4HLXA

The crystal structure of the dna binding domain of virf-1 from the oncogenic kshv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
99
Chain Sequence
ASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K9
publication title The crystal structure of the DNA-binding domain of vIRF-1 from the oncogenic KSHV reveals a conserved fold for DNA binding and reinforces its role as a transcription factor.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Dna binding protein
total genus 23
structure length 99
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hlxA00
3NQOA 1BI3A 1L3LA 1UCRA 4G8XA 3GFIA 1BN5A 1SD4A 2IW5A 4YFNF 2JZYA 3QP5A 3R60A 1SMYF 5FFZA 1KQ0A 3CUQB 4EM0B 4Z2YA 1WSUA 2UWMA 1P4AA 4GO1A 2DBBA 4O5VA 2ZBKA 5IT9K 1KGSA 4I02A 1SD6A 3MQ0A 2F5DA 4RB1A 5HDGA 3BWGA 1U5TA 3ZP5A 1T0FA 2L02A 3BJOA 2GZWA 4HW0A 3IWFA 1W4MA 1XMKA 3GFMA 3IWZA 1R1TA 4HQEA 1TTYA 4P5OA 4WCGA 3I53A 2HGCA 1HKSA 3IHUA 1P4WA 3DPLC 4R8HA 3IL2A 2KIUA 3SXYA 4YIFA 3HIFA 4HV5A 4LGWA 1CF7A 1XMAA 1AOYA 2XHKA 3KCCA 4HQMA 1KYZA 5E1XA 3RTRA 3HHHA 4PZJA 3HOSA 2D1HA 3OV8A 2L4AA 2V1DA 2LNBA 2ACJA 1G3SA 4ENKA 3HSFA 1Z6TA 1U6GA 3FWEA 1ZLJA 3WTYC 3E6BA 4UXNA 5L3DA 2DPDA 4AIJA 5HS7A 2G7UA 4EJVA 3I64A 2O61A 5LLQA 2PQ8A 1HSJA 2VE9A 3I54A 3KP2A 1O3RA 3KP3A 1ZN2A 4D0PA 3C7JA 4ENMA 2HEOA 2RV8A 3DPTA 2J5OA 3P9CA 4EJWA 3KEOA 5D6FA 3J80Z 2NNNA 1IN5A 2MLKA 1YS6A 3V7CA 4RGXA 2NS0A 4FX0A 4KICA 2P5LC 1BJAA 1RNLA 5FO5A 2ADUA 3LA2A 3IRRA 1XGNA 5DD4A 1MD0A 2GWRA 1R36A 4HAMA 3BJ6A 1K79A 2RVCA 5LGTA 2A6HF 3WG9A 3MZHA 2HYFA 3RYRA 3WGHA 2BV6A 3JAMZ 4UNOA 1EH8A 5FFXA 3ZMVA 4P96A 3V4GA 4OIQF 2K86A 2EB7A 1V4RA 1FYKA 4HF2A 5LHGA 1OR7A 2FOKA 3KEQA 3Q9VA 1T39A 3H3UA 4HA8A 4A2UA 1F1ZA 2H6CA 5JVTA 3COAC 1KQ8A 3RKWA 2ZKZA 3JTHA 3DEUA 4KMUX 4XRFA 4OOIA 2L3DA 2Y0MA 3O2PE 4KIFA 5EEGA 2Y75A 3RKYA 2DAOA 5D4RA 2XUBA 5FD6A 2P6TA 1ZREA 4RB2C 4EMSA 2RNJA 3I0TA 4CHUA 3WU0A 2GAUA 5KVRA 2OZ6A 2YX4A 4M72A 4A0ZA 4CGZA 1HW1A 1FOKA 2ELHA 4A6DA 4ZZDA 1HKTA 1W7PA 2STWA 4UUVA 4M6YA 3LFKA 2ETHA 1FYLA 4GGGA 2EA4A 1SD7A 1S7OA 2K02A 4M6XA 2KIFA 2FA5A 2WTEA 3CO6C 1W7PB 5BQTA 1Z1DA 3C1DA 4AWXB 1OKRA 5L3BA 5IT3A 2F5CA 3FX3A 3V8JA 4AIKA 2HOEA 5J8FA 2FU4A 4IHSA 2CSOA 5CVVA 4XSXF 1IXRC 2ZNYA 4A0XA 1C0WA 3KE2A 3Q9SA 3G3ZA 5DCMB 3TQNA 1Q1HA 5TRDA 3P9IA 1ZG1A 1FNNA 1Z91A 1J0RA 3EQLF 3GXOA 2UZKA 4L0YB 3DP7A 3JW4A 4G94A 1YQAA 5HDKA 5F6FA 3FXQA 1HBXG 4L5JA 3BP8A 1ULYA 3FM5A 4LLGF 4L5IA 4YFXF 1LNWA 1S3JA 2HKXA 1IXSB 5CVUA 1T98A 5DEQA 1KU3A 4KN4X 3WE3A 1FBSA 2A69F 5ERIA 2LF7A 2RC4A 3TGNA 4HYEA 4LD5A 2O0YA 2P5VA 2FMLA 4FT8A 2H27A 2WV0A 1EV7A 1O7LA 1TW3A 2CGPA 4MGRA 4LK0F 3R0JA 4MTDA 1IN7A 2E1CA 3SHFA 3FZVA 2PLYA 2X4HA 3FXUA 2QLZA 3E6MA 3GFLA 4IHTA 2L4MA 2ESNA 2FF4A 3SZTA 2E1NA 1L0OC 1U5TC 2FE3A 3E6CC 1KQ9A 4KYWA 4ZYHA 2STTA 3I59B 4S04A 4R79A 3WODF 2RQPA 3L00A 3KLNA 3B02A 1O7FA 2O3FA 5ICEA 2PMUA 3IKTA 5D5XB 5CVIA 1OMIA 4M74A 2HR3A 2QBYB 5HDNA 1BIBA 4YIIA 1D8JA 1BI0A 2XV4S 1H9TA 3GZ5A 3H3ZA 1IRGA 5BPDA 4IRHA 2IRFG 1D3YA 4ESBA 4HDVA 3FHZA 3F72A 3GO5A 4BHCA 5DUIA 4MQ9F 3W6KB 1K7AA 3L2CA 2K27A 2EWNA 2PFBA 2DK8A 2JPBA 5H20A 3W6JB 1FY7A 5LRSA 1JHHA 2IA1A 1REPC 3EDPA 1J7KA 5K5RA 3CO7C 4KT5C 3J81K 3I4PA 5L3CA 3KP6A 3K1MA 2MD5A 4N9IA 5AIPA 6PAXA 4GCVA 3BOQA 1YO5C 2G7HA 4I7HA 3ABUA 1S7AA 1YS7A 2JSCA 1R1UA 2OQGA 2VOPA 1IZ1A 1XSVA 4FX4A 1E17A 3L9FA 4RB0A 4CXFA 4P55A 3CLOA 1OPCA 2QQAA 1TQPA 3GW2A 4EM1A 2NAZA 2KKOA 4HLYA 4LJZF 3CUOA 4LG0A 3HUGA 2ISYA 3F22A 1B6AA 2L54A 3C18A 1FC3A 1NHAA 2HTSA 3D5LA 4ZYDA 4BXUA 3JTGA 2FXAA 4LG0B 3BZ6A 1KYWA 2Z9OA 1LVAA 4G7OF 1MGTA 1ZRFA 3ZPLA 2HWVA 3ZN1A 1QZYA 3F8FA 3CTAA 1U5TB 2FMYA 3WE2A 1UHMA 3HRUA 2QYOA 1FZPB 2G9WA 2O03A 2R7FA 2YU3A 4O3MA 4ZH4F 2W25A 2YX7A 2PEXA 1VTNC 2M5WA 3VFZA 2VC0A 1GXQA 3ZMDA 3I5UA 1LEAA 2PG4A 5J8CA 4B8XA 2VE8A 5A2QK 5E17F 2XIGA 3F8MA 1Z9CA 3WTUC 1QQIA 1XDSA 2DK5A 1BIAA 1E2XA 3IC7A 3I58A 4N0BA 3P9KA 1P92A 3QPHA 2GA1A 1CF7B 3HSRA 2DPUA 4Q48A 1YYVA 1P6RA 4M73A 3WU1B 3RI4A 2DLLA 2FNAA 1ZG3A 2IJLA 3PFIA 4U0WA 4RGUA 4FHTA 2IT0A 3H92A 1SFXA 3TO7A 4EJOA 2GXBA 3OOPA 4KNYA 4I0AA 3BJAA 2Z33A 2K4JA 3EYIA 1PDNC 3GLXA 2EFNA 1YTYA 3E6DA 3KP5A 3JSPA 3QAHA 1IRFA 4JQFA 3E5XA 2D45A 4ZZLA 1YW7A 1STZA 1LDDA 2H09A 1O3SA 4BYYA 3LSTA 3RJPA 4IF4A 1RUNA 2ZFWA 4XLPF 1FBUA 2OU2A 2IPQX 2Q0OA 1O3QA 2XKPA 3EETA 5DD8A 2PJPA 3HSEA 5H6QA 3U1DA 4XSZF 1GXPA 5FB2A 2NRAC 2YR2A 1FT9A 3QOPA 1B9NA 2JTVA 3GYHX 4OMZA 4UV8A 4IVNA 2HYGD 5CVJA 4M71A 1MDMA 1FX7A 1G3WA 4Q4ZF 4IXAA 2V9VA 3FMQA 5BPIA 5CJ9A 4RS8A 1HXDA 4XLNF 1QZZA 4OMYA 4YFKF 3ISPA 4I98B 2XAFA 3AAFA 1S29A 4Y13A 5D4SA 1UB9A 4S05A 3M8FA 1OYYA 4CYDA 2JRTA 5K5QA 2FEZA 2P6SA 3R61A 3L7WA 1WKMA 2EV5A 2WWYA 1T38A 4G9YA 1JHFA 1IN4A 4AVPA 2XKOA 4KN7X 1PP7U 4PGHA 4HDUA 3M7GA 5HLHA 3HHGA 4L9TA 4I01A 5BS6A 2D2WA 3GUDA 1DPRA 3ECHA 1B9MA 3QP6A 3SQNA 1W5TA 2RGVA 4R1HA 4HF1A 4EJTA 2BEOA 4IRGA 3KP7A 3TO9A 3J80K 2PBIA 1PP8F 3FM3A 4UVBA 1W7PD 3IKVA 1J9IA 3D0SA 1DPUA 3BDDA 2VXZA 4P9FA 1OYWA 1QBJA 2ZXJA 2IP2A 1K6OA 3LQRA 1F9NA 1DDNA 2DT5A 2M8EA 4MTEA 1K78A 3T0YA 3JAMK 3LWFA 3R4KA 1XD7A 5LGUA 1LEBA 2FSWA 3J7AO 5D8KB 4DNCA 3R6SA 1RZ4A 1XN7A 3RDIA 3LA7A 5ICFA 1K78B 3ZQ7A 2P7VB 4KFCA 3TDZC 2KRFA 5D6EA 1B4AA 3TOBA 2AXLA 4GYIA 2VBXA 3HRSA 4RAYA 4OIRF 3KFWX 1XSXA 2XASA 4AIHA 2XROA 2CYYA 2MC3A 1EH7A 5E1WA 3U9GA 3HRTA 2KJBA 3KP4A 5BMZA 2Z3YA 3BY6A 5L3EA 1ZAOA 1GVJA 4IPAA 2EFPA 2FNPA 4PDKA 3WGIA 1Y0UA 3QU6A 2FRHA 3R0AA 3T8TA 5L3FA 2HQRA 3DFGA 1O57A 3RPQA 1ODDA 1BM9A 5FLXZ 5CLSA 1H9GA 2HQNA 1BC8C 3ABTA 2O8XA 4NB5A 2O6GE 4U0YA 2VC1A 2M1BA 3WTTC 2F5EA 5DV5A 4RAZA 5KK1A 1ZG5A 2QQ9A 2FBKA 2NYXA 3GZ6A 4I09A 2VODA 1IUYA 1SAXA 2CFXA 1J5YA 4M9XA 2HS5A 2UXXA 2AS5F 1B1BA 1B59A 3F3XA 1BI1A 2ZMEA 4G6QA 3VOEA 1J59A 1Z6RA 1P2FA 3N4MA 2K4BA 4WF2A 2HFHA 4HF0A 2EFOA 2OAZA 2A5YB 5HS9A 1R23A 2XRNA 4O6JA 4L9NA 4CO8A 3E5QA 5HS8A 3BPXA 1TLHB 2XAQA 4PGGA 4WWCA 3K1PA 3ULQB 4A12A 1S6LA 4L18B 2K7LA 2EK5A 3HRMA 2EV6A 3GWZA 3WTXC 1I27A 3E3VA 3O3KA 2J5PA 2GIVA 5AONA 3HYIA 5J6XA 1TQIA 4Y15A 1IF1A 5IT9Z 1R58A 1JGSA 2VOOA 1J2XA 4CICA 1O3TA 3F6VA 2LKPA 4ESFA 1G3TA 1FWZA 1JXSA 4L0ZB 1RUOA 1WQ2A 3MAJA 2DQRA 5ICGA 5HLIA 1I5ZA 1JE8A 1TNTA 2XAJA 4CZZA 2MBFA 1A04A 3GEZA 4Q5SF 5HOOA 2EA2A 3DKWA 2VT3A 3ELKA 4ENJA 5LHIA 2P7CB 5LHHA 5E18F 2CQKA 3K2ZA 3DQVC 4KDPA 4ON0A 3F6OA 2PI0A 2HKOA 3ERED 3BPVA 1T2KA 3U2RA 4WXCA 2A3SA 3T1BA 1YLFA 1YW8A 4ESJA 1R5HA 4JK1X 1IAWA 1FSHA 4HX7A 3HTSB 4OINF 3LAJA 3FF5A 5ILVA 4I2OA 2EV0A 2PN6A 1BI2A 4CDGA 3BROA 4NHJA 5FD5A 3K1NA 4HX4A 1XGMA 3S2WA 3CUQA 1KU2A 3RPUA 3TDUC 3SFZA 1SD5A 3E97A 4BQAA 2B0LA 3ZN0A 4G7HF 5JHUA 4HZFA 1LQ1A 1F4KA 3FMRA 2ZJ2A 1RI7A 2EFWA 2ZO4A 5K5OA 2X0LA 2MH2A 4EV0A 1BOAA 4KIGA 3MEXA 2W57A 1FBQA 2OQRA 2M45A 3DV8A 2PMHA 5K1YA 4E70A 1TW2A 4UHTA 2QENA 4BHBA 2OA4A 4HBLA 4PCQA 1USSA 5LEJA 2DTRA 4ASNA 2F2EA 3GF2A 4B09A 2WC2A 1G6NA 2M30A 5D5UB 5LRRA 4G7ZF 1ZLKA 4EGYA 2CW0F 3DF8A 4LMYA 2GA2A 1FYMA 4LFUA 4LLNA 5JFRA 1IXCA 2XGXA 4ENNA 5L3GA 3ZMSA 4GYGA 3HTUA 3ECOA 2VN2A 1Z7UA 1R00A 2HDCA 4BAYA 3K69A 1SFUA 4MHGA 1YFHA 1S8NA 3RYPA 5D5WB 4A0YA 3LAPA 3C3WA 5JI6A 3N97A 3JSOA 3TO6A 1I1SA 2W84A 1QNTA 4WXDA 1CGPA 1AWCA 3TOAA 2ESHA 1FP1D 3T8RA 1IW7F 1LJ9A 3NEUA 2E7WA 2ZNZA 3CJNA 3B73A 4A5NA 5ICCA 2LDUA 3GFJA 2A6EF 1D5VA 3REOA 4Q47A 1SMTA 4QLCU 3QU3A 1ZGJA 2Y48A 2FBHA 4AD9A 3ML6A 3Q5FA 2RN7A 1WRJA 2QM3A 2DW4A 2HTJA 4BNCA 1XCVA 2YSRA 2BBYA 5AIQA 4RGRA 4G6DA 5DUKA 1MDMB 1TNSA 3NRVA 2EFQA 2EJRA 5CYVA 1MJBA 1U8RA 1YIOA 2QQBA 1ON1A 1OYIA 4HV6A 2YPRA 3MWMA 4LB5A 3PQKA 1USTA 4N9HA 4OIOF 4EGZA 1HW2A 4LLLA 2F5FA 2Z99A 2CWEA 2QWWA 3CDHA 2P8TA 5CVRA 5LEKA 1YW9A 3HOTA 5E8IA 4Y17A 5BOXA 1FPQA 2V6CA 1ON2A 1G4DA 3MZYA 3M1EA 1QO0D 1LDKB 4WXHA 5JR3A 2LF8A 2R3SA 3VB2A 1U2WA 2XVCA 2MLGA 1T6SA 1D8KA 1HQCA 1P4XA 3LQQA 3K9TA 1V3FA 1PUEE 4KUMA 3WTSC 5ILUA 2C6YA 3KETA 1ZRDA 1ZGAA 2OBPA 1J75A 4ZYEA 2VBYA 1GHCA 1XGOA 4U0VA 2P5KA 3ZMZA 3GVAA 4U7DA 1HSTA 3F21A 3I71A 5ED4A 3WTZA 3ZMTA 4UVCA 1UFMA 2NNYA 2IA0A 5DCFA 2Q8KA 5DCMA 4MEYF 3DXJF 2V1XA 2V79A 1TBXA 4P9UA 2DO7A 2XAHA 5TJJA 2MA3A 1XB4A 5EEHA 3E5UA 5DDGA 2ISZA 3QRFF 4UVAA 1ZRCA 2DQLA 2P4WA 1HKQA 1MJAA 1R1VA 3F8BA 1H0MA 4DQ2A 2BYVE 4KMFA 2VONA 4EM2A 3WTVC 2JPCA 5H6RA 2IVMA 3SZPA 1FP2A 3V8LA 2L01A 1IN8A 1QGPA 2E7XA 3RIRA 1MJ9A 2A07F 3GX4X 4KA4A 2JT1A 1KU7A 4MEXF 2OZUA 3O6BB 3MCZA 3KZZA 5E8GA 1R5GA 1SFEA 2V1UA 1Z05A 2QUFA 1I6XA 3KLOA 3CUQC 3QPTA 2QVOA 4KIBA 3TKYA 2GXGA 3ROUA 5FGMA 4M9ZA 4OIPF 1UHWA 4UV9A 1ZARA 1LB2A 3J81Z 1YG2A 4H0EA 4F7ZA 2VBZA 4RB3C 1MKMA 4HOBA 4XBFA 4BH9A 2CG4A 1XGSA 2ZMEB 2OD5A 2HZTA 4LK1F 4BHPA 3I59A 1R7JA 4QWQA 2D1VA 2XAGA 1TQMA 4LB6B 1MZBA 3V8KA 4U7BA 1X3UA 2LSOA 3L09A 3RKXA 4U88A 2A61A 4JBAA 4WK8F 1EH6A 5E1ZB 2BE5F 5HLGA 4ZYGA 2DI3A 2QBYA 2RKHA 3FMSA 1ONVA 2COMA 4TV7A 1G3YA 2GQQA 3M8EA 1QPMA 3ZMUA 2DFIA 1U78A 1WI9A 2Q2EA 2R7DA 2VBWA 1ZHFA 1KA8A 3P7NA 2H6BA 2KJCA 1XDUA 2W85A 1ZYRF 2IA2A 1KU9A 5E20A 2ZCWA 4NQWA 4WX9A 2A68F 1BC7C 3VEPA 4YG2F 4MNUA 1RIOH 5FLXK 2DU9A 4EVIA 3IRQA 2MH9A 3T5XA 1XCBA 1DUXC 3F23A 5LBQA 3WTWC 2BGCA 3KZYA 4RGSA 1IN6A 5DYMA 4L9VA 5ILSA 4MQVA 2VT2A 4EJUA 4I0BA 2UXNA 4K2EA 5F1RA 1XSDA 5A2QZ 1WWXA 1F5TA 2QZ8A 2RDPA 2TDXA 2FQ3A 1BBYA 5F64A 4HX8A 3V7SA 3G73A 3F8NA 1LDJA 4EQQA 2CO5A 4ETSA 5D8LB 1ZH5A 3FXRA 3MFKA 4HLXA 3M9AA 4M9SA 4IJAA 3PQJA 2Z5UA 5LGNA 2KIMA 4GXOA 1FLIA 2FBIA 3V7RA 4A5MA 2H94A 3EUHA 3EYYA 4A6EA 1I1GA 5HVQC 1R22A 4OU0A 1W5SA 1U3EM 3K0LA 2W24A 3WGGA 1DP7P 4L9JA 2M87A 3LA3A 1FSEA 3VODA 3F8CA 4IRIA 5D5VB 1HW5A
chains in the Genus database with same CATH superfamily
3NQOA 2CW8A 2R7UA 1BI3A 1L3LA 1UCRA 1I3AA 3W2VA 4IHVA 4B1RA 2VKDA 3PSIA 2MSYA 2WAQN 4G8XA 1X4PA 3GFIA 3HM5A 1BN5A 1SD4A 2IW5A 5C4XJ 1TL8A 4YFNF 2JZYA 3W6VA 2EQRA 1ZKGA 1A36A 2IXSA 2LKSA 3QP5A 3R60A 3HPGA 1SMYF 1YX3A 3IUOA 5FFZA 1HOMA 1KQ0A 1WCMJ 3CUQB 4EM0B 4Y33A 3D5RC 5F1JA 3GBGA 4Z2YA 5M5YJ 5IP6A 1WSUA 4HNVA 2R5ZB 5KAIC 3AKZA 2UWMA 1P4AA 4GO1A 2DBBA 4O5VA 1FMVA 2ZBKA 2L0KA 3ABKH 4C3HJ 1W0TA 3DTEA 5IT9K 1KGSA 4I02A 1SD6A 3MQ0A 2DA7A 3VYUB 2F5DA 4RB1A 4J01A 4C9YA 2KP6A 2EINH 1W1WE 5HDGA 1UG2A 3BWGA 1U5TA 3ZP5A 1T0FA 2L02A 3BJOA 3JCUC 2W82A 1JKPC 2GZWA 4HW0A 3A0BC 1D1BA 1FMWA 3IWFA 1W4MA 4RLFA 1I39A 5J1UA 1XMKA 1E3HA 3GFMA 3IWZA 1BR1A 1R1TA 4II2A 4HQEA 1TTYA 4P5OA 4WCGA 2K5CA 3I53A 4XLAA 2HGCA 1HKSA 4XICA 3CF5F 2M8GX 3IHUA 1P4WA 3K10A 1MBEA 5F08A 2FOWA 3DPLC 4R8HA 3IL2A 4CCJA 2KIUA 3SXYA 2A05A 4YIFA 3HIFA 2KIQA 4HV5A 3VYSB 2K9LA 4LGWA 4XKVA 2DCEA 3S14J 1CF7A 1XMAA 4A93J 1AOYA 1G8XA 2XHKA 3KCCA 4HQMA 4RAFA 1KYZA 2JA2A 1SC7A 5E1XA 3RTRA 3HHHA 4PZJA 3X2QH 3HOSA 2D1HA 5J4VA 3OV8A 2L4AA 2Y9ZA 4Y3OA 3MKZA 2V1DA 2LNBA 4IHXA 3EUKL 2EIMH 3RZOJ 4ZC3A 1FTTA 2ACJA 3MKLA 3Q3SA 3RQIA 2ICWG 1G3SA 4ENKA 3HSFA 2EZLA 3H3VK 1Z6TA 1U6GA 3FWEA 4ZDLA 1ZLJA 3AFHA 3WTYC 1Z0XA 2KZVA 3E6BA 1IUFA 3ZQGA 1OCPA 4UXNA 5L3DA 2DPDA 4AIJA 4DBRA 5IYCJ 5HS7A 2XPUA 3GTMJ 2G7UA 4EJVA 1JJ8C 2MW8A 2UV1A 3I64A 3L2QA 3DLAA 1V5GA 3OOUA 2O61A 5LLQA 4ZDPA 2PQ8A 1HSJA 2VE9A 3BR1A 1Y1VJ 3I54A 3KP2A 5EJCA 1O3RA 3KP3A 3HOZJ 1BW6A 1ZN2A 1JGGA 4D0PA 3C7JA 4ENMA 2CUFA 5GTHC 2M0MA 2TRTA 2HEOA 2JVGA 1SFKA 2RV8A 2NVUB 3WU2C 3DPTA 2J5OA 3P9CA 3QOEA 4EJWA 1JKQC 3KEOA 1WJEA 5D6FA 4A3CJ 3W2WA 1ZQ3P 2LG4A 4M3EA 3J80Z 2NNNA 1IN5A 3PNVA 2MLKA 1YS6A 3V7CA 1X1PA 3L2UA 4XLEA 4RGXA 4A3MJ 5GAHJ 1X1AA 1ZTRA 2NS0A 3H9GA 4FX0A 4KICA 2ZSIB 1ZR4A 1YX5A 2RREA 2P5LC 5FRMA 1BJAA 1ETYA 1RNLA 1XMXA 5FO5A 3CCVI 2VUMJ 2ADUA 3LA2A 3IRRA 4XLHA 1XGNA 5DD4A 4IOAF 5EYRA 2ZXWH 1MD0A 1I3QJ 5FKOA 2GWRA 1R36A 4HAMA 3BJ6A 1K79A 2NVTJ 2HQ5A 2IGNA 2RVCA 5LGTA 2A6HF 5FKMA 3WG9A 3MZHA 2HYFA 3RYRA 3FKIJ 3WGHA 2ME0A 2BV6A 3JAMZ 2K3PA 