4HLXA

The crystal structure of the dna binding domain of virf-1 from the oncogenic kshv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
99
Chain Sequence
ASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords K9
publication title The crystal structure of the DNA-binding domain of vIRF-1 from the oncogenic KSHV reveals a conserved fold for DNA binding and reinforces its role as a transcription factor.
pubmed doi rcsb
source organism Human herpesvirus 8
total genus 23
structure length 99
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00605 IRF Interferon regulatory factor transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hlxA00
3LA3A 3G3ZA 3WE3A 1J5YA 4WF2A 5BOXA 1H0MA 1XB4A 4G6DA 1FP1D 4P96A 2HYGD 3QOPA 4WK8F 1J75A 2HDCA 1V4RA 3GUDA 5D5UB 2KIMA 3KEQA 1ON2A 4HBLA 1U6GA 1FZPB 1I1SA 2HGCA 1SMTA 4I09A 4F7ZA 3G73A 3D5LA 4HLXA 1KYZA 1DP7P 3ML6A 4K2EA 4EM2A 3SFZA 3WU0A 2A3SA 5E17F 3QPHA 3T8TA 1B9NA 3PQJA 3J80K 1LDJA 3WG9A 4A5MA 3DV8A 4IRHA 2KRFA 5KVRA 4S04A 4RS8A 1CF7B 1A04A 3JAMZ 5DD4A 1ZHFA 5HLHA 5DCMB 2ISYA 2RKHA 4OMYA 4WWCA 1BBYA 4NB5A 2O6GE 5L3FA 4AIKA 4KUMA 1BOAA 4WXDA 1ULYA 3JTHA 2VBZA 1XMAA 5HS9A 4LLGF 4CYDA 1TTYA 4EM1A 4EQQA 4YIFA 1O3QA 3J7AO 3BPXA 3ZQ7A 4I02A 5ILUA 4BNCA 3LQQA 3T8RA 3RPUA 2ZFWA 2DI3A 1QBJA 1F9NA 3W6KB 4AVPA 2XAJA 2V1UA 1XDSA 5CVJA 1OYIA 4HDUA 1YW7A 5JHUA 3TKYA 3WTVC 5DUIA 3ULQB 1O57A 4ETSA 1TNTA 3Q9VA 3LAJA 2ACJA 2DFIA 1QGPA 3HRTA 5D4RA 2HYFA 2DO7A 1S3JA 3SZPA 3WGHA 5LHIA 4ZZLA 2P5LC 3BPVA 3DEUA 1FYKA 4Y13A 1BI2A 2LF8A 2HTSA 5TRDA 4M9XA 5L3EA 4EJUA 2HEOA 3QRFF 3R6SA 4I7HA 3E5QA 4G6QA 4U88A 2Z99A 3TDZC 3GZ5A 5LEJA 3BWGA 4BHCA 3QAHA 4O5VA 2PMUA 4R8HA 1QZYA 5L3GA 3BJOA 1W7PB 3LA7A 4BXUA 4CDGA 1T6SA 3FXRA 3MEXA 3J81K 3L9FA 3L00A 2ZJ2A 2JPCA 1EH7A 4ZH4F 3IRQA 5E8IA 1ON1A 1BIBA 3MFKA 2C6YA 3KCCA 4BHBA 2BBYA 2FSWA 3GO5A 3FZVA 5BPDA 4HLYA 4R1HA 1JXSA 1YIOA 2NYXA 4UV9A 1YG2A 3KP3A 1R5GA 4A2UA 2DW4A 1XSDA 2M8EA 1R58A 1T0FA 2XAFA 1GXQA 2O8XA 4JBAA 2ZCWA 4MEXF 4HOBA 1HW1A 4EM0B 4LD5A 1WRJA 3B73A 2M5WA 3ZN1A 1D8JA 3KZZA 5LGTA 4CGZA 1ZRCA 2GIVA 1MGTA 3WODF 1LEBA 1RZ4A 2KJBA 4Q47A 2A61A 3RDIA 2WWYA 1B4AA 3HSRA 1AOYA 1IXSB 1RI7A 2P8TA 2FEZA 1D8KA 3CJNA 2CW0F 5CVIA 3VOEA 1JHFA 4XSXF 1W7PD 4HAMA 3Q9SA 2DAOA 2DPUA 1ONVA 1FP2A 3FHZA 1S7AA 1XDUA 3U9GA 2VC0A 3RYPA 3DQVC 2NNYA 2KIFA 3S2WA 4L5IA 2L4AA 1FBQA 4LB5A 2HZTA 1TW3A 5CVUA 1U3EM 1YS7A 1Z1DA 1SMYF 2Z33A 4RGUA 3TO6A 3LA2A 4U7BA 1J2XA 2RQPA 4WXCA 1S7OA 2XRNA 3IHUA 4Y17A 3F8CA 3F6OA 2QQAA 5ILSA 2LNBA 5DDGA 5CLSA 1MJAA 4XLPF 2BYVE 2VT2A 5KK1A 5AIQA 2W85A 1B1BA 1HBXG 1ZG1A 4M74A 3BJAA 1XGOA 3HTSB 2HOEA 4WX9A 4EJWA 1SD4A 2OQGA 3L7WA 3HTUA 5HVQC 2KIUA 2K4JA 2FBHA 2GQQA 4I01A 5K5QA 2OU2A 1P6RA 1XSXA 1U5TC 1SFXA 1D5VA 3QU6A 4RB0A 2VBXA 2PG4A 3HOSA 2HQNA 4OU0A 4P9FA 5E1ZB 3ZMZA 1ZLJA 2PJPA 3F72A 4G94A 4G8XA 1FSEA 4CICA 5FGMA 2OQRA 3RI4A 1NHAA 2COMA 4ZZDA 1Y0UA 5K5RA 1G3TA 1FNNA 3EUHA 4YFXF 5DEQA 3V7CA 2RC4A 1XCBA 3O2PE 2TDXA 4NQWA 1T2KA 2MC3A 3M8FA 2FBIA 1ZG3A 3OOPA 4MEYF 5DCMA 1BM9A 3J81Z 4AWXB 1P2FA 5FO5A 4UVAA 4ENJA 5ILVA 2M1BA 5TJJA 4L5JA 2HKOA 3IWFA 1LDKB 5H6QA 3LWFA 2BGCA 1SD6A 4HZFA 3I4PA 1LB2A 1R7JA 2IA0A 4LLLA 1W4MA 2J5OA 1Z6RA 5D4SA 1TQMA 2ZNYA 4L9NA 1IN6A 4EJTA 4I0BA 2Z3YA 5L3CA 1PDNC 4Y15A 1R36A 2HS5A 3KP6A 2MH2A 4LB6B 1FBSA 2HR3A 2XVCA 1R23A 2FNPA 3GWZA 2F5DA 2XHKA 5BS6A 3E6DA 2M45A 2IW5A 1ZN2A 2QENA 5LRRA 3MZYA 1FLIA 3WGIA 3K1MA 1WI9A 1ZRDA 4WXHA 4ESJA 2FBKA 1YFHA 1XN7A 4A0YA 4Q48A 1V3FA 3E6CC 3VFZA 1U78A 2XAQA 1UFMA 1LEAA 4A5NA 2YSRA 1K7AA 1EH6A 2QQBA 5E18F 4IRGA 5FD6A 1Z6TA 2L3DA 1YYVA 2EFQA 2GZWA 3L09A 1GXPA 5CVRA 1YW8A 1WWXA 2DU9A 5A2QK 1R5HA 3HYIA 2X4HA 4MQ9F 2LDUA 3U1DA 1C0WA 4YFKF 1SD7A 4DNCA 3H3UA 3I58A 1D3YA 3C18A 1USTA 4B8XA 1J9IA 3H3ZA 3P9CA 1BI0A 3MZHA 4PCQA 5H20A 5JI6A 4I2OA 3CUOA 1XCVA 3GF2A 3C7JA 2K7LA 3BJ6A 1G4DA 1KGSA 3GXOA 3WTUC 2WTEA 2LKPA 3R4KA 3HOTA 1HW5A 4BHPA 2W57A 4EVIA 3SHFA 3GEZA 3P7NA 2W25A 4KN7X 5LEKA 2YR2A 3MAJA 4GO1A 3EQLF 3E6BA 2AXLA 3DF8A 3MWMA 1G3YA 2M30A 1F5TA 4L0YB 5JVTA 4ZYDA 2QVOA 4EMSA 5IT9K 2XGXA 1X3UA 3ECHA 4ENMA 2GAUA 1F1ZA 3TDUC 2EB7A 5FFXA 4HW0A 5IT3A 1Z91A 2HWVA 5LBQA 3IKVA 1OYYA 1W5TA 3K9TA 3I54A 2JPBA 2NRAC 2K4BA 1IW7F 2FNAA 2VT3A 2CG4A 3RJPA 1YTYA 3R61A 5ERIA 3I59A 5HDKA 2Q8KA 5FB2A 5ICEA 3NEUA 2IVMA 4ESBA 3SQNA 2XKPA 4D0PA 2WC2A 3TO9A 3I0TA 2M87A 2QZ8A 2GXGA 1IZ1A 4A0ZA 4KIFA 4HQMA 1FY7A 3ERED 1MJ9A 4HF2A 1U5TB 4LMYA 1WQ2A 2QLZA 1PP7U 2JTVA 3E3VA 4IHSA 3NRVA 3W6JB 5H6RA 2DK8A 5J6XA 1O3TA 3HUGA 4ENNA 2EK5A 4AIHA 2P4WA 2OZUA 1KU7A 4KDPA 5BMZA 4U0YA 2LF7A 2DTRA 1K79A 1R1UA 2CO5A 1B6AA 3ECOA 2FE3A 5LLQA 3SZTA 2VE8A 1RUNA 1R00A 3FX3A 4CO8A 3HRMA 2MLGA 4QWQA 3KETA 1BJAA 2H6BA 3V4GA 3NQOA 2ESNA 2RN7A 5LHGA 5A2QZ 4ZYHA 3KLOA 3E5XA 2F5EA 1HQCA 5E1WA 2DLLA 2P6TA 1RUOA 1DPUA 5HDNA 1UB9A 2D1VA 4DQ2A 2ELHA 4U0VA 2V1DA 3OV8A 2STWA 4HX8A 1YLFA 3GFMA 1Z7UA 2P5KA 5HS8A 3RKXA 3P9KA 4GGGA 4OOIA 3B02A 2KKOA 3L2CA 1UHMA 2PBIA 3GFLA 3AAFA 5HOOA 2Y0MA 3I71A 4KN4X 1SFEA 3DFGA 3ZN0A 5E20A 1U2WA 2UXNA 1ZRFA 3D0SA 2EV0A 3HRSA 3ZMVA 2HKXA 4RAZA 4RGRA 5IT9Z 1QO0D 5BPIA 2JRTA 4A6DA 4M9SA 1FC3A 3R60A 1K6OA 3CUQC 1TQIA 3REOA 1GHCA 3BOQA 2P5VA 2ZNZA 2W24A 2OZ6A 5DCFA 3KP5A 4HYEA 4AIJA 3KP7A 1T38A 1LDDA 2XIGA 3I59B 4ZYEA 2P7CB 2FF4A 3WE2A 3GX4X 2R3SA 4TV7A 4HF1A 5D5WB 1SD5A 1ZGAA 1KA8A 2L4MA 3HRUA 4B09A 1R22A 3Q5FA 2YPRA 2RNJA 3EYIA 4BQAA 1GVJA 4IHTA 2L02A 4LFUA 3DPLC 4BAYA 5JFRA 3WTZA 4UVCA 3QP5A 3FMSA 4ENKA 2STTA 3KFWX 1FBUA 3FMQA 5L3DA 4R79A 2FRHA 4N9HA 1ZYRF 2ZMEB 4YG2F 3O3KA 2EFOA 4EJVA 2V1XA 3T0YA 4M71A 2BEOA 2ADUA 3LSTA 1TQPA 4L9JA 1S8NA 3FXQA 2MA3A 2VBYA 4OIQF 2BE5F 3E6MA 4OINF 4EV0A 3N97A 4FHTA 1O3SA 1T39A 1FWZA 3TGNA 1KQ9A 4L9TA 4LJZF 2VE9A 1IRGA 2E7WA 2O03A 4MHGA 1BI1A 4LG0B 4LLNA 1WKMA 3HIFA 2OAZA 1G3SA 2ISZA 2OD5A 2CQKA 2E1NA 1SAXA 1IUYA 3RKWA 4EJOA 5FLXZ 4HX4A 5K1YA 2CGPA 1DDNA 2RDPA 5DYMA 5AONA 1ZREA 5ICCA 4S05A 1I1GA 2ZO4A 3CUQA 2JT1A 2NAZA 1OMIA 1KU9A 1KYWA 2OBPA 1IXRC 2O61A 3GFIA 4XSZF 5EEGA 3ZPLA 1PUEE 4YFNF 3KEOA 3RYRA 3DXJF 5CVVA 3CTAA 3E5UA 2DQLA 3V8JA 2WV0A 2EV6A 3IC7A 2KJCA 2QYOA 2UXXA 1DPRA 5D5XB 1QZZA 2CWEA 3K69A 2P7VB 2HQRA 2PMHA 1U8RA 1U5TA 3BROA 3ZP5A 5D8LB 2CFXA 2F2EA 5AIPA 2EJRA 2QBYA 1BN5A 3KP2A 2F5CA 3KE2A 4Q5SF 3P9IA 4RB2C 2Q0OA 2O0YA 3FM3A 4HV5A 4ASNA 1L3LA 2QM3A 4E70A 2FOKA 4HX7A 2Z9OA 4HDVA 1RIOH 1EV7A 3V8LA 5JR3A 1MDMA 5HLGA 2UWMA 2VN2A 1ZG5A 2G9WA 1DUXC 1ZGJA 1TNSA 5D8KB 4KMUX 3JSPA 2PEXA 3F23A 4CXFA 1YO5C 1KQ0A 5HLIA 1P4WA 2XAHA 4M73A 4M6XA 4XLNF 3T1BA 1S6LA 4XBFA 5EEHA 1G6NA 1O7FA 3ELKA 3SXYA 1P92A 5BQTA 3IRRA 3HSFA 2DT5A 3TOAA 4EGYA 3WTWC 1MKMA 1MD0A 2A5YB 1TLHB 2D45A 1IXCA 4IPAA 3MQ0A 2NNNA 3RPQA 3U2RA 3HHHA 5J8CA 1BIAA 3EYYA 4Q4ZF 3GW2A 5D6FA 1BI3A 1Z05A 2VXZA 1H9TA 5E8GA 5LGUA 3HHGA 4ZYGA 4GYGA 3V8KA 2H6CA 4KA4A 3ABTA 1IRFA 2FA5A 4N0BA 2H27A 1XGSA 4FX0A 4O6JA 2K02A 1RNLA 2EWNA 2HTJA 2XASA 3ZMTA 1MJBA 3TQNA 4A6EA 2ZKZA 3ABUA 1ZLKA 1IN8A 4IXAA 3N4MA 2X0LA 4ON0A 5ICGA 1EH8A 1K78A 3CUQB 1FT9A 3LFKA 2GA2A 2B0LA 1J0RA 3IWZA 1YS6A 4RB1A 2K86A 5F1RA 2GA1A 2W84A 3I53A 3CDHA 4WCGA 4UXNA 1OPCA 5D5VB 2A6EF 1FOKA 2RV8A 3FF5A 1OR7A 2CYYA 2FMYA 3BP8A 2IP2A 4G9YA 5F6FA 2EA2A 2PI0A 1PP8F 4G7OF 4GCVA 2MD5A 2PLYA 2EA4A 3CO6C 4HF0A 3F3XA 2VONA 2IA1A 2A69F 2R7FA 2VODA 2JZYA 2ZMEA 1REPC 3M9AA 2QBYB 1Z9CA 3K1NA 3ROUA 2EFWA 5F64A 3KLNA 4MQVA 2IT0A 2YX7A 4KNYA 3C3WA 5D6EA 3F6VA 3GLXA 1R1TA 1ZH5A 1P4XA 3DPTA 3FMRA 4MTDA 4IRIA 2OA4A 3JW4A 4MGRA 1MDMB 4M9ZA 3F8FA 3H92A 1FSHA 3PQKA 4LG0A 1P4AA 2QUFA 4KIGA 2GWRA 5FLXK 1JHHA 3WTXC 1IAWA 1TW2A 1R1VA 2Q2EA 2Y75A 2IPQX 1LVAA 4GYIA 2G7UA 3ISPA 1L0OC 5LGNA 1MZBA 4L0ZB 1S29A 2K27A 3RIRA 2FMLA 3R0JA 1J7KA 2XAGA 4UVBA 2L01A 1IN5A 1USSA 5CJ9A 2Z5UA 1ODDA 3O6BB 3F8NA 2V79A 3FWEA 3M1EA 1BC7C 1JGSA 5L3BA 4HV6A 4Z2YA 2CSOA 4P5OA 4LGWA 5J8FA 3LAPA 1SFUA 4G7ZF 2D2WA 4EGZA 2DBBA 1QPMA 1XGMA 2FU4A 4KICA 4RGSA 4MTEA 3FXUA 3DP7A 1JE8A 2IA2A 3K2ZA 4H0EA 3PFIA 1TBXA 2DQRA 5HS7A 4ESFA 1HKQA 3EDPA 2XROA 2LSOA 1J59A 3FM5A 1XGNA 2QQ9A 1WSUA 2G7HA 4PGGA 2NS0A 4KMFA 3J80Z 1XD7A 2XKOA 1YW9A 2V9VA 3EETA 1UHWA 1K78B 1H9GA 2R7DA 4OIOF 3E97A 1B9MA 2AS5F 4G7HF 1LNWA 4MNUA 1ZARA 4M72A 1ZAOA 2J5PA 3WGGA 3CLOA 2V6CA 1AWCA 4NHJA 2VBWA 2VOPA 1VTNC 4IVNA 1HXDA 1STZA 1HKTA 4CHUA 2XV4S 4AD9A 3ZMSA 4L9VA 3M8EA 2VC1A 4N9IA 5DV5A 2A07F 3QPTA 3WTSC 3RKYA 3WTTC 3F22A 4PDKA 2EFPA 2RGVA 4I0AA 1HKSA 2EV5A 3BY6A 4YIIA 5E1XA 4UUVA 2E1CA 1T98A 4UV8A 5ICFA 4L18B 3DKWA 3RTRA 3QP6A 2MLKA 4M6YA 4KIBA 3F21A 4A12A 1O3RA 4KT5C 1I5ZA 2H09A 2GXBA 4QLCU 1E2XA 2O3FA 2EFNA 3IL2A 4BH9A 3F8BA 1G3WA 3GZ6A 1FYLA 1CGPA 3BZ6A 3M7GA 5ED4A 3KZYA 4IF4A 4U0WA 4OIRF 5DUKA 6PAXA 2ZXJA 4HA8A 2VOOA 4OMZA 3LQRA 4A0XA 5FD5A 2QWWA 3JAMK 3JSOA 3VODA 5LHHA 2RVCA 2ETHA 4GXOA 1LQ1A 1BC8C 1CF7A 2A6HF 3R0AA 4CZZA 2XUBA 2P6SA 3I64A 3GVAA 2IRFG 2PN6A 2BV6A 2JSCA 2DPDA 3ZMDA 3V7SA 4RAYA 1FYMA 1HW2A 1YQAA 4JQFA 1KU3A 1IN7A 1KQ8A 2H94A 5K5OA 1E17A 1I27A 3BDDA 4RGXA 1OYWA 3VEPA 4OIPF 1UCRA 3WU1B 3I5UA 1QQIA 1O7LA 2D1HA 4P55A 1KU2A 1Q1HA 2F5FA 2HFHA 4O3MA 2PFBA 2MBFA 5CYVA 4P9UA 3T5XA 2ZBKA 3COAC 3K0LA 3QU3A 3VB2A 4KFCA 2FXAA 3GYHX 1W5SA 1FPQA 4PZJA 1F4KA 1IF1A 4FT8A 3GFJA 2MH9A 2E7XA 5DD8A 1XMKA 4FX4A 1I6XA 3TO7A 5LRSA 4KYWA 1LJ9A 1FX7A 2ESHA 4U7DA 4HQEA 5FFZA 2Y48A 1B59A 2UZKA 3MCZA 5HDGA 3ZMUA 2A68F 4IJAA 3IKTA 2L54A 2DK5A 3JTGA 3TOBA 1HSTA 1XSVA 1HSJA 4PGHA 1IN4A 3F8MA 3WTYC 4LK0F 2YU3A 4JK1X 4LK1F 1QNTA 2PQ8A 3K1PA 1W7PA 3C1DA 3HSEA 4UHTA 2YX4A 3CO7C 4I98B 4UNOA 4BYYA 2FQ3A 4RB3C 1OKRA 3KP4A 4XRFA 3V7RA 2IJLA
chains in the Genus database with same CATH superfamily
2ID3A 2IGOA 3LA3A 3G3ZA 2XB0X 3WE3A 3HM5A 1J5YA 4WF2A 3CCMI 2XF7A 2BOLA 5BOXA 3NAUA 3L2UA 1A36A 1H0MA 1XB4A 4G6DA 1FP1D 4P96A 2HYGD 2NS7A 1J09A 3QOPA 4WK8F 1J75A 1IGNA 1IDYA 2HDCA 1V4RA 3GUDA 5D5UB 1Q1VA 2X1CA 2KIMA 3KEQA 1ON2A 3QPLA 2LOOA 3OMYA 4HBLA 4F92B 2JQ7A 2CS3A 1U6GA 1UAAA 1FZPB 1I1SA 2HGCA 1SMTA 2M4KA 3PUBA 4I09A 1D0ZA 4F7ZA 3G73A 1W5CC 3D5LA 1AU7A 4HLXA 2ZSHB 1KYZA 3DEWA 1TWHJ 1DP7P 2O7OA 1BOBA 3ML6A 4FE7A 4K2EA 4EM2A 4IX7A 1ZGWA 2XSJC 3SFZA 3WU0A 2A3SA 5C44J 1B8IB 2GXAA 5E17F 3ZQLA 5EGOB 3JR9A 2CUEA 3HB9A 3QPHA 3T8TA 1B9NA 3PQJA 3J80K 1LDJA 1X58A 3WG9A 2KHMA 3HOVJ 4A5MA 3DV8A 4IRHA 2KRFA 4NQWB 2KRCA 5KVRA 2QKMB 4S04A 3JRCA 4RS8A 4IOCF 1K4TA 1CF7B 1A04A 3JAMZ 5DD4A 1ZHFA 2XGDA 5HLHA 3ZQCA 5DCMB 4C30A 2LVSA 2W7NA 2EIJH 2JVGA 3OIQA 2RQQA 2ISYA 2RKHA 3A4CA 2B9SA 5E3MA 4OMYA 4WWCA 1BBYA 1CQTA 4NB5A 2O6GE 5L3FA 4AIKA 4KUMA 1YX3A 3TMOA 1WPKA 1BOAA 4WXDA 1ULYA 3OL3A 1T95A 1TC3C 3JTHA 2VBZA 1XMAA 1VQNI 1MBFA 5HS9A 1JUPA 2B63J 4LLGF 4CYDA 3K7AJ 1TTYA 1H8AC 3VPRA 4EM1A 4EQQA 1AHDP 4YIFA 3I3LA 4D7NA 2P81A 1O3QA 3J7AO 3BPXA 2QKLB 4HNUA 1BJZA 4F52A 2ID6A 3ZQ7A 4I02A 2M7BA 4FASD 5ILUA 3C2HA 2GOMA 2L9VA 4BNCA 2HQAA 3LQQA 5EZGA 3OYEA 3T8RA 3RPUA 3BTCA 2ZFWA 3OR2C 1X3ZB 2LRDA 2DI3A 1QBJA 1F9NA 3W6KB 2R4GA 2KP6A 4XONA 1Z77A 3L2QA 4AVPA 1IRZA 2XAJA 4S0HB 1DQUA 2V1UA 1NH3A 4EATA 1XDSA 2OCEA 5CVJA 4Y3OA 1OYIA 3RQIA 1P7JA 4HDUA 3S2DJ 2DN0A 4V19K 4XR6A 1YW7A 1EF4A 5JHUA 3TKYA 3WTVC 5DUIA 2Y69H 3ABKH 1O57A 3ULQB 2HI3A 1UZCA 4ETSA 4YRVA 1WH7A 1FIAA 4XIDA 1TNTA 4BQOA 3Q9VA 2LY9A 3D5RC 3LAJA 2ACJA 3KZIC 5KAFC 1RPWA 2DFIA 2BW3B 1FOXA 1QGPA 1UG2A 1I3QJ 3HRTA 1GV2A 5D4RA 1XX5A 2HYFA 2DO7A 5HNFA 1S3JA 4CCNA 1HDPA 3SZPA 3WGHA 3W2WA 1N25A 2KL4A 4ZZLA 5LHIA 1ZK8A 2X6XA 2P5LC 2L7ZA 2VQGA 1QHHD 3BPVA 3DEUA 4BGDA 2KFDA 4Y13A 3OYFA 3WG7H 1FYKA 1BI2A 1FMVA 2FX0A 2LF8A 5IPAA 3MKZA 3OYGA 2HTSA 3PNTA 5TRDA 5B1BH 1MBHA 4M9XA 2DA7A 3BR1A 5L3EA 4EJUA 2HEOA 3QRFF 3HOYJ 3R6SA 5GAEJ 4I7HA 2I10A 5IYCJ 3E5QA 