2L3DA

The solution structure of the short form swirm domain of lsd1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
GSVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific histone demethylase 1A
publication title The chemical shift assignment of the SWIRM domain of LSD1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l3dA00
1XMKA 2M8EA 3CJNA 2H27A 1CGPA 5HLHA 2M1BA 4LG0B 2GAUA 5EEGA 1R00A 4Y15A 1XDSA 1QO0D 4A0YA 1K6OA 2DPUA 3GZ6A 5D4SA 1F1ZA 2CW0F 4EJTA 2XASA 1Z1DA 3C3WA 2VE9A 3J7AO 2VT2A 4BQAA 5LGUA 3BY6A 5CYVA 3ZN0A 4EMSA 1P4WA 1WQ2A 2WV0A 3DV8A 4L9VA 1IN6A 3MEXA 4HV6A 4HLXA 4WF2A 1FT9A 3V4GA 2EV0A 3ABTA 4XSXF 3TOAA 1U5TB 5D5WB 1R1UA 3HOTA 1HBXG 3WTSC 3CO6C 2M5WA 1P4XA 1PP7U 2LF7A 4K2EA 4B8XA 1F5TA 5D6EA 4CO8A 2H09A 3MQ0A 3L2CA 3CLOA 4G7ZF 4LG0A 4I2OA 4L0ZB 3F8FA 2EFWA 1R1TA 5ICFA 2DLLA 2RV8A 4UHTA 3BDDA 3ERED 2HQRA 4KN4X 3MZYA 3T8TA 2FF4A 3KZZA 3LQQA 1GHCA 2DT5A 3M9AA 1W7PB 4G7OF 2MC3A 4S05A 4WXCA 1U5TA 3N4MA 4GYGA 1R22A 3IL2A 1XD7A 3LWFA 1ZG3A 1KQ9A 1O3RA 4KNYA 4Y17A 4P9UA 3L9FA 6PAXA 5FLXZ 1ON2A 2A3SA 3MWMA 3COAC 4HV5A 2XROA 2HWVA 1FWZA 2ELHA 4Y13A 2EV6A 2ZO4A 4LK0F 2LNBA 4M74A 3ZN1A 4EGZA 4ESBA 1ZG5A 2H94A 4IHSA 1OMIA 2EFPA 4H0EA 4YIIA 1Z6RA 1XB4A 1W7PA 1FNNA 4L9TA 3I5UA 3I54A 1I1SA 2RQPA 4U0VA 2X4HA 4TV7A 2RGVA 1TQIA 1O57A 3TO9A 3IWFA 4A6DA 4L0YB 2W24A 1HKQA 1LEAA 1R1VA 3JTGA 3E6MA 2EB7A 3P9CA 5HLIA 3G3ZA 4GXOA 1XSXA 2X0LA 1FSEA 3ECHA 2EA2A 1YYVA 4CGZA 4FT8A 4HAMA 1S7AA 4OOIA 1J9IA 3ULQB 4ETSA 2TDXA 5KK1A 3GFIA 1B9MA 1SFEA 5D6FA 1IN4A 3LFKA 3VOEA 4U88A 5F64A 5HLGA 1QNTA 3T5XA 4PGGA 1IW7F 4A12A 4I0AA 3T0YA 3WODF 4EJVA 4HDUA 2FNPA 5HS9A 3LQRA 1ZRDA 4YFXF 2QQBA 1IXSB 3GFMA 2NNYA 5D5XB 2DO7A 4WCGA 2YSRA 1BI2A 4KMUX 1IRGA 2L3DA 1Z7UA 3RI4A 3KFWX 4LB5A 2W25A 1DDNA 2D2WA 4HLYA 4IVNA 5ILUA 1R23A 3PFIA 1IXCA 4WXDA 1W7PD 2HKOA 4DNCA 2MA3A 3KLOA 2G9WA 1W4MA 5ILVA 2FNAA 1VTNC 5FLXK 3HSEA 2R7FA 3FWEA 2M45A 2MBFA 3TO7A 1LNWA 1I5ZA 3BPVA 4UXNA 2BEOA 4IHTA 5ICGA 1BN5A 2VOPA 1JHHA 1LVAA 2KJBA 4U7DA 2EWNA 2XAGA 3SHFA 1K78B 5E1WA 1BBYA 1J5YA 1O3TA 2ACJA 3CDHA 3R60A 1YLFA 3DPTA 3V7RA 4Q5SF 1E17A 2F5CA 3KP7A 2DPDA 4GO1A 3BP8A 1ZREA 3J81Z 2O6GE 2VONA 1OKRA 1QZYA 1RUNA 5LRSA 2A5YB 1IN8A 5EEHA 5HDNA 4U0YA 2JPCA 3BPXA 3TQNA 1FP2A 4O3MA 4MNUA 2QUFA 3R0JA 2IRFG 4XRFA 2NNNA 2DFIA 2HS5A 1K78A 3BROA 1Z6TA 3E6DA 1Z9CA 1WKMA 2RNJA 2Q0OA 1MJ9A 3JTHA 1R58A 2XRNA 2K86A 2PN6A 1F4KA 1ODDA 4HX7A 4UV9A 3WGGA 4G94A 5KVRA 1DP7P 2UWMA 4KICA 2ETHA 4HW0A 5HS8A 5FB2A 2HTSA 2FEZA 1YW7A 1SMTA 5FD5A 5ICEA 4ESJA 3ZMSA 4BHCA 1ON1A 2EFOA 4M6YA 1ZLJA 3PQJA 2CGPA 4M72A 2EFNA 4G6QA 1FC3A 3F8MA 1W5SA 1TQMA 3HRMA 2KIMA 2K27A 3OV8A 1JGSA 1HSTA 4G7HF 5TJJA 2DAOA 2DBBA 3M8FA 4HA8A 1MDMB 1SMYF 2DK8A 4WWCA 4JBAA 2EA4A 3C7JA 1F9NA 1OYWA 1OPCA 2Z5UA 5LGTA 3KP2A 1ZLKA 4CHUA 2KJCA 3S2WA 4Z2YA 2HEOA 5LGNA 5D8LB 3FZVA 1ONVA 3QRFF 3DF8A 3LA7A 4M6XA 2DK5A 1B9NA 3QPHA 1IF1A 2DW4A 4LFUA 3GZ5A 3J81K 1H9GA 1ZRCA 4FHTA 4BYYA 5LBQA 1U3EM 3FX3A 3WTZA 1AOYA 3LSTA 1USSA 1MDMA 1PP8F 3QOPA 2COMA 3CUQC 1ZN2A 2A07F 1D8KA 1REPC 1J2XA 4OMYA 4AIHA 3WTVC 2AS5F 4G9YA 2XIGA 1YQAA 3WE2A 1T2KA 2BGCA 2MLKA 1IZ1A 3GVAA 1B6AA 2DQLA 3ML6A 4UUVA 1WWXA 1BC8C 3QU6A 5JHUA 5HDKA 5IT9Z 3ZMVA 2Y0MA 2R7DA 5JR3A 1HSJA 3R4KA 1O3SA 3FMQA 4CZZA 2PEXA 3ELKA 1T0FA 2K4JA 1O7LA 2Y75A 2KRFA 1P4AA 3MFKA 5CVUA 2FXAA 3G73A 2H6BA 3W6JB 2IW5A 1RUOA 2P6SA 1MJAA 3JW4A 4FX0A 4HZFA 3U2RA 5HS7A 4PZJA 3VEPA 3VFZA 1XMAA 2F5FA 3J80K 1GXPA 3KP4A 3V8JA 4BHBA 3P7NA 2PLYA 2VBZA 1WRJA 3ZMUA 2ZFWA 4GCVA 4YFNF 3IRQA 2QBYB 1D8JA 1XGSA 4HDVA 2C6YA 2XHKA 3AAFA 4ZYDA 3WTWC 2EV5A 4CDGA 2KKOA 2GXBA 5BPIA 2FMYA 1KU2A 1ZARA 4AIJA 2VBWA 1TBXA 3ZPLA 1S8NA 1ZRFA 4I01A 3K2ZA 4U7BA 5A2QZ 3LA2A 2FBIA 2V1UA 1UHWA 2K7LA 4M9SA 4R1HA 2V79A 2ZNZA 4KT5C 3E5QA 1BI3A 2JPBA 4NHJA 4Q48A 2Z3YA 2QBYA 3C18A 1UFMA 4M9XA 1HW5A 3K9TA 2HTJA 4Q4ZF 3ZMDA 1YW9A 1SD6A 1ZAOA 2E1CA 4LD5A 4UNOA 1TQPA 5F1RA 2FRHA 1I1GA 2XAFA 3CUOA 5LEJA 2FBKA 4IPAA 2A6EF 4QWQA 2PMHA 1OR7A 2BBYA 5CVVA 4KA4A 1FY7A 5IT9K 1A04A 1LDDA 1B4AA 3DQVC 3FF5A 5E8IA 2BE5F 2FQ3A 2MLGA 1R5GA 3FM5A 4GYIA 1RZ4A 3RPUA 3FXRA 1G3SA 4HYEA 4ZZLA 4FX4A 1H9TA 2Q2EA 4HF0A 5JVTA 2EFQA 4A5MA 4BNCA 2RC4A 4EM0B 3FMSA 1KQ8A 1XSDA 4L5IA 3RYPA 3EDPA 3KETA 2E7XA 4M71A 4I98B 1HXDA 3GUDA 1FX7A 3F6VA 4S04A 4IXAA 2DTRA 3IRRA 1YS6A 1EH8A 1U2WA 5BQTA 3TKYA 3ZQ7A 1TTYA 3BJOA 4ENMA 1UB9A 4IRHA 1WI9A 3IKTA 1LEBA 1ZGAA 1UCRA 3MAJA 4B09A 2GWRA 3I59B 4ENNA 2Z99A 3KP5A 5LHIA 4PGHA 3RKWA 4EM1A 3BZ6A 3GEZA 2G7HA 2IVMA 2GXGA 2OA4A 1XSVA 3DFGA 2NAZA 1J75A 3GLXA 1FYMA 4AVPA 1XCVA 4G8XA 2PI0A 3H3ZA 3RTRA 2PFBA 4RAYA 3SFZA 5A2QK 5DD8A 4OIRF 3EETA 2VBYA 3Q9SA 3M7GA 4JK1X 2ESHA 3V8KA 3RDIA 3DPLC 4QLCU 1Y0UA 3ECOA 4RB2C 2GQQA 4UV8A 1D5VA 3U1DA 2IPQX 5JI6A 2P4WA 2LSOA 1G3YA 4MTDA 2MD5A 3I59A 2VBXA 3M1EA 5ICCA 2IP2A 4LMYA 3ZMZA 2NRAC 3I4PA 2CYYA 1G6NA 1KA8A 4ZYGA 3KZYA 1HW1A 3VODA 4HQMA 3FMRA 2CWEA 4LLLA 1B1BA 2PMUA 2ZKZA 3V7SA 3D5LA 2HYGD 4LB6B 2HQNA 2P8TA 3GF2A 3LAJA 3K1MA 2VOOA 2HGCA 1RIOH 1T38A 3I53A 2GZWA 4AD9A 1EH6A 4RB1A 5FFZA 1IAWA 4OINF 3QP5A 1G3TA 5K5OA 3K69A 2HKXA 4OU0A 1IXRC 2L4MA 3MCZA 2E1NA 1YFHA 2J5OA 5L3DA 2OU2A 4MHGA 3HSFA 1Z05A 3RKYA 1XCBA 2QWWA 2Y48A 3HHGA 1Q1HA 5DCMB 2OAZA 1SAXA 3TO6A 4EQQA 5CJ9A 4OIPF 3F8BA 4HF2A 2FA5A 2ZXJA 2DQRA 4LLNA 3FM3A 2H6CA 2A68F 2YPRA 3F3XA 2JZYA 1K79A 3FXUA 4KUMA 3R61A 2W85A 4A2UA 3EYYA 4YFKF 1B59A 4L18B 4BHPA 1JXSA 3K1PA 2OD5A 4P55A 1E2XA 2CSOA 5E1ZB 1DPUA 2P7CB 3EYIA 3CTAA 2P6TA 2QQ9A 1JHFA 2FOKA 4LK1F 1BJAA 2D1VA 2PQ8A 5DCMA 1RI7A 2JSCA 3JAMZ 1QZZA 4CXFA 4P96A 4KIBA 4NB5A 4RB3C 4ZZDA 2P5VA 3E97A 3C1DA 2D1HA 3IHUA 4P5OA 3L7WA 4EJOA 4PCQA 1SD7A 4HX8A 3KEOA 3HSRA 2JRTA 2MH9A 1S6LA 5LEKA 1XDUA 2QVOA 2VXZA 5D5VB 1I27A 2V1XA 4I0BA 2W84A 3QAHA 1LDJA 3QPTA 4I7HA 2ISYA 3KE2A 2K4BA 1TNTA 2IA0A 4MEXF 2L02A 2WTEA 3L09A 3R6SA 2OBPA 3BWGA 4KDPA 2HZTA 3WU1B 1MJBA 2HR3A 1V3FA 1ZHFA 1P6RA 2A6HF 2YX7A 1R5HA 3NQOA 3DXJF 3EQLF 5FGMA 5H20A 3KP3A 1BI0A 4EV0A 2PG4A 1FBQA 1FBSA 1FYKA 2O3FA 4P9FA 3KCCA 5LHHA 2L54A 3IC7A 2QLZA 4L9JA 5CVIA 4BAYA 4KN7X 2IJLA 5DEQA 2NYXA 5HDGA 1HKSA 2AXLA 3TDUC 4RGSA 3E3VA 4ZYHA 1FLIA 5FD6A 2BV6A 3K0LA 3V8LA 3RJPA 1U5TC 3DP7A 3GFLA 4R79A 1RNLA 4YG2F 2FSWA 5JFRA 4HBLA 3O6BB 3K1NA 5AIPA 1PDNC 2VN2A 4MQVA 3GXOA 1H0MA 3I64A 1XGMA 3CUQB 2HDCA 1MZBA 5IT3A 3HRUA 1NHAA 1R36A 2EJRA 1LDKB 3JAMK 2XUBA 2CG4A 3BOQA 2F5DA 1U6GA 4MTEA 1HKTA 2Z9OA 4OIQF 1FSHA 3B02A 2GA1A 2LKPA 3GWZA 1P2FA 4L5JA 4ENJA 1L0OC 2PBIA 2V9VA 1GVJA 2EK5A 1P92A 2FMLA 5K5RA 2ZNYA 3I71A 4LJZF 5DD4A 3CUQA 3EUHA 3WTXC 5DUIA 2XVCA 4EM2A 4CYDA 3LAPA 3F21A 2XV4S 5FO5A 2O61A 3NRVA 4E70A 1TW3A 3Q5FA 3SQNA 3N97A 2FU4A 3ZP5A 4IF4A 3VB2A 2RVCA 4ASNA 4UVBA 3E6BA 3WG9A 3GYHX 1T39A 3L00A 1MGTA 1XGOA 2QZ8A 4RS8A 3TOBA 5LHGA 2IT0A 2UXXA 2L01A 2O0YA 3WGHA 3F23A 5L3CA 2RN7A 1FPQA 2LF8A 1QGPA 2GIVA 4IRIA 5H6QA 5ED4A 1S7OA 2P7VB 2Q8KA 2UZKA 2ZCWA 5J8CA 4ZH4F 3MZHA 1YTYA 1J7KA 1SD4A 2Z33A 5CVJA 4M9ZA 4F7ZA 3OOPA 4IJAA 5E18F 4DQ2A 5E1XA 5BOXA 4Q47A 2KIUA 1U8RA 4A0ZA 4XSZF 5DUKA 3KEQA 1KYZA 2RDPA 5HVQC 3R0AA 1K7AA 2WC2A 1T6SA 2YX4A 3IWZA 4RGXA 3P9IA 2DI3A 1BI1A 3H3UA 2CO5A 1J59A 2VT3A 4N9HA 1YW8A 5ERIA 5D5UB 1SD5A 3I0TA 3LA3A 3H92A 4ESFA 4BXUA 2LDUA 3GFJA 4IRGA 5CLSA 1S29A 4HX4A 2QYOA 2ESNA 2XAJA 4XLNF 3WE3A 1TNSA 1BIAA 3TGNA 3SZTA 2RKHA 2HFHA 2DU9A 1MD0A 2PJPA 1G4DA 4UVCA 5LLQA 3B73A 1KU7A 2ZBKA 3W6KB 2KIFA 4G6DA 2VODA 4RGUA 4XLPF 3QU3A 2O03A 2XAHA 1BOAA 4L9NA 1J0RA 1ULYA 2P5LC 2ZJ2A 1OYYA 1IUYA 2GA2A 2K02A 3E6CC 4A6EA 1DPRA 1IN7A 2JTVA 1TLHB 3DEUA 3WTTC 3U9GA 1BM9A 1QPMA 4U0WA 3HHHA 2IA1A 3DKWA 3HIFA 3IKVA 2O8XA 2OZUA 4KYWA 5E17F 1G3WA 3ROUA 1W5TA 4KFCA 4AWXB 5BS6A 4KIFA 2L4AA 1YIOA 5D4RA 3F22A 5DDGA 4HF1A 2JT1A 4M73A 4PDKA 3JSOA 1L3LA 2ADUA 3HRTA 3KP6A 1XN7A 1Z91A 2XKOA 4YIFA 1KQ0A 2A61A 2XKPA 5L3EA 3GO5A 5AONA 2WWYA 5FFXA 2R3SA 1LQ1A 4HOBA 1EH7A 1T98A 1KYWA 2BYVE 4ENKA 2XAQA 3FXQA 1JE8A 3RIRA 1X3UA 2F2EA 2B0LA 1ZYRF 1I6XA 3M8EA 5DYMA 3F6OA 3WTUC 2STWA 1FP1D 2YU3A 3P9KA 1BIBA 3ABUA 3WTYC 2CFXA 1U78A 1ZH5A 2V1DA 4OMZA 5TRDA 5BPDA 3E5XA 3HOSA 3REOA 1YO5C 3E5UA 2P5KA 1IN5A 1C0WA 1FBUA 1D3YA 2UXNA 4I02A 4UVAA 5AIQA 1QBJA 1FZPB 4O5VA 5DV5A 1WSUA 1AWCA 1STZA 1XGNA 4R8HA 4OIOF 3RYRA 4NQWA 1YS7A 1LJ9A 3F8CA 5DCFA 5L3GA 3QP6A 4O6JA 1TW2A 1UHMA 5HOOA 4EGYA 3GX4X 4ZYEA 1S3JA 2XGXA 1DUXC 2A69F 2ISZA 5ILSA 2F5EA 5BMZA 5L3BA 3GW2A 3SZPA 4HQEA 2QENA 3RPQA 4GGGA 2YR2A 1FOKA 3HRSA 3O3KA 1SFUA 1R7JA 5J8FA 1CF7B 1USTA 4MQ9F 4ON0A 3V7CA 2OZ6A 1OYIA 5K1YA 5J6XA 4MGRA 2STTA 1O3QA 4N9IA 1LB2A 2CQKA 3I58A 4LLGF 2HOEA 5H6RA 3JSPA 2OQRA 2ZMEB 3FHZA 4WX9A 2V6CA 3HUGA 2FBHA 2J5PA 3NEUA 2QQAA 2OQGA 3BJ6A 2D45A 1KU9A 3J80Z 5F6FA 4KMFA 4A5NA 4KIGA 3HTUA 3ISPA 5K5QA 5E8GA 1MKMA 1CF7A 4EJUA 1KU3A 3HTSB 3F8NA 3CO7C 5LRRA 3D0SA 4LGWA 3ZMTA 2E7WA 2VC0A 4D0PA 4WXHA 1YG2A 4WK8F 2VC1A 4N0BA 4RAZA 1BC7C 2M87A 1GXQA 2G7UA 4EJWA 2ZMEA 1PUEE 3SXYA 3Q9VA 1O7FA 4A0XA 5CVRA 1IRFA 3F72A 3T8RA 2MH2A 3KLNA 4I09A 1EV7A 2FE3A 1HW2A 2W57A 3WU0A 1FYLA 4RB0A 3O2PE 1ZG1A 5E20A 1V4RA 2IA2A 3PQKA 4AIKA 4RGRA 5L3FA 1QQIA 3T1BA 2QM3A 2M30A 4BH9A 4JQFA 3BJAA 4XBFA 3HYIA 3TDZC 2VE8A 1ZGJA 2NS0A 1SFXA 4MEYF 3RKXA 4EVIA 5D8KB 2HYFA 1KGSA 1HQCA 3WGIA 4CICA
chains in the Genus database with same CATH superfamily
1XMKA 3HPGA 3ESWB 1WCMJ 1SAUA 2M8EA 3CJNA 2H27A 1CGPA 1WZ2A 3H9GA 1UZCA 4HPQA 2NVQJ 5HLHA 2QCOA 2M1BA 3KEYA 4LG0B 1FIPA 2GAUA 5EEGA 1R00A 4Y15A 3UKGA 1XDSA 1QO0D 4A0YA 1U9NA 3IH3A 3GTPJ 5JLWA 1K6OA 2PMZN 2DPUA 1VI0A 3GZ6A 5D4SA 1DP3A 1W36D 1F1ZA 1ERDA 2CW0F 4V2GA 4EJTA 1LUJB 2KPMA 2XASA 3D1NI 1Z1DA 2LG4A 1IGNA 4V19K 3C3WA 2VE9A 3J7AO 2VT2A 4BQAA 2E36A 2WB1N 3CJRB 5LGUA 3BY6A 5CYVA 2H8RA 3ZN0A 2JUGA 1P4WA 4EMSA 1WQ2A 3DLAA 1WJ5A 2WV0A 3DV8A 1LVKA 4L9VA 3S93A 1IN6A 3MEXA 1UG0A 4HV6A 3AL0C 2G0EA 4HLXA 4WF2A 2JUCA 2NOJB 4YEJA 1FT9A 5FKMA 3V4GA 2EV0A 1XX5A 2M0MA 3ABTA 4XSXF 1JGGA 3TOAA 1U5TB 2OTJI 3S1MJ 3FIWA 3OYEA 5D5WB 2QGUA 1R1UA 1T08B 3HOTA 4RBOA 1HBXG 3WTSC 3CO6C 2M5WA 1P4XA 2BW3B 1W0UA 3OYCA 1PP7U 2LF7A 4K2EA 4AUXA 2IS2A 4B8XA 3DTIA 1F5TA 2ME0A 5D6EA 4CO8A 3MVPA 2H09A 1T56A 3MQ0A 1P7JA 3L2CA 1JI8A 3CLOA 4G7ZF 4LG0A 4I2OA 1A6QA 4LIVA 4DBRA 4L0ZB 3F8FA 4NC8A 1R1TA 2EFWA 4EEFG 1YX3A 5ICFA 2MABA 2DLLA 2RV8A 3Q3SA 4UHTA 4YIRX 3BDDA 3OSFA 2WB1A 3OYDA 1ZR2A 2L0KA 2HQRA 2L2OA 3ERED 4KN4X 4XRSG 4M3BA 3MZYA 2VKDA 1BR1A 3M07A 3T8TA 5FKOA 2EZHA 2FF4A 3KZZA 1X3ZB 3LQQA 4AC0A 1GHCA 3S15J 2L7MP 2DT5A 1VF9A 3M9AA 1W7PB 2VJ4A 2CUFA 4G7OF 1RRJA 2MC3A 4S05A 3AG4H 4MO7A 3DWLE 2ELJA 4IOCF 3K4BA 2OJED 3SJMA 2Y0SN 4WXCA 1U5TA 3N4MA 4DOZA 4GYGA 1R22A 3Q0UA 3IL2A 2BW3A 1XD7A 3LWFA 1ZG3A 5TISC 2BXZA 2IAIA 1KQ9A 3H9QA 5M3FJ 1O3RA 4KNYA 4Y17A 4P9UA 3L9FA 5GPAA 1P9QC 3DBRB 3FK7A 6PAXA 2R7OA 5FLXZ 1ON2A 2A3SA 4IHWA 3MWMA 3COAC 3DU5A 4HV5A 2H8WA 2XROA 1ETYA 2HWVA 1FWZA 3ABLH 3OYNA 1OCPA 2ELHA 4Y13A 2EV6A 2ZO4A 4HRIA 4LK0F 4BACA 2LNBA 2JMWA 4M74A 3ZN1A 4EGZA 4ESBA 1ZKGA 2A05A 3A2KA 2Z2SB 1ZG5A 2H94A 4IHSA 1OMIA 2EFPA 3IUOA 4NC7A 4H0EA 4YIIA 1Y8RB 5GTHC 2E1MB 1Z6RA 4XNFA 1M1EB 1XB4A 1W7PA 5F08A 1E3OC 1FNNA 4L9TA 3L2UA 3I5UA 3I54A 2JN6A 1I1SA 3S2HJ 3I9V2 1MMSA 2E19A 2RQPA 4HNTA 1XS9A 2GBYA 4U0VA 4A3EJ 2X4HA 1N77A 1N25A 2R7SA 3CF5F 2O9LA 2CV2A 4TV7A 4BJ6C 1TWFJ 2RGVA 1TQIA 1AA7A 1O57A 2CU7A 3TO9A 5J3LA 3OL4A 3IWFA 4A6DA 4L0YB 4MLOA 2W24A 5B66C 3PO2J 2JA2A 4E7SA 1HKQA 4PJMA 1RR7A 1TP4A 4V2FA 1LEAA 1ZK8A 1R1VA 2QSFX 3E6MA 3OR2C 3JTGA 1Y8QB 2EB7A 4XONA 1ZGWA 3P9CA 5HLIA 4UY8I 3G3ZA 4C2TA 1R9TJ 3IH4A 4GXOA 1XSXA 2X0LA 2P81A 1FSEA 3ECHA 2EA2A 2K40A 2KIQA 1YYVA 2ZJQF 4CGZA 4FT8A 