3S15J

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s15J00
2M9HA 3GTOJ 5IYCJ 2HQ5A 1TWGJ 2M8GX 4XRMA 1Y1VJ 4EEFG 5FKOA 1I3QJ 1TWAJ 3WHCA 4XK4A 3S1QJ 4L5EA 3BG5A 2N8GA 3O8HA 2YU9J 3HOYJ 1FTZA 1Z0XA 1HOMA 3CQZJ 2NVXJ 5EF6A 3G1LA 1WGXA 2K9SA 3DCFA 4DW6A 2TRTA 1IJWC 2ME0A 3FK6A 3LSRA 1BL0A 1QRYA 3G1OA 4AYBN 2JA6J 1I6HJ 5FKNA 1WH7A 5K7ZA 3GTJJ 2EZKA 4A3EJ 1MSFC 3S16J 1U9OA 2ECCA 2M34A 5J1UA 2E1OA 3BG3A 5FLVA 3HGYA 1FEXA 1B72B 1MSEC 3LSPA 3TP3A 1JTYA 4C3IJ 1B8IA 1W0UA 2NVTJ 1POGA 1RESA 1XS9A 2Y0SN 3M4OJ 1RR7A 3BG9A 3NAUA 3H3VK 2E2JJ 3JRCA 1O4XA 3PO3J 5M5YJ 1MH4A 1ZTRA 2M0CA 3LSGA 3BR0A 3RZOJ 3BR1A 2DA4A 5F04A 2DMNA 2VKEA 5IYBJ 2W48A 5GPAA 4B3AA 1QVTA 3S14J 4AUXA 2YUSA 2HOAA 1MBGA 2IAIA 2EZLA 2JA5J 4AC0A 5EDNA 1T33A 5J1YA 1I50J 5IPAA 3TP0A 1CQTA 2NVQJ 4B1RA 1EF4A 4Y52J 2FJ1A 3A01A 4D5FA 1AHDP 4JP0A 4XRSA 2R7ZJ 3OSGA 1JT6A 3BR2A 2XGDA 5FJ8J 2XB0X 1MBJA 2KT0A 1UHSA 2ELKA 2XPWA 3IH3A 4M3EA 2DA7A 2JA7J 1P7JA 3S15J 3BR5A 3M3YJ 5EG0A 3QPSA 1H88C 3SDGA 3BR3A 3I4MJ 4UUTA 1QPIA 1JKRC 3JRBA 4V2GA 2Y30A 1LE8A 2OPTA 5FKLA 2DN0A 3LNQA 1B72A 3O8GA 1WPKA 3IV5A 5F0CA 5C4JJ 1MBKA 1JTXA 1JJ8C 3FIWA 5K7FA 2HXOA 3ZQFA 1G2HA 3JR9A 1OCTC 3HOXJ 1ETQA 4M3GA 5E3NA 5FLMJ 4A3BJ 2LP0A 3K7AJ 3BT9A 3S17J 2YS9A 2L0KA 3B6CA 3HOWJ 1MNMC 2E2IJ 1IDZA 4MO7A 2EBIA 3ZOBA 1X2NA 4QSHA 5J1RA 4B4CA 5IOYA 4RBOA 3BTIA 4M3BA 5IYDJ 3IH2A 1A5JA 1R9TJ 2P81A 1TWHJ 2LVSA 4J19A 3GTKJ 2G0EA 3K2AA 1T56A 1JKQC 3BTCA 2WAQN 1VNDA 3QQAA 3RZDJ 2O7OA 2LFBA 2X9DA 3JRHA 2DTZA 3LOCA 2FD5A 4W97A 3C2BA 4A3CJ 2DA6A 2QCOA 1U8BA 2PMZN 1IUFA 4JYKA 1H89C 2DMUA 1JUPA 2ID6A 4MFEA 2X6OA 1BW5A 4BY7J 4BBSJ 4JX4A 1JKPC 1TWCJ 4XIDA 1JT0A 3OIOA 1ETKA 2B63J 2ID3A 3OSFA 1HF0A 1UG2A 2CRGA 4FE7A 3SFIA 2R5ZB 5EYRA 5EGOA 2LR8A 2XSDC 4MFDA 5E3LA 4UUSB 5FKKA 4CYCB 1U9NA 4C2MJ 4FE4A 3JRIA 3QPLA 4BKXA 1NK2P 3HDDA 5F0FA 4IHYA 3Q0UA 1OCPA 3BQYA 2DMPA 3MN2A 2HYJA 1F36A 3E7LA 1IDYA 3FISA 2VPRA 3PM1A 2CJJA 4A3MJ 4FTHA 2VI6A 5JLXA 1JGGA 1SFOJ 3G1MA 4C3JJ 2Y31A 3ZQCA 3DEWA 1AKHA 4I76A 3ZQIA 1PUFB 1IGNA 3BTJA 5IOZA 2LD5A 3B6AA 2LY9A 2R5YB 2DJNA 3NARA 2XRLA 3S1NJ 5EEAA 2NOGA 2LTPA 2NS7A 2QF7A 4M3DA 2L7MP 2R5ZA 1P7IA 3S1RJ 5M5XJ 5C3EJ 4M3FA 1ZK8A 2MW8A 2O9LA 3A02A 3LSJA 2DMQA 4QTRA 3ZQLA 2DA2A 2X48A 3HKZN 1FIPA 5DTDA 3JRDA 2CQQA 1BJZA 2LKXA 4D7NA 2L7ZA 2LK2A 3W6VA 1ORKA 1Q1VA 3UKGA 3S2DJ 3JRGA 9ANTA 3TEDA 3GTMJ 5M3MJ 2XGCA 4A93J 3WHBA 1DU0A 2JN6A 5JLWA 1ZGWA 1HDDC 3OOUA 3HGGA 1WH5A 4RDUA 3CCYA 3F0CA 2E19A 1LFUP 2I10A 4V2FA 4X1EA 1ETXA 5J3LA 2K9NA 2VUMJ 2TCTA 3MKLA 1VF9A 4UUSA 1JJ6C 5C4XJ 3TW6A 2HDDA 1GV5A 3ZQHA 1F43A 1IRZA 2DMTA 3S2HJ 5E3MA 2ME6A 2HOSA 3FK7A 2MGQA 1RETA 1HDPA 2MG4A 4BY1J 2ZB9A 1Y1WJ 2AHQA 1B8IB 1AKHB 1DU6A 4NDLA 3HOZJ 1FTTA 2AO9A 2COBA 3HOVJ 2L9RA 2XPUA 3I4NJ 4HNVA 2LLKA 4DYQA 1SANA 3SJMA 3D1NI 1GV2A 1HCRA 1GUUA 4A3FJ 1AU7A 4A3JJ 4BXXJ 1ITYA 1HLVA 2NS8A 2XGEA 1BW6A 2EQRA 2Y9YA 4IEJA 4JX5A 2JA8J 3H0GJ 1U78A 4C3HJ 3A01B 3RQIA 3BR6A 2DA5A 5C44J 1GDTA 3HM5A 5K7HA 4DZPA 1OJLA 2R93J 4Y7NJ 5E3OA 1FJLA 1K61A 2EZHA 4FISA 3GTQJ 4BBRJ 2GM4A 2CU7A 1NK3P 2IEKA 3GTLJ 3VPRA 2EZIA 1LE8B 2JJ7A 1ZKGA 1QVUA 3GTPJ 1IV6A 2EH3A 1WCMJ 1ZR4A 3JRAA 5F0HA 4XRSG 3TW7A 4MIMA 1TC3C 4JX6A 2XPVA 1VI0A 5EZGA 5EG0B 2ECBA 1YRNA 2GBYA 5M5WJ 2OF7A 1D5YA 1RKTA 2K9QA 5IP9J 2HXIA 1FIAA 3HB9A 1APLC 1W0TA 3RKQA 4XICA 2JMWA 4W1UA 3CDLA 4ABZA 5IP6A 1ETYA 5GPCA 2XB5A 4MLOA 2M2EA 3FKIJ 2CQXA 2R92J 2FX0A 2DA3A 4A3DJ 2KDZA 1ZR2A 5IP7J 4IHVA 1JKOC 1XG1A 2K40A 3JREA 4IHXA 1E3OC 1JUSA 3CMYA 1MBHA 4DYRA 3Q0VA 2GLOA 1UMQA 3Q0WA 1ETOA 1ZQ3P 1MH3A 4D7MA 2Y9ZA 4LOCA 2IBDA 4G12A 2VKVA 3BQZA 3IH4A 1X2MA 2H1KA 3GBGA 2DA1A 2Y2ZA 4I6ZA 1RPWA 1OFCX 1BA5A 3HEFA 4IHWA 2O8KA 1GVDA 4DZJA 1MBEA 2HI3A 1ETWA 5EGOB 4S0HB 2D5VA 1NTCA 2WB1N 5FKMA 4DYCA 2NVYJ 2R0QC 4CYCA 5F27A 1IC8A 3GTGJ 1H8AC 3HBLA 1WI3A 4X6AJ 2FQ4A 2JK3A 2E2HJ 1ETVA 4A3KJ 1GT0C 2RAEA 3JRFA 1X58A 4D5CA 2MSYA 2CUEA 5EZHA 5BNGA 1YRNB 1RKWA 1S7EA 1IG7A 3PO2J 1K83J 3ZQGA 5M3FJ 2JWTA 4A3LJ 3BTLA 3MVPA 2R5YA 2CUFA 3A03A 3HOUJ 4QIWN 1JUMA 5GP9A 4GFBA 1XC5A 1TWFJ 2WV1A 1MBFA 4A3GJ 2L7FP 3S1MJ 1LFBA 2H8RA 4FCYA 1ENHA 4A3IJ 4A69C 5F1JA 5HODA 1VFCA 5DS9A 5F08A 1A6IA 4M6VA 3L1PA 1PUFA 3Q3SA 1Z77A 2HOTA
chains in the Genus database with same CATH superfamily
3CMMA 3R61A 3F6VA 1UJ8A 2M9HA 1HKTA 2HVQA 5FRNA 2ZXIA 4XR6A 4XRMA 4R8HA 3I64A 4B3XA 1FP1D 2VJ5A 4RGUA 2MC4A 4D1QA 1BR2A 1QHHD 2V79A 4L5EA 1FP2A 4OAYA 1GHCA 1OYWA 2ZNZA 2M4KA 5HDGA 2WADA 3CQZJ 2NVXJ 2BYVE 5EF6A 2ZJRF 3H3ZA 3DTKA 3K4CA 4G94A 2DK8A 1TL8A 1YO5C 3NRVA 4WXCA 3W6KB 4XKVA 1JHHA 3FK6A 2UWMA 2R7QA 3CJQB 1WH7A 5KCMA 3PUBA 3GTJJ 2EZKA 1X1CA 4A0YA 1YW7A 4HEA2 3CTAA 5GTHC 2OUMA 3Q5FA 4ZYAA 2COMA 2ECCA 2KQRA 4PSWA 1IN7A 4ZYGA 3OOPA 1Y39A 2QGUA 2HZTA 3HGYA 1WFXA 2ZMEC 1MD0A 4BU2A 1UFMA 1JTYA 4WCGA 2O03A 2MABA 3F8BA 3LAJA 1W0UA 1IF1A 4IQJA 4XBFA 3DP7A 3PFIA 2FNPA 4Y17A 1XS9A 3CC4I 3SFZA 3M4OJ 2WC2A 4HNUA 5JR3A 1QZZA 3CUQC 2E2JJ 4I0AA 3PO3J 3V7SA 3L9FA 4EVIA 2M0CA 2VBZA 3NQOA 2DA4A 2MLGA 5F04A 1VQ4I 4OMYA 2VE9A 5ILSA 3HYIA 4P96A 5GPAA 4YFKF 3JSOA 2LY2A 3CCMI 4OAZA 2VJ4A 3BJ6A 2IAIA 2R7WA 1KQ8A 4B48A 4AC0A 5J1YA 1I50J 2BZTA 2JRMA 2F48A 3TP0A 2FUG2 1ODDA 2NVQJ 2Q2EB 5LHHA 4IX7A 4EGZA 1QNTA 2FJ1A 4XLAA 3V42A 4D5FA 1BOBA 4II3A 3ABMH 3DLAA 4U0VA 3PNYA 5HNFA 2XGDA 4OOIA 1WKMA 2CS3A 2XB0X 2JZYA 3O2PE 3SHFA 2KT0A 2PX9A 3H5NA 3OYLA 2ELKA 4M3EA 3IH3A 2JA7J 1P7JA 5J4YA 1H88C 3SDGA 2OJED 2BXZA 4QPOA 2YR2A 3I4MJ 1WJEA 3TDZC 1TQMA 5FD5A 2IGOA 3L2VA 1JKRC 2HNHA 3OYKA 2OPTA 5FKLA 1R00A 2M1BA 1PVEA 2K4BA 2MC3A 3ASNH 4GRIA 4IHTA 1FYLA 4DJAA 1JTXA 1V4RA 3U9GA 3FIWA 2FBHA 4E70A 4KYWA 1G3WA 1MIJA 3B73A 2ACJA 2DODA 4OWRB 4RM3A 3AG3H 1J59A 1XB4A 4KICA 1WQ2A 3DTEA 1LQ1A 4B09A 1OCTC 5FLMJ 3CCJI 2F4OB 5J8CA 4IXAA 3BCBA 4U0YA 1WVRA 1A04A 2L0KA 3KYCB 1E3PA 3B6CA 1YE9A 1OCZH 1BC8C 3HOWJ 1MNMC 3U2RA 4HDVA 2RNGA 1IDZA 4MO7A 4M71A 4HZFA 4QSHA 4WF2A 3F23A 3E6CC 3BTIA 1HKQA 3BLYA 4M3BA 5ICCA 2P5LC 1X19A 1QGPA 3OS2A 3ZGKA 4J19A 2GXGA 1T56A 3GWZA 2WAQN 3OL4A 3TGNA 3QQAA 3FBIB 2WWYA 2DTZA 4LG0B 2QYOA 4W97A 3C2BA 3S8PA 3VSKA 2DA6A 2KJBA 1LB2A 2PMZN 1ACIA 3PIPF 4JYKA 1H89C 2CO5A 4YELA 4FX4A 1JUPA 3OYEA 3A1YA 4MFEA 1MMSA 4FX0A 3HTSB 2A05A 1JKPC 2GA1A 5D8LB 1JT0A 2OD5A 1G3SA 3OSFA 5CVRA 2W24A 1HF0A 2XDVA 1YQAA 2M8EA 3BPXA 2QKMB 3CD6I 1DGRM 3SFIA 2HYGD 3OL3A 1X3WB 5FKKA 1IN6A 3OYMA 2VQCA 3P9KA 3ABKH 1XSXA 2NS0A 5HLTA 1NK2P 2JTVA 5F0FA 3HDDA 4MHGA 2WTEA 1ERDA 1OCPA 1W7PB 3G3ZA 1OMIA 1F36A 3E7LA 3F9KA 5HLHA 1WRJA 2R7VA 4CCNA 4JOMA 3H9GA 1LPQA 4RB0A 1HC8A 1JGGA 1SFOJ 1K78B 2PLYA 3DEWA 2DT7B 2QLZA 4I76A 5LEJA 5IOZA 2R5YB 3NARA 1BN5A 4IPAA 2K02A 3SXYA 3K10A 2K27A 1BOAA 2NOGA 2NS7A 1LUJB 1XGOA 2NOJB 3E0JB 2L7MP 4LIVA 5D5UB 1PUEE 4NC6A 2R5ZA 2VB6A 1ZARA 2KRFA 1KQ9A 4M72A 1QPMA 1FOXA 1ZK8A 4CICA 1UB9A 3FF5A 2ZJQF 2O9LA 3LSJA 2DMQA 3ZQLA 2DA2A 3K1NA 3JRDA 2Y0MA 3Q9SA 2W84A 4D7NA 1J7KA 4HX4A 3I53A 5B1BH 5KAFC 1HA8A 3FHNA 4CCLA 2GQQA 3FMQA 2HGCA 2VBWA 4LK0F 5DCMA 3WU2C 2JN6A 1ON1A 1ZGWA 2R7SA 3OOUA 1HBXG 1X4OA 1WH5A 3CCYA 3F0CA 4Y13A 2X0LA 3OYGA 5GAGJ 1G59A 2TCTA 3QOEA 3MKLA 5DCFA 3RDIA 1RI7A 4BAYA 4UVBA 1ZELA 3ZMUA 1GV5A 2ZSIB 5B5EC 2EA2A 2E71A 1F43A 1KU3A 4P9UA 2CMPA 1IRZA 2ZJPF 4M74A 2DW4A 4HX7A 1FZPB 1YYVA 2LC2A 2FBIA 2OTJI 4HF0A 1LVKA 3RJPA 1HDPA 1U5TC 4BY1J 1B8IB 5GAEJ 1O7FA 1OR7C 4MEXF 2X6YA 2V4JC 3MKWB 3W3CA 3BDDA 3HOVJ 2QQBA 2XPUA 3C2GA 2LLKA 3CO6C 3J7AO 1HCRA 1GV2A 4H0EA 4A3FJ 1AU7A 3P9CA 3EUAA 2KP6A 2QUFA 4E7ZA 2CGPA 1SAXA 1SFUA 4XM3A 4L9JA 1UHMA 4C3HJ 1SVMA 4EM1A 3HRUA 1FMVA 4A0ZA 2KRCA 1LVAA 4KN7X 2QWWA 3KLOA 2CV0A 4NUBA 3PJRA 4UV9A 4RLQA 2VBXA 4ZC3A 4XONA 5ED4A 4GYIA 1CF7B 5DCMB 3TOBA 3F8NA 2PQ8A 3U1KA 4BQOA 2GA2A 1MJAA 2Y0SA 3CJRB 3GTLJ 2ZNYA 4NC7A 4A6EA 2EZIA 3GTPJ 1XMKA 2P8TA 4I7HA 2NRAC 3KX2A 4KN4X 2EH3A 2O6GE 3A0BC 1TNTA 5AIQA 2ZO4A 4EJTA 4XRSG 3TW7A 4MIMA 2LYCA 1ULYA 1K4SA 3G6EI 1ZH5A 2XPVA 1VI0A 1RNLA 4WX9A 4LLLA 2L5QA 5D4RA 3EDPA 1AA7A 1Z21A 5EZGA 4LB6B 4NQWA 5KK1A 2FRHA 5EG0B 2M4GA 3H3UA 1IRFA 5H20A 2F2EA 4IL6C 1I6XA 3VSLA 5HS8A 1RKTA 4G8XA 2ZCWA 2BY1A 2H09A 3RTRA 2STWA 5JHFA 3GZ6A 5J6XA 2M2EA 2LKPA 1YX5A 1R1UA 4IVNA 3LSKA 4A5NA 3KZYA 2P4WA 4CYDA 3WTXC 5L3FA 1ZR2A 5CPRB 1XG1A 2K40A 4BL0B 1E3OC 1JUSA 2VN2A 3KEOA 1EJ9A 4UY8I 1ETOA 1MH3A 2W57A 1IUYA 4D7MA 4KJZA 2EV6A 1OYYA 4LOCA 2IBDA 4KDPA 4PFPA 1Z3XA 2JUGA 2YSRA 4G6QA 4M73A 2DXIA 1MDMB 1X2MA 1FLIA 4BE0A 2DA1A 5K1YA 4U7DA 3LFKA 4CO8A 4E7LA 1GVDA 1SFXA 2YPRA 2D1HA 3LA7A 3MZYA 4U87A 3CP2A 1NHAA 2M0MA 5FKMA 4DYCA 5L3BA 4CYCA 2BVMA 1J09A 3LQRA 3HBLA 3R0AA 2H1LA 3H5AA 3CMAI 2E2HJ 4A3KJ 2RAEA 3JRFA 3N97A 3M1EA 