2L3DA

The solution structure of the short form swirm domain of lsd1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
GSVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lysine-specific histone demethylase 1A
publication title The chemical shift assignment of the SWIRM domain of LSD1
rcsb
source organism Homo sapiens
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l3dA00
2EJRA 3J80K 4I02A 4UVCA 2TDXA 4MTEA 4BAYA 4LD5A 1FNNA 4EJUA 1BOAA 1U8RA 1DPUA 4GYGA 3FHZA 1RUNA 4RGRA 2HKXA 4WXCA 1V3FA 1LEAA 4M72A 3CUQA 3H3UA 4KMFA 3DPLC 1LDDA 3FXRA 3QP5A 1Z7UA 2XKOA 4HF2A 2XIGA 4MNUA 1IN4A 2YU3A 2XASA 2NNYA 1IN8A 3LAJA 2LNBA 1MJAA 3KFWX 3S2WA 2VBWA 5K5RA 2K27A 2QBYB 3FMSA 2XAGA 3JSPA 2AS5F 1R1VA 5H6RA 1ZYRF 2ZXJA 1P4XA 2O6GE 4B8XA 2P7VB 2V1DA 1F5TA 5D5WB 4L0ZB 1R00A 5BOXA 4IRHA 3CUOA 1B59A 2QENA 4G7ZF 2XRNA 5D8LB 5L3FA 1Z1DA 2P7CB 3ULQB 3RKYA 5J8FA 1SD4A 2JT1A 1P4WA 2BBYA 2Y75A 4UHTA 5ICEA 2DU9A 1WI9A 4ZYHA 2EV0A 1K78A 3JTGA 3DEUA 2PBIA 1FYKA 1IUYA 5LGNA 5ICGA 2ESHA 1H9TA 3L09A 4UNOA 4WK8F 1HW5A 4CZZA 2HOEA 3HSFA 3F8MA 1GXQA 3HSRA 3BY6A 3ML6A 2VN2A 4KA4A 3IC7A 3GWZA 2CGPA 2FBIA 4HBLA 2FNAA 2QVOA 3VOEA 1WWXA 4KDPA 2Y48A 2ZJ2A 1FX7A 2QM3A 2HYGD 3IL2A 3ZP5A 1TQPA 5FLXK 1B1BA 1VTNC 1ZARA 1D8JA 1DPRA 3I4PA 1ZN2A 3C18A 3V8LA 2W57A 3RDIA 4YFXF 1TLHB 1J59A 3FX3A 4HF1A 2RVCA 3KEQA 3Q9VA 1XGOA 2KJBA 4G6QA 2X0LA 4KN4X 3C7JA 3RTRA 2FBHA 4YFKF 5JFRA 3FWEA 3L00A 5DCMB 3WTWC 5HDKA 4L5IA 1U5TB 2XAFA 4HYEA 1E2XA 2E1CA 2HGCA 2OQRA 4R79A 4ZYDA 3BZ6A 5CVRA 5FFXA 2A69F 2DAOA 1JHFA 5L3GA 2FSWA 2PMUA 3R6SA 4M9ZA 5K5OA 3BOQA 4IPAA 1PP7U 1PP8F 1BI1A 3I53A 4HLXA 3BPXA 3T1BA 1TQMA 4ZH4F 1MGTA 4OINF 5FFZA 3R4KA 4TV7A 3PFIA 5HS9A 3L2CA 4LB5A 2OQGA 3QU3A 2D1HA 2W84A 5HS7A 3BJOA 2ACJA 5D5XB 2C6YA 2BE5F 2D2WA 4EGYA 2FMLA 2VBXA 2NRAC 3M1EA 2EB7A 1ZLJA 1HKSA 3H92A 2ZNYA 4HLYA 4A2UA 1OYYA 1O7LA 4A5MA 1FSEA 1S7AA 4WCGA 1FYLA 5DV5A 4EJWA 1FBSA 1YFHA 2O61A 2GXGA 2VOPA 3E97A 3M7GA 1FPQA 2QQBA 3M8FA 5JI6A 1D5VA 4CDGA 2BYVE 2PG4A 4G94A 4A0YA 2D1VA 3ZMSA 1YLFA 4EM0B 2HQRA 5J8CA 3ERED 4HOBA 1LDJA 5DD4A 1IXSB 2EA2A 4HQMA 2GA1A 3ABTA 3HOSA 3SZTA 3L7WA 3ZMVA 1WSUA 4IVNA 2V6CA 5EEHA 3V7SA 4AIHA 3GO5A 4HAMA 1YQAA 1RNLA 5CVUA 4LLGF 5DD8A 1XD7A 5D5UB 1KQ0A 4HQEA 5ILVA 2AXLA 3MWMA 3LWFA 3CUQB 1HQCA 4LB6B 4MEXF 3KP5A 1KGSA 3HYIA 4ZYGA 3TDUC 3WTUC 5FD6A 3D0SA 4IRIA 2G9WA 2JZYA 1IXRC 3KETA 4LFUA 2Q0OA 2VE9A 2IP2A 1G3YA 3HUGA 2YR2A 4L0YB 5EEGA 5F64A 1L3LA 2CWEA 3V7RA 3KE2A 3HIFA 2Z9OA 4Q5SF 3DP7A 3CTAA 4RB1A 2J5PA 3LAPA 2YPRA 4I09A 2QLZA 4MEYF 4HZFA 1O3SA 3O6BB 5ICFA 3WGGA 2BV6A 2OU2A 5BS6A 5BMZA 3GW2A 4RB2C 2HFHA 1D8KA 4GYIA 3WTXC 3EQLF 1IRFA 4I0BA 2GXBA 5HS8A 2L3DA 3KCCA 1WRJA 3OV8A 4I7HA 1CF7A 4PGGA 4A0ZA 4M9XA 2L01A 1SFXA 1R23A 4LMYA 5JVTA 1K78B 2H6CA 5CVJA 2FNPA 1YS6A 4UVBA 3HSEA 3W6KB 1R1TA 4CO8A 1IF1A 2WTEA 4LGWA 2ZCWA 5K5QA 2YSRA 1FBQA 3F8CA 3LFKA 2VE8A 2JTVA 4HDVA 5HVQC 4BNCA 3P9KA 5JR3A 1SMTA 2F2EA 5L3BA 3WE3A 1J5YA 2XROA 4U7BA 4AIJA 4O3MA 2HEOA 5LHIA 2ISZA 1K79A 2RN7A 4UV9A 2Y0MA 2QUFA 1SD7A 2Q2EA 4Y17A 3E6CC 2Z33A 1R36A 3CLOA 2HR3A 3HHGA 3KP3A 4HX7A 5LGTA 1GXPA 3ABUA 2P5LC 2STTA 2UXNA 3JSOA 2GWRA 1TW3A 1X3UA 1E17A 1TTYA 3L9FA 3WU0A 3IKTA 4OU0A 3QP6A 1YS7A 2FE3A 1T38A 2VBYA 3J7AO 1BC8C 5F6FA 3DKWA 3QOPA 3Q9SA 3FF5A 2PMHA 4EM1A 3WGIA 4EGZA 3GLXA 3TO9A 1HKTA 2DQRA 1J75A 3WTTC 1H0MA 3SZPA 4NHJA 1XMAA 1QGPA 2F5DA 4M6XA 4YFNF 4PDKA 1XGMA 4GO1A 3HTSB 1HBXG 1W4MA 1FT9A 5LEJA 1REPC 2LF8A 2FEZA 3GVAA 5E17F 2G7UA 3WODF 1U3EM 2GZWA 2FF4A 3K0LA 2RDPA 3SHFA 4A12A 4L18B 4WXHA 3DPTA 2DPUA 2LKPA 3I58A 3P7NA 1YO5C 5D5VB 2VOOA 1GHCA 1YG2A 5CLSA 4G9YA 4S04A 2DK5A 3J80Z 3PQJA 4MTDA 3T5XA 2BGCA 4NQWA 1BI0A 3SXYA 1R58A 5D8KB 2STWA 1D3YA 1USTA 5CVIA 4JK1X 4P55A 3IRRA 1IAWA 1BN5A 3K2ZA 4WXDA 1FOKA 4RS8A 2DW4A 2M8EA 3QPTA 2DFIA 2MC3A 4BYYA 1FLIA 2WWYA 3WTVC 4BH9A 1ULYA 2IRFG 1YYVA 2JSCA 1W5SA 2IPQX 2XAJA 3K9TA 3QAHA 2DPDA 2LSOA 3IHUA 1V4RA 2IW5A 5LRSA 2QWWA 4ENMA 2QQ9A 4OIOF 4L5JA 3HRSA 2O03A 3EYIA 4HDUA 2PFBA 5DEQA 5ERIA 2HTSA 1XSDA 2MH2A 1G3TA 1FWZA 2DO7A 2NS0A 3KP4A 2ZO4A 4KUMA 5E1XA 5L3DA 1XSVA 3MEXA 3GYHX 3J81K 4EM2A 3D5LA 1QBJA 1MDMA 1FBUA 2P8TA 1XMKA 4KN7X 1R5HA 3CDHA 2E7WA 2DTRA 3HOTA 5FD5A 2M87A 2FQ3A 2MBFA 2EV5A 4YG2F 2V9VA 2XAQA 2XVCA 3B02A 2NYXA 4UXNA 3IWZA 4BXUA 3RYPA 4K2EA 2W25A 2DI3A 3WGHA 2IT0A 2PN6A 1U2WA 1KYWA 3FXUA 1T39A 2HDCA 1CF7B 1O7FA 1EV7A 3BWGA 5FLXZ 3VEPA 4ESJA 1UFMA 2Z3YA 4Y15A 2W85A 1YW8A 3ECHA 4RAYA 4LK0F 4XRFA 2HTJA 3O2PE 4MQ9F 5AONA 3KEOA 1F1ZA 2A6EF 4ZZDA 2DLLA 3P9CA 4B09A 2OBPA 3TOBA 3ZN1A 3HTUA 4DQ2A 3E6BA 5IT9K 3ZMUA 3WTYC 2GQQA 3KP2A 3WE2A 3HRMA 4LLNA 3QPHA 3F8NA 2L4AA 1S6LA 4HW0A 5CJ9A 3R0JA 4ETSA 5HLGA 3TGNA 3BJ6A 3VFZA 3I54A 3RIRA 4BHPA 2P4WA 1OMIA 2RC4A 2KRFA 5D6FA 3RI4A 4A6DA 3FMRA 5J6XA 1T0FA 1DUXC 3CJNA 2H94A 5E1WA 3BP8A 5BPIA 2G7HA 3DFGA 1KA8A 1P6RA 3U9GA 3N4MA 2YX7A 4FX4A 5ILUA 5IT3A 4OMZA 4O5VA 2QQAA 3V8KA 1BIAA 1G3SA 2JPBA 2B0LA 1WKMA 1EH7A 3F72A 5BPDA 1SAXA 5L3EA 2YX4A 2A07F 4L9JA 2EFWA 2MD5A 1ZHFA 3U1DA 2COMA 1I1GA 3E6MA 4XLPF 3SFZA 3F6VA 3PQKA 3KP6A 3I71A 4I0AA 1I1SA 2UXXA 3RKWA 3RPQA 3TKYA 1SFEA 4RGUA 1USSA 3GF2A 4GCVA 3JTHA 3P9IA 1O57A 4DNCA 1B9MA 1K7AA 1U78A 1IN6A 4P96A 1FSHA 2QZ8A 1KYZA 4R1HA 5HDGA 2IA2A 1W5TA 3FMQA 1HSJA 1ZG5A 1G4DA 2XKPA 3MQ0A 5TJJA 4NB5A 5D4SA 4EQQA 3HHHA 2XHKA 2WC2A 3I0TA 3FZVA 4IJAA 1I6XA 1Y0UA 3V8JA 4G7OF 3DF8A 2FU4A 5TRDA 1J2XA 2E7XA 1BI2A 4RB0A 3HRTA 3ISPA 3T0YA 1TQIA 5JHUA 2F5EA 4OIRF 1S7OA 3DV8A 3GZ6A 1ODDA 2UZKA 4U88A 1MJ9A 2ZNZA 4Y13A 3LA3A 5LBQA 1RUOA 1S3JA 1H9GA 3SQNA 1ZRDA 2EFNA 1C0WA 4GGGA 2RKHA 4RAZA 4HV6A 4ZZLA 5DCMA 3F6OA 4KICA 1MD0A 2NNNA 3GFJA 4MQVA 2H09A 2XGXA 4U0WA 2L54A 4KIBA 1BC7C 4G8XA 3C1DA 4QWQA 1HW2A 4UUVA 3MZHA 2Z99A 3OOPA 1TNTA 2EFPA 1LB2A 3FM5A 3E5UA 3KLNA 4E70A 2IJLA 2DT5A 3EETA 1OYWA 1MDMB 2P6TA 2HQNA 6PAXA 1ZGJA 1PDNC 4CGZA 4KIFA 4IHSA 3TQNA 2EFOA 1UHMA 1HKQA 2HWVA 1SFUA 5ED4A 2D45A 2FMYA 2Z5UA 2FXAA 1P4AA 3ZPLA 4XBFA 1SD6A 3LQQA 4HX8A 1WQ2A 2OAZA 2VBZA 3AAFA 2JRTA 2CFXA 1P2FA 2M45A 4HV5A 4IRGA 1STZA 3U2RA 3E5XA 2K4JA 4BHBA 2NAZA 2CG4A 5HDNA 4LG0A 1I27A 3HRUA 1TBXA 3F8BA 5K1YA 4YIFA 1KQ9A 2EWNA 2L4MA 4BHCA 3R0AA 2QYOA 3GEZA 4ENNA 4KNYA 3GUDA 2XV4S 1LNWA 2OA4A 2M1BA 1KU7A 3EDPA 1LVAA 2FBKA 4S05A 5LHHA 5AIQA 1OYIA 2O3FA 1FZPB 4I98B 4KYWA 4EVIA 3RPUA 4U0VA 2LF7A 4L9NA 3TOAA 1S29A 1ZREA 4O6JA 5D4RA 4RGXA 1W7PA 2ZMEA 1ZG3A 2IVMA 4Q48A 3GXOA 4P9UA 4CHUA 2KIUA 1FY7A 2HYFA 1UHWA 5DCFA 2CQKA 2A6HF 4CXFA 1R22A 1UCRA 1HW1A 3BROA 4P5OA 1GVJA 4U0YA 1J7KA 2CW0F 3H3ZA 2ISYA 4ZYEA 1QQIA 3E5QA 2KJCA 2MLKA 2HS5A 3WG9A 1JE8A 4KT5C 3K1PA 4AD9A 2Q8KA 5D6EA 1T98A 4I01A 2V79A 1ON1A 2OD5A 3WTSC 3ZMTA 1Z6RA 3REOA 2ETHA 2F5FA 2P6SA 5CVVA 1XB4A 3ZN0A 3MFKA 4Q47A 5FGMA 1F4KA 3JAMK 4IHTA 2J5OA 3NEUA 1YW9A 1OKRA 2KKOA 3I59A 2MH9A 5H6QA 1QZYA 1MZBA 4L9TA 4WF2A 1T2KA 3T8TA 1RIOH 2CYYA 4AIKA 2V1UA 4Q4ZF 4ON0A 4A5NA 1JHHA 1HSTA 1IZ1A 4HA8A 5HLIA 1K6OA 2VT3A 3BDDA 2ZKZA 3C3WA 2XAHA 5A2QK 3MAJA 1SMYF 2CSOA 5E18F 2E1NA 3ZMDA 3JAMZ 1DDNA 3NQOA 1L0OC 1XGNA 1Z9CA 2K4BA 5E20A 3ECOA 2V1XA 2ELHA 1T6SA 1ZGAA 2OZ6A 5KVRA 2EV6A 5AIPA 4U7DA 4AVPA 3LA7A 1QO0D 4EJOA 1IW7F 3VODA 3J81Z 4P9FA 2VODA 1R5GA 4N9HA 4OIPF 1G3WA 2O8XA 2WV0A 3R60A 3B73A 3IWFA 1XN7A 1AWCA 2P5VA 2BEOA 2K86A 5A2QZ 2DK8A 1U6GA 5ILSA 1BBYA 5KK1A 1B6AA 2A5YB 1FC3A 5L3CA 1XDUA 1B9NA 2FA5A 1XSXA 3RJPA 1ZLKA 3NRVA 1OR7A 3IKVA 3QU6A 4N0BA 2MA3A 2HZTA 1YW7A 1XDSA 5DUKA 4ESBA 1ZG1A 1XCBA 2GIVA 4YIIA 1XGSA 5E8GA 5ICCA 2XUBA 5DDGA 2FRHA 1RZ4A 2RGVA 2ESNA 4M6YA 1BI3A 4CYDA 4G6DA 4I2OA 3RKXA 5HLHA 3JW4A 4A6EA 2PLYA 3BPVA 1W7PD 3RYRA 1S8NA 1O3RA 3G3ZA 5IT9Z 2RNJA 3M8EA 1Z05A 3T8RA 3TDZC 4LG0B 1TW2A 1Z6TA 1PUEE 2RQPA 3LQRA 2QBYA 1J9IA 3CO7C 2MLGA 2PJPA 3COAC 4IF4A 3V7CA 4MGRA 4HX4A 4LLLA 2M5WA 1DP7P 1KU9A 1I5ZA 3I5UA 3CO6C 5CYVA 2F5CA 2PI0A 1ZAOA 3ROUA 3F21A 1MKMA 3ZMZA 2H6BA 1P92A 3QRFF 1JXSA 2DBBA 1IN5A 4WX9A 4MHGA 1RI7A 2H27A 5LHGA 4OIQF 4IXAA 1ZRCA 4EMSA 4M71A 1KU2A 1EH8A 3K1MA 3I64A 4EJTA 3KLOA 2LDUA 4PGHA 3ELKA 4N9IA 5H20A 1BIBA 2IA1A 4JBAA 3FXQA 4RGSA 1J0RA 3IRQA 4GXOA 2K02A 1W7PB 1EH6A 2ZMEB 3TO7A 5LEKA 4OOIA 1BM9A 4CICA 5LLQA 2DQLA 1G6NA 1U5TC 4FX0A 3K69A 4H0EA 1ON2A 3LA2A 4LJZF 3GX4X 4EV0A 3ZQ7A 3VB2A 1Z91A 2CO5A 2L02A 2VONA 2X4HA 3KZYA 4RB3C 2ADUA 2KIFA 2JPCA 4XSZF 4R8HA 1LJ9A 4F7ZA 3F23A 2GA2A 3KZZA 2VC0A 1OPCA 3V4GA 3LSTA 1LDKB 3K1NA 4KIGA 1O3TA 3GFIA 4Z2YA 3W6JB 3F22A 5FO5A 1O3QA 4A0XA 3R61A 3WTZA 4BQAA 1ZH5A 3DQVC 1NHAA 3GZ5A 1U5TA 4ESFA 2ZBKA 4ASNA 3MCZA 4ENJA 2FOKA 3I59B 4QLCU 4KMUX 1AOYA 5DUIA 3N97A 1BJAA 5DYMA 1ONVA 1R7JA 2EK5A 3KP7A 1FYMA 2EA4A 2RV8A 4JQFA 2R7DA 4UVAA 1FP2A 3MZYA 1CGPA 2W24A 1UB9A 4PZJA 1LEBA 4XLNF 4EJVA 2ZFWA 4XSXF 1KQ8A 4M9SA 4OMYA 2A68F 1LQ1A 3BJAA 5E8IA 2PQ8A 2KIMA 4LK1F 5LGUA 3EUHA 5HOOA 1F9NA 4KFCA 2VT2A 2VXZA 2VC1A 2K7LA 3FM3A 5FB2A 2GAUA 4FHTA 3F3XA 1TNSA 4ENKA 5LRRA 3G73A 2A61A 1B4AA 3M9AA 2R7FA 3CUQC 5BQTA 2M30A 1R1UA 3E6DA 1IN7A 4PCQA 1SD5A 4HF0A 3TO6A 1IRGA 1QNTA 2OZUA 4G7HF 2HKOA 4L9VA 4D0PA 3GFLA 2A3SA 2PEXA 5E1ZB 4FT8A 1ZRFA 1Q1HA 1YIOA 3O3KA 4M73A 1QZZA 5F1RA 3DXJF 1A04A 1HXDA 3Q5FA 1XCVA 2R3SA 2IA0A 1IXCA 1MJBA 3WU1B 4UV8A 1QPMA 1JGSA 1FP1D 3F8FA 1YTYA 2EFQA 2P5KA 4AWXB 3GFMA 3E3VA 2UWMA 4WWCA 2O0YA 3EYYA 1KU3A 4M74A
chains in the Genus database with same CATH superfamily
2X6XA 2EJRA 3JRIA 3J80K 4I02A 1I39A 4UVCA 2TDXA 4MTEA 1WJEA 1ZK8A 4BAYA 1X4OA 3ABMH 2LBFA 3SEQA 4LD5A 1R49A 3ERMA 1FNNA 4EJUA 3HGGA 1BOAA 2XB0X 3HPHA 1U8RA 1DPUA 4GYGA 3FHZA 1RUNA 4RGRA 4E7HA 2HKXA 4HRIA 4WXCA 2KL4A 2DXIA 1V3FA 1LEAA 3JRCA 5KNLA 4M72A 1GDTA 3CUQA 3H3UA 1OJLA 4KMFA 2B7EA 1GVDA 4CA0A 3DPLC 1FOYA 3BQZA 1LDDA 3FXRA 1X19A 3QP5A 5M5YJ 4CCJA 1Z7UA 2XKOA 4HF2A 2WAQA 1FIAA 2XIGA 4MNUA 1IN4A 3S1MJ 2AHQA 3I4MJ 2YU3A 1MH3A 2ZC2A 3L1PA 2XASA 2NNYA 1IN8A 3LAJA 2LNBA 1YRNA 1MJAA 3KFWX 3S2WA 2VBWA 4IQJA 1JTYA 5K5RA 1BOBA 2K27A 2QBYB 3FMSA 2XAGA 3JSPA 3HL2A 2AS5F 1R1VA 2DMNA 2XF5A 5DM6F 5H6RA 4J00A 1ZYRF 2ZXJA 2E5ZA 5M5XJ 5IYDJ 1IG7A 4IHWA 4Y33A 1P4XA 2VLAA 4B8XA 2O6GE 2CH0A 2P7VB 2V1DA 3Q3SA 2CFOA 5EZHA 1F5TA 1Z77A 5D5WB 4L0ZB 1R00A 3S1RJ 5BOXA 1MIJA 2R7RA 4IRHA 3DLLF 1FOXA 3G2BA 3CUOA 1B59A 2DMQA 3H0GJ 4XOTA 3HEFA 4EATA 2E36A 2M0CA 4RAFA 2QENA 3NAUA 4G7ZF 2KDOA 2VJ4A 2ZB9A 2XRNA 4DW6A 4MLOA 5D8LB 5FKKA 1Z1DA 5L3FA 2P7CB 3MKZA 3ULQB 3RKYA 5J8FA 1SD4A 3ZCOA 5KAIC 2BHYA 3VYSB 3I55I 2JT1A 4II2A 2LY1A 1P4WA 2BBYA 1APLC 2Y75A 4UHTA 5ICEA 2DU9A 1WI9A 4ZYHA 2EV0A 1K78A 3JTGA 4C2UA 3DEUA 5J1YA 2PBIA 1P7IA 1FYKA 1WZ2A 2M0MA 1IUYA 4CH7A 5ICGA 5LGNA 4ZDOA 2ESHA 4JX4A 3L09A 1H9TA 4UNOA 4EEFG 2JA8J 4WK8F 1HW5A 1YX5A 5K7FA 5FRNA 1G2HA 2CUEA 4CZZA 2HOEA 2ZJRF 3HSFA 1X3WB 3F8MA 3KX2A 1AU7A 1GXQA 4G6TB 3HSRA 3BY6A 3ML6A 2VN2A 4KA4A 3IC7A 3GWZA 2ECCA 1TWGJ 2R92J 1IGNA 2VL8A 2CGPA 1TWCJ 2FBIA 4BJ5C 4J19A 4HBLA 4CCKA 3ZR8X 2FNAA 2QVOA 3VOEA 4DOZA 1WWXA 4KDPA 3C2BA 3PUBA 2BHZA 2K3FA 2Y48A 2ZJ2A 4N4NB 1FX7A 2QM3A 5HODA 2HYGD 3IL2A 2VUMJ 1U9OA 3ZP5A 1TQPA 1MSEC 4P1WA 3K70D 2CV2A 3TW6A 1B1BA 5FLXK 1VTNC 1ZARA 1D8JA 1DPRA 3I4PA 2W48A 2X48A 3RQIA 4UUSA 2EPFA 1ZN2A 3C18A 3V8LA 1IRZA 2W57A 3RDIA 4YFXF 1J59A 4BDYA 2VI6A 4B47A 1OQYA 3FX3A 1VQKI 1DGRM 4GFBA 2L7FP 4HF1A 2RVCA 5F04A 3KEQA 3P5JA 3Q9VA 4G12A 1XGOA 4KITB 4XLHA 2KJBA 4M3DA 1AKHA 3BZKA 4G6QA 2X0LA 4KN4X 3C7JA 1POGA 2COBA 3BTJA 3RTRA 2FBHA 4YFKF 3S3OA 2IS6A 2VJ5A 5JFRA 3LSPA 2EH3A 3FWEA 2QCOA 3L00A 4IL6C 5DCMB 3WTWC 5HDKA 2YUSA 2HXOA 1B8IA 3KIOA 3C2HA 4L5IA 1CQTA 1U5TB 2KFDA 5J1UA 3DEWA 1ERDA 2XAFA 4HYEA 1E2XA 2E1CA 5F0CA 2HGCA 4AVZA 1HF0A 2BXYA 2OQRA 4R79A 4ZYDA 3IV5A 1YJ9I 