2L3DA

The solution structure of the short form swirm domain of lsd1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
GSVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The chemical shift assignment of the SWIRM domain of LSD1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lysine-specific histone demethylase 1A
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l3dA00
4UXNA 2HR3A 1Z6TA 5AIPA 3C18A 1HSTA 1U5TA 4WXDA 2XV4S 2WWYA 3GZ6A 4ZZLA 4UVAA 2A69F 2DPUA 2IA0A 4JBAA 2F2EA 3BP8A 3EUHA 1HW5A 1WKMA 5ICEA 1SD7A 4EM0B 3V8JA 2DLLA 4Q5SF 2P5VA 3W6KB 2AXLA 2UZKA 2QQBA 4LD5A 1WRJA 1F4KA 4HW0A 2XAGA 2QQ9A 3GUDA 2W84A 5ED4A 1B1BA 1ODDA 1W7PB 2XROA 3NEUA 3BWGA 2RC4A 3DPLC 3WGHA 4QLCU 4UV8A 3R6SA 4UVBA 1K78B 2VC1A 4G7OF 2F5EA 1FP2A 3QRFF 3MAJA 2MH9A 3M8FA 2RV8A 2E7WA 2VT3A 5J8FA 4YFXF 2G7UA 4L9TA 4MGRA 2D45A 1PP8F 5FB2A 3J80Z 3ZMSA 5BS6A 5ICFA 2DO7A 3Q5FA 2QBYA 4ETSA 4GO1A 1B9MA 4LK1F 5DCMA 2E1NA 3TKYA 3I64A 5A2QK 3IC7A 4BYYA 1STZA 2F5FA 3GXOA 1R58A 1S7AA 1KU3A 3Q9SA 4BQAA 4RB2C 3GVAA 4M74A 1WQ2A 2VBYA 2HTJA 5E17F 3RI4A 3BROA 4LLGF 4P55A 2O3FA 2BBYA 3C7JA 3FXQA 2ZMEB 5ICCA 2A3SA 2R3SA 2DU9A 4MEXF 1PDNC 1YTYA 4R8HA 2F5CA 4FX4A 4YG2F 3BZ6A 4RGSA 5CLSA 4P9UA 1J9IA 1RUOA 2W85A 2O6GE 5D4SA 5E1WA 1FBSA 3ABTA 1KQ9A 5A2QZ 2RVCA 3DXJF 4B09A 1HW1A 2OBPA 3H3ZA 4CZZA 1D5VA 2R7DA 2QLZA 4L9NA 2HZTA 1TQPA 1TQIA 4G94A 3JW4A 3M1EA 3BJAA 1F1ZA 4HQMA 4PCQA 1FYLA 2QENA 4EJVA 2OU2A 5F6FA 1YG2A 1R1UA 4NQWA 2HYGD 4R1HA 3ZMTA 5EEHA 1AWCA 4XSXF 4EM1A 5DYMA 1L3LA 2QWWA 4WCGA 2YX7A 1LQ1A 5HLGA 3E97A 2VE8A 2ZNZA 2DPDA 4I7HA 2IRFG 3BJOA 1B59A 5AIQA 2IT0A 2RQPA 3R0AA 3ROUA 3MQ0A 5F64A 3HHHA 1IUYA 2GIVA 4ZYDA 1I27A 3HIFA 2V1DA 4MHGA 2XVCA 4YFNF 4R79A 1K78A 4EJWA 1XMKA 1QNTA 2DQLA 5LHIA 1ZGJA 3L7WA 1OR7A 4KN4X 2FBHA 4F7ZA 5D5VB 2Y48A 4CHUA 2YR2A 2NNYA 1U5TB 3H3UA 2Y75A 3F23A 4XRFA 4MQVA 1R00A 2KIUA 1IN7A 2YX4A 1VTNC 1USSA 1S3JA 4N9IA 2FE3A 1H9GA 2A68F 2XASA 2UXNA 5BPIA 1DPRA 2L4AA 3FMQA 3FF5A 5CYVA 4PZJA 5LRRA 3QPTA 5IT3A 2ESNA 1F5TA 4KMFA 3W6JB 3F8CA 2YU3A 1DP7P 5HS8A 1HBXG 3I59A 1HKSA 4A0YA 3KEQA 1IN8A 4IHTA 5AONA 3J7AO 4HOBA 3SZPA 2R7FA 2A6HF 1ULYA 3VODA 1TW2A 1U5TC 5ICGA 1ZG1A 4HBLA 4EQQA 1LDDA 4I09A 3KZZA 1K79A 1DUXC 2MLKA 4L5JA 4ENMA 2L4MA 1YLFA 3WG9A 2PBIA 2RDPA 2H09A 2JTVA 2MA3A 1RNLA 1IF1A 4BH9A 3MZYA 2V9VA 4OMZA 1LJ9A 2K7LA 5D5WB 3LSTA 3BJ6A 1P4AA 1XCBA 2EFOA 2VONA 2FQ3A 3WTWC 3TDZC 3I4PA 4HQEA 3HTSB 5L3GA 4HLYA 1IN6A 3I54A 4UHTA 4A5NA 1P4WA 3KZYA 3DPTA 3EYIA 3KETA 4RB1A 1O3RA 1YW8A 3HOSA 3Q9VA 3GW2A 5ERIA 4JQFA 5K5RA 4A6EA 4EMSA 2P5KA 3PQJA 1K7AA 3I71A 3S2WA 1D8KA 2CW0F 3ECHA 2HFHA 1CGPA 4UNOA 1UHWA 1V3FA 2E7XA 4ZH4F 3CO7C 3LA2A 4P9FA 4BHCA 2GAUA 3LAJA 1H9TA 1ZREA 1MJ9A 2MC3A 4WXCA 2JT1A 1DPUA 4RAZA 3CLOA 1IXRC 3T8TA 1OPCA 4HDVA 4BNCA 2MBFA 3ZQ7A 2QZ8A 3WGGA 4XLNF 1UFMA 4MQ9F 1FWZA 1FY7A 5DD8A 5BMZA 4M6XA 2FOKA 1R5GA 1ZRCA 3WTTC 1NHAA 5TRDA 3NQOA 1FYKA 1K6OA 1QQIA 1R5HA 2EJRA 2ZFWA 1YW9A 3IHUA 4L0YB 1Y0UA 2ZXJA 1B9NA 2NRAC 5DEQA 3RDIA 3E5XA 4G6QA 4WF2A 1HSJA 4XBFA 3JSOA 4HLXA 3N97A 1CF7A 3TDUC 1GHCA 2PN6A 1Z6RA 2XHKA 3V7CA 5D5UB 4P5OA 3V8LA 3WTZA 2XUBA 2XKPA 2HYFA 2JRTA 5D4RA 2EFPA 2XGXA 4PGHA 3I59B 4KIFA 2P8TA 1ON2A 1J0RA 3QAHA 5DCMB 2HEOA 5H6QA 1T0FA 1ZRFA 3QU6A 2HWVA 1JHFA 4A2UA 4KIGA 3VOEA 2K4BA 4EJOA 3ZN1A 5D6EA 2PJPA 3SHFA 4IRIA 2FXAA 2LSOA 4HV6A 4ESFA 3VB2A 4XLPF 5JHUA 4L9JA 2DW4A 1YO5C 2ZBKA 2PG4A 3MCZA 1TBXA 3QOPA 2E1CA 2H6BA 4HF1A 1Z1DA 1KGSA 4P96A 5BQTA 4I0AA 1P92A 4CDGA 4TV7A 5DD4A 4Y13A 1J59A 5JFRA 3FMSA 3VFZA 4RAYA 3F8BA 1JXSA 1IRGA 2XAJA 3GWZA 1ZH5A 4KT5C 2YSRA 1Q1HA 1BIBA 4AIJA 1E17A 1KQ0A 2KJBA 3LFKA 1O3QA 3ISPA 4IVNA 1TQMA 1HXDA 3L2CA 2M1BA 3JTHA 4EV0A 4OIQF 1BM9A 1BN5A 1BI2A 1IN5A 2Z3YA 2HGCA 5K5QA 4AIKA 1ZG5A 1TW3A 2A61A 3J80K 2K4JA 3O2PE 3ERED 1J2XA 1Z7UA 2MLGA 3T0YA 4CXFA 4Q4ZF 2FRHA 1W4MA 3KE2A 4Q48A 3P9IA 2BYVE 2YPRA 1JGSA 3RKWA 1Z9CA 1W7PA 5LGUA 3V8KA 4ZZDA 2CG4A 2M45A 4M9ZA 3SZTA 3KP7A 2XIGA 1O57A 1SAXA 2MD5A 3R60A 2IP2A 1YS7A 1FSEA 1FNNA 2LKPA 2HOEA 4GYGA 3GFMA 2QVOA 1P2FA 1T2KA 4M72A 5CVUA 5H6RA 3C1DA 4OU0A 3OOPA 3WE3A 4G9YA 4M9SA 2CQKA 1A04A 4QWQA 1W5TA 2O03A 4EGYA 4I2OA 4UVCA 4U7BA 1LDKB 3ZPLA 2DAOA 2OQGA 1R1VA 4K2EA 3J81K 3DF8A 2LF7A 2COMA 4HV5A 1BIAA 2FF4A 2Q2EA 3VEPA 3KEOA 5ILUA 3IKTA 3U1DA 3GF2A 2EFNA 2ADUA 4FX0A 4OINF 1BBYA 1JE8A 3EETA 3JAMZ 1ZAOA 3HSEA 5K5OA 3BY6A 5LLQA 1Z05A 2WV0A 4PGGA 4ASNA 2GWRA 2MH2A 3GFIA 1P6RA 2LF8A 5LGTA 1L0OC 1GXQA 2FSWA 4A6DA 1G3WA 1EH7A 1G3SA 2VT2A 4KFCA 1F9NA 2WC2A 1U2WA 1QBJA 1B4AA 2QUFA 1IW7F 5CVVA 5E20A 4Y15A 3WTSC 1LEBA 1CF7B 2BGCA 3R61A 2DK5A 3D0SA 1WWXA 3DV8A 2JSCA 5BOXA 2ZNYA 4ENNA 1U8RA 3ULQB 2Z33A 3ZP5A 2PI0A 1ZRDA 1XSXA 3F6VA 1QZYA 1S29A 5L3CA 5HOOA 4GGGA 1QZZA 5HS7A 2EFWA 4HF2A 4L5IA 1RI7A 5ILVA 1HKTA 1SMTA 4BXUA 3MWMA 3P9CA 2FMLA 4AVPA 3WE2A 5D6FA 3P9KA 3KLNA 4CICA 1FP1D 1ZGAA 2F5DA 2P4WA 3WTVC 3GO5A 1OMIA 5KVRA 5IT9Z 2Z99A 3U2RA 1G6NA 4MTDA 2STWA 2HQRA 3JTGA 4HX4A 3ZMZA 4U7DA 2X0LA 2J5OA 2CFXA 3FHZA 2EA2A 4M9XA 1QPMA 5LRSA 4RS8A 4UV9A 2XAQA 2ZMEA 5E1ZB 3CO6C 4I0BA 3H92A 3M8EA 1W5SA 3RKXA 5J6XA 2GXBA 2RN7A 3F8NA 2HKOA 4S05A 2AS5F 2OZUA 4PDKA 1Z91A 2L01A 4LFUA 4KA4A 5E18F 1S8NA 3F8MA 1U6GA 3PFIA 4A5MA 4EJUA 1JHHA 4U0VA 1J7KA 1O3SA 5HS9A 5K1YA 3T5XA 5IT9K 4U0YA 3JSPA 3BPXA 3L09A 2GXGA 1G4DA 3GLXA 3WTXC 3I0TA 3WTUC 3FX3A 2QQAA 4E70A 3TO6A 3ZMVA 4IJAA 1TTYA 2PFBA 4ZYEA 2VXZA 3IRQA 1ON1A 2XRNA 3U9GA 3HSRA 1BI3A 3B73A 3COAC 1FOKA 1P4XA 4ENKA 2B0LA 5J8CA 3T1BA 2NAZA 3LQQA 1SD5A 5H20A 3C3WA 1XB4A 2JPBA 2VBZA 4A12A 4MEYF 4NB5A 1FX7A 5D8LB 3RTRA 4FHTA 2FU4A 3KCCA 3I58A 1D8JA 2CGPA 4UUVA 4I98B 3F3XA 1MJBA 3OV8A 4LJZF 1LVAA 3L9FA 1E2XA 1RZ4A 3HRTA 4LB6B 4ENJA 2HS5A 1FLIA 2KIMA 4OIRF 1IXCA 1KYZA 1RUNA 5LEJA 1FC3A 1AOYA 3QP6A 1T39A 4EGZA 3FXUA 4G7ZF 5BPDA 1UHMA 4D0PA 5EEGA 1UCRA 4ON0A 3I53A 2IPQX 2IA1A 2DTRA 2GQQA 2EWNA 4L18B 4Z2YA 4Y17A 3V7RA 2L3DA 5LBQA 2DQRA 5D8KB 2Q8KA 4I01A 5CJ9A 1BOAA 1J5YA 1I5ZA 2CWEA 4CO8A 4MNUA 2Y0MA 2P5LC 4RGUA 2Z9OA 1HW2A 3K9TA 2EV6A 3DEUA 2PQ8A 3ECOA 3HSFA 3K1NA 4EJTA 2DT5A 4WK8F 4LK0F 4N9HA 3CUQA 3R0JA 1IN4A 3WGIA 4DNCA 2D1HA 5KK1A 2ZJ2A 4I02A 5LEKA 5FD6A 2QM3A 2TDXA 3EQLF 1XGOA 3SQNA 3HYIA 1FZPB 2VBXA 5D5XB 3RJPA 1XSDA 4U0WA 1SFXA 2LDUA 1RIOH 1MZBA 3IRRA 4B8XA 4GYIA 2OD5A 3E3VA 3CUQB 3T8RA 4KICA 1YQAA 3E6DA 1I6XA 2KJCA 3TOBA 5CVJA 1SD4A 3K0LA 2QYOA 4CYDA 5L3BA 3TGNA 3HUGA 2VC0A 5HDNA 1LEAA 2OZ6A 4XSZF 5FLXZ 4BHPA 3BPVA 1ZLJA 5LHGA 5L3FA 2ELHA 4BHBA 3LA7A 3BOQA 4ZYHA 2M87A 2NS0A 2QBYB 3RKYA 3WTYC 3CJNA 1ZHFA 3P7NA 3TO9A 5FFXA 3AAFA 1BI1A 1U78A 2G7HA 2OA4A 3J81Z 2FEZA 4G8XA 2W57A 4KIBA 5DUIA 1IXSB 4LMYA 2K86A 1GXPA 2W24A 2FBIA 1H0MA 3M7GA 3F22A 1EV7A 3GFJA 3K1MA 3FXRA 1R23A 3DQVC 2ISYA 3WU0A 4G6DA 4IRGA 1T6SA 2GA2A 4KNYA 4HAMA 4RGRA 3V4GA 3FWEA 2L02A 1V4RA 1ZARA 4KN7X 3RIRA 1LNWA 2KRFA 1UB9A 2IA2A 4O5VA 1XSVA 1OYYA 3KP3A 4HF0A 3RPQA 4L9VA 5FFZA 3G3ZA 1MD0A 2ACJA 5DUKA 2CSOA 3E6CC 4JK1X 5E8GA 5HVQC 3IKVA 2FNPA 3FZVA 1SD6A 2KKOA 3E6BA 2H6CA 2M8EA 3RYPA 1QO0D 1FSHA 2PMUA 4HX8A 2V6CA 1KU9A 1XDSA 3HOTA 3KP4A 2XKOA 2K02A 1ZN2A 3N4MA 2IVMA 2ZCWA 3HTUA 2A6EF 4M73A 4KMUX 2J5PA 2WTEA 2O8XA 4AIHA 4O3MA 4OIPF 2M30A 2ESHA 2OAZA 5LGNA 2JPCA 1TNTA 1SMYF 3TQNA 3GEZA 2M5WA 4LLLA 1XMAA 4Q47A 2FMYA 3K2ZA 2V1UA 2VOOA 3NRVA 3CUQC 1EH8A 3SFZA 5FGMA 2K27A 5DV5A 1USTA 3FM5A 1PP7U 1IAWA 5CVRA 2VOPA 3DKWA 2W25A 3ELKA 1TLHB 3EDPA 4IHSA 1O7LA 3G73A 1BC8C 4BAYA 3HRSA 1MGTA 1T98A 2GZWA 3ZN0A 1BI0A 2EV0A 3K69A 1MDMB 3KFWX 5JI6A 3TO7A 2H94A 3HRUA 1ZLKA 3MZHA 3PQKA 2IW5A 3CUOA 3REOA 1XGSA 3LWFA 2G9WA 3E5UA 2UWMA 4DQ2A 4OOIA 2FA5A 1D3YA 1LDJA 1YIOA 3K1PA 2P7CB 1FYMA 4AWXB 3RPUA 1S7OA 4LG0B 1XDUA 2EV5A 1R36A 1YYVA 3L00A 3LQRA 1B6AA 2A5YB 4HA8A 4WX9A 1KYWA 1TNSA 1HQCA 3I5UA 3F21A 3ML6A 5DDGA 3O3KA 4LLNA 3LA3A 3V7SA 6PAXA 3DFGA 2PEXA 1YW7A 5E1XA 2ZO4A 1FBQA 4ESBA 3KP5A 1FBUA 3GZ5A 4L0ZB 2A07F 5HLHA 4MTEA 4A0ZA 4KUMA 2IJLA 2V79A 1W7PD 4O6JA 2LNBA 2O61A 2HQNA 2D1VA 3GYHX 2HKXA 2STTA 4LGWA 4A0XA 1T38A 4YIFA 2V1XA 1QGPA 3IWFA 2VBWA 2L54A 3TOAA 1J75A 2PMHA 1I1GA 3ZMDA 1OKRA 2D2WA 3D5LA 2NYXA 3IWZA 3F8FA 1O3TA 5LHHA 4HYEA 4HX7A 2RKHA 2Z5UA 1R1TA 3CDHA 3GFLA 1GVJA 5HDGA 3KP2A 4ZYGA 4M6YA 4NHJA 4WXHA 2P7VB 1MJAA 5HDKA 2ZKZA 3F6OA 5HLIA 4KYWA 1ONVA 5CVIA 3HRMA 1DDNA 4HDUA 3FMRA 1R7JA 2BV6A 2OQRA 4YIIA 2EA4A 3IL2A 4AD9A 4OIOF 1XD7A 2RGVA 3B02A 3JAMK 1IZ1A 2EB7A 4GXOA 2VE9A 1C0WA 1ZYRF 1X3UA 2BEOA 1OYWA 3ABUA 2P6TA 3QP5A 1ZG3A 1SFEA 4M71A 3KLOA 1YFHA 5ILSA 3SXYA 3O6BB 5F1RA 3EYYA 4IF4A 2PLYA 4GCVA 4RB0A 4IXAA 1XN7A 3FM3A 1O7FA 3R4KA 1KU7A 2ISZA 1IRFA 2JZYA 3GX4X 4YFKF 4FT8A 1FT9A 2HDCA 1SFUA 1S6LA 1REPC 4ESJA 5FD5A 3HHGA 4H0EA 2HTSA 2EK5A 3WODF 4LG0A 2BE5F 4EVIA 1XGNA 3WU1B 1XGMA 2VODA 4OMYA 2KIFA 1XCVA 1U3EM 2Q0OA 3BDDA 3CTAA 2P6SA 2DFIA 5E8IA 3MEXA 1BJAA 3MFKA 3E6MA 4G7HF 4IRHA 2CO5A 1MKMA 2FBKA 5FO5A 4HZFA 2CYYA 1MDMA 5L3EA 1I1SA 3KP6A 2NNNA 2GA1A 2XAFA 1WI9A 2EFQA 5TJJA 5DCFA 1HKQA 1FPQA 3ZMUA 1G3TA 4CGZA 2DK8A 1R22A 2O0YA 2C6YA 1KA8A 4IPAA 3M9AA 1WSUA 1KU2A 1YS6A 4LB5A 4U88A 1G3YA 2UXXA 2X4HA 5L3DA 1PUEE 4N0BA 1OYIA 2VN2A 3E5QA 2XAHA 3F72A 1EH6A 3DP7A 2H27A 4RGXA 3QU3A 4RB3C 3RYRA 1KQ8A 3QPHA 2ETHA 5FLXK 4EM2A 2DI3A 1BC7C 2RNJA 2FNAA 5JR3A 3LAPA 2DBBA 4WWCA 4S04A 1LB2A 4KDPA 5JVTA
chains in the Genus database with same CATH superfamily
4UXNA 3E7LA 4IOAF 1SC7A 2HR3A 2OTLI 2E2JJ 1Y6IA 1Z6TA 2ICWG 4ZTJA 1YHQI 5AIPA 1DU6A 2M4KA 3C18A 1HSTA 1JKRC 1U5TA 4WXDA 2XV4S 2WWYA 3S14J 2GBYA 3GZ6A 2ECBA 2CRGA 1W1WE 4ZZLA 4UY8I 1EA3A 5M3MJ 3FISA 4UVAA 2DT7B 2A69F 1D5YA 5IP9J 3I55I 3I4MJ 4E7LA 2QQ8A 3OYJA 2DPUA 2IA0A 4JBAA 2F2EA 3BP8A 3EUHA 4XNFA 1HW5A 1WKMA 5ICEA 1N75A 4AYBN 3OYBA 1SD7A 1YE9A 4EM0B 3V8JA 3H0DA 5H2FC 3HC7A 2DLLA 4F93B 3VDXA 1B72B 1ETKA 4Q5SF 2P5VA 3W6KB 3H9QA 2AXLA 2WAQA 2UZKA 2QQBA 3CCUI 2X48A 2GIZA 2VPRA 4LD5A 1TWGJ 2GOMA 1JUMA 1WRJA 1F4KA 4HW0A 2XAGA 2QQ9A 2ZXWH 1OCRH 3GUDA 2W84A 1OCCH 5ED4A 3CCLI 2I5UA 1B1BA 1ODDA 2O7OA 2KRHA 2Y30A 4XKCA 3DKXA 1W7PB 3K6GA 3NEUA 2XROA 3BWGA 1IO2A 2RC4A 2M3AA 3DPLC 3WGHA 4QLCU 4UV8A 1VI0A 3R6SA 1HCRA 4UVBA 1K78B 2VC1A 4G7OF 2F5EA 3UR3C 3CCVI 1FP2A 3OL4A 3MAJA 3PSFA 1DGRM 4BE2A 3QRFF 4A3MJ 2MH9A 3M8FA 2RV8A 2E7WA 2VT3A 2NVTJ 1D0ZA 5J8FA 2VUMJ 4YFXF 2O9LA 4PJLA 2G7UA 4L9TA 4JP0A 4MGRA 2M7AA 3K2AA 2M4GA 5EEAA 2HXIA 2D45A 1PP8F 5FB2A 3J80Z 3ZMSA 5BS6A 1T8IA 5ICFA 4A3BJ 2MGQA 4XRSA 2DO7A 3Q5FA 5J40A 1MH3A 4BY1J 2QBYA 4ETSA 2DTZA 2EILH 3G2BA 1ZGWA 4GO1A 1B9MA 1IUFA 4LK1F 5DCMA 3ASNH 2HPMA 2OF7A 2E1NA 3PSIA 1X3WB 3LNQA 1QU3A 3TKYA 3I64A 1M1EB 2VXDA 5A2QK 2K9QA 2A05A 2Y69H 1D1AA 2ME0A 3IC7A 4BYYA 1STZA 1GV5A 5IY5H 4D7NA 4HG2A 3ZCOA 2F5FA 2AHQA 1LUJB 3EPZA 3GXOA 1R58A 1S7AA 3MKZA 1ETXA 1KU3A 3Q9SA 4HSRA 3OIOA 4BQAA 4X1EA 3W2AA 4RB2C 3GVAA 4M74A 1WQ2A 2DFHA 2DJIA 2VBYA 3CJTB 1OISA 2HTJA 5E17F 2BY1A 2VQLA 3RI4A 2OPTA 1BOBA 3BROA 4LLGF 1EJ9A 2COBA 1BR2A 2O3FA 4P55A 2BBYA 3C7JA 3FXQA 2ZMEB 4FE4A 3I3LA 5ICCA 1P7IA 2A3SA 2R3SA 3BG9A 2DU9A 4MEXF 2JA2A 4D7MA 1PDNC 5FKKA 5LFAA 4X6AJ 1YTYA 4R8HA 3MN2A 2X6YA 2F5CA 2VQGA 2VJIA 1IRZA 4FX4A 4PJMA 4YG2F 3BZ6A 4RGSA 5CLSA 3HL2A 2EZIA 4P9UA 1J9IA 3CESA 1RUOA 2W85A 2O6GE 5D4SA 5E1WA 2EH3A 2QSHX 1FBSA 4IZZA 1WJAA 3VYSB 2R5YA 5F27A 3ABTA 1VQ6I 1KQ9A 5A2QZ 2RVCA 3DXJF 4B09A 1HW1A 2B7EA 2L2OA 2OBPA 3H3ZA 2ME6A 4CZZA 1D5VA 2R7DA 2QLZA 1E3HA 5EZHA 2JQ7A 1PUFA 1VQ9I 4GRIA 4RDUA 4A3FJ 4L9NA 2Z16A 2HZTA 2TCTA 1TQPA 3G1OA 3CP2A 3ZRGA 4PSWA 1TQIA 2ZB9A 4G94A 4AIDA 3JW4A 3M1EA 1MBEA 3BJAA 1F1ZA 4HQMA 4PCQA 3CCRI 2QENA 2MG4A 3LSHA 1FYLA 4ABZA 2M9HA 4EJVA 4IEJA 2OU2A 3FXKA 5F6FA 1YG2A 2IGNA 