4M72A

Mutant structure of methyltransferase from streptomyces hygroscopicus
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGEYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
total genus 119
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m72A01
5FLXZ 1FWZA 4LB6B 1JHFA 2M5WA 3ELKA 3BJOA 4G94A 3TQNA 3ZN1A 4A12A 4Y13A 5D5XB 3T8RA 3CO7C 4HV6A 1GVJA 5ED4A 3O3KA 3G3ZA 4L9VA 1ZG5A 2P6SA 2KJCA 1LQ1A 3TO6A 3E6DA 2EWNA 1USSA 3LAPA 2V9VA 2WWYA 5LBQA 1UFMA 2K4JA 2ESNA 2FSWA 4WK8F 2DFIA 1MGTA 5DUKA 2NNYA 2GIVA 1P4XA 2IJLA 2V79A 2F5FA 4G7OF 1P2FA 3J80Z 1CF7B 3QPHA 2IRFG 1T39A 1HKTA 2DQLA 5L3GA 2P5VA 4O5VA 1ZRDA 3LQQA 2ZNYA 1KYZA 2PFBA 1R5HA 4ZZLA 1G3SA 2FNPA 2PLYA 3SQNA 4RGSA 4ZYDA 4I01A 2P8TA 3I54A 4M6XA 4UVCA 3IRQA 1K78B 1DP7P 4YFXF 4OIOF 1TNSA 3CUOA 2Y75A 5JHUA 4GGGA 4BQAA 2F2EA 4A6EA 6PAXA 3WTVC 3N97A 1YS7A 4ON0A 5L3CA 2XVCA 5JR3A 3F6OA 2EA4A 5LRRA 3C1DA 1ONVA 3GYHX 3VEPA 4BYYA 1JGSA 3M7GA 1I27A 4PCQA 4Q4ZF 3T1BA 4M9XA 3KEOA 1TW3A 1MKMA 2FMLA 2HTJA 2XIGA 3GVAA 4BAYA 1FZPB 2VT2A 4MQVA 4NHJA 4HQEA 5A2QZ 3E6CC 5HLHA 5LHIA 2IA2A 3ZMZA 1FSHA 2FA5A 3TOAA 1B6AA 2GAUA 4RGUA 1XCBA 4KFCA 2XHKA 2UZKA 3I5UA 3FX3A 5FD5A 5J8CA 3TO9A 5LHGA 1B9MA 3V8KA 4FHTA 5BPIA 2IVMA 4IJAA 2EFQA 3Q9VA 4KUMA 3GFIA 1Z05A 3Q9SA 3DKWA 1IXCA 2YSRA 5HDGA 2E7WA 3BZ6A 2M1BA 1BIBA 4OMZA 3P7NA 3RPUA 3HTUA 3I59B 3FXUA 3REOA 2DW4A 2ZMEB 4AIHA 2EK5A 3M9AA 2D2WA 3PQJA 2EV6A 3I4PA 4UNOA 4ENMA 2ELHA 1HSJA 5CJ9A 3WTWC 2Z33A 2FEZA 2B0LA 2M30A 3HRUA 3WTTC 2XKPA 1YYVA 4U88A 4ZYHA 4LFUA 4P9UA 2KKOA 2H09A 3RKYA 4EMSA 3NEUA 3WG9A 3DXJF 2OBPA 3GW2A 2LKPA 3F21A 1KYWA 2HKOA 4L9JA 2NNNA 2Z5UA 1IW7F 2A6EF 4RS8A 4OIQF 3TDZC 1LDJA 1Z6RA 2H6CA 1W7PD 4YG2F 2ISZA 5IT3A 5K5OA 4EJTA 2OD5A 3B73A 2YPRA 2YU3A 3KE2A 5FO5A 1J0RA 2UWMA 2GA1A 1REPC 4IF4A 1RIOH 2LF8A 1L0OC 4I02A 1XDSA 1HBXG 1FX7A 1D5VA 4BHPA 4ZZDA 4A0YA 1XMAA 2RQPA 2F5CA 3ABTA 1V4RA 3HSFA 5E18F 4P9FA 2HWVA 3ERED 2DT5A 3ISPA 2KRFA 1HQCA 2G9WA 3H3UA 4EJUA 4HLYA 2Z3YA 3GFMA 2Y0MA 1B1BA 5J8FA 4KT5C 5FLXK 2Q8KA 4I2OA 2FBKA 2V1UA 2HGCA 2WV0A 4ZYGA 3FXQA 1ZYRF 3M1EA 1ON2A 4PGHA 3KZZA 1ZN2A 1F5TA 3DPTA 4LLLA 4LLNA 4YIFA 2G7HA 1Q1HA 3R60A 4A5NA 1F1ZA 1SD5A 2XV4S 3HHHA 4U0WA 1LDDA 1U6GA 2W84A 1R1UA 2CYYA 1OPCA 2V1XA 1HKQA 2HTSA 2QZ8A 2A5YB 3C3WA 4F7ZA 1MZBA 2J5OA 4GCVA 3J80K 3DFGA 3FF5A 3F8MA 5KK1A 4U7DA 5AIQA 1TQIA 4MTDA 4A0XA 4NB5A 1B4AA 2HYGD 1VTNC 1RUNA 2VOPA 2FBHA 1IUYA 2FXAA 5BQTA 3SXYA 2E1NA 3L2CA 2PI0A 1G3TA 3ECHA 5DEQA 2DTRA 4LMYA 4L5IA 5LGUA 2JZYA 1WSUA 1G3YA 1KU7A 1FYMA 5D8LB 2HS5A 4JK1X 1MJAA 2VOOA 1O3QA 4FX4A 1BIAA 2QUFA 1UHMA 4KIGA 1P6RA 2AXLA 3LA2A 3EYYA 5LGTA 3K1PA 1Y0UA 2YR2A 1BC7C 2IT0A 1BI1A 4DQ2A 2VBWA 2XRNA 4G6QA 5BOXA 1YQAA 1ZGAA 3RKWA 3O2PE 4KA4A 3OV8A 4OINF 5L3FA 4WXDA 1H0MA 2XAGA 1ULYA 4BXUA 5D8KB 3KFWX 3FM3A 3GZ5A 1SMYF 1W5TA 2LF7A 4KDPA 2PBIA 1XSVA 5ERIA 4A5MA 4M71A 1BM9A 3MFKA 1ZREA 5E1XA 1T2KA 2K27A 5EEGA 3R61A 1SFXA 5K5QA 2RV8A 2VC0A 2AS5F 5BMZA 1QO0D 2EFNA 4M9ZA 2QYOA 4OOIA 1C0WA 4HOBA 3M8EA 5A2QK 3C7JA 1BJAA 3FM5A 4BH9A 3FHZA 4B8XA 4HX4A 1H9TA 1JXSA 2HFHA 2CW0F 1FY7A 2STWA 4A0ZA 1AWCA 3E5XA 3H3ZA 1JE8A 4U7BA 1U78A 2H6BA 3R0JA 4AD9A 1IZ1A 4AIJA 5D6FA 2E1CA 4LG0A 1MJ9A 5LHHA 4ENNA 4IRHA 1O3RA 3MWMA 1ZAOA 2PQ8A 1JHHA 4NQWA 1XN7A 5ILVA 3LWFA 2NAZA 2CSOA 4LK1F 1GXQA 1S8NA 1NHAA 3T0YA 5J6XA 1KQ8A 5DDGA 5HOOA 2P7CB 3F8BA 3LA3A 3S2WA 5E1WA 1MDMB 5JFRA 1K7AA 4ZYEA 2FE3A 4LLGF 3RIRA 4GYIA 4QWQA 3U1DA 4HF2A 4HF1A 4RB3C 1QNTA 2MLKA 5L3EA 2GXBA 1S3JA 4KN4X 2ESHA 3AAFA 2PEXA 5L3DA 1DUXC 4O3MA 1BC8C 1SD6A 3D5LA 1G6NA 3R0AA 2HEOA 3ZQ7A 1E17A 2GZWA 1WWXA 2HZTA 4XSZF 4BHBA 2BEOA 4UVBA 1O7LA 4EJWA 1F9NA 3I0TA 3JTGA 4ESJA 5LGNA 4MNUA 2Q2EA 4RGRA 1S6LA 5H6QA 2RNJA 3FWEA 1XB4A 5ILSA 4HX8A 4G8XA 5HLIA 2D1HA 1A04A 4LJZF 3COAC 3RYPA 3KETA 2H27A 4WF2A 5H20A 2QQBA 3E3VA 3CJNA 3J81Z 2QQ9A 4XRFA 4G7HF 4N9HA 3GX4X 3HTSB 2Z9OA 5CVRA 4HQMA 5DD4A 3JAMZ 1W7PB 2WC2A 5TRDA 2JPCA 3HOSA 4UHTA 1BN5A 1SD4A 2P5LC 2QM3A 3K69A 3GWZA 1R1TA 2R7FA 1BBYA 3DQVC 1IXRC 3FMSA 4EV0A 2X0LA 2ZBKA 4A6DA 3KZYA 1IXSB 1XD7A 1RUOA 3L00A 1IN5A 5D6EA 3QP5A 2FF4A 1P4AA 5ICFA 3GO5A 2OZUA 1YW7A 5BS6A 2HQRA 1WI9A 3IC7A 4CXFA 2LSOA 3ML6A 4D0PA 1FC3A 2JT1A 1HXDA 2MD5A 3I71A 3KLOA 2XROA 1OKRA 3DEUA 4KN7X 1HW1A 1MD0A 3EDPA 1D3YA 3L9FA 1G4DA 4OMYA 2DK8A 3W6KB 1G3WA 2P6TA 2QLZA 1ON1A 3KP5A 4XLPF 3IWFA 1ZG3A 2PJPA 2VODA 4EVIA 4RB0A 1MDMA 2L4AA 2RC4A 4HAMA 1U3EM 2DBBA 4HBLA 2J5PA 4RB2C 1QQIA 2GWRA 2KIMA 2GQQA 4QLCU 3WTZA 4I09A 1IN4A 2IW5A 3E97A 2YX7A 4M73A 2MLGA 4BHCA 3WTSC 4B09A 3F8CA 2HR3A 4G9YA 5ICGA 2IA1A 1LDKB 3K1MA 1FYLA 3DP7A 3BWGA 1KU9A 2W25A 1TTYA 1YLFA 2BGCA 3BJAA 4HW0A 3JW4A 1T0FA 3P9KA 1R58A 3CLOA 1K79A 4HF0A 4RGXA 1B59A 4WCGA 5FFXA 2CFXA 2QBYB 4U0YA 2EV0A 4EJOA 1IRFA 4M9SA 2VXZA 4EGYA 4LGWA 2O6GE 1T98A 2UXNA 5ICCA 1J5YA 1HSTA 2Q0OA 2BYVE 2XUBA 3BPXA 2EA2A 4LK0F 1W7PA 3RPQA 5JI6A 2ETHA 4YFNF 1L3LA 1ZLJA 3V7RA 1QZYA 2K02A 2OA4A 2M87A 4PZJA 3K0LA 5IT9K 1LB2A 1SFEA 3LQRA 5DUIA 2A6HF 2EFWA 2ZKZA 3L09A 5HS8A 1FYKA 3ZP5A 3IRRA 1D8JA 5FD6A 4HDUA 1R23A 4HV5A 4M6YA 2CGPA 4RAZA 2JPBA 3BJ6A 1I1GA 1SD7A 2KIUA 3V7SA 2ADUA 3TO7A 4WWCA 2L3DA 5L3BA 1RNLA 1V3FA 2ZXJA 3V7CA 4L9TA 1YW8A 5E1ZB 4LG0B 3EUHA 3I64A 2DI3A 2PMHA 3KLNA 3WGIA 1OYWA 4MHGA 1UCRA 1KA8A 3WTYC 2QWWA 4BNCA 2BBYA 2A61A 4L18B 3ECOA 1J7KA 4KNYA 4Y15A 1LVAA 3HRMA 3FMQA 4EM1A 2K86A 4L0YB 4ESBA 3RDIA 1ZG1A 1XDUA 4IVNA 4JQFA 3VFZA 2XAFA 3R4KA 3GFJA 3W6JB 1BI2A 2KIFA 3TGNA 4Q5SF 2YX4A 3SFZA 4M72A 4IXAA 3RYRA 1U5TA 3HHGA 3CUQB 5DD8A 3RTRA 3CUQC 2W85A 4UUVA 3CTAA 3RKXA 4FX0A 3QAHA 2HKXA 2R3SA 4HYEA 3VODA 4GO1A 3ZN0A 3EYIA 4HZFA 2ZJ2A 5F1RA 1Z1DA 3N4MA 4ENKA 2QBYA 4CHUA 1R5GA 4CO8A 3IL2A 2HYFA 1SAXA 1UB9A 3ZMTA 4KMUX 5FGMA 1O57A 1YO5C 3V8LA 4CGZA 3F72A 5K5RA 3HIFA 3I58A 1IRGA 5HS9A 2ISYA 1WQ2A 2O0YA 4ETSA 4Q48A 1LEAA 2FQ3A 3ZMVA 2IP2A 2MH9A 4RB1A 3RI4A 2CQKA 2CO5A 1E2XA 5FB2A 1FT9A 5F6FA 1DPUA 2W57A 2ACJA 4K2EA 3VB2A 4JBAA 3GZ6A 2EFOA 2DPUA 4GXOA 1TBXA 1TW2A 1EH6A 1FBUA 1FSEA 2MA3A 3JAMK 1OYIA 3T5XA 4S04A 3EETA 1R36A 3F8FA 3HSRA 2NRAC 1ODDA 1ZARA 2PG4A 1ZGJA 1ZH5A 2RGVA 4S05A 2VBXA 4IRGA 2P5KA 3EQLF 3KP2A 4L5JA 4UXNA 3KEQA 2UXXA 4MTEA 4Z2YA 3OOPA 3KP6A 2OZ6A 2RVCA 2VC1A 3G73A 5JVTA 2K4BA 4UV8A 3TKYA 4R79A 2QENA 2JSCA 3IKTA 1ZRCA 4KIFA 2D45A 5HDKA 5LLQA 1TQPA 4P5OA 1FBSA 3T8TA 3D0SA 3WODF 3MQ0A 2F5DA 1LNWA 4LB5A 2V1DA 4ENJA 2OAZA 3CDHA 2KJBA 4WX9A 2ZFWA 2DPDA 1LEBA 3HRTA 2MBFA 2QVOA 1O3TA 1QPMA 4AWXB 2A07F 3CUQA 2DO7A 4WXCA 1R22A 3FXRA 2VE9A 3J7AO 1ZRFA 3WGHA 3R6SA 2RKHA 4YIIA 3BDDA 2DAOA 2GXGA 1X3UA 1LJ9A 3JSOA 4M74A 2OQRA 5AONA 1WRJA 5HLGA 1ZHFA 2VBYA 4ESFA 1H9GA 3P9CA 2MH2A 4HDVA 3WE2A 2BV6A 3TDUC 5TJJA 1S7OA 5BPDA 5F64A 1YG2A 4A2UA 3F22A 4G6DA 2O61A 2ZNZA 2VN2A 3VOEA 2LDUA 3MCZA 4EM0B 2XAQA 1XGOA 2FMYA 3QRFF 3QU6A 2VE8A 1P92A 1DPRA 3QP6A 5K1YA 4TV7A 2X4HA 4UV9A 3WTXC 2C6YA 3ZPLA 3MEXA 4I0AA 2IPQX 1USTA 3LAJA 5DCMA 3HRSA 1I6XA 1PP7U 4IHTA 4R8HA 4L9NA 2O3FA 3HYIA 1TLHB 1YTYA 2M45A 3F6VA 4UVAA 2FNAA 3SZTA 1HW2A 2V6CA 3H92A 3LFKA 1W5SA 3NRVA 2XGXA 1J75A 4WXHA 1YS6A 3U9GA 2IA0A 4EJVA 1EH8A 2XAJA 2GA2A 3IWZA 4KYWA 3DV8A 1PP8F 4I0BA 1XGNA 4N9IA 2RN7A 1YFHA 4ZH4F 2CWEA 2DU9A 1WKMA 3IKVA 3F23A 2VONA 1Z91A 1FOKA 3ZMUA 4GYGA 4EM2A 1FPQA 1D8KA 1HKSA 1S29A 2O8XA 1FP1D 2M8EA 2XASA 2PMUA 4IHSA 4EGZA 4P55A 4G7ZF 3GLXA 1FLIA 4DNCA 5D4RA 2COMA 1PDNC 4P96A 1ZLKA 5HDNA 1CGPA 1K6OA 2P4WA 3CO6C 2FBIA 1OYYA 4YFKF 5LRSA 1U5TB 4OU0A 1U5TC 1CF7A 2OQGA 3WE3A 2OU2A 2DLLA 4MGRA 1QGPA 3GEZA 3GFLA 5HS7A 2A69F 1HW5A 4XSXF 1STZA 2E7XA 4IPAA 2LNBA 3FZVA 1BI3A 2O03A 3MZYA 1DDNA 1I1SA 3E5UA 1J2XA 2EFPA 1IN7A 2L02A 4MQ9F 1K78A 3LA7A 2A3SA 1FBQA 2MC3A 3HUGA 5DYMA 3IHUA 3K2ZA 2L4MA 2EV5A 2CG4A 1J59A 3LSTA 1UHWA 4IRIA 3DPLC 3NQOA 1FP2A 1W4MA 1KU2A 4R1HA 4Y17A 1R7JA 4MEYF 3FMRA 1TQMA 5E20A 1I5ZA 4I7HA 2FOKA 4OIRF 4AIKA 1XCVA 1R1VA 3WU0A 4KICA 2R7DA 3SZPA 1Z7UA 2G7UA 1XSDA 1IN8A 4I98B 5CVVA 1T38A 1KGSA 3GF2A 5H6RA 4HLXA 1BI0A 3KCCA 4O6JA 3V8JA 1Z6TA 1Z9CA 3K9TA 5LEJA 4MEXF 1BOAA 2NYXA 1IAWA 5DV5A 5D5VB 1B9NA 3BPVA 3ZMDA 3RJPA 3E5QA 2Y48A 5EEHA 5CVUA 4OIPF 1SFUA 1GHCA 3KP3A 4N0BA 5E8GA 3GXOA 5E8IA 4KMFA 5FFZA 1QBJA 1U8RA 2VT3A 4E70A 1KQ9A 3PQKA 2EJRA 2QQAA 2HDCA 5ILUA 2STTA 1RI7A 3SHFA 4HA8A 2NS0A 1EV7A 3JSPA 1IN6A 3B02A 3P9IA 1T6SA 2L54A 3ABUA 3QU3A 4LD5A 1AOYA 2RDPA 3M8FA 3I59A 3U2RA 1TNTA 2ZMEA 1XSXA 2A68F 5CLSA 2W24A 2WTEA 4CICA 1IF1A 1S7AA 1KU3A 3C18A 2ZO4A 2K7LA 5ICEA 3WTUC 1U2WA 3BY6A 2D1VA 2JTVA 1GXPA 1MJBA 4U0VA 1FNNA 5DCFA 3E6MA 4CDGA 3KP7A 4H0EA 4XLNF 1OR7A 3L7WA 4XBFA 5LEKA 1PUEE 3JTHA 3MZHA 4HX7A 5CVJA 1YW9A 3HSEA 3HOTA 2DK5A 1OMIA 3BOQA 1XMKA 2FU4A 3O6BB 3KP4A 2XKOA 3ULQB 1KQ0A 1O7FA 5D5UB 5HVQC 2PN6A 3WU1B 4KIBA 2H94A 5CVIA 4EQQA 4L0ZB 5AIPA 3F8NA 3GUDA 3DF8A 3I53A 4CZZA 4Q47A 3BROA 1F4KA 3J81K 5E17F 2L01A 3ROUA 2F5EA 2Z99A 2XAHA 2JRTA 3TOBA 3QPTA 3V4GA 5CYVA 2VBZA 4PDKA 3QOPA 2ZCWA 4PGGA 4AVPA 2HQNA 1O3SA 1SMTA 3Q5FA 5D5WB 3MAJA 5DCMB 3BP8A 2FRHA 2DQRA 2BE5F 5KVRA 1R00A 1RZ4A 1QZZA 4CYDA 5IT9Z 3ZMSA 2TDXA 1J9IA 3E6BA 1YIOA 1P4WA 2P7VB 1XGSA 5D4SA 3K1NA 2EB7A 4FT8A 3F3XA 4ASNA 1EH7A 1XGMA 3PFIA 3WGGA 2HOEA 4RAYA
chains in the Genus database with same CATH superfamily
2ELKA 5FLXZ 2CQXA 1FWZA 4LB6B 3BR6A 4PFPA 4OWRB 1KONA 3WG7H 1LFUP 2VASA 1JHFA 2M5WA 3ELKA 3BJOA 1Y56A 4G94A 4XOPA 1OFCX 3C2HA 3TQNA 3JR9A 3ZN1A 4A12A 5DM7F 4Y13A 3DBHB 1LKXA 5D5XB 3T8RA 2CV1A 1LUJB 2LH9A 4BQNA 4CYCB 3CO7C 2CV0A 4B48A 2VKEA 1GVJA 2AQEA 4HV6A 3DTKA 5ED4A 2L9SA 3O3KA 3G3ZA 4L9VA 4ABZA 2P6SA 1ZG5A 2KJCA 4QIWN 2B9SA 1LQ1A 3TO6A 3PNTA 3Q0VA 3CP2A 3E6DA 1R71A 3VYUB 2EWNA 1DP3A 1USSA 1VQPI 2CUFA 2V9VA 3QQAA 3LAPA 2WWYA 1GDTA 2E2IJ 5LBQA 1OCCH 2X51A 1UFMA 3OSFA 2K4JA 2ESNA 2FSWA 4C30A 1AKHA 1VI0A 4WK8F 3G4SI 2DFIA 1MGTA 5JVGF 4X6AJ 3E7LA 1X19A 1ETWA 2O9LA 2JA2A 2BHZA 2OJED 3Q0WA 5DUKA 2NNYA 2GIVA 2HU9A 1P4XA 2IJLA 2V79A 4XLAA 4E7ZA 5B1AH 3CCJI 2F5FA 2K9MA 3PFYA 2BY0A 4G7OF 1P2FA 5EZHA 2DJNA 3J80Z 3VPRA 3JCUC 1DU6A 2DA4A 3I3LA 2NS7A 2Z1DA 1CF7B 3QPHA 2IRFG 1T39A 1HKTA 2DQLA 1I39A 2IS2A 2BY3A 5L3GA 1T08B 2P5VA 4O5VA 1ZRDA 2XDVA 1ZK8A 4AYBN 3LQQA 2ZNYA 2DODA 1KYZA 2MG4A 2DYSH 2PFBA 2E2JJ 1OCRH 4XN0A 3B6AA 2KRHA 1X58A 2HNHA 5J1UA 4B44A 1R5HA 4ZZLA 1EJ9A 2VKHA 4HSTA 1J09A 1S7EA 1G3SA 2FNPA 3BG9A 2DTZA 2MABA 3EUAA 4W1UA 2PLYA 3SQNA 3IP4B 4RGSA 4ZYDA 4I01A 4IHVA 2M2EA 1ZELA 2P8TA 3I54A 4M6XA 4NUBA 2QKLB 1QVTA 4UVCA 1XTAA 2QGUA 3K10A 4DJAA 1MMGA 4ZDPA 4FQGA 2X6XA 3IRQA 4XM3A 3BR1A 4I76A 1K78B 2IXSA 1DP7P 3M07A 4YFXF 4OIOF 4XR6A 1TNSA 3CUOA 4XOTA 2Y75A 3FHNA 3LMMA 3IV5A 3AG1H 5JHUA 3TL4X 3K70D 4GGGA 2M4KA 4BQAA 3OYEA 1QVUA 2F2EA 4A6EA 5E3OA 1X3ZB 4L5EA 6PAXA 3WTVC 3N97A 1YS7A 1ZGWA 4ON0A 5L3CA 2KHMA 5GTIC 2XVCA 5GTHC 5IYCJ 5JR3A 3DEEA 5B66C 5J4VA 3F6OA 2EA4A 5LRRA 2OC6A 2XGCA 1WZ2A 3DKXA 3C1DA 1ONVA 4DBQA 1Z21A 3GYHX 1MH3A 3VEPA 4BYYA 1JGSA 2RQQA 3M7GA 1I27A 2LD5A 4PCQA 1UZCA 4Q4ZF 4A3MJ 3T1BA 4M9XA 3KEOA 4B43A 1TW3A 4J01A 4AYBA 5JLWA 1MKMA 4ZJZA 2LP0A 2FMLA 2LYCA 2HTJA 2HVQA 2ICWG 2XIGA 2LK2A 3GVAA 4BAYA 1FZPB 2VT2A 2IGKA 2VB6A 4MQVA 1R49A 4HQEA 4NHJA 5A2QZ 5IP9J 3LOCA 3E6CC 5HLHA 1Z67A 1VQOI 1WFXA 1U8BA 5LHIA 2Y0SN 2AQFA 1Y39A 2IA2A 3M8JA 3GTKJ 4HEA2 2ZXIA 3ZMZA 2HOSA 3CJQB 3SYTA 1FSHA 1A5JA 2FA5A 3TOAA 1B6AA 2GAUA 4RGUA 2KZGA 1XCBA 3A4CA 2DFHA 4KFCA 2XHKA 3MKLA 2UZKA 3I5UA 3FX3A 5FD5A 5J8CA 3TO9A 2MYSA 5LHGA 4RLQA 1B9MA 3V8KA 4PK4A 4FHTA 4XLCA 5BPIA 4BJ6C 4X0GA 2IVMA 4IJAA 4RMNA 1VQNI 2EFQA 3Q9VA 4KUMA 1LVKA 1MBJA 3GFIA 2LR8A 1Z05A 2R7WA 3Q9SA 3H0GJ 4XRMA 3P5JA 4BE0A 3DKWA 3RPUD 4IOCF 4MLOA 1IXCA 2YSRA 2EZHA 