3BZ6A 3LSHA 5CVRA 3BR5A 2OTLI 5FFXA 1WJFA 2A69F 3LSKA 2DAOA 1JHFA 5L3GA 2FSWA 2PMUA 3M3YJ 3MZ8A 3DBLB 1VNDA 4PJJA 1A31A 3R6SA 1BJZA 3GTLJ 4M9ZA 5K5OA 1D1BA 1VQLI 2DA4A 3BOQA 1W0TA 2JMWA 4IPAA 1PP7U 3PSIA 1IV6A 1PP8F 1JKRC 1BI1A 3I53A 4HLXA 3A01A 3BPXA 3T1BA 1JKQC 5LFAA 2QSFX 1TQMA 4ZH4F 1MGTA 1RR7A 3BG5A 4OINF 5FFZA 2OUMA 2XAUA 1MNDA 3AG1H 2CQQA 3R4KA 3OYFA 2RREA 4TV7A 3RPUD 3PFIA 5B5EC 5HS9A 4KJZA 4OWRB 1X1PA 3L2CA 4LB5A 2OQGA 3QU3A 4XKVA 2D1HA 2W84A 5HS7A 3BJOA 2DA5A 4LIUA 1Y56A 2Y30A 2R7XA 2ACJA 2FQ4A 5D5XB 1W0UA 2ID6A 2C6YA 2BE5F 1PJRA 2D2WA 4EGYA 3DCFA 3H3VK 2LLKA 2FMLA 2VBXA 3BR2A 3M1EA 1OCCH 2NRAC 5FLMJ 1MBKA 2CV1A 2EB7A 1ZLJA 1HKSA 3IH4A 3H92A 3TP3A 1RKTA 2ZNYA 4HLYA 4A2UA 1OYYA 2XC7A 1O7LA 2QSGX 4A5MA 2CQ7A 1FSEA 1S7AA 4WCGA 1FYLA 3J7YJ 1I3QJ 4DGWB 2KMUA 5DV5A 4EJWA 1FBSA 1YFHA 2O61A 2GXGA 2VOPA 3E97A 3GTJJ 3FHNA 3M7GA 1XG1A 1FPQA 3ZXSA 1MMSA 1NK2P 2QQBA 3M8FA 2NOGA 5JI6A 1D5VA 3OR2C 5IP6A 3LSJA 4CDGA 2BYVE 2PG4A 4G94A 1VQOI 1EA3A 2IGKA 4A0YA 3CCSI 2HVRA 3MKYB 1QA6A 2D1VA 1SFOJ 4IQ4A 3ZMSA 2DJIA 2DA6A 1YLFA 4EM0B 1YOVB 3DLAA 2DT7B 2HQRA 5J8CA 3CDLA 1DP3A 3ERED 4HOBA 1LDJA 4KT6A 5DD4A 1R4NB 3S16J 1IXSB 4IOAF 2EA2A 4HQMA 3D5SC 3B6AA 2M4KA 3BTCA 3MN2A 3BR0A 5EGOA 4FTHA 2GA1A 3ABTA 3HOSA 3SZTA 3DTIA 3L7WA 4MFEA 2R7SA 4XIDA 3CF2A 3ZMVA 3JRGA 1WSUA 1D5YA 1OCTC 4BEHA 4IVNA 4BACA 2V6CA 5EEHA 4MO7A 3V7SA 4AIHA 1JJ6C 1FTTA 2G0EA 2KRCA 3GO5A 4RM3A 3F9KA 4HAMA 1YQAA 4IX7A 2LBFB 4ANJA 1RNLA 5IYBJ 5CVUA 2CS3A 1WHUA 1Y39A 4YELA 3H5NA 4MFDA 2XSDC 4LLGF 5DD8A 1XD7A 2XPVA 5D5UB 1KQ0A 3QODA 4AU7A 5K7ZA 4HQEA 5ILVA 2R7VA 4E7IA 2AXLA 3G1MA 3MWMA 3LWFA 3HKZN 4E4HA 3CUQB 5HLTA 1HQCA 4LB6B 4M3FA 2F48A 2HYJA 4MEXF 2ZSHB 1B72A 3KP5A 4B3XA 1MBEA 1KGSA 3HYIA 4RA2A 4ZYGA 1ETQA 3TDUC 1EKEA 2FJ1A 2WB1N 3CCMI 3WTUC 5FD6A 5GPCA 3CCUI 2KDZA 3D0SA 4IRIA 2G9WA 2JZYA 4ZTFA 3HOUJ 4IZZA 1IXRC 4C3JJ 2L0KA 4LFUA 3KETA 2Q0OA 1WJCA 2VE9A 3AL0C 2IP2A 1G3YA 2M3AA 1YRNB 2DOFA 3HUGA 3K4BA 2YR2A 3PM1A 4L0YB 3W3CA 1LUJB 5EEGA 5F64A 1L3LA 2JA7J 3H0DA 2CWEA 1E3PA 4XNFA 3L2UA 3V7RA 2ELJA 3KE2A 3HIFA 4A3EJ 2Z9OA 4Q5SF 3DP7A 1XPXA 3MD2A 3CTAA 2X6WA 1WJ5A 2J5PA 4RB1A 3LAPA 2YPRA 1TWHJ 1YJNI 5GAEJ 4I09A 3LFUA 2W00A 2QLZA 4MEYF 3JR9A 4HZFA 1O3SA 3O6BB 2Y9YA 5ICFA 1MBHA 2BV6A 2OU2A 3WGGA 5BS6A 5BMZA 1JKOC 3DKYA 3H5AA 3GW2A 3OSFA 1FEXA 4RB2C 2HFHA 4PFOA 5DTDA 3OIQA 3MVPA 3KPHA 1D8KA 1BR1A 4GYIA 3OYLA 1P7JA 3SDBA 2A5WA 4J01A 3WTXC 3EQLF 1TZLA 4ZC3A 1FOWA 4F55A 1IRFA 2PX9A 3BC8A 2OCEA 4XR6A 4I0BA 2P0WA 1U0JA 2GXBA 5HS8A 2L3DA 3KCCA 1WRJA 3OV8A 2O8KA 4I7HA 3PL8A 1CF7A 2MG4A 4PGGA 2R5YA 1WPKA 4A0ZA 4M9XA 4NC7A 2L01A 1SFXA 3JREA 1R23A 3Q0VA 4LMYA 5JVTA 2M7AA 1K78B 2QKMB 2H6CA 5CVJA 4XMYA 2FNPA 1QVUA 1YS6A 4UVBA 4E7SA 2P81A 3VYUB 4BL0B 3OYBA 4E7KA 3HSEA 3W6KB 1R1TA 4CO8A 4C2MJ 5GAGJ 1IF1A 3VWBA 2WTEA 2LG4A 4LGWA 2ZCWA 4M3EA 2I5UA 5K5QA 2HNHA 3K4KA 1ORKA 2VQLA 3GTOJ 2YSRA 1FBQA 3F8CA 4CZCA 3LFKA 1V5EA 2VE8A 2JTVA 1MMNA 4HDVA 3S32A 3N05A 5HVQC 4CYCA 4BNCA 3P9KA 5JR3A 1SMTA 4QSHA 5DS9A 1T08B 2F2EA 5L3BA 4RLQA 3WE3A 3TBIA 1J5YA 2XROA 4U7BA 1Q1VA 2XGCA 2V9KA 4AIJA 1K6YA 2QQ8A 4O3MA 3H36A 2HEOA 4DYCA 3IAS2 4GDFA 5LHIA 4UUSB 2ISZA 1K79A 2BY0A 2RN7A 4UV9A 2IBDA 3BG3A 3CP8A 4NC6A 2Y0MA 2EQRA 3RZOJ 2QUFA 1Y8QB 1SD7A 2Q2EA 4Y17A 1NG7A 3E6CC 2Z33A 1R36A 3CLOA 4C30A 2HR3A 4V19K 4II3A 4PJLA 1YI2I 1AKHB 2JSPA 4UB6C 3W6VA 3GTGJ 3HHGA 4AYBN 1DU0A 3KP3A 4HX7A 3FXLA 5LGTA 1NH3A 3ABUA 2P5LC 1GXPA 2STTA 2UXNA 3JSOA 2GWRA 1TW3A 3ABLH 1X3UA 5EG0B 1E17A 1TTYA 2BW3A 1B8IB 3S8PA 3DTKA 1MBFA 4F91B 1SVLA 3L9FA 3WU0A 3HOXJ 1TP4A 3IKTA 2YS9A 3A0BC 4OU0A 3K4CA 3OYJA 3QP6A 5CPRB 1WH5A 1ZR4A 2L7MP 1YS7A 2DYSH 1Z3YA 2FE3A 2VBYA 5GTIC 1T38A 2HQAA 3QWLA 3J7AO 1YE9A 2KT0A 2JN6A 4LG3A 3M1CA 1BC8C 1D1AA 4BY7J 1ZQ3P 5F6FA 3DKWA 3QOPA 3Q9SA 4I76A 3FF5A 1D0XA 2XF7A 2PMHA 2MW8A 4EM1A 3SYTA 3WGIA 4EGZA 3VSKA 2RQQA 1IDYA 2KZVA 3GLXA 3TO9A 1HKTA 2DQRA 4XICA 1H88C 1J75A 3WTTC 1VQ7I 1H0MA 3A01B 3SZPA 4NHJA 1XMAA 2DJNA 1QGPA 2F5DA 3OS0A 4M6XA 4YFNF 4PDKA 4XONA 1XGMA 2AQEA 4GO1A 1YIJI 1HBXG 3HTSB 1W4MA 1FT9A 2OV7A 1SVMA 2EBIA 1N25A 3W2VA 5LEJA 5FJ8J 1REPC 2LF8A 2FEZA 1KU3A 3A1YA 3GVAA 3VDXA 2DDAA 5E17F 2HPIA 2G7UA 3J7AY 3WODF 2YU9J 1VQ8I 3CCJI 1U3EM 2GZWA 2FF4A 3FK6A 3K0LA 2RDPA 1ETOA 1Z67A 4BQQA 3SHFA 3OS1A 1ENHA 2ZSIB 4A12A 4L18B 4WXHA 5FLVA 3DPTA 2EZIA 2DPUA 4FQGA 2LKPA 3I58A 3P7NA 2R93J 1YHQI 4FE4A 1YO5C 1DGWY 5D5VB 2VOOA 1GHCA 1YG2A 2L9RA 3G1LA 2LRDA 3OYGA 3E0JB 5CLSA 1R9TJ 4G9YA 2VIXA 4S0HB 1ZTRA 3K4JA 4S04A 1XS9A 3H9QA 2DK5A 3J80Z 3PQJA 3HGYA 1MMAA 3T5XA 4MTDA 3FBNB 2BGCA 2GXAA 3GTKJ 1U9NA 4NQWA 4X1EA 1BI0A 5IY5H 3SXYA 1R58A 5D8KB 2STWA 1D3YA 1USTA 2I10A 5CVIA 4JK1X 2K3PA 1AHDP 4P55A 4JOMA 3IRRA 4UY8I 1V54H 2M4GA 1IAWA 1BN5A 1V5FA 2HDWA 3K2ZA 3RQ4A 2BY1A 5EZGA 1QU3A 4WXDA 5EGOB 1FOKA 3ESWB 4RS8A 2DW4A 2LVSA 2XPUA 1UG2A 2M8EA 3QPTA 2CUFA 2DFIA 1KZHA 5GADJ 4BEHB 4XM3A 2MC3A 4BYYA 1FLIA 2WWYA 2FUG2 3WTVC 4BH9A 3AG4H 1ULYA 2JUCA 1OCRH 2IRFG 2L7ZA 2DTZA 2BXZA 1YYVA 2JSCA 1W5SA 2IPQX 2XAJA 3K9TA 3ZQQA 3QAHA 1S72I 2DPDA 2LSOA 3CCYA 3IHUA 2VQHA 1V4RA 2IW5A 2O7OA 1BL0A 2K9SA 2VKVA 1ETKA 5LRSA 2HDDA 1VQ9I 2QWWA 1UMQA 4ENMA 2JVGA 5FKMA 5FKLA 1OCOH 2QQ9A 4OIOF 2BY3A 3SJMA 3DBRB 4L5JA 3HRSA 2O03A 2R0QC 3EYIA 1B72B 3HOZJ 4F93B 4HDUA 3OWTA 2PFBA 5DEQA 5ERIA 2HTSA 1XSDA 2Z1DA 1OCPA 2E2IJ 4XKCA 2MH2A 1G3TA 4D5FA 2WB1A 1FWZA 1UELB 2DO7A 2NS0A 2TCTA 3KP4A 1E3HA 2E1MB 4YRVA 3DU5A 3EPZA 2ZO4A 4KUMA 5E1XA 1O4XA 2HZDA 5L3DA 3QYFA 1XSVA 3MEXA 2NS7A 2L5QA 3GYHX 1BW5A 3LMMA 1MBJA 3CCRI 3J81K 4EM2A 3D5LA 2WY8Q 1QBJA 2F6CA 1ZELA 1MDMA 1FBUA 2P8TA 3IH2A 4BJ6C 1XMKA 4KN7X 3KZIC 2JK3A 3FXJA 3BR6A 1R5HA 3CDHA 2E7WA 3DEEA 3L2WA 3RZDJ 2E2JJ 2H8RA 2ZXHA 2JQ7A 2V26A 2WADA 3LSGA 2DTRA 3SDGA 3HOTA 5FD5A 4B4CA 1RRJA 2M87A 1JTXA 2FQ3A 2OJED 3HBLA 2MBFA 2EV5A 4YG2F 2V9VA 2F4IA 1HCRA 2XAQA 2XVCA 3LNQA 2I8DA 3B02A 2NYXA 4UXNA 3IWZA 4BXUA 2DMTA 4PSXA 2DFFA 3KYDB 3RYPA 2DA2A 4A3KJ 4K2EA 2W25A 5B1BH 2HOSA 2LK2A 4PJMA 2DI3A 3WGHA 2IT0A 3DU6A 2PN6A 1U2WA 1KYWA 3CJRB 3FXUA 4RAGA 1T39A 2HDCA 1CF7B 2VXDA 1O7FA 2R5YB 1EV7A 3BLYA 3BWGA 4ITVA 2WA0A 5FLXZ 3VEPA 1XC5A 2KHMA 2JWTA 4ESJA 1UFMA 2Z3YA 4Y15A 1YJWI 3OYCA 2W85A 4FCYA 1T0FC 1YW8A 3BR3A 1T95A 3ECHA 1JUPA 1X2MA 4RAYA 2AQFA 4LK0F 2HTJA 3O2PE 4XRFA 2ZJQF 4MQ9F 3AL0B 5AONA 1SVOA 4PJ0C 3KYLA 3EUKL 3KEOA 1F1ZA 2A6EF 4ZZDA 4IHYA 2DLLA 3P9CA 2QGUA 4B09A 5C44J 3H9JA 3E1SA 2DMPA 3FXMA 3PNYA 4CYCB 1ZGWA 2OBPA 3TOBA 4DJAA 3ZN1A 1PUFA 2H1KA 3HTUA 4DQ2A 3E6BA 1I6HJ 5IT9K 1VZ0A 1WVRA 4XLAA 3ZMUA 4FASD 1BW6A 3WTYC 3PO3J 2X1CA 2GQQA 2V9PA 2VPRA 3FXKA 2LR8A 2DODA 3KP2A 2CV0A 2R7TA 3WE2A 2Q2EB 3HRMA 4LLNA 1LVKA 3QPHA 3GTPJ 2CQNA 2NVYJ 3F8NA 3WU2C 3FKJA 2L4AA 2Y0SA 1S6LA 2RAEA 3CMEI 4HW0A 5CJ9A 2PJRA 3R0JA 4ETSA 5HLGA 4JX6A 4PK4A 3TGNA 3BJ6A 5GAHJ 3VFZA 5HNHA 3I54A 3RIRA 2P4WA 4BHPA 1OMIA 2Q1ZB 4C3HJ 5J40A 3CMYA 2RC4A 2KRFA 4IO9F 4PJNA 1MSFC 5D6FA 1S5LC 1K61A 5GTHC 2Z2SB 4A6DA 3RI4A 3FMRA 2X9DA 4M6VA 5J6XA 1T0FA 3TEDA 1DUXC 2BW3B 3CJNA 1K83J 5EYRA 2H94A 2BZTA 3HPGA 1XMXA 5E1WA 1QVTA 3OYEA 3BP8A 3G1OA 1F36A 5BPIA 2G7HA 3DFGA 3HXLA 2WAQN 3L2VA 1KA8A 1P6RA 3U9GA 2ID3A 1X1CA 2DA7A 3JRBA 3N4MA 1P9QC 2YX7A 1QZEA 1AA7A 4BBRJ 4V2FA 4FX4A 5ILUA 2W7NA 1JT0A 4NC8A 5IT3A 2W4SA 1JUMA 2NOJB 4OMZA 4BDZA 4O5VA 2QQAA 5F27A 3V8KA 3I56I 1D1CA 2VJJA 1BIAA 1IJWC 1G3SA 2JPBA 2NVTJ 2Y69H 5DM7F 2LMDA 2B0LA 1WKMA 4A3CJ 2EIKH 1EH7A 5FROA 3F72A 5BPDA 2LKXA 1SAXA 2MABA 5L3EA 4XORA 3DKXA 4BUPA 2YX4A 4XK4A 4OAZA 3SEZA 4BQNA 2A07F 4L9JA 2EFWA 2ZJPF 1E3OC 2MD5A 1ZHFA 3C2GA 3U1DA 2COMA 4HPQA 1I1GA 3E6MA 4XLPF 1A36A 3SFZA 2L7KA 3A03A 3F6VA 3PQKA 1PYVA 2E71A 3KP6A 3QQAA 4BGDA 2FD5A 3I71A 2W82A 4I0AA 1I1SA 4XLEA 1GUUA 2Y31A 2UXXA 3W2AA 3RKWA 3RPQA 3TKYA 2KLOA 1SFEA 2LOOA 4RGUA 4BQOA 3CLQA 1USSA 3GF2A 4GCVA 3JTHA 3P9IA 5E3OA 1MNMC 2LY9A 3OYKA 2X6YA 4CCMA 1O57A 4DNCA 1B9MA 1K7AA 4IHVA 1U78A 1IN6A 3TL4X 2DMUA 2X85A 2NXNB 3CP2A 1D0YA 4P96A 4V2GA 1FSHA 2QZ8A 4X0GA 2KQRA 3L2QA 1KYZA 4R1HA 1I50J 2V4JC 2QKLB 1JT6A 1X1AA 3ZQFA 3LOCA 2XGDA 4M3BA 5HDGA 3OYNA 4I6ZA 3D5RC 2IA2A 1W5TA 3FMQA 5JHFA 1ZR2A 3S17J 1RR8C 1HSJA 2ELKA 1ZG5A 1QRYA 1G4DA 2XKPA 4IHXA 3MQ0A 5TJJA 4NB5A 5D4SA 4EQQA 3HHHA 2XHKA 4NQWB 2WC2A 2XB5A 3I0TA 4JP0A 3S3MA 3FZVA 4LOCA 4IJAA 1K4SA 2M8GX 1I6XA 1Y0UA 3V8JA 2Y9ZA 3PFYA 4G7OF 2WBMA 3DF8A 2FU4A 4QPOA 5TRDA 1J2XA 1X3ZB 1BI2A 2E7XA 2EIJH 3GBGA 4RB0A 2D5VA 3HRTA 2XPWA 3BCBA 1TQIA 2DCEA 3ISPA 3T0YA 2F5EA 4OIRF 5JHUA 1S7OA 3DV8A 1R5ID 3K70C 4I99C 1IRXA 3GZ6A 1ODDA 2H8WA 4HSRA 4AM3A 2UZKA 4U88A 1MJ9A 2WY7Q 3BCAA 2ZNZA 4Y13A 4XQFA 3CCQI 3LA3A 4A93J 2V1NA 5LBQA 2X51A 1RUOA 4BE2A 1QHGA 4QPQA 1S3JA 1H9GA 3SQNA 1ZRDA 3E7LA 5M3MJ 3ABKH 2MGQA 4B48A 3M07A 4RMNA 2EFNA 4MIMA 2FOWA 3CQZJ 3DPUA 4Y4RA 1XX5A 4A69C 4E7JA 2CMPA 3OYDA 5B3SH 3BT9A 1C0WA 1VQPI 2LYCA 4GGGA 3H1CA 3HOWJ 2RKHA 3CD6I 3OL4A 4RAZA 2EIMH 2LREA 2GM4A 4XKWA 1HLVA 4HV6A 4ZZLA 2OC6A 5DCMA 3HJEA 3OS2A 2HPMA 1HA8A 3F6OA 4ZJZA 3PUFA 4KICA 5B1AH 5KHDA 1MD0A 2NNNA 3GFJA 4MQVA 2H09A 4Y3OA 1ETVA 2XGXA 4U0WA 2L54A 4KIBA 1BC7C 4G8XA 1D0ZA 3C1DA 2NVUB 4PUSA 4QWQA 4U87A 5CQEA 9ANTA 1HW2A 2AO9A 1ETXA 4UUVA 3MZHA 5IOZA 4A3MJ 2Z99A 2DT6A 1W1WE 3OOPA 1ETYA 1TNTA 2FX0A 2EFPA 1LB2A 1X58A 2KISA 3FM5A 3E5UA 3DWLE 3HOVJ 3JRAA 1A35A 2K9NA 1JI8A 3HC7A 3K6GA 2M2EA 3KLNA 1WCMJ 4BXFA 4E70A 4XRSG 2IJLA 3CDIA 2DT5A 3EETA 1OYWA 3HB9A 3A4CA 3QYBA 1EF4A 1MDMB 2NVXJ 2P6TA 2HQNA 1JKPC 1ZGJA 2IGMA 6PAXA 4RM2A 3IUOA 1PDNC 1YX3A 4CGZA 3M8JA 2DDBA 4LITA 4KIFA 3LSIA 4IHSA 2K85A 1W36C 3HG9A 3ZQIA 4XN3A 3CCVI 3TQNA 4NBQA 1R71A 2EFOA 1HOMA 5JLXA 1UHMA 1HKQA 2HWVA 1SFUA 5ED4A 4W1UA 2UV1A 2D45A 1BA5A 2FMYA 2Z5UA 3K10A 2FXAA 1P4AA 1MH4A 3OYMA 2ZXWH 3ZPLA 2K5CA 4XBFA 1SD6A 3LQQA 4HX8A 3LSRA 1WQ2A 3DTEA 1SAUA 2OAZA 3ZRGA 3NWSA 3IP4B 2XSJC 2VBZA 2BOLA 3AAFA 2JRTA 1KONA 5B66C 2CFXA 2DOAA 2IS1A 1P2FA 3X2QH 2M45A 4HV5A 2R7WA 2M9HA 3BR1A 4IRGA 4BKXA 1JGGA 2ZMEC 1STZA 3U2RA 2V7FA 3E5XA 2K4JA 3K7AJ 4HSTA 4BHBA 2JA6J 2NAZA 1QHHD 2CG4A 5HDNA 1OLTA 4LG0A 4B1RA 1U8BA 1I27A 2DN0A 3CMMA 3J7ZI 3HRUA 3MMYB 1TBXA 2R7QA 3F8BA 2VKEA 5K1YA 4YIFA 1KQ9A 5FKNA 2R5ZA 2EWNA 2L4MA 5IP9J 2R7ZJ 3OIPA 4BHCA 1WJDA 3R0AA 2QYOA 3GEZA 4ENNA 3G6EI 4KNYA 1N77A 5J47A 3GUDA 2XV4S 3UNGC 1LNWA 2OA4A 4JX5A 1PUFB 1Z0XA 2EZLA 2OF7A 2M1BA 3O8GA 3RKQA 1XTAA 3K4NA 1KU7A 5IYCJ 3EDPA 1LVAA 4IKFA 2FBKA 4ZYAA 1FMVA 1W5CC 4S05A 5LHHA 2IGOA 5AIQA 1OYIA 2O3FA 3BG6A 1FZPB 1N75A 4ZDLA 4I98B 1OCZH 4KYWA 2DFHA 2JRMA 1BR2A 4EVIA 4A3GJ 1LFUP 3RPUA 4BY1J 1VI0A 2ECBA 2VQGA 3U1KA 2PJRB 1S9HA 4U0VA 3CC7I 2LF7A 4L9NA 3MKLA 1S29A 3TOAA 1ZREA 1A6QA 4B3AA 4O6JA 1OFCX 5GP9A 5D4RA 4RGXA 5H2FC 4DBQA 1W7PA 1PVEA 2Y2ZA 2ZMEA 2IS4A 1ZG3A 3H9GA 5J4YA 2IVMA 4Q48A 2K9LA 3KEYA 1LFPA 5F1JA 3GXOA 3Q0WA 1V55H 5JLWA 4X6AJ 4Y7NJ 4P9UA 4CHUA 2KIUA 4AUXA 5C4JJ 1FY7A 3OSGA 2HYFA 1UHWA 5DCFA 2CQKA 2A6HF 4D5CA 1X1BA 4CXFA 1R22A 3QPLA 2DA3A 3JCUC 1UCRA 1HW1A 3BROA 3AFHA 4P5OA 2N8GA 1NTCA 1GVJA 4DZJA 2IGNA 4U0YA 4DZPA 2MD0A 1J7KA 3B6CA 3RCOA 3PIOF 2LTPA 4A3JJ 3AKZA 2JVHA 2CW0F 3H3ZA 2ISYA 4ZYEA 1QQIA 2LFBA 2R7OA 3E5QA 3V42A 2O5RA 3SFIA 2KJCA 1Y1WJ 2XGEA 2MLKA 2HS5A 3WG9A 1RC9A 3ASOH 2M34A 1JE8A 1IV8A 4KT5C 3K1PA 2H1LA 4AD9A 2JA2A 5D6EA 2Q8KA 2JUGA 2EZKA 1T98A 1SEUA 3ZOBA 1X1DA 5C4XJ 4I01A 2E60A 2V79A 1ITYA 3BTIA 2MYSA 5C3EJ 2PMZN 1ON1A 2OD5A 3WTSC 5E3LA 2DYRH 3ZMTA 2X6OA 4M3GA 1Z6RA 1FJLA 3REOA 2ETHA 2UUZA 3IAM2 2CQXA 2EILH 5FKOA 4FETA 1JUSA 2B9SA 2F5FA 4CUGA 2P6SA 3M4OJ 2XRLA 2E5NA 5CVVA 2CJJA 4XKBA 2GBYA 1XB4A 3ZN0A 3MFKA 3S14J 2R7UA 2JJ7A 3LSMA 2QA4I 4Q47A 5FGMA 1F4KA 2HQ5A 3CF5F 3JAMK 