1XN7A

Solution structure of e.coli protein yhgg: the northeast structural genomics consortium target et95
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGSCKSCPEGKACLREWWALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yhgG
publication title Solution Structure of E.Coli Protein yhgG: The Northeast Structural Genomics Consortium Target ET95
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 13
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xn7A00
2ZJ2A 5CVJA 2G7HA 2QM3A 4GGGA 2O3FA 2OD5A 4LB6B 2ESHA 1ZGAA 1K6OA 5FO5A 5FFZA 3GFMA 2MA3A 5IT9Z 2PJPA 3HSEA 1BM9A 1PDNC 3ABTA 3WGIA 3TOAA 3I59A 3EQLF 2W25A 3SQNA 4G9YA 1P4AA 2YX7A 1FBUA 1IXSB 2E1NA 2QENA 4BNCA 3DPLC 3F3XA 5LHGA 1OYYA 5ILUA 4IF4A 2DAOA 2ZO4A 4LB5A 1R7JA 2H6BA 3WTVC 3F8BA 1RIOH 1GXQA 5A2QZ 2Y75A 1LEBA 3H3UA 2H6CA 3B73A 2Y48A 3RPUA 4BYYA 2MH2A 1LVAA 2DQRA 4U0WA 1XN7A 1BC8C 3JW4A 1TNTA 4Q48A 2RVCA 4MQVA 1O3RA 3F21A 2HR3A 4YFKF 3G73A 2EFNA 4L5IA 1UHMA 5H20A 1ZAOA 2PG4A 2XRNA 5D5UB 4EVIA 1I27A 3CTAA 5IT9K 3RYPA 1KU9A 2FF4A 3WGHA 5J6XA 4Y15A 4FX4A 2PBIA 2KIUA 1MJAA 3GWZA 2HGCA 5LBQA 3TQNA 1FYLA 3HIFA 2VBXA 1CF7B 1YO5C 2QUFA 2W84A 1K78B 3BZ6A 2GWRA 1U8RA 4M71A 1LB2A 3FMRA 2ETHA 3DP7A 2HTSA 2YR2A 1ZG1A 5A2QK 3IRQA 1OKRA 4DQ2A 3MZYA 2WTEA 5ICFA 4AIKA 2Q0OA 4Q4ZF 1TQMA 1T38A 4BHBA 2UXNA 4MHGA 3E6CC 2JPCA 1FBQA 3RDIA 1KGSA 2G7UA 4OU0A 1B4AA 3IC7A 2F5EA 2XHKA 5DCMB 2QBYA 2PFBA 4RS8A 4Y17A 4ZZLA 3GXOA 5E1ZB 4RB2C 1UB9A 4WX9A 4A2UA 4XLNF 3OOPA 3KETA 2CO5A 5LHIA 2Z99A 4R79A 3CDHA 3O2PE 4YIFA 3E6MA 2DPUA 4KYWA 4HA8A 4OINF 4IHTA 2LF7A 3RKXA 3QU6A 3LSTA 1HW1A 1KA8A 3GFJA 3BY6A 2QWWA 1MKMA 4UVAA 2CG4A 1L3LA 4PZJA 3WTSC 3KZYA 1F5TA 2CYYA 2NNYA 1W4MA 1MZBA 3VOEA 1Z9CA 1DDNA 3QRFF 1FSHA 5FD5A 2IW5A 1UHWA 4P96A 2Z33A 3F8NA 3DV8A 2FBIA 2NYXA 1J75A 1PUEE 3WTXC 2A68F 2EFWA 1QPMA 2AXLA 3GX4X 4BXUA 2LDUA 3KP3A 2F5FA 2R7FA 2Y0MA 2A69F 4XRFA 4E70A 4KN7X 3O3KA 4WCGA 2DU9A 4FT8A 1LNWA 1SD6A 5H6RA 2VE9A 1KU2A 1IAWA 1MD0A 5E1WA 1WSUA 4L9TA 3KEQA 5FD6A 3TDUC 1KQ0A 3BPXA 2HQRA 1S7AA 2EJRA 2VE8A 5K5QA 5FB2A 4IJAA 2LSOA 3FZVA 3GFLA 3JSOA 2PMUA 3N4MA 3V8LA 1Z1DA 1T39A 3ECOA 4QWQA 4YG2F 1JXSA 1P4XA 1EH6A 3C3WA 5D5WB 3GF2A 1CF7A 4L0YB 2KIFA 5HOOA 4UUVA 4JQFA 4MEXF 3IRRA 2K27A 1XCVA 3JAMZ 4HAMA 1KU3A 5IT3A 4YFXF 2DLLA 1VTNC 1QNTA 3T8TA 5TRDA 2KKOA 3HOTA 1MDMB 3HTUA 2F5CA 2PI0A 5DD4A 2WV0A 1TQIA 4MTDA 4LJZF 5EEHA 1QO0D 3S2WA 4HZFA 3M8FA 5HS7A 2P8TA 2MLKA 5J8CA 1JHHA 3ZMVA 1MGTA 4RB0A 3IKTA 2M1BA 1FX7A 1ZARA 2YX4A 1U3EM 1X3UA 2PMHA 4M9SA 2X0LA 2OQGA 3NEUA 2V6CA 4GYGA 5KK1A 3J80Z 2DBBA 3HSRA 1SD4A 2X4HA 2EFQA 4IRGA 1IN7A 2HYFA 4BHCA 3KFWX 2XAFA 5ERIA 4OIQF 4OIPF 1O57A 3JAMK 4KMUX 4CXFA 1Q1HA 3RTRA 1WRJA 1SAXA 1J5YA 2FQ3A 3V4GA 4UV8A 1FPQA 2RGVA 1FZPB 1XGOA 3MFKA 2R7DA 2A6EF 2RV8A 4P55A 2WC2A 2GIVA 3FM5A 4GXOA 1SD5A 2JTVA 1S6LA 2OQRA 2M45A 3I53A 3M8EA 3GFIA 3E5XA 4KA4A 1OMIA 3TDZC 4A6EA 3J80K 1FP1D 2B0LA 3WTZA 5TJJA 4HV6A 3KP4A 2M5WA 2L4AA 4UHTA 1GXPA 1BIAA 1TW2A 4LD5A 1SFUA 5L3FA 1W5TA 5L3CA 1FP2A 4L9VA 4L0ZB 3FMSA 5LGNA 4RB3C 2XAJA 1HBXG 1E2XA 4UNOA 3GZ6A 4NHJA 2MBFA 1S8NA 1GVJA 4A0ZA 4BHPA 2XIGA 2VBZA 3QP6A 4KDPA 3DXJF 5JFRA 3ZMSA 2LNBA 4KMFA 3RJPA 4ZZDA 4A5MA 4ZYGA 3ISPA 1P92A 4HX8A 3BDDA 1YTYA 4G7HF 3QPTA 2J5PA 5ICGA 2EWNA 1XSXA 4HLXA 1U5TC 4OMZA 4CHUA 1EH7A 4A12A 2MH9A 2FNAA 1MDMA 1XD7A 3WTWC 3K1MA 2QYOA 3MEXA 3JTHA 3E97A 1TQPA 1YG2A 5JHUA 1D3YA 3FMQA 4ON0A 4LFUA 1D5VA 2XKPA 1IN6A 1EH8A 1W7PD 4L18B 5CVRA 5LGTA 1QZZA 3WGGA 4A0XA 3FHZA 2HKXA 4XBFA 2A5YB 1W5SA 2L02A 2P5LC 4I0BA 4L9NA 1KYWA 5H6QA 4CICA 1WI9A 1FT9A 3FXUA 2V1DA 3QOPA 1DPUA 4I01A 1J2XA 2K4JA 1Z7UA 1I1GA 2EK5A 4G94A 4U0VA 1S3JA 3QAHA 4B09A 4EJOA 4ENNA 4RAYA 3MZHA 1SFEA 2CWEA 1U78A 5CYVA 4ESBA 3IKVA 2A07F 2H09A 2M8EA 1BI3A 3KCCA 1IZ1A 4GO1A 5DCFA 1H9GA 2ACJA 2NRAC 3HHGA 4S04A 2V79A 2VT3A 1CGPA 1O7LA 3C18A 1R23A 5ICEA 2P6SA 1P4WA 3EYIA 1RI7A 3WTYC 3E5QA 3HRSA 1DUXC 1UCRA 3KP7A 5HLIA 4EQQA 3IWZA 4OIOF 5D6EA 4EMSA 2ISYA 4ETSA 2XROA 2NAZA 1DPRA 2GA1A 5HDKA 2ZBKA 4ZYHA 2VN2A 3DFGA 1DP7P 3NRVA 3HRUA 3VFZA 4KIGA 1LDKB 3ZMZA 3KP6A 4BAYA 2VXZA 1BN5A 1RNLA 1XGNA 1G4DA 2Z9OA 1S29A 1ZG3A 1AWCA 3RIRA 3LQRA 2GQQA 4CZZA 3BOQA 4HF2A 2K02A 2E7XA 3V8KA 3M7GA 2RDPA 1B1BA 2IPQX 1S7OA 3I71A 3E5UA 1LDJA 1LDDA 4LK0F 4HF1A 2TDXA 4YIIA 3GLXA 3MCZA 2BBYA 1O3SA 3KP5A 2ZXJA 3LA2A 3I58A 4FX0A 1F9NA 2EV5A 2W24A 2XKOA 1G3WA 3KP2A 2CSOA 3R6SA 3HRMA 3ZMDA 5D8LB 4H0EA 2IRFG 4I0AA 5L3EA 5DUIA 2L3DA 3V7RA 1IXCA 4G6DA 4JK1X 1GHCA 1IN8A 4GYIA 2RQPA 4Z2YA 2MLGA 1YS6A 2HWVA 3HSFA 3PFIA 4AD9A 2RNJA 4G6QA 1XDUA 3VEPA 3J81Z 4ESFA 4AIHA 4HX4A 2OZ6A 2JSCA 1YLFA 3F22A 5DDGA 2ESNA 4P9FA 4HLYA 4QLCU 3BJAA 3GW2A 1QGPA 3B02A 3RPQA 5HLHA 3P9KA 4JBAA 4L5JA 5JVTA 2NNNA 3GO5A 3FM3A 3EDPA 2DK5A 1IN5A 1P6RA 4P5OA 5K1YA 1L0OC 1ZHFA 2BEOA 2YPRA 4U7DA 2QZ8A 2COMA 3V7SA 4MNUA 1I5ZA 5E1XA 2QQBA 4A6DA 4O5VA 4PDKA 1U5TB 1G3YA 3SFZA 3Q5FA 3K0LA 1JE8A 1J7KA 4WF2A 3MWMA 4HBLA 3BP8A 3JTGA 1KQ9A 1R58A 3E6BA 1EV7A 1E17A 4PGGA 2YU3A 1RZ4A 3KLNA 3ELKA 1TTYA 1YYVA 5DD8A 1R1TA 3J81K 2P4WA 2ZCWA 2GXGA 3LAPA 3Q9SA 4PCQA 5BOXA 3C1DA 3D5LA 1G6NA 1BBYA 5J8FA 3F8CA 2HEOA 4WK8F 2HOEA 5D5XB 1PP8F 3IL2A 1R1UA 2HTJA 1KYZA 2FMYA 5K5RA 4WXDA 2FNPA 2K7LA 2KJCA 3QPHA 1HSTA 2FE3A 3H92A 4PGHA 2IA0A 3DQVC 2JT1A 5CVIA 4N9HA 3PQJA 2HZTA 2VODA 2HS5A 2NS0A 4A0YA 2LF8A 2ZFWA 3SHFA 2E1CA 2K86A 2ZKZA 4ZYDA 2FA5A 1IXRC 1HKTA 5BPIA 1ON1A 1H0MA 2ZMEB 5BQTA 4U7BA 2V1XA 1YW9A 5E20A 3TO9A 3ERED 1FBSA 3L7WA 1ZRDA 4Q5SF 2EB7A 4LK1F 3CO7C 1ODDA 1MJ9A 1IN4A 2XAQA 3WU0A 1TLHB 4NB5A 1F4KA 2FBKA 2QQAA 1HXDA 2VT2A 2VBWA 5LRRA 2EA4A 4G7OF 4TV7A 2DW4A 2KIMA 2KRFA 3FXRA 2VONA 2DT5A 4YFNF 2CFXA 2O03A 3W6KB 1I1SA 1BI2A 4K2EA 3AAFA 1G3SA 3TOBA 3BWGA 3EYYA 1XMAA 4AVPA 4LG0B 2DO7A 3K1PA 2VC0A 1USTA 3ZPLA 3SXYA 3EETA 1ZREA 1H9TA 5D6FA 5JI6A 3LFKA 1FNNA 2E7WA 4CYDA 2STTA 4IVNA 5KVRA 3R4KA 5FFXA 5LGUA 3ZN1A 3K9TA 2PLYA 3C7JA 4F7ZA 1U5TA 2OBPA 1T6SA 1A04A 3P9CA 1WKMA 3GYHX 3CUOA 5BS6A 1USSA 3LAJA 3CJNA 3U1DA 3H3ZA 4EM2A 4HW0A 4M72A 1K7AA 4RGRA 3R61A 1SD7A 2QLZA 5D4SA 5L3DA 2AS5F 5BMZA 1FYMA 4N9IA 3HOSA 3GVAA 4EGZA 1ZLJA 2IP2A 1IF1A 3OV8A 2FRHA 2ELHA 3L2CA 4O3MA 3VB2A 5HLGA 4I09A 4KUMA 1OPCA 1ZLKA 3ZP5A 2ZNZA 5AIQA 4AWXB 2F5DA 1B6AA 5HDNA 5CJ9A 4G8XA 3CUQA 1V4RA 4G7ZF 2XV4S 1JHFA 2D1VA 1WWXA 2H94A 3DPTA 2FMLA 2D1HA 2DK8A 1WQ2A 2IA1A 4XSZF 1KU7A 3E6DA 2KJBA 3WE2A 5ILVA 3LA7A 1OYIA 2ZMEA 2HYGD 1U6GA 5E18F 2DPDA 4BQAA 2O61A 4XLPF 3K69A 3I64A 3CUQC 2XAHA 4LGWA 3T0YA 2JPBA 3VODA 3SZPA 4LLLA 1IRGA 4BH9A 2RN7A 2PEXA 2RKHA 4N0BA 3QP5A 3GZ5A 5HS9A 5E8IA 4LLGF 3L00A 1U2WA 4Y13A 5K5OA 3DEUA 4I7HA 4LG0A 3FXQA 3L9FA 4HOBA 1W7PB 3P9IA 2P7VB 5FLXZ 2EFOA 1QQIA 4L9JA 2FOKA 5EEGA 1J9IA 1B9NA 3EUHA 3I4PA 2A61A 2ADUA 2EV6A 4UVBA 4M74A 4R1HA 3JSPA 4Q47A 2Z5UA 3V7CA 2XGXA 4HDUA 5DUKA 1LQ1A 2O0YA 3I54A 2XASA 4KN4X 2IVMA 1R22A 2OZUA 2DI3A 4M6YA 3V8JA 1BI0A 4M6XA 2P5KA 1J0RA 2XVCA 3QU3A 2IT0A 2M87A 4OMYA 5E8GA 1IUYA 1FOKA 4O6JA 4M9XA 3F72A 5FGMA 3ABUA 1B9MA 3SZTA 1TBXA 4MQ9F 1FSEA 4WXHA 2BV6A 1F1ZA 2EV0A 3LA3A 2VOOA 2IA2A 1HW2A 3DF8A 4EJWA 1O3TA 4NQWA 2L54A 1Z6TA 1C0WA 2P5VA 3R0AA 1Z91A 3ECHA 2OU2A 4HX7A 5FLXK 1R36A 4UXNA 2K4BA 3ULQB 3GUDA 3T8RA 1O7FA 4HYEA 3T5XA 2UWMA 3R0JA 4CDGA 4M9ZA 3W6JB 1T2KA 4OIRF 3WG9A 4GCVA 1STZA 1YW7A 2DFIA 1R00A 3WTTC 2QVOA 2A3SA 3HRTA 2XAGA 2VOPA 3BJ6A 3TGNA 1TNSA 4LLNA 4FHTA 5CLSA 5E17F 3FF5A 4I2OA 1XCBA 5LLQA 1FC3A 2Q8KA 3I5UA 4A5NA 3E3VA 4B8XA 4MGRA 1JGSA 1Y0UA 4I98B 2BYVE 1YIOA 2L01A 1BI1A 1BOAA 1HQCA 5DEQA 2FU4A 4ZYEA 1AOYA 1BIBA 2O6GE 1V3FA 1XMKA 3KLOA 3R60A 1XSDA 2P7CB 2GZWA 5ED4A 2FSWA 3T1BA 4UV9A 1D8KA 4ENMA 1ON2A 4KIFA 3RKYA 1NHAA 3ZQ7A 3LWFA 5CVUA 3L09A 1QBJA 5DYMA 4ESJA 3WODF 4RAZA 2EFPA 2QQ9A 3K1NA 6PAXA 3U2RA 4R8HA 1TW3A 4EJUA 3CO6C 2V9VA 3KEOA 2FEZA 5L3GA 3F8MA 3REOA 1W7PA 1B59A 3K2ZA 2R3SA 4EM1A 2J5OA 2P6TA 2PN6A 2GA2A 2HQNA 3IWFA 5BPDA 3RI4A 4IPAA 1R5HA 4DNCA 5AONA 5LRSA 3CLOA 1I6XA 5HVQC 1G3TA 3TKYA 2MC3A 5ICCA 2DQLA 4I02A 3M1EA 4AIJA 1ULYA 1OR7A 1J59A 1Z6RA 2VBYA 3HTSB 1YS7A 1SMTA 1HW5A 4IRHA 4KFCA 3WU1B 4HV5A 5CVVA 2DTRA 1K78A 1XGMA 4IRIA 4HDVA 1RUOA 2CQKA 3IHUA 4KIBA 1Z05A 2HFHA 3P7NA 2M30A 3ROUA 3CUQB 1XGSA 4CO8A 4EM0B 3MAJA 2OA4A 4ZH4F 4UVCA 4KNYA 2H27A 1P2FA 4MEYF 1FY7A 2JRTA 1T0FA 2O8XA 2HDCA 1QZYA 1HKQA 4S05A 3HHHA 2VC1A 4RB1A 1YFHA 3WTUC 3I0TA 4HQEA 2UZKA 4EGYA 3Q9VA 4RGSA 1FWZA 2C6YA 3BJOA 2W57A 1KQ8A 2A6HF 3J7AO 2G9WA 5DCMA 4ENKA 4EV0A 1ZRFA 2FBHA 1HSJA 3KZZA 3ZMTA 1ZYRF 1MJBA 1YQAA 3M9AA 3G3ZA 2MD5A 4EJVA 4LMYA 5JR3A 4EJTA 1K79A 3I59B 3BROA 5L3BA 5LEJA 4WXCA 1SFXA 1YW8A 1REPC 3RKWA 1ZN2A 3COAC 1R1VA 4IXAA 1BC7C 4KT5C 5D8KB 1FLIA 3ZN0A 1ZG5A 2IJLA 3F6VA 2JZYA 2BE5F 5F1RA 1ZRCA 2EA2A 1ONVA 2GAUA 4IHSA 1ZGJA 4U88A 5F64A 3BPVA 3O6BB 2BGCA 2L4MA 4P9UA 3F6OA 5LHHA 2Q2EA 1ZH5A 3MQ0A 5DV5A 1HKSA 4MTEA 5HDGA 2ISZA 1LJ9A 1LEAA 5D5VB 3U9GA 3NQOA 4WWCA 2GXBA 3PQKA 3N97A 2HKOA 3TO6A 4RGUA 2W85A 2XUBA 1XDSA 1IRFA 5LEKA 1R5GA 1UFMA 3F8FA 3KE2A 2WWYA 3HYIA 4U0YA 5HS8A 1SMYF 3ZMUA 3FX3A 2RC4A 5D4RA 3WE3A 4HQMA 2ZNYA 3D0SA 1D8JA 4KICA 2D2WA 1T98A 1O3QA 3F23A 1XB4A 1XSVA 4ASNA 3TO7A 1OYWA 3DKWA 1BJAA 3HUGA 2D45A 3GEZA 2YSRA 1IW7F 4XSXF 2F2EA 2PQ8A 2OAZA 3RYRA 2Z3YA 4RGXA 2UXXA 4M73A 5F6FA 1PP7U 3ML6A 2CW0F 2LKPA 4ENJA 4D0PA 5AIPA 3FWEA 2FXAA 2QBYB 4HF0A 4CGZA 1FYKA 3LQQA 2STWA 5ILSA 1RUNA 4OOIA 2CGPA 2V1UA
chains in the Genus database with same CATH superfamily
2M8GX 3G1LA 2ZJ2A 5CVJA 1EA3A 2G7HA 3A2KA 2QM3A 4GGGA 2O3FA 2OD5A 2NVUB 4LB6B 2ESHA 2LVSA 2LY2A 1ZGAA 4B47A 1K6OA 5FO5A 4D9JA 1A36A 1I3QJ 5FFZA 3GFMA 2R7SA 1WPKA 2MA3A 2NOJB 3I4NJ 5IT9Z 4I76A 2PJPA 3HSEA 4AU7A 1BM9A 3TP3A 1OCOH 2ZXIA 1MMDA 5J1UA 2HVSA 4XKBA 1PDNC 3ABTA 2HQAA 3WGIA 3PO2J 3TOAA 2CV0A 3I59A 3EQLF 2W25A 2M3AA 1FOXA 3SQNA 1P9QC 2DT7B 4G9YA 1P4AA 2YX7A 4DW6A 1FBUA 3QYFA 3E1SA 2JQ7A 3DTEA 1IXSB 2E71A 3O8GA 3FDYA 3VPRA 2E1NA 2QENA 3HKZN 1LFUP 4BNCA 3AL0C 3DPLC 3F3XA 4A3EJ 5LHGA 1OYYA 2M0MA 5ILUA 3BTCA 4IF4A 2ELKA 2WADA 2E2IJ 2DAOA 4F91B 1DU6A 2KZGA 2ZO4A 4C3IJ 4LB5A 1R7JA 2H6BA 3WTVC 3ZCOA 3C2BA 3F8BA 3ABKH 2RNGA 1RIOH 1GXQA 2BY2A 1HF0A 4C2MJ 4ZC3A 1V54H 5A2QZ 1IO2A 2Y75A 5EZGA 1BR2A 1LEBA 3H3UA 2H6CA 2R7WA 3B73A 2Y48A 2VKEA 3BG5A 3RPUA 4BYYA 2MH2A 1LVAA 2JWTA 2DQRA 3CCEI 5FROA 2M7BA 2PJRB 4HSTA 4A3LJ 3SJMA 4U0WA 1XN7A 4M3EA 1BC8C 1FTTA 3JW4A 5B1BH 1TNTA 5EJCA 4NNJA 4Q48A 2RVCA 2TRTA 4RM3A 4MQVA 1O3RA 3F21A 2HR3A 2FUG2 4YFKF 3G73A 4BQNA 4BGDA 4XQFA 2EFNA 4G12A 4L5IA 2ME6A 3MKYB 1UHMA 4XKWA 5H20A 1ZAOA 5EDNA 2PG4A 2XRNA 4E7JA 1B8IA 4A3IJ 5D5UB 5GTIC 2DYSH 4EVIA 1TWHJ 2R4GA 1I27A 3CTAA 3IUOA 1YITI 1DU0A 5IT9K 3S3NA 3M4OJ 3RYPA 1KU9A 2FF4A 1MBFA 3PNYA 4RA2A 3WGHA 1A6IA 5J6XA 3AG4H 4UY8I 3PSFA 5KHDA 2CV2A 4Y15A 4FX4A 2PBIA 2KIUA 1MJAA 3I55I 3GWZA 2HGCA 4HNVA 5FJ8J 5LBQA 3CCVI 2DA7A 2E34A 3TQNA 1FYLA 2HVRA 2O7OA 3HIFA 2VBXA 1SFOJ 1CF7B 1YO5C 2QUFA 4UB8C 2W84A 1K78B 3BZ6A 2COBA 2GWRA 2KZVA 3FXMA 1U8RA 4M71A 2FX0A 2R5ZA 1LB2A 1TWFJ 3M8JA 3FMRA 2ETHA 3DP7A 2HTSA 2YR2A 4FISA 4ZJZA 1ZG1A 5A2QK 3IRQA 1OKRA 3FBNB 4DQ2A 2AXTC 3PJRA 3MZYA 2WTEA 3D1NI 2CUEA 5ICFA 2KIQA 4AIKA 2VIXA 2Q0OA 4Q4ZF 3CD6I 1TQMA 1YJ9I 2DJNA 2VB6A 2RREA 1T38A 4BHBA 2N8GA 3OIQA 2UXNA 1SVOA 4MHGA 2JPCA 3E6CC 1M1EB 1FBQA 3RDIA 4ZDOA 4Y3OA 1KONA 1X1AA 4KISA 2AQEA 4CCOA 2WV1A 4DYCA 1KGSA 3G1MA 4B3AA 2G7UA 4OU0A 2E5ZA 4Y33A 3OYKA 1B4AA 3IC7A 2F5EA 2XHKA 1PYVA 5DCMB 2QBYA 3IV5A 2LTPA 2PFBA 3JRAA 1HOMA 4RS8A 2EH3A 4Y17A 3GXOA 4DGWB 4ZZLA 1EJ9A 1Z77A 1ITYA 5E1ZB 4RB2C 1RR7A 1UB9A 3BR6A 4WX9A 4A2UA 4XLNF 3OOPA 3KETA 3OYBA 2CO5A 3RZDJ 3BR0A 2XAUA 5LHIA 3K10A 1JUPA 1PJRA 