4HAMA 1B72B 3L1PA 2M34A 1S7AA 4OOIA 1J9IA 3ULQB 2HXOA 5LFAA 3F0CA 2FD5A 3H1CA 4ETSA 2TDXA 2NS8A 5KK1A 3LSPA 3GFIA 3PJRA 4D5FA 2F4OB 4C30A 2HVQA 1B9MA 2KRHA 4XKVA 1SFEA 5D6FA 1IN4A 3V42A 3LFKA 3VOEA 4U88A 2E2IJ 5F64A 5HLGA 1QNTA 3T5XA 3QYFA 4PGGA 1IW7F 4A12A 4I0AA 3T0YA 3WODF 3FDYA 4EJVA 2FNPA 4XRSA 4HDUA 2H1KA 5HS9A 3LQRA 3BG3A 3HZJA 1ZRDA 1S9HA 4A3BJ 2QQBA 4YFXF 4X0GA 1IXSB 3NAUA 1Z3YA 3GFMA 2QA4I 2NNYA 1OCTC 5D5XB 2DO7A 4DYCA 2HXIA 1H88C 4WCGA 2YSRA 2EINH 1BI2A 4KMUX 1IRGA 4XLEA 3S16J 2L3DA 1Z7UA 4D5CA 3RI4A 3KFWX 2DT6A 4LB5A 2BVLA 2W25A 4IO9F 2HVSA 1DDNA 2D2WA 4HLYA 1FIAA 2LVSA 4IVNA 2E60A 5ILUA 4XKBA 1R23A 1D0YA 3PFIA 1IXCA 3TEDA 4CH7A 2QKMB 4WXDA 1PJRA 3QWLA 1B72A 1W7PD 2HKOA 2CUZA 2FQ4A 1OJLA 1SVMA 1WH7A 4DNCA 2MA3A 3KLOA 2W4SA 2G9WA 1W4MA 1W1WE 2WY8Q 1T95A 3G1LA 3RPUD 5ILVA 3JRHA 2FNAA 1RC9A 5HODA 1VTNC 3H5AA 5FLXK 1VQ8I 3BR5A 2R7FA 3HSEA 4QPOA 4JX5A 3CZ6A 2JWTA 4LIUA 2R7UA 3FWEA 2M45A 3ZQHA 2MBFA 5EZHA 4N4NB 2MC4A 1WVRA 3TO7A 3QODA 2VUMJ 1GVDA 1LNWA 4J00A 1I5ZA 4OAZA 3BPVA 4UXNA 2R7TA 2BEOA 3FBIB 4A3IJ 2BVMA 3BG7A 4B43A 2ZFUA 3RCOA 4IHTA 5ICGA 1GLNA 5IOYA 1BN5A 3QYBA 2VOPA 1JHHA 2Y9ZA 1LVAA 1YHQI 2KJBA 4AU7A 4U7DA 2IS6A 2EWNA 2XAGA 1JT0A 3SHFA 2HNHA 1K78B 1TT5B 5E1WA 4DZJA 2XAUA 1BBYA 1APLC 1J5YA 1OISA 3HB9A 1O3TA 2X6OA 3A0HC 3U21A 2ACJA 2DOFA 2VIXA 2NXNB 3CDHA 1YLFA 3KPHA 3R60A 4C3IJ 2FUG2 1U9OA 3DPTA 1VQPI 3V7RA 4Q5SF 1RETA 1E17A 2F5CA 3KP7A 1XG1A 4XIDA 2DPDA 4RAFA 1IJWC 5M3MJ 4GO1A 3BP8A 1ZREA 3D5SC 4CCJA 4QIWN 1VQ5I 3OYIA 2XGDA 3CDIA 3EUAA 3J81Z 4FTHA 4E7HA 4G12A 2O6GE 2VONA 1OKRA 1QZYA 1RUNA 2R7VA 5LRSA 2Y2ZA 2A5YB 1DGWY 5C4JJ 1IN8A 5EEHA 5HDNA 4U0YA 4CCKA 2JQ7A 2Z1DA 3G1OA 2JPCA 3BPXA 3TQNA 5CPRB 1FP2A 2GLOA 4O3MA 5CQEA 1R71A 2R7XA 3W3CA 1N78A 1X19A 1SVOA 4MNUA 2QUFA 3R0JA 2IRFG 4ZYAA 4XRFA 4L5EA 2NNNA 2DFIA 2HS5A 2V4JC 3BR1A 3MMYB 1JKOC 1K78A 3BROA 1Z6TA 3E6DA 3J7ZI 1Z9CA 1WKMA 2RNJA 2Q0OA 1MJ9A 3JTHA 2EIJH 2B9SA 1NK3P 2DCEA 4BL0B 1R58A 3ABMH 3QPSA 2KRCA 2M0CA 2XRNA 1KZHA 2LP0A 3CQZJ 1VQ9I 2K86A 2PN6A 1F4KA 1ODDA 4HX7A 1MW7A 1BR2A 5IP6A 3GLLA 2E34A 1VQ6I 4UV9A 3WGGA 4RAGA 4G94A 5KVRA 3VYRB 4ZTFA 5C3EJ 4FASD 5K7ZA 1DP7P 2UWMA 2VJJA 2ETHA 4KICA 5HNHA 2GM4A 4HW0A 4FQGA 2IGNA 5HS8A 1X1AA 2HTSA 1MMDA 2FEZA 5FB2A 1YW7A 1SMTA 2M3AA 1HF0A 5FD5A 2JVHA 5ICEA 2E35A 4ESJA 3VYSB 3ZMSA 1V5GA 4BQNA 2E71A 3OIOA 4BHCA 1POGA 1ON1A 2CW7A 1JJ6C 4P1WA 1DQUA 2EFOA 4M6YA 1ZLJA 3PQJA 4X1EA 3LFUA 2CGPA 4M72A 2EFNA 2K3PA 4G6QA 1FC3A 3GTMJ 3LMMA 3F8MA 3ZQCA 1W5SA 2XF5A 4OWRB 2LMDA 1TQMA 3K4NA 2E5NA 3HRMA 1B8IA 3MZ8A 2KIMA 2K27A 1OQYA 3OV8A 1JKRC 1JGSA 1MH3A 2F5VA 4A93J 1X2MA 1HSTA 4G7HF 3CP2A 1QVUA 5TJJA 4LOCA 2DAOA 2DBBA 2DMPA 3M8FA 3K7AJ 3HM5A 4HA8A 1MDMB 1SMYF 2DK8A 4WWCA 4JBAA 2EA4A 4XOTA 3C7JA 1F9NA 1WJBA 1OYWA 3S1NJ 5GADJ 1OPCA 3CCUI 2X1EA 2M8GX 1VQMI 2Z5UA 2DOAA 3TMOA 5LGTA 3KP2A 1Y1WJ 1ZLKA 1IDYA 2KJCA 4CHUA 2M4GA 2AQEA 4II2A 3S2WA 4Z2YA 1YJWI 2HEOA 3TP3A 1K6YA 5LGNA 1IC8A 2O7OA 5D8LB 1TT0A 3FZVA 3Q0WA 3J7AY 1X58A 5K7HA 2D5VA 1JUPA 1ONVA 5DS9A 3QRFF 3DF8A 3I3LA 2JSPA 3WHBA 2M7AA 1LE8B 3LA7A 1YIJI 3PNVA 4M6XA 2DK5A 1B9NA 3QPHA 1IF1A 4KJZA 2DW4A 2MG4A 3CESA 3GZ5A 4LFUA 3ZQGA 3J81K 1H9GA 1ZRCA 2DA6A 2F48A 3I56I 1UG2A 4FHTA 2I5UA 1VQOI 4XLFA 4BYYA 1WI3A 5LBQA 1U3EM 2VPRA 2LKXA 3FX3A 3WTZA 2B7EA 1EF4A 3ZRGA 1AOYA 3LSTA 1USSA 1MBEA 1MDMA 1PP8F 3QOPA 1G8XA 2COMA 4B3AA 3BT9A 3CUQC 2R5ZB 3EUHC 3SDGA 4GFBA 2ZJPF 1GDTA 3QOEA 1ZN2A 2A07F 5E79C 1D8KA 1REPC 1J2XA 3MD2A 4XK4A 2LREA 5IPAA 4OMYA 4AIHA 3D5RC 2ID3A 1WJAA 2LC2A 3WTVC 4OAYA 2AS5F 4KITB 4G9YA 2XIGA 5KAIC 3ZQIA 4BQOA 1YQAA 4BJ5C 3WE2A 1T2KA 2IGKA 1VNDA 2F4MB 2L9NA 2OCCH 3GMEA 3MKWB 2BGCA 2JK3A 3FBNB 5F1JA 2K9NA 2MLKA 3CCMI 2AO9A 1IZ1A 3GVAA 2N8GA 1B6AA 2JA5J 2DDBA 1LE8A 2DQLA 1I50J 3ML6A 3PNYA 4UUVA 1WWXA 4IQJA 1BC8C 3QU6A 2ECBA 5HDKA 5JHUA 1MBJA 5IT9Z 1MMNA 3ZMVA 2Y0MA 2R7DA 5JR3A 1HSJA 2M7BA 3R4KA 3OYKA 1O3SA 3FKJA 5GP9A 3FMQA 4CZZA 2PEXA 3ELKA 1T0FA 2K4JA 4BU2A 2L5QA 2HOAA 1O7LA 2Y75A 2KRFA 1S7EA 2ZXWH 1P4AA 5IP7J 3MFKA 2R5ZA 5CVUA 2FXAA 3G73A 1FTZA 4IHXA 1E3HA 3AG2H 2H6BA 1GV2A 3W6JB 1QVTA 1ZQ3P 2IW5A 1Y1VJ 1RUOA 4IHYA 2P6SA 3BQYA 3CDLA 1MJAA 4D7MA 2VJIA 3JW4A 1BA5A 4FX0A 4DBQA 4C9YA 3DTKA 2KLOA 1JKQC 1D5YA 4HZFA 2MW8A 3OOUA 3U2RA 2R93J 2VKVA 2A6TA 5HS7A 4PZJA 3VEPA 3VFZA 3K4MA 1XMAA 3K70D 2BHZA 1K4SA 2F5FA 3J80K 1GXPA 1UMQA 2RNGA 3KP4A 1DU0A 3V8JA 4BHBA 3DEEA 3BR6A 2MYSA 3P7NA 3OYLA 2PLYA 1VQ7I 2VBZA 3QYEA 1WRJA 1H89C 3ZMUA 3IP4B 1VQLI 2ZFWA 4GCVA 2LRDA 2YU9J 4YFNF 1MMAA 5IYBJ 2R4GA 3IRQA 2QBYB 1D8JA 3BTLA 1XGSA 3C2BA 4HDVA 2IBDA 2XGEA 2C6YA 2XHKA 5FRNA 3KIOA 1X1PA 3AAFA 2DFHA 4ZYDA 3WTWC 1HCRA 2EV5A 4CDGA 1V5EA 2KKOA 2Y31A 2GXBA 1HA8A 5BPIA 2FMYA 2WAFA 4I99C 1KU2A 1ZARA 4AIJA 2Y9YA 2L7ZA 5J47A 2VBWA 4AYBN 1TBXA 3ZPLA 1S8NA 1ZRFA 4XLHA 4I01A 2ZXHA 3HOVJ 3K2ZA 2Z16A 4U7BA 5A2QZ 1N75A 3LA2A 4DJAA 2FBIA 2V1UA 4B48A 4MFEA 1MSFC 1UHWA 2K7LA 1TC3C 1LKXA 4GDFA 4LITA 4M9SA 4R1HA 2KZGA 2V79A 1BL0A 4BGDA 2ZNZA 4KT5C 3TL4X 2HDWA 3E5QA 1BI3A 2JPBA 2Q2EB 4NHJA 3M1CA 4Q48A 2KHMA 4HSRA 4M3FA 2BXYA 1MBGA 2Z3YA 2QBYA 3C18A 3RZOJ 1UFMA 1BOBA 4JOMA 2MD0A 4U87A 4M9XA 3A0BC 1HW5A 4ITVA 1U8BA 2VQGA 3K9TA 2HTJA 4Q4ZF 1YITI 4A3GJ 1WHUA 3ZMDA 1YW9A 1SD6A 1ZAOA 3K4JA 2E1CA 3LSIA 4LD5A 1TWHJ 2IGMA 4J19A 2TCTA 4UNOA 1TQPA 1NG7A 4AYBA 2WAEA 2FRHA 5F1RA 1I1GA 2XAFA 2L9SA 3I55I 1HDPA 3PM1A 2KDOA 3CUOA 5LEJA 2VB6A 2FBKA 4RM3A 4BEHB 4IPAA 2A6EF 4IX7A 4QWQA 4BBSJ 2PMHA 1OR7A 5F0HA 2BBYA 5CVVA 2R7ZJ 4XORA 1W5CC 4KA4A 2OUMA 1FY7A 5IT9K 1A04A 1LDDA 1B4AA 2Y69H 3DQVC 3FF5A 5E8IA 2A5WA 4C2MJ 4BE0A 2BE5F 2FQ3A 1A6IA 2MLGA 1R5GA 4FE4A 2QF7A 3FM5A 2VKHA 2LBFB 4G6TB 5KAFC 4GYIA 1RZ4A 3RPUA 3FXRA 2KQRA 1G3SA 3BR3A 4HYEA 3H9JA 4ZZLA 2X51A 4FX4A 3DBLB 2LTPA 2X6XA 2Q2EA 1H9TA 1IG7A 4HF0A 2LY2A 3BTIA 4E7ZA 5JVTA 2EFQA 4A5MA 4BNCA 1F43A 2RC4A 4EM0B 2W7NA 3FMSA 1KQ8A 1XSDA 4L5IA 3RYPA 3EDPA 3KETA 2O8KA 2ZC2A 2XRLA 2E7XA 2LK2A 4M71A 2HI3A 4I98B 1HXDA 1E0EA 1Q1VA 3GUDA 1FX7A 4JX6A 1VFCA 2DJIA 1IDZA 3BCBA 1BW5A 1YRNB 5FKNA 3F6VA 3WU2C 4S04A 2CQNA 3WHCA 4IXAA 2DTRA 3IRRA 4E7KA 4BEHA 1YS6A 1YJ9I 4PFPA 1EH8A 1U2WA 5BQTA 4UUSB 3TKYA 3ZQ7A 3L2RA 3CD6I 1TTYA 3BJOA 4ENMA 5EYRA 1UB9A 4IRHA 1WI9A 3OR1C 3HC7A 3IKTA 1LEBA 1ZGAA 1UCRA 1GV5A 1QHGA 3MAJA 2LBFA 2EZKA 3KX2A 3H3VK 4B09A 1KONA 2GWRA 4F52A 2UUZA 3I59B 1ETOA 5H2FC 3JRCA 4ENNA 1I6HJ 2Z99A 3KP5A 5LHIA 2CQQA 4PGHA 3RKWA 3HOUJ 1WFXA 3CJTB 2QSHX 4EM1A 3BZ6A 3DKYA 2DMNA 3GEZA 3L2VA 2G7HA 2IVMA 2RREA 4JYKA 2GXGA 1QHHD 2OA4A 5M5WJ 1XSVA 5J40A 4FE7A 2X1CA 3X2QH 3GTOJ 3GTLJ 3DFGA 2NAZA 4B3XA 1J75A 1XPXA 3GLXA 2YS9A 3H5RA 1FYMA 2X9DA 1A35A 4AVPA 1XCVA 4G8XA 2PI0A 3H3ZA 3RTRA 3PL8A 2PFBA 1YRNA 4RAYA 3SFZA 5A2QK 1TWGJ 1OLTA 1Y6IA 3PSIA 5DD8A 2LY1A 1AU7A 4OIRF 3EETA 2EH3A 2VBYA 3Q9SA 3M7GA 3SDBA 2K5CA 4JK1X 2F6CA 4UUSA 1QU3A 3VYTB 2ESHA 3V8KA 3RDIA 2ZXIA 3DPLC 3PNTA 4QLCU 3CC7I 3BZKA 1Y0UA 1QA6A 1T8IA 3ECOA 4RB2C 2GQQA 3LSMA 3FISA 4UV8A 4AIDA 1D5VA 3S3NA 1D1BA 4PJJA 3CF2A 3W2VA 4XRMA 2AQFA 2JA7J 3U1DA 2IPQX 5JI6A 2P4WA 2LSOA 1JT6A 1G3YA 3EUKL 2CS3A 3ASNH 4MTDA 2MD5A 3I59A 2VBXA 2GIZA 2DXIA 5HNFA 1JTXA 2DA3A 3M1EA 3L2WA 3FXLA 5ICCA 2IP2A 4C2UA 2EQRA 4LMYA 2KZVA 2MFZA 1NG6A 2Q1ZB 3ZMZA 1JUSA 2NRAC 3I4PA 2CYYA 1IV8A 4II3A 3ZQLA 2WY7Q 1J09A 1G6NA 1KA8A 1TL8A 3OIPA 5DTDA 3JRDA 4LG3A 4ZYGA 3MKZA 3KZYA 1HW1A 3JREA 3VODA 5J1UA 2KMUA 1X1DA 3FMRA 4HQMA 2CWEA 4LLLA 1B1BA 3CP8A 2QQ8A 2E1OA 2PMUA 2ZKZA 2XDVA 3A4CA 3V7SA 3D5LA 3TP0A 2HQAA 1DGRM 2HYGD 2VJ5A 2HQNA 3K6GA 4LB6B 2P8TA 3GF2A 3LAJA 5JHFA 3HKZN 3K1MA 3ZOBA 2VOOA 1GT0C 4XKWA 2DYRH 3G6EI 1FEXA 2HGCA 1RIOH 4IHVA 1VZ0A 2JVGA 4M3EA 1T38A 1VQ4I 3I53A 2GZWA 3HBLA 4AD9A 4N4OB 2V6EA 1EH6A 4RB1A 5E3LA 1X3WB 5FFZA 2EILH 1IAWA 1XTAA 3BCAA 4XR6A 2X48A 4JP0A 4OINF 3UNGC 2HVRA 1OCCH 3QP5A 2DMQA 1G3TA 5K5OA 2H1LA 3K69A 5M5YJ 4B1RA 2QEXI 2HKXA 4OU0A 1IXRC 2KFDA 2L4MA 3MCZA 2E1NA 1YFHA 4HG2A 1MSEC 2J5OA 5L3DA 2NVTJ 1W36C 2OU2A 4MHGA 3ZQFA 3HSFA 3ABKH 1Z05A 3CJQB 4BQQA 3OYAA 3OS1A 3RKYA 1XCBA 3GTQJ 2QWWA 2Y48A 3HHGA 2DMTA 1Q1HA 2R92J 5DCMB 2R7QA 3HKZA 2IEKA 5KCMA 5C44J 3JRAA 2OAZA 5GAHJ 1SAXA 3TO6A 4D1QA 3RKQA 1SVLA 5HLTA 3CCJI 4EQQA 5J4YA 2ZMEC 4PSXA 5CJ9A 5EG0B 3S17J 4XQFA 3JRGA 4I6ZA 4OIPF 1UJ8A 3F8BA 4HF2A 4PK4A 2FA5A 2LY9A 2ZXJA 2DQRA 2JJ7A 4DGWB 3CCQI 4LLNA 3FM3A 2H6CA 3ONQA 5J1RA 3CMEI 2A68F 2VLAA 4A3KJ 2YPRA 3F3XA 5JLXA 2JZYA 1X4PA 3CCLI 1K79A 3FXUA 3ASOH 4KUMA 3R61A 3BG6A 2P0WA 1MBHA 4H4KC 2W85A 1T33A 4JX4A 4A2UA 3EYYA 2X1DA 4YFKF 1B59A 4L18B 4BHPA 1V55H 3LSHA 3K4LA 1JXSA 2XPWA 3DKXA 2OD5A 3K1PA 4BXXJ 4BY1J 4B4CA 4P55A 1E2XA 2CSOA 2NS7A 4RDUA 2FOWA 5E1ZB 4CYCB 2P7CB 1ETQA 4PSWA 1DPUA 3A02A 3EYIA 3S14J 4BJTA 2RAEA 2HQ5A 3CTAA 2P6TA 2QQ9A 2COBA 2HYJA 3CCSI 2W00A 1JHFA 3ZQQA 2FOKA 4LK1F 1BJAA 2D1VA 2PQ8A 5DCMA 4XLCA 1RI7A 2JSCA 3JAMZ 1QZZA 1ZELA 2EZIA 4CXFA 5EF6A 4P96A 1V5FA 4KIBA 4UB8C 1Y0NA 1WJDA 4UUTA 3HGGA 4NB5A 3OYMA 2TRTA 2DA5A 5EG0A 4ZZDA 4RB3C 4ZDOA 2P5VA 2LLKA 3E97A 4XM3A 3C1DA 2D1HA 3IHUA 2DFEA 2NOGA 3OYFA 1FOYA 4P5OA 3L7WA 1AKHB 1I3QJ 4EJOA 4PCQA 1SD7A 4HX8A 3KEOA 2X6YA 1IUFA 3C2GA 1T0FC 3HSRA 2JRTA 2MH9A 1S6LA 5LEKA 1YE9A 1FJLA 1XDUA 1IV6A 2QVOA 2VXZA 3OY9A 3S8PA 5D5VB 3S3MA 4CUGA 1I27A 2V1XA 2FJ1A 4PUSA 3I4MJ 3SZGA 4C3HJ 3SEZA 4I0BA 2W84A 3QAHA 1LDJA 1MIJA 2XSDC 3QPTA 3HXLA 1E3PA 4HNVA 3BC8A 3IH2A 4I7HA 2ISYA 3KE2A 4CYCA 1D0XA 2MGQA 2K4BA 1WJFA 3AFHA 1TNTA 2X85A 2IA0A 2NVXJ 1O4XA 3HPHA 4MEXF 2DA4A 2XSJC 2L02A 4Y33A 2K9SA 2WTEA 3PFYA 3L09A 3JRIA 2DODA 1SEUA 3R6SA 1S5LC 2OBPA 5LD2C 4IQ4A 2HOSA 3BWGA 2FX0A 4KDPA 2HZTA 3WU1B 1MJBA 2HR3A 5BNGA 3VYUB 3P5JA 5F0CA 1R5ID 2VXDA 3OMYA 1V3FA 2L9VA 3CC4I 4ABZA 2CW8A 2ECCA 1S72I 1ZHFA 1P6RA 2A6HF 2YX7A 1R5HA 1AKHA 3NQOA 3DXJF 3GTKJ 5EEAA 1Z77A 3MKLA 3EQLF 5FGMA 1YOVB 5H20A 1XC5A 3KP3A 1BI0A 3BLYA 4EV0A 2PG4A 1FBQA 1FBSA 5CKTA 1R6RA 5GAGJ 1FYKA 1UAAA 2HZDA 2O3FA 1MMGA 5IYCJ 4P9FA 3KCCA 1RKTA 2EZLA 2V9KA 5LHHA 4ZDLA 2L54A 3HDDA 3IC7A 5KNLA 2XPUA 2QLZA 4L9JA 5CVIA 4BAYA 3NARA 4KN7X 2IJLA 5DEQA 2NYXA 4B47A 2ME6A 5HDGA 3HOXJ 1HKSA 2AXLA 3TDUC 4RGSA 3E3VA 4ZYHA 3A03A 1FLIA 5FD6A 2BV6A 5FKKA 3K0LA 4Y4RA 3NWSA 4CSWA 3V8LA 3RJPA 5E3NA 1U5TC 4XLAA 2V9PA 3DP7A 5F0FA 1XMXA 4EATA 4F55A 4CZCA 3GFLA 4R79A 1RNLA 4YG2F 3PO3J 2FSWA 5JFRA 4HEA2 4HBLA 4YELA 3O6BB 4A3JJ 2B63J 5FJ8J 3GCMA 3K1NA 2VPLA 5AIPA 1PDNC 2VN2A 3AG1H 4MQVA 2EIKH 3GXOA 5K7FA 1H0MA 1YX5A 4PJNA 4S0HB 3I64A 1XGMA 3BQZA 3CUQB 4BKXA 2HDCA 3S1RJ 2RQQA 2ZJRF 1MZBA 1WH5A 2DJNA 2Y30A 4AM3A 2CRGA 5IT3A 2E2JJ 3HRUA 1NHAA 4NUBA 1Z67A 2DMUA 1R36A 2EJRA 4XN3A 1LDKB 3JAMK 3FHNA 2ICWG 2CH0A 1UELB 2XUBA 2WV1A 2CG4A 3BOQA 2F5DA 1U6GA 3GZNB 4MTEA 3HOZJ 1OR7C 4RA2A 2BOLA 1HKTA 4DIQA 3SYTA 2I10A 5IY5H 2Z9OA 4OIQF 1VQKI 4CCNA 5B1BH 1FSHA 3B02A 2GA1A 2LKPA 2L7KA 2CFOA 3OIQA 3GWZA 1P2FA 2XC7A 3DPUA 3K10A 3BTCA 3HEFA 4L5JA 1OCZH 4ENJA 1L0OC 2YUSA 3LNQA 2PBIA 2DA2A 4F92B 2V9VA 2DA1A 1GVJA 2IGOA 4HSTA 2EK5A 5DM7F 1P92A 2FMLA 3QQAA 2ZNYA 5K5RA 1WGXA 3I71A 4LJZF 5DD4A 2LKSA 3CUQA 3EUHA 4BXFA 3WTXC 5DUIA 3B6AA 2XGCA 2XVCA 4ZC3A 1D0ZA 4EM2A 2PMZA 4E7LA 1WPKA 4CYDA 3LAPA 2BHYA 3F21A 2XV4S 3CCYA 5IOZA 3G4SI 2L7FP 5FO5A 2O61A 1U0JA 5EJCA 4IOAF 1FMVA 1SFKA 2HOTA 2CQXA 3NRVA 4E70A 2LFBA 3HOYJ 3AL0B 1TW3A 3Q5FA 3SQNA 3N97A 3JR9A 4NNJA 2FU4A 1P7IA 3ZP5A 3JRFA 4IF4A 3VB2A 2RVCA 2E1MC 4ASNA 2JA6J 2VQHA 4UVBA 3E6BA 3WG9A 3GYHX 1T39A 3L00A 4ANJA 1MGTA 4RMNA 1XGOA 1NH3A 2QZ8A 4RS8A 3TOBA 3VPRA 4RM2A 5LHGA 2WA0A 2K85A 2XF6A 2IT0A 2UXXA 3AG3H 2L01A 2O0YA 1FMWA 3OL3A 3CCVI 1R4MB 3B6CA 3TW6A 3WGHA 3F23A 1RPWA 5L3CA 2RN7A 2LH9A 1FPQA 2HDDA 4CA0A 2LF8A 