4G6QA 1PYVA 1EA3A 4U88A 3OYCA 2Z99A 4M3DA 1TP4A 3TDZC 4Z6YA 4RM2A 4CYCB 3GZ5A 3GTPJ 5LEJA 1F36A 4JX6A 1GV5A 3BWGA 5GPAA 4BHCA 2X48A 3V42A 3QAHA 2DMNA 2X1DA 4O5VA 5CQGA 2R5YB 2PMUA 1QRYA 4R8HA 4XKWA 3OS2A 1QZYA 5L3GA 3BJOA 1W7PB 1DGRM 2IGNA 3LA7A 4BXUA 5HODA 2R0QC 4CDGA 1T6SA 3FXRA 3MEXA 3J81K 3L9FA 1LE8A 3L00A 2ZJ2A 3LSRA 1BL0A 2JPCA 4DYRA 1EH7A 4ZH4F 1MNEA 3LSMA 1E0EA 1A35A 3IRQA 5E8IA 1ON1A 3SJMA 1DU6A 4MLOA 1BIBA 4UUTA 3MFKA 2C6YA 2BHZA 3KCCA 4BHBA 1N77A 3IH2A 2JUCA 2BBYA 2FSWA 3DTKA 3GO5A 3FZVA 2BXYA 5BPDA 2VJJA 4RM3A 3CMYA 4HLYA 4R1HA 2TRTA 2VKVA 1JXSA 1YIOA 2LFBA 2NYXA 2B7EA 4UV9A 1DP3A 4ZDOA 2HU9A 1U0JA 5FRMA 3MKLA 1YG2A 3KP3A 3AG2H 4CSWA 4XLEA 5FKOA 1R5GA 4A2UA 1S7EA 2DW4A 1XSDA 1FTZA 2M8EA 1R58A 1T0FA 3DTEA 4HSTA 2XAFA 1GXQA 1R4MB 2WAEA 1TWCJ 2O8XA 4BJ6C 1DGWY 4JBAA 2ZCWA 5DTDA 2IGKA 5LFAA 4MEXF 4D7MA 4HRIA 4HOBA 1HW1A 3CMAI 3JRFA 4BBRJ 3BTIA 1BW6A 4LD5A 3VYUB 4EM0B 1IO2A 1WRJA 3B73A 4B44A 2M5WA 3ZN1A 1B72A 1D8JA 3KZZA 4JX5A 1MH4A 5LGTA 4CGZA 2BXZA 1ZRCA 1MNDA 3EUHC 2GIVA 3KEYA 5LD2C 1MGTA 3WODF 1LEBA 1RZ4A 5C4XJ 2KIQA 2KJBA 2LC2A 4QSHA 4Q47A 2A61A 3RDIA 3OYNA 3HGGA 3TP3A 2ZSIB 1B4AA 2WWYA 2KDZA 2VJ5A 3DKYA 3HSRA 1AOYA 1IXSB 1RI7A 2P8TA 2FEZA 3OSFA 1D8KA 3VSLA 2IAIA 2CW0F 3CJNA 5CVIA 4DYCA 4BDYA 3ZQHA 3Q0UA 4M3FA 3C2GA 1JGGA 3DLLF 3VOEA 1JHFA 4XSXF 1W7PD 3KYDB 4HAMA 2XDVA 1WJBA 4PJMA 2K9QA 3Q9SA 2DAOA 2DPUA 3H5RA 1ONVA 1FP2A 3FHZA 1S7AA 1XDUA 3U9GA 1YI2I 2VC0A 2RNGA 1VQ7I 3B6AA 3RYPA 3S14J 2MG4A 3DQVC 2NNYA 2KIFA 2COBA 3S2WA 1GUUA 2IS6A 4L5IA 2L4AA 1XTAA 2ICWG 1FBQA 1WGXA 3MD2A 3HKZN 3MKWB 4LB5A 2HZTA 3CCSI 1TW3A 5CVUA 2WAQN 1YS7A 1Z1DA 1U3EM 1SMYF 2Z33A 2ZFUA 3TEDA 4RGUA 3TO6A 3BCBA 3OL4A 2H8RA 2V1NA 3LA2A 1Z0XA 4U7BA 1J2XA 2DOFA 2LK2A 2RQPA 4F55A 2VKHA 4WXCA 1TT0A 1S7OA 2XRNA 5E3LA 1YITI 3IHUA 2LYCA 3H1CA 2LLKA 4Y17A 3F8CA 3F6OA 2QQAA 4AYBA 1FOYA 5ILSA 2LNBA 5DDGA 3CDIA 1LPQA 5CLSA 2DA5A 2A05A 1VQLI 1MJAA 3JRAA 4XLPF 1WJDA 2BYVE 2VT2A 5KK1A 5AIQA 2JA7J 4UB6C 1ZELA 2MC4A 2W85A 4E6KG 3C2BA 2E71A 1QZEA 3J7ZI 1B1BA 1HBXG 3K4KA 4U87A 1ZG1A 4XKVA 3HL2A 1Z7LA 4M74A 3BJAA 3QQAA 4IEJA 1ENHA 1XGOA 5GTHC 1XC5A 3UKGA 3HTSB 2HOEA 3FK6A 4WX9A 3G1MA 4EJWA 1SD4A 2OQGA 3L7WA 2OTLI 3HTUA 3VSKA 5HVQC 2KIUA 2K4JA 2FBHA 4XM3A 2M0CA 4BUPA 3S16J 2GQQA 4I01A 5K5QA 1F43A 2OU2A 3OS0A 1P6RA 1XSXA 1K61A 1R6RA 1U5TC 4OAYA 4C3JJ 2G0EA 1XS9A 1SFXA 1D5VA 3QU6A 1W1WE 4RB0A 3BC8A 3CP2A 4V2GA 2VBXA 2PG4A 4XKCA 3UR3C 5B66C 2HQNA 3HOSA 1H88C 4OU0A 4P9FA 5E1ZB 3ZMZA 1ZLJA 2PJPA 2WY7Q 1D1CA 3F72A 2KZGA 1OCCH 4G94A 5J4VA 4G8XA 4UY8I 1FSEA 5EJCA 4CICA 2X6WA 5FGMA 4F3QA 5JLWA 2KLOA 1MBKA 4M3GA 2EZKA 2OQRA 3PIOF 3RI4A 1NHAA 3BG5A 2COMA 5J1RA 1JT6A 4BY7J 4ZZDA 1S72I 1Y0UA 4XNFA 1EKEA 5K5RA 1B8IA 1G3TA 2JUGA 5EGOA 1FNNA 3EUHA 4YFXF 1YE9A 1ZKGA 5DEQA 3V7CA 2RC4A 1JTXA 1XCBA 3O2PE 2TDXA 3CJRB 3CP8A 4NQWA 1T2KA 1ETQA 4BXFA 1IV8A 2MC3A 4J19A 3ZGKA 3M8FA 3K70C 1VZ0A 4M3BA 2FBIA 3FISA 3RPUD 1ZG3A 3OOPA 2PJRB 4MEYF 5BNGA 5DCMA 5KNLA 1BM9A 5EZHA 4DOZA 4FETA 1OFCX 4M6VA 3J81Z 1S5LC 5GAHJ 1FJLA 2Y0SA 3GTLJ 4AWXB 3FXLA 2HQ5A 1P2FA 5FO5A 3HOZJ 4F93B 4UVAA 4E7ZA 4ENJA 5ILVA 2HVQA 2M1BA 3AG4H 5TJJA 4L5JA 2WY8Q 2HKOA 4BXXJ 3IWFA 3P5JA 2BHYA 2WB1N 2GLOA 3CDLA 1TZLA 1LDKB 1TWGJ 5H6QA 4II2A 2M8GX 1K83J 3LWFA 4J01A 2BGCA 1SD6A 1W36C 2R93J 4D5CA 5EF6A 4HZFA 4MO7A 4HG2A 3I4PA 1LB2A 1R7JA 2IA0A 1JKRC 4LLLA 1W4MA 2J5OA 1HCRA 1Z6RA 3K4LA 1JUSA 5C4JJ 3I9V2 5D4SA 3G1LA 2LR8A 5JHFA 1D0XA 3HC7A 2JA2A 1TQMA 4B47A 2ZNYA 4L9NA 1IN6A 4EJTA 4I0BA 2E34A 2Z3YA 5L3CA 1PDNC 4IHWA 4XLAA 3CC2I 4Y15A 3TW7A 1R36A 4ZYAA 5DM6F 2HS5A 2M7AA 1UJ8A 3QWLA 2N8GA 5FKKA 3KP6A 3RCOA 2MH2A 2XPUA 2FUG2 4RAGA 2XPVA 4LB6B 1PJRA 1FBSA 2W4SA 2XVCA 1Y1VJ 1BR4A 1R23A 2BW3A 2HR3A 4RA2A 2FNPA 2Y9ZA 3GWZA 2F5DA 2XHKA 3NWTA 5BS6A 3E6DA 2H1KA 2L5QA 4E7KA 2M45A 3QODA 5FKMA 2CUZA 3HG9A 2IW5A 1ZN2A 2BY1A 2QENA 5LRRA 1JJ6C 4IQJA 2CFOA 3H0DA 3MZYA 1FLIA 3G6EI 5FRNA 3CC7I 3WGIA 3K1MA 1YRNB 1WI9A 1ZRDA 4E7IA 3H36A 4WXHA 4V2FA 4ESJA 2FBKA 1YFHA 1XN7A 4A0YA 4Q48A 2NVQJ 4XK4A 4XORA 1V3FA 2CUFA 3E6CC 3VFZA 2ME6A 1U78A 2XAQA 1UFMA 1LEAA 4A5NA 2YSRA 2GIZA 1K7AA 1EH6A 3BLYA 4C2MJ 2IEKA 2QQBA 5E18F 4CYCA 4IRGA 5FD6A 3S3MA 2VKDA 1Z6TA 4NDLA 2L3DA 3SEZA 1LKXA 3WU2C 3OOUA 5F1JA 2R5YA 3RKQA 1SVLA 4IZZA 2HNHA 5IOZA 4X0GA 2DMTA 2ZXWH 5J47A 2BY3A 1YYVA 2EFQA 2GZWA 3IH3A 1K6YA 2JWTA 2QEXI 1FEXA 2GM4A 1D1AA 3L09A 1GXPA 5CVRA 4IHYA 1YW8A 1WWXA 2FD5A 3H9GA 2DU9A 1FTTA 1Y8QB 4E4HA 4GRIA 5A2QK 1R5HA 3HYIA 2RREA 2X4HA 4MQ9F 1E3OC 4FCYA 2LDUA 3U1DA 4CCMA 4YFKF 1C0WA 1VQOI 2HZDA 1VQ9I 2M0MA 1SD7A 2LREA 4A3DJ 2A6TA 4DNCA 3H3UA 3I58A 2NVUB 1MSEC 1D3YA 3GBGA 3C18A 1USTA 1T8IA 4PSWA 4MFDA 4B8XA 1J9IA 4A3IJ 3H3ZA 1V5FA 3P9CA 1BI0A 4N4OB 3MZHA 1AKHB 2IXSA 4PCQA 5H20A 5JI6A 5IYDJ 3ZQIA 4I2OA 3CUOA 4X6AJ 5KCMA 1KONA 3PJRA 4FTHA 2ZB9A 2ZMEC 3ZQFA 3S17J 1BW5A 1XCVA 3CESA 3GF2A 3X2QH 3IV5A 4FE4A 2VKEA 3C7JA 2L9NA 2YS9A 1V5EA 2K7LA 4DBRA 3BJ6A 3M4OJ 1G4DA 1ETVA 1KGSA 3GXOA 3K4BA 3WTUC 2WTEA 3FXMA 2LKPA 3R4KA 2DA1A 2JK3A 3HOTA 1HW5A 1E3PA 4BHPA 2W57A 2W00A 4EVIA 3SHFA 3GEZA 2R7WA 3P7NA 2W25A 4KN7X 4RMNA 5LEKA 4W97A 2YR2A 2L7KA 3MAJA 1AA7A 3EQLF 4GO1A 4BY1J 5FLVA 1PUFB 2RAEA 2KISA 3JRDA 2CV2A 3E6BA 3SDBA 2AXLA 5B1AH 3KYLA 3DF8A 3MWMA 3OSGA 4D9JA 1G3YA 3BTLA 3SYTA 1E3HA 2M30A 1F5TA 4NC8A 4L0YB 3H0GJ 2F5VA 2KDOA 1ZQ3P 1Z3YA 5JVTA 3K4NA 1I39A 4ZYDA 1I50J 3QYEA 1A6IA 2QVOA 2Z2SB 4EMSA 4ANJA 5EEAA 5IT9K 3ASOH 2XGXA 1X3UA 3S15J 3ECHA 4ENMA 2GAUA 1IRXA 1F1ZA 3TDUC 4E7LA 4A3EJ 2EB7A 3LSPA 5FFXA 1W0TA 1IUFA 2ECCA 4C3HJ 4HW0A 2CJJA 2V9KA 3GMEA 5IT3A 1Z91A 5GPCA 2HWVA 5M5WJ 2EBIA 5LBQA 4MFEA 1SC7A 3IKVA 1JTYA 1OYYA 1W5TA 2NVYJ 2XF5A 5GAGJ 2VUMJ 2LG4A 3AG1H 1BR2A 3K9TA 2JN6A 3I54A 2JPBA 3ABMH 2NRAC 1T08B 2K4BA 3PIPF 2X1EA 3GCMA 2VQHA 3S3OA 1IW7F 2FNAA 2VT3A 3CMMA 3W2VA 2CG4A 3IP4B 3RJPA 1YTYA 3R61A 5ERIA 3I59A 1X1DA 5HDKA 2Q8KA 4D5FA 5FB2A 3DU5A 5ICEA 1SVOA 3A0HC 3NEUA 2DDBA 4C3IJ 3VWBA 2IVMA 4ESBA 3FIWA 3SQNA 2ZXHA 2XKPA 4D0PA 2CV0A 2ZC2A 2JRMA 2NOJB 1HOMA 2WC2A 3TO9A 3I0TA 2M87A 2QZ8A 1ETXA 1Z67A 2OF7A 2K5CA 2X9DA 3K6GA 2WBMA 2GXGA 1IZ1A 4A0ZA 2XGCA 2FOWA 3BQZA 2CH0A 3KX2A 4KIFA 4HQMA 1FY7A 3ERED 1HF0A 4IKFA 1X2NA 1MJ9A 2KRHA 4HF2A 1Y0NA 2ELJA 2I5UA 4Y4RA 1OCRH 1U5TB 3FXJA 2DMUA 3OYDA 4LMYA 2X51A 1WQ2A 2KPMA 4XN0A 2VPRA 2QLZA 5F0FA 5GP9A 1PP7U 4IO9F 2JTVA 3E3VA 3BR0A 3EUKL 2PJRA 4IHSA 1WJAA 3NRVA 4Y33A 3W6JB 4Y52J 1WCMJ 1Y39A 3LSGA 2ZJPF 5H6RA 2HDDA 2DK8A 3G2BA 5J6XA 2EIMH 2R7UA 5J3LA 4XLHA 3K10A 1A6QA 1O3TA 3HUGA 4B48A 4ENNA 2EK5A 4AIHA 2P4WA 4G12A 1QPIA 1SAUA 2M4GA 1LFPA 4B4CA 2K85A 3FKJA 4NC6A 2OZUA 1X1PA 4YIRX 1KU7A 4KDPA 5BMZA 2JA8J 4U0YA 5CKTA 4A93J 3CLQA 3GTJJ 4CA0A 2LF7A 4H4KC 2DTRA 1K79A 3H5AA 5GADJ 1R1UA 2EPFA 2CO5A 1B6AA 3ECOA 4XRSA 5KHDA 2FE3A 5LLQA 3SZTA 2VE8A 1RUNA 1R00A 3FX3A 4CO8A 4F91B 3HRMA 2ME0A 4IL6C 2MLGA 2AQFA 4QWQA 3KETA 3SDGA 1BJAA 2H6BA 2XPWA 3V4GA 3AG3H 4A69C 3NQOA 1V54H 2ESNA 2RN7A 5LHGA 5A2QZ 5FKNA 4ZYHA 5IYBJ 3ZR8X 1N78A 5J1UA 2CQ7A 4AVZA 3KLOA 3E5XA 2F5EA 1HQCA 2DFFA 5E1WA 2E1MC 1KZHA 2DLLA 3DTIA 3LMMA 2R7XA 2P6TA 4CCOA 3JRBA 1RUOA 1DPUA 2MD0A 1UB9A 2D1VA 4DQ2A 2ELHA 2DMQA 5HDNA 2K3PA 1MSFC 3VYRB 1MMGA 4U0VA 1VNDA 2V1DA 3OV8A 4Y7NJ 2STWA 4RBOA 4HX8A 1YLFA 3GFMA 4IOAF 2BVMA 2DA3A 2HYJA 1Z7UA 1UHSA 4FISA 2P5KA 5HS8A 2E19A 3RKXA 2OTJI 3P9KA 3TP0A 4FQGA 4GGGA 2FQ4A 5FROA 4C2UA 4OOIA 3B02A 4PJ0C 2VXDA 3FXOA 1EJ9A 2VJIA 2KKOA 3L2CA 2CMPA 5EDNA 3PFYA 4W1UA 2LBFA 3HOXJ 1OCOH 3HJEA 1IC8A 3OYIA 1JKOC 1UHMA 1FOWA 2PBIA 3W3CA 2V9PA 2DOEA 1TWFJ 3GFLA 3E0JB 3LSIA 3AAFA 3FXKA 3DBHB 2QSHX 5HOOA 2Y0MA 3I71A 4KN4X 1SFEA 3DFGA 3ZN0A 5E20A 1U2WA 3K70D 2UXNA 4BE0A 1VQPI 1WHUA 2V7FA 2IS4A 1ZRFA 1UMQA 3D0SA 3MZ8A 2EV0A 1YRNA 3HRSA 3ZMVA 2HKXA 4HPQA 4RAZA 4ZTFA 4IQ4A 4RGRA 5J40A 5IT9Z 1QO0D 2XF6A 5BPIA 2JRTA 2F48A 2DT7B 4A6DA 4M9SA 1FC3A 2KZVA 3R60A 1K6OA 5DM7F 3CUQC 1TQIA 4A3KJ 4PJNA 3REOA 4BE1A 4A3FJ 1GHCA 2Y31A 3A2KA 1OISA 2H8WA 3BOQA 1TWAJ 2P5VA 3L2RA 2ZNZA 2W24A 3OYMA 3HEFA 3FK7A 2OZ6A 3ERMA 5DCFA 3BQYA 3N05A 5TISC 3KP5A 4HYEA 4AIJA 1WFXA 3H9JA 3KP7A 3DKXA 1T38A 1LDDA 2XIGA 3I59B 3S8PA 4ZYEA 3CCYA 2P7CB 3BR2A 2EZIA 3D5SC 2FF4A 3WE2A 3GX4X 2R3SA 3GTOJ 4TV7A 4HF1A 5D5WB 1SD5A 2CRGA 2LY1A 2M34A 3PUFA 1ZGAA 3HBLA 1JI8A 1KA8A 2Q1ZB 2OC6A 3KIOA 1MBGA 2L4MA 3HRUA 4B09A 4HEA2 2NVXJ 1R22A 3Q5FA 2DOAA 2YPRA 2RNJA 3EYIA 4BQAA 2E36A 1GVJA 5FKLA 2L02A 4IHTA 2PMZA 3PO3J 1ACIA 3O8GA 2BY0A 4LFUA 3DPLC 4BAYA 1JT0A 2OPTA 5E3OA 5JFRA 5EG0B 3WTZA 4UVCA 3QP5A 3FMSA 5IOYA 4PK4A 4LOCA 4XLFA 4ENKA 2STTA 3KFWX 1FBUA 3FMQA 5L3DA 4R79A 1YJWI 2FRHA 2DT6A 1AKHA 4N9HA 1ZYRF 3EPZA 4XLCA 2DA6A 3S1MJ 2K9SA 3DWLE 1G2HA 2ZMEB 4YG2F 3O3KA 2EFOA 3H9QA 4EJVA 2V1XA 3T0YA 1X1CA 3OYLA 4M71A 3O8HA 2BEOA 3IUOA 2ADUA 3LSTA 1TQPA 4L9JA 5K7FA 4E7JA 1S8NA 3FXQA 4XKBA 4A3GJ 1A5JA 1VF9A 2MA3A 2VBYA 2IGMA 2EZHA 3A1YA 3HUGB 1YOVB 4OIQF 2W48A 2JVHA 1GDTA 4AM3A 2BE5F 1NK2P 3E6MA 4OINF 4EV0A 4A3MJ 3N97A 4FHTA 1O3SA 2HXIA 1YJNI 1T39A 1FWZA 3BT9A 3TGNA 1KQ9A 2GBYA 4L9TA 1PUFA 2VB6A 2R7TA 2HOSA 2K9LA 4LJZF 2VE9A 1IRGA 4D1QA 1MH3A 1QHGA 2E7WA 2O03A 2WADA 4G6TB 4MHGA 1ETKA 1BI1A 3FBNB 4LG0B 4LLNA 3BR6A 2JA6J 1TL8A 4AUXA 1WKMA 3HIFA 2OAZA 1G3SA 5JLXA 2XC7A 2ISZA 4DZJA 3OYBA 2OD5A 2CQKA 2Q2EB 4BJTA 2E1NA 1SAXA 1IUYA 3QYBA 4RLQA 3I55I 3RKWA 4EJOA 3JRGA 4ZTJA 3DEEA 2EH3A 4CUGA 5FLXZ 4HX4A 3ZXSA 2BY2A 4ITVA 4PFOA 2Y2ZA 4E7HA 5K1YA 1LFUP 2CGPA 1DDNA 2V4JC 2RDPA 4PSXA 5DYMA 5AONA 1IV6A 1ZREA 2ZXIA 1YIJI 2OJED 1JJ8C 5ICCA 3U1KA 4S05A 1I1GA 3CUQA 2ZO4A 3SZGA 3Q0VA 4A3BJ 2JT1A 2NAZA 4XMYA 3OYJA 4E7SA 1OMIA 1KU9A 1KYWA 1ETYA 2OBPA 1IXRC 3ESWB 4DW6A 1MNMC 2O61A 1JKQC 5F08A 3GFIA 4XSZF 5EEGA 2AQEA 3CD6I 3BTJA 3ZPLA 1PUEE 4YFNF 2R5ZA 3KYCB 3KEOA 3RYRA 3RZOJ 1NG6A 3DXJF 5CVVA 1SEUA 3CTAA 4CH7A 3DBRB 3E5UA 4AYBN 1LVKA 3ZQGA 1HC8A 2DQLA 3BG3A 1WH5A 3V8JA 2WV0A 5M3MJ 4GFBA 2EV6A 3IC7A 5K7ZA 5FLMJ 1XMXA 2KJCA 3CF5F 2LBFB 3ONQA 2QYOA 3SFIA 3CF2A 4A3JJ 2V6EA 2UXXA 1DPRA 3BG7A 3VDXA 5D5XB 1QZZA 1X1AA 2VQLA 2X6OA 1OJLA 2UUZA 2CWEA 3K69A 1MMSA 2P7VB 3F0CA 2ECBA 4AC0A 2HQRA 5F27A 2O5RA 3DCFA 2PMHA 1FIPA 3VYTB 1ORKA 4QPQA 4DYQA 1U8RA 1U5TA 2EILH 3BROA 3ZP5A 5D8LB 3GTKJ 2CFXA 2F2EA 5AIPA 3DBLB 3J7AY 2EJRA 2QBYA 1Z3XA 1Y6IA 1BN5A 3Q0WA 1G59A 3KP2A 4B3AA 2F5CA 1NK3P 3KE2A 4Q5SF 3P9IA 4RB2C 2TCTA 2QCOA 2Q0OA 2O0YA 3FM3A 4HV5A 4ASNA 4QTRA 1L3LA 2M3AA 2OCCH 2QM3A 4E70A 2FOKA 4HX7A 2KQRA 4PJLA 2Z9OA 2IS2A 4HDVA 1RIOH 1EV7A 3V8LA 1OR7C 4XRSG 5JR3A 1MDMA 4KT6A 5HLGA 2UWMA 1VQ5I 3KPHA 4I76A 2M9HA 1QVUA 2VN2A 2HOAA 4BS9A 1S9HA 1ZG5A 2G9WA 3TW6A 1DUXC 4IHVA 1ZGJA 1TNSA 5D8KB 4M3EA 2JJ7A 1ZR2A 4KMUX 3JSPA 2PEXA 3FBIB 3F23A 4LG3A 3BCAA 4CXFA 2HOTA 1V5GA 1POGA 1YO5C 1ERDA 1KQ0A 1X3WB 5HLIA 1P4WA 3CJQB 1X19A 2XAHA 4M73A 4M6XA 4ZDLA 3PNYA 4XLNF 2Y0SN 3WHBA 3T1BA 3MN2A 1S6LA 2QGUA 2F4MB 4XBFA 5EEHA 3GTQJ 2E60A 1G6NA 4QIWN 1O7FA 1R5ID 2E1MB 3ELKA 3SXYA 4I99C 1P92A 5BQTA 3IRRA 3HSFA 3AL0B 4A3CJ 2DT5A 3TOAA 3E7LA 3WTWC 4EGYA 1MKMA 1MD0A 2A5YB 3DU6A 2ELKA 1TLHB 2D45A 1HA8A 2E35A 4JP0A 2E5NA 3DPUA 2HPMA 1IXCA 4IPAA 3MQ0A 1OQYA 2NNNA 5M5XJ 2P0WA 3RPQA 4XN3A 4KITB 3JCUC 3U2RA 3HHHA 5J8CA 1BIAA 4DZPA 1MMDA 2CQQA 3EYYA 1I6HJ 4Q4ZF 3GW2A 5M3FJ 5D6FA 1BI3A 1Z05A 2CW7A 2VXZA 1H9TA 5E8GA 2AO9A 2Z16A 2V26A 2HDWA 4PJJA 2NXNB 3S1RJ 4XL9A 5LGUA 2O9LA 3HHGA 4ZYGA 4GYGA 2W1OA 3V8KA 5H2FC 5HNHA 3OY9A 2H6CA 4KA4A 4PFPA 1R4NB 3ABTA 1IRFA 2FA5A 2DDAA 4N0BA 1MMAA 2H27A 2EZLA 1MBEA 1XGSA 4FX0A 4O6JA 3A0BC 1MIJA 3S32A 1VQ4I 4BDZA 4OWRB 4BU2A 2K02A 1OCTC 3ASNH 1RNLA 2EWNA 1Z21A 4CCLA 2HTJA 2XASA 3ZMTA 1X1BA 1MJBA 3TQNA 4A6EA 2ZKZA 3ABUA 1IJWC 1IN8A 4IXAA 1ZLKA 4CZCA 