2EZHA 2Z99A 4R79A 3CDHA 3O2PE 4YIFA 3E6MA 2DPUA 4KYWA 3VYUB 4HA8A 4OINF 4IHTA 1WJAA 2LF7A 2DJIA 5JVGF 3RKXA 3QU6A 2F6CA 4XRSA 3CCLI 3LSTA 3OS2A 1HW1A 2AO9A 4E4HA 2DOEA 4CUGA 1KA8A 3GFJA 3BY6A 3S93A 4UUSB 2QWWA 2DA4A 1F43A 1MKMA 3S3OA 3CMYA 4CSWA 4UVAA 2CG4A 1L3LA 1V55H 4JYKA 1AKHB 4PZJA 5EG0A 5EEAA 3LSJA 3WTSC 3K4JA 3KZYA 1F5TA 3DKYA 1BA5A 2JRMA 2CYYA 1N25A 2NNYA 2OTLI 1W4MA 2IAIA 3SFIA 1MZBA 3VOEA 1Z9CA 1DDNA 5M3FJ 3QRFF 1FSHA 1MBKA 2FQ4A 3HXLA 4E6KG 5FD5A 2IW5A 2IS6A 1UHWA 4LOCA 4P96A 2L5QA 2Z33A 3F8NA 1OCRH 2JVHA 2GBYA 2CFOA 3DV8A 2FBIA 2WB1N 2NYXA 1J75A 3HC7A 4F52A 1PUEE 3WTXC 2W4SA 4E7HA 2A68F 3K2AA 3WHCA 2EFWA 1QPMA 2AXLA 1VQOI 3GX4X 4BXUA 2LDUA 3KP3A 1PUFB 2F5FA 2R7FA 4DBQA 4IHYA 2Y0MA 2A69F 4XRFA 1S9HA 1GT0C 2PJRA 4PJJA 4E70A 1B72B 3V42A 1SAUA 3O3KA 4KN7X 2KDOA 4WCGA 1RPWA 2DU9A 2E1MC 1LNWA 1SD6A 4FT8A 5H6RA 3DTKA 2VE9A 3NWTA 1KU2A 4BL0B 1IAWA 1MD0A 5E1WA 1WSUA 2FOWA 1X19A 4XIDA 4L9TA 1WHUA 3KEQA 5FD6A 3TDUC 1KQ0A 1Q1VA 3CCJI 3BPXA 2HQRA 1ZGWA 2L7ZA 1Z0XA 1S7AA 2EJRA 2VE8A 1LE8B 1YHQI 5K5QA 1YE9A 5FB2A 4IJAA 1H88C 3ZRGA 3JRCA 2LSOA 3FZVA 3GFLA 3IAS2 3JSOA 3S32A 4X0GA 4NC8A 1FIAA 3CJQB 4U87A 4M6VA 1T33A 1X3ZB 2PMUA 4IHXA 1Y56A 3N4MA 1VQ8I 3V8LA 1SC7A 1Z1DA 1T39A 3ECOA 1U0JA 3TL4X 4E7ZA 2NVTJ 3DBRB 4QWQA 3OYLA 4MFEA 4H4KC 4YG2F 3W2VA 5FKLA 4IQJA 1JXSA 1P4XA 3WHBA 1EH6A 3C3WA 5D5WB 3U21A 3GF2A 1CF7A 4L0YB 2KIFA 5HOOA 4UUVA 5CQGA 2KLOA 1V5GA 4JQFA 4MEXF 3IRRA 1HDDC 2K27A 1XCVA 3JAMZ 2M4GA 2KDZA 2X1CA 2XGDA 4I6ZA 5IOYA 3OYEA 1HA8A 4HAMA 1MNMC 3IP4B 1KU3A 3AL0B 5IT3A 2LLKA 4YFXF 2DLLA 2DMTA 4XL9A 3OL3A 4QIWN 1QNTA 1VTNC 3HG9A 3T8TA 4DBRA 5TRDA 2BW3B 1MSFC 2KKOA 5F1JA 1ZQ3P 3RQIA 3HOTA 1MDMB 2L7MP 4XICA 2GLOA 3HTUA 2MC4A 4A3FJ 2F5CA 2QSGX 1GV5A 2PI0A 3RQ4A 4NDLA 5DD4A 2WV0A 1TQIA 4MTDA 3PUFA 4LJZF 5EEHA 1QO0D 3S2WA 2A05A 2YUSA 2K3FA 3M8FA 4HZFA 5HS7A 3HPHA 2QA4I 2P8TA 2MLKA 5J8CA 1JHHA 3DPUA 3ZMVA 1MGTA 4RB0A 2R7TA 5C44J 3IKTA 2M1BA 1FX7A 2DCEA 1ZARA 3B6AA 1AU7A 2YX4A 3L2VA 2LY9A 1U3EM 2LRDA 1X3UA 2PMHA 1Y0NA 4M9SA 2X0LA 2OQGA 3JREA 2HU9A 3K4BA 4ZDLA 3DEWA 1ETQA 2V6CA 3NEUA 3BTLA 4GYGA 5KK1A 3J80Z 2DBBA 2GM4A 2I8DA 3AKZA 3HSRA 5IP9J 1SD4A 2X4HA 5CQEA 3ZOBA 1EF4A 3HEFA 3KPHA 5GAEJ 2NVQJ 2EFQA 4IRGA 4PFOA 2X6YA 1X3WB 2ECCA 1LVKA 1QHHD 3HOXJ 1IN7A 3JRIA 5J1RA 2HYFA 3FKIJ 2CW7A 2XF5A 4BHCA 3KFWX 4CZCA 2XAFA 2JMWA 3EUAA 5ERIA 4G6TB 4BBRJ 5F0HA 4OIQF 4OIPF 4HEA2 1O57A 1POGA 4DJAA 4XRMA 3JAMK 4KMUX 5KNLA 4F93B 4CXFA 1Q1HA 3RTRA 1WRJA 3H3VK 2X51A 2OTJI 1SAXA 1J5YA 2FQ3A 3V4GA 1MW7A 4UV8A 1N77A 3LSPA 1FPQA 2BXZA 2RGVA 1DGRM 1FZPB 1VQ5I 3HOWJ 1XGOA 3MFKA 2R7DA 4XLFA 2A6EF 4AUXA 3S2DJ 3CCSI 4BEHB 1TWAJ 2RV8A 3HZJA 2W82A 4P55A 3K6GA 2WC2A 2GIVA 3FM5A 4GXOA 1SD5A 2JTVA 1UAAA 1B8IB 1YX5A 1S6LA 2OQRA 2M45A 3KYLA 1MMSA 3JRFA 2CMPA 1F36A 3I53A 2BHZA 3ONQA 3A0HC 1B72A 3LSHA 3M8EA 1Y1WJ 2ZJRF 1K61A 1WH5A 3GFIA 3GZNB 5B3SH 2WAQA 3E5XA 4KA4A 1OMIA 3TDZC 4A6EA 1MMNA 3J80K 2ZFUA 3CMMA 1FP1D 3ZQHA 3GCMA 2YS9A 2LR8A 4XORA 2B0LA 3WTZA 5TJJA 2H8WA 4HV6A 2JUGA 2CQ7A 3KP4A 2MYSA 1U8BA 2M5WA 2XPUA 1LE8A 2L4AA 4UHTA 1NG6A 1GXPA 1BIAA 2ELJA 1TW2A 5TGTA 4LD5A 5CKTA 3H35A 1SFUA 1S5LC 3K4CA 5L3FA 2V4JC 1W5TA 5L3CA 1FP2A 4L9VA 5B5EC 4MO7A 4L0ZB 3BR1A 3ZQGA 2QSFX 3FMSA 5LGNA 4RB3C 2XAJA 5JHFA 1HBXG 1E2XA 1WGXA 4UNOA 3GZ6A 4NHJA 2MBFA 1S8NA 1GVJA 2E19A 5JLWA 2VKHA 1GUUA 4J00A 4A0ZA 4BHPA 2XIGA 4FE7A 2VBZA 3QP6A 4KDPA 4E7SA 4PK4A 3S15J 1QVTA 1MH3A 2ID6A 3DXJF 4HNUA 5JFRA 3ZMSA 2LNBA 2OCEA 3MVPA 4KMFA 1OCPA 2HPIA 3RJPA 4ZZDA 4B43A 3GTKJ 1W5CC 4A5MA 2HI3A 3NARA 4ZYGA 3DBHB 2V9KA 4W1UA 1W1WE 1VQ7I 1RESA 3ISPA 1P92A 4HX8A 3E7LA 2KQRA 3BDDA 3RKQA 1YTYA 1J09A 4G7HF 1XPXA 3QPTA 3BQZA 3BR3A 2J5PA 5ICGA 2IS2A 2EWNA 1XSXA 2L9NA 3FISA 4HLXA 3IH3A 1T95A 1U5TC 3BTJA 4OMZA 4CHUA 2BW3A 1EH7A 4A12A 2KPMA 4B1RA 2MH9A 2FNAA 1MDMA 2E2HJ 1XD7A 2E36A 3WTWC 3K1MA 2QYOA 3MEXA 4XM3A 2K9QA 2DA3A 5HLTA 1ZELA 3JTHA 3E97A 1TQPA 1YG2A 3FXKA 4YELA 2VASA 5JHUA 2LC2A 1D3YA 3FMQA 4ON0A 4LFUA 1D5VA 2XKPA 3OYIA 1IN6A 1EH8A 1W7PD 4FTHA 4L18B 5CVRA 5LGTA 1UG2A 3GTLJ 1QZZA 1WJDA 4EATA 3WGGA 4A0XA 3FHZA 1N75A 2HKXA 2OUMA 4XBFA 4PJLA 1Z21A 5EG0B 2A5YB 5FKOA 1W5SA 4F55A 2E1MB 2L02A 1GDTA 1X1PA 2DTZA 3I9V2 2P5LC 4I0BA 3O8HA 1DP3A 4L9NA 1KYWA 5H6QA 4CICA 1O4XA 3JRHA 1WI9A 3DCFA 1FT9A 3FXUA 2V1DA 3QOPA 4B4CA 3TW7A 1DPUA 4I01A 4MFDA 3JCUC 4C30A 1IDZA 1J2XA 2K4JA 2ZC2A 1Z7UA 2BXYA 3CMEI 2M2EA 1I1GA 2XPWA 3A4CA 2EK5A 3BZCA 4G94A 4N4OB 4S0HB 3SYTA 4NC7A 5HNFA 3MKWB 4OWRB 2DYRH 4U0VA 2VQLA 5M5XJ 2XF7A 1MBJA 1R49A 1S3JA 3QAHA 4B09A 2TCTA 4ZYAA 4EJOA 4JX4A 2L9RA 4ENNA 4RAYA 2VQCA 1SFEA 2CWEA 3MZHA 1U78A 5CYVA 3H5NA 4ESBA 3FK7A 1WJFA 3K4KA 2H8RA 5GTHC 3OYJA 1OISA 1FIPA 3IKVA 2A07F 2M8EA 2H09A 1BI3A 3KCCA 1IZ1A 4GO1A 1W0TA 5DCFA 3K4MA 4A3GJ 3HDDA 3CJTB 3MN2A 2VL8A 4PJNA 1IDYA 1YRNA 2Q1ZB 3Q0VA 3BC8A 2K9LA 5HODA 1H9GA 1Z3YA 3LSGA 2ACJA 2NRAC 3HHGA 4S04A 3QODA 2V79A 2V6EA 2VT3A 2M0CA 2VLAA 4P1WA 3MD2A 2DMQA 1X2NA 1O7LA 1CGPA 3C18A 3ZR8X 1TL8A 2Z2SB 1R23A 5ICEA 4QPOA 2XDVA 4BEHA 2P6SA 1VQ6I 1P4WA 1SEUA 3EYIA 2X1DA 5FKMA 1RI7A 3WTYC 3E5QA 3HRSA 2LD5A 1GVDA 1DUXC 2LYCA 2I5UA 2ZMEC 1VQMI 1UCRA 3KP7A 5HLIA 4EQQA 3IWZA 1V5FA 3D5SC 3K7AJ 4OIOF 5D6EA 1A5JA 4EMSA 2ISYA 4ETSA 2XROA 1X4OA 4BBSJ 1ETWA 2NAZA 2ICWG 1FEXA 1TP4A 2HPMA 4AIDA 1DPRA 2GA1A 5HDKA 1R9TJ 2ZBKA 3ZGKA 3LFUA 4ZYHA 4E7IA 2VN2A 4AYBA 2GXAA 5M5YJ 3DFGA 1DP7P 3NRVA 3HRUA 2LREA 3VFZA 4KIGA 1MBHA 1LDKB 1VQLI 3ZMZA 2KP6A 3KP6A 1MSEC 2CUZA 4BAYA 1OCZH 4B44A 2VXZA 1G2HA 1BN5A 2FJ1A 1RNLA 5IYBJ 1XGNA 4FETA 1BR1A 1G4DA 2CV1A 2Z9OA 1A6QA 1S29A 1ZG3A 1AWCA 2R0QC 3RIRA 1JKOC 1VI0A 3OWTA 3LQRA 2GQQA 2WY8Q 4BE2A 4CZZA 3ABMH 3BOQA 4HF2A 2K02A 2E7XA 3V8KA 3M7GA 1VQNI 3K70C 2YU9J 4ZTJA 2RDPA 4HG2A 1B1BA 2IPQX 1W0UA 1RKTA 2ZSIB 4M3DA 1NK3P 1ZKGA 1S7OA 2XB0X 3I71A 3EUHC 3E5UA 5E3MA 1LDJA 1LDDA 4LK0F 2RAEA 2LBFB 4HF1A 2HDDA 1OLTA 4BXFA 2TDXA 3CESA 4A3BJ 4YIIA 4JX5A 2R7ZJ 3GLXA 4IX7A 4PSWA 3HOVJ 3MCZA 2BBYA 4XLCA 1O3SA 3KP5A 2CQNA 2ZXJA 3LA2A 3JR9A 2VQHA 2D5VA 3I58A 4FX0A 1F9NA 2EV5A 2GOMA 2HXIA 3M07A 2W24A 1G8XA 2A6TA 2NXNB 2XKOA 1JT6A 2WAQN 1G3WA 2Z16A 2IS4A 4AM3A 2R5YA 3KP2A 2P0WA 2CSOA 4RAFA 3R6SA 3HRMA 1IGNA 3ZMDA 5D8LB 1QU3A 4H0EA 2IRFG 4HSRA 4I0AA 1JJ8C 1VF9A 5L3EA 4UUTA 5GAGJ 5J47A 5DUIA 2A5WA 1IG7A 3GTGJ 2X85A 2L3DA 4DIQA 1IV6A 3V7RA 1IXCA 2IBDA 3OYNA 3C2GA 4G6DA 3HJEA 3J7AY 4JK1X 1GHCA 1IN8A 4GYIA 2RQPA 3RCOA 5FLVA 2I10A 4Z2YA 2MLGA 5CPRB 3HOYJ 1IC8A 1YS6A 1Y39A 2HWVA 3HSFA 4A3MJ 1MNEA 3QPSA 3PFIA 4AD9A 2RNJA 4G6QA 1XDUA 2F48A 4B3XA 3VEPA 3J81Z 4ESFA 4AIHA 3OYGA 1XS9A 4HX4A 2DFEA 3OYAA 3GTMJ 2OZ6A 3MMYB 3OSFA 4FE4A 2B7EA 3L2QA 2JSCA 1PVEA 1YLFA 3F22A 5DDGA 2ESNA 4P9FA 3OS0A 2ZJQF 4PJMA 4CCLA 4HLYA 2BY0A 4QLCU 3BJAA 2JA8J 3GTPJ 1WI3A 2JA7J 3NWSA 3GW2A 1QGPA 3B02A 3RPQA 2HVQA 2K85A 2VJ5A 1YOVB 5FRNA 4RDUA 5HLHA 2QF7A 3P9KA 4L5EA 5F0CA 4JBAA 4L5JA 4X6AJ 5JVTA 2Y0SA 1YX3A 4DYQA 2LKXA 3BQYA 5DS9A 2NNNA 3QYBA 3GO5A 3I3LA 1FOWA 3FM3A 4XLEA 2R93J 3EDPA 3EUKL 3Q0UA 1UELB 1I6HJ 2DK5A 5GPAA 4A3JJ 1IN5A 1P6RA 4P5OA 5K1YA 1L0OC 1ZHFA 1E3OC 1FJLA 4C2TA 4NBQA 2BEOA 3S2HJ 2YPRA 4U7DA 2QZ8A 2COMA 3V7SA 4BJ6C 4MNUA 1I5ZA 5E1XA 2BHYA 2EQRA 3LOCA 3NAUA 2QQBA 4IQ4A 4A6DA 1RKWA 2K40A 4O5VA 4PDKA 1LPQA 2CJJA 1U5TB 1G3YA 2XF6A 4QTRA 3M3YJ 3OYCA 5HNHA 2R7RA 5DM7F 2EINH 1SANA 3SFZA 2M4KA 3K0LA 3BR5A 5IPAA 1LFBA 3Q5FA 1JE8A 1J7KA 4D1QA 1X4PA 4WF2A 3MWMA 4HBLA 1UZCA 3BP8A 3JTGA 1KQ9A 1R58A 1X1CA 3E6BA 1EV7A 4GDFA 1E17A 4PGGA 1ZR4A 2YU3A 1RZ4A 2Y30A 3KLNA 1UG0A 3ELKA 2VI6A 1TTYA 1YYVA 3OIOA 5DD8A 4BQQA 4GRIA 4BACA 1R1TA 1QRYA 3J81K 2OJED 2P4WA 2ZCWA 2GXGA 4RLQA 3LAPA 2IGMA 3Q9SA 4PCQA 1TT0A 4KITB 3OMYA 2OF7A 5BOXA 2X1EA 4PSXA 3FK6A 3W6VA 2KISA 2EPFA 1OCCH 3BG7A 3C1DA 1MH4A 1G6NA 3D5LA 1BBYA 5GP9A 3F8CA 5J8FA 2XSDC 2HEOA 4WK8F 2HOEA 4C9YA 5D5XB 3S1MJ 2V1NA 4XRSG 2MG4A 3DU6A 3HOZJ 4LIUA 3IAM2 1PP8F 3IL2A 3CC7I 1R1UA 1MMAA 1KYZA 2HTJA 1YI2I 3CJRB 2FMYA 5K5RA 4B48A 4IHVA 1ETKA 3CF2A 4WXDA 2FNPA 2K7LA 2KJCA 2MFZA 3DKXA 2WY7Q 2NVXJ 3CP2A 1S72I 3QPHA 2GIZA 1AA7A 1HSTA 2LBFA 3RPUD 2FE3A 3H92A 3IH4A 1NK2P 4BUPA 4PGHA 2IA0A 4XOPA 2HOTA 3I56I 3DQVC 2JT1A 5CVIA 4N9HA 4LG3A 3PQJA 2HZTA 5F27A 2VODA 1E0EA 2HS5A 3HOUJ 2NS0A 2XPVA 3KEYA 4A0YA 2LF8A 1IRZA 2ZFWA 3GBGA 4D7MA 9ANTA 3SHFA 2E1CA 2K86A 4HNTA 2ZKZA 4ZYDA 2FA5A 2QKMB 4AYBN 4A69C 1IXRC 1HKTA 5BPIA 1JUMA 1ON1A 3CMAI 1U9NA 3AG3H 2LY1A 2QKLB 1H0MA 1TT5B 2ZMEB 5BQTA 4IOAF 4KJZA 1EKEA 4U7BA 1DGWY 2M7AA 2V1XA 1YW9A 1R71A 4JOMA 2DFHA 5E20A 3TO9A 3ERED 1FBSA 3L7WA 4W97A 1ZRDA 4Q5SF 2EB7A 4LK1F 3CO7C 4HPQA 1ODDA 1MJ9A 1IN4A 2XAQA 3WU0A 2Y69H 1TLHB 4NB5A 1F4KA 1RETA 2FBKA 2QQAA 4J19A 1ERDA 1ETOA 1WCMJ 4MIMA 3JRGA 1HXDA 2VT2A 5FKNA 5E79C 2VBWA 5LRRA 2EA4A 4G7OF 4TV7A 2BVMA 2DW4A 2KIMA 3K4NA 5M5WJ 4BY1J 2HNHA 1T0FC 1RR8C 2KRFA 3FXRA 2L7FP 4RMNA 1YRNB 1WJ5A 2DT5A 4YFNF 2VONA 5F04A 4PFPA 2CQQA 2CFXA 2O03A 3W6KB 1I1SA 1BI2A 3GMEA 4K2EA 1VZ0A 3AAFA 1G3SA 2XGCA 3TOBA 2X48A 3BWGA 3DU5A 3EYYA 3G4SI 2G0EA 2MSYA 3UR3C 1XMAA 2DOAA 2JA6J 3E0JB 5EYRA 4AVPA 2UV1A 3H5RA 4LG0B 1VQ4I 2DO7A 2L2OA 3CCQI 2JVGA 3K1PA 2VC0A 4LITA 2DMUA 2EIMH 1USTA 2JK3A 3ZPLA 3MZ8A 3SXYA 3EETA 1ZREA 4OAYA 1H9TA 2IS1A 1MMGA 5D6FA 5JI6A 3GTQJ 3LFKA 1FNNA 3ASNH 2E7WA 1H8AC 4CYDA 2STTA 1UMQA 4IVNA 1TWCJ 3B6CA 1FMVA 5KVRA 4V19K 3VYRB 4BXXJ 3R4KA 1D1CA 5FFXA 2W48A 5LGUA 4IO9F 2PMZA 3ZN1A 2ZSHB 2F5VA 4IOCF 3K9TA 2PLYA 3C7JA 2IGNA 1Y8QB 4F7ZA 2HOSA 1U5TA 2OBPA 1T6SA 1A04A 3ABLH 2X6OA 2WA0A 3P9CA 2CUJA 3G1OA 1WKMA 2LH9A 2HQ5A 3GYHX 1RC9A 3CUOA 3DWLE 5BS6A 1USSA 1K83J 3LAJA 4E7KA 3FKJA 3CJNA 2EILH 3U1DA 2WAEA 2Z1DA 3BG9A 3H3ZA 3KZIC 1VQ9I 4II2A 4EM2A 2HZDA 4HW0A 4M72A 3CCRI 2ZXHA 1D1AA 2E5NA 2HDWA 1BOBA 4NUBA 4C3JJ 1W36D 1K7AA 4RGRA 2O8KA 2ECBA 2KFDA 4AVZA 3R61A 1G59A 2QSHX 5LFAA 1SD7A 1QVUA 4LIVA 2QLZA 5D4SA 3DLAA 5L3DA 2AS5F 5IP6A 2E1OA 5BMZA 1FYMA 4N9IA 3HOSA 3GVAA 4EGZA 4XN3A 1ZLJA 2IP2A 2V7FA 3AG1H 3ESWB 1D0XA 1IUFA 4X1EA 4EEFG 1IF1A 3OV8A 2FRHA 2K9MA 4JP0A 4F3QA 3CC2I 1FMWA 4V2GA 3ZQCA 2Y0SN 4M3GA 2ELHA 3FXOA 3L2CA 1R4MB 4CYCB 2CUFA 4O3MA 3S16J 3VB2A 5HLGA 4I09A 4KUMA 1ORKA 4Y4RA 5EF6A 2DN0A 5J1YA 1K6YA 1OPCA 3AFHA 1ZLKA 3ZP5A 2LMDA 2ZNZA 5AIQA 2MD0A 4XONA 2AHQA 4AWXB 2F5DA 2R5YB 1B6AA 3VDXA 5HDNA 5CJ9A 4G8XA 2JSPA 3CUQA 3OYFA 4UB6C 2W00A 4MLOA 1V4RA 2IGKA 4G7ZF 2XV4S 4C3HJ 1JHFA 4BJTA 2D1VA 4BY7J 4IHWA 1WWXA 2H94A 3DPTA 2FMLA 2XB5A 3A01B 3JRBA 2D1HA 2IGOA 4A3CJ 3PSIA 2DK8A 3SDBA 1QZEA 4BE0A 1Z67A 1K4TA 3CDLA 1WQ2A 2IA1A 4XSZF 2E2JJ 1KU7A 3W2AA 3HL2A 2QGUA 3E6DA 4PUSA 4DOZA 1ZTRA 2KJBA 4V2FA 5B1AH 2ZB9A 3A03A 1LFPA 3WE2A 5ILVA 1YIJI 5E3OA 4Z6YA 2GOXB 3ZQQA 3FIWA 3A1YA 3LA7A 1OYIA 2DOFA 3W3CA 5DTDA 2X9DA 2ZMEA 3G6EI 2HYGD 1V5EA 1MIJA 1U6GA 2DDBA 5IYCJ 2OC6A 5E18F 2DPDA 1WVRA 5FKKA 4BQAA 2O61A 1JTXA 2LOOA 4XLPF 3K69A 3SDGA 5C3EJ 4JX6A 2VKVA 3I64A 5H2FC 3CUQC 2XAHA 3BG3A 1ETYA 2CH0A 2NS8A 4CCJA 4LGWA 1I39A 3T0YA 2JPBA 3VODA 2H1KA 3SZPA 3A0BC 3PIPF 4LLLA 3S8PA 3CCUI 1IRGA 2B9SA 4BH9A 3TBIA 2RN7A 2L9SA 2KRCA 3F0CA 2PEXA 2RKHA 3BCAA 4CH7A 4N0BA 3QP5A 3GZ5A 5HS9A 2QEXI 1ZK8A 1Z3XA 5E8IA 2IEKA 4LLGF 3L00A 3KX2A 3KYCB 1U2WA 4Y13A 2QQ8A 5K5OA 3BT9A 3C2HA 3DEUA 4I7HA 2K5CA 1BR4A 4M3FA 4LG0A 3FXQA 3ZXSA 3L9FA 4HOBA 1W7PB 3P9IA 2P7VB 5FLXZ 2EFOA 1QQIA 4L9JA 2BY3A 2CRGA 2FOKA 5EEGA 3S14J 1D0ZA 4A93J 2L7KA 1J9IA 3FBIB 1B9NA 3EUHA 5KAFC 3I4PA 2A61A 2CS3A 1RRJA 5EGOA 2ADUA 2K9NA 2EV6A 4BDYA 2R7VA 3HGYA 4PJ0C 2DMNA 3MKLA 4UVBA 2DA1A 4M74A 5FRMA 4R1HA 3JSPA 3X2QH 3BR2A 4Q47A 2Z5UA 3LSMA 3V7CA 2XGXA 4HDUA 5DUKA 1LQ1A 1HDPA 2O0YA 3L1PA 1D5YA 4RBOA 3H0DA 3I54A 3CC4I 2XASA 4IL6C 4KN4X 