2MSYA

Solution structure of hox homeodomain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
b'ANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox protein Hox-C9
publication title Structural insight into the interaction between the Hox and HMGB1 and understanding of the HMGB1-enhancing effect of Hox-DNA binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2msyA00
1ZK8A 2N8GA 5J1RA 1YRNA 2FQ4A 3HM5A 1BJZA 4MFEA 3JREA 2H1KA 2DMTA 4EEFG 4MLOA 3JRHA 5E3OA 2XGDA 4JX6A 4M6VA 1I6HJ 2O8KA 4D7NA 5J1UA 3Q0VA 3LSRA 1GDTA 3ZQHA 1AKHB 3HB9A 3ZQIA 2LVSA 5C4XJ 5IYDJ 1JUSA 2R92J 5FKMA 1JKOC 2IAIA 1ZKGA 3NARA 5IPAA 1FIPA 2XSDC 4LOCA 2R5YB 1X58A 2ZB9A 1JKRC 2JN6A 2FX0A 1SANA 1IC8A 3GTMJ 5FKKA 2ECBA 3HGYA 4W97A 4UUSA 2Y9ZA 2KT0A 1RKWA 2YUSA 2O9LA 1XG1A 3HBLA 1GUUA 3TP3A 1Q1VA 2CU7A 4B3AA 2Y0SN 2MW8A 2XGCA 3ZQGA 3HOXJ 1JTYA 4M3DA 4JX5A 2HOAA 1T33A 3MKLA 1FTZA 2DMUA 2HDDA 3IV5A 1VI0A 2NVYJ 3JRCA 9ANTA 3WHCA 2LR8A 4B4CA 5M3MJ 3S2DJ 1G2HA 4DYRA 5BNGA 1NK3P 1ORKA 5EZHA 1ETQA 3TW6A 1FIAA 5M3FJ 1MH4A 1GT0C 5GPCA 4UUTA 2AO9A 1OFCX 1P7IA 3HOWJ 2R0QC 3BR6A 4I6ZA 1LFUP 3QPLA 5K7ZA 2XB5A 1ITYA 3I4MJ 5J3LA 5K7HA 1VF9A 1XC5A 1QPIA 2TRTA 4BBSJ 1RESA 3GTQJ 4X1EA 1MBGA 2DA3A 3B6AA 3BQYA 2NVTJ 1QVUA 1YRNB 1AU7A 3HGGA 1MH3A 3JR9A 3OSGA 1H8AC 3TEDA 1B72A 5IYBJ 4A3DJ 4MFDA 5EDNA 3O8HA 1LFBA 1BL0A 4A3CJ 2IBDA 4CYCA 4IHYA 1Z77A 3F0CA 2RAEA 4FISA 3GBGA 3GTGJ 1P7JA 5F27A 2DMPA 3IH3A 2FJ1A 2K40A 1S7EA 4DYCA 1RETA 2ID3A 2OPTA 4M3EA 1HDDC 3HOVJ 1PUFA 1TWHJ 5FLMJ 1HOMA 1RPWA 3S16J 2LY9A 3CDLA 2R7ZJ 3HDDA 1FJLA 4NDLA 3S1RJ 2M2EA 4L5EA 4A3MJ 3BR1A 1IG7A 5E3LA 5IOYA 2XPUA 2FD5A 3MN2A 2DA6A 2CUFA 2COBA 2L0KA 5FKNA 5DTDA 5F0HA 2CQQA 2DA2A 4UUSB 4DZPA 3VPRA 3Q3SA 4XRMA 2GBYA 2VI6A 4XRSA 3RKQA 2DMQA 2EBIA 2EZIA 3GTJJ 2JA5J 1A5JA 4FTHA 3ZQCA 1R9TJ 4D7MA 3HEFA 2EZLA 3BTIA 2DA7A 2JA8J 4ABZA 1T56A 4B1RA 1ETVA 2YS9A 5FJ8J 1B8IA 4A3BJ 2ELKA 4C2MJ 3LSPA 3UKGA 1Y1VJ 5F08A 5JLWA 2ME6A 4M3FA 3O8GA 4XRSG 5EG0A 2B63J 4IEJA 2NS7A 2E2JJ 1I50J 3TW7A 2TCTA 1UMQA 2I10A 3CCYA 3GTLJ 1EF4A 3ZOBA 1Z0XA 3JRGA 1QRYA 1TWGJ 3OIOA 2XGEA 4XICA 1TWAJ 4G12A 2K9NA 1W0TA 1MSFC 3BG9A 2HXOA 3I4NJ 3QQAA 2D5VA 3S2HJ 5EZGA 5IP7J 2R5ZA 1GV5A 3LOCA 2GM4A 1IUFA 2HOTA 1FEXA 5FLVA 2HYJA 2GLOA 2KDZA 4A3JJ 3ZQLA 1ETXA 1JTXA 4BY1J 1LE8A 3BQZA 2AHQA 1U9NA 2X6OA 2YU9J 2G0EA 5F0CA 4M3BA 3SJMA 4A3IJ 5J1YA 4AC0A 5K7FA 2Y30A 2LD5A 1IV6A 3C2BA 2WB1N 4MIMA 1B72B 3S14J 2DA5A 2QCOA 1JJ8C 3HKZN 5EF6A 4CYCB 3A01A 1UG2A 2CUEA 1QVTA 2EH3A 5F0FA 1MNMC 1H88C 1W0UA 4BY7J 3H0GJ 1X2MA 2EZKA 1WGXA 1JKPC 4W1UA 1HDPA 1DU0A 3BTCA 3JRAA 4HNVA 1PUFB 3ZQFA 4X6AJ 1BW6A 2E1OA 3IH4A 2R93J 5EYRA 3JRBA 1APLC 1GVDA 1WH5A 1HF0A 2MGQA 5EGOA 2DTZA 5C3EJ 2Y31A 5IP6A 4FCYA 3K2AA 3BTJA 4V2GA 2MSYA 3BG5A 4IHXA 2X48A 3JRIA 4A3LJ 3DEWA 2WAQN 2XPWA 1JGGA 1ETWA 2HI3A 1ETOA 3HOYJ 1U9OA 4IHWA 4XK4A 4FE7A 3HOZJ 5E3MA 3M4OJ 2HXIA 1HLVA 3M3YJ 1WCMJ 2VKVA 4I76A 3Q0WA 3SFIA 1IDYA 2W48A 4A69C 3MVPA 2ECCA 5IYCJ 2EQRA 3LNQA 1B8IB 5F1JA 2LFBA 1JT0A 2E2HJ 1ZR2A 2LLKA 3IH2A 2M8GX 5EG0B 1ZQ3P 3S1NJ 1JUMA 1D5YA 2CRGA 1U78A 1F43A 2X9DA 3Q0UA 4S0HB 3LSJA 3WHBA 2WV1A 3G1OA 3LSGA 5IP9J 3GTKJ 2R5ZB 3BR3A 2XB0X 2DA4A 1K61A 2L7MP 2HOSA 1MBHA 5DS9A 2LP0A 1LE8B 3JRFA 1WPKA 2VKEA 4FE4A 2H8RA 2JWTA 1MBJA 3FK7A 1BA5A 3D1NI 1X2NA 5HODA 1WI3A 1OCPA 2CJJA 1JUPA 5GP9A 5M5XJ 3S1MJ 1HCRA 3HOUJ 3A01B 1VFCA 5GPAA 2MG4A 2XRLA 3OSFA 1OJLA 3FISA 4GFBA 5FKLA 1Y1WJ 1CQTA 4A3GJ 3JRDA 1O4XA 1F36A 4QSHA 4AUXA 3BR0A 2HQ5A 2Y2ZA 3W6VA 3FK6A 5EGOB 1ENHA 2XPVA 1DU6A 2NOGA 3GTPJ 1TWFJ 4C3IJ 3S17J 1MBEA 2DA1A 3CQZJ 2NS8A 1JKQC 2NVXJ 4JYKA 2P81A 3SDGA 3GTOJ 1ZGWA 5IOZA 2DMNA 4QTRA 3K7AJ 3PM1A 1MSEC 3L1PA 3BTLA 4D5FA 5E3NA 2DN0A 4BKXA 1K83J 2JA6J 1AKHA 1IJWC 3QPSA 4DW6A 5M5YJ 3TP0A 2JA7J 2LTPA 5C4JJ 2EZHA 3RZDJ 1JJ6C 3H3VK 4IHVA 1MBFA 3S1QJ 2M9HA 1OCTC 2LKXA 2K9QA 2L9RA 2R5YA 4A93J 2CQXA 2ID6A 1H89C 3PO3J 1E3OC 1POGA 1MBKA 3E7LA 1IRZA 2JMWA 1ZTRA 1XS9A 1RR7A 1IGNA 3S15J 2E19A 1SFOJ 2LK2A 2E2IJ 2ME0A 5F04A 2M34A 1ETKA 1A6IA 3A02A 4D5CA 3G1LA 4JX4A 2IEKA 4V2FA 3NAUA 4M3GA 5EEAA 4RDUA 2Y9YA 1AHDP 4BXXJ 1UHSA 4JP0A 1NTCA 2PMZN 2JK3A 4Y7NJ 3CMYA 4XIDA 2L7FP 1VNDA 3OOUA 1JT6A 3DCFA 5FKOA 4A3EJ 3RZOJ 1ETYA 3FKIJ 2DJNA 1ZR4A 1FTTA 3A03A 4Y52J 3BG3A 1WH7A 1I3QJ 4BBRJ 4C3HJ 2NVQJ 2VPRA 2O7OA 1TC3C 4A3FJ 4A3KJ 2L7ZA 2QF7A 3RQIA 4C3JJ 1RKTA 1GV2A 3FIWA 1TWCJ 2VUMJ 2K9SA 4QIWN 4AYBN 1IDZA 3G1MA 4DYQA 4DZJA 4J19A 5JLXA 1U8BA 1BW5A 5C44J 2OF7A 3BR5A 5M5WJ 1NK2P 3PO2J 3BR2A 4RBOA 3B6CA 2JJ7A 3BT9A 4MO7A 2M0CA
chains in the Genus database with same CATH superfamily
3WODF 1IN5A 2N8GA 3K4JA 1W7PB 2V1XA 4NNJA 4XM3A 1MGTA 3HM5A 5J1RA 1W7PD 2Q1ZB 3KX2A 4MFEA 2DMTA 5FLXZ 4N0BA 5E3OA 4PJJA 1WJBA 4M6VA 3C7JA 2VJ4A 4KYWA 4LG3A 2VXZA 4CCMA 1XMKA 2ZO4A 5A2QZ 2A6HF 1XDSA 1OYYA 3GFJA 4PDKA 1QA6A 5LBQA 1G3WA 2IP2A 3K0LA 2DFFA 5C4XJ 3GUDA 1JUSA 5J4VA 1YOVB 2CV2A 2IAIA 4HEA2 1OCRH 1I1GA 3ABTA 2YR2A 1RUOA 1USTA 3H35A 1X58A 3LSIA 4IJAA 2H1LA 4XLNF 3GTMJ 1S29A 4Y33A 1R36A 4X0GA 1FSEA 2UWMA 1RKWA 3F23A 2YUSA 3I54A 1YIOA 4KT6A 1DP3A 3HBLA 3A2KA 2Y0SA 1X3WB 3DF8A 1X1CA 2XGCA 1U5TA 3FM5A 1S6LA 3HOXJ 2YX7A 3X2QH 3DLAA 2ZMEC 2HEOA 2NRAC 2HOAA 1T33A 2XAJA 4LIUA 4RB0A 1F1ZA 2EK5A 2HDDA 3PFYA 2RNJA 3JRCA 2R7FA 9ANTA 4BE2A 3J81Z 3L2UA 5M3MJ 2BEOA 2GAUA 3S2DJ 3H3UA 1ULYA 1ETQA 2FUG2 4CDGA 5H2FC 1ZLKA 1MH4A 4CUGA 3EUKL 4B43A 2X6XA 4ETSA 5GPCA 1GT0C 2HTSA 3CO7C 4B44A 4MEYF 4PZJA 2JSPA 3COAC 3HOWJ 4XL9A 4PFOA 2BV6A 2HZDA 3BR6A 1L3LA 1OR7C 4AIKA 5K7ZA 4UNOA 3CZ6A 4BQAA 5J3LA 2HS5A 5CVUA 2TRTA 5TRDA 4BBSJ 4X1EA 2ZXHA 4EQQA 3QOEA 2ZXIA 2NVTJ 3A4CA 1QVUA 1AU7A 3HGGA 4ZDOA 1MH3A 2HKXA 3TEDA 3F6VA 5TJJA 1MIJA 2KLOA 4YFXF 5TGTA 3O8HA 3EUAA 1LFBA 3FXKA 2XGXA 1BR1A 2YPRA 1YJ9I 2IBDA 2TDXA 3DP7A 3FDYA 3GTGJ 3DBRB 3GBGA 5F27A 3WTTC 2ETHA 2WWYA 5F64A 2DFIA 1R71A 2JSCA 3M1CA 3SZGA 4M3EA 4A5NA 2F48A 1U6GA 1TWHJ 2IGOA 5FLMJ 1PUFA 1MMNA 2AQEA 1HOMA 4CYDA 3CDLA 1YE9A 2PG4A 1ZG5A 4C2UA 1BI2A 2CQKA 4A3MJ 1IG7A 4UVAA 3CCMI 2XPUA 2VPLA 3VYUB 3MN2A 2B9SA 2L0KA 5FKNA 2V26A 1R58A 2CQQA 2XAFA 2DA2A 3KFWX 4NUBA 5GAHJ 1OCCH 1I6XA 4RA2A 3Q3SA 2M7BA 3GFLA 4XRSA 2BHZA 2DMQA 4ZDLA 3GTJJ 3RKQA 3ZQCA 1QO0D 3KEQA 3I58A 1Z91A 3HEFA 2Z33A 3BTIA 3F9KA 4ABZA 1IAWA 1R5ID 1FP2A 5FJ8J 1GXQA 4OINF 4A3BJ 1HQCA 1UB9A 3LSPA 4JOMA 4P5OA 4BE1A 1XCBA 4HSRA 2E1NA 2EV6A 2KPMA 3IWFA 5EG0A 4IEJA 2E2JJ 3LAJA 1I50J 3N05A 2CFOA 2TCTA 2HU9A 3HSEA 3E5XA 5ILSA 2DI3A 2DPUA 2I5UA 3DPTA 1ZRFA 2E36A 3CTAA 2MA3A 1EF4A 2KKOA 3ZOBA 1Z0XA 3JRGA 4BXUA 2DYRH 2PLYA 1FP1D 2OQRA 4G12A 4WF2A 2W1OA 3PNVA 4HSTA 2ZSHB 1WI9A 1LKXA 4IOAF 2IPQX 3KP5A 4NC6A 3QQAA 4LK1F 3CCEI 4P96A 2R5ZA 1GV5A 3RJPA 1RIOH 3MEXA 1SFKA 1IUFA 4BDYA 2KISA 3ZN1A 2P5LC 2KDOA 2HYJA 4IPAA 3DQVC 5FLVA 1X1DA 2KDZA 5AONA 3ZQLA 2E34A 2QBYB 1JTXA 1R1UA 1LE8A 3BQZA 1E3PA 1FX7A 2X6OA 3SFZA 2OCCH 5KHDA 2YU9J 1WJDA 5F0CA 4M3BA 4XLPF 2V7FA 3GLLA 5J1YA 1S7AA 3JCUC 4AC0A 1QNTA 4XONA 1IV6A 2KIFA 1SMTA 2F4IA 5H6QA 3T8TA 2WB1N 4B09A 1B72B 5L3EA 2EA2A 4E6KG 3CP8A 1BIBA 4EM2A 4CYCB 2VN2A 3B73A 3SEZA 4E7SA 1QVTA 3PQKA 3T5XA 2EH3A 1RR8C 2QQAA 3QPHA 2OQGA 1X1BA 4YG2F 3EYIA 1X2MA 2EZKA 4HPQA 4HX4A 4M72A 4BACA 4G7HF 3R0JA 4ZDPA 4AIHA 3BTCA 2DJIA 2VQHA 5ERIA 3JRAA 2DW4A 1CF7A 2R7OA 3CUOA 2E1OA 3LL7A 4GCVA 2FNPA 2R93J 3CC7I 1WH5A 2AXTC 4LMYA 2XF5A 3RYPA 1J7KA 2Y31A 2WTEA 3SXYA 3DEUA 3ZMSA 2HVSA 2MSYA 5ICFA 3VODA 3BG5A 3K2ZA 2X48A 4HRIA 2WAQA 1FT9A 1YW9A 1YW8A 2M0MA 3LA3A 1DPUA 5JHUA 1ETOA 3F8MA 3OS2A 1G3SA 3BZ6A 4NC8A 3M3YJ 3OMYA 2VKVA 3Q0WA 3MVPA 5LHGA 2JTVA 1OMIA 1PYVA 4Y15A 2VONA 3EETA 2HYFA 2O0YA 2DCEA 2ESHA 5K1YA 1A36A 4RGSA 1PVEA 4JK1X 2R7WA 3HUGB 3WTUC 1ZR2A 3IH2A 1YG2A 1FWZA 3L2CA 1ZQ3P 1IXSB 3S1NJ 3QYFA 4CGZA 3OYJA 2LG4A 1D5YA 4RB3C 5CPRB 3W2VA 2BHYA 2XHKA 1J0RA 1TNSA 2ZNYA 2R7VA 3Q0UA 4EJWA 5D4SA 4RGRA 3HL2A 2G7HA 3LSGA 2X4HA 1TQMA 3GTKJ 1I27A 2GIZA 4OIPF 2KMUA 2DA4A 2HYGD 4RB1A 1T38A 2GXBA 3WTVC 1HC8A 1WPKA 3K10A 4HBLA 3BP8A 1YX5A 4QPOA 2JWTA 1MBJA 1BA5A 2MD5A 3FXQA 1ZLJA 4XN0A 1WI3A 2Z2SB 3F21A 2ZMEB 2W00A 1IN8A 1YI2I 1X4OA 1ZG3A 5LLQA 3A01B 5J4YA 1VFCA 2DT5A 3IRQA 1O7LA 4S04A 3TO9A 4YRVA 3LAPA 1F4KA 3ZMZA 2WAEA 5L3DA 1Y8QB 4KA4A 2OD5A 1IXRC 2OC6A 4RS8A 4M71A 5TISC 2B7EA 3KP2A 4HNUA 1F36A 2IGKA 4AUXA 1A6QA 2OJED 3Q9SA 2DQRA 2DO7A 3BDDA 1W36D 4RGUA 2Y2ZA 3W6VA 5FFZA 4PJNA 5LGUA 1YJWI 3I53A 3DTKA 1TL8A 1DU6A 3GYHX 4ENKA 1WWXA 3LA2A 1OYWA 1VQ6I 2GXAA 1DUXC 2CS3A 1DDNA 1EV7A 2A3SA 1LPQA 1JKQC 2QSFX 2EB7A 4HF0A 2BY3A 1FBSA 2XKOA 3EDPA 3PNYA 3ZMUA 3GTOJ 5AIQA 2ZMEA 4CCOA 2P7VB 3ZN0A 2CWEA 3I3LA 3PM1A 5ILVA 3LSTA 3BTLA 1ZH5A 3ML6A 2DN0A 1K83J 2DODA 2LY2A 1AKHA 1IO2A 