3K2AA

Crystal structure of the homeobox domain of human homeobox protein meis2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
b'PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Meis2
publication title Crystal structure of the homeobox domain of human homeobox protein Meis2
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 17
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3k2aA00
1RESA 2XGEA 1IG7A 1ZQ3P 2CUFA 2K9QA 3JRBA 5FKMA 1GV5A 1PUFB 1S7EA 4IHYA 1JKOC 2K9NA 2M9HA 3A03A 4A3IJ 3MKLA 3VPRA 2K40A 3PO2J 2FX0A 2IEKA 2NVTJ 2RAEA 2O7OA 4NDLA 2XGDA 3SDGA 1FIAA 1ETVA 2XPWA 2M34A 2R5YA 3JRDA 1BL0A 4MLOA 2DTZA 1RKWA 2NOGA 1FTTA 4FE4A 1H89C 3OOUA 1JGGA 2N8GA 2OF7A 3CMYA 2R5ZB 1FTZA 2LK2A 2JA7J 2AO9A 1IV6A 1XC5A 2G0EA 1Z0XA 2VKVA 1JTXA 1U9OA 1ZKGA 2DA5A 5M5XJ 2I10A 4X1EA 4BY1J 4C2MJ 2COBA 4A3FJ 2NVQJ 1ETKA 2YS9A 3LNQA 2XSDC 4XICA 2CQXA 5C4XJ 3BQYA 2DA6A 3W6VA 5FKNA 3B6CA 1QPIA 3IH2A 2MSYA 3FIWA 4CYCA 5EG0B 2VI6A 3BTJA 2WV1A 2W48A 3Q0VA 3HOXJ 5EZHA 3S16J 4XRSG 4M3EA 4XRMA 2LKXA 5BNGA 1WCMJ 2L7ZA 1VF9A 3BR3A 4V2FA 3LSPA 3GTKJ 2HXOA 5IYDJ 3ZQFA 5EZGA 1ETYA 4IEJA 2NS8A 4JX5A 1G2HA 1YRNA 5J3LA 1MBJA 3WHBA 2XRLA 4BKXA 2LVSA 2JWTA 3FK6A 4I76A 1Q1VA 3JRGA 1LFUP 2DA7A 2ME0A 2ELKA 2E1OA 1AU7A 4L5EA 2MW8A 4IHWA 2IBDA 3MVPA 4A3LJ 1Y1WJ 2H8RA 4A3BJ 4A93J 5JLXA 4S0HB 3HB9A 2DA3A 3G1LA 2JA5J 5E3OA 5EGOB 2Y31A 2EZLA 1JT6A 2R92J 5F27A 2DMNA 5E3LA 3PO3J 2LD5A 1ENHA 3JRAA 2M2EA 4DYRA 1ITYA 4AUXA 3C2BA 3H0GJ 3ZQHA 4XRSA 3OIOA 2Y9YA 5FLVA 5IYCJ 4BXXJ 3JREA 3HOVJ 4A3KJ 1VNDA 2ID6A 2KDZA 4J19A 3K2AA 1W0UA 2DMTA 3F0CA 2NVYJ 4I6ZA 3OSGA 3H3VK 3G1OA 5IYBJ 1UG2A 5M3MJ 1WGXA 1T33A 2NVXJ 1JKQC 1ORKA 1B72A 3RKQA 4DZJA 3M3YJ 3ZQGA 2GLOA 2YU9J 2JA6J 3HOWJ 5FLMJ 1T56A 1HF0A 4A3GJ 5IOYA 1TWCJ 4D7MA 3JR9A 3IV5A 4QTRA 4DYCA 3A01A 2D5VA 2HDDA 1SANA 5GP9A 3BT9A 3QPLA 4HNVA 2JK3A 1R9TJ 1A6IA 1ZGWA 3GTQJ 4B4CA 1IGNA 3I4NJ 2CU7A 3HGGA 2DMPA 3TP0A 3DCFA 2EH3A 2O8KA 1QVUA 2DJNA 1BA5A 4IHVA 2EZHA 2JMWA 2JJ7A 4RDUA 1JT0A 3CCYA 2L7FP 2DA1A 3K7AJ 2Y9ZA 3BG9A 4FCYA 1VFCA 2L0KA 3HM5A 4AC0A 1NK2P 4BY7J 2O9LA 1WI3A 2XB5A 4A3DJ 3HOZJ 3NARA 1HDPA 3GTMJ 5J1RA 1RETA 3O8HA 1I50J 1APLC 2E2JJ 1RKTA 1LE8A 2HOSA 3TEDA 2LTPA 2ID3A 3BQZA 1GT0C 1MH3A 3TP3A 2L9RA 4M3DA 1OFCX 2X9DA 4ABZA 5C3EJ 2R5YB 2EBIA 4W1UA 2K9SA 2L7MP 2QCOA 4A69C 3S2DJ 2R0QC 1WPKA 2FJ1A 1NK3P 1DU0A 1HOMA 1QRYA 4BBRJ 2PMZN 4A3JJ 5F0FA 1MH4A 4Y7NJ 2B63J 1ETXA 1HCRA 5E3NA 1LFBA 2X48A 4BBSJ 1FIPA 4M3GA 2XGCA 3QPSA 3UKGA 1MBGA 3JRHA 3HDDA 1K83J 1OCTC 5EEAA 5HODA 4AYBN 1GDTA 1IRZA 3IH3A 3S1MJ 3I4MJ 4X6AJ 1XG1A 3FKIJ 1SFOJ 1K61A 4M6VA 2WAQN 1O4XA 3GTPJ 3SFIA 4CYCB 1HLVA 5IPAA 4JP0A 3HOUJ 3Q0WA 5EYRA 1TC3C 5IP6A 5F08A 5FKKA 2EZIA 5GPAA 5M3FJ 4Y52J 3G1MA 1A5JA 4M3BA 1GUUA 1P7JA 3LSGA 1AKHA 1TWGJ 2YUSA 4D5CA 1ETQA 1YRNB 2ECCA 4MFEA 1F43A 1F36A 1W0TA 3HGYA 4DW6A 5M5WJ 3BR5A 4DZPA 1WH5A 3D1NI 3OSFA 2ZB9A 3S1RJ 1JUSA 3JRFA 3RZOJ 1MBKA 2DMUA 3ZQLA 1PUFA 3S17J 1GV2A 3Q0UA 5EDNA 4JX6A 1TWFJ 3HOYJ 4V2GA 2LP0A 2X6OA 1X2NA 3BG3A 5IOZA 3BTCA 1ZR4A 5J1YA 4B3AA 5C4JJ 2TCTA 3FISA 2MG4A 1IC8A 1IJWC 3GTJJ 3CDLA 1OJLA 1POGA 1I3QJ 4RBOA 4C3JJ 3A02A 1TWAJ 3BR2A 4FISA 5F0CA 3TW7A 1BJZA 4D5FA 5EF6A 3L1PA 2JA8J 5GPCA 5J1UA 4JYKA 2R5ZA 2LFBA 4A3EJ 1JKRC 1FEXA 2XPUA 3BTLA 1RPWA 3ZQIA 1FJLA 2HOTA 2TRTA 1JJ6C 1JJ8C 4IHXA 4UUTA 2DN0A 4C3IJ 2KT0A 3S2HJ 2WB1N 2VUMJ 1ZR2A 1RR7A 3MN2A 3IH4A 3GTGJ 1Z77A 1D5YA 1B72B 4A3CJ 3DEWA 3TW6A 3WHCA 4QIWN 1CQTA 1TWHJ 1EF4A 5EG0A 2XB0X 1P7IA 2LLKA 2NS7A 2FD5A 2E2IJ 2ECBA 5DTDA 1X2MA 2H1KA 3SJMA 2Y30A 5F0HA 2LY9A 3BR1A 4C3HJ 5FJ8J 3A01B 4LOCA 2EZKA 2FQ4A 1Y1VJ 5K7ZA 2EQRA 3RZDJ 3LOCA 5JLWA 4MIMA 3O8GA 3Q3SA 4UUSA 3B6AA 1B8IA 2VKEA 3RQIA 1ETWA 2AHQA 1MBHA 5F1JA 1BW5A 1MNMC 3HEFA 4XIDA 1E3OC 4MFDA 5E3MA 4QSHA 3HBLA 2HXIA 2JN6A 1HDDC 1IUFA 1JTYA 5K7HA 4FE7A 4B1RA 5DS9A 5EGOA 3NAUA 4A3MJ 3GBGA 2GM4A 1MSEC 3GTLJ 1JKPC 1U9NA 1AHDP 3BR6A 1LE8B 1ZK8A 1VI0A 1WH7A 2Y2ZA 2VPRA 3JRIA 3JRCA 1GVDA 2CUEA 4G12A 3S1QJ 2QF7A 2R93J 1IDZA 4UUSB 1ZTRA 2DA4A 3LSJA 1B8IB 1I6HJ 2Y0SN 2DMQA 3CQZJ 2XPVA 3S14J 2DA2A 2HQ5A 4XK4A 1MSFC 3FK7A 4M3FA 5K7FA 4FTHA 1XS9A 1H88C 3PM1A 3BR0A 1JUMA 2P81A 5FKOA 1BW6A 3BTIA 1ETOA 2ME6A 1DU6A 5FKLA 2HYJA 4EEFG 1OCPA 2CRGA 2CJJA 4JX4A 3QQAA 5IP9J 9ANTA 1NTCA 4W97A 5M5YJ 2LR8A 3S1NJ 1U78A 2MGQA 1MBFA 2HOAA 4GFBA 3LSRA 3E7LA 2R7ZJ 3BG5A 2M0CA 3ZQCA 1IDYA 1X58A 4D7NA 2E2HJ 3GTOJ 1UHSA 5C44J 1U8BA 3S15J 3ZOBA 2CQQA 4MO7A 2OPTA 1H8AC 2M8GX 1MBEA 4DYQA 1JUPA 5F04A 3HKZN 2IAIA 2GBYA 1AKHB 3M4OJ 1QVTA 1UMQA 2HI3A 5IP7J 2E19A
chains in the Genus database with same CATH superfamily
1RESA 1XSDA 1KU7A 3BG6A 2IS4A 5EEHA 4G7OF 3H5AA 2OZ6A 3JRBA 1GLNA 2YX7A 4EATA 3ABUA 6PAXA 3VYTB 4XONA 4IHYA 3AL0C 4XNFA 2DJIA 2CG4A 3AFHA 4L5JA 2KISA 1XSXA 3A03A 1OYIA 2IEKA 4ZDLA 1P4AA 2RAEA 5E18F 4WX9A 2PFBA 2Y0MA 2O7OA 4I2OA 4NDLA 4MNUA 1FIAA 1ETVA 2M34A 3ZMSA 3H36A 3JRDA 4I01A 4U0VA 1BL0A 4UY8I 3KX2A 2NOGA 2XAFA 1XB4A 2BW3B 5FRNA 2Z99A 1EJ9A 3RQ4A 3K4JA 3RJPA 2LK2A 2DBBA 2Z33A 1IV6A 1RUNA 2NXNB 4B44A 4LJZF 2EB7A 2EPFA 1U9OA 1ZKGA 4X1EA 4BY1J 2K3PA 1HW5A 4A0YA 2L7KA 2VQHA 5L3DA 1XMKA 5D4SA 1XGNA 2K02A 1ETKA 2YS9A 3KP6A 3LNQA 4XICA 2CQXA 3OV8A 3BQYA 5C4XJ 1QPIA 2A69F 4EGYA 2D45A 2R7WA 1Y8QB 3GCMA 2FBHA 2VI6A 3BTJA 2KRFA 2XAGA 2ZFUA 4ZYGA 3Q0VA 4DIQA 2WB1A 1J0RA 4XRSG 4RA2A 2HTSA 4M3EA 4XRMA 3J80K 3JAMK 1T95A 1WCMJ 2L7ZA 4V2FA 5CPRB 4CDGA 4OMZA 2DT6A 1JGSA 1FOWA 3J7YJ 3TDUC 2NS8A 3I54A 1G2HA 3CC4I 4HBLA 1O7FA 1MBJA 4HX4A 2XRLA 4L9VA 2DFFA 1BR2A 2LVSA 4M73A 3FK6A 4Q5SF 3ZN1A 4EM0B 4CUGA 4IHSA 1Z7LA 4HSRA 1Z91A 4EJVA 2FU4A 3PIPF 2ELKA 5DD4A 4O6JA 1AU7A 4L5EA 3ULQB 5B5EC 2ZCWA 4QPOA 2H8RA 4A93J 2DA3A 3QU3A 3DKWA 2JA5J 5K1YA 2FOKA 2QGUA 3V42A 3S32A 4IVNA 4ENKA 2XF5A 3AG2H 3LFKA 3CDHA 2COMA 1HKSA 4XR6A 1P92A 2PMZA 1ITYA 1SD5A 4MGRA 3A0BC 3ZQHA 4XRSA 2DK5A 2J5PA 4A5NA 1YJ9I 2GXBA 1WRJA 2VKHA 2P7CB 1XGOA 5FLVA 1WZ2A 2DLLA 3JREA 2FQ3A 2V1DA 4G9YA 1VQ9I 1UHWA 2GOMA 1R00A 2L02A 4NNJA 3DKXA 1W0UA 1IXCA 2DMTA 1S5LC 3BY6A 2PMHA 3OSGA 4BJTA 2JPBA 3MZ8A 4BJ5C 3HL2A 4G6TB 1ORKA 3RKQA 2KMUA 4DZJA 1SFEA 4RGXA 5BPIA 4A0ZA 2V1NA 4A6EA 2QLZA 3U9GA 5FLMJ 3RDIA 4UB6C 5D6FA 5IOYA 4LIVA 2UXXA 3BP8A 2EIJH 1NH3A 3IWFA 3QRFF 2JRMA 3OYMA 3A01A 3BROA 3CESA 2VE9A 3P9IA 2D5VA 1SANA 4PFPA 3W3CA 4OINF 2HEOA 4HNVA 5ICCA 1G3WA 1WVRA 3HTUA 2FBIA 1TT5B 2FNPA 4B4CA 1OCCH 2J5OA 3I4NJ 3RPQA 1C0WA 4RAYA 4S05A 4IHTA 2DI3A 4YIIA 3QAHA 1CF7A 2O8KA 1QVUA 5F1RA 4Z2YA 2EZHA 2VOOA 2KIUA 2CFOA 2Q1ZB 1W36C 1S8NA 3IP4B 4II3A 2P5KA 2L7FP 3BG9A 5IT3A 1VFCA 4HLYA 2FRHA 3HM5A 4AC0A 1NK2P 5HLTA 1ZG3A 5HNHA 2XB5A 3NRVA 4IZZA 4A3DJ 2IJLA 4B43A 4HW0A 5D8KB 5FRMA 1SVOA 3D5LA 3FXRA 4F55A 4BACA 3GTMJ 1L3LA 4G8XA 4PUSA 3O8HA 1ZHFA 2OD5A 2F5FA 2G7HA 2XKPA 3I71A 1Y39A 2R7RA 1WJDA 2HOSA 3A4CA 1LE8A 2E1NA 4AD9A 2VBZA 1VTNC 3FXMA 2R7DA 1U3EM 2LTPA 2JZYA 1VQ6I 3HPGA 5HOOA 3SDBA 2HVSA 1X3WB 2EBIA 4QLCU 4W1UA 2K9SA 2V1UA 3MKYB 1WPKA 5KK1A 2HNHA 2QENA 2R7XA 1R71A 1QRYA 2ICWG 4BBRJ 4XLPF 2AXLA 1HCRA 2PI0A 1ERDA 4BBSJ 3RYRA 2XGCA 4PJJA 3L2UA 3JRHA 1IRFA 3UKGA 3U2RA 2HS5A 4M9XA 4HF1A 3S1MJ 3R6SA 3HSRA 3I4MJ 3B73A 1SFOJ 1ONVA 1K61A 3L2WA 3OL4A 4M9ZA 1FOKA 3PUFA 3W6JB 1QQIA 4HNTA 1I6XA 4LG0B 5EYRA 2VJJA 4XN3A 1KU2A 1TC3C 5IP6A 2XRNA 4ESBA 1X1CA 2EZIA 1R5HA 3F23A 4Y52J 5HLIA 2OV7A 2KQRA 2W84A 2LYCA 2WV0A 2YUSA 2F6CA 1FBQA 4D5CA 2LBFB 1F36A 1NG6A 3B02A 1W0TA 4DW6A 1PDNC 3BR5A 1FOYA 3OSFA 1DQUA 3CP2A 2TDXA 2FEZA 2RNGA 4II2A 3JRFA 1MBKA 3ZQLA 3MZYA 1PUFA 5EEGA 1GV2A 3KZIC 2VONA 3HOYJ 1KQ9A 2X6OA 4UXNA 4OOIA 3BTCA 4BL0B 5J1YA 4B3AA 5C4JJ 3FISA 2MG4A 1SAXA 3ONQA 4G6DA 4UB8C 3CDLA 1A36A 2DPUA 3C2GA 1SMTA 3HRUA 2XVCA 1Z05A 5F0CA 1IN7A 3HHGA 3SZPA 5K5OA 3UR3C 1BJZA 3SEZA 3L1PA 3OYLA 3NEUA 3LA7A 1S6LA 1O7LA 1EV7A 3CCVI 4A3EJ 3FMSA 3DFGA 2M4GA 1SFUA 3BTLA 1TTYA 1BC8C 1FNNA 2TRTA 2A5WA 4UUTA 4HG2A 4RB2C 4XOTA 3FBNB 1HSJA 5CVVA 2WB1N 2VUMJ 5KVRA 4QPQA 1TL8A 2O0YA 4Q4ZF 1HA8A 1Z77A 4RM3A 3OYNA 3DU5A 5J4YA 1X1BA 1B72B 4A3CJ 2Q2EB 2UUZA 3TW6A 1K79A 3ECHA 5B66C 2XB0X 2ZJQF 2NS7A 5L3BA 3ABLH 3PNVA 3WU2C 4A12A 3MKWB 3H0DA 2BY3A 3RSNA 5FD6A 2Y30A 3SYTA 2DODA 1KZHA 3BOQA 3V7SA 3EUAA 3WTWC 1J09A 1A31A 4HDUA 1YX5A 3RZDJ 3AG4H 3QP5A 3QYEA 3HPHA 1K78A 2O6GE 2M8EA 4FHTA 4XKBA 2ZMEA 3CMMA 2WY7Q 4BE2A 3OYJA 2VKEA 1JXSA 2AHQA 2MC3A 1MMGA 1YW7A 1BW5A 4OMYA 1MNMC 4U7DA 3ZMVA 2HDWA 2CUZA 2M3AA 4F92B 1E3OC 3DLLF 4ZDPA 4QSHA 5FROA 3MEXA 2ZFWA 3KFWX 1JTYA 3S3MA 3TO6A 1OCZH 1WJCA 1WJ5A 4IJAA 1OPCA 3IAM2 4GRIA 5EGOA 3P9CA 3GTLJ 1MSEC 1SD7A 1R49A 4XORA 5LRSA 1AHDP 2FA5A 4XBFA 1ZAOA 4Y4RA 1WJAA 4IOAF 1WH7A 2IGNA 4E7HA 3JRCA 2OA4A 2VT2A 1P9QC 4DBRA 