4X1EA 1NG6A 4UNOA 3HDDA 1EH8A 2Y0SN 5FFXA 2QEXI 3UNGC 3ZMVA 1P7JA 4P96A 3HC7A 2EIJH 5M3MJ 1WI3A 3V4GA 4OIQF 3HEFA 2K86A 2EB7A 4XM3A 1V4RA 3DU6A 4A3LJ 2M4KA 2OCEA 3LSMA 3IAS2 3BR6A 1VQOI 5EEAA 1FYKA 1ITYA 5E3OA 2MYSA 2HI3A 4XK4A 4HF2A 5LHGA 4B44A 3VYRB 9ANTA 1OR7A 5F04A 2FOKA 3KEQA 3Q9VA 4F3QA 1T39A 3H3UA 3JRIA 4HA8A 4A2UA 1F1ZA 4NC6A 1OCOH 2H6CA 2KZGA 5JVTA 3COAC 1OCCH 3DBRB 1AHDP 2IS4A 1KQ8A 3RKWA 2OF7A 2OJED 2ZKZA 3JTHA 3DEUA 4KMUX 5B5EC 3AG4H 4XRFA 2GM4A 1D1CA 4OOIA 2QF7A 1FIPA 1OCZH 1AKHB 2WAFA 3C2HA 2DT6A 2VQCA 2L3DA 2M4GA 2Y0MA 3O2PE 4KIFA 5EEGA 2DA4A 2EILH 2Y75A 3RKYA 1GT0C 4CZCA 2R7VA 3MD2A 2DAOA 5D4RA 5IPAA 2XUBA 4BXFA 5FD6A 1IRXA 1MBGA 2P6TA 3L2WA 1ZREA 4RB2C 4EMSA 3EPZA 3QYEA 3OYHA 1IGNA 1LUJB 2RNJA 3A2KA 4II3A 3TP0A 3I0TA 3ZQQA 3PIOF 4CHUA 1MIJA 2PMZA 4XORA 3WU0A 2GAUA 5KVRA 2OZ6A 3OS2A 2YX4A 3TEDA 4M72A 4A0ZA 3M8JA 2XSJC 4S0HB 4CGZA 1HW1A 1FOKA 4PK4A 1NG7A 2ELHA 4A6DA 2CQQA 4ZZDA 5B1AH 2CV2A 1HKTA 1W7PA 2X6OA 2X85A 4IQ4A 4RLQA 2STWA 4UUVA 4M6YA 1Y6IA 3LFKA 2ETHA 1FYLA 4E7LA 4GGGA 2EA4A 1SD7A 1S7OA 2K02A 4M6XA 2E5NA 5EDNA 4BJ6C 2KIFA 2FA5A 3CJRB 2WTEA 3ZRGA 4IL6C 3CO6C 1W7PB 1Y1WJ 5BQTA 3PL8A 4YEJA 1WZ2A 5FKNA 3KZIC 1E3PA 5EZHA 1FOYA 2XSDC 4A3DJ 1YOVB 1Z1DA 2IEKA 3C1DA 4AWXB 2R7QA 1QVTA 1OKRA 2KISA 5L3BA 1H89C 4EATA 3KYDB 3K4BA 5IT3A 2F5CA 2OV7A 3FX3A 2LD5A 3OSFA 3V8JA 2JJ7A 1T95A 3BZKA 4AIKA 2HOEA 3MMYB 5J8FA 2FU4A 4IHSA 2CSOA 5CVVA 4XSXF 1X1CA 4BQQA 1IXRC 1FTZA 1APLC 4MFEA 2ZNYA 4BACA 4A0XA 1C0WA 2K9NA 3OIQA 3KE2A 3Q9SA 2BXYA 1JJ6C 1Z77A 3G3ZA 5DCMB 3TQNA 1VQ7I 2IGMA 1Q1HA 5F0CA 3ONQA 5TRDA 3D5SC 3P9IA 1IRZA 1ZG1A 1FNNA 1T33A 1Z91A 4ZDOA 1J0RA 3EQLF 3GXOA 2UZKA 1R9TJ 4L0YB 1ACIA 3DP7A 3CMMA 3JW4A 4G94A 1YQAA 3MN2A 4BBSJ 5HDKA 5F6FA 3HKZN 3FXQA 1HBXG 3QODA 2K3FA 2ZSHB 4L5JA 3S3OA 3BP8A 2KRHA 1WH7A 1ULYA 3FM5A 4LLGF 4RM2A 3H5AA 5K7ZA 4L5IA 4G12A 2VL8A 3EUHC 4E6KG 2XAUA 2QSGX 4ZYAA 4LIUA 4YFXF 1IO2A 1LNWA 1S3JA 2BZTA 2HKXA 1MMGA 2LP0A 1IXSB 5CVUA 3QYBA 1OISA 1T98A 3AG3H 3HB9A 5DEQA 3KPHA 1KU3A 2OPTA 1UMQA 4KN4X 3WE3A 4DYRA 1FBSA 2A69F 1DGRM 5ERIA 4B43A 2ZJQF 2WAQA 2LF7A 2I10A 2RC4A 4ANJA 3TGNA 4DZJA 4HYEA 3I56I 4LD5A 2O0YA 2P5VA 2FMLA 4FT8A 4V2FA 2H27A 4D1QA 2L7FP 2WV0A 1R4MB 1EV7A 3TL4X 3S1MJ 2DFEA 1O7LA 2K9QA 1TW3A 2CGPA 2XPVA 4MGRA 4LK0F 3R0JA 4MTDA 1IN7A 1JT6A 2E1CA 3SHFA 3D1NI 3FZVA 1ETXA 4BE1A 2JWTA 1UJ8A 3CDIA 2PLYA 3A01A 4G6TB 4BBRJ 2X4HA 3FXUA 2QLZA 3E6MA 3OY9A 1WGXA 2BW3A 3GFLA 4IHTA 2L4MA 2ESNA 2FF4A 2F6CA 5FKKA 3SDGA 3SZTA 4XRMA 3S93A 3BR5A 2E1NA 5C3EJ 1L0OC 4BEHB 1SVLA 1U5TC 2ELKA 2E5ZA 1T0FC 2FE3A 3E6CC 1KQ9A 4E7ZA 4KYWA 4E7HA 4ZYHA 5K7HA 2STTA 3I59B 1DP3A 1Y39A 4S04A 2LFBA 4R79A 3Q0UA 5F0HA 3VWBA 2XF7A 3ZCOA 1VQPI 2JSPA 1ZR2A 2HVSA 3K70D 3WODF 2RQPA 5CQEA 3RKQA 3K2AA 3L00A 1IG7A 4B3XA 2E2IJ 3KLNA 3B02A 1O7FA 2H1LA 4XMYA 2O3FA 5ICEA 2PMUA 3L1PA 1EKEA 3IKTA 5D5XB 1JT0A 5CVIA 1OMIA 4M74A 1LE8B 2HR3A 2QBYB 1X3ZB 3MZ8A 4RM3A 2EIKH 2LRDA 3BG7A 1A31A 4XL9A 2HQAA 4E7KA 5HDNA 1BIBA 1MSEC 4X6AJ 4H4KC 4YIIA 5EF6A 3FK6A 1D8JA 1BI0A 2MD0A 1W5CC 2XV4S 2Q2EB 1H9TA 1SAUA 1O4XA 3GZ5A 2X1EA 1GV5A 4AM3A 3H3ZA 2EH3A 1IRGA 5BPDA 4IRHA 5IY5H 2IRFG 1D3YA 4LG3A 4ESBA 3TMOA 4IZZA 2O7OA 3DBHB 4HDVA 3FHZA 3F72A 3GO5A 4BHCA 3CC2I 1B8IA 5DUIA 2HDDA 5FRNA 4MQ9F 4NQWB 2VQHA 2L9VA 2TCTA 3W6KB 2LLKA 3BG5A 1K7AA 3L2CA 5LD2C 1MMDA 1ETQA 1WJFA 2K27A 1HCRA 2EWNA 2PFBA 2DK8A 3M4OJ 2JPBA 5GTIC 5H20A 3W6JB 4BJ5C 3J7AY 1K61A 4AIDA 1FY7A 5LRSA 2HOTA 5GPCA 1JHHA 2IA1A 1K4TA 1YRNA 1REPC 2V1NA 2VQGA 3EDPA 5M5XJ 3TW6A 1J7KA 1OQYA 5K5RA 3CO7C 3MKWB 1QU3A 4KT5C 5CKTA 4UUTA 3J81K 3I4PA 5L3CA 4BE0A 3KP6A 2GBYA 3K1MA 2MD5A 3OYBA 3H5NA 1TWHJ 2X6XA 4C30A 2DA1A 4N9IA 2XRLA 5AIPA 6PAXA 4GCVA 1UG0A 3E1SA 2HNHA 3I3LA 4CUGA 3OYCA 5GP9A 3ERMA 2X9DA 5HNFA 3P5JA 3BOQA 3PM1A 5LFAA 1YO5C 3GCMA 2G7HA 4I7HA 3ABUA 2Y0SA 1S7AA 2ZJPF 1YS7A 2JSCA 2V4JC 1OCTC 3BCBA 1LKXA 3UR3C 2LY2A 1R1UA 2OQGA 2VOPA 1V54H 1IZ1A 2Q1ZB 1XSVA 4FX4A 4DYQA 1E17A 1QRYA 2WY7Q 2IS6A 3L9FA 1W36C 4RB0A 4CXFA 4W1UA 2JN6A 3RPUD 3DBLB 1FOXA 4P55A 3CLOA 2M7BA 1GUUA 2K9SA 1OPCA 4I76A 2QSHX 2QQAA 1Y8QB 4XKCA 1TQPA 3GW2A 5E79C 2QQ8A 4I99C 2F4MB 3KYCB 1Z7LA 2HDWA 3HL2A 4EM1A 2NAZA 2KKOA 3CDLA 4HLYA 1OR7C 4LJZF 4XKBA 3CUOA 2A5WA 1PUFA 4LG0A 3HUGA 2ISYA 3F22A 1B6AA 4PJJA 2CH0A 2RNGA 2X1CA 3GLLA 2L2OA 3CCQI 2L54A 3A0HC 1ETKA 3C18A 3BC8A 1FC3A 3G2BA 1NHAA 3LMMA 2HTSA 1ORKA 3D5LA 3FXMA 4ZYDA 2CU7A 4BXUA 3JTGA 1F43A 2FXAA 4LG0B 2R93J 3BZ6A 1KYWA 1UAAA 2Z9OA 3GTGJ 1LVAA 2W1OA 2XDVA 4G7OF 1MGTA 3PIPF 1ZRFA 3M1CA 3ZPLA 2HWVA 2NOJB 3ZN1A 1QZYA 4BE2A 3F8FA 2W48A 3CTAA 1U5TB 2FMYA 3CP2A 3WE2A 1UHMA 3HRUA 2QYOA 1FZPB 2G9WA 2O03A 2R7FA 2YU3A 3DEEA 4C3JJ 4O3MA 4ZH4F 2W25A 3S3NA 3BTJA 1MH4A 2YX7A 2K85A 2PEXA 1VTNC 2M5WA 3VFZA 2PJRA 2VC0A 3HOVJ 1G59A 4BL0B 3HGYA 1GXQA 3ZMDA 3I5UA 1LEAA 2PG4A 5JVGF 5J8CA 4B8XA 2VE8A 5A2QK 3TP3A 5E17F 2XIGA 2LREA 3F8MA 1Z9CA 1NTCA 3TW7A 2R0QC 4FE7A 2HU9A 3WTUC 1QQIA 2PJRB 4BY7J 1BR4A 1XDSA 2DK5A 1BIAA 4FASD 1E2XA 3IC7A 1JKRC 3I58A 4N0BA 3P9KA 3F0CA 1P92A 4A3KJ 3QPHA 3NARA 2M0CA 1IDYA 2GA1A 1VQ4I 1CF7B 1WFXA 3HSRA 4BS9A 2DPUA 4A3EJ 4PJ0C 2E1MC 4Q48A 4PFPA 2IBDA 1YYVA 1P6RA 2XGEA 4M73A 3WU1B 3RI4A 2DLLA 1Y8RB 1ZG3A 2FNAA 2IJLA 3PFIA 4U0WA 2QKLB 4RGUA 2R5YA 4FHTA 1U0JA 2IT0A 1SFOJ 1IJWC 3H92A 1SFXA 1QA6A 3TO7A 4EJOA 2GXBA 3OOPA 1JUMA 4KNYA 4I0AA 3BJAA 1WVRA 5BNGA 1OFCX 4Y52J 4A3JJ 2Z33A 3VPRA 2K4JA 2E19A 1PDNC 3EYIA 2DMTA 1MBFA 2X48A 3GLXA 1AU7A 4HG2A 2EFNA 2EZKA 4BKXA 1YTYA 1Q1VA 3O8GA 2DA5A 2LR8A 3E6DA 3KP5A 4KT6A 3HKZA 1BR2A 2F4IA 3JSPA 3QAHA 1JI8A 1IRFA 4JQFA 3E5XA 2D45A 2OCCH 4ZZLA 3Q0WA 1YW7A 3BQYA 5GAEJ 4MIMA 4HSRA 4X0GA 1STZA 1FIAA 1LDDA 2H09A 1O3SA 4BYYA 3LSTA 3VSLA 3RJPA 2E35A 4IF4A 1RUNA 3LNQA 2ZFWA 4XLPF 1WPKA 2KMUA 3L2RA 5TISC 2LBFA 1FBUA 2OU2A 2ID6A 2IPQX 2Q0OA 3CLQA 4JYKA 4IO9F 3H0GJ 1O3QA 2XKPA 1ERDA 3EETA 4M3FA 5DD8A 1V5FA 2AQFA 2DYSH 2PJPA 3HSEA 4NC7A 5H6QA 5F0FA 2D5VA 3QPSA 1R5ID 4XSZF 3U1DA 1GXPA 5FB2A 2NRAC 3OYNA 4XNFA 2YR2A 1FT9A 2WB1N 3QOPA 1VQ8I 1I6HJ 2CW7A 1B9NA 2JTVA 1XTAA 4MLOA 3GYHX 2R7ZJ 1TC3C 4OMZA 4UV8A 1N75A 1JUSA 3H0DA 3CD6I 4IVNA 2HYGD 5CVJA 4M71A 1IC8A 2L9SA 3FIWA 1MDMA 2QCOA 1FX7A 1G3WA 2ZB9A 4Q4ZF 1OJLA 3HOYJ 3K4MA 4IXAA 4KISA 2V9VA 3FMQA 5BPIA 2CUZA 2MG4A 5FLVA 5EG0A 5CJ9A 4RS8A 1SANA 1FOWA 2CQNA 1HXDA 4JX5A 1X2NA 2V7FA 4XLNF 3HJEA 1QZZA 3JRFA 4OMYA 4YFKF 1HF0A 3ISPA 4I98B 3CC4I 2XAFA 3AAFA 1S29A 4Y13A 1VF9A 5D4SA 2R92J 1UB9A 2XF6A 4S05A 1YJWI 4PSXA 2VI6A 3M8FA 1OYYA 4CYDA 5EG0B 1HLVA 2CV0A 2JRTA 2OTJI 2RAEA 5K5QA 1TT5B 2FQ4A 3CF2A 2ZXIA 3DU5A 2ZMEC 2FEZA 2P6SA 3R61A 1PJRA 3L7WA 3HZJA 1WKMA 2EV5A 2WWYA 3AG2H 3ZQHA 1A35A 1T38A 3BLYA 2BHYA 4G9YA 4DW6A 2XGDA 2Z16A 1JHFA 1IN4A 4AVPA 1KZHA 2XKOA 4KN7X 1R49A 2CS3A 1PP7U 4PGHA 4HDUA 2WV1A 1ENHA 2AQEA 3M7GA 4OAZA 3CCLI 5HLHA 3BG9A 3BQZA 3HHGA 4L9TA 4I01A 3DLLF 5BS6A 3SZGA 2XPWA 2AXTC 2D2WA 3GUDA 1DPRA 3ECHA 1B9MA 3QP6A 4XQFA 3FXKA 1MW7A 3SQNA 1W5TA 3JREA 3WHCA 2RGVA 4R1HA 3ZXSA 2R7SA 4HF1A 1VQKI 2AHQA 1I50J 4EJTA 2BEOA 2LH9A 2O5RA 1TWFJ 4IRGA 3KP7A 3TO9A 3J80K 2PBIA 3OR2C 1PP8F 2V6EA 3FM3A 4EEFG 4UVBA 1W7PD 2HPIA 1BA5A 4DOZA 3K70C 4IOCF 4C2MJ 3IKVA 2Z2SB 4AC0A 3OYFA 1J9IA 3D0SA 1DPUA 4BDYA 3BDDA 2VXZA 2B63J 4P9FA 1OYWA 1QBJA 2ZXJA 2IP2A 1K6OA 1DU6A 3LQRA 1LFBA 2DFFA 1F9NA 2L7MP 3HOUJ 3H9JA 2VIXA 1DDNA 2DT5A 2M8EA 2BY3A 4MTEA 4CA0A 2QGUA 1RR7A 1K78A 1WJBA 1Z3XA 3T0YA 5J4YA 3JAMK 3N05A 3LWFA 3R4KA 1XD7A 4OAYA 5LGUA 1LEBA 2FSWA 2H1KA 4CYCA 4KITB 3CJQB 4QTRA 3J7AO 5D8KB 3BZCA 4DNCA 2E1MB 3R6SA 1RZ4A 2L5QA 1XN7A 5K7FA 4A3FJ 3RDIA 3LA7A 5KCMA 3GZNB 5CQGA 1WJ5A 4BGDA 2GOXB 3A03A 4B48A 1MH3A 4BJTA 3S1QJ 5ICFA 1K78B 3ZQ7A 2E34A 2P7VB 4KFCA 3K4NA 3PNYA 4QSHA 3TDZC 2KRFA 5D6EA 3IP4B 1B4AA 4BDZA 3S3MA 3TOBA 1H88C 2AXLA 3U21A 3GMEA 4GYIA 2VBXA 4D7MA 4XR6A 3HRSA 4RAYA 4OIRF 1F36A 2OC6A 3KFWX 1XSXA 2XASA 1NK3P 2HOAA 1Y0NA 2DTZA 2CQXA 4AIHA 2XROA 1HDDC 2CYYA 2CJJA 2MC3A 4CCNA 4E7SA 4AU7A 4RDUA 1EH7A 5E1WA 1D0ZA 3U9GA 3JRHA 1EF4A 3HRTA 2KJBA 5EGOA 3KP4A 5BMZA 2Z3YA 3BY6A 2E36A 5E3LA 5L3EA 2O9LA 1ZAOA 1GVJA 4IPAA 2EFPA 4NDLA 3KIOA 2X1DA 4A3GJ 2FNPA 2IS2A 1U9OA 4PDKA 4XIDA 3WGIA 2LKXA 1MNEA 1Y0UA 3QU6A 2FRHA 3R0AA 4F52A 3T8TA 4B4CA 5L3FA 1HDPA 2HQRA 3CMEI 1MMSA 3DFGA 1O57A 3HXLA 3CMAI 3RPQA 1ODDA 1BM9A 2KHMA 2MGQA 3FXOA 5CLSA 5FLXZ 4NBQA 2NXNB 1H9GA 2KRCA 2QKMB 1CQTA 2VJIA 3KEYA 2FX0A 2HQNA 3OIOA 2AO9A 1BC8C 4W97A 3ABTA 1YJ9I 2O8XA 1YHQI 4NB5A 2O6GE 4U0YA 3RZDJ 2EZHA 2VC1A 2ZJRF 3K4KA 4XN0A 2M1BA 1PYVA 4YIRX 4GDFA 3WTTC 2F5EA 5DV5A 1ZGWA 1RKTA 4RAZA 4FCYA 4PFOA 1QVUA 5KK1A 3JRCA 1ZG5A 2QQ9A 2FBKA 2NYXA 3GZ6A 5C44J 4I09A 2VODA 1QHHD 2CUJA 1IUYA 1SAXA 2CFXA 1J5YA 1X1DA 4M9XA 2HS5A 2UXXA 2AS5F 1B1BA 1B59A 3KYLA 3K4LA 3F3XA 1R6RA 3ASNH 1BI1A 2ZMEA 3DTKA 3NWTA 3JRDA 3CCEI 1UELB 2DOFA 5IOZA 4G6QA 3SDBA 3VOEA 1J59A 3OWTA 1Z6RA 2ZC2A 3M3YJ 1P2FA 3A01B 2HXOA 5IYBJ 3N4MA 2K4BA 1U9NA 3Q0VA 5DTDA 3J7YJ 4NNJA 2Y9YA 3OMYA 4WF2A 4IX7A 2BW3B 4JP0A 4ZJZA 4QIWN 1DQUA 3PO3J 3PUFA 3DEWA 2HFHA 4HF0A 4OWRB 3LSRA 2XF5A 1OLTA 2EFOA 3GTKJ 2OAZA 4JX4A 2A5YB 2NOGA 5HS9A 3BR3A 1R23A 1U8BA 4J00A 3OYMA 2OUMA 2XRNA 3BTLA 4UUSA 2B7EA 4M6VA 2GLOA 3TBIA 4O6JA 4L9NA 3LL7A 4CO8A 2M7AA 3E5QA 5HS8A 2UUZA 3BPXA 1TLHB 1X4OA 4ZTJA 3IH3A 2XAQA 2EZIA 4PGGA 4WWCA 3QPLA 3K1PA 3ULQB 2YUSA 5J1YA 4A12A 1S6LA 3S8PA 4L18B 2K7LA 2EK5A 4E7JA 4XOTA 1POGA 1Z67A 2Y31A 1TWGJ 2EV6A 3HRMA 3GWZA 5IP7J 3WTXC 1I27A 2Y30A 3OL4A 2FJ1A 2DN0A 3E3VA 3O3KA 2J5PA 4RA2A 2GIVA 1EA3A 5AONA 3HYIA 3ZQIA 1TQIA 4Y15A 5J6XA 1IF1A 3H5RA 4FISA 2DT7B 1Z21A 2VKVA 3LSGA 5KHDA 3OYEA 3V42A 5IT9Z 1R58A 1JGSA 3FK7A 2IGOA 5IOYA 1LPQA 2VOOA 5CPRB 3RQ4A 3CMYA 1BOBA 3OIPA 5J40A 1J2XA 3PUBA 2R7XA 3A1YA 4CICA 1B8IB 1O3TA 3LSIA 3W2AA 4V19K 4D9JA 3F6VA 4GFBA 3ZQLA 4Y4RA 3G1MA 2VPLA 2LKPA 4ESFA 4LIVA 1G3TA 4RAGA 2R7RA 1FWZA 2KL4A 1JXSA 4N4NB 4L0ZB 3K4JA 1RUOA 2ME6A 1WQ2A 2X6WA 4NUBA 1SVMA 3MAJA 2DQRA 5ICGA 5HLIA 1I5ZA 1JE8A 1TNTA 2JA5J 2XAJA 4CZZA 2MBFA 1A04A 2V26A 1YRNB 3GEZA 2L7ZA 4Q5SF 5HOOA 2LOOA 2LK2A 3RSNA 2EA2A 3DKWA 2VT3A 4F93B 3ELKA 4ENJA 1R71A 1IV6A 1YE9A 5LHIA 5M5WJ 2P7CB 5LHHA 5E18F 2CQKA 3FDYA 3K2ZA 3DQVC 4M3BA 1JKOC 1WH5A 4KDPA 3VDXA 2KLOA 3CP8A 4ON0A 3F6OA 4C3IJ 2DA6A 4PSWA 3S2DJ 2PI0A 3CESA 2ECCA 3I4MJ 2HKOA 1G2HA 1QHGA 3LSJA 4BQOA 3ERED 3FBNB 3BPVA 2WB1A 3OYAA 1T2KA 3U2RA 2H8RA 4WXCA 2E1OA 3CCRI 1LFPA 2A3SA 3G71I 3IAM2 1GV2A 3T1BA 3PO2J 1YLFA 1YW8A 2L7KA 3ZQCA 4ESJA 1R5HA 4JK1X 2XC7A 2VJ4A 2GIZA 2DOEA 2VASA 1IAWA 1FSHA 1RPWA 4HX7A 1TWAJ 3ESWB 4OINF 4AVZA 3HTSB 3LAJA 2OTLI 3FF5A 5ILVA 4I2OA 2VJJA 2DMUA 2EV0A 3C2BA 3ZQFA 3BT9A 2PN6A 1BI2A 4CDGA 3BROA 4NHJA 4N4OB 5FD5A 3K1NA 3OYJA 4ZTFA 4HX4A 1XGMA 3S2WA 3CUQA 4XRSA 1T08B 1KU2A 3RPUA 1E3OC 4YRVA 1KONA 2R5ZA 3H9QA 3TDUC 3OYLA 3SFZA 4U87A 1SD5A 4CH7A 1LFUP 4BXXJ 3E97A 2W7NA 3S1RJ 2B0LA 3ZGKA 4BQAA 1QPIA 4FTHA 2HZDA 3HGGA 3MKYB 3ZN0A 1PUFB 3HUGB 2COBA 4G7HF 1MBJA 5JHUA 4HZFA 2EBIA 3ZR8X 3HOXJ 1LQ1A 5HNHA 1N25A 1F4KA 3FMRA 5H2FC 2ZJ2A 1RI7A 5E3NA 1R4NB 1S9HA 5GPAA 5B3SH 2EFWA 4A3IJ 2ZO4A 2YS9A 1YI2I 3BCAA 5K5OA 2KFDA 2X0LA 2MH2A 4EV0A 1BOAA 4KIGA 3MEXA 1JTXA 1FEXA 1XS9A 2W57A 3HG9A 1FBQA 2OQRA 2M45A 3DV8A 3GTJJ 2PMHA 5KAFC 4XOPA 3I9V2 1GVDA 5K1YA 2P81A 4FQGA 4E70A 2CQ7A 1BJZA 1TW2A 4UHTA 2QENA 2JUGA 3K4CA 4BHBA 2OA4A 2E71A 4HBLA 4PCQA 2K9MA 3RCOA 1USSA 5HLTA 5LEJA 2DTRA 3FISA 1HA8A 4ASNA 2F2EA 3GF2A 3B6CA 4IHYA 4B09A 2CV1A 2WC2A 1G6NA 4F92B 2M30A 3DKXA 4QPOA 1VQMI 1X1BA 4FE4A 4M3GA 5LRRA 5D5UB 4G7ZF 2IGKA 5FLMJ 1ZLKA 1K4SA 1MNDA 1IDZA 1RETA 4EGYA 1P9QC 2CW0F 3DF8A 4LMYA 1M1EB 2GA2A 1FYMA 1XX5A 4LFUA 1D0YA 4KJZA 5F27A 4LLNA 