4HLXA

The crystal structure of the dna binding domain of virf-1 from the oncogenic kshv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
99
Chain Sequence
ASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K9
publication title The crystal structure of the DNA-binding domain of vIRF-1 from the oncogenic KSHV reveals a conserved fold for DNA binding and reinforces its role as a transcription factor.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Dna binding protein
total genus 23
structure length 99
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hlxA00
2MLKA 4EJWA 1UHWA 3GW2A 2M87A 2HQNA 3DF8A 3TOAA 2ZBKA 4FX0A 2Z9OA 2M30A 5TJJA 5LHIA 2L3DA 3BY6A 1IN7A 2D2WA 3FMRA 2VE8A 2A68F 4U7DA 4ENJA 3F23A 1KYZA 1LDJA 2P5LC 1MGTA 5D6EA 1QPMA 4L18B 2V1DA 1BIAA 4EV0A 4WWCA 5HLIA 3U2RA 1YS6A 1R00A 1G6NA 5CYVA 2YX7A 4LLGF 1SD4A 5TRDA 1WI9A 2W24A 1B9MA 3WE2A 1IW7F 3RKWA 3P9KA 1TQMA 3FHZA 1QGPA 3WTXC 5A2QZ 3LA2A 1IUYA 1U3EM 1D8JA 2ETHA 1SFXA 3WE3A 3SFZA 5IT3A 3E3VA 4YFXF 4RAYA 4ZYEA 2EA2A 3MCZA 5FO5A 3VOEA 5E1ZB 3PFIA 1O3RA 3QU3A 3BPXA 1Z91A 4EM0B 2V1UA 5JHUA 2A07F 2ACJA 1MDMA 1TW2A 3EDPA 2HKXA 3I64A 2NS0A 4GYIA 2P5KA 1ZRDA 3P9CA 1FYKA 2H09A 1QO0D 3ZP5A 3BP8A 4EGZA 1O3QA 2UWMA 5HOOA 2F5EA 3MEXA 3I58A 5LEKA 4HX7A 1WKMA 1HBXG 3GYHX 1L0OC 4A12A 3QP5A 1BJAA 2GWRA 2CYYA 1O7FA 2QWWA 1TTYA 1HXDA 3WTUC 4M6YA 3ML6A 2B0LA 3ZN0A 3R4KA 4P9UA 3GF2A 4A6EA 3SZPA 2DAOA 1IXRC 5AONA 5JI6A 2J5OA 1JHFA 1XCBA 3J81Z 2F5CA 1OYWA 2O61A 1FC3A 5HDNA 2HEOA 5ED4A 5FD6A 1G3SA 4A0ZA 1B59A 2KKOA 2Q0OA 2OAZA 2FNAA 2QYOA 1YQAA 5L3BA 3KP7A 2G9WA 3CO6C 4I2OA 4HZFA 4M73A 2XASA 2LF7A 4HV5A 1S3JA 3SXYA 4HQMA 2OA4A 3L2CA 2O0YA 1CF7B 2OQRA 3BROA 5LLQA 3JW4A 4CZZA 5DEQA 5D5XB 3EYYA 1FPQA 2A69F 1ON2A 4TV7A 3GO5A 2K86A 3F8BA 2D1HA 3M8EA 3HUGA 1FP2A 1XGOA 1G3WA 4RAZA 5L3FA 2Z5UA 3HOSA 4S04A 3GVAA 1XGSA 2EB7A 5ILUA 4U0WA 4NB5A 3CUQC 2CO5A 3FWEA 4AIKA 3KP3A 1J59A 5E17F 3V7RA 4RGXA 4FT8A 3MZHA 2EA4A 4ESJA 2FBIA 2ZFWA 2EFNA 3BPVA 2Q8KA 5CVJA 4RB1A 4IRGA 4P5OA 2WV0A 5EEHA 4HQEA 3E5XA 3DKWA 4YFKF 2OU2A 1TLHB 1L3LA 2XUBA 5LHGA 1R5HA 1JXSA 2NNNA 5FGMA 3ERED 3R6SA 4IRIA 1RI7A 2KJCA 3VB2A 1IN6A 4EJTA 1BI2A 2L02A 1FLIA 3TDZC 3N4MA 1ZREA 2BE5F 4KDPA 3V8JA 1EH8A 5L3CA 1EH7A 3F8FA 2JZYA 2A61A 3FZVA 2XAHA 4M6XA 4OIPF 2FMLA 2DBBA 2ZNYA 5FLXK 5D8KB 2PEXA 1FBSA 2RV8A 3G73A 3ISPA 1XCVA 4NHJA 1P4XA 4N0BA 1S7OA 3NQOA 2HKOA 5E1XA 1XGNA 3LAJA 1C0WA 1S6LA 4LGWA 2L4AA 1QBJA 4G94A 3ZMZA 1BI0A 4Y13A 3K1MA 4OU0A 4BHBA 2V9VA 2Z3YA 2HZTA 4LK0F 4ENKA 2A6EF 1TQPA 1SMTA 2XVCA 5LGTA 2LKPA 2BYVE 1MDMB 5D8LB 5D4RA 3ZMSA 4Q48A 2XKOA 3DP7A 1KQ9A 3R0JA 1HKQA 5BPIA 4AIHA 1SMYF 1Q1HA 4AVPA 3F6OA 2HDCA 1Z1DA 4ZZLA 3ZMDA 4F7ZA 2EV5A 2PJPA 3EQLF 1IXCA 5H20A 4WX9A 4JBAA 5HDGA 1XN7A 2KJBA 1U6GA 2PI0A 2YR2A 1O57A 4I0AA 4I0BA 1B1BA 3T1BA 1A04A 2CQKA 1MJBA 1TBXA 3IL2A 3M1EA 2FA5A 4P55A 1GXQA 3REOA 4XSZF 1ZHFA 3F8NA 2Z99A 4G8XA 3V7SA 3JAMK 1DP7P 4IHTA 2GZWA 4G7OF 1CF7A 1UFMA 2WWYA 3SZTA 5IT9K 4IPAA 3K0LA 2GA2A 2FBKA 1MJ9A 3HTUA 4GCVA 4ZZDA 4KA4A 3GX4X 3MWMA 1E2XA 2P7CB 4KT5C 1KQ0A 1R58A 3C7JA 3KZZA 2Z33A 4B8XA 2MA3A 2GA1A 1FSHA 5FB2A 4YIIA 2DQLA 3JTGA 1S29A 2VT2A 2IPQX 5BS6A 3MZYA 5BQTA 4EJUA 3D5LA 5HLHA 1FX7A 2JT1A 1H9GA 4GO1A 3ECOA 1U5TC 3IRQA 1OYIA 1FP1D 2EV6A 4KN7X 1ZG1A 4XLPF 2XRNA 1KU9A 1YIOA 4BNCA 1R22A 3WTZA 5H6QA 2QQAA 3ECHA 5E1WA 4L9TA 1ZN2A 3V8LA 5HS8A 2CGPA 3MAJA 1XB4A 1JHHA 5FD5A 4L9JA 5E8GA 4NQWA 1E17A 1XSDA 1USTA 1LDKB 2QUFA 5DUKA 3L7WA 1KYWA 3JAMZ 3F8MA 4L0YB 3KP5A 2W25A 3VFZA 5LEJA 4O6JA 2HS5A 4CDGA 4LB5A 4ENNA 2DPDA 2QQBA 2YPRA 4MTDA 3TOBA 5DUIA 2LF8A 3T0YA 4OMZA 4U7BA 3WGIA 1R1TA 1WQ2A 3IWZA 1SD6A 1XGMA 5DYMA 4R79A 4PGGA 2ESHA 3EETA 2IA2A 2R7FA 3WGGA 5J6XA 4YFNF 2W57A 2K4BA 1XMAA 4I01A 1YS7A 3KP6A 5ICEA 5ILVA 2VE9A 1PUEE 3I59A 4AIJA 3HSEA 2UXNA 1WSUA 3WU1B 1BI3A 2G7UA 4GGGA 3QP6A 4I98B 3QU6A 2AS5F 3IKVA 1PP7U 1ZGJA 5HDKA 2L4MA 2DK5A 3RKYA 1W7PA 3ELKA 3FX3A 2V79A 3RPUA 2HWVA 2F5DA 4M74A 4EM2A 3HOTA 4PGHA 4GYGA 4BQAA 1IN5A 3K1PA 4G6DA 2ZKZA 2H94A 4RB2C 2VC1A 4WK8F 3DPTA 4R8HA 1KGSA 3U9GA 1DDNA 3TO6A 1FBQA 1LEAA 2L01A 3O6BB 1REPC 2EFPA 3M8FA 5AIQA 2VOOA 5KVRA 4A0YA 5JFRA 4ZYGA 3IRRA 3E97A 2FQ3A 3OV8A 1H0MA 4RGSA 4BHCA 1MZBA 4OMYA 2FNPA 2J5PA 5CVVA 5D5WB 1ZYRF 3QAHA 2ZJ2A 5K5OA 4HLXA 5K5RA 3HRMA 3KLOA 1Y0UA 3WTVC 1O3TA 5DD4A 2EFWA 5DCMB 1I27A 1ON1A 4IXAA 3CJNA 5HS9A 2X0LA 5DCFA 1T2KA 2QLZA 3COAC 1KQ8A 3J80K 3ZN1A 5HVQC 4A5MA 3V7CA 1W5TA 2GXBA 3DFGA 4M72A 4HAMA 1DUXC 2NRAC 3MQ0A 4LJZF 3QOPA 2WTEA 2OBPA 1ZLJA 4HA8A 1HW1A 1F1ZA 4OOIA 3CUQB 2VODA 2VBYA 2JPCA 4K2EA 2YU3A 2ISYA 2GAUA 1AOYA 4HX4A 2H27A 1BC7C 2FBHA 1HW2A 2RC4A 1SD7A 4P9FA 5D4SA 2FE3A 1LDDA 3GFLA 2P8TA 1F5TA 1K79A 2CSOA 3RYRA 3QPTA 2CWEA 3BJ6A 3FF5A 2MH9A 1J2XA 1I1SA 3HSRA 3N97A 4CXFA 2A3SA 6PAXA 2O6GE 2NYXA 1MJAA 1R36A 2PG4A 2DU9A 4E70A 3Q9VA 1BBYA 4B09A 5BPDA 3R0AA 3TGNA 1P2FA 2NAZA 4QWQA 5DD8A 1AWCA 1KU7A 1IRFA 4UV9A 3BWGA 1YFHA 3FM3A 4RGUA 4EGYA 3OOPA 2FF4A 3DQVC 2P6SA 5CLSA 2EFQA 4DNCA 2DLLA 2QBYA 4MHGA 1R5GA 3VEPA 5AIPA 2IW5A 2PLYA 1YW8A 2KIFA 2E1NA 3B73A 4HX8A 3V4GA 3T8TA 1IN4A 2K7LA 4MQVA 3I4PA 2XAQA 2ZXJA 1KU2A 3C1DA 4A0XA 1RIOH 1V4RA 2IVMA 2HTSA 3L00A 3NEUA 4L9NA 2QQ9A 1DPRA 4ESBA 3W6KB 2DW4A 2PMUA 4JK1X 1I6XA 4UVBA 3I59B 3TO7A 4M71A 3CO7C 3K2ZA 4Q5SF 2DFIA 1F4KA 2QM3A 3KCCA 1LEBA 2RN7A 3D0SA 2PMHA 1YW7A 2ZNZA 3FM5A 1XSXA 1HSTA 3EYIA 1I5ZA 3M9AA 1IAWA 1W7PB 1HQCA 2VN2A 1J75A 2KIUA 2XROA 1YYVA 1FNNA 2CFXA 2LNBA 3TQNA 1J0RA 1OKRA 1YG2A 2ZMEA 3KEQA 1UB9A 3O3KA 2FXAA 2FEZA 2OQGA 4UVCA 4I7HA 2UZKA 3T5XA 1FBUA 2Y48A 1FWZA 4R1HA 4FHTA 3PQKA 1F9NA 2PBIA 4DQ2A 1XSVA 1YTYA 1P4AA 5ICCA 4IJAA 3K69A 4U0VA 2STWA 2EK5A 5F1RA 3SHFA 4MTEA 1Z9CA 3F3XA 2H6CA 2MC3A 1Z6TA 1H9TA 5FLXZ 3GZ6A 5JR3A 1OPCA 1S8NA 3GXOA 1W7PD 3L09A 5DCMA 4XBFA 2RVCA 1BM9A 3RPQA 5DV5A 4WCGA 4OIRF 2OZ6A 2HTJA 2STTA 2VBWA 4Z2YA 2CW0F 4HF0A 5E18F 3J7AO 1OR7A 4ENMA 2E7XA 2MLGA 2CG4A 1NHAA 1GXPA 1T39A 4KUMA 5LGNA 4O5VA 4L5JA 4A6DA 1LVAA 3F72A 4ETSA 1QZZA 2FSWA 3DPLC 5JVTA 3GUDA 1ZARA 2XAGA 3LAPA 3CUQA 2MD5A 5CVIA 4RGRA 3GZ5A 3RDIA 3RYPA 4HF1A 3BDDA 1RUNA 4MNUA 4MEYF 3SQNA 5D5VB 1TNSA 5LRRA 2M5WA 1BN5A 2ELHA 4QLCU 2IA1A 4EQQA 1I1GA 3C3WA 4CYDA 1QZYA 3R61A 5HLGA 2GXGA 1EV7A 4OINF 5CVRA 3U1DA 3JTHA 5BMZA 2IP2A 1R1UA 2RGVA 2W84A 4ZH4F 1BOAA 1USSA 1J5YA 4HW0A 4GXOA 3IKTA 1ZH5A 1Z7UA 1P6RA 5LHHA 4G7ZF 1MKMA 4CO8A 3BJOA 3I71A 4KMFA 4LD5A 3GFIA 3RTRA 2K4JA 1LQ1A 3IWFA 2IT0A 3L9FA 4IHSA 3TKYA 5IT9Z 2F5FA 3F6VA 3KEOA 3I0TA 4UXNA 1JE8A 4LLLA 4BH9A 4HDVA 4EJOA 4KN4X 4P96A 5D5UB 3WU0A 1IXSB 2XV4S 2KIMA 2YSRA 4KFCA 4WXHA 3RI4A 1B9NA 1MD0A 4YG2F 2GQQA 1D8KA 2IRFG 2HFHA 1K78A 2QBYB 3EUHA 4HF2A 3ULQB 1T38A 2E7WA 4KIFA 2M8EA 2FU4A 3HYIA 3WTYC 2O03A 1R7JA 4G9YA 2XHKA 2FMYA 3S2WA 3T8RA 3TDUC 4PCQA 4BYYA 4KIBA 1R23A 4HV6A 2BV6A 1FYMA 1D5VA 2X4HA 2JRTA 4LG0A 1BIBA 3P7NA 2GIVA 2H6BA 1T6SA 4MGRA 1P4WA 5D6FA 3WGHA 4XRFA 5LRSA 1G3YA 4JQFA 4D0PA 4M9ZA 2KRFA 3RKXA 3J81K 1JGSA 5ICFA 2OD5A 5E20A 3E6DA 1IRGA 3ABTA 2Y75A 3PQJA 3KLNA 5DDGA 2D1VA 2VOPA 3CUOA 2XIGA 1VTNC 2PN6A 3KP2A 2ZMEB 2V1XA 2AXLA 3ZMUA 3LWFA 1FYLA 4OIOF 1RUOA 3WTSC 5K5QA 1G3TA 3F22A 4A2UA 4KMUX 4N9HA 4Q47A 3M7GA 5LGUA 3KE2A 2VT3A 3MFKA 3IC7A 4I02A 3CDHA 4L9VA 4WF2A 5H6RA 5KK1A 2VBZA 1PP8F 3H3UA 2EJRA 2VXZA 4WXCA 5ILSA 2YX4A 3HRTA 4LFUA 4L0ZB 1IN8A 2K27A 3ABUA 1ULYA 1U78A 3Q5FA 3HSFA 4BXUA 2P6TA 4RB0A 2XKPA 3RJPA 2LSOA 4PDKA 3JSOA 2QVOA 4HBLA 4UHTA 1HSJA 2VONA 1T0FA 3KP4A 1KU3A 3FXRA 1ODDA 1TNTA 1ZRCA 3HRUA 2A6HF 1K6OA 2ZO4A 1UHMA 3LA7A 5LBQA 2M45A 1HKSA 5J8FA 5ICGA 1FZPB 1U5TA 4LLNA 1OYYA 2HYGD 3GFJA 1HW5A 4A5NA 4CHUA 3LQRA 2EWNA 2W85A 1SFEA 2JPBA 4IVNA 2D45A 3Q9SA 4I09A 4LK1F 3LSTA 2EV0A 1ZLKA 1S7AA 4LB6B 1V3FA 1U2WA 4OIQF 3BOQA 3HRSA 4AD9A 2RNJA 4UNOA 1STZA 5HS7A 4UVAA 4M9XA 2ESNA 2RKHA 5ERIA 3QPHA 4BAYA 1ONVA 4FX4A 1XDUA 5FFZA 2XAJA 1ZRFA 3LQQA 4CGZA 2R3SA 3WTTC 2ADUA 4RS8A 3C18A 1XD7A 2O3FA 3RIRA 5J8CA 3F8CA 3TO9A 3VODA 1FOKA 3QRFF 1BC8C 4UV8A 1FY7A 1SFUA 1J7KA 1J9IA 2IA0A 2M1BA 2RDPA 2P5VA 4Y17A 5F64A 3W6JB 4RB3C 1K7AA 2MH2A 1ZGAA 3J80Z 3WTWC 1XMKA 1B4AA 4XSXF 1QNTA 2DPUA 1O7LA 1TQIA 3FXUA 3H92A 2TDXA 3FMQA 1LJ9A 4N9IA 1SD5A 5CJ9A 1YO5C 4MQ9F 2ZCWA 1ZG5A 3BJAA 2HQRA 2P7VB 4BHPA 2Q2EA 3KETA 2QENA 3GFMA 2FOKA 1K78B 2E1CA 4Y15A 3HHHA 2C6YA 4EM1A 3R60A 3CLOA 2F2EA 1FSEA 4YIFA 5L3EA 4G7HF 4EJVA 1IF1A 3DV8A 2XAFA 4ZYHA 4G6QA 2VBXA 5EEGA 3FXQA 2NNYA 1TW3A 4U0YA 1DPUA 2R7DA 5K1YA 2A5YB 1T98A 2BGCA 2L54A 3E5UA 1KA8A 3O2PE 4LG0B 3WG9A 4LMYA 5BOXA 1PDNC 1YW9A 5L3GA 1WWXA 3BZ6A 4Q4ZF 2LDUA 2JSCA 4KNYA 2HOEA 4CICA 1ZG3A 4S05A 4WXDA 4UUVA 5L3DA 1QQIA 3B02A 3GLXA 1Z05A 1HKTA 4H0EA 2HGCA 2EFOA 3HIFA 2DO7A 1IZ1A 2DK8A 2O8XA 1RNLA 1O3SA 1SAXA 1W5SA 2PFBA 4O3MA 3ZMTA 3AAFA 3P9IA 1YLFA 2BBYA 2UXXA 3KFWX 2COMA 4ZYDA 4IRHA 2QZ8A 3ZQ7A 1RZ4A 3E6MA 4PZJA 2MBFA 3LFKA 1OMIA 4ON0A 2BEOA 2VC0A 3I53A 3E6BA 2DTRA 2HR3A 1UCRA 4HOBA 2RQPA 1LNWA 3JSPA 4AWXB 1U8RA 3K9TA 1LB2A 5CVUA 3HTSB 5E8IA 1GVJA 4M9SA 2FRHA 2HYFA 3DEUA 4XLNF 2WC2A 4HDUA 3E6CC 2OZUA 1GHCA 1R1VA 3K1NA 1P92A 3ROUA 3LA3A 4HYEA 3E5QA 5F6FA 2ISZA 4ASNA 4L5IA 3ZPLA 1Z6RA 2V6CA 4KIGA 1B6AA 3I54A 4KICA 4U88A 1U5TB 3ZMVA 2K02A 4MEXF 3I5UA 3H3ZA 3HHGA 2DT5A 2DI3A 2DQRA 1W4MA 2IJLA 1D3YA 4EMSA 1WRJA 1EH6A 4HLYA 1BI1A 3G3ZA 2Y0MA 2PQ8A 4IF4A 3WODF 1FT9A 3KZYA 2G7HA 3GEZA 1G4DA 3IHUA 3DXJF 1CGPA 1ZAOA 2XGXA 2P4WA 5A2QK 1X3UA 3F21A 2JTVA 4ESFA 4EVIA 3FMSA 3NRVA 3CTAA 4KYWA 1XDSA 3V8KA 5FFXA 3GWZA
chains in the Genus database with same CATH superfamily
2MLKA 4EJWA 1UHWA 2DFHA 2M87A 3GW2A 2HQNA 3DF8A 3TOAA 1QPIA 2ZBKA 4FX0A 3PUFA 2Z9OA 3S1RJ 2M30A 5TJJA 5LHIA 2L3DA 3BY6A 1WZ2A 3K4NA 1IN7A 4M3FA 4XICA 1OJLA 1BW6A 3QYBA 2JSPA 1NG6A 2D2WA 3FMRA 2W48A 2VE8A 3OS0A 2A68F 4AYBA 3HDDA 4U7DA 2XPVA 4ENJA 3F23A 1KYZA 1LDJA 1XPXA 2P5LC 4UB6C 1MGTA 5D6EA 1QPMA 4L18B 2EZHA 4NNJA 2V1DA 1Q1VA 1YJWI 2OUMA 2DTZA 1BIAA 4EV0A 4XORA 4WWCA 5HLIA 4J00A 4BUPA 3U2RA 1YS6A 1ZGWA 4X0GA 3TEDA 2VKHA 3BC8A 1R00A 3M3YJ 1G6NA 2VASA 3ABLH 5CYVA 3EPZA 3F9KA 2YX7A 2YUSA 2E2JJ 2CQXA 2EZLA 4LLGF 1SD4A 1D0ZA 2WAQN 2DT7B 4RM2A 5TRDA 3HGGA 2BY1A 1WI9A 2W24A 2Q2EB 3OWTA 3BG7A 5CPRB 2FOWA 1B9MA 3WHCA 3WE2A 4PJLA 1IW7F 3OSFA 2E5NA 3BG9A 3RKWA 3P9KA 1TQMA 1ETXA 3FHZA 2XPWA 2OV7A 3W6VA 4BQOA 4IHXA 1QGPA 3WTXC 4E4HA 5A2QZ 3LA2A 1IUYA 4C2UA 3JRIA 1U3EM 1SVOA 1D8JA 1SFOJ 3K70C 3OL4A 2ETHA 1SFXA 2KISA 5EG0B 4CYCA 3SFZA 3WE3A 4QSHA 2EPFA 2XAUA 5IT3A 3WU2C 3E3VA 2L7MP 5M5XJ 4YFXF 2IXSA 1X4PA 2DOFA 1TT0A 3J7YJ 2NVTJ 1S9HA 2ICWG 4RAYA 4ZYEA 2EA2A 3MCZA 5FO5A 1XS9A 2OTLI 1WVRA 3VOEA 3SFIA 5E1ZB 3PFIA 1IDZA 4XMYA 3QU3A 1O3RA 1DP3A 3BPXA 1LPQA 1Z91A 4EM0B 2V1UA 5JHUA 3U21A 2H1KA 2A07F 2JA7J 3KIOA 9ANTA 5J4YA 2ACJA 1MDMA 1TW2A 3EDPA 2HKXA 3I64A 2M7BA 5FROA 2JUGA 2DMPA 2Q1ZB 4PJNA 2NS0A 2HDWA 2TRTA 4DYRA 4A3JJ 4X6AJ 4GYIA 3K4LA 3KYCB 2P5KA 4MIMA 3C2BA 1EJ9A 3A0BC 1ZRDA 3P9CA 4E7LA 5M3MJ 1FYKA 2H09A 1QO0D 4LIVA 5J40A 3ZP5A 3BP8A 3H9QA 4EGZA 1O3QA 4C3JJ 3JREA 4F3QA 1N75A 2UWMA 5HOOA 1WJBA 4NC8A 2R5YB 2F5EA 3OYJA 3MEXA 3I58A 4IKFA 1X1DA 5LEKA 3OYGA 4HX7A 1H8AC 2JA6J 1WKMA 1HBXG 5IP7J 3GYHX 4IHYA 1L0OC 4XLEA 4A12A 3QP5A 1N78A 1PVEA 1AU7A 1BJAA 2GWRA 5IOYA 2CYYA 1O7FA 3SDBA 2QWWA 3HC7A 1TTYA 3LMMA 5E3NA 1HXDA 3WTUC 4M6YA 3ML6A 2B0LA 2DMTA 3ZN0A 3R4KA 2ZMEC 4P9UA 3GF2A 5GTHC 4A6EA 3SZPA 1LVKA 3VSLA 2LFBA 2DAOA 5EGOB 1IXRC 1TWCJ 1PUFA 5GAGJ 1GV2A 2LBFA 4B3AA 5AONA 5JI6A 2J5OA 1JHFA 1XCBA 2CFOA 1WH5A 3J81Z 1MNEA 2BZTA 2F5CA 2VQCA 1OYWA 3K4BA 1K4SA 2F5VA 2O61A 1FC3A 3RQIA 5HDNA 3JR9A 2HEOA 5ED4A 5FD6A 1G3SA 2N8GA 4A0ZA 1B59A 3CJRB 2KKOA 2Q0OA 2BVLA 3G71I 