2OCCH 5HDGA 3HKZA 2E7WA 2JVGA 3BZ6A 1MNDA 1HCRA 1PYVA 3ERMA 1YIJI 9ANTA 3W2VA 2M1BA 4BDYA 1BIBA 2LY9A 4OMZA 4E4HA 3P7NA 3RPUA 1ZR4A 4UB8C 4AU7A 3HTUA 3I59B 3FXUA 3REOA 5FROA 3S1NJ 2JMWA 4G12A 2DW4A 2MGQA 2ZMEB 4AIHA 4IQJA 3BR2A 2EK5A 5KCMA 3HXLA 1FMVA 3M9AA 3L2WA 2F4MB 2F6CA 3K4JA 3DWLE 3OYAA 2D2WA 1UG2A 1YX3A 3PQJA 2JRMA 2L7ZA 4YEJA 2EV6A 2DA2A 4KITB 3I4PA 4UNOA 4ENMA 2ELHA 3CJTB 1HSJA 2CQQA 2K9SA 5CJ9A 3WTWC 3A2KA 3FXOA 3AG2H 4A3KJ 2AHQA 2Z33A 4EATA 3H9JA 2FEZA 1A31A 1I6HJ 2B0LA 2M30A 1IC8A 3HRUA 3BTIA 1WI3A 4C3IJ 1K4SA 3WTTC 1VQ4I 5HODA 3HGYA 2DOAA 2XKPA 4Y4RA 5C4JJ 1Y0NA 1YYVA 5FKKA 3PNVA 2ECBA 4U88A 3HOZJ 2M8GX 2AXTC 2CW7A 1VZ0A 1G2HA 4ZYHA 4LFUA 4P9UA 2KKOA 2H09A 3RKYA 4EMSA 2E60A 5B1BH 4EEFG 3NEUA 3WG9A 3DXJF 3WHCA 4HG2A 3OIQA 1NG7A 1QRYA 2OBPA 3GMEA 4NC8A 3GW2A 3OMYA 3JRGA 2LKPA 3F21A 1KYWA 1E0EA 2L7MP 1TL8A 2HKOA 4L9JA 4II3A 5HNHA 1YITI 2NNNA 3FK6A 3RZDJ 2Z5UA 2DMUA 1IW7F 2A6EF 2KP6A 4RS8A 4OAZA 4OIQF 1PVEA 2M0MA 3TDZC 3IAS2 1LDJA 1Z6RA 2H6CA 1W7PD 4YG2F 2ISZA 5IT3A 1E3PA 5K5OA 2PJRB 4NC6A 4EJTA 2OD5A 4V19K 2XRLA 3B73A 4RDUA 3BG6A 2YPRA 2KRCA 2YU3A 3KE2A 3QWLA 4M3GA 4F92B 4XKVA 4CCOA 1UELB 3H1CA 1TC3C 5FO5A 1J0RA 2UWMA 2BY2A 2HDWA 2GA1A 4BJTA 1REPC 4IL6C 2XF7A 4IF4A 3H0DA 2LF8A 1RIOH 2IS1A 2DMTA 2L0KA 1L0OC 2P81A 2DMPA 4I02A 3X2QH 1O4XA 3HDDA 1XDSA 1HBXG 1FX7A 2OCEA 1D5VA 4BHPA 2M7AA 4ZZDA 5IP6A 4A0YA 1XMAA 2RQPA 1SVLA 2JA6J 2F5CA 3ABTA 1V4RA 3E0JB 3HSFA 3ZQCA 5E18F 1TP4A 4P9FA 2HWVA 5CPRB 2X1CA 3ERED 2DT5A 3ISPA 2KRFA 1HQCA 2G9WA 3FXKA 2Y31A 3H3UA 3F9KA 4EJUA 3PM1A 4HLYA 4BEHB 2Z3YA 3GFMA 1IG7A 2Y0MA 3OL4A 1B1BA 3A02A 5J8FA 1WH7A 3MZ8A 2M34A 4KT5C 2Q8KA 4B4CA 2GLOA 5FLXK 4I2OA 2M4GA 1MMNA 2QKMB 1V54H 2FBKA 4B3XA 2V1UA 1MIJA 2VJ5A 3CP8A 2HGCA 2WV0A 4ZYGA 3FXQA 1ZYRF 3M1EA 1ON2A 4PJNA 3VYSB 2K9QA 4PGHA 5FJ8J 3JRHA 3S32A 3KZZA 1ZN2A 1RC9A 1YE9A 1F5TA 3DPTA 4LLLA 2X6OA 4LLNA 4YIFA 2CQNA 2V1NA 4DYQA 2G7HA 3OYIA 1Q1HA 2R5ZA 2EZIA 1WJDA 1Z77A 3R60A 4IHWA 4J00A 3PSIA 1MW7A 4A5NA 3PUFA 1F1ZA 1SD5A 2CJJA 2XV4S 3HHHA 5GPAA 2QQ8A 4U0WA 1AKHB 1LDDA 1U6GA 2W84A 3HOXJ 1R1UA 4UB6C 2CYYA 1OPCA 2E1MB 2V1XA 2QEXI 2E1MC 1HKQA 1JUSA 1IUFA 2HTSA 1F36A 3GTLJ 1ERDA 2NXNB 2IGNA 3S1MJ 2QZ8A 2IGMA 1P7JA 4IEJA 2A5YB 3C3WA 3DLAA 1MZBA 5FKOA 2J5OA 4F7ZA 1MNEA 4GCVA 3J80K 3OYGA 3CF2A 2OPTA 3DFGA 4DZPA 3FF5A 1VQ6I 3F8MA 5KK1A 4U7DA 5AIQA 1TQIA 3KPHA 5EZGA 4MTDA 5IYDJ 2Y69H 4A0XA 4NB5A 1B4AA 3S15J 5J47A 3CCVI 2HYGD 1VTNC 4ZDOA 4MFDA 1ETQA 2OTLI 1RUNA 2VOPA 1XX5A 2F4IA 2FBHA 1IUYA 2FXAA 4XKCA 5BQTA 3SXYA 2E1NA 2DOFA 3L2CA 3GTJJ 3KX2A 2PI0A 1G3TA 1ETVA 3ECHA 3BLYA 1OQYA 5DEQA 4BE2A 3D5SC 2ZC2A 2XGEA 2F5VA 2N8GA 1FEXA 2DTRA 3CCYA 4LMYA 4L5IA 5LGUA 2JZYA 1WSUA 1G3YA 1QZEA 1KU7A 1WHUA 2BVLA 1FYMA 5D8LB 1FMWA 2KL4A 2K9LA 3OYJA 3JRIA 2HS5A 3PUBA 2E35A 3S8PA 4JK1X 2YS9A 2L9VA 1MJAA 1NTCA 2Q2EB 2VOOA 3S14J 4S0HB 1O3QA 3IH2A 2O7OA 4FX4A 3OS1A 1BIAA 2QUFA 1UHMA 4KIGA 1P6RA 3CF5F 4II2A 4BXXJ 2AXLA 3LA2A 4BS9A 2CH0A 3EYYA 5LGTA 4FE7A 3K1PA 3H5AA 4BL0B 1Y0UA 5C3EJ 2YR2A 1BC7C 2IT0A 1BI1A 4DQ2A 3KYLA 1IRXA 2VBWA 2EQRA 2XRNA 2JWTA 2Z2SB 4G6QA 3SDBA 5M5YJ 2JN6A 3PO3J 1LFPA 5M5XJ 4RLFA 3BZCA 5BOXA 1YQAA 1ZGAA 3RKWA 3I4MJ 3BG5A 3O2PE 4XMYA 3OV8A 4OINF 4KA4A 5L3FA 4WXDA 1H0MA 3W2AA 2KLOA 2XAGA 1ULYA 4CSWA 4BXUA 1NG6A 3ZCOA 3KFWX 3FM3A 5D8KB 2H8RA 3GZ5A 1SMYF 1W5TA 2LF7A 3TP0A 3CESA 4KDPA 4X1EA 3K70C 3AL0B 2PBIA 3OIOA 2QSHX 1XSVA 3AL0C 5ERIA 4A5MA 4M71A 1BM9A 4JP0A 3MFKA 1ZREA 1EA3A 4Y33A 2E36A 5E1XA 1T2KA 2K27A 5EEGA 2DXIA 3G1LA 3R61A 1SFXA 1WCMJ 2HOTA 1OLTA 2RV8A 5K5QA 3DKYA 2VC0A 2AS5F 5BMZA 1QO0D 2EFNA 4M9ZA 2QYOA 4OOIA 4U87A 1C0WA 4HOBA 3M8EA 5A2QK 3C7JA 2NVTJ 1BJAA 3FM5A 3FBNB 2CMPA 4BH9A 4UUSA 3FHZA 4B8XA 4E6KG 4HX4A 1H9TA 1JXSA 3SFIA 2HFHA 2CW0F 1FY7A 2STWA 5CQGA 4A0ZA 5J1RA 1AWCA 3E5XA 3H3ZA 1JE8A 4U7BA 1U78A 2R4GA 2DFFA 2V9KA 2H6BA 4PJJA 3R0JA 4HPQA 3I4NJ 1MBHA 4AD9A 1IZ1A 4AIJA 3CC2I 3Q3SA 5D6FA 2E1CA 4LG0A 1MJ9A 5LHHA 4ENNA 3OYFA 4IRHA 1O3RA 3MWMA 1ZAOA 2XF6A 4BY1J 2BZTA 2PQ8A 1JHHA 4NQWA 1XN7A 2WB1A 2CFOA 3DU6A 5ILVA 3LWFA 2NAZA 3D1NI 2CSOA 4LK1F 2HYJA 3MMYB 1GXQA 1S8NA 1TT0A 1NHAA 4DZJA 4KT6A 2EBIA 3KYDB 2HOAA 3T0YA 5J6XA 1KQ8A 3FXMA 5DDGA 4BACA 5HOOA 3AKZA 2IS4A 2P7CB 1RKTA 2MFZA 2BY1A 3F8BA 3LA3A 3S2WA 5E1WA 5FRNA 2GOXB 1MDMB 5JFRA 1Y8QB 1K7AA 4ZYEA 3I9V2 3SEZA 2FE3A 4LLGF 2XB0X 3RIRA 4GYIA 4QWQA 3U1DA 4HF2A 2XC7A 2R7RA 4HF1A 3MVPA 5M3MJ 3VSKA 1S9HA 3HM5A 2M3AA 2L9RA 2H1KA 4RB3C 2X1EA 3OR2C 1QNTA 2MLKA 5L3EA 2GXBA 1S3JA 1T56A 3H5RA 4KN4X 3SZGA 4BJ5C 1QHHD 2ESHA 3ZGKA 3S3NA 4CCLA 5TISC 3AAFA 2PEXA 1POGA 5L3DA 1I3AA 1DUXC 4O3MA 4AM3A 2MSYA 1BC8C 3LSKA 4KJZA 5EYRA 1SD6A 3ZQQA 3D5LA 1G6NA 3JRAA 3G1OA 3R0AA 4RAFA 2E2HJ 4AIDA 1SEUA 2HEOA 3ZQ7A 3PIPF 1E17A 2GZWA 1WWXA 2X6YA 2HZTA 3IUOA 4XSZF 2I5UA 3ZRGA 4BHBA 2BEOA 3QOEA 2BXYA 1BA5A 3ASNH 3JRCA 4UVBA 1O7LA 4EJWA 1F9NA 1F43A 3I0TA 3JTGA 4ESJA 5LGNA 1DGRM 3NAUA 2Q2EA 4MNUA 1BR4A 4RGRA 1S6LA 5E79C 3A1YA 1Y1VJ 2EZLA 5H6QA 2RNJA 2BVMA 3LFUA 2VPLA 3FWEA 2WV1A 1N75A 4FE4A 1XB4A 1BW5A 5ILSA 4HX8A 4G8XA 3BG3A 2E5NA 4ITVA 2FQ4A 1DQUA 5HLIA 2D1HA 1BOBA 3PNYA 5EG0A 1A04A 5F0CA 2WAQN 4ZTFA 4LJZF 1XS9A 1EF4A 3COAC 3RYPA 3KETA 2H27A 4XORA 2XGDA 4WF2A 5H20A 2K40A 3CCLI 2QQBA 3E3VA 3QYEA 4A3LJ 3CJNA 3J81Z 4DYCA 3HOUJ 3CCUI 2QQ9A 3HKZN 4XRFA 4G7HF 1IDYA 4N9HA 3OYLA 3GX4X 1T8IA 2O5RA 3HTSB 5E3MA 4D7MA 2Z9OA 5E3LA 1GLNA 5CVRA 1HC8A 3ZQLA 4HQMA 5DD4A 3JAMZ 3TW6A 2W7NA 1QU3A 1W7PB 2WC2A 5TRDA 2JPCA 2BOLA 2KMUA 3HOSA 2NVUB 4UHTA 2M9HA 1SD4A 1BN5A 4D7NA 1LFBA 2P5LC 2W1OA 5F1JA 2R92J 3MN2A 2QM3A 1WVRA 3K69A 3GWZA 1R1TA 2R7FA 3TW7A 1BBYA 2VQLA 1AHDP 4CA0A 1JKOC 3DQVC 5M5WJ 3CC4I 1IXRC 2OUMA 3FMSA 4EV0A 2X0LA 1ZTRA 2ZBKA 4J19A 1UAAA 4RM2A 1X1PA 4A6DA 3K4LA 3KZYA 3OYKA 1IXSB 1XD7A 5E3NA 2A5WA 3CDLA 1RUOA 3L00A 1IN5A 3K4MA 3QP5A 5D6EA 1FOYA 4JX4A 2FF4A 1P4AA 1GT0C 5ICFA 2DJIA 2L9NA 2YUSA 3GO5A 5EF6A 3K4NA 4E7JA 2ID3A 2OZUA 3GTMJ 1YW7A 5BS6A 2HQRA 2LOOA 5BNGA 1WI9A 3RCOA 1I3QJ 4DGWB 3IC7A 3OS2A 3OIPA 4I99C 4CXFA 2LSOA 3ML6A 4D0PA 1FC3A 4DW6A 2JT1A 1HXDA 2MD5A 3MKZA 3I71A 3KLOA 2IAIA 2XROA 4ZTJA 5K7HA 1Z0XA 1OKRA 3DEUA 4KN7X 5EGOA 1HW1A 1TT5B 1MD0A 3UNGC 1W1WE 3EDPA 2WAQA 1XG1A 4BDZA 1JKQC 4FETA 2X6WA 1D3YA 2B63J 1SFKA 1B8IA 2A05A 5F08A 3L9FA 1G4DA 4OMYA 2DDBA 2DK8A 3W6KB 1G3WA 2R5ZB 2P6TA 2VLAA 1TWAJ 3ABKH 2QLZA 1FIPA 1ON1A 2QF7A 3KP5A 4XLPF 3IWFA 1ZG3A 2PJPA 1GV5A 5J1YA 2VODA 3FXLA 2MW8A 4EVIA 1VFCA 4RB0A 1MDMA 2L4AA 4OAYA 3S93A 1UJ8A 3VSLA 1ACIA 4A3BJ 2RC4A 2JUCA 4HAMA 1U3EM 2DBBA 4HBLA 2DT6A 3OYCA 2J5PA 2VXDA 4RB2C 1QQIA 2KIQA 3OL3A 2GWRA 2KIMA 2GQQA 5H2FC 4QLCU 2EINH 3CC7I 2K3PA 3WTZA 2V6EA 4I09A 4PSXA 1IN4A 2IW5A 3E97A 1IGNA 1RR7A 2YX7A 4GDFA 4XKBA 4M73A 1U0JA 2CV2A 2MLGA 4BHCA 3WTSC 4B09A 3F8CA 2HR3A 4G9YA 4A3CJ 2AO9A 4MO7A 5ICGA 2IA1A 1LDKB 3K1MA 4CCKA 1FYLA 1VQ9I 1W36D 2CS3A 2ZJRF 3DP7A 2FD5A 2TCTA 3KEYA 3BWGA 5J4YA 4JOMA 1HDDC 1KU9A 2LG4A 2W25A 1TTYA 3J7AY 1YLFA 2EIJH 4C3HJ 2BGCA 3JREA 3BJAA 3F0CA 4HW0A 3JW4A 2VKDA 1T0FA 3P9KA 3RSNA 1R58A 4A69C 2K85A 3CLOA 5GAHJ 1K79A 1HOMA 3S2HJ 1OCTC 4GFBA 1WH5A 3E1SA 1ETXA 1R5ID 4HF0A 1IO2A 2LKSA 3S3MA 4RGXA 2HPIA 2XSDC 5IP7J 1B59A 4WCGA 2R0QC 1VQ5I 3A0BC 5FFXA 2CFXA 2QBYB 1WJAA 4U0YA 1YHQI 1JJ8C 1T33A 2EV0A 4EJOA 3GTQJ 1IRFA 4M9SA 1MBEA 2VXZA 3HL2A 4EGYA 4LGWA 2O6GE 1T98A 3G6EI 4DIQA 3MKYB 4W97A 3C2GA 2UXNA 2ME0A 3RQIA 3OYHA 2R5YA 4Y52J 4RBOA 1JKRC 1NK3P 5ICCA 4H4KC 1H88C 1J5YA 1HSTA 5FLMJ 2Q0OA 2BYVE 4UUTA 2XUBA 3BPXA 4QPOA 2EA2A 4LK0F 1W7PA 4HNTA 3RPQA 5JI6A 2ETHA 4YFNF 1L3LA 1B72A 1H89C 3U1KA 1ZLJA 2BW3A 2DMQA 3H35A 3V7RA 2JQ7A 3H3VK 1QZYA 2D5VA 2K02A 3KIOA 4BBSJ 3CD6I 3QPLA 2OA4A 2M87A 2VI6A 4PZJA 2V9PA 4HRIA 3K0LA 5IT9K 1LB2A 2JSPA 2KZVA 1SFEA 4XLHA 3I56I 3LQRA 5DUIA 1MSEC 2A6HF 2EFWA 2ZKZA 3L09A 3CLQA 1WJ5A 2IBDA 5HS8A 4F55A 4XIDA 1FYKA 5GPCA 2Z16A 3ZP5A 3IRRA 1IJWC 1SAUA 1D8JA 5FD6A 4HDUA 3SJMA 4ANJA 3AG4H 1R23A 4UY8I 2VJJA 1GUUA 4HV5A 3M1CA 2IS6A 4M6YA 2CGPA 4RAZA 2JPBA 1X1CA 3BJ6A 2FUG2 1I1GA 2PX9A 4HSRA 4UUSB 1SD7A 3CJRB 3S16J 2KIUA 3V7SA 2ZXWH 1BW6A 2ADUA 3TEDA 5DM6F 3TO7A 4WWCA 2R7TA 2L3DA 5L3BA 1RNLA 1V3FA 4C2TA 3UKGA 4D5FA 1UG0A 4A3FJ 1FTTA 2ZXJA 3V7CA 4L9TA 1TWHJ 1YW8A 1FOWA 3HPHA 5E1ZB 1X2MA 4LG0B 1W5CC 3W6VA 2F48A 1Z3XA 3EUHA 3I64A 2EPFA 2HQ5A 2DI3A 2PMHA 2W82A 1ZQ3P 1FOXA 2M7BA 3KLNA 3WGIA 2COBA 1OYWA 4MHGA 3OSGA 1UCRA 4NQWB 4D1QA 4BQOA 2LVSA 1K6YA 1TWGJ 1KA8A 3WTYC 2QWWA 4BNCA 3KZIC 2BBYA 2A61A 1EKEA 4L18B 3ECOA 1J7KA 3HPGA 2EIKH 4KNYA 4Y15A 3S3OA 1RR8C 1LVAA 2DDAA 2R7QA 3HRMA 3FMQA 4EM1A 1JGGA 1TWCJ 2K86A 2LC2A 4L0YB 1V5GA 4IOAF 1JI8A 4ESBA 3RDIA 1ZG1A 1XDUA 3CQZJ 4IVNA 2QCOA 3CZ6A 4JQFA 3VFZA 2XAFA 3R4KA 3GFJA 3JRDA 3W6JB 1BI2A 2CU7A 1X2NA 2KIFA 2YU9J 3TGNA 4Q5SF 2YX4A 3SFZA 5EDNA 1FJLA 4M72A 2HQAA 2JJ7A 4LIUA 4IXAA 2KQRA 4XRSA 3LNQA 3RYRA 1U5TA 3BCBA 3HHGA 2FX0A 3RKQA 3LL7A 3CUQB 1RETA 4MFEA 5DD8A 3RTRA 3CUQC 1A6IA 1K83J 2W85A 1N77A 1XC5A 4UUVA 4QPQA 3CTAA 3RKXA 4FX0A 5F0FA 3LSPA 2K9NA 3QAHA 4QSHA 5KHDA 3OYMA 5GAEJ 1RESA 1JUMA 2HKXA 5EEAA 2R3SA 4HYEA 4XK4A 1VQ8I 2DA1A 2R7SA 1OISA 5FKNA 3VODA 4ZC3A 4GO1A 3FIWA 3CCQI 3ZN0A 3EYIA 4HZFA 2QSGX 4M3BA 1QPIA 2ZJ2A 5F1RA 1Z1DA 4M3EA 1A36A 3N4MA 2NOJB 1MMAA 3ESWB 4ENKA 2QBYA 4CHUA 1R5GA 3FDYA 5IPAA 4CO8A 3IL2A 2HYFA 1SAXA 1UB9A 3ZMTA 4KMUX 5FGMA 1O57A 3VDXA 3GLLA 1YO5C 3H36A 1SVMA 3F72A 4LITA 3V8LA 4CGZA 5K5RA 4ZYAA 4CCJA 3HIFA 3GTGJ 2E71A 3I58A 4C2MJ 1A6QA 1VQMI 2H8WA 1IRGA 2WBMA 5HS9A 2ISYA 4XKWA 1WQ2A 2O0YA 4ETSA 4Q48A 1LEAA 2FQ3A 2ID6A 2WA0A 2DMNA 3J7ZI 3BG7A 4IX7A 3ZMVA 3L2UA 5EG0B 1MMSA 2IP2A 2MH9A 1YX5A 2VQGA 4M6VA 2WB1N 4RB1A 3RI4A 2CQKA 2CO5A 1V5FA 1E2XA 3QPSA 3ZOBA 5FB2A 5EJCA 1FT9A 2LRDA 5F6FA 1DPUA 2JVHA 2W57A 4PSWA 5LD2C 2ACJA 4RA2A 3HOWJ 2ZB9A 4K2EA 3VB2A 4JBAA 3GZ6A 2EFOA 2R7XA 3CCSI 1A35A 2DPUA 4GXOA 2KISA 3GTPJ 1TBXA 1TW2A 2VKVA 1EH6A 1FBUA 3DBRB 1VQKI 1FSEA 2MA3A 2X85A 3JAMK 4A3JJ 1OYIA 3B6CA 1YRNA 1SVOA 2WADA 3T5XA 1SANA 3S17J 4S04A 1MBKA 3CMAI 4D9JA 2R93J 1G59A 3EETA 1R36A 3F8FA 3FBIB 3HSRA 3BR3A 3S1RJ 2NRAC 2IGOA 1ODDA 5KNLA 2GIZA 1ZARA 3M4OJ 2PG4A 3PIOF 1ZGJA 2V7FA 4Y3OA 1NK2P 2L7FP 1D1BA 1ZH5A 2RGVA 1D0ZA 1H8AC 1WJFA 4S05A 1Y1WJ 2VBXA 2CUZA 1P7IA 4IRGA 2DA5A 2OV7A 2P5KA 3EQLF 3W3CA 2JA7J 3KP2A 4L5JA 3S1QJ 3ONQA 4UXNA 3JRFA 3KEQA 2UXXA 2DT7B 4MTEA 4Z2YA 4HNUA 4RAGA 3WHBA 3OOPA 4PUSA 5J40A 3KP6A 2OZ6A 2RVCA 4CUGA 1SC7A 2VC1A 2V4JC 3G73A 3O8HA 5JVTA 1ORKA 2K4BA 2E19A 4UV8A 3HOVJ 5EGOB 5HNFA 3TKYA 3H9QA 3CMEI 1Z3YA 1S72I 2ZJPF 3FXJA 2JA8J 3A01A 4R79A 1MBFA 5C44J 2QENA 4C9YA 1D0YA 2JSCA 3IKTA 2MD0A 4KIFA 3L2VA 2D45A 1B8IB 1ZRCA 5HDKA 5LLQA 1TQPA 3LSGA 3OYNA 2LBFA 4P5OA 1FBSA 3T8TA 2HVRA 3D0SA 3WODF 1WGXA 3MQ0A 4CCNA 1E3OC 2F5DA 1IDZA 1LNWA 4LB5A 3CDIA 2V1DA 4ENJA 2OAZA 3CDHA 3BT9A 1MBGA 2TRTA 2VIXA 2KJBA 2W4SA 4WX9A 2ZFWA 2DPDA 1LEBA 3HRTA 2MBFA 2QVOA 1O3TA 2JA5J 1QPMA 3QODA 2CW8A 4AWXB 2A07F 1UHSA 2Y2ZA 3CUQA 4XQFA 2DO7A 4WXCA 5CKTA 1R22A 3FXRA 5B5EC 1HF0A 4E7SA 2NVQJ 2VE9A 4B3AA 3J7AO 3M3YJ 1QA6A 5FLVA 1ZRFA 4BU2A 3ABMH 3WGHA 3ABLH 3R6SA 3MD2A 2RKHA 4P1WA 1IRZA 1U9NA 4YIIA 1X4OA 1X1DA 2X48A 3BDDA 2DAOA 2F4OB 2GXGA 4JX6A 2EZKA 1KZHA 1X3UA 1LJ9A 3JSOA 2E5ZA 4M74A 4QTRA 3HC7A 2OQRA 5AONA 3UR3C 1WRJA 4LOCA 5HLGA 1ZHFA 4JX5A 1D1CA 4E7HA 1PUFA 2VBYA 3RZOJ 4AUXA 2OF7A 2VQHA 4ESFA 3CMYA 1H9GA 1RPWA 2E1OA 3P9CA 2XPVA 2MH2A 4XN3A 4HDVA 1YI2I 1MSFC 1T0FC 3WE2A 2BV6A 4FCYA 3TDUC 4I6ZA 5TJJA 1S7OA 4CZCA 5F64A 5BPDA 1W36C 1YG2A 2DFEA 4A2UA 3F22A 1OJLA 4G6DA 2O61A 3HJEA 2ZNZA 4F93B 4BY7J 2VN2A 3VOEA 5FRMA 1I50J 2RNGA 2CQ7A 2LFBA 2HXIA 1OCPA 2LDUA 