1OPCA 3E1SA 2H8WA 3QPSA 3RKYA 4BQNA 4E7KA 2E35A 1IJWC 4FX0A 4IQ4A 3TP0A 3ZMDA 2LTPA 5D6EA 3RZDJ 3GVAA 5B1BH 1JJ6C 5HS7A 4IHVA 1MBFA 1YIJI 2LKXA 3M7GA 1VQNI 1Z67A 1X4PA 2QM3A 3BPVA 4A93J 4H4KC 2GOMA 1OR7A 3DU6A 5B5EC 2CQXA 3BJOA 2LKPA 2LDUA 5JI6A 1XGMA 1MBKA 3E7LA 1KQ8A 2UUZA 2H94A 2M1BA 1SD4A 1XS9A 1RR7A 4RAZA 3S15J 3AKZA 3H92A 2ME0A 1HW1A 4XLEA 5F04A 4MHGA 2XAHA 4BHCA 3AG4H 3A0HC 3G1LA 4RDUA 4M3GA 3OIPA 3PFIA 1XB4A 4ENNA 1AHDP 1V5FA 5GAEJ 2P7CB 1JI8A 4JP0A 1NTCA 1AWCA 2PMZN 4UV8A 1KYZA 4M74A 4OOIA 3CMYA 4XIDA 3CJTB 4G7ZF 3E0JB 3TGNA 4DGWB 3OYFA 5B66C 5ILUA 4WXHA 2VE8A 1G3YA 5FKOA 4GDFA 3I59A 2BE5F 3F8FA 3DPLC 4Y52J 1XSVA 4IRGA 4DOZA 4LFUA 4YELA 4BDZA 1TC3C 2CW0F 4A3KJ 2QF7A 2L2OA 3HHHA 2BY1A 1RKTA 4E7LA 1Y0NA 3AFHA 3CMAI 2EIKH 4AYBA 4QIWN 4DZJA 4J19A 1BW5A 1ZYRF 2OF7A 2ZFWA 2W57A 3BR5A 4KDPA 3PO2J 2Q8KA 3L2VA 5DM6F 3ONQA 5DCFA 1N25A 1R4NB 3B6CA 4LJZF 1IRFA 3CLOA 2QKMB 4XKWA 1YRNA 4DNCA 5LGNA 2DFHA 3KYDB 5DM7F 2NXNB 5F1RA 2P6TA 2H1KA 4EEFG 4MLOA 1OKRA 5AIPA 4WX9A 2XGDA 1GLNA 4JX6A 2V9VA 2O8KA 2ZJ2A 3IL2A 1QGPA 3H5NA 3LSRA 2STTA 1YFHA 4IOCF 2G7UA 3ZQHA 3I55I 1EH6A 4CO8A 4YFNF 5CVIA 1VQ7I 3TBIA 5HLHA 4GYIA 3GO5A 3OYLA 2FSWA 1FYLA 2M4GA 1TT5B 1HSJA 4IRHA 4HAMA 3K70C 1MDMB 4OMYA 3A0BC 1HKSA 4CCLA 4XKVA 3LWFA 5IPAA 3RPUA 3DKYA 4LOCA 2R5YB 1ZN2A 3RYRA 5K5QA 4EGYA 4HNTA 3JTHA 2ECBA 3PSIA 1G4DA 4P9UA 1I1SA 4W97A 4UUSA 2ZBKA 2OV7A 3V42A 4I99C 3HRUA 4U0YA 1MMAA 1GUUA 1UHMA 3F72A 2NOJB 1SVLA 4OU0A 2PFBA 1WJ5A 3AL0C 5BQTA 2PI0A 3L2QA 1WJCA 1S9HA 3MFKA 4F7ZA 3LSHA 4I7HA 5LFAA 1ZGAA 1RUNA 1V5EA 2OA4A 2E60A 1FTZA 1S5LC 3BY6A 2VKHA 2NVYJ 3E3VA 3ZCOA 2HWVA 2BGCA 1MDMA 1G2HA 5IT3A 2LBFB 5EZHA 4XKCA 2DBBA 1ZHFA 1MJ9A 1FIAA 2QKLB 2L01A 4NQWB 4U7DA 2XAUA 1FOXA 2AO9A 1P6RA 1OFCX 1BI1A 3QOPA 3FXRA 1LQ1A 4RAFA 2L3DA 2R0QC 1LFUP 2P6SA 3RDIA 1H9TA 2QQ9A 4KIBA 4UV9A 1FSHA 3VDXA 1QHGA 1ITYA 1FYKA 5K7HA 2IT0A 2K4BA 3JAMK 5E1XA 2LKSA 1Z05A 4BGDA 1QPIA 3LA7A 1T98A 3HRMA 4U0VA 1ZG1A 2L54A 2DA3A 3B6AA 3GZNB 3ELKA 3VYTB 3ECOA 2DQLA 4A12A 4ZYGA 2RV8A 2HQNA 4GXOA 3OSGA 2M5WA 1IXCA 5JVGF 1C0WA 4A3DJ 2LRDA 2IS2A 4A3CJ 2PEXA 4YIIA 2XAGA 4FISA 3DEEA 3GMEA 2DMPA 2HQAA 3IH3A 2FJ1A 3TKYA 2VOPA 3WE3A 4DYCA 1K7AA 1RETA 2K7LA 1W5CC 3HOVJ 3KZIC 1HA8A 1PUEE 2IA2A 4HLXA 2Q2EA 1KONA 1RPWA 3S16J 4IL6C 2XASA 1R00A 1LVAA 3S1RJ 3ABLH 5HS9A 3BR1A 2BZTA 2R7XA 4WK8F 2UZKA 2COBA 5F0HA 4II3A 4XSXF 5DTDA 2R3SA 1J75A 3QRFF 1RNLA 1PP8F 1N77A 4EM0B 1TW3A 1V5GA 2GZWA 3FXLA 2EZIA 5BS6A 4FTHA 1R9TJ 1D0YA 2JT1A 2STWA 2CO5A 1U5TB 2R7QA 2ESNA 3I4PA 5HVQC 4E7JA 1KU7A 2JA8J 2CSOA 1Z21A 1T56A 3CESA 2XVCA 1UJ8A 3CD6I 2P4WA 4Q48A 2ELKA 1HSTA 3V8KA 3UKGA 1Y1VJ 2HNHA 3OR1C 5JLWA 4M3FA 1KQ9A 3BCBA 3TDUC 3O8GA 1K78A 2KL4A 2QWWA 4I98B 2F5EA 2FXAA 1U8RA 3DTEA 2HPMA 1UMQA 2I10A 2W82A 3ZMTA 1IRXA 4PUSA 2P5KA 2FQ3A 1V4RA 4D1QA 3QYBA 3O3KA 4NBQA 1TWGJ 4BL0B 1XDUA 1MSFC 1Z9CA 2HXOA 3I4NJ 3BLYA 1G3TA 3O2PE 4A5MA 1J09A 3P5JA 5EZGA 3K4KA 3MAJA 2GM4A 5EJCA 2MH9A 4RAGA 1YLFA 4Y13A 1HBXG 3KPHA 4EJUA 1DGWY 1D1CA 4RGXA 4Q4ZF 3SJMA 1SVOA 2MLGA 1YO5C 4KMUX 2Y30A 2LD5A 4CCJA 1QZZA 2WB1A 1MMGA 2JQ7A 4MIMA 3OYCA 3S14J 3K4MA 2DA5A 4FASD 1D8JA 2QCOA 4I01A 3HKZN 4CICA 3DFGA 1MNDA 3OR2C 1TW2A 1UG2A 2CUEA 1MNMC 4HF2A 1H88C 4XKBA 4ZYHA 3U9GA 3G71I 2J5OA 1WGXA 4HX8A 4W1UA 3S2WA 1XPXA 1RC9A 1Z3XA 5FD5A 1PUFB 3WU0A 3HPGA 1BW6A 1WRJA 1K4TA 3DKWA 1VQ8I 3IH4A 1AOYA 1KU9A 1GXPA 3FXJA 2E1MC 1CGPA 4NC7A 1GVDA 3FMQA 4G8XA 2MGQA 4CZZA 2B0LA 3R0AA 3R6SA 2D45A 1HF0A 5C3EJ 2BYVE 2K9MA 2FMYA 3K2AA 4LLLA 3BTJA 4V2GA 3IUOA 3G2BA 3DEWA 4UVBA 5LRRA 3CCUI 1XTAA 2ZJQF 1A35A 1JGGA 2W25A 3RTRA 2HI3A 1Y8RB 3BZKA 4IHSA 3P9KA 3S3NA 3I9V2 4N9IA 5LEKA 2EWNA 1X3ZB 2XAQA 4FE7A 3T8RA 1HLVA 3WG9A 1WCMJ 2QQBA 4I76A 3UR3C 1P92A 1XGOA 1JE8A 1IDYA 3OYAA 1BI3A 2VJIA 2R7SA 2EQRA 3OWTA 3LFKA 3KEOA 5JR3A 4G9YA 2JPBA 2IS6A 2A07F 1R5HA 5EG0B 1R6RA 1X1PA 2KHMA 4LGWA 4PFPA 4LB6B 5CQEA 1BR4A 4ESJA 2IA1A 5BPIA 2CRGA 5JFRA 2IGMA 3I64A 2QA4I 2CQNA 2QENA 4IHTA 3LSJA 4XOTA 1VZ0A 4DBRA 3JSOA 3G1OA 2O61A 3K70D 5CKTA 5HDKA 3HYIA 2ZXWH 2R5ZB 1BR2A 1VQOI 4B8XA 2Y75A 2LREA 3EYYA 1WSUA 2L7MP 1TTYA 5DS9A 2EIMH 2LP0A 4Q47A 2DT7B 2E5ZA 4G6TB 1LE8B 5HNFA 1QBJA 1P4XA 2D2WA 4G94A 5DD8A 2H8RA 3DPUA 3FK7A 1M1EB 1SD7A 1SD5A 3H1CA 3D1NI 2ELHA 4U88A 4UVCA 1B9NA 1A04A 5GTIC 3CO6C 4HV5A 1OCPA 4MQ9F 2O03A 2VBZA 4OIOF 2MLKA 4P55A 2O5RA 3C1DA 4A0YA 5GPAA 3U1KA 3UNGC 3G73A 2MG4A 3J80K 1ZGJA 2XC7A 2XRLA 2XROA 4D0PA 1LNWA 5CLSA 1OJLA 4ASNA 5LGTA 1KU3A 2A61A 1Y1WJ 1VQPI 2ACJA 1CF7B 1O3RA 5KVRA 3AG3H 3H5RA 4QSHA 4YIFA 3BWGA 3DKXA 4A0ZA 1ZAOA 2HVQA 2PBIA 2NVUB 3FWEA 5H6RA 4I0BA 1EJ9A 3CLQA 1W5TA 3GTPJ 5E20A 1R22A 1YTYA 2DA1A 4GGGA 3C2GA 1WJFA 2LF7A 2P81A 1D0ZA 3ZR8X 3SDGA 4I09A 3R61A 1ZGWA 1XCVA 1LJ9A 5IOZA 1R49A 2VOOA 1UFMA 2DMNA 4QTRA 1XGSA 1FC3A 2X0LA 3CF5F 1MSEC 3PL8A 4D5FA 3MZHA 4UUVA 3ZGKA 3R60A 1YQAA 4RB2C 2DOAA 3F8NA 2NNYA 4HG2A 5L3GA 3PUBA 1ZARA 2LC2A 1IN4A 3WTWC 5CVRA 2JA7J 1DP7P 3WTYC 2FE3A 3K4CA 3L2WA 4H0EA 1FY7A 3ROUA 1PDNC 3H3VK 2M87A 4BU2A 2VQGA 3IP4B 2JUGA 4PSWA 3QAHA 1SD6A 2FU4A 2L9RA 3IKTA 4WWCA 5CVJA 1IN7A 3SQNA 3FX3A 4ITVA 3JAMZ 1RRJA 4XNFA 1B1BA 2VB6A 1ZTRA 3AG2H 4RLQA 3OYEA 3PUFA 1SFOJ 2E2IJ 4CSWA 2PJPA 4HDUA 1TQIA 4LD5A 2A6TA 1Y39A 3HIFA 3CDHA 3A02A 1SFUA 2L4AA 4D5CA 2Z5UA 2IEKA 4HOBA 2HFHA 4EM1A 2L9SA 2X6WA 5E1ZB 2PMZA 2JK3A 1KU2A 2OTJI 2YU3A 3G3ZA 3MKYB 4OIQF 4OAZA 2ZKZA 3GZ5A 2L4MA 2VC1A 2XDVA 2LH9A 3E5UA 3G4SI 2JUCA 5HS8A 4A3EJ 2NVQJ 2VC0A 3RZOJ 1ETYA 3FKIJ 2DJNA 2VIXA 3FM3A 4PGGA 3A03A 3BG3A 1UZCA 1I3QJ 2K9LA 2DOEA 5E1WA 2WV0A 3V7RA 5J8FA 4M9ZA 3CMEI 4EV0A 2QEXI 4A3FJ 4V19K 2L7ZA 2D1HA 3RQIA 1GV2A 2CG4A 2C6YA 3FIWA 1MZBA 4PJLA 3W2AA 2HTJA 5BOXA 2K9SA 3W3CA 3GZ6A 3GEZA 3J7YJ 3I56I 3DWLE 1U8BA 2EFPA 4FETA 5HOOA 4F55A 1WVRA 3BT9A 4MO7A 2M0CA 2V4JC 3D5LA 4HQEA 1S7OA 1IZ1A 2Z9OA 2AS5F 5DUIA 1YYVA 3JREA 4IF4A 3JRHA 2GXGA 1HKQA 4L9JA 5J1UA 4CCKA 3NEUA 4Z2YA 3Q0VA 1GDTA 2E7WA 1AKHB 1PP7U 3WU1B 1MMSA 1QU3A 1LVKA 3ERMA 2IW5A 2MC4A 2M4KA 5D5WB 2LVSA 1G6NA 3BCAA 3CCJI 5IYDJ 4BUPA 2RVCA 1E3HA 5A2QK 5FKMA 4O3MA 1JKOC 4MGRA 1Z6TA 4IXAA 2KP6A 1LDJA 2ZB9A 2JN6A 3VSLA 2PMHA 3M8JA 3CJNA 3ESWB 5FD6A 5FKKA 2W7NA 3HGYA 2KT0A 3IRRA 1OYIA 2O9LA 1XG1A 1A31A 5FB2A 3S93A 1K4SA 1VTNC 4HV6A 2DDAA 2E7XA 4P9FA 2W24A 4PJMA 2ZJPF 1KYWA 3IV5A 1VI0A 1KZHA 4HDVA 1MJAA 1T6SA 3WHCA 2LR8A 1BM9A 4N4OB 1T0FC 2X1DA 2Y0MA 3SHFA 2FRHA 1NK3P 2VLAA 3HC7A 3I59B 3BZCA 4M73A 3TW6A 5M3FJ 1O3QA 1BJAA 5D5UB 1J9IA 1P7IA 2IS1A 3L2RA 5DUKA 5FFXA 3BROA 1NHAA 4IO9F 3ZP5A 1MJBA 3I4MJ 4DQ2A 2O8XA 3G6EI 4S05A 1VF9A 4G6QA 3FXUA 4CZCA 1RESA 3MWMA 3GTQJ 3WGIA 2WY8Q 1MBGA 4PSXA 1R1VA 4A6DA 4E7IA 1B9MA 3M8EA 1YRNB 2HVRA 4DBQA 3JR9A 2V9KA 2F4MB 1VQKI 5IYBJ 4MFDA 5EDNA 2VXDA 1BL0A 3BOQA 2VBWA 4M6XA 4IHYA 1Z77A 3F0CA 4XMYA 2CGPA 2FNAA 2I8DA 3GXOA 1S7EA 4XLFA 1YJNI 1I5ZA 5GAGJ 1BC7C 2KIQA 3ZQQA 2DYSH 2PMUA 4RM3A 2DDBA 1HXDA 3HDDA 3D5RC 4L5JA 1FJLA 1VQLI 3LQQA 4NDLA 2BOLA 4PGHA 2M2EA 2Z16A 2L5QA 4L5EA 4BEHB 5E3LA 2KZGA 3RPUD 2R7RA 1ZRDA 2JRMA 2DA6A 2GOXB 1SAXA 3OL3A 4ZH4F 4DZPA 3VPRA 4UUSB 4XRMA 3W2WA 2GBYA 2FF4A 3OV8A 4UXNA 1A5JA 1B59A 3NWTA 3E6MA 4D7MA 1IW7F 2HKOA 1OCOH 2VBYA 2DA7A 3SDBA 4KUMA 5EEHA 5J6XA 2HGCA 2BVMA 3OL4A 4R1HA 4XN3A 3SZPA 1SC7A 2W85A 3GW2A 4B1RA 1ETVA 2YS9A 2V1UA 3KP3A 1B8IA 4I02A 3OYKA 2DLLA 2OBPA 4C2MJ 3K69A 2IJLA 4XR6A 2ME6A 1Y6IA 3HSRA 4XQFA 5DCMB 2B63J 3VEPA 4ESFA 2GA2A 3F6OA 3R4KA 1XSXA 3PJRA 3CCYA 3GTLJ 3VYRB 2WAFA 4BEHA 3T0YA 2A5WA 2K5CA 4QLCU 1YS6A 2ISYA 3RSNA 1YX3A 3OIOA 2XGEA 4EJOA 1TWAJ 4XICA 2HQRA 2K9NA 4E7ZA 5IT9K 1O57A 2WADA 1EH8A 4HA8A 2D1VA 2LNBA 4BHPA 3MZ8A 5IP7J 4AVZA 3V8JA 3ZPLA 1FEXA 2DT6A 3CP2A 4LB5A 3E97A 3P7NA 3D5SC 1LEAA 2K02A 1D1AA 4BY1J 2AHQA 3K6GA 2G0EA 1J59A 2Y48A 4IX7A 3KZYA 1XD7A 4A3IJ 2FBHA 1BBYA 4EJVA 1FBQA 5K7FA 3RKWA 2L9NA 4CHUA 2LOOA 4UHTA 4OMZA 5DCMA 3RIRA 1XSDA 1U3EM 2LMDA 3HKZA 1JJ8C 3JTGA 3QWLA 5EF6A 5E18F 1O7FA 1Z1DA 5F0FA 3TO6A 1T95A 1T2KA 2PJRA 1USSA 1W0UA 4BY7J 4IZZA 1JKPC 1YITI 3Q9VA 3D0SA 1B6AA 1HDPA 4BJ5C 4HNVA 2Q2EB 4FT8A 4GO1A 2QUFA 3ZQFA 5IY5H 1W5SA 3OS1A 3F22A 1TT0A 2PN6A 3GFMA 3CCLI 1TBXA 2R7TA 5EYRA 1ON2A 4M9XA 2KRCA 5KCMA 3K1NA 5EGOA 2DTZA 1FOWA 3OYBA 2ZJRF 5IP6A 3BG7A 4FCYA 5CJ9A 4J00A 2COMA 1TNTA 2BVLA 2EJRA 2IXSA 2OCEA 4IHXA 2O3FA 4A3LJ 1OLTA 2VKDA 5FGMA 3WTZA 3KCCA 3CCQI 2K27A 2OZUA 3CJQB 1SEUA 3HOYJ 4FX4A 1STZA 1U9OA 1LDDA 3ZMVA 4XK4A 4IHWA 4UY8I 3CUQC 1I3AA 3HOZJ 1W4MA 5DD4A 5K5OA 4WXDA 2H6CA 2R7DA 4ZJZA 3SFIA 4E70A 4AD9A 2W48A 5ICCA 3OYMA 2RKHA 5IYCJ 2JZYA 4JBAA 3SEQA 2ADUA 4LG0A 1FLIA 3NQOA 4AM3A 1KGSA 3LSMA 1JT0A 2E2HJ 4ZYEA 3PIOF 1FBUA 1N75A 4II2A 1K78B 2NNNA 