1FNNA 3HG9A 1IRGA 2M7AA 5BNGA 2JVGA 2NNYA 3AG4H 2DU9A 1O57A 1IG7A 4XN3A 3K6GA 3PSIA 4I02A 5EJCA 4EV0A 5M3FJ 1YJWI 1X1DA 4C2UA 4K2EA 2XF6A 1R1VA 4RA2A 2EIMH 4XKWA 5TRDA 1Z6TA 3GFJA 3AL0B 3CJNA 1IN5A 3VOEA 2VC1A 1UZCA 1VQ7I 3S1MJ 2ZC2A 2Q2EA 1ENHA 1E0EA 1Z7LA 4A69C 1T8IA 3Q9VA 5HODA 5DS9A 4HSTA 4M6VA 2RREA 3WG9A 1BBYA 3H0DA 1PUFA 1JGSA 2W82A 2HOTA 4BYYA 2GWRA 5TGTA 2DYRH 3OMYA 3MQ0A 4XLEA 1H9TA 5JFRA 2HQ5A 4IQ4A 1Y1VJ 3PNVA 4OINF 2O3FA 4EEFG 5FKOA 1I3QJ 3WHCA 4N4OB 1YIJI 2XAHA 3T5XA 2FXAA 3BG5A 2YU9J 4ITVA 2QZ8A 1FTZA 5CVJA 1VQKI 3D0SA 3J7ZI 1FBUA 5JI6A 2R7UA 3G1LA 2M7BA 1VQ9I 1T98A 2TRTA 5DUKA 3BJOA 3BWGA 3K2ZA 1TZLA 2GOMA 4PJ0C 3G1OA 3FMRA 4XSXF 5D6FA 5FKNA 1XCBA 4AYBN 3OYBA 1IAWA 2HR3A 4A3EJ 3LSIA 4AIHA 2K5CA 1W5CC 1R5HA 1U9OA 2KIUA 2R7TA 1E17A 5J1UA 1F4KA 2E1OA 4U88A 4OIOF 1B72B 3HKZA 5D6EA 1MSEC 3HIFA 4C3IJ 3QYFA 3ERMA 3PUFA 2X51A 1FOWA 1TP4A 1POGA 1BIAA 3TQNA 2Y0SN 2W7NA 1P6RA 1RR7A 1WJFA 5E8GA 5ERIA 2V9VA 2MD0A 4E6KG 2XKOA 2GOXB 2JUCA 3RYRA 4N9HA 5M5YJ 5IY5H 3B02A 1ZTRA 3MAJA 1MKMA 3BR0A 4ZTJA 3RZOJ 3BR1A 3OR1C 3W2AA 4V19K 4PGGA 1QU3A 2IT0A 3PQKA 1HXDA 5IYBJ 4EJUA 2V7FA 1K7AA 2PI0A 4PZJA 2CSOA 4B3AA 4ZZDA 2FEZA 3QYEA 1MBGA 2A6EF 4XN0A 2EZLA 2JA5J 3CP8A 3A2KA 2Z9OA 3AL0C 5HDKA 1SFKA 4XLNF 1KONA 3V8KA 1NG6A 2EFQA 3ZMDA 1CQTA 3WE2A 2D45A 2WV0A 2E7WA 4XKBA 3BROA 4LFUA 3DBLB 3ZMTA 5D4SA 3E6BA 3A01A 1AHDP 3J7AY 3MFKA 4DQ2A 3QPHA 3K4BA 1W7PA 1JT6A 4IO9F 3O6BB 1S72I 2VQLA 5DD8A 4PK4A 1MBJA 4KITB 3WGGA 3FZVA 4E7KA 3ELKA 1UHSA 2XPWA 1ZLKA 1U5TA 1XMXA 1K78A 2V1UA 2KPMA 3TO9A 3KP7A 5E18F 1O3TA 3QPSA 4ENJA 3RYPA 2XF5A 1G3YA 2K9MA 4UNOA 4F92B 4UUTA 3TMOA 1Y56A 4BHBA 2Y30A 1LE8A 2PEXA 1CGPA 1TT5B 3LNQA 1B72A 1Z7UA 2L01A 2ZBKA 2XUBA 3MD2A 4RB3C 1SD7A 2VKHA 1MBKA 1JI8A 1JJ8C 1YJNI 2WY7Q 3ECHA 5K7FA 2CW8A 3TDUC 3ZQFA 4Q5SF 2X4HA 2M30A 3HOXJ 1RUOA 5E3NA 2VT3A 4EJVA 4DBRA 4HRIA 1YS6A 2HDCA 1LJ9A 1ZLJA 2O5RA 3MKYB 4ETSA 1KQ0A 3DTIA 2E2IJ 2EBIA 1XSDA 3PSFA 2LREA 1X2NA 5J1RA 3H36A 3RQ4A 1AOYA 4L5IA 3DU6A 4LJZF 2ZMEB 3IAS2 1R9TJ 3WU0A 3AFHA 3WU1B 2DJIA 2G0EA 1JKQC 3U21A 2OU2A 3ZMSA 3JRHA 3I9V2 3MKZA 2X1EA 3LOCA 1JE8A 4R1HA 4ZZLA 2QCOA 1U8BA 4Q47A 4HPQA 1YHQI 3GUDA 1WJ5A 1OCOH 1D0XA 3R0JA 5DD4A 2DPUA 2V6EA 1IUFA 1I5ZA 2R7OA 3F22A 1WJBA 3TL4X 3RKYA 3WTTC 1BW5A 1FOKA 4JX4A 4XIDA 3OIOA 5TISC 1FMWA 4N4NB 1QZEA 3EYYA 1BJAA 4RGSA 1UG2A 3GCMA 1X1BA 3MMYB 2IP2A 4HNTA 1D1AA 2R5ZB 1NG7A 2QA4I 4ZJZA 4CDGA 4MFDA 2BW3A 2LNBA 5E3LA 2IVMA 1R5ID 3J81Z 1T08B 1YITI 1WI9A 3ZRGA 2E35A 1U9NA 4FQGA 1S29A 1L0OC 4FE4A 2WAEA 1UHWA 1ZG3A 3GZ5A 4L18B 1IZ1A 2DMPA 2E7XA 1BI2A 3F8FA 1SMYF 4IJAA 4BDZA 5CVVA 2FMLA 4I09A 4FTHA 4ON0A 1IN8A 2GIVA 2Y31A 3ZQCA 1R58A 2STTA 1YX3A 1SD5A 3ZQIA 4BQNA 1IGNA 2LD5A 2JSPA 4XRFA 5E20A 1DQUA 4M9ZA 2XRLA 4BUPA 2LTPA 3GFMA 2GXAA 2H6BA 4AU7A 4NHJA 3EUHC 2QF7A 2LF7A 4OMZA 3AG1H 2A5YB 5DM6F 1CF7A 4RAFA 1S9HA 2G9WA 3ROUA 3OYAA 1VQMI 2LY1A 4P5OA 2ZSHB 3DU5A 2ELHA 1R5GA 3GX4X 1YI2I 4QTRA 2ETHA 5D5WB 2F4IA 1K79A 1J0RA 2X48A 2ZXHA 5DTDA 1KGSA 4BHPA 1ZRFA 1RR8C 2CFOA 2IA0A 1BI0A 3CJTB 1W36D 2HQAA 1F9NA 3W6VA 3JAMK 1FY7A 2DFHA 3H9JA 1V5GA 5DM7F 3H1CA 1VQPI 2ZFUA 2L4AA 3UKGA 5B66C 9ANTA 3TEDA 3L2WA 5M3MJ 2XGCA 3I71A 1N75A 3HRTA 2X6XA 1DU0A 5JLWA 2JSCA 2NAZA 3TO6A 4IHSA 1V55H 3BP8A 4V2FA 2VUMJ 5J3LA 2K9NA 2V9KA 3VYSB 1YG2A 1I39A 4UV8A 4PJMA 3DPUA 3I58A 2BBYA 5LHIA 1HSTA 5CJ9A 5GADJ 1FSHA 2W4SA 3HUGB 5LGTA 3S2HJ 5E3MA 3ZXSA 2ME6A 3L2UA 2HOSA 1DUXC 3OV8A 1R4NB 5GAHJ 2MG4A 3K70C 5ILVA 4IZZA 3E3VA 1VQNI 3KIOA 1DU6A 3BOQA 3HOZJ 1FTTA 4KMFA 2COBA 3LSTA 1Z1DA 2L9RA 3I4NJ 4JQFA 4HNVA 3UR3C 4KIBA 4AVPA 3D1NI 3FM3A 4PFOA 4MQ9F 2IS6A 4RAZA 1GVJA 1HLVA 1SVOA 1D8KA 1BW6A 2EK5A 4IEJA 4BS9A 1L3LA 2E5NA 1J5YA 3H0GJ 5F6FA 1U78A 4RGRA 2R4GA 2CUZA 2F5DA 4ASNA 3C7JA 1T38A 1IN4A 2H6CA 2DBBA 2DT6A 3SEQA 1R49A 3COAC 3HHGA 1DDNA 4IF4A 2E1MB 1XGSA 4LD5A 4M6XA 3QWLA 2CU7A 3CCVI 5ICFA 3VYUB 2AXLA 3VPRA 1Q1HA 4S04A 3KYDB 1VQ6I 4BE2A 4AM3A 4HX8A 2BGCA 4F93B 3JRAA 5F0HA 3S3MA 4HQMA 4IOAF 2WA0A 1HSJA 1PDNC 2QQ9A 2QKLB 3LA2A 2DOAA 3SEZA 3K0LA 4XORA 1I27A 5L3GA 2A61A 1D5YA 4CZZA 4L9NA 4G9YA 1TW2A 3E6MA 2LMDA 4EM2A 2HXIA 3HB9A 4MGRA 1MNEA 2W1OA 3CESA 2XROA 3RKQA 1T39A 5J4VA 2JMWA 2XIGA 4HAMA 4KNYA 2FOKA 5BMZA 4ESBA 2QBYB 2Q1ZB 5JVGF 4UVAA 2CQXA 3BZKA 4RB2C 2R92J 2DA3A 2LSOA 3EUKL 3M7GA 4HV6A 4KMUX 3FMSA 4E4HA 3QU3A 5E1WA 3F8MA 1MMDA 2DDAA 4DBQA 2E5ZA 3KLNA 3JREA 5HLGA 4DYRA 2Z1DA 2GLOA 1UMQA 2VQHA 2CH0A 2O61A 1LKXA 3JW4A 2Y9ZA 3GO5A 1K6OA 1P9QC 3J80Z 1X1PA 3AAFA 4G12A 3VYRB 1M1EB 4CA0A 4XMYA 2K85A 4CXFA 1WJCA 3FBNB 2H1KA 2IPQX 5D5VB 3N05A 1TTYA 4BQAA 2Y2ZA 4GO1A 1BA5A 2V26A 3HEFA 1P4AA 5E1XA 2HI3A 3BY6A 4KUMA 3EETA 5EGOB 4S0HB 3FM5A 2VJIA 2WB1N 3K4MA 2R0QC 1MJBA 1IC8A 3GTGJ 1H8AC 1WI3A 2JK3A 2D2WA 3OYJA 2A07F 1ETVA 5CVIA 1BR4A 3ISPA 1GT0C 3ASOH 2B0LA 2MD5A 2P0WA 4AIJA 4L9VA 1T0FA 1R23A 3ZQ7A 4DNCA 2CUEA 2R7DA 1ZAOA 4XLPF 1FOYA 2XASA 1S7EA 3PO2J 3HHHA 1TT0A 2JWTA 4HDUA 5FD6A 1RC9A 3A03A 4UXNA 5GP9A 2L2OA 3LQQA 1QQIA 1TWFJ 1XC5A 2VXZA 2EFNA 5HLIA 1U6GA 4OIPF 1VQ5I 2J5OA 3N4MA 4A3IJ 3K4LA 5FFZA 5F1JA 2VOPA 1A6IA 3L1PA 2A6HF 3P5JA 1KYWA 2V1DA 1ZYRF 4TV7A 1W7PD 4EGYA 1ZGAA 2Y75A 3GTOJ 3LA3A 4YIIA 5IYCJ 1U5TB 3ZMZA 3IKTA 2X6WA 4B8XA 2M8GX 1IXCA 2KISA 2OA4A 4AWXB 2O8XA 2VPLA 3FXKA 5FLXK 2PFBA 2XRNA 1TWAJ 3GVAA 4XK4A 4A12A 3S1QJ 2JRTA 3RI4A 2RV8A 1S5LC 1RIOH 3O8HA 3HOYJ 1Z0XA 1HOMA 5GTIC 2DCEA 4BJTA 3BJAA 4KA4A 1O3SA 4DW6A 1VQOI 2DOFA 1IV8A 1OKRA 1B4AA 1Y8RB 1XX5A 2VASA 3DKXA 3BZCA 3LSRA 1FPQA 3OS0A 2HKOA 2KRHA 2JA6J 3M1CA 1I6HJ 3I59B 3JAMZ 2G7HA 2Z99A 4E7HA 3S16J 2OAZA 4LK1F 2M34A 3C1DA 4HYEA 2IXSA 3TOAA 3DEEA 5FLVA 2ZKZA 1WWXA 1FEXA 1ZGJA 3R4KA 1P92A 3TP3A 3QP6A 2EFPA 3SZPA 1FBSA 3ABTA 4ESFA 1RESA 4KFCA 2ZMEA 2JQ7A 4O6JA 1B59A 2OQRA 3H3VK 3VB2A 1SAUA 1Y0NA 2L9NA 3JRCA 1NH3A 2I8DA 3KE2A 1O4XA 5K5QA 2VONA 1D1BA 2XHKA 4UVCA 1MH4A 2F4MB 3OS1A 3JTGA 4AIDA 2L7KA 2DMNA 2BV6A 5LGUA 2VKEA 5CLSA 3WGIA 1WHUA 4MNUA 4RLFA 2W48A 3M9AA 3S14J 4AUXA 3WODF 3VEPA 5LLQA 2YUSA 2HOAA 1BC7C 1KU2A 2QM3A 1G4DA 1OQYA 4U0WA 5EDNA 5HDNA 4F3QA 2F5CA 1R4MB 3GW2A 1PP7U 4ZTFA 2MH9A 5IPAA 3NWSA 3ERED 3S3OA 5IT9Z 2VL8A 3VDXA 2WY8Q 2G7UA 2HOEA 2HZDA 1D0YA 3K4KA 4L0YB 2LKSA 3OYNA 4N0BA 3L2RA 3QODA 3OSGA 1T0FC 3BR2A 5FJ8J 3PFYA 1SEUA 4DOZA 2LOOA 4G6DA 2HKXA 2AQFA 2DA7A 4O3MA 3S15J 3BR5A 3M3YJ 2BEOA 3T8RA 2FA5A 3OWTA 2VKDA 3MZ8A 3BR3A 1RZ4A 1EH6A 1QPIA 3JRBA 3PIOF 4V2GA 3IRRA 4BNCA 3FXLA 2R7XA 2VQGA 3O8GA 3IV5A 5F0CA 5C4JJ 4AVZA 3W2VA 2K3PA 2R7FA 1T2KA 1N78A 3WG7H 1G2HA 2FOWA 3VWBA 4NQWB 1JXSA 2KZGA 1EH7A 4A3BJ 2FQ3A 2LP0A 3K7AJ 5DYMA 2E34A 3BT9A 3CDIA 2NYXA 2CQ7A 5K5RA 2YS9A 2VIXA 1LNWA 2NXNB 4LLNA 5KVRA 2YX7A 4HA8A 5J40A 3S2WA 3ZOBA 5IOYA 1GLNA 2BW3B 4BXFA 3MWMA 3IH2A 2CV1A 2JT1A 1A5JA 3FWEA 4E7JA 5HOOA 2VODA 4CCMA 5CYVA 2CG4A 2LVSA 3KZIC 3K2AA 1MJ9A 3KPHA 3CC7I 2VJJA 3X2QH 2O7OA 2LFBA 2X9DA 1SFEA 2XGXA 3HPGA 4XLCA 2KFDA 3K9TA 2BY0A 2DAOA 3R6SA 4BHCA 1R1TA 2Z2SB 1FSEA 2FF4A 1KYZA 4IRHA 3KFWX 5A2QK 1QO0D 4I0BA 2ID6A 4OIRF 3I54A 2BHZA 3IWZA 1DP7P 4BY7J 2Q8KA 2Z16A 1Y6IA 1TWCJ 5BS6A 3CCUI 1G8XA 2B63J 4QPQA 5FRMA 4Y33A 3HRSA 2KL4A 3I4PA 3K1MA 4AIKA 4O5VA 1G3TA 1XCVA 2CRGA 2VC0A 1VQLI 1WZ2A 5EYRA 2LR8A 2CUJA 1SVLA 1VQ8I 3F72A 4UUSB 4CYCB 2KIQA 3U1DA 1PYVA 4EJWA 5KNLA 2H27A 3JRIA 3HZJA 2YX4A 3QPLA 4BKXA 4IHYA 1F1ZA 4JBAA 1SMTA 3Q0UA 3BQYA 3MN2A 3G71I 3FISA 1IDYA 3IP4B 3PM1A 2ESHA 4YIRX 2CJJA 4A3MJ 4RAYA 4UHTA 3CF5F 1H9GA 3CCRI 5JLXA 3QU6A 5AONA 1YTYA 1QA6A 4FT8A 3FXUA 4C3JJ 1A6QA 3DF8A 1S8NA 4EATA 4YG2F 1LDKB 3HOSA 5J8FA 2QSFX 4ZDLA 2DDBA 5KHDA 5CKTA 4RAGA 3S1NJ 1P4XA 4GXOA 2E1NA 1PJRA 2PMUA 3K4NA 4C30A 4ENNA 1P7IA 5D5XB 5L3CA 5C3EJ 3GMEA 3QPTA 5FO5A 1X3UA 2HYFA 5LRSA 3A02A 3DFGA 3ZMVA 1H0MA 3ZQQA 3HKZN 1D5VA 4E7SA 3DXJF 2RNJA 1IXSB 2CQQA 3A0HC 3CDHA 3DQVC 1BJZA 3LWFA 4ANJA 2XSJC 2OZUA 5E79C 2LKXA 1D3YA 2LK2A 1YS7A 3FX3A 2ESNA 1QBJA 4J01A 4CSWA 3CO7C 1Q1VA 3T0YA 2K9LA 3S2DJ 3JRGA 2CV2A 3GTMJ 1U2WA 3WHBA 1HW1A 5DDGA 3K69A 3RKWA 5DV5A 4RDUA 1ZRDA 1LFUP 5FROA 4P1WA 1LEBA 3H92A 4RMNA 3VYTB 4U7BA 2ZFWA 1VF9A 3HPHA 4XOTA 3DKWA 4UUSA 1JJ6C 2XAFA 5LRRA 3IUOA 2HDDA 2Z5UA 3ZQHA 2RDPA 4ENKA 4L9TA 1ZRCA 2DMTA 3E5QA 3ZN1A 2H94A 4CUGA 3S93A 2KLOA 1V5EA 4P55A 1R6RA 2A5WA 3FK7A 4WXHA 1Z67A 2GAUA 2BXYA 1R71A 4BJ5C 2DQLA 2ZB9A 4BQQA 4B43A 1OISA 3KZZA 4NDLA 5E17F 3E6DA 2CWEA 2AO9A 4ZYEA 1V5FA 2JVHA 2QVOA 1S3JA 4G7HF 3CF2A 4DYQA 1KU9A 4WXDA 1SANA 2PMHA 5FB2A 1GUUA 2L4MA 5FFXA 3ECOA 4HV5A 4BXXJ 1YOVB 2NS8A 5E1ZB 2EQRA 3REOA 4CCKA 2KMUA 2GIZA 1XDUA 4ESJA 1JHFA 3E5UA 3DBHB 3G4SI 3KP4A 1W4MA 4C2TA 2IGMA 1YW9A 2MH2A 