1MSEC 1R1UA 2XF6A 4NQWA 3S3OA 2LBFB 1XTAA 3SZGA 2HYGD 4BE0A 4R1HA 3ZMTA 5EEHA 1AWCA 1MMSA 4XSXF 4EM1A 2G0EA 1FOXA 3ERMA 1OCTC 5DYMA 1FIAA 2KT0A 1L3LA 3IAS2 2QWWA 4XLEA 4WCGA 1DU0A 5F0FA 2YX7A 3OR1C 3MKWB 1ACIA 1XC5A 1K83J 3D5RC 1LQ1A 2H1KA 2LYCA 3E97A 5HLGA 3S1RJ 4W1UA 2VE8A 4IQ4A 2ZNZA 1H8AC 2DPDA 4I7HA 2LFBA 2IRFG 3BJOA 1B59A 3ABKH 5AIQA 2IT0A 1X19A 1BR1A 2RQPA 3R0AA 4DYRA 3UKGA 3K4MA 2WV1A 5F0CA 3ROUA 3MQ0A 5F64A 4A3CJ 2NVXJ 3HHHA 1IUYA 2GIVA 2DMQA 3FHNA 4ZYDA 2OCCH 1SFKA 1VQ4I 1I27A 3HIFA 2V1DA 3GZNB 4MHGA 2DA4A 4CSWA 2XVCA 1VQOI 4YFNF 1VQNI 4R79A 1K78A 1UJ8A 1RESA 4EJWA 2L9NA 3VYUB 1XMKA 1QNTA 2DQLA 5LHIA 1ZGJA 3L7WA 2VJ4A 1OR7A 2WAFA 4KN4X 2FBHA 4F7ZA 4BU2A 3LSRA 5D5VB 2Y48A 4CHUA 1RETA 3EUKL 2YR2A 2NNYA 1U5TB 3H3UA 5CQGA 2Y75A 2IS1A 4XRFA 2HI3A 3F23A 4IQJA 5B1BH 4HRIA 4MQVA 1R00A 2KIUA 4LITA 1A6IA 3VSKA 1JUPA 4I99C 1IN7A 2YX4A 3MMYB 1VTNC 1IV8A 1USSA 1S3JA 3OMYA 2V7FA 4N9IA 2LVSA 2FE3A 4D5CA 4B43A 3G6EI 3CMEI 1H9GA 2A68F 2XASA 3BQZA 2UXNA 5BPIA 1DPRA 2L4AA 1IDZA 3FMQA 1W36C 3FF5A 5CYVA 2IGOA 4PZJA 5LRRA 3QPTA 5IT3A 1V54H 2ESNA 2ZFUA 2ZXIA 3DKYA 3K4BA 3RCOA 3BG5A 1F5TA 2AQEA 4KMFA 3KYCB 4C2TA 3W6JB 4XKWA 1FIPA 4XONA 3F8CA 2YU3A 4RAGA 1DP7P 5HS8A 1HBXG 3I59A 4BGDA 2E71A 4C2MJ 1HKSA 4A0YA 1I3AA 1IN8A 3KEQA 4B44A 5GAEJ 4IHTA 5AONA 3J7AO 4HOBA 3SZPA 2R7FA 4RMNA 3DPUA 1Y39A 2A6HF 1ULYA 3VODA 1TW2A 1U5TC 5ICGA 1ZG1A 3ZXSA 2FUG2 2BVLA 4HBLA 4EQQA 1LDDA 4I09A 2KZGA 3KZZA 1R71A 1K79A 2LG4A 1DUXC 3CZ6A 2DOAA 2MLKA 4L5JA 4ENMA 2QF7A 4UB6C 3S1QJ 2Y9ZA 1VQ8I 2L4MA 2KP6A 1YLFA 3U21A 1HA8A 3WG9A 1AHDP 2VB6A 1MBJA 2PBIA 2RDPA 1H88C 1QVTA 2H09A 2JTVA 4ZDOA 1ZTRA 4XKVA 2MA3A 5FROA 1RNLA 3HXLA 1HLVA 5F08A 5HLTA 2R7RA 1IF1A 3WHBA 4BH9A 3MZYA 2V9VA 4P1WA 3CCJI 3OSGA 2XF7A 2AO9A 1LJ9A 2K7LA 3BZCA 4OMZA 4BJ5C 1MBHA 5D5WB 3H35A 3LSTA 3BJ6A 2K40A 3OS1A 1P4AA 1YOVB 3K70D 2Y2ZA 1XCBA 2EFOA 2VONA 1SVOA 3OYEA 2FQ3A 3CJRB 3WTWC 3TDZC 3I4PA 4HQEA 5HODA 1YX3A 3HTSB 3OYLA 5L3GA 4M3EA 4HLYA 1IN6A 2A6TA 3I54A 4UHTA 4FE7A 4A5NA 1T08B 2FQ4A 2LY9A 1P4WA 4BDYA 5B3SH 5GADJ 1XS9A 3KZYA 3DPTA 3EYIA 2ZSIB 3H36A 3KETA 5C4XJ 3BTIA 4A3EJ 2CQQA 3P5JA 4RB1A 3JRAA 2X85A 1O3RA 1Z3YA 3PUFA 4XN0A 1YW8A 3HOSA 3Q9VA 3GW2A 5ERIA 2W00A 4JQFA 5K5RA 3M07A 4A6EA 2BZTA 4EMSA 1EF4A 5KNLA 2P5KA 3PQJA 1K7AA 3I71A 4D1QA 1OCPA 3S2WA 1FMWA 1D8KA 1IJWC 2CW0F 3ECHA 2HFHA 1CGPA 2JWTA 4W97A 4FCYA 4UNOA 1UHWA 4UB8C 1V3FA 2M0MA 2E7XA 4ZH4F 3CO7C 2DA1A 2R7UA 5IYDJ 3M1CA 1ORKA 3LA2A 2KZVA 4P9FA 4BHCA 1K61A 2GAUA 5E3LA 4PUSA 3LAJA 1JKQC 1H9TA 3PUBA 1ZREA 1MJ9A 3A2KA 4DOZA 3BC8A 2XB0X 2VASA 2MC3A 4NC7A 4BQQA 2CQNA 4WXCA 1SEUA 2JT1A 4RBOA 4IKFA 4OAZA 4RAFA 3IP4B 1SANA 1DPUA 4RAZA 3RQ4A 3ZOBA 1X4PA 3CLOA 1IXRC 3T8TA 1OPCA 4HDVA 2K5CA 1RKTA 4BNCA 2MBFA 3ZQ7A 1K6YA 3HGYA 1IG7A 2QZ8A 4YELA 1OCOH 3FBIB 2HNHA 3I9V2 1YI2I 1UG0A 3WGGA 4XLNF 1UFMA 4AM3A 3E0JB 4MQ9F 1FWZA 1FY7A 4HEA2 5DD8A 5BMZA 1X1PA 4M6XA 4CCNA 2FOKA 1R5GA 1OFCX 5DM6F 3LOCA 5IYCJ 3L2RA 2KL4A 2LOOA 1ZRCA 3WTTC 1NHAA 2MFZA 3BTLA 3GTPJ 5TRDA 1D1CA 3LSPA 3NQOA 1JJ6C 1FYKA 5E3NA 1K6OA 1QQIA 1R5HA 2EJRA 2ZFWA 3BR5A 1YW9A 2KLOA 1YX5A 3HOVJ 4RLQA 3IHUA 3S2DJ 3HOZJ 2GXAA 4L0YB 1Y0UA 2ZXJA 1B9NA 2NRAC 1JT6A 2KPMA 3IH2A 2NOGA 5DEQA 3E5XA 4JX5A 3RDIA 4G6QA 1R6RA 1HSJA 3LL7A 4WF2A 4XKBA 4E7HA 4XBFA 3JSOA 3L2QA 4HLXA 1A5JA 1IRXA 2IGKA 4QTRA 3N97A 3HOXJ 1CF7A 3RZOJ 3TDUC 2OTJI 1RC9A 4NDLA 4FISA 3S1MJ 1TWFJ 2KMUA 5FRMA 3CMMA 2KFDA 1GHCA 3FBNB 2PN6A 1Z6RA 2DMPA 2XHKA 3V7CA 5D5UB 2KIQA 3LFUA 1B8IB 4P5OA 2MABA 3V8LA 2FOWA 2NVUB 3WTZA 4HNTA 2XUBA 3HUGB 3CCSI 2XKPA 2LRDA 2VI6A 2HYFA 1G2HA 2JRTA 5M5XJ 5D4RA 2EFPA 3JRGA 2YU9J 2JA7J 2XGXA 1N78A 4PGHA 3I59B 4KIFA 2JVGA 2E34A 2P8TA 1ON2A 1X1AA 1J0RA 4HNVA 3QAHA 4I76A 5DCMB 1LB2A 1E3OC 2HEOA 5H6QA 1T0FA 1ZRFA 3QU6A 3ZQQA 2HWVA 1JHFA 5IP6A 5M5WJ 3GTLJ 2KRCA 2JMWA 2CMPA 2PMZA 1I39A 1G8XA 2HDWA 4A2UA 3S1NJ 4KIGA 3H1CA 3VOEA 2K4BA 4EJOA 3ZN1A 1VQKI 4GDFA 2R7VA 5D6EA 3H5RA 2PJPA 3SHFA 4IRIA 2K9MA 4FASD 2FXAA 2LSOA 4HV6A 1X58A 2LH9A 4ESFA 2QA4I 3VB2A 3L2WA 1MMAA 2QKLB 4XLPF 2AQFA 4XMYA 5JHUA 4L9JA 4JOMA 1OLTA 2DW4A 1YO5C 4F52A 3PNVA 5BNGA 2ZBKA 2L9VA 3L2UA 2PG4A 3MCZA 1TBXA 4XICA 3QOPA 4I6ZA 2E1CA 5K7ZA 2H6BA 4HF1A 1Z1DA 1KGSA 1MW7A 2WBMA 4P96A 1E0EA 1RPWA 3HB9A 5BQTA 4I0AA 3K7AJ 1P92A 4CDGA 3AG3H 4TV7A 5F1JA 4CCLA 5DD4A 4Y13A 1J59A 5JFRA 3FMSA 3VFZA 1E3PA 4RAYA 1Q1VA 3ZQLA 3F8BA 1JXSA 1IRGA 2XAJA 3GWZA 1SFOJ 1ZH5A 4E7KA 2V9KA 4GFBA 1DGWY 3BZKA 4KT5C 2YSRA 4ZC3A 4E7IA 1Q1HA 1F43A 2L0KA 4BBSJ 1BIBA 3A03A 4AIJA 2BVMA 4D9JA 3G71I 1E17A 3MKLA 1KQ0A 2KJBA 1Z3XA 2DN0A 4MFEA 1LPQA 3JREA 3LFKA 3TP0A 1O3QA 4B47A 2V9PA 4CUGA 3ISPA 4IVNA 1TQMA 1HXDA 1VQ5I 3IV5A 4PK4A 3DU6A 3L2CA 2M1BA 3JTHA 4EV0A 1BL0A 4OIQF 3BG6A 4C9YA 3M3YJ 3C2BA 1BM9A 4PSXA 1BN5A 1MBFA 1BI2A 3EUAA 2ZJRF 1IN5A 2Z3YA 2Y0SN 1R9TJ 2HGCA 4XN3A 5K5QA 4AIKA 2ZSHB 1ZG5A 2O5RA 3CD6I 1TW3A 4CYCA 1VQMI 2A61A 3J80K 2K4JA 1HF0A 2R5ZA 3O2PE 3ERED 4FTHA 1J2XA 1Z7UA 2MLGA 3T0YA 4CXFA 4Q4ZF 4E7SA 3JR9A 4AC0A 4Y52J 2BY3A 2FRHA 3D5SC 1W4MA 2X51A 3KE2A 4Q48A 3P9IA 5TISC 2BYVE 3DLAA 2YPRA 1LFPA 5EGOB 3VPRA 1RR8C 2JA5J 1JGSA 4BBRJ 2DFFA 2DA7A 3RKWA 1TWAJ 1Z9CA 4PJ0C 2JK3A 1W7PA 4G6TB 5LGUA 3V8KA 2KDOA 4ZZDA 4F92B 2CG4A 2M45A 4M9ZA 3SZTA 3TL4X 2MC4A 2XPUA 2CFOA 3KP7A 2F4MB 2XIGA 1O57A 1ZR2A 1SAXA 1HC8A 1S9HA 2MD5A 3R60A 2IP2A 1BR4A 2B9SA 1YS7A 4OWRB 4QPQA 1TT5B 2XGCA 1UMQA 1FSEA 1FNNA 2QKMB 4ZDPA 2FJ1A 3LSIA 2LKPA 2HOEA 4PFOA 1AA7A 5B1AH 4BEHA 4GYGA 1V5FA 3GFMA 4IOCF 5C44J 2QVOA 1MNMC 4BKXA 1Z0XA 3VWBA 1P2FA 1T2KA 4M72A 3RPUD 5CVUA 5H6RA 1ZELA 3C1DA 4OU0A 3FXLA 2MD0A 3OOPA 3WE3A 4A3JJ 3HEFA 4G9YA 4M9SA 3JRFA 2CQKA 1A04A 1XPXA 4XOPA 4QWQA 2XF5A 5J1UA 1W0UA 1W5TA 2O03A 4EGYA 4XORA 4CH7A 4PJJA 3LSMA 2L9SA 2VLAA 2KQRA 3S8PA 3L2VA 1W5CC 2GLOA 4I2OA 1RKWA 3S3MA 1YRNB 4UVCA 2CU7A 1FJLA 2XSDC 2XPWA 4U7BA 3HJEA 3HPGA 4A3KJ 1BW5A 1LDKB 3K10A 1D1BA 3ZPLA 2DAOA 1H89C 2OQGA 2RQQA 3GLLA 1R1VA 2OV7A 4K2EA 3BR6A 2NS7A 1BA5A 2AXTC 4V2GA 2X1DA 1LKXA 3J81K 1IDYA 3DF8A 2R4GA 2IBDA 2COMA 2LF7A 3GCMA 4HV5A 5LD2C 1NK3P 1BIAA 2FF4A 4CCOA 1QHHD 2R7TA 2Q2EA 3QYEA 2EBIA 3FK6A 2LKXA 3VEPA 2XB5A 3KEOA 5ILUA 3FDYA 3SDGA 3C2HA 3IKTA 2JN6A 3U1DA 4ZJZA 3PM1A 1Y1VJ 3GF2A 2EFNA 1TWCJ 2ADUA 2LY2A 3KIOA 4FX0A 4OINF 4AUXA 4J00A 2FX0A 2CW8A 5CQEA 4B3XA 2DJNA 1BBYA 2DDBA 3BCAA 1JE8A 3EETA 3JAMZ 1ZAOA 5IPAA 3HSEA 3FKIJ 3KPHA 5K5OA 3CMAI 3BY6A 3ZQIA 1CQTA 5LLQA 1Z05A 3DLLF 4A3DJ 2WV0A 3G1LA 4PGGA 5K7FA 3NAUA 4ASNA 4FQGA 4AU7A 2GWRA 2EZLA 2MH2A 3GFIA 1P6RA 2LF8A 5JLWA 5LGTA 4C3IJ 5J1YA 4QSHA 1B8IA 1A35A 1L0OC 1SVLA 4PFPA 2L9RA 1GXQA 2FSWA 2LKSA 3PNYA 1GUUA 4A6DA 1V5EA 3OYFA 1G3WA 3L1PA 4IHVA 3HOWJ 2VPLA 1MMDA 1BJZA 1EH7A 1G3SA 2VT2A 4NQWB 4AYBA 1MBGA 4ZYAA 4KFCA 2F4IA 1F9NA 2WC2A 2R7XA 1U0JA 1U2WA 2R0QC 1IC8A 1QBJA 4XL9A 1B4AA 2QUFA 1IW7F 5GAHJ 3GTGJ 1JGGA 3QWLA 4II3A 5CVVA 4L5EA 5E20A 4DIQA 3K70C 1AU7A 1TZLA 1TL8A 4Y15A 3WTSC 1LEBA 1CF7B 2BGCA 2N8GA 3OYDA 3R61A 4J19A 4ZTFA 2DK5A 3D0SA 1LE8A 5FKMA 1WWXA 1XG1A 3DV8A 4M3FA 3G1MA 2CV1A 5KHDA 2JSCA 5BOXA 1Y8QB 2ZNYA 4ENNA 2HZDA 1YRNA 1U8RA 3ULQB 2QCOA 2Z33A 2V26A 3ZP5A 2PI0A 2P0WA 1ZRDA 1MBKA 1XSXA 2E5ZA 2Y9YA 1T56A 1QZYA 3F6VA 3UNGC 4BJ6C 4IHWA 2CV2A 1S29A 5L3CA 5HOOA 4GGGA 2DMNA 1T95A 1QZZA 1VQLI 3BR1A 5HS7A 4MIMA 2EFWA 4HF2A 3OWTA 4NNJA 4L5IA 2VKHA 3AL0B 1RI7A 3WHCA 1Z67A 5ILVA 3B6AA 1SMTA 1HKTA 4BXUA 3MWMA 3P9CA 2FMLA 3QPSA 4MFDA 4AVPA 4DGWB 3Q3SA 4IX7A 2LD5A 4BXFA 3WE2A 2LC2A 2ZJPF 3SFIA 4A3GJ 5D6FA 3P9KA 2W48A 3KLNA 4CICA 1FP1D 1R4MB 4F55A 1ZGAA 2F5DA 2P4WA 3WTVC 3DBHB 3GO5A 1OMIA 5KVRA 5IT9Z 2Z99A 3U2RA 1G6NA 2NVQJ 1NK2P 4MTDA 2STWA 3W6VA 2KISA 3S17J 2HQRA 4F91B 3JTGA 4HX4A 3ZMZA 4U7DA 3BG7A 2X0LA 2J5OA 3OYGA 3U1KA 1POGA 2W7NA 2CFXA 3FHZA 2EA2A 4M9XA 1QPMA 5LRSA 4RS8A 4UV9A 1FTTA 2XAQA 2PJRB 1GVDA 2ZMEA 5FRNA 1WFXA 2Q1ZB 5E1ZB 2X1EA 3CO6C 4I0BA 3H92A 3M8EA 1W5SA 3RKXA 5J6XA 5EYRA 3I56I 2RN7A 2GXBA 3F8NA 2HKOA 4S05A 2AS5F 2OZUA 2WAEA 1B72A 3Q0VA 4A93J 4PDKA 1Z91A 3IAM2 4YEJA 2IS4A 2L01A 3OYHA 2M7BA 1W0TA 2EIMH 5EG0B 2E60A 1OCZH 2XAUA 4LFUA 4KA4A 2IXSA 5E18F 1P9QC 1S8NA 3F8MA 3Q0UA 1U6GA 3PFIA 2VKVA 2Z1DA 4A5MA 4LOCA 2H1LA 4EJUA 1JHHA 4U0VA 1J7KA 1O3SA 4DZPA 5HS9A 3RQIA 1X3ZB 5K1YA 3OYAA 1ZKGA 3T5XA 4M3DA 1R5ID 5IT9K 3J7AY 4U0YA 2ELJA 3JSPA 4S0HB 1D0XA 1MH4A 1GT0C 1OR7C 3BPXA 3L09A 5C4JJ 2UV1A 1S72I 2GXGA 1G4DA 3OYNA 3GLXA 5FKNA 3WTXC 3I0TA 3WTUC 3TMOA 2IS2A 3FX3A 5DM7F 2QQAA 4E70A 3TO6A 1ENHA 3ZMVA 4IJAA 3JRHA 1TTYA 2JA8J 1BW6A 2PFBA 2DMTA 4ZYEA 1NG6A 2VXZA 3TEDA 2XGEA 3IRQA 1HOMA 3KX2A 1ON1A 5FKOA 2XRNA 3U9GA 3HSRA 1BI3A 3B73A 1FTZA 3COAC 4D5FA 2H8WA 1QPIA 3DU5A 1FOKA 5TGTA 1P4XA 4ENKA 3V42A 1A31A 3F9KA 2B0LA 2DA3A 2E35A 3T1BA 5J8CA 2NXNB 3AFHA 4RM2A 2NAZA 3LQQA 2GOXB 4XLHA 1QZEA 1SD5A 5H20A 3C3WA 1XB4A 2JPBA 2VBZA 3CC4I 4BEHB 4A12A 1A36A 4MEYF 4BUPA 1SVMA 1UHSA 4NB5A 1FX7A 3JRBA 3OR2C 5D8LB 3RTRA 2WAQN 5IOYA 4FHTA 2FU4A 2EIKH 1NG7A 3KCCA 3I58A 1D8JA 2CGPA 4UUVA 4I98B 4UUSB 3F3XA 5FLMJ 3AG1H 1MJBA 3CP8A 2PX9A 3OV8A 4LJZF 1X2NA 1LVAA 3C2GA 3L9FA 2JUGA 1E2XA 1RZ4A 3HRTA 4LB6B 3H9GA 4ENJA 3PO2J 1WZ2A 2HS5A 2OCEA 3OS0A 1FLIA 2KIMA 2RNGA 4OIRF 1IXCA 3K4LA 1KYZA 1U9NA 3HZJA 1T33A 5EG0A 2I8DA 1RUNA 2Z2SB 5LEJA 3CC7I 1Z77A 3H3VK 1FC3A 4DZJA 5EDNA 4DBQA 1AOYA 3GMEA 2IEKA 4RA2A 5FJ8J 2MW8A 3S3NA 3QP6A 1T39A 4EGZA 3FXUA 4G7ZF 3CJQB 5BPDA 1UHMA 4D0PA 3PO3J 5EEGA 3OS2A 2L5QA 1UCRA 2Q2EB 4ON0A 1OJLA 1PUFB 3OIQA 3I53A 4Y7NJ 3DWLE 3SEZA 2CS3A 4OAYA 2IPQX 2IA1A 2DTRA 2GQQA 3OYKA 3HOUJ 2EWNA 2K9LA 4L18B 1IGNA 2DYSH 2DA2A 4Z2YA 4Y17A 4E6KG 5B66C 3V7RA 2EPFA 2L3DA 1TWHJ 2LMDA 1Y1WJ 5LBQA 5IYBJ 2DQRA 1WH7A 3VYRB 5D8KB 2Q8KA 2CQXA 1WJ5A 2JA6J 2CUFA 4I01A 5CJ9A 2K3FA 1BOAA 1J5YA 1I5ZA 2CJJA 2CWEA 4CO8A 5HNHA 2GM4A 2QSFX 4C30A 5K7HA 2HOSA 4MNUA 2Y0MA 2P5LC 3IH3A 3EUHC 4RGUA 2Z9OA 2E1MC 3HG9A 4XQFA 2XGDA 1HW2A 3K9TA 2EV6A 4B3AA 1DQUA 4DYQA 3DEUA 2PQ8A 3B6CA 3ECOA 5IOZA 3ASOH 3HSFA 3IUOA 3K1NA 1UZCA 1VF9A 4EJTA 5KCMA 2XSJC 4ZDLA 2DT5A 2R7SA 4WK8F 4LK0F 4N9HA 2BXYA 3CUQA 3R0JA 1IN4A 3WGIA 3K4KA 4DNCA 4BS9A 3ESWB 2D1HA 5KK1A 1UG2A 2ZJ2A 3HGGA 3OOUA 4I02A 2E2HJ 2HOAA 5EJCA 5LEKA 5FD6A 2BW3B 2QM3A 3X2QH 1JJ8C 3S16J 2TDXA 3EQLF 3ZQFA 5E3OA 2DYRH 1ETWA 1XGOA 3SQNA 5GTHC 5EZGA 3HDDA 2ZJQF 2FD5A 3HYIA 4M3GA 2WADA 4B1RA 5IP7J 1FZPB 2VBXA 2X1CA 4C3JJ 1N77A 5D5XB 3RJPA 1XSDA 2EINH 4U0WA 1JKPC 1SFXA 2LDUA 1RIOH 1MZBA 3IRRA 3D1NI 2BHYA 3K4CA 4B8XA 3IH4A 4GYIA 2HDDA 2OD5A 1WJBA 3E3VA 3CUQB 3CLQA 4M6VA 3T8RA 4KICA 1YQAA 3JCUC 3E6DA 1I6XA 2KJCA 3TOBA 5CVJA 3MD2A 3ZQHA 1SD4A 2R7WA 1K4TA 3K0LA 3E1SA 2QYOA 4CYDA 1QHGA 4FETA 4C2UA 3CQZJ 5L3BA 3DTIA 2ZXHA 3A0BC 3TGNA 3HUGA 2R93J 2VC0A 5HDNA 2CUZA 2QEXI 2HXOA 1LEAA 2OZ6A 4XSZF 5FLXZ 2NS8A 4BHPA 3BPVA 1ZLJA 5LHGA 4NBQA 2QGUA 2LBFA 5EF6A 2L7MP 1Z7LA 5L3FA 4LIUA 3DBLB 3OYIA 2ELHA 4BHBA 3LA7A 3BOQA 4ZYHA 3S93A 3ABLH 2M87A 2NS0A 1WPKA 2QBYB 3RKYA 3WTYC 3CMYA 2F6CA 3BG3A 1ZHFA 3P7NA 3TO9A 4DW6A 2DA5A 5FFXA 3AAFA 1BI1A 1U78A 4KITB 2G7HA 2OA4A 4XR6A 5J47A 3DTKA 3J81Z 1GV2A 2FEZA 3HM5A 4G8XA 2W57A 2OC6A 5GPCA 4KIBA 3OL3A 5DUIA 2CW7A 1IXSB 2BY0A 3FIWA 3SYTA 4NUBA 1ETVA 2ZMEC 3BT9A 4LMYA 1X1DA 2K86A 1GXPA 1U8BA 2W24A 4UUSA 1LVKA 2FBIA 3A02A 1H0MA 4N4OB 4G12A 3M7GA 3F22A 5KAIC 4BY7J 2DFEA 1EV7A 3FKJA 3GFJA 3K1MA 1P7JA 3FXRA 1R23A 3DQVC 1FOWA 1NTCA 2ISYA 5E79C 1IV6A 3WG7H 2LK2A 1LFBA 3WU0A 4G6DA 4IRGA 2L7ZA 1T6SA 2GA2A 4KNYA 4HAMA 4RGRA 2X6OA 3TW6A 3V4GA 1Y56A 3FWEA 2L02A 5J4VA 1V4RA 2TRTA 1UELB 2W82A 1ZARA 4KN7X 3RIRA 2E1MB 1LNWA 2I10A 2KRFA 3PJRA 1X4OA 5M5YJ 2E1OA 3GTOJ 3ZR8X 1UB9A 1X2MA 2HVRA 3CC2I 2IA2A 4O5VA 1XSVA 