1K6YA 1K61A 2OAZA 3A0HC 2FNAA 1OFCX 2QYOA 2E35A 4PSXA 4BQNA 1YQAA 3OSGA 5LFAA 2CJJA 4ZTFA 3CDLA 5L3BA 2Y69H 3KP7A 2G9WA 3CO6C 4E7SA 4I2OA 1UG0A 4HZFA 3TW7A 5FJ8J 2EBIA 2L9NA 4M73A 2XASA 2LF7A 4HV5A 3PNTA 4ZC3A 1S3JA 3SXYA 4HQMA 2OA4A 4ZTJA 1FJLA 1ACIA 1JUPA 2O0YA 3L2CA 1CF7B 2FX0A 2OCCH 2LKSA 2OQRA 3LL7A 3BROA 5LLQA 1ZR4A 1WI3A 3C2HA 3JW4A 2EINH 3RCOA 3V42A 4CZZA 3HOWJ 1AHDP 5DEQA 2DYSH 2NS8A 5D5XB 2R7XA 3EYYA 1OR7C 1FPQA 2VI6A 3PIPF 5FRNA 5B5EC 4FETA 3G6EI 4HSRA 2LD5A 2A69F 1ON2A 4TV7A 1WGXA 3GO5A 4C2MJ 2K86A 3F8BA 1RPWA 2D1HA 3M8EA 3DKYA 2FJ1A 1U9NA 3HUGA 2DMQA 1FP2A 2CS3A 1XGOA 1G3WA 4RAZA 5L3FA 3S3MA 2Z5UA 3HOSA 1QA6A 4S04A 3GVAA 1XGSA 4A3GJ 3K7AJ 3JCUC 2EB7A 5ILUA 3KEYA 4U0WA 3OS2A 4NB5A 3CUQC 1F43A 1TZLA 2CO5A 3FWEA 2WY7Q 4AIKA 2MABA 3FXMA 3H36A 2GOXB 1Y1WJ 3KP3A 1J59A 5E17F 3VDXA 4DZJA 4DIQA 1FOXA 4F55A 1MMDA 1ETWA 3V7RA 2JQ7A 1I39A 4RGXA 1ITYA 5K7FA 2F4IA 4FT8A 3MZHA 1Z7LA 2EA4A 4ESJA 2FBIA 4XRSA 2ZFWA 2EFNA 2MYSA 3DBRB 3BPVA 2Q8KA 5CVJA 4RB1A 3K4MA 4IRGA 4P5OA 2WV0A 5EEHA 4HQEA 1TP4A 3E5XA 2ZXWH 2R7WA 3DKWA 4ZDLA 4YFKF 2OU2A 3J7ZI 1JKRC 1TLHB 4S0HB 4FE4A 4BE0A 1L3LA 1XX5A 1IRXA 2JMWA 2XUBA 1TC3C 5LHGA 4CUGA 3K4JA 1R5HA 3G1LA 2V4JC 2MC4A 3HOXJ 4XOPA 4BBSJ 1JXSA 3BCBA 2V9KA 2NNNA 2K3FA 5FGMA 2IS1A 4G6TB 3ERED 3GLLA 3R6SA 4IRIA 1RI7A 1R71A 2KJCA 2LH9A 3VB2A 5EDNA 3OYKA 3SEQA 2CRGA 1IN6A 4EJTA 2WB1A 1BI2A 2L02A 2XSDC 1FLIA 1XTAA 4OAZA 3TDZC 3N4MA 1ZREA 1MH4A 4CH7A 2BE5F 1QVUA 1YX3A 3CC2I 4KDPA 1P7JA 3HKZA 2CMPA 3I56I 3V8JA 1JJ6C 1EH8A 2V7FA 1GDTA 2LYCA 5L3CA 3MD2A 1EH7A 3E7LA 3F8FA 3B6CA 2JZYA 2A61A 3FZVA 2XAHA 1WHUA 3I3LA 4PK4A 4M6XA 3VYUB 5IYDJ 2X48A 4OIPF 5HLTA 2FMLA 2DBBA 2ZNYA 5FLXK 5D8KB 2R7SA 2PEXA 1FBSA 1V54H 2V26A 1HLVA 2RV8A 5HNHA 3OYNA 3G73A 2WA0A 5M3FJ 3MKWB 1TWHJ 3ISPA 1XCVA 4NHJA 1P4XA 4N0BA 4XL9A 1QRYA 1S7OA 3HBLA 2HKOA 3NQOA 4AU7A 2DODA 5E1XA 1XGNA 4D7MA 3LAJA 3O8HA 2QF7A 3PO3J 1C0WA 3O8GA 2R0QC 1S6LA 4LGWA 2L4AA 2DA6A 1IC8A 3TW6A 4G94A 1QBJA 2A6TA 3ZMZA 1BI0A 4A93J 2Y0SN 3EUHC 3K1MA 3QPSA 4OU0A 3TMOA 2XPUA 4Y13A 2NVXJ 4BHBA 1IUFA 2BXYA 3M1CA 2FD5A 2V9VA 2Z3YA 2KLOA 3DLLF 1QZEA 1MMAA 2HZTA 5J47A 5E3OA 4LK0F 4JOMA 4ENKA 2A6EF 3OYMA 3KYDB 2MD0A 5C3EJ 1TQPA 1JT6A 4RAFA 1SMTA 2XVCA 3QWLA 5LGTA 2E60A 2L2OA 2LLKA 2LKPA 1HF0A 2EH3A 3OIPA 2K9NA 2BYVE 1MDMB 5D8LB 5D4RA 3ZMSA 4Q48A 4BY1J 2XKOA 5H2FC 3DP7A 4XN0A 4KJZA 1VQ6I 1KQ9A 3R0JA 4V2GA 1BR4A 1HKQA 2GOMA 5BPIA 4AIHA 1SMYF 1Q1HA 4AVPA 1VQ4I 1Y8QB 3ZQGA 1KZHA 1X3ZB 1QU3A 1POGA 3F6OA 2HOTA 3A01A 5GP9A 2XRLA 5B1BH 3Q0WA 1X58A 2HDCA 1Z1DA 4ZZLA 4B1RA 3ZMDA 4F7ZA 3IAS2 4ITVA 2CU7A 2EV5A 3KPHA 2PJPA 1BJZA 2X6XA 3EQLF 1IXCA 5H20A 3VWBA 2H8WA 3MKLA 4WX9A 4JBAA 3F0CA 2KRCA 1X19A 2XGEA 5HDGA 3S3NA 4U87A 1XN7A 2KJBA 3MKYB 2L0KA 3S32A 4DJAA 3CP8A 4XK4A 3BR5A 1U6GA 2PI0A 1OQYA 1KONA 2YR2A 3HM5A 1MNDA 1O57A 4I0AA 4I0BA 1B1BA 3T1BA 2HQ5A 2YS9A 1A04A 4A3KJ 3RPUD 4E7JA 2CQKA 1MJBA 1N77A 1TBXA 5C4JJ 3IL2A 3CMAI 1SANA 1PUFB 2LBFB 1APLC 3M1EA 4LIUA 4D5CA 3L2RA 2FA5A 1NK2P 4P55A 1GXQA 2PMZN 3REOA 1JI8A 4XSZF 1GT0C 1ZHFA 2E1MC 2ME0A 3G2BA 5FKKA 1IO2A 1X3WB 3WHBA 1X1AA 3F8NA 2Z99A 4G8XA 1VQPI 3V7SA 3JAMK 1DP7P 4IHTA 2GZWA 4ZDOA 3ZQQA 4G7OF 2F48A 1CF7A 2D5VA 1UFMA 2ME6A 3LSJA 3SZGA 1Y8RB 2WWYA 3SZTA 5IT9K 5JVGF 3CMMA 3ZQIA 2JVGA 1OCCH 2ZJPF 1VQOI 1TWAJ 3K6GA 3AFHA 4IPAA 3K0LA 2ZXHA 1RC9A 2GA2A 2FBKA 2XDVA 2X1EA 1MJ9A 2LVSA 3HTUA 4GCVA 2OC6A 4ZZDA 4KA4A 2V6EA 3GX4X 2LREA 2QGUA 3MWMA 1E2XA 2P7CB 4KT5C 1KQ0A 2XB5A 1M1EB 2DXIA 1R58A 2LK2A 2DMNA 1MNMC 2E2HJ 3C7JA 1HOMA 3KZZA 2Z33A 5CKTA 1JGGA 4B8XA 2LC2A 3CF2A 2MA3A 2L5QA 3L2WA 2GA1A 4C30A 1T0FC 1FSHA 5FB2A 4C9YA 3IH2A 1S5LC 2CW8A 4YIIA 1IG7A 2DQLA 3OR2C 3JTGA 1S29A 2VT2A 1SAUA 3MMYB 2IPQX 5BS6A 3MZYA 5BQTA 4JYKA 4EJUA 3LSHA 5B1AH 3D5LA 5HLHA 1FX7A 2JT1A 1H9GA 1VQMI 5EZHA 4GO1A 3DEWA 3ECOA 2ZFUA 1U5TC 3HUGB 3IRQA 1OYIA 1FP1D 2EV6A 2IGKA 1MMSA 4JP0A 2L7ZA 4KN7X 1ZG1A 1DQUA 4XLPF 3ASNH 2DA5A 2HPIA 2XRNA 1KU9A 1YIOA 4BNCA 1R22A 3WTZA 1UG2A 5H6QA 2QQAA 3ECHA 5E1WA 2I8DA 4L9TA 2HOAA 1ZN2A 4JX6A 4YIRX 3V8LA 5DS9A 5HS8A 4Z6YA 1G8XA 4XR6A 2CGPA 1JKPC 3MAJA 5TISC 1VQ5I 2M4GA 1XB4A 1JHHA 2VJ5A 3BR0A 3ESWB 4MFDA 5FD5A 4L9JA 3S15J 5E8GA 4NQWA 1E17A 1XSDA 4BJ6C 1USTA 1B8IA 1LDKB 2QUFA 1VQNI 5DUKA 3L7WA 1KYWA 1Y6IA 3JAMZ 3F8MA 1T56A 1BW5A 1ZELA 4L0YB 3KP5A 2W25A 3VFZA 3DWLE 5C4XJ 1LKXA 5KAIC 5LEJA 4O6JA 2H1LA 2HS5A 1X1CA 2VL8A 4CDGA 4LB5A 4D5FA 3PUBA 4ENNA 3RKQA 2DPDA 3TL4X 2IEKA 2QQBA 2YPRA 4MTDA 1A36A 1E0EA 3ERMA 5EF6A 3TOBA 4A69C 2Z2SB 2MSYA 5DUIA 2P81A 2LF8A 3OYEA 3GTQJ 1VZ0A 3T0YA 3JRGA 4OMZA 4U7BA 3WGIA 4IL6C 1A31A 4BGDA 1R1TA 3QPLA 1WQ2A 3CLQA 2ID6A 3IWZA 1SD6A 1XGMA 3LSIA 5DYMA 4DBQA 4R79A 2GBYA 4PGGA 2O5RA 3NWTA 1MH3A 2ESHA 3EETA 2IA2A 2R7FA 2EIMH 3HGYA 2QA4I 3WGGA 5J6XA 4YFNF 1PJRA 4A3FJ 1GUUA 1LFUP 5GAHJ 2PJRA 2W57A 4EEFG 2K4BA 1XMAA 4DYCA 4I01A 3L2UA 1YS7A 3KP6A 5ICEA 5ILVA 2VE9A 1PUEE 3I59A 4AIJA 1R9TJ 3H0GJ 1SVLA 3HSEA 3MN2A 1YE9A 2LY9A 2UXNA 1WSUA 1LFBA 4JX4A 3WU1B 1WJEA 1BI3A 2G7UA 1U9OA 4GGGA 3QP6A 4I98B 3QU6A 2AS5F 3IKVA 1PP7U 1ZGJA 5HDKA 2L4MA 2DK5A 2R7UA 1D1CA 1Z3YA 3RKYA 1VQ8I 1W7PA 4BXXJ 3ELKA 3FX3A 3ABKH 2V79A 3RPUA 2HWVA 3CMEI 1Z3XA 2F5DA 4M74A 4EM2A 2WAQA 3HOTA 1YJNI 2DOAA 3S2HJ 4PGHA 1GV5A 4GYGA 3K70D 2CQ7A 3GZNB 5F08A 1W5CC 4BQAA 1I6HJ 5IPAA 2X51A 2B9SA 1JKOC 1BR1A 1IN5A 5FRMA 3K1PA 4G6DA 2ZKZA 2MW8A 2IGOA 2H94A 4RB2C 2VC1A 4WK8F 2BHYA 5HODA 1OLTA 3DPTA 3BTIA 4R8HA 3IH4A 1KGSA 5LD2C 2EIKH 3U9GA 4DW6A 1DDNA 3FDYA 3TO6A 1FBQA 1QVTA 1LEAA 3HZJA 2L01A 1BR2A 3E1SA 1DGRM 2EFPA 3O6BB 1REPC 3A02A 3M8FA 5AIQA 1ETKA 2VOOA 2CQQA 4ANJA 5KVRA 1TL8A 4I76A 5IYBJ 4A0YA 5JFRA 3FXKA 2IS4A 2AHQA 4ZYGA 3W2WA 4Y33A 4A3CJ 3IRRA 3E97A 3BTLA 3A01B 1OISA 3UKGA 2FQ3A 3H9JA 3OV8A 4XKBA 2WY8Q 1H0MA 4RGSA 5F04A 3Q3SA 3OY9A 4IQ4A 3AG3H 3BQYA 2NS7A 4BHCA 1MZBA 4OMYA 4GRIA 1YJ9I 2FNPA 2J5PA 2KZVA 1Y39A 5CVVA 4E7ZA 4B4CA 3ASOH 3G1MA 2LOOA 5D5WB 3D5SC 5J1RA 3RZDJ 3IH3A 1ZYRF 3QAHA 2ZJ2A 5K5OA 3JRHA 4BJ5C 4HLXA 5K5RA 3HRMA 3RQ4A 3KLOA 4UB8C 1BOBA 1Y0UA 2CQNA 3WTVC 1B72B 3JRDA 1O3TA 5DD4A 2EFWA 1QHGA 1Z0XA 5DCMB 2WV1A 1I27A 4N4OB 4FASD 5F1JA 1ON1A 4F91B 4IXAA 2K9LA 1T08B 3CJNA 5HS9A 5KAFC 3J7AY 1WJCA 4C3HJ 2X0LA 5DCFA 2OJED 5EYRA 1T2KA 4XLAA 2LY2A 2QLZA 1X1BA 3COAC 1KQ8A 2R7RA 2M7AA 2UUZA 4J01A 3J80K 2HVRA 2JA5J 3ZN1A 5HVQC 2KL4A 4A5MA 2KIQA 3I4NJ 3V7CA 3VSKA 2XF5A 1W5TA 2GXBA 5E3LA 3DFGA 1WJ5A 4M72A 3D1NI 3QODA 4XRMA 4HAMA 1D0XA 1DUXC 4IOAF 1WJFA 2NRAC 3MQ0A 1WPKA 4LJZF 3ZRGA 1WFXA 2Y9ZA 1LFPA 2R4GA 3QOPA 2WTEA 1NG7A 2OBPA 4B47A 2RNGA 1ZLJA 1MMNA 1HW1A 4HA8A 4IX7A 1F1ZA 3JRFA 4OOIA 3CUQB 2VODA 2AQEA 2KRHA 2M0MA 2VBYA 3FK7A 3BG5A 5DM7F 2JPCA 4K2EA 2YU3A 3FISA 2ISYA 3QQAA 2VPLA 2GAUA 2LRDA 3CJQB 4DOZA 1AOYA 3SYTA 4HX4A 3FIWA 3LSMA 1JT0A 2V9PA 2H27A 1BC7C 2FBHA 3DTEA 3DTIA 3QYEA 1LUJB 1HW2A 1SFKA 2VQHA 4PJ0C 4A3MJ 2RC4A 1SD7A 4P9FA 5D4SA 2FE3A 1VQ7I 4GDFA 1LDDA 3GFLA 2P8TA 4II2A 1F5TA 2VQGA 2O8KA 3OL3A 2CSOA 5FKLA 1K79A 2GXAA 3RYRA 4CA0A 3QPTA 2CWEA 3S1NJ 3BJ6A 3FF5A 2MH9A 1J2XA 1SC7A 1I1SA 3S93A 4BDYA 1OCOH 4A3DJ 3HSRA 3BT9A 3N97A 4CXFA 3IAM2 2A3SA 6PAXA 2O6GE 2NYXA 1OCZH 2F4MB 2L9RA 1Y1VJ 4F93B 2VJ4A 4IEJA 1NH3A 1SVMA 3W2VA 5J1UA 1MJAA 2W82A 4YEJA 1RETA 5FKOA 2WB1N 1R36A 2PG4A 1E3PA 2DU9A 4ZJZA 1FOYA 3LOCA 2KMUA 4E70A 5J1YA 3Q9VA 1BBYA 2HXIA 4B09A 5BPDA 4FQGA 5F0FA 3PM1A 3R0AA 3TGNA 3GTPJ 1P2FA 1T95A 2NAZA 4NQWB 2K9MA 3BR3A 4QWQA 1MBEA 1B8IB 2IAIA 5DD8A 1AWCA 2KT0A 1KU7A 3K10A 2DJNA 3ZQLA 1IRFA 2DA3A 4UV9A 3BWGA 5J4VA 1YFHA 3FM3A 4RGUA 3PSIA 4EGYA 3OOPA 3HXLA 2FF4A 4B43A 2F6CA 3DQVC 3GTGJ 3I4MJ 1D1BA 2P6SA 5CLSA 2EFQA 1R4NB 2DLLA 3HG9A 4DNCA 2QBYA 4DGWB 4MHGA 1R5GA 3VEPA 2LMDA 5AIPA 4GFBA 2IW5A 4E7IA 2PLYA 1YW8A 2KIFA 2E1NA 4UY8I 3B73A 4HX8A 4XKVA 3T8TA 3V4GA 1IN4A 4YRVA 1ENHA 2K7LA 1YRNA 4MQVA 3I4PA 2XAQA 2ZXJA 1KU2A 2O7OA 2CUFA 2E71A 5KNLA 2DT6A 3C1DA 4A0XA 3MZ8A 1YOVB 3OIOA 3UNGC 3IUOA 4L5EA 1X4OA 3EUKL 1RIOH 4KISA 1V4RA 2IVMA 4BACA 2HTSA 3L00A 3NEUA 4L9NA 5KCMA 2QQ9A 3OYHA 1DPRA 4ESBA 4LOCA 2WBMA 3FKJA 2PJRB 4HSTA 4M3EA 3W6KB 4BEHA 2QSFX 2DW4A 2PMUA 3TBIA 4JK1X 4BJTA 1I6XA 4UVBA 4QTRA 3I59B 3TO7A 4M71A 2M0CA 1QHHD 3CO7C 1W0TA 3HEFA 4IQJA 3K2ZA 2K40A 2COBA 4Q5SF 2DFIA 2JRMA 4Y4RA 3HOVJ 1F4KA 1ORKA 2QM3A 3KCCA 1LEBA 2BXZA 2RN7A 3D0SA 2PMHA 3S1MJ 1YW7A 2DOEA 3AKZA 4W1UA 2KDOA 2ZNZA 3FM5A 1HSTA 1XSXA 3EYIA 2Y9YA 3PIOF 1I5ZA 3M9AA 3QYFA 1IAWA 1W7PB 2H8RA 2QQ8A 1YI2I 2DMUA 1HQCA 2VN2A 1J75A 2IS2A 2KIUA 4HPQA 3BZCA 1YYVA 2XROA 2CH0A 2RREA 1XG1A 1ETOA 1A6IA 2X85A 4E7KA 3DU5A 1FNNA 2VKEA 2CFXA 3GTOJ 1RKTA 2QKLB 2LNBA 3TQNA 1J0RA 1A35A 1OKRA 2HVQA 1YG2A 3AL0B 3RZOJ 1MBKA 2ZMEA 3ZQCA 2DA2A 4YELA 2K85A 3KEQA 1UB9A 3O3KA 1HDDC 2FXAA 3BG6A 4M3GA 2FEZA 1ZTRA 2OQGA 4UVCA 1XMXA 4HRIA 1MMGA 2M34A 4I7HA 2UZKA 3T5XA 1FBUA 2Y48A 3BR2A 1FWZA 4R1HA 4BE1A 2LY1A 3CJTB 3PQKA 1F9NA 4FHTA 4B48A 1AKHA 3VYTB 2XGCA 1V5FA 2PBIA 4DQ2A 1XSVA 2JWTA 3LSPA 1YTYA 4XLCA 1P4AA 5ICCA 4C3IJ 4IJAA 3K69A 4LG3A 4U0VA 1JTXA 2STWA 2EK5A 5F1RA 1BA5A 3OYAA 2Y0SA 5GPCA 3SHFA 5IYCJ 4MTEA 2DYRH 1Z9CA 3C2GA 3GCMA 3F3XA 2H6CA 2MC3A 5EEAA 2MGQA 1Z6TA 2X6YA 1H9TA 5FLXZ 3GZ6A 5JR3A 1OPCA 1S8NA 3JRCA 3DBLB 3GXOA 4MFEA 1W7PD 1B72A 3DEEA 3L09A 3GTJJ 5DCMA 1UMQA 4XBFA 3HPGA 2RVCA 3A4CA 4XOTA 1BM9A 4UUTA 3HOUJ 1W36C 3RPQA 4MO7A 5DV5A 4WCGA 2E1OA 4OIRF 3A03A 3CCUI 2OZ6A 3FK6A 3IV5A 2HTJA 2STTA 2KHMA 4ZYAA 1JTYA 2VBWA 1XC5A 4Z2YA 2WAEA 2CW0F 4HF0A 2UV1A 4B44A 3KZIC 4DZPA 5IOZA 5E18F 4NDLA 1FIAA 3M8JA 3J7AO 2VKDA 4RA2A 1OR7A 3LSGA 3DLAA 4ENMA 4BL0B 4CSWA 2E7XA 2MLGA 1TT5B 1NHAA 2CG4A 3VPRA 1T39A 1GXPA 4KUMA 1H88C 4XLFA 5LGNA 4O5VA 3SDGA 3H35A 2Z1DA 2L9SA 4L5JA 2R7QA 4A6DA 1LVAA 3F72A 4D9JA 4ETSA 3AG2H 4CZCA 1QZZA 2FSWA 4M3DA 3DPLC 1K83J 1FIPA 5JVTA 4LITA 3GUDA 4D1QA 3OYBA 1ZARA 2XAGA 3NWSA 3A2KA 3CCQI 2ID3A 3LAPA 2W4SA 3CUQA 4RBOA 2MD5A 2AXTC 1WCMJ 5CVIA 3L2VA 4RGRA 3HJEA 3VYRB 3GZ5A 4HNVA 1VQKI 1MBFA 3RDIA 1FOWA 3LSRA 3RYPA 4HF1A 2V1NA 3BDDA 3G4SI 2ECCA 4V19K 1RUNA 2VXDA 2DCEA 1FTTA 4MNUA 4MEYF 3BTCA 2I5UA 3SQNA 1I3AA 5D5VB 1TNSA 5F0HA 1VF9A 5LRRA 2M5WA 3OYLA 1BN5A 1FMVA 2ELHA 4PJJA 2IA1A 4AYBN 4QLCU 4EQQA 2M3AA 1I1GA 3DU6A 1JUSA 2PMZA 1IGNA 5K7ZA 3C3WA 4CYDA 1QZYA 3R61A 2BW3A 2XC7A 5HLGA 1H89C 2GXGA 1EV7A 3U1KA 4OINF 5CVRA 3U1DA 3L2QA 2BY0A 3JTHA 2Y30A 3PSFA 1WH7A 5BMZA 2EQRA 5JHFA 3CCJI 2IP2A 2HDDA 1DU6A 1R1UA 2RGVA 2W84A 4ZH4F 3HPHA 5JLXA 1BOAA 1RKWA 2AQFA 1USSA 1J5YA 1DGWY 2AO9A 4Y7NJ 4HW0A 3BR6A 4GXOA 3IKTA 1ZH5A 1Z7UA 3S1QJ 2QEXI 1P6RA 2BVMA 2Y31A 4BE2A 5LHHA 5GPAA 2JJ7A 4G7ZF 2W7NA 1MKMA 4CO8A 4OAYA 4J19A 3BJOA 3I71A 4KMFA 1P7IA 2JVHA 4LD5A 3GFIA 2NVUB 3LSKA 2K4JA 3RTRA 3CCSI 1LQ1A 3LNQA 3IWFA 2IT0A 3L9FA 4IHSA 2KPMA 3ZQFA 2KQRA 3ZOBA 4CCLA 1MSFC 3TKYA 2ZJRF 5IT9Z 2F5FA 3F6VA 3KEOA 4XKWA 3JRAA 3I0TA 2R5ZA 4UXNA 1GLNA 4BQQA 2OTJI 1JE8A 4LLLA 3LFUA 5DM6F 4NC7A 3H9GA 4BH9A 4HDVA 4EJOA 3M07A 1X2NA 1IV8A 2A05A 4KN4X 4P96A 5D5UB 1AA7A 3CESA 4CCMA 1NK3P 3WU0A 1IXSB 2XV4S 2KIMA 2YSRA 4KFCA 2M9HA 4WXHA 2B63J 3RI4A 2BHZA 1W0UA 1B9NA 4BXFA 3GTKJ 1MD0A 3PNYA 3DBHB 4YG2F 5CQEA 2X6OA 3SEZA 3HOZJ 1X2MA 4Y3OA 2GQQA 1D8KA 2IRFG 2HFHA 1K78A 2QBYB 3EUHA 4C2TA 4HF2A 3KX2A 1NTCA 3ULQB 4AM3A 1T38A 2E7WA 2VB6A 4KIFA 2M8EA 2FU4A 4QPQA 3HYIA 3WTYC 3CCMI 2O03A 4PUSA 4NUBA 1ETYA 1R7JA 4G9YA 2XHKA 3S2DJ 1D1AA 1YRNB 1G2HA 3ABMH 2FMYA 3S8PA 3S2WA 3T8RA 1HC8A 2X9DA 1UAAA 3TDUC 3CCEI 2BY2A 2E19A 3CP2A 4PCQA 2OF7A 4BYYA 4KIBA 1R23A 4HV6A 2BV6A 4FISA 3I9V2 1FYMA 1D5VA 2X4HA 2JRTA 4EATA 4LG0A 2DDAA 1BIBA 4IZZA 3P7NA 2VLAA 2GIVA 2H6BA 1T6SA 1D5YA 4MGRA 3DKXA 1P4WA 2M4KA 5D6FA 1R4MB 3WGHA 3CF5F 2CUZA 4XRFA 3P5JA 