2MSYA

Solution structure of hox homeodomain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
ANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Homeobox protein Hox-C9
publication title Structural insight into the interaction between the Hox and HMGB1 and understanding of the HMGB1-enhancing effect of Hox-DNA binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2msyA00
1NTCA 4DYRA 3BTLA 1Z77A 1G2HA 4EEFG 1K61A 1GT0C 1AU7A 1JKRC 3S2HJ 2R5ZA 1MH4A 2JA6J 3WHCA 1T56A 1B8IA 1VF9A 2IAIA 4C2MJ 1AKHB 1JKPC 4M3BA 1I50J 1JT6A 1PUFA 1JUPA 5J1UA 1ZQ3P 3B6AA 4V2FA 2JA7J 1HDDC 5IPAA 1NK3P 4M3GA 3JRAA 3JR9A 4ABZA 1GV2A 1JKOC 3S15J 4FE7A 2NVQJ 2MSYA 3ZQGA 2KDZA 4L5EA 2QF7A 2E19A 2COBA 4BBRJ 4CYCB 1ZTRA 4AC0A 2HOSA 5IYDJ 1H88C 4B3AA 4I6ZA 2WB1N 1E3OC 2E1OA 1A6IA 3HOXJ 3A02A 1ORKA 2EZIA 2R5YB 5E3NA 3UKGA 2DMTA 1BA5A 1WI3A 1XC5A 3LSPA 1S7EA 1JTYA 1B72A 1LE8A 1FTZA 1GVDA 3OOUA 3HOZJ 1YRNB 1JUMA 3TP3A 1XG1A 2EQRA 2L7MP 2NS8A 4UUSB 4XICA 3H0GJ 4LOCA 1IC8A 3JRFA 2M9HA 5M5WJ 1EF4A 1IUFA 2CRGA 5BNGA 2K9SA 1X2NA 2L7ZA 1RR7A 3LNQA 5C4XJ 4S0HB 2O9LA 3BG3A 3GTGJ 4J19A 1QRYA 1W0TA 1VFCA 4MIMA 3GBGA 5FKOA 2Y9ZA 2CUEA 4BKXA 2M8GX 2JMWA 2NVXJ 3S16J 2G0EA 2XPWA 2EH3A 3S1RJ 3FK7A 2NVYJ 4HNVA 4DYCA 2XSDC 3GTKJ 4JYKA 1DU0A 3ZQCA 1MBFA 2LLKA 3QQAA 3S17J 3CMYA 2B63J 3HOYJ 5IP6A 3M3YJ 2LKXA 2NS7A 2QCOA 2JWTA 3FKIJ 3QPSA 2VKVA 3GTOJ 1X2MA 2O8KA 2LP0A 2CJJA 3MN2A 2JJ7A 1U9NA 2GLOA 3HOVJ 2M2EA 4V2GA 2DMPA 2EZHA 3MKLA 4UUTA 2FX0A 1JUSA 4RBOA 1ITYA 1WCMJ 5EGOA 1RKTA 3HDDA 5FKLA 4A3MJ 2VUMJ 3PO3J 4DYQA 1OFCX 5EZHA 2JK3A 4IHXA 3ZOBA 5F27A 3M4OJ 1GDTA 2XB5A 2DA2A 3BG5A 1BJZA 2AO9A 3B6CA 1P7IA 1WGXA 2HXIA 1JTXA 1U78A 3Q0VA 3JREA 5M5XJ 1ETKA 5K7ZA 2K40A 3BQZA 2D5VA 3W6VA 1MBHA 5EEAA 2R93J 2EBIA 2E2JJ 3ZQIA 4GFBA 3HGGA 2VI6A 2Y9YA 3A01B 2H1KA 1I3QJ 3BT9A 5C44J 3GTJJ 3JRHA 3RZOJ 2Y0SN 2W48A 5E3MA 5EG0B 3RKQA 1FTTA 3BR2A 2VPRA 1XS9A 1MSEC 1FEXA 1JJ6C 5GPAA 2R7ZJ 2Y31A 3IH3A 2RAEA 3GTLJ 3GTPJ 5EDNA 1P7JA 1U9OA 2ID3A 4D5CA 2LTPA 1RETA 2CU7A 1BW5A 5DTDA 3PO2J 1T33A 1VNDA 3E7LA 4BY7J 3BR1A 4RDUA 3TEDA 4IHVA 1GUUA 2O7OA 3HB9A 2NOGA 4DW6A 3FIWA 4B4CA 4QIWN 3BR6A 1ZGWA 1HOMA 3RZDJ 2P81A 1VI0A 5EZGA 3SFIA 4C3IJ 2L0KA 1SANA 3S14J 2HOAA 2DN0A 2MW8A 1TWFJ 5FLMJ 2FD5A 1HCRA 1MSFC 4JX6A 3JRDA 1WPKA 5F08A 3LSGA 1IV6A 5E3LA 4IHYA 1SFOJ 2M34A 4QSHA 1QVUA 5F0CA 1OCPA 3BTIA 2ME0A 5J1RA 3BR3A 2X48A 1ZR2A 2DTZA 1DU6A 3BR0A 2CQXA 5F0FA 3HBLA 4D7MA 2R5ZB 3HOWJ 3S1NJ 1B8IB 1IRZA 3L1PA 1R9TJ 3RQIA 4NDLA 2DA3A 1D5YA 3JRCA 4A93J 1PUFB 2OF7A 3LOCA 1NK2P 2R92J 4I76A 3HGYA 3IV5A 1QVTA 1AKHA 5IOZA 3JRGA 2ECBA 5E3OA 1F43A 1OJLA 4MFEA 4AYBN 2PMZN 4XRSA 4A3FJ 2N8GA 1BW6A 2LK2A 4A69C 3JRIA 2I10A 1H89C 1Z0XA 4XRSG 2LFBA 3PM1A 2WV1A 2HDDA 3IH2A 2ME6A 3WHBA 2R0QC 2NVTJ 1X58A 2LVSA 3Q0WA 1TWGJ 5F04A 1IGNA 1UHSA 4MO7A 3S1MJ 5FKMA 3JRBA 5EF6A 4CYCA 3CCYA 1B72B 2Y30A 3Q0UA 3G1OA 1LE8B 4XIDA 3HKZN 4FCYA 1AHDP 2JA5J 3GTMJ 5JLXA 1Y1VJ 5GP9A 1JKQC 4A3GJ 4JX4A 2XGDA 9ANTA 2GM4A 4IHWA 2R5YA 3BG9A 2HXOA 4MLOA 5DS9A 5M3MJ 3G1LA 5C4JJ 1ETXA 4X6AJ 3TP0A 2X6OA 1HF0A 3NARA 3OSFA 1YRNA 3ZQLA 4UUSA 2LY9A 1MNMC 5FJ8J 2KT0A 2YUSA 1MBKA 1Q1VA 2XB0X 3A03A 2IEKA 3CDLA 2HI3A 2DMUA 4FE4A 1HDPA 5K7HA 2ID6A 2IBDA 3F0CA 4D5FA 1MBGA 1IG7A 3FISA 5M5YJ 3K7AJ 4BY1J 4M3DA 1ETQA 2TCTA 5IP9J 3S2DJ 4BXXJ 1RKWA 2ZB9A 4A3KJ 1TWCJ 1LFUP 2DA1A 1ETYA 5M3FJ 4FISA 4A3IJ 4A3DJ 3SJMA 1APLC 5F0HA 3S1QJ 4Y7NJ 3FK6A 3NAUA 4G12A 5IOYA 3O8GA 3IH4A 2Y2ZA 2X9DA 4W1UA 4JP0A 5JLWA 2WAQN 2E2IJ 2DMQA 5IP7J 2XGEA 3VPRA 4DZJA 1IJWC 2CQQA 5FKKA 3H3VK 3HOUJ 3C2BA 4XRMA 5IYBJ 1F36A 4B1RA 4A3JJ 2E2HJ 2XPVA 1MBEA 2XGCA 3SDGA 2JN6A 5EYRA 5EGOB 2YS9A 1U8BA 3BQYA 1Y1WJ 4M3EA 3CQZJ 3HM5A 1HLVA 1TC3C 1H8AC 2VKEA 3Q3SA 1JT0A 1LFBA 1FIPA 1TWAJ 2EZKA 1ETVA 2K9NA 4X1EA 1MH3A 3TW6A 1K83J 2LD5A 1O4XA 5C3EJ 3ZQFA 5K7FA 2DA4A 2YU9J 5FKNA 4AUXA 1JJ8C 3HEFA 2L9RA 3OSGA 1ENHA 4C3HJ 3D1NI 1I6HJ 5FLVA 2K9QA 2TRTA 1UG2A 1ZR4A 3I4NJ 3TW7A 3GTQJ 4QTRA 1W0UA 1WH7A 2DJNA 1TWHJ 2FQ4A 4A3CJ 3A01A 2OPTA 2HQ5A 3OIOA 4IEJA 1ZKGA 1A5JA 4A3BJ 2M0CA 4Y52J 2L7FP 1RPWA 2DA6A 2JA8J 2HYJA 4A3EJ 5EG0A 1WH5A 1UMQA 3QPLA 2DA7A 3DCFA 2EZLA 4DZPA 3BTJA 1CQTA 1BL0A 1RESA 5J1YA 4D7NA 1ETWA 2MG4A 1GV5A 2ELKA 2XRLA 1MBJA 4C3JJ 3DEWA 2DMNA 3LSJA 2DA5A 1QPIA 5GPCA 3MVPA 4BBSJ 3BTCA 2GBYA 3BR5A 5F1JA 1ETOA 5J3LA 1JGGA 4FTHA 4W97A 3LSRA 1POGA 3K2AA 1ZK8A 1OCTC 2MGQA 2FJ1A 2AHQA 2H8RA 5IYCJ 4XK4A 2CUFA 3O8HA 4M6VA 4A3LJ 3ZQHA 2HOTA 4MFDA 2ECCA 3G1MA 1IDYA 1IDZA 2XPUA 1FIAA 3I4MJ 5HODA 2LR8A 4M3FA 1FJLA 4JX5A
chains in the Genus database with same CATH superfamily
2EV0A 3OIQA 3TOAA 1LB2A 3BTLA 5D5UB 2ZMEA 5IY5H 1K61A 3CF5F 1V55H 1G4DA 2IJLA 1TP4A 3K4CA 3MCZA 2O0YA 1XMKA 1VF9A 1AKHB 1DP3A 3DTKA 3QU6A 1ZRDA 4M3BA 4XLAA 4PGHA 1PUFA 3S2WA 4ZYGA 1EH6A 1ZQ3P 3B6AA 3KZYA 3ZQ7A 1T39A 2UWMA 5ICFA 5J8FA 2DAOA 1V4RA 1P92A 5IPAA 2IGMA 4M3GA 3IRRA 4HDUA 3H1CA 3DFGA 1MMGA 3WE3A 3FMSA 3V7RA 5HLIA 2EWNA 2LKSA 1JKOC 1VQ5I 3S15J 3COAC 2NXNB 2MSYA 2UXXA 5CLSA 4M72A 2FU4A 3F8NA 2UXNA 4BH9A 3OYKA 1KQ0A 4F7ZA 1BR2A 4HX4A 4EMSA 2FNPA 5LGUA 5IYDJ 4AC0A 2HOSA 2EINH 4CCKA 3MWMA 3DEEA 1PDNC 3SZTA 2WB1N 2E1OA 2GZWA 4ENJA 1A6IA 1K78B 3M8JA 3HSRA 3NEUA 2D2WA 3IKVA 3T5XA 3T8TA 3OOPA 1XGMA 3UKGA 3CD6I 1UFMA 2LRDA 3G71I 3LSPA 3MZHA 1S7EA 4NC8A 3OMYA 1LE8A 2VASA 2QKMB 1GVDA 1WJEA 3BLYA 2CFXA 4FASD 3L2QA 3HOZJ 3WTZA 4HRIA 1JUMA 2F4IA 2EQRA 2OZUA 2L7MP 3ABUA 3RIRA 3S8PA 1PVEA 3OIPA 2F2EA 2FSWA 2M9HA 2UV1A 2XAJA 3ABKH 4LLLA 1EF4A 1IUFA 1OQYA 2B0LA 2P5VA 3BDDA 3ZRGA 3E1SA 4EJUA 1BOAA 1RR7A 2IPQX 2V4JC 3ELKA 1KGSA 3SEQA 5C4XJ 4G6QA 3BG3A 3OS1A 2M5WA 3CLOA 2COMA 4LK1F 4MIMA 1NH3A 1Y6IA 2Y9ZA 1JE8A 3PFYA 2VKHA 2NVXJ 2CQNA 4D9JA 3QPHA 2ZJPF 2G0EA 4LB5A 4F3QA 2VQCA 4ENNA 4HLXA 5IT9K 4GYIA 2FMYA 4LITA 2XV4S 1XCBA 3KYDB 1VQOI 5IP6A 2AXLA 5EEHA 1Z91A 4BQQA 4Q48A 2KHMA 1VQNI 2VE8A 2LP0A 3HHHA 2CJJA 3IWZA 3O3KA 1FYMA 2JJ7A 2XAGA 1QNTA 3DKYA 2CW0F 1X3ZB 4E7IA 3HOVJ 1WJFA 3A1YA 3RI4A 2EZHA 2DJIA 1XPXA 3HXLA 3DU5A 2VONA 2FF4A 1K4TA 2E1MB 5FRNA 5FKLA 3W3CA 3CP8A 4DYQA 2W7NA 2ZFUA 3DTEA 5HS7A 1U2WA 1P9QC 1GDTA 2XB5A 1ZELA 1HA8A 2OZ6A 4DIQA 1BJZA 1YYVA 1B4AA 2HVQA 4KIGA 1ERDA 1JTXA 4E7JA 1B59A 1WHUA 3HSFA 4NNJA 5M5XJ 4O6JA 1F5TA 3DPUA 5K7ZA 3W6VA 2DT7B 3S32A 1V5FA 5EEAA 1DQUA 2GA1A 2LSOA 4L18B 5L3CA 4A0XA 2STTA 3HC7A 4EJOA 2K3FA 1R7JA 3LA3A 2FOWA 2H1KA 4PJ0C 3GTJJ 2PJRA 5CVIA 2BZTA 2Y0SN 2V1DA 3RKQA 1FTTA 2VPRA 3E97A 1LEAA 2Y31A 2VQLA 4OINF 4BDYA 3F8MA 3GTLJ 3GTPJ 3ECHA 3R0JA 4YG2F 2R7QA 1U9OA 2ZO4A 3L2UA 1OR7A 3EYIA 2VC0A 1EA3A 2XROA 1VNDA 4BY7J 3DLLF 2GIVA 1GUUA 2O7OA 3DWLE 1A6QA 2BVMA 2DK8A 1FOYA 3T8RA 4RAYA 4B4CA 2NYXA 4QIWN 3IP4B 1ZGWA 1Y0NA 2LBFB 1MNEA 3FM5A 2JSCA 4YELA 1VI0A 2FEZA 2HU9A 3CJNA 5EZGA 3SFIA 4A5NA 2MLGA 2KZGA 3S14J 2HOAA 1OCZH 3W6JB 1HCRA 3QODA 1WPKA 5F08A 1B9MA 3GF2A 5CVVA 4BU2A 5JHUA 1X1CA 3OYIA 1Y56A 4XORA 1QZZA 3ULQB 1UB9A 3ZCOA 5B3SH 4X0GA 2W00A 2M34A 4L0ZB 2GOMA 2RREA 3K1NA 1JGSA 4UXNA 5F0CA 1OCPA 2E71A 3KZZA 2QSHX 2ME0A 2LREA 3PQJA 4ZYAA 2DPUA 1ZR2A 1LDDA 1DU6A 3BR0A 3FBNB 4KJZA 1XD7A 4XOPA 1VQLI 3EUHC 4Z2YA 3GYHX 4BE0A 2FA5A 2WBMA 1R71A 1MNDA 3S1NJ 3RQIA 2P5KA 3CUQB 3F9KA 4XLEA 2DA3A 3D5LA 3PIPF 3HOTA 3LOCA 3MKZA 1VQ4I 3CC2I 2NS0A 2LG4A 2A61A 2XAHA 3IV5A 2JTVA 4DGWB 3M9AA 3MD2A 3JRGA 1FOWA 1SD6A 1OJLA 5E3OA 4E7SA 4AYBN 2BY2A 2PMZN 4XRSA 2MH9A 3QRFF 2Y0SA 2LK2A 4ZYEA 4CHUA 3JTHA 4Q4ZF 1GXQA 3OL4A 4XRSG 3E0JB 3KP4A 1FOKA 4HV6A 1YFHA 3WHBA 2HPIA 2ZJQF 1IGNA 3OY9A 4MO7A 4XLCA 4ITVA 2R4GA 2DQLA 4DBRA 3J7AO 5FKMA 3CTAA 3RYPA 4I02A 4OMZA 4EQQA 4CYCA 3CCYA 2NNYA 3Q0UA 4N4OB 4H4KC 1WRJA 1B72B 1N77A 3LSMA 3LL7A 3HKZN 3BZKA 1ON2A 4JQFA 1AHDP 2V9VA 3BG6A 5JLXA 3VYUB 4KT6A 3X2QH 4PJMA 4IHWA 1L0OC 4MLOA 5C4JJ 1VQMI 5M3MJ 3G1LA 2Q8KA 3TP0A 1MW7A 1HF0A 3GCMA 1OYYA 3OSFA 1Y39A 1W7PD 4BJ6C 2PQ8A 1LQ1A 2KRHA 3RKXA 1E3HA 3OYCA 3SZGA 1MNMC 5FJ8J 4XLFA 1VQPI 2M7BA 3J80K 1MBKA 3BPVA 2AQEA 4AVZA 2IEKA 5JFRA 2HI3A 3CMEI 4FE4A 4IZZA 2ID6A 3F0CA 4EGZA 2VPLA 3L2WA 1IRFA 1MBGA 3FISA 3S2DJ 2B9SA 2KZVA 1CF7A 2DI3A 5CVJA 1U5TA 1FWZA 1J75A 1HW2A 3MKWB 1W7PA 1MJBA 5M3FJ 1ETYA 3I9V2 3SJMA 2HZTA 2XSJC 2BW3A 1TT5B 2KISA 2Z9OA 3O8GA 3IH4A 2Y2ZA 2X9DA 4W1UA 4IOAF 1GXPA 4DQ2A 1A36A 1ZREA 3WTVC 4M9SA 4CCLA 1D1AA 4CSWA 1IJWC 3GZ5A 2L9VA 1FMVA 2K7LA 3C2BA 3GFMA 4AYBA 2DLLA 2VOOA 4N9IA 3SEZA 1OMIA 4Y13A 2J5OA 4YEJA 1XDUA 1BC7C 3AAFA 5E20A 3SDGA 5EYRA 5EGOB 1ODDA 2YS9A 3BOQA 2QWWA 4ETSA 1BIBA 4M3EA 1MJAA 3CQZJ 3KETA 2NRAC 1D1BA 3DKWA 4PK4A 2VKEA 1RRJA 1KZHA 2CFOA 4KN4X 3J81Z 2AXTC 2LNBA 2L54A 3Q3SA 2JVGA 2G7UA 1FIPA 2EZKA 1ONVA 4XQFA 4X1EA 4B09A 4RA2A 2DODA 3KLNA 2NOJB 2WA0A 2DFIA 