1XN7A

Solution structure of e.coli protein yhgg: the northeast structural genomics consortium target et95
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGSCKSCPEGKACLREWWALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yhgG
publication title Solution Structure of E.Coli Protein yhgG: The Northeast Structural Genomics Consortium Target ET95
rcsb
source organism Escherichia coli
total genus 13
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xn7A00
3HSRA 1IN8A 2M8EA 4HV5A 1YQAA 4EVIA 1O3QA 2P6TA 3HIFA 1JE8A 3K1NA 3VB2A 1KYZA 2Q0OA 3FX3A 3C1DA 3F8NA 1OKRA 3KLNA 5ICCA 2A61A 3EETA 1U78A 2WWYA 2NAZA 3ZMUA 2FMYA 1REPC 3BDDA 2Y0MA 1BJAA 5HOOA 4LK1F 2FU4A 2DPDA 1AOYA 3DKWA 5LLQA 4HX8A 3I5UA 1LEAA 2ZO4A 2PJPA 4YIIA 1G3SA 2CSOA 4JQFA 1BI0A 2EA4A 5DYMA 2AS5F 5HLHA 4G6QA 2UXXA 3K2ZA 1Z6TA 1ZARA 3P7NA 2QM3A 4OMYA 5D5VB 3COAC 4IJAA 2HS5A 2FNAA 2QBYA 3BJOA 2IA0A 3HOSA 2ISYA 5ILVA 3LA3A 1IRGA 4AWXB 2ZJ2A 2FMLA 2A68F 4N9HA 3I54A 1OYWA 1XGSA 3F8CA 4GYGA 1P6RA 3WTUC 1ODDA 4OU0A 4PDKA 1O57A 1Q1HA 5CLSA 4OINF 4WCGA 1ZRCA 1O3SA 4IPAA 4Q4ZF 3F8MA 3J80Z 2YSRA 4XLNF 3WTTC 1HKTA 3P9KA 3GX4X 3KP4A 3L2CA 4M6YA 1P2FA 2QBYB 4WXCA 4EGYA 1USTA 2M45A 2ELHA 3BJ6A 3SZPA 3V7SA 2XAGA 5ERIA 1FNNA 3HUGA 2W57A 1F5TA 4KN4X 1FY7A 3KP3A 3QP5A 4L9TA 5CVIA 2DBBA 3RTRA 5HDKA 2VBYA 3KEQA 3U1DA 2OA4A 2X4HA 1MGTA 4A5NA 3WTWC 1IXCA 3QU3A 1J0RA 2KJBA 2XAJA 3ZMDA 3RKYA 3V7CA 4U7DA 2DLLA 2HYFA 5LHHA 2VBZA 5JHUA 4CXFA 3MZYA 4OMZA 4I01A 1SD6A 5E20A 3BPXA 1UB9A 3WG9A 5E18F 2DQLA 1KGSA 3R4KA 1YIOA 1IRFA 3QPHA 3T1BA 5D6FA 4PCQA 4IRIA 2E1CA 4KT5C 1XSXA 3ULQB 4A6EA 3QRFF 4QWQA 1MZBA 3K1MA 3GWZA 3FXRA 4CDGA 4HDVA 1GXQA 1Z9CA 2XVCA 1B9MA 1FP2A 1HBXG 2L4AA 3CO6C 4HW0A 3E6DA 1QO0D 4Y13A 1J75A 3ABUA 3TOBA 1I27A 2VN2A 3F8FA 5DEQA 5E17F 5JFRA 5D8LB 2CW0F 4G8XA 5HLGA 1D5VA 1WKMA 1UHMA 3MWMA 1FBQA 3MZHA 2JRTA 5HS8A 1JXSA 1G3YA 3Q9VA 5HS9A 3WTVC 4KDPA 2K27A 2K7LA 3I64A 1KQ8A 4BH9A 2HR3A 3U9GA 2H6CA 2V79A 5E1XA 4OIQF 1KQ9A 1KU3A 2RV8A 4KNYA 3CO7C 2PFBA 1IUYA 3C18A 1WSUA 1ZN2A 4EM2A 4BYYA 5DD4A 4M9XA 5BPDA 1K6OA 2G9WA 4BXUA 4I0BA 2XIGA 1QQIA 3I59A 2QZ8A 4YFNF 3JW4A 3HRTA 1YG2A 4TV7A 2HQNA 2ZNYA 3GF2A 3WGGA 5L3DA 1VTNC 2FA5A 2XKOA 3V7RA 1FZPB 4F7ZA 2VC1A 3W6KB 4AIHA 3K0LA 3R0AA 2OQRA 2FSWA 3DPTA 1OYYA 2XKPA 5L3BA 4YIFA 3AAFA 3VODA 4L9NA 3MQ0A 1ON2A 4BHPA 3GFIA 1SD5A 2DTRA 1P4WA 1V4RA 2Q2EA 2FBHA 3Q9SA 1S6LA 3J7AO 1I6XA 5JVTA 4PZJA 1XGNA 3MFKA 1K7AA 4RGXA 1T6SA 2FOKA 2F5FA 1P92A 3I59B 2OQGA 4A2UA 2V9VA 4AVPA 2Z3YA 1YLFA 4IHTA 4I7HA 1TW3A 5AIQA 4N9IA 5BMZA 1XSVA 4LB6B 4RGUA 3NEUA 2EV0A 1W5SA 4AIJA 3DF8A 1J7KA 1O3RA 3ZN1A 2HFHA 2LF8A 4M9ZA 3FF5A 3L7WA 4NB5A 2KIUA 1CGPA 1TLHB 4RAYA 5FB2A 5FGMA 2IP2A 1HQCA 2QQBA 3M9AA 3RJPA 1H9GA 3ZMTA 1IN7A 1GXPA 3J81K 1ULYA 2FEZA 2GWRA 4CZZA 1R1VA 2NRAC 3BWGA 3C7JA 4EQQA 1QNTA 3QU6A 2JPBA 3ZMVA 3M1EA 2IA1A 3E6BA 3I58A 3JSOA 2IVMA 2MH2A 4U7BA 2GZWA 4M73A 3LAPA 2M30A 4LB5A 2G7HA 1BOAA 2HYGD 5EEGA 2XV4S 4O3MA 1X3UA 2A6EF 2P4WA 2O61A 1R7JA 2O0YA 1R1TA 1HKQA 1GHCA 3JSPA 3S2WA 4U0YA 2P8TA 1D3YA 2VE9A 4BQAA 5LBQA 4ENMA 4KUMA 4EJTA 2VOOA 2HTSA 2V6CA 2PI0A 5D6EA 3F6OA 3KETA 3TDUC 4IVNA 3WE2A 4BAYA 2HEOA 2NNNA 1MDMA 2J5OA 1FBUA 3FMSA 2P5VA 2VBXA 3FHZA 1SFEA 5HDNA 4G7OF 2TDXA 2K4JA 1LDJA 4U88A 3DV8A 3GW2A 5FD6A 1DPRA 4YFXF 1YS6A 1KQ0A 2KIFA 4CICA 2G7UA 4A0YA 1DUXC 3HTUA 4Y17A 3DQVC 2ZBKA 3IRQA 3QP6A 2FF4A 2RN7A 2XASA 3JTHA 3MCZA 2M87A 5LHGA 3QAHA 5L3FA 3O2PE 3QOPA 4ZH4F 2WTEA 3WTYC 3BROA 3ROUA 1DPUA 4ASNA 2P5KA 2YPRA 4CO8A 1H9TA 2P5LC 3T0YA 1MDMB 4LLGF 1UFMA 4ZZLA 2RGVA 3L00A 1QPMA 3IWZA 4HX4A 4QLCU 3TOAA 2F5EA 4BNCA 3KZZA 3FXQA 5E8IA 5JI6A 4P9FA 2GQQA 2IA2A 2ZNZA 2QQAA 3VOEA 4CGZA 3IL2A 1T38A 4HZFA 5ICGA 3RPUA 1ZLJA 3M8FA 1P4XA 5BQTA 2EFPA 1OPCA 3I4PA 4MHGA 1U3EM 1S8NA 2H94A 3CDHA 5BPIA 4EJOA 4AD9A 1E17A 4H0EA 2A5YB 2EK5A 4Z2YA 1HSJA 2AXLA 2ZFWA 2YU3A 2CGPA 4EM0B 1DP7P 3DXJF 1OMIA 4U0VA 3WU1B 2EFOA 2BV6A 2E1NA 3J81Z 1H0MA 1I1GA 1ZGJA 1FX7A 2XGXA 4KN7X 1BIBA 2A3SA 3HOTA 2L02A 1QZYA 4A12A 4AIKA 2ZMEA 1HKSA 4FT8A 1SFXA 5CVRA 1LNWA 1BI2A 5KK1A 4KMFA 2HDCA 1EH6A 2H27A 1U6GA 2XRNA 3R0JA 3HYIA 4P96A 3LWFA 2WC2A 2IPQX 3C3WA 1TQMA 3LA2A 5FFZA 1YFHA 4R1HA 4E70A 1HW2A 5LRSA 1CF7A 4RB1A 2FE3A 1BC7C 2L54A 4XBFA 1IF1A 2K02A 4IHSA 1W5TA 1TNTA 5F64A 4ZYEA 3EUHA 3E5UA 3CTAA 3H3UA 2X0LA 2GXGA 3P9IA 3EYYA 4HA8A 4K2EA 3F21A 2YR2A 1D8JA 2JPCA 3R61A 1R00A 4KFCA 4MQ9F 2ZMEB 1KA8A 2F5DA 1IXSB 2BBYA 3GFJA 2P7VB 3V8KA 4DQ2A 3CUQA 1TW2A 3TO7A 3LFKA 5HVQC 1OYIA 5DD8A 3SXYA 1T39A 4GXOA 2QLZA 3GVAA 3PQKA 4HYEA 3U2RA 1CF7B 1B59A 2EB7A 4U0WA 1Z1DA 2RNJA 1R1UA 1IW7F 1ZG3A 2DT5A 4EMSA 2C6YA 1FT9A 4UV8A 4FX4A 3E97A 2K86A 4ENKA 1XD7A 3B73A 2Y75A 3GZ5A 4MEYF 1TBXA 4RGRA 2VXZA 3HHHA 4P55A 3R60A 5ICFA 2OBPA 3WODF 4UNOA 3E6MA 1PP7U 5HS7A 2MLKA 2P6SA 4GGGA 3ECOA 2FQ3A 5H20A 3DFGA 1FBSA 1MKMA 1B1BA 1T98A 5K5RA 3CUQB 1ZG1A 4KIBA 1WQ2A 3I53A 3F23A 2HGCA 3ECHA 2D45A 1WWXA 4M74A 1U8RA 5HLIA 2FBIA 1FP1D 4ENNA 3D0SA 2NYXA 2NS0A 3BOQA 2ESHA 1ZRFA 3HSFA 4A0ZA 4HQEA 2EFQA 3HRSA 3RDIA 4ZYHA 5K5QA 5CJ9A 1XDUA 2O3FA 2NNYA 3LAJA 3FZVA 4G9YA 4XSXF 1J2XA 4L0ZB 2YX7A 1XN7A 2JT1A 1QGPA 1R22A 2CFXA 4HOBA 2LNBA 2GA2A 4KIGA 2XHKA 2GIVA 1JGSA 2RC4A 3ELKA 3GXOA 1YS7A 2CQKA 3WE3A 5LGNA 3ZMZA 2EV5A 1EH8A 2RQPA 4BHBA 4LLLA 4MGRA 4CYDA 2O8XA 1KU9A 1J5YA 3RYRA 5J6XA 3T5XA 4EGZA 3FMQA 3F22A 2H6BA 3WTXC 3GYHX 1FLIA 5CVVA 3GEZA 5CVUA 4RS8A 2H09A 3ISPA 2PQ8A 2PLYA 1U5TA 1I1SA 4BHCA 3SQNA 2BYVE 5A2QK 2M1BA 3M7GA 2M5WA 2IRFG 2PMUA 1TQIA 4UHTA 2Z33A 2DK8A 3F8BA 4WWCA 3DPLC 4KYWA 2CYYA 2MD5A 1FYLA 2V1UA 1XGMA 1BN5A 2VONA 4EM1A 5TRDA 4ZZDA 4O5VA 4S05A 3WGIA 3IWFA 1R5GA 1ZG5A 1QZZA 4FX0A 4O6JA 2P7CB 3K1PA 1HW5A 4M9SA 4RAZA 5H6RA 4I09A 4LGWA 5TJJA 1XGOA 2OD5A 4FHTA 1I5ZA 3F72A 1DDNA 3E5QA 1U5TB 2D2WA 4JK1X 2UZKA 4WXDA 5HDGA 4ENJA 1IAWA 1ZLKA 3W6JB 2VT2A 2DK5A 5L3EA 1RZ4A 2QQ9A 2F2EA 3ZPLA 4LFUA 4KA4A 2CWEA 4L18B 1NHAA 3F3XA 3RYPA 4L5JA 3LQQA 4Q48A 1S3JA 3CJNA 2EWNA 4HLXA 4UVCA 3IRRA 3KLOA 1AWCA 5ICEA 1PUEE 4IF4A 3WTSC 1Z7UA 4MTEA 1J59A 2MC3A 2LF7A 4Q5SF 1UHWA 3WGHA 2GAUA 3T8RA 1BM9A 5LEJA 5CYVA 1FYMA 1ZAOA 5FFXA 1XCVA 4LG0A 1G4DA 1K78A 2BGCA 1MJ9A 3GFLA 1RNLA 3FWEA 3HHGA 2HZTA 4IRGA 2XAQA 2EV6A 1LDDA 2LDUA 1R58A 1LQ1A 6PAXA 1SMYF 2EFNA 3HSEA 4HBLA 3E5XA 4PGGA 2HWVA 1FSEA 1UCRA 1P4AA 4YG2F 3K69A 2DI3A 3L09A 2W25A 1USSA 4LLNA 2Z99A 1RUNA 2MBFA 1XCBA 4WF2A 2DW4A 2GA1A 1KU7A 3P9CA 3HRUA 1YW8A 3RI4A 1B9NA 2GXBA 3FXUA 1C0WA 3ERED 1B6AA 5BOXA 1ZYRF 1YW9A 2ZXJA 5JR3A 2QWWA 3RIRA 3KP6A 3GZ6A 5A2QZ 4RB3C 4LG0B 1WI9A 1K78B 4HAMA 1L3LA 3BY6A 2R3SA 4G7HF 2R7DA 4G6DA 2FXAA 4ETSA 3DP7A 1W4MA 3V4GA 2Y48A 3B02A 3TO9A 4P5OA 2D1VA 3BP8A 4IXAA 2DFIA 4L9VA 1XSDA 2VBWA 2K4BA 1IZ1A 3TGNA 4I0AA 3JTGA 3OOPA 4HDUA 3CUQC 3SFZA 3VEPA 2E7WA 4A5MA 3V8LA 3REOA 1W7PD 4XLPF 2UWMA 2J5PA 1IN4A 3RPQA 3O3KA 2PG4A 1WRJA 1YO5C 4M71A 1R23A 3H3ZA 4Q47A 3ZP5A 4ON0A 4HF0A 4XSZF 2PN6A 2OZ6A 1W7PA 2HTJA 1SMTA 2XAFA 4M72A 1ZRDA 2HOEA 4CHUA 1MJAA 4ESJA 4Y15A 3KFWX 2ADUA 3WTZA 4LD5A 3M8EA 3MAJA 5ILUA 2OZUA 1MJBA 2FRHA 1XMAA 5FO5A 2PBIA 2IJLA 1EH7A 4WK8F 1L0OC 3TKYA 1LEBA 1ONVA 3NRVA 4UV9A 2IW5A 2V1XA 1FOKA 2EJRA 3EQLF 4EV0A 4KIFA 1TQPA 3RKWA 2BE5F 4G7ZF 4B8XA 1ON1A 2YX4A 1XDSA 4RB0A 4WX9A 2PMHA 2RVCA 1HXDA 1W7PB 1ZHFA 5D4SA 4R8HA 5DUKA 1D8KA 3LSTA 4EJUA 1Z91A 4LK0F 2LSOA 4PGHA 1O7FA 3R6SA 2VE8A 4HX7A 3KEOA 2MH9A 3KP5A 4ESBA 1R5HA 1HW1A 1G6NA 4LJZF 2B0LA 2KRFA 1XB4A 3FMRA 4OOIA 1G3TA 2RDPA 1F1ZA 1K79A 3PQJA 3Q5FA 4UUVA 3N4MA 4HQMA 3FM5A 4B09A 1R36A 1LDKB 4IRHA 1T0FA 4NHJA 2CG4A 1O3TA 4P9UA 2DQRA 4L5IA 1BBYA 5BS6A 1EV7A 3FM3A 3EDPA 4GCVA 1SD4A 3KP7A 3ABTA 5IT9K 4OIPF 4HF1A 1GVJA 2IT0A 5LGUA 3IC7A 3RKXA 3IKTA 4MTDA 1U5TC 3SZTA 2EFWA 2OU2A 2RKHA 2ISZA 1STZA 3TQNA 4N0BA 2XAHA 2KKOA 4D0PA 1ZGAA 2JTVA 1PDNC 2PEXA 2VT3A 1FC3A 5IT3A 5AIPA 5H6QA 3L9FA 1ZH5A 1Y0UA 1F9NA 2DPUA 1YYVA 1J9IA 4EJVA 2O6GE 1FYKA 2ZKZA 3F6VA 1V3FA 3O6BB 1TNSA 2FBKA 4KMUX 2ZCWA 3E3VA 3MEXA 4UXNA 2L3DA 3IHUA 1U2WA 3I71A 3N97A 2DO7A 3CLOA 2DU9A 2OAZA 2STTA 5LGTA 1O7LA 5ED4A 3KP2A 5E1WA 1SFUA 2JZYA 2D1HA 5DCFA 2MA3A 4GO1A 3KZYA 1YW7A 3LA7A 4XRFA 5E8GA 3DEUA 3GUDA 4S04A 3OV8A 2L4MA 2VODA 3I0TA 4OIOF 4I02A 3JAMK 2L01A 3ML6A 2HKXA 2E7XA 5DV5A 2CO5A 3CUOA 5D4RA 5ILSA 5LEKA 1E2XA 1BC8C 1BI1A 5FLXK 2QUFA 5K5OA 2V1DA 1A04A 2XUBA 1S7OA 3ZN0A 3VFZA 4LMYA 3BZ6A 2HQRA 1G3WA 5D5UB 2VOPA 2F5CA 4KICA 1MD0A 3T8TA 2QVOA 1JHFA 3H92A 5DCMA 1OR7A 3GFMA 1IN6A 1SAXA 3KCCA 5DUIA 5F6FA 1RIOH 3ZMSA 1KYWA 5LHIA 2O03A 2JSCA 3IKVA 2EA2A 2MLGA 4MEXF 1LB2A 3PFIA 2A07F 1LJ9A 3GO5A 4G94A 5E1ZB 5D8KB 3WU0A 2QENA 3BJAA 1HSTA 2Z5UA 4OIRF 1B4AA 3BPVA 4WXHA 2FNPA 2Z9OA 2UXNA 1Z6RA 4JBAA 3KE2A 4UVBA 5CVJA 3TDZC 5DCMB 4NQWA 3HTSB 4GYIA 1KU2A 3NQOA 4HV6A 2HKOA 5AONA 5K1YA 2DAOA 4HF2A 1S7AA 2A6HF 1JHHA 3GLXA 4I2OA 3SHFA 2W84A 3G73A 5IT9Z 3K9TA 2A69F 2LKPA 3LQRA 3G3ZA 1Z05A 1LVAA 4UVAA 2ACJA 3V8JA 4M6XA 4I98B 1BIAA 4HLYA 2Q8KA 4DNCA 5L3CA 1QBJA 4RB2C 1RI7A 5J8CA 1SD7A 2KIMA 2STWA 2KJCA 1YTYA 1XMKA 2XROA 3EYIA 1F4KA 4L9JA 4A0XA 2W85A 1IN5A 2WV0A 3J80K 1FSHA 2R7FA 5D5WB 5D5XB 5LRRA 3D5LA 1S29A 5KVRA 1FWZA 2ESNA 3QPTA 4ZYGA 3TO6A 1T2KA 5F1RA 2VC0A 4YFKF 2ETHA 1PP8F 5EEHA 3JAMZ 4RGSA 1IXRC 1ZREA 3HRMA 4R79A 3E6CC 5FD5A 5J8FA 4L0YB 4ZYDA 1BI3A 2BEOA 1TTYA 2COMA 4ESFA 4EJWA 2W24A 4MQVA 3ZQ7A 5FLXZ 1RUOA 2QYOA 1FPQA 4MNUA 4A6DA 5DDGA 5L3GA
chains in the Genus database with same CATH superfamily
2BW3B 2EZKA 2K9NA 3PM1A 3HSRA 2HDWA 1IN8A 3SYTA 1V5EA 2CQQA 3CDLA 3TL4X 3I55I 2M8EA 1WZ2A 4J19A 3GCMA 4HV5A 1YQAA 1D1AA 2DMNA 1QHHD 1UMQA 3IAM2 4EVIA 1O3QA 2WBMA 2P6TA 2L9VA 3HIFA 1JE8A 3K1NA 3DTIA 2LMDA 3VB2A 1IC8A 1KYZA 2Q0OA 3FX3A 3MD2A 3OYNA 3C1DA 1D1CA 1Y56A 3F8NA 2JN6A 3OL3A 3DEWA 2BY1A 2BY0A 1TT5B 2R7OA 4NC7A 1OKRA 3KLNA 5ICCA 2A61A 5K7HA 3E0JB 3OYDA 3L2WA 1MBHA 3EETA 5C4XJ 1U78A 2WWYA 3K70C 1WPKA 2DT6A 2CV2A 2MSYA 2NAZA 3ZR8X 3ZMUA 2VKEA 2FMYA 5EF6A 1REPC 3BDDA 2Y0MA 1BJAA 3W2WA 4LK1F 5HOOA 2FU4A 4F52A 2DPDA 5IYCJ 3BTJA 1AOYA 3DKWA 1Z77A 5LLQA 3OYGA 3CD6I 2IGKA 2X1EA 2LBFA 1S72I 4HX8A 2HU9A 5EZGA 2I8DA 3I5UA 1TC3C 1Z3YA 1LEAA 1LE8A 2ZO4A 3QPSA 2PJPA 4YIIA 3G71I 4JX6A 3JRFA 1X1DA 1G3SA 2CSOA 1AU7A 3VYSB 4JQFA 1BI0A 2EA4A 3FBIB 2R7RA 5DYMA 2AS5F 5HLHA 4G6QA 2UXXA 3K2ZA 3BCAA 1Z6TA 2E5ZA 2M34A 1ZARA 3P7NA 2QM3A 4OMYA 5GTIC 5D5VB 3UNGC 5J47A 3COAC 1HA8A 2JRMA 4IJAA 4DGWB 2HS5A 2FNAA 3OS1A 2Y2ZA 2QBYA 3S2DJ 1T0FC 2IA0A 3BJOA 3HOSA 3DU5A 2ISYA 5ILVA 2RQQA 3K7AJ 1UG2A 3LA3A 3O8GA 1IRGA 4AWXB 3QYFA 1IDYA 2N8GA 2ZJ2A 3ZCOA 2FMLA 2A68F 4N9HA 3I54A 3PSFA 1R4NB 1OJLA 3BG6A 1OYWA 1XGSA 3F8CA 4GYGA 5E3MA 2TCTA 1LFUP 2ID3A 1P6RA 2FJ1A 3WTUC 2BZTA 4XNFA 3LSHA 5FKKA 2MG4A 3J7YJ 2CFOA 1ODDA 4OU0A 2LBFB 4PDKA 1O57A 2ZJRF 1W5CC 1Q1HA 5CLSA 3SDBA 4OINF 4WCGA 1ZRCA 2EZLA 2EIKH 1O3SA 2PMZN 4CCLA 1LE8B 4IPAA 2HVQA 4DOZA 5CKTA 3CCMI 3BG7A 4FTHA 1QRYA 4Q4ZF 3SJMA 4OAYA 4UUTA 3F8MA 1FMVA 3J80Z 1E0EA 4B48A 1ERDA 4AU7A 2YSRA 1OFCX 4XLNF 3WTTC 2UV1A 1HKTA 4MFDA 1Z3XA 3P9KA 1EJ9A 3GX4X 1U9OA 3KP4A 3BLYA 4Y4RA 3L2CA 1OLTA 4AVZA 1JTXA 1XC5A 1MH3A 4M6YA 1P2FA 1K83J 1WFXA 2QBYB 4WXCA 1A35A 4EGYA 2VPLA 4II2A 1USTA 1XS9A 2M45A 4Y33A 3LSMA 4D5FA 2ELHA 3BJ6A 2L7ZA 3SZPA 3V7SA 2XAGA 5ERIA 3KYLA 1FNNA 4FE7A 3GZNB 1T33A 3HUGA 1IRZA 4C2TA 5HODA 3O8HA 9ANTA 2W57A 4BY7J 1F5TA 4KN4X 1FY7A 4IHVA 1ZR2A 3RSNA 3KP3A 1X3WB 3QP5A 4L9TA 4RAFA 4AM3A 1X1PA 5CVIA 2DBBA 3RTRA 4QIWN 4XRSG 5HDKA 3VPRA 2VBYA 3KEQA 3U1DA 2OA4A 2WA0A 2X4HA 5GAEJ 4Y52J 3HOYJ 1MGTA 1W0UA 4A5NA 1TWHJ 1FOYA 3FXKA 3WTWC 5CQEA 3JREA 1BL0A 3HDDA 1WJEA 3HM5A 4Z6YA 4S0HB 3QU3A 1J0RA 2K5CA 2KJBA 2XPVA 3G1LA 2OPTA 