1XG1A 5JFRA 1IXCA 2XGXA 4DIQA 2RQQA 3PNTA 3OYIA 2QSFX 4ENNA 5FROA 5L3GA 2LVSA 3ZMSA 4GYGA 3FKJA 3QQAA 3HTUA 3SEQA 3ECOA 2VN2A 1Z7UA 1R00A 4UB8C 2HDCA 2F4OB 4BAYA 3K69A 1SFUA 2R5YB 4MHGA 1YFHA 1NH3A 3J7ZI 3ABLH 3S15J 4A3BJ 3CCYA 2WBMA 1T8IA 1UHSA 1S8NA 4E4HA 1D5YA 2PX9A 4CCOA 3RYPA 5J3LA 2XB0X 5D5WB 3H35A 4A0YA 3I4NJ 3LAPA 3C3WA 1S7EA 2VKHA 5JI6A 3JSOA 3N97A 1VQ9I 3GTOJ 3JRGA 3TO6A 1I1SA 2W84A 2JRMA 3C2GA 3U1KA 4A69C 1QNTA 4HSTA 4AYBN 3WG7H 4WXDA 1CGPA 1AWCA 3TOAA 2ESHA 1FP1D 4JOMA 3T8RA 3UKGA 5TGTA 1IW7F 1TWCJ 1LJ9A 3NEUA 1TZLA 2CFOA 2DA2A 4C2TA 2LY9A 2E7WA 2HVQA 2JVHA 2ZNZA 3CJNA 1W36D 5J1RA 3B73A 4A5NA 2W4SA 3HPHA 2LDUA 3LSHA 3G1OA 4DZPA 3GFJA 2ID3A 5ICCA 2LBFB 4XLCA 2A6EF 1D5VA 3REOA 4HNTA 3LSPA 4Q47A 4IHWA 2VPRA 1SMTA 4ABZA 4QLCU 5EZGA 3BR0A 3QU3A 1ZGJA 4UB6C 2Y48A 2FBHA 3E0JB 4D5CA 4AD9A 3ML6A 3Q5FA 2RN7A 2M3AA 2X6YA 1WRJA 2QM3A 2DW4A 2HTJA 1B72A 2ECBA 2I8DA 4BNCA 1XCVA 2YSRA 4E7IA 2BBYA 3FBIB 5AIQA 4RGRA 4G6DA 1WJCA 2Y69H 1TNSA 2LYCA 3NRVA 5DUKA 1MDMB 4C2UA 2IS1A 2EFQA 2EJRA 5CYVA 2VLAA 4RBOA 3DTIA 2WAEA 1B72B 4MO7A 1MJBA 1U8RA 1YIOA 2QQBA 4BY1J 4J19A 3GTLJ 1RRJA 1ON1A 3BTCA 2BY1A 1OYIA 3OS0A 4F91B 4HV6A 3S1NJ 2YPRA 3MWMA 4LB5A 1AKHA 3PQKA 2DOAA 1USTA 4N9HA 4OIOF 2EPFA 4EGZA 3WHBA 2JK3A 4LLLA 1HW2A 2F5FA 2Z99A 3PSFA 2CWEA 5DS9A 2QWWA 1NK2P 3CDHA 2P8TA 5CVRA 3OSGA 5LEKA 1YW9A 4IKFA 4CCKA 3HOTA 5E8IA 1RC9A 3BG3A 1K6YA 4Y7NJ 1VQ6I 1K83J 4JX6A 3LOCA 4Y17A 1GLNA 5BOXA 1FPQA 1SVOA 1ETVA 2V6CA 3K6GA 1ON2A 2A6TA 1G4DA 2E2JJ 1VQ5I 3MZYA 3PJRA 2LMDA 3M1EA 1QO0D 1LDKB 1XPXA 1VNDA 4WXHA 3OR1C 2LF8A 2R3SA 3H36A 5IP9J 5JR3A 3VB2A 1J09A 3DKYA 4BUPA 5B1BH 1U2WA 2XVCA 3K7AJ 5FJ8J 2MLGA 1T6SA 1D8KA 1HQCA 2WADA 1YIJI 1P4XA 3LQQA 3FXLA 2NVYJ 2CRGA 1MBKA 3K9TA 2V9KA 3SYTA 4B47A 1V3FA 1PUEE 1ETOA 4KUMA 4B3AA 1DGWY 4RMNA 5KNLA 5ILUA 3WTSC 3OYDA 2JA7J 5FKLA 2C6YA 3KETA 2KDZA 4V2GA 1ZRDA 3GTPJ 1ZGAA 2DDAA 2OBPA 3KX2A 1DU0A 3AG1H 2CUEA 1J75A 2DA3A 3VSKA 4ZYEA 2BVLA 2VBYA 1GHCA 1JUPA 1VFCA 3S17J 1E0EA 4HEA2 1XGOA 4U0VA 3CCJI 3LFUA 2I5UA 2P5KA 3ZMZA 3GVAA 4U7DA 1HSTA 3F21A 4GRIA 3L2VA 4UY8I 3I71A 5ED4A 3CCUI 3ASOH 3WTZA 3S32A 3EUAA 3ZMTA 4IQJA 4CYCB 3IH4A 5GAGJ 5HODA 4L5EA 4UVCA 1UFMA 2NNYA 2IA0A 5DCFA 2Q8KA 2DJNA 2MC4A 5DCMA 1YITI 4MEYF 1BL0A 3DXJF 3JRBA 3AL0C 1UZCA 2V1XA 2V79A 1TBXA 1V5EA 4P9UA 2HPMA 2MFZA 4HNUA 2BXZA 2F5VA 2DO7A 2XAHA 2VXDA 5TJJA 2MA3A 4M3DA 2NS8A 2DMPA 1XB4A 1QZEA 4I6ZA 5EEHA 3FHNA 2DYRH 5GADJ 3E5UA 5DDGA 2ISZA 3QRFF 4UVAA 1ZRCA 2IAIA 2DQLA 2BHZA 2GOMA 1MMNA 2P4WA 1TP4A 3FXJA 1HKQA 1S72I 1MJAA 1R1VA 3F8BA 2E60A 3NWSA 1H0MA 1MSFC 4DQ2A 2BYVE 4KMFA 2VONA 4EM2A 3WTVC 2JPCA 5EGOB 2R7TA 5H6RA 2IVMA 3SZPA 2KPMA 4AUXA 4CSWA 1FP2A 3CCSI 3OL3A 1VQNI 1EJ9A 3V8LA 2BY0A 2L01A 1IN8A 2KQRA 2LC2A 1QGPA 2CMPA 2VQLA 3DPUA 2E7XA 3RIRA 1MJ9A 1X58A 2A07F 2K40A 2R7OA 1X3WB 1RR8C 3GX4X 4KA4A 2YU9J 2JT1A 3IH2A 1KU7A 4MEXF 3MVPA 2OZUA 1X2MA 2DXIA 2KT0A 2BY2A 4PUSA 4P1WA 3O6BB 3MCZA 3KZZA 3VYTB 5E3MA 2ZFUA 3OYKA 5E8GA 1BW5A 2M2EA 1R5GA 3CZ6A 1SFEA 2DMQA 3CJTB 3O8HA 4DGWB 2V1UA 1Z05A 2QUFA 2GXAA 2F48A 1I6XA 3KLOA 2WA0A 3CUQC 3QPTA 2QVOA 4KIBA 2ZXHA 3TKYA 3GTQJ 2DJIA 2GXGA 1ZELA 3ROUA 5JLWA 5FGMA 3ZOBA 3BR2A 4M9ZA 2NVQJ 4OIPF 2HVRA 3HOWJ 1UHWA 4UV9A 5B66C 1ZARA 3OS1A 1LB2A 3J81Z 3G1LA 2Z1DA 1YG2A 4H0EA 4F7ZA 2M34A 2VBZA 2VB6A 2BOLA 4RB3C 4BEHA 1AA7A 1MKMA 4HOBA 4LOCA 3I55I 2BVMA 5JLXA 4XBFA 4BH9A 2CG4A 1XGSA 4DBQA 2ZMEB 2OD5A 2HZTA 4LK1F 4QPQA 4LITA 4BHPA 1JTYA 3I59A 1R7JA 2JA8J 1FJLA 4QWQA 2D1VA 1GDTA 4XN3A 2XAGA 1TQMA 4IEJA 4LB6B 4YELA 1MZBA 3V8KA 3S2HJ 2LY1A 4U7BA 1X3UA 2WY8Q 1TT0A 1W0UA 2LSOA 1MBHA 3L09A 2NS7A 2VJ5A 4U88A 3RKXA 2A61A 4JBAA 4Z6YA 4WK8F 3NAUA 1YJNI 1N78A 1EH6A 5E1ZB 3A4CA 2NVXJ 2L9NA 3BTIA 2BE5F 4D7NA 1LVKA 3JRAA 5HLGA 1OCRH 3LSKA 5IYDJ 4ZYGA 2DI3A 1LE8A 4DJAA 2QBYA 2RKHA 2HOSA 3FMSA 2XB5A 2Y2ZA 1ONVA 3S16J 1Z3YA 2COMA 4D5FA 2JUCA 4TV7A 1G3YA 1A6IA 2GQQA 3SJMA 3H1CA 3M8EA 4UUSB 1ETWA 4HPQA 4F55A 1MNMC 2DDBA 4PJLA 2E2HJ 1HC8A 2PMZN 1QPMA 2P0WA 3ZMUA 4CCMA 3OYGA 2DFIA 3G6EI 1U78A 1WI9A 2Q2EA 2L9RA 2R7DA 2VBWA 1ZHFA 3SFIA 1KA8A 2KDOA 1P7IA 2G0EA 1RKWA 3PFYA 3P7NA 3G4SI 2H6BA 2KJCA 2FUG2 1XDUA 2DODA 1WJDA 2W85A 1ZYRF 3W3CA 2IA2A 1KU9A 4BQNA 1ZK8A 5E20A 2QA4I 2ZCWA 4NQWA 3HBLA 2FD5A 2R4GA 4WX9A 2XGCA 1PVEA 1VI0A 2H8WA 2A68F 2DFHA 1VZ0A 2VKEA 3A02A 2HYJA 2W00A 3DWLE 3B6AA 1BC7C 3VEPA 4YG2F 4MNUA 1RIOH 5FLXK 3CCMI 5DM7F 4MFDA 2DU9A 4XKWA 4EVIA 3CQZJ 4PJNA 3IRQA 2MH9A 3T5XA 1XCBA 1DUXC 3QWLA 3F23A 2B9SA 5LBQA 1RESA 3WTWC 2BGCA 2JMWA 3KZYA 4RGSA 1IN6A 1H8AC 3F9KA 5DYMA 2MABA 2DMNA 3QYFA 4L9VA 5ILSA 4MQVA 2O8KA 2VT2A 4EJUA 5M3FJ 1XC5A 4AYBA 4I0BA 1MMAA 2UXNA 4K2EA 1D1AA 2X51A 3JR9A 3AL0B 5J47A 2LTPA 5F1RA 4XRSG 4BU2A 5A2QZ 1XSDA 1WWXA 1F5TA 1WHUA 4PJMA 4XONA 2QZ8A 2RDPA 2TDXA 2V9PA 2FQ3A 1BBYA 5F64A 4HX8A 5DM6F 3V7SA 4ITVA 2M9HA 3F8NA 3G73A 1LDJA 1T56A 4EQQA 3BG6A 2CO5A 3M07A 4ETSA 1Y56A 5D8LB 1ZH5A 4HRIA 1IV8A 2HXIA 3FXRA 3MFKA 4HLXA 3M9AA 4NC8A 1VQLI 2R7WA 5C4JJ 4M9SA 4IJAA 3PQJA 5JHFA 2JQ7A 1A5JA 2Z5UA 1WJAA 3DCFA 2KIMA 4GXOA 3SEZA 5LGNA 2JA6J 2FBIA 1FLIA 4CCLA 3V7RA 4A5MA 2ELJA 2H94A 3EUHA 1SEUA 1D0XA 1N77A 4DYCA 3EYYA 4A6EA 1I1GA 5HVQC 4FETA 1R22A 4OU0A 1W5SA 1V55H 3ABMH 2N8GA 1U3EM 3K0LA 3IV5A 2W24A 3WGGA 1DP7P 1X19A 1S5LC 1A6QA 3E7LA 4L9JA 3CC7I 2M87A 3LA3A 1FSEA 3VODA 3F8CA 4IRIA 5D5VB 1HW5A 4XLFA
chains in the Genus database with same CATH topology
3NQOA 1BI3A 1L3LA 1UCRA 4G8XA 3GFIA 1BN5A 1SD4A 2IW5A 4YFNF 2JZYA 3QP5A 3R60A 1SMYF 5FFZA 1KQ0A 3CUQB 4EM0B 4Z2YA 1WSUA 2UWMA 1P4AA 4GO1A 2DBBA 4O5VA 2ZBKA 5IT9K 1KGSA 4I02A 1SD6A 3MQ0A 2F5DA 4RB1A 5HDGA 3BWGA 1U5TA 3ZP5A 1T0FA 2L02A 3BJOA 2GZWA 4HW0A 3IWFA 1W4MA 1XMKA 3GFMA 3IWZA 1R1TA 4HQEA 1TTYA 4P5OA 4WCGA 3I53A 2HGCA 1HKSA 3IHUA 1P4WA 3DPLC 4R8HA 3IL2A 2KIUA 3SXYA 4YIFA 3HIFA 4HV5A 4LGWA 1CF7A 1XMAA 1AOYA 2XHKA 3KCCA 4HQMA 1KYZA 5E1XA 3RTRA 3HHHA 4PZJA 3HOSA 2D1HA 3OV8A 2L4AA 2V1DA 2LNBA 2ACJA 1G3SA 4ENKA 3HSFA 1Z6TA 1U6GA 3FWEA 1ZLJA 3WTYC 3E6BA 4UXNA 5L3DA 2DPDA 4AIJA 5HS7A 2G7UA 4EJVA 3I64A 2O61A 5LLQA 2PQ8A 1HSJA 2VE9A 3I54A 3KP2A 1O3RA 3KP3A 1ZN2A 4D0PA 3C7JA 4ENMA 2HEOA 2RV8A 3DPTA 2J5OA 3P9CA 4EJWA 3KEOA 5D6FA 3J80Z 2NNNA 1IN5A 2MLKA 1YS6A 3V7CA 4RGXA 2NS0A 4FX0A 4KICA 2P5LC 1BJAA 1RNLA 5FO5A 2ADUA 3LA2A 3IRRA 1XGNA 5DD4A 1MD0A 2GWRA 1R36A 4HAMA 3BJ6A 1K79A 2RVCA 5LGTA 2A6HF 3WG9A 3MZHA 2HYFA 3RYRA 3WGHA 2BV6A 3JAMZ 4UNOA 1EH8A 5FFXA 3ZMVA 4P96A 3V4GA 4OIQF 2K86A 2EB7A 1V4RA 1FYKA 4HF2A 5LHGA 1OR7A 2FOKA 3KEQA 3Q9VA 1T39A 3H3UA 4HA8A 4A2UA 1F1ZA 2H6CA 5JVTA 3COAC 1KQ8A 3RKWA 2ZKZA 3JTHA 3DEUA 4KMUX 4XRFA 4OOIA 2L3DA 2Y0MA 3O2PE 4KIFA 5EEGA 2Y75A 3RKYA 2DAOA 5D4RA 2XUBA 5FD6A 2P6TA 1ZREA 4RB2C 4EMSA 2RNJA 3I0TA 4CHUA 3WU0A 2GAUA 5KVRA 2OZ6A 2YX4A 4M72A 4A0ZA 4CGZA 1HW1A 1FOKA 2ELHA 4A6DA 4ZZDA 1HKTA 1W7PA 2STWA 4UUVA 4M6YA 3LFKA 2ETHA 1FYLA 4GGGA 2EA4A 1SD7A 1S7OA 2K02A 4M6XA 2KIFA 2FA5A 2WTEA 3CO6C 1W7PB 5BQTA 1Z1DA 3C1DA 4AWXB 1OKRA 5L3BA 5IT3A 2F5CA 3FX3A 3V8JA 4AIKA 2HOEA 5J8FA 2FU4A 4IHSA 2CSOA 5CVVA 4XSXF 1IXRC 2ZNYA 4A0XA 1C0WA 3KE2A 3Q9SA 3G3ZA 5DCMB 3TQNA 1Q1HA 5TRDA 3P9IA 1ZG1A 1FNNA 1Z91A 1J0RA 3EQLF 3GXOA 2UZKA 4L0YB 3DP7A 3JW4A 4G94A 1YQAA 5HDKA 5F6FA 3FXQA 1HBXG 4L5JA 3BP8A 1ULYA 3FM5A 4LLGF 4L5IA 4YFXF 1LNWA 1S3JA 2HKXA 1IXSB 5CVUA 1T98A 5DEQA 1KU3A 4KN4X 3WE3A 1FBSA 2A69F 5ERIA 2LF7A 2RC4A 3TGNA 4HYEA 4LD5A 2O0YA 2P5VA 2FMLA 4FT8A 2H27A 2WV0A 1EV7A 1O7LA 1TW3A 2CGPA 4MGRA 4LK0F 3R0JA 4MTDA 1IN7A 2E1CA 3SHFA 3FZVA 2PLYA 2X4HA 3FXUA 2QLZA 3E6MA 3GFLA 4IHTA 2L4MA 2ESNA 2FF4A 3SZTA 2E1NA 1L0OC 1U5TC 2FE3A 3E6CC 1KQ9A 4KYWA 4ZYHA 2STTA 3I59B 4S04A 4R79A 3WODF 2RQPA 3L00A 3KLNA 3B02A 1O7FA 2O3FA 5ICEA 2PMUA 3IKTA 5D5XB 5CVIA 1OMIA 4M74A 2HR3A 2QBYB 5HDNA 1BIBA 4YIIA 1D8JA 1BI0A 2XV4S 1H9TA 3GZ5A 3H3ZA 1IRGA 5BPDA 4IRHA 2IRFG 1D3YA 4ESBA 4HDVA 3FHZA 3F72A 3GO5A 4BHCA 5DUIA 4MQ9F 3W6KB 1K7AA 3L2CA 2K27A 2EWNA 2PFBA 2DK8A 2JPBA 5H20A 3W6JB 1FY7A 5LRSA 1JHHA 2IA1A 1REPC 3EDPA 1J7KA 5K5RA 3CO7C 4KT5C 3J81K 3I4PA 5L3CA 3KP6A 3K1MA 2MD5A 4N9IA 5AIPA 6PAXA 4GCVA 3BOQA 1YO5C 2G7HA 4I7HA 3ABUA 1S7AA 1YS7A 2JSCA 1R1UA 2OQGA 2VOPA 1IZ1A 1XSVA 4FX4A 1E17A 3L9FA 4RB0A 4CXFA 4P55A 3CLOA 1OPCA 2QQAA 1TQPA 3GW2A 4EM1A 2NAZA 2KKOA 4HLYA 4LJZF 3CUOA 4LG0A 3HUGA 2ISYA 3F22A 1B6AA 2L54A 3C18A 1FC3A 1NHAA 2HTSA 3D5LA 4ZYDA 4BXUA 3JTGA 2FXAA 4LG0B 3BZ6A 1KYWA 2Z9OA 1LVAA 4G7OF 1MGTA 1ZRFA 3ZPLA 2HWVA 3ZN1A 1QZYA 3F8FA 3CTAA 1U5TB 2FMYA 3WE2A 1UHMA 3HRUA 2QYOA 1FZPB 2G9WA 2O03A 2R7FA 2YU3A 4O3MA 4ZH4F 2W25A 2YX7A 2PEXA 1VTNC 2M5WA 3VFZA 2VC0A 1GXQA 3ZMDA 3I5UA 1LEAA 2PG4A 5J8CA 4B8XA 2VE8A 5A2QK 5E17F 2XIGA 3F8MA 1Z9CA 3WTUC 1QQIA 1XDSA 2DK5A 1BIAA 1E2XA 3IC7A 3I58A 4N0BA 3P9KA 1P92A 3QPHA 2GA1A 1CF7B 3HSRA 2DPUA 4Q48A 1YYVA 1P6RA 4M73A 3WU1B 3RI4A 2DLLA 2FNAA 1ZG3A 2IJLA 3PFIA 4U0WA 4RGUA 4FHTA 2IT0A 3H92A 1SFXA 3TO7A 4EJOA 2GXBA 3OOPA 4KNYA 4I0AA 3BJAA 2Z33A 2K4JA 3EYIA 1PDNC 3GLXA 2EFNA 1YTYA 3E6DA 3KP5A 3JSPA 3QAHA 1IRFA 4JQFA 3E5XA 2D45A 4ZZLA 1YW7A 1STZA 1LDDA 2H09A 1O3SA 4BYYA 3LSTA 3RJPA 4IF4A 1RUNA 2ZFWA 4XLPF 1FBUA 2OU2A 2IPQX 2Q0OA 1O3QA 2XKPA 3EETA 5DD8A 2PJPA 3HSEA 5H6QA 3U1DA 4XSZF 1GXPA 5FB2A 2NRAC 2YR2A 1FT9A 3QOPA 1B9NA 2JTVA 3GYHX 4OMZA 4UV8A 4IVNA 2HYGD 5CVJA 4M71A 1MDMA 1FX7A 1G3WA 4Q4ZF 4IXAA 2V9VA 3FMQA 5BPIA 5CJ9A 4RS8A 1HXDA 4XLNF 1QZZA 4OMYA 4YFKF 3ISPA 4I98B 2XAFA 3AAFA 1S29A 4Y13A 5D4SA 1UB9A 4S05A 3M8FA 1OYYA 4CYDA 2JRTA 5K5QA 2FEZA 2P6SA 3R61A 3L7WA 1WKMA 2EV5A 2WWYA 1T38A 4G9YA 1JHFA 1IN4A 4AVPA 2XKOA 4KN7X 1PP7U 4PGHA 4HDUA 3M7GA 5HLHA 3HHGA 4L9TA 4I01A 5BS6A 2D2WA 3GUDA 1DPRA 3ECHA 1B9MA 3QP6A 3SQNA 1W5TA 2RGVA 4R1HA 4HF1A 4EJTA 2BEOA 4IRGA 3KP7A 3TO9A 3J80K 2PBIA 1PP8F 3FM3A 4UVBA 1W7PD 3IKVA 1J9IA 3D0SA 1DPUA 3BDDA 2VXZA 4P9FA 1OYWA 1QBJA 2ZXJA 2IP2A 1K6OA 3LQRA 1F9NA 1DDNA 2DT5A 2M8EA 4MTEA 1K78A 3T0YA 3JAMK 3LWFA 3R4KA 1XD7A 5LGUA 1LEBA 2FSWA 3J7AO 5D8KB 4DNCA 3R6SA 1RZ4A 1XN7A 3RDIA 3LA7A 5ICFA 1K78B 3ZQ7A 2P7VB 4KFCA 3TDZC 2KRFA 5D6EA 1B4AA 3TOBA 2AXLA 4GYIA 2VBXA 3HRSA 4RAYA 4OIRF 3KFWX 1XSXA 2XASA 4AIHA 2XROA 2CYYA 2MC3A 1EH7A 5E1WA 3U9GA 3HRTA 2KJBA 3KP4A 5BMZA 2Z3YA 3BY6A 5L3EA 1ZAOA 1GVJA 4IPAA 2EFPA 2FNPA 4PDKA 3WGIA 1Y0UA 3QU6A 2FRHA 3R0AA 3T8TA 5L3FA 2HQRA 3DFGA 1O57A 3RPQA 1ODDA 1BM9A 5FLXZ 5CLSA 1H9GA 2HQNA 1BC8C 3ABTA 2O8XA 4NB5A 2O6GE 4U0YA 2VC1A 2M1BA 3WTTC 2F5EA 5DV5A 4RAZA 5KK1A 1ZG5A 2QQ9A 2FBKA 2NYXA 3GZ6A 4I09A 2VODA 1IUYA 1SAXA 2CFXA 1J5YA 4M9XA 2HS5A 2UXXA 2AS5F 1B1BA 1B59A 3F3XA 1BI1A 2ZMEA 4G6QA 3VOEA 1J59A 1Z6RA 1P2FA 3N4MA 2K4BA 4WF2A 2HFHA 4HF0A 2EFOA 2OAZA 2A5YB 5HS9A 1R23A 2XRNA 4O6JA 4L9NA 4CO8A 3E5QA 5HS8A 3BPXA 1TLHB 2XAQA 4PGGA 4WWCA 3K1PA 3ULQB 4A12A 1S6LA 4L18B 2K7LA 2EK5A 3HRMA 2EV6A 3GWZA 3WTXC 1I27A 3E3VA 3O3KA 2J5PA 2GIVA 5AONA 3HYIA 5J6XA 1TQIA 4Y15A 1IF1A 5IT9Z 1R58A 1JGSA 2VOOA 1J2XA 4CICA 1O3TA 3F6VA 2LKPA 4ESFA 1G3TA 1FWZA 1JXSA 4L0ZB 1RUOA 1WQ2A 3MAJA 2DQRA 5ICGA 5HLIA 1I5ZA 1JE8A 1TNTA 2XAJA 4CZZA 2MBFA 1A04A 3GEZA 4Q5SF 5HOOA 2EA2A 3DKWA 2VT3A 3ELKA 4ENJA 5LHIA 2P7CB 5LHHA 5E18F 2CQKA 3K2ZA 3DQVC 4KDPA 4ON0A 3F6OA 2PI0A 2HKOA 3ERED 3BPVA 1T2KA 3U2RA 4WXCA 2A3SA 3T1BA 1YLFA 1YW8A 4ESJA 1R5HA 4JK1X 1IAWA 1FSHA 4HX7A 3HTSB 4OINF 3LAJA 3FF5A 5ILVA 4I2OA 2EV0A 2PN6A 1BI2A 4CDGA 3BROA 4NHJA 5FD5A 3K1NA 4HX4A 1XGMA 3S2WA 3CUQA 1KU2A 3RPUA 3TDUC 3SFZA 1SD5A 3E97A 4BQAA 2B0LA 3ZN0A 4G7HF 5JHUA 4HZFA 1LQ1A 1F4KA 3FMRA 2ZJ2A 1RI7A 2EFWA 2ZO4A 5K5OA 2X0LA 2MH2A 4EV0A 1BOAA 4KIGA 3MEXA 2W57A 1FBQA 2OQRA 2M45A 3DV8A 2PMHA 5K1YA 4E70A 1TW2A 4UHTA 2QENA 4BHBA 2OA4A 4HBLA 4PCQA 1USSA 5LEJA 2DTRA 