3S15J

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s15J00
3FISA 3OSFA 3LNQA 1BW6A 2Y2ZA 2NOGA 5IPAA 1IV6A 4A93J 3SJMA 5M5XJ 5E3MA 2YU9J 2CU7A 4XICA 1OJLA 3S1RJ 3F0CA 3MVPA 3S1QJ 4DYCA 1W0UA 2MW8A 3S1MJ 4DW6A 3BQYA 4I6ZA 1BA5A 1GV2A 5K7FA 2XPUA 4IHWA 9ANTA 2TRTA 1H88C 1HLVA 2R0QC 1I50J 2G0EA 3BR2A 2Y9ZA 2EBIA 2IEKA 5F04A 3CQZJ 3H0GJ 4FE7A 4GFBA 2XGCA 2Y30A 1YRNB 3LOCA 2ID3A 4A3CJ 2R5YB 1RETA 4B3AA 3JRBA 1HF0A 3FK7A 5E3OA 2JA6J 2NS7A 1B72B 1NTCA 2GLOA 3UKGA 3ZQHA 2XSDC 5GPCA 1T33A 1NK2P 1Y1WJ 4MIMA 1Z77A 4EEFG 1ETOA 3NARA 1I6HJ 5JLXA 3Q0VA 4MO7A 2IAIA 3GTJJ 1JKPC 3L1PA 5F1JA 1JUMA 2M8GX 3CCYA 1JJ6C 5FJ8J 3K7AJ 2L9RA 2HYJA 4V2FA 4UUTA 4DYRA 1YRNA 3BQZA 2CRGA 5HODA 2R5YA 2QF7A 3IH2A 4L5EA 5FLMJ 4Y7NJ 2Y0SN 3H3VK 3JR9A 1ETYA 2GM4A 4A3DJ 1B72A 3A02A 1A5JA 4J19A 2E2JJ 5E3LA 3G1MA 5IYCJ 2XGDA 2LK2A 3HOZJ 1X2MA 1U9OA 1TWGJ 3LSJA 1TC3C 1W0TA 1AU7A 4Y52J 1JUPA 4M3DA 5C4XJ 5GP9A 3IV5A 2DMTA 3S15J 5EYRA 1FTTA 4JX4A 3LSGA 1P7IA 3QQAA 4FISA 1GVDA 1FIPA 1QRYA 2MG4A 3WHCA 3BG5A 5IP6A 5C44J 2ECCA 4RDUA 1E3OC 1XS9A 3HOVJ 2EZKA 3PO2J 2CQXA 3FK6A 1POGA 1LFUP 2JA7J 1U78A 1IC8A 3I4NJ 2LY9A 2L0KA 3MN2A 3BTLA 3QPSA 3CDLA 4IHVA 5EEAA 3BG3A 3Q3SA 4XIDA 4BY7J 3O8GA 3HM5A 2WV1A 4G12A 4NDLA 2EQRA 2M9HA 2ID6A 3LSPA 2JK3A 3PO3J 2FX0A 4BXXJ 4BKXA 1RPWA 1ZK8A 5F08A 2M2EA 1QVUA 3JRAA 2HI3A 4M3FA 2R5ZB 4AC0A 1FIAA 3M3YJ 5IYDJ 2FD5A 1I3QJ 4W97A 1H89C 2GBYA 5M3MJ 2WB1N 2KDZA 5FKKA 3CMYA 5IP7J 3ZQCA 2DJNA 3HOXJ 2L7MP 2HXIA 3TEDA 1VNDA 3GTQJ 2Y9YA 1GDTA 2CUEA 1TWHJ 1PUFB 1MBGA 1X2NA 1ORKA 4XK4A 5DTDA 3TW6A 1GUUA 1RR7A 3BR6A 3S16J 2L7FP 2B63J 1RKTA 3TW7A 3GTPJ 3RQIA 2R5ZA 3JREA 2E19A 2LLKA 2DMPA 2XPWA 2DA3A 1TWCJ 2VI6A 4HNVA 4AUXA 5IYBJ 1UMQA 2LFBA 1MNMC 1HDDC 1HOMA 2LKXA 5K7ZA 3HDDA 4FCYA 1U9NA 3A03A 1D5YA 3BT9A 4XRMA 3BG9A 5E3NA 2NVQJ 4A69C 2HOAA 1HCRA 2DA2A 1A6IA 5C3EJ 3VPRA 1PUFA 1FJLA 2HOTA 3B6CA 1IDYA 1ENHA 1ZTRA 1MBJA 3HB9A 4M3BA 3C2BA 4A3GJ 4IEJA 3FKIJ 4UUSB 2WAQN 5IOZA 1R9TJ 2CUFA 5F27A 1WGXA 4A3KJ 5M3FJ 2XB0X 3SDGA 1JT0A 1HDPA 1JUSA 2L7ZA 2M34A 4AYBN 2LR8A 1VF9A 1JT6A 5C4JJ 2P81A 1P7JA 4W1UA 3HKZN 4B1RA 2MGQA 1MBKA 3K2AA 3PM1A 2CQQA 3BTCA 1ZR4A 2QCOA 1IGNA 3I4MJ 5FLVA 2YS9A 3M4OJ 5DS9A 1QPIA 3DCFA 1U8BA 3HOWJ 1LE8B 1GV5A 2ZB9A 4UUSA 2E1OA 4C3IJ 1MBHA 2LP0A 1GT0C 3GTKJ 4B4CA 4BBRJ 2NVTJ 1OCTC 3NAUA 1WH7A 2E2HJ 4V2GA 3S17J 4X1EA 2O7OA 1JJ8C 5J3LA 4C3JJ 4IHYA 2E2IJ 4MLOA 1XC5A 1JTYA 1FTZA 5FKLA 2LTPA 4X6AJ 3SFIA 5GPAA 1BW5A 4JYKA 2VPRA 5J1YA 2M0CA 3FIWA 1WI3A 3JRIA 1CQTA 2COBA 4FTHA 1DU0A 1ETQA 3G1OA 3HBLA 1JKRC 2N8GA 4MFEA 4JP0A 2DA6A 1Y1VJ 3BR0A 1LE8A 2R93J 1ZGWA 2JWTA 4QTRA 4S0HB 2RAEA 3Q0UA 4C3HJ 4QSHA 4D5CA 1ZKGA 2R92J 3HOUJ 5F0CA 1NK3P 1FEXA 4BBSJ 2W48A 4A3MJ 1ETWA 1MSEC 2Y31A 2HXOA 3IH4A 2DN0A 4D7MA 1IJWC 2D5VA 1K61A 4IHXA 5J1RA 1Z0XA 3S1NJ 2EZHA 2DA5A 2KT0A 3JRDA 1XG1A 2DMUA 1IUFA 3RZOJ 1UG2A 3LSRA 5F0FA 1O4XA 1AKHB 2H8RA 2XRLA 4M3GA 2AO9A 1MH3A 2AHQA 4D5FA 3GTMJ 2X6OA 2ECBA 4D7NA 1IG7A 4FE4A 3MKLA 1F43A 2LVSA 2O8KA 2HOSA 2PMZN 1WPKA 3QPLA 3S2HJ 1OCPA 3BR1A 2YUSA 5JLWA 3BTJA 1F36A 1APLC 3G1LA 1G2HA 4DZJA 5FKMA 3BR3A 5M5YJ 4JX6A 2K9SA 5K7HA 5EF6A 3IH3A 1K83J 2DTZA 3W6VA 4C2MJ 1B8IB 1ITYA 3GTOJ 3RKQA 2XGEA 4BY1J 1AKHA 4A3BJ 3D1NI 1BJZA 1EF4A 2JMWA 1TWAJ 5EGOB 2EZIA 2H1KA 1WCMJ 1TWFJ 1OFCX 1LFBA 4CYCB 1T56A 3O8HA 5EG0B 3OSGA 2FJ1A 3GTGJ 3ZQIA 2O9LA 2DMNA 2HQ5A 2NVYJ 4QIWN 4M6VA 3HOYJ 5BNGA 3BTIA 4A3JJ 3OIOA 5FKOA 1DU6A 3WHBA 3HEFA 1VI0A 1ETVA 3HGYA 