4AU7A 3F8CA 3VOEA 3PIOF 1ZYRF 4GRIA 5DCMB 3ZQQA 5C3EJ 1ZLKA 3KEOA 3ZQFA 1HSJA 2YU9J 5FKNA 2PFBA 2M3AA 5A2QZ 4UUVA 1X19A 5HS9A 2EFWA 4C3HJ 3D1NI 2HYFA 3DQVC 2YX4A 2OCCH 4I01A 2TRTA 3K4LA 1FY7A 1UG2A 2CV0A 3GTQJ 4F52A 1DPRA 2FQ4A 3V7SA 1M1EB 2OJED 1UAAA 3A01A 3HHGA 5JVGF 2OPTA 2P7CB 2HQ5A 2LF7A 2ZFWA 3OIOA 3HG9A 1IO2A 3L2VA 5IT3A 2JVHA 1F1ZA 3FF5A 2KIUA 4KN7X 2L7FP 4OMYA 1RPWA 3K70C 1UMQA 3QPLA 1J2XA 1YIJI 3DCFA 1XMXA 2Z16A 2H6CA 3BTJA 1X4OA 3F6OA 2MBFA 1P4XA 3MEXA 4RLFA 3WU1B 2HVRA 1RESA 4HPQA 5E1XA 2JZYA 4D7NA 2ELKA 2IRFG 2A3SA 2KLOA 3ABLH 3ZMVA 3DP7A 4WF2A 4PFOA 2DT5A 3PNTA 1J7KA 3LWFA 5JR3A 5J3LA 3OS0A 4R79A 4FTHA 1OISA 3L00A 3RKYA 1HKQA 1DDNA 2IA0A 1OCTC 2MGQA 3I58A 4HW0A 2IGKA 5BS6A 1DUXC 4XK4A 3KX2A 1MMDA 4M6VA 4F93B 1X1AA 4G6DA 2V26A 4MFDA 2K02A 1MDMA 2XPUA 3PSIA 4UB6C 1FT9A 5HS8A 1FJLA 3P5JA 3NWSA 3H5NA 2MYSA 1G2HA 4LFUA 4EEFG 3TBIA 1GT0C 3VYRB 1TL8A 1MH4A 3CCVI 3C3WA 2L4MA 1G3TA 1B8IA 3TMOA 1XSVA 1D1CA 4IX7A 2KJBA 4AIHA 1QA6A 1JKPC 1TNSA 1I6XA 5J1UA 1DGWY 2DW4A 4EJTA 4HOBA 5HVQC 4V2FA 2JA7J 2DQRA 4RAZA 4YFKF 4FT8A 4EJWA 3VSLA 2EB7A 5DUKA 1GVJA 1WWXA 3JRAA 1NG7A 2O8XA 1FLIA 4PJJA 3I59B 2RQQA 3EDPA 3H92A 2BY1A 4AD9A 5GAGJ 4L5EA 3U9GA 2ICWG 2E19A 2COBA 3H35A 2PMHA 3DV8A 2HOEA 4NC7A 2VB6A 4ZJZA 5FFZA 1H88C 4N4NB 2R7OA 3HRMA 2F5CA 3WG7H 2DYRH 1E3OC 5ILVA 3D5SC 4RGUA 3HOXJ 2W84A 2E35A 2EZIA 2KRCA 2M7AA 1X3UA 2BGCA 3ZN0A 5E3NA 3CJTB 2DMTA 1BA5A 1XC5A 4L9NA 1RUOA 2P7VB 4XOTA 2BBYA 3S3MA 2VQHA 2ZXWH 3OOUA 1YRNB 4UNOA 3TP3A 1XG1A 1TNTA 5ILUA 4UUSB 1ZHFA 1UHWA 2HQRA 4XICA 3H0GJ 4I09A 1P4AA 5FLXZ 2KQRA 2VJJA 5M5WJ 2CRGA 4TV7A 1S7AA 5L3BA 3LQRA 1X2NA 4PFPA 1G3WA 1HSTA 3Q9SA 4S0HB 2O9LA 1IN5A 4O5VA 4J19A 4RGSA 1G8XA 5DYMA 2BHYA 2CUEA 4BKXA 2M8GX 4KT5C 2Y48A 4AIKA 3A0BC 3S16J 2EV5A 4XN3A 3CCUI 4HNVA 4JYKA 2XASA 3ZQCA 2ESNA 2LLKA 3IC7A 3SQNA 3M8EA 2R7FA 3CMYA 2B63J 2A5WA 2RGVA 2FBIA 3NWTA 2JPBA 2C6YA 3HOYJ 3M3YJ 1FYKA 2A07F 3DU6A 1TZLA 2VKVA 3OYBA 4EM2A 1X2MA 3PQKA 4ASNA 1S6LA 1T6SA 3MN2A 2P0WA 3TDZC 2Y75A 5D4SA 4V2GA 4DOZA 4CUGA 5GAEJ 1QHHD 3WTWC 5J4VA 2M4KA 4P5OA 4UUTA 1IUYA 2EIJH 2VBXA 2L9SA 2HQNA 2QQBA 1LJ9A 2ZBKA 1KA8A 3F8BA 4LMYA 1QU3A 3FM3A 2KL4A 1T38A 1EH8A 1ZGAA 4J01A 3OYFA 4IHXA 1A35A 4NQWB 2ACJA 3ZOBA 5F27A 4L0YB 4B48A 2WWYA 2Z3YA 4I99C 2AO9A 5KHDA 2MH2A 2H27A 2H94A 4G94A 3MZYA 1WGXA 1R1UA 2DCEA 2Y69H 1UCRA 2R93J 2EBIA 1QZYA 3ZQIA 1YI2I 3LA2A 3E6DA 3HGGA 2R7VA 4U87A 4XNFA 4B44A 2E7XA 2PI0A 1FPQA 1YQAA 3TO9A 1YLFA 3CO7C 3SDBA 3WTYC 2W1OA 3QP5A 1FMWA 4U0YA 1VTNC 1GHCA 2R7DA 1LVKA 1P2FA 2A05A 4BACA 3CP2A 3L9FA 2DDBA 4DJAA 5BOXA 4FQGA 3P7NA 3JAMZ 1J59A 5GPAA 1JJ6C 3K1PA 2R7ZJ 2R7RA 2EA2A 3R0AA 5CVUA 1D5VA 2O3FA 4MQVA 5HDNA 1U8RA 3IRQA 2VJ5A 4G6TB 2ID3A 3Q9VA 3GFLA 1RETA 4D5CA 2FQ3A 1D8JA 3PO2J 2XUBA 1CGPA 3E7LA 3LSIA 2RNJA 4ZTFA 3BR1A 4IHVA 1QPMA 3HB9A 2M4GA 1WJAA 3N05A 3VEPA 3GMEA 2DFHA 1SAUA 2EV6A 1XDSA 3EPZA 1HOMA 2P81A 4LG0B 3QWLA 4Q47A 3HJEA 2BYVE 4HF2A 2RV8A 2DN0A 5FLMJ 3ASOH 3ZN1A 1PP7U 1ZRFA 4JX6A 3JRDA 3T0YA 4II3A 3OL3A 3PFIA 2LDUA 5FLXK 3LSGA 4D0PA 2XGXA 3I0TA 2QENA 2EA4A 3V7CA 2A5YB 1BI0A 1MIJA 3CCJI 3F8FA 1FBQA 4M6XA 1H0MA 3RTRA 3V8JA 1S7OA 4LG3A 3BTIA 2XRNA 5J1RA 4LK0F 1V54H 2X48A 4XSXF 1I1GA 4EJVA 2ZMEB 4BEHA 2D1VA 4D7MA 1JHFA 4HF0A 3P9KA 2ISZA 4HAMA 1WJBA 1UJ8A 1R9TJ 3OYAA 2OTLI 3BP8A 3K9TA 2IA1A 4UVAA 2GIZA 1PUFB 2A69F 2Z33A 5FRMA 3AG1H 3BJ6A 3EUAA 3FWEA 4I76A 2DU9A 1MGTA 3RKWA 1G6NA 4K2EA 2WV0A 4KNYA 2HPMA 1FBUA 3RPUD 4CYDA 3KP7A 1SD5A 2M1BA 3E3VA 4A3FJ 4HEA2 3KP3A 1STZA 3K10A 1BW6A 5K1YA 3JRIA 2I10A 4ZYDA 1L3LA 1KU2A 2HDWA 1WKMA 3PUFA 2HDDA 3BCAA 3IH2A 2R0QC 4HSTA 3Q0WA 3EUHA 2F5VA 1BI3A 2LH9A 3O6BB 2HYGD 3RPUA 4AIJA 2PBIA 3S1MJ 3P9IA 1ZAOA 4L5IA 1D0YA 2QQ8A 1BN5A 3FKJA 3HZJA 4E7KA 5EF6A 1N75A 1S5LC 2Y30A 2Y0MA 1LE8B 4XIDA 2X6XA 3SXYA 2IA2A 2LBFA 2YR2A 5K5OA 3GTMJ 3QP6A 5F6FA 3S3OA 5FFXA 3CC4I 4JX4A 9ANTA 2R5YA 2EFPA 1FBSA 1U6GA 4X6AJ 2FBKA 1SFEA 2X6OA 2XKPA 2ZSHB 2F4MB 1X1DA 3Q5FA 2BE5F 1B1BA 3ZQLA 3FHZA 5KAFC 2LY9A 2KT0A 4HNUA 5HNFA 4YIRX 3D0SA 4H0EA 1S72I 1LEBA 4P1WA 2B7EA 5B1AH 2XB0X 4Y33A 3JAMK 3F72A 4E6KG 1KU7A 5K7HA 2CW8A 3ECOA 4D5FA 3WE2A 3OYDA 3J80Z 3K4KA 4AWXB 1IG7A 4BY1J 4M3DA 1D3YA 5IP9J 1HKSA 5HLHA 2H1LA 1W1WE 2Z2SB 3GVAA 2RNGA 1QQIA 2CUJA 2F4OB 2Z99A 4EVIA 2VXZA 4NC6A 3CCEI 2EIKH 1MMAA 2E1MC 1TWCJ 1LFUP 2DFFA 2PLYA 2DA1A 3K0LA 4A3IJ 4XKWA 4A3DJ 4I98B 4XKCA 2DOAA 1SD7A 2WADA 3RCOA 3S1QJ 4Y7NJ 4R8HA 4KITB 4AVPA 2UZKA 4GCVA 4F55A 3ABTA 3I3LA 4OWRB 5GTHC 2DMQA 5IP7J 2XGEA 4P55A 3VPRA 3CC7I 3GZ6A 3HOUJ 1YITI 3V42A 2LMDA 2EILH 5B5EC 2V1XA 1X3WB 4EV0A 1F36A 1IZ1A 5LEJA 3QU3A 2IVMA 1FX7A 2KIMA 1O3QA 4BUPA 4A3JJ 2XPVA 2XGCA 1RI7A 5J6XA 2HZDA 3FXRA 1U8BA 1PP8F 1Y1WJ 3M8FA 2ZKZA 1HQCA 2QBYA 2R7SA 1H8AC 3DPTA 3CJRB 3BWGA 4EM1A 3M7GA 1JT0A 3CF2A 2L02A 2GA2A 1ETVA 4OU0A 2K9NA 1JXSA 4IXAA 5BPDA 4HBLA 1MH3A 1RR8C 5TGTA 2LD5A 4JBAA 3H36A 5D5VB 5K7FA 2DA4A 5H20A 1O3SA 1WVRA 4AUXA 2M0MA 4QLCU 1JJ8C 3BROA 1I39A 3OSGA 4MNUA 2OD5A 1SC7A 1I6HJ 3KIOA 4QWQA 1ZR4A 3TW7A 1QGPA 4M9XA 4QTRA 1WH7A 2FXAA 3KYLA 1TWHJ 4A3CJ 4HX8A 4HQMA 2P8TA 4RAFA 2LKPA 2FE3A 2M0CA 2LYCA 1S9HA 1A31A 3CCMI 4JK1X 3MQ0A 2JA8J 2HYJA 4A3EJ 5EG0A 2IS4A 3GX4X 3AKZA 5HDKA 1WH5A 2CH0A 2VBYA 1WFXA 1ZG1A 3WTTC 4RGXA 1CQTA 4V19K 2PMUA 3UR3C 2MG4A 1U0JA 2K85A 3LSHA 1R49A 2CQ7A 1MBJA 4C3JJ 3W2AA 4HNTA 2ZC2A 2DA5A 1FP2A 1H9GA 1Z05A 3VYTB 4RGRA 3K4NA 5B1BH 5LRSA 3OYEA 4WK8F 2KDOA 3LMMA 3CUQC 1G59A 3E6BA 4YIFA 3KYCB 2D1HA 3ZP5A 2FUG2 4BHPA 1POGA 4UVBA 5HLGA 3TKYA 2FJ1A 2AHQA 4XRFA 3VWBA 5EJCA 3FDYA 2XIGA 1ACIA 3HUGA 3LFUA 1VZ0A 4RB2C 3G1MA 4PSXA 1YS6A 2VJIA 5D8LB 5FO5A 3ZMUA 2IGOA 1FIAA 5HODA 2LR8A 4JX5A 1NTCA 4KUMA 4E4HA 4YFXF 1FP1D 4ON0A 4P96A 2LY1A 4CGZA 1AU7A 1T98A 1Z1DA 3MFKA 3FMQA 2KIFA 2R5ZA 1VQ9I 3S2HJ 2RKHA 4HG2A 3WHCA 4BGDA 4PJNA 3V4GA 1T56A 1KYZA 2NAZA 3HRSA 2DYSH 2IAIA 4C2MJ 2CV2A 2IP2A 1TQIA 1I50J 1JT6A 1SVOA 3HYIA 1JUPA 2GXBA 1XB4A 2A6TA 2FOKA 3F6VA 3FXOA 4BL0B 3VYSB 1Y0UA 1J5YA 1DP7P 3UNGC 1NK3P 4IL6C 5CPRB 3JR9A 3N97A 2P5LC 1GV2A 1MJ9A 3PL8A 2X4HA 4FE7A 2NVQJ 3EYYA 3ZQGA 4GYGA 2QF7A 1JHHA 2GOXB 2KFDA 4PGGA 3REOA 5DUIA 1O7LA 4CYCB 1ZTRA 1E0EA 1C0WA 4B3AA 1AOYA 3AL0B 5E1ZB 2QSGX 4N9HA 2RDPA 1ORKA 3BJAA 2W57A 4G7HF 3HRUA 4PZJA 2ZXHA 1JTYA 2GXGA 2K5CA 1U3EM 4C30A 5LRRA 5DD4A 3DEUA 3WU2C 4CA0A 1ZG5A 4LOCA 1IC8A 3JRFA 1W36D 2O61A 4IRHA 2MA3A 3ZMDA 4CCJA 1Y8QB 5ICGA 2FMLA 1YOVB 3SFZA 5K5QA 2ZCWA 2P4WA 3LNQA 3MKYB 1CF7B 3GTGJ 1Z7UA 1W0TA 1WJ5A 1VFCA 1U5TB 3OYHA 1Z3XA 4XR6A 3GBGA 1W7PB 3EQLF 5FKOA 2ZJRF 2R7XA 3BZ6A 3ZMSA 1LPQA 1T0FC 2CYYA 5LLQA 1MMNA 2W82A 1TLHB 1E2XA 2CUZA 3KFWX 3FK7A 2OBPA 2VC1A 2BW3B 5L3DA 1DU0A 1LKXA 3C2HA 2HTSA 1Z9CA 1MBFA 3QQAA 3S17J 4ENMA 3WTSC 3H5AA 1G3YA 2TDXA 1FOXA 1USSA 2NS7A 2QCOA 3FKIJ 3GTOJ 1PYVA 3GLXA 2O8KA 4N0BA 2DK5A 4RB0A 1MMSA 1GLNA 2QVOA 4E7HA 2EIMH 1F9NA 5FD6A 1U9NA 4KIBA 3R60A 3WGGA 3DXJF 2MABA 1SEUA 2GLOA 1Z21A 2PX9A 3RQ4A 5ICEA 1K7AA 5CKTA 2DMPA 1HBXG 3I5UA 2IXSA 2FX0A 2H09A 3C7JA 2KPMA 3PJRA 1ITYA 1WCMJ 3JCUC 4MTDA 3LQQA 4A3MJ 2VUMJ 4CZZA 1OFCX 4L9TA 5EZHA 2JK3A 1XCVA 2VJ4A 4M74A 5ED4A 4RM2A 3M4OJ 1SD4A 2DA2A 2IS2A 4GO1A 1ZLJA 4II2A 4ZYHA 4MQ9F 1VQKI 2XAQA 2A68F 3B6CA 2X85A 1RUNA 2LC2A 2HXIA 2JUCA 1U78A 1BOBA 2R7WA 2JPCA 4UHTA 3BQZA 4PJLA 2XF6A 1ON1A 2BY3A 2CMPA 2VI6A 3WGIA 5E17F 3SYTA 3A01B 4XM3A 4NUBA 2GWRA 1I3QJ 2W4SA 5C44J 2G7HA 1K6YA 3RZOJ 2CSOA 3IUOA 2Q2EA 1SVMA 1KONA 3GO5A 3BR2A 2QSFX 1XS9A 1R58A 1SFKA 1MSEC 3IH3A 2RAEA 5EDNA 4ANJA 1HW5A 1P7JA 1KU3A 5LD2C 5H6QA 2LTPA 4YIIA 2JSPA 4XLNF 5B66C 5HDGA 1WSUA 2JRMA 3I54A 4XLHA 5K5RA 4M73A 1T33A 4UVCA 3TEDA 4UV9A 4HZFA 2NOGA 3DKXA 3ZMTA 2AS5F 5AONA 1W5TA 2DDAA 3BZCA 5DD8A 2V79A 3BR6A 4IPAA 1XMAA 3A4CA 3W6KB 3L09A 4PDKA 3IAS2 2L0KA 4KA4A 3W2WA 2OUMA 5DDGA 2K4JA 2V1NA 3U1KA 1XGSA 3B73A 4IJAA 3K2ZA 1P4WA 1EKEA 2E1NA 5E3LA 3C18A 4O3MA 3BY6A 4IHYA 4P9FA 1MDMB 4QSHA 3M1CA 2ETHA 1LDJA 1QVUA 2EFQA 3G73A 3QOEA 2Z5UA 3ESWB 3BR3A 2QM3A 4ZZDA 3K69A 2CQXA 2HTJA 1YG2A 5F0FA 3F22A 3HBLA 4PSWA 3OV8A 2STWA 2F6CA 1B8IB 1T08B 1WZ2A 1IRZA 2I8DA 3AG2H 1IAWA 4A0ZA 3S3NA 1XGNA 2K9LA 1IXSB 2OF7A 4U0WA 1NK2P 2R92J 4M71A 3GWZA 2KIQA 5BPIA 2M30A 2GXAA 5LGNA 1I5ZA 3LA7A 2LY2A 3TOBA 1QVTA 1XSXA 1AKHA 5IOZA 1YE9A 1ZG3A 1OCCH 2X51A 1J9IA 2K86A 3OYLA 2HFHA 3SZPA 1V5EA 2HWVA 2N8GA 3WU0A 1H89C 1LNWA 5E8IA 1Z0XA 3KP2A 1H9TA 2KKOA 4Y3OA 2LFBA 2WV1A 2KJCA 4NB5A 1OYIA 1N78A 2QQAA 2YX7A 3I71A 3G2BA 3K4BA 5F04A 1BR1A 3BJOA 3CMMA 2M8EA 5L3EA 5CJ9A 2E34A 2VE9A 2QEXI 5ERIA 4D1QA 4J00A 3I56I 3JRBA 1LUJB 4ZTJA 1X4PA 4F91B 3G1OA 4RB3C 3HSEA 4CH7A 1K78A 1Y1VJ 2W25A 3FZVA 1O3RA 1JKQC 3OYNA 4U88A 1FSEA 4ZDOA 