2XUBA 1K6YA 2VJ4A 5J47A 2ELHA 1IN6A 2EV5A 3LSIA 3RPUD 2Y0SN 3CCEI 3L2CA 3CQZJ 3CJTB 4LG3A 3HIFA 4XK4A 4EJUA 2Z9OA 3DU6A 1JE8A 2L3DA 1OR7C 1H88C 1T2KA 4HF0A 4BXUA 1JUMA 5FKOA 4Y17A 3U1DA 2K4JA 2HQRA 4Y33A 4RM2A 3MFKA 4EEFG 3ABMH 3HOSA 5IP9J 1O57A 2H09A 2LR8A 4XLNF 2QSFX 3FMRA 3WTVC 2A6TA 1T0FC 2MD5A 2R7ZJ 4KITB 4F7ZA 3ZQCA 1X58A 2MA3A 4D7NA 2E2HJ 5BOXA 1EA3A 2VQLA 3AAFA 1TQIA 1YS7A 2HQNA 4NB5A 5C44J 3MWMA 1WFXA 1UJ8A 3CF5F 3OYKA 4XLEA 4GYGA 3VYUB 4XN0A 2IPQX 4UVBA 3O3KA 5L3CA 1E3HA 2M8GX 5E17F 4RLQA 2HYFA 4IPAA 1AKHB 5DCFA 3Q5FA 3P5JA 2A3SA 1BI0A 2R7QA 1QVTA 1ZELA 1EH7A 3HRTA 1HC8A 1YHQI 1IG7A 2O03A 5CKTA 3KYLA 2Q8KA 2CUFA 2LF8A 1LNWA 1PJRA 5FKMA 4PJ0C 4ESJA 5J6XA 1QBJA 4CZCA 2K9NA 1UCRA 4A3IJ 5AONA 1G59A 3VPRA 3CJQB 1FMWA 2NVTJ 1T39A 3W2WA 1BR1A 4EJWA 4NC6A 4Y3OA 3G6EI 3SDGA 1YG2A 1FYMA 2R5YA 1BR4A 1F9NA 3SFZA 3C3WA 2XHKA 4MLOA 2DTZA 1RKWA 2DT5A 3S3OA 1IUYA 1H89C 3OOUA 1JGGA 3LSHA 2CV1A 1LDDA 4EJOA 3TO9A 3IAS2 1R1UA 4UVCA 4OU0A 1I1SA 1LFPA 3DF8A 1JTXA 4LLGF 2DA5A 3KZZA 5M5XJ 1MW7A 5E8GA 4ZH4F 5D5WB 2K4BA 3KP4A 4BEHB 1YIJI 1OCRH 2FOWA 2H8WA 1LDJA 5E20A 1REPC 2EFQA 5EG0B 2LKPA 4PZJA 1STZA 2DFHA 1QZZA 2W48A 3HOXJ 4IO9F 3ZMZA 3S16J 2KP6A 4AIDA 2GWRA 5BNGA 1OQYA 3KZYA 5E1ZB 4E70A 1U5TB 1Y8RB 2F4IA 1MGTA 4BQQA 3LSPA 3KP3A 3GZ5A 4LLLA 4EM2A 5K5QA 4IEJA 2ZJ2A 3I9V2 3LQQA 4BE0A 3K9TA 2YSRA 3LAJA 1YRNA 4BKXA 3WG7H 5D5XB 4NC7A 4I76A 3KYDB 1OYYA 4AWXB 2HGCA 1QU3A 3JRGA 3EYIA 3QP6A 3WTZA 1LFUP 2DA7A 1MMSA 2ME0A 1VQNI 3RKWA 1S29A 1FP1D 3E1SA 1XMXA 3PSFA 2JVHA 2IBDA 1R5GA 4DGWB 2FXAA 2LRDA 5ICGA 4A3LJ 1W5CC 3FM3A 4TV7A 1Y1WJ 2VXDA 1QHGA 1MNEA 2YX4A 2YR2A 5JLXA 1LDKB 1S9HA 4S0HB 3G1LA 4FQGA 1VQ5I 1M1EB 4XLFA 3K2ZA 1MMDA 5F27A 2DMNA 2GIZA 4P5OA 3VB2A 3E6MA 2LD5A 5LHHA 1LEBA 1Z67A 3ZGKA 2VXZA 3R60A 2VASA 3EYYA 5E1XA 1D3YA 1R36A 1W7PB 3HYIA 2F2EA 5IYCJ 2PG4A 4DOZA 2ID6A 2K9LA 2KDZA 1XCVA 3BJOA 4IX7A 2ACJA 1WQ2A 3OYBA 3OL3A 3LL7A 1EH6A 3I0TA 4YFKF 2NVYJ 1QPMA 2Z3YA 3K4CA 4WXHA 3G1OA 2AQFA 1UG2A 4KNYA 2WAFA 3T0YA 2BBYA 1A35A 4C2TA 3CO7C 4V19K 2BGCA 2LNBA 3HOWJ 4A0XA 5KAFC 3GF2A 1A6QA 3HJEA 1YYVA 2KZGA 4HV6A 1YJWI 4G94A 3H5RA 1HSTA 2P6TA 4PSXA 5LD2C 2QBYB 1PP8F 4MQ9F 2MLKA 5EJCA 2MLGA 3IV5A 3L2RA 3LMMA 3ABKH 1UAAA 2X4HA 3CP8A 1KU3A 3QPLA 4N4OB 4ENNA 5DUIA 1ZGWA 3FF5A 1T38A 4ZJZA 2CU7A 3HGGA 2I8DA 4BHBA 4EGZA 2XF7A 3BZKA 2A07F 2L9SA 2EH3A 2XGXA 3F8MA 3KPHA 3TMOA 1FBSA 2DJNA 2UWMA 2JMWA 2JJ7A 1ZREA 3CCYA 2Y9ZA 4DBQA 3V4GA 1X4OA 3LWFA 5HS7A 5KNLA 4D1QA 2A6EF 3BLYA 3GFIA 3MD2A 2ZXIA 4PDKA 3MKZA 2XKOA 4LMYA 2DW4A 3N4MA 2JQ7A 1WI3A 1FY7A 1XPXA 4F52A 1W36D 1R6RA 3HOZJ 5TISC 2WBMA 4LFUA 4O5VA 1P4WA 2IRFG 2BYVE 2F5EA 5HVQC 4HSTA 5J1RA 1RETA 1XCBA 5KAIC 1APLC 1ZYRF 1RKTA 4BDYA 2CS3A 5B1BH 1BI1A 3F8BA 3TEDA 3CUQA 4FETA 5A2QZ 3BQZA 2CFXA 2L9RA 2E1MB 2X9DA 4L9NA 2QWWA 3FMQA 3DLAA 4A69C 4LIUA 3VYRB 2QA4I 2V26A 4E7JA 2WADA 3PNTA 4CCOA 4LK0F 2D1HA 1OKRA 2E35A 2O5RA 2VQGA 2R7OA 2RREA 4A3JJ 2E7WA 1GXPA 5F0FA 4Y7NJ 2NAZA 2B63J 3F6VA 2V6CA 1LFBA 1U5TC 4NHJA 3QPSA 1MBGA 1DPRA 2LH9A 2W57A 2CWEA 3ZMTA 3G3ZA 1GDTA 1FYKA 3RYPA 2KJBA 2KLOA 2HKXA 2AS5F 4M9SA 3FKIJ 3R0JA 3OIQA 3SFIA 2X6XA 3CUQB 1RUOA 3O6BB 3FZVA 3E3VA 3VYSB 1S72I 2WAEA 3DQVC 2XSJC 5HLGA 2OCCH 1YQAA 4D0PA 2EINH 2L9NA 1MNDA 1VQ4I 4UVAA 5GPAA 5M3FJ 1TW3A 5HDKA 4M3BA 3X2QH 5BQTA 5B1AH 1P7JA 2DYSH 5DD8A 3ZPLA 1RR8C 4MEYF 1RNLA 2MH9A 4E7SA 3D1NI 1LPQA 2DOAA 1AA7A 2IGOA 4PGGA 3CCRI 3W6KB 1HW2A 3CC2I 1R58A 2ZB9A 2CV2A 3PJRA 1JUSA 2DMUA 5HDGA 1RIOH 3I5UA 2PEXA 1TWFJ 1QGPA 1FYLA 2LP0A 3CD6I 3GFLA 5IOZA 1ZR4A 3KP2A 3K4MA 3PQKA 4N9HA 2CGPA 2LDUA 1IJWC 2L4AA 4R1HA 3FHZA 1ZG5A 5E79C 2Y0SA 1OJLA 1I3QJ 1VQMI 3TL4X 1V54H 1BI3A 3TW7A 1QNTA 1VQKI 4D5FA 2RGVA 5EF6A 2JA8J 4BH9A 5J1UA 2R5ZA 1JKRC 3C18A 1YX3A 4XRFA 4XL9A 2X51A 1FP2A 2R7UA 4J01A 1JJ8C 3BCBA 4IHXA 1X1DA 2VL8A 4C3IJ 1Y6IA 3HUGA 4ZYHA 1SFXA 5DDGA 2CW8A 2M4KA 2RDPA 2BVMA 1RR7A 3LSTA 5CQGA 1X4PA 3ASNH 1XMAA 3WE2A 2CSOA 2L9VA 1OISA 3W2AA 3G71I 3DEWA 1ZLJA 1CQTA 2B7EA 1EF4A 4FX4A 1D0XA 1BI2A 3QYFA 2LOOA 2LLKA 3BZ6A 5DUKA 2E2IJ 4BHCA 4E7LA 1K7AA 4A2UA 1FSEA 4CCLA 1YW8A 2OTLI 3SJMA 2K9MA 2KL4A 3TO7A 5F0HA 4BYYA 5F6FA 2VC0A 3BR1A 2MH2A 3K4BA 4C3HJ 3A01B 2F5DA 4LOCA 3EUHA 3F22A 2QEXI 2AXTC 4YIFA 5TJJA 3CMAI 1Y1VJ 1H0MA 2VJ5A 2K7LA 1NHAA 1WWXA 3E5QA 3M1EA 4IL6C 1LB2A 2A61A 5J40A 3JTHA 1IN4A 3HSFA 1CF7B 4CO8A 3K1MA 4HZFA 4DJAA 3B6AA 1HKQA 5H6QA 2W7NA 1B8IA 2EK5A 2P5VA 5ICFA 2E1MC 5F1JA 2EFNA 3GUDA 3DBHB 3OYIA 4LD5A 3GX4X 4KMFA 1ZARA 3SQNA 4Q47A 1UZCA 2IP2A 3HEFA 3ZQQA 4BGDA 1YTYA 1KU9A 3HBLA 2JN6A 1HDDC 5K7HA 3J7ZI 1YLFA 1Q1HA 1SVMA 3R0AA 2KIFA 4HA8A 2ZXJA 2RVCA 3H5NA 2BXZA 2Z1DA 1JKPC 3ZP5A 4MQVA 4A6DA 2VE8A 3FX3A 2KDOA 4WXDA 1LE8B 3DXJF 2JUGA 3JW4A 5TGTA 2ZXHA 2R3SA 1IO2A 4G7HF 1CGPA 2Y2ZA 2VPRA 3G2BA 2CUEA 1IDZA 1FBUA 3CCJI 4KISA 1XSVA 3T1BA 3ZQ7A 1B8IB 4XQFA 1XN7A 2DMQA 1BIAA 5LEJA 1MDMA 5LGTA 2EA2A 2LC2A 1KGSA 2HQ5A 3E6BA 5JFRA 4ZTFA 3C1DA 5K7FA 1XS9A 2W24A 4WF2A 1V55H 3KLOA 4IXAA 3K0LA 1SEUA 2CQNA 2ME6A 1B4AA 5FKLA 2CJJA 4ENMA 1GVJA 3CO6C 1TNTA 1NTCA 4W97A 4IRGA 5M5YJ 4OAYA 3S1NJ 2EFPA 2E71A 2FSWA 2HOAA 2ZNZA 5K5RA 1D1BA 4UNOA 3QYBA 3CZ6A 3ZCOA 3PUBA 4YG2F 3V7CA 2BOLA 5TRDA 3FXLA 3HG9A 4P9UA 3GTOJ 1UHSA 1MZBA 3S15J 4AYBA 4S04A 5AIPA 5E1WA 3QOEA 2FUG2 4CCJA 3DKYA 2K85A 4OIQF 3F3XA 5F04A 4HF2A 2MABA 2NRAC 3G4SI 2NNNA 4K2EA 2VN2A 4N4NB 5IP7J 3CJRB 2E19A 3KP5A 2P4WA 4RB0A 2STWA 2K9QA 1MD0A 4XSZF 3CMEI 3H3UA 5JVGF 1R22A 1PUFB 5IT9Z 1UG0A 2EV0A 3DPTA 2QSHX 1JKOC 3H35A 2H6CA 5CLSA 3MKLA 4I99C 2K40A 3PO2J 4BS9A 4ZYDA 1USTA 3OR1C 1D8JA 3Q9VA 1MJAA 2LF7A 5J8FA 3I56I 1XD7A 5FLXZ 1U2WA 3I59A 1ZH5A 2OTJI 1FTTA 3I4PA 2N8GA 2OF7A 4C30A 3IL2A 3CMYA 2OU2A 1K4SA 2V9VA 5FD5A 3E5UA 1Z3XA 2W1OA 5DCMA 5GTHC 3R61A 3S93A 2HQAA 1XC5A 3JCUC 1IN5A 3K69A 2I10A 3LQRA 3RPUA 2HR3A 1ZG1A 2XV4S 2FMLA 3DPLC 4A3FJ 2NVQJ 1D1AA 3HSEA 1LQ1A 3CF2A 3IKVA 4P1WA 4P9FA 1FLIA 3MMYB 3OR2C 5FKNA 3IH2A 3QPTA 4CYCA 3PIOF 3BZCA 3P9KA 4IF4A 1X3ZB 1T6SA 2M1BA 1SC7A 2WV1A 2P5LC 2HPMA 1R4MB 5EZHA 4I09A 1YOVB 3IKTA 4C2UA 4GXOA 4OIPF 1VQ7I 2K3FA 2LKXA 1DP3A 3J81Z 1VF9A 2EJRA 3BR3A 3GTKJ 2VOPA 3RCOA 3ZQFA 4I7HA 5EZGA 2RQPA 3VODA 2K5CA 1W1WE 2OQGA 3R4KA 1K78B 4JX5A 1PYVA 5J3LA 5KCMA 2DOEA 2ZMEB 1DGRM 1TW2A 2A5YB 2A6HF 2E1OA 3CJNA 2IGKA 2MW8A 4IHWA 4KYWA 3WU0A 1HBXG 1DDNA 4A3BJ 2NOJB 3HB9A 3QWLA 3OYCA 3WTUC 2KIMA 3FHNA 5EGOB 1FZPB 4I02A 1Y0UA 2EZLA 2HVRA 1JT6A 1YIOA 1ENHA 2M7BA 3WGGA 3JRAA 2M2EA 3FXQA 4AUXA 3OIOA 3EUKL 4YIRX 3OYFA 3OIPA 2HYGD 4BXXJ 2OBPA 1ZN2A 1Z9CA 3HOVJ 1A04A 3RIRA 4A3KJ 1T08B 1N77A 2HZTA 2IS6A 4PK4A 4B47A 2KRHA 4J19A 2JVGA 3GLXA 1DP7P 3KETA 1FWZA 2UV1A 2HZDA 4E7KA 2ZSIB 2PJPA 5IYBJ 3GYHX 4BQAA 3V7RA 2O8XA 4NQWA 1B59A 3QPHA 1JKQC 1ON1A 2A05A 3M3YJ 2NYXA 2JA6J 3BG7A 2DFEA 2UZKA 1I3AA 2WC2A 4F91B 1VQOI 1EH8A 3LSMA 4HRIA 5D8LB 4AIJA 2UXNA 4KFCA 3AKZA 4KDPA 2VBWA 1TWCJ 4D7MA 2ISZA 3LSKA 4XKCA 1T98A 1BJAA 1IXSB 4PJMA 5LRRA 2R7VA 3TDZC 1E2XA 1A6IA 1XTAA 1IGNA 1MKMA 3OYHA 3T8RA 1IAWA 3TKYA 2BXYA 3K1PA 1G3SA 3TP0A 4LB5A 3DCFA 1P4XA 1X3UA 4L9JA 5CVRA 4EV0A 3GXOA 4BU2A 3MCZA 3FDYA 4Q48A 3O2PE 4CA0A 4KN4X 5FO5A 5JR3A 4RDUA 4BXFA 2IXSA 2DA1A 5D6EA 1HQCA 2L0KA 3PFIA 1WHUA 4BY7J 2RKHA 1KYZA 3EDPA 2DQRA 2EIKH 2V4JC 3ELKA 4M72A 2DYRH 2ZNYA 3NARA 3M9AA 2VQCA 3VDXA 4CCNA 1WSUA 3M8JA 3RKYA 1I50J 1B1BA 3HKZA 2E2JJ 3CDIA 5CJ9A 1O3QA 3ASOH 2Z2SB 1YW9A 2QKMB 2VB6A 4E4HA 3M07A 4CZZA 1GT0C 4RGRA 3TP3A 2YPRA 4M3DA 1KQ8A 2ZSHB 1OFCX 4ABZA 5C3EJ 2R5YB 1E17A 4ZZLA 2L7MP 2ESNA 3I55I 1YE9A 2R0QC 2JRTA 4L9TA 4F93B 2FJ1A 5DEQA 3WTYC 1UFMA 4AVZA 1ZGAA 1HW1A 2MFZA 4XKWA 2HOEA 1MH4A 3GFJA 5CVJA 3IC7A 3S8PA 5FB2A 4M3GA 4DNCA 4OIOF 1U6GA 1K83J 1OCTC 5EEAA 4YEJA 4AYBN 4B8XA 5HODA 3CLOA 2BE5F 3F21A 1BM9A 4X6AJ 2HU9A 1Z21A 2ZMEC 4PCQA 2Y75A 3GTPJ 3LA2A 4RAGA 4HPQA 4CGZA 5IPAA 4JP0A 3K6GA 3Q0WA 4EM1A 1IRXA 2HFHA 2E5NA 3GZ6A 5LGUA 1FMVA 5F08A 5FKKA 4FX0A 2BY1A 4U88A 4M71A 2Y48A 4BDZA 1A5JA 1BN5A 1XDSA 3HC7A 5D5UB 4UUVA 3LSGA 1ON2A 1BC7C 1ETQA 2WY8Q 1YRNB 2ECCA 3ZR8X 3HGYA 1WJEA 3L2VA 4ZZDA 5M5WJ 2EILH 1FC3A 3DEUA 1SFKA 4YELA 3RZOJ 1GHCA 3E97A 3BC8A 4EQQA 3Q0UA 5EDNA 3OYEA 4JX6A 4WCGA 3FXOA 3CC7I 5LFAA 4I0BA 3BG3A 1B6AA 2P8TA 5HNFA 1K4TA 1R7JA 1W7PD 3GTJJ 4RBOA 3U1KA 4C3JJ 4BQNA 4OIRF 2W82A 3A02A 2V9KA 1U0JA 1W5SA 2HWVA 2V7FA 3WU1B 4G7ZF 1MJ9A 2BW3A 2C6YA 3VEPA 4HQMA 2DDBA 2M87A 5GPCA 1WJFA 2R7TA 1IN8A 2XPUA 1FEXA 2EWNA 3WTTC 3NQOA 1AWCA 1BOBA 1D1CA 3OOPA 3K10A 3ZQIA 2GZWA 2HOTA 1JJ6C 4AM3A 1PVEA 2DN0A 3HRSA 3H3ZA 2KT0A 3S2HJ 1G3YA 3IUOA 3E5XA 3S2WA 2M7AA 3GEZA 4RGUA 1ZR2A 5ILVA 4U0YA 3WGIA 2G9WA 3IH4A 3GTGJ 1Y56A 3LA3A 1TLHB 4ASNA 1D5YA 2XROA 3REOA 