4MEX F;  3DBR B;  2L4A A;  3CP8 A;  4E6K G;  1ITY A;  3OL4 A;  4IL6 C;  2DPU A;  1J0R A;  1OYW A;  2F4O B;  5HDK A;  2YS9 A;  2KRC A;  3CMY A;  1JI8 A;  5D5X B;  4N9H A;  3BC8 A;  3CO7 C;  4B43 A;  1BBY A;  1ZLJ A;  3GTK J;  2YX7 A;  4RM2 A;  3QYB A;  3ML6 A;  4XOR A;  4BGD A;  2O3F A; 
#chains in the Genus database with same CATH homology
 3HOX J;  1AU7 A;  1FTZ A;  4M3G A;  2FD5 A;  2CRG A;  2VKV A;  4A93 J;  2X48 A;  1JT6 A;  4BBS J;  1LFU P;  3L1P A;  3HOV J;  2Y0S N;  1TWA J;  1MNM C;  1AKH B;  5IYC J;  3FKI J;  3OSF A;  1VND A;  1B8I B;  2K9Q A;  2MSY A;  1FIP A;  3HEF A;  5IYD J;  2EH3 A;  1VF9 A;  3NAR A;  5C3E J;  2CU7 A;  2EQR A;  1U8B A;  2I10 A;  4M3D A;  2L9R A;  4JX6 A;  3IV5 A;  2XPV A;  1F43 A;  3BTI A;  1LFB A;  2H8R A;  5M5W J;  4A69 C;  1WCM J;  3IH4 A;  1RPW A;  3Q0V A;  3JRA A;  3S16 J;  3CDL A;  5EGO A;  3RZD J;  4CYC B;  3GTO J;  4B3A A;  2EZL A;  5M5X J;  4IHX A;  1JKQ C;  1Z0X A;  1XS9 A;  2DA7 A;  2AHQ A;  3B6C A;  3BQY A;  2NVY J;  4BKX A;  3IH2 A;  3PO2 J;  2HQ5 A;  1JUM A;  1G2H A;  4A3L J;  4XRS A;  2Y9Z A;  4BY1 J;  2LKX A;  1DU0 A;  2LK2 A;  4C2M J;  1WH7 A;  2NVQ J;  3QQA A;  4IHW A;  5J1U A;  5GPA A;  2JWT A;  1JJ8 C;  3GTQ J;  2IAI A;  2MGQ A;  1RES A;  4M3F A;  5GPC A;  1TWF J;  1QVU A;  5BNG A;  1BW5 A;  2XGC A;  1TWH J;  4A3G J;  1ETO A;  3FK6 A;  2LD5 A;  3B6A A;  2XSD C;  2ID3 A;  4D5C A;  4UUS A;  4XRS G;  2DMQ A;  2R93 J;  1JJ6 C;  3GTM J;  3MVP A;  5K7F A;  5HOD A;  3PM1 A;  2JN6 A;  2XB5 A;  1WGX A;  1MBE A;  5EG0 B;  2QCO A;  1QPI A;  2LTP A;  5J1R A;  2GM4 A;  3DEW A;  5C4J J;  4QTR A;  2R5Y A;  2LY9 A;  1VFC A;  4MFE A;  3ZQL A;  5EYR A;  1I50 J;  3BR0 A;  4XRM A;  2JA7 J;  4DW6 A;  3LSP A;  5C44 J;  1K61 A;  3S2H J;  3Q3S A;  4A3B J;  2E1O A;  2N8G A;  4DZP A;  5FKO A;  3BQZ A;  3ZQH A;  2ME0 A;  4D7N A;  5IPA A;  2JMW A;  2HOA A;  3QPL A;  2HDD A;  2OPT A;  3GTL J;  2DA3 A;  2E2J J;  3GTG J;  5IP6 A;  4A3C J;  1ORK A;  1ETY A;  4D7M A;  1U78 A;  4XID A;  4IEJ A;  2D5V A;  4RBO A;  2ECC A;  1EF4 A;  5C4X J;  5DTD A;  3FIW A;  3LSJ A;  3I4M J;  2NS8 A;  5FKK A;  2WAQ N;  3TW7 A;  2OF7 A;  4Y7N J;  1MBH A;  