4IHTA 2E35A 3AG3H 2J5OA 3NEUA 3HKZA 3PNTA 3ZQGA 1YW9A 1OKRA 2CRGA 2W1OA 5CQGA 4BE1A 4CCNA 2KZGA 2KKOA 1FIPA 3I59A 2MH9A 4AIDA 2HOAA 5H6QA 1LFBA 1WFXA 1QZYA 1MZBA 2ZXIA 1IC8A 4L9TA 4WF2A 1DU6A 1T2KA 4XL9A 1VFCA 2LP0A 3T8TA 1NG6A 1RIOH 2CYYA 3HUGB 3S2DJ 4NNJA 2CUJA 1DQUA 4BS9A 1F43A 5GPAA 4AIKA 2V1UA 4Q4ZF 1X2NA 4ON0A 4A5NA 1JHHA 1HSTA 1IZ1A 4HA8A 5HLIA 1K6OA 1SANA 4A3DJ 5M5WJ 2VT3A 4Z6YA 3BDDA 2GIZA 5F0HA 2ZKZA 2RNGA 1VQNI 3C3WA 2QEXI 2GLOA 2XAHA 2DA1A 1OR7C 1LE8A 5A2QK 3ZQHA 3UKGA 3MAJA 1SMYF 4E7ZA 2X1DA 1TWAJ 3VSLA 2CSOA 5E18F 3ZQLA 2E1NA 3ZMDA 1OISA 2TRTA 3PJRA 3WHBA 3BZCA 3JAMZ 1DDNA 4W97A 3NQOA 1J09A 1L0OC 1XGNA 4YIRX 1Z9CA 3S1NJ 2K4BA 5E20A 2EINH 3ECOA 3G71I 2V1XA 4DBRA 2ELHA 1T6SA 1ZGAA 1MMGA 1HDPA 1Z7LA 2OZ6A 2BY2A 1G59A 5KVRA 4ZTJA 3EUAA 4XLCA 3HM5A 2EV6A 2VQCA 5AIPA 1GV2A 4U7DA 2AXTC 4AVPA 3LA7A 1QO0D 3K4LA 4EJOA 5IOYA 1IW7F 1UHSA 3SZGA 3VODA 3GLLA 4A3IJ 2JA5J 3J81Z 4ABZA 5JVGF 1RETA 4P9FA 2VODA 1R5GA 4NDLA 5EG0A 4BXXJ 5EJCA 4N9HA 4OIPF 1G3WA 3W2WA 2O8XA 2WV0A 3R60A 4QTRA 3B73A 3IWFA 3ONQA 1WH7A 1R4MB 5E3MA 1XN7A 3QPSA 4CSWA 1AWCA 2P5VA 2LKSA 2BEOA 2K86A 5A2QZ 2DK8A 1U6GA 4XRMA 5ILSA 1BBYA 2IEKA 5KK1A 1VQ6I 4A3BJ 1B6AA 2A5YB 2KIQA 1FC3A 5L3CA 1XDUA 5EEAA 1B9NA 1Z21A 1Y0NA 2FA5A 1XSXA 3WG7H 3RJPA 4HNTA 4F3QA 1ZLKA 3NRVA 5HNFA 2MFZA 3WHCA 1OR7A 3IKVA 3QU6A 1MNEA 3CMAI 4N0BA 4D7MA 2MA3A 2HZTA 1WJAA 1YW7A 5E79C 1XDSA 1LKXA 2F4MB 5DUKA 1W36D 4ESBA 3GCMA 4HNVA 1XCBA 1ZG1A 2GIVA 4YIIA 1RKWA 1XGSA 4E6KG 3G4SI 3ZQCA 5E8GA 2GOXB 5ICCA 2XUBA 1LPQA 5DDGA 3OYIA 2FRHA 3S3NA 3JRHA 1RZ4A 2RGVA 2QF7A 3HZJA 2ESNA 1UZCA 4M6YA 2CW7A 1BI3A 2K9QA 3OMYA 2A05A 4G6DA 4CYDA 4I2OA 1A6IA 4AYBA 3OIOA 3RKXA 5HLHA 1N78A 2IS2A 3JW4A 4A6EA 2PLYA 1S7EA 5CKTA 3BPVA 3CESA 3QOEA 5FRMA 1W7PD 4ZDPA 1MW7A 2BVLA 3RYRA 1S8NA 1O3RA 2E34A 5BNGA 2B63J 3G3ZA 3H35A 1SC7A 5KCMA 4BE0A 5IT9Z 1X4PA 3S2HJ 2RNJA 3M8EA 2KRHA 1Z05A 3T8RA 3TDZC 4D1QA 5M3FJ 2MSYA 2VKDA 4LG0B 3D1NI 3A2KA 1WJBA 4HNUA 3BG7A 1E0EA 1TW2A 1EJ9A 1Z6TA 2KP6A 5EDNA 5IP7J 1GLNA 1PUEE 3BQYA 3H5RA 2RQPA 3LQRA 5K7HA 2QBYA 1J9IA 2O9LA 3CO7C 2LY2A 2MLGA 3FBIB 2R5ZB 3CCEI 3COAC 4IF4A 2PJPA 2EZHA 5J3LA 4XOPA 3V7CA 4MGRA 4C3IJ 4HX4A 3PSFA 4LLLA 2M5WA 1H89C 1DP7P 2GOMA 1JJ8C 1HDDC 2E1MC 1Z3XA 1KU9A 1I5ZA 3I5UA 4XRSA 3CO6C 5TGTA 4D9JA 5CYVA 2F5CA 2PI0A 3FIWA 1ZAOA 2F5VA 3ROUA 3F21A 1MKMA 3BG9A 3ZMZA 2H6BA 1FTZA 4HG2A 1P92A 3QRFF 1JXSA 2DBBA 1IN5A 5LD2C 4WX9A 1NK3P 2WAEA 3JRDA 4B44A 4MHGA 1RI7A 4XN0A 4QIWN 5LHGA 2HXIA 2H27A 5KAFC 4OIQF 4IXAA 3ASNH 1ZRCA 4EMSA 3A02A 4M71A 1KU2A 4JYKA 1EH8A 3K1MA 3I64A 4EJTA 4DYRA 3KLOA 2LDUA 2K9MA 4PFPA 3QYEA 4NUBA 3GTQJ 4PGHA 3ELKA 4N9IA 2VJIA 5H20A 5J4VA 3L2RA 1BIBA 2IA1A 1G8XA 4JBAA 3FXQA 3TP0A 3CC4I 1GT0C 4RGSA 1UG0A 4RBOA 1YITI 1J0RA 2XDVA 3IRQA 2OCCH 4GXOA 2HVQA 2K02A 1W7PB 1EH6A 3LL7A 2ZMEB 1ACIA 3TO7A 5LEKA 3FISA 4OOIA 1BM9A 4OAYA 3CC2I 4CICA 4BJTA 5LLQA 5TISC 2DQLA 3RSNA 1G6NA 1U5TC 4FX0A 2E19A 3K69A 4H0EA 2KPMA 2ICWG 2WV1A 5F08A 1ON2A 1I3AA 3LA2A 4LJZF 5EF6A 1IDZA 3GX4X 4EV0A 3ZQ7A 3VB2A 4N4OB 4HEA2 1QPIA 2A6TA 4C9YA 2VB6A 1Z91A 2CO5A 3S93A 2E2HJ 2L02A 2Z16A 2VONA 1TC3C 3U21A 2X4HA 3KZYA 4RB3C 5IPAA 2ADUA 2LH9A 2KIFA 2JPCA 4YEJA 4XSZF 2L9VA 4R8HA 1LJ9A 4F7ZA 3DBHB 3F23A 4A3FJ 4XLFA 4F52A 1SFKA 1HC8A 2GA2A 5E3NA 3KZZA 2VC0A 2X1EA 3F0CA 2ME6A 1OPCA 4RDUA 3V4GA 2HI3A 3CCLI 3VYRB 3LSTA 3CJTB 1BR4A 3OR1C 2QSHX 3CJQB 1LDKB 3K1NA 3JRFA 2PMZA 3I9V2 4KIGA 5J1RA 3O8HA 1O3TA 1Y1VJ 3BTLA 3GFIA 2ME0A 2OPTA 2R4GA 4LIVA 3EUHC 4Z2YA 3W6JB 4B43A 5FO5A 3F22A 1O3QA 4A0XA 3I3LA 3VYTB 4PSWA 2XF6A 4E7LA 3R61A 2VPLA 3FXOA 3TMOA 3WTZA 1TT5B 4BQAA 1ZH5A 4F92B 3DQVC 1NHAA 3GZ5A 1U5TA 2IAIA 2VASA 4ESFA 3TW7A 1FMWA 2NVQJ 2ZBKA 4D7NA 4BBSJ 4ASNA 3MCZA 4ENJA 2FOKA 3ZGKA 1WI3A 3I59B 3K4MA 4AC0A 2HVSA 3OYHA 4QLCU 4KMUX 1AOYA 1RPWA 3KYCB 2V6EA 5DUIA 3N97A 1BJAA 2CUZA 2CU7A 3UR3C 5DYMA 4RLFA 3AG2H 1ONVA 3Q0UA 1TWFJ 1R7JA 1MMDA 2LD5A 2EK5A 3KP7A 1FYMA 2EA4A 2RV8A 4JQFA 2R7DA 1T8IA 3OL3A 4UVAA 1FP2A 3MZYA 1CGPA 2W24A 1UB9A 2CW8A 4PZJA 1LEBA 4CCOA 4XLNF 2OTJI 4IEJA 3OY9A 4EJVA 3I4NJ 2ZFWA 4XSXF 1LE8B 2E1OA 2IXSA 1VQMI 3OYAA 1KQ8A 3FK7A 4M9SA 4OMYA 4GRIA 2A68F 3CZ6A 4IOCF 1LQ1A 3BJAA 3A0HC 4DYQA 3FKIJ 1UAAA 1VQ4I 2Y0SN 2PQ8A 5E8IA 2KIMA 4LK1F 4H4KC 2LC2A 5LGUA 3EUHA 3FDYA 1IUFA 5HOOA 1F9NA 4KFCA 3MKWB 2VT2A 1Y8RB 2HU9A 2VXZA 4FE7A 1UJ8A 2BVMA 3PO2J 1GV5A 2K7LA 2VC1A 3S1QJ 3NWTA 3HOYJ 1Y6IA 3FM3A 3GZNB 3PNVA 1RESA 3PIPF 5FB2A 2GAUA 4FHTA 3F3XA 4DIQA 1TNSA 1TT0A 4ENKA 5LRRA 4Y52J 3G73A 3OOUA 2A61A 1B4AA 1A5JA 1K4TA 2DFEA 1IO2A 1VF9A 3M9AA 4CCLA 2R7FA 3CUQC 5BQTA 2M30A 2L2OA 1TL8A 1R1UA 3NARA 3E6DA 1IN7A 2WAFA 4PCQA 1SD5A 4HF0A 1ETWA 2ZFUA 3TO6A 1IRGA 3S15J 1QNTA 1MBGA 2OZUA 2L9SA 1H8AC 2L9NA 4UUTA 4G7HF 2HKOA 4L9VA 4D0PA 4C2TA 3GFLA 2NS8A 2A3SA 1WGXA 2PEXA 3K2AA 5E1ZB 2K40A 4FT8A 1T33A 1ZKGA 1ZRFA 1Q1HA 1YIOA 3O3KA 4FISA 4M73A 1M1EB 1QZZA 5F1RA 3DXJF 1A04A 1HXDA 3Q5FA 1XCVA 2R3SA 2IA0A 1V5GA 1IXCA 1MJBA 2F4OB 2VKHA 4L5EA 3IH3A 4UV8A 3WU1B 1QPMA 1JGSA 5F0FA 3VPRA 3HDDA 1FP1D 2DOEA 3F8FA 1VQ5I 1YTYA 2EFQA 2P5KA 1T56A 4AWXB 4A3LJ 2M7BA 3E3VA 3GFMA 3GMEA 2UWMA 4BU2A 4WWCA 2O0YA 4KISA 3EYYA 3GTMJ 4UB8C 2HOTA 1TLHB 4M74A 1R6RA 2MC4A
chains in the Genus database with same CATH topology
2EJRA 3J80K 4I02A 4UVCA 2TDXA 4MTEA 4BAYA 4LD5A 1FNNA 4EJUA 1BOAA 1U8RA 1DPUA 4GYGA 3FHZA 1RUNA 4RGRA 2HKXA 4WXCA 1V3FA 1LEAA 4M72A 3CUQA 3H3UA 4KMFA 3DPLC 1LDDA 3FXRA 3QP5A 1Z7UA 2XKOA 4HF2A 2XIGA 4MNUA 1IN4A 2YU3A 2XASA 2NNYA 1IN8A 3LAJA 2LNBA 1MJAA 3KFWX 3S2WA 2VBWA 5K5RA 2K27A 2QBYB 3FMSA 2XAGA 3JSPA 2AS5F 1R1VA 5H6RA 1ZYRF 2ZXJA 1P4XA 2O6GE 4B8XA 2P7VB 2V1DA 1F5TA 5D5WB 4L0ZB 1R00A 5BOXA 4IRHA 3CUOA 1B59A 2QENA 4G7ZF 2XRNA 5D8LB 5L3FA 1Z1DA 2P7CB 3ULQB 3RKYA 5J8FA 1SD4A 2JT1A 1P4WA 2BBYA 2Y75A 4UHTA 5ICEA 2DU9A 1WI9A 4ZYHA 2EV0A 1K78A 3JTGA 3DEUA 2PBIA 1FYKA 1IUYA 5LGNA 5ICGA 2ESHA 1H9TA 3L09A 4UNOA 4WK8F 1HW5A 4CZZA 2HOEA 3HSFA 3F8MA 1GXQA 3HSRA 3BY6A 3ML6A 2VN2A 4KA4A 3IC7A 3GWZA 2CGPA 2FBIA 4HBLA 2FNAA 2QVOA 3VOEA 1WWXA 4KDPA 2Y48A 2ZJ2A 1FX7A 2QM3A 2HYGD 3IL2A 3ZP5A 1TQPA 5FLXK 1B1BA 1VTNC 1ZARA 1D8JA 1DPRA 3I4PA 1ZN2A 3C18A 3V8LA 2W57A 3RDIA 4YFXF 1TLHB 1J59A 3FX3A 4HF1A 2RVCA 3KEQA 3Q9VA 1XGOA 2KJBA 4G6QA 2X0LA 4KN4X 3C7JA 3RTRA 2FBHA 4YFKF 5JFRA 3FWEA 3L00A 5DCMB 3WTWC 5HDKA 4L5IA 1U5TB 2XAFA 4HYEA 1E2XA 2E1CA 2HGCA 2OQRA 4R79A 4ZYDA 3BZ6A 5CVRA 5FFXA 2A69F 2DAOA 1JHFA 5L3GA 2FSWA 2PMUA 3R6SA 4M9ZA 5K5OA 3BOQA 4IPAA 1PP7U 1PP8F 1BI1A 3I53A 4HLXA 3BPXA 3T1BA 1TQMA 4ZH4F 1MGTA 4OINF 5FFZA 3R4KA 4TV7A 3PFIA 5HS9A 3L2CA 4LB5A 2OQGA 3QU3A 2D1HA 2W84A 5HS7A 3BJOA 2ACJA 5D5XB 2C6YA 2BE5F 2D2WA 4EGYA 2FMLA 2VBXA 2NRAC 3M1EA 2EB7A 1ZLJA 1HKSA 3H92A 2ZNYA 4HLYA 4A2UA 1OYYA 1O7LA 4A5MA 1FSEA 1S7AA 4WCGA 1FYLA 5DV5A 4EJWA 1FBSA 1YFHA 2O61A 2GXGA 2VOPA 3E97A 3M7GA 1FPQA 2QQBA 3M8FA 5JI6A 1D5VA 4CDGA 2BYVE 2PG4A 4G94A 4A0YA 2D1VA 3ZMSA 1YLFA 4EM0B 2HQRA 5J8CA 3ERED 4HOBA 1LDJA 5DD4A 1IXSB 2EA2A 4HQMA 2GA1A 3ABTA 3HOSA 3SZTA 3L7WA 3ZMVA 1WSUA 4IVNA 2V6CA 5EEHA 3V7SA 4AIHA 3GO5A 4HAMA 1YQAA 1RNLA 5CVUA 4LLGF 5DD8A 1XD7A 5D5UB 1KQ0A 4HQEA 5ILVA 2AXLA 3MWMA 3LWFA 3CUQB 1HQCA 4LB6B 4MEXF 3KP5A 1KGSA 3HYIA 4ZYGA 3TDUC 3WTUC 5FD6A 3D0SA 4IRIA 2G9WA 2JZYA 1IXRC 3KETA 4LFUA 2Q0OA 2VE9A 2IP2A 1G3YA 3HUGA 2YR2A 4L0YB 5EEGA 5F64A 1L3LA 2CWEA 3V7RA 3KE2A 3HIFA 2Z9OA 4Q5SF 3DP7A 3CTAA 4RB1A 2J5PA 3LAPA 2YPRA 4I09A 2QLZA 4MEYF 4HZFA 1O3SA 3O6BB 5ICFA 3WGGA 2BV6A 2OU2A 5BS6A 5BMZA 3GW2A 4RB2C 2HFHA 1D8KA 4GYIA 3WTXC 3EQLF 1IRFA 4I0BA 2GXBA 5HS8A 2L3DA 3KCCA 1WRJA 3OV8A 4I7HA 1CF7A 4PGGA 4A0ZA 4M9XA 2L01A 1SFXA 1R23A 4LMYA 5JVTA 1K78B 2H6CA 5CVJA 2FNPA 1YS6A 4UVBA 3HSEA 3W6KB 1R1TA 4CO8A 1IF1A 2WTEA 4LGWA 2ZCWA 5K5QA 2YSRA 1FBQA 3F8CA 3LFKA 2VE8A 2JTVA 4HDVA 5HVQC 4BNCA 3P9KA 5JR3A 1SMTA 2F2EA 5L3BA 3WE3A 1J5YA 2XROA 4U7BA 4AIJA 4O3MA 2HEOA 5LHIA 2ISZA 1K79A 2RN7A 4UV9A 2Y0MA 2QUFA 1SD7A 2Q2EA 4Y17A 3E6CC 2Z33A 1R36A 3CLOA 2HR3A 3HHGA 3KP3A 4HX7A 5LGTA 1GXPA 3ABUA 2P5LC 2STTA 2UXNA 3JSOA 2GWRA 1TW3A 1X3UA 1E17A 1TTYA 3L9FA 3WU0A 3IKTA 4OU0A 3QP6A 1YS7A 2FE3A 1T38A 2VBYA 3J7AO 1BC8C 5F6FA 3DKWA 3QOPA 3Q9SA 3FF5A 2PMHA 4EM1A 3WGIA 4EGZA 3GLXA 3TO9A 1HKTA 2DQRA 1J75A 3WTTC 1H0MA 3SZPA 4NHJA 1XMAA 1QGPA 2F5DA 4M6XA 4YFNF 4PDKA 1XGMA 4GO1A 3HTSB 1HBXG 1W4MA 1FT9A 5LEJA 1REPC 2LF8A 2FEZA 3GVAA 5E17F 2G7UA 3WODF 1U3EM 2GZWA 2FF4A 3K0LA 2RDPA 3SHFA 4A12A 4L18B 4WXHA 3DPTA 2DPUA 2LKPA 3I58A 3P7NA 1YO5C 5D5VB 2VOOA 1GHCA 1YG2A 5CLSA 4G9YA 4S04A 2DK5A 3J80Z 3PQJA 4MTDA 3T5XA 2BGCA 4NQWA 1BI0A 3SXYA 1R58A 5D8KB 2STWA 1D3YA 1USTA 5CVIA 4JK1X 4P55A 3IRRA 1IAWA 1BN5A 3K2ZA 4WXDA 1FOKA 4RS8A 2DW4A 2M8EA 3QPTA 2DFIA 2MC3A 4BYYA 1FLIA 2WWYA 3WTVC 4BH9A 1ULYA 2IRFG 1YYVA 2JSCA 1W5SA 2IPQX 2XAJA 3K9TA 3QAHA 2DPDA 2LSOA 3IHUA 1V4RA 2IW5A 5LRSA 2QWWA 4ENMA 2QQ9A 4OIOF 4L5JA 3HRSA 2O03A 3EYIA 4HDUA 2PFBA 5DEQA 5ERIA 2HTSA 1XSDA 2MH2A 1G3TA 1FWZA 2DO7A 2NS0A 3KP4A 2ZO4A 4KUMA 5E1XA 5L3DA 1XSVA 3MEXA 3GYHX 3J81K 4EM2A 3D5LA 1QBJA 1MDMA 1FBUA 2P8TA 1XMKA 4KN7X 1R5HA 3CDHA 2E7WA 2DTRA 3HOTA 5FD5A 2M87A 2FQ3A 2MBFA 2EV5A 4YG2F 2V9VA 2XAQA 2XVCA 3B02A 2NYXA 4UXNA 3IWZA 4BXUA 3RYPA 4K2EA 2W25A 2DI3A 3WGHA 2IT0A 2PN6A 1U2WA 1KYWA 3FXUA 1T39A 2HDCA 1CF7B 1O7FA 1EV7A 3BWGA 5FLXZ 3VEPA 4ESJA 1UFMA 2Z3YA 4Y15A 2W85A 1YW8A 3ECHA 4RAYA 4LK0F 4XRFA 2HTJA 3O2PE 4MQ9F 5AONA 3KEOA 1F1ZA 2A6EF 4ZZDA 2DLLA 3P9CA 4B09A 2OBPA 3TOBA 3ZN1A 3HTUA 4DQ2A 3E6BA 5IT9K 3ZMUA 3WTYC 2GQQA 3KP2A 3WE2A 3HRMA 4LLNA 3QPHA 3F8NA 2L4AA 1S6LA 4HW0A 5CJ9A 3R0JA 4ETSA 5HLGA 3TGNA 3BJ6A 3VFZA 3I54A 3RIRA 4BHPA 2P4WA 1OMIA 2RC4A 2KRFA 5D6FA 3RI4A 4A6DA 3FMRA 5J6XA 1T0FA 1DUXC 3CJNA 2H94A 5E1WA 3BP8A 5BPIA 2G7HA 3DFGA 1KA8A 1P6RA 3U9GA 3N4MA 2YX7A 4FX4A 5ILUA 5IT3A 4OMZA 4O5VA 2QQAA 3V8KA 1BIAA 1G3SA 2JPBA 2B0LA 1WKMA 1EH7A 3F72A 5BPDA 1SAXA 5L3EA 2YX4A 2A07F 4L9JA 2EFWA 2MD5A 1ZHFA 3U1DA 2COMA 1I1GA 3E6MA 4XLPF 3SFZA 3F6VA 3PQKA 3KP6A 3I71A 4I0AA 1I1SA 2UXXA 3RKWA 3RPQA 3TKYA 1SFEA 4RGUA 1USSA 3GF2A 4GCVA 3JTHA 3P9IA 1O57A 4DNCA 1B9MA 1K7AA 1U78A 1IN6A 4P96A 1FSHA 2QZ8A 1KYZA 4R1HA 5HDGA 2IA2A 1W5TA 3FMQA 1HSJA 1ZG5A 1G4DA 2XKPA 3MQ0A 5TJJA 4NB5A 5D4SA 4EQQA 3HHHA 2XHKA 2WC2A 3I0TA 3FZVA 4IJAA 1I6XA 1Y0UA 3V8JA 4G7OF 3DF8A 2FU4A 5TRDA 1J2XA 2E7XA 1BI2A 4RB0A 3HRTA 3ISPA 3T0YA 1TQIA 5JHUA 2F5EA 4OIRF 1S7OA 3DV8A 3GZ6A 1ODDA 2UZKA 4U88A 1MJ9A 2ZNZA 4Y13A 3LA3A 5LBQA 1RUOA 1S3JA 1H9GA 3SQNA 1ZRDA 2EFNA 1C0WA 4GGGA 2RKHA 4RAZA 4HV6A 4ZZLA 5DCMA 3F6OA 4KICA 1MD0A 2NNNA 3GFJA 4MQVA 2H09A 2XGXA 4U0WA 2L54A 4KIBA 1BC7C 4G8XA 3C1DA 4QWQA 1HW2A 4UUVA 3MZHA 2Z99A 3OOPA 1TNTA 2EFPA 1LB2A 3FM5A 3E5UA 3KLNA 4E70A 2IJLA 2DT5A 3EETA 1OYWA 1MDMB 2P6TA 2HQNA 6PAXA 1ZGJA 1PDNC 4CGZA 4KIFA 4IHSA 3TQNA 2EFOA 1UHMA 1HKQA 2HWVA 1SFUA 5ED4A 2D45A 2FMYA 2Z5UA 2FXAA 1P4AA 3ZPLA 4XBFA 1SD6A 3LQQA 4HX8A 1WQ2A 2OAZA 2VBZA 3AAFA 2JRTA 2CFXA 1P2FA 2M45A 4HV5A 4IRGA 1STZA 3U2RA 3E5XA 2K4JA 4BHBA 2NAZA 2CG4A 5HDNA 4LG0A 1I27A 3HRUA 1TBXA 3F8BA 5K1YA 4YIFA 1KQ9A 2EWNA 2L4MA 4BHCA 3R0AA 2QYOA 3GEZA 4ENNA 4KNYA 3GUDA 2XV4S 1LNWA 2OA4A 2M1BA 1KU7A 3EDPA 1LVAA 2FBKA 4S05A 5LHHA 5AIQA 1OYIA 2O3FA 1FZPB 4I98B 4KYWA 4EVIA 3RPUA 4U0VA 2LF7A 4L9NA 3TOAA 1S29A 1ZREA 4O6JA 5D4RA 4RGXA 1W7PA 2ZMEA 1ZG3A 2IVMA 4Q48A 3GXOA 4P9UA 4CHUA 2KIUA 1FY7A 2HYFA 1UHWA 5DCFA 2CQKA 2A6HF 4CXFA 1R22A 1UCRA 1HW1A 3BROA 4P5OA 1GVJA 4U0YA 1J7KA 2CW0F 3H3ZA 2ISYA 4ZYEA 1QQIA 3E5QA 2KJCA 2MLKA 2HS5A 3WG9A 1JE8A 4KT5C 3K1PA 4AD9A 2Q8KA 5D6EA 1T98A 4I01A 2V79A 1ON1A 2OD5A 3WTSC 3ZMTA 1Z6RA 3REOA 2ETHA 2F5FA 2P6SA 5CVVA 1XB4A 