4BEHB 4PSWA 5LRSA 1U0JA 1G3YA 2IGMA 4JQFA 1W1WE 4D0PA 4QIWN 3IP4B 4M9ZA 2KRFA 3RKXA 4OWRB 4JX5A 3J81K 4HNTA 1JGSA 5ICFA 2OD5A 1E3HA 3FHNA 5E20A 3E6DA 2ZSHB 1OCTC 1IRGA 1YX5A 3ABTA 3FXJA 3PFYA 3BQZA 1I3QJ 1IRZA 4N4NB 1IDYA 4KITB 2Y75A 3PQJA 5C44J 3KLNA 5DDGA 5JLWA 2D1VA 2P0WA 2VOPA 3CUOA 3HOYJ 2BOLA 2XIGA 2DFFA 3FXOA 4XKCA 1VTNC 2PN6A 3KP2A 2ZC2A 3SJMA 2ZMEB 2V1XA 2AXLA 3H5AA 3LWFA 3ZMUA 1FYLA 3FXLA 4OIOF 4A3EJ 1RUOA 2R93J 3WTSC 4XLHA 4RM3A 1VI0A 4V2FA 5GADJ 2E2IJ 2LTPA 4NC6A 5K5QA 2NXNB 2R7VA 1G3TA 3F22A 2L9VA 3HB9A 3X2QH 4A2UA 4KMUX 4N9HA 4Q47A 3M7GA 5LGUA 1AKHB 2YU9J 3KE2A 1O4XA 2CW7A 2VT3A 3MFKA 5DTDA 3DTKA 4A3BJ 3IC7A 4I02A 4BKXA 5GTIC 3CDHA 1JUMA 4L9VA 4WF2A 5H6RA 5KK1A 2ZSIB 2VBZA 1PP8F 3H3UA 1TWGJ 2EJRA 2VXZA 2OCEA 1VQ9I 2FQ4A 5E79C 4WXCA 5FLMJ 5ILSA 2YX4A 3WG7H 3HRTA 4LFUA 5BNGA 5KHDA 4L0ZB 1IN8A 2K27A 1R6RA 3ABUA 1ULYA 1U78A 3Q5FA 3HSFA 4BXUA 2P6TA 4RB0A 2XKPA 4DYQA 1FEXA 5GAEJ 2KFDA 3RJPA 3JRBA 2K5CA 2LSOA 3CMYA 2VUMJ 4PDKA 3JSOA 1YITI 3S17J 1FTZA 3K4KA 2QVOA 4HBLA 4UHTA 1HSJA 2VONA 1T0FA 1Z67A 3KP4A 1KU3A 5TGTA 3FXRA 1ODDA 1TNTA 2HQAA 1ZRCA 3HRUA 1R5ID 3MVPA 1MW7A 2A6HF 3PNVA 1K6OA 1P9QC 2ZO4A 1UHMA 3CZ6A 2KP6A 5E3MA 3LA7A 1E3OC 1HA8A 2EZKA 2GIZA 5LBQA 2M45A 1HKSA 2ZXIA 4H4KC 1BL0A 2GLOA 3H5NA 1YHQI 5J8FA 5ICGA 1R49A 1CQTA 1FZPB 1EKEA 1U5TA 4LLNA 4D7NA 1K4TA 1ZR2A 3ZR8X 1OYYA 1UELB 2HYGD 3FBNB 3GFJA 1ETVA 1EA3A 1HW5A 4B3XA 4IO9F 5J3LA 3GMEA 4A5NA 1LE8A 3LQRA 3W3CA 4P1WA 1I50J 3OS1A 4CHUA 2EWNA 3OYCA 1MIJA 1ETQA 2W85A 1SFEA 2JPBA 1UHSA 3AG4H 1VFCA 4IVNA 2D45A 3Q9SA 4I09A 3UR3C 3PJRA 4LK1F 3Q0UA 4ABZA 3LSTA 2EV0A 1ZLKA 4DBRA 3S14J 2DA1A 2E34A 1S7AA 4LB6B 1V3FA 1U2WA 1SEUA 2LP0A 1Z77A 2JK3A 2X6WA 4E6KG 4OIQF 3BOQA 3HRSA 1G59A 1VQLI 3Q0VA 4AD9A 2RNJA 4Y52J 2E5ZA 4UNOA 4UUSB 1STZA 4M6VA 5HS7A 4AUXA 4UVAA 1N25A 4M9XA 2ESNA 3CD6I 3CCYA 2RKHA 5ERIA 3QPHA 4IOCF 4BAYA 1ONVA 1F36A 3ZCOA 4FX4A 1XDUA 2BW3B 4XN3A 1RR8C 5FFZA 2XAJA 3N05A 1ZRFA 2I10A 3LQQA 2WADA 1IJWC 2CUEA 4CGZA 2R3SA 2VQLA 3WTTC 2ADUA 4RS8A 3FBIB 3C18A 1XD7A 2O3FA 3RIRA 5J8CA 3F8CA 3TO9A 3VODA 5B66C 1FOKA 3QRFF 1BC8C 4QPOA 3L1PA 5HNFA 4UV8A 4BU2A 4IHVA 1FY7A 2XGDA 1SFUA 1J7KA 2NOJB 1J9IA 4XONA 2IA0A 1TWFJ 2M1BA 2RDPA 2P5VA 4M3BA 3HKZN 4Y17A 5F64A 3W6JB 4RB3C 2HZDA 1K7AA 2MH2A 3OYIA 1ZGAA 3J80Z 3WTWC 3GTMJ 2G0EA 1XMKA 5M5WJ 2B7EA 1B4AA 3H5RA 2ZJQF 4XSXF 3A1YA 1S72I 1QNTA 2DPUA 1O7LA 2QSGX 1TQIA 2M8GX 3FXUA 2JN6A 3H92A 2EIJH 2JA8J 4E7HA 5K7HA 1JJ8C 1UJ8A 1ZKGA 2TDXA 1ZK8A 3FMQA 1LJ9A 4N9IA 2ELKA 2PX9A 1SD5A 2DFEA 2R5ZB 2O9LA 1V5EA 3OYFA 5CJ9A 1YO5C 4MQ9F 2ZCWA 2QSHX 2VKVA 3BJAA 1ZG5A 2HQRA 2LKXA 2P7VB 1IV6A 4A3IJ 4BHPA 2E36A 3BZKA 3ZXSA 2Q2EA 4RLQA 1T8IA 3KETA 2ELJA 2K9QA 1EF4A 2FUG2 2QENA 3CDIA 2VIXA 1DU0A 3GFMA 4ZDPA 2FOKA 2ZB9A 2MG4A 1K78B 1MSEC 2E1CA 4Y15A 4PFOA 3HHHA 2C6YA 1OCPA 2A5WA 2Y2ZA 1J09A 4EM1A 2HPMA 3R60A 3CLOA 5CQGA 2F2EA 1FSEA 1D0YA 2QKMB 4YIFA 5L3EA 4G7HF 4KT6A 4EJVA 1IF1A 2CUJA 3DV8A 5EG0A 1V5GA 4AC0A 2L7KA 2XAFA 4ZYHA 3PO2J 1A5JA 1HCRA 4G6QA 5IP6A 2VBXA 1RESA 5EEGA 3FXQA 2HU9A 2NNYA 3ONQA 5M5YJ 1GVDA 3FKIJ 1TW3A 2JA2A 3H1CA 2R7TA 1S7EA 4U0YA 1DPUA 2XF6A 2KDZA 2R7DA 2A5YB 1T98A 5K1YA 1WJDA 1JKQC 2BGCA 2L54A 2HVSA 3E5UA 1KA8A 3O2PE 4LG0B 4CCKA 2CV0A 3WG9A 3HL2A 3BR1A 4LMYA 5BOXA 3OYDA 4HG2A 1A6QA 1PDNC 1YIJI 1YW9A 5L3GA 1Z21A 2BY3A 4CYCB 3I55I 1WWXA 3H0DA 3BZ6A 4Q4ZF 2LDUA 4IHWA 1MBHA 2JSCA 4KNYA 3VYSB 2HOEA 1Y0NA 4CICA 3EUAA 2VJJA 2GM4A 2R7OA 3E0JB 4CCJA 1ZG3A 3NARA 5FLVA 2NVQJ 4S05A 4XQFA 3DCFA 1ERDA 2WAFA 4AIDA 4WXDA 2DJIA 2ECBA 4UUVA 5L3DA 1QQIA 2HXOA 2K9SA 3B02A 4RMNA 1T33A 3GLXA 1U8BA 2IBDA 1Z05A 3CQZJ 3K2AA 5FKNA 1HKTA 3MKZA 4H0EA 2X1CA 1FMWA 3BLYA 2MFZA 1ZQ3P 2HGCA 2Z16A 2EFOA 3CC7I 2HOSA 2R5YA 3HIFA 5FKMA 2DO7A 4PFPA 1PYVA 5EJCA 1IZ1A 2DK8A 2X1DA 3OMYA 2O8XA 2M2EA 1RNLA 1O3SA 4RAGA 1SAXA 1W5SA 3OR1C 2PFBA 1RR7A 2XF7A 3NAUA 3ZMTA 3AAFA 4O3MA 3P9IA 1YLFA 3K4CA 4XRSG 2IS6A 2BBYA 2E1MB 3G1OA 4XIDA 2UXXA 3KFWX 2COMA 4ZYDA 4IRHA 2KZGA 3AL0C 2QZ8A 3ZQ7A 1RZ4A 3E6MA 4PZJA 2MBFA 2TCTA 3LFKA 1OMIA 4ON0A 3CC4I 2BEOA 4F92B 4FE7A 2VC0A 3I53A 4G12A 5EGOA 2F4OB 5IP9J 3E6BA 3M4OJ 5B3SH 2K3PA 3KYLA 2QCOA 2DA4A 2DTRA 2HR3A 1UCRA 4HOBA 3OOUA 2RQPA 4RLFA 1LNWA 5EZGA 3JSPA 2EZIA 3CCVI 4AWXB 3ZGKA 1U8RA 3BTJA 2HI3A 3K9TA 1LB2A 4I6ZA 1V55H 2NOGA 5CVUA 3HTSB 5E8IA 1GVJA 3OIQA 2VPRA 4M9SA 2FRHA 3QOEA 3TP3A 4FTHA 2HYFA 3DEUA 4XLNF 4F52A 2W00A 2HNHA 1HDPA 2WC2A 3BCAA 1UZCA 4HDUA 1VNDA 3DPUA 3RSNA 2OZUA 3E6CC 1GHCA 1R1VA 4CCNA 5F27A 3D5RC 3K1NA 3CCLI 1W36D 1P92A 4HEA2 2EILH 1WJAA 1X1PA 3ROUA 4RDUA 3LA3A 2XB0X 4II3A 2R7ZJ 4HYEA 4AVZA 2DDBA 3E5QA 4FCYA 5F6FA 4BY7J 2ISZA 4ASNA 4L5IA 2LG4A 3ZPLA 1Z6RA 2V6CA 3GBGA 4KIGA 2XSJC 1B6AA 3ZQHA 3I54A 4KICA 2RAEA 4U88A 1U5TB 4XM3A 3ZMVA 2K02A 4MEXF 2RQQA 5IY5H 2OPTA 2VJIA 1OCRH 4BDZA 3I5UA 3H3ZA 4MLOA 3HHGA 2DT5A 2CV2A 2JUCA 2DI3A 2DQRA 1W4MA 2IJLA 3CCRI 1D3YA 1LE8B 2HYJA 4W97A 4NBQA 4XNFA 3TP0A 1MBJA 4UUSA 4EMSA 2LR8A 1MBGA 5F0CA 1WRJA 1EH6A 4I99C 1RRJA 3W2AA 4HLYA 3BG3A 1BI1A 2CV1A 3G3ZA 2Y0MA 2DA7A 2DN0A 2PQ8A 4IF4A 3WODF 4A3LJ 3AG1H 1FT9A 3KZYA 2G7HA 3GEZA 2R92J 1G4DA 3IHUA 4X1EA 3DXJF 1CGPA 1Y56A 4BBRJ 1ZAOA 2XGXA 3H3VK 2IGNA 2P4WA 4CCOA 5A2QK 2NVYJ 1X3UA 3S3OA 3F21A 2JTVA 3S16J 4PJMA 4ESFA 4BS9A 4EVIA 3FMSA 2L7FP 3NRVA 3CTAA 3PL8A 3B6AA 4KYWA 3GTLJ 4HNUA 1XDSA 3V8KA 5FFXA 3GWZA 2W1OA
chains in the Genus database with same CATH topology
2MLKA 4EJWA 1UHWA 3GW2A 2M87A 2HQNA 3DF8A 3TOAA 2ZBKA 4FX0A 2Z9OA 2M30A 5TJJA 5LHIA 2L3DA 3BY6A 1IN7A 2D2WA 3FMRA 2VE8A 2A68F 4U7DA 4ENJA 3F23A 1KYZA 1LDJA 2P5LC 1MGTA 5D6EA 1QPMA 4L18B 2V1DA 1BIAA 4EV0A 4WWCA 5HLIA 3U2RA 1YS6A 1R00A 1G6NA 5CYVA 2YX7A 4LLGF 1SD4A 5TRDA 1WI9A 2W24A 1B9MA 3WE2A 1IW7F 3RKWA 3P9KA 1TQMA 3FHZA 1QGPA 3WTXC 5A2QZ 3LA2A 1IUYA 1U3EM 1D8JA 2ETHA 1SFXA 3WE3A 3SFZA 5IT3A 3E3VA 4YFXF 4RAYA 4ZYEA 2EA2A 3MCZA 5FO5A 3VOEA 5E1ZB 3PFIA 1O3RA 3QU3A 3BPXA 1Z91A 4EM0B 2V1UA 5JHUA 2A07F 2ACJA 1MDMA 1TW2A 3EDPA 2HKXA 3I64A 2NS0A 4GYIA 2P5KA 1ZRDA 3P9CA 1FYKA 2H09A 1QO0D 3ZP5A 3BP8A 4EGZA 1O3QA 2UWMA 5HOOA 2F5EA 3MEXA 3I58A 5LEKA 4HX7A 1WKMA 1HBXG 3GYHX 1L0OC 4A12A 3QP5A 1BJAA 2GWRA 2CYYA 1O7FA 2QWWA 1TTYA 1HXDA 3WTUC 4M6YA 3ML6A 2B0LA 3ZN0A 3R4KA 4P9UA 3GF2A 4A6EA 3SZPA 2DAOA 1IXRC 5AONA 5JI6A 2J5OA 1JHFA 1XCBA 3J81Z 2F5CA 1OYWA 2O61A 1FC3A 5HDNA 2HEOA 5ED4A 5FD6A 1G3SA 4A0ZA 1B59A 2KKOA 2Q0OA 2OAZA 2FNAA 2QYOA 1YQAA 5L3BA 3KP7A 2G9WA 3CO6C 4I2OA 4HZFA 4M73A 2XASA 2LF7A 4HV5A 1S3JA 3SXYA 4HQMA 2OA4A 3L2CA 2O0YA 1CF7B 2OQRA 3BROA 5LLQA 3JW4A 4CZZA 5DEQA 5D5XB 3EYYA 1FPQA 2A69F 1ON2A 4TV7A 3GO5A 2K86A 3F8BA 2D1HA 3M8EA 3HUGA 1FP2A 1XGOA 1G3WA 4RAZA 5L3FA 2Z5UA 3HOSA 4S04A 3GVAA 1XGSA 2EB7A 5ILUA 4U0WA 4NB5A 3CUQC 2CO5A 3FWEA 4AIKA 3KP3A 1J59A 5E17F 3V7RA 4RGXA 4FT8A 3MZHA 2EA4A 4ESJA 2FBIA 2ZFWA 2EFNA 3BPVA 2Q8KA 5CVJA 4RB1A 4IRGA 4P5OA 2WV0A 5EEHA 4HQEA 3E5XA 3DKWA 4YFKF 2OU2A 1TLHB 1L3LA 2XUBA 5LHGA 1R5HA 1JXSA 2NNNA 5FGMA 3ERED 3R6SA 4IRIA 1RI7A 2KJCA 3VB2A 1IN6A 4EJTA 1BI2A 2L02A 1FLIA 3TDZC 3N4MA 1ZREA 2BE5F 4KDPA 3V8JA 1EH8A 5L3CA 1EH7A 3F8FA 2JZYA 2A61A 3FZVA 2XAHA 4M6XA 4OIPF 2FMLA 2DBBA 2ZNYA 5FLXK 5D8KB 2PEXA 1FBSA 2RV8A 3G73A 3ISPA 1XCVA 4NHJA 1P4XA 4N0BA 1S7OA 3NQOA 2HKOA 5E1XA 1XGNA 3LAJA 1C0WA 1S6LA 4LGWA 2L4AA 1QBJA 4G94A 3ZMZA 1BI0A 4Y13A 3K1MA 4OU0A 4BHBA 2V9VA 2Z3YA 2HZTA 4LK0F 4ENKA 2A6EF 1TQPA 1SMTA 2XVCA 5LGTA 2LKPA 2BYVE 1MDMB 5D8LB 5D4RA 3ZMSA 4Q48A 2XKOA 3DP7A 1KQ9A 3R0JA 1HKQA 5BPIA 4AIHA 1SMYF 1Q1HA 4AVPA 3F6OA 2HDCA 1Z1DA 4ZZLA 3ZMDA 4F7ZA 2EV5A 2PJPA 3EQLF 1IXCA 5H20A 4WX9A 4JBAA 5HDGA 1XN7A 2KJBA 1U6GA 2PI0A 2YR2A 1O57A 4I0AA 4I0BA 1B1BA 3T1BA 1A04A 2CQKA 1MJBA 1TBXA 3IL2A 3M1EA 2FA5A 4P55A 1GXQA 3REOA 4XSZF 1ZHFA 3F8NA 2Z99A 4G8XA 3V7SA 3JAMK 1DP7P 4IHTA 2GZWA 4G7OF 1CF7A 1UFMA 2WWYA 3SZTA 5IT9K 4IPAA 3K0LA 2GA2A 2FBKA 1MJ9A 3HTUA 4GCVA 4ZZDA 4KA4A 3GX4X 3MWMA 1E2XA 2P7CB 4KT5C 1KQ0A 1R58A 3C7JA 3KZZA 2Z33A 4B8XA 2MA3A 2GA1A 1FSHA 5FB2A 4YIIA 2DQLA 3JTGA 1S29A 2VT2A 2IPQX 5BS6A 3MZYA 5BQTA 4EJUA 3D5LA 5HLHA 1FX7A 2JT1A 1H9GA 4GO1A 3ECOA 1U5TC 3IRQA 1OYIA 1FP1D 2EV6A 4KN7X 1ZG1A 4XLPF 2XRNA 1KU9A 1YIOA 4BNCA 1R22A 3WTZA 5H6QA 2QQAA 3ECHA 5E1WA 4L9TA 1ZN2A 3V8LA 5HS8A 2CGPA 3MAJA 1XB4A 1JHHA 5FD5A 4L9JA 5E8GA 4NQWA 1E17A 1XSDA 1USTA 1LDKB 2QUFA 5DUKA 3L7WA 1KYWA 3JAMZ 3F8MA 4L0YB 3KP5A 2W25A 3VFZA 5LEJA 4O6JA 2HS5A 4CDGA 4LB5A 4ENNA 2DPDA 2QQBA 2YPRA 4MTDA 3TOBA 5DUIA 2LF8A 3T0YA 4OMZA 4U7BA 3WGIA 1R1TA 1WQ2A 3IWZA 1SD6A 1XGMA 5DYMA 4R79A 4PGGA 2ESHA 3EETA 2IA2A 2R7FA 3WGGA 5J6XA 4YFNF 2W57A 2K4BA 1XMAA 4I01A 1YS7A 3KP6A 5ICEA 5ILVA 2VE9A 1PUEE 3I59A 4AIJA 3HSEA 2UXNA 1WSUA 3WU1B 1BI3A 2G7UA 4GGGA 3QP6A 4I98B 3QU6A 2AS5F 3IKVA 1PP7U 1ZGJA 5HDKA 2L4MA 2DK5A 3RKYA 1W7PA 3ELKA 3FX3A 2V79A 3RPUA 2HWVA 2F5DA 4M74A 4EM2A 3HOTA 4PGHA 4GYGA 4BQAA 1IN5A 3K1PA 4G6DA 2ZKZA 2H94A 4RB2C 2VC1A 4WK8F 3DPTA 4R8HA 1KGSA 3U9GA 1DDNA 3TO6A 1FBQA 1LEAA 2L01A 3O6BB 1REPC 2EFPA 3M8FA 5AIQA 2VOOA 5KVRA 4A0YA 5JFRA 4ZYGA 3IRRA 3E97A 2FQ3A 3OV8A 1H0MA 4RGSA 4BHCA 1MZBA 4OMYA 2FNPA 2J5PA 5CVVA 5D5WB 1ZYRF 3QAHA 2ZJ2A 5K5OA 4HLXA 5K5RA 3HRMA 3KLOA 1Y0UA 3WTVC 1O3TA 5DD4A 2EFWA 5DCMB 1I27A 1ON1A 4IXAA 3CJNA 5HS9A 2X0LA 5DCFA 1T2KA 2QLZA 3COAC 1KQ8A 3J80K 3ZN1A 5HVQC 4A5MA 3V7CA 1W5TA 2GXBA 3DFGA 4M72A 4HAMA 1DUXC 2NRAC 3MQ0A 4LJZF 3QOPA 2WTEA 2OBPA 1ZLJA 4HA8A 1HW1A 1F1ZA 4OOIA 3CUQB 2VODA 2VBYA 2JPCA 4K2EA 2YU3A 2ISYA 2GAUA 1AOYA 4HX4A 2H27A 1BC7C 2FBHA 1HW2A 2RC4A 1SD7A 4P9FA 5D4SA 2FE3A 1LDDA 3GFLA 2P8TA 1F5TA 1K79A 2CSOA 3RYRA 3QPTA 2CWEA 3BJ6A 3FF5A 2MH9A 1J2XA 1I1SA 3HSRA 3N97A 4CXFA 2A3SA 6PAXA 2O6GE 2NYXA 1MJAA 1R36A 2PG4A 2DU9A 4E70A 3Q9VA 1BBYA 4B09A 5BPDA 3R0AA 3TGNA 1P2FA 2NAZA 4QWQA 5DD8A 1AWCA 1KU7A 1IRFA 4UV9A 3BWGA 1YFHA 3FM3A 4RGUA 4EGYA 3OOPA 2FF4A 3DQVC 2P6SA 5CLSA 2EFQA 4DNCA 2DLLA 2QBYA 4MHGA 1R5GA 3VEPA 5AIPA 2IW5A 2PLYA 1YW8A 2KIFA 2E1NA 3B73A 4HX8A 3V4GA 3T8TA 1IN4A 2K7LA 4MQVA 3I4PA 2XAQA 2ZXJA 1KU2A 3C1DA 4A0XA 1RIOH 1V4RA 2IVMA 2HTSA 3L00A 3NEUA 4L9NA 2QQ9A 1DPRA 4ESBA 3W6KB 2DW4A 2PMUA 4JK1X 1I6XA 4UVBA 3I59B 3TO7A 4M71A 3CO7C 3K2ZA 4Q5SF 2DFIA 1F4KA 2QM3A 3KCCA 1LEBA 2RN7A 3D0SA 2PMHA 1YW7A 2ZNZA 3FM5A 1XSXA 1HSTA 3EYIA 1I5ZA 3M9AA 1IAWA 1W7PB 1HQCA 2VN2A 1J75A 2KIUA 2XROA 1YYVA 1FNNA 2CFXA 2LNBA 3TQNA 1J0RA 1OKRA 1YG2A 2ZMEA 3KEQA 1UB9A 3O3KA 2FXAA 2FEZA 2OQGA 4UVCA 4I7HA 2UZKA 3T5XA 1FBUA 2Y48A 1FWZA 4R1HA 4FHTA 3PQKA 1F9NA 2PBIA 4DQ2A 1XSVA 1YTYA 1P4AA 5ICCA 4IJAA 3K69A 4U0VA 2STWA 2EK5A 5F1RA 3SHFA 4MTEA 1Z9CA 3F3XA 2H6CA 2MC3A 1Z6TA 1H9TA 5FLXZ 3GZ6A 5JR3A 1OPCA 1S8NA 3GXOA 1W7PD 3L09A 5DCMA 4XBFA 2RVCA 1BM9A 3RPQA 5DV5A 4WCGA 4OIRF 2OZ6A 2HTJA 2STTA 2VBWA 4Z2YA 2CW0F 4HF0A 5E18F 3J7AO 1OR7A 4ENMA 2E7XA 2MLGA 2CG4A 1NHAA 1GXPA 1T39A 4KUMA 5LGNA 4O5VA 4L5JA 4A6DA 1LVAA 3F72A 4ETSA 1QZZA 2FSWA 3DPLC 5JVTA 3GUDA 1ZARA 2XAGA 3LAPA 3CUQA 2MD5A 5CVIA 4RGRA 3GZ5A 3RDIA 3RYPA 4HF1A 3BDDA 1RUNA 4MNUA 4MEYF 3SQNA 5D5VB 1TNSA 5LRRA 2M5WA 1BN5A 2ELHA 4QLCU 2IA1A 4EQQA 1I1GA 3C3WA 4CYDA 1QZYA 3R61A 5HLGA 2GXGA 1EV7A 4OINF 5CVRA 3U1DA 3JTHA 5BMZA 2IP2A 1R1UA 2RGVA 2W84A 4ZH4F 1BOAA 1USSA 1J5YA 4HW0A 4GXOA 3IKTA 1ZH5A 1Z7UA 1P6RA 5LHHA 4G7ZF 1MKMA 4CO8A 3BJOA 3I71A 4KMFA 4LD5A 3GFIA 3RTRA 2K4JA 1LQ1A 3IWFA 2IT0A 3L9FA 4IHSA 3TKYA 5IT9Z 2F5FA 3F6VA 3KEOA 3I0TA 4UXNA 1JE8A 4LLLA 4BH9A 4HDVA 4EJOA 4KN4X 4P96A 5D5UB 3WU0A 1IXSB 2XV4S 2KIMA 2YSRA 4KFCA 4WXHA 3RI4A 1B9NA 1MD0A 4YG2F 2GQQA 1D8KA 2IRFG 2HFHA 1K78A 2QBYB 3EUHA 4HF2A 3ULQB 1T38A 2E7WA 4KIFA 2M8EA 2FU4A 3HYIA 3WTYC 2O03A 1R7JA 4G9YA 2XHKA 2FMYA 3S2WA 3T8RA 3TDUC 4PCQA 4BYYA 