3K2AA

Crystal structure of the homeobox domain of human homeobox protein meis2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the homeobox domain of human homeobox protein Meis2
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Homeobox protein Meis2
total genus 17
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3k2aA00
1WCMJ 4FE7A 2JJ7A 3HDDA 3RZOJ 2OPTA 5EZGA 3BR6A 1WI3A 1F36A 1BW5A 4AC0A 5EG0B 1QVUA 4XRMA 1AKHA 3HM5A 2EZIA 4UUSB 5C44J 3HGGA 2KDZA 2XPWA 1H8AC 1P7JA 3RKQA 1O4XA 2YS9A 3W6VA 2CU7A 5IP9J 3LSRA 1JKRC 4BY1J 2TCTA 1ZQ3P 4FISA 3GTMJ 5M5YJ 3BTCA 1JTYA 2DA4A 1T56A 5E3OA 4IHXA 2K9SA 1RESA 4A3EJ 1BL0A 4B1RA 1MH4A 1LFBA 2NS7A 1QVTA 1I3QJ 1JKOC 3A01A 1GVDA 2O8KA 4D7MA 5K7HA 3L1PA 2Y0SN 1GT0C 3HKZN 5DS9A 2VI6A 2EZHA 3GTKJ 3TEDA 1IUFA 3LSGA 3CDLA 5IYBJ 4J19A 5F0CA 1HF0A 1DU6A 3E7LA 5F1JA 3S17J 1SFOJ 2E2JJ 5J1UA 3PO3J 2LTPA 1FTZA 2EZLA 2M9HA 4M3GA 1DU0A 1JKPC 2WB1N 3G1LA 3GTPJ 1OFCX 5C4XJ 4HNVA 1LFUP 5IYCJ 2JA5J 1HDDC 2HYJA 2QCOA 2G0EA 3ZQIA 3O8HA 1MBKA 4MLOA 3JRCA 2R7ZJ 3RQIA 1ENHA 2DTZA 3PO2J 3JRIA 3RZDJ 3LSJA 4RBOA 3IH4A 2JA6J 3GTGJ 2LK2A 4G12A 1T33A 4JYKA 3Q3SA 4QTRA 3HOUJ 3GTOJ 5J3LA 4W1UA 1MSFC 1MNMC 2ECCA 4C3HJ 1XS9A 3CQZJ 4JX5A 1NK3P 2I10A 3I4MJ 2X6OA 1B8IB 2NVQJ 1ETYA 1A6IA 3B6CA 4GFBA 2OF7A 1HCRA 2CJJA 5IP7J 3F0CA 2M34A 5GPAA 3GTQJ 5FKLA 1IDZA 2IEKA 2LVSA 4DYCA 1ZGWA 5C4JJ 2DN0A 2KT0A 3DCFA 2DA5A 2ME0A 4V2GA 3JRGA 3M3YJ 3BTLA 4QIWN 2Y2ZA 1OCPA 5HODA 2ID3A 3K2AA 2O7OA 4XRSG 2JWTA 3ZQFA 5EF6A 3QQAA 1AU7A 2XRLA 3JRHA 2DMPA 1MBGA 2DJNA 5F0FA 2EZKA 3BTIA 4L5EA 1TWGJ 4XIDA 3M4OJ 3OSFA 1ZTRA 4JP0A 1B72A 1JUSA 1I50J 3H3VK 2XGCA 1FTTA 1UMQA 4AUXA 1RKWA 2TRTA 1JGGA 2ZB9A 4ABZA 2NVYJ 4MIMA 5F0HA 3UKGA 2ELKA 3BR1A 2L7FP 3MN2A 5GP9A 4RDUA 4IHVA 3FISA 4Y52J 4A93J 3OIOA 4DZPA 3NARA 3ZOBA 3K7AJ 3BG9A 5M5WJ 2M2EA 1UG2A 1WH7A 3ZQLA 4A3IJ 3A01B 2L9RA 2H1KA 1Y1WJ 1MBJA 3JRFA 1W0UA 1H89C 2X48A 2L7ZA 5JLWA 1W0TA 4MO7A 2XSDC 4IHYA 3S1NJ 1BW6A 1YRNA 3CMYA 2R5YB 2N8GA 5F27A 5EG0A 1ZK8A 3NAUA 2P81A 1G2HA 4M3BA 1ETXA 3Q0UA 3S16J 3CCYA 1MBEA 4DW6A 1ETOA 1U9OA 1B8IA 3HOYJ 3HOXJ 2R0QC 5FKNA 2RAEA 2E19A 2IBDA 1VF9A 5M5XJ 2EH3A 3Q0WA 3S15J 1FIPA 2E1OA 5M3MJ 4X1EA 1WH5A 3BR3A 1RKTA 2LFBA 1RR7A 1IGNA 4FCYA 2GBYA 2COBA 3B6AA 3HEFA 3HOWJ 1R9TJ 2DA6A 3HGYA 4A3LJ 1VI0A 5E3NA 5E3MA 5FKKA 1IV6A 2XGDA 1QRYA 2ME6A 2DMTA 4NDLA 3SFIA 5F04A 2R5YA 1IJWC 3D1NI 5J1RA 3A02A 2HXIA 5IP6A 3JRDA 1ETVA 2XB5A 4FE4A 3BR0A 4V2FA 2LY9A 1HLVA 1WGXA 4AYBN 2CQXA 4S0HB 3IH2A 3Q0VA 1JUMA 3S2DJ 5M3FJ 1QPIA 4B3AA 4IEJA 1RETA 2FD5A 2W48A 2DMNA 2R5ZB 4FTHA 1MH3A 2XPUA 3H0GJ 4CYCB 1IDYA 2JK3A 1BA5A 2IAIA 1RPWA 4M3DA 1Z77A 1X2NA 1JT6A 5K7FA 3I4NJ 1TWCJ 4BY7J 2GLOA 1U9NA 1VNDA 2ID6A 3SJMA 1JJ6C 1TWHJ 4BXXJ 5BNGA 1VFCA 3C2BA 1SANA 9ANTA 3FIWA 2DA1A 1ETQA 3A03A 3TP0A 1TC3C 4UUSA 1A5JA 2XB0X 3BT9A 4IHWA 3WHCA 2DA3A 4B4CA 5C3EJ 4A3JJ 3JR9A 3S1MJ 3VPRA 3HOVJ 3IV5A 2YUSA 5DTDA 5IPAA 1ITYA 2VUMJ 3TW6A 5EEAA 4EEFG 4A69C 2MGQA 2DMQA 2CUEA 1JJ8C 2K9NA 2FX0A 5IOZA 3JRBA 4BKXA 1EF4A 5EGOA 5IOYA 1K61A 2DA2A 4C3JJ 2QF7A 1OJLA 1U78A 1PUFB 4A3CJ 1APLC 5FLMJ 3MVPA 1GV5A 4A3FJ 1NTCA 1ETWA 1X2MA 1S7EA 5E3LA 3LSPA 5EDNA 2WAQN 2ECBA 3BTJA 2X9DA 2HOSA 3G1OA 1PUFA 1ORKA 4C2MJ 3GTJJ 1I6HJ 3BG3A 1UHSA 3ZQGA 1MBFA 3QPSA 2LKXA 2AHQA 3FK7A 3TW7A 1CQTA 2CQQA 2HXOA 2LLKA 3HBLA 3PM1A 3S2HJ 4MFDA 2HOTA 1BJZA 2CUFA 2R5ZA 2O9LA 1NK2P 1LE8A 4BBSJ 1JKQC 1ETKA 2R92J 1Y1VJ 4DYRA 2XGEA 4DYQA 2FJ1A 1TWFJ 1K83J 1B72B 1JTXA 4CYCA 2PMZN 4LOCA 2L7MP 2MSYA 1H88C 3LNQA 1D5YA 3BR5A 1X58A 4D7NA 2NVXJ 2B63J 1MSEC 5EZHA 3GTLJ 1GV2A 4JX4A 2LR8A 1MBHA 4Y7NJ 2NS8A 1IG7A 2GM4A 3DEWA 4XRSA 2MG4A 2HQ5A 3FKIJ 5JLXA 5J1YA 3BR2A 2Y31A 2HI3A 2HDDA 2HOAA 3JRAA 2R93J 1POGA 4W97A 2JMWA 2Y9YA 4M6VA 5F08A 1E3OC 3QPLA 1JUPA 2LP0A 2E2IJ 5FKMA 1YRNB 2VKEA 5FJ8J 1P7IA 1F43A 2LD5A 1Z0XA 2M8GX 3BQYA 1HOMA 3BQZA 5EYRA 4DZJA 2CRGA 4I6ZA 2DA7A 3S1RJ 1JT0A 4JX6A 1IRZA 3ZQHA 3O8GA 2DMUA 1IC8A 2K9QA 3SDGA 4C3IJ 2EBIA 1TWAJ 1LE8B 3MKLA 4M3EA 5IYDJ 2FQ4A 2AO9A 1GDTA 1FEXA 1AHDP 4A3KJ 4X6AJ 1AKHB 1GUUA 4A3DJ 1ZKGA 3GBGA 3OSGA 2K40A 2Y9ZA 4XICA 3S1QJ 3HB9A 4D5CA 3BG5A 1FIAA 2EQRA 3ZQCA 1ZR2A 1ZR4A 2XPVA 2YU9J 1FJLA 2M0CA 4UUTA 2E2HJ 5FLVA 4D5FA 4A3GJ 5K7ZA 2VPRA 3WHBA 3OOUA 2Y30A 2JA7J 2JA8J 3JREA 2D5VA 4M3FA 4BBRJ 1WPKA 1U8BA 3IH3A 2WV1A 3TP3A 1HDPA 1OCTC 5FKOA 1XG1A 3LOCA 4MFEA 4A3BJ 2JN6A 5EGOB 2MW8A 5GPCA 3FK6A 1Q1VA 4QSHA 2L0KA 2NVTJ 2VKVA 3HOZJ 4I76A 4A3MJ 2H8RA 4XK4A 1XC5A 3G1MA 3S14J 2NOGA
chains in the Genus database with same CATH superfamily
3FXUA 4NC7A 4ZC3A 3T1BA 2ETHA 4FE7A 3F22A 2JJ7A 3M07A 4F55A 3HDDA 3F8BA 2OPTA 3M8JA 4I99C 5DD4A 1WI3A 5HDKA 2PQ8A 1W36D 1BW5A 2BXYA 2CFOA 4UUSB 1UCRA 2MBFA 1XSXA 4HEA2 3HGGA 1YOVB 2JUGA 3WE3A 2E36A 5TGTA 4EJOA 2YS9A 3RKQA 2CQNA 4ENNA 3W6VA 3L2QA 4M72A 4LITA 1ZQ3P 3CF2A 3GTMJ 2FEZA 3MEXA 3BTCA 2XAQA 4I0AA 3I4PA 1VQ7I 2F5VA 3I53A 1ERDA 2YR2A 4BQQA 3P7NA 1QVTA 3GCMA 2IPQX 2BEOA 1GVDA 4U88A 2UXNA 2NYXA 2LC2A 1U5TA 4PFOA 4RLQA 3ZMSA 2VI6A 3S2WA 2LYCA 3TEDA 3IP4B 2VQLA 2DW4A 2OZ6A 2TDXA 3CDLA 5IYBJ 4EATA 1KA8A 1IO2A 1MZBA 3E7LA 4ZYDA 1BN5A 5F1JA 2RGVA 2BBYA 3S17J 1SFOJ 2VB6A 3GFMA 2GIZA 5D6FA 5HS8A 4BE1A 3HPHA 1FTZA 1XSVA 1USSA 4OAYA 1H0MA 1EKEA 2F4MB 1JKPC 1DU0A 5TJJA 4HNTA 3G1LA 2M4GA 5C4XJ 1SD4A 4HNVA 1LFUP 4IHSA 2X4HA 4NC8A 2XKOA 2JT1A 4XLEA 5LEJA 3DWLE 1G3SA 2IGNA 4WXHA 3EUAA 4MLOA 1LPQA 1ENHA 1OMIA 3JRIA 4DQ2A 1MMDA 2X51A 3LSJA 3RZDJ 2PMUA 4QTRA 2DU9A 1T98A 2DT6A 1IN4A 1I39A 2Y0MA 2IS1A 1A35A 1MSFC 3PL8A 4GXOA 1XS9A 1W7PB 5B66C 4JX5A 4UVAA 1NK3P 2X6OA 5FRNA 5L3DA 3QP6A 1ETYA 2ISYA 1A6IA 2NVQJ 2JRTA 4OIPF 2OF7A 4XLHA 1HW1A 5FFZA 3BROA 5IP7J 2DYRH 2HU9A 5GPAA 5L3FA 1S7AA 3MKYB 1OLTA 5A2QK 4ZTFA 2WTEA 5C4JJ 1K4TA 2B0LA 3CDHA 1G3YA 2KT0A 1Z9CA 5DV5A 1SFXA 2ME0A 4OIOF 1IUYA 3BTLA 5B1BH 4CICA 3OYAA 4MTDA 4R1HA 1ZELA 3LQQA 2O7OA 4XRSG 3HG9A 1D0YA 5ERIA 5F1RA 1RRJA 1R1VA 2RREA 3ZQFA 5EF6A 1BIBA 1AU7A 2E1MB 1XB4A 1WJFA 3GWZA 2DMPA 3K6GA 3KLNA 5KNLA 1MBGA 2VPLA 4UV9A 4R8HA 2V1UA 3OSFA 3ABUA 1LEBA 1MMGA 2XGCA 4HQMA 1FTTA 1IF1A 3OWTA 3RKXA 4IL6C 4KMUX 2HZTA 2X6YA 5K5QA 1XX5A 2V9KA 3SZGA 1BR2A 3K4KA 4G6QA 4CZZA 4RB3C 1RKWA 1E3HA 1WKMA 5F0HA 2CV1A 3ABKH 2ZSIB 2ELKA 2A61A 5HVQC 4A0XA 2C6YA 2B7EA 1D1BA 3OIOA 1LUJB 1X1PA 3FMRA 4P9FA 1QQIA 1NHAA 1H9GA 1EH7A 4F3QA 1G6NA 5HLTA 2PEXA 4ZH4F 5E1WA 1OYWA 3RPUA 3E0JB 3DV8A 3PJRA 3GO5A 3V8JA 3ZQLA 5CJ9A 3O2PE 3QAHA 1MBJA 3CUQC 5J6XA 2IXSA 3M1CA 1RC9A 3JRFA 3OIPA 4MNUA 3S3OA 5JLWA 4GGGA 1WRJA 3I3LA 1O3QA 3S1NJ 4KN4X 2R5YB 2EILH 3W6KB 1T08B 3G4SI 3P9CA 5E8GA 2QQ9A 3NAUA 1QNTA 3HRUA 4XR6A 3WTXC 1Z7LA 3BZCA 3TO7A 4M3BA 4CCJA 2L01A 2LG4A 3S32A 4BEHB 3VSKA 5CQEA 1D3YA 2P8TA 1XN7A 1X1CA 1W5CC 1WFXA 1KYZA 2IT0A 5FKNA 2E19A 2VXDA 4L5IA 3Q9VA 3D5LA 3RIRA 2FU4A 2OQRA 2M5WA 4KUMA 3CCMI 2M7AA 4BYYA 2PFBA 1O7LA 3D5RC 2ZO4A 1RKTA 1T0FC 4HV5A 2LF7A 1R9TJ 2DA6A 3GFIA 3X2QH 4A0ZA 1QZZA 1W5TA 5E3MA 1VQ6I 4LLLA 2GQQA 4NDLA 4IJAA 1MMAA 2X6WA 3E5XA 2GOXB 3A02A 3PNVA 4E7ZA 3JRDA 3OYBA 2X0LA 3K4LA 5FO5A 4HBLA 2WY8Q 2BVMA 1C0WA 3WG7H 1V5EA 2GA1A 5BOXA 3M7GA 1UG0A 1T6SA 4IEJA 2AQFA 3DU6A 1P2FA 4WXDA 1FOKA 2QVOA 1YE9A 3IHUA 4MEXF 3TMOA 2VN2A 3H0GJ 3LL7A 2G7HA 3I54A 2HPMA 2AXTC 3F9KA 4GCVA 1YQAA 2UV1A 1TWCJ 1U9NA 1VNDA 3SJMA 1JJ6C 2CMPA 3HJEA 1VFCA 2E7XA 2M7BA 4HZFA 3QRFF 4XKVA 4UB8C 4HX8A 4ON0A 4UVBA 4GO1A 1ETQA 4ZDPA 3CMMA 1K7AA 4UUSA 2EA2A 2XB0X 1WSUA 2EIJH 4IO9F 1LNWA 4KNYA 3OV8A 3PIOF 3WHCA 5C3EJ 1YX5A 3VPRA 3GFLA 3HOVJ 1GXQA 2YUSA 4Y33A 5DTDA 3MFKA 4PJLA 1MDMA 3U2RA 4EEFG 2MGQA 3K4JA 2A68F 3FXQA 4RGUA 1FY7A 2IJLA 3ABLH 3KP4A 2XF5A 2ZXWH 5IT9K 4M9XA 5J8CA 2QF7A 2JSPA 3T8TA 1YW7A 4U0YA 3PUFA 3VWBA 2CUJA 3MVPA 2WBMA 1W7PA 1LKXA 1FYLA 1VTNC 4QWQA 1V54H 2A5YB 2NS0A 1YJNI 1SVMA 3CLQA 5JR3A 2LY2A 1JXSA 3WTVC 2RQQA 1UHSA 3ZMZA 2IA2A 1V5GA 2R7VA 3J80Z 3BY6A 3E6DA 1T38A 2R7FA 4MFDA 2Q0OA 3S2HJ 2HOTA 2DODA 5D4RA 2O9LA 2LBFB 5AONA 3RQ4A 4BBSJ 1KONA 3O6BB 1O57A 1Y1VJ 3ESWB 1WHUA 3HHHA 1WJ5A 2LSOA 4EGZA 4XSXF 2F5FA 4ESFA 4A0YA 4G7OF 4UXNA 4DGWB 2ISZA 4E6KG 2P7CB 3DKXA 3TOAA 3EYIA 5KAIC 4PCQA 2LH9A 4G7HF 1IZ1A 3V7SA 3IAS2 3ERED 1BC8C 1XCBA 1U8RA 1GXPA 3H3ZA 1R00A 4AU7A 5JVTA 5K1YA 2NVXJ 4CCLA 2XV4S 3CJRB 1WJCA 2O5RA 2LR8A 4N4OB 5D5UB 2HQ5A 2NXNB 5JLXA 5J1YA 3BR2A 1O3TA 1BOAA 4C9YA 5EJCA 5J4YA 2R93J 3FXMA 1POGA 3KYCB 4ZDOA 4OU0A 5F08A 3QPLA 3A4CA 1JHFA 2KIQA 5FKMA 3ASNH 3KX2A 3NWTA 2ZFUA 4L5JA 2MD0A 5D8KB 1Z0XA 2M8GX 3V4GA 3HIFA 3BQYA 2OC6A 1HOMA 2DXIA 4HX4A 1FP1D 4Q4ZF 1JT0A 2EV5A 2LKSA 1YIJI 2EJRA 3ERMA 1U5TC 4HX7A 2M0MA 4PZJA 4C3IJ 1K4SA 1J9IA 2F2EA 2M45A 1TWAJ 2R7DA 2LREA 5IYDJ 3PIPF 3LSKA 1GDTA 5ICFA 