3K2AA

Crystal structure of the homeobox domain of human homeobox protein meis2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
55
structure length
55
Chain Sequence
PKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Homeobox protein Meis2
publication title Crystal structure of the homeobox domain of human homeobox protein Meis2
rcsb
source organism Homo sapiens
total genus 17
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3k2aA00
5EGOB 3OSFA 1ETKA 3JRHA 3S17J 2NVQJ 2E2IJ 1HCRA 2EZHA 4MFEA 5E3OA 1U9NA 4XRMA 5IP6A 3TP3A 1D5YA 4XIDA 3JRIA 3WHCA 4NDLA 2HYJA 3HOUJ 2CUEA 3JRBA 4BBRJ 5JLXA 1P7IA 3FKIJ 2YS9A 1MH3A 3HKZN 4A3CJ 1T33A 5FKKA 4D7NA 2LLKA 3BR0A 2NOGA 2MGQA 5EZHA 1TWAJ 5GPAA 5IP7J 3BG3A 2JA7J 2XPUA 2AHQA 4M3FA 1LE8A 1GV5A 2XB5A 2IAIA 3ZQHA 2HQ5A 4D5FA 1WCMJ 2H1KA 3GTMJ 3W6VA 5EDNA 1X58A 3HOVJ 4XK4A 2K40A 2FJ1A 5K7FA 2ZB9A 3LSRA 2XRLA 3HB9A 1IRZA 2NVYJ 1G2HA 2ID6A 3HOYJ 1H88C 2IBDA 3ZQCA 1MSFC 5F04A 1NK3P 1Z0XA 2H8RA 1MBKA 1PUFA 2E1OA 2L0KA 2NS8A 1RKWA 3BR6A 2DA3A 2CJJA 2TRTA 1IGNA 1ZTRA 1JKPC 3M3YJ 3A01A 2OF7A 4XICA 1QRYA 2DTZA 5EZGA 1NTCA 1MBFA 3BTJA 3MKLA 5FKNA 1R9TJ 2N8GA 5C44J 2NVXJ 2EH3A 4Y7NJ 3SJMA 3G1LA 4I6ZA 5F1JA 2CU7A 3A03A 4DZPA 4A93J 1WGXA 3HGGA 5FKMA 5F27A 5EGOA 4Y52J 2R5ZB 2DA5A 5K7ZA 3PO3J 2Y2ZA 4JP0A 3GTKJ 4B3AA 1JGGA 2DMUA 1ITYA 1B8IB 3RZOJ 2JWTA 2LK2A 2YUSA 2LY9A 1WH7A 3Q3SA 2LFBA 2Y31A 5IP9J 4DW6A 4BY7J 4A3KJ 2XGEA 3K2AA 1GT0C 1K61A 1MNMC 1UMQA 1I3QJ 3BR5A 1T56A 4BXXJ 5GP9A 3FK6A 4CYCB 2K9SA 1JTYA 1APLC 3CQZJ 3MVPA 3L1PA 1JTXA 4B4CA 1QVTA 2WV1A 1I6HJ 4UUSB 2JA6J 4BKXA 5F0HA 2B63J 5C4JJ 4C3JJ 1RKTA 3OOUA 1ETOA 1YRNB 4QTRA 1RESA 2Y30A 1GUUA 2O8KA 1Y1VJ 3MN2A 4RDUA 1OCPA 4FISA 1F43A 2R0QC 1QPIA 2JK3A 1A6IA 3S15J 5FLVA 1X2NA 2P81A 3BTCA 3I4MJ 1S7EA 2CRGA 3BR1A 2VPRA 3TW7A 4XRSG 4A3DJ 2NS7A 1ORKA 1MBGA 4MO7A 2X6OA 2L7ZA 1U9OA 3JRAA 2LTPA 1FIAA 3LNQA 2YU9J 3S14J 4S0HB 3VPRA 1A5JA 2RAEA 2DA1A 5J3LA 5E3MA 2ECBA 1ZGWA 2E2JJ 2K9QA 3BR3A 1HDPA 3C2BA 1TWGJ 1P7JA 1I50J 1XC5A 2ID3A 4BY1J 3BTIA 1IJWC 3LSGA 5C4XJ 2Y0SN 4V2FA 2FX0A 2R5ZA 1F36A 4UUTA 1FJLA 4W1UA 3TEDA 1TC3C 1NK2P 3LOCA 5M5YJ 1TWHJ 3DEWA 2VI6A 1MH4A 2LP0A 3O8GA 4IHYA 4XRSA 2QCOA 2XSDC 3BR2A 1X2MA 1MBEA 5J1RA 4M3BA 1RETA 4AYBN 3HGYA 3PO2J 3HBLA 4DYRA 2R93J 2HI3A 1ZK8A 1JJ8C 3D1NI 1ETWA 4CYCA 5IOZA 2DA7A 2EZLA 2KT0A 3IH3A 5IOYA 2L7MP 4A3JJ 1RR7A 1JT0A 4DZJA 1UHSA 2VKVA 1JKOC 2GM4A 2M2EA 3GBGA 2M8GX 4JX6A 2GBYA 4UUSA 2HXOA 1JT6A 4X6AJ 2MSYA 2LR8A 2O7OA 3BG9A 5J1UA 5FLMJ 1ENHA 3G1OA 2HDDA 1VF9A 3H0GJ 2XGDA 1MSEC 1YRNA 3GTPJ 4IHVA 2KDZA 4DYCA 3RQIA 4A3GJ 2HOAA 4AC0A 3B6CA 4QIWN 3S16J 4JX4A 4W97A 3TW6A 4A3EJ 1AKHB 3S1QJ 1WH5A 2DMQA 3BQZA 4I76A 1K83J 1JUSA 5FKOA 2CQXA 3K7AJ 2Y9ZA 2I10A 1XG1A 5FKLA 3M4OJ 2NVTJ 4RBOA 1MBHA 3BTLA 3HM5A 5EYRA 1HDDC 1H89C 4C2MJ 4EEFG 2FD5A 1IDZA 3E7LA 5EF6A 2ME6A 3HOZJ 3F0CA 1Y1WJ 2CUFA 3HOWJ 1FEXA 5J1YA 4A3FJ 3S2DJ 1ETVA 1IG7A 4L5EA 1ETQA 2TCTA 2GLOA 2WB1N 3IH2A 4M6VA 4D7MA 2G0EA 1ZKGA 4A3IJ 2DA4A 4IHXA 2X9DA 3UKGA 1ZQ3P 3GTQJ 3LSPA 3CMYA 4A3LJ 3FIWA 1JUPA 5IYDJ 2COBA 1B72B 2JJ7A 3JREA 1TWCJ 1BA5A 4MIMA 4JX5A 4FE7A 5C3EJ 3RZDJ 2EZIA 2K9NA 1BJZA 4J19A 5FJ8J 2ECCA 1IDYA 1VNDA 5EG0B 1OFCX 3HOXJ 3GTJJ 2AO9A 2CQQA 1BW5A 5E3NA 4C3IJ 2LVSA 3WHBA 3HDDA 1HF0A 5IYCJ 3JRCA 1W0UA 1UG2A 1HOMA 4ABZA 3LSJA 1ETXA 3Q0WA 4FCYA 2PMZN 1RPWA 3B6AA 4B1RA 1OCTC 3O8HA 1MBJA 1VI0A 2VKEA 5IYBJ 1AKHA 2Y9YA 2MW8A 5F08A 4AUXA 2R92J 1IC8A 3CDLA 1CQTA 3QQAA 3GTOJ 4X1EA 5IPAA 5M3FJ 2E2HJ 1FTZA 1B8IA 1BW6A 5DTDA 4M3GA 3BG5A 3JR9A 1FIPA 9ANTA 2R5YB 3SFIA 4C3HJ 4JYKA 1VFCA 1HLVA 2QF7A 2ME0A 1XS9A 4QSHA 3S1NJ 2M34A 2EBIA 3NAUA 2W48A 3IH4A 2XPVA 3FK7A 2XB0X 3Q0UA 2HOTA 2XGCA 1U8BA 3ZQLA 4M3EA 5F0CA 3JRFA 4HNVA 4G12A 3S1RJ 1LFUP 1JUMA 2ELKA 2EQRA 3ZQIA 1JJ6C 1DU0A 3G1MA 3JRGA 5M5WJ 2DMPA 1DU6A 2L9RA 1B72A 5E3LA 5BNGA 3DCFA 1TWFJ 3H3VK 2WAQN 5F0FA 4LOCA 1POGA 2X48A 4MLOA 3TP0A 1JKRC 5M3MJ 1GV2A 5EG0A 2DA6A 2LD5A 2M0CA 3Q0VA 1BL0A 4DYQA 2O9LA 4IHWA 1ETYA 1EF4A 3BQYA 2OPTA 5HODA 1GVDA 3CCYA 4A69C 2DA2A 2EZKA 2DN0A 2XPWA 1GDTA 1AHDP 1FTTA 1QVUA 1JKQC 2FQ4A 2E19A 1LFBA 5K7HA 2VUMJ 3HEFA 1ZR4A 3OIOA 2IEKA 4FTHA 1LE8B 1SANA 2DMTA 1AU7A 2DJNA 4BBSJ 2D5VA 2HOSA 3ZQGA 3ZQFA 4A3MJ 5JLWA 3RKQA 1Q1VA 1WI3A 4V2GA 4M3DA 3NARA 3A02A 3OSGA 3QPLA 1O4XA 3I4NJ 2R5YA 2HXIA 4MFDA 5GPCA 2L7FP 1IV6A 3JRDA 1PUFB 1E3OC 4GFBA 2MG4A 3S1MJ 4A3BJ 1IUFA 2JMWA 3BT9A 3SDGA 4D5CA 4FE4A 3A01B 2JN6A 1OJLA 3S2HJ 1SFOJ 1U78A 1H8AC 5M5XJ 1ZR2A 5EEAA 3PM1A 1W0TA 2DMNA 1WPKA 2LKXA 3GTGJ 2JA8J 4IEJA 2M9HA 1Z77A 3GTLJ 3FISA 3QPSA 2R7ZJ 5DS9A 2JA5J 3ZOBA 3IV5A
chains in the Genus database with same CATH superfamily
1K78A 2HR3A 1ETKA 2H1LA 3CJNA 3WTWC 3AG2H 3O6BB 2XF5A 1BI1A 3VOEA 5L3EA 4GO1A 2EZHA 2VL8A 2YPRA 4LG0A 1JI8A 4UHTA 2X6YA 4XN3A 3JRIA 4NDLA 1ZAOA 1V55H 1G3WA 2NYXA 1J09A 1LNWA 1MGTA 2OC6A 4QPQA 2CUZA 4BBRJ 1P7IA 3GLLA 2KHMA 2VXDA 3FKIJ 5GAGJ 1T2KA 1E17A 1P2FA 3HKZN 3ZGKA 2K9LA 4A6EA 3KP6A 2DFFA 2MGQA 4IXAA 4M9ZA 4EJTA 2Z99A 4XONA 5AIPA 5GPAA 2FNPA 3CO6C 2CYYA 3DU6A 3AG1H 2JA7J 4M3FA 2AS5F 2R7FA 2VLAA 3GTMJ 3FXJA 4HDVA 2D1VA 3DKWA 3RSNA 2ZJQF 4N4NB 4KT6A 1TQPA 5K7FA 2ZB9A 2XRLA 3FMSA 1IRZA 2J5PA 3AKZA 2KIFA 1XSVA 5BS6A 4UB8C 1G2HA 1W5SA 2HGCA 3HOYJ 3OYKA 1OR7A 3BZKA 4IQ4A 4B8XA 1I27A 5F04A 3DV8A 3LAPA 1NK3P 2X51A 5E1XA 1MBKA 3E1SA 1PUFA 1BBYA 5EEGA 2NS8A 3AFHA 3R6SA 1J59A 1OQYA 2CJJA 5GAEJ 2TRTA 3C7JA 2LY1A 1U5TA 2DTRA 1QBJA 3I71A 1IAWA 2QLZA 2VB6A 1K7AA 1OCZH 2CV1A 4FASD 1ZH5A 5TISC 4CDGA 3W2AA 2N8GA 5BQTA 3LWFA 4DZPA 4A12A 4HSRA 1P6RA 2XV4S 5DUIA 1LEBA 1R7JA 4XLAA 4M73A 3JTHA 4B3AA 2E7XA 2HDCA 1Q1HA 2DMUA 4ZJZA 1KU7A 1B8IB 2ESHA 5L3CA 3IKVA 5BOXA 3FXOA 2PMHA 1ZLKA 3BC8A 2Q2EA 3F8FA 1VQ4I 4BY7J 2XGEA 3IHUA 1K61A 2V1NA 2CSOA 1KQ8A 2ZMEB 5CYVA 1T56A 2EIJH 2FEZA 5TRDA 2ICWG 2LYCA 3CJQB 1APLC 3CQZJ 1UCRA 4GYIA 3K2ZA 1JTXA 2F5VA 2MH2A 2KL4A 4U0WA 2WV1A 1XDSA 1AA7A 4ZDPA 4UUSB 2O03A 3FKJA 3Q5FA 2VKHA 2F5FA 5FB2A 4KIBA 1UJ8A 3CP2A 2Z9OA 3CCLI 1RKTA 2IW5A 3KYCB 1RESA 4DJAA 2O8KA 3OR2C 2QQ8A 2A6EF 2Z16A 2QGUA 2LBFA 2ZFWA 1F43A 1QPIA 4RB1A 5IT3A 1A6IA 1R5GA 3KZYA 4BE0A 5FLVA 2R7DA 4MQVA 3I4MJ 2VPRA 3TW7A 4XRSG 1ORKA 4MO7A 5HS8A 4A2UA 3VYRB 4O5VA 1FIAA 4HOBA 1X3WB 3SFZA 3WTYC 2FOKA 4I02A 4S0HB 4NUBA 1ACIA 3WTZA 4CXFA 1NHAA 3FXUA 1ZGWA 2E2JJ 5D6EA 3J7YJ 2A61A 3U1KA 1SFUA 4ESBA 2RDPA 3LSGA 2P5KA 4YFXF 3CMAI 4CCNA 1B6AA 4DBQA 2M45A 3K4MA 2K3FA 5DCMA 1E3HA 2P5LC 3KP7A 1TC3C 3LOCA 2EJRA 1TWHJ 2F4OB 2CWEA 5D5WB 2DXIA 1MH4A 3IWFA 4HEA2 1YJNI 4MTDA 5CVRA 2QCOA 2VKDA 4M3BA 1A35A 4U87A 4JBAA 3PO2J 4HYEA 4DYRA 1WJEA 1XMAA 2O8XA 1ZGAA 2DQLA 2AQEA 2DA7A 2EZLA 2KT0A 3BROA 2QSFX 2L7MP 3H92A 1RR7A 3IH3A 4Y15A 4CH7A 5J40A 3GBGA 1V5EA 3MFKA 2IT0A 4C9YA 1FOYA 3M1CA 2MSYA 3CF5F 5TJJA 5J1UA 4XM3A 3CD6I 3M07A 1ENHA 3CJTB 1S8NA 2XGDA 1MSEC 2IRFG 2Q1ZB 1ULYA 3LA3A 3TO6A 1QHGA 2HOAA 2GA2A 3OMYA 2FMYA 4BQOA 2KIQA 2JVGA 4QIWN 3S16J 3ZPLA 5IT9Z 4W97A 2VJ4A 3GUDA 1E3PA 4BQAA 2EFQA 3KLOA 1WH5A 3I55I 4F91B 5J47A 1W5CC 1OCRH 1WJBA 2R3SA 1K83J 3TO7A 1X1BA 1X4OA 3F8NA 4Y13A 1O7FA 2KQRA 2I10A 1SEUA 1XG1A 2LKSA 3P9KA 4LLGF 3GFIA 5EYRA 1HDDC 3A1YA 3OYFA 2BY1A 2ZKZA 2E1NA 3SEZA 2HS5A 1DP3A 3HOZJ 2M4GA 2ZXHA 2KMUA 1YJ9I 1PDNC 1ETVA 1WHUA 4CHUA 3ZQ7A 2PFBA 2QQAA 3KPHA 3OYCA 2MFZA 1S5LC 4IRIA 3OR1C 2I5UA 5GTHC 5J8CA 3S2WA 3IH2A 1TW3A 4H4KC 2G0EA 4D7MA 4XQFA 4ENMA 4A3IJ 3CO7C 2EIMH 3SZTA 2LREA 2BY0A 3GTQJ 4ZYGA 1B1BA 4XKBA 4A3LJ 2VIXA 3C2HA 3U2RA 5HOOA 2H6BA 2JJ7A 3JREA 1TWCJ 2DK5A 3RKXA 2JQ7A 1BA5A 3O3KA 1GVJA 3QU6A 4UV9A 4AIHA 5C3EJ 5E79C 2D45A 3RZDJ 1BJZA 3RDIA 1MIJA 2Z3YA 2BW3A 4UUVA 4PSWA 1W5TA 1S7OA 2O0YA 1OFCX 4DGWB 4AIKA 4EM2A 2AO9A 1JXSA 2CQQA 1DQUA 1K4SA 1YQAA 3NWSA 2K3PA 1FT9A 4RGRA 4P5OA 3HRMA 3I64A 3UNGC 1YJWI 3PNYA 3QOEA 2LRDA 2R7QA 3U1DA 3FM5A 3OS2A 2K4BA 3G6EI 4AVPA 2A3SA 3WHBA 3D5SC 2FNAA 2EA4A 3DBLB 3ZMSA 3U21A 4KUMA 1T6SA 3L2WA 4FETA 3QODA 4FCYA 2PMZN 3BG7A 1SD6A 4B1RA 4OIOF 1VI0A 2VKEA 5IYBJ 2FOWA 2DODA 3K4BA 1H9TA 2MW8A 5F08A 2NS0A 1ZG5A 4X1EA 1N78A 4QPOA 1B8IA 3OL4A 2QQ9A 5FRNA 3CC4I 1BC7C 3CP8A 2OJED 3HRTA 5ILUA 1XS9A 3ZXSA 3S1NJ 4S05A 4WX9A 1T0FC 3Q0UA 3NRVA 2HOTA 2V26A 4MEYF 4HAMA 2QYOA 3K0LA 3S3MA 5LRSA 3JRFA 4HRIA 2DK8A 3S1RJ 4AWXB 4Q47A 4FHTA 2EQRA 2ZSHB 1EV7A 4RLFA 1JJ6C 3EQLF 1UB9A 4G6QA 4BQNA 5JI6A 2UZKA 1D0YA 5M5WJ 4E7LA 1DU6A 2M30A 1ZREA 1D1BA 2CW7A 3IAM2 4KA4A 3DFGA 5BNGA 3QYEA 2DI3A 3M1EA 1WVRA 4CZCA 3H3VK 2WAQN 4IOCF 4IVNA 2X48A 1L3LA 2DFEA 1K78B 2R7OA 4KITB 1JKRC 3CUQC 3DLAA 3C2GA 1GV2A 4EQQA 1ON1A 2C6YA 4YFNF 1N75A 2O3FA 2KRCA 2DO7A 4PFPA 2M5WA 2K7LA 4P96A 2P4WA 1FWZA 4U88A 4LG0B 3NQOA 3O2PE 5ICCA 2NOJB 4LJZF 