4KIBA 1R23A 4HV6A 2BV6A 1FYMA 1D5VA 2X4HA 2JRTA 4LG0A 1BIBA 3P7NA 2GIVA 2H6BA 1T6SA 4MGRA 1P4WA 5D6FA 3WGHA 4XRFA 5LRSA 1G3YA 4JQFA 4D0PA 4M9ZA 2KRFA 3RKXA 3J81K 1JGSA 5ICFA 2OD5A 5E20A 3E6DA 1IRGA 3ABTA 2Y75A 3PQJA 3KLNA 5DDGA 2D1VA 2VOPA 3CUOA 2XIGA 1VTNC 2PN6A 3KP2A 2ZMEB 2V1XA 2AXLA 3ZMUA 3LWFA 1FYLA 4OIOF 1RUOA 3WTSC 5K5QA 1G3TA 3F22A 4A2UA 4KMUX 4N9HA 4Q47A 3M7GA 5LGUA 3KE2A 2VT3A 3MFKA 3IC7A 4I02A 3CDHA 4L9VA 4WF2A 5H6RA 5KK1A 2VBZA 1PP8F 3H3UA 2EJRA 2VXZA 4WXCA 5ILSA 2YX4A 3HRTA 4LFUA 4L0ZB 1IN8A 2K27A 3ABUA 1ULYA 1U78A 3Q5FA 3HSFA 4BXUA 2P6TA 4RB0A 2XKPA 3RJPA 2LSOA 4PDKA 3JSOA 2QVOA 4HBLA 4UHTA 1HSJA 2VONA 1T0FA 3KP4A 1KU3A 3FXRA 1ODDA 1TNTA 1ZRCA 3HRUA 2A6HF 1K6OA 2ZO4A 1UHMA 3LA7A 5LBQA 2M45A 1HKSA 5J8FA 5ICGA 1FZPB 1U5TA 4LLNA 1OYYA 2HYGD 3GFJA 1HW5A 4A5NA 4CHUA 3LQRA 2EWNA 2W85A 1SFEA 2JPBA 4IVNA 2D45A 3Q9SA 4I09A 4LK1F 3LSTA 2EV0A 1ZLKA 1S7AA 4LB6B 1V3FA 1U2WA 4OIQF 3BOQA 3HRSA 4AD9A 2RNJA 4UNOA 1STZA 5HS7A 4UVAA 4M9XA 2ESNA 2RKHA 5ERIA 3QPHA 4BAYA 1ONVA 4FX4A 1XDUA 5FFZA 2XAJA 1ZRFA 3LQQA 4CGZA 2R3SA 3WTTC 2ADUA 4RS8A 3C18A 1XD7A 2O3FA 3RIRA 5J8CA 3F8CA 3TO9A 3VODA 1FOKA 3QRFF 1BC8C 4UV8A 1FY7A 1SFUA 1J7KA 1J9IA 2IA0A 2M1BA 2RDPA 2P5VA 4Y17A 5F64A 3W6JB 4RB3C 1K7AA 2MH2A 1ZGAA 3J80Z 3WTWC 1XMKA 1B4AA 4XSXF 1QNTA 2DPUA 1O7LA 1TQIA 3FXUA 3H92A 2TDXA 3FMQA 1LJ9A 4N9IA 1SD5A 5CJ9A 1YO5C 4MQ9F 2ZCWA 1ZG5A 3BJAA 2HQRA 2P7VB 4BHPA 2Q2EA 3KETA 2QENA 3GFMA 2FOKA 1K78B 2E1CA 4Y15A 3HHHA 2C6YA 4EM1A 3R60A 3CLOA 2F2EA 1FSEA 4YIFA 5L3EA 4G7HF 4EJVA 1IF1A 3DV8A 2XAFA 4ZYHA 4G6QA 2VBXA 5EEGA 3FXQA 2NNYA 1TW3A 4U0YA 1DPUA 2R7DA 5K1YA 2A5YB 1T98A 2BGCA 2L54A 3E5UA 1KA8A 3O2PE 4LG0B 3WG9A 4LMYA 5BOXA 1PDNC 1YW9A 5L3GA 1WWXA 3BZ6A 4Q4ZF 2LDUA 2JSCA 4KNYA 2HOEA 4CICA 1ZG3A 4S05A 4WXDA 4UUVA 5L3DA 1QQIA 3B02A 3GLXA 1Z05A 1HKTA 4H0EA 2HGCA 2EFOA 3HIFA 2DO7A 1IZ1A 2DK8A 2O8XA 1RNLA 1O3SA 1SAXA 1W5SA 2PFBA 4O3MA 3ZMTA 3AAFA 3P9IA 1YLFA 2BBYA 2UXXA 3KFWX 2COMA 4ZYDA 4IRHA 2QZ8A 3ZQ7A 1RZ4A 3E6MA 4PZJA 2MBFA 3LFKA 1OMIA 4ON0A 2BEOA 2VC0A 3I53A 3E6BA 2DTRA 2HR3A 1UCRA 4HOBA 2RQPA 1LNWA 3JSPA 4AWXB 1U8RA 3K9TA 1LB2A 5CVUA 3HTSB 5E8IA 1GVJA 4M9SA 2FRHA 2HYFA 3DEUA 4XLNF 2WC2A 4HDUA 3E6CC 2OZUA 1GHCA 1R1VA 3K1NA 1P92A 3ROUA 3LA3A 4HYEA 3E5QA 5F6FA 2ISZA 4ASNA 4L5IA 3ZPLA 1Z6RA 2V6CA 4KIGA 1B6AA 3I54A 4KICA 4U88A 1U5TB 3ZMVA 2K02A 4MEXF 3I5UA 3H3ZA 3HHGA 2DT5A 2DI3A 2DQRA 1W4MA 2IJLA 1D3YA 4EMSA 1WRJA 1EH6A 4HLYA 1BI1A 3G3ZA 2Y0MA 2PQ8A 4IF4A 3WODF 1FT9A 3KZYA 2G7HA 3GEZA 1G4DA 3IHUA 3DXJF 1CGPA 1ZAOA 2XGXA 2P4WA 5A2QK 1X3UA 3F21A 2JTVA 4ESFA 4EVIA 3FMSA 3NRVA 3CTAA 4KYWA 1XDSA 3V8KA 5FFXA 3GWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLK A;  4EJW A;  1UHW A;  3GW2 A;  2M87 A;  2HQN A;  3DF8 A;  3TOA A;  2ZBK A;  4FX0 A;  2Z9O A;  2M30 A;  5TJJ A;  5LHI A;  2L3D A;  3BY6 A;  1IN7 A;  2D2W A;  3FMR A;  2VE8 A;  2A68 F;  4U7D A;  4ENJ A;  3F23 A;  1KYZ A;  1LDJ A;  2P5L C;  1MGT A;  5D6E A;  1QPM A;  4L18 B;  2V1D A;  1BIA A;  4EV0 A;  4WWC A;  5HLI A;  3U2R A;  1YS6 A;  1R00 A;  1G6N A;  5CYV A;  2YX7 A;  4LLG F;  1SD4 A;  5TRD A;  1WI9 A;  2W24 A;  1B9M A;  3WE2 A;  1IW7 F;  3RKW A;  3P9K A;  1TQM A;  3FHZ A;  1QGP A;  3WTX C;  5A2Q Z;  3LA2 A;  1IUY A;  1U3E M;  1D8J A;  2ETH A;  1SFX A;  3WE3 A;  3SFZ A;  5IT3 A;  3E3V A;  4YFX F;  4RAY A;  4ZYE A;  2EA2 A;  3MCZ A;  5FO5 A;  3VOE A;  5E1Z B;  3PFI A;  1O3R A;  3QU3 A;  3BPX A;  1Z91 A;  4EM0 B;  2V1U A;  5JHU A;  2A07 F;  2ACJ A;  1MDM A;  1TW2 A;  3EDP A;  2HKX A;  3I64 A;  2NS0 A;  4GYI A;  2P5K A;  1ZRD A;  3P9C A;  1FYK A;  2H09 A;  1QO0 D;  3ZP5 A;  3BP8 A;  4EGZ A;  1O3Q A;  2UWM A;  5HOO A;  2F5E A;  3MEX A;  3I58 A;  5LEK A;  4HX7 A;  1WKM A;  1HBX G;  3GYH X;  1L0O C;  4A12 A;  3QP5 A;  1BJA A;  2GWR A;  2CYY A;  1O7F A;  2QWW A;  1TTY A;  1HXD A;  3WTU C;  4M6Y A;  3ML6 A;  2B0L A;  3ZN0 A;  3R4K A;  4P9U A;  3GF2 A;  4A6E A;  3SZP A;  2DAO A;  1IXR C;  5AON A;  5JI6 A;  2J5O A;  1JHF A;  1XCB A;  3J81 Z;  2F5C A;  1OYW A;  2O61 A;  1FC3 A;  5HDN A;  2HEO A;  5ED4 A;  5FD6 A;  1G3S A;  4A0Z A;  1B59 A;  2KKO A;  2Q0O A;  2OAZ A;  2FNA A;  2QYO A;  1YQA A;  5L3B A;  3KP7 A;  2G9W A;  3CO6 C;  4I2O A;  4HZF A;  4M73 A;  2XAS A;  2LF7 A;  4HV5 A;  1S3J A;  3SXY A;  4HQM A;  2OA4 A;  3L2C A;  2O0Y A;  1CF7 B;  2OQR A;  3BRO A;  5LLQ A;  3JW4 A;  4CZZ A;  5DEQ A;  5D5X B;  3EYY A;  1FPQ A;  2A69 F;  1ON2 A;  4TV7 A;  3GO5 A;  2K86 A;  3F8B A;  2D1H A;  3M8E A;  3HUG A;  1FP2 A;  1XGO A;  1G3W A;  4RAZ A;  5L3F A;  2Z5U A;  3HOS A;  4S04 A;  3GVA A;  1XGS A;  2EB7 A;  5ILU A;  4U0W A;  4NB5 A;  3CUQ C;  2CO5 A;  3FWE A;  4AIK A;  3KP3 A;  1J59 A;  5E17 F;  3V7R A;  4RGX A;  4FT8 A;  3MZH A;  2EA4 A;  4ESJ A;  2FBI A;  2ZFW A;  2EFN A;  3BPV A;  2Q8K A;  5CVJ A;  4RB1 A;  4IRG A;  4P5O A;  2WV0 A;  5EEH A;  4HQE A;  3E5X A;  3DKW A;  4YFK F;  2OU2 A;  1TLH B;  1L3L A;  2XUB A;  5LHG A;  1R5H A;  1JXS A;  2NNN A;  5FGM A;  3ERE D;  3R6S A;  4IRI A;  1RI7 A;  2KJC A;  3VB2 A;  1IN6 A;  4EJT A;  1BI2 A;  2L02 A;  1FLI A;  3TDZ C;  3N4M A;  1ZRE A;  2BE5 F;  4KDP A;  3V8J A;  1EH8 A;  5L3C A;  1EH7 A;  3F8F A;  2JZY A;  2A61 A;  3FZV A;  2XAH A;  4M6X A;  4OIP F;  2FML A;  2DBB A;  2ZNY A;  5FLX K;  5D8K B;  2PEX A;  1FBS A;  2RV8 A;  3G73 A;  3ISP A;  1XCV A;  4NHJ A;  1P4X A;  4N0B A;  1S7O A;  3NQO A;  2HKO A;  5E1X A;  1XGN A;  3LAJ A;  1C0W A;  1S6L A;  4LGW A;  2L4A A;  1QBJ A;  4G94 A;  3ZMZ A;  1BI0 A;  4Y13 A;  3K1M A;  4OU0 A;  4BHB A;  2V9V A;  2Z3Y A;  2HZT A;  4LK0 F;  4ENK A;  2A6E F;  1TQP A;  1SMT A;  2XVC A;  5LGT A;  2LKP A;  2BYV E;  1MDM B;  5D8L B;  5D4R A;  3ZMS A;  4Q48 A;  2XKO A;  3DP7 A;  1KQ9 A;  3R0J A;  1HKQ A;  5BPI A;  4AIH A;  1SMY F;  1Q1H A;  4AVP A;  3F6O A;  2HDC A;  1Z1D A;  4ZZL A;  3ZMD A;  4F7Z A;  2EV5 A;  2PJP A;  3EQL F;  1IXC A;  5H20 A;  4WX9 A;  4JBA A;  5HDG A;  1XN7 A;  2KJB A;  1U6G A;  2PI0 A;  2YR2 A;  1O57 A;  4I0A A;  4I0B A;  1B1B A;  3T1B A;  1A04 A;  2CQK A;  1MJB A;  1TBX A;  3IL2 A;  3M1E A;  2FA5 A;  4P55 A;  1GXQ A;  3REO A;  4XSZ F;  1ZHF A;  3F8N A;  2Z99 A;  4G8X A;  3V7S A;  3JAM K;  1DP7 P;  4IHT A;  2GZW A;  4G7O F;  1CF7 A;  1UFM A;  2WWY A;  3SZT A;  5IT9 K;  4IPA A;  3K0L A;  2GA2 A;  2FBK A;  1MJ9 A;  3HTU A;  4GCV A;  4ZZD A;  4KA4 A;  3GX4 X;  3MWM A;  1E2X A;  2P7C B;  4KT5 C;  1KQ0 A;  1R58 A;  3C7J A;  3KZZ A;  2Z33 A;  4B8X A;  2MA3 A;  2GA1 A;  1FSH A;  5FB2 A;  4YII A;  2DQL A;  3JTG A;  1S29 A;  2VT2 A;  2IPQ X;  5BS6 A;  3MZY A;  5BQT A;  4EJU A;  3D5L A;  5HLH A;  1FX7 A;  2JT1 A;  1H9G A;  4GO1 A;  3ECO A;  1U5T C;  3IRQ A;  1OYI A;  1FP1 D;  2EV6 A;  4KN7 X;  1ZG1 A;  4XLP F;  2XRN A;  1KU9 A;  1YIO A;  4BNC A;  1R22 A;  3WTZ A;  5H6Q A;  2QQA A;  3ECH A;  5E1W A;  4L9T A;  1ZN2 A;  3V8L A;  5HS8 A;  2CGP A;  3MAJ A;  1XB4 A;  1JHH A;  5FD5 A;  4L9J A;  5E8G A;  4NQW A;  1E17 A;  1XSD A;  1UST A;  1LDK B;  2QUF A;  5DUK A;  3L7W A;  1KYW A;  3JAM Z;  3F8M A;  4L0Y B;  3KP5 A;  2W25 A;  3VFZ A;  5LEJ A;  4O6J A;  2HS5 A;  4CDG A;  4LB5 A;  4ENN A;  2DPD A;  2QQB A;  2YPR A;  4MTD A;  3TOB A;  5DUI A;  2LF8 A;  3T0Y A;  4OMZ A;  4U7B A;  3WGI A;  1R1T A;  1WQ2 A;  3IWZ A;  1SD6 A;  1XGM A;  5DYM A;  4R79 A;  4PGG A;  2ESH A;  3EET A;  2IA2 A;  2R7F A;  3WGG A;  5J6X A;  4YFN F;  2W57 A;  2K4B A;  1XMA A;  4I01 A;  1YS7 A;  3KP6 A;  5ICE A;  5ILV A;  2VE9 A;  1PUE E;  3I59 A;  4AIJ A;  3HSE A;  2UXN A;  1WSU A;  3WU1 B;  1BI3 A;  2G7U A;  4GGG A;  3QP6 A;  4I98 B;  3QU6 A;  2AS5 F;  3IKV A;  1PP7 U;  1ZGJ A;  5HDK A;  2L4M A;  2DK5 A;  3RKY A;  1W7P A;  3ELK A;  3FX3 A;  2V79 A;  3RPU A;  2HWV A;  2F5D A;  4M74 A;  4EM2 A;  3HOT A;  4PGH A;  4GYG A;  4BQA A;  1IN5 A;  3K1P A;  4G6D A;  2ZKZ A;  2H94 A;  4RB2 C;  2VC1 A;  4WK8 F;  3DPT A;  4R8H A;  1KGS A;  3U9G A;  1DDN A;  3TO6 A;  1FBQ A;  1LEA A;  2L01 A;  3O6B B;  1REP C;  2EFP A;  3M8F A;  5AIQ A;  2VOO A;  5KVR A;  4A0Y A;  5JFR A;  4ZYG A;  3IRR A;  3E97 A;  2FQ3 A;  3OV8 A;  1H0M A;  4RGS A;  4BHC A;  1MZB A;  4OMY A;  2FNP A;  2J5P A;  5CVV A;  5D5W B;  1ZYR F;  3QAH A;  2ZJ2 A;  5K5O A;  4HLX A;  5K5R A;  3HRM A;  3KLO A;  1Y0U A;  3WTV C;  1O3T A;  5DD4 A;  2EFW A;  5DCM B;  1I27 A;  1ON1 A;  4IXA A;  3CJN A;  5HS9 A;  2X0L A;  5DCF A;  1T2K A;  2QLZ A;  3COA C;  1KQ8 A;  3J80 K;  3ZN1 A;  5HVQ C;  4A5M A;  3V7C A;  1W5T A;  2GXB A;  3DFG A;  4M72 A;  4HAM A;  1DUX C;  2NRA C;  3MQ0 A;  4LJZ F;  3QOP A;  2WTE A;  2OBP A;  1ZLJ A;  4HA8 A;  1HW1 A;  1F1Z A;  4OOI A;  3CUQ B;  2VOD A;  2VBY A;  2JPC A;  4K2E A;  2YU3 A;  2ISY A;  2GAU A;  1AOY A;  4HX4 A;  2H27 A;  1BC7 C;  2FBH A;  1HW2 A;  2RC4 A;  1SD7 A;  4P9F A;  5D4S A;  2FE3 A;  1LDD A;  3GFL A;  2P8T A;  1F5T A;  1K79 A;  2CSO A;  3RYR A;  3QPT A;  2CWE A;  3BJ6 A;  3FF5 A;  2MH9 A;  1J2X A;  1I1S A;  3HSR A;  3N97 A;  4CXF A;  2A3S A;  6PAX A;  2O6G E;  2NYX A;  1MJA A;  1R36 A;  2PG4 A;  2DU9 A;  4E70 A;  3Q9V A;  1BBY A;  4B09 A;  5BPD A;  3R0A A;  3TGN A;  1P2F A;  2NAZ A;  4QWQ A;  5DD8 A;  1AWC A;  1KU7 A;  1IRF A;  4UV9 A;  3BWG A;  1YFH A;  3FM3 A;  4RGU A;  4EGY A;  3OOP A;  2FF4 A;  3DQV C;  2P6S A;  5CLS A;  2EFQ A;  4DNC A;  2DLL A;  2QBY A;  4MHG A;  1R5G A;  3VEP A;  5AIP A;  2IW5 A;  2PLY A;  1YW8 A;  2KIF A;  2E1N A;  3B73 A;  4HX8 A;  3V4G A;  3T8T A;  1IN4 A;  2K7L A;  4MQV A;  3I4P A;  2XAQ A;  2ZXJ A;  1KU2 A;  3C1D A;  4A0X A;  1RIO H;  1V4R A;  2IVM A;  2HTS A;  3L00 A;  3NEU A;  4L9N A;  2QQ9 A;  1DPR A;  4ESB A;  3W6K B;  2DW4 A;  2PMU A;  4JK1 X;  1I6X A;  4UVB A;  3I59 B;  3TO7 A;  4M71 A;  3CO7 C;  3K2Z A;  4Q5S F;  2DFI A;  1F4K A;  2QM3 A;  3KCC A;  1LEB A;  2RN7 A;  3D0S A;  2PMH A;  1YW7 A;  2ZNZ A;  3FM5 A;  1XSX A;  1HST A;  3EYI A;  1I5Z A;  3M9A A;  1IAW A;  1W7P B;  1HQC A;  2VN2 A;  1J75 A;  2KIU A;  2XRO A;  1YYV A;  1FNN A;  2CFX A;  2LNB A;  3TQN A;  1J0R A;  1OKR A;  1YG2 A;  2ZME A;  3KEQ A;  1UB9 A;  3O3K A;  2FXA A;  2FEZ A;  2OQG A;  4UVC A;  4I7H A;  2UZK A;  3T5X A;  1FBU A;  2Y48 A;  1FWZ A;  4R1H A;  4FHT A;  3PQK A;  1F9N A;  2PBI A;  4DQ2 A;  1XSV A;  1YTY A;  1P4A A;  5ICC A;  4IJA A;  3K69 A;  4U0V A;  2STW A;  2EK5 A;  5F1R A;  3SHF A;  4MTE A;  1Z9C A;  3F3X A;  2H6C A;  2MC3 A;  1Z6T A;  1H9T A;  5FLX Z;  3GZ6 A;  5JR3 A;  1OPC A;  1S8N A;  3GXO A;  1W7P D;  3L09 A;  5DCM A;  4XBF A;  2RVC A;  1BM9 A;  3RPQ A;  5DV5 A;  4WCG A;  4OIR F;  2OZ6 A;  2HTJ A;  2STT A;  2VBW A;  4Z2Y A;  2CW0 F;  4HF0 A;  5E18 F;  3J7A O;  1OR7 A;  4ENM A;  2E7X A;  2MLG A;  2CG4 A;  1NHA A;  1GXP A;  1T39 A;  4KUM A;  5LGN A;  4O5V A;  4L5J A;  4A6D A;  1LVA A;  3F72 A;  4ETS A;  1QZZ A;  2FSW A;  3DPL C;  5JVT A;  3GUD A;  1ZAR A;  2XAG A;  3LAP A;  3CUQ A;  2MD5 A;  5CVI A;  4RGR A;  3GZ5 A;  3RDI A;  3RYP A;  4HF1 A;  3BDD A;  1RUN A;  4MNU A;  4MEY F;  3SQN A;  5D5V B;  1TNS A;  5LRR A;  2M5W A;  1BN5 A;  2ELH A;  4QLC U;  2IA1 A;  4EQQ A;  1I1G A;  3C3W A;  4CYD A;  1QZY A;  3R61 A;  5HLG A;  2GXG A;  1EV7 A;  4OIN F;  5CVR A;  3U1D A;  3JTH A;  5BMZ A;  2IP2 A;  1R1U A;  2RGV A;  2W84 A;  4ZH4 F;  1BOA A;  1USS A;  1J5Y A;  4HW0 A;  4GXO A;  3IKT A;  1ZH5 A;  1Z7U A;  1P6R A;  5LHH A;  4G7Z F;  1MKM A;  4CO8 A;  3BJO A;  3I71 A;  4KMF A;  4LD5 A;  3GFI A;  3RTR A;  2K4J A;  1LQ1 A;  3IWF A;  2IT0 A;  3L9F A;  4IHS A;  3TKY A;  5IT9 Z;  2F5F A;  3F6V A;  3KEO A;  3I0T A;  4UXN A;  1JE8 A;  4LLL A;  4BH9 A;  