3S3MA 2IVMA 1R22A 1X1BA 2DI3A 2OZUA 4M6YA 3V8JA 1BI0A 2DDAA 4M6XA 4CCNA 2P5KA 1TWGJ 1J0RA 5LD2C 3H9QA 4XK4A 4XOTA 2XVCA 3QU3A 2IT0A 5GAHJ 2M87A 4OMYA 1UJ8A 5E8GA 3UKGA 1IUYA 1FOKA 4O6JA 4M9XA 2CQXA 3F72A 5FGMA 2EZLA 1OFCX 2OV7A 2VJ4A 2XSJC 3VYTB 4IZZA 3ABUA 1B9MA 3SZTA 1WJEA 3WG7H 1K4SA 5K7FA 1TBXA 1SVMA 3DEEA 3TMOA 5KCMA 5GADJ 4MQ9F 1OQYA 3PNVA 5DM6F 2QCOA 1FSEA 4WXHA 3GTJJ 2BV6A 1F1ZA 2EV0A 3LA3A 1QHGA 4D7NA 2WAFA 2KL4A 2VOOA 2F4IA 2IA2A 4ZTFA 1HW2A 1I3AA 2DA5A 3DF8A 4IKFA 4FASD 5IYDJ 1JKRC 1JKPC 4EJWA 1O3TA 4NQWA 2L54A 1Z6TA 2KRHA 1C0WA 2P5VA 3R0AA 1NG7A 3H9GA 4CYCA 1AHDP 1Z91A 3ECHA 2OU2A 3CDIA 4HX7A 5FLXK 2MW8A 1R36A 2VXDA 4UXNA 2K4BA 3ULQB 3GUDA 1XC5A 3T8RA 2VKDA 4FCYA 1IV8A 4CCMA 2ZJPF 1QA6A 3OYHA 1O7FA 4HYEA 5KAIC 3T5XA 1Z7LA 2UWMA 3R0JA 3PO3J 5EZHA 2LKSA 4M9ZA 3W6JB 4CDGA 1T2KA 4OIRF 3PUBA 3WG9A 4GCVA 3BG6A 2BY1A 3HM5A 5B66C 1H89C 1XX5A 1STZA 3U1KA 1YW7A 2XRLA 2DFIA 1R00A 3WTTC 1CQTA 4DYRA 2QVOA 2A3SA 2PMZN 3W2WA 3HRTA 3A02A 1LUJB 2XAGA 1A35A 3A01A 3K4LA 2VOPA 3BJ6A 3TP0A 5F08A 1XG1A 3LSRA 3TGNA 3JRDA 1ACIA 1TNSA 5GPCA 3ASOH 4LLNA 4FHTA 4XKVA 4QSHA 5CLSA 2DT6A 5E17F 3FF5A 1X58A 4I2OA 2KMUA 1XCBA 2W7NA 5LLQA 3PNTA 1FC3A 3EPZA 1Y1VJ 3I5UA 2Q8KA 3E3VA 4A5NA 4B8XA 4MGRA 1JGSA 1Y0UA 2W1OA 1JKQC 4I98B 3Q3SA 1I50J 2BYVE 3QYEA 1YIOA 2L01A 1BI1A 1BOAA 1HQCA 3L2WA 5DEQA 4BU2A 1S7EA 1MBGA 3Q0WA 2FU4A 2X6XA 4ZYEA 4Y7NJ 1AOYA 1BIBA 2O6GE 1V3FA 2JJ7A 4XMYA 4D5CA 2F4MB 3KIOA 4II3A 4YEJA 1BW5A 1XMKA 3KLOA 3HB9A 3R60A 4BE1A 1XSDA 2P7CB 2GZWA 5K7HA 1HC8A 5ED4A 2FSWA 3T1BA 1Y6IA 4E7LA 3BZKA 4UV9A 1D8KA 2Y31A 3CQZJ 4ENMA 2JA5J 1ON2A 1WFXA 3BTIA 4KIFA 3DBLB 3RKYA 3J7YJ 1NTCA 1NHAA 2EIJH 2O9LA 1ENHA 1KZHA 3ZQ7A 2EIKH 3CZ6A 3LWFA 5CVUA 2Q2EB 3H5AA 3L09A 1MBEA 2M9HA 1QBJA 1NH3A 2FD5A 2VJJA 1IJWC 3OS1A 5DYMA 4ESJA 3WODF 3OYMA 4RAZA 2EFPA 4F92B 2BVLA 2QQ9A 1WZ2A 3K1NA 3KYDB 6PAXA 5J4YA 1SFKA 3RSNA 3U2RA 4R8HA 1TW3A 1X1DA 4EJUA 3CO6C 1ETVA 2V9VA 3KEOA 2R7UA 5IY5H 2FEZA 1TC3C 1U9OA 5L3GA 3F8MA 3REOA 1W7PA 1W36C 3OYDA 1B59A 3PIOF 3K2ZA 2K9SA 2R3SA 2JN6A 4EM1A 2J5OA 2P6TA 1VFCA 2PN6A 4A3KJ 2GA2A 2R7OA 2HQNA 3IWFA 3I4MJ 4DZPA 3WU2C 5BPDA 3CP8A 3RI4A 3P5JA 4RLFA 4HRIA 4IPAA 1WH7A 1HCRA 2CU7A 1R5HA 4DNCA 4YIRX 5AONA 1R5ID 3CLOA 4I99C 5LRSA 4YRVA 1I6XA 5HVQC 5K7ZA 1G3TA 3LSIA 3TKYA 2MC3A 5ICCA 2DQLA 4I02A 3M1EA 2Y2ZA 4AIJA 3M1CA 3SEQA 1ULYA 1OR7A 4XN0A 3HUGB 1J59A 2AQFA 1Z6RA 2VBYA 3HTSB 1FOYA 1T08B 1YS7A 1SMTA 1HW5A 4AC0A 4IRHA 2X6WA 1E3PA 4KFCA 3WU1B 3OIPA 4HV5A 5CVVA 3HKZA 2DTRA 2VPRA 1K78A 1XGMA 1BL0A 3GTOJ 4IRIA 4HDVA 4OAZA 1RUOA 2CQKA 3IHUA 4KIBA 1Z05A 2M34A 1TZLA 1JJ6C 2HFHA 2DFFA 3P7NA 2M30A 3ROUA 3VSLA 5FLMJ 3VWBA 1D1BA 2Y9ZA 2VPLA 2BOLA 3CUQB 3OY9A 1XGSA 4CO8A 4EM0B 3MAJA 3GLLA 3FXLA 4RAGA 3ERMA 2OA4A 4ZH4F 3SZGA 5C4XJ 3H36A 2HXOA 1YJNI 1D0YA 3FXJA 4UVCA 4KNYA 3QOEA 3H9JA 3QPLA 5E3NA 2H27A 1P2FA 4MEYF 1FY7A 2JRTA 1T0FA 3LSKA 2O8XA 2HDCA 1QZYA 1HKQA 4S05A 3HHHA 2VC1A 4RB1A 1YFHA 3WTUC 3I0TA 4HQEA 1OR7C 2UZKA 4EGYA 3Q9VA 4RGSA 1GLNA 4BDZA 1FWZA 2C6YA 1P7JA 2XC7A 4M3BA 2VUMJ 3BJOA 2W57A 1KQ8A 2A6HF 3J7AO 1JI8A 2G9WA 5DCMA 2LG4A 4ENKA 4EV0A 1ZRFA 2FBHA 1HSJA 3K70D 2DXIA 3KZZA 2LFBA 3ZMTA 1ZYRF 2DODA 1ZR2A 1MJBA 1YQAA 3M9AA 5E3LA 3G3ZA 2MD5A 4EJVA 4LMYA 3OOUA 1XMXA 1VQKI 5JR3A 5BNGA 2BZTA 5F0FA 1N78A 3D5RC 4EJTA 1K79A 1QPIA 3I59B 3BROA 2NS7A 3HPGA 2Y9YA 1P7IA 5L3BA 5LEJA 4WXCA 4NC6A 1Y8RB 3PM1A 3TEDA 2ID3A 1VNDA 1SFXA 3VYSB 3AG2H 3ZQIA 1YW8A 4UUSA 1REPC 2V26A 3RKWA 4BKXA 1ZN2A 4FQGA 3COAC 1R1VA 3S1RJ 4Y52J 4IXAA 1AKHA 2F4OB 2LP0A 1BC7C 4KT5C 4XNFA 5D8KB 1FLIA 3ZN0A 2B63J 5C4JJ 1ZG5A 1VQPI 2IJLA 4IEJA 4BS9A 1OJLA 3F6VA 2XGEA 2JZYA 3IH2A 2BE5F 2HYJA 3FHNA 5F1RA 1GV2A 2MABA 2EA2A 1ZRCA 2V9PA 3F9KA 4ZDPA 1ONVA 2GAUA 2R7QA 4ABZA 5J40A 3G71I 4IHSA 1ZGJA 3G2BA 1WJBA 1T8IA 1MNDA 4U88A 2JA2A 5F64A 2DA2A 4BJ5C 3BPVA 2LK2A 2MGQA 2ME0A 2VJIA 3O6BB 3OSGA 2BGCA 2L4MA 4P9UA 3F6OA 2UUZA 5LHHA 2Q2EA 1UHSA 1YJWI 3MQ0A 1ZH5A 3RZOJ 1R4NB 1APLC 2R7XA 5DV5A 1HKSA 2VQGA 3OL4A 5EGOB 1JGGA 4MTEA 5HDGA 4XKCA 2ISZA 1LJ9A 3S1NJ 3ZQFA 1LEAA 2EZIA 3DTIA 5M3MJ 4XLHA 5D5VB 3U9GA 1BJZA 3NQOA 4WWCA 1ETXA 1JT0A 3ZQLA 2GXBA 5TISC 3PQKA 2IXSA 2RQQA 3MKZA 3N97A 3VSKA 1PUFA 1SVLA 2HKOA 2PX9A 3OR2C 3LNQA 1IRXA 3TO6A 4RGUA 2NOGA 2W85A 3CF5F 2XUBA 3L2UA 3TW6A 3S1QJ 1XDSA 1IRFA 5LEKA 1BW6A 1R5GA 1UFMA 4CA0A 3L2RA 3F8FA 5IOZA 3HBLA 3KE2A 2L0KA 2WWYA 3HYIA 5HS8A 2DMPA 1SMYF 4U0YA 3HGGA 4QPQA 3ZMUA 1XTAA 1DQUA 3FX3A 2RC4A 5D4RA 4XLAA 3WE3A 1A31A 4HQMA 1JTYA 1WJCA 4CCKA 3QQAA 5J4VA 4A3DJ 2ZNYA 4C2UA 3D0SA 4N4NB 1HLVA 3H0GJ 5JLXA 2R5ZB 1D8JA 1OCTC 4KICA 2D2WA 1T98A 4DZJA 1O3QA 1R6RA 2OPTA 4D5FA 3F23A 2HOAA 1XB4A 1XSVA 4ASNA 2EBIA 2NVYJ 3TO7A 1OYWA 4KT6A 3DKWA 1BJAA 2EZKA 3HUGA 3QWLA 2D45A 3CCYA 2YSRA 3GEZA 1IW7F 3PL8A 4XSXF 4BQOA 2JUCA 4NQWB 1JUSA 2OCCH 2P81A 2F2EA 1LKXA 2PQ8A 2OAZA 2DA6A 2K3PA 3RYRA 4J01A 3BCBA 2ZXWH 2Z3YA 4RGXA 3UNGC 2H1LA 2UXXA 2WBMA 3CCMI 4M73A 2O5RA 3LMMA 5F6FA 1PP7U 2WB1A 3H1CA 3ML6A 3OR1C 4XR6A 4ANJA 2CW0F 2R92J 2LKPA 3PFYA 3S17J 4ENJA 2L9VA 4D0PA 5AIPA 3FWEA 2FXAA 2QBYB 2CW8A 4HF0A 4RM2A 4CGZA 2E60A 1FYKA 1E3HA 3CLQA 3LQQA 3N05A 3SEZA 2STWA 4ITVA 5ILSA 3J7ZI 3LL7A 1FTZA 4GFBA 2KHMA 2KT0A 3BLYA 3DLLF 1RUNA 4OOIA 1T56A 5J3LA 5IP7J 2E35A 2CGPA 1X2MA 2V1UA
chains in the Genus database with same CATH topology
2ZJ2A 5CVJA 2G7HA 2QM3A 4GGGA 2O3FA 2OD5A 4LB6B 2ESHA 1ZGAA 1K6OA 5FO5A 5FFZA 3GFMA 2MA3A 5IT9Z 2PJPA 3HSEA 1BM9A 1PDNC 3ABTA 3WGIA 3TOAA 3I59A 3EQLF 2W25A 3SQNA 4G9YA 1P4AA 2YX7A 1FBUA 1IXSB 2E1NA 2QENA 4BNCA 3DPLC 3F3XA 5LHGA 1OYYA 5ILUA 4IF4A 2DAOA 2ZO4A 4LB5A 1R7JA 2H6BA 3WTVC 3F8BA 1RIOH 1GXQA 5A2QZ 2Y75A 1LEBA 3H3UA 2H6CA 3B73A 2Y48A 3RPUA 4BYYA 2MH2A 1LVAA 2DQRA 4U0WA 1XN7A 1BC8C 3JW4A 1TNTA 4Q48A 2RVCA 4MQVA 1O3RA 3F21A 2HR3A 4YFKF 3G73A 2EFNA 4L5IA 1UHMA 5H20A 1ZAOA 2PG4A 2XRNA 5D5UB 4EVIA 1I27A 3CTAA 5IT9K 3RYPA 1KU9A 2FF4A 3WGHA 5J6XA 4Y15A 4FX4A 2PBIA 2KIUA 1MJAA 3GWZA 2HGCA 5LBQA 3TQNA 1FYLA 3HIFA 2VBXA 1CF7B 1YO5C 2QUFA 2W84A 1K78B 3BZ6A 2GWRA 1U8RA 4M71A 1LB2A 3FMRA 2ETHA 3DP7A 2HTSA 2YR2A 1ZG1A 5A2QK 3IRQA 1OKRA 4DQ2A 3MZYA 2WTEA 5ICFA 4AIKA 2Q0OA 4Q4ZF 1TQMA 1T38A 4BHBA 2UXNA 4MHGA 3E6CC 2JPCA 1FBQA 3RDIA 1KGSA 2G7UA 4OU0A 1B4AA 3IC7A 2F5EA 2XHKA 5DCMB 2QBYA 2PFBA 4RS8A 4Y17A 4ZZLA 3GXOA 5E1ZB 4RB2C 1UB9A 4WX9A 4A2UA 4XLNF 3OOPA 3KETA 2CO5A 5LHIA 2Z99A 4R79A 3CDHA 3O2PE 4YIFA 3E6MA 2DPUA 4KYWA 4HA8A 4OINF 4IHTA 2LF7A 3RKXA 3QU6A 3LSTA 1HW1A 1KA8A 3GFJA 3BY6A 2QWWA 1MKMA 4UVAA 2CG4A 1L3LA 4PZJA 3WTSC 3KZYA 1F5TA 2CYYA 2NNYA 1W4MA 1MZBA 3VOEA 1Z9CA 1DDNA 3QRFF 1FSHA 5FD5A 2IW5A 1UHWA 4P96A 2Z33A 3F8NA 3DV8A 2FBIA 2NYXA 1J75A 1PUEE 3WTXC 2A68F 2EFWA 1QPMA 2AXLA 3GX4X 4BXUA 2LDUA 3KP3A 2F5FA 2R7FA 2Y0MA 2A69F 4XRFA 4E70A 4KN7X 3O3KA 4WCGA 2DU9A 4FT8A 1LNWA 1SD6A 5H6RA 2VE9A 1KU2A 1IAWA 1MD0A 5E1WA 1WSUA 4L9TA 3KEQA 5FD6A 3TDUC 1KQ0A 3BPXA 2HQRA 1S7AA 2EJRA 2VE8A 5K5QA 5FB2A 4IJAA 2LSOA 3FZVA 3GFLA 3JSOA 2PMUA 3N4MA 3V8LA 1Z1DA 1T39A 3ECOA 4QWQA 4YG2F 1JXSA 1P4XA 1EH6A 3C3WA 5D5WB 3GF2A 1CF7A 4L0YB 2KIFA 5HOOA 4UUVA 4JQFA 4MEXF 3IRRA 2K27A 1XCVA 3JAMZ 4HAMA 1KU3A 5IT3A 4YFXF 2DLLA 1VTNC 1QNTA 3T8TA 5TRDA 2KKOA 3HOTA 1MDMB 3HTUA 2F5CA 2PI0A 5DD4A 2WV0A 1TQIA 4MTDA 4LJZF 5EEHA 1QO0D 3S2WA 4HZFA 3M8FA 5HS7A 2P8TA 2MLKA 5J8CA 1JHHA 3ZMVA 1MGTA 4RB0A 3IKTA 2M1BA 1FX7A 1ZARA 2YX4A 1U3EM 1X3UA 2PMHA 4M9SA 2X0LA 2OQGA 3NEUA 2V6CA 4GYGA 5KK1A 3J80Z 2DBBA 3HSRA 1SD4A 2X4HA 2EFQA 4IRGA 1IN7A 2HYFA 4BHCA 3KFWX 2XAFA 5ERIA 4OIQF 4OIPF 1O57A 3JAMK 4KMUX 4CXFA 1Q1HA 3RTRA 1WRJA 1SAXA 1J5YA 2FQ3A 3V4GA 4UV8A 1FPQA 2RGVA 1FZPB 1XGOA 3MFKA 2R7DA 2A6EF 2RV8A 4P55A 2WC2A 2GIVA 3FM5A 4GXOA 1SD5A 2JTVA 1S6LA 2OQRA 2M45A 3I53A 3M8EA 3GFIA 3E5XA 4KA4A 1OMIA 3TDZC 4A6EA 3J80K 1FP1D 2B0LA 3WTZA 5TJJA 4HV6A 3KP4A 2M5WA 2L4AA 4UHTA 1GXPA 1BIAA 1TW2A 4LD5A 1SFUA 5L3FA 1W5TA 5L3CA 1FP2A 4L9VA 4L0ZB 3FMSA 5LGNA 4RB3C 2XAJA 1HBXG 1E2XA 4UNOA 3GZ6A 4NHJA 2MBFA 1S8NA 1GVJA 4A0ZA 4BHPA 2XIGA 2VBZA 3QP6A 4KDPA 3DXJF 5JFRA 3ZMSA 2LNBA 4KMFA 3RJPA 4ZZDA 4A5MA 4ZYGA 3ISPA 1P92A 4HX8A 3BDDA 1YTYA 4G7HF 3QPTA 2J5PA 5ICGA 2EWNA 1XSXA 4HLXA 1U5TC 4OMZA 4CHUA 1EH7A 4A12A 2MH9A 2FNAA 1MDMA 1XD7A 3WTWC 3K1MA 2QYOA 3MEXA 3JTHA 3E97A 1TQPA 1YG2A 5JHUA 1D3YA 3FMQA 4ON0A 4LFUA 1D5VA 2XKPA 1IN6A 1EH8A 1W7PD 4L18B 5CVRA 5LGTA 1QZZA 3WGGA 4A0XA 3FHZA 2HKXA 4XBFA 2A5YB 1W5SA 2L02A 2P5LC 4I0BA 4L9NA 1KYWA 5H6QA 4CICA 1WI9A 1FT9A 3FXUA 2V1DA 3QOPA 1DPUA 4I01A 1J2XA 2K4JA 1Z7UA 1I1GA 2EK5A 4G94A 4U0VA 1S3JA 3QAHA 4B09A 4EJOA 4ENNA 4RAYA 3MZHA 1SFEA 2CWEA 1U78A 5CYVA 4ESBA 3IKVA 2A07F 2H09A 2M8EA 1BI3A 3KCCA 1IZ1A 4GO1A 5DCFA 1H9GA 2ACJA 2NRAC 3HHGA 4S04A 2V79A 2VT3A 1CGPA 1O7LA 3C18A 1R23A 5ICEA 2P6SA 1P4WA 3EYIA 1RI7A 3WTYC 3E5QA 3HRSA 1DUXC 1UCRA 3KP7A 5HLIA 4EQQA 3IWZA 4OIOF 5D6EA 4EMSA 2ISYA 4ETSA 2XROA 2NAZA 1DPRA 2GA1A 5HDKA 2ZBKA 4ZYHA 2VN2A 3DFGA 1DP7P 3NRVA 3HRUA 3VFZA 4KIGA 1LDKB 3ZMZA 3KP6A 4BAYA 2VXZA 1BN5A 1RNLA 1XGNA 1G4DA 2Z9OA 1S29A 1ZG3A 1AWCA 3RIRA 3LQRA 2GQQA 4CZZA 3BOQA 4HF2A 2K02A 2E7XA 3V8KA 3M7GA 2RDPA 1B1BA 2IPQX 1S7OA 3I71A 3E5UA 1LDJA 1LDDA 4LK0F 4HF1A 2TDXA 4YIIA 3GLXA 3MCZA 2BBYA 1O3SA 3KP5A 2ZXJA 3LA2A 3I58A 4FX0A 1F9NA 2EV5A 2W24A 2XKOA 1G3WA 3KP2A 2CSOA 3R6SA 3HRMA 3ZMDA 5D8LB 4H0EA 2IRFG 4I0AA 5L3EA 5DUIA 2L3DA 3V7RA 1IXCA 4G6DA 4JK1X 1GHCA 1IN8A 4GYIA 2RQPA 4Z2YA 2MLGA 1YS6A 2HWVA 3HSFA 3PFIA 4AD9A 2RNJA 4G6QA 1XDUA 3VEPA 3J81Z 4ESFA 4AIHA 4HX4A 2OZ6A 2JSCA 1YLFA 3F22A 5DDGA 2ESNA 4P9FA 4HLYA 4QLCU 3BJAA 3GW2A 1QGPA 3B02A 3RPQA 5HLHA 3P9KA 4JBAA 4L5JA 5JVTA 2NNNA 3GO5A 3FM3A 3EDPA 2DK5A 1IN5A 1P6RA 4P5OA 5K1YA 1L0OC 1ZHFA 2BEOA 2YPRA 4U7DA 2QZ8A 2COMA 3V7SA 4MNUA 1I5ZA 5E1XA 2QQBA 4A6DA 4O5VA 4PDKA 1U5TB 1G3YA 3SFZA 3Q5FA 3K0LA 1JE8A 1J7KA 4WF2A 3MWMA 4HBLA 3BP8A 3JTGA 1KQ9A 1R58A 3E6BA 1EV7A 1E17A 4PGGA 2YU3A 1RZ4A 3KLNA 3ELKA 1TTYA 1YYVA 5DD8A 1R1TA 3J81K 2P4WA 2ZCWA 2GXGA 3LAPA 3Q9SA 4PCQA 5BOXA 3C1DA 3D5LA 1G6NA 1BBYA 5J8FA 3F8CA 2HEOA 4WK8F 2HOEA 5D5XB 1PP8F 3IL2A 1R1UA 2HTJA 1KYZA 2FMYA 5K5RA 4WXDA 2FNPA 2K7LA 2KJCA 3QPHA 1HSTA 2FE3A 3H92A 4PGHA 2IA0A 3DQVC 2JT1A 5CVIA 4N9HA 3PQJA 2HZTA 2VODA 2HS5A 2NS0A 4A0YA 2LF8A 2ZFWA 3SHFA 2E1CA 2K86A 2ZKZA 4ZYDA 2FA5A 1IXRC 1HKTA 5BPIA 1ON1A 1H0MA 2ZMEB 5BQTA 4U7BA 2V1XA 1YW9A 5E20A 3TO9A 3ERED 1FBSA 3L7WA 1ZRDA 4Q5SF 2EB7A 4LK1F 3CO7C 1ODDA 1MJ9A 1IN4A 2XAQA 3WU0A 1TLHB 4NB5A 1F4KA 2FBKA 2QQAA 1HXDA 2VT2A 2VBWA 5LRRA 2EA4A 4G7OF 4TV7A 2DW4A 2KIMA 2KRFA 3FXRA 2VONA 2DT5A 4YFNF 2CFXA 2O03A 3W6KB 1I1SA 1BI2A 4K2EA 3AAFA 1G3SA 3TOBA 3BWGA 3EYYA 1XMAA 4AVPA 4LG0B 2DO7A 3K1PA 2VC0A 1USTA 3ZPLA 3SXYA 3EETA 1ZREA 1H9TA 5D6FA 5JI6A 3LFKA 1FNNA 2E7WA 4CYDA 2STTA 4IVNA 5KVRA 3R4KA 5FFXA 5LGUA 3ZN1A 3K9TA 2PLYA 3C7JA 4F7ZA 1U5TA 2OBPA 1T6SA 1A04A 3P9CA 1WKMA 3GYHX 3CUOA 5BS6A 1USSA 3LAJA 3CJNA 3U1DA 3H3ZA 4EM2A 4HW0A 4M72A 1K7AA 4RGRA 3R61A 1SD7A 2QLZA 5D4SA 5L3DA 2AS5F 5BMZA 1FYMA 4N9IA 3HOSA 3GVAA 4EGZA 1ZLJA 2IP2A 1IF1A 3OV8A 2FRHA 2ELHA 3L2CA 4O3MA 3VB2A 5HLGA 4I09A 4KUMA 1OPCA 1ZLKA 3ZP5A 2ZNZA 5AIQA 4AWXB 2F5DA 1B6AA 5HDNA 5CJ9A 4G8XA 3CUQA 1V4RA 4G7ZF 2XV4S 1JHFA 2D1VA 1WWXA 2H94A 3DPTA 2FMLA 2D1HA 2DK8A 1WQ2A 2IA1A 4XSZF 1KU7A 3E6DA 2KJBA 3WE2A 5ILVA 3LA7A 1OYIA 2ZMEA 2HYGD 1U6GA 5E18F 2DPDA 4BQAA 2O61A 4XLPF 3K69A 3I64A 3CUQC 2XAHA 4LGWA 3T0YA 2JPBA 3VODA 3SZPA 4LLLA 1IRGA 4BH9A 2RN7A 2PEXA 2RKHA 4N0BA 3QP5A 3GZ5A 5HS9A 5E8IA 4LLGF 3L00A 1U2WA 4Y13A 5K5OA 3DEUA 4I7HA 4LG0A 3FXQA 3L9FA 4HOBA 1W7PB 3P9IA 2P7VB 5FLXZ 2EFOA 1QQIA 4L9JA 2FOKA 5EEGA 1J9IA 1B9NA 3EUHA 3I4PA 2A61A 2ADUA 2EV6A 4UVBA 