3ZN0A 3MFKA 4Q47A 5FGMA 1F4KA 3JAMK 4IHTA 2J5OA 3NEUA 1YW9A 1OKRA 2KKOA 3I59A 2MH9A 5H6QA 1QZYA 1MZBA 4L9TA 4WF2A 1T2KA 3T8TA 1RIOH 2CYYA 4AIKA 2V1UA 4Q4ZF 4ON0A 4A5NA 1JHHA 1HSTA 1IZ1A 4HA8A 5HLIA 1K6OA 2VT3A 3BDDA 2ZKZA 3C3WA 2XAHA 5A2QK 3MAJA 1SMYF 2CSOA 5E18F 2E1NA 3ZMDA 3JAMZ 1DDNA 3NQOA 1L0OC 1XGNA 1Z9CA 2K4BA 5E20A 3ECOA 2V1XA 2ELHA 1T6SA 1ZGAA 2OZ6A 5KVRA 2EV6A 5AIPA 4U7DA 4AVPA 3LA7A 1QO0D 4EJOA 1IW7F 3VODA 3J81Z 4P9FA 2VODA 1R5GA 4N9HA 4OIPF 1G3WA 2O8XA 2WV0A 3R60A 3B73A 3IWFA 1XN7A 1AWCA 2P5VA 2BEOA 2K86A 5A2QZ 2DK8A 1U6GA 5ILSA 1BBYA 5KK1A 1B6AA 2A5YB 1FC3A 5L3CA 1XDUA 1B9NA 2FA5A 1XSXA 3RJPA 1ZLKA 3NRVA 1OR7A 3IKVA 3QU6A 4N0BA 2MA3A 2HZTA 1YW7A 1XDSA 5DUKA 4ESBA 1ZG1A 1XCBA 2GIVA 4YIIA 1XGSA 5E8GA 5ICCA 2XUBA 5DDGA 2FRHA 1RZ4A 2RGVA 2ESNA 4M6YA 1BI3A 4CYDA 4G6DA 4I2OA 3RKXA 5HLHA 3JW4A 4A6EA 2PLYA 3BPVA 1W7PD 3RYRA 1S8NA 1O3RA 3G3ZA 5IT9Z 2RNJA 3M8EA 1Z05A 3T8RA 3TDZC 4LG0B 1TW2A 1Z6TA 1PUEE 2RQPA 3LQRA 2QBYA 1J9IA 3CO7C 2MLGA 2PJPA 3COAC 4IF4A 3V7CA 4MGRA 4HX4A 4LLLA 2M5WA 1DP7P 1KU9A 1I5ZA 3I5UA 3CO6C 5CYVA 2F5CA 2PI0A 1ZAOA 3ROUA 3F21A 1MKMA 3ZMZA 2H6BA 1P92A 3QRFF 1JXSA 2DBBA 1IN5A 4WX9A 4MHGA 1RI7A 2H27A 5LHGA 4OIQF 4IXAA 1ZRCA 4EMSA 4M71A 1KU2A 1EH8A 3K1MA 3I64A 4EJTA 3KLOA 2LDUA 4PGHA 3ELKA 4N9IA 5H20A 1BIBA 2IA1A 4JBAA 3FXQA 4RGSA 1J0RA 3IRQA 4GXOA 2K02A 1W7PB 1EH6A 2ZMEB 3TO7A 5LEKA 4OOIA 1BM9A 4CICA 5LLQA 2DQLA 1G6NA 1U5TC 4FX0A 3K69A 4H0EA 1ON2A 3LA2A 4LJZF 3GX4X 4EV0A 3ZQ7A 3VB2A 1Z91A 2CO5A 2L02A 2VONA 2X4HA 3KZYA 4RB3C 2ADUA 2KIFA 2JPCA 4XSZF 4R8HA 1LJ9A 4F7ZA 3F23A 2GA2A 3KZZA 2VC0A 1OPCA 3V4GA 3LSTA 1LDKB 3K1NA 4KIGA 1O3TA 3GFIA 4Z2YA 3W6JB 3F22A 5FO5A 1O3QA 4A0XA 3R61A 3WTZA 4BQAA 1ZH5A 3DQVC 1NHAA 3GZ5A 1U5TA 4ESFA 2ZBKA 4ASNA 3MCZA 4ENJA 2FOKA 3I59B 4QLCU 4KMUX 1AOYA 5DUIA 3N97A 1BJAA 5DYMA 1ONVA 1R7JA 2EK5A 3KP7A 1FYMA 2EA4A 2RV8A 4JQFA 2R7DA 4UVAA 1FP2A 3MZYA 1CGPA 2W24A 1UB9A 4PZJA 1LEBA 4XLNF 4EJVA 2ZFWA 4XSXF 1KQ8A 4M9SA 4OMYA 2A68F 1LQ1A 3BJAA 5E8IA 2PQ8A 2KIMA 4LK1F 5LGUA 3EUHA 5HOOA 1F9NA 4KFCA 2VT2A 2VXZA 2VC1A 2K7LA 3FM3A 5FB2A 2GAUA 4FHTA 3F3XA 1TNSA 4ENKA 5LRRA 3G73A 2A61A 1B4AA 3M9AA 2R7FA 3CUQC 5BQTA 2M30A 1R1UA 3E6DA 1IN7A 4PCQA 1SD5A 4HF0A 3TO6A 1IRGA 1QNTA 2OZUA 4G7HF 2HKOA 4L9VA 4D0PA 3GFLA 2A3SA 2PEXA 5E1ZB 4FT8A 1ZRFA 1Q1HA 1YIOA 3O3KA 4M73A 1QZZA 5F1RA 3DXJF 1A04A 1HXDA 3Q5FA 1XCVA 2R3SA 2IA0A 1IXCA 1MJBA 3WU1B 4UV8A 1QPMA 1JGSA 1FP1D 3F8FA 1YTYA 2EFQA 2P5KA 4AWXB 3GFMA 3E3VA 2UWMA 4WWCA 2O0YA 3EYYA 1KU3A 4M74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJR A;  3J80 K;  4I02 A;  4UVC A;  2TDX A;  4MTE A;  4BAY A;  4LD5 A;  1FNN A;  4EJU A;  1BOA A;  1U8R A;  1DPU A;  4GYG A;  3FHZ A;  1RUN A;  4RGR A;  2HKX A;  4WXC A;  1V3F A;  1LEA A;  4M72 A;  3CUQ A;  3H3U A;  4KMF A;  3DPL C;  1LDD A;  3FXR A;  3QP5 A;  1Z7U A;  2XKO A;  4HF2 A;  2XIG A;  4MNU A;  1IN4 A;  2YU3 A;  2XAS A;  2NNY A;  1IN8 A;  3LAJ A;  2LNB A;  1MJA A;  3KFW X;  3S2W A;  2VBW A;  5K5R A;  2K27 A;  2QBY B;  3FMS A;  2XAG A;  3JSP A;  2AS5 F;  1R1V A;  5H6R A;  1ZYR F;  2ZXJ A;  1P4X A;  2O6G E;  4B8X A;  2P7V B;  2V1D A;  1F5T A;  5D5W B;  4L0Z B;  1R00 A;  5BOX A;  4IRH A;  3CUO A;  1B59 A;  2QEN A;  4G7Z F;  2XRN A;  5D8L B;  5L3F A;  1Z1D A;  2P7C B;  3ULQ B;  3RKY A;  5J8F A;  1SD4 A;  2JT1 A;  1P4W A;  2BBY A;  2Y75 A;  4UHT A;  5ICE A;  2DU9 A;  1WI9 A;  4ZYH A;  2EV0 A;  1K78 A;  3JTG A;  3DEU A;  2PBI A;  1FYK A;  1IUY A;  5LGN A;  5ICG A;  2ESH A;  1H9T A;  3L09 A;  4UNO A;  4WK8 F;  1HW5 A;  4CZZ A;  2HOE A;  3HSF A;  3F8M A;  1GXQ A;  3HSR A;  3BY6 A;  3ML6 A;  2VN2 A;  4KA4 A;  3IC7 A;  3GWZ A;  2CGP A;  2FBI A;  4HBL A;  2FNA A;  2QVO A;  3VOE A;  1WWX A;  4KDP A;  2Y48 A;  2ZJ2 A;  1FX7 A;  2QM3 A;  2HYG D;  3IL2 A;  3ZP5 A;  1TQP A;  5FLX K;  1B1B A;  1VTN C;  1ZAR A;  1D8J A;  1DPR A;  3I4P A;  1ZN2 A;  3C18 A;  3V8L A;  2W57 A;  3RDI A;  4YFX F;  1TLH B;  1J59 A;  3FX3 A;  4HF1 A;  2RVC A;  3KEQ A;  3Q9V A;  1XGO A;  2KJB A;  4G6Q A;  2X0L A;  4KN4 X;  3C7J A;  3RTR A;  2FBH A;  4YFK F;  5JFR A;  3FWE A;  3L00 A;  5DCM B;  3WTW C;  5HDK A;  4L5I A;  1U5T B;  2XAF A;  4HYE A;  1E2X A;  2E1C A;  2HGC A;  2OQR A;  4R79 A;  4ZYD A;  3BZ6 A;  5CVR A;  5FFX A;  2A69 F;  2DAO A;  1JHF A;  5L3G A;  2FSW A;  2PMU A;  3R6S A;  4M9Z A;  5K5O A;  3BOQ A;  4IPA A;  1PP7 U;  1PP8 F;  1BI1 A;  3I53 A;  4HLX A;  3BPX A;  3T1B A;  1TQM A;  4ZH4 F;  1MGT A;  4OIN F;  5FFZ A;  3R4K A;  4TV7 A;  3PFI A;  5HS9 A;  3L2C A;  4LB5 A;  2OQG A;  3QU3 A;  2D1H A;  2W84 A;  5HS7 A;  3BJO A;  2ACJ A;  5D5X B;  2C6Y A;  2BE5 F;  2D2W A;  4EGY A;  2FML A;  2VBX A;  2NRA C;  3M1E A;  2EB7 A;  1ZLJ A;  1HKS A;  3H92 A;  2ZNY A;  4HLY A;  4A2U A;  1OYY A;  1O7L A;  4A5M A;  1FSE A;  1S7A A;  4WCG A;  1FYL A;  5DV5 A;  4EJW A;  1FBS A;  1YFH A;  2O61 A;  2GXG A;  2VOP A;  3E97 A;  3M7G A;  1FPQ A;  2QQB A;  3M8F A;  5JI6 A;  1D5V A;  4CDG A;  2BYV E;  2PG4 A;  4G94 A;  4A0Y A;  2D1V A;  3ZMS A;  1YLF A;  4EM0 B;  2HQR A;  5J8C A;  3ERE D;  4HOB A;  1LDJ A;  5DD4 A;  1IXS B;  2EA2 A;  4HQM A;  2GA1 A;  3ABT A;  3HOS A;  3SZT A;  3L7W A;  3ZMV A;  1WSU A;  4IVN A;  2V6C A;  5EEH A;  3V7S A;  4AIH A;  3GO5 A;  4HAM A;  1YQA A;  1RNL A;  5CVU A;  4LLG F;  5DD8 A;  1XD7 A;  5D5U B;  1KQ0 A;  4HQE A;  5ILV A;  2AXL A;  3MWM A;  3LWF A;  3CUQ B;  1HQC A;  4LB6 B;  4MEX F;  3KP5 A;  1KGS A;  3HYI A;  4ZYG A;  3TDU C;  3WTU C;  5FD6 A;  3D0S A;  4IRI A;  2G9W A;  2JZY A;  1IXR C;  3KET A;  4LFU A;  2Q0O A;  2VE9 A;  2IP2 A;  1G3Y A;  3HUG A;  2YR2 A;  4L0Y B;  5EEG A;  5F64 A;  1L3L A;  2CWE A;  3V7R A;  3KE2 A;  3HIF A;  2Z9O A;  4Q5S F;  3DP7 A;  3CTA A;  4RB1 A;  2J5P A;  3LAP A;  2YPR A;  4I09 A;  2QLZ A;  4MEY F;  4HZF A;  1O3S A;  3O6B B;  5ICF A;  3WGG A;  2BV6 A;  2OU2 A;  5BS6 A;  5BMZ A;  3GW2 A;  4RB2 C;  2HFH A;  1D8K A;  4GYI A;  3WTX C;  3EQL F;  1IRF A;  4I0B A;  2GXB A;  5HS8 A;  2L3D A;  3KCC A;  1WRJ A;  3OV8 A;  4I7H A;  1CF7 A;  4PGG A;  4A0Z A;  4M9X A;  2L01 A;  1SFX A;  1R23 A;  4LMY A;  5JVT A;  1K78 B;  2H6C A;  5CVJ A;  2FNP A;  1YS6 A;  4UVB A;  3HSE A;  3W6K B;  1R1T A;  4CO8 A;  1IF1 A;  2WTE A;  4LGW A;  2ZCW A;  5K5Q A;  2YSR A;  1FBQ A;  3F8C A;  3LFK A;  2VE8 A;  2JTV A;  4HDV A;  5HVQ C;  4BNC A;  3P9K A;  5JR3 A;  1SMT A;  2F2E A;  5L3B A;  3WE3 A;  1J5Y A;  2XRO A;  4U7B A;  4AIJ A;  4O3M A;  2HEO A;  5LHI A;  2ISZ A;  1K79 A;  2RN7 A;  4UV9 A;  2Y0M A;  2QUF A;  1SD7 A;  2Q2E A;  4Y17 A;  3E6C C;  2Z33 A;  1R36 A;  3CLO A;  2HR3 A;  3HHG A;  3KP3 A;  4HX7 A;  5LGT A;  1GXP A;  3ABU A;  2P5L C;  2STT A;  2UXN A;  3JSO A;  2GWR A;  1TW3 A;  1X3U A;  1E17 A;  1TTY A;  3L9F A;  3WU0 A;  3IKT A;  4OU0 A;  3QP6 A;  1YS7 A;  2FE3 A;  1T38 A;  2VBY A;  3J7A O;  1BC8 C;  5F6F A;  3DKW A;  3QOP A;  3Q9S A;  3FF5 A;  2PMH A;  4EM1 A;  3WGI A;  4EGZ A;  3GLX A;  3TO9 A;  1HKT A;  2DQR A;  1J75 A;  3WTT C;  1H0M A;  3SZP A;  4NHJ A;  1XMA A;  1QGP A;  2F5D A;  4M6X A;  4YFN F;  4PDK A;  1XGM A;  4GO1 A;  3HTS B;  1HBX G;  1W4M A;  1FT9 A;  5LEJ A;  1REP C;  2LF8 A;  2FEZ A;  3GVA A;  5E17 F;  2G7U A;  3WOD F;  1U3E M;  2GZW A;  2FF4 A;  3K0L A;  2RDP A;  3SHF A;  4A12 A;  4L18 B;  4WXH A;  3DPT A;  2DPU A;  2LKP A;  3I58 A;  3P7N A;  1YO5 C;  5D5V B;  2VOO A;  1GHC A;  1YG2 A;  5CLS A;  4G9Y A;  4S04 A;  2DK5 A;  3J80 Z;  3PQJ A;  4MTD A;  3T5X A;  2BGC A;  4NQW A;  1BI0 A;  3SXY A;  1R58 A;  5D8K B;  2STW A;  1D3Y A;  1UST A;  5CVI A;  4JK1 X;  4P55 A;  3IRR A;  1IAW A;  1BN5 A;  3K2Z A;  4WXD A;  1FOK A;  4RS8 A;  2DW4 A;  2M8E A;  3QPT A;  2DFI A;  2MC3 A;  4BYY A;  1FLI A;  2WWY A;  3WTV C;  4BH9 A;  1ULY A;  2IRF G;  1YYV A;  2JSC A;  1W5S A;  2IPQ X;  2XAJ A;  3K9T A;  3QAH A;  2DPD A;  2LSO A;  3IHU A;  1V4R A;  2IW5 A;  5LRS A;  2QWW A;  4ENM A;  2QQ9 A;  4OIO F;  4L5J A;  3HRS A;  2O03 A;  3EYI A;  4HDU A;  2PFB A;  5DEQ A;  5ERI A;  2HTS A;  1XSD A;  2MH2 A;  1G3T A;  1FWZ A;  2DO7 A;  2NS0 A;  3KP4 A;  2ZO4 A;  4KUM A;  5E1X A;  5L3D A;  1XSV A;  3MEX A;  3GYH X;  3J81 K;  4EM2 A;  3D5L A;  1QBJ A;  1MDM A;  1FBU A;  2P8T A;  1XMK A;  4KN7 X;  1R5H A;  3CDH A;  2E7W A;  2DTR A;  3HOT A;  5FD5 A;  2M87 A;  2FQ3 A;  2MBF A;  2EV5 A;  4YG2 F;  2V9V A;  2XAQ A;  2XVC A;  3B02 A;  2NYX A;  4UXN A;  3IWZ A;  4BXU A;  3RYP A;  4K2E A;  2W25 A;  2DI3 A;  3WGH A;  2IT0 A;  2PN6 A;  1U2W A;  1KYW A;  3FXU A;  1T39 A;  2HDC A;  1CF7 B;  1O7F A;  1EV7 A;  3BWG A;  5FLX Z;  3VEP A;  4ESJ A;  1UFM A;  2Z3Y A;  4Y15 A;  2W85 A;  1YW8 A;  3ECH A;  4RAY A;  4LK0 F;  4XRF A;  2HTJ A;  3O2P E;  4MQ9 F;  5AON A;  3KEO A;  1F1Z A;  2A6E F;  4ZZD A;  2DLL A;  3P9C A;  4B09 A;  2OBP A;  3TOB A;  3ZN1 A;  3HTU A;  4DQ2 A;  3E6B A;  5IT9 K;  3ZMU A;  3WTY C;  2GQQ A;  3KP2 A;  3WE2 A;  3HRM A;  4LLN A;  3QPH A;  3F8N A;  2L4A A;  1S6L A;  4HW0 A;  5CJ9 A;  3R0J A;  4ETS A;  5HLG A;  3TGN A;  3BJ6 A;  3VFZ A;  3I54 A;  3RIR A;  4BHP A;  2P4W A;  1OMI A;  2RC4 A;  2KRF A;  5D6F A;  3RI4 A;  4A6D A;  3FMR A;  5J6X A;  1T0F A;  1DUX C;  3CJN A;  2H94 A;  5E1W A;  3BP8 A;  5BPI A;  2G7H A;  3DFG A;  1KA8 A;  1P6R A;  3U9G A;  3N4M A;  2YX7 A;  4FX4 A;  5ILU A;  5IT3 A;  4OMZ A;  4O5V A;  2QQA A;  3V8K A;  1BIA A;  1G3S A;  2JPB A;  2B0L A;  1WKM A;  1EH7 A;  3F72 A;  5BPD A;  1SAX A;  5L3E A;  2YX4 A;  2A07 F;  4L9J A;  2EFW A;  2MD5 A;  1ZHF A;  3U1D A;  2COM A;  1I1G A;  3E6M A;  4XLP F;  3SFZ A;  3F6V A;  3PQK A;  3KP6 A;  3I71 A;  4I0A A;  1I1S A;  2UXX A;  3RKW A;  3RPQ A;  3TKY A;  1SFE A;  4RGU A;  1USS A;  3GF2 A;  4GCV A;  3JTH A;  3P9I A;  1O57 A;  4DNC A;  1B9M A;  1K7A A;  1U78 A;  1IN6 A;  4P96 A;  1FSH A;  2QZ8 A;  1KYZ A;  4R1H A;  5HDG A;  2IA2 A;  1W5T A;  3FMQ A;  1HSJ A;  1ZG5 A;  1G4D A;  2XKP A;  3MQ0 A;  5TJJ A;  4NB5 A;  5D4S A;  4EQQ A;  3HHH A;  2XHK A;  2WC2 A;  3I0T A;  3FZV A;  4IJA A;  1I6X A;  1Y0U A;  3V8J A;  4G7O F;  3DF8 A;  2FU4 A;  5TRD A;  1J2X A;  2E7X A;  1BI2 A;  4RB0 A;  3HRT A;  3ISP A;  3T0Y A;  1TQI A;  5JHU A;  2F5E A;  4OIR F;  1S7O A;  3DV8 A;  3GZ6 A;  1ODD A;  2UZK A;  4U88 A;  1MJ9 A;  2ZNZ A;  4Y13 A;  3LA3 A;  5LBQ A;  1RUO A;  1S3J A;  1H9G A;  3SQN A;  1ZRD A;  2EFN A;  1C0W A;  4GGG A;  2RKH A;  4RAZ A;  4HV6 A;  4ZZL A;  5DCM A;  3F6O A;  4KIC A;  1MD0 A;  2NNN A;  3GFJ A;  4MQV A;  2H09 A;  2XGX A;  4U0W A;  2L54 A;  4KIB A;  1BC7 C;  4G8X A;  3C1D A;  4QWQ A;  1HW2 A;  4UUV A;  3MZH A;  2Z99 A;  3OOP A;  1TNT A;  2EFP A;  1LB2 A;  3FM5 A;  3E5U A;  3KLN A;  4E70 A;  2IJL A;  2DT5 A;  3EET A;  1OYW A;  1MDM B;  2P6T A;  2HQN A;  6PAX A;  1ZGJ A;  1PDN C;  4CGZ A;  4KIF A;  4IHS A;  3TQN A;  2EFO A;  1UHM A;  1HKQ A;  2HWV A;  1SFU A;  5ED4 A;  2D45 A;  2FMY A;  2Z5U A;  2FXA A;  1P4A A;  3ZPL A;  4XBF A;  1SD6 A;  3LQQ A;  4HX8 A;  1WQ2 A;  2OAZ A;  2VBZ A;  3AAF A;  2JRT A;  2CFX A;  1P2F A;  2M45 A;  4HV5 A;  4IRG A;  1STZ A;  3U2R A;  3E5X A;  2K4J A;  4BHB A;  2NAZ A;  2CG4 A;  5HDN A;  4LG0 A;  1I27 A;  3HRU A;  1TBX A;  3F8B A;  5K1Y A;  4YIF A;  1KQ9 A;  2EWN A;  2L4M A;  4BHC A;  3R0A A;  2QYO A;  3GEZ A;  4ENN A;  4KNY A;  3GUD A;  2XV4 S;  1LNW A;  2OA4 A;  2M1B A;  1KU7 A;  3EDP A;  1LVA A;  2FBK A;  4S05 A;  5LHH A;  5AIQ A;  1OYI A;  2O3F A;  1FZP B;  4I98 B;  4KYW A;  4EVI A;  3RPU A;  4U0V A;  2LF7 A;  4L9N A;  3TOA A;  1S29 A;  1ZRE A;  4O6J A;  5D4R A;  4RGX A;  1W7P A;  2ZME A;  1ZG3 