3K4MA 3IP4B 2XAJA 5B1BH 3ZMDA 3MKYB 3RKYA 4F93B 2WB1N 5F0CA 3V7CA 4U7DA 2VLAA 1CQTA 2DLLA 5E79C 2HYFA 2R7WA 5LHHA 1JJ6C 2VBZA 3S2HJ 5JHUA 4FCYA 4CXFA 4A93J 3MZYA 4OMZA 4I01A 2JA5J 1SD6A 4G6TB 5E20A 3BPXA 4AYBN 3DPUA 5F0FA 4A3FJ 1UB9A 1BR1A 3WG9A 1DGWY 5E18F 3HUGB 1ETWA 1OR7C 1LFPA 1X2MA 2DQLA 1KGSA 3R4KA 3ZRGA 1YIOA 1IRFA 3QPHA 3BR6A 3T1BA 5D6FA 2VB6A 4PCQA 1OCPA 4IRIA 4X6AJ 2HPMA 4KT5C 2E1CA 2KISA 2CV1A 4DYCA 1XSXA 5HNHA 3ULQB 4A6EA 3QRFF 4QWQA 2A5WA 1MZBA 2NS7A 3K1MA 3GWZA 3FXRA 3S32A 4CDGA 1PVEA 1JUPA 4BEHA 1GXQA 2ZJQF 4HDVA 1Z9CA 2XVCA 1B9MA 1FP2A 1HBXG 1T95A 3HGYA 2L4AA 2K40A 5B66C 3BR0A 3CO6C 4BBRJ 4HW0A 3TMOA 3E6DA 1QO0D 4Y13A 4ZTFA 4PJ0C 3IH3A 1J75A 3ABUA 3TOBA 1I27A 2HPIA 2VN2A 3F8FA 5DEQA 1VQKI 2IS1A 3G1MA 5E17F 3ZQFA 5JFRA 2PJRA 1MNDA 1IRXA 3SEQA 1ETQA 5D8LB 2CW0F 4G8XA 5HLGA 4IQJA 3IUOA 2EIMH 1D5VA 2FUG2 1WKMA 1UHMA 3MWMA 3PUBA 1FBQA 3MZHA 2JRTA 5HS8A 1JXSA 1G3YA 4A3CJ 3Q9VA 5HS9A 3WTVC 4KDPA 1ZELA 2K27A 2K7LA 3I64A 1H88C 1KQ8A 2JVGA 4CZCA 4BH9A 4FASD 3L2UA 2HR3A 3U9GA 3BQYA 3S15J 2JA6J 2H6CA 2V79A 2EPFA 5E1XA 4OIQF 1KQ9A 1KU3A 2OCCH 2RV8A 4KNYA 5K7FA 3CO7C 2L0KA 2PFBA 1IUYA 2HOSA 3LL7A 1HDDC 3C18A 1WSUA 4QSHA 4FISA 1ZN2A 4EM2A 4BEHB 4BYYA 5DD4A 1RC9A 2DN0A 3NAUA 2A6TA 4M9XA 3CJQB 2DMUA 4BUPA 1Y8RB 5BPDA 2X9DA 1K6OA 1MNEA 1DU0A 1GT0C 2G9WA 3MN2A 4BXUA 4I0BA 2XIGA 1QQIA 3I59A 3LSKA 2BVLA 3I4NJ 2QZ8A 4YFNF 3HOUJ 3JW4A 3HRTA 1YG2A 1JKQC 4TV7A 2HQNA 3BQZA 2PJRB 2ZNYA 3GF2A 3WGGA 1W36D 4IHXA 4AC0A 3PL8A 4NBQA 5L3DA 1VTNC 2E71A 4C30A 4N4NB 2FA5A 2XKOA 3V7RA 1FZPB 2LFBA 3WHBA 4F7ZA 3CCVI 1APLC 2VC1A 3W6KB 1FTTA 4AIHA 2Y31A 3K0LA 1F43A 3EUKL 3R0AA 5IP7J 2OQRA 2FSWA 1YX5A 3DPTA 3M1CA 1OYYA 4EEFG 2XKPA 5L3BA 1SEUA 4YIFA 3AAFA 1RESA 4BACA 3VODA 2F4OB 4L9NA 3V42A 3MQ0A 1ON2A 4BHPA 2XGCA 1N77A 2XPUA 4YIRX 4JX5A 2CUFA 3GFIA 2ZXWH 1SD5A 3W2AA 4CCMA 2DA1A 5FKNA 1R49A 3ONQA 2GBYA 4U87A 1WJ5A 4A3KJ 3HOWJ 1WI3A 2DTRA 1P4WA 1V4RA 2Q2EA 2FBHA 3Q9SA 1S6LA 3J7AO 3JRGA 2YU9J 4BJ6C 1I6XA 3DBHB 5JVTA 4PZJA 1XGNA 3MFKA 2QQ8A 1K7AA 4RGXA 1T6SA 3AL0B 3DKXA 3GBGA 2FOKA 2F5FA 1P92A 1HDPA 3I59B 4L5EA 2OQGA 4A2UA 1IJWC 1P9QC 2V9VA 5KAFC 4A3BJ 4AVPA 3JCUC 3PJRA 2DA7A 3K4JA 2Z3YA 3LOCA 1IDZA 3AKZA 1YLFA 2WB1A 4IHTA 1Y39A 4I7HA 2VJIA 1TW3A 5AIQA 4N9IA 5BMZA 1XSVA 4MO7A 3A2KA 4LB6B 4RGUA 3NEUA 1N25A 4CCKA 4IO9F 2EV0A 2W1OA 1W5SA 4AIJA 3DF8A 1J7KA 4BJ5C 2BVMA 2E1MB 1O3RA 3ZN1A 2HFHA 2BOLA 2DOFA 2EINH 2LF8A 4M9ZA 1X1BA 3FF5A 3L7WA 4LIUA 3CF5F 4NB5A 2KIUA 1CGPA 1TLHB 4RAYA 2M7BA 2H8RA 3S1NJ 5GP9A 4XQFA 5FB2A 5FGMA 1ITYA 2IP2A 1HQCA 2QQBA 1MBJA 3OIQA 2RNGA 2BY2A 4ZDPA 1R9TJ 3KZIC 3M9AA 3FXLA 3RJPA 1H9GA 3H36A 1WJCA 3D1NI 3ZMTA 1IN7A 1GXPA 2E1OA 3J81K 1ULYA 2FEZA 1SVOA 4ZJZA 2GWRA 1SANA 4CZZA 2Q2EB 1R1VA 1ZKGA 2NRAC 3BWGA 3C7JA 1SFKA 4EQQA 1QNTA 3QU6A 2W82A 2QCOA 2JPBA 1V5FA 1QZEA 3BT9A 3ZMVA 1IO2A 1E3OC 3UKGA 3M1EA 3VDXA 2IA1A 3E6BA 3I58A 3JSOA 3K6GA 3Q0VA 2IVMA 2LG4A 5B3SH 2MH2A 1LVKA 2CUEA 3X2QH 4U7BA 4BBSJ 3CC7I 2BXYA 5BNGA 3M4OJ 2GZWA 2EILH 4M73A 3CMAI 1H8AC 3LAPA 5GAGJ 2M30A 1FMWA 3ZQIA 4LB5A 3BZKA 2G7HA 3Q0WA 2F4IA 1BOAA 2HYGD 5EEGA 2XV4S 2QSFX 4O3MA 1X3UA 2A6EF 2P4WA 1IUFA 1Z21A 4XKVA 4CCJA 1AKHA 2O61A 1R7JA 3HL2A 5HLTA 5DM7F 2XF7A 2O0YA 2DJIA 1R1TA 1HKQA 3FK7A 4F55A 2R7UA 1GHCA 3JSPA 3S2WA 2XF6A 4U0YA 2DDAA 4XK4A 4H4KC 2P8TA 3GMEA 1D3YA 2VE9A 5E3LA 4D5CA 4BQAA 5LBQA 3SZGA 2E2IJ 1JUSA 3H9GA 4ENMA 3EPZA 4KUMA 2LOOA 1Y8QB 2L7KA 3AG1H 4EJTA 2VOOA 3L2RA 2HTSA 2V6CA 2PI0A 5D6EA 1A6IA 4XONA 3F6OA 2O9LA 1MSFC 3KETA 3S1RJ 4ITVA 4A3GJ 3TDUC 4IVNA 1ZK8A 3WE2A 4BAYA 2HEOA 3GTPJ 3JR9A 2NNNA 1MDMA 2CW7A 2JSPA 2R5YA 1X1CA 2J5OA 1FBUA 1G59A 5C4JJ 3FMSA 1MMDA 3CMMA 2W7NA 2P5VA 1MW7A 1YI2I 4XLEA 4XM3A 4PFPA 4XIDA 2VBXA 1XTAA 3FHZA 1VF9A 1SFEA 1ETOA 5HDNA 5E3NA 1VQPI 1YJWI 4G7OF 2DTZA 3LSIA 2TDXA 3GTLJ 2K4JA 3PO2J 2XSDC 1VQ7I 1LDJA 4U88A 3DV8A 5C44J 2VKHA 3GW2A 5FD6A 1DPRA 4YFXF 1YS6A 2L2OA 1KQ0A 2KIFA 4CICA 1AKHB 2G7UA 4A0YA 1DUXC 4PJNA 3HTUA 4Y17A 4AUXA 3DQVC 2VQHA 1OCOH 2ZBKA 3PIOF 3IRQA 2LY2A 2ME0A 1OISA 4BE2A 4IHWA 3QP6A 1UELB 2FF4A 2RN7A 2XASA 1MBEA 3FK6A 2ELKA 3AG4H 3IAS2 3JTHA 3MCZA 2M87A 5GPCA 3RZOJ 5LHGA 5F0HA 5L3GA 1YHQI 3QAHA 2KDOA 2EZHA 3QYBA 4MIMA 1PJRA 3O2PE 5L3FA 3QOPA 3I56I 2WY8Q 2WAFA 4ZH4F 2FD5A 2WTEA 3WTYC 3BROA 3ROUA 3OR1C 1DPUA 3CCUI 3TW6A 4ASNA 3LSRA 4HG2A 2P5KA 2YPRA 4LG3A 4CO8A 1H9TA 2P5LC 2JMWA 4B44A 3RPUD 3PNTA 3T0YA 1MDMB 2R5YB 4LLGF 1UFMA 4NNJA 1I6HJ 4ZZLA 2RGVA 1X3ZB 3L00A 3ASNH 2E60A 1QPMA 1YRNA 3IWZA 5IYDJ 3KIOA 4DBRA 4B3AA 3WU2C 2DXIA 4HX4A 3PIPF 4QLCU 3TOAA 3DBRB 2F5EA 4F3QA 1A5JA 4BNCA 3KZZA 2Z1DA 4RA2A 2NVTJ 3FXQA 5K7ZA 5E8IA 5JI6A 2GOXB 2LD5A 4NC8A 4P9FA 2GQQA 2IA2A 2ZNZA 2QQAA 4IEJA 3VOEA 4CGZA 3OL4A 2ICWG 3IL2A 4I6ZA 4A3JJ 1T38A 2GIZA 1S7EA 4HZFA 2DFFA 5ICGA 3RPUA 1ZLJA 3M8FA 1P4XA 5BQTA 4OAZA 2EFPA 3CC2I 1OPCA 3I4PA 4IKFA 3CCYA 3CCEI 4MHGA 1U3EM 5F1JA 1S8NA 2R93J 2JVHA 2H94A 1AA7A 3CDHA 2H1KA 3PUFA 4EJOA 5BPIA 2XGEA 4AD9A 1E17A 2P0WA 4V2FA 3Q0UA 4H0EA 3HOVJ 3OYLA 1FOWA 2A5YB 2EK5A 2JUCA 4Z2YA 1HSJA 2AXLA 2ZFWA 1QVUA 2ELJA 2YU3A 2CGPA 1HC8A 1N75A 2M2EA 5GTHC 4EM0B 1DP7P 3DXJF 4CSWA 1OMIA 4U0VA 3WU1B 2DA4A 2EFOA 2BV6A 4JP0A 2E1NA 3J81Z 1H0MA 2KL4A 1V55H 1I1GA 1ZGJA 3OS2A 1FX7A 2XGXA 1BR2A 1YRNB 4KN7X 1BIBA 2A3SA 3HOTA 2L02A 1QZYA 4GDFA 4JX4A 4A12A 2K9QA 2K9MA 4AIKA 4GRIA 1BOBA 3ABKH 1NK3P 4E7JA 2QKLB 2VQLA 1W0TA 2ZMEA 4NDLA 3K4LA 1HKSA 4FT8A 2LREA 4DYRA 1SFXA 5CVRA 1LNWA 1BI2A 5KK1A 4KMFA 2HDDA 2HDCA 4HNUA 1EH6A 4HNVA 2H27A 1U6GA 3HPHA 2XRNA 4M3EA 3R0JA 3HYIA 4P96A 3LWFA 2WC2A 2IPQX 3C3WA 5IP9J 1WH5A 3ABMH 4KITB 1TQMA 2V4JC 3LA2A 5FFZA 1YFHA 4R1HA 4E70A 1IGNA 3W6VA 1HW2A 5LRSA 1CF7A 4RB1A 3J7AY 1SAUA 2NXNB 2FE3A 2KDZA 3OYEA 1I3QJ 2L54A 5IPAA 1BC7C 1IG7A 1EKEA 4XBFA 1IF1A 2K02A 4IHSA 4BQOA 1W5TA 1TNTA 1Y6IA 5F64A 4ZYEA 5EYRA 3EUHA 3E5UA 3ZGKA 3CTAA 3H3UA 2IGOA 2X0LA 2GXGA 3OWTA 4UB8C 3P9IA 3HXLA 1NK2P 2DYRH 3EYYA 1JKRC 1GUUA 2E19A 4HA8A 3D5RC 3CP2A 4W1UA 1R71A 4K2EA 3F21A 2YR2A 1D8JA 3A02A 2JPCA 3RCOA 3H5NA 3BTLA 3R61A 3ZQCA 1R00A 4KFCA 3FBNB 4XR6A 5FKOA 4MQ9F 2ZMEB 1KA8A 2F5DA 2XGDA 2R4GA 1IXSB 2BBYA 1K6YA 3GFJA 2P7VB 1DQUA 2UUZA 3V8KA 1K4TA 4C3JJ 4DQ2A 1MMSA 1XG1A 2NVYJ 3CUQA 5J4VA 3FKIJ 1TW2A 1I3AA 2WADA 2K3FA 2NOGA 3TO7A 3LFKA 5HVQC 1OYIA 5DD8A 3SXYA 1T39A 4GXOA 3AL0C 3N05A 2KMUA 2QLZA 3GVAA 3PQKA 4RM2A 5M5XJ 1HCRA 4HYEA 2V7FA 3U2RA 3KX2A 4C3HJ 1B59A 1X4PA 2EB7A 2WV1A 4B3XA 1CF7B 4U0WA 1Z1DA 3QYEA 2RNJA 1O4XA 2R7QA 1R1UA 1IW7F 2DFHA 1YJ9I 3OYFA 1ZG3A 3DBLB 1JTYA 2DT5A 3B6CA 4EMSA 2C6YA 1FT9A 1WCMJ 4UV8A 4FX4A 3E97A 2K86A 4ENKA 1XD7A 3B73A 3C2BA 2GM4A 3JRCA 2MC4A 2Y75A 3GZ5A 4MEYF 2E1MC 1TBXA 4RGRA 2DCEA 2VXDA 2Y9ZA 2VXZA 3HHHA 1JGGA 4P55A 3R60A 5JVGF 5ICFA 2OBPA 5F04A 2DFEA 2WAEA 3WODF 4UNOA 4D1QA 1SC7A 3E6MA 1R4MB 1Q1VA 1PP7U 5HS7A 2MLKA 2P6SA 4GGGA 4BS9A 4G12A 3G2BA 3ECOA 4XLFA 3JRHA 2FQ3A 2KT0A 5H20A 4HRIA 3DFGA 1W36C 1FBSA 2KZGA 1MKMA 1B1BA 4PK4A 1T98A 5K5RA 3CUQB 1X4OA 4PJJA 1ZG1A 4KIBA 5E3OA 1BR4A 4J01A 2QA4I 1WQ2A 3FISA 3I53A 3F23A 2L9RA 2HGCA 2M0MA 3OYJA 3ECHA 2D45A 1WWXA 1VQLI 4M74A 1U8RA 2D5VA 4XKWA 4E7SA 3OR2C 5HLIA 2FBIA 1FP1D 4ENNA 3D0SA 2OF7A 4BXFA 4V2GA 2NYXA 2NS0A 2IGMA 3BOQA 2ESHA 3QQAA 3H9JA 1ZRFA 3HSFA 2Y9YA 5FRMA 5JHFA 1YJNI 1D0YA 2EBIA 2RREA 4A0ZA 3TBIA 4HQEA 1OCZH 3FIWA 2EFQA 2XB5A 3BZCA 1QPIA 2K9LA 2AHQA 3BR3A 1UAAA 2DJNA 3HRSA 3RDIA 4UY8I 4B1RA 4ZYHA 4BE0A 2Z16A 3NARA 5K5QA 5CJ9A 1XDUA 2O3FA 3S8PA 2NS8A 2NNYA 3LAJA 3FZVA 1GDTA 3BTIA 4G9YA 4XSXF 1UHSA 1WHUA 1J2XA 1D5YA 1MBKA 3NWTA 4L0ZB 2YX7A 1XN7A 2DT7B 2JT1A 4C3IJ 1QGPA 1R22A 3L1PA 3BG3A 2CFXA 4HOBA 1TWGJ 2LNBA 2VIXA 3QWLA 4Y7NJ 2GA2A 2HYJA 1QHGA 4KIGA 2XHKA 3GTGJ 2JA8J 1MH4A 2GIVA 3S1MJ 1JGSA 2F5VA 2RC4A 2NVQJ 2XSJC 4HNTA 1RETA 3JRAA 3ELKA 3GXOA 1YS7A 2CQKA 3WE3A 3BR5A 2R7VA 5LGNA 3ZMZA 2JJ7A 4RAGA 1YOVB 2DA6A 2EV5A 4BE1A 2CV0A 1EH8A 2RQPA 4BHBA 4LLLA 4MGRA 4CYDA 3BG9A 2O8XA 3WHCA 1KU9A 1J5YA 3RYRA 5J6XA 3T5XA 4EGZA 4XN3A 3H35A 1FIPA 3A0BC 3FMQA 4XMYA 1LKXA 2H6BA 3WTXC 3F22A 2CQNA 3GYHX 2WAQA 4BXXJ 1FLIA 3ESWB 5EG0A 3GTMJ 2LY9A 4A3DJ 2OTJI 5CVVA 3GEZA 4B43A 2OCEA 3L2VA 3VYUB 4UB6C 5CVUA 3GLLA 5KCMA 3DLAA 2V9PA 4RS8A 5J1UA 4QPQA 2H09A 2H1LA 3ISPA 1YITI 2PQ8A 3DTEA 2H8WA 1VZ0A 4E7ZA 2PLYA 1U5TA 2KHMA 1I1SA 4BHCA 2W00A 3SQNA 5FKLA 4IHYA 2JUGA 2BYVE 5A2QK 2AXTC 2DA2A 2VQGA 2M1BA 3M7GA 2M5WA 4C2UA 3HG9A 3VSKA 2IRFG 2PMUA 1TQIA 3A01A 4UHTA 2Z33A 1ETXA 2DK8A 3F8BA 3KYCB 4WWCA 3CDIA 3DPLC 4XLHA 4KYWA 3VYTB 2X6OA 1RRJA 2CYYA 5HNFA 1U9NA 2MD5A 1FYLA 3DTKA 3SFIA 3S1QJ 4F91B 1WGXA 2V1UA 1XGMA 1BN5A 2KZVA 3TEDA 2VONA 2V6EA 3FXOA 4EM1A 3QPLA 4ZZDA 5TRDA 4O5VA 4N4OB 4S05A 2DA5A 3WGIA 3IWFA 2E34A 1Z7LA 1R5GA 2KPMA 1ZG5A 4A3EJ 3H3VK 1SVLA 3G4SI 4RLFA 1YX3A 1QZZA 4FX0A 5KHDA 4O6JA 2XC7A 2P7CB 3K1PA 4KJZA 5EG0B 4IZZA 2O5RA 4IX7A 1HW5A 4M9SA 4RAZA 5H6RA 3OYMA 4I09A 4ZTJA 4LGWA 5TJJA 3KEYA 4PSWA 1BW6A 1XGOA 2OD5A 3A03A 4FHTA 1G8XA 2QSGX 1E3HA 1I5ZA 2CH0A 2Y0SA 4BL0B 2FX0A 1TZLA 3F72A 1DDNA 3E5QA 4DBQA 1U5TB 1E3PA 2D2WA 4JK1X 5J3LA 4XRMA 3CMEI 3CJRB 4WXDA 2UZKA 1KONA 4BKXA 5GADJ 5HDGA 2IS6A 1VQOI 4ENJA 3A01B 2R7TA 2M0CA 3H5AA 1S9HA 3CCLI 1ZR4A 1TP4A 2VI6A 1IAWA 2DOAA 4BQNA 1FEXA 1ZLKA 2X85A 3JRDA 3IH4A 3IH2A 3W6JB 2VT2A 4ABZA 2DK5A 3ASOH 5L3EA 1RR7A 1RZ4A 2ZJPF 2QQ9A 2F2EA 2VKDA 3ZPLA 3DKYA 4LFUA 4PJMA 4KA4A 2CWEA 4L18B 1NHAA 3F3XA 3I9V2 2JA2A 2QGUA 3RYPA 2KQRA 4FQGA 4L5JA 3MKWB 1BW5A 4PJLA 3LQQA 3GTQJ 2X6WA 4Q48A 1S3JA 3CJNA 2EWNA 4HLXA 4UVCA 4DYQA 3IRRA 3KLOA 1WJBA 4MFEA 1AWCA 5LD2C 2I10A 5ICEA 1JT0A 1PUEE 4IF4A 3HJEA 2OUMA 3WTSC 1Z7UA 4MTEA 1U0JA 2MC3A 1J59A 2LF7A 3PNVA 3GTKJ 3CC4I 4Q5SF 2L7FP 2GOMA 3HOXJ 3PSIA 1UHWA 2M8GX 3CF2A 3WGHA 2K9SA 4V19K 2GAUA 3T8RA 1BM9A 5LEJA 4A3IJ 2NOJB 2VUMJ 4QTRA 2VJ5A 3MMYB 1BJZA 4IQ4A 5CYVA 1FYMA 1ZAOA 1T56A 5FFXA 1P7JA 1XCVA 3BG5A 1VNDA 1OCRH 4LG0A 1XX5A 1G4DA 1K78A 5EDNA 1PUFA 2BGCA 1MJ9A 3GFLA 1RNLA 3CESA 3FWEA 2YUSA 3HHGA 2HZTA 3W2VA 4IRGA 2NVXJ 2XAQA 4XICA 1DP3A 2EV6A 1LDDA 1RKTA 1R58A 2DOEA 2LDUA 1LQ1A 1VQ5I 2JQ7A 6PAXA 1SMYF 2EFNA 3HSEA 4HBLA 2ZMEC 1Z67A 3E5XA 4YEJA 3H5RA 4PGGA 1GV2A 1I39A 1FSEA 1UCRA 1P4AA 2FQ4A 2BXZA 2HWVA 3K69A 4KT6A 2DI3A 2HNHA 3L09A 1HF0A 2W25A 1USSA 4CCNA 1WJFA 1VQ9I 5C3EJ 2Z99A 1RUNA 2DMPA 4LLNA 2MBFA 4A3MJ 5EZHA 3K4CA 4I76A 1VI0A 5IP6A 1XCBA 3RZDJ 3FXMA 2R5ZA 3K4NA 3H1CA 4WF2A 2DW4A 2GA1A 1KU7A 3P9CA 3HRUA 2GXAA 1T08B 2HI3A 2K3PA 1YW8A 5EEAA 4RBOA 2EH3A 4M3BA 3OYCA 2BHZA 3RI4A 3CCQI 3BCBA 1B9NA 1DGRM 2ECCA 2ZB9A 2GXBA 3VSLA 2QKMB 3FXUA 3BR1A 1C0WA 3ERED 1B6AA 2E2JJ 5BOXA 2EQRA 2LP0A 2VQCA 1ZQ3P 3UR3C 3EUHC 3CP8A 4HSRA 2CQ7A 4XLCA 4II3A 5IOYA 5J4YA 3LNQA 3K4BA 1ZYRF 1YW9A 4RMNA 2ZXJA 5JR3A 2QWWA 3RIRA 4XKCA 1X19A 3KP6A 3GZ6A 2VJ4A 2LLKA 4RB3C 5A2QZ 4LG0B 1WI9A 1K78B 1B72A 2OTLI 4HAMA 1L3LA 1PUFB 3BY6A 3G1OA 2R3SA 2LYCA 2R7DA 4G6DA 4G7HF 2FXAA 2VL8A 3DP7A 1W4MA 3V4GA 4ETSA 3HOZJ 2PX9A 2Y48A 3B02A 3TO9A 1TWFJ 3U21A 4P5OA 5FROA 2D1VA 3BP8A 2LKXA 4IXAA 2DFIA 5JLXA 2XDVA 2R7ZJ 3TP3A 1A31A 5FLVA 4L9VA 4BQQA 1XSDA 3OYHA 2VBWA 2K4BA 3OYBA 2F6CA 1IZ1A 1EA3A 3TGNA 4I0AA 3JTGA 1SVMA 3OOPA 1V54H 4HDUA 2VJJA 3CUQC 4ANJA 3SFZA 3VEPA 2AO9A 2E7WA 4A5MA 3V8LA 3CLQA 3REOA 1W7PD 4XLPF 2R5ZB 3CCJI 3SEZA 1JKPC 2HVRA 1ENHA 2O7OA 2P81A 5EJCA 2UWMA 2J5PA 2QEXI 1IV8A 4Y3OA 1IN4A 2OV7A 2MYSA 1WVRA 2L7MP 4HSTA 3RPQA 1WJAA 3VWBA 3L2QA 1S5LC 4XRSA 3O3KA 4RDUA 1NH3A 2PG4A 1V5GA 1WRJA 3HKZA 1YO5C 5GAHJ 4M71A 2COBA 1R23A 2XPWA 3H3ZA 4Q47A 3ZP5A 4ON0A 1POGA 2X6XA 4LITA 4HF0A 4XSZF 1J09A 1H89C 1MNMC 3H0DA 5KNLA 4GFBA 3J7ZI 2PN6A 4PFOA 2OZ6A 3ABLH 3G6EI 3I3LA 2DMTA 4M3GA 1W7PA 3C2HA 4E7LA 