2MLGA 2LKPA 1E2XA 3ZMUA 1AKHB 3CMAI 1GUUA 2FMLA 1ZKGA 3CCJI 2DOFA 3E5UA 2Y9ZA 2FF4A 2Z3YA 2K85A 3KETA 3HB9A 4D5CA 2EFWA 3ISPA 3IWFA 2B9SA 2AQEA 5EEHA 4N9HA 2M0CA 3OIQA 2BHZA 3AL0C 5LGNA 2ESNA 5K7ZA 3GMEA 4A3GJ 2VPRA 3FXKA 1TTYA 2Y30A 4RGXA 5CLSA 2JA7J 2HKXA 2XGXA 1X1AA 1YYVA 1DDNA 3TOBA 5HLGA 5LEKA 2Q1ZB 2L5QA 3R4KA 4RAYA 1FT9A 3JW4A 4OMYA 3AFHA 2FOWA 2IW5A 5BMZA 3V7CA 1U8BA 1IRGA 3IH3A 2CYYA 3FHZA 4V19K 2OJED 4XNFA 3LOCA 1HKSA 4HPQA 2RKHA 4MFEA 2XAGA 4Y3OA 5EGOB 4BE2A 3RYRA 1SD6A 2HKOA 1NG7A 3LMMA 5DCMA 1XCVA 2OA4A 2BE5F 3HTUA 3I9V2 1I3AA 2COMA 2NAZA 3HL2A 4XN0A 4BQNA 3BDDA 2HR3A 4AD9A 2XVCA 4AC0A 5EG0B 1QVUA 1AKHA 2MC3A 3HM5A 2XAHA 1J2XA 4ZZDA 1P9QC 3ROUA 2XPWA 2KIMA 4HOBA 1H8AC 1P7JA 1O4XA 2CU7A 3KP6A 4BY1J 1SD7A 2EB7A 2CV0A 1B6AA 2TCTA 1W36C 3R61A 1UFMA 3C2HA 1S3JA 3Q9SA 3HPGA 2CV2A 1J75A 5D6EA 2KRFA 4QLCU 1JTYA 2IP2A 2DA4A 3FZVA 3R0AA 4I02A 2BXZA 4B1RA 2OUMA 1FOYA 4BUPA 1PP8F 5JHFA 5LBQA 3LAJA 2MH9A 3CZ6A 1KYWA 2P0WA 2WWYA 3FBNB 3ZN1A 4J00A 1JKOC 2F5DA 1R6RA 2OQGA 2OV7A 1SMTA 4XL9A 2GIVA 1RUNA 5D8LB 4NUBA 1R4NB 1BI2A 3FXOA 3ZQQA 4EJVA 5DS9A 3LFKA 3OYNA 1IUFA 4HYEA 2HS5A 3LSGA 4JOMA 5LRSA 1SAXA 1HF0A 4NHJA 2Y75A 1DU6A 1DP7P 4NNJA 3DLLF 3C3WA 2E2JJ 5J1UA 3PO3J 4IZZA 2EZLA 2MC4A 4M3GA 1XMKA 2ZJRF 4BJTA 4ANJA 4BNCA 3MD2A 2EFOA 3ABTA 3M8FA 3N05A 3OYGA 5IYCJ 2VBZA 4B44A 2PBIA 1HDDC 2ZJQF 2G0EA 4CCMA 1S7OA 3DQVC 1MBKA 4UNOA 3OYFA 2HVRA 3J7AY 3A0HC 4KICA 1T8IA 4RBOA 1CF7B 3ZN0A 3CDIA 1G4DA 2JA6J 3CCEI 1T33A 3Q3SA 1SVLA 3CC4I 4D1QA 2L2OA 1MNDA 4P96A 4W1UA 1QU3A 4KDPA 1QZYA 3V8KA 3CQZJ 4J01A 3GLLA 4G94A 2HYGD 2I10A 4HSRA 3E1SA 3WTTC 3AG4H 2P6SA 4RAGA 4F52A 1HCRA 2CJJA 2M34A 2W7NA 3IL2A 2V9VA 1IDZA 1WWXA 1A04A 2IEKA 3VDXA 4DYCA 2DN0A 2VBXA 2DA5A 2HVSA 4V2GA 2F4OB 4KJZA 3JRGA 5CPRB 4QIWN 4WK8F 5FFXA 1IW7F 3DTEA 2XAFA 2DPUA 1R5GA 2JWTA 3T8RA 1FWZA 1IN8A 3OYIA 3OS1A 2MD5A 4BXUA 3QQAA 5DDGA 3K2ZA 2XRLA 1WZ2A 3B73A 3KP5A 1OISA 1DGRM 2DJNA 1Z67A 3L00A 5BPDA 4L5EA 4OMZA 1TWGJ 2XKPA 5E1XA 4AYBA 1T39A 3M4OJ 3PQKA 3W2VA 2Z9OA 1JUSA 1I50J 3H3VK 4LK1F 4YELA 4PUSA 2PJRB 3M8EA 3HC7A 3F6VA 3TDUC 4FASD 3K70D 3PFIA 3I0TA 1JGGA 3NWSA 1ONVA 1YLFA 4MIMA 1IV8A 4CH7A 4C30A 1P6RA 1YW9A 3L7WA 2BZTA 1OR7A 1CF7A 1IXSB 1DGWY 1I1SA 2Y0SA 2STWA 2XUBA 3DF8A 1I6XA 3LSIA 5J4VA 3TKYA 3BG9A 1PJRA 5CVIA 4RLFA 1UG2A 4PJ0C 1S9HA 3A01B 2GXBA 2L9RA 2G7UA 2QGUA 1Y1WJ 3T5XA 2DO7A 5IT9Z 1VQLI 2DTRA 4ENJA 4Y17A 2L7ZA 1HC8A 5LGTA 1UJ8A 1ZYRF 2V9PA 1LVKA 4ZYGA 2OZUA 3CMYA 5F27A 3GFJA 1KQ0A 5EG0A 1ZK8A 4IQ4A 4B3XA 1YS6A 5GADJ 4DBQA 3OYKA 2QBYB 2VODA 1ZAOA 2P4WA 1KGSA 2HDWA 3CCYA 3OOPA 4GYIA 4PSWA 1BC7C 3VODA 4DW6A 1U9OA 3HOYJ 2MH2A 3HOXJ 1R7JA 4IQJA 4MQVA 5B3SH 2PN6A 2XDVA 3FX3A 3GYHX 3F23A 3TO9A 2VQGA 3Q0WA 5CVUA 1O3SA 5M3MJ 2VE8A 2GOMA 4X1EA 3VSLA 5CYVA 1WH5A 3BR3A 4BS9A 5HLHA 2HOEA 2DDBA 2HPIA 4PJJA 3R0JA 2F48A 3TL4X 3B6AA 4FCYA 3AL0B 4CHUA 3HOWJ 4A3LJ 2WAFA 2R7WA 3TGNA 2ZJPF 4FHTA 4E7JA 2KJBA 2CH0A 2R5YA 1IJWC 2V6CA 2Z5UA 5H2FC 5TISC 1Z21A 2RVCA 4ZTJA 3FXLA 4HG2A 5HOOA 1KU9A 2HXIA 1IXCA 1TP4A 3FXRA 2XB5A 1HLVA 4HDUA 2LY9A 2R3SA 5EEGA 1FZPB 4AYBN 2CQXA 1MJAA 1ODDA 3Q0VA 4JQFA 1JUMA 1XPXA 3S2DJ 2QWWA 4QPOA 5M3FJ 1QPIA 1EH6A 1LVAA 4XOPA 1X3WB 1VQNI 2FD5A 1YG2A 2DMNA 2HVQA 5E8IA 4UHTA 4FTHA 2XPUA 3NRVA 2M8EA 4M3DA 4CDGA 1Z77A 1YI2I 2QQAA 1JT6A 3HSRA 1BBYA 2ID6A 3REOA 5BNGA 1OPCA 1EA3A 4LLNA 2LBFA 2FBIA 1B9MA 4U0VA 4ENKA 9ANTA 2CFXA 2QYOA 4IRHA 1FLIA 5HS9A 3B02A 3U21A 5F6FA 4EMSA 3D5SC 4HF2A 2CWEA 2EK5A 2VC0A 4O6JA 5AIQA 1A5JA 1D5VA 2CG4A 2VC1A 3BT9A 3MZYA 2DA3A 4B4CA 2WV0A 2XAJA 4RM3A 3SDBA 3H92A 1ITYA 5IPAA 4ZDLA 2VUMJ 2FOKA 2A6HF 2RNJA 5EEAA 5LD2C 5FRMA 1JJ8C 4EGYA 2K9NA 1EF4A 2IA0A 1J0RA 1VQPI 4F7ZA 3QU3A 2DA2A 2IGKA 3MZHA 1NG6A 1HW5A 1OJLA 2A6TA 5FROA 1U78A 1PUFB 3L9FA 4Z2YA 2P7VB 4CCKA 1APLC 4ESJA 3A0BC 3E6BA 1ETWA 1R1UA 5HNHA 4XLCA 2DLLA 3LSPA 2V4JC 1OYYA 3HKZA 1R1TA 2Q8KA 3GEZA 2X1CA 3S8PA 3WGGA 5EDNA 2WAQN 2ZKZA 1KU7A 5BS6A 2HOSA 4HLYA 4B48A 3WU2C 2VBWA 3GTJJ 3J7ZI 1I6HJ 5BQTA 2NNYA 2R7TA 4G8XA 3ZQGA 3QPSA 3FK7A 2PJPA 3TW7A 1BR4A 2CQQA 2HXOA 1ZH5A 3PM1A 1NH3A 3R60A 1FOXA 2EFNA 4IRIA 1BJZA 2CUFA 4I09A 3IRQA 4I0BA 2R5ZA 4XN3A 1O3RA 1LE8A 1NK2P 2PJRA 1LDKB 2Z2SB 3I71A 5ICCA 1JKQC 1K78B 1MMNA 4HV6A 1CGPA 1G3TA 4WCGA 3P9IA 1ZGJA 4RAZA 3CUOA 2FJ1A 4PFPA 2JRMA 4KITB 1B72B 1MGTA 2BVLA 1VZ0A 2PMZN 4LOCA 3S93A 4HLXA 1IN7A 1UB9A 3BZKA 2MSYA 3H5RA 2HNHA 2K3FA 1H88C 4PJNA 4II3A 3LNQA 5B5EC 3RSNA 3BR5A 2QQBA 2Y48A 3WU1B 1MSEC 2B63J 3KZZA 4BQOA 1BI3A 2OAZA 5A2QZ 3IC7A 1B4AA 1MBHA 4Y7NJ 2FRHA 3E3VA 2MG4A 3L2WA 3FKIJ 4R79A 1RZ4A 1TT0A 3CMEI 2E5ZA 2HI3A 2DDAA 2HDDA 4P55A 4E7IA 1LDJA 2Y9YA 3QYFA 1AA7A 2DK5A 4M6VA 4CGZA 3EDPA 3IRRA 3K4CA 1J59A 2LP0A 4XKBA 1FMVA 2E2IJ 1MKMA 1DPRA 2YX4A 3CUQA 3S3NA 2LD5A 2DJIA 1XMXA 1MJBA 1R5HA 4A6DA 2A07F 3J7AO 2R7UA 4IOAF 3F8CA 2DA7A 1MJ9A 3WG9A 3L2UA 4JX6A 2R7XA 4P5OA 2PG4A 4U87A 2DMUA 1OCRH 2K9QA 2QKLB 1YITI 3MKLA 2L9SA 4CO8A 2AO9A 2L9NA 3ZPLA 2XIGA 1AHDP 1BOBA 4X6AJ 2ZJ2A 1HSTA 3OR2C 1XMAA 2W82A 1E0EA 1B1BA 4CA0A 4XICA 2DT5A 3S1QJ 2V7FA 3C7JA 1WJAA 4AIJA 2VE9A 2J5PA 2EQRA 1LQ1A 2XPVA 3H5NA 2FQ3A 4D0PA 2ZXJA 5E1ZB 1HKTA 2VQHA 4UUTA 3TBIA 2E2HJ 1HQCA 3WHBA 3KFWX 4MGRA 4RGSA 5DYMA 2KIUA 3QU6A 3I58A 3P5JA 3DEEA 2IS6A 2L3DA 2KISA 4KIBA 2E1NA 3RPUD 2WC2A 2HWVA 2AS5F 3RDIA 4S04A 1OCTC 1XG1A 1U6GA 4IPAA 3K1PA 3KEQA 4HA8A 4UV8A 2BY2A 2M3AA 4A3BJ 2CQ7A 3SEQA 4U7BA 2FA5A 1Q1VA 1Z3YA 2L0KA 2IS4A 2VKVA 2YSRA 4I76A 4A3MJ 3HOZJ 1DPUA 1W1WE 4U0WA 4XK4A 3VYTB 3G1MA 3S14J 1WCMJ 2QEXI 4L9NA 1TQMA 1X4PA 4K2EA 1XGNA 3BR6A 3EUKL 1LFPA 4XRMA 2JVHA 6PAXA 4MTEA 4RM2A 2LMDA 1P4WA 5DEQA 5C44J 2QBYA 2KDZA 3DLAA 2FBKA 1FC3A 1XDUA 2L9VA 3DPUA 4EQQA 3OYCA 2OTJI 3QOEA 5IP9J 1HKQA 5FGMA 1HW2A 2R7QA 1LJ9A 1XDSA 3LAPA 2Z1DA 2BYVE 1O7FA 3G2BA 1VQMI 2W00A 4GYGA 4IHXA 1RESA 2MABA 3FM5A 1MH4A 4WWCA 2HYFA 5IY5H 2NS7A 4LK0F 3A2KA 3RCOA 5JHUA 2F4IA 1YX3A 4A6EA 3A01A 4I98B 1VQ8I 1U3EM 2R7OA 2KDOA 4D7MA 1P92A 4LD5A 5K7HA 2AXLA 2KZGA 5DCFA 1RUOA 5FLXK 3TO6A 3V8LA 3F72A 1GT0C 2ZSHB 3EUHC 3HKZN 2F5CA 1AWCA 3OYDA 2E35A 2EZHA 3GTKJ 2HDCA 2HTJA 2VKDA 4J19A 3CF5F 2K9MA 3LSMA 3BP8A 5KCMA 2LTPA 2I8DA 2V1XA 2M9HA 3BLYA 3KE2A 5GAEJ 3JTGA 2WB1N 2HQRA 4E7HA 3GTPJ 1OFCX 1ZLJA 1ZG5A 2JA5J 5KVRA 2QCOA 2DFFA 2XF7A 3WU0A 1Z3XA 5HNFA 2KRCA 4D9JA 3RQIA 1MDMB 2DTZA 2R7ZJ 2E60A 3ZXSA 4ZZLA 5KAFC 2A5WA 4Y13A 4BAYA 3IH4A 2K3PA 2L7KA 2DQRA 5J3LA 1MNMC 1XGMA 4IHTA 2D1VA 4B47A 1OKRA 1QA6A 3GXOA 3FMSA 3IKVA 1I1GA 1B8IB 2P5VA 1QBJA 1OCZH 3F0CA 3GTQJ 3F8NA 2A3SA 1BJAA 4KT6A 2LVSA 3F6OA 1N25A 4YIRX 2QENA 1R36A 1G3WA 3DBHB 3W2WA 1MNEA 3ZQ7A 5J47A 3M3YJ 2M4KA 1IXRC 2Y2ZA 1OCPA 2FNAA 5HODA 2X6XA 3MZ8A 3K2AA 5GTHC 2DFHA 2GZWA 1AOYA 1TQPA 2CGPA 4RA2A 2ACJA 1QHHD 3ZRGA 4LLGF 5F0FA 3DPLC 2EZKA 3FBIB 1ZARA 2QA4I 2H8WA 1PVEA 3C18A 4CXFA 1YHQI 4AVPA 3JAMZ 1Z91A 2YU3A 2ELJA 2VQCA 4JP0A 3CP8A 2EIKH 2KHMA 3AG2H 4RB2C 1B72A 3WE2A 1M1EB 2KLOA 3L2RA 1TL8A 1SVOA 4NC6A 1XGOA 4E7SA 2UXXA 3LWFA 1XD7A 2TRTA 5LGUA 1YTYA 2NVYJ 3UKGA 1J5YA 1OR7C 2LRDA 3Q5FA 3BR1A 5ILUA 3H1CA 2L7FP 4O5VA 4RDUA 4ASNA 3FISA 4FX4A 4DZPA 1D1CA 3FDYA 3NARA 2E7WA 3OS2A 1MMSA 3KIOA 3PUBA 4WX9A 2M2EA 4EVIA 3AKZA 1U0JA 3HTSB 4XM3A 5CVJA 2VL8A 2H1KA 5H20A 4IX7A 1WJEA 3JSOA 2V79A 1H89C 4IHYA 1YRNA 4F91B 3SXYA 1SMYF 1YW8A 5CVVA 1K6OA 1D8KA 2EWNA 2D1HA 4NQWA 4PJMA 2QM3A 2P81A 4B8XA 4CSWA 1ETXA 4PDKA 2KRHA 3BG6A 4GRIA 3DTKA 3S16J 3W3CA 2ZMEA 3CCRI 2DFIA 4GDFA 4CYDA 1YJWI 5DCMB 2K27A 5FLXZ 2OCEA 2R0QC 2RAEA 4P1WA 2IBDA 5JVGF 1X1DA 2A69F 1ZG3A 1BI0A 1J09A 4XKWA 5E18F 1YO5C 2W24A 3K1MA 3VEPA 2EH3A 4BXFA 3S15J 4N4NB 4N9IA 2E1OA 4E7KA 2K5CA 3RI4A 2HQAA 2LFBA 1RR7A 1ZG1A 3EYYA 3HEFA 3PSFA 4NQWB 1VI0A 1SEUA 5E3NA 2WAQA 1BI1A 5F64A 5E79C 4BU2A 1ACIA 2VBYA 3UNGC 1IN5A 3DKYA 2ME6A 2DMTA 3K10A 3SFIA 3ONQA 4L0ZB 3QYEA 5J1RA 1U2WA 2DPDA 3ZMTA 5IP6A 4WXCA 4FE4A 4ENMA 4S0HB 4U7DA 4XKCA 5B1AH 1FPQA 5J8FA 2H27A 4DOZA 4M9SA 2HQNA 4HRIA 4B3AA 3PFYA 1RETA 3GW2A 4XLFA 3NEUA 3QYBA 4XLPF 4CYCB 1IDYA 1BA5A 2IAIA 4PK4A 3K69A 4C2TA 3HRTA 3I4NJ 3W6JB 3KLOA 4EM2A 3HOTA 4LG3A 1TWHJ 4EJWA 3N4MA 1EJ9A 2V6EA 3SQNA 2H09A 3KEOA 2FBHA 2XAUA 3FIWA 3KCCA 1D0XA 2CW0F 2DFEA 1T2KA 3TP0A 4M73A 2X1EA 1IAWA 4IKFA 2DK8A 2OBPA 4G7ZF 4KFCA 1PP7U 3S1MJ 1RNLA 2DT7B 3IV5A 2OD5A 2VJJA 4X0GA 3HXLA 4OOIA 1ZGAA 1R5ID 3HOSA 5LFAA 2XROA 2DMQA 1FYMA 2DOEA 3U9GA 1FBSA 5IOYA 2E1MC 1STZA 1T95A 1Y8QB 4FETA 1VQKI 4C3JJ 4OINF 4UVCA 4A3CJ 2OTLI 2KMUA 3F8MA 5FLMJ 3K1NA 1GV5A 3BPVA 1NTCA 3M9AA 3ZCOA 2VONA 3DBLB 5E3LA 5TRDA 5GAHJ 2VT2A 1TBXA 2M1BA 2ECBA 2ADUA 2WA0A 2X9DA 2IRFG 2JA2A 2Z16A 1PUFA 5H6RA 1ORKA 5K5OA 5DM6F 2CQKA 2ZNZA 2ZXHA 