5H20A 1VQ9I 4F52A 1EA3A 1HW2A 1JUMA 3MD2A 2VASA 1AA7A 2CUZA 2X51A 1JGSA 1U78A 1F43A 5FROA 5GADJ 2M30A 5LRSA 5LEJA 2OTLI 4U87A 3T1BA 4R8HA 4S0HB 3WHBA 4IRIA 1X19A 2WV1A 3OYHA 3MKWB 2Z99A 5IP9J 3S32A 2AXLA 3BR3A 2FBIA 2RNGA 2X1CA 2XB0X 3DTIA 3RPQA 2IVMA 4E4HA 4L5IA 3TQNA 3K4BA 4HYEA 2E5NA 1ODDA 3KLOA 2FOKA 3HJEA 3BJAA 4L0YB 4FE4A 5EEGA 3HG9A 5DDGA 3GX4X 1SVMA 2K4JA 2CFXA 2LSOA 3K1PA 5HODA 4I2OA 1JUPA 5GP9A 4F92B 3S1MJ 2HZTA 3HOUJ 3GWZA 1R4MB 2V1NA 5J47A 1MMDA 2NAZA 2CH0A 4F3QA 3OSFA 2KFDA 3FISA 1H9GA 2RGVA 1O3SA 1IV8A 3MCZA 3JRDA 1T39A 1O4XA 1SMYF 3BR0A 1TLHB 3P9CA 5HDGA 5FRMA 4N9HA 3IAM2 1G8XA 1ENHA 3GFIA 3EUHC 3FMSA 2BXZA 4EMSA 4C3IJ 3ZRGA 1MBEA 2FA5A 3QU6A 3CQZJ 1W7PA 2NVXJ 5DEQA 5E8GA 4FQGA 4KITB 4GRIA 5KAFC 2G9WA 1FZPB 3K7AJ 2RC4A 3FZVA 4BKXA 3OYGA 2YX4A 4EJTA 1T0FA 2JA6J 3B02A 2DFEA 1R1TA 2K3FA 3NRVA 1V3FA 5M5YJ 3HZJA 2F6CA 2MABA 2J5PA 2WC2A 5C4JJ 1QZEA 5F6FA 5LD2C 1BN5A 3MQ0A 3S1QJ 1K79A 2M9HA 4ZTJA 2HOEA 3K4LA 1FPQA 3QYEA 1W36C 1U0JA 1H89C 3PO3J 2KRFA 3MKZA 2OUMA 1J2XA 2EIJH 1IRZA 5BMZA 2X85A 2JMWA 2GWRA 3DV8A 1IGNA 3S8PA 3H0DA 4HF1A 1MW7A 2MD0A 3V4GA 2F2EA 2M34A 2QGUA 4CCNA 1LUJB 1A6IA 3H9GA 1GHCA 1PJRA 4HZFA 3NAUA 3ZQ7A 1UHSA 4G7OF 4XOPA 4Y7NJ 4CA0A 4KMFA 5L3CA 4U7BA 4M6YA 4MTDA 3E5QA 4AIDA 1BC8C 1R7JA 1X3UA 2AQFA 3KE2A 2KJCA 2ZSIB 2BXYA 4LK0F 4ZYAA 5KK1A 4L9NA 1H0MA 1FYMA 1VNDA 4XLCA 1JT6A 3DCFA 1SFXA 1QQIA 2L02A 1YHQI 2EV5A 1ONVA 1TP4A 3HTSB 1R23A 1ZR4A 4KIFA 4Z6YA 1FTTA 1WH7A 4C2TA 4C3HJ 1UAAA 2RQPA 3S3OA 2VPRA 1VQ5I 1ZELA 2O7OA 3QODA 2QSHX 3WG7H 4MEXF 1T08B 2ELJA 5HLTA 1DGRM 3I5UA 4L9VA 3CJRB 2KJBA 2VUMJ 4DYQA 1ZRCA 2OU2A 1D3YA 5C44J 4IKFA 5M5WJ 4D9JA 3PSFA 3IWZA 3C18A 1BI0A 2ZC2A 5J8CA 5JHFA 2P5VA 2JJ7A 3VYSB 3C2HA 1ZK8A 2FQ4A 3EQLF 2HDWA 3KZZA 3AL0B 4ZC3A 2NYXA 3K4NA 1BJZA 4KICA 5D8KB 3F8BA 2KZVA 3KYCB 1I6HJ 3IC7A 4D7NA 1XX5A 3RI4A 5HNHA 4RM2A 1NG6A 4DJAA 2GQQA 4NB5A 3M07A 3HB9A 3ZQIA 4KN4X 4A6EA 1P4AA 3HRTA 3OS0A 4PJ0C 2R92J 3LQRA 5IT9Z 4J01A 1ZKGA 2X1EA 3NARA 1HW5A 1MKMA 1IUYA 1FIPA 2XSDC 2A69F 4BXFA 3IAS2 4BS9A 2WBMA 3FKJA 1V54H 1JKRC 2FX0A 1SANA 1IC8A 4HW0A 4AU7A 2Y9ZA 3HRSA 3KLNA 4ANJA 1HKTA 4Y3OA 3OOPA 4BQQA 2XRNA 2BY2A 3CC2I 3TP3A 1Q1VA 2CU7A 5BPDA 2M3AA 4B3AA 1IRGA 2Y0SN 2MW8A 3ZQGA 1S72I 1RI7A 3JSPA 3J7ZI 2XV4S 4B48A 1JTYA 5K5RA 4XBFA 4M3DA 3ZXSA 4JX5A 2DAOA 2DPDA 1MD0A 4WXCA 3MKLA 3CUQB 2DMUA 1P4WA 2K3PA 1Q1HA 5KAIC 1OCZH 5DV5A 4LIVA 3S3MA 3QPTA 5ICEA 4B4CA 2X6YA 2RDPA 2VBXA 4DYRA 5BNGA 1ORKA 3BPXA 3HPHA 3KETA 2R7UA 2K85A 2LY1A 3WU2C 3L09A 2RREA 4UUTA 3KP6A 2FEZA 5HLIA 1Y0UA 2MC3A 4B47A 1WFXA 2H27A 3MMYB 5D5VB 4I6ZA 3GCMA 5J40A 3QPLA 2XB5A 1S8NA 2QBYA 4AVPA 1XC5A 4OIRF 2F5VA 2HDCA 5HLGA 3BQYA 4YFKF 3GLXA 4UB6C 3CUQA 3KEYA 4L0ZB 5CQGA 4ZTFA 1H8AC 2VODA 3CC4I 2DK5A 2FBKA 1B72A 2ZCWA 3I0TA 4RAYA 4AWXB 1BOAA 4U0WA 5FO5A 5E8IA 1UG0A 1LDKB 4CYCA 2RAEA 3LFUA 3JW4A 1P7JA 1QHHD 1OISA 1S3JA 2K40A 1GVJA 1WKMA 2ID3A 2OPTA 1HDDC 2CW8A 2QLZA 3A1YA 3OYDA 3SZTA 1Z7LA 2VJJA 2LY9A 4KN7X 2E1CA 4YEJA 4BNCA 2F5DA 2R7ZJ 3NWSA 1Y56A 4HX7A 1K6YA 2XIGA 2Y69H 3M9AA 4BAYA 3CCVI 5IOYA 2FD5A 3ABKH 3F3XA 2BBYA 4B3XA 2CUFA 3FHNA 1ZREA 1YW7A 2UV1A 2F4OB 1TZLA 3L7WA 3ERED 1VQ4I 2VI6A 5LHHA 5KNLA 2EBIA 2JA5J 3FF5A 2BW3B 2H09A 3ULQB 3J7AO 1WJAA 2L9VA 1REPC 4I0AA 2DOFA 2CUJA 2E71A 2EZLA 2CV0A 3ASNH 4G6DA 2W84A 5FLXK 2IGNA 4ZZDA 3W6KB 3FXMA 2H6BA 5D5XB 5HDNA 2VQCA 1UCRA 2WA0A 2FMLA 5F08A 2KIUA 3HUGA 3TMOA 2A5YB 1EH7A 5LHIA 4ENJA 4XRSG 1DQUA 4PCQA 4K2EA 2LF8A 2NS7A 3EPZA 5D8LB 3TW7A 4R79A 1F9NA 2UXNA 1WQ2A 4BE0A 1D5VA 1QRYA 2IRFG 1D8KA 2CV1A 1W0TA 3BG9A 2E1MB 2A68F 3BC8A 5CVVA 4KT5C 3EUHA 4Y17A 3DLLF 2D5VA 3S2HJ 4F93B 2BW3A 2V6CA 4XRFA 2EV0A 2V9PA 3LOCA 2HOTA 2A6EF 3IHUA 3ABMH 2GLOA 4A3JJ 1QPMA 1YS7A 1ETXA 3HOTA 1WHUA 2Q0OA 3J7AY 2OZ6A 1U9NA 4M9SA 3TL4X 2ZNZA 4ON0A 2M8EA 1U5TC 1TQPA 3ABUA 3MZYA 1FOKA 3TOBA 3C2BA 1BIAA 3HHGA 4RMNA 1W1WE 3H3ZA 1ERDA 4FHTA 2MH2A 3FXOA 3A01A 4BYYA 1MNEA 1BOBA 2JRTA 2Z3YA 4QWQA 1DPRA 4O5VA 3H0GJ 2V6EA 2NS0A 1FMVA 2EINH 2VT2A 2Z1DA 2ZXJA 5GTHC 3J81K 1F5TA 1DU0A 1U2WA 3PQJA 4X6AJ 3KP4A 4L9TA 4CH7A 3N97A 2RQQA 2BY0A 2HPIA 3ECHA 4KJZA 1D0XA 3TO7A 3JRBA 2F5FA 4OWRB 1APLC 5ED4A 3O6BB 3ISPA 1SAUA 2QZ8A 2K86A 4BHBA 3FMRA 3DXJF 5CYVA 2M45A 4IVNA 1R5GA 3JRIA 4UB8C 1E0EA 1G59A 3CMMA 2PQ8A 2F5CA 2WAQN 2XPWA 3KP7A 1ETWA 1L0OC 2XSJC 4KISA 1N78A 1P2FA 3W6JB 2KQRA 2JPCA 2QYOA 3H9QA 3M8FA 4QPQA 1ACIA 1QZYA 5E3MA 3M4OJ 2HXIA 2CQ7A 4KIGA 2GA1A 3I71A 2KRHA 3RKXA 5E17F 1UHWA 4A69C 2ECCA 1XN7A 2EFWA 5DYMA 1E2XA 1B8IB 3LNQA 4HLYA 2DTRA 5E79C 2EFQA 3LMMA 4A2UA 3FBNB 5F1JA 4LITA 2LFBA 2W4SA 2LLKA 2M8GX 2XF7A 4OAYA 1OQYA 3VFZA 4DIQA 2GIVA 4TV7A 2WY7Q 2X9DA 3V7CA 2VE9A 1FMWA 2EFNA 3OY9A 3SYTA 2JA2A 2EPFA 3H9JA 3REOA 3RCOA 1JHFA 2EILH 3C3WA 1K61A 4P1WA 3DBLB 2HOSA 1MBHA 3L00A 4CXFA 2XF6A 3KYLA 3JRFA 2EA4A 1XGNA 3VB2A 2VKEA 4PK4A 3Q5FA 3CF2A 4E7HA 2MFZA 2P8TA 3BG6A 1X2NA 3J80Z 3K1MA 4EGZA 3HSFA 2CJJA 3E6BA 2CW7A 2JVGA 2XUBA 5M5XJ 1HCRA 1KA8A 4BJTA 1VQMI 4F91B 2IS4A 3WTSC 5L3BA 4LLGF 2DXIA 1Z6RA 4ZYDA 1NH3A 3GF2A 2PJRB 4GFBA 5FKLA 3HTUA 4JQFA 4XLHA 5B3SH 3OYIA 1CQTA 4A3GJ 3HOSA 2R4GA 3H5AA 4NHJA 2HQ5A 1P9QC 3H36A 4ENMA 4BH9A 2VJ5A 3FK6A 4O6JA 1O3TA 2IA0A 5EGOB 3WE2A 4AIJA 2XPVA 2EFOA 2LYCA 1EKEA 4BJ6C 5L3FA 2NOGA 1TWFJ 4LLNA 3S17J 1WJEA 1XMAA 3DU5A 2NS8A 4YIRX 4ESBA 1UELB 1IF1A 5JVTA 4JYKA 2VQLA 3WGHA 1D1BA 2MBFA 3F8CA 4Q5SF 2KIMA 1E17A 3K9TA 1KQ0A 3WTXC 3OIQA 4XORA 3OYNA 1LEBA 3TDZC 5D4RA 3L9FA 3LSKA 3IKVA 3L1PA 3PNTA 3P9IA 2PX9A 3BJ6A 1NG7A 4GYGA 5E3NA 4EATA 3PIPF 4BQOA 4N4NB 2QSGX 3QP6A 4DW6A 4LG0B 3V8LA 6PAXA 2RN7A 2EZHA 1LB2A 3VOEA 3U2RA 3TOAA 2XKPA 3CCSI 2V1DA 1FNNA 2OAZA 1OCTC 2VL8A 1SFEA 2ZFUA 4WCGA 2K9QA 2V79A 2R5YA 4RLFA 1V55H 2HR3A 1IN6A 2ID6A 3AAFA 1E3OC 1POGA 2YSRA 4MNUA 2O6GE 2DU9A 3VWBA 1ON1A 4KFCA 3FHZA 1I39A 1J5YA 2E19A 2CYYA 2LK2A 1Z3YA 5FRNA 1ETKA 1WZ2A 3VSKA 3N4MA 3U1DA 4IQJA 4JX4A 5EEAA 4V2FA 2UXXA 1JXSA 2Y9YA 1X1AA 5ICGA 3V7SA 4BXXJ 4EVIA 2QVOA 4MTEA 1B4AA 3RQ4A 4HQMA 2L7KA 2L7FP 3U21A 2FOWA 4C30A 3CDIA 1FOYA 1Z7UA 2M7AA 3OOUA 3DBHB 2DK8A 2LBFA 3E6CC 2JVHA 2CMPA 4XSZF 2A05A 3CCRI 1T8IA 2P0WA 4KNYA 4NQWA 4BBRJ 1XMXA 2MYSA 2VT3A 4C3JJ 1K6OA 1LFPA 3QP5A 3KIOA 4C9YA 4A0XA 1TWCJ 1RZ4A 3WGGA 4AYBN 4L18B 1IDZA 3G1MA 3HXLA 2ISZA 4MQVA 3AG1H 5JLXA 3E6DA 4XLAA 3M1EA 1NK2P 3QU3A 3FBIB 2ICWG 5D6FA 3ASOH 4ZZLA 3BR2A 4Y4RA 5B1AH 4RBOA 2QQ8A 1JHHA
chains in the Genus database with same CATH topology
1ZK8A 2N8GA 5J1RA 1YRNA 2FQ4A 3HM5A 1BJZA 4MFEA 3JREA 2H1KA 2DMTA 4EEFG 4MLOA 3JRHA 5E3OA 2XGDA 4JX6A 4M6VA 1I6HJ 2O8KA 4D7NA 5J1UA 3Q0VA 3LSRA 1GDTA 3ZQHA 1AKHB 3HB9A 3ZQIA 2LVSA 5C4XJ 5IYDJ 1JUSA 2R92J 5FKMA 1JKOC 2IAIA 1ZKGA 3NARA 5IPAA 1FIPA 2XSDC 4LOCA 2R5YB 1X58A 2ZB9A 1JKRC 2JN6A 2FX0A 1SANA 1IC8A 3GTMJ 5FKKA 2ECBA 3HGYA 4W97A 4UUSA 2Y9ZA 2KT0A 1RKWA 2YUSA 2O9LA 1XG1A 3HBLA 1GUUA 3TP3A 1Q1VA 2CU7A 4B3AA 2Y0SN 2MW8A 2XGCA 3ZQGA 3HOXJ 1JTYA 4M3DA 4JX5A 2HOAA 1T33A 3MKLA 1FTZA 2DMUA 2HDDA 3IV5A 1VI0A 2NVYJ 3JRCA 9ANTA 3WHCA 2LR8A 4B4CA 5M3MJ 3S2DJ 1G2HA 4DYRA 5BNGA 1NK3P 1ORKA 5EZHA 1ETQA 3TW6A 1FIAA 5M3FJ 1MH4A 1GT0C 5GPCA 4UUTA 2AO9A 1OFCX 1P7IA 3HOWJ 2R0QC 3BR6A 4I6ZA 1LFUP 3QPLA 5K7ZA 2XB5A 1ITYA 3I4MJ 5J3LA 5K7HA 1VF9A 1XC5A 1QPIA 2TRTA 4BBSJ 1RESA 3GTQJ 4X1EA 1MBGA 2DA3A 3B6AA 3BQYA 2NVTJ 1QVUA 1YRNB 1AU7A 3HGGA 1MH3A 3JR9A 3OSGA 1H8AC 3TEDA 1B72A 5IYBJ 4A3DJ 4MFDA 5EDNA 3O8HA 1LFBA 1BL0A 4A3CJ 2IBDA 4CYCA 4IHYA 1Z77A 3F0CA 2RAEA 4FISA 3GBGA 3GTGJ 1P7JA 5F27A 2DMPA 3IH3A 2FJ1A 2K40A 1S7EA 4DYCA 1RETA 2ID3A 2OPTA 4M3EA 1HDDC 3HOVJ 1PUFA 1TWHJ 5FLMJ 1HOMA 1RPWA 3S16J 2LY9A 3CDLA 2R7ZJ 3HDDA 1FJLA 4NDLA 3S1RJ 2M2EA 4L5EA 4A3MJ 3BR1A 1IG7A 5E3LA 5IOYA 2XPUA 2FD5A 3MN2A 2DA6A 2CUFA 2COBA 2L0KA 5FKNA 5DTDA 5F0HA 2CQQA 2DA2A 4UUSB 4DZPA 3VPRA 3Q3SA 4XRMA 2GBYA 2VI6A 4XRSA 3RKQA 2DMQA 2EBIA 2EZIA 3GTJJ 2JA5J 1A5JA 4FTHA 3ZQCA 1R9TJ 4D7MA 3HEFA 2EZLA 3BTIA 2DA7A 2JA8J 4ABZA 1T56A 4B1RA 1ETVA 2YS9A 5FJ8J 1B8IA 4A3BJ 2ELKA 4C2MJ 3LSPA 3UKGA 1Y1VJ 5F08A 5JLWA 2ME6A 4M3FA 3O8GA 4XRSG 5EG0A 2B63J 4IEJA 2NS7A 2E2JJ 1I50J 3TW7A 2TCTA 1UMQA 2I10A 3CCYA 3GTLJ 1EF4A 3ZOBA 1Z0XA 3JRGA 1QRYA 1TWGJ 3OIOA 2XGEA 4XICA 1TWAJ 4G12A 2K9NA 1W0TA 1MSFC 3BG9A 2HXOA 3I4NJ 3QQAA 2D5VA 3S2HJ 5EZGA 5IP7J 2R5ZA 1GV5A 3LOCA 2GM4A 1IUFA 2HOTA 1FEXA 5FLVA 2HYJA 2GLOA 2KDZA 4A3JJ 3ZQLA 1ETXA 1JTXA 4BY1J 1LE8A 3BQZA 2AHQA 1U9NA 2X6OA 2YU9J 2G0EA 5F0CA 4M3BA 3SJMA 4A3IJ 5J1YA 4AC0A 5K7FA 2Y30A 2LD5A 1IV6A 3C2BA 2WB1N 4MIMA 1B72B 3S14J 2DA5A 2QCOA 1JJ8C 3HKZN 5EF6A 4CYCB 3A01A 1UG2A 2CUEA 1QVTA 2EH3A 5F0FA 1MNMC 1H88C 1W0UA 4BY7J 3H0GJ 1X2MA 2EZKA 1WGXA 1JKPC 4W1UA 