3S15J

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s15J00
3Q0WA 1ZR4A 3GTLJ 3LSGA 1SANA 3BG3A 4B4CA 4D7NA 4A3CJ 3L1PA 5IYBJ 1GDTA 3HGGA 1P7IA 1TWAJ 3DEWA 2R93J 2LLKA 3LSRA 3LSPA 3ZQIA 2JJ7A 1MSEC 1JT0A 2WV1A 5C4XJ 2CUEA 1WI3A 4BBRJ 4DW6A 1Y1WJ 3A02A 3M4OJ 3CDLA 2JA6J 1RESA 3BTCA 1GUUA 4I76A 2DJNA 1ITYA 4J19A 2FD5A 5E3OA 2DA2A 5E3LA 3S2HJ 1JJ8C 1XS9A 3FK7A 2L9RA 1ZGWA 2JA8J 1BA5A 2WAQN 2VUMJ 1JTXA 1FTTA 4FISA 3A01B 2HOTA 1WCMJ 4A69C 2CRGA 2TRTA 4M3DA 1HOMA 1NK3P 1OJLA 3HKZN 1H8AC 3ZQCA 3A01A 1IUFA 4DZPA 4DZJA 5M3MJ 1AKHB 2XGDA 3GTJJ 1T33A 2B63J 2HXOA 3JRAA 2HYJA 2MW8A 2ME0A 1MBGA 5GP9A 1JUSA 4BBSJ 3OIOA 1MNMC 3GTMJ 2GM4A 1O4XA 2XGCA 3TW7A 4LOCA 4CYCB 1GT0C 2JA7J 1ETOA 2E2IJ 1XG1A 2GLOA 2CJJA 4JYKA 2ID6A 1ORKA 1T56A 1JKRC 2CU7A 3HM5A 2OF7A 3BG9A 1TWGJ 5EZHA 1TC3C 1JT6A 1R9TJ 2R0QC 3RKQA 1LE8B 1YRNB 2EZIA 5FJ8J 4FCYA 1ENHA 1F36A 1UMQA 2EZKA 3JRBA 4V2FA 3I4NJ 3S2DJ 2R92J 3HOUJ 1LE8A 5EG0B 2O8KA 3JRIA 1YRNA 3HBLA 1HCRA 1X2NA 2ECCA 2ECBA 2MG4A 5EG0A 1MSFC 3D1NI 4IHYA 3S17J 3G1LA 2Y0SN 1MBFA 1IG7A 4IHWA 3BQZA 2Y9ZA 4C3IJ 4XRSG 3B6CA 1FJLA 1TWHJ 4FTHA 2AHQA 4A3BJ 3BR0A 3QQAA 3G1OA 1UG2A 5DS9A 5M5XJ 1E3OC 2JMWA 3Q3SA 2X9DA 2OPTA 2XB0X 4JX5A 5F27A 1DU0A 1BW5A 2HOSA 3BT9A 2NS7A 1POGA 3Q0UA 4A3DJ 3FISA 1FTZA 2E19A 4X6AJ 2MGQA 3QPSA 2E1OA 1ETXA 2VKVA 4C3HJ 4IHXA 1B8IB 2LP0A 5IP6A 1IJWC 2ELKA 2XPVA 4A3JJ 4NDLA 5EYRA 1B8IA 2QCOA 1APLC 1K61A 4A3KJ 3IH3A 2L7ZA 4D5FA 1IV6A 1IDZA 3OOUA 3FK6A 2LTPA 2XPUA 4Y52J 1RPWA 4D7MA 1U78A 2E2HJ 1TWFJ 1X2MA 3LSJA 1ETWA 4XRMA 3M3YJ 2EBIA 1I6HJ 9ANTA 2EZLA 1AU7A 5EDNA 1JKQC 4JX4A 4AC0A 3WHCA 2MSYA 3B6AA 1U8BA 1G2HA 4S0HB 2DTZA 2P81A 3S1QJ 4M3FA 3HOXJ 4AYBN 5F1JA 1HF0A 2IBDA 2M8GX 2LKXA 1AHDP 3BTIA 4M3BA 5IPAA 3S14J 4A3MJ 1DU6A 5K7HA 1JJ6C 2D5VA 2HDDA 3W6VA 4L5EA 1ZK8A 3TEDA 1HDDC 2EH3A 2YUSA 1B72B 3S1NJ 4A3GJ 5M5WJ 5FKLA 3LOCA 2JK3A 1BW6A 1B72A 1IDYA 2TCTA 2NOGA 1JUMA 1RETA 3JRDA 2M34A 1WGXA 3BR6A 5F0HA 3E7LA 3RQIA 4RBOA 3PM1A 2XRLA 2L7MP 2YS9A 1WPKA 3JRCA 4A3LJ 1XC5A 4C3JJ 2CQXA 2YU9J 3GTGJ 2NVYJ 1ETKA 4HNVA 5IYCJ 3GTPJ 2JN6A 3HEFA 3SFIA 2EZHA 1NK2P 1VI0A 3GTOJ 1JUPA 4G12A 3VPRA 5M3FJ 4W97A 4MFEA 1ZKGA 5JLXA 4MIMA 4B3AA 4A3IJ 3OSGA 1LFUP 1SFOJ 3FKIJ 2DMPA 3GTQJ 5J1RA 2HOAA 2I10A 3JRFA 3ZQHA 1ZR2A 2H1KA 3O8GA 3F0CA 4BY1J 5F04A 1Z77A 1I3QJ 3BG5A 4MFDA 1X58A 5IOZA 5E3NA 3HGYA 1WH5A 2O7OA 1RKWA 3BR5A 3CCYA 3BTJA 3HDDA 2ID3A 1NTCA 3TP0A 3JR9A 3JREA 1W0UA 2DA3A 5EEAA 3BR2A 3S1RJ 2AO9A 1MBHA 1P7JA 1H88C 5FKMA 5BNGA 1FIAA 2R5ZA 1A5JA 5M5YJ 3NARA 1W0TA 4XIDA 4FE4A 1WH7A 3ZOBA 3PO2J 5GPAA 1D5YA 2JA5J 2LVSA 3IH4A 3O8HA 5HODA 5C4JJ 2PMZN 1VNDA 5C44J 3HOZJ 2NS8A 2L0KA 2DA7A 1ETVA 2G0EA 5EGOB 1ETQA 4C2MJ 4M3EA 2M0CA 1U9NA 1IRZA 2L7FP 5K7FA 5EGOA 2VPRA 1QVTA 3GTKJ 2XB5A 1Y1VJ 1GVDA 3MN2A 3OSFA 4BKXA 5FKNA 1OCPA 3S15J 4MO7A 4Y7NJ 3ZQFA 2XGEA 1JTYA 3HOVJ 2M9HA 4DYQA 1FEXA 4UUSB 1I50J 4FE7A 4DYRA 3MKLA 4D5CA 1PUFA 2LR8A 3CQZJ 4BXXJ 2JWTA 4UUSA 1A6IA 1HDPA 3MVPA 2LY9A 4M6VA 4B1RA 2GBYA 2FX0A 2X48A 2X6OA 2HI3A 1RKTA 2W48A 1CQTA 2DMUA 1JGGA 3G1MA 3RZDJ 1LFBA 2HXIA 4UUTA 5FLVA 2KT0A 2LFBA 4A3EJ 4X1EA 3HOWJ 2H8RA 1QRYA 3K2AA 4W1UA 3UKGA 2XPWA 5J3LA 1IGNA 4QIWN 5IYDJ 2K9SA 2EQRA 1OFCX 1S7EA 3ZQGA 3I4MJ 2KDZA 3C2BA 1Q1VA 3BQYA 5DTDA 2LK2A 5FLMJ 4QTRA 2XSDC 3JRGA 3NAUA 1RR7A 3K7AJ 4A93J 3TP3A 2RAEA 1IC8A 2DA1A 1BL0A 3WHBA 1MBKA 1F43A 2Y2ZA 2FJ1A 3QPLA 4EEFG 1VFCA 2VI6A 1EF4A 2NVTJ 4RDUA 2NVXJ 4M3GA 5JLWA 4DYCA 1GV5A 2Y30A 2ME6A 4BY7J 1AKHA 5C3EJ 1VF9A 4IHVA 2M2EA 4MLOA 5FKOA 1ZTRA 2DMTA 2COBA 5J1YA 2NVQJ 3A03A 3IV5A 5EZGA 4XRSA 2R5YB 1UHSA 3BTLA 3RZOJ 3JRHA 2R5YA 2HQ5A 1Z0XA 2N8GA 4CYCA 3H3VK 5J1UA 3LNQA 3H0GJ 4IEJA 1HLVA 4GFBA 1MBJA 3S1MJ 2R7ZJ 2DN0A 1GV2A 3SJMA 2DA4A 1BJZA 2DA6A 5K7ZA 1ETYA 1ZQ3P 2R5ZB 3S16J 2DMNA 2CUFA 4A3FJ 4XK4A 1OCTC 1U9OA 3BR1A 5EF6A 4V2GA 5F0FA 4ABZA 2QF7A 1MH3A 4JX6A 4I6ZA 2K9QA 2WB1N 2ZB9A 1K83J 2LD5A 2O9LA 3DCFA 2IEKA 5E3MA 3IH2A 3SDGA 3Q0VA 3FIWA 4QSHA 2IAIA 5GPCA 3HOYJ 4XICA 3CMYA 2DMQA 1QVUA 2Y9YA 3PO3J 2VKEA 3ZQLA 3BR3A 4JP0A 3TW6A 5IP9J 1JKOC 4AUXA 1QPIA 1TWCJ 2E2JJ 1MBEA 5F08A 5FKKA 2K9NA 2FQ4A 3HB9A 1JKPC 2K40A 5IP7J 1H89C 1MH4A 2Y31A 1PUFB 2CQQA 5F0CA 3GBGA 2DA5A 5IOYA 1FIPA
chains in the Genus database with same CATH superfamily
2EIKH 1X1AA 3I71A 3OYJA 2PI0A 1B4AA 2CO5A 3WTVC 2OV7A 4B48A 4A3CJ 4PFOA 2QBYB 1ODDA 2EPFA 4LB6B 1UJ8A 2MA3A 2HR3A 3LSRA 4L9NA 3LSPA 4XLFA 3Q5FA 4Z6YA 1V3FA 2QBYA 2V4JC 4XSZF 1FC3A 1W5CC 5C4XJ 4FX0A 1K7AA 3M4OJ 4IO9F 3CDLA 4KA4A 1LJ9A 1T0FA 2ZCWA 1FSEA 2EWNA 3CUOA 1VQ8I 1DPUA 3KYLA 4J19A 3IWFA 3WE3A 4Y17A 1JJ8C 3PNTA 2YX4A 3LAJA 1YFHA 2X6WA 1XS9A 1S3JA 2L9RA 3MKZA 4UHTA 1R5HA 4KIGA 2CSOA 1JTXA 4XKVA 4MQ9F 1WCMJ 3OYDA 2D1HA 4M3DA 4RM3A 2FMLA 1UAAA 3ZQ7A 3ZQCA 3ZMUA 3A2KA 4DNCA 2OJED 3J7ZI 1AKHB 2BY0A 2XGDA 3JTHA 2HKOA 2KRCA 2Y48A 3KFWX 1FZPB 1V4RA 2BE5F 2D2WA 3DKYA 2KIUA 3WTYC 2E1MB 1F9NA 4C2TA 2GXGA 3REOA 2HYJA 2HPMA 2VIXA 2L9SA 2ME0A 3FXLA 1JUSA 2BV6A 2DT5A 3K0LA 3OIOA 4HX8A 2Q8KA 3HXLA 3VEPA 3S8PA 3GTMJ 2EIJH 3L2CA 3TW7A 4LOCA 1LFPA 1GT0C 2CG4A 5HDGA 4HV6A 1T0FC 3R60A 2ID6A 3HM5A 4PJLA 1FOXA 2WAEA 5EZHA 1JT6A 4CYDA 3KLNA 2PJRB 2DQLA 5ICGA 2KMUA 2VXDA 3TDZC 2M30A 3K4JA 1UZCA 2Z16A 3I59B 1FMVA 4V2FA 1ONVA 2O6GE 3S2DJ 3HOUJ 4GO1A 2PJRA 1MMSA 3CCLI 3CMEI 4DQ2A 2KL4A 3TOBA 2ECBA 3TDUC 2QA4I 4ENKA 1VQOI 4C9YA 2ZKZA 3DLLF 3CP8A 3ZP5A 3S17J 3PUFA 3BJ6A 2Y9ZA 2R7UA 3AFHA 4FTHA 3BR0A 4BAYA 1DDNA 2L02A 1ON1A 4F3QA 5M5XJ 1I5ZA 3WTWC 2XHKA 2M1BA 1Z9CA 1HW5A 3F8CA 1EKEA 3FHNA 1DU0A 1D0YA 2B9SA 2BVMA 3BT9A 3F23A 2E1MC 4XN0A 3J7AY 4A3DJ 3LSMA 4PGHA 2E19A 4X6AJ 3CDHA 3QU3A 4ZH4F 4RB2C 5LEKA 3K6GA 4RB0A 2DOAA 2VKVA 1YW9A 2VE9A 1K78B 4IHXA 1D8KA 4RB3C 1STZA 4BQAA 4XL9A 5LHHA 1DGWY 4WX9A 1SAXA 1R36A 1K78A 3CO7C 4A3JJ 1PDNC 3K4NA 2CFOA 4XQFA 3ZN0A 1J7KA 2NAZA 3EDPA 4A3KJ 1X3WB 3GLLA 2KQRA 5JFRA 2M87A 3VOEA 2HVSA 3OOUA 5HS7A 3FK6A 4HAMA 5H6QA 2LTPA 2P5VA 5HNFA 2JVGA 4PSXA 3V7SA 1YW7A 4D7MA 4ESFA 3OYBA 4O3MA 1MMGA 1IRXA 4E7KA 2NOJB 2XAQA 2YR2A 3F9KA 5EDNA 1E3PA 2OTLI 1JKQC 2W84A 1B9MA 4D9JA 4FX4A 4Y13A 3CF5F 2XAJA 2MSYA 4QPOA 1J0RA 1U8BA 4HDVA 3B73A 1L3LA 2P81A 3NQOA 2K4BA 1KU2A 1VQLI 5F1JA 1P9QC 3IRRA 4G7OF 2QSHX 2GZWA 1QNTA 2VJ5A 2R7FA 1AHDP 2L9VA 5FO5A 4U0YA 2ELHA 2K3FA 4Y15A 3TGNA 4XLEA 3QYBA 3ERED 1J9IA 3S14J 5GAHJ 2M4KA 4L5EA 3TEDA 2CQ7A 3T0YA 2QKLB 3E6DA 2H1LA 4U0WA 2PJPA 3PFYA 1TLHB 3EYIA 2JK3A 2QQBA 4HX7A 3L9FA 1FLIA 2MD0A 4BE2A 4HA8A 2VT2A 2NOGA 3ZMSA 1RETA 4CGZA 1WGXA 2KIFA 3BR6A 2BXZA 2OCCH 5F0HA 4NB5A 1ZGJA 1WZ2A 2DBBA 5J8CA 5LHIA 1LKXA 4CCKA 4C3JJ 4NC7A 4BQQA 2YU9J 2GOXB 2RNJA 1W36D 2NVYJ 1NH3A 5HS8A 1ETKA 1ZELA 3PFIA 3ONQA 5D8KB 1XSXA 2MH9A 4HNVA 4DBRA 5IYCJ 5DUKA 2JN6A 1LNWA 3M1EA 1VI0A 1KU3A 4H4KC 1JUPA 1ZKGA 3ASOH 1LFUP 1FYMA 4U7DA 4XKWA 4EGZA 3COAC 3GTQJ 1MNEA 3JRFA 1D0XA 3SQNA 1S9HA 1UHMA 1Z77A 3OL3A 1U8RA 4MFDA 1RC9A 3JSOA 3BLYA 1WH5A 5EEGA 1U3EM 5LRRA 3BR5A 1V55H 2EFWA 2CGPA 4XLHA 2JPBA 3F21A 3ISPA 1VQKI 3SZTA 1I1SA 1MBHA 1TW3A 5B1BH 4KN4X 2Z5UA 4RA2A 3S3OA 3NARA 5LLQA 2O8XA 3DEUA 2EB7A 3HRMA 4FE4A 3H5RA 1WH7A 4M6XA 3GX4X 1IO2A 3DBLB 5FRMA 2MYSA 2LVSA 1WWXA 5HODA 2NNYA 1VTNC 3VODA 2GXBA 5C4JJ 2DFIA 3HOZJ 1X1BA 1T2KA 4B47A 2VC0A 3ZMDA 1ZLKA 1ETVA 2G0EA 1EH7A 2QQ8A 2E5ZA 5EGOB 1ETQA 4C2MJ 4FASD 2MLGA 2XAFA 2L7FP 4AVPA 1V5FA 1VQMI 5EGOA 1KQ0A 1W7PD 1QVTA 3GTKJ 1SD4A 2HTSA 2M5WA 3MN2A 4I02A 1WJEA 1E2XA 3I53A 4ZYAA 1QO0D 3IRQA 4OAYA 4A2UA 2WY8Q 4DOZA 1OCPA 4I09A 1YITI 2CH0A 1KA8A 5DYMA 4LB5A 2F2EA 2VQCA 4DYQA 2AXLA 5ILVA 4FE7A 4DYRA 3MKLA 4MGRA 1PUFA 2RQPA 4BXXJ 1G3YA 1OLTA 5JI6A 2L4AA 1YW8A 5FB2A 2LY9A 2YSRA 1CGPA 2R7DA 1DUXC 2GBYA 3R61A 2VN2A 3I58A 2X48A 3D0SA 2X6OA 2VL8A 2W48A 1YI2I 3MEXA 1CQTA 3FXKA 1JGGA 2HYGD 2ZXHA 1LFBA 3V8LA 2P0WA 4LIVA 2A07F 3ZQQA 5CVIA 5L3EA 1PUEE 3BWGA 1IN5A 2XPWA 4W1UA 5J3LA 3UKGA 2DFFA 2IA1A 5D6FA 2A68F 2BW3B 5ERIA 3WTUC 2R7VA 5IYDJ 3ZQGA 1MMNA 2CQNA 1SD5A 2BW3A 4HF0A 5FLMJ 1OCCH 3QP5A 3DFGA 1LPQA 3ZGKA 5CJ9A 4ZTJA 4CXFA 3K7AJ 4A93J 4AU7A 4OWRB 1YLFA 1MBKA 2Y2ZA 2F5DA 4F91B 1TT5B 2E35A 2FNAA 4RDUA 1ON2A 4HDUA 5F1RA 5E8IA 3U2RA 4E6KG 2LOOA 3F8MA 2EV6A 1IAWA 2GA1A 1ZTRA 3CTAA 2DMTA 2COBA 2DAOA 3A03A 1HSTA 2CW8A 4E4HA 4XRSA 1YIJI 2H6BA 2K85A 3FX3A 3MCZA 2E1CA 3L2RA 3EQLF 3JTGA 3CCEI 4EJUA 2HQ5A 1Z0XA 3B02A 2DA5A 3FXOA 3H5AA 3M8FA 2R7SA 5KNLA 1LDDA 3EUKL 4IEJA 3MZ8A 1W1WE 5BS6A 3DQVC 4BJ6C 2DQRA 3FMRA 4M6YA 3BP8A 3KEQA 2DA6A 4WK8F 2E60A 1ZQ3P 3H9GA 2R5ZB 4E7IA 3S16J 4CZZA 4CCNA 3U9GA 2DK8A 2CUFA 3DP7A 2OQRA 4A3FJ 3RSNA 1MMDA 1DPRA 3S93A 1QPMA 5D4SA 5IT3A 5JR3A 3P9KA 2JPCA 4M73A 2O9LA 3DCFA 5KAIC 2IEKA 