1XN7A

Solution structure of e.coli protein yhgg: the northeast structural genomics consortium target et95
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGSCKSCPEGKACLREWWALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of E.Coli Protein yhgG: The Northeast Structural Genomics Consortium Target ET95
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yhgG
total genus 13
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xn7A00
5LGNA 4LMYA 5AIPA 2P7CB 4M6XA 2EV0A 3M7GA 1A04A 1BM9A 2EFOA 3QAHA 1Z05A 1H9TA 3E5QA 4EM2A 1HW5A 3U1DA 4HBLA 1LVAA 1JHFA 3BY6A 4QLCU 4HF2A 4MTEA 2FRHA 4RGRA 3MZYA 2JSCA 2D2WA 5DYMA 4BYYA 3B73A 3WTUC 3LWFA 3RYRA 2MLKA 3LA2A 4BAYA 4A6EA 4D0PA 4RGSA 4CZZA 3NQOA 3WTZA 4UV9A 2LF8A 3F23A 4A0ZA 2IJLA 2FBIA 1BIAA 1OYIA 1RZ4A 4Q47A 2P4WA 3WU1B 3TO6A 1XDSA 5J8FA 3JTGA 4KN4X 3M1EA 5AIQA 2QM3A 2QVOA 5BS6A 1IXSB 3O2PE 1UFMA 2IA0A 1TTYA 1WKMA 1HBXG 4CYDA 1PP7U 2OA4A 3HRUA 4EJWA 4I7HA 3KEOA 4DNCA 2YX4A 4RB2C 1SAXA 1W7PD 2H94A 2EV6A 1P4XA 3V7CA 3SZPA 4RB3C 1ZREA 5CLSA 3TDUC 4N9HA 4A6DA 2H27A 1FSHA 3CO6C 4OU0A 4EQQA 2HWVA 1HXDA 5CVJA 3HYIA 4IPAA 1ONVA 4M9SA 3R6SA 4OMZA 4UVBA 3MQ0A 3DP7A 2L3DA 3K1PA 3W6JB 1ZHFA 3EQLF 2KKOA 4O6JA 1OPCA 3ZMDA 1IN7A 2K02A 1HSJA 1B4AA 2VOOA 1H0MA 3GWZA 4EJVA 5BQTA 2V79A 3GLXA 1Y0UA 3REOA 4MNUA 3LAPA 1KU2A 4IF4A 3T0YA 4LB5A 2VODA 1MDMB 2OQRA 1B9MA 3FMSA 5ILVA 4CICA 6PAXA 2MH9A 1FNNA 3TDZC 2VBYA 3TGNA 4Q4ZF 5L3GA 4M9ZA 5DEQA 2FF4A 2VBXA 4MQVA 3RI4A 1O3TA 1WI9A 4K2EA 4LG0A 5DCMB 1R22A 1GHCA 4JBAA 4AIKA 3BJ6A 2VC1A 3ECHA 4LK1F 4XLNF 4YFXF 4OMYA 2HGCA 4EJUA 4QWQA 3FM3A 4HZFA 2B0LA 3GVAA 2K86A 4A2UA 4I09A 5TRDA 4I02A 3ZMUA 2W84A 4KN7X 4PCQA 1YS7A 3O6BB 2CGPA 2XAFA 5ICEA 3F8FA 2MA3A 2IVMA 1ZAOA 2A6HF 4EJOA 3FM5A 4YFKF 2QBYA 3I59B 3D0SA 4E70A 1FLIA 5LHHA 1MGTA 2XAGA 5FD6A 1YLFA 2W24A 1FOKA 4PGHA 3QOPA 3CJNA 4M74A 2XROA 2BE5F 4Q48A 3I0TA 3GEZA 5LGUA 2P5LC 3KLOA 2Q8KA 1QZYA 2O3FA 2MLGA 5HVQC 2ZFWA 5ICCA 2PBIA 1IUYA 5F1RA 3EUHA 5ERIA 2XHKA 4CDGA 4G7ZF 5L3CA 5HS8A 3D5LA 4Y13A 1EH6A 1IN5A 1ON2A 1JHHA 3HRSA 1FYKA 4GYIA 2A61A 3MFKA 3GX4X 3E5XA 1HQCA 2ISZA 4Z2YA 1F9NA 1MJ9A 4EV0A 3GFJA 1ZLJA 5D8KB 2XRNA 1HW2A 5HLIA 3F8MA 1FC3A 1K6OA 1SD6A 3BOQA 5ICFA 3CLOA 3BJAA 5L3EA 4XSXF 1T38A 2VE9A 5EEGA 3U9GA 2VXZA 2EFPA 1YYVA 3EDPA 1HSTA 4P55A 3ZQ7A 2NNYA 3GZ5A 4EM0B 2A6EF 3HOSA 5BMZA 2E7XA 3BJOA 4IRGA 4NB5A 4UXNA 4ENMA 4U88A 2KIUA 4N0BA 1F1ZA 3FWEA 4HF1A 3F3XA 2XAHA 5D8LB 2OU2A 3RPUA 4BNCA 3KZYA 3EETA 2ZMEA 3MAJA 2QLZA 2Z33A 2GWRA 1G4DA 2AXLA 1LB2A 2V1XA 1IXCA 3EYIA 2F5EA 1O57A 3DPLC 2XASA 3KE2A 3IWFA 1RUOA 3FMRA 1K78B 2R3SA 2VBZA 2GXGA 4DQ2A 2D1VA 4HA8A 3SQNA 1HKSA 5CYVA 3BPXA 1TNTA 1Z1DA 4IHSA 1XGOA 3CDHA 1QPMA 1Z91A 5J8CA 4LLLA 1ZLKA 4LLGF 3BZ6A 2DI3A 1FPQA 3J80Z 4WX9A 1LNWA 1ZG5A 1USSA 1TQPA 2FU4A 1S7OA 3L7WA 5E1ZB 2DPDA 4S04A 4RS8A 2VT2A 3VFZA 3PQJA 2IT0A 4ZH4F 5LGTA 2IW5A 2H6BA 4BH9A 3RKXA 4NHJA 2GQQA 1O3QA 2G9WA 3JAMK 2DU9A 2K4JA 3K69A 4MGRA 3IRQA 2WWYA 4G7HF 4R1HA 5L3DA 2NRAC 2CG4A 2KIFA 2C6YA 4KIBA 3ECOA 3JSOA 2XUBA 1FBSA 4I01A 2PMUA 2EJRA 2K27A 2IA2A 3H92A 2BEOA 2Y0MA 4FX0A 1K78A 3HHHA 4HV6A 3V7SA 2HTSA 3J81Z 1NHAA 2HTJA 4IXAA 3IWZA 3L00A 1KQ8A 4YIIA 2D1HA 3IL2A 3M8FA 2EK5A 2W57A 3C18A 2XVCA 1RIOH 2ETHA 1Q1HA 1Z6RA 1ZG3A 5JR3A 4RGXA 5FLXZ 1MZBA 1KU9A 2QUFA 3CUQB 5D5WB 1ZRDA 2HKOA 1XSVA 4U7DA 5HDKA 4EMSA 1J9IA 1XD7A 4RAZA 1U3EM 2DFIA 2FE3A 1J0RA 2P7VB 4YIFA 3CUOA 4KICA 1IF1A 1FX7A 4LK0F 5D5VB 2JTVA 2ISYA 3FXQA 4I0BA 5E8GA 1IAWA 1SFEA 3DEUA 3P9IA 4LJZF 4UV8A 1ZARA 2W85A 4I98B 2GA1A 4P9FA 5K5OA 3T8RA 3KP2A 4RB1A 2F5DA 1OR7A 3E6MA 1G6NA 3TO7A 1O7FA 2G7UA 5D5UB 2PQ8A 3P9CA 5D6FA 2WV0A 3CUQC 3GFMA 1W5SA 3WTVC 4HDUA 4PDKA 1R1TA 4ZYHA 1ZN2A 1D5VA 2EFQA 2L54A 2VONA 2LDUA 2P5VA 3L09A 2NS0A 5LRRA 3BPVA 3V8JA 2R7FA 1T98A 2Q2EA 2WC2A 4WF2A 1SD5A 1BN5A 1UCRA 1ODDA 1R7JA 5FB2A 3IKTA 2LF7A 2UWMA 1R5HA 2OZ6A 3ZN1A 3M8EA 3GXOA 2EV5A 1LEAA 2NYXA 1FZPB 4HYEA 4F7ZA 3IC7A 3FF5A 4KDPA 3ELKA 3O3KA 1MKMA 5FFZA 3GO5A 3J81K 2M87A 4ZZDA 4BQAA 1USTA 3Q5FA 4M9XA 2YSRA 3WGHA 1W5TA 1T6SA 2RVCA 1EH7A 2OD5A 1DP7P 4OIQF 1BJAA 2Z99A 1DDNA 1FYLA 4Y15A 1XGSA 2EWNA 4EVIA 1B6AA 1SD4A 4ZYEA 1F5TA 4BHCA 4UUVA 5DDGA 4MEXF 2DO7A 2K4BA 5DV5A 3E3VA 1MJBA 3T8TA 1KQ0A 1PUEE 4BHBA 3B02A 2COMA 1QBJA 2FA5A 3GW2A 1IN6A 3Q9VA 1WRJA 4EGYA 3F6VA 2JRTA 4HF0A 5E17F 1XCBA 3Q9SA 2O0YA 4I2OA 2GIVA 2A69F 4ASNA 5FFXA 1R5GA 1XMAA 1PP8F 1UB9A 3QPHA 3P7NA 4G9YA 3COAC 3DQVC 3E97A 1G3TA 1OKRA 4WCGA 4L0ZB 4KNYA 2VE8A 3V7RA 2PI0A 4IVNA 2FOKA 4TV7A 2J5OA 4L0YB 2J5PA 1WQ2A 3QU6A 2ZXJA 5D4RA 3C1DA 2E7WA 5CVUA 4G7OF 1QZZA 4HX4A 1XMKA 1QO0D 1OYWA 2A68F 1K79A 1FP2A 3F8BA 4MQ9F 4L9VA 4L5JA 5LEKA 2G7HA 3LAJA 3CTAA 3MWMA 1ULYA 5F64A 2IP2A 3HRTA 2Y48A 2KJBA 5BOXA 3FMQA 3QP6A 4A0XA 3TOAA 2ZCWA 1BC8C 2PEXA 5DUKA 1KU3A 2XKOA 2MH2A 1QNTA 3WTYC 3ULQB 3KCCA 5CJ9A 3RTRA 1BI2A 4P9UA 2QZ8A 3K2ZA 5HLHA 3HOTA 3ZMVA 4Q5SF 1DPUA 3AAFA 1T39A 3PQKA 1AOYA 2QBYB 2RNJA 1K7AA 3FHZA 5ILUA 1JXSA 1V4RA 1D8JA 1BOAA 1KA8A 5JVTA 5HS7A 5CVIA 3RPQA 1D3YA 4MHGA 3L2CA 5CVRA 3KP4A 1T0FA 3ERED 3RYPA 3GYHX 3LSTA 3TOBA 2JT1A 2ZJ2A 4LG0B 2DW4A 2HKXA 3ZP5A 1IXRC 3SXYA 2LKPA 2OAZA 1QQIA 4M73A 2PN6A 1P92A 4WXCA 1ZYRF 2YR2A 4R8HA 2Z3YA 4BXUA 1J2XA 4GYGA 1IZ1A 3N97A 3QRFF 3BWGA 2PMHA 4AWXB 1J7KA 2IPQX 2V6CA 3T1BA 2STTA 2ZO4A 1S3JA 1IN4A 2Y75A 2H6CA 2YU3A 3H3ZA 1LDDA 2P5KA 4EGZA 3LA7A 4HLXA 4AD9A 4CGZA 3CUQA 1I27A 4ON0A 2LSOA 2GA2A 3N4MA 2VT3A 1E17A 4EM1A 3F21A 4M72A 1G3YA 4JQFA 1HKTA 4B09A 3DXJF 2DK8A 5BPIA 1P2FA 4IJAA 2ZBKA 2L4AA 3ZPLA 4MTDA 2Q0OA 2RV8A 1FYMA 2XIGA 4U0WA 1FSEA 2FSWA 3P9KA 3C7JA 5LRSA 2RDPA 4KYWA 1XGNA 3C3WA 3R4KA 1U6GA 2R7DA 3VEPA 2P6SA 3KLNA 4FX4A 4HLYA 4IRIA 1AWCA 3GFIA 2FNAA 3K1NA 2STWA 2CYYA 1YW9A 1R1VA 4P5OA 2IRFG 1CF7B 1YW8A 3WTWC 3ZN0A 4M71A 5AONA 1ZGAA 4ENJA 1L3LA 3I53A 2GZWA 1FY7A 3HRMA 2D45A 2VN2A 1STZA 2M1BA 3FXRA 2QQAA 3MCZA 5E1XA 3F8NA 2HQRA 3TQNA 5D5XB 2FNPA 5E1WA 3WE2A 3KZZA 1LEBA 4N9IA 2UXXA 5K5QA 2P6TA 3QP5A 4KMFA 1ZH5A 3U2RA 1Z9CA 5HOOA 4AIJA 3MZHA 2OZUA 4ENNA 3F8CA 4HAMA 1X3UA 3HSRA 1JGSA 3HHGA 1S29A 2K7LA 2CWEA 4O5VA 1WWXA 2F5FA 2GAUA 2FBHA 4HV5A 2HDCA 5HDNA 3WODF 1HW1A 2W25A 3NRVA 5CVVA 3G73A 1Z7UA 3I4PA 2ZKZA 2NAZA 2TDXA 1FBUA 1SMTA 4ESFA 3HSFA 3QPTA 4WWCA 5KVRA 4OIPF 2BV6A 3RIRA 1WSUA 5A2QK 5DD8A 2DQRA 3R61A 4WK8F 3G3ZA 1BI1A 3BROA 2JZYA 2DQLA 2EB7A 5E8IA 5DCMA 1H9GA 1ON1A 4Y17A 1ZRCA 4KFCA 2UXNA 2PG4A 3MEXA 4A0YA 2M5WA 1MD0A 2DAOA 5H20A 1FP1D 1KGSA 5LBQA 2VBWA 2O8XA 5DCFA 4HOBA 3VB2A 1KYWA 3KP3A 2IA1A 5D6EA 4A5MA 3CO7C 2VOPA 5K5RA 1U2WA 2Z5UA 5BPDA 4KMUX 5JI6A 3HUGA 5IT9K 1J5YA 1TW2A 5IT9Z 1O3RA 1YS6A 3F6OA 1G3SA 4H0EA 4LLNA 2PFBA 5JHUA 2WTEA 1R1UA 4S05A 3K0LA 1ZGJA 3DV8A 1O7LA 1B9NA 2MC3A 4KIGA 1VTNC 1QGPA 2HYGD 2QQBA 5EEHA 1FWZA 4GCVA 4HX8A 3GZ6A 1UHWA 2UZKA 2DPUA 1EH8A 3LQQA 3KETA 3V8LA 4UHTA 4L9NA 2DT5A 2HR3A 1RNLA 4WXHA 4L18B 4ETSA 3NEUA 4KT5C 4HQEA 4XSZF 4FHTA 5HS9A 3WGGA 3E6DA 3HTUA 1YTYA 2VC0A 1YFHA 4YG2F 1HKQA 2V1DA 4RAYA 3HTSB 3WGIA 2EA4A 1YQAA 1BBYA 3E6BA 3LQRA 3RKWA 2RN7A 5ILSA 3FX3A 2NNNA 4XRFA 2EA2A 5L3FA 4O3MA 1ZRFA 1JE8A 5KK1A 1TLHB 2ADUA 1C0WA 5LEJA 2RC4A 1LJ9A 1B1BA 4WXDA 3ZMSA 3I59A 2E1NA 1TW3A 3DF8A 1REPC 5F6FA 4FT8A 4UNOA 3BDDA 3KFWX 2BYVE 3WTTC 2L01A 2F5CA 1TBXA 2ELHA 4IRHA 2YPRA 2FEZA 2ZNYA 2XAQA 2A3SA 1DUXC 5E20A 1CF7A 1LDJA 3HIFA 2O6GE 5JFRA 4ZYDA 1XCVA 2HFHA 1Z6TA 1LQ1A 3LFKA 5J6XA 1EV7A 1YO5C 4GGGA 5H6QA 3JW4A 4BHPA 1I1GA 3LA3A 3PFIA 5FLXK 4AIHA 2FQ3A 1T2KA 1F4KA 1V3FA 2HOEA 5TJJA 1MJAA 2A07F 1GXQA 4I0AA 3E5UA 3KEQA 4PGGA 2P8TA 1IW7F 1IRGA 3W6KB 4L5IA 4ZYGA 3TKYA 1L0OC 1J59A 1GXPA 1RI7A 1XSXA 1CGPA 1S6LA 2CFXA 2KJCA 3K9TA 4A12A 3ROUA 2QQ9A 4XLPF 2HZTA 2XAJA 4L9JA 4CXFA 1RUNA 2MBFA 4OOIA 2DBBA 3KP5A 2EFWA 5LHGA 2KRFA 3WE3A 4G8XA 2RQPA 2CSOA 3ABUA 2ZNZA 3IHUA 2O03A 2HS5A 4KUMA 3IKVA 2CW0F 4G94A 1S7AA 2BGCA 4CO8A 4UVCA 4ENKA 2YX7A 3GFLA 2DK5A 5H6RA 2JPCA 1KYZA 1W7PB 3GF2A 4OINF 2A5YB 5ED4A 2LNBA 3WTXC 4R79A 1I1SA 2O61A 3H3UA 3VOEA 1TQIA 4JK1X 5LLQA 4KIFA 2M45A 3KP7A 4IHTA 1I5ZA 1TNSA 3EYYA 4PZJA 4HX7A 5A2QZ 3DKWA 3OOPA 1DPRA 1IRFA 3RKYA 1YW7A 3OV8A 3S2WA 5L3BA 2M8EA 3GUDA 3WU0A 2QWWA 4U0VA 2ESNA 2RGVA 4MEYF 2PLYA 3FXUA 3WG9A 1W4MA 2QENA 4OIOF 1P4WA 1R00A 3IRRA 3BP8A 2HYFA 3SFZA 2HEOA 4ESBA 4GO1A 3SHFA 4OIRF 4M6YA 2BBYA 4KA4A 2XV4S 3I64A 1R58A 1FT9A 4HQMA 4P96A 4GXOA 4G6QA 2FMYA 2V9VA 3JSPA 1KU7A 1ZG1A 5K1YA 1P4AA 3FZVA 1XDUA 3DFGA 4U7BA 5FGMA 1G3WA 3RDIA 3HSEA 4NQWA 4HDVA 4LGWA 3JTHA 2ACJA 2X0LA 2FXAA 1I6XA 2L02A 1YIOA 5IT3A 1U5TB 2XKPA 4UVAA 3I5UA 2GXBA 4YFNF 3R60A 1UHMA 1OMIA 1R36A 1XN7A 5LHIA 5ICGA 1W7PA 4XBFA 3T5XA 1XSDA 2ZMEB 1IN8A 1P6RA 2V1UA 1LDKB 3ZMZA 1U78A 3SZTA 1S8NA 3QU3A 2RKHA 2PJPA 3V4GA 3M9AA 4L9TA 2ESHA 1YG2A 4ESJA 1J75A 2CO5A 4ZZLA 3E6CC 1XGMA 1BIBA 5HDGA 3ZMTA 3WTSC 2QYOA 1OYYA 1U5TC 1BI3A 1SFUA 2X4HA 5FD5A 2JPBA 1D8KA 2DLLA 2OQGA 3V8KA 3R0AA 2EFNA 3ABTA 1KQ9A 4A5NA 3TO9A 3DPTA 3ISPA 5FO5A 3K1MA 1BI0A 2AS5F 1BC7C 4AVPA 5HLGA 2XGXA 3J7AO 3JAMZ 2OBPA 2F2EA 1SFXA 4G6DA 4LFUA 4LD5A 4CHUA 2E1CA 1MDMA 1R23A 2CQKA 2HQNA 4U0YA 4B8XA 3I71A 3L9FA 3R0JA 3J80K 2FBKA 2FMLA 3VODA 2M30A 1XB4A 2H09A 2KIMA 5E18F 3RJPA 1PDNC 1GVJA 1O3SA 4EJTA 4RB0A 1FBQA 4LB6B 1SMYF 1SD7A 4HW0A 2L4MA 1TQMA 1U5TA 3F22A 1U8RA 1E2XA 3KP6A 5DD4A 5DUIA 2MD5A 2DTRA 3ML6A 3I58A 2Z9OA 3I54A 3F72A 4RGUA 1B59A 5D4SA
chains in the Genus database with same CATH superfamily
5LGNA 2MFZA 4LMYA 5AIPA 1HOMA 2X6OA 2LFBA 2P7CB 4M6XA 2EV0A 5GTIC 3M7GA 2MYSA 1A04A 2LYCA 4N4NB 1BM9A 2EFOA 3QAHA 1Z05A 1H9TA 3E5QA 4EM2A 4PJLA 1HW5A 3QYFA 3U1DA 4HBLA 4EEFG 5EF6A 1LVAA 3QPSA 3ZOBA 1PVEA 3OIOA 2ZJQF 2IS4A 2KMUA 1JHFA 3BY6A 2HXOA 4QLCU 4HF2A 4MTEA 1A31A 2FRHA 1DU0A 2JUCA 4RGRA 3MZYA 2JSCA 2D2WA 4LIVA 5DYMA 2DOAA 4BYYA 2VKVA 3B73A 5B3SH 3WTUC 3LWFA 3RYRA 1HA8A 2CS3A 2MLKA 5JHFA 3LA2A 4BAYA 3OYMA 1AKHA 4A6EA 4D0PA 3J7AY 1JI8A 2CFOA 4RGSA 2HOSA 1I50J 5HNHA 4ZTJA 3B6AA 5JVGF 1XX5A 2OUMA 4CZZA 3NQOA 3WTZA 2M4KA 4UV9A 3ERMA 2LF8A 3H9JA 3F23A 4A0ZA 1GVDA 2IJLA 3DWLE 2FBIA 2ZB9A 1A36A 1X1BA 1BIAA 3BTJA 4QPOA 2DJNA 2DMNA 1OYIA 1RZ4A 1WJDA 2NVQJ 5F0CA 4PSWA 4Q47A 1A5JA 2P4WA 3WU1B 4A3JJ 1DU6A 3TO6A 4CCMA 4B1RA 1A35A 2BVMA 1MH4A 1XDSA 3DTEA 5J8FA 2CW7A 3JTGA 4KN4X 3M1EA 2XF6A 5AIQA 2QM3A 1ETWA 2QVOA 2L9SA 2CUEA 5BS6A 1HF0A 1IXSB 1RKTA 4A69C 3O2PE 1UFMA 2IA0A 3SYTA 3TP3A 3GTQJ 1TTYA 1WKMA 2H8WA 2R0QC 1EF4A 4J19A 1OCPA 1HBXG 3LSKA 4NDLA 4H4KC 4CYDA 2F5VA 2RAEA 1PP7U 2OA4A 3HRUA 4EJWA 3A0HC 4D1QA 4I7HA 3KEOA 4DNCA 1ZR4A 2X1DA 1AA7A 2OTLI 1FOWA 1WJCA 3W2VA 4BBSJ 2YX4A 2LP0A 1PYVA 3FKJA 4RB2C 1SAXA 1Y1WJ 1ENHA 1G59A 1W7PD 3HG9A 4A3IJ 2H94A 2XSJC 2EV6A 1P4XA 2DT7B 3V7CA 3SZPA 4RB3C 1ZREA 5CLSA 3TDUC 3H0DA 2CMPA 4N9HA 1MW7A 4A6DA 3S3MA 2H27A 3HKZN 1Y39A 3CO6C 4OU0A 1FSHA 4MLOA 4EQQA 2RQQA 2HWVA 1HXDA 3H5RA 3OR2C 1KONA 5CVJA 3HYIA 4IPAA 1ONVA 4M9SA 4OAYA 3J7ZI 3A02A 2BY1A 2XDVA 2LC2A 3R6SA 4OMZA 1Z0XA 3OS0A 4UVBA 1SEUA 2KRHA 4XORA 3MQ0A 3DP7A 2R7ZJ 2L3DA 3K1PA 3W3CA 3W6JB 1ZHFA 2O7OA 3BR0A 3EQLF 3O8GA 2KKOA 3BZCA 1OPCA 4O6JA 2IS1A 2MG4A 5B1AH 3ZMDA 1EJ9A 1IN7A 2K02A 1HSJA 1B4AA 4UUTA 2VOOA 1H0MA 3GWZA 4NUBA 3GTJJ 4EJVA 3K6GA 2Y30A 5BQTA 2M7AA 2V79A 3GLXA 2LTPA 2LOOA 1Y0UA 4II3A 3REOA 4OAZA 4MNUA 5F0FA 1RR8C 3LAPA 4IKFA 4A3EJ 1KU2A 3HOVJ 3I56I 2CRGA 4IF4A 1JJ6C 3T0YA 4LB5A 2VODA 3A01A 2NS7A 1MDMB 2OQRA 1B9MA 3FMSA 4XQFA 3BZKA 5ILVA 2EIMH 4Y3OA 2DMUA 4CICA 3GTGJ 4DZJA 6PAXA 2MH9A 2KRCA 2WBMA 2HVRA 4FISA 1FNNA 3TDZC 4M3BA 5KAFC 2VBYA 3TGNA 4S0HB 1EA3A 2WV1A 4D7NA 1UMQA 3S32A 3M07A 4B43A 5L3GA 2CU7A 4Q4ZF 1Y1VJ 4M9ZA 5DEQA 2GXAA 2K3FA 2KISA 2FF4A 2VBXA 4MQVA 