4M74A 4R1HA 3JSPA 4Q47A 2Z5UA 3V7CA 2XGXA 4HDUA 5DUKA 1LQ1A 2O0YA 3I54A 2XASA 4KN4X 2IVMA 1R22A 2OZUA 2DI3A 4M6YA 3V8JA 1BI0A 4M6XA 2P5KA 1J0RA 2XVCA 3QU3A 2IT0A 2M87A 4OMYA 5E8GA 1IUYA 1FOKA 4O6JA 4M9XA 3F72A 5FGMA 3ABUA 1B9MA 3SZTA 1TBXA 4MQ9F 1FSEA 4WXHA 2BV6A 1F1ZA 2EV0A 3LA3A 2VOOA 2IA2A 1HW2A 3DF8A 4EJWA 1O3TA 4NQWA 2L54A 1Z6TA 1C0WA 2P5VA 3R0AA 1Z91A 3ECHA 2OU2A 4HX7A 5FLXK 1R36A 4UXNA 2K4BA 3ULQB 3GUDA 3T8RA 1O7FA 4HYEA 3T5XA 2UWMA 3R0JA 4CDGA 4M9ZA 3W6JB 1T2KA 4OIRF 3WG9A 4GCVA 1STZA 1YW7A 2DFIA 1R00A 3WTTC 2QVOA 2A3SA 3HRTA 2XAGA 2VOPA 3BJ6A 3TGNA 1TNSA 4LLNA 4FHTA 5CLSA 5E17F 3FF5A 4I2OA 1XCBA 5LLQA 1FC3A 2Q8KA 3I5UA 4A5NA 3E3VA 4B8XA 4MGRA 1JGSA 1Y0UA 4I98B 2BYVE 1YIOA 2L01A 1BI1A 1BOAA 1HQCA 5DEQA 2FU4A 4ZYEA 1AOYA 1BIBA 2O6GE 1V3FA 1XMKA 3KLOA 3R60A 1XSDA 2P7CB 2GZWA 5ED4A 2FSWA 3T1BA 4UV9A 1D8KA 4ENMA 1ON2A 4KIFA 3RKYA 1NHAA 3ZQ7A 3LWFA 5CVUA 3L09A 1QBJA 5DYMA 4ESJA 3WODF 4RAZA 2EFPA 2QQ9A 3K1NA 6PAXA 3U2RA 4R8HA 1TW3A 4EJUA 3CO6C 2V9VA 3KEOA 2FEZA 5L3GA 3F8MA 3REOA 1W7PA 1B59A 3K2ZA 2R3SA 4EM1A 2J5OA 2P6TA 2PN6A 2GA2A 2HQNA 3IWFA 5BPDA 3RI4A 4IPAA 1R5HA 4DNCA 5AONA 5LRSA 3CLOA 1I6XA 5HVQC 1G3TA 3TKYA 2MC3A 5ICCA 2DQLA 4I02A 3M1EA 4AIJA 1ULYA 1OR7A 1J59A 1Z6RA 2VBYA 3HTSB 1YS7A 1SMTA 1HW5A 4IRHA 4KFCA 3WU1B 4HV5A 5CVVA 2DTRA 1K78A 1XGMA 4IRIA 4HDVA 1RUOA 2CQKA 3IHUA 4KIBA 1Z05A 2HFHA 3P7NA 2M30A 3ROUA 3CUQB 1XGSA 4CO8A 4EM0B 3MAJA 2OA4A 4ZH4F 4UVCA 4KNYA 2H27A 1P2FA 4MEYF 1FY7A 2JRTA 1T0FA 2O8XA 2HDCA 1QZYA 1HKQA 4S05A 3HHHA 2VC1A 4RB1A 1YFHA 3WTUC 3I0TA 4HQEA 2UZKA 4EGYA 3Q9VA 4RGSA 1FWZA 2C6YA 3BJOA 2W57A 1KQ8A 2A6HF 3J7AO 2G9WA 5DCMA 4ENKA 4EV0A 1ZRFA 2FBHA 1HSJA 3KZZA 3ZMTA 1ZYRF 1MJBA 1YQAA 3M9AA 3G3ZA 2MD5A 4EJVA 4LMYA 5JR3A 4EJTA 1K79A 3I59B 3BROA 5L3BA 5LEJA 4WXCA 1SFXA 1YW8A 1REPC 3RKWA 1ZN2A 3COAC 1R1VA 4IXAA 1BC7C 4KT5C 5D8KB 1FLIA 3ZN0A 1ZG5A 2IJLA 3F6VA 2JZYA 2BE5F 5F1RA 1ZRCA 2EA2A 1ONVA 2GAUA 4IHSA 1ZGJA 4U88A 5F64A 3BPVA 3O6BB 2BGCA 2L4MA 4P9UA 3F6OA 5LHHA 2Q2EA 1ZH5A 3MQ0A 5DV5A 1HKSA 4MTEA 5HDGA 2ISZA 1LJ9A 1LEAA 5D5VB 3U9GA 3NQOA 4WWCA 2GXBA 3PQKA 3N97A 2HKOA 3TO6A 4RGUA 2W85A 2XUBA 1XDSA 1IRFA 5LEKA 1R5GA 1UFMA 3F8FA 3KE2A 2WWYA 3HYIA 4U0YA 5HS8A 1SMYF 3ZMUA 3FX3A 2RC4A 5D4RA 3WE3A 4HQMA 2ZNYA 3D0SA 1D8JA 4KICA 2D2WA 1T98A 1O3QA 3F23A 1XB4A 1XSVA 4ASNA 3TO7A 1OYWA 3DKWA 1BJAA 3HUGA 2D45A 3GEZA 2YSRA 1IW7F 4XSXF 2F2EA 2PQ8A 2OAZA 3RYRA 2Z3YA 4RGXA 2UXXA 4M73A 5F6FA 1PP7U 3ML6A 2CW0F 2LKPA 4ENJA 4D0PA 5AIPA 3FWEA 2FXAA 2QBYB 4HF0A 4CGZA 1FYKA 3LQQA 2STWA 5ILSA 1RUNA 4OOIA 2CGPA 2V1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJ2 A;  5CVJ A;  2G7H A;  2QM3 A;  4GGG A;  2O3F A;  2OD5 A;  4LB6 B;  2ESH A;  1ZGA A;  1K6O A;  5FO5 A;  5FFZ A;  3GFM A;  2MA3 A;  5IT9 Z;  2PJP A;  3HSE A;  1BM9 A;  1PDN C;  3ABT A;  3WGI A;  3TOA A;  3I59 A;  3EQL F;  2W25 A;  3SQN A;  4G9Y A;  1P4A A;  2YX7 A;  1FBU A;  1IXS B;  2E1N A;  2QEN A;  4BNC A;  3DPL C;  3F3X A;  5LHG A;  1OYY A;  5ILU A;  4IF4 A;  2DAO A;  2ZO4 A;  4LB5 A;  1R7J A;  2H6B A;  3WTV C;  3F8B A;  1RIO H;  1GXQ A;  5A2Q Z;  2Y75 A;  1LEB A;  3H3U A;  2H6C A;  3B73 A;  2Y48 A;  3RPU A;  4BYY A;  2MH2 A;  1LVA A;  2DQR A;  4U0W A;  1XN7 A;  1BC8 C;  3JW4 A;  1TNT A;  4Q48 A;  2RVC A;  4MQV A;  1O3R A;  3F21 A;  2HR3 A;  4YFK F;  3G73 A;  2EFN A;  4L5I A;  1UHM A;  5H20 A;  1ZAO A;  2PG4 A;  2XRN A;  5D5U B;  4EVI A;  1I27 A;  3CTA A;  5IT9 K;  3RYP A;  1KU9 A;  2FF4 A;  3WGH A;  5J6X A;  4Y15 A;  4FX4 A;  2PBI A;  2KIU A;  1MJA A;  3GWZ A;  2HGC A;  5LBQ A;  3TQN A;  1FYL A;  3HIF A;  2VBX A;  1CF7 B;  1YO5 C;  2QUF A;  2W84 A;  1K78 B;  3BZ6 A;  2GWR A;  1U8R A;  4M71 A;  1LB2 A;  3FMR A;  2ETH A;  3DP7 A;  2HTS A;  2YR2 A;  1ZG1 A;  5A2Q K;  3IRQ A;  1OKR A;  4DQ2 A;  3MZY A;  2WTE A;  5ICF A;  4AIK A;  2Q0O A;  4Q4Z F;  1TQM A;  1T38 A;  4BHB A;  2UXN A;  4MHG A;  3E6C C;  2JPC A;  1FBQ A;  3RDI A;  1KGS A;  2G7U A;  4OU0 A;  1B4A A;  3IC7 A;  2F5E A;  2XHK A;  5DCM B;  2QBY A;  2PFB A;  4RS8 A;  4Y17 A;  4ZZL A;  3GXO A;  5E1Z B;  4RB2 C;  1UB9 A;  4WX9 A;  4A2U A;  4XLN F;  3OOP A;  3KET A;  2CO5 A;  5LHI A;  2Z99 A;  4R79 A;  3CDH A;  3O2P E;  4YIF A;  3E6M A;  2DPU A;  4KYW A;  4HA8 A;  4OIN F;  4IHT A;  2LF7 A;  3RKX A;  3QU6 A;  3LST A;  1HW1 A;  1KA8 A;  3GFJ A;  3BY6 A;  2QWW A;  1MKM A;  4UVA A;  2CG4 A;  1L3L A;  4PZJ A;  3WTS C;  3KZY A;  1F5T A;  2CYY A;  2NNY A;  1W4M A;  1MZB A;  3VOE A;  1Z9C A;  1DDN A;  3QRF F;  1FSH A;  5FD5 A;  2IW5 A;  1UHW A;  4P96 A;  2Z33 A;  3F8N A;  3DV8 A;  2FBI A;  2NYX A;  1J75 A;  1PUE E;  3WTX C;  2A68 F;  2EFW A;  1QPM A;  2AXL A;  3GX4 X;  4BXU A;  2LDU A;  3KP3 A;  2F5F A;  2R7F A;  2Y0M A;  2A69 F;  4XRF A;  4E70 A;  4KN7 X;  3O3K A;  4WCG A;  2DU9 A;  4FT8 A;  1LNW A;  1SD6 A;  5H6R A;  2VE9 A;  1KU2 A;  1IAW A;  1MD0 A;  5E1W A;  1WSU A;  4L9T A;  3KEQ A;  5FD6 A;  3TDU C;  1KQ0 A;  3BPX A;  2HQR A;  1S7A A;  2EJR A;  2VE8 A;  5K5Q A;  5FB2 A;  4IJA A;  2LSO A;  3FZV A;  3GFL A;  3JSO A;  2PMU A;  3N4M A;  3V8L A;  1Z1D A;  1T39 A;  3ECO A;  4QWQ A;  4YG2 F;  1JXS A;  1P4X A;  1EH6 A;  3C3W A;  5D5W B;  3GF2 A;  1CF7 A;  4L0Y B;  2KIF A;  5HOO A;  4UUV A;  4JQF A;  4MEX F;  3IRR A;  2K27 A;  1XCV A;  3JAM Z;  4HAM A;  1KU3 A;  5IT3 A;  4YFX F;  2DLL A;  1VTN C;  1QNT A;  3T8T A;  5TRD A;  2KKO A;  3HOT A;  1MDM B;  3HTU A;  2F5C A;  2PI0 A;  5DD4 A;  2WV0 A;  1TQI A;  4MTD A;  4LJZ F;  5EEH A;  1QO0 D;  3S2W A;  4HZF A;  3M8F A;  5HS7 A;  2P8T A;  2MLK A;  5J8C A;  1JHH A;  3ZMV A;  1MGT A;  4RB0 A;  3IKT A;  2M1B A;  1FX7 A;  1ZAR A;  2YX4 A;  1U3E M;  1X3U A;  2PMH A;  4M9S A;  2X0L A;  2OQG A;  3NEU A;  2V6C A;  4GYG A;  5KK1 A;  3J80 Z;  2DBB A;  3HSR A;  1SD4 A;  2X4H A;  2EFQ A;  4IRG A;  1IN7 A;  2HYF A;  4BHC A;  3KFW X;  2XAF A;  5ERI A;  4OIQ F;  4OIP F;  1O57 A;  3JAM K;  4KMU X;  4CXF A;  1Q1H A;  3RTR A;  1WRJ A;  1SAX A;  1J5Y A;  2FQ3 A;  3V4G A;  4UV8 A;  1FPQ A;  2RGV A;  1FZP B;  1XGO A;  3MFK A;  2R7D A;  2A6E F;  2RV8 A;  4P55 A;  2WC2 A;  2GIV A;  3FM5 A;  4GXO A;  1SD5 A;  2JTV A;  1S6L A;  2OQR A;  2M45 A;  3I53 A;  3M8E A;  3GFI A;  3E5X A;  4KA4 A;  1OMI A;  3TDZ C;  4A6E A;  3J80 K;  1FP1 D;  2B0L A;  3WTZ A;  5TJJ A;  4HV6 A;  3KP4 A;  2M5W A;  2L4A A;  4UHT A;  1GXP A;  1BIA A;  1TW2 A;  4LD5 A;  1SFU A;  5L3F A;  1W5T A;  5L3C A;  1FP2 A;  4L9V A;  4L0Z B;  3FMS A;  5LGN A;  4RB3 C;  2XAJ A;  1HBX G;  1E2X A;  4UNO A;  3GZ6 A;  4NHJ A;  2MBF A;  1S8N A;  1GVJ A;  4A0Z A;  4BHP A;  2XIG A;  2VBZ A;  3QP6 A;  4KDP A;  3DXJ F;  5JFR A;  3ZMS A;  2LNB A;  4KMF A;  3RJP A;  4ZZD A;  4A5M A;  4ZYG A;  3ISP A;  1P92 A;  4HX8 A;  3BDD A;  1YTY A;  4G7H F;  3QPT A;  2J5P A;  5ICG A;  2EWN A;  1XSX A;  4HLX A;  1U5T C;  4OMZ A;  4CHU A;  1EH7 A;  4A12 A;  2MH9 A;  2FNA A;  1MDM A;  1XD7 A;  3WTW C;  3K1M A;  2QYO A;  3MEX A;  3JTH A;  3E97 A;  1TQP A;  1YG2 A;  5JHU A;  1D3Y A;  3FMQ A;  4ON0 A;  4LFU A;  1D5V A;  2XKP A;  1IN6 A;  1EH8 A;  1W7P D;  4L18 B;  5CVR A;  5LGT A;  1QZZ A;  3WGG A;  4A0X A;  3FHZ A;  2HKX A;  4XBF A;  2A5Y B;  1W5S A;  2L02 A;  2P5L C;  4I0B A;  4L9N A;  1KYW A;  5H6Q A;  4CIC A;  1WI9 A;  1FT9 A;  3FXU A;  2V1D A;  3QOP A;  1DPU A;  4I01 A;  1J2X A;  2K4J A;  1Z7U A;  1I1G A;  2EK5 A;  4G94 A;  4U0V A;  1S3J A;  3QAH A;  4B09 A;  4EJO A;  4ENN A;  4RAY A;  3MZH A;  1SFE A;  2CWE A;  1U78 A;  5CYV A;  4ESB A;  3IKV A;  2A07 F;  2H09 A;  2M8E A;  1BI3 A;  3KCC A;  1IZ1 A;  4GO1 A;  5DCF A;  1H9G A;  2ACJ A;  2NRA C;  3HHG A;  4S04 A;  2V79 A;  2VT3 A;  1CGP A;  1O7L A;  3C18 A;  1R23 A;  5ICE A;  2P6S A;  1P4W A;  3EYI A;  1RI7 A;  3WTY C;  3E5Q A;  3HRS A;  1DUX C;  1UCR A;  3KP7 A;  5HLI A;  4EQQ A;  3IWZ A;  4OIO F;  5D6E A;  4EMS A;  2ISY A;  4ETS A;  2XRO A;  2NAZ A;  1DPR A;  2GA1 A;  5HDK A;  2ZBK A;  4ZYH A;  2VN2 A;  3DFG A;  1DP7 P;  3NRV A;  3HRU A;  3VFZ A;  4KIG A;  1LDK B;  3ZMZ A;  3KP6 A;  4BAY A;  2VXZ A;  1BN5 A;  1RNL A;  1XGN A;  1G4D A;  2Z9O A;  1S29 A;  1ZG3 A;  1AWC A;  3RIR A;  3LQR A;  2GQQ A;  4CZZ A;  3BOQ A;  4HF2 A;  2K02 A;  2E7X A;  3V8K A;  3M7G A;  2RDP A;  1B1B A;  2IPQ X;  1S7O A;  3I71 A;  3E5U A;  1LDJ A;  1LDD A;  4LK0 F;  4HF1 A;  2TDX A;  4YII A;  3GLX A;  3MCZ A;  2BBY A;  1O3S A;  3KP5 A;  2ZXJ A;  3LA2 A;  3I58 A;  4FX0 A;  1F9N A;  2EV5 A;  2W24 A;  2XKO A;  1G3W A;  3KP2 A;  2CSO A;  3R6S A;  3HRM A;  3ZMD A;  5D8L B;  4H0E A;  2IRF G;  4I0A A;  5L3E A;  5DUI A;  2L3D A;  3V7R A;  1IXC A;  4G6D A;  4JK1 X;  1GHC A;  1IN8 A;  4GYI A;  2RQP A;  4Z2Y A;  2MLG A;  1YS6 A;  2HWV A;  3HSF A;  3PFI A;  4AD9 A;  2RNJ A;  4G6Q A;  1XDU A;  3VEP A;  3J81 Z;  4ESF A;  4AIH A;  4HX4 A;  2OZ6 A;  2JSC A;  1YLF A;  3F22 A;  5DDG A;  2ESN A;  4P9F A;  4HLY A;  4QLC U;  3BJA A;  3GW2 A;  1QGP A;  3B02 A;  3RPQ A;  5HLH A;  3P9K A;  4JBA A;  4L5J A;  5JVT A;  2NNN A;  3GO5 A;  3FM3 A;  3EDP A;  2DK5 A;  1IN5 A;  1P6R A;  4P5O A;  5K1Y A;  1L0O C;  1ZHF A;  2BEO A;  2YPR A;  4U7D A;  2QZ8 A;  2COM A;  3V7S A;  4MNU A;  1I5Z A;  5E1X A;  2QQB A;  4A6D A;  4O5V A;  4PDK A;  1U5T B;  1G3Y A;  3SFZ A;  3Q5F A;  3K0L A;  1JE8 A;  1J7K A;  4WF2 A;  3MWM A;  4HBL A;  3BP8 A;  3JTG A;  1KQ9 A;  1R58 A;  3E6B A;  1EV7 A;  1E17 A;  4PGG A;  2YU3 A;  1RZ4 A;  3KLN A;  3ELK A;  1TTY A;  1YYV A;  5DD8 A;  1R1T A;  3J81 K;  2P4W A;  2ZCW A;  2GXG A;  3LAP A;  3Q9S A;  4PCQ A;  5BOX A;  3C1D A;  3D5L A;  1G6N A;  1BBY A;  5J8F A;  3F8C A;  2HEO A;  4WK8 F;  2HOE A;  5D5X B;  1PP8 F;  3IL2 A;  1R1U A;  2HTJ A;  1KYZ A;  2FMY A;  5K5R A;  4WXD A;  2FNP A;  2K7L A;  2KJC A;  3QPH A;  1HST A;  2FE3 A;  3H92 A;  4PGH A;  2IA0 A;  3DQV C;  2JT1 A;  5CVI A;  4N9H A;  3PQJ A;  2HZT A;  2VOD A;  2HS5 A;  2NS0 A;  4A0Y A;  2LF8 A;  2ZFW A;  3SHF A;  2E1C A;  2K86 A;  2ZKZ A;  4ZYD A;  2FA5 A;  1IXR C;  1HKT A;  5BPI A;  1ON1 A;  1H0M A;  2ZME B;  5BQT A;  4U7B A;  2V1X A;  1YW9 A;  5E20 A;  3TO9 A;  3ERE D;  1FBS A;  3L7W A;  1ZRD A;  4Q5S F;  2EB7 A;  4LK1 F;  3CO7 C;  1ODD A;  1MJ9 A;  1IN4 A;  2XAQ A;  3WU0 A;  1TLH B;  4NB5 A;  1F4K A;  2FBK A;  2QQA A;  1HXD A;  2VT2 A;  2VBW A;  5LRR A;  2EA4 A;  4G7O F;  4TV7 A;  2DW4 A;  2KIM A;  2KRF A;  3FXR A;  2VON A;  2DT5 A;  4YFN F;  2CFX A;  2O03 A;  3W6K B;  1I1S A;  1BI2 A;  4K2E A;  3AAF A;  1G3S A;  3TOB A;  3BWG A;  3EYY A;  1XMA A;  4AVP A;  4LG0 B;  2DO7 A;  3K1P A;  2VC0 A;  1UST A;  3ZPL A;  3SXY A;  3EET A;  1ZRE A;  1H9T A;  5D6F A;  5JI6 A;  3LFK A;  1FNN A;  2E7W A;  4CYD A;  2STT A;  4IVN A;  5KVR A;  3R4K A;  5FFX A;  5LGU A;  3ZN1 A;  3K9T A;  2PLY A;  3C7J A;  4F7Z A;  1U5T A;  2OBP A;  1T6S A;  1A04 A;  3P9C A;  1WKM A;  3GYH X;  3CUO A;  5BS6 A;  1USS A;  3LAJ A;  3CJN A;  3U1D A;  3H3Z A;  4EM2 A;  4HW0 A;  4M72 A;  1K7A A;  4RGR A;  3R61 A;  1SD7 A;  2QLZ A;  5D4S A;  5L3D A;  2AS5 F;  5BMZ A;  1FYM A;  4N9I A;  3HOS A;  3GVA A;  4EGZ A;  1ZLJ A;  2IP2 A;  1IF1 A;  3OV8 A;  2FRH A;  2ELH A;  3L2C A;  4O3M A;  3VB2 A;  5HLG A;  4I09 A;  4KUM A;  1OPC A;  1ZLK A;  3ZP5 A;  2ZNZ A;  5AIQ A;  4AWX B;  2F5D A;  1B6A A;  5HDN A;  5CJ9 A;  4G8X A;  3CUQ A;  1V4R A;  4G7Z F;  2XV4 S;  1JHF A;  2D1V A;  1WWX A;  2H94 A;  3DPT A;  2FML A;  2D1H A;  2DK8 A;  1WQ2 A;  2IA1 A;  4XSZ F;  1KU7 A;  3E6D A;  2KJB A;  3WE2 A;  5ILV A;  3LA7 A;  1OYI A;  2ZME A;  2HYG D;  1U6G A;  5E18 F;  2DPD A;  4BQA A;  2O61 A;  4XLP F;  3K69 