2MSYA

Solution structure of hox homeodomain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
ANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the interaction between the Hox and HMGB1 and understanding of the HMGB1-enhancing effect of Hox-DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Homeobox protein Hox-C9
total genus 16
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2msyA00
3A02A 2XB5A 2MSYA 5JLXA 3JRFA 4FCYA 4DZJA 2JWTA 1ZKGA 2ME0A 3UKGA 1BW6A 1X2NA 3TP0A 3ZQHA 1IJWC 2LFBA 1LFBA 2WAQN 3IH2A 1FTZA 2DMPA 1ENHA 1OCPA 2TRTA 3IV5A 4FTHA 1JKOC 2NVTJ 2RAEA 3ZQIA 5FKOA 4W97A 4J19A 1VF9A 5K7FA 2X48A 2ME6A 2HYJA 4AC0A 1NK2P 4FE7A 3DCFA 5K7HA 1B8IB 3MVPA 1ZTRA 2L7FP 3BT9A 4B4CA 1QRYA 3JREA 2HDDA 2XGEA 2NS8A 5IYDJ 1AU7A 4UUTA 2K40A 3LSRA 5J3LA 4X6AJ 4A3FJ 3BR5A 2DMUA 1WH7A 2VUMJ 1JTXA 1BA5A 5EEAA 1JUPA 2LP0A 2L7ZA 1X58A 3GTPJ 4C2MJ 3NAUA 2DA7A 4QIWN 3H0GJ 5E3LA 2TCTA 4XRSG 2LTPA 1XS9A 1W0UA 1JKPC 2NVQJ 1TWFJ 1FIAA 4UUSA 1MBJA 3GBGA 2VPRA 3M4OJ 1FEXA 3BG3A 2YS9A 4XRSA 4Y7NJ 2DA4A 2HOTA 1MBEA 1RKTA 1DU0A 5FLVA 1RETA 3BR6A 3B6AA 2O8KA 1E3OC 2CJJA 2DMTA 3OSGA 1B8IA 1OCTC 2E2IJ 2FJ1A 1ZGWA 2K9SA 2LK2A 4DZPA 2DA2A 4V2GA 2M8GX 2R5YA 2EZLA 3JRBA 1EF4A 1FTTA 1G2HA 3TW7A 2Y2ZA 3S1NJ 4AYBN 2ECCA 3QPLA 5DTDA 2FD5A 4HNVA 1BJZA 1MBKA 4MO7A 1XC5A 2O9LA 3HGGA 4XIDA 1VNDA 2AHQA 4DYRA 1YRNA 1HDPA 2R7ZJ 3I4MJ 3TP3A 4BBSJ 1TWHJ 1A6IA 4DYCA 4UUSB 2HQ5A 2Y31A 1NTCA 5F08A 5BNGA 3JRCA 3F0CA 4IHVA 3W6VA 3S1RJ 5EF6A 3D1NI 1YRNB 1IUFA 1JKRC 3FK7A 4BBRJ 5EG0B 3A01B 1QVUA 4FE4A 4XICA 3OSFA 1CQTA 3BQZA 3TEDA 2X9DA 5HODA 1HLVA 4XRMA 1GVDA 1AKHB 1AHDP 2XGCA 3OOUA 1LE8A 3S2HJ 1Z0XA 5FJ8J 1HCRA 4B1RA 5IP7J 4BKXA 5F0CA 2HXOA 1IGNA 2JK3A 2DMNA 3I4NJ 4MIMA 5EDNA 3HB9A 3WHCA 4A3LJ 5K7ZA 2D5VA 1ETOA 5IOYA 3BTLA 5DS9A 5F0FA 1HDDC 1OFCX 3B6CA 3HOZJ 3H3VK 3CCYA 5EGOA 1F36A 1UG2A 5FKNA 2DN0A 1H88C 3FKIJ 4M6VA 1GV2A 3O8GA 3Q0VA 2LLKA 4IHXA 2LVSA 2MGQA 2JA7J 3LSGA 1MBGA 4JX5A 3MKLA 4A3JJ 1ORKA 2DA1A 1JT0A 2CQXA 4Y52J 5J1RA 3JR9A 2R93J 3JRGA 3M3YJ 1ITYA 1APLC 1ETQA 5FKLA 3GTOJ 2EZKA 2HI3A 5GP9A 1VFCA 4D7NA 1JGGA 1SFOJ 4A69C 3HOXJ 2DJNA 5EZHA 2VKVA 4A93J 3BTIA 2WV1A 3BTCA 1JUSA 2PMZN 1JJ8C 3A03A 3G1MA 5GPAA 1Q1VA 4C3JJ 1GUUA 1TWCJ 5FKKA 1QPIA 3HOVJ 2EQRA 2DA3A 4ABZA 2NOGA 4EEFG 3GTMJ 2DMQA 1NK3P 3FISA 3BR0A 3SFIA 2Y9YA 3G1OA 1Z77A 2ECBA 5E3OA 2M9HA 4MLOA 1ETKA 3L1PA 3CMYA 1P7IA 2FX0A 4X1EA 1MBHA 3PO2J 1OJLA 2CU7A 5IP6A 1JJ6C 2IEKA 5FLMJ 1POGA 1Y1VJ 3HOWJ 1WPKA 4B3AA 5GPCA 2ELKA 3HEFA 2R92J 1MSFC 1QVTA 2JA8J 2VKEA 2JA5J 1RKWA 3SJMA 2LR8A 1ETXA 3HDDA 1WH5A 4A3DJ 1D5YA 1R9TJ 2NVXJ 4W1UA 3ZQFA 1GV5A 3BR2A 4JP0A 1GDTA 2MW8A 2COBA 2Y0SN 4JYKA 2JJ7A 1ZR4A 3S15J 3S17J 5C4JJ 5FKMA 2R5ZB 2NVYJ 3GTLJ 2XRLA 1MH4A 3QPSA 4C3IJ 4JX4A 3O8HA 3HOYJ 4G12A 4A3EJ 1FJLA 1PUFA 4MFEA 1H89C 2M2EA 5EZGA 5F04A 2KDZA 1IDZA 1ZK8A 3OIOA 3DEWA 2EZIA 3RKQA 5M3FJ 5C4XJ 3JRAA 1U8BA 4FISA 4C3HJ 3ZQCA 3GTKJ 1B72A 2LY9A 3BTJA 4AUXA 2H1KA 3VPRA 4A3CJ 3HGYA 3NARA 3Q3SA 3C2BA 1UHSA 5F27A 3FK6A 3SDGA 2X6OA 1W0TA 2N8GA 1ETYA 2M34A 3HBLA 5F1JA 1IC8A 9ANTA 2XPVA 4I6ZA 1A5JA 3BG9A 2IBDA 3S1MJ 4BY1J 2CUFA 2JA6J 5IP9J 1I3QJ 2R5YB 2XB0X 3S1QJ 3BR1A 2XPUA 1ZR2A 3Q0UA 1ZQ3P 3JRDA 1WGXA 5C3EJ 2GM4A 4M3GA 2DTZA 1F43A 2MG4A 2EBIA 2XSDC 4M3FA 5IYBJ 2OPTA 2WB1N 3LSJA 4JX6A 4RBOA 3HOUJ 3RQIA 3LNQA 2W48A 2Y30A 1IDYA 4CYCB 1X2MA 2O7OA 1XG1A 2ID3A 1WI3A 2VI6A 5EGOB 1U9NA 3BQYA 4BXXJ 5E3MA 1U9OA 3S16J 2HOAA 2HXIA 1MBFA 4M3DA 1K61A 1MNMC 4D5FA 2YU9J 4IHYA 2IAIA 2ZB9A 2I10A 4XK4A 4DYQA 5M5XJ 3WHBA 3PO3J 2EH3A 2ID6A 3QQAA 1U78A 1FIPA 2R0QC 1JKQC 1HF0A 2XPWA 4CYCA 3LSPA 1T56A 4A3GJ 1UMQA 1P7JA 2CRGA 2KT0A 3E7LA 3FIWA 2NS7A 3Q0WA 5E3NA 4RDUA 2DA5A 1K83J 4A3IJ 3BR3A 3LOCA 2EZHA 2JN6A 1B72B 3CQZJ 3CDLA 1T33A 2K9NA 2QCOA 2AO9A 2G0EA 3GTQJ 4BY7J 1RESA 2CUEA 2H8RA 1H8AC 2E1OA 2L9RA 2M0CA 5M3MJ 4IEJA 1GT0C 3GTJJ 3HM5A 1IRZA 1TWAJ 1IV6A 3GTGJ 4DW6A 4A3MJ 4NDLA 4LOCA 2QF7A 5J1UA 1WCMJ 5M5YJ 4M3BA 1RR7A 2GBYA 1MSEC 1IG7A 3ZOBA 1PUFB 1ETWA 2YUSA 1SANA 1VI0A 5IPAA 1I6HJ 3PM1A 3TW6A 4I76A 2HOSA 1RPWA 1JTYA 3JRHA 1JT6A 1MH3A 1AKHA 3A01A 3JRIA 2LD5A 2P81A 4L5EA 5IOZA 5JLWA 5M5WJ 4A3KJ 1JUMA 5EG0A 2E2HJ 4D5CA 2LKXA 3S2DJ 3BG5A 1TC3C 4V2FA 1Y1WJ 3IH3A 2XGDA 2JMWA 4A3BJ 2DA6A 4QTRA 2Y9ZA 2B63J 2L0KA 4S0HB 2K9QA 2R5ZA 4IHWA 5J1YA 2E19A 2L7MP 3IH4A 2CQQA 5EYRA 5C44J 3S14J 4M3EA 1LFUP 1DU6A 3K2AA 3G1LA 1BW5A 3HKZN 1HOMA 1LE8B 5IYCJ 2FQ4A 4D7MA 2E2JJ 3ZQGA 1ETVA 1I50J 3K7AJ 1O4XA 1TWGJ 3RZDJ 4QSHA 2GLOA 2OF7A 4GFBA 1S7EA 3ZQLA 1BL0A 3RZOJ 3MN2A 5F0HA 4MFDA
chains in the Genus database with same CATH superfamily
5E79C 3A0HC 2XB5A 2MSYA 3TKYA 5JLXA 4A6DA 4CDGA 5KCMA 2W00A 4DZJA 4ENMA 3G2BA 1J9IA 2W24A 2E7WA 4HF0A 3JSOA 2X85A 3KYCB 1R36A 2VOOA 1LFBA 2VJJA 5FFXA 5B3SH 3N4MA 5CLSA 2CWEA 1ENHA 1OCPA 2BW3B 3M9AA 2A3SA 1JHHA 1NH3A 4LK0F 3W3CA 4XOPA 2C6YA 1VF9A 2GZWA 5KHDA 4O6JA 4H0EA 3DU6A 4CZZA 1TNSA 2HYJA 3F9KA 2JRMA 1PDNC 4WCGA 1HBXG 1TZLA 4K2EA 4B4CA 1YW9A 1ZELA 1B59A 3DKYA 5KAFC 2NS8A 3JAMK 3I59A 4XKBA 1HSTA 1LDJA 2DMUA 2XF7A 1XPXA 3IAS2 1ACIA 5EEHA 1XSXA 3BJ6A 5H20A 3WG9A 5DDGA 4WK8F 2LP0A 4EVIA 1IZ1A 3GTPJ 4KUMA 3OV8A 5DUKA 4C2MJ 3MZ8A 2EFWA 4QPOA 2TDXA 4EQQA 2LTPA 1XS9A 1W0UA 4EM2A 2M1BA 3QAHA 1MBJA 4AVZA 4XL9A 3GBGA 1U8RA 3C3WA 3EDPA 3OR1C 5DCFA 2YS9A 3E6CC 2Z1DA 2A5WA 2PX9A 4AIHA 2XIGA 2QSGX 2E1MB 4ZTFA 2O8KA 2DI3A 4WXCA 1B8IA 5EJCA 5HLIA 1LUJB 3GYHX 4HA8A 2R5YA 3JRBA 3B73A 1IXSB 1FTTA 3CCLI 4BAYA 3QOPA 4A5MA 1HSJA 1CF7B 3HTSB 3U1KA 1O3SA 5DTDA 3VEPA 2KISA 3RJPA 3LFUA 5ED4A 4AM3A 1ERDA 2O0YA 4MO7A 2AQEA 4NC8A 1XC5A 4GCVA 2AHQA 4CSWA 2IGMA 4XN3A 2BOLA 2R7ZJ 3ROUA 2ISZA 3TP3A 1TWHJ 3LL7A 3OR2C 2HQ5A 2VJ4A 3K4LA 5F08A 1XDSA 4ZYDA 2H1LA 3HPGA 4Q48A 3S1RJ 2EJRA 1VQ8I 3L2CA 1IUFA 5A2QZ 2PJRB 2AS5F 3G71I 1V55H 3T5XA 4Q5SF 2K9LA 3A01B 1QVUA 2XDVA 3OSFA 2FBKA 2FE3A 1UJ8A 5F6FA 4XMYA 2MFZA 2O3FA 3E1SA 2X9DA 1SFKA 3OYCA 3HSEA 3EUHC 1VQKI 4XRMA 1GVDA 2HQAA 3GLXA 3I56I 2VT2A 2GA1A 4D1QA 1LE8A 3GZNB 2QWWA 5CVRA 2ELJA 3RPQA 1HCRA 3EPZA 2MABA 3AL0B 2VE8A 3SXYA 1QNTA 4EMSA 2QLZA 2ACJA 2HS5A 3HJEA 3IP4B 1T08B 3ZN1A 4BYYA 1RIOH 1IGNA 4L0YB 2DMNA 2A6EF 4MIMA 5EDNA 3DLLF 4IPAA 5K7ZA 3FM3A 3DKWA 2HU9A 2LBFA 3BTLA 5DS9A 1Z91A 3N05A 1OFCX 1Z3XA 3M07A 3P9IA 3ESWB 4MNUA 1WKMA 5LEJA 3FDYA 1ZG3A 1GV2A 3Q0VA 2ZXHA 1D0YA 2JPCA 3F6VA 1FWZA 5L3GA 3X2QH 4JX5A 2DA1A 4LLLA 3S3OA 3O2PE 5J1RA 3AL0C 3JRGA 3M3YJ 1APLC 1YW7A 2E1NA 4O3MA 2OTLI 2Q2EB 2EZKA 3SYTA 3F23A 3GMEA 2EA4A 2PN6A 2NNYA 1VFCA 4LGWA 4A69C 2BHYA 3LFKA 3HOXJ 2DJNA 3NWTA 3R0AA 2GWRA 3GFMA 3K69A 1OCRH 2WV1A 2XKOA 3BTCA 2PMZN 5FD6A 2FRHA 2XF6A 3A03A 3G1MA 5GPAA 1QPIA 3CDIA 1T39A 4Z6YA 4XLPF 2H94A 3ASOH 1FX7A 1ONVA 1IXRC 3KP3A 4XKVA 1QHHD 3CP2A 2ZMEC 2JVHA 3P9CA 2ZNZA 2QA4I 2ZFWA 4E7IA 3FISA 4HF2A 4HX8A 2CQNA 4ZZLA 2G7HA 4BXUA 3ZQ7A 3J7YJ 4BE2A 1S5LC 1TT5B 3RKWA 2M9HA 2UWMA 4MLOA 2MA3A 4XQFA 1KQ9A 3U2RA 3CMYA 2FX0A 5D4RA 4CHUA 4LJZF 3OYEA 1B9NA 4XRFA 2L54A 4DOZA 5GTHC 5FLMJ 3CUQB 4L0ZB 1Y1VJ 1MD0A 3HOWJ 3BDDA 3HEFA 2Z16A 2XRNA 3CCRI 1QVTA 3NWSA 1SD6A 2R7RA 4N0BA 2F5CA 5L3FA 1CGPA 3K9TA 1ETXA 2XAGA 2NAZA 1KYWA 2P8TA 1D5YA 3H9GA 1FT9A 2Q0OA 3AKZA 3VSKA 2ZMEB 4P1WA 2FF4A 1BR2A 5CVUA 2R7SA 2M4KA 2XAHA 3PSIA 2COBA 4HQEA 1FP1D 1MMDA 1I1GA 4F93B 2OA4A 5K5RA 5C4JJ 2Q2EA 5KK1A 2NVYJ 3PIPF 1X3UA 1YQAA 3K70C 2GIVA 3PJRA 3HOYJ 1IN5A 5ICCA 4G12A 4C2TA 5BQTA 3LSMA 1BI0A 2RV8A 1FYMA 1ZARA 1XN7A 1IF1A 1FY7A 3TO7A 5D5WB 4ENKA 2DYRH 5M3FJ 3H5NA 2NS0A 4Y33A 5C4XJ 3JRAA 5D5VB 2OCCH 3LWFA 3WTZA 4XLNF 3BTJA 3DLAA 1S3JA 1K4SA 4UY8I 5JR3A 1Y6IA 3VPRA 3WGGA 3NARA 1UHSA 3LA3A 4Y3OA 5KNLA 2X6OA 2EFNA 2ICWG 3S32A 2W84A 4RLQA 5GADJ 2ZMEA 4L5IA 4Y15A 1IO2A 2UZKA 3S1MJ 1NG6A 2JA6J 2EA2A 2DQRA 2CW8A 2IXSA 3M1CA 5IP9J 2K9MA 3GZ5A 3S93A 3BR1A 4OAYA 3JRDA 1WSUA 1WGXA 3RKXA 2DXIA 2PJRA 4OMYA 3K1PA 4B47A 2RQPA 2JSPA 3CCQI 1YLFA 4M3FA 5IYBJ 2OPTA 1G3TA 3LSJA 2STWA 3W2AA 1UAAA 4HX7A 2V1NA 3F21A 2KP6A 4CYCB 2K4JA 4OOIA 5DD8A 2PMUA 2ID3A 2LH9A 1WI3A 2PLYA 2BHZA 1YIOA 2HGCA 1FYLA 2JUGA 2KL4A 2JPBA 5E3MA 2HOAA 4M3DA 2UXXA 4D5FA 4IHYA 3QOEA 2ZB9A 4BGDA 4CCOA 5M5XJ 1KU3A 3PO3J 4E7HA 2EH3A 2ID6A 3OYHA 1KU7A 4Q4ZF 1SD4A 1HF0A 4JQFA 3PIOF 3QP6A 2ZKZA 1FBQA 1R00A 1UMQA 1P7JA 3FIWA 4XLFA 4BQQA 1Y56A 3Q0WA 3VYTB 4RDUA 3OYDA 1UCRA 2W1OA 1TQPA 1YJNI 3J7AO 4P5OA 2NRAC 3BR3A 3RIRA 2EZHA 3CQZJ 3K4CA 1G59A 3CDLA 1JHFA 2AO9A 2G0EA 1GXQA 1OQYA 1ZGJA 3IWFA 2RDPA 1WJFA 3QPTA 3PUBA 3K1MA 2FBIA 1K6YA 3L7WA 2CUEA 1OLTA 1H8AC 1VQMI 4IRGA 2M0CA 1V4RA 4BJ5C 2A69F 1IRZA 1KGSA 2LBFB 5IT9Z 4DW6A 2V9KA 3GW2A 4XSZF 2M87A 5E1WA 1BJAA 1PUEE 1IW7F 5J1UA 1KU9A 5M5YJ 3GFIA 2FA5A 3CJQB 1MSEC 