2AHQA 1CQTA 1IRFA 3HBLA 2QSHX 2V26A 1TW2A 2HFHA 2E34A 2KIFA 1N77A 2MA3A 3OL3A 2G9WA 1S5LC 1FBQA 2JPCA 2J5OA 4E70A 2EV0A 3FF5A 4KYWA 1S72I 4IVNA 2LOOA 3BC8A 1Z7UA 2ZXIA 2L7MP 3GF2A 1R22A 3VYUB 3BZ6A 1Y39A 3CUQB 1D5YA 3I59B 1RR8C 4BJ5C 4D7NA 1WQ2A 3BWGA 3H9JA 5JI6A 2K4JA 2ZNYA 3CD6I 3MQ0A 5J40A 3CJNA 1GV2A 2QQ8A 5K5RA 2EFPA 2IGMA 2NS8A 2XASA 4XRSA 1KU3A 1LDDA 2LNBA 1VQ5I 2IA1A 1G59A 1TT5B 1ZHFA 2YX7A 3JRAA 3COAC 5GAGJ 3CC7I 4RB0A 3LA7A 3BJOA 1YRNB 4CCNA 4DJAA 2VASA 1P7IA 1Z05A 1F43A 2K4BA 3CC2I 3KYLA 5EYRA 5FD5A 2A05A 3QWLA 4DZJA 2CRGA 3E97A 1TLHB 2FNPA 4OAZA 2F5EA 3RTRA 4Y15A 3U1DA 4A5MA 4ESBA 3LA3A 2FXAA 1IRZA 2O3FA 1KU2A 3DXJF 1RI7A 3O8GA 3FWEA 1IC8A 3SDGA 3HUGA 1IRXA 4M3EA 2FQ4A 3O3KA 1FEXA 3MWMA 4LGWA 4A3DJ 3GBGA 3CP2A 4FT8A 4XBFA 2K40A 2UZKA 4L18B 1Y8RB 4E7LA 2GXGA 1UELB 2Z33A 2JQ7A 2WB1A 3BG5A 1FIAA 4JK1X 2RC4A 3WTWC 1FSEA 1TW3A 1FJLA 4TV7A 1TQIA 4D5FA 2KKOA 1ZREA 4OWRB 4L0YB 3V7RA 4HAMA 3FMQA 5D5VB 4QPQA 2D5VA 2H94A 4M3FA 4BQAA 1N78A 4PGHA 4BBRJ 1WPKA 2Y69H 1MD0A 3FM3A 3VOEA 2WV1A 1UZCA 2O8XA 1YFHA 1QO0D 5E17F 1U5TB 1SAUA 3IWZA 1F1ZA 2RNGA 4JBAA 4XMYA 2CW7A 2WY7Q 2W25A 2VOPA 2DAOA 2JN6A 2MW8A 4KT5C 3OY9A 5KHDA 2QUFA 1KQ8A 1DUXC 2RN7A 4QSHA 3RYPA 4ITVA 2H8RA 4ETSA 1VQ4I 2NOGA 5LHHA 3GUDA 4AWXB 3R6SA 3RZOJ 4BHPA 3RKWA 2HGCA 1X3UA 1S6LA 5EZGA 5HDNA 1V3FA 1F36A 2VJIA 3HZJA 2WADA 2P6TA 2XSJC 3KP3A 2EZIA 1ZLKA 1EH8A 2DCEA 4UY8I 3N97A 4M6YA 2FMYA 5AIPA 2MLKA 1HXDA 2PLYA 1VQ9I 1JHHA 3LSRA 1LB2A 3HRMA 1SFUA 1JKRC 2P5KA 2K9LA 4YFKF 4FISA 3BOQA 2KPMA 4MHGA 5LHIA 2ZC2A 5M5YJ 3MKZA 3JSPA 2IGOA 3JTHA 2DQLA 2V1NA 1T56A 3ULQB 3H3UA 2BW3A 2K9SA 4LFUA 4DIQA 4I01A 5E3OA 4A3EJ 1BL0A 2NRAC 2ZMEB 3CJQB 5CKTA 4KMFA 1LFBA 2E71A 1I3QJ 1LEAA 4EJUA 1E17A 4IOCF 2O8KA 3I59A 2O6GE 2W4SA 2XRNA 3L1PA 2EV6A 3DEUA 1DQUA 2Y0SN 3EUHA 1X1BA 1BM9A 2VJ5A 3DU5A 2CW8A 3QOPA 2ZBKA 3NQOA 3PQJA 4B43A 1EV7A 3AAFA 3QPTA 1BIAA 5ICEA 2IVMA 2X85A 4EM1A 4YFXF 3AG1H 5F0CA 4UUVA 3GZ5A 1Z6RA 2CSOA 3WTSC 4KA4A 1K79A 2BY0A 1Y0UA 4IRGA 4L9VA 4BL0B 1ON2A 2DYSH 5DUIA 3C1DA 3L2VA 5ILVA 1VQOI 5L3EA 4Z6YA 2XF6A 3OYMA 3UR3C 2HZDA 2L02A 4BJ6C 1HA8A 1OQYA 2KQRA 4XOTA 4BHCA 2HYJA 1BR1A 4YG2F 3AG3H 4XONA 3ZQIA 1TNTA 2LF8A 3O8HA 3LFUA 3JRCA 5BPIA 3PO2J 2E1CA 2JPBA 2PMZA 4MEYF 1ZRCA 2FSWA 4L9JA 3GTGJ 2LK2A 4G12A 4JYKA 1DP3A 3HOUJ 3GTOJ 2ECCA 2EIMH 4C3HJ 4B09A 3BCAA 1FX7A 5L3CA 3I4MJ 1JGSA 3DFGA 4UB6C 3B6CA 4GFBA 1REPC 2BW3B 4II2A 3GLXA 4G6DA 4BH9A 1OCCH 3L2CA 3RPQA 1I27A 5FKLA 2QKMB 4Y4RA 3A1YA 3HSEA 2W85A 4RGRA 3ECOA 1L3LA 1R4MB 4PSXA 1ZGWA 3MAJA 3DCFA 4XLAA 3E6CC 3GX4X 4BEHA 2ID3A 4LIUA 3JCUC 4BDZA 2VKHA 3MCZA 3ZMVA 3DBRB 1K6YA 1ZN2A 2RDPA 3ZP5A 1MIJA 1Y6IA 1PUEE 1SC7A 4RB1A 3CCSI 3EETA 1FMWA 3JRHA 3TDZC 3BTIA 2E5NA 2KZVA 4XIDA 2H1LA 2KFDA 4LG0B 5LLQA 1ZTRA 3G71I 1FBUA 4M9ZA 3OYHA 3H0DA 1W4MA 3BJAA 1UMQA 4AUXA 3GVAA 3CLOA 1YS7A 5E20A 2UWMA 2ZB9A 4ABZA 3GZNB 5L3GA 3LA2A 3ABMH 3OYEA 3EPZA 3WTYC 3MN2A 3CJTB 5GP9A 1W7PD 4IHVA 3L09A 4Y52J 4KN7X 4L9TA 3DKWA 4A93J 4M6XA 3ZOBA 4E4HA 5FB2A 1V5FA 3HRSA 4ZYAA 3K7AJ 1B59A 1R71A 2JVGA 2FUG2 4BGDA 3W2AA 1Y0NA 2JUCA 1G8XA 1P4XA 5M5WJ 4HF0A 2D45A 4KISA 3GZ6A 1WH7A 3PNYA 4A3IJ 3K9TA 4CCOA 4Q48A 3CTAA 4G9YA 2M87A 1W0UA 2HTSA 2X48A 1W0TA 4CZCA 3VYRB 2DBBA 4MO7A 2XSDC 1OCOH 1BW6A 3DP7A 3LQRA 4S05A 3H35A 3FXJA 4NB5A 2N8GA 3K4BA 5FD6A 3I56I 4KIFA 4EJTA 4F92B 3G6EI 3I55I 1G2HA 2GA2A 3HUGB 3H9GA 3Q0UA 3U1KA 5DUKA 1FYKA 4G6TB 1Z6TA 2R4GA 3E6MA 5ED4A 1MBEA 2QSFX 1ETOA 3CO6C 3F3XA 2NOJB 1B8IA 2DI3A 1XTAA 5HS7A 2STTA 2D2WA 2L54A 2M30A 1FNNA 1VF9A 3K4NA 3SEZA 4HDVA 3QODA 2EPFA 5M5XJ 4HQEA 4MQ9F 1FIPA 2PI0A 1E3PA 2YPRA 2RV8A 2VT3A 1X3ZB 3G73A 1ON1A 1IGNA 2H6CA 3DTIA 2FE3A 2GBYA 2COBA 4WF2A 1WI9A 2ZMEC 3HGYA 3KZIC 3PNTA 2XHKA 3CESA 5FKKA 1R23A 3KPHA 2ZFWA 4EV0A 1HSJA 2XGDA 1IV6A 3VFZA 1A36A 1QRYA 5JFRA 1F5TA 3FKJA 5F04A 4YEJA 2CS3A 3D1NI 3RJPA 1FSHA 3EQLF 4LIVA 3J7YJ 4AIKA 1SFKA 1ETVA 3BR0A 4V2FA 3BG7A 1WGXA 5KK1A 3IH2A 3K0LA 5ILSA 1Z1DA 3CCQI 4YIFA 2LY1A 5HDGA 2O03A 3QP5A 2ZCWA 2EINH 4YIIA 2KJCA 1OYIA 2W48A 3OL4A 1P4AA 2R5ZB 1PDNC 1MH3A 2K86A 2JK3A 1RPWA 3J81Z 2QZ8A 1A31A 2BOLA 4C2UA 1X2NA 3SZTA 3RKYA 2W1OA 5K7FA 1J7KA 3OYLA 4BY7J 2GLOA 2UUZA 1L0OC 1WJDA 4BDYA 3OR1C 1V55H 4YFNF 2VJ4A 4BXXJ 3D0SA 3C2BA 1SANA 2RQPA 2A6EF 5IT3A 1V4RA 3S3MA 3CCVI 4XRFA 3LSHA 2DA1A 4H4KC 4HSTA 3ECHA 3A03A 3F21A 2W57A 2GXAA 3KEYA 4H0EA 3E5QA 5LRRA 1TC3C 4BHBA 3PSIA 2BY1A 4N0BA 2R7RA 4IHWA 3LSTA 4DBRA 4A3JJ 3JR9A 3ZGKA 4HNUA 1Y56A 1UAAA 1SD5A 3ASOH 1A6QA 2X1DA 3KP7A 4ZYHA 3TW6A 3DPTA 2CO5A 4A69C 2W84A 2VOOA 2CUEA 3JRBA 2FX0A 3G3ZA 5IOZA 4BKXA 4Q5SF 5EGOA 2EFQA 1K61A 2BGCA 4RS8A 4A12A 4EM0B 2DOAA 1ZRDA 1XSDA 4RAFA 3KYDB 3SFZA 1Q1HA 2PX9A 4IF4A 3IAM2 2R7SA 4A3FJ 1W5SA 1X2MA 1XGSA 3CO7C 1S7EA 3IUOA 4HF1A 2VIXA 2K7LA 2VLAA 2O0YA 3KP2A 3K70C 3BTJA 1B9NA 4XQFA 1R49A 2GAUA 3G1OA 5D5XB 4O3MA 1F9NA 2GWRA 2JZYA 3HHGA 4C2MJ 1S29A 3C2GA 4AIDA 4YRVA 1SFEA 3BG3A 3T0YA 1F4KA 1FOWA 2EA4A 2KP6A 3WGIA 1FP2A 1MBFA 2NVUB 2LKXA 3HYIA 2LLKA 3BCBA 3CCLI 2JSCA 1X4OA 1IN6A 3SZPA 4FQGA 4XSZF 3VYSB 3JAMK 1H9TA 4A5NA 1ETKA 2R92J 4AM3A 4P9UA 4I7HA 4DYRA 2XGEA 4LG0A 4I2OA 3WODF 4DYQA 1TWFJ 2KL4A 1K83J 1TNSA 4AIHA 3CCUI 1JTXA 1ZRFA 2OU2A 4CYCA 3H9QA 2P5LC 1JI8A 5D5WB 4OIRF 4ZYEA 3J81K 1QHGA 3H36A 4KIGA 1YJ9I 2CUZA 2BHYA 4F93B 1UHMA 4OIQF 1X58A 1PYVA 5EZHA 3GTLJ 3ELKA 4BE0A 3BJ6A 4JX4A 1X19A 2ELHA 1IG7A 2Q2EB 2GM4A 1QGPA 3DEWA 3WTUC 4BACA 2L4AA 1RIOH 2JTVA 2IS2A 4XORA 2Y31A 3H5AA 2HOAA 2QLZA 3ZR8X 5HLIA 4W97A 4A2UA 2JMWA 4M71A 3J80K 1E3OC 1JUPA 1N75A 3K4MA 5CQGA 3OS0A 1YIOA 1R58A 4FX0A 4M74A 5H6QA 2VKEA 5CVRA 5FJ8J 4ZJZA 5GTIC 2K02A 3MMYB 4XLNF 1KZHA 3BQZA 2ESHA 3ZMDA 1D0ZA 1QZEA 3I64A 4LB6B 4I6ZA 1D8JA 2BY3A 1GHCA 3BPXA 3OYJA 2ICWG 3S1RJ 2O61A 2QSGX 3ZQHA 2Z99A 2BV6A 1I5ZA 1ULYA 2XC7A 1UHWA 2OCCH 3FHNA 2EBIA 4RMNA 3F8FA 3WTZA 1LE8B 1S8NA 4LB5A 1GVJA 3QPHA 2H6BA 1QPMA 1JE8A 4AVZA 4A3KJ 3I5UA 4Q47A 3OSGA 5D4SA 2VXZA 3IKTA 2I5UA 4NBQA 2L4MA 4IXAA 3ZQCA 1ZR2A 1HBXG 1ZR4A 1K78A 2YU9J 1MW7A 2HEOA 5FLVA 2F6CA 2PMHA 3V42A 2Q2EA 3SHFA 3OOUA 5L3BA 3HSFA 4CUGA 2JA8J 4LMYA 3JREA 2MFZA 1D1AA 4LJZF 3WGHA 3P9KA 3TP3A 1HDPA 2NNNA 5LHGA 1T0FA 5FKOA 3OMYA 3M1EA 5DD8A 2MYSA 1GLNA 2LDUA 3SYTA 3ML6A 4HW0A 2V1DA 4DNCA 5DM7F 3MKWB 3TQNA 5ICGA 2WAEA 5GPCA 3FK6A 1WVRA 1TZLA 3KZYA 2NVTJ 3VB2A 1WJBA 1KQ9A 1XC5A 1USTA 4PGGA
chains in the Genus database with same CATH topology
1WCMJ 4FE7A 2JJ7A 3HDDA 3RZOJ 2OPTA 5EZGA 3BR6A 1WI3A 1F36A 1BW5A 4AC0A 5EG0B 1QVUA 4XRMA 1AKHA 3HM5A 2EZIA 4UUSB 5C44J 3HGGA 2KDZA 2XPWA 1H8AC 1P7JA 3RKQA 1O4XA 2YS9A 3W6VA 2CU7A 5IP9J 3LSRA 1JKRC 4BY1J 2TCTA 1ZQ3P 4FISA 3GTMJ 5M5YJ 3BTCA 1JTYA 2DA4A 1T56A 5E3OA 4IHXA 2K9SA 1RESA 4A3EJ 1BL0A 4B1RA 1MH4A 1LFBA 2NS7A 1QVTA 1I3QJ 1JKOC 3A01A 1GVDA 2O8KA 4D7MA 5K7HA 3L1PA 2Y0SN 1GT0C 3HKZN 5DS9A 2VI6A 2EZHA 3GTKJ 3TEDA 1IUFA 3LSGA 3CDLA 5IYBJ 4J19A 5F0CA 1HF0A 1DU6A 3E7LA 5F1JA 3S17J 1SFOJ 2E2JJ 5J1UA 3PO3J 2LTPA 1FTZA 2EZLA 2M9HA 4M3GA 1DU0A 1JKPC 2WB1N 3G1LA 3GTPJ 1OFCX 5C4XJ 4HNVA 1LFUP 5IYCJ 2JA5J 1HDDC 2HYJA 2QCOA 2G0EA 3ZQIA 3O8HA 1MBKA 4MLOA 3JRCA 2R7ZJ 3RQIA 1ENHA 2DTZA 3PO2J 3JRIA 3RZDJ 3LSJA 4RBOA 3IH4A 2JA6J 3GTGJ 2LK2A 4G12A 1T33A 4JYKA 3Q3SA 4QTRA 3HOUJ 3GTOJ 5J3LA 4W1UA 1MSFC 1MNMC 2ECCA 4C3HJ 1XS9A 3CQZJ 4JX5A 1NK3P 2I10A 3I4MJ 2X6OA 1B8IB 2NVQJ 1ETYA 1A6IA 3B6CA 4GFBA 2OF7A 1HCRA 2CJJA 5IP7J 3F0CA 2M34A 5GPAA 3GTQJ 5FKLA 1IDZA 2IEKA 2LVSA 4DYCA 1ZGWA 5C4JJ 2DN0A 2KT0A 3DCFA 2DA5A 2ME0A 4V2GA 3JRGA 3M3YJ 3BTLA 4QIWN 2Y2ZA 1OCPA 5HODA 2ID3A 3K2AA 2O7OA 4XRSG 2JWTA 3ZQFA 5EF6A 3QQAA 1AU7A 2XRLA 3JRHA 2DMPA 1MBGA 2DJNA 5F0FA 2EZKA 3BTIA 4L5EA 1TWGJ 4XIDA 3M4OJ 3OSFA 1ZTRA 4JP0A 1B72A 1JUSA 1I50J 3H3VK 2XGCA 1FTTA 1UMQA 4AUXA 1RKWA 2TRTA 1JGGA 2ZB9A 4ABZA 2NVYJ 4MIMA 5F0HA 3UKGA 2ELKA 3BR1A 2L7FP 3MN2A 5GP9A 4RDUA 4IHVA 3FISA 4Y52J 4A93J 3OIOA 4DZPA 3NARA 3ZOBA 3K7AJ 3BG9A 5M5WJ 2M2EA 1UG2A 1WH7A 3ZQLA 4A3IJ 3A01B 2L9RA 2H1KA 1Y1WJ 1MBJA 3JRFA 1W0UA 1H89C 2X48A 2L7ZA 5JLWA 1W0TA 4MO7A 2XSDC 4IHYA 3S1NJ 1BW6A 1YRNA 3CMYA 2R5YB 2N8GA 5F27A 5EG0A 1ZK8A 3NAUA 2P81A 1G2HA 4M3BA 1ETXA 3Q0UA 3S16J 3CCYA 1MBEA 4DW6A 1ETOA 1U9OA 1B8IA 3HOYJ 3HOXJ 2R0QC 5FKNA 2RAEA 2E19A 2IBDA 1VF9A 5M5XJ 2EH3A 3Q0WA 3S15J 1FIPA 2E1OA 5M3MJ 4X1EA 1WH5A 3BR3A 1RKTA 2LFBA 1RR7A 1IGNA 4FCYA 2GBYA 2COBA 3B6AA 3HEFA 3HOWJ 1R9TJ 2DA6A 3HGYA 4A3LJ 1VI0A 5E3NA 5E3MA 5FKKA 1IV6A 2XGDA 1QRYA 2ME6A 2DMTA 4NDLA 3SFIA 5F04A 2R5YA 1IJWC 3D1NI 5J1RA 3A02A 2HXIA 5IP6A 3JRDA 1ETVA 2XB5A 4FE4A 3BR0A 4V2FA 2LY9A 1HLVA 1WGXA 4AYBN 2CQXA 4S0HB 3IH2A 3Q0VA 1JUMA 3S2DJ 5M3FJ 1QPIA 4B3AA 4IEJA 1RETA 2FD5A 