A;  3I64 A;  3CUQ C;  2XAH A;  4LGW A;  3T0Y A;  2JPB A;  3VOD A;  3SZP A;  4LLL A;  1IRG A;  4BH9 A;  2RN7 A;  2PEX A;  2RKH A;  4N0B A;  3QP5 A;  3GZ5 A;  5HS9 A;  5E8I A;  4LLG F;  3L00 A;  1U2W A;  4Y13 A;  5K5O A;  3DEU A;  4I7H A;  4LG0 A;  3FXQ A;  3L9F A;  4HOB A;  1W7P B;  3P9I A;  2P7V B;  5FLX Z;  2EFO A;  1QQI A;  4L9J A;  2FOK A;  5EEG A;  1J9I A;  1B9N A;  3EUH A;  3I4P A;  2A61 A;  2ADU A;  2EV6 A;  4UVB A;  4M74 A;  4R1H A;  3JSP A;  4Q47 A;  2Z5U A;  3V7C A;  2XGX A;  4HDU A;  5DUK A;  1LQ1 A;  2O0Y A;  3I54 A;  2XAS A;  4KN4 X;  2IVM A;  1R22 A;  2OZU A;  2DI3 A;  4M6Y A;  3V8J A;  1BI0 A;  4M6X A;  2P5K A;  1J0R A;  2XVC A;  3QU3 A;  2IT0 A;  2M87 A;  4OMY A;  5E8G A;  1IUY A;  1FOK A;  4O6J A;  4M9X A;  3F72 A;  5FGM A;  3ABU A;  1B9M A;  3SZT A;  1TBX A;  4MQ9 F;  1FSE A;  4WXH A;  2BV6 A;  1F1Z A;  2EV0 A;  3LA3 A;  2VOO A;  2IA2 A;  1HW2 A;  3DF8 A;  4EJW A;  1O3T A;  4NQW A;  2L54 A;  1Z6T A;  1C0W A;  2P5V A;  3R0A A;  1Z91 A;  3ECH A;  2OU2 A;  4HX7 A;  5FLX K;  1R36 A;  4UXN A;  2K4B A;  3ULQ B;  3GUD A;  3T8R A;  1O7F A;  4HYE A;  3T5X A;  2UWM A;  3R0J A;  4CDG A;  4M9Z A;  3W6J B;  1T2K A;  4OIR F;  3WG9 A;  4GCV A;  1STZ A;  1YW7 A;  2DFI A;  1R00 A;  3WTT C;  2QVO A;  2A3S A;  3HRT A;  2XAG A;  2VOP A;  3BJ6 A;  3TGN A;  1TNS A;  4LLN A;  4FHT A;  5CLS A;  5E17 F;  3FF5 A;  4I2O A;  1XCB A;  5LLQ A;  1FC3 A;  2Q8K A;  3I5U A;  4A5N A;  3E3V A;  4B8X A;  4MGR A;  1JGS A;  1Y0U A;  4I98 B;  2BYV E;  1YIO A;  2L01 A;  1BI1 A;  1BOA A;  1HQC A;  5DEQ A;  2FU4 A;  4ZYE A;  1AOY A;  1BIB A;  2O6G E;  1V3F A;  1XMK A;  3KLO A;  3R60 A;  1XSD A;  2P7C B;  2GZW A;  5ED4 A;  2FSW A;  3T1B A;  4UV9 A;  1D8K A;  4ENM A;  1ON2 A;  4KIF A;  3RKY A;  1NHA A;  3ZQ7 A;  3LWF A;  5CVU A;  3L09 A;  1QBJ A;  5DYM A;  4ESJ A;  3WOD F;  4RAZ A;  2EFP A;  2QQ9 A;  3K1N A;  6PAX A;  3U2R A;  4R8H A;  1TW3 A;  4EJU A;  3CO6 C;  2V9V A;  3KEO A;  2FEZ A;  5L3G A;  3F8M A;  3REO A;  1W7P A;  1B59 A;  3K2Z A;  2R3S A;  4EM1 A;  2J5O A;  2P6T A;  2PN6 A;  2GA2 A;  2HQN A;  3IWF A;  5BPD A;  3RI4 A;  4IPA A;  1R5H A;  4DNC A;  5AON A;  5LRS A;  3CLO A;  1I6X A;  5HVQ C;  1G3T A;  3TKY A;  2MC3 A;  5ICC A;  2DQL A;  4I02 A;  3M1E A;  4AIJ A;  1ULY A;  1OR7 A;  1J59 A;  1Z6R A;  2VBY A;  3HTS B;  1YS7 A;  1SMT A;  1HW5 A;  4IRH A;  4KFC A;  3WU1 B;  4HV5 A;  5CVV A;  2DTR A;  1K78 A;  1XGM A;  4IRI A;  4HDV A;  1RUO A;  2CQK A;  3IHU A;  4KIB A;  1Z05 A;  2HFH A;  3P7N A;  2M30 A;  3ROU A;  3CUQ B;  1XGS A;  4CO8 A;  4EM0 B;  3MAJ A;  2OA4 A;  4ZH4 F;  4UVC A;  4KNY A;  2H27 A;  1P2F A;  4MEY F;  1FY7 A;  2JRT A;  1T0F A;  2O8X A;  2HDC A;  1QZY A;  1HKQ A;  4S05 A;  3HHH A;  2VC1 A;  4RB1 A;  1YFH A;  3WTU C;  3I0T A;  4HQE A;  2UZK A;  4EGY A;  3Q9V A;  4RGS A;  1FWZ A;  2C6Y A;  3BJO A;  2W57 A;  1KQ8 A;  2A6H F;  3J7A O;  2G9W A;  5DCM A;  4ENK A;  4EV0 A;  1ZRF A;  2FBH A;  1HSJ A;  3KZZ A;  3ZMT A;  1ZYR F;  1MJB A;  1YQA A;  3M9A A;  3G3Z A;  2MD5 A;  4EJV A;  4LMY A;  5JR3 A;  4EJT A;  1K79 A;  3I59 B;  3BRO A;  5L3B A;  5LEJ A;  4WXC A;  1SFX A;  1YW8 A;  1REP C;  3RKW A;  1ZN2 A;  3COA C;  1R1V A;  4IXA A;  1BC7 C;  4KT5 C;  5D8K B;  1FLI A;  3ZN0 A;  1ZG5 A;  2IJL A;  3F6V A;  2JZY A;  2BE5 F;  5F1R A;  1ZRC A;  2EA2 A;  1ONV A;  2GAU A;  4IHS A;  1ZGJ A;  4U88 A;  5F64 A;  3BPV A;  3O6B B;  2BGC A;  2L4M A;  4P9U A;  3F6O A;  5LHH A;  2Q2E A;  1ZH5 A;  3MQ0 A;  5DV5 A;  1HKS A;  4MTE A;  5HDG A;  2ISZ A;  1LJ9 A;  1LEA A;  5D5V B;  3U9G A;  3NQO A;  4WWC A;  2GXB A;  3PQK A;  3N97 A;  2HKO A;  3TO6 A;  4RGU A;  2W85 A;  2XUB A;  1XDS A;  1IRF A;  5LEK A;  1R5G A;  1UFM A;  3F8F A;  3KE2 A;  2WWY A;  3HYI A;  4U0Y A;  5HS8 A;  1SMY F;  3ZMU A;  3FX3 A;  2RC4 A;  5D4R A;  3WE3 A;  4HQM A;  2ZNY A;  3D0S A;  1D8J A;  4KIC A;  2D2W A;  1T98 A;  1O3Q A;  3F23 A;  1XB4 A;  1XSV A;  4ASN A;  3TO7 A;  1OYW A;  3DKW A;  1BJA A;  3HUG A;  2D45 A;  3GEZ A;  2YSR A;  1IW7 F;  4XSX F;  2F2E A;  2PQ8 A;  2OAZ A;  3RYR A;  2Z3Y A;  4RGX A;  2UXX A;  4M73 A;  5F6F A;  1PP7 U;  3ML6 A;  2CW0 F;  2LKP A;  4ENJ A;  4D0P A;  5AIP A;  3FWE A;  2FXA A;  2QBY B;  4HF0 A;  4CGZ A;  1FYK A;  3LQQ A;  2STW A;  5ILS A;  1RUN A;  4OOI A;  2CGP A;  2V1U A; 
#chains in the Genus database with same CATH topology
 2M8G X;  3G1L A;  2ZJ2 A;  5CVJ A;  1EA3 A;  2G7H A;  3A2K A;  2QM3 A;  4GGG A;  2O3F A;  2OD5 A;  2NVU B;  4LB6 B;  2ESH A;  2LVS A;  2LY2 A;  1ZGA A;  4B47 A;  1K6O A;  5FO5 A;  4D9J A;  1A36 A;  1I3Q J;  5FFZ A;  3GFM A;  2R7S A;  1WPK A;  2MA3 A;  2NOJ B;  3I4N J;  5IT9 Z;  4I76 A;  2PJP A;  3HSE A;  4AU7 A;  1BM9 A;  3TP3 A;  1OCO H;  2ZXI A;  1MMD A;  5J1U A;  2HVS A;  4XKB A;  1PDN C;  3ABT A;  2HQA A;  3WGI A;  3PO2 J;  3TOA A;  2CV0 A;  3I59 A;  3EQL F;  2W25 A;  2M3A A;  1FOX A;  3SQN A;  1P9Q C;  2DT7 B;  4G9Y A;  1P4A A;  2YX7 A;  4DW6 A;  1FBU A;  3QYF A;  3E1S A;  2JQ7 A;  3DTE A;  1IXS B;  2E71 A;  3O8G A;  3FDY A;  3VPR A;  2E1N A;  2QEN A;  3HKZ N;  1LFU P;  4BNC A;  3AL0 C;  3DPL C;  3F3X A;  4A3E J;  5LHG A;  1OYY A;  2M0M A;  5ILU A;  3BTC A;  4IF4 A;  2ELK A;  2WAD A;  2E2I J;  2DAO A;  4F91 B;  1DU6 A;  2KZG A;  2ZO4 A;  4C3I J;  4LB5 A;  1R7J A;  2H6B A;  3WTV C;  3ZCO A;  3C2B A;  3F8B A;  3ABK H;  2RNG A;  1RIO H;  1GXQ A;  2BY2 A;  1HF0 A;  4C2M J;  4ZC3 A;  1V54 H;  5A2Q Z;  1IO2 A;  2Y75 A;  5EZG A;  1BR2 A;  1LEB A;  3H3U A;  2H6C A;  2R7W A;  3B73 A;  2Y48 A;  2VKE A;  3BG5 A;  3RPU A;  4BYY A;  2MH2 A;  1LVA A;  2JWT A;  2DQR A;  3CCE I;  5FRO A;  2M7B A;  2PJR B;  4HST A;  4A3L J;  3SJM A;  4U0W A;  1XN7 A;  4M3E A;  1BC8 C;  1FTT A;  3JW4 A;  5B1B H;  1TNT A;  5EJC A;  4NNJ A;  4Q48 A;  2RVC A;  2TRT A;  4RM3 A;  4MQV A;  1O3R A;  3F21 A;  2HR3 A;  2FUG 2;  4YFK F;  3G73 A;  4BQN A;  4BGD A;  4XQF A;  2EFN A;  4G12 A;  4L5I A;  2ME6 A;  3MKY B;  1UHM A;  4XKW A;  5H20 A;  1ZAO A;  5EDN A;  2PG4 A;  2XRN A;  4E7J A;  1B8I A;  4A3I J;  5D5U B;  5GTI C;  2DYS H;  4EVI A;  1TWH J;  2R4G A;  1I27 A;  3CTA A;  3IUO A;  1YIT I;  1DU0 A;  5IT9 K;  3S3N A;  3M4O J;  3RYP A;  1KU9 A;  2FF4 A;  1MBF A;  3PNY A;  4RA2 A;  3WGH A;  1A6I A;  5J6X A;  3AG4 H;  4UY8 I;  3PSF A;  5KHD A;  2CV2 A;  4Y15 A;  4FX4 A;  2PBI A;  2KIU A;  1MJA A;  3I55 I;  3GWZ A;  2HGC A;  4HNV A;  5FJ8 J;  5LBQ A;  3CCV I;  2DA7 A;  2E34 A;  3TQN A;  1FYL A;  2HVR A;  2O7O A;  3HIF A;  2VBX A;  1SFO J;  1CF7 B;  1YO5 C;  2QUF A;  4UB8 C;  2W84 A;  1K78 B;  3BZ6 A;  2COB A;  2GWR A;  2KZV A;  3FXM A;  1U8R A;  4M71 A;  2FX0 A;  2R5Z A;  1LB2 A;  1TWF J;  3M8J A;  3FMR A;  2ETH A;  3DP7 A;  2HTS A;  2YR2 A;  4FIS A;  4ZJZ A;  1ZG1 A;  5A2Q K;  3IRQ A;  1OKR A;  3FBN B;  4DQ2 A;  2AXT C;  3PJR A;  3MZY A;  2WTE A;  3D1N I;  2CUE A;  5ICF A;  2KIQ A;  4AIK A;  2VIX A;  2Q0O A;  4Q4Z F;  3CD6 I;  1TQM A;  1YJ9 I;  2DJN A;  2VB6 A;  2RRE A;  1T38 A;  4BHB A;  2N8G A;  3OIQ A;  2UXN A;  1SVO A;  4MHG A;  2JPC A;  3E6C C;  1M1E B;  1FBQ A;  3RDI A;  4ZDO A;  4Y3O A;  1KON A;  1X1A A;  4KIS A;  2AQE A;  4CCO A;  2WV1 A;  4DYC A;  1KGS A;  3G1M A;  4B3A A;  2G7U A;  4OU0 A;  2E5Z A;  4Y33 A;  3OYK A;  1B4A A;  3IC7 A;  2F5E A;  2XHK A;  1PYV A;  5DCM B;  2QBY A;  3IV5 A;  2LTP A;  2PFB A;  3JRA A;  1HOM A;  4RS8 A;  2EH3 A;  4Y17 A;  3GXO A;  4DGW B;  4ZZL A;  1EJ9 A;  1Z77 A;  1ITY A;  5E1Z B;  4RB2 C;  1RR7 A;  1UB9 A;  3BR6 A;  4WX9 A;  4A2U A;  4XLN F;  3OOP A;  3KET A;  3OYB A;  2CO5 A;  3RZD J;  3BR0 A;  2XAU A;  5LHI A;  3K10 A;  1JUP A;  1PJR A;  2EZH A;  2Z99 A;  4R79 A;  3CDH A;  3O2P E;  4YIF A;  3E6M A;  2DPU A;  4KYW A;  3VYU B;  4HA8 A;  4OIN F;  4IHT A;  1WJA A;  2LF7 A;  2DJI A;  5JVG F;  3RKX A;  3QU6 A;  2F6C A;  4XRS A;  3CCL I;  3LST A;  3OS2 A;  1HW1 A;  2AO9 A;  4E4H A;  2DOE A;  4CUG A;  1KA8 A;  3GFJ A;  3BY6 A;  3S93 A;  4UUS B;  2QWW A;  2DA4 A;  1F43 A;  1MKM A;  3S3O A;  3CMY A;  4CSW A;  4UVA A;  2CG4 A;  1L3L A;  1V55 H;  4JYK A;  1AKH B;  4PZJ A;  5EG0 A;  5EEA A;  3LSJ A;  3WTS C;  3K4J A;  3KZY A;  1F5T A;  3DKY A;  1BA5 A;  2JRM A;  2CYY A;  1N25 A;  2NNY A;  2OTL I;  1W4M A;  2IAI A;  3SFI A;  1MZB A;  3VOE A;  1Z9C A;  1DDN A;  5M3F J;  3QRF F;  1FSH A;  1MBK A;  2FQ4 A;  3HXL A;  4E6K G;  5FD5 A;  2IW5 A;  2IS6 A;  1UHW A;  4LOC A;  4P96 A;  2L5Q A;  2Z33 A;  3F8N A;  1OCR H;  2JVH A;  2GBY A;  2CFO A;  3DV8 A;  2FBI A;  2WB1 N;  2NYX A;  1J75 A;  3HC7 A;  4F52 A;  1PUE E;  3WTX C;  2W4S A;  4E7H A;  2A68 F;  3K2A A;  3WHC A;  2EFW A;  1QPM A;  2AXL A;  1VQO I;  3GX4 X;  4BXU A;  2LDU A;  3KP3 A;  1PUF B;  2F5F A;  2R7F A;  4DBQ A;  4IHY A;  2Y0M A;  2A69 F;  4XRF A;  1S9H A;  1GT0 C;  2PJR A;  4PJJ A;  4E70 A;  1B72 B;  3V42 A;  1SAU A;  3O3K A;  4KN7 X;  2KDO A;  4WCG A;  1RPW A;  2DU9 A;  2E1M C;  1LNW A;  1SD6 A;  4FT8 A;  5H6R A;  3DTK A;  2VE9 A;  3NWT A;  1KU2 A;  4BL0 B;  1IAW A;  1MD0 A;  5E1W A;  1WSU A;  2FOW A;  1X19 A;  4XID A;  4L9T A;  1WHU A;  3KEQ A;  5FD6 A;  3TDU C;  1KQ0 A;  1Q1V A;  3CCJ I;  3BPX A;  2HQR A;  1ZGW A;  2L7Z A;  1Z0X A;  1S7A A;  2EJR A;  2VE8 A;  1LE8 B;  1YHQ I;  5K5Q A;  1YE9 A;  5FB2 A;  4IJA A;  1H88 C;  3ZRG A;  3JRC A;  2LSO A;  3FZV A;  3GFL A;  3IAS 2;  3JSO A;  3S32 A;  4X0G A;  4NC8 A;  1FIA A;  3CJQ B;  4U87 A;  4M6V A;  1T33 A;  1X3Z B;  2PMU A;  4IHX A;  1Y56 A;  3N4M A;  1VQ8 I;  3V8L A;  1SC7 A;  1Z1D A;  1T39 A;  3ECO A;  1U0J A;  3TL4 X;  4E7Z A;  2NVT J;  3DBR B;  4QWQ A;  3OYL A;  4MFE A;  4H4K C;  4YG2 F;  3W2V A;  5FKL A;  4IQJ A;  1JXS A;  1P4X A;  3WHB A;  1EH6 A;  3C3W A;  5D5W B;  3U21 A;  3GF2 A;  1CF7 A;  4L0Y B;  2KIF A;  5HOO A;  4UUV A;  5CQG A;  2KLO A;  1V5G A;  4JQF A;  4MEX F;  3IRR A;  1HDD C;  2K27 A;  1XCV A;  3JAM Z;  2M4G A;  2KDZ A;  2X1C A;  2XGD A;  4I6Z A;  5IOY A;  3OYE A;  1HA8 A;  4HAM A;  1MNM C;  3IP4 B;  1KU3 A;  3AL0 B;  5IT3 A;  2LLK A;  4YFX F;  2DLL A;  2DMT A;  4XL9 A;  3OL3 A;  4QIW N;  1QNT A;  1VTN C;  3HG9 A;  3T8T A;  4DBR A;  5TRD A;  2BW3 B;  1MSF C;  2KKO A;  5F1J A;  1ZQ3 P;  3RQI A;  3HOT A;  1MDM B;  2L7M P;  4XIC A;  2GLO A;  3HTU A;  2MC4 A;  4A3F J;  2F5C A;  2QSG X;  1GV5 A;  2PI0 A;  3RQ4 A;  4NDL A;  5DD4 A;  2WV0 A;  1TQI A;  4MTD A;  3PUF A;  4LJZ F;  5EEH A;  1QO0 D;  3S2W A;  2A05 A;  2YUS A;  2K3F A;  3M8F A;  4HZF A;  5HS7 A;  3HPH A;  2QA4 I;  2P8T A;  2MLK A;  5J8C A;  1JHH A;  3DPU A;  3ZMV A;  1MGT A;  4RB0 A;  2R7T A;  5C44 J;  3IKT A;  2M1B A;  1FX7 A;  2DCE A;  1ZAR A;  3B6A A;  1AU7 A;  2YX4 A;  3L2V A;  2LY9 A;  1U3E M;  2LRD A;  1X3U A;  2PMH A;  1Y0N A;  4M9S A;  2X0L A;  2OQG A;  3JRE A;  2HU9 A;  3K4B A;  4ZDL A;  3DEW A;  1ETQ A;  2V6C A;  3NEU A;  3BTL A;  4GYG A;  5KK1 A;  3J80 Z;  2DBB A;  2GM4 A;  2I8D A;  3AKZ A;  3HSR A;  5IP9 J;  1SD4 A;  2X4H A;  5CQE A;  3ZOB A;  1EF4 A;  3HEF A;  3KPH A;  5GAE J;  2NVQ J;  2EFQ A;  4IRG A;  4PFO A;  2X6Y A;  1X3W B;  2ECC A;  1LVK A;  1QHH D;  3HOX J;  1IN7 A;  3JRI A;  5J1R A;  2HYF A;  3FKI J;  2CW7 A;  2XF5 A;  4BHC A;  3KFW X;  4CZC A;  2XAF A;  2JMW A;  3EUA A;  5ERI A;  4G6T B;  4BBR J;  5F0H A;  4OIQ F;  4OIP F;  4HEA 2;  1O57 A;  1POG A;  4DJA A;  4XRM A;  3JAM K;  4KMU X;  5KNL A;  4F93 B;  4CXF A;  1Q1H A;  3RTR A;  1WRJ A;  3H3V K;  2X51 A;  2OTJ I;  1SAX A;  1J5Y A;  2FQ3 A;  3V4G A;  1MW7 A;  4UV8 A;  1N77 A;  3LSP A;  1FPQ A;  2BXZ A;  2RGV A;  1DGR M;  1FZP B;  1VQ5 I;  3HOW J;  1XGO