1Y1W J;  3LSR A;  5EGO B;  2WV1 A;  1W0T A;  2FQ4 A;  2COB A;  4HNV A;  2R7Z J;  4JX4 A;  3W6V A;  2IBD A;  2CQQ A;  5DS9 A;  2L7M P;  1BW6 A;  5FLM J;  1HLV A;  3WHC A;  5F04 A;  1HCR A;  2Y2Z A;  4C3J J;  1RKT A;  2XGE A;  2EBI A;  2FX0 A;  3OOU A;  3HB9 A;  3GBG A;  5M3M J;  2H1K A;  3H3V K;  1IRZ A;  2DA1 A;  1JKR C;  4V2F A;  2WB1 N;  3SFI A;  2Y30 A;  2K40 A;  2HXO A;  4IHY A;  4MFD A;  1BJZ A;  3FIS A;  1B72 A;  3JRH A;  1H8A C;  1MSF C;  2DA6 A;  3C2B A;  3JRI A;  1ZK8 A;  1T33 A;  4I76 A;  4V2G A;  1QRY A;  3LNQ A;  3BG3 A;  3BTC A;  3HOZ J;  5FLV A;  2LP0 A;  1YRN A;  1IG7 A;  4UUS B;  2QF7 A;  3JRB A;  2DA2 A;  3IH3 A;  3HOY J;  1UHS A;  3CCY A;  3BTL A;  3S2D J;  1RKW A;  3G1O A;  2X9D A;  3ZQF A;  1A6I A;  2HXI A;  2LFB A;  3BR2 A;  3BG9 A;  4AUX A;  1HDP A;  4B4C A;  4QIW N;  2MG4 A;  2M34 A;  2DMT A;  5M5Y J;  2R5Y B;  3PO3 J;  2YUS A;  2G0E A;  3S15 J;  4M6V A;  2DA4 A;  2DMU A;  1H89 C;  2JA5 J;  3DCF A;  5J3L A;  4MO7 A;  5E3L A;  4GFB A;  5E3O A;  4X6A J;  3O8H A;  2DN0 A;  2LR8 A;  3A02 A;  1GUU A;  1XC5 A;  1TC3 C;  5IOY A;  3F0C A;  3GTP J;  5F1J A;  3A01 B;  2K9S A;  4A3D J;  1MH3 A;  3JR9 A;  5K7Z A;  1GDT A;  3E7L A;  4FIS A;  3OIO A;  3M3Y J;  4XIC A;  5GP9 A;  1JT0 A;  3K7A J;  5IYB J;  2XGD A;  2DMP A;  3JRG A;  2YU9 J;  4A3K J;  1U9N A;  4D5F A;  2FJ1 A;  4C3I J;  1F36 A;  1ETW A;  1MH4 A;  1MSE C;  3BTJ A;  4AYB N;  4JP0 A;  1VI0 A;  1P7I A;  5EZG A;  1FEX A;  2M9H A;  2XPW A;  1Q1V A;  2DTZ A;  1D5Y A;  2ME6 A;  1S7E A;  1PUF B;  3G1L A;  4I6Z A;  1JTX A;  5IP7 J;  1W0U A;  4LOC A;  4A3M J;  5J1Y A;  2HYJ A;  3LSG A;  1OFC X;  5FKM A;  1FTT A;  1B72 B;  1MBK A;  1K83 J;  1P7J A;  1XG1 A;  1JUP A;  2CQX A;  2GLO A;  1BL0 A;  1JGG A;  2CUE A;  2NVX J;  2JK3 A;  3Q0W A;  1YRN B;  4W97 A;  1IUF A;  3WHB A;  1FIA A;  5IOZ A;  2O9L A;  1HF0 A;  1ZGW A;  4UUT A;  2CUF A;  2JA6 J;  3A01 A;  2EZI A;  1NK3 P;  1SAN A;  3UKG A;  1IV6 A;  2E2I J;  1HDD C;  2ECB A;  1T56 A;  3RZO J;  3TED A;  2KT0 A;  4M3E A;  3JRE A;  1R9T J;  2EZK A;  3TW6 A;  2DMN A;  3H0G J;  2NS7 A;  2TCT A;  1MBJ A;  1PUF A;  1IGN A;  3BR1 A;  2HOS A;  4BBR J;  