2XAUA 3RQIA 1AWCA 2DK5A 3RKXA 3C18A 3ZP5A 1BI1A 3FXQA 5C44J 2LG4A 4M6YA 4Z2YA 1OJLA 1ZG1A 5E3OA 3K1PA 1MW7A 2IRFG 1O7LA 1FJLA 1K61A 2EZHA 2VBYA 1F5TA 3GTQJ 1BR1A 4BBRJ 1N77A 3IL2A 2L9SA 1LFPA 2OZ6A 2A6TA 3PQJA 3KYLA 3L2QA 1ZREA 3ZCOA 5E8IA 2ZXJA 4G6TB 4A2UA 4RB1A 2BY2A 2FMYA 2JJ7A 1QVUA 4GCVA 2EB7A 5TJJA 1IV6A 2B9SA 1WCMJ 5H6QA 1ZR4A 3GLXA 3SZGA 4IRGA 1R7JA 2QQ8A 5LD2C 1W36C 4CGZA 1Z3YA 3M8EA 4P9FA 2P7VB 3H5RA 5M5WJ 2HDWA 2OF7A 1FWZA 1IRXA 5ICGA 1ZN2A 3WTWC 1A31A 2JPCA 2MYSA 5LGNA 2V1XA 3CCQI 1ON2A 3D5RC 3AG2H 1W0TA 1EKEA 2V6CA 3I55I 3L7WA 4RGXA 4W1UA 5BPDA 1EA3A 4ABZA 2DFFA 5GPCA 1A35A 2HTSA 1I3AA 1A36A 3FKIJ 1REPC 2FX0A 4HF2A 3OYDA 4A3DJ 2ZJ2A 1DPRA 3FXJA 2R7RA 1XGMA 2AXTC 2KDZA 4IHVA 5IP7J 2DYSH 4EQQA 2QSGX 1TNSA 1IO2A 4LG0A 4F7ZA 4IHXA 1MBHA 5AIPA 1DPUA 2LBFB 3Q0WA 3E5XA 3RSNA 3DEUA 1KA8A 4D9JA 1TQPA 3PL8A 3IH4A 1R36A 3FXMA 3GBGA 3H35A 4AYBA 1J2XA 1O3QA 4I6ZA 4FETA 1RPWA 1UG0A 4IKFA 4N9IA 2O8KA 2PJPA 1MBEA 1ETWA 2X1DA 4KT5C 1E2XA 1NTCA 4ZYHA 1J9IA 3CUQA 2NVYJ 3QOPA 4CCOA 1W1WE 3NEUA 4YEJA 1WSUA 4ENMA 3FXRA 1I1GA 2ELJA 2PJRB 3HL2A 2M5WA 3MCZA 1YLFA 3DBRB 1OPCA 3LFUA 4BE1A 2E1MC 4D5CA 2XAGA 3A4CA 4UB6C 5BQTA 3EQLF 2P7CB 4A3LJ 3BTLA 1FC3A 3E97A 3MVPA 1E3HA 3TBIA 2R5YA 2CUFA 3JTHA 2EA4A 1RRJA 4CHUA 2A3SA 4A6DA 2D1VA 3C2HA 4OU0A 4M9XA 3RPUD 3ZN0A 4GFBA 2WV1A 1MBFA 4NBQA 4XSZF 3V8LA 4YFNF 4CZCA 2RN7A 4A3GJ 4EMSA 3W6JB 2UUZA 3NWTA 1LFBA 2EFOA 2EJRA 5CQEA 2H8RA 3DV8A 4FCYA 3J80K 3CCLI 1ONVA 1WJAA 3GXOA 4EJOA 3HXLA 3QYBA 2W00A 1I1SA 3IKVA 1X1AA 1TWGJ 2H8WA 3I56I 5LEKA 2HVRA 2HVSA 2B7EA 3OIPA 3F3XA 4I99C 4MTEA 2IGNA 2OCCH 2OBPA 4XNFA 2N8GA 4AD9A 1PP8F 3ZPLA 4Y4RA 3WGHA 2FNAA 4OIQF 2CW7A 3IRQA 1WGXA 2K9SA 3DCFA 3OY9A 2L02A 5IT3A 3CUOA 1U3EM 1IJWC 2ME0A 3CUQB 4Y15A 1S7OA 1BL0A 2AS5F 1QRYA 1N25A 1K4TA 5K7ZA 2RQQA 1MSFC 2KHMA 2BHYA 3OYIA 4PJLA 4I01A 4BXUA 2EIJH 1XDSA 2P5VA 2KDOA 2XKPA 3BG3A 1K6YA 3LMMA 3GYHX 3LSPA 1BIBA 2ISZA 1Z6RA 1EV7A 4Q48A 1B8IA 3BG6A 3CLOA 5J47A 2NVTJ 1SC7A 3HJEA 1B9NA 3WTSC 3BG9A 3I3LA 3NAUA 1XTAA 4LB5A 3H9QA 5FGMA 2X85A 3O3KA 1UELB 3HUGA 2R3SA 3DWLE 3LSGA 3CLQA 1USTA 1X4PA 2JPBA 2MFZA 3ONQA 3F21A 5HS7A 2HU9A 2WAFA 4G7ZF 1QVTA 1GXQA 2C6YA 4YFXF 4HQEA 1LDDA 3RIRA 4M9SA 3V7CA 3IHUA 2JA2A 5D8KB 3W2WA 4B47A 1T33A 2W85A 3HSFA 4BGDA 4S05A 3QRFF 1BM9A 3MZHA 2WB1A 4B1RA 1EF4A 3RPUA 4IOCF 4Y52J 2LH9A 2X1CA 4JP0A 2AQEA 3ZR8X 2L9VA 4XRSA 3IAM2 2RKHA 2R7ZJ 4F91B 2LRDA 3KP3A 2P5KA 6PAXA 3F8CA 4RM2A 2QEXI 2E1CA 3CC2I 3WE3A 2KJCA 1SD6A 4DIQA 5EG0A 3KP6A 5BPIA 4HSRA 1FBQA 1S7AA 2XAQA 4LITA 2XV4S 3M8JA 2HQNA 2Z3YA 5HNHA 2DN0A 1ZHFA 2E60A 3ESWB 3OR2C 1WPKA 1J75A 1WJDA 5HS9A 1VTNC 2EPFA 2QENA 4YIFA 2L3DA 3MEXA 4GYGA 2HXOA 5F64A 2W25A 3JR9A 2F5EA 2GZWA 1ETQA 4M3GA 1KU7A 3BC8A 4WWCA 2NVUB 1KZHA 3S17J 3OYHA 2LF8A 2XVCA 4KIFA 2I5UA 5B3SH 3SYTA 3WTYC 5EEHA 2KKOA 4PDKA 3HTUA 4D0PA 2DLLA 2HPMA 4B4CA 2QBYA 2IS4A 3BZ6A 4RBOA 4PJNA 1MDMA 4HOBA 1MMGA 2UXNA 1P2FA 3EUHA 5IYDJ 3WTZA 1SD4A 2P81A 1TWHJ 3GTKJ 1EH8A 2O0YA 3BTCA 3V4GA 1VNDA 3HSEA 4XL9A 3RZDJ 5H2FC 4UB8C 1YW8A 1B6AA 3LAPA 5A2QZ 3OYFA 2FD5A 4ZDOA 4A3CJ 3QAHA 2OTLI 2Z33A 2Q0OA 4F52A 2ZXWH 5B1AH 2DMUA 4PSXA 3BG7A 2X6OA 1VZ0A 2EWNA 2CW0F 1MMAA 4BBSJ 3SZTA 1ETKA 3BPVA 3I5UA 3AKZA 2ID3A 1YFHA 4WK8F 3DKYA 4FE7A 3RCOA 3J81K 3DPLC 1GXPA 2K4JA 3P7NA 3L09A 5EGOA 1HKSA 2M3AA 2XSDC 2L54A 2RGVA 4Q4ZF 5ICEA 4PJJA 3KEQA 1MNDA 4FHTA 3GEZA 2V9PA 1Y8QB 2Y48A 4C2MJ 1LEAA 2MLKA 1MGTA 1HQCA 5LHGA 2HYJA 2WBMA 1XPXA 2VPRA 3OIQA 3L2CA 1XSVA 2VI6A 2IJLA 4I98B 2ISYA 4B44A 3G1MA 4LG3A 2XF7A 2VXDA 2V1NA 4J00A 1YIOA 1AKHA 3DPTA 1PUFB 3T1BA 3BTJA 4BEHB 3B6AA 5KAIC 2LY9A 3GFLA 2DJNA 4I2OA 4LMYA 1V3FA 2RQPA 5EEAA 1P4WA 1ZG5A 4E7IA 4XLFA 2HEOA 4M3DA 3KP2A 4MQVA 2DTRA 3S1RJ 4HBLA 5M5XJ 4M3FA 2MW8A 3L00A 4BACA 2K86A 1FIPA 3M07A 1TW3A 2VT2A 3SDBA 4MTDA 2KZVA 4ZH4F 3ABLH 1Y0UA 3IWFA 2L7ZA 4KIGA 4CH7A 4G7OF 4DGWB 4XQFA 1TLHB 1ORKA 1HW2A 2HFHA 5IT9K 4II2A 1STZA 5EEGA 4A93J 2VE8A 2FSWA 2HS5A 2OC6A 2OQGA 5LBQA 1DGWY 1D8JA 5ILUA 1OYIA 1HDDC 4MEYF 3HGGA 1X3ZB 2PMZA 2E19A 3TO7A 3C3WA 2I10A 2Y69H 4X1EA 1ETXA 1T6SA 1W5TA 4ZYDA 4RS8A 2WAQA 5C4XJ 2M45A 3TW6A 2BOLA 1V54H 3CMEI 1USSA 5K5OA 4L0ZB 3KCCA 2CQNA 3I59A 5DEQA 3GF2A 3SQNA 4IRIA 2BE5F 3CCSI 5CVUA 2ADUA 3HSRA 3R60A 2HTJA 5JHUA 1U0JA 2F6CA 2IA2A 2BVLA 2LBFA 2MGQA 4YRVA 1RETA 2FBKA 3FKJA 1Y1WJ 2AHQA 1AKHB 4BEHA 1FYMA 1S6LA 2CFXA 2P6SA 3J7YJ 3SJMA 3G73A 2HQRA 3OYCA 4A3JJ 3E1SA 1ITYA 5HVQC 2FE3A 1RUNA 3G2BA 2XGEA 2Y9YA 3I0TA 2XAJA 4JX5A 1Z9CA 2JA8J 1R22A 3FXOA 2PN6A 3S3NA 3A01B 3GLLA 5DUIA 3EPZA 3QP5A 4LGWA 4QLCU 3BR6A 2DA5A 1GDTA 3HM5A 1OR7A 4BJ6C 5K7HA 4DZPA 3LL7A 1UCRA 3VODA 2R93J 4Y7NJ 4GGGA 1FX7A 1TQIA 2BY3A 3HOTA 1IXRC 4FISA 3F6OA 1IW7F 1XMAA 3ABUA 2HWVA 3D5LA 1YJ9I 1B1BA 2GM4A 4R79A 5FLXZ 3EYIA 3HC7A 1D1CA 1NK3P 2IEKA 2LDUA 4CCJA 4HLXA 3DLLF 2PBIA 2ICWG 1LE8B 1ZKGA 2UZKA 4LLGF 2VLAA 1QHGA 1D0ZA 1QZYA 4JK1X 3TKYA 4HF1A 3D5SC 3T8TA 1TC3C 4JX6A 2PG4A 2EV0A 1LDJA 2E36A 3CZ6A 4UUVA 2CQKA 1MZBA 3BCAA 3UNGC 1O3RA 2ECBA 5F1RA 1DP3A 1YRNA 2GBYA 3ML6A 4ZDPA 5JVTA 3JCUC 1T95A 2K9QA 5IP9J 1FIAA 1APLC 3IC7A 4A0XA 2IS2A 4HG2A 4XICA 3K70D 2DO7A 2EV5A 3CDLA 1B9MA 5IP6A 1ETYA 4X0GA 4Y3OA 2XB5A 1Z05A 2NNNA 4MLOA 2EILH 2IGKA 3P9IA 2OV7A 1OLTA 4KT6A 2RC4A 4XOPA 2MBFA 1JKOC 2PJRA 4HLYA 3ULQB 3CMYA 3FHZA 3Q0VA 2IW5A 2XC7A 1ZQ3P 2EFWA 1U8RA 2P6TA 4XKCA 1OCRH 4H4KC 2A68F 2VOOA 2F5VA 2VKVA 2RVCA 2QQAA 3BQZA 2MA3A 2KIMA 1XGNA 3KEYA 3JSPA 2OCEA 2A69F 2DQRA 4BDYA 4PCQA 1OFCX 3KETA 2J5PA 4NC8A 2DT5A 4IHWA 5L3EA 4DZJA 3KP5A 2DPDA 3CCEI 1TBXA 2D5VA 4QWQA 2CYYA 2K7LA 2GXBA 5F27A 5LFAA 3PNTA 2HPIA 2IA1A 1OCCH 2UV1A 4LIUA 4X6AJ 2FQ4A 4NNJA 2QSHX 1X58A 1BI3A 5CQGA 4C9YA 2DFIA 5BOXA 3RPQA 3GZNB 1G6NA 2FU4A 4PGHA 1C0WA 3HRMA 2MSYA 1HW5A 2K3FA 5EZHA 1FT9A 2UXXA 4Z6YA 4NB5A 3V7RA 1YRNB 1RKWA 1XN7A 3LSMA 1XD7A 2DOEA 1K83J 1Z91A 3WTUC 3ZQGA 1W5SA 3GFIA 2F5FA 3V8JA 3FDYA 4L5JA 3WTVC 1FYKA 3LSHA 4BH9A 3VFZA 3M8FA 4XLHA 1JUMA 4QIWN 4HW0A 3HOUJ 2KIFA 4PUSA 1UAAA 2DI3A 2EIKH 2L7FP 4A5MA 2M87A 3S32A 3K4JA 2TDXA 4FASD 2IS1A 2YU3A 5L3DA 2DFEA 1MMNA 1VFCA 5F08A 4F55A 4GDFA 4KISA 5H6RA 2EINH 3Q3SA 1Z77A 4EM0B
chains in the Genus database with same CATH topology
2M9HA 3GTOJ 5IYCJ 2HQ5A 1TWGJ 2M8GX 4XRMA 1Y1VJ 4EEFG 5FKOA 1I3QJ 1TWAJ 3WHCA 4XK4A 3S1QJ 4L5EA 3BG5A 2N8GA 3O8HA 2YU9J 3HOYJ 1FTZA 1Z0XA 1HOMA 3CQZJ 2NVXJ 5EF6A 3G1LA 1WGXA 2K9SA 3DCFA 4DW6A 2TRTA 1IJWC 2ME0A 3FK6A 3LSRA 1BL0A 1QRYA 3G1OA 4AYBN 2JA6J 1I6HJ 5FKNA 1WH7A 5K7ZA 3GTJJ 2EZKA 4A3EJ 1MSFC 3S16J 1U9OA 2ECCA 2M34A 5J1UA 2E1OA 3BG3A 5FLVA 3HGYA 1FEXA 1B72B 1MSEC 3LSPA 3TP3A 1JTYA 4C3IJ 1B8IA 1W0UA 2NVTJ 1POGA 1RESA 1XS9A 2Y0SN 3M4OJ 1RR7A 3BG9A 3NAUA 3H3VK 2E2JJ 3JRCA 1O4XA 3PO3J 5M5YJ 1MH4A 1ZTRA 2M0CA 3LSGA 3BR0A 3RZOJ 3BR1A 2DA4A 5F04A 2DMNA 2VKEA 5IYBJ 2W48A 5GPAA 4B3AA 1QVTA 3S14J 4AUXA 2YUSA 2HOAA 1MBGA 2IAIA 2EZLA 2JA5J 4AC0A 5EDNA 1T33A 5J1YA 1I50J 5IPAA 3TP0A 1CQTA 2NVQJ 4B1RA 1EF4A 4Y52J 2FJ1A 3A01A 4D5FA 1AHDP 4JP0A 4XRSA 2R7ZJ 3OSGA 1JT6A 3BR2A 2XGDA 5FJ8J 2XB0X 1MBJA 2KT0A 1UHSA 2ELKA 2XPWA 3IH3A 4M3EA 2DA7A 2JA7J 1P7JA 3S15J 3BR5A 3M3YJ 5EG0A 3QPSA 1H88C 3SDGA 3BR3A 3I4MJ 4UUTA 1QPIA 1JKRC 3JRBA 4V2GA 2Y30A 1LE8A 2OPTA 5FKLA 2DN0A 3LNQA 1B72A 3O8GA 1WPKA 3IV5A 5F0CA 5C4JJ 1MBKA 1JTXA 1JJ8C 3FIWA 5K7FA 2HXOA 3ZQFA 1G2HA 3JR9A 1OCTC 3HOXJ 1ETQA 4M3GA 5E3NA 5FLMJ 4A3BJ 2LP0A 3K7AJ 3BT9A 3S17J 2YS9A 2L0KA 3B6CA 3HOWJ 1MNMC 2E2IJ 1IDZA 4MO7A 2EBIA 3ZOBA 1X2NA 4QSHA 5J1RA 4B4CA 5IOYA 4RBOA 3BTIA 4M3BA 5IYDJ 3IH2A 1A5JA 1R9TJ 2P81A 1TWHJ 2LVSA 4J19A 3GTKJ 2G0EA 3K2AA 1T56A 1JKQC 3BTCA 2WAQN 1VNDA 3QQAA 3RZDJ 2O7OA 2LFBA 2X9DA 3JRHA 2DTZA 3LOCA 2FD5A 4W97A 3C2BA 4A3CJ 2DA6A 2QCOA 1U8BA 2PMZN 1IUFA 4JYKA 1H89C 2DMUA 1JUPA 2ID6A 4MFEA 2X6OA 1BW5A 4BY7J 4BBSJ 4JX4A 1JKPC 1TWCJ 4XIDA 1JT0A 3OIOA 1ETKA 2B63J 2ID3A 3OSFA 1HF0A 1UG2A 2CRGA 4FE7A 3SFIA 2R5ZB 5EYRA 5EGOA 2LR8A 2XSDC 4MFDA 5E3LA 4UUSB 5FKKA 4CYCB 1U9NA 4C2MJ 4FE4A 3JRIA 3QPLA 4BKXA 1NK2P 3HDDA 5F0FA 4IHYA 3Q0UA 1OCPA 3BQYA 2DMPA 3MN2A 2HYJA 1F36A 3E7LA 1IDYA 3FISA 2VPRA 3PM1A 2CJJA 4A3MJ 4FTHA 2VI6A 5JLXA 1JGGA 1SFOJ 3G1MA 4C3JJ 2Y31A 3ZQCA 3DEWA 1AKHA 4I76A 3ZQIA 1PUFB 1IGNA 3BTJA 5IOZA 2LD5A 3B6AA 2LY9A 2R5YB 2DJNA 3NARA 2XRLA 3S1NJ 5EEAA 2NOGA 2LTPA 2NS7A 2QF7A 4M3DA 2L7MP 2R5ZA 1P7IA 3S1RJ 5M5XJ 5C3EJ 4M3FA 1ZK8A 2MW8A 2O9LA 3A02A 3LSJA 2DMQA 4QTRA 3ZQLA 2DA2A 2X48A 3HKZN 1FIPA 5DTDA 3JRDA 2CQQA 1BJZA 2LKXA 4D7NA 2L7ZA 2LK2A 3W6VA 1ORKA 1Q1VA 3UKGA 3S2DJ 3JRGA 9ANTA 3TEDA 3GTMJ 5M3MJ 2XGCA 4A93J 3WHBA 1DU0A 2JN6A 5JLWA 1ZGWA 1HDDC 3OOUA 3HGGA 1WH5A 4RDUA 