2W48A 2DMNA 2R5ZB 4FTHA 1MH3A 2XPUA 3H0GJ 4CYCB 1IDYA 2JK3A 1BA5A 2IAIA 1RPWA 4M3DA 1Z77A 1X2NA 1JT6A 5K7FA 3I4NJ 1TWCJ 4BY7J 2GLOA 1U9NA 1VNDA 2ID6A 3SJMA 1JJ6C 1TWHJ 4BXXJ 5BNGA 1VFCA 3C2BA 1SANA 9ANTA 3FIWA 2DA1A 1ETQA 3A03A 3TP0A 1TC3C 4UUSA 1A5JA 2XB0X 3BT9A 4IHWA 3WHCA 2DA3A 4B4CA 5C3EJ 4A3JJ 3JR9A 3S1MJ 3VPRA 3HOVJ 3IV5A 2YUSA 5DTDA 5IPAA 1ITYA 2VUMJ 3TW6A 5EEAA 4EEFG 4A69C 2MGQA 2DMQA 2CUEA 1JJ8C 2K9NA 2FX0A 5IOZA 3JRBA 4BKXA 1EF4A 5EGOA 5IOYA 1K61A 2DA2A 4C3JJ 2QF7A 1OJLA 1U78A 1PUFB 4A3CJ 1APLC 5FLMJ 3MVPA 1GV5A 4A3FJ 1NTCA 1ETWA 1X2MA 1S7EA 5E3LA 3LSPA 5EDNA 2WAQN 2ECBA 3BTJA 2X9DA 2HOSA 3G1OA 1PUFA 1ORKA 4C2MJ 3GTJJ 1I6HJ 3BG3A 1UHSA 3ZQGA 1MBFA 3QPSA 2LKXA 2AHQA 3FK7A 3TW7A 1CQTA 2CQQA 2HXOA 2LLKA 3HBLA 3PM1A 3S2HJ 4MFDA 2HOTA 1BJZA 2CUFA 2R5ZA 2O9LA 1NK2P 1LE8A 4BBSJ 1JKQC 1ETKA 2R92J 1Y1VJ 4DYRA 2XGEA 4DYQA 2FJ1A 1TWFJ 1K83J 1B72B 1JTXA 4CYCA 2PMZN 4LOCA 2L7MP 2MSYA 1H88C 3LNQA 1D5YA 3BR5A 1X58A 4D7NA 2NVXJ 2B63J 1MSEC 5EZHA 3GTLJ 1GV2A 4JX4A 2LR8A 1MBHA 4Y7NJ 2NS8A 1IG7A 2GM4A 3DEWA 4XRSA 2MG4A 2HQ5A 3FKIJ 5JLXA 5J1YA 3BR2A 2Y31A 2HI3A 2HDDA 2HOAA 3JRAA 2R93J 1POGA 4W97A 2JMWA 2Y9YA 4M6VA 5F08A 1E3OC 3QPLA 1JUPA 2LP0A 2E2IJ 5FKMA 1YRNB 2VKEA 5FJ8J 1P7IA 1F43A 2LD5A 1Z0XA 2M8GX 3BQYA 1HOMA 3BQZA 5EYRA 4DZJA 2CRGA 4I6ZA 2DA7A 3S1RJ 1JT0A 4JX6A 1IRZA 3ZQHA 3O8GA 2DMUA 1IC8A 2K9QA 3SDGA 4C3IJ 2EBIA 1TWAJ 1LE8B 3MKLA 4M3EA 5IYDJ 2FQ4A 2AO9A 1GDTA 1FEXA 1AHDP 4A3KJ 4X6AJ 1AKHB 1GUUA 4A3DJ 1ZKGA 3GBGA 3OSGA 2K40A 2Y9ZA 4XICA 3S1QJ 3HB9A 4D5CA 3BG5A 1FIAA 2EQRA 3ZQCA 1ZR2A 1ZR4A 2XPVA 2YU9J 1FJLA 2M0CA 4UUTA 2E2HJ 5FLVA 4D5FA 4A3GJ 5K7ZA 2VPRA 3WHBA 3OOUA 2Y30A 2JA7J 2JA8J 3JREA 2D5VA 4M3FA 4BBRJ 1WPKA 1U8BA 3IH3A 2WV1A 3TP3A 1HDPA 1OCTC 5FKOA 1XG1A 3LOCA 4MFEA 4A3BJ 2JN6A 5EGOB 2MW8A 5GPCA 3FK6A 1Q1VA 4QSHA 2L0KA 2NVTJ 2VKVA 3HOZJ 4I76A 4A3MJ 2H8RA 4XK4A 1XC5A 3G1MA 3S14J 2NOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM J;  4FE7 A;  2JJ7 A;  3HDD A;  3RZO J;  2OPT A;  5EZG A;  3BR6 A;  1WI3 A;  1F36 A;  1BW5 A;  4AC0 A;  5EG0 B;  1QVU A;  4XRM A;  1AKH A;  3HM5 A;  2EZI A;  4UUS B;  5C44 J;  3HGG A;  2KDZ A;  2XPW A;  1H8A C;  1P7J A;  3RKQ A;  1O4X A;  2YS9 A;  3W6V A;  2CU7 A;  5IP9 J;  3LSR A;  1JKR C;  4BY1 J;  2TCT A;  1ZQ3 P;  4FIS A;  3GTM J;  5M5Y J;  3BTC A;  1JTY A;  2DA4 A;  1T56 A;  5E3O A;  4IHX A;  2K9S A;  1RES A;  4A3E J;  1BL0 A;  4B1R A;  1MH4 A;  1LFB A;  2NS7 A;  1QVT A;  1I3Q J;  1JKO C;  3A01 A;  1GVD A;  2O8K A;  4D7M A;  5K7H A;  3L1P A;  2Y0S N;  1GT0 C;  3HKZ N;  5DS9 A;  2VI6 A;  2EZH A;  3GTK J;  3TED A;  1IUF A;  3LSG A;  3CDL A;  5IYB J;  4J19 A;  5F0C A;  1HF0 A;  1DU6 A;  3E7L A;  5F1J A;  3S17 J;  1SFO J;  2E2J J;  5J1U A;  3PO3 J;  2LTP A;  1FTZ A;  2EZL A;  2M9H A;  4M3G A;  1DU0 A;  1JKP C;  2WB1 N;  3G1L A;  3GTP J;  1OFC X;  5C4X J;  4HNV A;  1LFU P;  5IYC J;  2JA5 J;  1HDD C;  2HYJ A;  2QCO A;  2G0E A;  3ZQI A;  3O8H A;  1MBK A;  4MLO A;  3JRC A;  2R7Z J;  3RQI A;  1ENH A;  2DTZ A;  3PO2 J;  3JRI A;  3RZD J;  3LSJ A;  4RBO A;  3IH4 A;  2JA6 J;  3GTG J;  2LK2 A;  4G12 A;  1T33 A;  4JYK A;  3Q3S A;  4QTR A;  3HOU J;  3GTO J;  5J3L A;  4W1U A;  1MSF C;  1MNM C;  2ECC A;  4C3H J;  1XS9 A;  3CQZ J;  4JX5 A;  1NK3 P;  2I10 A;  3I4M J;  2X6O A;  1B8I B;  2NVQ J;  1ETY A;  1A6I A;  3B6C A;  4GFB A;  2OF7 A;  1HCR A;  2CJJ A;  5IP7 J;  3F0C A;  2M34 A;  5GPA A;  3GTQ J;  5FKL A;  1IDZ A;  2IEK A;  2LVS A;  4DYC A;  1ZGW A;  5C4J J;  2DN0 A;  2KT0 A;  3DCF A;  2DA5 A;  2ME0 A;  4V2G A;  3JRG A;  3M3Y J;  3BTL A;  4QIW N;  2Y2Z A;  1OCP A;  5HOD A;  2ID3 A;  3K2A A;  2O7O A;  4XRS G;  2JWT A;  3ZQF A;  5EF6 A;  3QQA A;  1AU7 A;  2XRL A;  3JRH A;  2DMP A;  1MBG A;  2DJN A;  5F0F A;  2EZK A;  3BTI A;  4L5E A;  1TWG J;  4XID A;  3M4O J;  3OSF A;  1ZTR A;  4JP0 A;  1B72 A;  1JUS A;  1I50 J;  3H3V K;  2XGC A;  1FTT A;  1UMQ A;  4AUX A;  1RKW A;  2TRT A;  1JGG A;  2ZB9 A;  4ABZ A;  2NVY J;  4MIM A;  5F0H A;  3UKG A;  2ELK A;  3BR1 A;  2L7F P;  3MN2 A;  5GP9 A;  4RDU A;  4IHV A;  3FIS A;  4Y52 J;  4A93 J;  3OIO A;  4DZP A;  3NAR A;  3ZOB A;  3K7A J;  3BG9 A;  5M5W J;  2M2E A;  1UG2 A;  1WH7 A;  3ZQL A;  4A3I J;  3A01 B;  2L9R A;  2H1K A;  1Y1W J;  1MBJ A;  3JRF A;  1W0U A;  1H89 C;  2X48 A;  2L7Z A;  5JLW A;  1W0T A;  4MO7 A;  2XSD C;  4IHY A;  3S1N J;  1BW6 A;  1YRN A;  3CMY A;  2R5Y B;  2N8G A;  5F27 A;  5EG0 A;  1ZK8 A;  3NAU A;  2P81 A;  1G2H A;  4M3B A;  1ETX A;  3Q0U A;  3S16 J;  3CCY A;  1MBE A;  4DW6 A;  1ETO A;  1U9O A;  1B8I A;  3HOY J;  3HOX J;  2R0Q C;  5FKN A;  2RAE A;  2E19 A;  2IBD A;  1VF9 A;  5M5X J;  2EH3 A;  3Q0W A;  3S15 J;  1FIP A;  2E1O A;  5M3M J;  4X1E A;  1WH5 A;  3BR3 A;  1RKT A;  2LFB A;  1RR7 A;  1IGN A;  4FCY A;  2GBY A;  2COB A;  3B6A A;  3HEF A;  3HOW J;  1R9T J;  2DA6 A;  3HGY A;  4A3L J;  1VI0 A;  5E3N A;  5E3M A;  5FKK A;  1IV6 A;  2XGD A;  1QRY A;  2ME6 A;  2DMT A;  4NDL A;  3SFI A;  5F04 A;  2R5Y A;  1IJW C;  3D1N I;  5J1R A;  3A02 A;  2HXI A;  5IP6 A;  3JRD A;  1ETV A;  2XB5 A;  4FE4 A;  3BR0 A;  4V2F A;  2LY9 A;  1HLV A;  1WGX A;  4AYB N;  2CQX A;  4S0H B;  3IH2 A;  3Q0V A;  1JUM A;  3S2D J;  5M3F J;  1QPI A;  4B3A A;  4IEJ A;  1RET A;  2FD5 A;  2W48 A;  2DMN A;  2R5Z B;  4FTH A;  1MH3 A;  2XPU A;  3H0G J;  4CYC B;  1IDY A;  2JK3 A;  1BA5 A;  2IAI A;  1RPW A;  4M3D A;  1Z77 A;  1X2N A;  1JT6 A;  5K7F A;  3I4N J;  1TWC J;  4BY7 J;  2GLO A;  1U9N A;  1VND A;  2ID6 A;  3SJM A;  1JJ6 C;  1TWH J;  4BXX J;  5BNG A;  1VFC A;  3C2B A;  1SAN A;  9ANT A;  3FIW A;  2DA1 A;  1ETQ A;  3A03 A;  3TP0 A;  1TC3 C;  4UUS A;  1A5J A;  2XB0 X;  3BT9 A;  4IHW A;  3WHC A;  2DA3 A;  4B4C A;  5C3E J;  4A3J J;  3JR9 A;  3S1M J;  3VPR A;  3HOV J;  3IV5 A;  2YUS A;  5DTD A;  5IPA A;  1ITY A;  2VUM J;  3TW6 A;  5EEA A;  4EEF G;  4A69 C;  2MGQ A;  2DMQ A;  2CUE A;  1JJ8 C;  2K9N A;  2FX0 A;  5IOZ A;  3JRB A;  4BKX A;  1EF4 A;  5EGO A;  5IOY A;  1K61 A;  2DA2 A;  4C3J J;  2QF7 A;  1OJL A;  1U78 A;  1PUF B;  4A3C J;  1APL C;  5FLM J;  3MVP A;  1GV5 A;  4A3F J;  1NTC A;  1ETW A;  1X2M A;  1S7E A;  5E3L A;  3LSP A;  5EDN A;  2WAQ N;  2ECB A;  3BTJ A;  2X9D A;  2HOS A;  3G1O A;  1PUF A;  1ORK A;  4C2M J;  3GTJ J;  1I6H J;  3BG3 A;  1UHS A;  3ZQG A;  1MBF A;  3QPS A;  2LKX A;  2AHQ A;  3FK7 A;  3TW7 A;  1CQT A;  2CQQ A;  2HXO A;  2LLK A;  3HBL A;  3PM1 A;  3S2H J;  4MFD A;  2HOT A;  1BJZ A;  2CUF A;  2R5Z A;  2O9L A;  1NK2 P;  1LE8 A;  4BBS J;  1JKQ C;  1ETK A;  2R92 J;  1Y1V J;  4DYR A;  2XGE A;  4DYQ A;  2FJ1 A;  1TWF J;  1K83 J;  1B72 B;  1JTX A;  4CYC A;  2PMZ N;  4LOC A;  2L7M P;  2MSY A;  1H88 C;  3LNQ A;  1D5Y A;  3BR5 A;  1X58 A;  4D7N A;  2NVX J;  2B63 J;  1MSE C;  5EZH A;  3GTL J;  1GV2 A;  4JX4 A;  2LR8 A;  1MBH A;  4Y7N J;  2NS8 A;  1IG7 A;  2GM4 A;  3DEW A;  4XRS A;  2MG4 A;  2HQ5 A;  3FKI J;  5JLX A;  5J1Y A;  3BR2 A;  2Y31 A;  2HI3 A;  2HDD A;  2HOA A;  3JRA A;  2R93 J;  1POG A;  4W97 A;  2JMW A;  2Y9Y A;  4M6V A;  5F08 A;  1E3O C;  3QPL A;  1JUP A;  2LP0 A;  2E2I J;  5FKM A;  1YRN B;  2VKE A;  5FJ8 J;  1P7I A;  1F43 A;  2LD5 A;  1Z0X A;  2M8G X;  3BQY A;  1HOM A;  3BQZ A;  5EYR A;  4DZJ A;  2CRG A;  4I6Z A;  2DA7 A;  3S1R J;  1JT0 A;  4JX6 A;  1IRZ A;  3ZQH A;  3O8G A;  2DMU A;  1IC8 A;  2K9Q A;  3SDG A;  4C3I J;  2EBI A;  1TWA J;  1LE8 B;  3MKL A;  4M3E A;  5IYD J;  2FQ4 A;  2AO9 A;  1GDT A;  1FEX A;  1AHD P;  4A3K J;  4X6A J;  1AKH B;  1GUU A;  4A3D J;  1ZKG A;  3GBG A;  3OSG A;  2K40 A;  2Y9Z A;  4XIC A;  3S1Q J;  3HB9 A;  4D5C A;  3BG5 A;  1FIA A;  2EQR A;  3ZQC A;  1ZR2 A;  1ZR4 A;  2XPV A;  2YU9 J;  1FJL A;  2M0C A;  4UUT A;  2E2H J;  5FLV A;  4D5F A;  4A3G J;  5K7Z A;  2VPR A;  3WHB A;  3OOU A;  2Y30 A;  2JA7 J;  2JA8 J;  3JRE A;  2D5V A;  4M3F A;  4BBR J;  1WPK A;  1U8B A;  3IH3 A;  2WV1 A;  3TP3 A;  1HDP A;  1OCT C;  5FKO A;  1XG1 A;  3LOC A;  4MFE A;  4A3B J;  2JN6 A;  5EGO B;  2MW8 A;  5GPC A;  3FK6 A;  1Q1V A;  4QSH A;  2L0K A;  2NVT J;  2VKV A;  3HOZ J;  4I76 A;  4A3M J;  2H8R A;  4XK4 A;  1XC5 A;  3G1M A;  3S14 J;  2NOG A; 
#chains in the Genus database with same CATH topology