3S2HJ 2O8KA 2M2EA 3N4MA 2X0LA 3M1CA 4ON0A 2ZJRF 5JVGF 5ICGA 3CCRI 4AU7A 3VYSB 1EH8A 4JX4A 1K78A 2E1OA 2F6CA 2L9SA 3CUQB 1FT9A 3I56I 1VFCA 3LFKA 3A01A 1O4XA 1WJCA 2GA2A 4N4NB 3PM1A 3ZRGA 2B0LA 1J0RA 4KJZA 3IWZA 1YS6A 2WA0A 3Q3SA 4RB1A 2K86A 5F1RA 2GA1A 2W84A 3I53A 5J1YA 4GDFA 2L7MP 3CDHA 1T56A 2PX9A 4WCGA 4UXNA 1MBJA 1OPCA 2A6EF 5D5VB 1FOKA 2D5VA 2NVTJ 2RV8A 3HXLA 2R5ZB 3QYFA 1OLTA 3L2VA 3FF5A 1OR7A 2CYYA 4HSRA 3TBIA 4A3LJ 4II3A 2FMYA 3BP8A 3U21A 3I4MJ 2IP2A 4G9YA 1T0FC 4MIMA 2LD5A 5F6FA 2DYRH 4LITA 4UUSA 2HVRA 4BQNA 3TL4X 2EA2A 4JOMA 2X85A 2R7SA 2PI0A 1PP8F 4G7OF 4GCVA 2MD5A 2PLYA 1YJ9I 4BBSJ 3CQZJ 3HPHA 2EA4A 2UV1A 3CO6C 4BACA 3H3VK 2DCEA 5FJ8J 1JKPC 5EG0A 3WHCA 4HF0A 3F3XA 2DMPA 2VONA 2IA1A 2EIKH 1RC9A 2JA5J 2IS1A 1D5YA 2JMWA 3HDDA 2A69F 3K2AA 2R7FA 3CMEI 1LFBA 2VODA 3BR5A 2JZYA 2ZMEA 1REPC 3M9AA 3RZDJ 2QBYB 3H5NA 1Z9CA 3K1NA 3ROUA 2EFWA 5F64A 3KLNA 4MQVA 2IT0A 2YX7A 4KNYA 3C3WA 5D6EA 3F6VA 3GLXA 1R1TA 3MVPA 2W82A 4X1EA 3JRIA 1IDZA 3BG9A 2X6YA 1ZH5A 1P4XA 3RSNA 4KISA 1VQMI 3HKZA 3DPTA 2DA4A 2LMDA 3FMRA 1WVRA 4BEHA 4DGWB 4MTDA 4IHXA 2WAQA 4IRIA 2OA4A 1APLC 1D1BA 3I4NJ 4AIDA 5B5EC 1XPXA 3JW4A 1RRJA 3CCVI 4MGRA 2VASA 1LUJB 3K4JA 1ZR4A 2YUSA 1MDMB 4ZJZA 1U9NA 3HOWJ 4M9ZA 3F8FA 3H92A 2R7QA 5TGTA 3ZQQA 1FSHA 3PQKA 4LG0A 1P4AA 2QUFA 4KIGA 4XICA 2GWRA 1VQKI 4NC7A 2YU9J 5FLXK 1JHHA 1X4OA 3AFHA 3BZKA 4DIQA 1NG7A 3WTXC 1IAWA 3CCLI 1TW2A 3UNGC 1TT5B 1R1VA 3ABLH 2Q2EA 3K4MA 1SVMA 2Y75A 2IPQX 3CCJI 2EQRA 2MABA 1LVAA 4GYIA 2G7UA 3ISPA 1L0OC 5LGNA 2DYSH 1MZBA 4L0ZB 1QVTA 1S29A 2K27A 4NUBA 3LL7A 3OYHA 3RIRA 4XRMA 2Z1DA 2FMLA 3R0JA 2BZTA 1J7KA 2XAGA 2NS8A 3S1NJ 4DBQA 3AL0C 4UVBA 1P9QC 2L01A 1IN5A 1USSA 5CJ9A 2Z5UA 1ODDA 2F4IA 3O6BB 3CC4I 3F8NA 2V79A 2L2OA 1R71A 3FWEA 3M1EA 2VJ4A 1BC7C 1JGSA 1HDDC 2E2JJ 2K3FA 2MYSA 5L3BA 4HV6A 2R7OA 3A03A 2CV1A 3E1SA 4Z2YA 2CSOA 4C2TA 4P5OA 4LGWA 5J8FA 3LAPA 3M8JA 2MGQA 1SFUA 1MW7A 4G7ZF 2D2WA 1A31A 4EGZA 2DBBA 1QPMA 1XGMA 2FU4A 3LFUA 4KICA 1YX5A 4RGSA 4MTEA 5C3EJ 2LTPA 3FXUA 2E5ZA 3DP7A 2EINH 2IA2A 1RR8C 1JE8A 3K2ZA 3OYKA 2K40A 2R7ZJ 3D1NI 4H0EA 3PFIA 1X2MA 1TBXA 2DQRA 5HS7A 3G71I 3BG6A 4ESFA 4ZC3A 2H1LA 1HKQA 3F9KA 4I6ZA 1GLNA 1R9TJ 1ITYA 1JUMA 3EDPA 5B3SH 2XROA 2LSOA 3IAM2 3LOCA 3CCQI 1J59A 2L0KA 4YEJA 3FM5A 1XGNA 2WAFA 3ZOBA 2GOXB 5E3NA 2QQ9A 1WSUA 2G7HA 2WV1A 4PGGA 2NS0A 3IH4A 1DU0A 4KMFA 2FJ1A 3HGYA 3J80Z 1XD7A 1WZ2A 2XKOA 1YW9A 2V9VA 3EETA 1UHWA 1K78B 3A02A 9ANTA 2LKSA 1H9GA 2R7DA 2VIXA 3A01B 4OIOF 3E97A 2QF7A 1B9MA 2K9NA 2QSFX 3EUAA 3ZCOA 4G7HF 1YHQI 2AS5F 1LNWA 3HZJA 4MNUA 1VI0A 1ZARA 4M72A 5CPRB 1ZAOA 4NBQA 2J5PA 2IBDA 1I3AA 3WGGA 2WB1A 3CLOA 2V6CA 1RKWA 1AWCA 4NHJA 2VBWA 2R92J 2VOPA 3G4SI 1VTNC 2F4OB 2DA2A 4IVNA 3PSFA 1HXDA 1STZA 1HKTA 4CHUA 2VL8A 1WJFA 2XV4S 1H89C 1Y1WJ 4AD9A 3PL8A 1W36D 2XGEA 3ZMSA 1BA5A 4L9VA 3GZNB 3M8EA 1ETWA 3PO2J 4UUSB 4EEFG 1IG7A 3RQ4A 2VC1A 4N9IA 5DV5A 2A07F 4HNTA 1OCZH 3QPTA 3SEQA 5F0HA 3WTSC 3RKYA 4B43A 3WTTC 3F22A 4PDKA 3G1OA 2EFPA 4BE2A 2RGVA 3AKZA 1SANA 4RDUA 4I0AA 4BKXA 1HKSA 2EV5A 3BY6A 4YIIA 2CUJA 3S93A 2VLAA 5E1XA 3OS1A 3B6CA 5EYRA 4UUVA 5F04A 1T98A 4UV8A 2E1CA 1P7IA 5ICFA 3LSHA 3W2AA 4L18B 3HOUJ 2R7VA 4BJ5C 4CCKA 3MKYB 1WJ5A 3DKWA 3RTRA 1T33A 3QP6A 2MLKA 4M6YA 4KIBA 4NNJA 5CQEA 3F21A 4A12A 1VQ6I 2CQXA 4ABZA 2QQ8A 1O3RA 1UG0A 4KT5C 1I5ZA 2H09A 3M07A 2GXBA 4QLCU 2HVSA 5M5YJ 2DFHA 1E2XA 2O3FA 2EFNA 4BEHB 3IL2A 4BH9A 3F8BA 3GTMJ 1G3WA 4J00A 5F0CA 2LP0A 3GZ6A 1FYLA 4DJAA 4XQFA 5J4YA 1CGPA 3NWSA 2VI6A 3BZ6A 2MFZA 2XSDC 4JYKA 3M7GA 5ED4A 3KZYA 4IF4A 2CW8A 4U0WA 4OIRF 4PUSA 5DUKA 1W0UA 6PAXA 2I8DA 2ZXJA 3OWTA 3CCUI 4HA8A 2CQNA 2VOOA 4OMZA 1WJEA 2DJNA 3L1PA 3J7YJ 3LQRA 4A0XA 5FD5A 3S1QJ 2QWWA 3JAMK 1UELB 3JSOA 2L7FP 3LNQA 3VODA 4P1WA 2VQCA 5LHHA 3L2WA 1GVDA 2RVCA 2XRLA 2E2HJ 2ETHA 1V55H 4GXOA 2NOGA 1LE8B 3CJTB 1LQ1A 4XOPA 1FMWA 1BC8C 3JREA 1CF7A 2AHQA 2Y9YA 4HNVA 2A5WA 1QA6A 3OR1C 2A6HF 3DLAA 3CZ6A 5IP7J 3CCEI 3R0AA 4CZZA 2XUBA 2P6SA 3I64A 4XOTA 3GVAA 2HPIA 4C9YA 2IRFG 2PN6A 2BV6A 1K4SA 3JRHA 2JSCA 2DPDA 1ZTRA 3ZMDA 4BQQA 5GTIC 5IP9J 3V7SA 1RESA 2KMUA 3FKIJ 4OAZA 4RAYA 2BVLA 5KAIC 5E79C 5K7HA 1FYMA 1HW2A 1YQAA 1OCPA 4JQFA 1KU3A 1IN7A 3GTGJ 1KQ8A 2K9MA 2H94A 4L5EA 5K5OA 2KT0A 2R7RA 1E17A 1I27A 1RKTA 3BDDA 2DTZA 3GLLA 3LSJA 1WI3A 4RGXA 1OYWA 4RLFA 2LKXA 2L9RA 3K4CA 3VEPA 4OIPF 3FDYA 1UCRA 3WU1B 3I5UA 4ZDPA 1B72B 3FHNA 1QQIA 1O7LA 1RETA 2D1HA 2DXIA 3LSKA 3OIOA 2MW8A 2PMZN 4P55A 1KU2A 1MMNA 1G8XA 1GT0C 1QU3A 1Q1HA 2F5FA 2DFEA 2HFHA 2QA4I 1RR7A 1XG1A 4YELA 2DJIA 4BL0B 4O3MA 2PFBA 2MBFA 1N75A 2MSYA 2QSGX 5CYVA 2XB5A 1U9OA 3T5XA 4P9UA 2AXTC 2ZBKA 1U8BA 3COAC 3K0LA 3S3NA 3BR3A 3IAS2 3QU3A 2JSPA 3VB2A 2FXAA 4KFCA 3GYHX 1VQ8I 1W5SA 4LIVA 1FPQA 1R49A 4PZJA 1HLVA 5IP6A 1F4KA 1M1EB 1IF1A 5IY5H 1SFOJ 3W6VA 4B3XA 4FT8A 2ZJQF 5DS9A 2CU7A 3GFJA 2MH9A 2E7XA 5DD8A 1XMKA 2DODA 3PSIA 4FX4A 1Y8RB 1I6XA 3PNVA 3TO7A 1X4PA 5LRSA 4KYWA 1LJ9A 2OV7A 1FX7A 2ESHA 4U7DA 4HQEA 4QPOA 2HXOA 4B1RA 2Y48A 5FFZA 1B59A 2UZKA 3MCZA 1NTCA 5HDGA 3ZMUA 2A68F 4IJAA 3IKTA 4UB8C 2OUMA 2L54A 2DK5A 2XAUA 4LIUA 1Y56A 4CCJA 3JTGA 1PVEA 3TOBA 1HSTA 1SFKA 1XSVA 1HSJA 2Y30A 4PGHA 3NARA 1IN4A 3F8MA 3WTYC 2VPLA 4LK0F 2YU3A 4JK1X 1ETOA 5HLTA 4LK1F 3HPGA 1QNTA 3OYAA 2LH9A 2PQ8A 2LY2A 3K1PA 3BZCA 3MMYB 1W7PA 3OIPA 3M3YJ 3QPSA 3C1DA 1BR1A 3H35A 3HSEA 1D0YA 4UHTA 2YX4A 3CO7C 4I98B 4RAFA 4UNOA 3QOEA 4BYYA 2E2IJ 2FQ3A 4RB3C 1OKRA 3KP4A 4XRFA 3V7RA 2IJLA
chains in the Genus database with same CATH topology
3LA3A 3G3ZA 3WE3A 1J5YA 4WF2A 5BOXA 1H0MA 1XB4A 4G6DA 1FP1D 4P96A 2HYGD 3QOPA 4WK8F 1J75A 2HDCA 1V4RA 3GUDA 5D5UB 2KIMA 3KEQA 1ON2A 4HBLA 1U6GA 1FZPB 1I1SA 2HGCA 1SMTA 4I09A 4F7ZA 3G73A 3D5LA 4HLXA 1KYZA 1DP7P 3ML6A 4K2EA 4EM2A 3SFZA 3WU0A 2A3SA 5E17F 3QPHA 3T8TA 1B9NA 3PQJA 3J80K 1LDJA 3WG9A 4A5MA 3DV8A 4IRHA 2KRFA 5KVRA 4S04A 4RS8A 1CF7B 1A04A 3JAMZ 5DD4A 1ZHFA 5HLHA 5DCMB 2ISYA 2RKHA 4OMYA 4WWCA 1BBYA 4NB5A 2O6GE 5L3FA 4AIKA 4KUMA 1BOAA 4WXDA 1ULYA 3JTHA 2VBZA 1XMAA 5HS9A 4LLGF 4CYDA 1TTYA 4EM1A 4EQQA 4YIFA 1O3QA 3J7AO 3BPXA 3ZQ7A 4I02A 5ILUA 4BNCA 3LQQA 3T8RA 3RPUA 2ZFWA 2DI3A 1QBJA 1F9NA 3W6KB 4AVPA 2XAJA 2V1UA 1XDSA 5CVJA 1OYIA 4HDUA 1YW7A 5JHUA 3TKYA 3WTVC 5DUIA 3ULQB 1O57A 4ETSA 1TNTA 3Q9VA 3LAJA 2ACJA 2DFIA 1QGPA 3HRTA 5D4RA 2HYFA 2DO7A 1S3JA 3SZPA 3WGHA 5LHIA 4ZZLA 2P5LC 3BPVA 3DEUA 1FYKA 4Y13A 1BI2A 2LF8A 2HTSA 5TRDA 4M9XA 5L3EA 4EJUA 2HEOA 3QRFF 3R6SA 4I7HA 3E5QA 4G6QA 4U88A 2Z99A 3TDZC 3GZ5A 5LEJA 3BWGA 4BHCA 3QAHA 4O5VA 2PMUA 4R8HA 1QZYA 5L3GA 3BJOA 1W7PB 3LA7A 4BXUA 4CDGA 1T6SA 3FXRA 3MEXA 3J81K 3L9FA 3L00A 2ZJ2A 2JPCA 1EH7A 4ZH4F 3IRQA 5E8IA 1ON1A 1BIBA 3MFKA 2C6YA 3KCCA 4BHBA 2BBYA 2FSWA 3GO5A 3FZVA 5BPDA 4HLYA 4R1HA 1JXSA 1YIOA 2NYXA 4UV9A 1YG2A 3KP3A 1R5GA 4A2UA 2DW4A 1XSDA 2M8EA 1R58A 1T0FA 2XAFA 1GXQA 2O8XA 4JBAA 2ZCWA 4MEXF 4HOBA 1HW1A 4EM0B 4LD5A 1WRJA 3B73A 2M5WA 3ZN1A 1D8JA 3KZZA 5LGTA 4CGZA 1ZRCA 2GIVA 1MGTA 3WODF 1LEBA 1RZ4A 2KJBA 4Q47A 2A61A 3RDIA 2WWYA 1B4AA 3HSRA 1AOYA 1IXSB 1RI7A 2P8TA 2FEZA 1D8KA 3CJNA 2CW0F 5CVIA 3VOEA 1JHFA 4XSXF 1W7PD 4HAMA 3Q9SA 2DAOA 2DPUA 1ONVA 1FP2A 3FHZA 1S7AA 1XDUA 3U9GA 2VC0A 3RYPA 3DQVC 2NNYA 2KIFA 3S2WA 4L5IA 2L4AA 1FBQA 4LB5A 2HZTA 1TW3A 5CVUA 1U3EM 1YS7A 1Z1DA 1SMYF 2Z33A 4RGUA 3TO6A 3LA2A 4U7BA 1J2XA 2RQPA 4WXCA 1S7OA 2XRNA 3IHUA 4Y17A 3F8CA 3F6OA 2QQAA 5ILSA 2LNBA 5DDGA 5CLSA 1MJAA 4XLPF 2BYVE 2VT2A 5KK1A 5AIQA 2W85A 1B1BA 1HBXG 1ZG1A 4M74A 3BJAA 1XGOA 3HTSB 2HOEA 4WX9A 4EJWA 1SD4A 2OQGA 3L7WA 3HTUA 5HVQC 2KIUA 2K4JA 2FBHA 2GQQA 4I01A 5K5QA 2OU2A 1P6RA 1XSXA 1U5TC 1SFXA 1D5VA 3QU6A 4RB0A 2VBXA 2PG4A 3HOSA 2HQNA 4OU0A 4P9FA 5E1ZB 3ZMZA 1ZLJA 2PJPA 3F72A 4G94A 4G8XA 1FSEA 4CICA 5FGMA 2OQRA 3RI4A 1NHAA 2COMA 4ZZDA 1Y0UA 5K5RA 1G3TA 1FNNA 3EUHA 4YFXF 5DEQA 3V7CA 2RC4A 1XCBA 3O2PE 2TDXA 4NQWA 1T2KA 2MC3A 3M8FA 2FBIA 1ZG3A 3OOPA 4MEYF 5DCMA 1BM9A 3J81Z 4AWXB 1P2FA 5FO5A 4UVAA 4ENJA 5ILVA 2M1BA 5TJJA 4L5JA 2HKOA 3IWFA 1LDKB 5H6QA 3LWFA 2BGCA 1SD6A 4HZFA 3I4PA 1LB2A 1R7JA 2IA0A 4LLLA 1W4MA 2J5OA 1Z6RA 5D4SA 1TQMA 2ZNYA 4L9NA 1IN6A 4EJTA 4I0BA 2Z3YA 5L3CA 1PDNC 4Y15A 1R36A 2HS5A 3KP6A 2MH2A 4LB6B 1FBSA 2HR3A 2XVCA 1R23A 2FNPA 3GWZA 2F5DA 2XHKA 5BS6A 3E6DA 2M45A 2IW5A 1ZN2A 2QENA 5LRRA 3MZYA 1FLIA 3WGIA 3K1MA 1WI9A 1ZRDA 4WXHA 4ESJA 2FBKA 1YFHA 1XN7A 4A0YA 4Q48A 1V3FA 3E6CC 3VFZA 1U78A 2XAQA 1UFMA 1LEAA 4A5NA 2YSRA 1K7AA 1EH6A 2QQBA 5E18F 4IRGA 5FD6A 1Z6TA 2L3DA 1YYVA 2EFQA 2GZWA 3L09A 1GXPA 5CVRA 1YW8A 1WWXA 2DU9A 5A2QK 1R5HA 3HYIA 2X4HA 4MQ9F 2LDUA 3U1DA 1C0WA 4YFKF 1SD7A 4DNCA 3H3UA 3I58A 1D3YA 3C18A 1USTA 4B8XA 1J9IA 3H3ZA 3P9CA 1BI0A 3MZHA 4PCQA 5H20A 5JI6A 4I2OA 3CUOA 1XCVA 3GF2A 3C7JA 2K7LA 3BJ6A 1G4DA 1KGSA 3GXOA 3WTUC 2WTEA 2LKPA 3R4KA 3HOTA 1HW5A 4BHPA 2W57A 4EVIA 3SHFA 3GEZA 3P7NA 2W25A 4KN7X 5LEKA 2YR2A 3MAJA 4GO1A 3EQLF 3E6BA 2AXLA 3DF8A 3MWMA 1G3YA 2M30A 1F5TA 4L0YB 5JVTA 4ZYDA 2QVOA 4EMSA 5IT9K 2XGXA 1X3UA 3ECHA 4ENMA 2GAUA 1F1ZA 3TDUC 2EB7A 5FFXA 4HW0A 5IT3A 1Z91A 2HWVA 5LBQA 3IKVA 1OYYA 1W5TA 3K9TA 3I54A 2JPBA 2NRAC 2K4BA 1IW7F 2FNAA 2VT3A 2CG4A 3RJPA 1YTYA 3R61A 5ERIA 3I59A 5HDKA 2Q8KA 5FB2A 5ICEA 3NEUA 2IVMA 4ESBA 3SQNA 2XKPA 4D0PA 2WC2A 3TO9A 3I0TA 2M87A 2QZ8A 2GXGA 1IZ1A 4A0ZA 4KIFA 4HQMA 1FY7A 3ERED 1MJ9A 4HF2A 1U5TB 4LMYA 1WQ2A 2QLZA 1PP7U 2JTVA 3E3VA 4IHSA 3NRVA 3W6JB 5H6RA 2DK8A 5J6XA 1O3TA 3HUGA 4ENNA 2EK5A 4AIHA 2P4WA 2OZUA 1KU7A 4KDPA 5BMZA 4U0YA 2LF7A 2DTRA 1K79A 1R1UA 2CO5A 1B6AA 3ECOA 2FE3A 5LLQA 3SZTA 2VE8A 1RUNA 1R00A 3FX3A 4CO8A 3HRMA 2MLGA 4QWQA 3KETA 1BJAA 2H6BA 3V4GA 3NQOA 2ESNA 2RN7A 5LHGA 5A2QZ 4ZYHA 3KLOA 3E5XA 2F5EA 1HQCA 5E1WA 2DLLA 2P6TA 1RUOA 1DPUA 5HDNA 1UB9A 2D1VA 4DQ2A 2ELHA 4U0VA 2V1DA 3OV8A 2STWA 4HX8A 1YLFA 3GFMA 1Z7UA 2P5KA 5HS8A 3RKXA 3P9KA 4GGGA 4OOIA 3B02A 2KKOA 3L2CA 1UHMA 2PBIA 3GFLA 3AAFA 5HOOA 2Y0MA 3I71A 4KN4X 1SFEA 3DFGA 3ZN0A 5E20A 1U2WA 2UXNA 1ZRFA 3D0SA 2EV0A 3HRSA 3ZMVA 2HKXA 4RAZA 4RGRA 5IT9Z 1QO0D 5BPIA 2JRTA 4A6DA 4M9SA 1FC3A 3R60A 1K6OA 3CUQC 1TQIA 3REOA 1GHCA 3BOQA 2P5VA 2ZNZA 2W24A 2OZ6A 5DCFA 3KP5A 4HYEA 4AIJA 3KP7A 1T38A 1LDDA 2XIGA 3I59B 4ZYEA 2P7CB 2FF4A 3WE2A 3GX4X 2R3SA 4TV7A 4HF1A 5D5WB 1SD5A 1ZGAA 1KA8A 2L4MA 3HRUA 4B09A 1R22A 3Q5FA 2YPRA 2RNJA 3EYIA 4BQAA 1GVJA 4IHTA 2L02A 4LFUA 3DPLC 4BAYA 5JFRA 3WTZA 4UVCA 3QP5A 3FMSA 4ENKA 2STTA 3KFWX 1FBUA 3FMQA 5L3DA 4R79A 2FRHA 4N9HA 1ZYRF 2ZMEB 4YG2F 3O3KA 2EFOA 4EJVA 2V1XA 3T0YA 4M71A 2BEOA 2ADUA 3LSTA 1TQPA 4L9JA 1S8NA 3FXQA 2MA3A 2VBYA 4OIQF 2BE5F 3E6MA 4OINF 4EV0A 3N97A 4FHTA 1O3SA 1T39A 1FWZA 3TGNA 1KQ9A 4L9TA 4LJZF 2VE9A 1IRGA 2E7WA 2O03A 4MHGA 1BI1A 4LG0B 4LLNA 1WKMA 3HIFA 2OAZA 1G3SA 2ISZA 2OD5A 2CQKA 2E1NA 1SAXA 1IUYA 3RKWA 4EJOA 5FLXZ 4HX4A 5K1YA 2CGPA 1DDNA 2RDPA 5DYMA 5AONA 1ZREA 5ICCA 4S05A 1I1GA 2ZO4A 3CUQA 2JT1A 2NAZA 1OMIA 1KU9A 1KYWA 2OBPA 1IXRC 2O61A 3GFIA 4XSZF 5EEGA 3ZPLA 1PUEE 4YFNF 3KEOA 3RYRA 3DXJF 5CVVA 3CTAA 3E5UA 2DQLA 3V8JA 2WV0A 2EV6A 3IC7A 2KJCA 2QYOA 2UXXA 1DPRA 5D5XB 1QZZA 2CWEA 3K69A 2P7VB 2HQRA 2PMHA 1U8RA 1U5TA 3BROA 3ZP5A 5D8LB 2CFXA 2F2EA 5AIPA 2EJRA 2QBYA 1BN5A 3KP2A 2F5CA 3KE2A 4Q5SF 3P9IA 4RB2C 2Q0OA 2O0YA 3FM3A 4HV5A 4ASNA 1L3LA 2QM3A 4E70A 2FOKA 4HX7A 2Z9OA 4HDVA 1RIOH 1EV7A 3V8LA 5JR3A 1MDMA 5HLGA 2UWMA 2VN2A 1ZG5A 2G9WA 1DUXC 1ZGJA 1TNSA 5D8KB 4KMUX 3JSPA 2PEXA 3F23A 4CXFA 1YO5C 1KQ0A 5HLIA 1P4WA 2XAHA 4M73A 4M6XA 4XLNF 3T1BA 1S6LA 4XBFA 5EEHA 1G6NA 1O7FA 3ELKA 3SXYA 1P92A 5BQTA 3IRRA 3HSFA 2DT5A 3TOAA 4EGYA 3WTWC 1MKMA 1MD0A 2A5YB 1TLHB 2D45A 1IXCA 4IPAA 3MQ0A 2NNNA 3RPQA 3U2RA 3HHHA 5J8CA 1BIAA 3EYYA 4Q4ZF 3GW2A 5D6FA 1BI3A 1Z05A 2VXZA 1H9TA 5E8GA 5LGUA 3HHGA 4ZYGA 4GYGA 3V8KA 2H6CA 4KA4A 