3CCYA 3F0CA 2E19A 1LFUP 2I10A 4V2FA 4X1EA 1ETXA 5J3LA 2K9NA 2VUMJ 2TCTA 3MKLA 1VF9A 4UUSA 1JJ6C 5C4XJ 3TW6A 2HDDA 1GV5A 3ZQHA 1F43A 1IRZA 2DMTA 3S2HJ 5E3MA 2ME6A 2HOSA 3FK7A 2MGQA 1RETA 1HDPA 2MG4A 4BY1J 2ZB9A 1Y1WJ 2AHQA 1B8IB 1AKHB 1DU6A 4NDLA 3HOZJ 1FTTA 2AO9A 2COBA 3HOVJ 2L9RA 2XPUA 3I4NJ 4HNVA 2LLKA 4DYQA 1SANA 3SJMA 3D1NI 1GV2A 1HCRA 1GUUA 4A3FJ 1AU7A 4A3JJ 4BXXJ 1ITYA 1HLVA 2NS8A 2XGEA 1BW6A 2EQRA 2Y9YA 4IEJA 4JX5A 2JA8J 3H0GJ 1U78A 4C3HJ 3A01B 3RQIA 3BR6A 2DA5A 5C44J 1GDTA 3HM5A 5K7HA 4DZPA 1OJLA 2R93J 4Y7NJ 5E3OA 1FJLA 1K61A 2EZHA 4FISA 3GTQJ 4BBRJ 2GM4A 2CU7A 1NK3P 2IEKA 3GTLJ 3VPRA 2EZIA 1LE8B 2JJ7A 1ZKGA 1QVUA 3GTPJ 1IV6A 2EH3A 1WCMJ 1ZR4A 3JRAA 5F0HA 4XRSG 3TW7A 4MIMA 1TC3C 4JX6A 2XPVA 1VI0A 5EZGA 5EG0B 2ECBA 1YRNA 2GBYA 5M5WJ 2OF7A 1D5YA 1RKTA 2K9QA 5IP9J 2HXIA 1FIAA 3HB9A 1APLC 1W0TA 3RKQA 4XICA 2JMWA 4W1UA 3CDLA 4ABZA 5IP6A 1ETYA 5GPCA 2XB5A 4MLOA 2M2EA 3FKIJ 2CQXA 2R92J 2FX0A 2DA3A 4A3DJ 2KDZA 1ZR2A 5IP7J 4IHVA 1JKOC 1XG1A 2K40A 3JREA 4IHXA 1E3OC 1JUSA 3CMYA 1MBHA 4DYRA 3Q0VA 2GLOA 1UMQA 3Q0WA 1ETOA 1ZQ3P 1MH3A 4D7MA 2Y9ZA 4LOCA 2IBDA 4G12A 2VKVA 3BQZA 3IH4A 1X2MA 2H1KA 3GBGA 2DA1A 2Y2ZA 4I6ZA 1RPWA 1OFCX 1BA5A 3HEFA 4IHWA 2O8KA 1GVDA 4DZJA 1MBEA 2HI3A 1ETWA 5EGOB 4S0HB 2D5VA 1NTCA 2WB1N 5FKMA 4DYCA 2NVYJ 2R0QC 4CYCA 5F27A 1IC8A 3GTGJ 1H8AC 3HBLA 1WI3A 4X6AJ 2FQ4A 2JK3A 2E2HJ 1ETVA 4A3KJ 1GT0C 2RAEA 3JRFA 1X58A 4D5CA 2MSYA 2CUEA 5EZHA 5BNGA 1YRNB 1RKWA 1S7EA 1IG7A 3PO2J 1K83J 3ZQGA 5M3FJ 2JWTA 4A3LJ 3BTLA 3MVPA 2R5YA 2CUFA 3A03A 3HOUJ 4QIWN 1JUMA 5GP9A 4GFBA 1XC5A 1TWFJ 2WV1A 1MBFA 4A3GJ 2L7FP 3S1MJ 1LFBA 2H8RA 4FCYA 1ENHA 4A3IJ 4A69C 5F1JA 5HODA 1VFCA 5DS9A 5F08A 1A6IA 4M6VA 3L1PA 1PUFA 3Q3SA 1Z77A 2HOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9H A;  3GTO J;  5IYC J;  2HQ5 A;  1TWG J;  2M8G X;  4XRM A;  1Y1V J;  4EEF G;  5FKO A;  1I3Q J;  1TWA J;  3WHC A;  4XK4 A;  3S1Q J;  4L5E A;  3BG5 A;  2N8G A;  3O8H A;  2YU9 J;  3HOY J;  1FTZ A;  1Z0X A;  1HOM A;  3CQZ J;  2NVX J;  5EF6 A;  3G1L A;  1WGX A;  2K9S A;  3DCF A;  4DW6 A;  2TRT A;  1IJW C;  2ME0 A;  3FK6 A;  3LSR A;  1BL0 A;  1QRY A;  3G1O A;  4AYB N;  2JA6 J;  1I6H J;  5FKN A;  1WH7 A;  5K7Z A;  3GTJ J;  2EZK A;  4A3E J;  1MSF C;  3S16 J;  1U9O A;  2ECC A;  2M34 A;  5J1U A;  2E1O A;  3BG3 A;  5FLV A;  3HGY A;  1FEX A;  1B72 B;  1MSE C;  3LSP A;  3TP3 A;  1JTY A;  4C3I J;  1B8I A;  1W0U A;  2NVT J;  1POG A;  1RES A;  1XS9 A;  2Y0S N;  3M4O J;  1RR7 A;  3BG9 A;  3NAU A;  3H3V K;  2E2J J;  3JRC A;  1O4X A;  3PO3 J;  5M5Y J;  1MH4 A;  1ZTR A;  2M0C A;  3LSG A;  3BR0 A;  3RZO J;  3BR1 A;  2DA4 A;  5F04 A;  2DMN A;  2VKE A;  5IYB J;  2W48 A;  5GPA A;  4B3A A;  1QVT A;  3S14 J;  4AUX A;  2YUS A;  2HOA A;  1MBG A;  2IAI A;  2EZL A;  2JA5 J;  4AC0 A;  5EDN A;  1T33 A;  5J1Y A;  1I50 J;  5IPA A;  3TP0 A;  1CQT A;  2NVQ J;  4B1R A;  1EF4 A;  4Y52 J;  2FJ1 A;  3A01 A;  4D5F A;  1AHD P;  4JP0 A;  4XRS A;  2R7Z J;  3OSG A;  1JT6 A;  3BR2 A;  2XGD A;  5FJ8 J;  2XB0 X;  1MBJ A;  2KT0 A;  1UHS A;  2ELK A;  2XPW A;  3IH3 A;  4M3E A;  2DA7 A;  2JA7 J;  1P7J A;  3S15 J;  3BR5 A;  3M3Y J;  5EG0 A;  3QPS A;  1H88 C;  3SDG A;  3BR3 A;  3I4M J;  4UUT A;  1QPI A;  1JKR C;  3JRB A;  4V2G A;  2Y30 A;  1LE8 A;  2OPT A;  5FKL A;  2DN0 A;  3LNQ A;  1B72 A;  3O8G A;  1WPK A;  3IV5 A;  5F0C A;  5C4J J;  1MBK A;  1JTX A;  1JJ8 C;  3FIW A;  5K7F A;  2HXO A;  3ZQF A;  1G2H A;  3JR9 A;  1OCT C;  3HOX J;  1ETQ A;  4M3G A;  5E3N A;  5FLM J;  4A3B J;  2LP0 A;  3K7A J;  3BT9 A;  3S17 J;  2YS9 A;  2L0K A;  3B6C A;  3HOW J;  1MNM C;  2E2I J;  1IDZ A;  4MO7 A;  2EBI A;  3ZOB A;  1X2N A;  4QSH A;  5J1R A;  4B4C A;  5IOY A;  4RBO A;  3BTI A;  4M3B A;  5IYD J;  3IH2 A;  1A5J A;  1R9T J;  2P81 A;  1TWH J;  2LVS A;  4J19 A;  3GTK J;  2G0E A;  3K2A A;  1T56 A;  1JKQ C;  3BTC A;  2WAQ N;  1VND A;  3QQA A;  3RZD J;  2O7O A;  2LFB A;  2X9D A;  3JRH A;  2DTZ A;  3LOC A;  2FD5 A;  4W97 A;  3C2B A;  4A3C J;  2DA6 A;  2QCO A;  1U8B A;  2PMZ N;  1IUF A;  4JYK A;  1H89 C;  2DMU A;  1JUP A;  2ID6 A;  4MFE A;  2X6O A;  1BW5 A;  4BY7 J;  4BBS J;  4JX4 A;  1JKP C;  1TWC J;  4XID A;  1JT0 A;  3OIO A;  1ETK A;  2B63 J;  2ID3 A;  3OSF A;  1HF0 A;  1UG2 A;  2CRG A;  4FE7 A;  3SFI A;  2R5Z B;  5EYR A;  5EGO A;  2LR8 A;  2XSD C;  4MFD A;  5E3L A;  4UUS B;  5FKK A;  4CYC B;  1U9N A;  4C2M J;  4FE4 A;  3JRI A;  3QPL A;  4BKX A;  1NK2 P;  3HDD A;  5F0F A;  4IHY A;  3Q0U A;  1OCP A;  3BQY A;  2DMP A;  3MN2 A;  2HYJ A;  1F36 A;  3E7L A;  1IDY A;  3FIS A;  2VPR A;  3PM1 A;  2CJJ A;  4A3M J;  4FTH A;  2VI6 A;  5JLX A;  1JGG A;  1SFO J;  3G1M A;  4C3J J;  2Y31 A;  3ZQC A;  3DEW A;  1AKH A;  4I76 A;  3ZQI A;  1PUF B;  1IGN A;  3BTJ A;  5IOZ A;  2LD5 A;  3B6A A;  2LY9 A;  2R5Y B;  2DJN A;  3NAR A;  2XRL A;  3S1N J;  5EEA A;  2NOG A;  2LTP A;  2NS7 A;  2QF7 A;  4M3D A;  2L7M P;  2R5Z A;  1P7I A;  3S1R J;  5M5X J;  5C3E J;  4M3F A;  1ZK8 A;  2MW8 A;  2O9L A;  3A02 A;  3LSJ A;  2DMQ A;  4QTR A;  3ZQL A;  2DA2 A;  2X48 A;  3HKZ N;  1FIP A;  5DTD A;  3JRD A;  2CQQ A;  1BJZ A;  2LKX A;  4D7N A;  2L7Z A;  2LK2 A;  3W6V A;  1ORK A;  1Q1V A;  3UKG A;  3S2D J;  3JRG A;  9ANT A;  3TED A;  3GTM J;  5M3M J;  2XGC A;  4A93 J;  3WHB A;  1DU0 A;  2JN6 A;  5JLW A;  1ZGW A;  1HDD C;  3OOU A;  3HGG A;  1WH5 A;  4RDU A;  3CCY A;  3F0C A;  2E19 A;  1LFU P;  2I10 A;  4V2F A;  4X1E A;  1ETX A;  5J3L A;  2K9N A;  2VUM J;  2TCT A;  3MKL A;  1VF9 A;  4UUS A;  1JJ6 C;  5C4X J;  3TW6 A;  2HDD A;  1GV5 A;  3ZQH A;  1F43 A;  1IRZ A;  2DMT A;  3S2H J;  5E3M A;  2ME6 A;  2HOS A;  3FK7 A;  2MGQ A;  1RET A;  1HDP A;  2MG4 A;  4BY1 J;  2ZB9 A;  1Y1W J;  2AHQ A;  1B8I B;  1AKH B;  1DU6 A;  4NDL A;  3HOZ J;  1FTT A;  2AO9 A;  2COB A;  3HOV J;  2L9R A;  2XPU A;  3I4N J;  4HNV A;  2LLK A;  4DYQ A;  1SAN A;  3SJM A;  3D1N I;  1GV2 A;  1HCR A;  1GUU A;  4A3F J;  1AU7 A;  4A3J J;  4BXX J;  1ITY A;  1HLV A;  2NS8 A;  2XGE A;  1BW6 A;  2EQR A;  2Y9Y A;  4IEJ A;  4JX5 A;  2JA8 J;  3H0G J;  1U78 A;  4C3H J;  3A01 B;  3RQI A;  3BR6 A;  2DA5 A;  5C44 J;  1GDT A;  3HM5 A;  5K7H A;  4DZP A;  1OJL A;  2R93 J;  4Y7N J;  5E3O A;  1FJL A;  1K61 A;  2EZH A;  4FIS A;  3GTQ J;  4BBR J;  2GM4 A;  2CU7 A;  1NK3 P;  2IEK A;  3GTL J;  3VPR A;  2EZI A;  1LE8 B;  2JJ7 A;  1ZKG A;  1QVU A;  3GTP J;  1IV6 A;  2EH3 A;  1WCM J;  1ZR4 A;  3JRA A;  5F0H A;  4XRS G;  3TW7 A;  4MIM A;  1TC3 C;  4JX6 A;  2XPV A;  1VI0 A;  5EZG A;  5EG0 B;  2ECB A;  1YRN A;  2GBY A;  5M5W J;  2OF7 A;  1D5Y A;  1RKT A;  2K9Q A;  5IP9 J;  2HXI A;  1FIA A;  3HB9 A;  1APL C;  1W0T A;  3RKQ A;  4XIC A;  2JMW A;  4W1U A;  3CDL A;  4ABZ A;  5IP6 A;  1ETY A;  5GPC A;  2XB5 A;  4MLO A;  2M2E A;  3FKI J;  2CQX A;  2R92 J;  2FX0 A;  2DA3 A;  4A3D J;  2KDZ A;  1ZR2 A;  5IP7 J;  4IHV A;  1JKO C;  1XG1 A;  2K40 A;  3JRE A;  4IHX A;  1E3O C;  1JUS A;  3CMY A;  1MBH A;  4DYR A;  3Q0V A;  2GLO A;  1UMQ A;  3Q0W A;  1ETO A;  1ZQ3 P;  1MH3 A;  4D7M A;  2Y9Z A;  4LOC A;  2IBD A;  4G12 A;  2VKV A;  3BQZ A;  3IH4 A;  1X2M A;  2H1K A;  3GBG A;  2DA1 A;  2Y2Z A;  4I6Z A;  1RPW A;  1OFC X;  1BA5 A;  3HEF A;  4IHW A;  2O8K A;  1GVD A;  4DZJ A;  1MBE A;  2HI3 A;  1ETW A;  5EGO B;  4S0H B;  2D5V A;  1NTC A;  2WB1 N;  5FKM A;  4DYC A;  2NVY J;  2R0Q C;  4CYC A;  5F27 A;  1IC8 A;  3GTG J;  1H8A C;  3HBL A;  1WI3 A;  4X6A J;  2FQ4 A;  2JK3 A;  2E2H J;  1ETV A;  4A3K J;  1GT0 C;  2RAE A;  3JRF A;  1X58 A;  4D5C A;  2MSY A;  2CUE A;  5EZH A;  5BNG A;  1YRN B;  1RKW A;  1S7E A;  1IG7 A;  3PO2 J;  1K83 J;  3ZQG A;  5M3F J;  2JWT A;  4A3L J;  3BTL A;  3MVP A;  2R5Y A;  2CUF A;  3A03 A;  3HOU J;  4QIW N;  1JUM A;  5GP9 A;  4GFB A;  1XC5 A;  1TWF J;  2WV1 A;  1MBF A;  4A3G J;  2L7F P;  3S1M J;  1LFB A;  2H8R A;  4FCY A;  1ENH A;  4A3I J;  4A69 C;  5F1J A;  5HOD A;  1VFC A;  5DS9 A;  5F08 A;  1A6I A;  4M6V A;  3L1P A;  1PUF A;  3Q3S A;  1Z77 A;  2HOT A; 
#chains in the Genus database with same CATH topology