4ASNA 2F2EA 3GF2A 4B09A 2WC2A 1G6NA 2M30A 5D5UB 5LRRA 4G7ZF 1ZLKA 4EGYA 2CW0F 3DF8A 4LMYA 2GA2A 1FYMA 4LFUA 4LLNA 5JFRA 1IXCA 2XGXA 4ENNA 5L3GA 3ZMSA 4GYGA 3HTUA 3ECOA 2VN2A 1Z7UA 1R00A 2HDCA 4BAYA 3K69A 1SFUA 4MHGA 1YFHA 1S8NA 3RYPA 5D5WB 4A0YA 3LAPA 3C3WA 5JI6A 3N97A 3JSOA 3TO6A 1I1SA 2W84A 1QNTA 4WXDA 1CGPA 1AWCA 3TOAA 2ESHA 1FP1D 3T8RA 1IW7F 1LJ9A 3NEUA 2E7WA 2ZNZA 3CJNA 3B73A 4A5NA 5ICCA 2LDUA 3GFJA 2A6EF 1D5VA 3REOA 4Q47A 1SMTA 4QLCU 3QU3A 1ZGJA 2Y48A 2FBHA 4AD9A 3ML6A 3Q5FA 2RN7A 1WRJA 2QM3A 2DW4A 2HTJA 4BNCA 1XCVA 2YSRA 2BBYA 5AIQA 4RGRA 4G6DA 5DUKA 1MDMB 1TNSA 3NRVA 2EFQA 2EJRA 5CYVA 1MJBA 1U8RA 1YIOA 2QQBA 1ON1A 1OYIA 4HV6A 2YPRA 3MWMA 4LB5A 3PQKA 1USTA 4N9HA 4OIOF 4EGZA 1HW2A 4LLLA 2F5FA 2Z99A 2CWEA 2QWWA 3CDHA 2P8TA 5CVRA 5LEKA 1YW9A 3HOTA 5E8IA 4Y17A 5BOXA 1FPQA 2V6CA 1ON2A 1G4DA 3MZYA 3M1EA 1QO0D 1LDKB 4WXHA 5JR3A 2LF8A 2R3SA 3VB2A 1U2WA 2XVCA 2MLGA 1T6SA 1D8KA 1HQCA 1P4XA 3LQQA 3K9TA 1V3FA 1PUEE 4KUMA 3WTSC 5ILUA 2C6YA 3KETA 1ZRDA 1ZGAA 2OBPA 1J75A 4ZYEA 2VBYA 1GHCA 1XGOA 4U0VA 2P5KA 3ZMZA 3GVAA 4U7DA 1HSTA 3F21A 3I71A 5ED4A 3WTZA 3ZMTA 4UVCA 1UFMA 2NNYA 2IA0A 5DCFA 2Q8KA 5DCMA 4MEYF 3DXJF 2V1XA 2V79A 1TBXA 4P9UA 2DO7A 2XAHA 5TJJA 2MA3A 1XB4A 5EEHA 3E5UA 5DDGA 2ISZA 3QRFF 4UVAA 1ZRCA 2DQLA 2P4WA 1HKQA 1MJAA 1R1VA 3F8BA 1H0MA 4DQ2A 2BYVE 4KMFA 2VONA 4EM2A 3WTVC 2JPCA 5H6RA 2IVMA 3SZPA 1FP2A 3V8LA 2L01A 1IN8A 1QGPA 2E7XA 3RIRA 1MJ9A 2A07F 3GX4X 4KA4A 2JT1A 1KU7A 4MEXF 2OZUA 3O6BB 3MCZA 3KZZA 5E8GA 1R5GA 1SFEA 2V1UA 1Z05A 2QUFA 1I6XA 3KLOA 3CUQC 3QPTA 2QVOA 4KIBA 3TKYA 2GXGA 3ROUA 5FGMA 4M9ZA 4OIPF 1UHWA 4UV9A 1ZARA 1LB2A 3J81Z 1YG2A 4H0EA 4F7ZA 2VBZA 4RB3C 1MKMA 4HOBA 4XBFA 4BH9A 2CG4A 1XGSA 2ZMEB 2OD5A 2HZTA 4LK1F 4BHPA 3I59A 1R7JA 4QWQA 2D1VA 2XAGA 1TQMA 4LB6B 1MZBA 3V8KA 4U7BA 1X3UA 2LSOA 3L09A 3RKXA 4U88A 2A61A 4JBAA 4WK8F 1EH6A 5E1ZB 2BE5F 5HLGA 4ZYGA 2DI3A 2QBYA 2RKHA 3FMSA 1ONVA 2COMA 4TV7A 1G3YA 2GQQA 3M8EA 1QPMA 3ZMUA 2DFIA 1U78A 1WI9A 2Q2EA 2R7DA 2VBWA 1ZHFA 1KA8A 3P7NA 2H6BA 2KJCA 1XDUA 2W85A 1ZYRF 2IA2A 1KU9A 5E20A 2ZCWA 4NQWA 4WX9A 2A68F 1BC7C 3VEPA 4YG2F 4MNUA 1RIOH 5FLXK 2DU9A 4EVIA 3IRQA 2MH9A 3T5XA 1XCBA 1DUXC 3F23A 5LBQA 3WTWC 2BGCA 3KZYA 4RGSA 1IN6A 5DYMA 4L9VA 5ILSA 4MQVA 2VT2A 4EJUA 4I0BA 2UXNA 4K2EA 5F1RA 1XSDA 5A2QZ 1WWXA 1F5TA 2QZ8A 2RDPA 2TDXA 2FQ3A 1BBYA 5F64A 4HX8A 3V7SA 3G73A 3F8NA 1LDJA 4EQQA 2CO5A 4ETSA 5D8LB 1ZH5A 3FXRA 3MFKA 4HLXA 3M9AA 4M9SA 4IJAA 3PQJA 2Z5UA 5LGNA 2KIMA 4GXOA 1FLIA 2FBIA 3V7RA 4A5MA 2H94A 3EUHA 3EYYA 4A6EA 1I1GA 5HVQC 1R22A 4OU0A 1W5SA 1U3EM 3K0LA 2W24A 3WGGA 1DP7P 4L9JA 2M87A 3LA3A 1FSEA 3VODA 3F8CA 4IRIA 5D5VB 1HW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQO A;  1BI3 A;  1L3L A;  1UCR A;  4G8X A;  3GFI A;  1BN5 A;  1SD4 A;  2IW5 A;  4YFN F;  2JZY A;  3QP5 A;  3R60 A;  1SMY F;  5FFZ A;  1KQ0 A;  3CUQ B;  4EM0 B;  4Z2Y A;  1WSU A;  2UWM A;  1P4A A;  4GO1 A;  2DBB A;  4O5V A;  2ZBK A;  5IT9 K;  1KGS A;  4I02 A;  1SD6 A;  3MQ0 A;  2F5D A;  4RB1 A;  5HDG A;  3BWG A;  1U5T A;  3ZP5 A;  1T0F A;  2L02 A;  3BJO A;  2GZW A;  4HW0 A;  3IWF A;  1W4M A;  1XMK A;  3GFM A;  3IWZ A;  1R1T A;  4HQE A;  1TTY A;  4P5O A;  4WCG A;  3I53 A;  2HGC A;  1HKS A;  3IHU A;  1P4W A;  3DPL C;  4R8H A;  3IL2 A;  2KIU A;  3SXY A;  4YIF A;  3HIF A;  4HV5 A;  4LGW A;  1CF7 A;  1XMA A;  1AOY A;  2XHK A;  3KCC A;  4HQM A;  1KYZ A;  5E1X A;  3RTR A;  3HHH A;  4PZJ A;  3HOS A;  2D1H A;  3OV8 A;  2L4A A;  2V1D A;  2LNB A;  2ACJ A;  1G3S A;  4ENK A;  3HSF A;  1Z6T A;  1U6G A;  3FWE A;  1ZLJ A;  3WTY C;  3E6B A;  4UXN A;  5L3D A;  2DPD A;  4AIJ A;  5HS7 A;  2G7U A;  4EJV A;  3I64 A;  2O61 A;  5LLQ A;  2PQ8 A;  1HSJ A;  2VE9 A;  3I54 A;  3KP2 A;  1O3R A;  3KP3 A;  1ZN2 A;  4D0P A;  3C7J A;  4ENM A;  2HEO A;  2RV8 A;  3DPT A;  2J5O A;  3P9C A;  4EJW A;  3KEO A;  5D6F A;  3J80 Z;  2NNN A;  1IN5 A;  2MLK A;  1YS6 A;  3V7C A;  4RGX A;  2NS0 A;  4FX0 A;  4KIC A;  2P5L C;  1BJA A;  1RNL A;  5FO5 A;  2ADU A;  3LA2 A;  3IRR A;  1XGN A;  5DD4 A;  1MD0 A;  2GWR A;  1R36 A;  4HAM A;  3BJ6 A;  1K79 A;  2RVC A;  5LGT A;  2A6H F;  3WG9 A;  3MZH A;  2HYF A;  3RYR A;  3WGH A;  2BV6 A;  3JAM Z;  4UNO A;  1EH8 A;  5FFX A;  3ZMV A;  4P96 A;  3V4G A;  4OIQ F;  2K86 A;  2EB7 A;  1V4R A;  1FYK A;  4HF2 A;  5LHG A;  1OR7 A;  2FOK A;  3KEQ A;  3Q9V A;  1T39 A;  3H3U A;  4HA8 A;  4A2U A;  1F1Z A;  2H6C A;  5JVT A;  3COA C;  1KQ8 A;  3RKW A;  2ZKZ A;  3JTH A;  3DEU A;  4KMU X;  4XRF A;  4OOI A;  2L3D A;  2Y0M A;  3O2P E;  4KIF A;  5EEG A;  2Y75 A;  3RKY A;  2DAO A;  5D4R A;  2XUB A;  5FD6 A;  2P6T A;  1ZRE A;  4RB2 C;  4EMS A;  2RNJ A;  3I0T A;  4CHU A;  3WU0 A;  2GAU A;  5KVR A;  2OZ6 A;  2YX4 A;  4M72 A;  4A0Z A;  4CGZ A;  1HW1 A;  1FOK A;  2ELH A;  4A6D A;  4ZZD A;  1HKT A;  1W7P A;  2STW A;  4UUV A;  4M6Y A;  3LFK A;  2ETH A;  1FYL A;  4GGG A;  2EA4 A;  1SD7 A;  1S7O A;  2K02 A;  4M6X A;  2KIF A;  2FA5 A;  2WTE A;  3CO6 C;  1W7P B;  5BQT A;  1Z1D A;  3C1D A;  4AWX B;  1OKR A;  5L3B A;  5IT3 A;  2F5C A;  3FX3 A;  3V8J A;  4AIK A;  2HOE A;  5J8F A;  2FU4 A;  4IHS A;  2CSO A;  5CVV A;  4XSX F;  1IXR C;  2ZNY A;  4A0X A;  1C0W A;  3KE2 A;  3Q9S A;  3G3Z A;  5DCM B;  3TQN A;  1Q1H A;  5TRD A;  3P9I A;  1ZG1 A;  1FNN A;  1Z91 A;  1J0R A;  3EQL F;  3GXO A;  2UZK A;  4L0Y B;  3DP7 A;  3JW4 A;  4G94 A;  1YQA A;  5HDK A;  5F6F A;  3FXQ A;  1HBX G;  4L5J A;  3BP8 A;  1ULY A;  3FM5 A;  4LLG F;  4L5I A;  4YFX F;  1LNW A;  1S3J A;  2HKX A;  1IXS B;  5CVU A;  1T98 A;  5DEQ A;  1KU3 A;  4KN4 X;  3WE3 A;  1FBS A;  2A69 F;  5ERI A;  2LF7 A;  2RC4 A;  3TGN A;  4HYE A;  4LD5 A;  2O0Y A;  2P5V A;  2FML A;  4FT8 A;  2H27 A;  2WV0 A;  1EV7 A;  1O7L A;  1TW3 A;  2CGP A;  4MGR A;  4LK0 F;  3R0J A;  4MTD A;  1IN7 A;  2E1C A;  3SHF A;  3FZV A;  2PLY A;  2X4H A;  3FXU A;  2QLZ A;  3E6M A;  3GFL A;  4IHT A;  2L4M A;  2ESN A;  2FF4 A;  3SZT A;  2E1N A;  1L0O C;  1U5T C;  2FE3 A;  3E6C C;  1KQ9 A;  4KYW A;  4ZYH A;  2STT A;  3I59 B;  4S04 A;  4R79 A;  3WOD F;  2RQP A;  3L00 A;  3KLN A;  3B02 A;  1O7F A;  2O3F A;  5ICE A;  2PMU A;  3IKT A;  5D5X B;  5CVI A;  1OMI A;  4M74 A;  2HR3 A;  2QBY B;  5HDN A;  1BIB A;  4YII A;  1D8J A;  1BI0 A;  2XV4 S;  1H9T A;  3GZ5 A;  3H3Z A;  1IRG A;  5BPD A;  4IRH A;  2IRF G;  1D3Y A;  4ESB A;  4HDV A;  3FHZ A;  3F72 A;  3GO5 A;  4BHC A;  5DUI A;  4MQ9 F;  3W6K B;  1K7A A;  3L2C A;  2K27 A;  2EWN A;  2PFB A;  2DK8 A;  2JPB A;  5H20 A;  3W6J B;  1FY7 A;  5LRS A;  1JHH A;  2IA1 A;  1REP C;  3EDP A;  1J7K A;  5K5R A;  3CO7 C;  4KT5 C;  3J81 K;  3I4P A;  5L3C A;  3KP6 A;  3K1M A;  2MD5 A;  4N9I A;  5AIP A;  6PAX A;  4GCV A;  3BOQ A;  1YO5 C;  2G7H A;  4I7H A;  3ABU A;  1S7A A;  1YS7 A;  2JSC A;  1R1U A;  2OQG A;  2VOP A;  1IZ1 A;  1XSV A;  4FX4 A;  1E17 A;  3L9F A;  4RB0 A;  4CXF A;  4P55 A;  3CLO A;  1OPC A;  2QQA A;  1TQP A;  3GW2 A;  4EM1 A;  2NAZ A;  2KKO A;  4HLY A;  4LJZ F;  3CUO A;  4LG0 A;  3HUG A;  2ISY A;  3F22 A;  1B6A A;  2L54 A;  3C18 A;  1FC3 A;  1NHA A;  2HTS A;  3D5L A;  4ZYD A;  4BXU A;  3JTG A;  2FXA A;  4LG0 B;  3BZ6 A;  1KYW A;  2Z9O A;  1LVA A;  4G7O F;  1MGT A;  1ZRF A;  3ZPL A;  2HWV A;  3ZN1 A;  1QZY A;  3F8F A;  3CTA A;  1U5T B;  2FMY A;  3WE2 A;  1UHM A;  3HRU A;  2QYO A;  1FZP B;  2G9W A;  2O03 A;  2R7F A;  2YU3 A;  4O3M A;  4ZH4 F;  2W25 A;  2YX7 A;  2PEX A;  1VTN C;  2M5W A;  3VFZ A;  2VC0 A;  1GXQ A;  3ZMD A;  3I5U A;  1LEA A;  2PG4 A;  5J8C A;  4B8X A;  2VE8 A;  5A2Q K;  5E17 F;  2XIG A;  3F8M A;  1Z9C A;  3WTU C;  1QQI A;  1XDS A;  2DK5 A;  1BIA A;  1E2X A;  3IC7 A;  3I58 A;  4N0B A;  3P9K A;  1P92 A;  3QPH A;  2GA1 A;  1CF7 B;  3HSR A;  2DPU A;  4Q48 A;  1YYV A;  1P6R A;  4M73 A;  3WU1 B;  3RI4 A;  2DLL A;  2FNA A;  1ZG3 A;  2IJL A;  3PFI A;  4U0W A;  4RGU A;  4FHT A;  2IT0 A;  3H92 A;  1SFX A;  3TO7 A;  4EJO A;  2GXB A;  3OOP A;  4KNY A;  4I0A A;  3BJA A;  2Z33 A;  2K4J A;  3EYI A;  1PDN C;  3GLX A;  2EFN A;  1YTY A;  3E6D A;  3KP5 A;  3JSP A;  3QAH A;  1IRF A;  4JQF A;  3E5X A;  2D45 A;  4ZZL A;  1YW7 A;  1STZ A;  1LDD A;  2H09 A;  1O3S A;  4BYY A;  3LST A;  3RJP A;  4IF4 A;  1RUN A;  2ZFW A;  4XLP F;  1FBU A;  2OU2 A;  2IPQ X;  2Q0O A;  1O3Q A;  2XKP A;  3EET A;  5DD8 A;  2PJP A;  3HSE A;  5H6Q A;  3U1D A;  4XSZ F;  1GXP A;  5FB2 A;  2NRA C;  2YR2 A;  1FT9 A;  3QOP A;  1B9N A;  2JTV A;  3GYH X;  4OMZ A;  4UV8 A;  4IVN A;  2HYG D;  5CVJ A;  4M71 A;  1MDM A;  1FX7 A;  1G3W A;  4Q4Z F;  4IXA A;  2V9V A;  3FMQ A;  5BPI A;  5CJ9 A;  4RS8 A;  1HXD A;  4XLN F;  1QZZ A;  4OMY A;  4YFK F;  3ISP A;  4I98 B;  2XAF A;  3AAF A;  1S29 A;  4Y13 A;  5D4S A;  1UB9 A;  4S05 A;  3M8F A;  1OYY A;  4CYD A;  2JRT A;  5K5Q A;  2FEZ A;  2P6S A;  3R61 A;  3L7W A;  1WKM A;  2EV5 A;  2WWY A;  1T38 A;  4G9Y A;  1JHF A;  1IN4 A;  4AVP A;  2XKO A;  4KN7 X;  1PP7 U;  4PGH A;  4HDU A;  3M7G A;  5HLH A;  3HHG A;  4L9T A;  4I01 A;  5BS6 A;  2D2W A;  3GUD A;  1DPR A;  3ECH A;  1B9M A;  3QP6 A;  3SQN A;  1W5T A;  2RGV A;  4R1H A;  4HF1 A;  4EJT A;  2BEO A;  4IRG A;  3KP7 A;  3TO9 A;  3J80 K;  2PBI A;  1PP8 F;  3FM3 A;  4UVB A;  1W7P D;  3IKV A;  1J9I A;  3D0S A;  1DPU A;  3BDD A;  2VXZ A;  4P9F A;  1OYW A;  1QBJ A;  2ZXJ A;  2IP2 A;  1K6O A;  3LQR A;  1F9N A;  1DDN A;  2DT5 A;  2M8E A;  4MTE A;  1K78 A;  3T0Y A;  3JAM K;  3LWF A;  3R4K A;  1XD7 A;  5LGU A;  1LEB A;  2FSW A;  3J7A O;  5D8K B;  4DNC A;  3R6S A;  1RZ4 A;  1XN7 A;  3RDI A;  3LA7 A;  5ICF A;  1K78 B;  3ZQ7 A;  2P7V B;  4KFC A;  3TDZ C;  2KRF A;  5D6E A;  1B4A A;  3TOB A;  2AXL A;  4GYI A;  2VBX A;  3HRS A;  4RAY A;  4OIR F;  3KFW X;  1XSX A;  2XAS A;  4AIH A;  2XRO A;  2CYY A;  2MC3 A;  1EH7 A;  5E1W A;  3U9G A;  3HRT A;  2KJB A;  3KP4 A;  5BMZ A;  2Z3Y A;  3BY6 A;  5L3E A;  1ZAO A;  1GVJ A;  4IPA A;  2EFP A;  2FNP A;  4PDK A;  3WGI A;  1Y0U A;  3QU6 A;  2FRH A;  3R0A A;  3T8T A;  5L3F A;  2HQR A;  3DFG A;  1O57 A;  3RPQ A;  1ODD A;  1BM9 A;  5FLX Z;  5CLS A;  1H9G A;  2HQN A;  1BC8 C;  3ABT A;  2O8X A;  4NB5 A;  2O6G E;  4U0Y A;  2VC1 A;  2M1B A;  3WTT C;  2F5E A;  5DV5 A;  4RAZ A;  5KK1 A;  1ZG5 A;  2QQ9 A;  2FBK A;  2NYX A;  3GZ6 A;  4I09 A;  2VOD A;  1IUY A;  1SAX A;  2CFX A;  1J5Y A;  4M9X A;  2HS5 A;  2UXX A;  2AS5 F;  1B1B A;  1B59 A;  3F3X A;  1BI1 A;  2ZME A;  4G6Q A;  3VOE A;  1J59 A;  1Z6R A;  1P2F A;  3N4M A;  2K4B A;  4WF2 A;  2HFH A;  4HF0 A;  2EFO A;  2OAZ A;  2A5Y B;  5HS9 A;  1R23 A;  2XRN A;  4O6J A;  4L9N A;  4CO8 A;  3E5Q A;  5HS8 A;  3BPX A;  1TLH B;  2XAQ A;  4PGG A;  4WWC A;  3K1P A;  3ULQ B;  4A12 A;  1S6L A;  4L18 B;  2K7L A;  2EK5 A;  3HRM A;  2EV6 A;  3GWZ A;  3WTX C;  1I27 A;  3E3V A;  3O3K A;  2J5P A;  2GIV A;  5AON A;  3HYI A;  5J6X A;  1TQI A;  4Y15 A;  1IF1 A;  5IT9 Z;  1R58 A;  1JGS A;  2VOO A;  1J2X A;  4CIC A;  1O3T A;  3F6V A;  2LKP A;  4ESF A;  1G3T A;  1FWZ A;  1JXS A;  4L0Z B;  1RUO A;  1WQ2 A;  3MAJ A;  2DQR A;  5ICG A;  5HLI A;  1I5Z A;  1JE8 A;  1TNT A;  2XAJ A;  4CZZ A;  2MBF A;  1A04 A;  3GEZ A;  4Q5S F;  5HOO A;  2EA2 A;  3DKW A;  2VT3 A;  3ELK A;  4ENJ A;  5LHI A;  2P7C B;  5LHH A;  5E18 F;  2CQK A;  3K2Z A;  3DQV C;  4KDP A;  4ON0 A;  3F6O A;  2PI0 A;  2HKO A;  3ERE D;  3BPV A;  1T2K A;  3U2R A;  4WXC A;  2A3S A;  3T1B A;  1YLF A;  1YW8 A;  4ESJ A;  1R5H A;  4JK1 X;  1IAW A;  1FSH A;  4HX7 A;  3HTS B;  4OIN F;  3LAJ A;  3FF5 A;  5ILV A;  4I2O A;  2EV0 A;  2PN6 A;  1BI2 A;  4CDG A;  3BRO A;  4NHJ A;  5FD5 A;  3K1N A;  4HX4 A;  1XGM A;  3S2W A;  3CUQ A;  1KU2 A;  3RPU A;  