3ABTA 1IRFA 2FA5A 4N0BA 2H27A 1XGSA 4FX0A 4O6JA 2K02A 1RNLA 2EWNA 2HTJA 2XASA 3ZMTA 1MJBA 3TQNA 4A6EA 2ZKZA 3ABUA 1ZLKA 1IN8A 4IXAA 3N4MA 2X0LA 4ON0A 5ICGA 1EH8A 1K78A 3CUQB 1FT9A 3LFKA 2GA2A 2B0LA 1J0RA 3IWZA 1YS6A 4RB1A 2K86A 5F1RA 2GA1A 2W84A 3I53A 3CDHA 4WCGA 4UXNA 1OPCA 5D5VB 2A6EF 1FOKA 2RV8A 3FF5A 1OR7A 2CYYA 2FMYA 3BP8A 2IP2A 4G9YA 5F6FA 2EA2A 2PI0A 1PP8F 4G7OF 4GCVA 2MD5A 2PLYA 2EA4A 3CO6C 4HF0A 3F3XA 2VONA 2IA1A 2A69F 2R7FA 2VODA 2JZYA 2ZMEA 1REPC 3M9AA 2QBYB 1Z9CA 3K1NA 3ROUA 2EFWA 5F64A 3KLNA 4MQVA 2IT0A 2YX7A 4KNYA 3C3WA 5D6EA 3F6VA 3GLXA 1R1TA 1ZH5A 1P4XA 3DPTA 3FMRA 4MTDA 4IRIA 2OA4A 3JW4A 4MGRA 1MDMB 4M9ZA 3F8FA 3H92A 1FSHA 3PQKA 4LG0A 1P4AA 2QUFA 4KIGA 2GWRA 5FLXK 1JHHA 3WTXC 1IAWA 1TW2A 1R1VA 2Q2EA 2Y75A 2IPQX 1LVAA 4GYIA 2G7UA 3ISPA 1L0OC 5LGNA 1MZBA 4L0ZB 1S29A 2K27A 3RIRA 2FMLA 3R0JA 1J7KA 2XAGA 4UVBA 2L01A 1IN5A 1USSA 5CJ9A 2Z5UA 1ODDA 3O6BB 3F8NA 2V79A 3FWEA 3M1EA 1BC7C 1JGSA 5L3BA 4HV6A 4Z2YA 2CSOA 4P5OA 4LGWA 5J8FA 3LAPA 1SFUA 4G7ZF 2D2WA 4EGZA 2DBBA 1QPMA 1XGMA 2FU4A 4KICA 4RGSA 4MTEA 3FXUA 3DP7A 1JE8A 2IA2A 3K2ZA 4H0EA 3PFIA 1TBXA 2DQRA 5HS7A 4ESFA 1HKQA 3EDPA 2XROA 2LSOA 1J59A 3FM5A 1XGNA 2QQ9A 1WSUA 2G7HA 4PGGA 2NS0A 4KMFA 3J80Z 1XD7A 2XKOA 1YW9A 2V9VA 3EETA 1UHWA 1K78B 1H9GA 2R7DA 4OIOF 3E97A 1B9MA 2AS5F 4G7HF 1LNWA 4MNUA 1ZARA 4M72A 1ZAOA 2J5PA 3WGGA 3CLOA 2V6CA 1AWCA 4NHJA 2VBWA 2VOPA 1VTNC 4IVNA 1HXDA 1STZA 1HKTA 4CHUA 2XV4S 4AD9A 3ZMSA 4L9VA 3M8EA 2VC1A 4N9IA 5DV5A 2A07F 3QPTA 3WTSC 3RKYA 3WTTC 3F22A 4PDKA 2EFPA 2RGVA 4I0AA 1HKSA 2EV5A 3BY6A 4YIIA 5E1XA 4UUVA 2E1CA 1T98A 4UV8A 5ICFA 4L18B 3DKWA 3RTRA 3QP6A 2MLKA 4M6YA 4KIBA 3F21A 4A12A 1O3RA 4KT5C 1I5ZA 2H09A 2GXBA 4QLCU 1E2XA 2O3FA 2EFNA 3IL2A 4BH9A 3F8BA 1G3WA 3GZ6A 1FYLA 1CGPA 3BZ6A 3M7GA 5ED4A 3KZYA 4IF4A 4U0WA 4OIRF 5DUKA 6PAXA 2ZXJA 4HA8A 2VOOA 4OMZA 3LQRA 4A0XA 5FD5A 2QWWA 3JAMK 3JSOA 3VODA 5LHHA 2RVCA 2ETHA 4GXOA 1LQ1A 1BC8C 1CF7A 2A6HF 3R0AA 4CZZA 2XUBA 2P6SA 3I64A 3GVAA 2IRFG 2PN6A 2BV6A 2JSCA 2DPDA 3ZMDA 3V7SA 4RAYA 1FYMA 1HW2A 1YQAA 4JQFA 1KU3A 1IN7A 1KQ8A 2H94A 5K5OA 1E17A 1I27A 3BDDA 4RGXA 1OYWA 3VEPA 4OIPF 1UCRA 3WU1B 3I5UA 1QQIA 1O7LA 2D1HA 4P55A 1KU2A 1Q1HA 2F5FA 2HFHA 4O3MA 2PFBA 2MBFA 5CYVA 4P9UA 3T5XA 2ZBKA 3COAC 3K0LA 3QU3A 3VB2A 4KFCA 2FXAA 3GYHX 1W5SA 1FPQA 4PZJA 1F4KA 1IF1A 4FT8A 3GFJA 2MH9A 2E7XA 5DD8A 1XMKA 4FX4A 1I6XA 3TO7A 5LRSA 4KYWA 1LJ9A 1FX7A 2ESHA 4U7DA 4HQEA 5FFZA 2Y48A 1B59A 2UZKA 3MCZA 5HDGA 3ZMUA 2A68F 4IJAA 3IKTA 2L54A 2DK5A 3JTGA 3TOBA 1HSTA 1XSVA 1HSJA 4PGHA 1IN4A 3F8MA 3WTYC 4LK0F 2YU3A 4JK1X 4LK1F 1QNTA 2PQ8A 3K1PA 1W7PA 3C1DA 3HSEA 4UHTA 2YX4A 3CO7C 4I98B 4UNOA 4BYYA 2FQ3A 4RB3C 1OKRA 3KP4A 4XRFA 3V7RA 2IJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA3 A;  3G3Z A;  3WE3 A;  1J5Y A;  4WF2 A;  5BOX A;  1H0M A;  1XB4 A;  4G6D A;  1FP1 D;  4P96 A;  2HYG D;  3QOP A;  4WK8 F;  1J75 A;  2HDC A;  1V4R A;  3GUD A;  5D5U B;  2KIM A;  3KEQ A;  1ON2 A;  4HBL A;  1U6G A;  1FZP B;  1I1S A;  2HGC A;  1SMT A;  4I09 A;  4F7Z A;  3G73 A;  3D5L A;  4HLX A;  1KYZ A;  1DP7 P;  3ML6 A;  4K2E A;  4EM2 A;  3SFZ A;  3WU0 A;  2A3S A;  5E17 F;  3QPH A;  3T8T A;  1B9N A;  3PQJ A;  3J80 K;  1LDJ A;  3WG9 A;  4A5M A;  3DV8 A;  4IRH A;  2KRF A;  5KVR A;  4S04 A;  4RS8 A;  1CF7 B;  1A04 A;  3JAM Z;  5DD4 A;  1ZHF A;  5HLH A;  5DCM B;  2ISY A;  2RKH A;  4OMY A;  4WWC A;  1BBY A;  4NB5 A;  2O6G E;  5L3F A;  4AIK A;  4KUM A;  1BOA A;  4WXD A;  1ULY A;  3JTH A;  2VBZ A;  1XMA A;  5HS9 A;  4LLG F;  4CYD A;  1TTY A;  4EM1 A;  4EQQ A;  4YIF A;  1O3Q A;  3J7A O;  3BPX A;  3ZQ7 A;  4I02 A;  5ILU A;  4BNC A;  3LQQ A;  3T8R A;  3RPU A;  2ZFW A;  2DI3 A;  1QBJ A;  1F9N A;  3W6K B;  4AVP A;  2XAJ A;  2V1U A;  1XDS A;  5CVJ A;  1OYI A;  4HDU A;  1YW7 A;  5JHU A;  3TKY A;  3WTV C;  5DUI A;  3ULQ B;  1O57 A;  4ETS A;  1TNT A;  3Q9V A;  3LAJ A;  2ACJ A;  2DFI A;  1QGP A;  3HRT A;  5D4R A;  2HYF A;  2DO7 A;  1S3J A;  3SZP A;  3WGH A;  5LHI A;  4ZZL A;  2P5L C;  3BPV A;  3DEU A;  1FYK A;  4Y13 A;  1BI2 A;  2LF8 A;  2HTS A;  5TRD A;  4M9X A;  5L3E A;  4EJU A;  2HEO A;  3QRF F;  3R6S A;  4I7H A;  3E5Q A;  4G6Q A;  4U88 A;  2Z99 A;  3TDZ C;  3GZ5 A;  5LEJ A;  3BWG A;  4BHC A;  3QAH A;  4O5V A;  2PMU A;  4R8H A;  1QZY A;  5L3G A;  3BJO A;  1W7P B;  3LA7 A;  4BXU A;  4CDG A;  1T6S A;  3FXR A;  3MEX A;  3J81 K;  3L9F A;  3L00 A;  2ZJ2 A;  2JPC A;  1EH7 A;  4ZH4 F;  3IRQ A;  5E8I A;  1ON1 A;  1BIB A;  3MFK A;  2C6Y A;  3KCC A;  4BHB A;  2BBY A;  2FSW A;  3GO5 A;  3FZV A;  5BPD A;  4HLY A;  4R1H A;  1JXS A;  1YIO A;  2NYX A;  4UV9 A;  1YG2 A;  3KP3 A;  1R5G A;  4A2U A;  2DW4 A;  1XSD A;  2M8E A;  1R58 A;  1T0F A;  2XAF A;  1GXQ A;  2O8X A;  4JBA A;  2ZCW A;  4MEX F;  4HOB A;  1HW1 A;  4EM0 B;  4LD5 A;  1WRJ A;  3B73 A;  2M5W A;  3ZN1 A;  1D8J A;  3KZZ A;  5LGT A;  4CGZ A;  1ZRC A;  2GIV A;  1MGT A;  3WOD F;  1LEB A;  1RZ4 A;  2KJB A;  4Q47 A;  2A61 A;  3RDI A;  2WWY A;  1B4A A;  3HSR A;  1AOY A;  1IXS B;  1RI7 A;  2P8T A;  2FEZ A;  1D8K A;  3CJN A;  2CW0 F;  5CVI A;  3VOE A;  1JHF A;  4XSX F;  1W7P D;  4HAM A;  3Q9S A;  2DAO A;  2DPU A;  1ONV A;  1FP2 A;  3FHZ A;  1S7A A;  1XDU A;  3U9G A;  2VC0 A;  3RYP A;  3DQV C;  2NNY A;  2KIF A;  3S2W A;  4L5I A;  2L4A A;  1FBQ A;  4LB5 A;  2HZT A;  1TW3 A;  5CVU A;  1U3E M;  1YS7 A;  1Z1D A;  1SMY F;  2Z33 A;  4RGU A;  3TO6 A;  3LA2 A;  4U7B A;  1J2X A;  2RQP A;  4WXC A;  1S7O A;  2XRN A;  3IHU A;  4Y17 A;  3F8C A;  3F6O A;  2QQA A;  5ILS A;  2LNB A;  5DDG A;  5CLS A;  1MJA A;  4XLP F;  2BYV E;  2VT2 A;  5KK1 A;  5AIQ A;  2W85 A;  1B1B A;  1HBX G;  1ZG1 A;  4M74 A;  3BJA A;  1XGO A;  3HTS B;  2HOE A;  4WX9 A;  4EJW A;  1SD4 A;  2OQG A;  3L7W A;  3HTU A;  5HVQ C;  2KIU A;  2K4J A;  2FBH A;  2GQQ A;  4I01 A;  5K5Q A;  2OU2 A;  1P6R A;  1XSX A;  1U5T C;  1SFX A;  1D5V A;  3QU6 A;  4RB0 A;  2VBX A;  2PG4 A;  3HOS A;  2HQN A;  4OU0 A;  4P9F A;  5E1Z B;  3ZMZ A;  1ZLJ A;  2PJP A;  3F72 A;  4G94 A;  4G8X A;  1FSE A;  4CIC A;  5FGM A;  2OQR A;  3RI4 A;  1NHA A;  2COM A;  4ZZD A;  1Y0U A;  5K5R A;  1G3T A;  1FNN A;  3EUH A;  4YFX F;  5DEQ A;  3V7C A;  2RC4 A;  1XCB A;  3O2P E;  2TDX A;  4NQW A;  1T2K A;  2MC3 A;  3M8F A;  2FBI A;  1ZG3 A;  3OOP A;  4MEY F;  5DCM A;  1BM9 A;  3J81 Z;  4AWX B;  1P2F A;  5FO5 A;  4UVA A;  4ENJ A;  5ILV A;  2M1B A;  5TJJ A;  4L5J A;  2HKO A;  3IWF A;  1LDK B;  5H6Q A;  3LWF A;  2BGC A;  1SD6 A;  4HZF A;  3I4P A;  1LB2 A;  1R7J A;  2IA0 A;  4LLL A;  1W4M A;  2J5O A;  1Z6R A;  5D4S A;  1TQM A;  2ZNY A;  4L9N A;  1IN6 A;  4EJT A;  4I0B A;  2Z3Y A;  5L3C A;  1PDN C;  4Y15 A;  1R36 A;  2HS5 A;  3KP6 A;  2MH2 A;  4LB6 B;  1FBS A;  2HR3 A;  2XVC A;  1R23 A;  2FNP A;  3GWZ A;  2F5D A;  2XHK A;  5BS6 A;  3E6D A;  2M45 A;  2IW5 A;  1ZN2 A;  2QEN A;  5LRR A;  3MZY A;  1FLI A;  3WGI A;  3K1M A;  1WI9 A;  1ZRD A;  4WXH A;  4ESJ A;  2FBK A;  1YFH A;  1XN7 A;  4A0Y A;  4Q48 A;  1V3F A;  3E6C C;  3VFZ A;  1U78 A;  2XAQ A;  1UFM A;  1LEA A;  4A5N A;  2YSR A;  1K7A A;  1EH6 A;  2QQB A;  5E18 F;  4IRG A;  5FD6 A;  1Z6T A;  2L3D A;  1YYV A;  2EFQ A;  2GZW A;  3L09 A;  1GXP A;  5CVR A;  1YW8 A;  1WWX A;  2DU9 A;  5A2Q K;  1R5H A;  3HYI A;  2X4H A;  4MQ9 F;  2LDU A;  3U1D A;  1C0W A;  4YFK F;  1SD7 A;  4DNC A;  3H3U A;  3I58 A;  1D3Y A;  3C18 A;  1UST A;  4B8X A;  1J9I A;  3H3Z A;  3P9C A;  1BI0 A;  3MZH A;  4PCQ A;  5H20 A;  5JI6 A;  4I2O A;  3CUO A;  1XCV A;  3GF2 A;  3C7J A;  2K7L A;  3BJ6 A;  1G4D A;  1KGS A;  3GXO A;  3WTU C;  2WTE A;  2LKP A;  3R4K A;  3HOT A;  1HW5 A;  4BHP A;  2W57 A;  4EVI A;  3SHF A;  3GEZ A;  3P7N A;  2W25 A;  4KN7 X;  5LEK A;  2YR2 A;  3MAJ A;  4GO1 A;  3EQL F;  3E6B A;  2AXL A;  3DF8 A;  3MWM A;  1G3Y A;  2M30 A;  1F5T A;  4L0Y B;  5JVT A;  4ZYD A;  2QVO A;  4EMS A;  5IT9 K;  2XGX A;  1X3U A;  3ECH A;  4ENM A;  2GAU A;  1F1Z A;  3TDU C;  2EB7 A;  5FFX A;  4HW0 A;  5IT3 A;  1Z91 A;  2HWV A;  5LBQ A;  3IKV A;  1OYY A;  1W5T A;  3K9T A;  3I54 A;  2JPB A;  2NRA C;  2K4B A;  1IW7 F;  2FNA A;  2VT3 A;  2CG4 A;  3RJP A;  1YTY A;  3R61 A;  5ERI A;  3I59 A;  5HDK A;  2Q8K A;  5FB2 A;  5ICE A;  3NEU A;  2IVM A;  4ESB A;  3SQN A;  2XKP A;  4D0P A;  2WC2 A;  3TO9 A;  3I0T A;  2M87 A;  2QZ8 A;  2GXG A;  1IZ1 A;  4A0Z A;  4KIF A;  4HQM A;  1FY7 A;  3ERE D;  1MJ9 A;  4HF2 A;  1U5T B;  4LMY A;  1WQ2 A;  2QLZ A;  1PP7 U;  2JTV A;  3E3V A;  4IHS A;  3NRV A;  3W6J B;  5H6R A;  2DK8 A;  5J6X A;  1O3T A;  3HUG A;  4ENN A;  2EK5 A;  4AIH A;  2P4W A;  2OZU A;  1KU7 A;  4KDP A;  5BMZ A;  4U0Y A;  2LF7 A;  2DTR A;  1K79 A;  1R1U A;  2CO5 A;  1B6A A;  3ECO A;  2FE3 A;  5LLQ A;  3SZT A;  2VE8 A;  1RUN A;  1R00 A;  3FX3 A;  4CO8 A;  3HRM A;  2MLG A;  4QWQ A;  3KET A;  1BJA A;  2H6B A;  3V4G A;  3NQO A;  2ESN A;  2RN7 A;  5LHG A;  5A2Q Z;  4ZYH A;  3KLO A;  3E5X A;  2F5E A;  1HQC A;  5E1W A;  2DLL A;  2P6T A;  1RUO A;  1DPU A;  5HDN A;  1UB9 A;  2D1V A;  4DQ2 A;  2ELH A;  4U0V A;  2V1D A;  3OV8 A;  2STW A;  4HX8 A;  1YLF A;  3GFM A;  1Z7U A;  2P5K A;  5HS8 A;  3RKX A;  3P9K A;  4GGG A;  4OOI A;  3B02 A;  2KKO A;  3L2C A;  1UHM A;  2PBI A;  3GFL A;  3AAF A;  5HOO A;  2Y0M A;  3I71 A;  4KN4 X;  1SFE A;  3DFG A;  3ZN0 A;  5E20 A;  1U2W A;  2UXN A;  1ZRF A;  3D0S A;  2EV0 A;  3HRS A;  3ZMV A;  2HKX A;  4RAZ A;  4RGR A;  5IT9 Z;  1QO0 D;  5BPI A;  2JRT A;  4A6D A;  4M9S A;  1FC3 A;  3R60 A;  1K6O A;  3CUQ C;  1TQI A;  3REO A;  1GHC A;  3BOQ A;  2P5V A;  2ZNZ A;  2W24 A;  2OZ6 A;  5DCF A;  3KP5 A;  4HYE A;  4AIJ A;  3KP7 A;  1T38 A;  1LDD A;  2XIG A;  3I59 B;  4ZYE A;  2P7C B;  2FF4 A;  3WE2 A;  3GX4 X;  2R3S A;  4TV7 A;  4HF1 A;  5D5W B;  1SD5 A;  1ZGA A;  1KA8 A;  2L4M A;  3HRU A;  4B09 A;  1R22 A;  3Q5F A;  2YPR A;  2RNJ A;  3EYI A;  4BQA A;  1GVJ A;  4IHT A;  2L02 A;  4LFU A;  3DPL C;  4BAY A;  5JFR A;  3WTZ A;  4UVC A;  3QP5 A;  3FMS A;  4ENK A;  2STT A;  3KFW X;  1FBU A;  3FMQ A;  5L3D A;  4R79 A;  2FRH A;  4N9H A;  1ZYR F;  2ZME B;  4YG2 F;  3O3K A;  2EFO A;  4EJV A;  2V1X A;  3T0Y A;  4M71 A;  2BEO A;  2ADU A;  3LST A;  1TQP A;  4L9J A;  1S8N A;  3FXQ A;  2MA3 A;  2VBY A;  4OIQ F;  2BE5 F;  3E6M A;  4OIN F;  4EV0 A;  3N97 A;  4FHT A;  1O3S A;  1T39 A;  1FWZ A;  3TGN A;  1KQ9 A;  4L9T A;  4LJZ F;  2VE9 A;  1IRG A;  2E7W A;  2O03 A;  4MHG A;  1BI1 A;  4LG0 B;  4LLN A;  1WKM A;  3HIF A;  2OAZ A;  1G3S A;  2ISZ A;  2OD5 A;  2CQK A;  2E1N A;  1SAX A;  1IUY A;  3RKW A;  4EJO A;  5FLX Z;  4HX4 A;  5K1Y A;  2CGP A;  1DDN A;  2RDP A;  5DYM A;  5AON A;  1ZRE A;  5ICC A;  4S05 A;  1I1G A;  2ZO4 A;  3CUQ A;  2JT1 A;  2NAZ A;  1OMI A;  1KU9 A;  1KYW A;  2OBP A;  1IXR C;  2O61 A;  3GFI A;  4XSZ F;  5EEG A;  3ZPL A;  1PUE E;  4YFN F;  3KEO A;  3RYR A;  3DXJ F;  5CVV A;  3CTA A;  3E5U A;  2DQL A;  3V8J A;  2WV0 A;  2EV6 A;  3IC7 A;  2KJC A;  2QYO A;  2UXX A;  1DPR A;  5D5X B;  1QZZ A;  2CWE A;  3K69 A;  2P7V B;  2HQR A;  2PMH A;  1U8R A;  1U5T A;  3BRO A;  3ZP5 A;  5D8L B;  2CFX A;  2F2E A;  5AIP A;  2EJR A;  2QBY A;  1BN5 A;  3KP2 A;  2F5C A;  3KE2 A;  4Q5S F;  3P9I A;  4RB2 C;  2Q0O A;  2O0Y A;  3FM3 A;  4HV5 A;  4ASN A;  1L3L A;  2QM3 A;  4E70 A;  2FOK A;  4HX7 A;  2Z9O A;  4HDV A;  1RIO H;  1EV7 A;  3V8L A;  5JR3 A;  1MDM A;  5HLG A;  2UWM A;  2VN2 A;  1ZG5 A;  2G9W A;  1DUX C;  1ZGJ A;  1TNS A;  5D8K B;  4KMU X;  3JSP A;  2PEX A;  3F23 A;  4CXF A;  1YO5 C;  1KQ0 A;  5HLI A;  1P4W A;  2XAH A;  4M73 A;  4M6X A;  4XLN F;  3T1B A;  1S6L A;  4XBF A;  5EEH A;  1G6N A;  1O7F A;  3ELK A;  3SXY A;  1P92 