 3CMM A;  3R61 A;  3F6V A;  1UJ8 A;  2M9H A;  1HKT A;  2HVQ A;  5FRN A;  2ZXI A;  4XR6 A;  4XRM A;  4R8H A;  3I64 A;  4B3X A;  1FP1 D;  2VJ5 A;  4RGU A;  2MC4 A;  4D1Q A;  1BR2 A;  1QHH D;  2V79 A;  4L5E A;  1FP2 A;  4OAY A;  1GHC A;  1OYW A;  2ZNZ A;  2M4K A;  5HDG A;  2WAD A;  3CQZ J;  2NVX J;  2BYV E;  5EF6 A;  2ZJR F;  3H3Z A;  3DTK A;  3K4C A;  4G94 A;  2DK8 A;  1TL8 A;  1YO5 C;  3NRV A;  4WXC A;  3W6K B;  4XKV A;  1JHH A;  3FK6 A;  2UWM A;  2R7Q A;  3CJQ B;  1WH7 A;  5KCM A;  3PUB A;  3GTJ J;  2EZK A;  1X1C A;  4A0Y A;  1YW7 A;  4HEA 2;  3CTA A;  5GTH C;  2OUM A;  3Q5F A;  4ZYA A;  2COM A;  2ECC A;  2KQR A;  4PSW A;  1IN7 A;  4ZYG A;  3OOP A;  1Y39 A;  2QGU A;  2HZT A;  3HGY A;  1WFX A;  2ZME C;  1MD0 A;  4BU2 A;  1UFM A;  1JTY A;  4WCG A;  2O03 A;  2MAB A;  3F8B A;  3LAJ A;  1W0U A;  1IF1 A;  4IQJ A;  4XBF A;  3DP7 A;  3PFI A;  2FNP A;  4Y17 A;  1XS9 A;  3CC4 I;  3SFZ A;  3M4O J;  2WC2 A;  4HNU A;  5JR3 A;  1QZZ A;  3CUQ C;  2E2J J;  4I0A A;  3PO3 J;  3V7S A;  3L9F A;  4EVI A;  2M0C A;  2VBZ A;  3NQO A;  2DA4 A;  2MLG A;  5F04 A;  1VQ4 I;  4OMY A;  2VE9 A;  5ILS A;  3HYI A;  4P96 A;  5GPA A;  4YFK F;  3JSO A;  2LY2 A;  3CCM I;  4OAZ A;  2VJ4 A;  3BJ6 A;  2IAI A;  2R7W A;  1KQ8 A;  4B48 A;  4AC0 A;  5J1Y A;  1I50 J;  2BZT A;  2JRM A;  2F48 A;  3TP0 A;  2FUG 2;  1ODD A;  2NVQ J;  2Q2E B;  5LHH A;  4IX7 A;  4EGZ A;  1QNT A;  2FJ1 A;  4XLA A;  3V42 A;  4D5F A;  1BOB A;  4II3 A;  3ABM H;  3DLA A;  4U0V A;  3PNY A;  5HNF A;  2XGD A;  4OOI A;  1WKM A;  2CS3 A;  2XB0 X;  2JZY A;  3O2P E;  3SHF A;  2KT0 A;  2PX9 A;  3H5N A;  3OYL A;  2ELK A;  4M3E A;  3IH3 A;  2JA7 J;  1P7J A;  5J4Y A;  1H88 C;  3SDG A;  2OJE D;  2BXZ A;  4QPO A;  2YR2 A;  3I4M J;  1WJE A;  3TDZ C;  1TQM A;  5FD5 A;  2IGO A;  3L2V A;  1JKR C;  2HNH A;  3OYK A;  2OPT A;  5FKL A;  1R00 A;  2M1B A;  1PVE A;  2K4B A;  2MC3 A;  3ASN H;  4GRI A;  4IHT A;  1FYL A;  4DJA A;  1JTX A;  1V4R A;  3U9G A;  3FIW A;  2FBH A;  4E70 A;  4KYW A;  1G3W A;  1MIJ A;  3B73 A;  2ACJ A;  2DOD A;  4OWR B;  4RM3 A;  3AG3 H;  1J59 A;  1XB4 A;  4KIC A;  1WQ2 A;  3DTE A;  1LQ1 A;  4B09 A;  1OCT C;  5FLM J;  3CCJ I;  2F4O B;  5J8C A;  4IXA A;  3BCB A;  4U0Y A;  1WVR A;  1A04 A;  2L0K A;  3KYC B;  1E3P A;  3B6C A;  1YE9 A;  1OCZ H;  1BC8 C;  3HOW J;  1MNM C;  3U2R A;  4HDV A;  2RNG A;  1IDZ A;  4MO7 A;  4M71 A;  4HZF A;  4QSH A;  4WF2 A;  3F23 A;  3E6C C;  3BTI A;  1HKQ A;  3BLY A;  4M3B A;  5ICC A;  2P5L C;  1X19 A;  1QGP A;  3OS2 A;  3ZGK A;  4J19 A;  2GXG A;  1T56 A;  3GWZ A;  2WAQ N;  3OL4 A;  3TGN A;  3QQA A;  3FBI B;  2WWY A;  2DTZ A;  4LG0 B;  2QYO A;  4W97 A;  3C2B A;  3S8P A;  3VSK A;  2DA6 A;  2KJB A;  1LB2 A;  2PMZ N;  1ACI A;  3PIP F;  4JYK A;  1H89 C;  2CO5 A;  4YEL A;  4FX4 A;  1JUP A;  3OYE A;  3A1Y A;  4MFE A;  1MMS A;  4FX0 A;  3HTS B;  2A05 A;  1JKP C;  2GA1 A;  5D8L B;  1JT0 A;  2OD5 A;  1G3S A;  3OSF A;  5CVR A;  2W24 A;  1HF0 A;  2XDV A;  1YQA A;  2M8E A;  3BPX A;  2QKM B;  3CD6 I;  1DGR M;  3SFI A;  2HYG D;  3OL3 A;  1X3W B;  5FKK A;  1IN6 A;  3OYM A;  2VQC A;  3P9K A;  3ABK H;  1XSX A;  2NS0 A;  5HLT A;  1NK2 P;  2JTV A;  5F0F A;  3HDD A;  4MHG A;  2WTE A;  1ERD A;  1OCP A;  1W7P B;  3G3Z A;  1OMI A;  1F36 A;  3E7L A;  3F9K A;  5HLH A;  1WRJ A;  2R7V A;  4CCN A;  4JOM A;  3H9G A;  1LPQ A;  4RB0 A;  1HC8 A;  1JGG A;  1SFO J;  1K78 B;  2PLY A;  3DEW A;  2DT7 B;  2QLZ A;  4I76 A;  5LEJ A;  5IOZ A;  2R5Y B;  3NAR A;  1BN5 A;  4IPA A;  2K02 A;  3SXY A;  3K10 A;  2K27 A;  1BOA A;  2NOG A;  2NS7 A;  1LUJ B;  1XGO A;  2NOJ B;  3E0J B;  2L7M P;  4LIV A;  5D5U B;  1PUE E;  4NC6 A;  2R5Z A;  2VB6 A;  1ZAR A;  2KRF A;  1KQ9 A;  4M72 A;  1QPM A;  1FOX A;  1ZK8 A;  4CIC A;  1UB9 A;  3FF5 A;  2ZJQ F;  2O9L A;  3LSJ A;  2DMQ A;  3ZQL A;  2DA2 A;  3K1N A;  3JRD A;  2Y0M A;  3Q9S A;  2W84 A;  4D7N A;  1J7K A;  4HX4 A;  3I53 A;  5B1B H;  5KAF C;  1HA8 A;  3FHN A;  4CCL A;  2GQQ A;  3FMQ A;  2HGC A;  2VBW A;  4LK0 F;  5DCM A;  3WU2 C;  2JN6 A;  1ON1 A;  1ZGW A;  2R7S A;  3OOU A;  1HBX G;  1X4O A;  1WH5 A;  3CCY A;  3F0C A;  4Y13 A;  2X0L A;  3OYG A;  5GAG J;  1G59 A;  2TCT A;  3QOE A;  3MKL A;  5DCF A;  3RDI A;  1RI7 A;  4BAY A;  4UVB A;  1ZEL A;  3ZMU A;  1GV5 A;  2ZSI B;  5B5E C;  2EA2 A;  2E71 A;  1F43 A;  1KU3 A;  4P9U A;  2CMP A;  1IRZ A;  2ZJP F;  4M74 A;  2DW4 A;  4HX7 A;  1FZP B;  1YYV A;  2LC2 A;  2FBI A;  2OTJ I;  4HF0 A;  1LVK A;  3RJP A;  1HDP A;  1U5T C;  4BY1 J;  1B8I B;  5GAE J;  1O7F A;  1OR7 C;  4MEX F;  2X6Y A;  2V4J C;  3MKW B;  3W3C A;  3BDD A;  3HOV J;  2QQB A;  2XPU A;  3C2G A;  2LLK A;  3CO6 C;  3J7A O;  1HCR A;  1GV2 A;  4H0E A;  4A3F J;  1AU7 A;  3P9C A;  3EUA A;  2KP6 A;  2QUF A;  4E7Z A;  2CGP A;  1SAX A;  1SFU A;  4XM3 A;  4L9J A;  1UHM A;  4C3H J;  1SVM A;  4EM1 A;  3HRU A;  1FMV A;  4A0Z A;  2KRC A;  1LVA A;  4KN7 X;  2QWW A;  3KLO A;  2CV0 A;  4NUB A;  3PJR A;  4UV9 A;  4RLQ A;  2VBX A;  4ZC3 A;  4XON A;  5ED4 A;  4GYI A;  1CF7 B;  5DCM B;  3TOB A;  3F8N A;  2PQ8 A;  3U1K A;  4BQO A;  2GA2 A;  1MJA A;  2Y0S A;  3CJR B;  3GTL J;  2ZNY A;  4NC7 A;  4A6E A;  2EZI A;  3GTP J;  1XMK A;  2P8T A;  4I7H A;  2NRA C;  3KX2 A;  4KN4 X;  2EH3 A;  2O6G E;  3A0B C;  1TNT A;  5AIQ A;  2ZO4 A;  4EJT A;  4XRS G;  3TW7 A;  4MIM A;  2LYC A;  1ULY A;  1K4S A;  3G6E I;  1ZH5 A;  2XPV A;  1VI0 A;  1RNL A;  4WX9 A;  4LLL A;  2L5Q A;  5D4R A;  3EDP A;  1AA7 A;  1Z21 A;  5EZG A;  4LB6 B;  4NQW A;  5KK1 A;  2FRH A;  5EG0 B;  2M4G A;  3H3U A;  1IRF A;  5H20 A;  2F2E A;  4IL6 C;  1I6X A;  3VSL A;  5HS8 A;  1RKT A;  4G8X A;  2ZCW A;  2BY1 A;  2H09 A;  3RTR A;  2STW A;  5JHF A;  3GZ6 A;  5J6X A;  2M2E A;  2LKP A;  1YX5 A;  1R1U A;  4IVN A;  3LSK A;  4A5N A;  3KZY A;  2P4W A;  4CYD A;  3WTX C;  5L3F A;  1ZR2 A;  5CPR B;  1XG1 A;  2K40 A;  4BL0 B;  1E3O C;  1JUS A;  2VN2 A;  3KEO A;  1EJ9 A;  4UY8 I;  1ETO A;  1MH3 A;  2W57 A;  1IUY A;  4D7M A;  4KJZ A;  2EV6 A;  1OYY A;  4LOC A;  2IBD A;  4KDP A;  4PFP A;  1Z3X A;  2JUG A;  2YSR A;  4G6Q A;  4M73 A;  2DXI A;  1MDM B;  1X2M A;  1FLI A;  4BE0 A;  2DA1 A;  5K1Y A;  4U7D A;  3LFK A;  4CO8 A;  4E7L A;  1GVD A;  1SFX A;  2YPR A;  2D1H A;  3LA7 A;  3MZY A;  4U87 A;  3CP2 A;  1NHA A;  2M0M A;  5FKM A;  4DYC A;  5L3B A;  4CYC A;  2BVM A;  1J09 A;  3LQR A;  3HBL A;  3R0A A;  2H1L A;  3H5A A;  3CMA I;  2E2H J;  4A3K J;  2RAE A;  3JRF A;  3N97 A;  3M1E A;  1FNN A;  3HG9 A;  1IRG A;  2M7A A;  5BNG A;  2JVG A;  2NNY A;  3AG4 H;  2DU9 A;  1O57 A;  1IG7 A;  4XN3 A;  3K6G A;  3PSI A;  4I02 A;  5EJC A;  4EV0 A;  5M3F J;  1YJW I;  1X1D A;  4C2U A;  4K2E A;  2XF6 A;  1R1V A;  4RA2 A;  2EIM H;  4XKW A;  5TRD A;  1Z6T A;  3GFJ A;  3AL0 B;  3CJN A;  1IN5 A;  3VOE A;  2VC1 A;  1UZC A;  1VQ7 I;  3S1M J;  2ZC2 A;  2Q2E A;  1ENH A;  1E0E A;  1Z7L A;  4A69 C;  1T8I A;  3Q9V A;  5HOD A;  5DS9 A;  4HST A;  4M6V A;  2RRE A;  3WG9 A;  1BBY A;  3H0D A;  1PUF A;  1JGS A;  2W82 A;  2HOT A;  4BYY A;  2GWR A;  5TGT A;  2DYR H;  3OMY A;  3MQ0 A;  4XLE A;  1H9T A;  5JFR A;  2HQ5 A;  4IQ4 A;  1Y1V J;  3PNV A;  4OIN F;  2O3F A;  4EEF G;  5FKO A;  1I3Q J;  3WHC A;  4N4O B;  1YIJ I;  2XAH A;  3T5X A;  2FXA A;  3BG5 A;  2YU9 J;  4ITV A;  2QZ8 A;  1FTZ A;  5CVJ A;  1VQK I;  3D0S A;  3J7Z I;  1FBU A;  5JI6 A;  2R7U A;  3G1L A;  2M7B A;  1VQ9 I;  1T98 A;  2TRT A;  5DUK A;  3BJO A;  3BWG A;  3K2Z A;  1TZL A;  2GOM A;  4PJ0 C;  3G1O A;  3FMR A;  4XSX F;  5D6F A;  5FKN A;  1XCB A;  4AYB N;  3OYB A;  1IAW A;  2HR3 A;  4A3E J;  3LSI A;  4AIH A;  2K5C A;  1W5C C;  1R5H A;  1U9O A;  2KIU A;  2R7T A;  1E17 A;  5J1U A;  1F4K A;  2E1O A;  4U88 A;  4OIO F;  1B72 B;  3HKZ A;  5D6E A;  1MSE C;  3HIF A;  4C3I J;  3QYF A;  3ERM A;  3PUF A;  2X51 A;  1FOW A;  1TP4 A;  1POG A;  1BIA A;  3TQN A;  2Y0S N;  2W7N A;  1P6R A;  1RR7 A;  1WJF A;  5E8G A;  5ERI A;  2V9V A;  2MD0 A;  4E6K G;  2XKO A;  2GOX B;  2JUC A;  3RYR A;  4N9H A;  5M5Y J;  5IY5 H;  3B02 A;  1ZTR A;  3MAJ A;  1MKM A;  3BR0 A;  4ZTJ A;  3RZO J;  3BR1 A;  3OR1 C;  3W2A A;  4V19 K;  4PGG A;  1QU3 A;  2IT0 A;  3PQK A;  1HXD A;  5IYB J;  4EJU A;  2V7F A;  1K7A A;  2PI0 A;  4PZJ A;  2CSO A;  4B3A A;  4ZZD A;  2FEZ A;  3QYE A;  1MBG A;  2A6E F;  4XN0 A;  2EZL A;  2JA5 J;  3CP8 A;  3A2K A;  2Z9O A;  3AL0 C;  5HDK A;  1SFK A;  4XLN F;  1KON A;  3V8K A;  1NG6 A;  2EFQ A;  3ZMD A;  1CQT A;  3WE2 A;  2D45 A;  2WV0 A;  2E7W A;  4XKB A;  3BRO A;  4LFU A;  3DBL B;  3ZMT A;  5D4S A;  3E6B A;  3A01 A;  1AHD P;  3J7A Y;  3MFK A;  4DQ2 A;  3QPH A;  3K4B A;  1W7P A;  1JT6 A;  4IO9 F;  3O6B B;  1S72 I;  2VQL A;  5DD8 A;  4PK4 A;  1MBJ A;  4KIT B;  3WGG A;  3FZV A;  4E7K A;  3ELK A;  1UHS A;  2XPW A;  1ZLK A;  1U5T A;  1XMX A;  1K78 A;  2V1U A;  2KPM A;  3TO9 A;  3KP7 A;  5E18 F;  1O3T A;  3QPS A;  4ENJ A;  3RYP A;  2XF5 A;  1G3Y A;  2K9M A;  4UNO A;  4F92 B;  4UUT A;  3TMO A;  1Y56 A;  4BHB A;  2Y30 A;  1LE8 A;  2PEX A;  1CGP A;  1TT5 B;  3LNQ A;  1B72 A;  1Z7U A;  2L01 A;  2ZBK A;  2XUB A;  3MD2 A;  4RB3 C;  1SD7 A;  