1OYYA 3KP3A 4HF0A 3PIOF 1WH5A 3RPQA 4L9VA 5FFZA 1TT0A 1WJFA 3G3ZA 2Y31A 4H4KC 1MD0A 3F0CA 3Q0WA 2ACJA 3SEQA 5DUKA 2Y0SA 4HNUA 1SAUA 2CSOA 3QYFA 2OUMA 3E6CC 4Z6YA 1GLNA 2HVQA 3CDLA 4XRMA 3ZQGA 3A4CA 4RM3A 4JK1X 5E8GA 5HVQC 3IKVA 2FNPA 3FZVA 5EGOA 5F04A 1SD6A 3OYCA 3O8GA 2KKOA 4V2FA 3E6BA 2M0CA 2H6CA 2F5VA 2M8EA 4PJNA 3RYPA 1QO0D 1FSHA 3DEWA 2NVYJ 2PMUA 3O8HA 2EQRA 2X9DA 4HX8A 2M2EA 3TP3A 4KISA 1FMVA 3KZIC 2ZC2A 2M34A 2V6CA 1KU9A 1HDDC 1ZR4A 1XDSA 2BW3A 2HQAA 3HOTA 3KP4A 3G4SI 2XKOA 3HOYJ 2K02A 1ZN2A 1S7EA 2ELKA 3N4MA 3H5NA 3LSGA 2IVMA 4B4CA 1V55H 3WU2C 2ZCWA 5B5EC 3LMMA 3HTUA 2NOJB 2A6EF 4M73A 4KMUX 2J5PA 2HPIA 4CZCA 2WTEA 1F36A 2O8XA 4BQNA 3FXJA 1Z21A 4AIHA 4O3MA 4OIPF 2M30A 2XC7A 4V19K 2WB1N 2RAEA 1X1CA 2ESHA 2OAZA 5LGNA 2CV0A 5GPAA 2WB1A 2JPCA 4BACA 2BHZA 4XLFA 1TNTA 5HNFA 1SMYF 3RSNA 5F0HA 5J3LA 3TQNA 4QIWN 3GEZA 2M5WA 4LLLA 1VQPI 3NWSA 1XMAA 4Q47A 4B48A 1WJCA 3ZGKA 3N05A 2FMYA 3K2ZA 2V1UA 2VOOA 3NRVA 2DCEA 2X6XA 3CUQC 1EH8A 3SFZA 3CDIA 1HDPA 2F4OB 2YUSA 5FGMA 2BY2A 2K27A 5DV5A 4BL0B 3TW7A 1JTYA 2VQCA 1USTA 2HQ5A 1V5GA 3FM5A 4X0GA 1PP7U 1IAWA 2ID6A 3CCEI 4C3HJ 5CVRA 2VOPA 3DKWA 2V1NA 2W25A 1XMXA 3ELKA 1I6HJ 1PJRA 1TLHB 1Y0NA 3EDPA 3HPHA 4IHSA 1O7LA 3H9JA 3G73A 1BC8C 4BAYA 3HRSA 2EZKA 1JT0A 1FEXA 1MGTA 2HYJA 3A1YA 3LSJA 3QODA 2MYSA 1T98A 2GZWA 3ZN0A 1BI0A 1TP4A 2BOLA 3JRIA 2EV0A 3S15J 3K69A 1NH3A 1MDMB 3KFWX 5JI6A 3TO7A 2E19A 4ITVA 4E7JA 2H94A 5JLXA 3KYDB 3HRUA 1ZLKA 3PNTA 2HOTA 3MZHA 3PQKA 2IW5A 3CUOA 4M3BA 3REOA 1XGSA 3BR0A 3LWFA 1MNDA 4XLAA 2G9WA 3E5UA 4QPOA 1R49A 2O8KA 1Y8RB 2UWMA 3TBIA 2LLKA 4DQ2A 5JVGF 1FOYA 4OOIA 3A0HC 3BTJA 3DEEA 1LFUP 2FA5A 2R5ZB 4MLOA 1D3YA 1LDJA 1YIOA 4EATA 4JX4A 3K1PA 1O4XA 2P7CB 1FYMA 1RRJA 4AWXB 3AL0C 3RPUA 1S7OA 4LG0B 2IGMA 1ITYA 1XDUA 2R7OA 2EV5A 1R36A 3PIPF 1YYVA 1ERDA 4DYCA 3S2HJ 3L00A 2R5YB 1OQYA 3LQRA 3RZDJ 2QSGX 1B6AA 1PYVA 2R92J 2A5YB 1VZ0A 4HA8A 4WX9A 3PFYA 1KYWA 3I4NJ 1TNSA 1HQCA 3I5UA 3F21A 1QVUA 3DTEA 5FLVA 1LE8B 1KONA 2WY7Q 3ML6A 2DOEA 4IO9F 3BR3A 5DDGA 1TC3C 2V6EA 2E5NA 4BXXJ 3O3KA 4LLNA 4BQOA 3LA3A 3V7SA 1WGXA 1DP3A 3DCFA 3QPLA 6PAXA 4IHYA 3DFGA 3QYBA 2PEXA 1YW7A 3FK7A 5E1XA 2ZO4A 5CPRB 3FXOA 1ETOA 1FBQA 1QA6A 3HKZA 4ESBA 4Y3OA 3KP5A 3GTMJ 3W2VA 3BQYA 1AKHB 1FBUA 3GZ5A 9ANTA 2CUJA 3ABMH 3W3CA 5JHFA 4L0ZB 2A07F 5HLHA 4NC8A 4MTEA 3LSKA 5CKTA 2B63J 2JJ7A 4A0ZA 3OYMA 4HSTA 2IJLA 2V79A 3QQAA 4KUMA 2E36A 1W7PD 2DMUA 4O6JA 2IS6A 2LNBA 2DT6A 2HU9A 3NWTA 2O61A 4IL6C 2HQNA 1EKEA 1MNEA 3OSFA 2D1VA 3JRCA 3GBGA 3MZ8A 3GYHX 2HKXA 2STTA 4LGWA 3AG4H 5GAGJ 4A0XA 1T38A 4YIFA 4XK4A 2V1XA 1QGPA 3IWFA 2VBWA 2L54A 4CCJA 2XRLA 2EZHA 1WCMJ 3TOAA 1J75A 1YJ9I 1JI8A 2PMHA 4XOTA 2R7ZJ 3AKZA 1I1GA 3ZMDA 1OKRA 2D2WA 3D5LA 2NYXA 1VNDA 3KEYA 3IWZA 4KJZA 5J4YA 2VQHA 1MMGA 4BDZA 3F8FA 1O3TA 3J7ZI 5LHHA 3NARA 2M8GX 2JSPA 2XDVA 4HYEA 2V4JC 1JKOC 4HX7A 2RKHA 1PVEA 4IHXA 2Z5UA 1R1TA 2L7FP 2DA6A 3GFLA 3CDHA 1GVJA 5HDGA 5GP9A 1T0FC 5KAFC 2K9SA 3KP2A 1X1BA 3GTQJ 1WJEA 4II2A 1S5LC 3PL8A 4M6YA 4ZYGA 3MKYB 1GDTA 4NHJA 3K4JA 2K3PA 4WXHA 2HVSA 2P7VB 1MJAA 3KYLA 3SJMA 5HDKA 4BJTA 1W36D 2ZKZA 3F6OA 2VIXA 5HLIA 4KYWA 1K4SA 1ETQA 1ONVA 2DXIA 2VL8A 5CVIA 3CF2A 1G59A 3HRMA 4EEFG 1DDNA 4A3IJ 4HDUA 3FMRA 1I3QJ 1R7JA 2BV6A 3M8JA 4LG3A 2OQRA 4YIIA 3HKZN 3BR2A 3ZQCA 2EA4A 4YIRX 3CCQI 3IL2A 2YS9A 5DTDA 4AD9A 4OIOF 1XD7A 2W1OA 4DJAA 2ECCA 2RGVA 5DS9A 3B02A 2UUZA 4N4NB 3JAMK 1IZ1A 2EB7A 4GXOA 3ONQA 2VE9A 2WA0A 3BCBA 3FXMA 1C0WA 1ZYRF 3OIPA 1X3UA 2BEOA 1OYWA 3OY9A 1R4NB 4J01A 3ABUA 2P6TA 3A01A 3QP5A 1ZG3A 5FKLA 4CCMA 1SFEA 4M71A 4XLCA 5J1RA 1ZQ3P 1D0YA 3GTKJ 3KLOA 1APLC 1YFHA 2A5WA 5ILSA 2D5VA 2X6WA 4JYKA 3SXYA 3O6BB 5F1RA 2H8RA 1A6QA 1UAAA 3EYYA 4IF4A 2PLYA 4GCVA 4RB0A 2K9NA 4IXAA 1XN7A 3FM3A 5E3MA 4JX6A 1O7FA 2DDAA 3R4KA 1QRYA 2BXZA 3RKQA 1KU7A 4U87A 2ISZA 1IRFA 2JZYA 2CUEA 2R7QA 3GX4X 4YFKF 3H0GJ 4FT8A 1FT9A 2HDCA 1SFUA 1S6LA 1REPC 2W4SA 3DBRB 2KDZA 4ESJA 5FD5A 3HHGA 4LIVA 4ANJA 4H0EA 4S04A 3AG2H 2HTSA 2XPVA 3GTJJ 2F48A 2EK5A 3WODF 3VSLA 4RLFA 3JRDA 2JRMA 4LG0A 1U9OA 1RR7A 2BE5F 4EVIA 3CF5F 1XGNA 4F3QA 1WHUA 2K85A 3WU1B 1XGMA 1VFCA 2VJJA 2VODA 4OMYA 2KIFA 1XCVA 1XX5A 3CCMI 1U3EM 1VQ7I 1AKHA 4XRSG 4E4HA 1I50J 2Q0OA 3MVPA 3BDDA 4XM3A 2CH0A 3CTAA 3M4OJ 2P6SA 1JTXA 2DFIA 3K4NA 2IAIA 4MO7A 4AVZA 5E8IA 3MEXA 2MSYA 2JVHA 1MMNA 2WY8Q 1BJAA 3MFKA 3E6MA 4G7HF 4IRHA 4Y4RA 1YITI 2RREA 2CO5A 1JUSA 1MKMA 2FBKA 5FO5A 2LTPA 4BE1A 4HZFA 2CYYA 4A69C 2DODA 2VKEA 1MDMA 5L3EA 1I1SA 3QOEA 3KP6A 2NNNA 3W2WA 2ID3A 2GA1A 2XAFA 1YJNI 1WI9A 4Y33A 2EFQA 1MSFC 5TJJA 4CA0A 5DCFA 2PJRA 1HKQA 1FPQA 3ZMUA 2P81A 4CCKA 1G3TA 4CGZA 2EIJH 2KHMA 2L7KA 2DK8A 1R22A 2O0YA 2DOFA 2C6YA 1KA8A 4IPAA 3J7YJ 2VJ5A 3M9AA 1WSUA 1KU2A 1ETYA 1YS6A 4KT6A 4LB5A 2LR8A 2OJED 4U88A 1WI3A 1G3YA 3VYTB 2JUCA 4YRVA 3BLYA 2UXXA 1KZHA 2X4HA 4XIDA 2LP0A 5L3DA 4UUTA 2VKDA 1PUEE 1J09A 1ZK8A 4N0BA 1OYIA 2VN2A 3H5AA 2CQ7A 4E7ZA 3E5QA 2XAHA 5C3EJ 3F72A 1EH6A 3DP7A 2H27A 4RGXA 3QU3A 1YJWI 5GTIC 4RB3C 3RYRA 1N25A 1WVRA 1KQ8A 3SDBA 3QPHA 4HPQA 3S32A 2PMZN 2ETHA 1YIJI 4NC6A 2LREA 5FLXK 3CCYA 4EM2A 2DI3A 1BC7C 4CYCB 2RNJA 4DBRA 3A01B 5M3FJ 2FNAA 3BTCA 5JR3A 3LAPA 3HBLA 1MIJA 2LY1A 2E2IJ 2DBBA 4WWCA 1WJDA 3CJNA 4KDPA 4A3LJ 5JVTA
chains in the Genus database with same CATH topology
4UXNA 2HR3A 1Z6TA 5AIPA 3C18A 1HSTA 1U5TA 4WXDA 2XV4S 2WWYA 3GZ6A 4ZZLA 4UVAA 2A69F 2DPUA 2IA0A 4JBAA 2F2EA 3BP8A 3EUHA 1HW5A 1WKMA 5ICEA 1SD7A 4EM0B 3V8JA 2DLLA 4Q5SF 2P5VA 3W6KB 2AXLA 2UZKA 2QQBA 4LD5A 1WRJA 1F4KA 4HW0A 2XAGA 2QQ9A 3GUDA 2W84A 5ED4A 1B1BA 1ODDA 1W7PB 2XROA 3NEUA 3BWGA 2RC4A 3DPLC 3WGHA 4QLCU 4UV8A 3R6SA 4UVBA 1K78B 2VC1A 4G7OF 2F5EA 1FP2A 3QRFF 3MAJA 2MH9A 3M8FA 2RV8A 2E7WA 2VT3A 5J8FA 4YFXF 2G7UA 4L9TA 4MGRA 2D45A 1PP8F 5FB2A 3J80Z 3ZMSA 5BS6A 5ICFA 2DO7A 3Q5FA 2QBYA 4ETSA 4GO1A 1B9MA 4LK1F 5DCMA 2E1NA 3TKYA 3I64A 5A2QK 3IC7A 4BYYA 1STZA 2F5FA 3GXOA 1R58A 1S7AA 1KU3A 3Q9SA 4BQAA 4RB2C 3GVAA 4M74A 1WQ2A 2VBYA 2HTJA 5E17F 3RI4A 3BROA 4LLGF 4P55A 2O3FA 2BBYA 3C7JA 3FXQA 2ZMEB 5ICCA 2A3SA 2R3SA 2DU9A 4MEXF 1PDNC 1YTYA 4R8HA 2F5CA 4FX4A 4YG2F 3BZ6A 4RGSA 5CLSA 4P9UA 1J9IA 1RUOA 2W85A 2O6GE 5D4SA 5E1WA 1FBSA 3ABTA 1KQ9A 5A2QZ 2RVCA 3DXJF 4B09A 1HW1A 2OBPA 3H3ZA 4CZZA 1D5VA 2R7DA 2QLZA 4L9NA 2HZTA 1TQPA 1TQIA 4G94A 3JW4A 3M1EA 3BJAA 1F1ZA 4HQMA 4PCQA 1FYLA 2QENA 4EJVA 2OU2A 5F6FA 1YG2A 1R1UA 4NQWA 2HYGD 4R1HA 3ZMTA 5EEHA 1AWCA 4XSXF 4EM1A 5DYMA 1L3LA 2QWWA 4WCGA 2YX7A 1LQ1A 5HLGA 3E97A 2VE8A 2ZNZA 2DPDA 4I7HA 2IRFG 3BJOA 1B59A 5AIQA 2IT0A 2RQPA 3R0AA 3ROUA 3MQ0A 5F64A 3HHHA 1IUYA 2GIVA 4ZYDA 1I27A 3HIFA 2V1DA 4MHGA 2XVCA 4YFNF 4R79A 1K78A 4EJWA 1XMKA 1QNTA 2DQLA 5LHIA 1ZGJA 3L7WA 1OR7A 4KN4X 2FBHA 4F7ZA 5D5VB 2Y48A 4CHUA 2YR2A 2NNYA 1U5TB 3H3UA 2Y75A 3F23A 4XRFA 4MQVA 1R00A 2KIUA 1IN7A 2YX4A 1VTNC 1USSA 1S3JA 4N9IA 2FE3A 1H9GA 2A68F 2XASA 2UXNA 5BPIA 1DPRA 2L4AA 3FMQA 3FF5A 5CYVA 4PZJA 5LRRA 3QPTA 5IT3A 2ESNA 1F5TA 4KMFA 3W6JB 3F8CA 2YU3A 1DP7P 5HS8A 1HBXG 3I59A 1HKSA 4A0YA 3KEQA 1IN8A 4IHTA 5AONA 3J7AO 4HOBA 3SZPA 2R7FA 2A6HF 1ULYA 3VODA 1TW2A 1U5TC 5ICGA 1ZG1A 4HBLA 4EQQA 1LDDA 4I09A 3KZZA 1K79A 1DUXC 2MLKA 4L5JA 4ENMA 2L4MA 1YLFA 3WG9A 2PBIA 2RDPA 2H09A 2JTVA 2MA3A 1RNLA 1IF1A 4BH9A 3MZYA 2V9VA 4OMZA 1LJ9A 2K7LA 5D5WB 3LSTA 3BJ6A 1P4AA 1XCBA 2EFOA 2VONA 2FQ3A 3WTWC 3TDZC 3I4PA 4HQEA 3HTSB 5L3GA 4HLYA 1IN6A 3I54A 4UHTA 4A5NA 1P4WA 3KZYA 3DPTA 3EYIA 3KETA 4RB1A 1O3RA 1YW8A 3HOSA 3Q9VA 3GW2A 5ERIA 4JQFA 5K5RA 4A6EA 4EMSA 2P5KA 3PQJA 1K7AA 3I71A 3S2WA 1D8KA 2CW0F 3ECHA 2HFHA 1CGPA 4UNOA 1UHWA 1V3FA 2E7XA 4ZH4F 3CO7C 3LA2A 4P9FA 4BHCA 2GAUA 3LAJA 1H9TA 1ZREA 1MJ9A 2MC3A 4WXCA 2JT1A 1DPUA 4RAZA 3CLOA 1IXRC 3T8TA 1OPCA 4HDVA 4BNCA 2MBFA 3ZQ7A 2QZ8A 3WGGA 4XLNF 1UFMA 4MQ9F 1FWZA 1FY7A 5DD8A 5BMZA 4M6XA 2FOKA 1R5GA 1ZRCA 3WTTC 1NHAA 5TRDA 3NQOA 1FYKA 1K6OA 1QQIA 1R5HA 2EJRA 2ZFWA 1YW9A 3IHUA 4L0YB 1Y0UA 2ZXJA 1B9NA 2NRAC 5DEQA 3RDIA 3E5XA 4G6QA 4WF2A 1HSJA 4XBFA 3JSOA 4HLXA 3N97A 1CF7A 3TDUC 1GHCA 2PN6A 1Z6RA 2XHKA 3V7CA 5D5UB 4P5OA 3V8LA 3WTZA 2XUBA 2XKPA 2HYFA 2JRTA 5D4RA 2EFPA 2XGXA 4PGHA 3I59B 4KIFA 2P8TA 1ON2A 1J0RA 3QAHA 5DCMB 2HEOA 5H6QA 1T0FA 1ZRFA 3QU6A 2HWVA 1JHFA 4A2UA 4KIGA 3VOEA 2K4BA 4EJOA 3ZN1A 5D6EA 2PJPA 3SHFA 4IRIA 2FXAA 2LSOA 4HV6A 4ESFA 3VB2A 4XLPF 5JHUA 4L9JA 2DW4A 1YO5C 2ZBKA 2PG4A 3MCZA 1TBXA 3QOPA 2E1CA 2H6BA 4HF1A 1Z1DA 1KGSA 4P96A 5BQTA 4I0AA 1P92A 4CDGA 4TV7A 5DD4A 4Y13A 1J59A 5JFRA 3FMSA 3VFZA 4RAYA 3F8BA 1JXSA 1IRGA 2XAJA 3GWZA 1ZH5A 4KT5C 2YSRA 1Q1HA 1BIBA 4AIJA 1E17A 1KQ0A 2KJBA 3LFKA 1O3QA 3ISPA 4IVNA 1TQMA 1HXDA 3L2CA 2M1BA 3JTHA 4EV0A 4OIQF 1BM9A 1BN5A 1BI2A 1IN5A 2Z3YA 2HGCA 5K5QA 4AIKA 1ZG5A 1TW3A 2A61A 3J80K 2K4JA 3O2PE 3ERED 1J2XA 1Z7UA 2MLGA 3T0YA 4CXFA 4Q4ZF 2FRHA 1W4MA 3KE2A 4Q48A 3P9IA 2BYVE 2YPRA 1JGSA 3RKWA 1Z9CA 1W7PA 5LGUA 3V8KA 4ZZDA 2CG4A 2M45A 4M9ZA 3SZTA 3KP7A 2XIGA 1O57A 1SAXA 2MD5A 3R60A 2IP2A 1YS7A 1FSEA 1FNNA 2LKPA 2HOEA 4GYGA 3GFMA 2QVOA 1P2FA 1T2KA 4M72A 5CVUA 5H6RA 3C1DA 4OU0A 3OOPA 3WE3A 4G9YA 4M9SA 2CQKA 1A04A 4QWQA 1W5TA 2O03A 4EGYA 4I2OA 4UVCA 4U7BA 1LDKB 3ZPLA 2DAOA 2OQGA 1R1VA 4K2EA 3J81K 3DF8A 2LF7A 2COMA 4HV5A 1BIAA 2FF4A 2Q2EA 3VEPA 3KEOA 5ILUA 3IKTA 3U1DA 3GF2A 2EFNA 2ADUA 4FX0A 4OINF 1BBYA 1JE8A 3EETA 3JAMZ 1ZAOA 3HSEA 5K5OA 3BY6A 5LLQA 1Z05A 2WV0A 4PGGA 4ASNA 2GWRA 2MH2A 3GFIA 1P6RA 2LF8A 5LGTA 1L0OC 1GXQA 2FSWA 4A6DA 1G3WA 1EH7A 1G3SA 2VT2A 4KFCA 1F9NA 2WC2A 1U2WA 1QBJA 1B4AA 2QUFA 1IW7F 5CVVA 5E20A 4Y15A 3WTSC 1LEBA 1CF7B 2BGCA 3R61A 2DK5A 3D0SA 1WWXA 3DV8A 2JSCA 5BOXA 2ZNYA 4ENNA 1U8RA 3ULQB 2Z33A 3ZP5A 2PI0A 1ZRDA 1XSXA 3F6VA 1QZYA 1S29A 5L3CA 5HOOA 4GGGA 1QZZA 5HS7A 2EFWA 4HF2A 4L5IA 1RI7A 5ILVA 1HKTA 1SMTA 4BXUA 3MWMA 3P9CA 2FMLA 4AVPA 3WE2A 5D6FA 3P9KA 3KLNA 4CICA 1FP1D 1ZGAA 2F5DA 2P4WA 3WTVC 3GO5A 1OMIA 5KVRA 5IT9Z 2Z99A 3U2RA 1G6NA 4MTDA 2STWA 2HQRA 3JTGA 4HX4A 3ZMZA 4U7DA 2X0LA 2J5OA 2CFXA 3FHZA 2EA2A 4M9XA 1QPMA 5LRSA 4RS8A 4UV9A 2XAQA 2ZMEA 5E1ZB 3CO6C 4I0BA 3H92A 3M8EA 1W5SA 3RKXA 5J6XA 2GXBA 2RN7A 3F8NA 2HKOA 4S05A 2AS5F 2OZUA 4PDKA 1Z91A 2L01A 4LFUA 4KA4A 5E18F 1S8NA 3F8MA 1U6GA 3PFIA 4A5MA 4EJUA 1JHHA 4U0VA 1J7KA 1O3SA 5HS9A 5K1YA 3T5XA 5IT9K 4U0YA 3JSPA 3BPXA 3L09A 2GXGA 1G4DA 3GLXA 3WTXC 3I0TA 3WTUC 3FX3A 2QQAA 4E70A 3TO6A 3ZMVA 4IJAA 1TTYA 2PFBA 4ZYEA 2VXZA 3IRQA 1ON1A 2XRNA 3U9GA 3HSRA 1BI3A 3B73A 3COAC 1FOKA 1P4XA 4ENKA 2B0LA 5J8CA 3T1BA 2NAZA 3LQQA 1SD5A 5H20A 3C3WA 1XB4A 2JPBA 2VBZA 4A12A 4MEYF 4NB5A 1FX7A 5D8LB 3RTRA 4FHTA 2FU4A 3KCCA 3I58A 1D8JA 2CGPA 4UUVA 4I98B 3F3XA 1MJBA 3OV8A 4LJZF 1LVAA 3L9FA 1E2XA 1RZ4A 3HRTA 4LB6B 4ENJA 2HS5A 1FLIA 2KIMA 4OIRF 1IXCA 1KYZA 1RUNA 5LEJA 1FC3A 1AOYA 3QP6A 1T39A 4EGZA 3FXUA 4G7ZF 5BPDA 1UHMA 4D0PA 5EEGA 1UCRA 4ON0A 3I53A 2IPQX 2IA1A 2DTRA 2GQQA 2EWNA 4L18B 4Z2YA 4Y17A 3V7RA 2L3DA 5LBQA 2DQRA 5D8KB 2Q8KA 4I01A 5CJ9A 1BOAA 1J5YA 1I5ZA 2CWEA 4CO8A 4MNUA 2Y0MA 2P5LC 4RGUA 2Z9OA 1HW2A 3K9TA 2EV6A 3DEUA 2PQ8A 3ECOA 3HSFA 3K1NA 4EJTA 2DT5A 4WK8F 4LK0F 4N9HA 3CUQA 3R0JA 1IN4A 3WGIA 4DNCA 2D1HA 5KK1A 2ZJ2A 4I02A 5LEKA 5FD6A 2QM3A 2TDXA 3EQLF 1XGOA 3SQNA 3HYIA 1FZPB 2VBXA 5D5XB 3RJPA 1XSDA 4U0WA 1SFXA 2LDUA 1RIOH 1MZBA 3IRRA 4B8XA 4GYIA 2OD5A 3E3VA 3CUQB 3T8RA 4KICA 1YQAA 3E6DA 1I6XA 2KJCA 3TOBA 5CVJA 1SD4A 3K0LA 2QYOA 4CYDA 5L3BA 3TGNA 3HUGA 2VC0A 5HDNA 1LEAA 2OZ6A 4XSZF 5FLXZ 4BHPA 3BPVA 1ZLJA 5LHGA 5L3FA 2ELHA 4BHBA 3LA7A 3BOQA 4ZYHA 2M87A 2NS0A 2QBYB 3RKYA 3WTYC 3CJNA 1ZHFA 3P7NA 3TO9A 5FFXA 3AAFA 1BI1A 1U78A 2G7HA 2OA4A 3J81Z 2FEZA 4G8XA 2W57A 4KIBA 5DUIA 1IXSB 4LMYA 2K86A 1GXPA 2W24A 2FBIA 1H0MA 3M7GA 3F22A 1EV7A 3GFJA 3K1MA 3FXRA 1R23A 