3HRMA 3SEQA 3WHCA 4QIWN 2NNYA 3L9FA 2LY1A 5FGMA 4CH7A 1P7IA 3HHHA 3J80Z 2FD5A 3JAMZ 5HS8A 5DTDA 1X2MA 2V6EA 4WXCA 4B48A 2IT0A 3KEYA 2H27A 5IY5H 3FWEA 4QWQA 3SZTA 4E6KG 2VLAA 4ENJA 2L2OA 2HVQA 1YITI 2E5ZA 2ADUA 4GO1A 3LOCA 2RC4A 3PNYA 4L5IA 1BBYA 3OS2A 4UUSA 2XF6A 1RZ4A 2HKOA 2A68F 1JHFA 2OAZA 1IW7F 3W2VA 1U8RA 3TBIA 2XAJA 4XMYA 4CXFA 4P55A 2DU9A 2E36A 2BZTA 2JA2A 3I53A 3BJ6A 4BJ6C 4UV8A 4XIDA 2F5VA 2XASA 2HXIA 1KONA 4R8HA 1IUFA 4KT6A 2OUMA 2JTVA 1B9NA 2L54A 5DS9A 2W4SA 1BOAA 4A3MJ 3GBGA 3GO5A 2CV0A 2H1LA 4ZTJA 1G8XA 2WWYA 1ZK8A 1VI0A 2X6YA 5H20A 3N97A 1VQ8I 3JRIA 5LBQA 2DT7B 1GVDA 2M30A 4KMUX 4G12A 3S1QJ 2QF7A 2R93J 2DAOA 1O3SA 1N25A 4UUSB 1TBXA 5BPDA 5A2QK 1ZTRA 2XAQA 2P7VB 4F3QA 1QZYA 2DA4A 4KA4A 3LSJA 4J00A 1I6HJ 3FBIB 1XGSA 4KICA 1V3FA 5FFXA 2DA2A 1SD6A 5JI6A 1WKMA 4NUBA 2XIGA 3FK7A 3HTSB 1J75A 1YO5C 2V79A 2KKOA 5ILSA 2IA2A 5JHUA 3DTIA 3TOAA 3WG9A 2F4OB 2P81A 3H92A 2G7UA 1O3RA 1BW6A 3BTIA 4LITA 1QA6A 4XKVA 5H6RA 1P6RA 2HYJA 1OCPA 2CRGA 4ZDOA 2KJCA 2VBYA 3QQAA 4X0GA 5J8CA 1O3TA 1FSHA 3ZMUA 2LMDA 3DTKA 2MGQA 3CCSI 1ULYA 1MBFA 3L7WA 4GFBA 3C2HA 3E7LA 4RMNA 1RI7A 3BG5A 2EV6A 1IDYA 5JHFA 3TQNA 3ABTA 3RTRA 5ICEA 2ZJRF 2STTA 4BNCA 2GQQA 5J4VA 5F64A 1P2FA 1USSA 4H0EA 2ZO4A 3PQJA 2OPTA 5GAEJ 3TGNA 1Y0NA 1D8KA 2CQ7A 2WAQA 4DYQA 2XAHA 2IAIA 3HKZN 1MJBA 1I39A 1I1GA 4XLCA 2H6BA 3H9JA 3IRRA 4I98B 1BIBA 2KIQA 1UMQA 2HI3A 2ZXWH 2FE3A 2XGEA 1ZQ3P 3D0SA 3EQLF 1RRJA 5ED4A 2BHZA 3CCUI 2R7SA 1GV5A 2L5QA 5D5VB 2EFWA 1S7EA 3K4KA 2HPIA 4IQJA 4HOBA 2M9HA 3L09A 2PX9A 3M1CA 2FX0A 4RAZA 1I5ZA 3D5SC 1NG7A 3F8FA 4JQFA 1HXDA 1RC9A 3KIOA 4KIGA 3CUOA 2BY0A 3AG3H 2XGDA 1R23A 1V5GA 2XPWA 3F9KA 3I58A 3H9QA 4N0BA 4LGWA 1LUJB 2VKDA 4XM3A 4DQ2A 3JTGA 2CMPA 4HQEA 4FE4A 3MAJA 2P6SA 2R5ZB 3BJAA 3OY9A 3GZNB 2B9SA 2RN7A 2PQ8A 4MTEA 1FTZA 2JA7J 2AO9A 4HX7A 1I27A 2VJIA 2G0EA 1Z0XA 3HUGB 1IV8A 2VKVA 3GWZA 1VZ0A 5LEKA 4C2MJ 2COBA 4IRHA 3VOEA 1SAUA 4XLAA 1VQLI 2DFIA 3ZN0A 1DGWY 4JK1X 4CCMA 1QHHD 2XSDC 2Z5UA 2DA6A 3W6VA 4HLXA 3B6CA 2GXAA 4ITVA 2MSYA 3GFMA 3FIWA 2DOFA 2EIMH 3I64A 4I0AA 1DUXC 4RGSA 4ANJA 1OYWA 3CTAA 4LG0A 3J7AO 5CVUA 2XC7A 1OR7A 2DQLA 1G6NA 1YJNI 2QQ8A 2JPCA 5DV5A 4CHUA 3QOPA 3VSKA 4O3MA 3V8LA 2HXOA 5IYDJ 3P7NA 1ETYA 4G6QA 2RV8A 1V4RA 1IZ1A 2OCEA 3E6DA 5BS6A 2IGMA 3V8JA 4ZYEA 2VPLA 2LBFA 1K6OA 2BHYA 4E7IA 3WHBA 2RNJA 5LHIA 2JWTA 1T0FA 3CUQC 1MIJA 1H9TA 4EJTA 4OWRB 1Q1VA 5LLQA 2BY2A 1ODDA 2L01A 4IQ4A 3S3NA 4BQOA 5ILUA 2GAUA 4KJZA 3MVPA 4MHGA 2DTRA 2QQ9A 4YRVA 5GTIC 4CSWA 3C7JA 4Y13A 5E3OA 4U7BA 2Y31A 4HYEA 1D5VA 2R92J 3OS0A 5E3LA 5L3EA 3PO3J 3PL8A 2K27A 1LEAA 4EVIA 3QU6A 3GW2A 4DYRA 4U0WA 1ZGJA 3C2BA 3H0GJ 5LGNA 2E34A 1E3PA 2Y9YA 3DP7A 5HS9A 5FFZA 2IVMA 2E1CA 1F4KA 2WA0A 3BDDA 3DPUA 2V9PA 3KLNA 1VNDA 3K2AA 1MDMB 1TQPA 1LJ9A 1OLTA 1GXQA 2XDVA 1J59A 3F0CA 3M8EA 1JHHA 4I6ZA 3H3VK 1J2XA 5M3MJ 3WTSC 1WGXA 1T8IA 4FASD 1LVKA 3VSLA 1T33A 2NVXJ 2ZBKA 3K70D 3A1YA 5GADJ 1B72A 2Q2EA 4CCKA 3ZQGA 4E7ZA 2GLOA 3FXUA 4FT8A 2YU9J 2QYOA 2CW0F 3VWBA 5B3SH 1T56A 1HF0A 4A3GJ 5CVIA 4KIFA 3PFYA 3JR9A 4XLHA 2JUCA 4QTRA 1ACIA 4DYCA 1G4DA 2HDDA 3F8NA 4IRIA 3WTXC 3U21A 5GP9A 3BT9A 2BEOA 2JK3A 1JI8A 1S7AA 1R9TJ 3GTQJ 1R4NB 2O61A 1YI2I 2DMPA 2QUFA 5DYMA 2K86A 1ZLKA 3TOBA 3LAPA 3FKJA 1PP7U 1WJBA 3K4NA 1BA5A 4IHVA 1TNSA 2QQBA 2O3FA 3M7GA 4KIBA 1JT0A 4LK1F 2OJED 2F5CA 3K7AJ 5E8IA 1YFHA 2MYSA 4RS8A 4FCYA 3KE2A 2V1XA 3CCQI 2PJRA 2MC4A 2LREA 2O9LA 1KQ0A 3F6OA 4BUPA 2ETHA 1R1VA 2HTJA 1HDPA 4AU7A 5L3GA 3OWTA 4HDVA 4ETSA 2QZ8A 1F5TA 2JSPA 1R1TA 2X1EA 3DEEA 3K1NA 5IT9K 1LVAA 2FBKA 5GAGJ 1J7KA 3HOTA 2ID3A 2PMUA 1MH3A 3CCMI 4M6YA 4B3XA 4PJNA 2M0MA 1L0OC 1OMIA 2KFDA 2QCOA 3I59B 1XDUA 3S2DJ 4Y15A 1NK3P 1DU0A 3OMYA 5FLXK 1HOMA 1Z6TA 2E7XA 3WE3A 5L3FA 2ISYA 3ERED 5DCMB 4WWCA 2PMZN 4PJLA 2PJRB 2X6WA 1FPQA 3QODA 4OAZA 1ETXA 5E3NA 2DCEA 2X48A 3EUHC 4L18B 1FIPA 3N05A 3G73A 2CQKA 3HDDA 3T8TA 4BHPA 1UHMA 4LB6B 1IRZA 2Z16A 3UNGC 1FOXA 3IH3A 2D1VA 3RI4A 1XG1A 3IHUA 2GIVA 1LKXA 2X1CA 4UV9A 4ESFA 2IS2A 2NVUB 3CCLI 4M6VA 2WAQN 1O4XA 1E0EA 4BAYA 4CYCB 1HLVA 2ZC2A 4GGGA 3ZRGA 3A0HC 1TP4A 2VC1A 4MTDA 3ERMA 4ZYAA 1D0ZA 4N9IA 3HOUJ 2W00A 2IW5A 2R7FA 1G3TA 2XAUA 2YU3A 4RB3C 4MEXF 4GCVA 4BE1A 3WGHA 3NWSA 2WTEA 2BVLA 3H9GA 1TT0A 2CYYA 3LFUA 1XX5A 4KN7X 4JBAA 3G1MA 2PN6A 3DBRB 4RAFA 3J81K 1B9MA 1Z1DA 1GUUA 2ZJPF 4M74A 2MD0A 5CQEA 1UB9A 1TWGJ 4CICA 1AKHA 3WODF 3DV8A 1S3JA 4MFEA 1F43A 4JOMA 5HDNA 2KRCA 1SD4A 3GMEA 4DZPA 1WH5A 4HAMA 3SXYA 3K4LA 3K70C 2HDCA 3BWGA 3S1RJ 1PUEE 3ROUA 2EFOA 1ZRDA 4IOCF 3S17J 2JSCA 1S7OA 4YFNF 3OYAA 2AQEA 3E0JB 1XGMA 3T5XA 2Y69H 4V2GA 1X2NA 5DM7F 2CO5A 2TCTA 1TQMA 1IC8A 1H9GA 5KHDA 1N75A 1QO0D 1POGA 1X1AA 2H94A 4U87A 2CH0A 4NC8A 4AIKA 4L0ZB 3BR2A 1TWAJ 4FISA 4GDFA 4AIHA 3OS1A 2RQQA 1R5ID 1W4MA 4JYKA 2LFBA 2LSOA 1Z3YA 2OC6A 1RPWA 2MBFA 1AOYA 3KYCB 1FJLA 3AG1H 3AL0B 2X85A 3DWLE 3FXJA 2GOXB 5BMZA 3VFZA 1N78A 1QZEA 2GXGA 1SMYF 3EETA 3ZMDA 2P0WA 3KCCA 2VODA 4LLNA 4H4KC 2JT1A 3MN2A 1FX7A 2M5WA 4BEHA 3Q9SA 4NQWB 4R79A 2QVOA 2D2WA 1MMAA 4NBQA 3FXKA 4P96A 1TWHJ 2M45A 2OQRA 5EG0A 5D4RA 2X1DA 3J7AY 1IRGA 4WK8F 2VT3A 3L00A 2ECBA 3EPZA 4ON0A 2H1KA 2E60A 2ZKZA 3BPVA 4C9YA 2LY9A 4KUMA 2QQAA 5FJ8J 5H2FC 1U5TA 1KA8A 2EZKA 2FQ4A 3E6CC 3MQ0A 5ERIA 5K7ZA 2EQRA 2F4MB 5JLWA 4MIMA 2I5UA 3O8GA 3CLQA 3KEQA 1V5EA 3BCAA 2DDAA 2NS0A 2FF4A 3Q3SA 3L2QA 1Z7UA 3FM5A 3GLLA 1YS6A 4ZC3A 3RQIA 1ETWA 4HX8A 2LKSA 1MBHA 2GA1A 2W85A 3RKXA 4HNUA 4KT5C 2CUJA 2X0LA 3SHFA 1FT9A 2BV6A 2LY2A 3V8KA 1EKEA 2DPDA 4L0YB 4MFDA 3NWTA 4HV5A 1X19A 5E3MA 3HZJA 1KYWA 2FNAA 1ZRCA 4YFXF 5AIQA 4CYDA 3MZHA 2IS1A 4FE7A 4B1RA 2B0LA 3ESWB 4PSWA 3IRQA 3I3LA 3NAUA 2GM4A 2QSGX 1SVLA 1UELB 1U9NA 5HLHA 1DPUA 2GA2A 3BR6A 3ECOA 4HEA2 3IWZA 3OYGA 2OZUA 4XSXF 2DO7A 3GVAA 2VBXA 1X1PA 2FMYA 1WI9A 2KPMA 3PSIA 1W7PA 5DM6F 2IA1A 2R4GA 4D9JA 1TZLA 3DBLB 2QKLB 3H1CA 1W5TA 3KEOA 2F48A 3D5RC 2XPVA 3S14J 3ZXSA 1MSFC 3COAC 4M3FA 2KHMA 1MMNA 4FTHA 3HXLA 3PM1A 1V5FA 3BR0A 3F72A 1F1ZA 1ETOA 3A2KA 2PBIA 2KZVA 2QM3A 2DXIA 1DU6A 3DTEA 3ML6A 4PGHA 4JX4A 4EMSA 1OCOH 4IKFA 2CW7A 9ANTA 2QBYA 1J5YA 4RB1A 1U78A 1IF1A 2IA0A 2VIXA 3LSRA 4XOPA 1D0YA 3JSOA 4B09A 5GAHJ 4Z6YA 2LG4A 2M0CA 2EA4A 4M6XA 5JVTA 2L4MA 1Z6RA 2ELJA 4RLFA 3JSPA 1U8BA 4UHTA 3ZOBA 2Q0OA 2CQQA 4MO7A 1H8AC 1MBEA 1J9IA 4AVPA 1HKTA 1JUPA 2ESHA 4GYIA 3ISPA 1IXRC 2GBYA 5CYVA 1VQPI 4A5MA 1ZRFA 2PLYA 2W25A 3OYDA 3M4OJ 3BPXA 3KP7A 4PFOA 3SZGA 5LHGA 2DK8A 3F8CA 3M8FA
chains in the Genus database with same CATH topology
1RESA 2XGEA 1IG7A 1ZQ3P 2CUFA 2K9QA 3JRBA 5FKMA 1GV5A 1PUFB 1S7EA 4IHYA 1JKOC 2K9NA 2M9HA 3A03A 4A3IJ 3MKLA 3VPRA 2K40A 3PO2J 2FX0A 2IEKA 2NVTJ 2RAEA 2O7OA 4NDLA 2XGDA 3SDGA 1FIAA 1ETVA 2XPWA 2M34A 2R5YA 3JRDA 1BL0A 4MLOA 2DTZA 1RKWA 2NOGA 1FTTA 4FE4A 1H89C 3OOUA 1JGGA 2N8GA 2OF7A 3CMYA 2R5ZB 1FTZA 2LK2A 2JA7J 2AO9A 1IV6A 1XC5A 2G0EA 1Z0XA 2VKVA 1JTXA 1U9OA 1ZKGA 2DA5A 5M5XJ 2I10A 4X1EA 4BY1J 4C2MJ 2COBA 4A3FJ 2NVQJ 1ETKA 2YS9A 3LNQA 2XSDC 4XICA 2CQXA 5C4XJ 3BQYA 2DA6A 3W6VA 5FKNA 3B6CA 1QPIA 3IH2A 2MSYA 3FIWA 4CYCA 5EG0B 2VI6A 3BTJA 2WV1A 2W48A 3Q0VA 3HOXJ 5EZHA 3S16J 4XRSG 4M3EA 4XRMA 2LKXA 5BNGA 1WCMJ 2L7ZA 1VF9A 3BR3A 4V2FA 3LSPA 3GTKJ 2HXOA 5IYDJ 3ZQFA 5EZGA 1ETYA 4IEJA 2NS8A 4JX5A 1G2HA 1YRNA 5J3LA 1MBJA 3WHBA 2XRLA 4BKXA 2LVSA 2JWTA 3FK6A 4I76A 1Q1VA 3JRGA 1LFUP 2DA7A 2ME0A 2ELKA 2E1OA 1AU7A 4L5EA 2MW8A 4IHWA 2IBDA 3MVPA 4A3LJ 1Y1WJ 2H8RA 4A3BJ 4A93J 5JLXA 4S0HB 3HB9A 2DA3A 3G1LA 2JA5J 5E3OA 5EGOB 2Y31A 2EZLA 1JT6A 2R92J 5F27A 2DMNA 5E3LA 3PO3J 2LD5A 1ENHA 3JRAA 2M2EA 4DYRA 1ITYA 4AUXA 3C2BA 3H0GJ 3ZQHA 4XRSA 3OIOA 2Y9YA 5FLVA 5IYCJ 4BXXJ 3JREA 3HOVJ 4A3KJ 1VNDA 2ID6A 2KDZA 4J19A 3K2AA 1W0UA 2DMTA 3F0CA 2NVYJ 4I6ZA 3OSGA 3H3VK 3G1OA 5IYBJ 1UG2A 5M3MJ 1WGXA 1T33A 2NVXJ 1JKQC 1ORKA 1B72A 3RKQA 4DZJA 3M3YJ 3ZQGA 2GLOA 2YU9J 2JA6J 3HOWJ 5FLMJ 1T56A 1HF0A 4A3GJ 5IOYA 1TWCJ 4D7MA 3JR9A 3IV5A 4QTRA 4DYCA 3A01A 2D5VA 2HDDA 1SANA 5GP9A 3BT9A 3QPLA 4HNVA 2JK3A 1R9TJ 1A6IA 1ZGWA 3GTQJ 4B4CA 1IGNA 3I4NJ 2CU7A 3HGGA 2DMPA 3TP0A 3DCFA 2EH3A 2O8KA 1QVUA 2DJNA 1BA5A 4IHVA 2EZHA 2JMWA 2JJ7A 4RDUA 1JT0A 3CCYA 2L7FP 2DA1A 3K7AJ 2Y9ZA 3BG9A 4FCYA 1VFCA 2L0KA 3HM5A 4AC0A 1NK2P 4BY7J 2O9LA 1WI3A 2XB5A 4A3DJ 3HOZJ 3NARA 1HDPA 3GTMJ 5J1RA 1RETA 3O8HA 1I50J 1APLC 2E2JJ 1RKTA 1LE8A 2HOSA 3TEDA 2LTPA 2ID3A 3BQZA 1GT0C 1MH3A 3TP3A 2L9RA 4M3DA 1OFCX 2X9DA 4ABZA 5C3EJ 2R5YB 2EBIA 4W1UA 2K9SA 2L7MP 2QCOA 4A69C 3S2DJ 2R0QC 1WPKA 2FJ1A 1NK3P 1DU0A 1HOMA 1QRYA 4BBRJ 2PMZN 4A3JJ 5F0FA 1MH4A 4Y7NJ 2B63J 1ETXA 1HCRA 5E3NA 1LFBA 2X48A 4BBSJ 1FIPA 4M3GA 2XGCA 3QPSA 3UKGA 1MBGA 3JRHA 3HDDA 1K83J 1OCTC 5EEAA 5HODA 4AYBN 1GDTA 1IRZA 3IH3A 3S1MJ 3I4MJ 4X6AJ 