3RI4A 1WI9A 4K2EA 1O3TA 4NBQA 3K4NA 4LG0A 5DCMB 5KNLA 1R22A 1GHCA 1MNMC 4JBAA 4AIKA 3ZQGA 3BJ6A 2VC1A 4I99C 3ECHA 4LK1F 1LFPA 4UB6C 4XNFA 4XLNF 2HVQA 4YFXF 2ZJPF 4OMYA 3KZIC 2HGCA 1N78A 4EJUA 3S2DJ 2R5ZB 4QWQA 4X1EA 3SFIA 3BR5A 4E7SA 3FM3A 1VQNI 3HOYJ 4HZFA 2B0LA 3GVAA 1MSFC 2K86A 1FMVA 3CDIA 4A2UA 4I09A 4IOCF 3CESA 5TRDA 4I02A 4PCQA 2W84A 3BC8A 4KN7X 3ZMUA 1YS7A 3O6BB 2CGPA 2QKMB 2XAFA 5ICEA 3F8FA 3BCBA 2MA3A 2IVMA 2E35A 2FQ4A 1ZAOA 3TL4X 2E2IJ 2A6HF 2H8RA 4EJOA 3FM5A 4M3EA 4YFKF 3I59B 1X1AA 3D0SA 1VI0A 3TBIA 4E70A 2QBYA 1FLIA 5LHHA 1RRJA 1MGTA 2XAGA 5FD6A 3IUOA 1YLFA 2KDOA 2W24A 4XKVA 1JTXA 2ZSIB 2A6TA 1FOKA 2ELJA 3QYBA 4PGHA 3QOPA 3UKGA 3CJNA 4M74A 2XROA 2WB1N 2BE5F 3K4MA 3I0TA 4Q48A 4RLFA 3GEZA 5LGUA 2P5LC 3KLOA 2Q8KA 4ANJA 2FOWA 1QZYA 3DU5A 5EEAA 4MO7A 2O3FA 2R93J 3D5RC 1SVLA 2DMPA 4GDFA 2MLGA 5HVQC 2ZFWA 3HDDA 2X6YA 5ICCA 2PBIA 1IUYA 5F1RA 3EUHA 1QA6A 1APLC 5J4VA 5ERIA 1WCMJ 5EGOB 3LOCA 1ZK8A 2XHKA 3LL7A 2BOLA 4CDGA 3CJQB 4G7ZF 5L3CA 5HS8A 3OYBA 4XIDA 2Z2SB 3D5LA 4Y13A 4FQGA 1EH6A 1IN5A 1ON2A 2HDWA 1JHHA 3HRSA 3A01B 1FYKA 2AQEA 4GYIA 2FX0A 3CD6I 2A61A 4DYRA 3MFKA 4XRMA 3GX4X 3E5XA 5IP6A 1HQCA 1T0FC 3HEFA 2ISZA 4Z2YA 1F9NA 1MNDA 1ERDA 1MJ9A 4EV0A 3GFJA 1ZLJA 2K5CA 5D8KB 2XRNA 4YELA 3JREA 1HW2A 5HLIA 2KZGA 3F8MA 1FC3A 1MMNA 1K6OA 1IV6A 1RKWA 1VQOI 2F4MB 2PMZA 1SD6A 1X1PA 3BOQA 1ETXA 1TT5B 5ICFA 3CLOA 3OS2A 3BJAA 1Y8QB 5L3EA 3C2BA 3CZ6A 4XSXF 1T38A 3BQZA 2VE9A 2JQ7A 5KAIC 4F52A 5EEGA 3U9GA 2VXZA 4DZPA 4FCYA 4JX6A 2EFPA 5M3MJ 1YYVA 2K9MA 3EDPA 1X2MA 3O8HA 3CCRI 2ECCA 1HSTA 3CDLA 3EUKL 4P55A 3ZQ7A 2CQXA 2NNYA 3QQAA 4C3JJ 1LUJB 3CQZJ 3GZ5A 4EM0B 2A6EF 2XC7A 3HOSA 4RAFA 5BMZA 2E2JJ 2E7XA 3BJOA 3RCOA 3HOXJ 4IRGA 4NB5A 2DJIA 3D1NI 1X2NA 3FIWA 2GIZA 4UXNA 1RESA 2JVGA 2VIXA 4ENMA 4U88A 3PSFA 2KIUA 4N0BA 1F1ZA 1SANA 2RREA 3FWEA 4HF1A 2L9VA 2F6CA 1TT0A 1E0EA 3F3XA 1NH3A 2XAHA 3CC7I 5D8LB 3L2WA 3PNTA 4XRSG 5CQGA 2OU2A 3RPUA 4BNCA 3KZYA 4BDZA 3GCMA 4ZYAA 2XF5A 3EETA 3SJMA 3LSPA 2V1NA 3HKZA 4I76A 1TWCJ 1K6YA 2E5ZA 2ZMEA 2A5WA 1QU3A 2PX9A 3MAJA 1T8IA 2QLZA 2HVSA 2K9LA 2JRMA 2Z33A 1VZ0A 5F27A 3V42A 2GWRA 1G4DA 2AXLA 1LB2A 3NARA 2V1XA 3W6VA 1IXCA 3EYIA 2F5EA 1FMWA 1O57A 1ZKGA 3MN2A 4IL6C 3DPLC 2XASA 3KE2A 4NC7A 2XPUA 3Q0UA 1QVTA 3IWFA 1RUOA 2M0CA 3FMRA 1NG6A 4IZZA 1K78B 2K9NA 1GLNA 4NNJA 4Y52J 2R3SA 4BXFA 4NQWB 1HLVA 2VBZA 3BG5A 2K40A 3G6EI 3DBLB 2XSDC 2GXGA 1I39A 4DQ2A 2D1VA 4HA8A 3FXOA 3SQNA 2DA7A 1HKSA 5CYVA 1XG1A 3BPXA 1TNTA 2LMDA 3K4LA 3FK7A 3ASNH 1Z1DA 2XRLA 3PSIA 4IHSA 1XGOA 1LFBA 5HNFA 2DCEA 3CDHA 2RNGA 3MMYB 2ZJRF 1QPMA 1Z91A 2Y0SN 5J8CA 3H0GJ 3DKYA 4E7HA 4LLLA 1ZLKA 4LLGF 3BZ6A 5GTHC 2DI3A 2IS6A 1FPQA 3J80Z 4WX9A 1LNWA 2GM4A 1ZG5A 1USSA 1TQPA 2FU4A 1S7OA 3L7WA 5E1ZB 4S04A 2DPDA 4RS8A 4ABZA 2VT2A 3VFZA 3GTOJ 2QGUA 3PQJA 2IT0A 9ANTA 2QSHX 4ZH4F 3PUBA 5B66C 2AHQA 1PUFA 5LGTA 2IW5A 2Y2ZA 3E7LA 2H6BA 1JUPA 3KYCB 4HEA2 1NG7A 3ZGKA 5C4JJ 4BH9A 2D5VA 3RKXA 4DBQA 4NHJA 1FOYA 2GQQA 4RLQA 3HGYA 1O3QA 2G9WA 3ZQCA 3JAMK 2DU9A 2K4JA 1B8IB 5IP9J 3LSMA 4PFOA 4Y7NJ 2JA7J 2GBYA 3K69A 1QVUA 4MGRA 2BXYA 4DW6A 1OQYA 4DGWB 3IRQA 2WWYA 2DFFA 4AVZA 4G7HF 4R1HA 2QSFX 5L3DA 1U9OA 2NRAC 2CG4A 4XK4A 4BQQA 3OIQA 2KIFA 3AL0B 2C6YA 1D1BA 2TRTA 4KIBA 2Y9ZA 3ECOA 3JSOA 3L1PA 1ETYA 2XUBA 1J09A 1FBSA 2PMUA 1YX5A 2EJRA 2K27A 4I01A 3WHBA 1T33A 4M3GA 2IA2A 3H92A 2LVSA 2BEOA 2L7ZA 2Y0MA 4FX0A 1K78A 2R7TA 1PJRA 3JRFA 1IUFA 4FTHA 3HHHA 1O4XA 4HV6A 3V7SA 3Q0WA 4Y4RA 5IYCJ 2NOGA 4LIUA 2HNHA 1YX3A 2HTSA 4HPQA 1VQLI 1GT0C 1AHDP 3J81Z 2Y9YA 2Q1ZB 4IQ4A 1NHAA 3Q0VA 3CP8A 3KIOA 1VQPI 4P1WA 2HTJA 4IXAA 3IWZA 2MGQA 3L00A 4B3XA 3QOEA 1KQ8A 4YIIA 2M9HA 1QHHD 2D1HA 3OYDA 3W2AA 3IL2A 3M8FA 2EK5A 1JJ8C 3K4BA 2IGOA 2ZFUA 2W57A 3ABKH 4C2TA 3C18A 2XVCA 3L2UA 3LSGA 1RIOH 2R7SA 2ETHA 1Q1HA 2YS9A 3OYFA 1Z6RA 3S14J 1XMXA 1ZG3A 4RM2A 5JR3A 3CCSI 2L9NA 4RGXA 5FLXZ 1MZBA 1KU9A 2QUFA 1JGGA 3CUQB 5D5WB 3G4SI 1S7EA 1ZRDA 3OY9A 2V9KA 3H1CA 2HKOA 1XSVA 4XLEA 2M4GA 4U7DA 1WHUA 4EMSA 5HDKA 3AL0C 4Z6YA 1FOXA 2DA6A 1H88C 1J9IA 3C2HA 1XD7A 4RAZA 2I5UA 4QTRA 3QYEA 2EZLA 1U3EM 3KEYA 2DFIA 2FE3A 1J0RA 3KPHA 2P7VB 1GV2A 4YIFA 3CUOA 2Y0SA 4KICA 4XR6A 4FE4A 5FJ8J 1WFXA 1IF1A 1FX7A 4LK0F 5D5VB 2BXZA 2JTVA 4XLFA 1DQUA 1D0YA 2ISYA 3L2RA 2LY9A 2LY2A 3FXQA 4I0BA 5E8GA 4BJ5C 2ME0A 5IYBJ 3JRCA 3VSLA 1IAWA 1K4TA 1TZLA 2PMZN 3BTCA 1IG7A 1SFEA 2BY2A 3DEUA 1RETA 4RMNA 2I8DA 2M0MA 3P9IA 3UR3C 4LJZF 2X6XA 3FDYA 3NAUA 4UV8A 1ZARA 1VNDA 2CQ7A 1OR7C 2FJ1A 2W85A 3BR1A 4I98B 3BG9A 3MD2A 2GA1A 4P9FA 5K5OA 3T8RA 3KP2A 4HNVA 2AO9A 4RB1A 4PK4A 2F5DA 2VKDA 1OR7A 3FBNB 3E6MA 1G6NA 3TO7A 3L2QA 1U8BA 2R7VA 1O7FA 3ZQQA 4ZC3A 3C2GA 2G7UA 5D5UB 2PQ8A 3P9CA 5D6FA 2WV0A 2DA4A 4E7ZA 2MSYA 3CUQC 1LVKA 4XKWA 3HB9A 3GFMA 3S2HJ 2HPIA 1W5SA 3WTVC 4HDUA 4PDKA 1IV8A 1R1TA 4ZYHA 1ZN2A 1D5VA 2EFQA 2E71A 3M8JA 1X3WB 3CC4I 3OSGA 1FTTA 2L54A 2VONA 2LDUA 3S8PA 2P5VA 5DS9A 1M1EB 3L09A 2NS0A 5LRRA 4F92B 3BPVA 1F36A 3V8JA 2R7FA 2EH3A 1T98A 2Q2EA 2JN6A 4PJJA 2E2HJ 2JK3A 3IH4A 2WC2A 4WF2A 4BQNA 3TMOA 1B8IA 1SD5A 1BN5A 1UCRA 1ODDA 1R7JA 5FB2A 3IKTA 1WJFA 2LF7A 1X1DA 4CCNA 1JT6A 4CA0A 2UWMA 1R5HA 1SFOJ 2OZ6A 3A1YA 3ZN1A 2IAIA 1FIAA 2BY0A 2Q2EB 4XOPA 3M8EA 3GXOA 2EV5A 1LEAA 3VYTB 2NYXA 4GRIA 1FZPB 4HYEA 3DBHB 3QWLA 2NOJB 4F7ZA 3IC7A 3FF5A 4KDPA 3ELKA 2YU9J 4HG2A 4PJ0C 4D5CA 3QPLA 3O3KA 1MKMA 2DYSH 5FFZA 3GO5A 3DPUA 3J81K 2M87A 4ZZDA 4BQAA 3ZXSA 1USTA 5E3MA 3ESWB 1WJAA 4IQJA 3Q5FA 4M9XA 4PUSA 2YSRA 3OL3A 1TWHJ 4FETA 3WGHA 1W5TA 1T6SA 1OCTC 2RVCA 5FKNA 1EH7A 2OD5A 1DP7P 4OIQF 1BJAA 2OCEA 2Z99A 1FYLA 1DDNA 4Y15A 1XGSA 2EWNA 5EGOA 5HLTA 4EVIA 3FK6A 1B6AA 4AYBN 4I6ZA 3H36A 1SD4A 1P7JA 2EQRA 3GTMJ 4ZYEA 1F5TA 4BHCA 4UUVA 5DDGA 3S1MJ 1R4NB 4MEXF 2DO7A 2K4BA 3PJRA 4A3DJ 5DV5A 3E3VA 1S9HA 3MVPA 1Y0NA 1MJBA 4FE7A 2HOAA 3T8TA 3RZOJ 4A3LJ 1KQ0A 2UUZA 1PUEE 2E5NA 2KT0A 4BHBA 2R7RA 3B02A 1JTYA 2WB1A 2COMA 1QBJA 2FA5A 3G1MA 2R4GA 3GW2A 1IN6A 3IAM2 1R6RA 4XICA 3CP2A 3Q9VA 3OR1C 4JOMA 1WRJA 4JP0A 3TW7A 4GFBA 4EGYA 4A3CJ 2LK2A 3F6VA 2JRTA 4HF0A 5E17F 3OYJA 1XCBA 4XL9A 3Q9SA 1UG0A 1IO2A 2O0YA 2MC4A 4I2OA 4B47A 2GIVA 1WZ2A 2A69F 4ASNA 4YIRX 2X48A 1WGXA 3CLQA 5FFXA 1R5GA 1VQ6I 1BA5A 3K4JA 1XMAA 1PP8F 3E0JB 1WJBA 1UB9A 3QPHA 2B7EA 3HBLA 3P7NA 2OCCH 4G9YA 3COAC 3DQVC 3E97A 1G3TA 1B72B 1OKRA 2K85A 4N4OB 4WCGA 1ZR2A 1GDTA 4L0ZB 4CSWA 4KNYA 2VE8A 1OJLA 3GTPJ 3OYAA 3V7RA 2PI0A 4IVNA 5EZGA 5FKLA 2FOKA 2N8GA 4TV7A 1EKEA 4XLHA 2J5OA 1QZEA 2MW8A 2LKXA 2J5PA 1VQKI 4L0YB 2ICWG 2V9PA 2VASA 1WQ2A 3QU6A 3VWBA 1TP4A 2ZXJA 4NC6A 5D4RA 1P9QC 4RM3A 4PFPA 3E1SA 2HXIA 1OCCH 2VKEA 3C1DA 4II2A 4PJMA 3CMAI 2E7WA 5K7FA 2H1KA 5CVUA 4G7OF 3JRIA 2W7NA 2P81A 1QZZA 4HX4A 3K70C 1XMKA 1QO0D 4BE0A 2R5YA 1OFCX 2IEKA 3TW6A 4M6VA 1OYWA 2A68F 1K79A 1FP2A 3F8BA 2CW8A 4MQ9F 1ZELA 4L9VA 1YIJI 4L5JA 5LEKA 2DOFA 2G7HA 2VJIA 4D9JA 5J40A 3LAJA 2GLOA 3CTAA 3MWMA 2OF7A 1ULYA 5F64A 1LE8B 2IP2A 3I4NJ 2HU9A 3HRTA 2Y48A 2HOTA 2KJBA 5BOXA 3FMQA 3QP6A 4A0XA 3TOAA 4A93J 1Y6IA 2EZHA 3LSIA 4IHXA 1MBKA 3GTLJ 1SAUA 2ZCWA 4V2GA 2P0WA 2PEXA 5DUKA 1BC8C 5FROA 2IXSA 1KU3A 3DLLF 5B1BH 4LOCA 1T08B 3H5NA 5E79C 3OWTA 1WVRA 2XKOA 3CJTB 2MH2A 1QNTA 3WTYC 3ULQB 3KCCA 1MBGA 5CJ9A 1N77A 1SVMA 5E3LA 3RTRA 1BI2A 4C30A 1K4SA 2QF7A 3HPHA 2QZ8A 3D5SC 3K2ZA 4P9UA 1N75A 5HLHA 5FRMA 2NVYJ 3OYEA 3HOTA 3ZMVA 4Q5SF 1DPUA 3AAFA 1T39A 3PQKA 1AOYA 2QBYB 2RNJA 2M2EA 1MIJA 4XLAA 2WAEA 1Z7LA 3CCLI 1IGNA 1ACIA 1K7AA 3FHZA 3K4KA 1R49A 4UB8C 5ILUA 5LFAA 1JXSA 1V4RA 3DU6A 5GAHJ 2Y31A 1D8JA 1BOAA 1KA8A 4BUPA 5JVTA 5TISC 2NXNB 2XPVA 3HZJA 2L5QA 5HS7A 5CVIA 3RPQA 1LPQA 1D3YA 4MHGA 3SDBA 4BE1A 3L2CA 1FJLA 5CVRA 3G1OA 3KP4A 2A05A 1T0FA 5BNGA 3PO2J 2K3PA 1A6QA 2K9QA 3ERED 3QODA 3RYPA 4E7LA 2DTZA 1MBFA 3GYHX 3HXLA 3LSTA 3TOBA 5IOYA 2JT1A 4DOZA 2AQFA 2ZJ2A 4LG0B 2VPLA 2DW4A 2HKXA 3ZP5A 3FHNA 3JRDA 4CYCB 2WADA 3WU2C 1IXRC 3SXYA 2LKPA 3CCYA 5J1RA 2OAZA 1QQIA 4M73A 2PN6A 1P92A 5F0HA 4WXCA 1ZYRF 3S93A 2R7XA 2YR2A 2EINH 2F4OB 4R8HA 2Z3YA 1X19A 4BXUA 1MBEA 3VPRA 2VJJA 1G8XA 1J2XA 1ETQA 2CH0A 3MKYB 3N05A 1IZ1A 4GYGA 4BJTA 2R7WA 1VFCA 1JUMA 5C44J 3N97A 3QRFF 3BWGA 1GUUA 2PMHA 4AWXB 3Q3SA 2DODA 1J7KA 2BW3A 2IPQX 2V6CA 3PUFA 3T1BA 5IY5H 2R7UA 1YHQI 2STTA 2ZO4A 1S3JA 3AKZA 1IN4A 2Y75A 2H6CA 2YU3A 3F9KA 2JUGA 3H35A 3ZRGA 5EG0B 3H3ZA 4BY7J 4HSTA 4BKXA 1TC3C 3HOZJ 1W5CC 3OYNA 1LDDA 2P5KA 2K9SA 4EGZA 4M3FA 3LA7A 4HLXA 4AD9A 2R92J 3CUQA 4CGZA 1I27A 3H5AA 4ON0A 3OL4A 2X6WA 4IEJA 1GV5A 2LSOA 1UZCA 4C3HJ 5B5EC 2CQQA 2I10A 4HNUA 3HOWJ 2GA2A 3OYGA 3N4MA 2VT3A 2CJJA 5EZHA 1E17A 2VL8A 4EM1A 4M72A 3F21A 4BU2A 3CCQI 1G3YA 3VYSB 2E34A 3UNGC 2R5YB 4JQFA 1HKTA 1FTZA 4B48A 4B09A 3DXJF 2DK8A 2V26A 4BE2A 5C4XJ 4KT6A 5BPIA 1P2FA 4IJAA 1W36C 2L7KA 2V4JC 2ZBKA 1SVOA 2L4AA 3ZPLA 2O5RA 4MTDA 2Q0OA 3BG3A 2EBIA 2HQAA 2RV8A 1FYMA 2XIGA 4U0WA 1FSEA 2FSWA 3P9KA 3C7JA 5LRSA 2VQLA 4BXXJ 1I3AA 2RDPA 4KYWA 1UHSA 1XGNA 3C3WA 3R4KA 1U6GA 3FISA 2R7DA 3VEPA 2P6SA 1POGA 4RA2A 3KLNA 2XB0X 4UY8I 4FX4A 2KZVA 4HLYA 4IRIA 4AUXA 1Z3YA 3LFUA 4BEHA 1AWCA 3GFIA 2E60A 1R71A 2FNAA 3K1NA 3IAS2 1VF9A 2STWA 2X51A 4AIDA 2CYYA 1YW9A 5CPRB 3RKQA 1R1VA 4P5OA 3K7AJ 4JX5A 1Y56A 3CF2A 1SC7A 2IRFG 4FASD 1CF7B 1YW8A 5GPCA 3WTWC 1Z21A 2IGMA 2XPWA 4ZDOA 2HZDA 5KHDA 2DDBA 3PIOF 5DM6F 1BR2A 3BG6A 3ZN0A 4M71A 2OTJI 1X58A 1Q1VA 1U0JA 1ITYA 3PO3J 5AONA 1VQ9I 1RR7A 1ZGAA 4ENJA 2NVUB 1L3LA 3I53A 3PNVA 2GZWA 5M5WJ 1FY7A 5FLVA 3HRMA 1MH3A 2VN2A 3LMMA 5J4YA 2H1LA 5JLXA 2D45A 3OMYA 1JT0A 1STZA 2M1BA 4BJ6C 3FXRA 2QQAA 3MCZA 3I9V2 5E1XA 3F8NA 5F08A 1FIPA 2DN0A 2HQRA 4ZDPA 1WH7A 2OV7A 3TQNA 5D5XB 3OS1A 3H9QA 2FNPA 2QCOA 5E1WA 3JRHA 2Y69H 3WE2A 1W1WE 1ZQ3P 3KZZA 3DEWA 5M5YJ 1W0UA 1LEBA 4N9IA 2UXXA 5DTDA 5K5QA 2P6TA 3QP5A 4EATA 4KMFA 4KITB 1ZH5A 1R4MB 3U2RA 1Z9CA 4DIQA 1ETVA 4F93B 5HOOA 3BT9A 1UAAA 3VDXA 1X4PA 4AIJA 3MZHA 1VQ7I 2OZUA 4ENNA 2W48A 3F8CA 4HAMA 1X3UA 3HSRA 1JGSA 3ZCOA 5IYDJ 3HHGA 1S29A 2HQ5A 2K7LA 2CWEA 5GP9A 4O5VA 1IRXA 3S3NA 1X1CA 1MMSA 1WWXA 2F5FA 2GAUA 2FBHA 1ORKA 5GAEJ 4HV5A 2HDCA 3NWTA 3CC2I 2L7MP 4B4CA 5FKOA 3S1NJ 5HDNA 3WODF 2MABA 2JSPA 2EPFA 4HRIA 2FUG2 1HW1A 2X1EA 2W25A 2XAUA 4IHWA 3NRVA 5E3NA 5CVVA 1DGRM 3SEQA 1Z7UA 3G73A 3I4PA 2ZKZA 2NAZA 2TDXA 1FBUA 3PIPF 3HOUJ 1HC8A 1SMTA 4Y33A 2F48A 4ESFA 1PUFB 1UJ8A 3HSFA 4CCKA 5FLMJ 2WAFA 3QPTA 4WWCA 5KVRA 4RDUA 1CQTA 4F3QA 4OIPF 2BV6A 3ASOH 3RIRA 2X85A 5A2QK 1WSUA 2R7QA 3GLLA 5DD8A 2DQRA 3DKXA 3HGGA 2PJRB 1K83J 1QPIA 3R61A 4WK8F 3G3ZA 1BI1A 3BROA 2OPTA 2JZYA 2DQLA 2EB7A 3A0BC 5E8IA 3IH2A 5DCMA 3OOUA 1H9GA 1ON1A 4Y17A 4CYCA 1JKQC 1ZRCA 4KFCA 2UXNA 5K7HA 4U87A 2PG4A 4BL0B 3MEXA 2L2OA 3B6CA 4A0YA 2FD5A 2M5WA 1MD0A 2DAOA 4BQOA 5H20A 3JRGA 4AYBA 1FP1D 1KGSA 1MMAA 5LBQA 4J00A 2VBWA 2O8XA 1LKXA 5DCFA 4HOBA 4AC0A 3HPGA 5EJCA 3ABMH 3VB2A 1OISA 5JLWA 3M4OJ 1KYWA 3CMEI 3KP3A 2IA1A 5D6EA 4XN0A 4A5MA 3BR2A 3BR6A 3BTLA 4KJZA 3CO7C 2VOPA 1VQMI 4X6AJ 5K5RA 5IOZA 4BDYA 1U2WA 1G2HA 2Z5UA 2E1OA 4PSXA 3ONQA 5BPDA 4AM3A 4KMUX 5JI6A 3HUGA 2VQGA 5IT9K 1J5YA 2M34A 3MKZA 2VKHA 1TW2A 5IT9Z 2COBA 4XOTA 3CJRB 1O3RA 1YS6A 3F6OA 1D1CA 1G3SA 2LG4A 4H0EA 4LLNA 2PFBA 3SZGA 1V5FA 3OYCA 5JHUA 3P5JA 2WTEA 1R1UA 2TCTA 4S05A 2DFHA 4BGDA 2DXIA 3K0LA 4OWRB 4HNTA 5IP7J 4A3KJ 1ZGJA 3DV8A 1O7LA 1JKOC 1B9NA 3FXMA 1SFKA 2M3AA 2MC3A 1F43A 4KIGA 1IC8A 3HL2A 1VTNC 1XS9A 5H2FC 4XONA 1QGPA 2HYGD 2QQBA 4CH7A 3OYKA 5EEHA 1FWZA 2KLOA 4GCVA 3KX2A 2V7FA 4HX8A 3GZ6A 1UHWA 1K61A 2UZKA 5GADJ 2KIQA 2DPUA 3I4MJ 1EH8A 3LQQA 4CCJA 3KETA 3V8LA 3H9GA 4E7KA 3J7YJ 3JRBA 1DGWY 2L0KA 4L9NA 2DT5A 2HR3A 1D0XA 2W1OA 4UHTA 2VLAA 1RNLA 4J01A 1RC9A 3BG7A 4WXHA 3K4CA 2ZXIA 4L18B 4E6KG 2EILH 2MD0A 3K10A 4ETSA 3KYLA 3NEUA 4KT5C 