1LFPA 1QGPA 2GIVA 3LSGA 5H6QA 5ED4A 1S7OA 4IRIA 2P7VB 2Q8KA 2UZKA 2ZCWA 2HPIA 3HG9A 1JKPC 1HC8A 5J8CA 4ZTJA 4ZH4F 1MBKA 1UHSA 2ZSHB 3MZHA 1YTYA 4D9JA 3LSKA 1J7KA 3DBHB 1K4TA 4I76A 4KISA 4QSHA 1SD4A 3WG7H 3LSJA 2Z33A 4NC6A 5CVJA 4M9ZA 3S32A 2WADA 4F7ZA 3OOPA 5J4VA 2R5YB 4YRVA 3CCEI 1I3AA 4IJAA 5E18F 4DQ2A 5E1XA 5BOXA 3CMAI 2EBIA 2WAQN 2ZSIB 4Q47A 1EA3A 2KIUA 3QPLA 3PSFA 4CCMA 1Y56A 2IS4A 5GAEJ 2CV1A 1U8RA 4W97A 4A0ZA 4BE1A 1JTYA 4XSZF 5DUKA 1PUFB 3KEQA 1KYZA 3NWTA 2RDPA 3OWTA 1ETWA 3E1SA 5HVQC 4GRIA 3R0AA 3IV5A 1SANA 4E6KG 2V1NA 3OS2A 1K7AA 3OSGA 2WC2A 2JRMA 1T6SA 2YX4A 3JRBA 3AKZA 3IWZA 2XB5A 5FKLA 2PX9A 5FRMA 3C2HA 2Y0SA 4RGXA 3P9IA 1WJEA 3W6VA 2DYSH 2CMPA 2DI3A 1BI1A 4MFDA 1ZR4A 3H3UA 2CO5A 1J59A 3PIOF 2VT3A 4N9HA 4Y52J 1YW8A 5ERIA 5D5UB 4QPQA 5F04A 1G2HA 4RLQA 4DYRA 2OTLI 1SD5A 3I0TA 3LA3A 1X4OA 2OF7A 3BTJA 4A3DJ 3H92A 2KISA 1HDDC 3K2AA 4ESFA 4BXUA 3H0DA 2LDUA 2R0QC 2WAQA 3GFJA 2CV0A 4IRGA 3MN2A 5CLSA 1S29A 4HX4A 2QYOA 2ESNA 1F36A 2KL4A 2XAJA 1BR4A 4XOPA 4XLNF 3WE3A 2R5YA 3M3YJ 3BG5A 1TNSA 1BIAA 4F91B 4M3DA 3TGNA 3SZTA 2E5ZA 3DU6A 4W1UA 2V26A 2RKHA 5B5EC 4QTRA 2HFHA 2DU9A 1MD0A 1PUFA 2PJPA 3HJEA 5EGOB 1G4DA 4UVCA 3RQIA 3B73A 5LLQA 1KU7A 2ZBKA 4UB6C 3W6KB 4E7IA 2ID6A 4PJ0C 4IL6C 2KIFA 2MSYA 2DDAA 3GTGJ 5DM6F 3H0GJ 3MKYB 2W48A 2KP6A 2BY2A 3F9KA 4G6DA 2VODA 4RGUA 4XLPF 4AVZA 1K83J 3QU3A 1RESA 2O03A 2XAHA 4DW6A 2W1OA 1CQTA 3DLLF 4XN0A 1BOAA 4L9NA 4XL9A 1J0RA 3RZDJ 2VL8A 1MNDA 1ULYA 2P5LC 1A5JA 2DFFA 2ZJ2A 1OYYA 1IUYA 2GA2A 2K02A 3E6CC 4A6EA 3OYHA 1R49A 1DPRA 1IN7A 1OCRH 1ACIA 2JTVA 1TLHB 4IZZA 3DEUA 1LPQA 4IEJA 3WTTC 3U9GA 1BM9A 1QPMA 4U0WA 4J01A 2LD5A 3HHHA 2V7FA 2IA1A 3DKWA 3HIFA 3IKVA 2O8XA 3BR2A 5M5XJ 2OZUA 4M6VA 4D7NA 4ZJZA 4KYWA 5E17F 1G3WA 3SEQA 5FLMJ 1DU6A 3FXKA 3ROUA 2OCEA 1W5TA 2DA7A 4NDLA 2OC6A 4AWXB 5BS6A 3LSRA 5EGOA 4KFCA 4KIFA 4CCLA 1MH4A 2L4AA 2L9RA 3IAS2 1YIOA 5D4RA 3F22A 3G1MA 5DDGA 9ANTA 5FLVA 1IO2A 4HF1A 2IXSA 2JT1A 2GXAA 3JCUC 5KHDA 2BY1A 4M73A 2M9HA 4PDKA 2KDZA 3E7LA 2K9MA 2CQ7A 3UR3C 3JSOA 2X6WA 2AHQA 1L3LA 2K3FA 1GUUA 4XICA 3FXOA 2ADUA 1FOWA 1ETVA 3HRTA 3KP6A 2XF7A 1XN7A 1Z91A 2XKOA 2GOMA 4YIFA 1KQ0A 2A61A 2XKPA 1SC7A 5L3EA 2K9QA 2UV1A 3GO5A 5AONA 2WBMA 2WWYA 5FFXA 2R3SA 5GTIC 4CCOA 1LQ1A 4HOBA 1EH7A 1T98A 2M2EA 3A01B 4BS9A 1KYWA 2BYVE 4ENKA 1ITYA 2XAQA 5EDNA 3G71I 3FXQA 3CMMA 3H5NA 1JE8A 1MNMC 4F93B 3W2WA 2CUJA 1WJCA 4PJLA 3RIRA 1X3UA 2F2EA 1LFUP 2B0LA 4BUPA 2OPTA 2LYCA 4NQWB 1A31A 2XPVA 3ZGKA 1ZYRF 1YI2I 4PFOA 3TBIA 1NTCA 4FISA 2NVUB 1I6XA 2ELKA 3M8EA 5DYMA 1QZEA 3BZCA 3PUBA 3F6OA 4NBQA 3RSNA 4M3GA 3WTUC 2STWA 1FP1D 1OCOH 1ETXA 2YU3A 3O8GA 3P9KA 1BIBA 3ABUA 1Z21A 3WTYC 2CFXA 1U78A 1ZH5A 2V1DA 4OMZA 2LR8A 5TRDA 1ENHA 2VI6A 3SFIA 2I8DA 5BPDA 3E5XA 2DN0A 3N05A 3HOSA 3REOA 1YO5C 3E5UA 2P5KA 2K9LA 4RLFA 1IN5A 1C0WA 5B1AH 1FBUA 5TGTA 3W2AA 1D3YA 1IRXA 2QSGX 1VQNI 1TWCJ 2UXNA 4I02A 4Z6YA 5FROA 4Y3OA 4UVAA 5AIQA 1QBJA 3A01A 1FZPB 4O5VA 2GOXB 1IRZA 3BR0A 5DV5A 3I4NJ 4XKCA 1X1BA 2M4KA 1WSUA 1AWCA 1STZA 1PYVA 1LFBA 1HOMA 1XGNA 4R8HA 3U1KA 4FCYA 1H8AC 4OIOF 3K70C 3RYRA 3E0JB 4NQWA 4IKFA 1YS7A 1LJ9A 3F8CA 5DCFA 5L3GA 3A1YA 4A3LJ 3HL2A 1R4NB 3H36A 2OV7A 3QP6A 4O6JA 3VSKA 1Y39A 1BW6A 1TW2A 1UHMA 2QKLB 5HOOA 3HUGB 4EGYA 5IYDJ 1TZLA 3GX4X 4ZYEA 1B8IB 4MIMA 2XGXA 1S3JA 2DT7B 1BJZA 1DUXC 2A69F 2ISZA 5ILSA 1OFCX 2F5EA 5BMZA 5IP9J 5L3BA 3GW2A 3SZPA 4HQEA 2QENA 3RPQA 3LL7A 1V54H 2DOEA 2VQCA 2IS1A 4GGGA 3RQ4A 2JA8J 2YR2A 1MBFA 1D1CA 1FOKA 3HRSA 1HLVA 2EIMH 4BDZA 3O3KA 1SFUA 3HGYA 2NVYJ 1R7JA 3ERMA 1FTTA 5J8FA 1CF7B 1PVEA 1USTA 4MQ9F 4ON0A 4F3QA 3PUFA 3V7CA 5E3MA 4DYQA 3S2DJ 2OZ6A 3FXJA 3M8JA 3VWBA 3GTJJ 3KYDB 2DTZA 1OYIA 5K1YA 5J6XA 3S1QJ 4MGRA 3VSLA 4BBRJ 2CJJA 3KZIC 3CCRI 2STTA 5GPCA 1O3QA 2R7RA 4N9IA 1LB2A 3OS0A 3K4CA 3FKIJ 2LOOA 3K4KA 2CQKA 3I58A 4LLGF 3Q0VA 2HOEA 5H6RA 3JSPA 1JJ8C 2OQRA 3TW7A 3ZR8X 2ZMEB 3DEWA 3FXMA 3FHZA 3FK6A 3O8HA 1ETKA 2XB0X 3KYLA 4KT6A 1RKWA 4A3MJ 3GBGA 4A69C 4WX9A 2V6CA 3HUGA 2FBHA 1MNEA 2J5PA 3NEUA 2QQAA 2OQGA 3BJ6A 3OYBA 2D45A 1QRYA 1KU9A 1G59A 3J80Z 5F6FA 4KMFA 2PJRB 1ZTRA 3G2BA 1SFOJ 4A5NA 1FOXA 4KIGA 3HTUA 4B44A 4C3JJ 3ZXSA 1I39A 3ZCOA 3ISPA 5K5QA 5E8GA 3LOCA 1AHDP 3S3OA 1MKMA 1CF7A 3IAM2 2ZB9A 1EJ9A 2O5RA 5EZGA 2BZTA 5CQGA 2HPMA 3CC2I 3EPZA 1RR8C 2R7WA 4EJUA 1KU3A 1Z7LA 3HTSB 4ZDPA 1QPIA 3F8NA 3CO7C 3D0SA 4LGWA 5LRRA 3ZMTA 2E7WA 2VC0A 4D0PA 4X6AJ 4WXHA 2F4IA 1YG2A 2EPFA 4WK8F 2VC1A 3CMYA 1K61A 4N0BA 4RAZA 1BC7C 2M87A 1GXQA 2G7UA 2VQLA 4EJWA 2ZMEA 1PUEE 3SXYA 3Q9VA 3BG9A 5E3OA 1O7FA 1D1AA 2VASA 4A0XA 5CVRA 1X1CA 1IRFA 3F72A 3T8RA 2MH2A 3L2QA 1ORKA 3KLNA 3DCFA 4E4HA 2W82A 4I09A 1EV7A 1A36A 1TWAJ 2FE3A 4A3FJ 1HW2A 3KYCB 2W57A 2HU9A 3WU0A 1FYLA 2VKEA 4RB0A 2PJRA 1W0TA 3O2PE 5C4XJ 1ZG1A 3M4OJ 4Y7NJ 1YJNI 5J1YA 3HOWJ 5E20A 3PIPF 1V4RA 2IA2A 4BY7J 5B3SH 1NK2P 4XMYA 4HNUA 2E2HJ 3PQKA 4AIKA 5JVGF 4RGRA 3VDXA 1X2NA 2BY3A 5F27A 3DTEA 4FETA 5L3FA 2AXTC 1QQIA 3T1BA 2QM3A 2M30A 4BH9A 3H35A 4JQFA 3BJAA 4XBFA 1Z3XA 3HYIA 1EKEA 3CLQA 2BY0A 3J7YJ 4E7JA 4BDYA 2KT0A 4A3CJ 3TDZC 2VE8A 1ZGJA 2NS0A 4DZPA 4BE2A 1SFXA 4MEYF 3RKXA 2CUEA 4EVIA 5D8KB 3OYGA 1JUMA 2HYFA 1KGSA 1HQCA 3WGIA 4CICA 1Z0XA 3OYJA
chains in the Genus database with same CATH topology
1XMKA 2M8EA 3CJNA 2H27A 1CGPA 5HLHA 2M1BA 4LG0B 2GAUA 5EEGA 1R00A 4Y15A 1XDSA 1QO0D 4A0YA 1K6OA 2DPUA 3GZ6A 5D4SA 1F1ZA 2CW0F 4EJTA 2XASA 1Z1DA 3C3WA 2VE9A 3J7AO 2VT2A 4BQAA 5LGUA 3BY6A 5CYVA 3ZN0A 4EMSA 1P4WA 1WQ2A 2WV0A 3DV8A 4L9VA 1IN6A 3MEXA 4HV6A 4HLXA 4WF2A 1FT9A 3V4GA 2EV0A 3ABTA 4XSXF 3TOAA 1U5TB 5D5WB 1R1UA 3HOTA 1HBXG 3WTSC 3CO6C 2M5WA 1P4XA 1PP7U 2LF7A 4K2EA 4B8XA 1F5TA 5D6EA 4CO8A 2H09A 3MQ0A 3L2CA 3CLOA 4G7ZF 4LG0A 4I2OA 4L0ZB 3F8FA 2EFWA 1R1TA 5ICFA 2DLLA 2RV8A 4UHTA 3BDDA 3ERED 2HQRA 4KN4X 3MZYA 3T8TA 2FF4A 3KZZA 3LQQA 1GHCA 2DT5A 3M9AA 1W7PB 4G7OF 2MC3A 4S05A 4WXCA 1U5TA 3N4MA 4GYGA 1R22A 3IL2A 1XD7A 3LWFA 1ZG3A 1KQ9A 1O3RA 4KNYA 4Y17A 4P9UA 3L9FA 6PAXA 5FLXZ 1ON2A 2A3SA 3MWMA 3COAC 4HV5A 2XROA 2HWVA 1FWZA 2ELHA 4Y13A 2EV6A 2ZO4A 4LK0F 2LNBA 4M74A 3ZN1A 4EGZA 4ESBA 1ZG5A 2H94A 4IHSA 1OMIA 2EFPA 4H0EA 4YIIA 1Z6RA 1XB4A 1W7PA 1FNNA 4L9TA 3I5UA 3I54A 1I1SA 2RQPA 4U0VA 2X4HA 4TV7A 2RGVA 1TQIA 1O57A 3TO9A 3IWFA 4A6DA 4L0YB 2W24A 1HKQA 1LEAA 1R1VA 3JTGA 3E6MA 2EB7A 3P9CA 5HLIA 3G3ZA 4GXOA 1XSXA 2X0LA 1FSEA 3ECHA 2EA2A 1YYVA 4CGZA 4FT8A 4HAMA 1S7AA 4OOIA 1J9IA 3ULQB 4ETSA 2TDXA 5KK1A 3GFIA 1B9MA 1SFEA 5D6FA 1IN4A 3LFKA 3VOEA 4U88A 5F64A 5HLGA 1QNTA 3T5XA 4PGGA 1IW7F 4A12A 4I0AA 3T0YA 3WODF 4EJVA 4HDUA 2FNPA 5HS9A 3LQRA 1ZRDA 4YFXF 2QQBA 1IXSB 3GFMA 2NNYA 5D5XB 2DO7A 4WCGA 2YSRA 1BI2A 4KMUX 1IRGA 2L3DA 1Z7UA 3RI4A 3KFWX 4LB5A 2W25A 1DDNA 2D2WA 4HLYA 4IVNA 5ILUA 1R23A 3PFIA 1IXCA 4WXDA 1W7PD 2HKOA 4DNCA 2MA3A 3KLOA 2G9WA 1W4MA 5ILVA 2FNAA 1VTNC 5FLXK 3HSEA 2R7FA 3FWEA 2M45A 2MBFA 3TO7A 1LNWA 1I5ZA 3BPVA 4UXNA 2BEOA 4IHTA 5ICGA 1BN5A 2VOPA 1JHHA 1LVAA 2KJBA 4U7DA 2EWNA 2XAGA 3SHFA 1K78B 5E1WA 1BBYA 1J5YA 1O3TA 2ACJA 3CDHA 3R60A 1YLFA 3DPTA 3V7RA 4Q5SF 1E17A 2F5CA 3KP7A 2DPDA 4GO1A 3BP8A 1ZREA 3J81Z 2O6GE 2VONA 1OKRA 1QZYA 1RUNA 5LRSA 2A5YB 1IN8A 5EEHA 5HDNA 4U0YA 2JPCA 3BPXA 3TQNA 1FP2A 4O3MA 4MNUA 2QUFA 3R0JA 2IRFG 4XRFA 2NNNA 2DFIA 2HS5A 1K78A 3BROA 1Z6TA 3E6DA 1Z9CA 1WKMA 2RNJA 2Q0OA 1MJ9A 3JTHA 1R58A 2XRNA 2K86A 2PN6A 1F4KA 1ODDA 4HX7A 4UV9A 3WGGA 4G94A 5KVRA 1DP7P 2UWMA 4KICA 2ETHA 4HW0A 5HS8A 5FB2A 2HTSA 2FEZA 1YW7A 1SMTA 5FD5A 5ICEA 4ESJA 3ZMSA 4BHCA 1ON1A 2EFOA 4M6YA 1ZLJA 3PQJA 2CGPA 4M72A 2EFNA 4G6QA 1FC3A 3F8MA 1W5SA 1TQMA 3HRMA 2KIMA 2K27A 3OV8A 1JGSA 1HSTA 4G7HF 5TJJA 2DAOA 2DBBA 3M8FA 4HA8A 1MDMB 1SMYF 2DK8A 4WWCA 4JBAA 2EA4A 3C7JA 1F9NA 1OYWA 1OPCA 2Z5UA 5LGTA 3KP2A 1ZLKA 4CHUA 2KJCA 3S2WA 4Z2YA 2HEOA 5LGNA 5D8LB 3FZVA 1ONVA 3QRFF 3DF8A 3LA7A 4M6XA 2DK5A 1B9NA 3QPHA 1IF1A 2DW4A 4LFUA 3GZ5A 3J81K 1H9GA 1ZRCA 4FHTA 4BYYA 5LBQA 1U3EM 3FX3A 3WTZA 1AOYA 3LSTA 1USSA 1MDMA 1PP8F 3QOPA 2COMA 3CUQC 1ZN2A 2A07F 1D8KA 1REPC 1J2XA 4OMYA 4AIHA 3WTVC 2AS5F 4G9YA 2XIGA 1YQAA 3WE2A 1T2KA 2BGCA 2MLKA 1IZ1A 3GVAA 1B6AA 2DQLA 3ML6A 4UUVA 1WWXA 1BC8C 3QU6A 5JHUA 5HDKA 5IT9Z 3ZMVA 2Y0MA 2R7DA 5JR3A 1HSJA 3R4KA 1O3SA 3FMQA 4CZZA 2PEXA 3ELKA 1T0FA 2K4JA 1O7LA 2Y75A 2KRFA 1P4AA 3MFKA 5CVUA 2FXAA 3G73A 2H6BA 3W6JB 2IW5A 1RUOA 2P6SA 1MJAA 3JW4A 4FX0A 4HZFA 3U2RA 5HS7A 4PZJA 3VEPA 3VFZA 1XMAA 2F5FA 3J80K 1GXPA 3KP4A 3V8JA 4BHBA 3P7NA 2PLYA 2VBZA 1WRJA 3ZMUA 2ZFWA 4GCVA 4YFNF 3IRQA 2QBYB 1D8JA 1XGSA 4HDVA 2C6YA 2XHKA 3AAFA 4ZYDA 3WTWC 2EV5A 4CDGA 2KKOA 2GXBA 5BPIA 2FMYA 1KU2A 1ZARA 4AIJA 2VBWA 1TBXA 3ZPLA 1S8NA 1ZRFA 4I01A 3K2ZA 4U7BA 5A2QZ 3LA2A 2FBIA 2V1UA 1UHWA 2K7LA 4M9SA 4R1HA 2V79A 2ZNZA 4KT5C 3E5QA 1BI3A 2JPBA 4NHJA 4Q48A 2Z3YA 2QBYA 3C18A 1UFMA 4M9XA 1HW5A 3K9TA 2HTJA 4Q4ZF 3ZMDA 1YW9A 1SD6A 1ZAOA 2E1CA 4LD5A 4UNOA 1TQPA 5F1RA 2FRHA 1I1GA 2XAFA 3CUOA 5LEJA 2FBKA 4IPAA 2A6EF 4QWQA 2PMHA 1OR7A 2BBYA 5CVVA 4KA4A 1FY7A 5IT9K 1A04A 1LDDA 1B4AA 3DQVC 3FF5A 5E8IA 2BE5F 2FQ3A 2MLGA 1R5GA 3FM5A 4GYIA 1RZ4A 3RPUA 3FXRA 1G3SA 4HYEA 4ZZLA 4FX4A 1H9TA 2Q2EA 4HF0A 5JVTA 2EFQA 4A5MA 4BNCA 2RC4A 4EM0B 3FMSA 1KQ8A 1XSDA 4L5IA 3RYPA 3EDPA 3KETA 2E7XA 4M71A 4I98B 1HXDA 3GUDA 1FX7A 3F6VA 4S04A 4IXAA 2DTRA 3IRRA 1YS6A 1EH8A 1U2WA 5BQTA 3TKYA 3ZQ7A 1TTYA 3BJOA 4ENMA 1UB9A 4IRHA 1WI9A 3IKTA 1LEBA 1ZGAA 1UCRA 3MAJA 4B09A 2GWRA 3I59B 4ENNA 2Z99A 3KP5A 5LHIA 4PGHA 3RKWA 4EM1A 3BZ6A 3GEZA 2G7HA 2IVMA 2GXGA 2OA4A 1XSVA 3DFGA 2NAZA 1J75A 3GLXA 1FYMA 4AVPA 1XCVA 4G8XA 2PI0A 3H3ZA 3RTRA 2PFBA 4RAYA 3SFZA 5A2QK 5DD8A 4OIRF 3EETA 2VBYA 3Q9SA 3M7GA 4JK1X 2ESHA 3V8KA 3RDIA 3DPLC 4QLCU 1Y0UA 3ECOA 4RB2C 2GQQA 4UV8A 1D5VA 3U1DA 2IPQX 5JI6A 2P4WA 2LSOA 1G3YA 4MTDA 2MD5A 3I59A 2VBXA 3M1EA 5ICCA 2IP2A 4LMYA 3ZMZA 2NRAC 3I4PA 2CYYA 1G6NA 1KA8A 4ZYGA 3KZYA 1HW1A 3VODA 4HQMA 3FMRA 2CWEA 4LLLA 1B1BA 2PMUA 2ZKZA 3V7SA 3D5LA 2HYGD 4LB6B 2HQNA 2P8TA 3GF2A 3LAJA 3K1MA 2VOOA 2HGCA 1RIOH 1T38A 3I53A 2GZWA 4AD9A 1EH6A 4RB1A 5FFZA 1IAWA 4OINF 3QP5A 1G3TA 5K5OA 3K69A 2HKXA 4OU0A 1IXRC 2L4MA 3MCZA 2E1NA 1YFHA 2J5OA 5L3DA 2OU2A 4MHGA 3HSFA 1Z05A 3RKYA 1XCBA 2QWWA 2Y48A 3HHGA 1Q1HA 5DCMB 2OAZA 1SAXA 3TO6A 4EQQA 5CJ9A 4OIPF 3F8BA 4HF2A 2FA5A 2ZXJA 2DQRA 4LLNA 3FM3A 2H6CA 2A68F 2YPRA 3F3XA 2JZYA 1K79A 3FXUA 4KUMA 3R61A 2W85A 4A2UA 3EYYA 4YFKF 1B59A 4L18B 4BHPA 1JXSA 3K1PA 2OD5A 4P55A 1E2XA 2CSOA 5E1ZB 1DPUA 2P7CB 3EYIA 3CTAA 2P6TA 2QQ9A 1JHFA 2FOKA 4LK1F 1BJAA 2D1VA 2PQ8A 5DCMA 1RI7A 2JSCA 3JAMZ 1QZZA 4CXFA 4P96A 4KIBA 4NB5A 4RB3C 4ZZDA 2P5VA 3E97A 3C1DA 2D1HA 3IHUA 4P5OA 3L7WA 4EJOA 4PCQA 1SD7A 4HX8A 3KEOA 3HSRA 2JRTA 2MH9A 1S6LA 5LEKA 1XDUA 2QVOA 2VXZA 5D5VB 1I27A 2V1XA 4I0BA 2W84A 3QAHA 1LDJA 3QPTA 4I7HA 2ISYA 3KE2A 2K4BA 1TNTA 2IA0A 4MEXF 2L02A 2WTEA 3L09A 3R6SA 2OBPA 3BWGA 4KDPA 2HZTA 3WU1B 1MJBA 2HR3A 1V3FA 1ZHFA 1P6RA 2A6HF 2YX7A 1R5HA 3NQOA 3DXJF 3EQLF 5FGMA 5H20A 3KP3A 1BI0A 4EV0A 2PG4A 1FBQA 1FBSA 1FYKA 2O3FA 4P9FA 3KCCA 5LHHA 2L54A 3IC7A 2QLZA 4L9JA 5CVIA 4BAYA 4KN7X 2IJLA 5DEQA 2NYXA 5HDGA 1HKSA 2AXLA 3TDUC 4RGSA 3E3VA 4ZYHA 1FLIA 5FD6A 2BV6A 3K0LA 3V8LA 3RJPA 1U5TC 3DP7A 3GFLA 4R79A 1RNLA 4YG2F 2FSWA 5JFRA 4HBLA 3O6BB 3K1NA 5AIPA 1PDNC 2VN2A 4MQVA 3GXOA 1H0MA 3I64A 1XGMA 3CUQB 2HDCA 1MZBA 5IT3A 3HRUA 1NHAA 1R36A 2EJRA 1LDKB 3JAMK 2XUBA 2CG4A 3BOQA 2F5DA 1U6GA 4MTEA 1HKTA 2Z9OA 4OIQF 1FSHA 3B02A 2GA1A 2LKPA 3GWZA 1P2FA 4L5JA 4ENJA 1L0OC 2PBIA 2V9VA 1GVJA 2EK5A 1P92A 2FMLA 5K5RA 2ZNYA 3I71A 4LJZF 5DD4A 3CUQA 3EUHA 3WTXC 5DUIA 2XVCA 4EM2A 4CYDA 3LAPA 3F21A 2XV4S 5FO5A 2O61A 3NRVA 4E70A 1TW3A 3Q5FA 3SQNA 3N97A 2FU4A 3ZP5A 4IF4A 3VB2A 2RVCA 4ASNA 