A;  3MFK A;  2R7D A;  4XLF A;  2A6E F;  4AUX A;  3S2D J;  3CCS I;  4BEH B;  1TWA J;  2RV8 A;  3HZJ A;  2W82 A;  4P55 A;  3K6G A;  2WC2 A;  2GIV A;  3FM5 A;  4GXO A;  1SD5 A;  2JTV A;  1UAA A;  1B8I B;  1YX5 A;  1S6L A;  2OQR A;  2M45 A;  3KYL A;  1MMS A;  3JRF A;  2CMP A;  1F36 A;  3I53 A;  2BHZ A;  3ONQ A;  3A0H C;  1B72 A;  3LSH A;  3M8E A;  1Y1W J;  2ZJR F;  1K61 A;  1WH5 A;  3GFI A;  3GZN B;  5B3S H;  2WAQ A;  3E5X A;  4KA4 A;  1OMI A;  3TDZ C;  4A6E A;  1MMN A;  3J80 K;  2ZFU A;  3CMM A;  1FP1 D;  3ZQH A;  3GCM A;  2YS9 A;  2LR8 A;  4XOR A;  2B0L A;  3WTZ A;  5TJJ A;  2H8W A;  4HV6 A;  2JUG A;  2CQ7 A;  3KP4 A;  2MYS A;  1U8B A;  2M5W A;  2XPU A;  1LE8 A;  2L4A A;  4UHT A;  1NG6 A;  1GXP A;  1BIA A;  2ELJ A;  1TW2 A;  5TGT A;  4LD5 A;  5CKT A;  3H35 A;  1SFU A;  1S5L C;  3K4C A;  5L3F A;  2V4J C;  1W5T A;  5L3C A;  1FP2 A;  4L9V A;  5B5E C;  4MO7 A;  4L0Z B;  3BR1 A;  3ZQG A;  2QSF X;  3FMS A;  5LGN A;  4RB3 C;  2XAJ A;  5JHF A;  1HBX G;  1E2X A;  1WGX A;  4UNO A;  3GZ6 A;  4NHJ A;  2MBF A;  1S8N A;  1GVJ A;  2E19 A;  5JLW A;  2VKH A;  1GUU A;  4J00 A;  4A0Z A;  4BHP A;  2XIG A;  4FE7 A;  2VBZ A;  3QP6 A;  4KDP A;  4E7S A;  4PK4 A;  3S15 J;  1QVT A;  1MH3 A;  2ID6 A;  3DXJ F;  4HNU A;  5JFR A;  3ZMS A;  2LNB A;  2OCE A;  3MVP A;  4KMF A;  1OCP A;  2HPI A;  3RJP A;  4ZZD A;  4B43 A;  3GTK J;  1W5C C;  4A5M A;  2HI3 A;  3NAR A;  4ZYG A;  3DBH B;  2V9K A;  4W1U A;  1W1W E;  1VQ7 I;  1RES A;  3ISP A;  1P92 A;  4HX8 A;  3E7L A;  2KQR A;  3BDD A;  3RKQ A;  1YTY A;  1J09 A;  4G7H F;  1XPX A;  3QPT A;  3BQZ A;  3BR3 A;  2J5P A;  5ICG A;  2IS2 A;  2EWN A;  1XSX A;  2L9N A;  3FIS A;  4HLX A;  3IH3 A;  1T95 A;  1U5T C;  3BTJ A;  4OMZ A;  4CHU A;  2BW3 A;  1EH7 A;  4A12 A;  2KPM A;  4B1R A;  2MH9 A;  2FNA A;  1MDM A;  2E2H J;  1XD7 A;  2E36 A;  3WTW C;  3K1M A;  2QYO A;  3MEX A;  4XM3 A;  2K9Q A;  2DA3 A;  5HLT A;  1ZEL A;  3JTH A;  3E97 A;  1TQP A;  1YG2 A;  3FXK A;  4YEL A;  2VAS A;  5JHU A;  2LC2 A;  1D3Y A;  3FMQ A;  4ON0 A;  4LFU A;  1D5V A;  2XKP A;  3OYI A;  1IN6 A;  1EH8 A;  1W7P D;  4FTH A;  4L18 B;  5CVR A;  5LGT A;  1UG2 A;  3GTL J;  1QZZ A;  1WJD A;  4EAT A;  3WGG A;  4A0X A;  3FHZ A;  1N75 A;  2HKX A;  2OUM A;  4XBF A;  4PJL A;  1Z21 A;  5EG0 B;  2A5Y B;  5FKO A;  1W5S A;  4F55 A;  2E1M B;  2L02 A;  1GDT A;  1X1P A;  2DTZ A;  3I9V 2;  2P5L C;  4I0B A;  3O8H A;  1DP3 A;  4L9N A;  1KYW A;  5H6Q A;  4CIC A;  1O4X A;  3JRH A;  1WI9 A;  3DCF A;  1FT9 A;  3FXU A;  2V1D A;  3QOP A;  4B4C A;  3TW7 A;  1DPU A;  4I01 A;  4MFD A;  3JCU C;  4C30 A;  1IDZ A;  1J2X A;  2K4J A;  2ZC2 A;  1Z7U A;  2BXY A;  3CME I;  2M2E A;  1I1G A;  2XPW A;  3A4C A;  2EK5 A;  3BZC A;  4G94 A;  4N4O B;  4S0H B;  3SYT A;  4NC7 A;  5HNF A;  3MKW B;  4OWR B;  2DYR H;  4U0V A;  2VQL A;  5M5X J;  2XF7 A;  1MBJ A;  1R49 A;  1S3J A;  3QAH A;  4B09 A;  2TCT A;  4ZYA A;  4EJO A;  4JX4 A;  2L9R A;  4ENN A;  4RAY A;  2VQC A;  1SFE A;  2CWE A;  3MZH A;  1U78 A;  5CYV A;  3H5N A;  4ESB A;  3FK7 A;  1WJF A;  3K4K A;  2H8R A;  5GTH C;  3OYJ A;  1OIS A;  1FIP A;  3IKV A;  2A07 F;  2M8E A;  2H09 A;  1BI3 A;  3KCC A;  1IZ1 A;  4GO1 A;  1W0T A;  5DCF A;  3K4M A;  4A3G J;  3HDD A;  3CJT B;  3MN2 A;  2VL8 A;  4PJN A;  1IDY A;  1YRN A;  2Q1Z B;  3Q0V A;  3BC8 A;  2K9L A;  5HOD A;  1H9G A;  1Z3Y A;  3LSG A;  2ACJ A;  2NRA C;  3HHG A;  4S04 A;  3QOD A;  2V79 A;  2V6E A;  2VT3 A;  2M0C A;  2VLA A;  4P1W A;  3MD2 A;  2DMQ A;  1X2N A;  1O7L A;  1CGP A;  3C18 A;  3ZR8 X;  1TL8 A;  2Z2S B;  1R23 A;  5ICE A;  4QPO A;  2XDV A;  4BEH A;  2P6S A;  1VQ6 I;  1P4W A;  1SEU A;  3EYI A;  2X1D A;  5FKM A;  1RI7 A;  3WTY C;  3E5Q A;  3HRS A;  2LD5 A;  1GVD A;  1DUX C;  2LYC A;  2I5U A;  2ZME C;  1VQM I;  1UCR A;  3KP7 A;  5HLI A;  4EQQ A;  3IWZ A;  1V5F A;  3D5S C;  3K7A J;  4OIO F;  5D6E A;  1A5J A;  4EMS A;  2ISY A;  4ETS A;  2XRO A;  1X4O A;  4BBS J;  1ETW A;  2NAZ A;  2ICW G;  1FEX A;  1TP4 A;  2HPM A;  4AID A;  1DPR A;  2GA1 A;  5HDK A;  1R9T J;  2ZBK A;  3ZGK A;  3LFU A;  4ZYH A;  4E7I A;  2VN2 A;  4AYB A;  2GXA A;  5M5Y J;  3DFG A;  1DP7 P;  3NRV A;  3HRU A;  2LRE A;  3VFZ A;  4KIG A;  1MBH A;  1LDK B;  1VQL I;  3ZMZ A;  2KP6 A;  3KP6 A;  1MSE C;  2CUZ A;  4BAY A;  1OCZ H;  4B44 A;  2VXZ A;  1G2H A;  1BN5 A;  2FJ1 A;  1RNL A;  5IYB J;  1XGN A;  4FET A;  1BR1 A;  1G4D A;  2CV1 A;  2Z9O A;  1A6Q A;  1S29 A;  1ZG3 A;  1AWC A;  2R0Q C;  3RIR A;  1JKO C;  1VI0 A;  3OWT A;  3LQR A;  2GQQ A;  2WY8 Q;  4BE2 A;  4CZZ A;  3ABM H;  3BOQ A;  4HF2 A;  2K02 A;  2E7X A;  3V8K A;  3M7G A;  1VQN I;  3K70 C;  2YU9 J;  4ZTJ A;  2RDP A;  4HG2 A;  1B1B A;  2IPQ X;  1W0U A;  1RKT A;  2ZSI B;  4M3D A;  1NK3 P;  1ZKG A;  1S7O A;  2XB0 X;  3I71 A;  3EUH C;  3E5U A;  5E3M A;  1LDJ A;  1LDD A;  4LK0 F;  2RAE A;  2LBF B;  4HF1 A;  2HDD A;  1OLT A;  4BXF A;  2TDX A;  3CES A;  4A3B J;  4YII A;  4JX5 A;  2R7Z J;  3GLX A;  4IX7 A;  4PSW A;  3HOV J;  3MCZ A;  2BBY A;  4XLC A;  1O3S A;  3KP5 A;  2CQN A;  2ZXJ A;  3LA2 A;  3JR9 A;  2VQH A;  2D5V A;  3I58 A;  4FX0 A;  1F9N A;  2EV5 A;  2GOM A;  2HXI A;  3M07 A;  2W24 A;  1G8X A;  2A6T A;  2NXN B;  2XKO A;  1JT6 A;  2WAQ N;  1G3W A;  2Z16 A;  2IS4 A;  4AM3 A;  2R5Y A;  3KP2 A;  2P0W A;  2CSO A;  4RAF A;  3R6S A;  3HRM A;  1IGN A;  3ZMD A;  5D8L B;  1QU3 A;  4H0E A;  2IRF G;  4HSR A;  4I0A A;  1JJ8 C;  1VF9 A;  5L3E A;  4UUT A;  5GAG J;  5J47 A;  5DUI A;  2A5W A;  1IG7 A;  3GTG J;  2X85 A;  2L3D A;  4DIQ A;  1IV6 A;  3V7R A;  1IXC A;  2IBD A;  3OYN A;  3C2G A;  4G6D A;  3HJE A;  3J7A Y;  4JK1 X;  1GHC A;  1IN8 A;  4GYI A;  2RQP A;  3RCO A;  5FLV A;  2I10 A;  4Z2Y A;  2MLG A;  5CPR B;  3HOY J;  1IC8 A;  1YS6 A;  1Y39 A;  2HWV A;  3HSF A;  4A3M J;  1MNE A;  3QPS A;  3PFI A;  4AD9 A;  2RNJ A;  4G6Q A;  1XDU A;  2F48 A;  4B3X A;  3VEP A;  3J81 Z;  4ESF A;  4AIH A;  3OYG A;  1XS9 A;  4HX4 A;  2DFE A;  3OYA A;  3GTM J;  2OZ6 A;  3MMY B;  3OSF A;  4FE4 A;  2B7E A;  3L2Q A;  2JSC A;  1PVE A;  1YLF A;  3F22 A;  5DDG A;  2ESN A;  4P9F A;  3OS0 A;  2ZJQ F;  4PJM A;  4CCL A;  4HLY A;  2BY0 A;  4QLC U;  3BJA A;  2JA8 J;  3GTP J;  1WI3 A;  2JA7 J;  3NWS A;  3GW2 A;  1QGP A;  3B02 A;  3RPQ A;  2HVQ A;  2K85 A;  2VJ5 A;  1YOV B;  5FRN A;  4RDU A;  5HLH A;  2QF7 A;  3P9K A;  4L5E A;  5F0C A;  4JBA A;  4L5J A;  4X6A J;  5JVT A;  2Y0S A;  1YX3 A;  4DYQ A;  2LKX A;  3BQY A;  5DS9 A;  2NNN A;  3QYB A;  3GO5 A;  3I3L A;  1FOW A;  3FM3 A;  4XLE A;  2R93 J;  3EDP A;  3EUK L;  3Q0U A;  1UEL B;  1I6H J;  2DK5 A;  5GPA A;  4A3J J;  1IN5 A;  1P6R A;  4P5O A;  5K1Y A;  1L0O C;  1ZHF A;  1E3O C;  1FJL A;  4C2T A;  4NBQ A;  2BEO A;  3S2H J;  2YPR A;  4U7D A;  2QZ8 A;  2COM A;  3V7S A;  4BJ6 C;  4MNU A;  1I5Z A;  5E1X A;  2BHY A;  2EQR A;  3LOC A;  3NAU A;  2QQB A;  4IQ4 A;  4A6D A;  1RKW A;  2K40 A;  4O5V A;  4PDK A;  1LPQ A;  2CJJ A;  1U5T B;  1G3Y A;  2XF6 A;  4QTR A;  3M3Y J;  3OYC A;  5HNH A;  2R7R A;  5DM7 F;  2EIN H;  1SAN A;  3SFZ A;  2M4K A;  3K0L A;  3BR5 A;  5IPA A;  1LFB A;  3Q5F A;  1JE8 A;  1J7K A;  4D1Q A;  1X4P A;  4WF2 A;  3MWM A;  4HBL A;  1UZC A;  3BP8 A;  3JTG A;  1KQ9 A;  1R58 A;  1X1C A;  3E6B A;  1EV7 A;  4GDF A;  1E17 A;  4PGG A;  1ZR4 A;  2YU3 A;  1RZ4 A;  2Y30 A;  3KLN A;  1UG0 A;  3ELK A;  2VI6 A;  1TTY A;  1YYV A;  3OIO A;  5DD8 A;  4BQQ A;  4GRI A;  4BAC A;  1R1T A;  1QRY A;  3J81 K;  2OJE D;  2P4W A;  2ZCW A;  2GXG A;  4RLQ A;  3LAP A;  2IGM A;  3Q9S A;  4PCQ A;  1TT0 A;  4KIT B;  3OMY A;  2OF7 A;  5BOX A;  2X1E A;  4PSX A;  3FK6 A;  3W6V A;  2KIS A;  2EPF A;  1OCC H;  3BG7 A;  3C1D A;  1MH4 A;  1G6N A;  3D5L A;  1BBY A;  5GP9 A;  3F8C A;  5J8F A;  2XSD C;  2HEO A;  4WK8 F;  2HOE A;  4C9Y A;  5D5X B;  3S1M J;  2V1N A;  4XRS G;  2MG4 A;  3DU6 A;  3HOZ J;  4LIU A;  3IAM 2;  1PP8 F;  3IL2 A;  3CC7 I;  1R1U A;  1MMA A;  1KYZ A;  2HTJ A;  1YI2 I;  3CJR B;  2FMY A;  5K5R A;  4B48 A;  4IHV A;  1ETK A;  3CF2 A;  4WXD A;  2FNP A;  2K7L A;  2KJC A;  2MFZ A;  3DKX A;  2WY7 Q;  2NVX J;  3CP2 A;  1S72 I;  3QPH A;  2GIZ A;  1AA7 A;  1HST A;  2LBF A;  3RPU D;  2FE3 A;  3H92 A;  3IH4 A;  1NK2 P;  4BUP A;  4PGH A;  2IA0 A;  4XOP A;  2HOT A;  3I56 I;  3DQV C;  2JT1 A;  5CVI A;  4N9H A;  4LG3 A;  3PQJ A;  2HZT A;  5F27 A;  2VOD A;  1E0E A;  2HS5 A;  3HOU J;  2NS0 A;  2XPV A;  3KEY A;  4A0Y A;  2LF8 A;  1IRZ A;  2ZFW A;  3GBG A;  4D7M A;  9ANT A;  3SHF A;  2E1C A;  2K86 A;  4HNT A;  2ZKZ A;  4ZYD A;  2FA5 A;  2QKM B;  4AYB N;  4A69 C;  1IXR C;  1HKT A;  5BPI A;  1JUM A;  1ON1 A;  3CMA I;  1U9N A;  3AG3 H;  2LY1 A;  2QKL B;  1H0M A;  1TT5 B;  2ZME B;  5BQT A;  4IOA F;  4KJZ A;  1EKE A;  4U7B A;  1DGW Y;  2M7A A;  2V1X A;  1YW9 A;  1R71 A;  4JOM A;  2DFH A;  5E20 A;  3TO9 A;  3ERE D;  1FBS A;  3L7W A;  4W97 A;  1ZRD A;  4Q5S F;  2EB7 A;  4LK1 F;  3CO7 C;  4HPQ A;  1ODD A;  1MJ9 A;  1IN4 A;  2XAQ A;  3WU0 A;  2Y69 H;  1TLH B;  4NB5 A;  1F4K A;  1RET A;  2FBK A;  2QQA A;  4J19 A;  1ERD A;  1ETO A;  1WCM J;  4MIM A;  3JRG A;  1HXD A;  2VT2 A;  5FKN A;  5E79 C;  2VBW A;  5LRR A;  2EA4 A;  4G7O F;  4TV7 A;  2BVM A;  2DW4 A;  2KIM A;  3K4N A;  5M5W J;  4BY1 J;  2HNH A;  1T0F C;  1RR8 C;  2KRF A;  3FXR A;  2L7F P;  4RMN A;  1YRN B;  1WJ5 A;  2DT5 A;  4YFN F;  2VON A;  5F04 A;  4PFP A;  2CQQ A;  2CFX A;  2O03 A;  3W6K B;  1I1S A;  1BI2 A;  3GME A;  4K2E A;  1VZ0 A;  3AAF A;  1G3S A;  2XGC A;  3TOB A;  2X48 A;  3BWG A;  3DU5 A;  3EYY A;  3G4S I;  2G0E A;  2MSY A;  3UR3 C;  1XMA A;  2DOA A;  2JA6 J;  3E0J B;  5EYR A;  4AVP A;  2UV1 A;  3H5R A;  4LG0 B;  1VQ4 I;  2DO7 A;  2L2O A;  3CCQ I;  2JVG A;  3K1P A;  2VC0 A;  4LIT A;  2DMU A;  2EIM H;  1UST A;  2JK3 A;  3ZPL A;  3MZ8 A;  3SXY A;  3EET A;  1ZRE A;  4OAY A;  1H9T A;  2IS1 A;  1MMG A;  5D6F A;  5JI6 A;  3GTQ J;  3LFK A;  1FNN A;  3ASN H;  2E7W A;  1H8A C;  4CYD A;  2STT A;  1UMQ A;  4IVN A;  1TWC J;  3B6C A;  1FMV A;  5KVR A;  4V19 K;  3VYR B;  4BXX J;  3R4K A;  1D1C A;  5FFX A;  2W48 A;  5LGU A;  4IO9 F;  2PMZ A;  3ZN1 A;  2ZSH B;  2F5V A;  4IOC F;  3K9T A;  2PLY A;  3C7J A;  2IGN A;  1Y8Q B;  4F7Z A;  2HOS A;  1U5T A;  2OBP A;  1T6S A;  1A04 A;  3ABL H;  2X6O A;  2WA0 A;  3P9C A;  2CUJ A;  3G1O A;  1WKM A;  2LH9 A;  2HQ5 A;  3GYH X;  1RC9 A;  3CUO A;  3DWL E;  5BS6 A;  1USS A;  1K83 J;  3LAJ A;  4E7K A;  3FKJ A;  3CJN A;  2EIL H;  3U1D A;  2WAE A;  2Z1D A;  3BG9 A;  3H3Z A;  3KZI C;  1VQ9 I;  4II2 A;  4EM2 A;  2HZD A;  4HW0 A;  4M72 A;  3CCR I;  2ZXH A;  1D1A A;  2E5N A;  2HDW A;  1BOB A;  4NUB A;  4C3J J;  1W36 D;  1K7A A;  4RGR A;  2O8K A;  2ECB A;  2KFD A;  4AVZ A;  3R61 A;  1G59 A;  2QSH X;  5LFA A;  1SD7 A;  1QVU A;  4LIV A;  2QLZ A;  5D4S A;  3DLA A;  5L3D A;  2AS5 F;  5IP6 A;  2E1O A;  5BMZ A;  1FYM A;  4N9I A;  3HOS A;  3GVA A;  4EGZ A;  4XN3 A;  1ZLJ A;  2IP2 A;  2V7F A;  3AG1 H;  3ESW B;  1D0X A;  1IUF A;  4X1E A;  4EEF G;  1IF1 A;  3OV8 A;  2FRH A;  2K9M A;  4JP0 A;  4F3Q A;  3CC2 I;  1FMW A;  4V2G A;  3ZQC A;  2Y0S N;  4M3G A;  2ELH A;  3FXO A;  3L2C A;  1R4M B;  4CYC B;  2CUF A;  4O3M A;  3S16 J;  3VB2 A;  5HLG A;  4I09 A;  4KUM A;  1ORK A;  4Y4R A;  5EF6 A;  2DN0 A;  5J1Y A;  1K6Y A;  1OPC A;  3AFH A;  1ZLK A;  3ZP5 A;  2LMD A;  2ZNZ A;  5AIQ A;  2MD0 A;  4XON A;  2AHQ A;  4AWX B;  2F5D A;  2R5Y B;  1B6A A;  3VDX A;  5HDN A;  5CJ9 A;  4G8X A;  2JSP A;  3CUQ A;  3OYF A;  4UB6 C;  2W00 A;  4MLO A;  1V4R A;  2IGK A;  4G7Z F;  2XV4 S;  4C3H J;  1JHF A;  4BJT A;  2D1V A;  4BY7 J;  4IHW A;  