1ON2A 3N4MA 1FPQA 4E7IA 2KP6A 3DTEA 1GVDA 1YS7A 1SFKA 1T98A 4S04A 3CCYA 3I4PA 1ZG3A 1IN8A 2DN0A 2XPWA 3WE3A 3OYLA 3QP6A 2P7VB 3FX3A 2FQ4A 2E19A 3SZPA 3KLNA 4DOZA 1YHQI 2ZSIB 4ZYHA 2VUMJ 3HEFA 1ZR4A 1ZLJA 2DMTA 2MABA 3L7WA 4PJJA 2EILH 1DPUA 5FLXZ 3QU3A 4A3MJ 5JLWA 3ULQB 3KP3A 1Q1VA 2BVLA 3B73A 2E1MB 4I0BA 2KKOA 1UHWA 2VQHA 5TGTA 3H5NA 3NARA 3MQ0A 3I4NJ 2PG4A 2R5YA 1X4PA 4II2A 2HXIA 2ACJA 1WJCA 4CSWA 2GXGA 3CCJI 2K86A 2CG4A 4YIIA 4GGGA 2PI0A 1AOYA 3IC7A 2B0LA 1PUFB 1E3OC 2PMZA 3TDZC 4KNYA 3IRRA 2KRFA 2DT7B 1B59A 2PJRA 1IN7A 2X1DA 4PGHA 3E0JB 1XMKA 3HRSA 1U5TB 1BIBA 2VBZA 2A68F 3QPTA 4LK1F 2XROA 1H0MA 1DGWY 2JZYA 5CJ9A 3CF2A 1JHHA 5D5XB 5H20A 2JPCA 1W0TA 2XSJC 4IEJA 4YG2F 1JGSA 1ZRFA 2ISYA 2JSPA 3GTLJ 4E6KG 5DS9A 2JA5J 2EFWA 3IV5A 1W36D 4C2UA 2H94A 3OSFA 1FX7A 1VQ9I 1FMWA 2UXNA 3F9KA 3PNTA 1FYMA 2E2IJ 1F5TA 3HHGA 2UUZA 2XIGA 5E3OA 3KIOA 2IP2A 3L00A 3TOAA 3GXOA 1TQMA 5IP6A 1HSTA 4PCQA 2R7UA 5F6FA 2Q2EB 3TP3A 3I59A 5DYMA 4EATA 2HYJA 1MD0A 3IL2A 1X19A 2NVUB 2CV2A 3LAJA 4KISA 2E7WA 2VT2A 3IWZA 4A3CJ 2MA3A 1T33A 2LH9A 2LLKA 3PFYA 4RB3C 4HQEA 4PK4A 1LPQA 1J2XA 5IP7J 2WAQA 3ERED 2XPUA 3SXYA 1LE8A 3F6OA 1GV5A 5J6XA 2XB5A 2IAIA 4OAYA 2HQ5A 4D5FA 2A6HF 2PX9A 3H36A 4WCGA 5EDNA 1X58A 3DKYA 3HOVJ 3COAC 2KPMA 2K40A 2K85A 3GVAA 4NC8A 5KAFC 5FD6A 3LSRA 1KU2A 5B1BH 1R1TA 2HKXA 5CPRB 3MEXA 3IKTA 2JUGA 3QWLA 3ZQCA 2LBFB 2V7FA 5GADJ 4ZZDA 1A36A 4M74A 2CW8A 1T0FA 3J7AY 4F7ZA 1HXDA 1PYVA 1YYVA 2V9KA 1IGNA 3BZ6A 3E3VA 2XKOA 4XICA 1X1DA 4HF2A 1QRYA 2DTZA 5EZGA 1NTCA 1MBFA 5FKNA 3Q9VA 5A2QZ 3WTUC 1FLIA 1MMGA 4YIFA 5C44J 1LDJA 1EH8A 4Y7NJ 3SJMA 3G1LA 2R7WA 4P55A 4I6ZA 3A03A 4HA8A 1WGXA 2UV1A 4XR6A 2FRHA 3HGGA 5FKMA 1FP2A 3E5XA 3BDDA 4G94A 2KJCA 3W2WA 1HKSA 3K69A 3I9V2 2NNYA 4YELA 5DCMB 2BY2A 1JGGA 1O57A 2QA4I 3HUGA 1I1SA 1OPCA 2Y31A 3ZMDA 4XLPF 1J9IA 5IP9J 4DW6A 3ML6A 4UVCA 2GXBA 2K9MA 3K2AA 5D8LB 1R23A 3OY9A 3ELKA 4Y17A 2JSCA 2IS4A 5A2QK 4BH9A 3HXLA 3MVPA 2AXTC 3A4CA 4B4CA 1RNLA 2HQNA 3FBIB 3GO5A 3HPGA 1I6HJ 5JVTA 4NB5A 3FHZA 3HC7A 5C4JJ 1BI0A 1LVKA 2JVHA 2Y30A 3EUAA 2DPDA 1ZN2A 2GWRA 4RDUA 2PBIA 3K9TA 3BCAA 1Z3YA 2HZDA 1E0EA 2XF6A 2JK3A 3S93A 3DPLC 2EFOA 4EM0B 2P0WA 1VQLI 3VSLA 5F1RA 2V79A 2P81A 1F9NA 3BTCA 3VYTB 1S7EA 2QKLB 4N9HA 2UWMA 3BR1A 1KZHA 4F55A 2WY8Q 2FMLA 4KYWA 1U9OA 1R4NB 2ZBKA 3JRAA 2LTPA 2IGMA 1XD7A 1WJ5A 3SEQA 3S14J 3OOPA 1R5HA 1JE8A 3K1PA 1IO2A 2BV6A 1XGNA 2GA1A 3NEUA 3K70C 2ECBA 4IJAA 4M71A 1D0XA 2K9QA 2DCEA 1VQ7I 1HDPA 3C2BA 4BY1J 1T95A 2CS3A 3OS1A 3BZCA 3WU1B 4BNCA 4XL9A 4A0YA 2FX0A 4CA0A 2R5ZA 3OS0A 1WRJA 4XN0A 5D8KB 4W1UA 3K4NA 5CVVA 1QA6A 3AL0C 4PDKA 1FBUA 2W85A 2PLYA 1I6XA 3JW4A 2A6TA 2BXYA 3E5QA 4A5MA 2LP0A 3FXLA 3O8GA 3KEOA 5HVQC 3BR2A 2BW3B 4AYBN 3HGYA 5E8IA 2GXAA 3DKXA 3HBLA 2EV0A 4C2TA 1VQ5I 2R4GA 3D1NI 4HX4A 4CYCA 4XLCA 4IPAA 4OAZA 5D6FA 1JT0A 3LQRA 1W7PA 2YX4A 1WQ2A 3FZVA 4X6AJ 1Z21A 2Z1DA 3V7RA 1TZLA 3BG9A 2O7OA 2XGXA 2KISA 3S32A 3G1OA 2HDDA 3H0GJ 4A6DA 1D1CA 4LFUA 3VYSB 4ON0A 1ERDA 3H9JA 4UVBA 3RQIA 4XKWA 4A3GJ 2KDOA 1G59A 3B6CA 3GFMA 4A3EJ 1Y8QB 2VQCA 4YIRX 3HTUA 3DTIA 3ABMH 3I5UA 4I76A 4DQ2A 1DUXC 1X1PA 2HTJA 2CQXA 2Y9ZA 4ZDOA 2K4JA 5FKLA 4X0GA 4EGZA 2EV6A 3HM5A 1TLHB 1BIAA 1IDZA 2M3AA 2VPLA 4O6JA 5EF6A 3QYFA 4IHTA 3F0CA 2CUFA 4LB6B 2JT1A 4L5IA 5ICFA 4EJOA 1YW9A 4PSXA 1IG7A 1F4KA 3FXRA 4L5EA 3BG6A 4KMUX 1ETQA 2FBKA 3K10A 2WB1N 2A07F 3BJAA 2X9DA 4OMYA 1Z05A 4L9VA 3LSPA 4LITA 4XLNF 3FIWA 1JUPA 5L3DA 2O5RA 4RA2A 3WU2C 4IO9F 4OWRB 4ZTFA 3P5JA 3MD2A 2K9NA 3N97A 2EFPA 4P1WA 3V7SA 5FJ8J 4NHJA 2ZNYA 4PZJA 3J7ZI 2CQKA 1D8JA 2M8EA 3L09A 3HKZA 5HLHA 3HOXJ 4RGUA 3GTJJ 4I2OA 3OYDA 2ESNA 2FUG2 4HF0A 4BHBA 4C3IJ 2A5YB 2V1DA 3HDDA 2WADA 3KZIC 3JRCA 4A0XA 3EUKL 4ZTJA 5HLIA 1UG2A 3HZJA 1HOMA 1ETXA 2G7HA 5L3BA 4M6XA 3RJPA 4LIVA 1RPWA 1HBXG 2WAEA 3MMYB 4ZH4F 1FOXA 2OZUA 2V1UA 4AYBA 2G7UA 4OMZA 4U0YA 4B43A 4NC6A 4AUXA 2R92J 3CDLA 1CQTA 3QQAA 1MJAA 3PIPF 1TP4A 2WWYA 2E2HJ 2NNNA 2V9PA 3RKWA 3OV8A 5LGTA 1BJAA 2JPBA 2W82A 1BW6A 1UHMA 2ZMEC 1CF7A 5DTDA 2IS1A 2MD0A 3AG4H 3HG9A 3JR9A 2XKPA 1FIPA 2NAZA 3NWTA 2AXLA 4I01A 3SFIA 3JSPA 4C3HJ 2R5YB 3F23A 1HLVA 5H6QA 3VFZA 3M8EA 2ME0A 1IXSB 2YSRA 3NAUA 2EBIA 4MNUA 2LKPA 2W48A 1YX5A 5B66C 2XB0X 2XGCA 1U8BA 4M3EA 2YU3A 2PJRB 1B4AA 2R7SA 4L9NA 3T1BA 1LFUP 4ETSA 4BHCA 1L0OC 1JUMA 4B3XA 1DU0A 1ZELA 3JRGA 3BJ6A 2GIVA 3E6DA 3EETA 3RPQA 2DW4A 3FBNB 2PJPA 4Z6YA 3RI4A 4ENNA 2P6TA 3DCFA 1G6NA 3DPUA 3LMMA 1RUOA 2QSHX 4MLOA 4G6TB 3KE2A 3ECOA 3TP0A 1HSJA 1NH3A 5M3MJ 1W4MA 1YITI 5EG0A 4GYGA 1RIOH 3BY6A 5DV5A 2V4JC 2P7CB 3BPVA 1MMNA 4XKCA 3Q0VA 2IGNA 4BYYA 5L3FA 1SFXA 4BGDA 2O9LA 3ABUA 1QHHD 2UXXA 3L2VA 5DM6F 4YRVA 3Q9SA 1EF4A 3I59B 4RAFA 2OPTA 4UVAA 2DA2A 2EZKA 5KK1A 2IA2A 3R0JA 4IF4A 1FTTA 4HNTA 2X6WA 2ZXJA 5ICGA 3PQKA 3GZNB 4NNJA 5K7HA 4IL6C 2EA2A 3OIOA 4FTHA 3RQ4A 3WGHA 1LE8B 1SANA 2HVSA 1VZ0A 2Q8KA 1GXPA 2D1HA 5CLSA 5K1YA 3ZQFA 3J81Z 1A31A 4EJUA 3BPXA 2DDBA 2X85A 2XVCA 4V2GA 3T0YA 3OSGA 3QPLA 4KFCA 3KEYA 3OYJA 2A05A 4BXFA 2E35A 1HA8A 4MFDA 2RREA 3CUOA 3EPZA 2L7FP 3LSTA 3TKYA 1KYZA 1P9QC 4CCLA 2EV5A 3JRDA 4GFBA 3V8LA 3S1MJ 4A3BJ 2JMWA 1U2WA 2L5QA 1VQPI 3BT9A 2XRNA 2M4KA 3QYBA 3TL4X 2M87A 1SD4A 2JUCA 4IRGA 2BHZA 1ZGJA 1IUYA 3IRQA 4FE4A 1SAXA 4NQWA 3F8CA 2DYRH 2E34A 3S2HJ 3FHNA 3F6VA 1BI3A 3ZP5A 5M5XJ 3ZN1A 5EEAA 3PM1A 1U6GA 1SAUA 3DWLE 4I7HA 5CVIA 3J81K 3FISA 1D1AA 3FMRA 2QM3A 3QRFF 2I8DA 3ZOBA 3ZMZA 1R6RA 1HW5A 5E1ZB 2DQRA 2DBBA 1VQOI 5K5OA 3S17J 5JHUA 4BS9A 2LMDA 4BE1A 4CCOA 1DP7P 3MAJA 3HUGB 1ONVA 4OU0A 3V42A 3PUFA 1LDDA 2F5EA 3GYHX 1Z9CA 4LD5A 4XRMA 1IRXA 3WTVC 1D5YA 3WHCA 3LQQA 3JSOA 3HOSA 4XLFA 1LEAA 5JR3A 5JLXA 2XC7A 2YS9A 3PFIA 1I5ZA 5FKKA 1HW1A 2NOGA 4N0BA 1TWAJ 4OOIA 1WWXA 4CO8A 5LHIA 1Y56A 3GEZA 3C3WA 2PMUA 3L2RA 1BR1A 3ZQHA 1R58A 2FE3A 4EJVA 3ZMUA 2W00A 3KEQA 1IN4A 1D5VA 2FJ1A 1D0ZA 2R7TA 1TTYA 3CDIA 1P4XA 2HPIA 3CLQA 5LGNA 4I99C 1H88C 2IBDA 1MSFC 1RZ4A 1YW7A 2H8RA 1YS6A 3CJRB 3A2KA 2E1OA 3QOPA 1RKWA 1BM9A 1MKMA 2DA3A 5B1AH 1OYWA 4RAYA 2QBYA 1Y8RB 2EFNA 1JKPC 2K5CA 3M3YJ 2OF7A 3PUBA 1O3TA 2WAFA 3TGNA 2MC3A 3MCZA 3MKLA 1FSEA 3BTJA 3WTTC 5AIQA 4BACA 4ANJA 2NVXJ 2AQFA 2EH3A 2CFOA 5HLTA 3H3ZA 3ERMA 2YR2A 3RPUD 3VSKA 4D0PA 2FF4A 5F27A 2L3DA 5EGOA 4D9JA 4U7DA 2R5ZB 2RC4A 2L02A 2DA5A 3PO3J 5KNLA 3H35A 2BHYA 2Y2ZA 3PL8A 1UZCA 4XRFA 4HZFA 1TW2A 3D5RC 2XAFA 1ITYA 3GLXA 2JWTA 4G8XA 2LY9A 2FBIA 3H5RA 2GAUA 1OKRA 3KP5A 1S9HA 4LGWA 1FOKA 1WJAA 3HYIA 1B9NA 3KX2A 3LL7A 3ABKH 1BC8C 4IQJA 3RTRA 1GT0C 2VBYA 3RKYA 2MLKA 3OYIA 3BR5A 3DU5A 1SVLA 3FXQA 2GOXB 4UNOA 5GP9A 2LF8A 2XF7A 3FK6A 4R8HA 3CCUI 1VQKI 2L9NA 4CYCB 3AG3H 2K9SA 3H9GA 3I0TA 2Z33A 3HHHA 1YIJI 3ESWB 1W7PB 3H5AA 1J0RA 2QKMB 2JA6J 1WZ2A 4BKXA 1YX3A 4F3QA 5F0HA 3L9FA 1MW7A 2L4MA 1SD5A 3G71I 4L0ZB 2WBMA 3MKWB 4ZDLA 4C3JJ 3OOUA 1ETOA 2CH0A 4ASNA 4QTRA 1GUUA 1D8KA 5LGUA 5IY5H 2VE8A 1Y1VJ 5KVRA 3V7CA 3MN2A 2IGKA 2YX7A 1K6YA 2IJLA 2Y69H 2R0QC 3CLOA 4IRHA 4PJLA 1X2NA 4B44A 3ASNH 1U3EM 1J75A 2CRGA 2QENA 4CYDA 1TBXA 4A3DJ 2NS7A 3PJRA 1MBGA 1N25A 2X6OA 2H8WA 3RCOA 2BGCA 1ODDA 2MLGA 3LNQA 2VJIA 5D4SA 4MTEA 4BDYA 4HLXA 1LB2A 2WA0A 3VPRA 5J3LA 2DA1A 5E3MA 2LC2A 1V3FA 3DQVC 1M1EB 3BR3A 5D5VB 4XLEA 1TWGJ 1Z6RA 1I50J 2ID3A 2W24A 2Y75A 3EUHC 1A04A 2E60A 4RM3A 2Y0SN 4V2FA 3OIPA 4Q5SF 2RN7A 1A6QA 4UUTA 2E1MC 2V9VA 4U0VA 3F22A 3ROUA 2VASA 3TEDA 2LY2A 1MJBA 2V6CA 4JK1X 2M7BA 1SMYF 1J7KA 4LG3A 4XBFA 1O3RA 1NK2P 1WJDA 5B5EC 4RGXA 1EH7A 3N05A 3DF8A 1OR7C 1TL8A 4RAGA 1V5GA 2RNJA 4IHYA 2VOOA 2CFXA 3PSFA 5DD8A 4E7SA 4XRSA 3I56I 2HU9A 3PIOF 1AWCA 5J4YA 5J1RA 2KRHA 2ELHA 1R1UA 2L4AA 2HTSA 2RKHA 5ED4A 2ZJ2A 5E17F 2LF7A 3ZMVA 1Z67A 4AD9A 2ZXWH 1XGMA 2HNHA 5IOYA 4A3JJ 1UHSA 2M8GX 3FMQA 5FD5A 4OIPF 2GBYA 4ENKA 4WXHA 1JT6A 2VXZA 4EJWA 2VQGA 1VQMI 3TQNA 1MMAA 1W1WE 5FLMJ 1PVEA 1ZYRF 3FM3A 5FFXA 1YRNA 3ABLH 3ZQQA 1KQ9A 3GTPJ 2KDZA 4DYCA 3OL3A 2VC0A 2M1BA 5ICEA 3MZHA 3D5LA 1I3AA 2L01A 4M6YA 3TW6A 2XUBA 2EPFA 3CC2I 3DBRB 3BQZA 5HS9A 1KONA 1KU3A 5LHHA 3CUQA 1JUSA 1Z7LA 5FKOA 4LLNA 4WF2A 5CKTA 1XSDA 4HLYA 2LSOA 3M4OJ 1CF7B 4OIRF 2NVTJ 4BXUA 4BUPA 4RBOA 1MBHA 3BTLA 3VODA 1H89C 3CCSI 1TNSA 2A5WA 2Y0MA 4EEFG 2HOEA 2FD5A 1R36A 3KETA 2ME6A 1RR8C 3KP2A 2BXZA 4AIJA 4DBRA 2HQRA 4K2EA 2FBHA 5J1YA 2ZXIA 3KZZA 3HTSB 1TQIA 3S2DJ 5CQEA 2R7VA 1MMDA 2TCTA 1VQ6I 4M6VA 1ZKGA 3U9GA 1MDMA 1SD7A 2RGVA 3F21A 1O3SA 3K6GA 1PUEE 4B09A 2MYSA 2COBA 2ETHA 3AL0B 1XN7A 2L7KA 3WTSC 2OUMA 2PN6A 3M8FA 4MIMA 3G73A 4FQGA 1CGPA 2ZJPF 3FXMA 4F92B 3R60A 1LQ1A 4ZC3A 4E7HA 3P9CA 2Y48A 5BPDA 4J19A 1UELB 5LBQA 2NRAC 1MNEA 4O3MA 2DYSH 2DU9A 1IDYA 5DCFA 1VNDA 3DXJF 5EG0B 2W25A 4PFOA 4XMYA 1PP8F 1IW7F 3DLLF 5K5RA 1BW5A 4IKFA 3K1MA 2Y0SA 1HKQA 5HNFA 1HQCA 