4UVBA 3E6BA 3WG9A 3GYHX 1T39A 3L00A 1MGTA 1XGOA 2QZ8A 4RS8A 3TOBA 5LHGA 2IT0A 2UXXA 2L01A 2O0YA 3WGHA 3F23A 5L3CA 2RN7A 1FPQA 2LF8A 1QGPA 2GIVA 4IRIA 5H6QA 5ED4A 1S7OA 2P7VB 2Q8KA 2UZKA 2ZCWA 5J8CA 4ZH4F 3MZHA 1YTYA 1J7KA 1SD4A 2Z33A 5CVJA 4M9ZA 4F7ZA 3OOPA 4IJAA 5E18F 4DQ2A 5E1XA 5BOXA 4Q47A 2KIUA 1U8RA 4A0ZA 4XSZF 5DUKA 3KEQA 1KYZA 2RDPA 5HVQC 3R0AA 1K7AA 2WC2A 1T6SA 2YX4A 3IWZA 4RGXA 3P9IA 2DI3A 1BI1A 3H3UA 2CO5A 1J59A 2VT3A 4N9HA 1YW8A 5ERIA 5D5UB 1SD5A 3I0TA 3LA3A 3H92A 4ESFA 4BXUA 2LDUA 3GFJA 4IRGA 5CLSA 1S29A 4HX4A 2QYOA 2ESNA 2XAJA 4XLNF 3WE3A 1TNSA 1BIAA 3TGNA 3SZTA 2RKHA 2HFHA 2DU9A 1MD0A 2PJPA 1G4DA 4UVCA 5LLQA 3B73A 1KU7A 2ZBKA 3W6KB 2KIFA 4G6DA 2VODA 4RGUA 4XLPF 3QU3A 2O03A 2XAHA 1BOAA 4L9NA 1J0RA 1ULYA 2P5LC 2ZJ2A 1OYYA 1IUYA 2GA2A 2K02A 3E6CC 4A6EA 1DPRA 1IN7A 2JTVA 1TLHB 3DEUA 3WTTC 3U9GA 1BM9A 1QPMA 4U0WA 3HHHA 2IA1A 3DKWA 3HIFA 3IKVA 2O8XA 2OZUA 4KYWA 5E17F 1G3WA 3ROUA 1W5TA 4KFCA 4AWXB 5BS6A 4KIFA 2L4AA 1YIOA 5D4RA 3F22A 5DDGA 4HF1A 2JT1A 4M73A 4PDKA 3JSOA 1L3LA 2ADUA 3HRTA 3KP6A 1XN7A 1Z91A 2XKOA 4YIFA 1KQ0A 2A61A 2XKPA 5L3EA 3GO5A 5AONA 2WWYA 5FFXA 2R3SA 1LQ1A 4HOBA 1EH7A 1T98A 1KYWA 2BYVE 4ENKA 2XAQA 3FXQA 1JE8A 3RIRA 1X3UA 2F2EA 2B0LA 1ZYRF 1I6XA 3M8EA 5DYMA 3F6OA 3WTUC 2STWA 1FP1D 2YU3A 3P9KA 1BIBA 3ABUA 3WTYC 2CFXA 1U78A 1ZH5A 2V1DA 4OMZA 5TRDA 5BPDA 3E5XA 3HOSA 3REOA 1YO5C 3E5UA 2P5KA 1IN5A 1C0WA 1FBUA 1D3YA 2UXNA 4I02A 4UVAA 5AIQA 1QBJA 1FZPB 4O5VA 5DV5A 1WSUA 1AWCA 1STZA 1XGNA 4R8HA 4OIOF 3RYRA 4NQWA 1YS7A 1LJ9A 3F8CA 5DCFA 5L3GA 3QP6A 4O6JA 1TW2A 1UHMA 5HOOA 4EGYA 3GX4X 4ZYEA 1S3JA 2XGXA 1DUXC 2A69F 2ISZA 5ILSA 2F5EA 5BMZA 5L3BA 3GW2A 3SZPA 4HQEA 2QENA 3RPQA 4GGGA 2YR2A 1FOKA 3HRSA 3O3KA 1SFUA 1R7JA 5J8FA 1CF7B 1USTA 4MQ9F 4ON0A 3V7CA 2OZ6A 1OYIA 5K1YA 5J6XA 4MGRA 2STTA 1O3QA 4N9IA 1LB2A 2CQKA 3I58A 4LLGF 2HOEA 5H6RA 3JSPA 2OQRA 2ZMEB 3FHZA 4WX9A 2V6CA 3HUGA 2FBHA 2J5PA 3NEUA 2QQAA 2OQGA 3BJ6A 2D45A 1KU9A 3J80Z 5F6FA 4KMFA 4A5NA 4KIGA 3HTUA 3ISPA 5K5QA 5E8GA 1MKMA 1CF7A 4EJUA 1KU3A 3HTSB 3F8NA 3CO7C 5LRRA 3D0SA 4LGWA 3ZMTA 2E7WA 2VC0A 4D0PA 4WXHA 1YG2A 4WK8F 2VC1A 4N0BA 4RAZA 1BC7C 2M87A 1GXQA 2G7UA 4EJWA 2ZMEA 1PUEE 3SXYA 3Q9VA 1O7FA 4A0XA 5CVRA 1IRFA 3F72A 3T8RA 2MH2A 3KLNA 4I09A 1EV7A 2FE3A 1HW2A 2W57A 3WU0A 1FYLA 4RB0A 3O2PE 1ZG1A 5E20A 1V4RA 2IA2A 3PQKA 4AIKA 4RGRA 5L3FA 1QQIA 3T1BA 2QM3A 2M30A 4BH9A 4JQFA 3BJAA 4XBFA 3HYIA 3TDZC 2VE8A 1ZGJA 2NS0A 1SFXA 4MEYF 3RKXA 4EVIA 5D8KB 2HYFA 1KGSA 1HQCA 3WGIA 4CICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMK A;  2M8E A;  3CJN A;  2H27 A;  1CGP A;  5HLH A;  2M1B A;  4LG0 B;  2GAU A;  5EEG A;  1R00 A;  4Y15 A;  1XDS A;  1QO0 D;  4A0Y A;  1K6O A;  2DPU A;  3GZ6 A;  5D4S A;  1F1Z A;  2CW0 F;  4EJT A;  2XAS A;  1Z1D A;  3C3W A;  2VE9 A;  3J7A O;  2VT2 A;  4BQA A;  5LGU A;  3BY6 A;  5CYV A;  3ZN0 A;  4EMS A;  1P4W A;  1WQ2 A;  2WV0 A;  3DV8 A;  4L9V A;  1IN6 A;  3MEX A;  4HV6 A;  4HLX A;  4WF2 A;  1FT9 A;  3V4G A;  2EV0 A;  3ABT A;  4XSX F;  3TOA A;  1U5T B;  5D5W B;  1R1U A;  3HOT A;  1HBX G;  3WTS C;  3CO6 C;  2M5W A;  1P4X A;  1PP7 U;  2LF7 A;  4K2E A;  4B8X A;  1F5T A;  5D6E A;  4CO8 A;  2H09 A;  3MQ0 A;  3L2C A;  3CLO A;  4G7Z F;  4LG0 A;  4I2O A;  4L0Z B;  3F8F A;  2EFW A;  1R1T A;  5ICF A;  2DLL A;  2RV8 A;  4UHT A;  3BDD A;  3ERE D;  2HQR A;  4KN4 X;  3MZY A;  3T8T A;  2FF4 A;  3KZZ A;  3LQQ A;  1GHC A;  2DT5 A;  3M9A A;  1W7P B;  4G7O F;  2MC3 A;  4S05 A;  4WXC A;  1U5T A;  3N4M A;  4GYG A;  1R22 A;  3IL2 A;  1XD7 A;  3LWF A;  1ZG3 A;  1KQ9 A;  1O3R A;  4KNY A;  4Y17 A;  4P9U A;  3L9F A;  6PAX A;  5FLX Z;  1ON2 A;  2A3S A;  3MWM A;  3COA C;  4HV5 A;  2XRO A;  2HWV A;  1FWZ A;  2ELH A;  4Y13 A;  2EV6 A;  2ZO4 A;  4LK0 F;  2LNB A;  4M74 A;  3ZN1 A;  4EGZ A;  4ESB A;  1ZG5 A;  2H94 A;  4IHS A;  1OMI A;  2EFP A;  4H0E A;  4YII A;  1Z6R A;  1XB4 A;  1W7P A;  1FNN A;  4L9T A;  3I5U A;  3I54 A;  1I1S A;  2RQP A;  4U0V A;  2X4H A;  4TV7 A;  2RGV A;  1TQI A;  1O57 A;  3TO9 A;  3IWF A;  4A6D A;  4L0Y B;  2W24 A;  1HKQ A;  1LEA A;  1R1V A;  3JTG A;  3E6M A;  2EB7 A;  3P9C A;  5HLI A;  3G3Z A;  4GXO A;  1XSX A;  2X0L A;  1FSE A;  3ECH A;  2EA2 A;  1YYV A;  4CGZ A;  4FT8 A;  4HAM A;  1S7A A;  4OOI A;  1J9I A;  3ULQ B;  4ETS A;  2TDX A;  5KK1 A;  3GFI A;  1B9M A;  1SFE A;  5D6F A;  1IN4 A;  3LFK A;  3VOE A;  4U88 A;  5F64 A;  5HLG A;  1QNT A;  3T5X A;  4PGG A;  1IW7 F;  4A12 A;  4I0A A;  3T0Y A;  3WOD F;  4EJV A;  4HDU A;  2FNP A;  5HS9 A;  3LQR A;  1ZRD A;  4YFX F;  2QQB A;  1IXS B;  3GFM A;  2NNY A;  5D5X B;  2DO7 A;  4WCG A;  2YSR A;  1BI2 A;  4KMU X;  1IRG A;  2L3D A;  1Z7U A;  3RI4 A;  3KFW X;  4LB5 A;  2W25 A;  1DDN A;  2D2W A;  4HLY A;  4IVN A;  5ILU A;  1R23 A;  3PFI A;  1IXC A;  4WXD A;  1W7P D;  2HKO A;  4DNC A;  2MA3 A;  3KLO A;  2G9W A;  1W4M A;  5ILV A;  2FNA A;  1VTN C;  5FLX K;  3HSE A;  2R7F A;  3FWE A;  2M45 A;  2MBF A;  3TO7 A;  1LNW A;  1I5Z A;  3BPV A;  4UXN A;  2BEO A;  4IHT A;  5ICG A;  1BN5 A;  2VOP A;  1JHH A;  1LVA A;  2KJB A;  4U7D A;  2EWN A;  2XAG A;  3SHF A;  1K78 B;  5E1W A;  1BBY A;  1J5Y A;  1O3T A;  2ACJ A;  3CDH A;  3R60 A;  1YLF A;  3DPT A;  3V7R A;  4Q5S F;  1E17 A;  2F5C A;  3KP7 A;  2DPD A;  4GO1 A;  3BP8 A;  1ZRE A;  3J81 Z;  2O6G E;  2VON A;  1OKR A;  1QZY A;  1RUN A;  5LRS A;  2A5Y B;  1IN8 A;  5EEH A;  5HDN A;  4U0Y A;  2JPC A;  3BPX A;  3TQN A;  1FP2 A;  4O3M A;  4MNU A;  2QUF A;  3R0J A;  2IRF G;  4XRF A;  2NNN A;  2DFI A;  2HS5 A;  1K78 A;  3BRO A;  1Z6T A;  3E6D A;  1Z9C A;  1WKM A;  2RNJ A;  2Q0O A;  1MJ9 A;  3JTH A;  1R58 A;  2XRN A;  2K86 A;  2PN6 A;  1F4K A;  1ODD A;  4HX7 A;  4UV9 A;  3WGG A;  4G94 A;  5KVR A;  1DP7 P;  2UWM A;  4KIC A;  2ETH A;  4HW0 A;  5HS8 A;  5FB2 A;  2HTS A;  2FEZ A;  1YW7 A;  1SMT A;  5FD5 A;  5ICE A;  4ESJ A;  3ZMS A;  4BHC A;  1ON1 A;  2EFO A;  4M6Y A;  1ZLJ A;  3PQJ A;  2CGP A;  4M72 A;  2EFN A;  4G6Q A;  1FC3 A;  3F8M A;  1W5S A;  1TQM A;  3HRM A;  2KIM A;  2K27 A;  3OV8 A;  1JGS A;  1HST A;  4G7H F;  5TJJ A;  2DAO A;  2DBB A;  3M8F A;  4HA8 A;  1MDM B;  1SMY F;  2DK8 A;  4WWC A;  4JBA A;  2EA4 A;  3C7J A;  1F9N A;  1OYW A;  1OPC A;  2Z5U A;  5LGT A;  3KP2 A;  1ZLK A;  4CHU A;  2KJC A;  3S2W A;  4Z2Y A;  2HEO A;  5LGN A;  5D8L B;  3FZV A;  1ONV A;  3QRF F;  3DF8 A;  3LA7 A;  4M6X A;  2DK5 A;  1B9N A;  3QPH A;  1IF1 A;  2DW4 A;  4LFU A;  3GZ5 A;  3J81 K;  1H9G A;  1ZRC A;  4FHT A;  4BYY A;  5LBQ A;  1U3E M;  3FX3 A;  3WTZ A;  1AOY A;  3LST A;  1USS A;  1MDM A;  1PP8 F;  3QOP A;  2COM A;  3CUQ C;  1ZN2 A;  2A07 F;  1D8K A;  1REP C;  1J2X A;  4OMY A;  4AIH A;  3WTV C;  2AS5 F;  4G9Y A;  2XIG A;  1YQA A;  3WE2 A;  1T2K A;  2BGC A;  2MLK A;  1IZ1 A;  3GVA A;  1B6A A;  2DQL A;  3ML6 A;  4UUV A;  1WWX A;  1BC8 C;  3QU6 A;  5JHU A;  5HDK A;  5IT9 Z;  3ZMV A;  2Y0M A;  2R7D A;  5JR3 A;  1HSJ A;  3R4K A;  1O3S A;  3FMQ A;  4CZZ A;  2PEX A;  3ELK A;  1T0F A;  2K4J A;  1O7L A;  2Y75 A;  2KRF A;  1P4A A;  3MFK A;  5CVU A;  2FXA A;  3G73 A;  2H6B A;  3W6J B;  2IW5 A;  1RUO A;  2P6S A;  1MJA A;  3JW4 A;  4FX0 A;  4HZF A;  3U2R A;  5HS7 A;  4PZJ A;  3VEP A;  3VFZ A;  1XMA A;  2F5F A;  3J80 K;  1GXP A;  3KP4 A;  3V8J A;  4BHB A;  3P7N A;  2PLY A;  2VBZ A;  1WRJ A;  3ZMU A;  2ZFW A;  4GCV A;  4YFN F;  3IRQ A;  2QBY B;  1D8J A;  1XGS A;  4HDV A;  2C6Y A;  2XHK A;  3AAF A;  4ZYD A;  3WTW C;  2EV5 A;  4CDG A;  2KKO A;  2GXB A;  5BPI A;  2FMY A;  1KU2 A;  1ZAR A;  4AIJ A;  2VBW A;  1TBX A;  3ZPL A;  1S8N A;  1ZRF A;  4I01 A;  3K2Z A;  4U7B A;  5A2Q Z;  3LA2 A;  2FBI A;  2V1U A;  1UHW A;  2K7L A;  4M9S A;  4R1H A;  2V79 A;  2ZNZ A;  4KT5 C;  3E5Q A;  1BI3 A;  2JPB A;  4NHJ A;  4Q48 A;  2Z3Y A;  2QBY A;  3C18 A;  1UFM A;  4M9X A;  1HW5 A;  3K9T A;  2HTJ A;  4Q4Z F;  3ZMD A;  1YW9 A;  1SD6 A;  1ZAO A;  2E1C A;  4LD5 A;  4UNO A;  1TQP A;  5F1R A;  2FRH A;  1I1G A;  2XAF A;  3CUO A;  5LEJ A;  2FBK A;  4IPA A;  2A6E F;  4QWQ A;  2PMH A;  1OR7 A;  2BBY A;  5CVV A;  4KA4 A;  1FY7 A;  5IT9 K;  1A04 A;  1LDD A;  1B4A A;  3DQV C;  3FF5 A;  5E8I A;  2BE5 F;  2FQ3 A;  2MLG A;  1R5G A;  3FM5 A;  4GYI A;  1RZ4 A;  3RPU A;  3FXR A;  1G3S A;  4HYE A;  4ZZL A;  4FX4 A;  1H9T A;  2Q2E A;  4HF0 A;  5JVT A;  2EFQ A;  4A5M A;  4BNC A;  2RC4 A;  4EM0 B;  3FMS A;  1KQ8 A;  1XSD A;  4L5I A;  3RYP A;  3EDP A;  3KET A;  2E7X A;  4M71 A;  4I98 B;  1HXD A;  3GUD A;  1FX7 A;  3F6V A;  4S04 A;  4IXA A;  2DTR A;  3IRR A;  1YS6 A;  1EH8 A;  1U2W A;  5BQT A;  3TKY A;  3ZQ7 A;  1TTY A;  3BJO A;  4ENM A;  1UB9 A;  4IRH A;  1WI9 A;  3IKT A;  1LEB A;  1ZGA A;  1UCR A;  3MAJ A;  4B09 A;  2GWR A;  3I59 B;  4ENN A;  2Z99 A;  3KP5 A;  5LHI A;  4PGH A;  3RKW A;  4EM1 A;  3BZ6 A;  3GEZ A;  2G7H A;  2IVM A;  2GXG A;  2OA4 A;  1XSV A;  3DFG A;  2NAZ A;  1J75 A;  3GLX A;  1FYM A;  4AVP A;  1XCV A;  4G8X A;  2PI0 A;  3H3Z A;  3RTR A;  2PFB A;  4RAY A;  3SFZ A;  5A2Q K;  5DD8 A;  4OIR F;  3EET A;  2VBY A;  3Q9S A;  3M7G A;  4JK1 X;  2ESH A;  3V8K A;  3RDI A;  3DPL C;  4QLC U;  1Y0U A;  3ECO A;  4RB2 C;  2GQQ A;  4UV8 A;  1D5V A;  3U1D A;  2IPQ X;  5JI6 A;  2P4W A;  2LSO A;  1G3Y A;  4MTD A;  2MD5 A;  3I59 A;  2VBX A;  3M1E A;  5ICC A;  2IP2 A;  4LMY A;  3ZMZ A;  2NRA C;  3I4P A;  2CYY A;  1G6N A;  1KA8 A;  4ZYG A;  3KZY A;  1HW1 A;  3VOD A;  4HQM A;  3FMR A;  2CWE A;  4LLL A;  1B1B A;  2PMU A;  2ZKZ A;  3V7S A;  3D5L A;  2HYG D;  4LB6 B;  2HQN A;  2P8T A;  3GF2 A;  3LAJ A;  3K1M A;  2VOO A;  2HGC A;  1RIO H;  1T38 A;  3I53 A;  2GZW A;  4AD9 A;  1EH6 A;  4RB1 A;  5FFZ A;  1IAW A;  4OIN F;  3QP5 A;  1G3T A;  5K5O A;  3K69 A;  2HKX A;  4OU0 A;  1IXR C;  2L4M A;  3MCZ A;  2E1N A;  1YFH A;  2J5O A;  5L3D A;  2OU2 A;  4MHG A;  3HSF A;  1Z05 A;  3RKY A;  1XCB A;  2QWW A;  2Y48 A;  3HHG A;  1Q1H A;  5DCM B;  2OAZ A;  1SAX A;  3TO6 A;  4EQQ A;  5CJ9 A;  4OIP F;  3F8B A;  4HF2 A;  2FA5 A;  2ZXJ A;  2DQR A;  4LLN A;  3FM3 A;  2H6C A;  2A68 F;  2YPR A;  3F3X A;  2JZY A;  1K79 A;  3FXU A;  4KUM A;  3R61 A;  2W85 A;  4A2U A;  3EYY A;  4YFK F;  1B59 A;  4L18 B;  4BHP A;  1JXS A;  3K1P A;  2OD5 A;  4P55 A;  1E2X A;  2CSO A;  5E1Z B;  1DPU A;  2P7C B;  3EYI A;  3CTA A;  2P6T A;  2QQ9 A;  1JHF A;  2FOK A;  4LK1 F;  1BJA A;  2D1V A;  2PQ8 A;  5DCM A;  1RI7 A;  2JSC A;  3JAM Z;  1QZZ A;  4CXF A;  4P96 A;  4KIB A;  4NB5 A;  4RB3 C;  4ZZD A;  2P5V A;  3E97 A;  3C1D A;  2D1H A;  3IHU A;  4P5O A;  3L7W A;  4EJO A;  4PCQ A;  1SD7 A;  4HX8 A;  3KEO A;  3HSR A;  2JRT A;  2MH9 A;  1S6L A;  5LEK A;  1XDU A;  2QVO A;  2VXZ A;  5D5V B;  1I27 A;  2V1X A;  4I0B A;  2W84 A;  3QAH A;  1LDJ A;  3QPT A;  4I7H A;  2ISY A;  3KE2 A;  2K4B A;  1TNT A;  2IA0 A;  4MEX F;  2L02 A;  2WTE A;  3L09 A;  3R6S A;  2OBP A;  3BWG A;  4KDP A;  2HZT A;  3WU1 B;  1MJB A;  2HR3 A;  1V3F A;  1ZHF A;  1P6R A;  2A6H F;  2YX7 A;  1R5H A;  3NQO A;  3DXJ F;  3EQL F;  5FGM A;  5H20 A;  3KP3 A;  1BI0 A;  4EV0 A;  2PG4 A;  1FBQ A;  1FBS A;  1FYK A;  2O3F A;  4P9F A;  3KCC A;  5LHH A;  2L54 A;  3IC7 A;  2QLZ A;  4L9J A;  5CVI A;  4BAY A;  4KN7 X;  2IJL A;  5DEQ A;  2NYX A;  5HDG A;  1HKS A;  2AXL A;  3TDU C;  4RGS A;  3E3V A;  4ZYH A;  1FLI A;  5FD6 A;  2BV6 A;  3K0L A;  3V8L A;  3RJP A;  1U5T C;  3DP7 A;  3GFL A;  4R79 A;  1RNL A;  4YG2 F;  2FSW A;  5JFR A;  4HBL A;  3O6B B;  3K1N A;  5AIP A;  1PDN C;  2VN2 A;  4MQV A;  3GXO A;  1H0M A;  3I64 A;  1XGM A;  3CUQ B;  2HDC A;  1MZB A;  5IT3 A;  3HRU A;  1NHA A;  1R36 A;  2EJR A;  1LDK B;  3JAM K;  