3TDU C;  3SFZ A;  1SD5 A;  3E97 A;  4BQA A;  2B0L A;  3ZN0 A;  4G7H F;  5JHU A;  4HZF A;  1LQ1 A;  1F4K A;  3FMR A;  2ZJ2 A;  1RI7 A;  2EFW A;  2ZO4 A;  5K5O A;  2X0L A;  2MH2 A;  4EV0 A;  1BOA A;  4KIG A;  3MEX A;  2W57 A;  1FBQ A;  2OQR A;  2M45 A;  3DV8 A;  2PMH A;  5K1Y A;  4E70 A;  1TW2 A;  4UHT A;  2QEN A;  4BHB A;  2OA4 A;  4HBL A;  4PCQ A;  1USS A;  5LEJ A;  2DTR A;  4ASN A;  2F2E A;  3GF2 A;  4B09 A;  2WC2 A;  1G6N A;  2M30 A;  5D5U B;  5LRR A;  4G7Z F;  1ZLK A;  4EGY A;  2CW0 F;  3DF8 A;  4LMY A;  2GA2 A;  1FYM A;  4LFU A;  4LLN A;  5JFR A;  1IXC A;  2XGX A;  4ENN A;  5L3G A;  3ZMS A;  4GYG A;  3HTU A;  3ECO A;  2VN2 A;  1Z7U A;  1R00 A;  2HDC A;  4BAY A;  3K69 A;  1SFU A;  4MHG A;  1YFH A;  1S8N A;  3RYP A;  5D5W B;  4A0Y A;  3LAP A;  3C3W A;  5JI6 A;  3N97 A;  3JSO A;  3TO6 A;  1I1S A;  2W84 A;  1QNT A;  4WXD A;  1CGP A;  1AWC A;  3TOA A;  2ESH A;  1FP1 D;  3T8R A;  1IW7 F;  1LJ9 A;  3NEU A;  2E7W A;  2ZNZ A;  3CJN A;  3B73 A;  4A5N A;  5ICC A;  2LDU A;  3GFJ A;  2A6E F;  1D5V A;  3REO A;  4Q47 A;  1SMT A;  4QLC U;  3QU3 A;  1ZGJ A;  2Y48 A;  2FBH A;  4AD9 A;  3ML6 A;  3Q5F A;  2RN7 A;  1WRJ A;  2QM3 A;  2DW4 A;  2HTJ A;  4BNC A;  1XCV A;  2YSR A;  2BBY A;  5AIQ A;  4RGR A;  4G6D A;  5DUK A;  1MDM B;  1TNS A;  3NRV A;  2EFQ A;  2EJR A;  5CYV A;  1MJB A;  1U8R A;  1YIO A;  2QQB A;  1ON1 A;  1OYI A;  4HV6 A;  2YPR A;  3MWM A;  4LB5 A;  3PQK A;  1UST A;  4N9H A;  4OIO F;  4EGZ A;  1HW2 A;  4LLL A;  2F5F A;  2Z99 A;  2CWE A;  2QWW A;  3CDH A;  2P8T A;  5CVR A;  5LEK A;  1YW9 A;  3HOT A;  5E8I A;  4Y17 A;  5BOX A;  1FPQ A;  2V6C A;  1ON2 A;  1G4D A;  3MZY A;  3M1E A;  1QO0 D;  1LDK B;  4WXH A;  5JR3 A;  2LF8 A;  2R3S A;  3VB2 A;  1U2W A;  2XVC A;  2MLG A;  1T6S A;  1D8K A;  1HQC A;  1P4X A;  3LQQ A;  3K9T A;  1V3F A;  1PUE E;  4KUM A;  3WTS C;  5ILU A;  2C6Y A;  3KET A;  1ZRD A;  1ZGA A;  2OBP A;  1J75 A;  4ZYE A;  2VBY A;  1GHC A;  1XGO A;  4U0V A;  2P5K A;  3ZMZ A;  3GVA A;  4U7D A;  1HST A;  3F21 A;  3I71 A;  5ED4 A;  3WTZ A;  3ZMT A;  4UVC A;  1UFM A;  2NNY A;  2IA0 A;  5DCF A;  2Q8K A;  5DCM A;  4MEY F;  3DXJ F;  2V1X A;  2V79 A;  1TBX A;  4P9U A;  2DO7 A;  2XAH A;  5TJJ A;  2MA3 A;  1XB4 A;  5EEH A;  3E5U A;  5DDG A;  2ISZ A;  3QRF F;  4UVA A;  1ZRC A;  2DQL A;  2P4W A;  1HKQ A;  1MJA A;  1R1V A;  3F8B A;  1H0M A;  4DQ2 A;  2BYV E;  4KMF A;  2VON A;  4EM2 A;  3WTV C;  2JPC A;  5H6R A;  2IVM A;  3SZP A;  1FP2 A;  3V8L A;  2L01 A;  1IN8 A;  1QGP A;  2E7X A;  3RIR A;  1MJ9 A;  2A07 F;  3GX4 X;  4KA4 A;  2JT1 A;  1KU7 A;  4MEX F;  2OZU A;  3O6B B;  3MCZ A;  3KZZ A;  5E8G A;  1R5G A;  1SFE A;  2V1U A;  1Z05 A;  2QUF A;  1I6X A;  3KLO A;  3CUQ C;  3QPT A;  2QVO A;  4KIB A;  3TKY A;  2GXG A;  3ROU A;  5FGM A;  4M9Z A;  4OIP F;  1UHW A;  4UV9 A;  1ZAR A;  1LB2 A;  3J81 Z;  1YG2 A;  4H0E A;  4F7Z A;  2VBZ A;  4RB3 C;  1MKM A;  4HOB A;  4XBF A;  4BH9 A;  2CG4 A;  1XGS A;  2ZME B;  2OD5 A;  2HZT A;  4LK1 F;  4BHP A;  3I59 A;  1R7J A;  4QWQ A;  2D1V A;  2XAG A;  1TQM A;  4LB6 B;  1MZB A;  3V8K A;  4U7B A;  1X3U A;  2LSO A;  3L09 A;  3RKX A;  4U88 A;  2A61 A;  4JBA A;  4WK8 F;  1EH6 A;  5E1Z B;  2BE5 F;  5HLG A;  4ZYG A;  2DI3 A;  2QBY A;  2RKH A;  3FMS A;  1ONV A;  2COM A;  4TV7 A;  1G3Y A;  2GQQ A;  3M8E A;  1QPM A;  3ZMU A;  2DFI A;  1U78 A;  1WI9 A;  2Q2E A;  2R7D A;  2VBW A;  1ZHF A;  1KA8 A;  3P7N A;  2H6B A;  2KJC A;  1XDU A;  2W85 A;  1ZYR F;  2IA2 A;  1KU9 A;  5E20 A;  2ZCW A;  4NQW A;  4WX9 A;  2A68 F;  1BC7 C;  3VEP A;  4YG2 F;  4MNU A;  1RIO H;  5FLX K;  2DU9 A;  4EVI A;  3IRQ A;  2MH9 A;  3T5X A;  1XCB A;  1DUX C;  3F23 A;  5LBQ A;  3WTW C;  2BGC A;  3KZY A;  4RGS A;  1IN6 A;  5DYM A;  4L9V A;  5ILS A;  4MQV A;  2VT2 A;  4EJU A;  4I0B A;  2UXN A;  4K2E A;  5F1R A;  1XSD A;  5A2Q Z;  1WWX A;  1F5T A;  2QZ8 A;  2RDP A;  2TDX A;  2FQ3 A;  1BBY A;  5F64 A;  4HX8 A;  3V7S A;  3G73 A;  3F8N A;  1LDJ A;  4EQQ A;  2CO5 A;  4ETS A;  5D8L B;  1ZH5 A;  3FXR A;  3MFK A;  4HLX A;  3M9A A;  4M9S A;  4IJA A;  3PQJ A;  2Z5U A;  5LGN A;  2KIM A;  4GXO A;  1FLI A;  2FBI A;  3V7R A;  4A5M A;  2H94 A;  3EUH A;  3EYY A;  4A6E A;  1I1G A;  5HVQ C;  1R22 A;  4OU0 A;  1W5S A;  1U3E M;  3K0L A;  2W24 A;  3WGG A;  1DP7 P;  4L9J A;  2M87 A;  3LA3 A;  1FSE A;  3VOD A;  3F8C A;  4IRI A;  5D5V B;  1HW5 A; 
#chains in the Genus database with same CATH topology
 3NQO A;  2CW8 A;  2R7U A;  1BI3 A;  1L3L A;  1UCR A;  1I3A A;  3W2V A;  4IHV A;  4B1R A;  2VKD A;  3PSI A;  2MSY A;  2WAQ N;  4G8X A;  1X4P A;  3GFI A;  3HM5 A;  1BN5 A;  1SD4 A;  2IW5 A;  5C4X J;  1TL8 A;  4YFN F;  2JZY A;  3W6V A;  2EQR A;  1ZKG A;  1A36 A;  2IXS A;  2LKS A;  3QP5 A;  3R60 A;  3HPG A;  1SMY F;  1YX3 A;  3IUO A;  5FFZ A;  1HOM A;  1KQ0 A;  1WCM J;  3CUQ B;  4EM0 B;  4Y33 A;  3D5R C;  5F1J A;  3GBG A;  4Z2Y A;  5M5Y J;  5IP6 A;  1WSU A;  4HNV A;  2R5Z B;  5KAI C;  3AKZ A;  2UWM A;  1P4A A;  4GO1 A;  2DBB A;  4O5V A;  1FMV A;  2ZBK A;  2L0K A;  3ABK H;  4C3H J;  1W0T A;  3DTE A;  5IT9 K;  1KGS A;  4I02 A;  1SD6 A;  3MQ0 A;  2DA7 A;  3VYU B;  2F5D A;  4RB1 A;  4J01 A;  4C9Y A;  2KP6 A;  2EIN H;  1W1W E;  5HDG A;  1UG2 A;  3BWG A;  1U5T A;  3ZP5 A;  1T0F A;  2L02 A;  3BJO A;  3JCU C;  2W82 A;  1JKP C;  2GZW A;  4HW0 A;  3A0B C;  1D1B A;  1FMW A;  3IWF A;  1W4M A;  4RLF A;  1I39 A;  5J1U A;  1XMK A;  1E3H A;  3GFM A;  3IWZ A;  1BR1 A;  1R1T A;  4II2 A;  4HQE A;  1TTY A;  4P5O A;  4WCG A;  2K5C A;  3I53 A;  4XLA A;  2HGC A;  1HKS A;  4XIC A;  3CF5 F;  2M8G X;  3IHU A;  1P4W A;  3K10 A;  1MBE A;  5F08 A;  2FOW A;  3DPL C;  4R8H A;  3IL2 A;  4CCJ A;  2KIU A;  3SXY A;  2A05 A;  4YIF A;  3HIF A;  2KIQ A;  4HV5 A;  3VYS B;  2K9L A;  4LGW A;  4XKV A;  2DCE A;  3S14 J;  1CF7 A;  1XMA A;  4A93 J;  1AOY A;  1G8X A;  2XHK A;  3KCC A;  4HQM A;  4RAF A;  1KYZ A;  2JA2 A;  1SC7 A;  5E1X A;  3RTR A;  3HHH A;  4PZJ A;  3X2Q H;  3HOS A;  2D1H A;  5J4V A;  3OV8 A;  2L4A A;  2Y9Z A;  4Y3O A;  3MKZ A;  2V1D A;  2LNB A;  4IHX A;  3EUK L;  2EIM H;  3RZO J;  4ZC3 A;  1FTT A;  2ACJ A;  3MKL A;  3Q3S A;  3RQI A;  2ICW G;  1G3S A;  4ENK A;  3HSF A;  2EZL A;  3H3V K;  1Z6T A;  1U6G A;  3FWE A;  4ZDL A;  1ZLJ A;  3AFH A;  3WTY C;  1Z0X A;  2KZV A;  3E6B A;  1IUF A;  3ZQG A;  1OCP A;  4UXN A;  5L3D A;  2DPD A;  4AIJ A;  4DBR A;  5IYC J;  5HS7 A;  2XPU A;  3GTM J;  2G7U A;  4EJV A;  1JJ8 C;  2MW8 A;  2UV1 A;  3I64 A;  3L2Q A;  3DLA A;  1V5G A;  3OOU A;  2O61 A;  5LLQ A;  4ZDP A;  2PQ8 A;  1HSJ A;  2VE9 A;  3BR1 A;  1Y1V J;  3I54 A;  3KP2 A;  5EJC A;  1O3R A;  3KP3 A;  3HOZ J;  1BW6 A;  1ZN2 A;  1JGG A;  4D0P A;  3C7J A;  4ENM A;  2CUF A;  5GTH C;  2M0M A;  2TRT A;  2HEO A;  2JVG A;  1SFK A;  2RV8 A;  2NVU B;  3WU2 C;  3DPT A;  2J5O A;  3P9C A;  3QOE A;  4EJW A;  1JKQ C;  3KEO A;  1WJE A;  5D6F A;  4A3C J;  3W2W A;  1ZQ3 P;  2LG4 A;  4M3E A;  3J80 Z;  2NNN A;  1IN5 A;  3PNV A;  2MLK A;  1YS6 A;  3V7C A;  1X1P A;  3L2U A;  4XLE A;  4RGX A;  4A3M J;  5GAH J;  1X1A A;  1ZTR A;  2NS0 A;  3H9G A;  4FX0 A;  4KIC A;  2ZSI B;  1ZR4 A;  1YX5 A;  2RRE A;  2P5L C;  5FRM A;  1BJA A;  1ETY A;  1RNL A;  1XMX A;  5FO5 A;  3CCV I;  2VUM J;  2ADU A;  3LA2 A;  3IRR A;  4XLH A;  1XGN A;  5DD4 A;  4IOA F;  5EYR A;  2ZXW H;  1MD0 A;  1I3Q J;  5FKO A;  2GWR A;  1R36 A;  4HAM A;  3BJ6 A;  1K79 A;  2NVT J;  2HQ5 A;  2IGN A;  2RVC A;  5LGT A;  2A6H F;  5FKM A;  3WG9 A;  3MZH A;  2HYF A;  3RYR A;  3FKI J;  3WGH A;  2ME0 A;  2BV6 A;  3JAM Z;  2K3P A;  4X1E A;  1NG6 A;  4UNO A;  3HDD A;  1EH8 A;  2Y0S N;  5FFX A;  2QEX I;  3UNG C;  3ZMV A;  1P7J A;  4P96 A;  3HC7 A;  2EIJ H;  5M3M J;  1WI3 A;  3V4G A;  4OIQ F;  3HEF A;  2K86 A;  2EB7 A;  4XM3 A;  1V4R A;  3DU6 A;  4A3L J;  2M4K A;  2OCE A;  3LSM A;  3IAS 2;  3BR6 A;  1VQO I;  5EEA A;  1FYK A;  1ITY A;  5E3O A;  2MYS A;  2HI3 A;  4XK4 A;  4HF2 A;  5LHG A;  4B44 A;  3VYR B;  9ANT A;  1OR7 A;  5F04 A;  2FOK A;  3KEQ A;  3Q9V A;  4F3Q A;  1T39 A;  3H3U A;  3JRI A;  4HA8 A;  4A2U A;  1F1Z A;  4NC6 A;  1OCO H;  2H6C A;  2KZG A;  5JVT A;  3COA C;  1OCC H;  3DBR B;  1AHD P;  2IS4 A;  1KQ8 A;  3RKW A;  2OF7 A;  2OJE D;  2ZKZ A;  3JTH A;  3DEU A;  4KMU X;  5B5E C;  3AG4 H;  4XRF A;  2GM4 A;  1D1C A;  4OOI A;  2QF7 A;  1FIP A;  1OCZ H;  1AKH B;  2WAF A;  3C2H A;  2DT6 A;  2VQC A;  2L3D A;  2M4G A;  2Y0M A;  3O2P E;  4KIF A;  5EEG A;  2DA4 A;  2EIL H;  2Y75 A;  3RKY A;  1GT0 C;  4CZC A;  2R7V A;  3MD2 A;  2DAO A;  5D4R A;  5IPA A;  2XUB A;  4BXF A;  5FD6 A;  1IRX A;  1MBG A;  2P6T A;  3L2W A;  1ZRE A;  4RB2 C;  4EMS A;  3EPZ A;  3QYE A;  3OYH A;  1IGN A;  1LUJ B;  2RNJ A;  3A2K A;  4II3 A;  3TP0 A;  3I0T A;  3ZQQ A;  3PIO F;  4CHU A;  1MIJ A;  2PMZ A;  4XOR A;  3WU0 A;  2GAU A;  5KVR A;  2OZ6 A;  3OS2 A;  2YX4 A;  3TED A;  4M72 A;  4A0Z A;  3M8J A;  2XSJ C;  4S0H B;  4CGZ A;  1HW1 A;  1FOK A;  4PK4 A;  1NG7 A;  2ELH A;  4A6D A;  2CQQ A;  4ZZD A;  5B1A H;  2CV2 A;  1HKT A;  1W7P A;  2X6O A;  2X85 A;  4IQ4 A;  4RLQ A;  2STW A;  4UUV A;  4M6Y A;  1Y6I A;  3LFK A;  2ETH A;  1FYL A;  4E7L A;  4GGG A;  2EA4 A;  1SD7 A;  1S7O A;  2K02 A;  4M6X A;  2E5N A;  5EDN A;  4BJ6 C;  2KIF A;  2FA5 A;  3CJR B;  2WTE A;  3ZRG A;  4IL6 C;  3CO6 C;  1W7P B;  1Y1W J;  5BQT A;  3PL8 A;  4YEJ A;  1WZ2 A;  5FKN A;  3KZI C;  1E3P A;  5EZH A;  1FOY A;  2XSD C;  4A3D J;  1YOV B;  1Z1D A;  2IEK A;  3C1D A;  4AWX B;  2R7Q A;  1QVT A;  1OKR A;  2KIS A;  5L3B A;  1H89 C;  4EAT A;  3KYD B;  3K4B A;  5IT3 A;  2F5C A;  2OV7 A;  3FX3 A;  2LD5 A;  3OSF A;  3V8J A;  2JJ7 A;  1T95 A;  3BZK A;  4AIK A;  2HOE A;  3MMY B;  5J8F A;  2FU4 A;  4IHS A;  2CSO A;  5CVV A;  4XSX F;  1X1C A;  4BQQ A;  1IXR C;  1FTZ A;  1APL C;  4MFE A;  2ZNY A;  4BAC A;  4A0X A;  1C0W A;  2K9N A;  3OIQ A;  3KE2 A;  3Q9S A;  2BXY A;  1JJ6 C;  1Z77 A;  3G3Z A;  5DCM B;  3TQN A;  1VQ7 I;  2IGM A;  1Q1H A;  5F0C A;  3ONQ A;  5TRD A;  3D5S C;  3P9I A;  1IRZ A;  1ZG1 A;  1FNN A;  1T33 A;  1Z91 A;  4ZDO A;  1J0R A;  3EQL F;  3GXO A;  2UZK A;  1R9T J;  4L0Y B;  1ACI A;  3DP7 A;  3CMM A;  3JW4 A;  4G94 A;  1YQA A;  3MN2 A;  4BBS J;  5HDK A;  5F6F A;  3HKZ N;  3FXQ A;  1HBX G;  3QOD A;  2K3F A;  2ZSH B;  4L5J A;  3S3O A;  3BP8 A;  2KRH A;  1WH7 A;  1ULY A;  3FM5 A;  4LLG F;  4RM2 A;  3H5A A;  5K7Z A;  4L5I A;  4G12 A;  2VL8 A;  3EUH C;  4E6K G;  2XAU A;  2QSG X;  4ZYA A;  4LIU A;  4YFX F;  1IO2 A;  1LNW A;  1S3J A;  2BZT A;  2HKX A;  1MMG A;  2LP0 A;  1IXS B;  5CVU A;  3QYB A;  1OIS A;  1T98 A;  3AG3 H;  3HB9 A;  5DEQ A;  3KPH A;  1KU3 A;  2OPT A;  1UMQ A;  4KN4 X;  3WE3 A;  4DYR A;  1FBS A;  2A69 F;  1DGR M;  5ERI A;  4B43 A;  2ZJQ F;  2WAQ A;  2LF7 A;  2I10 A;  2RC4 A;  4ANJ A;  3TGN A;  4DZJ A;  4HYE A;  3I56 I;  4LD5 A;  2O0Y A;  2P5V A;  2FML A;  4FT8 A;  4V2F A;  2H27 A;  4D1Q A;  2L7F P;  2WV0 A;  1R4M B;  1EV7 A;  3TL4 X;  3S1M J;  2DFE A;  1O7L A;  2K9Q A;  1TW3 A;  2CGP A;  2XPV A;  4MGR A;  4LK0 F;  3R0J A;  4MTD A;  1IN7 A;  1JT6 A;  2E1C A;  3SHF A;  3D1N I;  3FZV A;  1ETX A;  4BE1 A;  2JWT A;  1UJ8 A;  3CDI A;  2PLY A;  3A01 A;  4G6T B;  4BBR J;  2X4H A;  3FXU A;  2QLZ A;  3E6M A;  3OY9 A;  1WGX A;  2BW3 A;  3GFL A;  4IHT A;  2L4M A;  2ESN A;  2FF4 A;  2F6C A;  5FKK A;  3SDG A;  3SZT A;  4XRM A;  3S93 A;  3BR5 A;  2E1N A;  5C3E J;  1L0O C;  4BEH B;  1SVL A;  1U5T C;  2ELK A;  2E5Z A;  1T0F C;  2FE3 A;  3E6C C;  1KQ9 A;  4E7Z A;  4KYW A;  4E7H A;  4ZYH A;  5K7H A;  2STT A;  3I59 B;  1DP3 A;  1Y39 A;  4S04 A;  2LFB A;  