 3FXU A;  4NC7 A;  4ZC3 A;  3T1B A;  2ETH A;  4FE7 A;  3F22 A;  2JJ7 A;  3M07 A;  4F55 A;  3HDD A;  3F8B A;  2OPT A;  3M8J A;  4I99 C;  5DD4 A;  1WI3 A;  5HDK A;  2PQ8 A;  1W36 D;  1BW5 A;  2BXY A;  2CFO A;  4UUS B;  1UCR A;  2MBF A;  1XSX A;  4HEA 2;  3HGG A;  1YOV B;  2JUG A;  3WE3 A;  2E36 A;  5TGT A;  4EJO A;  2YS9 A;  3RKQ A;  2CQN A;  4ENN A;  3W6V A;  3L2Q A;  4M72 A;  4LIT A;  1ZQ3 P;  3CF2 A;  3GTM J;  2FEZ A;  3MEX A;  3BTC A;  2XAQ A;  4I0A A;  3I4P A;  1VQ7 I;  2F5V A;  3I53 A;  1ERD A;  2YR2 A;  4BQQ A;  3P7N A;  1QVT A;  3GCM A;  2IPQ X;  2BEO A;  1GVD A;  4U88 A;  2UXN A;  2NYX A;  2LC2 A;  1U5T A;  4PFO A;  4RLQ A;  3ZMS A;  2VI6 A;  3S2W A;  2LYC A;  3TED A;  3IP4 B;  2VQL A;  2DW4 A;  2OZ6 A;  2TDX A;  3CDL A;  5IYB J;  4EAT A;  1KA8 A;  1IO2 A;  1MZB A;  3E7L A;  4ZYD A;  1BN5 A;  5F1J A;  2RGV A;  2BBY A;  3S17 J;  1SFO J;  2VB6 A;  3GFM A;  2GIZ A;  5D6F A;  5HS8 A;  4BE1 A;  3HPH A;  1FTZ A;  1XSV A;  1USS A;  4OAY A;  1H0M A;  1EKE A;  2F4M B;  1JKP C;  1DU0 A;  5TJJ A;  4HNT A;  3G1L A;  2M4G A;  5C4X J;  1SD4 A;  4HNV A;  1LFU P;  4IHS A;  2X4H A;  4NC8 A;  2XKO A;  2JT1 A;  4XLE A;  5LEJ A;  3DWL E;  1G3S A;  2IGN A;  4WXH A;  3EUA A;  4MLO A;  1LPQ A;  1ENH A;  1OMI A;  3JRI A;  4DQ2 A;  1MMD A;  2X51 A;  3LSJ A;  3RZD J;  2PMU A;  4QTR A;  2DU9 A;  1T98 A;  2DT6 A;  1IN4 A;  1I39 A;  2Y0M A;  2IS1 A;  1A35 A;  1MSF C;  3PL8 A;  4GXO A;  1XS9 A;  1W7P B;  5B66 C;  4JX5 A;  4UVA A;  1NK3 P;  2X6O A;  5FRN A;  5L3D A;  3QP6 A;  1ETY A;  2ISY A;  1A6I A;  2NVQ J;  2JRT A;  4OIP F;  2OF7 A;  4XLH A;  1HW1 A;  5FFZ A;  3BRO A;  5IP7 J;  2DYR H;  2HU9 A;  5GPA A;  5L3F A;  1S7A A;  3MKY B;  1OLT A;  5A2Q K;  4ZTF A;  2WTE A;  5C4J J;  1K4T A;  2B0L A;  3CDH A;  1G3Y A;  2KT0 A;  1Z9C A;  5DV5 A;  1SFX A;  2ME0 A;  4OIO F;  1IUY A;  3BTL A;  5B1B H;  4CIC A;  3OYA A;  4MTD A;  4R1H A;  1ZEL A;  3LQQ A;  2O7O A;  4XRS G;  3HG9 A;  1D0Y A;  5ERI A;  5F1R A;  1RRJ A;  1R1V A;  2RRE A;  3ZQF A;  5EF6 A;  1BIB A;  1AU7 A;  2E1M B;  1XB4 A;  1WJF A;  3GWZ A;  2DMP A;  3K6G A;  3KLN A;  5KNL A;  1MBG A;  2VPL A;  4UV9 A;  4R8H A;  2V1U A;  3OSF A;  3ABU A;  1LEB A;  1MMG A;  2XGC A;  4HQM A;  1FTT A;  1IF1 A;  3OWT A;  3RKX A;  4IL6 C;  4KMU X;  2HZT A;  2X6Y A;  5K5Q A;  1XX5 A;  2V9K A;  3SZG A;  1BR2 A;  3K4K A;  4G6Q A;  4CZZ A;  4RB3 C;  1RKW A;  1E3H A;  1WKM A;  5F0H A;  2CV1 A;  3ABK H;  2ZSI B;  2ELK A;  2A61 A;  5HVQ C;  4A0X A;  2C6Y A;  2B7E A;  1D1B A;  3OIO A;  1LUJ B;  1X1P A;  3FMR A;  4P9F A;  1QQI A;  1NHA A;  1H9G A;  1EH7 A;  4F3Q A;  1G6N A;  5HLT A;  2PEX A;  4ZH4 F;  5E1W A;  1OYW A;  3RPU A;  3E0J B;  3DV8 A;  3PJR A;  3GO5 A;  3V8J A;  3ZQL A;  5CJ9 A;  3O2P E;  3QAH A;  1MBJ A;  3CUQ C;  5J6X A;  2IXS A;  3M1C A;  1RC9 A;  3JRF A;  3OIP A;  4MNU A;  3S3O A;  5JLW A;  4GGG A;  1WRJ A;  3I3L A;  1O3Q A;  3S1N J;  4KN4 X;  2R5Y B;  2EIL H;  3W6K B;  1T08 B;  3G4S I;  3P9C A;  5E8G A;  2QQ9 A;  3NAU A;  1QNT A;  3HRU A;  4XR6 A;  3WTX C;  1Z7L A;  3BZC A;  3TO7 A;  4M3B A;  4CCJ A;  2L01 A;  2LG4 A;  3S32 A;  4BEH B;  3VSK A;  5CQE A;  1D3Y A;  2P8T A;  1XN7 A;  1X1C A;  1W5C C;  1WFX A;  1KYZ A;  2IT0 A;  5FKN A;  2E19 A;  2VXD A;  4L5I A;  3Q9V A;  3D5L A;  3RIR A;  2FU4 A;  2OQR A;  2M5W A;  4KUM A;  3CCM I;  2M7A A;  4BYY A;  2PFB A;  1O7L A;  3D5R C;  2ZO4 A;  1RKT A;  1T0F C;  4HV5 A;  2LF7 A;  1R9T J;  2DA6 A;  3GFI A;  3X2Q H;  4A0Z A;  1QZZ A;  1W5T A;  5E3M A;  1VQ6 I;  4LLL A;  2GQQ A;  4NDL A;  4IJA A;  1MMA A;  2X6W A;  3E5X A;  2GOX B;  3A02 A;  3PNV A;  4E7Z A;  3JRD A;  3OYB A;  2X0L A;  3K4L A;  5FO5 A;  4HBL A;  2WY8 Q;  2BVM A;  1C0W A;  3WG7 H;  1V5E A;  2GA1 A;  5BOX A;  3M7G A;  1UG0 A;  1T6S A;  4IEJ A;  2AQF A;  3DU6 A;  1P2F A;  4WXD A;  1FOK A;  2QVO A;  1YE9 A;  3IHU A;  4MEX F;  3TMO A;  2VN2 A;  3H0G J;  3LL7 A;  2G7H A;  3I54 A;  2HPM A;  2AXT C;  3F9K A;  4GCV A;  1YQA A;  2UV1 A;  1TWC J;  1U9N A;  1VND A;  3SJM A;  1JJ6 C;  2CMP A;  3HJE A;  1VFC A;  2E7X A;  2M7B A;  4HZF A;  3QRF F;  4XKV A;  4UB8 C;  4HX8 A;  4ON0 A;  4UVB A;  4GO1 A;  1ETQ A;  4ZDP A;  3CMM A;  1K7A A;  4UUS A;  2EA2 A;  2XB0 X;  1WSU A;  2EIJ H;  4IO9 F;  1LNW A;  4KNY A;  3OV8 A;  3PIO F;  3WHC A;  5C3E J;  1YX5 A;  3VPR A;  3GFL A;  3HOV J;  1GXQ A;  2YUS A;  4Y33 A;  5DTD A;  3MFK A;  4PJL A;  1MDM A;  3U2R A;  4EEF G;  2MGQ A;  3K4J A;  2A68 F;  3FXQ A;  4RGU A;  1FY7 A;  2IJL A;  3ABL H;  3KP4 A;  2XF5 A;  2ZXW H;  5IT9 K;  4M9X A;  5J8C A;  2QF7 A;  2JSP A;  3T8T A;  1YW7 A;  4U0Y A;  3PUF A;  3VWB A;  2CUJ A;  3MVP A;  2WBM A;  1W7P A;  1LKX A;  1FYL A;  1VTN C;  4QWQ A;  1V54 H;  2A5Y B;  2NS0 A;  1YJN I;  1SVM A;  3CLQ A;  5JR3 A;  2LY2 A;  1JXS A;  3WTV C;  2RQQ A;  1UHS A;  3ZMZ A;  2IA2 A;  1V5G A;  2R7V A;  3J80 Z;  3BY6 A;  3E6D A;  1T38 A;  2R7F A;  4MFD A;  2Q0O A;  3S2H J;  2HOT A;  2DOD A;  5D4R A;  2O9L A;  2LBF B;  5AON A;  3RQ4 A;  4BBS J;  1KON A;  3O6B B;  1O57 A;  1Y1V J;  3ESW B;  1WHU A;  3HHH A;  1WJ5 A;  2LSO A;  4EGZ A;  4XSX F;  2F5F A;  4ESF A;  4A0Y A;  4G7O F;  4UXN A;  4DGW B;  2ISZ A;  4E6K G;  2P7C B;  3DKX A;  3TOA A;  3EYI A;  5KAI C;  4PCQ A;  2LH9 A;  4G7H F;  1IZ1 A;  3V7S A;  3IAS 2;  3ERE D;  1BC8 C;  1XCB A;  1U8R A;  1GXP A;  3H3Z A;  1R00 A;  4AU7 A;  5JVT A;  5K1Y A;  2NVX J;  4CCL A;  2XV4 S;  3CJR B;  1WJC A;  2O5R A;  2LR8 A;  4N4O B;  5D5U B;  2HQ5 A;  2NXN B;  5JLX A;  5J1Y A;  3BR2 A;  1O3T A;  1BOA A;  4C9Y A;  5EJC A;  5J4Y A;  2R93 J;  3FXM A;  1POG A;  3KYC B;  4ZDO A;  4OU0 A;  5F08 A;  3QPL A;  3A4C A;  1JHF A;  2KIQ A;  5FKM A;  3ASN H;  3KX2 A;  3NWT A;  2ZFU A;  4L5J A;  2MD0 A;  5D8K B;  1Z0X A;  2M8G X;  3V4G A;  3HIF A;  3BQY A;  2OC6 A;  1HOM A;  2DXI A;  4HX4 A;  1FP1 D;  4Q4Z F;  1JT0 A;  2EV5 A;  2LKS A;  1YIJ I;  2EJR A;  3ERM A;  1U5T C;  4HX7 A;  2M0M A;  4PZJ A;  4C3I J;  1K4S A;  1J9I A;  2F2E A;  2M45 A;  1TWA J;  2R7D A;  2LRE A;  5IYD J;  3PIP F;  3LSK A;  1GDT A;  5ICF A;  2MLG A;  2LKP A;  1E2X A;  3ZMU A;  1AKH B;  3CMA I;  1GUU A;  2FML A;  1ZKG A;  3CCJ I;  2DOF A;  3E5U A;  2Y9Z A;  2FF4 A;  2Z3Y A;  2K85 A;  3KET A;  3HB9 A;  4D5C A;  2EFW A;  3ISP A;  3IWF A;  2B9S A;  2AQE A;  5EEH A;  4N9H A;  2M0C A;  3OIQ A;  2BHZ A;  3AL0 C;  5LGN A;  2ESN A;  5K7Z A;  3GME A;  4A3G J;  2VPR A;  3FXK A;  1TTY A;  2Y30 A;  4RGX A;  5CLS A;  2JA7 J;  2HKX A;  2XGX A;  1X1A A;  1YYV A;  1DDN A;  3TOB A;  5HLG A;  5LEK A;  2Q1Z B;  2L5Q A;  3R4K A;  4RAY A;  1FT9 A;  3JW4 A;  4OMY A;  3AFH A;  2FOW A;  2IW5 A;  5BMZ A;  3V7C A;  1U8B A;  1IRG A;  3IH3 A;  2CYY A;  3FHZ A;  4V19 K;  2OJE D;  4XNF A;  3LOC A;  1HKS A;  4HPQ A;  2RKH A;  4MFE A;  2XAG A;  4Y3O A;  5EGO B;  4BE2 A;  3RYR A;  1SD6 A;  2HKO A;  1NG7 A;  3LMM A;  5DCM A;  1XCV A;  2OA4 A;  2BE5 F;  3HTU A;  3I9V 2;  1I3A A;  2COM A;  2NAZ A;  3HL2 A;  4XN0 A;  4BQN A;  3BDD A;  2HR3 A;  4AD9 A;  2XVC A;  4AC0 A;  5EG0 B;  1QVU A;  1AKH A;  2MC3 A;  3HM5 A;  2XAH A;  1J2X A;  4ZZD A;  1P9Q C;  3ROU A;  2XPW A;  2KIM A;  4HOB A;  1H8A C;  1P7J A;  1O4X A;  2CU7 A;  3KP6 A;  4BY1 J;  1SD7 A;  2EB7 A;  2CV0 A;  1B6A A;  2TCT A;  1W36 C;  3R61 A;  1UFM A;  3C2H A;  1S3J A;  3Q9S A;  3HPG A;  2CV2 A;  1J75 A;  5D6E A;  2KRF A;  4QLC U;  1JTY A;  2IP2 A;  2DA4 A;  3FZV A;  3R0A A;  4I02 A;  2BXZ A;  4B1R A;  2OUM A;  1FOY A;  4BUP A;  1PP8 F;  5JHF A;  5LBQ A;  3LAJ A;  2MH9 A;  3CZ6 A;  1KYW A;  2P0W A;  2WWY A;  3FBN B;  3ZN1 A;  4J00 A;  1JKO C;  2F5D A;  1R6R A;  2OQG A;  2OV7 A;  1SMT A;  4XL9 A;  2GIV A;  1RUN A;  5D8L B;  4NUB A;  1R4N B;  1BI2 A;  3FXO A;  3ZQQ A;  4EJV A;  5DS9 A;  3LFK A;  3OYN A;  1IUF A;  4HYE A;  2HS5 A;  3LSG A;  4JOM A;  5LRS A;  1SAX A;  1HF0 A;  4NHJ A;  2Y75 A;  1DU6 A;  1DP7 P;  4NNJ A;  3DLL F;  3C3W A;  2E2J J;  5J1U A;  3PO3 J;  4IZZ A;  2EZL A;  2MC4 A;  4M3G A;  1XMK A;  2ZJR F;  4BJT A;  4ANJ A;  4BNC A;  3MD2 A;  2EFO A;  3ABT A;  3M8F A;  3N05 A;  3OYG A;  5IYC J;  2VBZ A;  4B44 A;  2PBI A;  1HDD C;  2ZJQ F;  2G0E A;  4CCM A;  1S7O A;  3DQV C;  1MBK A;  4UNO A;  3OYF A;  2HVR A;  3J7A Y;  3A0H C;  4KIC A;  1T8I A;  4RBO A;  1CF7 B;  3ZN0 A;  3CDI A;  1G4D A;  2JA6 J;  3CCE I;  1T33 A;  3Q3S A;  1SVL A;  3CC4 I;  4D1Q A;  2L2O A;  1MND A;  4P96 A;  4W1U A;  1QU3 A;  4KDP A;  1QZY A;  3V8K A;  3CQZ J;  4J01 A;  3GLL A;  4G94 A;  2HYG D;  2I10 A;  4HSR A;  3E1S A;  3WTT C;  3AG4 H;  2P6S A;  4RAG A;  4F52 A;  1HCR A;  2CJJ A;  2M34 A;  2W7N A;  3IL2 A;  2V9V A;  1IDZ A;  1WWX A;  1A04 A;  2IEK A;  3VDX A;  4DYC A;  2DN0 A;  2VBX A;  2DA5 A;  2HVS A;  4V2G A;  2F4O B;  4KJZ A;  3JRG A;  5CPR B;  4QIW N;  4WK8 F;  5FFX A;  1IW7 F;  3DTE A;  2XAF A;  2DPU A;  1R5G A;  2JWT A;  3T8R A;  1FWZ A;  1IN8 A;  3OYI A;  3OS1 A;  2MD5 A;  4BXU A;  3QQA A;  5DDG A;  3K2Z A;  2XRL A;  1WZ2 A;  3B73 