3NARA 5LHIA 4BAYA 2VIXA 3H9QA 1T95A 3E5XA 1R5ID 4JOMA 1BBYA 1RNLA 2XAUA 2DFEA 2GAUA 2E5ZA 1BI2A 1Q1VA 3A03A 3B02A 1B9NA 3CDLA 4B47A 3A0HC 5JI6A 1HDPA 1UG0A 3C1DA 2IBDA 1IN8A 5DEQA 2VODA 2LOOA 4I0BA 3WTXC 3K7AJ 4BXXJ 1ETQA 5TISC 2DTRA 1RKWA 3EUKL 3OYGA 1BJAA 3SHFA 4L5JA 3IL2A 2VBZA 3ZPLA 1RIOH 3HL2A 4A3KJ 4LD5A 2IGNA 2FNAA 4FISA 2VOPA 4A6DA 5CVRA 5AIQA 3WODF 3CCLI 4IHTA 3BPXA 5F0HA 3OS2A 1D8KA 2VQGA 5CQEA 4G12A 5JHFA 2EK5A 2VN2A 1YO5C 4KMUX 2ADUA 5H6RA 2X6WA 2P6TA 4NBQA 1F43A 3H3VK 2CQQA 2VL8A 4MHGA 3K6GA 4MEXF 4IKFA 3RDIA 3P9CA 3J7AY 3KEQA 1YW7A 2ZJ2A 2CQKA 4FHTA 1QO0D 1O7FA 4L9VA 2HVSA 2E2HJ 6PAXA 2L9NA 4HA8A 2IS6A 4ENKA 1HLVA 1TTYA 5D8KB 2BHZA 3CCSI 1TWAJ 3U2RA 4RS8A 3WTUC 3MMYB 4BXUA 3TW6A 1X1BA 1K83J 5DCFA 4CICA 3ONQA 3F3XA 5E8GA 4E7LA 2V9KA 2OAZA 5DM6F 3HEFA 2L9RA 3HIFA 3TO7A 1ENHA 4GGGA 3JSPA 3ZR8X 1W5CC 4XKBA 3OYJA 3I4NJ 2JA2A 1X1PA 4EGYA 3HTSB 2WY8Q 5KK1A 3E5QA 1E17A 2XHKA 4LLNA 4IEJA 5J47A 1N25A 1ZKGA 3LAJA 1SFUA 1A5JA 1S29A 2ZXIA 2DA6A 3CO6C 5HLTA 1R6RA 1YHQI 5JVTA 2OCEA 2E36A 5KCMA 2EZLA 4DZPA 1R23A 3QPTA 4EM0B 1S3JA 2HNHA 1SMYF 1ULYA 2X6YA 4XLPF 4LIUA 2QLZA 2CW7A 1NHAA 1GV5A 4XBFA 2XRLA 4WXCA 2ZMEC 1ZARA 4CCOA 3CZ6A 3J7YJ 2HGCA 3KE2A 3CUOA 3L2RA 4BBSJ 3BTCA 2GBYA 3BR5A 1YW9A 5H2FC 4U7BA 2YPRA 4DBQA 1ETOA 4KMFA 1LVAA 4LJZF 2FRHA 4YFNF 3HRTA 4BQAA 1BIAA 1ZK8A 1USTA 2YU3A 3NRVA 5BQTA 2WTEA 2MLKA 1EJ9A 4WX9A 3FXMA 5D4RA 2PJPA 5IYCJ 4B43A 4B3XA 2CUFA 3O8HA 5LHGA 2JUGA 2VXDA 3ZQHA 3MAJA 5F64A 1BR4A 5L3GA 4KDPA 1ZGJA 1TQMA 5AIPA 1IDZA 2W85A 3IWFA 4QPQA 4BEHB 1D0XA 2Q1ZB 2CGPA 2XF7A 2WB1A 2A6HF 3GFJA 4R1HA 5GTIC 3QOPA 1VQ7I 3DPLC 4M3FA 2QZ8A 2ZXJA 1TW2A 4ZDLA 4CO8A 2EJRA 3RYRA 4DYRA 1TQPA 2OA4A 1Z77A 2V1UA 4CCNA 3C2GA 1JKRC 4XSZF 2ELJA 1W4MA 2JA6J 2OQRA 3FXKA 5D5XB 4G7OF 3KEYA 2X1CA 2UUZA 4CDGA 3CUQA 4ESJA 3W2VA 1MD0A 2BV6A 3TQNA 4M6YA 3MZ8A 5TJJA 3RJPA 4E70A 1DPUA 2FBHA 1MKMA 2OU2A 3DBRB 1LFPA 3E6CC 1HDDC 3H3ZA 1UELB 3TL4X 5LGTA 3PUBA 4PCQA 4ABZA 1OCOH 2QA4I 4I0AA 4WXDA 3FBIB 1XN7A 1TW3A 3GUDA 2KDZA 4BBRJ 3R6SA 1T2KA 2PN6A 2F48A 3GEZA 2R7UA 3OYMA 4XL9A 2RN7A 4I6ZA 2Z1DA 2WC2A 4FX0A 4GXOA 1R5GA 4OIRF 1AWCA 3E6MA 1IN4A 3A02A 2R5YB 1WI3A 2W24A 1B72A 5LFAA 1PJRA 3VODA 3H5RA 1FTZA 3D5RC 2H6BA 3GXOA 1YJWI 5FD5A 2NS8A 4LB6B 4KFCA 1T8IA 1I3AA 2QGUA 2DBBA 1SMTA 1D0ZA 1IXRC 5BNGA 4PUSA 3FXQA 3H9JA 2PJRB 2K9SA 5D6FA 4P9UA 1YX5A 2L7ZA 4IF4A 4BNCA 3ASNH 3ERMA 2M45A 1B6AA 2IS1A 1QRYA 2VT3A 1R4NB 3H3UA 3F23A 2JMWA 1WQ2A 3JTGA 1MZBA 2XPWA 1RC9A 2EH3A 3VDXA 1J0RA 3M07A 5BMZA 1LDKB 3S1RJ 2NVYJ 3GTKJ 4DYCA 2MFZA 2XSDC 2K4BA 4BQOA 1HC8A 4ZDPA 2BXZA 2E5NA 3OR1C 4BXFA 3VSKA 2K9MA 2VKDA 2LKXA 2JWTA 3K70D 3FXJA 3ML6A 3GW2A 3R61A 3H0DA 3QPSA 1K79A 2HDCA 2O5RA 1FSHA 2G9WA 2ZNZA 4RM3A 2QUFA 3KLOA 2L7KA 2P6SA 2X1DA 2E60A 1VQ6I 3WG9A 2M2EA 3K1MA 3KP5A 4UV8A 3ERED 2IT0A 4IOCF 3I4PA 2QBYB 2ZSIB 2MC3A 3MKLA 2V9PA 4UY8I 4BHBA 3L2CA 1FNNA 1JUSA 4RBOA 3FHNA 4EATA 1J09A 5J4YA 1T0FA 3CESA 1IW7F 1RKTA 5EGOA 1K4SA 1BI1A 3VB2A 1REPC 1DGRM 3HDDA 3PO3J 4HQEA 1NG6A 2EPFA 1I27A 1XGOA 1OR7C 1Z67A 2XDVA 4U7DA 2O6GE 3BG5A 3DF8A 3JW4A 1P7IA 4OIQF 2JQ7A 4BS9A 1UHMA 3Q0VA 3JREA 2F5FA 3PNVA 1ETKA 2K40A 1Z6RA 2J5PA 5DCMA 1MBHA 2D5VA 2E2JJ 4S05A 1R5HA 4GFBA 2Y9YA 1FZPB 4IQ4A 3BT9A 1WI9A 2XAFA 1YTYA 3JRHA 5GAHJ 1R1TA 4HV5A 4YRVA 2W48A 5E3MA 1S8NA 5EG0B 2PG4A 2BY0A 1YS7A 5HOOA 1FEXA 3KPHA 4RLQA 4A2UA 2L4AA 1Q1HA 2HR3A 3IHUA 4U0VA 2K27A 1K6OA 5E79C 1IV8A 1BW5A 2CU7A 5GADJ 5DTDA 3M1EA 2WAEA 2E1CA 1HXDA 1OKRA 3HPGA 1TT0A 4RDUA 4IVNA 4DW6A 2V7FA 2ESHA 3FIWA 3OWTA 2EFOA 2OV7A 2BVLA 5HNHA 1YJNI 3WGHA 2R7TA 3AFHA 1IRGA 3RZDJ 2DT6A 2ISYA 2GQQA 2PMZA 4C3IJ 3QYEA 5LEKA 1SANA 5CYVA 2MW8A 3R4KA 1TWFJ 3JSOA 2FD5A 1OCRH 1MSFC 1QBJA 1KU9A 1I1SA 4RMNA 3V8LA 4OIPF 1IV6A 1JI8A 4A0YA 3HUGB 4G7ZF 2KP6A 3RSNA 1EH7A 2X1EA 4A6EA 4ZZLA 2XC7A 3U21A 1SFOJ 4CZCA 3V8KA 5LHHA 2V6CA 1FC3A 4Y4RA 1ZN2A 3ZXSA 2DXIA 5DM7F 3DBHB 1YW8A 2DTZA 4OOIA 4HLYA 4AIDA 2R5ZB 4B8XA 4C9YA 3BC8A 3HOWJ 2D45A 3HKZA 3L1PA 3GFIA 4NDLA 2DPDA 1R4MB 3ROUA 1D5YA 3JRCA 4A93J 5E18F 2CO5A 1SFXA 1V3FA 2KRFA 2F5DA 4G9YA 4LLGF 1R00A 1UZCA 2HEOA 1R22A 3AL0C 4ESFA 3HGYA 3DBLB 3CCRI 2ECBA 1XSDA 4A5MA 1Z3YA 4MFEA 5FROA 5KAIC 3TGNA 4KYWA 3NQOA 4A69C 3HPHA 2AQFA 1VQ8I 4NHJA 3CMAI 3PM1A 1PUEE 2MD0A 2WY7Q 2ME6A 2NVTJ 4E7ZA 2I5UA 3I59A 4ZC3A 4RAGA 1X58A 2LVSA 1TWGJ 3FX3A 4A12A 3IAM2 1UHSA 5F1RA 4F92B 1U5TC 5KNLA 2VLAA 1O3TA 3FXUA 2L2OA 3CCQI 3N4MA 2YSRA 4BDZA 2HKXA 4FCYA 4XONA 2JA5J 3ISPA 3CDIA 4MTEA 1Z7LA 5GP9A 3GZNB 4A3GJ 2XGDA 3G4SI 2GM4A 3BG9A 2HXOA 5DS9A 1ETXA 3VFZA 2NNNA 3L7WA 3A2KA 1YIOA 5KVRA 1ZH5A 1YRNA 2XVCA 4UUSA 2LF8A 2CS3A 2YUSA 2QYOA 2WAFA 1SVLA 4RB1A 2DMUA 3S93A 4HX7A 3K4JA 4CXFA 4CCMA 2ZNYA 3FMRA 5M5YJ 2TCTA 4QPOA 4DNCA 5L3FA 5J40A 3T1BA 2HKOA 4S04A 1E3PA 4BQNA 2BOLA 4KISA 2ZB9A 3HTUA 3HOSA 4KIFA 1APLC 4IRIA 4M9ZA 3ZGKA 3FK6A 3NAUA 3KZIC 4HDVA 3QYBA 5FB2A 5IOYA 2K3PA 4IQJA 4IRGA 1HKTA 2E7WA 4JP0A 5JLWA 4UB8C 4G8XA 2WAQN 2L5QA 2E2IJ 3E5UA 4Y17A 3QYFA 4DZJA 1IXCA 5FKKA 3AG3H 3ABMH 1Z6TA 2MC4A 2QQ9A 4BYYA 3TDUC 4XRMA 5IYBJ 3F21A 4FX4A 2BXYA 2JRTA 3RPQA 4B1RA 3IKTA 2OTJI 2BEOA 2XKOA 5TRDA 2L3DA 1MBEA 4BHCA 2JN6A 4LIVA 3J81K 3LFKA 3U1DA 3BQYA 4WCGA 2F5EA 3HM5A 1OPCA 1OLTA 1TC3C 4GDFA 3I64A 3H9GA 1FYLA 1KYWA 1P6RA 4Q5SF 4WWCA 2KMUA 2H8WA 2NVUB 1QZEA 1W36C 1LFBA 4I2OA 3LSKA 3QAHA 5ICCA 4KICA 4XKVA 5A2QK 5E1WA 1A04A 1Y8RB 1O4XA 2DOEA 4NQWA 1RZ4A 4AM3A 5ILSA 4C2TA 3DTIA 3O2PE 4HSRA 3CLQA 1G3SA 2QKLB 4BJTA 2VT2A 4WXHA 5FLVA 2XF5A 1WJCA 2K9QA 2Q0OA 2Q2EB 1W0UA 1SAXA 1F4KA 4HF1A 2DJNA 2CV1A 4OAZA 4OIOF 3BG7A 1QHGA 4I7HA 4HYEA 4FETA 4MGRA 3I55I 2MD5A 1KQ8A 2X0LA 3AG4H 3BCBA 4ZH4F 4A3BJ 4L9JA 2M87A 1HW1A 5LBQA 4Y52J 4Y15A 4OAYA 3PSFA 3LAPA 1R1VA 4IO9F 1R36A 4XMYA 2HS5A 3FXLA 3CDHA 2ELHA 5FGMA 1WJDA 2DA7A 1IN6A 2VBWA 2A6EF 3GLLA 4LGWA 4XN0A 3ZMZA 3K4MA 1BL0A 2OC6A 1EV7A 4MEYF 5DV5A 2HQAA 3TO6A 2RVCA 3G6EI 1TBXA 5J1YA 1ETWA 4IHSA 1YJ9I 2L01A 3G3ZA 1BC8C 1KQ9A 1W5SA 5IT9Z 2RC4A 1OYWA 2EFNA 3DEWA 1XX5A 2DO7A 2DMNA 5CQGA 5EEGA 3LSJA 4BE1A 5J8CA 1QPIA 4C2UA 5GPCA 2PEXA 3OR2C 5D5WB 3MVPA 4BJ5C 3J7ZI 2WAQA 1ZRCA 2DOFA 5F1JA 1JGGA 4LG0A 2CG4A 2OQGA 3I53A 4W97A 3LSRA 3K2AA 2V6EA 2JT1A 3KCCA 2IW5A 1XTAA 3CJQB 2O03A 4Z6YA 3KP6A 2R3SA 2H8RA 2RQPA 5D6EA 4A3LJ 2CWEA 4BE2A 2HOTA 1YX3A 2ECCA 4ESBA 3DLAA 1IN7A 1IDYA 1V5GA 3LSTA 3PNYA 1IF1A 1AA7A 3EETA 1O57A 3I4MJ 1IRXA 1BM9A
chains in the Genus database with same CATH topology
1NTCA 4DYRA 3BTLA 1Z77A 1G2HA 4EEFG 1K61A 1GT0C 1AU7A 1JKRC 3S2HJ 2R5ZA 1MH4A 2JA6J 3WHCA 1T56A 1B8IA 1VF9A 2IAIA 4C2MJ 1AKHB 1JKPC 4M3BA 1I50J 1JT6A 1PUFA 1JUPA 5J1UA 1ZQ3P 3B6AA 4V2FA 2JA7J 1HDDC 5IPAA 1NK3P 4M3GA 3JRAA 3JR9A 4ABZA 1GV2A 1JKOC 3S15J 4FE7A 2NVQJ 2MSYA 3ZQGA 2KDZA 4L5EA 2QF7A 2E19A 2COBA 4BBRJ 4CYCB 1ZTRA 4AC0A 2HOSA 5IYDJ 1H88C 4B3AA 4I6ZA 2WB1N 1E3OC 2E1OA 1A6IA 3HOXJ 3A02A 1ORKA 2EZIA 2R5YB 5E3NA 3UKGA 2DMTA 1BA5A 1WI3A 1XC5A 3LSPA 1S7EA 1JTYA 1B72A 1LE8A 1FTZA 1GVDA 3OOUA 3HOZJ 1YRNB 1JUMA 3TP3A 1XG1A 2EQRA 2L7MP 2NS8A 4UUSB 4XICA 3H0GJ 4LOCA 1IC8A 3JRFA 2M9HA 5M5WJ 1EF4A 1IUFA 2CRGA 5BNGA 2K9SA 1X2NA 2L7ZA 1RR7A 3LNQA 5C4XJ 4S0HB 2O9LA 3BG3A 3GTGJ 4J19A 1QRYA 1W0TA 1VFCA 4MIMA 3GBGA 5FKOA 2Y9ZA 2CUEA 4BKXA 2M8GX 2JMWA 2NVXJ 3S16J 2G0EA 2XPWA 2EH3A 3S1RJ 3FK7A 2NVYJ 4HNVA 4DYCA 2XSDC 3GTKJ 4JYKA 1DU0A 3ZQCA 1MBFA 2LLKA 3QQAA 3S17J 3CMYA 2B63J 3HOYJ 5IP6A 3M3YJ 2LKXA 2NS7A 2QCOA 2JWTA 3FKIJ 3QPSA 2VKVA 3GTOJ 1X2MA 2O8KA 2LP0A 2CJJA 3MN2A 2JJ7A 1U9NA 2GLOA 3HOVJ 2M2EA 4V2GA 2DMPA 2EZHA 3MKLA 4UUTA 2FX0A 1JUSA 4RBOA 1ITYA 1WCMJ 5EGOA 1RKTA 3HDDA 5FKLA 4A3MJ 2VUMJ 3PO3J 4DYQA 1OFCX 5EZHA 2JK3A 4IHXA 3ZOBA 5F27A 3M4OJ 1GDTA 2XB5A 2DA2A 3BG5A 1BJZA 2AO9A 3B6CA 1P7IA 1WGXA 2HXIA 1JTXA 1U78A 3Q0VA 3JREA 5M5XJ 1ETKA 5K7ZA 2K40A 3BQZA 2D5VA 3W6VA 1MBHA 5EEAA 2R93J 2EBIA 2E2JJ 3ZQIA 4GFBA 3HGGA 2VI6A 2Y9YA 3A01B 2H1KA 1I3QJ 3BT9A 5C44J 3GTJJ 3JRHA 3RZOJ 2Y0SN 2W48A 5E3MA 5EG0B 3RKQA 1FTTA 3BR2A 2VPRA 1XS9A 1MSEC 1FEXA 1JJ6C 5GPAA 2R7ZJ 2Y31A 3IH3A 2RAEA 3GTLJ 3GTPJ 5EDNA 1P7JA 1U9OA 2ID3A 4D5CA 2LTPA 1RETA 2CU7A 1BW5A 5DTDA 3PO2J 1T33A 1VNDA 3E7LA 4BY7J 3BR1A 4RDUA 3TEDA 4IHVA 1GUUA 2O7OA 3HB9A 2NOGA 4DW6A 3FIWA 4B4CA 4QIWN 3BR6A 1ZGWA 1HOMA 3RZDJ 2P81A 1VI0A 5EZGA 3SFIA 4C3IJ 2L0KA 1SANA 3S14J 2HOAA 2DN0A 2MW8A 1TWFJ 5FLMJ 2FD5A 1HCRA 1MSFC 4JX6A 3JRDA 1WPKA 5F08A 3LSGA 1IV6A 5E3LA 4IHYA 1SFOJ 2M34A 4QSHA 1QVUA 5F0CA 1OCPA 3BTIA 2ME0A 5J1RA 3BR3A 2X48A 1ZR2A 2DTZA 1DU6A 3BR0A 2CQXA 5F0FA 3HBLA 4D7MA 2R5ZB 3HOWJ 3S1NJ 1B8IB 1IRZA 3L1PA 1R9TJ 3RQIA 4NDLA 2DA3A 1D5YA 3JRCA 4A93J 1PUFB 2OF7A 3LOCA 1NK2P 2R92J 4I76A 3HGYA 3IV5A 