4HQEA 1YRNA 2L9RA 4XSZF 4FHTA 2VB6A 5HS9A 3WGGA 1YE9A 3E6DA 3HTUA 5DM7F 2LD5A 1YTYA 4BBRJ 1S72I 3FXJA 1FEXA 3U1KA 5EYRA 2VC0A 1YFHA 4YG2F 1HKQA 2V1DA 2KQRA 4RAYA 4YEJA 3HTSB 3WGIA 2EA4A 3FXKA 2QA4I 3AG1H 1YQAA 5FKMA 1AKHB 1BBYA 4F91B 3E6BA 3LQRA 2LH9A 3RKWA 2RN7A 2LBFA 5ILSA 2M8GX 3FX3A 2NNNA 4XRFA 1IJWC 1YRNB 2EA2A 1NTCA 5L3FA 1BJZA 4O3MA 1ZRFA 1JE8A 5KK1A 1BL0A 1TLHB 5J3LA 5J47A 4QPQA 2HPMA 4BACA 2ADUA 2BY3A 2X1CA 1C0WA 3K70D 1YJWI 2QKLB 5LEJA 2RC4A 2CUZA 3BLYA 1TWFJ 2QEXI 1JKPC 3PM1A 5HODA 4XMYA 1LJ9A 1B1BA 4BS9A 4WXDA 3ZMSA 2EIKH 4AU7A 3I59A 4XKCA 4DBRA 4D7MA 3ZQHA 2E1NA 3RSNA 1TW3A 3DF8A 3LSJA 2XGDA 1REPC 5F6FA 1BR4A 4B44A 4FT8A 4UNOA 2HDDA 3CMYA 3BDDA 3KFWX 2BYVE 3WTTC 3K2AA 2L01A 2F5CA 5FRNA 1TBXA 1OCRH 3GBGA 2ELHA 4IRHA 3LSRA 2YPRA 2FEZA 3VYUB 2W82A 3ZQLA 1WPKA 1NK3P 2ZNYA 2XAQA 2A3SA 3LNQA 1DUXC 5E20A 1IRZA 3HM5A 1CF7A 1ETKA 1MMDA 1VQ5I 2WA0A 1LDJA 3HIFA 1IDYA 4DYQA 2WY7Q 3OYIA 3EUHC 2O6GE 5JFRA 3CCVI 4ZYDA 1XCVA 2HFHA 1Z6TA 2ELKA 1LQ1A 3LFKA 5J6XA 3DTKA 3RZDJ 1OCOH 1EV7A 1YO5C 4GGGA 4YRVA 5H6QA 3JW4A 2HYJA 1HCRA 2E1MC 4BHPA 4CUGA 2OC6A 3JR9A 1I1GA 3LA3A 3PFIA 4RAGA 2B9SA 1HDPA 5FLXK 4AIHA 2FQ3A 1T2KA 2IGKA 1F4KA 1V3FA 2KFDA 2VUMJ 3GTKJ 1N25A 2ZC2A 4ZTFA 5GPAA 4BY1J 2HOEA 5TJJA 3ABLH 2DA1A 2LREA 1TWAJ 3DEEA 3TP0A 4M3DA 3JRAA 3A2KA 1MJAA 2A07F 5CKTA 1ZTRA 2VQCA 1GXQA 4I0AA 3E5UA 3U21A 2DA2A 3KEQA 4PGGA 2P8TA 1IW7F 2VJ4A 3PNYA 1IRGA 3W6KB 4L5IA 2GOMA 4ZYGA 2JA2A 3TKYA 1L0OC 2KP6A 1J59A 1GXPA 1ETOA 2R5ZA 2GOXB 1BR1A 1RI7A 1H89C 2L7FP 4V19K 2G0EA 2PJRA 1I6HJ 2DOEA 3CCEI 1XSXA 4X0GA 3GMEA 3DTIA 1CGPA 1YJ9I 1S6LA 2CFXA 4C3IJ 2KJCA 3K9TA 5F1JA 4A12A 3ROUA 2QQ9A 1V54H 4XLPF 2HZTA 4L5EA 1YI2I 2XAJA 4L9JA 4CXFA 1RUNA 2MBFA 4OOIA 2DBBA 1UELB 5J1YA 5EG0A 3TEDA 5C3EJ 3KP5A 1W0TA 2EFWA 5LHGA 2E1MB 2LR8A 2DT6A 2KRFA 3CCJI 3WE3A 4G8XA 3MZ8A 2RQPA 1TWGJ 2CSOA 3ABUA 2DMQA 4A3FJ 2ZNZA 3IHUA 1P7IA 2M7BA 4IOAF 4IHVA 2KL4A 2O03A 2VPRA 2HS5A 4KUMA 3IKVA 2JMWA 2QSGX 2CW0F 4G94A 4C2MJ 1S7AA 2DFEA 3RPUD 2BGCA 4CO8A 3JCUC 4UVCA 2XB5A 4ENKA 1I3QJ 3BTIA 2YX7A 3GFLA 2DK5A 1T56A 2EZKA 5H6RA 3HC7A 2JPCA 1KYZA 4UUSB 1LFUP 1QHGA 3CCUI 1ZGWA 1W7PB 2NVTJ 3GF2A 1VQ8I 2BZTA 4A3BJ 3CF5F 4OINF 3G71I 1E3PA 2CV0A 2A5YB 5ED4A 2LNBA 3WTXC 3A03A 4XLCA 4R79A 4LITA 1I1SA 2O61A 1WI3A 4E7IA 2LY1A 1KZHA 1Z77A 2BVLA 1E3OC 2CQNA 3H3UA 3VOEA 4PJNA 2XF7A 2IBDA 1TQIA 4MIMA 2KDZA 2O9LA 4JK1X 3FBIB 5LD2C 5LLQA 2WAQA 4KIFA 2M45A 3KP7A 4IHTA 2NS8A 2VI6A 2XGEA 1I5ZA 1TNSA 4LG3A 3EYYA 4PZJA 2LKSA 2JJ7A 4HX7A 1Z67A 3ZR8X 5A2QZ 4UUSA 3DKWA 3OOPA 1B72A 2XGCA 1DPRA 2Z16A 1IRFA 3AG4H 4QSHA 1Z3XA 3RKYA 1YW7A 2EIJH 3OV8A 4C2UA 3HJEA 3S2WA 5L3BA 3OYHA 2M8EA 4W1UA 3GUDA 3WU0A 2QWWA 2F4IA 4U0VA 4B3AA 2ESNA 4C9YA 5GAGJ 2RGVA 4MEYF 3S17J 2DA5A 2BHYA 2PLYA 3FXUA 3WG9A 2JA8J 4XRSA 2ECBA 1W4MA 1NK2P 2QENA 4MFDA 4OIOF 5J1UA 2AXTC 1P4WA 3LSHA 1R00A 3IRRA 3BP8A 5M3FJ 2HYFA 2ZMEC 3SFZA 2HEOA 4ESBA 4GO1A 1WJEA 4OIRF 4M6YA 3SHFA 2BBYA 2DA3A 3SDGA 4KA4A 2XV4S 3I64A 4F55A 1R58A 4ZDLA 1FT9A 1OCZH 2LLKA 4MFEA 5EDNA 4HQMA 4P96A 4ZJZA 1Y8RB 3CCMI 1HDDC 4NC8A 1MBJA 2ME6A 4GXOA 4G6QA 1YJNI 3AG2H 1D0ZA 1U9NA 3EUAA 2FMYA 2V9VA 3S3OA 4HSRA 2X9DA 4JYKA 5M5XJ 3JSPA 1KU7A 2VQHA 1V5GA 1ZG1A 2DYRH 5K1YA 1P4AA 2KHMA 2DDAA 1E3HA 2WAQN 1XDUA 3FZVA 4DJAA 3DFGA 1LE8A 3OYLA 3G2BA 4U7BA 5FGMA 2E36A 2UV1A 1G3WA 3PFYA 3RDIA 3HSEA 4NQWA 4HDVA 4LGWA 4W97A 3JTHA 2ACJA 2X0LA 2FXAA 4CCLA 1WJ5A 5F04A 1I6XA 2LBFB 2L02A 1VQ4I 3S16J 1YIOA 2ID3A 1MSEC 2ZXHA 2QQ8A 5IT3A 1U5TB 3SEZA 1T95A 2XKPA 4UVAA 3I5UA 2GXBA 1A6IA 4YFNF 3CMMA 3ZQFA 3GZNB 3WG7H 3R60A 1UHMA 3BR3A 4RBOA 1OMIA 1R36A 1XN7A 2WY8Q 5LHIA 5ICGA 1W7PA 2IGNA 4XBFA 2HI3A 1YOVB 4QIWN 3A4CA 4CCOA 4XM3A 5K7ZA 1MNEA 3T5XA 4E7JA 1XSDA 2ZMEB 3DBRB 4A3MJ 3EPZA 4JX4A 3WHCA 1IN8A 1P6RA 2EZIA 4G6TB 2JVHA 2Z1DA 1WH5A 1BW6A 3FKIJ 2V1UA 1LDKB 3KYDB 3ZMZA 1OLTA 3SZTA 1S8NA 1U78A 3QU3A 2IS2A 3X2QH 2CUJA 2RKHA 2PJPA 3V4GA 2DMTA 1MMGA 3DLAA 3AG3H 3M9AA 4L9TA 2ESHA 1YG2A 4ESJA 1V55H 1J75A 3S15J 2CO5A 4ITVA 2BHZA 4ZZLA 2O8KA 3E6CC 3BCAA 2V6EA 1XGMA 1XC5A 3S1QJ 1D5YA 1BIBA 5HDGA 3AFHA 3I3LA 2KPMA 3H3VK 3ZMTA 1YITI 2OJED 4E4HA 1W36D 3G1LA 1QRYA 1V5EA 3WTSC 2W4SA 3W2WA 2CV2A 3RQ4A 2QYOA 1OYYA 1U5TC 1BI3A 2LRDA 2VJ5A 3OSFA 1SFUA 2X4HA 5FD5A 3ZQIA 2JPBA 1D8KA 2DLLA 2OQGA 3V8KA 2ID6A 3R0AA 2EFNA 3ABTA 1KQ9A 1UG2A 4A3GJ 1D1AA 1AU7A 4A5NA 3TO9A 3S1RJ 4IX7A 3DPTA 1S5LC 3ISPA 5FKKA 3K1MA 5FO5A 2CV1A 1BI0A 3IP4B 3OIPA 2AS5F 3VYRB 1BC7C 5IPAA 1H8AC 1XPXA 3IH3A 1BW5A 4AVPA 5HLGA 2XGXA 1MBHA 3J7AO 3MKLA 4IHYA 2JA6J 3JAMZ 2OBPA 2F2EA 1SFXA 4G6DA 4LFUA 4LD5A 4CHUA 3NWSA 3M1CA 4KISA 3MKWB 2E1CA 1MDMA 1R23A 2JWTA 4CZCA 1RPWA 2CQKA 2HQNA 4XN3A 4B8XA 4U0YA 1XTAA 3I71A 1DP3A 3RQIA 3L9FA 3R0JA 3J80K 3DCFA 2FBKA 2FMLA 3F0CA 3M3YJ 1R5ID 3BQYA 1X4OA 2JA5J 2ZXWH 3VODA 4G12A 3L2VA 2M30A 2VXDA 4D5FA 2R7OA 1XB4A 1IDZA 2NVXJ 2H09A 2KIMA 3I55I 5E18F 3HUGB 3VSKA 3RJPA 1PDNC 1GVJA 3PL8A 2E19A 1O3SA 4EJTA 2CUFA 4RB0A 1FBQA 5TGTA 5E3OA 3IV5A 1BOBA 1X3ZB 4LB6B 5CQEA 2BW3B 3FXLA 5KCMA 1SMYF 1JKRC 1SD7A 1JUSA 4HW0A 2L4MA 4DYCA 4BEHB 4IO9F 1TQMA 1TL8A 1U5TA 2YUSA 3F22A 1U8RA 1E2XA 3KP6A 5DD4A 5DUIA 2MD5A 2B63J 1R9TJ 2DTRA 3ML6A 3I58A 2ZSHB 2Z9OA 3I54A 3F72A 4RGUA 1B59A 4XKBA 2W00A 4V2FA 5D4SA
chains in the Genus database with same CATH topology
5LGNA 4LMYA 5AIPA 2P7CB 4M6XA 2EV0A 3M7GA 1A04A 1BM9A 2EFOA 3QAHA 1Z05A 1H9TA 3E5QA 4EM2A 1HW5A 3U1DA 4HBLA 1LVAA 1JHFA 3BY6A 4QLCU 4HF2A 4MTEA 2FRHA 4RGRA 3MZYA 2JSCA 2D2WA 5DYMA 4BYYA 3B73A 3WTUC 3LWFA 3RYRA 2MLKA 3LA2A 4BAYA 4A6EA 4D0PA 4RGSA 4CZZA 3NQOA 3WTZA 4UV9A 2LF8A 3F23A 4A0ZA 2IJLA 2FBIA 1BIAA 1OYIA 1RZ4A 4Q47A 2P4WA 3WU1B 3TO6A 1XDSA 5J8FA 3JTGA 4KN4X 3M1EA 5AIQA 2QM3A 2QVOA 5BS6A 1IXSB 3O2PE 1UFMA 2IA0A 1TTYA 1WKMA 1HBXG 4CYDA 1PP7U 2OA4A 3HRUA 4EJWA 4I7HA 3KEOA 4DNCA 2YX4A 4RB2C 1SAXA 1W7PD 2H94A 2EV6A 1P4XA 3V7CA 3SZPA 4RB3C 1ZREA 5CLSA 3TDUC 4N9HA 4A6DA 2H27A 1FSHA 3CO6C 4OU0A 4EQQA 2HWVA 1HXDA 5CVJA 3HYIA 4IPAA 1ONVA 4M9SA 3R6SA 4OMZA 4UVBA 3MQ0A 3DP7A 2L3DA 3K1PA 3W6JB 1ZHFA 3EQLF 2KKOA 4O6JA 1OPCA 3ZMDA 1IN7A 2K02A 1HSJA 1B4AA 2VOOA 1H0MA 3GWZA 4EJVA 5BQTA 2V79A 3GLXA 1Y0UA 3REOA 4MNUA 3LAPA 1KU2A 4IF4A 3T0YA 4LB5A 2VODA 1MDMB 2OQRA 1B9MA 3FMSA 5ILVA 4CICA 6PAXA 2MH9A 1FNNA 3TDZC 2VBYA 3TGNA 4Q4ZF 5L3GA 4M9ZA 5DEQA 2FF4A 2VBXA 4MQVA 3RI4A 1O3TA 1WI9A 4K2EA 4LG0A 5DCMB 1R22A 1GHCA 4JBAA 4AIKA 3BJ6A 2VC1A 3ECHA 4LK1F 4XLNF 4YFXF 4OMYA 2HGCA 4EJUA 4QWQA 3FM3A 4HZFA 2B0LA 3GVAA 2K86A 4A2UA 4I09A 5TRDA 4I02A 3ZMUA 2W84A 4KN7X 4PCQA 1YS7A 3O6BB 2CGPA 2XAFA 5ICEA 3F8FA 2MA3A 2IVMA 1ZAOA 2A6HF 4EJOA 3FM5A 4YFKF 2QBYA 3I59B 3D0SA 4E70A 1FLIA 5LHHA 1MGTA 2XAGA 5FD6A 1YLFA 2W24A 1FOKA 4PGHA 3QOPA 3CJNA 4M74A 2XROA 2BE5F 4Q48A 3I0TA 3GEZA 5LGUA 2P5LC 3KLOA 2Q8KA 1QZYA 2O3FA 2MLGA 5HVQC 2ZFWA 5ICCA 2PBIA 1IUYA 5F1RA 3EUHA 5ERIA 2XHKA 4CDGA 4G7ZF 5L3CA 5HS8A 3D5LA 4Y13A 1EH6A 1IN5A 1ON2A 1JHHA 3HRSA 1FYKA 4GYIA 2A61A 3MFKA 3GX4X 3E5XA 1HQCA 2ISZA 4Z2YA 1F9NA 1MJ9A 4EV0A 3GFJA 1ZLJA 5D8KB 2XRNA 1HW2A 5HLIA 3F8MA 1FC3A 1K6OA 1SD6A 3BOQA 5ICFA 3CLOA 3BJAA 5L3EA 4XSXF 1T38A 2VE9A 5EEGA 3U9GA 2VXZA 2EFPA 1YYVA 3EDPA 1HSTA 4P55A 3ZQ7A 2NNYA 3GZ5A 4EM0B 2A6EF 3HOSA 5BMZA 2E7XA 3BJOA 4IRGA 4NB5A 4UXNA 4ENMA 4U88A 2KIUA 4N0BA 1F1ZA 3FWEA 4HF1A 3F3XA 2XAHA 5D8LB 2OU2A 3RPUA 4BNCA 3KZYA 3EETA 2ZMEA 3MAJA 2QLZA 2Z33A 2GWRA 1G4DA 2AXLA 1LB2A 2V1XA 1IXCA 3EYIA 2F5EA 1O57A 3DPLC 2XASA 3KE2A 3IWFA 1RUOA 3FMRA 1K78B 2R3SA 2VBZA 2GXGA 4DQ2A 2D1VA 4HA8A 3SQNA 1HKSA 5CYVA 3BPXA 1TNTA 1Z1DA 4IHSA 1XGOA 3CDHA 1QPMA 1Z91A 5J8CA 4LLLA 1ZLKA 4LLGF 3BZ6A 2DI3A 1FPQA 3J80Z 4WX9A 1LNWA 1ZG5A 1USSA 1TQPA 2FU4A 1S7OA 3L7WA 5E1ZB 2DPDA 4S04A 4RS8A 2VT2A 3VFZA 3PQJA 2IT0A 4ZH4F 5LGTA 2IW5A 2H6BA 4BH9A 3RKXA 4NHJA 2GQQA 1O3QA 2G9WA 3JAMK 2DU9A 2K4JA 3K69A 4MGRA 3IRQA 2WWYA 4G7HF 4R1HA 5L3DA 2NRAC 2CG4A 2KIFA 2C6YA 4KIBA 3ECOA 3JSOA 2XUBA 1FBSA 4I01A 2PMUA 2EJRA 2K27A 2IA2A 3H92A 2BEOA 2Y0MA 4FX0A 1K78A 3HHHA 4HV6A 3V7SA 2HTSA 3J81Z 1NHAA 2HTJA 4IXAA 3IWZA 3L00A 1KQ8A 4YIIA 2D1HA 3IL2A 3M8FA 2EK5A 2W57A 3C18A 2XVCA 1RIOH 2ETHA 1Q1HA 1Z6RA 1ZG3A 5JR3A 4RGXA 5FLXZ 1MZBA 1KU9A 2QUFA 3CUQB 5D5WB 1ZRDA 2HKOA 1XSVA 4U7DA 5HDKA 4EMSA 1J9IA 1XD7A 4RAZA 1U3EM 2DFIA 2FE3A 1J0RA 2P7VB 4YIFA 3CUOA 4KICA 1IF1A 1FX7A 4LK0F 5D5VB 2JTVA 2ISYA 3FXQA 4I0BA 5E8GA 1IAWA 1SFEA 3DEUA 3P9IA 4LJZF 4UV8A 1ZARA 2W85A 4I98B 2GA1A 4P9FA 5K5OA 3T8RA 3KP2A 4RB1A 2F5DA 1OR7A 3E6MA 1G6NA 3TO7A 1O7FA 2G7UA 5D5UB 2PQ8A 3P9CA 5D6FA 2WV0A 3CUQC 3GFMA 1W5SA 3WTVC 4HDUA 4PDKA 1R1TA 4ZYHA 1ZN2A 1D5VA 2EFQA 2L54A 2VONA 2LDUA 2P5VA 3L09A 2NS0A 5LRRA 3BPVA 3V8JA 2R7FA 1T98A 2Q2EA 2WC2A 4WF2A 1SD5A 1BN5A 1UCRA 1ODDA 1R7JA 5FB2A 3IKTA 2LF7A 2UWMA 1R5HA 2OZ6A 3ZN1A 3M8EA 3GXOA 2EV5A 1LEAA 2NYXA 1FZPB 4HYEA 4F7ZA 3IC7A 3FF5A 4KDPA 3ELKA 3O3KA 1MKMA 5FFZA 3GO5A 3J81K 2M87A 4ZZDA 4BQAA 1USTA 3Q5FA 4M9XA 2YSRA 3WGHA 1W5TA 1T6SA 2RVCA 1EH7A 2OD5A 1DP7P 4OIQF 1BJAA 2Z99A 1DDNA 1FYLA 4Y15A 1XGSA 2EWNA 4EVIA 1B6AA 1SD4A 4ZYEA 1F5TA 4BHCA 4UUVA 5DDGA 4MEXF 2DO7A 2K4BA 5DV5A 3E3VA 1MJBA 3T8TA 1KQ0A 1PUEE 4BHBA 3B02A 2COMA 1QBJA 2FA5A 3GW2A 1IN6A 3Q9VA 1WRJA 4EGYA 3F6VA 2JRTA 4HF0A 5E17F 1XCBA 3Q9SA 2O0YA 4I2OA 2GIVA 2A69F 4ASNA 5FFXA 1R5GA 1XMAA 1PP8F 1UB9A 3QPHA 3P7NA 4G9YA 3COAC 3DQVC 3E97A 1G3TA 1OKRA 4WCGA 4L0ZB 4KNYA 2VE8A 3V7RA 2PI0A 4IVNA 2FOKA 4TV7A 2J5OA 4L0YB 2J5PA 1WQ2A 3QU6A 2ZXJA 5D4RA 3C1DA 2E7WA 5CVUA 4G7OF 1QZZA 4HX4A 1XMKA 1QO0D 1OYWA 2A68F 1K79A 1FP2A 3F8BA 4MQ9F 4L9VA 4L5JA 5LEKA 2G7HA 3LAJA 3CTAA 3MWMA 1ULYA 5F64A 2IP2A 3HRTA 2Y48A 2KJBA 5BOXA 3FMQA 3QP6A 4A0XA 3TOAA 2ZCWA 1BC8C 2PEXA 5DUKA 1KU3A 2XKOA 2MH2A 1QNTA 3WTYC 3ULQB 3KCCA 5CJ9A 3RTRA 1BI2A 4P9UA 2QZ8A 3K2ZA 5HLHA 3HOTA 3ZMVA 4Q5SF 1DPUA 3AAFA 1T39A 3PQKA 1AOYA 2QBYB 2RNJA 1K7AA 3FHZA 5ILUA 1JXSA 1V4RA 1D8JA 1BOAA 1KA8A 5JVTA 5HS7A 5CVIA 3RPQA 1D3YA 4MHGA 3L2CA 5CVRA 3KP4A 1T0FA 3ERED 3RYPA 3GYHX 3LSTA 3TOBA 2JT1A 2ZJ2A 4LG0B 2DW4A 2HKXA 3ZP5A 1IXRC 3SXYA 2LKPA 2OAZA 1QQIA 4M73A 2PN6A 1P92A 4WXCA 1ZYRF 2YR2A 4R8HA 2Z3YA 4BXUA 1J2XA 4GYGA 1IZ1A 3N97A 3QRFF 3BWGA 2PMHA 4AWXB 1J7KA 2IPQX 2V6CA 3T1BA 2STTA 2ZO4A 1S3JA 1IN4A 2Y75A 2H6CA 2YU3A 3H3ZA 1LDDA 2P5KA 4EGZA 3LA7A 4HLXA 4AD9A 4CGZA 3CUQA 1I27A 4ON0A 2LSOA 2GA2A 3N4MA 2VT3A 1E17A 4EM1A 3F21A 4M72A 1G3YA 4JQFA 1HKTA 4B09A 3DXJF 2DK8A 5BPIA 1P2FA 4IJAA 2ZBKA 2L4AA 3ZPLA 4MTDA 2Q0OA 2RV8A 1FYMA 2XIGA 4U0WA 1FSEA 2FSWA 3P9KA 3C7JA 5LRSA 2RDPA 4KYWA 1XGNA 3C3WA 3R4KA 1U6GA 2R7DA 3VEPA 2P6SA 3KLNA 4FX4A 4HLYA 4IRIA 1AWCA 3GFIA 2FNAA 3K1NA 2STWA 2CYYA 1YW9A 1R1VA 4P5OA 2IRFG 1CF7B 1YW8A 3WTWC 3ZN0A 4M71A 5AONA 1ZGAA 4ENJA 1L3LA 3I53A 2GZWA 1FY7A 3HRMA 2D45A 2VN2A 1STZA 2M1BA 3FXRA 2QQAA 3MCZA 5E1XA 3F8NA 2HQRA 3TQNA 5D5XB 2FNPA 5E1WA 3WE2A 3KZZA 1LEBA 4N9IA 2UXXA 5K5QA 2P6TA 3QP5A 4KMFA 1ZH5A 3U2RA 1Z9CA 5HOOA 4AIJA 3MZHA 2OZUA 4ENNA 3F8CA 4HAMA 1X3UA 3HSRA 1JGSA 3HHGA 1S29A 2K7LA 2CWEA 4O5VA 1WWXA 2F5FA 2GAUA 2FBHA 4HV5A 2HDCA 5HDNA 3WODF 1HW1A 2W25A 3NRVA 5CVVA 3G73A 1Z7UA 3I4PA 2ZKZA 2NAZA 2TDXA 1FBUA 1SMTA 4ESFA 3HSFA 3QPTA 4WWCA 5KVRA 4OIPF 2BV6A 3RIRA 1WSUA 5A2QK 5DD8A 2DQRA 3R61A 4WK8F 3G3ZA 1BI1A 3BROA 2JZYA 2DQLA 2EB7A 5E8IA 5DCMA 1H9GA 1ON1A 4Y17A 1ZRCA 4KFCA 2UXNA 2PG4A 3MEXA 4A0YA 2M5WA 1MD0A 2DAOA 5H20A 1FP1D 1KGSA 5LBQA 2VBWA 2O8XA 5DCFA 4HOBA 3VB2A 1KYWA 3KP3A 2IA1A 5D6EA 4A5MA 3CO7C 2VOPA 5K5RA 1U2WA 2Z5UA 5BPDA 4KMUX 5JI6A 3HUGA 5IT9K 1J5YA 1TW2A 5IT9Z 1O3RA 1YS6A 3F6OA 1G3SA 4H0EA 4LLNA 2PFBA 5JHUA 2WTEA 1R1UA 4S05A 3K0LA 1ZGJA 3DV8A 1O7LA 1B9NA 2MC3A 4KIGA 1VTNC 1QGPA 2HYGD 