1HDPA 1DU0A 3BTCA 3JRAA 4HNVA 1PUFB 3ZQFA 4X6AJ 1BW6A 2E1OA 3IH4A 2R93J 5EYRA 3JRBA 1APLC 1GVDA 1WH5A 1HF0A 2MGQA 5EGOA 2DTZA 5C3EJ 2Y31A 5IP6A 4FCYA 3K2AA 3BTJA 4V2GA 2MSYA 3BG5A 4IHXA 2X48A 3JRIA 4A3LJ 3DEWA 2WAQN 2XPWA 1JGGA 1ETWA 2HI3A 1ETOA 3HOYJ 1U9OA 4IHWA 4XK4A 4FE7A 3HOZJ 5E3MA 3M4OJ 2HXIA 1HLVA 3M3YJ 1WCMJ 2VKVA 4I76A 3Q0WA 3SFIA 1IDYA 2W48A 4A69C 3MVPA 2ECCA 5IYCJ 2EQRA 3LNQA 1B8IB 5F1JA 2LFBA 1JT0A 2E2HJ 1ZR2A 2LLKA 3IH2A 2M8GX 5EG0B 1ZQ3P 3S1NJ 1JUMA 1D5YA 2CRGA 1U78A 1F43A 2X9DA 3Q0UA 4S0HB 3LSJA 3WHBA 2WV1A 3G1OA 3LSGA 5IP9J 3GTKJ 2R5ZB 3BR3A 2XB0X 2DA4A 1K61A 2L7MP 2HOSA 1MBHA 5DS9A 2LP0A 1LE8B 3JRFA 1WPKA 2VKEA 4FE4A 2H8RA 2JWTA 1MBJA 3FK7A 1BA5A 3D1NI 1X2NA 5HODA 1WI3A 1OCPA 2CJJA 1JUPA 5GP9A 5M5XJ 3S1MJ 1HCRA 3HOUJ 3A01B 1VFCA 5GPAA 2MG4A 2XRLA 3OSFA 1OJLA 3FISA 4GFBA 5FKLA 1Y1WJ 1CQTA 4A3GJ 3JRDA 1O4XA 1F36A 4QSHA 4AUXA 3BR0A 2HQ5A 2Y2ZA 3W6VA 3FK6A 5EGOB 1ENHA 2XPVA 1DU6A 2NOGA 3GTPJ 1TWFJ 4C3IJ 3S17J 1MBEA 2DA1A 3CQZJ 2NS8A 1JKQC 2NVXJ 4JYKA 2P81A 3SDGA 3GTOJ 1ZGWA 5IOZA 2DMNA 4QTRA 3K7AJ 3PM1A 1MSEC 3L1PA 3BTLA 4D5FA 5E3NA 2DN0A 4BKXA 1K83J 2JA6J 1AKHA 1IJWC 3QPSA 4DW6A 5M5YJ 3TP0A 2JA7J 2LTPA 5C4JJ 2EZHA 3RZDJ 1JJ6C 3H3VK 4IHVA 1MBFA 3S1QJ 2M9HA 1OCTC 2LKXA 2K9QA 2L9RA 2R5YA 4A93J 2CQXA 2ID6A 1H89C 3PO3J 1E3OC 1POGA 1MBKA 3E7LA 1IRZA 2JMWA 1ZTRA 1XS9A 1RR7A 1IGNA 3S15J 2E19A 1SFOJ 2LK2A 2E2IJ 2ME0A 5F04A 2M34A 1ETKA 1A6IA 3A02A 4D5CA 3G1LA 4JX4A 2IEKA 4V2FA 3NAUA 4M3GA 5EEAA 4RDUA 2Y9YA 1AHDP 4BXXJ 1UHSA 4JP0A 1NTCA 2PMZN 2JK3A 4Y7NJ 3CMYA 4XIDA 2L7FP 1VNDA 3OOUA 1JT6A 3DCFA 5FKOA 4A3EJ 3RZOJ 1ETYA 3FKIJ 2DJNA 1ZR4A 1FTTA 3A03A 4Y52J 3BG3A 1WH7A 1I3QJ 4BBRJ 4C3HJ 2NVQJ 2VPRA 2O7OA 1TC3C 4A3FJ 4A3KJ 2L7ZA 2QF7A 3RQIA 4C3JJ 1RKTA 1GV2A 3FIWA 1TWCJ 2VUMJ 2K9SA 4QIWN 4AYBN 1IDZA 3G1MA 4DYQA 4DZJA 4J19A 5JLXA 1U8BA 1BW5A 5C44J 2OF7A 3BR5A 5M5WJ 1NK2P 3PO2J 3BR2A 4RBOA 3B6CA 2JJ7A 3BT9A 4MO7A 2M0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK8 A;  2N8G A;  5J1R A;  1YRN A;  2FQ4 A;  3HM5 A;  1BJZ A;  4MFE A;  3JRE A;  2H1K A;  2DMT A;  4EEF G;  4MLO A;  3JRH A;  5E3O A;  2XGD A;  4JX6 A;  4M6V A;  1I6H J;  2O8K A;  4D7N A;  5J1U A;  3Q0V A;  3LSR A;  1GDT A;  3ZQH A;  1AKH B;  3HB9 A;  3ZQI A;  2LVS A;  5C4X J;  5IYD J;  1JUS A;  2R92 J;  5FKM A;  1JKO C;  2IAI A;  1ZKG A;  3NAR A;  5IPA A;  1FIP A;  2XSD C;  4LOC A;  2R5Y B;  1X58 A;  2ZB9 A;  1JKR C;  2JN6 A;  2FX0 A;  1SAN A;  1IC8 A;  3GTM J;  5FKK A;  2ECB A;  3HGY A;  4W97 A;  4UUS A;  2Y9Z A;  2KT0 A;  1RKW A;  2YUS A;  2O9L A;  1XG1 A;  3HBL A;  1GUU A;  3TP3 A;  1Q1V A;  2CU7 A;  4B3A A;  2Y0S N;  2MW8 A;  2XGC A;  3ZQG A;  3HOX J;  1JTY A;  4M3D A;  4JX5 A;  2HOA A;  1T33 A;  3MKL A;  1FTZ A;  2DMU A;  2HDD A;  3IV5 A;  1VI0 A;  2NVY J;  3JRC A;  9ANT A;  3WHC A;  2LR8 A;  4B4C A;  5M3M J;  3S2D J;  1G2H A;  4DYR A;  5BNG A;  1NK3 P;  1ORK A;  5EZH A;  1ETQ A;  3TW6 A;  1FIA A;  5M3F J;  1MH4 A;  1GT0 C;  5GPC A;  4UUT A;  2AO9 A;  1OFC X;  1P7I A;  3HOW J;  2R0Q C;  3BR6 A;  4I6Z A;  1LFU P;  3QPL A;  5K7Z A;  2XB5 A;  1ITY A;  3I4M J;  5J3L A;  5K7H A;  1VF9 A;  1XC5 A;  1QPI A;  2TRT A;  4BBS J;  1RES A;  3GTQ J;  4X1E A;  1MBG A;  2DA3 A;  3B6A A;  3BQY A;  2NVT J;  1QVU A;  1YRN B;  1AU7 A;  3HGG A;  1MH3 A;  3JR9 A;  3OSG A;  1H8A C;  3TED A;  1B72 A;  5IYB J;  4A3D J;  4MFD A;  5EDN A;  3O8H A;  1LFB A;  1BL0 A;  4A3C J;  2IBD A;  4CYC A;  4IHY A;  1Z77 A;  3F0C A;  2RAE A;  4FIS A;  3GBG A;  3GTG J;  1P7J A;  5F27 A;  2DMP A;  3IH3 A;  2FJ1 A;  2K40 A;  1S7E A;  4DYC A;  1RET A;  2ID3 A;  2OPT A;  4M3E A;  1HDD C;  3HOV J;  1PUF A;  1TWH J;  5FLM J;  1HOM A;  1RPW A;  3S16 J;  2LY9 A;  3CDL A;  2R7Z J;  3HDD A;  1FJL A;  4NDL A;  3S1R J;  2M2E A;  4L5E A;  4A3M J;  3BR1 A;  1IG7 A;  5E3L A;  5IOY A;  2XPU A;  2FD5 A;  3MN2 A;  2DA6 A;  2CUF A;  2COB A;  2L0K A;  5FKN A;  5DTD A;  5F0H A;  2CQQ A;  2DA2 A;  4UUS B;  4DZP A;  3VPR A;  3Q3S A;  4XRM A;  2GBY A;  2VI6 A;  4XRS A;  3RKQ A;  2DMQ A;  2EBI A;  2EZI A;  3GTJ J;  2JA5 J;  1A5J A;  4FTH A;  3ZQC A;  1R9T J;  4D7M A;  3HEF A;  2EZL A;  3BTI A;  2DA7 A;  2JA8 J;  4ABZ A;  1T56 A;  4B1R A;  1ETV A;  2YS9 A;  5FJ8 J;  1B8I A;  4A3B J;  2ELK A;  4C2M J;  3LSP A;  3UKG A;  1Y1V J;  5F08 A;  5JLW A;  2ME6 A;  4M3F A;  3O8G A;  4XRS G;  5EG0 A;  2B63 J;  4IEJ A;  2NS7 A;  2E2J J;  1I50 J;  3TW7 A;  2TCT A;  1UMQ A;  2I10 A;  3CCY A;  3GTL J;  1EF4 A;  3ZOB A;  1Z0X A;  3JRG A;  1QRY A;  1TWG J;  3OIO A;  2XGE A;  4XIC A;  1TWA J;  4G12 A;  2K9N A;  1W0T A;  1MSF C;  3BG9 A;  2HXO A;  3I4N J;  3QQA A;  2D5V A;  3S2H J;  5EZG A;  5IP7 J;  2R5Z A;  1GV5 A;  3LOC A;  2GM4 A;  1IUF A;  2HOT A;  1FEX A;  5FLV A;  2HYJ A;  2GLO A;  2KDZ A;  4A3J J;  3ZQL A;  1ETX A;  1JTX A;  4BY1 J;  1LE8 A;  3BQZ A;  2AHQ A;  1U9N A;  2X6O A;  2YU9 J;  2G0E A;  5F0C A;  4M3B A;  3SJM A;  4A3I J;  5J1Y A;  4AC0 A;  5K7F A;  2Y30 A;  2LD5 A;  1IV6 A;  3C2B A;  2WB1 N;  4MIM A;  1B72 B;  3S14 J;  2DA5 A;  2QCO A;  1JJ8 C;  3HKZ N;  5EF6 A;  4CYC B;  3A01 A;  1UG2 A;  2CUE A;  1QVT A;  2EH3 A;  5F0F A;  1MNM C;  1H88 C;  1W0U A;  4BY7 J;  3H0G J;  1X2M A;  2EZK A;  1WGX A;  1JKP C;  4W1U A;  1HDP A;  1DU0 A;  3BTC A;  3JRA A;  4HNV A;  1PUF B;  3ZQF A;  4X6A J;  1BW6 A;  2E1O A;  3IH4 A;  2R93 J;  5EYR A;  3JRB A;  1APL C;  1GVD A;  1WH5 A;  1HF0 A;  2MGQ A;  5EGO A;  2DTZ A;  5C3E J;  2Y31 A;  5IP6 A;  4FCY A;  3K2A A;  3BTJ A;  4V2G A;  2MSY A;  3BG5 A;  4IHX A;  2X48 A;  3JRI A;  4A3L J;  3DEW A;  2WAQ N;  2XPW A;  1JGG A;  1ETW A;  2HI3 A;  1ETO A;  3HOY J;  1U9O A;  4IHW A;  4XK4 A;  4FE7 A;  3HOZ J;  5E3M A;  3M4O J;  2HXI A;  1HLV A;  3M3Y J;  1WCM J;  2VKV A;  4I76 A;  3Q0W A;  3SFI A;  1IDY A;  2W48 A;  4A69 C;  3MVP A;  2ECC A;  5IYC J;  2EQR A;  3LNQ A;  1B8I B;  5F1J A;  2LFB A;  1JT0 A;  2E2H J;  1ZR2 A;  2LLK A;  3IH2 A;  2M8G X;  5EG0 B;  1ZQ3 P;  3S1N J;  1JUM A;  1D5Y A;  2CRG A;  1U78 A;  1F43 A;  2X9D A;  3Q0U A;  4S0H B;  3LSJ A;  3WHB A;  2WV1 A;  3G1O A;  3LSG A;  5IP9 J;  3GTK J;  2R5Z B;  3BR3 A;  2XB0 X;  2DA4 A;  1K61 A;  2L7M P;  2HOS A;  1MBH A;  5DS9 A;  2LP0 A;  1LE8 B;  3JRF A;  1WPK A;  2VKE A;  4FE4 A;  2H8R A;  2JWT A;  1MBJ A;  3FK7 A;  1BA5 A;  3D1N I;  1X2N A;  5HOD A;  1WI3 A;  1OCP A;  2CJJ A;  1JUP A;  5GP9 A;  5M5X J;  3S1M J;  1HCR A;  3HOU J;  3A01 B;  1VFC A;  5GPA A;  2MG4 A;  2XRL A;  3OSF A;  1OJL A;  3FIS A;  4GFB A;  5FKL A;  1Y1W J;  1CQT A;  4A3G J;  3JRD A;  1O4X A;  1F36 A;  4QSH A;  4AUX A;  3BR0 A;  2HQ5 A;  2Y2Z A;  3W6V A;  3FK6 A;  5EGO B;  1ENH A;  2XPV A;  1DU6 A;  2NOG A;  3GTP J;  1TWF J;  4C3I J;  3S17 J;  1MBE A;  2DA1 A;  3CQZ J;  2NS8 A;  1JKQ C;  2NVX J;  4JYK A;  2P81 A;  3SDG A;  3GTO J;  1ZGW A;  5IOZ A;  2DMN A;  4QTR A;  3K7A J;  3PM1 A;  1MSE C;  3L1P A;  3BTL A;  4D5F A;  5E3N A;  2DN0 A;  4BKX A;  1K83 J;  2JA6 J;  1AKH A;  1IJW C;  3QPS A;  4DW6 A;  5M5Y J;  3TP0 A;  2JA7 J;  2LTP A;  5C4J J;  2EZH A;  3RZD J;  1JJ6 C;  3H3V K;  4IHV A;  1MBF A;  3S1Q J;  2M9H A;  1OCT C;  2LKX A;  2K9Q A;  2L9R A;  2R5Y A;  4A93 J;  2CQX A;  2ID6 A;  1H89 C;  3PO3 J;  1E3O C;  1POG A;  1MBK A;  3E7L A;  1IRZ A;  2JMW A;  1ZTR A;  1XS9 A;  1RR7 A;  1IGN A;  3S15 J;  2E19 A;  1SFO J;  2LK2 A;  2E2I J;  2ME0 A;  5F04 A;  2M34 A;  1ETK A;  1A6I A;  3A02 A;  4D5C A;  3G1L A;  4JX4 A;  2IEK A;  4V2F A;  3NAU A;  4M3G A;  5EEA A;  4RDU A;  2Y9Y A;  1AHD P;  4BXX J;  1UHS A;  4JP0 A;  1NTC A;  2PMZ N;  2JK3 A;  4Y7N J;  3CMY A;  4XID A;  2L7F P;  1VND A;  3OOU A;  1JT6 A;  3DCF A;  5FKO A;  4A3E J;  3RZO J;  1ETY A;  3FKI J;  2DJN A;  1ZR4 A;  1FTT A;  3A03 A;  4Y52 J;  3BG3 A;  1WH7 A;  1I3Q J;  4BBR J;  4C3H J;  2NVQ J;  2VPR A;  2O7O A;  1TC3 C;  4A3F J;  4A3K J;  2L7Z A;  2QF7 A;  3RQI A;  4C3J J;  1RKT A;  1GV2 A;  3FIW A;  1TWC J;  2VUM J;  2K9S A;  4QIW N;  4AYB N;  1IDZ A;  3G1M A;  4DYQ A;  4DZJ A;  4J19 A;  5JLX A;  1U8B A;  1BW5 A;  5C44 J;  2OF7 A;  3BR5 A;  5M5W J;  1NK2 P;  3PO2 J;  3BR2 A;  4RBO A;  3B6C A;  2JJ7 A;  3BT9 A;  4MO7 A;  2M0C A; 
#chains in the Genus database with same CATH topology