A;  5BQT A;  3IRR A;  3HSF A;  2DT5 A;  3TOA A;  4EGY A;  3WTW C;  1MKM A;  1MD0 A;  2A5Y B;  1TLH B;  2D45 A;  1IXC A;  4IPA A;  3MQ0 A;  2NNN A;  3RPQ A;  3U2R A;  3HHH A;  5J8C A;  1BIA A;  3EYY A;  4Q4Z F;  3GW2 A;  5D6F A;  1BI3 A;  1Z05 A;  2VXZ A;  1H9T A;  5E8G A;  5LGU A;  3HHG A;  4ZYG A;  4GYG A;  3V8K A;  2H6C A;  4KA4 A;  3ABT A;  1IRF A;  2FA5 A;  4N0B A;  2H27 A;  1XGS A;  4FX0 A;  4O6J A;  2K02 A;  1RNL A;  2EWN A;  2HTJ A;  2XAS A;  3ZMT A;  1MJB A;  3TQN A;  4A6E A;  2ZKZ A;  3ABU A;  1ZLK A;  1IN8 A;  4IXA A;  3N4M A;  2X0L A;  4ON0 A;  5ICG A;  1EH8 A;  1K78 A;  3CUQ B;  1FT9 A;  3LFK A;  2GA2 A;  2B0L A;  1J0R A;  3IWZ A;  1YS6 A;  4RB1 A;  2K86 A;  5F1R A;  2GA1 A;  2W84 A;  3I53 A;  3CDH A;  4WCG A;  4UXN A;  1OPC A;  5D5V B;  2A6E F;  1FOK A;  2RV8 A;  3FF5 A;  1OR7 A;  2CYY A;  2FMY A;  3BP8 A;  2IP2 A;  4G9Y A;  5F6F A;  2EA2 A;  2PI0 A;  1PP8 F;  4G7O F;  4GCV A;  2MD5 A;  2PLY A;  2EA4 A;  3CO6 C;  4HF0 A;  3F3X A;  2VON A;  2IA1 A;  2A69 F;  2R7F A;  2VOD A;  2JZY A;  2ZME A;  1REP C;  3M9A A;  2QBY B;  1Z9C A;  3K1N A;  3ROU A;  2EFW A;  5F64 A;  3KLN A;  4MQV A;  2IT0 A;  2YX7 A;  4KNY A;  3C3W A;  5D6E A;  3F6V A;  3GLX A;  1R1T A;  1ZH5 A;  1P4X A;  3DPT A;  3FMR A;  4MTD A;  4IRI A;  2OA4 A;  3JW4 A;  4MGR A;  1MDM B;  4M9Z A;  3F8F A;  3H92 A;  1FSH A;  3PQK A;  4LG0 A;  1P4A A;  2QUF A;  4KIG A;  2GWR A;  5FLX K;  1JHH A;  3WTX C;  1IAW A;  1TW2 A;  1R1V A;  2Q2E A;  2Y75 A;  2IPQ X;  1LVA A;  4GYI A;  2G7U A;  3ISP A;  1L0O C;  5LGN A;  1MZB A;  4L0Z B;  1S29 A;  2K27 A;  3RIR A;  2FML A;  3R0J A;  1J7K A;  2XAG A;  4UVB A;  2L01 A;  1IN5 A;  1USS A;  5CJ9 A;  2Z5U A;  1ODD A;  3O6B B;  3F8N A;  2V79 A;  3FWE A;  3M1E A;  1BC7 C;  1JGS A;  5L3B A;  4HV6 A;  4Z2Y A;  2CSO A;  4P5O A;  4LGW A;  5J8F A;  3LAP A;  1SFU A;  4G7Z F;  2D2W A;  4EGZ A;  2DBB A;  1QPM A;  1XGM A;  2FU4 A;  4KIC A;  4RGS A;  4MTE A;  3FXU A;  3DP7 A;  1JE8 A;  2IA2 A;  3K2Z A;  4H0E A;  3PFI A;  1TBX A;  2DQR A;  5HS7 A;  4ESF A;  1HKQ A;  3EDP A;  2XRO A;  2LSO A;  1J59 A;  3FM5 A;  1XGN A;  2QQ9 A;  1WSU A;  2G7H A;  4PGG A;  2NS0 A;  4KMF A;  3J80 Z;  1XD7 A;  2XKO A;  1YW9 A;  2V9V A;  3EET A;  1UHW A;  1K78 B;  1H9G A;  2R7D A;  4OIO F;  3E97 A;  1B9M A;  2AS5 F;  4G7H F;  1LNW A;  4MNU A;  1ZAR A;  4M72 A;  1ZAO A;  2J5P A;  3WGG A;  3CLO A;  2V6C A;  1AWC A;  4NHJ A;  2VBW A;  2VOP A;  1VTN C;  4IVN A;  1HXD A;  1STZ A;  1HKT A;  4CHU A;  2XV4 S;  4AD9 A;  3ZMS A;  4L9V A;  3M8E A;  2VC1 A;  4N9I A;  5DV5 A;  2A07 F;  3QPT A;  3WTS C;  3RKY A;  3WTT C;  3F22 A;  4PDK A;  2EFP A;  2RGV A;  4I0A A;  1HKS A;  2EV5 A;  3BY6 A;  4YII A;  5E1X A;  4UUV A;  2E1C A;  1T98 A;  4UV8 A;  5ICF A;  4L18 B;  3DKW A;  3RTR A;  3QP6 A;  2MLK A;  4M6Y A;  4KIB A;  3F21 A;  4A12 A;  1O3R A;  4KT5 C;  1I5Z A;  2H09 A;  2GXB A;  4QLC U;  1E2X A;  2O3F A;  2EFN A;  3IL2 A;  4BH9 A;  3F8B A;  1G3W A;  3GZ6 A;  1FYL A;  1CGP A;  3BZ6 A;  3M7G A;  5ED4 A;  3KZY A;  4IF4 A;  4U0W A;  4OIR F;  5DUK A;  6PAX A;  2ZXJ A;  4HA8 A;  2VOO A;  4OMZ A;  3LQR A;  4A0X A;  5FD5 A;  2QWW A;  3JAM K;  3JSO A;  3VOD A;  5LHH A;  2RVC A;  2ETH A;  4GXO A;  1LQ1 A;  1BC8 C;  1CF7 A;  2A6H F;  3R0A A;  4CZZ A;  2XUB A;  2P6S A;  3I64 A;  3GVA A;  2IRF G;  2PN6 A;  2BV6 A;  2JSC A;  2DPD A;  3ZMD A;  3V7S A;  4RAY A;  1FYM A;  1HW2 A;  1YQA A;  4JQF A;  1KU3 A;  1IN7 A;  1KQ8 A;  2H94 A;  5K5O A;  1E17 A;  1I27 A;  3BDD A;  4RGX A;  1OYW A;  3VEP A;  4OIP F;  1UCR A;  3WU1 B;  3I5U A;  1QQI A;  1O7L A;  2D1H A;  4P55 A;  1KU2 A;  1Q1H A;  2F5F A;  2HFH A;  4O3M A;  2PFB A;  2MBF A;  5CYV A;  4P9U A;  3T5X A;  2ZBK A;  3COA C;  3K0L A;  3QU3 A;  3VB2 A;  4KFC A;  2FXA A;  3GYH X;  1W5S A;  1FPQ A;  4PZJ A;  1F4K A;  1IF1 A;  4FT8 A;  3GFJ A;  2MH9 A;  2E7X A;  5DD8 A;  1XMK A;  4FX4 A;  1I6X A;  3TO7 A;  5LRS A;  4KYW A;  1LJ9 A;  1FX7 A;  2ESH A;  4U7D A;  4HQE A;  5FFZ A;  2Y48 A;  1B59 A;  2UZK A;  3MCZ A;  5HDG A;  3ZMU A;  2A68 F;  4IJA A;  3IKT A;  2L54 A;  2DK5 A;  3JTG A;  3TOB A;  1HST A;  1XSV A;  1HSJ A;  4PGH A;  1IN4 A;  3F8M A;  3WTY C;  4LK0 F;  2YU3 A;  4JK1 X;  4LK1 F;  1QNT A;  2PQ8 A;  3K1P A;  1W7P A;  3C1D A;  3HSE A;  4UHT A;  2YX4 A;  3CO7 C;  4I98 B;  4UNO A;  4BYY A;  2FQ3 A;  4RB3 C;  1OKR A;  3KP4 A;  4XRF A;  3V7R A;  2IJL A; 
#chains in the Genus database with same CATH topology
 2ID3 A;  2IGO A;  3LA3 A;  3G3Z A;  2XB0 X;  3WE3 A;  3HM5 A;  1J5Y A;  4WF2 A;  3CCM I;  2XF7 A;  2BOL A;  5BOX A;  3NAU A;  3L2U A;  1A36 A;  1H0M A;  1XB4 A;  4G6D A;  1FP1 D;  4P96 A;  2HYG D;  2NS7 A;  1J09 A;  3QOP A;  4WK8 F;  1J75 A;  1IGN A;  1IDY A;  2HDC A;  1V4R A;  3GUD A;  5D5U B;  1Q1V A;  2X1C A;  2KIM A;  3KEQ A;  1ON2 A;  3QPL A;  2LOO A;  3OMY A;  4HBL A;  4F92 B;  2JQ7 A;  2CS3 A;  1U6G A;  1UAA A;  1FZP B;  1I1S A;  2HGC A;  1SMT A;  2M4K A;  3PUB A;  4I09 A;  1D0Z A;  4F7Z A;  3G73 A;  1W5C C;  3D5L A;  1AU7 A;  4HLX A;  2ZSH B;  1KYZ A;  3DEW A;  1TWH J;  1DP7 P;  2O7O A;  1BOB A;  3ML6 A;  4FE7 A;  4K2E A;  4EM2 A;  4IX7 A;  1ZGW A;  2XSJ C;  3SFZ A;  3WU0 A;  2A3S A;  5C44 J;  1B8I B;  2GXA A;  5E17 F;  3ZQL A;  5EGO B;  3JR9 A;  2CUE A;  3HB9 A;  3QPH A;  3T8T A;  1B9N A;  3PQJ A;  3J80 K;  1LDJ A;  1X58 A;  3WG9 A;  2KHM A;  3HOV J;  4A5M A;  3DV8 A;  4IRH A;  2KRF A;  4NQW B;  2KRC A;  5KVR A;  2QKM B;  4S04 A;  3JRC A;  4RS8 A;  4IOC F;  1K4T A;  1CF7 B;  1A04 A;  3JAM Z;  5DD4 A;  1ZHF A;  2XGD A;  5HLH A;  3ZQC A;  5DCM B;  4C30 A;  2LVS A;  2W7N A;  2EIJ H;  2JVG A;  3OIQ A;  2RQQ A;  2ISY A;  2RKH A;  3A4C A;  2B9S A;  5E3M A;  4OMY A;  4WWC A;  1BBY A;  1CQT A;  4NB5 A;  2O6G E;  5L3F A;  4AIK A;  4KUM A;  1YX3 A;  3TMO A;  1WPK A;  1BOA A;  4WXD A;  1ULY A;  3OL3 A;  1T95 A;  1TC3 C;  3JTH A;  2VBZ A;  1XMA A;  1VQN I;  1MBF A;  5HS9 A;  1JUP A;  2B63 J;  4LLG F;  4CYD A;  3K7A J;  1TTY A;  1H8A C;  3VPR A;  4EM1 A;  4EQQ A;  1AHD P;  4YIF A;  3I3L A;  4D7N A;  2P81 A;  1O3Q A;  3J7A O;  3BPX A;  2QKL B;  4HNU A;  1BJZ A;  4F52 A;  2ID6 A;  3ZQ7 A;  4I02 A;  2M7B A;  4FAS D;  5ILU A;  3C2H A;  2GOM A;  2L9V A;  4BNC A;  2HQA A;  3LQQ A;  5EZG A;  3OYE A;  3T8R A;  3RPU A;  3BTC A;  2ZFW A;  3OR2 C;  1X3Z B;  2LRD A;  2DI3 A;  1QBJ A;  1F9N A;  3W6K B;  2R4G A;  2KP6 A;  4XON A;  1Z77 A;  3L2Q A;  4AVP A;  1IRZ A;  2XAJ A;  4S0H B;  1DQU A;  2V1U A;  1NH3 A;  4EAT A;  1XDS A;  2OCE A;  5CVJ A;  4Y3O A;  1OYI A;  3RQI A;  1P7J A;  4HDU A;  3S2D J;  2DN0 A;  4V19 K;  4XR6 A;  1YW7 A;  1EF4 A;  5JHU A;  3TKY A;  3WTV C;  5DUI A;  2Y69 H;  3ABK H;  1O57 A;  3ULQ B;  2HI3 A;  1UZC A;  4ETS A;  4YRV A;  1WH7 A;  1FIA A;  4XID A;  1TNT A;  4BQO A;  3Q9V A;  2LY9 A;  3D5R C;  3LAJ A;  2ACJ A;  3KZI C;  5KAF C;  1RPW A;  2DFI A;  2BW3 B;  1FOX A;  1QGP A;  1UG2 A;  1I3Q J;  3HRT A;  1GV2 A;  5D4R A;  1XX5 A;  2HYF A;  2DO7 A;  5HNF A;  1S3J A;  4CCN A;  1HDP A;  3SZP A;  3WGH A;  3W2W A;  1N25 A;  2KL4 A;  4ZZL A;  5LHI A;  1ZK8 A;  2X6X A;  2P5L C;  2L7Z A;  2VQG A;  1QHH D;  3BPV A;  3DEU A;  4BGD A;  2KFD A;  4Y13 A;  3OYF A;  3WG7 H;  1FYK A;  1BI2 A;  1FMV A;  2FX0 A;  2LF8 A;  5IPA A;  3MKZ A;  3OYG A;  2HTS A;  3PNT A;  5TRD A;  5B1B H;  1MBH A;  4M9X A;  2DA7 A;  3BR1 A;  5L3E A;  4EJU A;  2HEO A;  3QRF F;  3HOY J;  3R6S A;  5GAE J;  4I7H A;  2I10 A;  5IYC J;  3E5Q A;  4G6Q A;  1PYV A;  1EA3 A;  4U88 A;  3OYC A;  2Z99 A;  4M3D A;  1TP4 A;  3TDZ C;  4Z6Y A;  4RM2 A;  4CYC B;  3GZ5 A;  3GTP J;  5LEJ A;  1F36 A;  4JX6 A;  1GV5 A;  3BWG A;  5GPA A;  4BHC A;  2X48 A;  3V42 A;  3QAH A;  2DMN A;  2X1D A;  4O5V A;  5CQG A;  2R5Y B;  2PMU A;  1QRY A;  4R8H A;  4XKW A;  3OS2 A;  1QZY A;  5L3G A;  3BJO A;  1W7P B;  1DGR M;  2IGN A;  3LA7 A;  4BXU A;  5HOD A;  2R0Q C;  4CDG A;  1T6S A;  3FXR A;  3MEX A;  3J81 K;  3L9F A;  1LE8 A;  3L00 A;  2ZJ2 A;  3LSR A;  1BL0 A;  2JPC A;  4DYR A;  1EH7 A;  4ZH4 F;  1MNE A;  3LSM A;  1E0E A;  1A35 A;  3IRQ A;  5E8I A;  1ON1 A;  3SJM A;  1DU6 A;  4MLO A;  1BIB A;  4UUT A;  3MFK A;  2C6Y A;  2BHZ A;  3KCC A;  4BHB A;  1N77 A;  3IH2 A;  2JUC A;  2BBY A;  2FSW A;  3DTK A;  3GO5 A;  3FZV A;  2BXY A;  5BPD A;  2VJJ A;  4RM3 A;  3CMY A;  4HLY A;  4R1H A;  2TRT A;  2VKV A;  1JXS A;  1YIO A;  2LFB A;  2NYX A;  2B7E A;  4UV9 A;  1DP3 A;  4ZDO A;  2HU9 A;  1U0J A;  5FRM A;  3MKL A;  1YG2 A;  3KP3 A;  3AG2 H;  4CSW A;  4XLE A;  5FKO A;  1R5G A;  4A2U A;  1S7E A;  2DW4 A;  1XSD A;  1FTZ A;  2M8E A;  1R58 A;  1T0F A;  3DTE A;  4HST A;  2XAF A;  1GXQ A;  1R4M B;  2WAE A;  1TWC J;  2O8X A;  4BJ6 C;  1DGW Y;  4JBA A;  2ZCW A;  5DTD A;  2IGK A;  5LFA A;  4MEX F;  4D7M A;  4HRI A;  4HOB A;  1HW1 A;  3CMA I;  3JRF A;  4BBR J;  3BTI A;  1BW6 A;  4LD5 A;  3VYU B;  4EM0 B;  1IO2 A;  1WRJ A;  3B73 A;  4B44 A;  2M5W A;  3ZN1 A;  1B72 A;  1D8J A;  3KZZ A;  4JX5 A;  1MH4 A;  5LGT A;  4CGZ A;  2BXZ A;  1ZRC A;  1MND A;  3EUH C;  2GIV A;  3KEY A;  5LD2 C;  1MGT A;  3WOD F;  1LEB A;  1RZ4 A;  5C4X J;  2KIQ A;  2KJB A;  2LC2 A;  4QSH A;  4Q47 A;  2A61 A;  3RDI A;  3OYN A;  3HGG A;  3TP3 A;  2ZSI B;  1B4A A;  2WWY A;  2KDZ A;  2VJ5 A;  3DKY A;  3HSR A;  1AOY A;  1IXS B;  1RI7 A;  2P8T A;  2FEZ A;  3OSF A;  1D8K A;  3VSL A;  2IAI A;  2CW0 F;  3CJN A;  5CVI A;  4DYC A;  4BDY A;  3ZQH A;  3Q0U A;  4M3F A;  3C2G A;  1JGG A;  3DLL F;  3VOE A;  1JHF A;  4XSX F;  1W7P D;  3KYD B;  4HAM A;  2XDV A;  1WJB A;  4PJM A;  2K9Q A;  3Q9S A;  2DAO A;  2DPU A;  3H5R A;  1ONV A;  1FP2 A;  3FHZ A;  1S7A A;  1XDU A;  3U9G A;  1YI2 I;  2VC0 A;  2RNG A;  1VQ7 I;  3B6A A;  3RYP A;  3S14 J;  2MG4 A;  3DQV C;  2NNY A;  2KIF A;  2COB A;  3S2W A;  1GUU A;  2IS6 A;  4L5I A;  2L4A A;  1XTA A;  2ICW G;  1FBQ A;  1WGX A;  3MD2 A;  3HKZ N;  3MKW B;  4LB5 A;  2HZT A;  3CCS I;  1TW3 A;  5CVU A;  2WAQ N;  1YS7 A;  1Z1D A;  1U3E M;  1SMY F;  2Z33 A;  2ZFU A;  3TED A;  4RGU A;  3TO6 A;  3BCB A;  3OL4 A;  2H8R A;  2V1N A;  3LA2 A;  1Z0X A;  4U7B A;  1J2X A;  2DOF A;  2LK2 A;  2RQP A;  4F55 A;  2VKH A;  4WXC A;  1TT0 A;  1S7O A;  2XRN A;  5E3L A;  1YIT I;  3IHU A;  2LYC A;  3H1C A;  2LLK A;  4Y17 A;  3F8C A;  3F6O A;  2QQA A;  4AYB A;  1FOY A;  5ILS A;  2LNB A;  5DDG A;  3CDI A;  1LPQ A;  5CLS A;  2DA5 A;  2A05 A;  1VQL I;  1MJA A;  3JRA A;  4XLP F;  1WJD A;  2BYV E;  2VT2 A;  5KK1 A;  5AIQ A;  2JA7 J;  4UB6 C;  1ZEL A;  2MC4 A;  2W85 A;  4E6K G;  3C2B A;  2E71 A;  1QZE A;  3J7Z I;  1B1B A;  1HBX G;  3K4K A;  4U87 A;  1ZG1 A;  4XKV A;  3HL2 A;  1Z7L A;  4M74 A;  3BJA A;  3QQA A;  4IEJ A;  1ENH A;  1XGO A;  5GTH C;  1XC5 A;  3UKG A;  3HTS B;  2HOE A;  3FK6 A;  4WX9 A;  3G1M A;  4EJW A;  1SD4 A;  2OQG A;  3L7W A;  2OTL I;  3HTU A;  3VSK A;  5HVQ C;  2KIU A;  2K4J A;  2FBH A;  4XM3 A;  2M0C A;  4BUP A;  3S16 J;  2GQQ A;  4I01 A;  5K5Q A;  1F43 A;  2OU2 A;  3OS0 A;  1P6R A;  1XSX A;  1K61 A;  1R6R A;  1U5T C;  4OAY A;  4C3J J;  2G0E A;  1XS9 A;  1SFX A;  1D5V A;  3QU6 A;  1W1W E;  4RB0 A;  3BC8 A;  3CP2 A;  4V2G A;  2VBX A;  2PG4 A;  4XKC A;  3UR3 C;  5B66 C;  2HQN A;  3HOS A;  1H88 C;  4OU0 A;  4P9F A;  5E1Z B;  3ZMZ A;  1ZLJ A;  2PJP A;  2WY7 Q;  1D1C A;  3F72 A;  2KZG A;  1OCC H;  4G94 A;  5J4V A;  4G8X A;  4UY8 I;  1FSE A;  5EJC A;  4CIC A;  2X6W A;  5FGM A;  4F3Q A;  5JLW A;  2KLO A;  1MBK A;  4M3G A;  2EZK A;  2OQR A;  3PIO F;  3RI4 A;  1NHA A;  3BG5 A;  2COM A;  5J1R A;  1JT6 A;  4BY7 J;  4ZZD A;  1S72 I;  1Y0U A;  4XNF A;  1EKE