2VKH A;  1MBK A;  1JI8 A;  1JJ8 C;  1YJN I;  2WY7 Q;  3ECH A;  5K7F A;  2CW8 A;  3TDU C;  3ZQF A;  4Q5S F;  2X4H A;  2M30 A;  3HOX J;  1RUO A;  5E3N A;  2VT3 A;  4EJV A;  4DBR A;  4HRI A;  1YS6 A;  2HDC A;  1LJ9 A;  1ZLJ A;  2O5R A;  3MKY B;  4ETS A;  1KQ0 A;  3DTI A;  2E2I J;  2EBI A;  1XSD A;  3PSF A;  2LRE A;  1X2N A;  5J1R A;  3H36 A;  3RQ4 A;  1AOY A;  4L5I A;  3DU6 A;  4LJZ F;  2ZME B;  3IAS 2;  1R9T J;  3WU0 A;  3AFH A;  3WU1 B;  2DJI A;  2G0E A;  1JKQ C;  3U21 A;  2OU2 A;  3ZMS A;  3JRH A;  3I9V 2;  3MKZ A;  2X1E A;  3LOC A;  1JE8 A;  4R1H A;  4ZZL A;  2QCO A;  1U8B A;  4Q47 A;  4HPQ A;  1YHQ I;  3GUD A;  1WJ5 A;  1OCO H;  1D0X A;  3R0J A;  5DD4 A;  2DPU A;  2V6E A;  1IUF A;  1I5Z A;  2R7O A;  3F22 A;  1WJB A;  3TL4 X;  3RKY A;  3WTT C;  1BW5 A;  1FOK A;  4JX4 A;  4XID A;  3OIO A;  5TIS C;  1FMW A;  4N4N B;  1QZE A;  3EYY A;  1BJA A;  4RGS A;  1UG2 A;  3GCM A;  1X1B A;  3MMY B;  2IP2 A;  4HNT A;  1D1A A;  2R5Z B;  1NG7 A;  2QA4 I;  4ZJZ A;  4CDG A;  4MFD A;  2BW3 A;  2LNB A;  5E3L A;  2IVM A;  1R5I D;  3J81 Z;  1T08 B;  1YIT I;  1WI9 A;  3ZRG A;  2E35 A;  1U9N A;  4FQG A;  1S29 A;  1L0O C;  4FE4 A;  2WAE A;  1UHW A;  1ZG3 A;  3GZ5 A;  4L18 B;  1IZ1 A;  2DMP A;  2E7X A;  1BI2 A;  3F8F A;  1SMY F;  4IJA A;  4BDZ A;  5CVV A;  2FML A;  4I09 A;  4FTH A;  4ON0 A;  1IN8 A;  2GIV A;  2Y31 A;  3ZQC A;  1R58 A;  2STT A;  1YX3 A;  1SD5 A;  3ZQI A;  4BQN A;  1IGN A;  2LD5 A;  2JSP A;  4XRF A;  5E20 A;  1DQU A;  4M9Z A;  2XRL A;  4BUP A;  2LTP A;  3GFM A;  2GXA A;  2H6B A;  4AU7 A;  4NHJ A;  3EUH C;  2QF7 A;  2LF7 A;  4OMZ A;  3AG1 H;  2A5Y B;  5DM6 F;  1CF7 A;  4RAF A;  1S9H A;  2G9W A;  3ROU A;  3OYA A;  1VQM I;  2LY1 A;  4P5O A;  2ZSH B;  3DU5 A;  2ELH A;  1R5G A;  3GX4 X;  1YI2 I;  4QTR A;  2ETH A;  5D5W B;  2F4I A;  1K79 A;  1J0R A;  2X48 A;  2ZXH A;  5DTD A;  1KGS A;  4BHP A;  1ZRF A;  1RR8 C;  2CFO A;  2IA0 A;  1BI0 A;  3CJT B;  1W36 D;  2HQA A;  1F9N A;  3W6V A;  3JAM K;  1FY7 A;  2DFH A;  3H9J A;  1V5G A;  5DM7 F;  3H1C A;  1VQP I;  2ZFU A;  2L4A A;  3UKG A;  5B66 C;  9ANT A;  3TED A;  3L2W A;  5M3M J;  2XGC A;  3I71 A;  1N75 A;  3HRT A;  2X6X A;  1DU0 A;  5JLW A;  2JSC A;  2NAZ A;  3TO6 A;  4IHS A;  1V55 H;  3BP8 A;  4V2F A;  2VUM J;  5J3L A;  2K9N A;  2V9K A;  3VYS B;  1YG2 A;  1I39 A;  4UV8 A;  4PJM A;  3DPU A;  3I58 A;  2BBY A;  5LHI A;  1HST A;  5CJ9 A;  5GAD J;  1FSH A;  2W4S A;  3HUG B;  5LGT A;  3S2H J;  5E3M A;  3ZXS A;  2ME6 A;  3L2U A;  2HOS A;  1DUX C;  3OV8 A;  1R4N B;  5GAH J;  2MG4 A;  3K70 C;  5ILV A;  4IZZ A;  3E3V A;  1VQN I;  3KIO A;  1DU6 A;  3BOQ A;  3HOZ J;  1FTT A;  4KMF A;  2COB A;  3LST A;  1Z1D A;  2L9R A;  3I4N J;  4JQF A;  4HNV A;  3UR3 C;  4KIB A;  4AVP A;  3D1N I;  3FM3 A;  4PFO A;  4MQ9 F;  2IS6 A;  4RAZ A;  1GVJ A;  1HLV A;  1SVO A;  1D8K A;  1BW6 A;  2EK5 A;  4IEJ A;  4BS9 A;  1L3L A;  2E5N A;  1J5Y A;  3H0G J;  5F6F A;  1U78 A;  4RGR A;  2R4G A;  2CUZ A;  2F5D A;  4ASN A;  3C7J A;  1T38 A;  1IN4 A;  2H6C A;  2DBB A;  2DT6 A;  3SEQ A;  1R49 A;  3COA C;  3HHG A;  1DDN A;  4IF4 A;  2E1M B;  1XGS A;  4LD5 A;  4M6X A;  3QWL A;  2CU7 A;  3CCV I;  5ICF A;  3VYU B;  2AXL A;  3VPR A;  1Q1H A;  4S04 A;  3KYD B;  1VQ6 I;  4BE2 A;  4AM3 A;  4HX8 A;  2BGC A;  4F93 B;  3JRA A;  5F0H A;  3S3M A;  4HQM A;  4IOA F;  2WA0 A;  1HSJ A;  1PDN C;  2QQ9 A;  2QKL B;  3LA2 A;  2DOA A;  3SEZ A;  3K0L A;  4XOR A;  1I27 A;  5L3G A;  2A61 A;  1D5Y A;  4CZZ A;  4L9N A;  4G9Y A;  1TW2 A;  3E6M A;  2LMD A;  4EM2 A;  2HXI A;  3HB9 A;  4MGR A;  1MNE A;  2W1O A;  3CES A;  2XRO A;  3RKQ A;  1T39 A;  5J4V A;  2JMW A;  2XIG A;  4HAM A;  4KNY A;  2FOK A;  5BMZ A;  4ESB A;  2QBY B;  2Q1Z B;  5JVG F;  4UVA A;  2CQX A;  3BZK A;  4RB2 C;  2R92 J;  2DA3 A;  2LSO A;  3EUK L;  3M7G A;  4HV6 A;  4KMU X;  3FMS A;  4E4H A;  3QU3 A;  5E1W A;  3F8M A;  1MMD A;  2DDA A;  4DBQ A;  2E5Z A;  3KLN A;  3JRE A;  5HLG A;  4DYR A;  2Z1D A;  2GLO A;  1UMQ A;  2VQH A;  2CH0 A;  2O61 A;  1LKX A;  3JW4 A;  2Y9Z A;  3GO5 A;  1K6O A;  1P9Q C;  3J80 Z;  1X1P A;  3AAF A;  4G12 A;  3VYR B;  1M1E B;  4CA0 A;  4XMY A;  2K85 A;  4CXF A;  1WJC A;  3FBN B;  2H1K A;  2IPQ X;  5D5V B;  3N05 A;  1TTY A;  4BQA A;  2Y2Z A;  4GO1 A;  1BA5 A;  2V26 A;  3HEF A;  1P4A A;  5E1X A;  2HI3 A;  3BY6 A;  4KUM A;  3EET A;  5EGO B;  4S0H B;  3FM5 A;  2VJI A;  2WB1 N;  3K4M A;  2R0Q C;  1MJB A;  1IC8 A;  3GTG J;  1H8A C;  1WI3 A;  2JK3 A;  2D2W A;  3OYJ A;  2A07 F;  1ETV A;  5CVI A;  1BR4 A;  3ISP A;  1GT0 C;  3ASO H;  2B0L A;  2MD5 A;  2P0W A;  4AIJ A;  4L9V A;  1T0F A;  1R23 A;  3ZQ7 A;  4DNC A;  2CUE A;  2R7D A;  1ZAO A;  4XLP F;  1FOY A;  2XAS A;  1S7E A;  3PO2 J;  3HHH A;  1TT0 A;  2JWT A;  4HDU A;  5FD6 A;  1RC9 A;  3A03 A;  4UXN A;  5GP9 A;  2L2O A;  3LQQ A;  1QQI A;  1TWF J;  1XC5 A;  2VXZ A;  2EFN A;  5HLI A;  1U6G A;  4OIP F;  1VQ5 I;  2J5O A;  3N4M A;  4A3I J;  3K4L A;  5FFZ A;  5F1J A;  2VOP A;  1A6I A;  3L1P A;  2A6H F;  3P5J A;  1KYW A;  2V1D A;  1ZYR F;  4TV7 A;  1W7P D;  4EGY A;  1ZGA A;  2Y75 A;  3GTO J;  3LA3 A;  4YII A;  5IYC J;  1U5T B;  3ZMZ A;  3IKT A;  2X6W A;  4B8X A;  2M8G X;  1IXC A;  2KIS A;  2OA4 A;  4AWX B;  2O8X A;  2VPL A;  3FXK A;  5FLX K;  2PFB A;  2XRN A;  1TWA J;  3GVA A;  4XK4 A;  4A12 A;  3S1Q J;  2JRT A;  3RI4 A;  2RV8 A;  1S5L C;  1RIO H;  3O8H A;  3HOY J;  1Z0X A;  1HOM A;  5GTI C;  2DCE A;  4BJT A;  3BJA A;  4KA4 A;  1O3S A;  4DW6 A;  1VQO I;  2DOF A;  1IV8 A;  1OKR A;  1B4A A;  1Y8R B;  1XX5 A;  2VAS A;  3DKX A;  3BZC A;  3LSR A;  1FPQ A;  3OS0 A;  2HKO A;  2KRH A;  2JA6 J;  3M1C A;  1I6H J;  3I59 B;  3JAM Z;  2G7H A;  2Z99 A;  4E7H A;  3S16 J;  2OAZ A;  4LK1 F;  2M34 A;  3C1D A;  4HYE A;  2IXS A;  3TOA A;  3DEE A;  5FLV A;  2ZKZ A;  1WWX A;  1FEX A;  1ZGJ A;  3R4K A;  1P92 A;  3TP3 A;  3QP6 A;  2EFP A;  3SZP A;  1FBS A;  3ABT A;  4ESF A;  1RES A;  4KFC A;  2ZME A;  2JQ7 A;  4O6J A;  1B59 A;  2OQR A;  3H3V K;  3VB2 A;  1SAU A;  1Y0N A;  2L9N A;  3JRC A;  1NH3 A;  2I8D A;  3KE2 A;  1O4X A;  5K5Q A;  2VON A;  1D1B A;  2XHK A;  4UVC A;  1MH4 A;  2F4M B;  3OS1 A;  3JTG A;  4AID A;  2L7K A;  2DMN A;  2BV6 A;  5LGU A;  2VKE A;  5CLS A;  3WGI A;  1WHU A;  4MNU A;  4RLF A;  2W48 A;  3M9A A;  3S14 J;  4AUX A;  3WOD F;  3VEP A;  5LLQ A;  2YUS A;  2HOA A;  1BC7 C;  1KU2 A;  2QM3 A;  1G4D A;  1OQY A;  4U0W A;  5EDN A;  5HDN A;  4F3Q A;  2F5C A;  1R4M B;  3GW2 A;  1PP7 U;  4ZTF A;  2MH9 A;  5IPA A;  3NWS A;  3ERE D;  3S3O A;  5IT9 Z;  2VL8 A;  3VDX A;  2WY8 Q;  2G7U A;  2HOE A;  2HZD A;  1D0Y A;  3K4K A;  4L0Y B;  2LKS A;  3OYN A;  4N0B A;  3L2R A;  3QOD A;  3OSG A;  1T0F C;  3BR2 A;  5FJ8 J;  3PFY A;  1SEU A;  4DOZ A;  2LOO A;  4G6D A;  2HKX A;  2AQF A;  2DA7 A;  4O3M A;  3S15 J;  3BR5 A;  3M3Y J;  2BEO A;  3T8R A;  2FA5 A;  3OWT A;  2VKD A;  3MZ8 A;  3BR3 A;  1RZ4 A;  1EH6 A;  1QPI A;  3JRB A;  3PIO F;  4V2G A;  3IRR A;  4BNC A;  3FXL A;  2R7X A;  2VQG A;  3O8G A;  3IV5 A;  5F0C A;  5C4J J;  4AVZ A;  3W2V A;  2K3P A;  2R7F A;  1T2K A;  1N78 A;  3WG7 H;  1G2H A;  2FOW A;  3VWB A;  4NQW B;  1JXS A;  2KZG A;  1EH7 A;  4A3B J;  2FQ3 A;  2LP0 A;  3K7A J;  5DYM A;  2E34 A;  3BT9 A;  3CDI A;  2NYX A;  2CQ7 A;  5K5R A;  2YS9 A;  2VIX A;  1LNW A;  2NXN B;  4LLN A;  5KVR A;  2YX7 A;  4HA8 A;  5J40 A;  3S2W A;  3ZOB A;  5IOY A;  1GLN A;  2BW3 B;  4BXF A;  3MWM A;  3IH2 A;  2CV1 A;  2JT1 A;  1A5J A;  3FWE A;  4E7J A;  5HOO A;  2VOD A;  4CCM A;  5CYV A;  2CG4 A;  2LVS A;  3KZI C;  3K2A A;  1MJ9 A;  3KPH A;  3CC7 I;  2VJJ A;  3X2Q H;  2O7O A;  2LFB A;  2X9D A;  1SFE A;  2XGX A;  3HPG A;  4XLC A;  2KFD A;  3K9T A;  2BY0 A;  2DAO A;  3R6S A;  4BHC A;  1R1T A;  2Z2S B;  1FSE A;  2FF4 A;  1KYZ A;  4IRH A;  3KFW X;  5A2Q K;  1QO0 D;  4I0B A;  2ID6 A;  4OIR F;  3I54 A;  2BHZ A;  3IWZ A;  1DP7 P;  4BY7 J;  2Q8K A;  2Z16 A;  1Y6I A;  1TWC J;  5BS6 A;  3CCU I;  1G8X A;  2B63 J;  4QPQ A;  5FRM A;  4Y33 A;  3HRS A;  2KL4 A;  3I4P A;  3K1M A;  4AIK A;  4O5V A;  1G3T A;  1XCV A;  2CRG A;  2VC0 A;  1VQL I;  1WZ2 A;  5EYR A;  2LR8 A;  2CUJ A;  1SVL A;  1VQ8 I;  3F72 A;  4UUS B;  4CYC B;  2KIQ A;  3U1D A;  1PYV A;  4EJW A;  5KNL A;  2H27 A;  3JRI A;  3HZJ A;  2YX4 A;  3QPL A;  4BKX A;  4IHY A;  1F1Z A;  4JBA A;  1SMT A;  3Q0U A;  3BQY A;  3MN2 A;  3G71 I;  3FIS A;  1IDY A;  3IP4 B;  3PM1 A;  2ESH A;  4YIR X;  2CJJ A;  4A3M J;  4RAY A;  4UHT A;  3CF5 F;  1H9G A;  3CCR I;  5JLX A;  3QU6 A;  5AON A;  1YTY A;  1QA6 A;  4FT8 A;  3FXU A;  