 3WOD F;  1IN5 A;  2N8G A;  3K4J A;  1W7P B;  2V1X A;  4NNJ A;  4XM3 A;  1MGT A;  3HM5 A;  5J1R A;  1W7P D;  2Q1Z B;  3KX2 A;  4MFE A;  2DMT A;  5FLX Z;  4N0B A;  5E3O A;  4PJJ A;  1WJB A;  4M6V A;  3C7J A;  2VJ4 A;  4KYW A;  4LG3 A;  2VXZ A;  4CCM A;  1XMK A;  2ZO4 A;  5A2Q Z;  2A6H F;  1XDS A;  1OYY A;  3GFJ A;  4PDK A;  1QA6 A;  5LBQ A;  1G3W A;  2IP2 A;  3K0L A;  2DFF A;  5C4X J;  3GUD A;  1JUS A;  5J4V A;  1YOV B;  2CV2 A;  2IAI A;  4HEA 2;  1OCR H;  1I1G A;  3ABT A;  2YR2 A;  1RUO A;  1UST A;  3H35 A;  1X58 A;  3LSI A;  4IJA A;  2H1L A;  4XLN F;  3GTM J;  1S29 A;  4Y33 A;  1R36 A;  4X0G A;  1FSE A;  2UWM A;  1RKW A;  3F23 A;  2YUS A;  3I54 A;  1YIO A;  4KT6 A;  1DP3 A;  3HBL A;  3A2K A;  2Y0S A;  1X3W B;  3DF8 A;  1X1C A;  2XGC A;  1U5T A;  3FM5 A;  1S6L A;  3HOX J;  2YX7 A;  3X2Q H;  3DLA A;  2ZME C;  2HEO A;  2NRA C;  2HOA A;  1T33 A;  2XAJ A;  4LIU A;  4RB0 A;  1F1Z A;  2EK5 A;  2HDD A;  3PFY A;  2RNJ A;  3JRC A;  2R7F A;  9ANT A;  4BE2 A;  3J81 Z;  3L2U A;  5M3M J;  2BEO A;  2GAU A;  3S2D J;  3H3U A;  1ULY A;  1ETQ A;  2FUG 2;  4CDG A;  5H2F C;  1ZLK A;  1MH4 A;  4CUG A;  3EUK L;  4B43 A;  2X6X A;  4ETS A;  5GPC A;  1GT0 C;  2HTS A;  3CO7 C;  4B44 A;  4MEY F;  4PZJ A;  2JSP A;  3COA C;  3HOW J;  4XL9 A;  4PFO A;  2BV6 A;  2HZD A;  3BR6 A;  1L3L A;  1OR7 C;  4AIK A;  5K7Z A;  4UNO A;  3CZ6 A;  4BQA A;  5J3L A;  2HS5 A;  5CVU A;  2TRT A;  5TRD A;  4BBS J;  4X1E A;  2ZXH A;  4EQQ A;  3QOE A;  2ZXI A;  2NVT J;  3A4C A;  1QVU A;  1AU7 A;  3HGG A;  4ZDO A;  1MH3 A;  2HKX A;  3TED A;  3F6V A;  5TJJ A;  1MIJ A;  2KLO A;  4YFX F;  5TGT A;  3O8H A;  3EUA A;  1LFB A;  3FXK A;  2XGX A;  1BR1 A;  2YPR A;  1YJ9 I;  2IBD A;  2TDX A;  3DP7 A;  3FDY A;  3GTG J;  3DBR B;  3GBG A;  5F27 A;  3WTT C;  2ETH A;  2WWY A;  5F64 A;  2DFI A;  1R71 A;  2JSC A;  3M1C A;  3SZG A;  4M3E A;  4A5N A;  2F48 A;  1U6G A;  1TWH J;  2IGO A;  5FLM J;  1PUF A;  1MMN A;  2AQE A;  1HOM A;  4CYD A;  3CDL A;  1YE9 A;  2PG4 A;  1ZG5 A;  4C2U A;  1BI2 A;  2CQK A;  4A3M J;  1IG7 A;  4UVA A;  3CCM I;  2XPU A;  2VPL A;  3VYU B;  3MN2 A;  2B9S A;  2L0K A;  5FKN A;  2V26 A;  1R58 A;  2CQQ A;  2XAF A;  2DA2 A;  3KFW X;  4NUB A;  5GAH J;  1OCC H;  1I6X A;  4RA2 A;  3Q3S A;  2M7B A;  3GFL A;  4XRS A;  2BHZ A;  2DMQ A;  4ZDL A;  3GTJ J;  3RKQ A;  3ZQC A;  1QO0 D;  3KEQ A;  3I58 A;  1Z91 A;  3HEF A;  2Z33 A;  3BTI A;  3F9K A;  4ABZ A;  1IAW A;  1R5I D;  1FP2 A;  5FJ8 J;  1GXQ A;  4OIN F;  4A3B J;  1HQC A;  1UB9 A;  3LSP A;  4JOM A;  4P5O A;  4BE1 A;  1XCB A;  4HSR A;  2E1N A;  2EV6 A;  2KPM A;  3IWF A;  5EG0 A;  4IEJ A;  2E2J J;  3LAJ A;  1I50 J;  3N05 A;  2CFO A;  2TCT A;  2HU9 A;  3HSE A;  3E5X A;  5ILS A;  2DI3 A;  2DPU A;  2I5U A;  3DPT A;  1ZRF A;  2E36 A;  3CTA A;  2MA3 A;  1EF4 A;  2KKO A;  3ZOB A;  1Z0X A;  3JRG A;  4BXU A;  2DYR H;  2PLY A;  1FP1 D;  2OQR A;  4G12 A;  4WF2 A;  2W1O A;  3PNV A;  4HST A;  2ZSH B;  1WI9 A;  1LKX A;  4IOA F;  2IPQ X;  3KP5 A;  4NC6 A;  3QQA A;  4LK1 F;  3CCE I;  4P96 A;  2R5Z A;  1GV5 A;  3RJP A;  1RIO H;  3MEX A;  1SFK A;  1IUF A;  4BDY A;  2KIS A;  3ZN1 A;  2P5L C;  2KDO A;  2HYJ A;  4IPA A;  3DQV C;  5FLV A;  1X1D A;  2KDZ A;  5AON A;  3ZQL A;  2E34 A;  2QBY B;  1JTX A;  1R1U A;  1LE8 A;  3BQZ A;  1E3P A;  1FX7 A;  2X6O A;  3SFZ A;  2OCC H;  5KHD A;  2YU9 J;  1WJD A;  5F0C A;  4M3B A;  4XLP F;  2V7F A;  3GLL A;  5J1Y A;  1S7A A;  3JCU C;  4AC0 A;  1QNT A;  4XON A;  1IV6 A;  2KIF A;  1SMT A;  2F4I A;  5H6Q A;  3T8T A;  2WB1 N;  4B09 A;  1B72 B;  5L3E A;  2EA2 A;  4E6K G;  3CP8 A;  1BIB A;  4EM2 A;  4CYC B;  2VN2 A;  3B73 A;  3SEZ A;  4E7S A;  1QVT A;  3PQK A;  3T5X A;  2EH3 A;  1RR8 C;  2QQA A;  3QPH A;  2OQG A;  1X1B A;  4YG2 F;  3EYI A;  1X2M A;  2EZK A;  4HPQ A;  4HX4 A;  4M72 A;  4BAC A;  4G7H F;  3R0J A;  4ZDP A;  4AIH A;  3BTC A;  2DJI A;  2VQH A;  5ERI A;  3JRA A;  2DW4 A;  1CF7 A;  2R7O A;  3CUO A;  2E1O A;  3LL7 A;  4GCV A;  2FNP A;  2R93 J;  3CC7 I;  1WH5 A;  2AXT C;  4LMY A;  2XF5 A;  3RYP A;  1J7K A;  2Y31 A;  2WTE A;  3SXY A;  3DEU A;  3ZMS A;  2HVS A;  2MSY A;  5ICF A;  3VOD A;  3BG5 A;  3K2Z A;  2X48 A;  4HRI A;  2WAQ A;  1FT9 A;  1YW9 A;  1YW8 A;  2M0M A;  3LA3 A;  1DPU A;  5JHU A;  1ETO A;  3F8M A;  3OS2 A;  1G3S A;  3BZ6 A;  4NC8 A;  3M3Y J;  3OMY A;  2VKV A;  3Q0W A;  3MVP A;  5LHG A;  2JTV A;  1OMI A;  1PYV A;  4Y15 A;  2VON A;  3EET A;  2HYF A;  2O0Y A;  2DCE A;  2ESH A;  5K1Y A;  1A36 A;  4RGS A;  1PVE A;  4JK1 X;  2R7W A;  3HUG B;  3WTU C;  1ZR2 A;  3IH2 A;  1YG2 A;  1FWZ A;  3L2C A;  1ZQ3 P;  1IXS B;  3S1N J;  3QYF A;  4CGZ A;  3OYJ A;  2LG4 A;  1D5Y A;  4RB3 C;  5CPR B;  3W2V A;  2BHY A;  2XHK A;  1J0R A;  1TNS A;  2ZNY A;  2R7V A;  3Q0U A;  4EJW A;  5D4S A;  4RGR A;  3HL2 A;  2G7H A;  3LSG A;  2X4H A;  1TQM A;  3GTK J;  1I27 A;  2GIZ A;  4OIP F;  2KMU A;  2DA4 A;  2HYG D;  4RB1 A;  1T38 A;  2GXB A;  3WTV C;  1HC8 A;  1WPK A;  3K10 A;  4HBL A;  3BP8 A;  1YX5 A;  4QPO A;  2JWT A;  1MBJ A;  1BA5 A;  2MD5 A;  3FXQ A;  1ZLJ A;  4XN0 A;  1WI3 A;  2Z2S B;  3F21 A;  2ZME B;  2W00 A;  1IN8 A;  1YI2 I;  1X4O A;  1ZG3 A;  5LLQ A;  3A01 B;  5J4Y A;  1VFC A;  2DT5 A;  3IRQ A;  1O7L A;  4S04 A;  3TO9 A;  4YRV A;  3LAP A;  1F4K A;  3ZMZ A;  2WAE A;  5L3D A;  1Y8Q B;  4KA4 A;  2OD5 A;  1IXR C;  2OC6 A;  4RS8 A;  4M71 A;  5TIS C;  2B7E A;  3KP2 A;  4HNU A;  1F36 A;  2IGK A;  4AUX A;  1A6Q A;  2OJE D;  3Q9S A;  2DQR A;  2DO7 A;  3BDD A;  1W36 D;  4RGU A;  2Y2Z A;  3W6V A;  5FFZ A;  4PJN A;  5LGU A;  1YJW I;  3I53 A;  3DTK A;  1TL8 A;  1DU6 A;  3GYH X;  4ENK A;  1WWX A;  3LA2 A;  1OYW A;  1VQ6 I;  2GXA A;  1DUX C;  2CS3 A;  1DDN A;  1EV7 A;  2A3S A;  1LPQ A;  1JKQ C;  2QSF X;  2EB7 A;  4HF0 A;  2BY3 A;  1FBS A;  2XKO A;  3EDP A;  3PNY A;  3ZMU A;  3GTO J;  5AIQ A;  2ZME A;  4CCO A;  2P7V B;  3ZN0 A;  2CWE A;  3I3L A;  3PM1 A;  5ILV A;  3LST A;  3BTL A;  1ZH5 A;  3ML6 A;  2DN0 A;  1K83 J;  2DOD A;  2LY2 A;  1AKH A;  1IO2 A;  1OPC A;  3E1S A;  2H8W A;  3QPS A;  3RKY A;  4BQN A;  4E7K A;  2E35 A;  1IJW C;  4FX0 A;  4IQ4 A;  3TP0 A;  3ZMD A;  2LTP A;  5D6E A;  3RZD J;  3GVA A;  5B1B H;  1JJ6 C;  5HS7 A;  4IHV A;  1MBF A;  1YIJ I;  2LKX A;  3M7G A;  1VQN I;  1Z67 A;  1X4P A;  2QM3 A;  3BPV A;  4A93 J;  4H4K C;  2GOM A;  1OR7 A;  3DU6 A;  5B5E C;  2CQX A;  3BJO A;  2LKP A;  2LDU A;  5JI6 A;  1XGM A;  1MBK A;  3E7L A;  1KQ8 A;  2UUZ A;  2H94 A;  2M1B A;  1SD4 A;  1XS9 A;  1RR7 A;  4RAZ A;  3S15 J;  3AKZ A;  3H92 A;  2ME0 A;  1HW1 A;  4XLE A;  5F04 A;  4MHG A;  2XAH A;  4BHC A;  3AG4 H;  3A0H C;  3G1L A;  4RDU A;  4M3G A;  3OIP A;  3PFI A;  1XB4 A;  4ENN A;  1AHD P;  1V5F A;  5GAE J;  2P7C B;  1JI8 A;  4JP0 A;  1NTC A;  1AWC A;  2PMZ N;  4UV8 A;  1KYZ A;  4M74 A;  4OOI A;  3CMY A;  4XID A;  3CJT B;  4G7Z F;  3E0J B;  3TGN A;  4DGW B;  3OYF A;  5B66 C;  5ILU A;  4WXH A;  2VE8 A;  1G3Y A;  5FKO A;  4GDF A;  3I59 A;  2BE5 F;  3F8F A;  3DPL C;  4Y52 J;  1XSV A;  4IRG A;  4DOZ A;  4LFU A;  4YEL A;  4BDZ A;  1TC3 C;  2CW0 F;  4A3K J;  2QF7 A;  2L2O A;  3HHH A;  2BY1 A;  1RKT A;  4E7L A;  1Y0N A;  3AFH A;  3CMA I;  2EIK H;  4AYB A;  4QIW N;  4DZJ A;  4J19 A;  1BW5 A;  1ZYR F;  2OF7 A;  2ZFW A;  2W57 A;  3BR5 A;  4KDP A;  3PO2 J;  2Q8K A;  3L2V A;  5DM6 F;  3ONQ A;  5DCF A;  1N25 A;  1R4N B;  3B6C A;  4LJZ F;  1IRF A;  3CLO A;  2QKM B;  4XKW A;  1YRN A;  4DNC A;  5LGN A;  2DFH A;  3KYD B;  5DM7 F;  2NXN B;  5F1R A;  2P6T A;  2H1K A;  4EEF G;  4MLO A;  1OKR A;  5AIP A;  4WX9 A;  2XGD A;  1GLN A;  4JX6 A;  2V9V A;  2O8K A;  2ZJ2 A;  3IL2 A;  1QGP A;  3H5N A;  3LSR A;  2STT A;  1YFH A;  4IOC F;  2G7U A;  3ZQH A;  3I55 I;  1EH6 A;  4CO8 A;  4YFN F;  5CVI A;  1VQ7 I;  3TBI A;  5HLH A;  4GYI A;  3GO5 A;  3OYL A;  2FSW A;  1FYL A;  2M4G A;  1TT5 B;  1HSJ A;  4IRH A;  4HAM A;  3K70 C;  1MDM B;  4OMY A;  3A0B C;  1HKS A;  4CCL A;  4XKV A;  3LWF A;  5IPA A;  3RPU A;  3DKY A;  4LOC A;  2R5Y B;  1ZN2 A;  3RYR A;  5K5Q A;  4EGY A;  4HNT A;  3JTH A;  2ECB A;  3PSI A;  1G4D A;  4P9U A;  1I1S A;  4W97 A;  4UUS A;  2ZBK A;  2OV7 A;  3V42 A;  4I99 C;  3HRU A;  4U0Y A;  1MMA A;  1GUU A;  1UHM A;  3F72 A;  2NOJ B;  1SVL A;  4OU0 A;  2PFB A;  1WJ5 A;  3AL0 C;  5BQT A;  2PI0 A;  3L2Q A;  1WJC A;  1S9H A;  3MFK A;  4F7Z A;  3LSH A;  4I7H A;  5LFA A;  1ZGA A;  1RUN A;  1V5E A;  2OA4 A;  2E60 A;  1FTZ A;  1S5L C;  3BY6 A;  2VKH A;  2NVY J;  3E3V A;  3ZCO A;  2HWV A;  2BGC A;  1MDM A;  1G2H A;  5IT3 A;  2LBF B;  5EZH A;  4XKC A;  2DBB A;  1ZHF A;  1MJ9 A;  1FIA A;  2QKL B;  2L01 A;  4NQW B;  4U7D A;  2XAU A;  1FOX A;  2AO9 A;  1P6R A;  1OFC X;  1BI1 A;  3QOP A;  3FXR A;  1LQ1 A;  4RAF A;  2L3D A;  2R0Q C;  1LFU P;  2P6S A;  3RDI A;  1H9T A;  2QQ9 A;  4KIB A;  4UV9 A;  1FSH A;  3VDX A;  1QHG A;  1ITY A;  1FYK A;  5K7H A;  2IT0 A;  2K4B A;  3JAM K;  5E1X A;  2LKS A;  1Z05 A;  4BGD A;  1QPI A;  3LA7 A;  1T98 