A;  3KP5 A;  1OIS A;  1DGR M;  2DJN A;  1Z67 A;  3L00 A;  5BPD A;  4L5E A;  4OMZ A;  1TWG J;  2XKP A;  5E1X A;  4AYB A;  1T39 A;  3M4O J;  3PQK A;  3W2V A;  2Z9O A;  1JUS A;  1I50 J;  3H3V K;  4LK1 F;  4YEL A;  4PUS A;  2PJR B;  3M8E A;  3HC7 A;  3F6V A;  3TDU C;  4FAS D;  3K70 D;  3PFI A;  3I0T A;  1JGG A;  3NWS A;  1ONV A;  1YLF A;  4MIM A;  1IV8 A;  4CH7 A;  4C30 A;  1P6R A;  1YW9 A;  3L7W A;  2BZT A;  1OR7 A;  1CF7 A;  1IXS B;  1DGW Y;  1I1S A;  2Y0S A;  2STW A;  2XUB A;  3DF8 A;  1I6X A;  3LSI A;  5J4V A;  3TKY A;  3BG9 A;  1PJR A;  5CVI A;  4RLF A;  1UG2 A;  4PJ0 C;  1S9H A;  3A01 B;  2GXB A;  2L9R A;  2G7U A;  2QGU A;  1Y1W J;  3T5X A;  2DO7 A;  5IT9 Z;  1VQL I;  2DTR A;  4ENJ A;  4Y17 A;  2L7Z A;  1HC8 A;  5LGT A;  1UJ8 A;  1ZYR F;  2V9P A;  1LVK A;  4ZYG A;  2OZU A;  3CMY A;  5F27 A;  3GFJ A;  1KQ0 A;  5EG0 A;  1ZK8 A;  4IQ4 A;  4B3X A;  1YS6 A;  5GAD J;  4DBQ A;  3OYK A;  2QBY B;  2VOD A;  1ZAO A;  2P4W A;  1KGS A;  2HDW A;  3CCY A;  3OOP A;  4GYI A;  4PSW A;  1BC7 C;  3VOD A;  4DW6 A;  1U9O A;  3HOY J;  2MH2 A;  3HOX J;  1R7J A;  4IQJ A;  4MQV A;  5B3S H;  2PN6 A;  2XDV A;  3FX3 A;  3GYH X;  3F23 A;  3TO9 A;  2VQG A;  3Q0W A;  5CVU A;  1O3S A;  5M3M J;  2VE8 A;  2GOM A;  4X1E A;  3VSL A;  5CYV A;  1WH5 A;  3BR3 A;  4BS9 A;  5HLH A;  2HOE A;  2DDB A;  2HPI A;  4PJJ A;  3R0J A;  2F48 A;  3TL4 X;  3B6A A;  4FCY A;  3AL0 B;  4CHU A;  3HOW J;  4A3L J;  2WAF A;  2R7W A;  3TGN A;  2ZJP F;  4FHT A;  4E7J A;  2KJB A;  2CH0 A;  2R5Y A;  1IJW C;  2V6C A;  2Z5U A;  5H2F C;  5TIS C;  1Z21 A;  2RVC A;  4ZTJ A;  3FXL A;  4HG2 A;  5HOO A;  1KU9 A;  2HXI A;  1IXC A;  1TP4 A;  3FXR A;  2XB5 A;  1HLV A;  4HDU A;  2LY9 A;  2R3S A;  5EEG A;  1FZP B;  4AYB N;  2CQX A;  1MJA A;  1ODD A;  3Q0V A;  4JQF A;  1JUM A;  1XPX A;  3S2D J;  2QWW A;  4QPO A;  5M3F J;  1QPI A;  1EH6 A;  1LVA A;  4XOP A;  1X3W B;  1VQN I;  2FD5 A;  1YG2 A;  2DMN A;  2HVQ A;  5E8I A;  4UHT A;  4FTH A;  2XPU A;  3NRV A;  2M8E A;  4M3D A;  4CDG A;  1Z77 A;  1YI2 I;  2QQA A;  1JT6 A;  3HSR A;  1BBY A;  2ID6 A;  3REO A;  5BNG A;  1OPC A;  1EA3 A;  4LLN A;  2LBF A;  2FBI A;  1B9M A;  4U0V A;  4ENK A;  9ANT A;  2CFX A;  2QYO A;  4IRH A;  1FLI A;  5HS9 A;  3B02 A;  3U21 A;  5F6F A;  4EMS A;  3D5S C;  4HF2 A;  2CWE A;  2EK5 A;  2VC0 A;  4O6J A;  5AIQ A;  1A5J A;  1D5V A;  2CG4 A;  2VC1 A;  3BT9 A;  3MZY A;  2DA3 A;  4B4C A;  2WV0 A;  2XAJ A;  4RM3 A;  3SDB A;  3H92 A;  1ITY A;  5IPA A;  4ZDL A;  2VUM J;  2FOK A;  2A6H F;  2RNJ A;  5EEA A;  5LD2 C;  5FRM A;  1JJ8 C;  4EGY A;  2K9N A;  1EF4 A;  2IA0 A;  1J0R A;  1VQP I;  4F7Z A;  3QU3 A;  2DA2 A;  2IGK A;  3MZH A;  1NG6 A;  1HW5 A;  1OJL A;  2A6T A;  5FRO A;  1U78 A;  1PUF B;  3L9F A;  4Z2Y A;  2P7V B;  4CCK A;  1APL C;  4ESJ A;  3A0B C;  3E6B A;  1ETW A;  1R1U A;  5HNH A;  4XLC A;  2DLL A;  3LSP A;  2V4J C;  1OYY A;  3HKZ A;  1R1T A;  2Q8K A;  3GEZ A;  2X1C A;  3S8P A;  3WGG A;  5EDN A;  2WAQ N;  2ZKZ A;  1KU7 A;  5BS6 A;  2HOS A;  4HLY A;  4B48 A;  3WU2 C;  2VBW A;  3GTJ J;  3J7Z I;  1I6H J;  5BQT A;  2NNY A;  2R7T A;  4G8X A;  3ZQG A;  3QPS A;  3FK7 A;  2PJP A;  3TW7 A;  1BR4 A;  2CQQ A;  2HXO A;  1ZH5 A;  3PM1 A;  1NH3 A;  3R60 A;  1FOX A;  2EFN A;  4IRI A;  1BJZ A;  2CUF A;  4I09 A;  3IRQ A;  4I0B A;  2R5Z A;  4XN3 A;  1O3R A;  1LE8 A;  1NK2 P;  2PJR A;  1LDK B;  2Z2S B;  3I71 A;  5ICC A;  1JKQ C;  1K78 B;  1MMN A;  4HV6 A;  1CGP A;  1G3T A;  4WCG A;  3P9I A;  1ZGJ A;  4RAZ A;  3CUO A;  2FJ1 A;  4PFP A;  2JRM A;  4KIT B;  1B72 B;  1MGT A;  2BVL A;  1VZ0 A;  2PMZ N;  4LOC A;  3S93 A;  4HLX A;  1IN7 A;  1UB9 A;  3BZK A;  2MSY A;  3H5R A;  2HNH A;  2K3F A;  1H88 C;  4PJN A;  4II3 A;  3LNQ A;  5B5E C;  3RSN A;  3BR5 A;  2QQB A;  2Y48 A;  3WU1 B;  1MSE C;  2B63 J;  3KZZ A;  4BQO A;  1BI3 A;  2OAZ A;  5A2Q Z;  3IC7 A;  1B4A A;  1MBH A;  4Y7N J;  2FRH A;  3E3V A;  2MG4 A;  3L2W A;  3FKI J;  4R79 A;  1RZ4 A;  1TT0 A;  3CME I;  2E5Z A;  2HI3 A;  2DDA A;  2HDD A;  4P55 A;  4E7I A;  1LDJ A;  2Y9Y A;  3QYF A;  1AA7 A;  2DK5 A;  4M6V A;  4CGZ A;  3EDP A;  3IRR A;  3K4C A;  1J59 A;  2LP0 A;  4XKB A;  1FMV A;  2E2I J;  1MKM A;  1DPR A;  2YX4 A;  3CUQ A;  3S3N A;  2LD5 A;  2DJI A;  1XMX A;  1MJB A;  1R5H A;  4A6D A;  2A07 F;  3J7A O;  2R7U A;  4IOA F;  3F8C A;  2DA7 A;  1MJ9 A;  3WG9 A;  3L2U A;  4JX6 A;  2R7X A;  4P5O A;  2PG4 A;  4U87 A;  2DMU A;  1OCR H;  2K9Q A;  2QKL B;  1YIT I;  3MKL A;  2L9S A;  4CO8 A;  2AO9 A;  2L9N A;  3ZPL A;  2XIG A;  1AHD P;  1BOB A;  4X6A J;  2ZJ2 A;  1HST A;  3OR2 C;  1XMA A;  2W82 A;  1E0E A;  1B1B A;  4CA0 A;  4XIC A;  2DT5 A;  3S1Q J;  2V7F A;  3C7J A;  1WJA A;  4AIJ A;  2VE9 A;  2J5P A;  2EQR A;  1LQ1 A;  2XPV A;  3H5N A;  2FQ3 A;  4D0P A;  2ZXJ A;  5E1Z B;  1HKT A;  2VQH A;  4UUT A;  3TBI A;  2E2H J;  1HQC A;  3WHB A;  3KFW X;  4MGR A;  4RGS A;  5DYM A;  2KIU A;  3QU6 A;  3I58 A;  3P5J A;  3DEE A;  2IS6 A;  2L3D A;  2KIS A;  4KIB A;  2E1N A;  3RPU D;  2WC2 A;  2HWV A;  2AS5 F;  3RDI A;  4S04 A;  1OCT C;  1XG1 A;  1U6G A;  4IPA A;  3K1P A;  3KEQ A;  4HA8 A;  4UV8 A;  2BY2 A;  2M3A A;  4A3B J;  2CQ7 A;  3SEQ A;  4U7B A;  2FA5 A;  1Q1V A;  1Z3Y A;  2L0K A;  2IS4 A;  2VKV A;  2YSR A;  4I76 A;  4A3M J;  3HOZ J;  1DPU A;  1W1W E;  4U0W A;  4XK4 A;  3VYT B;  3G1M A;  3S14 J;  1WCM J;  2QEX I;  4L9N A;  1TQM A;  1X4P A;  4K2E A;  1XGN A;  3BR6 A;  3EUK L;  1LFP A;  4XRM A;  2JVH A;  6PAX A;  4MTE A;  4RM2 A;  2LMD A;  1P4W A;  5DEQ A;  5C44 J;  2QBY A;  2KDZ A;  3DLA A;  2FBK A;  1FC3 A;  1XDU A;  2L9V A;  3DPU A;  4EQQ A;  3OYC A;  2OTJ I;  3QOE A;  5IP9 J;  1HKQ A;  5FGM A;  1HW2 A;  2R7Q A;  1LJ9 A;  1XDS A;  3LAP A;  2Z1D A;  2BYV E;  1O7F A;  3G2B A;  1VQM I;  2W00 A;  4GYG A;  4IHX A;  1RES A;  2MAB A;  3FM5 A;  1MH4 A;  4WWC A;  2HYF A;  5IY5 H;  2NS7 A;  4LK0 F;  3A2K A;  3RCO A;  5JHU A;  2F4I A;  1YX3 A;  4A6E A;  3A01 A;  4I98 B;  1VQ8 I;  1U3E M;  2R7O A;  2KDO A;  4D7M A;  1P92 A;  4LD5 A;  5K7H A;  2AXL A;  2KZG A;  5DCF A;  1RUO A;  5FLX K;  3TO6 A;  3V8L A;  3F72 A;  1GT0 C;  2ZSH B;  3EUH C;  3HKZ N;  2F5C A;  1AWC A;  3OYD A;  2E35 A;  2EZH A;  3GTK J;  2HDC A;  2HTJ A;  2VKD A;  4J19 A;  3CF5 F;  2K9M A;  3LSM A;  3BP8 A;  5KCM A;  2LTP A;  2I8D A;  2V1X A;  2M9H A;  3BLY A;  3KE2 A;  5GAE J;  3JTG A;  2WB1 N;  2HQR A;  4E7H A;  3GTP J;  1OFC X;  1ZLJ A;  1ZG5 A;  2JA5 J;  5KVR A;  2QCO A;  2DFF A;  2XF7 A;  3WU0 A;  1Z3X A;  5HNF A;  2KRC A;  4D9J A;  3RQI A;  1MDM B;  2DTZ A;  2R7Z J;  2E60 A;  3ZXS A;  4ZZL A;  5KAF C;  2A5W A;  4Y13 A;  4BAY A;  3IH4 A;  2K3P A;  2L7K A;  2DQR A;  5J3L A;  1MNM C;  1XGM A;  4IHT A;  2D1V A;  4B47 A;  1OKR A;  1QA6 A;  3GXO A;  3FMS A;  3IKV A;  1I1G A;  1B8I B;  2P5V A;  1QBJ A;  1OCZ H;  3F0C A;  3GTQ J;  3F8N A;  2A3S A;  1BJA A;  4KT6 A;  2LVS A;  3F6O A;  1N25 A;  4YIR X;  2QEN A;  1R36 A;  1G3W A;  3DBH B;  3W2W A;  1MNE A;  3ZQ7 A;  5J47 A;  3M3Y J;  2M4K A;  1IXR C;  2Y2Z A;  1OCP A;  2FNA A;  5HOD A;  2X6X A;  3MZ8 A;  3K2A A;  5GTH C;  2DFH A;  2GZW A;  1AOY A;  1TQP A;  2CGP A;  4RA2 A;  2ACJ A;  1QHH D;  3ZRG A;  4LLG F;  5F0F A;  3DPL C;  2EZK A;  3FBI B;  1ZAR A;  2QA4 I;  2H8W A;  1PVE A;  3C18 A;  4CXF A;  1YHQ I;  4AVP A;  3JAM Z;  1Z91 A;  2YU3 A;  2ELJ A;  2VQC A;  4JP0 A;  3CP8 A;  2EIK H;  2KHM A;  3AG2 H;  4RB2 C;  1B72 A;  3WE2 A;  1M1E B;  2KLO A;  3L2R A;  1TL8 A;  1SVO A;  4NC6 A;  1XGO A;  4E7S A;  2UXX A;  3LWF A;  1XD7 A;  2TRT A;  5LGU A;  1YTY A;  2NVY J;  3UKG A;  1J5Y A;  1OR7 C;  2LRD A;  3Q5F A;  3BR1 A;  5ILU A;  3H1C A;  2L7F P;  4O5V A;  4RDU A;  4ASN A;  3FIS A;  4FX4 A;  4DZP A;  1D1C A;  3FDY A;  3NAR A;  2E7W A;  3OS2 A;  1MMS A;  3KIO A;  3PUB A;  4WX9 A;  2M2E A;  4EVI A;  3AKZ A;  1U0J A;  3HTS B;  4XM3 A;  5CVJ A;  2VL8 A;  2H1K A;  5H20 A;  4IX7 A;  1WJE A;  3JSO A;  2V79 A;  1H89 C;  4IHY A;  1YRN A;  4F91 B;  3SXY A;  1SMY F;  1YW8 A;  5CVV A;  1K6O A;  1D8K A;  2EWN A;  2D1H A;  4NQW A;  4PJM A;  2QM3 A;  2P81 A;  4B8X A;  4CSW A;  1ETX A;  4PDK A;  2KRH A;  3BG6 A;  4GRI A;  3DTK A;  3S16 J;  3W3C A;  2ZME A;  3CCR I;  2DFI A;  4GDF A;  4CYD A;  1YJW I;  5DCM B;  2K27 A;  5FLX Z;  2OCE A;  2R0Q C;  2RAE A;  4P1W A;  2IBD A;  5JVG F;  1X1D A;  2A69 F;  1ZG3 A;  1BI0 A;  1J09 A;  4XKW A;  5E18 F;  1YO5 C;  2W24 A;  3K1M A;  3VEP A;  2EH3 A;  4BXF A;  3S15 J;  4N4N B;  4N9I A;  2E1O A;  4E7K A;  2K5C A;  3RI4 A;  2HQA A;  2LFB A;  1RR7 A;  1ZG1 A;  3EYY A;  3HEF A;  3PSF A;  4NQW B;  1VI0 A;  1SEU