3K7AJ 3W2WA 2VL8A 3MCZA 3DPUA 3FISA 1IV8A 2UV1A 1DU0A 1VF9A 4EM0B 3BC8A 4NDLA 1R4NB 2XAQA 1XGOA 5F04A 2FMYA 5F27A 1WJEA 2G0EA 3QRFF 5IY5H 2R5YB 3QU6A 2DN0A 3HUGB 2VE8A 3I55I 1P92A 1DPRA 2DA3A 3QP6A 4TV7A 5K1YA 3SDGA 2ZJQF 5IOZA 2X4HA 4UV9A 1Y6IA 3WTXC 1G8XA 3KYCB 2C6YA 3ZPLA 2EH3A 2EIMH 5C4XJ 1B72B 3MEXA 2RREA 4I0AA 5JLXA 2BW3B 2IPQX 1USTA 2HI3A 3V42A 1YJWI 3LAJA 5DCMA 4E7LA 3DEWA 2LTPA 3HRSA 1Y8RB 1U9OA 3CCEI 1I6XA 1PP7U 4IHTA 3GBGA 4R8HA 4L9NA 2O3FA 5FKLA 3DTEA 3HYIA 2HZDA 5IOYA 1TLHB 1YTYA 2M45A 3A0HC 3BR0A 3F6VA 4UVAA 2FNAA 4FISA 3SZTA 4IZZA 1HW2A 4YRVA 2V6CA 1TZLA 3H92A 3LFKA 4M3DA 1W5SA 3NRVA 2XGXA 1J75A 2QA4I 3K4BA 4WXHA 5KAFC 4IQ4A 2LKXA 1YS6A 3U9GA 1K4TA 2IA0A 2BXZA 4EJVA 4IHYA 1EH8A 4A3GJ 4BXFA 2XAJA 4PJMA 2GA2A 1M1EB 3IWZA 2GM4A 4KYWA 3DV8A 4XICA 1PP8F 1K61A 2GXAA 3NWTA 2NVYJ 4I0BA 4AVZA 2HPMA 1XGNA 4MIMA 3IH3A 3OY9A 4N9IA 2RN7A 3BZKA 3DLLF 1YFHA 1P9QC 4ZH4F 4B47A 4CYCA 2CWEA 2DU9A 5DTDA 2DCEA 1XPXA 1WKMA 3EUKL 3GCMA 3IKVA 3EUHC 3PSFA 1X1AA 4LG3A 3F23A 2VONA 5HLTA 2LREA 2B7EA 1Z91A 1FOKA 2LY2A 4XL9A 2OTJI 2I10A 3ZMUA 2R7UA 2L2OA 4GYGA 4EM2A 1FPQA 3LSJA 1D8KA 3BTLA 1HKSA 1DGWY 1S29A 2O8XA 1FP1D 2M8EA 2XASA 5TGTA 4A3IJ 5FKMA 2PMUA 3BQZA 4IHSA 1BL0A 4EGZA 1Z7LA 3H9GA 5JHFA 4BUPA 4P55A 1QHGA 4G7ZF 3GLXA 1RKWA 1FLIA 1WJBA 2NOGA 4DNCA 5D4RA 2COMA 1V5EA 5B3SH 1YOVB 1W0TA 1D5YA 3GZNB 1PDNC 2LY1A 4P96A 1ZLKA 5HDNA 3ZXSA 1CGPA 2Y9YA 1K6OA 2P4WA 3CO6C 3OOUA 2FBIA 2H1LA 2M0CA 3ZR8X 1OYYA 3HOYJ 4DBRA 4YFKF 2P0WA 2ZMEC 2GOMA 5LRSA 1U5TB 4OU0A 1U5TC 3U21A 1CF7A 3K4CA 3TP3A 2ZFUA 2DA7A 2OQGA 4JYKA 3G71I 2WY8Q 1HA8A 3C2BA 4D5CA 2DOEA 3AFHA 3ZQHA 2WY7Q 3Q0UA 3WE3A 2Y0SA 2OU2A 2DLLA 3NWSA 3OYBA 1AA7A 4CH7A 1BJZA 4MGRA 1QGPA 3GEZA 1WJCA 3GFLA 5HS7A 1JT0A 1GV2A 3LSHA 4LIVA 2A69F 3K2AA 1APLC 1HW5A 4GRIA 4XSXF 2VJIA 2JK3A 1STZA 1XMXA 2E7XA 4IPAA 4BGDA 1FIAA 2KFDA 5GP9A 2ZSIB 3QYBA 3ZQFA 4E7IA 2LNBA 3FZVA 1BI3A 2O03A 4G6TB 4IO9F 2R7VA 1OR7C 3MZYA 3NARA 1VNDA 1DDNA 1I1SA 5LFAA 1ETOA 3E5UA 1J2XA 2EFPA 1IN7A 2UUZA 2L02A 4F91B 2HVSA 4DYRA 3CMMA 4MQ9F 5J3LA 1MH4A 1K78A 3LA7A 3OWTA 2A3SA 3MKWB 1YJ9I 3QYFA 1FBQA 2JUGA 2MC3A 3HUGA 2VJ4A 5DYMA 3IHUA 4YIRX 4IHXA 4N4NB 1NH3A 1R9TJ 3K2ZA 2L4MA 2EV5A 2HDDA 2CG4A 5KAIC 2KPMA 2PMZN 1J59A 4AC0A 3LSTA 4YELA 3WU2C 1IV6A 1UHWA 1HLVA 4IRIA 2FOWA 3DPLC 3NQOA 1FP2A 1W4MA 2MC4A 4ZDLA 1KU2A 4R1HA 1JTXA 4Y17A 1R7JA 4MEYF 1JUPA 3FMRA 1TQMA 3D5RC 5E20A 1I5ZA 3DCFA 4CCMA 3ZQIA 4F52A 3IH4A 2L5QA 4I7HA 2FOKA 4OIRF 4AIKA 2ZXHA 3VYRB 4FTHA 2VQCA 1JKPC 1YRNB 2X9DA 2K3FA 3PJRA 1XCVA 1R1VA 5GAGJ 3WU0A 4KICA 3L1PA 1N25A 2R7DA 1R4MB 3H5NA 4V2FA 3SZPA 1Z7UA 2DA6A 2WAFA 2G7UA 3DBLB 5F0HA 1XSDA 3TBIA 1IN8A 5DS9A 4I98B 4NC7A 3J7YJ 5CVVA 2ME6A 2L7KA 1T38A 1KGSA 3GF2A 2HXOA 5K7FA 5H6RA 1MMDA 4XNFA 4HLXA 1WPKA 1BI0A 3KCCA 3VYTB 4O6JA 3V8JA 1BR1A 1Z6TA 1Z9CA 3K9TA 5LEJA 4N4OB 1LE8B 4MEXF 1BOAA 2NYXA 2CUJA 3G2BA 3BTJA 2ECCA 1IAWA 1D1AA 5DV5A 5D5VB 1B9NA 1V55H 3BPVA 3ZMDA 3RQ4A 3RJPA 4M3FA 3E5QA 1PJRA 3FKIJ 2Y48A 2V26A 3O8GA 4PFOA 5EEHA 5CVUA 4OIPF 1SFUA 1GHCA 3JRBA 3KP3A 4N0BA 5E8GA 1CQTA 2R7ZJ 3S2DJ 3OS0A 3HZJA 4BQQA 3HG9A 3GXOA 4KISA 5E8IA 2PMZA 4KMFA 5FFZA 3A01B 2GBYA 3FKJA 1QBJA 1U8RA 3PO2J 2VT3A 4FASD 2QSFX 4E70A 1KQ9A 3PQKA 2EJRA 2QQAA 2X1DA 3IAM2 2HDCA 2LBFB 5ILUA 2STTA 1RI7A 3BQYA 4A93J 4XRSG 2XB5A 3SHFA 1S5LC 4HA8A 3EPZA 2NS0A 1EV7A 3JSPA 1IN6A 3B02A 1YJNI 3P9IA 1T6SA 1ETKA 2L54A 4BKXA 3ABUA 3QU3A 4LD5A 1AOYA 3K6GA 3BR5A 3LSIA 4V2GA 4E7KA 1VQ7I 2LLKA 2RDPA 3M8FA 3I59A 1UMQA 4RM3A 3U2RA 1HDPA 1TNTA 4XLFA 2ZMEA 4XONA 1XSXA 1ETYA 2A68F 5CLSA 2W24A 2WTEA 4CICA 1IF1A 2Y9ZA 1S7AA 3SEQA 2W00A 1KU3A 3C18A 1T95A 2ZO4A 1RRJA 1X1BA 2K7LA 3FK7A 2KT0A 3N05A 5ICEA 3WTUC 1JT6A 1U2WA 3BY6A 2D1VA 2JTVA 1GXPA 3AG3H 2K5CA 2XPWA 1MJBA 4U0VA 1FNNA 5K7ZA 4NNJA 5DCFA 2ZSHB 1W0UA 2R7OA 3E6MA 4CDGA 1SFOJ 3KP7A 4NBQA 1ZKGA 2IEKA 4F3QA 3L2QA 3LSRA 4IKFA 4H0EA 4XLNF 3OYDA 3G1MA 1OR7A 2Q1ZB 3L7WA 4XBFA 5LEKA 1PUFB 3JTHA 3MZHA 4HX7A 5CVJA 1PUEE 4Y7NJ 1YW9A 3HSEA 1JJ6C 3HOTA 3ASOH 2DK5A 1OMIA 3BOQA 3PL8A 1TWFJ 1XMKA 2FU4A 2KDZA 1AU7A 2W48A 3O6BB 5M3FJ 1JTYA 3BTCA 3DTIA 3KP4A 1X4PA 2FJ1A 2XKOA 3CCRI 1ZR2A 3ULQB 2CRGA 2I8DA 1KQ0A 1O7FA 5D5UB 5HVQC 2PN6A 3WU1B 4KIBA 4C3JJ 2H94A 2RAEA 5CVIA 4EQQA 4B1RA 4L0ZB 5AIPA 3F8NA 3GUDA 1E3HA 3DF8A 3I53A 4BBRJ 4CZZA 3HB9A 4Q47A 2Y30A 3HGGA 4A3EJ 3BROA 1F4KA 3J81K 5E17F 2L01A 2PJRA 3ROUA 5CQEA 1FTZA 1Q1VA 3OR1C 2F5EA 3LSMA 1ITYA 2VUMJ 4PJ0C 2Z99A 3GTOJ 2XAHA 4BE1A 1VQLI 2JRTA 3TOBA 3QPTA 3TMOA 3V4GA 5CYVA 2WAEA 2XAUA 2VBZA 3CCMI 4PDKA 3QOPA 2ZCWA 3HBLA 4PGGA 4AVPA 2HQNA 2NS8A 1O3SA 4C2UA 1SMTA 4A3DJ 3DU5A 5IYBJ 4PJLA 1GVDA 2ELJA 3VWBA 3Q5FA 5D5WB 3MAJA 3BCAA 5DCMB 3BP8A 1LPQA 3K4KA 2A6TA 1N78A 2E34A 2FRHA 4DOZA 1OCZH 2DQRA 3ZQGA 2BE5F 5KVRA 1R00A 1RZ4A 1QZZA 4CYDA 3HEFA 1R6RA 1MNMC 5IT9Z 3ZMSA 2TDXA 5GADJ 1D0XA 4Z6YA 1J9IA 3E6BA 1YIOA 3A03A 1P4WA 1OCOH 2BHYA 2P7VB 4HNVA 1XGSA 2XSJC 2LMDA 5D4SA 3K1NA 2EB7A 2XF5A 1BR2A 1ENHA 2EILH 3L2RA 4FT8A 3F3XA 1LE8A 2KDOA 4ASNA 2NVXJ 2VPRA 4XLEA 4BEHA 1EH7A 1X3WB 1XGMA 2DYRH 2O8KA 3PFIA 3WGGA 2HOEA 2XPUA 2CUEA 4RAYA
chains in the Genus database with same CATH topology
5FLXZ 1FWZA 4LB6B 1JHFA 2M5WA 3ELKA 3BJOA 4G94A 3TQNA 3ZN1A 4A12A 4Y13A 5D5XB 3T8RA 3CO7C 4HV6A 1GVJA 5ED4A 3O3KA 3G3ZA 4L9VA 1ZG5A 2P6SA 2KJCA 1LQ1A 3TO6A 3E6DA 2EWNA 1USSA 3LAPA 2V9VA 2WWYA 5LBQA 1UFMA 2K4JA 2ESNA 2FSWA 4WK8F 2DFIA 1MGTA 5DUKA 2NNYA 2GIVA 1P4XA 2IJLA 2V79A 2F5FA 4G7OF 1P2FA 3J80Z 1CF7B 3QPHA 2IRFG 1T39A 1HKTA 2DQLA 5L3GA 2P5VA 4O5VA 1ZRDA 3LQQA 2ZNYA 1KYZA 2PFBA 1R5HA 4ZZLA 1G3SA 2FNPA 2PLYA 3SQNA 4RGSA 4ZYDA 4I01A 2P8TA 3I54A 4M6XA 4UVCA 3IRQA 1K78B 1DP7P 4YFXF 4OIOF 1TNSA 3CUOA 2Y75A 5JHUA 4GGGA 4BQAA 2F2EA 4A6EA 6PAXA 3WTVC 3N97A 1YS7A 4ON0A 5L3CA 2XVCA 5JR3A 3F6OA 2EA4A 5LRRA 3C1DA 1ONVA 3GYHX 3VEPA 4BYYA 1JGSA 3M7GA 1I27A 4PCQA 4Q4ZF 3T1BA 4M9XA 3KEOA 1TW3A 1MKMA 2FMLA 2HTJA 2XIGA 3GVAA 4BAYA 1FZPB 2VT2A 4MQVA 4NHJA 4HQEA 5A2QZ 3E6CC 5HLHA 5LHIA 2IA2A 3ZMZA 1FSHA 2FA5A 3TOAA 1B6AA 2GAUA 4RGUA 1XCBA 4KFCA 2XHKA 2UZKA 3I5UA 3FX3A 5FD5A 5J8CA 3TO9A 5LHGA 1B9MA 3V8KA 4FHTA 5BPIA 2IVMA 4IJAA 2EFQA 3Q9VA 4KUMA 3GFIA 1Z05A 3Q9SA 3DKWA 1IXCA 2YSRA 5HDGA 2E7WA 3BZ6A 2M1BA 1BIBA 4OMZA 3P7NA 3RPUA 3HTUA 3I59B 3FXUA 3REOA 2DW4A 2ZMEB 4AIHA 2EK5A 3M9AA 2D2WA 3PQJA 2EV6A 3I4PA 4UNOA 4ENMA 2ELHA 1HSJA 5CJ9A 3WTWC 2Z33A 2FEZA 2B0LA 2M30A 3HRUA 3WTTC 2XKPA 1YYVA 4U88A 4ZYHA 4LFUA 4P9UA 2KKOA 2H09A 3RKYA 4EMSA 3NEUA 3WG9A 3DXJF 2OBPA 3GW2A 2LKPA 3F21A 1KYWA 2HKOA 4L9JA 2NNNA 2Z5UA 1IW7F 2A6EF 4RS8A 4OIQF 3TDZC 1LDJA 1Z6RA 2H6CA 1W7PD 4YG2F 2ISZA 5IT3A 5K5OA 4EJTA 2OD5A 3B73A 2YPRA 2YU3A 3KE2A 5FO5A 1J0RA 2UWMA 2GA1A 1REPC 4IF4A 1RIOH 2LF8A 1L0OC 4I02A 1XDSA 1HBXG 1FX7A 1D5VA 4BHPA 4ZZDA 4A0YA 1XMAA 2RQPA 2F5CA 3ABTA 1V4RA 3HSFA 5E18F 4P9FA 2HWVA 3ERED 2DT5A 3ISPA 2KRFA 1HQCA 2G9WA 3H3UA 4EJUA 4HLYA 2Z3YA 3GFMA 2Y0MA 1B1BA 5J8FA 4KT5C 5FLXK 2Q8KA 4I2OA 2FBKA 2V1UA 2HGCA 2WV0A 4ZYGA 3FXQA 1ZYRF 3M1EA 1ON2A 4PGHA 3KZZA 1ZN2A 1F5TA 3DPTA 4LLLA 4LLNA 4YIFA 2G7HA 1Q1HA 3R60A 4A5NA 1F1ZA 1SD5A 2XV4S 3HHHA 4U0WA 1LDDA 1U6GA 2W84A 1R1UA 2CYYA 1OPCA 2V1XA 1HKQA 2HTSA 2QZ8A 2A5YB 3C3WA 4F7ZA 1MZBA 2J5OA 4GCVA 3J80K 3DFGA 3FF5A 3F8MA 5KK1A 4U7DA 5AIQA 1TQIA 4MTDA 4A0XA 4NB5A 1B4AA 2HYGD 1VTNC 1RUNA 2VOPA 2FBHA 1IUYA 2FXAA 5BQTA 3SXYA 2E1NA 3L2CA 2PI0A 1G3TA 3ECHA 5DEQA 2DTRA 4LMYA 4L5IA 5LGUA 2JZYA 1WSUA 1G3YA 1KU7A 1FYMA 5D8LB 2HS5A 4JK1X 1MJAA 2VOOA 1O3QA 4FX4A 1BIAA 2QUFA 1UHMA 4KIGA 1P6RA 2AXLA 3LA2A 3EYYA 5LGTA 3K1PA 1Y0UA 2YR2A 1BC7C 2IT0A 1BI1A 4DQ2A 2VBWA 2XRNA 4G6QA 5BOXA 1YQAA 1ZGAA 3RKWA 3O2PE 4KA4A 3OV8A 4OINF 5L3FA 4WXDA 1H0MA 2XAGA 1ULYA 4BXUA 5D8KB 3KFWX 3FM3A 3GZ5A 1SMYF 1W5TA 2LF7A 4KDPA 2PBIA 1XSVA 5ERIA 4A5MA 4M71A 1BM9A 3MFKA 1ZREA 5E1XA 1T2KA 2K27A 5EEGA 3R61A 1SFXA 5K5QA 2RV8A 2VC0A 2AS5F 5BMZA 1QO0D 2EFNA 4M9ZA 2QYOA 4OOIA 1C0WA 4HOBA 3M8EA 5A2QK 3C7JA 1BJAA 3FM5A 4BH9A 3FHZA 4B8XA 4HX4A 1H9TA 1JXSA 2HFHA 2CW0F 1FY7A 2STWA 4A0ZA 1AWCA 3E5XA 3H3ZA 1JE8A 4U7BA 1U78A 2H6BA 3R0JA 4AD9A 1IZ1A 4AIJA 5D6FA 2E1CA 4LG0A 1MJ9A 5LHHA 4ENNA 4IRHA 1O3RA 3MWMA 1ZAOA 2PQ8A 1JHHA 4NQWA 1XN7A 5ILVA 3LWFA 2NAZA 2CSOA 4LK1F 1GXQA 1S8NA 1NHAA 3T0YA 5J6XA 1KQ8A 5DDGA 5HOOA 2P7CB 3F8BA 3LA3A 3S2WA 5E1WA 1MDMB 5JFRA 1K7AA 4ZYEA 2FE3A 4LLGF 3RIRA 4GYIA 4QWQA 3U1DA 4HF2A 4HF1A 4RB3C 1QNTA 2MLKA 5L3EA 2GXBA 1S3JA 4KN4X 2ESHA 3AAFA 2PEXA 5L3DA 1DUXC 4O3MA 1BC8C 1SD6A 3D5LA 1G6NA 3R0AA 2HEOA 3ZQ7A 1E17A 2GZWA 1WWXA 2HZTA 4XSZF 4BHBA 2BEOA 4UVBA 1O7LA 4EJWA 1F9NA 3I0TA 3JTGA 4ESJA 5LGNA 4MNUA 2Q2EA 4RGRA 1S6LA 5H6QA 2RNJA 3FWEA 1XB4A 5ILSA 4HX8A 4G8XA 5HLIA 2D1HA 1A04A 4LJZF 3COAC 3RYPA 3KETA 2H27A 4WF2A 5H20A 2QQBA 3E3VA 3CJNA 3J81Z 2QQ9A 4XRFA 4G7HF 4N9HA 3GX4X 3HTSB 2Z9OA 5CVRA 4HQMA 5DD4A 3JAMZ 1W7PB 2WC2A 5TRDA 2JPCA 3HOSA 4UHTA 1BN5A 1SD4A 2P5LC 2QM3A 3K69A 3GWZA 1R1TA 2R7FA 1BBYA 3DQVC 1IXRC 3FMSA 4EV0A 2X0LA 2ZBKA 4A6DA 3KZYA 1IXSB 1XD7A 1RUOA 3L00A 1IN5A 5D6EA 3QP5A 2FF4A 1P4AA 5ICFA 3GO5A 2OZUA 1YW7A 5BS6A 2HQRA 1WI9A 3IC7A 4CXFA 2LSOA 3ML6A 4D0PA 1FC3A 2JT1A 1HXDA 2MD5A 3I71A 3KLOA 2XROA 1OKRA 3DEUA 4KN7X 1HW1A 1MD0A 3EDPA 1D3YA 3L9FA 1G4DA 4OMYA 2DK8A 3W6KB 1G3WA 2P6TA 2QLZA 1ON1A 3KP5A 4XLPF 3IWFA 1ZG3A 2PJPA 2VODA 4EVIA 4RB0A 1MDMA 2L4AA 2RC4A 4HAMA 1U3EM 2DBBA 4HBLA 2J5PA 4RB2C 1QQIA 2GWRA 2KIMA 2GQQA 4QLCU 3WTZA 4I09A 1IN4A 2IW5A 3E97A 2YX7A 4M73A 2MLGA 4BHCA 3WTSC 4B09A 3F8CA 2HR3A 4G9YA 5ICGA 2IA1A 1LDKB 3K1MA 1FYLA 3DP7A 3BWGA 1KU9A 2W25A 1TTYA 1YLFA 2BGCA 3BJAA 4HW0A 3JW4A 1T0FA 3P9KA 1R58A 3CLOA 1K79A 4HF0A 4RGXA 1B59A 4WCGA 5FFXA 2CFXA 2QBYB 4U0YA 2EV0A 4EJOA 1IRFA 4M9SA 2VXZA 4EGYA 4LGWA 2O6GE 1T98A 2UXNA 5ICCA 1J5YA 1HSTA 2Q0OA 2BYVE 2XUBA 3BPXA 2EA2A 4LK0F 1W7PA 3RPQA 5JI6A 2ETHA 4YFNF 1L3LA 1ZLJA 3V7RA 1QZYA 2K02A 2OA4A 2M87A 4PZJA 3K0LA 5IT9K 1LB2A 1SFEA 3LQRA 5DUIA 2A6HF 2EFWA 2ZKZA 3L09A 5HS8A 1FYKA 3ZP5A 3IRRA 1D8JA 5FD6A 4HDUA 1R23A 4HV5A 4M6YA 2CGPA 4RAZA 2JPBA 3BJ6A 1I1GA 1SD7A 2KIUA 3V7SA 2ADUA 3TO7A 4WWCA 2L3DA 5L3BA 1RNLA 1V3FA 2ZXJA 3V7CA 4L9TA 1YW8A 5E1ZB 4LG0B 3EUHA 3I64A 2DI3A 2PMHA 3KLNA 3WGIA 1OYWA 4MHGA 1UCRA 1KA8A 3WTYC 2QWWA 4BNCA 2BBYA 2A61A 4L18B 3ECOA 1J7KA 4KNYA 4Y15A 1LVAA 3HRMA 3FMQA 4EM1A 2K86A 4L0YB 4ESBA 3RDIA 1ZG1A 1XDUA 4IVNA 4JQFA 3VFZA 2XAFA 3R4KA 3GFJA 3W6JB 1BI2A 2KIFA 3TGNA 4Q5SF 2YX4A 3SFZA 4M72A 4IXAA 3RYRA 1U5TA 3HHGA 3CUQB 5DD8A 3RTRA 3CUQC 2W85A 4UUVA 3CTAA 3RKXA 4FX0A 3QAHA 2HKXA 2R3SA 4HYEA 3VODA 4GO1A 3ZN0A 3EYIA 4HZFA 2ZJ2A 5F1RA 1Z1DA 3N4MA 4ENKA 2QBYA 4CHUA 1R5GA 4CO8A 3IL2A 2HYFA 1SAXA 1UB9A 3ZMTA 4KMUX 5FGMA 1O57A 1YO5C 3V8LA 4CGZA 3F72A 5K5RA 3HIFA 3I58A 1IRGA 5HS9A 2ISYA 1WQ2A 2O0YA 4ETSA 4Q48A 1LEAA 2FQ3A 3ZMVA 2IP2A 2MH9A 4RB1A 3RI4A 2CQKA 2CO5A 1E2XA 5FB2A 1FT9A 5F6FA 1DPUA 2W57A 2ACJA 4K2EA 3VB2A 4JBAA 3GZ6A 2EFOA 2DPUA 4GXOA 1TBXA 1TW2A 1EH6A 1FBUA 1FSEA 2MA3A 3JAMK 1OYIA 3T5XA 4S04A 3EETA 1R36A 3F8FA 3HSRA 2NRAC 1ODDA 1ZARA 2PG4A 1ZGJA 1ZH5A 2RGVA 4S05A 2VBXA 4IRGA 2P5KA 3EQLF 3KP2A 4L5JA 4UXNA 3KEQA 2UXXA 4MTEA 4Z2YA 3OOPA 3KP6A 2OZ6A 2RVCA 2VC1A 3G73A 5JVTA 2K4BA 4UV8A 3TKYA 4R79A 2QENA 2JSCA 3IKTA 1ZRCA 4KIFA 2D45A 5HDKA 5LLQA 1TQPA 4P5OA 1FBSA 3T8TA 3D0SA 3WODF 3MQ0A 2F5DA 1LNWA 4LB5A 2V1DA 4ENJA 2OAZA 3CDHA 2KJBA 4WX9A 2ZFWA 2DPDA 1LEBA 3HRTA 2MBFA 2QVOA 1O3TA 1QPMA 4AWXB 2A07F 3CUQA 2DO7A 4WXCA 1R22A 3FXRA 2VE9A 3J7AO 1ZRFA 3WGHA 3R6SA 2RKHA 4YIIA 3BDDA 2DAOA 2GXGA 1X3UA 1LJ9A 3JSOA 4M74A 2OQRA 5AONA 1WRJA 5HLGA 1ZHFA 2VBYA 4ESFA 1H9GA 3P9CA 2MH2A 4HDVA 3WE2A 2BV6A 3TDUC 