5E3NA 4YFKF 3OYNA 1DPRA 2LVSA 2P5VA 3BOQA 1HF0A 3K4JA 1IXCA 2P6SA 1O7LA 5IYCJ 2BYVE 4GXOA 3LSJA 3Q0WA 2VE9A 4BJTA 3OWTA 3B6AA 2GZWA 1OCTC 1MBJA 1XGOA 1S7AA 1AKHA 2CMPA 1UFMA 5KCMA 2Y9YA 4RM2A 2DPUA 2RQQA 1YTYA 5HDKA 4CUGA 4UY8I 3SQNA 1IC8A 4OIQF 3GTOJ 2H6CA 2OV7A 3R4KA 5M3FJ 4DNCA 1FTZA 5H2FC 1BOBA 4BJ6C 4KJZA 4I0AA 4M3GA 3BG5A 1IF1A 1DDNA 1UG0A 1VFCA 4JYKA 1WKMA 1QZYA 1XCBA 2DT5A 4QSHA 2KLOA 5DM7F 2M34A 5GTIC 1JHFA 3C1DA 3M7GA 1XTAA 4MQ9F 5F0CA 1BR2A 2VC1A 3EUHA 4G12A 2ELKA 3ZQIA 1TNTA 1QO0D 2VJJA 3G1MA 4NQWB 1YO5C 4HSTA 3KP4A 4Z2YA 4B48A 4J01A 2DMPA 2FXAA 2VQLA 5JVGF 1B72A 3TDUC 2G9WA 4IX7A 3CC7I 3CCQI 1TWFJ 1FSHA 3GFLA 5F0FA 4ENJA 3PSIA 2BBYA 2BEOA 4Q48A 5KAIC 2R7RA 2CV0A 1C0WA 3OYMA 5E1WA 4ZYAA 3EYYA 4KIGA 1IZ1A 4HG2A 2OBPA 3MZ8A 4RMNA 1XB4A 4HV5A 1P4AA 1FBQA 4KT5C 1OISA 4N4OB 3BQYA 2O61A 3A0BC 5LRRA 3S3NA 5HODA 1ZARA 5LEKA 1KQ0A 3E6BA 1V54H 3IAS2 4AIDA 2CGPA 1NG7A 3M9AA 4LMYA 3HIFA 2O6GE 3HSEA 5JFRA 4PJ0C 2LDUA 1JKQC 1SVMA 4JQFA 2X6XA 2B7EA 2BOLA 1N77A 4BEHA 4HPQA 2BY3A 3LSIA 3KYDB 1AU7A 2DJNA 3ECHA 4LB5A 3C18A 4BBSJ 1WFXA 2HOSA 1EH6A 2ZC2A 3ZQGA 4A5NA 2LNBA 4XLHA 5DEQA 3RKQA 1EA3A 2DLLA 2XAGA 2XAHA 3A02A 4E7KA 1ZRCA 4Y4RA 3S3OA 3V8KA 1R5ID 1O4XA 3BP8A 1FBSA 3WGGA 2LOOA 1R4MB 4TV7A 4Q4ZF 2OTLI 5BPIA 1LVAA 2M7AA 3LA7A 5FROA 2HQAA 4PJMA 1IV6A 3BLYA 1YG2A 3J80Z 4L0YB 1S29A 1G3YA 4WXDA 2W84A 2QEXI 1F1ZA 2VBWA 3MZYA 2QBYB 4Y33A 2E71A 3B02A 1RI7A 1OJLA 4IHSA 2JRMA 1Z1DA 3HL2A 1SFOJ 1YLFA 1U78A 2VJ5A 3ZCOA 4XORA 2E1CA 3LSKA 4F52A 4HDUA 2HVQA 4L18B 4GDFA 3QPSA 3OYGA 1E2XA 1Y0UA 5EGOB 2IPQX 3JRHA 2OQRA 4JOMA 2CUJA 2NVQJ 1IRGA 1HCRA 1VTNC 1DGRM 3OYAA 1W36C 4MFEA 4BHPA 1TT5B 1RUNA 1U9NA 3SDBA 3J80K 4RS8A 1SFEA 1YIOA 3CMMA 4XIDA 2QVOA 3HOUJ 1STZA 2CUEA 3OIQA 3OYEA 1W7PD 1MH3A 2OTJI 2IVMA 2E5NA 2BVMA 1WI9A 2OQGA 4D7NA 3BR0A 3BWGA 5EZHA 5HS7A 4CICA 1IV8A 2RQPA 3BG3A 3KFWX 2AHQA 3WG7H 4LLLA 2L2OA 4Y3OA 2FSWA 4AU7A 1WCMJ 4H0EA 2H1KA 3W6VA 2KJBA 2LG4A 1OCOH 2X4HA 2X1CA 3LSHA 4E4HA 5DD4A 3CDHA 4XK4A 3QPHA 5GAHJ 3HB9A 2NVYJ 3GCMA 3W3CA 2ID6A 4HX7A 2WC2A 2M0MA 1RRJA 4E70A 3QAHA 4R79A 5K5QA 1Z0XA 3SHFA 3FWEA 4FT8A 3MKYB 4V19K 1HKTA 4EGYA 2L0KA 3KCCA 5B3SH 1XGSA 2V1XA 3BR6A 1MJ9A 2STWA 1ZTRA 1FOWA 3A01A 3DBHB 2WB1A 2DFIA 3W6KB 1FYLA 1LJ9A 1R9TJ 4R1HA 1BOAA 2QQBA 2PEXA 2DAOA 2J5OA 2XHKA 1HC8A 5F1JA 2CU7A 4PUSA 4A93J 1I1GA 2VT3A 1USSA 4KMFA 4PGGA 4Y52J 3DEUA 5K7ZA 3G3ZA 4JP0A 3PNVA 4G7ZF 2EIKH 3ZN0A 3GTKJ 1BN5A 3RIRA 4HNUA 2PQ8A 4L9JA 3RZOJ 2LK2A 1OYIA 2YUSA 1QPMA 4C30A 1WH7A 3Q3SA 4P9UA 2LFBA 1MZBA 2EINH 5E8GA 3F72A 3RYRA 5LHGA 2BZTA 3ZR8X 3IUOA 4A3KJ 3FDYA 5EEHA 1MNMC 1JKOC 4EMSA 1UMQA 2DOEA 1I3QJ 4E7JA 1QNTA 4BXXJ 1Y6IA 2ZCWA 1U0JA 2F4MB 2RNGA 5HDGA 4BAYA 1QZZA 5E18F 4F93B 1KGSA 4M9SA 1JTYA 3WG9A 5D4RA 3L1PA 3I3LA 1LFPA 2JTVA 4I98B 1QVTA 4ESJA 3M8JA 2GOMA 2HYFA 4G9YA 5IT9K 3RPUA 3KYLA 1YI2I 4MHGA 2XAUA 3I58A 3DPTA 2B63J 1USTA 1SC7A 1G3SA 2HZTA 1YRNB 3JAMZ 4CCJA 5KHDA 3DP7A 2HVRA 1FZPB 3WE2A 1VQ8I 3D0SA 4KIFA 1OCPA 5AONA 4FISA 2OD5A 1NG6A 4U7BA 1KU9A 2F48A 1BR4A 3EDPA 4YEJA 4BE2A 2QSGX 3S15J 2Z5UA 3ISPA 4II3A 3CUQB 4CGZA 3REOA 2ADUA 1XDUA 1YFHA 2B9SA 2BE5F 3T8RA 2L7ZA 4ZYEA 2X1EA 3K70D 2F4IA 3HPHA 4G6DA 2YU9J 2XASA 2ELJA 1A5JA 2RAEA 1QGPA 5HLGA 3R0AA 3WODF 4AM3A 3GMEA 3GF2A 1P7JA 3LFKA 1XC5A 5BMZA 1I39A 4WXCA 3HSRA 3BTIA 1G8XA 1IJWC 2QZ8A 3V4GA 2KZVA 5C4XJ 3JAMK 1Z91A 1F36A 5HDNA 4XSXF 2WY7Q 2XAQA 2IXSA 3ZRGA 1MDMB 4GRIA 3VEPA 1FJLA 2VOPA 3H1CA 5JHFA 3L2QA 5M5YJ 1TT0A 4HBLA 3DEWA 4HQMA 3H3UA 4DIQA 4L5JA 1OCCH 2VI6A 4AVZA 4MEXF 4E7ZA 2ZO4A 2COMA 5EJCA 4ZZLA 2XAJA 4KICA 2ZMEA 2XSDC 3ABTA 3UR3C 4D1QA 1X2MA 1MBEA 3GX4X 1S6LA 3P9IA 4G7HF 3JCUC 1RETA 4P9FA 5ILVA 2R93J 2HI3A 1ZK8A 1FP1D 1SVOA 1ETWA 4EV0A 1JJ8C 1UAAA 4FX0A 4ESFA 5IOZA 4HF1A 1QU3A 2OCEA 3HOTA 3G2BA 1SMTA 2Z2SB 4HW0A 4DZJA 2VKVA 4EM1A 5LEJA 2M2EA 2GM4A 2V6EA 2L54A 4JX6A 5LFAA 4UUSA 2HXOA 4GCVA 4RB0A 1XCVA 2LR8A 2HEOA 2H09A 3H0DA 1VF9A 2OA4A 4IHVA 1EKEA 2HKOA 4WWCA 6PAXA 2ZFUA 1GXQA 4AC0A 4JX4A 4M9XA 1AKHB 4L9TA 2VONA 1YOVB 3S1QJ 2JRTA 4CZZA 2DMQA 1FNNA 5CQGA 2MD5A 1EJ9A 4KDPA 2DT6A 3QP5A 4XSZF 3K4CA 3K7AJ 3OYHA 3LFUA 3EYIA 3P7NA 1X1AA 1XX5A 2OAZA 3MWMA 1R00A 3VB2A 2IS6A 4G7OF 4C2MJ 3SYTA 4EVIA 1X3ZB 1OLTA 3CCRI 4IZZA 3E7LA 5L3GA 2TDXA 4XOTA 2HYGD 1Y1WJ 3E5UA 3HOWJ 1FEXA 2W1OA 4A3FJ 1ZRDA 3I53A 1G4DA 1XMXA 4CCMA 3WGIA 2GLOA 4ZYDA 2IS2A 1O3QA 1WJFA 4BJ5C 3CTAA 1Y0NA 2DA4A 4QLCU 4IHXA 3UKGA 1S3JA 4QWQA 1ZQ3P 4RLQA 1K79A 3CMYA 4RB2C 1R71A 2CW0F 5IYDJ 2KZGA 1T08B 1B72B 2CQNA 3TMOA 4JX5A 4FE7A 3W2VA 1OYYA 2EZIA 3K1NA 3CCEI 5ILSA 1K4TA 2RVCA 2ZNZA 4KN4X 3G4SI 4BDZA 2F6CA 1GHCA 2ECCA 1V5FA 3H9QA 2VODA 1U8RA 4BU2A 2KIUA 2DDAA 3CMEI 1RC9A 2DOAA 3L2CA 5J8FA 1MMSA 2DOFA 4WK8F 4LK0F 4BL0B 3E6CC 3FXKA 4OINF 1W0UA 5DUKA 4FX4A 1R49A 4ABZA 5FLXK 2MH9A 2P8TA 1V4RA 2IGOA 3CCMI 3O8HA 2K27A 1FYKA 3WTXC 3GZ6A 4BEHB 1VQNI 3PQJA 1PP7U 2OCCH 3HSFA 4CCKA 3IP4B 1GLNA 5IPAA 1YE9A 2DJIA 4N9IA 2WV0A 5DDGA 3ZMTA 3HRUA 2GIZA 2W57A 3FF5A 3GWZA 1T38A 3VWBA 3T8TA 1LKXA 9ANTA 3DTKA 1OMIA 2FU4A 2QF7A 2ZJRF 1KYWA 3E97A 1R1VA 3IH4A 3CCVI 2XPVA 3FK7A 3BJOA 1IN6A 1FMVA 4XOPA 3R61A 3SZGA 3ZQLA 5LLQA 1U5TC 4PJNA 3TOBA 3F8MA 4HNVA 2W7NA 2W4SA 3ASOH 1QQIA 1X3UA 1LUJB 2QUFA 5ERIA 3W6JB 2VN2A 4UXNA 3GZ5A 2FA5A 4MGRA 4XNFA 2D2WA 4HV6A 2L9RA 1P92A 3K4LA 3X2QH 1XSXA 2DFHA 2Q0OA 5E3LA 2RV8A 2HFHA 2F5CA 4ITVA 3A0HC 1FC3A 5HNHA 1HW2A 4LOCA 1POGA 2WTEA 2HDWA 3CESA 2MBFA 3K4KA 3HJEA 3WU0A 3I54A 2F5DA 2DA6A 4RGSA 2M0CA 2LD5A 5LD2C 1LDKB 4J00A 1XPXA 4I09A 5J4VA 3S8PA 1BL0A 1Z6TA 4LIUA 4DYQA 3JRBA 4IHWA 2E36A 2HWVA 3JTGA 1ETYA 3LSMA 5FFZA 5CVUA 1B9MA 3J7AO 2A69F 2K02A 3F8BA 5D5UB 4A69C 2OZ6A 3E6MA 2H27A 2QWWA 5H6RA 3VYUB 3GFJA 4UB6C 1AHDP 1GDTA 5E20A 3F3XA 1QVUA 1IN5A 2FQ3A 1Z3XA 2GQQA 1BI2A 1Z7UA 2EWNA 3ONQA 1ZHFA 1LFBA 4HX8A 1Y39A 1S72I 4B47A 1J5YA 2IEKA 4RAZA 1KA8A 2NXNB 3TBIA 2D5VA 2IA1A 2CO5A 2XDVA 2E5ZA 3AAFA 2IA0A 4NC7A 1G3TA 2EB7A 3T5XA 2EK5A 2VBXA 1WI3A 2OU2A 2STTA 4M3DA 2MC4A 1K6OA 1T39A 5FRMA 2L9VA 1P4WA 1D3YA 1H9GA 2F2EA 1R22A 5F64A 1WSUA 4IOAF 2JA2A 5GPCA 3BCBA 1X1CA 3DEEA 3GW2A 4BQQA 2MG4A 3CZ6A 1IUFA 2ISZA 3L2UA 1REPC 3OYBA 5FO5A 1IXRC 1QZEA 3RYPA 1ZG1A 3SDGA 2L9SA 2X0LA 5CVJA 4UV8A 4XKVA 4D5CA 4KN7X 3VDXA 3A01B 2JN6A 3LA2A 1T8IA 1FY7A 1IRFA 3V8JA 1YW8A 3MKZA 3TO9A 4NBQA 1H8AC 2R7XA 4M72A 1ZR2A 2HPMA 2KFDA 1MNDA 2DMNA 1WPKA 2KIMA 2LKXA 2JA8J 3GTGJ 2M9HA 2CQ7A 1Z77A 2R7ZJ 4A0ZA 1PJRA 5FGMA
chains in the Genus database with same CATH topology
5EGOB 3OSFA 1ETKA 3JRHA 3S17J 2NVQJ 2E2IJ 1HCRA 2EZHA 4MFEA 5E3OA 1U9NA 4XRMA 5IP6A 3TP3A 1D5YA 4XIDA 3JRIA 3WHCA 4NDLA 2HYJA 3HOUJ 2CUEA 3JRBA 4BBRJ 5JLXA 1P7IA 3FKIJ 2YS9A 1MH3A 3HKZN 4A3CJ 1T33A 5FKKA 4D7NA 2LLKA 3BR0A 2NOGA 2MGQA 5EZHA 1TWAJ 5GPAA 5IP7J 3BG3A 2JA7J 2XPUA 2AHQA 4M3FA 1LE8A 1GV5A 2XB5A 2IAIA 3ZQHA 2HQ5A 4D5FA 1WCMJ 2H1KA 3GTMJ 3W6VA 5EDNA 1X58A 3HOVJ 4XK4A 2K40A 2FJ1A 5K7FA 2ZB9A 3LSRA 2XRLA 3HB9A 1IRZA 2NVYJ 1G2HA 2ID6A 3HOYJ 1H88C 2IBDA 3ZQCA 1MSFC 5F04A 1NK3P 1Z0XA 2H8RA 1MBKA 1PUFA 2E1OA 2L0KA 2NS8A 1RKWA 3BR6A 2DA3A 2CJJA 2TRTA 1IGNA 1ZTRA 1JKPC 3M3YJ 3A01A 2OF7A 4XICA 1QRYA 2DTZA 5EZGA 1NTCA 1MBFA 3BTJA 3MKLA 5FKNA 1R9TJ 2N8GA 5C44J 2NVXJ 2EH3A 4Y7NJ 3SJMA 3G1LA 4I6ZA 5F1JA 2CU7A 3A03A 4DZPA 4A93J 1WGXA 3HGGA 5FKMA 5F27A 5EGOA 4Y52J 2R5ZB 2DA5A 5K7ZA 3PO3J 2Y2ZA 4JP0A 3GTKJ 4B3AA 1JGGA 2DMUA 1ITYA 1B8IB 3RZOJ 2JWTA 2LK2A 2YUSA 2LY9A 1WH7A 3Q3SA 2LFBA 2Y31A 5IP9J 4DW6A 4BY7J 4A3KJ 2XGEA 3K2AA 1GT0C 1K61A 1MNMC 1UMQA 1I3QJ 3BR5A 1T56A 4BXXJ 5GP9A 3FK6A 4CYCB 2K9SA 1JTYA 1APLC 3CQZJ 3MVPA 3L1PA 1JTXA 4B4CA 1QVTA 2WV1A 1I6HJ 4UUSB 2JA6J 4BKXA 5F0HA 2B63J 5C4JJ 4C3JJ 1RKTA 3OOUA 1ETOA 1YRNB 4QTRA 1RESA 2Y30A 1GUUA 2O8KA 1Y1VJ 3MN2A 4RDUA 1OCPA 4FISA 1F43A 2R0QC 1QPIA 2JK3A 1A6IA 3S15J 5FLVA 1X2NA 2P81A 3BTCA 3I4MJ 1S7EA 2CRGA 3BR1A 2VPRA 3TW7A 4XRSG 4A3DJ 2NS7A 1ORKA 1MBGA 4MO7A 2X6OA 2L7ZA 1U9OA 3JRAA 2LTPA 1FIAA 3LNQA 2YU9J 3S14J 4S0HB 3VPRA 1A5JA 2RAEA 2DA1A 5J3LA 5E3MA 2ECBA 1ZGWA 2E2JJ 2K9QA 3BR3A 1HDPA 3C2BA 1TWGJ 1P7JA 1I50J 1XC5A 2ID3A 4BY1J 3BTIA 1IJWC 3LSGA 5C4XJ 2Y0SN 4V2FA 2FX0A 2R5ZA 1F36A 4UUTA 1FJLA 4W1UA 3TEDA 1TC3C 1NK2P 3LOCA 5M5YJ 1TWHJ 3DEWA 2VI6A 1MH4A 2LP0A 3O8GA 4IHYA 4XRSA 2QCOA 2XSDC 3BR2A 1X2MA 1MBEA 5J1RA 4M3BA 1RETA 4AYBN 3HGYA 3PO2J 3HBLA 4DYRA 2R93J 2HI3A 1ZK8A 1JJ8C 3D1NI 1ETWA 4CYCA 5IOZA 2DA7A 2EZLA 2KT0A 3IH3A 5IOYA 2L7MP 4A3JJ 1RR7A 1JT0A 4DZJA 1UHSA 2VKVA 1JKOC 2GM4A 2M2EA 3GBGA 2M8GX 4JX6A 2GBYA 4UUSA 2HXOA 1JT6A 4X6AJ 2MSYA 2LR8A 2O7OA 3BG9A 5J1UA 5FLMJ 1ENHA 3G1OA 2HDDA 1VF9A 3H0GJ 2XGDA 1MSEC 1YRNA 3GTPJ 4IHVA 2KDZA 4DYCA 3RQIA 4A3GJ 