3CESA 3MAJA 1LVAA 2WAEA 1XTAA 2XVCA 2COMA 5DV5A 2M30A 3GXOA 3G73A 3OYKA 1OISA 1SD7A 1JTYA 5IT3A 4F92B 3LAJA 2PMZA 3JRHA 4S04A 3RCOA 1JT6A 1MH3A 4RB1A 1AKHA 4ZDOA 3HXLA 3JRIA 2HFHA 5IT9K 4FETA 4L5EA 1FOYA 1Y39A 3CC7I 3CUQA 3VOEA 1JUMA 2EILH 3WU2C 4D5CA 4CYDA 3E0JB 5LRSA 2P7CB 2ESHA 1K78B 4P55A 4A3BJ 1G3SA 2QZ8A 2EINH 3WTTC 3ZMSA 3H9QA 4IRHA 4NQWA 4JBAA 4S0HB 2R5ZA 4E7KA 4KT5C 2DFHA 5F1RA 4L9NA 3OMYA 3S14J 4XKWA 1I5ZA 5BOXA 3K2AA 1Y0NA 2IW5A 4G6QA 2ZXIA 3G1LA 3L2QA 3HKZN 1IV8A 4XONA 1FOXA 1X1DA 3ZMUA 2FQ4A 2BY1A 3IRRA 3CMAI 3ZQGA 5FLXZ 2ELHA 3F8FA 1FLIA 2AXTC 4BUPA 3A4CA 1TWGJ 2DAOA 3DFGA 3QYEA 2J5PA 4RAGA 3KPHA 4GFBA 3ZQLA 2HZTA 2X6XA 4L9JA 4BL0B 2KMUA 2HKOA 2IA2A 3UKGA 2QUFA 3OIQA 4IF4A 3H9JA 5BMZA 1R22A 3JRFA 4E7SA 5E18F 2JWTA 1ZKGA 1K4TA 5L3EA 3D5LA 1KA8A 2X1EA 4ENNA 2K02A 2HTSA 4WXDA 3SZTA 2BYVE 3P9KA 2JSCA 1DGWY 1FTZA 2WC2A 2DMPA 4XR6A 4I01A 4FTHA 2A07F 2QSHX 1HKSA 1S9HA 4QLCU 2F4MB 1RUNA 3EUKL 2XROA 2I8DA 4I98B 4OU0A 4OMZA 1TTYA 4AC0A 3QWLA 2CV1A 1P92A 5K7HA 2HPMA 4ASNA 4IVNA 3K1NA 1UB9A 1BIAA 2L7FP 3KP6A 3P7NA 1LDKB 2F4IA 2F2EA 2XGEA 3V8LA 1K7AA 2CSOA 5HDKA 5IYDJ 1U6GA 1QZEA 2QKMB 1W1WE 4OIPF 1MMNA 3CO7C 5J3LA 4UUVA 4RMNA 1QZYA 1XCBA 2PJPA 1J0RA 3TDZC 3TGNA 4H4KC 1ZG1A 4XSXF 3ABMH 3ULQB 2DODA 1YJ9I 1P9QC 4E7ZA 1X58A 5K5OA 4PJJA 1Z21A 2DA7A 3NAUA 4R8HA 3OYLA 5FRNA 2DYSH 1ZAOA 3BP8A 3H0GJ 5E3LA 1BI2A 4XRSG 3CO6C 1JKPC 4HQMA 3F8NA 2IS4A 1SVMA 3MMYB 4LB6B 1HQCA 1EV7A 2VPRA 3M4OJ 2STTA 5HLTA 3AG2H 4IHTA 3FM5A 2E36A 4Y7NJ 4EATA 2HOTA 3WTSC 1MBEA 5CQEA 2L2OA 1RETA 1WHUA 2IS2A 2ZO4A 1FOKA 5J8CA 3HOTA 2DMTA 2EV5A 2DLLA 3KEQA 2H6CA 2FJ1A 2XAUA 2LK2A 4DZPA 3W6JB 1HC8A 2M8GX 2FU4A 1I6XA 2X6YA 3AAFA 1D1BA 1W5TA 2L9SA 2H6BA 1RC9A 2JRTA 2W57A 2ECCA 4AYBN 5DM7F 2P6SA 1XGOA 4HNVA 1BJZA 1IRXA 4ESFA 1RNLA 5D8LB 1A35A 3AG3H 3KP4A 3FBNB 2M8EA 5L3CA 3WTYC 3QPHA 1VNDA 4A2UA 3IL2A 2E5ZA 2P5VA 3H92A 2HOEA 5HS9A 4ZJZA 1DUXC 1YRNA 1HDPA 3BCBA 1XD7A 2Y75A 1ULYA 3VB2A 4LFUA 3CMMA 4C9YA 2DQLA 1SVLA 2Y31A 1NTCA 3TBIA 3FF5A 1XSVA 4PCQA 3OS2A 4IHSA 5LHIA 2GIZA 3TO6A 3F0CA 1J7KA 1MDMB 4IHVA 4KIBA 3KLNA 3MFKA 4I02A 3OIPA 2UXNA 4G8XA 3FXUA 4BQOA 4U7BA 2Z9OA 3W6KB 4KFCA 3BCAA 3UNGC 3MD2A 4BXFA 3FXLA 4HOBA 2DT7B 4BBRJ 5EG0B 5AIPA 4RGUA 1CQTA 1J2XA 1YTYA 3TEDA 4LD5A 2QM3A 1HLVA 1AKHB 3S2HJ 4PUSA 1Z0XA 5TGTA 2R7OA 2V6EA 2DTRA 4DBQA 2E1MC 1W5SA 2RC4A 3MKWB 5IP7J 3L00A 5LGUA 2HXOA 5H2FC 2I5UA 5B1AH 1LKXA 2H09A 2JK3A 1T38A 4NQWB 2Y69H 2LF8A 3FMQA 3HB9A 4MTDA 1TL8A 1ETOA 1ZLKA 3B6CA 3NEUA 4YRVA 2EFOA 3GWZA 3I9V2 4GXOA 3VSLA 4FASD 1RZ4A 3E6DA 5LRRA 4C30A 4M6VA 2HDWA 4EJUA 1E2XA 1WJAA 2ZBKA 1TW2A 4KNYA 4IRIA 1MGTA 5JVTA 2MGQA 3FBIB 2JA7J 1Y8RB 2VODA 1OYWA 3TOBA 3MKLA 1ZGAA 3QP5A 3KYLA 2A6HF 2QKLB 2GQQA 3M7GA 2W7NA 1QGPA 4CCNA 3L9FA 1WJDA 2HI3A 1G4DA 5GP9A 4HAMA 1JGGA 3SFZA 5D4SA 1OMIA 3OYMA 6PAXA 3F72A 1UHWA 5EZHA 4A93J 3BTIA 3CP8A 4NC6A 3S8PA 2DPDA 1JJ8C 1Z6TA 4AU7A 4C3JJ 3DTIA 4M6XA 3IKTA 2GOXB 3ZRGA 1LNWA 1KONA 2EQRA 2IGNA 2NOGA 3HRUA 2IS1A 3ABTA 1P6RA 2DMQA 5J6XA 1LFPA 4ZYGA 4NB5A 4XNFA 2K5CA 1OCCH 1ZN2A 2MC4A 1S8NA 1XX5A 1Z77A 2Z3YA 3S3MA 4EM1A 1ETKA 4MTEA 4BE0A 3GFLA 4Y13A 2CQ7A 2CYYA 4HV5A 1MBHA 4PGGA 4Y4RA 1OJLA 3ECOA 2KKOA 3RQ4A 1VQLI 2GOMA 1XMXA 2X0LA 5K1YA 2JVGA 2CG4A 4ZTJA 1POGA 4ZYAA 3EYIA 2LY2A 5DCMA 4B3AA 4NC7A 2DDBA 3DPTA 2L4AA 3FXKA 1RKWA 2KZVA 3HRMA 1LVKA 3HDDA 4CCLA 2ZXWH 1R9TJ 2NVXJ 4G94A 1I27A 4JOMA 2KIUA 2KDOA 1GDTA 1U5TA 1X1AA 2Y0SA 1QQIA 1TLHB 2MW8A 5ILVA 4IOCF 5A2QK 1ZR4A 4UVCA 3WG7H 3S17J 5FKMA 3FHNA 3D5RC 4AIKA 1MZBA 2WY8Q 1OCZH 4KMFA 2OBPA 2XRLA 3KLOA 3QPSA 4JX4A 1S72I 2IA1A 1SAUA 2VN2A 1UELB 4MHGA 1HW1A 4UNOA 1FJLA 2IA0A 5LGNA 2BY0A 1H89C 5EZGA 5F04A 3HKZA 1IDZA 3OIOA 3DEWA 2EZIA 2F5VA 2WBMA 2V7FA 2BBYA 2L9VA 2BVMA 4FISA 4C3HJ 3GTKJ 4PDKA 1FNNA 1XB4A 2H8WA 3SHFA 1B72A 3CUOA 2D1VA 4RB0A 1Z7LA 5H6RA 4R1HA 2RGVA 1HXDA 1F9NA 2DFIA 4RAFA 4CZCA 4A5NA 1X1PA 2BXZA 1SFXA 3H36A 1FPQA 3ERED 3Q3SA 4N4NB 3KP7A 2VJIA 2GA2A 3FK6A 4KMUX 2M34A 3WU0A 1HW5A 3ZN0A 5ILUA 9ANTA 2HDCA 4I6ZA 1A5JA 3TOAA 3L2RA 2IBDA 4OIOF 2P0WA 4BY1J 1ZHFA 2WTEA 4OAZA 4ZC3A 5J8FA 4KYWA 1VTNC 4CXFA 4M73A 2HZDA 2LNBA 2R5YB 2XB0X 4YIIA 1MNEA 3GLLA 1ZR2A 1ZQ3P 3GCMA 1OR7A 4KN4X 2A5YB 2FUG2 4M3GA 4E4HA 1IN6A 1ON1A 2DTZA 2ISYA 3T0YA 3CF5F 4BJ6C 4EV0A 2VT3A 1YIJI 2MG4A 1NG7A 5E1ZB 4UVAA 2F4OB 4HW0A 2VIXA 4JX6A 1YI2I 3I0TA 1ZREA 3GO5A 2ZFUA 1XSDA 3LAPA 1ON2A 2W48A 4RAZA 1IDYA 5B1BH 2KRFA 4IXAA 4L9VA 2VI6A 1EA3A 2DU9A 5DYMA 4BH9A 3BZCA 2DT6A 4LK1F 1I3AA 2HPIA 3I58A 3G6EI 3I4PA 2CMPA 2HXIA 3HSRA 1MNMC 3FMSA 5H6QA 2IAIA 5D8KB 2CH0A 3DP7A 3GX4X 1USTA 1OCOH 4XK4A 3SZGA 1AA7A 3WHBA 1W7PD 3QQAA 4EGYA 1U78A 2UUZA 3HSFA 2R0QC 3LSPA 1T56A 2R7VA 4G7ZF 1PJRA 2KT0A 2NS7A 2IP2A 3GF2A 4KJZA 5E3NA 4DNCA 4B44A 1K83J 1SMTA 3CCEI 4A3IJ 4L5JA 4E70A 1GHCA 4WXHA 4GDFA 3OS1A 1WJBA 2OQRA 2IGOA 2EFQA 5CVIA 3GTQJ 4BY7J 3SEZA 1RESA 4MQVA 4TV7A 2KIFA 4RM2A 2BW3A 3BPXA 4HV6A 2E1OA 4F52A 4N9IA 2OV7A 4IEJA 4XOTA 2OJED 1IXCA 3H5AA 3V8KA 1MDMA 3GTGJ 2KJCA 3HIFA 2V26A 3E6BA 2IS6A 4NDLA 2BZTA 2QF7A 1WCMJ 3JW4A 3VODA 1ZG5A 4M3BA 2DFFA 4XKCA 3ABUA 2GBYA 5JHFA 1IG7A 3ZOBA 3HTUA 1PUFB 5B66C 5IPAA 3ONQA 1IRGA 5IY5H 2ZJQF 1D0XA 5JVGF 1DP7P 4YFKF 1FYKA 2OZ6A 4HSTA 1D1AA 1R58A 2W25A 1QU3A 2P81A 1FOWA 1IAWA 5IOZA 3CF2A 2LC2A 2ZCWA 3FHZA 4AD9A 2HWVA 4YFNF 3J7ZI 2KFDA 2LKXA 4UXNA 4MEYF 3KCCA 1XMAA 5D6EA 4ZYHA 3PNTA 4V2FA 2OCEA 2XSJC 3IH3A 2JMWA 2XGXA 5CKTA 4YIFA 2IRFG 4QTRA 3AG4H 4U0WA 2EK5A 4GRIA 1O3QA 1JE8A 2E19A 5E8GA 3K0LA 5L3BA 2CQQA 2M7AA 5EYRA 4AIJA 1Y0UA 1ZYRF 4M3EA 4NUBA 5CYVA 1DU6A 2KLOA 3LMMA 1YX3A 4L18B 3IC7A 4D7MA 1W5CC 2O8XA 2VBZA 2KPMA 2M5WA 2E2JJ 4AWXB 5EEGA 2BXYA 4OINF 3KETA 1I50J 2MC3A 1EH8A 4HRIA 2W4SA 4PSWA 2GLOA 1MJ9A 4ITVA 1BOAA 5FFZA 2VXZA 3PNYA 3DF8A 2JA2A 4RGRA 1LQ1A 3KZIC 1B6AA 3RZOJ 2O61A 2FNPA 4MFDA 3OYFA 3QRFF 1OYYA 1SEUA 2CUJA 1MNDA 2FXAA 2DT5A 3ERMA 1BW6A 1R5ID 4D9JA 1P4WA 3TP0A 4QWQA 3ZQHA 4BU2A 4YIRX 2LFBA 2XV4S 2OUMA 1YO5C 2CQKA 4HX4A 2WAQN 3F22A 2WWYA 4M71A 3CCUI 2DK5A 1WZ2A 3WGIA 4B3XA 2RAEA 2KRCA 3ZQIA 5FKOA 2PQ8A 2MYSA 2JUCA 4W97A 4J19A 5K7FA 1E3PA 2X48A 2ME6A 3WODF 1MIJA 2VC0A 4ZYEA 3OWTA 2HYFA 2JT1A 1NK2P 1RRJA 3BWGA 1IN7A 3HC7A 3MVPA 3MKZA 1ZTRA 2FQ3A 2WAFA 3BT9A 4XM3A 1QRYA 5J47A 3FXRA 4BE1A 5CVVA 2RREA 3T8TA 2K40A 2LDUA 2NNNA 4X6AJ 2CV2A 3U1DA 4OWRB 5FROA 2R7QA 1JTXA 1L0OC 3JCUC 5B5EC 1Z1DA 4RS8A 3AG1H 4JK1X 1JUPA 1TNTA 4IQ4A 2FMLA 2NYXA 1BR1A 2TCTA 3N97A 4EJVA 1UHMA 1XGMA 1D1CA 2YX7A 2NVQJ 1FIAA 4UUSA 4S05A 1FEXA 1DPRA 3R4KA 1MJBA 3I55I 3BG3A 1R6RA 2QGUA 1X1BA 3VWBA 2PG4A 1DU0A 1RKTA 2OTJI 1WVRA 1HW2A 3B6AA 2K3FA 2HKXA 3A0BC 2CJJA 1OCTC 3OSGA 2E5NA 1SC7A 3E97A 2A6TA 2LG4A 4V2GA 4DJAA 1V3FA 3VYRB 4AVPA 1EF4A 3HZJA 2MLGA 1G2HA 4LLGF 3EUAA 2Y2ZA 3S1NJ 2A68F 2FD5A 1Z6RA 3S2WA 1MMAA 2V6CA 4D0PA 2CUZA 3HGGA 4XIDA 5HLGA 3K4BA 4CGZA 4XBFA 4AIDA 3KE2A 4ZDPA 3RTRA 2IPQX 3PQKA 2HR3A 4UHTA 1A36A 5BNGA 2EPFA 3L2UA 3H3UA 1YRNB 3D1NI 4LG0B 1R23A 2A05A 3G3ZA 3RDIA 1TQIA 2QEXI 1JKRC 5LHHA 2MBFA 4E7LA 3FK7A 1RR8C 4XICA 4DBRA 1ZRCA 2KJBA 3GEZA 2VE9A 2V1UA 3AFHA 3C1DA 2V79A 2DOFA 2PBIA 2CW0F 2P7VB 2BEOA 3CCMI 3CDHA 1SMYF 1R5GA 5FJ8J 4BEHA 4IOAF 4YELA 4CO8A 5D5UB 2VQLA 3J80K 4HYEA 4HLXA 4MGRA 4U0VA 2F48A 4HNUA 3KFWX 1OR7C 4UV9A 2R7TA 4J01A 3WHCA 5ICEA 3J81Z 1K78A 4A3LJ 2D5VA 1IN8A 4XLAA 5IOYA 3BZ6A 5F0FA 3H35A 4CUGA 3HOZJ 3WGHA 1F36A 1X3ZB 1UG2A 1FMVA 5FKNA 3JAMZ 1H88C 2PFBA 3O8GA 1WQ2A 4XLEA 2ZXJA 1BR4A 2VPLA 5LGTA 2EFPA 1X4PA 3V7RA 1ORKA 1JT0A 2KRHA 2Y0MA 2CQXA 3K70D 2QQ8A 3JR9A 2R93J 1VQOI 1ITYA 3F6OA 3DU5A 4X0GA 1ETQA 4V19K 1YW8A 5J4YA 3LSIA 2HVSA 3SEQA 5GTIC 1U5TB 2VKVA 3UR3C 3HUGA 1XGNA 1WJEA 5GAHJ 5KVRA 1JUSA 5ERIA 4G7HF 3DEEA 3ZXSA 3HHGA 3BOQA 2IGKA 1GUUA 1TWCJ 4ANJA 3HOVJ 3C7JA 2DA3A 5CQGA 4ABZA 4EEFG 4CA0A 1R4NB 3GTMJ 2V1DA 3PQJA 1NK3P 5E17F 3OY9A 3V7SA 1M1EB 4G7OF 3OL4A 3M8EA 3G1OA 4DQ2A 3ZR8X 4HSRA 1W7PA 3ZMVA 3BZKA 2GAUA 3L1PA 5FO5A 3ZCOA 1Z7UA 3DKXA 4WWCA 1P7IA 4X1EA 2RN7A 2CU7A 4RM3A 1RUOA 1OPCA 3KYDB 1JJ6C 2IEKA 2YSRA 3ML6A 2ELKA 1I39A 2QVOA 1S29A 4DIQA 1U5TC 2JA8J 2VXDA 1D8JA 4B8XA 1R4MB 2VKHA 4CCMA 4BQNA 5CVJA 2LR8A 3CJNA 3DBHB 1Q1HA 2BY2A 1WH5A 4A3DJ 2HVQA 1IRFA 2MH9A 4W1UA 3FXQA 1R49A 4CICA 2JTVA 2OU2A 1KU2A 3KZZA 1UFMA 1DPUA 1K6OA 2Y0SN 2GXAA 4JYKA 2ZJPF 5LHGA 4MQ9F 2QBYB 1S7OA 1DP3A 3M8JA 2CGPA 3V4GA 1GLNA 1P2FA 3GTLJ 1IUYA 2LKSA 3WTXC 1WWXA 3O8HA 1LB2A 2O03A 1AOYA 3VYUB 3EQLF 4QPQA 4MFEA 1STZA 3ISPA 2M2EA 1ZK8A 3RKQA 4IZZA 3TL4X 2M3AA 3MKYB 3OYNA 2P5LC 5D6FA 2VQCA 1Z05A 2B9SA 3ZMZA 3ZQCA 1TT0A 1N78A 2LY9A 4I0AA 3JTHA 3LA7A 4AUXA 5HLHA 4RB2C 4BDZA 1D8KA 3E5XA 1B4AA 1FSEA 2H1KA 1VQPI 