5TJJA 1S7OA 5BPDA 5F64A 1YG2A 4A2UA 3F22A 4G6DA 2O61A 2ZNZA 2VN2A 3VOEA 2LDUA 3MCZA 4EM0B 2XAQA 1XGOA 2FMYA 3QRFF 3QU6A 2VE8A 1P92A 1DPRA 3QP6A 5K1YA 4TV7A 2X4HA 4UV9A 3WTXC 2C6YA 3ZPLA 3MEXA 4I0AA 2IPQX 1USTA 3LAJA 5DCMA 3HRSA 1I6XA 1PP7U 4IHTA 4R8HA 4L9NA 2O3FA 3HYIA 1TLHB 1YTYA 2M45A 3F6VA 4UVAA 2FNAA 3SZTA 1HW2A 2V6CA 3H92A 3LFKA 1W5SA 3NRVA 2XGXA 1J75A 4WXHA 1YS6A 3U9GA 2IA0A 4EJVA 1EH8A 2XAJA 2GA2A 3IWZA 4KYWA 3DV8A 1PP8F 4I0BA 1XGNA 4N9IA 2RN7A 1YFHA 4ZH4F 2CWEA 2DU9A 1WKMA 3IKVA 3F23A 2VONA 1Z91A 1FOKA 3ZMUA 4GYGA 4EM2A 1FPQA 1D8KA 1HKSA 1S29A 2O8XA 1FP1D 2M8EA 2XASA 2PMUA 4IHSA 4EGZA 4P55A 4G7ZF 3GLXA 1FLIA 4DNCA 5D4RA 2COMA 1PDNC 4P96A 1ZLKA 5HDNA 1CGPA 1K6OA 2P4WA 3CO6C 2FBIA 1OYYA 4YFKF 5LRSA 1U5TB 4OU0A 1U5TC 1CF7A 2OQGA 3WE3A 2OU2A 2DLLA 4MGRA 1QGPA 3GEZA 3GFLA 5HS7A 2A69F 1HW5A 4XSXF 1STZA 2E7XA 4IPAA 2LNBA 3FZVA 1BI3A 2O03A 3MZYA 1DDNA 1I1SA 3E5UA 1J2XA 2EFPA 1IN7A 2L02A 4MQ9F 1K78A 3LA7A 2A3SA 1FBQA 2MC3A 3HUGA 5DYMA 3IHUA 3K2ZA 2L4MA 2EV5A 2CG4A 1J59A 3LSTA 1UHWA 4IRIA 3DPLC 3NQOA 1FP2A 1W4MA 1KU2A 4R1HA 4Y17A 1R7JA 4MEYF 3FMRA 1TQMA 5E20A 1I5ZA 4I7HA 2FOKA 4OIRF 4AIKA 1XCVA 1R1VA 3WU0A 4KICA 2R7DA 3SZPA 1Z7UA 2G7UA 1XSDA 1IN8A 4I98B 5CVVA 1T38A 1KGSA 3GF2A 5H6RA 4HLXA 1BI0A 3KCCA 4O6JA 3V8JA 1Z6TA 1Z9CA 3K9TA 5LEJA 4MEXF 1BOAA 2NYXA 1IAWA 5DV5A 5D5VB 1B9NA 3BPVA 3ZMDA 3RJPA 3E5QA 2Y48A 5EEHA 5CVUA 4OIPF 1SFUA 1GHCA 3KP3A 4N0BA 5E8GA 3GXOA 5E8IA 4KMFA 5FFZA 1QBJA 1U8RA 2VT3A 4E70A 1KQ9A 3PQKA 2EJRA 2QQAA 2HDCA 5ILUA 2STTA 1RI7A 3SHFA 4HA8A 2NS0A 1EV7A 3JSPA 1IN6A 3B02A 3P9IA 1T6SA 2L54A 3ABUA 3QU3A 4LD5A 1AOYA 2RDPA 3M8FA 3I59A 3U2RA 1TNTA 2ZMEA 1XSXA 2A68F 5CLSA 2W24A 2WTEA 4CICA 1IF1A 1S7AA 1KU3A 3C18A 2ZO4A 2K7LA 5ICEA 3WTUC 1U2WA 3BY6A 2D1VA 2JTVA 1GXPA 1MJBA 4U0VA 1FNNA 5DCFA 3E6MA 4CDGA 3KP7A 4H0EA 4XLNF 1OR7A 3L7WA 4XBFA 5LEKA 1PUEE 3JTHA 3MZHA 4HX7A 5CVJA 1YW9A 3HSEA 3HOTA 2DK5A 1OMIA 3BOQA 1XMKA 2FU4A 3O6BB 3KP4A 2XKOA 3ULQB 1KQ0A 1O7FA 5D5UB 5HVQC 2PN6A 3WU1B 4KIBA 2H94A 5CVIA 4EQQA 4L0ZB 5AIPA 3F8NA 3GUDA 3DF8A 3I53A 4CZZA 4Q47A 3BROA 1F4KA 3J81K 5E17F 2L01A 3ROUA 2F5EA 2Z99A 2XAHA 2JRTA 3TOBA 3QPTA 3V4GA 5CYVA 2VBZA 4PDKA 3QOPA 2ZCWA 4PGGA 4AVPA 2HQNA 1O3SA 1SMTA 3Q5FA 5D5WB 3MAJA 5DCMB 3BP8A 2FRHA 2DQRA 2BE5F 5KVRA 1R00A 1RZ4A 1QZZA 4CYDA 5IT9Z 3ZMSA 2TDXA 1J9IA 3E6BA 1YIOA 1P4WA 2P7VB 1XGSA 5D4SA 3K1NA 2EB7A 4FT8A 3F3XA 4ASNA 1EH7A 1XGMA 3PFIA 3WGGA 2HOEA 4RAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX Z;  1FWZ A;  4LB6 B;  1JHF A;  2M5W A;  3ELK A;  3BJO A;  4G94 A;  3TQN A;  3ZN1 A;  4A12 A;  4Y13 A;  5D5X B;  3T8R A;  3CO7 C;  4HV6 A;  1GVJ A;  5ED4 A;  3O3K A;  3G3Z A;  4L9V A;  1ZG5 A;  2P6S A;  2KJC A;  1LQ1 A;  3TO6 A;  3E6D A;  2EWN A;  1USS A;  3LAP A;  2V9V A;  2WWY A;  5LBQ A;  1UFM A;  2K4J A;  2ESN A;  2FSW A;  4WK8 F;  2DFI A;  1MGT A;  5DUK A;  2NNY A;  2GIV A;  1P4X A;  2IJL A;  2V79 A;  2F5F A;  4G7O F;  1P2F A;  3J80 Z;  1CF7 B;  3QPH A;  2IRF G;  1T39 A;  1HKT A;  2DQL A;  5L3G A;  2P5V A;  4O5V A;  1ZRD A;  3LQQ A;  2ZNY A;  1KYZ A;  2PFB A;  1R5H A;  4ZZL A;  1G3S A;  2FNP A;  2PLY A;  3SQN A;  4RGS A;  4ZYD A;  4I01 A;  2P8T A;  3I54 A;  4M6X A;  4UVC A;  3IRQ A;  1K78 B;  1DP7 P;  4YFX F;  4OIO F;  1TNS A;  3CUO A;  2Y75 A;  5JHU A;  4GGG A;  4BQA A;  2F2E A;  4A6E A;  6PAX A;  3WTV C;  3N97 A;  1YS7 A;  4ON0 A;  5L3C A;  2XVC A;  5JR3 A;  3F6O A;  2EA4 A;  5LRR A;  3C1D A;  1ONV A;  3GYH X;  3VEP A;  4BYY A;  1JGS A;  3M7G A;  1I27 A;  4PCQ A;  4Q4Z F;  3T1B A;  4M9X A;  3KEO A;  1TW3 A;  1MKM A;  2FML A;  2HTJ A;  2XIG A;  3GVA A;  4BAY A;  1FZP B;  2VT2 A;  4MQV A;  4NHJ A;  4HQE A;  5A2Q Z;  3E6C C;  5HLH A;  5LHI A;  2IA2 A;  3ZMZ A;  1FSH A;  2FA5 A;  3TOA A;  1B6A A;  2GAU A;  4RGU A;  1XCB A;  4KFC A;  2XHK A;  2UZK A;  3I5U A;  3FX3 A;  5FD5 A;  5J8C A;  3TO9 A;  5LHG A;  1B9M A;  3V8K A;  4FHT A;  5BPI A;  2IVM A;  4IJA A;  2EFQ A;  3Q9V A;  4KUM A;  3GFI A;  1Z05 A;  3Q9S A;  3DKW A;  1IXC A;  2YSR A;  5HDG A;  2E7W A;  3BZ6 A;  2M1B A;  1BIB A;  4OMZ A;  3P7N A;  3RPU A;  3HTU A;  3I59 B;  3FXU A;  3REO A;  2DW4 A;  2ZME B;  4AIH A;  2EK5 A;  3M9A A;  2D2W A;  3PQJ A;  2EV6 A;  3I4P A;  4UNO A;  4ENM A;  2ELH A;  1HSJ A;  5CJ9 A;  3WTW C;  2Z33 A;  2FEZ A;  2B0L A;  2M30 A;  3HRU A;  3WTT C;  2XKP A;  1YYV A;  4U88 A;  4ZYH A;  4LFU A;  4P9U A;  2KKO A;  2H09 A;  3RKY A;  4EMS A;  3NEU A;  3WG9 A;  3DXJ F;  2OBP A;  3GW2 A;  2LKP A;  3F21 A;  1KYW A;  2HKO A;  4L9J A;  2NNN A;  2Z5U A;  1IW7 F;  2A6E F;  4RS8 A;  4OIQ F;  3TDZ C;  1LDJ A;  1Z6R A;  2H6C A;  1W7P D;  4YG2 F;  2ISZ A;  5IT3 A;  5K5O A;  4EJT A;  2OD5 A;  3B73 A;  2YPR A;  2YU3 A;  3KE2 A;  5FO5 A;  1J0R A;  2UWM A;  2GA1 A;  1REP C;  4IF4 A;  1RIO H;  2LF8 A;  1L0O C;  4I02 A;  1XDS A;  1HBX G;  1FX7 A;  1D5V A;  4BHP A;  4ZZD A;  4A0Y A;  1XMA A;  2RQP A;  2F5C A;  3ABT A;  1V4R A;  3HSF A;  5E18 F;  4P9F A;  2HWV A;  3ERE D;  2DT5 A;  3ISP A;  2KRF A;  1HQC A;  2G9W A;  3H3U A;  4EJU A;  4HLY A;  2Z3Y A;  3GFM A;  2Y0M A;  1B1B A;  5J8F A;  4KT5 C;  5FLX K;  2Q8K A;  4I2O A;  2FBK A;  2V1U A;  2HGC A;  2WV0 A;  4ZYG A;  3FXQ A;  1ZYR F;  3M1E A;  1ON2 A;  4PGH A;  3KZZ A;  1ZN2 A;  1F5T A;  3DPT A;  4LLL A;  4LLN A;  4YIF A;  2G7H A;  1Q1H A;  3R60 A;  4A5N A;  1F1Z A;  1SD5 A;  2XV4 S;  3HHH A;  4U0W A;  1LDD A;  1U6G A;  2W84 A;  1R1U A;  2CYY A;  1OPC A;  2V1X A;  1HKQ A;  2HTS A;  2QZ8 A;  2A5Y B;  3C3W A;  4F7Z A;  1MZB A;  2J5O A;  4GCV A;  3J80 K;  3DFG A;  3FF5 A;  3F8M A;  5KK1 A;  4U7D A;  5AIQ A;  1TQI A;  4MTD A;  4A0X A;  4NB5 A;  1B4A A;  2HYG D;  1VTN C;  1RUN A;  2VOP A;  2FBH A;  1IUY A;  2FXA A;  5BQT A;  3SXY A;  2E1N A;  3L2C A;  2PI0 A;  1G3T A;  3ECH A;  5DEQ A;  2DTR A;  4LMY A;  4L5I A;  5LGU A;  2JZY A;  1WSU A;  1G3Y A;  1KU7 A;  1FYM A;  5D8L B;  2HS5 A;  4JK1 X;  1MJA A;  2VOO A;  1O3Q A;  4FX4 A;  1BIA A;  2QUF A;  1UHM A;  4KIG A;  1P6R A;  2AXL A;  3LA2 A;  3EYY A;  5LGT A;  3K1P A;  1Y0U A;  2YR2 A;  1BC7 C;  2IT0 A;  1BI1 A;  4DQ2 A;  2VBW A;  2XRN A;  4G6Q A;  5BOX A;  1YQA A;  1ZGA A;  3RKW A;  3O2P E;  4KA4 A;  3OV8 A;  4OIN F;  5L3F A;  4WXD A;  1H0M A;  2XAG A;  1ULY A;  4BXU A;  5D8K B;  3KFW X;  3FM3 A;  3GZ5 A;  1SMY F;  1W5T A;  2LF7 A;  4KDP A;  2PBI A;  1XSV A;  5ERI A;  4A5M A;  4M71 A;  1BM9 A;  3MFK A;  1ZRE A;  5E1X A;  1T2K A;  2K27 A;  5EEG A;  3R61 A;  1SFX A;  5K5Q A;  2RV8 A;  2VC0 A;  2AS5 F;  5BMZ A;  1QO0 D;  2EFN A;  4M9Z A;  2QYO A;  4OOI A;  1C0W A;  4HOB A;  3M8E A;  5A2Q K;  3C7J A;  1BJA A;  3FM5 A;  4BH9 A;  3FHZ A;  4B8X A;  4HX4 A;  1H9T A;  1JXS A;  2HFH A;  2CW0 F;  1FY7 A;  2STW A;  4A0Z A;  1AWC A;  3E5X A;  3H3Z A;  1JE8 A;  4U7B A;  1U78 A;  2H6B A;  3R0J A;  4AD9 A;  1IZ1 A;  4AIJ A;  5D6F A;  2E1C A;  4LG0 A;  1MJ9 A;  5LHH A;  4ENN A;  4IRH A;  1O3R A;  3MWM A;  1ZAO A;  2PQ8 A;  1JHH A;  4NQW A;  1XN7 A;  5ILV A;  3LWF A;  2NAZ A;  2CSO A;  4LK1 F;  1GXQ A;  1S8N A;  1NHA A;  3T0Y A;  5J6X A;  1KQ8 A;  5DDG A;  5HOO A;  2P7C B;  3F8B A;  3LA3 A;  3S2W A;  5E1W A;  1MDM B;  5JFR A;  1K7A A;  4ZYE A;  2FE3 A;  4LLG F;  3RIR A;  4GYI A;  4QWQ A;  3U1D A;  4HF2 A;  4HF1 A;  4RB3 C;  1QNT A;  2MLK A;  5L3E A;  2GXB A;  1S3J A;  4KN4 X;  2ESH A;  3AAF A;  2PEX A;  5L3D A;  1DUX C;  4O3M A;  1BC8 C;  1SD6 A;  3D5L A;  1G6N A;  3R0A A;  2HEO A;  3ZQ7 A;  1E17 A;  2GZW A;  1WWX A;  2HZT A;  4XSZ F;  4BHB A;  2BEO A;  4UVB A;  1O7L A;  4EJW A;  1F9N A;  3I0T A;  3JTG A;  4ESJ A;  5LGN A;  4MNU A;  2Q2E A;  4RGR A;  1S6L A;  5H6Q A;  2RNJ A;  3FWE A;  1XB4 A;  5ILS A;  4HX8 A;  4G8X A;  5HLI A;  2D1H A;  1A04 A;  4LJZ F;  3COA C;  3RYP A;  3KET A;  2H27 A;  4WF2 A;  5H20 A;  2QQB A;  3E3V A;  3CJN A;  3J81 Z;  2QQ9 A;  4XRF A;  4G7H F;  4N9H A;  3GX4 X;  3HTS B;  2Z9O A;  5CVR A;  4HQM A;  5DD4 A;  3JAM Z;  1W7P B;  2WC2 A;  5TRD A;  2JPC A;  3HOS A;  4UHT A;  1BN5 A;  1SD4 A;  2P5L C;  2QM3 A;  3K69 A;  3GWZ A;  1R1T A;  2R7F A;  1BBY A;  3DQV C;  1IXR C;  3FMS A;  4EV0 A;  2X0L A;  2ZBK A;  4A6D A;  3KZY A;  1IXS B;  1XD7 A;  1RUO A;  3L00 A;  1IN5 A;  5D6E A;  3QP5 A;  2FF4 A;  1P4A A;  5ICF A;  3GO5 A;  2OZU A;  1YW7 A;  5BS6 A;  2HQR A;  1WI9 A;  3IC7 A;  4CXF A;  2LSO A;  3ML6 A;  4D0P A;  1FC3 A;  2JT1 A;  1HXD A;  2MD5 A;  3I71 A;  3KLO A;  2XRO A;  1OKR A;  3DEU A;  4KN7 X;  1HW1 A;  1MD0 A;  3EDP A;  1D3Y A;  3L9F A;  1G4D A;  4OMY A;  2DK8 A;  3W6K B;  1G3W A;  2P6T A;  2QLZ A;  1ON1 A;  3KP5 A;  4XLP F;  3IWF A;  1ZG3 A;  2PJP A;  2VOD A;  4EVI A;  4RB0 A;  1MDM A;  2L4A A;  2RC4 A;  4HAM A;  1U3E M;  2DBB A;  4HBL A;  2J5P A;  4RB2 C;  1QQI A;  2GWR A;  2KIM A;  2GQQ A;  4QLC U;  3WTZ A;  4I09 A;  1IN4 A;  2IW5 A;  3E97 A;  2YX7 A;  4M73 A;  2MLG A;  4BHC A;  3WTS C;  4B09 A;  3F8C A;  2HR3 A;  4G9Y A;  5ICG A;  2IA1 A;  1LDK B;  3K1M A;  1FYL A;  3DP7 A;  3BWG A;  1KU9 A;  2W25 A;  1TTY A;  1YLF A;  2BGC A;  3BJA A;  4HW0 A;  3JW4 A;  1T0F A;  3P9K A;  1R58 A;  3CLO A;  1K79 A;  4HF0 A;  4RGX A;  1B59 A;  4WCG A;  5FFX A;  2CFX A;  2QBY B;  4U0Y A;  2EV0 A;  4EJO A;  1IRF A;  4M9S A;  2VXZ A;  4EGY A;  4LGW A;  2O6G E;  1T98 A;  2UXN A;  5ICC A;  1J5Y A;  1HST A;  2Q0O A;  2BYV E;  2XUB A;  3BPX A;  2EA2 A;  4LK0 F;  1W7P A;  3RPQ A;  5JI6 A;  2ETH A;  4YFN F;  1L3L A;  1ZLJ A;  3V7R A;  1QZY A;  2K02 A;  2OA4 A;  2M87 A;  4PZJ A;  3K0L A;  5IT9 K;  1LB2 A;  1SFE A;  3LQR A;  5DUI A;  2A6H F;  2EFW A;  2ZKZ A;  3L09 A;  5HS8 A;  1FYK A;  3ZP5 A;  3IRR A;  1D8J A;  5FD6 A;  4HDU A;  1R23 A;  4HV5 A;  4M6Y A;  2CGP A;  4RAZ A;  2JPB A;  3BJ6 A;  1I1G A;  1SD7 A;  2KIU A;  3V7S A;  2ADU A;  3TO7 A;  4WWC A;  2L3D A;  5L3B A;  1RNL A;  1V3F A;  2ZXJ A;  3V7C A;  4L9T A;  1YW8 A;  5E1Z B;  4LG0 B;  3EUH A;  3I64 A;  2DI3 A;  2PMH A;  3KLN A;  3WGI A;  1OYW A;  4MHG A;  1UCR A;  1KA8 A;  3WTY C;  2QWW A;  4BNC A;  2BBY A;  2A61 A;  4L18 B;  3ECO A;  1J7K A;  4KNY A;  4Y15 A;  1LVA A;  3HRM A;  3FMQ A;  4EM1 A;  2K86 A;  4L0Y B;  4ESB A;  3RDI A;  1ZG1 A;  1XDU A;  4IVN A;  4JQF A;  3VFZ A;  2XAF A;  3R4K A;  3GFJ A;  3W6J B;  1BI2 A;  2KIF A;  3TGN A;  4Q5S F;  2YX4 A;  3SFZ A;  4M72 A;  4IXA A;  3RYR A;  1U5T A;  3HHG A;  3CUQ B;  5DD8 A;  3RTR A;  3CUQ C;  2W85 A;  4UUV A;  3CTA A;  3RKX A;  4FX0 A;  3QAH A;  2HKX A;  2R3S A;  4HYE A;  3VOD A;  4GO1 A;  3ZN0 A;  3EYI A;  4HZF A;  2ZJ2 A;  5F1R A;  1Z1D A;  3N4M A;  4ENK A;  2QBY A;  4CHU A;  1R5G A;  4CO8 A;  3IL2 A;  2HYF A;  1SAX A;  1UB9 A;  3ZMT A;  4KMU X;  5FGM A;  1O57 A;  1YO5 C;  3V8L A;  4CGZ A;  3F72 A;  5K5R A;  3HIF A;  3I58 A;  1IRG A;  5HS9 A;  2ISY A;  1WQ2 A;  2O0Y A;  4ETS A;  4Q48 A;  1LEA A;  2FQ3 A;  3ZMV A;  2IP2 A;  2MH9 A;  4RB1 A;  3RI4 A;  2CQK A;  2CO5 A;  1E2X A;  5FB2 A;  1FT9 A;  5F6F A;  1DPU A;  2W57 A;  2ACJ A;  4K2E A;  3VB2 A;  4JBA A;  3GZ6 A;  2EFO A;  2DPU A;  4GXO A;  1TBX A;  1TW2 A;  1EH6 A;  1FBU A;  1FSE A;  2MA3 A;  3JAM K;  1OYI A;  3T5X A;  4S04 A;  3EET A;  1R36 A;  3F8F A;  3HSR A;  2NRA C;  1ODD A;  1ZAR A;  2PG4 A;  1ZGJ A;  1ZH5 A;  2RGV A;  4S05 A;  2VBX A;  4IRG A;  2P5K A;  3EQL F;  3KP2 A;  4L5J A;  4UXN A;  3KEQ A;  2UXX A;  4MTE A;  4Z2Y A;  3OOP A;  3KP6 A;  2OZ6 A;  2RVC A;  2VC1 A;  3G73 A;  5JVT A;  2K4B A;  4UV8 A;  3TKY A;  4R79 A;  2QEN A;  2JSC A;  3IKT A;  1ZRC A;  4KIF A;  2D45 A;  5HDK A;  5LLQ A;  1TQP A;  4P5O A;  1FBS