1WWX A;  2H94 A;  3DPT A;  2FML A;  2XB5 A;  3A01 B;  3JRB A;  2D1H A;  2IGO A;  4A3C J;  3PSI A;  2DK8 A;  3SDB A;  1QZE A;  4BE0 A;  1Z67 A;  1K4T A;  3CDL A;  1WQ2 A;  2IA1 A;  4XSZ F;  2E2J J;  1KU7 A;  3W2A A;  3HL2 A;  2QGU A;  3E6D A;  4PUS A;  4DOZ A;  1ZTR A;  2KJB A;  4V2F A;  5B1A H;  2ZB9 A;  3A03 A;  1LFP A;  3WE2 A;  5ILV A;  1YIJ I;  5E3O A;  4Z6Y A;  2GOX B;  3ZQQ A;  3FIW A;  3A1Y A;  3LA7 A;  1OYI A;  2DOF A;  3W3C A;  5DTD A;  2X9D A;  2ZME A;  3G6E I;  2HYG D;  1V5E A;  1MIJ A;  1U6G A;  2DDB A;  5IYC J;  2OC6 A;  5E18 F;  2DPD A;  1WVR A;  5FKK A;  4BQA A;  2O61 A;  1JTX A;  2LOO A;  4XLP F;  3K69 A;  3SDG A;  5C3E J;  4JX6 A;  2VKV A;  3I64 A;  5H2F C;  3CUQ C;  2XAH A;  3BG3 A;  1ETY A;  2CH0 A;  2NS8 A;  4CCJ A;  4LGW A;  1I39 A;  3T0Y A;  2JPB A;  3VOD A;  2H1K A;  3SZP A;  3A0B C;  3PIP F;  4LLL A;  3S8P A;  3CCU I;  1IRG A;  2B9S A;  4BH9 A;  3TBI A;  2RN7 A;  2L9S A;  2KRC A;  3F0C A;  2PEX A;  2RKH A;  3BCA A;  4CH7 A;  4N0B A;  3QP5 A;  3GZ5 A;  5HS9 A;  2QEX I;  1ZK8 A;  1Z3X A;  5E8I A;  2IEK A;  4LLG F;  3L00 A;  3KX2 A;  3KYC B;  1U2W A;  4Y13 A;  2QQ8 A;  5K5O A;  3BT9 A;  3C2H A;  3DEU A;  4I7H A;  2K5C A;  1BR4 A;  4M3F A;  4LG0 A;  3FXQ A;  3ZXS A;  3L9F A;  4HOB A;  1W7P B;  3P9I A;  2P7V B;  5FLX Z;  2EFO A;  1QQI A;  4L9J A;  2BY3 A;  2CRG A;  2FOK A;  5EEG A;  3S14 J;  1D0Z A;  4A93 J;  2L7K A;  1J9I A;  3FBI B;  1B9N A;  3EUH A;  5KAF C;  3I4P A;  2A61 A;  2CS3 A;  1RRJ A;  5EGO A;  2ADU A;  2K9N A;  2EV6 A;  4BDY A;  2R7V A;  3HGY A;  4PJ0 C;  2DMN A;  3MKL A;  4UVB A;  2DA1 A;  4M74 A;  5FRM A;  4R1H A;  3JSP A;  3X2Q H;  3BR2 A;  4Q47 A;  2Z5U A;  3LSM A;  3V7C A;  2XGX A;  4HDU A;  5DUK A;  1LQ1 A;  1HDP A;  2O0Y A;  3L1P A;  1D5Y A;  4RBO A;  3H0D A;  3I54 A;  3CC4 I;  2XAS A;  4IL6 C;  4KN4 X;  3S3M A;  2IVM A;  1R22 A;  1X1B A;  2DI3 A;  2OZU A;  4M6Y A;  3V8J A;  1BI0 A;  2DDA A;  4M6X A;  4CCN A;  2P5K A;  1TWG J;  1J0R A;  5LD2 C;  3H9Q A;  4XK4 A;  4XOT A;  2XVC A;  3QU3 A;  2IT0 A;  5GAH J;  2M87 A;  4OMY A;  1UJ8 A;  5E8G A;  3UKG A;  1IUY A;  1FOK A;  4O6J A;  4M9X A;  2CQX A;  3F72 A;  5FGM A;  2EZL A;  1OFC X;  2OV7 A;  2VJ4 A;  2XSJ C;  3VYT B;  4IZZ A;  3ABU A;  1B9M A;  3SZT A;  1WJE A;  3WG7 H;  1K4S A;  5K7F A;  1TBX A;  1SVM A;  3DEE A;  3TMO A;  5KCM A;  5GAD J;  4MQ9 F;  1OQY A;  3PNV A;  5DM6 F;  2QCO A;  1FSE A;  4WXH A;  3GTJ J;  2BV6 A;  1F1Z A;  2EV0 A;  3LA3 A;  1QHG A;  4D7N A;  2WAF A;  2KL4 A;  2VOO A;  2F4I A;  2IA2 A;  4ZTF A;  1HW2 A;  1I3A A;  2DA5 A;  3DF8 A;  4IKF A;  4FAS D;  5IYD J;  1JKR C;  1JKP C;  4EJW A;  1O3T A;  4NQW A;  2L54 A;  1Z6T A;  2KRH A;  1C0W A;  2P5V A;  3R0A A;  1NG7 A;  3H9G A;  4CYC A;  1AHD P;  1Z91 A;  3ECH A;  2OU2 A;  3CDI A;  4HX7 A;  5FLX K;  2MW8 A;  1R36 A;  2VXD A;  4UXN A;  2K4B A;  3ULQ B;  3GUD A;  1XC5 A;  3T8R A;  2VKD A;  4FCY A;  1IV8 A;  4CCM A;  2ZJP F;  1QA6 A;  3OYH A;  1O7F A;  4HYE A;  5KAI C;  3T5X A;  1Z7L A;  2UWM A;  3R0J A;  3PO3 J;  5EZH A;  2LKS A;  4M9Z A;  3W6J B;  4CDG A;  1T2K A;  4OIR F;  3PUB A;  3WG9 A;  4GCV A;  3BG6 A;  2BY1 A;  3HM5 A;  5B66 C;  1H89 C;  1XX5 A;  1STZ A;  3U1K A;  1YW7 A;  2XRL A;  2DFI A;  1R00 A;  3WTT C;  1CQT A;  4DYR A;  2QVO A;  2A3S A;  2PMZ N;  3W2W A;  3HRT A;  3A02 A;  1LUJ B;  2XAG A;  1A35 A;  3A01 A;  3K4L A;  2VOP A;  3BJ6 A;  3TP0 A;  5F08 A;  1XG1 A;  3LSR A;  3TGN A;  3JRD A;  1ACI A;  1TNS A;  5GPC A;  3ASO H;  4LLN A;  4FHT A;  4XKV A;  4QSH A;  5CLS A;  2DT6 A;  5E17 F;  3FF5 A;  1X58 A;  4I2O A;  2KMU A;  1XCB A;  2W7N A;  5LLQ A;  3PNT A;  1FC3 A;  3EPZ A;  1Y1V J;  3I5U A;  2Q8K A;  3E3V A;  4A5N A;  4B8X A;  4MGR A;  1JGS A;  1Y0U A;  2W1O A;  1JKQ C;  4I98 B;  3Q3S A;  1I50 J;  2BYV E;  3QYE A;  1YIO A;  2L01 A;  1BI1 A;  1BOA A;  1HQC A;  3L2W A;  5DEQ A;  4BU2 A;  1S7E A;  1MBG A;  3Q0W A;  2FU4 A;  2X6X A;  4ZYE A;  4Y7N J;  1AOY A;  1BIB A;  2O6G E;  1V3F A;  2JJ7 A;  4XMY A;  4D5C A;  2F4M B;  3KIO A;  4II3 A;  4YEJ A;  1BW5 A;  1XMK A;  3KLO A;  3HB9 A;  3R60 A;  4BE1 A;  1XSD A;  2P7C B;  2GZW A;  5K7H A;  1HC8 A;  5ED4 A;  2FSW A;  3T1B A;  1Y6I A;  4E7L A;  3BZK A;  4UV9 A;  1D8K A;  2Y31 A;  3CQZ J;  4ENM A;  2JA5 J;  1ON2 A;  1WFX A;  3BTI A;  4KIF A;  3DBL B;  3RKY A;  3J7Y J;  1NTC A;  1NHA A;  2EIJ H;  2O9L A;  1ENH A;  1KZH A;  3ZQ7 A;  2EIK H;  3CZ6 A;  3LWF A;  5CVU A;  2Q2E B;  3H5A A;  3L09 A;  1MBE A;  2M9H A;  1QBJ A;  1NH3 A;  2FD5 A;  2VJJ A;  1IJW C;  3OS1 A;  5DYM A;  4ESJ A;  3WOD F;  3OYM A;  4RAZ A;  2EFP A;  4F92 B;  2BVL A;  2QQ9 A;  1WZ2 A;  3K1N A;  3KYD B;  6PAX A;  5J4Y A;  1SFK A;  3RSN A;  3U2R A;  4R8H A;  1TW3 A;  1X1D A;  4EJU A;  3CO6 C;  1ETV A;  2V9V A;  3KEO A;  2R7U A;  5IY5 H;  2FEZ A;  1TC3 C;  1U9O A;  5L3G A;  3F8M A;  3REO A;  1W7P A;  1W36 C;  3OYD A;  1B59 A;  3PIO F;  3K2Z A;  2K9S A;  2R3S A;  2JN6 A;  4EM1 A;  2J5O A;  2P6T A;  1VFC A;  2PN6 A;  4A3K J;  2GA2 A;  2R7O A;  2HQN A;  3IWF A;  3I4M J;  4DZP A;  3WU2 C;  5BPD A;  3CP8 A;  3RI4 A;  3P5J A;  4RLF A;  4HRI A;  4IPA A;  1WH7 A;  1HCR A;  2CU7 A;  1R5H A;  4DNC A;  4YIR X;  5AON A;  1R5I D;  3CLO A;  4I99 C;  5LRS A;  4YRV A;  1I6X A;  5HVQ C;  5K7Z A;  1G3T A;  3LSI A;  3TKY A;  2MC3 A;  5ICC A;  2DQL A;  4I02 A;  3M1E A;  2Y2Z A;  4AIJ A;  3M1C A;  3SEQ A;  1ULY A;  1OR7 A;  4XN0 A;  3HUG B;  1J59 A;  2AQF A;  1Z6R A;  2VBY A;  3HTS B;  1FOY A;  1T08 B;  1YS7 A;  1SMT A;  1HW5 A;  4AC0 A;  4IRH A;  2X6W A;  1E3P A;  4KFC A;  3WU1 B;  3OIP A;  4HV5 A;  5CVV A;  3HKZ A;  2DTR A;  2VPR A;  1K78 A;  1XGM A;  1BL0 A;  3GTO J;  4IRI A;  4HDV A;  4OAZ A;  1RUO A;  2CQK A;  3IHU A;  4KIB A;  1Z05 A;  2M34 A;  1TZL A;  1JJ6 C;  2HFH A;  2DFF A;  3P7N A;  2M30 A;  3ROU A;  3VSL A;  5FLM J;  3VWB A;  1D1B A;  2Y9Z A;  2VPL A;  2BOL A;  3CUQ B;  3OY9 A;  1XGS A;  4CO8 A;  4EM0 B;  3MAJ A;  3GLL A;  3FXL A;  4RAG A;  3ERM A;  2OA4 A;  4ZH4 F;  3SZG A;  5C4X J;  3H36 A;  2HXO A;  1YJN I;  1D0Y A;  3FXJ A;  4UVC A;  4KNY A;  3QOE A;  3H9J A;  3QPL A;  5E3N A;  2H27 A;  1P2F A;  4MEY F;  1FY7 A;  2JRT A;  1T0F A;  3LSK A;  2O8X A;  2HDC A;  1QZY A;  1HKQ A;  4S05 A;  3HHH A;  2VC1 A;  4RB1 A;  1YFH A;  3WTU C;  3I0T A;  4HQE A;  1OR7 C;  2UZK A;  4EGY A;  3Q9V A;  4RGS A;  1GLN A;  4BDZ A;  1FWZ A;  2C6Y A;  1P7J A;  2XC7 A;  4M3B A;  2VUM J;  3BJO A;  2W57 A;  1KQ8 A;  2A6H F;  3J7A O;  1JI8 A;  2G9W A;  5DCM A;  2LG4 A;  4ENK A;  4EV0 A;  1ZRF A;  2FBH A;  1HSJ A;  3K70 D;  2DXI A;  3KZZ A;  2LFB A;  3ZMT A;  1ZYR F;  2DOD A;  1ZR2 A;  1MJB A;  1YQA A;  3M9A A;  5E3L A;  3G3Z A;  2MD5 A;  4EJV A;  4LMY A;  3OOU A;  1XMX A;  1VQK I;  5JR3 A;  5BNG A;  2BZT A;  5F0F A;  1N78 A;  3D5R C;  4EJT A;  1K79 A;  1QPI A;  3I59 B;  3BRO A;  2NS7 A;  3HPG A;  2Y9Y A;  1P7I A;  5L3B A;  5LEJ A;  4WXC A;  4NC6 A;  1Y8R B;  3PM1 A;  3TED A;  2ID3 A;  1VND A;  1SFX A;  3VYS B;  3AG2 H;  3ZQI A;  1YW8 A;  4UUS A;  1REP C;  2V26 A;  3RKW A;  4BKX A;  1ZN2 A;  4FQG A;  3COA C;  1R1V A;  3S1R J;  4Y52 J;  4IXA A;  1AKH A;  2F4O B;  2LP0 A;  1BC7 C;  4KT5 C;  4XNF A;  5D8K B;  1FLI A;  3ZN0 A;  2B63 J;  5C4J J;  1ZG5 A;  1VQP I;  2IJL A;  4IEJ A;  4BS9 A;  1OJL A;  3F6V A;  2XGE A;  2JZY A;  3IH2 A;  2BE5 F;  2HYJ A;  3FHN A;  5F1R A;  1GV2 A;  2MAB A;  2EA2 A;  1ZRC A;  2V9P A;  3F9K A;  4ZDP A;  1ONV A;  2GAU A;  2R7Q A;  4ABZ A;  5J40 A;  3G71 I;  4IHS A;  1ZGJ A;  3G2B A;  1WJB A;  1T8I A;  1MND A;  4U88 A;  2JA2 A;  5F64 A;  2DA2 A;  4BJ5 C;  3BPV A;  2LK2 A;  2MGQ A;  2ME0 A;  2VJI A;  3O6B B;  3OSG A;  2BGC A;  2L4M A;  4P9U A;  3F6O A;  2UUZ A;  5LHH A;  2Q2E A;  1UHS A;  1YJW I;  3MQ0 A;  1ZH5 A;  3RZO J;  1R4N B;  1APL C;  2R7X A;  5DV5 A;  1HKS A;  2VQG A;  3OL4 A;  5EGO B;  1JGG A;  4MTE A;  5HDG A;  4XKC A;  2ISZ A;  1LJ9 A;  3S1N J;  3ZQF A;  1LEA A;  2EZI A;  3DTI A;  5M3M J;  4XLH A;  5D5V B;  3U9G A;  1BJZ A;  3NQO A;  4WWC A;  1ETX A;  1JT0 A;  3ZQL A;  2GXB A;  5TIS C;  3PQK A;  2IXS A;  2RQQ A;  3MKZ A;  3N97 A;  3VSK A;  1PUF A;  1SVL A;  2HKO A;  2PX9 A;  3OR2 C;  3LNQ A;  1IRX A;  3TO6 A;  4RGU A;  2NOG A;  2W85 A;  3CF5 F;  2XUB A;  3L2U A;  3TW6 A;  3S1Q J;  1XDS A;  1IRF A;  5LEK A;  1BW6 A;  1R5G A;  1UFM A;  4CA0 A;  3L2R A;  3F8F A;  5IOZ A;  3HBL A;  3KE2 A;  2L0K A;  2WWY A;  3HYI A;  5HS8 A;  2DMP A;  1SMY F;  4U0Y A;  3HGG A;  4QPQ A;  3ZMU A;  1XTA A;  1DQU A;  3FX3 A;  2RC4 A;  5D4R A;  4XLA A;  3WE3 A;  1A31 A;  4HQM A;  1JTY A;  1WJC A;  4CCK A;  3QQA A;  5J4V A;  4A3D J;  2ZNY A;  4C2U A;  3D0S A;  4N4N B;  1HLV A;  3H0G J;  5JLX A;  2R5Z B;  1D8J A;  1OCT C;  4KIC A;  2D2W A;  1T98 A;  4DZJ A;  1O3Q A;  1R6R A;  2OPT A;  4D5F A;  3F23 A;  2HOA A;  1XB4 A;  1XSV A;  4ASN A;  2EBI A;  2NVY J;  3TO7 A;  1OYW A;  4KT6 A;  3DKW A;  1BJA A;  2EZK A;  3HUG A;  3QWL A;  2D45 A;  3CCY A;  2YSR A;  3GEZ A;  1IW7 F;  3PL8 A;  4XSX F;  4BQO A;  2JUC A;  4NQW B;  1JUS A;  2OCC H;  2P81 A;  2F2E A;  1LKX A;  2PQ8 A;  2OAZ A;  2DA6 A;  2K3P A;  3RYR A;  4J01 A;  3BCB A;  2ZXW H;  2Z3Y A;  4RGX A;  3UNG C;  2H1L A;  2UXX A;  2WBM A;  3CCM I;  4M73 A;  2O5R A;  3LMM A;  5F6F A;  1PP7 U;  2WB1 A;  3H1C A;  3ML6 A;  3OR1 C;  4XR6 A;  4ANJ A;  2CW0 F;  2R92 J;  2LKP A;  3PFY A;  3S17 J;  4ENJ A;  2L9V A;  4D0P A;  5AIP A;  3FWE A;  2FXA A;  2QBY B;  2CW8 A;  4HF0 A;  4RM2 A;  4CGZ A;  2E60 A;  1FYK A;  1E3H A;  3CLQ A;  3LQQ A;  3N05 A;  3SEZ A;  2STW A;  4ITV A;  5ILS A;  3J7Z I;  3LL7 A;  1FTZ A;  4GFB A;  2KHM A;  2KT0 A;  3BLY A;  3DLL F;  1RUN A;  4OOI A;  1T56 A;  5J3L A;  5IP7 J;  2E35 A;  2CGP A;  1X2M A;  2V1U A; 
#chains in the Genus database with same CATH homology
 2ZJ2 A;  5CVJ A;  2G7H A;  2QM3 A;  4GGG A;  2O3F A;  2OD5 A;  4LB6 B;  2ESH A;  1ZGA A;  1K6O A;  5FO5 A;  5FFZ A;  3GFM A;  2MA3 A;  5IT9 Z;  2PJP A;  3HSE A;  1BM9 A;  1PDN C;  3ABT A;  3WGI A;  3TOA A;  3I59 A;  3EQL F;  2W25 A;  3SQN A;  4G9Y A;  1P4A A;  2YX7 A;  1FBU A;  1IXS B;  2E1N A;  2QEN A;  4BNC A;  3DPL C;  3F3X A;  5LHG A;  1OYY A;  5ILU A;  4IF4 A;  2DAO A;  2ZO4 A;  4LB5 A;  1R7J A;  2H6B A;  3WTV C;  3F8B A;  1RIO H;  1GXQ A;  5A2Q Z;  2Y75 A;  1LEB A;  3H3U A;  2H6C A;  3B73 A;  2Y48 A;  3RPU A;  4BYY A;  2MH2 A;  1LVA A;  2DQR A;  4U0W A;  1XN7 A;  1BC8 C;  3JW4 A;  1TNT A;  4Q48 A;  2RVC A;  4MQV A;  1O3R A;  3F21 A;  2HR3 A;  4YFK F;  3G73 A;  2EFN A;  4L5I A;  1UHM A;  5H20 A;  1ZAO A;  2PG4 A;  2XRN A;  5D5U B;  4EVI A;  1I27 A;  3CTA A;  5IT9 K;  3RYP A;  1KU9 A;  2FF4 A;  3WGH A;  5J6X A;  4Y15 A;  4FX4 A;  2PBI A;  2KIU A;  1MJA A;  3GWZ A;  2HGC A;  5LBQ A;  3TQN A;  1FYL A;  3HIF A;  2VBX A;  1CF7 B;  1YO5 C;  2QUF A;  2W84 A;  1K78 B;  3BZ6 A;  2GWR A;  1U8R A;  4M71 A;  1LB2 A;  3FMR A;  2ETH A;  3DP7 A;  2HTS A;  2YR2 A;  1ZG1 A;  5A2Q K;  3IRQ A;  1OKR A;  4DQ2 A;  3MZY A;  2WTE A;  5ICF A;  4AIK A;  2Q0O A;  4Q4Z F;  1TQM A;  1T38 A;  4BHB A;  2UXN A;  4MHG A;  3E6C C;  2JPC A;  1FBQ A;  3RDI A;  1KGS A;  2G7U A;  4OU0 A;  1B4A A;  3IC7 A;  2F5E A;  2XHK A;  5DCM B;  2QBY A;  2PFB A;  4RS8 A;  4Y17 A;  4ZZL A;  3GXO A;  5E1Z B;  4RB2 C;  1UB9 A;  4WX9 A;  4A2U A;  4XLN F;  3OOP A;  3KET A;  2CO5 A;  5LHI A;  2Z99 A;  4R79 A;  3CDH A;  3O2P E;  4YIF A;  3E6M A;  2DPU A;  4KYW A;  4HA8 A;  4OIN F;  4IHT A;  2LF7 A;  3RKX A;  3QU6 A;  3LST A;  1HW1 A;  1KA8 A;  3GFJ A;  3BY6 A;  2QWW A;  1MKM A;  