2FOWA 1JKOC 1B72B 2VPRA 2HTJA 1SMTA 2XAFA 2IAIA 4M72A 4C9YA 1ZRDA 5FLMJ 1N78A 1R5ID 2HOEA 4CHUA 3P5JA 3QODA 1FTZA 1MJAA 4ESJA 3CMYA 3M3YJ 4Y15A 3BTCA 2ADUA 3KFWX 3WTZA 4BGDA 2Y69H 2KP6A 4LD5A 3S93A 1Y1WJ 1ACIA 3M8EA 1ETKA 3MAJA 5ILUA 2OZUA 1MJBA 5DM6F 1A36A 1UJ8A 2FRHA 4ZDLA 4M3DA 3W3CA 2JA7J 1XMAA 5FO5A 2PBIA 4MNUA 2IJLA 1EH7A 4WK8F 1FOXA 1RPWA 1L0OC 3TKYA 1LEBA 1BA5A 5J1YA 1ONVA 3NRVA 3RQ4A 3K70D 2IW5A 4UV9A 2IS2A 2KRHA 2V1XA 1FOKA 2E36A 4YG2F 1GLNA 3DEEA 1ETVA 2TRTA 2EJRA 4I99C 2HOTA 3EQLF 4EV0A 4KIFA 1IV6A 2W48A 3WG7H 1TQPA 3RKWA 2BE5F 2CS3A 1RR8C 4W97A 4LOCA 1A6QA 2WAQN 2LH9A 1XMXA 4B8XA 4G7ZF 1ON1A 3AFHA 3ERMA 2GLOA 2YX4A 2B9SA 1GVDA 2LVSA 1XDSA 4RB0A 2R7XA 1EF4A 3HGGA 2PMHA 4WX9A 2RVCA 1HXDA 1ZGWA 3B6AA 1W7PB 2LR8A 1OCTC 3LSJA 2HQAA 1ZHFA 5D4SA 1MSEC 4R8HA 5DUKA 1D8KA 3LSTA 4EJUA 1Z91A 3OMYA 1NG7A 4LK0F 1NTCA 2LSOA 1X58A 4PGHA 4ZC3A 3A1YA 1O7FA 3K10A 1JI8A 3FDYA 3R6SA 1UG0A 4YRVA 1W1WE 2VE8A 4B47A 1F36A 4E7IA 4HX7A 3KEOA 1TWAJ 4EATA 4XKBA 2MH9A 2ZFUA 2DMQA 4LIVA 3KP5A 4ESBA 1R5HA 1HW1A 1G6NA 4A3LJ 5FRNA 4LJZF 2B0LA 2KRFA 1XB4A 1JT6A 5FKMA 1YE9A 2BY3A 3OIOA 2KRCA 3FMRA 5JLWA 4OOIA 1D1BA 1G3TA 3TW7A 2L5QA 2RDPA 1F1ZA 2XRLA 1VQNI 4DZPA 3ZQHA 1K79A 4ZDOA 3PQJA 3M8JA 2DODA 3Q5FA 1MMNA 1UZCA 3OSGA 1VFCA 4UUVA 3A4CA 5IYBJ 3N4MA 4HQMA 3OY9A 3FM5A 4XL9A 4B09A 1R36A 2VKVA 1LDKB 1VQ4I 4IRHA 2MD0A 1T0FA 4PSXA 4NHJA 3PFYA 2CG4A 2ID6A 2KIQA 2IEKA 2A05A 2M3AA 4P9UA 4CYCA 3OS0A 2DQRA 1O3TA 4L5IA 1BBYA 5BS6A 1EV7A 3LMMA 2O8KA 3FM3A 2HQ5A 3EDPA 4GCVA 5M3MJ 2Y0SN 5TGTA 5FJ8J 1SD4A 3KP7A 2F4MB 3ABTA 5IT9K 1VQ8I 4OIPF 4HF1A 3S3NA 2RAEA 2WY7Q 2X1DA 1GVJA 2IT0A 2MABA 5LGUA 3IC7A 3RKXA 4BJTA 4QPOA 3AG2H 3IKTA 3LFUA 4MTDA 1U5TC 3SZTA 2ZXIA 2XB0X 2EFWA 2OU2A 4OWRB 2RKHA 2ISZA 3D5SC 1STZA 1I50J 3TQNA 4N0BA 3LSPA 2XAHA 2KKOA 1K61A 4D0PA 1ZGAA 2JTVA 4PUSA 5J40A 3TP0A 2PEXA 1PDNC 2VT3A 2JWTA 3I4MJ 1FC3A 5M5WJ 5IT3A 1T8IA 5AIPA 5H6QA 1R6RA 3L9FA 5DTDA 3K2AA 1ZH5A 3PO3J 1ETYA 3DU6A 2AQEA 1Y0UA 1F9NA 2DPUA 2IBDA 2BHYA 3DCFA 4BU2A 1YYVA 3PNYA 1J9IA 4EJVA 2O6GE 1P7IA 4MLOA 4J00A 1FYKA 2ZKZA 3C2GA 3F6VA 2E35A 3HZJA 4JYKA 3S3MA 1V3FA 3O6BB 4D9JA 1TNSA 2FBKA 4KMUX 4D7NA 2LK2A 2ZCWA 3E3VA 3MEXA 4DJAA 3E7LA 2L3DA 4UXNA 3IHUA 5TISC 2QSHX 2IGNA 1U2WA 1X2NA 3I71A 3N97A 2JK3A 2DO7A 3CLOA 2DU9A 1G2HA 1Z0XA 2OAZA 4CYCB 2STTA 3KYDB 5LGTA 2OJED 1O7LA 1MBFA 5ED4A 4X0GA 2CUZA 4D7MA 3KP2A 5E1WA 4E4HA 1SFUA 1VQMI 3S14J 1OQYA 4DZJA 2JZYA 2D1HA 5DCFA 2MA3A 4GO1A 3ZQLA 3KZYA 2CUJA 1YW7A 3LA7A 4XRFA 2G0EA 2ZC2A 3CJTB 3DEUA 5E8GA 3OYAA 3GUDA 4S04A 3OV8A 2L4MA 2VODA 2K85A 3FXJA 3I0TA 4OIOF 4XORA 1HLVA 3M07A 1OCCH 4I02A 1WJDA 2CQXA 3CCRI 2CMPA 2KLOA 3OSFA 3AG3H 1LUJB 3JAMK 2YS9A 2L01A 5B5EC 3ML6A 1QA6A 1KZHA 3DWLE 2HKXA 2ZXHA 2E7XA 5DV5A 2CO5A 3OIPA 3CUOA 1GV5A 4FE4A 5D4RA 2PMZA 3FHNA 2IXSA 4JOMA 3U1KA 5ILSA 4A69C 5LEKA 2QF7A 1E2XA 3MVPA 2R0QC 2IS4A 1BC8C 1BI1A 1K4SA 5IOZA 3F0CA 1LPQA 2CJJA 5FLXK 4X1EA 2QUFA 5K5OA 2V1DA 1MBGA 1A04A 2MFZA 3FKJA 2XUBA 1S7OA 3ZN0A 2HOAA 3VFZA 3E1SA 2R7SA 4LMYA 3BZ6A 1YIJI 4BY1J 2HQRA 1G3WA 2MGQA 2LC2A 5D5UB 2HXOA 5M5YJ 1QVTA 3OYIA 3GTOJ 2VOPA 2F5CA 1LFBA 3JRBA 1QU3A 4KICA 1B8IA 1MD0A 3T8TA 2CW8A 2QVOA 4NC6A 1JHFA 3H92A 3DLLF 5DCMA 3RQIA 2E2HJ 1OR7A 3GFMA 3EUAA 2VASA 1IN6A 1SAXA 3KCCA 5DUIA 5F6FA 1RIOH 1NG6A 3ZMSA 1KYWA 4E6KG 3MKZA 3RKQA 5LHIA 2O03A 2JSCA 2X51A 3IKVA 5DS9A 2EA2A 2MLGA 4MEXF 1LB2A 3PFIA 1D0ZA 2X1CA 3MKLA 4CCOA 3S3OA 2A07F 4RLQA 1LJ9A 4CA0A 4KISA 1JJ8C 3GO5A 4G94A 4BDZA 3HEFA 5E1ZB 5D8KB 3WU0A 4CH7A 3SDGA 4C2MJ 2QENA 2DA3A 4IOAF 2ZSHB 3BJAA 2M7AA 2W4SA 1HSTA 2Z5UA 4OIRF 3BR2A 2LRDA 1B4AA 3BPVA 1U8BA 4XLAA 4E7HA 4WXHA 2X6YA 2CRGA 2FNPA 1TL8A 2Z9OA 2UXNA 1Z6RA 2ECBA 2X48A 3QOEA 4JBAA 1WH7A 2HXIA 3KE2A 4UVBA 1AHDP 5CVJA 2DDBA 1MMAA 2EIJH 3GTJJ 1XPXA 4IL6C 3TDZC 4UUSA 1B8IB 3ZXSA 5LFAA 2LY1A 5DCMB 4NQWA 3ZQQA 3HTSB 1TWCJ 4GYIA 3CCSI 1KU2A 4AYBA 3NQOA 2LKSA 4HV6A 2L9NA 3MZ8A 2HKOA 2OC6A 5AONA 5K1YA 3HKZN 2MW8A 3LSGA 3A0HC 2I5UA 2DAOA 4HF2A 1S7AA 2A6HF 1JHHA 1HOMA 3GLXA 4I2OA 3SHFA 3ZQGA 1D0XA 4AIDA 2W84A 3G73A 5IT9Z 4F92B 3K9TA 2A69F 5CQGA 2LKPA 3LQRA 4M6VA 3HPGA 5EGOA 3G3ZA 5GPAA 3NWSA 1PYVA 1ZTRA 4M3FA 1Z05A 4XOTA 1LVAA 4UVAA 5F27A 2ACJA 3V8JA 2V26A 2AQFA 1MIJA 3HBLA 2Q1ZB 4I98B 4M6XA 5IY5H 1BIAA 5M3FJ 2Q8KA 4DNCA 5L3CA 4HLYA 1QBJA 3S17J 4RB2C 3HC7A 1RI7A 5J8CA 3F9KA 2KFDA 1SD7A 2KIMA 2Y30A 3H0GJ 2STWA 2HZDA 2KJCA 4E7KA 2DYSH 1JUMA 1YTYA 1XMKA 1VQ6I 2L9SA 1ORKA 4FETA 2V9KA 1TT0A 3BC8A 4ZYAA 2CU7A 2E5NA 2XROA 1X1AA 2XAUA 2F48A 3EYIA 1F4KA 4BDYA 4L9JA 2BW3A 4A0XA 2W85A 1IN5A 3KPHA 2WV0A 3J80K 1FSHA 3OYKA 2M4KA 4UUSB 2R7FA 3VYRB 2B7EA 5D5WB 5D5XB 2M4GA 5LRRA 4NUBA 4DIQA 3D5LA 4NQWB 1S29A 5CPRB 5KVRA 3K4KA 1FWZA 2ESNA 2HVSA 3QPTA 4ZYGA 2R92J 4IOCF 1M1EB 4XOPA 4CUGA 1Y1VJ 4HPQA 3TO6A 2LTPA 3H9QA 1T2KA 4XN0A 3S16J 4B4CA 1FIAA 3IV5A 3OOUA 5F1RA 1DU6A 1Y0NA 2XF5A 2B63J 1FJLA 2NVUB 4HEA2 2VC0A 1SFOJ 4YELA 4YFKF 2V1NA 5EGOB 2ETHA 5H2FC 4DW6A 1PP8F 3JRIA 5KAIC 2Z2SB 2M9HA 5J1RA 4P1WA 5EEHA 3JAMZ 2ZSIB 4RGSA 1IXRC 5B1AH 3HRMA 4R79A 1ZREA 3HB9A 3E6CC 1MMGA 5FD5A 2EZIA 3ZOBA 5J8FA 4L0YB 4ZYDA 3CQZJ 2ME6A 1BI3A 2BEOA 5F08A 1TTYA 1RKWA 2COMA 4EJWA 4ESFA 2W24A 4MQVA 3ZQ7A 3CZ6A 4RM3A 5FLXZ 1RUOA 2QYOA 1FPQA 1IXCA 4A6DA 5DDGA 3Q3SA
chains in the Genus database with same CATH topology
3HSRA 1IN8A 2M8EA 4HV5A 1YQAA 4EVIA 1O3QA 2P6TA 3HIFA 1JE8A 3K1NA 3VB2A 1KYZA 2Q0OA 3FX3A 3C1DA 3F8NA 1OKRA 3KLNA 5ICCA 2A61A 3EETA 1U78A 2WWYA 2NAZA 3ZMUA 2FMYA 1REPC 3BDDA 2Y0MA 1BJAA 5HOOA 4LK1F 2FU4A 2DPDA 1AOYA 3DKWA 5LLQA 4HX8A 3I5UA 1LEAA 2ZO4A 2PJPA 4YIIA 1G3SA 2CSOA 4JQFA 1BI0A 2EA4A 5DYMA 2AS5F 5HLHA 4G6QA 2UXXA 3K2ZA 1Z6TA 1ZARA 3P7NA 2QM3A 4OMYA 5D5VB 3COAC 4IJAA 2HS5A 2FNAA 2QBYA 3BJOA 2IA0A 3HOSA 2ISYA 5ILVA 3LA3A 1IRGA 4AWXB 2ZJ2A 2FMLA 2A68F 4N9HA 3I54A 1OYWA 1XGSA 3F8CA 4GYGA 1P6RA 3WTUC 1ODDA 4OU0A 4PDKA 1O57A 1Q1HA 5CLSA 4OINF 4WCGA 1ZRCA 1O3SA 4IPAA 4Q4ZF 3F8MA 3J80Z 2YSRA 4XLNF 3WTTC 1HKTA 3P9KA 3GX4X 3KP4A 3L2CA 4M6YA 1P2FA 2QBYB 4WXCA 4EGYA 1USTA 2M45A 2ELHA 3BJ6A 3SZPA 3V7SA 2XAGA 5ERIA 1FNNA 3HUGA 2W57A 1F5TA 4KN4X 1FY7A 3KP3A 3QP5A 4L9TA 5CVIA 2DBBA 3RTRA 5HDKA 2VBYA 3KEQA 3U1DA 2OA4A 2X4HA 1MGTA 4A5NA 3WTWC 1IXCA 3QU3A 1J0RA 2KJBA 2XAJA 3ZMDA 3RKYA 3V7CA 4U7DA 2DLLA 2HYFA 5LHHA 2VBZA 5JHUA 4CXFA 3MZYA 4OMZA 4I01A 1SD6A 5E20A 3BPXA 1UB9A 3WG9A 5E18F 2DQLA 1KGSA 3R4KA 1YIOA 1IRFA 3QPHA 3T1BA 5D6FA 4PCQA 4IRIA 2E1CA 4KT5C 1XSXA 3ULQB 4A6EA 3QRFF 4QWQA 1MZBA 3K1MA 3GWZA 3FXRA 4CDGA 4HDVA 1GXQA 1Z9CA 2XVCA 1B9MA 1FP2A 1HBXG 2L4AA 3CO6C 4HW0A 3E6DA 1QO0D 4Y13A 1J75A 3ABUA 3TOBA 1I27A 2VN2A 3F8FA 5DEQA 5E17F 5JFRA 5D8LB 2CW0F 4G8XA 5HLGA 1D5VA 1WKMA 1UHMA 3MWMA 1FBQA 3MZHA 2JRTA 5HS8A 1JXSA 1G3YA 3Q9VA 5HS9A 3WTVC 4KDPA 2K27A 2K7LA 3I64A 1KQ8A 4BH9A 2HR3A 3U9GA 2H6CA 2V79A 5E1XA 4OIQF 1KQ9A 1KU3A 2RV8A 4KNYA 3CO7C 2PFBA 1IUYA 3C18A 1WSUA 1ZN2A 4EM2A 4BYYA 5DD4A 4M9XA 5BPDA 1K6OA 2G9WA 4BXUA 4I0BA 2XIGA 1QQIA 3I59A 2QZ8A 4YFNF 3JW4A 3HRTA 1YG2A 4TV7A 2HQNA 2ZNYA 3GF2A 3WGGA 5L3DA 1VTNC 2FA5A 2XKOA 3V7RA 1FZPB 4F7ZA 2VC1A 3W6KB 4AIHA 3K0LA 3R0AA 2OQRA 2FSWA 3DPTA 1OYYA 2XKPA 5L3BA 4YIFA 3AAFA 3VODA 4L9NA 3MQ0A 1ON2A 4BHPA 3GFIA 1SD5A 2DTRA 1P4WA 1V4RA 2Q2EA 2FBHA 3Q9SA 1S6LA 3J7AO 1I6XA 5JVTA 4PZJA 1XGNA 3MFKA 1K7AA 4RGXA 1T6SA 2FOKA 2F5FA 1P92A 3I59B 2OQGA 4A2UA 2V9VA 4AVPA 2Z3YA 1YLFA 4IHTA 4I7HA 1TW3A 5AIQA 4N9IA 5BMZA 1XSVA 4LB6B 4RGUA 3NEUA 2EV0A 1W5SA 4AIJA 3DF8A 1J7KA 1O3RA 3ZN1A 2HFHA 2LF8A 4M9ZA 3FF5A 3L7WA 4NB5A 2KIUA 1CGPA 1TLHB 4RAYA 5FB2A 5FGMA 2IP2A 1HQCA 2QQBA 3M9AA 3RJPA 1H9GA 3ZMTA 1IN7A 1GXPA 3J81K 1ULYA 2FEZA 2GWRA 4CZZA 1R1VA 2NRAC 3BWGA 3C7JA 4EQQA 1QNTA 3QU6A 2JPBA 3ZMVA 3M1EA 2IA1A 3E6BA 3I58A 3JSOA 2IVMA 2MH2A 4U7BA 2GZWA 4M73A 3LAPA 2M30A 4LB5A 2G7HA 1BOAA 2HYGD 5EEGA 2XV4S 4O3MA 1X3UA 2A6EF 2P4WA 2O61A 1R7JA 2O0YA 1R1TA 1HKQA 1GHCA 3JSPA 3S2WA 4U0YA 2P8TA 1D3YA 2VE9A 4BQAA 5LBQA 4ENMA 4KUMA 4EJTA 2VOOA 2HTSA 2V6CA 2PI0A 5D6EA 3F6OA 3KETA 3TDUC 4IVNA 3WE2A 4BAYA 2HEOA 2NNNA 1MDMA 2J5OA 1FBUA 3FMSA 2P5VA 2VBXA 3FHZA 1SFEA 5HDNA 4G7OF 2TDXA 2K4JA 1LDJA 4U88A 3DV8A 3GW2A 5FD6A 1DPRA 4YFXF 1YS6A 1KQ0A 2KIFA 4CICA 2G7UA 4A0YA 1DUXC 3HTUA 4Y17A 3DQVC 2ZBKA 3IRQA 3QP6A 2FF4A 2RN7A 2XASA 3JTHA 3MCZA 2M87A 5LHGA 3QAHA 5L3FA 3O2PE 3QOPA 4ZH4F 2WTEA 3WTYC 3BROA 3ROUA 1DPUA 4ASNA 2P5KA 2YPRA 4CO8A 1H9TA 2P5LC 3T0YA 1MDMB 4LLGF 1UFMA 4ZZLA 2RGVA 3L00A 1QPMA 3IWZA 4HX4A 4QLCU 3TOAA 2F5EA 4BNCA 3KZZA 3FXQA 5E8IA 5JI6A 4P9FA 2GQQA 2IA2A 2ZNZA 2QQAA 3VOEA 4CGZA 3IL2A 1T38A 4HZFA 5ICGA 3RPUA 1ZLJA 3M8FA 1P4XA 5BQTA 2EFPA 1OPCA 3I4PA 4MHGA 1U3EM 1S8NA 2H94A 3CDHA 5BPIA 4EJOA 4AD9A 1E17A 4H0EA 2A5YB 2EK5A 4Z2YA 1HSJA 2AXLA 2ZFWA 2YU3A 2CGPA 4EM0B 1DP7P 3DXJF 1OMIA 4U0VA 3WU1B 2EFOA 2BV6A 2E1NA 3J81Z 1H0MA 1I1GA 1ZGJA 1FX7A 2XGXA 4KN7X 1BIBA 2A3SA 3HOTA 2L02A 1QZYA 4A12A 4AIKA 2ZMEA 1HKSA 4FT8A 1SFXA 5CVRA 1LNWA 1BI2A 5KK1A 4KMFA 2HDCA 1EH6A 2H27A 1U6GA 2XRNA 3R0JA 3HYIA 4P96A 3LWFA 2WC2A 2IPQX 3C3WA 1TQMA 3LA2A 5FFZA 1YFHA 4R1HA 4E70A 1HW2A 5LRSA 1CF7A 4RB1A 2FE3A 1BC7C 2L54A 4XBFA 1IF1A 2K02A 4IHSA 1W5TA 1TNTA 5F64A 4ZYEA 3EUHA 3E5UA 3CTAA 3H3UA 2X0LA 2GXGA 3P9IA 3EYYA 4HA8A 4K2EA 3F21A 2YR2A 1D8JA 2JPCA 3R61A 1R00A 4KFCA 4MQ9F 2ZMEB 1KA8A 2F5DA 1IXSB 2BBYA 3GFJA 2P7VB 3V8KA 4DQ2A 3CUQA 1TW2A 3TO7A 3LFKA 5HVQC 1OYIA 5DD8A 3SXYA 1T39A 4GXOA 2QLZA 3GVAA 3PQKA 4HYEA 3U2RA 1CF7B 1B59A 2EB7A 4U0WA 1Z1DA 2RNJA 1R1UA 1IW7F 1ZG3A 2DT5A 4EMSA 2C6YA 1FT9A 4UV8A 4FX4A 3E97A 2K86A 4ENKA 1XD7A 3B73A 2Y75A 3GZ5A 4MEYF 1TBXA 4RGRA 2VXZA 3HHHA 4P55A 3R60A 5ICFA 2OBPA 3WODF 4UNOA 3E6MA 1PP7U 5HS7A 2MLKA 2P6SA 4GGGA 3ECOA 2FQ3A 5H20A 3DFGA 1FBSA 1MKMA 1B1BA 1T98A 5K5RA 3CUQB 1ZG1A 4KIBA 1WQ2A 3I53A 3F23A 2HGCA 3ECHA 2D45A 1WWXA 4M74A 1U8RA 5HLIA 2FBIA 1FP1D 4ENNA 3D0SA 2NYXA 2NS0A 3BOQA 2ESHA 1ZRFA 3HSFA 4A0ZA 4HQEA 2EFQA 3HRSA 3RDIA 4ZYHA 5K5QA 5CJ9A 1XDUA 2O3FA 2NNYA 3LAJA 3FZVA 4G9YA 4XSXF 1J2XA 4L0ZB 2YX7A 1XN7A 2JT1A 1QGPA 1R22A 2CFXA 4HOBA 2LNBA 2GA2A 4KIGA 2XHKA 2GIVA 1JGSA 2RC4A 3ELKA 3GXOA 1YS7A 2CQKA 3WE3A 5LGNA 3ZMZA 2EV5A 1EH8A 2RQPA 4BHBA 4LLLA 4MGRA 4CYDA 2O8XA 1KU9A 1J5YA 3RYRA 5J6XA 3T5XA 4EGZA 3FMQA 3F22A 2H6BA 3WTXC 3GYHX 1FLIA 5CVVA 3GEZA 5CVUA 4RS8A 2H09A 3ISPA 2PQ8A 2PLYA 1U5TA 1I1SA 4BHCA 3SQNA 2BYVE 5A2QK 2M1BA 3M7GA 2M5WA 2IRFG 2PMUA 1TQIA 4UHTA 2Z33A 2DK8A 3F8BA 4WWCA 3DPLC 4KYWA 2CYYA 2MD5A 1FYLA 2V1UA 1XGMA 1BN5A 2VONA 4EM1A 5TRDA 4ZZDA 4O5VA 4S05A 3WGIA 3IWFA 1R5GA 1ZG5A 1QZZA 4FX0A 4O6JA 2P7CB 3K1PA 1HW5A 4M9SA 4RAZA 5H6RA 4I09A 4LGWA 5TJJA 1XGOA 2OD5A 4FHTA 1I5ZA 3F72A 1DDNA 3E5QA 1U5TB 2D2WA 4JK1X 2UZKA 4WXDA 5HDGA 4ENJA 1IAWA 1ZLKA 3W6JB 2VT2A 2DK5A 5L3EA 1RZ4A 2QQ9A 2F2EA 3ZPLA 4LFUA 4KA4A 2CWEA 4L18B 1NHAA 3F3XA 3RYPA 4L5JA 3LQQA 4Q48A 1S3JA 3CJNA 2EWNA 4HLXA 4UVCA 3IRRA 3KLOA 1AWCA 5ICEA 1PUEE 4IF4A 3WTSC 1Z7UA 4MTEA 1J59A 2MC3A 2LF7A 4Q5SF 1UHWA 3WGHA 2GAUA 3T8RA 1BM9A 5LEJA 5CYVA 1FYMA 1ZAOA 5FFXA 1XCVA 4LG0A 1G4DA 1K78A 2BGCA 1MJ9A 3GFLA 1RNLA 3FWEA 3HHGA 2HZTA 4IRGA 2XAQA 2EV6A 1LDDA 2LDUA 1R58A 1LQ1A 6PAXA 1SMYF 2EFNA 3HSEA 4HBLA 3E5XA 4PGGA 2HWVA 1FSEA 1UCRA 1P4AA 4YG2F 3K69A 2DI3A 3L09A 2W25A 1USSA 4LLNA 2Z99A 1RUNA 2MBFA 1XCBA 4WF2A 2DW4A 2GA1A 1KU7A 3P9CA 3HRUA 1YW8A 3RI4A 1B9NA 2GXBA 3FXUA 1C0WA 3ERED 1B6AA 5BOXA 1ZYRF 1YW9A 2ZXJA 5JR3A 2QWWA 3RIRA 3KP6A 3GZ6A 5A2QZ 4RB3C 4LG0B 1WI9A 1K78B 4HAMA 1L3LA 3BY6A 2R3SA 4G7HF 2R7DA 4G6DA 2FXAA 4ETSA 3DP7A 1W4MA 3V4GA 2Y48A 3B02A 3TO9A 4P5OA 2D1VA 3BP8A 4IXAA 2DFIA 4L9VA 1XSDA 2VBWA 2K4BA 1IZ1A 3TGNA 4I0AA 3JTGA 3OOPA 4HDUA 3CUQC 