A;  3T8T A;  3D0S A;  3WOD F;  3MQ0 A;  2F5D A;  1LNW A;  4LB5 A;  2V1D A;  4ENJ A;  2OAZ A;  3CDH A;  2KJB A;  4WX9 A;  2ZFW A;  2DPD A;  1LEB A;  3HRT A;  2MBF A;  2QVO A;  1O3T A;  1QPM A;  4AWX B;  2A07 F;  3CUQ A;  2DO7 A;  4WXC A;  1R22 A;  3FXR A;  2VE9 A;  3J7A O;  1ZRF A;  3WGH A;  3R6S A;  2RKH A;  4YII A;  3BDD A;  2DAO A;  2GXG A;  1X3U A;  1LJ9 A;  3JSO A;  4M74 A;  2OQR A;  5AON A;  1WRJ A;  5HLG A;  1ZHF A;  2VBY A;  4ESF A;  1H9G A;  3P9C A;  2MH2 A;  4HDV A;  3WE2 A;  2BV6 A;  3TDU C;  5TJJ A;  1S7O A;  5BPD A;  5F64 A;  1YG2 A;  4A2U A;  3F22 A;  4G6D A;  2O61 A;  2ZNZ A;  2VN2 A;  3VOE A;  2LDU A;  3MCZ A;  4EM0 B;  2XAQ A;  1XGO A;  2FMY A;  3QRF F;  3QU6 A;  2VE8 A;  1P92 A;  1DPR A;  3QP6 A;  5K1Y A;  4TV7 A;  2X4H A;  4UV9 A;  3WTX C;  2C6Y A;  3ZPL A;  3MEX A;  4I0A A;  2IPQ X;  1UST A;  3LAJ A;  5DCM A;  3HRS A;  1I6X A;  1PP7 U;  4IHT A;  4R8H A;  4L9N A;  2O3F A;  3HYI A;  1TLH B;  1YTY A;  2M45 A;  3F6V A;  4UVA A;  2FNA A;  3SZT A;  1HW2 A;  2V6C A;  3H92 A;  3LFK A;  1W5S A;  3NRV A;  2XGX A;  1J75 A;  4WXH A;  1YS6 A;  3U9G A;  2IA0 A;  4EJV A;  1EH8 A;  2XAJ A;  2GA2 A;  3IWZ A;  4KYW A;  3DV8 A;  1PP8 F;  4I0B A;  1XGN A;  4N9I A;  2RN7 A;  1YFH A;  4ZH4 F;  2CWE A;  2DU9 A;  1WKM A;  3IKV A;  3F23 A;  2VON A;  1Z91 A;  1FOK A;  3ZMU A;  4GYG A;  4EM2 A;  1FPQ A;  1D8K A;  1HKS A;  1S29 A;  2O8X A;  1FP1 D;  2M8E A;  2XAS A;  2PMU A;  4IHS A;  4EGZ A;  4P55 A;  4G7Z F;  3GLX A;  1FLI A;  4DNC A;  5D4R A;  2COM A;  1PDN C;  4P96 A;  1ZLK A;  5HDN A;  1CGP A;  1K6O A;  2P4W A;  3CO6 C;  2FBI A;  1OYY A;  4YFK F;  5LRS A;  1U5T B;  4OU0 A;  1U5T C;  1CF7 A;  2OQG A;  3WE3 A;  2OU2 A;  2DLL A;  4MGR A;  1QGP A;  3GEZ A;  3GFL A;  5HS7 A;  2A69 F;  1HW5 A;  4XSX F;  1STZ A;  2E7X A;  4IPA A;  2LNB A;  3FZV A;  1BI3 A;  2O03 A;  3MZY A;  1DDN A;  1I1S A;  3E5U A;  1J2X A;  2EFP A;  1IN7 A;  2L02 A;  4MQ9 F;  1K78 A;  3LA7 A;  2A3S A;  1FBQ A;  2MC3 A;  3HUG A;  5DYM A;  3IHU A;  3K2Z A;  2L4M A;  2EV5 A;  2CG4 A;  1J59 A;  3LST A;  1UHW A;  4IRI A;  3DPL C;  3NQO A;  1FP2 A;  1W4M A;  1KU2 A;  4R1H A;  4Y17 A;  1R7J A;  4MEY F;  3FMR A;  1TQM A;  5E20 A;  1I5Z A;  4I7H A;  2FOK A;  4OIR F;  4AIK A;  1XCV A;  1R1V A;  3WU0 A;  4KIC A;  2R7D A;  3SZP A;  1Z7U A;  2G7U A;  1XSD A;  1IN8 A;  4I98 B;  5CVV A;  1T38 A;  1KGS A;  3GF2 A;  5H6R A;  4HLX A;  1BI0 A;  3KCC A;  4O6J A;  3V8J A;  1Z6T A;  1Z9C A;  3K9T A;  5LEJ A;  4MEX F;  1BOA A;  2NYX A;  1IAW A;  5DV5 A;  5D5V B;  1B9N A;  3BPV A;  3ZMD A;  3RJP A;  3E5Q A;  2Y48 A;  5EEH A;  5CVU A;  4OIP F;  1SFU A;  1GHC A;  3KP3 A;  4N0B A;  5E8G A;  3GXO A;  5E8I A;  4KMF A;  5FFZ A;  1QBJ A;  1U8R A;  2VT3 A;  4E70 A;  1KQ9 A;  3PQK A;  2EJR A;  2QQA A;  2HDC A;  5ILU A;  2STT A;  1RI7 A;  3SHF A;  4HA8 A;  2NS0 A;  1EV7 A;  3JSP A;  1IN6 A;  3B02 A;  3P9I A;  1T6S A;  2L54 A;  3ABU A;  3QU3 A;  4LD5 A;  1AOY A;  2RDP A;  3M8F A;  3I59 A;  3U2R A;  1TNT A;  2ZME A;  1XSX A;  2A68 F;  5CLS A;  2W24 A;  2WTE A;  4CIC A;  1IF1 A;  1S7A A;  1KU3 A;  3C18 A;  2ZO4 A;  2K7L A;  5ICE A;  3WTU C;  1U2W A;  3BY6 A;  2D1V A;  2JTV A;  1GXP A;  1MJB A;  4U0V A;  1FNN A;  5DCF A;  3E6M A;  4CDG A;  3KP7 A;  4H0E A;  4XLN F;  1OR7 A;  3L7W A;  4XBF A;  5LEK A;  1PUE E;  3JTH A;  3MZH A;  4HX7 A;  5CVJ A;  1YW9 A;  3HSE A;  3HOT A;  2DK5 A;  1OMI A;  3BOQ A;  1XMK A;  2FU4 A;  3O6B B;  3KP4 A;  2XKO A;  3ULQ B;  1KQ0 A;  1O7F A;  5D5U B;  5HVQ C;  2PN6 A;  3WU1 B;  4KIB A;  2H94 A;  5CVI A;  4EQQ A;  4L0Z B;  5AIP A;  3F8N A;  3GUD A;  3DF8 A;  3I53 A;  4CZZ A;  4Q47 A;  3BRO A;  1F4K A;  3J81 K;  5E17 F;  2L01 A;  3ROU A;  2F5E A;  2Z99 A;  2XAH A;  2JRT A;  3TOB A;  3QPT A;  3V4G A;  5CYV A;  2VBZ A;  4PDK A;  3QOP A;  2ZCW A;  4PGG A;  4AVP A;  2HQN A;  1O3S A;  1SMT A;  3Q5F A;  5D5W B;  3MAJ A;  5DCM B;  3BP8 A;  2FRH A;  2DQR A;  2BE5 F;  5KVR A;  1R00 A;  1RZ4 A;  1QZZ A;  4CYD A;  5IT9 Z;  3ZMS A;  2TDX A;  1J9I A;  3E6B A;  1YIO A;  1P4W A;  2P7V B;  1XGS A;  5D4S A;  3K1N A;  2EB7 A;  4FT8 A;  3F3X A;  4ASN A;  1EH7 A;  1XGM A;  3PFI A;  3WGG A;  2HOE A;  4RAY A; 
#chains in the Genus database with same CATH topology
 2ELK A;  5FLX Z;  2CQX A;  1FWZ A;  4LB6 B;  3BR6 A;  4PFP A;  4OWR B;  1KON A;  3WG7 H;  1LFU P;  2VAS A;  1JHF A;  2M5W A;  3ELK A;  3BJO A;  1Y56 A;  4G94 A;  4XOP A;  1OFC X;  3C2H A;  3TQN A;  3JR9 A;  3ZN1 A;  4A12 A;  5DM7 F;  4Y13 A;  3DBH B;  1LKX A;  5D5X B;  3T8R A;  2CV1 A;  1LUJ B;  2LH9 A;  4BQN A;  4CYC B;  3CO7 C;  2CV0 A;  4B48 A;  2VKE A;  1GVJ A;  2AQE A;  4HV6 A;  3DTK A;  5ED4 A;  2L9S A;  3O3K A;  3G3Z A;  4L9V A;  4ABZ A;  2P6S A;  1ZG5 A;  2KJC A;  4QIW N;  2B9S A;  1LQ1 A;  3TO6 A;  3PNT A;  3Q0V A;  3CP2 A;  3E6D A;  1R71 A;  3VYU B;  2EWN A;  1DP3 A;  1USS A;  1VQP I;  2CUF A;  2V9V A;  3QQA A;  3LAP A;  2WWY A;  1GDT A;  2E2I J;  5LBQ A;  1OCC H;  2X51 A;  1UFM A;  3OSF A;  2K4J A;  2ESN A;  2FSW A;  4C30 A;  1AKH A;  1VI0 A;  4WK8 F;  3G4S I;  2DFI A;  1MGT A;  5JVG F;  4X6A J;  3E7L A;  1X19 A;  1ETW A;  2O9L A;  2JA2 A;  2BHZ A;  2OJE D;  3Q0W A;  5DUK A;  2NNY A;  2GIV A;  2HU9 A;  1P4X A;  2IJL A;  2V79 A;  4XLA A;  4E7Z A;  5B1A H;  3CCJ I;  2F5F A;  2K9M A;  3PFY A;  2BY0 A;  4G7O F;  1P2F A;  5EZH A;  2DJN A;  3J80 Z;  3VPR A;  3JCU C;  1DU6 A;  2DA4 A;  3I3L A;  2NS7 A;  2Z1D A;  1CF7 B;  3QPH A;  2IRF G;  1T39 A;  1HKT A;  2DQL A;  1I39 A;  2IS2 A;  2BY3 A;  5L3G A;  1T08 B;  2P5V A;  4O5V A;  1ZRD A;  2XDV A;  1ZK8 A;  4AYB N;  3LQQ A;  2ZNY A;  2DOD A;  1KYZ A;  2MG4 A;  2DYS H;  2PFB A;  2E2J J;  1OCR H;  4XN0 A;  3B6A A;  2KRH A;  1X58 A;  2HNH A;  5J1U A;  4B44 A;  1R5H A;  4ZZL A;  1EJ9 A;  2VKH A;  4HST A;  1J09 A;  1S7E A;  1G3S A;  2FNP A;  3BG9 A;  2DTZ A;  2MAB A;  3EUA A;  4W1U A;  2PLY A;  3SQN A;  3IP4 B;  4RGS A;  4ZYD A;  4I01 A;  4IHV A;  2M2E A;  1ZEL A;  2P8T A;  3I54 A;  4M6X A;  4NUB A;  2QKL B;  1QVT A;  4UVC A;  1XTA A;  2QGU A;  3K10 A;  4DJA A;  1MMG A;  4ZDP A;  4FQG A;  2X6X A;  3IRQ A;  4XM3 A;  3BR1 A;  4I76 A;  1K78 B;  2IXS A;  1DP7 P;  3M07 A;  4YFX F;  4OIO F;  4XR6 A;  1TNS A;  3CUO A;  4XOT A;  2Y75 A;  3FHN A;  3LMM A;  3IV5 A;  3AG1 H;  5JHU A;  3TL4 X;  3K70 D;  4GGG A;  2M4K A;  4BQA A;  3OYE A;  1QVU A;  2F2E A;  4A6E A;  5E3O A;  1X3Z B;  4L5E A;  6PAX A;  3WTV C;  3N97 A;  1YS7 A;  1ZGW A;  4ON0 A;  5L3C A;  2KHM A;  5GTI C;  2XVC A;  5GTH C;  5IYC J;  5JR3 A;  3DEE A;  5B66 C;  5J4V A;  3F6O A;  2EA4 A;  5LRR A;  2OC6 A;  2XGC A;  1WZ2 A;  3DKX A;  3C1D A;  1ONV A;  4DBQ A;  1Z21 A;  3GYH X;  1MH3 A;  3VEP A;  4BYY A;  1JGS A;  2RQQ A;  3M7G A;  1I27 A;  2LD5 A;  4PCQ A;  1UZC A;  4Q4Z F;  4A3M J;  3T1B A;  4M9X A;  3KEO A;  4B43 A;  1TW3 A;  4J01 A;  4AYB A;  5JLW A;  1MKM A;  4ZJZ A;  2LP0 A;  2FML A;  2LYC A;  2HTJ A;  2HVQ A;  2ICW G;  2XIG A;  2LK2 A;  3GVA A;  4BAY A;  1FZP B;  2VT2 A;  2IGK A;  2VB6 A;  4MQV A;  1R49 A;  4HQE A;  4NHJ A;  5A2Q Z;  5IP9 J;  3LOC A;  3E6C C;  5HLH A;  1Z67 A;  1VQO I;  1WFX A;  1U8B A;  5LHI A;  2Y0S N;  2AQF A;  1Y39 A;  2IA2 A;  3M8J A;  3GTK J;  4HEA 2;  2ZXI A;  3ZMZ A;  2HOS A;  3CJQ B;  3SYT A;  1FSH A;  1A5J A;  2FA5 A;  3TOA A;  1B6A A;  2GAU A;  4RGU A;  2KZG A;  1XCB A;  3A4C A;  2DFH A;  4KFC A;  2XHK A;  3MKL A;  2UZK A;  3I5U A;  3FX3 A;  5FD5 A;  5J8C A;  3TO9 A;  2MYS A;  5LHG A;  4RLQ A;  1B9M A;  3V8K A;  4PK4 A;  4FHT A;  4XLC A;  5BPI A;  4BJ6 C;  4X0G A;  2IVM A;  4IJA A;  4RMN A;  1VQN I;  2EFQ A;  3Q9V A;  4KUM A;  1LVK A;  1MBJ A;  3GFI A;  2LR8 A;  1Z05 A;  2R7W A;  3Q9S A;  3H0G J;  4XRM A;  3P5J A;  4BE0 A;  3DKW A;  3RPU D;  4IOC F;  4MLO A;  1IXC A;  2YSR A;  2EZH A;  2OCC H;  5HDG A;  3HKZ A;  2E7W A;  2JVG A;  3BZ6 A;  1MND A;  1HCR A;  1PYV A;  3ERM A;  1YIJ I;  9ANT A;  3W2V A;  2M1B A;  4BDY A;  1BIB A;  2LY9 A;  4OMZ A;  4E4H A;  3P7N A;  3RPU A;  1ZR4 A;  4UB8 C;  4AU7 A;  3HTU A;  3I59 B;  3FXU A;  3REO A;  5FRO A;  3S1N J;  2JMW A;  4G12 A;  2DW4 A;  2MGQ A;  2ZME B;  4AIH A;  4IQJ A;  3BR2 A;  2EK5 A;  5KCM A;  3HXL A;  1FMV A;  3M9A A;  3L2W A;  2F4M B;  2F6C A;  3K4J A;  3DWL E;  3OYA A;  2D2W A;  1UG2 A;  1YX3 A;  3PQJ A;  2JRM A;  2L7Z A;  4YEJ A;  2EV6 A;  2DA2 A;  4KIT B;  3I4P A;  4UNO A;  4ENM A;  2ELH A;  3CJT B;  1HSJ A;  2CQQ A;  2K9S A;  5CJ9 A;  3WTW C;  3A2K A;  3FXO A;  3AG2 H;  4A3K J;  2AHQ A;  2Z33 A;  4EAT A;  3H9J A;  2FEZ A;  1A31 A;  1I6H J;  2B0L A;  2M30 A;  1IC8 A;  3HRU A;  3BTI A;  1WI3 A;  4C3I J;  1K4S A;  3WTT C;  1VQ4 I;  5HOD A;  3HGY A;  2DOA A;  2XKP A;  4Y4R A;  5C4J J;  1Y0N A;  1YYV A;  5FKK A;  3PNV A;  2ECB A;  4U88 A;  3HOZ J;  2M8G X;  2AXT C;  2CW7 A;  1VZ0 A;  1G2H A;  4ZYH A;  4LFU A;  4P9U A;  2KKO A;  2H09 A;  3RKY A;  4EMS A;  2E60 A;  5B1B H;  4EEF G;  3NEU A;  3WG9 A;  3DXJ F;  3WHC A;  4HG2 A;  3OIQ A;  1NG7 A;  1QRY A;  2OBP A;  3GME A;  4NC8 A;  3GW2 A;  3OMY A;  3JRG A;  2LKP A;  3F21 A;  1KYW A;  1E0E A;  2L7M P;  1TL8 A;  2HKO A;  4L9J A;  4II3 A;  5HNH A;  1YIT I;  2NNN A;  3FK6 A;  3RZD J;  2Z5U A;  2DMU A;  1IW7 F;  2A6E F;  2KP6 A;  4RS8 A;  4OAZ A;  4OIQ F;  1PVE A;  2M0M A;  3TDZ C;  3IAS 2;  1LDJ A;  1Z6R A;  2H6C A;  1W7P D;  4YG2 F;  2ISZ A;  5IT3 A;  1E3P A;  5K5O A;  2PJR B;  4NC6 A;  4EJT A;  2OD5 A;  4V19 K;  2XRL A;  3B73 A;  4RDU A;  3BG6 A;  2YPR A;  2KRC A;  2YU3 A;  3KE2 A;  3QWL A;  4M3G A;  4F92 B;  4XKV A;  4CCO A;  1UEL B;  3H1C A;  1TC3 C;  5FO5 A;  1J0R A;  2UWM A;  2BY2 A;  2HDW A;  2GA1 A;  4BJT A;  1REP C;  4IL6 C;  2XF7 A;  4IF4 A;  3H0D A;  2LF8 A;  1RIO H;  2IS1 A;  2DMT A;  2L0K A;  1L0O C;  2P81 A;  2DMP A;  4I02 A;  3X2Q H;  1O4X A;  3HDD A;  1XDS A;  1HBX G;  1FX7 A;  2OCE A;  1D5V A;  4BHP A;  2M7A A;  4ZZD A;  5IP6 A;  4A0Y A;  1XMA A;  2RQP A;  1SVL A;  2JA6 J;  2F5C A;  3ABT A;  1V4R A;  3E0J B;  3HSF A;  3ZQC A;  5E18 F;  1TP4 A;  4P9F A;  2HWV A;  5CPR B;  2X1C A;  3ERE D;  2DT5 A;  3ISP A;  2KRF A;  1HQC A;  2G9W A;  3FXK A;  2Y31 A;  3H3U A;  3F9K A;  4EJU A;  3PM1 A;  4HLY A;  4BEH B;  2Z3Y A;  3GFM A;  1IG7 A;  2Y0M A;  3OL4 A;  1B1B A;  3A02 A;  5J8F A;  1WH7 A;  3MZ8 A;  2M34 A;  4KT5 C;  2Q8K A;  4B4C A;  2GLO A;  5FLX K;  4I2O A;  2M4G A;  1MMN A;  2QKM B;  1V54 H;  2FBK A;  4B3X A;  2V1U A;  1MIJ A;  2VJ5 A;  3CP8 A;  2HGC A;  2WV0 A;  4ZYG A;  3FXQ A;  1ZYR F;  3M1E A;  1ON2 A;  4PJN A;  3VYS B;  2K9Q A;  4PGH A;  5FJ8 J;  3JRH A;  3S32 A;  3KZZ A;  1ZN2 A;  1RC9 A;  1YE9 A;  1F5T A;  3DPT A;  4LLL A;  2X6O A;  4LLN A;  4YIF A;  2CQN A;  2V1N A;  4DYQ A;  2G7H A;  3OYI A;  1Q1H A;  2R5Z A;  2EZI A;  1WJD A;  1Z77 A;  3R60 A;  4IHW A;  4J00 A;  3PSI A;  1MW7 A;  4A5N A;  3PUF A;  1F1Z A;  1SD5 A;  2CJJ A;  2XV4 S;  3HHH A;  5GPA A;  2QQ8 A;  4U0W A;  1AKH B;  1LDD A;  1U6G A;  2W84 A;  3HOX J;  1R1U A;  4UB6 C;  2CYY A;  1OPC A;  2E1M B;  2V1X A;  2QEX I;  2E1M C;  1HKQ A;  1JUS A;  1IUF A;  2HTS A;  1F36 A;  3GTL J;  1ERD A;  2NXN B;  2IGN A;  3S1M J;  2QZ8 A;  2IGM A;  1P7J A;  4IEJ A;  2A5Y B;  3C3W A;  3DLA A;  1MZB A;  5FKO A;  2J5O A;  4F7Z A;  1MNE A;  4GCV A;  3J80 K;  3OYG A;  3CF2 A;  2OPT A;  3DFG A;  4DZP A;  3FF5 A;  1VQ6 I;  3F8M A;  5KK1 A;  4U7D A;  5AIQ A;  1TQI A;  3KPH A;  5EZG A;  4MTD A;  5IYD J;  2Y69 H;  4A0X A;  4NB5 A;  1B4A A;  3S15 J;  5J47 A;  3CCV I;  2HYG D;  1VTN C;  4ZDO A;  