2HOAA 4AC0A 3B6CA 4QIWN 3S16J 4JX4A 4W97A 3TW6A 4A3EJ 1AKHB 3S1QJ 1WH5A 2DMQA 3BQZA 4I76A 1K83J 1JUSA 5FKOA 2CQXA 3K7AJ 2Y9ZA 2I10A 1XG1A 5FKLA 3M4OJ 2NVTJ 4RBOA 1MBHA 3BTLA 3HM5A 5EYRA 1HDDC 1H89C 4C2MJ 4EEFG 2FD5A 1IDZA 3E7LA 5EF6A 2ME6A 3HOZJ 3F0CA 1Y1WJ 2CUFA 3HOWJ 1FEXA 5J1YA 4A3FJ 3S2DJ 1ETVA 1IG7A 4L5EA 1ETQA 2TCTA 2GLOA 2WB1N 3IH2A 4M6VA 4D7MA 2G0EA 1ZKGA 4A3IJ 2DA4A 4IHXA 2X9DA 3UKGA 1ZQ3P 3GTQJ 3LSPA 3CMYA 4A3LJ 3FIWA 1JUPA 5IYDJ 2COBA 1B72B 2JJ7A 3JREA 1TWCJ 1BA5A 4MIMA 4JX5A 4FE7A 5C3EJ 3RZDJ 2EZIA 2K9NA 1BJZA 4J19A 5FJ8J 2ECCA 1IDYA 1VNDA 5EG0B 1OFCX 3HOXJ 3GTJJ 2AO9A 2CQQA 1BW5A 5E3NA 4C3IJ 2LVSA 3WHBA 3HDDA 1HF0A 5IYCJ 3JRCA 1W0UA 1UG2A 1HOMA 4ABZA 3LSJA 1ETXA 3Q0WA 4FCYA 2PMZN 1RPWA 3B6AA 4B1RA 1OCTC 3O8HA 1MBJA 1VI0A 2VKEA 5IYBJ 1AKHA 2Y9YA 2MW8A 5F08A 4AUXA 2R92J 1IC8A 3CDLA 1CQTA 3QQAA 3GTOJ 4X1EA 5IPAA 5M3FJ 2E2HJ 1FTZA 1B8IA 1BW6A 5DTDA 4M3GA 3BG5A 3JR9A 1FIPA 9ANTA 2R5YB 3SFIA 4C3HJ 4JYKA 1VFCA 1HLVA 2QF7A 2ME0A 1XS9A 4QSHA 3S1NJ 2M34A 2EBIA 3NAUA 2W48A 3IH4A 2XPVA 3FK7A 2XB0X 3Q0UA 2HOTA 2XGCA 1U8BA 3ZQLA 4M3EA 5F0CA 3JRFA 4HNVA 4G12A 3S1RJ 1LFUP 1JUMA 2ELKA 2EQRA 3ZQIA 1JJ6C 1DU0A 3G1MA 3JRGA 5M5WJ 2DMPA 1DU6A 2L9RA 1B72A 5E3LA 5BNGA 3DCFA 1TWFJ 3H3VK 2WAQN 5F0FA 4LOCA 1POGA 2X48A 4MLOA 3TP0A 1JKRC 5M3MJ 1GV2A 5EG0A 2DA6A 2LD5A 2M0CA 3Q0VA 1BL0A 4DYQA 2O9LA 4IHWA 1ETYA 1EF4A 3BQYA 2OPTA 5HODA 1GVDA 3CCYA 4A69C 2DA2A 2EZKA 2DN0A 2XPWA 1GDTA 1AHDP 1FTTA 1QVUA 1JKQC 2FQ4A 2E19A 1LFBA 5K7HA 2VUMJ 3HEFA 1ZR4A 3OIOA 2IEKA 4FTHA 1LE8B 1SANA 2DMTA 1AU7A 2DJNA 4BBSJ 2D5VA 2HOSA 3ZQGA 3ZQFA 4A3MJ 5JLWA 3RKQA 1Q1VA 1WI3A 4V2GA 4M3DA 3NARA 3A02A 3OSGA 3QPLA 1O4XA 3I4NJ 2R5YA 2HXIA 4MFDA 5GPCA 2L7FP 1IV6A 3JRDA 1PUFB 1E3OC 4GFBA 2MG4A 3S1MJ 4A3BJ 1IUFA 2JMWA 3BT9A 3SDGA 4D5CA 4FE4A 3A01B 2JN6A 1OJLA 3S2HJ 1SFOJ 1U78A 1H8AC 5M5XJ 1ZR2A 5EEAA 3PM1A 1W0TA 2DMNA 1WPKA 2LKXA 3GTGJ 2JA8J 4IEJA 2M9HA 1Z77A 3GTLJ 3FISA 3QPSA 2R7ZJ 5DS9A 2JA5J 3ZOBA 3IV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EGO B;  3OSF A;  1ETK A;  3JRH A;  3S17 J;  2NVQ J;  2E2I J;  1HCR A;  2EZH A;  4MFE A;  5E3O A;  1U9N A;  4XRM A;  5IP6 A;  3TP3 A;  1D5Y A;  4XID A;  3JRI A;  3WHC A;  4NDL A;  2HYJ A;  3HOU J;  2CUE A;  3JRB A;  4BBR J;  5JLX A;  1P7I A;  3FKI J;  2YS9 A;  1MH3 A;  3HKZ N;  4A3C J;  1T33 A;  5FKK A;  4D7N A;  2LLK A;  3BR0 A;  2NOG A;  2MGQ A;  5EZH A;  1TWA J;  5GPA A;  5IP7 J;  3BG3 A;  2JA7 J;  2XPU A;  2AHQ A;  4M3F A;  1LE8 A;  1GV5 A;  2XB5 A;  2IAI A;  3ZQH A;  2HQ5 A;  4D5F A;  1WCM J;  2H1K A;  3GTM J;  3W6V A;  5EDN A;  1X58 A;  3HOV J;  4XK4 A;  2K40 A;  2FJ1 A;  5K7F A;  2ZB9 A;  3LSR A;  2XRL A;  3HB9 A;  1IRZ A;  2NVY J;  1G2H A;  2ID6 A;  3HOY J;  1H88 C;  2IBD A;  3ZQC A;  1MSF C;  5F04 A;  1NK3 P;  1Z0X A;  2H8R A;  1MBK A;  1PUF A;  2E1O A;  2L0K A;  2NS8 A;  1RKW A;  3BR6 A;  2DA3 A;  2CJJ A;  2TRT A;  1IGN A;  1ZTR A;  1JKP C;  3M3Y J;  3A01 A;  2OF7 A;  4XIC A;  1QRY A;  2DTZ A;  5EZG A;  1NTC A;  1MBF A;  3BTJ A;  3MKL A;  5FKN A;  1R9T J;  2N8G A;  5C44 J;  2NVX J;  2EH3 A;  4Y7N J;  3SJM A;  3G1L A;  4I6Z A;  5F1J A;  2CU7 A;  3A03 A;  4DZP A;  4A93 J;  1WGX A;  3HGG A;  5FKM A;  5F27 A;  5EGO A;  4Y52 J;  2R5Z B;  2DA5 A;  5K7Z A;  3PO3 J;  2Y2Z A;  4JP0 A;  3GTK J;  4B3A A;  1JGG A;  2DMU A;  1ITY A;  1B8I B;  3RZO J;  2JWT A;  2LK2 A;  2YUS A;  2LY9 A;  1WH7 A;  3Q3S A;  2LFB A;  2Y31 A;  5IP9 J;  4DW6 A;  4BY7 J;  4A3K J;  2XGE A;  3K2A A;  1GT0 C;  1K61 A;  1MNM C;  1UMQ A;  1I3Q J;  3BR5 A;  1T56 A;  4BXX J;  5GP9 A;  3FK6 A;  4CYC B;  2K9S A;  1JTY A;  1APL C;  3CQZ J;  3MVP A;  3L1P A;  1JTX A;  4B4C A;  1QVT A;  2WV1 A;  1I6H J;  4UUS B;  2JA6 J;  4BKX A;  5F0H A;  2B63 J;  5C4J J;  4C3J J;  1RKT A;  3OOU A;  1ETO A;  1YRN B;  4QTR A;  1RES A;  2Y30 A;  1GUU A;  2O8K A;  1Y1V J;  3MN2 A;  4RDU A;  1OCP A;  4FIS A;  1F43 A;  2R0Q C;  1QPI A;  2JK3 A;  1A6I A;  3S15 J;  5FLV A;  1X2N A;  2P81 A;  3BTC A;  3I4M J;  1S7E A;  2CRG A;  3BR1 A;  2VPR A;  3TW7 A;  4XRS G;  4A3D J;  2NS7 A;  1ORK A;  1MBG A;  4MO7 A;  2X6O A;  2L7Z A;  1U9O A;  3JRA A;  2LTP A;  1FIA A;  3LNQ A;  2YU9 J;  3S14 J;  4S0H B;  3VPR A;  1A5J A;  2RAE A;  2DA1 A;  5J3L A;  5E3M A;  2ECB A;  1ZGW A;  2E2J J;  2K9Q A;  3BR3 A;  1HDP A;  3C2B A;  1TWG J;  1P7J A;  1I50 J;  1XC5 A;  2ID3 A;  4BY1 J;  3BTI A;  1IJW C;  3LSG A;  5C4X J;  2Y0S N;  4V2F A;  2FX0 A;  2R5Z A;  1F36 A;  4UUT A;  1FJL A;  4W1U A;  3TED A;  1TC3 C;  1NK2 P;  3LOC A;  5M5Y J;  1TWH J;  3DEW A;  2VI6 A;  1MH4 A;  2LP0 A;  3O8G A;  4IHY A;  4XRS A;  2QCO A;  2XSD C;  3BR2 A;  1X2M A;  1MBE A;  5J1R A;  4M3B A;  1RET A;  4AYB N;  3HGY A;  3PO2 J;  3HBL A;  4DYR A;  2R93 J;  2HI3 A;  1ZK8 A;  1JJ8 C;  3D1N I;  1ETW A;  4CYC A;  5IOZ A;  2DA7 A;  2EZL A;  2KT0 A;  3IH3 A;  5IOY A;  2L7M P;  4A3J J;  1RR7 A;  1JT0 A;  4DZJ A;  1UHS A;  2VKV A;  1JKO C;  2GM4 A;  2M2E A;  3GBG A;  2M8G X;  4JX6 A;  2GBY A;  4UUS A;  2HXO A;  1JT6 A;  4X6A J;  2MSY A;  2LR8 A;  2O7O A;  3BG9 A;  5J1U A;  5FLM J;  1ENH A;  3G1O A;  2HDD A;  1VF9 A;  3H0G J;  2XGD A;  1MSE C;  1YRN A;  3GTP J;  4IHV A;  2KDZ A;  4DYC A;  3RQI A;  4A3G J;  2HOA A;  4AC0 A;  3B6C A;  4QIW N;  3S16 J;  4JX4 A;  4W97 A;  3TW6 A;  4A3E J;  1AKH B;  3S1Q J;  1WH5 A;  2DMQ A;  3BQZ A;  4I76 A;  1K83 J;  1JUS A;  5FKO A;  2CQX A;  3K7A J;  2Y9Z A;  2I10 A;  1XG1 A;  5FKL A;  3M4O J;  2NVT J;  4RBO A;  1MBH A;  3BTL A;  3HM5 A;  5EYR A;  1HDD C;  1H89 C;  4C2M J;  4EEF G;  2FD5 A;  1IDZ A;  3E7L A;  5EF6 A;  2ME6 A;  3HOZ J;  3F0C A;  1Y1W J;  2CUF A;  3HOW J;  1FEX A;  5J1Y A;  4A3F J;  3S2D J;  1ETV A;  1IG7 A;  4L5E A;  1ETQ A;  2TCT A;  2GLO A;  2WB1 N;  3IH2 A;  4M6V A;  4D7M A;  2G0E A;  1ZKG A;  4A3I J;  2DA4 A;  4IHX A;  2X9D A;  3UKG A;  1ZQ3 P;  3GTQ J;  3LSP A;  3CMY A;  4A3L J;  3FIW A;  1JUP A;  5IYD J;  2COB A;  1B72 B;  2JJ7 A;  3JRE A;  1TWC J;  1BA5 A;  4MIM A;  4JX5 A;  4FE7 A;  5C3E J;  3RZD J;  2EZI A;  2K9N A;  1BJZ A;  4J19 A;  5FJ8 J;  2ECC A;  1IDY A;  1VND A;  5EG0 B;  1OFC X;  3HOX J;  3GTJ J;  2AO9 A;  2CQQ A;  1BW5 A;  5E3N A;  4C3I J;  2LVS A;  3WHB A;  3HDD A;  1HF0 A;  5IYC J;  3JRC A;  1W0U A;  1UG2 A;  1HOM A;  4ABZ A;  3LSJ A;  1ETX A;  3Q0W A;  4FCY A;  2PMZ N;  1RPW A;  3B6A A;  4B1R A;  1OCT C;  3O8H A;  1MBJ A;  1VI0 A;  2VKE A;  5IYB J;  1AKH A;  2Y9Y A;  2MW8 A;  5F08 A;  4AUX A;  2R92 J;  1IC8 A;  3CDL A;  1CQT A;  3QQA A;  3GTO J;  4X1E A;  5IPA A;  5M3F J;  2E2H J;  1FTZ A;  1B8I A;  1BW6 A;  5DTD A;  4M3G A;  3BG5 A;  3JR9 A;  1FIP A;  9ANT A;  2R5Y B;  3SFI A;  4C3H J;  4JYK A;  1VFC A;  1HLV A;  2QF7 A;  2ME0 A;  1XS9 A;  4QSH A;  3S1N J;  2M34 A;  2EBI A;  3NAU A;  2W48 A;  3IH4 A;  2XPV A;  3FK7 A;  2XB0 X;  3Q0U A;  2HOT A;  2XGC A;  1U8B A;  3ZQL A;  4M3E A;  5F0C A;  3JRF A;  4HNV A;  4G12 A;  3S1R J;  1LFU P;  1JUM A;  2ELK A;  2EQR A;  3ZQI A;  1JJ6 C;  1DU0 A;  3G1M A;  3JRG A;  5M5W J;  2DMP A;  1DU6 A;  2L9R A;  1B72 A;  5E3L A;  5BNG A;  3DCF A;  1TWF J;  3H3V K;  2WAQ N;  5F0F A;  4LOC A;  1POG A;  2X48 A;  4MLO A;  3TP0 A;  1JKR C;  5M3M J;  1GV2 A;  5EG0 A;  2DA6 A;  2LD5 A;  2M0C A;  3Q0V A;  1BL0 A;  4DYQ A;  2O9L A;  4IHW A;  1ETY A;  1EF4 A;  3BQY A;  2OPT A;  5HOD A;  1GVD A;  3CCY A;  4A69 C;  2DA2 A;  2EZK A;  2DN0 A;  2XPW A;  1GDT A;  1AHD P;  1FTT A;  1QVU A;  1JKQ C;  2FQ4 A;  2E19 A;  1LFB A;  5K7H A;  2VUM J;  3HEF A;  1ZR4 A;  3OIO A;  2IEK A;  4FTH A;  1LE8 B;  1SAN A;  2DMT A;  1AU7 A;  2DJN A;  4BBS J;  2D5V A;  2HOS A;  3ZQG A;  3ZQF A;  4A3M J;  5JLW A;  3RKQ A;  1Q1V A;  1WI3 A;  4V2G A;  4M3D A;  3NAR A;  3A02 A;  3OSG A;  3QPL A;  1O4X A;  3I4N J;  2R5Y A;  2HXI A;  4MFD A;  5GPC A;  2L7F P;  1IV6 A;  3JRD A;  1PUF B;  1E3O C;  4GFB A;  2MG4 A;  3S1M J;  4A3B J;  1IUF A;  2JMW A;  3BT9 A;  3SDG A;  4D5C A;  4FE4 A;  3A01 B;  2JN6 A;  1OJL A;  3S2H J;  1SFO J;  1U78 A;  1H8A C;  5M5X J;  1ZR2 A;  5EEA A;  3PM1 A;  1W0T A;  2DMN A;  1WPK A;  2LKX A;  3GTG J;  2JA8 J;  4IEJ A;  2M9H A;  1Z77 A;  3GTL J;  3FIS A;  3QPS A;  2R7Z J;  5DS9 A;  2JA5 J;  3ZOB A;  3IV5 A; 
#chains in the Genus database with same CATH topology