3DQVC 2ISYA 3WU0A 4G6DA 4IRGA 1T6SA 2GA2A 4KNYA 4HAMA 4RGRA 3V4GA 3FWEA 2L02A 1V4RA 1ZARA 4KN7X 3RIRA 1LNWA 2KRFA 1UB9A 2IA2A 4O5VA 1XSVA 1OYYA 3KP3A 4HF0A 3RPQA 4L9VA 5FFZA 3G3ZA 1MD0A 2ACJA 5DUKA 2CSOA 3E6CC 4JK1X 5E8GA 5HVQC 3IKVA 2FNPA 3FZVA 1SD6A 2KKOA 3E6BA 2H6CA 2M8EA 3RYPA 1QO0D 1FSHA 2PMUA 4HX8A 2V6CA 1KU9A 1XDSA 3HOTA 3KP4A 2XKOA 2K02A 1ZN2A 3N4MA 2IVMA 2ZCWA 3HTUA 2A6EF 4M73A 4KMUX 2J5PA 2WTEA 2O8XA 4AIHA 4O3MA 4OIPF 2M30A 2ESHA 2OAZA 5LGNA 2JPCA 1TNTA 1SMYF 3TQNA 3GEZA 2M5WA 4LLLA 1XMAA 4Q47A 2FMYA 3K2ZA 2V1UA 2VOOA 3NRVA 3CUQC 1EH8A 3SFZA 5FGMA 2K27A 5DV5A 1USTA 3FM5A 1PP7U 1IAWA 5CVRA 2VOPA 3DKWA 2W25A 3ELKA 1TLHB 3EDPA 4IHSA 1O7LA 3G73A 1BC8C 4BAYA 3HRSA 1MGTA 1T98A 2GZWA 3ZN0A 1BI0A 2EV0A 3K69A 1MDMB 3KFWX 5JI6A 3TO7A 2H94A 3HRUA 1ZLKA 3MZHA 3PQKA 2IW5A 3CUOA 3REOA 1XGSA 3LWFA 2G9WA 3E5UA 2UWMA 4DQ2A 4OOIA 2FA5A 1D3YA 1LDJA 1YIOA 3K1PA 2P7CB 1FYMA 4AWXB 3RPUA 1S7OA 4LG0B 1XDUA 2EV5A 1R36A 1YYVA 3L00A 3LQRA 1B6AA 2A5YB 4HA8A 4WX9A 1KYWA 1TNSA 1HQCA 3I5UA 3F21A 3ML6A 5DDGA 3O3KA 4LLNA 3LA3A 3V7SA 6PAXA 3DFGA 2PEXA 1YW7A 5E1XA 2ZO4A 1FBQA 4ESBA 3KP5A 1FBUA 3GZ5A 4L0ZB 2A07F 5HLHA 4MTEA 4A0ZA 4KUMA 2IJLA 2V79A 1W7PD 4O6JA 2LNBA 2O61A 2HQNA 2D1VA 3GYHX 2HKXA 2STTA 4LGWA 4A0XA 1T38A 4YIFA 2V1XA 1QGPA 3IWFA 2VBWA 2L54A 3TOAA 1J75A 2PMHA 1I1GA 3ZMDA 1OKRA 2D2WA 3D5LA 2NYXA 3IWZA 3F8FA 1O3TA 5LHHA 4HYEA 4HX7A 2RKHA 2Z5UA 1R1TA 3CDHA 3GFLA 1GVJA 5HDGA 3KP2A 4ZYGA 4M6YA 4NHJA 4WXHA 2P7VB 1MJAA 5HDKA 2ZKZA 3F6OA 5HLIA 4KYWA 1ONVA 5CVIA 3HRMA 1DDNA 4HDUA 3FMRA 1R7JA 2BV6A 2OQRA 4YIIA 2EA4A 3IL2A 4AD9A 4OIOF 1XD7A 2RGVA 3B02A 3JAMK 1IZ1A 2EB7A 4GXOA 2VE9A 1C0WA 1ZYRF 1X3UA 2BEOA 1OYWA 3ABUA 2P6TA 3QP5A 1ZG3A 1SFEA 4M71A 3KLOA 1YFHA 5ILSA 3SXYA 3O6BB 5F1RA 3EYYA 4IF4A 2PLYA 4GCVA 4RB0A 4IXAA 1XN7A 3FM3A 1O7FA 3R4KA 1KU7A 2ISZA 1IRFA 2JZYA 3GX4X 4YFKF 4FT8A 1FT9A 2HDCA 1SFUA 1S6LA 1REPC 4ESJA 5FD5A 3HHGA 4H0EA 2HTSA 2EK5A 3WODF 4LG0A 2BE5F 4EVIA 1XGNA 3WU1B 1XGMA 2VODA 4OMYA 2KIFA 1XCVA 1U3EM 2Q0OA 3BDDA 3CTAA 2P6SA 2DFIA 5E8IA 3MEXA 1BJAA 3MFKA 3E6MA 4G7HF 4IRHA 2CO5A 1MKMA 2FBKA 5FO5A 4HZFA 2CYYA 1MDMA 5L3EA 1I1SA 3KP6A 2NNNA 2GA1A 2XAFA 1WI9A 2EFQA 5TJJA 5DCFA 1HKQA 1FPQA 3ZMUA 1G3TA 4CGZA 2DK8A 1R22A 2O0YA 2C6YA 1KA8A 4IPAA 3M9AA 1WSUA 1KU2A 1YS6A 4LB5A 4U88A 1G3YA 2UXXA 2X4HA 5L3DA 1PUEE 4N0BA 1OYIA 2VN2A 3E5QA 2XAHA 3F72A 1EH6A 3DP7A 2H27A 4RGXA 3QU3A 4RB3C 3RYRA 1KQ8A 3QPHA 2ETHA 5FLXK 4EM2A 2DI3A 1BC7C 2RNJA 2FNAA 5JR3A 3LAPA 2DBBA 4WWCA 4S04A 1LB2A 4KDPA 5JVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXN A;  2HR3 A;  1Z6T A;  5AIP A;  3C18 A;  1HST A;  1U5T A;  4WXD A;  2XV4 S;  2WWY A;  3GZ6 A;  4ZZL A;  4UVA A;  2A69 F;  2DPU A;  2IA0 A;  4JBA A;  2F2E A;  3BP8 A;  3EUH A;  1HW5 A;  1WKM A;  5ICE A;  1SD7 A;  4EM0 B;  3V8J A;  2DLL A;  4Q5S F;  2P5V A;  3W6K B;  2AXL A;  2UZK A;  2QQB A;  4LD5 A;  1WRJ A;  1F4K A;  4HW0 A;  2XAG A;  2QQ9 A;  3GUD A;  2W84 A;  5ED4 A;  1B1B A;  1ODD A;  1W7P B;  2XRO A;  3NEU A;  3BWG A;  2RC4 A;  3DPL C;  3WGH A;  4QLC U;  4UV8 A;  3R6S A;  4UVB A;  1K78 B;  2VC1 A;  4G7O F;  2F5E A;  1FP2 A;  3QRF F;  3MAJ A;  2MH9 A;  3M8F A;  2RV8 A;  2E7W A;  2VT3 A;  5J8F A;  4YFX F;  2G7U A;  4L9T A;  4MGR A;  2D45 A;  1PP8 F;  5FB2 A;  3J80 Z;  3ZMS A;  5BS6 A;  5ICF A;  2DO7 A;  3Q5F A;  2QBY A;  4ETS A;  4GO1 A;  1B9M A;  4LK1 F;  5DCM A;  2E1N A;  3TKY A;  3I64 A;  5A2Q K;  3IC7 A;  4BYY A;  1STZ A;  2F5F A;  3GXO A;  1R58 A;  1S7A A;  1KU3 A;  3Q9S A;  4BQA A;  4RB2 C;  3GVA A;  4M74 A;  1WQ2 A;  2VBY A;  2HTJ A;  5E17 F;  3RI4 A;  3BRO A;  4LLG F;  4P55 A;  2O3F A;  2BBY A;  3C7J A;  3FXQ A;  2ZME B;  5ICC A;  2A3S A;  2R3S A;  2DU9 A;  4MEX F;  1PDN C;  1YTY A;  4R8H A;  2F5C A;  4FX4 A;  4YG2 F;  3BZ6 A;  4RGS A;  5CLS A;  4P9U A;  1J9I A;  1RUO A;  2W85 A;  2O6G E;  5D4S A;  5E1W A;  1FBS A;  3ABT A;  1KQ9 A;  5A2Q Z;  2RVC A;  3DXJ F;  4B09 A;  1HW1 A;  2OBP A;  3H3Z A;  4CZZ A;  1D5V A;  2R7D A;  2QLZ A;  4L9N A;  2HZT A;  1TQP A;  1TQI A;  4G94 A;  3JW4 A;  3M1E A;  3BJA A;  1F1Z A;  4HQM A;  4PCQ A;  1FYL A;  2QEN A;  4EJV A;  2OU2 A;  5F6F A;  1YG2 A;  1R1U A;  4NQW A;  2HYG D;  4R1H A;  3ZMT A;  5EEH A;  1AWC A;  4XSX F;  4EM1 A;  5DYM A;  1L3L A;  2QWW A;  4WCG A;  2YX7 A;  1LQ1 A;  5HLG A;  3E97 A;  2VE8 A;  2ZNZ A;  2DPD A;  4I7H A;  2IRF G;  3BJO A;  1B59 A;  5AIQ A;  2IT0 A;  2RQP A;  3R0A A;  3ROU A;  3MQ0 A;  5F64 A;  3HHH A;  1IUY A;  2GIV A;  4ZYD A;  1I27 A;  3HIF A;  2V1D A;  4MHG A;  2XVC A;  4YFN F;  4R79 A;  1K78 A;  4EJW A;  1XMK A;  1QNT A;  2DQL A;  5LHI A;  1ZGJ A;  3L7W A;  1OR7 A;  4KN4 X;  2FBH A;  4F7Z A;  5D5V B;  2Y48 A;  4CHU A;  2YR2 A;  2NNY A;  1U5T B;  3H3U A;  2Y75 A;  3F23 A;  4XRF A;  4MQV A;  1R00 A;  2KIU A;  1IN7 A;  2YX4 A;  1VTN C;  1USS A;  1S3J A;  4N9I A;  2FE3 A;  1H9G A;  2A68 F;  2XAS A;  2UXN A;  5BPI A;  1DPR A;  2L4A A;  3FMQ A;  3FF5 A;  5CYV A;  4PZJ A;  5LRR A;  3QPT A;  5IT3 A;  2ESN A;  1F5T A;  4KMF A;  3W6J B;  3F8C A;  2YU3 A;  1DP7 P;  5HS8 A;  1HBX G;  3I59 A;  1HKS A;  4A0Y A;  3KEQ A;  1IN8 A;  4IHT A;  5AON A;  3J7A O;  4HOB A;  3SZP A;  2R7F A;  2A6H F;  1ULY A;  3VOD A;  1TW2 A;  1U5T C;  5ICG A;  1ZG1 A;  4HBL A;  4EQQ A;  1LDD A;  4I09 A;  3KZZ A;  1K79 A;  1DUX C;  2MLK A;  4L5J A;  4ENM A;  2L4M A;  1YLF A;  3WG9 A;  2PBI A;  2RDP A;  2H09 A;  2JTV A;  2MA3 A;  1RNL A;  1IF1 A;  4BH9 A;  3MZY A;  2V9V A;  4OMZ A;  1LJ9 A;  2K7L A;  5D5W B;  3LST A;  3BJ6 A;  1P4A A;  1XCB A;  2EFO A;  2VON A;  2FQ3 A;  3WTW C;  3TDZ C;  3I4P A;  4HQE A;  3HTS B;  5L3G A;  4HLY A;  1IN6 A;  3I54 A;  4UHT A;  4A5N A;  1P4W A;  3KZY A;  3DPT A;  3EYI A;  3KET A;  4RB1 A;  1O3R A;  1YW8 A;  3HOS A;  3Q9V A;  3GW2 A;  5ERI A;  4JQF A;  5K5R A;  4A6E A;  4EMS A;  2P5K A;  3PQJ A;  1K7A A;  3I71 A;  3S2W A;  1D8K A;  2CW0 F;  3ECH A;  2HFH A;  1CGP A;  4UNO A;  1UHW A;  1V3F A;  2E7X A;  4ZH4 F;  3CO7 C;  3LA2 A;  4P9F A;  4BHC A;  2GAU A;  3LAJ A;  1H9T A;  1ZRE A;  1MJ9 A;  2MC3 A;  4WXC A;  2JT1 A;  1DPU A;  4RAZ A;  3CLO A;  1IXR C;  3T8T A;  1OPC A;  4HDV A;  4BNC A;  2MBF A;  3ZQ7 A;  2QZ8 A;  3WGG A;  4XLN F;  1UFM A;  4MQ9 F;  1FWZ A;  1FY7 A;  5DD8 A;  5BMZ A;  4M6X A;  2FOK A;  1R5G A;  1ZRC A;  3WTT C;  1NHA A;  5TRD A;  3NQO A;  1FYK A;  1K6O A;  1QQI A;  1R5H A;  2EJR A;  2ZFW A;  1YW9 A;  3IHU A;  4L0Y B;  1Y0U A;  2ZXJ A;  1B9N A;  2NRA C;  5DEQ A;  3RDI A;  3E5X A;  4G6Q A;  4WF2 A;  1HSJ A;  4XBF A;  3JSO A;  4HLX A;  3N97 A;  1CF7 A;  3TDU C;  1GHC A;  2PN6 A;  1Z6R A;  2XHK A;  3V7C A;  5D5U B;  4P5O A;  3V8L A;  3WTZ A;  2XUB A;  2XKP A;  2HYF A;  2JRT A;  5D4R A;  2EFP A;  2XGX A;  4PGH A;  3I59 B;  4KIF A;  2P8T A;  1ON2 A;  1J0R A;  3QAH A;  5DCM B;  2HEO A;  5H6Q A;  1T0F A;  1ZRF A;  3QU6 A;  2HWV A;  1JHF A;  4A2U A;  4KIG A;  3VOE A;  2K4B A;  4EJO A;  3ZN1 A;  5D6E A;  2PJP A;  3SHF A;  4IRI A;  2FXA A;  2LSO A;  4HV6 A;  4ESF A;  3VB2 A;  4XLP F;  5JHU A;  4L9J A;  2DW4 A;  1YO5 C;  2ZBK A;  2PG4 A;  3MCZ A;  1TBX A;  3QOP A;  2E1C A;  2H6B A;  4HF1 A;  1Z1D A;  1KGS A;  4P96 A;  5BQT A;  4I0A A;  1P92 A;  4CDG A;  4TV7 A;  5DD4 A;  4Y13 A;  1J59 A;  5JFR A;  3FMS A;  3VFZ A;  4RAY A;  3F8B A;  1JXS A;  1IRG A;  2XAJ A;  3GWZ A;  1ZH5 A;  4KT5 C;  2YSR A;  1Q1H A;  1BIB A;  4AIJ A;  1E17 A;  1KQ0 A;  2KJB A;  3LFK A;  1O3Q A;  3ISP A;  4IVN A;  1TQM A;  1HXD A;  3L2C A;  2M1B A;  3JTH A;  4EV0 A;  4OIQ F;  1BM9 A;  1BN5 A;  1BI2 A;  1IN5 A;  2Z3Y A;  2HGC A;  5K5Q A;  4AIK A;  1ZG5 A;  1TW3 A;  2A61 A;  3J80 K;  2K4J A;  3O2P E;  3ERE D;  1J2X A;  1Z7U A;  2MLG A;  3T0Y A;  4CXF A;  4Q4Z F;  2FRH A;  1W4M A;  3KE2 A;  4Q48 A;  3P9I A;  2BYV E;  2YPR A;  1JGS A;  3RKW A;  1Z9C A;  1W7P A;  5LGU A;  3V8K A;  4ZZD A;  2CG4 A;  2M45 A;  4M9Z A;  3SZT A;  3KP7 A;  2XIG A;  1O57 A;  1SAX A;  2MD5 A;  3R60 A;  2IP2 A;  1YS7 A;  1FSE A;  1FNN A;  2LKP A;  2HOE A;  4GYG A;  3GFM A;  2QVO A;  1P2F A;  1T2K A;  4M72 A;  5CVU A;  5H6R A;  3C1D A;  4OU0 A;  3OOP A;  3WE3 A;  4G9Y A;  4M9S A;  2CQK A;  1A04 A;  4QWQ A;  1W5T A;  2O03 A;  4EGY A;  4I2O A;  4UVC A;  4U7B A;  1LDK B;  3ZPL A;  2DAO A;  2OQG A;  1R1V A;  4K2E A;  3J81 K;  3DF8 A;  2LF7 A;  2COM A;  4HV5 A;  1BIA A;  2FF4 A;  2Q2E A;  3VEP A;  3KEO A;  5ILU A;  3IKT A;  3U1D A;  3GF2 A;  2EFN A;  2ADU A;  4FX0 A;  4OIN F;  1BBY A;  1JE8 A;  3EET A;  3JAM Z;  1ZAO A;  3HSE A;  5K5O A;  3BY6 A;  5LLQ A;  1Z05 A;  2WV0 A;  4PGG A;  4ASN A;  2GWR A;  2MH2 A;  3GFI A;  1P6R A;  2LF8 A;  5LGT A;  1L0O C;  1GXQ A;  2FSW A;  4A6D A;  1G3W A;  1EH7 A;  1G3S A;  2VT2 A;  4KFC A;  1F9N A;  2WC2 A;  1U2W A;  1QBJ A;  1B4A A;  2QUF A;  1IW7 F;  5CVV A;  5E20 A;  4Y15 A;  3WTS C;  1LEB A;  1CF7 B;  2BGC A;  3R61 A;  2DK5 A;  3D0S A;  1WWX A;  3DV8 A;  2JSC A;  5BOX A;  2ZNY A;  4ENN A;  1U8R A;  3ULQ B;  2Z33 A;  3ZP5 A;  2PI0 A;  1ZRD A;  1XSX A;  3F6V A;  1QZY A;  1S29 A;  5L3C A;  5HOO A;  4GGG A;  1QZZ A;  5HS7 A;  2EFW A;  4HF2 A;  4L5I A;  1RI7 A;  5ILV A;  1HKT A;  1SMT A;  4BXU A;  3MWM A;  3P9C A;  2FML A;  4AVP A;  3WE2 A;  5D6F A;  3P9K A;  3KLN A;  4CIC A;  1FP1 D;  1ZGA A;  2F5D A;  2P4W A;  3WTV C;  3GO5 A;  1OMI A;  5KVR A;  5IT9 Z;  2Z99 A;  3U2R A;  1G6N A;  4MTD A;  2STW A;  2HQR A;  3JTG A;  4HX4 A;  3ZMZ A;  4U7D A;  2X0L A;  2J5O A;  2CFX A;  3FHZ A;  2EA2 A;  4M9X A;  1QPM A;  5LRS A;  4RS8 A;  4UV9 A;  2XAQ A;  2ZME A;  5E1Z B;  3CO6 C;  4I0B A;  3H92 A;  3M8E A;  1W5S A;  3RKX A;  5J6X A;  2GXB A;  2RN7 A;  3F8N A;  2HKO A;  4S05 A;  2AS5 F;  2OZU A;  4PDK A;  1Z91 A;  2L01 A;  4LFU A;  4KA4 A;  5E18 F;  1S8N A;  3F8M A;  1U6G A;  3PFI A;  4A5M A;  4EJU A;  1JHH A;  4U0V A;  1J7K A;  1O3S A;  5HS9 A;  5K1Y A;  3T5X A;  5IT9 K;  4U0Y A;  3JSP A;  3BPX A;  3L09 A;  2GXG A;  1G4D A;  3GLX A;  3WTX C;  3I0T A;  3WTU C;  3FX3 A;  2QQA A;  4E70 A;  3TO6 A;  3ZMV A;  4IJA A;  1TTY A;  2PFB A;  4ZYE A;  2VXZ A;  3IRQ A;  1ON1 A;  2XRN A;  3U9G A;  3HSR A;  1BI3 A;  3B73 A;  3COA C;  1FOK A;  1P4X A;  4ENK A;  2B0L A;  5J8C A;  3T1B A;  2NAZ A;  3LQQ A;  1SD5 A;  5H20 A;  3C3W A;  1XB4 A;  2JPB A;  2VBZ A;  4A12 A;  4MEY F;  4NB5 A;  1FX7 A;  5D8L B;  3RTR A;  4FHT A;  2FU4 A;  3KCC A;  3I58 A;  1D8J A;  2CGP A;  4UUV A;  4I98 B;  3F3X A;  1MJB A;  3OV8 A;  4LJZ F;  1LVA A;  3L9F A;  1E2X A;  1RZ4 A;  3HRT A;  4LB6 B;  4ENJ A;  2HS5 A;  1FLI A;  2KIM A;  4OIR F;  1IXC A;  1KYZ A;  1RUN A;  5LEJ A;  1FC3 A;  1AOY A;  3QP6 A;  1T39 A;  4EGZ A;  3FXU A;  4G7Z F;  5BPD A;  1UHM A;  4D0P A;  5EEG A;  1UCR A;  4ON0 A;  3I53 A;  2IPQ X;  2IA1 A;  2DTR A;  2GQQ A;  2EWN A;  4L18 B;  4Z2Y A;  4Y17 A;  3V7R A;  2L3D A;  5LBQ A;  2DQR A;  5D8K B;  2Q8K A;  4I01 A;  5CJ9 A;  1BOA A;  1J5Y A;  1I5Z A;  2CWE A;  4CO8 A;  4MNU A;  2Y0M A;  2P5L C;  4RGU A;  2Z9O A;  1HW2 A;  3K9T A;  2EV6 A;  3DEU A;  2PQ8 A;  3ECO A;  3HSF A;  3K1N A;  4EJT A;  2DT5 A;  4WK8 F;  4LK0 F;  4N9H A;  3CUQ A;  3R0J A;  1IN4 A;  3WGI A;  4DNC A;  2D1H A;  5KK1 A;  2ZJ2 A;  4I02 A;  5LEK A;  5FD6 A;  2QM3 A;  2TDX A;  3EQL F;  1XGO A;  3SQN A;  3HYI A;  1FZP B;  2VBX A;  5D5X B;  3RJP A;  1XSD A;  4U0W A;  1SFX A;  2LDU A;  1RIO H;  1MZB A;  3IRR A;  4B8X A;  4GYI A;  2OD5 A;  3E3V A;  3CUQ B;  3T8R A;  4KIC A;  1YQA A;  3E6D A;  1I6X A;  2KJC A;  3TOB A;  5CVJ A;  1SD4 A;  3K0L A;  2QYO A;  4CYD A;  5L3B A;  3TGN A;  3HUG A;  2VC0 