2XUB A;  2CG4 A;  3BOQ A;  2F5D A;  1U6G A;  4MTE A;  1HKT A;  2Z9O A;  4OIQ F;  1FSH A;  3B02 A;  2GA1 A;  2LKP A;  3GWZ A;  1P2F A;  4L5J A;  4ENJ A;  1L0O C;  2PBI A;  2V9V A;  1GVJ A;  2EK5 A;  1P92 A;  2FML A;  5K5R A;  2ZNY A;  3I71 A;  4LJZ F;  5DD4 A;  3CUQ A;  3EUH A;  3WTX C;  5DUI A;  2XVC A;  4EM2 A;  4CYD A;  3LAP A;  3F21 A;  2XV4 S;  5FO5 A;  2O61 A;  3NRV A;  4E70 A;  1TW3 A;  3Q5F A;  3SQN A;  3N97 A;  2FU4 A;  3ZP5 A;  4IF4 A;  3VB2 A;  2RVC A;  4ASN A;  4UVB A;  3E6B A;  3WG9 A;  3GYH X;  1T39 A;  3L00 A;  1MGT A;  1XGO A;  2QZ8 A;  4RS8 A;  3TOB A;  5LHG A;  2IT0 A;  2UXX A;  2L01 A;  2O0Y A;  3WGH A;  3F23 A;  5L3C A;  2RN7 A;  1FPQ A;  2LF8 A;  1QGP A;  2GIV A;  4IRI A;  5H6Q A;  5ED4 A;  1S7O A;  2P7V B;  2Q8K A;  2UZK A;  2ZCW A;  5J8C A;  4ZH4 F;  3MZH A;  1YTY A;  1J7K A;  1SD4 A;  2Z33 A;  5CVJ A;  4M9Z A;  4F7Z A;  3OOP A;  4IJA A;  5E18 F;  4DQ2 A;  5E1X A;  5BOX A;  4Q47 A;  2KIU A;  1U8R A;  4A0Z A;  4XSZ F;  5DUK A;  3KEQ A;  1KYZ A;  2RDP A;  5HVQ C;  3R0A A;  1K7A A;  2WC2 A;  1T6S A;  2YX4 A;  3IWZ A;  4RGX A;  3P9I A;  2DI3 A;  1BI1 A;  3H3U A;  2CO5 A;  1J59 A;  2VT3 A;  4N9H A;  1YW8 A;  5ERI A;  5D5U B;  1SD5 A;  3I0T A;  3LA3 A;  3H92 A;  4ESF A;  4BXU A;  2LDU A;  3GFJ A;  4IRG A;  5CLS A;  1S29 A;  4HX4 A;  2QYO A;  2ESN A;  2XAJ A;  4XLN F;  3WE3 A;  1TNS A;  1BIA A;  3TGN A;  3SZT A;  2RKH A;  2HFH A;  2DU9 A;  1MD0 A;  2PJP A;  1G4D A;  4UVC A;  5LLQ A;  3B73 A;  1KU7 A;  2ZBK A;  3W6K B;  2KIF A;  4G6D A;  2VOD A;  4RGU A;  4XLP F;  3QU3 A;  2O03 A;  2XAH A;  1BOA A;  4L9N A;  1J0R A;  1ULY A;  2P5L C;  2ZJ2 A;  1OYY A;  1IUY A;  2GA2 A;  2K02 A;  3E6C C;  4A6E A;  1DPR A;  1IN7 A;  2JTV A;  1TLH B;  3DEU A;  3WTT C;  3U9G A;  1BM9 A;  1QPM A;  4U0W A;  3HHH A;  2IA1 A;  3DKW A;  3HIF A;  3IKV A;  2O8X A;  2OZU A;  4KYW A;  5E17 F;  1G3W A;  3ROU A;  1W5T A;  4KFC A;  4AWX B;  5BS6 A;  4KIF A;  2L4A A;  1YIO A;  5D4R A;  3F22 A;  5DDG A;  4HF1 A;  2JT1 A;  4M73 A;  4PDK A;  3JSO A;  1L3L A;  2ADU A;  3HRT A;  3KP6 A;  1XN7 A;  1Z91 A;  2XKO A;  4YIF A;  1KQ0 A;  2A61 A;  2XKP A;  5L3E A;  3GO5 A;  5AON A;  2WWY A;  5FFX A;  2R3S A;  1LQ1 A;  4HOB A;  1EH7 A;  1T98 A;  1KYW A;  2BYV E;  4ENK A;  2XAQ A;  3FXQ A;  1JE8 A;  3RIR A;  1X3U A;  2F2E A;  2B0L A;  1ZYR F;  1I6X A;  3M8E A;  5DYM A;  3F6O A;  3WTU C;  2STW A;  1FP1 D;  2YU3 A;  3P9K A;  1BIB A;  3ABU A;  3WTY C;  2CFX A;  1U78 A;  1ZH5 A;  2V1D A;  4OMZ A;  5TRD A;  5BPD A;  3E5X A;  3HOS A;  3REO A;  1YO5 C;  3E5U A;  2P5K A;  1IN5 A;  1C0W A;  1FBU A;  1D3Y A;  2UXN A;  4I02 A;  4UVA A;  5AIQ A;  1QBJ A;  1FZP B;  4O5V A;  5DV5 A;  1WSU A;  1AWC A;  1STZ A;  1XGN A;  4R8H A;  4OIO F;  3RYR A;  4NQW A;  1YS7 A;  1LJ9 A;  3F8C A;  5DCF A;  5L3G A;  3QP6 A;  4O6J A;  1TW2 A;  1UHM A;  5HOO A;  4EGY A;  3GX4 X;  4ZYE A;  1S3J A;  2XGX A;  1DUX C;  2A69 F;  2ISZ A;  5ILS A;  2F5E A;  5BMZ A;  5L3B A;  3GW2 A;  3SZP A;  4HQE A;  2QEN A;  3RPQ A;  4GGG A;  2YR2 A;  1FOK A;  3HRS A;  3O3K A;  1SFU A;  1R7J A;  5J8F A;  1CF7 B;  1UST A;  4MQ9 F;  4ON0 A;  3V7C A;  2OZ6 A;  1OYI A;  5K1Y A;  5J6X A;  4MGR A;  2STT A;  1O3Q A;  4N9I A;  1LB2 A;  2CQK A;  3I58 A;  4LLG F;  2HOE A;  5H6R A;  3JSP A;  2OQR A;  2ZME B;  3FHZ A;  4WX9 A;  2V6C A;  3HUG A;  2FBH A;  2J5P A;  3NEU A;  2QQA A;  2OQG A;  3BJ6 A;  2D45 A;  1KU9 A;  3J80 Z;  5F6F A;  4KMF A;  4A5N A;  4KIG A;  3HTU A;  3ISP A;  5K5Q A;  5E8G A;  1MKM A;  1CF7 A;  4EJU A;  1KU3 A;  3HTS B;  3F8N A;  3CO7 C;  5LRR A;  3D0S A;  4LGW A;  3ZMT A;  2E7W A;  2VC0 A;  4D0P A;  4WXH A;  1YG2 A;  4WK8 F;  2VC1 A;  4N0B A;  4RAZ A;  1BC7 C;  2M87 A;  1GXQ A;  2G7U A;  4EJW A;  2ZME A;  1PUE E;  3SXY A;  3Q9V A;  1O7F A;  4A0X A;  5CVR A;  1IRF A;  3F72 A;  3T8R A;  2MH2 A;  3KLN A;  4I09 A;  1EV7 A;  2FE3 A;  1HW2 A;  2W57 A;  3WU0 A;  1FYL A;  4RB0 A;  3O2P E;  1ZG1 A;  5E20 A;  1V4R A;  2IA2 A;  3PQK A;  4AIK A;  4RGR A;  5L3F A;  1QQI A;  3T1B A;  2QM3 A;  2M30 A;  4BH9 A;  4JQF A;  3BJA A;  4XBF A;  3HYI A;  3TDZ C;  2VE8 A;  1ZGJ A;  2NS0 A;  1SFX A;  4MEY F;  3RKX A;  4EVI A;  5D8K B;  2HYF A;  1KGS A;  1HQC A;  3WGI A;  4CIC A; 
#chains in the Genus database with same CATH topology
 1XMK A;  3HPG A;  3ESW B;  1WCM J;  1SAU A;  2M8E A;  3CJN A;  2H27 A;  1CGP A;  1WZ2 A;  3H9G A;  1UZC A;  4HPQ A;  2NVQ J;  5HLH A;  2QCO A;  2M1B A;  3KEY A;  4LG0 B;  1FIP A;  2GAU A;  5EEG A;  1R00 A;  4Y15 A;  3UKG A;  1XDS A;  1QO0 D;  4A0Y A;  1U9N A;  3IH3 A;  3GTP J;  5JLW A;  1K6O A;  2PMZ N;  2DPU A;  1VI0 A;  3GZ6 A;  5D4S A;  1DP3 A;  1W36 D;  1F1Z A;  1ERD A;  2CW0 F;  4V2G A;  4EJT A;  1LUJ B;  2KPM A;  2XAS A;  3D1N I;  1Z1D A;  2LG4 A;  1IGN A;  4V19 K;  3C3W A;  2VE9 A;  3J7A O;  2VT2 A;  4BQA A;  2E36 A;  2WB1 N;  3CJR B;  5LGU A;  3BY6 A;  5CYV A;  2H8R A;  3ZN0 A;  2JUG A;  1P4W A;  4EMS A;  1WQ2 A;  3DLA A;  1WJ5 A;  2WV0 A;  3DV8 A;  1LVK A;  4L9V A;  3S93 A;  1IN6 A;  3MEX A;  1UG0 A;  4HV6 A;  3AL0 C;  2G0E A;  4HLX A;  4WF2 A;  2JUC A;  2NOJ B;  4YEJ A;  1FT9 A;  5FKM A;  3V4G A;  2EV0 A;  1XX5 A;  2M0M A;  3ABT A;  4XSX F;  1JGG A;  3TOA A;  1U5T B;  2OTJ I;  3S1M J;  3FIW A;  3OYE A;  5D5W B;  2QGU A;  1R1U A;  1T08 B;  3HOT A;  4RBO A;  1HBX G;  3WTS C;  3CO6 C;  2M5W A;  1P4X A;  2BW3 B;  1W0U A;  3OYC A;  1PP7 U;  2LF7 A;  4K2E A;  4AUX A;  2IS2 A;  4B8X A;  3DTI A;  1F5T A;  2ME0 A;  5D6E A;  4CO8 A;  3MVP A;  2H09 A;  1T56 A;  3MQ0 A;  1P7J A;  3L2C A;  1JI8 A;  3CLO A;  4G7Z F;  4LG0 A;  4I2O A;  1A6Q A;  4LIV A;  4DBR A;  4L0Z B;  3F8F A;  4NC8 A;  1R1T A;  2EFW A;  4EEF G;  1YX3 A;  5ICF A;  2MAB A;  2DLL A;  2RV8 A;  3Q3S A;  4UHT A;  4YIR X;  3BDD A;  3OSF A;  2WB1 A;  3OYD A;  1ZR2 A;  2L0K A;  2HQR A;  2L2O A;  3ERE D;  4KN4 X;  4XRS G;  4M3B A;  3MZY A;  2VKD A;  1BR1 A;  3M07 A;  3T8T A;  5FKO A;  2EZH A;  2FF4 A;  3KZZ A;  1X3Z B;  3LQQ A;  4AC0 A;  1GHC A;  3S15 J;  2L7M P;  2DT5 A;  1VF9 A;  3M9A A;  1W7P B;  2VJ4 A;  2CUF A;  4G7O F;  1RRJ A;  2MC3 A;  4S05 A;  3AG4 H;  4MO7 A;  3DWL E;  2ELJ A;  4IOC F;  3K4B A;  2OJE D;  3SJM A;  2Y0S N;  4WXC A;  1U5T A;  3N4M A;  4DOZ A;  4GYG A;  1R22 A;  3Q0U A;  3IL2 A;  2BW3 A;  1XD7 A;  3LWF A;  1ZG3 A;  5TIS C;  2BXZ A;  2IAI A;  1KQ9 A;  3H9Q A;  5M3F J;  1O3R A;  4KNY A;  4Y17 A;  4P9U A;  3L9F A;  5GPA A;  1P9Q C;  3DBR B;  3FK7 A;  6PAX A;  2R7O A;  5FLX Z;  1ON2 A;  2A3S A;  4IHW A;  3MWM A;  3COA C;  3DU5 A;  4HV5 A;  2H8W A;  2XRO A;  1ETY A;  2HWV A;  1FWZ A;  3ABL H;  3OYN A;  1OCP A;  2ELH A;  4Y13 A;  2EV6 A;  2ZO4 A;  4HRI A;  4LK0 F;  4BAC A;  2LNB A;  2JMW A;  4M74 A;  3ZN1 A;  4EGZ A;  4ESB A;  1ZKG A;  2A05 A;  3A2K A;  2Z2S B;  1ZG5 A;  2H94 A;  4IHS A;  1OMI A;  2EFP A;  3IUO A;  4NC7 A;  4H0E A;  4YII A;  1Y8R B;  5GTH C;  2E1M B;  1Z6R A;  4XNF A;  1M1E B;  1XB4 A;  1W7P A;  5F08 A;  1E3O C;  1FNN A;  4L9T A;  3L2U A;  3I5U A;  3I54 A;  2JN6 A;  1I1S A;  3S2H J;  3I9V 2;  1MMS A;  2E19 A;  2RQP A;  4HNT A;  1XS9 A;  2GBY A;  4U0V A;  4A3E J;  2X4H A;  1N77 A;  1N25 A;  2R7S A;  3CF5 F;  2O9L A;  2CV2 A;  4TV7 A;  4BJ6 C;  1TWF J;  2RGV A;  1TQI A;  1AA7 A;  1O57 A;  2CU7 A;  3TO9 A;  5J3L A;  3OL4 A;  3IWF A;  4A6D A;  4L0Y B;  4MLO A;  2W24 A;  5B66 C;  3PO2 J;  2JA2 A;  4E7S A;  1HKQ A;  4PJM A;  1RR7 A;  1TP4 A;  4V2F A;  1LEA A;  1ZK8 A;  1R1V A;  2QSF X;  3E6M A;  3OR2 C;  3JTG A;  1Y8Q B;  2EB7 A;  4XON A;  1ZGW A;  3P9C A;  5HLI A;  4UY8 I;  3G3Z A;  4C2T A;  1R9T J;  3IH4 A;  4GXO A;  1XSX A;  2X0L A;  2P81 A;  1FSE A;  3ECH A;  2EA2 A;  2K40 A;  2KIQ A;  1YYV A;  2ZJQ F;  4CGZ A;  4FT8 A;  4HAM A;  1B72 B;  3L1P A;  2M34 A;  1S7A A;  4OOI A;  1J9I A;  3ULQ B;  2HXO A;  5LFA A;  3F0C A;  2FD5 A;  3H1C A;  4ETS A;  2TDX A;  2NS8 A;  5KK1 A;  3LSP A;  3GFI A;  3PJR A;  4D5F A;  2F4O B;  4C30 A;  2HVQ A;  1B9M A;  2KRH A;  4XKV A;  1SFE A;  5D6F A;  1IN4 A;  3V42 A;  3LFK A;  3VOE A;  4U88 A;  2E2I J;  5F64 A;  5HLG A;  1QNT A;  3T5X A;  3QYF A;  4PGG A;  1IW7 F;  4A12 A;  4I0A A;  3T0Y A;  3WOD F;  3FDY A;  4EJV A;  2FNP A;  4XRS A;  4HDU A;  2H1K A;  5HS9 A;  3LQR A;  3BG3 A;  3HZJ A;  1ZRD A;  1S9H A;  4A3B J;  2QQB A;  4YFX F;  4X0G A;  1IXS B;  3NAU A;  1Z3Y A;  3GFM A;  2QA4 I;  2NNY A;  1OCT C;  5D5X B;  2DO7 A;  4DYC A;  2HXI A;  1H88 C;  4WCG A;  2YSR A;  2EIN H;  1BI2 A;  4KMU X;  1IRG A;  4XLE A;  3S16 J;  2L3D A;  1Z7U A;  4D5C A;  3RI4 A;  3KFW X;  2DT6 A;  4LB5 A;  2BVL A;  2W25 A;  4IO9 F;  2HVS A;  1DDN A;  2D2W A;  4HLY A;  1FIA A;  2LVS A;  4IVN A;  2E60 A;  5ILU A;  4XKB A;  1R23 A;  1D0Y A;  3PFI A;  1IXC A;  3TED A;  4CH7 A;  2QKM B;  4WXD A;  1PJR A;  3QWL A;  1B72 A;  1W7P D;  2HKO A;  2CUZ A;  2FQ4 A;  1OJL A;  1SVM A;  1WH7 A;  4DNC A;  2MA3 A;  3KLO A;  2W4S A;  2G9W A;  1W4M A;  1W1W E;  2WY8 Q;  1T95 A;  3G1L A;  3RPU D;  5ILV A;  3JRH A;  2FNA A;  1RC9 A;  5HOD A;  1VTN C;  3H5A A;  5FLX K;  1VQ8 I;  3BR5 A;  2R7F A;  3HSE A;  4QPO A;  4JX5 A;  3CZ6 A;  2JWT A;  4LIU A;  2R7U A;  3FWE A;  2M45 A;  3ZQH A;  2MBF A;  5EZH A;  4N4N B;  2MC4 A;  1WVR A;  3TO7 A;  3QOD A;  2VUM J;  1GVD A;  1LNW A;  4J00 A;  1I5Z A;  4OAZ A;  3BPV A;  4UXN A;  2R7T A;  2BEO A;  3FBI B;  4A3I J;  2BVM A;  3BG7 A;  4B43 A;  2ZFU A;  3RCO A;  4IHT A;  5ICG A;  1GLN A;  5IOY A;  1BN5 A;  3QYB A;  2VOP A;  1JHH A;  2Y9Z A;  1LVA A;  1YHQ I;  2KJB A;  4AU7 A;  4U7D A;  2IS6 A;  2EWN A;  2XAG A;  1JT0 A;  3SHF A;  2HNH A;  1K78 B;  1TT5 B;  5E1W A;  4DZJ A;  2XAU A;  1BBY A;  1APL C;  1J5Y A;  1OIS A;  3HB9 A;  1O3T A;  2X6O A;  3A0H C;  3U21 A;  2ACJ A;  2DOF A;  2VIX A;  2NXN B;  3CDH A;  1YLF A;  3KPH A;  3R60 A;  4C3I J;  2FUG 2;  1U9O A;  3DPT A;  1VQP I;  3V7R A;  4Q5S F;  1RET A;  1E17 A;  2F5C A;  3KP7 A;  1XG1 A;  4XID A;  2DPD A;  4RAF A;  1IJW C;  5M3M J;  4GO1 A;  3BP8 A;  1ZRE A;  3D5S C;  4CCJ A;  4QIW N;  1VQ5 I;  3OYI A;  2XGD A;  3CDI A;  3EUA A;  3J81 Z;  4FTH A;  4E7H A;  4G12 A;  2O6G E;  2VON A;  1OKR A;  1QZY A;  1RUN A;  2R7V A;  5LRS A;  2Y2Z A;  2A5Y B;  1DGW Y;  5C4J J;  1IN8 A;  5EEH A;  5HDN A;  4U0Y A;  4CCK A;  2JQ7 A;  2Z1D A;  3G1O A;  2JPC A;  3BPX A;  3TQN A;  5CPR B;  1FP2 A;  2GLO A;  4O3M A;  5CQE A;  1R71 A;  2R7X A;  3W3C A;  1N78 A;  1X19 A;  1SVO A;  4MNU A;  2QUF A;  3R0J A;  2IRF G;  4ZYA A;  4XRF A;  4L5E A;  2NNN A;  2DFI A;  2HS5 A;  2V4J C;  3BR1 A;  3MMY B;  1JKO C;  1K78 A;  3BRO A;  1Z6T A;  3E6D A;  3J7Z I;  1Z9C A;  1WKM A;  2RNJ A;  2Q0O A;  1MJ9 A;  3JTH A;  2EIJ H;  2B9S A;  1NK3 P;  2DCE A;  4BL0 B;  1R58 A;  3ABM H;  3QPS A;  2KRC A;  2M0C A;  2XRN A;  1KZH A;  2LP0 A;  3CQZ J;  1VQ9 I;  2K86 A;  2PN6 A;  1F4K A;  1ODD A;  4HX7 A;  1MW7 A;  1BR2 A;  5IP6 A;  3GLL A;  2E34 A;  1VQ6 I;  4UV9 A;  3WGG A;  4RAG A;  4G94 A;  5KVR A;  3VYR B;  4ZTF A;  5C3E J;  4FAS D;  5K7Z A;  1DP7 P;  2UWM A;  2VJJ A;  2ETH A;  4KIC A;  5HNH A;  2GM4 A;  4HW0 A;  4FQG A;  2IGN A;  5HS8 A;  1X1A A;  2HTS A;  1MMD A;  2FEZ A;  5FB2 A;  1YW7 A;  1SMT A;  2M3A A;  1HF0 A;  5FD5 A;  2JVH A;  5ICE A;  2E35 A;  4ESJ A;  3VYS B;  3ZMS A;  1V5G A;  4BQN A;  2E71 A;  3OIO A;  4BHC A;  1POG A;  1ON1 A;  2CW7 A;  1JJ6 C;  4P1W A;  1DQU A;  2EFO A;  4M6Y A;  1ZLJ A;  3PQJ A;  4X1E A;  3LFU A;  2CGP A;  4M72 A;  2EFN A;  2K3P A;  4G6Q A;  1FC3 A;  3GTM J;  3LMM A;  3F8M A;  3ZQC A;  1W5S A;  2XF5 A;  