1QVTA 1AKHA 5IOZA 3JRGA 2ECBA 5E3OA 1F43A 1OJLA 4MFEA 4AYBN 2PMZN 4XRSA 4A3FJ 2N8GA 1BW6A 2LK2A 4A69C 3JRIA 2I10A 1H89C 1Z0XA 4XRSG 2LFBA 3PM1A 2WV1A 2HDDA 3IH2A 2ME6A 3WHBA 2R0QC 2NVTJ 1X58A 2LVSA 3Q0WA 1TWGJ 5F04A 1IGNA 1UHSA 4MO7A 3S1MJ 5FKMA 3JRBA 5EF6A 4CYCA 3CCYA 1B72B 2Y30A 3Q0UA 3G1OA 1LE8B 4XIDA 3HKZN 4FCYA 1AHDP 2JA5J 3GTMJ 5JLXA 1Y1VJ 5GP9A 1JKQC 4A3GJ 4JX4A 2XGDA 9ANTA 2GM4A 4IHWA 2R5YA 3BG9A 2HXOA 4MLOA 5DS9A 5M3MJ 3G1LA 5C4JJ 1ETXA 4X6AJ 3TP0A 2X6OA 1HF0A 3NARA 3OSFA 1YRNA 3ZQLA 4UUSA 2LY9A 1MNMC 5FJ8J 2KT0A 2YUSA 1MBKA 1Q1VA 2XB0X 3A03A 2IEKA 3CDLA 2HI3A 2DMUA 4FE4A 1HDPA 5K7HA 2ID6A 2IBDA 3F0CA 4D5FA 1MBGA 1IG7A 3FISA 5M5YJ 3K7AJ 4BY1J 4M3DA 1ETQA 2TCTA 5IP9J 3S2DJ 4BXXJ 1RKWA 2ZB9A 4A3KJ 1TWCJ 1LFUP 2DA1A 1ETYA 5M3FJ 4FISA 4A3IJ 4A3DJ 3SJMA 1APLC 5F0HA 3S1QJ 4Y7NJ 3FK6A 3NAUA 4G12A 5IOYA 3O8GA 3IH4A 2Y2ZA 2X9DA 4W1UA 4JP0A 5JLWA 2WAQN 2E2IJ 2DMQA 5IP7J 2XGEA 3VPRA 4DZJA 1IJWC 2CQQA 5FKKA 3H3VK 3HOUJ 3C2BA 4XRMA 5IYBJ 1F36A 4B1RA 4A3JJ 2E2HJ 2XPVA 1MBEA 2XGCA 3SDGA 2JN6A 5EYRA 5EGOB 2YS9A 1U8BA 3BQYA 1Y1WJ 4M3EA 3CQZJ 3HM5A 1HLVA 1TC3C 1H8AC 2VKEA 3Q3SA 1JT0A 1LFBA 1FIPA 1TWAJ 2EZKA 1ETVA 2K9NA 4X1EA 1MH3A 3TW6A 1K83J 2LD5A 1O4XA 5C3EJ 3ZQFA 5K7FA 2DA4A 2YU9J 5FKNA 4AUXA 1JJ8C 3HEFA 2L9RA 3OSGA 1ENHA 4C3HJ 3D1NI 1I6HJ 5FLVA 2K9QA 2TRTA 1UG2A 1ZR4A 3I4NJ 3TW7A 3GTQJ 4QTRA 1W0UA 1WH7A 2DJNA 1TWHJ 2FQ4A 4A3CJ 3A01A 2OPTA 2HQ5A 3OIOA 4IEJA 1ZKGA 1A5JA 4A3BJ 2M0CA 4Y52J 2L7FP 1RPWA 2DA6A 2JA8J 2HYJA 4A3EJ 5EG0A 1WH5A 1UMQA 3QPLA 2DA7A 3DCFA 2EZLA 4DZPA 3BTJA 1CQTA 1BL0A 1RESA 5J1YA 4D7NA 1ETWA 2MG4A 1GV5A 2ELKA 2XRLA 1MBJA 4C3JJ 3DEWA 2DMNA 3LSJA 2DA5A 1QPIA 5GPCA 3MVPA 4BBSJ 3BTCA 2GBYA 3BR5A 5F1JA 1ETOA 5J3LA 1JGGA 4FTHA 4W97A 3LSRA 1POGA 3K2AA 1ZK8A 1OCTC 2MGQA 2FJ1A 2AHQA 2H8RA 5IYCJ 4XK4A 2CUFA 3O8HA 4M6VA 4A3LJ 3ZQHA 2HOTA 4MFDA 2ECCA 3G1MA 1IDYA 1IDZA 2XPUA 1FIAA 3I4MJ 5HODA 2LR8A 4M3FA 1FJLA 4JX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTC A;  4DYR A;  3BTL A;  1Z77 A;  1G2H A;  4EEF G;  1K61 A;  1GT0 C;  1AU7 A;  1JKR C;  3S2H J;  2R5Z A;  1MH4 A;  2JA6 J;  3WHC A;  1T56 A;  1B8I A;  1VF9 A;  2IAI A;  4C2M J;  1AKH B;  1JKP C;  4M3B A;  1I50 J;  1JT6 A;  1PUF A;  1JUP A;  5J1U A;  1ZQ3 P;  3B6A A;  4V2F A;  2JA7 J;  1HDD C;  5IPA A;  1NK3 P;  4M3G A;  3JRA A;  3JR9 A;  4ABZ A;  1GV2 A;  1JKO C;  3S15 J;  4FE7 A;  2NVQ J;  2MSY A;  3ZQG A;  2KDZ A;  4L5E A;  2QF7 A;  2E19 A;  2COB A;  4BBR J;  4CYC B;  1ZTR A;  4AC0 A;  2HOS A;  5IYD J;  1H88 C;  4B3A A;  4I6Z A;  2WB1 N;  1E3O C;  2E1O A;  1A6I A;  3HOX J;  3A02 A;  1ORK A;  2EZI A;  2R5Y B;  5E3N A;  3UKG A;  2DMT A;  1BA5 A;  1WI3 A;  1XC5 A;  3LSP A;  1S7E A;  1JTY A;  1B72 A;  1LE8 A;  1FTZ A;  1GVD A;  3OOU A;  3HOZ J;  1YRN B;  1JUM A;  3TP3 A;  1XG1 A;  2EQR A;  2L7M P;  2NS8 A;  4UUS B;  4XIC A;  3H0G J;  4LOC A;  1IC8 A;  3JRF A;  2M9H A;  5M5W J;  1EF4 A;  1IUF A;  2CRG A;  5BNG A;  2K9S A;  1X2N A;  2L7Z A;  1RR7 A;  3LNQ A;  5C4X J;  4S0H B;  2O9L A;  3BG3 A;  3GTG J;  4J19 A;  1QRY A;  1W0T A;  1VFC A;  4MIM A;  3GBG A;  5FKO A;  2Y9Z A;  2CUE A;  4BKX A;  2M8G X;  2JMW A;  2NVX J;  3S16 J;  2G0E A;  2XPW A;  2EH3 A;  3S1R J;  3FK7 A;  2NVY J;  4HNV A;  4DYC A;  2XSD C;  3GTK J;  4JYK A;  1DU0 A;  3ZQC A;  1MBF A;  2LLK A;  3QQA A;  3S17 J;  3CMY A;  2B63 J;  3HOY J;  5IP6 A;  3M3Y J;  2LKX A;  2NS7 A;  2QCO A;  2JWT A;  3FKI J;  3QPS A;  2VKV A;  3GTO J;  1X2M A;  2O8K A;  2LP0 A;  2CJJ A;  3MN2 A;  2JJ7 A;  1U9N A;  2GLO A;  3HOV J;  2M2E A;  4V2G A;  2DMP A;  2EZH A;  3MKL A;  4UUT A;  2FX0 A;  1JUS A;  4RBO A;  1ITY A;  1WCM J;  5EGO A;  1RKT A;  3HDD A;  5FKL A;  4A3M J;  2VUM J;  3PO3 J;  4DYQ A;  1OFC X;  5EZH A;  2JK3 A;  4IHX A;  3ZOB A;  5F27 A;  3M4O J;  1GDT A;  2XB5 A;  2DA2 A;  3BG5 A;  1BJZ A;  2AO9 A;  3B6C A;  1P7I A;  1WGX A;  2HXI A;  1JTX A;  1U78 A;  3Q0V A;  3JRE A;  5M5X J;  1ETK A;  5K7Z A;  2K40 A;  3BQZ A;  2D5V A;  3W6V A;  1MBH A;  5EEA A;  2R93 J;  2EBI A;  2E2J J;  3ZQI A;  4GFB A;  3HGG A;  2VI6 A;  2Y9Y A;  3A01 B;  2H1K A;  1I3Q J;  3BT9 A;  5C44 J;  3GTJ J;  3JRH A;  3RZO J;  2Y0S N;  2W48 A;  5E3M A;  5EG0 B;  3RKQ A;  1FTT A;  3BR2 A;  2VPR A;  1XS9 A;  1MSE C;  1FEX A;  1JJ6 C;  5GPA A;  2R7Z J;  2Y31 A;  3IH3 A;  2RAE A;  3GTL J;  3GTP J;  5EDN A;  1P7J A;  1U9O A;  2ID3 A;  4D5C A;  2LTP A;  1RET A;  2CU7 A;  1BW5 A;  5DTD A;  3PO2 J;  1T33 A;  1VND A;  3E7L A;  4BY7 J;  3BR1 A;  4RDU A;  3TED A;  4IHV A;  1GUU A;  2O7O A;  3HB9 A;  2NOG A;  4DW6 A;  3FIW A;  4B4C A;  4QIW N;  3BR6 A;  1ZGW A;  1HOM A;  3RZD J;  2P81 A;  1VI0 A;  5EZG A;  3SFI A;  4C3I J;  2L0K A;  1SAN A;  3S14 J;  2HOA A;  2DN0 A;  2MW8 A;  1TWF J;  5FLM J;  2FD5 A;  1HCR A;  1MSF C;  4JX6 A;  3JRD A;  1WPK A;  5F08 A;  3LSG A;  1IV6 A;  5E3L A;  4IHY A;  1SFO J;  2M34 A;  4QSH A;  1QVU A;  5F0C A;  1OCP A;  3BTI A;  2ME0 A;  5J1R A;  3BR3 A;  2X48 A;  1ZR2 A;  2DTZ A;  1DU6 A;  3BR0 A;  2CQX A;  5F0F A;  3HBL A;  4D7M A;  2R5Z B;  3HOW J;  3S1N J;  1B8I B;  1IRZ A;  3L1P A;  1R9T J;  3RQI A;  4NDL A;  2DA3 A;  1D5Y A;  3JRC A;  4A93 J;  1PUF B;  2OF7 A;  3LOC A;  1NK2 P;  2R92 J;  4I76 A;  3HGY A;  3IV5 A;  1QVT A;  1AKH A;  5IOZ A;  3JRG A;  2ECB A;  5E3O A;  1F43 A;  1OJL A;  4MFE A;  4AYB N;  2PMZ N;  4XRS A;  4A3F J;  2N8G A;  1BW6 A;  2LK2 A;  4A69 C;  3JRI A;  2I10 A;  1H89 C;  1Z0X A;  4XRS G;  2LFB A;  3PM1 A;  2WV1 A;  2HDD A;  3IH2 A;  2ME6 A;  3WHB A;  2R0Q C;  2NVT J;  1X58 A;  2LVS A;  3Q0W A;  1TWG J;  5F04 A;  1IGN A;  1UHS A;  4MO7 A;  3S1M J;  5FKM A;  3JRB A;  5EF6 A;  4CYC A;  3CCY A;  1B72 B;  2Y30 A;  3Q0U A;  3G1O A;  1LE8 B;  4XID A;  3HKZ N;  4FCY A;  1AHD P;  2JA5 J;  3GTM J;  5JLX A;  1Y1V J;  5GP9 A;  1JKQ C;  4A3G J;  4JX4 A;  2XGD A;  9ANT A;  2GM4 A;  4IHW A;  2R5Y A;  3BG9 A;  2HXO A;  4MLO A;  5DS9 A;  5M3M J;  3G1L A;  5C4J J;  1ETX A;  4X6A J;  3TP0 A;  2X6O A;  1HF0 A;  3NAR A;  3OSF A;  1YRN A;  3ZQL A;  4UUS A;  2LY9 A;  1MNM C;  5FJ8 J;  2KT0 A;  2YUS A;  1MBK A;  1Q1V A;  2XB0 X;  3A03 A;  2IEK A;  3CDL A;  2HI3 A;  2DMU A;  4FE4 A;  1HDP A;  5K7H A;  2ID6 A;  2IBD A;  3F0C A;  4D5F A;  1MBG A;  1IG7 A;  3FIS A;  5M5Y J;  3K7A J;  4BY1 J;  4M3D A;  1ETQ A;  2TCT A;  5IP9 J;  3S2D J;  4BXX J;  1RKW A;  2ZB9 A;  4A3K J;  1TWC J;  1LFU P;  2DA1 A;  1ETY A;  5M3F J;  4FIS A;  4A3I J;  4A3D J;  3SJM A;  1APL C;  5F0H A;  3S1Q J;  4Y7N J;  3FK6 A;  3NAU A;  4G12 A;  5IOY A;  3O8G A;  3IH4 A;  2Y2Z A;  2X9D A;  4W1U A;  4JP0 A;  5JLW A;  2WAQ N;  2E2I J;  2DMQ A;  5IP7 J;  2XGE A;  3VPR A;  4DZJ A;  1IJW C;  2CQQ A;  5FKK A;  3H3V K;  3HOU J;  3C2B A;  4XRM A;  5IYB J;  1F36 A;  4B1R A;  4A3J J;  2E2H J;  2XPV A;  1MBE A;  2XGC A;  3SDG A;  2JN6 A;  5EYR A;  5EGO B;  2YS9 A;  1U8B A;  3BQY A;  1Y1W J;  4M3E A;  3CQZ J;  3HM5 A;  1HLV A;  1TC3 C;  1H8A C;  2VKE A;  3Q3S A;  1JT0 A;  1LFB A;  1FIP A;  1TWA J;  2EZK A;  1ETV A;  2K9N A;  4X1E A;  1MH3 A;  3TW6 A;  1K83 J;  2LD5 A;  1O4X A;  5C3E J;  3ZQF A;  5K7F A;  2DA4 A;  2YU9 J;  5FKN A;  4AUX A;  1JJ8 C;  3HEF A;  2L9R A;  3OSG A;  1ENH A;  4C3H J;  3D1N I;  1I6H J;  5FLV A;  2K9Q A;  2TRT A;  1UG2 A;  1ZR4 A;  3I4N J;  3TW7 A;  3GTQ J;  4QTR A;  1W0U A;  1WH7 A;  2DJN A;  1TWH J;  2FQ4 A;  4A3C J;  3A01 A;  2OPT A;  2HQ5 A;  3OIO A;  4IEJ A;  1ZKG A;  1A5J A;  4A3B J;  2M0C A;  4Y52 J;  2L7F P;  1RPW A;  2DA6 A;  2JA8 J;  2HYJ A;  4A3E J;  5EG0 A;  1WH5 A;  1UMQ A;  3QPL A;  2DA7 A;  3DCF A;  2EZL A;  4DZP A;  3BTJ A;  1CQT A;  1BL0 A;  1RES A;  5J1Y A;  4D7N A;  1ETW A;  2MG4 A;  1GV5 A;  2ELK A;  2XRL A;  1MBJ A;  4C3J J;  3DEW A;  2DMN A;  3LSJ A;  2DA5 A;  1QPI A;  5GPC A;  3MVP A;  4BBS J;  3BTC A;  2GBY A;  3BR5 A;  5F1J A;  1ETO A;  5J3L A;  1JGG A;  4FTH A;  4W97 A;  3LSR A;  1POG A;  3K2A A;  1ZK8 A;  1OCT C;  2MGQ A;  2FJ1 A;  2AHQ A;  2H8R A;  5IYC J;  4XK4 A;  2CUF A;  3O8H A;  4M6V A;  4A3L J;  3ZQH A;  2HOT A;  4MFD A;  2ECC A;  3G1M A;  1IDY A;  1IDZ A;  2XPU A;  1FIA A;  3I4M J;  5HOD A;  2LR8 A;  4M3F A;  1FJL A;  4JX5 A; 
#chains in the Genus database with same CATH topology