A;  2IVM A;  4Q48 A;  3GXO A;  4P9U A;  4CHU A;  2KIU A;  1FY7 A;  2HYF A;  1UHW A;  5DCF A;  2CQK A;  2A6H F;  4CXF A;  1R22 A;  1UCR A;  1HW1 A;  3BRO A;  4P5O A;  1GVJ A;  4U0Y A;  1J7K A;  2CW0 F;  3H3Z A;  2ISY A;  4ZYE A;  1QQI A;  3E5Q A;  2KJC A;  2MLK A;  2HS5 A;  3WG9 A;  1JE8 A;  4KT5 C;  3K1P A;  4AD9 A;  2Q8K A;  5D6E A;  1T98 A;  4I01 A;  2V79 A;  1ON1 A;  2OD5 A;  3WTS C;  3ZMT A;  1Z6R A;  3REO A;  2ETH A;  2F5F A;  2P6S A;  5CVV A;  1XB4 A;  3ZN0 A;  3MFK A;  4Q47 A;  5FGM A;  1F4K A;  3JAM K;  4IHT A;  2J5O A;  3NEU A;  1YW9 A;  1OKR A;  2KKO A;  3I59 A;  2MH9 A;  5H6Q A;  1QZY A;  1MZB A;  4L9T A;  4WF2 A;  1T2K A;  3T8T A;  1RIO H;  2CYY A;  4AIK A;  2V1U A;  4Q4Z F;  4ON0 A;  4A5N A;  1JHH A;  1HST A;  1IZ1 A;  4HA8 A;  5HLI A;  1K6O A;  2VT3 A;  3BDD A;  2ZKZ A;  3C3W A;  2XAH A;  5A2Q K;  3MAJ A;  1SMY F;  2CSO A;  5E18 F;  2E1N A;  3ZMD A;  3JAM Z;  1DDN A;  3NQO A;  1L0O C;  1XGN A;  1Z9C A;  2K4B A;  5E20 A;  3ECO A;  2V1X A;  2ELH A;  1T6S A;  1ZGA A;  2OZ6 A;  5KVR A;  2EV6 A;  5AIP A;  4U7D A;  4AVP A;  3LA7 A;  1QO0 D;  4EJO A;  1IW7 F;  3VOD A;  3J81 Z;  4P9F A;  2VOD A;  1R5G A;  4N9H A;  4OIP F;  1G3W A;  2O8X A;  2WV0 A;  3R60 A;  3B73 A;  3IWF A;  1XN7 A;  1AWC A;  2P5V A;  2BEO A;  2K86 A;  5A2Q Z;  2DK8 A;  1U6G A;  5ILS A;  1BBY A;  5KK1 A;  1B6A A;  2A5Y B;  1FC3 A;  5L3C A;  1XDU A;  1B9N A;  2FA5 A;  1XSX A;  3RJP A;  1ZLK A;  3NRV A;  1OR7 A;  3IKV A;  3QU6 A;  4N0B A;  2MA3 A;  2HZT A;  1YW7 A;  1XDS A;  5DUK A;  4ESB A;  1ZG1 A;  1XCB A;  2GIV A;  4YII A;  1XGS A;  5E8G A;  5ICC A;  2XUB A;  5DDG A;  2FRH A;  1RZ4 A;  2RGV A;  2ESN A;  4M6Y A;  1BI3 A;  4CYD A;  4G6D A;  4I2O A;  3RKX A;  5HLH A;  3JW4 A;  4A6E A;  2PLY A;  3BPV A;  1W7P D;  3RYR A;  1S8N A;  1O3R A;  3G3Z A;  5IT9 Z;  2RNJ A;  3M8E A;  1Z05 A;  3T8R A;  3TDZ C;  4LG0 B;  1TW2 A;  1Z6T A;  1PUE E;  2RQP A;  3LQR A;  2QBY A;  1J9I A;  3CO7 C;  2MLG A;  2PJP A;  3COA C;  4IF4 A;  3V7C A;  4MGR A;  4HX4 A;  4LLL A;  2M5W A;  1DP7 P;  1KU9 A;  1I5Z A;  3I5U A;  3CO6 C;  5CYV A;  2F5C A;  2PI0 A;  1ZAO A;  3ROU A;  3F21 A;  1MKM A;  3ZMZ A;  2H6B A;  1P92 A;  3QRF F;  1JXS A;  2DBB A;  1IN5 A;  4WX9 A;  4MHG A;  1RI7 A;  2H27 A;  5LHG A;  4OIQ F;  4IXA A;  1ZRC A;  4EMS A;  4M71 A;  1KU2 A;  1EH8 A;  3K1M A;  3I64 A;  4EJT A;  3KLO A;  2LDU A;  4PGH A;  3ELK A;  4N9I A;  5H20 A;  1BIB A;  2IA1 A;  4JBA A;  3FXQ A;  4RGS A;  1J0R A;  3IRQ A;  4GXO A;  2K02 A;  1W7P B;  1EH6 A;  2ZME B;  3TO7 A;  5LEK A;  4OOI A;  1BM9 A;  4CIC A;  5LLQ A;  2DQL A;  1G6N A;  1U5T C;  4FX0 A;  3K69 A;  4H0E A;  1ON2 A;  3LA2 A;  4LJZ F;  3GX4 X;  4EV0 A;  3ZQ7 A;  3VB2 A;  1Z91 A;  2CO5 A;  2L02 A;  2VON A;  2X4H A;  3KZY A;  4RB3 C;  2ADU A;  2KIF A;  2JPC A;  4XSZ F;  4R8H A;  1LJ9 A;  4F7Z A;  3F23 A;  2GA2 A;  3KZZ A;  2VC0 A;  1OPC A;  3V4G A;  3LST A;  1LDK B;  3K1N A;  4KIG A;  1O3T A;  3GFI A;  4Z2Y A;  3W6J B;  3F22 A;  5FO5 A;  1O3Q A;  4A0X A;  3R61 A;  3WTZ A;  4BQA A;  1ZH5 A;  3DQV C;  1NHA A;  3GZ5 A;  1U5T A;  4ESF A;  2ZBK A;  4ASN A;  3MCZ A;  4ENJ A;  2FOK A;  3I59 B;  4QLC U;  4KMU X;  1AOY A;  5DUI A;  3N97 A;  1BJA A;  5DYM A;  1ONV A;  1R7J A;  2EK5 A;  3KP7 A;  1FYM A;  2EA4 A;  2RV8 A;  4JQF A;  2R7D A;  4UVA A;  1FP2 A;  3MZY A;  1CGP A;  2W24 A;  1UB9 A;  4PZJ A;  1LEB A;  4XLN F;  4EJV A;  2ZFW A;  4XSX F;  1KQ8 A;  4M9S A;  4OMY A;  2A68 F;  1LQ1 A;  3BJA A;  5E8I A;  2PQ8 A;  2KIM A;  4LK1 F;  5LGU A;  3EUH A;  5HOO A;  1F9N A;  4KFC A;  2VT2 A;  2VXZ A;  2VC1 A;  2K7L A;  3FM3 A;  5FB2 A;  2GAU A;  4FHT A;  3F3X A;  1TNS A;  4ENK A;  5LRR A;  3G73 A;  2A61 A;  1B4A A;  3M9A A;  2R7F A;  3CUQ C;  5BQT A;  2M30 A;  1R1U A;  3E6D A;  1IN7 A;  4PCQ A;  1SD5 A;  4HF0 A;  3TO6 A;  1IRG A;  1QNT A;  2OZU A;  4G7H F;  2HKO A;  4L9V A;  4D0P A;  3GFL A;  2A3S A;  2PEX A;  5E1Z B;  4FT8 A;  1ZRF A;  1Q1H A;  1YIO A;  3O3K A;  4M73 A;  1QZZ A;  5F1R A;  3DXJ F;  1A04 A;  1HXD A;  3Q5F A;  1XCV A;  2R3S A;  2IA0 A;  1IXC A;  1MJB A;  3WU1 B;  4UV8 A;  1QPM A;  1JGS A;  1FP1 D;  3F8F A;  1YTY A;  2EFQ A;  2P5K A;  4AWX B;  3GFM A;  3E3V A;  2UWM A;  4WWC A;  2O0Y A;  3EYY A;  1KU3 A;  4M74 A; 
#chains in the Genus database with same CATH topology
 2X6X A;  2EJR A;  3JRI A;  3J80 K;  4I02 A;  1I39 A;  4UVC A;  2TDX A;  4MTE A;  1WJE A;  1ZK8 A;  4BAY A;  1X4O A;  3ABM H;  2LBF A;  3SEQ A;  4LD5 A;  1R49 A;  3ERM A;  1FNN A;  4EJU A;  3HGG A;  1BOA A;  2XB0 X;  3HPH A;  1U8R A;  1DPU A;  4GYG A;  3FHZ A;  1RUN A;  4RGR A;  4E7H A;  2HKX A;  4HRI A;  4WXC A;  2KL4 A;  2DXI A;  1V3F A;  1LEA A;  3JRC A;  5KNL A;  4M72 A;  1GDT A;  3CUQ A;  3H3U A;  1OJL A;  4KMF A;  2B7E A;  1GVD A;  4CA0 A;  3DPL C;  1FOY A;  3BQZ A;  1LDD A;  3FXR A;  1X19 A;  3QP5 A;  5M5Y J;  4CCJ A;  1Z7U A;  2XKO A;  4HF2 A;  2WAQ A;  1FIA A;  2XIG A;  4MNU A;  1IN4 A;  3S1M J;  2AHQ A;  3I4M J;  2YU3 A;  1MH3 A;  2ZC2 A;  3L1P A;  2XAS A;  2NNY A;  1IN8 A;  3LAJ A;  2LNB A;  1YRN A;  1MJA A;  3KFW X;  3S2W A;  2VBW A;  4IQJ A;  1JTY A;  5K5R A;  1BOB A;  2K27 A;  2QBY B;  3FMS A;  2XAG A;  3JSP A;  3HL2 A;  2AS5 F;  1R1V A;  2DMN A;  2XF5 A;  5DM6 F;  5H6R A;  4J00 A;  1ZYR F;  2ZXJ A;  2E5Z A;  5M5X J;  5IYD J;  1IG7 A;  4IHW A;  4Y33 A;  1P4X A;  2VLA A;  4B8X A;  2O6G E;  2CH0 A;  2P7V B;  2V1D A;  3Q3S A;  2CFO A;  5EZH A;  1F5T A;  1Z77 A;  5D5W B;  4L0Z B;  1R00 A;  3S1R J;  5BOX A;  1MIJ A;  2R7R A;  4IRH A;  3DLL F;  1FOX A;  3G2B A;  3CUO A;  1B59 A;  2DMQ A;  3H0G J;  4XOT A;  3HEF A;  4EAT A;  2E36 A;  2M0C A;  4RAF A;  2QEN A;  3NAU A;  4G7Z F;  2KDO A;  2VJ4 A;  2ZB9 A;  2XRN A;  4DW6 A;  4MLO A;  5D8L B;  5FKK A;  1Z1D A;  5L3F A;  2P7C B;  3MKZ A;  3ULQ B;  3RKY A;  5J8F A;  1SD4 A;  3ZCO A;  5KAI C;  2BHY A;  3VYS B;  3I55 I;  2JT1 A;  4II2 A;  2LY1 A;  1P4W A;  2BBY A;  1APL C;  2Y75 A;  4UHT A;  5ICE A;  2DU9 A;  1WI9 A;  4ZYH A;  2EV0 A;  1K78 A;  3JTG A;  4C2U A;  3DEU A;  5J1Y A;  2PBI A;  1P7I A;  1FYK A;  1WZ2 A;  2M0M A;  1IUY A;  4CH7 A;  5ICG A;  5LGN A;  4ZDO A;  2ESH A;  4JX4 A;  3L09 A;  1H9T A;  4UNO A;  4EEF G;  2JA8 J;  4WK8 F;  1HW5 A;  1YX5 A;  5K7F A;  5FRN A;  1G2H A;  2CUE A;  4CZZ A;  2HOE A;  2ZJR F;  3HSF A;  1X3W B;  3F8M A;  3KX2 A;  1AU7 A;  1GXQ A;  4G6T B;  3HSR A;  3BY6 A;  3ML6 A;  2VN2 A;  4KA4 A;  3IC7 A;  3GWZ A;  2ECC A;  1TWG J;  2R92 J;  1IGN A;  2VL8 A;  2CGP A;  1TWC J;  2FBI A;  4BJ5 C;  4J19 A;  4HBL A;  4CCK A;  3ZR8 X;  2FNA A;  2QVO A;  3VOE A;  4DOZ A;  1WWX A;  4KDP A;  3C2B A;  3PUB A;  2BHZ A;  2K3F A;  2Y48 A;  2ZJ2 A;  4N4N B;  1FX7 A;  2QM3 A;  5HOD A;  2HYG D;  3IL2 A;  2VUM J;  1U9O A;  3ZP5 A;  1TQP A;  1MSE C;  4P1W A;  3K70 D;  2CV2 A;  3TW6 A;  1B1B A;  5FLX K;  1VTN C;  1ZAR A;  1D8J A;  1DPR A;  3I4P A;  2W48 A;  2X48 A;  3RQI A;  4UUS A;  2EPF A;  1ZN2 A;  3C18 A;  3V8L A;  1IRZ A;  2W57 A;  3RDI A;  4YFX F;  1J59 A;  4BDY A;  2VI6 A;  4B47 A;  1OQY A;  3FX3 A;  1VQK I;  1DGR M;  4GFB A;  2L7F P;  4HF1 A;  2RVC A;  5F04 A;  3KEQ A;  3P5J A;  3Q9V A;  4G12 A;  1XGO A;  4KIT B;  4XLH A;  2KJB A;  4M3D A;  1AKH A;  3BZK A;  4G6Q A;  2X0L A;  4KN4 X;  3C7J A;  1POG A;  2COB A;  3BTJ A;  3RTR A;  2FBH A;  4YFK F;  3S3O A;  2IS6 A;  2VJ5 A;  5JFR A;  3LSP A;  2EH3 A;  3FWE A;  2QCO A;  3L00 A;  4IL6 C;  5DCM B;  3WTW C;  5HDK A;  2YUS A;  2HXO A;  1B8I A;  3KIO A;  3C2H A;  4L5I A;  1CQT A;  1U5T B;  2KFD A;  5J1U A;  3DEW A;  1ERD A;  2XAF A;  4HYE A;  1E2X A;  2E1C A;  5F0C A;  2HGC A;  4AVZ A;  1HF0 A;  2BXY A;  2OQR A;  4R79 A;  4ZYD A;  3IV5 A;  1YJ9 I;  3BZ6 A;  3LSH A;  5CVR A;  3BR5 A;  2OTL I;  5FFX A;  1WJF A;  2A69 F;  3LSK A;  2DAO A;  1JHF A;  5L3G A;  2FSW A;  2PMU A;  3M3Y J;  3MZ8 A;  3DBL B;  1VND A;  4PJJ A;  1A31 A;  3R6S A;  1BJZ A;  3GTL J;  4M9Z A;  5K5O A;  1D1B A;  1VQL I;  2DA4 A;  3BOQ A;  1W0T A;  2JMW A;  4IPA A;  1PP7 U;  3PSI A;  1IV6 A;  1PP8 F;  1JKR C;  1BI1 A;  3I53 A;  4HLX A;  3A01 A;  3BPX A;  3T1B A;  1JKQ C;  5LFA A;  2QSF X;  1TQM A;  4ZH4 F;  1MGT A;  1RR7 A;  3BG5 A;  4OIN F;  5FFZ A;  2OUM A;  2XAU A;  1MND A;  3AG1 H;  2CQQ A;  3R4K A;  3OYF A;  2RRE A;  4TV7 A;  3RPU D;  3PFI A;  5B5E C;  5HS9 A;  4KJZ A;  4OWR B;  1X1P A;  3L2C A;  4LB5 A;  2OQG A;  3QU3 A;  4XKV A;  2D1H A;  2W84 A;  5HS7 A;  3BJO A;  2DA5 A;  4LIU A;  1Y56 A;  2Y30 A;  2R7X A;  2ACJ A;  2FQ4 A;  5D5X B;  1W0U A;  2ID6 A;  2C6Y A;  2BE5 F;  1PJR A;  2D2W A;  4EGY A;  3DCF A;  3H3V K;  2LLK A;  2FML A;  2VBX A;  3BR2 A;  3M1E A;  1OCC H;  2NRA C;  5FLM J;  1MBK A;  2CV1 A;  2EB7 A;  1ZLJ A;  1HKS A;  3IH4 A;  3H92 A;  3TP3 A;  1RKT A;  2ZNY A;  4HLY A;  4A2U A;  1OYY A;  2XC7 A;  1O7L A;  2QSG X;  4A5M A;  2CQ7 A;  1FSE A;  1S7A A;  4WCG A;  1FYL A;  3J7Y J;  1I3Q J;  4DGW B;  2KMU A;  5DV5 A;  4EJW A;  1FBS A;  1YFH A;  2O61 A;  2GXG A;  2VOP A;  3E97 A;  3GTJ J;  3FHN A;  3M7G A;  1XG1 A;  1FPQ A;  3ZXS A;  1MMS A;  1NK2 P;  2QQB A;  3M8F A;  2NOG A;  5JI6 A;  1D5V A;  3OR2 C;  5IP6 A;  3LSJ A;  4CDG A;  2BYV E;  2PG4 A;  4G94 A;  1VQO I;  1EA3 A;  2IGK A;  4A0Y A;  3CCS I;  2HVR A;  3MKY B;  1QA6 A;  2D1V A;  1SFO J;  4IQ4 A;  3ZMS A;  2DJI A;  2DA6 A;  1YLF A;  4EM0 B;  1YOV B;  3DLA A;  2DT7 B;  2HQR A;  5J8C A;  3CDL A;  1DP3 A;  3ERE D;  4HOB A;  1LDJ A;  4KT6 A;  5DD4 A;  1R4N B;  3S16 J;  1IXS B;  4IOA F;  2EA2 A;  4HQM A;  3D5S C;  3B6A A;  2M4K A;  3BTC A;  3MN2 A;  3BR0 A;  5EGO A;  4FTH A;  2GA1 A;  3ABT A;  3HOS A;  3SZT A;  3DTI A;  3L7W A;  4MFE A;  2R7S A;  4XID A;  3CF2 A;  3ZMV A;  3JRG A;  1WSU A;  1D5Y A;  1OCT C;  4BEH A;  4IVN A;  4BAC A;  2V6C A;  5EEH A;  4MO7 A;  3V7S A;  4AIH A;  1JJ6 C;  1FTT A;  2G0E A;  2KRC A;  3GO5 A;  4RM3 A;  3F9K A;  4HAM A;  1YQA A;  4IX7 A;  2LBF B;  4ANJ A;  1RNL A;  5IYB J;  5CVU A;  2CS3 A;  1WHU A;  1Y39 A;  4YEL A;  3H5N A;  4MFD A;  2XSD C;  4LLG F;  5DD8 A;  1XD7 A;  2XPV A;  5D5U B;  1KQ0 A;  3QOD A;  4AU7 A;  5K7Z A;  4HQE A;  5ILV A;  2R7V A;  4E7I A;  2AXL A;  3G1M A;  3MWM A;  3LWF A;  3HKZ N;  4E4H A;  3CUQ B;  5HLT A;  1HQC A;  4LB6 B;  4M3F A;  2F48 A;  2HYJ A;  4MEX F;  2ZSH B;  1B72 A;  3KP5 A;  4B3X A;  1MBE A;  1KGS A;  3HYI A;  4RA2 A;  4ZYG A;  1ETQ A;  3TDU C;  1EKE A;  2FJ1 A;  2WB1 N;  3CCM I;  3WTU C;  5FD6 A;  5GPC A;  3CCU I;  2KDZ A;  3D0S A;  4IRI A;  2G9W A;  2JZY A;  4ZTF A;  3HOU J;  4IZZ A;  1IXR C;  4C3J J;  2L0K A;  4LFU A;  3KET A;  2Q0O A;  1WJC A;  2VE9 A;  3AL0 C;  2IP2 A;  1G3Y A;  2M3A A;  1YRN B;  2DOF A;  3HUG A;  3K4B A;  2YR2 A;  3PM1 A;  4L0Y B;  3W3C A;  1LUJ B;  5EEG A;  5F64 A;  1L3L A;  2JA7 J;  3H0D A;  2CWE A;  1E3P A;  4XNF A;  3L2U A;  3V7R A;  2ELJ A;  3KE2 A;  3HIF A;  4A3E J;  2Z9O A;  4Q5S F;  3DP7 A;  1XPX A;  3MD2 A;  3CTA A;  2X6W A;  1WJ5 A;  2J5P A;  4RB1 A;  3LAP A;  2YPR A;  1TWH J;  1YJN I;  5GAE J;  4I09 A;  3LFU A;  2W00 A;  2QLZ A;  4MEY F;  3JR9 A;  4HZF A;  1O3S A;  3O6B B;  2Y9Y A;  5ICF A;  1MBH A;  2BV6 A;  2OU2 A;  3WGG A;  5BS6 A;  5BMZ A;  1JKO C;  3DKY A;  3H5A A;  3GW2 A;  3OSF A;  1FEX A;  4RB2 C;  2HFH A;  4PFO A;  5DTD A;  3OIQ A;  3MVP A;  3KPH A;  1D8K A;  1BR1 A;  4GYI A;  3OYL A;  1P7J A;  3SDB A;  2A5W A;  4J01 A;  3WTX C;  3EQL F;  1TZL A;  4ZC3 A;  1FOW A;  4F55 A;  1IRF A;  2PX9 A;  3BC8 A;  2OCE A;  4XR6 A;  4I0B A;  2P0W A;  1U0J A;  2GXB A;  5HS8 A;  2L3D A;  3KCC A;  