2DA4A 5J1UA 1AHDP 2EH3A 2X9DA 1MBEA 5M5WJ 1MH4A 1ZQ3P 4A3LJ 1B8IA 2R7ZJ 1UHSA 5F0HA 2NVXJ 3Q0WA 1IRZA 2I10A 2XPVA 2DA1A 2VUMJ 4MFDA 1ETXA 2OF7A 5EGOA 2JJ7A 2HDDA 4A3FJ 1JGGA 4CYCA 4ABZA 2MSYA 2DA7A 3E7LA 3A01B 2EZLA 4JX5A 5EG0A 2ELKA 2ME0A 2JN6A 5IOYA 4DYQA 3TP0A 3ZQGA 3ZQLA 4LOCA 2FQ4A 1MBFA 1S7EA 3BR5A 1RESA 1H8AC 1MSFC 2K40A 3JRCA 1QVTA 4XRSA 4A3EJ 1BL0A 4RBOA 2LD5A 1WH5A 4I76A 1SFOJ 2XB5A 3HGGA 4XRSG 5EZHA 3S14J 2K9NA 2K9QA 2DMQA 1VFCA 2ME6A 3DEWA 3JRHA 3S2DJ 3ZOBA 3A01A 1JTXA 2X48A 1ETKA 1RKWA 5EZGA 1ZR2A 3OOUA 4DZPA 5EDNA 3JRFA 2JA8J 3GTLJ 1JKQC 2CJJA 3GBGA 3RZDJ 2VKEA 2OPTA 1X58A 3ZQFA 2JA5J 3TP3A 2NS8A 2TCTA 1Q1VA 3B6AA 2VKVA 1IDZA 1SANA 4M3EA 4A3IJ 1JKOC 5FKNA 5IP9J 2IBDA 3JRGA
chains in the Genus database with same CATH superfamily
1LNWA 4PGHA 3ZCOA 2AS5F 5HDNA 1BW6A 2Y2ZA 3W2WA 4QLCU 2ZXHA 1IV6A 2RNJA 2XKPA 2IVMA 1R1UA 2KISA 4XLAA 1T38A 1X3ZB 2K3FA 3S1QJ 3J80K 1YTYA 1SD7A 3DTKA 4OAZA 2A61A 5E1ZB 4WCGA 3H5RA 1WKMA 3HKZA 1PVEA 1Y0NA 2MW8A 4DW6A 4I6ZA 2DCEA 1GV2A 1V4RA 1FWZA 1LPQA 3N97A 3VWBA 1UHWA 1J75A 5J8FA 2ZBKA 4Z6YA 3H35A 2V9PA 5LHGA 1H88C 1OQYA 1W7PB 2HQNA 1A36A 1WQ2A 5B1AH 2JVGA 4FE7A 1MDMA 2STTA 4GFBA 4CCMA 4B43A 1YRNB 2VIXA 2R5YB 2E1NA 3JRBA 4EJVA 2Z3YA 4PK4A 1YFHA 4HQEA 1S9HA 2E7WA 3QPHA 5FO5A 1B6AA 3MKYB 3UKGA 1HW5A 2YX7A 3ZQHA 5AONA 3P5JA 1T33A 3E6BA 4UNOA 1QGPA 3OYIA 2R7FA 1EKEA 4IL6C 2JSCA 3Q0VA 3R4KA 2LF7A 2IAIA 2X6YA 4MO7A 1ZARA 2K85A 5BQTA 4DBQA 3JSPA 2WBMA 4IQ4A 1JUMA 2ZMEA 4EGYA 4LIUA 4LITA 3R60A 2PMHA 3S32A 3VOEA 2D1HA 2HYJA 4DYRA 3IL2A 3WG7H 1Z05A 4P1WA 3CC4I 1HW2A 2QF7A 2F2EA 1OLTA 4M6XA 3QYEA 2P7CB 3CUQB 3IWZA 4BHPA 1BI0A 1XDSA 2GM4A 2LREA 2FMLA 2E7XA 1RI7A 1YHQI 5D4SA 4YFKF 3F3XA 2HU9A 3I58A 4PDKA 4KIFA 3AG1H 5E3LA 5ICCA 5IYCJ 2XGDA 4CZZA 3A0HC 1UFMA 3L2VA 4YIFA 1U9OA 1TC3C 1W0TA 3FXJA 4E7LA 4UUVA 1AU7A 2ETHA 5CVUA 1JUPA 1TW2A 2OQRA 4RB1A 3OS0A 4Q48A 3IV5A 4JBAA 2IS4A 2M7BA 2ESNA 4M73A 1QA6A 3C3WA 5EYRA 1FTTA 1FP2A 2DK8A 4JX4A 3G71I 3CCEI 2JPBA 2BW3B 3BP8A 2LSOA 1WJBA 3FMSA 1GVDA 2HVQA 5IP6A 1XS9A 3PO2J 1KGSA 2VC1A 4BQNA 3FK6A 1POGA 2V1UA 1G3WA 4NB5A 1LFUP 5DUIA 3P7NA 1IC8A 1U5TA 3QPSA 3BTLA 2ZNZA 4PCQA 4HX8A 5EEAA 3BG3A 4XIDA 2PN6A 4BY7J 2VE8A 4B48A 2EQRA 1SC7A 2ID6A 2JK3A 2FX0A 2L4AA 3U21A 1KU3A 1BM9A 4XLPF 4IHSA 3O6BB 3HC7A 3WG9A 4XRFA 4L5JA 2VT3A 1TNTA 1UCRA 1ZREA 5IT9K 2M5WA 3LSHA 5IYDJ 1I3QJ 1SEUA 3E0JB 3H9JA 3JSOA 1TBXA 1R22A 4CCNA 3I53A 1LUJB 3KP3A 2ISYA 4LB6B 3U9GA 1E2XA 2DJNA 3D5SC 1I1GA 3TEDA 1CF7A 2Y9YA 1U2WA 4BJTA 1GDTA 1EV7A 2HVRA 1G3YA 2M4GA 4NC7A 5KAFC 4RB3C 1YX3A 2G9WA 3WTVC 2DO7A 2LKPA 3PIOF 2IGMA 1B9NA 3TW6A 2Z33A 3GFJA 5FD6A 2WC2A 3G3ZA 4AVPA 2L7FP 3BC8A 2CUJA 4BAYA 3FF5A 1B59A 2EFPA 2H94A 2RC4A 1XDUA 3GTPJ 2R5ZA 4ESFA 3JREA 4F91B 2M1BA 2X1DA 4KICA 4HW0A 2UXXA 3GZ6A 4EATA 2LFBA 3Q9SA 2LKXA 5K7ZA 4RB0A 2XAUA 1D5YA 1YJ9I 3BZCA 2FMYA 3RYRA 4RB2C 3LA2A 2M3AA 1SMTA 2GIZA 3BG9A 5E3NA 4O3MA 2VPLA 2IA0A 2OCCH 3FXQA 2DA2A 2NNYA 1N25A 3VPRA 1YW8A 5LRSA 2IGNA 3B6CA 2LKSA 4BXUA 3MKWB 1ZTRA 4A3GJ 1LDKB 5GTHC 2W7NA 2WAQN 2R7DA 3MZHA 1R9TJ 3HOTA 4KIBA 3GEZA 2XB0X 4KFCA 4DGWB 2L54A 2LBFB 2BXZA 1P4XA 2KQRA 4AYBN 1B4AA 3CCSI 2V4JC 2KJCA 5D5WB 3CDIA 3R0JA 4KA4A 4UVBA 1Z6TA 2MGQA 1XSVA 3GUDA 2P6SA 4IRHA 3MMYB 5DCMB 3I4MJ 5FLVA 2YS9A 4LLNA 1OCZH 5L3BA 1LKXA 2H09A 3BZKA 3DCFA 1XB4A 3HPGA 4HX7A 3HOWJ 2F5CA 1GV5A 2ZNYA 2ZB9A 4UUSA 3F6OA 3REOA 1S72I 4C3IJ 1MBHA 1TT0A 1TTYA 2A69F 3K4JA 5KNLA 2A6EF 2CG4A 