4MFD A;  1ETQ A;  2OTL I;  1RUN A;  2VOP A;  1XX5 A;  2F4I A;  2FBH A;  1IUY A;  2FXA A;  4XKC A;  5BQT A;  3SXY A;  2E1N A;  2DOF A;  3L2C A;  3GTJ J;  3KX2 A;  2PI0 A;  1G3T A;  1ETV A;  3ECH A;  3BLY A;  1OQY A;  5DEQ A;  4BE2 A;  3D5S C;  2ZC2 A;  2XGE A;  2F5V A;  2N8G A;  1FEX A;  2DTR A;  3CCY A;  4LMY A;  4L5I A;  5LGU A;  2JZY A;  1WSU A;  1G3Y A;  1QZE A;  1KU7 A;  1WHU A;  2BVL A;  1FYM A;  5D8L B;  1FMW A;  2KL4 A;  2K9L A;  3OYJ A;  3JRI A;  2HS5 A;  3PUB A;  2E35 A;  3S8P A;  4JK1 X;  2YS9 A;  2L9V A;  1MJA A;  1NTC A;  2Q2E B;  2VOO A;  3S14 J;  4S0H B;  1O3Q A;  3IH2 A;  2O7O A;  4FX4 A;  3OS1 A;  1BIA A;  2QUF A;  1UHM A;  4KIG A;  1P6R A;  3CF5 F;  4II2 A;  4BXX J;  2AXL A;  3LA2 A;  4BS9 A;  2CH0 A;  3EYY A;  5LGT A;  4FE7 A;  3K1P A;  3H5A A;  4BL0 B;  1Y0U A;  5C3E J;  2YR2 A;  1BC7 C;  2IT0 A;  1BI1 A;  4DQ2 A;  3KYL A;  1IRX A;  2VBW A;  2EQR A;  2XRN A;  2JWT A;  2Z2S B;  4G6Q A;  3SDB A;  5M5Y J;  2JN6 A;  3PO3 J;  1LFP A;  5M5X J;  4RLF A;  3BZC A;  5BOX A;  1YQA A;  1ZGA A;  3RKW A;  3I4M J;  3BG5 A;  3O2P E;  4XMY A;  3OV8 A;  4OIN F;  4KA4 A;  5L3F A;  4WXD A;  1H0M A;  3W2A A;  2KLO A;  2XAG A;  1ULY A;  4CSW A;  4BXU A;  1NG6 A;  3ZCO A;  3KFW X;  3FM3 A;  5D8K B;  2H8R A;  3GZ5 A;  1SMY F;  1W5T A;  2LF7 A;  3TP0 A;  3CES A;  4KDP A;  4X1E A;  3K70 C;  3AL0 B;  2PBI A;  3OIO A;  2QSH X;  1XSV A;  3AL0 C;  5ERI A;  4A5M A;  4M71 A;  1BM9 A;  4JP0 A;  3MFK A;  1ZRE A;  1EA3 A;  4Y33 A;  2E36 A;  5E1X A;  1T2K A;  2K27 A;  5EEG A;  2DXI A;  3G1L A;  3R61 A;  1SFX A;  1WCM J;  2HOT A;  1OLT A;  2RV8 A;  5K5Q A;  3DKY A;  2VC0 A;  2AS5 F;  5BMZ A;  1QO0 D;  2EFN A;  4M9Z A;  2QYO A;  4OOI A;  4U87 A;  1C0W A;  4HOB A;  3M8E A;  5A2Q K;  3C7J A;  2NVT J;  1BJA A;  3FM5 A;  3FBN B;  2CMP A;  4BH9 A;  4UUS A;  3FHZ A;  4B8X A;  4E6K G;  4HX4 A;  1H9T A;  1JXS A;  3SFI A;  2HFH A;  2CW0 F;  1FY7 A;  2STW A;  5CQG A;  4A0Z A;  5J1R A;  1AWC A;  3E5X A;  3H3Z A;  1JE8 A;  4U7B A;  1U78 A;  2R4G A;  2DFF A;  2V9K A;  2H6B A;  4PJJ A;  3R0J A;  4HPQ A;  3I4N J;  1MBH A;  4AD9 A;  1IZ1 A;  4AIJ A;  3CC2 I;  3Q3S A;  5D6F A;  2E1C A;  4LG0 A;  1MJ9 A;  5LHH A;  4ENN A;  3OYF A;  4IRH A;  1O3R A;  3MWM A;  1ZAO A;  2XF6 A;  4BY1 J;  2BZT A;  2PQ8 A;  1JHH A;  4NQW A;  1XN7 A;  2WB1 A;  2CFO A;  3DU6 A;  5ILV A;  3LWF A;  2NAZ A;  3D1N I;  2CSO A;  4LK1 F;  2HYJ A;  3MMY B;  1GXQ A;  1S8N A;  1TT0 A;  1NHA A;  4DZJ A;  4KT6 A;  2EBI A;  3KYD B;  2HOA A;  3T0Y A;  5J6X A;  1KQ8 A;  3FXM A;  5DDG A;  4BAC A;  5HOO A;  3AKZ A;  2IS4 A;  2P7C B;  1RKT A;  2MFZ A;  2BY1 A;  3F8B A;  3LA3 A;  3S2W A;  5E1W A;  5FRN A;  2GOX B;  1MDM B;  5JFR A;  1Y8Q B;  1K7A A;  4ZYE A;  3I9V 2;  3SEZ A;  2FE3 A;  4LLG F;  2XB0 X;  3RIR A;  4GYI A;  4QWQ A;  3U1D A;  4HF2 A;  2XC7 A;  2R7R A;  4HF1 A;  3MVP A;  5M3M J;  3VSK A;  1S9H A;  3HM5 A;  2M3A A;  2L9R A;  2H1K A;  4RB3 C;  2X1E A;  3OR2 C;  1QNT A;  2MLK A;  5L3E A;  2GXB A;  1S3J A;  1T56 A;  3H5R A;  4KN4 X;  3SZG A;  4BJ5 C;  1QHH D;  2ESH A;  3ZGK A;  3S3N A;  4CCL A;  5TIS C;  3AAF A;  2PEX A;  1POG A;  5L3D A;  1I3A A;  1DUX C;  4O3M A;  4AM3 A;  2MSY A;  1BC8 C;  3LSK A;  4KJZ A;  5EYR A;  1SD6 A;  3ZQQ A;  3D5L A;  1G6N A;  3JRA A;  3G1O A;  3R0A A;  4RAF A;  2E2H J;  4AID A;  1SEU A;  2HEO A;  3ZQ7 A;  3PIP F;  1E17 A;  2GZW A;  1WWX A;  2X6Y A;  2HZT A;  3IUO A;  4XSZ F;  2I5U A;  3ZRG A;  4BHB A;  2BEO A;  3QOE A;  2BXY A;  1BA5 A;  3ASN H;  3JRC A;  4UVB A;  1O7L A;  4EJW A;  1F9N A;  1F43 A;  3I0T A;  3JTG A;  4ESJ A;  5LGN A;  1DGR M;  3NAU A;  2Q2E A;  4MNU A;  1BR4 A;  4RGR A;  1S6L A;  5E79 C;  3A1Y A;  1Y1V J;  2EZL A;  5H6Q A;  2RNJ A;  2BVM A;  3LFU A;  2VPL A;  3FWE A;  2WV1 A;  1N75 A;  4FE4 A;  1XB4 A;  1BW5 A;  5ILS A;  4HX8 A;  4G8X A;  3BG3 A;  2E5N A;  4ITV A;  2FQ4 A;  1DQU A;  5HLI A;  2D1H A;  1BOB A;  3PNY A;  5EG0 A;  1A04 A;  5F0C A;  2WAQ N;  4ZTF A;  4LJZ F;  1XS9 A;  1EF4 A;  3COA C;  3RYP A;  3KET A;  2H27 A;  4XOR A;  2XGD A;  4WF2 A;  5H20 A;  2K40 A;  3CCL I;  2QQB A;  3E3V A;  3QYE A;  4A3L J;  3CJN A;  3J81 Z;  4DYC A;  3HOU J;  3CCU I;  2QQ9 A;  3HKZ N;  4XRF A;  4G7H F;  1IDY A;  4N9H A;  3OYL A;  3GX4 X;  1T8I A;  2O5R A;  3HTS B;  5E3M A;  4D7M A;  2Z9O A;  5E3L A;  1GLN A;  5CVR A;  1HC8 A;  3ZQL A;  4HQM A;  5DD4 A;  3JAM Z;  3TW6 A;  2W7N A;  1QU3 A;  1W7P B;  2WC2 A;  5TRD A;  2JPC A;  2BOL A;  2KMU A;  3HOS A;  2NVU B;  4UHT A;  2M9H A;  1SD4 A;  1BN5 A;  4D7N A;  1LFB A;  2P5L C;  2W1O A;  5F1J A;  2R92 J;  3MN2 A;  2QM3 A;  1WVR A;  3K69 A;  3GWZ A;  1R1T A;  2R7F A;  3TW7 A;  1BBY A;  2VQL A;  1AHD P;  4CA0 A;  1JKO C;  3DQV C;  5M5W J;  3CC4 I;  1IXR C;  2OUM A;  3FMS A;  4EV0 A;  2X0L A;  1ZTR A;  2ZBK A;  4J19 A;  1UAA A;  4RM2 A;  1X1P A;  4A6D A;  3K4L A;  3KZY A;  3OYK A;  1IXS B;  1XD7 A;  5E3N A;  2A5W A;  3CDL A;  1RUO A;  3L00 A;  1IN5 A;  3K4M A;  3QP5 A;  5D6E A;  1FOY A;  4JX4 A;  2FF4 A;  1P4A A;  1GT0 C;  5ICF A;  2DJI A;  2L9N A;  2YUS A;  3GO5 A;  5EF6 A;  3K4N A;  4E7J A;  2ID3 A;  2OZU A;  3GTM J;  1YW7 A;  5BS6 A;  2HQR A;  2LOO A;  5BNG A;  1WI9 A;  3RCO A;  1I3Q J;  4DGW B;  3IC7 A;  3OS2 A;  3OIP A;  4I99 C;  4CXF A;  2LSO A;  3ML6 A;  4D0P A;  1FC3 A;  4DW6 A;  2JT1 A;  1HXD A;  2MD5 A;  3MKZ A;  3I71 A;  3KLO A;  2IAI A;  2XRO A;  4ZTJ A;  5K7H A;  1Z0X A;  1OKR A;  3DEU A;  4KN7 X;  5EGO A;  1HW1 A;  1TT5 B;  1MD0 A;  3UNG C;  1W1W E;  3EDP A;  2WAQ A;  1XG1 A;  4BDZ A;  1JKQ C;  4FET A;  2X6W A;  1D3Y A;  2B63 J;  1SFK A;  1B8I A;  2A05 A;  5F08 A;  3L9F A;  1G4D A;  4OMY A;  2DDB A;  2DK8 A;  3W6K B;  1G3W A;  2R5Z B;  2P6T A;  2VLA A;  1TWA J;  3ABK H;  2QLZ A;  1FIP A;  1ON1 A;  2QF7 A;  3KP5 A;  4XLP F;  3IWF A;  1ZG3 A;  2PJP A;  1GV5 A;  5J1Y A;  2VOD A;  3FXL A;  2MW8 A;  4EVI A;  1VFC A;  4RB0 A;  1MDM A;  2L4A A;  4OAY A;  3S93 A;  1UJ8 A;  3VSL A;  1ACI A;  4A3B J;  2RC4 A;  2JUC A;  4HAM A;  1U3E M;  2DBB A;  4HBL A;  2DT6 A;  3OYC A;  2J5P A;  2VXD A;  4RB2 C;  1QQI A;  2KIQ A;  3OL3 A;  2GWR A;  2KIM A;  2GQQ A;  5H2F C;  4QLC U;  2EIN H;  3CC7 I;  2K3P A;  3WTZ A;  2V6E A;  4I09 A;  4PSX A;  1IN4 A;  2IW5 A;  3E97 A;  1IGN A;  1RR7 A;  2YX7 A;  4GDF A;  4XKB A;  4M73 A;  1U0J A;  2CV2 A;  2MLG A;  4BHC A;  3WTS C;  4B09 A;  3F8C A;  2HR3 A;  4G9Y A;  4A3C J;  2AO9 A;  4MO7 A;  5ICG A;  2IA1 A;  1LDK B;  3K1M A;  4CCK A;  1FYL A;  1VQ9 I;  1W36 D;  2CS3 A;  2ZJR F;  3DP7 A;  2FD5 A;  2TCT A;  3KEY A;  3BWG A;  5J4Y A;  4JOM A;  1HDD C;  1KU9 A;  2LG4 A;  2W25 A;  1TTY A;  3J7A Y;  1YLF A;  2EIJ H;  4C3H J;  2BGC A;  3JRE A;  3BJA A;  3F0C A;  4HW0 A;  3JW4 A;  2VKD A;  1T0F A;  3P9K A;  3RSN A;  1R58 A;  4A69 C;  2K85 A;  3CLO A;  5GAH J;  1K79 A;  1HOM A;  3S2H J;  1OCT C;  4GFB A;  1WH5 A;  3E1S A;  1ETX A;  1R5I D;  4HF0 A;  1IO2 A;  2LKS A;  3S3M A;  4RGX A;  2HPI A;  2XSD C;  5IP7 J;  1B59 A;  4WCG A;  2R0Q C;  1VQ5 I;  3A0B C;  5FFX A;  2CFX A;  2QBY B;  1WJA A;  4U0Y A;  1YHQ I;  1JJ8 C;  1T33 A;  2EV0 A;  4EJO A;  3GTQ J;  1IRF A;  4M9S A;  1MBE A;  2VXZ A;  3HL2 A;  4EGY A;  4LGW A;  2O6G E;  1T98 A;  3G6E I;  4DIQ A;  3MKY B;  4W97 A;  3C2G A;  2UXN A;  2ME0 A;  3RQI A;  3OYH A;  2R5Y A;  4Y52 J;  4RBO A;  1JKR C;  1NK3 P;  5ICC A;  4H4K C;  1H88 C;  1J5Y A;  1HST A;  5FLM J;  2Q0O A;  2BYV E;  4UUT A;  2XUB A;  3BPX A;  4QPO A;  2EA2 A;  4LK0 F;  1W7P A;  4HNT A;  3RPQ A;  5JI6 A;  2ETH A;  4YFN F;  1L3L A;  1B72 A;  1H89 C;  3U1K A;  1ZLJ A;  2BW3 A;  2DMQ A;  3H35 A;  3V7R A;  2JQ7 A;  3H3V K;  1QZY A;  2D5V A;  2K02 A;  3KIO A;  4BBS J;  3CD6 I;  3QPL A;  2OA4 A;  2M87 A;  2VI6 A;  4PZJ A;  2V9P A;  4HRI A;  3K0L A;  5IT9 K;  1LB2 A;  2JSP A;  2KZV A;  1SFE A;  4XLH A;  3I56 I;  3LQR A;  5DUI A;  1MSE C;  2A6H F;  2EFW A;  2ZKZ A;  3L09 A;  3CLQ A;  1WJ5 A;  2IBD A;  5HS8 A;  4F55 A;  4XID A;  1FYK A;  5GPC A;  2Z16 A;  3ZP5 A;  3IRR A;  1IJW C;  1SAU A;  1D8J A;  5FD6 A;  4HDU A;  3SJM A;  4ANJ A;  3AG4 H;  1R23 A;  4UY8 I;  2VJJ A;  1GUU A;  4HV5 A;  3M1C A;  2IS6 A;  4M6Y A;  2CGP A;  4RAZ A;  2JPB A;  1X1C A;  3BJ6 A;  2FUG 2;  1I1G A;  2PX9 A;  4HSR A;  4UUS B;  1SD7 A;  3CJR B;  3S16 J;  2KIU A;  3V7S A;  2ZXW H;  1BW6 A;  2ADU A;  3TED A;  5DM6 F;  3TO7 A;  4WWC A;  2R7T A;  2L3D A;  5L3B A;  1RNL A;  1V3F A;  4C2T A;  3UKG A;  4D5F A;  1UG0 A;  4A3F J;  1FTT A;  2ZXJ A;  3V7C A;  4L9T A;  1TWH J;  1YW8 A;  1FOW A;  3HPH A;  5E1Z B;  1X2M A;  4LG0 B;  1W5C C;  3W6V A;  2F48 A;  1Z3X A;  3EUH A;  3I64 A;  2EPF A;  2HQ5 A;  2DI3 A;  2PMH A;  2W82 A;  1ZQ3 P;  1FOX A;  2M7B A;  3KLN A;  3WGI A;  2COB A;  1OYW A;  4MHG A;  3OSG A;  1UCR A;  4NQW B;  4D1Q A;  4BQO A;  2LVS A;  1K6Y A;  1TWG J;  1KA8 A;  3WTY C;  2QWW A;  4BNC A;  3KZI C;  2BBY A;  2A61 A;  1EKE A;  4L18 B;  3ECO A;  1J7K A;  3HPG A;  2EIK H;  4KNY A;  4Y15 A;  3S3O A;  1RR8 C;  1LVA A;  2DDA A;  2R7Q A;  3HRM A;  3FMQ A;  4EM1 A;  1JGG A;  1TWC J;  2K86 A;  2LC2 A;  4L0Y B;  1V5G A;  4IOA F;  1JI8 A;  4ESB A;  3RDI A;  1ZG1 A;  1XDU A;  3CQZ J;  4IVN A;  2QCO A;  3CZ6 A;  4JQF A;  3VFZ A;  2XAF A;  3R4K A;  3GFJ A;  3JRD A;  3W6J B;  1BI2 A;  2CU7 A;  1X2N A;  2KIF A;  2YU9 J;  3TGN A;  4Q5S F;  2YX4 A;  3SFZ A;  5EDN A;  1FJL A;  4M72 A;  2HQA A;  2JJ7 A;  4LIU A;  4IXA A;  2KQR A;  4XRS A;  3LNQ A;  3RYR A;  1U5T A;  3BCB A;  3HHG A;  2FX0 A;  3RKQ A;  3LL7 A;  3CUQ B;  1RET A;  4MFE A;  5DD8 A;  3RTR A;  3CUQ C;  1A6I A;  1K83 J;  2W85 A;  1N77 A;  1XC5 A;  4UUV A;  4QPQ A;  3CTA A;  3RKX A;  4FX0 A;  5F0F A;  3LSP A;  2K9N A;  3QAH A;  4QSH A;  5KHD A;  3OYM A;  5GAE J;  1RES A;  1JUM A;  2HKX A;  5EEA A;  2R3S A;  4HYE A;  4XK4 A;  1VQ8 I;  2DA1 A;  2R7S A;  1OIS A;  5FKN A;  3VOD A;  4ZC3 A;  4GO1 A;  3FIW A;  3CCQ I;  3ZN0 A;  3EYI A;  4HZF A;  2QSG X;  4M3B A;  1QPI A;  2ZJ2 A;  5F1R A;  1Z1D A;  4M3E A;  1A36 A;  3N4M A;  2NOJ B;  1MMA A;  3ESW B;  4ENK A;  2QBY A;  4CHU A;  1R5G A;  3FDY A;  5IPA A;  4CO8 A;  3IL2 A;  2HYF A;  1SAX A;  1UB9 A;  3ZMT A;  4KMU X;  5FGM A;  1O57 A;  3VDX A;  3GLL A;  1YO5 C;  3H36 A;  1SVM A;  3F72 A;  4LIT A;  3V8L A;  4CGZ A;  5K5R A;  4ZYA A;  4CCJ A;  3HIF A;  3GTG J;  2E71 A;  3I58 A;  4C2M J;  1A6Q A;  1VQM I;  2H8W A;  1IRG A;  2WBM A;  5HS9 A;  2ISY A;  4XKW A;  1WQ2 A;  2O0Y A;  4ETS A;  4Q48 A;  1LEA A;  2FQ3 A;  2ID6 A;  2WA0 A;  2DMN A;  3J7Z I;  3BG7 A;  4IX7 A;  3ZMV A;  3L2U A;  5EG0 B;  1MMS A;  2IP2 A;  2MH9 A;  1YX5 A;  2VQG A;  4M6V A;  2WB1 N;  4RB1 A;  3RI4 A;  2CQK A;  2CO5 A;  1V5F A;  1E2X A;  3QPS A;  3ZOB A;  5FB2 A;  5EJC A;  1FT9 A;  2LRD A;  5F6F A;  1DPU A;  2JVH A;  2W57 A;  4PSW A;  5LD2 C;  2ACJ A;  4RA2 A;  3HOW J;  2ZB9 A;  4K2E A;  3VB2 A;  4JBA A;  3GZ6 A;  2EFO A;  2R7X A;  3CCS I;  1A35 A;  2DPU A;  4GXO A;  2KIS A;  3GTP J;  1TBX A;  1TW2 A;  2VKV A;  1EH6 A;  1FBU A;  3DBR B;  1VQK I;  1FSE A;  2MA3 A;  2X85 A;  3JAM K;  4A3J J;  1OYI A;  3B6C A;  1YRN A;  1SVO A;  2WAD A;  3T5X A;  1SAN A;  3S17 J;  4S04 A;  1MBK A;  3CMA I;  4D9J A;  2R93 J;  1G59 A;  3EET A;  1R36 A;  3F8F A;  3FBI B;  3HSR A;  3BR3 A;  3S1R J;  2NRA C;  2IGO A;  1ODD A;  5KNL A;  2GIZ A;  1ZAR A;  3M4O J;  2PG4 A;  3PIO F;  1ZGJ A;  2V7F A;  4Y3O A;  1NK2 P;  2L7F P;  1D1B A;  1ZH5 A;  2RGV A;  1D0Z A;  1H8A C;  1WJF A;  4S05 A;  1Y1W J;  2VBX A;  2CUZ A;  1P7I A;  4IRG A;  