2FNAA 3HGYA 4BHCA 3ZMDA 2VLAA 3BJOA 5LFAA 3CLQA 3CC2I 3SDGA 2P6TA 2L9NA 1ETYA 4GO1A 4UV8A 1B1BA 3HBLA 5F1JA 1IC8A 2XPVA 1HKTA 1EH7A 1KQ0A 3OYJA 1G6NA 1O7FA 3BG9A 3DBRB 2CUFA 5HS8A 4RAYA 1X3WB 3TO9A 2VB6A 3S1QJ 3KZYA 2DFEA 4II2A 2XPUA 4BJTA 4PJ0C 1LEBA 4LMYA 3Q9SA 5C3EJ 1ODDA 3E5UA 4KIGA 2MLKA 1MMSA 3NQOA 1USSA 1YITI 1F43A 4KITB 2LYCA 2EBIA 2XSDC 4LG0A 2OAZA 2WB1N 3R61A 5E20A 1Y8QB 4RBOA 2Q8KA 3S3NA 3DV8A 4Y17A 3LNQA 1F1ZA 1V54H 1W7PB 3HYIA 2B7EA 3ABKH 1U9NA 2R7FA 3V42A 3BQYA 3LSHA 3K4JA 3MWMA 4BXXJ 4KN7X 3VDXA 1J75A 3S16J 1MBFA 2YU9J 1D5VA 2I10A 1XGSA 3FKJA 2GXGA 2QYOA 3HRSA 1FIPA 1JKQC 2XPWA 3K6GA 2CRGA 3E7LA 3W2VA 3K10A 1R1TA 2E71A 4NBQA 4NNJA 3W2WA 1JGSA 3VYSB 2HTJA 1ZRFA 2FSWA 4PFOA 2VJ5A 1B72B 2ZSIB 2QENA 4J00A 3CTAA 2R7UA 4PFPA 3E5QA 1T6SA 4F3QA 4BS9A 3SDBA 2PMHA 1RI7A 2EIJH 1ZLJA 2H8RA 3WU1B 4BHBA 4FX0A 3GTJJ 1TWAJ 1EH6A 2RVCA 2G9WA 3HL2A 3WE2A 4A3MJ 3A2KA 5FGMA 3DXJF 4LOCA 4KIFA 3GFJA 4EGZA 3COAC 1BI3A 3OOPA 4R79A 4I99C 1ETWA 3PL8A 2LKPA 2RNJA 1SANA 3PM1A 2PI0A 3TW6A 4I76A 2HOSA 2E34A 2KQRA 1FMWA 2K86A 2LD5A 3M1EA 2CFOA 3ABLH 5J4VA 3ECHA 5DEQA 3MZYA 5DCMB 4I2OA 4EJTA 1B9MA 2G7UA 2YU3A 4EJOA 2E2HJ 2BY3A 3PNVA 1H0MA 2IT0A 3S2DJ 3BG5A 2ADUA 3BJAA 4NHJA 5FLXK 3BC8A 2XGDA 1WRJA 1Z67A 2EIKH 2Z5UA 4F91B 1R1UA 2DA6A 2Y9ZA 1BM9A 2L0KA 2DPUA 2B63J 1TP4A 4IHWA 5J1YA 5ILSA 4PJMA 5BPDA 2L7MP 4RGXA 2JZYA 3RPUA 5C44J 1DGRM 2VASA 3F8MA 1LFUP 1J5YA 1BW5A 3C2GA 1HKQA 1HOMA 1LE8B 3FX3A 2DOEA 5FB2A 3ASNH 3KP5A 1CF7A 2DDAA 3H1CA 3D0SA 3U9GA 2EV6A 2LREA 2P5KA 3VFZA 3QU3A 5BS6A 3K7AJ 5CPRB 1O4XA 2KIQA 2K27A 3RZDJ 3I59B 3I64A 3ZQQA 2DW4A 1PVEA 3I53A 2YPRA 4B48A 1YFHA 3IUOA 3MEXA 1TQMA 3O3KA 5DUIA 4BDYA 3WTWC 2AQFA 4I7HA 4II3A 3MN2A 1TBXA 3QPLA 5F0HA 3CCJI 1PUFA 5HDNA 3A02A 5HDGA 4FCYA 2P4WA 2ME0A 1X2NA 1G8XA 2H27A 3RYRA 5HOOA 2BGCA 1IJWC 2HVRA 4LG3A 3IH2A 3WE3A 2VBYA 2TRTA 4YFXF 2KIMA 3IV5A 3DEUA 3F3XA 2IJLA 5HS7A 3Q5FA 1JKOC 1N77A 3EUHA 2NVTJ 3KP2A 4A0YA 2HQRA 1XDUA 1JI8A 4ENJA 3HOSA 4RA2A 4FE7A 3DCFA 2F6CA 1VQ9I 1B8IB 1YHQI 4E7JA 1PP8F 4FT8A 1J59A 4GYGA 1S6LA 3JREA 4KA4A 2E1CA 2HDDA 2VOPA 2VBWA 1SVOA 3I54A 2Q1ZB 1AU7A 4UUTA 3PFIA 2R7DA 3JTGA 3LSRA 5FD5A 4A3FJ 3R6SA 3BR5A 2V1XA 3KEYA 1H9TA 4HBLA 1WH7A 5HNHA 2XASA 5KAIC 4Q47A 3OS0A 4GYIA 1K79A 2VUMJ 1KQ8A 1BA5A 5EEAA 4IJAA 2DO7A 5J40A 2L7ZA 4ZDLA 5LBQA 1R5HA 4XN0A 3PFYA 4QIWN 1QA6A 1GVJA 2ETHA 4IQJA 1TWFJ 3KEOA 4M72A 2DJIA 2V9PA 3DTEA 4AYBA 5LD2C 1R7JA 4XRSA 2DA4A 4HZFA 1U0JA 5FLVA 1LEAA 1N25A 2VQGA 1BIBA 2FOWA 4ZH4F 3BR6A 1MKMA 2XHKA 1E3OC 1GXPA 5FRMA 3CJRB 2E2IJ 2UV1A 1SFEA 3FXOA 1ZGWA 2X1CA 1I1SA 2K9SA 2DA2A 1P4AA 2OQGA 3OYGA 2EZLA 2AXLA 3FWEA 5GAGJ 3E6MA 2XKPA 2R4GA 2QQ9A 3EYYA 3TW7A 2D2WA 1QPMA 4G6TB 1O7LA 4ESBA 3CCSI 2O5RA 1Z3YA 1MBKA 3Q9VA 4XLHA 1VQ7I 3FXMA 2O9LA 4G9YA 2DK8A 4DYRA 2LOOA 3I4MJ 3KX2A 4BBSJ 3HPHA 1E0EA 2QQAA 1A6IA 3CZ6A 4DYCA 4UUSB 3H3ZA 2W82A 1YX5A 2XAJA 2KZGA 4B09A 3R0JA 2WA0A 3JRCA 3W6VA 4IL6C 5EF6A 4PZJA 1WJ5A 3GVAA 3ZPLA 2F5EA 5GAEJ 1OKRA 3M8FA 4B43A 4CH7A 4DGWB 4P9UA 2L02A 4FE4A 4BHPA 5ICGA 2CS3A 3WTVC 2L4MA 3BQZA 3L2VA 5HODA 3D5SC 4HNTA 4GGGA 1FSHA 1AHDP 2VC1A 2XGCA 3LQRA 4ETSA 3OOUA 3PUFA 2K7LA 1YE9A 1C0WA 4B1RA 1F5TA 2YX4A 1YS7A 4P96A 1SFUA 1T8IA 3BROA 5F0CA 4BKXA 1S7AA 2K3PA 3BPVA 3I4NJ 1G3WA 2XF5A 2Z2SB 2BV6A 2GXBA 2JQ7A 4OIQF 2EB7A 3C18A 3DPUA 3DTKA 3O6BB 5DM6F 2R7WA 4HEA2 4IKFA 1DQUA 2L01A 4HG2A 5JI6A 2Z33A 2D1HA 1HDDC 3NRVA 1XCVA 2EV0A 3H3VK 4O5VA 1F4KA 3CCYA 5EGOA 1R1VA 2DN0A 4RB3C 3FKIJ 1TW3A 2LLKA 2FBHA 2M45A 4IX7A 4IHXA 5L3DA 2LVSA 3J81K 2FOKA 4ZZDA 3LSGA 1MBGA 2L3DA 4FHTA 4A3JJ 3BY6A 2NVUB 4Y52J 4ESJA 1LDDA 3OYBA 4BNCA 4MEXF 4A0XA 5FKLA 3GTOJ 2E7XA 2E35A 4LITA 1L3LA 3OYIA 2X4HA 4D7NA 2ZNYA 2B0LA 1ZRDA 1QHGA 1YG2A 3QODA 1SFOJ 4RLFA 4M74A 3K4MA 3MQ0A 5TRDA 4BACA 2EWNA 1FZPB 2VKDA 1PYVA 3BLYA 1QBJA 5DD4A 1Q1VA 4UB6C 3K4NA 3LA2A 5FKKA 1O3TA 1EJ9A 1VQ6I 3BR0A 2CW7A 2CFXA 2FMYA 3ELKA 2X1DA 1QO0D 3R60A 3SFIA 2Y9YA 1VZ0A 1W36D 1QZZA 3IWZA 5E3OA 2ECBA 1VQ5I 3ZGKA 3ZMTA 3FZVA 4HPQA 5E8IA 5E1XA 3H5RA 2QQBA 4CCKA 3PO2J 2CO5A 1W36C 4PGHA 5IP6A 4FQGA 3I71A 1WPKA 5GPCA 1E17A 2DCEA 2R92J 1MSFC 1OYIA 2VKEA 4HDUA 2JA5J 4XLCA 3SJMA 4P9FA 1O3RA 3EETA 3RSNA 1X1CA 5JFRA 2WADA 2WB1A 4KISA 3KIOA 2O6GE 3ZQFA 1FC3A 1GV5A 3BR2A 3QYFA 4JP0A 5D5XB 3DBLB 2HYGD 1YS6A 2JJ7A 2MD5A 3IHUA 3RKYA 2YR2A 3E3VA 4BEHB 3LSKA 1YJWI 3S15J 2LY1A 2R5ZB 2HQNA 1YOVB 1MH4A 4C3IJ 3L2WA 1BN5A 4F55A 4U0YA 3FMRA 4A3EJ 1FBUA 5LEKA 4YEJA 4M9SA 3OL3A 1SD5A 5AONA 1Z9CA 1BC7C 1D0ZA 4UVBA 3JSPA 3P5JA 2KDZA 2XUBA 2XAFA 1N75A 2M7BA 4KDPA 1A6QA 1U8BA 1E3HA 4LB5A 2OC6A 2OD5A 4XORA 4HLYA 2RKHA 2CV0A 2A61A 1G3YA 2R3SA 5JHUA 3HRTA 4PSXA 5AIQA 1REPC 4A3CJ 4L9TA 2NOJB 3C2BA 4M9XA 5ICFA 5F27A 3CCVI 3PSFA 1W0TA 2N8GA 3V8JA 2F5DA 1O57A 1UG0A 3F8BA 2V4JC 4PJNA 3MCZA 2K4BA 3J80Z 3H0DA 3GZ6A 1UZCA 1FP2A 4PK4A 2ZC2A 3CLOA 3HUGB 1I3QJ 2HNHA 3F8CA 1VQNI 3Q0UA 3T1BA 3IAM2 3T8RA 4KICA 2GM4A 3RYPA 1T0FA 2VL8A 5CJ9A 1JXSA 4A6EA 4IO9F 4WF2A 4G6DA 3HOUJ 3RQIA 4M6YA 2NXNB 3TQNA 2QBYA 3CJTB 2Y30A 2R7XA 2EIMH 1X2MA 3K4KA 2O7OA 2VBXA 1SAXA 1XG1A 4KT6A 5EGOB 2ZJ2A 1P4XA 3CMEI 3IRQA 3MZHA 3C2HA 1PP7U 1A31A 1U9OA 2W85A 3J7AY 1T2KA 1K61A 2XC7A 4OIRF 4DYQA 2K85A 2ZJRF 3SZPA 2LF7A 3OYAA 3GUDA 5TJJA 3B02A 2VONA 1WJCA 4CYCA 1WFXA 2OZUA 4A3GJ 2DA5A 1MJAA 2DBBA 3CC4I 3LOCA 2JN6A 4LIVA 2QSFX 1T33A 2K9NA 1BBYA 2QCOA 2ESNA 1D3YA 2D45A 2M0MA 4LLNA 3I3LA 2V9VA 2X6WA 5F64A 2LMDA 3U21A 2X51A 1A04A 2L9RA 2HEOA 4RGSA 5M3MJ 4HF1A 1GT0C 2PEXA 3I5UA 3HM5A 5LLQA 1WI9A 3HHHA 1IV6A 4Z2YA 3QYBA 1U2WA 4A0ZA 1MMGA 3A1YA 3ZP5A 3FXJA 1T95A 5HVQC 1LJ9A 2KHMA 4E6KG 4ON0A 4EM0B 2L7KA 4N4OB 5TISC 1RR7A 5HNFA 4U7DA 3V7CA 3IKVA 3WTUC 4A12A 5BPIA 4BQAA 4C2UA 2WV0A 1YYVA 1IN4A 1T0FC 3TDUC 1EKEA 1H9GA 2YUSA 2LRDA 1VI0A 3LSTA 1I6HJ 4WX9A 1KZHA 1RPWA 2M4GA 1VQ4I 1AWCA 2BVLA 3SQNA 2Y48A 3A01A 5K5QA 2WAQA 1V5EA 4LIUA 5JLWA 1V5GA 4CCJA 1NHAA 4PJLA 2F5FA 5M5WJ 3DPLC 4M9ZA 4A3KJ 2LSOA 4U87A 5EG0A 3K2ZA 4U88A 4I0BA 1BOBA 3BG7A 2L5QA 1W4MA 1TC3C 3CD6I 1Y1WJ 3TMOA 1J09A 2VQHA 3REOA 4YG2F 1U3EM 2XAQA 2MD0A 2K9QA 3RI4A 1MW7A 4F7ZA 3IH4A 3LQQA 2Z99A 1X19A 2RQQA 3QU6A 4FX4A 3G4SI 2RNGA 3RPUD 2BE5F 4HDVA 2MH2A 2DOAA 1R71A 1X4OA 5IYCJ 3DQVC 3CUQC 1KYZA 1LPQA 1BC8C 3HG9A 1ETVA 1HA8A 1XMKA 4I09A 2E60A 4UB8C 2ZSHB 1BI1A 2IVMA 4EJWA 1V5FA 2J5OA 3BG6A 3L09A 1T98A 4QSHA 1ZH5A 1DDNA 2OF7A 4N9HA 1S7EA 3DWLE 2WY7Q 1BL0A 1FBSA 2FEZA
chains in the Genus database with same CATH topology
3A02A 2XB5A 2MSYA 5JLXA 3JRFA 4FCYA 4DZJA 2JWTA 1ZKGA 2ME0A 3UKGA 1BW6A 1X2NA 3TP0A 3ZQHA 1IJWC 2LFBA 1LFBA 2WAQN 3IH2A 1FTZA 2DMPA 1ENHA 1OCPA 2TRTA 3IV5A 4FTHA 1JKOC 2NVTJ 2RAEA 3ZQIA 5FKOA 4W97A 4J19A 1VF9A 5K7FA 2X48A 2ME6A 2HYJA 4AC0A 1NK2P 4FE7A 3DCFA 5K7HA 1B8IB 3MVPA 1ZTRA 2L7FP 3BT9A 4B4CA 1QRYA 3JREA 2HDDA 2XGEA 2NS8A 5IYDJ 1AU7A 4UUTA 2K40A 3LSRA 5J3LA 4X6AJ 4A3FJ 3BR5A 2DMUA 1WH7A 2VUMJ 1JTXA 1BA5A 5EEAA 1JUPA 2LP0A 2L7ZA 1X58A 3GTPJ 4C2MJ 3NAUA 2DA7A 4QIWN 3H0GJ 5E3LA 2TCTA 4XRSG 2LTPA 1XS9A 1W0UA 1JKPC 2NVQJ 1TWFJ 1FIAA 4UUSA 1MBJA 3GBGA 2VPRA 3M4OJ 1FEXA 3BG3A 2YS9A 4XRSA 4Y7NJ 2DA4A 2HOTA 1MBEA 1RKTA 1DU0A 5FLVA 1RETA 3BR6A 3B6AA 2O8KA 1E3OC 2CJJA 2DMTA 3OSGA 1B8IA 1OCTC 2E2IJ 2FJ1A 1ZGWA 2K9SA 2LK2A 4DZPA 2DA2A 4V2GA 2M8GX 2R5YA 2EZLA 3JRBA 1EF4A 1FTTA 1G2HA 3TW7A 2Y2ZA 3S1NJ 4AYBN 2ECCA 3QPLA 5DTDA 2FD5A 4HNVA 1BJZA 1MBKA 4MO7A 1XC5A 2O9LA 3HGGA 4XIDA 1VNDA 2AHQA 4DYRA 1YRNA 1HDPA 2R7ZJ 3I4MJ 3TP3A 4BBSJ 1TWHJ 1A6IA 4DYCA 4UUSB 2HQ5A 2Y31A 1NTCA 5F08A 5BNGA 3JRCA 3F0CA 4IHVA 3W6VA 3S1RJ 5EF6A 3D1NI 1YRNB 1IUFA 1JKRC 3FK7A 4BBRJ 5EG0B 3A01B 1QVUA 4FE4A 4XICA 3OSFA 1CQTA 3BQZA 3TEDA 2X9DA 5HODA 1HLVA 4XRMA 1GVDA 1AKHB 1AHDP 2XGCA 3OOUA 1LE8A 3S2HJ 1Z0XA 5FJ8J 1HCRA 4B1RA 5IP7J 4BKXA 5F0CA 2HXOA 1IGNA 2JK3A 2DMNA 3I4NJ 4MIMA 5EDNA 3HB9A 3WHCA 4A3LJ 5K7ZA 2D5VA 1ETOA 5IOYA 3BTLA 5DS9A 5F0FA 1HDDC 1OFCX 3B6CA 3HOZJ 3H3VK 3CCYA 5EGOA 1F36A 1UG2A 5FKNA 2DN0A 1H88C 3FKIJ 4M6VA 1GV2A 3O8GA 3Q0VA 2LLKA 4IHXA 2LVSA 2MGQA 2JA7J 3LSGA 1MBGA 4JX5A 3MKLA 4A3JJ 1ORKA 2DA1A 1JT0A 2CQXA 4Y52J 5J1RA 3JR9A 2R93J 3JRGA 3M3YJ 1ITYA 1APLC 1ETQA 5FKLA 3GTOJ 2EZKA 2HI3A 5GP9A 1VFCA 4D7NA 1JGGA 1SFOJ 4A69C 3HOXJ 2DJNA 5EZHA 2VKVA 4A93J 3BTIA 2WV1A 3BTCA 1JUSA 2PMZN 1JJ8C 3A03A 3G1MA 5GPAA 1Q1VA 4C3JJ 1GUUA 1TWCJ 5FKKA 1QPIA 3HOVJ 2EQRA 2DA3A 4ABZA 2NOGA 4EEFG 3GTMJ 2DMQA 1NK3P 3FISA 3BR0A 3SFIA 2Y9YA 3G1OA 1Z77A 2ECBA 5E3OA 2M9HA 4MLOA 1ETKA 3L1PA 3CMYA 1P7IA 2FX0A 4X1EA 1MBHA 3PO2J 1OJLA 2CU7A 5IP6A 1JJ6C 2IEKA 5FLMJ 1POGA 1Y1VJ 3HOWJ 1WPKA 4B3AA 5GPCA 2ELKA 3HEFA 2R92J 1MSFC 1QVTA 2JA8J 2VKEA 2JA5J 1RKWA 3SJMA 2LR8A 1ETXA 3HDDA 