1XG1A 3FKIJ 1SFOJ 1K61A 4M6VA 2WAQN 1O4XA 3GTPJ 3SFIA 4CYCB 1HLVA 5IPAA 4JP0A 3HOUJ 3Q0WA 5EYRA 1TC3C 5IP6A 5F08A 5FKKA 2EZIA 5GPAA 5M3FJ 4Y52J 3G1MA 1A5JA 4M3BA 1GUUA 1P7JA 3LSGA 1AKHA 1TWGJ 2YUSA 4D5CA 1ETQA 1YRNB 2ECCA 4MFEA 1F43A 1F36A 1W0TA 3HGYA 4DW6A 5M5WJ 3BR5A 4DZPA 1WH5A 3D1NI 3OSFA 2ZB9A 3S1RJ 1JUSA 3JRFA 3RZOJ 1MBKA 2DMUA 3ZQLA 1PUFA 3S17J 1GV2A 3Q0UA 5EDNA 4JX6A 1TWFJ 3HOYJ 4V2GA 2LP0A 2X6OA 1X2NA 3BG3A 5IOZA 3BTCA 1ZR4A 5J1YA 4B3AA 5C4JJ 2TCTA 3FISA 2MG4A 1IC8A 1IJWC 3GTJJ 3CDLA 1OJLA 1POGA 1I3QJ 4RBOA 4C3JJ 3A02A 1TWAJ 3BR2A 4FISA 5F0CA 3TW7A 1BJZA 4D5FA 5EF6A 3L1PA 2JA8J 5GPCA 5J1UA 4JYKA 2R5ZA 2LFBA 4A3EJ 1JKRC 1FEXA 2XPUA 3BTLA 1RPWA 3ZQIA 1FJLA 2HOTA 2TRTA 1JJ6C 1JJ8C 4IHXA 4UUTA 2DN0A 4C3IJ 2KT0A 3S2HJ 2WB1N 2VUMJ 1ZR2A 1RR7A 3MN2A 3IH4A 3GTGJ 1Z77A 1D5YA 1B72B 4A3CJ 3DEWA 3TW6A 3WHCA 4QIWN 1CQTA 1TWHJ 1EF4A 5EG0A 2XB0X 1P7IA 2LLKA 2NS7A 2FD5A 2E2IJ 2ECBA 5DTDA 1X2MA 2H1KA 3SJMA 2Y30A 5F0HA 2LY9A 3BR1A 4C3HJ 5FJ8J 3A01B 4LOCA 2EZKA 2FQ4A 1Y1VJ 5K7ZA 2EQRA 3RZDJ 3LOCA 5JLWA 4MIMA 3O8GA 3Q3SA 4UUSA 3B6AA 1B8IA 2VKEA 3RQIA 1ETWA 2AHQA 1MBHA 5F1JA 1BW5A 1MNMC 3HEFA 4XIDA 1E3OC 4MFDA 5E3MA 4QSHA 3HBLA 2HXIA 2JN6A 1HDDC 1IUFA 1JTYA 5K7HA 4FE7A 4B1RA 5DS9A 5EGOA 3NAUA 4A3MJ 3GBGA 2GM4A 1MSEC 3GTLJ 1JKPC 1U9NA 1AHDP 3BR6A 1LE8B 1ZK8A 1VI0A 1WH7A 2Y2ZA 2VPRA 3JRIA 3JRCA 1GVDA 2CUEA 4G12A 3S1QJ 2QF7A 2R93J 1IDZA 4UUSB 1ZTRA 2DA4A 3LSJA 1B8IB 1I6HJ 2Y0SN 2DMQA 3CQZJ 2XPVA 3S14J 2DA2A 2HQ5A 4XK4A 1MSFC 3FK7A 4M3FA 5K7FA 4FTHA 1XS9A 1H88C 3PM1A 3BR0A 1JUMA 2P81A 5FKOA 1BW6A 3BTIA 1ETOA 2ME6A 1DU6A 5FKLA 2HYJA 4EEFG 1OCPA 2CRGA 2CJJA 4JX4A 3QQAA 5IP9J 9ANTA 1NTCA 4W97A 5M5YJ 2LR8A 3S1NJ 1U78A 2MGQA 1MBFA 2HOAA 4GFBA 3LSRA 3E7LA 2R7ZJ 3BG5A 2M0CA 3ZQCA 1IDYA 1X58A 4D7NA 2E2HJ 3GTOJ 1UHSA 5C44J 1U8BA 3S15J 3ZOBA 2CQQA 4MO7A 2OPTA 1H8AC 2M8GX 1MBEA 4DYQA 1JUPA 5F04A 3HKZN 2IAIA 2GBYA 1AKHB 3M4OJ 1QVTA 1UMQA 2HI3A 5IP7J 2E19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RES A;  2XGE A;  1IG7 A;  1ZQ3 P;  2CUF A;  2K9Q A;  3JRB A;  5FKM A;  1GV5 A;  1PUF B;  1S7E A;  4IHY A;  1JKO C;  2K9N A;  2M9H A;  3A03 A;  4A3I J;  3MKL A;  3VPR A;  2K40 A;  3PO2 J;  2FX0 A;  2IEK A;  2NVT J;  2RAE A;  2O7O A;  4NDL A;  2XGD A;  3SDG A;  1FIA A;  1ETV A;  2XPW A;  2M34 A;  2R5Y A;  3JRD A;  1BL0 A;  4MLO A;  2DTZ A;  1RKW A;  2NOG A;  1FTT A;  4FE4 A;  1H89 C;  3OOU A;  1JGG A;  2N8G A;  2OF7 A;  3CMY A;  2R5Z B;  1FTZ A;  2LK2 A;  2JA7 J;  2AO9 A;  1IV6 A;  1XC5 A;  2G0E A;  1Z0X A;  2VKV A;  1JTX A;  1U9O A;  1ZKG A;  2DA5 A;  5M5X J;  2I10 A;  4X1E A;  4BY1 J;  4C2M J;  2COB A;  4A3F J;  2NVQ J;  1ETK A;  2YS9 A;  3LNQ A;  2XSD C;  4XIC A;  2CQX A;  5C4X J;  3BQY A;  2DA6 A;  3W6V A;  5FKN A;  3B6C A;  1QPI A;  3IH2 A;  2MSY A;  3FIW A;  4CYC A;  5EG0 B;  2VI6 A;  3BTJ A;  2WV1 A;  2W48 A;  3Q0V A;  3HOX J;  5EZH A;  3S16 J;  4XRS G;  4M3E A;  4XRM A;  2LKX A;  5BNG A;  1WCM J;  2L7Z A;  1VF9 A;  3BR3 A;  4V2F A;  3LSP A;  3GTK J;  2HXO A;  5IYD J;  3ZQF A;  5EZG A;  1ETY A;  4IEJ A;  2NS8 A;  4JX5 A;  1G2H A;  1YRN A;  5J3L A;  1MBJ A;  3WHB A;  2XRL A;  4BKX A;  2LVS A;  2JWT A;  3FK6 A;  4I76 A;  1Q1V A;  3JRG A;  1LFU P;  2DA7 A;  2ME0 A;  2ELK A;  2E1O A;  1AU7 A;  4L5E A;  2MW8 A;  4IHW A;  2IBD A;  3MVP A;  4A3L J;  1Y1W J;  2H8R A;  4A3B J;  4A93 J;  5JLX A;  4S0H B;  3HB9 A;  2DA3 A;  3G1L A;  2JA5 J;  5E3O A;  5EGO B;  2Y31 A;  2EZL A;  1JT6 A;  2R92 J;  5F27 A;  2DMN A;  5E3L A;  3PO3 J;  2LD5 A;  1ENH A;  3JRA A;  2M2E A;  4DYR A;  1ITY A;  4AUX A;  3C2B A;  3H0G J;  3ZQH A;  4XRS A;  3OIO A;  2Y9Y A;  5FLV A;  5IYC J;  4BXX J;  3JRE A;  3HOV J;  4A3K J;  1VND A;  2ID6 A;  2KDZ A;  4J19 A;  3K2A A;  1W0U A;  2DMT A;  3F0C A;  2NVY J;  4I6Z A;  3OSG A;  3H3V K;  3G1O A;  5IYB J;  1UG2 A;  5M3M J;  1WGX A;  1T33 A;  2NVX J;  1JKQ C;  1ORK A;  1B72 A;  3RKQ A;  4DZJ A;  3M3Y J;  3ZQG A;  2GLO A;  2YU9 J;  2JA6 J;  3HOW J;  5FLM J;  1T56 A;  1HF0 A;  4A3G J;  5IOY A;  1TWC J;  4D7M A;  3JR9 A;  3IV5 A;  4QTR A;  4DYC A;  3A01 A;  2D5V A;  2HDD A;  1SAN A;  5GP9 A;  3BT9 A;  3QPL A;  4HNV A;  2JK3 A;  1R9T J;  1A6I A;  1ZGW A;  3GTQ J;  4B4C A;  1IGN A;  3I4N J;  2CU7 A;  3HGG A;  2DMP A;  3TP0 A;  3DCF A;  2EH3 A;  2O8K A;  1QVU A;  2DJN A;  1BA5 A;  4IHV A;  2EZH A;  2JMW A;  2JJ7 A;  4RDU A;  1JT0 A;  3CCY A;  2L7F P;  2DA1 A;  3K7A J;  2Y9Z A;  3BG9 A;  4FCY A;  1VFC A;  2L0K A;  3HM5 A;  4AC0 A;  1NK2 P;  4BY7 J;  2O9L A;  1WI3 A;  2XB5 A;  4A3D J;  3HOZ J;  3NAR A;  1HDP A;  3GTM J;  5J1R A;  1RET A;  3O8H A;  1I50 J;  1APL C;  2E2J J;  1RKT A;  1LE8 A;  2HOS A;  3TED A;  2LTP A;  2ID3 A;  3BQZ A;  1GT0 C;  1MH3 A;  3TP3 A;  2L9R A;  4M3D A;  1OFC X;  2X9D A;  4ABZ A;  5C3E J;  2R5Y B;  2EBI A;  4W1U A;  2K9S A;  2L7M P;  2QCO A;  4A69 C;  3S2D J;  2R0Q C;  1WPK A;  2FJ1 A;  1NK3 P;  1DU0 A;  1HOM A;  1QRY A;  4BBR J;  2PMZ N;  4A3J J;  5F0F A;  1MH4 A;  4Y7N J;  2B63 J;  1ETX A;  1HCR A;  5E3N A;  1LFB A;  2X48 A;  4BBS J;  1FIP A;  4M3G A;  2XGC A;  3QPS A;  3UKG A;  1MBG A;  3JRH A;  3HDD A;  1K83 J;  1OCT C;  5EEA A;  5HOD A;  4AYB N;  1GDT A;  1IRZ A;  3IH3 A;  3S1M J;  3I4M J;  4X6A J;  1XG1 A;  3FKI J;  1SFO J;  1K61 A;  4M6V A;  2WAQ N;  1O4X A;  3GTP J;  3SFI A;  4CYC B;  1HLV A;  5IPA A;  4JP0 A;  3HOU J;  3Q0W A;  5EYR A;  1TC3 C;  5IP6 A;  5F08 A;  5FKK A;  2EZI A;  5GPA A;  5M3F J;  4Y52 J;  3G1M A;  1A5J A;  4M3B A;  1GUU A;  1P7J A;  3LSG A;  1AKH A;  1TWG J;  2YUS A;  4D5C A;  1ETQ A;  1YRN B;  2ECC A;  4MFE A;  1F43 A;  1F36 A;  1W0T A;  3HGY A;  4DW6 A;  5M5W J;  3BR5 A;  4DZP A;  1WH5 A;  3D1N I;  3OSF A;  2ZB9 A;  3S1R J;  1JUS A;  3JRF A;  3RZO J;  1MBK A;  2DMU A;  3ZQL A;  1PUF A;  3S17 J;  1GV2 A;  3Q0U A;  5EDN A;  4JX6 A;  1TWF J;  3HOY J;  4V2G A;  2LP0 A;  2X6O A;  1X2N A;  3BG3 A;  5IOZ A;  3BTC A;  1ZR4 A;  5J1Y A;  4B3A A;  5C4J J;  2TCT A;  3FIS A;  2MG4 A;  1IC8 A;  1IJW C;  3GTJ J;  3CDL A;  1OJL A;  1POG A;  1I3Q J;  4RBO A;  4C3J J;  3A02 A;  1TWA J;  3BR2 A;  4FIS A;  5F0C A;  3TW7 A;  1BJZ A;  4D5F A;  5EF6 A;  3L1P A;  2JA8 J;  5GPC A;  5J1U A;  4JYK A;  2R5Z A;  2LFB A;  4A3E J;  1JKR C;  1FEX A;  2XPU A;  3BTL A;  1RPW A;  3ZQI A;  1FJL A;  2HOT A;  2TRT A;  1JJ6 C;  1JJ8 C;  4IHX A;  4UUT A;  2DN0 A;  4C3I J;  2KT0 A;  3S2H J;  2WB1 N;  2VUM J;  1ZR2 A;  1RR7 A;  3MN2 A;  3IH4 A;  3GTG J;  1Z77 A;  1D5Y A;  1B72 B;  4A3C J;  3DEW A;  3TW6 A;  3WHC A;  4QIW N;  1CQT A;  1TWH J;  1EF4 A;  5EG0 A;  2XB0 X;  1P7I A;  2LLK A;  2NS7 A;  2FD5 A;  2E2I J;  2ECB A;  5DTD A;  1X2M A;  2H1K A;  3SJM A;  2Y30 A;  5F0H A;  2LY9 A;  3BR1 A;  4C3H J;  5FJ8 J;  3A01 B;  4LOC A;  2EZK A;  2FQ4 A;  1Y1V J;  5K7Z A;  2EQR A;  3RZD J;  3LOC A;  5JLW A;  4MIM A;  3O8G A;  3Q3S A;  4UUS A;  3B6A A;  1B8I A;  2VKE A;  3RQI A;  1ETW A;  2AHQ A;  1MBH A;  5F1J A;  1BW5 A;  1MNM C;  3HEF A;  4XID A;  1E3O C;  4MFD A;  5E3M A;  4QSH A;  3HBL A;  2HXI A;  2JN6 A;  1HDD C;  1IUF A;  1JTY A;  5K7H A;  4FE7 A;  4B1R A;  5DS9 A;  5EGO A;  3NAU A;  4A3M J;  3GBG A;  2GM4 A;  1MSE C;  3GTL J;  1JKP C;  1U9N A;  1AHD P;  3BR6 A;  1LE8 B;  1ZK8 A;  1VI0 A;  1WH7 A;  2Y2Z A;  2VPR A;  3JRI A;  3JRC A;  1GVD A;  2CUE A;  4G12 A;  3S1Q J;  2QF7 A;  2R93 J;  1IDZ A;  4UUS B;  1ZTR A;  2DA4 A;  3LSJ A;  1B8I B;  1I6H J;  2Y0S N;  2DMQ A;  3CQZ J;  2XPV A;  3S14 J;  2DA2 A;  2HQ5 A;  4XK4 A;  1MSF C;  3FK7 A;  4M3F A;  5K7F A;  4FTH A;  1XS9 A;  1H88 C;  3PM1 A;  3BR0 A;  1JUM A;  2P81 A;  5FKO A;  1BW6 A;  3BTI A;  1ETO A;  2ME6 A;  1DU6 A;  5FKL A;  2HYJ A;  4EEF G;  1OCP A;  2CRG A;  2CJJ A;  4JX4 A;  3QQA A;  5IP9 J;  9ANT A;  1NTC A;  4W97 A;  5M5Y J;  2LR8 A;  3S1N J;  1U78 A;  2MGQ A;  1MBF A;  2HOA A;  4GFB A;  3LSR A;  3E7L A;  2R7Z J;  3BG5 A;  2M0C A;  3ZQC A;  1IDY A;  1X58 A;  4D7N A;  2E2H J;  3GTO J;  1UHS A;  5C44 J;  1U8B A;  3S15 J;  3ZOB A;  2CQQ A;  4MO7 A;  2OPT A;  1H8A C;  2M8G X;  1MBE A;  4DYQ A;  1JUP A;  5F04 A;  3HKZ N;  2IAI A;  2GBY A;  1AKH B;  3M4O J;  1QVT A;  1UMQ A;  2HI3 A;  5IP7 J;  2E19 A; 
#chains in the Genus database with same CATH topology