A;  5K5R A;  1B8I A;  1G3T A;  2JUG A;  5EGO A;  1FNN A;  3EUH A;  4YFX F;  1YE9 A;  1ZKG A;  5DEQ A;  3V7C A;  2RC4 A;  1JTX A;  1XCB A;  3O2P E;  2TDX A;  3CJR B;  3CP8 A;  4NQW A;  1T2K A;  1ETQ A;  4BXF A;  1IV8 A;  2MC3 A;  4J19 A;  3ZGK A;  3M8F A;  3K70 C;  1VZ0 A;  4M3B A;  2FBI A;  3FIS A;  3RPU D;  1ZG3 A;  3OOP A;  2PJR B;  4MEY F;  5BNG A;  5DCM A;  5KNL A;  1BM9 A;  5EZH A;  4DOZ A;  4FET A;  1OFC X;  4M6V A;  3J81 Z;  1S5L C;  5GAH J;  1FJL A;  2Y0S A;  3GTL J;  4AWX B;  3FXL A;  2HQ5 A;  1P2F A;  5FO5 A;  3HOZ J;  4F93 B;  4UVA A;  4E7Z A;  4ENJ A;  5ILV A;  2HVQ A;  2M1B A;  3AG4 H;  5TJJ A;  4L5J A;  2WY8 Q;  2HKO A;  4BXX J;  3IWF A;  3P5J A;  2BHY A;  2WB1 N;  2GLO A;  3CDL A;  1TZL A;  1LDK B;  1TWG J;  5H6Q A;  4II2 A;  2M8G X;  1K83 J;  3LWF A;  4J01 A;  2BGC A;  1SD6 A;  1W36 C;  2R93 J;  4D5C A;  5EF6 A;  4HZF A;  4MO7 A;  4HG2 A;  3I4P A;  1LB2 A;  1R7J A;  2IA0 A;  1JKR C;  4LLL A;  1W4M A;  2J5O A;  1HCR A;  1Z6R A;  3K4L A;  1JUS A;  5C4J J;  3I9V 2;  5D4S A;  3G1L A;  2LR8 A;  5JHF A;  1D0X A;  3HC7 A;  2JA2 A;  1TQM A;  4B47 A;  2ZNY A;  4L9N A;  1IN6 A;  4EJT A;  4I0B A;  2E34 A;  2Z3Y A;  5L3C A;  1PDN C;  4IHW A;  4XLA A;  3CC2 I;  4Y15 A;  3TW7 A;  1R36 A;  4ZYA A;  5DM6 F;  2HS5 A;  2M7A A;  1UJ8 A;  3QWL A;  2N8G A;  5FKK A;  3KP6 A;  3RCO A;  2MH2 A;  2XPU A;  2FUG 2;  4RAG A;  2XPV A;  4LB6 B;  1PJR A;  1FBS A;  2W4S A;  2XVC A;  1Y1V J;  1BR4 A;  1R23 A;  2BW3 A;  2HR3 A;  4RA2 A;  2FNP A;  2Y9Z A;  3GWZ A;  2F5D A;  2XHK A;  3NWT A;  5BS6 A;  3E6D A;  2H1K A;  2L5Q A;  4E7K A;  2M45 A;  3QOD A;  5FKM A;  2CUZ A;  3HG9 A;  2IW5 A;  1ZN2 A;  2BY1 A;  2QEN A;  5LRR A;  1JJ6 C;  4IQJ A;  2CFO A;  3H0D A;  3MZY A;  1FLI A;  3G6E I;  5FRN A;  3CC7 I;  3WGI A;  3K1M A;  1YRN B;  1WI9 A;  1ZRD A;  4E7I A;  3H36 A;  4WXH A;  4V2F A;  4ESJ A;  2FBK A;  1YFH A;  1XN7 A;  4A0Y A;  4Q48 A;  2NVQ J;  4XK4 A;  4XOR A;  1V3F A;  2CUF A;  3E6C C;  3VFZ A;  2ME6 A;  1U78 A;  2XAQ A;  1UFM A;  1LEA A;  4A5N A;  2YSR A;  2GIZ A;  1K7A A;  1EH6 A;  3BLY A;  4C2M J;  2IEK A;  2QQB A;  5E18 F;  4CYC A;  4IRG A;  5FD6 A;  3S3M A;  2VKD A;  1Z6T A;  4NDL A;  2L3D A;  3SEZ A;  1LKX A;  3WU2 C;  3OOU A;  5F1J A;  2R5Y A;  3RKQ A;  1SVL A;  4IZZ A;  2HNH A;  5IOZ A;  4X0G A;  2DMT A;  2ZXW H;  5J47 A;  2BY3 A;  1YYV A;  2EFQ A;  2GZW A;  3IH3 A;  1K6Y A;  2JWT A;  2QEX I;  1FEX A;  2GM4 A;  1D1A A;  3L09 A;  1GXP A;  5CVR A;  4IHY A;  1YW8 A;  1WWX A;  2FD5 A;  3H9G A;  2DU9 A;  1FTT A;  1Y8Q B;  4E4H A;  4GRI A;  5A2Q K;  1R5H A;  3HYI A;  2RRE A;  2X4H A;  4MQ9 F;  1E3O C;  4FCY A;  2LDU A;  3U1D A;  4CCM A;  4YFK F;  1C0W A;  1VQO I;  2HZD A;  1VQ9 I;  2M0M A;  1SD7 A;  2LRE A;  4A3D J;  2A6T A;  4DNC A;  3H3U A;  3I58 A;  2NVU B;  1MSE C;  1D3Y A;  3GBG A;  3C18 A;  1UST A;  1T8I A;  4PSW A;  4MFD A;  4B8X A;  1J9I A;  4A3I J;  3H3Z A;  1V5F A;  3P9C A;  1BI0 A;  4N4O B;  3MZH A;  1AKH B;  2IXS A;  4PCQ A;  5H20 A;  5JI6 A;  5IYD J;  3ZQI A;  4I2O A;  3CUO A;  4X6A J;  5KCM A;  1KON A;  3PJR A;  4FTH A;  2ZB9 A;  2ZME C;  3ZQF A;  3S17 J;  1BW5 A;  1XCV A;  3CES A;  3GF2 A;  3X2Q H;  3IV5 A;  4FE4 A;  2VKE A;  3C7J A;  2L9N A;  2YS9 A;  1V5E A;  2K7L A;  4DBR A;  3BJ6 A;  3M4O J;  1G4D A;  1ETV A;  1KGS A;  3GXO A;  3K4B A;  3WTU C;  2WTE A;  3FXM A;  2LKP A;  3R4K A;  2DA1 A;  2JK3 A;  3HOT A;  1HW5 A;  1E3P A;  4BHP A;  2W57 A;  2W00 A;  4EVI A;  3SHF A;  3GEZ A;  2R7W A;  3P7N A;  2W25 A;  4KN7 X;  4RMN A;  5LEK A;  4W97 A;  2YR2 A;  2L7K A;  3MAJ A;  1AA7 A;  3EQL F;  4GO1 A;  4BY1 J;  5FLV A;  1PUF B;  2RAE A;  2KIS A;  3JRD A;  2CV2 A;  3E6B A;  3SDB A;  2AXL A;  5B1A H;  3KYL A;  3DF8 A;  3MWM A;  3OSG A;  4D9J A;  1G3Y A;  3BTL A;  3SYT A;  1E3H A;  2M30 A;  1F5T A;  4NC8 A;  4L0Y B;  3H0G J;  2F5V A;  2KDO A;  1ZQ3 P;  1Z3Y A;  5JVT A;  3K4N A;  1I39 A;  4ZYD A;  1I50 J;  3QYE A;  1A6I A;  2QVO A;  2Z2S B;  4EMS A;  4ANJ A;  5EEA A;  5IT9 K;  3ASO H;  2XGX A;  1X3U A;  3S15 J;  3ECH A;  4ENM A;  2GAU A;  1IRX A;  1F1Z A;  3TDU C;  4E7L A;  4A3E J;  2EB7 A;  3LSP A;  5FFX A;  1W0T A;  1IUF A;  2ECC A;  4C3H J;  4HW0 A;  2CJJ A;  2V9K A;  3GME A;  5IT3 A;  1Z91 A;  5GPC A;  2HWV A;  5M5W J;  2EBI A;  5LBQ A;  4MFE A;  1SC7 A;  3IKV A;  1JTY A;  1OYY A;  1W5T A;  2NVY J;  2XF5 A;  5GAG J;  2VUM J;  2LG4 A;  3AG1 H;  1BR2 A;  3K9T A;  2JN6 A;  3I54 A;  2JPB A;  3ABM H;  2NRA C;  1T08 B;  2K4B A;  3PIP F;  2X1E A;  3GCM A;  2VQH A;  3S3O A;  1IW7 F;  2FNA A;  2VT3 A;  3CMM A;  3W2V A;  2CG4 A;  3IP4 B;  3RJP A;  1YTY A;  3R61 A;  5ERI A;  3I59 A;  1X1D A;  5HDK A;  2Q8K A;  4D5F A;  5FB2 A;  3DU5 A;  5ICE A;  1SVO A;  3A0H C;  3NEU A;  2DDB A;  4C3I J;  3VWB A;  2IVM A;  4ESB A;  3FIW A;  3SQN A;  2ZXH A;  2XKP A;  4D0P A;  2CV0 A;  2ZC2 A;  2JRM A;  2NOJ B;  1HOM A;  2WC2 A;  3TO9 A;  3I0T A;  2M87 A;  2QZ8 A;  1ETX A;  1Z67 A;  2OF7 A;  2K5C A;  2X9D A;  3K6G A;  2WBM A;  2GXG A;  1IZ1 A;  4A0Z A;  2XGC A;  2FOW A;  3BQZ A;  2CH0 A;  3KX2 A;  4KIF A;  4HQM A;  1FY7 A;  3ERE D;  1HF0 A;  4IKF A;  1X2N A;  1MJ9 A;  2KRH A;  4HF2 A;  1Y0N A;  2ELJ A;  2I5U A;  4Y4R A;  1OCR H;  1U5T B;  3FXJ A;  2DMU A;  3OYD A;  4LMY A;  2X51 A;  1WQ2 A;  2KPM A;  4XN0 A;  2VPR A;  2QLZ A;  5F0F A;  5GP9 A;  1PP7 U;  4IO9 F;  2JTV A;  3E3V A;  3BR0 A;  3EUK L;  2PJR A;  4IHS A;  1WJA A;  3NRV A;  4Y33 A;  3W6J B;  4Y52 J;  1WCM J;  1Y39 A;  3LSG A;  2ZJP F;  5H6R A;  2HDD A;  2DK8 A;  3G2B A;  5J6X A;  2EIM H;  2R7U A;  5J3L A;  4XLH A;  3K10 A;  1A6Q A;  1O3T A;  3HUG A;  4B48 A;  4ENN A;  2EK5 A;  4AIH A;  2P4W A;  4G12 A;  1QPI A;  1SAU A;  2M4G A;  1LFP A;  4B4C A;  2K85 A;  3FKJ A;  4NC6 A;  2OZU A;  1X1P A;  4YIR X;  1KU7 A;  4KDP A;  5BMZ A;  2JA8 J;  4U0Y A;  5CKT A;  4A93 J;  3CLQ A;  3GTJ J;  4CA0 A;  2LF7 A;  4H4K C;  2DTR A;  1K79 A;  3H5A A;  5GAD J;  1R1U A;  2EPF A;  2CO5 A;  1B6A A;  3ECO A;  4XRS A;  5KHD A;  2FE3 A;  5LLQ A;  3SZT A;  2VE8 A;  1RUN A;  1R00 A;  3FX3 A;  4CO8 A;  4F91 B;  3HRM A;  2ME0 A;  4IL6 C;  2MLG A;  2AQF A;  4QWQ A;  3KET A;  3SDG A;  1BJA A;  2H6B A;  2XPW A;  3V4G A;  3AG3 H;  4A69 C;  3NQO A;  1V54 H;  2ESN A;  2RN7 A;  5LHG A;  5A2Q Z;  5FKN A;  4ZYH A;  5IYB J;  3ZR8 X;  1N78 A;  5J1U A;  2CQ7 A;  4AVZ A;  3KLO A;  3E5X A;  2F5E A;  1HQC A;  2DFF A;  5E1W A;  2E1M C;  1KZH A;  2DLL A;  3DTI A;  3LMM A;  2R7X A;  2P6T A;  4CCO A;  3JRB A;  1RUO A;  1DPU A;  2MD0 A;  1UB9 A;  2D1V A;  4DQ2 A;  2ELH A;  2DMQ A;  5HDN A;  2K3P A;  1MSF C;  3VYR B;  1MMG A;  4U0V A;  1VND A;  2V1D A;  3OV8 A;  4Y7N J;  2STW A;  4RBO A;  4HX8 A;  1YLF A;  3GFM A;  4IOA F;  2BVM A;  2DA3 A;  2HYJ A;  1Z7U A;  1UHS A;  4FIS A;  2P5K A;  5HS8 A;  2E19 A;  3RKX A;  2OTJ I;  3P9K A;  3TP0 A;  4FQG A;  4GGG A;  2FQ4 A;  5FRO A;  4C2U A;  4OOI A;  3B02 A;  4PJ0 C;  2VXD A;  3FXO A;  1EJ9 A;  2VJI A;  2KKO A;  3L2C A;  2CMP A;  5EDN A;  3PFY A;  4W1U A;  2LBF A;  3HOX J;  1OCO H;  3HJE A;  1IC8 A;  3OYI A;  1JKO C;  1UHM A;  1FOW A;  2PBI A;  3W3C A;  2V9P A;  2DOE A;  1TWF J;  3GFL A;  3E0J B;  3LSI A;  3AAF A;  3FXK A;  3DBH B;  2QSH X;  5HOO A;  2Y0M A;  3I71 A;  4KN4 X;  1SFE A;  3DFG A;  3ZN0 A;  5E20 A;  1U2W A;  3K70 D;  2UXN A;  4BE0 A;  1VQP I;  1WHU A;  2V7F A;  2IS4 A;  1ZRF A;  1UMQ A;  3D0S A;  3MZ8 A;  2EV0 A;  1YRN A;  3HRS A;  3ZMV A;  2HKX A;  4HPQ A;  4RAZ A;  4ZTF A;  4IQ4 A;  4RGR A;  5J40 A;  5IT9 Z;  1QO0 D;  2XF6 A;  5BPI A;  2JRT A;  2F48 A;  2DT7 B;  4A6D A;  4M9S A;  1FC3 A;  2KZV A;  3R60 A;  1K6O A;  5DM7 F;  3CUQ C;  1TQI A;  4A3K J;  4PJN A;  3REO A;  4BE1 A;  4A3F J;  1GHC A;  2Y31 A;  3A2K A;  1OIS A;  2H8W A;  3BOQ A;  1TWA J;  2P5V A;  3L2R A;  2ZNZ A;  2W24 A;  3OYM A;  3HEF A;  3FK7 A;  2OZ6 A;  3ERM A;  5DCF A;  3BQY A;  3N05 A;  5TIS C;  3KP5 A;  4HYE A;  4AIJ A;  1WFX A;  3H9J A;  3KP7 A;  3DKX A;  1T38 A;  1LDD A;  2XIG A;  3I59 B;  3S8P A;  4ZYE A;  3CCY A;  2P7C B;  3BR2 A;  2EZI A;  3D5S C;  2FF4 A;  3WE2 A;  3GX4 X;  2R3S A;  3GTO J;  4TV7 A;  4HF1 A;  5D5W B;  1SD5 A;  2CRG A;  2LY1 A;  2M34 A;  3PUF A;  1ZGA A;  3HBL A;  1JI8 A;  1KA8 A;  2Q1Z B;  2OC6 A;  3KIO A;  1MBG A;  2L4M A;  3HRU A;  4B09 A;  4HEA 2;  2NVX J;  1R22 A;  3Q5F A;  2DOA A;  2YPR A;  2RNJ A;  3EYI A;  4BQA A;  2E36 A;  1GVJ A;  5FKL A;  2L02 A;  4IHT A;  2PMZ A;  3PO3 J;  1ACI A;  3O8G A;  2BY0 A;  4LFU A;  3DPL C;  4BAY A;  1JT0 A;  2OPT A;  5E3O A;  5JFR A;  5EG0 B;  3WTZ A;  4UVC A;  3QP5 A;  3FMS A;  5IOY A;  4PK4 A;  4LOC A;  4XLF A;  4ENK A;  2STT A;  3KFW X;  1FBU A;  3FMQ A;  5L3D A;  4R79 A;  1YJW I;  2FRH A;  2DT6 A;  1AKH A;  4N9H A;  1ZYR F;  3EPZ A;  4XLC A;  2DA6 A;  3S1M J;  2K9S A;  3DWL E;  1G2H A;  2ZME B;  4YG2 F;  3O3K A;  2EFO A;  3H9Q A;  4EJV A;  2V1X A;  3T0Y A;  1X1C A;  3OYL A;  4M71 A;  3O8H A;  2BEO A;  3IUO A;  2ADU A;  3LST A;  1TQP A;  4L9J A;  5K7F A;  4E7J A;  1S8N A;  3FXQ A;  4XKB A;  4A3G J;  1A5J A;  1VF9 A;  2MA3 A;  2VBY A;  2IGM A;  2EZH A;  3A1Y A;  3HUG B;  1YOV B;  4OIQ F;  2W48 A;  2JVH A;  1GDT A;  4AM3 A;  2BE5 F;  1NK2 P;  3E6M A;  4OIN F;  4EV0 A;  4A3M J;  3N97 A;  4FHT A;  1O3S A;  2HXI A;  1YJN I;  1T39 A;  1FWZ A;  3BT9 A;  3TGN A;  1KQ9 A;  2GBY A;  4L9T A;  1PUF A;  2VB6 A;  2R7T A;  2HOS A;  2K9L A;  4LJZ F;  2VE9 A;  1IRG A;  4D1Q A;  1MH3 A;  1QHG A;  2E7W A;  2O03 A;  2WAD A;  4G6T B;  4MHG A;  1ETK A;  1BI1 A;  3FBN B;  4LG0 B;  4LLN A;  3BR6 A;  2JA6 J;  1TL8 A;  4AUX A;  1WKM A;  3HIF A;  2OAZ A;  1G3S A;  5JLX A;  2XC7 A;  2ISZ A;  4DZJ A;  3OYB A;  2OD5 A;  2CQK A;  2Q2E B;  4BJT A;  2E1N A;  1SAX A;  1IUY A;  3QYB A;  4RLQ A;  3I55 I;  3RKW A;  4EJO A;  3JRG A;  4ZTJ A;  3DEE A;  2EH3 A;  4CUG A;  5FLX Z;  4HX4 A;  3ZXS A;  2BY2 A;  4ITV A;  4PFO A;  2Y2Z A;  4E7H A;  5K1Y A;  1LFU P;  2CGP A;  1DDN A;  2V4J C;  2RDP A;  4PSX A;  5DYM A;  5AON A;  1IV6 A;  1ZRE A;  2ZXI A;  1YIJ I;  2OJE D;  1JJ8 C;  5ICC A;  3U1K A;  4S05 A;  1I1G A;  3CUQ A;  2ZO4 A;  3SZG A;  3Q0V A;  4A3B J;  2JT1 A;  2NAZ A;  4XMY A;  3OYJ A;  4E7S A;  1OMI A;  1KU9 A;  1KYW A;  1ETY A;  2OBP A;  1IXR C;  3ESW B;  4DW6 A;  1MNM C;  2O61 A;  1JKQ C;  5F08 A;  3GFI A;  4XSZ F;  5EEG A;  2AQE A;  3CD6 I;  3BTJ A;  3ZPL A;  1PUE E;  4YFN F;  2R5Z A;  3KYC B;  3KEO A;  3RYR A;  3RZO J;  1NG6 A;  3DXJ F;  5CVV A;  1SEU A;  3CTA A;  4CH7 A;  3DBR B;  3E5U A;  4AYB N;  1LVK A;  3ZQG A;  1HC8 A;  2DQL A;  3BG3 A;  1WH5 A;  3V8J A;  2WV0 A;  5M3M J;  4GFB A;  2EV6 A;  3IC7 A;  5K7Z A;  5FLM J;  1XMX A;  2KJC A;  3CF5 F;  2LBF B;  3ONQ A;  2QYO A;  3SFI A;  3CF2 A;  4A3J J;  2V6E A;  2UXX A;  1DPR A;  3BG7 A;  3VDX A;  5D5X B;  1QZZ A;  1X1A A;  2VQL A;  2X6O A;  1OJL A;  2UUZ A;  2CWE A;  3K69 A;  1MMS A;  2P7V B;  3F0C A;  2ECB A;  4AC0 A;  2HQR A;  5F27 A;  2O5R A;  3DCF A;  2PMH A;  1FIP A;  3VYT B;  1ORK A;  4QPQ A;  4DYQ A;  1U8R A;  1U5T A;  2EIL H;  3BRO A;  3ZP5 A;  5D8L B;  3GTK J;  2CFX A;  2F2E A;  5AIP A;  3DBL B;  3J7A Y;  2EJR A;  2QBY A;  1Z3X A;  1Y6I A;  1BN5 A;  3Q0W A;  1G59 A;  3KP2 A;  4B3A A;  2F5C A;  1NK3 P;  3KE2 A;  4Q5S F;  3P9I A;  4RB2 C;  2TCT A;  2QCO A;  2Q0O A;  2O0Y A;  3FM3 A;  4HV5 A;  4ASN A;  4QTR A;  1L3L A;  2M3A A;  2OCC H;  2QM3 A;  4E70 A;  2FOK A;  4HX7 A;  2KQR A;  4PJL A;  2Z9O A;  2IS2 A;  4HDV A;  1RIO H;  1EV7 A;  3V8L A;  1OR7 C;  4XRS G;  5JR3 A;  1MDM A;  4KT6 A;  5HLG A;  2UWM A;  1VQ5 I;  