1T6SA 2MD5A 3GO5A 3NAUA 4V2GA 2D1VA 1JJ8C 5J3LA 4C3JJ 4OMYA 4U88A 4HNUA 2DFFA 4FASD 4B8XA 1G59A 4BE2A 4AWXB 2W57A 2VPRA 4P9UA 2DT6A 1X4PA 3CP8A 1WI3A 3JRIA 1R49A 2VBWA 4I09A 4EM0B 2VONA 1MMSA 5K1YA 5B3SH 1E3PA 1G8XA 5DM6F 1HXDA 1SVLA 2VKHA 4IZZA 4AIJA 4D0PA 1EH8A 4HV5A 4QTRA 6PAXA 2X4HA 4QSHA 5F0CA 3HL2A 1NK3P 1X4OA 3KE2A 2W48A 4A3MJ 1OCRH 1ETWA 1YE9A 3GZ5A 4MEXF 2Y31A 2OV7A 1XCBA 1PP8F 1R58A 3S3NA 2CSOA 4GCVA 3EPZA 4RLQA 4ESBA 4BH9A 3JRDA 1XG1A 2DMUA 4PZJA 3OR2C 1UG2A 3AG4H 3F21A 1O4XA 4LFUA 5D5VB 3DLLF 1AKHB 3Q9VA 2XRLA 3FM3A 3WTSC 3GTMJ 2X6OA 3FMRA 2ECBA 1VQMI 3CUOA 3PUBA 2H6CA 4P5OA 2LVSA 2O8KA 2HOSA 4G7OF 5A2QZ 3L2QA 3L00A 3K70D 3RSNA 4I2OA 1XN7A 1OCPA 1D8KA 1TT5B 2HYFA 3BR1A 5JLWA 4LG0B 4AM3A 1APLC 3G1LA 4OIQF 1T8IA 3CJRB 5FKMA 1ZRDA 5K7HA 1QNTA 1XGNA 4C2MJ 3H36A 1XMXA 3K6GA 3PNVA 1IZ1A 3D1NI 4EJUA 1VZ0A 5DYMA 3DBHB 4ZDPA 2H1KA 2MD0A 1TWFJ 3MCZA 1WZ2A 4CYCB 2JT1A 2ELJA 2L01A 3DP7A 1YW7A 5CVJA 1T39A 2V6EA 3OL4A 2GA1A 2DMNA 2NVUB 3M8JA 3U1KA 2NYXA 3CC2I 4K2EA 4M6VA 4QPOA 1IW7F 3BTIA 4A3JJ 3OIOA 5FKOA 2L3DA 4C2TA 3TQNA 1DU6A 3HZJA 4XSZF 2NXNB 2GA2A 3HGYA 4XNFA 3IHUA 3K2ZA 3PQJA 1UAAA 1Z7UA 2O03A 2IA2A 3E5UA 1MH4A 2L9VA 1G3SA 5L3CA 1UHSA 3LSKA 3I56I 1QZYA 2XPVA 1PP7U 1E3HA 4M9XA 2VUMJ 4I98B 1MJBA 2QBYA 5EGOA 4B44A 1GXQA 1OPCA 4RMNA 3SEZA 5FLXZ 3BOQA 4A3FJ 3RQ4A 4ANJA 2E34A 2DA7A 4I0BA 2HZDA 2F4MB 4MQ9F 5ILVA 4JX5A 5EG0A 4R1HA 1S6LA 5LHHA 4HOBA 5K5RA 3VODA 3HSEA 4XLFA 3ZQGA 3ZQ7A 1TQIA 5GAHJ 1MBFA 1S7EA 4ZJZA 2K40A 2CW7A 4QPQA 3FX3A 2XF7A 3HUGA 3HPHA 2Q8KA 3JRCA 2X6WA 1X1DA 2I8DA 2DFIA 2KJBA 4YELA 4HQMA 4E7SA 2HR3A 3DPUA 2Z16A 4HNTA 4NUBA 5EZHA 3J81Z 3BG7A 2ZCWA 1YQAA 1KQ8A 1QZZA 1S8NA 2E36A 1HC8A 3FHNA 4UVCA 4H4KC 3JRHA 4E7HA 2LF8A 3EUHC 1H9TA 1I1SA 3WE3A 1ETKA 3MAJA 3GCMA 1ERDA 3CF2A 3L7WA 3F6VA 2JSPA 5EDNA 2HOEA 1MMAA 2OPTA 2VKEA 4UV8A 3ZQFA 4Y33A 3I55I 2JA5J 1KU9A 1VQNI 2B9SA 4DOZA 4EGZA 1USTA 3L2CA 2L9NA 1I6XA 3DBRB 2OU2A 1IV8A 2M30A 3KP6A 2P7VB 5ICEA 2IBDA 4XKVA 3CO7C 3GW2A 1FX7A 3JRGA 2QENA 2JVHA 3FISA 3K1MA 3LFKA 2ZXJA 3O2PE 1FOYA 2NOGA 5IPAA 2M7AA 3SJMA 2CU7A 5CKTA 1OJLA 3ABMH 5ILUA 3CCQI 3F0CA 3ZP5A 2VKDA 3W6JB 1MNDA 3M1EA 1A31A 3WTUC 4G6TB 3IAS2 4HYEA 1IN4A 1W0UA 3FXRA 4ETSA 2DT7B 1BBYA 5K7FA 2W00A 3JAMK 3SZPA 3HYIA 1JHFA 4ZYHA 4XOTA 4HEA2 4KMFA 1SAUA 2G0EA 4CCKA 3PQKA 2EBIA 2IEKA 2ZMEB 4M9ZA 3H5AA 4M74A 3ZMDA 3PFYA 1UG0A 2QZ8A 3GZNB 2XGCA 2Y30A 4NQWA 3LOCA 4A3CJ 1RETA 3AG2H 3I59A 1HSTA 1VQ5I 2ZC2A 2VJ5A 2HGCA 1FYLA 5ICGA 2JA6J 1TLHB 2KZGA 1NTCA 1VQ9I 3V8KA 3HHHA 2XV4S 3GVAA 3CJQB 2XSDC 1V5GA 3OIQA 5GPCA 5D6FA 4ENJA 1NK2P 2EA2A 1Y56A 4MIMA 3P9CA 1P6RA 3CCVI 4EEFG 3F23A 1ETOA 4IKFA 3I71A 5JLXA 2XIGA 3ZR8X 1KYWA 2IS1A 3GTJJ 3BG6A 4OINF 5DCFA 2M8GX 4AD9A 4BE1A 3CCYA 1JJ6C 1XTAA 4JOMA 2V9VA 1K4TA 1LB2A 1F1ZA 4IRGA 5L3DA 2WTEA 4UUTA 5CPRB 4BXFA 4NC8A 2R3SA 3IUOA 2ZSHB 3BCBA 3GFIA 1WSUA 2Y0SN 4CUGA 5LFAA 4A3DJ 4I01A 1B72A 3A02A 4J19A 1O3RA 5FGMA 2VBXA 2E2JJ 3K1NA 2Z1DA 4ESJA 3A1YA 1U5TB 3G1MA 1YO5C 3K4MA 4LMYA 3WU1B 2B0LA 4NC6A 1KQ0A 2DLLA 3M9AA 2WV0A 1Z67A 5GP9A 1X1AA 4HG2A 4S04A 1RC9A 3LSGA 1G6NA 4PJMA 4A6EA 4F3QA 2QQBA 2CQ7A 2EIJH 3U2RA 1BN5A 2PX9A 3IKVA 4HBLA 2CQXA 1VQ6I 4HLXA 2ZJQF 3ZPLA 2FE3A 1CF7B 2JA7J 4M71A 4HA8A 5J47A 2OUMA 3HTUA 4U0VA 2PJPA 1WFXA 5HS8A 3Q3SA 4HX4A 4Y13A 3H3UA 3TMOA 1C0WA 1NHAA 4Y17A 1GXPA 1QVUA 3JRAA 1QHHD 4EVIA 2VODA 2M45A 2W84A 2R5ZB 5IT3A 4Q47A 3OYAA 4KUMA 3W3CA 5D8LB 3DF8A 3LFUA 4W97A 3LQQA 