4HDV A;  4EJO A;  4KN4 X;  4P96 A;  5D5U B;  3WU0 A;  1IXS B;  2XV4 S;  2KIM A;  2YSR A;  4KFC A;  4WXH A;  3RI4 A;  1B9N A;  1MD0 A;  4YG2 F;  2GQQ A;  1D8K A;  2IRF G;  2HFH A;  1K78 A;  2QBY B;  3EUH A;  4HF2 A;  3ULQ B;  1T38 A;  2E7W A;  4KIF A;  2M8E A;  2FU4 A;  3HYI A;  3WTY C;  2O03 A;  1R7J A;  4G9Y A;  2XHK A;  2FMY A;  3S2W A;  3T8R A;  3TDU C;  4PCQ A;  4BYY A;  4KIB A;  1R23 A;  4HV6 A;  2BV6 A;  1FYM A;  1D5V A;  2X4H A;  2JRT A;  4LG0 A;  1BIB A;  3P7N A;  2GIV A;  2H6B A;  1T6S A;  4MGR A;  1P4W A;  5D6F A;  3WGH A;  4XRF A;  5LRS A;  1G3Y A;  4JQF A;  4D0P A;  4M9Z A;  2KRF A;  3RKX A;  3J81 K;  1JGS A;  5ICF A;  2OD5 A;  5E20 A;  3E6D A;  1IRG A;  3ABT A;  2Y75 A;  3PQJ A;  3KLN A;  5DDG A;  2D1V A;  2VOP A;  3CUO A;  2XIG A;  1VTN C;  2PN6 A;  3KP2 A;  2ZME B;  2V1X A;  2AXL A;  3ZMU A;  3LWF A;  1FYL A;  4OIO F;  1RUO A;  3WTS C;  5K5Q A;  1G3T A;  3F22 A;  4A2U A;  4KMU X;  4N9H A;  4Q47 A;  3M7G A;  5LGU A;  3KE2 A;  2VT3 A;  3MFK A;  3IC7 A;  4I02 A;  3CDH A;  4L9V A;  4WF2 A;  5H6R A;  5KK1 A;  2VBZ A;  1PP8 F;  3H3U A;  2EJR A;  2VXZ A;  4WXC A;  5ILS A;  2YX4 A;  3HRT A;  4LFU A;  4L0Z B;  1IN8 A;  2K27 A;  3ABU A;  1ULY A;  1U78 A;  3Q5F A;  3HSF A;  4BXU A;  2P6T A;  4RB0 A;  2XKP A;  3RJP A;  2LSO A;  4PDK A;  3JSO A;  2QVO A;  4HBL A;  4UHT A;  1HSJ A;  2VON A;  1T0F A;  3KP4 A;  1KU3 A;  3FXR A;  1ODD A;  1TNT A;  1ZRC A;  3HRU A;  2A6H F;  1K6O A;  2ZO4 A;  1UHM A;  3LA7 A;  5LBQ A;  2M45 A;  1HKS A;  5J8F A;  5ICG A;  1FZP B;  1U5T A;  4LLN A;  1OYY A;  2HYG D;  3GFJ A;  1HW5 A;  4A5N A;  4CHU A;  3LQR A;  2EWN A;  2W85 A;  1SFE A;  2JPB A;  4IVN A;  2D45 A;  3Q9S A;  4I09 A;  4LK1 F;  3LST A;  2EV0 A;  1ZLK A;  1S7A A;  4LB6 B;  1V3F A;  1U2W A;  4OIQ F;  3BOQ A;  3HRS A;  4AD9 A;  2RNJ A;  4UNO A;  1STZ A;  5HS7 A;  4UVA A;  4M9X A;  2ESN A;  2RKH A;  5ERI A;  3QPH A;  4BAY A;  1ONV A;  4FX4 A;  1XDU A;  5FFZ A;  2XAJ A;  1ZRF A;  3LQQ A;  4CGZ A;  2R3S A;  3WTT C;  2ADU A;  4RS8 A;  3C18 A;  1XD7 A;  2O3F A;  3RIR A;  5J8C A;  3F8C A;  3TO9 A;  3VOD A;  1FOK A;  3QRF F;  1BC8 C;  4UV8 A;  1FY7 A;  1SFU A;  1J7K A;  1J9I A;  2IA0 A;  2M1B A;  2RDP A;  2P5V A;  4Y17 A;  5F64 A;  3W6J B;  4RB3 C;  1K7A A;  2MH2 A;  1ZGA A;  3J80 Z;  3WTW C;  1XMK A;  1B4A A;  4XSX F;  1QNT A;  2DPU A;  1O7L A;  1TQI A;  3FXU A;  3H92 A;  2TDX A;  3FMQ A;  1LJ9 A;  4N9I A;  1SD5 A;  5CJ9 A;  1YO5 C;  4MQ9 F;  2ZCW A;  1ZG5 A;  3BJA A;  2HQR A;  2P7V B;  4BHP A;  2Q2E A;  3KET A;  2QEN A;  3GFM A;  2FOK A;  1K78 B;  2E1C A;  4Y15 A;  3HHH A;  2C6Y A;  4EM1 A;  3R60 A;  3CLO A;  2F2E A;  1FSE A;  4YIF A;  5L3E A;  4G7H F;  4EJV A;  1IF1 A;  3DV8 A;  2XAF A;  4ZYH A;  4G6Q A;  2VBX A;  5EEG A;  3FXQ A;  2NNY A;  1TW3 A;  4U0Y A;  1DPU A;  2R7D A;  5K1Y A;  2A5Y B;  1T98 A;  2BGC A;  2L54 A;  3E5U A;  1KA8 A;  3O2P E;  4LG0 B;  3WG9 A;  4LMY A;  5BOX A;  1PDN C;  1YW9 A;  5L3G A;  1WWX A;  3BZ6 A;  4Q4Z F;  2LDU A;  2JSC A;  4KNY A;  2HOE A;  4CIC A;  1ZG3 A;  4S05 A;  4WXD A;  4UUV A;  5L3D A;  1QQI A;  3B02 A;  3GLX A;  1Z05 A;  1HKT A;  4H0E A;  2HGC A;  2EFO A;  3HIF A;  2DO7 A;  1IZ1 A;  2DK8 A;  2O8X A;  1RNL A;  1O3S A;  1SAX A;  1W5S A;  2PFB A;  4O3M A;  3ZMT A;  3AAF A;  3P9I A;  1YLF A;  2BBY A;  2UXX A;  3KFW X;  2COM A;  4ZYD A;  4IRH A;  2QZ8 A;  3ZQ7 A;  1RZ4 A;  3E6M A;  4PZJ A;  2MBF A;  3LFK A;  1OMI A;  4ON0 A;  2BEO A;  2VC0 A;  3I53 A;  3E6B A;  2DTR A;  2HR3 A;  1UCR A;  4HOB A;  2RQP A;  1LNW A;  3JSP A;  4AWX B;  1U8R A;  3K9T A;  1LB2 A;  5CVU A;  3HTS B;  5E8I A;  1GVJ A;  4M9S A;  2FRH A;  2HYF A;  3DEU A;  4XLN F;  2WC2 A;  4HDU A;  3E6C C;  2OZU A;  1GHC A;  1R1V A;  3K1N A;  1P92 A;  3ROU A;  3LA3 A;  4HYE A;  3E5Q A;  5F6F A;  2ISZ A;  4ASN A;  4L5I A;  3ZPL A;  1Z6R A;  2V6C A;  4KIG A;  1B6A A;  3I54 A;  4KIC A;  4U88 A;  1U5T B;  3ZMV A;  2K02 A;  4MEX F;  3I5U A;  3H3Z A;  3HHG A;  2DT5 A;  2DI3 A;  2DQR A;  1W4M A;  2IJL A;  1D3Y A;  4EMS A;  1WRJ A;  1EH6 A;  4HLY A;  1BI1 A;  3G3Z A;  2Y0M A;  2PQ8 A;  4IF4 A;  3WOD F;  1FT9 A;  3KZY A;  2G7H A;  3GEZ A;  1G4D A;  3IHU A;  3DXJ F;  1CGP A;  1ZAO A;  2XGX A;  2P4W A;  5A2Q K;  1X3U A;  3F21 A;  2JTV A;  4ESF A;  4EVI A;  3FMS A;  3NRV A;  3CTA A;  4KYW A;  1XDS A;  3V8K A;  5FFX A;  3GWZ A; 
#chains in the Genus database with same CATH topology
 2MLK A;  4EJW A;  1UHW A;  2DFH A;  2M87 A;  3GW2 A;  2HQN A;  3DF8 A;  3TOA A;  1QPI A;  2ZBK A;  4FX0 A;  3PUF A;  2Z9O A;  3S1R J;  2M30 A;  5TJJ A;  5LHI A;  2L3D A;  3BY6 A;  1WZ2 A;  3K4N A;  1IN7 A;  4M3F A;  4XIC A;  1OJL A;  1BW6 A;  3QYB A;  2JSP A;  1NG6 A;  2D2W A;  3FMR A;  2W48 A;  2VE8 A;  3OS0 A;  2A68 F;  4AYB A;  3HDD A;  4U7D A;  2XPV A;  4ENJ A;  3F23 A;  1KYZ A;  1LDJ A;  1XPX A;  2P5L C;  4UB6 C;  1MGT A;  5D6E A;  1QPM A;  4L18 B;  2EZH A;  4NNJ A;  2V1D A;  1Q1V A;  1YJW I;  2OUM A;  2DTZ A;  1BIA A;  4EV0 A;  4XOR A;  4WWC A;  5HLI A;  4J00 A;  4BUP A;  3U2R A;  1YS6 A;  1ZGW A;  4X0G A;  3TED A;  2VKH A;  3BC8 A;  1R00 A;  3M3Y J;  1G6N A;  2VAS A;  3ABL H;  5CYV A;  3EPZ A;  3F9K A;  2YX7 A;  2YUS A;  2E2J J;  2CQX A;  2EZL A;  4LLG F;  1SD4 A;  1D0Z A;  2WAQ N;  2DT7 B;  4RM2 A;  5TRD A;  3HGG A;  2BY1 A;  1WI9 A;  2W24 A;  2Q2E B;  3OWT A;  3BG7 A;  5CPR B;  2FOW A;  1B9M A;  3WHC A;  3WE2 A;  4PJL A;  1IW7 F;  3OSF A;  2E5N A;  3BG9 A;  3RKW A;  3P9K A;  1TQM A;  1ETX A;  3FHZ A;  2XPW A;  2OV7 A;  3W6V A;  4BQO A;  4IHX A;  1QGP A;  3WTX C;  4E4H A;  5A2Q Z;  3LA2 A;  1IUY A;  4C2U A;  3JRI A;  1U3E M;  1SVO A;  1D8J A;  1SFO J;  3K70 C;  3OL4 A;  2ETH A;  1SFX A;  2KIS A;  5EG0 B;  4CYC A;  3SFZ A;  3WE3 A;  4QSH A;  2EPF A;  2XAU A;  5IT3 A;  3WU2 C;  3E3V A;  2L7M P;  5M5X J;  4YFX F;  2IXS A;  1X4P A;  2DOF A;  1TT0 A;  3J7Y J;  2NVT J;  1S9H A;  2ICW G;  4RAY A;  4ZYE A;  2EA2 A;  3MCZ A;  5FO5 A;  1XS9 A;  2OTL I;  1WVR A;  3VOE A;  3SFI A;  5E1Z B;  3PFI A;  1IDZ A;  4XMY A;  3QU3 A;  1O3R A;  1DP3 A;  3BPX A;  1LPQ A;  1Z91 A;  4EM0 B;  2V1U A;  5JHU A;  3U21 A;  2H1K A;  2A07 F;  2JA7 J;  3KIO A;  9ANT A;  5J4Y A;  2ACJ A;  1MDM A;  1TW2 A;  3EDP A;  2HKX A;  3I64 A;  2M7B A;  5FRO A;  2JUG A;  2DMP A;  2Q1Z B;  4PJN A;  2NS0 A;  2HDW A;  2TRT A;  4DYR A;  4A3J J;  4X6A J;  4GYI A;  3K4L A;  3KYC B;  2P5K A;  4MIM A;  3C2B A;  1EJ9 A;  3A0B C;  1ZRD A;  3P9C A;  4E7L A;  5M3M J;  1FYK A;  2H09 A;  1QO0 D;  4LIV A;  5J40 A;  3ZP5 A;  3BP8 A;  3H9Q A;  4EGZ A;  1O3Q A;  4C3J J;  3JRE A;  4F3Q A;  1N75 A;  2UWM A;  5HOO A;  1WJB A;  4NC8 A;  2R5Y B;  2F5E A;  3OYJ A;  3MEX A;  3I58 A;  4IKF A;  1X1D A;  5LEK A;  3OYG A;  4HX7 A;  1H8A C;  2JA6 J;  1WKM A;  1HBX G;  5IP7 J;  3GYH X;  4IHY A;  1L0O C;  4XLE A;  4A12 A;  3QP5 A;  1N78 A;  1PVE A;  1AU7 A;  1BJA A;  2GWR A;  5IOY A;  2CYY A;  1O7F A;  3SDB A;  2QWW A;  3HC7 A;  1TTY A;  3LMM A;  5E3N A;  1HXD A;  3WTU C;  4M6Y A;  3ML6 A;  2B0L A;  2DMT A;  3ZN0 A;  3R4K A;  2ZME C;  4P9U A;  3GF2 A;  5GTH C;  4A6E A;  3SZP A;  1LVK A;  3VSL A;  2LFB A;  2DAO A;  5EGO B;  1IXR C;  1TWC J;  1PUF A;  5GAG J;  1GV2 A;  2LBF A;  4B3A A;  5AON A;  5JI6 A;  2J5O A;  1JHF A;  1XCB A;  2CFO A;  1WH5 A;  3J81 Z;  1MNE A;  2BZT A;  2F5C A;  2VQC A;  1OYW A;  3K4B A;  1K4S A;  2F5V A;  2O61 A;  1FC3 A;  3RQI A;  5HDN A;  3JR9 A;  2HEO A;  5ED4 A;  5FD6 A;  1G3S A;  2N8G A;  4A0Z A;  1B59 A;  3CJR B;  2KKO A;  2Q0O A;  2BVL A;  3G71 I;  1K6Y A;  1K61 A;  2OAZ A;  3A0H C;  2FNA A;  1OFC X;  2QYO A;  2E35 A;  4PSX A;  4BQN A;  1YQA A;  3OSG A;  5LFA A;  2CJJ A;  4ZTF A;  3CDL A;  5L3B A;  2Y69 H;  3KP7 A;  2G9W A;  3CO6 C;  4E7S A;  4I2O A;  1UG0 A;  4HZF A;  3TW7 A;  5FJ8 J;  2EBI A;  2L9N A;  4M73 A;  2XAS A;  2LF7 A;  4HV5 A;  3PNT A;  4ZC3 A;  1S3J A;  3SXY A;  4HQM A;  2OA4 A;  4ZTJ A;  1FJL A;  1ACI A;  1JUP A;  2O0Y A;  3L2C A;  1CF7 B;  2FX0 A;  2OCC H;  2LKS A;  2OQR A;  3LL7 A;  3BRO A;  5LLQ A;  1ZR4 A;  1WI3 A;  3C2H A;  3JW4 A;  2EIN H;  3RCO A;  3V42 A;  4CZZ A;  3HOW J;  1AHD P;  5DEQ A;  2DYS H;  2NS8 A;  5D5X B;  2R7X A;  3EYY A;  1OR7 C;  1FPQ A;  2VI6 A;  3PIP F;  5FRN A;  5B5E C;  4FET A;  3G6E I;  4HSR A;  2LD5 A;  2A69 F;  1ON2 A;  4TV7 A;  1WGX A;  3GO5 A;  4C2M J;  2K86 A;  3F8B A;  1RPW A;  2D1H A;  3M8E A;  3DKY A;  2FJ1 A;  1U9N A;  3HUG A;  2DMQ A;  1FP2 A;  2CS3 A;  1XGO A;  1G3W A;  4RAZ A;  5L3F A;  3S3M A;  2Z5U A;  3HOS A;  1QA6 A;  4S04 A;  3GVA A;  1XGS A;  4A3G J;  3K7A J;  3JCU C;  2EB7 A;  5ILU A;  3KEY A;  4U0W A;  3OS2 A;  4NB5 A;  3CUQ C;  1F43 A;  1TZL A;  2CO5 A;  3FWE A;  2WY7 Q;  4AIK A;  2MAB A;  3FXM A;  3H36 A;  2GOX B;  1Y1W J;  3KP3 A;  1J59 A;  5E17 F;  3VDX A;  4DZJ A;  4DIQ A;  1FOX A;  4F55 A;  1MMD A;  1ETW A;  3V7R A;  2JQ7 A;  1I39 A;  4RGX A;  1ITY A;  5K7F A;  2F4I A;  4FT8 A;  3MZH A;  1Z7L A;  2EA4 A;  4ESJ A;  2FBI A;  4XRS A;  2ZFW A;  2EFN A;  2MYS A;  3DBR B;  3BPV A;  2Q8K A;  5CVJ A;  4RB1 A;  3K4M A;  4IRG A;  4P5O A;  2WV0 A;  5EEH A;  4HQE A;  1TP4 A;  3E5X A;  2ZXW H;  2R7W A;  3DKW A;  4ZDL A;  4YFK F;  2OU2 A;  3J7Z I;  1JKR C;  1TLH B;  4S0H B;  4FE4 A;  4BE0 A;  1L3L A;  1XX5 A;  1IRX A;  2JMW A;  2XUB A;  1TC3 C;  5LHG A;  4CUG A;  3K4J A;  1R5H A;  3G1L A;  2V4J C;  2MC4 A;  3HOX J;  4XOP A;  4BBS J;  1JXS A;  3BCB A;  2V9K A;  2NNN A;  2K3F A;  5FGM A;  2IS1 A;  4G6T B;  3ERE D;  3GLL A;  3R6S A;  4IRI A;  1RI7 A;  1R71 A;  2KJC A;  2LH9 A;  3VB2 A;  5EDN A;  3OYK A;  3SEQ A;  2CRG A;  1IN6 A;  4EJT A;  2WB1 A;  1BI2 A;  2L02 A;  2XSD C;  1FLI A;  1XTA A;  4OAZ A;  3TDZ C;  3N4M A;  1ZRE A;  1MH4 A;  4CH7 A;  2BE5 F;  1QVU A;  1YX3 A;  3CC2 I;  4KDP A;  1P7J A;  3HKZ A;  2CMP A;  3I56 I;  3V8J A;  1JJ6 C;  1EH8 A;  2V7F A;  1GDT A;  2LYC A;  5L3C A;  3MD2 A;  1EH7 A;  3E7L A;  3F8F A;  3B6C A;  2JZY A;  2A61 A;  3FZV A;  2XAH A;  1WHU A;  3I3L A;  4PK4 A;  4M6X A;  3VYU B;  5IYD J;  2X48 A;  4OIP F;  5HLT A;  2FML A;  2DBB A;  2ZNY A;  5FLX K;  5D8K B;  2R7S A;  2PEX A;  1FBS A;  1V54 H;  2V26 A;  1HLV A;  2RV8 A;  5HNH A;  3OYN A;  3G73 A;  2WA0 A;  5M3F J;  3MKW B;  1TWH J;  3ISP A;  1XCV A;  4NHJ A;  1P4X A;  4N0B A;  4XL9 A;  1QRY A;  1S7O A;  3HBL A;  2HKO A;  3NQO A;  4AU7 A;  2DOD A;  5E1X A;  1XGN A;  4D7M A;  3LAJ A;  3O8H A;  2QF7 A;  3PO3 J;  1C0W A;  3O8G A;  2R0Q C;  1S6L A;  4LGW A;  2L4A A;  2DA6 A;  1IC8 A;  3TW6 A;  4G94 A;  1QBJ A;  2A6T A;  3ZMZ A;  1BI0 A;  4A93 J;  2Y0S N;  3EUH C;  3K1M A;  3QPS A;  4OU0 A;  3TMO A;  2XPU A;  4Y13 A;  2NVX J;  4BHB A;  1IUF A;  2BXY A;  3M1C A;  2FD5 A;  2V9V A;  2Z3Y A;  2KLO A;  3DLL F;  1QZE A;  1MMA A;  2HZT A;  5J47 A;  5E3O A;  4LK0 F;  4JOM A;  4ENK A;  2A6E F;  3OYM A;  3KYD B;  2MD0 A;  5C3E J;  1TQP A;  1JT6 A;  4RAF A;  1SMT A;  2XVC A;  3QWL A;  5LGT A;  2E60 A;  2L2O A;  2LLK A;  2LKP A;  1HF0 A;  2EH3 A;  3OIP A;  2K9N A;  2BYV E;  1MDM B;  5D8L B;  5D4R A;  3ZMS A;  4Q48 A;  4BY1 J;  2XKO A;  5H2F C;  3DP7 A;  4XN0 A;  4KJZ A;  1VQ6 I;  1KQ9 A;  3R0J A;  4V2G A;  1BR4 A;  1HKQ A;  2GOM A;  5BPI A;  4AIH A;  1SMY F;  1Q1H A;  4AVP A;  1VQ4 I;  1Y8Q B;  3ZQG A;  1KZH A;  1X3Z B;  1QU3 A;  1POG A;  3F6O A;  2HOT A;  3A01 A;  5GP9 A;  2XRL A;  5B1B H;  3Q0W A;  1X58 A;  2HDC A;  1Z1D A;  4ZZL A;  4B1R A;  3ZMD A;  4F7Z A;  3IAS 2;  4ITV A;  2CU7 A;  2EV5 A;  3KPH A;  2PJP A;  1BJZ A;  2X6X A;  3EQL F;  1IXC A;  5H20 A;  3VWB A;  2H8W A;  