3K4CA 3T8RA 3SDGA 3LWFA 2V9KA 2WB1A 4OU0A 3AG4H 1USTA 3HOYJ 3WU0A 1V5EA 4BXFA 2DMQA 2JVHA 3W2AA 4R79A 1BR4A 2M0MA 4AIHA 1S29A 2V6EA 2VB6A 3HRSA 5IP9J 1OMIA 4OMYA 1QPIA 1TWCJ 2WADA 1LVKA 2IGNA 5BOXA 1K6OA 5IT9Z 2XSJC 4RGSA 3GZNB 3HTUA 2DK5A 2JQ7A 1BR2A 1Y8QB 4DIQA 3GO5A 1Y56A 1RIOH 1FBQA 2CV1A 3R0JA 3HPHA 5E1ZB 4G9YA 1TTYA 3E6CC 4P9UA 2K4JA 2Y31A 5CPRB 5L3FA 5FLXK 3K1PA 2CQQA 2O03A 5F0CA 3WU2C 5IOYA 4PGGA 1FIPA 3GTOJ 2KISA 2OAZA 4BQOA 3Q0WA 3K1MA 1SANA 1RUOA 1RUNA 2VKDA 3L1PA 3HGGA 3OYIA 3HIFA 1IXSB 1P7IA 1TWAJ 3CF2A 4JQFA 3BDDA 4A6DA 3ABMH 3KLOA 3SZPA 1JT0A 3QYEA 2CUEA 1WI3A 3VFZA 2I5UA 3W3CA 4BHCA 4BBRJ 4XKBA 2FUG2 4S04A 3H3UA 4G7HF 2LF8A 4IPAA 4A0ZA 5JVTA 2KFDA 1RESA 3RYPA 2JA6J 1WJAA 3BJOA 1S7AA 3VWBA 4V19K 2HS5A 2XAUA 3M9AA 4IZZA 2ZMEA 3S2HJ 1X4OA 3OMYA 1ZGWA 1BA5A 2H27A 3HC7A 3MMYB 1QA6A 4WWCA 2WTEA 4UV9A 4MEXF 1P92A 1FTTA 2F5VA 1HOMA 2XV4S 2WA0A 2ISYA 4CCJA 1H8AC 2HYFA 1YE9A 4DZPA 1D5VA 1W4MA 5KVRA 2QZ8A 2LC2A 3S3NA 2BHZA 3PSFA 3SXYA 2ACJA 2YU3A 5FGMA 4XORA 3KYCB 3JRAA 3HTSB 5E17F 2HU9A 1WJFA 4BBSJ 3E97A 2WY7Q 1R58A 3IC7A 4AWXB 5CLSA 3QU6A 5CQGA 4P1WA 3O3KA 3DXJF 4CYCB 2JA7J 4IRHA 2E2IJ 1SD6A 1OCRH 4ENJA 2ZXWH 3KE2A 4JYKA 1ORKA 5LRSA 1RZ4A 3D5LA 1T56A 1YOVB 1KU7A 2CU7A 3ERMA 2YPRA 3BG9A 3D5RC 4CCLA 1TWGJ 3O6BB 4ASNA 3K4KA 1IUYA 2R0QC 1LE8B 2DYRH 1OQYA 2CW7A 5FJ8J 4FCYA 2OBPA 1GVJA 4IRIA 2EZKA 3JRBA 3I4NJ 2R92J 1LE8A 5EG0B 3JRIA 1WKMA 3HBLA 4RGRA 2IJLA 4G7ZF 3I0TA 3F8BA 2V7FA 1XGMA 5EG0A 5HOOA 4HNTA 4IHYA 2Y0SN 2DT7B 1IG7A 3FXMA 3NRVA 3JAMK 4ZYDA 3SFZA 3B6CA 3CMMA 3K2ZA 2AHQA 4A3BJ 3G1OA 3QQAA 3UNGC 1HW1A 3VSKA 4DJAA 1ZRDA 5DS9A 2F6CA 1IN6A 1N75A 4BJ5C 5E79C 5A2QK 2VBZA 2X9DA 4E7LA 5CVUA 4JX5A 3D5SC 5F27A 4RAFA 2PMHA 2HOSA 1Z21A 3LA3A 3E5XA 3Q0UA 3G6EI 3FISA 3GWZA 3UR3C 1FTZA 1V5GA 2MGQA 4IJAA 1IXRC 2F4OB 5LEJA 2AS5F 1MKMA 3FM3A 1IRFA 2PBIA 1ETXA 2X1DA 4C3HJ 2QVOA 5FRNA 4LLLA 4IOCF 3RKYA 3ML6A 1IJWC 3KP2A 2XPVA 3I56I 1UHWA 2HQAA 5EYRA 4OIOF 2ESHA 1BI3A 2L7ZA 3P7NA 3QRFF 2STWA 4G6QA 3FXRA 3LA2A 2WC2A 3OIQA 4PK4A 2NYXA 1X3ZB 2HFHA 3DTIA 4II2A 1OR7C 2K7LA 5HNHA 4Q4ZF 4UNOA 3CCUI 2RGVA 4XRMA 2X85A 2Q0OA 3QODA 4L18B 5JVGF 1WJ5A 1YIOA 2HVRA 1BN5A 2QSFX 1SMTA 1P4XA 1WFXA 3DV8A 2E7WA 4BJTA 2PFBA 2OQGA 5CVRA 4HF1A 2DTZA 4UB6C 3GLXA 3KP4A 4KMUX 3WTSC 1HF0A 3DBHB 3E6BA 2ZJRF 2IBDA 5HDNA 3KX2A 2HKXA 3WGHA 4AYBA 2DXIA 2R7QA 3LL7A 1DU6A 1JJ6C 2D5VA 2HDDA 2NNNA 4IRGA 1ZK8A 2EFQA 4I0BA 2YUSA 1LB2A 1HBXG 3S1NJ 5M5WJ 3BZKA 4EGYA 3N05A 3M8JA 3LOCA 1P4AA 3DEEA 1XDSA 1P2FA 2XF6A 3LSIA 2Q1ZB 3AG3H 2TCTA 3OWTA 2EFNA 4XLAA 3FXJA 3ASNH 3N4MA 3ECOA 4OOIA 3WTZA 4F7ZA 5E8GA 3GYHX 1SVLA 4ZJZA 2X6XA 2LMDA 5LBQA 1I3AA 1R49A 4Q48A 3TKYA 1QU3A 1W5SA 3PM1A 1O3TA 2R7RA 2E5NA 3BOQA 1WPKA 3JRCA 3L2WA 4A3LJ 2M45A 2CQXA 1FP2A 2K5CA 5DD4A 2QSGX 4HQMA 1AA7A 4E7ZA 3K69A 1FWZA 2GAUA 2QM3A 3MKYB 1MIJA 3HEFA 1USSA 2EFOA 2EZHA 2GOMA 2BEOA 4G12A 4GYGA 5M3FJ 4AM3A 1SD7A 3CP2A 4DBQA 4E70A 4NQWA 2KZVA 3CLOA 5BQTA 2JUGA 3QPTA 2DYSH 2HOAA 3KYDB 2I10A 3ZQHA 1D1BA 5DV5A 3SEQA 4LK0F 2MBFA 2BOLA 1F5TA 1FOWA 1FP1D 3OYEA 2EK5A 2KKOA 1OCZH 2RC4A 3KP6A 5J8FA 5TJJA 4B8XA 1RKWA 2Y0SA 1FNNA 2K02A 5EEHA 3CCJI 1NTCA 3TP0A 3JR9A 4LFUA 2DA3A 3U1DA 3JW4A 2GQQA 3BR2A 2CV0A 2D1VA 3TOAA 3H35A 2ZC2A 2VODA 1HSJA 1P7JA 1H88C 1F1ZA 1FIAA 3KIOA 5M5YJ 5AONA 4FHTA 4XIDA 3ZCOA 2VONA 3FDYA 1R7JA 3PO2J 1Z7UA 2LG4A 3BZCA 4ZZLA 3RTRA 5CKTA 3A1YA 4PJJA 3ELKA 3FXQA 4I2OA 1J75A 4UY8I 3OYLA 5C44J 3PNVA 2NS8A 2L0KA 2DPDA 1C0WA 3AG2H 1YO5C 1Y39A 2ICWG 3VSLA 4XMYA 3EUHA 4KN7X 1LEAA 5K1YA 2FEZA 2O5RA 2VJIA 4BEHB 3CC4I 3V7RA 2K86A 3ZRGA 2VPRA 2LY1A 2XB5A 1Y1VJ 4LIUA 4CICA 4BEHA 3OSFA 4GDFA 2UXNA 4A6EA 4R8HA 1H0MA 3V4GA 2W4SA 4NBQA 3S15J 3LSHA 3E0JB 4MO7A 4Y7NJ 1T6SA 3CZ6A 1UCRA 3HOVJ 1Z3XA 2M9HA 1FOYA 3IKVA 4UUSB 1FEXA 1I50J 2DODA 4XLNF 3MZHA 1YJWI 2EV5A 2JRMA 1YYVA 4OIQF 3CQZJ 2WV0A 3H9JA 4UUSA 1A6IA 2HOEA 5AIQA 2P4WA 2RVCA 3MVPA 4WCGA 4B1RA 3CJNA 2FF4A 2XVCA 1YG2A 3V42A 2IS2A 4HZFA 3RZDJ 1HA8A 1E0EA 4B44A 2KT0A 2H09A 2ZJ2A 2V9PA 2LFBA 3ZMTA 1WI9A 3GMEA 2HVQA 1QRYA 3MWMA 3K2AA 1S8NA 1XD7A 1Z6TA 3J80K 2R7TA 1K4SA 5D5XB 3ZN1A 1R5ID 5GAEJ 1VQPI 2CYYA 1Q1VA 3C2BA 3BQYA 3EUHC 3FKJA 4HEA2 4CSWA 3ECHA 5DTDA 3OYHA 5LGUA 3R4KA 2A69F 2GXAA 3IHUA 5LHGA 1TQIA 2RAEA 1IW7F 4BDZA 4O5VA 4YRVA 3SYTA 2HQRA 4AIKA 3OL4A 4RB1A 3KZIC 2FXAA 2EJRA 3X2QH 1VFCA 4HBLA 3H3ZA 4B3XA 2K9LA 4NC6A 2H6CA 2ZSIB 2FBKA 4DYCA 1YX3A 1GV5A 5GADJ 4BY7J 2CUZA 2J5OA 3ROUA 4F55A 3BROA 2GWRA 4WXCA 4ZYHA 5DDGA 3M1CA 2L3DA 1QHHD 2R3SA 1BOAA 2CQKA 1S5LC 3RZOJ 3QP6A 1KYZA 2G9WA 2A3SA 4OINF 4ANJA 4RAYA 2VOPA 4U7BA 5DD8A 1UELB 2LNBA 2XUBA 1BIAA 4GFBA 2AQFA 3J81Z 1Z3YA 1ZGAA 2DN0A 1YJ9I 1SVOA 4XOTA 3CO6C 4CUGA 3EETA 1NG6A 1BJZA 1WQ2A 4KT5C 3L2QA 1FMWA 2DW4A 4RLQA 1G6NA 2DU9A 3ZMZA 1OCTC 3H1CA 3BR1A 5HLHA 2IGOA 2RREA 5ICFA 3W6JB 4ABZA 1MH3A 4JX6A 2K9QA 2WB1N 2XGXA 2NXNB 3PSIA 1XTAA 4BGDA 3FF5A 3K4MA 1IN7A 4LLNA 3FIWA 3HJEA 3KCCA 1HQCA 4CH7A 2IAIA 4ENNA 5GPCA 2PN6A 2V1NA 1LQ1A 4XICA 4CA0A 2Y9YA 1B9NA 3F6VA 3JSPA 2VKEA 3ZQLA 4PJ0C 1ACIA 1QGPA 2O3FA 4G6TB 2JSCA 3C2HA 3RCOA 1JKOC 4AUXA 2OZ6A 2O61A 4HF2A 5F08A 5FKKA 2H8WA 2K9NA 1O7LA 2PG4A 1H9TA 1FPQA 2FQ4A 3HB9A 4D0PA 1JKPC 1YS7A 2PX9A 1EV7A 3VB2A 2P5LC 1H89C 2QGUA 2MFZA 3QOEA 3VYUB 1PUFB 2FNPA 2IP2A 4YG2F 2XC7A 1BC7C 2V6CA 3MAJA 1ZR4A 1IXCA 5KAFC 5FFXA 2EINH 4D7NA 4I01A 4KICA 5IYBJ 3CMAI 5GTHC 3QAHA 3DF8A 3DEWA 5HVQC 2JUCA 2LLKA 2LREA 2V26A 4PDKA 1IV8A 4NHJA 2P6TA 4AIDA 3CD6I 1SMYF 3ZQIA 5FFZA 3V8JA 2LH9A 3MQ0A 1OYIA 2O0YA 2VBXA 3OYCA 3FXUA 2XF7A 1ZG3A 3E5UA 3BTCA 1GUUA 1KONA 3K70D 1YS6A 4KIFA 4XLPF 1ITYA 3P9IA 3DPUA 2FD5A 5LD2C 4XR6A 4A12A 4KDPA 2IGMA 1E3HA 1KQ9A 5E3LA 3I55I 3I3LA 3HSEA 1Z6RA 2M7AA 1TW2A 2HDWA 2DOFA 4BACA 4L9JA 1QQIA 1S6LA 1QBJA 3KP5A 1BOBA 5F64A 2H94A 4I98B 2UXXA 3VYSB 4LK1F 3TO9A 2RKHA 3A01B 4BXUA 2TRTA 2WAQA 2Q2EB 3E5QA 1NK3P 1OJLA 1KZHA 2M3AA 1N25A 3MD2A 3VDXA 3A01A 2Q2EA 3WE2A 4Y3OA 1A35A 5M3MJ 5CQEA 4PSWA 3GTJJ 2IS1A 1T33A 2B63J 2HXOA 3T5XA 2MW8A 1MBGA 2I8DA 2QWWA 2DPUA 2K27A 2CW0F 3FHZA 3LMMA 2FSWA 2KRFA 3TQNA 4XN3A 3EUAA 1KGSA 3K10A 5CYVA 2FMYA 1WHUA 4BNCA 4MQVA 1FBSA 1MNDA 2OF7A 4HPQA 1SFKA 1RRJA 1XGNA 1TC3C 1SAUA 1Y8RB 1R9TJ 1B59A 4E7SA 2ZNYA 4BQNA 3IUOA 3M8EA 4MEYF 3CJQB 1ENHA 1F36A 4HOBA 4NNJA 2DFEA 1UMQA 3KP3A 2OA4A 1MZBA 2O8KA 1N78A 2XIGA 1YHQI 1FSHA 2QQ9A 4GYIA 1X2NA 1XMKA 1R1VA 1WJBA 4KIBA 2MG4A 1MJBA 2UWMA 2Z1DA 3H36A 3T8TA 3D1NI 1DP7P 3FM5A 2VBYA 4L9TA 1MBFA 4LLGF 3BQZA 2GIZA 5J40A 4UVBA 1S7OA 1FJLA 3GFIA 1TWHJ 2L5QA 3RPUD 3EPZA 5KCMA 3TBIA 1ZHFA 2A5WA 3GF2A 4KJZA 3WU1B 3KP7A 4EJTA 1W5TA 3W2VA 2QYOA 2XB0X 3LAPA 2HGCA 2B7EA 1QZYA 1BW5A 4C2UA 2K3PA 1LUJB 1POGA 2MH2A 3AAFA 2PQ8A 1XGOA 1ZLJA 3F6OA 3OYNA 1Z1DA 4O6JA 3WG7H 4M71A 4G6DA 3F22A 4UV8A 2V9VA 3TMOA 1W7PB 3I54A 1TQPA 3CLQA 1DGRM 4KUMA 3ZMVA 1ZG1A 4QWQA 3OYFA 1W7PA 1BR1A 2EILH 4M74A 1A31A 5ILSA 2RDPA 2IS4A 3IH3A 1R1UA 2CUJA 3G73A 1XCVA 2ISZA 3DWLE 5FD5A 2ZJQF 1R4NB 3KETA 1VQ4I 3LSKA 5D5UB 1I39A 5IT9K 2LRDA 3HHGA 4Y52J 1RPWA 2E2HJ 2XKPA 3LSJA 1SFXA 4MTEA 3RPQA 2EBIA 1I6HJ 2VPLA 2EZLA 2ZMEB 4LG3A 3PIPF 3IKTA 4Z2YA 3WHCA 1BC8C 5B3SH 3FMSA 3CC2I 1FX7A 3GCMA 1BJAA 4S0HB 3A0HC 4CDGA 1AWCA 1JI8A 5HS9A 2KP6A 2M8EA 1O3QA 4AYBN 3OYGA 2P7VB 2WBMA 4CCOA 2M8GX 4I0AA 2HZTA 2LKXA 4M9XA 2Z99A 4UVAA 3QYFA 3T1BA 5D8LB 1X1DA 2IPQX 2RV8A 5J47A 3NWTA 2IVMA 2VOOA 5IPAA 4UXNA 4BHBA 4EM1A 4A3MJ 2DOEA 3HHHA 3W6VA 1HDDC 1HXDA 1T95A 3C2GA 1SFUA 2EH3A 3HPGA 1B72B 1ZH5A 1TQMA 2KZGA 4JBAA 4HRIA 2DDAA 3V8KA 1FYLA 1B72A 2Y75A 1Z7LA 1IDYA 2ETHA 1G3TA 3FBNB 1U2WA 5H2FC 3NWSA 1JUMA 3JRDA 3SEZA 3KZZA 3HUGB 5GAGJ 4MTDA 3GEZA 2QEXI 3G4SI 3GUDA 1XDUA 2EA2A 4IHTA 3HUGA 4F92B 4XOPA 5BMZA 1R00A 3GTGJ 1UB9A 2PEXA 2VT3A 5DCFA 2ZMEC 4EMSA 3NEUA 1WVRA 4EJWA 4M9ZA 4ESJA 1L0OC 3GTPJ 3SFIA 2IW5A 1NK2P 3PIOF 3C1DA 3VPRA 4W97A 1R6RA 3J7YJ 3WGIA 3IWZA 5E20A 4B3AA 4MIMA 2EIMH 5L3CA 1SFOJ 3JAMZ 1E17A 2KJBA 2QKMB 3TL4X 3KEOA 1ZR2A 4XM3A 2TDXA 2H1KA 3O8GA 4YEJA 2W00A 1MJ9A 4BY1J 5F04A 1I3QJ 4BUPA 3CESA 3LFKA 2O7OA 3HOSA 2LF7A 3CCYA 3OR2C 1TNSA 3BTJA 3P5JA 2ID3A 2EV0A 3JREA 1ZARA 3RQ4A 1GXPA 3S1RJ 4RGXA 4U87A 1BI1A 2HPIA 3FBIB 4GRIA 4HYEA 5BNGA 1A5JA 3ABUA 2DJIA 3DKXA 1W0TA 2JRTA 5CVJA 4EJOA 5GPAA 2XRNA 2IT0A 3O8HA 3S2WA 4YIIA 1JGSA 1IN4A 1T39A 4HSRA 1EA3A 4LD5A 2DA7A 3P9CA 2A05A 4HLYA 1YJNI 4EVIA 1YQAA 2M0CA 4X0GA 2XF5A 3F8FA 2Y0MA 1SEUA 3L09A 2FBHA 4Q5SF 3DLAA 5TGTA 5BPDA 1GVDA 2DI3A 4AD9A 1D1CA 4BKXA 2Y69H 2RQQA 5B5EC 4MHGA 1JE8A 1TP4A 3DPTA 1JHHA 4IHSA 2IA0A 2ZXJA 5FKNA 2W57A 1XPXA 5JHUA 2GA2A 2JSPA 4XBFA 1JTYA 3TO7A 2BHYA 3RKXA 5HDKA 