1WH5A 4A3DJ 1D5YA 1R9TJ 2NVXJ 4W1UA 3ZQFA 1GV5A 3BR2A 4JP0A 1GDTA 2MW8A 2COBA 2Y0SN 4JYKA 2JJ7A 1ZR4A 3S15J 3S17J 5C4JJ 5FKMA 2R5ZB 2NVYJ 3GTLJ 2XRLA 1MH4A 3QPSA 4C3IJ 4JX4A 3O8HA 3HOYJ 4G12A 4A3EJ 1FJLA 1PUFA 4MFEA 1H89C 2M2EA 5EZGA 5F04A 2KDZA 1IDZA 1ZK8A 3OIOA 3DEWA 2EZIA 3RKQA 5M3FJ 5C4XJ 3JRAA 1U8BA 4FISA 4C3HJ 3ZQCA 3GTKJ 1B72A 2LY9A 3BTJA 4AUXA 2H1KA 3VPRA 4A3CJ 3HGYA 3NARA 3Q3SA 3C2BA 1UHSA 5F27A 3FK6A 3SDGA 2X6OA 1W0TA 2N8GA 1ETYA 2M34A 3HBLA 5F1JA 1IC8A 9ANTA 2XPVA 4I6ZA 1A5JA 3BG9A 2IBDA 3S1MJ 4BY1J 2CUFA 2JA6J 5IP9J 1I3QJ 2R5YB 2XB0X 3S1QJ 3BR1A 2XPUA 1ZR2A 3Q0UA 1ZQ3P 3JRDA 1WGXA 5C3EJ 2GM4A 4M3GA 2DTZA 1F43A 2MG4A 2EBIA 2XSDC 4M3FA 5IYBJ 2OPTA 2WB1N 3LSJA 4JX6A 4RBOA 3HOUJ 3RQIA 3LNQA 2W48A 2Y30A 1IDYA 4CYCB 1X2MA 2O7OA 1XG1A 2ID3A 1WI3A 2VI6A 5EGOB 1U9NA 3BQYA 4BXXJ 5E3MA 1U9OA 3S16J 2HOAA 2HXIA 1MBFA 4M3DA 1K61A 1MNMC 4D5FA 2YU9J 4IHYA 2IAIA 2ZB9A 2I10A 4XK4A 4DYQA 5M5XJ 3WHBA 3PO3J 2EH3A 2ID6A 3QQAA 1U78A 1FIPA 2R0QC 1JKQC 1HF0A 2XPWA 4CYCA 3LSPA 1T56A 4A3GJ 1UMQA 1P7JA 2CRGA 2KT0A 3E7LA 3FIWA 2NS7A 3Q0WA 5E3NA 4RDUA 2DA5A 1K83J 4A3IJ 3BR3A 3LOCA 2EZHA 2JN6A 1B72B 3CQZJ 3CDLA 1T33A 2K9NA 2QCOA 2AO9A 2G0EA 3GTQJ 4BY7J 1RESA 2CUEA 2H8RA 1H8AC 2E1OA 2L9RA 2M0CA 5M3MJ 4IEJA 1GT0C 3GTJJ 3HM5A 1IRZA 1TWAJ 1IV6A 3GTGJ 4DW6A 4A3MJ 4NDLA 4LOCA 2QF7A 5J1UA 1WCMJ 5M5YJ 4M3BA 1RR7A 2GBYA 1MSEC 1IG7A 3ZOBA 1PUFB 1ETWA 2YUSA 1SANA 1VI0A 5IPAA 1I6HJ 3PM1A 3TW6A 4I76A 2HOSA 1RPWA 1JTYA 3JRHA 1JT6A 1MH3A 1AKHA 3A01A 3JRIA 2LD5A 2P81A 4L5EA 5IOZA 5JLWA 5M5WJ 4A3KJ 1JUMA 5EG0A 2E2HJ 4D5CA 2LKXA 3S2DJ 3BG5A 1TC3C 4V2FA 1Y1WJ 3IH3A 2XGDA 2JMWA 4A3BJ 2DA6A 4QTRA 2Y9ZA 2B63J 2L0KA 4S0HB 2K9QA 2R5ZA 4IHWA 5J1YA 2E19A 2L7MP 3IH4A 2CQQA 5EYRA 5C44J 3S14J 4M3EA 1LFUP 1DU6A 3K2AA 3G1LA 1BW5A 3HKZN 1HOMA 1LE8B 5IYCJ 2FQ4A 4D7MA 2E2JJ 3ZQGA 1ETVA 1I50J 3K7AJ 1O4XA 1TWGJ 3RZDJ 4QSHA 2GLOA 2OF7A 4GFBA 1S7EA 3ZQLA 1BL0A 3RZOJ 3MN2A 5F0HA 4MFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A02 A;  2XB5 A;  2MSY A;  5JLX A;  3JRF A;  4FCY A;  4DZJ A;  2JWT A;  1ZKG A;  2ME0 A;  3UKG A;  1BW6 A;  1X2N A;  3TP0 A;  3ZQH A;  1IJW C;  2LFB A;  1LFB A;  2WAQ N;  3IH2 A;  1FTZ A;  2DMP A;  1ENH A;  1OCP A;  2TRT A;  3IV5 A;  4FTH A;  1JKO C;  2NVT J;  2RAE A;  3ZQI A;  5FKO A;  4W97 A;  4J19 A;  1VF9 A;  5K7F A;  2X48 A;  2ME6 A;  2HYJ A;  4AC0 A;  1NK2 P;  4FE7 A;  3DCF A;  5K7H A;  1B8I B;  3MVP A;  1ZTR A;  2L7F P;  3BT9 A;  4B4C A;  1QRY A;  3JRE A;  2HDD A;  2XGE A;  2NS8 A;  5IYD J;  1AU7 A;  4UUT A;  2K40 A;  3LSR A;  5J3L A;  4X6A J;  4A3F J;  3BR5 A;  2DMU A;  1WH7 A;  2VUM J;  1JTX A;  1BA5 A;  5EEA A;  1JUP A;  2LP0 A;  2L7Z A;  1X58 A;  3GTP J;  4C2M J;  3NAU A;  2DA7 A;  4QIW N;  3H0G J;  5E3L A;  2TCT A;  4XRS G;  2LTP A;  1XS9 A;  1W0U A;  1JKP C;  2NVQ J;  1TWF J;  1FIA A;  4UUS A;  1MBJ A;  3GBG A;  2VPR A;  3M4O J;  1FEX A;  3BG3 A;  2YS9 A;  4XRS A;  4Y7N J;  2DA4 A;  2HOT A;  1MBE A;  1RKT A;  1DU0 A;  5FLV A;  1RET A;  3BR6 A;  3B6A A;  2O8K A;  1E3O C;  2CJJ A;  2DMT A;  3OSG A;  1B8I A;  1OCT C;  2E2I J;  2FJ1 A;  1ZGW A;  2K9S A;  2LK2 A;  4DZP A;  2DA2 A;  4V2G A;  2M8G X;  2R5Y A;  2EZL A;  3JRB A;  1EF4 A;  1FTT A;  1G2H A;  3TW7 A;  2Y2Z A;  3S1N J;  4AYB N;  2ECC A;  3QPL A;  5DTD A;  2FD5 A;  4HNV A;  1BJZ A;  1MBK A;  4MO7 A;  1XC5 A;  2O9L A;  3HGG A;  4XID A;  1VND A;  2AHQ A;  4DYR A;  1YRN A;  1HDP A;  2R7Z J;  3I4M J;  3TP3 A;  4BBS J;  1TWH J;  1A6I A;  4DYC A;  4UUS B;  2HQ5 A;  2Y31 A;  1NTC A;  5F08 A;  5BNG A;  3JRC A;  3F0C A;  4IHV A;  3W6V A;  3S1R J;  5EF6 A;  3D1N I;  1YRN B;  1IUF A;  1JKR C;  3FK7 A;  4BBR J;  5EG0 B;  3A01 B;  1QVU A;  4FE4 A;  4XIC A;  3OSF A;  1CQT A;  3BQZ A;  3TED A;  2X9D A;  5HOD A;  1HLV A;  4XRM A;  1GVD A;  1AKH B;  1AHD P;  2XGC A;  3OOU A;  1LE8 A;  3S2H J;  1Z0X A;  5FJ8 J;  1HCR A;  4B1R A;  5IP7 J;  4BKX A;  5F0C A;  2HXO A;  1IGN A;  2JK3 A;  2DMN A;  3I4N J;  4MIM A;  5EDN A;  3HB9 A;  3WHC A;  4A3L J;  5K7Z A;  2D5V A;  1ETO A;  5IOY A;  3BTL A;  5DS9 A;  5F0F A;  1HDD C;  1OFC X;  3B6C A;  3HOZ J;  3H3V K;  3CCY A;  5EGO A;  1F36 A;  1UG2 A;  5FKN A;  2DN0 A;  1H88 C;  3FKI J;  4M6V A;  1GV2 A;  3O8G A;  3Q0V A;  2LLK A;  4IHX A;  2LVS A;  2MGQ A;  2JA7 J;  3LSG A;  1MBG A;  4JX5 A;  3MKL A;  4A3J J;  1ORK A;  2DA1 A;  1JT0 A;  2CQX A;  4Y52 J;  5J1R A;  3JR9 A;  2R93 J;  3JRG A;  3M3Y J;  1ITY A;  1APL C;  1ETQ A;  5FKL A;  3GTO J;  2EZK A;  2HI3 A;  5GP9 A;  1VFC A;  4D7N A;  1JGG A;  1SFO J;  4A69 C;  3HOX J;  2DJN A;  5EZH A;  2VKV A;  4A93 J;  3BTI A;  2WV1 A;  3BTC A;  1JUS A;  2PMZ N;  1JJ8 C;  3A03 A;  3G1M A;  5GPA A;  1Q1V A;  4C3J J;  1GUU A;  1TWC J;  5FKK A;  1QPI A;  3HOV J;  2EQR A;  2DA3 A;  4ABZ A;  2NOG A;  4EEF G;  3GTM J;  2DMQ A;  1NK3 P;  3FIS A;  3BR0 A;  3SFI A;  2Y9Y A;  3G1O A;  1Z77 A;  2ECB A;  5E3O A;  2M9H A;  4MLO A;  1ETK A;  3L1P A;  3CMY A;  1P7I A;  2FX0 A;  4X1E A;  1MBH A;  3PO2 J;  1OJL A;  2CU7 A;  5IP6 A;  1JJ6 C;  2IEK A;  5FLM J;  1POG A;  1Y1V J;  3HOW J;  1WPK A;  4B3A A;  5GPC A;  2ELK A;  3HEF A;  2R92 J;  1MSF C;  1QVT A;  2JA8 J;  2VKE A;  2JA5 J;  1RKW A;  3SJM A;  2LR8 A;  1ETX A;  3HDD A;  1WH5 A;  4A3D J;  1D5Y A;  1R9T J;  2NVX J;  4W1U A;  3ZQF A;  1GV5 A;  3BR2 A;  4JP0 A;  1GDT A;  2MW8 A;  2COB A;  2Y0S N;  4JYK A;  2JJ7 A;  1ZR4 A;  3S15 J;  3S17 J;  5C4J J;  5FKM A;  2R5Z B;  2NVY J;  3GTL J;  2XRL A;  1MH4 A;  3QPS A;  4C3I J;  4JX4 A;  3O8H A;  3HOY J;  4G12 A;  4A3E J;  1FJL A;  1PUF A;  4MFE A;  1H89 C;  2M2E A;  5EZG A;  5F04 A;  2KDZ A;  1IDZ A;  1ZK8 A;  3OIO A;  3DEW A;  2EZI A;  3RKQ A;  5M3F J;  5C4X J;  3JRA A;  1U8B A;  4FIS A;  4C3H J;  3ZQC A;  3GTK J;  1B72 A;  2LY9 A;  3BTJ A;  4AUX A;  2H1K A;  3VPR A;  4A3C J;  3HGY A;  3NAR A;  3Q3S A;  3C2B A;  1UHS A;  5F27 A;  3FK6 A;  3SDG A;  2X6O A;  1W0T A;  2N8G A;  1ETY A;  2M34 A;  3HBL A;  5F1J A;  1IC8 A;  9ANT A;  2XPV A;  4I6Z A;  1A5J A;  3BG9 A;  2IBD A;  3S1M J;  4BY1 J;  2CUF A;  2JA6 J;  5IP9 J;  1I3Q J;  2R5Y B;  2XB0 X;  3S1Q J;  3BR1 A;  2XPU A;  1ZR2 A;  3Q0U A;  1ZQ3 P;  3JRD A;  1WGX A;  5C3E J;  2GM4 A;  4M3G A;  2DTZ A;  1F43 A;  2MG4 A;  2EBI A;  2XSD C;  4M3F A;  5IYB J;  2OPT A;  2WB1 N;  3LSJ A;  4JX6 A;  4RBO A;  3HOU J;  3RQI A;  3LNQ A;  2W48 A;  2Y30 A;  1IDY A;  4CYC B;  1X2M A;  2O7O A;  1XG1 A;  2ID3 A;  1WI3 A;  2VI6 A;  5EGO B;  1U9N A;  3BQY A;  4BXX J;  5E3M A;  1U9O A;  3S16 J;  2HOA A;  2HXI A;  1MBF A;  4M3D A;  1K61 A;  1MNM C;  4D5F A;  2YU9 J;  4IHY A;  2IAI A;  2ZB9 A;  2I10 A;  4XK4 A;  4DYQ A;  5M5X J;  3WHB A;  3PO3 J;  2EH3 A;  2ID6 A;  3QQA A;  1U78 A;  1FIP A;  2R0Q C;  1JKQ C;  1HF0 A;  2XPW A;  4CYC A;  3LSP A;  1T56 A;  4A3G J;  1UMQ A;  1P7J A;  2CRG A;  2KT0 A;  3E7L A;  3FIW A;  2NS7 A;  3Q0W A;  5E3N A;  4RDU A;  2DA5 A;  1K83 J;  4A3I J;  3BR3 A;  3LOC A;  2EZH A;  2JN6 A;  1B72 B;  3CQZ J;  3CDL A;  1T33 A;  2K9N A;  2QCO A;  2AO9 A;  2G0E A;  3GTQ J;  4BY7 J;  1RES A;  2CUE A;  2H8R A;  1H8A C;  2E1O A;  2L9R A;  2M0C A;  5M3M J;  4IEJ A;  1GT0 C;  3GTJ J;  3HM5 A;  1IRZ A;  1TWA J;  1IV6 A;  3GTG J;  4DW6 A;  4A3M J;  4NDL A;  4LOC A;  2QF7 A;  5J1U A;  1WCM J;  5M5Y J;  4M3B A;  1RR7 A;  2GBY A;  1MSE C;  1IG7 A;  3ZOB A;  1PUF B;  1ETW A;  2YUS A;  1SAN A;  1VI0 A;  5IPA A;  1I6H J;  3PM1 A;  3TW6 A;  4I76 A;  2HOS A;  1RPW A;  1JTY A;  3JRH A;  1JT6 A;  1MH3 A;  1AKH A;  3A01 A;  3JRI A;  2LD5 A;  2P81 A;  4L5E A;  5IOZ A;  5JLW A;  5M5W J;  4A3K J;  1JUM A;  5EG0 A;  2E2H J;  4D5C A;  2LKX A;  3S2D J;  3BG5 A;  1TC3 C;  4V2F A;  1Y1W J;  3IH3 A;  2XGD A;  2JMW A;  4A3B J;  2DA6 A;  4QTR A;  2Y9Z A;  2B63 J;  2L0K A;  4S0H B;  2K9Q A;  2R5Z A;  4IHW A;  5J1Y A;  2E19 A;  2L7M P;  3IH4 A;  2CQQ A;  5EYR A;  5C44 J;  3S14 J;  4M3E A;  1LFU P;  1DU6 A;  3K2A A;  3G1L A;  1BW5 A;  3HKZ N;  1HOM A;  1LE8 B;  5IYC J;  2FQ4 A;  4D7M A;  2E2J J;  3ZQG A;  1ETV A;  1I50 J;  3K7A J;  1O4X A;  1TWG J;  3RZD J;  4QSH A;  2GLO A;  2OF7 A;  4GFB A;  1S7E A;  3ZQL A;  1BL0 A;  3RZO J;  3MN2 A;  5F0H A;  4MFD A; 
#chains in the Genus database with same CATH topology