A;  5HDN A;  1LEA A;  2OZ6 A;  4XSZ F;  5FLX Z;  4BHP A;  3BPV A;  1ZLJ A;  5LHG A;  5L3F A;  2ELH A;  4BHB A;  3LA7 A;  3BOQ A;  4ZYH A;  2M87 A;  2NS0 A;  2QBY B;  3RKY A;  3WTY C;  3CJN A;  1ZHF A;  3P7N A;  3TO9 A;  5FFX A;  3AAF A;  1BI1 A;  1U78 A;  2G7H A;  2OA4 A;  3J81 Z;  2FEZ A;  4G8X A;  2W57 A;  4KIB A;  5DUI A;  1IXS B;  4LMY A;  2K86 A;  1GXP A;  2W24 A;  2FBI A;  1H0M A;  3M7G A;  3F22 A;  1EV7 A;  3GFJ A;  3K1M A;  3FXR A;  1R23 A;  3DQV C;  2ISY A;  3WU0 A;  4G6D A;  4IRG A;  1T6S A;  2GA2 A;  4KNY A;  4HAM A;  4RGR A;  3V4G A;  3FWE A;  2L02 A;  1V4R A;  1ZAR A;  4KN7 X;  3RIR A;  1LNW A;  2KRF A;  1UB9 A;  2IA2 A;  4O5V A;  1XSV A;  1OYY A;  3KP3 A;  4HF0 A;  3RPQ A;  4L9V A;  5FFZ A;  3G3Z A;  1MD0 A;  2ACJ A;  5DUK A;  2CSO A;  3E6C C;  4JK1 X;  5E8G A;  5HVQ C;  3IKV A;  2FNP A;  3FZV A;  1SD6 A;  2KKO A;  3E6B A;  2H6C A;  2M8E A;  3RYP A;  1QO0 D;  1FSH A;  2PMU A;  4HX8 A;  2V6C A;  1KU9 A;  1XDS A;  3HOT A;  3KP4 A;  2XKO A;  2K02 A;  1ZN2 A;  3N4M A;  2IVM A;  2ZCW A;  3HTU A;  2A6E F;  4M73 A;  4KMU X;  2J5P A;  2WTE A;  2O8X A;  4AIH A;  4O3M A;  4OIP F;  2M30 A;  2ESH A;  2OAZ A;  5LGN A;  2JPC A;  1TNT A;  1SMY F;  3TQN A;  3GEZ A;  2M5W A;  4LLL A;  1XMA A;  4Q47 A;  2FMY A;  3K2Z A;  2V1U A;  2VOO A;  3NRV A;  3CUQ C;  1EH8 A;  3SFZ A;  5FGM A;  2K27 A;  5DV5 A;  1UST A;  3FM5 A;  1PP7 U;  1IAW A;  5CVR A;  2VOP A;  3DKW A;  2W25 A;  3ELK A;  1TLH B;  3EDP A;  4IHS A;  1O7L A;  3G73 A;  1BC8 C;  4BAY A;  3HRS A;  1MGT A;  1T98 A;  2GZW A;  3ZN0 A;  1BI0 A;  2EV0 A;  3K69 A;  1MDM B;  3KFW X;  5JI6 A;  3TO7 A;  2H94 A;  3HRU A;  1ZLK A;  3MZH A;  3PQK A;  2IW5 A;  3CUO A;  3REO A;  1XGS A;  3LWF A;  2G9W A;  3E5U A;  2UWM A;  4DQ2 A;  4OOI A;  2FA5 A;  1D3Y A;  1LDJ A;  1YIO A;  3K1P A;  2P7C B;  1FYM A;  4AWX B;  3RPU A;  1S7O A;  4LG0 B;  1XDU A;  2EV5 A;  1R36 A;  1YYV A;  3L00 A;  3LQR A;  1B6A A;  2A5Y B;  4HA8 A;  4WX9 A;  1KYW A;  1TNS A;  1HQC A;  3I5U A;  3F21 A;  3ML6 A;  5DDG A;  3O3K A;  4LLN A;  3LA3 A;  3V7S A;  6PAX A;  3DFG A;  2PEX A;  1YW7 A;  5E1X A;  2ZO4 A;  1FBQ A;  4ESB A;  3KP5 A;  1FBU A;  3GZ5 A;  4L0Z B;  2A07 F;  5HLH A;  4MTE A;  4A0Z A;  4KUM A;  2IJL A;  2V79 A;  1W7P D;  4O6J A;  2LNB A;  2O61 A;  2HQN A;  2D1V A;  3GYH X;  2HKX A;  2STT A;  4LGW A;  4A0X A;  1T38 A;  4YIF A;  2V1X A;  1QGP A;  3IWF A;  2VBW A;  2L54 A;  3TOA A;  1J75 A;  2PMH A;  1I1G A;  3ZMD A;  1OKR A;  2D2W A;  3D5L A;  2NYX A;  3IWZ A;  3F8F A;  1O3T A;  5LHH A;  4HYE A;  4HX7 A;  2RKH A;  2Z5U A;  1R1T A;  3CDH A;  3GFL A;  1GVJ A;  5HDG A;  3KP2 A;  4ZYG A;  4M6Y A;  4NHJ A;  4WXH A;  2P7V B;  1MJA A;  5HDK A;  2ZKZ A;  3F6O A;  5HLI A;  4KYW A;  1ONV A;  5CVI A;  3HRM A;  1DDN A;  4HDU A;  3FMR A;  1R7J A;  2BV6 A;  2OQR A;  4YII A;  2EA4 A;  3IL2 A;  4AD9 A;  4OIO F;  1XD7 A;  2RGV A;  3B02 A;  3JAM K;  1IZ1 A;  2EB7 A;  4GXO A;  2VE9 A;  1C0W A;  1ZYR F;  1X3U A;  2BEO A;  1OYW A;  3ABU A;  2P6T A;  3QP5 A;  1ZG3 A;  1SFE A;  4M71 A;  3KLO A;  1YFH A;  5ILS A;  3SXY A;  3O6B B;  5F1R A;  3EYY A;  4IF4 A;  2PLY A;  4GCV A;  4RB0 A;  4IXA A;  1XN7 A;  3FM3 A;  1O7F A;  3R4K A;  1KU7 A;  2ISZ A;  1IRF A;  2JZY A;  3GX4 X;  4YFK F;  4FT8 A;  1FT9 A;  2HDC A;  1SFU A;  1S6L A;  1REP C;  4ESJ A;  5FD5 A;  3HHG A;  4H0E A;  2HTS A;  2EK5 A;  3WOD F;  4LG0 A;  2BE5 F;  4EVI A;  1XGN A;  3WU1 B;  1XGM A;  2VOD A;  4OMY A;  2KIF A;  1XCV A;  1U3E M;  2Q0O A;  3BDD A;  3CTA A;  2P6S A;  2DFI A;  5E8I A;  3MEX A;  1BJA A;  3MFK A;  3E6M A;  4G7H F;  4IRH A;  2CO5 A;  1MKM A;  2FBK A;  5FO5 A;  4HZF A;  2CYY A;  1MDM A;  5L3E A;  1I1S A;  3KP6 A;  2NNN A;  2GA1 A;  2XAF A;  1WI9 A;  2EFQ A;  5TJJ A;  5DCF A;  1HKQ A;  1FPQ A;  3ZMU A;  1G3T A;  4CGZ A;  2DK8 A;  1R22 A;  2O0Y A;  2C6Y A;  1KA8 A;  4IPA A;  3M9A A;  1WSU A;  1KU2 A;  1YS6 A;  4LB5 A;  4U88 A;  1G3Y A;  2UXX A;  2X4H A;  5L3D A;  1PUE E;  4N0B A;  1OYI A;  2VN2 A;  3E5Q A;  2XAH A;  3F72 A;  1EH6 A;  3DP7 A;  2H27 A;  4RGX A;  3QU3 A;  4RB3 C;  3RYR A;  1KQ8 A;  3QPH A;  2ETH A;  5FLX K;  4EM2 A;  2DI3 A;  1BC7 C;  2RNJ A;  2FNA A;  5JR3 A;  3LAP A;  2DBB A;  4WWC A;  4S04 A;  1LB2 A;  4KDP A;  5JVT A; 
#chains in the Genus database with same CATH topology
 4UXN A;  3E7L A;  4IOA F;  1SC7 A;  2HR3 A;  2OTL I;  2E2J J;  1Y6I A;  1Z6T A;  2ICW G;  4ZTJ A;  1YHQ I;  5AIP A;  1DU6 A;  2M4K A;  3C18 A;  1HST A;  1JKR C;  1U5T A;  4WXD A;  2XV4 S;  2WWY A;  3S14 J;  2GBY A;  3GZ6 A;  2ECB A;  2CRG A;  1W1W E;  4ZZL A;  4UY8 I;  1EA3 A;  5M3M J;  3FIS A;  4UVA A;  2DT7 B;  2A69 F;  1D5Y A;  5IP9 J;  3I55 I;  3I4M J;  4E7L A;  2QQ8 A;  3OYJ A;  2DPU A;  2IA0 A;  4JBA A;  2F2E A;  3BP8 A;  3EUH A;  4XNF A;  1HW5 A;  1WKM A;  5ICE A;  1N75 A;  4AYB N;  3OYB A;  1SD7 A;  1YE9 A;  4EM0 B;  3V8J A;  3H0D A;  5H2F C;  3HC7 A;  2DLL A;  4F93 B;  3VDX A;  1B72 B;  1ETK A;  4Q5S F;  2P5V A;  3W6K B;  3H9Q A;  2AXL A;  2WAQ A;  2UZK A;  2QQB A;  3CCU I;  2X48 A;  2GIZ A;  2VPR A;  4LD5 A;  1TWG J;  2GOM A;  1JUM A;  1WRJ A;  1F4K A;  4HW0 A;  2XAG A;  2QQ9 A;  2ZXW H;  1OCR H;  3GUD A;  2W84 A;  1OCC H;  5ED4 A;  3CCL I;  2I5U A;  1B1B A;  1ODD A;  2O7O A;  2KRH A;  2Y30 A;  4XKC A;  3DKX A;  1W7P B;  3K6G A;  3NEU A;  2XRO A;  3BWG A;  1IO2 A;  2RC4 A;  2M3A A;  3DPL C;  3WGH A;  4QLC U;  4UV8 A;  1VI0 A;  3R6S A;  1HCR A;  4UVB A;  1K78 B;  2VC1 A;  4G7O F;  2F5E A;  3UR3 C;  3CCV I;  1FP2 A;  3OL4 A;  3MAJ A;  3PSF A;  1DGR M;  4BE2 A;  3QRF F;  4A3M J;  2MH9 A;  3M8F A;  2RV8 A;  2E7W A;  2VT3 A;  2NVT J;  1D0Z A;  5J8F A;  2VUM J;  4YFX F;  2O9L A;  4PJL A;  2G7U A;  4L9T A;  4JP0 A;  4MGR A;  2M7A A;  3K2A A;  2M4G A;  5EEA A;  2HXI A;  2D45 A;  1PP8 F;  5FB2 A;  3J80 Z;  3ZMS A;  5BS6 A;  1T8I A;  5ICF A;  4A3B J;  2MGQ A;  4XRS A;  2DO7 A;  3Q5F A;  5J40 A;  1MH3 A;  4BY1 J;  2QBY A;  4ETS A;  2DTZ A;  2EIL H;  3G2B A;  1ZGW A;  4GO1 A;  1B9M A;  1IUF A;  4LK1 F;  5DCM A;  3ASN H;  2HPM A;  2OF7 A;  2E1N A;  3PSI A;  1X3W B;  3LNQ A;  1QU3 A;  3TKY A;  3I64 A;  1M1E B;  2VXD A;  5A2Q K;  2K9Q A;  2A05 A;  2Y69 H;  1D1A A;  2ME0 A;  3IC7 A;  4BYY A;  1STZ A;  1GV5 A;  5IY5 H;  4D7N A;  4HG2 A;  3ZCO A;  2F5F A;  2AHQ A;  1LUJ B;  3EPZ A;  3GXO A;  1R58 A;  1S7A A;  3MKZ A;  1ETX A;  1KU3 A;  3Q9S A;  4HSR A;  3OIO A;  4BQA A;  4X1E A;  3W2A A;  4RB2 C;  3GVA A;  4M74 A;  1WQ2 A;  2DFH A;  2DJI A;  2VBY A;  3CJT B;  1OIS A;  2HTJ A;  5E17 F;  2BY1 A;  2VQL A;  3RI4 A;  2OPT A;  1BOB A;  3BRO A;  4LLG F;  1EJ9 A;  2COB A;  1BR2 A;  2O3F A;  4P55 A;  2BBY A;  3C7J A;  3FXQ A;  2ZME B;  4FE4 A;  3I3L A;  5ICC A;  1P7I A;  2A3S A;  2R3S A;  3BG9 A;  2DU9 A;  4MEX F;  2JA2 A;  4D7M A;  1PDN C;  5FKK A;  5LFA A;  4X6A J;  1YTY A;  4R8H A;  3MN2 A;  2X6Y A;  2F5C A;  2VQG A;  2VJI A;  1IRZ A;  4FX4 A;  4PJM A;  4YG2 F;  3BZ6 A;  4RGS A;  5CLS A;  3HL2 A;  2EZI A;  4P9U A;  1J9I A;  3CES A;  1RUO A;  2W85 A;  2O6G E;  5D4S A;  5E1W A;  2EH3 A;  2QSH X;  1FBS A;  4IZZ A;  1WJA A;  3VYS B;  2R5Y A;  5F27 A;  3ABT A;  1VQ6 I;  1KQ9 A;  5A2Q Z;  2RVC A;  3DXJ F;  4B09 A;  1HW1 A;  2B7E A;  2L2O A;  2OBP A;  3H3Z A;  2ME6 A;  4CZZ A;  1D5V A;  2R7D A;  2QLZ A;  1E3H A;  5EZH A;  2JQ7 A;  1PUF A;  1VQ9 I;  4GRI A;  4RDU A;  4A3F J;  4L9N A;  2Z16 A;  2HZT A;  2TCT A;  1TQP A;  3G1O A;  3CP2 A;  3ZRG A;  4PSW A;  1TQI A;  2ZB9 A;  4G94 A;  4AID A;  3JW4 A;  3M1E A;  1MBE A;  3BJA A;  1F1Z A;  4HQM A;  4PCQ A;  3CCR I;  2QEN A;  2MG4 A;  3LSH A;  1FYL A;  4ABZ A;  2M9H A;  4EJV A;  4IEJ A;  2OU2 A;  3FXK A;  5F6F A;  1YG2 A;  2IGN A;  1MSE C;  1R1U A;  2XF6 A;  4NQW A;  3S3O A;  2LBF B;  1XTA A;  3SZG A;  2HYG D;  4BE0 A;  4R1H A;  3ZMT A;  5EEH A;  1AWC A;  1MMS A;  4XSX F;  4EM1 A;  2G0E A;  1FOX A;  3ERM A;  1OCT C;  5DYM A;  1FIA A;  2KT0 A;  1L3L A;  3IAS 2;  2QWW A;  4XLE A;  4WCG A;  1DU0 A;  5F0F A;  2YX7 A;  3OR1 C;  3MKW B;  1ACI A;  1XC5 A;  1K83 J;  3D5R C;  1LQ1 A;  2H1K A;  2LYC A;  3E97 A;  5HLG A;  3S1R J;  4W1U A;  2VE8 A;  4IQ4 A;  2ZNZ A;  1H8A C;  2DPD A;  4I7H A;  2LFB A;  2IRF G;  3BJO A;  1B59 A;  3ABK H;  5AIQ A;  2IT0 A;  1X19 A;  1BR1 A;  2RQP A;  3R0A A;  4DYR A;  3UKG A;  3K4M A;  2WV1 A;  5F0C A;  3ROU A;  3MQ0 A;  5F64 A;  4A3C J;  2NVX J;  3HHH A;  1IUY A;  2GIV A;  2DMQ A;  3FHN A;  4ZYD A;  2OCC H;  1SFK A;  1VQ4 I;  1I27 A;  3HIF A;  2V1D A;  3GZN B;  4MHG A;  2DA4 A;  4CSW A;  2XVC A;  1VQO I;  4YFN F;  1VQN I;  4R79 A;  1K78 A;  1UJ8 A;  1RES A;  4EJW A;  2L9N A;  3VYU B;  1XMK A;  1QNT A;  2DQL A;  5LHI A;  1ZGJ A;  3L7W A;  2VJ4 A;  1OR7 A;  2WAF A;  4KN4 X;  2FBH A;  4F7Z A;  4BU2 A;  3LSR A;  5D5V B;  2Y48 A;  4CHU A;  1RET A;  3EUK L;  2YR2 A;  2NNY A;  1U5T B;  3H3U A;  5CQG A;  2Y75 A;  2IS1 A;  4XRF A;  2HI3 A;  3F23 A;  4IQJ A;  5B1B H;  4HRI A;  4MQV A;  1R00 A;  2KIU A;  4LIT A;  1A6I A;  3VSK A;  1JUP A;  4I99 C;  1IN7 A;  2YX4 A;  3MMY B;  1VTN C;  1IV8 A;  1USS A;  1S3J A;  3OMY A;  2V7F A;  4N9I A;  2LVS A;  2FE3 A;  4D5C A;  4B43 A;  3G6E I;  3CME I;  1H9G A;  2A68 F;  2XAS A;  3BQZ A;  2UXN A;  5BPI A;  1DPR A;  2L4A A;  1IDZ A;  3FMQ A;  1W36 C;  3FF5 A;  5CYV A;  2IGO A;  4PZJ A;  5LRR A;  3QPT A;  5IT3 A;  1V54 H;  2ESN A;  2ZFU A;  2ZXI A;  3DKY A;  3K4B A;  3RCO A;  3BG5 A;  1F5T A;  2AQE A;  4KMF A;  3KYC B;  4C2T A;  3W6J B;  4XKW A;  1FIP A;  4XON A;  3F8C A;  2YU3 A;  4RAG A;  1DP7 P;  5HS8 A;  1HBX G;  3I59 A;  4BGD A;  2E71 A;  4C2M J;  1HKS A;  4A0Y A;  1I3A A;  1IN8 A;  3KEQ A;  4B44 A;  5GAE J;  4IHT A;  5AON A;  3J7A O;  4HOB A;  3SZP A;  2R7F A;  4RMN A;  3DPU A;  1Y39 A;  2A6H F;  1ULY A;  3VOD A;  1TW2 A;  1U5T C;  5ICG A;  1ZG1 A;  3ZXS A;  2FUG 2;  2BVL A;  4HBL A;  4EQQ A;  1LDD A;  4I09 A;  2KZG A;  3KZZ A;  1R71 A;  1K79 A;  2LG4 A;  1DUX C;  3CZ6 A;  2DOA A;  2MLK A;  4L5J A;  4ENM A;  2QF7 A;  4UB6 C;  3S1Q J;  2Y9Z A;  1VQ8 I;  2L4M A;  2KP6 A;  1YLF A;  3U21 A;  1HA8 A;  3WG9 A;  1AHD P;  2VB6 A;  1MBJ A;  2PBI A;  2RDP A;  1H88 C;  1QVT A;  2H09 A;  2JTV A;  4ZDO A;  1ZTR A;  4XKV A;  2MA3 A;  5FRO A;  1RNL A;  3HXL A;  1HLV A;  5F08 A;  5HLT A;  2R7R A;  1IF1 A;  3WHB A;  4BH9 A;  3MZY A;  2V9V A;  4P1W A;  3CCJ I;  3OSG A;  2XF7 A;  2AO9 A;  1LJ9 A;  2K7L A;  3BZC A;  4OMZ A;  4BJ5 C;  1MBH A;  5D5W B;  3H35 A;  3LST A;  3BJ6 A;  2K40 A;  3OS1 A;  1P4A A;  1YOV B;  3K70 D;  2Y2Z A;  1XCB A;  2EFO A;  2VON A;  1SVO A;  3OYE A;  2FQ3 A;  3CJR B;  3WTW C;  3TDZ C;  3I4P A;  4HQE A;  5HOD A;  1YX3 A;  3HTS B;  3OYL A;  5L3G A;  4M3E A;  4HLY A;  1IN6 A;  2A6T A;  3I54 A;  4UHT A;  4FE7 A;  4A5N A;  1T08 B;  2FQ4 A;  2LY9 A;  1P4W A;  4BDY A;  5B3S H;  5GAD J;  1XS9 A;  3KZY A;  3DPT A;  3EYI A;  2ZSI B;  3H36 A;  3KET A;  5C4X J;  3BTI A;  4A3E J;  2CQQ A;  3P5J A;  4RB1 A;  3JRA A;  2X85 A;  1O3R A;  1Z3Y A;  3PUF A;  4XN0 A;  1YW8 A;  3HOS A;  3Q9V A;  3GW2 A;  5ERI A;  2W00 A;  4JQF A;  5K5R A;  3M07 A;  4A6E A;  2BZT A;  4EMS A;  1EF4 A;  5KNL A;  2P5K A;  3PQJ A;  1K7A A;  3I71 A;  4D1Q A;  1OCP A;  3S2W A;  1FMW A;  1D8K A;  1IJW C;  2CW0 F;  3ECH A;  2HFH A;  1CGP A;  2JWT A;  4W97 A;  4FCY A;  4UNO A;  1UHW A;  4UB8 C;  1V3F A;  2M0M A;  2E7X A;  4ZH4 F;  3CO7 C;  2DA1 A;  2R7U A;  5IYD J;  3M1C A;  1ORK A;  3LA2 A;  2KZV A;  4P9F A;  4BHC A;  1K61 A;  2GAU A;  5E3L A;  4PUS A;  3LAJ A;  1JKQ C;  1H9T A;  3PUB A;  