5D4RA 4FQGA 1B1BA 1KQ8A 1GXQA 4IL6C 2JWTA 4ZC3A 3O2PE 3N97A 4M6VA 1GHCA 2KIQA 4Y33A 3HSFA 1QHGA 2VC1A 1BI2A 1RKTA 1XSDA 3MZYA 2DCEA 4C30A 1CF7B 1I1GA 2DDBA 3ZR8X 2CWEA 3HOWJ 3OIPA 1CF7A 2QQAA 2VKHA 4XONA 4QIWN 5DM7F 2PLYA 2EQRA 4ZYGA 2CMPA 4NC8A 4EJVA 3I4MJ 4ITVA 3HRTA 2A6HF 3A4CA 2LK2A 2DLLA 3C3WA 4A5MA 4QTRA 2M4GA 2XSDC 2E7XA 2L9NA 3JRGA 3NAUA 2EFPA 4BDYA 1RR7A 2DA1A 3CCSI 1F43A 2LKSA 3IAM2 2FJ1A 2ZSHB 3QPLA 4M72A 4EEFG 1EF4A 2VXZA 2NVTJ 3E1SA 2NVXJ 3BG7A 1Z91A 4M3GA 5JLWA 3J7AO 2ME6A 3EYYA 1AKHA 2ESNA 5C3EJ 4GGGA 1X3UA 1SVMA 2YX7A 1NHAA 2M2EA 5HLTA 4MLOA 4HNUA 4NQWB 2A61A 5FKOA 5J1YA 4M9SA 1WJDA 3M07A 3IV5A 4OMZA 3LA7A 4L5IA 3BTLA 1JXSA 1HKQA 3H92A 3GFMA 4TV7A 3JRHA 2N8GA 1TL8A 1N77A 3LNQA 3H0GJ 3H0DA 1HLVA 3C18A 2P5KA 3S1MJ 1H9GA 1XCBA 3G2BA 2DTRA 2FE3A 4GCVA 4PUSA 3CCMI 1GV2A 2X1CA 4IX7A 4HG2A 2LBFB 2XKOA 5K7ZA 1ETYA 1ZAOA 3BPXA 1WSUA 4EV0A 2P8TA 2KJCA 1O7FA 2LY2A 3I59A 5ICEA 5J6XA 2LBFA 5B1AH 2OTJI 1G8XA 5F0FA 5DEQA 2QF7A 3HRUA 4I6ZA 2HNHA 4P55A 2XAGA 5K5OA 1K83J 3GXOA 2BVLA 4KITB 2GIVA 3IH2A 4RS8A 3K4LA 4QSHA 2COMA 3ESWB 3OYKA 4E7HA 3WTTC 5BPIA 2V1XA 3DTKA 2HDCA 3PO3J 3G71I 1G4DA 5J4YA 3ZXSA 2VQGA 4XSXF 2W1OA 3TW6A 1OCOH 1ZYRF 2L54A 2E2JJ 4I7HA 1R22A 2BXYA 1HC8A 1MBEA 3BC8A 3OV8A 1RI7A 3GZ5A 1VQNI 1HKSA 1BIBA 4AIJA 3AL0B 4CO8A 4L0ZB 1TT0A 2DT6A 1LVAA 1XMAA 4RLFA 2ZXIA 1XB4A 1T08B 4XKCA 3GBGA 1LDJA 4BHPA 2X51A 3L2UA 1YTYA 1A6QA 4PFPA 3GTLJ 3LSGA 3BG3A 4B4CA 2E71A 3BPVA 1R5GA 1GDTA 5L3BA 5HLIA 2R93J 1G3SA 2W24A 3IL2A 1EJ9A 2JJ7A 3QPHA 4Y4RA 1MSEC 2WV1A 4UVCA 1PVEA 1X19A 2G7UA 3BCAA 3BCBA 4YIRX 5FD6A 4DW6A 1Y1WJ 3A02A 4HLXA 4RAZA 5TRDA 1IN8A 2CFXA 2ZBKA 3J80Z 1ZREA 1PJRA 4I76A 2DJNA 4BYYA 2VJJA 3E3VA 4ETSA 1U6GA 4UB8C 4ZZDA 5E3OA 3M7GA 2FRHA 4FETA 2DA2A 2HWVA 1O3SA 1EH8A 5ED4A 4G94A 3FK7A 3LFUA 2JA8J 4N4NB 5KHDA 2WAQN 2VUMJ 1R23A 4FISA 2HOTA 4A69C 2CRGA 4LITA 5L3GA 2FU4A 2F48A 3HKZN 5ICCA 4ENMA 5D5WB 4XLCA 1IUFA 3AL0C 1OYWA 4DZJA 4HQEA 3K1NA 3F3XA 1VQ5I 6PAXA 2OUMA 3S32A 2M7BA 2ZFUA 3OS1A 3KPHA 2IGKA 5GP9A 4F52A 2CS3A 1MNMC 2VJ4A 3DPLC 1RNLA 2QLZA 3BG6A 1O4XA 1FT9A 2EA4A 2GM4A 4HV5A 2JA2A 2XGCA 1G59A 1ETOA 2V1DA 4S05A 4ZYEA 1XG1A 2GLOA 1AOYA 1OYYA 2CJJA 4LG0B 2KPMA 5DM6F 3GW2A 2HZDA 1X1PA 1ZG5A 1JKRC 5IY5H 4LG0A 3RKQA 2D45A 1YRNB 2EZIA 3F72A 1MMAA 3HL2A 5LGNA 2ZO4A 4RM2A 1HKTA 2FQ3A 3FWEA 2ZFWA 4BE1A 1YRNA 1OISA 1HCRA 1MGTA 2XROA 3DU6A 2ECCA 1UFMA 2KDOA 2F5FA 2VE8A 1V54H 1MSFC 1FYKA 4PJMA 3G1LA 3OS2A 4IHWA 4C3IJ 4XRSG 2QUFA 4IQ4A 5DUIA 4YIFA 1UG2A 4KMFA 1E3OC 2JMWA 3CJTB 3Q3SA 3CJRB 4P9FA 3J81K 2OPTA 2NS0A 5LFAA 4JK1X 3Q9SA 2NS7A 3WODF 4PJNA 3KZYA 3HOTA 5GTIC 4LJZF 1MJAA 4HX4A 2L2OA 4RAGA 3W2WA 3LQRA 4QLCU 4HSTA 1ZRFA 3QPSA 2E1OA 5CVVA 2STTA 4I99C 3BY6A 3HG9A 2LP0A 1J09A 1B8IB 2E1NA 5D5VB 5IP6A 1UG0A 2KHMA 1TBXA 3CC7I 3VYTB 2VASA 2ELKA 1KU9A 2Z9OA 3ULQB 4NDLA 1B8IA 1LDKB 2QCOA 4CZCA 2IS6A 1APLC 2KRHA 1D8JA 1K61A 5E18F 1OKRA 3R0AA 4D5FA 1IV6A 2E36A 1IDZA 2HQNA 4AVZA 3IAS2 4LMYA 1T98A 3GFJA 2XPUA 3H9QA 4RMNA 1U78A 4J01A 1TWFJ 1X2MA 1DP3A 3M3YJ 1ETWA 9ANTA 2F4MB 4ZDLA 3PL8A 4YFKF 3PNYA 4U0VA 1D1AA 1AU7A 1J5YA 2ADUA 3BZ6A 3DTEA 4K2EA 4JX4A 4AC0A 2FBIA 5ILUA 3PQJA 1IF1A 1Y0UA 3Q9VA 3B6AA 1R4MB 1G2HA 4YELA 2BYVE 2KLOA 5L3DA 4D1QA 3S1QJ 4M3FA 3HOXJ 1D0ZA 1I6XA 4IKFA 1ZN2A 2A6EF 1F4KA 2K9MA 1TNTA 2ZNZA 3BTIA 1FOKA 1Z05A 4M3BA 1A36A 4A0XA 2DFHA 2J5PA 5AIPA 4ZDOA 4LGWA 2A6TA 2KIMA 1BBYA 5H20A 3SDBA 5KK1A 5K7HA 2R4GA 1U0JA 2AXTC 3RIRA 2X6YA 4A3GJ 1J59A 5FKLA 3HKZA 2CV2A 4IF4A 2B0LA 1Z67A 1BW6A 2X0LA 2X1EA 2M34A 4G8XA 3AG1H 2UUZA 4ZTFA 4II3A 1SFEA 3DBRB 2V79A 3GZ6A 3CUQB 3E7LA 4KISA 4L0YB 3RQIA 1PP8F 4RBOA 1XSVA 2BGCA 1PYVA 2L4MA 2XRLA 2L7MP 1QZZA 3CUQA 2Z33A 2YS9A 3A0BC 1IRGA 1XC5A 2IA2A 4N0BA 5LGTA 5J4VA 5B66C 3WG9A 3CDIA 3SZGA 2LDUA 4P5OA 3LQQA 4R1HA 5DCMB 1X4PA 4NUBA 2P7CB 4ESBA 3OYAA 3I4PA 3OS0A 4H0EA 5DCMA 4MFEA 2JTVA 2LKPA 4YFXF 5JLXA 2BY2A 1OPCA 4A3IJ 3OSGA 4ZDPA 3FKIJ 2DMPA 3VYRB 1LEBA 5J1RA 1BI0A 1B6AA 4GXOA 1Y6IA 1T38A 3PQKA 2OCEA 1EH6A 3F0CA 3OOPA 3BG5A 2MABA 4EM2A 4KNYA 1X58A 5IOZA 5E3NA 2HTJA 3HGYA 1WRJA 1P4WA 1U5TB 2XASA 2G7HA 3GVAA 3QOPA 2UZKA 1O57A 1TZLA 1QZEA 3U21A 3HDDA 4DGWB 1GLNA 1W0UA 1U5TA 3F8NA 2Z3YA 4EQQA 5HLGA 5EEAA 4BU2A 3U1KA 1O3RA 1MD0A 2AO9A 2E34A 3WTXC 2MC3A 1BM9A 5F6FA 5FKMA 1PP7U 2R5ZA 3GFLA 4N9IA 3LSTA 1K6YA 4OIPF 3L2VA 3ZOBA 4OAZA 5FLXZ 1D5YA 2RNGA 4B09A 2JA5J 3BJAA 1W36C 2OZUA 3CUQC 2BY3A 3IH4A 2UV1A 1FY7A 3OYMA 4MNUA 3MFKA 1R1TA 2VLAA 4FT8A 2PMZN 1VNDA 2Z2SB 4ON0A 1HW2A 4EM0B 5K5RA 2NRAC 2XDVA 5E1WA 3QWLA 5E1XA 3WGGA 2WAFA 3W6KB 4A0YA 4M3EA 1IRZA 1U9NA 5D6EA 4OIRF 5K7FA 4E7JA 3DU5A 1VQ7I 4L5JA 1NG7A 1M1EB 5TISC 2HEOA 3L7WA 1FBUA 4F93B 2A5YB 1X1CA 3ZQFA 2XGEA 1DQUA 1G3WA 2W82A 3RKWA 3AKZA 3MKWB 2L7KA 3V7CA 4J00A 3R6SA 1XMXA 4BH9A 4YFNF 2OC6A 3K4BA 2MD5A 5FROA 4D5CA 2X4HA 3CCVI 2LR8A 3HYIA 3K9TA 2PMUA 4WXDA 3TO6A 4IVNA 1U5TC 1HDPA 3IP4B 1Q1HA 2FX0A 4RGUA 1MW7A 3DKWA 2HI3A 3CCRI 2DMUA 3G1MA 4QPQA 4UUVA 4UUTA 2HXIA 2NVUB 3RI4A 5FLVA 4L9VA 1WJCA 1ULYA 2LSOA 4A3EJ 1K4TA 3FMQA 4X1EA 2H8RA 1ERDA 1XX5A 4U88A 1IGNA 3RYRA 2K9SA 1OFCX 1S7EA 3PUBA 2R7OA 4IOAF 2KDZA 3S3MA 2LYCA 2W7NA 1A04A 2BZTA 5H6RA 1P6RA 2MC4A 2FA5A 3RJPA 3KEYA 4A5NA 5K5QA 2F5EA 5EJCA 1K79A 3TP3A 1IC8A 2F4IA 4XNFA 3WHBA 1BL0A 3OY9A 3OR1C 2R7WA 2DO7A 1D3YA 2F5CA 2VI6A 3I64A 4N4OB 4XRFA 4BE0A 4KT6A 1T8IA 2OU2A 2JZYA 2IXSA 2Y30A 2P6SA 2OD5A 4IHVA 1VF9A 3HZJA 1JHFA 3H5NA 2NVQJ 2AQEA 3CCQI 4KYWA 2W85A 5EZGA 1RR8C 2R5YB 5JHFA 3K70C 1UHSA 2W25A 4PCQA 1R71A 2ELJA 2R7XA 2R5YA 2MLKA 3H3VK 4CYCA 5J1UA 1Y0NA 2ZJPF 3ABLH 3E6MA 1MBJA 5A2QZ 4JOMA 4B43A 2R7ZJ 2XAHA 4P96A 3PJRA 4BS9A 2VQLA 3I9V2 2BBYA 3SJMA 2DA4A 2VBWA 1YX5A 1REPC 4IQJA 2BY1A 4N9HA 2FOKA 2DMNA 1VQ6I 1XGSA 4XK4A 3HSRA 1OR7A 1U9OA 1XN7A 5EF6A 4V2GA 3RPUA 3ABTA 3I5UA 2V1UA 4EATA 2ZB9A 2LD5A 3JCUC 5E3MA 3Q0VA 4BL0B 3G3ZA 1J2XA 3SHFA 1QVUA 3CMYA 1VZ0A 2RN7A 1MDMB 4WF2A 2C6YA 3BR3A 4JP0A 2PMZA 1SC7A 2QENA 4CHUA 3L00A 1ZRCA 4IXAA 3ZPLA 1VQ9I 1S72I 1KYWA 1MDMA 2JT1A 2VQHA 3RDIA 4Q47A 2FOWA 1I27A 2K40A 2L01A 3ABKH 3FZVA 2IRFG 1IZ1A 4PZJA 2WWYA 5IP7J 1MH4A 4CCMA 4WXHA 4KFCA 4HW0A 3C7JA
chains in the Genus database with same CATH topology
3Q0WA 1ZR4A 3GTLJ 3LSGA 1SANA 3BG3A 4B4CA 4D7NA 4A3CJ 3L1PA 5IYBJ 1GDTA 3HGGA 1P7IA 1TWAJ 3DEWA 2R93J 2LLKA 3LSRA 3LSPA 3ZQIA 2JJ7A 1MSEC 1JT0A 2WV1A 5C4XJ 2CUEA 1WI3A 4BBRJ 4DW6A 1Y1WJ 3A02A 3M4OJ 3CDLA 2JA6J 1RESA 3BTCA 1GUUA 4I76A 2DJNA 1ITYA 4J19A 2FD5A 5E3OA 2DA2A 5E3LA 3S2HJ 1JJ8C 1XS9A 3FK7A 2L9RA 1ZGWA 2JA8J 1BA5A 2WAQN 2VUMJ 1JTXA 1FTTA 4FISA 3A01B 2HOTA 1WCMJ 4A69C 2CRGA 2TRTA 4M3DA 1HOMA 1NK3P 1OJLA 3HKZN 1H8AC 3ZQCA 3A01A 1IUFA 4DZPA 4DZJA 5M3MJ 1AKHB 2XGDA 3GTJJ 1T33A 2B63J 2HXOA 3JRAA 2HYJA 2MW8A 2ME0A 1MBGA 5GP9A 1JUSA 4BBSJ 3OIOA 1MNMC 3GTMJ 2GM4A 1O4XA 2XGCA 3TW7A 4LOCA 4CYCB 1GT0C 2JA7J 1ETOA 2E2IJ 1XG1A 2GLOA 2CJJA 4JYKA 2ID6A 1ORKA 1T56A 1JKRC 2CU7A 3HM5A 2OF7A 3BG9A 1TWGJ 5EZHA 1TC3C 1JT6A 1R9TJ 2R0QC 3RKQA 1LE8B 1YRNB 2EZIA 5FJ8J 4FCYA 1ENHA 1F36A 1UMQA 2EZKA 3JRBA 4V2FA 3I4NJ 3S2DJ 2R92J 3HOUJ 1LE8A 5EG0B 2O8KA 3JRIA 1YRNA 3HBLA 1HCRA 1X2NA 2ECCA 2ECBA 2MG4A 5EG0A 1MSFC 3D1NI 4IHYA 3S17J 3G1LA 2Y0SN 1MBFA 1IG7A 4IHWA 3BQZA 2Y9ZA 4C3IJ 4XRSG 3B6CA 1FJLA 1TWHJ 4FTHA 2AHQA 4A3BJ 3BR0A 3QQAA 3G1OA 1UG2A 5DS9A 5M5XJ 1E3OC 2JMWA 3Q3SA 2X9DA 2OPTA 2XB0X 4JX5A 5F27A 1DU0A 1BW5A 2HOSA 3BT9A 2NS7A 1POGA 3Q0UA 4A3DJ 3FISA 1FTZA 2E19A 4X6AJ 2MGQA 3QPSA 2E1OA 1ETXA 2VKVA 4C3HJ 4IHXA 1B8IB 2LP0A 5IP6A 1IJWC 2ELKA 2XPVA 4A3JJ 4NDLA 5EYRA 1B8IA 2QCOA 1APLC 1K61A 4A3KJ 3IH3A 2L7ZA 4D5FA 1IV6A 1IDZA 3OOUA 3FK6A 2LTPA 2XPUA 4Y52J 1RPWA 4D7MA 1U78A 2E2HJ 1TWFJ 1X2MA 3LSJA 1ETWA 4XRMA 3M3YJ 2EBIA 1I6HJ 9ANTA 2EZLA 1AU7A 5EDNA 1JKQC 4JX4A 4AC0A 3WHCA 2MSYA 3B6AA 1U8BA 1G2HA 4S0HB 2DTZA 2P81A 3S1QJ 4M3FA 3HOXJ 4AYBN 5F1JA 1HF0A 2IBDA 2M8GX 2LKXA 1AHDP 3BTIA 4M3BA 5IPAA 3S14J 4A3MJ 1DU6A 5K7HA 1JJ6C 2D5VA 2HDDA 3W6VA 4L5EA 1ZK8A 3TEDA 1HDDC 2EH3A 2YUSA 1B72B 3S1NJ 4A3GJ 5M5WJ 5FKLA 3LOCA 2JK3A 1BW6A 1B72A 1IDYA 2TCTA 2NOGA 1JUMA 1RETA 3JRDA 2M34A 1WGXA 3BR6A 5F0HA 3E7LA 3RQIA 4RBOA 3PM1A 2XRLA 2L7MP 2YS9A 1WPKA 3JRCA 4A3LJ 1XC5A 4C3JJ 2CQXA 2YU9J 3GTGJ 2NVYJ 1ETKA 4HNVA 5IYCJ 3GTPJ 2JN6A 3HEFA 3SFIA 2EZHA 1NK2P 1VI0A 3GTOJ 1JUPA 4G12A 3VPRA 5M3FJ 4W97A 4MFEA 1ZKGA 5JLXA 4MIMA 4B3AA 4A3IJ 3OSGA 1LFUP 1SFOJ 3FKIJ 2DMPA 3GTQJ 5J1RA 2HOAA 2I10A 3JRFA 3ZQHA 1ZR2A 2H1KA 3O8GA 3F0CA 4BY1J 5F04A 1Z77A 1I3QJ 3BG5A 4MFDA 1X58A 5IOZA 5E3NA 3HGYA 1WH5A 2O7OA 1RKWA 3BR5A 3CCYA 3BTJA 3HDDA 2ID3A 1NTCA 3TP0A 3JR9A 3JREA 1W0UA 2DA3A 5EEAA 3BR2A 