 2EV0 A;  3OIQ A;  3TOA A;  1LB2 A;  3BTL A;  5D5U B;  2ZME A;  5IY5 H;  1K61 A;  3CF5 F;  1V55 H;  1G4D A;  2IJL A;  1TP4 A;  3K4C A;  3MCZ A;  2O0Y A;  1XMK A;  1VF9 A;  1AKH B;  1DP3 A;  3DTK A;  3QU6 A;  1ZRD A;  4M3B A;  4XLA A;  4PGH A;  1PUF A;  3S2W A;  4ZYG A;  1EH6 A;  1ZQ3 P;  3B6A A;  3KZY A;  3ZQ7 A;  1T39 A;  2UWM A;  5ICF A;  5J8F A;  2DAO A;  1V4R A;  1P92 A;  5IPA A;  2IGM A;  4M3G A;  3IRR A;  4HDU A;  3H1C A;  3DFG A;  1MMG A;  3WE3 A;  3FMS A;  3V7R A;  5HLI A;  2EWN A;  2LKS A;  1JKO C;  1VQ5 I;  3S15 J;  3COA C;  2NXN B;  2MSY A;  2UXX A;  5CLS A;  4M72 A;  2FU4 A;  3F8N A;  2UXN A;  4BH9 A;  3OYK A;  1KQ0 A;  4F7Z A;  1BR2 A;  4HX4 A;  4EMS A;  2FNP A;  5LGU A;  5IYD J;  4AC0 A;  2HOS A;  2EIN H;  4CCK A;  3MWM A;  3DEE A;  1PDN C;  3SZT A;  2WB1 N;  2E1O A;  2GZW A;  4ENJ A;  1A6I A;  1K78 B;  3M8J A;  3HSR A;  3NEU A;  2D2W A;  3IKV A;  3T5X A;  3T8T A;  3OOP A;  1XGM A;  3UKG A;  3CD6 I;  1UFM A;  2LRD A;  3G71 I;  3LSP A;  3MZH A;  1S7E A;  4NC8 A;  3OMY A;  1LE8 A;  2VAS A;  2QKM B;  1GVD A;  1WJE A;  3BLY A;  2CFX A;  4FAS D;  3L2Q A;  3HOZ J;  3WTZ A;  4HRI A;  1JUM A;  2F4I A;  2EQR A;  2OZU A;  2L7M P;  3ABU A;  3RIR A;  3S8P A;  1PVE A;  3OIP A;  2F2E A;  2FSW A;  2M9H A;  2UV1 A;  2XAJ A;  3ABK H;  4LLL A;  1EF4 A;  1IUF A;  1OQY A;  2B0L A;  2P5V A;  3BDD A;  3ZRG A;  3E1S A;  4EJU A;  1BOA A;  1RR7 A;  2IPQ X;  2V4J C;  3ELK A;  1KGS A;  3SEQ A;  5C4X J;  4G6Q A;  3BG3 A;  3OS1 A;  2M5W A;  3CLO A;  2COM A;  4LK1 F;  4MIM A;  1NH3 A;  1Y6I A;  2Y9Z A;  1JE8 A;  3PFY A;  2VKH A;  2NVX J;  2CQN A;  4D9J A;  3QPH A;  2ZJP F;  2G0E A;  4LB5 A;  4F3Q A;  2VQC A;  4ENN A;  4HLX A;  5IT9 K;  4GYI A;  2FMY A;  4LIT A;  2XV4 S;  1XCB A;  3KYD B;  1VQO I;  5IP6 A;  2AXL A;  5EEH A;  1Z91 A;  4BQQ A;  4Q48 A;  2KHM A;  1VQN I;  2VE8 A;  2LP0 A;  3HHH A;  2CJJ A;  3IWZ A;  3O3K A;  1FYM A;  2JJ7 A;  2XAG A;  1QNT A;  3DKY A;  2CW0 F;  1X3Z B;  4E7I A;  3HOV J;  1WJF A;  3A1Y A;  3RI4 A;  2EZH A;  2DJI A;  1XPX A;  3HXL A;  3DU5 A;  2VON A;  2FF4 A;  1K4T A;  2E1M B;  5FRN A;  5FKL A;  3W3C A;  3CP8 A;  4DYQ A;  2W7N A;  2ZFU A;  3DTE A;  5HS7 A;  1U2W A;  1P9Q C;  1GDT A;  2XB5 A;  1ZEL A;  1HA8 A;  2OZ6 A;  4DIQ A;  1BJZ A;  1YYV A;  1B4A A;  2HVQ A;  4KIG A;  1ERD A;  1JTX A;  4E7J A;  1B59 A;  1WHU A;  3HSF A;  4NNJ A;  5M5X J;  4O6J A;  1F5T A;  3DPU A;  5K7Z A;  3W6V A;  2DT7 B;  3S32 A;  1V5F A;  5EEA A;  1DQU A;  2GA1 A;  2LSO A;  4L18 B;  5L3C A;  4A0X A;  2STT A;  3HC7 A;  4EJO A;  2K3F A;  1R7J A;  3LA3 A;  2FOW A;  2H1K A;  4PJ0 C;  3GTJ J;  2PJR A;  5CVI A;  2BZT A;  2Y0S N;  2V1D A;  3RKQ A;  1FTT A;  2VPR A;  3E97 A;  1LEA A;  2Y31 A;  2VQL A;  4OIN F;  4BDY A;  3F8M A;  3GTL J;  3GTP J;  3ECH A;  3R0J A;  4YG2 F;  2R7Q A;  1U9O A;  2ZO4 A;  3L2U A;  1OR7 A;  3EYI A;  2VC0 A;  1EA3 A;  2XRO A;  1VND A;  4BY7 J;  3DLL F;  2GIV A;  1GUU A;  2O7O A;  3DWL E;  1A6Q A;  2BVM A;  2DK8 A;  1FOY A;  3T8R A;  4RAY A;  4B4C A;  2NYX A;  4QIW N;  3IP4 B;  1ZGW A;  1Y0N A;  2LBF B;  1MNE A;  3FM5 A;  2JSC A;  4YEL A;  1VI0 A;  2FEZ A;  2HU9 A;  3CJN A;  5EZG A;  3SFI A;  4A5N A;  2MLG A;  2KZG A;  3S14 J;  2HOA A;  1OCZ H;  3W6J B;  1HCR A;  3QOD A;  1WPK A;  5F08 A;  1B9M A;  3GF2 A;  5CVV A;  4BU2 A;  5JHU A;  1X1C A;  3OYI A;  1Y56 A;  4XOR A;  1QZZ A;  3ULQ B;  1UB9 A;  3ZCO A;  5B3S H;  4X0G A;  2W00 A;  2M34 A;  4L0Z B;  2GOM A;  2RRE A;  3K1N A;  1JGS A;  4UXN A;  5F0C A;  1OCP A;  2E71 A;  3KZZ A;  2QSH X;  2ME0 A;  2LRE A;  3PQJ A;  4ZYA A;  2DPU A;  1ZR2 A;  1LDD A;  1DU6 A;  3BR0 A;  3FBN B;  4KJZ A;  1XD7 A;  4XOP A;  1VQL I;  3EUH C;  4Z2Y A;  3GYH X;  4BE0 A;  2FA5 A;  2WBM A;  1R71 A;  1MND A;  3S1N J;  3RQI A;  2P5K A;  3CUQ B;  3F9K A;  4XLE A;  2DA3 A;  3D5L A;  3PIP F;  3HOT A;  3LOC A;  3MKZ A;  1VQ4 I;  3CC2 I;  2NS0 A;  2LG4 A;  2A61 A;  2XAH A;  3IV5 A;  2JTV A;  4DGW B;  3M9A A;  3MD2 A;  3JRG A;  1FOW A;  1SD6 A;  1OJL A;  5E3O A;  4E7S A;  4AYB N;  2BY2 A;  2PMZ N;  4XRS A;  2MH9 A;  3QRF F;  2Y0S A;  2LK2 A;  4ZYE A;  4CHU A;  3JTH A;  4Q4Z F;  1GXQ A;  3OL4 A;  4XRS G;  3E0J B;  3KP4 A;  1FOK A;  4HV6 A;  1YFH A;  3WHB A;  2HPI A;  2ZJQ F;  1IGN A;  3OY9 A;  4MO7 A;  4XLC A;  4ITV A;  2R4G A;  2DQL A;  4DBR A;  3J7A O;  5FKM A;  3CTA A;  3RYP A;  4I02 A;  4OMZ A;  4EQQ A;  4CYC A;  3CCY A;  2NNY A;  3Q0U A;  4N4O B;  4H4K C;  1WRJ A;  1B72 B;  1N77 A;  3LSM A;  3LL7 A;  3HKZ N;  3BZK A;  1ON2 A;  4JQF A;  1AHD P;  2V9V A;  3BG6 A;  5JLX A;  3VYU B;  4KT6 A;  3X2Q H;  4PJM A;  4IHW A;  1L0O C;  4MLO A;  5C4J J;  1VQM I;  5M3M J;  3G1L A;  2Q8K A;  3TP0 A;  1MW7 A;  1HF0 A;  3GCM A;  1OYY A;  3OSF A;  1Y39 A;  1W7P D;  4BJ6 C;  2PQ8 A;  1LQ1 A;  2KRH A;  3RKX A;  1E3H A;  3OYC A;  3SZG A;  1MNM C;  5FJ8 J;  4XLF A;  1VQP I;  2M7B A;  3J80 K;  1MBK A;  3BPV A;  2AQE A;  4AVZ A;  2IEK A;  5JFR A;  2HI3 A;  3CME I;  4FE4 A;  4IZZ A;  2ID6 A;  3F0C A;  4EGZ A;  2VPL A;  3L2W A;  1IRF A;  1MBG A;  3FIS A;  3S2D J;  2B9S A;  2KZV A;  1CF7 A;  2DI3 A;  5CVJ A;  1U5T A;  1FWZ A;  1J75 A;  1HW2 A;  3MKW B;  1W7P A;  1MJB A;  5M3F J;  1ETY A;  3I9V 2;  3SJM A;  2HZT A;  2XSJ C;  2BW3 A;  1TT5 B;  2KIS A;  2Z9O A;  3O8G A;  3IH4 A;  2Y2Z A;  2X9D A;  4W1U A;  4IOA F;  1GXP A;  4DQ2 A;  1A36 A;  1ZRE A;  3WTV C;  4M9S A;  4CCL A;  1D1A A;  4CSW A;  1IJW C;  3GZ5 A;  2L9V A;  1FMV A;  2K7L A;  3C2B A;  3GFM A;  4AYB A;  2DLL A;  2VOO A;  4N9I A;  3SEZ A;  1OMI A;  4Y13 A;  2J5O A;  4YEJ A;  1XDU A;  1BC7 C;  3AAF A;  5E20 A;  3SDG A;  5EYR A;  5EGO B;  1ODD A;  2YS9 A;  3BOQ A;  2QWW A;  4ETS A;  1BIB A;  4M3E A;  1MJA A;  3CQZ J;  3KET A;  2NRA C;  1D1B A;  3DKW A;  4PK4 A;  2VKE A;  1RRJ A;  1KZH A;  2CFO A;  4KN4 X;  3J81 Z;  2AXT C;  2LNB A;  2L54 A;  3Q3S A;  2JVG A;  2G7U A;  1FIP A;  2EZK A;  1ONV A;  4XQF A;  4X1E A;  4B09 A;  4RA2 A;  2DOD A;  3KLN A;  2NOJ B;  2WA0 A;  2DFI A;  4AU7 A;  3F8C A;  3VOE A;  3PIO F;  1ZYR F;  4GRI A;  5DCM B;  3ZQQ A;  5C3E J;  1ZLK A;  3KEO A;  3ZQF A;  1HSJ A;  2YU9 J;  5FKN A;  2PFB A;  2M3A A;  5A2Q Z;  4UUV A;  1X19 A;  5HS9 A;  2EFW A;  4C3H J;  3D1N I;  2HYF A;  3DQV C;  2YX4 A;  2OCC H;  4I01 A;  2TRT A;  3K4L A;  1FY7 A;  1UG2 A;  2CV0 A;  3GTQ J;  4F52 A;  1DPR A;  2FQ4 A;  3V7S A;  1M1E B;  2OJE D;  1UAA A;  3A01 A;  3HHG A;  5JVG F;  2OPT A;  2P7C B;  2HQ5 A;  2LF7 A;  2ZFW A;  3OIO A;  3HG9 A;  1IO2 A;  3L2V A;  5IT3 A;  2JVH A;  1F1Z A;  3FF5 A;  2KIU A;  4KN7 X;  2L7F P;  4OMY A;  1RPW A;  3K70 C;  1UMQ A;  3QPL A;  1J2X A;  1YIJ I;  3DCF A;  1XMX A;  2Z16 A;  2H6C A;  3BTJ A;  1X4O A;  3F6O A;  2MBF A;  1P4X A;  3MEX A;  4RLF A;  3WU1 B;  2HVR A;  1RES A;  4HPQ A;  5E1X A;  2JZY A;  4D7N A;  2ELK A;  2IRF G;  2A3S A;  2KLO A;  3ABL H;  3ZMV A;  3DP7 A;  4WF2 A;  4PFO A;  2DT5 A;  3PNT A;  1J7K A;  3LWF A;  5JR3 A;  5J3L A;  3OS0 A;  4R79 A;  4FTH A;  1OIS A;  3L00 A;  3RKY A;  1HKQ A;  1DDN A;  2IA0 A;  1OCT C;  2MGQ A;  3I58 A;  4HW0 A;  2IGK A;  5BS6 A;  1DUX C;  4XK4 A;  3KX2 A;  1MMD A;  4M6V A;  4F93 B;  1X1A A;  4G6D A;  2V26 A;  4MFD A;  2K02 A;  1MDM A;  2XPU A;  3PSI A;  4UB6 C;  1FT9 A;  5HS8 A;  1FJL A;  3P5J A;  3NWS A;  3H5N A;  2MYS A;  1G2H A;  4LFU A;  4EEF G;  3TBI A;  1GT0 C;  3VYR B;  1TL8 A;  1MH4 A;  3CCV I;  3C3W A;  2L4M A;  1G3T A;  1B8I A;  3TMO A;  1XSV A;  1D1C A;  4IX7 A;  2KJB A;  4AIH A;  1QA6 A;  1JKP C;  1TNS A;  1I6X A;  5J1U A;  1DGW Y;  2DW4 A;  4EJT A;  4HOB A;  5HVQ C;  4V2F A;  2JA7 J;  2DQR A;  4RAZ A;  4YFK F;  4FT8 A;  4EJW A;  3VSL A;  2EB7 A;  5DUK A;  1GVJ A;  1WWX A;  3JRA A;  1NG7 A;  2O8X A;  1FLI A;  4PJJ A;  3I59 B;  2RQQ A;  3EDP A;  3H92 A;  2BY1 A;  4AD9 A;  5GAG J;  4L5E A;  3U9G A;  2ICW G;  2E19 A;  2COB A;  3H35 A;  2PMH A;  3DV8 A;  2HOE A;  4NC7 A;  2VB6 A;  4ZJZ A;  5FFZ A;  1H88 C;  4N4N B;  2R7O A;  3HRM A;  2F5C A;  3WG7 H;  2DYR H;  1E3O C;  5ILV A;  3D5S C;  4RGU A;  3HOX J;  2W84 A;  2E35 A;  2EZI A;  2KRC A;  2M7A A;  1X3U A;  2BGC A;  3ZN0 A;  5E3N A;  3CJT B;  2DMT A;  1BA5 A;  1XC5 A;  4L9N A;  1RUO A;  2P7V B;  4XOT A;  2BBY A;  3S3M A;  2VQH A;  2ZXW H;  3OOU A;  1YRN B;  4UNO A;  3TP3 A;  1XG1 A;  1TNT A;  5ILU A;  4UUS B;  1ZHF A;  1UHW A;  2HQR A;  4XIC A;  3H0G J;  4I09 A;  1P4A A;  5FLX Z;  2KQR A;  2VJJ A;  5M5W J;  2CRG A;  4TV7 A;  1S7A A;  5L3B A;  3LQR A;  1X2N A;  4PFP A;  1G3W A;  1HST A;  3Q9S A;  4S0H B;  2O9L A;  1IN5 A;  4O5V A;  4J19 A;  4RGS A;  1G8X A;  5DYM A;  2BHY A;  2CUE A;  4BKX A;  2M8G X;  4KT5 C;  2Y48 A;  4AIK A;  3A0B C;  3S16 J;  2EV5 A;  4XN3 A;  3CCU I;  4HNV A;  4JYK A;  2XAS A;  3ZQC A;  2ESN A;  2LLK A;  3IC7 A;  3SQN A;  3M8E A;  2R7F A;  3CMY A;  2B63 J;  2A5W A;  2RGV A;  2FBI A;  3NWT A;  2JPB A;  2C6Y A;  3HOY J;  3M3Y J;  1FYK A;  2A07 F;  3DU6 A;  1TZL A;  2VKV