3SFZA 3VEPA 2E7WA 4A5MA 3V8LA 3REOA 1W7PD 4XLPF 2UWMA 2J5PA 1IN4A 3RPQA 3O3KA 2PG4A 1WRJA 1YO5C 4M71A 1R23A 3H3ZA 4Q47A 3ZP5A 4ON0A 4HF0A 4XSZF 2PN6A 2OZ6A 1W7PA 2HTJA 1SMTA 2XAFA 4M72A 1ZRDA 2HOEA 4CHUA 1MJAA 4ESJA 4Y15A 3KFWX 2ADUA 3WTZA 4LD5A 3M8EA 3MAJA 5ILUA 2OZUA 1MJBA 2FRHA 1XMAA 5FO5A 2PBIA 2IJLA 1EH7A 4WK8F 1L0OC 3TKYA 1LEBA 1ONVA 3NRVA 4UV9A 2IW5A 2V1XA 1FOKA 2EJRA 3EQLF 4EV0A 4KIFA 1TQPA 3RKWA 2BE5F 4G7ZF 4B8XA 1ON1A 2YX4A 1XDSA 4RB0A 4WX9A 2PMHA 2RVCA 1HXDA 1W7PB 1ZHFA 5D4SA 4R8HA 5DUKA 1D8KA 3LSTA 4EJUA 1Z91A 4LK0F 2LSOA 4PGHA 1O7FA 3R6SA 2VE8A 4HX7A 3KEOA 2MH9A 3KP5A 4ESBA 1R5HA 1HW1A 1G6NA 4LJZF 2B0LA 2KRFA 1XB4A 3FMRA 4OOIA 1G3TA 2RDPA 1F1ZA 1K79A 3PQJA 3Q5FA 4UUVA 3N4MA 4HQMA 3FM5A 4B09A 1R36A 1LDKB 4IRHA 1T0FA 4NHJA 2CG4A 1O3TA 4P9UA 2DQRA 4L5IA 1BBYA 5BS6A 1EV7A 3FM3A 3EDPA 4GCVA 1SD4A 3KP7A 3ABTA 5IT9K 4OIPF 4HF1A 1GVJA 2IT0A 5LGUA 3IC7A 3RKXA 3IKTA 4MTDA 1U5TC 3SZTA 2EFWA 2OU2A 2RKHA 2ISZA 1STZA 3TQNA 4N0BA 2XAHA 2KKOA 4D0PA 1ZGAA 2JTVA 1PDNC 2PEXA 2VT3A 1FC3A 5IT3A 5AIPA 5H6QA 3L9FA 1ZH5A 1Y0UA 1F9NA 2DPUA 1YYVA 1J9IA 4EJVA 2O6GE 1FYKA 2ZKZA 3F6VA 1V3FA 3O6BB 1TNSA 2FBKA 4KMUX 2ZCWA 3E3VA 3MEXA 4UXNA 2L3DA 3IHUA 1U2WA 3I71A 3N97A 2DO7A 3CLOA 2DU9A 2OAZA 2STTA 5LGTA 1O7LA 5ED4A 3KP2A 5E1WA 1SFUA 2JZYA 2D1HA 5DCFA 2MA3A 4GO1A 3KZYA 1YW7A 3LA7A 4XRFA 5E8GA 3DEUA 3GUDA 4S04A 3OV8A 2L4MA 2VODA 3I0TA 4OIOF 4I02A 3JAMK 2L01A 3ML6A 2HKXA 2E7XA 5DV5A 2CO5A 3CUOA 5D4RA 5ILSA 5LEKA 1E2XA 1BC8C 1BI1A 5FLXK 2QUFA 5K5OA 2V1DA 1A04A 2XUBA 1S7OA 3ZN0A 3VFZA 4LMYA 3BZ6A 2HQRA 1G3WA 5D5UB 2VOPA 2F5CA 4KICA 1MD0A 3T8TA 2QVOA 1JHFA 3H92A 5DCMA 1OR7A 3GFMA 1IN6A 1SAXA 3KCCA 5DUIA 5F6FA 1RIOH 3ZMSA 1KYWA 5LHIA 2O03A 2JSCA 3IKVA 2EA2A 2MLGA 4MEXF 1LB2A 3PFIA 2A07F 1LJ9A 3GO5A 4G94A 5E1ZB 5D8KB 3WU0A 2QENA 3BJAA 1HSTA 2Z5UA 4OIRF 1B4AA 3BPVA 4WXHA 2FNPA 2Z9OA 2UXNA 1Z6RA 4JBAA 3KE2A 4UVBA 5CVJA 3TDZC 5DCMB 4NQWA 3HTSB 4GYIA 1KU2A 3NQOA 4HV6A 2HKOA 5AONA 5K1YA 2DAOA 4HF2A 1S7AA 2A6HF 1JHHA 3GLXA 4I2OA 3SHFA 2W84A 3G73A 5IT9Z 3K9TA 2A69F 2LKPA 3LQRA 3G3ZA 1Z05A 1LVAA 4UVAA 2ACJA 3V8JA 4M6XA 4I98B 1BIAA 4HLYA 2Q8KA 4DNCA 5L3CA 1QBJA 4RB2C 1RI7A 5J8CA 1SD7A 2KIMA 2STWA 2KJCA 1YTYA 1XMKA 2XROA 3EYIA 1F4KA 4L9JA 4A0XA 2W85A 1IN5A 2WV0A 3J80K 1FSHA 2R7FA 5D5WB 5D5XB 5LRRA 3D5LA 1S29A 5KVRA 1FWZA 2ESNA 3QPTA 4ZYGA 3TO6A 1T2KA 5F1RA 2VC0A 4YFKF 2ETHA 1PP8F 5EEHA 3JAMZ 4RGSA 1IXRC 1ZREA 3HRMA 4R79A 3E6CC 5FD5A 5J8FA 4L0YB 4ZYDA 1BI3A 2BEOA 1TTYA 2COMA 4ESFA 4EJWA 2W24A 4MQVA 3ZQ7A 5FLXZ 1RUOA 2QYOA 1FPQA 4MNUA 4A6DA 5DDGA 5L3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSR A;  1IN8 A;  2M8E A;  4HV5 A;  1YQA A;  4EVI A;  1O3Q A;  2P6T A;  3HIF A;  1JE8 A;  3K1N A;  3VB2 A;  1KYZ A;  2Q0O A;  3FX3 A;  3C1D A;  3F8N A;  1OKR A;  3KLN A;  5ICC A;  2A61 A;  3EET A;  1U78 A;  2WWY A;  2NAZ A;  3ZMU A;  2FMY A;  1REP C;  3BDD A;  2Y0M A;  1BJA A;  5HOO A;  4LK1 F;  2FU4 A;  2DPD A;  1AOY A;  3DKW A;  5LLQ A;  4HX8 A;  3I5U A;  1LEA A;  2ZO4 A;  2PJP A;  4YII A;  1G3S A;  2CSO A;  4JQF A;  1BI0 A;  2EA4 A;  5DYM A;  2AS5 F;  5HLH A;  4G6Q A;  2UXX A;  3K2Z A;  1Z6T A;  1ZAR A;  3P7N A;  2QM3 A;  4OMY A;  5D5V B;  3COA C;  4IJA A;  2HS5 A;  2FNA A;  2QBY A;  3BJO A;  2IA0 A;  3HOS A;  2ISY A;  5ILV A;  3LA3 A;  1IRG A;  4AWX B;  2ZJ2 A;  2FML A;  2A68 F;  4N9H A;  3I54 A;  1OYW A;  1XGS A;  3F8C A;  4GYG A;  1P6R A;  3WTU C;  1ODD A;  4OU0 A;  4PDK A;  1O57 A;  1Q1H A;  5CLS A;  4OIN F;  4WCG A;  1ZRC A;  1O3S A;  4IPA A;  4Q4Z F;  3F8M A;  3J80 Z;  2YSR A;  4XLN F;  3WTT C;  1HKT A;  3P9K A;  3GX4 X;  3KP4 A;  3L2C A;  4M6Y A;  1P2F A;  2QBY B;  4WXC A;  4EGY A;  1UST A;  2M45 A;  2ELH A;  3BJ6 A;  3SZP A;  3V7S A;  2XAG A;  5ERI A;  1FNN A;  3HUG A;  2W57 A;  1F5T A;  4KN4 X;  1FY7 A;  3KP3 A;  3QP5 A;  4L9T A;  5CVI A;  2DBB A;  3RTR A;  5HDK A;  2VBY A;  3KEQ A;  3U1D A;  2OA4 A;  2X4H A;  1MGT A;  4A5N A;  3WTW C;  1IXC A;  3QU3 A;  1J0R A;  2KJB A;  2XAJ A;  3ZMD A;  3RKY A;  3V7C A;  4U7D A;  2DLL A;  2HYF A;  5LHH A;  2VBZ A;  5JHU A;  4CXF A;  3MZY A;  4OMZ A;  4I01 A;  1SD6 A;  5E20 A;  3BPX A;  1UB9 A;  3WG9 A;  5E18 F;  2DQL A;  1KGS A;  3R4K A;  1YIO A;  1IRF A;  3QPH A;  3T1B A;  5D6F A;  4PCQ A;  4IRI A;  2E1C A;  4KT5 C;  1XSX A;  3ULQ B;  4A6E A;  3QRF F;  4QWQ A;  1MZB A;  3K1M A;  3GWZ A;  3FXR A;  4CDG A;  4HDV A;  1GXQ A;  1Z9C A;  2XVC A;  1B9M A;  1FP2 A;  1HBX G;  2L4A A;  3CO6 C;  4HW0 A;  3E6D A;  1QO0 D;  4Y13 A;  1J75 A;  3ABU A;  3TOB A;  1I27 A;  2VN2 A;  3F8F A;  5DEQ A;  5E17 F;  5JFR A;  5D8L B;  2CW0 F;  4G8X A;  5HLG A;  1D5V A;  1WKM A;  1UHM A;  3MWM A;  1FBQ A;  3MZH A;  2JRT A;  5HS8 A;  1JXS A;  1G3Y A;  3Q9V A;  5HS9 A;  3WTV C;  4KDP A;  2K27 A;  2K7L A;  3I64 A;  1KQ8 A;  4BH9 A;  2HR3 A;  3U9G A;  2H6C A;  2V79 A;  5E1X A;  4OIQ F;  1KQ9 A;  1KU3 A;  2RV8 A;  4KNY A;  3CO7 C;  2PFB A;  1IUY A;  3C18 A;  1WSU A;  1ZN2 A;  4EM2 A;  4BYY A;  5DD4 A;  4M9X A;  5BPD A;  1K6O A;  2G9W A;  4BXU A;  4I0B A;  2XIG A;  1QQI A;  3I59 A;  2QZ8 A;  4YFN F;  3JW4 A;  3HRT A;  1YG2 A;  4TV7 A;  2HQN A;  2ZNY A;  3GF2 A;  3WGG A;  5L3D A;  1VTN C;  2FA5 A;  2XKO A;  3V7R A;  1FZP B;  4F7Z A;  2VC1 A;  3W6K B;  4AIH A;  3K0L A;  3R0A A;  2OQR A;  2FSW A;  3DPT A;  1OYY A;  2XKP A;  5L3B A;  4YIF A;  3AAF A;  3VOD A;  4L9N A;  3MQ0 A;  1ON2 A;  4BHP A;  3GFI A;  1SD5 A;  2DTR A;  1P4W A;  1V4R A;  2Q2E A;  2FBH A;  3Q9S A;  1S6L A;  3J7A O;  1I6X A;  5JVT A;  4PZJ A;  1XGN A;  3MFK A;  1K7A A;  4RGX A;  1T6S A;  2FOK A;  2F5F A;  1P92 A;  3I59 B;  2OQG A;  4A2U A;  2V9V A;  4AVP A;  2Z3Y A;  1YLF A;  4IHT A;  4I7H A;  1TW3 A;  5AIQ A;  4N9I A;  5BMZ A;  1XSV A;  4LB6 B;  4RGU A;  3NEU A;  2EV0 A;  1W5S A;  4AIJ A;  3DF8 A;  1J7K A;  1O3R A;  3ZN1 A;  2HFH A;  2LF8 A;  4M9Z A;  3FF5 A;  3L7W A;  4NB5 A;  2KIU A;  1CGP A;  1TLH B;  4RAY A;  5FB2 A;  5FGM A;  2IP2 A;  1HQC A;  2QQB A;  3M9A A;  3RJP A;  1H9G A;  3ZMT A;  1IN7 A;  1GXP A;  3J81 K;  1ULY A;  2FEZ A;  2GWR A;  4CZZ A;  1R1V A;  2NRA C;  3BWG A;  3C7J A;  4EQQ A;  1QNT A;  3QU6 A;  2JPB A;  3ZMV A;  3M1E A;  2IA1 A;  3E6B A;  3I58 A;  3JSO A;  2IVM A;  2MH2 A;  4U7B A;  2GZW A;  4M73 A;  3LAP A;  2M30 A;  4LB5 A;  2G7H A;  1BOA A;  2HYG D;  5EEG A;  2XV4 S;  4O3M A;  1X3U A;  2A6E F;  2P4W A;  2O61 A;  1R7J A;  2O0Y A;  1R1T A;  1HKQ A;  1GHC A;  3JSP A;  3S2W A;  4U0Y A;  2P8T A;  1D3Y A;  2VE9 A;  4BQA A;  5LBQ A;  4ENM A;  4KUM A;  4EJT A;  2VOO A;  2HTS A;  2V6C A;  2PI0 A;  5D6E A;  3F6O A;  3KET A;  3TDU C;  4IVN A;  3WE2 A;  4BAY A;  2HEO A;  2NNN A;  1MDM A;  2J5O A;  1FBU A;  3FMS A;  2P5V A;  2VBX A;  3FHZ A;  1SFE A;  5HDN A;  4G7O F;  2TDX A;  2K4J A;  1LDJ A;  4U88 A;  3DV8 A;  3GW2 A;  5FD6 A;  1DPR A;  4YFX F;  1YS6 A;  1KQ0 A;  2KIF A;  4CIC A;  2G7U A;  4A0Y A;  1DUX C;  3HTU A;  4Y17 A;  3DQV C;  2ZBK A;  3IRQ A;  3QP6 A;  2FF4 A;  2RN7 A;  2XAS A;  3JTH A;  3MCZ A;  2M87 A;  5LHG A;  3QAH A;  5L3F A;  3O2P E;  3QOP A;  4ZH4 F;  2WTE A;  3WTY C;  3BRO A;  3ROU A;  1DPU A;  4ASN A;  2P5K A;  2YPR A;  4CO8 A;  1H9T A;  2P5L C;  3T0Y A;  1MDM B;  4LLG F;  1UFM A;  4ZZL A;  2RGV A;  3L00 A;  1QPM A;  3IWZ A;  4HX4 A;  4QLC U;  3TOA A;  2F5E A;  4BNC A;  3KZZ A;  3FXQ A;  5E8I A;  5JI6 A;  4P9F A;  2GQQ A;  2IA2 A;  2ZNZ A;  2QQA A;  3VOE A;  4CGZ A;  3IL2 A;  1T38 A;  4HZF A;  5ICG A;  3RPU A;  1ZLJ A;  3M8F A;  1P4X A;  5BQT A;  2EFP A;  1OPC A;  3I4P A;  4MHG A;  1U3E M;  1S8N A;  2H94 A;  3CDH A;  5BPI A;  4EJO A;  4AD9 A;  1E17 A;  4H0E A;  2A5Y B;  2EK5 A;  4Z2Y A;  1HSJ A;  2AXL A;  2ZFW A;  2YU3 A;  2CGP A;  4EM0 B;  1DP7 P;  3DXJ F;  1OMI A;  4U0V A;  3WU1 B;  2EFO A;  2BV6 A;  2E1N A;  3J81 Z;  1H0M A;  1I1G A;  1ZGJ A;  1FX7 A;  2XGX A;  4KN7 X;  1BIB A;  2A3S A;  3HOT A;  2L02 A;  1QZY A;  4A12 A;  4AIK A;  2ZME A;  1HKS A;  4FT8 A;  1SFX A;  5CVR A;  1LNW A;  1BI2 A;  5KK1 A;  4KMF A;  2HDC A;  1EH6 A;  2H27 A;  1U6G A;  2XRN A;  3R0J A;  3HYI A;  4P96 A;  3LWF A;  2WC2 A;  2IPQ X;  3C3W A;  1TQM A;  3LA2 A;  5FFZ A;  1YFH A;  4R1H A;  4E70 A;  1HW2 A;  5LRS A;  1CF7 A;  4RB1 A;  2FE3 A;  1BC7 C;  2L54 A;  4XBF A;  1IF1 A;  2K02 A;  4IHS A;  1W5T A;  1TNT A;  5F64 A;  4ZYE A;  3EUH A;  3E5U A;  3CTA A;  3H3U A;  2X0L A;  2GXG A;  3P9I A;  3EYY A;  4HA8 A;  4K2E A;  3F21 A;  2YR2 A;  1D8J A;  2JPC A;  3R61 A;  1R00 A;  4KFC A;  4MQ9 F;  2ZME B;  1KA8 A;  2F5D A;  1IXS B;  2BBY A;  3GFJ A;  2P7V B;  3V8K A;  4DQ2 A;  3CUQ A;  1TW2 A;  3TO7 A;  3LFK A;  5HVQ C;  1OYI A;  5DD8 A;  3SXY A;  1T39 A;  4GXO A;  2QLZ A;  3GVA A;  3PQK A;  4HYE A;  3U2R A;  1CF7 B;  1B59 A;  2EB7 A;  4U0W A;  1Z1D A;  2RNJ A;  1R1U A;  1IW7 F;  1ZG3 A;  2DT5 A;  4EMS A;  2C6Y A;  1FT9 A;  4UV8 A;  4FX4 A;  3E97 A;  2K86 A;  4ENK A;  1XD7 A;  3B73 A;  2Y75 A;  3GZ5 A;  4MEY F;  1TBX A;  4RGR A;  2VXZ A;  3HHH A;  4P55 A;  3R60 A;  5ICF A;  2OBP A;  3WOD F;  4UNO A;  3E6M A;  1PP7 U;  5HS7 A;  2MLK A;  2P6S A;  4GGG A;  3ECO A;  2FQ3 A;  5H20 A;  3DFG A;  1FBS A;  1MKM A;  1B1B A;  1T98 A;  5K5R A;  3CUQ B;  1ZG1 A;  4KIB A;  1WQ2 A;  3I53 A;  3F23 A;  2HGC A;  3ECH A;  2D45 A;  1WWX A;  4M74 A;  1U8R A;  5HLI A;  2FBI A;  1FP1 D;  4ENN A;  3D0S A;  2NYX A;  2NS0 A;  3BOQ A;  2ESH A;  1ZRF A;  3HSF A;  4A0Z A;  4HQE A;  2EFQ A;  3HRS A;  3RDI A;  4ZYH A;  5K5Q A;  5CJ9 A;  1XDU A;  2O3F A;  2NNY A;  3LAJ A;  3FZV A;  4G9Y A;  4XSX F;  1J2X A;  4L0Z B;  2YX7 A;  1XN7 A;  2JT1 A;  1QGP A;  1R22 A;  2CFX A;  4HOB A;  2LNB A;  2GA2 A;  4KIG A;  2XHK A;  2GIV A;  1JGS A;  2RC4 A;  3ELK A;  3GXO A;  1YS7 A;  2CQK A;  3WE3 A;  5LGN A;  3ZMZ A;  2EV5 A;  1EH8 A;  2RQP A;  4BHB A;  4LLL A;  4MGR A;  4CYD A;  2O8X A;  1KU9 A;  1J5Y A;  3RYR A;  5J6X A;  3T5X A;  4EGZ A;  3FMQ A;  3F22 A;  2H6B A;  3WTX C;  3GYH X;  1FLI A;  5CVV A;  3GEZ A;  5CVU A;  4RS8 A;  2H09 A;  3ISP A;  2PQ8 A;  2PLY A;  1U5T A;  1I1S A;  4BHC A;  3SQN A;  2BYV E;  5A2Q K;  2M1B A;  3M7G A;  2M5W A;  2IRF G;  2PMU A;  1TQI A;  4UHT A;  2Z33 A;  2DK8 A;  3F8B A;  4WWC A;  3DPL C;  4KYW A;  2CYY A;  2MD5 A;  1FYL A;  2V1U A;  1XGM A;  1BN5 A;  2VON A;  4EM1 A;  5TRD A;  4ZZD A;  4O5V A;  4S05 A;  3WGI A;  3IWF A;  1R5G A;  1ZG5 A;  1QZZ A;  4FX0 A;  4O6J A;  2P7C B;  3K1P A;  1HW5 A;  4M9S A;  4RAZ A;  5H6R A;  4I09 A;  4LGW A;  5TJJ A;  1XGO A;  2OD5 A;  4FHT A;  1I5Z A;  3F72 A;  1DDN A;  3E5Q A;  1U5T B;  2D2W A;  4JK1 X;  2UZK A;  4WXD A;  5HDG A;  4ENJ A;  1IAW A;  1ZLK A;  3W6J B;  2VT2 A;  2DK5 A;  5L3E A;  1RZ4 A;  2QQ9 A;  2F2E A;  3ZPL A;  4LFU A;  4KA4 A;  2CWE A;  4L18 B;  1NHA A;  3F3X A;  3RYP A;  4L5J A;  3LQQ A;  4Q48 A;  1S3J A;  3CJN A;  2EWN A;  4HLX A;  4UVC A;  3IRR A;  3KLO A;  1AWC A;  5ICE A;  1PUE E;  4IF4 A;  3WTS C;  1Z7U A;  4MTE A;  1J59 A;  2MC3 A;  2LF7 A;  4Q5S F;  1UHW A;  3WGH A;  2GAU A;  3T8R A;  1BM9 A;  5LEJ A;  5CYV A;  1FYM A;  1ZAO A;  5FFX A;  1XCV A;  4LG0 A;  1G4D A;  1K78 A;  2BGC A;  1MJ9 A;  3GFL A;  1RNL A;  3FWE A;  3HHG A;  2HZT A;  4IRG A;  2XAQ A;  2EV6 A;  1LDD A;  2LDU A;  1R58 A;  1LQ1 A;  6PAX A;  1SMY F;  2EFN A;  3HSE A;  4HBL A;  3E5X A;  4PGG A;  2HWV A;  1FSE A;  1UCR A;  1P4A A;  4YG2 F;  3K69 A;  2DI3 A;  3L09 A;  2W25 A;  1USS A;  4LLN A;  2Z99 A;  1RUN A;  2MBF A;  1XCB A;  4WF2 A;  2DW4 A;  2GA1 A;  1KU7 A;  3P9C A;  3HRU A;  1YW8 A;  3RI4 A;  1B9N A;  2GXB A;  3FXU A;  1C0W A;  