2DA5 A;  2OV7 A;  2P5K A;  3EQL F;  3W3C A;  2JA7 J;  3KP2 A;  4L5J A;  3S1Q J;  3ONQ A;  4UXN A;  3JRF A;  3KEQ A;  2UXX A;  2DT7 B;  4MTE A;  4Z2Y A;  4HNU A;  4RAG A;  3WHB A;  3OOP A;  4PUS A;  5J40 A;  3KP6 A;  2OZ6 A;  2RVC A;  4CUG A;  1SC7 A;  2VC1 A;  2V4J C;  3G73 A;  3O8H A;  5JVT A;  1ORK A;  2K4B A;  2E19 A;  4UV8 A;  3HOV J;  5EGO B;  5HNF A;  3TKY A;  3H9Q A;  3CME I;  1Z3Y A;  1S72 I;  2ZJP F;  3FXJ A;  2JA8 J;  3A01 A;  4R79 A;  1MBF A;  5C44 J;  2QEN A;  4C9Y A;  1D0Y A;  2JSC A;  3IKT A;  2MD0 A;  4KIF A;  3L2V A;  2D45 A;  1B8I B;  1ZRC A;  5HDK A;  5LLQ A;  1TQP A;  3LSG A;  3OYN A;  2LBF A;  4P5O A;  1FBS A;  3T8T A;  2HVR A;  3D0S A;  3WOD F;  1WGX A;  3MQ0 A;  4CCN A;  1E3O C;  2F5D A;  1IDZ A;  1LNW A;  4LB5 A;  3CDI A;  2V1D A;  4ENJ A;  2OAZ A;  3CDH A;  3BT9 A;  1MBG A;  2TRT A;  2VIX A;  2KJB A;  2W4S A;  4WX9 A;  2ZFW A;  2DPD A;  1LEB A;  3HRT A;  2MBF A;  2QVO A;  1O3T A;  2JA5 J;  1QPM A;  3QOD A;  2CW8 A;  4AWX B;  2A07 F;  1UHS A;  2Y2Z A;  3CUQ A;  4XQF A;  2DO7 A;  4WXC A;  5CKT A;  1R22 A;  3FXR A;  5B5E C;  1HF0 A;  4E7S A;  2NVQ J;  2VE9 A;  4B3A A;  3J7A O;  3M3Y J;  1QA6 A;  5FLV A;  1ZRF A;  4BU2 A;  3ABM H;  3WGH A;  3ABL H;  3R6S A;  3MD2 A;  2RKH A;  4P1W A;  1IRZ A;  1U9N A;  4YII A;  1X4O A;  1X1D A;  2X48 A;  3BDD A;  2DAO A;  2F4O B;  2GXG A;  4JX6 A;  2EZK A;  1KZH A;  1X3U A;  1LJ9 A;  3JSO A;  2E5Z A;  4M74 A;  4QTR A;  3HC7 A;  2OQR A;  5AON A;  3UR3 C;  1WRJ A;  4LOC A;  5HLG A;  1ZHF A;  4JX5 A;  1D1C A;  4E7H A;  1PUF A;  2VBY A;  3RZO J;  4AUX A;  2OF7 A;  2VQH A;  4ESF A;  3CMY A;  1H9G A;  1RPW A;  2E1O A;  3P9C A;  2XPV A;  2MH2 A;  4XN3 A;  4HDV A;  1YI2 I;  1MSF C;  1T0F C;  3WE2 A;  2BV6 A;  4FCY A;  3TDU C;  4I6Z A;  5TJJ A;  1S7O A;  4CZC A;  5F64 A;  5BPD A;  1W36 C;  1YG2 A;  2DFE A;  4A2U A;  3F22 A;  1OJL A;  4G6D A;  2O61 A;  3HJE A;  2ZNZ A;  4F93 B;  4BY7 J;  2VN2 A;  3VOE A;  5FRM A;  1I50 J;  2RNG A;  2CQ7 A;  2LFB A;  2HXI A;  1OCP A;  2LDU A;  3K7A J;  3W2W A;  2VL8 A;  3MCZ A;  3DPU A;  3FIS A;  1IV8 A;  2UV1 A;  1DU0 A;  1VF9 A;  4EM0 B;  3BC8 A;  4NDL A;  1R4N B;  2XAQ A;  1XGO A;  5F04 A;  2FMY A;  5F27 A;  1WJE A;  2G0E A;  3QRF F;  5IY5 H;  2R5Y B;  3QU6 A;  2DN0 A;  3HUG B;  2VE8 A;  3I55 I;  1P92 A;  1DPR A;  2DA3 A;  3QP6 A;  4TV7 A;  5K1Y A;  3SDG A;  2ZJQ F;  5IOZ A;  2X4H A;  4UV9 A;  1Y6I A;  3WTX C;  1G8X A;  3KYC B;  2C6Y A;  3ZPL A;  2EH3 A;  2EIM H;  5C4X J;  1B72 B;  3MEX A;  2RRE A;  4I0A A;  5JLX A;  2BW3 B;  2IPQ X;  1UST A;  2HI3 A;  3V42 A;  1YJW I;  3LAJ A;  5DCM A;  4E7L A;  3DEW A;  2LTP A;  3HRS A;  1Y8R B;  1U9O A;  3CCE I;  1I6X A;  1PP7 U;  4IHT A;  3GBG A;  4R8H A;  4L9N A;  2O3F A;  5FKL A;  3DTE A;  3HYI A;  2HZD A;  5IOY A;  1TLH B;  1YTY A;  2M45 A;  3A0H C;  3BR0 A;  3F6V A;  4UVA A;  2FNA A;  4FIS A;  3SZT A;  4IZZ A;  1HW2 A;  4YRV A;  2V6C A;  1TZL A;  3H92 A;  3LFK A;  4M3D A;  1W5S A;  3NRV A;  2XGX A;  1J75 A;  2QA4 I;  3K4B A;  4WXH A;  5KAF C;  4IQ4 A;  2LKX A;  1YS6 A;  3U9G A;  1K4T A;  2IA0 A;  2BXZ A;  4EJV A;  4IHY A;  1EH8 A;  4A3G J;  4BXF A;  2XAJ A;  4PJM A;  2GA2 A;  1M1E B;  3IWZ A;  2GM4 A;  4KYW A;  3DV8 A;  4XIC A;  1PP8 F;  1K61 A;  2GXA A;  3NWT A;  2NVY J;  4I0B A;  4AVZ A;  2HPM A;  1XGN A;  4MIM A;  3IH3 A;  3OY9 A;  4N9I A;  2RN7 A;  3BZK A;  3DLL F;  1YFH A;  1P9Q C;  4ZH4 F;  4B47 A;  4CYC A;  2CWE A;  2DU9 A;  5DTD A;  2DCE A;  1XPX A;  1WKM A;  3EUK L;  3GCM A;  3IKV A;  3EUH C;  3PSF A;  1X1A A;  4LG3 A;  3F23 A;  2VON A;  5HLT A;  2LRE A;  2B7E A;  1Z91 A;  1FOK A;  2LY2 A;  4XL9 A;  2OTJ I;  2I10 A;  3ZMU A;  2R7U A;  2L2O A;  4GYG A;  4EM2 A;  1FPQ A;  3LSJ A;  1D8K A;  3BTL A;  1HKS A;  1DGW Y;  1S29 A;  2O8X A;  1FP1 D;  2M8E A;  2XAS A;  5TGT A;  4A3I J;  5FKM A;  2PMU A;  3BQZ A;  4IHS A;  1BL0 A;  4EGZ A;  1Z7L A;  3H9G A;  5JHF A;  4BUP A;  4P55 A;  1QHG A;  4G7Z F;  3GLX A;  1RKW A;  1FLI A;  1WJB A;  2NOG A;  4DNC A;  5D4R A;  2COM A;  1V5E A;  5B3S H;  1YOV B;  1W0T A;  1D5Y A;  3GZN B;  1PDN C;  2LY1 A;  4P96 A;  1ZLK A;  5HDN A;  3ZXS A;  1CGP A;  2Y9Y A;  1K6O A;  2P4W A;  3CO6 C;  3OOU A;  2FBI A;  2H1L A;  2M0C A;  3ZR8 X;  1OYY A;  3HOY J;  4DBR A;  4YFK F;  2P0W A;  2ZME C;  2GOM A;  5LRS A;  1U5T B;  4OU0 A;  1U5T C;  3U21 A;  1CF7 A;  3K4C A;  3TP3 A;  2ZFU A;  2DA7 A;  2OQG A;  4JYK A;  3G71 I;  2WY8 Q;  1HA8 A;  3C2B A;  4D5C A;  2DOE A;  3AFH A;  3ZQH A;  2WY7 Q;  3Q0U A;  3WE3 A;  2Y0S A;  2OU2 A;  2DLL A;  3NWS A;  3OYB A;  1AA7 A;  4CH7 A;  1BJZ A;  4MGR A;  1QGP A;  3GEZ A;  1WJC A;  3GFL A;  5HS7 A;  1JT0 A;  1GV2 A;  3LSH A;  4LIV A;  2A69 F;  3K2A A;  1APL C;  1HW5 A;  4GRI A;  4XSX F;  2VJI A;  2JK3 A;  1STZ A;  1XMX A;  2E7X A;  4IPA A;  4BGD A;  1FIA A;  2KFD A;  5GP9 A;  2ZSI B;  3QYB A;  3ZQF A;  4E7I A;  2LNB A;  3FZV A;  1BI3 A;  2O03 A;  4G6T B;  4IO9 F;  2R7V A;  1OR7 C;  3MZY A;  3NAR A;  1VND A;  1DDN A;  1I1S A;  5LFA A;  1ETO A;  3E5U A;  1J2X A;  2EFP A;  1IN7 A;  2UUZ A;  2L02 A;  4F91 B;  2HVS A;  4DYR A;  3CMM A;  4MQ9 F;  5J3L A;  1MH4 A;  1K78 A;  3LA7 A;  3OWT A;  2A3S A;  3MKW B;  1YJ9 I;  3QYF A;  1FBQ A;  2JUG A;  2MC3 A;  3HUG A;  2VJ4 A;  5DYM A;  3IHU A;  4YIR X;  4IHX A;  4N4N B;  1NH3 A;  1R9T J;  3K2Z A;  2L4M A;  2EV5 A;  2HDD A;  2CG4 A;  5KAI C;  2KPM A;  2PMZ N;  1J59 A;  4AC0 A;  3LST A;  4YEL A;  3WU2 C;  1IV6 A;  1UHW A;  1HLV A;  4IRI A;  2FOW A;  3DPL C;  3NQO A;  1FP2 A;  1W4M A;  2MC4 A;  4ZDL A;  1KU2 A;  4R1H A;  1JTX A;  4Y17 A;  1R7J A;  4MEY F;  1JUP A;  3FMR A;  1TQM A;  3D5R C;  5E20 A;  1I5Z A;  3DCF A;  4CCM A;  3ZQI A;  4F52 A;  3IH4 A;  2L5Q A;  4I7H A;  2FOK A;  4OIR F;  4AIK A;  2ZXH A;  3VYR B;  4FTH A;  2VQC A;  1JKP C;  1YRN B;  2X9D A;  2K3F A;  3PJR A;  1XCV A;  1R1V A;  5GAG J;  3WU0 A;  4KIC A;  3L1P A;  1N25 A;  2R7D A;  1R4M B;  3H5N A;  4V2F A;  3SZP A;  1Z7U A;  2DA6 A;  2WAF A;  2G7U A;  3DBL B;  5F0H A;  1XSD A;  3TBI A;  1IN8 A;  5DS9 A;  4I98 B;  4NC7 A;  3J7Y J;  5CVV A;  2ME6 A;  2L7K A;  1T38 A;  1KGS A;  3GF2 A;  2HXO A;  5K7F A;  5H6R A;  1MMD A;  4XNF A;  4HLX A;  1WPK A;  1BI0 A;  3KCC A;  3VYT B;  4O6J A;  3V8J A;  1BR1 A;  1Z6T A;  1Z9C A;  3K9T A;  5LEJ A;  4N4O B;  1LE8 B;  4MEX F;  1BOA A;  2NYX A;  2CUJ A;  3G2B A;  3BTJ A;  2ECC A;  1IAW A;  1D1A A;  5DV5 A;  5D5V B;  1B9N A;  1V55 H;  3BPV A;  3ZMD A;  3RQ4 A;  3RJP A;  4M3F A;  3E5Q A;  1PJR A;  3FKI J;  2Y48 A;  2V26 A;  3O8G A;  4PFO A;  5EEH A;  5CVU A;  4OIP F;  1SFU A;  1GHC A;  3JRB A;  3KP3 A;  4N0B A;  5E8G A;  1CQT A;  2R7Z J;  3S2D J;  3OS0 A;  3HZJ A;  4BQQ A;  3HG9 A;  3GXO A;  4KIS A;  5E8I A;  2PMZ A;  4KMF A;  5FFZ A;  3A01 B;  2GBY A;  3FKJ A;  1QBJ A;  1U8R A;  3PO2 J;  2VT3 A;  4FAS D;  2QSF X;  4E70 A;  1KQ9 A;  3PQK A;  2EJR A;  2QQA A;  2X1D A;  3IAM 2;  2HDC A;  2LBF B;  5ILU A;  2STT A;  1RI7 A;  3BQY A;  4A93 J;  4XRS G;  2XB5 A;  3SHF A;  1S5L C;  4HA8 A;  3EPZ A;  2NS0 A;  1EV7 A;  3JSP A;  1IN6 A;  3B02 A;  1YJN I;  3P9I A;  1T6S A;  1ETK A;  2L54 A;  4BKX A;  3ABU A;  3QU3 A;  4LD5 A;  1AOY A;  3K6G A;  3BR5 A;  3LSI A;  4V2G A;  4E7K A;  1VQ7 I;  2LLK A;  2RDP A;  3M8F A;  3I59 A;  1UMQ A;  4RM3 A;  3U2R A;  1HDP A;  1TNT A;  4XLF A;  2ZME A;  4XON A;  1XSX A;  1ETY A;  2A68 F;  5CLS A;  2W24 A;  2WTE A;  4CIC A;  1IF1 A;  2Y9Z A;  1S7A A;  3SEQ A;  2W00 A;  1KU3 A;  3C18 A;  1T95 A;  2ZO4 A;  1RRJ A;  1X1B A;  2K7L A;  3FK7 A;  2KT0 A;  3N05 A;  5ICE A;  3WTU C;  1JT6 A;  1U2W A;  3BY6 A;  2D1V A;  2JTV A;  1GXP A;  3AG3 H;  2K5C A;  2XPW A;  1MJB A;  4U0V A;  1FNN A;  5K7Z A;  4NNJ A;  5DCF A;  2ZSH B;  1W0U A;  2R7O A;  3E6M A;  4CDG A;  1SFO J;  3KP7 A;  4NBQ A;  1ZKG A;  2IEK A;  4F3Q A;  3L2Q A;  3LSR A;  4IKF A;  4H0E A;  4XLN F;  3OYD A;  3G1M A;  1OR7 A;  2Q1Z B;  3L7W A;  4XBF A;  5LEK A;  1PUF B;  3JTH A;  3MZH A;  4HX7 A;  5CVJ A;  1PUE E;  4Y7N J;  1YW9 A;  3HSE A;  1JJ6 C;  3HOT A;  3ASO H;  2DK5 A;  1OMI A;  3BOQ A;  3PL8 A;  1TWF J;  1XMK A;  2FU4 A;  2KDZ A;  1AU7 A;  2W48 A;  3O6B B;  5M3F J;  1JTY A;  3BTC A;  3DTI A;  3KP4 A;  1X4P A;  2FJ1 A;  2XKO A;  3CCR I;  1ZR2 A;  3ULQ B;  2CRG A;  2I8D A;  1KQ0 A;  1O7F A;  5D5U B;  5HVQ C;  2PN6 A;  3WU1 B;  4KIB A;  4C3J J;  2H94 A;  2RAE A;  5CVI A;  4EQQ A;  4B1R A;  4L0Z B;  5AIP A;  3F8N A;  3GUD A;  1E3H A;  3DF8 A;  3I53 A;  4BBR J;  4CZZ A;  3HB9 A;  4Q47 A;  2Y30 A;  3HGG A;  4A3E J;  3BRO A;  1F4K A;  3J81 K;  5E17 F;  2L01 A;  2PJR A;  3ROU A;  5CQE A;  1FTZ A;  1Q1V A;  3OR1 C;  2F5E A;  3LSM A;  1ITY A;  2VUM J;  4PJ0 C;  2Z99 A;  3GTO J;  2XAH A;  4BE1 A;  1VQL I;  2JRT A;  3TOB A;  3QPT A;  3TMO A;  3V4G A;  5CYV A;  2WAE A;  2XAU A;  2VBZ A;  3CCM I;  4PDK A;  3QOP A;  2ZCW A;  3HBL A;  4PGG A;  4AVP A;  2HQN A;  2NS8 A;  1O3S A;  4C2U A;  1SMT A;  4A3D J;  3DU5 A;  5IYB J;  4PJL A;  1GVD A;  2ELJ A;  3VWB A;  3Q5F A;  5D5W B;  3MAJ A;  3BCA A;  5DCM B;  3BP8 A;  1LPQ A;  3K4K A;  2A6T A;  1N78 A;  2E34 A;  2FRH A;  4DOZ A;  1OCZ H;  2DQR A;  3ZQG A;  2BE5 F;  5KVR A;  1R00 A;  1RZ4 A;  1QZZ A;  4CYD A;  3HEF A;  1R6R A;  1MNM C;  5IT9 Z;  3ZMS A;  2TDX A;  5GAD J;  1D0X A;  4Z6Y A;  1J9I A;  3E6B A;  1YIO A;  3A03 A;  1P4W A;  1OCO H;  2BHY A;  2P7V B;  4HNV A;  1XGS A;  2XSJ C;  2LMD A;  5D4S A;  3K1N A;  2EB7 A;  2XF5 A;  1BR2 A;  1ENH A;  2EIL H;  3L2R A;  4FT8 A;  3F3X A;  1LE8 A;  2KDO A;  4ASN A;  2NVX J;  2VPR A;  4XLE A;  4BEH A;  1EH7 A;  1X3W B;  1XGM A;  2DYR H;  2O8K A;  3PFI A;  3WGG A;  2HOE A;  2XPU A;  2CUE A;  4RAY A; 
#chains in the Genus database with same CATH homology
 5FLX Z;  1FWZ A;  4LB6 B;  1JHF A;  2M5W A;  3ELK A;  3BJO A;  4G94 A;  3TQN A;  3ZN1 A;  4A12 A;  4Y13 A;  5D5X B;  3T8R A;  3CO7 C;  4HV6 A;  1GVJ A;  5ED4 A;  3O3K A;  3G3Z A;  4L9V A;  1ZG5 A;  2P6S A;  2KJC A;  1LQ1 A;  3TO6 A;  3E6D A;  2EWN A;  1USS A;  3LAP A;  2V9V A;  2WWY A;  5LBQ A;  1UFM A;  2K4J A;  2ESN A;  2FSW A;  4WK8 F;  2DFI A;  1MGT A;  5DUK A;  2NNY A;  2GIV A;  1P4X A;  2IJL A;  2V79 A;  2F5F A;  4G7O F;  1P2F A;  3J80 Z;  1CF7 B;  3QPH A;  2IRF G;  1T39 A;  1HKT A;  2DQL A;  5L3G A;  2P5V A;  4O5V A;  1ZRD A;  3LQQ A;  2ZNY A;  1KYZ A;  2PFB A;  1R5H A;  4ZZL A;  1G3S A;  2FNP A;  2PLY A;  3SQN A;  4RGS A;  4ZYD A;  4I01 A;  2P8T A;  3I54 A;  4M6X A;  4UVC A;  3IRQ A;  1K78 B;  1DP7 P;  4YFX F;  4OIO F;  1TNS A;  3CUO A;  2Y75 A;  5JHU A;  4GGG A;  4BQA A;  2F2E A;  4A6E A;  6PAX A;  3WTV C;  3N97 A;  1YS7 A;  4ON0 A;  5L3C A;  2XVC A;  5JR3 A;  3F6O A;  2EA4 A;  5LRR A;  3C1D A;  1ONV A;  3GYH X;  3VEP A;  4BYY A;  1JGS A;  3M7G A;  1I27 A;  4PCQ A;  4Q4Z F;  3T1B A;  4M9X A;  3KEO A;  1TW3 A;  1MKM A;  2FML A;  2HTJ A;  2XIG A;  3GVA A;  4BAY A;  1FZP B;  2VT2 A;  4MQV A;  4NHJ A;  4HQE A;  5A2Q Z;  3E6C C;  5HLH A;  5LHI A;  2IA2 A;  3ZMZ A;  1FSH A;  2FA5 A;  3TOA A;  1B6A A;  2GAU A;  4RGU A;  1XCB A;  4KFC A;  2XHK A;  2UZK A;  3I5U A;  3FX3 A;  5FD5 A;  5J8C A;  3TO9 A;  5LHG A;  1B9M A;  3V8K A;  4FHT A;  5BPI A;  2IVM A;  4IJA A;  2EFQ A;  3Q9V A;  4KUM A;  3GFI A;  1Z05 A;  3Q9S A;  3DKW A;  1IXC A;  2YSR A;  5HDG A;  2E7W A;  3BZ6 A;  2M1B A;  1BIB A;  4OMZ A;  3P7N A;  3RPU A;  3HTU A;  3I59 B;  3FXU A;  3REO A;  2DW4 A;  2ZME B;  4AIH A;  2EK5 A;  3M9A A;  2D2W A;  3PQJ A;  2EV6 A;  3I4P A;  4UNO A;  4ENM A;  2ELH