 5E79 C;  3A0H C;  2XB5 A;  2MSY A;  3TKY A;  5JLX A;  4A6D A;  4CDG A;  5KCM A;  2W00 A;  4DZJ A;  4ENM A;  3G2B A;  1J9I A;  2W24 A;  2E7W A;  4HF0 A;  3JSO A;  2X85 A;  3KYC B;  1R36 A;  2VOO A;  1LFB A;  2VJJ A;  5FFX A;  5B3S H;  3N4M A;  5CLS A;  2CWE A;  1ENH A;  1OCP A;  2BW3 B;  3M9A A;  2A3S A;  1JHH A;  1NH3 A;  4LK0 F;  3W3C A;  4XOP A;  2C6Y A;  1VF9 A;  2GZW A;  5KHD A;  4O6J A;  4H0E A;  3DU6 A;  4CZZ A;  1TNS A;  2HYJ A;  3F9K A;  2JRM A;  1PDN C;  4WCG A;  1HBX G;  1TZL A;  4K2E A;  4B4C A;  1YW9 A;  1ZEL A;  1B59 A;  3DKY A;  5KAF C;  2NS8 A;  3JAM K;  3I59 A;  4XKB A;  1HST A;  1LDJ A;  2DMU A;  2XF7 A;  1XPX A;  3IAS 2;  1ACI A;  5EEH A;  1XSX A;  3BJ6 A;  5H20 A;  3WG9 A;  5DDG A;  4WK8 F;  2LP0 A;  4EVI A;  1IZ1 A;  3GTP J;  4KUM A;  3OV8 A;  5DUK A;  4C2M J;  3MZ8 A;  2EFW A;  4QPO A;  2TDX A;  4EQQ A;  2LTP A;  1XS9 A;  1W0U A;  4EM2 A;  2M1B A;  3QAH A;  1MBJ A;  4AVZ A;  4XL9 A;  3GBG A;  1U8R A;  3C3W A;  3EDP A;  3OR1 C;  5DCF A;  2YS9 A;  3E6C C;  2Z1D A;  2A5W A;  2PX9 A;  4AIH A;  2XIG A;  2QSG X;  2E1M B;  4ZTF A;  2O8K A;  2DI3 A;  4WXC A;  1B8I A;  5EJC A;  5HLI A;  1LUJ B;  3GYH X;  4HA8 A;  2R5Y A;  3JRB A;  3B73 A;  1IXS B;  1FTT A;  3CCL I;  4BAY A;  3QOP A;  4A5M A;  1HSJ A;  1CF7 B;  3HTS B;  3U1K A;  1O3S A;  5DTD A;  3VEP A;  2KIS A;  3RJP A;  3LFU A;  5ED4 A;  4AM3 A;  1ERD A;  2O0Y A;  4MO7 A;  2AQE A;  4NC8 A;  1XC5 A;  4GCV A;  2AHQ A;  4CSW A;  2IGM A;  4XN3 A;  2BOL A;  2R7Z J;  3ROU A;  2ISZ A;  3TP3 A;  1TWH J;  3LL7 A;  3OR2 C;  2HQ5 A;  2VJ4 A;  3K4L A;  5F08 A;  1XDS A;  4ZYD A;  2H1L A;  3HPG A;  4Q48 A;  3S1R J;  2EJR A;  1VQ8 I;  3L2C A;  1IUF A;  5A2Q Z;  2PJR B;  2AS5 F;  3G71 I;  1V55 H;  3T5X A;  4Q5S F;  2K9L A;  3A01 B;  1QVU A;  2XDV A;  3OSF A;  2FBK A;  2FE3 A;  1UJ8 A;  5F6F A;  4XMY A;  2MFZ A;  2O3F A;  3E1S A;  2X9D A;  1SFK A;  3OYC A;  3HSE A;  3EUH C;  1VQK I;  4XRM A;  1GVD A;  2HQA A;  3GLX A;  3I56 I;  2VT2 A;  2GA1 A;  4D1Q A;  1LE8 A;  3GZN B;  2QWW A;  5CVR A;  2ELJ A;  3RPQ A;  1HCR A;  3EPZ A;  2MAB A;  3AL0 B;  2VE8 A;  3SXY A;  1QNT A;  4EMS A;  2QLZ A;  2ACJ A;  2HS5 A;  3HJE A;  3IP4 B;  1T08 B;  3ZN1 A;  4BYY A;  1RIO H;  1IGN A;  4L0Y B;  2DMN A;  2A6E F;  4MIM A;  5EDN A;  3DLL F;  4IPA A;  5K7Z A;  3FM3 A;  3DKW A;  2HU9 A;  2LBF A;  3BTL A;  5DS9 A;  1Z91 A;  3N05 A;  1OFC X;  1Z3X A;  3M07 A;  3P9I A;  3ESW B;  4MNU A;  1WKM A;  5LEJ A;  3FDY A;  1ZG3 A;  1GV2 A;  3Q0V A;  2ZXH A;  1D0Y A;  2JPC A;  3F6V A;  1FWZ A;  5L3G A;  3X2Q H;  4JX5 A;  2DA1 A;  4LLL A;  3S3O A;  3O2P E;  5J1R A;  3AL0 C;  3JRG A;  3M3Y J;  1APL C;  1YW7 A;  2E1N A;  4O3M A;  2OTL I;  2Q2E B;  2EZK A;  3SYT A;  3F23 A;  3GME A;  2EA4 A;  2PN6 A;  2NNY A;  1VFC A;  4LGW A;  4A69 C;  2BHY A;  3LFK A;  3HOX J;  2DJN A;  3NWT A;  3R0A A;  2GWR A;  3GFM A;  3K69 A;  1OCR H;  2WV1 A;  2XKO A;  3BTC A;  2PMZ N;  5FD6 A;  2FRH A;  2XF6 A;  3A03 A;  3G1M A;  5GPA A;  1QPI A;  3CDI A;  1T39 A;  4Z6Y A;  4XLP F;  2H94 A;  3ASO H;  1FX7 A;  1ONV A;  1IXR C;  3KP3 A;  4XKV A;  1QHH D;  3CP2 A;  2ZME C;  2JVH A;  3P9C A;  2ZNZ A;  2QA4 I;  2ZFW A;  4E7I A;  3FIS A;  4HF2 A;  4HX8 A;  2CQN A;  4ZZL A;  2G7H A;  4BXU A;  3ZQ7 A;  3J7Y J;  4BE2 A;  1S5L C;  1TT5 B;  3RKW A;  2M9H A;  2UWM A;  4MLO A;  2MA3 A;  4XQF A;  1KQ9 A;  3U2R A;  3CMY A;  2FX0 A;  5D4R A;  4CHU A;  4LJZ F;  3OYE A;  1B9N A;  4XRF A;  2L54 A;  4DOZ A;  5GTH C;  5FLM J;  3CUQ B;  4L0Z B;  1Y1V J;  1MD0 A;  3HOW J;  3BDD A;  3HEF A;  2Z16 A;  2XRN A;  3CCR I;  1QVT A;  3NWS A;  1SD6 A;  2R7R A;  4N0B A;  2F5C A;  5L3F A;  1CGP A;  3K9T A;  1ETX A;  2XAG A;  2NAZ A;  1KYW A;  2P8T A;  1D5Y A;  3H9G A;  1FT9 A;  2Q0O A;  3AKZ A;  3VSK A;  2ZME B;  4P1W A;  2FF4 A;  1BR2 A;  5CVU A;  2R7S A;  2M4K A;  2XAH A;  3PSI A;  2COB A;  4HQE A;  1FP1 D;  1MMD A;  1I1G A;  4F93 B;  2OA4 A;  5K5R A;  5C4J J;  2Q2E A;  5KK1 A;  2NVY J;  3PIP F;  1X3U A;  1YQA A;  3K70 C;  2GIV A;  3PJR A;  3HOY J;  1IN5 A;  5ICC A;  4G12 A;  4C2T A;  5BQT A;  3LSM A;  1BI0 A;  2RV8 A;  1FYM A;  1ZAR A;  1XN7 A;  1IF1 A;  1FY7 A;  3TO7 A;  5D5W B;  4ENK A;  2DYR H;  5M3F J;  3H5N A;  2NS0 A;  4Y33 A;  5C4X J;  3JRA A;  5D5V B;  2OCC H;  3LWF A;  3WTZ A;  4XLN F;  3BTJ A;  3DLA A;  1S3J A;  1K4S A;  4UY8 I;  5JR3 A;  1Y6I A;  3VPR A;  3WGG A;  3NAR A;  1UHS A;  3LA3 A;  4Y3O A;  5KNL A;  2X6O A;  2EFN A;  2ICW G;  3S32 A;  2W84 A;  4RLQ A;  5GAD J;  2ZME A;  4L5I A;  4Y15 A;  1IO2 A;  2UZK A;  3S1M J;  1NG6 A;  2JA6 J;  2EA2 A;  2DQR A;  2CW8 A;  2IXS A;  3M1C A;  5IP9 J;  2K9M A;  3GZ5 A;  3S93 A;  3BR1 A;  4OAY A;  3JRD A;  1WSU A;  1WGX A;  3RKX A;  2DXI A;  2PJR A;  4OMY A;  3K1P A;  4B47 A;  2RQP A;  2JSP A;  3CCQ I;  1YLF A;  4M3F A;  5IYB J;  2OPT A;  1G3T A;  3LSJ A;  2STW A;  3W2A A;  1UAA A;  4HX7 A;  2V1N A;  3F21 A;  2KP6 A;  4CYC B;  2K4J A;  4OOI A;  5DD8 A;  2PMU A;  2ID3 A;  2LH9 A;  1WI3 A;  2PLY A;  2BHZ A;  1YIO A;  2HGC A;  1FYL A;  2JUG A;  2KL4 A;  2JPB A;  5E3M A;  2HOA A;  4M3D A;  2UXX A;  4D5F A;  4IHY A;  3QOE A;  2ZB9 A;  4BGD A;  4CCO A;  5M5X J;  1KU3 A;  3PO3 J;  4E7H A;  2EH3 A;  2ID6 A;  3OYH A;  1KU7 A;  4Q4Z F;  1SD4 A;  1HF0 A;  4JQF A;  3PIO F;  3QP6 A;  2ZKZ A;  1FBQ A;  1R00 A;  1UMQ A;  1P7J A;  3FIW A;  4XLF A;  4BQQ A;  1Y56 A;  3Q0W A;  3VYT B;  4RDU A;  3OYD A;  1UCR A;  2W1O A;  1TQP A;  1YJN I;  3J7A O;  4P5O A;  2NRA C;  3BR3 A;  3RIR A;  2EZH A;  3CQZ J;  3K4C A;  1G59 A;  3CDL A;  1JHF A;  2AO9 A;  2G0E A;  1GXQ A;  1OQY A;  1ZGJ A;  3IWF A;  2RDP A;  1WJF A;  3QPT A;  3PUB A;  3K1M A;  2FBI A;  1K6Y A;  3L7W A;  2CUE A;  1OLT A;  1H8A C;  1VQM I;  4IRG A;  2M0C A;  1V4R A;  4BJ5 C;  2A69 F;  1IRZ A;  1KGS A;  2LBF B;  5IT9 Z;  4DW6 A;  2V9K A;  3GW2 A;  4XSZ F;  2M87 A;  5E1W A;  1BJA A;  1PUE E;  1IW7 F;  5J1U A;  1KU9 A;  5M5Y J;  3GFI A;  2FA5 A;  3CJQ B;  1MSE C;  3CES A;  3MAJ A;  1LVA A;  2WAE A;  1XTA A;  2XVC A;  2COM A;  5DV5 A;  2M30 A;  3GXO A;  3G73 A;  3OYK A;  1OIS A;  1SD7 A;  1JTY A;  5IT3 A;  4F92 B;  3LAJ A;  2PMZ A;  3JRH A;  4S04 A;  3RCO A;  1JT6 A;  1MH3 A;  4RB1 A;  1AKH A;  4ZDO A;  3HXL A;  3JRI A;  2HFH A;  5IT9 K;  4FET A;  4L5E A;  1FOY A;  1Y39 A;  3CC7 I;  3CUQ A;  3VOE A;  1JUM A;  2EIL H;  3WU2 C;  4D5C A;  4CYD A;  3E0J B;  5LRS A;  2P7C B;  2ESH A;  1K78 B;  4P55 A;  4A3B J;  1G3S A;  2QZ8 A;  2EIN H;  3WTT C;  3ZMS A;  3H9Q A;  4IRH A;  4NQW A;  4JBA A;  4S0H B;  2R5Z A;  4E7K A;  4KT5 C;  2DFH A;  5F1R A;  4L9N A;  3OMY A;  3S14 J;  4XKW A;  1I5Z A;  5BOX A;  3K2A A;  1Y0N A;  2IW5 A;  4G6Q A;  2ZXI A;  3G1L A;  3L2Q A;  3HKZ N;  1IV8 A;  4XON A;  1FOX A;  1X1D A;  3ZMU A;  2FQ4 A;  2BY1 A;  3IRR A;  3CMA I;  3ZQG A;  5FLX Z;  2ELH A;  3F8F A;  1FLI A;  2AXT C;  4BUP A;  3A4C A;  1TWG J;  2DAO A;  3DFG A;  3QYE A;  2J5P A;  4RAG A;  3KPH A;  4GFB A;  3ZQL A;  2HZT A;  2X6X A;  4L9J A;  4BL0 B;  2KMU A;  2HKO A;  2IA2 A;  3UKG A;  2QUF A;  3OIQ A;  4IF4 A;  3H9J A;  5BMZ A;  1R22 A;  3JRF A;  4E7S A;  5E18 F;  2JWT A;  1ZKG A;  1K4T A;  5L3E A;  3D5L A;  1KA8 A;  2X1E A;  4ENN A;  2K02 A;  2HTS A;  4WXD A;  3SZT A;  2BYV E;  3P9K A;  2JSC A;  1DGW Y;  1FTZ A;  2WC2 A;  2DMP A;  4XR6 A;  4I01 A;  4FTH A;  2A07 F;  2QSH X;  1HKS A;  1S9H A;  4QLC U;  2F4M B;  1RUN A;  3EUK L;  2XRO A;  2I8D A;  4I98 B;  4OU0 A;  4OMZ A;  1TTY A;  4AC0 A;  3QWL A;  2CV1 A;  1P92 A;  5K7H A;  2HPM A;  4ASN A;  4IVN A;  3K1N A;  1UB9 A;  1BIA A;  2L7F P;  3KP6 A;  3P7N A;  1LDK B;  2F4I A;  2F2E A;  2XGE A;  3V8L A;  1K7A A;  2CSO A;  5HDK A;  5IYD J;  1U6G A;  1QZE A;  2QKM B;  1W1W E;  4OIP F;  1MMN A;  3CO7 C;  5J3L A;  4UUV A;  4RMN A;  1QZY A;  1XCB A;  2PJP A;  1J0R A;  3TDZ C;  3TGN A;  4H4K C;  1ZG1 A;  4XSX F;  3ABM H;  3ULQ B;  2DOD A;  1YJ9 I;  1P9Q C;  4E7Z A;  1X58 A;  5K5O A;  4PJJ A;  1Z21 A;  2DA7 A;  3NAU A;  4R8H A;  3OYL A;  5FRN A;  2DYS H;  1ZAO A;  3BP8 A;  3H0G J;  5E3L A;  1BI2 A;  4XRS G;  3CO6 C;  1JKP C;  4HQM A;  3F8N A;  2IS4 A;  1SVM A;  3MMY B;  4LB6 B;  1HQC A;  1EV7 A;  2VPR A;  3M4O J;  2STT A;  5HLT A;  3AG2 H;  4IHT A;  3FM5 A;  2E36 A;  4Y7N J;  4EAT A;  2HOT A;  3WTS C;  1MBE A;  5CQE A;  2L2O A;  1RET A;  1WHU A;  2IS2 A;  2ZO4 A;  1FOK A;  5J8C A;  3HOT A;  2DMT A;  2EV5 A;  2DLL A;  3KEQ A;  2H6C A;  2FJ1 A;  2XAU A;  2LK2 A;  4DZP A;  3W6J B;  1HC8 A;  2M8G X;  2FU4 A;  1I6X A;  2X6Y A;  3AAF A;  1D1B A;  1W5T A;  2L9S A;  2H6B A;  1RC9 A;  2JRT A;  2W57 A;  2ECC A;  4AYB N;  5DM7 F;  2P6S A;  1XGO A;  4HNV A;  1BJZ A;  1IRX A;  4ESF A;  1RNL A;  5D8L B;  1A35 A;  3AG3 H;  3KP4 A;  3FBN B;  2M8E A;  5L3C A;  3WTY C;  3QPH A;  1VND A;  4A2U A;  3IL2 A;  2E5Z A;  2P5V A;  3H92 A;  2HOE A;  5HS9 A;  4ZJZ A;  1DUX C;  1YRN A;  1HDP A;  3BCB A;  1XD7 A;  2Y75 A;  1ULY A;  3VB2 