 1RES A;  1XSD A;  1KU7 A;  3BG6 A;  2IS4 A;  5EEH A;  4G7O F;  3H5A A;  2OZ6 A;  3JRB A;  1GLN A;  2YX7 A;  4EAT A;  3ABU A;  6PAX A;  3VYT B;  4XON A;  4IHY A;  3AL0 C;  4XNF A;  2DJI A;  2CG4 A;  3AFH A;  4L5J A;  2KIS A;  1XSX A;  3A03 A;  1OYI A;  2IEK A;  4ZDL A;  1P4A A;  2RAE A;  5E18 F;  4WX9 A;  2PFB A;  2Y0M A;  2O7O A;  4I2O A;  4NDL A;  4MNU A;  1FIA A;  1ETV A;  2M34 A;  3ZMS A;  3H36 A;  3JRD A;  4I01 A;  4U0V A;  1BL0 A;  4UY8 I;  3KX2 A;  2NOG A;  2XAF A;  1XB4 A;  2BW3 B;  5FRN A;  2Z99 A;  1EJ9 A;  3RQ4 A;  3K4J A;  3RJP A;  2LK2 A;  2DBB A;  2Z33 A;  1IV6 A;  1RUN A;  2NXN B;  4B44 A;  4LJZ F;  2EB7 A;  2EPF A;  1U9O A;  1ZKG A;  4X1E A;  4BY1 J;  2K3P A;  1HW5 A;  4A0Y A;  2L7K A;  2VQH A;  5L3D A;  1XMK A;  5D4S A;  1XGN A;  2K02 A;  1ETK A;  2YS9 A;  3KP6 A;  3LNQ A;  4XIC A;  2CQX A;  3OV8 A;  3BQY A;  5C4X J;  1QPI A;  2A69 F;  4EGY A;  2D45 A;  2R7W A;  1Y8Q B;  3GCM A;  2FBH A;  2VI6 A;  3BTJ A;  2KRF A;  2XAG A;  2ZFU A;  4ZYG A;  3Q0V A;  4DIQ A;  2WB1 A;  1J0R A;  4XRS G;  4RA2 A;  2HTS A;  4M3E A;  4XRM A;  3J80 K;  3JAM K;  1T95 A;  1WCM J;  2L7Z A;  4V2F A;  5CPR B;  4CDG A;  4OMZ A;  2DT6 A;  1JGS A;  1FOW A;  3J7Y J;  3TDU C;  2NS8 A;  3I54 A;  1G2H A;  3CC4 I;  4HBL A;  1O7F A;  1MBJ A;  4HX4 A;  2XRL A;  4L9V A;  2DFF A;  1BR2 A;  2LVS A;  4M73 A;  3FK6 A;  4Q5S F;  3ZN1 A;  4EM0 B;  4CUG A;  4IHS A;  1Z7L A;  4HSR A;  1Z91 A;  4EJV A;  2FU4 A;  3PIP F;  2ELK A;  5DD4 A;  4O6J A;  1AU7 A;  4L5E A;  3ULQ B;  5B5E C;  2ZCW A;  4QPO A;  2H8R A;  4A93 J;  2DA3 A;  3QU3 A;  3DKW A;  2JA5 J;  5K1Y A;  2FOK A;  2QGU A;  3V42 A;  3S32 A;  4IVN A;  4ENK A;  2XF5 A;  3AG2 H;  3LFK A;  3CDH A;  2COM A;  1HKS A;  4XR6 A;  1P92 A;  2PMZ A;  1ITY A;  1SD5 A;  4MGR A;  3A0B C;  3ZQH A;  4XRS A;  2DK5 A;  2J5P A;  4A5N A;  1YJ9 I;  2GXB A;  1WRJ A;  2VKH A;  2P7C B;  1XGO A;  5FLV A;  1WZ2 A;  2DLL A;  3JRE A;  2FQ3 A;  2V1D A;  4G9Y A;  1VQ9 I;  1UHW A;  2GOM A;  1R00 A;  2L02 A;  4NNJ A;  3DKX A;  1W0U A;  1IXC A;  2DMT A;  1S5L C;  3BY6 A;  2PMH A;  3OSG A;  4BJT A;  2JPB A;  3MZ8 A;  4BJ5 C;  3HL2 A;  4G6T B;  1ORK A;  3RKQ A;  2KMU A;  4DZJ A;  1SFE A;  4RGX A;  5BPI A;  4A0Z A;  2V1N A;  4A6E A;  2QLZ A;  3U9G A;  5FLM J;  3RDI A;  4UB6 C;  5D6F A;  5IOY A;  4LIV A;  2UXX A;  3BP8 A;  2EIJ H;  1NH3 A;  3IWF A;  3QRF F;  2JRM A;  3OYM A;  3A01 A;  3BRO A;  3CES A;  2VE9 A;  3P9I A;  2D5V A;  1SAN A;  4PFP A;  3W3C A;  4OIN F;  2HEO A;  4HNV A;  5ICC A;  1G3W A;  1WVR A;  3HTU A;  2FBI A;  1TT5 B;  2FNP A;  4B4C A;  1OCC H;  2J5O A;  3I4N J;  3RPQ A;  1C0W A;  4RAY A;  4S05 A;  4IHT A;  2DI3 A;  4YII A;  3QAH A;  1CF7 A;  2O8K A;  1QVU A;  5F1R A;  4Z2Y A;  2EZH A;  2VOO A;  2KIU A;  2CFO A;  2Q1Z B;  1W36 C;  1S8N A;  3IP4 B;  4II3 A;  2P5K A;  2L7F P;  3BG9 A;  5IT3 A;  1VFC A;  4HLY A;  2FRH A;  3HM5 A;  4AC0 A;  1NK2 P;  5HLT A;  1ZG3 A;  5HNH A;  2XB5 A;  3NRV A;  4IZZ A;  4A3D J;  2IJL A;  4B43 A;  4HW0 A;  5D8K B;  5FRM A;  1SVO A;  3D5L A;  3FXR A;  4F55 A;  4BAC A;  3GTM J;  1L3L A;  4G8X A;  4PUS A;  3O8H A;  1ZHF A;  2OD5 A;  2F5F A;  2G7H A;  2XKP A;  3I71 A;  1Y39 A;  2R7R A;  1WJD A;  2HOS A;  3A4C A;  1LE8 A;  2E1N A;  4AD9 A;  2VBZ A;  1VTN C;  3FXM A;  2R7D A;  1U3E M;  2LTP A;  2JZY A;  1VQ6 I;  3HPG A;  5HOO A;  3SDB A;  2HVS A;  1X3W B;  2EBI A;  4QLC U;  4W1U A;  2K9S A;  2V1U A;  3MKY B;  1WPK A;  5KK1 A;  2HNH A;  2QEN A;  2R7X A;  1R71 A;  1QRY A;  2ICW G;  4BBR J;  4XLP F;  2AXL A;  1HCR A;  2PI0 A;  1ERD A;  4BBS J;  3RYR A;  2XGC A;  4PJJ A;  3L2U A;  3JRH A;  1IRF A;  3UKG A;  3U2R A;  2HS5 A;  4M9X A;  4HF1 A;  3S1M J;  3R6S A;  3HSR A;  3I4M J;  3B73 A;  1SFO J;  1ONV A;  1K61 A;  3L2W A;  3OL4 A;  4M9Z A;  1FOK A;  3PUF A;  3W6J B;  1QQI A;  4HNT A;  1I6X A;  4LG0 B;  5EYR A;  2VJJ A;  4XN3 A;  1KU2 A;  1TC3 C;  5IP6 A;  2XRN A;  4ESB A;  1X1C A;  2EZI A;  1R5H A;  3F23 A;  4Y52 J;  5HLI A;  2OV7 A;  2KQR A;  2W84 A;  2LYC A;  2WV0 A;  2YUS A;  2F6C A;  1FBQ A;  4D5C A;  2LBF B;  1F36 A;  1NG6 A;  3B02 A;  1W0T A;  4DW6 A;  1PDN C;  3BR5 A;  1FOY A;  3OSF A;  1DQU A;  3CP2 A;  2TDX A;  2FEZ A;  2RNG A;  4II2 A;  3JRF A;  1MBK A;  3ZQL A;  3MZY A;  1PUF A;  5EEG A;  1GV2 A;  3KZI C;  2VON A;  3HOY J;  1KQ9 A;  2X6O A;  4UXN A;  4OOI A;  3BTC A;  4BL0 B;  5J1Y A;  4B3A A;  5C4J J;  3FIS A;  2MG4 A;  1SAX A;  3ONQ A;  4G6D A;  4UB8 C;  3CDL A;  1A36 A;  2DPU A;  3C2G A;  1SMT A;  3HRU A;  2XVC A;  1Z05 A;  5F0C A;  1IN7 A;  3HHG A;  3SZP A;  5K5O A;  3UR3 C;  1BJZ A;  3SEZ A;  3L1P A;  3OYL A;  3NEU A;  3LA7 A;  1S6L A;  1O7L A;  1EV7 A;  3CCV I;  4A3E J;  3FMS A;  3DFG A;  2M4G A;  1SFU A;  3BTL A;  1TTY A;  1BC8 C;  1FNN A;  2TRT A;  2A5W A;  4UUT A;  4HG2 A;  4RB2 C;  4XOT A;  3FBN B;  1HSJ A;  5CVV A;  2WB1 N;  2VUM J;  5KVR A;  4QPQ A;  1TL8 A;  2O0Y A;  4Q4Z F;  1HA8 A;  1Z77 A;  4RM3 A;  3OYN A;  3DU5 A;  5J4Y A;  1X1B A;  1B72 B;  4A3C J;  2Q2E B;  2UUZ A;  3TW6 A;  1K79 A;  3ECH A;  5B66 C;  2XB0 X;  2ZJQ F;  2NS7 A;  5L3B A;  3ABL H;  3PNV A;  3WU2 C;  4A12 A;  3MKW B;  3H0D A;  2BY3 A;  3RSN A;  5FD6 A;  2Y30 A;  3SYT A;  2DOD A;  1KZH A;  3BOQ A;  3V7S A;  3EUA A;  3WTW C;  1J09 A;  1A31 A;  4HDU A;  1YX5 A;  3RZD J;  3AG4 H;  3QP5 A;  3QYE A;  3HPH A;  1K78 A;  2O6G E;  2M8E A;  4FHT A;  4XKB A;  2ZME A;  3CMM A;  2WY7 Q;  4BE2 A;  3OYJ A;  2VKE A;  1JXS A;  2AHQ A;  2MC3 A;  1MMG A;  1YW7 A;  1BW5 A;  4OMY A;  1MNM C;  4U7D A;  3ZMV A;  2HDW A;  2CUZ A;  2M3A A;  4F92 B;  1E3O C;  3DLL F;  4ZDP A;  4QSH A;  5FRO A;  3MEX A;  2ZFW A;  3KFW X;  1JTY A;  3S3M A;  3TO6 A;  1OCZ H;  1WJC A;  1WJ5 A;  4IJA A;  1OPC A;  3IAM 2;  4GRI A;  5EGO A;  3P9C A;  3GTL J;  1MSE C;  1SD7 A;  1R49 A;  4XOR A;  5LRS A;  1AHD P;  2FA5 A;  4XBF A;  1ZAO A;  4Y4R A;  1WJA A;  4IOA F;  1WH7 A;  2IGN A;  4E7H A;  3JRC A;  2OA4 A;  2VT2 A;  1P9Q C;  4DBR A;  2XUB A;  1K6Y A;  2VJ4 A;  5J47 A;  2ELH A;  1IN6 A;  2EV5 A;  3LSI A;  3RPU D;  2Y0S N;  3CCE I;  3L2C A;  3CQZ J;  3CJT B;  4LG3 A;  3HIF A;  4XK4 A;  4EJU A;  2Z9O A;  3DU6 A;  1JE8 A;  2L3D A;  1OR7 C;  1H88 C;  1T2K A;  4HF0 A;  4BXU A;  1JUM A;  5FKO A;  4Y17 A;  3U1D A;  2K4J A;  2HQR A;  4Y33 A;  4RM2 A;  3MFK A;  4EEF G;  3ABM H;  3HOS A;  5IP9 J;  1O57 A;  2H09 A;  2LR8 A;  4XLN F;  2QSF X;  3FMR A;  3WTV C;  2A6T A;  1T0F C;  2MD5 A;  2R7Z J;  4KIT B;  4F7Z A;  3ZQC A;  1X58 A;  2MA3 A;  4D7N A;  2E2H J;  5BOX A;  1EA3 A;  2VQL A;  3AAF A;  1TQI A;  1YS7 A;  2HQN A;  4NB5 A;  5C44 J;  3MWM A;  1WFX A;  1UJ8 A;  3CF5 F;  3OYK A;  4XLE A;  4GYG A;  3VYU B;  4XN0 A;  2IPQ X;  4UVB A;  3O3K A;  5L3C A;  1E3H A;  2M8G X;  5E17 F;  4RLQ A;  2HYF A;  4IPA A;  1AKH B;  5DCF A;  3Q5F A;  3P5J A;  2A3S A;  1BI0 A;  2R7Q A;  1QVT A;  1ZEL A;  1EH7 A;  3HRT A;  1HC8 A;  1YHQ I;  1IG7 A;  2O03 A;  5CKT A;  3KYL A;  2Q8K A;  2CUF A;  2LF8 A;  1LNW A;  1PJR A;  5FKM A;  4PJ0 C;  4ESJ A;  5J6X A;  1QBJ A;  4CZC A;  2K9N A;  1UCR A;  4A3I J;  5AON A;  1G59 A;  3VPR A;  3CJQ B;  1FMW A;  2NVT J;  1T39 A;  3W2W A;  1BR1 A;  4EJW A;  4NC6 A;  4Y3O A;  3G6E I;  3SDG A;  1YG2 A;  1FYM A;  2R5Y A;  1BR4 A;  1F9N A;  3SFZ A;  3C3W A;  2XHK A;  4MLO A;  2DTZ A;  1RKW A;  2DT5 A;  3S3O A;  1IUY A;  1H89 C;  3OOU A;  1JGG A;  3LSH A;  2CV1 A;  1LDD A;  4EJO A;  3TO9 A;  3IAS 2;  1R1U A;  4UVC A;  4OU0 A;  1I1S A;  1LFP A;  3DF8 A;  1JTX A;  4LLG F;  2DA5 A;  3KZZ A;  5M5X J;  1MW7 A;  5E8G A;  4ZH4 F;  5D5W B;  2K4B A;  3KP4 A;  4BEH B;  1YIJ I;  1OCR H;  2FOW A;  2H8W A;  1LDJ A;  5E20 A;  1REP C;  2EFQ A;  5EG0 B;  2LKP A;  4PZJ A;  1STZ A;  2DFH A;  1QZZ A;  2W48 A;  3HOX J;  4IO9 F;  3ZMZ A;  3S16 J;  2KP6 A;  4AID A;  2GWR A;  5BNG A;  1OQY A;  3KZY A;  5E1Z B;  4E70 A;  1U5T B;  1Y8R B;  2F4I A;  1MGT A;  4BQQ A;  3LSP A;  3KP3 A;  3GZ5 A;  4LLL A;  4EM2 A;  5K5Q A;  4IEJ A;  2ZJ2 A;  3I9V 2;  3LQQ A;  4BE0 A;  3K9T A;  2YSR A;  3LAJ A;  1YRN A;  4BKX A;  3WG7 H;  5D5X B;  4NC7 A;  4I76 A;  3KYD B;  1OYY A;  4AWX B;  2HGC A;  1QU3 A;  3JRG A;  3EYI A;  3QP6 A;  3WTZ A;  1LFU P;  2DA7 A;  1MMS A;  2ME0 A;  1VQN I;  3RKW A;  1S29 A;  1FP1 D;  3E1S A;  1XMX A;  3PSF A;  2JVH A;  2IBD A;  1R5G A;  4DGW B;  2FXA A;  2LRD A;  5ICG A;  4A3L J;  1W5C C;  3FM3 A;  4TV7 A;  1Y1W J;  2VXD A;  1QHG A;  1MNE A;  2YX4 A;  2YR2 A;  5JLX A;  1LDK B;  1S9H A;  4S0H B;  3G1L A;  4FQG A;  1VQ5 I;  1M1E B;  4XLF A;  3K2Z A;  1MMD A;  5F27 A;  2DMN A;  2GIZ A;  4P5O A;  3VB2 A;  3E6M A;  2LD5 A;  5LHH A;  1LEB A;  1Z67 A;  3ZGK A;  2VXZ A;  3R60 A;  2VAS A;  3EYY A;  5E1X A;  1D3Y A;  1R36 A;  1W7P B;  3HYI A;  2F2E A;  5IYC J;  2PG4 A;  4DOZ A;  2ID6 A;  2K9L A;  2KDZ A;  1XCV A;  3BJO A;  4IX7 A;  2ACJ A;  1WQ2 A;  3OYB A;  3OL3 A;  3LL7 A;  1EH6 A;  3I0T A;  4YFK F;  2NVY J;  1QPM A;  2Z3Y