4R79 A;  3Q0U A;  5F0H A;  3VWB A;  2XF7 A;  3ZCO A;  1VQP I;  2JSP A;  1ZR2 A;  2HVS A;  3K70 D;  3WOD F;  2RQP A;  5CQE A;  3RKQ A;  3K2A A;  3L00 A;  1IG7 A;  4B3X A;  2E2I J;  3KLN A;  3B02 A;  1O7F A;  2H1L A;  4XMY A;  2O3F A;  5ICE A;  2PMU A;  3L1P A;  1EKE A;  3IKT A;  5D5X B;  1JT0 A;  5CVI A;  1OMI A;  4M74 A;  1LE8 B;  2HR3 A;  2QBY B;  1X3Z B;  3MZ8 A;  4RM3 A;  2EIK H;  2LRD A;  3BG7 A;  1A31 A;  4XL9 A;  2HQA A;  4E7K A;  5HDN A;  1BIB A;  1MSE C;  4X6A J;  4H4K C;  4YII A;  5EF6 A;  3FK6 A;  1D8J A;  1BI0 A;  2MD0 A;  1W5C C;  2XV4 S;  2Q2E B;  1H9T A;  1SAU A;  1O4X A;  3GZ5 A;  2X1E A;  1GV5 A;  4AM3 A;  3H3Z A;  2EH3 A;  1IRG A;  5BPD A;  4IRH A;  5IY5 H;  2IRF G;  1D3Y A;  4LG3 A;  4ESB A;  3TMO A;  4IZZ A;  2O7O A;  3DBH B;  4HDV A;  3FHZ A;  3F72 A;  3GO5 A;  4BHC A;  3CC2 I;  1B8I A;  5DUI A;  2HDD A;  5FRN A;  4MQ9 F;  4NQW B;  2VQH A;  2L9V A;  2TCT A;  3W6K B;  2LLK A;  3BG5 A;  1K7A A;  3L2C A;  5LD2 C;  1MMD A;  1ETQ A;  1WJF A;  2K27 A;  1HCR A;  2EWN A;  2PFB A;  2DK8 A;  3M4O J;  2JPB A;  5GTI C;  5H20 A;  3W6J B;  4BJ5 C;  3J7A Y;  1K61 A;  4AID A;  1FY7 A;  5LRS A;  2HOT A;  5GPC A;  1JHH A;  2IA1 A;  1K4T A;  1YRN A;  1REP C;  2V1N A;  2VQG A;  3EDP A;  5M5X J;  3TW6 A;  1J7K A;  1OQY A;  5K5R A;  3CO7 C;  3MKW B;  1QU3 A;  4KT5 C;  5CKT A;  4UUT A;  3J81 K;  3I4P A;  5L3C A;  4BE0 A;  3KP6 A;  2GBY A;  3K1M A;  2MD5 A;  3OYB A;  3H5N A;  1TWH J;  2X6X A;  4C30 A;  2DA1 A;  4N9I A;  2XRL A;  5AIP A;  6PAX A;  4GCV A;  1UG0 A;  3E1S A;  2HNH A;  3I3L A;  4CUG A;  3OYC A;  5GP9 A;  3ERM A;  2X9D A;  5HNF A;  3P5J A;  3BOQ A;  3PM1 A;  5LFA A;  1YO5 C;  3GCM A;  2G7H A;  4I7H A;  3ABU A;  2Y0S A;  1S7A A;  2ZJP F;  1YS7 A;  2JSC A;  2V4J C;  1OCT C;  3BCB A;  1LKX A;  3UR3 C;  2LY2 A;  1R1U A;  2OQG A;  2VOP A;  1V54 H;  1IZ1 A;  2Q1Z B;  1XSV A;  4FX4 A;  4DYQ A;  1E17 A;  1QRY A;  2WY7 Q;  2IS6 A;  3L9F A;  1W36 C;  4RB0 A;  4CXF A;  4W1U A;  2JN6 A;  3RPU D;  3DBL B;  1FOX A;  4P55 A;  3CLO A;  2M7B A;  1GUU A;  2K9S A;  1OPC A;  4I76 A;  2QSH X;  2QQA A;  1Y8Q B;  4XKC A;  1TQP A;  3GW2 A;  5E79 C;  2QQ8 A;  4I99 C;  2F4M B;  3KYC B;  1Z7L A;  2HDW A;  3HL2 A;  4EM1 A;  2NAZ A;  2KKO A;  3CDL A;  4HLY A;  1OR7 C;  4LJZ F;  4XKB A;  3CUO A;  2A5W A;  1PUF A;  4LG0 A;  3HUG A;  2ISY A;  3F22 A;  1B6A A;  4PJJ A;  2CH0 A;  2RNG A;  2X1C A;  3GLL A;  2L2O A;  3CCQ I;  2L54 A;  3A0H C;  1ETK A;  3C18 A;  3BC8 A;  1FC3 A;  3G2B A;  1NHA A;  3LMM A;  2HTS A;  1ORK A;  3D5L A;  3FXM A;  4ZYD A;  2CU7 A;  4BXU A;  3JTG A;  1F43 A;  2FXA A;  4LG0 B;  2R93 J;  3BZ6 A;  1KYW A;  1UAA A;  2Z9O A;  3GTG J;  1LVA A;  2W1O A;  2XDV A;  4G7O F;  1MGT A;  3PIP F;  1ZRF A;  3M1C A;  3ZPL A;  2HWV A;  2NOJ B;  3ZN1 A;  1QZY A;  4BE2 A;  3F8F A;  2W48 A;  3CTA A;  1U5T B;  2FMY A;  3CP2 A;  3WE2 A;  1UHM A;  3HRU A;  2QYO A;  1FZP B;  2G9W A;  2O03 A;  2R7F A;  2YU3 A;  3DEE A;  4C3J J;  4O3M A;  4ZH4 F;  2W25 A;  3S3N A;  3BTJ A;  1MH4 A;  2YX7 A;  2K85 A;  2PEX A;  1VTN C;  2M5W A;  3VFZ A;  2PJR A;  2VC0 A;  3HOV J;  1G59 A;  4BL0 B;  3HGY A;  1GXQ A;  3ZMD A;  3I5U A;  1LEA A;  2PG4 A;  5JVG F;  5J8C A;  4B8X A;  2VE8 A;  5A2Q K;  3TP3 A;  5E17 F;  2XIG A;  2LRE A;  3F8M A;  1Z9C A;  1NTC A;  3TW7 A;  2R0Q C;  4FE7 A;  2HU9 A;  3WTU C;  1QQI A;  2PJR B;  4BY7 J;  1BR4 A;  1XDS A;  2DK5 A;  1BIA A;  4FAS D;  1E2X A;  3IC7 A;  1JKR C;  3I58 A;  4N0B A;  3P9K A;  3F0C A;  1P92 A;  4A3K J;  3QPH A;  3NAR A;  2M0C A;  1IDY A;  2GA1 A;  1VQ4 I;  1CF7 B;  1WFX A;  3HSR A;  4BS9 A;  2DPU A;  4A3E J;  4PJ0 C;  2E1M C;  4Q48 A;  4PFP A;  2IBD A;  1YYV A;  1P6R A;  2XGE A;  4M73 A;  3WU1 B;  3RI4 A;  2DLL A;  1Y8R B;  1ZG3 A;  2FNA A;  2IJL A;  3PFI A;  4U0W A;  2QKL B;  4RGU A;  2R5Y A;  4FHT A;  1U0J A;  2IT0 A;  1SFO J;  1IJW C;  3H92 A;  1SFX A;  1QA6 A;  3TO7 A;  4EJO A;  2GXB A;  3OOP A;  1JUM A;  4KNY A;  4I0A A;  3BJA A;  1WVR A;  5BNG A;  1OFC X;  4Y52 J;  4A3J J;  2Z33 A;  3VPR A;  2K4J A;  2E19 A;  1PDN C;  3EYI A;  2DMT A;  1MBF A;  2X48 A;  3GLX A;  1AU7 A;  4HG2 A;  2EFN A;  2EZK A;  4BKX A;  1YTY A;  1Q1V A;  3O8G A;  2DA5 A;  2LR8 A;  3E6D A;  3KP5 A;  4KT6 A;  3HKZ A;  1BR2 A;  2F4I A;  3JSP A;  3QAH A;  1JI8 A;  1IRF A;  4JQF A;  3E5X A;  2D45 A;  2OCC H;  4ZZL A;  3Q0W A;  1YW7 A;  3BQY A;  5GAE J;  4MIM A;  4HSR A;  4X0G A;  1STZ A;  1FIA A;  1LDD A;  2H09 A;  1O3S A;  4BYY A;  3LST A;  3VSL A;  3RJP A;  2E35 A;  4IF4 A;  1RUN A;  3LNQ A;  2ZFW A;  4XLP F;  1WPK A;  2KMU A;  3L2R A;  5TIS C;  2LBF A;  1FBU A;  2OU2 A;  2ID6 A;  2IPQ X;  2Q0O A;  3CLQ A;  4JYK A;  4IO9 F;  3H0G J;  1O3Q A;  2XKP A;  1ERD A;  3EET A;  4M3F A;  5DD8 A;  1V5F A;  2AQF A;  2DYS H;  2PJP A;  3HSE A;  4NC7 A;  5H6Q A;  5F0F A;  2D5V A;  3QPS A;  1R5I D;  4XSZ F;  3U1D A;  1GXP A;  5FB2 A;  2NRA C;  3OYN A;  4XNF A;  2YR2 A;  1FT9 A;  2WB1 N;  3QOP A;  1VQ8 I;  1I6H J;  2CW7 A;  1B9N A;  2JTV A;  1XTA A;  4MLO A;  3GYH X;  2R7Z J;  1TC3 C;  4OMZ A;  4UV8 A;  1N75 A;  1JUS A;  3H0D A;  3CD6 I;  4IVN A;  2HYG D;  5CVJ A;  4M71 A;  1IC8 A;  2L9S A;  3FIW A;  1MDM A;  2QCO A;  1FX7 A;  1G3W A;  2ZB9 A;  4Q4Z F;  1OJL A;  3HOY J;  3K4M A;  4IXA A;  4KIS A;  2V9V A;  3FMQ A;  5BPI A;  2CUZ A;  2MG4 A;  5FLV A;  5EG0 A;  5CJ9 A;  4RS8 A;  1SAN A;  1FOW A;  2CQN A;  1HXD A;  4JX5 A;  1X2N A;  2V7F A;  4XLN F;  3HJE A;  1QZZ A;  3JRF A;  4OMY A;  4YFK F;  1HF0 A;  3ISP A;  4I98 B;  3CC4 I;  2XAF A;  3AAF A;  1S29 A;  4Y13 A;  1VF9 A;  5D4S A;  2R92 J;  1UB9 A;  2XF6 A;  4S05 A;  1YJW I;  4PSX A;  2VI6 A;  3M8F A;  1OYY A;  4CYD A;  5EG0 B;  1HLV A;  2CV0 A;  2JRT A;  2OTJ I;  2RAE A;  5K5Q A;  1TT5 B;  2FQ4 A;  3CF2 A;  2ZXI A;  3DU5 A;  2ZME C;  2FEZ A;  2P6S A;  3R61 A;  1PJR A;  3L7W A;  3HZJ A;  1WKM A;  2EV5 A;  2WWY A;  3AG2 H;  3ZQH A;  1A35 A;  1T38 A;  3BLY A;  2BHY A;  4G9Y A;  4DW6 A;  2XGD A;  2Z16 A;  1JHF A;  1IN4 A;  4AVP A;  1KZH A;  2XKO A;  4KN7 X;  1R49 A;  2CS3 A;  1PP7 U;  4PGH A;  4HDU A;  2WV1 A;  1ENH A;  2AQE A;  3M7G A;  4OAZ A;  3CCL I;  5HLH A;  3BG9 A;  3BQZ A;  3HHG A;  4L9T A;  4I01 A;  3DLL F;  5BS6 A;  3SZG A;  2XPW A;  2AXT C;  2D2W A;  3GUD A;  1DPR A;  3ECH A;  1B9M A;  3QP6 A;  4XQF A;  3FXK A;  1MW7 A;  3SQN A;  1W5T A;  3JRE A;  3WHC A;  2RGV A;  4R1H A;  3ZXS A;  2R7S A;  4HF1 A;  1VQK I;  2AHQ A;  1I50 J;  4EJT A;  2BEO A;  2LH9 A;  2O5R A;  1TWF J;  4IRG A;  3KP7 A;  3TO9 A;  3J80 K;  2PBI A;  3OR2 C;  1PP8 F;  2V6E A;  3FM3 A;  4EEF G;  4UVB A;  1W7P D;  2HPI A;  1BA5 A;  4DOZ A;  3K70 C;  4IOC F;  4C2M J;  3IKV A;  2Z2S B;  4AC0 A;  3OYF A;  1J9I A;  3D0S A;  1DPU A;  4BDY A;  3BDD A;  2VXZ A;  2B63 J;  4P9F A;  1OYW A;  1QBJ A;  2ZXJ A;  2IP2 A;  1K6O A;  1DU6 A;  3LQR A;  1LFB A;  2DFF A;  1F9N A;  2L7M P;  3HOU J;  3H9J A;  2VIX A;  1DDN A;  2DT5 A;  2M8E A;  2BY3 A;  4MTE A;  4CA0 A;  2QGU A;  1RR7 A;  1K78 A;  1WJB A;  1Z3X A;  3T0Y A;  5J4Y A;  3JAM K;  3N05 A;  3LWF A;  3R4K A;  1XD7 A;  4OAY A;  5LGU A;  1LEB A;  2FSW A;  2H1K A;  4CYC A;  4KIT B;  3CJQ B;  4QTR A;  3J7A O;  5D8K B;  3BZC A;  4DNC A;  2E1M B;  3R6S A;  1RZ4 A;  2L5Q A;  1XN7 A;  5K7F A;  4A3F J;  3RDI A;  3LA7 A;  5KCM A;  3GZN B;  5CQG A;  1WJ5 A;  4BGD A;  2GOX B;  3A03 A;  4B48 A;  1MH3 A;  4BJT A;  3S1Q J;  5ICF A;  1K78 B;  3ZQ7 A;  2E34 A;  2P7V B;  4KFC A;  3K4N A;  3PNY A;  4QSH A;  3TDZ C;  2KRF A;  5D6E A;  3IP4 B;  1B4A A;  4BDZ A;  3S3M A;  3TOB A;  1H88 C;  2AXL A;  3U21 A;  3GME A;  4GYI A;  2VBX A;  4D7M A;  4XR6 A;  3HRS A;  4RAY A;  4OIR F;  1F36 A;  2OC6 A;  3KFW X;  1XSX A;  2XAS A;  1NK3 P;  2HOA A;  1Y0N A;  2DTZ A;  2CQX A;  4AIH A;  2XRO A;  1HDD C;  2CYY A;  2CJJ A;  2MC3 A;  4CCN A;  4E7S A;  4AU7 A;  4RDU A;  1EH7 A;  5E1W A;  1D0Z A;  3U9G A;  3JRH A;  1EF4 A;  3HRT A;  2KJB A;  5EGO A;  3KP4 A;  5BMZ A;  2Z3Y A;  3BY6 A;  2E36 A;  5E3L A;  5L3E A;  2O9L A;  1ZAO A;  1GVJ A;  4IPA A;  2EFP A;  4NDL A;  3KIO A;  2X1D A;  4A3G J;  2FNP A;  2IS2 A;  1U9O A;  4PDK A;  4XID A;  3WGI A;  2LKX A;  1MNE A;  1Y0U A;  3QU6 A;  2FRH A;  3R0A A;  4F52 A;  3T8T A;  4B4C A;  5L3F A;  1HDP A;  2HQR A;  3CME I;  1MMS A;  3DFG A;  1O57 A;  3HXL A;  3CMA I;  3RPQ A;  1ODD A;  1BM9 A;  2KHM A;  2MGQ A;  3FXO A;  5CLS A;  5FLX Z;  4NBQ A;  2NXN B;  1H9G A;  2KRC A;  2QKM B;  1CQT A;  2VJI A;  3KEY A;  2FX0 A;  2HQN A;  3OIO A;  2AO9 A;  1BC8 C;  4W97 A;  3ABT A;  1YJ9 I;  2O8X A;  1YHQ I;  4NB5 A;  2O6G E;  4U0Y A;  3RZD J;  2EZH A;  2VC1 A;  2ZJR F;  3K4K A;  4XN0 A;  2M1B A;  1PYV A;  4YIR X;  4GDF A;  3WTT C;  2F5E A;  5DV5 A;  1ZGW A;  1RKT A;  4RAZ A;  4FCY A;  4PFO A;  1QVU A;  5KK1 A;  3JRC A;  1ZG5 A;  2QQ9 A;  2FBK A;  2NYX A;  3GZ6 A;  5C44 J;  4I09 A;  2VOD A;  1QHH D;  2CUJ A;  1IUY A;  1SAX A;  2CFX A;  1J5Y A;  1X1D A;  4M9X A;  2HS5 A;  2UXX A;  2AS5 F;  1B1B A;  1B59 A;  3KYL A;  3K4L A;  3F3X A;  1R6R A;  3ASN H;  1BI1 A;  2ZME A;  3DTK A;  3NWT A;  3JRD A;  3CCE I;  1UEL B;  2DOF A;  5IOZ A;  4G6Q A;  3SDB A;  3VOE A;  1J59 A;  3OWT A;  1Z6R A;  2ZC2 A;  3M3Y J;  1P2F A;  3A01 B;  2HXO A;  5IYB J;  3N4M A;  2K4B A;  1U9N A;  3Q0V A;  5DTD A;  3J7Y J;  4NNJ A;  2Y9Y A;  3OMY A;  4WF2 A;  4IX7 A;  2BW3 B;  4JP0 A;  4ZJZ A;  4QIW N;  1DQU A;  3PO3 J;  3PUF A;  3DEW A;  2HFH A;  4HF0 A;  4OWR B;  3LSR A;  2XF5 A;  1OLT A;  2EFO A;  3GTK J;  2OAZ A;  4JX4 A;  2A5Y B;  2NOG A;  5HS9 A;  3BR3 A;  1R23 A;  1U8B A;  4J00 A;  3OYM A;  2OUM A;  2XRN A;  3BTL A;  4UUS A;  2B7E A;  4M6V A;  2GLO A;  3TBI A;  4O6J A;  4L9N A;  3LL7 A;  4CO8 A;  2M7A A;  3E5Q A;  5HS8 A;  2UUZ A;  3BPX A;  1TLH B;  1X4O A;  4ZTJ A;  3IH3 A;  2XAQ A;  2EZI A;  4PGG A;  4WWC A;  3QPL A;  3K1P A;  3ULQ B;  2YUS A;  5J1Y A;  4A12 A;  1S6L A;  3S8P A;  4L18 B;  2K7L A;  2EK5 A;  4E7J A;  4XOT A;  1POG A;  1Z67 A;  2Y31 A;  1TWG J;  2EV6 A;  3HRM A;  3GWZ A;  5IP7 J;  3WTX C;  1I27 A;  2Y30 A;  3OL4 A;  2FJ1 A;  2DN0 A;  3E3V A;  3O3K A;  2J5P A;  4RA2 A;  2GIV A;  1EA3 A;  5AON A;  3HYI A;  3ZQI A;  1TQI A;  4Y15 A;  5J6X A;  1IF1 A;  3H5R A;  4FIS A;  2DT7 B;  1Z21 A;  2VKV A;  3LSG A;  5KHD A;  3OYE A;  3V42 A;  5IT9 Z;  1R58 A;  1JGS A;  3FK7 A;  2IGO A;  5IOY A;  1LPQ A;  2VOO A;  5CPR B;  3RQ4 A;  3CMY A;  1BOB A;  3OIP A;  5J40 A;  1J2X A;  3PUB A;  2R7X A;  3A1Y A;  4CIC A;  1B8I B;  1O3T A;  3LSI A;  3W2A A;  4V19 K;  4D9J A;  3F6V A;  4GFB A;  3ZQL A;  4Y4R A;  3G1M A;  2VPL A;  2LKP A;  4ESF A;  4LIV A;  1G3T A;  4RAG A;  2R7R A;  1FWZ A;  2KL4 A;  1JXS A;  4N4N B;  4L0Z B;  3K4J A;  1RUO A;  2ME6 A;  1WQ2 A;  2X6W A;  4NUB A;  1SVM A;  3MAJ A;  2DQR A;  5ICG A;  5HLI A;  1I5Z A;  1JE8 A;  1TNT A;  2JA5 J;  2XAJ A;  4CZZ A;  2MBF A;  1A04 A;  2V26 A;  1YRN B;  3GEZ A;  2L7Z A;  4Q5S F;  5HOO A;  2LOO A;  2LK2 A;  3RSN A;  2EA2 A;  3DKW A;  2VT3 A;  4F93 B;  3ELK A;  4ENJ A;  1R71 A;  1IV6 A;  1YE9 A;  5LHI A;  5M5W J;  2P7C B;  5LHH A;  5E18 F;  2CQK A;  3FDY A;  3K2Z A;  3DQV C;  4M3B A;  1JKO C;  1WH5 A;  4KDP A;  3VDX A;  2KLO A;  3CP8 A;  4ON0 A;  3F6O A;  4C3I J;  2DA6 A;  4PSW A;  3S2D J;  2PI0 A;  3CES A;  2ECC A;  3I4M J;  2HKO A;  1G2H A;  1QHG A;  3LSJ A;  4BQO A;  3ERE D;  3FBN B;  3BPV A;  2WB1 A;  3OYA A;  1T2K A;  3U2R A;  2H8R A;  4WXC A;  2E1O A;  3CCR I;  1LFP A;  2A3S A;  3G71 I;  3IAM 2;  1GV2 A;  3T1B A;  3PO2 J;  1YLF A;  1YW8 A;  2L7K A;  3ZQC A;  4ESJ A;  