A;  4LFU A;  3CMM A;  4C9Y A;  2DQL A;  1SVL A;  2Y31 A;  1NTC A;  3TBI A;  3FF5 A;  1XSV A;  4PCQ A;  3OS2 A;  4IHS A;  5LHI A;  2GIZ A;  3TO6 A;  3F0C A;  1J7K A;  1MDM B;  4IHV A;  4KIB A;  3KLN A;  3MFK A;  4I02 A;  3OIP A;  2UXN A;  4G8X A;  3FXU A;  4BQO A;  4U7B A;  2Z9O A;  3W6K B;  4KFC A;  3BCA A;  3UNG C;  3MD2 A;  4BXF A;  3FXL A;  4HOB A;  2DT7 B;  4BBR J;  5EG0 B;  5AIP A;  4RGU A;  1CQT A;  1J2X A;  1YTY A;  3TED A;  4LD5 A;  2QM3 A;  1HLV A;  1AKH B;  3S2H J;  4PUS A;  1Z0X A;  5TGT A;  2R7O A;  2V6E A;  2DTR A;  4DBQ A;  2E1M C;  1W5S A;  2RC4 A;  3MKW B;  5IP7 J;  3L00 A;  5LGU A;  2HXO A;  5H2F C;  2I5U A;  5B1A H;  1LKX A;  2H09 A;  2JK3 A;  1T38 A;  4NQW B;  2Y69 H;  2LF8 A;  3FMQ A;  3HB9 A;  4MTD A;  1TL8 A;  1ETO A;  1ZLK A;  3B6C A;  3NEU A;  4YRV A;  2EFO A;  3GWZ A;  3I9V 2;  4GXO A;  3VSL A;  4FAS D;  1RZ4 A;  3E6D A;  5LRR A;  4C30 A;  4M6V A;  2HDW A;  4EJU A;  1E2X A;  1WJA A;  2ZBK A;  1TW2 A;  4KNY A;  4IRI A;  1MGT A;  5JVT A;  2MGQ A;  3FBI B;  2JA7 J;  1Y8R B;  2VOD A;  1OYW A;  3TOB A;  3MKL A;  1ZGA A;  3QP5 A;  3KYL A;  2A6H F;  2QKL B;  2GQQ A;  3M7G A;  2W7N A;  1QGP A;  4CCN A;  3L9F A;  1WJD A;  2HI3 A;  1G4D A;  5GP9 A;  4HAM A;  1JGG A;  3SFZ A;  5D4S A;  1OMI A;  3OYM A;  6PAX A;  3F72 A;  1UHW A;  5EZH A;  4A93 J;  3BTI A;  3CP8 A;  4NC6 A;  3S8P A;  2DPD A;  1JJ8 C;  1Z6T A;  4AU7 A;  4C3J J;  3DTI A;  4M6X A;  3IKT A;  2GOX B;  3ZRG A;  1LNW A;  1KON A;  2EQR A;  2IGN A;  2NOG A;  3HRU A;  2IS1 A;  3ABT A;  1P6R A;  2DMQ A;  5J6X A;  1LFP A;  4ZYG A;  4NB5 A;  4XNF A;  2K5C A;  1OCC H;  1ZN2 A;  2MC4 A;  1S8N A;  1XX5 A;  1Z77 A;  2Z3Y A;  3S3M A;  4EM1 A;  1ETK A;  4MTE A;  4BE0 A;  3GFL A;  4Y13 A;  2CQ7 A;  2CYY A;  4HV5 A;  1MBH A;  4PGG A;  4Y4R A;  1OJL A;  3ECO A;  2KKO A;  3RQ4 A;  1VQL I;  2GOM A;  1XMX A;  2X0L A;  5K1Y A;  2JVG A;  2CG4 A;  4ZTJ A;  1POG A;  4ZYA A;  3EYI A;  2LY2 A;  5DCM A;  4B3A A;  4NC7 A;  2DDB A;  3DPT A;  2L4A A;  3FXK A;  1RKW A;  2KZV A;  3HRM A;  1LVK A;  3HDD A;  4CCL A;  2ZXW H;  1R9T J;  2NVX J;  4G94 A;  1I27 A;  4JOM A;  2KIU A;  2KDO A;  1GDT A;  1U5T A;  1X1A A;  2Y0S A;  1QQI A;  1TLH B;  2MW8 A;  5ILV A;  4IOC F;  5A2Q K;  1ZR4 A;  4UVC A;  3WG7 H;  3S17 J;  5FKM A;  3FHN A;  3D5R C;  4AIK A;  1MZB A;  2WY8 Q;  1OCZ H;  4KMF A;  2OBP A;  2XRL A;  3KLO A;  3QPS A;  4JX4 A;  1S72 I;  2IA1 A;  1SAU A;  2VN2 A;  1UEL B;  4MHG A;  1HW1 A;  4UNO A;  1FJL A;  2IA0 A;  5LGN A;  2BY0 A;  1H89 C;  5EZG A;  5F04 A;  3HKZ A;  1IDZ A;  3OIO A;  3DEW A;  2EZI A;  2F5V A;  2WBM A;  2V7F A;  2BBY A;  2L9V A;  2BVM A;  4FIS A;  4C3H J;  3GTK J;  4PDK A;  1FNN A;  1XB4 A;  2H8W A;  3SHF A;  1B72 A;  3CUO A;  2D1V A;  4RB0 A;  1Z7L A;  5H6R A;  4R1H A;  2RGV A;  1HXD A;  1F9N A;  2DFI A;  4RAF A;  4CZC A;  4A5N A;  1X1P A;  2BXZ A;  1SFX A;  3H36 A;  1FPQ A;  3ERE D;  3Q3S A;  4N4N B;  3KP7 A;  2VJI A;  2GA2 A;  3FK6 A;  4KMU X;  2M34 A;  3WU0 A;  1HW5 A;  3ZN0 A;  5ILU A;  9ANT A;  2HDC A;  4I6Z A;  1A5J A;  3TOA A;  3L2R A;  2IBD A;  4OIO F;  2P0W A;  4BY1 J;  1ZHF A;  2WTE A;  4OAZ A;  4ZC3 A;  5J8F A;  4KYW A;  1VTN C;  4CXF A;  4M73 A;  2HZD A;  2LNB A;  2R5Y B;  2XB0 X;  4YII A;  1MNE A;  3GLL A;  1ZR2 A;  1ZQ3 P;  3GCM A;  1OR7 A;  4KN4 X;  2A5Y B;  2FUG 2;  4M3G A;  4E4H A;  1IN6 A;  1ON1 A;  2DTZ A;  2ISY A;  3T0Y A;  3CF5 F;  4BJ6 C;  4EV0 A;  2VT3 A;  1YIJ I;  2MG4 A;  1NG7 A;  5E1Z B;  4UVA A;  2F4O B;  4HW0 A;  2VIX A;  4JX6 A;  1YI2 I;  3I0T A;  1ZRE A;  3GO5 A;  2ZFU A;  1XSD A;  3LAP A;  1ON2 A;  2W48 A;  4RAZ A;  1IDY A;  5B1B H;  2KRF A;  4IXA A;  4L9V A;  2VI6 A;  1EA3 A;  2DU9 A;  5DYM A;  4BH9 A;  3BZC A;  2DT6 A;  4LK1 F;  1I3A A;  2HPI A;  3I58 A;  3G6E I;  3I4P A;  2CMP A;  2HXI A;  3HSR A;  1MNM C;  3FMS A;  5H6Q A;  2IAI A;  5D8K B;  2CH0 A;  3DP7 A;  3GX4 X;  1UST A;  1OCO H;  4XK4 A;  3SZG A;  1AA7 A;  3WHB A;  1W7P D;  3QQA A;  4EGY A;  1U78 A;  2UUZ A;  3HSF A;  2R0Q C;  3LSP A;  1T56 A;  2R7V A;  4G7Z F;  1PJR A;  2KT0 A;  2NS7 A;  2IP2 A;  3GF2 A;  4KJZ A;  5E3N A;  4DNC A;  4B44 A;  1K83 J;  1SMT A;  3CCE I;  4A3I J;  4L5J A;  4E70 A;  1GHC A;  4WXH A;  4GDF A;  3OS1 A;  1WJB A;  2OQR A;  2IGO A;  2EFQ A;  5CVI A;  3GTQ J;  4BY7 J;  3SEZ A;  1RES A;  4MQV A;  4TV7 A;  2KIF A;  4RM2 A;  2BW3 A;  3BPX A;  4HV6 A;  2E1O A;  4F52 A;  4N9I A;  2OV7 A;  4IEJ A;  4XOT A;  2OJE D;  1IXC A;  3H5A A;  3V8K A;  1MDM A;  3GTG J;  2KJC A;  3HIF A;  2V26 A;  3E6B A;  2IS6 A;  4NDL A;  2BZT A;  2QF7 A;  1WCM J;  3JW4 A;  3VOD A;  1ZG5 A;  4M3B A;  2DFF A;  4XKC A;  3ABU A;  2GBY A;  5JHF A;  1IG7 A;  3ZOB A;  3HTU A;  1PUF B;  5B66 C;  5IPA A;  3ONQ A;  1IRG A;  5IY5 H;  2ZJQ F;  1D0X A;  5JVG F;  1DP7 P;  4YFK F;  1FYK A;  2OZ6 A;  4HST A;  1D1A A;  1R58 A;  2W25 A;  1QU3 A;  2P81 A;  1FOW A;  1IAW A;  5IOZ A;  3CF2 A;  2LC2 A;  2ZCW A;  3FHZ A;  4AD9 A;  2HWV A;  4YFN F;  3J7Z I;  2KFD A;  2LKX A;  4UXN A;  4MEY F;  3KCC A;  1XMA A;  5D6E A;  4ZYH A;  3PNT A;  4V2F A;  2OCE A;  2XSJ C;  3IH3 A;  2JMW A;  2XGX A;  5CKT A;  4YIF A;  2IRF G;  4QTR A;  3AG4 H;  4U0W A;  2EK5 A;  4GRI A;  1O3Q A;  1JE8 A;  2E19 A;  5E8G A;  3K0L A;  5L3B A;  2CQQ A;  2M7A A;  5EYR A;  4AIJ A;  1Y0U A;  1ZYR F;  4M3E A;  4NUB A;  5CYV A;  1DU6 A;  2KLO A;  3LMM A;  1YX3 A;  4L18 B;  3IC7 A;  4D7M A;  1W5C C;  2O8X A;  2VBZ A;  2KPM A;  2M5W A;  2E2J J;  4AWX B;  5EEG A;  2BXY A;  4OIN F;  3KET A;  1I50 J;  2MC3 A;  1EH8 A;  4HRI A;  2W4S A;  4PSW A;  2GLO A;  1MJ9 A;  4ITV A;  1BOA A;  5FFZ A;  2VXZ A;  3PNY A;  3DF8 A;  2JA2 A;  4RGR A;  1LQ1 A;  3KZI C;  1B6A A;  3RZO J;  2O61 A;  2FNP A;  4MFD A;  3OYF A;  3QRF F;  1OYY A;  1SEU A;  2CUJ A;  1MND A;  2FXA A;  2DT5 A;  3ERM A;  1BW6 A;  1R5I D;  4D9J A;  1P4W A;  3TP0 A;  4QWQ A;  3ZQH A;  4BU2 A;  4YIR X;  2LFB A;  2XV4 S;  2OUM A;  1YO5 C;  2CQK A;  4HX4 A;  2WAQ N;  3F22 A;  2WWY A;  4M71 A;  3CCU I;  2DK5 A;  1WZ2 A;  3WGI A;  4B3X A;  2RAE A;  2KRC A;  3ZQI A;  5FKO A;  2PQ8 A;  2MYS A;  2JUC A;  4W97 A;  4J19 A;  5K7F A;  1E3P A;  2X48 A;  2ME6 A;  3WOD F;  1MIJ A;  2VC0 A;  4ZYE A;  3OWT A;  2HYF A;  2JT1 A;  1NK2 P;  1RRJ A;  3BWG A;  1IN7 A;  3HC7 A;  3MVP A;  3MKZ A;  1ZTR A;  2FQ3 A;  2WAF A;  3BT9 A;  4XM3 A;  1QRY A;  5J47 A;  3FXR A;  4BE1 A;  5CVV A;  2RRE A;  3T8T A;  2K40 A;  2LDU A;  2NNN A;  4X6A J;  2CV2 A;  3U1D A;  4OWR B;  5FRO A;  2R7Q A;  1JTX A;  1L0O C;  3JCU C;  5B5E C;  1Z1D A;  4RS8 A;  3AG1 H;  4JK1 X;  1JUP A;  1TNT A;  4IQ4 A;  2FML A;  2NYX A;  1BR1 A;  2TCT A;  3N97 A;  4EJV A;  1UHM A;  1XGM A;  1D1C A;  2YX7 A;  2NVQ J;  1FIA A;  4UUS A;  4S05 A;  1FEX A;  1DPR A;  3R4K A;  1MJB A;  3I55 I;  3BG3 A;  1R6R A;  2QGU A;  1X1B A;  3VWB A;  2PG4 A;  1DU0 A;  1RKT A;  2OTJ I;  1WVR A;  1HW2 A;  3B6A A;  2K3F A;  2HKX A;  3A0B C;  2CJJ A;  1OCT C;  3OSG A;  2E5N A;  1SC7 A;  3E97 A;  2A6T A;  2LG4 A;  4V2G A;  4DJA A;  1V3F A;  3VYR B;  4AVP A;  1EF4 A;  3HZJ A;  2MLG A;  1G2H A;  4LLG F;  3EUA A;  2Y2Z A;  3S1N J;  2A68 F;  2FD5 A;  1Z6R A;  3S2W A;  1MMA A;  2V6C A;  4D0P A;  2CUZ A;  3HGG A;  4XID A;  5HLG A;  3K4B A;  4CGZ A;  4XBF A;  4AID A;  3KE2 A;  4ZDP A;  3RTR A;  2IPQ X;  3PQK A;  2HR3 A;  4UHT A;  1A36 A;  5BNG A;  2EPF A;  3L2U A;  3H3U A;  1YRN B;  3D1N I;  4LG0 B;  1R23 A;  2A05 A;  3G3Z A;  3RDI A;  1TQI A;  2QEX I;  1JKR C;  5LHH A;  2MBF A;  4E7L A;  3FK7 A;  1RR8 C;  4XIC A;  4DBR A;  1ZRC A;  2KJB A;  3GEZ A;  2VE9 A;  2V1U A;  3AFH A;  3C1D A;  2V79 A;  2DOF A;  2PBI A;  2CW0 F;  2P7V B;  2BEO A;  3CCM I;  3CDH A;  1SMY F;  1R5G A;  5FJ8 J;  4BEH A;  4IOA F;  4YEL A;  4CO8 A;  5D5U B;  2VQL A;  3J80 K;  4HYE A;  4HLX A;  4MGR A;  4U0V A;  2F48 A;  4HNU A;  3KFW X;  1OR7 C;  4UV9 A;  2R7T A;  4J01 A;  3WHC A;  5ICE A;  3J81 Z;  1K78 A;  4A3L J;  2D5V A;  1IN8 A;  4XLA A;  5IOY A;  3BZ6 A;  5F0F A;  3H35 A;  4CUG A;  3HOZ J;  3WGH A;  1F36 A;  1X3Z B;  1UG2 A;  1FMV A;  5FKN A;  3JAM Z;  1H88 C;  2PFB A;  3O8G A;  1WQ2 A;  4XLE A;  2ZXJ A;  1BR4 A;  2VPL A;  5LGT A;  2EFP A;  1X4P A;  3V7R A;  1ORK A;  1JT0 A;  2KRH A;  2Y0M A;  2CQX A;  3K70 D;  2QQ8 A;  3JR9 A;  2R93 J;  1VQO I;  1ITY A;  3F6O A;  3DU5 A;  4X0G A;  1ETQ A;  4V19 K;  1YW8 A;  5J4Y A;  3LSI A;  2HVS A;  3SEQ A;  5GTI C;  1U5T B;  2VKV A;  3UR3 C;  3HUG A;  1XGN A;  1WJE A;  5GAH J;  5KVR A;  1JUS A;  5ERI A;  4G7H F;  3DEE A;  3ZXS A;  3HHG A;  3BOQ A;  2IGK A;  1GUU A;  1TWC J;  4ANJ A;  3HOV J;  3C7J A;  2DA3 A;  5CQG A;  4ABZ A;  4EEF G;  4CA0 A;  1R4N B;  3GTM J;  2V1D A;  3PQJ A;  1NK3 P;  5E17 F;  3OY9 A;  3V7S A;  1M1E B;  4G7O F;  3OL4 A;  3M8E A;  3G1O A;  4DQ2 A;  3ZR8 X;  4HSR A;  1W7P A;  3ZMV A;  3BZK A;  2GAU A;  3L1P A;  5FO5 A;  3ZCO A;  1Z7U A;  3DKX A;  4WWC A;  1P7I A;  4X1E A;  2RN7 A;  2CU7 A;  4RM3 A;  1RUO A;  1OPC A;  3KYD B;  1JJ6 C;  2IEK A;  2YSR A;  3ML6 A;  2ELK A;  1I39 A;  2QVO A;  1S29 A;  4DIQ A;  1U5T C;  2JA8 J;  2VXD A;  1D8J A;  4B8X A;  1R4M B;  2VKH A;  4CCM A;  4BQN A;  5CVJ A;  2LR8 A;  3CJN A;  3DBH B;  1Q1H A;  2BY2 A;  1WH5 A;  4A3D J;  2HVQ A;  1IRF A;  2MH9 A;  4W1U A;  3FXQ A;  1R49 A;  4CIC A;  2JTV A;  2OU2 A;  1KU2 A;  3KZZ A;  1UFM A;  1DPU A;  1K6O A;  2Y0S N;  2GXA A;  4JYK A;  2ZJP F;  5LHG A;  4MQ9 F;  2QBY B;  1S7O A;  1DP3 A;  3M8J A;  2CGP A;  3V4G A;  1GLN A;  1P2F A;  3GTL J;  1IUY A;  2LKS A;  3WTX C;  1WWX A;  3O8H A;  1LB2 A;  2O03 A;  1AOY A;  3VYU B;  3EQL F;  4QPQ A;  4MFE A;  1STZ A;  3ISP A;  2M2E A;  1ZK8 A;  3RKQ A;  4IZZ A;  3TL4 X;  2M3A A;  3MKY B;  3OYN A;  2P5L C;  5D6F A;  2VQC A;  1Z05 A;  2B9S A;  3ZMZ A;  3ZQC A;  1TT0 A;  1N78 A;  2LY9 A;  4I0A A;  3JTH A;  3LA7 A;  4AUX A;  5HLH A;  4RB2 C;  4BDZ A;  1D8K A;  3E5X A;  1B4A A;  1FSE A;  2H1K A;  1VQP I;  2FNA A;  3HGY A;  4BHC A;  3ZMD A;  2VLA A;  3BJO A;  5LFA A;  3CLQ A;  3CC2 I;  3SDG A;  2P6T A;  2L9N A;  1ETY A;  4GO1 A;  4UV8 A;  1B1B A;  3HBL A;  5F1J A;  1IC8 A;  2XPV A;  1HKT A;  1EH7 A;  1KQ0 A;  3OYJ A;  1G6N A;  1O7F A;  3BG9 A;  3DBR B;  2CUF A;  5HS8 A;  4RAY A;  1X3W B;  3TO9 A;  2VB6 A;  3S1Q J;  3KZY A;  2DFE A;  4II2 A;  2XPU A;  4BJT A;  4PJ0 C;  1LEB A;  4LMY A;  3Q9S A;  5C3E J;  1ODD A;  3E5U A;  4KIG A;  2MLK A;  1MMS A;  3NQO A;  1USS A;  1YIT I;  1F43 A;  4KIT B;  2LYC A;  2EBI A;  2XSD C;  4LG0 A;  2OAZ A;  2WB1 N;  3R61 A;  5E20 A;  1Y8Q B;  4RBO A;  2Q8K A;  3S3N A;  3DV8 A;  4Y17 A;  3LNQ A;  1F1Z A;  1V54 H;  1W7P B;  3HYI A;  2B7E A;  3ABK H;  1U9N A;  2R7F A;  3V42 A;  3BQY A;  3LSH A;  3K4J A;  3MWM A;  4BXX J;  4KN7 X;  3VDX A;  1J75 A;  3S16 J;  1MBF A;  2YU9 J;  1D5V A;  2I10 A;  1XGS A;  3FKJ A;  2GXG A;  2QYO A;  3HRS A;  1FIP A;  1JKQ C;  2XPW A;  3K6G A;  2CRG A;  3E7L A;  3W2V A;  3K10 A;  1R1T A;  2E71 A;  4NBQ A;  4NNJ A;  3W2W A;  1JGS A;  3VYS B;  2HTJ A;  1ZRF A;  2FSW A;  4PFO A;  2VJ5 A;  1B72 B;  2ZSI B;  2QEN A;  4J00 A;  3CTA A;  2R7U A;  4PFP A;  3E5Q A;  1T6S A;  4F3Q A;  4BS9 A;  3SDB A;  2PMH A;  1RI7 A;  2EIJ H;  1ZLJ A;  2H8R A;  3WU1 B;  4BHB A;  4FX0 A;  3GTJ J;  1TWA J;  1EH6 A;  2RVC A;  2G9W A;  3HL2 A;  3WE2 A;  4A3M J;  3A2K A;  5FGM A;  3DXJ F;  4LOC A;  4KIF A;  3GFJ A;  4EGZ A;  3COA C;  1BI3 A;  3OOP A;  4R79 A;  4I99 C;  1ETW A;  3PL8 A;  2LKP A;  2RNJ A;  1SAN A;  3PM1 A;  2PI0 A;  3TW6 A;  4I76 A;  2HOS A;  2E34 A;  2KQR A;  1FMW A;  2K86 A;  2LD5 A;  3M1E A;  2CFO A;  3ABL H;  5J4V A;  3ECH A;  5DEQ A;  3MZY A;  5DCM B;  4I2O A;  4EJT A;  1B9M A;  2G7U A;  2YU3 A;  4EJO A;  2E2H J;  2BY3 A;  3PNV A;  1H0M A;  2IT0 A;  3S2D J;  3BG5 A;  2ADU A;  3BJA A;  4NHJ A;  5FLX K;  3BC8 A;  2XGD A;  1WRJ A;  1Z67 A;  2EIK H;  2Z5U A;  4F91 B;  1R1U A;  2DA6 A;  2Y9Z A;  1BM9 A;  2L0K A;  2DPU A;  2B63 J;  1TP4 A;  4IHW A;  5J1Y A;  5ILS A;  4PJM A;  5BPD A;  2L7M P;  4RGX A;  2JZY A;  3RPU A;  5C44 J;  1DGR M;  2VAS A;  3F8M A;  1LFU P;  1J5Y A;  1BW5 A;  3C2G A;  1HKQ A;  1HOM A;  1LE8 B;  3FX3 A;  2DOE A;  5FB2 A;  3ASN H;  3KP5 A;  1CF7 A;  2DDA A;  3H1C A;  3D0S A;  3U9G A;  2EV6 A;  2LRE A;  2P5K A;  3VFZ A;  3QU3 A;  5BS6 A;  3K7A J;  5CPR B;  1O4X A;  2KIQ A;  2K27 A;  3RZD J;  3I59 B;  3I64 A;  3ZQQ A;  2DW4 A;  1PVE A;  3I53 A;  2YPR A;  4B48 A;  1YFH A;  3IUO A;  3MEX A;  1TQM A;  3O3K A;  5DUI A;  4BDY A;  3WTW C;  2AQF A;  4I7H A;  4II3 A;  3MN2 A;  1TBX A;  3QPL A;  5F0H A;  3CCJ I;  1PUF A;  5HDN A;  3A02 A;  5HDG A;  4FCY A;  2P4W A;  2ME0 A;  1X2N A;  1G8X A;  2H27 A;  3RYR A;  5HOO A;  2BGC A;  1IJW C;  2HVR A;  4LG3 A;  3IH2 A;  3WE3 A;  2VBY A;  2TRT A;  4YFX F;  2KIM A;  3IV5 A;  3DEU A;  3F3X A;  2IJL A;  5HS7 A;  3Q5F A;  1JKO C;  1N77 A;  3EUH A;  2NVT J;  3KP2 A;  4A0Y A;  2HQR A;  1XDU A;  1JI8 A;  4ENJ A;  3HOS A;  4RA2 A;  4FE7 A;  3DCF A;  2F6C A;  1VQ9 I;  1B8I B;  1YHQ I;  4E7J A;  1PP8 F;  4FT8 A;  1J59 A;  4GYG A;  1S6L A;  3JRE A;  4KA4 A;  2E1C A;  2HDD A;  2VOP A;  2VBW A;  1SVO A;  3I54 A;  2Q1Z B;  1AU7 A;  4UUT A;  3PFI A;  2R7D A;  3JTG A;  3LSR A;  5FD5 A;  4A3F J;  3R6S A;  3BR5 A;  2V1X A;  3KEY A;  1H9T A;  4HBL A;  1WH7 A;  5HNH A;  2XAS A;  5KAI C;  4Q47 A;  3OS0 A;  4GYI A;  1K79 A;  2VUM J;  1KQ8 A;  1BA5 A;  5EEA A;  4IJA A;  2DO7 A;  5J40 A;  2L7Z A;  4ZDL A;  5LBQ A;  1R5H A;  4XN0 A;  3PFY A;  4QIW N;  1QA6 A;  1GVJ A;  2ETH A;  4IQJ A;  1TWF J;  3KEO A;  4M72 A;  2DJI A;  2V9P A;  3DTE A;  4AYB A;  5LD2 C;  1R7J A;  4XRS A;  2DA4 A;  4HZF A;  1U0J A;  5FLV A;  1LEA A;  1N25 A;  2VQG A;  1BIB A;  2FOW A;  4ZH4 F;  3BR6 A;  1MKM A;  2XHK A;  1E3O C;  1GXP A;  5FRM A;  3CJR B;  2E2I J;  2UV1 A;  1SFE A;  3FXO A;  1ZGW A;  2X1C A;  1I1S A;  2K9S A;  2DA2 A;  1P4A A;  2OQG A;  3OYG A;  2EZL A;  2AXL A;  3FWE A;  5GAG J;  3E6M A;  2XKP A;  2R4G A;  2QQ9 A;  3EYY A;  3TW7 A;  2D2W A;  1QPM A;  4G6T B;  1O7L A;  4ESB A;  3CCS I;  2O5R A;  1Z3Y A;  1MBK A;  3Q9V A;  4XLH A;  1VQ7 I;  3FXM A;  2O9L A;  4G9Y A;  2DK8 A;  4DYR A;  2LOO A;  3I4M J;  3KX2 A;  4BBS J;  3HPH A;  1E0E A;  2QQA A;  1A6I A;  3CZ6 A;  4DYC A;  4UUS B;  3H3Z A;  2W82 A;  1YX5 A;  2XAJ A;  2KZG A;  4B09 A;  3R0J A;  2WA0 A;  3JRC A;  3W6V A;  4IL6 C;  5EF6 A;  4PZJ A;  1WJ5 A;  3GVA A;  3ZPL A;  2F5E A;  5GAE J;  1OKR A;  3M8F A;  4B43 A;  4CH7 A;  4DGW B;  4P9U A;  2L02 A;  4FE4 A;  4BHP A;  5ICG A;  2CS3 A;  3WTV C;  2L4M A;  3BQZ A;  3L2V A;  5HOD A;  3D5S C;  4HNT A;  4GGG A;  1FSH A;  1AHD P;  2VC1 A;  2XGC A;  3LQR A;  4ETS A;  3OOU A;  3PUF A;  2K7L A;  1YE9 A;  1C0W A;  4B1R A;  1F5T A;  2YX4 A;  1YS7 A;  4P96 A;  1SFU A;  1T8I A;  3BRO A;  5F0C A;  4BKX A;  1S7A A;  2K3P A;  3BPV A;  3I4N J;  1G3W A;  2XF5 A;  2Z2S B;  2BV6 A;  2GXB A;  2JQ7 A;  4OIQ F;  2EB7 A;  3C18 A;  3DPU A;  3DTK A;  3O6B B;  5DM6 F;  2R7W A;  4HEA 2;  4IKF A;  1DQU A;  2L01 A;  4HG2 A;  5JI6 A;  2Z33 A;  2D1H A;  1HDD C;  3NRV A;  1XCV A;  2EV0 A;  3H3V K;  4O5V A;  1F4K A;  3CCY A;  5EGO A;  1R1V A;  2DN0 A;  4RB3 C;  3FKI J;  1TW3 A;  2LLK A;  2FBH A;  2M45 A;  4IX7 A;  4IHX A;  5L3D A;  2LVS A;  3J81 K;  2FOK A;  4ZZD A;  3LSG A;  1MBG A;  2L3D A;  4FHT A;  4A3J J;  3BY6 A;  2NVU B;  4Y52 J;  4ESJ A;  1LDD A;  3OYB A;  4BNC A;  4MEX F;  4A0X A;  5FKL A;  3GTO J;  2E7X A;  2E35 A;  4LIT A;  1L3L A;  3OYI A;  2X4H A;  4D7N A;  2ZNY A;  2B0L A;  1ZRD A;  1QHG A;  1YG2 A;  3QOD A;  1SFO J;  4RLF A;  4M74 A;  3K4M A;  3MQ0 A;  5TRD A;  4BAC A;  2EWN A;  1FZP B;  2VKD A;  1PYV A;  3BLY A;  1QBJ A;  5DD4 A;  1Q1V A;  4UB6 C;  3K4N A;  3LA2 A;  5FKK A;  1O3T A;  1EJ9 A;  1VQ6 I;  3BR0 A;  2CW7 A;  2CFX A;  2FMY A;  3ELK A;  2X1D A;  1QO0 D;  3R60 A;  3SFI A;  2Y9Y A;  1VZ0 A;  1W36 D;  1QZZ A;  3IWZ A;  5E3O A;  2ECB A;  1VQ5 I;  3ZGK A;  3ZMT A;  3FZV A;  4HPQ A;  5E8I A;  5E1X A;  3H5R A;  2QQB A;  4CCK A;  3PO2 J;  2CO5 A;  1W36 C;  4PGH A;  5IP6 A;  4FQG A;  3I71 A;  1WPK A;  5GPC A;  1E17 A;  2DCE A;  2R92 J;  1MSF C;  1OYI A;  2VKE A;  4HDU A;  2JA5 J;  4XLC A;  3SJM A;  4P9F A;  1O3R A;  3EET A;  3RSN A;  1X1C A;  5JFR A;  2WAD A;  2WB1 A;  4KIS A;  3KIO A;  2O6G E;  3ZQF A;  1FC3 A;  1GV5 A;  3BR2 A;  3QYF A;  4JP0 A;  5D5X B;  3DBL B;  2HYG D;  1YS6 A;  2JJ7 A;  2MD5 A;  3IHU A;  3RKY A;  2YR2 A;  3E3V A;  4BEH B;  3LSK A;  1YJW I;  3S15 J;  2LY1 A;  2R5Z B;  2HQN A;  1YOV B;  1MH4 A;  4C3I J;  3L2W A;  1BN5 A;  4F55 A;  4U0Y A;  3FMR A;  4A3E J;  1FBU A;  5LEK A;  4YEJ A;  4M9S A;  3OL3 A;  1SD5 A;  5AON A;  1Z9C A;  1BC7 C;  1D0Z A;  4UVB A;  3JSP A;  3P5J A;  2KDZ A;  2XUB A;  2XAF A;  1N75 A;  2M7B A;  4KDP A;  1A6Q A;  1U8B A;  1E3H A;  4LB5 A;  2OC6 A;  2OD5 A;  4XOR A;  4HLY A;  2RKH A;  2CV0 A;  2A61 A;  1G3Y A;  2R3S A;  5JHU A;  3HRT A;  4PSX A;  5AIQ A;  1REP C;  4A3C J;  4L9T A;  2NOJ B;  3C2B A;  4M9X A;  5ICF A;  5F27 A;  3CCV I;  3PSF A;  1W0T A;  2N8G A;  3V8J A;  2F5D A;  1O57 A;  1UG0 A;  3F8B A;  2V4J C;  4PJN A;  3MCZ A;  2K4B A;  3J80 Z;  3H0D A;  3GZ6 A;  1UZC A;  1FP2 A;  4PK4 A;  2ZC2 A;  3CLO