3S1RJ 2AO9A 1MBHA 1P7JA 1H88C 5FKMA 5BNGA 1FIAA 2R5ZA 1A5JA 5M5YJ 3NARA 1W0TA 4XIDA 4FE4A 1WH7A 3ZOBA 3PO2J 5GPAA 1D5YA 2JA5J 2LVSA 3IH4A 3O8HA 5HODA 5C4JJ 2PMZN 1VNDA 5C44J 3HOZJ 2NS8A 2L0KA 2DA7A 1ETVA 2G0EA 5EGOB 1ETQA 4C2MJ 4M3EA 2M0CA 1U9NA 1IRZA 2L7FP 5K7FA 5EGOA 2VPRA 1QVTA 3GTKJ 2XB5A 1Y1VJ 1GVDA 3MN2A 3OSFA 4BKXA 5FKNA 1OCPA 3S15J 4MO7A 4Y7NJ 3ZQFA 2XGEA 1JTYA 3HOVJ 2M9HA 4DYQA 1FEXA 4UUSB 1I50J 4FE7A 4DYRA 3MKLA 4D5CA 1PUFA 2LR8A 3CQZJ 4BXXJ 2JWTA 4UUSA 1A6IA 1HDPA 3MVPA 2LY9A 4M6VA 4B1RA 2GBYA 2FX0A 2X48A 2X6OA 2HI3A 1RKTA 2W48A 1CQTA 2DMUA 1JGGA 3G1MA 3RZDJ 1LFBA 2HXIA 4UUTA 5FLVA 2KT0A 2LFBA 4A3EJ 4X1EA 3HOWJ 2H8RA 1QRYA 3K2AA 4W1UA 3UKGA 2XPWA 5J3LA 1IGNA 4QIWN 5IYDJ 2K9SA 2EQRA 1OFCX 1S7EA 3ZQGA 3I4MJ 2KDZA 3C2BA 1Q1VA 3BQYA 5DTDA 2LK2A 5FLMJ 4QTRA 2XSDC 3JRGA 3NAUA 1RR7A 3K7AJ 4A93J 3TP3A 2RAEA 1IC8A 2DA1A 1BL0A 3WHBA 1MBKA 1F43A 2Y2ZA 2FJ1A 3QPLA 4EEFG 1VFCA 2VI6A 1EF4A 2NVTJ 4RDUA 2NVXJ 4M3GA 5JLWA 4DYCA 1GV5A 2Y30A 2ME6A 4BY7J 1AKHA 5C3EJ 1VF9A 4IHVA 2M2EA 4MLOA 5FKOA 1ZTRA 2DMTA 2COBA 5J1YA 2NVQJ 3A03A 3IV5A 5EZGA 4XRSA 2R5YB 1UHSA 3BTLA 3RZOJ 3JRHA 2R5YA 2HQ5A 1Z0XA 2N8GA 4CYCA 3H3VK 5J1UA 3LNQA 3H0GJ 4IEJA 1HLVA 4GFBA 1MBJA 3S1MJ 2R7ZJ 2DN0A 1GV2A 3SJMA 2DA4A 1BJZA 2DA6A 5K7ZA 1ETYA 1ZQ3P 2R5ZB 3S16J 2DMNA 2CUFA 4A3FJ 4XK4A 1OCTC 1U9OA 3BR1A 5EF6A 4V2GA 5F0FA 4ABZA 2QF7A 1MH3A 4JX6A 4I6ZA 2K9QA 2WB1N 2ZB9A 1K83J 2LD5A 2O9LA 3DCFA 2IEKA 5E3MA 3IH2A 3SDGA 3Q0VA 3FIWA 4QSHA 2IAIA 5GPCA 3HOYJ 4XICA 3CMYA 2DMQA 1QVUA 2Y9YA 3PO3J 2VKEA 3ZQLA 3BR3A 4JP0A 3TW6A 5IP9J 1JKOC 4AUXA 1QPIA 1TWCJ 2E2JJ 1MBEA 5F08A 5FKKA 2K9NA 2FQ4A 3HB9A 1JKPC 2K40A 5IP7J 1H89C 1MH4A 2Y31A 1PUFB 2CQQA 5F0CA 3GBGA 2DA5A 5IOYA 1FIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0W A;  1ZR4 A;  3GTL J;  3LSG A;  1SAN A;  3BG3 A;  4B4C A;  4D7N A;  4A3C J;  3L1P A;  5IYB J;  1GDT A;  3HGG A;  1P7I A;  1TWA J;  3DEW A;  2R93 J;  2LLK A;  3LSR A;  3LSP A;  3ZQI A;  2JJ7 A;  1MSE C;  1JT0 A;  2WV1 A;  5C4X J;  2CUE A;  1WI3 A;  4BBR J;  4DW6 A;  1Y1W J;  3A02 A;  3M4O J;  3CDL A;  2JA6 J;  1RES A;  3BTC A;  1GUU A;  4I76 A;  2DJN A;  1ITY A;  4J19 A;  2FD5 A;  5E3O A;  2DA2 A;  5E3L A;  3S2H J;  1JJ8 C;  1XS9 A;  3FK7 A;  2L9R A;  1ZGW A;  2JA8 J;  1BA5 A;  2WAQ N;  2VUM J;  1JTX A;  1FTT A;  4FIS A;  3A01 B;  2HOT A;  1WCM J;  4A69 C;  2CRG A;  2TRT A;  4M3D A;  1HOM A;  1NK3 P;  1OJL A;  3HKZ N;  1H8A C;  3ZQC A;  3A01 A;  1IUF A;  4DZP A;  4DZJ A;  5M3M J;  1AKH B;  2XGD A;  3GTJ J;  1T33 A;  2B63 J;  2HXO A;  3JRA A;  2HYJ A;  2MW8 A;  2ME0 A;  1MBG A;  5GP9 A;  1JUS A;  4BBS J;  3OIO A;  1MNM C;  3GTM J;  2GM4 A;  1O4X A;  2XGC A;  3TW7 A;  4LOC A;  4CYC B;  1GT0 C;  2JA7 J;  1ETO A;  2E2I J;  1XG1 A;  2GLO A;  2CJJ A;  4JYK A;  2ID6 A;  1ORK A;  1T56 A;  1JKR C;  2CU7 A;  3HM5 A;  2OF7 A;  3BG9 A;  1TWG J;  5EZH A;  1TC3 C;  1JT6 A;  1R9T J;  2R0Q C;  3RKQ A;  1LE8 B;  1YRN B;  2EZI A;  5FJ8 J;  4FCY A;  1ENH A;  1F36 A;  1UMQ A;  2EZK A;  3JRB A;  4V2F A;  3I4N J;  3S2D J;  2R92 J;  3HOU J;  1LE8 A;  5EG0 B;  2O8K A;  3JRI A;  1YRN A;  3HBL A;  1HCR A;  1X2N A;  2ECC A;  2ECB A;  2MG4 A;  5EG0 A;  1MSF C;  3D1N I;  4IHY A;  3S17 J;  3G1L A;  2Y0S N;  1MBF A;  1IG7 A;  4IHW A;  3BQZ A;  2Y9Z A;  4C3I J;  4XRS G;  3B6C A;  1FJL A;  1TWH J;  4FTH A;  2AHQ A;  4A3B J;  3BR0 A;  3QQA A;  3G1O A;  1UG2 A;  5DS9 A;  5M5X J;  1E3O C;  2JMW A;  3Q3S A;  2X9D A;  2OPT A;  2XB0 X;  4JX5 A;  5F27 A;  1DU0 A;  1BW5 A;  2HOS A;  3BT9 A;  2NS7 A;  1POG A;  3Q0U A;  4A3D J;  3FIS A;  1FTZ A;  2E19 A;  4X6A J;  2MGQ A;  3QPS A;  2E1O A;  1ETX A;  2VKV A;  4C3H J;  4IHX A;  1B8I B;  2LP0 A;  5IP6 A;  1IJW C;  2ELK A;  2XPV A;  4A3J J;  4NDL A;  5EYR A;  1B8I A;  2QCO A;  1APL C;  1K61 A;  4A3K J;  3IH3 A;  2L7Z A;  4D5F A;  1IV6 A;  1IDZ A;  3OOU A;  3FK6 A;  2LTP A;  2XPU A;  4Y52 J;  1RPW A;  4D7M A;  1U78 A;  2E2H J;  1TWF J;  1X2M A;  3LSJ A;  1ETW A;  4XRM A;  3M3Y J;  2EBI A;  1I6H J;  9ANT A;  2EZL A;  1AU7 A;  5EDN A;  1JKQ C;  4JX4 A;  4AC0 A;  3WHC A;  2MSY A;  3B6A A;  1U8B A;  1G2H A;  4S0H B;  2DTZ A;  2P81 A;  3S1Q J;  4M3F A;  3HOX J;  4AYB N;  5F1J A;  1HF0 A;  2IBD A;  2M8G X;  2LKX A;  1AHD P;  3BTI A;  4M3B A;  5IPA A;  3S14 J;  4A3M J;  1DU6 A;  5K7H A;  1JJ6 C;  2D5V A;  2HDD A;  3W6V A;  4L5E A;  1ZK8 A;  3TED A;  1HDD C;  2EH3 A;  2YUS A;  1B72 B;  3S1N J;  4A3G J;  5M5W J;  5FKL A;  3LOC A;  2JK3 A;  1BW6 A;  1B72 A;  1IDY A;  2TCT A;  2NOG A;  1JUM A;  1RET A;  3JRD A;  2M34 A;  1WGX A;  3BR6 A;  5F0H A;  3E7L A;  3RQI A;  4RBO A;  3PM1 A;  2XRL A;  2L7M P;  2YS9 A;  1WPK A;  3JRC A;  4A3L J;  1XC5 A;  4C3J J;  2CQX A;  2YU9 J;  3GTG J;  2NVY J;  1ETK A;  4HNV A;  5IYC J;  3GTP J;  2JN6 A;  3HEF A;  3SFI A;  2EZH A;  1NK2 P;  1VI0 A;  3GTO J;  1JUP A;  4G12 A;  3VPR A;  5M3F J;  4W97 A;  4MFE A;  1ZKG A;  5JLX A;  4MIM A;  4B3A A;  4A3I J;  3OSG A;  1LFU P;  1SFO J;  3FKI J;  2DMP A;  3GTQ J;  5J1R A;  2HOA A;  2I10 A;  3JRF A;  3ZQH A;  1ZR2 A;  2H1K A;  3O8G A;  3F0C A;  4BY1 J;  5F04 A;  1Z77 A;  1I3Q J;  3BG5 A;  4MFD A;  1X58 A;  5IOZ A;  5E3N A;  3HGY A;  1WH5 A;  2O7O A;  1RKW A;  3BR5 A;  3CCY A;  3BTJ A;  3HDD A;  2ID3 A;  1NTC A;  3TP0 A;  3JR9 A;  3JRE A;  1W0U A;  2DA3 A;  5EEA A;  3BR2 A;  3S1R J;  2AO9 A;  1MBH A;  1P7J A;  1H88 C;  5FKM A;  5BNG A;  1FIA A;  2R5Z A;  1A5J A;  5M5Y J;  3NAR A;  1W0T A;  4XID A;  4FE4 A;  1WH7 A;  3ZOB A;  3PO2 J;  5GPA A;  1D5Y A;  2JA5 J;  2LVS A;  3IH4 A;  3O8H A;  5HOD A;  5C4J J;  2PMZ N;  1VND A;  5C44 J;  3HOZ J;  2NS8 A;  2L0K A;  2DA7 A;  1ETV A;  2G0E A;  5EGO B;  1ETQ A;  4C2M J;  4M3E A;  2M0C A;  1U9N A;  1IRZ A;  2L7F P;  5K7F A;  5EGO A;  2VPR A;  1QVT A;  3GTK J;  2XB5 A;  1Y1V J;  1GVD A;  3MN2 A;  3OSF A;  4BKX A;  5FKN A;  1OCP A;  3S15 J;  4MO7 A;  4Y7N J;  3ZQF A;  2XGE A;  1JTY A;  3HOV J;  2M9H A;  4DYQ A;  1FEX A;  4UUS B;  1I50 J;  4FE7 A;  4DYR A;  3MKL A;  4D5C A;  1PUF A;  2LR8 A;  3CQZ J;  4BXX J;  2JWT A;  4UUS A;  1A6I A;  1HDP A;  3MVP A;  2LY9 A;  4M6V A;  4B1R A;  2GBY A;  2FX0 A;  2X48 A;  2X6O A;  2HI3 A;  1RKT A;  2W48 A;  1CQT A;  2DMU A;  1JGG A;  3G1M A;  3RZD J;  1LFB A;  2HXI A;  4UUT A;  5FLV A;  2KT0 A;  2LFB A;  4A3E J;  4X1E A;  3HOW J;  2H8R A;  1QRY A;  3K2A A;  4W1U A;  3UKG A;  2XPW A;  5J3L A;  1IGN A;  4QIW N;  5IYD J;  2K9S A;  2EQR A;  1OFC X;  1S7E A;  3ZQG A;  3I4M J;  2KDZ A;  3C2B A;  1Q1V A;  3BQY A;  5DTD A;  2LK2 A;  5FLM J;  4QTR A;  2XSD C;  3JRG A;  3NAU A;  1RR7 A;  3K7A J;  4A93 J;  3TP3 A;  2RAE A;  1IC8 A;  2DA1 A;  1BL0 A;  3WHB A;  1MBK A;  1F43 A;  2Y2Z A;  2FJ1 A;  3QPL A;  4EEF G;  1VFC A;  2VI6 A;  1EF4 A;  2NVT J;  4RDU A;  2NVX J;  4M3G A;  5JLW A;  4DYC A;  1GV5 A;  2Y30 A;  2ME6 A;  4BY7 J;  1AKH A;  5C3E J;  1VF9 A;  4IHV A;  2M2E A;  4MLO A;  5FKO A;  1ZTR A;  2DMT A;  2COB A;  5J1Y A;  2NVQ J;  3A03 A;  3IV5 A;  5EZG A;  4XRS A;  2R5Y B;  1UHS A;  3BTL A;  3RZO J;  3JRH A;  2R5Y A;  2HQ5 A;  1Z0X A;  2N8G A;  4CYC A;  3H3V K;  5J1U A;  3LNQ A;  3H0G J;  4IEJ A;  1HLV A;  4GFB A;  1MBJ A;  3S1M J;  2R7Z J;  2DN0 A;  1GV2 A;  3SJM A;  2DA4 A;  1BJZ A;  2DA6 A;  5K7Z A;  1ETY A;  1ZQ3 P;  2R5Z B;  3S16 J;  2DMN A;  2CUF A;  4A3F J;  4XK4 A;  1OCT C;  1U9O A;  3BR1 A;  5EF6 A;  4V2G A;  5F0F A;  4ABZ A;  2QF7 A;  1MH3 A;  4JX6 A;  4I6Z A;  2K9Q A;  2WB1 N;  2ZB9 A;  1K83 J;  2LD5 A;  2O9L A;  3DCF A;  2IEK A;  5E3M A;  3IH2 A;  3SDG A;  3Q0V A;  3FIW A;  4QSH A;  2IAI A;  5GPC A;  3HOY J;  4XIC A;  3CMY A;  2DMQ A;  1QVU A;  2Y9Y A;  3PO3 J;  2VKE A;  3ZQL A;  3BR3 A;  4JP0 A;  3TW6 A;  5IP9 J;  1JKO C;  4AUX A;  1QPI A;  1TWC J;  2E2J J;  1MBE A;  5F08 A;  5FKK A;  2K9N A;  2FQ4 A;  3HB9 A;  1JKP C;  2K40 A;  5IP7 J;  1H89 C;  1MH4 A;  2Y31 A;  1PUF B;  2CQQ A;  5F0C A;  3GBG A;  2DA5 A;  5IOY A;  1FIP A; 
#chains in the Genus database with same CATH topology