 1K78 A;  2HR3 A;  1ETK A;  2H1L A;  3CJN A;  3WTW C;  3AG2 H;  3O6B B;  2XF5 A;  1BI1 A;  3VOE A;  5L3E A;  4GO1 A;  2EZH A;  2VL8 A;  2YPR A;  4LG0 A;  1JI8 A;  4UHT A;  2X6Y A;  4XN3 A;  3JRI A;  4NDL A;  1ZAO A;  1V55 H;  1G3W A;  2NYX A;  1J09 A;  1LNW A;  1MGT A;  2OC6 A;  4QPQ A;  2CUZ A;  4BBR J;  1P7I A;  3GLL A;  2KHM A;  2VXD A;  3FKI J;  5GAG J;  1T2K A;  1E17 A;  1P2F A;  3HKZ N;  3ZGK A;  2K9L A;  4A6E A;  3KP6 A;  2DFF A;  2MGQ A;  4IXA A;  4M9Z A;  4EJT A;  2Z99 A;  4XON A;  5AIP A;  5GPA A;  2FNP A;  3CO6 C;  2CYY A;  3DU6 A;  3AG1 H;  2JA7 J;  4M3F A;  2AS5 F;  2R7F A;  2VLA A;  3GTM J;  3FXJ A;  4HDV A;  2D1V A;  3DKW A;  3RSN A;  2ZJQ F;  4N4N B;  4KT6 A;  1TQP A;  5K7F A;  2ZB9 A;  2XRL A;  3FMS A;  1IRZ A;  2J5P A;  3AKZ A;  2KIF A;  1XSV A;  5BS6 A;  4UB8 C;  1G2H A;  1W5S A;  2HGC A;  3HOY J;  3OYK A;  1OR7 A;  3BZK A;  4IQ4 A;  4B8X A;  1I27 A;  5F04 A;  3DV8 A;  3LAP A;  1NK3 P;  2X51 A;  5E1X A;  1MBK A;  3E1S A;  1PUF A;  1BBY A;  5EEG A;  2NS8 A;  3AFH A;  3R6S A;  1J59 A;  1OQY A;  2CJJ A;  5GAE J;  2TRT A;  3C7J A;  2LY1 A;  1U5T A;  2DTR A;  1QBJ A;  3I71 A;  1IAW A;  2QLZ A;  2VB6 A;  1K7A A;  1OCZ H;  2CV1 A;  4FAS D;  1ZH5 A;  5TIS C;  4CDG A;  3W2A A;  2N8G A;  5BQT A;  3LWF A;  4DZP A;  4A12 A;  4HSR A;  1P6R A;  2XV4 S;  5DUI A;  1LEB A;  1R7J A;  4XLA A;  4M73 A;  3JTH A;  4B3A A;  2E7X A;  2HDC A;  1Q1H A;  2DMU A;  4ZJZ A;  1KU7 A;  1B8I B;  2ESH A;  5L3C A;  3IKV A;  5BOX A;  3FXO A;  2PMH A;  1ZLK A;  3BC8 A;  2Q2E A;  3F8F A;  1VQ4 I;  4BY7 J;  2XGE A;  3IHU A;  1K61 A;  2V1N A;  2CSO A;  1KQ8 A;  2ZME B;  5CYV A;  1T56 A;  2EIJ H;  2FEZ A;  5TRD A;  2ICW G;  2LYC A;  3CJQ B;  1APL C;  3CQZ J;  1UCR A;  4GYI A;  3K2Z A;  1JTX A;  2F5V A;  2MH2 A;  2KL4 A;  4U0W A;  2WV1 A;  1XDS A;  1AA7 A;  4ZDP A;  4UUS B;  2O03 A;  3FKJ A;  3Q5F A;  2VKH A;  2F5F A;  5FB2 A;  4KIB A;  1UJ8 A;  3CP2 A;  2Z9O A;  3CCL I;  1RKT A;  2IW5 A;  3KYC B;  1RES A;  4DJA A;  2O8K A;  3OR2 C;  2QQ8 A;  2A6E F;  2Z16 A;  2QGU A;  2LBF A;  2ZFW A;  1F43 A;  1QPI A;  4RB1 A;  5IT3 A;  1A6I A;  1R5G A;  3KZY A;  4BE0 A;  5FLV A;  2R7D A;  4MQV A;  3I4M J;  2VPR A;  3TW7 A;  4XRS G;  1ORK A;  4MO7 A;  5HS8 A;  4A2U A;  3VYR B;  4O5V A;  1FIA A;  4HOB A;  1X3W B;  3SFZ A;  3WTY C;  2FOK A;  4I02 A;  4S0H B;  4NUB A;  1ACI A;  3WTZ A;  4CXF A;  1NHA A;  3FXU A;  1ZGW A;  2E2J J;  5D6E A;  3J7Y J;  2A61 A;  3U1K A;  1SFU A;  4ESB A;  2RDP A;  3LSG A;  2P5K A;  4YFX F;  3CMA I;  4CCN A;  1B6A A;  4DBQ A;  2M45 A;  3K4M A;  2K3F A;  5DCM A;  1E3H A;  2P5L C;  3KP7 A;  1TC3 C;  3LOC A;  2EJR A;  1TWH J;  2F4O B;  2CWE A;  5D5W B;  2DXI A;  1MH4 A;  3IWF A;  4HEA 2;  1YJN I;  4MTD A;  5CVR A;  2QCO A;  2VKD A;  4M3B A;  1A35 A;  4U87 A;  4JBA A;  3PO2 J;  4HYE A;  4DYR A;  1WJE A;  1XMA A;  2O8X A;  1ZGA A;  2DQL A;  2AQE A;  2DA7 A;  2EZL A;  2KT0 A;  3BRO A;  2QSF X;  2L7M P;  3H92 A;  1RR7 A;  3IH3 A;  4Y15 A;  4CH7 A;  5J40 A;  3GBG A;  1V5E A;  3MFK A;  2IT0 A;  4C9Y A;  1FOY A;  3M1C A;  2MSY A;  3CF5 F;  5TJJ A;  5J1U A;  4XM3 A;  3CD6 I;  3M07 A;  1ENH A;  3CJT B;  1S8N A;  2XGD A;  1MSE C;  2IRF G;  2Q1Z B;  1ULY A;  3LA3 A;  3TO6 A;  1QHG A;  2HOA A;  2GA2 A;  3OMY A;  2FMY A;  4BQO A;  2KIQ A;  2JVG A;  4QIW N;  3S16 J;  3ZPL A;  5IT9 Z;  4W97 A;  2VJ4 A;  3GUD A;  1E3P A;  4BQA A;  2EFQ A;  3KLO A;  1WH5 A;  3I55 I;  4F91 B;  5J47 A;  1W5C C;  1OCR H;  1WJB A;  2R3S A;  1K83 J;  3TO7 A;  1X1B A;  1X4O A;  3F8N A;  4Y13 A;  1O7F A;  2KQR A;  2I10 A;  1SEU A;  1XG1 A;  2LKS A;  3P9K A;  4LLG F;  3GFI A;  5EYR A;  1HDD C;  3A1Y A;  3OYF A;  2BY1 A;  2ZKZ A;  2E1N A;  3SEZ A;  2HS5 A;  1DP3 A;  3HOZ J;  2M4G A;  2ZXH A;  2KMU A;  1YJ9 I;  1PDN C;  1ETV A;  1WHU A;  4CHU A;  3ZQ7 A;  2PFB A;  2QQA A;  3KPH A;  3OYC A;  2MFZ A;  1S5L C;  4IRI A;  3OR1 C;  2I5U A;  5GTH C;  5J8C A;  3S2W A;  3IH2 A;  1TW3 A;  4H4K C;  2G0E A;  4D7M A;  4XQF A;  4ENM A;  4A3I J;  3CO7 C;  2EIM H;  3SZT A;  2LRE A;  2BY0 A;  3GTQ J;  4ZYG A;  1B1B A;  4XKB A;  4A3L J;  2VIX A;  3C2H A;  3U2R A;  5HOO A;  2H6B A;  2JJ7 A;  3JRE A;  1TWC J;  2DK5 A;  3RKX A;  2JQ7 A;  1BA5 A;  3O3K A;  1GVJ A;  3QU6 A;  4UV9 A;  4AIH A;  5C3E J;  5E79 C;  2D45 A;  3RZD J;  1BJZ A;  3RDI A;  1MIJ A;  2Z3Y A;  2BW3 A;  4UUV A;  4PSW A;  1W5T A;  1S7O A;  2O0Y A;  1OFC X;  4DGW B;  4AIK A;  4EM2 A;  2AO9 A;  1JXS A;  2CQQ A;  1DQU A;  1K4S A;  1YQA A;  3NWS A;  2K3P A;  1FT9 A;  4RGR A;  4P5O A;  3HRM A;  3I64 A;  3UNG C;  1YJW I;  3PNY A;  3QOE A;  2LRD A;  2R7Q A;  3U1D A;  3FM5 A;  3OS2 A;  2K4B A;  3G6E I;  4AVP A;  2A3S A;  3WHB A;  3D5S C;  2FNA A;  2EA4 A;  3DBL B;  3ZMS A;  3U21 A;  4KUM A;  1T6S A;  3L2W A;  4FET A;  3QOD A;  4FCY A;  2PMZ N;  3BG7 A;  1SD6 A;  4B1R A;  4OIO F;  1VI0 A;  2VKE A;  5IYB J;  2FOW A;  2DOD A;  3K4B A;  1H9T A;  2MW8 A;  5F08 A;  2NS0 A;  1ZG5 A;  4X1E A;  1N78 A;  4QPO A;  1B8I A;  3OL4 A;  2QQ9 A;  5FRN A;  3CC4 I;  1BC7 C;  3CP8 A;  2OJE D;  3HRT A;  5ILU A;  1XS9 A;  3ZXS A;  3S1N J;  4S05 A;  4WX9 A;  1T0F C;  3Q0U A;  3NRV A;  2HOT A;  2V26 A;  4MEY F;  4HAM A;  2QYO A;  3K0L A;  3S3M A;  5LRS A;  3JRF A;  4HRI A;  2DK8 A;  3S1R J;  4AWX B;  4Q47 A;  4FHT A;  2EQR A;  2ZSH B;  1EV7 A;  4RLF A;  1JJ6 C;  3EQL F;  1UB9 A;  4G6Q A;  4BQN A;  5JI6 A;  2UZK A;  1D0Y A;  5M5W J;  4E7L A;  1DU6 A;  2M30 A;  1ZRE A;  1D1B A;  2CW7 A;  3IAM 2;  4KA4 A;  3DFG A;  5BNG A;  3QYE A;  2DI3 A;  3M1E A;  1WVR A;  4CZC A;  3H3V K;  2WAQ N;  4IOC F;  4IVN A;  2X48 A;  1L3L A;  2DFE A;  1K78 B;  2R7O A;  4KIT B;  1JKR C;  3CUQ C;  3DLA A;  3C2G A;  1GV2 A;  4EQQ A;  1ON1 A;  2C6Y A;  4YFN F;  1N75 A;  2O3F A;  2KRC A;  2DO7 A;  4PFP A;  2M5W A;  2K7L A;  4P96 A;  2P4W A;  1FWZ A;  4U88 A;  4LG0 B;  3NQO A;  3O2P E;  5ICC A;  2NOJ B;  4LJZ F;  1ON2 A;  3N4M A;  1FPQ A;  4E7I A;  2KP6 A;  3DTE A;  1GVD A;  1YS7 A;  1SFK A;  1T98 A;  4S04 A;  3CCY A;  3I4P A;  1ZG3 A;  1IN8 A;  2DN0 A;  2XPW A;  3WE3 A;  3OYL A;  3QP6 A;  2P7V B;  3FX3 A;  2FQ4 A;  2E19 A;  3SZP A;  3KLN A;  4DOZ A;  1YHQ I;  2ZSI B;  4ZYH A;  2VUM J;  3HEF A;  1ZR4 A;  1ZLJ A;  2DMT A;  2MAB A;  3L7W A;  4PJJ A;  2EIL H;  1DPU A;  5FLX Z;  3QU3 A;  4A3M J;  5JLW A;  3ULQ B;  3KP3 A;  1Q1V A;  2BVL A;  3B73 A;  2E1M B;  4I0B A;  2KKO A;  1UHW A;  2VQH A;  5TGT A;  3H5N A;  3NAR A;  3MQ0 A;  3I4N J;  2PG4 A;  2R5Y A;  1X4P A;  4II2 A;  2HXI A;  2ACJ A;  1WJC A;  4CSW A;  2GXG A;  3CCJ I;  2K86 A;  2CG4 A;  4YII A;  4GGG A;  2PI0 A;  1AOY A;  3IC7 A;  2B0L A;  1PUF B;  1E3O C;  2PMZ A;  3TDZ C;  4KNY A;  3IRR A;  2KRF A;  2DT7 B;  1B59 A;  2PJR A;  1IN7 A;  2X1D A;  4PGH A;  3E0J B;  1XMK A;  3HRS A;  1U5T B;  1BIB A;  2VBZ A;  2A68 F;  3QPT A;  4LK1 F;  2XRO A;  1H0M A;  1DGW Y;  2JZY A;  5CJ9 A;  3CF2 A;  1JHH A;  5D5X B;  5H20 A;  2JPC A;  1W0T A;  2XSJ C;  4IEJ A;  4YG2 F;  1JGS A;  1ZRF A;  2ISY A;  2JSP A;  3GTL J;  4E6K G;  5DS9 A;  2JA5 J;  2EFW A;  3IV5 A;  1W36 D;  4C2U A;  2H94 A;  3OSF A;  1FX7 A;  1VQ9 I;  1FMW A;  2UXN A;  3F9K A;  3PNT A;  1FYM A;  2E2I J;  1F5T A;  3HHG A;  2UUZ A;  2XIG A;  5E3O A;  3KIO A;  2IP2 A;  3L00 A;  3TOA A;  3GXO A;  1TQM A;  5IP6 A;  1HST A;  4PCQ A;  2R7U A;  5F6F A;  2Q2E B;  3TP3 A;  3I59 A;  5DYM A;  4EAT A;  2HYJ A;  1MD0 A;  3IL2 A;  1X19 A;  2NVU B;  2CV2 A;  3LAJ A;  4KIS A;  2E7W A;  2VT2 A;  3IWZ A;  4A3C J;  2MA3 A;  1T33 A;  2LH9 A;  2LLK A;  3PFY A;  4RB3 C;  4HQE A;  4PK4 A;  1LPQ A;  1J2X A;  5IP7 J;  2WAQ A;  3ERE D;  2XPU A;  3SXY A;  1LE8 A;  3F6O A;  1GV5 A;  5J6X A;  2XB5 A;  2IAI A;  4OAY A;  2HQ5 A;  4D5F A;  2A6H F;  2PX9 A;  3H36 A;  4WCG A;  5EDN A;  1X58 A;  3DKY A;  3HOV J;  3COA C;  2KPM A;  2K40 A;  2K85 A;  3GVA A;  4NC8 A;  5KAF C;  5FD6 A;  3LSR A;  1KU2 A;  5B1B H;  1R1T A;  2HKX A;  5CPR B;  3MEX A;  3IKT A;  2JUG A;  3QWL A;  3ZQC A;  2LBF B;  2V7F A;  5GAD J;  4ZZD A;  1A36 A;  4M74 A;  2CW8 A;  1T0F A;  3J7A Y;  4F7Z A;  1HXD A;  1PYV A;  1YYV A;  2V9K A;  1IGN A;  3BZ6 A;  3E3V A;  2XKO A;  4XIC A;  1X1D A;  4HF2 A;  1QRY A;  2DTZ A;  5EZG A;  1NTC A;  1MBF A;  5FKN A;  3Q9V A;  5A2Q Z;  3WTU C;  1FLI A;  1MMG A;  4YIF A;  5C44 J;  1LDJ A;  1EH8 A;  4Y7N J;  3SJM A;  3G1L A;  2R7W A;  4P55 A;  4I6Z A;  3A03 A;  4HA8 A;  1WGX A;  2UV1 A;  4XR6 A;  2FRH A;  3HGG A;  5FKM A;  1FP2 A;  3E5X A;  3BDD A;  4G94 A;  2KJC A;  3W2W A;  1HKS A;  3K69 A;  3I9V 2;  2NNY A;  4YEL A;  5DCM B;  2BY2 A;  1JGG A;  1O57 A;  2QA4 I;  3HUG A;  1I1S A;  1OPC A;  2Y31 A;  3ZMD A;  4XLP F;  1J9I A;  5IP9 J;  4DW6 A;  3ML6 A;  4UVC A;  2GXB A;  2K9M A;  3K2A A;  5D8L B;  1R23 A;  3OY9 A;  3ELK A;  4Y17 A;  2JSC A;  2IS4 A;  5A2Q K;  4BH9 A;  3HXL A;  3MVP A;  2AXT C;  3A4C A;  4B4C A;  1RNL A;  2HQN A;  3FBI B;  3GO5 A;  3HPG A;  