1ZRE A;  1MJ9 A;  3A2K A;  4DOZ A;  3BC8 A;  2XB0 X;  2VAS A;  2MC3 A;  4NC7 A;  4BQQ A;  2CQN A;  4WXC A;  1SEU A;  2JT1 A;  4RBO A;  4IKF A;  4OAZ A;  4RAF A;  3IP4 B;  1SAN A;  1DPU A;  4RAZ A;  3RQ4 A;  3ZOB A;  1X4P A;  3CLO A;  1IXR C;  3T8T A;  1OPC A;  4HDV A;  2K5C A;  1RKT A;  4BNC A;  2MBF A;  3ZQ7 A;  1K6Y A;  3HGY A;  1IG7 A;  2QZ8 A;  4YEL A;  1OCO H;  3FBI B;  2HNH A;  3I9V 2;  1YI2 I;  1UG0 A;  3WGG A;  4XLN F;  1UFM A;  4AM3 A;  3E0J B;  4MQ9 F;  1FWZ A;  1FY7 A;  4HEA 2;  5DD8 A;  5BMZ A;  1X1P A;  4M6X A;  4CCN A;  2FOK A;  1R5G A;  1OFC X;  5DM6 F;  3LOC A;  5IYC J;  3L2R A;  2KL4 A;  2LOO A;  1ZRC A;  3WTT C;  1NHA A;  2MFZ A;  3BTL A;  3GTP J;  5TRD A;  1D1C A;  3LSP A;  3NQO A;  1JJ6 C;  1FYK A;  5E3N A;  1K6O A;  1QQI A;  1R5H A;  2EJR A;  2ZFW A;  3BR5 A;  1YW9 A;  2KLO A;  1YX5 A;  3HOV J;  4RLQ A;  3IHU A;  3S2D J;  3HOZ J;  2GXA A;  4L0Y B;  1Y0U A;  2ZXJ A;  1B9N A;  2NRA C;  1JT6 A;  2KPM A;  3IH2 A;  2NOG A;  5DEQ A;  3E5X A;  4JX5 A;  3RDI A;  4G6Q A;  1R6R A;  1HSJ A;  3LL7 A;  4WF2 A;  4XKB A;  4E7H A;  4XBF A;  3JSO A;  3L2Q A;  4HLX A;  1A5J A;  1IRX A;  2IGK A;  4QTR A;  3N97 A;  3HOX J;  1CF7 A;  3RZO J;  3TDU C;  2OTJ I;  1RC9 A;  4NDL A;  4FIS A;  3S1M J;  1TWF J;  2KMU A;  5FRM A;  3CMM A;  2KFD A;  1GHC A;  3FBN B;  2PN6 A;  1Z6R A;  2DMP A;  2XHK A;  3V7C A;  5D5U B;  2KIQ A;  3LFU A;  1B8I B;  4P5O A;  2MAB A;  3V8L A;  2FOW A;  2NVU B;  3WTZ A;  4HNT A;  2XUB A;  3HUG B;  3CCS I;  2XKP A;  2LRD A;  2VI6 A;  2HYF A;  1G2H A;  2JRT A;  5M5X J;  5D4R A;  2EFP A;  3JRG A;  2YU9 J;  2JA7 J;  2XGX A;  1N78 A;  4PGH A;  3I59 B;  4KIF A;  2JVG A;  2E34 A;  2P8T A;  1ON2 A;  1X1A A;  1J0R A;  4HNV A;  3QAH A;  4I76 A;  5DCM B;  1LB2 A;  1E3O C;  2HEO A;  5H6Q A;  1T0F A;  1ZRF A;  3QU6 A;  3ZQQ A;  2HWV A;  1JHF A;  5IP6 A;  5M5W J;  3GTL J;  2KRC A;  2JMW A;  2CMP A;  2PMZ A;  1I39 A;  1G8X A;  2HDW A;  4A2U A;  3S1N J;  4KIG A;  3H1C A;  3VOE A;  2K4B A;  4EJO A;  3ZN1 A;  1VQK I;  4GDF A;  2R7V A;  5D6E A;  3H5R A;  2PJP A;  3SHF A;  4IRI A;  2K9M A;  4FAS D;  2FXA A;  2LSO A;  4HV6 A;  1X58 A;  2LH9 A;  4ESF A;  2QA4 I;  3VB2 A;  3L2W A;  1MMA A;  2QKL B;  4XLP F;  2AQF A;  4XMY A;  5JHU A;  4L9J A;  4JOM A;  1OLT A;  2DW4 A;  1YO5 C;  4F52 A;  3PNV A;  5BNG A;  2ZBK A;  2L9V A;  3L2U A;  2PG4 A;  3MCZ A;  1TBX A;  4XIC A;  3QOP A;  4I6Z A;  2E1C A;  5K7Z A;  2H6B A;  4HF1 A;  1Z1D A;  1KGS A;  1MW7 A;  2WBM A;  4P96 A;  1E0E A;  1RPW A;  3HB9 A;  5BQT A;  4I0A A;  3K7A J;  1P92 A;  4CDG A;  3AG3 H;  4TV7 A;  5F1J A;  4CCL A;  5DD4 A;  4Y13 A;  1J59 A;  5JFR A;  3FMS A;  3VFZ A;  1E3P A;  4RAY A;  1Q1V A;  3ZQL A;  3F8B A;  1JXS A;  1IRG A;  2XAJ A;  3GWZ A;  1SFO J;  1ZH5 A;  4E7K A;  2V9K A;  4GFB A;  1DGW Y;  3BZK A;  4KT5 C;  2YSR A;  4ZC3 A;  4E7I A;  1Q1H A;  1F43 A;  2L0K A;  4BBS J;  1BIB A;  3A03 A;  4AIJ A;  2BVM A;  4D9J A;  3G71 I;  1E17 A;  3MKL A;  1KQ0 A;  2KJB A;  1Z3X A;  2DN0 A;  4MFE A;  1LPQ A;  3JRE A;  3LFK A;  3TP0 A;  1O3Q A;  4B47 A;  2V9P A;  4CUG A;  3ISP A;  4IVN A;  1TQM A;  1HXD A;  1VQ5 I;  3IV5 A;  4PK4 A;  3DU6 A;  3L2C A;  2M1B A;  3JTH A;  4EV0 A;  1BL0 A;  4OIQ F;  3BG6 A;  4C9Y A;  3M3Y J;  3C2B A;  1BM9 A;  4PSX A;  1BN5 A;  1MBF A;  1BI2 A;  3EUA A;  2ZJR F;  1IN5 A;  2Z3Y A;  2Y0S N;  1R9T J;  2HGC A;  4XN3 A;  5K5Q A;  4AIK A;  2ZSH B;  1ZG5 A;  2O5R A;  3CD6 I;  1TW3 A;  4CYC A;  1VQM I;  2A61 A;  3J80 K;  2K4J A;  1HF0 A;  2R5Z A;  3O2P E;  3ERE D;  4FTH A;  1J2X A;  1Z7U A;  2MLG A;  3T0Y A;  4CXF A;  4Q4Z F;  4E7S A;  3JR9 A;  4AC0 A;  4Y52 J;  2BY3 A;  2FRH A;  3D5S C;  1W4M A;  2X51 A;  3KE2 A;  4Q48 A;  3P9I A;  5TIS C;  2BYV E;  3DLA A;  2YPR A;  1LFP A;  5EGO B;  3VPR A;  1RR8 C;  2JA5 J;  1JGS A;  4BBR J;  2DFF A;  2DA7 A;  3RKW A;  1TWA J;  1Z9C A;  4PJ0 C;  2JK3 A;  1W7P A;  4G6T B;  5LGU A;  3V8K A;  2KDO A;  4ZZD A;  4F92 B;  2CG4 A;  2M45 A;  4M9Z A;  3SZT A;  3TL4 X;  2MC4 A;  2XPU A;  2CFO A;  3KP7 A;  2F4M B;  2XIG A;  1O57 A;  1ZR2 A;  1SAX A;  1HC8 A;  1S9H A;  2MD5 A;  3R60 A;  2IP2 A;  1BR4 A;  2B9S A;  1YS7 A;  4OWR B;  4QPQ A;  1TT5 B;  2XGC A;  1UMQ A;  1FSE A;  1FNN A;  2QKM B;  4ZDP A;  2FJ1 A;  3LSI A;  2LKP A;  2HOE A;  4PFO A;  1AA7 A;  5B1A H;  4BEH A;  4GYG A;  1V5F A;  3GFM A;  4IOC F;  5C44 J;  2QVO A;  1MNM C;  4BKX A;  1Z0X A;  3VWB A;  1P2F A;  1T2K A;  4M72 A;  3RPU D;  5CVU A;  5H6R A;  1ZEL A;  3C1D A;  4OU0 A;  3FXL A;  2MD0 A;  3OOP A;  3WE3 A;  4A3J J;  3HEF A;  4G9Y A;  4M9S A;  3JRF A;  2CQK A;  1A04 A;  1XPX A;  4XOP A;  4QWQ A;  2XF5 A;  5J1U A;  1W0U A;  1W5T A;  2O03 A;  4EGY A;  4XOR A;  4CH7 A;  4PJJ A;  3LSM A;  2L9S A;  2VLA A;  2KQR A;  3S8P A;  3L2V A;  1W5C C;  2GLO A;  4I2O A;  1RKW A;  3S3M A;  1YRN B;  4UVC A;  2CU7 A;  1FJL A;  2XSD C;  2XPW A;  4U7B A;  3HJE A;  3HPG A;  4A3K J;  1BW5 A;  1LDK B;  3K10 A;  1D1B A;  3ZPL A;  2DAO A;  1H89 C;  2OQG A;  2RQQ A;  3GLL A;  1R1V A;  2OV7 A;  4K2E A;  3BR6 A;  2NS7 A;  1BA5 A;  2AXT C;  4V2G A;  2X1D A;  1LKX A;  3J81 K;  1IDY A;  3DF8 A;  2R4G A;  2IBD A;  2COM A;  2LF7 A;  3GCM A;  4HV5 A;  5LD2 C;  1NK3 P;  1BIA A;  2FF4 A;  4CCO A;  1QHH D;  2R7T A;  2Q2E A;  3QYE A;  2EBI A;  3FK6 A;  2LKX A;  3VEP A;  2XB5 A;  3KEO A;  5ILU A;  3FDY A;  3SDG A;  3C2H A;  3IKT A;  2JN6 A;  3U1D A;  4ZJZ A;  3PM1 A;  1Y1V J;  3GF2 A;  2EFN A;  1TWC J;  2ADU A;  2LY2 A;  3KIO A;  4FX0 A;  4OIN F;  4AUX A;  4J00 A;  2FX0 A;  2CW8 A;  5CQE A;  4B3X A;  2DJN A;  1BBY A;  2DDB A;  3BCA A;  1JE8 A;  3EET A;  3JAM Z;  1ZAO A;  5IPA A;  3HSE A;  3FKI J;  3KPH A;  5K5O A;  3CMA I;  3BY6 A;  3ZQI A;  1CQT A;  5LLQ A;  1Z05 A;  3DLL F;  4A3D J;  2WV0 A;  3G1L A;  4PGG A;  5K7F A;  3NAU A;  4ASN A;  4FQG A;  4AU7 A;  2GWR A;  2EZL A;  2MH2 A;  3GFI A;  1P6R A;  2LF8 A;  5JLW A;  5LGT A;  4C3I J;  5J1Y A;  4QSH A;  1B8I A;  1A35 A;  1L0O C;  1SVL A;  4PFP A;  2L9R A;  1GXQ A;  2FSW A;  2LKS A;  3PNY A;  1GUU A;  4A6D A;  1V5E A;  3OYF A;  1G3W A;  3L1P A;  4IHV A;  3HOW J;  2VPL A;  1MMD A;  1BJZ A;  1EH7 A;  1G3S A;  2VT2 A;  4NQW B;  4AYB A;  1MBG A;  4ZYA A;  4KFC A;  2F4I A;  1F9N A;  2WC2 A;  2R7X A;  1U0J A;  1U2W A;  2R0Q C;  1IC8 A;  1QBJ A;  4XL9 A;  1B4A A;  2QUF A;  1IW7 F;  5GAH J;  3GTG J;  1JGG A;  3QWL A;  4II3 A;  5CVV A;  4L5E A;  5E20 A;  4DIQ A;  3K70 C;  1AU7 A;  1TZL A;  1TL8 A;  4Y15 A;  3WTS C;  1LEB A;  1CF7 B;  2BGC A;  2N8G A;  3OYD A;  3R61 A;  4J19 A;  4ZTF A;  2DK5 A;  3D0S A;  1LE8 A;  5FKM A;  1WWX A;  1XG1 A;  3DV8 A;  4M3F A;  3G1M A;  2CV1 A;  5KHD A;  2JSC A;  5BOX A;  1Y8Q B;  2ZNY A;  4ENN A;  2HZD A;  1YRN A;  1U8R A;  3ULQ B;  2QCO A;  2Z33 A;  2V26 A;  3ZP5 A;  2PI0 A;  2P0W A;  1ZRD A;  1MBK A;  1XSX A;  2E5Z A;  2Y9Y A;  1T56 A;  1QZY A;  3F6V A;  3UNG C;  4BJ6 C;  4IHW A;  2CV2 A;  1S29 A;  5L3C A;  5HOO A;  4GGG A;  2DMN A;  1T95 A;  1QZZ A;  1VQL I;  3BR1 A;  5HS7 A;  4MIM A;  2EFW A;  4HF2 A;  3OWT A;  4NNJ A;  4L5I A;  2VKH A;  3AL0 B;  1RI7 A;  3WHC A;  1Z67 A;  5ILV A;  3B6A A;  1SMT A;  1HKT A;  4BXU A;  3MWM A;  3P9C A;  2FML A;  3QPS A;  4MFD A;  4AVP A;  4DGW B;  3Q3S A;  4IX7 A;  2LD5 A;  4BXF A;  3WE2 A;  2LC2 A;  2ZJP F;  3SFI A;  4A3G J;  5D6F A;  3P9K A;  2W48 A;  3KLN A;  4CIC A;  1FP1 D;  1R4M B;  4F55 A;  1ZGA A;  2F5D A;  2P4W A;  3WTV C;  3DBH B;  3GO5 A;  1OMI A;  5KVR A;  5IT9 Z;  2Z99 A;  3U2R A;  1G6N A;  2NVQ J;  1NK2 P;  4MTD A;  2STW A;  3W6V A;  2KIS A;  3S17 J;  2HQR A;  4F91 B;  3JTG A;  4HX4 A;  3ZMZ A;  4U7D A;  3BG7 A;  2X0L A;  2J5O A;  3OYG A;  3U1K A;  1POG A;  2W7N A;  2CFX A;  3FHZ A;  2EA2 A;  4M9X A;  1QPM A;  5LRS A;  4RS8 A;  4UV9 A;  1FTT A;  2XAQ A;  2PJR B;  1GVD A;  2ZME A;  5FRN A;  1WFX A;  2Q1Z B;  5E1Z B;  2X1E A;  3CO6 C;  4I0B A;  3H92 A;  3M8E A;  1W5S A;  3RKX A;  5J6X A;  5EYR A;  3I56 I;  2RN7 A;  2GXB A;  3F8N A;  2HKO A;  4S05 A;  2AS5 F;  2OZU A;  2WAE A;  1B72 A;  3Q0V A;  4A93 J;  4PDK A;  1Z91 A;  3IAM 2;  4YEJ A;  2IS4 A;  2L01 A;  3OYH A;  2M7B A;  1W0T A;  2EIM H;  5EG0 B;  2E60 A;  1OCZ H;  2XAU A;  4LFU A;  4KA4 A;  2IXS A;  5E18 F;  1P9Q C;  1S8N A;  3F8M A;  3Q0U A;  1U6G A;  3PFI A;  2VKV A;  2Z1D A;  4A5M A;  4LOC A;  2H1L A;  4EJU A;  1JHH A;  4U0V A;  1J7K A;  1O3S A;  4DZP A;  5HS9 A;  3RQI A;  1X3Z B;  5K1Y A;  3OYA A;  1ZKG A;  3T5X A;  4M3D A;  1R5I D;  5IT9 K;  3J7A Y;  4U0Y A;  2ELJ A;  3JSP A;  4S0H B;  1D0X A;  1MH4 A;  1GT0 C;  1OR7 C;  3BPX A;  3L09 A;  5C4J J;  2UV1 A;  1S72 I;  2GXG A;  1G4D A;  3OYN A;  3GLX A;  5FKN A;  3WTX C;  3I0T A;  3WTU C;  3TMO A;  2IS2 A;  3FX3 A;  5DM7 F;  2QQA A;  4E70 A;  3TO6 A;  1ENH A;  3ZMV A;  4IJA A;  3JRH A;  1TTY A;  2JA8 J;  1BW6 A;  2PFB A;  2DMT A;  4ZYE A;  1NG6 A;  2VXZ A;  3TED A;  2XGE A;  3IRQ A;  1HOM A;  3KX2 A;  1ON1 A;  5FKO A;  2XRN A;  3U9G A;  3HSR A;  1BI3 A;  3B73 A;  1FTZ A;  3COA C;  4D5F A;  2H8W A;  1QPI A;  3DU5 A;  1FOK A;  5TGT A;  1P4X A;  4ENK A;  3V42 A;  1A31 A;  3F9K A;  2B0L A;  2DA3 A;  2E35 A;  3T1B A;  5J8C A;  2NXN B;  3AFH A;  4RM2 A;  2NAZ A;  3LQQ A;  2GOX B;  4XLH A;  1QZE A;  1SD5 A;  5H20 A;  3C3W A;  1XB4 A;  2JPB A;  2VBZ A;  3CC4 I;  4BEH B;  4A12 A;  1A36 A;  4MEY F;  4BUP A;  1SVM A;  1UHS A;  4NB5 A;  1FX7 A;  3JRB A;  3OR2 C;  5D8L B;  3RTR A;  2WAQ N;  5IOY A;  4FHT A;  2FU4 A;  2EIK H;  1NG7 A;  3KCC A;  3I58 A;  1D8J A;  2CGP A;  4UUV A;  4I98 B;  4UUS B;  3F3X A;  5FLM J;  3AG1 H;  1MJB A;  3CP8 A;  2PX9 A;  3OV8 A;  4LJZ F;  1X2N A;  1LVA A;  3C2G A;  3L9F A;  2JUG A;  1E2X A;  1RZ4 A;  3HRT A;  4LB6 B;  3H9G A;  4ENJ A;  3PO2 J;  1WZ2 A;  2HS5 A;  2OCE A;  3OS0 A;  1FLI A;  2KIM A;  2RNG A;  4OIR F;  1IXC A;  3K4L A;  1KYZ A;  1U9N A;  3HZJ A;  1T33 A;  5EG0 A;  2I8D A;  1RUN A;  2Z2S B;  5LEJ A;  3CC7 I;  1Z77 A;  3H3V K;  1FC3 A;  4DZJ A;  5EDN A;  4DBQ A;  1AOY A;  3GME A;  2IEK A;  4RA2 A;  5FJ8 J;  2MW8 A;  3S3N A;  3QP6 A;  1T39 A;  4EGZ A;  3FXU A;  4G7Z F;  3CJQ B;  5BPD A;  1UHM A;  4D0P A;  3PO3 J;  5EEG A;  3OS2 A;  2L5Q A;  1UCR A;  2Q2E B;  4ON0 A;  1OJL A;  1PUF B;  3OIQ A;  3I53 A;  4Y7N J;  3DWL E;  3SEZ A;  2CS3 A;  4OAY A;  2IPQ X;  2IA1 A;  2DTR A;  2GQQ A;  3OYK A;  3HOU J;  2EWN A;  2K9L A;  4L18 B;  1IGN A;  2DYS H;  2DA2 A;  4Z2Y A;  4Y17 A;  4E6K G;  5B66 C;  3V7R A;  2EPF A;  2L3D A;  1TWH J;  2LMD A;  1Y1W J;  5LBQ A;  5IYB J;  2DQR A;  1WH7 A;  3VYR B;  5D8K B;  2Q8K A;  2CQX A;  1WJ5 A;  2JA6 J;  2CUF A;  4I01 A;  5CJ9 A;  2K3F A;  1BOA A;  1J5Y A;  1I5Z A;  2CJJ A;  2CWE A;  4CO8 A;  5HNH A;  2GM4 A;  2QSF X;  4C30 A;  5K7H A;  2HOS A;  4MNU A;  2Y0M A;  2P5L C;  3IH3 A;  3EUH C;  4RGU A;  2Z9O A;  2E1M C;  3HG9 A;  4XQF A;  2XGD A;  1HW2 A;  3K9T A;  2EV6 A;  4B3A A;  1DQU A;  4DYQ A;  3DEU A;  2PQ8 A;  3B6C A;  3ECO A;  5IOZ A;  3ASO H;  3HSF A;  3IUO A;  3K1N A;  1UZC A;  1VF9 A;  4EJT A;  5KCM A;  2XSJ C;  4ZDL A;  2DT5 A;  2R7S A;  4WK8 F;  4LK0 F;  4N9H A;  2BXY A;  3CUQ A;  3R0J A;  1IN4 A;  3WGI A;  3K4K A;  4DNC A;  4BS9 A;  3ESW B;  2D1H A;  5KK1 A;  1UG2 A;  2ZJ2 A;  3HGG A;  3OOU A;  4I02 A;  2E2H J;  2HOA A;  5EJC A;  5LEK A;  5FD6 A;  2BW3 B;  2QM3 A;  3X2Q H;  1JJ8 C;  3S16 J;  2TDX A;  3EQL F;  3ZQF A;  5E3O A;  2DYR H;  1ETW A;  1XGO A;  3SQN A;  5GTH C;  5EZG A;  3HDD A;  2ZJQ F;  2FD5 A;  3HYI A;  4M3G A;  2WAD A;  4B1R A;  5IP7 J;  1FZP B;  2VBX