4E7JA 2GBYA 2WB1N 2KDZA 1XCVA 5IP7J 3ZQCA 2UWMA 4B47A 3F22A 1SFEA 2RVCA 1N77A 1A6QA 1MMGA 3IWFA 2DDAA 3E3VA 1VNDA 3GTQJ 5ICFA 3A2KA 2K86A 1TZLA 4ZH4F 1BR2A 1T2KA 5LEKA 1ORKA 5KVRA 5DTDA 3IC7A 2K27A 3DEUA 1BI1A 3LAPA 4FQGA 3BR6A 1RKTA 2AQFA 3ZMUA 3I54A 5DEQA 3RQIA 3B02A 4OAYA 5J4YA 3OIPA 3QWLA 2DMPA 3CCLI 4OIPF 1TP4A 2P8TA 4AUXA 1ACIA 2QEXI 1HOMA 4XKWA 1ULYA 2HQRA 3HDDA 4FCYA 1ON2A 1U9NA 4CSWA 3SZGA 2YPRA 2CGPA 4LD5A 1JI8A 2LOOA 3QAHA 2OZUA 3HSFA 1HCRA 1A6IA 3H9GA 1S5LC 4ZYGA 2HOTA 1IDYA 4XM3A 3DTIA 1F9NA 1IXSB 3HB9A 4M3BA 1MD0A 5CVRA 4U7BA 1WJDA 4IEJA 3FKIJ 4N4OB 3WODF 4UUSB 3M1CA 2H27A 2KIMA 2CUFA 3E6MA 4A3KJ 2YSRA 1ZELA 4EMSA 2XAQA 4PJ0C 1JT0A 3J7AO 2K5CA 2EB7A 1HDPA 3I5UA 3G2BA 3KLOA 3WTYC 3OYEA 3C2HA 2XSJC 3HG9A 3RYPA 5C4JJ 5KK1A 1P7JA 4IPAA 1TNSA 4WXDA 5DV5A 3DTEA 3CCMI 1MBKA 2ZO4A 2PI0A 3K2AA 2DPUA 3M8FA 2CQQA 4F93B 3JCUC 1IGNA 3EUHA 2A6HF 3KCCA 4XLEA 3SYTA 1FOKA 3M4OJ 2AQEA 4I99C 1QPIA 1BR1A 3KP2A 1U8BA 2QQ8A 4XKBA 2CWEA 1MW7A 2LP0A 2QQ9A 3TOAA 1GT0C 2X51A 4B4CA 4BBRJ 4X0GA 2RV8A 2P5LC 1OCTC 1QHGA 1YS7A 4ZDOA 3KYDB 3VSLA 1GLNA 5JHUA 2MA3A 2W25A 4X1EA 3VB2A 1UZCA 1QO0D 2VBYA 4ENMA 1R5ID 5FKLA 5DDGA 2GWRA 2PLYA 4IF4A 1NG7A 4BDZA 4JYKA 1HSJA 2M0CA 4LLGF 1J9IA 2COBA 3HJEA 4FTHA 3LWFA 1DU0A 5FFZA 3HBLA 2KRCA 5LRRA 3GWZA 2H1LA 2DA6A 1Y1VJ 3ECOA 1LE8A 2R93J 1ZGWA 2PG4A 2Y75A 4OIRF 1OCOH 4ZTFA 2RNGA 5BS6A 2EIKH 4EM2A 2GQQA 4EV0A 3KZIC 4G7ZF 2FSWA 3I4PA 3EYYA 4WXHA 3ASOH 4AU7A 2Y48A 2VL8A 3TOBA 1BI3A 1SD4A 4CA0A 2D5VA 1VQ8I 2DXIA 3U1DA 3ROUA 1MNEA 3ABKH 2DA5A 1ZLJA 3OYGA 4KT5C 1TL8A 1UELB 2LC2A 3RZOJ 4DQ2A 4HZFA 2F5EA 3DFGA 3GLLA 1SFXA 2AO9A 2AHQA 2VOPA 1JXSA 4CDGA 1JGSA 3RIRA 3H92A 2COMA 3AG3H 1WJ5A 4D7NA 5H20A 4DNCA 3E5XA 3QPLA 4FT8A 1ZRCA 3IRQA 1HKTA 3GLXA 3BTJA 2BXYA 3BY6A 3VYUB 3J7AY 4IHTA 2RN7A 3K4NA 1G2HA 4DZJA 2R7TA 3LSMA 4PJLA 2BBYA 2G7HA 4I7HA 3RTRA 2HWVA 3SHFA 2QVOA 3OMYA 4TV7A 4XSXF 5EF6A 5TRDA 3H0DA 1U8RA 3QP5A 4O6JA 3GTOJ 4U7DA 4BY1J 2H6BA 4RAFA 5F1RA 2JMWA 2FNPA 1TWAJ 4RAGA 5EGOB 2QBYB 1XGSA 4PFOA 2F48A 4XN3A 4UV9A 5EG0B 2EFOA 3OSGA 2FJ1A 4M72A 3X2QH 4E7IA 1EH6A 1KU2A 2QYOA 5BPIA 4QIWN 2OJED 3FKJA 2HTJA 4MGRA 5LEJA 4MNUA 2L9SA 4XLHA 5CYVA 3IRRA 2XVCA 3ZMSA 4BQQA 2A5YB 3HUGB 3K69A 5H6QA 1MBEA 2JRTA 3PUFA 2KKOA 4F92B 3MZ8A 5F0HA 2NVXJ 4UVAA 4L9VA 4BHCA 2R7QA 4CO8A 3LQRA 4IO9F 2PJRB 1DP7P 3D5RC 2R7UA 3RKXA 1BOBA 1DDNA 4A2UA 3K4LA 3F8MA 5HLHA 3E7LA 2EZLA 2FNAA 2ELKA 2JN6A 3KP4A 1SFKA 1XGOA 3WTZA 4I02A 3HXLA 3ZQLA 3FDYA 4MTDA 2MLKA 4KN7X 1PJRA 1RUNA 2HTSA 1QVTA 3ABTA 4MEYF 2J5PA 4DIQA 1QQIA 2LD5A 5CJ9A 5TGTA 2XB5A 2IS6A 1I39A 4XRSG 3GFMA 1X19A 1LVAA 5ED4A 1HW1A 4UB8C 2IP2A 2DMQA 4BGDA 1XSXA 2KL4A 2ME6A 1VFCA 3DEWA 1F5TA 3A01A 3TBIA 1SD5A 1ZGJA 1RKWA 5EZGA 1D1CA 3FXMA 2X1CA 4YFNF 1WJEA 2V7FA 3D5LA 3CCRI 3TKYA 3ZN1A 2JA8J 3GTLJ 1JKQC 3GBGA 1ZN2A 2EJRA 5LGTA 3MKZA 3ABUA 2NS8A 1FY7A 5HLTA 2K02A 2AXTC 2OTLI 2VKVA 3K4BA 4EJWA 2OZ6A 4HF0A 2WAQA 2ADUA 2BGCA 5IP9J 3G73A 4HPQA 4S05A 2ICWG 3OSFA 4NQWB 1VTNC 2ESHA 1LEBA 2BW3A 1D3YA 3I59B 5GAGJ 4HF2A 2O5RA 4AYBA 5M5XJ 5E3MA 3S1RJ 2HKOA 2M4KA 3ZQQA 2RKHA 4WXCA 1IN7A 3VSKA 1YS6A 4MQVA 2RREA 4F52A 1FPQA 4L9TA 2AXLA 3S1MJ 3BQYA 3PNTA 2QKLB 2BZTA 3ERMA 3EUKL 3COAC 3WU0A 1X1PA 3OYKA 4OIOF 2Y0MA 1AWCA 2CQNA 2TRTA 4A0ZA 1HLVA 4A12A 2R0QC 3NWSA 4N0BA 3BR2A 4HV6A 4BEHA 1ONVA 1J59A 2Y9ZA 3T0YA 4F55A 1R36A 3L9FA 5F04A 2IT0A 3CQZJ 3H0GJ 3CO6C 5BOXA 1LFPA 4XORA 1UB9A 4B3AA 2XRNA 2VXDA 3OYJA 1HF0A 