3KPH A;  4I76 A;  2M9H A;  1QVU A;  2VN2 A;  2HOA A;  4BS9 A;  1S9H A;  1ZG5 A;  2G9W A;  3TW6 A;  1DUX C;  4IHV A;  1ZGJ A;  1TNS A;  5D8K B;  4M3E A;  2JJ7 A;  1ZR2 A;  4KMU X;  3JSP A;  2PEX A;  3FBI B;  3F23 A;  4LG3 A;  3BCA A;  4CXF A;  2HOT A;  1V5G A;  1POG A;  1YO5 C;  1ERD A;  1KQ0 A;  1X3W B;  5HLI A;  1P4W A;  3CJQ B;  1X19 A;  2XAH A;  4M73 A;  4M6X A;  4ZDL A;  3PNY A;  4XLN F;  2Y0S N;  3WHB A;  3T1B A;  3MN2 A;  1S6L A;  2QGU A;  2F4M B;  4XBF A;  5EEH A;  3GTQ J;  2E60 A;  1G6N A;  4QIW N;  1O7F A;  1R5I D;  2E1M B;  3ELK A;  3SXY A;  4I99 C;  1P92 A;  5BQT A;  3IRR A;  3HSF A;  3AL0 B;  4A3C J;  2DT5 A;  3TOA A;  3E7L A;  3WTW C;  4EGY A;  1MKM A;  1MD0 A;  2A5Y B;  3DU6 A;  2ELK A;  1TLH B;  2D45 A;  1HA8 A;  2E35 A;  4JP0 A;  2E5N A;  3DPU A;  2HPM A;  1IXC A;  4IPA A;  3MQ0 A;  1OQY A;  2NNN A;  5M5X J;  2P0W A;  3RPQ A;  4XN3 A;  4KIT B;  3JCU C;  3U2R A;  3HHH A;  5J8C A;  1BIA A;  4DZP A;  1MMD A;  2CQQ A;  3EYY A;  1I6H J;  4Q4Z F;  3GW2 A;  5M3F J;  5D6F A;  1BI3 A;  1Z05 A;  2CW7 A;  2VXZ A;  1H9T A;  5E8G A;  2AO9 A;  2Z16 A;  2V26 A;  2HDW A;  4PJJ A;  2NXN B;  3S1R J;  4XL9 A;  5LGU A;  2O9L A;  3HHG A;  4ZYG A;  4GYG A;  2W1O A;  3V8K A;  5H2F C;  5HNH A;  3OY9 A;  2H6C A;  4KA4 A;  4PFP A;  1R4N B;  3ABT A;  1IRF A;  2FA5 A;  2DDA A;  4N0B A;  1MMA A;  2H27 A;  2EZL A;  1MBE A;  1XGS A;  4FX0 A;  4O6J A;  3A0B C;  1MIJ A;  3S32 A;  1VQ4 I;  4BDZ A;  4OWR B;  4BU2 A;  2K02 A;  1OCT C;  3ASN H;  1RNL A;  2EWN A;  1Z21 A;  4CCL A;  2HTJ A;  2XAS A;  3ZMT A;  1X1B A;  1MJB A;  3TQN A;  4A6E A;  2ZKZ A;  3ABU A;  1IJW C;  1IN8 A;  4IXA A;  1ZLK A;  4CZC A;  3S2H J;  2O8K A;  2M2E A;  3N4M A;  2X0L A;  3M1C A;  4ON0 A;  2ZJR F;  5JVG F;  5ICG A;  3CCR I;  4AU7 A;  3VYS B;  1EH8 A;  4JX4 A;  1K78 A;  2E1O A;  2F6C A;  2L9S A;  3CUQ B;  1FT9 A;  3I56 I;  1VFC A;  3LFK A;  3A01 A;  1O4X A;  1WJC A;  2GA2 A;  4N4N B;  3PM1 A;  3ZRG A;  2B0L A;  1J0R A;  4KJZ A;  3IWZ A;  1YS6 A;  2WA0 A;  3Q3S A;  4RB1 A;  2K86 A;  5F1R A;  2GA1 A;  2W84 A;  3I53 A;  5J1Y A;  4GDF A;  2L7M P;  3CDH A;  1T56 A;  2PX9 A;  4WCG A;  4UXN A;  1MBJ A;  1OPC A;  2A6E F;  5D5V B;  1FOK A;  2D5V A;  2NVT J;  2RV8 A;  3HXL A;  2R5Z B;  3QYF A;  1OLT A;  3L2V A;  3FF5 A;  1OR7 A;  2CYY A;  4HSR A;  3TBI A;  4A3L J;  4II3 A;  2FMY A;  3BP8 A;  3U21 A;  3I4M J;  2IP2 A;  4G9Y A;  1T0F C;  4MIM A;  2LD5 A;  5F6F A;  2DYR H;  4LIT A;  4UUS A;  2HVR A;  4BQN A;  3TL4 X;  2EA2 A;  4JOM A;  2X85 A;  2R7S A;  2PI0 A;  1PP8 F;  4G7O F;  4GCV A;  2MD5 A;  2PLY A;  1YJ9 I;  4BBS J;  3CQZ J;  3HPH A;  2EA4 A;  2UV1 A;  3CO6 C;  4BAC A;  3H3V K;  2DCE A;  5FJ8 J;  1JKP C;  5EG0 A;  3WHC A;  4HF0 A;  3F3X A;  2DMP A;  2VON A;  2IA1 A;  2EIK H;  1RC9 A;  2JA5 J;  2IS1 A;  1D5Y A;  2JMW A;  3HDD A;  2A69 F;  3K2A A;  2R7F A;  3CME I;  1LFB A;  2VOD A;  3BR5 A;  2JZY A;  2ZME A;  1REP C;  3M9A A;  3RZD J;  2QBY B;  3H5N A;  1Z9C A;  3K1N A;  3ROU A;  2EFW A;  5F64 A;  3KLN A;  4MQV A;  2IT0 A;  2YX7 A;  4KNY A;  3C3W A;  5D6E A;  3F6V A;  3GLX A;  1R1T A;  3MVP A;  2W82 A;  4X1E A;  3JRI A;  1IDZ A;  3BG9 A;  2X6Y A;  1ZH5 A;  1P4X A;  3RSN A;  4KIS A;  1VQM I;  3HKZ A;  3DPT A;  2DA4 A;  2LMD A;  3FMR A;  1WVR A;  4BEH A;  4DGW B;  4MTD A;  4IHX A;  2WAQ A;  4IRI A;  2OA4 A;  1APL C;  1D1B A;  3I4N J;  4AID A;  5B5E C;  1XPX A;  3JW4 A;  1RRJ A;  3CCV I;  4MGR A;  2VAS A;  1LUJ B;  3K4J A;  1ZR4 A;  2YUS A;  1MDM B;  4ZJZ A;  1U9N A;  3HOW J;  4M9Z A;  3F8F A;  3H92 A;  2R7Q A;  5TGT A;  3ZQQ A;  1FSH A;  3PQK A;  4LG0 A;  1P4A A;  2QUF A;  4KIG A;  4XIC A;  2GWR A;  1VQK I;  4NC7 A;  2YU9 J;  5FLX K;  1JHH A;  1X4O A;  3AFH A;  3BZK A;  4DIQ A;  1NG7 A;  3WTX C;  1IAW A;  3CCL I;  1TW2 A;  3UNG C;  1TT5 B;  1R1V A;  3ABL H;  2Q2E A;  3K4M A;  1SVM A;  2Y75 A;  2IPQ X;  3CCJ I;  2EQR A;  2MAB A;  1LVA A;  4GYI A;  2G7U A;  3ISP A;  1L0O C;  5LGN A;  2DYS H;  1MZB A;  4L0Z B;  1QVT A;  1S29 A;  2K27 A;  4NUB A;  3LL7 A;  3OYH A;  3RIR A;  4XRM A;  2Z1D A;  2FML A;  3R0J A;  2BZT A;  1J7K A;  2XAG A;  2NS8 A;  3S1N J;  4DBQ A;  3AL0 C;  4UVB A;  1P9Q C;  2L01 A;  1IN5 A;  1USS A;  5CJ9 A;  2Z5U A;  1ODD A;  2F4I A;  3O6B B;  3CC4 I;  3F8N A;  2V79 A;  2L2O A;  1R71 A;  3FWE A;  3M1E A;  2VJ4 A;  1BC7 C;  1JGS A;  1HDD C;  2E2J J;  2K3F A;  2MYS A;  5L3B A;  4HV6 A;  2R7O A;  3A03 A;  2CV1 A;  3E1S A;  4Z2Y A;  2CSO A;  4C2T A;  4P5O A;  4LGW A;  5J8F A;  3LAP A;  3M8J A;  2MGQ A;  1SFU A;  1MW7 A;  4G7Z F;  2D2W A;  1A31 A;  4EGZ A;  2DBB A;  1QPM A;  1XGM A;  2FU4 A;  3LFU A;  4KIC A;  1YX5 A;  4RGS A;  4MTE A;  5C3E J;  2LTP A;  3FXU A;  2E5Z A;  3DP7 A;  2EIN H;  2IA2 A;  1RR8 C;  1JE8 A;  3K2Z A;  3OYK A;  2K40 A;  2R7Z J;  3D1N I;  4H0E A;  3PFI A;  1X2M A;  1TBX A;  2DQR A;  5HS7 A;  3G71 I;  3BG6 A;  4ESF A;  4ZC3 A;  2H1L A;  1HKQ A;  3F9K A;  4I6Z A;  1GLN A;  1R9T J;  1ITY A;  1JUM A;  3EDP A;  5B3S H;  2XRO A;  2LSO A;  3IAM 2;  3LOC A;  3CCQ I;  1J59 A;  2L0K A;  4YEJ A;  3FM5 A;  1XGN A;  2WAF A;  3ZOB A;  2GOX B;  5E3N A;  2QQ9 A;  1WSU A;  2G7H A;  2WV1 A;  4PGG A;  2NS0 A;  3IH4 A;  1DU0 A;  4KMF A;  2FJ1 A;  3HGY A;  3J80 Z;  1XD7 A;  1WZ2 A;  2XKO A;  1YW9 A;  2V9V A;  3EET A;  1UHW A;  1K78 B;  3A02 A;  9ANT A;  2LKS A;  1H9G A;  2R7D A;  2VIX A;  3A01 B;  4OIO F;  3E97 A;  2QF7 A;  1B9M A;  2K9N A;  2QSF X;  3EUA A;  3ZCO A;  4G7H F;  1YHQ I;  2AS5 F;  1LNW A;  3HZJ A;  4MNU A;  1VI0 A;  1ZAR A;  4M72 A;  5CPR B;  1ZAO A;  4NBQ A;  2J5P A;  2IBD A;  1I3A A;  3WGG A;  2WB1 A;  3CLO A;  2V6C A;  1RKW A;  1AWC A;  4NHJ A;  2VBW A;  2R92 J;  2VOP A;  3G4S I;  1VTN C;  2F4O B;  2DA2 A;  4IVN A;  3PSF A;  1HXD A;  1STZ A;  1HKT A;  4CHU A;  2VL8 A;  1WJF A;  2XV4 S;  1H89 C;  1Y1W J;  4AD9 A;  3PL8 A;  1W36 D;  2XGE A;  3ZMS A;  1BA5 A;  4L9V A;  3GZN B;  3M8E A;  1ETW A;  3PO2 J;  4UUS B;  4EEF G;  1IG7 A;  3RQ4 A;  2VC1 A;  4N9I A;  5DV5 A;  2A07 F;  4HNT A;  1OCZ H;  3QPT A;  3SEQ A;  5F0H A;  3WTS C;  3RKY A;  4B43 A;  3WTT C;  3F22 A;  4PDK A;  3G1O A;  2EFP A;  4BE2 A;  2RGV A;  3AKZ A;  1SAN A;  4RDU A;  4I0A A;  4BKX A;  1HKS A;  2EV5 A;  3BY6 A;  4YII A;  2CUJ A;  3S93 A;  2VLA A;  5E1X A;  3OS1 A;  3B6C A;  5EYR A;  4UUV A;  5F04 A;  1T98 A;  4UV8 A;  2E1C A;  1P7I A;  5ICF A;  3LSH A;  3W2A A;  4L18 B;  3HOU J;  2R7V A;  4BJ5 C;  4CCK A;  3MKY B;  1WJ5 A;  3DKW A;  3RTR A;  1T33 A;  3QP6 A;  2MLK A;  4M6Y A;  4KIB A;  4NNJ A;  5CQE A;  3F21 A;  4A12 A;  1VQ6 I;  2CQX A;  4ABZ A;  2QQ8 A;  1O3R A;  1UG0 A;  4KT5 C;  1I5Z A;  2H09 A;  3M07 A;  2GXB A;  4QLC U;  2HVS A;  5M5Y J;  2DFH A;  1E2X A;  2O3F A;  2EFN A;  4BEH B;  3IL2 A;  4BH9 A;  3F8B A;  3GTM J;  1G3W A;  4J00 A;  5F0C A;  2LP0 A;  3GZ6 A;  1FYL A;  4DJA A;  4XQF A;  5J4Y A;  1CGP A;  3NWS A;  2VI6 A;  3BZ6 A;  2MFZ A;  2XSD C;  4JYK A;  3M7G A;  5ED4 A;  3KZY A;  4IF4 A;  2CW8 A;  4U0W A;  4OIR F;  4PUS A;  5DUK A;  1W0U A;  6PAX A;  2I8D A;  2ZXJ A;  3OWT A;  3CCU I;  4HA8 A;  2CQN A;  2VOO A;  4OMZ A;  1WJE A;  2DJN A;  3L1P A;  3J7Y J;  3LQR A;  4A0X A;  5FD5 A;  3S1Q J;  2QWW A;  3JAM K;  1UEL B;  3JSO A;  2L7F P;  3LNQ A;  3VOD A;  4P1W A;  2VQC A;  5LHH A;  3L2W A;  1GVD A;  2RVC A;  2XRL A;  2E2H J;  2ETH A;  1V55 H;  4GXO A;  2NOG A;  1LE8 B;  3CJT B;  1LQ1 A;  4XOP A;  1FMW A;  1BC8 C;  3JRE A;  1CF7 A;  2AHQ A;  2Y9Y A;  4HNV A;  2A5W A;  1QA6 A;  3OR1 C;  2A6H F;  3DLA A;  3CZ6 A;  5IP7 J;  3CCE I;  3R0A A;  4CZZ A;  2XUB A;  2P6S A;  3I64 A;  4XOT A;  3GVA A;  2HPI A;  4C9Y A;  2IRF G;  2PN6 A;  2BV6 A;  1K4S A;  3JRH A;  2JSC A;  2DPD A;  1ZTR A;  3ZMD A;  4BQQ A;  5GTI C;  5IP9 J;  3V7S A;  1RES A;  2KMU A;  3FKI J;  4OAZ A;  4RAY A;  2BVL A;  5KAI C;  5E79 C;  5K7H A;  1FYM A;  1HW2 A;  1YQA A;  1OCP A;  4JQF A;  1KU3 A;  1IN7 A;  3GTG J;  1KQ8 A;  2K9M A;  2H94 A;  4L5E A;  5K5O A;  2KT0 A;  2R7R A;  1E17 A;  1I27 A;  1RKT A;  3BDD A;  2DTZ A;  3GLL A;  3LSJ A;  1WI3 A;  4RGX A;  1OYW A;  4RLF A;  2LKX A;  2L9R A;  3K4C A;  3VEP A;  4OIP F;  3FDY A;  1UCR A;  3WU1 B;  3I5U A;  4ZDP A;  1B72 B;  3FHN A;  1QQI A;  1O7L A;  1RET A;  2D1H A;  2DXI A;  3LSK A;  3OIO A;  2MW8 A;  2PMZ N;  4P55 A;  1KU2 A;  1MMN A;  1G8X A;  1GT0 C;  1QU3 A;  1Q1H A;  2F5F A;  2DFE A;  2HFH A;  2QA4 I;  1RR7 A;  1XG1 A;  4YEL A;  2DJI A;  4BL0 B;  4O3M A;  2PFB A;  2MBF A;  1N75 A;  2MSY A;  2QSG X;  5CYV A;  2XB5 A;  1U9O A;  3T5X A;  4P9U A;  2AXT C;  2ZBK A;  1U8B A;  3COA C;  3K0L A;  3S3N A;  3BR3 A;  3IAS 2;  3QU3 A;  2JSP A;  3VB2 A;  2FXA A;  4KFC A;  3GYH X;  1VQ8 I;  1W5S A;  4LIV A;  1FPQ A;  1R49 A;  4PZJ A;  1HLV A;  5IP6 A;  1F4K A;  1M1E B;  1IF1 A;  5IY5 H;  1SFO J;  3W6V A;  4B3X A;  4FT8 A;  2ZJQ F;  5DS9 A;  2CU7 A;  3GFJ A;  2MH9 A;  2E7X A;  5DD8 A;  1XMK A;  2DOD A;  3PSI A;  4FX4 A;  1Y8R B;  1I6X A;  3PNV A;  3TO7 A;  1X4P A;  5LRS A;  4KYW A;  1LJ9 A;  2OV7 A;  1FX7 A;  2ESH A;  4U7D A;  4HQE A;  4QPO A;  2HXO A;  4B1R A;  2Y48 A;  5FFZ A;  1B59 A;  2UZK A;  3MCZ A;  1NTC A;  5HDG A;  3ZMU A;  2A68 F;  4IJA A;  3IKT A;  4UB8 C;  2OUM A;  2L54 A;  2DK5 A;  2XAU A;  4LIU A;  1Y56 A;  4CCJ A;  3JTG A;  1PVE A;  3TOB A;  1HST A;  1SFK A;  1XSV A;  1HSJ A;  2Y30 A;  4PGH A;  3NAR A;  1IN4 A;  3F8M A;  3WTY C;  2VPL A;  4LK0 F;  2YU3 A;  4JK1 X;  1ETO A;  5HLT A;  4LK1 F;  3HPG A;  1QNT A;  3OYA A;  2LH9 A;  2PQ8 A;  2LY2 A;  3K1P A;  3BZC A;  3MMY B;  1W7P A;  3OIP A;  3M3Y J;  3QPS A;  3C1D A;  1BR1 A;  3H35 A;  3HSE A;  1D0Y A;  4UHT A;  2YX4 A;  3CO7 C;  4I98 B;  4RAF A;  4UNO A;  3QOE A;  4BYY A;  2E2I J;  2FQ3 A;  4RB3 C;  1OKR A;  3KP4 A;  4XRF A;  3V7R A;  2IJL A; 
#chains in the Genus database with same CATH homology