A;  2X1C A;  4C3J J;  1N77 A;  5D5X B;  3RJP A;  1XSD A;  2EIN H;  4U0W A;  1JKP C;  1SFX A;  2LDU A;  1RIO H;  1MZB A;  3IRR A;  3D1N I;  2BHY A;  3K4C A;  4B8X A;  3IH4 A;  4GYI A;  2HDD A;  2OD5 A;  1WJB A;  3E3V A;  3CUQ B;  3CLQ A;  4M6V A;  3T8R A;  4KIC A;  1YQA A;  3JCU C;  3E6D A;  1I6X A;  2KJC A;  3TOB A;  5CVJ A;  3MD2 A;  3ZQH A;  1SD4 A;  2R7W A;  1K4T A;  3K0L A;  3E1S A;  2QYO A;  4CYD A;  1QHG A;  4FET A;  4C2U A;  3CQZ J;  5L3B A;  3DTI A;  2ZXH A;  3A0B C;  3TGN A;  3HUG A;  2R93 J;  2VC0 A;  5HDN A;  2CUZ A;  2QEX I;  2HXO A;  1LEA A;  2OZ6 A;  4XSZ F;  5FLX Z;  2NS8 A;  4BHP A;  3BPV A;  1ZLJ A;  5LHG A;  4NBQ A;  2QGU A;  2LBF A;  5EF6 A;  2L7M P;  1Z7L A;  5L3F A;  4LIU A;  3DBL B;  3OYI A;  2ELH A;  4BHB A;  3LA7 A;  3BOQ A;  4ZYH A;  3S93 A;  3ABL H;  2M87 A;  2NS0 A;  1WPK A;  2QBY B;  3RKY A;  3WTY C;  3CMY A;  2F6C A;  3BG3 A;  1ZHF A;  3P7N A;  3TO9 A;  4DW6 A;  2DA5 A;  5FFX A;  3AAF A;  1BI1 A;  1U78 A;  4KIT B;  2G7H A;  2OA4 A;  4XR6 A;  5J47 A;  3DTK A;  3J81 Z;  1GV2 A;  2FEZ A;  3HM5 A;  4G8X A;  2W57 A;  2OC6 A;  5GPC A;  4KIB A;  3OL3 A;  5DUI A;  2CW7 A;  1IXS B;  2BY0 A;  3FIW A;  3SYT A;  4NUB A;  1ETV A;  2ZME C;  3BT9 A;  4LMY A;  1X1D A;  2K86 A;  1GXP A;  1U8B A;  2W24 A;  4UUS A;  1LVK A;  2FBI A;  3A02 A;  1H0M A;  4N4O B;  4G12 A;  3M7G A;  3F22 A;  5KAI C;  4BY7 J;  2DFE A;  1EV7 A;  3FKJ A;  3GFJ A;  3K1M A;  1P7J A;  3FXR A;  1R23 A;  3DQV C;  1FOW A;  1NTC A;  2ISY A;  5E79 C;  1IV6 A;  3WG7 H;  2LK2 A;  1LFB A;  3WU0 A;  4G6D A;  4IRG A;  2L7Z A;  1T6S A;  2GA2 A;  4KNY A;  4HAM A;  4RGR A;  2X6O A;  3TW6 A;  3V4G A;  1Y56 A;  3FWE A;  2L02 A;  5J4V A;  1V4R A;  2TRT A;  1UEL B;  2W82 A;  1ZAR A;  4KN7 X;  3RIR A;  2E1M B;  1LNW A;  2I10 A;  2KRF A;  3PJR A;  1X4O A;  5M5Y J;  2E1O A;  3GTO J;  3ZR8 X;  1UB9 A;  1X2M A;  2HVR A;  3CC2 I;  2IA2 A;  4O5V A;  1XSV A;  1OYY A;  3KP3 A;  4HF0 A;  3PIO F;  1WH5 A;  3RPQ A;  4L9V A;  5FFZ A;  1TT0 A;  1WJF A;  3G3Z A;  2Y31 A;  4H4K C;  1MD0 A;  3F0C A;  3Q0W A;  2ACJ A;  3SEQ A;  5DUK A;  2Y0S A;  4HNU A;  1SAU A;  2CSO A;  3QYF A;  2OUM A;  3E6C C;  4Z6Y A;  1GLN A;  2HVQ A;  3CDL A;  4XRM A;  3ZQG A;  3A4C A;  4RM3 A;  4JK1 X;  5E8G A;  5HVQ C;  3IKV A;  2FNP A;  3FZV A;  5EGO A;  5F04 A;  1SD6 A;  3OYC A;  3O8G A;  2KKO A;  4V2F A;  3E6B A;  2M0C A;  2H6C A;  2F5V A;  2M8E A;  4PJN A;  3RYP A;  1QO0 D;  1FSH A;  3DEW A;  2NVY J;  2PMU A;  3O8H A;  2EQR A;  2X9D A;  4HX8 A;  2M2E A;  3TP3 A;  4KIS A;  1FMV A;  3KZI C;  2ZC2 A;  2M34 A;  2V6C A;  1KU9 A;  1HDD C;  1ZR4 A;  1XDS A;  2BW3 A;  2HQA A;  3HOT A;  3KP4 A;  3G4S I;  2XKO A;  3HOY J;  2K02 A;  1ZN2 A;  1S7E A;  2ELK A;  3N4M A;  3H5N A;  3LSG A;  2IVM A;  4B4C A;  1V55 H;  3WU2 C;  2ZCW A;  5B5E C;  3LMM A;  3HTU A;  2NOJ B;  2A6E F;  4M73 A;  4KMU X;  2J5P A;  2HPI A;  4CZC A;  2WTE A;  1F36 A;  2O8X A;  4BQN A;  3FXJ A;  1Z21 A;  4AIH A;  4O3M A;  4OIP F;  2M30 A;  2XC7 A;  4V19 K;  2WB1 N;  2RAE A;  1X1C A;  2ESH A;  2OAZ A;  5LGN A;  2CV0 A;  5GPA A;  2WB1 A;  2JPC A;  4BAC A;  2BHZ A;  4XLF A;  1TNT A;  5HNF A;  1SMY F;  3RSN A;  5F0H A;  5J3L A;  3TQN A;  4QIW N;  3GEZ A;  2M5W A;  4LLL A;  1VQP I;  3NWS A;  1XMA A;  4Q47 A;  4B48 A;  1WJC A;  3ZGK A;  3N05 A;  2FMY A;  3K2Z A;  2V1U A;  2VOO A;  3NRV A;  2DCE A;  2X6X A;  3CUQ C;  1EH8 A;  3SFZ A;  3CDI A;  1HDP A;  2F4O B;  2YUS A;  5FGM A;  2BY2 A;  2K27 A;  5DV5 A;  4BL0 B;  3TW7 A;  1JTY A;  2VQC A;  1UST A;  2HQ5 A;  1V5G A;  3FM5 A;  4X0G A;  1PP7 U;  1IAW A;  2ID6 A;  3CCE I;  4C3H J;  5CVR A;  2VOP A;  3DKW A;  2V1N A;  2W25 A;  1XMX A;  3ELK A;  1I6H J;  1PJR A;  1TLH B;  1Y0N A;  3EDP A;  3HPH A;  4IHS A;  1O7L A;  3H9J A;  3G73 A;  1BC8 C;  4BAY A;  3HRS A;  2EZK A;  1JT0 A;  1FEX A;  1MGT A;  2HYJ A;  3A1Y A;  3LSJ A;  3QOD A;  2MYS A;  1T98 A;  2GZW A;  3ZN0 A;  1BI0 A;  1TP4 A;  2BOL A;  3JRI A;  2EV0 A;  3S15 J;  3K69 A;  1NH3 A;  1MDM B;  3KFW X;  5JI6 A;  3TO7 A;  2E19 A;  4ITV A;  4E7J A;  2H94 A;  5JLX A;  3KYD B;  3HRU A;  1ZLK A;  3PNT A;  2HOT A;  3MZH A;  3PQK A;  2IW5 A;  3CUO A;  4M3B A;  3REO A;  1XGS A;  3BR0 A;  3LWF A;  1MND A;  4XLA A;  2G9W A;  3E5U A;  4QPO A;  1R49 A;  2O8K A;  1Y8R B;  2UWM A;  3TBI A;  2LLK A;  4DQ2 A;  5JVG F;  1FOY A;  4OOI A;  3A0H C;  3BTJ A;  3DEE A;  1LFU P;  2FA5 A;  2R5Z B;  4MLO A;  1D3Y A;  1LDJ A;  1YIO A;  4EAT A;  4JX4 A;  3K1P A;  1O4X A;  2P7C B;  1FYM A;  1RRJ A;  4AWX B;  3AL0 C;  3RPU A;  1S7O A;  4LG0 B;  2IGM A;  1ITY A;  1XDU A;  2R7O A;  2EV5 A;  1R36 A;  3PIP F;  1YYV A;  1ERD A;  4DYC A;  3S2H J;  3L00 A;  2R5Y B;  1OQY A;  3LQR A;  3RZD J;  2QSG X;  1B6A A;  1PYV A;  2R92 J;  2A5Y B;  1VZ0 A;  4HA8 A;  4WX9 A;  3PFY A;  1KYW A;  3I4N J;  1TNS A;  1HQC A;  3I5U A;  3F21 A;  1QVU A;  3DTE A;  5FLV A;  1LE8 B;  1KON A;  2WY7 Q;  3ML6 A;  2DOE A;  4IO9 F;  3BR3 A;  5DDG A;  1TC3 C;  2V6E A;  2E5N A;  4BXX J;  3O3K A;  4LLN A;  4BQO A;  3LA3 A;  3V7S A;  1WGX A;  1DP3 A;  3DCF A;  3QPL A;  6PAX A;  4IHY A;  3DFG A;  3QYB A;  2PEX A;  1YW7 A;  3FK7 A;  5E1X A;  2ZO4 A;  5CPR B;  3FXO A;  1ETO A;  1FBQ A;  1QA6 A;  3HKZ A;  4ESB A;  4Y3O A;  3KP5 A;  3GTM J;  3W2V A;  3BQY A;  1AKH B;  1FBU A;  3GZ5 A;  9ANT A;  2CUJ A;  3ABM H;  3W3C A;  5JHF A;  4L0Z B;  2A07 F;  5HLH A;  4NC8 A;  4MTE A;  3LSK A;  5CKT A;  2B63 J;  2JJ7 A;  4A0Z A;  3OYM A;  4HST A;  2IJL A;  2V79 A;  3QQA A;  4KUM A;  2E36 A;  1W7P D;  2DMU A;  4O6J A;  2IS6 A;  2LNB A;  2DT6 A;  2HU9 A;  3NWT A;  2O61 A;  4IL6 C;  2HQN A;  1EKE A;  1MNE A;  3OSF A;  2D1V A;  3JRC A;  3GBG A;  3MZ8 A;  3GYH X;  2HKX A;  2STT A;  4LGW A;  3AG4 H;  5GAG J;  4A0X A;  1T38 A;  4YIF A;  4XK4 A;  2V1X A;  1QGP A;  3IWF A;  2VBW A;  2L54 A;  4CCJ A;  2XRL A;  2EZH A;  1WCM J;  3TOA A;  1J75 A;  1YJ9 I;  1JI8 A;  2PMH A;  4XOT A;  2R7Z J;  3AKZ A;  1I1G A;  3ZMD A;  1OKR A;  2D2W A;  3D5L A;  2NYX A;  1VND A;  3KEY A;  3IWZ A;  4KJZ A;  5J4Y A;  2VQH A;  1MMG A;  4BDZ A;  3F8F A;  1O3T A;  3J7Z I;  5LHH A;  3NAR A;  2M8G X;  2JSP A;  2XDV A;  4HYE A;  2V4J C;  1JKO C;  4HX7 A;  2RKH A;  1PVE A;  4IHX A;  2Z5U A;  1R1T A;  2L7F P;  2DA6 A;  3GFL A;  3CDH A;  1GVJ A;  5HDG A;  5GP9 A;  1T0F C;  5KAF C;  2K9S A;  3KP2 A;  1X1B A;  3GTQ J;  1WJE A;  4II2 A;  1S5L C;  3PL8 A;  4M6Y A;  4ZYG A;  3MKY B;  1GDT A;  4NHJ A;  3K4J A;  2K3P A;  4WXH A;  2HVS A;  2P7V B;  1MJA A;  3KYL A;  3SJM A;  5HDK A;  4BJT A;  1W36 D;  2ZKZ A;  3F6O A;  2VIX A;  5HLI A;  4KYW A;  1K4S A;  1ETQ A;  1ONV A;  2DXI A;  2VL8 A;  5CVI A;  3CF2 A;  1G59 A;  3HRM A;  4EEF G;  1DDN A;  4A3I J;  4HDU A;  3FMR A;  1I3Q J;  1R7J A;  2BV6 A;  3M8J A;  4LG3 A;  2OQR A;  4YII A;  3HKZ N;  3BR2 A;  3ZQC A;  2EA4 A;  4YIR X;  3CCQ I;  3IL2 A;  2YS9 A;  5DTD A;  4AD9 A;  4OIO F;  1XD7 A;  2W1O A;  4DJA A;  2ECC A;  2RGV A;  5DS9 A;  3B02 A;  2UUZ A;  4N4N B;  3JAM K;  1IZ1 A;  2EB7 A;  4GXO A;  3ONQ A;  2VE9 A;  2WA0 A;  3BCB A;  3FXM A;  1C0W A;  1ZYR F;  3OIP A;  1X3U A;  2BEO A;  1OYW A;  3OY9 A;  1R4N B;  4J01 A;  3ABU A;  2P6T A;  3A01 A;  3QP5 A;  1ZG3 A;  5FKL A;  4CCM A;  1SFE A;  4M71 A;  4XLC A;  5J1R A;  1ZQ3 P;  1D0Y A;  3GTK J;  3KLO A;  1APL C;  1YFH A;  2A5W A;  5ILS A;  2D5V A;  2X6W A;  4JYK A;  3SXY A;  3O6B B;  5F1R A;  2H8R A;  1A6Q A;  1UAA A;  3EYY A;  4IF4 A;  2PLY A;  4GCV A;  4RB0 A;  2K9N A;  4IXA A;  1XN7 A;  3FM3 A;  5E3M A;  4JX6 A;  1O7F A;  2DDA A;  3R4K A;  1QRY A;  2BXZ A;  3RKQ A;  1KU7 A;  4U87 A;  2ISZ A;  1IRF A;  2JZY A;  2CUE A;  2R7Q A;  3GX4 X;  4YFK F;  3H0G J;  4FT8 A;  1FT9 A;  2HDC A;  1SFU A;  1S6L A;  1REP C;  2W4S A;  3DBR B;  2KDZ A;  4ESJ A;  5FD5 A;  3HHG A;  4LIV A;  4ANJ A;  4H0E A;  4S04 A;  3AG2 H;  2HTS A;  2XPV A;  3GTJ J;  2F48 A;  2EK5 A;  3WOD F;  3VSL A;  4RLF A;  3JRD A;  2JRM A;  4LG0 A;  1U9O A;  1RR7 A;  2BE5 F;  4EVI A;  3CF5 F;  1XGN A;  4F3Q A;  1WHU A;  2K85 A;  3WU1 B;  1XGM A;  1VFC A;  2VJJ A;  2VOD A;  4OMY A;  2KIF A;  1XCV A;  1XX5 A;  3CCM I;  1U3E M;  1VQ7 I;  1AKH A;  4XRS G;  4E4H A;  1I50 J;  2Q0O A;  3MVP A;  3BDD A;  4XM3 A;  2CH0 A;  3CTA A;  3M4O J;  2P6S A;  1JTX A;  2DFI A;  3K4N A;  2IAI A;  4MO7 A;  4AVZ A;  5E8I A;  3MEX A;  2MSY A;  2JVH A;  1MMN A;  2WY8 Q;  1BJA A;  3MFK A;  3E6M A;  4G7H F;  4IRH A;  4Y4R A;  1YIT I;  2RRE A;  2CO5 A;  1JUS A;  1MKM A;  2FBK A;  5FO5 A;  2LTP A;  4BE1 A;  4HZF A;  2CYY A;  4A69 C;  2DOD A;  2VKE A;  1MDM A;  5L3E A;  1I1S A;  3QOE A;  3KP6 A;  2NNN A;  3W2W A;  2ID3 A;  2GA1 A;  2XAF A;  1YJN I;  1WI9 A;  4Y33 A;  2EFQ A;  1MSF C;  5TJJ A;  4CA0 A;  5DCF A;  2PJR A;  1HKQ A;  1FPQ A;  3ZMU A;  2P81 A;  4CCK A;  1G3T A;  4CGZ A;  2EIJ H;  2KHM A;  2L7K A;  2DK8 A;  1R22 A;  2O0Y A;  2DOF A;  2C6Y A;  1KA8 A;  4IPA A;  3J7Y J;  2VJ5 A;  3M9A A;  1WSU A;  1KU2 A;  1ETY A;  1YS6 A;  4KT6 A;  4LB5 A;  2LR8 A;  2OJE D;  4U88 A;  1WI3 A;  1G3Y A;  3VYT B;  2JUC A;  4YRV A;  3BLY A;  2UXX A;  1KZH A;  2X4H A;  4XID A;  2LP0 A;  5L3D A;  4UUT A;  2VKD A;  1PUE E;  1J09 A;  1ZK8 A;  4N0B A;  1OYI A;  2VN2 A;  3H5A A;  2CQ7 A;  4E7Z A;  3E5Q A;  2XAH A;  5C3E J;  3F72 A;  1EH6 A;  3DP7 A;  2H27 A;  4RGX A;  3QU3 A;  1YJW I;  5GTI C;  4RB3 C;  3RYR A;  1N25 A;  1WVR A;  1KQ8 A;  3SDB A;  3QPH A;  4HPQ A;  3S32 A;  2PMZ N;  2ETH A;  1YIJ I;  4NC6 A;  2LRE A;  5FLX K;  3CCY A;  4EM2 A;  2DI3 A;  1BC7 C;  4CYC B;  2RNJ A;  4DBR A;  3A01 B;  5M3F J;  2FNA A;  3BTC A;  5JR3 A;  3LAP A;  3HBL A;  1MIJ A;  2LY1 A;  2E2I J;  2DBB A;  4WWC A;  1WJD A;  3CJN A;  4KDP A;  4A3L J;  5JVT A; 
#chains in the Genus database with same CATH homology
 4UXN A;  2HR3 A;  1Z6T A;  5AIP A;  3C18 A;  1HST A;  1U5T A;  4WXD A;  2XV4 S;  2WWY A;  3GZ6 A;  4ZZL A;  4UVA A;  2A69 F;  2DPU A;  2IA0 A;  4JBA A;  2F2E A;  3BP8 A;  3EUH A;  1HW5 A;  1WKM A;  5ICE A;  1SD7 A;  4EM0 B;  3V8J A;  2DLL A;  4Q5S F;  2P5V A;  3W6K B;  2AXL A;  2UZK A;  2QQB A;  4LD5 A;  1WRJ A;  1F4K A;  4HW0 A;  2XAG A;  2QQ9 A;  3GUD A;  2W84 A;  5ED4 A;  1B1B A;  1ODD A;  1W7P B;  2XRO A;  3NEU A;  3BWG A;  2RC4 A;  3DPL C;  3WGH A;  4QLC U;  4UV8 A;  3R6S A;  4UVB A;  1K78 B;  2VC1 A;  4G7O F;  2F5E A;  1FP2 A;  3QRF F;  3MAJ A;  2MH9 A;  3M8F A;  2RV8 A;  2E7W A;  2VT3 A;  5J8F A;  4YFX F;  2G7U A;  4L9T A;  4MGR A;  2D45 A;  1PP8 F;  5FB2 A;  3J80 Z;  3ZMS A;  5BS6 A;  5ICF A;  2DO7 A;  3Q5F A;  2QBY A;  4ETS A;  4GO1 A;  1B9M A;  4LK1 F;  5DCM A;  2E1N A;  3TKY A;  3I64 A;  5A2Q K;  3IC7 A;  4BYY A;  1STZ A;  2F5F A;  3GXO A;  1R58 A;  1S7A A;  1KU3 A;  3Q9S A;  4BQA A;  4RB2 C;  3GVA A;  4M74 A;  1WQ2 A;  2VBY A;  2HTJ A;  5E17 F;  3RI4 A;  3BRO A;  4LLG F;  4P55 A;  2O3F A;  2BBY A;  3C7J A;  3FXQ A;  2ZME B;  5ICC A;  2A3S A;  2R3S A;  2DU9 A;  4MEX F;  1PDN C;  1YTY A;  4R8H A;  2F5C A;  4FX4 A;  4YG2 F;  3BZ6 A;  4RGS A;  5CLS A;  4P9U A;  1J9I A;  1RUO A;  2W85 A;  2O6G E;  5D4S A;  5E1W A;  1FBS A;  3ABT A;  1KQ9 A;  5A2Q Z;  2RVC A;  3DXJ F;  4B09 A;  1HW1 A;  2OBP A;  3H3Z A;  4CZZ A;  1D5V A;  2R7D A;  2QLZ A;  4L9N A;  2HZT A;  1TQP A;  1TQI A;  4G94 A;  3JW4 A;  3M1E A;  3BJA A;  1F1Z A;  4HQM A;  4PCQ A;  1FYL A;  2QEN A;  4EJV A;  2OU2 A;  5F6F A;  1YG2 A;  1R1U A;  4NQW A;  2HYG D;  4R1H A;  3ZMT A;  5EEH A;  1AWC A;  4XSX F;  4EM1 A;  5DYM A;  1L3L A;  2QWW A;  4WCG A;  2YX7 A;  1LQ1 A;  5HLG A;  