3FK7A 1ZG5A 2VQLA 3S93A 3OWTA 5E3OA 2UZKA 4KYWA 3OL3A 4BJ6C 1S3JA 1B72B 3CC7I 1D8JA 3DU5A 3MD2A 2GLOA 3WTTC 2OBPA 4A6DA 2DOEA 3HIFA 3WGIA 3F9KA 2QUFA 3SQNA 3CTAA 4KNYA 2BVMA 1Y1WJ 2CS3A 3FBIB 5DUKA 1I6HJ 5FRNA 4N9HA 2OQGA 2XAFA 4L9NA 3T5XA 2V9KA 1JKPC 1EH7A 3NRVA 3L1PA 4BE0A 3BJOA 2KP6A 3KZYA 4E4HA 2VJIA 1Y8QB 5FJ8J 2EWNA 3ZMTA 3K7AJ 4V2FA 2KFDA 3PNYA 1ZAOA 2CRGA 3BQZA 4M9SA 1OMIA 4ASNA 1T95A 1FMWA 5FLMJ 2I5UA 3C7JA 3W2VA 3JR9A 1Y8RB 4LJZF 3I64A 5E1XA 5D8KB 4H0EA 3TDUC 1USSA 3TO6A 2P0WA 2WA0A 1K79A 1X2MA 3P9KA 5D5XB 3PJRA 1TWGJ 2Q2EB 3LSJA 3QYFA 4RGRA 2LY2A 4CICA 3KETA 2MLGA 4ON0A 2MBFA 4LK0F 4UHTA 4LLLA 3S15J 1D0YA 2MH2A 2VT2A 1W4MA 3QQAA 1FIPA 1ZG3A 1QRYA 2KLOA 4CCOA 2MG4A 5C44J 3BG5A 1OYIA 4KT6A 4RDUA 1E3OC 1P92A 3HOVJ 2EZKA 1O3QA 1BJAA 2RQQA 4CYDA 3SEQA 1R1VA 4RLFA 3ONQA 2Z99A 2MFZA 1U78A 1CGPA 3I4NJ 2LY9A 1R7JA 5DCMA 2E35A 1W5TA 2E1MC 3KEOA 1L3LA 2ZFUA 2CH0A 4G8XA 1J09A 2EV0A 2G7UA 3QOPA 4ZYAA 3PO3J 3V7SA 1FBQA 1RPWA 1FC3A 1U6GA 5LGUA 4XLCA 2M2EA 1Y6IA 1KZHA 4A0YA 1T0FC 4CCLA 2HI3A 4M3FA 3RDIA 2CV1A 5K5QA 1MDMB 4A5NA 4I0AA 3M3YJ 3KFWX 4R8HA 1H89C 5A2QK 1WWXA 3H1CA 1MZBA 4OMZA 5M3MJ 1I3AA 3CMYA 1FSEA 3OYLA 1U0JA 4ZYDA 3F8CA 3T1BA 2JA2A 4G7HF 1FLIA 2L7MP 2HXIA 4MHGA 1OR7C 3W2AA 4XLNF 1TWHJ 3KYLA 1MBGA 1R71A 1X3UA 1X2NA 4B09A 3ZMVA 1YOVB 2WADA 4KIGA 1GUUA 4UXNA 2EINH 5FRMA 5CVIA 2P5VA 3S16J 4ENKA 2EFQA 2B63J 1K6OA 1LJ9A 2GIVA 4UB6C 4P96A 4L0ZB 2E19A 4L5IA 1VQPI 5E18F 2DFHA 4HNVA 2XPWA 5GAEJ 3RJPA 1K78A 1HDDC 5IYBJ 2IJLA 3VEPA 3J80Z 4L9JA 4PGGA 3L2UA 2XC7A 3A03A 4BUPA 2XF6A 1HQCA 3BT9A 2EIMH 3M07A 2JPCA 3QU6A 3PSFA 2NVQJ 2HOAA 4U0YA 1FP1D 3C1DA 1Z3XA 2ELHA 5DD8A 5C3EJ 1PUFA 1ENHA 2QSFX 3C18A 5HLGA 3C2BA 3WGGA 2QSHX 1D5VA 2P4WA 1P4AA 3MQ0A 4G6QA 4CCJA 4N4NB 3RKWA 5M3FJ 1ZLKA 1A04A 2BEOA 5FLXK 1WRJA 2EA4A 4JQFA 2MABA 3QODA 3RCOA 3K1PA 3D0SA 3C2GA 5FFXA 1JUSA 2M34A 4II3A 2LR8A 3HOSA 1VF9A 2HFHA 1IRFA 1FOWA 2CV2A 2P81A 2JUGA 1XX5A 2K3PA 3CLOA 2XKOA 2CFOA 4PFPA 3HKZN 4W1UA 4ZC3A 4B1RA 4Z2YA 3J7ZI 3PM1A 1QBJA 1I27A 4FETA 3BTCA 1ZR4A 3KPHA 3HHGA 5TISC 2XHKA 2HYGD 2FOKA 2O6GE 3OYCA 2WAFA 1YIOA 2EFNA 1R5GA 2KIQA 1Q1HA 4KISA 1LE8B 1V5EA 2E1OA 1QPMA 2O61A 5D5UB 1D1AA 1XGMA 4YEJA 4FX4A 1YI2I 3GTKJ 4BHBA 3J81K 1XSDA 2NVTJ 5BPDA 2BY1A 5FROA 2NNNA 2HNHA 3WTWC 2CUZA 3S17J 2O7OA 3DKYA 3L2WA 2E2IJ 4RA2A 1TW3A 5EEHA 1XC5A 2WY7Q 4GDFA 3CMMA 3GMEA 3NEUA 2LG4A 3H9QA 1WI9A 3CCJI 3OYBA 5GPAA 1SVMA 1BW5A 5M5YJ 2W4SA 2FUG2 2ZSIB 3EYIA 3DBLB 1CQTA 2ACJA 3BPXA 2DT5A 1ETQA 3G1OA 3WU2C 1JKRC 2N8GA 4MFEA 2R4GA 5JI6A 4WWCA 3QYBA 3AFHA 1W36D 4RM2A 2JWTA 2DYSH 2GOMA 2W85A 2CQKA 2X85A 2O3FA 5BMZA 2OC6A 4C3HJ 2R92J 1FBUA 1ZKGA 4D5CA 3HOUJ 1Z7LA 3FWEA 4FX0A 5B1BH 4BBSJ 1O7LA 2VQCA 1E0EA 2VXZA 5HNFA 2OAZA 5CQEA 2WWYA 2F4IA 4D9JA 1WJCA 2HXOA 3IH4A 2DN0A 4BYYA 1RZ4A 1IJWC 1K61A 2KHMA 1NH3A 5J1RA 4CZCA 2EZHA 3O3KA 5E8IA 1XPXA 2QWWA 5JVTA 3LSIA 3F8NA 2D45A 3KYCB 5B66C 5F0FA 2H8RA 4L0YB 4M3GA 3HSRA 5DM7F 1K7AA 1PUEE 1WHUA 3RPQA 3KLNA 2O8XA 4C9YA 3CUQC 4D5FA 3BZ6A 1STZA 2A05A 3DQVC 3WGHA 5E8GA 5IT9Z 1IG7A 4FE4A 3MKLA 4R79A 2CW0F 3NWTA 4BL0B 1F43A 5J4VA 1I5ZA 2PMZN 1AOYA 2RDPA 2Y0SA 2FOWA 4G9YA 2QQAA 1F36A 3KEQA 1IRGA 2KDOA 2BY0A 1EJ9A 2JUCA 1FNNA 4KDPA 1Z6RA 2K9SA 2CW8A 1K83J 2DTZA 2KIUA 1KU7A 2FF4A 3Q5FA 4WX9A 3VYTB 3OY9A 1ITYA 1IXRC 3RKQA 2XGEA 3OYMA 4YRVA 1OKRA 1X1BA 5D4RA 2EZIA 4HRIA 1RUOA 1OFCX 1LFBA 2DI3A 2OD5A 4GXOA 3V7RA 3O8HA 2DODA 3S2WA 3L2RA 3FXOA 2F5FA 2J5OA 