4C3J J;  1A6Q A;  3DF8 A;  1S8N A;  4EAT A;  4YG2 F;  1LDK B;  3HOS A;  5J8F A;  2QSF X;  4ZDL A;  2DDB A;  5KHD A;  5CKT A;  4RAG A;  3S1N J;  1P4X A;  4GXO A;  2E1N A;  1PJR A;  2PMU A;  3K4N A;  4C30 A;  4ENN A;  1P7I A;  5D5X B;  5L3C A;  5C3E J;  3GME A;  3QPT A;  5FO5 A;  1X3U A;  2HYF A;  5LRS A;  3A02 A;  3DFG A;  3ZMV A;  1H0M A;  3ZQQ A;  3HKZ N;  1D5V A;  4E7S A;  3DXJ F;  2RNJ A;  1IXS B;  2CQQ A;  3A0H C;  3CDH A;  3DQV C;  1BJZ A;  3LWF A;  4ANJ A;  2XSJ C;  2OZU A;  5E79 C;  2LKX A;  1D3Y A;  2LK2 A;  1YS7 A;  3FX3 A;  2ESN A;  1QBJ A;  4J01 A;  4CSW A;  3CO7 C;  1Q1V A;  3T0Y A;  2K9L A;  3S2D J;  3JRG A;  2CV2 A;  3GTM J;  1U2W A;  3WHB A;  1HW1 A;  5DDG A;  3K69 A;  3RKW A;  5DV5 A;  4RDU A;  1ZRD A;  1LFU P;  5FRO A;  4P1W A;  1LEB A;  3H92 A;  4RMN A;  3VYT B;  4U7B A;  2ZFW A;  1VF9 A;  3HPH A;  4XOT A;  3DKW A;  4UUS A;  1JJ6 C;  2XAF A;  5LRR A;  3IUO A;  2HDD A;  2Z5U A;  3ZQH A;  2RDP A;  4ENK A;  4L9T A;  1ZRC A;  2DMT A;  3E5Q A;  3ZN1 A;  2H94 A;  4CUG A;  3S93 A;  2KLO A;  1V5E A;  4P55 A;  1R6R A;  2A5W A;  3FK7 A;  4WXH A;  1Z67 A;  2GAU A;  2BXY A;  1R71 A;  4BJ5 C;  2DQL A;  2ZB9 A;  4BQQ A;  4B43 A;  1OIS A;  3KZZ A;  4NDL A;  5E17 F;  3E6D A;  2CWE A;  2AO9 A;  4ZYE A;  1V5F A;  2JVH A;  2QVO A;  1S3J A;  4G7H F;  3CF2 A;  4DYQ A;  1KU9 A;  4WXD A;  1SAN A;  2PMH A;  5FB2 A;  1GUU A;  2L4M A;  5FFX A;  3ECO A;  4HV5 A;  4BXX J;  1YOV B;  2NS8 A;  5E1Z B;  2EQR A;  3REO A;  4CCK A;  2KMU A;  2GIZ A;  1XDU A;  4ESJ A;  1JHF A;  3E5U A;  3DBH B;  3G4S I;  3KP4 A;  1W4M A;  4C2T A;  2IGM A;  1YW9 A;  2MH2 A;  2XAU A;  3RQI A;  1AWC A;  2DK5 A;  3RKX A;  3C18 A;  3ZP5 A;  1BI1 A;  3FXQ A;  5C44 J;  2LG4 A;  4M6Y A;  4Z2Y A;  1OJL A;  1ZG1 A;  5E3O A;  3K1P A;  1MW7 A;  2IRF G;  1O7L A;  1FJL A;  1K61 A;  2EZH A;  2VBY A;  1F5T A;  3GTQ J;  1BR1 A;  4BBR J;  1N77 A;  3IL2 A;  2L9S A;  1LFP A;  2OZ6 A;  2A6T A;  3PQJ A;  3KYL A;  3L2Q A;  1ZRE A;  3ZCO A;  5E8I A;  2ZXJ A;  4G6T B;  4A2U A;  4RB1 A;  2BY2 A;  2FMY A;  2JJ7 A;  1QVU A;  4GCV A;  2EB7 A;  5TJJ A;  1IV6 A;  2B9S A;  1WCM J;  5H6Q A;  1ZR4 A;  3GLX A;  3SZG A;  4IRG A;  1R7J A;  2QQ8 A;  5LD2 C;  1W36 C;  4CGZ A;  1Z3Y A;  3M8E A;  4P9F A;  2P7V B;  3H5R A;  5M5W J;  2HDW A;  2OF7 A;  1FWZ A;  1IRX A;  5ICG A;  1ZN2 A;  3WTW C;  1A31 A;  2JPC A;  2MYS A;  5LGN A;  2V1X A;  3CCQ I;  1ON2 A;  3D5R C;  3AG2 H;  1W0T A;  1EKE A;  2V6C A;  3I55 I;  3L7W A;  4RGX A;  4W1U A;  5BPD A;  1EA3 A;  4ABZ A;  2DFF A;  5GPC A;  1A35 A;  2HTS A;  1I3A A;  1A36 A;  3FKI J;  1REP C;  2FX0 A;  4HF2 A;  3OYD A;  4A3D J;  2ZJ2 A;  1DPR A;  3FXJ A;  2R7R A;  1XGM A;  2AXT C;  2KDZ A;  4IHV A;  5IP7 J;  2DYS H;  4EQQ A;  2QSG X;  1TNS A;  1IO2 A;  4LG0 A;  4F7Z A;  4IHX A;  1MBH A;  5AIP A;  1DPU A;  2LBF B;  3Q0W A;  3E5X A;  3RSN A;  3DEU A;  1KA8 A;  4D9J A;  1TQP A;  3PL8 A;  3IH4 A;  1R36 A;  3FXM A;  3GBG A;  3H35 A;  4AYB A;  1J2X A;  1O3Q A;  4I6Z A;  4FET A;  1RPW A;  1UG0 A;  4IKF A;  4N9I A;  2O8K A;  2PJP A;  1MBE A;  1ETW A;  2X1D A;  4KT5 C;  1E2X A;  1NTC A;  4ZYH A;  1J9I A;  3CUQ A;  2NVY J;  3QOP A;  4CCO A;  1W1W E;  3NEU A;  4YEJ A;  1WSU A;  4ENM A;  3FXR A;  1I1G A;  2ELJ A;  2PJR B;  3HL2 A;  2M5W A;  3MCZ A;  1YLF A;  3DBR B;  1OPC A;  3LFU A;  4BE1 A;  2E1M C;  4D5C A;  2XAG A;  3A4C A;  4UB6 C;  5BQT A;  3EQL F;  2P7C B;  4A3L J;  3BTL A;  1FC3 A;  3E97 A;  3MVP A;  1E3H A;  3TBI A;  2R5Y A;  2CUF A;  3JTH A;  2EA4 A;  1RRJ A;  4CHU A;  2A3S A;  4A6D A;  2D1V A;  3C2H A;  4OU0 A;  4M9X A;  3RPU D;  3ZN0 A;  4GFB A;  2WV1 A;  1MBF A;  4NBQ A;  4XSZ F;  3V8L A;  4YFN F;  4CZC A;  2RN7 A;  4A3G J;  4EMS A;  3W6J B;  2UUZ A;  3NWT A;  1LFB A;  2EFO A;  2EJR A;  5CQE A;  2H8R A;  3DV8 A;  4FCY A;  3J80 K;  3CCL I;  1ONV A;  1WJA A;  3GXO A;  4EJO A;  3HXL A;  3QYB A;  2W00 A;  1I1S A;  3IKV A;  1X1A A;  1TWG J;  2H8W A;  3I56 I;  5LEK A;  2HVR A;  2HVS A;  2B7E A;  3OIP A;  3F3X A;  4I99 C;  4MTE A;  2IGN A;  2OCC H;  2OBP A;  4XNF A;  2N8G A;  4AD9 A;  1PP8 F;  3ZPL A;  4Y4R A;  3WGH A;  2FNA A;  4OIQ F;  2CW7 A;  3IRQ A;  1WGX A;  2K9S A;  3DCF A;  3OY9 A;  2L02 A;  5IT3 A;  3CUO A;  1U3E M;  1IJW C;  2ME0 A;  3CUQ B;  4Y15 A;  1S7O A;  1BL0 A;  2AS5 F;  1QRY A;  1N25 A;  1K4T A;  5K7Z A;  2RQQ A;  1MSF C;  2KHM A;  2BHY A;  3OYI A;  4PJL A;  4I01 A;  4BXU A;  2EIJ H;  1XDS A;  2P5V A;  2KDO A;  2XKP A;  3BG3 A;  1K6Y A;  3LMM A;  3GYH X;  3LSP A;  1BIB A;  2ISZ A;  1Z6R A;  1EV7 A;  4Q48 A;  1B8I A;  3BG6 A;  3CLO A;  5J47 A;  2NVT J;  1SC7 A;  3HJE A;  1B9N A;  3WTS C;  3BG9 A;  3I3L A;  3NAU A;  1XTA A;  4LB5 A;  3H9Q A;  5FGM A;  2X85 A;  3O3K A;  1UEL B;  3HUG A;  2R3S A;  3DWL E;  3LSG A;  3CLQ A;  1UST A;  1X4P A;  2JPB A;  2MFZ A;  3ONQ A;  3F21 A;  5HS7 A;  2HU9 A;  2WAF A;  4G7Z F;  1QVT A;  1GXQ A;  2C6Y A;  4YFX F;  4HQE A;  1LDD A;  3RIR A;  4M9S A;  3V7C A;  3IHU A;  2JA2 A;  5D8K B;  3W2W A;  4B47 A;  1T33 A;  2W85 A;  3HSF A;  4BGD A;  4S05 A;  3QRF F;  1BM9 A;  3MZH A;  2WB1 A;  4B1R A;  1EF4 A;  3RPU A;  4IOC F;  4Y52 J;  2LH9 A;  2X1C A;  4JP0 A;  2AQE A;  3ZR8 X;  2L9V A;  4XRS A;  3IAM 2;  2RKH A;  2R7Z J;  4F91 B;  2LRD A;  3KP3 A;  2P5K A;  6PAX A;  3F8C A;  4RM2 A;  2QEX I;  2E1C A;  3CC2 I;  3WE3 A;  2KJC A;  1SD6 A;  4DIQ A;  5EG0 A;  3KP6 A;  5BPI A;  4HSR A;  1FBQ A;  1S7A A;  2XAQ A;  4LIT A;  2XV4 S;  3M8J A;  2HQN A;  2Z3Y A;  5HNH A;  2DN0 A;  1ZHF A;  2E60 A;  3ESW B;  3OR2 C;  1WPK A;  1J75 A;  1WJD A;  5HS9 A;  1VTN C;  2EPF A;  2QEN A;  4YIF A;  2L3D A;  3MEX A;  4GYG A;  2HXO A;  5F64 A;  2W25 A;  3JR9 A;  2F5E A;  2GZW A;  1ETQ A;  4M3G A;  1KU7 A;  3BC8 A;  4WWC A;  2NVU B;  1KZH A;  3S17 J;  3OYH A;  2LF8 A;  2XVC A;  4KIF A;  2I5U A;  5B3S H;  3SYT A;  3WTY C;  5EEH A;  2KKO A;  4PDK A;  3HTU A;  4D0P A;  2DLL A;  2HPM A;  4B4C A;  2QBY A;  2IS4 A;  3BZ6 A;  4RBO A;  4PJN A;  1MDM A;  4HOB A;  1MMG A;  2UXN A;  1P2F A;  3EUH A;  5IYD J;  3WTZ A;  1SD4 A;  2P81 A;  1TWH J;  3GTK J;  1EH8 A;  2O0Y A;  3BTC A;  3V4G A;  1VND A;  3HSE A;  4XL9 A;  3RZD J;  5H2F C;  4UB8 C;  1YW8 A;  1B6A A;  3LAP A;  5A2Q Z;  3OYF A;  2FD5 A;  4ZDO A;  4A3C J;  3QAH A;  2OTL I;  2Z33 A;  2Q0O A;  4F52 A;  2ZXW H;  5B1A H;  2DMU A;  4PSX A;  3BG7 A;  2X6O A;  1VZ0 A;  2EWN A;  2CW0 F;  1MMA A;  4BBS J;  3SZT A;  1ETK A;  3BPV A;  3I5U A;  3AKZ A;  2ID3 A;  1YFH A;  4WK8 F;  3DKY A;  4FE7 A;  3RCO A;  3J81 K;  3DPL C;  1GXP A;  2K4J A;  3P7N A;  3L09 A;  5EGO A;  1HKS A;  2M3A A;  2XSD C;  2L54 A;  2RGV A;  4Q4Z F;  5ICE A;  4PJJ A;  3KEQ A;  1MND A;  4FHT A;  3GEZ A;  2V9P A;  1Y8Q B;  2Y48 A;  4C2M J;  1LEA A;  2MLK A;  1MGT A;  1HQC A;  5LHG A;  2HYJ A;  2WBM A;  1XPX A;  2VPR A;  3OIQ A;  3L2C A;  1XSV A;  2VI6 A;  2IJL A;  4I98 B;  2ISY A;  4B44 A;  3G1M A;  4LG3 A;  2XF7 A;  2VXD A;  2V1N A;  4J00 A;  1YIO A;  1AKH A;  3DPT A;  1PUF B;  3T1B A;  3BTJ A;  4BEH B;  3B6A A;  5KAI C;  2LY9 A;  3GFL A;  2DJN A;  4I2O A;  4LMY A;  1V3F A;  2RQP A;  5EEA A;  1P4W A;  1ZG5 A;  4E7I A;  4XLF A;  2HEO A;  4M3D A;  3KP2 A;  4MQV A;  2DTR A;  3S1R J;  4HBL A;  5M5X J;  4M3F A;  2MW8 A;  3L00 A;  4BAC A;  2K86 A;  1FIP A;  3M07 A;  1TW3 A;  2VT2 A;  3SDB A;  4MTD A;  2KZV A;  4ZH4 F;  3ABL H;  1Y0U A;  3IWF A;  2L7Z A;  4KIG A;  4CH7 A;  4G7O F;  4DGW B;  4XQF A;  1TLH B;  1ORK A;  1HW2 A;  2HFH A;  5IT9 K;  4II2 A;  1STZ A;  5EEG A;  4A93 J;  2VE8 A;  2FSW A;  2HS5 A;  2OC6 A;  2OQG A;  5LBQ A;  1DGW Y;  1D8J A;  5ILU A;  1OYI A;  1HDD C;  4MEY F;  3HGG A;  1X3Z B;  2PMZ A;  2E19 A;  3TO7 A;  3C3W A;  2I10 A;  2Y69 H;  4X1E A;  1ETX A;  1T6S A;  1W5T A;  4ZYD A;  4RS8 A;  2WAQ A;  5C4X J;  2M45 A;  3TW6 A;  2BOL A;  1V54 H;  3CME I;  1USS A;  5K5O A;  4L0Z B;  3KCC A;  2CQN A;  3I59 A;  5DEQ A;  3GF2 A;  3SQN A;  4IRI A;  2BE5 F;  3CCS I;  5CVU A;  2ADU A;  3HSR A;  3R60 A;  2HTJ A;  5JHU A;  1U0J A;  2F6C A;  2IA2 A;  2BVL A;  2LBF A;  2MGQ A;  4YRV A;  1RET A;  2FBK A;  3FKJ A;  1Y1W J;  2AHQ A;  1AKH B;  4BEH A;  1FYM A;  1S6L A;  2CFX A;  2P6S A;  3J7Y J;  3SJM A;  3G73 A;  2HQR A;  3OYC A;  4A3J J;  3E1S A;  1ITY A;  5HVQ C;  2FE3 A;  1RUN A;  3G2B A;  2XGE A;  2Y9Y A;  3I0T A;  2XAJ A;  4JX5 A;  1Z9C A;  2JA8 J;  1R22 A;  3FXO A;  2PN6 A;  3S3N A;  3A01 B;  3GLL A;  5DUI A;  3EPZ A;  3QP5 A;  4LGW A;  4QLC U;  3BR6 A;  2DA5 A;  1GDT A;  3HM5 A;  1OR7 A;  4BJ6 C;  5K7H A;  4DZP