2QQBA 5EEHA 1FWZA 4GCVA 4HX8A 3GZ6A 1UHWA 2UZKA 2DPUA 1EH8A 3LQQA 3KETA 3V8LA 4UHTA 4L9NA 2DT5A 2HR3A 1RNLA 4WXHA 4L18B 4ETSA 3NEUA 4KT5C 4HQEA 4XSZF 4FHTA 5HS9A 3WGGA 3E6DA 3HTUA 1YTYA 2VC0A 1YFHA 4YG2F 1HKQA 2V1DA 4RAYA 3HTSB 3WGIA 2EA4A 1YQAA 1BBYA 3E6BA 3LQRA 3RKWA 2RN7A 5ILSA 3FX3A 2NNNA 4XRFA 2EA2A 5L3FA 4O3MA 1ZRFA 1JE8A 5KK1A 1TLHB 2ADUA 1C0WA 5LEJA 2RC4A 1LJ9A 1B1BA 4WXDA 3ZMSA 3I59A 2E1NA 1TW3A 3DF8A 1REPC 5F6FA 4FT8A 4UNOA 3BDDA 3KFWX 2BYVE 3WTTC 2L01A 2F5CA 1TBXA 2ELHA 4IRHA 2YPRA 2FEZA 2ZNYA 2XAQA 2A3SA 1DUXC 5E20A 1CF7A 1LDJA 3HIFA 2O6GE 5JFRA 4ZYDA 1XCVA 2HFHA 1Z6TA 1LQ1A 3LFKA 5J6XA 1EV7A 1YO5C 4GGGA 5H6QA 3JW4A 4BHPA 1I1GA 3LA3A 3PFIA 5FLXK 4AIHA 2FQ3A 1T2KA 1F4KA 1V3FA 2HOEA 5TJJA 1MJAA 2A07F 1GXQA 4I0AA 3E5UA 3KEQA 4PGGA 2P8TA 1IW7F 1IRGA 3W6KB 4L5IA 4ZYGA 3TKYA 1L0OC 1J59A 1GXPA 1RI7A 1XSXA 1CGPA 1S6LA 2CFXA 2KJCA 3K9TA 4A12A 3ROUA 2QQ9A 4XLPF 2HZTA 2XAJA 4L9JA 4CXFA 1RUNA 2MBFA 4OOIA 2DBBA 3KP5A 2EFWA 5LHGA 2KRFA 3WE3A 4G8XA 2RQPA 2CSOA 3ABUA 2ZNZA 3IHUA 2O03A 2HS5A 4KUMA 3IKVA 2CW0F 4G94A 1S7AA 2BGCA 4CO8A 4UVCA 4ENKA 2YX7A 3GFLA 2DK5A 5H6RA 2JPCA 1KYZA 1W7PB 3GF2A 4OINF 2A5YB 5ED4A 2LNBA 3WTXC 4R79A 1I1SA 2O61A 3H3UA 3VOEA 1TQIA 4JK1X 5LLQA 4KIFA 2M45A 3KP7A 4IHTA 1I5ZA 1TNSA 3EYYA 4PZJA 4HX7A 5A2QZ 3DKWA 3OOPA 1DPRA 1IRFA 3RKYA 1YW7A 3OV8A 3S2WA 5L3BA 2M8EA 3GUDA 3WU0A 2QWWA 4U0VA 2ESNA 2RGVA 4MEYF 2PLYA 3FXUA 3WG9A 1W4MA 2QENA 4OIOF 1P4WA 1R00A 3IRRA 3BP8A 2HYFA 3SFZA 2HEOA 4ESBA 4GO1A 3SHFA 4OIRF 4M6YA 2BBYA 4KA4A 2XV4S 3I64A 1R58A 1FT9A 4HQMA 4P96A 4GXOA 4G6QA 2FMYA 2V9VA 3JSPA 1KU7A 1ZG1A 5K1YA 1P4AA 3FZVA 1XDUA 3DFGA 4U7BA 5FGMA 1G3WA 3RDIA 3HSEA 4NQWA 4HDVA 4LGWA 3JTHA 2ACJA 2X0LA 2FXAA 1I6XA 2L02A 1YIOA 5IT3A 1U5TB 2XKPA 4UVAA 3I5UA 2GXBA 4YFNF 3R60A 1UHMA 1OMIA 1R36A 1XN7A 5LHIA 5ICGA 1W7PA 4XBFA 3T5XA 1XSDA 2ZMEB 1IN8A 1P6RA 2V1UA 1LDKB 3ZMZA 1U78A 3SZTA 1S8NA 3QU3A 2RKHA 2PJPA 3V4GA 3M9AA 4L9TA 2ESHA 1YG2A 4ESJA 1J75A 2CO5A 4ZZLA 3E6CC 1XGMA 1BIBA 5HDGA 3ZMTA 3WTSC 2QYOA 1OYYA 1U5TC 1BI3A 1SFUA 2X4HA 5FD5A 2JPBA 1D8KA 2DLLA 2OQGA 3V8KA 3R0AA 2EFNA 3ABTA 1KQ9A 4A5NA 3TO9A 3DPTA 3ISPA 5FO5A 3K1MA 1BI0A 2AS5F 1BC7C 4AVPA 5HLGA 2XGXA 3J7AO 3JAMZ 2OBPA 2F2EA 1SFXA 4G6DA 4LFUA 4LD5A 4CHUA 2E1CA 1MDMA 1R23A 2CQKA 2HQNA 4U0YA 4B8XA 3I71A 3L9FA 3R0JA 3J80K 2FBKA 2FMLA 3VODA 2M30A 1XB4A 2H09A 2KIMA 5E18F 3RJPA 1PDNC 1GVJA 1O3SA 4EJTA 4RB0A 1FBQA 4LB6B 1SMYF 1SD7A 4HW0A 2L4MA 1TQMA 1U5TA 3F22A 1U8RA 1E2XA 3KP6A 5DD4A 5DUIA 2MD5A 2DTRA 3ML6A 3I58A 2Z9OA 3I54A 3F72A 4RGUA 1B59A 5D4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LGN A;  4LMY A;  5AIP A;  2P7C B;  4M6X A;  2EV0 A;  3M7G A;  1A04 A;  1BM9 A;  2EFO A;  3QAH A;  1Z05 A;  1H9T A;  3E5Q A;  4EM2 A;  1HW5 A;  3U1D A;  4HBL A;  1LVA A;  1JHF A;  3BY6 A;  4QLC U;  4HF2 A;  4MTE A;  2FRH A;  4RGR A;  3MZY A;  2JSC A;  2D2W A;  5DYM A;  4BYY A;  3B73 A;  3WTU C;  3LWF A;  3RYR A;  2MLK A;  3LA2 A;  4BAY A;  4A6E A;  4D0P A;  4RGS A;  4CZZ A;  3NQO A;  3WTZ A;  4UV9 A;  2LF8 A;  3F23 A;  4A0Z A;  2IJL A;  2FBI A;  1BIA A;  1OYI A;  1RZ4 A;  4Q47 A;  2P4W A;  3WU1 B;  3TO6 A;  1XDS A;  5J8F A;  3JTG A;  4KN4 X;  3M1E A;  5AIQ A;  2QM3 A;  2QVO A;  5BS6 A;  1IXS B;  3O2P E;  1UFM A;  2IA0 A;  1TTY A;  1WKM A;  1HBX G;  4CYD A;  1PP7 U;  2OA4 A;  3HRU A;  4EJW A;  4I7H A;  3KEO A;  4DNC A;  2YX4 A;  4RB2 C;  1SAX A;  1W7P D;  2H94 A;  2EV6 A;  1P4X A;  3V7C A;  3SZP A;  4RB3 C;  1ZRE A;  5CLS A;  3TDU C;  4N9H A;  4A6D A;  2H27 A;  1FSH A;  3CO6 C;  4OU0 A;  4EQQ A;  2HWV A;  1HXD A;  5CVJ A;  3HYI A;  4IPA A;  1ONV A;  4M9S A;  3R6S A;  4OMZ A;  4UVB A;  3MQ0 A;  3DP7 A;  2L3D A;  3K1P A;  3W6J B;  1ZHF A;  3EQL F;  2KKO A;  4O6J A;  1OPC A;  3ZMD A;  1IN7 A;  2K02 A;  1HSJ A;  1B4A A;  2VOO A;  1H0M A;  3GWZ A;  4EJV A;  5BQT A;  2V79 A;  3GLX A;  1Y0U A;  3REO A;  4MNU A;  3LAP A;  1KU2 A;  4IF4 A;  3T0Y A;  4LB5 A;  2VOD A;  1MDM B;  2OQR A;  1B9M A;  3FMS A;  5ILV A;  4CIC A;  6PAX A;  2MH9 A;  1FNN A;  3TDZ C;  2VBY A;  3TGN A;  4Q4Z F;  5L3G A;  4M9Z A;  5DEQ A;  2FF4 A;  2VBX A;  4MQV A;  3RI4 A;  1O3T A;  1WI9 A;  4K2E A;  4LG0 A;  5DCM B;  1R22 A;  1GHC A;  4JBA A;  4AIK A;  3BJ6 A;  2VC1 A;  3ECH A;  4LK1 F;  4XLN F;  4YFX F;  4OMY A;  2HGC A;  4EJU A;  4QWQ A;  3FM3 A;  4HZF A;  2B0L A;  3GVA A;  2K86 A;  4A2U A;  4I09 A;  5TRD A;  4I02 A;  3ZMU A;  2W84 A;  4KN7 X;  4PCQ A;  1YS7 A;  3O6B B;  2CGP A;  2XAF A;  5ICE A;  3F8F A;  2MA3 A;  2IVM A;  1ZAO A;  2A6H F;  4EJO A;  3FM5 A;  4YFK F;  2QBY A;  3I59 B;  3D0S A;  4E70 A;  1FLI A;  5LHH A;  1MGT A;  2XAG A;  5FD6 A;  1YLF A;  2W24 A;  1FOK A;  4PGH A;  3QOP A;  3CJN A;  4M74 A;  2XRO A;  2BE5 F;  4Q48 A;  3I0T A;  3GEZ A;  5LGU A;  2P5L C;  3KLO A;  2Q8K A;  1QZY A;  2O3F A;  2MLG A;  5HVQ C;  2ZFW A;  5ICC A;  2PBI A;  1IUY A;  5F1R A;  3EUH A;  5ERI A;  2XHK A;  4CDG A;  4G7Z F;  5L3C A;  5HS8 A;  3D5L A;  4Y13 A;  1EH6 A;  1IN5 A;  1ON2 A;  1JHH A;  3HRS A;  1FYK A;  4GYI A;  2A61 A;  3MFK A;  3GX4 X;  3E5X A;  1HQC A;  2ISZ A;  4Z2Y A;  1F9N A;  1MJ9 A;  4EV0 A;  3GFJ A;  1ZLJ A;  5D8K B;  2XRN A;  1HW2 A;  5HLI A;  3F8M A;  1FC3 A;  1K6O A;  1SD6 A;  3BOQ A;  5ICF A;  3CLO A;  3BJA A;  5L3E A;  4XSX F;  1T38 A;  2VE9 A;  5EEG A;  3U9G A;  2VXZ A;  2EFP A;  1YYV A;  3EDP A;  1HST A;  4P55 A;  3ZQ7 A;  2NNY A;  3GZ5 A;  4EM0 B;  2A6E F;  3HOS A;  5BMZ A;  2E7X A;  3BJO A;  4IRG A;  4NB5 A;  4UXN A;  4ENM A;  4U88 A;  2KIU A;  4N0B A;  1F1Z A;  3FWE A;  4HF1 A;  3F3X A;  2XAH A;  5D8L B;  2OU2 A;  3RPU A;  4BNC A;  3KZY A;  3EET A;  2ZME A;  3MAJ A;  2QLZ A;  2Z33 A;  2GWR A;  1G4D A;  2AXL A;  1LB2 A;  2V1X A;  1IXC A;  3EYI A;  2F5E A;  1O57 A;  3DPL C;  2XAS A;  3KE2 A;  3IWF A;  1RUO A;  3FMR A;  1K78 B;  2R3S A;  2VBZ A;  2GXG A;  4DQ2 A;  2D1V A;  4HA8 A;  3SQN A;  1HKS A;  5CYV A;  3BPX A;  1TNT A;  1Z1D A;  4IHS A;  1XGO A;  3CDH A;  1QPM A;  1Z91 A;  5J8C A;  4LLL A;  1ZLK A;  4LLG F;  3BZ6 A;  2DI3 A;  1FPQ A;  3J80 Z;  4WX9 A;  1LNW A;  1ZG5 A;  1USS A;  1TQP A;  2FU4 A;  1S7O A;  3L7W A;  5E1Z B;  2DPD A;  4S04 A;  4RS8 A;  2VT2 A;  3VFZ A;  3PQJ A;  2IT0 A;  4ZH4 F;  5LGT A;  2IW5 A;  2H6B A;  4BH9 A;  3RKX A;  4NHJ A;  2GQQ A;  1O3Q A;  2G9W A;  3JAM K;  2DU9 A;  2K4J A;  3K69 A;  4MGR A;  3IRQ A;  2WWY A;  4G7H F;  4R1H A;  5L3D A;  2NRA C;  2CG4 A;  2KIF A;  2C6Y A;  4KIB A;  3ECO A;  3JSO A;  2XUB A;  1FBS A;  4I01 A;  2PMU A;  2EJR A;  2K27 A;  2IA2 A;  3H92 A;  2BEO A;  2Y0M A;  4FX0 A;  1K78 A;  3HHH A;  4HV6 A;  3V7S A;  2HTS A;  3J81 Z;  1NHA A;  2HTJ A;  4IXA A;  3IWZ A;  3L00 A;  1KQ8 A;  4YII A;  2D1H A;  3IL2 A;  3M8F A;  2EK5 A;  2W57 A;  3C18 A;  2XVC A;  1RIO H;  2ETH A;  1Q1H A;  1Z6R A;  1ZG3 A;  5JR3 A;  4RGX A;  5FLX Z;  1MZB A;  1KU9 A;  2QUF A;  3CUQ B;  5D5W B;  1ZRD A;  2HKO A;  1XSV A;  4U7D A;  5HDK A;  4EMS A;  1J9I A;  1XD7 A;  4RAZ A;  1U3E M;  2DFI A;  2FE3 A;  1J0R A;  2P7V B;  4YIF A;  3CUO A;  4KIC A;  1IF1 A;  1FX7 A;  4LK0 F;  5D5V B;  2JTV A;  2ISY A;  3FXQ A;  4I0B A;  5E8G A;  1IAW A;  1SFE A;  3DEU A;  3P9I A;  4LJZ F;  4UV8 A;  1ZAR A;  2W85 A;  4I98 B;  2GA1 A;  4P9F A;  5K5O A;  3T8R A;  3KP2 A;  4RB1 A;  2F5D A;  1OR7 A;  3E6M A;  1G6N A;  3TO7 A;  1O7F A;  2G7U A;  5D5U B;  2PQ8 A;  3P9C A;  5D6F A;  2WV0 A;  3CUQ C;  3GFM A;  1W5S A;  3WTV C;  4HDU A;  4PDK A;  1R1T A;  4ZYH A;  1ZN2 A;  1D5V A;  2EFQ A;  2L54 A;  2VON A;  2LDU A;  2P5V A;  3L09 A;  2NS0 A;  5LRR A;  3BPV A;  3V8J A;  2R7F A;  1T98 A;  2Q2E A;  2WC2 A;  4WF2 A;  1SD5 A;  1BN5 A;  1UCR A;  1ODD A;  1R7J A;  5FB2 A;  3IKT A;  2LF7 A;  2UWM A;  1R5H A;  2OZ6 A;  3ZN1 A;  3M8E A;  3GXO A;  2EV5 A;  1LEA A;  2NYX A;  1FZP B;  4HYE A;  4F7Z A;  3IC7 A;  3FF5 A;  4KDP A;  3ELK A;  3O3K A;  1MKM A;  5FFZ A;  3GO5 A;  3J81 K;  2M87 A;  4ZZD A;  4BQA A;  1UST A;  3Q5F A;  4M9X A;  2YSR A;  3WGH A;  1W5T A;  1T6S A;  2RVC A;  1EH7 A;  2OD5 A;  1DP7 P;  4OIQ F;  1BJA A;  2Z99 A;  1DDN A;  1FYL A;  4Y15 A;  1XGS A;  2EWN A;  4EVI A;  1B6A A;  1SD4 A;  4ZYE A;  1F5T A;  4BHC A;  4UUV A;  5DDG A;  4MEX F;  2DO7 A;  2K4B A;  5DV5 A;  3E3V A;  1MJB A;  3T8T A;  1KQ0 A;  1PUE E;  4BHB A;  3B02 A;  2COM A;  1QBJ A;  2FA5 A;  3GW2 A;  1IN6 A;  3Q9V A;  1WRJ A;  4EGY A;  3F6V A;  2JRT A;  4HF0 A;  5E17 F;  1XCB A;  3Q9S A;  2O0Y A;  4I2O A;  2GIV A;  2A69 F;  4ASN A;  5FFX A;  1R5G A;  1XMA A;  1PP8 F;  1UB9 A;  3QPH A;  3P7N A;  4G9Y A;  3COA C;  3DQV C;  3E97 A;  1G3T A;  1OKR A;  4WCG A;  4L0Z B;  4KNY A;  2VE8 A;  3V7R A;  2PI0 A;  4IVN A;  2FOK A;  4TV7 A;  2J5O A;  4L0Y B;  2J5P A;  1WQ2 A;  3QU6 A;  2ZXJ A;  5D4R A;  3C1D A;  2E7W A;  5CVU A;  4G7O F;  1QZZ A;  4HX4 A;  1XMK A;  1QO0 D;  1OYW A;  2A68 F;  1K79 A;  1FP2 A;  3F8B A;  4MQ9 F;  4L9V A;  4L5J A;  5LEK A;  2G7H A;  3LAJ A;  3CTA A;  3MWM A;  1ULY A;  5F64 A;  2IP2 A;  3HRT A;  2Y48 A;  2KJB A;  5BOX A;  3FMQ A;  3QP6 A;  4A0X A;  3TOA A;  2ZCW A;  1BC8 C;  2PEX A;  5DUK A;  1KU3 A;  2XKO A;  2MH2 A;  1QNT A;  3WTY C;  3ULQ B;  3KCC A;  5CJ9 A;  3RTR A;  1BI2 A;  4P9U A;  2QZ8 A;  3K2Z A;  5HLH A;  3HOT A;  3ZMV A;  4Q5S F;  1DPU A;  3AAF A;  1T39 A;  3PQK A;  1AOY A;  2QBY B;  2RNJ A;  1K7A A;  3FHZ A;  5ILU A;  1JXS A;  1V4R A;  1D8J A;  1BOA A;  1KA8 A;  5JVT A;  5HS7 A;  5CVI A;  3RPQ A;  1D3Y A;  4MHG A;  3L2C A;  5CVR A;  3KP4 A;  1T0F A;  3ERE D;  3RYP A;  3GYH X;  3LST A;  3TOB A;  2JT1 A;  2ZJ2 A;  4LG0 B;  2DW4 A;  2HKX A;  3ZP5 A;  1IXR C;  3SXY A;  2LKP A;  2OAZ A;  1QQI A;  4M73 A;  2PN6 A;  1P92 A;  4WXC A;  1ZYR F;  2YR2 A;  4R8H A;  2Z3Y A;  4BXU A;  1J2X A;  4GYG A;  1IZ1 A;  3N97 A;  3QRF F;  3BWG A;  2PMH A;  4AWX B;  1J7K A;  2IPQ X;  2V6C A;  3T1B A;  2STT A;  2ZO4 A;  1S3J A;  1IN4 A;  2Y75 A;  2H6C A;  2YU3 A;  3H3Z A;  1LDD A;  2P5K A;  4EGZ A;  3LA7 A;  4HLX A;  4AD9 A;  4CGZ A;  3CUQ A;  1I27 A;  4ON0 A;  2LSO A;  2GA2 A;  3N4M A;  2VT3 A;  1E17 A;  4EM1 A;  3F21 A;  4M72 A;  1G3Y A;  4JQF A;  1HKT A;  4B09 A;  3DXJ F;  2DK8 A;  5BPI A;  1P2F A;  4IJA A;  2ZBK A;  2L4A A;  3ZPL A;  4MTD A;  2Q0O A;  2RV8 A;  1FYM A;  2XIG A;  4U0W A;  1FSE A;  2FSW A;  3P9K A;  3C7J A;  5LRS A;  2RDP A;  4KYW A;  1XGN A;  3C3W A;  3R4K A;  1U6G A;  2R7D A;  3VEP A;  2P6S A;  3KLN A;  4FX4 A;  4HLY A;  4IRI A;  1AWC A;  3GFI A;  2FNA A;  3K1N A;  2STW A;  2CYY A;  1YW9 A;  1R1V A;  4P5O A;  2IRF G;  1CF7 B;  1YW8 A;  3WTW C;  3ZN0 A;  4M71 A;  5AON A;  1ZGA A;  4ENJ A;  1L3L A;  3I53 A;  2GZW A;  1FY7 A;  3HRM A;  2D45 A;  2VN2 A;  1STZ A;  2M1B A;  3FXR A;  2QQA A;  3MCZ A;  5E1X A;  3F8N A;  2HQR A;  3TQN A;  5D5X B;  2FNP A;  5E1W A;  3WE2 A;  3KZZ A;  1LEB A;  4N9I A;  2UXX A;  5K5Q A;  2P6T A;  3QP5 A;  4KMF A;  1ZH5 A;  3U2R A;  1Z9C A;  5HOO A;  4AIJ A;  3MZH A;  2OZU A;  4ENN A;  3F8C A;  4HAM A;  1X3U A;  3HSR A;  1JGS A;  3HHG A;  1S29 A;  2K7L A;  2CWE A;  4O5V A;  1WWX A;  2F5F A;  2GAU A;  2FBH A;  4HV5 A;  2HDC A;  5HDN A;  3WOD F;  1HW1 A;  2W25 A;  3NRV A;  5CVV A;  3G73 A;  1Z7U A;  3I4P A;  2ZKZ A;  2NAZ A;  2TDX A;  1FBU A;  1SMT A;  4ESF A;  3HSF A;  3QPT A;  4WWC A;  5KVR A;  4OIP F;  2BV6 A;  3RIR A;  1WSU A;  5A2Q K;  5DD8 A;  2DQR A;  3R61 A;  4WK8 F;  3G3Z A;  1BI1 A;  3BRO A;  2JZY A;  2DQL A;  2EB7 A;  5E8I A;  5DCM A;  1H9G A;  1ON1 A;  4Y17 A;  1ZRC A;  4KFC A;  2UXN A;  2PG4 A;  3MEX A;  4A0Y A;  2M5W A;  1MD0 A;  2DAO A;  