5HS7A 4IRIA 3ZQIA 2HQ5A 4N9IA 3HOYJ 1JHHA 5BNGA 1IUYA 3WHBA 1VI0A 3VDXA 5IY5H 2EH3A 4HF1A 2X9DA 3CMEI 2HZTA 2WAEA 2EV6A 4A3LJ 2PQ8A 1B8IA 4E70A 2R7ZJ 1QU3A 3DKXA 1IRZA 2I10A 1UJ8A 2DA1A 5HS9A 1UHMA 1Z9CA 3SZTA 2IXSA 3P9IA 3K4KA 1JGGA 5LD2C 2VB6A 2YR2A 3JW4A 5CLSA 2DOAA 3T8TA 3A01B 1W1WE 2LY1A 2ME0A 2WB1A 4XR6A 2BY2A 5IOYA 2CYYA 3TP0A 3DPTA 4BU2A 1T0FA 3OYNA 4BACA 1YJNI 3UNGC 4KJZA 4LOCA 5FB2A 2FQ4A 2DFEA 3BR5A 4J00A 1RESA 1H8AC 1YIJI 3KP7A 2KPMA 2WY8Q 3CLQA 1VQKI 2V1DA 1N75A 4AIKA 2H8WA 5LGNA 1DPUA 2MC4A 5LLQA 4RBOA 3ESWB 4CGZA 1WH5A 3FXUA 4I76A 2K4BA 3QOEA 3RPUA 2IGOA 3S14J 1KONA 3I9V2 3S8PA 1OR7A 2PBIA 2DU9A 2R7WA 2PMZA 1S29A 1TQPA 4GGGA 2EFWA 1XMAA 1BC7C 2XASA 4P55A 3S2DJ 3ZOBA 3K10A 3WE2A 5KHDA 2E71A 5B5EC 3OOUA 3CD6I 4WK8F 2FBKA 3BDDA 1O57A 2K9LA 1FZPB 3QU3A 2RQPA 1X58A 1OISA 3TP3A 1RNLA 5L3GA 3UR3C 1Q1VA 3MZYA 2A68F 1J7KA 3EDPA 2NRAC 4A0XA 2JRMA 1IDZA 1SANA 4M3EA 3BROA 1HBXG 2ZXWH 4BEHB 1JKOC 1O3SA 4C2UA 2GXBA 2NAZA 1W5CC 1D0XA 4IOAF 2B7EA 1XMKA 1RIOH 3LNQA 2DPDA 2EPFA 2IPQX 5J6XA 3DPLC 4A93J 2HVSA 2XAJA 2YU9J 3ERED 4XICA 4P9FA 5H2FC 2CV0A 5CQGA 1ZYRF 3MVPA 3SDBA 4DYCA 1T08B 2K9MA 2GOXB 2DDBA 3J7YJ 1X3WB 2LYCA 2KRFA 3MFKA 2L02A 3M8EA 2VJJA 1BOAA 3DKWA 3QP6A 3CMAI 1BA5A 4IXAA 3V4GA 2XPUA 4IHWA 3RKYA 4Q4ZF 3OS1A 2L5QA 1FMVA 4Y4RA 9ANTA 1W36C 3HTSB 3ZN0A 3GX4X 1I50J 2OCEA 2UV1A 1PDNC 1NG6A 2W1OA 3VFZA 3IAM2 3I0TA 4GYIA 4UY8I 1Z21A 1R6RA 3CJNA 4M6YA 2NS0A 2ID3A 4OOIA 3E6CC 1YG2A 1DPRA 1GVJA 4AIHA 2PMUA 1OYWA 4EM1A 2NS7A 4RAYA 1V55H 3HRTA 3KIOA 2BVLA 1MIJA 1IAWA 1SVOA 1SD6A 4F7ZA 4QWQA 3N05A 1Z77A 5HLIA 3NARA 3SFZA 3KX2A 4G94A 1O3TA 3LL7A 1W7PA 1Z1DA 5F1JA 1R4NB 3TO9A 1MJ9A 3BPVA 4HSTA 4XQFA 3FBNB 2L9RA 2DQLA 3L09A 3HRMA 3CZ6A 3ZXSA 1YRNA 2R5YA 5HODA 4ITVA 1XD7A 3IH2A 1OYYA 2VQGA 3ISPA 4L5EA 4Y7NJ 1R23A 3H3VK 1ETYA 1IO2A 4LG3A 1A5JA 2VASA 1E17A 2VE9A 1MMDA 4KMUX 2D2WA 2JTVA 3MEXA 3PSIA 1IXCA 4RM3A 4ENNA 1ZG1A 2LK2A 1IN5A 2QLZA 3HOZJ 4BDYA 3ZMZA 3RPUD 2VBZA 2BHYA 4Y15A 2HS5A 1T98A 4RGXA 4LB5A 4Y52J 2DTRA 1FYKA 1EA3A 2E60A 4RGUA 5HNHA 4M3DA 3GXOA 1HKQA 5C4XJ 1DGRM 2DMTA 3FHZA 2C6YA 2E5NA 2HDWA 3B73A 4CH7A 4PJJA 2VLAA 1REPC 1P7IA 2HPMA 4E6KG 2VN2A 4FISA 2X0LA 3WHCA 3DXJF 3I3LA 4DJAA 2IS2A 2ECCA 1IN6A 3AKZA 2UUZA 3CUQA 1B1BA 1BIAA 4O5VA 2O0YA 4NHJA 1A35A 3E5QA 2L0KA 2MYSA 3MN2A 3CDLA 4IHVA 2Y69H 3CF5F 3GYHX 3O8GA 3R0AA 3HM5A 2WV1A 5KAIC 4G12A 4NDLA 4GO1A 4CHUA 2M9HA 4PSXA 3LSPA 1KYZA 1TQMA 4BXXJ 4BKXA 5KCMA 1ZK8A 5F08A 4L18B 3HRUA 4E7KA 5F64A 4AC0A 1K78B 4B3XA 5HVQC 1FIAA 1DGWY 1MGTA 4D1QA 2FD5A 1RRJA 3S3MA 2IGKA 3CESA 2Q0OA 3A0BC 4U87A 5FKKA 4KITB 3TL4X 2MC3A 1VQ7I 4E7ZA 3HOXJ 3OS2A 2PEXA 2P5KA 2CUEA 1D1BA 1P9QC 1ODDA 2HQAA 1PUFB 1DUXC 3G6EI 1YLFA 3CCUI 3ECHA 4XK4A 1MJAA 1FBSA 2FRHA 4II2A 4XN0A 3KEYA 1R4MB 3LA3A 1RR7A 3OYHA 5ERIA 3AL0C 3TDZC 4LIVA 1WJAA 4HDVA 3CP2A 1YJWI 3TW7A 4BQAA 5HDKA 3JTGA 2LLKA 2V26A 1ZGAA 1TWCJ 2DA3A 2VI6A 4U0WA 1HA8A 3G4SI 2LH9A 1UMQA 1MNMC 2F4OB 2DYRH 3BJAA 4CXFA 2VJ4A 1MMNA 4XRMA 4LK1F 4A69C 1S7OA 3ABLH 3JAMZ 2BOLA 5DD4A 5ILSA 1OCCH 1W7PD 2KIFA 1SAXA 1FJLA 4Q5SF 1FSHA 3R6SA 1MBJA 2E1CA 3DLAA 2BE5F 2FBHA 5F6FA 2M8EA 2E5ZA 5GTIC 5L3EA 5J8CA 1DP3A 1LEAA 4V19K 4IJAA 3DU6A 1VQLI 1PYVA 3V8JA 5IOZA 2STWA 5F27A 3FXKA 1WGXA 2FU4A 3SDGA 3IKTA 2KZVA 3MWMA 1Y0UA 4XL9A 2R7OA 2L7ZA 3LA7A 2W24A 3NQOA 2EK5A 1JT6A 3LMMA 2LNBA 4NNJA 1MKMA 2GAUA 3OV8A 2F6CA 3K9TA 4JK1X 2DW4A 5HDGA 1Z3YA 3EUAA 5GADJ 2QCOA 1W5SA 2MH9A 1LVKA 