4OWR B;  2LMD A;  1TQM A;  3K4N A;  2E5N A;  3HRM A;  1B8I A;  3MZ8 A;  2KIM A;  2K27 A;  1OQY A;  3OV8 A;  1JKR C;  1JGS A;  1MH3 A;  2F5V A;  4A93 J;  1X2M A;  1HST A;  4G7H F;  3CP2 A;  1QVU A;  5TJJ A;  4LOC A;  2DAO A;  2DBB A;  2DMP A;  3M8F A;  3K7A J;  3HM5 A;  4HA8 A;  1MDM B;  1SMY F;  2DK8 A;  4WWC A;  4JBA A;  2EA4 A;  4XOT A;  3C7J A;  1F9N A;  1WJB A;  1OYW A;  3S1N J;  5GAD J;  1OPC A;  3CCU I;  2X1E A;  2M8G X;  1VQM I;  2Z5U A;  2DOA A;  3TMO A;  5LGT A;  3KP2 A;  1Y1W J;  1ZLK A;  1IDY A;  2KJC A;  4CHU A;  2M4G A;  2AQE A;  4II2 A;  3S2W A;  4Z2Y A;  1YJW I;  2HEO A;  3TP3 A;  1K6Y A;  5LGN A;  1IC8 A;  2O7O A;  5D8L B;  1TT0 A;  3FZV A;  3Q0W A;  3J7A Y;  1X58 A;  5K7H A;  2D5V A;  1JUP A;  1ONV A;  5DS9 A;  3QRF F;  3DF8 A;  3I3L A;  2JSP A;  3WHB A;  2M7A A;  1LE8 B;  3LA7 A;  1YIJ I;  3PNV A;  4M6X A;  2DK5 A;  1B9N A;  3QPH A;  1IF1 A;  4KJZ A;  2DW4 A;  2MG4 A;  3CES A;  3GZ5 A;  4LFU A;  3ZQG A;  3J81 K;  1H9G A;  1ZRC A;  2DA6 A;  2F48 A;  3I56 I;  1UG2 A;  4FHT A;  2I5U A;  1VQO I;  4XLF A;  4BYY A;  1WI3 A;  5LBQ A;  1U3E M;  2VPR A;  2LKX A;  3FX3 A;  3WTZ A;  2B7E A;  1EF4 A;  3ZRG A;  1AOY A;  3LST A;  1USS A;  1MBE A;  1MDM A;  1PP8 F;  3QOP A;  1G8X A;  2COM A;  4B3A A;  3BT9 A;  3CUQ C;  2R5Z B;  3EUH C;  3SDG A;  4GFB A;  2ZJP F;  1GDT A;  3QOE A;  1ZN2 A;  2A07 F;  5E79 C;  1D8K A;  1REP C;  1J2X A;  3MD2 A;  4XK4 A;  2LRE A;  5IPA A;  4OMY A;  4AIH A;  3D5R C;  2ID3 A;  1WJA A;  2LC2 A;  3WTV C;  4OAY A;  2AS5 F;  4KIT B;  4G9Y A;  2XIG A;  5KAI C;  3ZQI A;  4BQO A;  1YQA A;  4BJ5 C;  3WE2 A;  1T2K A;  2IGK A;  1VND A;  2F4M B;  2L9N A;  2OCC H;  3GME A;  3MKW B;  2BGC A;  2JK3 A;  3FBN B;  5F1J A;  2K9N A;  2MLK A;  3CCM I;  2AO9 A;  1IZ1 A;  3GVA A;  2N8G A;  1B6A A;  2JA5 J;  2DDB A;  1LE8 A;  2DQL A;  1I50 J;  3ML6 A;  3PNY A;  4UUV A;  1WWX A;  4IQJ A;  1BC8 C;  3QU6 A;  2ECB A;  5HDK A;  5JHU A;  1MBJ A;  5IT9 Z;  1MMN A;  3ZMV A;  2Y0M A;  2R7D A;  5JR3 A;  1HSJ A;  2M7B A;  3R4K A;  3OYK A;  1O3S A;  3FKJ A;  5GP9 A;  3FMQ A;  4CZZ A;  2PEX A;  3ELK A;  1T0F A;  2K4J A;  4BU2 A;  2L5Q A;  2HOA A;  1O7L A;  2Y75 A;  2KRF A;  1S7E A;  2ZXW H;  1P4A A;  5IP7 J;  3MFK A;  2R5Z A;  5CVU A;  2FXA A;  3G73 A;  1FTZ A;  4IHX A;  1E3H A;  3AG2 H;  2H6B A;  1GV2 A;  3W6J B;  1QVT A;  1ZQ3 P;  2IW5 A;  1Y1V J;  1RUO A;  4IHY A;  2P6S A;  3BQY A;  3CDL A;  1MJA A;  4D7M A;  2VJI A;  3JW4 A;  1BA5 A;  4FX0 A;  4DBQ A;  4C9Y A;  3DTK A;  2KLO A;  1JKQ C;  1D5Y A;  4HZF A;  2MW8 A;  3OOU A;  3U2R A;  2R93 J;  2VKV A;  2A6T A;  5HS7 A;  4PZJ A;  3VEP A;  3VFZ A;  3K4M A;  1XMA A;  3K70 D;  2BHZ A;  1K4S A;  2F5F A;  3J80 K;  1GXP A;  1UMQ A;  2RNG A;  3KP4 A;  1DU0 A;  3V8J A;  4BHB A;  3DEE A;  3BR6 A;  2MYS A;  3P7N A;  3OYL A;  2PLY A;  1VQ7 I;  2VBZ A;  3QYE A;  1WRJ A;  1H89 C;  3ZMU A;  3IP4 B;  1VQL I;  2ZFW A;  4GCV A;  2LRD A;  2YU9 J;  4YFN F;  1MMA A;  5IYB J;  2R4G A;  3IRQ A;  2QBY B;  1D8J A;  3BTL A;  1XGS A;  3C2B A;  4HDV A;  2IBD A;  2XGE A;  2C6Y A;  2XHK A;  5FRN A;  3KIO A;  1X1P A;  3AAF A;  2DFH A;  4ZYD A;  3WTW C;  1HCR A;  2EV5 A;  4CDG A;  1V5E A;  2KKO A;  2Y31 A;  2GXB A;  1HA8 A;  5BPI A;  2FMY A;  2WAF A;  4I99 C;  1KU2 A;  1ZAR A;  4AIJ A;  2Y9Y A;  2L7Z A;  5J47 A;  2VBW A;  4AYB N;  1TBX A;  3ZPL A;  1S8N A;  1ZRF A;  4XLH A;  4I01 A;  2ZXH A;  3HOV J;  3K2Z A;  2Z16 A;  4U7B A;  5A2Q Z;  1N75 A;  3LA2 A;  4DJA A;  2FBI A;  2V1U A;  4B48 A;  4MFE A;  1MSF C;  1UHW A;  2K7L A;  1TC3 C;  1LKX A;  4GDF A;  4LIT A;  4M9S A;  4R1H A;  2KZG A;  2V79 A;  1BL0 A;  4BGD A;  2ZNZ A;  4KT5 C;  3TL4 X;  2HDW A;  3E5Q A;  1BI3 A;  2JPB A;  2Q2E B;  4NHJ A;  3M1C A;  4Q48 A;  2KHM A;  4HSR A;  4M3F A;  2BXY A;  1MBG A;  2Z3Y A;  2QBY A;  3C18 A;  3RZO J;  1UFM A;  1BOB A;  4JOM A;  2MD0 A;  4U87 A;  4M9X A;  3A0B C;  1HW5 A;  4ITV A;  1U8B A;  2VQG A;  3K9T A;  2HTJ A;  4Q4Z F;  1YIT I;  4A3G J;  1WHU A;  3ZMD A;  1YW9 A;  1SD6 A;  1ZAO A;  3K4J A;  2E1C A;  3LSI A;  4LD5 A;  1TWH J;  2IGM A;  4J19 A;  2TCT A;  4UNO A;  1TQP A;  1NG7 A;  4AYB A;  2WAE A;  2FRH A;  5F1R A;  1I1G A;  2XAF A;  2L9S A;  3I55 I;  1HDP A;  3PM1 A;  2KDO A;  3CUO A;  5LEJ A;  2VB6 A;  2FBK A;  4RM3 A;  4BEH B;  4IPA A;  2A6E F;  4IX7 A;  4QWQ A;  4BBS J;  2PMH A;  1OR7 A;  5F0H A;  2BBY A;  5CVV A;  2R7Z J;  4XOR A;  1W5C C;  4KA4 A;  2OUM A;  1FY7 A;  5IT9 K;  1A04 A;  1LDD A;  1B4A A;  2Y69 H;  3DQV C;  3FF5 A;  5E8I A;  2A5W A;  4C2M J;  4BE0 A;  2BE5 F;  2FQ3 A;  1A6I A;  2MLG A;  1R5G A;  4FE4 A;  2QF7 A;  3FM5 A;  2VKH A;  2LBF B;  4G6T B;  5KAF C;  4GYI A;  1RZ4 A;  3RPU A;  3FXR A;  2KQR A;  1G3S A;  3BR3 A;  4HYE A;  3H9J A;  4ZZL A;  2X51 A;  4FX4 A;  3DBL B;  2LTP A;  2X6X A;  2Q2E A;  1H9T A;  1IG7 A;  4HF0 A;  2LY2 A;  3BTI A;  4E7Z A;  5JVT A;  2EFQ A;  4A5M A;  4BNC A;  1F43 A;  2RC4 A;  4EM0 B;  2W7N A;  3FMS A;  1KQ8 A;  1XSD A;  4L5I A;  3RYP A;  3EDP A;  3KET A;  2O8K A;  2ZC2 A;  2XRL A;  2E7X A;  2LK2 A;  4M71 A;  2HI3 A;  4I98 B;  1HXD A;  1E0E A;  1Q1V A;  3GUD A;  1FX7 A;  4JX6 A;  1VFC A;  2DJI A;  1IDZ A;  3BCB A;  1BW5 A;  1YRN B;  5FKN A;  3F6V A;  3WU2 C;  4S04 A;  2CQN A;  3WHC A;  4IXA A;  2DTR A;  3IRR A;  4E7K A;  4BEH A;  1YS6 A;  1YJ9 I;  4PFP A;  1EH8 A;  1U2W A;  5BQT A;  4UUS B;  3TKY A;  3ZQ7 A;  3L2R A;  3CD6 I;  1TTY A;  3BJO A;  4ENM A;  5EYR A;  1UB9 A;  4IRH A;  1WI9 A;  3OR1 C;  3HC7 A;  3IKT A;  1LEB A;  1ZGA A;  1UCR A;  1GV5 A;  1QHG A;  3MAJ A;  2LBF A;  2EZK A;  3KX2 A;  3H3V K;  4B09 A;  1KON A;  2GWR A;  4F52 A;  2UUZ A;  3I59 B;  1ETO A;  5H2F C;  3JRC A;  4ENN A;  1I6H J;  2Z99 A;  3KP5 A;  5LHI A;  2CQQ A;  4PGH A;  3RKW A;  3HOU J;  1WFX A;  3CJT B;  2QSH X;  4EM1 A;  3BZ6 A;  3DKY A;  2DMN A;  3GEZ A;  3L2V A;  2G7H A;  2IVM A;  2RRE A;  4JYK A;  2GXG A;  1QHH D;  2OA4 A;  5M5W J;  1XSV A;  5J40 A;  4FE7 A;  2X1C A;  3X2Q H;  3GTO J;  3GTL J;  3DFG A;  2NAZ A;  4B3X A;  1J75 A;  1XPX A;  3GLX A;  2YS9 A;  3H5R A;  1FYM A;  2X9D A;  1A35 A;  4AVP A;  1XCV A;  4G8X A;  2PI0 A;  3H3Z A;  3RTR A;  3PL8 A;  2PFB A;  1YRN A;  4RAY A;  3SFZ A;  5A2Q K;  1TWG J;  1OLT A;  1Y6I A;  3PSI A;  5DD8 A;  2LY1 A;  1AU7 A;  4OIR F;  3EET A;  2EH3 A;  2VBY A;  3Q9S A;  3M7G A;  3SDB A;  2K5C A;  4JK1 X;  2F6C A;  4UUS A;  1QU3 A;  3VYT B;  2ESH A;  3V8K A;  3RDI A;  2ZXI A;  3DPL C;  3PNT A;  4QLC U;  3CC7 I;  3BZK A;  1Y0U A;  1QA6 A;  1T8I A;  3ECO A;  4RB2 C;  2GQQ A;  3LSM A;  3FIS A;  4UV8 A;  4AID A;  1D5V A;  3S3N A;  1D1B A;  4PJJ A;  3CF2 A;  3W2V A;  4XRM A;  2AQF A;  2JA7 J;  3U1D A;  2IPQ X;  5JI6 A;  2P4W A;  2LSO A;  1JT6 A;  1G3Y A;  3EUK L;  2CS3 A;  3ASN H;  4MTD A;  2MD5 A;  3I59 A;  2VBX A;  2GIZ A;  2DXI A;  5HNF A;  1JTX A;  2DA3 A;  3M1E A;  3L2W A;  3FXL A;  5ICC A;  2IP2 A;  4C2U A;  2EQR A;  4LMY A;  2KZV A;  2MFZ A;  1NG6 A;  2Q1Z B;  3ZMZ A;  1JUS A;  2NRA C;  3I4P A;  2CYY A;  1IV8 A;  4II3 A;  3ZQL A;  2WY7 Q;  1J09 A;  1G6N A;  1KA8 A;  1TL8 A;  3OIP A;  5DTD A;  3JRD A;  4LG3 A;  4ZYG A;  3MKZ A;  3KZY A;  1HW1 A;  3JRE A;  3VOD A;  5J1U A;  2KMU A;  1X1D A;  3FMR A;  4HQM A;  2CWE A;  4LLL A;  1B1B A;  3CP8 A;  2QQ8 A;  2E1O A;  2PMU A;  2ZKZ A;  2XDV A;  3A4C A;  3V7S A;  3D5L A;  3TP0 A;  2HQA A;  1DGR M;  2HYG D;  2VJ5 A;  2HQN A;  3K6G A;  4LB6 B;  2P8T A;  3GF2 A;  3LAJ A;  5JHF A;  3HKZ N;  3K1M A;  3ZOB A;  2VOO A;  1GT0 C;  4XKW A;  2DYR H;  3G6E I;  1FEX A;  2HGC A;  1RIO H;  4IHV A;  1VZ0 A;  2JVG A;  4M3E A;  1T38 A;  1VQ4 I;  3I53 A;  2GZW A;  3HBL A;  4AD9 A;  4N4O B;  2V6E A;  1EH6 A;  4RB1 A;  5E3L A;  1X3W B;  5FFZ A;  2EIL H;  1IAW A;  1XTA A;  3BCA A;  4XR6 A;  2X48 A;  4JP0 A;  4OIN F;  3UNG C;  2HVR A;  1OCC H;  3QP5 A;  2DMQ A;  1G3T A;  5K5O A;  2H1L A;  3K69 A;  5M5Y J;  4B1R A;  2QEX I;  2HKX A;  4OU0 A;  1IXR C;  2KFD A;  2L4M A;  3MCZ A;  2E1N A;  1YFH A;  4HG2 A;  1MSE C;  2J5O A;  5L3D A;  2NVT J;  1W36 C;  2OU2 A;  4MHG A;  3ZQF A;  3HSF A;  3ABK H;  1Z05 A;  3CJQ B;  4BQQ A;  3OYA A;  3OS1 A;  3RKY A;  1XCB A;  3GTQ J;  2QWW A;  2Y48 A;  3HHG A;  2DMT A;  1Q1H A;  2R92 J;  5DCM B;  2R7Q A;  3HKZ A;  2IEK A;  5KCM A;  5C44 J;  3JRA A;  2OAZ A;  5GAH J;  1SAX A;  3TO6 A;  4D1Q A;  3RKQ A;  1SVL A;  5HLT A;  3CCJ I;  4EQQ A;  5J4Y A;  2ZME C;  4PSX A;  5CJ9 A;  5EG0 B;  3S17 J;  4XQF A;  3JRG A;  4I6Z A;  4OIP F;  1UJ8 A;  3F8B A;  4HF2 A;  4PK4 A;  2FA5 A;  2LY9 A;  2ZXJ A;  2DQR A;  2JJ7 A;  4DGW B;  3CCQ I;  4LLN A;  3FM3 A;  2H6C A;  3ONQ A;  5J1R A;  3CME I;  2A68 F;  2VLA A;  4A3K J;  2YPR A;  3F3X A;  5JLX A;  2JZY A;  1X4P A;  3CCL I;  1K79 A;  3FXU A;  3ASO H;  4KUM A;  3R61 A;  3BG6 A;  2P0W A;  1MBH A;  4H4K C;  2W85 A;  1T33 A;  4JX4 A;  4A2U A;  3EYY A;  2X1D A;  4YFK F;  1B59 A;  4L18 B;  4BHP A;  1V55 H;  3LSH A;  3K4L A;  1JXS A;  2XPW A;  3DKX A;  2OD5 A;  3K1P A;  4BXX J;  4BY1 J;  4B4C A;  4P55 A;  1E2X A;  2CSO A;  2NS7 A;  4RDU A;  2FOW A;  5E1Z B;  4CYC B;  2P7C B;  1ETQ A;  4PSW A;  1DPU A;  3A02 A;  3EYI A;  3S14 J;  4BJT A;  2RAE A;  2HQ5 A;  3CTA A;  2P6T A;  2QQ9 A;  2COB A;  2HYJ A;  3CCS I;  2W00 A;  1JHF A;  3ZQQ A;  2FOK A;  4LK1 F;  1BJA A;  2D1V A;  2PQ8 A;  5DCM A;  4XLC A;  1RI7 A;  2JSC A;  3JAM Z;  1QZZ A;  1ZEL A;  2EZI A;  4CXF A;  5EF6 A;  4P96 A;  1V5F A;  4KIB A;  4UB8 C;  1Y0N A;  1WJD A;  4UUT A;  3HGG A;  4NB5 A;  3OYM A;  2TRT A;  2DA5 A;  5EG0 A;  4ZZD A;  4RB3 C;  4ZDO A;  2P5V A;  2LLK A;  3E97 A;  4XM3 A;  3C1D A;  2D1H A;  3IHU A;  2DFE A;  2NOG A;  3OYF A;  1FOY A;  4P5O A;  3L7W A;  1AKH B;  1I3Q J;  4EJO A;  4PCQ A;  1SD7 A;  4HX8 A;  3KEO A;  2X6Y A;  1IUF A;  3C2G A;  1T0F C;  3HSR A;  2JRT A;  2MH9 A;  1S6L A;  5LEK A;  1YE9 A;  1FJL A;  1XDU A;  1IV6 A;  2QVO A;  2VXZ A;  3OY9 A;  3S8P A;  5D5V B;  3S3M A;  4CUG A;  1I27 A;  2V1X A;  2FJ1 A;  4PUS A;  3I4M J;  3SZG A;  4C3H J;  3SEZ A;  4I0B A;  2W84 A;  3QAH A;  1LDJ A;  1MIJ A;  2XSD C;  3QPT A;  3HXL A;  1E3P A;  4HNV A;  3BC8 A;  3IH2 A;  4I7H A;  2ISY A;  3KE2 A;  4CYC A;  1D0X A;  2MGQ A;  2K4B A;  1WJF A;  3AFH A;  1TNT A;  2X85 A;  2IA0 A;  2NVX J;  1O4X A;  3HPH A;  4MEX F;  2DA4 A;  2XSJ C;  2L02 A;  4Y33 A;  2K9S A;  2WTE A;  3PFY A;  3L09 A;  3JRI A;  2DOD A;  1SEU A;  3R6S A;  1S5L C;  2OBP A;  5LD2 C;  4IQ4 A;  2HOS A;  3BWG A;  2FX0 A;  4KDP A;  2HZT A;  3WU1 B;  1MJB A;  2HR3 A;  5BNG A;  3VYU B;  3P5J A;  5F0C A;  1R5I D;  2VXD A;  3OMY A;  1V3F A;  2L9V A;  3CC4 I;  4ABZ A;  2CW8 A;  2ECC A;  1S72 I;  1ZHF A;  1P6R A;  2A6H F;  2YX7 A;  1R5H A;  1AKH A;  3NQO A;  3DXJ F;  3GTK J;  5EEA A;  1Z77 A;  3MKL A;  3EQL F;  5FGM A;  1YOV B;  5H20 A;  1XC5 A;  3KP3 A;  1BI0 A;  3BLY A;  4EV0 A;  2PG4 A;  1FBQ A;  1FBS A;  5CKT A;  1R6R A;  5GAG J;  1FYK A;  1UAA A;  2HZD A;  2O3F A;  1MMG A;  5IYC J;  4P9F A;  3KCC A;  1RKT A;  2EZL A;  2V9K A;  5LHH A;  4ZDL A;  2L54 A;  3HDD A;  3IC7 A;  5KNL A;  2XPU A;  2QLZ A;  4L9J A;  5CVI A;  4BAY A;  3NAR A;  4KN7 X;  2IJL A;  5DEQ A;  2NYX A;  4B47 A;  2ME6 A;  5HDG A;  3HOX J;  1HKS A;  2AXL A;  3TDU C;  4RGS A;  3E3V A;  4ZYH A;  3A03 A;  1FLI A;  5FD6 A;  2BV6 A;  5FKK A;  3K0L A;  4Y4R A;  3NWS A;  4CSW A;  3V8L A;  3RJP A;  5E3N A;  1U5T C;  4XLA A;  2V9P A;  3DP7 A;  5F0F A;  1XMX A;  4EAT A;  4F55 A;  4CZC A;  3GFL A;  4R79 A;  1RNL A;  4YG2 F;  3PO3 J;  2FSW A;  5JFR