A;  5E3N A;  2WAQ A;  1BI1 A;  5F64 A;  5E79 C;  4BU2 A;  1ACI A;  2VBY A;  3UNG C;  1IN5 A;  3DKY A;  2ME6 A;  2DMT A;  3K10 A;  3SFI A;  3ONQ A;  4L0Z B;  3QYE A;  5J1R A;  1U2W A;  2DPD A;  3ZMT A;  5IP6 A;  4WXC A;  4FE4 A;  4ENM A;  4S0H B;  4U7D A;  4XKC A;  5B1A H;  1FPQ A;  5J8F A;  2H27 A;  4DOZ A;  4M9S A;  2HQN A;  4HRI A;  4B3A A;  3PFY A;  1RET A;  3GW2 A;  4XLF A;  3NEU A;  3QYB A;  4XLP F;  4CYC B;  1IDY A;  1BA5 A;  2IAI A;  4PK4 A;  3K69 A;  4C2T A;  3HRT A;  3I4N J;  3W6J B;  3KLO A;  4EM2 A;  3HOT A;  4LG3 A;  1TWH J;  4EJW A;  3N4M A;  1EJ9 A;  2V6E A;  3SQN A;  2H09 A;  3KEO A;  2FBH A;  2XAU A;  3FIW A;  3KCC A;  1D0X A;  2CW0 F;  2DFE A;  1T2K A;  3TP0 A;  4M73 A;  2X1E A;  1IAW A;  4IKF A;  2DK8 A;  2OBP A;  4G7Z F;  4KFC A;  1PP7 U;  3S1M J;  1RNL A;  2DT7 B;  3IV5 A;  2OD5 A;  2VJJ A;  4X0G A;  3HXL A;  4OOI A;  1ZGA A;  1R5I D;  3HOS A;  5LFA A;  2XRO A;  2DMQ A;  1FYM A;  2DOE A;  3U9G A;  1FBS A;  5IOY A;  2E1M C;  1STZ A;  1T95 A;  1Y8Q B;  4FET A;  1VQK I;  4C3J J;  4OIN F;  4UVC A;  4A3C J;  2OTL I;  2KMU A;  3F8M A;  5FLM J;  3K1N A;  1GV5 A;  3BPV A;  1NTC A;  3M9A A;  3ZCO A;  2VON A;  3DBL B;  5E3L A;  5TRD A;  5GAH J;  2VT2 A;  1TBX A;  2M1B A;  2ECB A;  2ADU A;  2WA0 A;  2X9D A;  2IRF G;  2JA2 A;  2Z16 A;  1PUF A;  5H6R A;  1ORK A;  5K5O A;  5DM6 F;  2CQK A;  2ZNZ A;  2ZXH A;  2AHQ A;  1CQT A;  1IRF A;  3HBL A;  2QSH X;  2V26 A;  1TW2 A;  2HFH A;  2E34 A;  2KIF A;  1N77 A;  2MA3 A;  3OL3 A;  2G9W A;  1S5L C;  1FBQ A;  2JPC A;  2J5O A;  4E70 A;  2EV0 A;  3FF5 A;  4KYW A;  1S72 I;  4IVN A;  2LOO A;  3BC8 A;  1Z7U A;  2ZXI A;  2L7M P;  3GF2 A;  1R22 A;  3VYU B;  3BZ6 A;  1Y39 A;  3CUQ B;  1D5Y A;  3I59 B;  1RR8 C;  4BJ5 C;  4D7N A;  1WQ2 A;  3BWG A;  3H9J A;  5JI6 A;  2K4J A;  2ZNY A;  3CD6 I;  3MQ0 A;  5J40 A;  3CJN A;  1GV2 A;  2QQ8 A;  5K5R A;  2EFP A;  2IGM A;  2NS8 A;  2XAS A;  4XRS A;  1KU3 A;  1LDD A;  2LNB A;  1VQ5 I;  2IA1 A;  1G59 A;  1TT5 B;  1ZHF A;  2YX7 A;  3JRA A;  3COA C;  5GAG J;  3CC7 I;  4RB0 A;  3LA7 A;  3BJO A;  1YRN B;  4CCN A;  4DJA A;  2VAS A;  1P7I A;  1Z05 A;  1F43 A;  2K4B A;  3CC2 I;  3KYL A;  5EYR A;  5FD5 A;  2A05 A;  3QWL A;  4DZJ A;  2CRG A;  3E97 A;  1TLH B;  2FNP A;  4OAZ A;  2F5E A;  3RTR A;  4Y15 A;  3U1D A;  4A5M A;  4ESB A;  3LA3 A;  2FXA A;  1IRZ A;  2O3F A;  1KU2 A;  3DXJ F;  1RI7 A;  3O8G A;  3FWE A;  1IC8 A;  3SDG A;  3HUG A;  1IRX A;  4M3E A;  2FQ4 A;  3O3K A;  1FEX A;  3MWM A;  4LGW A;  4A3D J;  3GBG A;  3CP2 A;  4FT8 A;  4XBF A;  2K40 A;  2UZK A;  4L18 B;  1Y8R B;  4E7L A;  2GXG A;  1UEL B;  2Z33 A;  2JQ7 A;  2WB1 A;  3BG5 A;  1FIA A;  4JK1 X;  2RC4 A;  3WTW C;  1FSE A;  1TW3 A;  1FJL A;  4TV7 A;  1TQI A;  4D5F A;  2KKO A;  1ZRE A;  4OWR B;  4L0Y B;  3V7R A;  4HAM A;  3FMQ A;  5D5V B;  4QPQ A;  2D5V A;  2H94 A;  4M3F A;  4BQA A;  1N78 A;  4PGH A;  4BBR J;  1WPK A;  2Y69 H;  1MD0 A;  3FM3 A;  3VOE A;  2WV1 A;  1UZC A;  2O8X A;  1YFH A;  1QO0 D;  5E17 F;  1U5T B;  1SAU A;  3IWZ A;  1F1Z A;  2RNG A;  4JBA A;  4XMY A;  2CW7 A;  2WY7 Q;  2W25 A;  2VOP A;  2DAO A;  2JN6 A;  2MW8 A;  4KT5 C;  3OY9 A;  5KHD A;  2QUF A;  1KQ8 A;  1DUX C;  2RN7 A;  4QSH A;  3RYP A;  4ITV A;  2H8R A;  4ETS A;  1VQ4 I;  2NOG A;  5LHH A;  3GUD A;  4AWX B;  3R6S A;  3RZO J;  4BHP A;  3RKW A;  2HGC A;  1X3U A;  1S6L A;  5EZG A;  5HDN A;  1V3F A;  1F36 A;  2VJI A;  3HZJ A;  2WAD A;  2P6T A;  2XSJ C;  3KP3 A;  2EZI A;  1ZLK A;  1EH8 A;  2DCE A;  4UY8 I;  3N97 A;  4M6Y A;  2FMY A;  5AIP A;  2MLK A;  1HXD A;  2PLY A;  1VQ9 I;  1JHH A;  3LSR A;  1LB2 A;  3HRM A;  1SFU A;  1JKR C;  2P5K A;  2K9L A;  4YFK F;  4FIS A;  3BOQ A;  2KPM A;  4MHG A;  5LHI A;  2ZC2 A;  5M5Y J;  3MKZ A;  3JSP A;  2IGO A;  3JTH A;  2DQL A;  2V1N A;  1T56 A;  3ULQ B;  3H3U A;  2BW3 A;  2K9S A;  4LFU A;  4DIQ A;  4I01 A;  5E3O A;  4A3E J;  1BL0 A;  2NRA C;  2ZME B;  3CJQ B;  5CKT A;  4KMF A;  1LFB A;  2E71 A;  1I3Q J;  1LEA A;  4EJU A;  1E17 A;  4IOC F;  2O8K A;  3I59 A;  2O6G E;  2W4S A;  2XRN A;  3L1P A;  2EV6 A;  3DEU A;  1DQU A;  2Y0S N;  3EUH A;  1X1B A;  1BM9 A;  2VJ5 A;  3DU5 A;  2CW8 A;  3QOP A;  2ZBK A;  3NQO A;  3PQJ A;  4B43 A;  1EV7 A;  3AAF A;  3QPT A;  1BIA A;  5ICE A;  2IVM A;  2X85 A;  4EM1 A;  4YFX F;  3AG1 H;  5F0C A;  4UUV A;  3GZ5 A;  1Z6R A;  2CSO A;  3WTS C;  4KA4 A;  1K79 A;  2BY0 A;  1Y0U A;  4IRG A;  4L9V A;  4BL0 B;  1ON2 A;  2DYS H;  5DUI A;  3C1D A;  3L2V A;  5ILV A;  1VQO I;  5L3E A;  4Z6Y A;  2XF6 A;  3OYM A;  3UR3 C;  2HZD A;  2L02 A;  4BJ6 C;  1HA8 A;  1OQY A;  2KQR A;  4XOT A;  4BHC A;  2HYJ A;  1BR1 A;  4YG2 F;  3AG3 H;  4XON A;  3ZQI A;  1TNT A;  2LF8 A;  3O8H A;  3LFU A;  3JRC A;  5BPI A;  3PO2 J;  2E1C A;  2JPB A;  2PMZ A;  4MEY F;  1ZRC A;  2FSW A;  4L9J A;  3GTG J;  2LK2 A;  4G12 A;  4JYK A;  1DP3 A;  3HOU J;  3GTO J;  2ECC A;  2EIM H;  4C3H J;  4B09 A;  3BCA A;  1FX7 A;  5L3C A;  3I4M J;  1JGS A;  3DFG A;  4UB6 C;  3B6C A;  4GFB A;  1REP C;  2BW3 B;  4II2 A;  3GLX A;  4G6D A;  4BH9 A;  1OCC H;  3L2C A;  3RPQ A;  1I27 A;  5FKL A;  2QKM B;  4Y4R A;  3A1Y A;  3HSE A;  2W85 A;  4RGR A;  3ECO A;  1L3L A;  1R4M B;  4PSX A;  1ZGW A;  3MAJ A;  3DCF A;  4XLA A;  3E6C C;  3GX4 X;  4BEH A;  2ID3 A;  4LIU A;  3JCU C;  4BDZ A;  2VKH A;  3MCZ A;  3ZMV A;  3DBR B;  1K6Y A;  1ZN2 A;  2RDP A;  3ZP5 A;  1MIJ A;  1Y6I A;  1PUE E;  1SC7 A;  4RB1 A;  3CCS I;  3EET A;  1FMW A;  3JRH A;  3TDZ C;  3BTI A;  2E5N A;  2KZV A;  4XID A;  2H1L A;  2KFD A;  4LG0 B;  5LLQ A;  1ZTR A;  3G71 I;  1FBU A;  4M9Z A;  3OYH A;  3H0D A;  1W4M A;  3BJA A;  1UMQ A;  4AUX A;  3GVA A;  3CLO A;  1YS7 A;  5E20 A;  2UWM A;  2ZB9 A;  4ABZ A;  3GZN B;  5L3G A;  3LA2 A;  3ABM H;  3OYE A;  3EPZ A;  3WTY C;  3MN2 A;  3CJT B;  5GP9 A;  1W7P D;  4IHV A;  3L09 A;  4Y52 J;  4KN7 X;  4L9T A;  3DKW A;  4A93 J;  4M6X A;  3ZOB A;  4E4H A;  5FB2 A;  1V5F A;  3HRS A;  4ZYA A;  3K7A J;  1B59 A;  1R71 A;  2JVG A;  2FUG 2;  4BGD A;  3W2A A;  1Y0N A;  2JUC A;  1G8X A;  1P4X A;  5M5W J;  4HF0 A;  2D45 A;  4KIS A;  3GZ6 A;  1WH7 A;  3PNY A;  4A3I J;  3K9T A;  4CCO A;  4Q48 A;  3CTA A;  4G9Y A;  2M87 A;  1W0U A;  2HTS A;  2X48 A;  1W0T A;  4CZC A;  3VYR B;  2DBB A;  4MO7 A;  2XSD C;  1OCO H;  1BW6 A;  3DP7 A;  3LQR A;  4S05 A;  3H35 A;  3FXJ A;  4NB5 A;  2N8G A;  3K4B A;  5FD6 A;  3I56 I;  4KIF A;  4EJT A;  4F92 B;  3G6E I;  3I55 I;  1G2H A;  2GA2 A;  3HUG B;  3H9G A;  3Q0U A;  3U1K A;  5DUK A;  1FYK A;  4G6T B;  1Z6T A;  2R4G A;  3E6M A;  5ED4 A;  1MBE A;  2QSF X;  1ETO A;  3CO6 C;  3F3X A;  2NOJ B;  1B8I A;  2DI3 A;  1XTA A;  5HS7 A;  2STT A;  2D2W A;  2L54 A;  2M30 A;  1FNN A;  1VF9 A;  3K4N A;  3SEZ A;  4HDV A;  3QOD A;  2EPF A;  5M5X J;  4HQE A;  4MQ9 F;  1FIP A;  2PI0 A;  1E3P A;  2YPR A;  2RV8 A;  2VT3 A;  1X3Z B;  3G73 A;  1ON1 A;  1IGN A;  2H6C A;  3DTI A;  2FE3 A;  2GBY A;  2COB A;  4WF2 A;  1WI9 A;  2ZME C;  3HGY A;  3KZI C;  3PNT A;  2XHK A;  3CES A;  5FKK A;  1R23 A;  3KPH A;  2ZFW A;  4EV0 A;  1HSJ A;  2XGD A;  1IV6 A;  3VFZ A;  1A36 A;  1QRY A;  5JFR A;  1F5T A;  3FKJ A;  5F04 A;  4YEJ A;  2CS3 A;  3D1N I;  3RJP A;  1FSH A;  3EQL F;  4LIV A;  3J7Y J;  4AIK A;  1SFK A;  1ETV A;  3BR0 A;  4V2F A;  3BG7 A;  1WGX A;  5KK1 A;  3IH2 A;  3K0L A;  5ILS A;  1Z1D A;  3CCQ I;  4YIF A;  2LY1 A;  5HDG A;  2O03 A;  3QP5 A;  2ZCW A;  2EIN H;  4YII A;  2KJC A;  1OYI A;  2W48 A;  3OL4 A;  1P4A A;  2R5Z B;  1PDN C;  1MH3 A;  2K86 A;  2JK3 A;  1RPW A;  3J81 Z;  2QZ8 A;  1A31 A;  2BOL A;  4C2U A;  1X2N A;  3SZT A;  3RKY A;  2W1O A;  5K7F A;  1J7K A;  3OYL A;  4BY7 J;  2GLO A;  2UUZ A;  1L0O C;  1WJD A;  4BDY A;  3OR1 C;  1V55 H;  4YFN F;  2VJ4 A;  4BXX J;  3D0S A;  3C2B A;  1SAN A;  2RQP A;  2A6E F;  5IT3 A;  1V4R A;  3S3M A;  3CCV I;  4XRF A;  3LSH A;  2DA1 A;  4H4K C;  4HST A;  3ECH A;  3A03 A;  3F21 A;  2W57 A;  2GXA A;  3KEY A;  4H0E A;  3E5Q A;  5LRR A;  1TC3 C;  4BHB A;  3PSI A;  2BY1 A;  4N0B A;  2R7R A;  4IHW A;  3LST A;  4DBR A;  4A3J J;  3JR9 A;  3ZGK A;  4HNU A;  1Y56 A;  1UAA A;  1SD5 A;  3ASO H;  1A6Q A;  2X1D A;  3KP7 A;  4ZYH A;  3TW6 A;  3DPT A;  2CO5 A;  4A69 C;  2W84 A;  2VOO A;  2CUE A;  3JRB A;  2FX0 A;  3G3Z A;  5IOZ A;  4BKX A;  4Q5S F;  5EGO A;  2EFQ A;  1K61 A;  2BGC A;  4RS8 A;  4A12 A;  4EM0 B;  2DOA A;  1ZRD A;  1XSD A;  4RAF A;  3KYD B;  3SFZ A;  1Q1H A;  2PX9 A;  4IF4 A;  3IAM 2;  2R7S A;  4A3F J;  1W5S A;  1X2M A;  1XGS A;  3CO7 C;  1S7E A;  3IUO A;  4HF1 A;  2VIX A;  2K7L A;  2VLA A;  2O0Y A;  3KP2 A;  3K70 