3ERE D;  1B6A A;  5BOX A;  1ZYR F;  1YW9 A;  2ZXJ A;  5JR3 A;  2QWW A;  3RIR A;  3KP6 A;  3GZ6 A;  5A2Q Z;  4RB3 C;  4LG0 B;  1WI9 A;  1K78 B;  4HAM A;  1L3L A;  3BY6 A;  2R3S A;  4G7H F;  2R7D A;  4G6D A;  2FXA A;  4ETS A;  3DP7 A;  1W4M A;  3V4G A;  2Y48 A;  3B02 A;  3TO9 A;  4P5O A;  2D1V A;  3BP8 A;  4IXA A;  2DFI A;  4L9V A;  1XSD A;  2VBW A;  2K4B A;  1IZ1 A;  3TGN A;  4I0A A;  3JTG A;  3OOP A;  4HDU A;  3CUQ C;  3SFZ A;  3VEP A;  2E7W A;  4A5M A;  3V8L A;  3REO A;  1W7P D;  4XLP F;  2UWM A;  2J5P A;  1IN4 A;  3RPQ A;  3O3K A;  2PG4 A;  1WRJ A;  1YO5 C;  4M71 A;  1R23 A;  3H3Z A;  4Q47 A;  3ZP5 A;  4ON0 A;  4HF0 A;  4XSZ F;  2PN6 A;  2OZ6 A;  1W7P A;  2HTJ A;  1SMT A;  2XAF A;  4M72 A;  1ZRD A;  2HOE A;  4CHU A;  1MJA A;  4ESJ A;  4Y15 A;  3KFW X;  2ADU A;  3WTZ A;  4LD5 A;  3M8E A;  3MAJ A;  5ILU A;  2OZU A;  1MJB A;  2FRH A;  1XMA A;  5FO5 A;  2PBI A;  2IJL A;  1EH7 A;  4WK8 F;  1L0O C;  3TKY A;  1LEB A;  1ONV A;  3NRV A;  4UV9 A;  2IW5 A;  2V1X A;  1FOK A;  2EJR A;  3EQL F;  4EV0 A;  4KIF A;  1TQP A;  3RKW A;  2BE5 F;  4G7Z F;  4B8X A;  1ON1 A;  2YX4 A;  1XDS A;  4RB0 A;  4WX9 A;  2PMH A;  2RVC A;  1HXD A;  1W7P B;  1ZHF A;  5D4S A;  4R8H A;  5DUK A;  1D8K A;  3LST A;  4EJU A;  1Z91 A;  4LK0 F;  2LSO A;  4PGH A;  1O7F A;  3R6S A;  2VE8 A;  4HX7 A;  3KEO A;  2MH9 A;  3KP5 A;  4ESB A;  1R5H A;  1HW1 A;  1G6N A;  4LJZ F;  2B0L A;  2KRF A;  1XB4 A;  3FMR A;  4OOI A;  1G3T A;  2RDP A;  1F1Z A;  1K79 A;  3PQJ A;  3Q5F A;  4UUV A;  3N4M A;  4HQM A;  3FM5 A;  4B09 A;  1R36 A;  1LDK B;  4IRH A;  1T0F A;  4NHJ A;  2CG4 A;  1O3T A;  4P9U A;  2DQR A;  4L5I A;  1BBY A;  5BS6 A;  1EV7 A;  3FM3 A;  3EDP A;  4GCV A;  1SD4 A;  3KP7 A;  3ABT A;  5IT9 K;  4OIP F;  4HF1 A;  1GVJ A;  2IT0 A;  5LGU A;  3IC7 A;  3RKX A;  3IKT A;  4MTD A;  1U5T C;  3SZT A;  2EFW A;  2OU2 A;  2RKH A;  2ISZ A;  1STZ A;  3TQN A;  4N0B A;  2XAH A;  2KKO A;  4D0P A;  1ZGA A;  2JTV A;  1PDN C;  2PEX A;  2VT3 A;  1FC3 A;  5IT3 A;  5AIP A;  5H6Q A;  3L9F A;  1ZH5 A;  1Y0U A;  1F9N A;  2DPU A;  1YYV A;  1J9I A;  4EJV A;  2O6G E;  1FYK A;  2ZKZ A;  3F6V A;  1V3F A;  3O6B B;  1TNS A;  2FBK A;  4KMU X;  2ZCW A;  3E3V A;  3MEX A;  4UXN A;  2L3D A;  3IHU A;  1U2W A;  3I71 A;  3N97 A;  2DO7 A;  3CLO A;  2DU9 A;  2OAZ A;  2STT A;  5LGT A;  1O7L A;  5ED4 A;  3KP2 A;  5E1W A;  1SFU A;  2JZY A;  2D1H A;  5DCF A;  2MA3 A;  4GO1 A;  3KZY A;  1YW7 A;  3LA7 A;  4XRF A;  5E8G A;  3DEU A;  3GUD A;  4S04 A;  3OV8 A;  2L4M A;  2VOD A;  3I0T A;  4OIO F;  4I02 A;  3JAM K;  2L01 A;  3ML6 A;  2HKX A;  2E7X A;  5DV5 A;  2CO5 A;  3CUO A;  5D4R A;  5ILS A;  5LEK A;  1E2X A;  1BC8 C;  1BI1 A;  5FLX K;  2QUF A;  5K5O A;  2V1D A;  1A04 A;  2XUB A;  1S7O A;  3ZN0 A;  3VFZ A;  4LMY A;  3BZ6 A;  2HQR A;  1G3W A;  5D5U B;  2VOP A;  2F5C A;  4KIC A;  1MD0 A;  3T8T A;  2QVO A;  1JHF A;  3H92 A;  5DCM A;  1OR7 A;  3GFM A;  1IN6 A;  1SAX A;  3KCC A;  5DUI A;  5F6F A;  1RIO H;  3ZMS A;  1KYW A;  5LHI A;  2O03 A;  2JSC A;  3IKV A;  2EA2 A;  2MLG A;  4MEX F;  1LB2 A;  3PFI A;  2A07 F;  1LJ9 A;  3GO5 A;  4G94 A;  5E1Z B;  5D8K B;  3WU0 A;  2QEN A;  3BJA A;  1HST A;  2Z5U A;  4OIR F;  1B4A A;  3BPV A;  4WXH A;  2FNP A;  2Z9O A;  2UXN A;  1Z6R A;  4JBA A;  3KE2 A;  4UVB A;  5CVJ A;  3TDZ C;  5DCM B;  4NQW A;  3HTS B;  4GYI A;  1KU2 A;  3NQO A;  4HV6 A;  2HKO A;  5AON A;  5K1Y A;  2DAO A;  4HF2 A;  1S7A A;  2A6H F;  1JHH A;  3GLX A;  4I2O A;  3SHF A;  2W84 A;  3G73 A;  5IT9 Z;  3K9T A;  2A69 F;  2LKP A;  3LQR A;  3G3Z A;  1Z05 A;  1LVA A;  4UVA A;  2ACJ A;  3V8J A;  4M6X A;  4I98 B;  1BIA A;  4HLY A;  2Q8K A;  4DNC A;  5L3C A;  1QBJ A;  4RB2 C;  1RI7 A;  5J8C A;  1SD7 A;  2KIM A;  2STW A;  2KJC A;  1YTY A;  1XMK A;  2XRO A;  3EYI A;  1F4K A;  4L9J A;  4A0X A;  2W85 A;  1IN5 A;  2WV0 A;  3J80 K;  1FSH A;  2R7F A;  5D5W B;  5D5X B;  5LRR A;  3D5L A;  1S29 A;  5KVR A;  1FWZ A;  2ESN A;  3QPT A;  4ZYG A;  3TO6 A;  1T2K A;  5F1R A;  2VC0 A;  4YFK F;  2ETH A;  1PP8 F;  5EEH A;  3JAM Z;  4RGS A;  1IXR C;  1ZRE A;  3HRM A;  4R79 A;  3E6C C;  5FD5 A;  5J8F A;  4L0Y B;  4ZYD A;  1BI3 A;  2BEO A;  1TTY A;  2COM A;  4ESF A;  4EJW A;  2W24 A;  4MQV A;  3ZQ7 A;  5FLX Z;  1RUO A;  2QYO A;  1FPQ A;  4MNU A;  4A6D A;  5DDG A;  5L3G A; 
#chains in the Genus database with same CATH topology
 2BW3 B;  2EZK A;  2K9N A;  3PM1 A;  3HSR A;  2HDW A;  1IN8 A;  3SYT A;  1V5E A;  2CQQ A;  3CDL A;  3TL4 X;  3I55 I;  2M8E A;  1WZ2 A;  4J19 A;  3GCM A;  4HV5 A;  1YQA A;  1D1A A;  2DMN A;  1QHH D;  1UMQ A;  3IAM 2;  4EVI A;  1O3Q A;  2WBM A;  2P6T A;  2L9V A;  3HIF A;  1JE8 A;  3K1N A;  3DTI A;  2LMD A;  3VB2 A;  1IC8 A;  1KYZ A;  2Q0O A;  3FX3 A;  3MD2 A;  3OYN A;  3C1D A;  1D1C A;  1Y56 A;  3F8N A;  2JN6 A;  3OL3 A;  3DEW A;  2BY1 A;  2BY0 A;  1TT5 B;  2R7O A;  4NC7 A;  1OKR A;  3KLN A;  5ICC A;  2A61 A;  5K7H A;  3E0J B;  3OYD A;  3L2W A;  1MBH A;  3EET A;  5C4X J;  1U78 A;  2WWY A;  3K70 C;  1WPK A;  2DT6 A;  2CV2 A;  2MSY A;  2NAZ A;  3ZR8 X;  3ZMU A;  2VKE A;  2FMY A;  5EF6 A;  1REP C;  3BDD A;  2Y0M A;  1BJA A;  3W2W A;  4LK1 F;  5HOO A;  2FU4 A;  4F52 A;  2DPD A;  5IYC J;  3BTJ A;  1AOY A;  3DKW A;  1Z77 A;  5LLQ A;  3OYG A;  3CD6 I;  2IGK A;  2X1E A;  2LBF A;  1S72 I;  4HX8 A;  2HU9 A;  5EZG A;  2I8D A;  3I5U A;  1TC3 C;  1Z3Y A;  1LEA A;  1LE8 A;  2ZO4 A;  3QPS A;  2PJP A;  4YII A;  3G71 I;  4JX6 A;  3JRF A;  1X1D A;  1G3S A;  2CSO A;  1AU7 A;  3VYS B;  4JQF A;  1BI0 A;  2EA4 A;  3FBI B;  2R7R A;  5DYM A;  2AS5 F;  5HLH A;  4G6Q A;  2UXX A;  3K2Z A;  3BCA A;  1Z6T A;  2E5Z A;  2M34 A;  1ZAR A;  3P7N A;  2QM3 A;  4OMY A;  5GTI C;  5D5V B;  3UNG C;  5J47 A;  3COA C;  1HA8 A;  2JRM A;  4IJA A;  4DGW B;  2HS5 A;  2FNA A;  3OS1 A;  2Y2Z A;  2QBY A;  3S2D J;  1T0F C;  2IA0 A;  3BJO A;  3HOS A;  3DU5 A;  2ISY A;  5ILV A;  2RQQ A;  3K7A J;  1UG2 A;  3LA3 A;  3O8G A;  1IRG A;  4AWX B;  3QYF A;  1IDY A;  2N8G A;  2ZJ2 A;  3ZCO A;  2FML A;  2A68 F;  4N9H A;  3I54 A;  3PSF A;  1R4N B;  1OJL A;  3BG6 A;  1OYW A;  1XGS A;  3F8C A;  4GYG A;  5E3M A;  2TCT A;  1LFU P;  2ID3 A;  1P6R A;  2FJ1 A;  3WTU C;  2BZT A;  4XNF A;  3LSH A;  5FKK A;  2MG4 A;  3J7Y J;  2CFO A;  1ODD A;  4OU0 A;  2LBF B;  4PDK A;  1O57 A;  2ZJR F;  1W5C C;  1Q1H A;  5CLS A;  3SDB A;  4OIN F;  4WCG A;  1ZRC A;  2EZL A;  2EIK H;  1O3S A;  2PMZ N;  4CCL A;  1LE8 B;  4IPA A;  2HVQ A;  4DOZ A;  5CKT A;  3CCM I;  3BG7 A;  4FTH A;  1QRY A;  4Q4Z F;  3SJM A;  4OAY A;  4UUT A;  3F8M A;  1FMV A;  3J80 Z;  1E0E A;  4B48 A;  1ERD A;  4AU7 A;  2YSR A;  1OFC X;  4XLN F;  3WTT C;  2UV1 A;  1HKT A;  4MFD A;  1Z3X A;  3P9K A;  1EJ9 A;  3GX4 X;  1U9O A;  3KP4 A;  3BLY A;  4Y4R A;  3L2C A;  1OLT A;  4AVZ A;  1JTX A;  1XC5 A;  1MH3 A;  4M6Y A;  1P2F A;  1K83 J;  1WFX A;  2QBY B;  4WXC A;  1A35 A;  4EGY A;  2VPL A;  4II2 A;  1UST A;  1XS9 A;  2M45 A;  4Y33 A;  3LSM A;  4D5F A;  2ELH A;  3BJ6 A;  2L7Z A;  3SZP A;  3V7S A;  2XAG A;  5ERI A;  3KYL A;  1FNN A;  4FE7 A;  3GZN B;  1T33 A;  3HUG A;  1IRZ A;  4C2T A;  5HOD A;  3O8H A;  9ANT A;  2W57 A;  4BY7 J;  1F5T A;  4KN4 X;  1FY7 A;  4IHV A;  1ZR2 A;  3RSN A;  3KP3 A;  1X3W B;  3QP5 A;  4L9T A;  4RAF A;  4AM3 A;  1X1P A;  5CVI A;  2DBB A;  3RTR A;  4QIW N;  4XRS G;  5HDK A;  3VPR A;  2VBY A;  3KEQ A;  3U1D A;  2OA4 A;  2WA0 A;  2X4H A;  5GAE J;  4Y52 J;  3HOY J;  1MGT A;  1W0U A;  4A5N A;  1TWH J;  1FOY A;  3FXK A;  3WTW C;  5CQE A;  3JRE A;  1BL0 A;  3HDD A;  1WJE A;  3HM5 A;  4Z6Y A;  4S0H B;  3QU3 A;  1J0R A;  2K5C A;  2KJB A;  2XPV A;  3G1L A;  2OPT A;  3K4M A;  3IP4 B;  2XAJ A;  5B1B H;  3ZMD A;  3MKY B;  3RKY A;  4F93 B;  2WB1 N;  5F0C A;  3V7C A;  4U7D A;  2VLA A;  1CQT A;  2DLL A;  5E79 C;  2HYF A;  2R7W A;  5LHH A;  1JJ6 C;  2VBZ A;  3S2H J;  5JHU A;  4FCY A;  4CXF A;  4A93 J;  3MZY A;  4OMZ A;  4I01 A;  2JA5 J;  1SD6 A;  4G6T B;  5E20 A;  3BPX A;  4AYB N;  3DPU A;  5F0F A;  4A3F J;  1UB9 A;  1BR1 A;  3WG9 A;  1DGW Y;  5E18 F;  3HUG B;  1ETW A;  1OR7 C;  1LFP A;  1X2M A;  2DQL A;  1KGS A;  3R4K A;  3ZRG A;  1YIO A;  1IRF A;  3QPH A;  3BR6 A;  3T1B A;  5D6F A;  2VB6 A;  4PCQ A;  1OCP A;  4IRI A;  4X6A J;  2HPM A;  4KT5 C;  2E1C A;  2KIS A;  2CV1 A;  4DYC A;  1XSX A;  5HNH A;  3ULQ B;  4A6E A;  3QRF F;  4QWQ A;  2A5W A;  1MZB A;  2NS7 A;  3K1M A;  3GWZ A;  3FXR A;  3S32 A;  4CDG A;  1PVE A;  1JUP A;  4BEH A;  1GXQ A;  2ZJQ F;  4HDV A;  1Z9C A;  2XVC A;  1B9M A;  1FP2 A;  1HBX G;  1T95 A;  3HGY A;  2L4A A;  2K40 A;  5B66 C;  3BR0 A;  3CO6 C;  4BBR J;  4HW0 A;  3TMO A;  3E6D A;  1QO0 D;  4Y13 A;  4ZTF A;  4PJ0 C;  3IH3 A;  1J75 A;  3ABU A;  3TOB A;  1I27 A;  2HPI A;  2VN2 A;  3F8F A;  5DEQ A;  1VQK I;  2IS1 A;  3G1M A;  5E17 F;  3ZQF A;  5JFR A;  2PJR A;  1MND A;  1IRX A;  3SEQ A;  1ETQ A;  5D8L B;  2CW0 F;  4G8X A;  5HLG A;  4IQJ A;  3IUO A;  2EIM H;  1D5V A;  2FUG 2;  1WKM A;  1UHM A;  3MWM A;  3PUB A;  1FBQ A;  3MZH A;  2JRT A;  5HS8 A;  1JXS A;  1G3Y A;  4A3C J;  3Q9V A;  5HS9 A;  3WTV C;  4KDP A;  1ZEL A;  2K27 A;  2K7L A;  3I64 A;  1H88 C;  1KQ8 A;  2JVG A;  4CZC A;  4BH9 A;  4FAS D;  3L2U A;  2HR3 A;  3U9G A;  3BQY A;  3S15 J;  2JA6 J;  2H6C A;  2V79 A;  2EPF A;  5E1X A;  4OIQ F;  1KQ9 A;  1KU3 A;  2OCC H;  2RV8 A;  4KNY A;  5K7F A;  3CO7 C;  2L0K A;  2PFB A;  1IUY A;  2HOS A;  3LL7 A;  1HDD C;  3C18 A;  1WSU A;  4QSH A;  4FIS A;  1ZN2 A;  4EM2 A;  4BEH B;  4BYY A;  5DD4 A;  1RC9 A;  2DN0 A;  3NAU A;  2A6T A;  4M9X A;  3CJQ B;  2DMU A;  4BUP A;  1Y8R B;  5BPD A;  2X9D A;  1K6O A;  1MNE A;  1DU0 A;  1GT0 C;  2G9W A;  3MN2 A;  4BXU A;  4I0B A;  2XIG A;  1QQI A;  3I59 A;  3LSK A;  2BVL A;  3I4N J;  2QZ8 A;  4YFN F;  3HOU J;  3JW4 A;  3HRT A;  1YG2 A;  1JKQ C;  4TV7 A;  2HQN A;  3BQZ A;  2PJR B;  2ZNY A;  3GF2 A;  3WGG A;  1W36 D;  4IHX A;  4AC0 A;  3PL8 A;  4NBQ A;  5L3D A;  1VTN C;  2E71 A;  4C30 A;  4N4N B;  2FA5 A;  2XKO A;  3V7R A;  1FZP B;  2LFB A;  3WHB A;  4F7Z A;  3CCV I;  1APL C;  2VC1 A;  3W6K B;  1FTT A;  4AIH A;  2Y31 A;  3K0L A;  1F43 A;  3EUK L;  3R0A A;  5IP7 J;  2OQR A;  2FSW A;  1YX5 A;  3DPT A;  3M1C A;  1OYY A;  4EEF G;  2XKP A;  5L3B A;  1SEU A;  4YIF A;  3AAF A;  1RES A;  4BAC A;  3VOD A;  2F4O B;  4L9N A;  3V42 A;  3MQ0 A;  1ON2 A;  4BHP A;  2XGC A;  1N77 A;  2XPU A;  4YIR X;  4JX5 A;  2CUF A;  3GFI A;  2ZXW H;  1SD5 A;  3W2A A;  4CCM A;  2DA1 A;  5FKN A;  1R49 A;  3ONQ A;  2GBY A;  4U87 A;  1WJ5 A;  4A3K J;  3HOW J;  1WI3 A;  2DTR A;  1P4W A;  1V4R A;  2Q2E A;  2FBH A;  3Q9S A;  1S6L A;  3J7A O;  3JRG A;  2YU9 J;  4BJ6 C;  1I6X A;  3DBH B;  5JVT A;  4PZJ A;  1XGN A;  3MFK A;  2QQ8 A;  1K7A A;  4RGX A;  1T6S A;  3AL0 B;  3DKX A;  3GBG A;  2FOK A;  2F5F A;  1P92 A;  1HDP A;  3I59 B;  4L5E A;  2OQG A;  4A2U A;  1IJW C;  1P9Q C;  2V9V A;  5KAF C;  4A3B J;  4AVP A;  3JCU C;  3PJR A;  2DA7 A;  3K4J A;  2Z3Y A;  3LOC A;  1IDZ A;  3AKZ A;  1YLF A;  2WB1 A;  4IHT A;  1Y39 A;  4I7H A;  2VJI A;  1TW3 A;  5AIQ A;  4N9I A;  5BMZ A;  1XSV A;  4MO7 A;  3A2K A;  4LB6 B;  4RGU A;  3NEU A;  1N25 A;  4CCK A;  4IO9 F;  2EV0 A;  2W1O A;  1W5S A;  4AIJ A;  3DF8 A;  1J7K A;  4BJ5 C;  2BVM A;  2E1M B;  1O3R A;  3ZN1 A;  2HFH A;  2BOL A;  2DOF A;  2EIN H;  2LF8 A;  4M9Z A;  1X1B A;  3FF5 A;  3L7W A;  4LIU A;  3CF5 F;  4NB5 A;  2KIU A;  1CGP A;  1TLH B;  4RAY A;  2M7B A;  2H8R A;  3S1N J;  5GP9 A;  4XQF A;  5FB2 A;  5FGM A;  1ITY A;  2IP2 A;  1HQC A;  2QQB A;  1MBJ A;  3OIQ A;  2RNG A;  2BY2 