A;  4HEA 2;  4HBL A;  4YEL A;  3O6B B;  4A3J J;  2B63 J;  5FJ8 J;  3GCM A;  3K1N A;  2VPL A;  5AIP A;  1PDN C;  2VN2 A;  3AG1 H;  4MQV A;  2EIK H;  3GXO A;  5K7F A;  1H0M A;  1YX5 A;  4PJN A;  4S0H B;  3I64 A;  1XGM A;  3BQZ A;  3CUQ B;  4BKX A;  2HDC A;  3S1R J;  2RQQ A;  2ZJR F;  1MZB A;  1WH5 A;  2DJN A;  2Y30 A;  4AM3 A;  2CRG A;  5IT3 A;  2E2J J;  3HRU A;  1NHA A;  4NUB A;  1Z67 A;  2DMU A;  1R36 A;  2EJR A;  4XN3 A;  1LDK B;  3JAM K;  3FHN A;  2ICW G;  2CH0 A;  1UEL B;  2XUB A;  2WV1 A;  2CG4 A;  3BOQ A;  2F5D A;  1U6G A;  3GZN B;  4MTE A;  3HOZ J;  1OR7 C;  4RA2 A;  2BOL A;  1HKT A;  4DIQ A;  3SYT A;  2I10 A;  5IY5 H;  2Z9O A;  4OIQ F;  1VQK I;  4CCN A;  5B1B H;  1FSH A;  3B02 A;  2GA1 A;  2LKP A;  2L7K A;  2CFO A;  3OIQ A;  3GWZ A;  1P2F A;  2XC7 A;  3DPU A;  3K10 A;  3BTC A;  3HEF A;  4L5J A;  1OCZ H;  4ENJ A;  1L0O C;  2YUS A;  3LNQ A;  2PBI A;  2DA2 A;  4F92 B;  2V9V A;  2DA1 A;  1GVJ A;  2IGO A;  4HST A;  2EK5 A;  5DM7 F;  1P92 A;  2FML A;  3QQA A;  2ZNY A;  5K5R A;  1WGX A;  3I71 A;  4LJZ F;  5DD4 A;  2LKS A;  3CUQ A;  3EUH A;  4BXF A;  3WTX C;  5DUI A;  3B6A A;  2XGC A;  2XVC A;  4ZC3 A;  1D0Z A;  4EM2 A;  2PMZ A;  4E7L A;  1WPK A;  4CYD A;  3LAP A;  2BHY A;  3F21 A;  2XV4 S;  3CCY A;  5IOZ A;  3G4S I;  2L7F P;  5FO5 A;  2O61 A;  1U0J A;  5EJC A;  4IOA F;  1FMV A;  1SFK A;  2HOT A;  2CQX A;  3NRV A;  4E70 A;  2LFB A;  3HOY J;  3AL0 B;  1TW3 A;  3Q5F A;  3SQN A;  3N97 A;  3JR9 A;  4NNJ A;  2FU4 A;  1P7I A;  3ZP5 A;  3JRF A;  4IF4 A;  3VB2 A;  2RVC A;  2E1M C;  4ASN A;  2JA6 J;  2VQH A;  4UVB A;  3E6B A;  3WG9 A;  3GYH X;  1T39 A;  3L00 A;  4ANJ A;  1MGT A;  4RMN A;  1XGO A;  1NH3 A;  2QZ8 A;  4RS8 A;  3TOB A;  3VPR A;  4RM2 A;  5LHG A;  2WA0 A;  2K85 A;  2XF6 A;  2IT0 A;  2UXX A;  3AG3 H;  2L01 A;  2O0Y A;  1FMW A;  3OL3 A;  3CCV I;  1R4M B;  3B6C A;  3TW6 A;  3WGH A;  3F23 A;  1RPW A;  5L3C A;  2RN7 A;  2LH9 A;  1FPQ A;  2HDD A;  4CA0 A;  2LF8 A;  1LFP A;  1QGP A;  2GIV A;  3LSG A;  5H6Q A;  5ED4 A;  1S7O A;  4IRI A;  2P7V B;  2Q8K A;  2UZK A;  2ZCW A;  2HPI A;  3HG9 A;  1JKP C;  1HC8 A;  5J8C A;  4ZTJ A;  4ZH4 F;  1MBK A;  1UHS A;  2ZSH B;  3MZH A;  1YTY A;  4D9J A;  3LSK A;  1J7K A;  3DBH B;  1K4T A;  4I76 A;  4KIS A;  4QSH A;  1SD4 A;  3WG7 H;  3LSJ A;  2Z33 A;  4NC6 A;  5CVJ A;  4M9Z A;  3S32 A;  2WAD A;  4F7Z A;  3OOP A;  5J4V A;  2R5Y B;  4YRV A;  3CCE I;  1I3A A;  4IJA A;  5E18 F;  4DQ2 A;  5E1X A;  5BOX A;  3CMA I;  2EBI A;  2WAQ N;  2ZSI B;  4Q47 A;  1EA3 A;  2KIU A;  3QPL A;  3PSF A;  4CCM A;  1Y56 A;  2IS4 A;  5GAE J;  2CV1 A;  1U8R A;  4W97 A;  4A0Z A;  4BE1 A;  1JTY A;  4XSZ F;  5DUK A;  1PUF B;  3KEQ A;  1KYZ A;  3NWT A;  2RDP A;  3OWT A;  1ETW A;  3E1S A;  5HVQ C;  4GRI A;  3R0A A;  3IV5 A;  1SAN A;  4E6K G;  2V1N A;  3OS2 A;  1K7A A;  3OSG A;  2WC2 A;  2JRM A;  1T6S A;  2YX4 A;  3JRB A;  3AKZ A;  3IWZ A;  2XB5 A;  5FKL A;  2PX9 A;  5FRM A;  3C2H A;  2Y0S A;  4RGX A;  3P9I A;  1WJE A;  3W6V A;  2DYS H;  2CMP A;  2DI3 A;  1BI1 A;  4MFD A;  1ZR4 A;  3H3U A;  2CO5 A;  1J59 A;  3PIO F;  2VT3 A;  4N9H A;  4Y52 J;  1YW8 A;  5ERI A;  5D5U B;  4QPQ A;  5F04 A;  1G2H A;  4RLQ A;  4DYR A;  2OTL I;  1SD5 A;  3I0T A;  3LA3 A;  1X4O A;  2OF7 A;  3BTJ A;  4A3D J;  3H92 A;  2KIS A;  1HDD C;  3K2A A;  4ESF A;  4BXU A;  3H0D A;  2LDU A;  2R0Q C;  2WAQ A;  3GFJ A;  2CV0 A;  4IRG A;  3MN2 A;  5CLS A;  1S29 A;  4HX4 A;  2QYO A;  2ESN A;  1F36 A;  2KL4 A;  2XAJ A;  1BR4 A;  4XOP A;  4XLN F;  3WE3 A;  2R5Y A;  3M3Y J;  3BG5 A;  1TNS A;  1BIA A;  4F91 B;  4M3D A;  3TGN A;  3SZT A;  2E5Z A;  3DU6 A;  4W1U A;  2V26 A;  2RKH A;  5B5E C;  4QTR A;  2HFH A;  2DU9 A;  1MD0 A;  1PUF A;  2PJP A;  3HJE A;  5EGO B;  1G4D A;  4UVC A;  3RQI A;  3B73 A;  5LLQ A;  1KU7 A;  2ZBK A;  4UB6 C;  3W6K B;  4E7I A;  2ID6 A;  4PJ0 C;  4IL6 C;  2KIF A;  2MSY A;  2DDA A;  3GTG J;  5DM6 F;  3H0G J;  3MKY B;  2W48 A;  2KP6 A;  2BY2 A;  3F9K A;  4G6D A;  2VOD A;  4RGU A;  4XLP F;  4AVZ A;  1K83 J;  3QU3 A;  1RES A;  2O03 A;  2XAH A;  4DW6 A;  2W1O A;  1CQT A;  3DLL F;  4XN0 A;  1BOA A;  4L9N A;  4XL9 A;  1J0R A;  3RZD J;  2VL8 A;  1MND A;  1ULY A;  2P5L C;  1A5J A;  2DFF A;  2ZJ2 A;  1OYY A;  1IUY A;  2GA2 A;  2K02 A;  3E6C C;  4A6E A;  3OYH A;  1R49 A;  1DPR A;  1IN7 A;  1OCR H;  1ACI A;  2JTV A;  1TLH B;  4IZZ A;  3DEU A;  1LPQ A;  4IEJ A;  3WTT C;  3U9G A;  1BM9 A;  1QPM A;  4U0W A;  4J01 A;  2LD5 A;  3HHH A;  2V7F A;  2IA1 A;  3DKW A;  3HIF A;  3IKV A;  2O8X A;  3BR2 A;  5M5X J;  2OZU A;  4M6V A;  4D7N A;  4ZJZ A;  4KYW A;  5E17 F;  1G3W A;  3SEQ A;  5FLM J;  1DU6 A;  3FXK A;  3ROU A;  2OCE A;  1W5T A;  2DA7 A;  4NDL A;  2OC6 A;  4AWX B;  5BS6 A;  3LSR A;  5EGO A;  4KFC A;  4KIF A;  4CCL A;  1MH4 A;  2L4A A;  2L9R A;  3IAS 2;  1YIO A;  5D4R A;  3F22 A;  3G1M A;  5DDG A;  9ANT A;  5FLV A;  1IO2 A;  4HF1 A;  2IXS A;  2JT1 A;  2GXA A;  3JCU C;  5KHD A;  2BY1 A;  4M73 A;  2M9H A;  4PDK A;  2KDZ A;  3E7L A;  2K9M A;  2CQ7 A;  3UR3 C;  3JSO A;  2X6W A;  2AHQ A;  1L3L A;  2K3F A;  1GUU A;  4XIC A;  3FXO A;  2ADU A;  1FOW A;  1ETV A;  3HRT A;  3KP6 A;  2XF7 A;  1XN7 A;  1Z91 A;  2XKO A;  2GOM A;  4YIF A;  1KQ0 A;  2A61 A;  2XKP A;  1SC7 A;  5L3E A;  2K9Q A;  2UV1 A;  3GO5 A;  5AON A;  2WBM A;  2WWY A;  5FFX A;  2R3S A;  5GTI C;  4CCO A;  1LQ1 A;  4HOB A;  1EH7 A;  1T98 A;  2M2E A;  3A01 B;  4BS9 A;  1KYW A;  2BYV E;  4ENK A;  1ITY A;  2XAQ A;  5EDN A;  3G71 I;  3FXQ A;  3CMM A;  3H5N A;  1JE8 A;  1MNM C;  4F93 B;  3W2W A;  2CUJ A;  1WJC A;  4PJL A;  3RIR A;  1X3U A;  2F2E A;  1LFU P;  2B0L A;  4BUP A;  2OPT A;  2LYC A;  4NQW B;  1A31 A;  2XPV A;  3ZGK A;  1ZYR F;  1YI2 I;  4PFO A;  3TBI A;  1NTC A;  4FIS A;  2NVU B;  1I6X A;  2ELK A;  3M8E A;  5DYM A;  1QZE A;  3BZC A;  3PUB A;  3F6O A;  4NBQ A;  3RSN A;  4M3G A;  3WTU C;  2STW A;  1FP1 D;  1OCO H;  1ETX A;  2YU3 A;  3O8G A;  3P9K A;  1BIB A;  3ABU A;  1Z21 A;  3WTY C;  2CFX A;  1U78 A;  1ZH5 A;  2V1D A;  4OMZ A;  2LR8 A;  5TRD A;  1ENH A;  2VI6 A;  3SFI A;  2I8D A;  5BPD A;  3E5X A;  2DN0 A;  3N05 A;  3HOS A;  3REO A;  1YO5 C;  3E5U A;  2P5K A;  2K9L A;  4RLF A;  1IN5 A;  1C0W A;  5B1A H;  1FBU A;  5TGT A;  3W2A A;  1D3Y A;  1IRX A;  2QSG X;  1VQN I;  1TWC J;  2UXN A;  4I02 A;  4Z6Y A;  5FRO A;  4Y3O A;  4UVA A;  5AIQ A;  1QBJ A;  3A01 A;  1FZP B;  4O5V A;  2GOX B;  1IRZ A;  3BR0 A;  5DV5 A;  3I4N J;  4XKC A;  1X1B A;  2M4K A;  1WSU A;  1AWC A;  1STZ A;  1PYV A;  1LFB A;  1HOM A;  1XGN A;  4R8H A;  3U1K A;  4FCY A;  1H8A C;  4OIO F;  3K70 C;  3RYR A;  3E0J B;  4NQW A;  4IKF A;  1YS7 A;  1LJ9 A;  3F8C A;  5DCF A;  5L3G A;  3A1Y A;  4A3L J;  3HL2 A;  1R4N B;  3H36 A;  2OV7 A;  3QP6 A;  4O6J A;  3VSK A;  1Y39 A;  1BW6 A;  1TW2 A;  1UHM A;  2QKL B;  5HOO A;  3HUG B;  4EGY A;  5IYD J;  1TZL A;  3GX4 X;  4ZYE A;  1B8I B;  4MIM A;  2XGX A;  1S3J A;  2DT7 B;  1BJZ A;  1DUX C;  2A69 F;  2ISZ A;  5ILS A;  1OFC X;  2F5E A;  5BMZ A;  5IP9 J;  5L3B A;  3GW2 A;  3SZP A;  4HQE A;  2QEN A;  3RPQ A;  3LL7 A;  1V54 H;  2DOE A;  2VQC A;  2IS1 A;  4GGG A;  3RQ4 A;  2JA8 J;  2YR2 A;  1MBF A;  1D1C A;  1FOK A;  3HRS A;  1HLV A;  2EIM H;  4BDZ A;  3O3K A;  1SFU A;  3HGY A;  2NVY J;  1R7J A;  3ERM A;  1FTT A;  5J8F A;  1CF7 B;  1PVE A;  1UST A;  4MQ9 F;  4ON0 A;  4F3Q A;  3PUF A;  3V7C A;  5E3M A;  4DYQ A;  3S2D J;  2OZ6 A;  3FXJ A;  3M8J A;  3VWB A;  3GTJ J;  3KYD B;  2DTZ A;  1OYI A;  5K1Y A;  5J6X A;  3S1Q J;  4MGR A;  3VSL A;  4BBR J;  2CJJ A;  3KZI C;  3CCR I;  2STT A;  5GPC A;  1O3Q A;  2R7R A;  4N9I A;  1LB2 A;  3OS0 A;  3K4C A;  3FKI J;  2LOO A;  3K4K A;  2CQK A;  3I58 A;  4LLG F;  3Q0V A;  2HOE A;  5H6R A;  3JSP A;  1JJ8 C;  2OQR A;  3TW7 A;  3ZR8 X;  2ZME B;  3DEW A;  3FXM A;  3FHZ A;  3FK6 A;  3O8H A;  1ETK A;  2XB0 X;  3KYL A;  4KT6 A;  1RKW A;  4A3M J;  3GBG A;  4A69 C;  4WX9 A;  2V6C A;  3HUG A;  2FBH A;  1MNE A;  2J5P A;  3NEU A;  2QQA A;  2OQG A;  3BJ6 A;  3OYB A;  2D45 A;  1QRY A;  1KU9 A;  1G59 A;  3J80 Z;  5F6F A;  4KMF A;  2PJR B;  1ZTR A;  3G2B A;  1SFO J;  4A5N A;  1FOX A;  4KIG A;  3HTU A;  4B44 A;  4C3J J;  3ZXS A;  1I39 A;  3ZCO A;  3ISP A;  5K5Q A;  5E8G A;  3LOC A;  1AHD P;  3S3O A;  1MKM A;  1CF7 A;  3IAM 2;  2ZB9 A;  1EJ9 A;  2O5R A;  5EZG A;  2BZT A;  5CQG A;  2HPM A;  3CC2 I;  3EPZ A;  1RR8 C;  2R7W A;  4EJU A;  1KU3 A;  1Z7L A;  3HTS B;  4ZDP A;  1QPI A;  3F8N A;  3CO7 C;  3D0S A;  4LGW A;  5LRR A;  3ZMT A;  2E7W A;  2VC0 A;  4D0P A;  4X6A J;  4WXH A;  2F4I A;  1YG2 A;  2EPF A;  4WK8 F;  2VC1 A;  3CMY A;  1K61 A;  4N0B A;  4RAZ A;  1BC7 C;  2M87 A;  1GXQ A;  2G7U A;  2VQL A;  4EJW A;  2ZME A;  1PUE E;  3SXY A;  3Q9V A;  3BG9 A;  5E3O A;  1O7F A;  1D1A A;  2VAS A;  4A0X A;  5CVR A;  1X1C A;  1IRF A;  3F72 A;  3T8R A;  2MH2 A;  3L2Q A;  1ORK A;  3KLN A;  3DCF A;  4E4H A;  2W82 A;  4I09 A;  1EV7 A;  1A36 A;  1TWA J;  2FE3 A;  4A3F J;  1HW2 A;  3KYC B;  2W57 A;  2HU9 A;  3WU0 A;  1FYL A;  2VKE A;  4RB0 A;  2PJR A;  1W0T A;  3O2P E;  5C4X J;  1ZG1 A;  3M4O J;  4Y7N J;  1YJN I;  5J1Y A;  3HOW J;  5E20 A;  3PIP F;  1V4R A;  2IA2 A;  4BY7 J;  5B3S H;  1NK2 P;  4XMY A;  4HNU A;  2E2H J;  3PQK A;  4AIK A;  5JVG F;  4RGR A;  3VDX A;  1X2N A;  2BY3 A;  5F27 A;  3DTE A;  4FET A;  5L3F A;  2AXT C;  1QQI A;  3T1B A;  2QM3 A;  2M30 A;  4BH9 A;  3H35 A;  4JQF A;  3BJA A;  4XBF A;  1Z3X A;  3HYI A;  1EKE A;  3CLQ A;  2BY0 A;  3J7Y J;  4E7J A;  4BDY A;  2KT0 A;  4A3C J;  3TDZ C;  2VE8 A;  1ZGJ A;  2NS0 A;  4DZP A;  4BE2 A;  1SFX A;  4MEY F;  3RKX A;  2CUE A;  4EVI A;  5D8K B;  3OYG A;  1JUM A;  2HYF A;  1KGS A;  1HQC A;  3WGI A;  4CIC A;  1Z0X A;  3OYJ A; 
#chains in the Genus database with same CATH homology
 1XMK A;  2M8E A;  3CJN A;  2H27 A;  1CGP A;  5HLH A;  2M1B A;  4LG0 B;  2GAU A;  5EEG A;  1R00 A;  4Y15 A;  1XDS A;  1QO0 D;  4A0Y A;  1K6O A;  2DPU A;  3GZ6 A;  5D4S A;  1F1Z A;  2CW0 F;  4EJT A;  2XAS A;  1Z1D A;  3C3W A;  2VE9 A;  3J7A O;  2VT2 A;  4BQA A;  5LGU A;  3BY6 A;  5CYV A;  3ZN0 A;  4EMS A;  1P4W A;  1WQ2 A;  2WV0 A;  3DV8 A;  4L9V A;  1IN6 A;  3MEX A;  4HV6 A;  4HLX A;  4WF2 A;  1FT9 A;  3V4G A;  2EV0 A;  3ABT A;  4XSX F;  3TOA A;  1U5T B;  5D5W B;  1R1U A;  3HOT A;  1HBX G;  3WTS C;  3CO6 C;  2M5W A;  1P4X A;  1PP7 U;  2LF7 A;  4K2E A;  4B8X A;  1F5T A;  5D6E A;  4CO8 A;  2H09 A;  3MQ0 A;  3L2C A;  3CLO A;  4G7Z F;  4LG0 A;  4I2O A;  4L0Z B;  3F8F A;  2EFW A;  1R1T A;  5ICF A;  2DLL A;  2RV8 A;  4UHT A;  3BDD A;  3ERE D;  2HQR A;  4KN4 X;  3MZY A;  3T8T A;  2FF4 A;  3KZZ A;  3LQQ A;  1GHC A;  2DT5 A;  3M9A A;  1W7P B;  4G7O F;  2MC3 A;  4S05 A;  4WXC A;  1U5T A;  3N4M A;  4GYG A;  1R22 A;  3IL2 A;  1XD7 A;  3LWF A;  1ZG3 A;  1KQ9 A;  1O3R A;  4KNY A;  4Y17 A;  4P9U A;  3L9F A;  6PAX A;  5FLX Z;  1ON2 A;  2A3S A;  3MWM A;  3COA C;  4HV5 A;  2XRO A;  2HWV A;  1FWZ A;  2ELH A;  4Y13 A;  2EV6 A;  2ZO4 A;  4LK0 F;  2LNB A;  4M74 A;  3ZN1 A;  4EGZ A;  4ESB A;  1ZG5 A;  2H94 A;  4IHS A;  1OMI A;  2EFP A;  4H0E A;  4YII A;  1Z6R A;  1XB4 A;  1W7P A;  1FNN A;  4L9T A;  3I5U A;  3I54 A;  1I1S A;  2RQP A;  4U0V A;  2X4H A;  4TV7 A;  2RGV A;  1TQI A;  1O57 A;  3TO9 A;  3IWF A;  4A6D A;  4L0Y B;  2W24 A;  1HKQ A;  1LEA A;  1R1V A;  3JTG A;  3E6M A;  2EB7 A;  3P9C A;  5HLI A;  3G3Z A;  4GXO A;  1XSX A;  2X0L A;  1FSE A;  3ECH A;  2EA2 A;  1YYV A;  4CGZ A;  4FT8 A;  4HAM A;  1S7A A;  4OOI A;  1J9I A;  3ULQ B;  4ETS A;  2TDX A;  5KK1 A;  3GFI