A;  3K4C A;  4WXH A;  3G1O A;  2AQF A;  1UG2 A;  4KNY A;  2WAF A;  3T0Y A;  2BBY A;  1A35 A;  4C2T A;  3CO7 C;  4V19 K;  2BGC A;  2LNB A;  3HOW J;  4A0X A;  5KAF C;  3GF2 A;  1A6Q A;  3HJE A;  1YYV A;  2KZG A;  4HV6 A;  1YJW I;  4G94 A;  3H5R A;  1HST A;  2P6T A;  4PSX A;  5LD2 C;  2QBY B;  1PP8 F;  4MQ9 F;  2MLK A;  5EJC A;  2MLG A;  3IV5 A;  3L2R A;  3LMM A;  3ABK H;  1UAA A;  2X4H A;  3CP8 A;  1KU3 A;  3QPL A;  4N4O B;  4ENN A;  5DUI A;  1ZGW A;  3FF5 A;  1T38 A;  4ZJZ A;  2CU7 A;  3HGG A;  2I8D A;  4BHB A;  4EGZ A;  2XF7 A;  3BZK A;  2A07 F;  2L9S A;  2EH3 A;  2XGX A;  3F8M A;  3KPH A;  3TMO A;  1FBS A;  2DJN A;  2UWM A;  2JMW A;  2JJ7 A;  1ZRE A;  3CCY A;  2Y9Z A;  4DBQ A;  3V4G A;  1X4O A;  3LWF A;  5HS7 A;  5KNL A;  4D1Q A;  2A6E F;  3BLY A;  3GFI A;  3MD2 A;  2ZXI A;  4PDK A;  3MKZ A;  2XKO A;  4LMY A;  2DW4 A;  3N4M A;  2JQ7 A;  1WI3 A;  1FY7 A;  1XPX A;  4F52 A;  1W36 D;  1R6R A;  3HOZ J;  5TIS C;  2WBM A;  4LFU A;  4O5V A;  1P4W A;  2IRF G;  2BYV E;  2F5E A;  5HVQ C;  4HST A;  5J1R A;  1RET A;  1XCB A;  5KAI C;  1APL C;  1ZYR F;  1RKT A;  4BDY A;  2CS3 A;  5B1B H;  1BI1 A;  3F8B A;  3TED A;  3CUQ A;  4FET A;  5A2Q Z;  3BQZ A;  2CFX A;  2L9R A;  2E1M B;  2X9D A;  4L9N A;  2QWW A;  3FMQ A;  3DLA A;  4A69 C;  4LIU A;  3VYR B;  2QA4 I;  2V26 A;  4E7J A;  2WAD A;  3PNT A;  4CCO A;  4LK0 F;  2D1H A;  1OKR A;  2E35 A;  2O5R A;  2VQG A;  2R7O A;  2RRE A;  4A3J J;  2E7W A;  1GXP A;  5F0F A;  4Y7N J;  2NAZ A;  2B63 J;  3F6V A;  2V6C A;  1LFB A;  1U5T C;  4NHJ A;  3QPS A;  1MBG A;  1DPR A;  2LH9 A;  2W57 A;  2CWE A;  3ZMT A;  3G3Z A;  1GDT A;  1FYK A;  3RYP A;  2KJB A;  2KLO A;  2HKX A;  2AS5 F;  4M9S A;  3FKI J;  3R0J A;  3OIQ A;  3SFI A;  2X6X A;  3CUQ B;  1RUO A;  3O6B B;  3FZV A;  3E3V A;  3VYS B;  1S72 I;  2WAE A;  3DQV C;  2XSJ C;  5HLG A;  2OCC H;  1YQA A;  4D0P A;  2EIN H;  2L9N A;  1MND A;  1VQ4 I;  4UVA A;  5GPA A;  5M3F J;  1TW3 A;  5HDK A;  4M3B A;  3X2Q H;  5BQT A;  5B1A H;  1P7J A;  2DYS H;  5DD8 A;  3ZPL A;  1RR8 C;  4MEY F;  1RNL A;  2MH9 A;  4E7S A;  3D1N I;  1LPQ A;  2DOA A;  1AA7 A;  2IGO A;  4PGG A;  3CCR I;  3W6K B;  1HW2 A;  3CC2 I;  1R58 A;  2ZB9 A;  2CV2 A;  3PJR A;  1JUS A;  2DMU A;  5HDG A;  1RIO H;  3I5U A;  2PEX A;  1TWF J;  1QGP A;  1FYL A;  2LP0 A;  3CD6 I;  3GFL A;  5IOZ A;  1ZR4 A;  3KP2 A;  3K4M A;  3PQK A;  4N9H A;  2CGP A;  2LDU A;  1IJW C;  2L4A A;  4R1H A;  3FHZ A;  1ZG5 A;  5E79 C;  2Y0S A;  1OJL A;  1I3Q J;  1VQM I;  3TL4 X;  1V54 H;  1BI3 A;  3TW7 A;  1QNT A;  1VQK I;  4D5F A;  2RGV A;  5EF6 A;  2JA8 J;  4BH9 A;  5J1U A;  2R5Z A;  1JKR C;  3C18 A;  1YX3 A;  4XRF A;  4XL9 A;  2X51 A;  1FP2 A;  2R7U A;  4J01 A;  1JJ8 C;  3BCB A;  4IHX A;  1X1D A;  2VL8 A;  4C3I J;  1Y6I A;  3HUG A;  4ZYH A;  1SFX A;  5DDG A;  2CW8 A;  2M4K A;  2RDP A;  2BVM A;  1RR7 A;  3LST A;  5CQG A;  1X4P A;  3ASN H;  1XMA A;  3WE2 A;  2CSO A;  2L9V A;  1OIS A;  3W2A A;  3G71 I;  3DEW A;  1ZLJ A;  1CQT A;  2B7E A;  1EF4 A;  4FX4 A;  1D0X A;  1BI2 A;  3QYF A;  2LOO A;  2LLK A;  3BZ6 A;  5DUK A;  2E2I J;  4BHC A;  4E7L A;  1K7A A;  4A2U A;  1FSE A;  4CCL A;  1YW8 A;  2OTL I;  3SJM A;  2K9M A;  2KL4 A;  3TO7 A;  5F0H A;  4BYY A;  5F6F A;  2VC0 A;  3BR1 A;  2MH2 A;  3K4B A;  4C3H J;  3A01 B;  2F5D A;  4LOC A;  3EUH A;  3F22 A;  2QEX I;  2AXT C;  4YIF A;  5TJJ A;  3CMA I;  1Y1V J;  1H0M A;  2VJ5 A;  2K7L A;  1NHA A;  1WWX A;  3E5Q A;  3M1E A;  4IL6 C;  1LB2 A;  2A61 A;  5J40 A;  3JTH A;  1IN4 A;  3HSF A;  1CF7 B;  4CO8 A;  3K1M A;  4HZF A;  4DJA A;  3B6A A;  1HKQ A;  5H6Q A;  2W7N A;  1B8I A;  2EK5 A;  2P5V A;  5ICF A;  2E1M C;  5F1J A;  2EFN A;  3GUD A;  3DBH B;  3OYI A;  4LD5 A;  3GX4 X;  4KMF A;  1ZAR A;  3SQN A;  4Q47 A;  1UZC A;  2IP2 A;  3HEF A;  3ZQQ A;  4BGD A;  1YTY A;  1KU9 A;  3HBL A;  2JN6 A;  1HDD C;  5K7H A;  3J7Z I;  1YLF A;  1Q1H A;  1SVM A;  3R0A A;  2KIF A;  4HA8 A;  2ZXJ A;  2RVC A;  3H5N A;  2BXZ A;  2Z1D A;  1JKP C;  3ZP5 A;  4MQV A;  4A6D A;  2VE8 A;  3FX3 A;  2KDO A;  4WXD A;  1LE8 B;  3DXJ F;  2JUG A;  3JW4 A;  5TGT A;  2ZXH A;  2R3S A;  1IO2 A;  4G7H F;  1CGP A;  2Y2Z A;  2VPR A;  3G2B A;  2CUE A;  1IDZ A;  1FBU A;  3CCJ I;  4KIS A;  1XSV A;  3T1B A;  3ZQ7 A;  1B8I B;  4XQF A;  1XN7 A;  2DMQ A;  1BIA A;  5LEJ A;  1MDM A;  5LGT A;  2EA2 A;  2LC2 A;  1KGS A;  2HQ5 A;  3E6B A;  5JFR A;  4ZTF A;  3C1D A;  5K7F A;  1XS9 A;  2W24 A;  4WF2 A;  1V55 H;  3KLO A;  4IXA A;  3K0L A;  1SEU A;  2CQN A;  2ME6 A;  1B4A A;  5FKL A;  2CJJ A;  4ENM A;  1GVJ A;  3CO6 C;  1TNT A;  1NTC A;  4W97 A;  4IRG A;  5M5Y J;  4OAY A;  3S1N J;  2EFP A;  2E71 A;  2FSW A;  2HOA A;  2ZNZ A;  5K5R A;  1D1B A;  4UNO A;  3QYB A;  3CZ6 A;  3ZCO A;  3PUB A;  4YG2 F;  3V7C A;  2BOL A;  5TRD A;  3FXL A;  3HG9 A;  4P9U A;  3GTO J;  1UHS A;  1MZB A;  3S15 J;  4AYB A;  4S04 A;  5AIP A;  5E1W A;  3QOE A;  2FUG 2;  4CCJ A;  3DKY A;  2K85 A;  4OIQ F;  3F3X A;  5F04 A;  4HF2 A;  2MAB A;  2NRA C;  3G4S I;  2NNN A;  4K2E A;  2VN2 A;  4N4N B;  5IP7 J;  3CJR B;  2E19 A;  3KP5 A;  2P4W A;  4RB0 A;  2STW A;  2K9Q A;  1MD0 A;  4XSZ F;  3CME I;  3H3U A;  5JVG F;  1R22 A;  1PUF B;  5IT9 Z;  1UG0 A;  2EV0 A;  3DPT A;  2QSH X;  1JKO C;  3H35 A;  2H6C A;  5CLS A;  3MKL A;  4I99 C;  2K40 A;  3PO2 J;  4BS9 A;  4ZYD A;  1UST A;  3OR1 C;  1D8J A;  3Q9V A;  1MJA A;  2LF7 A;  5J8F A;  3I56 I;  1XD7 A;  5FLX Z;  1U2W A;  3I59 A;  1ZH5 A;  2OTJ I;  1FTT A;  3I4P A;  2N8G A;  2OF7 A;  4C30 A;  3IL2 A;  3CMY A;  2OU2 A;  1K4S A;  2V9V A;  5FD5 A;  3E5U A;  1Z3X A;  2W1O A;  5DCM A;  5GTH C;  3R61 A;  3S93 A;  2HQA A;  1XC5 A;  3JCU C;  1IN5 A;  3K69 A;  2I10 A;  3LQR A;  3RPU A;  2HR3 A;  1ZG1 A;  2XV4 S;  2FML A;  3DPL C;  4A3F J;  2NVQ J;  1D1A A;  3HSE A;  1LQ1 A;  3CF2 A;  3IKV A;  4P1W A;  4P9F A;  1FLI A;  3MMY B;  3OR2 C;  5FKN A;  3IH2 A;  3QPT A;  4CYC A;  3PIO F;  3BZC A;  3P9K A;  4IF4 A;  1X3Z B;  1T6S A;  2M1B A;  1SC7 A;  2WV1 A;  2P5L C;  2HPM A;  1R4M B;  5EZH A;  4I09 A;  1YOV B;  3IKT A;  4C2U A;  4GXO A;  4OIP F;  1VQ7 I;  2K3F A;  2LKX A;  1DP3 A;  3J81 Z;  1VF9 A;  2EJR A;  3BR3 A;  3GTK J;  2VOP A;  3RCO A;  3ZQF A;  4I7H A;  5EZG A;  2RQP A;  3VOD A;  2K5C A;  1W1W E;  2OQG A;  3R4K A;  1K78 B;  4JX5 A;  1PYV A;  5J3L A;  5KCM A;  2DOE A;  2ZME B;  1DGR M;  1TW2 A;  2A5Y B;  2A6H F;  2E1O A;  3CJN A;  2IGK A;  2MW8 A;  4IHW A;  4KYW A;  3WU0 A;  1HBX G;  1DDN A;  4A3B J;  2NOJ B;  3HB9 A;  3QWL A;  3OYC A;  3WTU C;  2KIM A;  3FHN A;  5EGO B;  1FZP B;  4I02 A;  1Y0U A;  2EZL A;  2HVR A;  1JT6 A;  1YIO A;  1ENH A;  2M7B A;  3WGG A;  3JRA A;  2M2E A;  3FXQ A;  4AUX A;  3OIO A;  3EUK L;  4YIR X;  3OYF A;  3OIP A;  2HYG D;  4BXX J;  2OBP A;  1ZN2 A;  1Z9C A;  3HOV J;  1A04 A;  3RIR A;  4A3K J;  1T08 B;  1N77 A;  2HZT A;  2IS6 A;  4PK4 A;  4B47 A;  2KRH A;  4J19 A;  2JVG A;  3GLX A;  1DP7 P;  3KET A;  1FWZ A;  2UV1 A;  2HZD A;  4E7K A;  2ZSI B;  2PJP A;  5IYB J;  3GYH X;  4BQA A;  3V7R A;  2O8X A;  4NQW A;  1B59 A;  3QPH A;  1JKQ C;  1ON1 A;  2A05 A;  3M3Y J;  2NYX A;  2JA6 J;  3BG7 A;  2DFE A;  2UZK A;  1I3A A;  2WC2 A;  4F91 B;  1VQO I;  1EH8 A;  3LSM A;  4HRI A;  5D8L B;  4AIJ A;  2UXN A;  4KFC A;  3AKZ A;  4KDP A;  2VBW A;  1TWC J;  4D7M A;  2ISZ A;  3LSK A;  4XKC A;  1T98 A;  1BJA A;  1IXS B;  4PJM A;  5LRR A;  2R7V A;  3TDZ C;  1E2X A;  1A6I A;  1XTA A;  1IGN A;  1MKM A;  3OYH A;  3T8R A;  1IAW A;  3TKY A;  2BXY A;  3K1P A;  1G3S A;  3TP0 A;  4LB5 A;  3DCF A;  1P4X A;  1X3U A;  4L9J A;  5CVR A;  4EV0 A;  3GXO A;  4BU2 A;  3MCZ A;  3FDY A;  4Q48 A;  3O2P E;  4CA0 A;  4KN4 X;  5FO5 A;  5JR3 A;  4RDU A;  4BXF A;  2IXS A;  2DA1 A;  5D6E A;  1HQC A;  2L0K A;  3PFI A;  1WHU A;  4BY7 J;  2RKH A;  1KYZ A;  3EDP A;  2DQR A;  2EIK H;  2V4J C;  3ELK A;  4M72 A;  2DYR H;  2ZNY A;  3NAR A;  3M9A A;  2VQC A;  3VDX A;  4CCN A;  1WSU A;  3M8J A;  3RKY A;  1I50 J;  1B1B A;  3HKZ A;  2E2J J;  3CDI A;  5CJ9 A;  1O3Q A;  3ASO H;  2Z2S B;  1YW9 A;  2QKM B;  2VB6 A;  4E4H A;  3M07 A;  4CZZ A;  1GT0 C;  4RGR A;  3TP3 A;  2YPR A;  4M3D A;  1KQ8 A;  2ZSH B;  1OFC X;  4ABZ A;  5C3E J;  2R5Y B;  1E17 A;  4ZZL A;  2L7M P;  2ESN A;  3I55 I;  1YE9 A;  2R0Q C;  2JRT A;  4L9T A;  4F93 B;  2FJ1 A;  5DEQ A;  3WTY C;  1UFM A;  4AVZ A;  1ZGA A;  1HW1 A;  2MFZ A;  4XKW A;  2HOE A;  1MH4 A;  3GFJ A;  5CVJ A;  3IC7 A;  3S8P A;  5FB2 A;  4M3G A;  4DNC A;  4OIO F;  1U6G A;  1K83 J;  1OCT C;  5EEA A;  4YEJ A;  4AYB N;  4B8X A;  5HOD A;  3CLO A;  2BE5 F;  3F21 A;  1BM9 A;  4X6A J;  2HU9 A;  1Z21 A;  2ZME C;  4PCQ A;  2Y75 A;  3GTP J;  3LA2 A;  4RAG A;  4HPQ A;  4CGZ A;  5IPA A;  4JP0 A;  3K6G A;  3Q0W A;  4EM1 A;  1IRX A;  2HFH A;  2E5N A;  3GZ6 A;  5LGU A;  1FMV A;  5F08 A;  5FKK A;  4FX0 A;  2BY1 A;  4U88 A;  4M71 A;  2Y48 A;  4BDZ A;  1A5J A;  1BN5 A;  1XDS A;  3HC7 A;  5D5U B;  4UUV A;  3LSG A;  1ON2 A;  1BC7 C;  1ETQ A;  2WY8 Q;  1YRN B;  2ECC A;  3ZR8 X;  3HGY A;  1WJE A;  3L2V A;  4ZZD A;  5M5W J;  2EIL H;  1FC3 A;  3DEU A;  1SFK A;  4YEL A;  3RZO J;  1GHC A;  3E97 A;  3BC8 A;  4EQQ A;  3Q0U A;  5EDN A;  3OYE A;  4JX6 A;  4WCG A;  3FXO A;  3CC7 I;  5LFA A;  4I0B A;  3BG3 A;  1B6A A;  2P8T A;  5HNF A;  1K4T A;  1R7J A;  1W7P D;  3GTJ J;  4RBO A;  3U1K A;  4C3J J;  4BQN A;  4OIR F;  2W82 A;  3A02 A;  2V9K A;  1U0J A;  1W5S A;  2HWV A;  2V7F A;  3WU1 B;  4G7Z F;  1MJ9 A;  2BW3 A;  2C6Y A;  3VEP A;  4HQM A;  2DDB A;  2M87 A;  5GPC A;  1WJF A;  2R7T A;  1IN8 A;  2XPU A;  1FEX A;  2EWN A;  3WTT C;  3NQO A;  1AWC A;  1BOB A;  1D1C A;  3OOP A;  3K10 A;  3ZQI A;  2GZW A;  2HOT A;  1JJ6 C;  4AM3 A;  1PVE A;  2DN0 A;  3HRS A;  3H3Z A;  2KT0 A;  3S2H J;  1G3Y A;  3IUO A;  3E5X A;  3S2W A;  2M7A A;  3GEZ A;  4RGU A;  1ZR2 A;  5ILV A;  4U0Y A;  3WGI A;  2G9W A;  3IH4 A;  3GTG J;  1Y56 A;  3LA3 A;  1TLH B;  4ASN A;  1D5Y A;  2XRO A;  3REO A;  3HRM A;  3SEQ A;  3WHC A;  4QIW N;  2NNY A;  3L9F A;  2LY1 A;  5FGM A;  4CH7 A;  1P7I A;  3HHH A;  3J80 Z;  2FD5 A;  3JAM Z;  5HS8 A;  5DTD A;  1X2M A;  2V6E A;  4WXC A;  4B48 A;  2IT0 A;  3KEY A;  2H27 A;  5IY5 H;  3FWE A;  4QWQ A;  3SZT A;  4E6K G;  2VLA A;  4ENJ A;  2L2O A;  2HVQ A;  1YIT I;  2E5Z A;  2ADU A;  4GO1 A;  3LOC A;  2RC4 A;  3PNY A;  4L5I A;  1BBY A;  3OS2 A;  4UUS A;  2XF6 A;  1RZ4 A;  2HKO A;  2A68 F;  1JHF A;  2OAZ A;  1IW7 F;  3W2V A;  1U8R A;  3TBI A;  2XAJ A;  4XMY A;  4CXF A;  4P55 A;  2DU9 A;  2E36 A;  2BZT A;  2JA2 A;  3I53 A;  3BJ6 A;  4BJ6 C;  4UV8 A;  4XID A;  2F5V A;  2XAS A;  2HXI A;  1KON A;  4R8H A;  1IUF A;  4KT6 A;  2OUM A;  2JTV A;  1B9N A;  2L54 A;  5DS9 A;  2W4S A;  1BOA A;  4A3M J;  3GBG A;  3GO5 A;  2CV0 A;  2H1L A;  4ZTJ A;  1G8X A;  2WWY A;  1ZK8 A;  1VI0 A;  2X6Y A;  5H20 A;  3N97 A;  1VQ8 I;  3JRI A;  5LBQ A;  2DT7 B;  1GVD A;  2M30 A;  4KMU X;  4G12 A;  3S1Q J;  2QF7 A;  2R93 J;  2DAO A;  1O3S A;  1N25 A;  4UUS B;  1TBX A;  5BPD A;  5A2Q K;  1ZTR A;  2XAQ A;  2P7V B;  4F3Q A;  1QZY A;  2DA4 A;  4KA4 A;  3LSJ A;  4J00 A;  1I6H J;  3FBI B;  1XGS A;  4KIC A;  1V3F A;  5FFX A;  2DA2 A;  1SD6 A;  5JI6 A;  1WKM A;  4NUB A;  2XIG A;  3FK7 A;  3HTS B;  1J75 A;  1YO5 C;  2V79 A;  2KKO A;  5ILS A;  2IA2 A;  5JHU A;  3DTI A;  3TOA A;  3WG9 A;  2F4O B;  2P81 A;  3H92 A;  2G7U A;  1O3R A;  1BW6 A;  3BTI A;  4LIT A;  1QA6 A;  4XKV A;  5H6R A;  1P6R A;  2HYJ A;  1OCP A;  2CRG A;  4ZDO A;  2KJC A;  2VBY A;  3QQA A;  4X0G A;  5J8C A;  1O3T A;  1FSH A;  3ZMU A;  2LMD A;  3DTK A;  2MGQ A;  3CCS I;  1ULY A;  1MBF A;  3L7W A;  4GFB A;  3C2H A;  3E7L A;  4RMN A;  1RI7 A;  3BG5 A;  2EV6 A;  1IDY A;  5JHF A;  3TQN A;  3ABT A;  3RTR A;  5ICE A;  2ZJR F;  2STT A;  4BNC A;  2GQQ A;  5J4V A;  5F64 A;  1P2F A;  1USS A;  4H0E A;  2ZO4 A;  3PQJ A;  2OPT A;  5GAE J;  3TGN A;  1Y0N A;  1D8K A;  2CQ7 A;  2WAQ A;  4DYQ A;  2XAH A;  2IAI A;  3HKZ N;  1MJB A;  1I39 A;  1I1G A;  4XLC A;  2H6B A;  3H9J A;  3IRR A;  4I98 B;  1BIB A;  2KIQ A;  1UMQ A;  2HI3 A;  2ZXW H;  2FE3 A;  2XGE A;  1ZQ3 P;  3D0S A;  3EQL F;  1RRJ A;  5ED4 A;  2BHZ A;  3CCU I;  2R7S A;  1GV5 A;  2L5Q A;  5D5V B;  2EFW A;  1S7E A;  3K4K A;  2HPI A;  4IQJ A;  4HOB A;  2M9H A;  3L09 A;  2PX9 A;  3M1C A;  2FX0 A;  4RAZ A;  1I5Z A;  3D5S C;  1NG7 A;  3F8F A;  4JQF A;  1HXD A;  1RC9 A;  3KIO A;  4KIG A;  3CUO A;  2BY0 A;  3AG3 H;  2XGD A;  1R23 A;  1V5G A;  2XPW A;  3F9K A;  3I58 A;  3H9Q A;  4N0B A;  4LGW A;  1LUJ B;  2VKD A;  4XM3 A;  4DQ2 A;  3JTG A;  2CMP A;  4HQE A;  4FE4 A;  3MAJ A;  2P6S A;  2R5Z B;  3BJA A;  3OY9 A;  3GZN B;  2B9S A;  2RN7 A;  2PQ8 A;  4MTE A;  1FTZ A;  2JA7 J;  2AO9 A;  4HX7 A;  1I27 A;  2VJI A;  2G0E A;  1Z0X A;  3HUG B;  1IV8 A;  2VKV A;  3GWZ A;  1VZ0 A;  5LEK A;  4C2M J;  2COB A;  4IRH A;  3VOE A;  1SAU A;  4XLA A;  1VQL I;  2DFI A;  3ZN0 A;  1DGW Y;  4JK1 X;  4CCM A;  1QHH D;  2XSD C;  2Z5U A;  2DA6 A;  3W6V A;  4HLX A;  3B6C A;  2GXA A;  4ITV A;  2MSY A;  3GFM A;  3FIW A;  2DOF A;  2EIM H;  3I64 A;  4I0A A;  1DUX C;  4RGS A;  4ANJ A;  1OYW A;  3CTA A;  4LG0 A;  3J7A O;  5CVU A;  2XC7 A;  1OR7 A;  2DQL A;  1G6N A;  1YJN I;  2QQ8 A;  2JPC A;  5DV5 A;  4CHU A;  3QOP A;  3VSK A;  4O3M A;  3V8L A;  2HXO A;  5IYD J;  3P7N A;  1ETY A;  4G6Q A;  2RV8 A;  1V4R A;  1IZ1 A;  2OCE A;  3E6D A;  5BS6 A;  2IGM A;  3V8J A;  4ZYE A;  2VPL A;  2LBF A;  1K6O A;  2BHY A;  4E7I A;  3WHB A;  2RNJ A;  5LHI A;  2JWT A;  1T0F A;  3CUQ C;  1MIJ A;  1H9T A;  4EJT A;  4OWR B;  1Q1V A;  5LLQ A;  2BY2 A;  1ODD A;  2L01 A;  4IQ4 A;  3S3N A;  4BQO A;  5ILU A;  2GAU A;  4KJZ A;  3MVP A;  4MHG A;  2DTR A;  2QQ9 A;  4YRV A;  5GTI C;  4CSW A;  3C7J A;  4Y13 A;  5E3O A;  4U7B A;  2Y31 A;  4HYE A;  1D5V A;  2R92 J;  3OS0 A;  5E3L A;  5L3E A;  3PO3 J;  3PL8 A;  2K27 A;  1LEA A;  4EVI A;  3QU6 A;  3GW2 A;  4DYR A;  4U0W A;  1ZGJ A;  3C2B A;  3H0G J;  5LGN A;  2E34 A;  1E3P A;  2Y9Y A;  3DP7 A;  5HS9 A;  5FFZ A;  2IVM A;  2E1C A;  1F4K A;  2WA0 A;  3BDD A;  3DPU A;  2V9P A;  3KLN A;  1VND A;  3K2A A;  1MDM B;  1TQP A;  1LJ9 A;  1OLT A;  1GXQ A;  2XDV A;  1J59 A;  3F0C A;  3M8E A;  1JHH A;  4I6Z A;  3H3V K;  1J2X A;  5M3M J;  3WTS C;  1WGX A;  1T8I A;  4FAS D;  1LVK A;  3VSL A;  1T33 A;  2NVX J;  2ZBK A;  3K70 D;  3A1Y A;  5GAD J;  1B72 A;  2Q2E A;  4CCK A;  3ZQG A;  4E7Z A;  2GLO A;  3FXU A;  4FT8 A;  2YU9 J;  2QYO A;  2CW0 F;  3VWB A;  5B3S H;  1T56 A;  1HF0 A;  4A3G J;  5CVI A;  4KIF A;  3PFY A;  3JR9 A;  4XLH A;  2JUC A;  4QTR A;  1ACI A;  4DYC A;  1G4D A;  2HDD A;  3F8N A;  4IRI A;  3WTX C;  3U21 A;  5GP9 A;  3BT9 A;  2BEO A;  2JK3 A;  1JI8 A;  1S7A A;  1R9T J;  3GTQ J;  1R4N B;  2O61 A;  1YI2 I;  2DMP A;  2QUF A;  5DYM A;  2K86 A;  1ZLK A;  3TOB A;  3LAP A;  3FKJ A;  1PP7 U;  1WJB A;  3K4N A;  1BA5 A;  4IHV A;  1TNS A;  2QQB A;  2O3F A;  3M7G A;  4KIB A;  1JT0 A;  4LK1 F;  2OJE D;  2F5C A;  3K7A J;  5E8I A;  1YFH A;  2MYS A;  4RS8 A;  4FCY A;  3KE2 A;  2V1X A;  3CCQ I;  2PJR A;  2MC4 A;  2LRE A;  2O9L A;  1KQ0 A;  3F6O A;  4BUP A;  2ETH A;  1R1V A;  2HTJ A;  1HDP A;  4AU7 A;  5L3G A;  3OWT A;  4HDV A;  4ETS A;  2QZ8 A;  1F5T A;  2JSP A;  1R1T A;  2X1E A;  3DEE A;  3K1N A;  5IT9 K;  1LVA A;  2FBK A;  5GAG J;  1J7K A;  3HOT A;  2ID3 A;  2PMU A;  1MH3 A;  3CCM I;  4M6Y A;  4B3X A;  4PJN A;  2M0M A;  1L0O C;  1OMI A;  2KFD A;  2QCO A;  3I59 B;  1XDU A;  3S2D J;  4Y15 A;  1NK3 P;  1DU0 A;  3OMY A;  5FLX K;  1HOM A;  1Z6T A;  2E7X A;  3WE3 A;  5L3F A;  2ISY A;  3ERE D;  5DCM B;  4WWC A;  2PMZ N;  4PJL A;  2PJR B;  2X6W A;  1FPQ A;  3QOD A;  4OAZ A;  1ETX A;  5E3N A;  2DCE A;  2X48 A;  3EUH C;  4L18 B;  1FIP A;  3N05 A;  3G73 A;  2CQK A;  3HDD A;  3T8T A;  4BHP A;  1UHM A;  4LB6 B;  1IRZ A;  2Z16 A;  3UNG C;  1FOX A;  3IH3 A;  2D1V A;  3RI4 A;  1XG1 A;  3IHU A;  2GIV A;  1LKX A;  2X1C A;  4UV9 A;  4ESF A;  2IS2 A;  2NVU B;  3CCL I;  4M6V A;  2WAQ N;  1O4X A;  1E0E A;  4BAY A;  4CYC B;  1HLV A;  2ZC2 A;  4GGG A;  3ZRG A;  3A0H C;  1TP4 A;  2VC1 A;  4MTD A;  3ERM A;  4ZYA A;  1D0Z A;  4N9I A;  3HOU J;  2W00 A;  2IW5 A;  2R7F A;  1G3T A;  2XAU A;  2YU3 A;  4RB3 C;  4MEX F;  4GCV A;  4BE1 A;  3WGH A;  3NWS A;  2WTE A;  2BVL A;  3H9G A;  1TT0 A;  2CYY A;  3LFU A;  1XX5 A;  4KN7 X;  4JBA A;  3G1M A;  2PN6 A;  3DBR B;  4RAF A;  3J81 K;  1B9M A;  1Z1D A;  1GUU A;  2ZJP F;  4M74 A;  2MD0 A;  5CQE A;  1UB9 A;  1TWG J;  4CIC A;  1AKH A;  3WOD F;  3DV8 A;  1S3J A;  4MFE A;  1F43 A;  4JOM A;  5HDN A;  2KRC A;  1SD4 A;  3GME A;  4DZP A;  1WH5 A;  4HAM A;  3SXY A;  3K4L A;  3K70 C;  2HDC A;  3BWG A;  3S1R J;  1PUE E;  3ROU A;  2EFO A;  1ZRD A;  4IOC F;  3S17 J;  2JSC A;  1S7O A;  4YFN F;  3OYA A;  2AQE A;  3E0J B;  1XGM A;  3T5X A;  2Y69 H;  4V2G A;  1X2N A;  5DM7 F;  2CO5 A;  2TCT A;  1TQM A;  1IC8 A;  1H9G A;  5KHD A;  1N75 A;  1QO0 D;  1POG A;  1X1A A;  2H94 A;  4U87 A;  2CH0 A;  4NC8 A;  4AIK A;  4L0Z B;  3BR2 A;  1TWA J;  4FIS A;  4GDF A;  4AIH A;  3OS1 A;  2RQQ A;  1R5I D;  1W4M A;  4JYK A;  2LFB A;  2LSO A;  1Z3Y A;  2OC6 A;  1RPW A;  2MBF A;  1AOY A;  3KYC B;  1FJL A;  3AG1 H;  3AL0 B;  2X85 A;  3DWL E;  3FXJ A;  2GOX B;  5BMZ A;  3VFZ A;  1N78 A;  1QZE A;  2GXG A;  1SMY F;  3EET A;  3ZMD A;  2P0W A;  3KCC A;  2VOD A;  4LLN A;  4H4K C;  2JT1 A;  3MN2 A;  1FX7 A;  2M5W A;  4BEH A;  3Q9S A;  4NQW B;  4R79 A;  2QVO A;  2D2W A;  1MMA A;  4NBQ A;  3FXK A;  4P96 A;  1TWH J;  2M45 A;  2OQR A;  5EG0 A;  5D4R A;  2X1D A;  3J7A Y;  1IRG A;  4WK8 F;  2VT3 A;  3L00 A;  2ECB A;  3EPZ A;  4ON0 A;  2H1K A;  2E60 A;  2ZKZ A;  3BPV A;  4C9Y A;  2LY9 A;  4KUM A;  2QQA A;  5FJ8 J;  5H2F C;  1U5T A;  1KA8 A;  2EZK A;  2FQ4 A;  3E6C C;  3MQ0 A;  5ERI A;  5K7Z A;  2EQR A;  2F4M B;  5JLW A;  4MIM A;  2I5U A;  3O8G A;  3CLQ A;  3KEQ A;  1V5E A;  3BCA A;  2DDA A;  2NS0 A;  2FF4 A;  3Q3S A;  3L2Q A;  1Z7U A;  3FM5 A;  3GLL A;  1YS6 A;  4ZC3 A;  3RQI A;  1ETW A;  4HX8 A;  2LKS A;  1MBH A;  2GA1 A;  2W85 A;  3RKX A;  4HNU A;  4KT5 C;  2CUJ A;  2X0L A;  3SHF A;  1FT9 A;  2BV6 A;  2LY2 A;  3V8K A;  1EKE A;  2DPD A;  4L0Y B;  4MFD A;  3NWT A;  4HV5 A;  1X19 A;  5E3M A;  3HZJ A;  1KYW A;  2FNA A;  1ZRC A;  4YFX F;  5AIQ A;  4CYD A;  3MZH A;  2IS1 A;  4FE7 A;  4B1R A;  2B0L A;  3ESW B;  4PSW A;  3IRQ A;  3I3L A;  3NAU A;  2GM4 A;  2QSG X;  1SVL A;  1UEL B;  1U9N A;  5HLH A;  1DPU A;  2GA2 A;  3BR6 A;  3ECO A;  4HEA 2;  3IWZ A;  3OYG A;  2OZU A;  4XSX F;  2DO7 A;  3GVA A;  2VBX A;  1X1P A;  2FMY A;  1WI9 A;  2KPM A;  3PSI A;  1W7P A;  5DM6 F;  2IA1 A;  2R4G A;  4D9J A;  1TZL A;  3DBL B;  2QKL B;  3H1C A;  1W5T A;  3KEO A;  2F48 A;  3D5R C;  2XPV A;  3S14 J;  3ZXS A;  1MSF C;  3COA C;  4M3F A;  2KHM A;  1MMN A;  4FTH A;  3HXL A;  3PM1 A;  1V5F A;  3BR0 A;  3F72 A;  1F1Z A;  1ETO A;  3A2K A;  2PBI A;  2KZV A;  2QM3 A;  2DXI A;  1DU6 A;  3DTE A;  3ML6 A;  4PGH A;  4JX4 A;  4EMS A;  1OCO H;  4IKF A;  2CW7 A;  9ANT A;  2QBY A;  1J5Y A;  4RB1 A;  1U78 A;  1IF1 A;  2IA0 A;  2VIX A;  3LSR A;  4XOP A;  1D0Y A;  3JSO A;  4B09 A;  5GAH J;  4Z6Y A;  2LG4 A;  2M0C A;  2EA4 A;  4M6X A;  5JVT A;  2L4M A;  1Z6R A;  2ELJ A;  4RLF A;  3JSP A;  1U8B A;  4UHT A;  3ZOB A;  2Q0O A;  2CQQ A;  4MO7 A;  1H8A C;  1MBE A;  1J9I A;  4AVP A;  1HKT A;  1JUP A;  2ESH A;  4GYI A;  3ISP A;  1IXR C;  2GBY A;  5CYV A;  1VQP I;  4A5M A;  1ZRF A;  2PLY A;  2W25 A;  3OYD A;  3M4O J;  3BPX A;  3KP7 A;  4PFO A;  3SZG A;  5LHG A;  2DK8 A;  3F8C A;  3M8F A; 
#chains in the Genus database with same CATH homology
 1RES A;  2XGE A;  1IG7 A;  1ZQ3 P;  2CUF A;  2K9Q A;  3JRB A;  5FKM A;  1GV5 A;  1PUF B;  1S7E A;  4IHY A;  1JKO C;  2K9N A;  2M9H A;  3A03 A;  4A3I J;  3MKL A;  3VPR A;  2K40 A;  3PO2 J;  2FX0 A;  2IEK A;  2NVT J;  2RAE A;  2O7O A;  4NDL A;  2XGD A;  3SDG A;  1FIA A;  1ETV A;  2XPW A;  2M34 A;  2R5Y A;  3JRD A;  1BL0 A;  4MLO A;  2DTZ A;  1RKW A;  2NOG A;  1FTT A;  4FE4 A;  1H89 C;  3OOU A;  1JGG A;  2N8G A;  2OF7 A;  3CMY A;  2R5Z B;  1FTZ A;  2LK2 A;  2JA7 J;  2AO9 A;  1IV6 A;  1XC5 A;  2G0E A;  1Z0X A;  2VKV A;  1JTX A;  1U9O A;  1ZKG A;  2DA5 A;  5M5X J;  2I10 A;  4X1E A;  4BY1 J;  4C2M J;  2COB A;  4A3F J;  2NVQ J;  1ETK A;  2YS9 A;  3LNQ A;  2XSD C;  4XIC A;  2CQX A;  5C4X J;  3BQY A;  2DA6 A;  3W6V A;  5FKN A;  3B6C A;  1QPI A;  3IH2 A;  2MSY A;  3FIW A;  4CYC A;  5EG0 B;  2VI6 A;  3BTJ A;  2WV1 A;  2W48 A;  3Q0V A;  3HOX J;  5EZH A;  3S16 J;  4XRS G;  4M3E A;  4XRM A;  2LKX A;  5BNG A;  1WCM J;  2L7Z A;  1VF9 A;  3BR3 A;  4V2F A;  3LSP A;  3GTK J;  2HXO A;  5IYD J;  3ZQF A;  5EZG A;  1ETY A;  4IEJ A;  2NS8 A;  4JX5 A;  1G2H A;  1YRN A;  5J3L A;  1MBJ A;  3WHB A;  2XRL A;  4BKX A;  2LVS A;  2JWT A;  3FK6 A;  4I76 A;  1Q1V A;  3JRG A;  1LFU P;  2DA7 A;  2ME0 A;  2ELK A;  2E1O A;  1AU7 A;  4L5E A;  2MW8 A;  4IHW A;  2IBD A;  3MVP A;  4A3L J;  1Y1W J;  2H8R A;  4A3B J;  4A93 J;  5JLX A;  4S0H B;  3HB9 A;  2DA3 A;  3G1L A;  2JA5 J;  5E3O A;  5EGO B;  2Y31 A;  2EZL A;  1JT6 A;  2R92 J;  5F27 A;  2DMN A;  5E3L A;  3PO3 J;  2LD5 A;  1ENH A;  3JRA A;  2M2E A;  4DYR A;  1ITY A;  4AUX A;  3C2B A;  3H0G J;  3ZQH A;  4XRS A;  3OIO A;  2Y9Y A;  5FLV A;  5IYC J;  4BXX J;  3JRE A;  3HOV J;  4A3K J;  1VND A;  2ID6 A;  2KDZ A;  4J19 A;  3K2A A;  1W0U A;  2DMT A;  3F0C A;  2NVY J;  4I6Z A;  3OSG A;  3H3V K;  3G1O A;  5IYB J;  1UG2 A;  5M3M J;  1WGX A;  1T33 A;  2NVX J;  1JKQ C;  1ORK A;  1B72 A;  3RKQ A;  4DZJ A;  3M3Y J;  3ZQG A;  2GLO A;  2YU9 J;  2JA6 J;  3HOW J;  5FLM J;  1T56 A;  1HF0 A;  4A3G J;  5IOY A;  1TWC J;  4D7M A;  3JR9 A;  3IV5 A;  4QTR A;  4DYC A;  3A01 A;  2D5V A;  2HDD A;  1SAN A;  5GP9 A;  3BT9 A;  3QPL A;  4HNV A;  2JK3 A;  1R9T J;  1A6I A;  1ZGW A;  3GTQ J;  4B4C A;  1IGN A;  3I4N J;  2CU7 A;  3HGG A;  2DMP A;  3TP0 A;  3DCF A;  2EH3 A;  2O8K A;  1QVU A;  2DJN A;  1BA5 A;  4IHV A;  2EZH A;  2JMW A;  2JJ7 A;  4RDU A;  1JT0 A;  3CCY A;  2L7F P;  2DA1 A;  3K7A J;  2Y9Z A;  3BG9 A;  4FCY A;  1VFC A;  2L0K A;  3HM5 A;  4AC0 A;  1NK2 P;  4BY7 J;  2O9L A;  1WI3 A;  2XB5 A;  4A3D J;  3HOZ J;  3NAR A;  1HDP A;  3GTM J;  5J1R A;  1RET A;  3O8H A;  1I50 J;  1APL C;  2E2J J;  1RKT A;  1LE8 A;  2HOS A;  3TED A;  2LTP A;  2ID3 A;  3BQZ A;  1GT0 C;  1MH3 A;  3TP3 A;  2L9R A;  4M3D A;  1OFC X;  2X9D A;  4ABZ A;  5C3E J;  2R5Y B;  2EBI A;  4W1U A;  2K9S A;  2L7M P;  2QCO A;  4A69 C;  3S2D J;  2R0Q C;  1WPK A;  2FJ1 A;  1NK3 P;  1DU0 A;  1HOM A;  1QRY A;  4BBR J;  2PMZ N;  4A3J J;  5F0F A;  1MH4 A;  4Y7N J;  2B63 J;  1ETX A;  1HCR A;  5E3N A;  1LFB A;  2X48 A;  4BBS J;  1FIP A;  4M3G A;  2XGC A;  3QPS A;  3UKG A;  1MBG A;  3JRH A;  3HDD A;  1K83 J;  1OCT C;  5EEA A;  5HOD A;  4AYB N;  1GDT A;  1IRZ A;  3IH3 A;  3S1M J;  3I4M J;  4X6A J;  1XG1 A;  3FKI J;  1SFO J;  1K61 A;  4M6V A;  2WAQ N;  1O4X A;  3GTP J;  3SFI A;  4CYC B;  1HLV A;  5IPA A;  4JP0 A;  3HOU J;  3Q0W A;  5EYR A;  1TC3 C;  5IP6 A;  5F08 A;  5FKK A;  2EZI A;  5GPA A;  5M3F J;  4Y52 J;  3G1M A;  1A5J A;  4M3B A;  1GUU A;  1P7J A;  3LSG A;  1AKH A;  1TWG J;  2YUS A;  4D5C A;  1ETQ A;  1YRN B;  2ECC A;  4MFE A;  1F43 A;  1F36 A;  1W0T A;  3HGY A;  4DW6 A;  5M5W J;  3BR5 A;  4DZP A;  1WH5 A;  3D1N I;  3OSF A;  2ZB9 A;  3S1R J;  1JUS A;  3JRF A;  3RZO J;  1MBK A;  2DMU A;  3ZQL A;  1PUF A;  3S17 J;  1GV2 A;  3Q0U A;  5EDN A;  4JX6 A;  1TWF J;  3HOY J;  4V2G A;  2LP0 A;  2X6O A;  1X2N A;  3BG3 A;  5IOZ A;  3BTC A;  1ZR4 A;  5J1Y A;  4B3A A;  5C4J J;  2TCT A;  3FIS A;  2MG4 A;  1IC8 A;  1IJW C;  3GTJ J;  3CDL A;  1OJL A;  1POG A;  1I3Q J;  4RBO A;  4C3J J;  3A02 A;  1TWA J;  3BR2 A;  4FIS A;  5F0C A;  3TW7 A;  1BJZ A;  4D5F A;  5EF6 A;  3L1P A;  2JA8 J;  5GPC A;  5J1U A;  4JYK A;  2R5Z A;  2LFB A;  4A3E J;  1JKR C;  1FEX A;  2XPU A;  3BTL A;  1RPW A;  3ZQI A;  1FJL A;  2HOT A;  2TRT A;  1JJ6 C;  1JJ8 C;  4IHX A;  4UUT A;  2DN0 A;  4C3I J;  2KT0 A;  3S2H J;  2WB1 N;  2VUM J;  1ZR2 A;  1RR7 A;  3MN2 A;  3IH4 A;  3GTG J;  1Z77 A;  1D5Y A;  1B72 B;  4A3C J;  3DEW A;  3TW6 A;  3WHC A;  4QIW N;  1CQT A;  1TWH J;  1EF4 A;  5EG0 A;  2XB0 X;  1P7I A;  2LLK A;  2NS7 A;  2FD5 A;  2E2I J;  2ECB A;  5DTD A;  1X2M A;  2H1K A;  3SJM A;  2Y30 A;  5F0H A;  2LY9 A;  3BR1 A;  4C3H J;  5FJ8 J;  3A01 B;  4LOC A;  2EZK A;  2FQ4 A;  1Y1V J;  5K7Z A;  2EQR A;  3RZD J;  3LOC A;  5JLW A;  4MIM A;  3O8G A;  3Q3S A;  4UUS A;  3B6A A;  1B8I A;  2VKE A;  3RQI A;  1ETW A;  2AHQ A;  1MBH A;  5F1J A;  1BW5 A;  1MNM C;  3HEF A;  4XID A;  1E3O C;  4MFD A;  5E3M A;  4QSH A;  3HBL A;  2HXI A;  2JN6 A;  1HDD C;  1IUF A;  1JTY A;  5K7H A;  4FE7 A;  4B1R A;  5DS9 A;  5EGO A;  3NAU A;  4A3M J;  3GBG A;  2GM4 A;  1MSE C;  3GTL J;  1JKP C;  1U9N A;  1AHD P;  3BR6 A;  1LE8 B;  1ZK8 A;  1VI0 A;  1WH7 A;  2Y2Z A;  2VPR A;  3JRI A;  3JRC A;  1GVD A;  2CUE A;  4G12 A;  3S1Q J;  2QF7 A;  2R93 J;  1IDZ A;  4UUS B;  1ZTR A;  2DA4 A;  3LSJ A;  1B8I B;  1I6H J;  2Y0S N;  2DMQ A;  3CQZ J;  2XPV A;  3S14 J;  2DA2 A;  2HQ5 A;  4XK4 A;  1MSF C;  3FK7 A;  4M3F A;  5K7F A;  4FTH A;  1XS9 A;  1H88 C;  3PM1 A;  3BR0 A;  1JUM A;  2P81 A;  5FKO A;  1BW6 A;  3BTI A;  1ETO A;  2ME6 A;  1DU6 A;  5FKL A;  2HYJ A;  4EEF G;  1OCP A;  2CRG A;  2CJJ A;  4JX4 A;  3QQA A;  5IP9 J;  9ANT A;  1NTC A;  4W97 A;  5M5Y J;  2LR8 A;  3S1N J;  1U78 A;  2MGQ A;  1MBF A;  2HOA A;  4GFB A;  3LSR A;  3E7L A;  2R7Z J;  3BG5 A;  2M0C A;  3ZQC A;  1IDY A;  1X58 A;  4D7N A;  2E2H J;  3GTO J;  1UHS A;  5C44 J;  1U8B A;  3S15 J;  3ZOB A;  2CQQ A;  4MO7 A;  2OPT A;  1H8A C;  2M8G X;  1MBE A;  4DYQ A;  1JUP A;  5F04 A;  3HKZ N;  2IAI A;  2GBY A;  1AKH B;  3M4O J;  1QVT A;  1UMQ A;  2HI3 A;  5IP7 J;  2E19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...