A;  4ZDP A;  1R9T J;  3KZI C;  3M9A A;  3FXL A;  3RJP A;  1H9G A;  3H36 A;  1WJC A;  3D1N I;  3ZMT A;  1IN7 A;  1GXP A;  2E1O A;  3J81 K;  1ULY A;  2FEZ A;  1SVO A;  4ZJZ A;  2GWR A;  1SAN A;  4CZZ A;  2Q2E B;  1R1V A;  1ZKG A;  2NRA C;  3BWG A;  3C7J A;  1SFK A;  4EQQ A;  1QNT A;  3QU6 A;  2W82 A;  2QCO A;  2JPB A;  1V5F A;  1QZE A;  3BT9 A;  3ZMV A;  1IO2 A;  1E3O C;  3UKG A;  3M1E A;  3VDX A;  2IA1 A;  3E6B A;  3I58 A;  3JSO A;  3K6G A;  3Q0V A;  2IVM A;  2LG4 A;  5B3S H;  2MH2 A;  1LVK A;  2CUE A;  3X2Q H;  4U7B A;  4BBS J;  3CC7 I;  2BXY A;  5BNG A;  3M4O J;  2GZW A;  2EIL H;  4M73 A;  3CMA I;  1H8A C;  3LAP A;  5GAG J;  2M30 A;  1FMW A;  3ZQI A;  4LB5 A;  3BZK A;  2G7H A;  3Q0W A;  2F4I A;  1BOA A;  2HYG D;  5EEG A;  2XV4 S;  2QSF X;  4O3M A;  1X3U A;  2A6E F;  2P4W A;  1IUF A;  1Z21 A;  4XKV A;  4CCJ A;  1AKH A;  2O61 A;  1R7J A;  3HL2 A;  5HLT A;  5DM7 F;  2XF7 A;  2O0Y A;  2DJI A;  1R1T A;  1HKQ A;  3FK7 A;  4F55 A;  2R7U A;  1GHC A;  3JSP A;  3S2W A;  2XF6 A;  4U0Y A;  2DDA A;  4XK4 A;  4H4K C;  2P8T A;  3GME A;  1D3Y A;  2VE9 A;  5E3L A;  4D5C A;  4BQA A;  5LBQ A;  3SZG A;  2E2I J;  1JUS A;  3H9G A;  4ENM A;  3EPZ A;  4KUM A;  2LOO A;  1Y8Q B;  2L7K A;  3AG1 H;  4EJT A;  2VOO A;  3L2R A;  2HTS A;  2V6C A;  2PI0 A;  5D6E A;  1A6I A;  4XON A;  3F6O A;  2O9L A;  1MSF C;  3KET A;  3S1R J;  4ITV A;  4A3G J;  3TDU C;  4IVN A;  1ZK8 A;  3WE2 A;  4BAY A;  2HEO A;  3GTP J;  3JR9 A;  2NNN A;  1MDM A;  2CW7 A;  2JSP A;  2R5Y A;  1X1C A;  2J5O A;  1FBU A;  1G59 A;  5C4J J;  3FMS A;  1MMD A;  3CMM A;  2W7N A;  2P5V A;  1MW7 A;  1YI2 I;  4XLE A;  4XM3 A;  4PFP A;  4XID A;  2VBX A;  1XTA A;  3FHZ A;  1VF9 A;  1SFE A;  1ETO A;  5HDN A;  5E3N A;  1VQP I;  1YJW I;  4G7O F;  2DTZ A;  3LSI A;  2TDX A;  3GTL J;  2K4J A;  3PO2 J;  2XSD C;  1VQ7 I;  1LDJ A;  4U88 A;  3DV8 A;  5C44 J;  2VKH A;  3GW2 A;  5FD6 A;  1DPR A;  4YFX F;  1YS6 A;  2L2O A;  1KQ0 A;  2KIF A;  4CIC A;  1AKH B;  2G7U A;  4A0Y A;  1DUX C;  4PJN A;  3HTU A;  4Y17 A;  4AUX A;  3DQV C;  2VQH A;  1OCO H;  2ZBK A;  3PIO F;  3IRQ A;  2LY2 A;  2ME0 A;  1OIS A;  4BE2 A;  4IHW A;  3QP6 A;  1UEL B;  2FF4 A;  2RN7 A;  2XAS A;  1MBE A;  3FK6 A;  2ELK A;  3AG4 H;  3IAS 2;  3JTH A;  3MCZ A;  2M87 A;  5GPC A;  3RZO J;  5LHG A;  5F0H A;  5L3G A;  1YHQ I;  3QAH A;  2KDO A;  2EZH A;  3QYB A;  4MIM A;  1PJR A;  3O2P E;  5L3F A;  3QOP A;  3I56 I;  2WY8 Q;  2WAF A;  4ZH4 F;  2FD5 A;  2WTE A;  3WTY C;  3BRO A;  3ROU A;  3OR1 C;  1DPU A;  3CCU I;  3TW6 A;  4ASN A;  3LSR A;  4HG2 A;  2P5K A;  2YPR A;  4LG3 A;  4CO8 A;  1H9T A;  2P5L C;  2JMW A;  4B44 A;  3RPU D;  3PNT A;  3T0Y A;  1MDM B;  2R5Y B;  4LLG F;  1UFM A;  4NNJ A;  1I6H J;  4ZZL A;  2RGV A;  1X3Z B;  3L00 A;  3ASN H;  2E60 A;  1QPM A;  1YRN A;  3IWZ A;  5IYD J;  3KIO A;  4DBR A;  4B3A A;  3WU2 C;  2DXI A;  4HX4 A;  3PIP F;  4QLC U;  3TOA A;  3DBR B;  2F5E A;  4F3Q A;  1A5J A;  4BNC A;  3KZZ A;  2Z1D A;  4RA2 A;  2NVT J;  3FXQ A;  5K7Z A;  5E8I A;  5JI6 A;  2GOX B;  2LD5 A;  4NC8 A;  4P9F A;  2GQQ A;  2IA2 A;  2ZNZ A;  2QQA A;  4IEJ A;  3VOE A;  4CGZ A;  3OL4 A;  2ICW G;  3IL2 A;  4I6Z A;  4A3J J;  1T38 A;  2GIZ A;  1S7E A;  4HZF A;  2DFF A;  5ICG A;  3RPU A;  1ZLJ A;  3M8F A;  1P4X A;  5BQT A;  4OAZ A;  2EFP A;  3CC2 I;  1OPC A;  3I4P A;  4IKF A;  3CCY A;  3CCE I;  4MHG A;  1U3E M;  5F1J A;  1S8N A;  2R93 J;  2JVH A;  2H94 A;  1AA7 A;  3CDH A;  2H1K A;  3PUF A;  4EJO A;  5BPI A;  2XGE A;  4AD9 A;  1E17 A;  2P0W A;  4V2F A;  3Q0U A;  4H0E A;  3HOV J;  3OYL A;  1FOW A;  2A5Y B;  2EK5 A;  2JUC A;  4Z2Y A;  1HSJ A;  2AXL A;  2ZFW A;  1QVU A;  2ELJ A;  2YU3 A;  2CGP A;  1HC8 A;  1N75 A;  2M2E A;  5GTH C;  4EM0 B;  1DP7 P;  3DXJ F;  4CSW A;  1OMI A;  4U0V A;  3WU1 B;  2DA4 A;  2EFO A;  2BV6 A;  4JP0 A;  2E1N A;  3J81 Z;  1H0M A;  2KL4 A;  1V55 H;  1I1G A;  1ZGJ A;  3OS2 A;  1FX7 A;  2XGX A;  1BR2 A;  1YRN B;  4KN7 X;  1BIB A;  2A3S A;  3HOT A;  2L02 A;  1QZY A;  4GDF A;  4JX4 A;  4A12 A;  2K9Q A;  2K9M A;  4AIK A;  4GRI A;  1BOB A;  3ABK H;  1NK3 P;  4E7J A;  2QKL B;  2VQL A;  1W0T A;  2ZME A;  4NDL A;  3K4L A;  1HKS A;  4FT8 A;  2LRE A;  4DYR A;  1SFX A;  5CVR A;  1LNW A;  1BI2 A;  5KK1 A;  4KMF A;  2HDD A;  2HDC A;  4HNU A;  1EH6 A;  4HNV A;  2H27 A;  1U6G A;  3HPH A;  2XRN A;  4M3E A;  3R0J A;  3HYI A;  4P96 A;  3LWF A;  2WC2 A;  2IPQ X;  3C3W A;  5IP9 J;  1WH5 A;  3ABM H;  4KIT B;  1TQM A;  2V4J C;  3LA2 A;  5FFZ A;  1YFH A;  4R1H A;  4E70 A;  1IGN A;  3W6V A;  1HW2 A;  5LRS A;  1CF7 A;  4RB1 A;  3J7A Y;  1SAU A;  2NXN B;  2FE3 A;  2KDZ A;  3OYE A;  1I3Q J;  2L54 A;  5IPA A;  1BC7 C;  1IG7 A;  1EKE A;  4XBF A;  1IF1 A;  2K02 A;  4IHS A;  4BQO A;  1W5T A;  1TNT A;  1Y6I A;  5F64 A;  4ZYE A;  5EYR A;  3EUH A;  3E5U A;  3ZGK A;  3CTA A;  3H3U A;  2IGO A;  2X0L A;  2GXG A;  3OWT A;  4UB8 C;  3P9I A;  3HXL A;  1NK2 P;  2DYR H;  3EYY A;  1JKR C;  1GUU A;  2E19 A;  4HA8 A;  3D5R C;  3CP2 A;  4W1U A;  1R71 A;  4K2E A;  3F21 A;  2YR2 A;  1D8J A;  3A02 A;  2JPC A;  3RCO A;  3H5N A;  3BTL A;  3R61 A;  3ZQC A;  1R00 A;  4KFC A;  3FBN B;  4XR6 A;  5FKO A;  4MQ9 F;  2ZME B;  1KA8 A;  2F5D A;  2XGD A;  2R4G A;  1IXS B;  2BBY A;  1K6Y A;  3GFJ A;  2P7V B;  1DQU A;  2UUZ A;  3V8K A;  1K4T A;  4C3J J;  4DQ2 A;  1MMS A;  1XG1 A;  2NVY J;  3CUQ A;  5J4V A;  3FKI J;  1TW2 A;  1I3A A;  2WAD A;  2K3F A;  2NOG A;  3TO7 A;  3LFK A;  5HVQ C;  1OYI A;  5DD8 A;  3SXY A;  1T39 A;  4GXO A;  3AL0 C;  3N05 A;  2KMU A;  2QLZ A;  3GVA A;  3PQK A;  4RM2 A;  5M5X J;  1HCR A;  4HYE A;  2V7F A;  3U2R A;  3KX2 A;  4C3H J;  1B59 A;  1X4P A;  2EB7 A;  2WV1 A;  4B3X A;  1CF7 B;  4U0W A;  1Z1D A;  3QYE A;  2RNJ A;  1O4X A;  2R7Q A;  1R1U A;  1IW7 F;  2DFH A;  1YJ9 I;  3OYF A;  1ZG3 A;  3DBL B;  1JTY A;  2DT5 A;  3B6C A;  4EMS A;  2C6Y A;  1FT9 A;  1WCM J;  4UV8 A;  4FX4 A;  3E97 A;  2K86 A;  4ENK A;  1XD7 A;  3B73 A;  3C2B A;  2GM4 A;  3JRC A;  2MC4 A;  2Y75 A;  3GZ5 A;  4MEY F;  2E1M C;  1TBX A;  4RGR A;  2DCE A;  2VXD A;  2Y9Z A;  2VXZ A;  3HHH A;  1JGG A;  4P55 A;  3R60 A;  5JVG F;  5ICF A;  2OBP A;  5F04 A;  2DFE A;  2WAE A;  3WOD F;  4UNO A;  4D1Q A;  1SC7 A;  3E6M A;  1R4M B;  1Q1V A;  1PP7 U;  5HS7 A;  2MLK A;  2P6S A;  4GGG A;  4BS9 A;  4G12 A;  3G2B A;  3ECO A;  4XLF A;  3JRH A;  2FQ3 A;  2KT0 A;  5H20 A;  4HRI A;  3DFG A;  1W36 C;  1FBS A;  2KZG A;  1MKM A;  1B1B A;  4PK4 A;  1T98 A;  5K5R A;  3CUQ B;  1X4O A;  4PJJ A;  1ZG1 A;  4KIB A;  5E3O A;  1BR4 A;  4J01 A;  2QA4 I;  1WQ2 A;  3FIS A;  3I53 A;  3F23 A;  2L9R A;  2HGC A;  2M0M A;  3OYJ A;  3ECH A;  2D45 A;  1WWX A;  1VQL I;  4M74 A;  1U8R A;  2D5V A;  4XKW A;  4E7S A;  3OR2 C;  5HLI A;  2FBI A;  1FP1 D;  4ENN A;  3D0S A;  2OF7 A;  4BXF A;  4V2G A;  2NYX A;  2NS0 A;  2IGM A;  3BOQ A;  2ESH A;  3QQA A;  3H9J A;  1ZRF A;  3HSF A;  2Y9Y A;  5FRM A;  5JHF A;  1YJN I;  1D0Y A;  2EBI A;  2RRE A;  4A0Z A;  3TBI A;  4HQE A;  1OCZ H;  3FIW A;  2EFQ A;  2XB5 A;  3BZC A;  1QPI A;  2K9L A;  2AHQ A;  3BR3 A;  1UAA A;  2DJN A;  3HRS A;  3RDI A;  4UY8 I;  4B1R A;  4ZYH A;  4BE0 A;  2Z16 A;  3NAR A;  5K5Q A;  5CJ9 A;  1XDU A;  2O3F A;  3S8P A;  2NS8 A;  2NNY A;  3LAJ A;  3FZV A;  1GDT A;  3BTI A;  4G9Y A;  4XSX F;  1UHS A;  1WHU A;  1J2X A;  1D5Y A;  1MBK A;  3NWT A;  4L0Z B;  2YX7 A;  1XN7 A;  2DT7 B;  2JT1 A;  4C3I J;  1QGP A;  1R22 A;  3L1P A;  3BG3 A;  2CFX A;  4HOB A;  1TWG J;  2LNB A;  2VIX A;  3QWL A;  4Y7N J;  2GA2 A;  2HYJ A;  1QHG A;  4KIG A;  2XHK A;  3GTG J;  2JA8 J;  1MH4 A;  2GIV A;  3S1M J;  1JGS A;  2F5V A;  2RC4 A;  2NVQ J;  2XSJ C;  4HNT A;  1RET A;  3JRA A;  3ELK A;  3GXO A;  1YS7 A;  2CQK A;  3WE3 A;  3BR5 A;  2R7V A;  5LGN A;  3ZMZ A;  2JJ7 A;  4RAG A;  1YOV B;  2DA6 A;  2EV5 A;  4BE1 A;  2CV0 A;  1EH8 A;  2RQP A;  4BHB A;  4LLL A;  4MGR A;  4CYD A;  3BG9 A;  2O8X A;  3WHC A;  1KU9 A;  1J5Y A;  3RYR A;  5J6X A;  3T5X A;  4EGZ A;  4XN3 A;  3H35 A;  1FIP A;  3A0B C;  3FMQ A;  4XMY A;  1LKX A;  2H6B A;  3WTX C;  3F22 A;  2CQN A;  3GYH X;  2WAQ A;  4BXX J;  1FLI A;  3ESW B;  5EG0 A;  3GTM J;  2LY9 A;  4A3D J;  2OTJ I;  5CVV A;  3GEZ A;  4B43 A;  2OCE A;  3L2V A;  3VYU B;  4UB6 C;  5CVU A;  3GLL A;  5KCM A;  3DLA A;  2V9P A;  4RS8 A;  5J1U A;  4QPQ A;  2H09 A;  2H1L A;  3ISP A;  1YIT I;  2PQ8 A;  3DTE A;  2H8W A;  1VZ0 A;  4E7Z A;  2PLY A;  1U5T A;  2KHM A;  1I1S A;  4BHC A;  2W00 A;  3SQN A;  5FKL A;  4IHY A;  2JUG A;  2BYV E;  5A2Q K;  2AXT C;  2DA2 A;  2VQG A;  2M1B A;  3M7G A;  2M5W A;  4C2U A;  3HG9 A;  3VSK A;  2IRF G;  2PMU A;  1TQI A;  3A01 A;  4UHT A;  2Z33 A;  1ETX A;  2DK8 A;  3F8B A;  3KYC B;  4WWC A;  3CDI A;  3DPL C;  4XLH A;  4KYW A;  3VYT B;  2X6O A;  1RRJ A;  2CYY A;  5HNF A;  1U9N A;  2MD5 A;  1FYL A;  3DTK A;  3SFI A;  3S1Q J;  4F91 B;  1WGX A;  2V1U A;  1XGM A;  1BN5 A;  2KZV A;  3TED A;  2VON A;  2V6E A;  3FXO A;  4EM1 A;  3QPL A;  4ZZD A;  5TRD A;  4O5V A;  4N4O B;  4S05 A;  2DA5 A;  3WGI A;  3IWF A;  2E34 A;  1Z7L A;  1R5G A;  2KPM A;  1ZG5 A;  4A3E J;  3H3V K;  1SVL A;  3G4S I;  4RLF A;  1YX3 A;  1QZZ A;  4FX0 A;  5KHD A;  4O6J A;  2XC7 A;  2P7C B;  3K1P A;  4KJZ A;  5EG0 B;  4IZZ A;  2O5R A;  4IX7 A;  1HW5 A;  4M9S A;  4RAZ A;  5H6R A;  3OYM A;  4I09 A;  4ZTJ A;  4LGW A;  5TJJ A;  3KEY A;  4PSW A;  1BW6 A;  1XGO A;  2OD5 A;  3A03 A;  4FHT A;  1G8X A;  2QSG X;  1E3H A;  1I5Z A;  2CH0 A;  2Y0S A;  4BL0 B;  2FX0 A;  1TZL A;  3F72 A;  1DDN A;  3E5Q A;  4DBQ A;  1U5T B;  1E3P A;  2D2W A;  4JK1 X;  5J3L A;  4XRM A;  3CME I;  3CJR B;  4WXD A;  2UZK A;  1KON A;  4BKX A;  5GAD J;  5HDG A;  2IS6 A;  1VQO I;  4ENJ A;  3A01 B;  2R7T A;  2M0C A;  3H5A A;  1S9H A;  3CCL I;  1ZR4 A;  1TP4 A;  2VI6 A;  1IAW A;  2DOA A;  4BQN A;  1FEX A;  1ZLK A;  2X85 A;  3JRD A;  3IH4 A;  3IH2 A;  3W6J B;  2VT2 A;  4ABZ A;  2DK5 A;  3ASO H;  5L3E A;  1RR7 A;  1RZ4 A;  2ZJP F;  2QQ9 A;  2F2E A;  2VKD A;  3ZPL A;  3DKY A;  4LFU A;  4PJM A;  4KA4 A;  2CWE A;  4L18 B;  1NHA A;  3F3X A;  3I9V 2;  2JA2 A;  2QGU A;  3RYP A;  2KQR A;  4FQG A;  4L5J A;  3MKW B;  1BW5 A;  4PJL A;  3LQQ A;  3GTQ J;  2X6W A;  4Q48 A;  1S3J A;  3CJN A;  2EWN A;  4HLX A;  4UVC A;  4DYQ A;  3IRR A;  3KLO A;  1WJB A;  4MFE A;  1AWC A;  5LD2 C;  2I10 A;  5ICE A;  1JT0 A;  1PUE E;  4IF4 A;  3HJE A;  2OUM A;  3WTS C;  1Z7U A;  4MTE A;  1U0J A;  2MC3 A;  1J59 A;  2LF7 A;  3PNV A;  3GTK J;  3CC4 I;  4Q5S F;  2L7F P;  2GOM A;  3HOX J;  3PSI A;  1UHW A;  2M8G X;  3CF2 A;  3WGH A;  2K9S A;  4V19 K;  2GAU A;  3T8R A;  1BM9 A;  5LEJ A;  4A3I J;  2NOJ B;  2VUM J;  4QTR A;  2VJ5 A;  3MMY B;  1BJZ A;  4IQ4 A;  5CYV A;  1FYM A;  1ZAO A;  1T56 A;  5FFX A;  1P7J A;  1XCV A;  3BG5 A;  1VND A;  1OCR H;  4LG0 A;  1XX5 A;  1G4D A;  1K78 A;  5EDN A;  1PUF A;  2BGC A;  1MJ9 A;  3GFL A;  1RNL A;  3CES A;  3FWE A;  2YUS A;  3HHG A;  2HZT A;  3W2V A;  4IRG A;  2NVX J;  2XAQ A;  4XIC A;  1DP3 A;  2EV6 A;  1LDD A;  1RKT A;  1R58 A;  2DOE A;  2LDU A;  1LQ1 A;  1VQ5 I;  2JQ7 A;  6PAX A;  1SMY F;  2EFN A;  3HSE A;  4HBL A;  2ZME C;  1Z67 A;  3E5X A;  4YEJ A;  3H5R A;  4PGG A;  1GV2 A;  1I39 A;  1FSE A;  1UCR A;  1P4A A;  2FQ4 A;  2BXZ A;  2HWV A;  3K69 A;  4KT6 A;  2DI3 A;  2HNH A;  3L09 A;  1HF0 A;  2W25 A;  1USS A;  4CCN A;  1WJF A;  1VQ9 I;  5C3E J;  2Z99 A;  1RUN A;  2DMP A;  4LLN A;  2MBF A;  4A3M J;  5EZH A;  3K4C A;  4I76 A;  1VI0 A;  5IP6 A;  1XCB A;  3RZD J;  3FXM A;  2R5Z A;  3K4N A;  3H1C A;  4WF2 A;  2DW4 A;  2GA1 A;  