4UVA A;  2CG4 A;  1L3L A;  4PZJ A;  3WTS C;  3KZY A;  1F5T A;  2CYY A;  2NNY A;  1W4M A;  1MZB A;  3VOE A;  1Z9C A;  1DDN A;  3QRF F;  1FSH A;  5FD5 A;  2IW5 A;  1UHW A;  4P96 A;  2Z33 A;  3F8N A;  3DV8 A;  2FBI A;  2NYX A;  1J75 A;  1PUE E;  3WTX C;  2A68 F;  2EFW A;  1QPM A;  2AXL A;  3GX4 X;  4BXU A;  2LDU A;  3KP3 A;  2F5F A;  2R7F A;  2Y0M A;  2A69 F;  4XRF A;  4E70 A;  4KN7 X;  3O3K A;  4WCG A;  2DU9 A;  4FT8 A;  1LNW A;  1SD6 A;  5H6R A;  2VE9 A;  1KU2 A;  1IAW A;  1MD0 A;  5E1W A;  1WSU A;  4L9T A;  3KEQ A;  5FD6 A;  3TDU C;  1KQ0 A;  3BPX A;  2HQR A;  1S7A A;  2EJR A;  2VE8 A;  5K5Q A;  5FB2 A;  4IJA A;  2LSO A;  3FZV A;  3GFL A;  3JSO A;  2PMU A;  3N4M A;  3V8L A;  1Z1D A;  1T39 A;  3ECO A;  4QWQ A;  4YG2 F;  1JXS A;  1P4X A;  1EH6 A;  3C3W A;  5D5W B;  3GF2 A;  1CF7 A;  4L0Y B;  2KIF A;  5HOO A;  4UUV A;  4JQF A;  4MEX F;  3IRR A;  2K27 A;  1XCV A;  3JAM Z;  4HAM A;  1KU3 A;  5IT3 A;  4YFX F;  2DLL A;  1VTN C;  1QNT A;  3T8T A;  5TRD A;  2KKO A;  3HOT A;  1MDM B;  3HTU A;  2F5C A;  2PI0 A;  5DD4 A;  2WV0 A;  1TQI A;  4MTD A;  4LJZ F;  5EEH A;  1QO0 D;  3S2W A;  4HZF A;  3M8F A;  5HS7 A;  2P8T A;  2MLK A;  5J8C A;  1JHH A;  3ZMV A;  1MGT A;  4RB0 A;  3IKT A;  2M1B A;  1FX7 A;  1ZAR A;  2YX4 A;  1U3E M;  1X3U A;  2PMH A;  4M9S A;  2X0L A;  2OQG A;  3NEU A;  2V6C A;  4GYG A;  5KK1 A;  3J80 Z;  2DBB A;  3HSR A;  1SD4 A;  2X4H A;  2EFQ A;  4IRG A;  1IN7 A;  2HYF A;  4BHC A;  3KFW X;  2XAF A;  5ERI A;  4OIQ F;  4OIP F;  1O57 A;  3JAM K;  4KMU X;  4CXF A;  1Q1H A;  3RTR A;  1WRJ A;  1SAX A;  1J5Y A;  2FQ3 A;  3V4G A;  4UV8 A;  1FPQ A;  2RGV A;  1FZP B;  1XGO A;  3MFK A;  2R7D A;  2A6E F;  2RV8 A;  4P55 A;  2WC2 A;  2GIV A;  3FM5 A;  4GXO A;  1SD5 A;  2JTV A;  1S6L A;  2OQR A;  2M45 A;  3I53 A;  3M8E A;  3GFI A;  3E5X A;  4KA4 A;  1OMI A;  3TDZ C;  4A6E A;  3J80 K;  1FP1 D;  2B0L A;  3WTZ A;  5TJJ A;  4HV6 A;  3KP4 A;  2M5W A;  2L4A A;  4UHT A;  1GXP A;  1BIA A;  1TW2 A;  4LD5 A;  1SFU A;  5L3F A;  1W5T A;  5L3C A;  1FP2 A;  4L9V A;  4L0Z B;  3FMS A;  5LGN A;  4RB3 C;  2XAJ A;  1HBX G;  1E2X A;  4UNO A;  3GZ6 A;  4NHJ A;  2MBF A;  1S8N A;  1GVJ A;  4A0Z A;  4BHP A;  2XIG A;  2VBZ A;  3QP6 A;  4KDP A;  3DXJ F;  5JFR A;  3ZMS A;  2LNB A;  4KMF A;  3RJP A;  4ZZD A;  4A5M A;  4ZYG A;  3ISP A;  1P92 A;  4HX8 A;  3BDD A;  1YTY A;  4G7H F;  3QPT A;  2J5P A;  5ICG A;  2EWN A;  1XSX A;  4HLX A;  1U5T C;  4OMZ A;  4CHU A;  1EH7 A;  4A12 A;  2MH9 A;  2FNA A;  1MDM A;  1XD7 A;  3WTW C;  3K1M A;  2QYO A;  3MEX A;  3JTH A;  3E97 A;  1TQP A;  1YG2 A;  5JHU A;  1D3Y A;  3FMQ A;  4ON0 A;  4LFU A;  1D5V A;  2XKP A;  1IN6 A;  1EH8 A;  1W7P D;  4L18 B;  5CVR A;  5LGT A;  1QZZ A;  3WGG A;  4A0X A;  3FHZ A;  2HKX A;  4XBF A;  2A5Y B;  1W5S A;  2L02 A;  2P5L C;  4I0B A;  4L9N A;  1KYW A;  5H6Q A;  4CIC A;  1WI9 A;  1FT9 A;  3FXU A;  2V1D A;  3QOP A;  1DPU A;  4I01 A;  1J2X A;  2K4J A;  1Z7U A;  1I1G A;  2EK5 A;  4G94 A;  4U0V A;  1S3J A;  3QAH A;  4B09 A;  4EJO A;  4ENN A;  4RAY A;  3MZH A;  1SFE A;  2CWE A;  1U78 A;  5CYV A;  4ESB A;  3IKV A;  2A07 F;  2H09 A;  2M8E A;  1BI3 A;  3KCC A;  1IZ1 A;  4GO1 A;  5DCF A;  1H9G A;  2ACJ A;  2NRA C;  3HHG A;  4S04 A;  2V79 A;  2VT3 A;  1CGP A;  1O7L A;  3C18 A;  1R23 A;  5ICE A;  2P6S A;  1P4W A;  3EYI A;  1RI7 A;  3WTY C;  3E5Q A;  3HRS A;  1DUX C;  1UCR A;  3KP7 A;  5HLI A;  4EQQ A;  3IWZ A;  4OIO F;  5D6E A;  4EMS A;  2ISY A;  4ETS A;  2XRO A;  2NAZ A;  1DPR A;  2GA1 A;  5HDK A;  2ZBK A;  4ZYH A;  2VN2 A;  3DFG A;  1DP7 P;  3NRV A;  3HRU A;  3VFZ A;  4KIG A;  1LDK B;  3ZMZ A;  3KP6 A;  4BAY A;  2VXZ A;  1BN5 A;  1RNL A;  1XGN A;  1G4D A;  2Z9O A;  1S29 A;  1ZG3 A;  1AWC A;  3RIR A;  3LQR A;  2GQQ A;  4CZZ A;  3BOQ A;  4HF2 A;  2K02 A;  2E7X A;  3V8K A;  3M7G A;  2RDP A;  1B1B A;  2IPQ X;  1S7O A;  3I71 A;  3E5U A;  1LDJ A;  1LDD A;  4LK0 F;  4HF1 A;  2TDX A;  4YII A;  3GLX A;  3MCZ A;  2BBY A;  1O3S A;  3KP5 A;  2ZXJ A;  3LA2 A;  3I58 A;  4FX0 A;  1F9N A;  2EV5 A;  2W24 A;  2XKO A;  1G3W A;  3KP2 A;  2CSO A;  3R6S A;  3HRM A;  3ZMD A;  5D8L B;  4H0E A;  2IRF G;  4I0A A;  5L3E A;  5DUI A;  2L3D A;  3V7R A;  1IXC A;  4G6D A;  4JK1 X;  1GHC A;  1IN8 A;  4GYI A;  2RQP A;  4Z2Y A;  2MLG A;  1YS6 A;  2HWV A;  3HSF A;  3PFI A;  4AD9 A;  2RNJ A;  4G6Q A;  1XDU A;  3VEP A;  3J81 Z;  4ESF A;  4AIH A;  4HX4 A;  2OZ6 A;  2JSC A;  1YLF A;  3F22 A;  5DDG A;  2ESN A;  4P9F A;  4HLY A;  4QLC U;  3BJA A;  3GW2 A;  1QGP A;  3B02 A;  3RPQ A;  5HLH A;  3P9K A;  4JBA A;  4L5J A;  5JVT A;  2NNN A;  3GO5 A;  3FM3 A;  3EDP A;  2DK5 A;  1IN5 A;  1P6R A;  4P5O A;  5K1Y A;  1L0O C;  1ZHF A;  2BEO A;  2YPR A;  4U7D A;  2QZ8 A;  2COM A;  3V7S A;  4MNU A;  1I5Z A;  5E1X A;  2QQB A;  4A6D A;  4O5V A;  4PDK A;  1U5T B;  1G3Y A;  3SFZ A;  3Q5F A;  3K0L A;  1JE8 A;  1J7K A;  4WF2 A;  3MWM A;  4HBL A;  3BP8 A;  3JTG A;  1KQ9 A;  1R58 A;  3E6B A;  1EV7 A;  1E17 A;  4PGG A;  2YU3 A;  1RZ4 A;  3KLN A;  3ELK A;  1TTY A;  1YYV A;  5DD8 A;  1R1T A;  3J81 K;  2P4W A;  2ZCW A;  2GXG A;  3LAP A;  3Q9S A;  4PCQ A;  5BOX A;  3C1D A;  3D5L A;  1G6N A;  1BBY A;  5J8F A;  3F8C A;  2HEO A;  4WK8 F;  2HOE A;  5D5X B;  1PP8 F;  3IL2 A;  1R1U A;  2HTJ A;  1KYZ A;  2FMY A;  5K5R A;  4WXD A;  2FNP A;  2K7L A;  2KJC A;  3QPH A;  1HST A;  2FE3 A;  3H92 A;  4PGH A;  2IA0 A;  3DQV C;  2JT1 A;  5CVI A;  4N9H A;  3PQJ A;  2HZT A;  2VOD A;  2HS5 A;  2NS0 A;  4A0Y A;  2LF8 A;  2ZFW A;  3SHF A;  2E1C A;  2K86 A;  2ZKZ A;  4ZYD A;  2FA5 A;  1IXR C;  1HKT A;  5BPI A;  1ON1 A;  1H0M A;  2ZME B;  5BQT A;  4U7B A;  2V1X A;  1YW9 A;  5E20 A;  3TO9 A;  3ERE D;  1FBS A;  3L7W A;  1ZRD A;  4Q5S F;  2EB7 A;  4LK1 F;  3CO7 C;  1ODD A;  1MJ9 A;  1IN4 A;  2XAQ A;  3WU0 A;  1TLH B;  4NB5 A;  1F4K A;  2FBK A;  2QQA A;  1HXD A;  2VT2 A;  2VBW A;  5LRR A;  2EA4 A;  4G7O F;  4TV7 A;  2DW4 A;  2KIM A;  2KRF A;  3FXR A;  2VON A;  2DT5 A;  4YFN F;  2CFX A;  2O03 A;  3W6K B;  1I1S A;  1BI2 A;  4K2E A;  3AAF A;  1G3S A;  3TOB A;  3BWG A;  3EYY A;  1XMA A;  4AVP A;  4LG0 B;  2DO7 A;  3K1P A;  2VC0 A;  1UST A;  3ZPL A;  3SXY A;  3EET A;  1ZRE A;  1H9T A;  5D6F A;  5JI6 A;  3LFK A;  1FNN A;  2E7W A;  4CYD A;  2STT A;  4IVN A;  5KVR A;  3R4K A;  5FFX A;  5LGU A;  3ZN1 A;  3K9T A;  2PLY A;  3C7J A;  4F7Z A;  1U5T A;  2OBP A;  1T6S A;  1A04 A;  3P9C A;  1WKM A;  3GYH X;  3CUO A;  5BS6 A;  1USS A;  3LAJ A;  3CJN A;  3U1D A;  3H3Z A;  4EM2 A;  4HW0 A;  4M72 A;  1K7A A;  4RGR A;  3R61 A;  1SD7 A;  2QLZ A;  5D4S A;  5L3D A;  2AS5 F;  5BMZ A;  1FYM A;  4N9I A;  3HOS A;  3GVA A;  4EGZ A;  1ZLJ A;  2IP2 A;  1IF1 A;  3OV8 A;  2FRH A;  2ELH A;  3L2C A;  4O3M A;  3VB2 A;  5HLG A;  4I09 A;  4KUM A;  1OPC A;  1ZLK A;  3ZP5 A;  2ZNZ A;  5AIQ A;  4AWX B;  2F5D A;  1B6A A;  5HDN A;  5CJ9 A;  4G8X A;  3CUQ A;  1V4R A;  4G7Z F;  2XV4 S;  1JHF A;  2D1V A;  1WWX A;  2H94 A;  3DPT A;  2FML A;  2D1H A;  2DK8 A;  1WQ2 A;  2IA1 A;  4XSZ F;  1KU7 A;  3E6D A;  2KJB A;  3WE2 A;  5ILV A;  3LA7 A;  1OYI A;  2ZME A;  2HYG D;  1U6G A;  5E18 F;  2DPD A;  4BQA A;  2O61 A;  4XLP F;  3K69 A;  3I64 A;  3CUQ C;  2XAH A;  4LGW A;  3T0Y A;  2JPB A;  3VOD A;  3SZP A;  4LLL A;  1IRG A;  4BH9 A;  2RN7 A;  2PEX A;  2RKH A;  4N0B A;  3QP5 A;  3GZ5 A;  5HS9 A;  5E8I A;  4LLG F;  3L00 A;  1U2W A;  4Y13 A;  5K5O A;  3DEU A;  4I7H A;  4LG0 A;  3FXQ A;  3L9F A;  4HOB A;  1W7P B;  3P9I A;  2P7V B;  5FLX Z;  2EFO A;  1QQI A;  4L9J A;  2FOK A;  5EEG A;  1J9I A;  1B9N A;  3EUH A;  3I4P A;  2A61 A;  2ADU A;  2EV6 A;  4UVB A;  4M74 A;  4R1H A;  3JSP A;  4Q47 A;  2Z5U A;  3V7C A;  2XGX A;  4HDU A;  5DUK A;  1LQ1 A;  2O0Y A;  3I54 A;  2XAS A;  4KN4 X;  2IVM A;  1R22 A;  2OZU A;  2DI3 A;  4M6Y A;  3V8J A;  1BI0 A;  4M6X A;  2P5K A;  1J0R A;  2XVC A;  3QU3 A;  2IT0 A;  2M87 A;  4OMY A;  5E8G A;  1IUY A;  1FOK A;  4O6J A;  4M9X A;  3F72 A;  5FGM A;  3ABU A;  1B9M A;  3SZT A;  1TBX A;  4MQ9 F;  1FSE A;  4WXH A;  2BV6 A;  1F1Z A;  2EV0 A;  3LA3 A;  2VOO A;  2IA2 A;  1HW2 A;  3DF8 A;  4EJW A;  1O3T A;  4NQW A;  2L54 A;  1Z6T A;  1C0W A;  2P5V A;  3R0A A;  1Z91 A;  3ECH A;  2OU2 A;  4HX7 A;  5FLX K;  1R36 A;  4UXN A;  2K4B A;  3ULQ B;  3GUD A;  3T8R A;  1O7F A;  4HYE A;  3T5X A;  2UWM A;  3R0J A;  4CDG A;  4M9Z A;  3W6J B;  1T2K A;  4OIR F;  3WG9 A;  4GCV A;  1STZ A;  1YW7 A;  2DFI A;  1R00 A;  3WTT C;  2QVO A;  2A3S A;  3HRT A;  2XAG A;  2VOP A;  3BJ6 A;  3TGN A;  1TNS A;  4LLN A;  4FHT A;  5CLS A;  5E17 F;  3FF5 A;  4I2O A;  1XCB A;  5LLQ A;  1FC3 A;  2Q8K A;  3I5U A;  4A5N A;  3E3V A;  4B8X A;  4MGR A;  1JGS A;  1Y0U A;  4I98 B;  2BYV E;  1YIO A;  2L01 A;  1BI1 A;  1BOA A;  1HQC A;  5DEQ A;  2FU4 A;  4ZYE A;  1AOY A;  1BIB A;  2O6G E;  1V3F A;  1XMK A;  3KLO A;  3R60 A;  1XSD A;  2P7C B;  2GZW A;  5ED4 A;  2FSW A;  3T1B A;  4UV9 A;  1D8K A;  4ENM A;  1ON2 A;  4KIF A;  3RKY A;  1NHA A;  3ZQ7 A;  3LWF A;  5CVU A;  3L09 A;  1QBJ A;  5DYM A;  4ESJ A;  3WOD F;  4RAZ A;  2EFP A;  2QQ9 A;  3K1N A;  6PAX A;  3U2R A;  4R8H A;  1TW3 A;  4EJU A;  3CO6 C;  2V9V A;  3KEO A;  2FEZ A;  5L3G A;  3F8M A;  3REO A;  1W7P A;  1B59 A;  3K2Z A;  2R3S A;  4EM1 A;  2J5O A;  2P6T A;  2PN6 A;  2GA2 A;  2HQN A;  3IWF A;  5BPD A;  3RI4 A;  4IPA A;  1R5H A;  4DNC A;  5AON A;  5LRS A;  3CLO A;  1I6X A;  5HVQ C;  1G3T A;  3TKY A;  2MC3 A;  5ICC A;  2DQL A;  4I02 A;  3M1E A;  4AIJ A;  1ULY A;  1OR7 A;  1J59 A;  1Z6R A;  2VBY A;  3HTS B;  1YS7 A;  1SMT A;  1HW5 A;  4IRH A;  4KFC A;  3WU1 B;  4HV5 A;  5CVV A;  2DTR A;  1K78 A;  1XGM A;  4IRI A;  4HDV A;  1RUO A;  2CQK A;  3IHU A;  4KIB A;  1Z05 A;  2HFH A;  3P7N A;  2M30 A;  3ROU A;  3CUQ B;  1XGS A;  4CO8 A;  4EM0 B;  3MAJ A;  2OA4 A;  4ZH4 F;  4UVC A;  4KNY A;  2H27 A;  1P2F A;  4MEY F;  1FY7 A;  2JRT A;  1T0F A;  2O8X A;  2HDC A;  1QZY A;  1HKQ A;  4S05 A;  3HHH A;  2VC1 A;  4RB1 A;  1YFH A;  3WTU C;  3I0T A;  4HQE A;  2UZK A;  4EGY A;  3Q9V A;  4RGS A;  1FWZ A;  2C6Y A;  3BJO A;  2W57 A;  1KQ8 A;  2A6H F;  3J7A O;  2G9W A;  5DCM A;  4ENK A;  4EV0 A;  1ZRF A;  2FBH A;  1HSJ A;  3KZZ A;  3ZMT A;  1ZYR F;  1MJB A;  1YQA A;  3M9A A;  3G3Z A;  2MD5 A;  4EJV A;  4LMY A;  5JR3 A;  4EJT A;  1K79 A;  3I59 B;  3BRO A;  5L3B A;  5LEJ A;  4WXC A;  1SFX A;  1YW8 A;  1REP C;  3RKW A;  1ZN2 A;  3COA C;  1R1V A;  4IXA A;  1BC7 C;  4KT5 C;  5D8K B;  1FLI A;  3ZN0 A;  1ZG5 A;  2IJL A;  3F6V A;  2JZY A;  2BE5 F;  5F1R A;  1ZRC A;  2EA2 A;  1ONV A;  2GAU A;  4IHS A;  1ZGJ A;  4U88 A;  5F64 A;  3BPV A;  3O6B B;  2BGC A;  2L4M A;  4P9U A;  3F6O A;  5LHH A;  2Q2E A;  1ZH5 A;  3MQ0 A;  5DV5 A;  1HKS A;  4MTE A;  5HDG A;  2ISZ A;  1LJ9 A;  1LEA A;  5D5V B;  3U9G A;  3NQO A;  4WWC A;  2GXB A;  3PQK A;  3N97 A;  2HKO A;  3TO6 A;  4RGU A;  2W85 A;  2XUB A;  1XDS A;  1IRF A;  5LEK A;  1R5G A;  1UFM A;  3F8F A;  3KE2 A;  2WWY A;  3HYI A;  4U0Y A;  5HS8 A;  1SMY F;  3ZMU A;  3FX3 A;  2RC4 A;  5D4R A;  3WE3 A;  4HQM A;  2ZNY A;  3D0S A;  1D8J A;  4KIC A;  2D2W A;  1T98 A;  1O3Q A;  3F23 A;  1XB4 A;  1XSV A;  4ASN A;  3TO7 A;  1OYW A;  3DKW A;  1BJA A;  3HUG A;  2D45 A;  3GEZ A;  2YSR A;  1IW7 F;  4XSX F;  2F2E A;  2PQ8 A;  2OAZ A;  3RYR A;  2Z3Y A;  4RGX A;  2UXX A;  4M73 A;  5F6F A;  1PP7 U;  3ML6 A;  2CW0 F;  2LKP A;  4ENJ A;  4D0P A;  5AIP A;  3FWE A;  2FXA A;  2QBY B;  4HF0 A;  4CGZ A;  1FYK A;  3LQQ A;  2STW A;  5ILS A;  1RUN A;  4OOI A;  2CGP A;  2V1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...