5H20 A;  1FP1 D;  1KGS A;  5LBQ A;  2VBW A;  2O8X A;  5DCF A;  4HOB A;  3VB2 A;  1KYW A;  3KP3 A;  2IA1 A;  5D6E A;  4A5M A;  3CO7 C;  2VOP A;  5K5R A;  1U2W A;  2Z5U A;  5BPD A;  4KMU X;  5JI6 A;  3HUG A;  5IT9 K;  1J5Y A;  1TW2 A;  5IT9 Z;  1O3R A;  1YS6 A;  3F6O A;  1G3S A;  4H0E A;  4LLN A;  2PFB A;  5JHU A;  2WTE A;  1R1U A;  4S05 A;  3K0L A;  1ZGJ A;  3DV8 A;  1O7L A;  1B9N A;  2MC3 A;  4KIG A;  1VTN C;  1QGP A;  2HYG D;  2QQB A;  5EEH A;  1FWZ A;  4GCV A;  4HX8 A;  3GZ6 A;  1UHW A;  2UZK A;  2DPU A;  1EH8 A;  3LQQ A;  3KET A;  3V8L A;  4UHT A;  4L9N A;  2DT5 A;  2HR3 A;  1RNL A;  4WXH A;  4L18 B;  4ETS A;  3NEU A;  4KT5 C;  4HQE A;  4XSZ F;  4FHT A;  5HS9 A;  3WGG A;  3E6D A;  3HTU A;  1YTY A;  2VC0 A;  1YFH A;  4YG2 F;  1HKQ A;  2V1D A;  4RAY A;  3HTS B;  3WGI A;  2EA4 A;  1YQA A;  1BBY A;  3E6B A;  3LQR A;  3RKW A;  2RN7 A;  5ILS A;  3FX3 A;  2NNN A;  4XRF A;  2EA2 A;  5L3F A;  4O3M A;  1ZRF A;  1JE8 A;  5KK1 A;  1TLH B;  2ADU A;  1C0W A;  5LEJ A;  2RC4 A;  1LJ9 A;  1B1B A;  4WXD A;  3ZMS A;  3I59 A;  2E1N A;  1TW3 A;  3DF8 A;  1REP C;  5F6F A;  4FT8 A;  4UNO A;  3BDD A;  3KFW X;  2BYV E;  3WTT C;  2L01 A;  2F5C A;  1TBX A;  2ELH A;  4IRH A;  2YPR A;  2FEZ A;  2ZNY A;  2XAQ A;  2A3S A;  1DUX C;  5E20 A;  1CF7 A;  1LDJ A;  3HIF A;  2O6G E;  5JFR A;  4ZYD A;  1XCV A;  2HFH A;  1Z6T A;  1LQ1 A;  3LFK A;  5J6X A;  1EV7 A;  1YO5 C;  4GGG A;  5H6Q A;  3JW4 A;  4BHP A;  1I1G A;  3LA3 A;  3PFI A;  5FLX K;  4AIH A;  2FQ3 A;  1T2K A;  1F4K A;  1V3F A;  2HOE A;  5TJJ A;  1MJA A;  2A07 F;  1GXQ A;  4I0A A;  3E5U A;  3KEQ A;  4PGG A;  2P8T A;  1IW7 F;  1IRG A;  3W6K B;  4L5I A;  4ZYG A;  3TKY A;  1L0O C;  1J59 A;  1GXP A;  1RI7 A;  1XSX A;  1CGP A;  1S6L A;  2CFX A;  2KJC A;  3K9T A;  4A12 A;  3ROU A;  2QQ9 A;  4XLP F;  2HZT A;  2XAJ A;  4L9J A;  4CXF A;  1RUN A;  2MBF A;  4OOI A;  2DBB A;  3KP5 A;  2EFW A;  5LHG A;  2KRF A;  3WE3 A;  4G8X A;  2RQP A;  2CSO A;  3ABU A;  2ZNZ A;  3IHU A;  2O03 A;  2HS5 A;  4KUM A;  3IKV A;  2CW0 F;  4G94 A;  1S7A A;  2BGC A;  4CO8 A;  4UVC A;  4ENK A;  2YX7 A;  3GFL A;  2DK5 A;  5H6R A;  2JPC A;  1KYZ A;  1W7P B;  3GF2 A;  4OIN F;  2A5Y B;  5ED4 A;  2LNB A;  3WTX C;  4R79 A;  1I1S A;  2O61 A;  3H3U A;  3VOE A;  1TQI A;  4JK1 X;  5LLQ A;  4KIF A;  2M45 A;  3KP7 A;  4IHT A;  1I5Z A;  1TNS A;  3EYY A;  4PZJ A;  4HX7 A;  5A2Q Z;  3DKW A;  3OOP A;  1DPR A;  1IRF A;  3RKY A;  1YW7 A;  3OV8 A;  3S2W A;  5L3B A;  2M8E A;  3GUD A;  3WU0 A;  2QWW A;  4U0V A;  2ESN A;  2RGV A;  4MEY F;  2PLY A;  3FXU A;  3WG9 A;  1W4M A;  2QEN A;  4OIO F;  1P4W A;  1R00 A;  3IRR A;  3BP8 A;  2HYF A;  3SFZ A;  2HEO A;  4ESB A;  4GO1 A;  3SHF A;  4OIR F;  4M6Y A;  2BBY A;  4KA4 A;  2XV4 S;  3I64 A;  1R58 A;  1FT9 A;  4HQM A;  4P96 A;  4GXO A;  4G6Q A;  2FMY A;  2V9V A;  3JSP A;  1KU7 A;  1ZG1 A;  5K1Y A;  1P4A A;  3FZV A;  1XDU A;  3DFG A;  4U7B A;  5FGM A;  1G3W A;  3RDI A;  3HSE A;  4NQW A;  4HDV A;  4LGW A;  3JTH A;  2ACJ A;  2X0L A;  2FXA A;  1I6X A;  2L02 A;  1YIO A;  5IT3 A;  1U5T B;  2XKP A;  4UVA A;  3I5U A;  2GXB A;  4YFN F;  3R60 A;  1UHM A;  1OMI A;  1R36 A;  1XN7 A;  5LHI A;  5ICG A;  1W7P A;  4XBF A;  3T5X A;  1XSD A;  2ZME B;  1IN8 A;  1P6R A;  2V1U A;  1LDK B;  3ZMZ A;  1U78 A;  3SZT A;  1S8N A;  3QU3 A;  2RKH A;  2PJP A;  3V4G A;  3M9A A;  4L9T A;  2ESH A;  1YG2 A;  4ESJ A;  1J75 A;  2CO5 A;  4ZZL A;  3E6C C;  1XGM A;  1BIB A;  5HDG A;  3ZMT A;  3WTS C;  2QYO A;  1OYY A;  1U5T C;  1BI3 A;  1SFU A;  2X4H A;  5FD5 A;  2JPB A;  1D8K A;  2DLL A;  2OQG A;  3V8K A;  3R0A A;  2EFN A;  3ABT A;  1KQ9 A;  4A5N A;  3TO9 A;  3DPT A;  3ISP A;  5FO5 A;  3K1M A;  1BI0 A;  2AS5 F;  1BC7 C;  4AVP A;  5HLG A;  2XGX A;  3J7A O;  3JAM Z;  2OBP A;  2F2E A;  1SFX A;  4G6D A;  4LFU A;  4LD5 A;  4CHU A;  2E1C A;  1MDM A;  1R23 A;  2CQK A;  2HQN A;  4U0Y A;  4B8X A;  3I71 A;  3L9F A;  3R0J A;  3J80 K;  2FBK A;  2FML A;  3VOD A;  2M30 A;  1XB4 A;  2H09 A;  2KIM A;  5E18 F;  3RJP A;  1PDN C;  1GVJ A;  1O3S A;  4EJT A;  4RB0 A;  1FBQ A;  4LB6 B;  1SMY F;  1SD7 A;  4HW0 A;  2L4M A;  1TQM A;  1U5T A;  3F22 A;  1U8R A;  1E2X A;  3KP6 A;  5DD4 A;  5DUI A;  2MD5 A;  2DTR A;  3ML6 A;  3I58 A;  2Z9O A;  3I54 A;  3F72 A;  4RGU A;  1B59 A;  5D4S A; 
#chains in the Genus database with same CATH topology
 5LGN A;  2MFZ A;  4LMY A;  5AIP A;  1HOM A;  2X6O A;  2LFB A;  2P7C B;  4M6X A;  2EV0 A;  5GTI C;  3M7G A;  2MYS A;  1A04 A;  2LYC A;  4N4N B;  1BM9 A;  2EFO A;  3QAH A;  1Z05 A;  1H9T A;  3E5Q A;  4EM2 A;  4PJL A;  1HW5 A;  3QYF A;  3U1D A;  4HBL A;  4EEF G;  5EF6 A;  1LVA A;  3QPS A;  3ZOB A;  1PVE A;  3OIO A;  2ZJQ F;  2IS4 A;  2KMU A;  1JHF A;  3BY6 A;  2HXO A;  4QLC U;  4HF2 A;  4MTE A;  1A31 A;  2FRH A;  1DU0 A;  2JUC A;  4RGR A;  3MZY A;  2JSC A;  2D2W A;  4LIV A;  5DYM A;  2DOA A;  4BYY A;  2VKV A;  3B73 A;  5B3S H;  3WTU C;  3LWF A;  3RYR A;  1HA8 A;  2CS3 A;  2MLK A;  5JHF A;  3LA2 A;  4BAY A;  3OYM A;  1AKH A;  4A6E A;  4D0P A;  3J7A Y;  1JI8 A;  2CFO A;  4RGS A;  2HOS A;  1I50 J;  5HNH A;  4ZTJ A;  3B6A A;  5JVG F;  1XX5 A;  2OUM A;  4CZZ A;  3NQO A;  3WTZ A;  2M4K A;  4UV9 A;  3ERM A;  2LF8 A;  3H9J A;  3F23 A;  4A0Z A;  1GVD A;  2IJL A;  3DWL E;  2FBI A;  2ZB9 A;  1A36 A;  1X1B A;  1BIA A;  3BTJ A;  4QPO A;  2DJN A;  2DMN A;  1OYI A;  1RZ4 A;  1WJD A;  2NVQ J;  5F0C A;  4PSW A;  4Q47 A;  1A5J A;  2P4W A;  3WU1 B;  4A3J J;  1DU6 A;  3TO6 A;  4CCM A;  4B1R A;  1A35 A;  2BVM A;  1MH4 A;  1XDS A;  3DTE A;  5J8F A;  2CW7 A;  3JTG A;  4KN4 X;  3M1E A;  2XF6 A;  5AIQ A;  2QM3 A;  1ETW A;  2QVO A;  2L9S A;  2CUE A;  5BS6 A;  1HF0 A;  1IXS B;  1RKT A;  4A69 C;  3O2P E;  1UFM A;  2IA0 A;  3SYT A;  3TP3 A;  3GTQ J;  1TTY A;  1WKM A;  2H8W A;  2R0Q C;  1EF4 A;  4J19 A;  1OCP A;  1HBX G;  3LSK A;  4NDL A;  4H4K C;  4CYD A;  2F5V A;  2RAE A;  1PP7 U;  2OA4 A;  3HRU A;  4EJW A;  3A0H C;  4D1Q A;  4I7H A;  3KEO A;  4DNC A;  1ZR4 A;  2X1D A;  1AA7 A;  2OTL I;  1FOW A;  1WJC A;  3W2V A;  4BBS J;  2YX4 A;  2LP0 A;  1PYV A;  3FKJ A;  4RB2 C;  1SAX A;  1Y1W J;  1ENH A;  1G59 A;  1W7P D;  3HG9 A;  4A3I J;  2H94 A;  2XSJ C;  2EV6 A;  1P4X A;  2DT7 B;  3V7C A;  3SZP A;  4RB3 C;  1ZRE A;  5CLS A;  3TDU C;  3H0D A;  2CMP A;  4N9H A;  1MW7 A;  4A6D A;  3S3M A;  2H27 A;  3HKZ N;  1Y39 A;  3CO6 C;  4OU0 A;  1FSH A;  4MLO A;  4EQQ A;  2RQQ A;  2HWV A;  1HXD A;  3H5R A;  3OR2 C;  1KON A;  5CVJ A;  3HYI A;  4IPA A;  1ONV A;  4M9S A;  4OAY A;  3J7Z I;  3A02 A;  2BY1 A;  2XDV A;  2LC2 A;  3R6S A;  4OMZ A;  1Z0X A;  3OS0 A;  4UVB A;  1SEU A;  2KRH A;  4XOR A;  3MQ0 A;  3DP7 A;  2R7Z J;  2L3D A;  3K1P A;  3W3C A;  3W6J B;  1ZHF A;  2O7O A;  3BR0 A;  3EQL F;  3O8G A;  2KKO A;  3BZC A;  1OPC A;  4O6J A;  2IS1 A;  2MG4 A;  5B1A H;  3ZMD A;  1EJ9 A;  1IN7 A;  2K02 A;  1HSJ A;  1B4A A;  4UUT A;  2VOO A;  1H0M A;  3GWZ A;  4NUB A;  3GTJ J;  4EJV A;  3K6G A;  2Y30 A;  5BQT A;  2M7A A;  2V79 A;  3GLX A;  2LTP A;  2LOO A;  1Y0U A;  4II3 A;  3REO A;  4OAZ A;  4MNU A;  5F0F A;  1RR8 C;  3LAP A;  4IKF A;  4A3E J;  1KU2 A;  3HOV J;  3I56 I;  2CRG A;  4IF4 A;  1JJ6 C;  3T0Y A;  4LB5 A;  2VOD A;  3A01 A;  2NS7 A;  1MDM B;  2OQR A;  1B9M A;  3FMS A;  4XQF A;  3BZK A;  5ILV A;  2EIM H;  4Y3O A;  2DMU A;  4CIC A;  3GTG J;  4DZJ A;  6PAX A;  2MH9 A;  2KRC A;  2WBM A;  2HVR A;  4FIS A;  1FNN A;  3TDZ C;  4M3B A;  5KAF C;  2VBY A;  3TGN A;  4S0H B;  1EA3 A;  2WV1 A;  4D7N A;  1UMQ A;  3S32 A;  3M07 A;  4B43 A;  5L3G A;  2CU7 A;  4Q4Z F;  1Y1V J;  4M9Z A;  5DEQ A;  2GXA A;  2K3F A;  2KIS A;  2FF4 A;  2VBX A;  4MQV A;  3RI4 A;  1WI9 A;  4K2E A;  1O3T A;  4NBQ A;  3K4N A;  4LG0 A;  5DCM B;  5KNL A;  1R22 A;  1GHC A;  1MNM C;  4JBA A;  4AIK A;  3ZQG A;  3BJ6 A;  2VC1 A;  4I99 C;  3ECH A;  4LK1 F;  1LFP A;  4UB6 C;  4XNF A;  4XLN F;  2HVQ A;  4YFX F;  2ZJP F;  4OMY A;  3KZI C;  2HGC A;  1N78 A;  4EJU A;  3S2D J;  2R5Z B;  4QWQ A;  4X1E A;  3SFI A;  3BR5 A;  4E7S A;  3FM3 A;  1VQN I;  3HOY J;  4HZF A;  2B0L A;  3GVA A;  1MSF C;  2K86 A;  1FMV A;  3CDI A;  4A2U A;  4I09 A;  4IOC F;  3CES A;  5TRD A;  4I02 A;  4PCQ A;  2W84 A;  3BC8 A;  4KN7 X;  3ZMU A;  1YS7 A;  3O6B B;  2CGP A;  2QKM B;  2XAF A;  5ICE A;  3F8F A;  3BCB A;  2MA3 A;  2IVM A;  2E35 A;  2FQ4 A;  1ZAO A;  3TL4 X;  2E2I J;  2A6H F;  2H8R A;  4EJO A;  3FM5 A;  4M3E A;  4YFK F;  3I59 B;  1X1A A;  3D0S A;  1VI0 A;  3TBI A;  4E70 A;  2QBY A;  1FLI A;  5LHH A;  1RRJ A;  1MGT A;  2XAG A;  5FD6 A;  3IUO A;  1YLF A;  2KDO A;  2W24 A;  4XKV A;  1JTX A;  2ZSI B;  2A6T A;  1FOK A;  2ELJ A;  3QYB A;  4PGH A;  3QOP A;  3UKG A;  3CJN A;  4M74 A;  2XRO A;  2WB1 N;  2BE5 F;  3K4M A;  3I0T A;  4Q48 A;  4RLF A;  3GEZ A;  5LGU A;  2P5L C;  3KLO A;  2Q8K A;  4ANJ A;  2FOW A;  1QZY A;  3DU5 A;  5EEA A;  4MO7 A;  2O3F A;  2R93 J;  3D5R C;  1SVL A;  2DMP A;  4GDF A;  2MLG A;  5HVQ C;  2ZFW A;  3HDD A;  2X6Y A;  5ICC A;  2PBI A;  1IUY A;  5F1R A;  3EUH A;  1QA6 A;  1APL C;  5J4V A;  5ERI A;  1WCM J;  5EGO B;  3LOC A;  1ZK8 A;  2XHK A;  3LL7 A;  2BOL A;  4CDG A;  3CJQ B;  4G7Z F;  5L3C A;  5HS8 A;  3OYB A;  4XID A;  2Z2S B;  3D5L A;  4Y13 A;  4FQG A;  1EH6 A;  1IN5 A;  1ON2 A;  2HDW A;  1JHH A;  3HRS A;  3A01 B;  1FYK A;  2AQE A;  4GYI A;  2FX0 A;  3CD6 I;  2A61 A;  4DYR A;  3MFK A;  4XRM A;  3GX4 X;  3E5X A;  5IP6 A;  1HQC A;  1T0F C;  3HEF A;  2ISZ A;  4Z2Y A;  1F9N A;  1MND A;  1ERD A;  1MJ9 A;  4EV0 A;  3GFJ A;  1ZLJ A;  2K5C A;  5D8K B;  2XRN A;  4YEL A;  3JRE A;  1HW2 A;  5HLI A;  2KZG A;  3F8M A;  1FC3 A;  1MMN A;  1K6O A;  1IV6 A;  1RKW A;  1VQO I;  2F4M B;  2PMZ A;  1SD6 A;  1X1P A;  3BOQ A;  1ETX A;  1TT5 B;  5ICF A;  3CLO A;  3OS2 A;  3BJA A;  1Y8Q B;  5L3E A;  3C2B A;  3CZ6 A;  4XSX F;  1T38 A;  3BQZ A;  2VE9 A;  2JQ7 A;  5KAI C;  4F52 A;  5EEG A;  3U9G A;  2VXZ A;  4DZP A;  4FCY A;  4JX6 A;  2EFP A;  5M3M J;  1YYV A;  2K9M A;  3EDP A;  1X2M A;  3O8H A;  3CCR I;  2ECC A;  1HST A;  3CDL A;  3EUK L;  4P55 A;  3ZQ7 A;  2CQX A;  2NNY A;  3QQA A;  4C3J J;  1LUJ B;  3CQZ J;  3GZ5 A;  4EM0 B;  2A6E F;  2XC7 A;  3HOS A;  4RAF A;  5BMZ A;  2E2J J;  2E7X A;  3BJO A;  3RCO A;  3HOX J;  4IRG A;  4NB5 A;  2DJI A;  3D1N I;  1X2N A;  3FIW A;  2GIZ A;  4UXN A;  1RES A;  2JVG A;  2VIX A;  4ENM A;  4U88 A;  3PSF A;  2KIU A;  4N0B A;  1F1Z A;  1SAN A;  2RRE A;  3FWE A;  4HF1 A;  2L9V A;  2F6C A;  1TT0 A;  1E0E A;  3F3X A;  1NH3 A;  2XAH A;  3CC7 I;  5D8L B;  3L2W A;  3PNT A;  4XRS G;  5CQG A;  2OU2 A;  3RPU A;  4BNC A;  3KZY A;  4BDZ A;  3GCM A;  4ZYA A;  2XF5 A;  3EET A;  3SJM A;  3LSP A;  2V1N A;  3HKZ A;  4I76 A;  1TWC J;  1K6Y A;  2E5Z A;  2ZME A;  2A5W A;  1QU3 A;  2PX9 A;  3MAJ A;  1T8I A;  2QLZ A;  2HVS A;  2K9L A;  2JRM A;  2Z33 A;  1VZ0 A;  5F27 A;  3V42 A;  2GWR A;  1G4D A;  2AXL A;  1LB2 A;  3NAR A;  2V1X A;  3W6V A;  1IXC A;  3EYI A;  2F5E A;  1FMW A;  1O57 A;  1ZKG A;  3MN2 A;  4IL6 C;  3DPL C;  2XAS A;  3KE2 A;  4NC7 A;  2XPU A;  3Q0U A;  1QVT A;  3IWF A;  1RUO A;  2M0C A;  3FMR A;  1NG6 A;  4IZZ A;  1K78 B;  2K9N A;  1GLN A;  4NNJ A;  4Y52 J;  2R3S A;  4BXF A;  4NQW B;  1HLV A;  2VBZ A;  3BG5 A;  2K40 A;  3G6E I;  3DBL B;  2XSD C;  2GXG A;  1I39 A;  4DQ2 A;  2D1V A;  4HA8 A;  3FXO A;  3SQN A;  2DA7 A;  1HKS A;  5CYV A;  1XG1 A;  3BPX A;  1TNT A;  2LMD A;  3K4L A;  3FK7 A;  3ASN H;  1Z1D A;  2XRL A;  3PSI A;  4IHS A;  1XGO A;  1LFB A;  5HNF A;  2DCE A;  3CDH A;  2RNG A;  3MMY B;  2ZJR F;  1QPM A;  1Z91 