A;  1HSJ A;  5CJ9 A;  3WTW C;  2Z33 A;  2FEZ A;  2B0L A;  2M30 A;  3HRU A;  3WTT C;  2XKP A;  1YYV A;  4U88 A;  4ZYH A;  4LFU A;  4P9U A;  2KKO A;  2H09 A;  3RKY A;  4EMS A;  3NEU A;  3WG9 A;  3DXJ F;  2OBP A;  3GW2 A;  2LKP A;  3F21 A;  1KYW A;  2HKO A;  4L9J A;  2NNN A;  2Z5U A;  1IW7 F;  2A6E F;  4RS8 A;  4OIQ F;  3TDZ C;  1LDJ A;  1Z6R A;  2H6C A;  1W7P D;  4YG2 F;  2ISZ A;  5IT3 A;  5K5O A;  4EJT A;  2OD5 A;  3B73 A;  2YPR A;  2YU3 A;  3KE2 A;  5FO5 A;  1J0R A;  2UWM A;  2GA1 A;  1REP C;  4IF4 A;  1RIO H;  2LF8 A;  1L0O C;  4I02 A;  1XDS A;  1HBX G;  1FX7 A;  1D5V A;  4BHP A;  4ZZD A;  4A0Y A;  1XMA A;  2RQP A;  2F5C A;  3ABT A;  1V4R A;  3HSF A;  5E18 F;  4P9F A;  2HWV A;  3ERE D;  2DT5 A;  3ISP A;  2KRF A;  1HQC A;  2G9W A;  3H3U A;  4EJU A;  4HLY A;  2Z3Y A;  3GFM A;  2Y0M A;  1B1B A;  5J8F A;  4KT5 C;  5FLX K;  2Q8K A;  4I2O A;  2FBK A;  2V1U A;  2HGC A;  2WV0 A;  4ZYG A;  3FXQ A;  1ZYR F;  3M1E A;  1ON2 A;  4PGH A;  3KZZ A;  1ZN2 A;  1F5T A;  3DPT A;  4LLL A;  4LLN A;  4YIF A;  2G7H A;  1Q1H A;  3R60 A;  4A5N A;  1F1Z A;  1SD5 A;  2XV4 S;  3HHH A;  4U0W A;  1LDD A;  1U6G A;  2W84 A;  1R1U A;  2CYY A;  1OPC A;  2V1X A;  1HKQ A;  2HTS A;  2QZ8 A;  2A5Y B;  3C3W A;  4F7Z A;  1MZB A;  2J5O A;  4GCV A;  3J80 K;  3DFG A;  3FF5 A;  3F8M A;  5KK1 A;  4U7D A;  5AIQ A;  1TQI A;  4MTD A;  4A0X A;  4NB5 A;  1B4A A;  2HYG D;  1VTN C;  1RUN A;  2VOP A;  2FBH A;  1IUY A;  2FXA A;  5BQT A;  3SXY A;  2E1N A;  3L2C A;  2PI0 A;  1G3T A;  3ECH A;  5DEQ A;  2DTR A;  4LMY A;  4L5I A;  5LGU A;  2JZY A;  1WSU A;  1G3Y A;  1KU7 A;  1FYM A;  5D8L B;  2HS5 A;  4JK1 X;  1MJA A;  2VOO A;  1O3Q A;  4FX4 A;  1BIA A;  2QUF A;  1UHM A;  4KIG A;  1P6R A;  2AXL A;  3LA2 A;  3EYY A;  5LGT A;  3K1P A;  1Y0U A;  2YR2 A;  1BC7 C;  2IT0 A;  1BI1 A;  4DQ2 A;  2VBW A;  2XRN A;  4G6Q A;  5BOX A;  1YQA A;  1ZGA A;  3RKW A;  3O2P E;  4KA4 A;  3OV8 A;  4OIN F;  5L3F A;  4WXD A;  1H0M A;  2XAG A;  1ULY A;  4BXU A;  5D8K B;  3KFW X;  3FM3 A;  3GZ5 A;  1SMY F;  1W5T A;  2LF7 A;  4KDP A;  2PBI A;  1XSV A;  5ERI A;  4A5M A;  4M71 A;  1BM9 A;  3MFK A;  1ZRE A;  5E1X A;  1T2K A;  2K27 A;  5EEG A;  3R61 A;  1SFX A;  5K5Q A;  2RV8 A;  2VC0 A;  2AS5 F;  5BMZ A;  1QO0 D;  2EFN A;  4M9Z A;  2QYO A;  4OOI A;  1C0W A;  4HOB A;  3M8E A;  5A2Q K;  3C7J A;  1BJA A;  3FM5 A;  4BH9 A;  3FHZ A;  4B8X A;  4HX4 A;  1H9T A;  1JXS A;  2HFH A;  2CW0 F;  1FY7 A;  2STW A;  4A0Z A;  1AWC A;  3E5X A;  3H3Z A;  1JE8 A;  4U7B A;  1U78 A;  2H6B A;  3R0J A;  4AD9 A;  1IZ1 A;  4AIJ A;  5D6F A;  2E1C A;  4LG0 A;  1MJ9 A;  5LHH A;  4ENN A;  4IRH A;  1O3R A;  3MWM A;  1ZAO A;  2PQ8 A;  1JHH A;  4NQW A;  1XN7 A;  5ILV A;  3LWF A;  2NAZ A;  2CSO A;  4LK1 F;  1GXQ A;  1S8N A;  1NHA A;  3T0Y A;  5J6X A;  1KQ8 A;  5DDG A;  5HOO A;  2P7C B;  3F8B A;  3LA3 A;  3S2W A;  5E1W A;  1MDM B;  5JFR A;  1K7A A;  4ZYE A;  2FE3 A;  4LLG F;  3RIR A;  4GYI A;  4QWQ A;  3U1D A;  4HF2 A;  4HF1 A;  4RB3 C;  1QNT A;  2MLK A;  5L3E A;  2GXB A;  1S3J A;  4KN4 X;  2ESH A;  3AAF A;  2PEX A;  5L3D A;  1DUX C;  4O3M A;  1BC8 C;  1SD6 A;  3D5L A;  1G6N A;  3R0A A;  2HEO A;  3ZQ7 A;  1E17 A;  2GZW A;  1WWX A;  2HZT A;  4XSZ F;  4BHB A;  2BEO A;  4UVB A;  1O7L A;  4EJW A;  1F9N A;  3I0T A;  3JTG A;  4ESJ A;  5LGN A;  4MNU A;  2Q2E A;  4RGR A;  1S6L A;  5H6Q A;  2RNJ A;  3FWE A;  1XB4 A;  5ILS A;  4HX8 A;  4G8X A;  5HLI A;  2D1H A;  1A04 A;  4LJZ F;  3COA C;  3RYP A;  3KET A;  2H27 A;  4WF2 A;  5H20 A;  2QQB A;  3E3V A;  3CJN A;  3J81 Z;  2QQ9 A;  4XRF A;  4G7H F;  4N9H A;  3GX4 X;  3HTS B;  2Z9O A;  5CVR A;  4HQM A;  5DD4 A;  3JAM Z;  1W7P B;  2WC2 A;  5TRD A;  2JPC A;  3HOS A;  4UHT A;  1BN5 A;  1SD4 A;  2P5L C;  2QM3 A;  3K69 A;  3GWZ A;  1R1T A;  2R7F A;  1BBY A;  3DQV C;  1IXR C;  3FMS A;  4EV0 A;  2X0L A;  2ZBK A;  4A6D A;  3KZY A;  1IXS B;  1XD7 A;  1RUO A;  3L00 A;  1IN5 A;  5D6E A;  3QP5 A;  2FF4 A;  1P4A A;  5ICF A;  3GO5 A;  2OZU A;  1YW7 A;  5BS6 A;  2HQR A;  1WI9 A;  3IC7 A;  4CXF A;  2LSO A;  3ML6 A;  4D0P A;  1FC3 A;  2JT1 A;  1HXD A;  2MD5 A;  3I71 A;  3KLO A;  2XRO A;  1OKR A;  3DEU A;  4KN7 X;  1HW1 A;  1MD0 A;  3EDP A;  1D3Y A;  3L9F A;  1G4D A;  4OMY A;  2DK8 A;  3W6K B;  1G3W A;  2P6T A;  2QLZ A;  1ON1 A;  3KP5 A;  4XLP F;  3IWF A;  1ZG3 A;  2PJP A;  2VOD A;  4EVI A;  4RB0 A;  1MDM A;  2L4A A;  2RC4 A;  4HAM A;  1U3E M;  2DBB A;  4HBL A;  2J5P A;  4RB2 C;  1QQI A;  2GWR A;  2KIM A;  2GQQ A;  4QLC U;  3WTZ A;  4I09 A;  1IN4 A;  2IW5 A;  3E97 A;  2YX7 A;  4M73 A;  2MLG A;  4BHC A;  3WTS C;  4B09 A;  3F8C A;  2HR3 A;  4G9Y A;  5ICG A;  2IA1 A;  1LDK B;  3K1M A;  1FYL A;  3DP7 A;  3BWG A;  1KU9 A;  2W25 A;  1TTY A;  1YLF A;  2BGC A;  3BJA A;  4HW0 A;  3JW4 A;  1T0F A;  3P9K A;  1R58 A;  3CLO A;  1K79 A;  4HF0 A;  4RGX A;  1B59 A;  4WCG A;  5FFX A;  2CFX A;  2QBY B;  4U0Y A;  2EV0 A;  4EJO A;  1IRF A;  4M9S A;  2VXZ A;  4EGY A;  4LGW A;  2O6G E;  1T98 A;  2UXN A;  5ICC A;  1J5Y A;  1HST A;  2Q0O A;  2BYV E;  2XUB A;  3BPX A;  2EA2 A;  4LK0 F;  1W7P A;  3RPQ A;  5JI6 A;  2ETH A;  4YFN F;  1L3L A;  1ZLJ A;  3V7R A;  1QZY A;  2K02 A;  2OA4 A;  2M87 A;  4PZJ A;  3K0L A;  5IT9 K;  1LB2 A;  1SFE A;  3LQR A;  5DUI A;  2A6H F;  2EFW A;  2ZKZ A;  3L09 A;  5HS8 A;  1FYK A;  3ZP5 A;  3IRR A;  1D8J A;  5FD6 A;  4HDU A;  1R23 A;  4HV5 A;  4M6Y A;  2CGP A;  4RAZ A;  2JPB A;  3BJ6 A;  1I1G A;  1SD7 A;  2KIU A;  3V7S A;  2ADU A;  3TO7 A;  4WWC A;  2L3D A;  5L3B A;  1RNL A;  1V3F A;  2ZXJ A;  3V7C A;  4L9T A;  1YW8 A;  5E1Z B;  4LG0 B;  3EUH A;  3I64 A;  2DI3 A;  2PMH A;  3KLN A;  3WGI A;  1OYW A;  4MHG A;  1UCR A;  1KA8 A;  3WTY C;  2QWW A;  4BNC A;  2BBY A;  2A61 A;  4L18 B;  3ECO A;  1J7K A;  4KNY A;  4Y15 A;  1LVA A;  3HRM A;  3FMQ A;  4EM1 A;  2K86 A;  4L0Y B;  4ESB A;  3RDI A;  1ZG1 A;  1XDU A;  4IVN A;  4JQF A;  3VFZ A;  2XAF A;  3R4K A;  3GFJ A;  3W6J B;  1BI2 A;  2KIF A;  3TGN A;  4Q5S F;  2YX4 A;  3SFZ A;  4M72 A;  4IXA A;  3RYR A;  1U5T A;  3HHG A;  3CUQ B;  5DD8 A;  3RTR A;  3CUQ C;  2W85 A;  4UUV A;  3CTA A;  3RKX A;  4FX0 A;  3QAH A;  2HKX A;  2R3S A;  4HYE A;  3VOD A;  4GO1 A;  3ZN0 A;  3EYI A;  4HZF A;  2ZJ2 A;  5F1R A;  1Z1D A;  3N4M A;  4ENK A;  2QBY A;  4CHU A;  1R5G A;  4CO8 A;  3IL2 A;  2HYF A;  1SAX A;  1UB9 A;  3ZMT A;  4KMU X;  5FGM A;  1O57 A;  1YO5 C;  3V8L A;  4CGZ A;  3F72 A;  5K5R A;  3HIF A;  3I58 A;  1IRG A;  5HS9 A;  2ISY A;  1WQ2 A;  2O0Y A;  4ETS A;  4Q48 A;  1LEA A;  2FQ3 A;  3ZMV A;  2IP2 A;  2MH9 A;  4RB1 A;  3RI4 A;  2CQK A;  2CO5 A;  1E2X A;  5FB2 A;  1FT9 A;  5F6F A;  1DPU A;  2W57 A;  2ACJ A;  4K2E A;  3VB2 A;  4JBA A;  3GZ6 A;  2EFO A;  2DPU A;  4GXO A;  1TBX A;  1TW2 A;  1EH6 A;  1FBU A;  1FSE A;  2MA3 A;  3JAM K;  1OYI A;  3T5X A;  4S04 A;  3EET A;  1R36 A;  3F8F A;  3HSR A;  2NRA C;  1ODD A;  1ZAR A;  2PG4 A;  1ZGJ A;  1ZH5 A;  2RGV A;  4S05 A;  2VBX A;  4IRG A;  2P5K A;  3EQL F;  3KP2 A;  4L5J A;  4UXN A;  3KEQ A;  2UXX A;  4MTE A;  4Z2Y A;  3OOP A;  3KP6 A;  2OZ6 A;  2RVC A;  2VC1 A;  3G73 A;  5JVT A;  2K4B A;  4UV8 A;  3TKY A;  4R79 A;  2QEN A;  2JSC A;  3IKT A;  1ZRC A;  4KIF A;  2D45 A;  5HDK A;  5LLQ A;  1TQP A;  4P5O A;  1FBS A;  3T8T A;  3D0S A;  3WOD F;  3MQ0 A;  2F5D A;  1LNW A;  4LB5 A;  2V1D A;  4ENJ A;  2OAZ A;  3CDH A;  2KJB A;  4WX9 A;  2ZFW A;  2DPD A;  1LEB A;  3HRT A;  2MBF A;  2QVO A;  1O3T A;  1QPM A;  4AWX B;  2A07 F;  3CUQ A;  2DO7 A;  4WXC A;  1R22 A;  3FXR A;  2VE9 A;  3J7A O;  1ZRF A;  3WGH A;  3R6S A;  2RKH A;  4YII A;  3BDD A;  2DAO A;  2GXG A;  1X3U A;  1LJ9 A;  3JSO A;  4M74 A;  2OQR A;  5AON A;  1WRJ A;  5HLG A;  1ZHF A;  2VBY A;  4ESF A;  1H9G A;  3P9C A;  2MH2 A;  4HDV A;  3WE2 A;  2BV6 A;  3TDU C;  5TJJ A;  1S7O A;  5BPD A;  5F64 A;  1YG2 A;  4A2U A;  3F22 A;  4G6D A;  2O61 A;  2ZNZ A;  2VN2 A;  3VOE A;  2LDU A;  3MCZ A;  4EM0 B;  2XAQ A;  1XGO A;  2FMY A;  3QRF F;  3QU6 A;  2VE8 A;  1P92 A;  1DPR A;  3QP6 A;  5K1Y A;  4TV7 A;  2X4H A;  4UV9 A;  3WTX C;  2C6Y A;  3ZPL A;  3MEX A;  4I0A A;  2IPQ X;  1UST A;  3LAJ A;  5DCM A;  3HRS A;  1I6X A;  1PP7 U;  4IHT A;  4R8H A;  4L9N A;  2O3F A;  3HYI A;  1TLH B;  1YTY A;  2M45 A;  3F6V A;  4UVA A;  2FNA A;  3SZT A;  1HW2 A;  2V6C A;  3H92 A;  3LFK A;  1W5S A;  3NRV A;  2XGX A;  1J75 A;  4WXH A;  1YS6 A;  3U9G A;  2IA0 A;  4EJV A;  1EH8 A;  2XAJ A;  2GA2 A;  3IWZ A;  4KYW A;  3DV8 A;  1PP8 F;  4I0B A;  1XGN A;  4N9I A;  2RN7 A;  1YFH A;  4ZH4 F;  2CWE A;  2DU9 A;  1WKM A;  3IKV A;  3F23 A;  2VON A;  1Z91 A;  1FOK A;  3ZMU A;  4GYG A;  4EM2 A;  1FPQ A;  1D8K A;  1HKS A;  1S29 A;  2O8X A;  1FP1 D;  2M8E A;  2XAS A;  2PMU A;  4IHS A;  4EGZ A;  4P55 A;  4G7Z F;  3GLX A;  1FLI A;  4DNC A;  5D4R A;  2COM A;  1PDN C;  4P96 A;  1ZLK A;  5HDN A;  1CGP A;  1K6O A;  2P4W A;  3CO6 C;  2FBI A;  1OYY A;  4YFK F;  5LRS A;  1U5T B;  4OU0 A;  1U5T C;  1CF7 A;  2OQG A;  3WE3 A;  2OU2 A;  2DLL A;  4MGR A;  1QGP A;  3GEZ A;  3GFL A;  5HS7 A;  2A69 F;  1HW5 A;  4XSX F;  1STZ A;  2E7X A;  4IPA A;  2LNB A;  3FZV A;  1BI3 A;  2O03 A;  3MZY A;  1DDN A;  1I1S A;  3E5U A;  1J2X A;  2EFP A;  1IN7 A;  2L02 A;  4MQ9 F;  1K78 A;  3LA7 A;  2A3S A;  1FBQ A;  2MC3 A;  3HUG A;  5DYM A;  3IHU A;  3K2Z A;  2L4M A;  2EV5 A;  2CG4 A;  1J59 A;  3LST A;  1UHW A;  4IRI A;  3DPL C;  3NQO A;  1FP2 A;  1W4M A;  1KU2 A;  4R1H A;  4Y17 A;  1R7J A;  4MEY F;  3FMR A;  1TQM A;  5E20 A;  1I5Z A;  4I7H A;  2FOK A;  4OIR F;  4AIK A;  1XCV A;  1R1V A;  3WU0 A;  4KIC A;  2R7D A;  3SZP A;  1Z7U A;  2G7U A;  1XSD A;  1IN8 A;  4I98 B;  5CVV A;  1T38 A;  1KGS A;  3GF2 A;  5H6R A;  4HLX A;  1BI0 A;  3KCC A;  4O6J A;  3V8J A;  1Z6T A;  1Z9C A;  3K9T A;  5LEJ A;  4MEX F;  1BOA A;  2NYX A;  1IAW A;  5DV5 A;  5D5V B;  1B9N A;  3BPV A;  3ZMD A;  3RJP A;  3E5Q A;  2Y48 A;  5EEH A;  5CVU A;  4OIP F;  1SFU A;  1GHC A;  3KP3 A;  4N0B A;  5E8G A;  3GXO A;  5E8I A;  4KMF A;  5FFZ A;  1QBJ A;  1U8R A;  2VT3 A;  4E70 A;  1KQ9 A;  3PQK A;  2EJR A;  2QQA A;  2HDC A;  5ILU A;  2STT A;  1RI7 A;  3SHF A;  4HA8 A;  2NS0 A;  1EV7 A;  3JSP A;  1IN6 A;  3B02 A;  3P9I A;  1T6S A;  2L54 A;  3ABU A;  3QU3 A;  4LD5 A;  1AOY A;  2RDP A;  3M8F A;  3I59 A;  3U2R A;  1TNT A;  2ZME A;  1XSX A;  2A68 F;  5CLS A;  2W24 A;  2WTE A;  4CIC A;  1IF1 A;  1S7A A;  1KU3 A;  3C18 A;  2ZO4 A;  2K7L A;  5ICE A;  3WTU C;  1U2W A;  3BY6 A;  2D1V A;  2JTV A;  1GXP A;  1MJB A;  4U0V A;  1FNN A;  5DCF A;  3E6M A;  4CDG A;  3KP7 A;  4H0E A;  4XLN F;  1OR7 A;  3L7W A;  4XBF A;  5LEK A;  1PUE E;  3JTH A;  3MZH A;  4HX7 A;  5CVJ A;  1YW9 A;  3HSE A;  3HOT A;  2DK5 A;  1OMI A;  3BOQ A;  1XMK A;  2FU4 A;  3O6B B;  3KP4 A;  2XKO A;  3ULQ B;  1KQ0 A;  1O7F A;  5D5U B;  5HVQ C;  2PN6 A;  3WU1 B;  4KIB A;  2H94 A;  5CVI A;  4EQQ A;  4L0Z B;  5AIP A;  3F8N A;  3GUD A;  3DF8 A;  3I53 A;  4CZZ A;  4Q47 A;  3BRO A;  1F4K A;  3J81 K;  5E17 F;  2L01 A;  3ROU A;  2F5E A;  2Z99 A;  2XAH A;  2JRT A;  3TOB A;  3QPT A;  3V4G A;  5CYV A;  2VBZ A;  4PDK A;  3QOP A;  2ZCW A;  4PGG A;  4AVP A;  2HQN A;  1O3S A;  1SMT A;  3Q5F A;  5D5W B;  3MAJ A;  5DCM B;  3BP8 A;  2FRH A;  2DQR A;  2BE5 F;  5KVR A;  1R00 A;  1RZ4 A;  1QZZ A;  4CYD A;  5IT9 Z;  3ZMS A;  2TDX A;  1J9I A;  3E6B A;  1YIO A;  1P4W A;  2P7V B;  1XGS A;  5D4S A;  3K1N A;  2EB7 A;  4FT8 A;  3F3X A;  4ASN A;  1EH7 A;  1XGM A;  3PFI A;  3WGG A;  2HOE A;  4RAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...