 2EIK H;  1X1A A;  3I71 A;  3OYJ A;  2PI0 A;  1B4A A;  2CO5 A;  3WTV C;  2OV7 A;  4B48 A;  4A3C J;  4PFO A;  2QBY B;  1ODD A;  2EPF A;  4LB6 B;  1UJ8 A;  2MA3 A;  2HR3 A;  3LSR A;  4L9N A;  3LSP A;  4XLF A;  3Q5F A;  4Z6Y A;  1V3F A;  2QBY A;  2V4J C;  4XSZ F;  1FC3 A;  1W5C C;  5C4X J;  4FX0 A;  1K7A A;  3M4O J;  4IO9 F;  3CDL A;  4KA4 A;  1LJ9 A;  1T0F A;  2ZCW A;  1FSE A;  2EWN A;  3CUO A;  1VQ8 I;  1DPU A;  3KYL A;  4J19 A;  3IWF A;  3WE3 A;  4Y17 A;  1JJ8 C;  3PNT A;  2YX4 A;  3LAJ A;  1YFH A;  2X6W A;  1XS9 A;  1S3J A;  2L9R A;  3MKZ A;  4UHT A;  1R5H A;  4KIG A;  2CSO A;  1JTX A;  4XKV A;  4MQ9 F;  1WCM J;  3OYD A;  2D1H A;  4M3D A;  4RM3 A;  2FML A;  1UAA A;  3ZQ7 A;  3ZQC A;  3ZMU A;  3A2K A;  4DNC A;  2OJE D;  3J7Z I;  1AKH B;  2BY0 A;  2XGD A;  3JTH A;  2HKO A;  2KRC A;  2Y48 A;  3KFW X;  1FZP B;  1V4R A;  2BE5 F;  2D2W A;  3DKY A;  2KIU A;  3WTY C;  2E1M B;  1F9N A;  4C2T A;  2GXG A;  3REO A;  2HYJ A;  2HPM A;  2VIX A;  2L9S A;  2ME0 A;  3FXL A;  1JUS A;  2BV6 A;  2DT5 A;  3K0L A;  3OIO A;  4HX8 A;  2Q8K A;  3HXL A;  3VEP A;  3S8P A;  3GTM J;  2EIJ H;  3L2C A;  3TW7 A;  4LOC A;  1LFP A;  1GT0 C;  2CG4 A;  5HDG A;  4HV6 A;  1T0F C;  3R60 A;  2ID6 A;  3HM5 A;  4PJL A;  1FOX A;  2WAE A;  5EZH A;  1JT6 A;  4CYD A;  3KLN A;  2PJR B;  2DQL A;  5ICG A;  2KMU A;  2VXD A;  3TDZ C;  2M30 A;  3K4J A;  1UZC A;  2Z16 A;  3I59 B;  1FMV A;  4V2F A;  1ONV A;  2O6G E;  3S2D J;  3HOU J;  4GO1 A;  2PJR A;  1MMS A;  3CCL I;  3CME I;  4DQ2 A;  2KL4 A;  3TOB A;  2ECB A;  3TDU C;  2QA4 I;  4ENK A;  1VQO I;  4C9Y A;  2ZKZ A;  3DLL F;  3CP8 A;  3ZP5 A;  3S17 J;  3PUF A;  3BJ6 A;  2Y9Z A;  2R7U A;  3AFH A;  4FTH A;  3BR0 A;  4BAY A;  1DDN A;  2L02 A;  1ON1 A;  4F3Q A;  5M5X J;  1I5Z A;  3WTW C;  2XHK A;  2M1B A;  1Z9C A;  1HW5 A;  3F8C A;  1EKE A;  3FHN A;  1DU0 A;  1D0Y A;  2B9S A;  2BVM A;  3BT9 A;  3F23 A;  2E1M C;  4XN0 A;  3J7A Y;  4A3D J;  3LSM A;  4PGH A;  2E19 A;  4X6A J;  3CDH A;  3QU3 A;  4ZH4 F;  4RB2 C;  5LEK A;  3K6G A;  4RB0 A;  2DOA A;  2VKV A;  1YW9 A;  2VE9 A;  1K78 B;  4IHX A;  1D8K A;  4RB3 C;  1STZ A;  4BQA A;  4XL9 A;  5LHH A;  1DGW Y;  4WX9 A;  1SAX A;  1R36 A;  1K78 A;  3CO7 C;  4A3J J;  1PDN C;  3K4N A;  2CFO A;  4XQF A;  3ZN0 A;  1J7K A;  2NAZ A;  3EDP A;  4A3K J;  1X3W B;  3GLL A;  2KQR A;  5JFR A;  2M87 A;  3VOE A;  2HVS A;  3OOU A;  5HS7 A;  3FK6 A;  4HAM A;  5H6Q A;  2LTP A;  2P5V A;  5HNF A;  2JVG A;  4PSX A;  3V7S A;  1YW7 A;  4D7M A;  4ESF A;  3OYB A;  4O3M A;  1MMG A;  1IRX A;  4E7K A;  2NOJ B;  2XAQ A;  2YR2 A;  3F9K A;  5EDN A;  1E3P A;  2OTL I;  1JKQ C;  2W84 A;  1B9M A;  4D9J A;  4FX4 A;  4Y13 A;  3CF5 F;  2XAJ A;  2MSY A;  4QPO A;  1J0R A;  1U8B A;  4HDV A;  3B73 A;  1L3L A;  2P81 A;  3NQO A;  2K4B A;  1KU2 A;  1VQL I;  5F1J A;  1P9Q C;  3IRR A;  4G7O F;  2QSH X;  2GZW A;  1QNT A;  2VJ5 A;  2R7F A;  1AHD P;  2L9V A;  5FO5 A;  4U0Y A;  2ELH A;  2K3F A;  4Y15 A;  3TGN A;  4XLE A;  3QYB A;  3ERE D;  1J9I A;  3S14 J;  5GAH J;  2M4K A;  4L5E A;  3TED A;  2CQ7 A;  3T0Y A;  2QKL B;  3E6D A;  2H1L A;  4U0W A;  2PJP A;  3PFY A;  1TLH B;  3EYI A;  2JK3 A;  2QQB A;  4HX7 A;  3L9F A;  1FLI A;  2MD0 A;  4BE2 A;  4HA8 A;  2VT2 A;  2NOG A;  3ZMS A;  1RET A;  4CGZ A;  1WGX A;  2KIF A;  3BR6 A;  2BXZ A;  2OCC H;  5F0H A;  4NB5 A;  1ZGJ A;  1WZ2 A;  2DBB A;  5J8C A;  5LHI A;  1LKX A;  4CCK A;  4C3J J;  4NC7 A;  4BQQ A;  2YU9 J;  2GOX B;  2RNJ A;  1W36 D;  2NVY J;  1NH3 A;  5HS8 A;  1ETK A;  1ZEL A;  3PFI A;  3ONQ A;  5D8K B;  1XSX A;  2MH9 A;  4HNV A;  4DBR A;  5IYC J;  5DUK A;  2JN6 A;  1LNW A;  3M1E A;  1VI0 A;  1KU3 A;  4H4K C;  1JUP A;  1ZKG A;  3ASO H;  1LFU P;  1FYM A;  4U7D A;  4XKW A;  4EGZ A;  3COA C;  3GTQ J;  1MNE A;  3JRF A;  1D0X A;  3SQN A;  1S9H A;  1UHM A;  1Z77 A;  3OL3 A;  1U8R A;  4MFD A;  1RC9 A;  3JSO A;  3BLY A;  1WH5 A;  5EEG A;  1U3E M;  5LRR A;  3BR5 A;  1V55 H;  2EFW A;  2CGP A;  4XLH A;  2JPB A;  3F21 A;  3ISP A;  1VQK I;  3SZT A;  1I1S A;  1MBH A;  1TW3 A;  5B1B H;  4KN4 X;  2Z5U A;  4RA2 A;  3S3O A;  3NAR A;  5LLQ A;  2O8X A;  3DEU A;  2EB7 A;  3HRM A;  4FE4 A;  3H5R A;  1WH7 A;  4M6X A;  3GX4 X;  1IO2 A;  3DBL B;  5FRM A;  2MYS A;  2LVS A;  1WWX A;  5HOD A;  2NNY A;  1VTN C;  3VOD A;  2GXB A;  5C4J J;  2DFI A;  3HOZ J;  1X1B A;  1T2K A;  4B47 A;  2VC0 A;  3ZMD A;  1ZLK A;  1ETV A;  2G0E A;  1EH7 A;  2QQ8 A;  2E5Z A;  5EGO B;  1ETQ A;  4C2M J;  4FAS D;  2MLG A;  2XAF A;  2L7F P;  4AVP A;  1V5F A;  1VQM I;  5EGO A;  1KQ0 A;  1W7P D;  1QVT A;  3GTK J;  1SD4 A;  2HTS A;  2M5W A;  3MN2 A;  4I02 A;  1WJE A;  1E2X A;  3I53 A;  4ZYA A;  1QO0 D;  3IRQ A;  4OAY A;  4A2U A;  2WY8 Q;  4DOZ A;  1OCP A;  4I09 A;  1YIT I;  2CH0 A;  1KA8 A;  5DYM A;  4LB5 A;  2F2E A;  2VQC A;  4DYQ A;  2AXL A;  5ILV A;  4FE7 A;  4DYR A;  3MKL A;  4MGR A;  1PUF A;  2RQP A;  4BXX J;  1G3Y A;  1OLT A;  5JI6 A;  2L4A A;  1YW8 A;  5FB2 A;  2LY9 A;  2YSR A;  1CGP A;  2R7D A;  1DUX C;  2GBY A;  3R61 A;  2VN2 A;  3I58 A;  2X48 A;  3D0S A;  2X6O A;  2VL8 A;  2W48 A;  1YI2 I;  3MEX A;  1CQT A;  3FXK A;  1JGG A;  2HYG D;  2ZXH A;  1LFB A;  3V8L A;  2P0W A;  4LIV A;  2A07 F;  3ZQQ A;  5CVI A;  5L3E A;  1PUE E;  3BWG A;  1IN5 A;  2XPW A;  4W1U A;  5J3L A;  3UKG A;  2DFF A;  2IA1 A;  5D6F A;  2A68 F;  2BW3 B;  5ERI A;  3WTU C;  2R7V A;  5IYD J;  3ZQG A;  1MMN A;  2CQN A;  1SD5 A;  2BW3 A;  4HF0 A;  5FLM J;  1OCC H;  3QP5 A;  3DFG A;  1LPQ A;  3ZGK A;  5CJ9 A;  4ZTJ A;  4CXF A;  3K7A J;  4A93 J;  4AU7 A;  4OWR B;  1YLF A;  1MBK A;  2Y2Z A;  2F5D A;  4F91 B;  1TT5 B;  2E35 A;  2FNA A;  4RDU A;  1ON2 A;  4HDU A;  5F1R A;  5E8I A;  3U2R A;  4E6K G;  2LOO A;  3F8M A;  2EV6 A;  1IAW A;  2GA1 A;  1ZTR A;  3CTA A;  2DMT A;  2COB A;  2DAO A;  3A03 A;  1HST A;  2CW8 A;  4E4H A;  4XRS A;  1YIJ I;  2H6B A;  2K85 A;  3FX3 A;  3MCZ A;  2E1C A;  3L2R A;  3EQL F;  3JTG A;  3CCE I;  4EJU A;  2HQ5 A;  1Z0X A;  3B02 A;  2DA5 A;  3FXO A;  3H5A A;  3M8F A;  2R7S A;  5KNL A;  1LDD A;  3EUK L;  4IEJ A;  3MZ8 A;  1W1W E;  5BS6 A;  3DQV C;  4BJ6 C;  2DQR A;  3FMR A;  4M6Y A;  3BP8 A;  3KEQ A;  2DA6 A;  4WK8 F;  2E60 A;  1ZQ3 P;  3H9G A;  2R5Z B;  4E7I A;  3S16 J;  4CZZ A;  4CCN A;  3U9G A;  2DK8 A;  2CUF A;  3DP7 A;  2OQR A;  4A3F J;  3RSN A;  1MMD A;  1DPR A;  3S93 A;  1QPM A;  5D4S A;  5IT3 A;  5JR3 A;  3P9K A;  2JPC A;  4M73 A;  2O9L A;  3DCF A;  5KAI C;  2IEK A;  3K4C A;  3T8R A;  3SDG A;  3LWF A;  2V9K A;  2WB1 A;  4OU0 A;  3AG4 H;  1UST A;  3HOY J;  3WU0 A;  1V5E A;  4BXF A;  2DMQ A;  2JVH A;  3W2A A;  4R79 A;  1BR4 A;  2M0M A;  4AIH A;  1S29 A;  2V6E A;  2VB6 A;  3HRS A;  5IP9 J;  1OMI A;  4OMY A;  1QPI A;  1TWC J;  2WAD A;  1LVK A;  2IGN A;  5BOX A;  1K6O A;  5IT9 Z;  2XSJ C;  4RGS A;  3GZN B;  3HTU A;  2DK5 A;  2JQ7 A;  1BR2 A;  1Y8Q B;  4DIQ A;  3GO5 A;  1Y56 A;  1RIO H;  1FBQ A;  2CV1 A;  3R0J A;  3HPH A;  5E1Z B;  4G9Y A;  1TTY A;  3E6C C;  4P9U A;  2K4J A;  2Y31 A;  5CPR B;  5L3F A;  5FLX K;  3K1P A;  2CQQ A;  2O03 A;  5F0C A;  3WU2 C;  5IOY A;  4PGG A;  1FIP A;  3GTO J;  2KIS A;  2OAZ A;  4BQO A;  3Q0W A;  3K1M A;  1SAN A;  1RUO A;  1RUN A;  2VKD A;  3L1P A;  3HGG A;  3OYI A;  3HIF A;  1IXS B;  1P7I A;  1TWA J;  3CF2 A;  4JQF A;  3BDD A;  4A6D A;  3ABM H;  3KLO A;  3SZP A;  1JT0 A;  3QYE A;  2CUE A;  1WI3 A;  3VFZ A;  2I5U A;  3W3C A;  4BHC A;  4BBR J;  4XKB A;  2FUG 2;  4S04 A;  3H3U A;  4G7H F;  2LF8 A;  4IPA A;  4A0Z A;  5JVT A;  2KFD A;  1RES A;  3RYP A;  2JA6 J;  1WJA A;  3BJO A;  1S7A A;  3VWB A;  4V19 K;  2HS5 A;  2XAU A;  3M9A A;  4IZZ A;  2ZME A;  3S2H J;  1X4O A;  3OMY A;  1ZGW A;  1BA5 A;  2H27 A;  3HC7 A;  3MMY B;  1QA6 A;  4WWC A;  2WTE A;  4UV9 A;  4MEX F;  1P92 A;  1FTT A;  2F5V A;  1HOM A;  2XV4 S;  2WA0 A;  2ISY A;  4CCJ A;  1H8A C;  2HYF A;  1YE9 A;  4DZP A;  1D5V A;  1W4M A;  5KVR A;  2QZ8 A;  2LC2 A;  3S3N A;  2BHZ A;  3PSF A;  3SXY A;  2ACJ A;  2YU3 A;  5FGM A;  4XOR A;  3KYC B;  3JRA A;  3HTS B;  5E17 F;  2HU9 A;  1WJF A;  4BBS J;  3E97 A;  2WY7 Q;  1R58 A;  3IC7 A;  4AWX B;  5CLS A;  3QU6 A;  5CQG A;  4P1W A;  3O3K A;  3DXJ F;  4CYC B;  2JA7 J;  4IRH A;  2E2I J;  1SD6 A;  1OCR H;  4ENJ A;  2ZXW H;  3KE2 A;  4JYK A;  1ORK A;  5LRS A;  1RZ4 A;  3D5L A;  1T56 A;  1YOV B;  1KU7 A;  2CU7 A;  3ERM A;  2YPR A;  3BG9 A;  3D5R C;  4CCL A;  1TWG J;  3O6B B;  4ASN A;  3K4K A;  1IUY A;  2R0Q C;  1LE8 B;  2DYR H;  1OQY A;  2CW7 A;  5FJ8 J;  4FCY A;  2OBP A;  1GVJ A;  4IRI A;  2EZK A;  3JRB A;  3I4N J;  2R92 J;  1LE8 A;  5EG0 B;  3JRI A;  1WKM A;  3HBL A;  4RGR A;  2IJL A;  4G7Z F;  3I0T A;  3F8B A;  2V7F A;  1XGM A;  5EG0 A;  5HOO A;  4HNT A;  4IHY A;  2Y0S N;  2DT7 B;  1IG7 A;  3FXM A;  3NRV A;  3JAM K;  4ZYD A;  3SFZ A;  3B6C A;  3CMM A;  3K2Z A;  2AHQ A;  4A3B J;  3G1O A;  3QQA A;  3UNG C;  1HW1 A;  3VSK A;  4DJA A;  1ZRD A;  5DS9 A;  2F6C A;  1IN6 A;  1N75 A;  4BJ5 C;  5E79 C;  5A2Q K;  2VBZ A;  2X9D A;  4E7L A;  5CVU A;  4JX5 A;  3D5S C;  5F27 A;  4RAF A;  2PMH A;  2HOS A;  1Z21 A;  3LA3 A;  