1I6H J;  5JVT A;  4NB5 A;  3FHZ A;  3HC7 A;  5C4J J;  1BI0 A;  1LVK A;  2JVH A;  2Y30 A;  3EUA A;  2DPD A;  1ZN2 A;  2GWR A;  4RDU A;  2PBI A;  3K9T A;  3BCA A;  1Z3Y A;  2HZD A;  1E0E A;  2XF6 A;  2JK3 A;  3S93 A;  3DPL C;  2EFO A;  4EM0 B;  2P0W A;  1VQL I;  3VSL A;  5F1R A;  2V79 A;  2P81 A;  1F9N A;  3BTC A;  3VYT B;  1S7E A;  2QKL B;  4N9H A;  2UWM A;  3BR1 A;  1KZH A;  4F55 A;  2WY8 Q;  2FML A;  4KYW A;  1U9O A;  1R4N B;  2ZBK A;  3JRA A;  2LTP A;  2IGM A;  1XD7 A;  1WJ5 A;  3SEQ A;  3S14 J;  3OOP A;  1R5H A;  1JE8 A;  3K1P A;  1IO2 A;  2BV6 A;  1XGN A;  2GA1 A;  3NEU A;  3K70 C;  2ECB A;  4IJA A;  4M71 A;  1D0X A;  2K9Q A;  2DCE A;  1VQ7 I;  1HDP A;  3C2B A;  4BY1 J;  1T95 A;  2CS3 A;  3OS1 A;  3BZC A;  3WU1 B;  4BNC A;  4XL9 A;  4A0Y A;  2FX0 A;  4CA0 A;  2R5Z A;  3OS0 A;  1WRJ A;  4XN0 A;  5D8K B;  4W1U A;  3K4N A;  5CVV A;  1QA6 A;  3AL0 C;  4PDK A;  1FBU A;  2W85 A;  2PLY A;  1I6X A;  3JW4 A;  2A6T A;  2BXY A;  3E5Q A;  4A5M A;  2LP0 A;  3FXL A;  3O8G A;  3KEO A;  5HVQ C;  3BR2 A;  2BW3 B;  4AYB N;  3HGY A;  5E8I A;  2GXA A;  3DKX A;  3HBL A;  2EV0 A;  4C2T A;  1VQ5 I;  2R4G A;  3D1N I;  4HX4 A;  4CYC A;  4XLC A;  4IPA A;  4OAZ A;  5D6F A;  1JT0 A;  3LQR A;  1W7P A;  2YX4 A;  1WQ2 A;  3FZV A;  4X6A J;  1Z21 A;  2Z1D A;  3V7R A;  1TZL A;  3BG9 A;  2O7O A;  2XGX A;  2KIS A;  3S32 A;  3G1O A;  2HDD A;  3H0G J;  4A6D A;  1D1C A;  4LFU A;  3VYS B;  4ON0 A;  1ERD A;  3H9J A;  4UVB A;  3RQI A;  4XKW A;  4A3G J;  2KDO A;  1G59 A;  3B6C A;  3GFM A;  4A3E J;  1Y8Q B;  2VQC A;  4YIR X;  3HTU A;  3DTI A;  3ABM H;  3I5U A;  4I76 A;  4DQ2 A;  1DUX C;  1X1P A;  2HTJ A;  2CQX A;  2Y9Z A;  4ZDO A;  2K4J A;  5FKL A;  4X0G A;  4EGZ A;  2EV6 A;  3HM5 A;  1TLH B;  1BIA A;  1IDZ A;  2M3A A;  2VPL A;  4O6J A;  5EF6 A;  3QYF A;  4IHT A;  3F0C A;  2CUF A;  4LB6 B;  2JT1 A;  4L5I A;  5ICF A;  4EJO A;  1YW9 A;  4PSX A;  1IG7 A;  1F4K A;  3FXR A;  4L5E A;  3BG6 A;  4KMU X;  1ETQ A;  2FBK A;  3K10 A;  2WB1 N;  2A07 F;  3BJA A;  2X9D A;  4OMY A;  1Z05 A;  4L9V A;  3LSP A;  4LIT A;  4XLN F;  3FIW A;  1JUP A;  5L3D A;  2O5R A;  4RA2 A;  3WU2 C;  4IO9 F;  4OWR B;  4ZTF A;  3P5J A;  3MD2 A;  2K9N A;  3N97 A;  2EFP A;  4P1W A;  3V7S A;  5FJ8 J;  4NHJ A;  2ZNY A;  4PZJ A;  3J7Z I;  2CQK A;  1D8J A;  2M8E A;  3L09 A;  3HKZ A;  5HLH A;  3HOX J;  4RGU A;  3GTJ J;  4I2O A;  3OYD A;  2ESN A;  2FUG 2;  4HF0 A;  4BHB A;  4C3I J;  2A5Y B;  2V1D A;  3HDD A;  2WAD A;  3KZI C;  3JRC A;  4A0X A;  3EUK L;  4ZTJ A;  5HLI A;  1UG2 A;  3HZJ A;  1HOM A;  1ETX A;  2G7H A;  5L3B A;  4M6X A;  3RJP A;  4LIV A;  1RPW A;  1HBX G;  2WAE A;  3MMY B;  4ZH4 F;  1FOX A;  2OZU A;  2V1U A;  4AYB A;  2G7U A;  4OMZ A;  4U0Y A;  4B43 A;  4NC6 A;  4AUX A;  2R92 J;  3CDL A;  1CQT A;  3QQA A;  1MJA A;  3PIP F;  1TP4 A;  2WWY A;  2E2H J;  2NNN A;  2V9P A;  3RKW A;  3OV8 A;  5LGT A;  1BJA A;  2JPB A;  2W82 A;  1BW6 A;  1UHM A;  2ZME C;  1CF7 A;  5DTD A;  2IS1 A;  2MD0 A;  3AG4 H;  3HG9 A;  3JR9 A;  2XKP A;  1FIP A;  2NAZ A;  3NWT A;  2AXL A;  4I01 A;  3SFI A;  3JSP A;  4C3H J;  2R5Y B;  3F23 A;  1HLV A;  5H6Q A;  3VFZ A;  3M8E A;  2ME0 A;  1IXS B;  2YSR A;  3NAU A;  2EBI A;  4MNU A;  2LKP A;  2W48 A;  1YX5 A;  5B66 C;  2XB0 X;  2XGC A;  1U8B A;  4M3E A;  2YU3 A;  2PJR B;  1B4A A;  2R7S A;  4L9N A;  3T1B A;  1LFU P;  4ETS A;  4BHC A;  1L0O C;  1JUM A;  4B3X A;  1DU0 A;  1ZEL A;  3JRG A;  3BJ6 A;  2GIV A;  3E6D A;  3EET A;  3RPQ A;  2DW4 A;  3FBN B;  2PJP A;  4Z6Y A;  3RI4 A;  4ENN A;  2P6T A;  3DCF A;  1G6N A;  3DPU A;  3LMM A;  1RUO A;  2QSH X;  4MLO A;  4G6T B;  3KE2 A;  3ECO A;  3TP0 A;  1HSJ A;  1NH3 A;  5M3M J;  1W4M A;  1YIT I;  5EG0 A;  4GYG A;  1RIO H;  3BY6 A;  5DV5 A;  2V4J C;  2P7C B;  3BPV A;  1MMN A;  4XKC A;  3Q0V A;  2IGN A;  4BYY A;  5L3F A;  1SFX A;  4BGD A;  2O9L A;  3ABU A;  1QHH D;  2UXX A;  3L2V A;  5DM6 F;  4YRV A;  3Q9S A;  1EF4 A;  3I59 B;  4RAF A;  2OPT A;  4UVA A;  2DA2 A;  2EZK A;  5KK1 A;  2IA2 A;  3R0J A;  4IF4 A;  1FTT A;  4HNT A;  2X6W A;  2ZXJ A;  5ICG A;  3PQK A;  3GZN B;  4NNJ A;  5K7H A;  4IL6 C;  2EA2 A;  3OIO A;  4FTH A;  3RQ4 A;  3WGH A;  1LE8 B;  1SAN A;  2HVS A;  1VZ0 A;  2Q8K A;  1GXP A;  2D1H A;  5CLS A;  5K1Y A;  3ZQF A;  3J81 Z;  1A31 A;  4EJU A;  3BPX A;  2DDB A;  2X85 A;  2XVC A;  4V2G A;  3T0Y A;  3OSG A;  3QPL A;  4KFC A;  3KEY A;  3OYJ A;  2A05 A;  4BXF A;  2E35 A;  1HA8 A;  4MFD A;  2RRE A;  3CUO A;  3EPZ A;  2L7F P;  3LST A;  3TKY A;  1KYZ A;  1P9Q C;  4CCL A;  2EV5 A;  3JRD A;  4GFB A;  3V8L A;  3S1M J;  4A3B J;  2JMW A;  1U2W A;  2L5Q A;  1VQP I;  3BT9 A;  2XRN A;  2M4K A;  3QYB A;  3TL4 X;  2M87 A;  1SD4 A;  2JUC A;  4IRG A;  2BHZ A;  1ZGJ A;  1IUY A;  3IRQ A;  4FE4 A;  1SAX A;  4NQW A;  3F8C A;  2DYR H;  2E34 A;  3S2H J;  3FHN A;  3F6V A;  1BI3 A;  3ZP5 A;  5M5X J;  3ZN1 A;  5EEA A;  3PM1 A;  1U6G A;  1SAU A;  3DWL E;  4I7H A;  5CVI A;  3J81 K;  3FIS A;  1D1A A;  3FMR A;  2QM3 A;  3QRF F;  2I8D A;  3ZOB A;  3ZMZ A;  1R6R A;  1HW5 A;  5E1Z B;  2DQR A;  2DBB A;  1VQO I;  5K5O A;  3S17 J;  5JHU A;  4BS9 A;  2LMD A;  4BE1 A;  4CCO A;  1DP7 P;  3MAJ A;  3HUG B;  1ONV A;  4OU0 A;  3V42 A;  3PUF A;  1LDD A;  2F5E A;  3GYH X;  1Z9C A;  4LD5 A;  4XRM A;  1IRX A;  3WTV C;  1D5Y A;  3WHC A;  3LQQ A;  3JSO A;  3HOS A;  4XLF A;  1LEA A;  5JR3 A;  5JLX A;  2XC7 A;  2YS9 A;  3PFI A;  1I5Z A;  5FKK A;  1HW1 A;  2NOG A;  4N0B A;  1TWA J;  4OOI A;  1WWX A;  4CO8 A;  5LHI A;  1Y56 A;  3GEZ A;  3C3W A;  2PMU A;  3L2R A;  1BR1 A;  3ZQH A;  1R58 A;  2FE3 A;  4EJV A;  3ZMU A;  2W00 A;  3KEQ A;  1IN4 A;  1D5V A;  2FJ1 A;  1D0Z A;  2R7T A;  1TTY A;  3CDI A;  1P4X A;  2HPI A;  3CLQ A;  5LGN A;  4I99 C;  1H88 C;  2IBD A;  1MSF C;  1RZ4 A;  1YW7 A;  2H8R A;  1YS6 A;  3CJR B;  3A2K A;  2E1O A;  3QOP A;  1RKW A;  1BM9 A;  1MKM A;  2DA3 A;  5B1A H;  1OYW A;  4RAY A;  2QBY A;  1Y8R B;  2EFN A;  1JKP C;  2K5C A;  3M3Y J;  2OF7 A;  3PUB A;  1O3T A;  2WAF A;  3TGN A;  2MC3 A;  3MCZ A;  3MKL A;  1FSE A;  3BTJ A;  3WTT C;  5AIQ A;  4BAC A;  4ANJ A;  2NVX J;  2AQF A;  2EH3 A;  2CFO A;  5HLT A;  3H3Z A;  3ERM A;  2YR2 A;  3RPU D;  3VSK A;  4D0P A;  2FF4 A;  5F27 A;  2L3D A;  5EGO A;  4D9J A;  4U7D A;  2R5Z B;  2RC4 A;  2L02 A;  2DA5 A;  3PO3 J;  5KNL A;  3H35 A;  2BHY A;  2Y2Z A;  3PL8 A;  1UZC A;  4XRF A;  4HZF A;  1TW2 A;  3D5R C;  2XAF A;  1ITY A;  3GLX A;  2JWT A;  4G8X A;  2LY9 A;  2FBI A;  3H5R A;  2GAU A;  1OKR A;  3KP5 A;  1S9H A;  4LGW A;  1FOK A;  1WJA A;  3HYI A;  1B9N A;  3KX2 A;  3LL7 A;  3ABK H;  1BC8 C;  4IQJ A;  3RTR A;  1GT0 C;  2VBY A;  3RKY A;  2MLK A;  3OYI A;  3BR5 A;  3DU5 A;  1SVL A;  3FXQ A;  2GOX B;  4UNO A;  5GP9 A;  2LF8 A;  2XF7 A;  3FK6 A;  4R8H A;  3CCU I;  1VQK I;  2L9N A;  4CYC B;  3AG3 H;  2K9S A;  3H9G A;  3I0T A;  2Z33 A;  3HHH A;  1YIJ I;  3ESW B;  1W7P B;  3H5A A;  1J0R A;  2QKM B;  2JA6 J;  1WZ2 A;  4BKX A;  1YX3 A;  4F3Q A;  5F0H A;  3L9F A;  1MW7 A;  2L4M A;  1SD5 A;  3G71 I;  4L0Z B;  2WBM A;  3MKW B;  4ZDL A;  4C3J J;  3OOU A;  1ETO A;  2CH0 A;  4ASN A;  4QTR A;  1GUU A;  1D8K A;  5LGU A;  5IY5 H;  2VE8 A;  1Y1V J;  5KVR A;  3V7C A;  3MN2 A;  2IGK A;  2YX7 A;  1K6Y A;  2IJL A;  2Y69 H;  2R0Q C;  3CLO A;  4IRH A;  4PJL A;  1X2N A;  4B44 A;  3ASN H;  1U3E M;  1J75 A;  2CRG A;  2QEN A;  4CYD A;  1TBX A;  4A3D J;  2NS7 A;  3PJR A;  1MBG A;  1N25 A;  2X6O A;  2H8W A;  3RCO A;  2BGC A;  1ODD A;  2MLG A;  3LNQ A;  2VJI A;  5D4S A;  4MTE A;  4BDY A;  4HLX A;  1LB2 A;  2WA0 A;  3VPR A;  5J3L A;  2DA1 A;  5E3M A;  2LC2 A;  1V3F A;  3DQV C;  1M1E B;  3BR3 A;  5D5V B;  4XLE A;  1TWG J;  1Z6R A;  1I50 J;  2ID3 A;  2W24 A;  2Y75 A;  3EUH C;  1A04 A;  2E60 A;  4RM3 A;  2Y0S N;  4V2F A;  3OIP A;  4Q5S F;  2RN7 A;  1A6Q A;  4UUT A;  2E1M C;  2V9V A;  4U0V A;  3F22 A;  3ROU A;  2VAS A;  3TED A;  2LY2 A;  1MJB A;  2V6C A;  4JK1 X;  2M7B A;  1SMY F;  1J7K A;  4LG3 A;  4XBF A;  1O3R A;  1NK2 P;  1WJD A;  5B5E C;  4RGX A;  1EH7 A;  3N05 A;  3DF8 A;  1OR7 C;  1TL8 A;  4RAG A;  1V5G A;  2RNJ A;  4IHY A;  2VOO A;  2CFX A;  3PSF A;  5DD8 A;  4E7S A;  4XRS A;  3I56 I;  2HU9 A;  3PIO F;  1AWC A;  5J4Y A;  5J1R A;  2KRH A;  2ELH A;  1R1U A;  2L4A A;  2HTS A;  2RKH A;  5ED4 A;  2ZJ2 A;  5E17 F;  2LF7 A;  3ZMV A;  1Z67 A;  4AD9 A;  2ZXW H;  1XGM A;  2HNH A;  5IOY A;  4A3J J;  1UHS A;  2M8G X;  3FMQ A;  5FD5 A;  4OIP F;  2GBY A;  4ENK A;  4WXH A;  1JT6 A;  2VXZ A;  4EJW A;  2VQG A;  1VQM I;  3TQN A;  1MMA A;  1W1W E;  5FLM J;  1PVE A;  1ZYR F;  3FM3 A;  5FFX A;  1YRN