1KU7 A;  3P9C A;  3HRU A;  2GXA A;  1T08 B;  2HI3 A;  2K3P A;  1YW8 A;  5EEA A;  4RBO A;  2EH3 A;  4M3B A;  3OYC A;  2BHZ A;  3RI4 A;  3CCQ I;  3BCB A;  1B9N A;  1DGR M;  2ECC A;  2ZB9 A;  2GXB A;  3VSL A;  2QKM B;  3FXU A;  3BR1 A;  1C0W A;  3ERE D;  1B6A A;  2E2J J;  5BOX A;  2EQR A;  2LP0 A;  2VQC A;  1ZQ3 P;  3UR3 C;  3EUH C;  3CP8 A;  4HSR A;  2CQ7 A;  4XLC A;  4II3 A;  5IOY A;  5J4Y A;  3LNQ A;  3K4B A;  1ZYR F;  1YW9 A;  4RMN A;  2ZXJ A;  5JR3 A;  2QWW A;  3RIR A;  4XKC A;  1X19 A;  3KP6 A;  3GZ6 A;  2VJ4 A;  2LLK A;  4RB3 C;  5A2Q Z;  4LG0 B;  1WI9 A;  1K78 B;  1B72 A;  2OTL I;  4HAM A;  1L3L A;  1PUF B;  3BY6 A;  3G1O A;  2R3S A;  2LYC A;  2R7D A;  4G6D A;  4G7H F;  2FXA A;  2VL8 A;  3DP7 A;  1W4M A;  3V4G A;  4ETS A;  3HOZ J;  2PX9 A;  2Y48 A;  3B02 A;  3TO9 A;  1TWF J;  3U21 A;  4P5O A;  5FRO A;  2D1V A;  3BP8 A;  2LKX A;  4IXA A;  2DFI A;  5JLX A;  2XDV A;  2R7Z J;  3TP3 A;  1A31 A;  5FLV A;  4L9V A;  4BQQ A;  1XSD A;  3OYH A;  2VBW A;  2K4B A;  3OYB A;  2F6C A;  1IZ1 A;  1EA3 A;  3TGN A;  4I0A A;  3JTG A;  1SVM A;  3OOP A;  1V54 H;  4HDU A;  2VJJ A;  3CUQ C;  4ANJ A;  3SFZ A;  3VEP A;  2AO9 A;  2E7W A;  4A5M A;  3V8L A;  3CLQ A;  3REO A;  1W7P D;  4XLP F;  2R5Z B;  3CCJ I;  3SEZ A;  1JKP C;  2HVR A;  1ENH A;  2O7O A;  2P81 A;  5EJC A;  2UWM A;  2J5P A;  2QEX I;  1IV8 A;  4Y3O A;  1IN4 A;  2OV7 A;  2MYS A;  1WVR A;  2L7M P;  4HST A;  3RPQ A;  1WJA A;  3VWB A;  3L2Q A;  1S5L C;  4XRS A;  3O3K A;  4RDU A;  1NH3 A;  2PG4 A;  1V5G A;  1WRJ A;  3HKZ A;  1YO5 C;  5GAH J;  4M71 A;  2COB A;  1R23 A;  2XPW A;  3H3Z A;  4Q47 A;  3ZP5 A;  4ON0 A;  1POG A;  2X6X A;  4LIT A;  4HF0 A;  4XSZ F;  1J09 A;  1H89 C;  1MNM C;  3H0D A;  5KNL A;  4GFB A;  3J7Z I;  2PN6 A;  4PFO A;  2OZ6 A;  3ABL H;  3G6E I;  3I3L A;  2DMT A;  4M3G A;  1W7P A;  3C2H A;  4E7L A;  2FOW A;  1JKO C;  1B72 B;  2VPR A;  2HTJ A;  1SMT A;  2XAF A;  2IAI A;  4M72 A;  4C9Y A;  1ZRD A;  5FLM J;  1N78 A;  1R5I D;  2HOE A;  4CHU A;  3P5J A;  3QOD A;  1FTZ A;  1MJA A;  4ESJ A;  3CMY A;  3M3Y J;  4Y15 A;  3BTC A;  2ADU A;  3KFW X;  3WTZ A;  4BGD A;  2Y69 H;  2KP6 A;  4LD5 A;  3S93 A;  1Y1W J;  1ACI A;  3M8E A;  1ETK A;  3MAJ A;  5ILU A;  2OZU A;  1MJB A;  5DM6 F;  1A36 A;  1UJ8 A;  2FRH A;  4ZDL A;  4M3D A;  3W3C A;  2JA7 J;  1XMA A;  5FO5 A;  2PBI A;  4MNU A;  2IJL A;  1EH7 A;  4WK8 F;  1FOX A;  1RPW A;  1L0O C;  3TKY A;  1LEB A;  1BA5 A;  5J1Y A;  1ONV A;  3NRV A;  3RQ4 A;  3K70 D;  2IW5 A;  4UV9 A;  2IS2 A;  2KRH A;  2V1X A;  1FOK A;  2E36 A;  4YG2 F;  1GLN A;  3DEE A;  1ETV A;  2TRT A;  2EJR A;  4I99 C;  2HOT A;  3EQL F;  4EV0 A;  4KIF A;  1IV6 A;  2W48 A;  3WG7 H;  1TQP A;  3RKW A;  2BE5 F;  2CS3 A;  1RR8 C;  4W97 A;  4LOC A;  1A6Q A;  2WAQ N;  2LH9 A;  1XMX A;  4B8X A;  4G7Z F;  1ON1 A;  3AFH A;  3ERM A;  2GLO A;  2YX4 A;  2B9S A;  1GVD A;  2LVS A;  1XDS A;  4RB0 A;  2R7X A;  1EF4 A;  3HGG A;  2PMH A;  4WX9 A;  2RVC A;  1HXD A;  1ZGW A;  3B6A A;  1W7P B;  2LR8 A;  1OCT C;  3LSJ A;  2HQA A;  1ZHF A;  5D4S A;  1MSE C;  4R8H A;  5DUK A;  1D8K A;  3LST A;  4EJU A;  1Z91 A;  3OMY A;  1NG7 A;  4LK0 F;  1NTC A;  2LSO A;  1X58 A;  4PGH A;  4ZC3 A;  3A1Y A;  1O7F A;  3K10 A;  1JI8 A;  3FDY A;  3R6S A;  1UG0 A;  4YRV A;  1W1W E;  2VE8 A;  4B47 A;  1F36 A;  4E7I A;  4HX7 A;  3KEO A;  1TWA J;  4EAT A;  4XKB A;  2MH9 A;  2ZFU A;  2DMQ A;  4LIV A;  3KP5 A;  4ESB A;  1R5H A;  1HW1 A;  1G6N A;  4A3L J;  5FRN A;  4LJZ F;  2B0L A;  2KRF A;  1XB4 A;  1JT6 A;  5FKM A;  1YE9 A;  2BY3 A;  3OIO A;  2KRC A;  3FMR A;  5JLW A;  4OOI A;  1D1B A;  1G3T A;  3TW7 A;  2L5Q A;  2RDP A;  1F1Z A;  2XRL A;  1VQN I;  4DZP A;  3ZQH A;  1K79 A;  4ZDO A;  3PQJ A;  3M8J A;  2DOD A;  3Q5F A;  1MMN A;  1UZC A;  3OSG A;  1VFC A;  4UUV A;  3A4C A;  5IYB J;  3N4M A;  4HQM A;  3OY9 A;  3FM5 A;  4XL9 A;  4B09 A;  1R36 A;  2VKV A;  1LDK B;  1VQ4 I;  4IRH A;  2MD0 A;  1T0F A;  4PSX A;  4NHJ A;  3PFY A;  2CG4 A;  2ID6 A;  2KIQ A;  2IEK A;  2A05 A;  2M3A A;  4P9U A;  4CYC A;  3OS0 A;  2DQR A;  1O3T A;  4L5I A;  1BBY A;  5BS6 A;  1EV7 A;  3LMM A;  2O8K A;  3FM3 A;  2HQ5 A;  3EDP A;  4GCV A;  5M3M J;  2Y0S N;  5TGT A;  5FJ8 J;  1SD4 A;  3KP7 A;  2F4M B;  3ABT A;  5IT9 K;  1VQ8 I;  4OIP F;  4HF1 A;  3S3N A;  2RAE A;  2WY7 Q;  2X1D A;  1GVJ A;  2IT0 A;  2MAB A;  5LGU A;  3IC7 A;  3RKX A;  4BJT A;  4QPO A;  3AG2 H;  3IKT A;  3LFU A;  4MTD A;  1U5T C;  3SZT A;  2ZXI A;  2XB0 X;  2EFW A;  2OU2 A;  4OWR B;  2RKH A;  2ISZ A;  3D5S C;  1STZ A;  1I50 J;  3TQN A;  4N0B A;  3LSP A;  2XAH A;  2KKO A;  1K61 A;  4D0P A;  1ZGA A;  2JTV A;  4PUS A;  5J40 A;  3TP0 A;  2PEX A;  1PDN C;  2VT3 A;  2JWT A;  3I4M J;  1FC3 A;  5M5W J;  5IT3 A;  1T8I A;  5AIP A;  5H6Q A;  1R6R A;  3L9F A;  5DTD A;  3K2A A;  1ZH5 A;  3PO3 J;  1ETY A;  3DU6 A;  2AQE A;  1Y0U A;  1F9N A;  2DPU A;  2IBD A;  2BHY A;  3DCF A;  4BU2 A;  1YYV A;  3PNY A;  1J9I A;  4EJV A;  2O6G E;  1P7I A;  4MLO A;  4J00 A;  1FYK A;  2ZKZ A;  3C2G A;  3F6V A;  2E35 A;  3HZJ A;  4JYK A;  3S3M A;  1V3F A;  3O6B B;  4D9J A;  1TNS A;  2FBK A;  4KMU X;  4D7N A;  2LK2 A;  2ZCW A;  3E3V A;  3MEX A;  4DJA A;  3E7L A;  2L3D A;  4UXN A;  3IHU A;  5TIS C;  2QSH X;  2IGN A;  1U2W A;  1X2N A;  3I71 A;  3N97 A;  2JK3 A;  2DO7 A;  3CLO A;  2DU9 A;  1G2H A;  1Z0X A;  2OAZ A;  4CYC B;  2STT A;  3KYD B;  5LGT A;  2OJE D;  1O7L A;  1MBF A;  5ED4 A;  4X0G A;  2CUZ A;  4D7M A;  3KP2 A;  5E1W A;  4E4H A;  1SFU A;  1VQM I;  3S14 J;  1OQY A;  4DZJ A;  2JZY A;  2D1H A;  5DCF A;  2MA3 A;  4GO1 A;  3ZQL A;  3KZY A;  2CUJ A;  1YW7 A;  3LA7 A;  4XRF A;  2G0E A;  2ZC2 A;  3CJT B;  3DEU A;  5E8G A;  3OYA A;  3GUD A;  4S04 A;  3OV8 A;  2L4M A;  2VOD A;  2K85 A;  3FXJ A;  3I0T A;  4OIO F;  4XOR A;  1HLV A;  3M07 A;  1OCC H;  4I02 A;  1WJD A;  2CQX A;  3CCR I;  2CMP A;  2KLO A;  3OSF A;  3AG3 H;  1LUJ B;  3JAM K;  2YS9 A;  2L01 A;  5B5E C;  3ML6 A;  1QA6 A;  1KZH A;  3DWL E;  2HKX A;  2ZXH A;  2E7X A;  5DV5 A;  2CO5 A;  3OIP A;  3CUO A;  1GV5 A;  4FE4 A;  5D4R A;  2PMZ A;  3FHN A;  2IXS A;  4JOM A;  3U1K A;  5ILS A;  4A69 C;  5LEK A;  2QF7 A;  1E2X A;  3MVP A;  2R0Q C;  2IS4 A;  1BC8 C;  1BI1 A;  1K4S A;  5IOZ A;  3F0C A;  1LPQ A;  2CJJ A;  5FLX K;  4X1E A;  2QUF A;  5K5O A;  2V1D A;  1MBG A;  1A04 A;  2MFZ A;  3FKJ A;  2XUB A;  1S7O A;  3ZN0 A;  2HOA A;  3VFZ A;  3E1S A;  2R7S A;  4LMY A;  3BZ6 A;  1YIJ I;  4BY1 J;  2HQR A;  1G3W A;  2MGQ A;  2LC2 A;  5D5U B;  2HXO A;  5M5Y J;  1QVT A;  3OYI A;  3GTO J;  2VOP A;  2F5C A;  1LFB A;  3JRB A;  1QU3 A;  4KIC A;  1B8I A;  1MD0 A;  3T8T A;  2CW8 A;  2QVO A;  4NC6 A;  1JHF A;  3H92 A;  3DLL F;  5DCM A;  3RQI A;  2E2H J;  1OR7 A;  3GFM A;  3EUA A;  2VAS A;  1IN6 A;  1SAX A;  3KCC A;  5DUI A;  5F6F A;  1RIO H;  1NG6 A;  3ZMS A;  1KYW A;  4E6K G;  3MKZ A;  3RKQ A;  5LHI A;  2O03 A;  2JSC A;  2X51 A;  3IKV A;  5DS9 A;  2EA2 A;  2MLG A;  4MEX F;  1LB2 A;  3PFI A;  1D0Z A;  2X1C A;  3MKL A;  4CCO A;  3S3O A;  2A07 F;  4RLQ A;  1LJ9 A;  4CA0 A;  4KIS A;  1JJ8 C;  3GO5 A;  4G94 A;  4BDZ A;  3HEF A;  5E1Z B;  5D8K B;  3WU0 A;  4CH7 A;  3SDG A;  4C2M J;  2QEN A;  2DA3 A;  4IOA F;  2ZSH B;  3BJA A;  2M7A A;  2W4S A;  1HST A;  2Z5U A;  4OIR F;  3BR2 A;  2LRD A;  1B4A A;  3BPV A;  1U8B A;  4XLA A;  4E7H A;  4WXH A;  2X6Y A;  2CRG A;  2FNP A;  1TL8 A;  2Z9O A;  2UXN A;  1Z6R A;  2ECB A;  2X48 A;  3QOE A;  4JBA A;  1WH7 A;  2HXI A;  3KE2 A;  4UVB A;  1AHD P;  5CVJ A;  2DDB A;  1MMA A;  2EIJ H;  3GTJ J;  1XPX A;  4IL6 C;  3TDZ C;  4UUS A;  1B8I B;  3ZXS A;  5LFA A;  2LY1 A;  5DCM B;  4NQW A;  3ZQQ A;  3HTS B;  1TWC J;  4GYI A;  3CCS I;  1KU2 A;  4AYB A;  3NQO A;  2LKS A;  4HV6 A;  2L9N A;  3MZ8 A;  2HKO A;  2OC6 A;  5AON A;  5K1Y A;  3HKZ N;  2MW8 A;  3LSG A;  3A0H C;  2I5U A;  2DAO A;  4HF2 A;  1S7A A;  2A6H F;  1JHH A;  1HOM A;  3GLX A;  4I2O A;  3SHF A;  3ZQG A;  1D0X A;  4AID A;  2W84 A;  3G73 A;  5IT9 Z;  4F92 B;  3K9T A;  2A69 F;  5CQG A;  2LKP A;  3LQR A;  4M6V A;  3HPG A;  5EGO A;  3G3Z A;  5GPA A;  3NWS A;  1PYV A;  1ZTR A;  4M3F A;  1Z05 A;  4XOT A;  1LVA A;  4UVA A;  5F27 A;  2ACJ A;  3V8J A;  2V26 A;  2AQF A;  1MIJ A;  3HBL A;  2Q1Z B;  4I98 B;  4M6X A;  5IY5 H;  1BIA A;  5M3F J;  2Q8K A;  4DNC A;  5L3C A;  4HLY A;  1QBJ A;  3S17 J;  4RB2 C;  3HC7 A;  1RI7 A;  5J8C A;  3F9K A;  2KFD A;  1SD7 A;  2KIM A;  2Y30 A;  3H0G J;  2STW A;  2HZD A;  2KJC A;  4E7K A;  2DYS H;  1JUM A;  1YTY A;  1XMK A;  1VQ6 I;  2L9S A;  1ORK A;  4FET A;  2V9K A;  1TT0 A;  3BC8 A;  4ZYA A;  2CU7 A;  2E5N A;  2XRO A;  1X1A A;  2XAU A;  2F48 A;  3EYI A;  1F4K A;  4BDY A;  4L9J A;  2BW3 A;  4A0X A;  2W85 A;  1IN5 A;  3KPH A;  2WV0 A;  3J80 K;  1FSH A;  3OYK A;  2M4K A;  4UUS B;  2R7F A;  3VYR B;  2B7E A;  5D5W B;  5D5X B;  2M4G A;  5LRR A;  4NUB A;  4DIQ A;  3D5L A;  4NQW B;  1S29 A;  5CPR B;  5KVR A;  3K4K A;  1FWZ A;  2ESN A;  2HVS A;  3QPT A;  4ZYG A;  2R92 J;  4IOC F;  1M1E B;  4XOP A;  4CUG A;  1Y1V J;  4HPQ A;  3TO6 A;  2LTP A;  3H9Q A;  1T2K A;  4XN0 A;  3S16 J;  4B4C A;  1FIA A;  3IV5 A;  3OOU A;  5F1R A;  1DU6 A;  1Y0N A;  2XF5 A;  2B63 J;  1FJL A;  2NVU B;  4HEA 2;  2VC0 A;  1SFO J;  4YEL A;  4YFK F;  2V1N A;  5EGO B;  2ETH A;  5H2F C;  4DW6 A;  1PP8 F;  3JRI A;  5KAI C;  2Z2S B;  2M9H A;  5J1R A;  4P1W A;  5EEH A;  3JAM Z;  2ZSI B;  4RGS A;  1IXR C;  5B1A H;  3HRM A;  4R79 A;  1ZRE A;  3HB9 A;  3E6C C;  1MMG A;  5FD5 A;  2EZI A;  3ZOB A;  5J8F A;  4L0Y B;  4ZYD A;  3CQZ J;  2ME6 A;  1BI3 A;  2BEO A;  5F08 A;  1TTY A;  1RKW A;  2COM A;  4EJW A;  4ESF A;  2W24 A;  4MQV A;  3ZQ7 A;  3CZ6 A;  4RM3 A;  5FLX Z;  1RUO A;  2QYO A;  1FPQ A;  1IXC A;  4A6D A;  5DDG A;  3Q3S A; 
#chains in the Genus database with same CATH homology
 3HSR A;  1IN8 A;  2M8E A;  4HV5 A;  1YQA A;  4EVI A;  1O3Q A;  2P6T A;  3HIF A;  1JE8 A;  3K1N A;  3VB2 A;  1KYZ A;  2Q0O A;  3FX3 A;  3C1D A;  3F8N A;  1OKR A;  3KLN A;  5ICC A;  2A61 A;  3EET A;  1U78 A;  2WWY A;  2NAZ A;  3ZMU A;  2FMY A;  1REP C;  3BDD A;  2Y0M A;  1BJA A;  5HOO A;  4LK1 F;  2FU4 A;  2DPD A;  1AOY A;  3DKW A;  5LLQ A;  4HX8 A;  3I5U A;  1LEA A;  2ZO4 A;  2PJP A;  4YII A;  1G3S A;  2CSO A;  4JQF A;  1BI0 A;  2EA4 A;  5DYM A;  2AS5 F;  5HLH A;  4G6Q A;  2UXX A;  3K2Z A;  1Z6T A;  1ZAR A;  3P7N A;  2QM3 A;  4OMY A;  5D5V B;  3COA C;  4IJA A;  2HS5 A;  2FNA A;  2QBY A;  3BJO A;  2IA0 A;  3HOS A;  2ISY A;  5ILV A;  3LA3 A;  1IRG A;  4AWX B;  2ZJ2 A;  2FML A;  2A68 F;  4N9H A;  3I54 A;  1OYW A;  1XGS A;  3F8C A;  4GYG A;  1P6R A;  3WTU C;  1ODD A;  4OU0 A;  4PDK A;  1O57 A;  1Q1H A;  5CLS A;  4OIN F;  4WCG A;  1ZRC A;  1O3S A;  4IPA A;  4Q4Z F;  3F8M A;  3J80 Z;  2YSR A;  4XLN F;  3WTT C;  1HKT A;  3P9K A;  3GX4 X;  3KP4 A;  3L2C A;  4M6Y A;  1P2F A;  2QBY B;  4WXC A;  4EGY A;  1UST A;  2M45 A;  2ELH A;  3BJ6 A;  3SZP A;  3V7S A;  2XAG A;  5ERI A;  1FNN A;  3HUG A;  2W57 A;  1F5T A;  4KN4 X;  1FY7 A;  3KP3 A;  3QP5 A;  4L9T A;  5CVI A;  2DBB A;  3RTR A;  5HDK A;  2VBY A;  3KEQ A;  3U1D A;  2OA4 A;  2X4H A;  1MGT A;  4A5N A;  3WTW C;  1IXC A;  3QU3 A;  1J0R A;  2KJB A;  2XAJ A;  3ZMD A;  3RKY A;  3V7C A;  4U7D A;  2DLL A;  2HYF A;  5LHH A;  2VBZ A;  5JHU A;  4CXF A;  3MZY A;  4OMZ A;  4I01 A;  1SD6 A;  5E20 A;  3BPX A;  1UB9 A;  3WG9 A;  5E18 F;  2DQL A;  1KGS A;  3R4K A;  1YIO A;  1IRF A;  3QPH A;  3T1B A;  5D6F A;  4PCQ A;  4IRI A;  2E1C A;  4KT5 C;  1XSX A;  3ULQ B;  4A6E A;  3QRF F;  4QWQ A;  1MZB A;  3K1M A;  