A;  2Y0S N;  5J8C A;  3H0G J;  3DKY A;  4E7H A;  4LLL A;  1ZLK A;  4LLG F;  3BZ6 A;  5GTH C;  2DI3 A;  2IS6 A;  1FPQ A;  3J80 Z;  4WX9 A;  1LNW A;  2GM4 A;  1ZG5 A;  1USS A;  1TQP A;  2FU4 A;  1S7O A;  3L7W A;  5E1Z B;  4S04 A;  2DPD A;  4RS8 A;  4ABZ A;  2VT2 A;  3VFZ A;  3GTO J;  2QGU A;  3PQJ A;  2IT0 A;  9ANT A;  2QSH X;  4ZH4 F;  3PUB A;  5B66 C;  2AHQ A;  1PUF A;  5LGT A;  2IW5 A;  2Y2Z A;  3E7L A;  2H6B A;  1JUP A;  3KYC B;  4HEA 2;  1NG7 A;  3ZGK A;  5C4J J;  4BH9 A;  2D5V A;  3RKX A;  4DBQ A;  4NHJ A;  1FOY A;  2GQQ A;  4RLQ A;  3HGY A;  1O3Q A;  2G9W A;  3ZQC A;  3JAM K;  2DU9 A;  2K4J A;  1B8I B;  5IP9 J;  3LSM A;  4PFO A;  4Y7N J;  2JA7 J;  2GBY A;  3K69 A;  1QVU A;  4MGR A;  2BXY A;  4DW6 A;  1OQY A;  4DGW B;  3IRQ A;  2WWY A;  2DFF A;  4AVZ A;  4G7H F;  4R1H A;  2QSF X;  5L3D A;  1U9O A;  2NRA C;  2CG4 A;  4XK4 A;  4BQQ A;  3OIQ A;  2KIF A;  3AL0 B;  2C6Y A;  1D1B A;  2TRT A;  4KIB A;  2Y9Z A;  3ECO A;  3JSO A;  3L1P A;  1ETY A;  2XUB A;  1J09 A;  1FBS A;  2PMU A;  1YX5 A;  2EJR A;  2K27 A;  4I01 A;  3WHB A;  1T33 A;  4M3G A;  2IA2 A;  3H92 A;  2LVS A;  2BEO A;  2L7Z A;  2Y0M A;  4FX0 A;  1K78 A;  2R7T A;  1PJR A;  3JRF A;  1IUF A;  4FTH A;  3HHH A;  1O4X A;  4HV6 A;  3V7S A;  3Q0W A;  4Y4R A;  5IYC J;  2NOG A;  4LIU A;  2HNH A;  1YX3 A;  2HTS A;  4HPQ A;  1VQL I;  1GT0 C;  1AHD P;  3J81 Z;  2Y9Y A;  2Q1Z B;  4IQ4 A;  1NHA A;  3Q0V A;  3CP8 A;  3KIO A;  1VQP I;  4P1W A;  2HTJ A;  4IXA A;  3IWZ A;  2MGQ A;  3L00 A;  4B3X A;  3QOE A;  1KQ8 A;  4YII A;  2M9H A;  1QHH D;  2D1H A;  3OYD A;  3W2A A;  3IL2 A;  3M8F A;  2EK5 A;  1JJ8 C;  3K4B A;  2IGO A;  2ZFU A;  2W57 A;  3ABK H;  4C2T A;  3C18 A;  2XVC A;  3L2U A;  3LSG A;  1RIO H;  2R7S A;  2ETH A;  1Q1H A;  2YS9 A;  3OYF A;  1Z6R A;  3S14 J;  1XMX A;  1ZG3 A;  4RM2 A;  5JR3 A;  3CCS I;  2L9N A;  4RGX A;  5FLX Z;  1MZB A;  1KU9 A;  2QUF A;  1JGG A;  3CUQ B;  5D5W B;  3G4S I;  1S7E A;  1ZRD A;  3OY9 A;  2V9K A;  3H1C A;  2HKO A;  1XSV A;  4XLE A;  2M4G A;  4U7D A;  1WHU A;  4EMS A;  5HDK A;  3AL0 C;  4Z6Y A;  1FOX A;  2DA6 A;  1H88 C;  1J9I A;  3C2H A;  1XD7 A;  4RAZ A;  2I5U A;  4QTR A;  3QYE A;  2EZL A;  1U3E M;  3KEY A;  2DFI A;  2FE3 A;  1J0R A;  3KPH A;  2P7V B;  1GV2 A;  4YIF A;  3CUO A;  2Y0S A;  4KIC A;  4XR6 A;  4FE4 A;  5FJ8 J;  1WFX A;  1IF1 A;  1FX7 A;  4LK0 F;  5D5V B;  2BXZ A;  2JTV A;  4XLF A;  1DQU A;  1D0Y A;  2ISY A;  3L2R A;  2LY9 A;  2LY2 A;  3FXQ A;  4I0B A;  5E8G A;  4BJ5 C;  2ME0 A;  5IYB J;  3JRC A;  3VSL A;  1IAW A;  1K4T A;  1TZL A;  2PMZ N;  3BTC A;  1IG7 A;  1SFE A;  2BY2 A;  3DEU A;  1RET A;  4RMN A;  2I8D A;  2M0M A;  3P9I A;  3UR3 C;  4LJZ F;  2X6X A;  3FDY A;  3NAU A;  4UV8 A;  1ZAR A;  1VND A;  2CQ7 A;  1OR7 C;  2FJ1 A;  2W85 A;  3BR1 A;  4I98 B;  3BG9 A;  3MD2 A;  2GA1 A;  4P9F A;  5K5O A;  3T8R A;  3KP2 A;  4HNV A;  2AO9 A;  4RB1 A;  4PK4 A;  2F5D A;  2VKD A;  1OR7 A;  3FBN B;  3E6M A;  1G6N A;  3TO7 A;  3L2Q A;  1U8B A;  2R7V A;  1O7F A;  3ZQQ A;  4ZC3 A;  3C2G A;  2G7U A;  5D5U B;  2PQ8 A;  3P9C A;  5D6F A;  2WV0 A;  2DA4 A;  4E7Z A;  2MSY A;  3CUQ C;  1LVK A;  4XKW A;  3HB9 A;  3GFM A;  3S2H J;  2HPI A;  1W5S A;  3WTV C;  4HDU A;  4PDK A;  1IV8 A;  1R1T A;  4ZYH A;  1ZN2 A;  1D5V A;  2EFQ A;  2E71 A;  3M8J A;  1X3W B;  3CC4 I;  3OSG A;  1FTT A;  2L54 A;  2VON A;  2LDU A;  3S8P A;  2P5V A;  5DS9 A;  1M1E B;  3L09 A;  2NS0 A;  5LRR A;  4F92 B;  3BPV A;  1F36 A;  3V8J A;  2R7F A;  2EH3 A;  1T98 A;  2Q2E A;  2JN6 A;  4PJJ A;  2E2H J;  2JK3 A;  3IH4 A;  2WC2 A;  4WF2 A;  4BQN A;  3TMO A;  1B8I A;  1SD5 A;  1BN5 A;  1UCR A;  1ODD A;  1R7J A;  5FB2 A;  3IKT A;  1WJF A;  2LF7 A;  1X1D A;  4CCN A;  1JT6 A;  4CA0 A;  2UWM A;  1R5H A;  1SFO J;  2OZ6 A;  3A1Y A;  3ZN1 A;  2IAI A;  1FIA A;  2BY0 A;  2Q2E B;  4XOP A;  3M8E A;  3GXO A;  2EV5 A;  1LEA A;  3VYT B;  2NYX A;  4GRI A;  1FZP B;  4HYE A;  3DBH B;  3QWL A;  2NOJ B;  4F7Z A;  3IC7 A;  3FF5 A;  4KDP A;  3ELK A;  2YU9 J;  4HG2 A;  4PJ0 C;  4D5C A;  3QPL A;  3O3K A;  1MKM A;  2DYS H;  5FFZ A;  3GO5 A;  3DPU A;  3J81 K;  2M87 A;  4ZZD A;  4BQA A;  3ZXS A;  1UST A;  5E3M A;  3ESW B;  1WJA A;  4IQJ A;  3Q5F A;  4M9X A;  4PUS A;  2YSR A;  3OL3 A;  1TWH J;  4FET A;  3WGH A;  1W5T A;  1T6S A;  1OCT C;  2RVC A;  5FKN A;  1EH7 A;  2OD5 A;  1DP7 P;  4OIQ F;  1BJA A;  2OCE A;  2Z99 A;  1FYL A;  1DDN A;  4Y15 A;  1XGS A;  2EWN A;  5EGO A;  5HLT A;  4EVI A;  3FK6 A;  1B6A A;  4AYB N;  4I6Z A;  3H36 A;  1SD4 A;  1P7J A;  2EQR A;  3GTM J;  4ZYE A;  1F5T A;  4BHC A;  4UUV A;  5DDG A;  3S1M J;  1R4N B;  4MEX F;  2DO7 A;  2K4B A;  3PJR A;  4A3D J;  5DV5 A;  3E3V A;  1S9H A;  3MVP A;  1Y0N A;  1MJB A;  4FE7 A;  2HOA A;  3T8T A;  3RZO J;  4A3L J;  1KQ0 A;  2UUZ A;  1PUE E;  2E5N A;  2KT0 A;  4BHB A;  2R7R A;  3B02 A;  1JTY A;  2WB1 A;  2COM A;  1QBJ A;  2FA5 A;  3G1M A;  2R4G A;  3GW2 A;  1IN6 A;  3IAM 2;  1R6R A;  4XIC A;  3CP2 A;  3Q9V A;  3OR1 C;  4JOM A;  1WRJ A;  4JP0 A;  3TW7 A;  4GFB A;  4EGY A;  4A3C J;  2LK2 A;  3F6V A;  2JRT A;  4HF0 A;  5E17 F;  3OYJ A;  1XCB A;  4XL9 A;  3Q9S A;  1UG0 A;  1IO2 A;  2O0Y A;  2MC4 A;  4I2O A;  4B47 A;  2GIV A;  1WZ2 A;  2A69 F;  4ASN A;  4YIR X;  2X48 A;  1WGX A;  3CLQ A;  5FFX A;  1R5G A;  1VQ6 I;  1BA5 A;  3K4J A;  1XMA A;  1PP8 F;  3E0J B;  1WJB A;  1UB9 A;  3QPH A;  2B7E A;  3HBL A;  3P7N A;  2OCC H;  4G9Y A;  3COA C;  3DQV C;  3E97 A;  1G3T A;  1B72 B;  1OKR A;  2K85 A;  4N4O B;  4WCG A;  1ZR2 A;  1GDT A;  4L0Z B;  4CSW A;  4KNY A;  2VE8 A;  1OJL A;  3GTP J;  3OYA A;  3V7R A;  2PI0 A;  4IVN A;  5EZG A;  5FKL A;  2FOK A;  2N8G A;  4TV7 A;  1EKE A;  4XLH A;  2J5O A;  1QZE A;  2MW8 A;  2LKX A;  2J5P A;  1VQK I;  4L0Y B;  2ICW G;  2V9P A;  2VAS A;  1WQ2 A;  3QU6 A;  3VWB A;  1TP4 A;  2ZXJ A;  4NC6 A;  5D4R A;  1P9Q C;  4RM3 A;  4PFP A;  3E1S A;  2HXI A;  1OCC H;  2VKE A;  3C1D A;  4II2 A;  4PJM A;  3CMA I;  2E7W A;  5K7F A;  2H1K A;  5CVU A;  4G7O F;  3JRI A;  2W7N A;  2P81 A;  1QZZ A;  4HX4 A;  3K70 C;  1XMK A;  1QO0 D;  4BE0 A;  2R5Y A;  1OFC X;  2IEK A;  3TW6 A;  4M6V A;  1OYW A;  2A68 F;  1K79 A;  1FP2 A;  3F8B A;  2CW8 A;  4MQ9 F;  1ZEL A;  4L9V A;  1YIJ I;  4L5J A;  5LEK A;  2DOF A;  2G7H A;  2VJI A;  4D9J A;  5J40 A;  3LAJ A;  2GLO A;  3CTA A;  3MWM A;  2OF7 A;  1ULY A;  5F64 A;  1LE8 B;  2IP2 A;  3I4N J;  2HU9 A;  3HRT A;  2Y48 A;  2HOT A;  2KJB A;  5BOX A;  3FMQ A;  3QP6 A;  4A0X A;  3TOA A;  4A93 J;  1Y6I A;  2EZH A;  3LSI A;  4IHX A;  1MBK A;  3GTL J;  1SAU A;  2ZCW A;  4V2G A;  2P0W A;  2PEX A;  5DUK A;  1BC8 C;  5FRO A;  2IXS A;  1KU3 A;  3DLL F;  5B1B H;  4LOC A;  1T08 B;  3H5N A;  5E79 C;  3OWT A;  1WVR A;  2XKO A;  3CJT B;  2MH2 A;  1QNT A;  3WTY C;  3ULQ B;  3KCC A;  1MBG A;  5CJ9 A;  1N77 A;  1SVM A;  5E3L A;  3RTR A;  1BI2 A;  4C30 A;  1K4S A;  2QF7 A;  3HPH A;  2QZ8 A;  3D5S C;  3K2Z A;  4P9U A;  1N75 A;  5HLH A;  5FRM A;  2NVY J;  3OYE A;  3HOT A;  3ZMV A;  4Q5S F;  1DPU A;  3AAF A;  1T39 A;  3PQK A;  1AOY A;  2QBY B;  2RNJ A;  2M2E A;  1MIJ A;  4XLA A;  2WAE A;  1Z7L A;  3CCL I;  1IGN A;  1ACI A;  1K7A A;  3FHZ A;  3K4K A;  1R49 A;  4UB8 C;  5ILU A;  5LFA A;  1JXS A;  1V4R A;  3DU6 A;  5GAH J;  2Y31 A;  1D8J A;  1BOA A;  1KA8 A;  4BUP A;  5JVT A;  5TIS C;  2NXN B;  2XPV A;  3HZJ A;  2L5Q A;  5HS7 A;  5CVI A;  3RPQ A;  1LPQ A;  1D3Y A;  4MHG A;  3SDB A;  4BE1 A;  3L2C A;  1FJL A;  5CVR A;  3G1O A;  3KP4 A;  2A05 A;  1T0F A;  5BNG A;  3PO2 J;  2K3P A;  1A6Q A;  2K9Q A;  3ERE D;  3QOD A;  3RYP A;  4E7L A;  2DTZ A;  1MBF A;  3GYH X;  3HXL A;  3LST A;  3TOB A;  5IOY A;  2JT1 A;  4DOZ A;  2AQF A;  2ZJ2 A;  4LG0 B;  2VPL A;  2DW4 A;  2HKX A;  3ZP5 A;  3FHN A;  3JRD A;  4CYC B;  2WAD A;  3WU2 C;  1IXR C;  3SXY A;  2LKP A;  3CCY A;  5J1R A;  2OAZ A;  1QQI A;  4M73 A;  2PN6 A;  1P92 A;  5F0H A;  4WXC A;  1ZYR F;  3S93 A;  2R7X A;  2YR2 A;  2EIN H;  2F4O B;  4R8H A;  2Z3Y A;  1X19 A;  4BXU A;  1MBE A;  3VPR A;  2VJJ A;  1G8X A;  1J2X A;  1ETQ A;  2CH0 A;  3MKY B;  3N05 A;  1IZ1 A;  4GYG A;  4BJT A;  2R7W A;  1VFC A;  1JUM A;  5C44 J;  3N97 A;  3QRF F;  3BWG A;  1GUU A;  2PMH A;  4AWX B;  3Q3S A;  2DOD A;  1J7K A;  2BW3 A;  2IPQ X;  2V6C A;  3PUF A;  3T1B A;  5IY5 H;  2R7U A;  1YHQ I;  2STT A;  2ZO4 A;  1S3J A;  3AKZ A;  1IN4 A;  2Y75 A;  2H6C A;  2YU3 A;  3F9K A;  2JUG A;  3H35 A;  3ZRG A;  5EG0 B;  3H3Z A;  4BY7 J;  4HST A;  4BKX A;  1TC3 C;  3HOZ J;  1W5C C;  3OYN A;  1LDD A;  2P5K A;  2K9S A;  4EGZ A;  4M3F A;  3LA7 A;  4HLX A;  4AD9 A;  2R92 J;  3CUQ A;  4CGZ A;  1I27 A;  3H5A A;  4ON0 A;  3OL4 A;  2X6W A;  4IEJ A;  1GV5 A;  2LSO A;  1UZC A;  4C3H J;  5B5E C;  2CQQ A;  2I10 A;  4HNU A;  3HOW J;  2GA2 A;  3OYG A;  3N4M A;  2VT3 A;  2CJJ A;  5EZH A;  1E17 A;  2VL8 A;  4EM1 A;  4M72 A;  3F21 A;  4BU2 A;  3CCQ I;  1G3Y A;  3VYS B;  2E34 A;  3UNG C;  2R5Y B;  4JQF A;  1HKT A;  1FTZ A;  4B48 A;  4B09 A;  3DXJ F;  2DK8 A;  2V26 A;  4BE2 A;  5C4X J;  4KT6 A;  5BPI A;  1P2F A;  4IJA A;  1W36 C;  2L7K A;  2V4J C;  2ZBK A;  1SVO A;  2L4A A;  3ZPL A;  2O5R A;  4MTD A;  2Q0O A;  3BG3 A;  2EBI A;  2HQA A;  2RV8 A;  1FYM A;  2XIG A;  4U0W A;  1FSE A;  2FSW A;  3P9K A;  3C7J A;  5LRS A;  2VQL A;  4BXX J;  1I3A A;  2RDP A;  4KYW A;  1UHS A;  1XGN A;  3C3W A;  3R4K A;  1U6G A;  3FIS A;  2R7D A;  3VEP A;  2P6S A;  1POG A;  4RA2 A;  3KLN A;  2XB0 X;  4UY8 I;  4FX4 A;  2KZV A;  4HLY A;  4IRI A;  4AUX A;  1Z3Y A;  3LFU A;  4BEH A;  1AWC A;  3GFI A;  2E60 A;  1R71 A;  2FNA A;  3K1N A;  3IAS 2;  1VF9 A;  2STW A;  2X51 A;  4AID A;  2CYY A;  1YW9 A;  5CPR B;  3RKQ A;  1R1V A;  4P5O A;  3K7A J;  4JX5 A;  1Y56 A;  3CF2 A;  1SC7 A;  2IRF G;  4FAS D;  1CF7 B;  1YW8 A;  5GPC A;  3WTW C;  1Z21 A;  2IGM A;  2XPW A;  4ZDO A;  2HZD A;  5KHD A;  2DDB A;  3PIO F;  5DM6 F;  1BR2 A;  3BG6 A;  3ZN0 A;  4M71 A;  2OTJ I;  1X58 A;  1Q1V A;  1U0J A;  1ITY A;  3PO3 J;  5AON A;  1VQ9 I;  1RR7 A;  1ZGA A;  4ENJ A;  2NVU B;  1L3L A;  3I53 A;  3PNV A;  2GZW A;  5M5W J;  1FY7 A;  5FLV A;  3HRM A;  1MH3 A;  2VN2 A;  3LMM A;  5J4Y A;  2H1L A;  5JLX A;  2D45 A;  3OMY A;  1JT0 A;  1STZ A;  2M1B A;  4BJ6 C;  3FXR A;  2QQA A;  3MCZ A;  3I9V 2;  5E1X A;  3F8N A;  5F08 A;  1FIP A;  2DN0 A;  2HQR A;  4ZDP A;  1WH7 A;  2OV7 A;  3TQN A;  5D5X B;  3OS1 A;  3H9Q A;  2FNP A;  2QCO A;  5E1W A;  3JRH A;  2Y69 H;  3WE2 A;  1W1W E;  1ZQ3 P;  3KZZ A;  3DEW A;  5M5Y J;  1W0U A;  1LEB A;  4N9I A;  2UXX A;  5DTD A;  5K5Q A;  2P6T A;  3QP5 A;  4EAT A;  4KMF A;  4KIT B;  1ZH5 A;  1R4M B;  3U2R A;  1Z9C A;  4DIQ A;  1ETV A;  4F93 B;  5HOO A;  3BT9 A;  1UAA A;  3VDX A;  1X4P A;  4AIJ A;  3MZH A;  1VQ7 I;  2OZU A;  4ENN A;  2W48 A;  3F8C A;  4HAM A;  1X3U A;  3HSR A;  1JGS A;  3ZCO A;  5IYD J;  3HHG A;  1S29 A;  2HQ5 A;  2K7L A;  2CWE A;  5GP9 A;  4O5V A;  1IRX A;  3S3N A;  1X1C A;  1MMS A;  1WWX A;  2F5F A;  2GAU A;  2FBH A;  1ORK A;  5GAE J;  4HV5 A;  2HDC A;  3NWT A;  3CC2 I;  2L7M P;  4B4C A;  5FKO A;  3S1N J;  5HDN A;  3WOD F;  2MAB A;  2JSP A;  2EPF A;  4HRI A;  2FUG 2;  1HW1 A;  2X1E A;  2W25 A;  2XAU A;  4IHW A;  3NRV A;  5E3N A;  5CVV A;  1DGR M;  3SEQ A;  1Z7U A;  3G73 A;  3I4P A;  2ZKZ A;  2NAZ A;  2TDX A;  1FBU A;  3PIP F;  3HOU J;  1HC8 A;  1SMT A;  4Y33 A;  2F48 A;  4ESF A;  1PUF B;  1UJ8 A;  3HSF A;  4CCK A;  5FLM J;  2WAF A;  3QPT A;  4WWC A;  5KVR A;  4RDU A;  1CQT A;  4F3Q A;  4OIP F;  2BV6 A;  3ASO H;  3RIR A;  2X85 A;  5A2Q K;  1WSU A;  2R7Q A;  3GLL A;  