A;  3LL7 A;  1UCR A;  3VOD A;  2R93 J;  4Y7N J;  4GGG A;  1FX7 A;  1TQI A;  2BY3 A;  3HOT A;  1IXR C;  4FIS A;  3F6O A;  1IW7 F;  1XMA A;  3ABU A;  2HWV A;  3D5L A;  1YJ9 I;  1B1B A;  2GM4 A;  4R79 A;  5FLX Z;  3EYI A;  3HC7 A;  1D1C A;  1NK3 P;  2IEK A;  2LDU A;  4CCJ A;  4HLX A;  3DLL F;  2PBI A;  2ICW G;  1LE8 B;  1ZKG A;  2UZK A;  4LLG F;  2VLA A;  1QHG A;  1D0Z A;  1QZY A;  4JK1 X;  3TKY A;  4HF1 A;  3D5S C;  3T8T A;  1TC3 C;  4JX6 A;  2PG4 A;  2EV0 A;  1LDJ A;  2E36 A;  3CZ6 A;  4UUV A;  2CQK A;  1MZB A;  3BCA A;  3UNG C;  1O3R A;  2ECB A;  5F1R A;  1DP3 A;  1YRN A;  2GBY A;  3ML6 A;  4ZDP A;  5JVT A;  3JCU C;  1T95 A;  2K9Q A;  5IP9 J;  1FIA A;  1APL C;  3IC7 A;  4A0X A;  2IS2 A;  4HG2 A;  4XIC A;  3K70 D;  2DO7 A;  2EV5 A;  3CDL A;  1B9M A;  5IP6 A;  1ETY A;  4X0G A;  4Y3O A;  2XB5 A;  1Z05 A;  2NNN A;  4MLO A;  2EIL H;  2IGK A;  3P9I A;  2OV7 A;  1OLT A;  4KT6 A;  2RC4 A;  4XOP A;  2MBF A;  1JKO C;  2PJR A;  4HLY A;  3ULQ B;  3CMY A;  3FHZ A;  3Q0V A;  2IW5 A;  2XC7 A;  1ZQ3 P;  2EFW A;  1U8R A;  2P6T A;  4XKC A;  1OCR H;  4H4K C;  2A68 F;  2VOO A;  2F5V A;  2VKV A;  2RVC A;  2QQA A;  3BQZ A;  2MA3 A;  2KIM A;  1XGN A;  3KEY A;  3JSP A;  2OCE A;  2A69 F;  2DQR A;  4BDY A;  4PCQ A;  1OFC X;  3KET A;  2J5P A;  4NC8 A;  2DT5 A;  4IHW A;  5L3E A;  4DZJ A;  3KP5 A;  2DPD A;  3CCE I;  1TBX A;  2D5V A;  4QWQ A;  2CYY A;  2K7L A;  2GXB A;  5F27 A;  5LFA A;  3PNT A;  2HPI A;  2IA1 A;  1OCC H;  2UV1 A;  4LIU A;  4X6A J;  2FQ4 A;  4NNJ A;  2QSH X;  1X58 A;  1BI3 A;  5CQG A;  4C9Y A;  2DFI A;  5BOX A;  3RPQ A;  3GZN B;  1G6N A;  2FU4 A;  4PGH A;  1C0W A;  3HRM A;  2MSY A;  1HW5 A;  2K3F A;  5EZH A;  1FT9 A;  2UXX A;  4Z6Y A;  4NB5 A;  3V7R A;  1YRN B;  1RKW A;  1XN7 A;  3LSM A;  1XD7 A;  2DOE A;  1K83 J;  1Z91 A;  3WTU C;  3ZQG A;  1W5S A;  3GFI A;  2F5F A;  3V8J A;  3FDY A;  4L5J A;  3WTV C;  1FYK A;  3LSH A;  4BH9 A;  3VFZ A;  3M8F A;  4XLH A;  1JUM A;  4QIW N;  4HW0 A;  3HOU J;  2KIF A;  4PUS A;  1UAA A;  2DI3 A;  2EIK H;  2L7F P;  4A5M A;  2M87 A;  3S32 A;  3K4J A;  2TDX A;  4FAS D;  2IS1 A;  2YU3 A;  5L3D A;  2DFE A;  1MMN A;  1VFC A;  5F08 A;  4F55 A;  4GDF A;  4KIS A;  5H6R A;  2EIN H;  3Q3S A;  1Z77 A;  4EM0 B; 
#chains in the Genus database with same CATH homology
 2M9H A;  3GTO J;  5IYC J;  2HQ5 A;  1TWG J;  2M8G X;  4XRM A;  1Y1V J;  4EEF G;  5FKO A;  1I3Q J;  1TWA J;  3WHC A;  4XK4 A;  3S1Q J;  4L5E A;  3BG5 A;  2N8G A;  3O8H A;  2YU9 J;  3HOY J;  1FTZ A;  1Z0X A;  1HOM A;  3CQZ J;  2NVX J;  5EF6 A;  3G1L A;  1WGX A;  2K9S A;  3DCF A;  4DW6 A;  2TRT A;  1IJW C;  2ME0 A;  3FK6 A;  3LSR A;  1BL0 A;  1QRY A;  3G1O A;  4AYB N;  2JA6 J;  1I6H J;  5FKN A;  1WH7 A;  5K7Z A;  3GTJ J;  2EZK A;  4A3E J;  1MSF C;  3S16 J;  1U9O A;  2ECC A;  2M34 A;  5J1U A;  2E1O A;  3BG3 A;  5FLV A;  3HGY A;  1FEX A;  1B72 B;  1MSE C;  3LSP A;  3TP3 A;  1JTY A;  4C3I J;  1B8I A;  1W0U A;  2NVT J;  1POG A;  1RES A;  1XS9 A;  2Y0S N;  3M4O J;  1RR7 A;  3BG9 A;  3NAU A;  3H3V K;  2E2J J;  3JRC A;  1O4X A;  3PO3 J;  5M5Y J;  1MH4 A;  1ZTR A;  2M0C A;  3LSG A;  3BR0 A;  3RZO J;  3BR1 A;  2DA4 A;  5F04 A;  2DMN A;  2VKE A;  5IYB J;  2W48 A;  5GPA A;  4B3A A;  1QVT A;  3S14 J;  4AUX A;  2YUS A;  2HOA A;  1MBG A;  2IAI A;  2EZL A;  2JA5 J;  4AC0 A;  5EDN A;  1T33 A;  5J1Y A;  1I50 J;  5IPA A;  3TP0 A;  1CQT A;  2NVQ J;  4B1R A;  1EF4 A;  4Y52 J;  2FJ1 A;  3A01 A;  4D5F A;  1AHD P;  4JP0 A;  4XRS A;  2R7Z J;  3OSG A;  1JT6 A;  3BR2 A;  2XGD A;  5FJ8 J;  2XB0 X;  1MBJ A;  2KT0 A;  1UHS A;  2ELK A;  2XPW A;  3IH3 A;  4M3E A;  2DA7 A;  2JA7 J;  1P7J A;  3S15 J;  3BR5 A;  3M3Y J;  5EG0 A;  3QPS A;  1H88 C;  3SDG A;  3BR3 A;  3I4M J;  4UUT A;  1QPI A;  1JKR C;  3JRB A;  4V2G A;  2Y30 A;  1LE8 A;  2OPT A;  5FKL A;  2DN0 A;  3LNQ A;  1B72 A;  3O8G A;  1WPK A;  3IV5 A;  5F0C A;  5C4J J;  1MBK A;  1JTX A;  1JJ8 C;  3FIW A;  5K7F A;  2HXO A;  3ZQF A;  1G2H A;  3JR9 A;  1OCT C;  3HOX J;  1ETQ A;  4M3G A;  5E3N A;  5FLM J;  4A3B J;  2LP0 A;  3K7A J;  3BT9 A;  3S17 J;  2YS9 A;  2L0K A;  3B6C A;  3HOW J;  1MNM C;  2E2I J;  1IDZ A;  4MO7 A;  2EBI A;  3ZOB A;  1X2N A;  4QSH A;  5J1R A;  4B4C A;  5IOY A;  4RBO A;  3BTI A;  4M3B A;  5IYD J;  3IH2 A;  1A5J A;  1R9T J;  2P81 A;  1TWH J;  2LVS A;  4J19 A;  3GTK J;  2G0E A;  3K2A A;  1T56 A;  1JKQ C;  3BTC A;  2WAQ N;  1VND A;  3QQA A;  3RZD J;  2O7O A;  2LFB A;  2X9D A;  3JRH A;  2DTZ A;  3LOC A;  2FD5 A;  4W97 A;  3C2B A;  4A3C J;  2DA6 A;  2QCO A;  1U8B A;  2PMZ N;  1IUF A;  4JYK A;  1H89 C;  2DMU A;  1JUP A;  2ID6 A;  4MFE A;  2X6O A;  1BW5 A;  4BY7 J;  4BBS J;  4JX4 A;  1JKP C;  1TWC J;  4XID A;  1JT0 A;  3OIO A;  1ETK A;  2B63 J;  2ID3 A;  3OSF A;  1HF0 A;  1UG2 A;  2CRG A;  4FE7 A;  3SFI A;  2R5Z B;  5EYR A;  5EGO A;  2LR8 A;  2XSD C;  4MFD A;  5E3L A;  4UUS B;  5FKK A;  4CYC B;  1U9N A;  4C2M J;  4FE4 A;  3JRI A;  3QPL A;  4BKX A;  1NK2 P;  3HDD A;  5F0F A;  4IHY A;  3Q0U A;  1OCP A;  3BQY A;  2DMP A;  3MN2 A;  2HYJ A;  1F36 A;  3E7L A;  1IDY A;  3FIS A;  2VPR A;  3PM1 A;  2CJJ A;  4A3M J;  4FTH A;  2VI6 A;  5JLX A;  1JGG A;  1SFO J;  3G1M A;  4C3J J;  2Y31 A;  3ZQC A;  3DEW A;  1AKH A;  4I76 A;  3ZQI A;  1PUF B;  1IGN A;  3BTJ A;  5IOZ A;  2LD5 A;  3B6A A;  2LY9 A;  2R5Y B;  2DJN A;  3NAR A;  2XRL A;  3S1N J;  5EEA A;  2NOG A;  2LTP A;  2NS7 A;  2QF7 A;  4M3D A;  2L7M P;  2R5Z A;  1P7I A;  3S1R J;  5M5X J;  5C3E J;  4M3F A;  1ZK8 A;  2MW8 A;  2O9L A;  3A02 A;  3LSJ A;  2DMQ A;  4QTR A;  3ZQL A;  2DA2 A;  2X48 A;  3HKZ N;  1FIP A;  5DTD A;  3JRD A;  2CQQ A;  1BJZ A;  2LKX A;  4D7N A;  2L7Z A;  2LK2 A;  3W6V A;  1ORK A;  1Q1V A;  3UKG A;  3S2D J;  3JRG A;  9ANT A;  3TED A;  3GTM J;  5M3M J;  2XGC A;  4A93 J;  3WHB A;  1DU0 A;  2JN6 A;  5JLW A;  1ZGW A;  1HDD C;  3OOU A;  3HGG A;  1WH5 A;  4RDU A;  3CCY A;  3F0C A;  2E19 A;  1LFU P;  2I10 A;  4V2F A;  4X1E A;  1ETX A;  5J3L A;  2K9N A;  2VUM J;  2TCT A;  3MKL A;  1VF9 A;  4UUS A;  1JJ6 C;  5C4X J;  3TW6 A;  2HDD A;  1GV5 A;  3ZQH A;  1F43 A;  1IRZ A;  2DMT A;  3S2H J;  5E3M A;  2ME6 A;  2HOS A;  3FK7 A;  2MGQ A;  1RET A;  1HDP A;  2MG4 A;  4BY1 J;  2ZB9 A;  1Y1W J;  2AHQ A;  1B8I B;  1AKH B;  1DU6 A;  4NDL A;  3HOZ J;  1FTT A;  2AO9 A;  2COB A;  3HOV J;  2L9R A;  2XPU A;  3I4N J;  4HNV A;  2LLK A;  4DYQ A;  1SAN A;  3SJM A;  3D1N I;  1GV2 A;  1HCR A;  1GUU A;  4A3F J;  1AU7 A;  4A3J J;  4BXX J;  1ITY A;  1HLV A;  2NS8 A;  2XGE A;  1BW6 A;  2EQR A;  2Y9Y A;  4IEJ A;  4JX5 A;  2JA8 J;  3H0G J;  1U78 A;  4C3H J;  3A01 B;  3RQI A;  3BR6 A;  2DA5 A;  5C44 J;  1GDT A;  3HM5 A;  5K7H A;  4DZP A;  1OJL A;  2R93 J;  4Y7N J;  5E3O A;  1FJL A;  1K61 A;  2EZH A;  4FIS A;  3GTQ J;  4BBR J;  2GM4 A;  2CU7 A;  1NK3 P;  2IEK A;  3GTL J;  3VPR A;  2EZI A;  1LE8 B;  2JJ7 A;  1ZKG A;  1QVU A;  3GTP J;  1IV6 A;  2EH3 A;  1WCM J;  1ZR4 A;  3JRA A;  5F0H A;  4XRS G;  3TW7 A;  4MIM A;  1TC3 C;  4JX6 A;  2XPV A;  1VI0 A;  5EZG A;  5EG0 B;  2ECB A;  1YRN A;  2GBY A;  5M5W J;  2OF7 A;  1D5Y A;  1RKT A;  2K9Q A;  5IP9 J;  2HXI A;  1FIA A;  3HB9 A;  1APL C;  1W0T A;  3RKQ A;  4XIC A;  2JMW A;  4W1U A;  3CDL A;  4ABZ A;  5IP6 A;  1ETY A;  5GPC A;  2XB5 A;  4MLO A;  2M2E A;  3FKI J;  2CQX A;  2R92 J;  2FX0 A;  2DA3 A;  4A3D J;  2KDZ A;  1ZR2 A;  5IP7 J;  4IHV A;  1JKO C;  1XG1 A;  2K40 A;  3JRE A;  4IHX A;  1E3O C;  1JUS A;  3CMY A;  1MBH A;  4DYR A;  3Q0V A;  2GLO A;  1UMQ A;  3Q0W A;  1ETO A;  1ZQ3 P;  1MH3 A;  4D7M A;  2Y9Z A;  4LOC A;  2IBD A;  4G12 A;  2VKV A;  3BQZ A;  3IH4 A;  1X2M A;  2H1K A;  3GBG A;  2DA1 A;  2Y2Z A;  4I6Z A;  1RPW A;  1OFC X;  1BA5 A;  3HEF A;  4IHW A;  2O8K A;  1GVD A;  4DZJ A;  1MBE A;  2HI3 A;  1ETW A;  5EGO B;  4S0H B;  2D5V A;  1NTC A;  2WB1 N;  5FKM A;  4DYC A;  2NVY J;  2R0Q C;  4CYC A;  5F27 A;  1IC8 A;  3GTG J;  1H8A C;  3HBL A;  1WI3 A;  4X6A J;  2FQ4 A;  2JK3 A;  2E2H J;  1ETV A;  4A3K J;  1GT0 C;  2RAE A;  3JRF A;  1X58 A;  4D5C A;  2MSY A;  2CUE A;  5EZH A;  5BNG A;  1YRN B;  1RKW A;  1S7E A;  1IG7 A;  3PO2 J;  1K83 J;  3ZQG A;  5M3F J;  2JWT A;  4A3L J;  3BTL A;  3MVP A;  2R5Y A;  2CUF A;  3A03 A;  3HOU J;  4QIW N;  1JUM A;  5GP9 A;  4GFB A;  1XC5 A;  1TWF J;  2WV1 A;  1MBF A;  4A3G J;  2L7F P;  3S1M J;  1LFB A;  2H8R A;  4FCY A;  1ENH A;  4A3I J;  4A69 C;  5F1J A;  5HOD A;  1VFC A;  5DS9 A;  5F08 A;  1A6I A;  4M6V A;  3L1P A;  1PUF A;  3Q3S A;  1Z77 A;  2HOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...