 3LA3 A;  3G3Z A;  3WE3 A;  1J5Y A;  4WF2 A;  5BOX A;  1H0M A;  1XB4 A;  4G6D A;  1FP1 D;  4P96 A;  2HYG D;  3QOP A;  4WK8 F;  1J75 A;  2HDC A;  1V4R A;  3GUD A;  5D5U B;  2KIM A;  3KEQ A;  1ON2 A;  4HBL A;  1U6G A;  1FZP B;  1I1S A;  2HGC A;  1SMT A;  4I09 A;  4F7Z A;  3G73 A;  3D5L A;  4HLX A;  1KYZ A;  1DP7 P;  3ML6 A;  4K2E A;  4EM2 A;  3SFZ A;  3WU0 A;  2A3S A;  5E17 F;  3QPH A;  3T8T A;  1B9N A;  3PQJ A;  3J80 K;  1LDJ A;  3WG9 A;  4A5M A;  3DV8 A;  4IRH A;  2KRF A;  5KVR A;  4S04 A;  4RS8 A;  1CF7 B;  1A04 A;  3JAM Z;  5DD4 A;  1ZHF A;  5HLH A;  5DCM B;  2ISY A;  2RKH A;  4OMY A;  4WWC A;  1BBY A;  4NB5 A;  2O6G E;  5L3F A;  4AIK A;  4KUM A;  1BOA A;  4WXD A;  1ULY A;  3JTH A;  2VBZ A;  1XMA A;  5HS9 A;  4LLG F;  4CYD A;  1TTY A;  4EM1 A;  4EQQ A;  4YIF A;  1O3Q A;  3J7A O;  3BPX A;  3ZQ7 A;  4I02 A;  5ILU A;  4BNC A;  3LQQ A;  3T8R A;  3RPU A;  2ZFW A;  2DI3 A;  1QBJ A;  1F9N A;  3W6K B;  4AVP A;  2XAJ A;  2V1U A;  1XDS A;  5CVJ A;  1OYI A;  4HDU A;  1YW7 A;  5JHU A;  3TKY A;  3WTV C;  5DUI A;  3ULQ B;  1O57 A;  4ETS A;  1TNT A;  3Q9V A;  3LAJ A;  2ACJ A;  2DFI A;  1QGP A;  3HRT A;  5D4R A;  2HYF A;  2DO7 A;  1S3J A;  3SZP A;  3WGH A;  5LHI A;  4ZZL A;  2P5L C;  3BPV A;  3DEU A;  1FYK A;  4Y13 A;  1BI2 A;  2LF8 A;  2HTS A;  5TRD A;  4M9X A;  5L3E A;  4EJU A;  2HEO A;  3QRF F;  3R6S A;  4I7H A;  3E5Q A;  4G6Q A;  4U88 A;  2Z99 A;  3TDZ C;  3GZ5 A;  5LEJ A;  3BWG A;  4BHC A;  3QAH A;  4O5V A;  2PMU A;  4R8H A;  1QZY A;  5L3G A;  3BJO A;  1W7P B;  3LA7 A;  4BXU A;  4CDG A;  1T6S A;  3FXR A;  3MEX A;  3J81 K;  3L9F A;  3L00 A;  2ZJ2 A;  2JPC A;  1EH7 A;  4ZH4 F;  3IRQ A;  5E8I A;  1ON1 A;  1BIB A;  3MFK A;  2C6Y A;  3KCC A;  4BHB A;  2BBY A;  2FSW A;  3GO5 A;  3FZV A;  5BPD A;  4HLY A;  4R1H A;  1JXS A;  1YIO A;  2NYX A;  4UV9 A;  1YG2 A;  3KP3 A;  1R5G A;  4A2U A;  2DW4 A;  1XSD A;  2M8E A;  1R58 A;  1T0F A;  2XAF A;  1GXQ A;  2O8X A;  4JBA A;  2ZCW A;  4MEX F;  4HOB A;  1HW1 A;  4EM0 B;  4LD5 A;  1WRJ A;  3B73 A;  2M5W A;  3ZN1 A;  1D8J A;  3KZZ A;  5LGT A;  4CGZ A;  1ZRC A;  2GIV A;  1MGT A;  3WOD F;  1LEB A;  1RZ4 A;  2KJB A;  4Q47 A;  2A61 A;  3RDI A;  2WWY A;  1B4A A;  3HSR A;  1AOY A;  1IXS B;  1RI7 A;  2P8T A;  2FEZ A;  1D8K A;  3CJN A;  2CW0 F;  5CVI A;  3VOE A;  1JHF A;  4XSX F;  1W7P D;  4HAM A;  3Q9S A;  2DAO A;  2DPU A;  1ONV A;  1FP2 A;  3FHZ A;  1S7A A;  1XDU A;  3U9G A;  2VC0 A;  3RYP A;  3DQV C;  2NNY A;  2KIF A;  3S2W A;  4L5I A;  2L4A A;  1FBQ A;  4LB5 A;  2HZT A;  1TW3 A;  5CVU A;  1U3E M;  1YS7 A;  1Z1D A;  1SMY F;  2Z33 A;  4RGU A;  3TO6 A;  3LA2 A;  4U7B A;  1J2X A;  2RQP A;  4WXC A;  1S7O A;  2XRN A;  3IHU A;  4Y17 A;  3F8C A;  3F6O A;  2QQA A;  5ILS A;  2LNB A;  5DDG A;  5CLS A;  1MJA A;  4XLP F;  2BYV E;  2VT2 A;  5KK1 A;  5AIQ A;  2W85 A;  1B1B A;  1HBX G;  1ZG1 A;  4M74 A;  3BJA A;  1XGO A;  3HTS B;  2HOE A;  4WX9 A;  4EJW A;  1SD4 A;  2OQG A;  3L7W A;  3HTU A;  5HVQ C;  2KIU A;  2K4J A;  2FBH A;  2GQQ A;  4I01 A;  5K5Q A;  2OU2 A;  1P6R A;  1XSX A;  1U5T C;  1SFX A;  1D5V A;  3QU6 A;  4RB0 A;  2VBX A;  2PG4 A;  3HOS A;  2HQN A;  4OU0 A;  4P9F A;  5E1Z B;  3ZMZ A;  1ZLJ A;  2PJP A;  3F72 A;  4G94 A;  4G8X A;  1FSE A;  4CIC A;  5FGM A;  2OQR A;  3RI4 A;  1NHA A;  2COM A;  4ZZD A;  1Y0U A;  5K5R A;  1G3T A;  1FNN A;  3EUH A;  4YFX F;  5DEQ A;  3V7C A;  2RC4 A;  1XCB A;  3O2P E;  2TDX A;  4NQW A;  1T2K A;  2MC3 A;  3M8F A;  2FBI A;  1ZG3 A;  3OOP A;  4MEY F;  5DCM A;  1BM9 A;  3J81 Z;  4AWX B;  1P2F A;  5FO5 A;  4UVA A;  4ENJ A;  5ILV A;  2M1B A;  5TJJ A;  4L5J A;  2HKO A;  3IWF A;  1LDK B;  5H6Q A;  3LWF A;  2BGC A;  1SD6 A;  4HZF A;  3I4P A;  1LB2 A;  1R7J A;  2IA0 A;  4LLL A;  1W4M A;  2J5O A;  1Z6R A;  5D4S A;  1TQM A;  2ZNY A;  4L9N A;  1IN6 A;  4EJT A;  4I0B A;  2Z3Y A;  5L3C A;  1PDN C;  4Y15 A;  1R36 A;  2HS5 A;  3KP6 A;  2MH2 A;  4LB6 B;  1FBS A;  2HR3 A;  2XVC A;  1R23 A;  2FNP A;  3GWZ A;  2F5D A;  2XHK A;  5BS6 A;  3E6D A;  2M45 A;  2IW5 A;  1ZN2 A;  2QEN A;  5LRR A;  3MZY A;  1FLI A;  3WGI A;  3K1M A;  1WI9 A;  1ZRD A;  4WXH A;  4ESJ A;  2FBK A;  1YFH A;  1XN7 A;  4A0Y A;  4Q48 A;  1V3F A;  3E6C C;  3VFZ A;  1U78 A;  2XAQ A;  1UFM A;  1LEA A;  4A5N A;  2YSR A;  1K7A A;  1EH6 A;  2QQB A;  5E18 F;  4IRG A;  5FD6 A;  1Z6T A;  2L3D A;  1YYV A;  2EFQ A;  2GZW A;  3L09 A;  1GXP A;  5CVR A;  1YW8 A;  1WWX A;  2DU9 A;  5A2Q K;  1R5H A;  3HYI A;  2X4H A;  4MQ9 F;  2LDU A;  3U1D A;  1C0W A;  4YFK F;  1SD7 A;  4DNC A;  3H3U A;  3I58 A;  1D3Y A;  3C18 A;  1UST A;  4B8X A;  1J9I A;  3H3Z A;  3P9C A;  1BI0 A;  3MZH A;  4PCQ A;  5H20 A;  5JI6 A;  4I2O A;  3CUO A;  1XCV A;  3GF2 A;  3C7J A;  2K7L A;  3BJ6 A;  1G4D A;  1KGS A;  3GXO A;  3WTU C;  2WTE A;  2LKP A;  3R4K A;  3HOT A;  1HW5 A;  4BHP A;  2W57 A;  4EVI A;  3SHF A;  3GEZ A;  3P7N A;  2W25 A;  4KN7 X;  5LEK A;  2YR2 A;  3MAJ A;  4GO1 A;  3EQL F;  3E6B A;  2AXL A;  3DF8 A;  3MWM A;  1G3Y A;  2M30 A;  1F5T A;  4L0Y B;  5JVT A;  4ZYD A;  2QVO A;  4EMS A;  5IT9 K;  2XGX A;  1X3U A;  3ECH A;  4ENM A;  2GAU A;  1F1Z A;  3TDU C;  2EB7 A;  5FFX A;  4HW0 A;  5IT3 A;  1Z91 A;  2HWV A;  5LBQ A;  3IKV A;  1OYY A;  1W5T A;  3K9T A;  3I54 A;  2JPB A;  2NRA C;  2K4B A;  1IW7 F;  2FNA A;  2VT3 A;  2CG4 A;  3RJP A;  1YTY A;  3R61 A;  5ERI A;  3I59 A;  5HDK A;  2Q8K A;  5FB2 A;  5ICE A;  3NEU A;  2IVM A;  4ESB A;  3SQN A;  2XKP A;  4D0P A;  2WC2 A;  3TO9 A;  3I0T A;  2M87 A;  2QZ8 A;  2GXG A;  1IZ1 A;  4A0Z A;  4KIF A;  4HQM A;  1FY7 A;  3ERE D;  1MJ9 A;  4HF2 A;  1U5T B;  4LMY A;  1WQ2 A;  2QLZ A;  1PP7 U;  2JTV A;  3E3V A;  4IHS A;  3NRV A;  3W6J B;  5H6R A;  2DK8 A;  5J6X A;  1O3T A;  3HUG A;  4ENN A;  2EK5 A;  4AIH A;  2P4W A;  2OZU A;  1KU7 A;  4KDP A;  5BMZ A;  4U0Y A;  2LF7 A;  2DTR A;  1K79 A;  1R1U A;  2CO5 A;  1B6A A;  3ECO A;  2FE3 A;  5LLQ A;  3SZT A;  2VE8 A;  1RUN A;  1R00 A;  3FX3 A;  4CO8 A;  3HRM A;  2MLG A;  4QWQ A;  3KET A;  1BJA A;  2H6B A;  3V4G A;  3NQO A;  2ESN A;  2RN7 A;  5LHG A;  5A2Q Z;  4ZYH A;  3KLO A;  3E5X A;  2F5E A;  1HQC A;  5E1W A;  2DLL A;  2P6T A;  1RUO A;  1DPU A;  5HDN A;  1UB9 A;  2D1V A;  4DQ2 A;  2ELH A;  4U0V A;  2V1D A;  3OV8 A;  2STW A;  4HX8 A;  1YLF A;  3GFM A;  1Z7U A;  2P5K A;  5HS8 A;  3RKX A;  3P9K A;  4GGG A;  4OOI A;  3B02 A;  2KKO A;  3L2C A;  1UHM A;  2PBI A;  3GFL A;  3AAF A;  5HOO A;  2Y0M A;  3I71 A;  4KN4 X;  1SFE A;  3DFG A;  3ZN0 A;  5E20 A;  1U2W A;  2UXN A;  1ZRF A;  3D0S A;  2EV0 A;  3HRS A;  3ZMV A;  2HKX A;  4RAZ A;  4RGR A;  5IT9 Z;  1QO0 D;  5BPI A;  2JRT A;  4A6D A;  4M9S A;  1FC3 A;  3R60 A;  1K6O A;  3CUQ C;  1TQI A;  3REO A;  1GHC A;  3BOQ A;  2P5V A;  2ZNZ A;  2W24 A;  2OZ6 A;  5DCF A;  3KP5 A;  4HYE A;  4AIJ A;  3KP7 A;  1T38 A;  1LDD A;  2XIG A;  3I59 B;  4ZYE A;  2P7C B;  2FF4 A;  3WE2 A;  3GX4 X;  2R3S A;  4TV7 A;  4HF1 A;  5D5W B;  1SD5 A;  1ZGA A;  1KA8 A;  2L4M A;  3HRU A;  4B09 A;  1R22 A;  3Q5F A;  2YPR A;  2RNJ A;  3EYI A;  4BQA A;  1GVJ A;  4IHT A;  2L02 A;  4LFU A;  3DPL C;  4BAY A;  5JFR A;  3WTZ A;  4UVC A;  3QP5 A;  3FMS A;  4ENK A;  2STT A;  3KFW X;  1FBU A;  3FMQ A;  5L3D A;  4R79 A;  2FRH A;  4N9H A;  1ZYR F;  2ZME B;  4YG2 F;  3O3K A;  2EFO A;  4EJV A;  2V1X A;  3T0Y A;  4M71 A;  2BEO A;  2ADU A;  3LST A;  1TQP A;  4L9J A;  1S8N A;  3FXQ A;  2MA3 A;  2VBY A;  4OIQ F;  2BE5 F;  3E6M A;  4OIN F;  4EV0 A;  3N97 A;  4FHT A;  1O3S A;  1T39 A;  1FWZ A;  3TGN A;  1KQ9 A;  4L9T A;  4LJZ F;  2VE9 A;  1IRG A;  2E7W A;  2O03 A;  4MHG A;  1BI1 A;  4LG0 B;  4LLN A;  1WKM A;  3HIF A;  2OAZ A;  1G3S A;  2ISZ A;  2OD5 A;  2CQK A;  2E1N A;  1SAX A;  1IUY A;  3RKW A;  4EJO A;  5FLX Z;  4HX4 A;  5K1Y A;  2CGP A;  1DDN A;  2RDP A;  5DYM A;  5AON A;  1ZRE A;  5ICC A;  4S05 A;  1I1G A;  2ZO4 A;  3CUQ A;  2JT1 A;  2NAZ A;  1OMI A;  1KU9 A;  1KYW A;  2OBP A;  1IXR C;  2O61 A;  3GFI A;  4XSZ F;  5EEG A;  3ZPL A;  1PUE E;  4YFN F;  3KEO A;  3RYR A;  3DXJ F;  5CVV A;  3CTA A;  3E5U A;  2DQL A;  3V8J A;  2WV0 A;  2EV6 A;  3IC7 A;  2KJC A;  2QYO A;  2UXX A;  1DPR A;  5D5X B;  1QZZ A;  2CWE A;  3K69 A;  2P7V B;  2HQR A;  2PMH A;  1U8R A;  1U5T A;  3BRO A;  3ZP5 A;  5D8L B;  2CFX A;  2F2E A;  5AIP A;  2EJR A;  2QBY A;  1BN5 A;  3KP2 A;  2F5C A;  3KE2 A;  4Q5S F;  3P9I A;  4RB2 C;  2Q0O A;  2O0Y A;  3FM3 A;  4HV5 A;  4ASN A;  1L3L A;  2QM3 A;  4E70 A;  2FOK A;  4HX7 A;  2Z9O A;  4HDV A;  1RIO H;  1EV7 A;  3V8L A;  5JR3 A;  1MDM A;  5HLG A;  2UWM A;  2VN2 A;  1ZG5 A;  2G9W A;  1DUX C;  1ZGJ A;  1TNS A;  5D8K B;  4KMU X;  3JSP A;  2PEX A;  3F23 A;  4CXF A;  1YO5 C;  1KQ0 A;  5HLI A;  1P4W A;  2XAH A;  4M73 A;  4M6X A;  4XLN F;  3T1B A;  1S6L A;  4XBF A;  5EEH A;  1G6N A;  1O7F A;  3ELK A;  3SXY A;  1P92 A;  5BQT A;  3IRR A;  3HSF A;  2DT5 A;  3TOA A;  4EGY A;  3WTW C;  1MKM A;  1MD0 A;  2A5Y B;  1TLH B;  2D45 A;  1IXC A;  4IPA A;  3MQ0 A;  2NNN A;  3RPQ A;  3U2R A;  3HHH A;  5J8C A;  1BIA A;  3EYY A;  4Q4Z F;  3GW2 A;  5D6F A;  1BI3 A;  1Z05 A;  2VXZ A;  1H9T A;  5E8G A;  5LGU A;  3HHG A;  4ZYG A;  4GYG A;  3V8K A;  2H6C A;  4KA4 A;  3ABT A;  1IRF A;  2FA5 A;  4N0B A;  2H27 A;  1XGS A;  4FX0 A;  4O6J A;  2K02 A;  1RNL A;  2EWN A;  2HTJ A;  2XAS A;  3ZMT A;  1MJB A;  3TQN A;  4A6E A;  2ZKZ A;  3ABU A;  1ZLK A;  1IN8 A;  4IXA A;  3N4M A;  2X0L A;  4ON0 A;  5ICG A;  1EH8 A;  1K78 A;  3CUQ B;  1FT9 A;  3LFK A;  2GA2 A;  2B0L A;  1J0R A;  3IWZ A;  1YS6 A;  4RB1 A;  2K86 A;  5F1R A;  2GA1 A;  2W84 A;  3I53 A;  3CDH A;  4WCG A;  4UXN A;  1OPC A;  5D5V B;  2A6E F;  1FOK A;  2RV8 A;  3FF5 A;  1OR7 A;  2CYY A;  2FMY A;  3BP8 A;  2IP2 A;  4G9Y A;  5F6F A;  2EA2 A;  2PI0 A;  1PP8 F;  4G7O F;  4GCV A;  2MD5 A;  2PLY A;  2EA4 A;  3CO6 C;  4HF0 A;  3F3X A;  2VON A;  2IA1 A;  2A69 F;  2R7F A;  2VOD A;  2JZY A;  2ZME A;  1REP C;  3M9A A;  2QBY B;  1Z9C A;  3K1N A;  3ROU A;  2EFW A;  5F64 A;  3KLN A;  4MQV A;  2IT0 A;  2YX7 A;  4KNY A;  3C3W A;  5D6E A;  3F6V A;  3GLX A;  1R1T A;  1ZH5 A;  1P4X A;  3DPT A;  3FMR A;  4MTD A;  4IRI A;  2OA4 A;  3JW4 A;  4MGR A;  1MDM B;  4M9Z A;  3F8F A;  3H92 A;  1FSH A;  3PQK A;  4LG0 A;  1P4A A;  2QUF A;  4KIG A;  2GWR A;  5FLX K;  1JHH A;  3WTX C;  1IAW A;  1TW2 A;  1R1V A;  2Q2E A;  2Y75 A;  2IPQ X;  1LVA A;  4GYI A;  2G7U A;  3ISP A;  1L0O C;  5LGN A;  1MZB A;  4L0Z B;  1S29 A;  2K27 A;  3RIR A;  2FML A;  3R0J A;  1J7K A;  2XAG A;  4UVB A;  2L01 A;  1IN5 A;  1USS A;  5CJ9 A;  2Z5U A;  1ODD A;  3O6B B;  3F8N A;  2V79 A;  3FWE A;  3M1E A;  1BC7 C;  1JGS A;  5L3B A;  4HV6 A;  4Z2Y A;  2CSO A;  4P5O A;  4LGW A;  5J8F A;  3LAP A;  1SFU A;  4G7Z F;  2D2W A;  4EGZ A;  2DBB A;  1QPM A;  1XGM A;  2FU4 A;  4KIC A;  4RGS A;  4MTE A;  3FXU A;  3DP7 A;  1JE8 A;  2IA2 A;  3K2Z A;  4H0E A;  3PFI A;  1TBX A;  2DQR A;  5HS7 A;  4ESF A;  1HKQ A;  3EDP A;  2XRO A;  2LSO A;  1J59 A;  3FM5 A;  1XGN A;  2QQ9 A;  1WSU A;  2G7H A;  4PGG A;  2NS0 A;  4KMF A;  3J80 Z;  1XD7 A;  2XKO A;  1YW9 A;  2V9V A;  3EET A;  1UHW A;  1K78 B;  1H9G A;  2R7D A;  4OIO F;  3E97 A;  1B9M A;  2AS5 F;  4G7H F;  1LNW A;  4MNU A;  1ZAR A;  4M72 A;  1ZAO A;  2J5P A;  3WGG A;  3CLO A;  2V6C A;  1AWC A;  4NHJ A;  2VBW A;  2VOP A;  1VTN C;  4IVN A;  1HXD A;  1STZ A;  1HKT A;  4CHU A;  2XV4 S;  4AD9 A;  3ZMS A;  4L9V A;  3M8E A;  2VC1 A;  4N9I A;  5DV5 A;  2A07 F;  3QPT A;  3WTS C;  3RKY A;  3WTT C;  3F22 A;  4PDK A;  2EFP A;  2RGV A;  4I0A A;  1HKS A;  2EV5 A;  3BY6 A;  4YII A;  5E1X A;  4UUV A;  2E1C A;  1T98 A;  4UV8 A;  5ICF A;  4L18 B;  3DKW A;  3RTR A;  3QP6 A;  2MLK A;  4M6Y A;  4KIB A;  3F21 A;  4A12 A;  1O3R A;  4KT5 C;  1I5Z A;  2H09 A;  2GXB A;  4QLC U;  1E2X A;  2O3F A;  2EFN A;  3IL2 A;  4BH9 A;  3F8B A;  1G3W A;  3GZ6 A;  1FYL A;  1CGP A;  3BZ6 A;  3M7G A;  5ED4 A;  3KZY A;  4IF4 A;  4U0W A;  4OIR F;  5DUK A;  6PAX A;  2ZXJ A;  4HA8 A;  2VOO A;  4OMZ A;  3LQR A;  4A0X A;  5FD5 A;  2QWW A;  3JAM K;  3JSO A;  3VOD A;  5LHH A;  2RVC A;  2ETH A;  4GXO A;  1LQ1 A;  1BC8 C;  1CF7 A;  2A6H F;  3R0A A;  4CZZ A;  2XUB A;  2P6S A;  3I64 A;  3GVA A;  2IRF G;  2PN6 A;  2BV6 A;  2JSC A;  2DPD A;  3ZMD A;  3V7S A;  4RAY A;  1FYM A;  1HW2 A;  1YQA A;  4JQF A;  1KU3 A;  1IN7 A;  1KQ8 A;  2H94 A;  5K5O A;  1E17 A;  1I27 A;  3BDD A;  4RGX A;  1OYW A;  3VEP A;  4OIP F;  1UCR A;  3WU1 B;  3I5U A;  1QQI A;  1O7L A;  2D1H A;  4P55 A;  1KU2 A;  1Q1H A;  2F5F A;  2HFH A;  4O3M A;  2PFB A;  2MBF A;  5CYV A;  4P9U A;  3T5X A;  2ZBK A;  3COA C;  3K0L A;  3QU3 A;  3VB2 A;  4KFC A;  2FXA A;  3GYH X;  1W5S A;  1FPQ A;  4PZJ A;  1F4K A;  1IF1 A;  4FT8 A;  3GFJ A;  2MH9 A;  2E7X A;  5DD8 A;  1XMK A;  4FX4 A;  1I6X A;  3TO7 A;  5LRS A;  4KYW A;  1LJ9 A;  1FX7 A;  2ESH A;  4U7D A;  4HQE A;  5FFZ A;  2Y48 A;  1B59 A;  2UZK A;  3MCZ A;  5HDG A;  3ZMU A;  2A68 F;  4IJA A;  3IKT A;  2L54 A;  2DK5 A;  3JTG A;  3TOB A;  1HST A;  1XSV A;  1HSJ A;  4PGH A;  1IN4 A;  3F8M A;  3WTY C;  4LK0 F;  2YU3 A;  4JK1 X;  4LK1 F;  1QNT A;  2PQ8 A;  3K1P A;  1W7P A;  3C1D A;  3HSE A;  4UHT A;  2YX4 A;  3CO7 C;  4I98 B;  4UNO A;  4BYY A;  2FQ3 A;  4RB3 C;  1OKR A;  3KP4 A;  4XRF A;  3V7R A;  2IJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...