3E5X A;  3Q0U A;  3G6E I;  3FIS A;  3GWZ A;  3UR3 C;  1FTZ A;  1V5G A;  2MGQ A;  4IJA A;  1IXR C;  2F4O B;  5LEJ A;  2AS5 F;  1MKM A;  3FM3 A;  1IRF A;  2PBI A;  1ETX A;  2X1D A;  4C3H J;  2QVO A;  5FRN A;  4LLL A;  4IOC F;  3RKY A;  3ML6 A;  1IJW C;  3KP2 A;  2XPV A;  3I56 I;  1UHW A;  2HQA A;  5EYR A;  4OIO F;  2ESH A;  1BI3 A;  2L7Z A;  3P7N A;  3QRF F;  2STW A;  4G6Q A;  3FXR A;  3LA2 A;  2WC2 A;  3OIQ A;  4PK4 A;  2NYX A;  1X3Z B;  2HFH A;  3DTI A;  4II2 A;  1OR7 C;  2K7L A;  5HNH A;  4Q4Z F;  4UNO A;  3CCU I;  2RGV A;  4XRM A;  2X85 A;  2Q0O A;  3QOD A;  4L18 B;  5JVG F;  1WJ5 A;  1YIO A;  2HVR A;  1BN5 A;  2QSF X;  1SMT A;  1P4X A;  1WFX A;  3DV8 A;  2E7W A;  4BJT A;  2PFB A;  2OQG A;  5CVR A;  4HF1 A;  2DTZ A;  4UB6 C;  3GLX A;  3KP4 A;  4KMU X;  3WTS C;  1HF0 A;  3DBH B;  3E6B A;  2ZJR F;  2IBD A;  5HDN A;  3KX2 A;  2HKX A;  3WGH A;  4AYB A;  2DXI A;  2R7Q A;  3LL7 A;  1DU6 A;  1JJ6 C;  2D5V A;  2HDD A;  2NNN A;  4IRG A;  1ZK8 A;  2EFQ A;  4I0B A;  2YUS A;  1LB2 A;  1HBX G;  3S1N J;  5M5W J;  3BZK A;  4EGY A;  3N05 A;  3M8J A;  3LOC A;  1P4A A;  3DEE A;  1XDS A;  1P2F A;  2XF6 A;  3LSI A;  2Q1Z B;  3AG3 H;  2TCT A;  3OWT A;  2EFN A;  4XLA A;  3FXJ A;  3ASN H;  3N4M A;  3ECO A;  4OOI A;  3WTZ A;  4F7Z A;  5E8G A;  3GYH X;  1SVL A;  4ZJZ A;  2X6X A;  2LMD A;  5LBQ A;  1I3A A;  1R49 A;  4Q48 A;  3TKY A;  1QU3 A;  1W5S A;  3PM1 A;  1O3T A;  2R7R A;  2E5N A;  3BOQ A;  1WPK A;  3JRC A;  3L2W A;  4A3L J;  2M45 A;  2CQX A;  1FP2 A;  2K5C A;  5DD4 A;  2QSG X;  4HQM A;  1AA7 A;  4E7Z A;  3K69 A;  1FWZ A;  2GAU A;  2QM3 A;  3MKY B;  1MIJ A;  3HEF A;  1USS A;  2EFO A;  2EZH A;  2GOM A;  2BEO A;  4G12 A;  4GYG A;  5M3F J;  4AM3 A;  1SD7 A;  3CP2 A;  4DBQ A;  4E70 A;  4NQW A;  2KZV A;  3CLO A;  5BQT A;  2JUG A;  3QPT A;  2DYS H;  2HOA A;  3KYD B;  2I10 A;  3ZQH A;  1D1B A;  5DV5 A;  3SEQ A;  4LK0 F;  2MBF A;  2BOL A;  1F5T A;  1FOW A;  1FP1 D;  3OYE A;  2EK5 A;  2KKO A;  1OCZ H;  2RC4 A;  3KP6 A;  5J8F A;  5TJJ A;  4B8X A;  1RKW A;  2Y0S A;  1FNN A;  2K02 A;  5EEH A;  3CCJ I;  1NTC A;  3TP0 A;  3JR9 A;  4LFU A;  2DA3 A;  3U1D A;  3JW4 A;  2GQQ A;  3BR2 A;  2CV0 A;  2D1V A;  3TOA A;  3H35 A;  2ZC2 A;  2VOD A;  1HSJ A;  1P7J A;  1H88 C;  1F1Z A;  1FIA A;  3KIO A;  5M5Y J;  5AON A;  4FHT A;  4XID A;  3ZCO A;  2VON A;  3FDY A;  1R7J A;  3PO2 J;  1Z7U A;  2LG4 A;  3BZC A;  4ZZL A;  3RTR A;  5CKT A;  3A1Y A;  4PJJ A;  3ELK A;  3FXQ A;  4I2O A;  1J75 A;  4UY8 I;  3OYL A;  5C44 J;  3PNV A;  2NS8 A;  2L0K A;  2DPD A;  1C0W A;  3AG2 H;  1YO5 C;  1Y39 A;  2ICW G;  3VSL A;  4XMY A;  3EUH A;  4KN7 X;  1LEA A;  5K1Y A;  2FEZ A;  2O5R A;  2VJI A;  4BEH B;  3CC4 I;  3V7R A;  2K86 A;  3ZRG A;  2VPR A;  2LY1 A;  2XB5 A;  1Y1V J;  4LIU A;  4CIC A;  4BEH A;  3OSF A;  4GDF A;  2UXN A;  4A6E A;  4R8H A;  1H0M A;  3V4G A;  2W4S A;  4NBQ A;  3S15 J;  3LSH A;  3E0J B;  4MO7 A;  4Y7N J;  1T6S A;  3CZ6 A;  1UCR A;  3HOV J;  1Z3X A;  2M9H A;  1FOY A;  3IKV A;  4UUS B;  1FEX A;  1I50 J;  2DOD A;  4XLN F;  3MZH A;  1YJW I;  2EV5 A;  2JRM A;  1YYV A;  4OIQ F;  3CQZ J;  2WV0 A;  3H9J A;  4UUS A;  1A6I A;  2HOE A;  5AIQ A;  2P4W A;  2RVC A;  3MVP A;  4WCG A;  4B1R A;  3CJN A;  2FF4 A;  2XVC A;  1YG2 A;  3V42 A;  2IS2 A;  4HZF A;  3RZD J;  1HA8 A;  1E0E A;  4B44 A;  2KT0 A;  2H09 A;  2ZJ2 A;  2V9P A;  2LFB A;  3ZMT A;  1WI9 A;  3GME A;  2HVQ A;  1QRY A;  3MWM A;  3K2A A;  1S8N A;  1XD7 A;  1Z6T A;  3J80 K;  2R7T A;  1K4S A;  5D5X B;  3ZN1 A;  1R5I D;  5GAE J;  1VQP I;  2CYY A;  1Q1V A;  3C2B A;  3BQY A;  3EUH C;  3FKJ A;  4HEA 2;  4CSW A;  3ECH A;  5DTD A;  3OYH A;  5LGU A;  3R4K A;  2A69 F;  2GXA A;  3IHU A;  5LHG A;  1TQI A;  2RAE A;  1IW7 F;  4BDZ A;  4O5V A;  4YRV A;  3SYT A;  2HQR A;  4AIK A;  3OL4 A;  4RB1 A;  3KZI C;  2FXA A;  2EJR A;  3X2Q H;  1VFC A;  4HBL A;  3H3Z A;  4B3X A;  2K9L A;  4NC6 A;  2H6C A;  2ZSI B;  2FBK A;  4DYC A;  1YX3 A;  1GV5 A;  5GAD J;  4BY7 J;  2CUZ A;  2J5O A;  3ROU A;  4F55 A;  3BRO A;  2GWR A;  4WXC A;  4ZYH A;  5DDG A;  3M1C A;  2L3D A;  1QHH D;  2R3S A;  1BOA A;  2CQK A;  1S5L C;  3RZO J;  3QP6 A;  1KYZ A;  2G9W A;  2A3S A;  4OIN F;  4ANJ A;  4RAY A;  2VOP A;  4U7B A;  5DD8 A;  1UEL B;  2LNB A;  2XUB A;  1BIA A;  4GFB A;  2AQF A;  3J81 Z;  1Z3Y A;  1ZGA A;  2DN0 A;  1YJ9 I;  1SVO A;  4XOT A;  3CO6 C;  4CUG A;  3EET A;  1NG6 A;  1BJZ A;  1WQ2 A;  4KT5 C;  3L2Q A;  1FMW A;  2DW4 A;  4RLQ A;  1G6N A;  2DU9 A;  3ZMZ A;  1OCT C;  3H1C A;  3BR1 A;  5HLH A;  2IGO A;  2RRE A;  5ICF A;  3W6J B;  4ABZ A;  1MH3 A;  4JX6 A;  2K9Q A;  2WB1 N;  2XGX A;  2NXN B;  3PSI A;  1XTA A;  4BGD A;  3FF5 A;  3K4M A;  1IN7 A;  4LLN A;  3FIW A;  3HJE A;  3KCC A;  1HQC A;  4CH7 A;  2IAI A;  4ENN A;  5GPC A;  2PN6 A;  2V1N A;  1LQ1 A;  4XIC A;  4CA0 A;  2Y9Y A;  1B9N A;  3F6V A;  3JSP A;  2VKE A;  3ZQL A;  4PJ0 C;  1ACI A;  1QGP A;  2O3F A;  4G6T B;  2JSC A;  3C2H A;  3RCO A;  1JKO C;  4AUX A;  2OZ6 A;  2O61 A;  4HF2 A;  5F08 A;  5FKK A;  2H8W A;  2K9N A;  1O7L A;  2PG4 A;  1H9T A;  1FPQ A;  2FQ4 A;  3HB9 A;  4D0P A;  1JKP C;  1YS7 A;  2PX9 A;  1EV7 A;  3VB2 A;  2P5L C;  1H89 C;  2QGU A;  2MFZ A;  3QOE A;  3VYU B;  1PUF B;  2FNP A;  2IP2 A;  4YG2 F;  2XC7 A;  1BC7 C;  2V6C A;  3MAJ A;  1ZR4 A;  1IXC A;  5KAF C;  5FFX A;  2EIN H;  4D7N A;  4I01 A;  4KIC A;  5IYB J;  3CMA I;  5GTH C;  3QAH A;  3DF8 A;  3DEW A;  5HVQ C;  2JUC A;  2LLK A;  2LRE A;  2V26 A;  4PDK A;  1IV8 A;  4NHJ A;  2P6T A;  4AID A;  3CD6 I;  1SMY F;  3ZQI A;  5FFZ A;  3V8J A;  2LH9 A;  3MQ0 A;  1OYI A;  2O0Y A;  2VBX A;  3OYC A;  3FXU A;  2XF7 A;  1ZG3 A;  3E5U A;  3BTC A;  1GUU A;  1KON A;  3K70 D;  1YS6 A;  4KIF A;  4XLP F;  1ITY A;  3P9I A;  3DPU A;  2FD5 A;  5LD2 C;  4XR6 A;  4A12 A;  4KDP A;  2IGM A;  1E3H A;  1KQ9 A;  5E3L A;  3I55 I;  3I3L A;  3HSE A;  1Z6R A;  2M7A A;  1TW2 A;  2HDW A;  2DOF A;  4BAC A;  4L9J A;  1QQI A;  1S6L A;  1QBJ A;  3KP5 A;  1BOB A;  5F64 A;  2H94 A;  4I98 B;  2UXX A;  3VYS B;  4LK1 F;  3TO9 A;  2RKH A;  3A01 B;  4BXU A;  2TRT A;  2WAQ A;  2Q2E B;  3E5Q A;  1NK3 P;  1OJL A;  1KZH A;  2M3A A;  1N25 A;  3MD2 A;  3VDX A;  3A01 A;  2Q2E A;  3WE2 A;  4Y3O A;  1A35 A;  5M3M J;  5CQE A;  4PSW A;  3GTJ J;  2IS1 A;  1T33 A;  2B63 J;  2HXO A;  3T5X A;  2MW8 A;  1MBG A;  2I8D A;  2QWW A;  2DPU A;  2K27 A;  2CW0 F;  3FHZ A;  3LMM A;  2FSW A;  2KRF A;  3TQN A;  4XN3 A;  3EUA A;  1KGS A;  3K10 A;  5CYV A;  2FMY A;  1WHU A;  4BNC A;  4MQV A;  1FBS A;  1MND A;  2OF7 A;  4HPQ A;  1SFK A;  1RRJ A;  1XGN A;  1TC3 C;  1SAU A;  1Y8R B;  1R9T J;  1B59 A;  4E7S A;  2ZNY A;  4BQN A;  3IUO A;  3M8E A;  4MEY F;  3CJQ B;  1ENH A;  1F36 A;  4HOB A;  4NNJ A;  2DFE A;  1UMQ A;  3KP3 A;  2OA4 A;  1MZB A;  2O8K A;  1N78 A;  2XIG A;  1YHQ I;  1FSH A;  2QQ9 A;  4GYI A;  1X2N A;  1XMK A;  1R1V A;  1WJB A;  4KIB A;  2MG4 A;  1MJB A;  2UWM A;  2Z1D A;  3H36 A;  3T8T A;  3D1N I;  1DP7 P;  3FM5 A;  2VBY A;  4L9T A;  1MBF A;  4LLG F;  3BQZ A;  2GIZ A;  5J40 A;  4UVB A;  1S7O A;  1FJL A;  3GFI A;  1TWH J;  2L5Q A;  3RPU D;  3EPZ A;  5KCM A;  3TBI A;  1ZHF A;  2A5W A;  3GF2 A;  4KJZ A;  3WU1 B;  3KP7 A;  4EJT A;  1W5T A;  3W2V A;  2QYO A;  2XB0 X;  3LAP A;  2HGC A;  2B7E A;  1QZY A;  1BW5 A;  4C2U A;  2K3P A;  1LUJ B;  1POG A;  2MH2 A;  3AAF A;  2PQ8 A;  1XGO A;  1ZLJ A;  3F6O A;  3OYN A;  1Z1D A;  4O6J A;  3WG7 H;  4M71 A;  4G6D A;  3F22 A;  4UV8 A;  2V9V A;  3TMO A;  1W7P B;  3I54 A;  1TQP A;  3CLQ A;  1DGR M;  4KUM A;  3ZMV A;  1ZG1 A;  4QWQ A;  3OYF A;  1W7P A;  1BR1 A;  2EIL H;  4M74 A;  1A31 A;  5ILS A;  2RDP A;  2IS4 A;  3IH3 A;  1R1U A;  2CUJ A;  3G73 A;  1XCV A;  2ISZ A;  3DWL E;  5FD5 A;  2ZJQ F;  1R4N B;  3KET A;  1VQ4 I;  3LSK A;  5D5U B;  1I39 A;  5IT9 K;  2LRD A;  3HHG A;  4Y52 J;  1RPW A;  2E2H J;  2XKP A;  3LSJ A;  1SFX A;  4MTE A;  3RPQ A;  2EBI A;  1I6H J;  2VPL A;  2EZL A;  2ZME B;  4LG3 A;  3PIP F;  3IKT A;  4Z2Y A;  3WHC A;  1BC8 C;  5B3S H;  3FMS A;  3CC2 I;  1FX7 A;  3GCM A;  1BJA A;  4S0H B;  3A0H C;  4CDG A;  1AWC A;  1JI8 A;  5HS9 A;  2KP6 A;  2M8E A;  1O3Q A;  4AYB N;  3OYG A;  2P7V B;  2WBM A;  4CCO A;  2M8G X;  4I0A A;  2HZT A;  2LKX A;  4M9X A;  2Z99 A;  4UVA A;  3QYF A;  3T1B A;  5D8L B;  1X1D A;  2IPQ X;  2RV8 A;  5J47 A;  3NWT A;  2IVM A;  2VOO A;  5IPA A;  4UXN A;  4BHB A;  4EM1 A;  4A3M J;  2DOE A;  3HHH A;  3W6V A;  1HDD C;  1HXD A;  1T95 A;  3C2G A;  1SFU A;  2EH3 A;  3HPG A;  1B72 B;  1ZH5 A;  1TQM A;  2KZG A;  4JBA A;  