1R5H A;  4JK1 X;  2XC7 A;  2VJ4 A;  2GIZ A;  2DOE A;  2VAS A;  1IAW A;  1FSH A;  1RPW A;  4HX7 A;  1TWA J;  3ESW B;  4OIN F;  4AVZ A;  3HTS B;  3LAJ A;  2OTL I;  3FF5 A;  5ILV A;  4I2O A;  2VJJ A;  2DMU A;  2EV0 A;  3C2B A;  3ZQF A;  3BT9 A;  2PN6 A;  1BI2 A;  4CDG A;  3BRO A;  4NHJ A;  4N4O B;  5FD5 A;  3K1N A;  3OYJ A;  4ZTF A;  4HX4 A;  1XGM A;  3S2W A;  3CUQ A;  4XRS A;  1T08 B;  1KU2 A;  3RPU A;  1E3O C;  4YRV A;  1KON A;  2R5Z A;  3H9Q A;  3TDU C;  3OYL A;  3SFZ A;  4U87 A;  1SD5 A;  4CH7 A;  1LFU P;  4BXX J;  3E97 A;  2W7N A;  3S1R J;  2B0L A;  3ZGK A;  4BQA A;  1QPI A;  4FTH A;  2HZD A;  3HGG A;  3MKY B;  3ZN0 A;  1PUF B;  3HUG B;  2COB A;  4G7H F;  1MBJ A;  5JHU A;  4HZF A;  2EBI A;  3ZR8 X;  3HOX J;  1LQ1 A;  5HNH A;  1N25 A;  1F4K A;  3FMR A;  5H2F C;  2ZJ2 A;  1RI7 A;  5E3N A;  1R4N B;  1S9H A;  5GPA A;  5B3S H;  2EFW A;  4A3I J;  2ZO4 A;  2YS9 A;  1YI2 I;  3BCA A;  5K5O A;  2KFD A;  2X0L A;  2MH2 A;  4EV0 A;  1BOA A;  4KIG A;  3MEX A;  1JTX A;  1FEX A;  1XS9 A;  2W57 A;  3HG9 A;  1FBQ A;  2OQR A;  2M45 A;  3DV8 A;  3GTJ J;  2PMH A;  5KAF C;  4XOP A;  3I9V 2;  1GVD A;  5K1Y A;  2P81 A;  4FQG A;  4E70 A;  2CQ7 A;  1BJZ A;  1TW2 A;  4UHT A;  2QEN A;  2JUG A;  3K4C A;  4BHB A;  2OA4 A;  2E71 A;  4HBL A;  4PCQ A;  2K9M A;  3RCO A;  1USS A;  5HLT A;  5LEJ A;  2DTR A;  3FIS A;  1HA8 A;  4ASN A;  2F2E A;  3GF2 A;  3B6C A;  4IHY A;  4B09 A;  2CV1 A;  2WC2 A;  1G6N A;  4F92 B;  2M30 A;  3DKX A;  4QPO A;  1VQM I;  1X1B A;  4FE4 A;  4M3G A;  5LRR A;  5D5U B;  4G7Z F;  2IGK A;  5FLM J;  1ZLK A;  1K4S A;  1MND A;  1IDZ A;  1RET A;  4EGY A;  1P9Q C;  2CW0 F;  3DF8 A;  4LMY A;  1M1E B;  2GA2 A;  1FYM A;  1XX5 A;  4LFU A;  1D0Y A;  4KJZ A;  5F27 A;  4LLN A;  1XG1 A;  5JFR A;  1IXC A;  2XGX A;  4DIQ A;  2RQQ A;  3PNT A;  3OYI A;  2QSF X;  4ENN A;  5FRO A;  5L3G A;  2LVS A;  3ZMS A;  4GYG A;  3FKJ A;  3QQA A;  3HTU A;  3SEQ A;  3ECO A;  2VN2 A;  1Z7U A;  1R00 A;  4UB8 C;  2HDC A;  2F4O B;  4BAY A;  3K69 A;  1SFU A;  2R5Y B;  4MHG A;  1YFH A;  1NH3 A;  3J7Z I;  3ABL H;  3S15 J;  4A3B J;  3CCY A;  2WBM A;  1T8I A;  1UHS A;  1S8N A;  4E4H A;  1D5Y A;  2PX9 A;  4CCO A;  3RYP A;  5J3L A;  2XB0 X;  5D5W B;  3H35 A;  4A0Y A;  3I4N J;  3LAP A;  3C3W A;  1S7E A;  2VKH A;  5JI6 A;  3JSO A;  3N97 A;  1VQ9 I;  3GTO J;  3JRG A;  3TO6 A;  1I1S A;  2W84 A;  2JRM A;  3C2G A;  3U1K A;  4A69 C;  1QNT A;  4HST A;  4AYB N;  3WG7 H;  4WXD A;  1CGP A;  1AWC A;  3TOA A;  2ESH A;  1FP1 D;  4JOM A;  3T8R A;  3UKG A;  5TGT A;  1IW7 F;  1TWC J;  1LJ9 A;  3NEU A;  1TZL A;  2CFO A;  2DA2 A;  4C2T A;  2LY9 A;  2E7W A;  2HVQ A;  2JVH A;  2ZNZ A;  3CJN A;  1W36 D;  5J1R A;  3B73 A;  4A5N A;  2W4S A;  3HPH A;  2LDU A;  3LSH A;  3G1O A;  4DZP A;  3GFJ A;  2ID3 A;  5ICC A;  2LBF B;  4XLC A;  2A6E F;  1D5V A;  3REO A;  4HNT A;  3LSP A;  4Q47 A;  4IHW A;  2VPR A;  1SMT A;  4ABZ A;  4QLC U;  5EZG A;  3BR0 A;  3QU3 A;  1ZGJ A;  4UB6 C;  2Y48 A;  2FBH A;  3E0J B;  4D5C A;  4AD9 A;  3ML6 A;  3Q5F A;  2RN7 A;  2M3A A;  2X6Y A;  1WRJ A;  2QM3 A;  2DW4 A;  2HTJ A;  1B72 A;  2ECB A;  2I8D A;  4BNC A;  1XCV A;  2YSR A;  4E7I A;  2BBY A;  3FBI B;  5AIQ A;  4RGR A;  4G6D A;  1WJC A;  2Y69 H;  1TNS A;  2LYC A;  3NRV A;  5DUK A;  1MDM B;  4C2U A;  2IS1 A;  2EFQ A;  2EJR A;  5CYV A;  2VLA A;  4RBO A;  3DTI A;  2WAE A;  1B72 B;  4MO7 A;  1MJB A;  1U8R A;  1YIO A;  2QQB A;  4BY1 J;  4J19 A;  3GTL J;  1RRJ A;  1ON1 A;  3BTC A;  2BY1 A;  1OYI A;  3OS0 A;  4F91 B;  4HV6 A;  3S1N J;  2YPR A;  3MWM A;  4LB5 A;  1AKH A;  3PQK A;  2DOA A;  1UST A;  4N9H A;  4OIO F;  2EPF A;  4EGZ A;  3WHB A;  2JK3 A;  4LLL A;  1HW2 A;  2F5F A;  2Z99 A;  3PSF A;  2CWE A;  5DS9 A;  2QWW A;  1NK2 P;  3CDH A;  2P8T A;  5CVR A;  3OSG A;  5LEK A;  1YW9 A;  4IKF A;  4CCK A;  3HOT A;  5E8I A;  1RC9 A;  3BG3 A;  1K6Y A;  4Y7N J;  1VQ6 I;  1K83 J;  4JX6 A;  3LOC A;  4Y17 A;  1GLN A;  5BOX A;  1FPQ A;  1SVO A;  1ETV A;  2V6C A;  3K6G A;  1ON2 A;  2A6T A;  1G4D A;  2E2J J;  1VQ5 I;  3MZY A;  3PJR A;  2LMD A;  3M1E A;  1QO0 D;  1LDK B;  1XPX A;  1VND A;  4WXH A;  3OR1 C;  2LF8 A;  2R3S A;  3H36 A;  5IP9 J;  5JR3 A;  3VB2 A;  1J09 A;  3DKY A;  4BUP A;  5B1B H;  1U2W A;  2XVC A;  3K7A J;  5FJ8 J;  2MLG A;  1T6S A;  1D8K A;  1HQC A;  2WAD A;  1YIJ I;  1P4X A;  3LQQ A;  3FXL A;  2NVY J;  2CRG A;  1MBK A;  3K9T A;  2V9K A;  3SYT A;  4B47 A;  1V3F A;  1PUE E;  1ETO A;  4KUM A;  4B3A A;  1DGW Y;  4RMN A;  5KNL A;  5ILU A;  3WTS C;  3OYD A;  2JA7 J;  5FKL A;  2C6Y A;  3KET A;  2KDZ A;  4V2G A;  1ZRD A;  3GTP J;  1ZGA A;  2DDA A;  2OBP A;  3KX2 A;  1DU0 A;  3AG1 H;  2CUE A;  1J75 A;  2DA3 A;  3VSK A;  4ZYE A;  2BVL A;  2VBY A;  1GHC A;  1JUP A;  1VFC A;  3S17 J;  1E0E A;  4HEA 2;  1XGO A;  4U0V A;  3CCJ I;  3LFU A;  2I5U A;  2P5K A;  3ZMZ A;  3GVA A;  4U7D A;  1HST A;  3F21 A;  4GRI A;  3L2V A;  4UY8 I;  3I71 A;  5ED4 A;  3CCU I;  3ASO H;  3WTZ A;  3S32 A;  3EUA A;  3ZMT A;  4IQJ A;  4CYC B;  3IH4 A;  5GAG J;  5HOD A;  4L5E A;  4UVC A;  1UFM A;  2NNY A;  2IA0 A;  5DCF A;  2Q8K A;  2DJN A;  2MC4 A;  5DCM A;  1YIT I;  4MEY F;  1BL0 A;  3DXJ F;  3JRB A;  3AL0 C;  1UZC A;  2V1X A;  2V79 A;  1TBX A;  1V5E A;  4P9U A;  2HPM A;  2MFZ A;  4HNU A;  2BXZ A;  2F5V A;  2DO7 A;  2XAH A;  2VXD A;  5TJJ A;  2MA3 A;  4M3D A;  2NS8 A;  2DMP A;  1XB4 A;  1QZE A;  4I6Z A;  5EEH A;  3FHN A;  2DYR H;  5GAD J;  3E5U A;  5DDG A;  2ISZ A;  3QRF F;  4UVA A;  1ZRC A;  2IAI A;  2DQL A;  2BHZ A;  2GOM A;  1MMN A;  2P4W A;  1TP4 A;  3FXJ A;  1HKQ A;  1S72 I;  1MJA A;  1R1V A;  3F8B A;  2E60 A;  3NWS A;  1H0M A;  1MSF C;  4DQ2 A;  2BYV E;  4KMF A;  2VON A;  4EM2 A;  3WTV C;  2JPC A;  5EGO B;  2R7T A;  5H6R A;  2IVM A;  3SZP A;  2KPM A;  4AUX A;  4CSW A;  1FP2 A;  3CCS I;  3OL3 A;  1VQN I;  1EJ9 A;  3V8L A;  2BY0 A;  2L01 A;  1IN8 A;  2KQR A;  2LC2 A;  1QGP A;  2CMP A;  2VQL A;  3DPU A;  2E7X A;  3RIR A;  1MJ9 A;  1X58 A;  2A07 F;  2K40 A;  2R7O A;  1X3W B;  1RR8 C;  3GX4 X;  4KA4 A;  2YU9 J;  2JT1 A;  3IH2 A;  1KU7 A;  4MEX F;  3MVP A;  2OZU A;  1X2M A;  2DXI A;  2KT0 A;  2BY2 A;  4PUS A;  4P1W A;  3O6B B;  3MCZ A;  3KZZ A;  3VYT B;  5E3M A;  2ZFU A;  3OYK A;  5E8G A;  1BW5 A;  2M2E A;  1R5G A;  3CZ6 A;  1SFE A;  2DMQ A;  3CJT B;  3O8H A;  4DGW B;  2V1U A;  1Z05 A;  2QUF A;  2GXA A;  2F48 A;  1I6X A;  3KLO A;  2WA0 A;  3CUQ C;  3QPT A;  2QVO A;  4KIB A;  2ZXH A;  3TKY A;  3GTQ J;  2DJI A;  2GXG A;  1ZEL A;  3ROU A;  5JLW A;  5FGM A;  3ZOB A;  3BR2 A;  4M9Z A;  2NVQ J;  4OIP F;  2HVR A;  3HOW J;  1UHW A;  4UV9 A;  5B66 C;  1ZAR A;  3OS1 A;  1LB2 A;  3J81 Z;  3G1L A;  2Z1D A;  1YG2 A;  4H0E A;  4F7Z A;  2M34 A;  2VBZ A;  2VB6 A;  2BOL A;  4RB3 C;  4BEH A;  1AA7 A;  1MKM A;  4HOB A;  4LOC A;  3I55 I;  2BVM A;  5JLX A;  4XBF A;  4BH9 A;  2CG4 A;  1XGS A;  4DBQ A;  2ZME B;  2OD5 A;  2HZT A;  4LK1 F;  4QPQ A;  4LIT A;  4BHP A;  1JTY A;  3I59 A;  1R7J A;  2JA8 J;  1FJL A;  4QWQ A;  2D1V A;  1GDT A;  4XN3 A;  2XAG A;  1TQM A;  4IEJ A;  4LB6 B;  4YEL A;  1MZB A;  3V8K A;  3S2H J;  2LY1 A;  4U7B A;  1X3U A;  2WY8 Q;  1TT0 A;  1W0U A;  2LSO A;  1MBH A;  3L09 A;  2NS7 A;  2VJ5 A;  4U88 A;  3RKX A;  2A61 A;  4JBA A;  4Z6Y A;  4WK8 F;  3NAU A;  1YJN I;  1N78 A;  1EH6 A;  5E1Z B;  3A4C A;  2NVX J;  2L9N A;  3BTI A;  2BE5 F;  4D7N A;  1LVK A;  3JRA A;  5HLG A;  1OCR H;  3LSK A;  5IYD J;  4ZYG A;  2DI3 A;  1LE8 A;  4DJA A;  2QBY A;  2RKH A;  2HOS A;  3FMS A;  2XB5 A;  2Y2Z A;  1ONV A;  3S16 J;  1Z3Y A;  2COM A;  4D5F A;  2JUC A;  4TV7 A;  1G3Y A;  1A6I A;  2GQQ A;  3SJM A;  3H1C A;  3M8E A;  4UUS B;  1ETW A;  4HPQ A;  4F55 A;  1MNM C;  2DDB A;  4PJL A;  2E2H J;  1HC8 A;  2PMZ N;  1QPM A;  2P0W A;  3ZMU A;  4CCM A;  3OYG A;  2DFI A;  3G6E I;  1U78 A;  1WI9 A;  2Q2E A;  2L9R A;  2R7D A;  2VBW A;  1ZHF A;  3SFI A;  1KA8 A;  2KDO A;  1P7I A;  2G0E A;  1RKW A;  3PFY A;  3P7N A;  3G4S I;  2H6B A;  2KJC A;  2FUG 2;  1XDU A;  2DOD A;  1WJD A;  2W85 A;  1ZYR F;  3W3C A;  2IA2 A;  1KU9 A;  4BQN A;  1ZK8 A;  5E20 A;  2QA4 I;  2ZCW A;  4NQW A;  3HBL A;  2FD5 A;  2R4G A;  4WX9 A;  2XGC A;  1PVE A;  1VI0 A;  2H8W A;  2A68 F;  2DFH A;  1VZ0 A;  2VKE A;  3A02 A;  2HYJ A;  2W00 A;  3DWL E;  3B6A A;  1BC7 C;  3VEP A;  4YG2 F;  4MNU A;  1RIO H;  5FLX K;  3CCM I;  5DM7 F;  4MFD A;  2DU9 A;  4XKW A;  4EVI A;  3CQZ J;  4PJN A;  3IRQ A;  2MH9 A;  3T5X A;  1XCB A;  1DUX C;  3QWL A;  3F23 A;  2B9S A;  5LBQ A;  1RES A;  3WTW C;  2BGC A;  2JMW A;  3KZY A;  4RGS A;  1IN6 A;  1H8A C;  3F9K A;  5DYM A;  2MAB A;  2DMN A;  3QYF A;  4L9V A;  5ILS A;  4MQV A;  2O8K A;  2VT2 A;  4EJU A;  5M3F J;  1XC5 A;  4AYB A;  4I0B A;  1MMA A;  2UXN A;  4K2E A;  1D1A A;  2X51 A;  3JR9 A;  3AL0 B;  5J47 A;  2LTP A;  5F1R A;  4XRS G;  4BU2 A;  5A2Q Z;  1XSD A;  1WWX A;  1F5T A;  1WHU A;  4PJM A;  4XON A;  2QZ8 A;  2RDP A;  2TDX A;  2V9P A;  2FQ3 A;  1BBY A;  5F64 A;  4HX8 A;  5DM6 F;  3V7S A;  4ITV A;  2M9H A;  3F8N A;  3G73 A;  1LDJ A;  1T56 A;  4EQQ A;  3BG6 A;  2CO5 A;  3M07 A;  4ETS A;  1Y56 A;  5D8L B;  1ZH5 A;  4HRI A;  1IV8 A;  2HXI A;  3FXR A;  3MFK A;  4HLX A;  3M9A A;  4NC8 A;  1VQL I;  2R7W A;  5C4J J;  4M9S A;  4IJA A;  3PQJ A;  5JHF A;  2JQ7 A;  1A5J A;  2Z5U A;  1WJA A;  3DCF A;  2KIM A;  4GXO A;  3SEZ A;  5LGN A;  2JA6 J;  2FBI A;  1FLI A;  4CCL A;  3V7R A;  4A5M A;  2ELJ A;  2H94 A;  3EUH A;  1SEU A;  1D0X A;  1N77 A;  4DYC A;  3EYY A;  4A6E A;  1I1G A;  5HVQ C;  4FET A;  1R22 A;  4OU0 A;  1W5S A;  1V55 H;  3ABM H;  2N8G A;  1U3E M;  3K0L A;  3IV5 A;  2W24 A;  3WGG A;  1DP7 P;  1X19 A;  1S5L C;  1A6Q A;  3E7L A;  4L9J A;  3CC7 I;  2M87 A;  3LA3 A;  1FSE A;  3VOD A;  3F8C A;  4IRI A;  5D5V B;  1HW5 A;  4XLF A; 
#chains in the Genus database with same CATH homology