5DD8 A;  2DQR A;  3DKX A;  3HGG A;  2PJR B;  1K83 J;  1QPI A;  3R61 A;  4WK8 F;  3G3Z A;  1BI1 A;  3BRO A;  2OPT A;  2JZY A;  2DQL A;  2EB7 A;  3A0B C;  5E8I A;  3IH2 A;  5DCM A;  3OOU A;  1H9G A;  1ON1 A;  4Y17 A;  4CYC A;  1JKQ C;  1ZRC A;  4KFC A;  2UXN A;  5K7H A;  4U87 A;  2PG4 A;  4BL0 B;  3MEX A;  2L2O A;  3B6C A;  4A0Y A;  2FD5 A;  2M5W A;  1MD0 A;  2DAO A;  4BQO A;  5H20 A;  3JRG A;  4AYB A;  1FP1 D;  1KGS A;  1MMA A;  5LBQ A;  4J00 A;  2VBW A;  2O8X A;  1LKX A;  5DCF A;  4HOB A;  4AC0 A;  3HPG A;  5EJC A;  3ABM H;  3VB2 A;  1OIS A;  5JLW A;  3M4O J;  1KYW A;  3CME I;  3KP3 A;  2IA1 A;  5D6E A;  4XN0 A;  4A5M A;  3BR2 A;  3BR6 A;  3BTL A;  4KJZ A;  3CO7 C;  2VOP A;  1VQM I;  4X6A J;  5K5R A;  5IOZ A;  4BDY A;  1U2W A;  1G2H A;  2Z5U A;  2E1O A;  4PSX A;  3ONQ A;  5BPD A;  4AM3 A;  4KMU X;  5JI6 A;  3HUG A;  2VQG A;  5IT9 K;  1J5Y A;  2M34 A;  3MKZ A;  2VKH A;  1TW2 A;  5IT9 Z;  2COB A;  4XOT A;  3CJR B;  1O3R A;  1YS6 A;  3F6O A;  1D1C A;  1G3S A;  2LG4 A;  4H0E A;  4LLN A;  2PFB A;  3SZG A;  1V5F A;  3OYC A;  5JHU A;  3P5J A;  2WTE A;  1R1U A;  2TCT A;  4S05 A;  2DFH A;  4BGD A;  2DXI A;  3K0L A;  4OWR B;  4HNT A;  5IP7 J;  4A3K J;  1ZGJ A;  3DV8 A;  1O7L A;  1JKO C;  1B9N A;  3FXM A;  1SFK A;  2M3A A;  2MC3 A;  1F43 A;  4KIG A;  1IC8 A;  3HL2 A;  1VTN C;  1XS9 A;  5H2F C;  4XON A;  1QGP A;  2HYG D;  2QQB A;  4CH7 A;  3OYK A;  5EEH A;  1FWZ A;  2KLO A;  4GCV A;  3KX2 A;  2V7F A;  4HX8 A;  3GZ6 A;  1UHW A;  1K61 A;  2UZK A;  5GAD J;  2KIQ A;  2DPU A;  3I4M J;  1EH8 A;  3LQQ A;  4CCJ A;  3KET A;  3V8L A;  3H9G A;  4E7K A;  3J7Y J;  3JRB A;  1DGW Y;  2L0K A;  4L9N A;  2DT5 A;  2HR3 A;  1D0X A;  2W1O A;  4UHT A;  2VLA A;  1RNL A;  4J01 A;  1RC9 A;  3BG7 A;  4WXH A;  3K4C A;  2ZXI A;  4L18 B;  4E6K G;  2EIL H;  2MD0 A;  3K10 A;  4ETS A;  3KYL A;  3NEU A;  4KT5 C;  4HQE A;  1YRN A;  2L9R A;  4XSZ F;  4FHT A;  2VB6 A;  5HS9 A;  3WGG A;  1YE9 A;  3E6D A;  3HTU A;  5DM7 F;  2LD5 A;  1YTY A;  4BBR J;  1S72 I;  3FXJ A;  1FEX A;  3U1K A;  5EYR A;  2VC0 A;  1YFH A;  4YG2 F;  1HKQ A;  2V1D A;  2KQR A;  4RAY A;  4YEJ A;  3HTS B;  3WGI A;  2EA4 A;  3FXK A;  2QA4 I;  3AG1 H;  1YQA A;  5FKM A;  1AKH B;  1BBY A;  4F91 B;  3E6B A;  3LQR A;  2LH9 A;  3RKW A;  2RN7 A;  2LBF A;  5ILS A;  2M8G X;  3FX3 A;  2NNN A;  4XRF A;  1IJW C;  1YRN B;  2EA2 A;  1NTC A;  5L3F A;  1BJZ A;  4O3M A;  1ZRF A;  1JE8 A;  5KK1 A;  1BL0 A;  1TLH B;  5J3L A;  5J47 A;  4QPQ A;  2HPM A;  4BAC A;  2ADU A;  2BY3 A;  2X1C A;  1C0W A;  3K70 D;  1YJW I;  2QKL B;  5LEJ A;  2RC4 A;  2CUZ A;  3BLY A;  1TWF J;  2QEX I;  1JKP C;  3PM1 A;  5HOD A;  4XMY A;  1LJ9 A;  1B1B A;  4BS9 A;  4WXD A;  3ZMS A;  2EIK H;  4AU7 A;  3I59 A;  4XKC A;  4DBR A;  4D7M A;  3ZQH A;  2E1N A;  3RSN A;  1TW3 A;  3DF8 A;  3LSJ A;  2XGD A;  1REP C;  5F6F A;  1BR4 A;  4B44 A;  4FT8 A;  4UNO A;  2HDD A;  3CMY A;  3BDD A;  3KFW X;  2BYV E;  3WTT C;  3K2A A;  2L01 A;  2F5C A;  5FRN A;  1TBX A;  1OCR H;  3GBG A;  2ELH A;  4IRH A;  3LSR A;  2YPR A;  2FEZ A;  3VYU B;  2W82 A;  3ZQL A;  1WPK A;  1NK3 P;  2ZNY A;  2XAQ A;  2A3S A;  3LNQ A;  1DUX C;  5E20 A;  1IRZ A;  3HM5 A;  1CF7 A;  1ETK A;  1MMD A;  1VQ5 I;  2WA0 A;  1LDJ A;  3HIF A;  1IDY A;  4DYQ A;  2WY7 Q;  3OYI A;  3EUH C;  2O6G E;  5JFR A;  3CCV I;  4ZYD A;  1XCV A;  2HFH A;  1Z6T A;  2ELK A;  1LQ1 A;  3LFK A;  5J6X A;  3DTK A;  3RZD J;  1OCO H;  1EV7 A;  1YO5 C;  4GGG A;  4YRV A;  5H6Q A;  3JW4 A;  2HYJ A;  1HCR A;  2E1M C;  4BHP A;  4CUG A;  2OC6 A;  3JR9 A;  1I1G A;  3LA3 A;  3PFI A;  4RAG A;  2B9S A;  1HDP A;  5FLX K;  4AIH A;  2FQ3 A;  1T2K A;  2IGK A;  1F4K A;  1V3F A;  2KFD A;  2VUM J;  3GTK J;  1N25 A;  2ZC2 A;  4ZTF A;  5GPA A;  4BY1 J;  2HOE A;  5TJJ A;  3ABL H;  2DA1 A;  2LRE A;  1TWA J;  3DEE A;  3TP0 A;  4M3D A;  3JRA A;  3A2K A;  1MJA A;  2A07 F;  5CKT A;  1ZTR A;  2VQC A;  1GXQ A;  4I0A A;  3E5U A;  3U21 A;  2DA2 A;  3KEQ A;  4PGG A;  2P8T A;  1IW7 F;  2VJ4 A;  3PNY A;  1IRG A;  3W6K B;  4L5I A;  2GOM A;  4ZYG A;  2JA2 A;  3TKY A;  1L0O C;  2KP6 A;  1J59 A;  1GXP A;  1ETO A;  2R5Z A;  2GOX B;  1BR1 A;  1RI7 A;  1H89 C;  2L7F P;  4V19 K;  2G0E A;  2PJR A;  1I6H J;  2DOE A;  3CCE I;  1XSX A;  4X0G A;  3GME A;  3DTI A;  1CGP A;  1YJ9 I;  1S6L A;  2CFX A;  4C3I J;  2KJC A;  3K9T A;  5F1J A;  4A12 A;  3ROU A;  2QQ9 A;  1V54 H;  4XLP F;  2HZT A;  4L5E A;  1YI2 I;  2XAJ A;  4L9J A;  4CXF A;  1RUN A;  2MBF A;  4OOI A;  2DBB A;  1UEL B;  5J1Y A;  5EG0 A;  3TED A;  5C3E J;  3KP5 A;  1W0T A;  2EFW A;  5LHG A;  2E1M B;  2LR8 A;  2DT6 A;  2KRF A;  3CCJ I;  3WE3 A;  4G8X A;  3MZ8 A;  2RQP A;  1TWG J;  2CSO A;  3ABU A;  2DMQ A;  4A3F J;  2ZNZ A;  3IHU A;  1P7I A;  2M7B A;  4IOA F;  4IHV A;  2KL4 A;  2O03 A;  2VPR A;  2HS5 A;  4KUM A;  3IKV A;  2JMW A;  2QSG X;  2CW0 F;  4G94 A;  4C2M J;  1S7A A;  2DFE A;  3RPU D;  2BGC A;  4CO8 A;  3JCU C;  4UVC A;  2XB5 A;  4ENK A;  1I3Q J;  3BTI A;  2YX7 A;  3GFL A;  2DK5 A;  1T56 A;  2EZK A;  5H6R A;  3HC7 A;  2JPC A;  1KYZ A;  4UUS B;  1LFU P;  1QHG A;  3CCU I;  1ZGW A;  1W7P B;  2NVT J;  3GF2 A;  1VQ8 I;  2BZT A;  4A3B J;  3CF5 F;  4OIN F;  3G71 I;  1E3P A;  2CV0 A;  2A5Y B;  5ED4 A;  2LNB A;  3WTX C;  3A03 A;  4XLC A;  4R79 A;  4LIT A;  1I1S A;  2O61 A;  1WI3 A;  4E7I A;  2LY1 A;  1KZH A;  1Z77 A;  2BVL A;  1E3O C;  2CQN A;  3H3U A;  3VOE A;  4PJN A;  2XF7 A;  2IBD A;  1TQI A;  4MIM A;  2KDZ A;  2O9L A;  4JK1 X;  3FBI B;  5LD2 C;  5LLQ A;  2WAQ A;  4KIF A;  2M45 A;  3KP7 A;  4IHT A;  2NS8 A;  2VI6 A;  2XGE A;  1I5Z A;  1TNS A;  4LG3 A;  3EYY A;  4PZJ A;  2LKS A;  2JJ7 A;  4HX7 A;  1Z67 A;  3ZR8 X;  5A2Q Z;  4UUS A;  3DKW A;  3OOP A;  1B72 A;  2XGC A;  1DPR A;  2Z16 A;  1IRF A;  3AG4 H;  4QSH A;  1Z3X A;  3RKY A;  1YW7 A;  2EIJ H;  3OV8 A;  4C2U A;  3HJE A;  3S2W A;  5L3B A;  3OYH A;  2M8E A;  4W1U A;  3GUD A;  3WU0 A;  2QWW A;  2F4I A;  4U0V A;  4B3A A;  2ESN A;  4C9Y A;  5GAG J;  2RGV A;  4MEY F;  3S17 J;  2DA5 A;  2BHY A;  2PLY A;  3FXU A;  3WG9 A;  2JA8 J;  4XRS A;  2ECB A;  1W4M A;  1NK2 P;  2QEN A;  4MFD A;  4OIO F;  5J1U A;  2AXT C;  1P4W A;  3LSH A;  1R00 A;  3IRR A;  3BP8 A;  5M3F J;  2HYF A;  2ZME C;  3SFZ A;  2HEO A;  4ESB A;  4GO1 A;  1WJE A;  4OIR F;  4M6Y A;  3SHF A;  2BBY A;  2DA3 A;  3SDG A;  4KA4 A;  2XV4 S;  3I64 A;  4F55 A;  1R58 A;  4ZDL A;  1FT9 A;  1OCZ H;  2LLK A;  4MFE A;  5EDN A;  4HQM A;  4P96 A;  4ZJZ A;  1Y8R B;  3CCM I;  1HDD C;  4NC8 A;  1MBJ A;  2ME6 A;  4GXO A;  4G6Q A;  1YJN I;  3AG2 H;  1D0Z A;  1U9N A;  3EUA A;  2FMY A;  2V9V A;  3S3O A;  4HSR A;  2X9D A;  4JYK A;  5M5X J;  3JSP A;  1KU7 A;  2VQH A;  1V5G A;  1ZG1 A;  2DYR H;  5K1Y A;  1P4A A;  2KHM A;  2DDA A;  1E3H A;  2WAQ N;  1XDU A;  3FZV A;  4DJA A;  3DFG A;  1LE8 A;  3OYL A;  3G2B A;  4U7B A;  5FGM A;  2E36 A;  2UV1 A;  1G3W A;  3PFY A;  3RDI A;  3HSE A;  4NQW A;  4HDV A;  4LGW A;  4W97 A;  3JTH A;  2ACJ A;  2X0L A;  2FXA A;  4CCL A;  1WJ5 A;  5F04 A;  1I6X A;  2LBF B;  2L02 A;  1VQ4 I;  3S16 J;  1YIO A;  2ID3 A;  1MSE C;  2ZXH A;  2QQ8 A;  5IT3 A;  1U5T B;  3SEZ A;  1T95 A;  2XKP A;  4UVA A;  3I5U A;  2GXB A;  1A6I A;  4YFN F;  3CMM A;  3ZQF A;  3GZN B;  3WG7 H;  3R60 A;  1UHM A;  3BR3 A;  4RBO A;  1OMI A;  1R36 A;  1XN7 A;  2WY8 Q;  5LHI A;  5ICG A;  1W7P A;  2IGN A;  4XBF A;  2HI3 A;  1YOV B;  4QIW N;  3A4C A;  4CCO A;  4XM3 A;  5K7Z A;  1MNE A;  3T5X A;  4E7J A;  1XSD A;  2ZME B;  3DBR B;  4A3M J;  3EPZ A;  4JX4 A;  3WHC A;  1IN8 A;  1P6R A;  2EZI A;  4G6T B;  2JVH A;  2Z1D A;  1WH5 A;  1BW6 A;  3FKI J;  2V1U A;  1LDK B;  3KYD B;  3ZMZ A;  1OLT A;  3SZT A;  1S8N A;  1U78 A;  3QU3 A;  2IS2 A;  3X2Q H;  2CUJ A;  2RKH A;  2PJP A;  3V4G A;  2DMT A;  1MMG A;  3DLA A;  3AG3 H;  3M9A A;  4L9T A;  2ESH A;  1YG2 A;  4ESJ A;  1V55 H;  1J75 A;  3S15 J;  2CO5 A;  4ITV A;  2BHZ A;  4ZZL A;  2O8K A;  3E6C C;  3BCA A;  2V6E A;  1XGM A;  1XC5 A;  3S1Q J;  1D5Y A;  1BIB A;  5HDG A;  3AFH A;  3I3L A;  2KPM A;  3H3V K;  3ZMT A;  1YIT I;  2OJE D;  4E4H A;  1W36 D;  3G1L A;  1QRY A;  1V5E A;  3WTS C;  2W4S A;  3W2W A;  2CV2 A;  3RQ4 A;  2QYO A;  1OYY A;  1U5T C;  1BI3 A;  2LRD A;  2VJ5 A;  3OSF A;  1SFU A;  2X4H A;  5FD5 A;  3ZQI A;  2JPB A;  1D8K A;  2DLL A;  2OQG A;  3V8K A;  2ID6 A;  3R0A A;  2EFN A;  3ABT A;  1KQ9 A;  1UG2 A;  4A3G J;  1D1A A;  1AU7 A;  4A5N A;  3TO9 A;  3S1R J;  4IX7 A;  3DPT A;  1S5L C;  3ISP A;  5FKK A;  3K1M A;  5FO5 A;  2CV1 A;  1BI0 A;  3IP4 B;  3OIP A;  2AS5 F;  3VYR B;  1BC7 C;  5IPA A;  1H8A C;  1XPX A;  3IH3 A;  1BW5 A;  4AVP A;  5HLG A;  2XGX A;  1MBH A;  3J7A O;  3MKL A;  4IHY A;  2JA6 J;  3JAM Z;  2OBP A;  2F2E A;  1SFX A;  4G6D A;  4LFU A;  4LD5 A;  4CHU A;  3NWS A;  3M1C A;  4KIS A;  3MKW B;  2E1C A;  1MDM A;  1R23 A;  2JWT A;  4CZC A;  1RPW A;  2CQK A;  2HQN A;  4XN3 A;  4B8X A;  4U0Y A;  1XTA A;  3I71 A;  1DP3 A;  3RQI A;  3L9F A;  3R0J A;  3J80 K;  3DCF A;  2FBK A;  2FML A;  3F0C A;  3M3Y J;  1R5I D;  3BQY A;  1X4O A;  2JA5 J;  2ZXW H;  3VOD A;  4G12 A;  3L2V A;  2M30 A;  2VXD A;  4D5F A;  2R7O A;  1XB4 A;  1IDZ A;  2NVX J;  2H09 A;  2KIM A;  3I55 I;  5E18 F;  3HUG B;  3VSK A;  3RJP A;  1PDN C;  1GVJ A;  3PL8 A;  2E19 A;  1O3S A;  4EJT A;  2CUF A;  4RB0 A;  1FBQ A;  5TGT A;  5E3O A;  3IV5 A;  1BOB A;  1X3Z B;  4LB6 B;  5CQE A;  2BW3 B;  3FXL A;  5KCM A;  1SMY F;  1JKR C;  1SD7 A;  1JUS A;  4HW0 A;  2L4M A;  4DYC A;  4BEH B;  4IO9 F;  1TQM A;  1TL8 A;  1U5T A;  2YUS A;  3F22 A;  1U8R A;  1E2X A;  3KP6 A;  5DD4 A;  5DUI A;  2MD5 A;  2B63 J;  1R9T J;  2DTR A;  3ML6 A;  3I58 A;  2ZSH B;  2Z9O A;  3I54 A;  3F72 A;  4RGU A;  1B59 A;  4XKB A;  2W00 A;  4V2F A;  5D4S A; 
#chains in the Genus database with same CATH homology
 5LGN A;  4LMY A;  5AIP A;  2P7C B;  4M6X A;  2EV0 A;  3M7G A;  1A04 A;  1BM9 A;  2EFO A;  3QAH A;  1Z05 A;  1H9T A;  3E5Q A;  4EM2 A;  1HW5 A;  3U1D A;  4HBL A;  1LVA A;  1JHF A;  3BY6 A;  4QLC U;  4HF2 A;  4MTE A;  2FRH A;  4RGR A;  3MZY A;  2JSC A;  2D2W A;  5DYM A;  4BYY A;  3B73 A;  3WTU C;  3LWF A;  3RYR A;  2MLK A;  3LA2 A;  4BAY A;  4A6E A;  4D0P A;  4RGS A;  4CZZ A;  3NQO A;  3WTZ A;  4UV9 A;  2LF8 A;  3F23 A;  4A0Z A;  2IJL A;  2FBI A;  1BIA A;  1OYI A;  1RZ4 A;  4Q47 A;  2P4W A;  3WU1 B;  3TO6 A;  1XDS A;  5J8F A;  3JTG A;  4KN4 X;  3M1E A;  5AIQ A;  2QM3 A;  2QVO A;  5BS6 A;  1IXS B;  3O2P E;  1UFM A;  2IA0 A;  1TTY A;  1WKM A;  1HBX G;  4CYD A;  1PP7 U;  2OA4 A;  3HRU A;  4EJW A;  4I7H A;  3KEO A;  4DNC A;  2YX4 A;  4RB2 C;  1SAX A;  1W7P D;  2H94 A;  2EV6 A;  1P4X A;  3V7C A;  3SZP A;  4RB3 C;  1ZRE A;  5CLS A;  3TDU C;  4N9H A;  4A6D A;  2H27 A;  1FSH A;  3CO6 C;  4OU0 A;  4EQQ A;  2HWV A;  1HXD A;  5CVJ A;  3HYI A;  4IPA A;  1ONV A;  4M9S A;  3R6S A;  4OMZ A;  4UVB A;  3MQ0 A;  3DP7 A;  2L3D A;  3K1P A;  3W6J B;  1ZHF A;  3EQL F;  2KKO A;  4O6J A;  1OPC A;  3ZMD A;  1IN7 A;  2K02 A;  1HSJ A;  1B4A A;  2VOO A;  1H0M A;  3GWZ A;  4EJV A;  5BQT A;  2V79 A;  3GLX A;  1Y0U A;  3REO A;  4MNU A;  3LAP A;  1KU2 A;  4IF4 A;  3T0Y A;  4LB5 A;  2VOD A;  1MDM B;  2OQR A;  1B9M A;  3FMS A;  5ILV A;  4CIC A;  6PAX A;  2MH9 A;  1FNN A;  3TDZ C;  2VBY A;  3TGN A;  4Q4Z F;  5L3G A;  4M9Z A;  5DEQ A;  2FF4 A;  2VBX A;  4MQV A;  3RI4 A;  1O3T A;  1WI9 A;  4K2E A;  4LG0 A;  5DCM B;  1R22 A;  1GHC A;  4JBA A;  4AIK A;  3BJ6 A;  2VC1 A;  3ECH A;  4LK1 F;  4XLN F;  4YFX F;  4OMY A;  2HGC A;  4EJU A;  4QWQ A;  3FM3 A;  4HZF A;  2B0L A;  