A;  3ABL H;  3ZQQ A;  1KQ9 A;  3GTP J;  2KDZ A;  4DYC A;  3OL3 A;  2VC0 A;  2M1B A;  5ICE A;  3MZH A;  3D5L A;  1I3A A;  2L01 A;  4M6Y A;  3TW6 A;  2XUB A;  2EPF A;  3CC2 I;  3DBR B;  3BQZ A;  5HS9 A;  1KON A;  1KU3 A;  5LHH A;  3CUQ A;  1JUS A;  1Z7L A;  5FKO A;  4LLN A;  4WF2 A;  5CKT A;  1XSD A;  4HLY A;  2LSO A;  3M4O J;  1CF7 B;  4OIR F;  2NVT J;  4BXU A;  4BUP A;  4RBO A;  1MBH A;  3BTL A;  3VOD A;  1H89 C;  3CCS I;  1TNS A;  2A5W A;  2Y0M A;  4EEF G;  2HOE A;  2FD5 A;  1R36 A;  3KET A;  2ME6 A;  1RR8 C;  3KP2 A;  2BXZ A;  4AIJ A;  4DBR A;  2HQR A;  4K2E A;  2FBH A;  5J1Y A;  2ZXI A;  3KZZ A;  3HTS B;  1TQI A;  3S2D J;  5CQE A;  2R7V A;  1MMD A;  2TCT A;  1VQ6 I;  4M6V A;  1ZKG A;  3U9G A;  1MDM A;  1SD7 A;  2RGV A;  3F21 A;  1O3S A;  3K6G A;  1PUE E;  4B09 A;  2MYS A;  2COB A;  2ETH A;  3AL0 B;  1XN7 A;  2L7K A;  3WTS C;  2OUM A;  2PN6 A;  3M8F A;  4MIM A;  3G73 A;  4FQG A;  1CGP A;  2ZJP F;  3FXM A;  4F92 B;  3R60 A;  1LQ1 A;  4ZC3 A;  4E7H A;  3P9C A;  2Y48 A;  5BPD A;  4J19 A;  1UEL B;  5LBQ A;  2NRA C;  1MNE A;  4O3M A;  2DYS H;  2DU9 A;  1IDY A;  5DCF A;  1VND A;  3DXJ F;  5EG0 B;  2W25 A;  4PFO A;  4XMY A;  1PP8 F;  1IW7 F;  3DLL F;  5K5R A;  1BW5 A;  4IKF A;  3K1M A;  2Y0S A;  1HKQ A;  5HNF A;  1HQC A;  5E3N A;  4YFK F;  3OYN A;  1DPR A;  2LVS A;  2P5V A;  3BOQ A;  1HF0 A;  3K4J A;  1IXC A;  2P6S A;  1O7L A;  5IYC J;  2BYV E;  4GXO A;  3LSJ A;  3Q0W A;  2VE9 A;  4BJT A;  3OWT A;  3B6A A;  2GZW A;  1OCT C;  1MBJ A;  1XGO A;  1S7A A;  1AKH A;  2CMP A;  1UFM A;  5KCM A;  2Y9Y A;  4RM2 A;  2DPU A;  2RQQ A;  1YTY A;  5HDK A;  4CUG A;  4UY8 I;  3SQN A;  1IC8 A;  4OIQ F;  3GTO J;  2H6C A;  2OV7 A;  3R4K A;  5M3F J;  4DNC A;  1FTZ A;  5H2F C;  1BOB A;  4BJ6 C;  4KJZ A;  4I0A A;  4M3G A;  3BG5 A;  1IF1 A;  1DDN A;  1UG0 A;  1VFC A;  4JYK A;  1WKM A;  1QZY A;  1XCB A;  2DT5 A;  4QSH A;  2KLO A;  5DM7 F;  2M34 A;  5GTI C;  1JHF A;  3C1D A;  3M7G A;  1XTA A;  4MQ9 F;  5F0C A;  1BR2 A;  2VC1 A;  3EUH A;  4G12 A;  2ELK A;  3ZQI A;  1TNT A;  1QO0 D;  2VJJ A;  3G1M A;  4NQW B;  1YO5 C;  4HST A;  3KP4 A;  4Z2Y A;  4B48 A;  4J01 A;  2DMP A;  2FXA A;  2VQL A;  5JVG F;  1B72 A;  3TDU C;  2G9W A;  4IX7 A;  3CC7 I;  3CCQ I;  1TWF J;  1FSH A;  3GFL A;  5F0F A;  4ENJ A;  3PSI A;  2BBY A;  2BEO A;  4Q48 A;  5KAI C;  2R7R A;  2CV0 A;  1C0W A;  3OYM A;  5E1W A;  4ZYA A;  3EYY A;  4KIG A;  1IZ1 A;  4HG2 A;  2OBP A;  3MZ8 A;  4RMN A;  1XB4 A;  4HV5 A;  1P4A A;  1FBQ A;  4KT5 C;  1OIS A;  4N4O B;  3BQY A;  2O61 A;  3A0B C;  5LRR A;  3S3N A;  5HOD A;  1ZAR A;  5LEK A;  1KQ0 A;  3E6B A;  1V54 H;  3IAS 2;  4AID A;  2CGP A;  1NG7 A;  3M9A A;  4LMY A;  3HIF A;  2O6G E;  3HSE A;  5JFR A;  4PJ0 C;  2LDU A;  1JKQ C;  1SVM A;  4JQF A;  2X6X A;  2B7E A;  2BOL A;  1N77 A;  4BEH A;  4HPQ A;  2BY3 A;  3LSI A;  3KYD B;  1AU7 A;  2DJN A;  3ECH A;  4LB5 A;  3C18 A;  4BBS J;  1WFX A;  2HOS A;  1EH6 A;  2ZC2 A;  3ZQG A;  4A5N A;  2LNB A;  4XLH A;  5DEQ A;  3RKQ A;  1EA3 A;  2DLL A;  2XAG A;  2XAH A;  3A02 A;  4E7K A;  1ZRC A;  4Y4R A;  3S3O A;  3V8K A;  1R5I D;  1O4X A;  3BP8 A;  1FBS A;  3WGG A;  2LOO A;  1R4M B;  4TV7 A;  4Q4Z F;  2OTL I;  5BPI A;  1LVA A;  2M7A A;  3LA7 A;  5FRO A;  2HQA A;  4PJM A;  1IV6 A;  3BLY A;  1YG2 A;  3J80 Z;  4L0Y B;  1S29 A;  1G3Y A;  4WXD A;  2W84 A;  2QEX I;  1F1Z A;  2VBW A;  3MZY A;  2QBY B;  4Y33 A;  2E71 A;  3B02 A;  1RI7 A;  1OJL A;  4IHS A;  2JRM A;  1Z1D A;  3HL2 A;  1SFO J;  1YLF A;  1U78 A;  2VJ5 A;  3ZCO A;  4XOR A;  2E1C A;  3LSK A;  4F52 A;  4HDU A;  2HVQ A;  4L18 B;  4GDF A;  3QPS A;  3OYG A;  1E2X A;  1Y0U A;  5EGO B;  2IPQ X;  3JRH A;  2OQR A;  4JOM A;  2CUJ A;  2NVQ J;  1IRG A;  1HCR A;  1VTN C;  1DGR M;  3OYA A;  1W36 C;  4MFE A;  4BHP A;  1TT5 B;  1RUN A;  1U9N A;  3SDB A;  3J80 K;  4RS8 A;  1SFE A;  1YIO A;  3CMM A;  4XID A;  2QVO A;  3HOU J;  1STZ A;  2CUE A;  3OIQ A;  3OYE A;  1W7P D;  1MH3 A;  2OTJ I;  2IVM A;  2E5N A;  2BVM A;  1WI9 A;  2OQG A;  4D7N A;  3BR0 A;  3BWG A;  5EZH A;  5HS7 A;  4CIC A;  1IV8 A;  2RQP A;  3BG3 A;  3KFW X;  2AHQ A;  3WG7 H;  4LLL A;  2L2O A;  4Y3O A;  2FSW A;  4AU7 A;  1WCM J;  4H0E A;  2H1K A;  3W6V A;  2KJB A;  2LG4 A;  1OCO H;  2X4H A;  2X1C A;  3LSH A;  4E4H A;  5DD4 A;  3CDH A;  4XK4 A;  3QPH A;  5GAH J;  3HB9 A;  2NVY J;  3GCM A;  3W3C A;  2ID6 A;  4HX7 A;  2WC2 A;  2M0M A;  1RRJ A;  4E70 A;  3QAH A;  4R79 A;  5K5Q A;  1Z0X A;  3SHF A;  3FWE A;  4FT8 A;  3MKY B;  4V19 K;  1HKT A;  4EGY A;  2L0K A;  3KCC A;  5B3S H;  1XGS A;  2V1X A;  3BR6 A;  1MJ9 A;  2STW A;  1ZTR A;  1FOW A;  3A01 A;  3DBH B;  2WB1 A;  2DFI A;  3W6K B;  1FYL A;  1LJ9 A;  1R9T J;  4R1H A;  1BOA A;  2QQB A;  2PEX A;  2DAO A;  2J5O A;  2XHK A;  1HC8 A;  5F1J A;  2CU7 A;  4PUS A;  4A93 J;  1I1G A;  2VT3 A;  1USS A;  4KMF A;  4PGG A;  4Y52 J;  3DEU A;  5K7Z A;  3G3Z A;  4JP0 A;  3PNV A;  4G7Z F;  2EIK H;  3ZN0 A;  3GTK J;  1BN5 A;  3RIR A;  4HNU A;  2PQ8 A;  4L9J A;  3RZO J;  2LK2 A;  1OYI A;  2YUS A;  1QPM A;  4C30 A;  1WH7 A;  3Q3S A;  4P9U A;  2LFB A;  1MZB A;  2EIN H;  5E8G A;  3F72 A;  3RYR A;  5LHG A;  2BZT A;  3ZR8 X;  3IUO A;  4A3K J;  3FDY A;  5EEH A;  1MNM C;  1JKO C;  4EMS A;  1UMQ A;  2DOE A;  1I3Q J;  4E7J A;  1QNT A;  4BXX J;  1Y6I A;  2ZCW A;  1U0J A;  2F4M B;  2RNG A;  5HDG A;  4BAY A;  1QZZ A;  5E18 F;  4F93 B;  1KGS A;  4M9S A;  1JTY A;  3WG9 A;  5D4R A;  3L1P A;  3I3L A;  1LFP A;  2JTV A;  4I98 B;  1QVT A;  4ESJ A;  3M8J A;  2GOM A;  2HYF A;  4G9Y A;  5IT9 K;  3RPU A;  3KYL A;  1YI2 I;  4MHG A;  2XAU A;  3I58 A;  3DPT A;  2B63 J;  1UST A;  1SC7 A;  1G3S A;  2HZT A;  1YRN B;  3JAM Z;  4CCJ A;  5KHD A;  3DP7 A;  2HVR A;  1FZP B;  3WE2 A;  1VQ8 I;  3D0S A;  4KIF A;  1OCP A;  5AON A;  4FIS A;  2OD5 A;  1NG6 A;  4U7B A;  1KU9 A;  2F48 A;  1BR4 A;  3EDP A;  4YEJ A;  4BE2 A;  2QSG X;  3S15 J;  2Z5U A;  3ISP A;  4II3 A;  3CUQ B;  4CGZ A;  3REO A;  2ADU A;  1XDU A;  1YFH A;  2B9S A;  2BE5 F;  3T8R A;  2L7Z A;  4ZYE A;  2X1E A;  3K70 D;  2F4I A;  3HPH A;  4G6D A;  2YU9 J;  2XAS A;  2ELJ A;  1A5J A;  2RAE A;  1QGP A;  5HLG A;  3R0A A;  3WOD F;  4AM3 A;  3GME A;  3GF2 A;  1P7J A;  3LFK A;  1XC5 A;  5BMZ A;  1I39 A;  4WXC A;  3HSR A;  3BTI A;  1G8X A;  1IJW C;  2QZ8 A;  3V4G A;  2KZV A;  5C4X J;  3JAM K;  1Z91 A;  1F36 A;  5HDN A;  4XSX F;  2WY7 Q;  2XAQ A;  2IXS A;  3ZRG A;  1MDM B;  4GRI A;  3VEP A;  1FJL A;  2VOP A;  3H1C A;  5JHF A;  3L2Q A;  5M5Y J;  1TT0 A;  4HBL A;  3DEW A;  4HQM A;  3H3U A;  4DIQ A;  4L5J A;  1OCC H;  2VI6 A;  4AVZ A;  4MEX F;  4E7Z A;  2ZO4 A;  2COM A;  5EJC A;  4ZZL A;  2XAJ A;  4KIC A;  2ZME A;  2XSD C;  3ABT A;  3UR3 C;  4D1Q A;  1X2M A;  1MBE A;  3GX4 X;  1S6L A;  3P9I A;  4G7H F;  3JCU C;  1RET A;  4P9F A;  5ILV A;  2R93 J;  2HI3 A;  1ZK8 A;  1FP1 D;  1SVO A;  1ETW A;  4EV0 A;  1JJ8 C;  1UAA A;  4FX0 A;  4ESF A;  5IOZ A;  4HF1 A;  1QU3 A;  2OCE A;  3HOT A;  3G2B A;  1SMT A;  2Z2S B;  4HW0 A;  4DZJ A;  2VKV A;  4EM1 A;  5LEJ A;  2M2E A;  2GM4 A;  2V6E A;  2L54 A;  4JX6 A;  5LFA A;  4UUS A;  2HXO A;  4GCV A;  4RB0 A;  1XCV A;  2LR8 A;  2HEO A;  2H09 A;  3H0D A;  1VF9 A;  2OA4 A;  4IHV A;  1EKE A;  2HKO A;  4WWC A;  6PAX A;  2ZFU A;  1GXQ A;  4AC0 A;  4JX4 A;  4M9X A;  1AKH B;  4L9T A;  2VON A;  1YOV B;  3S1Q J;  2JRT A;  4CZZ A;  2DMQ A;  1FNN A;  5CQG A;  2MD5 A;  1EJ9 A;  4KDP A;  2DT6 A;  3QP5 A;  4XSZ F;  3K4C A;  3K7A J;  3OYH A;  3LFU A;  3EYI A;  3P7N A;  1X1A A;  1XX5 A;  2OAZ A;  3MWM A;  1R00 A;  3VB2 A;  2IS6 A;  4G7O F;  4C2M J;  3SYT A;  4EVI A;  1X3Z B;  1OLT A;  3CCR I;  4IZZ A;  3E7L A;  5L3G A;  2TDX A;  4XOT A;  2HYG D;  1Y1W J;  3E5U A;  3HOW J;  1FEX A;  2W1O A;  4A3F J;  1ZRD A;  3I53 A;  1G4D A;  1XMX A;  4CCM A;  3WGI A;  2GLO A;  4ZYD A;  2IS2 A;  1O3Q A;  1WJF A;  4BJ5 C;  3CTA A;  1Y0N A;  2DA4 A;  4QLC U;  4IHX A;  3UKG A;  1S3J A;  4QWQ A;  1ZQ3 P;  4RLQ A;  1K79 A;  3CMY A;  4RB2 C;  1R71 A;  2CW0 F;  5IYD J;  2KZG A;  1T08 B;  1B72 B;  2CQN A;  3TMO A;  4JX5 A;  4FE7 A;  3W2V A;  1OYY A;  2EZI A;  3K1N A;  3CCE I;  5ILS A;  1K4T A;  2RVC A;  2ZNZ A;  4KN4 X;  3G4S I;  4BDZ A;  2F6C A;  1GHC A;  2ECC A;  1V5F A;  3H9Q A;  2VOD A;  1U8R A;  4BU2 A;  2KIU A;  2DDA A;  3CME I;  1RC9 A;  2DOA A;  3L2C A;  5J8F A;  1MMS A;  2DOF A;  4WK8 F;  4LK0 F;  4BL0 B;  3E6C C;  3FXK A;  4OIN F;  1W0U A;  5DUK A;  4FX4 A;  1R49 A;  4ABZ A;  5FLX K;  2MH9 A;  2P8T A;  1V4R A;  2IGO A;  3CCM I;  3O8H A;  2K27 A;  1FYK A;  3WTX C;  3GZ6 A;  4BEH B;  1VQN I;  3PQJ A;  