4HRI A;  2DDA A;  3V8K A;  1FYL A;  1B72 A;  2Y75 A;  1Z7L A;  1IDY A;  2ETH A;  1G3T A;  3FBN B;  1U2W A;  5H2F C;  3NWS A;  1JUM A;  3JRD A;  3SEZ A;  3KZZ A;  3HUG B;  5GAG J;  4MTD A;  3GEZ A;  2QEX I;  3G4S I;  3GUD A;  1XDU A;  2EA2 A;  4IHT A;  3HUG A;  4F92 B;  4XOP A;  5BMZ A;  1R00 A;  3GTG J;  1UB9 A;  2PEX A;  2VT3 A;  5DCF A;  2ZME C;  4EMS A;  3NEU A;  1WVR A;  4EJW A;  4M9Z A;  4ESJ A;  1L0O C;  3GTP J;  3SFI A;  2IW5 A;  1NK2 P;  3PIO F;  3C1D A;  3VPR A;  4W97 A;  1R6R A;  3J7Y J;  3WGI A;  3IWZ A;  5E20 A;  4B3A A;  4MIM A;  2EIM H;  5L3C A;  1SFO J;  3JAM Z;  1E17 A;  2KJB A;  2QKM B;  3TL4 X;  3KEO A;  1ZR2 A;  4XM3 A;  2TDX A;  2H1K A;  3O8G A;  4YEJ A;  2W00 A;  1MJ9 A;  4BY1 J;  5F04 A;  1I3Q J;  4BUP A;  3CES A;  3LFK A;  2O7O A;  3HOS A;  2LF7 A;  3CCY A;  3OR2 C;  1TNS A;  3BTJ A;  3P5J A;  2ID3 A;  2EV0 A;  3JRE A;  1ZAR A;  3RQ4 A;  1GXP A;  3S1R J;  4RGX A;  4U87 A;  1BI1 A;  2HPI A;  3FBI B;  4GRI A;  4HYE A;  5BNG A;  1A5J A;  3ABU A;  2DJI A;  3DKX A;  1W0T A;  2JRT A;  5CVJ A;  4EJO A;  5GPA A;  2XRN A;  2IT0 A;  3O8H A;  3S2W A;  4YII A;  1JGS A;  1IN4 A;  1T39 A;  4HSR A;  1EA3 A;  4LD5 A;  2DA7 A;  3P9C A;  2A05 A;  4HLY A;  1YJN I;  4EVI A;  1YQA A;  2M0C A;  4X0G A;  2XF5 A;  3F8F A;  2Y0M A;  1SEU A;  3L09 A;  2FBH A;  4Q5S F;  3DLA A;  5TGT A;  5BPD A;  1GVD A;  2DI3 A;  4AD9 A;  1D1C A;  4BKX A;  2Y69 H;  2RQQ A;  5B5E C;  4MHG A;  1JE8 A;  1TP4 A;  3DPT A;  1JHH A;  4IHS A;  2IA0 A;  2ZXJ A;  5FKN A;  2W57 A;  1XPX A;  5JHU A;  2GA2 A;  2JSP A;  4XBF A;  1JTY A;  3TO7 A;  2BHY A;  3RKX A;  5HDK A;  5D4R A;  4FQG A;  1B1B A;  1KQ8 A;  1GXQ A;  4IL6 C;  2JWT A;  4ZC3 A;  3O2P E;  3N97 A;  4M6V A;  1GHC A;  2KIQ A;  4Y33 A;  3HSF A;  1QHG A;  2VC1 A;  1BI2 A;  1RKT A;  1XSD A;  3MZY A;  2DCE A;  4C30 A;  1CF7 B;  1I1G A;  2DDB A;  3ZR8 X;  2CWE A;  3HOW J;  3OIP A;  1CF7 A;  2QQA A;  2VKH A;  4XON A;  4QIW N;  5DM7 F;  2PLY A;  2EQR A;  4ZYG A;  2CMP A;  4NC8 A;  4EJV A;  3I4M J;  4ITV A;  3HRT A;  2A6H F;  3A4C A;  2LK2 A;  2DLL A;  3C3W A;  4A5M A;  4QTR A;  2M4G A;  2XSD C;  2E7X A;  2L9N A;  3JRG A;  3NAU A;  2EFP A;  4BDY A;  1RR7 A;  2DA1 A;  3CCS I;  1F43 A;  2LKS A;  3IAM 2;  2FJ1 A;  2ZSH B;  3QPL A;  4M72 A;  4EEF G;  1EF4 A;  2VXZ A;  2NVT J;  3E1S A;  2NVX J;  3BG7 A;  1Z91 A;  4M3G A;  5JLW A;  3J7A O;  2ME6 A;  3EYY A;  1AKH A;  2ESN A;  5C3E J;  4GGG A;  1X3U A;  1SVM A;  2YX7 A;  1NHA A;  2M2E A;  5HLT A;  4MLO A;  4HNU A;  4NQW B;  2A61 A;  5FKO A;  5J1Y A;  4M9S A;  1WJD A;  3M07 A;  3IV5 A;  4OMZ A;  3LA7 A;  4L5I A;  3BTL A;  1JXS A;  1HKQ A;  3H92 A;  3GFM A;  4TV7 A;  3JRH A;  2N8G A;  1TL8 A;  1N77 A;  3LNQ A;  3H0G J;  3H0D A;  1HLV A;  3C18 A;  2P5K A;  3S1M J;  1H9G A;  1XCB A;  3G2B A;  2DTR A;  2FE3 A;  4GCV A;  4PUS A;  3CCM I;  1GV2 A;  2X1C A;  4IX7 A;  4HG2 A;  2LBF B;  2XKO A;  5K7Z A;  1ETY A;  1ZAO A;  3BPX A;  1WSU A;  4EV0 A;  2P8T A;  2KJC A;  1O7F A;  2LY2 A;  3I59 A;  5ICE A;  5J6X A;  2LBF A;  5B1A H;  2OTJ I;  1G8X A;  5F0F A;  5DEQ A;  2QF7 A;  3HRU A;  4I6Z A;  2HNH A;  4P55 A;  2XAG A;  5K5O A;  1K83 J;  3GXO A;  2BVL A;  4KIT B;  2GIV A;  3IH2 A;  4RS8 A;  3K4L A;  4QSH A;  2COM A;  3ESW B;  3OYK A;  4E7H A;  3WTT C;  5BPI A;  2V1X A;  3DTK A;  2HDC A;  3PO3 J;  3G71 I;  1G4D A;  5J4Y A;  3ZXS A;  2VQG A;  4XSX F;  2W1O A;  3TW6 A;  1OCO H;  1ZYR F;  2L54 A;  2E2J J;  4I7H A;  1R22 A;  2BXY A;  1HC8 A;  1MBE A;  3BC8 A;  3OV8 A;  1RI7 A;  3GZ5 A;  1VQN I;  1HKS A;  1BIB A;  4AIJ A;  3AL0 B;  4CO8 A;  4L0Z B;  1TT0 A;  2DT6 A;  1LVA A;  1XMA A;  4RLF A;  2ZXI A;  1XB4 A;  1T08 B;  4XKC A;  3GBG A;  1LDJ A;  4BHP A;  2X51 A;  3L2U A;  1YTY A;  1A6Q A;  4PFP A;  3GTL J;  3LSG A;  3BG3 A;  4B4C A;  2E71 A;  3BPV A;  1R5G A;  1GDT A;  5L3B A;  5HLI A;  2R93 J;  1G3S A;  2W24 A;  3IL2 A;  1EJ9 A;  2JJ7 A;  3QPH A;  4Y4R A;  1MSE C;  2WV1 A;  4UVC A;  1PVE A;  1X19 A;  2G7U A;  3BCA A;  3BCB A;  4YIR X;  5FD6 A;  4DW6 A;  1Y1W J;  3A02 A;  4HLX A;  4RAZ A;  5TRD A;  1IN8 A;  2CFX A;  2ZBK A;  3J80 Z;  1ZRE A;  1PJR A;  4I76 A;  2DJN A;  4BYY A;  2VJJ A;  3E3V A;  4ETS A;  1U6G A;  4UB8 C;  4ZZD A;  5E3O A;  3M7G A;  2FRH A;  4FET A;  2DA2 A;  2HWV A;  1O3S A;  1EH8 A;  5ED4 A;  4G94 A;  3FK7 A;  3LFU A;  2JA8 J;  4N4N B;  5KHD A;  2WAQ N;  2VUM J;  1R23 A;  4FIS A;  2HOT A;  4A69 C;  2CRG A;  4LIT A;  5L3G A;  2FU4 A;  2F48 A;  3HKZ N;  5ICC A;  4ENM A;  5D5W B;  4XLC A;  1IUF A;  3AL0 C;  1OYW A;  4DZJ A;  4HQE A;  3K1N A;  3F3X A;  1VQ5 I;  6PAX A;  2OUM A;  3S32 A;  2M7B A;  2ZFU A;  3OS1 A;  3KPH A;  2IGK A;  5GP9 A;  4F52 A;  2CS3 A;  1MNM C;  2VJ4 A;  3DPL C;  1RNL A;  2QLZ A;  3BG6 A;  1O4X A;  1FT9 A;  2EA4 A;  2GM4 A;  4HV5 A;  2JA2 A;  2XGC A;  1G59 A;  1ETO A;  2V1D A;  4S05 A;  4ZYE A;  1XG1 A;  2GLO A;  1AOY A;  1OYY A;  2CJJ A;  4LG0 B;  2KPM A;  5DM6 F;  3GW2 A;  2HZD A;  1X1P A;  1ZG5 A;  1JKR C;  5IY5 H;  4LG0 A;  3RKQ A;  2D45 A;  1YRN B;  2EZI A;  3F72 A;  1MMA A;  3HL2 A;  5LGN A;  2ZO4 A;  4RM2 A;  1HKT A;  2FQ3 A;  3FWE A;  2ZFW A;  4BE1 A;  1YRN A;  1OIS A;  1HCR A;  1MGT A;  2XRO A;  3DU6 A;  2ECC A;  1UFM A;  2KDO A;  2F5F A;  2VE8 A;  1V54 H;  1MSF C;  1FYK A;  4PJM A;  3G1L A;  3OS2 A;  4IHW A;  4C3I J;  4XRS G;  2QUF A;  4IQ4 A;  5DUI A;  4YIF A;  1UG2 A;  4KMF A;  1E3O C;  2JMW A;  3CJT B;  3Q3S A;  3CJR B;  4P9F A;  3J81 K;  2OPT A;  2NS0 A;  5LFA A;  4JK1 X;  3Q9S A;  2NS7 A;  3WOD F;  4PJN A;  3KZY A;  3HOT A;  5GTI C;  4LJZ F;  1MJA A;  4HX4 A;  2L2O A;  4RAG A;  3W2W A;  3LQR A;  4QLC U;  4HST A;  1ZRF A;  3QPS A;  2E1O A;  5CVV A;  2STT A;  4I99 C;  3BY6 A;  3HG9 A;  2LP0 A;  1J09 A;  1B8I B;  2E1N A;  5D5V B;  5IP6 A;  1UG0 A;  2KHM A;  1TBX A;  3CC7 I;  3VYT B;  2VAS A;  2ELK A;  1KU9 A;  2Z9O A;  3ULQ B;  4NDL A;  1B8I A;  1LDK B;  2QCO A;  4CZC A;  2IS6 A;  1APL C;  2KRH A;  1D8J A;  1K61 A;  5E18 F;  1OKR A;  3R0A A;  4D5F A;  1IV6 A;  2E36 A;  1IDZ A;  2HQN A;  4AVZ A;  3IAS 2;  4LMY A;  1T98 A;  3GFJ A;  2XPU A;  3H9Q A;  4RMN A;  1U78 A;  4J01 A;  1TWF J;  1X2M A;  1DP3 A;  3M3Y J;  1ETW A;  9ANT A;  2F4M B;  4ZDL A;  3PL8 A;  4YFK F;  3PNY A;  4U0V A;  1D1A A;  1AU7 A;  1J5Y A;  2ADU A;  3BZ6 A;  3DTE A;  4K2E A;  4JX4 A;  4AC0 A;  2FBI A;  5ILU A;  3PQJ A;  1IF1 A;  1Y0U A;  3Q9V A;  3B6A A;  1R4M B;  1G2H A;  4YEL A;  2BYV E;  2KLO A;  5L3D A;  4D1Q A;  3S1Q J;  4M3F A;  3HOX J;  1D0Z A;  1I6X A;  4IKF A;  1ZN2 A;  2A6E F;  1F4K A;  2K9M A;  1TNT A;  2ZNZ A;  3BTI A;  1FOK A;  1Z05 A;  4M3B A;  1A36 A;  4A0X A;  2DFH A;  2J5P A;  5AIP A;  4ZDO A;  4LGW A;  2A6T A;  2KIM A;  1BBY A;  5H20 A;  3SDB A;  5KK1 A;  5K7H A;  2R4G A;  1U0J A;  2AXT C;  3RIR A;  2X6Y A;  4A3G J;  1J59 A;  5FKL A;  3HKZ A;  2CV2 A;  4IF4 A;  2B0L A;  1Z67 A;  1BW6 A;  2X0L A;  2X1E A;  2M34 A;  4G8X A;  3AG1 H;  2UUZ A;  4ZTF A;  4II3 A;  1SFE A;  3DBR B;  2V79 A;  3GZ6 A;  3CUQ B;  3E7L A;  4KIS A;  4L0Y B;  3RQI A;  1PP8 F;  4RBO A;  1XSV A;  2BGC A;  1PYV A;  2L4M A;  2XRL A;  2L7M P;  1QZZ A;  3CUQ A;  2Z33 A;  2YS9 A;  3A0B C;  1IRG A;  1XC5 A;  2IA2 A;  4N0B A;  5LGT A;  5J4V A;  5B66 C;  3WG9 A;  3CDI A;  3SZG A;  2LDU A;  4P5O A;  3LQQ A;  4R1H A;  5DCM B;  1X4P A;  4NUB A;  2P7C B;  4ESB A;  3OYA A;  3I4P A;  3OS0 A;  4H0E A;  5DCM A;  4MFE A;  2JTV A;  2LKP A;  4YFX F;  5JLX A;  2BY2 A;  1OPC A;  4A3I J;  3OSG A;  4ZDP A;  3FKI J;  2DMP A;  3VYR B;  1LEB A;  5J1R A;  1BI0 A;  1B6A A;  4GXO A;  1Y6I A;  1T38 A;  3PQK A;  2OCE A;  1EH6 A;  3F0C A;  3OOP A;  3BG5 A;  2MAB A;  4EM2 A;  4KNY A;  1X58 A;  5IOZ A;  5E3N A;  2HTJ A;  3HGY A;  1WRJ A;  1P4W A;  1U5T B;  2XAS A;  2G7H A;  3GVA A;  3QOP A;  2UZK A;  1O57 A;  1TZL A;  1QZE A;  3U21 A;  3HDD A;  4DGW B;  1GLN A;  1W0U A;  1U5T A;  3F8N A;  2Z3Y A;  4EQQ A;  5HLG A;  5EEA A;  4BU2 A;  3U1K A;  1O3R A;  1MD0 A;  2AO9 A;  2E34 A;  3WTX C;  2MC3 A;  1BM9 A;  5F6F A;  5FKM A;  1PP7 U;  2R5Z A;  3GFL A;  4N9I A;  3LST A;  1K6Y A;  4OIP F;  3L2V A;  3ZOB A;  4OAZ A;  5FLX Z;  1D5Y A;  2RNG A;  4B09 A;  2JA5 J;  3BJA A;  1W36 C;  2OZU A;  3CUQ C;  2BY3 A;  3IH4 A;  2UV1 A;  1FY7 A;  3OYM A;  4MNU A;  3MFK A;  1R1T A;  2VLA A;  4FT8 A;  2PMZ N;  1VND A;  2Z2S B;  4ON0 A;  1HW2 A;  4EM0 B;  5K5R A;  2NRA C;  2XDV A;  5E1W A;  3QWL A;  5E1X A;  3WGG A;  2WAF A;  3W6K B;  4A0Y A;  4M3E A;  1IRZ A;  1U9N A;  5D6E A;  4OIR F;  5K7F A;  4E7J