A;  1B9M A;  1SFE A;  5D6F A;  1IN4 A;  3LFK A;  3VOE A;  4U88 A;  5F64 A;  5HLG A;  1QNT A;  3T5X A;  4PGG A;  1IW7 F;  4A12 A;  4I0A A;  3T0Y A;  3WOD F;  4EJV A;  4HDU A;  2FNP A;  5HS9 A;  3LQR A;  1ZRD A;  4YFX F;  2QQB A;  1IXS B;  3GFM A;  2NNY A;  5D5X B;  2DO7 A;  4WCG A;  2YSR A;  1BI2 A;  4KMU X;  1IRG A;  2L3D A;  1Z7U A;  3RI4 A;  3KFW X;  4LB5 A;  2W25 A;  1DDN A;  2D2W A;  4HLY A;  4IVN A;  5ILU A;  1R23 A;  3PFI A;  1IXC A;  4WXD A;  1W7P D;  2HKO A;  4DNC A;  2MA3 A;  3KLO A;  2G9W A;  1W4M A;  5ILV A;  2FNA A;  1VTN C;  5FLX K;  3HSE A;  2R7F A;  3FWE A;  2M45 A;  2MBF A;  3TO7 A;  1LNW A;  1I5Z A;  3BPV A;  4UXN A;  2BEO A;  4IHT A;  5ICG A;  1BN5 A;  2VOP A;  1JHH A;  1LVA A;  2KJB A;  4U7D A;  2EWN A;  2XAG A;  3SHF A;  1K78 B;  5E1W A;  1BBY A;  1J5Y A;  1O3T A;  2ACJ A;  3CDH A;  3R60 A;  1YLF A;  3DPT A;  3V7R A;  4Q5S F;  1E17 A;  2F5C A;  3KP7 A;  2DPD A;  4GO1 A;  3BP8 A;  1ZRE A;  3J81 Z;  2O6G E;  2VON A;  1OKR A;  1QZY A;  1RUN A;  5LRS A;  2A5Y B;  1IN8 A;  5EEH A;  5HDN A;  4U0Y A;  2JPC A;  3BPX A;  3TQN A;  1FP2 A;  4O3M A;  4MNU A;  2QUF A;  3R0J A;  2IRF G;  4XRF A;  2NNN A;  2DFI A;  2HS5 A;  1K78 A;  3BRO A;  1Z6T A;  3E6D A;  1Z9C A;  1WKM A;  2RNJ A;  2Q0O A;  1MJ9 A;  3JTH A;  1R58 A;  2XRN A;  2K86 A;  2PN6 A;  1F4K A;  1ODD A;  4HX7 A;  4UV9 A;  3WGG A;  4G94 A;  5KVR A;  1DP7 P;  2UWM A;  4KIC A;  2ETH A;  4HW0 A;  5HS8 A;  5FB2 A;  2HTS A;  2FEZ A;  1YW7 A;  1SMT A;  5FD5 A;  5ICE A;  4ESJ A;  3ZMS A;  4BHC A;  1ON1 A;  2EFO A;  4M6Y A;  1ZLJ A;  3PQJ A;  2CGP A;  4M72 A;  2EFN A;  4G6Q A;  1FC3 A;  3F8M A;  1W5S A;  1TQM A;  3HRM A;  2KIM A;  2K27 A;  3OV8 A;  1JGS A;  1HST A;  4G7H F;  5TJJ A;  2DAO A;  2DBB A;  3M8F A;  4HA8 A;  1MDM B;  1SMY F;  2DK8 A;  4WWC A;  4JBA A;  2EA4 A;  3C7J A;  1F9N A;  1OYW A;  1OPC A;  2Z5U A;  5LGT A;  3KP2 A;  1ZLK A;  4CHU A;  2KJC A;  3S2W A;  4Z2Y A;  2HEO A;  5LGN A;  5D8L B;  3FZV A;  1ONV A;  3QRF F;  3DF8 A;  3LA7 A;  4M6X A;  2DK5 A;  1B9N A;  3QPH A;  1IF1 A;  2DW4 A;  4LFU A;  3GZ5 A;  3J81 K;  1H9G A;  1ZRC A;  4FHT A;  4BYY A;  5LBQ A;  1U3E M;  3FX3 A;  3WTZ A;  1AOY A;  3LST A;  1USS A;  1MDM A;  1PP8 F;  3QOP A;  2COM A;  3CUQ C;  1ZN2 A;  2A07 F;  1D8K A;  1REP C;  1J2X A;  4OMY A;  4AIH A;  3WTV C;  2AS5 F;  4G9Y A;  2XIG A;  1YQA A;  3WE2 A;  1T2K A;  2BGC A;  2MLK A;  1IZ1 A;  3GVA A;  1B6A A;  2DQL A;  3ML6 A;  4UUV A;  1WWX A;  1BC8 C;  3QU6 A;  5JHU A;  5HDK A;  5IT9 Z;  3ZMV A;  2Y0M A;  2R7D A;  5JR3 A;  1HSJ A;  3R4K A;  1O3S A;  3FMQ A;  4CZZ A;  2PEX A;  3ELK A;  1T0F A;  2K4J A;  1O7L A;  2Y75 A;  2KRF A;  1P4A A;  3MFK A;  5CVU A;  2FXA A;  3G73 A;  2H6B A;  3W6J B;  2IW5 A;  1RUO A;  2P6S A;  1MJA A;  3JW4 A;  4FX0 A;  4HZF A;  3U2R A;  5HS7 A;  4PZJ A;  3VEP A;  3VFZ A;  1XMA A;  2F5F A;  3J80 K;  1GXP A;  3KP4 A;  3V8J A;  4BHB A;  3P7N A;  2PLY A;  2VBZ A;  1WRJ A;  3ZMU A;  2ZFW A;  4GCV A;  4YFN F;  3IRQ A;  2QBY B;  1D8J A;  1XGS A;  4HDV A;  2C6Y A;  2XHK A;  3AAF A;  4ZYD A;  3WTW C;  2EV5 A;  4CDG A;  2KKO A;  2GXB A;  5BPI A;  2FMY A;  1KU2 A;  1ZAR A;  4AIJ A;  2VBW A;  1TBX A;  3ZPL A;  1S8N A;  1ZRF A;  4I01 A;  3K2Z A;  4U7B A;  5A2Q Z;  3LA2 A;  2FBI A;  2V1U A;  1UHW A;  2K7L A;  4M9S A;  4R1H A;  2V79 A;  2ZNZ A;  4KT5 C;  3E5Q A;  1BI3 A;  2JPB A;  4NHJ A;  4Q48 A;  2Z3Y A;  2QBY A;  3C18 A;  1UFM A;  4M9X A;  1HW5 A;  3K9T A;  2HTJ A;  4Q4Z F;  3ZMD A;  1YW9 A;  1SD6 A;  1ZAO A;  2E1C A;  4LD5 A;  4UNO A;  1TQP A;  5F1R A;  2FRH A;  1I1G A;  2XAF A;  3CUO A;  5LEJ A;  2FBK A;  4IPA A;  2A6E F;  4QWQ A;  2PMH A;  1OR7 A;  2BBY A;  5CVV A;  4KA4 A;  1FY7 A;  5IT9 K;  1A04 A;  1LDD A;  1B4A A;  3DQV C;  3FF5 A;  5E8I A;  2BE5 F;  2FQ3 A;  2MLG A;  1R5G A;  3FM5 A;  4GYI A;  1RZ4 A;  3RPU A;  3FXR A;  1G3S A;  4HYE A;  4ZZL A;  4FX4 A;  1H9T A;  2Q2E A;  4HF0 A;  5JVT A;  2EFQ A;  4A5M A;  4BNC A;  2RC4 A;  4EM0 B;  3FMS A;  1KQ8 A;  1XSD A;  4L5I A;  3RYP A;  3EDP A;  3KET A;  2E7X A;  4M71 A;  4I98 B;  1HXD A;  3GUD A;  1FX7 A;  3F6V A;  4S04 A;  4IXA A;  2DTR A;  3IRR A;  1YS6 A;  1EH8 A;  1U2W A;  5BQT A;  3TKY A;  3ZQ7 A;  1TTY A;  3BJO A;  4ENM A;  1UB9 A;  4IRH A;  1WI9 A;  3IKT A;  1LEB A;  1ZGA A;  1UCR A;  3MAJ A;  4B09 A;  2GWR A;  3I59 B;  4ENN A;  2Z99 A;  3KP5 A;  5LHI A;  4PGH A;  3RKW A;  4EM1 A;  3BZ6 A;  3GEZ A;  2G7H A;  2IVM A;  2GXG A;  2OA4 A;  1XSV A;  3DFG A;  2NAZ A;  1J75 A;  3GLX A;  1FYM A;  4AVP A;  1XCV A;  4G8X A;  2PI0 A;  3H3Z A;  3RTR A;  2PFB A;  4RAY A;  3SFZ A;  5A2Q K;  5DD8 A;  4OIR F;  3EET A;  2VBY A;  3Q9S A;  3M7G A;  4JK1 X;  2ESH A;  3V8K A;  3RDI A;  3DPL C;  4QLC U;  1Y0U A;  3ECO A;  4RB2 C;  2GQQ A;  4UV8 A;  1D5V A;  3U1D A;  2IPQ X;  5JI6 A;  2P4W A;  2LSO A;  1G3Y A;  4MTD A;  2MD5 A;  3I59 A;  2VBX A;  3M1E A;  5ICC A;  2IP2 A;  4LMY A;  3ZMZ A;  2NRA C;  3I4P A;  2CYY A;  1G6N A;  1KA8 A;  4ZYG A;  3KZY A;  1HW1 A;  3VOD A;  4HQM A;  3FMR A;  2CWE A;  4LLL A;  1B1B A;  2PMU A;  2ZKZ A;  3V7S A;  3D5L A;  2HYG D;  4LB6 B;  2HQN A;  2P8T A;  3GF2 A;  3LAJ A;  3K1M A;  2VOO A;  2HGC A;  1RIO H;  1T38 A;  3I53 A;  2GZW A;  4AD9 A;  1EH6 A;  4RB1 A;  5FFZ A;  1IAW A;  4OIN F;  3QP5 A;  1G3T A;  5K5O A;  3K69 A;  2HKX A;  4OU0 A;  1IXR C;  2L4M A;  3MCZ A;  2E1N A;  1YFH A;  2J5O A;  5L3D A;  2OU2 A;  4MHG A;  3HSF A;  1Z05 A;  3RKY A;  1XCB A;  2QWW A;  2Y48 A;  3HHG A;  1Q1H A;  5DCM B;  2OAZ A;  1SAX A;  3TO6 A;  4EQQ A;  5CJ9 A;  4OIP F;  3F8B A;  4HF2 A;  2FA5 A;  2ZXJ A;  2DQR A;  4LLN A;  3FM3 A;  2H6C A;  2A68 F;  2YPR A;  3F3X A;  2JZY A;  1K79 A;  3FXU A;  4KUM A;  3R61 A;  2W85 A;  4A2U A;  3EYY A;  4YFK F;  1B59 A;  4L18 B;  4BHP A;  1JXS A;  3K1P A;  2OD5 A;  4P55 A;  1E2X A;  2CSO A;  5E1Z B;  1DPU A;  2P7C B;  3EYI A;  3CTA A;  2P6T A;  2QQ9 A;  1JHF A;  2FOK A;  4LK1 F;  1BJA A;  2D1V A;  2PQ8 A;  5DCM A;  1RI7 A;  2JSC A;  3JAM Z;  1QZZ A;  4CXF A;  4P96 A;  4KIB A;  4NB5 A;  4RB3 C;  4ZZD A;  2P5V A;  3E97 A;  3C1D A;  2D1H A;  3IHU A;  4P5O A;  3L7W A;  4EJO A;  4PCQ A;  1SD7 A;  4HX8 A;  3KEO A;  3HSR A;  2JRT A;  2MH9 A;  1S6L A;  5LEK A;  1XDU A;  2QVO A;  2VXZ A;  5D5V B;  1I27 A;  2V1X A;  4I0B A;  2W84 A;  3QAH A;  1LDJ A;  3QPT A;  4I7H A;  2ISY A;  3KE2 A;  2K4B A;  1TNT A;  2IA0 A;  4MEX F;  2L02 A;  2WTE A;  3L09 A;  3R6S A;  2OBP A;  3BWG A;  4KDP A;  2HZT A;  3WU1 B;  1MJB A;  2HR3 A;  1V3F A;  1ZHF A;  1P6R A;  2A6H F;  2YX7 A;  1R5H A;  3NQO A;  3DXJ F;  3EQL F;  5FGM A;  5H20 A;  3KP3 A;  1BI0 A;  4EV0 A;  2PG4 A;  1FBQ A;  1FBS A;  1FYK A;  2O3F A;  4P9F A;  3KCC A;  5LHH A;  2L54 A;  3IC7 A;  2QLZ A;  4L9J A;  5CVI A;  4BAY A;  4KN7 X;  2IJL A;  5DEQ A;  2NYX A;  5HDG A;  1HKS A;  2AXL A;  3TDU C;  4RGS A;  3E3V A;  4ZYH A;  1FLI A;  5FD6 A;  2BV6 A;  3K0L A;  3V8L A;  3RJP A;  1U5T C;  3DP7 A;  3GFL A;  4R79 A;  1RNL A;  4YG2 F;  2FSW A;  5JFR A;  4HBL A;  3O6B B;  3K1N A;  5AIP A;  1PDN C;  2VN2 A;  4MQV A;  3GXO A;  1H0M A;  3I64 A;  1XGM A;  3CUQ B;  2HDC A;  1MZB A;  5IT3 A;  3HRU A;  1NHA A;  1R36 A;  2EJR A;  1LDK B;  3JAM K;  2XUB A;  2CG4 A;  3BOQ A;  2F5D A;  1U6G A;  4MTE A;  1HKT A;  2Z9O A;  4OIQ F;  1FSH A;  3B02 A;  2GA1 A;  2LKP A;  3GWZ A;  1P2F A;  4L5J A;  4ENJ A;  1L0O C;  2PBI A;  2V9V A;  1GVJ A;  2EK5 A;  1P92 A;  2FML A;  5K5R A;  2ZNY A;  3I71 A;  4LJZ F;  5DD4 A;  3CUQ A;  3EUH A;  3WTX C;  5DUI A;  2XVC A;  4EM2 A;  4CYD A;  3LAP A;  3F21 A;  2XV4 S;  5FO5 A;  2O61 A;  3NRV A;  4E70 A;  1TW3 A;  3Q5F A;  3SQN A;  3N97 A;  2FU4 A;  3ZP5 A;  4IF4 A;  3VB2 A;  2RVC A;  4ASN A;  4UVB A;  3E6B A;  3WG9 A;  3GYH X;  1T39 A;  3L00 A;  1MGT A;  1XGO A;  2QZ8 A;  4RS8 A;  3TOB A;  5LHG A;  2IT0 A;  2UXX A;  2L01 A;  2O0Y A;  3WGH A;  3F23 A;  5L3C A;  2RN7 A;  1FPQ A;  2LF8 A;  1QGP A;  2GIV A;  4IRI A;  5H6Q A;  5ED4 A;  1S7O A;  2P7V B;  2Q8K A;  2UZK A;  2ZCW A;  5J8C A;  4ZH4 F;  3MZH A;  1YTY A;  1J7K A;  1SD4 A;  2Z33 A;  5CVJ A;  4M9Z A;  4F7Z A;  3OOP A;  4IJA A;  5E18 F;  4DQ2 A;  5E1X A;  5BOX A;  4Q47 A;  2KIU A;  1U8R A;  4A0Z A;  4XSZ F;  5DUK A;  3KEQ A;  1KYZ A;  2RDP A;  5HVQ C;  3R0A A;  1K7A A;  2WC2 A;  1T6S A;  2YX4 A;  3IWZ A;  4RGX A;  3P9I A;  2DI3 A;  1BI1 A;  3H3U A;  2CO5 A;  1J59 A;  2VT3 A;  4N9H A;  1YW8 A;  5ERI A;  5D5U B;  1SD5 A;  3I0T A;  3LA3 A;  3H92 A;  4ESF A;  4BXU A;  2LDU A;  3GFJ A;  4IRG A;  5CLS A;  1S29 A;  4HX4 A;  2QYO A;  2ESN A;  2XAJ A;  4XLN F;  3WE3 A;  1TNS A;  1BIA A;  3TGN A;  3SZT A;  2RKH A;  2HFH A;  2DU9 A;  1MD0 A;  2PJP A;  1G4D A;  4UVC A;  5LLQ A;  3B73 A;  1KU7 A;  2ZBK A;  3W6K B;  2KIF A;  4G6D A;  2VOD A;  4RGU A;  4XLP F;  3QU3 A;  2O03 A;  2XAH A;  1BOA A;  4L9N A;  1J0R A;  1ULY A;  2P5L C;  2ZJ2 A;  1OYY A;  1IUY A;  2GA2 A;  2K02 A;  3E6C C;  4A6E A;  1DPR A;  1IN7 A;  2JTV A;  1TLH B;  3DEU A;  3WTT C;  3U9G A;  1BM9 A;  1QPM A;  4U0W A;  3HHH A;  2IA1 A;  3DKW A;  3HIF A;  3IKV A;  2O8X A;  2OZU A;  4KYW A;  5E17 F;  1G3W A;  3ROU A;  1W5T A;  4KFC A;  4AWX B;  5BS6 A;  4KIF A;  2L4A A;  1YIO A;  5D4R A;  3F22 A;  5DDG A;  4HF1 A;  2JT1 A;  4M73 A;  4PDK A;  3JSO A;  1L3L A;  2ADU A;  3HRT A;  3KP6 A;  1XN7 A;  1Z91 A;  2XKO A;  4YIF A;  1KQ0 A;  2A61 A;  2XKP A;  5L3E A;  3GO5 A;  5AON A;  2WWY A;  5FFX A;  2R3S A;  1LQ1 A;  4HOB A;  1EH7 A;  1T98 A;  1KYW A;  2BYV E;  4ENK A;  2XAQ A;  3FXQ A;  1JE8 A;  3RIR A;  1X3U A;  2F2E A;  2B0L A;  1ZYR F;  1I6X A;  3M8E A;  5DYM A;  3F6O A;  3WTU C;  2STW A;  1FP1 D;  2YU3 A;  3P9K A;  1BIB A;  3ABU A;  3WTY C;  2CFX A;  1U78 A;  1ZH5 A;  2V1D A;  4OMZ A;  5TRD A;  5BPD A;  3E5X A;  3HOS A;  3REO A;  1YO5 C;  3E5U A;  2P5K A;  1IN5 A;  1C0W A;  1FBU A;  1D3Y A;  2UXN A;  4I02 A;  4UVA A;  5AIQ A;  1QBJ A;  1FZP B;  4O5V A;  5DV5 A;  1WSU A;  1AWC A;  1STZ A;  1XGN A;  4R8H A;  4OIO F;  3RYR A;  4NQW A;  1YS7 A;  1LJ9 A;  3F8C A;  5DCF A;  5L3G A;  3QP6 A;  4O6J A;  1TW2 A;  1UHM A;  5HOO A;  4EGY A;  3GX4 X;  4ZYE A;  1S3J A;  2XGX A;  1DUX C;  2A69 F;  2ISZ A;  5ILS A;  2F5E A;  5BMZ A;  5L3B A;  3GW2 A;  3SZP A;  4HQE A;  2QEN A;  3RPQ A;  4GGG A;  2YR2 A;  1FOK A;  3HRS A;  3O3K A;  1SFU A;  1R7J A;  5J8F A;  1CF7 B;  1UST A;  4MQ9 F;  4ON0 A;  3V7C A;  2OZ6 A;  1OYI A;  5K1Y A;  5J6X A;  4MGR A;  2STT A;  1O3Q A;  4N9I A;  1LB2 A;  2CQK A;  3I58 A;  4LLG F;  2HOE A;  5H6R A;  3JSP A;  2OQR A;  2ZME B;  3FHZ A;  4WX9 A;  2V6C A;  3HUG A;  2FBH A;  2J5P A;  3NEU A;  2QQA A;  2OQG A;  3BJ6 A;  2D45 A;  1KU9 A;  3J80 Z;  5F6F A;  4KMF A;  4A5N A;  4KIG A;  3HTU A;  3ISP A;  5K5Q A;  5E8G A;  1MKM A;  1CF7 A;  4EJU A;  1KU3 A;  3HTS B;  3F8N A;  3CO7 C;  5LRR A;  3D0S A;  4LGW A;  3ZMT A;  2E7W A;  2VC0 A;  4D0P A;  4WXH A;  1YG2 A;  4WK8 F;  2VC1 A;  4N0B A;  4RAZ A;  1BC7 C;  2M87 A;  1GXQ A;  2G7U A;  4EJW A;  2ZME A;  1PUE E;  3SXY A;  3Q9V A;  1O7F A;  4A0X A;  5CVR A;  1IRF A;  3F72 A;  3T8R A;  2MH2 A;  3KLN A;  4I09 A;  1EV7 A;  2FE3 A;  1HW2 A;  2W57 A;  3WU0 A;  1FYL A;  4RB0 A;  3O2P E;  1ZG1 A;  5E20 A;  1V4R A;  2IA2 A;  3PQK A;  4AIK A;  4RGR A;  5L3F A;  1QQI A;  3T1B A;  2QM3 A;  2M30 A;  4BH9 A;  4JQF A;  3BJA A;  4XBF A;  3HYI A;  3TDZ C;  2VE8 A;  1ZGJ A;  2NS0 A;  1SFX A;  4MEY F;  3RKX A;  4EVI A;  5D8K B;  2HYF A;  1KGS A;  1HQC A;  3WGI A;  4CIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...