1PP7 U;  2OCC H;  3HSF A;  4CCK A;  3IP4 B;  1GLN A;  5IPA A;  1YE9 A;  2DJI A;  4N9I A;  2WV0 A;  5DDG A;  3ZMT A;  3HRU A;  2GIZ A;  2W57 A;  3FF5 A;  3GWZ A;  1T38 A;  3VWB A;  3T8T A;  1LKX A;  9ANT A;  3DTK A;  1OMI A;  2FU4 A;  2QF7 A;  2ZJR F;  1KYW A;  3E97 A;  1R1V A;  3IH4 A;  3CCV I;  2XPV A;  3FK7 A;  3BJO A;  1IN6 A;  1FMV A;  4XOP A;  3R61 A;  3SZG A;  3ZQL A;  5LLQ A;  1U5T C;  4PJN A;  3TOB A;  3F8M A;  4HNV A;  2W7N A;  2W4S A;  3ASO H;  1QQI A;  1X3U A;  1LUJ B;  2QUF A;  5ERI A;  3W6J B;  2VN2 A;  4UXN A;  3GZ5 A;  2FA5 A;  4MGR A;  4XNF A;  2D2W A;  4HV6 A;  2L9R A;  1P92 A;  3K4L A;  3X2Q H;  1XSX A;  2DFH A;  2Q0O A;  5E3L A;  2RV8 A;  2HFH A;  2F5C A;  4ITV A;  3A0H C;  1FC3 A;  5HNH A;  1HW2 A;  4LOC A;  1POG A;  2WTE A;  2HDW A;  3CES A;  2MBF A;  3K4K A;  3HJE A;  3WU0 A;  3I54 A;  2F5D A;  2DA6 A;  4RGS A;  2M0C A;  2LD5 A;  5LD2 C;  1LDK B;  4J00 A;  1XPX A;  4I09 A;  5J4V A;  3S8P A;  1BL0 A;  1Z6T A;  4LIU A;  4DYQ A;  3JRB A;  4IHW A;  2E36 A;  2HWV A;  3JTG A;  1ETY A;  3LSM A;  5FFZ A;  5CVU A;  1B9M A;  3J7A O;  2A69 F;  2K02 A;  3F8B A;  5D5U B;  4A69 C;  2OZ6 A;  3E6M A;  2H27 A;  2QWW A;  5H6R A;  3VYU B;  3GFJ A;  4UB6 C;  1AHD P;  1GDT A;  5E20 A;  3F3X A;  1QVU A;  1IN5 A;  2FQ3 A;  1Z3X A;  2GQQ A;  1BI2 A;  1Z7U A;  2EWN A;  3ONQ A;  1ZHF A;  1LFB A;  4HX8 A;  1Y39 A;  1S72 I;  4B47 A;  1J5Y A;  2IEK A;  4RAZ A;  1KA8 A;  2NXN B;  3TBI A;  2D5V A;  2IA1 A;  2CO5 A;  2XDV A;  2E5Z A;  3AAF A;  2IA0 A;  4NC7 A;  1G3T A;  2EB7 A;  3T5X A;  2EK5 A;  2VBX A;  1WI3 A;  2OU2 A;  2STT A;  4M3D A;  2MC4 A;  1K6O A;  1T39 A;  5FRM A;  2L9V A;  1P4W A;  1D3Y A;  1H9G A;  2F2E A;  1R22 A;  5F64 A;  1WSU A;  4IOA F;  2JA2 A;  5GPC A;  3BCB A;  1X1C A;  3DEE A;  3GW2 A;  4BQQ A;  2MG4 A;  3CZ6 A;  1IUF A;  2ISZ A;  3L2U A;  1REP C;  3OYB A;  5FO5 A;  1IXR C;  1QZE A;  3RYP A;  1ZG1 A;  3SDG A;  2L9S A;  2X0L A;  5CVJ A;  4UV8 A;  4XKV A;  4D5C A;  4KN7 X;  3VDX A;  3A01 B;  2JN6 A;  3LA2 A;  1T8I A;  1FY7 A;  1IRF A;  3V8J A;  1YW8 A;  3MKZ A;  3TO9 A;  4NBQ A;  1H8A C;  2R7X A;  4M72 A;  1ZR2 A;  2HPM A;  2KFD A;  1MND A;  2DMN A;  1WPK A;  2KIM A;  2LKX A;  2JA8 J;  3GTG J;  2M9H A;  2CQ7 A;  1Z77 A;  2R7Z J;  4A0Z A;  1PJR A;  5FGM A; 
#chains in the Genus database with same CATH homology
 5EGO B;  3OSF A;  1ETK A;  3JRH A;  3S17 J;  2NVQ J;  2E2I J;  1HCR A;  2EZH A;  4MFE A;  5E3O A;  1U9N A;  4XRM A;  5IP6 A;  3TP3 A;  1D5Y A;  4XID A;  3JRI A;  3WHC A;  4NDL A;  2HYJ A;  3HOU J;  2CUE A;  3JRB A;  4BBR J;  5JLX A;  1P7I A;  3FKI J;  2YS9 A;  1MH3 A;  3HKZ N;  4A3C J;  1T33 A;  5FKK A;  4D7N A;  2LLK A;  3BR0 A;  2NOG A;  2MGQ A;  5EZH A;  1TWA J;  5GPA A;  5IP7 J;  3BG3 A;  2JA7 J;  2XPU A;  2AHQ A;  4M3F A;  1LE8 A;  1GV5 A;  2XB5 A;  2IAI A;  3ZQH A;  2HQ5 A;  4D5F A;  1WCM J;  2H1K A;  3GTM J;  3W6V A;  5EDN A;  1X58 A;  3HOV J;  4XK4 A;  2K40 A;  2FJ1 A;  5K7F A;  2ZB9 A;  3LSR A;  2XRL A;  3HB9 A;  1IRZ A;  2NVY J;  1G2H A;  2ID6 A;  3HOY J;  1H88 C;  2IBD A;  3ZQC A;  1MSF C;  5F04 A;  1NK3 P;  1Z0X A;  2H8R A;  1MBK A;  1PUF A;  2E1O A;  2L0K A;  2NS8 A;  1RKW A;  3BR6 A;  2DA3 A;  2CJJ A;  2TRT A;  1IGN A;  1ZTR A;  1JKP C;  3M3Y J;  3A01 A;  2OF7 A;  4XIC A;  1QRY A;  2DTZ A;  5EZG A;  1NTC A;  1MBF A;  3BTJ A;  3MKL A;  5FKN A;  1R9T J;  2N8G A;  5C44 J;  2NVX J;  2EH3 A;  4Y7N J;  3SJM A;  3G1L A;  4I6Z A;  5F1J A;  2CU7 A;  3A03 A;  4DZP A;  4A93 J;  1WGX A;  3HGG A;  5FKM A;  5F27 A;  5EGO A;  4Y52 J;  2R5Z B;  2DA5 A;  5K7Z A;  3PO3 J;  2Y2Z A;  4JP0 A;  3GTK J;  4B3A A;  1JGG A;  2DMU A;  1ITY A;  1B8I B;  3RZO J;  2JWT A;  2LK2 A;  2YUS A;  2LY9 A;  1WH7 A;  3Q3S A;  2LFB A;  2Y31 A;  5IP9 J;  4DW6 A;  4BY7 J;  4A3K J;  2XGE A;  3K2A A;  1GT0 C;  1K61 A;  1MNM C;  1UMQ A;  1I3Q J;  3BR5 A;  1T56 A;  4BXX J;  5GP9 A;  3FK6 A;  4CYC B;  2K9S A;  1JTY A;  1APL C;  3CQZ J;  3MVP A;  3L1P A;  1JTX A;  4B4C A;  1QVT A;  2WV1 A;  1I6H J;  4UUS B;  2JA6 J;  4BKX A;  5F0H A;  2B63 J;  5C4J J;  4C3J J;  1RKT A;  3OOU A;  1ETO A;  1YRN B;  4QTR A;  1RES A;  2Y30 A;  1GUU A;  2O8K A;  1Y1V J;  3MN2 A;  4RDU A;  1OCP A;  4FIS A;  1F43 A;  2R0Q C;  1QPI A;  2JK3 A;  1A6I A;  3S15 J;  5FLV A;  1X2N A;  2P81 A;  3BTC A;  3I4M J;  1S7E A;  2CRG A;  3BR1 A;  2VPR A;  3TW7 A;  4XRS G;  4A3D J;  2NS7 A;  1ORK A;  1MBG A;  4MO7 A;  2X6O A;  2L7Z A;  1U9O A;  3JRA A;  2LTP A;  1FIA A;  3LNQ A;  2YU9 J;  3S14 J;  4S0H B;  3VPR A;  1A5J A;  2RAE A;  2DA1 A;  5J3L A;  5E3M A;  2ECB A;  1ZGW A;  2E2J J;  2K9Q A;  3BR3 A;  1HDP A;  3C2B A;  1TWG J;  1P7J A;  1I50 J;  1XC5 A;  2ID3 A;  4BY1 J;  3BTI A;  1IJW C;  3LSG A;  5C4X J;  2Y0S N;  4V2F A;  2FX0 A;  2R5Z A;  1F36 A;  4UUT A;  1FJL A;  4W1U A;  3TED A;  1TC3 C;  1NK2 P;  3LOC A;  5M5Y J;  1TWH J;  3DEW A;  2VI6 A;  1MH4 A;  2LP0 A;  3O8G A;  4IHY A;  4XRS A;  2QCO A;  2XSD C;  3BR2 A;  1X2M A;  1MBE A;  5J1R A;  4M3B A;  1RET A;  4AYB N;  3HGY A;  3PO2 J;  3HBL A;  4DYR A;  2R93 J;  2HI3 A;  1ZK8 A;  1JJ8 C;  3D1N I;  1ETW A;  4CYC A;  5IOZ A;  2DA7 A;  2EZL A;  2KT0 A;  3IH3 A;  5IOY A;  2L7M P;  4A3J J;  1RR7 A;  1JT0 A;  4DZJ A;  1UHS A;  2VKV A;  1JKO C;  2GM4 A;  2M2E A;  3GBG A;  2M8G X;  4JX6 A;  2GBY A;  4UUS A;  2HXO A;  1JT6 A;  4X6A J;  2MSY A;  2LR8 A;  2O7O A;  3BG9 A;  5J1U A;  5FLM J;  1ENH A;  3G1O A;  2HDD A;  1VF9 A;  3H0G J;  2XGD A;  1MSE C;  1YRN A;  3GTP J;  4IHV A;  2KDZ A;  4DYC A;  3RQI A;  4A3G J;  2HOA A;  4AC0 A;  3B6C A;  4QIW N;  3S16 J;  4JX4 A;  4W97 A;  3TW6 A;  4A3E J;  1AKH B;  3S1Q J;  1WH5 A;  2DMQ A;  3BQZ A;  4I76 A;  1K83 J;  1JUS A;  5FKO A;  2CQX A;  3K7A J;  2Y9Z A;  2I10 A;  1XG1 A;  5FKL A;  3M4O J;  2NVT J;  4RBO A;  1MBH A;  3BTL A;  3HM5 A;  5EYR A;  1HDD C;  1H89 C;  4C2M J;  4EEF G;  2FD5 A;  1IDZ A;  3E7L A;  5EF6 A;  2ME6 A;  3HOZ J;  3F0C A;  1Y1W J;  2CUF A;  3HOW J;  1FEX A;  5J1Y A;  4A3F J;  3S2D J;  1ETV A;  1IG7 A;  4L5E A;  1ETQ A;  2TCT A;  2GLO A;  2WB1 N;  3IH2 A;  4M6V A;  4D7M A;  2G0E A;  1ZKG A;  4A3I J;  2DA4 A;  4IHX A;  2X9D A;  3UKG A;  1ZQ3 P;  3GTQ J;  3LSP A;  3CMY A;  4A3L J;  3FIW A;  1JUP A;  5IYD J;  2COB A;  1B72 B;  2JJ7 A;  3JRE A;  1TWC J;  1BA5 A;  4MIM A;  4JX5 A;  4FE7 A;  5C3E J;  3RZD J;  2EZI A;  2K9N A;  1BJZ A;  4J19 A;  5FJ8 J;  2ECC A;  1IDY A;  1VND A;  5EG0 B;  1OFC X;  3HOX J;  3GTJ J;  2AO9 A;  2CQQ A;  1BW5 A;  5E3N A;  4C3I J;  2LVS A;  3WHB A;  3HDD A;  1HF0 A;  5IYC J;  3JRC A;  1W0U A;  1UG2 A;  1HOM A;  4ABZ A;  3LSJ A;  1ETX A;  3Q0W A;  4FCY A;  2PMZ N;  1RPW A;  3B6A A;  4B1R A;  1OCT C;  3O8H A;  1MBJ A;  1VI0 A;  2VKE A;  5IYB J;  1AKH A;  2Y9Y A;  2MW8 A;  5F08 A;  4AUX A;  2R92 J;  1IC8 A;  3CDL A;  1CQT A;  3QQA A;  3GTO J;  4X1E A;  5IPA A;  5M3F J;  2E2H J;  1FTZ A;  1B8I A;  1BW6 A;  5DTD A;  4M3G A;  3BG5 A;  3JR9 A;  1FIP A;  9ANT A;  2R5Y B;  3SFI A;  4C3H J;  4JYK A;  1VFC A;  1HLV A;  2QF7 A;  2ME0 A;  1XS9 A;  4QSH A;  3S1N J;  2M34 A;  2EBI A;  3NAU A;  2W48 A;  3IH4 A;  2XPV A;  3FK7 A;  2XB0 X;  3Q0U A;  2HOT A;  2XGC A;  1U8B A;  3ZQL A;  4M3E A;  5F0C A;  3JRF A;  4HNV A;  4G12 A;  3S1R J;  1LFU P;  1JUM A;  2ELK A;  2EQR A;  3ZQI A;  1JJ6 C;  1DU0 A;  3G1M A;  3JRG A;  5M5W J;  2DMP A;  1DU6 A;  2L9R A;  1B72 A;  5E3L A;  5BNG A;  3DCF A;  1TWF J;  3H3V K;  2WAQ N;  5F0F A;  4LOC A;  1POG A;  2X48 A;  4MLO A;  3TP0 A;  1JKR C;  5M3M J;  1GV2 A;  5EG0 A;  2DA6 A;  2LD5 A;  2M0C A;  3Q0V A;  1BL0 A;  4DYQ A;  2O9L A;  4IHW A;  1ETY A;  1EF4 A;  3BQY A;  2OPT A;  5HOD A;  1GVD A;  3CCY A;  4A69 C;  2DA2 A;  2EZK A;  2DN0 A;  2XPW A;  1GDT A;  1AHD P;  1FTT A;  1QVU A;  1JKQ C;  2FQ4 A;  2E19 A;  1LFB A;  5K7H A;  2VUM J;  3HEF A;  1ZR4 A;  3OIO A;  2IEK A;  4FTH A;  1LE8 B;  1SAN A;  2DMT A;  1AU7 A;  2DJN A;  4BBS J;  2D5V A;  2HOS A;  3ZQG A;  3ZQF A;  4A3M J;  5JLW A;  3RKQ A;  1Q1V A;  1WI3 A;  4V2G A;  4M3D A;  3NAR A;  3A02 A;  3OSG A;  3QPL A;  1O4X A;  3I4N J;  2R5Y A;  2HXI A;  4MFD A;  5GPC A;  2L7F P;  1IV6 A;  3JRD A;  1PUF B;  1E3O C;  4GFB A;  2MG4 A;  3S1M J;  4A3B J;  1IUF A;  2JMW A;  3BT9 A;  3SDG A;  4D5C A;  4FE4 A;  3A01 B;  2JN6 A;  1OJL A;  3S2H J;  1SFO J;  1U78 A;  1H8A C;  5M5X J;  1ZR2 A;  5EEA A;  3PM1 A;  1W0T A;  2DMN A;  1WPK A;  2LKX A;  3GTG J;  2JA8 J;  4IEJ A;  2M9H A;  1Z77 A;  3GTL J;  3FIS A;  3QPS A;  2R7Z J;  5DS9 A;  2JA5 J;  3ZOB A;  3IV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...