3GVA A;  2K86 A;  4A2U A;  4I09 A;  5TRD A;  4I02 A;  3ZMU A;  2W84 A;  4KN7 X;  4PCQ A;  1YS7 A;  3O6B B;  2CGP A;  2XAF A;  5ICE A;  3F8F A;  2MA3 A;  2IVM A;  1ZAO A;  2A6H F;  4EJO A;  3FM5 A;  4YFK F;  2QBY A;  3I59 B;  3D0S A;  4E70 A;  1FLI A;  5LHH A;  1MGT A;  2XAG A;  5FD6 A;  1YLF A;  2W24 A;  1FOK A;  4PGH A;  3QOP A;  3CJN A;  4M74 A;  2XRO A;  2BE5 F;  4Q48 A;  3I0T A;  3GEZ A;  5LGU A;  2P5L C;  3KLO A;  2Q8K A;  1QZY A;  2O3F A;  2MLG A;  5HVQ C;  2ZFW A;  5ICC A;  2PBI A;  1IUY A;  5F1R A;  3EUH A;  5ERI A;  2XHK A;  4CDG A;  4G7Z F;  5L3C A;  5HS8 A;  3D5L A;  4Y13 A;  1EH6 A;  1IN5 A;  1ON2 A;  1JHH A;  3HRS A;  1FYK A;  4GYI A;  2A61 A;  3MFK A;  3GX4 X;  3E5X A;  1HQC A;  2ISZ A;  4Z2Y A;  1F9N A;  1MJ9 A;  4EV0 A;  3GFJ A;  1ZLJ A;  5D8K B;  2XRN A;  1HW2 A;  5HLI A;  3F8M A;  1FC3 A;  1K6O A;  1SD6 A;  3BOQ A;  5ICF A;  3CLO A;  3BJA A;  5L3E A;  4XSX F;  1T38 A;  2VE9 A;  5EEG A;  3U9G A;  2VXZ A;  2EFP A;  1YYV A;  3EDP A;  1HST A;  4P55 A;  3ZQ7 A;  2NNY A;  3GZ5 A;  4EM0 B;  2A6E F;  3HOS A;  5BMZ A;  2E7X A;  3BJO A;  4IRG A;  4NB5 A;  4UXN A;  4ENM A;  4U88 A;  2KIU A;  4N0B A;  1F1Z A;  3FWE A;  4HF1 A;  3F3X A;  2XAH A;  5D8L B;  2OU2 A;  3RPU A;  4BNC A;  3KZY A;  3EET A;  2ZME A;  3MAJ A;  2QLZ A;  2Z33 A;  2GWR A;  1G4D A;  2AXL A;  1LB2 A;  2V1X A;  1IXC A;  3EYI A;  2F5E A;  1O57 A;  3DPL C;  2XAS A;  3KE2 A;  3IWF A;  1RUO A;  3FMR A;  1K78 B;  2R3S A;  2VBZ A;  2GXG A;  4DQ2 A;  2D1V A;  4HA8 A;  3SQN A;  1HKS A;  5CYV A;  3BPX A;  1TNT A;  1Z1D A;  4IHS A;  1XGO A;  3CDH A;  1QPM A;  1Z91 A;  5J8C A;  4LLL A;  1ZLK A;  4LLG F;  3BZ6 A;  2DI3 A;  1FPQ A;  3J80 Z;  4WX9 A;  1LNW A;  1ZG5 A;  1USS A;  1TQP A;  2FU4 A;  1S7O A;  3L7W A;  5E1Z B;  2DPD A;  4S04 A;  4RS8 A;  2VT2 A;  3VFZ A;  3PQJ A;  2IT0 A;  4ZH4 F;  5LGT A;  2IW5 A;  2H6B A;  4BH9 A;  3RKX A;  4NHJ A;  2GQQ A;  1O3Q A;  2G9W A;  3JAM K;  2DU9 A;  2K4J A;  3K69 A;  4MGR A;  3IRQ A;  2WWY A;  4G7H F;  4R1H A;  5L3D A;  2NRA C;  2CG4 A;  2KIF A;  2C6Y A;  4KIB A;  3ECO A;  3JSO A;  2XUB A;  1FBS A;  4I01 A;  2PMU A;  2EJR A;  2K27 A;  2IA2 A;  3H92 A;  2BEO A;  2Y0M A;  4FX0 A;  1K78 A;  3HHH A;  4HV6 A;  3V7S A;  2HTS A;  3J81 Z;  1NHA A;  2HTJ A;  4IXA A;  3IWZ A;  3L00 A;  1KQ8 A;  4YII A;  2D1H A;  3IL2 A;  3M8F A;  2EK5 A;  2W57 A;  3C18 A;  2XVC A;  1RIO H;  2ETH A;  1Q1H A;  1Z6R A;  1ZG3 A;  5JR3 A;  4RGX A;  5FLX Z;  1MZB A;  1KU9 A;  2QUF A;  3CUQ B;  5D5W B;  1ZRD A;  2HKO A;  1XSV A;  4U7D A;  5HDK A;  4EMS A;  1J9I A;  1XD7 A;  4RAZ A;  1U3E M;  2DFI A;  2FE3 A;  1J0R A;  2P7V B;  4YIF A;  3CUO A;  4KIC A;  1IF1 A;  1FX7 A;  4LK0 F;  5D5V B;  2JTV A;  2ISY A;  3FXQ A;  4I0B A;  5E8G A;  1IAW A;  1SFE A;  3DEU A;  3P9I A;  4LJZ F;  4UV8 A;  1ZAR A;  2W85 A;  4I98 B;  2GA1 A;  4P9F A;  5K5O A;  3T8R A;  3KP2 A;  4RB1 A;  2F5D A;  1OR7 A;  3E6M A;  1G6N A;  3TO7 A;  1O7F A;  2G7U A;  5D5U B;  2PQ8 A;  3P9C A;  5D6F A;  2WV0 A;  3CUQ C;  3GFM A;  1W5S A;  3WTV C;  4HDU A;  4PDK A;  1R1T A;  4ZYH A;  1ZN2 A;  1D5V A;  2EFQ A;  2L54 A;  2VON A;  2LDU A;  2P5V A;  3L09 A;  2NS0 A;  5LRR A;  3BPV A;  3V8J A;  2R7F A;  1T98 A;  2Q2E A;  2WC2 A;  4WF2 A;  1SD5 A;  1BN5 A;  1UCR A;  1ODD A;  1R7J A;  5FB2 A;  3IKT A;  2LF7 A;  2UWM A;  1R5H A;  2OZ6 A;  3ZN1 A;  3M8E A;  3GXO A;  2EV5 A;  1LEA A;  2NYX A;  1FZP B;  4HYE A;  4F7Z A;  3IC7 A;  3FF5 A;  4KDP A;  3ELK A;  3O3K A;  1MKM A;  5FFZ A;  3GO5 A;  3J81 K;  2M87 A;  4ZZD A;  4BQA A;  1UST A;  3Q5F A;  4M9X A;  2YSR A;  3WGH A;  1W5T A;  1T6S A;  2RVC A;  1EH7 A;  2OD5 A;  1DP7 P;  4OIQ F;  1BJA A;  2Z99 A;  1DDN A;  1FYL A;  4Y15 A;  1XGS A;  2EWN A;  4EVI A;  1B6A A;  1SD4 A;  4ZYE A;  1F5T A;  4BHC A;  4UUV A;  5DDG A;  4MEX F;  2DO7 A;  2K4B A;  5DV5 A;  3E3V A;  1MJB A;  3T8T A;  1KQ0 A;  1PUE E;  4BHB A;  3B02 A;  2COM A;  1QBJ A;  2FA5 A;  3GW2 A;  1IN6 A;  3Q9V A;  1WRJ A;  4EGY A;  3F6V A;  2JRT A;  4HF0 A;  5E17 F;  1XCB A;  3Q9S A;  2O0Y A;  4I2O A;  2GIV A;  2A69 F;  4ASN A;  5FFX A;  1R5G A;  1XMA A;  1PP8 F;  1UB9 A;  3QPH A;  3P7N A;  4G9Y A;  3COA C;  3DQV C;  3E97 A;  1G3T A;  1OKR A;  4WCG A;  4L0Z B;  4KNY A;  2VE8 A;  3V7R A;  2PI0 A;  4IVN A;  2FOK A;  4TV7 A;  2J5O A;  4L0Y B;  2J5P A;  1WQ2 A;  3QU6 A;  2ZXJ A;  5D4R A;  3C1D A;  2E7W A;  5CVU A;  4G7O F;  1QZZ A;  4HX4 A;  1XMK A;  1QO0 D;  1OYW A;  2A68 F;  1K79 A;  1FP2 A;  3F8B A;  4MQ9 F;  4L9V A;  4L5J A;  5LEK A;  2G7H A;  3LAJ A;  3CTA A;  3MWM A;  1ULY A;  5F64 A;  2IP2 A;  3HRT A;  2Y48 A;  2KJB A;  5BOX A;  3FMQ A;  3QP6 A;  4A0X A;  3TOA A;  2ZCW A;  1BC8 C;  2PEX A;  5DUK A;  1KU3 A;  2XKO A;  2MH2 A;  1QNT A;  3WTY C;  3ULQ B;  3KCC A;  5CJ9 A;  3RTR A;  1BI2 A;  4P9U A;  2QZ8 A;  3K2Z A;  5HLH A;  3HOT A;  3ZMV A;  4Q5S F;  1DPU A;  3AAF A;  1T39 A;  3PQK A;  1AOY A;  2QBY B;  2RNJ A;  1K7A A;  3FHZ A;  5ILU A;  1JXS A;  1V4R A;  1D8J A;  1BOA A;  1KA8 A;  5JVT A;  5HS7 A;  5CVI A;  3RPQ A;  1D3Y A;  4MHG A;  3L2C A;  5CVR A;  3KP4 A;  1T0F A;  3ERE D;  3RYP A;  3GYH X;  3LST A;  3TOB A;  2JT1 A;  2ZJ2 A;  4LG0 B;  2DW4 A;  2HKX A;  3ZP5 A;  1IXR C;  3SXY A;  2LKP A;  2OAZ A;  1QQI A;  4M73 A;  2PN6 A;  1P92 A;  4WXC A;  1ZYR F;  2YR2 A;  4R8H A;  2Z3Y A;  4BXU A;  1J2X A;  4GYG A;  1IZ1 A;  3N97 A;  3QRF F;  3BWG A;  2PMH A;  4AWX B;  1J7K A;  2IPQ X;  2V6C A;  3T1B A;  2STT A;  2ZO4 A;  1S3J A;  1IN4 A;  2Y75 A;  2H6C A;  2YU3 A;  3H3Z A;  1LDD A;  2P5K A;  4EGZ A;  3LA7 A;  4HLX A;  4AD9 A;  4CGZ A;  3CUQ A;  1I27 A;  4ON0 A;  2LSO A;  2GA2 A;  3N4M A;  2VT3 A;  1E17 A;  4EM1 A;  3F21 A;  4M72 A;  1G3Y A;  4JQF A;  1HKT A;  4B09 A;  3DXJ F;  2DK8 A;  5BPI A;  1P2F A;  4IJA A;  2ZBK A;  2L4A A;  3ZPL A;  4MTD A;  2Q0O A;  2RV8 A;  1FYM A;  2XIG A;  4U0W A;  1FSE A;  2FSW A;  3P9K A;  3C7J A;  5LRS A;  2RDP A;  4KYW A;  1XGN A;  3C3W A;  3R4K A;  1U6G A;  2R7D A;  3VEP A;  2P6S A;  3KLN A;  4FX4 A;  4HLY A;  4IRI A;  1AWC A;  3GFI A;  2FNA A;  3K1N A;  2STW A;  2CYY A;  1YW9 A;  1R1V A;  4P5O A;  2IRF G;  1CF7 B;  1YW8 A;  3WTW C;  3ZN0 A;  4M71 A;  5AON A;  1ZGA A;  4ENJ A;  1L3L A;  3I53 A;  2GZW A;  1FY7 A;  3HRM A;  2D45 A;  2VN2 A;  1STZ A;  2M1B A;  3FXR A;  2QQA A;  3MCZ A;  5E1X A;  3F8N A;  2HQR A;  3TQN A;  5D5X B;  2FNP A;  5E1W A;  3WE2 A;  3KZZ A;  1LEB A;  4N9I A;  2UXX A;  5K5Q A;  2P6T A;  3QP5 A;  4KMF A;  1ZH5 A;  3U2R A;  1Z9C A;  5HOO A;  4AIJ A;  3MZH A;  2OZU A;  4ENN A;  3F8C A;  4HAM A;  1X3U A;  3HSR A;  1JGS A;  3HHG A;  1S29 A;  2K7L A;  2CWE A;  4O5V A;  1WWX A;  2F5F A;  2GAU A;  2FBH A;  4HV5 A;  2HDC A;  5HDN A;  3WOD F;  1HW1 A;  2W25 A;  3NRV A;  5CVV A;  3G73 A;  1Z7U A;  3I4P A;  2ZKZ A;  2NAZ A;  2TDX A;  1FBU A;  1SMT A;  4ESF A;  3HSF A;  3QPT A;  4WWC A;  5KVR A;  4OIP F;  2BV6 A;  3RIR A;  1WSU A;  5A2Q K;  5DD8 A;  2DQR A;  3R61 A;  4WK8 F;  3G3Z A;  1BI1 A;  3BRO A;  2JZY A;  2DQL A;  2EB7 A;  5E8I A;  5DCM A;  1H9G A;  1ON1 A;  4Y17 A;  1ZRC A;  4KFC A;  2UXN A;  2PG4 A;  3MEX A;  4A0Y A;  2M5W A;  1MD0 A;  2DAO A;  5H20 A;  1FP1 D;  1KGS A;  5LBQ A;  2VBW A;  2O8X A;  5DCF A;  4HOB A;  3VB2 A;  1KYW A;  3KP3 A;  2IA1 A;  5D6E A;  4A5M A;  3CO7 C;  2VOP A;  5K5R A;  1U2W A;  2Z5U A;  5BPD A;  4KMU X;  5JI6 A;  3HUG A;  5IT9 K;  1J5Y A;  1TW2 A;  5IT9 Z;  1O3R A;  1YS6 A;  3F6O A;  1G3S A;  4H0E A;  4LLN A;  2PFB A;  5JHU A;  2WTE A;  1R1U A;  4S05 A;  3K0L A;  1ZGJ A;  3DV8 A;  1O7L A;  1B9N A;  2MC3 A;  4KIG A;  1VTN C;  1QGP A;  2HYG D;  2QQB A;  5EEH A;  1FWZ A;  4GCV A;  4HX8 A;  3GZ6 A;  1UHW A;  2UZK A;  2DPU A;  1EH8 A;  3LQQ A;  3KET A;  3V8L A;  4UHT A;  4L9N A;  2DT5 A;  2HR3 A;  1RNL A;  4WXH A;  4L18 B;  4ETS A;  3NEU A;  4KT5 C;  4HQE A;  4XSZ F;  4FHT A;  5HS9 A;  3WGG A;  3E6D A;  3HTU A;  1YTY A;  2VC0 A;  1YFH A;  4YG2 F;  1HKQ A;  2V1D A;  4RAY A;  3HTS B;  3WGI A;  2EA4 A;  1YQA A;  1BBY A;  3E6B A;  3LQR A;  3RKW A;  2RN7 A;  5ILS A;  3FX3 A;  2NNN A;  4XRF A;  2EA2 A;  5L3F A;  4O3M A;  1ZRF A;  1JE8 A;  5KK1 A;  1TLH B;  2ADU A;  1C0W A;  5LEJ A;  2RC4 A;  1LJ9 A;  1B1B A;  4WXD A;  3ZMS A;  3I59 A;  2E1N A;  1TW3 A;  3DF8 A;  1REP C;  5F6F A;  4FT8 A;  4UNO A;  3BDD A;  3KFW X;  2BYV E;  3WTT C;  2L01 A;  2F5C A;  1TBX A;  2ELH A;  4IRH A;  2YPR A;  2FEZ A;  2ZNY A;  2XAQ A;  2A3S A;  1DUX C;  5E20 A;  1CF7 A;  1LDJ A;  3HIF A;  2O6G E;  5JFR A;  4ZYD A;  1XCV A;  2HFH A;  1Z6T A;  1LQ1 A;  3LFK A;  5J6X A;  1EV7 A;  1YO5 C;  4GGG A;  5H6Q A;  3JW4 A;  4BHP A;  1I1G A;  3LA3 A;  3PFI A;  5FLX K;  4AIH A;  2FQ3 A;  1T2K A;  1F4K A;  1V3F A;  2HOE A;  5TJJ A;  1MJA A;  2A07 F;  1GXQ A;  4I0A A;  3E5U A;  3KEQ A;  4PGG A;  2P8T A;  1IW7 F;  1IRG A;  3W6K B;  4L5I A;  4ZYG A;  3TKY A;  1L0O C;  1J59 A;  1GXP A;  1RI7 A;  1XSX A;  1CGP A;  1S6L A;  2CFX A;  2KJC A;  3K9T A;  4A12 A;  3ROU A;  2QQ9 A;  4XLP F;  2HZT A;  2XAJ A;  4L9J A;  4CXF A;  1RUN A;  2MBF A;  4OOI A;  2DBB A;  3KP5 A;  2EFW A;  5LHG A;  2KRF A;  3WE3 A;  4G8X A;  2RQP A;  2CSO A;  3ABU A;  2ZNZ A;  3IHU A;  2O03 A;  2HS5 A;  4KUM A;  3IKV A;  2CW0 F;  4G94 A;  1S7A A;  2BGC A;  4CO8 A;  4UVC A;  4ENK A;  2YX7 A;  3GFL A;  2DK5 A;  5H6R A;  2JPC A;  1KYZ A;  1W7P B;  3GF2 A;  4OIN F;  2A5Y B;  5ED4 A;  2LNB A;  3WTX C;  4R79 A;  1I1S A;  2O61 A;  3H3U A;  3VOE A;  1TQI A;  4JK1 X;  5LLQ A;  4KIF A;  2M45 A;  3KP7 A;  4IHT A;  1I5Z A;  1TNS A;  3EYY A;  4PZJ A;  4HX7 A;  5A2Q Z;  3DKW A;  3OOP A;  1DPR A;  1IRF A;  3RKY A;  1YW7 A;  3OV8 A;  3S2W A;  5L3B A;  2M8E A;  3GUD A;  3WU0 A;  2QWW A;  4U0V A;  2ESN A;  2RGV A;  4MEY F;  2PLY A;  3FXU A;  3WG9 A;  1W4M A;  2QEN A;  4OIO F;  1P4W A;  1R00 A;  3IRR A;  3BP8 A;  2HYF A;  3SFZ A;  2HEO A;  4ESB A;  4GO1 A;  3SHF A;  4OIR F;  4M6Y A;  2BBY A;  4KA4 A;  2XV4 S;  3I64 A;  1R58 A;  1FT9 A;  4HQM A;  4P96 A;  4GXO A;  4G6Q A;  2FMY A;  2V9V A;  3JSP A;  1KU7 A;  1ZG1 A;  5K1Y A;  1P4A A;  3FZV A;  1XDU A;  3DFG A;  4U7B A;  5FGM A;  1G3W A;  3RDI A;  3HSE A;  4NQW A;  4HDV A;  4LGW A;  3JTH A;  2ACJ A;  2X0L A;  2FXA A;  1I6X A;  2L02 A;  1YIO A;  5IT3 A;  1U5T B;  2XKP A;  4UVA A;  3I5U A;  2GXB A;  4YFN F;  3R60 A;  1UHM A;  1OMI A;  1R36 A;  1XN7 A;  5LHI A;  5ICG A;  1W7P A;  4XBF A;  3T5X A;  1XSD A;  2ZME B;  1IN8 A;  1P6R A;  2V1U A;  1LDK B;  3ZMZ A;  1U78 A;  3SZT A;  1S8N A;  3QU3 A;  2RKH A;  2PJP A;  3V4G A;  3M9A A;  4L9T A;  2ESH A;  1YG2 A;  4ESJ A;  1J75 A;  2CO5 A;  4ZZL A;  3E6C C;  1XGM A;  1BIB A;  5HDG A;  3ZMT A;  3WTS C;  2QYO A;  1OYY A;  1U5T C;  1BI3 A;  1SFU A;  2X4H A;  5FD5 A;  2JPB A;  1D8K A;  2DLL A;  2OQG A;  3V8K A;  3R0A A;  2EFN A;  3ABT A;  1KQ9 A;  4A5N A;  3TO9 A;  3DPT A;  3ISP A;  5FO5 A;  3K1M A;  1BI0 A;  2AS5 F;  1BC7 C;  4AVP A;  5HLG A;  2XGX A;  3J7A O;  3JAM Z;  2OBP A;  2F2E A;  1SFX A;  4G6D A;  4LFU A;  4LD5 A;  4CHU A;  2E1C A;  1MDM A;  1R23 A;  2CQK A;  2HQN A;  4U0Y A;  4B8X A;  3I71 A;  3L9F A;  3R0J A;  3J80 K;  2FBK A;  2FML A;  3VOD A;  2M30 A;  1XB4 A;  2H09 A;  2KIM A;  5E18 F;  3RJP A;  1PDN C;  1GVJ A;  1O3S A;  4EJT A;  4RB0 A;  1FBQ A;  4LB6 B;  1SMY F;  1SD7 A;  4HW0 A;  2L4M A;  1TQM A;  1U5T A;  3F22 A;  1U8R A;  1E2X A;  3KP6 A;  5DD4 A;  5DUI A;  2MD5 A;  2DTR A;  3ML6 A;  3I58 A;  2Z9O A;  3I54 A;  3F72 A;  4RGU A;  1B59 A;  5D4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...