A;  3OYB A;  4EM2 A;  1X2M A;  3PQK A;  4ASN A;  1S6L A;  1T6S A;  3MN2 A;  2P0W A;  3TDZ C;  2Y75 A;  5D4S A;  4V2G A;  4DOZ A;  4CUG A;  5GAE J;  1QHH D;  3WTW C;  5J4V A;  2M4K A;  4P5O A;  4UUT A;  1IUY A;  2EIJ H;  2VBX A;  2L9S A;  2HQN A;  2QQB A;  1LJ9 A;  2ZBK A;  1KA8 A;  3F8B A;  4LMY A;  1QU3 A;  3FM3 A;  2KL4 A;  1T38 A;  1EH8 A;  1ZGA A;  4J01 A;  3OYF A;  4IHX A;  1A35 A;  4NQW B;  2ACJ A;  3ZOB A;  5F27 A;  4L0Y B;  4B48 A;  2WWY A;  2Z3Y A;  4I99 C;  2AO9 A;  5KHD A;  2MH2 A;  2H27 A;  2H94 A;  4G94 A;  3MZY A;  1WGX A;  1R1U A;  2DCE A;  2Y69 H;  1UCR A;  2R93 J;  2EBI A;  1QZY A;  3ZQI A;  1YI2 I;  3LA2 A;  3E6D A;  3HGG A;  2R7V A;  4U87 A;  4XNF A;  4B44 A;  2E7X A;  2PI0 A;  1FPQ A;  1YQA A;  3TO9 A;  1YLF A;  3CO7 C;  3SDB A;  3WTY C;  2W1O A;  3QP5 A;  1FMW A;  4U0Y A;  1VTN C;  1GHC A;  2R7D A;  1LVK A;  1P2F A;  2A05 A;  4BAC A;  3CP2 A;  3L9F A;  2DDB A;  4DJA A;  5BOX A;  4FQG A;  3P7N A;  3JAM Z;  1J59 A;  5GPA A;  1JJ6 C;  3K1P A;  2R7Z J;  2R7R A;  2EA2 A;  3R0A A;  5CVU A;  1D5V A;  2O3F A;  4MQV A;  5HDN A;  1U8R A;  3IRQ A;  2VJ5 A;  4G6T B;  2ID3 A;  3Q9V A;  3GFL A;  1RET A;  4D5C A;  2FQ3 A;  1D8J A;  3PO2 J;  2XUB A;  1CGP A;  3E7L A;  3LSI A;  2RNJ A;  4ZTF A;  3BR1 A;  4IHV A;  1QPM A;  3HB9 A;  2M4G A;  1WJA A;  3N05 A;  3VEP A;  3GME A;  2DFH A;  1SAU A;  2EV6 A;  1XDS A;  3EPZ A;  1HOM A;  2P81 A;  4LG0 B;  3QWL A;  4Q47 A;  3HJE A;  2BYV E;  4HF2 A;  2RV8 A;  2DN0 A;  5FLM J;  3ASO H;  3ZN1 A;  1PP7 U;  1ZRF A;  4JX6 A;  3JRD A;  3T0Y A;  4II3 A;  3OL3 A;  3PFI A;  2LDU A;  5FLX K;  3LSG A;  4D0P A;  2XGX A;  3I0T A;  2QEN A;  2EA4 A;  3V7C A;  2A5Y B;  1BI0 A;  1MIJ A;  3CCJ I;  3F8F A;  1FBQ A;  4M6X A;  1H0M A;  3RTR A;  3V8J A;  1S7O A;  4LG3 A;  3BTI A;  2XRN A;  5J1R A;  4LK0 F;  1V54 H;  2X48 A;  4XSX F;  1I1G A;  4EJV A;  2ZME B;  4BEH A;  2D1V A;  4D7M A;  1JHF A;  4HF0 A;  3P9K A;  2ISZ A;  4HAM A;  1WJB A;  1UJ8 A;  1R9T J;  3OYA A;  2OTL I;  3BP8 A;  3K9T A;  2IA1 A;  4UVA A;  2GIZ A;  1PUF B;  2A69 F;  2Z33 A;  5FRM A;  3AG1 H;  3BJ6 A;  3EUA A;  3FWE A;  4I76 A;  2DU9 A;  1MGT A;  3RKW A;  1G6N A;  4K2E A;  2WV0 A;  4KNY A;  2HPM A;  1FBU A;  3RPU D;  4CYD A;  3KP7 A;  1SD5 A;  2M1B A;  3E3V A;  4A3F J;  4HEA 2;  3KP3 A;  1STZ A;  3K10 A;  1BW6 A;  5K1Y A;  3JRI A;  2I10 A;  4ZYD A;  1L3L A;  1KU2 A;  2HDW A;  1WKM A;  3PUF A;  2HDD A;  3BCA A;  3IH2 A;  2R0Q C;  4HST A;  3Q0W A;  3EUH A;  2F5V A;  1BI3 A;  2LH9 A;  3O6B B;  2HYG D;  3RPU A;  4AIJ A;  2PBI A;  3S1M J;  3P9I A;  1ZAO A;  4L5I A;  1D0Y A;  2QQ8 A;  1BN5 A;  3FKJ A;  3HZJ A;  4E7K A;  5EF6 A;  1N75 A;  1S5L C;  2Y30 A;  2Y0M A;  1LE8 B;  4XID A;  2X6X A;  3SXY A;  2IA2 A;  2LBF A;  2YR2 A;  5K5O A;  3GTM J;  3QP6 A;  5F6F A;  3S3O A;  5FFX A;  3CC4 I;  4JX4 A;  9ANT A;  2R5Y A;  2EFP A;  1FBS A;  1U6G A;  4X6A J;  2FBK A;  1SFE A;  2X6O A;  2XKP A;  2ZSH B;  2F4M B;  1X1D A;  3Q5F A;  2BE5 F;  1B1B A;  3ZQL A;  3FHZ A;  5KAF C;  2LY9 A;  2KT0 A;  4HNU A;  5HNF A;  4YIR X;  3D0S A;  4H0E A;  1S72 I;  1LEB A;  4P1W A;  2B7E A;  5B1A H;  2XB0 X;  4Y33 A;  3JAM K;  3F72 A;  4E6K G;  1KU7 A;  5K7H A;  2CW8 A;  3ECO A;  4D5F A;  3WE2 A;  3OYD A;  3J80 Z;  3K4K A;  4AWX B;  1IG7 A;  4BY1 J;  4M3D A;  1D3Y A;  5IP9 J;  1HKS A;  5HLH A;  2H1L A;  1W1W E;  2Z2S B;  3GVA A;  2RNG A;  1QQI A;  2CUJ A;  2F4O B;  2Z99 A;  4EVI A;  2VXZ A;  4NC6 A;  3CCE I;  2EIK H;  1MMA A;  2E1M C;  1TWC J;  1LFU P;  2DFF A;  2PLY A;  2DA1 A;  3K0L A;  4A3I J;  4XKW A;  4A3D J;  4I98 B;  4XKC A;  2DOA A;  1SD7 A;  2WAD A;  3RCO A;  3S1Q J;  4Y7N J;  4R8H A;  4KIT B;  4AVP A;  2UZK A;  4GCV A;  4F55 A;  3ABT A;  3I3L A;  4OWR B;  5GTH C;  2DMQ A;  5IP7 J;  2XGE A;  4P55 A;  3VPR A;  3CC7 I;  3GZ6 A;  3HOU J;  1YIT I;  3V42 A;  2LMD A;  2EIL H;  5B5E C;  2V1X A;  1X3W B;  4EV0 A;  1F36 A;  1IZ1 A;  5LEJ A;  3QU3 A;  2IVM A;  1FX7 A;  2KIM A;  1O3Q A;  4BUP A;  4A3J J;  2XPV A;  2XGC A;  1RI7 A;  5J6X A;  2HZD A;  3FXR A;  1U8B A;  1PP8 F;  1Y1W J;  3M8F A;  2ZKZ A;  1HQC A;  2QBY A;  2R7S A;  1H8A C;  3DPT A;  3CJR B;  3BWG A;  4EM1 A;  3M7G A;  1JT0 A;  3CF2 A;  2L02 A;  2GA2 A;  1ETV A;  4OU0 A;  2K9N A;  1JXS A;  4IXA A;  5BPD A;  4HBL A;  1MH3 A;  1RR8 C;  5TGT A;  2LD5 A;  4JBA A;  3H36 A;  5D5V B;  5K7F A;  2DA4 A;  5H20 A;  1O3S A;  1WVR A;  4AUX A;  2M0M A;  4QLC U;  1JJ8 C;  3BRO A;  1I39 A;  3OSG A;  4MNU A;  2OD5 A;  1SC7 A;  1I6H J;  3KIO A;  4QWQ A;  1ZR4 A;  3TW7 A;  1QGP A;  4M9X A;  4QTR A;  1WH7 A;  2FXA A;  3KYL A;  1TWH J;  4A3C J;  4HX8 A;  4HQM A;  2P8T A;  4RAF A;  2LKP A;  2FE3 A;  2M0C A;  2LYC A;  1S9H A;  1A31 A;  3CCM I;  4JK1 X;  3MQ0 A;  2JA8 J;  2HYJ A;  4A3E J;  5EG0 A;  2IS4 A;  3GX4 X;  3AKZ A;  5HDK A;  1WH5 A;  2CH0 A;  2VBY A;  1WFX A;  1ZG1 A;  3WTT C;  4RGX A;  1CQT A;  4V19 K;  2PMU A;  3UR3 C;  2MG4 A;  1U0J A;  2K85 A;  3LSH A;  1R49 A;  2CQ7 A;  1MBJ A;  4C3J J;  3W2A A;  4HNT A;  2ZC2 A;  2DA5 A;  1FP2 A;  1H9G A;  1Z05 A;  3VYT B;  4RGR A;  3K4N A;  5B1B H;  5LRS A;  3OYE A;  4WK8 F;  2KDO A;  3LMM A;  3CUQ C;  1G59 A;  3E6B A;  4YIF A;  3KYC B;  2D1H A;  3ZP5 A;  2FUG 2;  4BHP A;  1POG A;  4UVB A;  5HLG A;  3TKY A;  2FJ1 A;  2AHQ A;  4XRF A;  3VWB A;  5EJC A;  3FDY A;  2XIG A;  1ACI A;  3HUG A;  3LFU A;  1VZ0 A;  4RB2 C;  3G1M A;  4PSX A;  1YS6 A;  2VJI A;  5D8L B;  5FO5 A;  3ZMU A;  2IGO A;  1FIA A;  5HOD A;  2LR8 A;  4JX5 A;  1NTC A;  4KUM A;  4E4H A;  4YFX F;  1FP1 D;  4ON0 A;  4P96 A;  2LY1 A;  4CGZ A;  1AU7 A;  1T98 A;  1Z1D A;  3MFK A;  3FMQ A;  2KIF A;  2R5Z A;  1VQ9 I;  3S2H J;  2RKH A;  4HG2 A;  3WHC A;  4BGD A;  4PJN A;  3V4G A;  1T56 A;  1KYZ A;  2NAZ A;  3HRS A;  2DYS H;  2IAI A;  4C2M J;  2CV2 A;  2IP2 A;  1TQI A;  1I50 J;  1JT6 A;  1SVO A;  3HYI A;  1JUP A;  2GXB A;  1XB4 A;  2A6T A;  2FOK A;  3F6V A;  3FXO A;  4BL0 B;  3VYS B;  1Y0U A;  1J5Y A;  1DP7 P;  3UNG C;  1NK3 P;  4IL6 C;  5CPR B;  3JR9 A;  3N97 A;  2P5L C;  1GV2 A;  1MJ9 A;  3PL8 A;  2X4H A;  4FE7 A;  2NVQ J;  3EYY A;  3ZQG A;  4GYG A;  2QF7 A;  1JHH A;  2GOX B;  2KFD A;  4PGG A;  3REO A;  5DUI A;  1O7L A;  4CYC B;  1ZTR A;  1E0E A;  1C0W A;  4B3A A;  1AOY A;  3AL0 B;  5E1Z B;  2QSG X;  4N9H A;  2RDP A;  1ORK A;  3BJA A;  2W57 A;  4G7H F;  3HRU A;  4PZJ A;  2ZXH A;  1JTY A;  2GXG A;  2K5C A;  1U3E M;  4C30 A;  5LRR A;  5DD4 A;  3DEU A;  3WU2 C;  4CA0 A;  1ZG5 A;  4LOC A;  1IC8 A;  3JRF A;  1W36 D;  2O61 A;  4IRH A;  2MA3 A;  3ZMD A;  4CCJ A;  1Y8Q B;  5ICG A;  2FML A;  1YOV B;  3SFZ A;  5K5Q A;  2ZCW A;  2P4W A;  3LNQ A;  3MKY B;  1CF7 B;  3GTG J;  1Z7U A;  1W0T A;  1WJ5 A;  1VFC A;  1U5T B;  3OYH A;  1Z3X A;  4XR6 A;  3GBG A;  1W7P B;  3EQL F;  5FKO A;  2ZJR F;  2R7X A;  3BZ6 A;  3ZMS A;  1LPQ A;  1T0F C;  2CYY A;  5LLQ A;  1MMN A;  2W82 A;  1TLH B;  1E2X A;  2CUZ A;  3KFW X;  3FK7 A;  2OBP A;  2VC1 A;  2BW3 B;  5L3D A;  1DU0 A;  1LKX A;  3C2H A;  2HTS A;  1Z9C A;  1MBF A;  3QQA A;  3S17 J;  4ENM A;  3WTS C;  3H5A A;  1G3Y A;  2TDX A;  1FOX A;  1USS A;  2NS7 A;  2QCO A;  3FKI J;  3GTO J;  1PYV A;  3GLX A;  2O8K A;  4N0B A;  2DK5 A;  4RB0 A;  1MMS A;  1GLN A;  2QVO A;  4E7H A;  2EIM H;  1F9N A;  5FD6 A;  1U9N A;  4KIB A;  3R60 A;  3WGG A;  3DXJ F;  2MAB A;  1SEU A;  2GLO A;  1Z21 A;  2PX9 A;  3RQ4 A;  5ICE A;  1K7A A;  5CKT A;  2DMP A;  1HBX G;  3I5U A;  2IXS A;  2FX0 A;  2H09 A;  3C7J A;  2KPM A;  3PJR A;  1ITY A;  1WCM J;  3JCU C;  4MTD A;  3LQQ A;  4A3M J;  2VUM J;  4CZZ A;  1OFC X;  4L9T A;  5EZH A;  2JK3 A;  1XCV A;  2VJ4 A;  4M74 A;  5ED4 A;  4RM2 A;  3M4O J;  1SD4 A;  2DA2 A;  2IS2 A;  4GO1 A;  1ZLJ A;  4II2 A;  4ZYH A;  4MQ9 F;  1VQK I;  2XAQ A;  2A68 F;  3B6C A;  2X85 A;  1RUN A;  2LC2 A;  2HXI A;  2JUC A;  1U78 A;  1BOB A;  2R7W A;  2JPC A;  4UHT A;  3BQZ A;  4PJL A;  2XF6 A;  1ON1 A;  2BY3 A;  2CMP A;  2VI6 A;  3WGI A;  5E17 F;  3SYT A;  3A01 B;  4XM3 A;  4NUB A;  2GWR A;  1I3Q J;  2W4S A;  5C44 J;  2G7H A;  1K6Y A;  3RZO J;  2CSO A;  3IUO A;  2Q2E A;  1SVM A;  1KON A;  3GO5 A;  3BR2 A;  2QSF X;  1XS9 A;  1R58 A;  1SFK A;  1MSE C;  3IH3 A;  2RAE A;  5EDN A;  4ANJ A;  1HW5 A;  1P7J A;  1KU3 A;  5LD2 C;  5H6Q A;  2LTP A;  4YII A;  2JSP A;  4XLN F;  5B66 C;  5HDG A;  1WSU A;  2JRM A;  3I54 A;  4XLH A;  5K5R A;  4M73 A;  1T33 A;  4UVC A;  3TED A;  4UV9 A;  4HZF A;  2NOG A;  3DKX A;  3ZMT A;  2AS5 F;  5AON A;  1W5T A;  2DDA A;  3BZC A;  5DD8 A;  2V79 A;  3BR6 A;  4IPA A;  1XMA A;  3A4C A;  3W6K B;  3L09 A;  