3E97 A;  2VE8 A;  2ZNZ A;  2DPD A;  4I7H A;  2IRF G;  3BJO A;  1B59 A;  5AIQ A;  2IT0 A;  2RQP A;  3R0A A;  3ROU A;  3MQ0 A;  5F64 A;  3HHH A;  1IUY A;  2GIV A;  4ZYD A;  1I27 A;  3HIF A;  2V1D A;  4MHG A;  2XVC A;  4YFN F;  4R79 A;  1K78 A;  4EJW A;  1XMK A;  1QNT A;  2DQL A;  5LHI A;  1ZGJ A;  3L7W A;  1OR7 A;  4KN4 X;  2FBH A;  4F7Z A;  5D5V B;  2Y48 A;  4CHU A;  2YR2 A;  2NNY A;  1U5T B;  3H3U A;  2Y75 A;  3F23 A;  4XRF A;  4MQV A;  1R00 A;  2KIU A;  1IN7 A;  2YX4 A;  1VTN C;  1USS A;  1S3J A;  4N9I A;  2FE3 A;  1H9G A;  2A68 F;  2XAS A;  2UXN A;  5BPI A;  1DPR A;  2L4A A;  3FMQ A;  3FF5 A;  5CYV A;  4PZJ A;  5LRR A;  3QPT A;  5IT3 A;  2ESN A;  1F5T A;  4KMF A;  3W6J B;  3F8C A;  2YU3 A;  1DP7 P;  5HS8 A;  1HBX G;  3I59 A;  1HKS A;  4A0Y A;  3KEQ A;  1IN8 A;  4IHT A;  5AON A;  3J7A O;  4HOB A;  3SZP A;  2R7F A;  2A6H F;  1ULY A;  3VOD A;  1TW2 A;  1U5T C;  5ICG A;  1ZG1 A;  4HBL A;  4EQQ A;  1LDD A;  4I09 A;  3KZZ A;  1K79 A;  1DUX C;  2MLK A;  4L5J A;  4ENM A;  2L4M A;  1YLF A;  3WG9 A;  2PBI A;  2RDP A;  2H09 A;  2JTV A;  2MA3 A;  1RNL A;  1IF1 A;  4BH9 A;  3MZY A;  2V9V A;  4OMZ A;  1LJ9 A;  2K7L A;  5D5W B;  3LST A;  3BJ6 A;  1P4A A;  1XCB A;  2EFO A;  2VON A;  2FQ3 A;  3WTW C;  3TDZ C;  3I4P A;  4HQE A;  3HTS B;  5L3G A;  4HLY A;  1IN6 A;  3I54 A;  4UHT A;  4A5N A;  1P4W A;  3KZY A;  3DPT A;  3EYI A;  3KET A;  4RB1 A;  1O3R A;  1YW8 A;  3HOS A;  3Q9V A;  3GW2 A;  5ERI A;  4JQF A;  5K5R A;  4A6E A;  4EMS A;  2P5K A;  3PQJ A;  1K7A A;  3I71 A;  3S2W A;  1D8K A;  2CW0 F;  3ECH A;  2HFH A;  1CGP A;  4UNO A;  1UHW A;  1V3F A;  2E7X A;  4ZH4 F;  3CO7 C;  3LA2 A;  4P9F A;  4BHC A;  2GAU A;  3LAJ A;  1H9T A;  1ZRE A;  1MJ9 A;  2MC3 A;  4WXC A;  2JT1 A;  1DPU A;  4RAZ A;  3CLO A;  1IXR C;  3T8T A;  1OPC A;  4HDV A;  4BNC A;  2MBF A;  3ZQ7 A;  2QZ8 A;  3WGG A;  4XLN F;  1UFM A;  4MQ9 F;  1FWZ A;  1FY7 A;  5DD8 A;  5BMZ A;  4M6X A;  2FOK A;  1R5G A;  1ZRC A;  3WTT C;  1NHA A;  5TRD A;  3NQO A;  1FYK A;  1K6O A;  1QQI A;  1R5H A;  2EJR A;  2ZFW A;  1YW9 A;  3IHU A;  4L0Y B;  1Y0U A;  2ZXJ A;  1B9N A;  2NRA C;  5DEQ A;  3RDI A;  3E5X A;  4G6Q A;  4WF2 A;  1HSJ A;  4XBF A;  3JSO A;  4HLX A;  3N97 A;  1CF7 A;  3TDU C;  1GHC A;  2PN6 A;  1Z6R A;  2XHK A;  3V7C A;  5D5U B;  4P5O A;  3V8L A;  3WTZ A;  2XUB A;  2XKP A;  2HYF A;  2JRT A;  5D4R A;  2EFP A;  2XGX A;  4PGH A;  3I59 B;  4KIF A;  2P8T A;  1ON2 A;  1J0R A;  3QAH A;  5DCM B;  2HEO A;  5H6Q A;  1T0F A;  1ZRF A;  3QU6 A;  2HWV A;  1JHF A;  4A2U A;  4KIG A;  3VOE A;  2K4B A;  4EJO A;  3ZN1 A;  5D6E A;  2PJP A;  3SHF A;  4IRI A;  2FXA A;  2LSO A;  4HV6 A;  4ESF A;  3VB2 A;  4XLP F;  5JHU A;  4L9J A;  2DW4 A;  1YO5 C;  2ZBK A;  2PG4 A;  3MCZ A;  1TBX A;  3QOP A;  2E1C A;  2H6B A;  4HF1 A;  1Z1D A;  1KGS A;  4P96 A;  5BQT A;  4I0A A;  1P92 A;  4CDG A;  4TV7 A;  5DD4 A;  4Y13 A;  1J59 A;  5JFR A;  3FMS A;  3VFZ A;  4RAY A;  3F8B A;  1JXS A;  1IRG A;  2XAJ A;  3GWZ A;  1ZH5 A;  4KT5 C;  2YSR A;  1Q1H A;  1BIB A;  4AIJ A;  1E17 A;  1KQ0 A;  2KJB A;  3LFK A;  1O3Q A;  3ISP A;  4IVN A;  1TQM A;  1HXD A;  3L2C A;  2M1B A;  3JTH A;  4EV0 A;  4OIQ F;  1BM9 A;  1BN5 A;  1BI2 A;  1IN5 A;  2Z3Y A;  2HGC A;  5K5Q A;  4AIK A;  1ZG5 A;  1TW3 A;  2A61 A;  3J80 K;  2K4J A;  3O2P E;  3ERE D;  1J2X A;  1Z7U A;  2MLG A;  3T0Y A;  4CXF A;  4Q4Z F;  2FRH A;  1W4M A;  3KE2 A;  4Q48 A;  3P9I A;  2BYV E;  2YPR A;  1JGS A;  3RKW A;  1Z9C A;  1W7P A;  5LGU A;  3V8K A;  4ZZD A;  2CG4 A;  2M45 A;  4M9Z A;  3SZT A;  3KP7 A;  2XIG A;  1O57 A;  1SAX A;  2MD5 A;  3R60 A;  2IP2 A;  1YS7 A;  1FSE A;  1FNN A;  2LKP A;  2HOE A;  4GYG A;  3GFM A;  2QVO A;  1P2F A;  1T2K A;  4M72 A;  5CVU A;  5H6R A;  3C1D A;  4OU0 A;  3OOP A;  3WE3 A;  4G9Y A;  4M9S A;  2CQK A;  1A04 A;  4QWQ A;  1W5T A;  2O03 A;  4EGY A;  4I2O A;  4UVC A;  4U7B A;  1LDK B;  3ZPL A;  2DAO A;  2OQG A;  1R1V A;  4K2E A;  3J81 K;  3DF8 A;  2LF7 A;  2COM A;  4HV5 A;  1BIA A;  2FF4 A;  2Q2E A;  3VEP A;  3KEO A;  5ILU A;  3IKT A;  3U1D A;  3GF2 A;  2EFN A;  2ADU A;  4FX0 A;  4OIN F;  1BBY A;  1JE8 A;  3EET A;  3JAM Z;  1ZAO A;  3HSE A;  5K5O A;  3BY6 A;  5LLQ A;  1Z05 A;  2WV0 A;  4PGG A;  4ASN A;  2GWR A;  2MH2 A;  3GFI A;  1P6R A;  2LF8 A;  5LGT A;  1L0O C;  1GXQ A;  2FSW A;  4A6D A;  1G3W A;  1EH7 A;  1G3S A;  2VT2 A;  4KFC A;  1F9N A;  2WC2 A;  1U2W A;  1QBJ A;  1B4A A;  2QUF A;  1IW7 F;  5CVV A;  5E20 A;  4Y15 A;  3WTS C;  1LEB A;  1CF7 B;  2BGC A;  3R61 A;  2DK5 A;  3D0S A;  1WWX A;  3DV8 A;  2JSC A;  5BOX A;  2ZNY A;  4ENN A;  1U8R A;  3ULQ B;  2Z33 A;  3ZP5 A;  2PI0 A;  1ZRD A;  1XSX A;  3F6V A;  1QZY A;  1S29 A;  5L3C A;  5HOO A;  4GGG A;  1QZZ A;  5HS7 A;  2EFW A;  4HF2 A;  4L5I A;  1RI7 A;  5ILV A;  1HKT A;  1SMT A;  4BXU A;  3MWM A;  3P9C A;  2FML A;  4AVP A;  3WE2 A;  5D6F A;  3P9K A;  3KLN A;  4CIC A;  1FP1 D;  1ZGA A;  2F5D A;  2P4W A;  3WTV C;  3GO5 A;  1OMI A;  5KVR A;  5IT9 Z;  2Z99 A;  3U2R A;  1G6N A;  4MTD A;  2STW A;  2HQR A;  3JTG A;  4HX4 A;  3ZMZ A;  4U7D A;  2X0L A;  2J5O A;  2CFX A;  3FHZ A;  2EA2 A;  4M9X A;  1QPM A;  5LRS A;  4RS8 A;  4UV9 A;  2XAQ A;  2ZME A;  5E1Z B;  3CO6 C;  4I0B A;  3H92 A;  3M8E A;  1W5S A;  3RKX A;  5J6X A;  2GXB A;  2RN7 A;  3F8N A;  2HKO A;  4S05 A;  2AS5 F;  2OZU A;  4PDK A;  1Z91 A;  2L01 A;  4LFU A;  4KA4 A;  5E18 F;  1S8N A;  3F8M A;  1U6G A;  3PFI A;  4A5M A;  4EJU A;  1JHH A;  4U0V A;  1J7K A;  1O3S A;  5HS9 A;  5K1Y A;  3T5X A;  5IT9 K;  4U0Y A;  3JSP A;  3BPX A;  3L09 A;  2GXG A;  1G4D A;  3GLX A;  3WTX C;  3I0T A;  3WTU C;  3FX3 A;  2QQA A;  4E70 A;  3TO6 A;  3ZMV A;  4IJA A;  1TTY A;  2PFB A;  4ZYE A;  2VXZ A;  3IRQ A;  1ON1 A;  2XRN A;  3U9G A;  3HSR A;  1BI3 A;  3B73 A;  3COA C;  1FOK A;  1P4X A;  4ENK A;  2B0L A;  5J8C A;  3T1B A;  2NAZ A;  3LQQ A;  1SD5 A;  5H20 A;  3C3W A;  1XB4 A;  2JPB A;  2VBZ A;  4A12 A;  4MEY F;  4NB5 A;  1FX7 A;  5D8L B;  3RTR A;  4FHT A;  2FU4 A;  3KCC A;  3I58 A;  1D8J A;  2CGP A;  4UUV A;  4I98 B;  3F3X A;  1MJB A;  3OV8 A;  4LJZ F;  1LVA A;  3L9F A;  1E2X A;  1RZ4 A;  3HRT A;  4LB6 B;  4ENJ A;  2HS5 A;  1FLI A;  2KIM A;  4OIR F;  1IXC A;  1KYZ A;  1RUN A;  5LEJ A;  1FC3 A;  1AOY A;  3QP6 A;  1T39 A;  4EGZ A;  3FXU A;  4G7Z F;  5BPD A;  1UHM A;  4D0P A;  5EEG A;  1UCR A;  4ON0 A;  3I53 A;  2IPQ X;  2IA1 A;  2DTR A;  2GQQ A;  2EWN A;  4L18 B;  4Z2Y A;  4Y17 A;  3V7R A;  2L3D A;  5LBQ A;  2DQR A;  5D8K B;  2Q8K A;  4I01 A;  5CJ9 A;  1BOA A;  1J5Y A;  1I5Z A;  2CWE A;  4CO8 A;  4MNU A;  2Y0M A;  2P5L C;  4RGU A;  2Z9O A;  1HW2 A;  3K9T A;  2EV6 A;  3DEU A;  2PQ8 A;  3ECO A;  3HSF A;  3K1N A;  4EJT A;  2DT5 A;  4WK8 F;  4LK0 F;  4N9H A;  3CUQ A;  3R0J A;  1IN4 A;  3WGI A;  4DNC A;  2D1H A;  5KK1 A;  2ZJ2 A;  4I02 A;  5LEK A;  5FD6 A;  2QM3 A;  2TDX A;  3EQL F;  1XGO A;  3SQN A;  3HYI A;  1FZP B;  2VBX A;  5D5X B;  3RJP A;  1XSD A;  4U0W A;  1SFX A;  2LDU A;  1RIO H;  1MZB A;  3IRR A;  4B8X A;  4GYI A;  2OD5 A;  3E3V A;  3CUQ B;  3T8R A;  4KIC A;  1YQA A;  3E6D A;  1I6X A;  2KJC A;  3TOB A;  5CVJ A;  1SD4 A;  3K0L A;  2QYO A;  4CYD A;  5L3B A;  3TGN A;  3HUG A;  2VC0 A;  5HDN A;  1LEA A;  2OZ6 A;  4XSZ F;  5FLX Z;  4BHP A;  3BPV A;  1ZLJ A;  5LHG A;  5L3F A;  2ELH A;  4BHB A;  3LA7 A;  3BOQ A;  4ZYH A;  2M87 A;  2NS0 A;  2QBY B;  3RKY A;  3WTY C;  3CJN A;  1ZHF A;  3P7N A;  3TO9 A;  5FFX A;  3AAF A;  1BI1 A;  1U78 A;  2G7H A;  2OA4 A;  3J81 Z;  2FEZ A;  4G8X A;  2W57 A;  4KIB A;  5DUI A;  1IXS B;  4LMY A;  2K86 A;  1GXP A;  2W24 A;  2FBI A;  1H0M A;  3M7G A;  3F22 A;  1EV7 A;  3GFJ A;  3K1M A;  3FXR A;  1R23 A;  3DQV C;  2ISY A;  3WU0 A;  4G6D A;  4IRG A;  1T6S A;  2GA2 A;  4KNY A;  4HAM A;  4RGR A;  3V4G A;  3FWE A;  2L02 A;  1V4R A;  1ZAR A;  4KN7 X;  3RIR A;  1LNW A;  2KRF A;  1UB9 A;  2IA2 A;  4O5V A;  1XSV A;  1OYY A;  3KP3 A;  4HF0 A;  3RPQ A;  4L9V A;  5FFZ A;  3G3Z A;  1MD0 A;  2ACJ A;  5DUK A;  2CSO A;  3E6C C;  4JK1 X;  5E8G A;  5HVQ C;  3IKV A;  2FNP A;  3FZV A;  1SD6 A;  2KKO A;  3E6B A;  2H6C A;  2M8E A;  3RYP A;  1QO0 D;  1FSH A;  2PMU A;  4HX8 A;  2V6C A;  1KU9 A;  1XDS A;  3HOT A;  3KP4 A;  2XKO A;  2K02 A;  1ZN2 A;  3N4M A;  2IVM A;  2ZCW A;  3HTU A;  2A6E F;  4M73 A;  4KMU X;  2J5P A;  2WTE A;  2O8X A;  4AIH A;  4O3M A;  4OIP F;  2M30 A;  2ESH A;  2OAZ A;  5LGN A;  2JPC A;  1TNT A;  1SMY F;  3TQN A;  3GEZ A;  2M5W A;  4LLL A;  1XMA A;  4Q47 A;  2FMY A;  3K2Z A;  2V1U A;  2VOO A;  3NRV A;  3CUQ C;  1EH8 A;  3SFZ A;  5FGM A;  2K27 A;  5DV5 A;  1UST A;  3FM5 A;  1PP7 U;  1IAW A;  5CVR A;  2VOP A;  3DKW A;  2W25 A;  3ELK A;  1TLH B;  3EDP A;  4IHS A;  1O7L A;  3G73 A;  1BC8 C;  4BAY A;  3HRS A;  1MGT A;  1T98 A;  2GZW A;  3ZN0 A;  1BI0 A;  2EV0 A;  3K69 A;  1MDM B;  3KFW X;  5JI6 A;  3TO7 A;  2H94 A;  3HRU A;  1ZLK A;  3MZH A;  3PQK A;  2IW5 A;  3CUO A;  3REO A;  1XGS A;  3LWF A;  2G9W A;  3E5U A;  2UWM A;  4DQ2 A;  4OOI A;  2FA5 A;  1D3Y A;  1LDJ A;  1YIO A;  3K1P A;  2P7C B;  1FYM A;  4AWX B;  3RPU A;  1S7O A;  4LG0 B;  1XDU A;  2EV5 A;  1R36 A;  1YYV A;  3L00 A;  3LQR A;  1B6A A;  2A5Y B;  4HA8 A;  4WX9 A;  1KYW A;  1TNS A;  1HQC A;  3I5U A;  3F21 A;  3ML6 A;  5DDG A;  3O3K A;  4LLN A;  3LA3 A;  3V7S A;  6PAX A;  3DFG A;  2PEX A;  1YW7 A;  5E1X A;  2ZO4 A;  1FBQ A;  4ESB A;  3KP5 A;  1FBU A;  3GZ5 A;  4L0Z B;  2A07 F;  5HLH A;  4MTE A;  4A0Z A;  4KUM A;  2IJL A;  2V79 A;  1W7P D;  4O6J A;  2LNB A;  2O61 A;  2HQN A;  2D1V A;  3GYH X;  2HKX A;  2STT A;  4LGW A;  4A0X A;  1T38 A;  4YIF A;  2V1X A;  1QGP A;  3IWF A;  2VBW A;  2L54 A;  3TOA A;  1J75 A;  2PMH A;  1I1G A;  3ZMD A;  1OKR A;  2D2W A;  3D5L A;  2NYX A;  3IWZ A;  3F8F A;  1O3T A;  5LHH A;  4HYE A;  4HX7 A;  2RKH A;  2Z5U A;  1R1T A;  3CDH A;  3GFL A;  1GVJ A;  5HDG A;  3KP2 A;  4ZYG A;  4M6Y A;  4NHJ A;  4WXH A;  2P7V B;  1MJA A;  5HDK A;  2ZKZ A;  3F6O A;  5HLI A;  4KYW A;  1ONV A;  5CVI A;  3HRM A;  1DDN A;  4HDU A;  3FMR A;  1R7J A;  2BV6 A;  2OQR A;  4YII A;  2EA4 A;  3IL2 A;  4AD9 A;  4OIO F;  1XD7 A;  2RGV A;  3B02 A;  3JAM K;  1IZ1 A;  2EB7 A;  4GXO A;  2VE9 A;  1C0W A;  1ZYR F;  1X3U A;  2BEO A;  1OYW A;  3ABU A;  2P6T A;  3QP5 A;  1ZG3 A;  1SFE A;  4M71 A;  3KLO A;  1YFH A;  5ILS A;  3SXY A;  3O6B B;  5F1R A;  3EYY A;  4IF4 A;  2PLY A;  4GCV A;  4RB0 A;  4IXA A;  1XN7 A;  3FM3 A;  1O7F A;  3R4K A;  1KU7 A;  2ISZ A;  1IRF A;  2JZY A;  3GX4 X;  4YFK F;  4FT8 A;  1FT9 A;  2HDC A;  1SFU A;  1S6L A;  1REP C;  4ESJ A;  5FD5 A;  3HHG A;  4H0E A;  2HTS A;  2EK5 A;  3WOD F;  4LG0 A;  2BE5 F;  4EVI A;  1XGN A;  3WU1 B;  1XGM A;  2VOD A;  4OMY A;  2KIF A;  1XCV A;  1U3E M;  2Q0O A;  3BDD A;  3CTA A;  2P6S A;  2DFI A;  5E8I A;  3MEX A;  1BJA A;  3MFK A;  3E6M A;  4G7H F;  4IRH A;  2CO5 A;  1MKM A;  2FBK A;  5FO5 A;  4HZF A;  2CYY A;  1MDM A;  5L3E A;  1I1S A;  3KP6 A;  2NNN A;  2GA1 A;  2XAF A;  1WI9 A;  2EFQ A;  5TJJ A;  5DCF A;  1HKQ A;  1FPQ A;  3ZMU A;  1G3T A;  4CGZ A;  2DK8 A;  1R22 A;  2O0Y A;  2C6Y A;  1KA8 A;  4IPA A;  3M9A A;  1WSU A;  1KU2 A;  1YS6 A;  4LB5 A;  4U88 A;  1G3Y A;  2UXX A;  2X4H A;  5L3D A;  1PUE E;  4N0B A;  1OYI A;  2VN2 A;  3E5Q A;  2XAH A;  3F72 A;  1EH6 A;  3DP7 A;  2H27 A;  4RGX A;  3QU3 A;  4RB3 C;  3RYR A;  1KQ8 A;  3QPH A;  2ETH A;  5FLX K;  4EM2 A;  2DI3 A;  1BC7 C;  2RNJ A;  2FNA A;  5JR3 A;  3LAP A;  2DBB A;  4WWC A;  4S04 A;  1LB2 A;  4KDP A;  5JVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...