3MKL A;  4WX9 A;  4JBA A;  3F0C A;  2KRC A;  1X19 A;  2XGE A;  5HDG A;  3S3N A;  4U87 A;  1XN7 A;  2KJB A;  3MKY B;  2L0K A;  3S32 A;  4DJA A;  3CP8 A;  4XK4 A;  3BR5 A;  1U6G A;  2PI0 A;  1OQY A;  1KON A;  2YR2 A;  3HM5 A;  1MND A;  1O57 A;  4I0A A;  4I0B A;  1B1B A;  3T1B A;  2HQ5 A;  2YS9 A;  1A04 A;  4A3K J;  3RPU D;  4E7J A;  2CQK A;  1MJB A;  1N77 A;  1TBX A;  5C4J J;  3IL2 A;  3CMA I;  1SAN A;  1PUF B;  2LBF B;  1APL C;  3M1E A;  4LIU A;  4D5C A;  3L2R A;  2FA5 A;  1NK2 P;  4P55 A;  1GXQ A;  2PMZ N;  3REO A;  1JI8 A;  4XSZ F;  1GT0 C;  1ZHF A;  2E1M C;  2ME0 A;  3G2B A;  5FKK A;  1IO2 A;  1X3W B;  3WHB A;  1X1A A;  3F8N A;  2Z99 A;  4G8X A;  1VQP I;  3V7S A;  3JAM K;  1DP7 P;  4IHT A;  2GZW A;  4ZDO A;  3ZQQ A;  4G7O F;  2F48 A;  1CF7 A;  2D5V A;  1UFM A;  2ME6 A;  3LSJ A;  3SZG A;  1Y8R B;  2WWY A;  3SZT A;  5IT9 K;  5JVG F;  3CMM A;  3ZQI A;  2JVG A;  1OCC H;  2ZJP F;  1VQO I;  1TWA J;  3K6G A;  3AFH A;  4IPA A;  3K0L A;  2ZXH A;  1RC9 A;  2GA2 A;  2FBK A;  2XDV A;  2X1E A;  1MJ9 A;  2LVS A;  3HTU A;  4GCV A;  2OC6 A;  4ZZD A;  4KA4 A;  2V6E A;  3GX4 X;  2LRE A;  2QGU A;  3MWM A;  1E2X A;  2P7C B;  4KT5 C;  1KQ0 A;  2XB5 A;  1M1E B;  2DXI A;  1R58 A;  2LK2 A;  2DMN A;  1MNM C;  2E2H J;  3C7J A;  1HOM A;  3KZZ A;  2Z33 A;  5CKT A;  1JGG A;  4B8X A;  2LC2 A;  3CF2 A;  2MA3 A;  2L5Q A;  3L2W A;  2GA1 A;  4C30 A;  1T0F C;  1FSH A;  5FB2 A;  4C9Y A;  3IH2 A;  1S5L C;  2CW8 A;  4YII A;  1IG7 A;  2DQL A;  3OR2 C;  3JTG A;  1S29 A;  2VT2 A;  1SAU A;  3MMY B;  2IPQ X;  5BS6 A;  3MZY A;  5BQT A;  4JYK A;  4EJU A;  3LSH A;  5B1A H;  3D5L A;  5HLH A;  1FX7 A;  2JT1 A;  1H9G A;  1VQM I;  5EZH A;  4GO1 A;  3DEW A;  3ECO A;  2ZFU A;  1U5T C;  3HUG B;  3IRQ A;  1OYI A;  1FP1 D;  2EV6 A;  2IGK A;  1MMS A;  4JP0 A;  2L7Z A;  4KN7 X;  1ZG1 A;  1DQU A;  4XLP F;  3ASN H;  2DA5 A;  2HPI A;  2XRN A;  1KU9 A;  1YIO A;  4BNC A;  1R22 A;  3WTZ A;  1UG2 A;  5H6Q A;  2QQA A;  3ECH A;  5E1W A;  2I8D A;  4L9T A;  2HOA A;  1ZN2 A;  4JX6 A;  4YIR X;  3V8L A;  5DS9 A;  5HS8 A;  4Z6Y A;  1G8X A;  4XR6 A;  2CGP A;  1JKP C;  3MAJ A;  5TIS C;  1VQ5 I;  2M4G A;  1XB4 A;  1JHH A;  2VJ5 A;  3BR0 A;  3ESW B;  4MFD A;  5FD5 A;  4L9J A;  3S15 J;  5E8G A;  4NQW A;  1E17 A;  1XSD A;  4BJ6 C;  1UST A;  1B8I A;  1LDK B;  2QUF A;  1VQN I;  5DUK A;  3L7W A;  1KYW A;  1Y6I A;  3JAM Z;  3F8M A;  1T56 A;  1BW5 A;  1ZEL A;  4L0Y B;  3KP5 A;  2W25 A;  3VFZ A;  3DWL E;  5C4X J;  1LKX A;  5KAI C;  5LEJ A;  4O6J A;  2H1L A;  2HS5 A;  1X1C A;  2VL8 A;  4CDG A;  4LB5 A;  4D5F A;  3PUB A;  4ENN A;  3RKQ A;  2DPD A;  3TL4 X;  2IEK A;  2QQB A;  2YPR A;  4MTD A;  1A36 A;  1E0E A;  3ERM A;  5EF6 A;  3TOB A;  4A69 C;  2Z2S B;  2MSY A;  5DUI A;  2P81 A;  2LF8 A;  3OYE A;  3GTQ J;  1VZ0 A;  3T0Y A;  3JRG A;  4OMZ A;  4U7B A;  3WGI A;  4IL6 C;  1A31 A;  4BGD A;  1R1T A;  3QPL A;  1WQ2 A;  3CLQ A;  2ID6 A;  3IWZ A;  1SD6 A;  1XGM A;  3LSI A;  5DYM A;  4DBQ A;  4R79 A;  2GBY A;  4PGG A;  2O5R A;  3NWT A;  1MH3 A;  2ESH A;  3EET A;  2IA2 A;  2R7F A;  2EIM H;  3HGY A;  2QA4 I;  3WGG A;  5J6X A;  4YFN F;  1PJR A;  4A3F J;  1GUU A;  1LFU P;  5GAH J;  2PJR A;  2W57 A;  4EEF G;  2K4B A;  1XMA A;  4DYC A;  4I01 A;  3L2U A;  1YS7 A;  3KP6 A;  5ICE A;  5ILV A;  2VE9 A;  1PUE E;  3I59 A;  4AIJ A;  1R9T J;  3H0G J;  1SVL A;  3HSE A;  3MN2 A;  1YE9 A;  2LY9 A;  2UXN A;  1WSU A;  1LFB A;  4JX4 A;  3WU1 B;  1WJE A;  1BI3 A;  2G7U A;  1U9O A;  4GGG A;  3QP6 A;  4I98 B;  3QU6 A;  2AS5 F;  3IKV A;  1PP7 U;  1ZGJ A;  5HDK A;  2L4M A;  2DK5 A;  2R7U A;  1D1C A;  1Z3Y A;  3RKY A;  1VQ8 I;  1W7P A;  4BXX J;  3ELK A;  3FX3 A;  3ABK H;  2V79 A;  3RPU A;  2HWV A;  3CME I;  1Z3X A;  2F5D A;  4M74 A;  4EM2 A;  2WAQ A;  3HOT A;  1YJN I;  2DOA A;  3S2H J;  4PGH A;  1GV5 A;  4GYG A;  3K70 D;  2CQ7 A;  3GZN B;  5F08 A;  1W5C C;  4BQA A;  1I6H J;  5IPA A;  2X51 A;  2B9S A;  1JKO C;  1BR1 A;  1IN5 A;  5FRM A;  3K1P A;  4G6D A;  2ZKZ A;  2MW8 A;  2IGO A;  2H94 A;  4RB2 C;  2VC1 A;  4WK8 F;  2BHY A;  5HOD A;  1OLT A;  3DPT A;  3BTI A;  4R8H A;  3IH4 A;  1KGS A;  5LD2 C;  2EIK H;  3U9G A;  4DW6 A;  1DDN A;  3FDY A;  3TO6 A;  1FBQ A;  1QVT A;  1LEA A;  3HZJ A;  2L01 A;  1BR2 A;  3E1S A;  1DGR M;  2EFP A;  3O6B B;  1REP C;  3A02 A;  3M8F A;  5AIQ A;  1ETK A;  2VOO A;  2CQQ A;  4ANJ A;  5KVR A;  1TL8 A;  4I76 A;  5IYB J;  4A0Y A;  5JFR A;  3FXK A;  2IS4 A;  2AHQ A;  4ZYG A;  3W2W A;  4Y33 A;  4A3C J;  3IRR A;  3E97 A;  3BTL A;  3A01 B;  1OIS A;  3UKG A;  2FQ3 A;  3H9J A;  3OV8 A;  4XKB A;  2WY8 Q;  1H0M A;  4RGS A;  5F04 A;  3Q3S A;  3OY9 A;  4IQ4 A;  3AG3 H;  3BQY A;  2NS7 A;  4BHC A;  1MZB A;  4OMY A;  4GRI A;  1YJ9 I;  2FNP A;  2J5P A;  2KZV A;  1Y39 A;  5CVV A;  4E7Z A;  4B4C A;  3ASO H;  3G1M A;  2LOO A;  5D5W B;  3D5S C;  5J1R A;  3RZD J;  3IH3 A;  1ZYR F;  3QAH A;  2ZJ2 A;  5K5O A;  3JRH A;  4BJ5 C;  4HLX A;  5K5R A;  3HRM A;  3RQ4 A;  3KLO A;  4UB8 C;  1BOB A;  1Y0U A;  2CQN A;  3WTV C;  1B72 B;  3JRD A;  1O3T A;  5DD4 A;  2EFW A;  1QHG A;  1Z0X A;  5DCM B;  2WV1 A;  1I27 A;  4N4O B;  4FAS D;  5F1J A;  1ON1 A;  4F91 B;  4IXA A;  2K9L A;  1T08 B;  3CJN A;  5HS9 A;  5KAF C;  3J7A Y;  1WJC A;  4C3H J;  2X0L A;  5DCF A;  2OJE D;  5EYR A;  1T2K A;  4XLA A;  2LY2 A;  2QLZ A;  1X1B A;  3COA C;  1KQ8 A;  2R7R A;  2M7A A;  2UUZ A;  4J01 A;  3J80 K;  2HVR A;  2JA5 J;  3ZN1 A;  5HVQ C;  2KL4 A;  4A5M A;  2KIQ A;  3I4N J;  3V7C A;  3VSK A;  2XF5 A;  1W5T A;  2GXB A;  5E3L A;  3DFG A;  1WJ5 A;  4M72 A;  3D1N I;  3QOD A;  4XRM A;  4HAM A;  1D0X A;  1DUX C;  4IOA F;  1WJF A;  2NRA C;  3MQ0 A;  1WPK A;  4LJZ F;  3ZRG A;  1WFX A;  2Y9Z A;  1LFP A;  2R4G A;  3QOP A;  2WTE A;  1NG7 A;  2OBP A;  4B47 A;  2RNG A;  1ZLJ A;  1MMN A;  1HW1 A;  4HA8 A;  4IX7 A;  1F1Z A;  3JRF A;  4OOI A;  3CUQ B;  2VOD A;  2AQE A;  2KRH A;  2M0M A;  2VBY A;  3FK7 A;  3BG5 A;  5DM7 F;  2JPC A;  4K2E A;  2YU3 A;  3FIS A;  2ISY A;  3QQA A;  2VPL A;  2GAU A;  2LRD A;  3CJQ B;  4DOZ A;  1AOY A;  3SYT A;  4HX4 A;  3FIW A;  3LSM A;  1JT0 A;  2V9P A;  2H27 A;  1BC7 C;  2FBH A;  3DTE A;  3DTI A;  3QYE A;  1LUJ B;  1HW2 A;  1SFK A;  2VQH A;  4PJ0 C;  4A3M J;  2RC4 A;  1SD7 A;  4P9F A;  5D4S A;  2FE3 A;  1VQ7 I;  4GDF A;  1LDD A;  3GFL A;  2P8T A;  4II2 A;  1F5T A;  2VQG A;  2O8K A;  3OL3 A;  2CSO A;  5FKL A;  1K79 A;  2GXA A;  3RYR A;  4CA0 A;  3QPT A;  2CWE A;  3S1N J;  3BJ6 A;  3FF5 A;  2MH9 A;  1J2X A;  1SC7 A;  1I1S A;  3S93 A;  4BDY A;  1OCO H;  4A3D J;  3HSR A;  3BT9 A;  3N97 A;  4CXF A;  3IAM 2;  2A3S A;  6PAX A;  2O6G E;  2NYX A;  1OCZ H;  2F4M B;  2L9R A;  1Y1V J;  4F93 B;  2VJ4 A;  4IEJ A;  1NH3 A;  1SVM A;  3W2V A;  5J1U A;  1MJA A;  2W82 A;  4YEJ A;  1RET A;  5FKO A;  2WB1 N;  1R36 A;  2PG4 A;  1E3P A;  2DU9 A;  4ZJZ A;  1FOY A;  3LOC A;  2KMU A;  4E70 A;  5J1Y A;  3Q9V A;  1BBY A;  2HXI A;  4B09 A;  5BPD A;  4FQG A;  5F0F A;  3PM1 A;  3R0A A;  3TGN A;  3GTP J;  1P2F A;  1T95 A;  2NAZ A;  4NQW B;  2K9M A;  3BR3 A;  4QWQ A;  1MBE A;  1B8I B;  2IAI A;  5DD8 A;  1AWC A;  2KT0 A;  1KU7 A;  3K10 A;  2DJN A;  3ZQL A;  1IRF A;  2DA3 A;  4UV9 A;  3BWG A;  5J4V A;  1YFH A;  3FM3 A;  4RGU A;  3PSI A;  4EGY A;  3OOP A;  3HXL A;  2FF4 A;  4B43 A;  2F6C A;  3DQV C;  3GTG J;  3I4M J;  1D1B A;  2P6S A;  5CLS A;  2EFQ A;  1R4N B;  2DLL A;  3HG9 A;  4DNC A;  2QBY A;  4DGW B;  4MHG A;  1R5G A;  3VEP A;  2LMD A;  5AIP A;  4GFB A;  2IW5 A;  4E7I A;  2PLY A;  1YW8 A;  2KIF A;  2E1N A;  4UY8 I;  3B73 A;  4HX8 A;  4XKV A;  3T8T A;  3V4G A;  1IN4 A;  4YRV A;  1ENH A;  2K7L A;  1YRN A;  4MQV A;  3I4P A;  2XAQ A;  2ZXJ A;  1KU2 A;  2O7O A;  2CUF A;  2E71 A;  5KNL A;  2DT6 A;  3C1D A;  4A0X A;  3MZ8 A;  1YOV B;  3OIO A;  3UNG C;  3IUO A;  4L5E A;  1X4O A;  3EUK L;  1RIO H;  4KIS A;  1V4R A;  2IVM A;  4BAC A;  2HTS A;  3L00 A;  3NEU A;  4L9N A;  5KCM A;  2QQ9 A;  3OYH A;  1DPR A;  4ESB A;  4LOC A;  2WBM A;  3FKJ A;  2PJR B;  4HST A;  4M3E A;  3W6K B;  4BEH A;  2QSF X;  2DW4 A;  2PMU A;  3TBI A;  4JK1 X;  4BJT A;  1I6X A;  4UVB A;  4QTR A;  3I59 B;  3TO7 A;  4M71 A;  2M0C A;  1QHH D;  3CO7 C;  1W0T A;  3HEF A;  4IQJ A;  3K2Z A;  2K40 A;  2COB A;  4Q5S F;  2DFI A;  2JRM A;  4Y4R A;  3HOV J;  1F4K A;  1ORK A;  2QM3 A;  3KCC A;  1LEB A;  2BXZ A;  2RN7 A;  3D0S A;  2PMH A;  3S1M J;  1YW7 A;  2DOE A;  3AKZ A;  4W1U A;  2KDO A;  2ZNZ A;  3FM5 A;  1HST A;  1XSX A;  3EYI A;  2Y9Y A;  3PIO F;  1I5Z A;  3M9A A;  3QYF A;  1IAW A;  1W7P B;  2H8R A;  2QQ8 A;  1YI2 I;  2DMU A;  1HQC A;  2VN2 A;  1J75 A;  2IS2 A;  2KIU A;  4HPQ A;  3BZC A;  1YYV A;  2XRO A;  2CH0 A;  2RRE A;  1XG1 A;  1ETO A;  1A6I A;  2X85 A;  4E7K A;  3DU5 A;  1FNN A;  2VKE A;  2CFX A;  3GTO J;  1RKT A;  2QKL B;  2LNB A;  3TQN A;  1J0R A;  1A35 A;  1OKR A;  2HVQ A;  1YG2 A;  3AL0 B;  3RZO J;  1MBK A;  2ZME A;  3ZQC A;  2DA2 A;  4YEL A;  2K85 A;  3KEQ A;  1UB9 A;  3O3K A;  1HDD C;  2FXA A;  3BG6 A;  4M3G A;  2FEZ A;  1ZTR A;  2OQG A;  4UVC A;  1XMX A;  4HRI A;  1MMG A;  2M34 A;  4I7H A;  2UZK A;  3T5X A;  1FBU A;  2Y48 A;  3BR2 A;  1FWZ A;  4R1H A;  4BE1 A;  2LY1 A;  3CJT B;  3PQK A;  1F9N A;  4FHT A;  4B48 A;  1AKH A;  3VYT B;  2XGC A;  1V5F A;  2PBI A;  4DQ2 A;  1XSV A;  2JWT A;  3LSP A;  1YTY A;  4XLC A;  1P4A A;  5ICC A;  4C3I J;  4IJA A;  3K69 A;  4LG3 A;  4U0V A;  1JTX A;  2STW A;  2EK5 A;  5F1R A;  1BA5 A;  3OYA A;  2Y0S A;  5GPC A;  3SHF A;  5IYC J;  4MTE A;  2DYR H;  1Z9C A;  3C2G A;  3GCM A;  3F3X A;  2H6C A;  2MC3 A;  5EEA A;  2MGQ A;  1Z6T A;  2X6Y A;  1H9T A;  5FLX Z;  3GZ6 A;  5JR3 A;  1OPC A;  1S8N A;  3JRC A;  3DBL B;  3GXO A;  4MFE A;  1W7P D;  1B72 A;  3DEE A;  3L09 A;  3GTJ J;  5DCM A;  1UMQ A;  4XBF A;  3HPG A;  2RVC A;  3A4C A;  4XOT A;  1BM9 A;  4UUT A;  3HOU J;  1W36 C;  3RPQ A;  4MO7 A;  5DV5 A;  4WCG A;  2E1O A;  4OIR F;  3A03 A;  3CCU I;  2OZ6 A;  3FK6 A;  3IV5 A;  2HTJ A;  2STT A;  2KHM A;  4ZYA A;  1JTY A;  2VBW A;  1XC5 A;  4Z2Y A;  2WAE A;  2CW0 F;  4HF0 A;  2UV1 A;  4B44 A;  3KZI C;  4DZP A;  5IOZ A;  5E18 F;  4NDL A;  1FIA A;  3M8J A;  3J7A O;  2VKD A;  4RA2 A;  1OR7 A;  3LSG A;  3DLA A;  4ENM A;  4BL0 B;  4CSW A;  2E7X A;  2MLG A;  1TT5 B;  1NHA A;  2CG4 A;  3VPR A;  1T39 A;  1GXP A;  4KUM A;  1H88 C;  4XLF A;  5LGN A;  4O5V A;  3SDG A;  3H35 A;  2Z1D A;  2L9S A;  4L5J A;  2R7Q A;  4A6D A;  1LVA A;  3F72 A;  4D9J A;  4ETS A;  3AG2 H;  4CZC A;  1QZZ A;  2FSW A;  4M3D A;  3DPL C;  1K83 J;  1FIP A;  5JVT A;  4LIT A;  3GUD A;  4D1Q A;  3OYB A;  1ZAR A;  2XAG A;  3NWS A;  3A2K A;  3CCQ I;  2ID3 A;  3LAP A;  2W4S A;  3CUQ A;  4RBO A;  2MD5 A;  2AXT C;  1WCM J;  5CVI A;  3L2V A;  4RGR A;  3HJE A;  3VYR B;  3GZ5 A;  4HNV A;  1VQK I;  1MBF A;  3RDI A;  1FOW A;  3LSR A;  3RYP A;  4HF1 A;  2V1N A;  3BDD A;  3G4S I;  2ECC A;  4V19 K;  1RUN A;  2VXD A;  2DCE A;  1FTT A;  4MNU A;  4MEY F;  3BTC A;  2I5U A;  3SQN A;  1I3A A;  5D5V B;  1TNS A;  5F0H A;  1VF9 A;  5LRR A;  2M5W A;  3OYL A;  1BN5 A;  1FMV A;  2ELH A;  4PJJ A;  2IA1 A;  4AYB N;  4QLC U;  4EQQ A;  2M3A A;  1I1G A;  3DU6 A;  1JUS A;  2PMZ A;  1IGN A;  5K7Z A;  3C3W A;  4CYD A;  1QZY A;  3R61 A;  2BW3 A;  2XC7 A;  5HLG A;  1H89 C;  2GXG A;  1EV7 A;  3U1K A;  4OIN F;  5CVR A;  3U1D A;  3L2Q A;  2BY0 A;  3JTH A;  2Y30 A;  3PSF A;  1WH7 A;  5BMZ A;  2EQR A;  5JHF A;  3CCJ I;  2IP2 A;  2HDD A;  1DU6 A;  1R1U A;  2RGV A;  2W84 A;  4ZH4 F;  3HPH A;  5JLX A;  1BOA A;  1RKW A;  2AQF A;  1USS A;  1J5Y A;  1DGW Y;  2AO9 A;  4Y7N J;  4HW0 A;  3BR6 A;  4GXO A;  3IKT A;  1ZH5 A;  1Z7U A;  3S1Q J;  2QEX I;  1P6R A;  2BVM A;  2Y31 A;  4BE2 A;  5LHH A;  5GPA A;  2JJ7 A;  4G7Z F;  2W7N A;  1MKM A;  4CO8 A;  4OAY A;  4J19 A;  3BJO A;  3I71 A;  4KMF A;  1P7I A;  2JVH A;  4LD5 A;  3GFI A;  2NVU B;  3LSK A;  2K4J A;  3RTR A;  3CCS I;  1LQ1 A;  3LNQ A;  3IWF A;  2IT0 A;  3L9F A;  4IHS A;  2KPM A;  3ZQF A;  2KQR A;  3ZOB A;  4CCL A;  1MSF C;  3TKY A;  2ZJR F;  5IT9 Z;  2F5F A;  3F6V A;  3KEO A;  4XKW A;  3JRA A;  3I0T A;  2R5Z A;  4UXN A;  1GLN A;  4BQQ A;  2OTJ I;  1JE8 A;  4LLL A;  3LFU A;  5DM6 F;  4NC7 A;  3H9G A;  4BH9 A;  4HDV A;  4EJO A;  3M07 A;  1X2N A;  1IV8 A;  2A05 A;  4KN4 X;  4P96 A;  5D5U B;  1AA7 A;  3CES A;  4CCM A;  1NK3 P;  3WU0 A;  1IXS B;  2XV4 S;  2KIM A;  2YSR A;  4KFC A;  2M9H A;  4WXH A;  2B63 J;  3RI4 A;  2BHZ A;  1W0U A;  1B9N A;  4BXF A;  3GTK J;  1MD0 A;  3PNY A;  3DBH B;  4YG2 F;  5CQE A;  2X6O A;  3SEZ A;  3HOZ J;  1X2M A;  4Y3O A;  2GQQ A;  1D8K A;  2IRF G;  2HFH A;  1K78 A;  2QBY B;  3EUH A;  4C2T A;  4HF2 A;  3KX2 A;  1NTC A;  3ULQ B;  4AM3 A;  1T38 A;  2E7W A;  2VB6 A;  4KIF A;  2M8E A;  2FU4 A;  4QPQ A;  3HYI A;  3WTY C;  3CCM I;  2O03 A;  4PUS A;  4NUB A;  1ETY A;  1R7J A;  4G9Y A;  2XHK A;  3S2D J;  1D1A A;  1YRN B;  1G2H A;  3ABM H;  2FMY A;  3S8P A;  3S2W A;  3T8R A;  1HC8 A;  2X9D A;  1UAA A;  3TDU C;  3CCE I;  2BY2 A;  2E19 A;  3CP2 A;  4PCQ A;  2OF7 A;  4BYY A;  4KIB A;  1R23 A;  4HV6 A;  2BV6 A;  4FIS A;  3I9V 2;  1FYM A;  1D5V A;  2X4H A;  2JRT A;  4EAT A;  4LG0 A;  2DDA A;  1BIB A;  4IZZ A;  3P7N A;  2VLA A;  2GIV A;  2H6B A;  1T6S A;  1D5Y A;  4MGR A;  3DKX A;  1P4W A;  2M4K A;  5D6F A;  1R4M B;  3WGH A;  3CF5 F;  2CUZ A;  4XRF A;  3P5J A;  4BEH B;  4PSW A;  5LRS A;  1U0J A;  1G3Y A;  2IGM A;  4JQF A;  1W1W E;  4D0P A;  4QIW N;  3IP4 B;  4M9Z A;  2KRF A;  3RKX A;  4OWR B;  4JX5 A;  3J81 K;  4HNT A;  1JGS A;  5ICF A;  2OD5 A;  1E3H A;  3FHN A;  5E20 A;  3E6D A;  2ZSH B;  1OCT C;  1IRG A;  1YX5 A;  3ABT A;  3FXJ A;  3PFY A;  3BQZ A;  1I3Q J;  1IRZ A;  4N4N B;  1IDY A;  4KIT B;  2Y75 A;  3PQJ A;  5C44 J;  3KLN A;  5DDG A;  5JLW A;  2D1V A;  2P0W A;  2VOP A;  3CUO A;  3HOY J;  2BOL A;  2XIG A;  2DFF A;  3FXO A;  4XKC A;  1VTN C;  2PN6 A;  3KP2 A;  2ZC2 A;  3SJM A;  2ZME B;  2V1X A;  2AXL A;  3H5A A;  3LWF A;  3ZMU A;  1FYL A;  3FXL A;  4OIO F;  4A3E J;  1RUO A;  2R93 J;  3WTS C;  4XLH A;  4RM3 A;  1VI0 A;  4V2F A;  5GAD J;  2E2I J;  2LTP A;  4NC6 A;  5K5Q A;  2NXN B;  2R7V A;  1G3T A;  3F22 A;  2L9V A;  3HB9 A;  3X2Q H;  4A2U A;  4KMU X;  4N9H A;  4Q47 A;  3M7G A;  5LGU A;  1AKH B;  2YU9 J;  3KE2 A;  1O4X A;  2CW7 A;  2VT3 A;  3MFK A;  5DTD A;  3DTK A;  4A3B J;  3IC7 A;  4I02 A;  4BKX A;  5GTI C;  3CDH A;  1JUM A;  4L9V A;  4WF2 A;  5H6R A;  5KK1 A;  2ZSI B;  2VBZ A;  1PP8 F;  3H3U A;  1TWG J;  2EJR A;  2VXZ A;  2OCE A;  1VQ9 I;  2FQ4 A;  5E79 C;  4WXC A;  5FLM J;  5ILS A;  2YX4 A;  3WG7 H;  3HRT A;  4LFU A;  5BNG A;  5KHD A;  4L0Z B;  1IN8 A;  2K27 A;  1R6R A;  3ABU A;  1ULY A;  1U78 A;  3Q5F A;  3HSF A;  4BXU A;  2P6T A;  4RB0 A;  2XKP A;  4DYQ A;  1FEX A;  5GAE J;  2KFD A;  3RJP A;  3JRB A;  2K5C A;  2LSO A;  3CMY A;  2VUM J;  4PDK A;  3JSO A;  1YIT I;  3S17 J;  1FTZ A;  3K4K A;  2QVO A;  4HBL A;  4UHT A;  1HSJ A;  2VON A;  1T0F A;  1Z67 A;  3KP4 A;  1KU3 A;  5TGT A;  3FXR A;  1ODD A;  1TNT A;  2HQA A;  1ZRC A;  3HRU A;  1R5I D;  3MVP A;  1MW7 A;  2A6H F;  3PNV A;  1K6O A;  1P9Q C;  2ZO4 A;  1UHM A;  3CZ6 A;  2KP6 A;  5E3M A;  3LA7 A;  1E3O C;  1HA8 A;  2EZK A;  2GIZ A;  5LBQ A;  2M45 A;  1HKS A;  2ZXI A;  4H4K C;  1BL0 A;  2GLO A;  3H5N A;  1YHQ I;  5J8F A;  5ICG A;  1R49 A;  1CQT A;  1FZP B;  1EKE A;  1U5T A;  4LLN A;  4D7N A;  1K4T A;  1ZR2 A;  3ZR8 X;  1OYY A;  1UEL B;  2HYG D;  3FBN B;  3GFJ A;  1ETV A;  1EA3 A;  1HW5 A;  4B3X A;  4IO9 F;  5J3L A;  3GME A;  4A5N A;  1LE8 A;  3LQR A;  3W3C A;  4P1W A;  1I50 J;  3OS1 A;  4CHU A;  2EWN A;  3OYC A;  1MIJ A;  1ETQ A;  2W85 A;  1SFE A;  2JPB A;  1UHS A;  3AG4 H;  1VFC A;  4IVN A;  2D45 A;  3Q9S A;  4I09 A;  3UR3 C;  3PJR A;  4LK1 F;  3Q0U A;  4ABZ A;  3LST A;  2EV0 A;  1ZLK A;  4DBR A;  3S14 J;  2DA1 A;  2E34 A;  1S7A A;  4LB6 B;  1V3F A;  1U2W A;  1SEU A;  2LP0 A;  1Z77 A;  2JK3 A;  2X6W A;  4E6K G;  4OIQ F;  3BOQ A;  3HRS A;  1G59 A;  1VQL I;  3Q0V A;  4AD9 A;  2RNJ A;  4Y52 J;  2E5Z A;  4UNO A;  4UUS B;  1STZ A;  4M6V A;  5HS7 A;  4AUX A;  4UVA A;  1N25 A;  4M9X A;  2ESN A;  3CD6 I;  3CCY A;  2RKH A;  5ERI A;  3QPH A;  4IOC F;  4BAY A;  1ONV A;  1F36 A;  3ZCO A;  4FX4 A;  1XDU A;  2BW3 B;  4XN3 A;  1RR8 C;  5FFZ A;  2XAJ A;  3N05 A;  1ZRF A;  2I10 A;  3LQQ A;  2WAD A;  1IJW C;  2CUE A;  4CGZ A;  2R3S A;  2VQL A;  3WTT C;  2ADU A;  4RS8 A;  3FBI B;  3C18 A;  1XD7 A;  2O3F A;  3RIR A;  5J8C A;  3F8C A;  3TO9 A;  3VOD A;  5B66 C;  1FOK A;  3QRF F;  1BC8 C;  4QPO A;  3L1P A;  5HNF A;  4UV8 A;  4BU2 A;  4IHV A;  1FY7 A;  2XGD A;  1SFU A;  1J7K A;  2NOJ B;  1J9I A;  4XON A;  2IA0 A;  1TWF J;  2M1B A;  2RDP A;  2P5V A;  4M3B A;  3HKZ N;  4Y17 A;  5F64 A;  3W6J B;  4RB3 C;  2HZD A;  1K7A A;  2MH2 A;  3OYI A;  1ZGA A;  3J80 Z;  3WTW C;  3GTM J;  2G0E A;  1XMK A;  5M5W J;  2B7E A;  1B4A A;  3H5R A;  2ZJQ F;  4XSX F;  3A1Y A;  1S72 I;  1QNT A;  2DPU A;  1O7L A;  2QSG X;  1TQI A;  2M8G X;  3FXU A;  2JN6 A;  3H92 A;  2EIJ H;  2JA8 J;  4E7H A;  5K7H A;  1JJ8 C;  1UJ8 A;  1ZKG A;  2TDX A;  1ZK8 A;  3FMQ A;  1LJ9 A;  4N9I A;  2ELK A;  2PX9 A;  1SD5 A;  2DFE A;  2R5Z B;  2O9L A;  1V5E A;  3OYF A;  5CJ9 A;  1YO5 C;  4MQ9 F;  2ZCW A;  2QSH X;  2VKV A;  3BJA A;  1ZG5 A;  2HQR A;  2LKX A;  2P7V B;  1IV6 A;  4A3I J;  4BHP A;  2E36 A;  3BZK A;  3ZXS A;  2Q2E A;  4RLQ A;  1T8I A;  3KET A;  2ELJ A;  2K9Q A;  1EF4 A;  2FUG 2;  2QEN A;  3CDI A;  2VIX A;  1DU0 A;  3GFM A;  4ZDP A;  2FOK A;  2ZB9 A;  2MG4 A;  1K78 B;  1MSE C;  2E1C A;  4Y15 A;  4PFO A;  3HHH A;  2C6Y A;  1OCP A;  2A5W A;  2Y2Z A;  1J09 A;  4EM1 A;  2HPM A;  3R60 A;  3CLO A;  5CQG A;  2F2E A;  1FSE A;  1D0Y A;  2QKM B;  4YIF A;  5L3E A;  4G7H F;  4KT6 A;  4EJV A;  1IF1 A;  2CUJ A;  3DV8 A;  5EG0 A;  1V5G A;  4AC0 A;  2L7K A;  2XAF A;  4ZYH A;  3PO2 J;  1A5J A;  1HCR A;  4G6Q A;  5IP6 A;  2VBX A;  1RES A;  5EEG A;  3FXQ A;  2HU9 A;  2NNY A;  3ONQ A;  5M5Y J;  1GVD A;  3FKI J;  1TW3 A;  2JA2 A;  3H1C A;  2R7T A;  1S7E A;  4U0Y A;  1DPU A;  2XF6 A;  2KDZ A;  2R7D A;  2A5Y B;  1T98 A;  5K1Y A;  1WJD A;  1JKQ C;  2BGC A;  2L54 A;  2HVS A;  3E5U A;  1KA8 A;  3O2P E;  4LG0 B;  4CCK A;  2CV0 A;  3WG9 A;  3HL2 A;  3BR1 A;  4LMY A;  5BOX A;  3OYD A;  4HG2 A;  1A6Q A;  1PDN C;  1YIJ I;  1YW9 A;  5L3G A;  1Z21 A;  2BY3 A;  4CYC B;  3I55 I;  1WWX A;  3H0D A;  3BZ6 A;  4Q4Z F;  2LDU A;  4IHW A;  1MBH A;  2JSC A;  4KNY A;  3VYS B;  2HOE A;  1Y0N A;  4CIC A;  3EUA A;  2VJJ A;  2GM4 A;  2R7O A;  3E0J B;  4CCJ A;  1ZG3 A;  3NAR A;  5FLV A;  2NVQ J;  4S05 A;  4XQF A;  3DCF A;  1ERD A;  2WAF A;  4AID A;  4WXD A;  2DJI A;  2ECB A;  4UUV A;  5L3D A;  1QQI A;  2HXO A;  2K9S A;  3B02 A;  4RMN A;  1T33 A;  3GLX A;  1U8B A;  2IBD A;  1Z05 A;  3CQZ J;  3K2A A;  5FKN A;  1HKT A;  3MKZ A;  4H0E A;  2X1C A;  1FMW A;  3BLY A;  2MFZ A;  1ZQ3 P;  2HGC A;  2Z16 A;  2EFO A;  3CC7 I;  2HOS A;  2R5Y A;  3HIF A;  5FKM A;  2DO7 A;  4PFP A;  1PYV A;  5EJC A;  1IZ1 A;  2DK8 A;  2X1D A;  3OMY A;  2O8X A;  2M2E A;  1RNL A;  1O3S A;  4RAG A;  1SAX A;  1W5S A;  3OR1 C;  2PFB A;  1RR7 A;  2XF7 A;  3NAU A;  3ZMT A;  3AAF A;  4O3M A;  3P9I A;  1YLF A;  3K4C A;  4XRS G;  2IS6 A;  2BBY A;  2E1M B;  3G1O A;  4XID A;  2UXX A;  3KFW X;  2COM A;  4ZYD A;  4IRH A;  2KZG A;  3AL0 C;  2QZ8 A;  3ZQ7 A;  1RZ4 A;  3E6M A;  4PZJ A;  2MBF A;  2TCT A;  3LFK A;  1OMI A;  4ON0 A;  3CC4 I;  2BEO A;  4F92 B;  4FE7 A;  2VC0 A;  3I53 A;  4G12 A;  5EGO A;  2F4O B;  5IP9 J;  3E6B A;  3M4O J;  5B3S H;  2K3P A;  3KYL A;  2QCO A;  2DA4 A;  2DTR A;  2HR3 A;  1UCR A;  4HOB A;  3OOU A;  2RQP A;  4RLF A;  1LNW A;  5EZG A;  3JSP A;  2EZI A;  3CCV I;  4AWX B;  3ZGK A;  1U8R A;  3BTJ A;  2HI3 A;  3K9T A;  1LB2 A;  4I6Z A;  1V55 H;  2NOG A;  5CVU A;  3HTS B;  5E8I A;  1GVJ A;  3OIQ A;  2VPR A;  4M9S A;  2FRH A;  3QOE A;  3TP3 A;  4FTH A;  2HYF A;  3DEU A;  4XLN F;  4F52 A;  2W00 A;  2HNH A;  1HDP A;  2WC2 A;  3BCA A;  1UZC A;  4HDU A;  1VND A;  3DPU A;  3RSN A;  2OZU A;  3E6C C;  1GHC A;  1R1V A;  4CCN A;  5F27 A;  3D5R C;  3K1N A;  3CCL I;  1W36 D;  1P92 A;  4HEA 2;  2EIL H;  1WJA A;  1X1P A;  3ROU A;  4RDU A;  3LA3 A;  2XB0 X;  4II3 A;  2R7Z J;  4HYE A;  4AVZ A;  2DDB A;  3E5Q A;  4FCY A;  5F6F A;  4BY7 J;  2ISZ A;  4ASN A;  4L5I A;  2LG4 A;  3ZPL A;  1Z6R A;  2V6C A;  3GBG A;  4KIG A;  2XSJ C;  1B6A A;  3ZQH A;  3I54 A;  4KIC A;  2RAE A;  4U88 A;  1U5T B;  4XM3 A;  3ZMV A;  2K02 A;  4MEX F;  2RQQ A;  5IY5 H;  2OPT A;  2VJI A;  1OCR H;  4BDZ A;  3I5U A;  3H3Z A;  4MLO A;  3HHG A;  2DT5 A;  2CV2 A;  2JUC A;  2DI3 A;  2DQR A;  1W4M A;  2IJL A;  3CCR I;  1D3Y A;  1LE8 B;  2HYJ A;  4W97 A;  4NBQ A;  4XNF A;  3TP0 A;  1MBJ A;  4UUS A;  4EMS A;  2LR8 A;  1MBG A;  5F0C A;  1WRJ A;  1EH6 A;  4I99 C;  1RRJ A;  3W2A A;  4HLY A;  3BG3 A;  1BI1 A;  2CV1 A;  3G3Z A;  2Y0M A;  2DA7 A;  2DN0 A;  2PQ8 A;  4IF4 A;  3WOD F;  4A3L J;  3AG1 H;  1FT9 A;  3KZY A;  2G7H A;  3GEZ A;  2R92 J;  1G4D A;  3IHU A;  4X1E A;  3DXJ F;  1CGP A;  1Y56 A;  4BBR J;  1ZAO A;  2XGX A;  3H3V K;  2IGN A;  2P4W A;  4CCO A;  5A2Q K;  2NVY J;  1X3U A;  3S3O A;  3F21 A;  2JTV A;  3S16 J;  4PJM A;  4ESF A;  4BS9 A;  4EVI A;  3FMS A;  2L7F P;  3NRV A;  3CTA A;  3PL8 A;  3B6A A;  4KYW A;  3GTL J;  4HNU A;  1XDS A;  3V8K A;  5FFX A;  3GWZ A;  2W1O A; 
#chains in the Genus database with same CATH homology