C;  3BTJ A;  1B9N A;  4XQF A;  1R49 A;  2GAU A;  3G1O A;  5D5X B;  4O3M A;  1F9N A;  2GWR A;  2JZY A;  3HHG A;  4C2M J;  1S29 A;  3C2G A;  4AID A;  4YRV A;  1SFE A;  3BG3 A;  3T0Y A;  1F4K A;  1FOW A;  2EA4 A;  2KP6 A;  3WGI A;  1FP2 A;  1MBF A;  2NVU B;  2LKX A;  3HYI A;  2LLK A;  3BCB A;  3CCL I;  2JSC A;  1X4O A;  1IN6 A;  3SZP A;  4FQG A;  4XSZ F;  3VYS B;  3JAM K;  1H9T A;  4A5N A;  1ETK A;  2R92 J;  4AM3 A;  4P9U A;  4I7H A;  4DYR A;  2XGE A;  4LG0 A;  4I2O A;  3WOD F;  4DYQ A;  1TWF J;  2KL4 A;  1K83 J;  1TNS A;  4AIH A;  3CCU I;  1JTX A;  1ZRF A;  2OU2 A;  4CYC A;  3H9Q A;  2P5L C;  1JI8 A;  5D5W B;  4OIR F;  4ZYE A;  3J81 K;  1QHG A;  3H36 A;  4KIG A;  1YJ9 I;  2CUZ A;  2BHY A;  4F93 B;  1UHM A;  4OIQ F;  1X58 A;  1PYV A;  5EZH A;  3GTL J;  3ELK A;  4BE0 A;  3BJ6 A;  4JX4 A;  1X19 A;  2ELH A;  1IG7 A;  2Q2E B;  2GM4 A;  1QGP A;  3DEW A;  3WTU C;  4BAC A;  2L4A A;  1RIO H;  2JTV A;  2IS2 A;  4XOR A;  2Y31 A;  3H5A A;  2HOA A;  2QLZ A;  3ZR8 X;  5HLI A;  4W97 A;  4A2U A;  2JMW A;  4M71 A;  3J80 K;  1E3O C;  1JUP A;  1N75 A;  3K4M A;  5CQG A;  3OS0 A;  1YIO A;  1R58 A;  4FX0 A;  4M74 A;  5H6Q A;  2VKE A;  5CVR A;  5FJ8 J;  4ZJZ A;  5GTI C;  2K02 A;  3MMY B;  4XLN F;  1KZH A;  3BQZ A;  2ESH A;  3ZMD A;  1D0Z A;  1QZE A;  3I64 A;  4LB6 B;  4I6Z A;  1D8J A;  2BY3 A;  1GHC A;  3BPX A;  3OYJ A;  2ICW G;  3S1R J;  2O61 A;  2QSG X;  3ZQH A;  2Z99 A;  2BV6 A;  1I5Z A;  1ULY A;  2XC7 A;  1UHW A;  2OCC H;  3FHN A;  2EBI A;  4RMN A;  3F8F A;  3WTZ A;  1LE8 B;  1S8N A;  4LB5 A;  1GVJ A;  3QPH A;  2H6B A;  1QPM A;  1JE8 A;  4AVZ A;  4A3K J;  3I5U A;  4Q47 A;  3OSG A;  5D4S A;  2VXZ A;  3IKT A;  2I5U A;  4NBQ A;  2L4M A;  4IXA A;  3ZQC A;  1ZR2 A;  1HBX G;  1ZR4 A;  1K78 A;  2YU9 J;  1MW7 A;  2HEO A;  5FLV A;  2F6C A;  2PMH A;  3V42 A;  2Q2E A;  3SHF A;  3OOU A;  5L3B A;  3HSF A;  4CUG A;  2JA8 J;  4LMY A;  3JRE A;  2MFZ A;  1D1A A;  4LJZ F;  3WGH A;  3P9K A;  3TP3 A;  1HDP A;  2NNN A;  5LHG A;  1T0F A;  5FKO A;  3OMY A;  3M1E A;  5DD8 A;  2MYS A;  1GLN A;  2LDU A;  3SYT A;  3ML6 A;  4HW0 A;  2V1D A;  4DNC A;  5DM7 F;  3MKW B;  3TQN A;  5ICG A;  2WAE A;  5GPC A;  3FK6 A;  1WVR A;  1TZL A;  3KZY A;  2NVT J;  3VB2 A;  1WJB A;  1KQ9 A;  1XC5 A;  1UST A;  4PGG A; 
#chains in the Genus database with same CATH homology
 1WCM J;  4FE7 A;  2JJ7 A;  3HDD A;  3RZO J;  2OPT A;  5EZG A;  3BR6 A;  1WI3 A;  1F36 A;  1BW5 A;  4AC0 A;  5EG0 B;  1QVU A;  4XRM A;  1AKH A;  3HM5 A;  2EZI A;  4UUS B;  5C44 J;  3HGG A;  2KDZ A;  2XPW A;  1H8A C;  1P7J A;  3RKQ A;  1O4X A;  2YS9 A;  3W6V A;  2CU7 A;  5IP9 J;  3LSR A;  1JKR C;  4BY1 J;  2TCT A;  1ZQ3 P;  4FIS A;  3GTM J;  5M5Y J;  3BTC A;  1JTY A;  2DA4 A;  1T56 A;  5E3O A;  4IHX A;  2K9S A;  1RES A;  4A3E J;  1BL0 A;  4B1R A;  1MH4 A;  1LFB A;  2NS7 A;  1QVT A;  1I3Q J;  1JKO C;  3A01 A;  1GVD A;  2O8K A;  4D7M A;  5K7H A;  3L1P A;  2Y0S N;  1GT0 C;  3HKZ N;  5DS9 A;  2VI6 A;  2EZH A;  3GTK J;  3TED A;  1IUF A;  3LSG A;  3CDL A;  5IYB J;  4J19 A;  5F0C A;  1HF0 A;  1DU6 A;  3E7L A;  5F1J A;  3S17 J;  1SFO J;  2E2J J;  5J1U A;  3PO3 J;  2LTP A;  1FTZ A;  2EZL A;  2M9H A;  4M3G A;  1DU0 A;  1JKP C;  2WB1 N;  3G1L A;  3GTP J;  1OFC X;  5C4X J;  4HNV A;  1LFU P;  5IYC J;  2JA5 J;  1HDD C;  2HYJ A;  2QCO A;  2G0E A;  3ZQI A;  3O8H A;  1MBK A;  4MLO A;  3JRC A;  2R7Z J;  3RQI A;  1ENH A;  2DTZ A;  3PO2 J;  3JRI A;  3RZD J;  3LSJ A;  4RBO A;  3IH4 A;  2JA6 J;  3GTG J;  2LK2 A;  4G12 A;  1T33 A;  4JYK A;  3Q3S A;  4QTR A;  3HOU J;  3GTO J;  5J3L A;  4W1U A;  1MSF C;  1MNM C;  2ECC A;  4C3H J;  1XS9 A;  3CQZ J;  4JX5 A;  1NK3 P;  2I10 A;  3I4M J;  2X6O A;  1B8I B;  2NVQ J;  1ETY A;  1A6I A;  3B6C A;  4GFB A;  2OF7 A;  1HCR A;  2CJJ A;  5IP7 J;  3F0C A;  2M34 A;  5GPA A;  3GTQ J;  5FKL A;  1IDZ A;  2IEK A;  2LVS A;  4DYC A;  1ZGW A;  5C4J J;  2DN0 A;  2KT0 A;  3DCF A;  2DA5 A;  2ME0 A;  4V2G A;  3JRG A;  3M3Y J;  3BTL A;  4QIW N;  2Y2Z A;  1OCP A;  5HOD A;  2ID3 A;  3K2A A;  2O7O A;  4XRS G;  2JWT A;  3ZQF A;  5EF6 A;  3QQA A;  1AU7 A;  2XRL A;  3JRH A;  2DMP A;  1MBG A;  2DJN A;  5F0F A;  2EZK A;  3BTI A;  4L5E A;  1TWG J;  4XID A;  3M4O J;  3OSF A;  1ZTR A;  4JP0 A;  1B72 A;  1JUS A;  1I50 J;  3H3V K;  2XGC A;  1FTT A;  1UMQ A;  4AUX A;  1RKW A;  2TRT A;  1JGG A;  2ZB9 A;  4ABZ A;  2NVY J;  4MIM A;  5F0H A;  3UKG A;  2ELK A;  3BR1 A;  2L7F P;  3MN2 A;  5GP9 A;  4RDU A;  4IHV A;  3FIS A;  4Y52 J;  4A93 J;  3OIO A;  4DZP A;  3NAR A;  3ZOB A;  3K7A J;  3BG9 A;  5M5W J;  2M2E A;  1UG2 A;  1WH7 A;  3ZQL A;  4A3I J;  3A01 B;  2L9R A;  2H1K A;  1Y1W J;  1MBJ A;  3JRF A;  1W0U A;  1H89 C;  2X48 A;  2L7Z A;  5JLW A;  1W0T A;  4MO7 A;  2XSD C;  4IHY A;  3S1N J;  1BW6 A;  1YRN A;  3CMY A;  2R5Y B;  2N8G A;  5F27 A;  5EG0 A;  1ZK8 A;  3NAU A;  2P81 A;  1G2H A;  4M3B A;  1ETX A;  3Q0U A;  3S16 J;  3CCY A;  1MBE A;  4DW6 A;  1ETO A;  1U9O A;  1B8I A;  3HOY J;  3HOX J;  2R0Q C;  5FKN A;  2RAE A;  2E19 A;  2IBD A;  1VF9 A;  5M5X J;  2EH3 A;  3Q0W A;  3S15 J;  1FIP A;  2E1O A;  5M3M J;  4X1E A;  1WH5 A;  3BR3 A;  1RKT A;  2LFB A;  1RR7 A;  1IGN A;  4FCY A;  2GBY A;  2COB A;  3B6A A;  3HEF A;  3HOW J;  1R9T J;  2DA6 A;  3HGY A;  4A3L J;  1VI0 A;  5E3N A;  5E3M A;  5FKK A;  1IV6 A;  2XGD A;  1QRY A;  2ME6 A;  2DMT A;  4NDL A;  3SFI A;  5F04 A;  2R5Y A;  1IJW C;  3D1N I;  5J1R A;  3A02 A;  2HXI A;  5IP6 A;  3JRD A;  1ETV A;  2XB5 A;  4FE4 A;  3BR0 A;  4V2F A;  2LY9 A;  1HLV A;  1WGX A;  4AYB N;  2CQX A;  4S0H B;  3IH2 A;  3Q0V A;  1JUM A;  3S2D J;  5M3F J;  1QPI A;  4B3A A;  4IEJ A;  1RET A;  2FD5 A;  2W48 A;  2DMN A;  2R5Z B;  4FTH A;  1MH3 A;  2XPU A;  3H0G J;  4CYC B;  1IDY A;  2JK3 A;  1BA5 A;  2IAI A;  1RPW A;  4M3D A;  1Z77 A;  1X2N A;  1JT6 A;  5K7F A;  3I4N J;  1TWC J;  4BY7 J;  2GLO A;  1U9N A;  1VND A;  2ID6 A;  3SJM A;  1JJ6 C;  1TWH J;  4BXX J;  5BNG A;  1VFC A;  3C2B A;  1SAN A;  9ANT A;  3FIW A;  2DA1 A;  1ETQ A;  3A03 A;  3TP0 A;  1TC3 C;  4UUS A;  1A5J A;  2XB0 X;  3BT9 A;  4IHW A;  3WHC A;  2DA3 A;  4B4C A;  5C3E J;  4A3J J;  3JR9 A;  3S1M J;  3VPR A;  3HOV J;  3IV5 A;  2YUS A;  5DTD A;  5IPA A;  1ITY A;  2VUM J;  3TW6 A;  5EEA A;  4EEF G;  4A69 C;  2MGQ A;  2DMQ A;  2CUE A;  1JJ8 C;  2K9N A;  2FX0 A;  5IOZ A;  3JRB A;  4BKX A;  1EF4 A;  5EGO A;  5IOY A;  1K61 A;  2DA2 A;  4C3J J;  2QF7 A;  1OJL A;  1U78 A;  1PUF B;  4A3C J;  1APL C;  5FLM J;  3MVP A;  1GV5 A;  4A3F J;  1NTC A;  1ETW A;  1X2M A;  1S7E A;  5E3L A;  3LSP A;  5EDN A;  2WAQ N;  2ECB A;  3BTJ A;  2X9D A;  2HOS A;  3G1O A;  1PUF A;  1ORK A;  4C2M J;  3GTJ J;  1I6H J;  3BG3 A;  1UHS A;  3ZQG A;  1MBF A;  3QPS A;  2LKX A;  2AHQ A;  3FK7 A;  3TW7 A;  1CQT A;  2CQQ A;  2HXO A;  2LLK A;  3HBL A;  3PM1 A;  3S2H J;  4MFD A;  2HOT A;  1BJZ A;  2CUF A;  2R5Z A;  2O9L A;  1NK2 P;  1LE8 A;  4BBS J;  1JKQ C;  1ETK A;  2R92 J;  1Y1V J;  4DYR A;  2XGE A;  4DYQ A;  2FJ1 A;  1TWF J;  1K83 J;  1B72 B;  1JTX A;  4CYC A;  2PMZ N;  4LOC A;  2L7M P;  2MSY A;  1H88 C;  3LNQ A;  1D5Y A;  3BR5 A;  1X58 A;  4D7N A;  2NVX J;  2B63 J;  1MSE C;  5EZH A;  3GTL J;  1GV2 A;  4JX4 A;  2LR8 A;  1MBH A;  4Y7N J;  2NS8 A;  1IG7 A;  2GM4 A;  3DEW A;  4XRS A;  2MG4 A;  2HQ5 A;  3FKI J;  5JLX A;  5J1Y A;  3BR2 A;  2Y31 A;  2HI3 A;  2HDD A;  2HOA A;  3JRA A;  2R93 J;  1POG A;  4W97 A;  2JMW A;  2Y9Y A;  4M6V A;  5F08 A;  1E3O C;  3QPL A;  1JUP A;  2LP0 A;  2E2I J;  5FKM A;  1YRN B;  2VKE A;  5FJ8 J;  1P7I A;  1F43 A;  2LD5 A;  1Z0X A;  2M8G X;  3BQY A;  1HOM A;  3BQZ A;  5EYR A;  4DZJ A;  2CRG A;  4I6Z A;  2DA7 A;  3S1R J;  1JT0 A;  4JX6 A;  1IRZ A;  3ZQH A;  3O8G A;  2DMU A;  1IC8 A;  2K9Q A;  3SDG A;  4C3I J;  2EBI A;  1TWA J;  1LE8 B;  3MKL A;  4M3E A;  5IYD J;  2FQ4 A;  2AO9 A;  1GDT A;  1FEX A;  1AHD P;  4A3K J;  4X6A J;  1AKH B;  1GUU A;  4A3D J;  1ZKG A;  3GBG A;  3OSG A;  2K40 A;  2Y9Z A;  4XIC A;  3S1Q J;  3HB9 A;  4D5C A;  3BG5 A;  1FIA A;  2EQR A;  3ZQC A;  1ZR2 A;  1ZR4 A;  2XPV A;  2YU9 J;  1FJL A;  2M0C A;  4UUT A;  2E2H J;  5FLV A;  4D5F A;  4A3G J;  5K7Z A;  2VPR A;  3WHB A;  3OOU A;  2Y30 A;  2JA7 J;  2JA8 J;  3JRE A;  2D5V A;  4M3F A;  4BBR J;  1WPK A;  1U8B A;  3IH3 A;  2WV1 A;  3TP3 A;  1HDP A;  1OCT C;  5FKO A;  1XG1 A;  3LOC A;  4MFE A;  4A3B J;  2JN6 A;  5EGO B;  2MW8 A;  5GPC A;  3FK6 A;  1Q1V A;  4QSH A;  2L0K A;  2NVT J;  2VKV A;  3HOZ J;  4I76 A;  4A3M J;  2H8R A;  4XK4 A;  1XC5 A;  3G1M A;  3S14 J;  2NOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...