1WRJ A;  3OV8 A;  2O8K A;  4I7H A;  3PL8 A;  1CF7 A;  2MG4 A;  4PGG A;  2R5Y A;  1WPK A;  4A0Z A;  4M9X A;  4NC7 A;  2L01 A;  1SFX A;  3JRE A;  1R23 A;  3Q0V A;  4LMY A;  5JVT A;  2M7A A;  1K78 B;  2QKM B;  2H6C A;  5CVJ A;  4XMY A;  2FNP A;  1QVU A;  1YS6 A;  4UVB A;  4E7S A;  2P81 A;  3VYU B;  4BL0 B;  3OYB A;  4E7K A;  3HSE A;  3W6K B;  1R1T A;  4CO8 A;  4C2M J;  5GAG J;  1IF1 A;  3VWB A;  2WTE A;  2LG4 A;  4LGW A;  2ZCW A;  4M3E A;  2I5U A;  5K5Q A;  2HNH A;  3K4K A;  1ORK A;  2VQL A;  3GTO J;  2YSR A;  1FBQ A;  3F8C A;  4CZC A;  3LFK A;  1V5E A;  2VE8 A;  2JTV A;  1MMN A;  4HDV A;  3S32 A;  3N05 A;  5HVQ C;  4CYC A;  4BNC A;  3P9K A;  5JR3 A;  1SMT A;  4QSH A;  5DS9 A;  1T08 B;  2F2E A;  5L3B A;  4RLQ A;  3WE3 A;  3TBI A;  1J5Y A;  2XRO A;  4U7B A;  1Q1V A;  2XGC A;  2V9K A;  4AIJ A;  1K6Y A;  2QQ8 A;  4O3M A;  3H36 A;  2HEO A;  4DYC A;  3IAS 2;  4GDF A;  5LHI A;  4UUS B;  2ISZ A;  1K79 A;  2BY0 A;  2RN7 A;  4UV9 A;  2IBD A;  3BG3 A;  3CP8 A;  4NC6 A;  2Y0M A;  2EQR A;  3RZO J;  2QUF A;  1Y8Q B;  1SD7 A;  2Q2E A;  4Y17 A;  1NG7 A;  3E6C C;  2Z33 A;  1R36 A;  3CLO A;  4C30 A;  2HR3 A;  4V19 K;  4II3 A;  4PJL A;  1YI2 I;  1AKH B;  2JSP A;  4UB6 C;  3W6V A;  3GTG J;  3HHG A;  4AYB N;  1DU0 A;  3KP3 A;  4HX7 A;  3FXL A;  5LGT A;  1NH3 A;  3ABU A;  2P5L C;  1GXP A;  2STT A;  2UXN A;  3JSO A;  2GWR A;  1TW3 A;  3ABL H;  1X3U A;  5EG0 B;  1E17 A;  1TTY A;  2BW3 A;  1B8I B;  3S8P A;  3DTK A;  1MBF A;  4F91 B;  1SVL A;  3L9F A;  3WU0 A;  3HOX J;  1TP4 A;  3IKT A;  2YS9 A;  3A0B C;  4OU0 A;  3K4C A;  3OYJ A;  3QP6 A;  5CPR B;  1WH5 A;  1ZR4 A;  2L7M P;  1YS7 A;  2DYS H;  1Z3Y A;  2FE3 A;  2VBY A;  5GTI C;  1T38 A;  2HQA A;  3QWL A;  3J7A O;  1YE9 A;  2KT0 A;  2JN6 A;  4LG3 A;  3M1C A;  1BC8 C;  1D1A A;  4BY7 J;  1ZQ3 P;  5F6F A;  3DKW A;  3QOP A;  3Q9S A;  4I76 A;  3FF5 A;  1D0X A;  2XF7 A;  2PMH A;  2MW8 A;  4EM1 A;  3SYT A;  3WGI A;  4EGZ A;  3VSK A;  2RQQ A;  1IDY A;  2KZV A;  3GLX A;  3TO9 A;  1HKT A;  2DQR A;  4XIC A;  1H88 C;  1J75 A;  3WTT C;  1VQ7 I;  1H0M A;  3A01 B;  3SZP A;  4NHJ A;  1XMA A;  2DJN A;  1QGP A;  2F5D A;  3OS0 A;  4M6X A;  4YFN F;  4PDK A;  4XON A;  1XGM A;  2AQE A;  4GO1 A;  1YIJ I;  1HBX G;  3HTS B;  1W4M A;  1FT9 A;  2OV7 A;  1SVM A;  2EBI A;  1N25 A;  3W2V A;  5LEJ A;  5FJ8 J;  1REP C;  2LF8 A;  2FEZ A;  1KU3 A;  3A1Y A;  3GVA A;  3VDX A;  2DDA A;  5E17 F;  2HPI A;  2G7U A;  3J7A Y;  3WOD F;  2YU9 J;  1VQ8 I;  3CCJ I;  1U3E M;  2GZW A;  2FF4 A;  3FK6 A;  3K0L A;  2RDP A;  1ETO A;  1Z67 A;  4BQQ A;  3SHF A;  3OS1 A;  1ENH A;  2ZSI B;  4A12 A;  4L18 B;  4WXH A;  5FLV A;  3DPT A;  2EZI A;  2DPU A;  4FQG A;  2LKP A;  3I58 A;  3P7N A;  2R93 J;  1YHQ I;  4FE4 A;  1YO5 C;  1DGW Y;  5D5V B;  2VOO A;  1GHC A;  1YG2 A;  2L9R A;  3G1L A;  2LRD A;  3OYG A;  3E0J B;  5CLS A;  1R9T J;  4G9Y A;  2VIX A;  4S0H B;  1ZTR A;  3K4J A;  4S04 A;  1XS9 A;  3H9Q A;  2DK5 A;  3J80 Z;  3PQJ A;  3HGY A;  1MMA A;  3T5X A;  4MTD A;  3FBN B;  2BGC A;  2GXA A;  3GTK J;  1U9N A;  4NQW A;  4X1E A;  1BI0 A;  5IY5 H;  3SXY A;  1R58 A;  5D8K B;  2STW A;  1D3Y A;  1UST A;  2I10 A;  5CVI A;  4JK1 X;  2K3P A;  1AHD P;  4P55 A;  4JOM A;  3IRR A;  4UY8 I;  1V54 H;  2M4G A;  1IAW A;  1BN5 A;  1V5F A;  2HDW A;  3K2Z A;  3RQ4 A;  2BY1 A;  5EZG A;  1QU3 A;  4WXD A;  5EGO B;  1FOK A;  3ESW B;  4RS8 A;  2DW4 A;  2LVS A;  2XPU A;  1UG2 A;  2M8E A;  3QPT A;  2CUF A;  2DFI A;  1KZH A;  5GAD J;  4BEH B;  4XM3 A;  2MC3 A;  4BYY A;  1FLI A;  2WWY A;  2FUG 2;  3WTV C;  4BH9 A;  3AG4 H;  1ULY A;  2JUC A;  1OCR H;  2IRF G;  2L7Z A;  2DTZ A;  2BXZ A;  1YYV A;  2JSC A;  1W5S A;  2IPQ X;  2XAJ A;  3K9T A;  3ZQQ A;  3QAH A;  1S72 I;  2DPD A;  2LSO A;  3CCY A;  3IHU A;  2VQH A;  1V4R A;  2IW5 A;  2O7O A;  1BL0 A;  2K9S A;  2VKV A;  1ETK A;  5LRS A;  2HDD A;  1VQ9 I;  2QWW A;  1UMQ A;  4ENM A;  2JVG A;  5FKM A;  5FKL A;  1OCO H;  2QQ9 A;  4OIO F;  2BY3 A;  3SJM A;  3DBR B;  4L5J A;  3HRS A;  2O03 A;  2R0Q C;  3EYI A;  1B72 B;  3HOZ J;  4F93 B;  4HDU A;  3OWT A;  2PFB A;  5DEQ A;  5ERI A;  2HTS A;  1XSD A;  2Z1D A;  1OCP A;  2E2I J;  4XKC A;  2MH2 A;  1G3T A;  4D5F A;  2WB1 A;  1FWZ A;  1UEL B;  2DO7 A;  2NS0 A;  2TCT A;  3KP4 A;  1E3H A;  2E1M B;  4YRV A;  3DU5 A;  3EPZ A;  2ZO4 A;  4KUM A;  5E1X A;  1O4X A;  2HZD A;  5L3D A;  3QYF A;  1XSV A;  3MEX A;  2NS7 A;  2L5Q A;  3GYH X;  1BW5 A;  3LMM A;  1MBJ A;  3CCR I;  3J81 K;  4EM2 A;  3D5L A;  2WY8 Q;  1QBJ A;  2F6C A;  1ZEL A;  1MDM A;  1FBU A;  2P8T A;  3IH2 A;  4BJ6 C;  1XMK A;  4KN7 X;  3KZI C;  2JK3 A;  3FXJ A;  3BR6 A;  1R5H A;  3CDH A;  2E7W A;  3DEE A;  3L2W A;  3RZD J;  2E2J J;  2H8R A;  2ZXH A;  2JQ7 A;  2V26 A;  2WAD A;  3LSG A;  2DTR A;  3SDG A;  3HOT A;  5FD5 A;  4B4C A;  1RRJ A;  2M87 A;  1JTX A;  2FQ3 A;  2OJE D;  3HBL A;  2MBF A;  2EV5 A;  4YG2 F;  2V9V A;  2F4I A;  1HCR A;  2XAQ A;  2XVC A;  3LNQ A;  2I8D A;  3B02 A;  2NYX A;  4UXN A;  3IWZ A;  4BXU A;  2DMT A;  4PSX A;  2DFF A;  3KYD B;  3RYP A;  2DA2 A;  4A3K J;  4K2E A;  2W25 A;  5B1B H;  2HOS A;  2LK2 A;  4PJM A;  2DI3 A;  3WGH A;  2IT0 A;  3DU6 A;  2PN6 A;  1U2W A;  1KYW A;  3CJR B;  3FXU A;  4RAG A;  1T39 A;  2HDC A;  1CF7 B;  2VXD A;  1O7F A;  2R5Y B;  1EV7 A;  3BLY A;  3BWG A;  4ITV A;  2WA0 A;  5FLX Z;  3VEP A;  1XC5 A;  2KHM A;  2JWT A;  4ESJ A;  1UFM A;  2Z3Y A;  4Y15 A;  1YJW I;  3OYC A;  2W85 A;  4FCY A;  1T0F C;  1YW8 A;  3BR3 A;  1T95 A;  3ECH A;  1JUP A;  1X2M A;  4RAY A;  2AQF A;  4LK0 F;  2HTJ A;  3O2P E;  4XRF A;  2ZJQ F;  4MQ9 F;  3AL0 B;  5AON A;  1SVO A;  4PJ0 C;  3KYL A;  3EUK L;  3KEO A;  1F1Z A;  2A6E F;  4ZZD A;  4IHY A;  2DLL A;  3P9C A;  2QGU A;  4B09 A;  5C44 J;  3H9J A;  3E1S A;  2DMP A;  3FXM A;  3PNY A;  4CYC B;  1ZGW A;  2OBP A;  3TOB A;  4DJA A;  3ZN1 A;  1PUF A;  2H1K A;  3HTU A;  4DQ2 A;  3E6B A;  1I6H J;  5IT9 K;  1VZ0 A;  1WVR A;  4XLA A;  3ZMU A;  4FAS D;  1BW6 A;  3WTY C;  3PO3 J;  2X1C A;  2GQQ A;  2V9P A;  2VPR A;  3FXK A;  2LR8 A;  2DOD A;  3KP2 A;  2CV0 A;  2R7T A;  3WE2 A;  2Q2E B;  3HRM A;  4LLN A;  1LVK A;  3QPH A;  3GTP J;  2CQN A;  2NVY J;  3F8N A;  3WU2 C;  3FKJ A;  2L4A A;  2Y0S A;  1S6L A;  2RAE A;  3CME I;  4HW0 A;  5CJ9 A;  2PJR A;  3R0J A;  4ETS A;  5HLG A;  4JX6 A;  4PK4 A;  3TGN A;  3BJ6 A;  5GAH J;  3VFZ A;  5HNH A;  3I54 A;  3RIR A;  2P4W A;  4BHP A;  1OMI A;  2Q1Z B;  4C3H J;  5J40 A;  3CMY A;  2RC4 A;  2KRF A;  4IO9 F;  4PJN A;  1MSF C;  5D6F A;  1S5L C;  1K61 A;  5GTH C;  2Z2S B;  4A6D A;  3RI4 A;  3FMR A;  2X9D A;  4M6V A;  5J6X A;  1T0F A;  3TED A;  1DUX C;  2BW3 B;  3CJN A;  1K83 J;  5EYR A;  2H94 A;  2BZT A;  3HPG A;  1XMX A;  5E1W A;  1QVT A;  3OYE A;  3BP8 A;  3G1O A;  1F36 A;  5BPI A;  2G7H A;  3DFG A;  3HXL A;  2WAQ N;  3L2V A;  1KA8 A;  1P6R A;  3U9G A;  2ID3 A;  1X1C A;  2DA7 A;  3JRB A;  3N4M A;  1P9Q C;  2YX7 A;  1QZE A;  1AA7 A;  4BBR J;  4V2F A;  4FX4 A;  5ILU A;  2W7N A;  1JT0 A;  4NC8 A;  5IT3 A;  2W4S A;  1JUM A;  2NOJ B;  4OMZ A;  4BDZ A;  4O5V A;  2QQA A;  5F27 A;  3V8K A;  3I56 I;  1D1C A;  2VJJ A;  1BIA A;  1IJW C;  1G3S A;  2JPB A;  2NVT J;  2Y69 H;  5DM7 F;  2LMD A;  2B0L A;  1WKM A;  4A3C J;  2EIK H;  1EH7 A;  5FRO A;  3F72 A;  5BPD A;  2LKX A;  1SAX A;  2MAB A;  5L3E A;  4XOR A;  3DKX A;  4BUP A;  2YX4 A;  4XK4 A;  4OAZ A;  3SEZ A;  4BQN A;  2A07 F;  4L9J A;  2EFW A;  2ZJP F;  1E3O C;  2MD5 A;  1ZHF A;  3C2G A;  3U1D A;  2COM A;  4HPQ A;  1I1G A;  3E6M A;  4XLP F;  1A36 A;  3SFZ A;  2L7K A;  3A03 A;  3F6V A;  3PQK A;  1PYV A;  2E71 A;  3KP6 A;  3QQA A;  4BGD A;  2FD5 A;  3I71 A;  2W82 A;  4I0A A;  1I1S A;  4XLE A;  1GUU A;  2Y31 A;  2UXX A;  3W2A A;  3RKW A;  3RPQ A;  3TKY A;  2KLO A;  1SFE A;  2LOO A;  4RGU A;  4BQO A;  3CLQ A;  1USS A;  3GF2 A;  4GCV A;  3JTH A;  3P9I A;  5E3O A;  1MNM C;  2LY9 A;  3OYK A;  2X6Y A;  4CCM A;  1O57 A;  4DNC A;  1B9M A;  1K7A A;  4IHV A;  1U78 A;  1IN6 A;  3TL4 X;  2DMU A;  2X85 A;  2NXN B;  3CP2 A;  1D0Y A;  4P96 A;  4V2G A;  1FSH A;  2QZ8 A;  4X0G A;  2KQR A;  3L2Q A;  1KYZ A;  4R1H A;  1I50 J;  2V4J C;  2QKL B;  1JT6 A;  1X1A A;  3ZQF A;  3LOC A;  2XGD A;  4M3B A;  5HDG A;  3OYN A;  4I6Z A;  3D5R C;  2IA2 A;  1W5T A;  3FMQ A;  5JHF A;  1ZR2 A;  3S17 J;  1RR8 C;  1HSJ A;  2ELK A;  1ZG5 A;  1QRY A;  1G4D A;  2XKP A;  4IHX A;  3MQ0 A;  5TJJ A;  4NB5 A;  5D4S A;  4EQQ A;  3HHH A;  2XHK A;  4NQW B;  2WC2 A;  2XB5 A;  3I0T A;  4JP0 A;  3S3M A;  3FZV A;  4LOC A;  4IJA A;  1K4S A;  2M8G X;  1I6X A;  1Y0U A;  3V8J A;  2Y9Z A;  3PFY A;  4G7O F;  2WBM A;  3DF8 A;  2FU4 A;  4QPO A;  5TRD A;  1J2X A;  1X3Z B;  1BI2 A;  2E7X A;  2EIJ H;  3GBG A;  4RB0 A;  2D5V A;  3HRT A;  2XPW A;  3BCB A;  1TQI A;  2DCE A;  3ISP A;  3T0Y A;  2F5E A;  4OIR F;  5JHU A;  1S7O A;  3DV8 A;  1R5I D;  3K70 C;  4I99 C;  1IRX A;  3GZ6 A;  1ODD A;  2H8W A;  4HSR A;  4AM3 A;  2UZK A;  4U88 A;  1MJ9 A;  2WY7 Q;  3BCA A;  2ZNZ A;  4Y13 A;  4XQF A;  3CCQ I;  3LA3 A;  4A93 J;  2V1N A;  5LBQ A;  2X51 A;  1RUO A;  4BE2 A;  1QHG A;  4QPQ A;  1S3J A;  1H9G A;  3SQN A;  1ZRD A;  3E7L A;  5M3M J;  3ABK H;  2MGQ A;  4B48 A;  3M07 A;  4RMN A;  2EFN A;  4MIM A;  2FOW A;  3CQZ J;  3DPU A;  4Y4R A;  1XX5 A;  4A69 C;  4E7J A;  2CMP A;  3OYD A;  5B3S H;  3BT9 A;  1C0W A;  1VQP I;  2LYC A;  4GGG A;  3H1C A;  3HOW J;  2RKH A;  3CD6 I;  3OL4 A;  4RAZ A;  2EIM H;  2LRE A;  2GM4 A;  4XKW A;  1HLV A;  4HV6 A;  4ZZL A;  2OC6 A;  5DCM A;  3HJE A;  3OS2 A;  2HPM A;  1HA8 A;  3F6O A;  4ZJZ A;  3PUF A;  4KIC A;  5B1A H;  5KHD A;  1MD0 A;  2NNN A;  3GFJ A;  4MQV A;  2H09 A;  4Y3O A;  1ETV A;  2XGX A;  4U0W A;  2L54 A;  4KIB A;  1BC7 C;  4G8X A;  1D0Z A;  3C1D A;  2NVU B;  4PUS A;  4QWQ A;  4U87 A;  5CQE A;  9ANT A;  1HW2 A;  2AO9 A;  1ETX A;  4UUV A;  3MZH A;  5IOZ A;  4A3M J;  2Z99 A;  2DT6 A;  1W1W E;  3OOP A;  1ETY A;  1TNT A;  2FX0 A;  2EFP A;  1LB2 A;  1X58 A;  2KIS A;  3FM5 A;  3E5U A;  3DWL E;  3HOV J;  3JRA A;  1A35 A;  2K9N A;  1JI8 A;  3HC7 A;  3K6G A;  2M2E A;  3KLN A;  1WCM J;  4BXF A;  4E70 A;  4XRS G;  2IJL A;  3CDI A;  2DT5 A;  3EET A;  1OYW A;  3HB9 A;  3A4C A;  3QYB A;  1EF4 A;  1MDM B;  2NVX J;  2P6T A;  2HQN A;  1JKP C;  1ZGJ A;  2IGM A;  6PAX A;  4RM2 A;  3IUO A;  1PDN C;  1YX3 A;  4CGZ A;  3M8J A;  2DDB A;  4LIT A;  4KIF A;  3LSI A;  4IHS A;  2K85 A;  1W36 C;  3HG9 A;  3ZQI A;  4XN3 A;  3CCV I;  3TQN A;  4NBQ A;  1R71 A;  2EFO A;  1HOM A;  5JLX A;  1UHM A;  1HKQ A;  2HWV A;  1SFU A;  5ED4 A;  4W1U A;  2UV1 A;  2D45 A;  1BA5 A;  2FMY A;  2Z5U A;  3K10 A;  2FXA A;  1P4A A;  1MH4 A;  3OYM A;  2ZXW H;  3ZPL A;  2K5C A;  4XBF A;  1SD6 A;  3LQQ A;  4HX8 A;  3LSR A;  1WQ2 A;  3DTE A;  1SAU A;  2OAZ A;  3ZRG A;  3NWS A;  3IP4 B;  2XSJ C;  2VBZ A;  2BOL A;  3AAF A;  2JRT A;  1KON A;  5B66 C;  2CFX A;  2DOA A;  2IS1 A;  1P2F A;  3X2Q H;  2M45 A;  4HV5 A;  2R7W A;  2M9H A;  3BR1 A;  4IRG A;  4BKX A;  1JGG A;  2ZME C;  1STZ A;  3U2R A;  2V7F A;  3E5X A;  2K4J A;  3K7A J;  4HST A;  4BHB A;  2JA6 J;  2NAZ A;  1QHH D;  2CG4 A;  5HDN A;  1OLT A;  4LG0 A;  4B1R A;  1U8B A;  1I27 A;  2DN0 A;  3CMM A;  3J7Z I;  3HRU A;  3MMY B;  1TBX A;  2R7Q A;  3F8B A;  2VKE A;  5K1Y A;  4YIF A;  1KQ9 A;  5FKN A;  2R5Z A;  2EWN A;  2L4M A;  5IP9 J;  2R7Z J;  3OIP A;  4BHC A;  1WJD A;  3R0A A;  2QYO A;  3GEZ A;  4ENN A;  3G6E I;  4KNY A;  1N77 A;  5J47 A;  3GUD A;  2XV4 S;  3UNG C;  1LNW A;  2OA4 A;  4JX5 A;  1PUF B;  1Z0X A;  2EZL A;  2OF7 A;  2M1B