A;  3DU5 A;  1VQ7 I;  4L5J A;  1NG7 A;  1M1E B;  5TIS C;  2HEO A;  3L7W A;  1FBU A;  4F93 B;  2A5Y B;  1X1C A;  3ZQF A;  2XGE A;  1DQU A;  1G3W A;  2W82 A;  3RKW A;  3AKZ A;  3MKW B;  2L7K A;  3V7C A;  4J00 A;  3R6S A;  1XMX A;  4BH9 A;  4YFN F;  2OC6 A;  3K4B A;  2MD5 A;  5FRO A;  4D5C A;  2X4H A;  3CCV I;  2LR8 A;  3HYI A;  3K9T A;  2PMU A;  4WXD A;  3TO6 A;  4IVN A;  1U5T C;  1HDP A;  3IP4 B;  1Q1H A;  2FX0 A;  4RGU A;  1MW7 A;  3DKW A;  2HI3 A;  3CCR I;  2DMU A;  3G1M A;  4QPQ A;  4UUV A;  4UUT A;  2HXI A;  2NVU B;  3RI4 A;  5FLV A;  4L9V A;  1WJC A;  1ULY A;  2LSO A;  4A3E J;  1K4T A;  3FMQ A;  4X1E A;  2H8R A;  1ERD A;  1XX5 A;  4U88 A;  1IGN A;  3RYR A;  2K9S A;  1OFC X;  1S7E A;  3PUB A;  2R7O A;  4IOA F;  2KDZ A;  3S3M A;  2LYC A;  2W7N A;  1A04 A;  2BZT A;  5H6R A;  1P6R A;  2MC4 A;  2FA5 A;  3RJP A;  3KEY A;  4A5N A;  5K5Q A;  2F5E A;  5EJC A;  1K79 A;  3TP3 A;  1IC8 A;  2F4I A;  4XNF A;  3WHB A;  1BL0 A;  3OY9 A;  3OR1 C;  2R7W A;  2DO7 A;  1D3Y A;  2F5C A;  2VI6 A;  3I64 A;  4N4O B;  4XRF A;  4BE0 A;  4KT6 A;  1T8I A;  2OU2 A;  2JZY A;  2IXS A;  2Y30 A;  2P6S A;  2OD5 A;  4IHV A;  1VF9 A;  3HZJ A;  1JHF A;  3H5N A;  2NVQ J;  2AQE A;  3CCQ I;  4KYW A;  2W85 A;  5EZG A;  1RR8 C;  2R5Y B;  5JHF A;  3K70 C;  1UHS A;  2W25 A;  4PCQ A;  1R71 A;  2ELJ A;  2R7X A;  2R5Y A;  2MLK A;  3H3V K;  4CYC A;  5J1U A;  1Y0N A;  2ZJP F;  3ABL H;  3E6M A;  1MBJ A;  5A2Q Z;  4JOM A;  4B43 A;  2R7Z J;  2XAH A;  4P96 A;  3PJR A;  4BS9 A;  2VQL A;  3I9V 2;  2BBY A;  3SJM A;  2DA4 A;  2VBW A;  1YX5 A;  1REP C;  4IQJ A;  2BY1 A;  4N9H A;  2FOK A;  2DMN A;  1VQ6 I;  1XGS A;  4XK4 A;  3HSR A;  1OR7 A;  1U9O A;  1XN7 A;  5EF6 A;  4V2G A;  3RPU A;  3ABT A;  3I5U A;  2V1U A;  4EAT A;  2ZB9 A;  2LD5 A;  3JCU C;  5E3M A;  3Q0V A;  4BL0 B;  3G3Z A;  1J2X A;  3SHF A;  1QVU A;  3CMY A;  1VZ0 A;  2RN7 A;  1MDM B;  4WF2 A;  2C6Y A;  3BR3 A;  4JP0 A;  2PMZ A;  1SC7 A;  2QEN A;  4CHU A;  3L00 A;  1ZRC A;  4IXA A;  3ZPL A;  1VQ9 I;  1S72 I;  1KYW A;  1MDM A;  2JT1 A;  2VQH A;  3RDI A;  4Q47 A;  2FOW A;  1I27 A;  2K40 A;  2L01 A;  3ABK H;  3FZV A;  2IRF G;  1IZ1 A;  4PZJ A;  2WWY A;  5IP7 J;  1MH4 A;  4CCM A;  4WXH A;  4KFC A;  4HW0 A;  3C7J A; 
#chains in the Genus database with same CATH homology
 3Q0W A;  1ZR4 A;  3GTL J;  3LSG A;  1SAN A;  3BG3 A;  4B4C A;  4D7N A;  4A3C J;  3L1P A;  5IYB J;  1GDT A;  3HGG A;  1P7I A;  1TWA J;  3DEW A;  2R93 J;  2LLK A;  3LSR A;  3LSP A;  3ZQI A;  2JJ7 A;  1MSE C;  1JT0 A;  2WV1 A;  5C4X J;  2CUE A;  1WI3 A;  4BBR J;  4DW6 A;  1Y1W J;  3A02 A;  3M4O J;  3CDL A;  2JA6 J;  1RES A;  3BTC A;  1GUU A;  4I76 A;  2DJN A;  1ITY A;  4J19 A;  2FD5 A;  5E3O A;  2DA2 A;  5E3L A;  3S2H J;  1JJ8 C;  1XS9 A;  3FK7 A;  2L9R A;  1ZGW A;  2JA8 J;  1BA5 A;  2WAQ N;  2VUM J;  1JTX A;  1FTT A;  4FIS A;  3A01 B;  2HOT A;  1WCM J;  4A69 C;  2CRG A;  2TRT A;  4M3D A;  1HOM A;  1NK3 P;  1OJL A;  3HKZ N;  1H8A C;  3ZQC A;  3A01 A;  1IUF A;  4DZP A;  4DZJ A;  5M3M J;  1AKH B;  2XGD A;  3GTJ J;  1T33 A;  2B63 J;  2HXO A;  3JRA A;  2HYJ A;  2MW8 A;  2ME0 A;  1MBG A;  5GP9 A;  1JUS A;  4BBS J;  3OIO A;  1MNM C;  3GTM J;  2GM4 A;  1O4X A;  2XGC A;  3TW7 A;  4LOC A;  4CYC B;  1GT0 C;  2JA7 J;  1ETO A;  2E2I J;  1XG1 A;  2GLO A;  2CJJ A;  4JYK A;  2ID6 A;  1ORK A;  1T56 A;  1JKR C;  2CU7 A;  3HM5 A;  2OF7 A;  3BG9 A;  1TWG J;  5EZH A;  1TC3 C;  1JT6 A;  1R9T J;  2R0Q C;  3RKQ A;  1LE8 B;  1YRN B;  2EZI A;  5FJ8 J;  4FCY A;  1ENH A;  1F36 A;  1UMQ A;  2EZK A;  3JRB A;  4V2F A;  3I4N J;  3S2D J;  2R92 J;  3HOU J;  1LE8 A;  5EG0 B;  2O8K A;  3JRI A;  1YRN A;  3HBL A;  1HCR A;  1X2N A;  2ECC A;  2ECB A;  2MG4 A;  5EG0 A;  1MSF C;  3D1N I;  4IHY A;  3S17 J;  3G1L A;  2Y0S N;  1MBF A;  1IG7 A;  4IHW A;  3BQZ A;  2Y9Z A;  4C3I J;  4XRS G;  3B6C A;  1FJL A;  1TWH J;  4FTH A;  2AHQ A;  4A3B J;  3BR0 A;  3QQA A;  3G1O A;  1UG2 A;  5DS9 A;  5M5X J;  1E3O C;  2JMW A;  3Q3S A;  2X9D A;  2OPT A;  2XB0 X;  4JX5 A;  5F27 A;  1DU0 A;  1BW5 A;  2HOS A;  3BT9 A;  2NS7 A;  1POG A;  3Q0U A;  4A3D J;  3FIS A;  1FTZ A;  2E19 A;  4X6A J;  2MGQ A;  3QPS A;  2E1O A;  1ETX A;  2VKV A;  4C3H J;  4IHX A;  1B8I B;  2LP0 A;  5IP6 A;  1IJW C;  2ELK A;  2XPV A;  4A3J J;  4NDL A;  5EYR A;  1B8I A;  2QCO A;  1APL C;  1K61 A;  4A3K J;  3IH3 A;  2L7Z A;  4D5F A;  1IV6 A;  1IDZ A;  3OOU A;  3FK6 A;  2LTP A;  2XPU A;  4Y52 J;  1RPW A;  4D7M A;  1U78 A;  2E2H J;  1TWF J;  1X2M A;  3LSJ A;  1ETW A;  4XRM A;  3M3Y J;  2EBI A;  1I6H J;  9ANT A;  2EZL A;  1AU7 A;  5EDN A;  1JKQ C;  4JX4 A;  4AC0 A;  3WHC A;  2MSY A;  3B6A A;  1U8B A;  1G2H A;  4S0H B;  2DTZ A;  2P81 A;  3S1Q J;  4M3F A;  3HOX J;  4AYB N;  5F1J A;  1HF0 A;  2IBD A;  2M8G X;  2LKX A;  1AHD P;  3BTI A;  4M3B A;  5IPA A;  3S14 J;  4A3M J;  1DU6 A;  5K7H A;  1JJ6 C;  2D5V A;  2HDD A;  3W6V A;  4L5E A;  1ZK8 A;  3TED A;  1HDD C;  2EH3 A;  2YUS A;  1B72 B;  3S1N J;  4A3G J;  5M5W J;  5FKL A;  3LOC A;  2JK3 A;  1BW6 A;  1B72 A;  1IDY A;  2TCT A;  2NOG A;  1JUM A;  1RET A;  3JRD A;  2M34 A;  1WGX A;  3BR6 A;  5F0H A;  3E7L A;  3RQI A;  4RBO A;  3PM1 A;  2XRL A;  2L7M P;  2YS9 A;  1WPK A;  3JRC A;  4A3L J;  1XC5 A;  4C3J J;  2CQX A;  2YU9 J;  3GTG J;  2NVY J;  1ETK A;  4HNV A;  5IYC J;  3GTP J;  2JN6 A;  3HEF A;  3SFI A;  2EZH A;  1NK2 P;  1VI0 A;  3GTO J;  1JUP A;  4G12 A;  3VPR A;  5M3F J;  4W97 A;  4MFE A;  1ZKG A;  5JLX A;  4MIM A;  4B3A A;  4A3I J;  3OSG A;  1LFU P;  1SFO J;  3FKI J;  2DMP A;  3GTQ J;  5J1R A;  2HOA A;  2I10 A;  3JRF A;  3ZQH A;  1ZR2 A;  2H1K A;  3O8G A;  3F0C A;  4BY1 J;  5F04 A;  1Z77 A;  1I3Q J;  3BG5 A;  4MFD A;  1X58 A;  5IOZ A;  5E3N A;  3HGY A;  1WH5 A;  2O7O A;  1RKW A;  3BR5 A;  3CCY A;  3BTJ A;  3HDD A;  2ID3 A;  1NTC A;  3TP0 A;  3JR9 A;  3JRE A;  1W0U A;  2DA3 A;  5EEA A;  3BR2 A;  3S1R J;  2AO9 A;  1MBH A;  1P7J A;  1H88 C;  5FKM A;  5BNG A;  1FIA A;  2R5Z A;  1A5J A;  5M5Y J;  3NAR A;  1W0T A;  4XID A;  4FE4 A;  1WH7 A;  3ZOB A;  3PO2 J;  5GPA A;  1D5Y A;  2JA5 J;  2LVS A;  3IH4 A;  3O8H A;  5HOD A;  5C4J J;  2PMZ N;  1VND A;  5C44 J;  3HOZ J;  2NS8 A;  2L0K A;  2DA7 A;  1ETV A;  2G0E A;  5EGO B;  1ETQ A;  4C2M J;  4M3E A;  2M0C A;  1U9N A;  1IRZ A;  2L7F P;  5K7F A;  5EGO A;  2VPR A;  1QVT A;  3GTK J;  2XB5 A;  1Y1V J;  1GVD A;  3MN2 A;  3OSF A;  4BKX A;  5FKN A;  1OCP A;  3S15 J;  4MO7 A;  4Y7N J;  3ZQF A;  2XGE A;  1JTY A;  3HOV J;  2M9H A;  4DYQ A;  1FEX A;  4UUS B;  1I50 J;  4FE7 A;  4DYR A;  3MKL A;  4D5C A;  1PUF A;  2LR8 A;  3CQZ J;  4BXX J;  2JWT A;  4UUS A;  1A6I A;  1HDP A;  3MVP A;  2LY9 A;  4M6V A;  4B1R A;  2GBY A;  2FX0 A;  2X48 A;  2X6O A;  2HI3 A;  1RKT A;  2W48 A;  1CQT A;  2DMU A;  1JGG A;  3G1M A;  3RZD J;  1LFB A;  2HXI A;  4UUT A;  5FLV A;  2KT0 A;  2LFB A;  4A3E J;  4X1E A;  3HOW J;  2H8R A;  1QRY A;  3K2A A;  4W1U A;  3UKG A;  2XPW A;  5J3L A;  1IGN A;  4QIW N;  5IYD J;  2K9S A;  2EQR A;  1OFC X;  1S7E A;  3ZQG A;  3I4M J;  2KDZ A;  3C2B A;  1Q1V A;  3BQY A;  5DTD A;  2LK2 A;  5FLM J;  4QTR A;  2XSD C;  3JRG A;  3NAU A;  1RR7 A;  3K7A J;  4A93 J;  3TP3 A;  2RAE A;  1IC8 A;  2DA1 A;  1BL0 A;  3WHB A;  1MBK A;  1F43 A;  2Y2Z A;  2FJ1 A;  3QPL A;  4EEF G;  1VFC A;  2VI6 A;  1EF4 A;  2NVT J;  4RDU A;  2NVX J;  4M3G A;  5JLW A;  4DYC A;  1GV5 A;  2Y30 A;  2ME6 A;  4BY7 J;  1AKH A;  5C3E J;  1VF9 A;  4IHV A;  2M2E A;  4MLO A;  5FKO A;  1ZTR A;  2DMT A;  2COB A;  5J1Y A;  2NVQ J;  3A03 A;  3IV5 A;  5EZG A;  4XRS A;  2R5Y B;  1UHS A;  3BTL A;  3RZO J;  3JRH A;  2R5Y A;  2HQ5 A;  1Z0X A;  2N8G A;  4CYC A;  3H3V K;  5J1U A;  3LNQ A;  3H0G J;  4IEJ A;  1HLV A;  4GFB A;  1MBJ A;  3S1M J;  2R7Z J;  2DN0 A;  1GV2 A;  3SJM A;  2DA4 A;  1BJZ A;  2DA6 A;  5K7Z A;  1ETY A;  1ZQ3 P;  2R5Z B;  3S16 J;  2DMN A;  2CUF A;  4A3F J;  4XK4 A;  1OCT C;  1U9O A;  3BR1 A;  5EF6 A;  4V2G A;  5F0F A;  4ABZ A;  2QF7 A;  1MH3 A;  4JX6 A;  4I6Z A;  2K9Q A;  2WB1 N;  2ZB9 A;  1K83 J;  2LD5 A;  2O9L A;  3DCF A;  2IEK A;  5E3M A;  3IH2 A;  3SDG A;  3Q0V A;  3FIW A;  4QSH A;  2IAI A;  5GPC A;  3HOY J;  4XIC A;  3CMY A;  2DMQ A;  1QVU A;  2Y9Y A;  3PO3 J;  2VKE A;  3ZQL A;  3BR3 A;  4JP0 A;  3TW6 A;  5IP9 J;  1JKO C;  4AUX A;  1QPI A;  1TWC J;  2E2J J;  1MBE A;  5F08 A;  5FKK A;  2K9N A;  2FQ4 A;  3HB9 A;  1JKP C;  2K40 A;  5IP7 J;  1H89 C;  1MH4 A;  2Y31 A;  1PUF B;  2CQQ A;  5F0C A;  3GBG A;  2DA5 A;  5IOY A;  1FIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...