A;  3HRM A;  4U0V A;  1ZG1 A;  2L54 A;  2DA3 A;  3B6A A;  3GZN B;  3ELK A;  3VYT B;  3ECO A;  2DQL A;  4A12 A;  4ZYG A;  2RV8 A;  2HQN A;  4GXO A;  3OSG A;  2M5W A;  1IXC A;  5JVG F;  1C0W A;  4A3D J;  2LRD A;  2IS2 A;  4A3C J;  2PEX A;  4YII A;  2XAG A;  4FIS A;  3DEE A;  3GME A;  2DMP A;  2HQA A;  3IH3 A;  2FJ1 A;  3TKY A;  2VOP A;  3WE3 A;  4DYC A;  1K7A A;  1RET A;  2K7L A;  1W5C C;  3HOV J;  3KZI C;  1HA8 A;  1PUE E;  2IA2 A;  4HLX A;  2Q2E A;  1KON A;  1RPW A;  3S16 J;  4IL6 C;  2XAS A;  1R00 A;  1LVA A;  3S1R J;  3ABL H;  5HS9 A;  3BR1 A;  2BZT A;  2R7X A;  4WK8 F;  2UZK A;  2COB A;  5F0H A;  4II3 A;  4XSX F;  5DTD A;  2R3S A;  1J75 A;  3QRF F;  1RNL A;  1PP8 F;  1N77 A;  4EM0 B;  1TW3 A;  1V5G A;  2GZW A;  3FXL A;  2EZI A;  5BS6 A;  4FTH A;  1R9T J;  1D0Y A;  2JT1 A;  2STW A;  2CO5 A;  1U5T B;  2R7Q A;  2ESN A;  3I4P A;  5HVQ C;  4E7J A;  1KU7 A;  2JA8 J;  2CSO A;  1Z21 A;  1T56 A;  3CES A;  2XVC A;  1UJ8 A;  3CD6 I;  2P4W A;  4Q48 A;  2ELK A;  1HST A;  3V8K A;  3UKG A;  1Y1V J;  2HNH A;  3OR1 C;  5JLW A;  4M3F A;  1KQ9 A;  3BCB A;  3TDU C;  3O8G A;  1K78 A;  2KL4 A;  2QWW A;  4I98 B;  2F5E A;  2FXA A;  1U8R A;  3DTE A;  2HPM A;  1UMQ A;  2I10 A;  2W82 A;  3ZMT A;  1IRX A;  4PUS A;  2P5K A;  2FQ3 A;  1V4R A;  4D1Q A;  3QYB A;  3O3K A;  4NBQ A;  1TWG J;  4BL0 B;  1XDU A;  1MSF C;  1Z9C A;  2HXO A;  3I4N J;  3BLY A;  1G3T A;  3O2P E;  4A5M A;  1J09 A;  3P5J A;  5EZG A;  3K4K A;  3MAJ A;  2GM4 A;  5EJC A;  2MH9 A;  4RAG A;  1YLF A;  4Y13 A;  1HBX G;  3KPH A;  4EJU A;  1DGW Y;  1D1C A;  4RGX A;  4Q4Z F;  3SJM A;  1SVO A;  2MLG A;  1YO5 C;  4KMU X;  2Y30 A;  2LD5 A;  4CCJ A;  1QZZ A;  2WB1 A;  1MMG A;  2JQ7 A;  4MIM A;  3OYC A;  3S14 J;  3K4M A;  2DA5 A;  4FAS D;  1D8J A;  2QCO A;  4I01 A;  3HKZ N;  4CIC A;  3DFG A;  1MND A;  3OR2 C;  1TW2 A;  1UG2 A;  2CUE A;  1MNM C;  4HF2 A;  1H88 C;  4XKB A;  4ZYH A;  3U9G A;  3G71 I;  2J5O A;  1WGX A;  4HX8 A;  4W1U A;  3S2W A;  1XPX A;  1RC9 A;  1Z3X A;  5FD5 A;  1PUF B;  3WU0 A;  3HPG A;  1BW6 A;  1WRJ A;  1K4T A;  3DKW A;  1VQ8 I;  3IH4 A;  1AOY A;  1KU9 A;  1GXP A;  3FXJ A;  2E1M C;  1CGP A;  4NC7 A;  1GVD A;  3FMQ A;  4G8X A;  2MGQ A;  4CZZ A;  2B0L A;  3R0A A;  3R6S A;  2D45 A;  1HF0 A;  5C3E J;  2BYV E;  2K9M A;  2FMY A;  3K2A A;  4LLL A;  3BTJ A;  4V2G A;  3IUO A;  3G2B A;  3DEW A;  4UVB A;  5LRR A;  3CCU I;  1XTA A;  2ZJQ F;  1A35 A;  1JGG A;  2W25 A;  3RTR A;  2HI3 A;  1Y8R B;  3BZK A;  4IHS A;  3P9K A;  3S3N A;  3I9V 2;  4N9I A;  5LEK A;  2EWN A;  1X3Z B;  2XAQ A;  4FE7 A;  3T8R A;  1HLV A;  3WG9 A;  1WCM J;  2QQB A;  4I76 A;  3UR3 C;  1P92 A;  1XGO A;  1JE8 A;  1IDY A;  3OYA A;  1BI3 A;  2VJI A;  2R7S A;  2EQR A;  3OWT A;  3LFK A;  3KEO A;  5JR3 A;  4G9Y A;  2JPB A;  2IS6 A;  2A07 F;  1R5H A;  5EG0 B;  1R6R A;  1X1P A;  2KHM A;  4LGW A;  4PFP A;  4LB6 B;  5CQE A;  1BR4 A;  4ESJ A;  2IA1 A;  5BPI A;  2CRG A;  5JFR A;  2IGM A;  3I64 A;  2QA4 I;  2CQN A;  2QEN A;  4IHT A;  3LSJ A;  4XOT A;  1VZ0 A;  4DBR A;  3JSO A;  3G1O A;  2O61 A;  3K70 D;  5CKT A;  5HDK A;  3HYI A;  2ZXW H;  2R5Z B;  1BR2 A;  1VQO I;  4B8X A;  2Y75 A;  2LRE A;  3EYY A;  1WSU A;  2L7M P;  1TTY A;  5DS9 A;  2EIM H;  2LP0 A;  4Q47 A;  2DT7 B;  2E5Z A;  4G6T B;  1LE8 B;  5HNF A;  1QBJ A;  1P4X A;  2D2W A;  4G94 A;  5DD8 A;  2H8R A;  3DPU A;  3FK7 A;  1M1E B;  1SD7 A;  1SD5 A;  3H1C A;  3D1N I;  2ELH A;  4U88 A;  4UVC A;  1B9N A;  1A04 A;  5GTI C;  3CO6 C;  4HV5 A;  1OCP A;  4MQ9 F;  2O03 A;  2VBZ A;  4OIO F;  2MLK A;  4P55 A;  2O5R A;  3C1D A;  4A0Y A;  5GPA A;  3U1K A;  3UNG C;  3G73 A;  2MG4 A;  3J80 K;  1ZGJ A;  2XC7 A;  2XRL A;  2XRO A;  4D0P A;  1LNW A;  5CLS A;  1OJL A;  4ASN A;  5LGT A;  1KU3 A;  2A61 A;  1Y1W J;  1VQP I;  2ACJ A;  1CF7 B;  1O3R A;  5KVR A;  3AG3 H;  3H5R A;  4QSH A;  4YIF A;  3BWG A;  3DKX A;  4A0Z A;  1ZAO A;  2HVQ A;  2PBI A;  2NVU B;  3FWE A;  5H6R A;  4I0B A;  1EJ9 A;  3CLQ A;  1W5T A;  3GTP J;  5E20 A;  1R22 A;  1YTY A;  2DA1 A;  4GGG A;  3C2G A;  1WJF A;  2LF7 A;  2P81 A;  1D0Z A;  3ZR8 X;  3SDG A;  4I09 A;  3R61 A;  1ZGW A;  1XCV A;  1LJ9 A;  5IOZ A;  1R49 A;  2VOO A;  1UFM A;  2DMN A;  4QTR A;  1XGS A;  1FC3 A;  2X0L A;  3CF5 F;  1MSE C;  3PL8 A;  4D5F A;  3MZH A;  4UUV A;  3ZGK A;  3R60 A;  1YQA A;  4RB2 C;  2DOA A;  3F8N A;  2NNY A;  4HG2 A;  5L3G A;  3PUB A;  1ZAR A;  2LC2 A;  1IN4 A;  3WTW C;  5CVR A;  2JA7 J;  1DP7 P;  3WTY C;  2FE3 A;  3K4C A;  3L2W A;  4H0E A;  1FY7 A;  3ROU A;  1PDN C;  3H3V K;  2M87 A;  4BU2 A;  2VQG A;  3IP4 B;  2JUG A;  4PSW A;  3QAH A;  1SD6 A;  2FU4 A;  2L9R A;  3IKT A;  4WWC A;  5CVJ A;  1IN7 A;  3SQN A;  3FX3 A;  4ITV A;  3JAM Z;  1RRJ A;  4XNF A;  1B1B A;  2VB6 A;  1ZTR A;  3AG2 H;  4RLQ A;  3OYE A;  3PUF A;  1SFO J;  2E2I J;  4CSW A;  2PJP A;  4HDU A;  1TQI A;  4LD5 A;  2A6T A;  1Y39 A;  3HIF A;  3CDH A;  3A02 A;  1SFU A;  2L4A A;  4D5C A;  2Z5U A;  2IEK A;  4HOB A;  2HFH A;  4EM1 A;  2L9S A;  2X6W A;  5E1Z B;  2PMZ A;  2JK3 A;  1KU2 A;  2OTJ I;  2YU3 A;  3G3Z A;  3MKY B;  4OIQ F;  4OAZ A;  2ZKZ A;  3GZ5 A;  2L4M A;  2VC1 A;  2XDV A;  2LH9 A;  3E5U A;  3G4S I;  2JUC A;  5HS8 A;  4A3E J;  2NVQ J;  2VC0 A;  3RZO J;  1ETY A;  3FKI J;  2DJN A;  2VIX A;  3FM3 A;  4PGG A;  3A03 A;  3BG3 A;  1UZC A;  1I3Q J;  2K9L A;  2DOE A;  5E1W A;  2WV0 A;  3V7R A;  5J8F A;  4M9Z A;  3CME I;  4EV0 A;  2QEX I;  4A3F J;  4V19 K;  2L7Z A;  2D1H A;  3RQI A;  1GV2 A;  2CG4 A;  2C6Y A;  3FIW A;  1MZB A;  4PJL A;  3W2A A;  2HTJ A;  5BOX A;  2K9S A;  3W3C A;  3GZ6 A;  3GEZ A;  3J7Y J;  3I56 I;  3DWL E;  1U8B A;  2EFP A;  4FET A;  5HOO A;  4F55 A;  1WVR A;  3BT9 A;  4MO7 A;  2M0C A;  2V4J C;  3D5L A;  4HQE A;  1S7O A;  1IZ1 A;  2Z9O A;  2AS5 F;  5DUI A;  1YYV A;  3JRE A;  4IF4 A;  3JRH A;  2GXG A;  1HKQ A;  4L9J A;  5J1U A;  4CCK A;  3NEU A;  4Z2Y A;  3Q0V A;  1GDT A;  2E7W A;  1AKH B;  1PP7 U;  3WU1 B;  1MMS A;  1QU3 A;  1LVK A;  3ERM A;  2IW5 A;  2MC4 A;  2M4K A;  5D5W B;  2LVS A;  1G6N A;  3BCA A;  3CCJ I;  5IYD J;  4BUP A;  2RVC A;  1E3H A;  5A2Q K;  5FKM A;  4O3M A;  1JKO C;  4MGR A;  1Z6T A;  4IXA A;  2KP6 A;  1LDJ A;  2ZB9 A;  2JN6 A;  3VSL A;  2PMH A;  3M8J A;  3CJN A;  3ESW B;  5FD6 A;  5FKK A;  2W7N A;  3HGY A;  2KT0 A;  3IRR A;  1OYI A;  2O9L A;  1XG1 A;  1A31 A;  5FB2 A;  3S93 A;  1K4S A;  1VTN C;  4HV6 A;  2DDA A;  2E7X A;  4P9F A;  2W24 A;  4PJM A;  2ZJP F;  1KYW A;  3IV5 A;  1VI0 A;  1KZH A;  4HDV A;  1MJA A;  1T6S A;  3WHC A;  2LR8 A;  1BM9 A;  4N4O B;  1T0F C;  2X1D A;  2Y0M A;  3SHF A;  2FRH A;  1NK3 P;  2VLA A;  3HC7 A;  3I59 B;  3BZC A;  4M73 A;  3TW6 A;  5M3F J;  1O3Q A;  1BJA A;  5D5U B;  1J9I A;  1P7I A;  2IS1 A;  3L2R A;  5DUK A;  5FFX A;  3BRO A;  1NHA A;  4IO9 F;  3ZP5 A;  1MJB A;  3I4M J;  4DQ2 A;  2O8X A;  3G6E I;  4S05 A;  1VF9 A;  4G6Q A;  3FXU A;  4CZC A;  1RES A;  3MWM A;  3GTQ J;  3WGI A;  2WY8 Q;  1MBG A;  4PSX A;  1R1V A;  4A6D A;  4E7I A;  1B9M A;  3M8E A;  1YRN B;  2HVR A;  4DBQ A;  3JR9 A;  2V9K A;  2F4M B;  1VQK I;  5IYB J;  4MFD A;  5EDN A;  2VXD A;  1BL0 A;  3BOQ A;  2VBW A;  4M6X A;  4IHY A;  1Z77 A;  3F0C A;  4XMY A;  2CGP A;  2FNA A;  2I8D A;  3GXO A;  1S7E A;  4XLF A;  1YJN I;  1I5Z A;  5GAG J;  1BC7 C;  2KIQ A;  3ZQQ A;  2DYS H;  2PMU A;  4RM3 A;  2DDB A;  1HXD A;  3HDD A;  3D5R C;  4L5J A;  1FJL A;  1VQL I;  3LQQ A;  4NDL A;  2BOL A;  4PGH A;  2M2E A;  2Z16 A;  2L5Q A;  4L5E A;  4BEH B;  5E3L A;  2KZG A;  3RPU D;  2R7R A;  1ZRD A;  2JRM A;  2DA6 A;  2GOX B;  1SAX A;  3OL3 A;  4ZH4 F;  4DZP A;  3VPR A;  4UUS B;  4XRM A;  3W2W A;  2GBY A;  2FF4 A;  3OV8 A;  4UXN A;  1A5J A;  1B59 A;  3NWT A;  3E6M A;  4D7M A;  1IW7 F;  2HKO A;  1OCO H;  2VBY A;  2DA7 A;  3SDB A;  4KUM A;  5EEH A;  5J6X A;  2HGC A;  2BVM A;  3OL4 A;  4R1H A;  4XN3 A;  3SZP A;  1SC7 A;  2W85 A;  3GW2 A;  4B1R A;  1ETV A;  2YS9 A;  2V1U A;  3KP3 A;  1B8I A;  4I02 A;  3OYK A;  2DLL A;  2OBP A;  4C2M J;  3K69 A;  2IJL A;  4XR6 A;  2ME6 A;  1Y6I A;  3HSR A;  4XQF A;  5DCM B;  2B63 J;  3VEP A;  4ESF A;  2GA2 A;  3F6O A;  3R4K A;  1XSX A;  3PJR A;  3CCY A;  3GTL J;  3VYR B;  2WAF A;  4BEH A;  3T0Y A;  2A5W A;  2K5C A;  4QLC U;  1YS6 A;  2ISY A;  3RSN A;  1YX3 A;  3OIO A;  2XGE A;  4EJO A;  1TWA J;  4XIC A;  2HQR A;  2K9N A;  4E7Z A;  5IT9 K;  1O57 A;  2WAD A;  1EH8 A;  4HA8 A;  2D1V A;  2LNB A;  4BHP A;  3MZ8 A;  5IP7 J;  4AVZ A;  3V8J A;  3ZPL A;  1FEX A;  2DT6 A;  3CP2 A;  4LB5 A;  3E97 A;  3P7N A;  3D5S C;  1LEA A;  2K02 A;  1D1A A;  4BY1 J;  2AHQ A;  3K6G A;  2G0E