4PDK A;  3IAS 2;  2L0K A;  4KA4 A;  3W2W A;  2OUM A;  5DDG A;  2K4J A;  2V1N A;  3U1K A;  1XGS A;  3B73 A;  4IJA A;  3K2Z A;  1P4W A;  1EKE A;  2E1N A;  5E3L A;  3C18 A;  4O3M A;  3BY6 A;  4IHY A;  4P9F A;  1MDM B;  4QSH A;  3M1C A;  2ETH A;  1LDJ A;  1QVU A;  2EFQ A;  3G73 A;  3QOE A;  2Z5U A;  3ESW B;  3BR3 A;  2QM3 A;  4ZZD A;  3K69 A;  2CQX A;  2HTJ A;  1YG2 A;  5F0F A;  3F22 A;  3HBL A;  4PSW A;  3OV8 A;  2STW A;  2F6C A;  1B8I B;  1T08 B;  1WZ2 A;  1IRZ A;  2I8D A;  3AG2 H;  1IAW A;  4A0Z A;  3S3N A;  1XGN A;  2K9L A;  1IXS B;  2OF7 A;  4U0W A;  1NK2 P;  2R92 J;  4M71 A;  3GWZ A;  2KIQ A;  5BPI A;  2M30 A;  2GXA A;  5LGN A;  1I5Z A;  3LA7 A;  2LY2 A;  3TOB A;  1QVT A;  1XSX A;  1AKH A;  5IOZ A;  1YE9 A;  1ZG3 A;  1OCC H;  2X51 A;  1J9I A;  2K86 A;  3OYL A;  2HFH A;  3SZP A;  1V5E A;  2HWV A;  2N8G A;  3WU0 A;  1H89 C;  1LNW A;  5E8I A;  1Z0X A;  3KP2 A;  1H9T A;  2KKO A;  4Y3O A;  2LFB A;  2WV1 A;  2KJC A;  4NB5 A;  1OYI A;  1N78 A;  2QQA A;  2YX7 A;  3I71 A;  3G2B A;  3K4B A;  5F04 A;  1BR1 A;  3BJO A;  3CMM A;  2M8E A;  5L3E A;  5CJ9 A;  2E34 A;  2VE9 A;  2QEX I;  5ERI A;  4D1Q A;  4J00 A;  3I56 I;  3JRB A;  1LUJ B;  4ZTJ A;  1X4P A;  4F91 B;  3G1O A;  4RB3 C;  3HSE A;  4CH7 A;  1K78 A;  1Y1V J;  2W25 A;  3FZV A;  1O3R A;  1JKQ C;  3OYN A;  4U88 A;  1FSE A;  4ZDO A;  3NAR A;  5LHI A;  4BAY A;  2VIX A;  3H9Q A;  1T95 A;  3E5X A;  1R5I D;  4JOM A;  1BBY A;  1RNL A;  2XAU A;  2DFE A;  2GAU A;  2E5Z A;  1BI2 A;  1Q1V A;  3A03 A;  3B02 A;  1B9N A;  3CDL A;  4B47 A;  3A0H C;  5JI6 A;  1HDP A;  1UG0 A;  3C1D A;  2IBD A;  1IN8 A;  5DEQ A;  2VOD A;  2LOO A;  4I0B A;  3WTX C;  3K7A J;  4BXX J;  1ETQ A;  5TIS C;  2DTR A;  1RKW A;  3EUK L;  3OYG A;  1BJA A;  3SHF A;  4L5J A;  3IL2 A;  2VBZ A;  3ZPL A;  1RIO H;  3HL2 A;  4A3K J;  4LD5 A;  2IGN A;  2FNA A;  4FIS A;  2VOP A;  4A6D A;  5CVR A;  5AIQ A;  3WOD F;  3CCL I;  4IHT A;  3BPX A;  5F0H A;  3OS2 A;  1D8K A;  2VQG A;  5CQE A;  4G12 A;  5JHF A;  2EK5 A;  2VN2 A;  1YO5 C;  4KMU X;  2ADU A;  5H6R A;  2X6W A;  2P6T A;  4NBQ A;  1F43 A;  3H3V K;  2CQQ A;  2VL8 A;  4MHG A;  3K6G A;  4MEX F;  4IKF A;  3RDI A;  3P9C A;  3J7A Y;  3KEQ A;  1YW7 A;  2ZJ2 A;  2CQK A;  4FHT A;  1QO0 D;  1O7F A;  4L9V A;  2HVS A;  2E2H J;  6PAX A;  2L9N A;  4HA8 A;  2IS6 A;  4ENK A;  1HLV A;  1TTY A;  5D8K B;  2BHZ A;  3CCS I;  1TWA J;  3U2R A;  4RS8 A;  3WTU C;  3MMY B;  4BXU A;  3TW6 A;  1X1B A;  1K83 J;  5DCF A;  4CIC A;  3ONQ A;  3F3X A;  5E8G A;  4E7L A;  2V9K A;  2OAZ A;  5DM6 F;  3HEF A;  2L9R A;  3HIF A;  3TO7 A;  1ENH A;  4GGG A;  3JSP A;  3ZR8 X;  1W5C C;  4XKB A;  3OYJ A;  3I4N J;  2JA2 A;  1X1P A;  4EGY A;  3HTS B;  2WY8 Q;  5KK1 A;  3E5Q A;  1E17 A;  2XHK A;  4LLN A;  4IEJ A;  5J47 A;  1N25 A;  1ZKG A;  3LAJ A;  1SFU A;  1A5J A;  1S29 A;  2ZXI A;  2DA6 A;  3CO6 C;  5HLT A;  1R6R A;  1YHQ I;  5JVT A;  2OCE A;  2E36 A;  5KCM A;  2EZL A;  4DZP A;  1R23 A;  3QPT A;  4EM0 B;  1S3J A;  2HNH A;  1SMY F;  1ULY A;  2X6Y A;  4XLP F;  4LIU A;  2QLZ A;  2CW7 A;  1NHA A;  1GV5 A;  4XBF A;  2XRL A;  4WXC A;  2ZME C;  1ZAR A;  4CCO A;  3CZ6 A;  3J7Y J;  2HGC A;  3KE2 A;  3CUO A;  3L2R A;  4BBS J;  3BTC A;  2GBY A;  3BR5 A;  1YW9 A;  5H2F C;  4U7B A;  2YPR A;  4DBQ A;  1ETO A;  4KMF A;  1LVA A;  4LJZ F;  2FRH A;  4YFN F;  3HRT A;  4BQA A;  1BIA A;  1ZK8 A;  1UST A;  2YU3 A;  3NRV A;  5BQT A;  2WTE A;  2MLK A;  1EJ9 A;  4WX9 A;  3FXM A;  5D4R A;  2PJP A;  5IYC J;  4B43 A;  4B3X A;  2CUF A;  3O8H A;  5LHG A;  2JUG A;  2VXD A;  3ZQH A;  3MAJ A;  5F64 A;  1BR4 A;  5L3G A;  4KDP A;  1ZGJ A;  1TQM A;  5AIP A;  1IDZ A;  2W85 A;  3IWF A;  4QPQ A;  4BEH B;  1D0X A;  2Q1Z B;  2CGP A;  2XF7 A;  2WB1 A;  2A6H F;  3GFJ A;  4R1H A;  5GTI C;  3QOP A;  1VQ7 I;  3DPL C;  4M3F A;  2QZ8 A;  2ZXJ A;  1TW2 A;  4ZDL A;  4CO8 A;  2EJR A;  3RYR A;  4DYR A;  1TQP A;  2OA4 A;  1Z77 A;  2V1U A;  4CCN A;  3C2G A;  1JKR C;  4XSZ F;  2ELJ A;  1W4M A;  2JA6 J;  2OQR A;  3FXK A;  5D5X B;  4G7O F;  3KEY A;  2X1C A;  2UUZ A;  4CDG A;  3CUQ A;  4ESJ A;  3W2V A;  1MD0 A;  2BV6 A;  3TQN A;  4M6Y A;  3MZ8 A;  5TJJ A;  3RJP A;  4E70 A;  1DPU A;  2FBH A;  1MKM A;  2OU2 A;  3DBR B;  1LFP A;  3E6C C;  1HDD C;  3H3Z A;  1UEL B;  3TL4 X;  5LGT A;  3PUB A;  4PCQ A;  4ABZ A;  1OCO H;  2QA4 I;  4I0A A;  4WXD A;  3FBI B;  1XN7 A;  1TW3 A;  3GUD A;  2KDZ A;  4BBR J;  3R6S A;  1T2K A;  2PN6 A;  2F48 A;  3GEZ A;  2R7U A;  3OYM A;  4XL9 A;  2RN7 A;  4I6Z A;  2Z1D A;  2WC2 A;  4FX0 A;  4GXO A;  1R5G A;  4OIR F;  1AWC A;  3E6M A;  1IN4 A;  3A02 A;  2R5Y B;  1WI3 A;  2W24 A;  1B72 A;  5LFA A;  1PJR A;  3VOD A;  3H5R A;  1FTZ A;  3D5R C;  2H6B A;  3GXO A;  1YJW I;  5FD5 A;  2NS8 A;  4LB6 B;  4KFC A;  1T8I A;  1I3A A;  2QGU A;  2DBB A;  1SMT A;  1D0Z A;  1IXR C;  5BNG A;  4PUS A;  3FXQ A;  3H9J A;  2PJR B;  2K9S A;  5D6F A;  4P9U A;  1YX5 A;  2L7Z A;  4IF4 A;  4BNC A;  3ASN H;  3ERM A;  2M45 A;  1B6A A;  2IS1 A;  1QRY A;  2VT3 A;  1R4N B;  3H3U A;  3F23 A;  2JMW A;  1WQ2 A;  3JTG A;  1MZB A;  2XPW A;  1RC9 A;  2EH3 A;  3VDX A;  1J0R A;  3M07 A;  5BMZ A;  1LDK B;  3S1R J;  2NVY J;  3GTK J;  4DYC A;  2MFZ A;  2XSD C;  2K4B A;  4BQO A;  1HC8 A;  4ZDP A;  2BXZ A;  2E5N A;  3OR1 C;  4BXF A;  3VSK A;  2K9M A;  2VKD A;  2LKX A;  2JWT A;  3K70 D;  3FXJ A;  3ML6 A;  3GW2 A;  3R61 A;  3H0D A;  3QPS A;  1K79 A;  2HDC A;  2O5R A;  1FSH A;  2G9W A;  2ZNZ A;  4RM3 A;  2QUF A;  3KLO A;  2L7K A;  2P6S A;  2X1D A;  2E60 A;  1VQ6 I;  3WG9 A;  2M2E A;  3K1M A;  3KP5 A;  4UV8 A;  3ERE D;  2IT0 A;  4IOC F;  3I4P A;  2QBY B;  2ZSI B;  2MC3 A;  3MKL A;  2V9P A;  4UY8 I;  4BHB A;  3L2C A;  1FNN A;  1JUS A;  4RBO A;  3FHN A;  4EAT A;  1J09 A;  5J4Y A;  1T0F A;  3CES A;  1IW7 F;  1RKT A;  5EGO A;  1K4S A;  1BI1 A;  3VB2 A;  1REP C;  1DGR M;  3HDD A;  3PO3 J;  4HQE A;  1NG6 A;  2EPF A;  1I27 A;  1XGO A;  1OR7 C;  1Z67 A;  2XDV A;  4U7D A;  2O6G E;  3BG5 A;  3DF8 A;  3JW4 A;  1P7I A;  4OIQ F;  2JQ7 A;  4BS9 A;  1UHM A;  3Q0V A;  3JRE A;  2F5F A;  3PNV A;  1ETK A;  2K40 A;  1Z6R A;  2J5P A;  5DCM A;  1MBH A;  2D5V A;  2E2J J;  4S05 A;  1R5H A;  4GFB A;  2Y9Y A;  1FZP B;  4IQ4 A;  3BT9 A;  1WI9 A;  2XAF A;  1YTY A;  3JRH A;  5GAH J;  1R1T A;  4HV5 A;  4YRV A;  2W48 A;  5E3M A;  1S8N A;  5EG0 B;  2PG4 A;  2BY0 A;  1YS7 A;  5HOO A;  1FEX A;  3KPH A;  4RLQ A;  4A2U A;  2L4A A;  1Q1H A;  2HR3 A;  3IHU A;  4U0V A;  2K27 A;  1K6O A;  5E79 C;  1IV8 A;  1BW5 A;  2CU7 A;  5GAD J;  5DTD A;  3M1E A;  2WAE A;  2E1C A;  1HXD A;  1OKR A;  3HPG A;  1TT0 A;  4RDU A;  4IVN A;  4DW6 A;  2V7F A;  2ESH A;  3FIW A;  3OWT A;  2EFO A;  2OV7 A;  2BVL A;  5HNH A;  1YJN I;  3WGH A;  2R7T A;  3AFH A;  1IRG A;  3RZD J;  2DT6 A;  2ISY A;  2GQQ A;  2PMZ A;  4C3I J;  3QYE A;  5LEK A;  1SAN A;  5CYV A;  2MW8 A;  3R4K A;  1TWF J;  3JSO A;  2FD5 A;  1OCR H;  1MSF C;  1QBJ A;  1KU9 A;  1I1S A;  4RMN A;  3V8L A;  4OIP F;  1IV6 A;  1JI8 A;  4A0Y A;  3HUG B;  4G7Z F;  2KP6 A;  3RSN A;  1EH7 A;  2X1E A;  4A6E A;  4ZZL A;  2XC7 A;  3U21 A;  1SFO J;  4CZC A;  3V8K A;  5LHH A;  2V6C A;  1FC3 A;  4Y4R A;  1ZN2 A;  3ZXS A;  2DXI A;  5DM7 F;  3DBH B;  1YW8 A;  2DTZ A;  4OOI A;  4HLY A;  4AID A;  2R5Z B;  4B8X A;  4C9Y A;  3BC8 A;  3HOW J;  2D45 A;  3HKZ A;  3L1P A;  3GFI A;  4NDL A;  2DPD A;  1R4M B;  3ROU A;  1D5Y A;  3JRC A;  4A93 J;  5E18 F;  2CO5 A;  1SFX A;  1V3F A;  2KRF A;  2F5D A;  4G9Y A;  4LLG F;  1R00 A;  1UZC A;  2HEO A;  1R22 A;  3AL0 C;  4ESF A;  3HGY A;  3DBL B;  3CCR I;  2ECB A;  1XSD A;  4A5M A;  1Z3Y A;  4MFE A;  5FRO A;  5KAI C;  3TGN A;  4KYW A;  3NQO A;  4A69 C;  3HPH A;  2AQF A;  1VQ8 I;  4NHJ A;  3CMA I;  3PM1 A;  1PUE E;  2MD0 A;  2WY7 Q;  2ME6 A;  2NVT J;  4E7Z A;  2I5U A;  3I59 A;  4ZC3 A;  4RAG A;  1X58 A;  2LVS A;  1TWG J;  3FX3 A;  4A12 A;  3IAM 2;  1UHS A;  5F1R A;  4F92 B;  1U5T C;  5KNL A;  2VLA A;  1O3T A;  3FXU A;  2L2O A;  3CCQ I;  3N4M A;  2YSR A;  4BDZ A;  2HKX A;  4FCY A;  4XON A;  2JA5 J;  3ISP A;  3CDI A;  4MTE A;  1Z7L A;  5GP9 A;  3GZN B;  4A3G J;  2XGD A;  3G4S I;  2GM4 A;  3BG9 A;  2HXO A;  5DS9 A;  1ETX A;  3VFZ A;  2NNN A;  3L7W A;  3A2K A;  1YIO A;  5KVR A;  1ZH5 A;  1YRN A;  2XVC A;  4UUS A;  2LF8 A;  2CS3 A;  2YUS A;  2QYO A;  2WAF A;  1SVL A;  4RB1 A;  2DMU A;  3S93 A;  4HX7 A;  3K4J A;  4CXF A;  4CCM A;  2ZNY A;  3FMR A;  5M5Y J;  2TCT A;  4QPO A;  4DNC A;  5L3F A;  5J40 A;  3T1B A;  2HKO A;  4S04 A;  1E3P A;  4BQN A;  2BOL A;  4KIS A;  2ZB9 A;  3HTU A;  3HOS A;  4KIF A;  1APL C;  4IRI A;  