A;  3O8G A;  3RKQ A;  1XTA A;  3K4N A;  1KU7 A;  5IYC J;  3EDP A;  1LVA A;  4IKF A;  2FBK A;  4ZYA A;  1FMV A;  1W5C C;  4S05 A;  5LHH A;  2IGO A;  5AIQ A;  1OYI A;  2O3F A;  3BG6 A;  1FZP B;  1N75 A;  4ZDL A;  4I98 B;  1OCZ H;  4KYW A;  2DFH A;  2JRM A;  1BR2 A;  4EVI A;  4A3G J;  1LFU P;  3RPU A;  4BY1 J;  1VI0 A;  2ECB A;  2VQG A;  3U1K A;  2PJR B;  1S9H A;  4U0V A;  3CC7 I;  2LF7 A;  4L9N A;  3MKL A;  1S29 A;  3TOA A;  1ZRE A;  1A6Q A;  4B3A A;  4O6J A;  1OFC X;  5GP9 A;  5D4R A;  4RGX A;  5H2F C;  4DBQ A;  1W7P A;  1PVE A;  2Y2Z A;  2ZME A;  2IS4 A;  1ZG3 A;  3H9G A;  5J4Y A;  2IVM A;  4Q48 A;  2K9L A;  3KEY A;  1LFP A;  5F1J A;  3GXO A;  3Q0W A;  1V55 H;  5JLW A;  4X6A J;  4Y7N J;  4P9U A;  4CHU A;  2KIU A;  4AUX A;  5C4J J;  1FY7 A;  3OSG A;  2HYF A;  1UHW A;  5DCF A;  2CQK A;  2A6H F;  4D5C A;  1X1B A;  4CXF A;  1R22 A;  3QPL A;  2DA3 A;  3JCU C;  1UCR A;  1HW1 A;  3BRO A;  3AFH A;  4P5O A;  2N8G A;  1NTC A;  1GVJ A;  4DZJ A;  2IGN A;  4U0Y A;  4DZP A;  2MD0 A;  1J7K A;  3B6C A;  3RCO A;  3PIO F;  2LTP A;  4A3J J;  3AKZ A;  2JVH A;  2CW0 F;  3H3Z A;  2ISY A;  4ZYE A;  1QQI A;  2LFB A;  2R7O A;  3E5Q A;  3V42 A;  2O5R A;  3SFI A;  2KJC A;  1Y1W J;  2XGE A;  2MLK A;  2HS5 A;  3WG9 A;  1RC9 A;  3ASO H;  2M34 A;  1JE8 A;  1IV8 A;  4KT5 C;  3K1P A;  2H1L A;  4AD9 A;  2JA2 A;  5D6E A;  2Q8K A;  2JUG A;  2EZK A;  1T98 A;  1SEU A;  3ZOB A;  1X1D A;  5C4X J;  4I01 A;  2E60 A;  2V79 A;  1ITY A;  3BTI A;  2MYS A;  5C3E J;  2PMZ N;  1ON1 A;  2OD5 A;  3WTS C;  5E3L A;  2DYR H;  3ZMT A;  2X6O A;  4M3G A;  1Z6R A;  1FJL A;  3REO A;  2ETH A;  2UUZ A;  3IAM 2;  2CQX A;  2EIL H;  5FKO A;  4FET A;  1JUS A;  2B9S A;  2F5F A;  4CUG A;  2P6S A;  3M4O J;  2XRL A;  2E5N A;  5CVV A;  2CJJ A;  4XKB A;  2GBY A;  1XB4 A;  3ZN0 A;  3MFK A;  3S14 J;  2R7U A;  2JJ7 A;  3LSM A;  2QA4 I;  4Q47 A;  5FGM A;  1F4K A;  2HQ5 A;  3CF5 F;  3JAM K;  4IHT A;  2E35 A;  3AG3 H;  2J5O A;  3NEU A;  3HKZ A;  3PNT A;  3ZQG A;  1YW9 A;  1OKR A;  2CRG A;  2W1O A;  5CQG A;  4BE1 A;  4CCN A;  2KZG A;  2KKO A;  1FIP A;  3I59 A;  2MH9 A;  4AID A;  2HOA A;  5H6Q A;  1LFB A;  1WFX A;  1QZY A;  1MZB A;  2ZXI A;  1IC8 A;  4L9T A;  4WF2 A;  1DU6 A;  1T2K A;  4XL9 A;  1VFC A;  2LP0 A;  3T8T A;  1NG6 A;  1RIO H;  2CYY A;  3HUG B;  3S2D J;  4NNJ A;  2CUJ A;  1DQU A;  4BS9 A;  1F43 A;  5GPA A;  4AIK A;  2V1U A;  4Q4Z F;  1X2N A;  4ON0 A;  4A5N A;  1JHH A;  1HST A;  1IZ1 A;  4HA8 A;  5HLI A;  1K6O A;  1SAN A;  4A3D J;  5M5W J;  2VT3 A;  4Z6Y A;  3BDD A;  2GIZ A;  5F0H A;  2ZKZ A;  2RNG A;  1VQN I;  3C3W A;  2QEX I;  2GLO A;  2XAH A;  2DA1 A;  1OR7 C;  1LE8 A;  5A2Q K;  3ZQH A;  3UKG A;  3MAJ A;  1SMY F;  4E7Z A;  2X1D A;  1TWA J;  3VSL A;  2CSO A;  5E18 F;  3ZQL A;  2E1N A;  3ZMD A;  1OIS A;  2TRT A;  3PJR A;  3WHB A;  3BZC A;  3JAM Z;  1DDN A;  4W97 A;  3NQO A;  1J09 A;  1L0O C;  1XGN A;  4YIR X;  1Z9C A;  3S1N J;  2K4B A;  5E20 A;  2EIN H;  3ECO A;  3G71 I;  2V1X A;  4DBR A;  2ELH A;  1T6S A;  1ZGA A;  1MMG A;  1HDP A;  1Z7L A;  2OZ6 A;  2BY2 A;  1G59 A;  5KVR A;  4ZTJ A;  3EUA A;  4XLC A;  3HM5 A;  2EV6 A;  2VQC A;  5AIP A;  1GV2 A;  4U7D A;  2AXT C;  4AVP A;  3LA7 A;  1QO0 D;  3K4L A;  4EJO A;  5IOY A;  1IW7 F;  1UHS A;  3SZG A;  3VOD A;  3GLL A;  4A3I J;  2JA5 J;  3J81 Z;  4ABZ A;  5JVG F;  1RET A;  4P9F A;  2VOD A;  1R5G A;  4NDL A;  5EG0 A;  4BXX J;  5EJC A;  4N9H A;  4OIP F;  1G3W A;  3W2W A;  2O8X A;  2WV0 A;  3R60 A;  4QTR A;  3B73 A;  3IWF A;  3ONQ A;  1WH7 A;  1R4M B;  5E3M A;  1XN7 A;  3QPS A;  4CSW A;  1AWC A;  2P5V A;  2LKS A;  2BEO A;  2K86 A;  5A2Q Z;  2DK8 A;  1U6G A;  4XRM A;  5ILS A;  1BBY A;  2IEK A;  5KK1 A;  1VQ6 I;  4A3B J;  1B6A A;  2A5Y B;  2KIQ A;  1FC3 A;  5L3C A;  1XDU A;  5EEA A;  1B9N A;  1Z21 A;  1Y0N A;  2FA5 A;  1XSX A;  3WG7 H;  3RJP A;  4HNT A;  4F3Q A;  1ZLK A;  3NRV A;  5HNF A;  2MFZ A;  3WHC A;  1OR7 A;  3IKV A;  3QU6 A;  1MNE A;  3CMA I;  4N0B A;  4D7M A;  2MA3 A;  2HZT A;  1WJA A;  1YW7 A;  5E79 C;  1XDS A;  1LKX A;  2F4M B;  5DUK A;  1W36 D;  4ESB A;  3GCM A;  4HNV A;  1XCB A;  1ZG1 A;  2GIV A;  4YII A;  1RKW A;  1XGS A;  4E6K G;  3G4S I;  3ZQC A;  5E8G A;  2GOX B;  5ICC A;  2XUB A;  1LPQ A;  5DDG A;  3OYI A;  2FRH A;  3S3N A;  3JRH A;  1RZ4 A;  2RGV A;  2QF7 A;  3HZJ A;  2ESN A;  1UZC A;  4M6Y A;  2CW7 A;  1BI3 A;  2K9Q A;  3OMY A;  2A05 A;  4G6D A;  4CYD A;  4I2O A;  1A6I A;  4AYB A;  3OIO A;  3RKX A;  5HLH A;  1N78 A;  2IS2 A;  3JW4 A;  4A6E A;  2PLY A;  1S7E A;  5CKT A;  3BPV A;  3CES A;  3QOE A;  5FRM A;  1W7P D;  4ZDP A;  1MW7 A;  2BVL A;  3RYR A;  1S8N A;  1O3R A;  2E34 A;  5BNG A;  2B63 J;  3G3Z A;  3H35 A;  1SC7 A;  5KCM A;  4BE0 A;  5IT9 Z;  1X4P A;  3S2H J;  2RNJ A;  3M8E A;  2KRH A;  1Z05 A;  3T8R A;  3TDZ C;  4D1Q A;  5M3F J;  2MSY A;  2VKD A;  4LG0 B;  3D1N I;  3A2K A;  1WJB A;  4HNU A;  3BG7 A;  1E0E A;  1TW2 A;  1EJ9 A;  1Z6T A;  2KP6 A;  5EDN A;  5IP7 J;  1GLN A;  1PUE E;  3BQY A;  3H5R A;  2RQP A;  3LQR A;  5K7H A;  2QBY A;  1J9I A;  2O9L A;  3CO7 C;  2LY2 A;  2MLG A;  3FBI B;  2R5Z B;  3CCE I;  3COA C;  4IF4 A;  2PJP A;  2EZH A;  5J3L A;  4XOP A;  3V7C A;  4MGR A;  4C3I J;  4HX4 A;  3PSF A;  4LLL A;  2M5W A;  1H89 C;  1DP7 P;  2GOM A;  1JJ8 C;  1HDD C;  2E1M C;  1Z3X A;  1KU9 A;  1I5Z A;  3I5U A;  4XRS A;  3CO6 C;  5TGT A;  4D9J A;  5CYV A;  2F5C A;  2PI0 A;  3FIW A;  1ZAO A;  2F5V A;  3ROU A;  3F21 A;  1MKM A;  3BG9 A;  3ZMZ A;  2H6B A;  1FTZ A;  4HG2 A;  1P92 A;  3QRF F;  1JXS A;  2DBB A;  1IN5 A;  5LD2 C;  4WX9 A;  1NK3 P;  2WAE A;  3JRD A;  4B44 A;  4MHG A;  1RI7 A;  4XN0 A;  4QIW N;  5LHG A;  2HXI A;  2H27 A;  5KAF C;  4OIQ F;  4IXA A;  3ASN H;  1ZRC A;  4EMS A;  3A02 A;  4M71 A;  1KU2 A;  4JYK A;  1EH8 A;  3K1M A;  3I64 A;  4EJT A;  4DYR A;  3KLO A;  2LDU A;  2K9M A;  4PFP A;  3QYE A;  4NUB A;  3GTQ J;  4PGH A;  3ELK A;  4N9I A;  2VJI A;  5H20 A;  5J4V A;  3L2R A;  1BIB A;  2IA1 A;  1G8X A;  4JBA A;  3FXQ A;  3TP0 A;  3CC4 I;  1GT0 C;  4RGS A;  1UG0 A;  4RBO A;  1YIT I;  1J0R A;  2XDV A;  3IRQ A;  2OCC H;  4GXO A;  2HVQ A;  2K02 A;  1W7P B;  1EH6 A;  3LL7 A;  2ZME B;  1ACI A;  3TO7 A;  5LEK A;  3FIS A;  4OOI A;  1BM9 A;  4OAY A;  3CC2 I;  4CIC A;  4BJT A;  5LLQ A;  5TIS C;  2DQL A;  3RSN A;  1G6N A;  1U5T C;  4FX0 A;  2E19 A;  3K69 A;  4H0E A;  2KPM A;  2ICW G;  2WV1 A;  5F08 A;  1ON2 A;  1I3A A;  3LA2 A;  4LJZ F;  5EF6 A;  1IDZ A;  3GX4 X;  4EV0 A;  3ZQ7 A;  3VB2 A;  4N4O B;  4HEA 2;  1QPI A;  2A6T A;  4C9Y A;  2VB6 A;  1Z91 A;  2CO5 A;  3S93 A;  2E2H J;  2L02 A;  2Z16 A;  2VON A;  1TC3 C;  3U21 A;  2X4H A;  3KZY A;  4RB3 C;  5IPA A;  2ADU A;  2LH9 A;  2KIF A;  2JPC A;  4YEJ A;  4XSZ F;  2L9V A;  4R8H A;  1LJ9 A;  4F7Z A;  3DBH B;  3F23 A;  4A3F J;  4XLF A;  4F52 A;  1SFK A;  1HC8 A;  2GA2 A;  5E3N A;  3KZZ A;  2VC0 A;  2X1E A;  3F0C A;  2ME6 A;  1OPC A;  4RDU A;  3V4G A;  2HI3 A;  3CCL I;  3VYR B;  3LST A;  3CJT B;  1BR4 A;  3OR1 C;  2QSH X;  3CJQ B;  1LDK B;  3K1N A;  3JRF A;  2PMZ A;  3I9V 2;  4KIG A;  5J1R A;  3O8H A;  1O3T A;  1Y1V J;  3BTL A;  3GFI A;  2ME0 A;  2OPT A;  2R4G A;  4LIV A;  3EUH C;  4Z2Y A;  3W6J B;  4B43 A;  5FO5 A;  3F22 A;  1O3Q A;  4A0X A;  3I3L A;  3VYT B;  4PSW A;  2XF6 A;  4E7L A;  3R61 A;  2VPL A;  3FXO A;  3TMO A;  3WTZ A;  1TT5 B;  4BQA A;  1ZH5 A;  4F92 B;  3DQV C;  1NHA A;  3GZ5 A;  1U5T A;  2IAI A;  2VAS A;  4ESF A;  3TW7 A;  1FMW A;  2NVQ J;  2ZBK A;  4D7N A;  4BBS J;  4ASN A;  3MCZ A;  4ENJ A;  2FOK A;  3ZGK A;  1WI3 A;  3I59 B;  3K4M A;  4AC0 A;  2HVS A;  3OYH A;  4QLC U;  4KMU X;  1AOY A;  1RPW A;  3KYC B;  2V6E A;  5DUI A;  3N97 A;  1BJA A;  2CUZ A;  2CU7 A;  3UR3 C;  5DYM A;  4RLF A;  3AG2 H;  1ONV A;  3Q0U A;  1TWF J;  1R7J A;  1MMD A;  2LD5 A;  2EK5 A;  3KP7 A;  1FYM A;  2EA4 A;  2RV8 A;  4JQF A;  2R7D A;  1T8I A;  3OL3 A;  4UVA A;  1FP2 A;  3MZY A;  1CGP A;  2W24 A;  1UB9 A;  2CW8 A;  4PZJ A;  1LEB A;  4CCO A;  4XLN F;  2OTJ I;  4IEJ A;  3OY9 A;  4EJV A;  3I4N J;  2ZFW A;  4XSX F;  1LE8 B;  2E1O A;  2IXS A;  1VQM I;  3OYA A;  1KQ8 A;  3FK7 A;  4M9S A;  4OMY A;  4GRI A;  2A68 F;  3CZ6 A;  4IOC F;  1LQ1 A;  3BJA A;  3A0H C;  4DYQ A;  3FKI J;  1UAA A;  1VQ4 I;  2Y0S N;  2PQ8 A;  5E8I A;  2KIM A;  4LK1 F;  4H4K C;  2LC2 A;  5LGU A;  3EUH A;  3FDY A;  1IUF A;  5HOO A;  1F9N A;  4KFC A;  3MKW B;  2VT2 A;  1Y8R B;  2HU9 A;  2VXZ A;  4FE7 A;  1UJ8 A;  2BVM A;  3PO2 J;  1GV5 A;  2K7L A;  2VC1 A;  3S1Q J;  3NWT A;  3HOY J;  1Y6I A;  3FM3 A;  3GZN B;  3PNV A;  1RES A;  3PIP F;  5FB2 A;  2GAU A;  4FHT A;  3F3X A;  4DIQ A;  1TNS A;  1TT0 A;  4ENK A;  5LRR A;  4Y52 J;  3G73 A;  3OOU A;  2A61 A;  1B4A A;  1A5J A;  1K4T A;  2DFE A;  1IO2 A;  1VF9 A;  3M9A A;  4CCL A;  2R7F A;  3CUQ C;  5BQT A;  2M30 A;  2L2O A;  1TL8 A;  1R1U A;  3NAR A;  3E6D A;  1IN7 A;  2WAF A;  4PCQ A;  1SD5 A;  4HF0 A;  1ETW A;  2ZFU A;  3TO6 A;  1IRG A;  3S15 J;  1QNT A;  1MBG A;  2OZU A;  2L9S A;  1H8A C;  2L9N A;  4UUT A;  4G7H F;  2HKO A;  4L9V A;  4D0P A;  4C2T A;  3GFL A;  2NS8 A;  2A3S A;  1WGX A;  2PEX A;  3K2A A;  5E1Z B;  2K40 A;  4FT8 A;  1T33 A;  1ZKG A;  1ZRF A;  1Q1H A;  1YIO A;  3O3K A;  4FIS A;  4M73 A;  1M1E B;  1QZZ A;  5F1R A;  3DXJ F;  1A04 A;  1HXD A;  3Q5F A;  1XCV A;  2R3S A;  2IA0 A;  1V5G A;  1IXC A;  1MJB A;  2F4O B;  2VKH A;  4L5E A;  3IH3 A;  4UV8 A;  3WU1 B;  1QPM A;  1JGS A;  5F0F A;  3VPR A;  3HDD A;  1FP1 D;  2DOE A;  3F8F A;  1VQ5 I;  1YTY A;  2EFQ A;  2P5K A;  1T56 A;  4AWX B;  4A3L J;  2M7B A;  3E3V A;  3GFM A;  3GME A;  2UWM A;  4BU2 A;  4WWC A;  2O0Y A;  4KIS A;  3EYY A;  3GTM J;  4UB8 C;  2HOT A;  1TLH B;  4M74 A;  1R6R A;  2MC4 A; 
#chains in the Genus database with same CATH homology
 2EJR A;  3J80 K;  4I02 A;  4UVC A;  2TDX A;  4MTE A;  4BAY A;  4LD5 A;  1FNN A;  4EJU A;  1BOA A;  1U8R A;  1DPU A;  4GYG A;  3FHZ A;  1RUN A;  4RGR A;  2HKX A;  4WXC A;  1V3F A;  1LEA A;  4M72 A;  3CUQ A;  3H3U A;  4KMF A;  3DPL C;  1LDD A;  3FXR A;  3QP5 A;  1Z7U A;  2XKO A;  4HF2 A;  2XIG A;  4MNU A;  1IN4 A;  2YU3 A;  2XAS A;  2NNY A;  1IN8 A;  3LAJ A;  2LNB A;  1MJA A;  3KFW X;  3S2W A;  2VBW A;  5K5R A;  2K27 A;  2QBY B;  3FMS A;  2XAG A;  3JSP A;  2AS5 F;  1R1V A;  5H6R A;  1ZYR F;  2ZXJ A;  1P4X A;  2O6G E;  4B8X A;  2P7V B;  2V1D A;  1F5T A;  5D5W B;  4L0Z B;  1R00 A;  5BOX A;  4IRH A;  3CUO A;  1B59 A;  2QEN A;  4G7Z F;  2XRN A;  5D8L B;  5L3F A;  1Z1D A;  2P7C B;  3ULQ B;  3RKY A;  5J8F A;  1SD4 A;  2JT1 A;  1P4W A;  2BBY A;  2Y75 A;  4UHT A;  5ICE A;  2DU9 A;  1WI9 A;  4ZYH A;  2EV0 A;  1K78 A;  3JTG A;  3DEU A;  2PBI A;  1FYK A;  1IUY A;  5LGN A;  5ICG A;  2ESH A;  1H9T A;  3L09 A;  4UNO A;  4WK8 F;  1HW5 A;  4CZZ A;  2HOE A;  3HSF A;  3F8M A;  1GXQ A;  3HSR A;  3BY6 A;  3ML6 A;  2VN2 A;  4KA4 A;  3IC7 A;  3GWZ A;  2CGP A;  2FBI A;  4HBL A;  2FNA A;  2QVO A;  3VOE A;  1WWX A;  4KDP A;  2Y48 A;  2ZJ2 A;  1FX7 A;  2QM3 A;  2HYG D;  3IL2 A;  3ZP5 A;  1TQP A;  5FLX K;  1B1B A;  1VTN C;  1ZAR A;  1D8J A;  1DPR A;  3I4P A;  1ZN2 A;  3C18 A;  3V8L A;  2W57 A;  3RDI A;  4YFX F;  1TLH B;  1J59 A;  3FX3 A;  4HF1 A;  2RVC A;  3KEQ A;  3Q9V A;  1XGO A;  2KJB A;  4G6Q A;  2X0L A;  4KN4 X;  3C7J A;  3RTR A;  2FBH A;  4YFK F;  5JFR A;  3FWE A;  3L00 A;  5DCM B;  3WTW C;  5HDK A;  4L5I A;  1U5T B;  2XAF A;  4HYE A;  1E2X A;  2E1C A;  2HGC A;  2OQR A;  4R79 A;  4ZYD A;  3BZ6 A;  5CVR A;  5FFX A;  2A69 F;  2DAO A;  1JHF A;  5L3G A;  2FSW A;  