 2MLK A;  4EJW A;  1UHW A;  3GW2 A;  2M87 A;  2HQN A;  3DF8 A;  3TOA A;  2ZBK A;  4FX0 A;  2Z9O A;  2M30 A;  5TJJ A;  5LHI A;  2L3D A;  3BY6 A;  1IN7 A;  2D2W A;  3FMR A;  2VE8 A;  2A68 F;  4U7D A;  4ENJ A;  3F23 A;  1KYZ A;  1LDJ A;  2P5L C;  1MGT A;  5D6E A;  1QPM A;  4L18 B;  2V1D A;  1BIA A;  4EV0 A;  4WWC A;  5HLI A;  3U2R A;  1YS6 A;  1R00 A;  1G6N A;  5CYV A;  2YX7 A;  4LLG F;  1SD4 A;  5TRD A;  1WI9 A;  2W24 A;  1B9M A;  3WE2 A;  1IW7 F;  3RKW A;  3P9K A;  1TQM A;  3FHZ A;  1QGP A;  3WTX C;  5A2Q Z;  3LA2 A;  1IUY A;  1U3E M;  1D8J A;  2ETH A;  1SFX A;  3WE3 A;  3SFZ A;  5IT3 A;  3E3V A;  4YFX F;  4RAY A;  4ZYE A;  2EA2 A;  3MCZ A;  5FO5 A;  3VOE A;  5E1Z B;  3PFI A;  1O3R A;  3QU3 A;  3BPX A;  1Z91 A;  4EM0 B;  2V1U A;  5JHU A;  2A07 F;  2ACJ A;  1MDM A;  1TW2 A;  3EDP A;  2HKX A;  3I64 A;  2NS0 A;  4GYI A;  2P5K A;  1ZRD A;  3P9C A;  1FYK A;  2H09 A;  1QO0 D;  3ZP5 A;  3BP8 A;  4EGZ A;  1O3Q A;  2UWM A;  5HOO A;  2F5E A;  3MEX A;  3I58 A;  5LEK A;  4HX7 A;  1WKM A;  1HBX G;  3GYH X;  1L0O C;  4A12 A;  3QP5 A;  1BJA A;  2GWR A;  2CYY A;  1O7F A;  2QWW A;  1TTY A;  1HXD A;  3WTU C;  4M6Y A;  3ML6 A;  2B0L A;  3ZN0 A;  3R4K A;  4P9U A;  3GF2 A;  4A6E A;  3SZP A;  2DAO A;  1IXR C;  5AON A;  5JI6 A;  2J5O A;  1JHF A;  1XCB A;  3J81 Z;  2F5C A;  1OYW A;  2O61 A;  1FC3 A;  5HDN A;  2HEO A;  5ED4 A;  5FD6 A;  1G3S A;  4A0Z A;  1B59 A;  2KKO A;  2Q0O A;  2OAZ A;  2FNA A;  2QYO A;  1YQA A;  5L3B A;  3KP7 A;  2G9W A;  3CO6 C;  4I2O A;  4HZF A;  4M73 A;  2XAS A;  2LF7 A;  4HV5 A;  1S3J A;  3SXY A;  4HQM A;  2OA4 A;  3L2C A;  2O0Y A;  1CF7 B;  2OQR A;  3BRO A;  5LLQ A;  3JW4 A;  4CZZ A;  5DEQ A;  5D5X B;  3EYY A;  1FPQ A;  2A69 F;  1ON2 A;  4TV7 A;  3GO5 A;  2K86 A;  3F8B A;  2D1H A;  3M8E A;  3HUG A;  1FP2 A;  1XGO A;  1G3W A;  4RAZ A;  5L3F A;  2Z5U A;  3HOS A;  4S04 A;  3GVA A;  1XGS A;  2EB7 A;  5ILU A;  4U0W A;  4NB5 A;  3CUQ C;  2CO5 A;  3FWE A;  4AIK A;  3KP3 A;  1J59 A;  5E17 F;  3V7R A;  4RGX A;  4FT8 A;  3MZH A;  2EA4 A;  4ESJ A;  2FBI A;  2ZFW A;  2EFN A;  3BPV A;  2Q8K A;  5CVJ A;  4RB1 A;  4IRG A;  4P5O A;  2WV0 A;  5EEH A;  4HQE A;  3E5X A;  3DKW A;  4YFK F;  2OU2 A;  1TLH B;  1L3L A;  2XUB A;  5LHG A;  1R5H A;  1JXS A;  2NNN A;  5FGM A;  3ERE D;  3R6S A;  4IRI A;  1RI7 A;  2KJC A;  3VB2 A;  1IN6 A;  4EJT A;  1BI2 A;  2L02 A;  1FLI A;  3TDZ C;  3N4M A;  1ZRE A;  2BE5 F;  4KDP A;  3V8J A;  1EH8 A;  5L3C A;  1EH7 A;  3F8F A;  2JZY A;  2A61 A;  3FZV A;  2XAH A;  4M6X A;  4OIP F;  2FML A;  2DBB A;  2ZNY A;  5FLX K;  5D8K B;  2PEX A;  1FBS A;  2RV8 A;  3G73 A;  3ISP A;  1XCV A;  4NHJ A;  1P4X A;  4N0B A;  1S7O A;  3NQO A;  2HKO A;  5E1X A;  1XGN A;  3LAJ A;  1C0W A;  1S6L A;  4LGW A;  2L4A A;  1QBJ A;  4G94 A;  3ZMZ A;  1BI0 A;  4Y13 A;  3K1M A;  4OU0 A;  4BHB A;  2V9V A;  2Z3Y A;  2HZT A;  4LK0 F;  4ENK A;  2A6E F;  1TQP A;  1SMT A;  2XVC A;  5LGT A;  2LKP A;  2BYV E;  1MDM B;  5D8L B;  5D4R A;  3ZMS A;  4Q48 A;  2XKO A;  3DP7 A;  1KQ9 A;  3R0J A;  1HKQ A;  5BPI A;  4AIH A;  1SMY F;  1Q1H A;  4AVP A;  3F6O A;  2HDC A;  1Z1D A;  4ZZL A;  3ZMD A;  4F7Z A;  2EV5 A;  2PJP A;  3EQL F;  1IXC A;  5H20 A;  4WX9 A;  4JBA A;  5HDG A;  1XN7 A;  2KJB A;  1U6G A;  2PI0 A;  2YR2 A;  1O57 A;  4I0A A;  4I0B A;  1B1B A;  3T1B A;  1A04 A;  2CQK A;  1MJB A;  1TBX A;  3IL2 A;  3M1E A;  2FA5 A;  4P55 A;  1GXQ A;  3REO A;  4XSZ F;  1ZHF A;  3F8N A;  2Z99 A;  4G8X A;  3V7S A;  3JAM K;  1DP7 P;  4IHT A;  2GZW A;  4G7O F;  1CF7 A;  1UFM A;  2WWY A;  3SZT A;  5IT9 K;  4IPA A;  3K0L A;  2GA2 A;  2FBK A;  1MJ9 A;  3HTU A;  4GCV A;  4ZZD A;  4KA4 A;  3GX4 X;  3MWM A;  1E2X A;  2P7C B;  4KT5 C;  1KQ0 A;  1R58 A;  3C7J A;  3KZZ A;  2Z33 A;  4B8X A;  2MA3 A;  2GA1 A;  1FSH A;  5FB2 A;  4YII A;  2DQL A;  3JTG A;  1S29 A;  2VT2 A;  2IPQ X;  5BS6 A;  3MZY A;  5BQT A;  4EJU A;  3D5L A;  5HLH A;  1FX7 A;  2JT1 A;  1H9G A;  4GO1 A;  3ECO A;  1U5T C;  3IRQ A;  1OYI A;  1FP1 D;  2EV6 A;  4KN7 X;  1ZG1 A;  4XLP F;  2XRN A;  1KU9 A;  1YIO A;  4BNC A;  1R22 A;  3WTZ A;  5H6Q A;  2QQA A;  3ECH A;  5E1W A;  4L9T A;  1ZN2 A;  3V8L A;  5HS8 A;  2CGP A;  3MAJ A;  1XB4 A;  1JHH A;  5FD5 A;  4L9J A;  5E8G A;  4NQW A;  1E17 A;  1XSD A;  1UST A;  1LDK B;  2QUF A;  5DUK A;  3L7W A;  1KYW A;  3JAM Z;  3F8M A;  4L0Y B;  3KP5 A;  2W25 A;  3VFZ A;  5LEJ A;  4O6J A;  2HS5 A;  4CDG A;  4LB5 A;  4ENN A;  2DPD A;  2QQB A;  2YPR A;  4MTD A;  3TOB A;  5DUI A;  2LF8 A;  3T0Y A;  4OMZ A;  4U7B A;  3WGI A;  1R1T A;  1WQ2 A;  3IWZ A;  1SD6 A;  1XGM A;  5DYM A;  4R79 A;  4PGG A;  2ESH A;  3EET A;  2IA2 A;  2R7F A;  3WGG A;  5J6X A;  4YFN F;  2W57 A;  2K4B A;  1XMA A;  4I01 A;  1YS7 A;  3KP6 A;  5ICE A;  5ILV A;  2VE9 A;  1PUE E;  3I59 A;  4AIJ A;  3HSE A;  2UXN A;  1WSU A;  3WU1 B;  1BI3 A;  2G7U A;  4GGG A;  3QP6 A;  4I98 B;  3QU6 A;  2AS5 F;  3IKV A;  1PP7 U;  1ZGJ A;  5HDK A;  2L4M A;  2DK5 A;  3RKY A;  1W7P A;  3ELK A;  3FX3 A;  2V79 A;  3RPU A;  2HWV A;  2F5D A;  4M74 A;  4EM2 A;  3HOT A;  4PGH A;  4GYG A;  4BQA A;  1IN5 A;  3K1P A;  4G6D A;  2ZKZ A;  2H94 A;  4RB2 C;  2VC1 A;  4WK8 F;  3DPT A;  4R8H A;  1KGS A;  3U9G A;  1DDN A;  3TO6 A;  1FBQ A;  1LEA A;  2L01 A;  3O6B B;  1REP C;  2EFP A;  3M8F A;  5AIQ A;  2VOO A;  5KVR A;  4A0Y A;  5JFR A;  4ZYG A;  3IRR A;  3E97 A;  2FQ3 A;  3OV8 A;  1H0M A;  4RGS A;  4BHC A;  1MZB A;  4OMY A;  2FNP A;  2J5P A;  5CVV A;  5D5W B;  1ZYR F;  3QAH A;  2ZJ2 A;  5K5O A;  4HLX A;  5K5R A;  3HRM A;  3KLO A;  1Y0U A;  3WTV C;  1O3T A;  5DD4 A;  2EFW A;  5DCM B;  1I27 A;  1ON1 A;  4IXA A;  3CJN A;  5HS9 A;  2X0L A;  5DCF A;  1T2K A;  2QLZ A;  3COA C;  1KQ8 A;  3J80 K;  3ZN1 A;  5HVQ C;  4A5M A;  3V7C A;  1W5T A;  2GXB A;  3DFG A;  4M72 A;  4HAM A;  1DUX C;  2NRA C;  3MQ0 A;  4LJZ F;  3QOP A;  2WTE A;  2OBP A;  1ZLJ A;  4HA8 A;  1HW1 A;  1F1Z A;  4OOI A;  3CUQ B;  2VOD A;  2VBY A;  2JPC A;  4K2E A;  2YU3 A;  2ISY A;  2GAU A;  1AOY A;  4HX4 A;  2H27 A;  1BC7 C;  2FBH A;  1HW2 A;  2RC4 A;  1SD7 A;  4P9F A;  5D4S A;  2FE3 A;  1LDD A;  3GFL A;  2P8T A;  1F5T A;  1K79 A;  2CSO A;  3RYR A;  3QPT A;  2CWE A;  3BJ6 A;  3FF5 A;  2MH9 A;  1J2X A;  1I1S A;  3HSR A;  3N97 A;  4CXF A;  2A3S A;  6PAX A;  2O6G E;  2NYX A;  1MJA A;  1R36 A;  2PG4 A;  2DU9 A;  4E70 A;  3Q9V A;  1BBY A;  4B09 A;  5BPD A;  3R0A A;  3TGN A;  1P2F A;  2NAZ A;  4QWQ A;  5DD8 A;  1AWC A;  1KU7 A;  1IRF A;  4UV9 A;  3BWG A;  1YFH A;  3FM3 A;  4RGU A;  4EGY A;  3OOP A;  2FF4 A;  3DQV C;  2P6S A;  5CLS A;  2EFQ A;  4DNC A;  2DLL A;  2QBY A;  4MHG A;  1R5G A;  3VEP A;  5AIP A;  2IW5 A;  2PLY A;  1YW8 A;  2KIF A;  2E1N A;  3B73 A;  4HX8 A;  3V4G A;  3T8T A;  1IN4 A;  2K7L A;  4MQV A;  3I4P A;  2XAQ A;  2ZXJ A;  1KU2 A;  3C1D A;  4A0X A;  1RIO H;  1V4R A;  2IVM A;  2HTS A;  3L00 A;  3NEU A;  4L9N A;  2QQ9 A;  1DPR A;  4ESB A;  3W6K B;  2DW4 A;  2PMU A;  4JK1 X;  1I6X A;  4UVB A;  3I59 B;  3TO7 A;  4M71 A;  3CO7 C;  3K2Z A;  4Q5S F;  2DFI A;  1F4K A;  2QM3 A;  3KCC A;  1LEB A;  2RN7 A;  3D0S A;  2PMH A;  1YW7 A;  2ZNZ A;  3FM5 A;  1XSX A;  1HST A;  3EYI A;  1I5Z A;  3M9A A;  1IAW A;  1W7P B;  1HQC A;  2VN2 A;  1J75 A;  2KIU A;  2XRO A;  1YYV A;  1FNN A;  2CFX A;  2LNB A;  3TQN A;  1J0R A;  1OKR A;  1YG2 A;  2ZME A;  3KEQ A;  1UB9 A;  3O3K A;  2FXA A;  2FEZ A;  2OQG A;  4UVC A;  4I7H A;  2UZK A;  3T5X A;  1FBU A;  2Y48 A;  1FWZ A;  4R1H A;  4FHT A;  3PQK A;  1F9N A;  2PBI A;  4DQ2 A;  1XSV A;  1YTY A;  1P4A A;  5ICC A;  4IJA A;  3K69 A;  4U0V A;  2STW A;  2EK5 A;  5F1R A;  3SHF A;  4MTE A;  1Z9C A;  3F3X A;  2H6C A;  2MC3 A;  1Z6T A;  1H9T A;  5FLX Z;  3GZ6 A;  5JR3 A;  1OPC A;  1S8N A;  3GXO A;  1W7P D;  3L09 A;  5DCM A;  4XBF A;  2RVC A;  1BM9 A;  3RPQ A;  5DV5 A;  4WCG A;  4OIR F;  2OZ6 A;  2HTJ A;  2STT A;  2VBW A;  4Z2Y A;  2CW0 F;  4HF0 A;  5E18 F;  3J7A O;  1OR7 A;  4ENM A;  2E7X A;  2MLG A;  2CG4 A;  1NHA A;  1GXP A;  1T39 A;  4KUM A;  5LGN A;  4O5V A;  4L5J A;  4A6D A;  1LVA A;  3F72 A;  4ETS A;  1QZZ A;  2FSW A;  3DPL C;  5JVT A;  3GUD A;  1ZAR A;  2XAG A;  3LAP A;  3CUQ A;  2MD5 A;  5CVI A;  4RGR A;  3GZ5 A;  3RDI A;  3RYP A;  4HF1 A;  3BDD A;  1RUN A;  4MNU A;  4MEY F;  3SQN A;  5D5V B;  1TNS A;  5LRR A;  2M5W A;  1BN5 A;  2ELH A;  4QLC U;  2IA1 A;  4EQQ A;  1I1G A;  3C3W A;  4CYD A;  1QZY A;  3R61 A;  5HLG A;  2GXG A;  1EV7 A;  4OIN F;  5CVR A;  3U1D A;  3JTH A;  5BMZ A;  2IP2 A;  1R1U A;  2RGV A;  2W84 A;  4ZH4 F;  1BOA A;  1USS A;  1J5Y A;  4HW0 A;  4GXO A;  3IKT A;  1ZH5 A;  1Z7U A;  1P6R A;  5LHH A;  4G7Z F;  1MKM A;  4CO8 A;  3BJO A;  3I71 A;  4KMF A;  4LD5 A;  3GFI A;  3RTR A;  2K4J A;  1LQ1 A;  3IWF A;  2IT0 A;  3L9F A;  4IHS A;  3TKY A;  5IT9 Z;  2F5F A;  3F6V A;  3KEO A;  3I0T A;  4UXN A;  1JE8 A;  4LLL A;  4BH9 A;  4HDV A;  4EJO A;  4KN4 X;  4P96 A;  5D5U B;  3WU0 A;  1IXS B;  2XV4 S;  2KIM A;  2YSR A;  4KFC A;  4WXH A;  3RI4 A;  1B9N A;  1MD0 A;  4YG2 F;  2GQQ A;  1D8K A;  2IRF G;  2HFH A;  1K78 A;  2QBY B;  3EUH A;  4HF2 A;  3ULQ B;  1T38 A;  2E7W A;  4KIF A;  2M8E A;  2FU4 A;  3HYI A;  3WTY C;  2O03 A;  1R7J A;  4G9Y A;  2XHK A;  2FMY A;  3S2W A;  3T8R A;  3TDU C;  4PCQ A;  4BYY A;  4KIB A;  1R23 A;  4HV6 A;  2BV6 A;  1FYM A;  1D5V A;  2X4H A;  2JRT A;  4LG0 A;  1BIB A;  3P7N A;  2GIV A;  2H6B A;  1T6S A;  4MGR A;  1P4W A;  5D6F A;  3WGH A;  4XRF A;  5LRS A;  1G3Y A;  4JQF A;  4D0P A;  4M9Z A;  2KRF A;  3RKX A;  3J81 K;  1JGS A;  5ICF A;  2OD5 A;  5E20 A;  3E6D A;  1IRG A;  3ABT A;  2Y75 A;  3PQJ A;  3KLN A;  5DDG A;  2D1V A;  2VOP A;  3CUO A;  2XIG A;  1VTN C;  2PN6 A;  3KP2 A;  2ZME B;  2V1X A;  2AXL A;  3ZMU A;  3LWF A;  1FYL A;  4OIO F;  1RUO A;  3WTS C;  5K5Q A;  1G3T A;  3F22 A;  4A2U A;  4KMU X;  4N9H A;  4Q47 A;  3M7G A;  5LGU A;  3KE2 A;  2VT3 A;  3MFK A;  3IC7 A;  4I02 A;  3CDH A;  4L9V A;  4WF2 A;  5H6R A;  5KK1 A;  2VBZ A;  1PP8 F;  3H3U A;  2EJR A;  2VXZ A;  4WXC A;  5ILS A;  2YX4 A;  3HRT A;  4LFU A;  4L0Z B;  1IN8 A;  2K27 A;  3ABU A;  1ULY A;  1U78 A;  3Q5F A;  3HSF A;  4BXU A;  2P6T A;  4RB0 A;  2XKP A;  3RJP A;  2LSO A;  4PDK A;  3JSO A;  2QVO A;  4HBL A;  4UHT A;  1HSJ A;  2VON A;  1T0F A;  3KP4 A;  1KU3 A;  3FXR A;  1ODD A;  1TNT A;  1ZRC A;  3HRU A;  2A6H F;  1K6O A;  2ZO4 A;  1UHM A;  3LA7 A;  5LBQ A;  2M45 A;  1HKS A;  5J8F A;  5ICG A;  1FZP B;  1U5T A;  4LLN A;  1OYY A;  2HYG D;  3GFJ A;  1HW5 A;  4A5N A;  4CHU A;  3LQR A;  2EWN A;  2W85 A;  1SFE A;  2JPB A;  4IVN A;  2D45 A;  3Q9S A;  4I09 A;  4LK1 F;  3LST A;  2EV0 A;  1ZLK A;  1S7A A;  4LB6 B;  1V3F A;  1U2W A;  4OIQ F;  3BOQ A;  3HRS A;  4AD9 A;  2RNJ A;  4UNO A;  1STZ A;  5HS7 A;  4UVA A;  4M9X A;  2ESN A;  2RKH A;  5ERI A;  3QPH A;  4BAY A;  1ONV A;  4FX4 A;  1XDU A;  5FFZ A;  2XAJ A;  1ZRF A;  3LQQ A;  4CGZ A;  2R3S A;  3WTT C;  2ADU A;  4RS8 A;  3C18 A;  1XD7 A;  2O3F A;  3RIR A;  5J8C A;  3F8C A;  3TO9 A;  3VOD A;  1FOK A;  3QRF F;  1BC8 C;  4UV8 A;  1FY7 A;  1SFU A;  1J7K A;  1J9I A;  2IA0 A;  2M1B A;  2RDP A;  2P5V A;  4Y17 A;  5F64 A;  3W6J B;  4RB3 C;  1K7A A;  2MH2 A;  1ZGA A;  3J80 Z;  3WTW C;  1XMK A;  1B4A A;  4XSX F;  1QNT A;  2DPU A;  1O7L A;  1TQI A;  3FXU A;  3H92 A;  2TDX A;  3FMQ A;  1LJ9 A;  4N9I A;  1SD5 A;  5CJ9 A;  1YO5 C;  4MQ9 F;  2ZCW A;  1ZG5 A;  3BJA A;  2HQR A;  2P7V B;  4BHP A;  2Q2E A;  3KET A;  2QEN A;  3GFM A;  2FOK A;  1K78 B;  2E1C A;  4Y15 A;  3HHH A;  2C6Y A;  4EM1 A;  3R60 A;  3CLO A;  2F2E A;  1FSE A;  4YIF A;  5L3E A;  4G7H F;  4EJV A;  1IF1 A;  3DV8 A;  2XAF A;  4ZYH A;  4G6Q A;  2VBX A;  5EEG A;  3FXQ A;  2NNY A;  1TW3 A;  4U0Y A;  1DPU A;  2R7D A;  5K1Y A;  2A5Y B;  1T98 A;  2BGC A;  2L54 A;  3E5U A;  1KA8 A;  3O2P E;  4LG0 B;  3WG9 A;  4LMY A;  5BOX A;  1PDN C;  1YW9 A;  5L3G A;  1WWX A;  3BZ6 A;  4Q4Z F;  2LDU A;  2JSC A;  4KNY A;  2HOE A;  4CIC A;  1ZG3 A;  4S05 A;  4WXD A;  4UUV A;  5L3D A;  1QQI A;  3B02 A;  3GLX A;  1Z05 A;  1HKT A;  4H0E A;  2HGC A;  2EFO A;  3HIF A;  2DO7 A;  1IZ1 A;  2DK8 A;  2O8X A;  1RNL A;  1O3S A;  1SAX A;  1W5S A;  2PFB A;  4O3M A;  3ZMT A;  3AAF A;  3P9I A;  1YLF A;  2BBY A;  2UXX A;  3KFW X;  2COM A;  4ZYD A;  4IRH A;  2QZ8 A;  3ZQ7 A;  1RZ4 A;  3E6M A;  4PZJ A;  2MBF A;  3LFK A;  1OMI A;  4ON0 A;  2BEO A;  2VC0 A;  3I53 A;  3E6B A;  2DTR A;  2HR3 A;  1UCR A;  4HOB A;  2RQP A;  1LNW A;  3JSP A;  4AWX B;  1U8R A;  3K9T A;  1LB2 A;  5CVU A;  3HTS B;  5E8I A;  1GVJ A;  4M9S A;  2FRH A;  2HYF A;  3DEU A;  4XLN F;  2WC2 A;  4HDU A;  3E6C C;  2OZU A;  1GHC A;  1R1V A;  3K1N A;  1P92 A;  3ROU A;  3LA3 A;  4HYE A;  3E5Q A;  5F6F A;  2ISZ A;  4ASN A;  4L5I A;  3ZPL A;  1Z6R A;  2V6C A;  4KIG A;  1B6A A;  3I54 A;  4KIC A;  4U88 A;  1U5T B;  3ZMV A;  2K02 A;  4MEX F;  3I5U A;  3H3Z A;  3HHG A;  2DT5 A;  2DI3 A;  2DQR A;  1W4M A;  2IJL A;  1D3Y A;  4EMS A;  1WRJ A;  1EH6 A;  4HLY A;  1BI1 A;  3G3Z A;  2Y0M A;  2PQ8 A;  4IF4 A;  3WOD F;  1FT9 A;  3KZY A;  2G7H A;  3GEZ A;  1G4D A;  3IHU A;  3DXJ F;  1CGP A;  1ZAO A;  2XGX A;  2P4W A;  5A2Q K;  1X3U A;  3F21 A;  2JTV A;  4ESF A;  4EVI A;  3FMS A;  3NRV A;  3CTA A;  4KYW A;  1XDS A;  3V8K A;  5FFX A;  3GWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...