4M9Z A;  3ZGK A;  3FK6 A;  3NAU A;  3KZI C;  4HDV A;  3QYB A;  5FB2 A;  5IOY A;  2K3P A;  4IQJ A;  4IRG A;  1HKT A;  2E7W A;  4JP0 A;  5JLW A;  4UB8 C;  4G8X A;  2WAQ N;  2L5Q A;  2E2I J;  3E5U A;  4Y17 A;  3QYF A;  4DZJ A;  1IXC A;  5FKK A;  3AG3 H;  3ABM H;  1Z6T A;  2MC4 A;  2QQ9 A;  4BYY A;  3TDU C;  4XRM A;  5IYB J;  3F21 A;  4FX4 A;  2BXY A;  2JRT A;  3RPQ A;  4B1R A;  3IKT A;  2OTJ I;  2BEO A;  2XKO A;  5TRD A;  2L3D A;  1MBE A;  4BHC A;  2JN6 A;  4LIV A;  3J81 K;  3LFK A;  3U1D A;  3BQY A;  4WCG A;  2F5E A;  3HM5 A;  1OPC A;  1OLT A;  1TC3 C;  4GDF A;  3I64 A;  3H9G A;  1FYL A;  1KYW A;  1P6R A;  4Q5S F;  4WWC A;  2KMU A;  2H8W A;  2NVU B;  1QZE A;  1W36 C;  1LFB A;  4I2O A;  3LSK A;  3QAH A;  5ICC A;  4KIC A;  4XKV A;  5A2Q K;  5E1W A;  1A04 A;  1Y8R B;  1O4X A;  2DOE A;  4NQW A;  1RZ4 A;  4AM3 A;  5ILS A;  4C2T A;  3DTI A;  3O2P E;  4HSR A;  3CLQ A;  1G3S A;  2QKL B;  4BJT A;  2VT2 A;  4WXH A;  5FLV A;  2XF5 A;  1WJC A;  2K9Q A;  2Q0O A;  2Q2E B;  1W0U A;  1SAX A;  1F4K A;  4HF1 A;  2DJN A;  2CV1 A;  4OAZ A;  4OIO F;  3BG7 A;  1QHG A;  4I7H A;  4HYE A;  4FET A;  4MGR A;  3I55 I;  2MD5 A;  1KQ8 A;  2X0L A;  3AG4 H;  3BCB A;  4ZH4 F;  4A3B J;  4L9J A;  2M87 A;  1HW1 A;  5LBQ A;  4Y52 J;  4Y15 A;  4OAY A;  3PSF A;  3LAP A;  1R1V A;  4IO9 F;  1R36 A;  4XMY A;  2HS5 A;  3FXL A;  3CDH A;  2ELH A;  5FGM A;  1WJD A;  2DA7 A;  1IN6 A;  2VBW A;  2A6E F;  3GLL A;  4LGW A;  4XN0 A;  3ZMZ A;  3K4M A;  1BL0 A;  2OC6 A;  1EV7 A;  4MEY F;  5DV5 A;  2HQA A;  3TO6 A;  2RVC A;  3G6E I;  1TBX A;  5J1Y A;  1ETW A;  4IHS A;  1YJ9 I;  2L01 A;  3G3Z A;  1BC8 C;  1KQ9 A;  1W5S A;  5IT9 Z;  2RC4 A;  1OYW A;  2EFN A;  3DEW A;  1XX5 A;  2DO7 A;  2DMN A;  5CQG A;  5EEG A;  3LSJ A;  4BE1 A;  5J8C A;  1QPI A;  4C2U A;  5GPC A;  2PEX A;  3OR2 C;  5D5W B;  3MVP A;  4BJ5 C;  3J7Z I;  2WAQ A;  1ZRC A;  2DOF A;  5F1J A;  1JGG A;  4LG0 A;  2CG4 A;  2OQG A;  3I53 A;  4W97 A;  3LSR A;  3K2A A;  2V6E A;  2JT1 A;  3KCC A;  2IW5 A;  1XTA A;  3CJQ B;  2O03 A;  4Z6Y A;  3KP6 A;  2R3S A;  2H8R A;  2RQP A;  5D6E A;  4A3L J;  2CWE A;  4BE2 A;  2HOT A;  1YX3 A;  2ECC A;  4ESB A;  3DLA A;  1IN7 A;  1IDY A;  1V5G A;  3LST A;  3PNY A;  1IF1 A;  1AA7 A;  3EET A;  1O57 A;  3I4M J;  1IRX A;  1BM9 A; 
#chains in the Genus database with same CATH homology
 1NTC A;  4DYR A;  3BTL A;  1Z77 A;  1G2H A;  4EEF G;  1K61 A;  1GT0 C;  1AU7 A;  1JKR C;  3S2H J;  2R5Z A;  1MH4 A;  2JA6 J;  3WHC A;  1T56 A;  1B8I A;  1VF9 A;  2IAI A;  4C2M J;  1AKH B;  1JKP C;  4M3B A;  1I50 J;  1JT6 A;  1PUF A;  1JUP A;  5J1U A;  1ZQ3 P;  3B6A A;  4V2F A;  2JA7 J;  1HDD C;  5IPA A;  1NK3 P;  4M3G A;  3JRA A;  3JR9 A;  4ABZ A;  1GV2 A;  1JKO C;  3S15 J;  4FE7 A;  2NVQ J;  2MSY A;  3ZQG A;  2KDZ A;  4L5E A;  2QF7 A;  2E19 A;  2COB A;  4BBR J;  4CYC B;  1ZTR A;  4AC0 A;  2HOS A;  5IYD J;  1H88 C;  4B3A A;  4I6Z A;  2WB1 N;  1E3O C;  2E1O A;  1A6I A;  3HOX J;  3A02 A;  1ORK A;  2EZI A;  2R5Y B;  5E3N A;  3UKG A;  2DMT A;  1BA5 A;  1WI3 A;  1XC5 A;  3LSP A;  1S7E A;  1JTY A;  1B72 A;  1LE8 A;  1FTZ A;  1GVD A;  3OOU A;  3HOZ J;  1YRN B;  1JUM A;  3TP3 A;  1XG1 A;  2EQR A;  2L7M P;  2NS8 A;  4UUS B;  4XIC A;  3H0G J;  4LOC A;  1IC8 A;  3JRF A;  2M9H A;  5M5W J;  1EF4 A;  1IUF A;  2CRG A;  5BNG A;  2K9S A;  1X2N A;  2L7Z A;  1RR7 A;  3LNQ A;  5C4X J;  4S0H B;  2O9L A;  3BG3 A;  3GTG J;  4J19 A;  1QRY A;  1W0T A;  1VFC A;  4MIM A;  3GBG A;  5FKO A;  2Y9Z A;  2CUE A;  4BKX A;  2M8G X;  2JMW A;  2NVX J;  3S16 J;  2G0E A;  2XPW A;  2EH3 A;  3S1R J;  3FK7 A;  2NVY J;  4HNV A;  4DYC A;  2XSD C;  3GTK J;  4JYK A;  1DU0 A;  3ZQC A;  1MBF A;  2LLK A;  3QQA A;  3S17 J;  3CMY A;  2B63 J;  3HOY J;  5IP6 A;  3M3Y J;  2LKX A;  2NS7 A;  2QCO A;  2JWT A;  3FKI J;  3QPS A;  2VKV A;  3GTO J;  1X2M A;  2O8K A;  2LP0 A;  2CJJ A;  3MN2 A;  2JJ7 A;  1U9N A;  2GLO A;  3HOV J;  2M2E A;  4V2G A;  2DMP A;  2EZH A;  3MKL A;  4UUT A;  2FX0 A;  1JUS A;  4RBO A;  1ITY A;  1WCM J;  5EGO A;  1RKT A;  3HDD A;  5FKL A;  4A3M J;  2VUM J;  3PO3 J;  4DYQ A;  1OFC X;  5EZH A;  2JK3 A;  4IHX A;  3ZOB A;  5F27 A;  3M4O J;  1GDT A;  2XB5 A;  2DA2 A;  3BG5 A;  1BJZ A;  2AO9 A;  3B6C A;  1P7I A;  1WGX A;  2HXI A;  1JTX A;  1U78 A;  3Q0V A;  3JRE A;  5M5X J;  1ETK A;  5K7Z A;  2K40 A;  3BQZ A;  2D5V A;  3W6V A;  1MBH A;  5EEA A;  2R93 J;  2EBI A;  2E2J J;  3ZQI A;  4GFB A;  3HGG A;  2VI6 A;  2Y9Y A;  3A01 B;  2H1K A;  1I3Q J;  3BT9 A;  5C44 J;  3GTJ J;  3JRH A;  3RZO J;  2Y0S N;  2W48 A;  5E3M A;  5EG0 B;  3RKQ A;  1FTT A;  3BR2 A;  2VPR A;  1XS9 A;  1MSE C;  1FEX A;  1JJ6 C;  5GPA A;  2R7Z J;  2Y31 A;  3IH3 A;  2RAE A;  3GTL J;  3GTP J;  5EDN A;  1P7J A;  1U9O A;  2ID3 A;  4D5C A;  2LTP A;  1RET A;  2CU7 A;  1BW5 A;  5DTD A;  3PO2 J;  1T33 A;  1VND A;  3E7L A;  4BY7 J;  3BR1 A;  4RDU A;  3TED A;  4IHV A;  1GUU A;  2O7O A;  3HB9 A;  2NOG A;  4DW6 A;  3FIW A;  4B4C A;  4QIW N;  3BR6 A;  1ZGW A;  1HOM A;  3RZD J;  2P81 A;  1VI0 A;  5EZG A;  3SFI A;  4C3I J;  2L0K A;  1SAN A;  3S14 J;  2HOA A;  2DN0 A;  2MW8 A;  1TWF J;  5FLM J;  2FD5 A;  1HCR A;  1MSF C;  4JX6 A;  3JRD A;  1WPK A;  5F08 A;  3LSG A;  1IV6 A;  5E3L A;  4IHY A;  1SFO J;  2M34 A;  4QSH A;  1QVU A;  5F0C A;  1OCP A;  3BTI A;  2ME0 A;  5J1R A;  3BR3 A;  2X48 A;  1ZR2 A;  2DTZ A;  1DU6 A;  3BR0 A;  2CQX A;  5F0F A;  3HBL A;  4D7M A;  2R5Z B;  3HOW J;  3S1N J;  1B8I B;  1IRZ A;  3L1P A;  1R9T J;  3RQI A;  4NDL A;  2DA3 A;  1D5Y A;  3JRC A;  4A93 J;  1PUF B;  2OF7 A;  3LOC A;  1NK2 P;  2R92 J;  4I76 A;  3HGY A;  3IV5 A;  1QVT A;  1AKH A;  5IOZ A;  3JRG A;  2ECB A;  5E3O A;  1F43 A;  1OJL A;  4MFE A;  4AYB N;  2PMZ N;  4XRS A;  4A3F J;  2N8G A;  1BW6 A;  2LK2 A;  4A69 C;  3JRI A;  2I10 A;  1H89 C;  1Z0X A;  4XRS G;  2LFB A;  3PM1 A;  2WV1 A;  2HDD A;  3IH2 A;  2ME6 A;  3WHB A;  2R0Q C;  2NVT J;  1X58 A;  2LVS A;  3Q0W A;  1TWG J;  5F04 A;  1IGN A;  1UHS A;  4MO7 A;  3S1M J;  5FKM A;  3JRB A;  5EF6 A;  4CYC A;  3CCY A;  1B72 B;  2Y30 A;  3Q0U A;  3G1O A;  1LE8 B;  4XID A;  3HKZ N;  4FCY A;  1AHD P;  2JA5 J;  3GTM J;  5JLX A;  1Y1V J;  5GP9 A;  1JKQ C;  4A3G J;  4JX4 A;  2XGD A;  9ANT A;  2GM4 A;  4IHW A;  2R5Y A;  3BG9 A;  2HXO A;  4MLO A;  5DS9 A;  5M3M J;  3G1L A;  5C4J J;  1ETX A;  4X6A J;  3TP0 A;  2X6O A;  1HF0 A;  3NAR A;  3OSF A;  1YRN A;  3ZQL A;  4UUS A;  2LY9 A;  1MNM C;  5FJ8 J;  2KT0 A;  2YUS A;  1MBK A;  1Q1V A;  2XB0 X;  3A03 A;  2IEK A;  3CDL A;  2HI3 A;  2DMU A;  4FE4 A;  1HDP A;  5K7H A;  2ID6 A;  2IBD A;  3F0C A;  4D5F A;  1MBG A;  1IG7 A;  3FIS A;  5M5Y J;  3K7A J;  4BY1 J;  4M3D A;  1ETQ A;  2TCT A;  5IP9 J;  3S2D J;  4BXX J;  1RKW A;  2ZB9 A;  4A3K J;  1TWC J;  1LFU P;  2DA1 A;  1ETY A;  5M3F J;  4FIS A;  4A3I J;  4A3D J;  3SJM A;  1APL C;  5F0H A;  3S1Q J;  4Y7N J;  3FK6 A;  3NAU A;  4G12 A;  5IOY A;  3O8G A;  3IH4 A;  2Y2Z A;  2X9D A;  4W1U A;  4JP0 A;  5JLW A;  2WAQ N;  2E2I J;  2DMQ A;  5IP7 J;  2XGE A;  3VPR A;  4DZJ A;  1IJW C;  2CQQ A;  5FKK A;  3H3V K;  3HOU J;  3C2B A;  4XRM A;  5IYB J;  1F36 A;  4B1R A;  4A3J J;  2E2H J;  2XPV A;  1MBE A;  2XGC A;  3SDG A;  2JN6 A;  5EYR A;  5EGO B;  2YS9 A;  1U8B A;  3BQY A;  1Y1W J;  4M3E A;  3CQZ J;  3HM5 A;  1HLV A;  1TC3 C;  1H8A C;  2VKE A;  3Q3S A;  1JT0 A;  1LFB A;  1FIP A;  1TWA J;  2EZK A;  1ETV A;  2K9N A;  4X1E A;  1MH3 A;  3TW6 A;  1K83 J;  2LD5 A;  1O4X A;  5C3E J;  3ZQF A;  5K7F A;  2DA4 A;  2YU9 J;  5FKN A;  4AUX A;  1JJ8 C;  3HEF A;  2L9R A;  3OSG A;  1ENH A;  4C3H J;  3D1N I;  1I6H J;  5FLV A;  2K9Q A;  2TRT A;  1UG2 A;  1ZR4 A;  3I4N J;  3TW7 A;  3GTQ J;  4QTR A;  1W0U A;  1WH7 A;  2DJN A;  1TWH J;  2FQ4 A;  4A3C J;  3A01 A;  2OPT A;  2HQ5 A;  3OIO A;  4IEJ A;  1ZKG A;  1A5J A;  4A3B J;  2M0C A;  4Y52 J;  2L7F P;  1RPW A;  2DA6 A;  2JA8 J;  2HYJ A;  4A3E J;  5EG0 A;  1WH5 A;  1UMQ A;  3QPL A;  2DA7 A;  3DCF A;  2EZL A;  4DZP A;  3BTJ A;  1CQT A;  1BL0 A;  1RES A;  5J1Y A;  4D7N A;  1ETW A;  2MG4 A;  1GV5 A;  2ELK A;  2XRL A;  1MBJ A;  4C3J J;  3DEW A;  2DMN A;  3LSJ A;  2DA5 A;  1QPI A;  5GPC A;  3MVP A;  4BBS J;  3BTC A;  2GBY A;  3BR5 A;  5F1J A;  1ETO A;  5J3L A;  1JGG A;  4FTH A;  4W97 A;  3LSR A;  1POG A;  3K2A A;  1ZK8 A;  1OCT C;  2MGQ A;  2FJ1 A;  2AHQ A;  2H8R A;  5IYC J;  4XK4 A;  2CUF A;  3O8H A;  4M6V A;  4A3L J;  3ZQH A;  2HOT A;  4MFD A;  2ECC A;  3G1M A;  1IDY A;  1IDZ A;  2XPU A;  1FIA A;  3I4M J;  5HOD A;  2LR8 A;  4M3F A;  1FJL A;  4JX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...