5DS9A 2VQHA 2HEOA 1P4WA 2ZFWA 2A6TA 3QRFF 2Z2SB 1SFUA 3ZRGA 2L4MA 2FXAA 3OOPA 2RGVA 2VOOA 5AIPA 2XF5A 4OU0A 1J2XA 1KA8A 2DAOA 1LQ1A 2LRDA 4IOCF 4BS9A 1M1EB 2PFBA 2OA4A 3V7CA 4EJOA 1WH7A 3LAJA 2E2HJ 1V5FA 2LBFA 3AL0B 4XMYA 4IHYA 2R7RA 1V3FA 1QZEA 4MLOA 1JTYA 4HDUA 1FTZA 5FD5A 1BC8C 2LTPA 4X6AJ 2KRHA 2ZMEC 1GHCA 1FT9A 3SFIA 3E97A 5J1YA 4GYGA 3CJTB 1AA7A 3FIWA 3KZZA 1KQ9A 2L2OA 1R00A 2PJRA 1ZH5A 2M0MA 4JP0A 4YFXF 3SXYA 3BR0A 2QA4I 4NBQA 2IA1A 3RI4A 4S0HB 3QPTA 2RAEA 3Q0UA 1IF1A 3JTHA 2EILH 2QKMB 4IX7A 1FEXA 3W6KB 4PUSA 1WVRA 1YYVA 3EQLF 1MSEC 1P2FA 2V1NA 2FEZA 1RR8C 5H6RA 4D7MA 2YU3A 4EQQA 3BCAA 3KP5A 4IHXA 1ON1A 1WJFA 1Z0XA 3S1NJ 2KT0A 1IUFA 1X1CA 4GRIA 4DBRA 3LSRA 5JR3A 4HAMA 2GXGA 4YIIA 1MH3A 1BIBA 3GFLA 5JVGF 4YG2F 4BNCA 2TDXA 1FYMA 3M7GA 4YIRX 3FZVA 5JFRA 5HOOA 2LDUA 3FXLA 1U3EM 2ZJRF 2HPIA 1U5TC 2JZYA 2F5DA 3E1SA 2BHZA 3FM5A 2A3SA 1WPKA 3S2HJ 5CVVA 1R1TA 1F4KA 4IVNA 4MTEA 2UXNA 2K7LA 4C30A 3R61A 1H9GA 2YUSA 1BR4A 3AAFA 2YX4A 3ASNH 2FA5A 2XDVA 2VC0A 3EETA 4OWRB 2GXAA 3F8BA 4RAZA 2XAHA 3BR3A 2V1XA 2XGXA 1YW9A 4JX6A 1Y39A 5EEGA 1V54H 3IH3A 3PIPF 1G3TA 3W6VA 1LDJA 4HSRA 1YX5A 3FMQA 5D6EA 4HLYA 1B8IB 2V6CA 4AVZA 1ZHFA 1BI2A 3PL8A 1H0MA 2W82A 1AKHA 4A3BJ 2BY3A 3CDHA 4Y3OA 1BJZA 1L0OC 2DK5A 2Z5UA 1D0ZA 1EF4A 2JQ7A 1WCMJ 3PFIA 4J01A 1K6YA 3K4CA 2E1MB 3OYDA 2V79A 2DQRA 2IW5A 3DV8A 3WTXC 2EV5A 1T56A 2FBIA 2CO5A 2DOFA 5EJCA 4PJNA 3GTGJ 4PSWA 2O9LA 3ULQB 2NVYJ 1VQ4I 4ZTJA 3GF2A 4RGSA 2KMUA 2DJIA 3TGNA 4LG0A 3HEFA 1ETVA 3A4CA 2DA4A 5J1UA 3DEEA 1AHDP 1R5HA 5LBQA 2M87A 5M5WJ 4EJTA 3TO7A 2BV6A 3BLYA 3BJ6A 3OR1C 1ZQ3P 2GZWA 3LSTA 1FOXA 5J40A 3V42A 3F8FA 3T8RA 4FHTA 1J5YA 3Q0WA 1YITI 1DQUA 1VQOI 2Z9OA 4XOPA 4MFDA 1ETXA 2HKXA 2OF7A 2JJ7A 4XBFA 2ZJPF 3K70C 2HDDA 4CYCA 4ABZA 3K0LA 2MSYA 5TJJA 4RS8A 1B9MA 2ZXIA 2K4JA 3HRSA 4KN4X 5E79C 3VYSB 2FQ3A 5LHIA 2XUBA 4DYQA 4WF2A 1Z91A 2HDCA 4XONA 5E20A 5L3FA 1MSFC 4BJ5C 5E1WA 1LDDA 1G4DA 2ZKZA 2R7VA 4XRSA 4A3EJ 1IN8A 1BL0A 3E6DA 2A5WA 3VYRB 2CFXA 1SFOJ 4IQJA 3HGGA 2OTJI 1K4SA 5AIQA 3ML6A 2K9NA 1J0RA 4ZZDA 1ZRFA 2K9QA 2P6TA 3BWGA 5JHFA 5K5OA 2CMPA 4A5MA 4BQOA 3OYFA 2DBBA 3V8LA 3N4MA 4G6DA 2R7XA 1JTXA 2X48A 1ZR2A 4XKCA 2QSGX 2A07F 4LGWA 4ZDLA 5E17F 2BYVE 4DZPA 2L7KA 3F72A 2ISZA 3JRFA 1N78A 2Q1ZB 2QGUA 2CJJA 4ZZLA 2XROA 3RZDJ 2F5VA 3DWLE 3S3OA 2LMDA 2TCTA 1S7AA 2Q2EA 2ZJ2A 1HKSA 3B6AA 4AIDA 3ELKA 2XAGA 2X1EA 3ZGKA 1SMYF 4A3IJ 2X6XA 2NOJB 2IRFG 3H5NA 2R7SA 5FKNA 3H3ZA 1JE8A 1O7FA 2QM3A 3IP4B 4ZYEA 1IRXA
chains in the Genus database with same CATH topology
3FISA 3OSFA 3LNQA 1BW6A 2Y2ZA 2NOGA 5IPAA 1IV6A 4A93J 3SJMA 5M5XJ 5E3MA 2YU9J 2CU7A 4XICA 1OJLA 3S1RJ 3F0CA 3MVPA 3S1QJ 4DYCA 1W0UA 2MW8A 3S1MJ 4DW6A 3BQYA 4I6ZA 1BA5A 1GV2A 5K7FA 2XPUA 4IHWA 9ANTA 2TRTA 1H88C 1HLVA 2R0QC 1I50J 2G0EA 3BR2A 2Y9ZA 2EBIA 2IEKA 5F04A 3CQZJ 3H0GJ 4FE7A 4GFBA 2XGCA 2Y30A 1YRNB 3LOCA 2ID3A 4A3CJ 2R5YB 1RETA 4B3AA 3JRBA 1HF0A 3FK7A 5E3OA 2JA6J 2NS7A 1B72B 1NTCA 2GLOA 3UKGA 3ZQHA 2XSDC 5GPCA 1T33A 1NK2P 1Y1WJ 4MIMA 1Z77A 4EEFG 1ETOA 3NARA 1I6HJ 5JLXA 3Q0VA 4MO7A 2IAIA 3GTJJ 1JKPC 3L1PA 5F1JA 1JUMA 2M8GX 3CCYA 1JJ6C 5FJ8J 3K7AJ 2L9RA 2HYJA 4V2FA 4UUTA 4DYRA 1YRNA 3BQZA 2CRGA 5HODA 2R5YA 2QF7A 3IH2A 4L5EA 5FLMJ 4Y7NJ 2Y0SN 3H3VK 3JR9A 1ETYA 2GM4A 4A3DJ 1B72A 3A02A 1A5JA 4J19A 2E2JJ 5E3LA 3G1MA 5IYCJ 2XGDA 2LK2A 3HOZJ 1X2MA 1U9OA 1TWGJ 3LSJA 1TC3C 1W0TA 1AU7A 4Y52J 1JUPA 4M3DA 5C4XJ 5GP9A 3IV5A 2DMTA 3S15J 5EYRA 1FTTA 4JX4A 3LSGA 1P7IA 