A;  1J59 A;  2Y48 A;  4IX7 A;  3KZY A;  1XD7 A;  4A3I J;  2FBH A;  1BBY A;  4EJV A;  1FBQ A;  5K7F A;  3RKW A;  2L9N A;  4CHU A;  2LOO A;  4UHT A;  4OMZ A;  5DCM A;  3RIR A;  1XSD A;  1U3E M;  2LMD A;  3HKZ A;  1JJ8 C;  3JTG A;  3QWL A;  5EF6 A;  5E18 F;  1O7F A;  1Z1D A;  5F0F A;  3TO6 A;  1T95 A;  1T2K A;  2PJR A;  1USS A;  1W0U A;  4BY7 J;  4IZZ A;  1JKP C;  1YIT I;  3Q9V A;  3D0S A;  1B6A A;  1HDP A;  4BJ5 C;  4HNV A;  2Q2E B;  4FT8 A;  4GO1 A;  2QUF A;  3ZQF A;  5IY5 H;  1W5S A;  3OS1 A;  3F22 A;  1TT0 A;  2PN6 A;  3GFM A;  3CCL I;  1TBX A;  2R7T A;  5EYR A;  1ON2 A;  4M9X A;  2KRC A;  5KCM A;  3K1N A;  5EGO A;  2DTZ A;  1FOW A;  3OYB A;  2ZJR F;  5IP6 A;  3BG7 A;  4FCY A;  5CJ9 A;  4J00 A;  2COM A;  1TNT A;  2BVL A;  2EJR A;  2IXS A;  2OCE A;  4IHX A;  2O3F A;  4A3L J;  1OLT A;  2VKD A;  5FGM A;  3WTZ A;  3KCC A;  3CCQ I;  2K27 A;  2OZU A;  3CJQ B;  1SEU A;  3HOY J;  4FX4 A;  1STZ A;  1U9O A;  1LDD A;  3ZMV A;  4XK4 A;  4IHW A;  4UY8 I;  3CUQ C;  1I3A A;  3HOZ J;  1W4M A;  5DD4 A;  5K5O A;  4WXD A;  2H6C A;  2R7D A;  4ZJZ A;  3SFI A;  4E70 A;  4AD9 A;  2W48 A;  5ICC A;  3OYM A;  2RKH A;  5IYC J;  2JZY A;  4JBA A;  3SEQ A;  2ADU A;  4LG0 A;  1FLI A;  3NQO A;  4AM3 A;  1KGS A;  3LSM A;  1JT0 A;  2E2H J;  4ZYE A;  3PIO F;  1FBU A;  1N75 A;  4II2 A;  1K78 B;  2NNN A;  5H20 A;  1VQ9 I;  4F52 A;  1EA3 A;  1HW2 A;  1JUM A;  3MD2 A;  2VAS A;  1AA7 A;  2CUZ A;  2X51 A;  1JGS A;  1U78 A;  1F43 A;  5FRO A;  5GAD J;  2M30 A;  5LRS A;  5LEJ A;  2OTL I;  4U87 A;  3T1B A;  4R8H A;  4S0H B;  3WHB A;  4IRI A;  1X19 A;  2WV1 A;  3OYH A;  3MKW B;  2Z99 A;  5IP9 J;  3S32 A;  2AXL A;  3BR3 A;  2FBI A;  2RNG A;  2X1C A;  2XB0 X;  3DTI A;  3RPQ A;  2IVM A;  4E4H A;  4L5I A;  3TQN A;  3K4B A;  4HYE A;  2E5N A;  1ODD A;  3KLO A;  2FOK A;  3HJE A;  3BJA A;  4L0Y B;  4FE4 A;  5EEG A;  3HG9 A;  5DDG A;  3GX4 X;  1SVM A;  2K4J A;  2CFX A;  2LSO A;  3K1P A;  5HOD A;  4I2O A;  1JUP A;  5GP9 A;  4F92 B;  3S1M J;  2HZT A;  3HOU J;  3GWZ A;  1R4M B;  2V1N A;  5J47 A;  1MMD A;  2NAZ A;  2CH0 A;  4F3Q A;  3OSF A;  2KFD A;  3FIS A;  1H9G A;  2RGV A;  1O3S A;  1IV8 A;  3MCZ A;  3JRD A;  1T39 A;  1O4X A;  1SMY F;  3BR0 A;  1TLH B;  3P9C A;  5HDG A;  5FRM A;  4N9H A;  3IAM 2;  1G8X A;  1ENH A;  3GFI A;  3EUH C;  3FMS A;  2BXZ A;  4EMS A;  4C3I J;  3ZRG A;  1MBE A;  2FA5 A;  3QU6 A;  3CQZ J;  1W7P A;  2NVX J;  5DEQ A;  5E8G A;  4FQG A;  4KIT B;  4GRI A;  5KAF C;  2G9W A;  1FZP B;  3K7A J;  2RC4 A;  3FZV A;  4BKX A;  3OYG A;  2YX4 A;  4EJT A;  1T0F A;  2JA6 J;  3B02 A;  2DFE A;  1R1T A;  2K3F A;  3NRV A;  1V3F A;  5M5Y J;  3HZJ A;  2F6C A;  2MAB A;  2J5P A;  2WC2 A;  5C4J J;  1QZE A;  5F6F A;  5LD2 C;  1BN5 A;  3MQ0 A;  3S1Q J;  1K79 A;  2M9H A;  4ZTJ A;  2HOE A;  3K4L A;  1FPQ A;  3QYE A;  1W36 C;  1U0J A;  1H89 C;  3PO3 J;  2KRF A;  3MKZ A;  2OUM A;  1J2X A;  2EIJ H;  1IRZ A;  5BMZ A;  2X85 A;  2JMW A;  2GWR A;  3DV8 A;  1IGN A;  3S8P A;  3H0D A;  4HF1 A;  1MW7 A;  2MD0 A;  3V4G A;  2F2E A;  2M34 A;  2QGU A;  4CCN A;  1LUJ B;  1A6I A;  3H9G A;  1GHC A;  1PJR A;  4HZF A;  3NAU A;  3ZQ7 A;  1UHS A;  4G7O F;  4XOP A;  4Y7N J;  4CA0 A;  4KMF A;  5L3C A;  4U7B A;  4M6Y A;  4MTD A;  3E5Q A;  4AID A;  1BC8 C;  1R7J A;  1X3U A;  2AQF A;  3KE2 A;  2KJC A;  2ZSI B;  2BXY A;  4LK0 F;  4ZYA A;  5KK1 A;  4L9N A;  1H0M A;  1FYM A;  1VND A;  4XLC A;  1JT6 A;  3DCF A;  1SFX A;  1QQI A;  2L02 A;  1YHQ I;  2EV5 A;  1ONV A;  1TP4 A;  3HTS B;  1R23 A;  1ZR4 A;  4KIF A;  4Z6Y A;  1FTT A;  1WH7 A;  4C2T A;  4C3H J;  1UAA A;  2RQP A;  3S3O A;  2VPR A;  1VQ5 I;  1ZEL A;  2O7O A;  3QOD A;  2QSH X;  3WG7 H;  4MEX F;  1T08 B;  2ELJ A;  5HLT A;  1DGR M;  3I5U A;  4L9V A;  3CJR B;  2KJB A;  2VUM J;  4DYQ A;  1ZRC A;  2OU2 A;  1D3Y A;  5C44 J;  4IKF A;  5M5W J;  4D9J A;  3PSF A;  3IWZ A;  3C18 A;  1BI0 A;  2ZC2 A;  5J8C A;  5JHF A;  2P5V A;  2JJ7 A;  3VYS B;  3C2H A;  1ZK8 A;  2FQ4 A;  3EQL F;  2HDW A;  3KZZ A;  3AL0 B;  4ZC3 A;  2NYX A;  3K4N A;  1BJZ A;  4KIC A;  5D8K B;  3F8B A;  2KZV A;  3KYC B;  1I6H J;  3IC7 A;  4D7N A;  1XX5 A;  3RI4 A;  5HNH A;  4RM2 A;  1NG6 A;  4DJA A;  2GQQ A;  4NB5 A;  3M07 A;  3HB9 A;  3ZQI A;  4KN4 X;  4A6E A;  1P4A A;  3HRT A;  3OS0 A;  4PJ0 C;  2R92 J;  3LQR A;  5IT9 Z;  4J01 A;  1ZKG A;  2X1E A;  3NAR A;  1HW5 A;  1MKM A;  1IUY A;  1FIP A;  2XSD C;  2A69 F;  4BXF A;  3IAS 2;  4BS9 A;  2WBM A;  3FKJ A;  1V54 H;  1JKR C;  2FX0 A;  1SAN A;  1IC8 A;  4HW0 A;  4AU7 A;  2Y9Z A;  3HRS A;  3KLN A;  4ANJ A;  1HKT A;  4Y3O A;  3OOP A;  4BQQ A;  2XRN A;  2BY2 A;  3CC2 I;  3TP3 A;  1Q1V A;  2CU7 A;  5BPD A;  2M3A A;  4B3A A;  1IRG A;  2Y0S N;  2MW8 A;  3ZQG A;  1S72 I;  1RI7 A;  3JSP A;  3J7Z I;  2XV4 S;  4B48 A;  1JTY A;  5K5R A;  4XBF A;  4M3D A;  3ZXS A;  4JX5 A;  2DAO A;  2DPD A;  1MD0 A;  4WXC A;  3MKL A;  3CUQ B;  2DMU A;  1P4W A;  2K3P A;  1Q1H A;  5KAI C;  1OCZ H;  5DV5 A;  4LIV A;  3S3M A;  3QPT A;  5ICE A;  4B4C A;  2X6Y A;  2RDP A;  2VBX A;  4DYR A;  5BNG A;  1ORK A;  3BPX A;  3HPH A;  3KET A;  2R7U A;  2K85 A;  2LY1 A;  3WU2 C;  3L09 A;  2RRE A;  4UUT A;  3KP6 A;  2FEZ A;  5HLI A;  1Y0U A;  2MC3 A;  4B47 A;  1WFX A;  2H27 A;  3MMY B;  5D5V B;  4I6Z A;  3GCM A;  5J40 A;  3QPL A;  2XB5 A;  1S8N A;  2QBY A;  4AVP A;  1XC5 A;  4OIR F;  2F5V A;  2HDC A;  5HLG A;  3BQY A;  4YFK F;  3GLX A;  4UB6 C;  3CUQ A;  3KEY A;  4L0Z B;  5CQG A;  4ZTF A;  1H8A C;  2VOD A;  3CC4 I;  2DK5 A;  2FBK A;  1B72 A;  2ZCW A;  3I0T A;  4RAY A;  4AWX B;  1BOA A;  4U0W A;  5FO5 A;  5E8I A;  1UG0 A;  1LDK B;  4CYC A;  2RAE A;  3LFU A;  3JW4 A;  1P7J A;  1QHH D;  1OIS A;  1S3J A;  2K40 A;  1GVJ A;  1WKM A;  2ID3 A;  2OPT A;  1HDD C;  2CW8 A;  2QLZ A;  3A1Y A;  3OYD A;  3SZT A;  1Z7L A;  2VJJ A;  2LY9 A;  4KN7 X;  2E1C A;  4YEJ A;  4BNC A;  2F5D A;  2R7Z J;  3NWS A;  1Y56 A;  4HX7 A;  1K6Y A;  2XIG A;  2Y69 H;  3M9A A;  4BAY A;  3CCV I;  5IOY A;  2FD5 A;  3ABK H;  3F3X A;  2BBY A;  4B3X A;  2CUF A;  3FHN A;  1ZRE A;  1YW7 A;  2UV1 A;  2F4O B;  1TZL A;  3L7W A;  3ERE D;  1VQ4 I;  2VI6 A;  5LHH A;  5KNL A;  2EBI A;  2JA5 J;  3FF5 A;  2BW3 B;  2H09 A;  3ULQ B;  3J7A O;  1WJA A;  2L9V A;  1REP C;  4I0A A;  2DOF A;  2CUJ A;  2E71 A;  2EZL A;  2CV0 A;  3ASN H;  4G6D A;  2W84 A;  5FLX K;  2IGN A;  4ZZD A;  3W6K B;  3FXM A;  2H6B A;  5D5X B;  5HDN A;  2VQC A;  1UCR A;  2WA0 A;  2FML A;  5F08 A;  2KIU A;  3HUG A;  3TMO A;  2A5Y B;  1EH7 A;  5LHI A;  4ENJ A;  4XRS G;  1DQU A;  4PCQ A;  4K2E A;  2LF8 A;  2NS7 A;  3EPZ A;  5D8L B;  3TW7 A;  4R79 A;  1F9N A;  2UXN A;  1WQ2 A;  4BE0 A;  1D5V A;  1QRY A;  2IRF G;  1D8K A;  2CV1 A;  1W0T A;  3BG9 A;  2E1M B;  2A68 F;  3BC8 A;  5CVV A;  4KT5 C;  3EUH A;  4Y17 A;  3DLL F;  2D5V A;  3S2H J;  4F93 B;  2BW3 A;  2V6C A;  4XRF A;  2EV0 A;  2V9P A;  3LOC A;  2HOT A;  2A6E F;  3IHU A;  3ABM H;  2GLO A;  4A3J J;  1QPM A;  1YS7 A;  1ETX A;  3HOT A;  1WHU A;  2Q0O A;  3J7A Y;  2OZ6 A;  1U9N A;  4M9S A;  3TL4 X;  2ZNZ A;  4ON0 A;  2M8E A;  1U5T C;  1TQP A;  3ABU A;  3MZY A;  1FOK A;  3TOB A;  3C2B A;  1BIA A;  3HHG A;  4RMN A;  1W1W E;  3H3Z A;  1ERD A;  4FHT A;  2MH2 A;  3FXO A;  3A01 A;  4BYY A;  1MNE A;  1BOB A;  2JRT A;  2Z3Y A;  4QWQ A;  1DPR A;  4O5V A;  3H0G J;  2V6E A;  2NS0 A;  1FMV A;  2EIN H;  2VT2 A;  2Z1D A;  2ZXJ A;  5GTH C;  3J81 K;  1F5T A;  1DU0 A;  1U2W A;  3PQJ A;  4X6A J;  3KP4 A;  4L9T A;  4CH7 A;  3N97 A;  2RQQ A;  2BY0 A;  2HPI A;  3ECH A;  4KJZ A;  1D0X A;  3TO7 A;  3JRB A;  2F5F A;  4OWR B;  1APL C;  5ED4 A;  3O6B B;  3ISP A;  1SAU A;  2QZ8 A;  2K86 A;  4BHB A;  3FMR A;  3DXJ F;  5CYV A;  2M45 A;  4IVN A;  1R5G A;  3JRI A;  4UB8 C;  1E0E A;  1G59 A;  3CMM A;  2PQ8 A;  2F5C A;  2WAQ N;  2XPW A;  3KP7 A;  1ETW A;  1L0O C;  2XSJ C;  4KIS A;  1N78 A;  1P2F A;  3W6J B;  2KQR A;  2JPC A;  2QYO A;  3H9Q A;  3M8F A;  4QPQ A;  1ACI A;  1QZY A;  5E3M A;  3M4O J;  2HXI A;  2CQ7 A;  4KIG A;  2GA1 A;  3I71 A;  2KRH A;  3RKX A;  5E17 F;  1UHW A;  4A69 C;  2ECC A;  1XN7 A;  2EFW A;  5DYM A;  1E2X A;  1B8I B;  3LNQ A;  4HLY A;  2DTR A;  5E79 C;  2EFQ A;  3LMM A;  4A2U A;  3FBN B;  5F1J A;  4LIT A;  2LFB A;  2W4S A;  2LLK A;  2M8G X;  2XF7 A;  4OAY A;  1OQY A;  3VFZ A;  4DIQ A;  2GIV A;  4TV7 A;  2WY7 Q;  2X9D A;  3V7C A;  2VE9 A;  1FMW A;  2EFN A;  3OY9 A;  3SYT A;  2JA2 A;  2EPF A;  3H9J A;  3REO A;  3RCO A;  1JHF A;  2EIL H;  3C3W A;  1K61 A;  4P1W A;  3DBL B;  2HOS A;  1MBH A;  3L00 A;  4CXF A;  2XF6 A;  3KYL A;  3JRF A;  2EA4 A;  1XGN A;  3VB2 A;  