3A03 A;  1RR7 A;  1IJW C;  3FK7 A;  4AC0 A;  1IDY A;  1SFO J;  2TRT A;  3RKQ A;  2DA5 A;  2LVS A;  3BR3 A;  2EZH A;  3ZQG A;  2P81 A;  2L7F P;  2Y31 A;  4ABZ A;  2O7O A;  2XPU A;  1I3Q J;  2CJJ A;  3HKZ N;  3S1N J;  3SJM A;  2VUM J;  5F27 A;  3MKL A;  1TWG J;  3O8G A;  5JLW A;  2R92 J;  1Y1V J;  1GV5 A;  1WH5 A;  1ETQ A;  4W1U A;  4JYK A;  1OCT C;  9ANT A;  1WPK A;  1OJL A;  5F0F A;  1POG A;  4JX5 A;  1A5J A;  2HOT A;  4FE4 A;  3SDG A;  3ZOB A;  1ZQ3 P;  3NAU A;  2O8K A;  1GVD A;  5E3M A;  1ETV A;  1LE8 A;  2L0K A;  2JA8 J;  1FJL A;  4A3F J;  4A3I J;  3TP3 A;  2XRL A;  1X2N A;  1NK2 P;  2R5Z A;  3HGG A;  4DYR A;  2GBY A;  4MIM A;  3HBL A;  4C3H J;  2B63 J;  3M4O J;  3GTJ J;  4BY7 J;  1QVT A;  2M0C A;  4IHV A;  3S1M J;  5F0H A;  4FTH A;  4L5E A;  3BR6 A;  3JRC A;  5FJ8 J;  3BT9 A;  3Q0U A;  5JLX A;  5FKL A;  3MN2 A;  2M8G X;  5M3F J;  1JKP C;  1ETX A;  1E3O C;  1ENH A;  3HGY A;  2LLK A;  1UMQ A;  2K9N A;  3HOW J;  5IP9 J;  5K7H A;  4J19 A;  2VI6 A;  4G12 A;  5E3N A;  5EEA A;  1H88 C;  4Y52 J;  4M3B A;  3S17 J;  4NDL A;  1APL C;  4A3J J;  3G1M A;  4RDU A;  1AKH A;  1B8I A;  4FE7 A;  1MBG A;  1AHD P;  3D1N I;  3S1R J;  2VKE A;  1I6H J;  3ZQI A;  4X1E A;  3OSG A;  1U9O A;  3HM5 A;  3K2A A;  1ZR2 A;  3VPR A;  1NTC A;  1HOM A;  3LOC A;  2XB0 X;  1X58 A;  3QPS A;  1ZR4 A;  1TWC J;  4BXX J;  2DJN A;  1Z77 A;  2Y9Y A;  2ELK A;  3JRF A;  2RAE A;  5FKN A;  2NOG A;  2X6O A;  5F08 A;  4CYC A;  4FCY A;  3HDD A;  1OCP A;  1DU6 A;  3S14 J;  3S1Q J;  1GV2 A;  2NVT J;  4MLO A;  5F0C A;  3CQZ J;  2HI3 A;  5EDN A;  2KDZ A;  4EEF G;  2W48 A;  2M2E A;  1BA5 A;  1LE8 B;  1JTY A;  1MBF A;  3BR5 A;  1RET A;  1WI3 A;  4DYC A;  1GT0 C;  3TP0 A;  3HOU J;  3ZQC A;  4A3E J;  1JUS A;  2ZB9 A;  4S0H B;  3I4N J;  2JJ7 A;  2R5Z B;  1ETK A;  3BG5 A;  1UG2 A;  2ID6 A;  1IC8 A;  5EF6 A;  1ZKG A;  3RQI A;  1CQT A;  1JKO C;  1ITY A;  1IDZ A;  2PMZ N;  2AO9 A;  1O4X A;  1X2M A;  4B1R A;  4DYQ A;  4QSH A;  2YS9 A;  5EZH A;  3CMY A;  4XK4 A;  2L7Z A;  3JRD A;  2E19 A;  2E2H J;  2IEK A;  2VPR A;  3GTK J;  4DZJ A;  2R0Q C;  1ZTR A;  5EG0 A;  2MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...