3GWZ A;  3FXR A;  4CDG A;  4HDV A;  1GXQ A;  1Z9C A;  2XVC A;  1B9M A;  1FP2 A;  1HBX G;  2L4A A;  3CO6 C;  4HW0 A;  3E6D A;  1QO0 D;  4Y13 A;  1J75 A;  3ABU A;  3TOB A;  1I27 A;  2VN2 A;  3F8F A;  5DEQ A;  5E17 F;  5JFR A;  5D8L B;  2CW0 F;  4G8X A;  5HLG A;  1D5V A;  1WKM A;  1UHM A;  3MWM A;  1FBQ A;  3MZH A;  2JRT A;  5HS8 A;  1JXS A;  1G3Y A;  3Q9V A;  5HS9 A;  3WTV C;  4KDP A;  2K27 A;  2K7L A;  3I64 A;  1KQ8 A;  4BH9 A;  2HR3 A;  3U9G A;  2H6C A;  2V79 A;  5E1X A;  4OIQ F;  1KQ9 A;  1KU3 A;  2RV8 A;  4KNY A;  3CO7 C;  2PFB A;  1IUY A;  3C18 A;  1WSU A;  1ZN2 A;  4EM2 A;  4BYY A;  5DD4 A;  4M9X A;  5BPD A;  1K6O A;  2G9W A;  4BXU A;  4I0B A;  2XIG A;  1QQI A;  3I59 A;  2QZ8 A;  4YFN F;  3JW4 A;  3HRT A;  1YG2 A;  4TV7 A;  2HQN A;  2ZNY A;  3GF2 A;  3WGG A;  5L3D A;  1VTN C;  2FA5 A;  2XKO A;  3V7R A;  1FZP B;  4F7Z A;  2VC1 A;  3W6K B;  4AIH A;  3K0L A;  3R0A A;  2OQR A;  2FSW A;  3DPT A;  1OYY A;  2XKP A;  5L3B A;  4YIF A;  3AAF A;  3VOD A;  4L9N A;  3MQ0 A;  1ON2 A;  4BHP A;  3GFI A;  1SD5 A;  2DTR A;  1P4W A;  1V4R A;  2Q2E A;  2FBH A;  3Q9S A;  1S6L A;  3J7A O;  1I6X A;  5JVT A;  4PZJ A;  1XGN A;  3MFK A;  1K7A A;  4RGX A;  1T6S A;  2FOK A;  2F5F A;  1P92 A;  3I59 B;  2OQG A;  4A2U A;  2V9V A;  4AVP A;  2Z3Y A;  1YLF A;  4IHT A;  4I7H A;  1TW3 A;  5AIQ A;  4N9I A;  5BMZ A;  1XSV A;  4LB6 B;  4RGU A;  3NEU A;  2EV0 A;  1W5S A;  4AIJ A;  3DF8 A;  1J7K A;  1O3R A;  3ZN1 A;  2HFH A;  2LF8 A;  4M9Z A;  3FF5 A;  3L7W A;  4NB5 A;  2KIU A;  1CGP A;  1TLH B;  4RAY A;  5FB2 A;  5FGM A;  2IP2 A;  1HQC A;  2QQB A;  3M9A A;  3RJP A;  1H9G A;  3ZMT A;  1IN7 A;  1GXP A;  3J81 K;  1ULY A;  2FEZ A;  2GWR A;  4CZZ A;  1R1V A;  2NRA C;  3BWG A;  3C7J A;  4EQQ A;  1QNT A;  3QU6 A;  2JPB A;  3ZMV A;  3M1E A;  2IA1 A;  3E6B A;  3I58 A;  3JSO A;  2IVM A;  2MH2 A;  4U7B A;  2GZW A;  4M73 A;  3LAP A;  2M30 A;  4LB5 A;  2G7H A;  1BOA A;  2HYG D;  5EEG A;  2XV4 S;  4O3M A;  1X3U A;  2A6E F;  2P4W A;  2O61 A;  1R7J A;  2O0Y A;  1R1T A;  1HKQ A;  1GHC A;  3JSP A;  3S2W A;  4U0Y A;  2P8T A;  1D3Y A;  2VE9 A;  4BQA A;  5LBQ A;  4ENM A;  4KUM A;  4EJT A;  2VOO A;  2HTS A;  2V6C A;  2PI0 A;  5D6E A;  3F6O A;  3KET A;  3TDU C;  4IVN A;  3WE2 A;  4BAY A;  2HEO A;  2NNN A;  1MDM A;  2J5O A;  1FBU A;  3FMS A;  2P5V A;  2VBX A;  3FHZ A;  1SFE A;  5HDN A;  4G7O F;  2TDX A;  2K4J A;  1LDJ A;  4U88 A;  3DV8 A;  3GW2 A;  5FD6 A;  1DPR A;  4YFX F;  1YS6 A;  1KQ0 A;  2KIF A;  4CIC A;  2G7U A;  4A0Y A;  1DUX C;  3HTU A;  4Y17 A;  3DQV C;  2ZBK A;  3IRQ A;  3QP6 A;  2FF4 A;  2RN7 A;  2XAS A;  3JTH A;  3MCZ A;  2M87 A;  5LHG A;  3QAH A;  5L3F A;  3O2P E;  3QOP A;  4ZH4 F;  2WTE A;  3WTY C;  3BRO A;  3ROU A;  1DPU A;  4ASN A;  2P5K A;  2YPR A;  4CO8 A;  1H9T A;  2P5L C;  3T0Y A;  1MDM B;  4LLG F;  1UFM A;  4ZZL A;  2RGV A;  3L00 A;  1QPM A;  3IWZ A;  4HX4 A;  4QLC U;  3TOA A;  2F5E A;  4BNC A;  3KZZ A;  3FXQ A;  5E8I A;  5JI6 A;  4P9F A;  2GQQ A;  2IA2 A;  2ZNZ A;  2QQA A;  3VOE A;  4CGZ A;  3IL2 A;  1T38 A;  4HZF A;  5ICG A;  3RPU A;  1ZLJ A;  3M8F A;  1P4X A;  5BQT A;  2EFP A;  1OPC A;  3I4P A;  4MHG A;  1U3E M;  1S8N A;  2H94 A;  3CDH A;  5BPI A;  4EJO A;  4AD9 A;  1E17 A;  4H0E A;  2A5Y B;  2EK5 A;  4Z2Y A;  1HSJ A;  2AXL A;  2ZFW A;  2YU3 A;  2CGP A;  4EM0 B;  1DP7 P;  3DXJ F;  1OMI A;  4U0V A;  3WU1 B;  2EFO A;  2BV6 A;  2E1N A;  3J81 Z;  1H0M A;  1I1G A;  1ZGJ A;  1FX7 A;  2XGX A;  4KN7 X;  1BIB A;  2A3S A;  3HOT A;  2L02 A;  1QZY A;  4A12 A;  4AIK A;  2ZME A;  1HKS A;  4FT8 A;  1SFX A;  5CVR A;  1LNW A;  1BI2 A;  5KK1 A;  4KMF A;  2HDC A;  1EH6 A;  2H27 A;  1U6G A;  2XRN A;  3R0J A;  3HYI A;  4P96 A;  3LWF A;  2WC2 A;  2IPQ X;  3C3W A;  1TQM A;  3LA2 A;  5FFZ A;  1YFH A;  4R1H A;  4E70 A;  1HW2 A;  5LRS A;  1CF7 A;  4RB1 A;  2FE3 A;  1BC7 C;  2L54 A;  4XBF A;  1IF1 A;  2K02 A;  4IHS A;  1W5T A;  1TNT A;  5F64 A;  4ZYE A;  3EUH A;  3E5U A;  3CTA A;  3H3U A;  2X0L A;  2GXG A;  3P9I A;  3EYY A;  4HA8 A;  4K2E A;  3F21 A;  2YR2 A;  1D8J A;  2JPC A;  3R61 A;  1R00 A;  4KFC A;  4MQ9 F;  2ZME B;  1KA8 A;  2F5D A;  1IXS B;  2BBY A;  3GFJ A;  2P7V B;  3V8K A;  4DQ2 A;  3CUQ A;  1TW2 A;  3TO7 A;  3LFK A;  5HVQ C;  1OYI A;  5DD8 A;  3SXY A;  1T39 A;  4GXO A;  2QLZ A;  3GVA A;  3PQK A;  4HYE A;  3U2R A;  1CF7 B;  1B59 A;  2EB7 A;  4U0W A;  1Z1D A;  2RNJ A;  1R1U A;  1IW7 F;  1ZG3 A;  2DT5 A;  4EMS A;  2C6Y A;  1FT9 A;  4UV8 A;  4FX4 A;  3E97 A;  2K86 A;  4ENK A;  1XD7 A;  3B73 A;  2Y75 A;  3GZ5 A;  4MEY F;  1TBX A;  4RGR A;  2VXZ A;  3HHH A;  4P55 A;  3R60 A;  5ICF A;  2OBP A;  3WOD F;  4UNO A;  3E6M A;  1PP7 U;  5HS7 A;  2MLK A;  2P6S A;  4GGG A;  3ECO A;  2FQ3 A;  5H20 A;  3DFG A;  1FBS A;  1MKM A;  1B1B A;  1T98 A;  5K5R A;  3CUQ B;  1ZG1 A;  4KIB A;  1WQ2 A;  3I53 A;  3F23 A;  2HGC A;  3ECH A;  2D45 A;  1WWX A;  4M74 A;  1U8R A;  5HLI A;  2FBI A;  1FP1 D;  4ENN A;  3D0S A;  2NYX A;  2NS0 A;  3BOQ A;  2ESH A;  1ZRF A;  3HSF A;  4A0Z A;  4HQE A;  2EFQ A;  3HRS A;  3RDI A;  4ZYH A;  5K5Q A;  5CJ9 A;  1XDU A;  2O3F A;  2NNY A;  3LAJ A;  3FZV A;  4G9Y A;  4XSX F;  1J2X A;  4L0Z B;  2YX7 A;  1XN7 A;  2JT1 A;  1QGP A;  1R22 A;  2CFX A;  4HOB A;  2LNB A;  2GA2 A;  4KIG A;  2XHK A;  2GIV A;  1JGS A;  2RC4 A;  3ELK A;  3GXO A;  1YS7 A;  2CQK A;  3WE3 A;  5LGN A;  3ZMZ A;  2EV5 A;  1EH8 A;  2RQP A;  4BHB A;  4LLL A;  4MGR A;  4CYD A;  2O8X A;  1KU9 A;  1J5Y A;  3RYR A;  5J6X A;  3T5X A;  4EGZ A;  3FMQ A;  3F22 A;  2H6B A;  3WTX C;  3GYH X;  1FLI A;  5CVV A;  3GEZ A;  5CVU A;  4RS8 A;  2H09 A;  3ISP A;  2PQ8 A;  2PLY A;  1U5T A;  1I1S A;  4BHC A;  3SQN A;  2BYV E;  5A2Q K;  2M1B A;  3M7G A;  2M5W A;  2IRF G;  2PMU A;  1TQI A;  4UHT A;  2Z33 A;  2DK8 A;  3F8B A;  4WWC A;  3DPL C;  4KYW A;  2CYY A;  2MD5 A;  1FYL A;  2V1U A;  1XGM A;  1BN5 A;  2VON A;  4EM1 A;  5TRD A;  4ZZD A;  4O5V A;  4S05 A;  3WGI A;  3IWF A;  1R5G A;  1ZG5 A;  1QZZ A;  4FX0 A;  4O6J A;  2P7C B;  3K1P A;  1HW5 A;  4M9S A;  4RAZ A;  5H6R A;  4I09 A;  4LGW A;  5TJJ A;  1XGO A;  2OD5 A;  4FHT A;  1I5Z A;  3F72 A;  1DDN A;  3E5Q A;  1U5T B;  2D2W A;  4JK1 X;  2UZK A;  4WXD A;  5HDG A;  4ENJ A;  1IAW A;  1ZLK A;  3W6J B;  2VT2 A;  2DK5 A;  5L3E A;  1RZ4 A;  2QQ9 A;  2F2E A;  3ZPL A;  4LFU A;  4KA4 A;  2CWE A;  4L18 B;  1NHA A;  3F3X A;  3RYP A;  4L5J A;  3LQQ A;  4Q48 A;  1S3J A;  3CJN A;  2EWN A;  4HLX A;  4UVC A;  3IRR A;  3KLO A;  1AWC A;  5ICE A;  1PUE E;  4IF4 A;  3WTS C;  1Z7U A;  4MTE A;  1J59 A;  2MC3 A;  2LF7 A;  4Q5S F;  1UHW A;  3WGH A;  2GAU A;  3T8R A;  1BM9 A;  5LEJ A;  5CYV A;  1FYM A;  1ZAO A;  5FFX A;  1XCV A;  4LG0 A;  1G4D A;  1K78 A;  2BGC A;  1MJ9 A;  3GFL A;  1RNL A;  3FWE A;  3HHG A;  2HZT A;  4IRG A;  2XAQ A;  2EV6 A;  1LDD A;  2LDU A;  1R58 A;  1LQ1 A;  6PAX A;  1SMY F;  2EFN A;  3HSE A;  4HBL A;  3E5X A;  4PGG A;  2HWV A;  1FSE A;  1UCR A;  1P4A A;  4YG2 F;  3K69 A;  2DI3 A;  3L09 A;  2W25 A;  1USS A;  4LLN A;  2Z99 A;  1RUN A;  2MBF A;  1XCB A;  4WF2 A;  2DW4 A;  2GA1 A;  1KU7 A;  3P9C A;  3HRU A;  1YW8 A;  3RI4 A;  1B9N A;  2GXB A;  3FXU A;  1C0W A;  3ERE D;  1B6A A;  5BOX A;  1ZYR F;  1YW9 A;  2ZXJ A;  5JR3 A;  2QWW A;  3RIR A;  3KP6 A;  3GZ6 A;  5A2Q Z;  4RB3 C;  4LG0 B;  1WI9 A;  1K78 B;  4HAM A;  1L3L A;  3BY6 A;  2R3S A;  4G7H F;  2R7D A;  4G6D A;  2FXA A;  4ETS A;  3DP7 A;  1W4M A;  3V4G A;  2Y48 A;  3B02 A;  3TO9 A;  4P5O A;  2D1V A;  3BP8 A;  4IXA A;  2DFI A;  4L9V A;  1XSD A;  2VBW A;  2K4B A;  1IZ1 A;  3TGN A;  4I0A A;  3JTG A;  3OOP A;  4HDU A;  3CUQ C;  3SFZ A;  3VEP A;  2E7W A;  4A5M A;  3V8L A;  3REO A;  1W7P D;  4XLP F;  2UWM A;  2J5P A;  1IN4 A;  3RPQ A;  3O3K A;  2PG4 A;  1WRJ A;  1YO5 C;  4M71 A;  1R23 A;  3H3Z A;  4Q47 A;  3ZP5 A;  4ON0 A;  4HF0 A;  4XSZ F;  2PN6 A;  2OZ6 A;  1W7P A;  2HTJ A;  1SMT A;  2XAF A;  4M72 A;  1ZRD A;  2HOE A;  4CHU A;  1MJA A;  4ESJ A;  4Y15 A;  3KFW X;  2ADU A;  3WTZ A;  4LD5 A;  3M8E A;  3MAJ A;  5ILU A;  2OZU A;  1MJB A;  2FRH A;  1XMA A;  5FO5 A;  2PBI A;  2IJL A;  1EH7 A;  4WK8 F;  1L0O C;  3TKY A;  1LEB A;  1ONV A;  3NRV A;  4UV9 A;  2IW5 A;  2V1X A;  1FOK A;  2EJR A;  3EQL F;  4EV0 A;  4KIF A;  1TQP A;  3RKW A;  2BE5 F;  4G7Z F;  4B8X A;  1ON1 A;  2YX4 A;  1XDS A;  4RB0 A;  4WX9 A;  2PMH A;  2RVC A;  1HXD A;  1W7P B;  1ZHF A;  5D4S A;  4R8H A;  5DUK A;  1D8K A;  3LST A;  4EJU A;  1Z91 A;  4LK0 F;  2LSO A;  4PGH A;  1O7F A;  3R6S A;  2VE8 A;  4HX7 A;  3KEO A;  2MH9 A;  3KP5 A;  4ESB A;  1R5H A;  1HW1 A;  1G6N A;  4LJZ F;  2B0L A;  2KRF A;  1XB4 A;  3FMR A;  4OOI A;  1G3T A;  2RDP A;  1F1Z A;  1K79 A;  3PQJ A;  3Q5F A;  4UUV A;  3N4M A;  4HQM A;  3FM5 A;  4B09 A;  1R36 A;  1LDK B;  4IRH A;  1T0F A;  4NHJ A;  2CG4 A;  1O3T A;  4P9U A;  2DQR A;  4L5I A;  1BBY A;  5BS6 A;  1EV7 A;  3FM3 A;  3EDP A;  4GCV A;  1SD4 A;  3KP7 A;  3ABT A;  5IT9 K;  4OIP F;  4HF1 A;  1GVJ A;  2IT0 A;  5LGU A;  3IC7 A;  3RKX A;  3IKT A;  4MTD A;  1U5T C;  3SZT A;  2EFW A;  2OU2 A;  2RKH A;  2ISZ A;  1STZ A;  3TQN A;  4N0B A;  2XAH A;  2KKO A;  4D0P A;  1ZGA A;  2JTV A;  1PDN C;  2PEX A;  2VT3 A;  1FC3 A;  5IT3 A;  5AIP A;  5H6Q A;  3L9F A;  1ZH5 A;  1Y0U A;  1F9N A;  2DPU A;  1YYV A;  1J9I A;  4EJV A;  2O6G E;  1FYK A;  2ZKZ A;  3F6V A;  1V3F A;  3O6B B;  1TNS A;  2FBK A;  4KMU X;  2ZCW A;  3E3V A;  3MEX A;  4UXN A;  2L3D A;  3IHU A;  1U2W A;  3I71 A;  3N97 A;  2DO7 A;  3CLO A;  2DU9 A;  2OAZ A;  2STT A;  5LGT A;  1O7L A;  5ED4 A;  3KP2 A;  5E1W A;  1SFU A;  2JZY A;  2D1H A;  5DCF A;  2MA3 A;  4GO1 A;  3KZY A;  1YW7 A;  3LA7 A;  4XRF A;  5E8G A;  3DEU A;  3GUD A;  4S04 A;  3OV8 A;  2L4M A;  2VOD A;  3I0T A;  4OIO F;  4I02 A;  3JAM K;  2L01 A;  3ML6 A;  2HKX A;  2E7X A;  5DV5 A;  2CO5 A;  3CUO A;  5D4R A;  5ILS A;  5LEK A;  1E2X A;  1BC8 C;  1BI1 A;  5FLX K;  2QUF A;  5K5O A;  2V1D A;  1A04 A;  2XUB A;  1S7O A;  3ZN0 A;  3VFZ A;  4LMY A;  3BZ6 A;  2HQR A;  1G3W A;  5D5U B;  2VOP A;  2F5C A;  4KIC A;  1MD0 A;  3T8T A;  2QVO A;  1JHF A;  3H92 A;  5DCM A;  1OR7 A;  3GFM A;  1IN6 A;  1SAX A;  3KCC A;  5DUI A;  5F6F A;  1RIO H;  3ZMS A;  1KYW A;  5LHI A;  2O03 A;  2JSC A;  3IKV A;  2EA2 A;  2MLG A;  4MEX F;  1LB2 A;  3PFI A;  2A07 F;  1LJ9 A;  3GO5 A;  4G94 A;  5E1Z B;  5D8K B;  3WU0 A;  2QEN A;  3BJA A;  1HST A;  2Z5U A;  4OIR F;  1B4A A;  3BPV A;  4WXH A;  2FNP A;  2Z9O A;  2UXN A;  1Z6R A;  4JBA A;  3KE2 A;  4UVB A;  5CVJ A;  3TDZ C;  5DCM B;  4NQW A;  3HTS B;  4GYI A;  1KU2 A;  3NQO A;  4HV6 A;  2HKO A;  5AON A;  5K1Y A;  2DAO A;  4HF2 A;  1S7A A;  2A6H F;  1JHH A;  3GLX A;  4I2O A;  3SHF A;  2W84 A;  3G73 A;  5IT9 Z;  3K9T A;  2A69 F;  2LKP A;  3LQR A;  3G3Z A;  1Z05 A;  1LVA A;  4UVA A;  2ACJ A;  3V8J A;  4M6X A;  4I98 B;  1BIA A;  4HLY A;  2Q8K A;  4DNC A;  5L3C A;  1QBJ A;  4RB2 C;  1RI7 A;  5J8C A;  1SD7 A;  2KIM A;  2STW A;  2KJC A;  1YTY A;  1XMK A;  2XRO A;  3EYI A;  1F4K A;  4L9J A;  4A0X A;  2W85 A;  1IN5 A;  2WV0 A;  3J80 K;  1FSH A;  2R7F A;  5D5W B;  5D5X B;  5LRR A;  3D5L A;  1S29 A;  5KVR A;  1FWZ A;  2ESN A;  3QPT A;  4ZYG A;  3TO6 A;  1T2K A;  5F1R A;  2VC0 A;  4YFK F;  2ETH A;  1PP8 F;  5EEH A;  3JAM Z;  4RGS A;  1IXR C;  1ZRE A;  3HRM A;  4R79 A;  3E6C C;  5FD5 A;  5J8F A;  4L0Y B;  4ZYD A;  1BI3 A;  2BEO A;  1TTY A;  2COM A;  4ESF A;  4EJW A;  2W24 A;  4MQV A;  3ZQ7 A;  5FLX Z;  1RUO A;  2QYO A;  1FPQ A;  4MNU A;  4A6D A;  5DDG A;  5L3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...