2VKE A;  4PK4 A;  3Q5F A;  3CF2 A;  4E7H A;  2MFZ A;  2P8T A;  3BG6 A;  1X2N A;  3J80 Z;  3K1M A;  4EGZ A;  3HSF A;  2CJJ A;  3E6B A;  2CW7 A;  2JVG A;  2XUB A;  5M5X J;  1HCR A;  1KA8 A;  4BJT A;  1VQM I;  4F91 B;  2IS4 A;  3WTS C;  5L3B A;  4LLG F;  2DXI A;  1Z6R A;  4ZYD A;  1NH3 A;  3GF2 A;  2PJR B;  4GFB A;  5FKL A;  3HTU A;  4JQF A;  4XLH A;  5B3S H;  3OYI A;  1CQT A;  4A3G J;  3HOS A;  2R4G A;  3H5A A;  4NHJ A;  2HQ5 A;  1P9Q C;  3H36 A;  4ENM A;  4BH9 A;  2VJ5 A;  3FK6 A;  4O6J A;  1O3T A;  2IA0 A;  5EGO B;  3WE2 A;  4AIJ A;  2XPV A;  2EFO A;  2LYC A;  1EKE A;  4BJ6 C;  5L3F A;  2NOG A;  1TWF J;  4LLN A;  3S17 J;  1WJE A;  1XMA A;  3DU5 A;  2NS8 A;  4YIR X;  4ESB A;  1UEL B;  1IF1 A;  5JVT A;  4JYK A;  2VQL A;  3WGH A;  1D1B A;  2MBF A;  3F8C A;  4Q5S F;  2KIM A;  1E17 A;  3K9T A;  1KQ0 A;  3WTX C;  3OIQ A;  4XOR A;  3OYN A;  1LEB A;  3TDZ C;  5D4R A;  3L9F A;  3LSK A;  3IKV A;  3L1P A;  3PNT A;  3P9I A;  2PX9 A;  3BJ6 A;  1NG7 A;  4GYG A;  5E3N A;  4EAT A;  3PIP F;  4BQO A;  4N4N B;  2QSG X;  3QP6 A;  4DW6 A;  4LG0 B;  3V8L A;  6PAX A;  2RN7 A;  2EZH A;  1LB2 A;  3VOE A;  3U2R A;  3TOA A;  2XKP A;  3CCS I;  2V1D A;  1FNN A;  2OAZ A;  1OCT C;  2VL8 A;  1SFE A;  2ZFU A;  4WCG A;  2K9Q A;  2V79 A;  2R5Y A;  4RLF A;  1V55 H;  2HR3 A;  1IN6 A;  2ID6 A;  3AAF A;  1E3O C;  1POG A;  2YSR A;  4MNU A;  2O6G E;  2DU9 A;  3VWB A;  1ON1 A;  4KFC A;  3FHZ A;  1I39 A;  1J5Y A;  2E19 A;  2CYY A;  2LK2 A;  1Z3Y A;  5FRN A;  1ETK A;  1WZ2 A;  3VSK A;  3N4M A;  3U1D A;  4IQJ A;  4JX4 A;  5EEA A;  4V2F A;  2UXX A;  1JXS A;  2Y9Y A;  1X1A A;  5ICG A;  3V7S A;  4BXX J;  4EVI A;  2QVO A;  4MTE A;  1B4A A;  3RQ4 A;  4HQM A;  2L7K A;  2L7F P;  3U21 A;  2FOW A;  4C30 A;  3CDI A;  1FOY A;  1Z7U A;  2M7A A;  3OOU A;  3DBH B;  2DK8 A;  2LBF A;  3E6C C;  2JVH A;  2CMP A;  4XSZ F;  2A05 A;  3CCR I;  1T8I A;  2P0W A;  4KNY A;  4NQW A;  4BBR J;  1XMX A;  2MYS A;  2VT3 A;  4C3J J;  1K6O A;  1LFP A;  3QP5 A;  3KIO A;  4C9Y A;  4A0X A;  1TWC J;  1RZ4 A;  3WGG A;  4AYB N;  4L18 B;  1IDZ A;  3G1M A;  3HXL A;  2ISZ A;  4MQV A;  3AG1 H;  5JLX A;  3E6D A;  4XLA A;  3M1E A;  1NK2 P;  3QU3 A;  3FBI B;  2ICW G;  5D6F A;  3ASO H;  4ZZL A;  3BR2 A;  4Y4R A;  5B1A H;  4RBO A;  2QQ8 A;  1JHH A; 
#chains in the Genus database with same CATH homology
 1ZK8 A;  2N8G A;  5J1R A;  1YRN A;  2FQ4 A;  3HM5 A;  1BJZ A;  4MFE A;  3JRE A;  2H1K A;  2DMT A;  4EEF G;  4MLO A;  3JRH A;  5E3O A;  2XGD A;  4JX6 A;  4M6V A;  1I6H J;  2O8K A;  4D7N A;  5J1U A;  3Q0V A;  3LSR A;  1GDT A;  3ZQH A;  1AKH B;  3HB9 A;  3ZQI A;  2LVS A;  5C4X J;  5IYD J;  1JUS A;  2R92 J;  5FKM A;  1JKO C;  2IAI A;  1ZKG A;  3NAR A;  5IPA A;  1FIP A;  2XSD C;  4LOC A;  2R5Y B;  1X58 A;  2ZB9 A;  1JKR C;  2JN6 A;  2FX0 A;  1SAN A;  1IC8 A;  3GTM J;  5FKK A;  2ECB A;  3HGY A;  4W97 A;  4UUS A;  2Y9Z A;  2KT0 A;  1RKW A;  2YUS A;  2O9L A;  1XG1 A;  3HBL A;  1GUU A;  3TP3 A;  1Q1V A;  2CU7 A;  4B3A A;  2Y0S N;  2MW8 A;  2XGC A;  3ZQG A;  3HOX J;  1JTY A;  4M3D A;  4JX5 A;  2HOA A;  1T33 A;  3MKL A;  1FTZ A;  2DMU A;  2HDD A;  3IV5 A;  1VI0 A;  2NVY J;  3JRC A;  9ANT A;  3WHC A;  2LR8 A;  4B4C A;  5M3M J;  3S2D J;  1G2H A;  4DYR A;  5BNG A;  1NK3 P;  1ORK A;  5EZH A;  1ETQ A;  3TW6 A;  1FIA A;  5M3F J;  1MH4 A;  1GT0 C;  5GPC A;  4UUT A;  2AO9 A;  1OFC X;  1P7I A;  3HOW J;  2R0Q C;  3BR6 A;  4I6Z A;  1LFU P;  3QPL A;  5K7Z A;  2XB5 A;  1ITY A;  3I4M J;  5J3L A;  5K7H A;  1VF9 A;  1XC5 A;  1QPI A;  2TRT A;  4BBS J;  1RES A;  3GTQ J;  4X1E A;  1MBG A;  2DA3 A;  3B6A A;  3BQY A;  2NVT J;  1QVU A;  1YRN B;  1AU7 A;  3HGG A;  1MH3 A;  3JR9 A;  3OSG A;  1H8A C;  3TED A;  1B72 A;  5IYB J;  4A3D J;  4MFD A;  5EDN A;  3O8H A;  1LFB A;  1BL0 A;  4A3C J;  2IBD A;  4CYC A;  4IHY A;  1Z77 A;  3F0C A;  2RAE A;  4FIS A;  3GBG A;  3GTG J;  1P7J A;  5F27 A;  2DMP A;  3IH3 A;  2FJ1 A;  2K40 A;  1S7E A;  4DYC A;  1RET A;  2ID3 A;  2OPT A;  4M3E A;  1HDD C;  3HOV J;  1PUF A;  1TWH J;  5FLM J;  1HOM A;  1RPW A;  3S16 J;  2LY9 A;  3CDL A;  2R7Z J;  3HDD A;  1FJL A;  4NDL A;  3S1R J;  2M2E A;  4L5E A;  4A3M J;  3BR1 A;  1IG7 A;  5E3L A;  5IOY A;  2XPU A;  2FD5 A;  3MN2 A;  2DA6 A;  2CUF A;  2COB A;  2L0K A;  5FKN A;  5DTD A;  5F0H A;  2CQQ A;  2DA2 A;  4UUS B;  4DZP A;  3VPR A;  3Q3S A;  4XRM A;  2GBY A;  2VI6 A;  4XRS A;  3RKQ A;  2DMQ A;  2EBI A;  2EZI A;  3GTJ J;  2JA5 J;  1A5J A;  4FTH A;  3ZQC A;  1R9T J;  4D7M A;  3HEF A;  2EZL A;  3BTI A;  2DA7 A;  2JA8 J;  4ABZ A;  1T56 A;  4B1R A;  1ETV A;  2YS9 A;  5FJ8 J;  1B8I A;  4A3B J;  2ELK A;  4C2M J;  3LSP A;  3UKG A;  1Y1V J;  5F08 A;  5JLW A;  2ME6 A;  4M3F A;  3O8G A;  4XRS G;  5EG0 A;  2B63 J;  4IEJ A;  2NS7 A;  2E2J J;  1I50 J;  3TW7 A;  2TCT A;  1UMQ A;  2I10 A;  3CCY A;  3GTL J;  1EF4 A;  3ZOB A;  1Z0X A;  3JRG A;  1QRY A;  1TWG J;  3OIO A;  2XGE A;  4XIC A;  1TWA J;  4G12 A;  2K9N A;  1W0T A;  1MSF C;  3BG9 A;  2HXO A;  3I4N J;  3QQA A;  2D5V A;  3S2H J;  5EZG A;  5IP7 J;  2R5Z A;  1GV5 A;  3LOC A;  2GM4 A;  1IUF A;  2HOT A;  1FEX A;  5FLV A;  2HYJ A;  2GLO A;  2KDZ A;  4A3J J;  3ZQL A;  1ETX A;  1JTX A;  4BY1 J;  1LE8 A;  3BQZ A;  2AHQ A;  1U9N A;  2X6O A;  2YU9 J;  2G0E A;  5F0C A;  4M3B A;  3SJM A;  4A3I J;  5J1Y A;  4AC0 A;  5K7F A;  2Y30 A;  2LD5 A;  1IV6 A;  3C2B A;  2WB1 N;  4MIM A;  1B72 B;  3S14 J;  2DA5 A;  2QCO A;  1JJ8 C;  3HKZ N;  5EF6 A;  4CYC B;  3A01 A;  1UG2 A;  2CUE A;  1QVT A;  2EH3 A;  5F0F A;  1MNM C;  1H88 C;  1W0U A;  4BY7 J;  3H0G J;  1X2M A;  2EZK A;  1WGX A;  1JKP C;  4W1U A;  1HDP A;  1DU0 A;  3BTC A;  3JRA A;  4HNV A;  1PUF B;  3ZQF A;  4X6A J;  1BW6 A;  2E1O A;  3IH4 A;  2R93 J;  5EYR A;  3JRB A;  1APL C;  1GVD A;  1WH5 A;  1HF0 A;  2MGQ A;  5EGO A;  2DTZ A;  5C3E J;  2Y31 A;  5IP6 A;  4FCY A;  3K2A A;  3BTJ A;  4V2G A;  2MSY A;  3BG5 A;  4IHX A;  2X48 A;  3JRI A;  4A3L J;  3DEW A;  2WAQ N;  2XPW A;  1JGG A;  1ETW A;  2HI3 A;  1ETO A;  3HOY J;  1U9O A;  4IHW A;  4XK4 A;  4FE7 A;  3HOZ J;  5E3M A;  3M4O J;  2HXI A;  1HLV A;  3M3Y J;  1WCM J;  2VKV A;  4I76 A;  3Q0W A;  3SFI A;  1IDY A;  2W48 A;  4A69 C;  3MVP A;  2ECC A;  5IYC J;  2EQR A;  3LNQ A;  1B8I B;  5F1J A;  2LFB A;  1JT0 A;  2E2H J;  1ZR2 A;  2LLK A;  3IH2 A;  2M8G X;  5EG0 B;  1ZQ3 P;  3S1N J;  1JUM A;  1D5Y A;  2CRG A;  1U78 A;  1F43 A;  2X9D A;  3Q0U A;  4S0H B;  3LSJ A;  3WHB A;  2WV1 A;  3G1O A;  3LSG A;  5IP9 J;  3GTK J;  2R5Z B;  3BR3 A;  2XB0 X;  2DA4 A;  1K61 A;  2L7M P;  2HOS A;  1MBH A;  5DS9 A;  2LP0 A;  1LE8 B;  3JRF A;  1WPK A;  2VKE A;  4FE4 A;  2H8R A;  2JWT A;  1MBJ A;  3FK7 A;  1BA5 A;  3D1N I;  1X2N A;  5HOD A;  1WI3 A;  1OCP A;  2CJJ A;  1JUP A;  5GP9 A;  5M5X J;  3S1M J;  1HCR A;  3HOU J;  3A01 B;  1VFC A;  5GPA A;  2MG4 A;  2XRL A;  3OSF A;  1OJL A;  3FIS A;  4GFB A;  5FKL A;  1Y1W J;  1CQT A;  4A3G J;  3JRD A;  1O4X A;  1F36 A;  4QSH A;  4AUX A;  3BR0 A;  2HQ5 A;  2Y2Z A;  3W6V A;  3FK6 A;  5EGO B;  1ENH A;  2XPV A;  1DU6 A;  2NOG A;  3GTP J;  1TWF J;  4C3I J;  3S17 J;  1MBE A;  2DA1 A;  3CQZ J;  2NS8 A;  1JKQ C;  2NVX J;  4JYK A;  2P81 A;  3SDG A;  3GTO J;  1ZGW A;  5IOZ A;  2DMN A;  4QTR A;  3K7A J;  3PM1 A;  1MSE C;  3L1P A;  3BTL A;  4D5F A;  5E3N A;  2DN0 A;  4BKX A;  1K83 J;  2JA6 J;  1AKH A;  1IJW C;  3QPS A;  4DW6 A;  5M5Y J;  3TP0 A;  2JA7 J;  2LTP A;  5C4J J;  2EZH A;  3RZD J;  1JJ6 C;  3H3V K;  4IHV A;  1MBF A;  3S1Q J;  2M9H A;  1OCT C;  2LKX A;  2K9Q A;  2L9R A;  2R5Y A;  4A93 J;  2CQX A;  2ID6 A;  1H89 C;  3PO3 J;  1E3O C;  1POG A;  1MBK A;  3E7L A;  1IRZ A;  2JMW A;  1ZTR A;  1XS9 A;  1RR7 A;  1IGN A;  3S15 J;  2E19 A;  1SFO J;  2LK2 A;  2E2I J;  2ME0 A;  5F04 A;  2M34 A;  1ETK A;  1A6I A;  3A02 A;  4D5C A;  3G1L A;  4JX4 A;  2IEK A;  4V2F A;  3NAU A;  4M3G A;  5EEA A;  4RDU A;  2Y9Y A;  1AHD P;  4BXX J;  1UHS A;  4JP0 A;  1NTC A;  2PMZ N;  2JK3 A;  4Y7N J;  3CMY A;  4XID A;  2L7F P;  1VND A;  3OOU A;  1JT6 A;  3DCF A;  5FKO A;  4A3E J;  3RZO J;  1ETY A;  3FKI J;  2DJN A;  1ZR4 A;  1FTT A;  3A03 A;  4Y52 J;  3BG3 A;  1WH7 A;  1I3Q J;  4BBR J;  4C3H J;  2NVQ J;  2VPR A;  2O7O A;  1TC3 C;  4A3F J;  4A3K J;  2L7Z A;  2QF7 A;  3RQI A;  4C3J J;  1RKT A;  1GV2 A;  3FIW A;  1TWC J;  2VUM J;  2K9S A;  4QIW N;  4AYB N;  1IDZ A;  3G1M A;  4DYQ A;  4DZJ A;  4J19 A;  5JLX A;  1U8B A;  1BW5 A;  5C44 J;  2OF7 A;  3BR5 A;  5M5W J;  1NK2 P;  3PO2 J;  3BR2 A;  4RBO A;  3B6C A;  2JJ7 A;  3BT9 A;  4MO7 A;  2M0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...