2PMU A;  3R6S A;  4M9Z A;  5K5O A;  3BOQ A;  4IPA A;  1PP7 U;  1PP8 F;  1BI1 A;  3I53 A;  4HLX A;  3BPX A;  3T1B A;  1TQM A;  4ZH4 F;  1MGT A;  4OIN F;  5FFZ A;  3R4K A;  4TV7 A;  3PFI A;  5HS9 A;  3L2C A;  4LB5 A;  2OQG A;  3QU3 A;  2D1H A;  2W84 A;  5HS7 A;  3BJO A;  2ACJ A;  5D5X B;  2C6Y A;  2BE5 F;  2D2W A;  4EGY A;  2FML A;  2VBX A;  2NRA C;  3M1E A;  2EB7 A;  1ZLJ A;  1HKS A;  3H92 A;  2ZNY A;  4HLY A;  4A2U A;  1OYY A;  1O7L A;  4A5M A;  1FSE A;  1S7A A;  4WCG A;  1FYL A;  5DV5 A;  4EJW A;  1FBS A;  1YFH A;  2O61 A;  2GXG A;  2VOP A;  3E97 A;  3M7G A;  1FPQ A;  2QQB A;  3M8F A;  5JI6 A;  1D5V A;  4CDG A;  2BYV E;  2PG4 A;  4G94 A;  4A0Y A;  2D1V A;  3ZMS A;  1YLF A;  4EM0 B;  2HQR A;  5J8C A;  3ERE D;  4HOB A;  1LDJ A;  5DD4 A;  1IXS B;  2EA2 A;  4HQM A;  2GA1 A;  3ABT A;  3HOS A;  3SZT A;  3L7W A;  3ZMV A;  1WSU A;  4IVN A;  2V6C A;  5EEH A;  3V7S A;  4AIH A;  3GO5 A;  4HAM A;  1YQA A;  1RNL A;  5CVU A;  4LLG F;  5DD8 A;  1XD7 A;  5D5U B;  1KQ0 A;  4HQE A;  5ILV A;  2AXL A;  3MWM A;  3LWF A;  3CUQ B;  1HQC A;  4LB6 B;  4MEX F;  3KP5 A;  1KGS A;  3HYI A;  4ZYG A;  3TDU C;  3WTU C;  5FD6 A;  3D0S A;  4IRI A;  2G9W A;  2JZY A;  1IXR C;  3KET A;  4LFU A;  2Q0O A;  2VE9 A;  2IP2 A;  1G3Y A;  3HUG A;  2YR2 A;  4L0Y B;  5EEG A;  5F64 A;  1L3L A;  2CWE A;  3V7R A;  3KE2 A;  3HIF A;  2Z9O A;  4Q5S F;  3DP7 A;  3CTA A;  4RB1 A;  2J5P A;  3LAP A;  2YPR A;  4I09 A;  2QLZ A;  4MEY F;  4HZF A;  1O3S A;  3O6B B;  5ICF A;  3WGG A;  2BV6 A;  2OU2 A;  5BS6 A;  5BMZ A;  3GW2 A;  4RB2 C;  2HFH A;  1D8K A;  4GYI A;  3WTX C;  3EQL F;  1IRF A;  4I0B A;  2GXB A;  5HS8 A;  2L3D A;  3KCC A;  1WRJ A;  3OV8 A;  4I7H A;  1CF7 A;  4PGG A;  4A0Z A;  4M9X A;  2L01 A;  1SFX A;  1R23 A;  4LMY A;  5JVT A;  1K78 B;  2H6C A;  5CVJ A;  2FNP A;  1YS6 A;  4UVB A;  3HSE A;  3W6K B;  1R1T A;  4CO8 A;  1IF1 A;  2WTE A;  4LGW A;  2ZCW A;  5K5Q A;  2YSR A;  1FBQ A;  3F8C A;  3LFK A;  2VE8 A;  2JTV A;  4HDV A;  5HVQ C;  4BNC A;  3P9K A;  5JR3 A;  1SMT A;  2F2E A;  5L3B A;  3WE3 A;  1J5Y A;  2XRO A;  4U7B A;  4AIJ A;  4O3M A;  2HEO A;  5LHI A;  2ISZ A;  1K79 A;  2RN7 A;  4UV9 A;  2Y0M A;  2QUF A;  1SD7 A;  2Q2E A;  4Y17 A;  3E6C C;  2Z33 A;  1R36 A;  3CLO A;  2HR3 A;  3HHG A;  3KP3 A;  4HX7 A;  5LGT A;  1GXP A;  3ABU A;  2P5L C;  2STT A;  2UXN A;  3JSO A;  2GWR A;  1TW3 A;  1X3U A;  1E17 A;  1TTY A;  3L9F A;  3WU0 A;  3IKT A;  4OU0 A;  3QP6 A;  1YS7 A;  2FE3 A;  1T38 A;  2VBY A;  3J7A O;  1BC8 C;  5F6F A;  3DKW A;  3QOP A;  3Q9S A;  3FF5 A;  2PMH A;  4EM1 A;  3WGI A;  4EGZ A;  3GLX A;  3TO9 A;  1HKT A;  2DQR A;  1J75 A;  3WTT C;  1H0M A;  3SZP A;  4NHJ A;  1XMA A;  1QGP A;  2F5D A;  4M6X A;  4YFN F;  4PDK A;  1XGM A;  4GO1 A;  3HTS B;  1HBX G;  1W4M A;  1FT9 A;  5LEJ A;  1REP C;  2LF8 A;  2FEZ A;  3GVA A;  5E17 F;  2G7U A;  3WOD F;  1U3E M;  2GZW A;  2FF4 A;  3K0L A;  2RDP A;  3SHF A;  4A12 A;  4L18 B;  4WXH A;  3DPT A;  2DPU A;  2LKP A;  3I58 A;  3P7N A;  1YO5 C;  5D5V B;  2VOO A;  1GHC A;  1YG2 A;  5CLS A;  4G9Y A;  4S04 A;  2DK5 A;  3J80 Z;  3PQJ A;  4MTD A;  3T5X A;  2BGC A;  4NQW A;  1BI0 A;  3SXY A;  1R58 A;  5D8K B;  2STW A;  1D3Y A;  1UST A;  5CVI A;  4JK1 X;  4P55 A;  3IRR A;  1IAW A;  1BN5 A;  3K2Z A;  4WXD A;  1FOK A;  4RS8 A;  2DW4 A;  2M8E A;  3QPT A;  2DFI A;  2MC3 A;  4BYY A;  1FLI A;  2WWY A;  3WTV C;  4BH9 A;  1ULY A;  2IRF G;  1YYV A;  2JSC A;  1W5S A;  2IPQ X;  2XAJ A;  3K9T A;  3QAH A;  2DPD A;  2LSO A;  3IHU A;  1V4R A;  2IW5 A;  5LRS A;  2QWW A;  4ENM A;  2QQ9 A;  4OIO F;  4L5J A;  3HRS A;  2O03 A;  3EYI A;  4HDU A;  2PFB A;  5DEQ A;  5ERI A;  2HTS A;  1XSD A;  2MH2 A;  1G3T A;  1FWZ A;  2DO7 A;  2NS0 A;  3KP4 A;  2ZO4 A;  4KUM A;  5E1X A;  5L3D A;  1XSV A;  3MEX A;  3GYH X;  3J81 K;  4EM2 A;  3D5L A;  1QBJ A;  1MDM A;  1FBU A;  2P8T A;  1XMK A;  4KN7 X;  1R5H A;  3CDH A;  2E7W A;  2DTR A;  3HOT A;  5FD5 A;  2M87 A;  2FQ3 A;  2MBF A;  2EV5 A;  4YG2 F;  2V9V A;  2XAQ A;  2XVC A;  3B02 A;  2NYX A;  4UXN A;  3IWZ A;  4BXU A;  3RYP A;  4K2E A;  2W25 A;  2DI3 A;  3WGH A;  2IT0 A;  2PN6 A;  1U2W A;  1KYW A;  3FXU A;  1T39 A;  2HDC A;  1CF7 B;  1O7F A;  1EV7 A;  3BWG A;  5FLX Z;  3VEP A;  4ESJ A;  1UFM A;  2Z3Y A;  4Y15 A;  2W85 A;  1YW8 A;  3ECH A;  4RAY A;  4LK0 F;  4XRF A;  2HTJ A;  3O2P E;  4MQ9 F;  5AON A;  3KEO A;  1F1Z A;  2A6E F;  4ZZD A;  2DLL A;  3P9C A;  4B09 A;  2OBP A;  3TOB A;  3ZN1 A;  3HTU A;  4DQ2 A;  3E6B A;  5IT9 K;  3ZMU A;  3WTY C;  2GQQ A;  3KP2 A;  3WE2 A;  3HRM A;  4LLN A;  3QPH A;  3F8N A;  2L4A A;  1S6L A;  4HW0 A;  5CJ9 A;  3R0J A;  4ETS A;  5HLG A;  3TGN A;  3BJ6 A;  3VFZ A;  3I54 A;  3RIR A;  4BHP A;  2P4W A;  1OMI A;  2RC4 A;  2KRF A;  5D6F A;  3RI4 A;  4A6D A;  3FMR A;  5J6X A;  1T0F A;  1DUX C;  3CJN A;  2H94 A;  5E1W A;  3BP8 A;  5BPI A;  2G7H A;  3DFG A;  1KA8 A;  1P6R A;  3U9G A;  3N4M A;  2YX7 A;  4FX4 A;  5ILU A;  5IT3 A;  4OMZ A;  4O5V A;  2QQA A;  3V8K A;  1BIA A;  1G3S A;  2JPB A;  2B0L A;  1WKM A;  1EH7 A;  3F72 A;  5BPD A;  1SAX A;  5L3E A;  2YX4 A;  2A07 F;  4L9J A;  2EFW A;  2MD5 A;  1ZHF A;  3U1D A;  2COM A;  1I1G A;  3E6M A;  4XLP F;  3SFZ A;  3F6V A;  3PQK A;  3KP6 A;  3I71 A;  4I0A A;  1I1S A;  2UXX A;  3RKW A;  3RPQ A;  3TKY A;  1SFE A;  4RGU A;  1USS A;  3GF2 A;  4GCV A;  3JTH A;  3P9I A;  1O57 A;  4DNC A;  1B9M A;  1K7A A;  1U78 A;  1IN6 A;  4P96 A;  1FSH A;  2QZ8 A;  1KYZ A;  4R1H A;  5HDG A;  2IA2 A;  1W5T A;  3FMQ A;  1HSJ A;  1ZG5 A;  1G4D A;  2XKP A;  3MQ0 A;  5TJJ A;  4NB5 A;  5D4S A;  4EQQ A;  3HHH A;  2XHK A;  2WC2 A;  3I0T A;  3FZV A;  4IJA A;  1I6X A;  1Y0U A;  3V8J A;  4G7O F;  3DF8 A;  2FU4 A;  5TRD A;  1J2X A;  2E7X A;  1BI2 A;  4RB0 A;  3HRT A;  3ISP A;  3T0Y A;  1TQI A;  5JHU A;  2F5E A;  4OIR F;  1S7O A;  3DV8 A;  3GZ6 A;  1ODD A;  2UZK A;  4U88 A;  1MJ9 A;  2ZNZ A;  4Y13 A;  3LA3 A;  5LBQ A;  1RUO A;  1S3J A;  1H9G A;  3SQN A;  1ZRD A;  2EFN A;  1C0W A;  4GGG A;  2RKH A;  4RAZ A;  4HV6 A;  4ZZL A;  5DCM A;  3F6O A;  4KIC A;  1MD0 A;  2NNN A;  3GFJ A;  4MQV A;  2H09 A;  2XGX A;  4U0W A;  2L54 A;  4KIB A;  1BC7 C;  4G8X A;  3C1D A;  4QWQ A;  1HW2 A;  4UUV A;  3MZH A;  2Z99 A;  3OOP A;  1TNT A;  2EFP A;  1LB2 A;  3FM5 A;  3E5U A;  3KLN A;  4E70 A;  2IJL A;  2DT5 A;  3EET A;  1OYW A;  1MDM B;  2P6T A;  2HQN A;  6PAX A;  1ZGJ A;  1PDN C;  4CGZ A;  4KIF A;  4IHS A;  3TQN A;  2EFO A;  1UHM A;  1HKQ A;  2HWV A;  1SFU A;  5ED4 A;  2D45 A;  2FMY A;  2Z5U A;  2FXA A;  1P4A A;  3ZPL A;  4XBF A;  1SD6 A;  3LQQ A;  4HX8 A;  1WQ2 A;  2OAZ A;  2VBZ A;  3AAF A;  2JRT A;  2CFX A;  1P2F A;  2M45 A;  4HV5 A;  4IRG A;  1STZ A;  3U2R A;  3E5X A;  2K4J A;  4BHB A;  2NAZ A;  2CG4 A;  5HDN A;  4LG0 A;  1I27 A;  3HRU A;  1TBX A;  3F8B A;  5K1Y A;  4YIF A;  1KQ9 A;  2EWN A;  2L4M A;  4BHC A;  3R0A A;  2QYO A;  3GEZ A;  4ENN A;  4KNY A;  3GUD A;  2XV4 S;  1LNW A;  2OA4 A;  2M1B A;  1KU7 A;  3EDP A;  1LVA A;  2FBK A;  4S05 A;  5LHH A;  5AIQ A;  1OYI A;  2O3F A;  1FZP B;  4I98 B;  4KYW A;  4EVI A;  3RPU A;  4U0V A;  2LF7 A;  4L9N A;  3TOA A;  1S29 A;  1ZRE A;  4O6J A;  5D4R A;  4RGX A;  1W7P A;  2ZME A;  1ZG3 A;  2IVM A;  4Q48 A;  3GXO A;  4P9U A;  4CHU A;  2KIU A;  1FY7 A;  2HYF A;  1UHW A;  5DCF A;  2CQK A;  2A6H F;  4CXF A;  1R22 A;  1UCR A;  1HW1 A;  3BRO A;  4P5O A;  1GVJ A;  4U0Y A;  1J7K A;  2CW0 F;  3H3Z A;  2ISY A;  4ZYE A;  1QQI A;  3E5Q A;  2KJC A;  2MLK A;  2HS5 A;  3WG9 A;  1JE8 A;  4KT5 C;  3K1P A;  4AD9 A;  2Q8K A;  5D6E A;  1T98 A;  4I01 A;  2V79 A;  1ON1 A;  2OD5 A;  3WTS C;  3ZMT A;  1Z6R A;  3REO A;  2ETH A;  2F5F A;  2P6S A;  5CVV A;  1XB4 A;  3ZN0 A;  3MFK A;  4Q47 A;  5FGM A;  1F4K A;  3JAM K;  4IHT A;  2J5O A;  3NEU A;  1YW9 A;  1OKR A;  2KKO A;  3I59 A;  2MH9 A;  5H6Q A;  1QZY A;  1MZB A;  4L9T A;  4WF2 A;  1T2K A;  3T8T A;  1RIO H;  2CYY A;  4AIK A;  2V1U A;  4Q4Z F;  4ON0 A;  4A5N A;  1JHH A;  1HST A;  1IZ1 A;  4HA8 A;  5HLI A;  1K6O A;  2VT3 A;  3BDD A;  2ZKZ A;  3C3W A;  2XAH A;  5A2Q K;  3MAJ A;  1SMY F;  2CSO A;  5E18 F;  2E1N A;  3ZMD A;  3JAM Z;  1DDN A;  3NQO A;  1L0O C;  1XGN A;  1Z9C A;  2K4B A;  5E20 A;  3ECO A;  2V1X A;  2ELH A;  1T6S A;  1ZGA A;  2OZ6 A;  5KVR A;  2EV6 A;  5AIP A;  4U7D A;  4AVP A;  3LA7 A;  1QO0 D;  4EJO A;  1IW7 F;  3VOD A;  3J81 Z;  4P9F A;  2VOD A;  1R5G A;  4N9H A;  4OIP F;  1G3W A;  2O8X A;  2WV0 A;  3R60 A;  3B73 A;  3IWF A;  1XN7 A;  1AWC A;  2P5V A;  2BEO A;  2K86 A;  5A2Q Z;  2DK8 A;  1U6G A;  5ILS A;  1BBY A;  5KK1 A;  1B6A A;  2A5Y B;  1FC3 A;  5L3C A;  1XDU A;  1B9N A;  2FA5 A;  1XSX A;  3RJP A;  1ZLK A;  3NRV A;  1OR7 A;  3IKV A;  3QU6 A;  4N0B A;  2MA3 A;  2HZT A;  1YW7 A;  1XDS A;  5DUK A;  4ESB A;  1ZG1 A;  1XCB A;  2GIV A;  4YII A;  1XGS A;  5E8G A;  5ICC A;  2XUB A;  5DDG A;  2FRH A;  1RZ4 A;  2RGV A;  2ESN A;  4M6Y A;  1BI3 A;  4CYD A;  4G6D A;  4I2O A;  3RKX A;  5HLH A;  3JW4 A;  4A6E A;  2PLY A;  3BPV A;  1W7P D;  3RYR A;  1S8N A;  1O3R A;  3G3Z A;  5IT9 Z;  2RNJ A;  3M8E A;  1Z05 A;  3T8R A;  3TDZ C;  4LG0 B;  1TW2 A;  1Z6T A;  1PUE E;  2RQP A;  3LQR A;  2QBY A;  1J9I A;  3CO7 C;  2MLG A;  2PJP A;  3COA C;  4IF4 A;  3V7C A;  4MGR A;  4HX4 A;  4LLL A;  2M5W A;  1DP7 P;  1KU9 A;  1I5Z A;  3I5U A;  3CO6 C;  5CYV A;  2F5C A;  2PI0 A;  1ZAO A;  3ROU A;  3F21 A;  1MKM A;  3ZMZ A;  2H6B A;  1P92 A;  3QRF F;  1JXS A;  2DBB A;  1IN5 A;  4WX9 A;  4MHG A;  1RI7 A;  2H27 A;  5LHG A;  4OIQ F;  4IXA A;  1ZRC A;  4EMS A;  4M71 A;  1KU2 A;  1EH8 A;  3K1M A;  3I64 A;  4EJT A;  3KLO A;  2LDU A;  4PGH A;  3ELK A;  4N9I A;  5H20 A;  1BIB A;  2IA1 A;  4JBA A;  3FXQ A;  4RGS A;  1J0R A;  3IRQ A;  4GXO A;  2K02 A;  1W7P B;  1EH6 A;  2ZME B;  3TO7 A;  5LEK A;  4OOI A;  1BM9 A;  4CIC A;  5LLQ A;  2DQL A;  1G6N A;  1U5T C;  4FX0 A;  3K69 A;  4H0E A;  1ON2 A;  3LA2 A;  4LJZ F;  3GX4 X;  4EV0 A;  3ZQ7 A;  3VB2 A;  1Z91 A;  2CO5 A;  2L02 A;  2VON A;  2X4H A;  3KZY A;  4RB3 C;  2ADU A;  2KIF A;  2JPC A;  4XSZ F;  4R8H A;  1LJ9 A;  4F7Z A;  3F23 A;  2GA2 A;  3KZZ A;  2VC0 A;  1OPC A;  3V4G A;  3LST A;  1LDK B;  3K1N A;  4KIG A;  1O3T A;  3GFI A;  4Z2Y A;  3W6J B;  3F22 A;  5FO5 A;  1O3Q A;  4A0X A;  3R61 A;  3WTZ A;  4BQA A;  1ZH5 A;  3DQV C;  1NHA A;  3GZ5 A;  1U5T A;  4ESF A;  2ZBK A;  4ASN A;  3MCZ A;  4ENJ A;  2FOK A;  3I59 B;  4QLC U;  4KMU X;  1AOY A;  5DUI A;  3N97 A;  1BJA A;  5DYM A;  1ONV A;  1R7J A;  2EK5 A;  3KP7 A;  1FYM A;  2EA4 A;  2RV8 A;  4JQF A;  2R7D A;  4UVA A;  1FP2 A;  3MZY A;  1CGP A;  2W24 A;  1UB9 A;  4PZJ A;  1LEB A;  4XLN F;  4EJV A;  2ZFW A;  4XSX F;  1KQ8 A;  4M9S A;  4OMY A;  2A68 F;  1LQ1 A;  3BJA A;  5E8I A;  2PQ8 A;  2KIM A;  4LK1 F;  5LGU A;  3EUH A;  5HOO A;  1F9N A;  4KFC A;  2VT2 A;  2VXZ A;  2VC1 A;  2K7L A;  3FM3 A;  5FB2 A;  2GAU A;  4FHT A;  3F3X A;  1TNS A;  4ENK A;  5LRR A;  3G73 A;  2A61 A;  1B4A A;  3M9A A;  2R7F A;  3CUQ C;  5BQT A;  2M30 A;  1R1U A;  3E6D A;  1IN7 A;  4PCQ A;  1SD5 A;  4HF0 A;  3TO6 A;  1IRG A;  1QNT A;  2OZU A;  4G7H F;  2HKO A;  4L9V A;  4D0P A;  3GFL A;  2A3S A;  2PEX A;  5E1Z B;  4FT8 A;  1ZRF A;  1Q1H A;  1YIO A;  3O3K A;  4M73 A;  1QZZ A;  5F1R A;  3DXJ F;  1A04 A;  1HXD A;  3Q5F A;  1XCV A;  2R3S A;  2IA0 A;  1IXC A;  1MJB A;  3WU1 B;  4UV8 A;  1QPM A;  1JGS A;  1FP1 D;  3F8F A;  1YTY A;  2EFQ A;  2P5K A;  4AWX B;  3GFM A;  3E3V A;  2UWM A;  4WWC A;  2O0Y A;  3EYY A;  1KU3 A;  4M74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...