 3NQO A;  1BI3 A;  1L3L A;  1UCR A;  4G8X A;  3GFI A;  1BN5 A;  1SD4 A;  2IW5 A;  4YFN F;  2JZY A;  3QP5 A;  3R60 A;  1SMY F;  5FFZ A;  1KQ0 A;  3CUQ B;  4EM0 B;  4Z2Y A;  1WSU A;  2UWM A;  1P4A A;  4GO1 A;  2DBB A;  4O5V A;  2ZBK A;  5IT9 K;  1KGS A;  4I02 A;  1SD6 A;  3MQ0 A;  2F5D A;  4RB1 A;  5HDG A;  3BWG A;  1U5T A;  3ZP5 A;  1T0F A;  2L02 A;  3BJO A;  2GZW A;  4HW0 A;  3IWF A;  1W4M A;  1XMK A;  3GFM A;  3IWZ A;  1R1T A;  4HQE A;  1TTY A;  4P5O A;  4WCG A;  3I53 A;  2HGC A;  1HKS A;  3IHU A;  1P4W A;  3DPL C;  4R8H A;  3IL2 A;  2KIU A;  3SXY A;  4YIF A;  3HIF A;  4HV5 A;  4LGW A;  1CF7 A;  1XMA A;  1AOY A;  2XHK A;  3KCC A;  4HQM A;  1KYZ A;  5E1X A;  3RTR A;  3HHH A;  4PZJ A;  3HOS A;  2D1H A;  3OV8 A;  2L4A A;  2V1D A;  2LNB A;  2ACJ A;  1G3S A;  4ENK A;  3HSF A;  1Z6T A;  1U6G A;  3FWE A;  1ZLJ A;  3WTY C;  3E6B A;  4UXN A;  5L3D A;  2DPD A;  4AIJ A;  5HS7 A;  2G7U A;  4EJV A;  3I64 A;  2O61 A;  5LLQ A;  2PQ8 A;  1HSJ A;  2VE9 A;  3I54 A;  3KP2 A;  1O3R A;  3KP3 A;  1ZN2 A;  4D0P A;  3C7J A;  4ENM A;  2HEO A;  2RV8 A;  3DPT A;  2J5O A;  3P9C A;  4EJW A;  3KEO A;  5D6F A;  3J80 Z;  2NNN A;  1IN5 A;  2MLK A;  1YS6 A;  3V7C A;  4RGX A;  2NS0 A;  4FX0 A;  4KIC A;  2P5L C;  1BJA A;  1RNL A;  5FO5 A;  2ADU A;  3LA2 A;  3IRR A;  1XGN A;  5DD4 A;  1MD0 A;  2GWR A;  1R36 A;  4HAM A;  3BJ6 A;  1K79 A;  2RVC A;  5LGT A;  2A6H F;  3WG9 A;  3MZH A;  2HYF A;  3RYR A;  3WGH A;  2BV6 A;  3JAM Z;  4UNO A;  1EH8 A;  5FFX A;  3ZMV A;  4P96 A;  3V4G A;  4OIQ F;  2K86 A;  2EB7 A;  1V4R A;  1FYK A;  4HF2 A;  5LHG A;  1OR7 A;  2FOK A;  3KEQ A;  3Q9V A;  1T39 A;  3H3U A;  4HA8 A;  4A2U A;  1F1Z A;  2H6C A;  5JVT A;  3COA C;  1KQ8 A;  3RKW A;  2ZKZ A;  3JTH A;  3DEU A;  4KMU X;  4XRF A;  4OOI A;  2L3D A;  2Y0M A;  3O2P E;  4KIF A;  5EEG A;  2Y75 A;  3RKY A;  2DAO A;  5D4R A;  2XUB A;  5FD6 A;  2P6T A;  1ZRE A;  4RB2 C;  4EMS A;  2RNJ A;  3I0T A;  4CHU A;  3WU0 A;  2GAU A;  5KVR A;  2OZ6 A;  2YX4 A;  4M72 A;  4A0Z A;  4CGZ A;  1HW1 A;  1FOK A;  2ELH A;  4A6D A;  4ZZD A;  1HKT A;  1W7P A;  2STW A;  4UUV A;  4M6Y A;  3LFK A;  2ETH A;  1FYL A;  4GGG A;  2EA4 A;  1SD7 A;  1S7O A;  2K02 A;  4M6X A;  2KIF A;  2FA5 A;  2WTE A;  3CO6 C;  1W7P B;  5BQT A;  1Z1D A;  3C1D A;  4AWX B;  1OKR A;  5L3B A;  5IT3 A;  2F5C A;  3FX3 A;  3V8J A;  4AIK A;  2HOE A;  5J8F A;  2FU4 A;  4IHS A;  2CSO A;  5CVV A;  4XSX F;  1IXR C;  2ZNY A;  4A0X A;  1C0W A;  3KE2 A;  3Q9S A;  3G3Z A;  5DCM B;  3TQN A;  1Q1H A;  5TRD A;  3P9I A;  1ZG1 A;  1FNN A;  1Z91 A;  1J0R A;  3EQL F;  3GXO A;  2UZK A;  4L0Y B;  3DP7 A;  3JW4 A;  4G94 A;  1YQA A;  5HDK A;  5F6F A;  3FXQ A;  1HBX G;  4L5J A;  3BP8 A;  1ULY A;  3FM5 A;  4LLG F;  4L5I A;  4YFX F;  1LNW A;  1S3J A;  2HKX A;  1IXS B;  5CVU A;  1T98 A;  5DEQ A;  1KU3 A;  4KN4 X;  3WE3 A;  1FBS A;  2A69 F;  5ERI A;  2LF7 A;  2RC4 A;  3TGN A;  4HYE A;  4LD5 A;  2O0Y A;  2P5V A;  2FML A;  4FT8 A;  2H27 A;  2WV0 A;  1EV7 A;  1O7L A;  1TW3 A;  2CGP A;  4MGR A;  4LK0 F;  3R0J A;  4MTD A;  1IN7 A;  2E1C A;  3SHF A;  3FZV A;  2PLY A;  2X4H A;  3FXU A;  2QLZ A;  3E6M A;  3GFL A;  4IHT A;  2L4M A;  2ESN A;  2FF4 A;  3SZT A;  2E1N A;  1L0O C;  1U5T C;  2FE3 A;  3E6C C;  1KQ9 A;  4KYW A;  4ZYH A;  2STT A;  3I59 B;  4S04 A;  4R79 A;  3WOD F;  2RQP A;  3L00 A;  3KLN A;  3B02 A;  1O7F A;  2O3F A;  5ICE A;  2PMU A;  3IKT A;  5D5X B;  5CVI A;  1OMI A;  4M74 A;  2HR3 A;  2QBY B;  5HDN A;  1BIB A;  4YII A;  1D8J A;  1BI0 A;  2XV4 S;  1H9T A;  3GZ5 A;  3H3Z A;  1IRG A;  5BPD A;  4IRH A;  2IRF G;  1D3Y A;  4ESB A;  4HDV A;  3FHZ A;  3F72 A;  3GO5 A;  4BHC A;  5DUI A;  4MQ9 F;  3W6K B;  1K7A A;  3L2C A;  2K27 A;  2EWN A;  2PFB A;  2DK8 A;  2JPB A;  5H20 A;  3W6J B;  1FY7 A;  5LRS A;  1JHH A;  2IA1 A;  1REP C;  3EDP A;  1J7K A;  5K5R A;  3CO7 C;  4KT5 C;  3J81 K;  3I4P A;  5L3C A;  3KP6 A;  3K1M A;  2MD5 A;  4N9I A;  5AIP A;  6PAX A;  4GCV A;  3BOQ A;  1YO5 C;  2G7H A;  4I7H A;  3ABU A;  1S7A A;  1YS7 A;  2JSC A;  1R1U A;  2OQG A;  2VOP A;  1IZ1 A;  1XSV A;  4FX4 A;  1E17 A;  3L9F A;  4RB0 A;  4CXF A;  4P55 A;  3CLO A;  1OPC A;  2QQA A;  1TQP A;  3GW2 A;  4EM1 A;  2NAZ A;  2KKO A;  4HLY A;  4LJZ F;  3CUO A;  4LG0 A;  3HUG A;  2ISY A;  3F22 A;  1B6A A;  2L54 A;  3C18 A;  1FC3 A;  1NHA A;  2HTS A;  3D5L A;  4ZYD A;  4BXU A;  3JTG A;  2FXA A;  4LG0 B;  3BZ6 A;  1KYW A;  2Z9O A;  1LVA A;  4G7O F;  1MGT A;  1ZRF A;  3ZPL A;  2HWV A;  3ZN1 A;  1QZY A;  3F8F A;  3CTA A;  1U5T B;  2FMY A;  3WE2 A;  1UHM A;  3HRU A;  2QYO A;  1FZP B;  2G9W A;  2O03 A;  2R7F A;  2YU3 A;  4O3M A;  4ZH4 F;  2W25 A;  2YX7 A;  2PEX A;  1VTN C;  2M5W A;  3VFZ A;  2VC0 A;  1GXQ A;  3ZMD A;  3I5U A;  1LEA A;  2PG4 A;  5J8C A;  4B8X A;  2VE8 A;  5A2Q K;  5E17 F;  2XIG A;  3F8M A;  1Z9C A;  3WTU C;  1QQI A;  1XDS A;  2DK5 A;  1BIA A;  1E2X A;  3IC7 A;  3I58 A;  4N0B A;  3P9K A;  1P92 A;  3QPH A;  2GA1 A;  1CF7 B;  3HSR A;  2DPU A;  4Q48 A;  1YYV A;  1P6R A;  4M73 A;  3WU1 B;  3RI4 A;  2DLL A;  2FNA A;  1ZG3 A;  2IJL A;  3PFI A;  4U0W A;  4RGU A;  4FHT A;  2IT0 A;  3H92 A;  1SFX A;  3TO7 A;  4EJO A;  2GXB A;  3OOP A;  4KNY A;  4I0A A;  3BJA A;  2Z33 A;  2K4J A;  3EYI A;  1PDN C;  3GLX A;  2EFN A;  1YTY A;  3E6D A;  3KP5 A;  3JSP A;  3QAH A;  1IRF A;  4JQF A;  3E5X A;  2D45 A;  4ZZL A;  1YW7 A;  1STZ A;  1LDD A;  2H09 A;  1O3S A;  4BYY A;  3LST A;  3RJP A;  4IF4 A;  1RUN A;  2ZFW A;  4XLP F;  1FBU A;  2OU2 A;  2IPQ X;  2Q0O A;  1O3Q A;  2XKP A;  3EET A;  5DD8 A;  2PJP A;  3HSE A;  5H6Q A;  3U1D A;  4XSZ F;  1GXP A;  5FB2 A;  2NRA C;  2YR2 A;  1FT9 A;  3QOP A;  1B9N A;  2JTV A;  3GYH X;  4OMZ A;  4UV8 A;  4IVN A;  2HYG D;  5CVJ A;  4M71 A;  1MDM A;  1FX7 A;  1G3W A;  4Q4Z F;  4IXA A;  2V9V A;  3FMQ A;  5BPI A;  5CJ9 A;  4RS8 A;  1HXD A;  4XLN F;  1QZZ A;  4OMY A;  4YFK F;  3ISP A;  4I98 B;  2XAF A;  3AAF A;  1S29 A;  4Y13 A;  5D4S A;  1UB9 A;  4S05 A;  3M8F A;  1OYY A;  4CYD A;  2JRT A;  5K5Q A;  2FEZ A;  2P6S A;  3R61 A;  3L7W A;  1WKM A;  2EV5 A;  2WWY A;  1T38 A;  4G9Y A;  1JHF A;  1IN4 A;  4AVP A;  2XKO A;  4KN7 X;  1PP7 U;  4PGH A;  4HDU A;  3M7G A;  5HLH A;  3HHG A;  4L9T A;  4I01 A;  5BS6 A;  2D2W A;  3GUD A;  1DPR A;  3ECH A;  1B9M A;  3QP6 A;  3SQN A;  1W5T A;  2RGV A;  4R1H A;  4HF1 A;  4EJT A;  2BEO A;  4IRG A;  3KP7 A;  3TO9 A;  3J80 K;  2PBI A;  1PP8 F;  3FM3 A;  4UVB A;  1W7P D;  3IKV A;  1J9I A;  3D0S A;  1DPU A;  3BDD A;  2VXZ A;  4P9F A;  1OYW A;  1QBJ A;  2ZXJ A;  2IP2 A;  1K6O A;  3LQR A;  1F9N A;  1DDN A;  2DT5 A;  2M8E A;  4MTE A;  1K78 A;  3T0Y A;  3JAM K;  3LWF A;  3R4K A;  1XD7 A;  5LGU A;  1LEB A;  2FSW A;  3J7A O;  5D8K B;  4DNC A;  3R6S A;  1RZ4 A;  1XN7 A;  3RDI A;  3LA7 A;  5ICF A;  1K78 B;  3ZQ7 A;  2P7V B;  4KFC A;  3TDZ C;  2KRF A;  5D6E A;  1B4A A;  3TOB A;  2AXL A;  4GYI A;  2VBX A;  3HRS A;  4RAY A;  4OIR F;  3KFW X;  1XSX A;  2XAS A;  4AIH A;  2XRO A;  2CYY A;  2MC3 A;  1EH7 A;  5E1W A;  3U9G A;  3HRT A;  2KJB A;  3KP4 A;  5BMZ A;  2Z3Y A;  3BY6 A;  5L3E A;  1ZAO A;  1GVJ A;  4IPA A;  2EFP A;  2FNP A;  4PDK A;  3WGI A;  1Y0U A;  3QU6 A;  2FRH A;  3R0A A;  3T8T A;  5L3F A;  2HQR A;  3DFG A;  1O57 A;  3RPQ A;  1ODD A;  1BM9 A;  5FLX Z;  5CLS A;  1H9G A;  2HQN A;  1BC8 C;  3ABT A;  2O8X A;  4NB5 A;  2O6G E;  4U0Y A;  2VC1 A;  2M1B A;  3WTT C;  2F5E A;  5DV5 A;  4RAZ A;  5KK1 A;  1ZG5 A;  2QQ9 A;  2FBK A;  2NYX A;  3GZ6 A;  4I09 A;  2VOD A;  1IUY A;  1SAX A;  2CFX A;  1J5Y A;  4M9X A;  2HS5 A;  2UXX A;  2AS5 F;  1B1B A;  1B59 A;  3F3X A;  1BI1 A;  2ZME A;  4G6Q A;  3VOE A;  1J59 A;  1Z6R A;  1P2F A;  3N4M A;  2K4B A;  4WF2 A;  2HFH A;  4HF0 A;  2EFO A;  2OAZ A;  2A5Y B;  5HS9 A;  1R23 A;  2XRN A;  4O6J A;  4L9N A;  4CO8 A;  3E5Q A;  5HS8 A;  3BPX A;  1TLH B;  2XAQ A;  4PGG A;  4WWC A;  3K1P A;  3ULQ B;  4A12 A;  1S6L A;  4L18 B;  2K7L A;  2EK5 A;  3HRM A;  2EV6 A;  3GWZ A;  3WTX C;  1I27 A;  3E3V A;  3O3K A;  2J5P A;  2GIV A;  5AON A;  3HYI A;  5J6X A;  1TQI A;  4Y15 A;  1IF1 A;  5IT9 Z;  1R58 A;  1JGS A;  2VOO A;  1J2X A;  4CIC A;  1O3T A;  3F6V A;  2LKP A;  4ESF A;  1G3T A;  1FWZ A;  1JXS A;  4L0Z B;  1RUO A;  1WQ2 A;  3MAJ A;  2DQR A;  5ICG A;  5HLI A;  1I5Z A;  1JE8 A;  1TNT A;  2XAJ A;  4CZZ A;  2MBF A;  1A04 A;  3GEZ A;  4Q5S F;  5HOO A;  2EA2 A;  3DKW A;  2VT3 A;  3ELK A;  4ENJ A;  5LHI A;  2P7C B;  5LHH A;  5E18 F;  2CQK A;  3K2Z A;  3DQV C;  4KDP A;  4ON0 A;  3F6O A;  2PI0 A;  2HKO A;  3ERE D;  3BPV A;  1T2K A;  3U2R A;  4WXC A;  2A3S A;  3T1B A;  1YLF A;  1YW8 A;  4ESJ A;  1R5H A;  4JK1 X;  1IAW A;  1FSH A;  4HX7 A;  3HTS B;  4OIN F;  3LAJ A;  3FF5 A;  5ILV A;  4I2O A;  2EV0 A;  2PN6 A;  1BI2 A;  4CDG A;  3BRO A;  4NHJ A;  5FD5 A;  3K1N A;  4HX4 A;  1XGM A;  3S2W A;  3CUQ A;  1KU2 A;  3RPU A;  3TDU C;  3SFZ A;  1SD5 A;  3E97 A;  4BQA A;  2B0L A;  3ZN0 A;  4G7H F;  5JHU A;  4HZF A;  1LQ1 A;  1F4K A;  3FMR A;  2ZJ2 A;  1RI7 A;  2EFW A;  2ZO4 A;  5K5O A;  2X0L A;  2MH2 A;  4EV0 A;  1BOA A;  4KIG A;  3MEX A;  2W57 A;  1FBQ A;  2OQR A;  2M45 A;  3DV8 A;  2PMH A;  5K1Y A;  4E70 A;  1TW2 A;  4UHT A;  2QEN A;  4BHB A;  2OA4 A;  4HBL A;  4PCQ A;  1USS A;  5LEJ A;  2DTR A;  4ASN A;  2F2E A;  3GF2 A;  4B09 A;  2WC2 A;  1G6N A;  2M30 A;  5D5U B;  5LRR A;  4G7Z F;  1ZLK A;  4EGY A;  2CW0 F;  3DF8 A;  4LMY A;  2GA2 A;  1FYM A;  4LFU A;  4LLN A;  5JFR A;  1IXC A;  2XGX A;  4ENN A;  5L3G A;  3ZMS A;  4GYG A;  3HTU A;  3ECO A;  2VN2 A;  1Z7U A;  1R00 A;  2HDC A;  4BAY A;  3K69 A;  1SFU A;  4MHG A;  1YFH A;  1S8N A;  3RYP A;  5D5W B;  4A0Y A;  3LAP A;  3C3W A;  5JI6 A;  3N97 A;  3JSO A;  3TO6 A;  1I1S A;  2W84 A;  1QNT A;  4WXD A;  1CGP A;  1AWC A;  3TOA A;  2ESH A;  1FP1 D;  3T8R A;  1IW7 F;  1LJ9 A;  3NEU A;  2E7W A;  2ZNZ A;  3CJN A;  3B73 A;  4A5N A;  5ICC A;  2LDU A;  3GFJ A;  2A6E F;  1D5V A;  3REO A;  4Q47 A;  1SMT A;  4QLC U;  3QU3 A;  1ZGJ A;  2Y48 A;  2FBH A;  4AD9 A;  3ML6 A;  3Q5F A;  2RN7 A;  1WRJ A;  2QM3 A;  2DW4 A;  2HTJ A;  4BNC A;  1XCV A;  2YSR A;  2BBY A;  5AIQ A;  4RGR A;  4G6D A;  5DUK A;  1MDM B;  1TNS A;  3NRV A;  2EFQ A;  2EJR A;  5CYV A;  1MJB A;  1U8R A;  1YIO A;  2QQB A;  1ON1 A;  1OYI A;  4HV6 A;  2YPR A;  3MWM A;  4LB5 A;  3PQK A;  1UST A;  4N9H A;  4OIO F;  4EGZ A;  1HW2 A;  4LLL A;  2F5F A;  2Z99 A;  2CWE A;  2QWW A;  3CDH A;  2P8T A;  5CVR A;  5LEK A;  1YW9 A;  3HOT A;  5E8I A;  4Y17 A;  5BOX A;  1FPQ A;  2V6C A;  1ON2 A;  1G4D A;  3MZY A;  3M1E A;  1QO0 D;  1LDK B;  4WXH A;  5JR3 A;  2LF8 A;  2R3S A;  3VB2 A;  1U2W A;  2XVC A;  2MLG A;  1T6S A;  1D8K A;  1HQC A;  1P4X A;  3LQQ A;  3K9T A;  1V3F A;  1PUE E;  4KUM A;  3WTS C;  5ILU A;  2C6Y A;  3KET A;  1ZRD A;  1ZGA A;  2OBP A;  1J75 A;  4ZYE A;  2VBY A;  1GHC A;  1XGO A;  4U0V A;  2P5K A;  3ZMZ A;  3GVA A;  4U7D A;  1HST A;  3F21 A;  3I71 A;  5ED4 A;  3WTZ A;  3ZMT A;  4UVC A;  1UFM A;  2NNY A;  2IA0 A;  5DCF A;  2Q8K A;  5DCM A;  4MEY F;  3DXJ F;  2V1X A;  2V79 A;  1TBX A;  4P9U A;  2DO7 A;  2XAH A;  5TJJ A;  2MA3 A;  1XB4 A;  5EEH A;  3E5U A;  5DDG A;  2ISZ A;  3QRF F;  4UVA A;  1ZRC A;  2DQL A;  2P4W A;  1HKQ A;  1MJA A;  1R1V A;  3F8B A;  1H0M A;  4DQ2 A;  2BYV E;  4KMF A;  2VON A;  4EM2 A;  3WTV C;  2JPC A;  5H6R A;  2IVM A;  3SZP A;  1FP2 A;  3V8L A;  2L01 A;  1IN8 A;  1QGP A;  2E7X A;  3RIR A;  1MJ9 A;  2A07 F;  3GX4 X;  4KA4 A;  2JT1 A;  1KU7 A;  4MEX F;  2OZU A;  3O6B B;  3MCZ A;  3KZZ A;  5E8G A;  1R5G A;  1SFE A;  2V1U A;  1Z05 A;  2QUF A;  1I6X A;  3KLO A;  3CUQ C;  3QPT A;  2QVO A;  4KIB A;  3TKY A;  2GXG A;  3ROU A;  5FGM A;  4M9Z A;  4OIP F;  1UHW A;  4UV9 A;  1ZAR A;  1LB2 A;  3J81 Z;  1YG2 A;  4H0E A;  4F7Z A;  2VBZ A;  4RB3 C;  1MKM A;  4HOB A;  4XBF A;  4BH9 A;  2CG4 A;  1XGS A;  2ZME B;  2OD5 A;  2HZT A;  4LK1 F;  4BHP A;  3I59 A;  1R7J A;  4QWQ A;  2D1V A;  2XAG A;  1TQM A;  4LB6 B;  1MZB A;  3V8K A;  4U7B A;  1X3U A;  2LSO A;  3L09 A;  3RKX A;  4U88 A;  2A61 A;  4JBA A;  4WK8 F;  1EH6 A;  5E1Z B;  2BE5 F;  5HLG A;  4ZYG A;  2DI3 A;  2QBY A;  2RKH A;  3FMS A;  1ONV A;  2COM A;  4TV7 A;  1G3Y A;  2GQQ A;  3M8E A;  1QPM A;  3ZMU A;  2DFI A;  1U78 A;  1WI9 A;  2Q2E A;  2R7D A;  2VBW A;  1ZHF A;  1KA8 A;  3P7N A;  2H6B A;  2KJC A;  1XDU A;  2W85 A;  1ZYR F;  2IA2 A;  1KU9 A;  5E20 A;  2ZCW A;  4NQW A;  4WX9 A;  2A68 F;  1BC7 C;  3VEP A;  4YG2 F;  4MNU A;  1RIO H;  5FLX K;  2DU9 A;  4EVI A;  3IRQ A;  2MH9 A;  3T5X A;  1XCB A;  1DUX C;  3F23 A;  5LBQ A;  3WTW C;  2BGC A;  3KZY A;  4RGS A;  1IN6 A;  5DYM A;  4L9V A;  5ILS A;  4MQV A;  2VT2 A;  4EJU A;  4I0B A;  2UXN A;  4K2E A;  5F1R A;  1XSD A;  5A2Q Z;  1WWX A;  1F5T A;  2QZ8 A;  2RDP A;  2TDX A;  2FQ3 A;  1BBY A;  5F64 A;  4HX8 A;  3V7S A;  3G73 A;  3F8N A;  1LDJ A;  4EQQ A;  2CO5 A;  4ETS A;  5D8L B;  1ZH5 A;  3FXR A;  3MFK A;  4HLX A;  3M9A A;  4M9S A;  4IJA A;  3PQJ A;  2Z5U A;  5LGN A;  2KIM A;  4GXO A;  1FLI A;  2FBI A;  3V7R A;  4A5M A;  2H94 A;  3EUH A;  3EYY A;  4A6E A;  1I1G A;  5HVQ C;  1R22 A;  4OU0 A;  1W5S A;  1U3E M;  3K0L A;  2W24 A;  3WGG A;  1DP7 P;  4L9J A;  2M87 A;  3LA3 A;  1FSE A;  3VOD A;  3F8C A;  4IRI A;  5D5V B;  1HW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...