A;  3HUG B;  1I3Q J;  2HNH A;  3F8C A;  1VQN I;  3Q0U A;  3T1B A;  3IAM 2;  3T8R A;  4KIC A;  2GM4 A;  3RYP A;  1T0F A;  2VL8 A;  5CJ9 A;  1JXS A;  4A6E A;  4IO9 F;  4WF2 A;  4G6D A;  3HOU J;  3RQI A;  4M6Y A;  2NXN B;  3TQN A;  2QBY A;  3CJT B;  2Y30 A;  2R7X A;  2EIM H;  1X2M A;  3K4K A;  2O7O A;  2VBX A;  1SAX A;  1XG1 A;  4KT6 A;  5EGO B;  2ZJ2 A;  1P4X A;  3CME I;  3IRQ A;  3MZH A;  3C2H A;  1PP7 U;  1A31 A;  1U9O A;  2W85 A;  3J7A Y;  1T2K A;  1K61 A;  2XC7 A;  4OIR F;  4DYQ A;  2K85 A;  2ZJR F;  3SZP A;  2LF7 A;  3OYA A;  3GUD A;  5TJJ A;  3B02 A;  2VON A;  1WJC A;  4CYC A;  1WFX A;  2OZU A;  4A3G J;  2DA5 A;  1MJA A;  2DBB A;  3CC4 I;  3LOC A;  2JN6 A;  4LIV A;  2QSF X;  1T33 A;  2K9N A;  1BBY A;  2QCO A;  2ESN A;  1D3Y A;  2D45 A;  2M0M A;  4LLN A;  3I3L A;  2V9V A;  2X6W A;  5F64 A;  2LMD A;  3U21 A;  2X51 A;  1A04 A;  2L9R A;  2HEO A;  4RGS A;  5M3M J;  4HF1 A;  1GT0 C;  2PEX A;  3I5U A;  3HM5 A;  5LLQ A;  1WI9 A;  3HHH A;  1IV6 A;  4Z2Y A;  3QYB A;  1U2W A;  4A0Z A;  1MMG A;  3A1Y A;  3ZP5 A;  3FXJ A;  1T95 A;  5HVQ C;  1LJ9 A;  2KHM A;  4E6K G;  4ON0 A;  4EM0 B;  2L7K A;  4N4O B;  5TIS C;  1RR7 A;  5HNF A;  4U7D A;  3V7C A;  3IKV A;  3WTU C;  4A12 A;  5BPI A;  4BQA A;  4C2U A;  2WV0 A;  1YYV A;  1IN4 A;  1T0F C;  3TDU C;  1EKE A;  1H9G A;  2YUS A;  2LRD A;  1VI0 A;  3LST A;  1I6H J;  4WX9 A;  1KZH A;  1RPW A;  2M4G A;  1VQ4 I;  1AWC A;  2BVL A;  3SQN A;  2Y48 A;  3A01 A;  5K5Q A;  2WAQ A;  1V5E A;  4LIU A;  5JLW A;  1V5G A;  4CCJ A;  1NHA A;  4PJL A;  2F5F A;  5M5W J;  3DPL C;  4M9Z A;  4A3K J;  2LSO A;  4U87 A;  5EG0 A;  3K2Z A;  4U88 A;  4I0B A;  1BOB A;  3BG7 A;  2L5Q A;  1W4M A;  1TC3 C;  3CD6 I;  1Y1W J;  3TMO A;  1J09 A;  2VQH A;  3REO A;  4YG2 F;  1U3E M;  2XAQ A;  2MD0 A;  2K9Q A;  3RI4 A;  1MW7 A;  4F7Z A;  3IH4 A;  3LQQ A;  2Z99 A;  1X19 A;  2RQQ A;  3QU6 A;  4FX4 A;  3G4S I;  2RNG A;  3RPU D;  2BE5 F;  4HDV A;  2MH2 A;  2DOA A;  1R71 A;  1X4O A;  5IYC J;  3DQV C;  3CUQ C;  1KYZ A;  1LPQ A;  1BC8 C;  3HG9 A;  1ETV A;  1HA8 A;  1XMK A;  4I09 A;  2E60 A;  4UB8 C;  2ZSH B;  1BI1 A;  2IVM A;  4EJW A;  1V5F A;  2J5O A;  3BG6 A;  3L09 A;  1T98 A;  4QSH A;  1ZH5 A;  1DDN A;  2OF7 A;  4N9H A;  1S7E A;  3DWL E;  2WY7 Q;  1BL0 A;  1FBS A;  2FEZ A; 
#chains in the Genus database with same CATH homology
 3A02 A;  2XB5 A;  2MSY A;  5JLX A;  3JRF A;  4FCY A;  4DZJ A;  2JWT A;  1ZKG A;  2ME0 A;  3UKG A;  1BW6 A;  1X2N A;  3TP0 A;  3ZQH A;  1IJW C;  2LFB A;  1LFB A;  2WAQ N;  3IH2 A;  1FTZ A;  2DMP A;  1ENH A;  1OCP A;  2TRT A;  3IV5 A;  4FTH A;  1JKO C;  2NVT J;  2RAE A;  3ZQI A;  5FKO A;  4W97 A;  4J19 A;  1VF9 A;  5K7F A;  2X48 A;  2ME6 A;  2HYJ A;  4AC0 A;  1NK2 P;  4FE7 A;  3DCF A;  5K7H A;  1B8I B;  3MVP A;  1ZTR A;  2L7F P;  3BT9 A;  4B4C A;  1QRY A;  3JRE A;  2HDD A;  2XGE A;  2NS8 A;  5IYD J;  1AU7 A;  4UUT A;  2K40 A;  3LSR A;  5J3L A;  4X6A J;  4A3F J;  3BR5 A;  2DMU A;  1WH7 A;  2VUM J;  1JTX A;  1BA5 A;  5EEA A;  1JUP A;  2LP0 A;  2L7Z A;  1X58 A;  3GTP J;  4C2M J;  3NAU A;  2DA7 A;  4QIW N;  3H0G J;  5E3L A;  2TCT A;  4XRS G;  2LTP A;  1XS9 A;  1W0U A;  1JKP C;  2NVQ J;  1TWF J;  1FIA A;  4UUS A;  1MBJ A;  3GBG A;  2VPR A;  3M4O J;  1FEX A;  3BG3 A;  2YS9 A;  4XRS A;  4Y7N J;  2DA4 A;  2HOT A;  1MBE A;  1RKT A;  1DU0 A;  5FLV A;  1RET A;  3BR6 A;  3B6A A;  2O8K A;  1E3O C;  2CJJ A;  2DMT A;  3OSG A;  1B8I A;  1OCT C;  2E2I J;  2FJ1 A;  1ZGW A;  2K9S A;  2LK2 A;  4DZP A;  2DA2 A;  4V2G A;  2M8G X;  2R5Y A;  2EZL A;  3JRB A;  1EF4 A;  1FTT A;  1G2H A;  3TW7 A;  2Y2Z A;  3S1N J;  4AYB N;  2ECC A;  3QPL A;  5DTD A;  2FD5 A;  4HNV A;  1BJZ A;  1MBK A;  4MO7 A;  1XC5 A;  2O9L A;  3HGG A;  4XID A;  1VND A;  2AHQ A;  4DYR A;  1YRN A;  1HDP A;  2R7Z J;  3I4M J;  3TP3 A;  4BBS J;  1TWH J;  1A6I A;  4DYC A;  4UUS B;  2HQ5 A;  2Y31 A;  1NTC A;  5F08 A;  5BNG A;  3JRC A;  3F0C A;  4IHV A;  3W6V A;  3S1R J;  5EF6 A;  3D1N I;  1YRN B;  1IUF A;  1JKR C;  3FK7 A;  4BBR J;  5EG0 B;  3A01 B;  1QVU A;  4FE4 A;  4XIC A;  3OSF A;  1CQT A;  3BQZ A;  3TED A;  2X9D A;  5HOD A;  1HLV A;  4XRM A;  1GVD A;  1AKH B;  1AHD P;  2XGC A;  3OOU A;  1LE8 A;  3S2H J;  1Z0X A;  5FJ8 J;  1HCR A;  4B1R A;  5IP7 J;  4BKX A;  5F0C A;  2HXO A;  1IGN A;  2JK3 A;  2DMN A;  3I4N J;  4MIM A;  5EDN A;  3HB9 A;  3WHC A;  4A3L J;  5K7Z A;  2D5V A;  1ETO A;  5IOY A;  3BTL A;  5DS9 A;  5F0F A;  1HDD C;  1OFC X;  3B6C A;  3HOZ J;  3H3V K;  3CCY A;  5EGO A;  1F36 A;  1UG2 A;  5FKN A;  2DN0 A;  1H88 C;  3FKI J;  4M6V A;  1GV2 A;  3O8G A;  3Q0V A;  2LLK A;  4IHX A;  2LVS A;  2MGQ A;  2JA7 J;  3LSG A;  1MBG A;  4JX5 A;  3MKL A;  4A3J J;  1ORK A;  2DA1 A;  1JT0 A;  2CQX A;  4Y52 J;  5J1R A;  3JR9 A;  2R93 J;  3JRG A;  3M3Y J;  1ITY A;  1APL C;  1ETQ A;  5FKL A;  3GTO J;  2EZK A;  2HI3 A;  5GP9 A;  1VFC A;  4D7N A;  1JGG A;  1SFO J;  4A69 C;  3HOX J;  2DJN A;  5EZH A;  2VKV A;  4A93 J;  3BTI A;  2WV1 A;  3BTC A;  1JUS A;  2PMZ N;  1JJ8 C;  3A03 A;  3G1M A;  5GPA A;  1Q1V A;  4C3J J;  1GUU A;  1TWC J;  5FKK A;  1QPI A;  3HOV J;  2EQR A;  2DA3 A;  4ABZ A;  2NOG A;  4EEF G;  3GTM J;  2DMQ A;  1NK3 P;  3FIS A;  3BR0 A;  3SFI A;  2Y9Y A;  3G1O A;  1Z77 A;  2ECB A;  5E3O A;  2M9H A;  4MLO A;  1ETK A;  3L1P A;  3CMY A;  1P7I A;  2FX0 A;  4X1E A;  1MBH A;  3PO2 J;  1OJL A;  2CU7 A;  5IP6 A;  1JJ6 C;  2IEK A;  5FLM J;  1POG A;  1Y1V J;  3HOW J;  1WPK A;  4B3A A;  5GPC A;  2ELK A;  3HEF A;  2R92 J;  1MSF C;  1QVT A;  2JA8 J;  2VKE A;  2JA5 J;  1RKW A;  3SJM A;  2LR8 A;  1ETX A;  3HDD A;  1WH5 A;  4A3D J;  1D5Y A;  1R9T J;  2NVX J;  4W1U A;  3ZQF A;  1GV5 A;  3BR2 A;  4JP0 A;  1GDT A;  2MW8 A;  2COB A;  2Y0S N;  4JYK A;  2JJ7 A;  1ZR4 A;  3S15 J;  3S17 J;  5C4J J;  5FKM A;  2R5Z B;  2NVY J;  3GTL J;  2XRL A;  1MH4 A;  3QPS A;  4C3I J;  4JX4 A;  3O8H A;  3HOY J;  4G12 A;  4A3E J;  1FJL A;  1PUF A;  4MFE A;  1H89 C;  2M2E A;  5EZG A;  5F04 A;  2KDZ A;  1IDZ A;  1ZK8 A;  3OIO A;  3DEW A;  2EZI A;  3RKQ A;  5M3F J;  5C4X J;  3JRA A;  1U8B A;  4FIS A;  4C3H J;  3ZQC A;  3GTK J;  1B72 A;  2LY9 A;  3BTJ A;  4AUX A;  2H1K A;  3VPR A;  4A3C J;  3HGY A;  3NAR A;  3Q3S A;  3C2B A;  1UHS A;  5F27 A;  3FK6 A;  3SDG A;  2X6O A;  1W0T A;  2N8G A;  1ETY A;  2M34 A;  3HBL A;  5F1J A;  1IC8 A;  9ANT A;  2XPV A;  4I6Z A;  1A5J A;  3BG9 A;  2IBD A;  3S1M J;  4BY1 J;  2CUF A;  2JA6 J;  5IP9 J;  1I3Q J;  2R5Y B;  2XB0 X;  3S1Q J;  3BR1 A;  2XPU A;  1ZR2 A;  3Q0U A;  1ZQ3 P;  3JRD A;  1WGX A;  5C3E J;  2GM4 A;  4M3G A;  2DTZ A;  1F43 A;  2MG4 A;  2EBI A;  2XSD C;  4M3F A;  5IYB J;  2OPT A;  2WB1 N;  3LSJ A;  4JX6 A;  4RBO A;  3HOU J;  3RQI A;  3LNQ A;  2W48 A;  2Y30 A;  1IDY A;  4CYC B;  1X2M A;  2O7O A;  1XG1 A;  2ID3 A;  1WI3 A;  2VI6 A;  5EGO B;  1U9N A;  3BQY A;  4BXX J;  5E3M A;  1U9O A;  3S16 J;  2HOA A;  2HXI A;  1MBF A;  4M3D A;  1K61 A;  1MNM C;  4D5F A;  2YU9 J;  4IHY A;  2IAI A;  2ZB9 A;  2I10 A;  4XK4 A;  4DYQ A;  5M5X J;  3WHB A;  3PO3 J;  2EH3 A;  2ID6 A;  3QQA A;  1U78 A;  1FIP A;  2R0Q C;  1JKQ C;  1HF0 A;  2XPW A;  4CYC A;  3LSP A;  1T56 A;  4A3G J;  1UMQ A;  1P7J A;  2CRG A;  2KT0 A;  3E7L A;  3FIW A;  2NS7 A;  3Q0W A;  5E3N A;  4RDU A;  2DA5 A;  1K83 J;  4A3I J;  3BR3 A;  3LOC A;  2EZH A;  2JN6 A;  1B72 B;  3CQZ J;  3CDL A;  1T33 A;  2K9N A;  2QCO A;  2AO9 A;  2G0E A;  3GTQ J;  4BY7 J;  1RES A;  2CUE A;  2H8R A;  1H8A C;  2E1O A;  2L9R A;  2M0C A;  5M3M J;  4IEJ A;  1GT0 C;  3GTJ J;  3HM5 A;  1IRZ A;  1TWA J;  1IV6 A;  3GTG J;  4DW6 A;  4A3M J;  4NDL A;  4LOC A;  2QF7 A;  5J1U A;  1WCM J;  5M5Y J;  4M3B A;  1RR7 A;  2GBY A;  1MSE C;  1IG7 A;  3ZOB A;  1PUF B;  1ETW A;  2YUS A;  1SAN A;  1VI0 A;  5IPA A;  1I6H J;  3PM1 A;  3TW6 A;  4I76 A;  2HOS A;  1RPW A;  1JTY A;  3JRH A;  1JT6 A;  1MH3 A;  1AKH A;  3A01 A;  3JRI A;  2LD5 A;  2P81 A;  4L5E A;  5IOZ A;  5JLW A;  5M5W J;  4A3K J;  1JUM A;  5EG0 A;  2E2H J;  4D5C A;  2LKX A;  3S2D J;  3BG5 A;  1TC3 C;  4V2F A;  1Y1W J;  3IH3 A;  2XGD A;  2JMW A;  4A3B J;  2DA6 A;  4QTR A;  2Y9Z A;  2B63 J;  2L0K A;  4S0H B;  2K9Q A;  2R5Z A;  4IHW A;  5J1Y A;  2E19 A;  2L7M P;  3IH4 A;  2CQQ A;  5EYR A;  5C44 J;  3S14 J;  4M3E A;  1LFU P;  1DU6 A;  3K2A A;  3G1L A;  1BW5 A;  3HKZ N;  1HOM A;  1LE8 B;  5IYC J;  2FQ4 A;  4D7M A;  2E2J J;  3ZQG A;  1ETV A;  1I50 J;  3K7A J;  1O4X A;  1TWG J;  3RZD J;  4QSH A;  2GLO A;  2OF7 A;  4GFB A;  1S7E A;  3ZQL A;  1BL0 A;  3RZO J;  3MN2 A;  5F0H A;  4MFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...