3QQAA 4FISA 1GVDA 1FIPA 1QRYA 2MG4A 3WHCA 3BG5A 5IP6A 5C44J 2ECCA 4RDUA 1E3OC 1XS9A 3HOVJ 2EZKA 3PO2J 2CQXA 3FK6A 1POGA 1LFUP 2JA7J 1U78A 1IC8A 3I4NJ 2LY9A 2L0KA 3MN2A 3BTLA 3QPSA 3CDLA 4IHVA 5EEAA 3BG3A 3Q3SA 4XIDA 4BY7J 3O8GA 3HM5A 2WV1A 4G12A 4NDLA 2EQRA 2M9HA 2ID6A 3LSPA 2JK3A 3PO3J 2FX0A 4BXXJ 4BKXA 1RPWA 1ZK8A 5F08A 2M2EA 1QVUA 3JRAA 2HI3A 4M3FA 2R5ZB 4AC0A 1FIAA 3M3YJ 5IYDJ 2FD5A 1I3QJ 4W97A 1H89C 2GBYA 5M3MJ 2WB1N 2KDZA 5FKKA 3CMYA 5IP7J 3ZQCA 2DJNA 3HOXJ 2L7MP 2HXIA 3TEDA 1VNDA 3GTQJ 2Y9YA 1GDTA 2CUEA 1TWHJ 1PUFB 1MBGA 1X2NA 1ORKA 4XK4A 5DTDA 3TW6A 1GUUA 1RR7A 3BR6A 3S16J 2L7FP 2B63J 1RKTA 3TW7A 3GTPJ 3RQIA 2R5ZA 3JREA 2E19A 2LLKA 2DMPA 2XPWA 2DA3A 1TWCJ 2VI6A 4HNVA 4AUXA 5IYBJ 1UMQA 2LFBA 1MNMC 1HDDC 1HOMA 2LKXA 5K7ZA 3HDDA 4FCYA 1U9NA 3A03A 1D5YA 3BT9A 4XRMA 3BG9A 5E3NA 2NVQJ 4A69C 2HOAA 1HCRA 2DA2A 1A6IA 5C3EJ 3VPRA 1PUFA 1FJLA 2HOTA 3B6CA 1IDYA 1ENHA 1ZTRA 1MBJA 3HB9A 4M3BA 3C2BA 4A3GJ 4IEJA 3FKIJ 4UUSB 2WAQN 5IOZA 1R9TJ 2CUFA 5F27A 1WGXA 4A3KJ 5M3FJ 2XB0X 3SDGA 1JT0A 1HDPA 1JUSA 2L7ZA 2M34A 4AYBN 2LR8A 1VF9A 1JT6A 5C4JJ 2P81A 1P7JA 4W1UA 3HKZN 4B1RA 2MGQA 1MBKA 3K2AA 3PM1A 2CQQA 3BTCA 1ZR4A 2QCOA 1IGNA 3I4MJ 5FLVA 2YS9A 3M4OJ 5DS9A 1QPIA 3DCFA 1U8BA 3HOWJ 1LE8B 1GV5A 2ZB9A 4UUSA 2E1OA 4C3IJ 1MBHA 2LP0A 1GT0C 3GTKJ 4B4CA 4BBRJ 2NVTJ 1OCTC 3NAUA 1WH7A 2E2HJ 4V2GA 3S17J 4X1EA 2O7OA 1JJ8C 5J3LA 4C3JJ 4IHYA 2E2IJ 4MLOA 1XC5A 1JTYA 1FTZA 5FKLA 2LTPA 4X6AJ 3SFIA 5GPAA 1BW5A 4JYKA 2VPRA 5J1YA 2M0CA 3FIWA 1WI3A 3JRIA 1CQTA 2COBA 4FTHA 1DU0A 1ETQA 3G1OA 3HBLA 1JKRC 2N8GA 4MFEA 4JP0A 2DA6A 1Y1VJ 3BR0A 1LE8A 2R93J 1ZGWA 2JWTA 4QTRA 4S0HB 2RAEA 3Q0UA 4C3HJ 4QSHA 4D5CA 1ZKGA 2R92J 3HOUJ 5F0CA 1NK3P 1FEXA 4BBSJ 2W48A 4A3MJ 1ETWA 1MSEC 2Y31A 2HXOA 3IH4A 2DN0A 4D7MA 1IJWC 2D5VA 1K61A 4IHXA 5J1RA 1Z0XA 3S1NJ 2EZHA 2DA5A 2KT0A 3JRDA 1XG1A 2DMUA 1IUFA 3RZOJ 1UG2A 3LSRA 5F0FA 1O4XA 1AKHB 2H8RA 2XRLA 4M3GA 2AO9A 1MH3A 2AHQA 4D5FA 3GTMJ 2X6OA 2ECBA 4D7NA 1IG7A 4FE4A 3MKLA 1F43A 2LVSA 2O8KA 2HOSA 2PMZN 1WPKA 3QPLA 3S2HJ 1OCPA 3BR1A 2YUSA 5JLWA 3BTJA 1F36A 1APLC 3G1LA 1G2HA 4DZJA 5FKMA 3BR3A 5M5YJ 4JX6A 2K9SA 5K7HA 5EF6A 3IH3A 1K83J 2DTZA 3W6VA 4C2MJ 1B8IB 1ITYA 3GTOJ 3RKQA 2XGEA 4BY1J 1AKHA 4A3BJ 3D1NI 1BJZA 1EF4A 2JMWA 1TWAJ 5EGOB 2EZIA 2H1KA 1WCMJ 1TWFJ 1OFCX 1LFBA 4CYCB 1T56A 3O8HA 5EG0B 3OSGA 2FJ1A 3GTGJ 3ZQIA 2O9LA 2DMNA 2HQ5A 2NVYJ 4QIWN 4M6VA 3HOYJ 5BNGA 3BTIA 4A3JJ 3OIOA 5FKOA 1DU6A 3WHBA 3HEFA 1VI0A 1ETVA 3HGYA 2DA4A 5J1UA 1AHDP 2EH3A 2X9DA 1MBEA 5M5WJ 1MH4A 1ZQ3P 4A3LJ 1B8IA 2R7ZJ 1UHSA 5F0HA 2NVXJ 3Q0WA 1IRZA 2I10A 2XPVA 2DA1A 2VUMJ 4MFDA 1ETXA 2OF7A 5EGOA 2JJ7A 2HDDA 4A3FJ 1JGGA 4CYCA 4ABZA 2MSYA 2DA7A 3E7LA 3A01B 2EZLA 4JX5A 5EG0A 2ELKA 2ME0A 2JN6A 5IOYA 4DYQA 3TP0A 3ZQGA 3ZQLA 4LOCA 2FQ4A 1MBFA 1S7EA 3BR5A 1RESA 1H8AC 1MSFC 2K40A 3JRCA 1QVTA 4XRSA 4A3EJ 1BL0A 4RBOA 2LD5A 1WH5A 4I76A 1SFOJ 2XB5A 3HGGA 4XRSG 5EZHA 3S14J 2K9NA 2K9QA 2DMQA 1VFCA 2ME6A 3DEWA 3JRHA 3S2DJ 3ZOBA 3A01A 1JTXA 2X48A 1ETKA 1RKWA 5EZGA 1ZR2A 3OOUA 4DZPA 5EDNA 3JRFA 2JA8J 3GTLJ 1JKQC 2CJJA 3GBGA 3RZDJ 2VKEA 2OPTA 1X58A 3ZQFA 2JA5J 3TP3A 2NS8A 2TCTA 1Q1VA 3B6AA 2VKVA 1IDZA 1SANA 4M3EA 4A3IJ 1JKOC 5FKNA 5IP9J 2IBDA 3JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIS A;  3OSF A;  3LNQ A;  1BW6 A;  2Y2Z A;  2NOG A;  5IPA A;  1IV6 A;  4A93 J;  3SJM A;  5M5X J;  5E3M A;  2YU9 J;  2CU7 A;  4XIC A;  1OJL A;  3S1R J;  3F0C A;  3MVP A;  3S1Q J;  4DYC A;  1W0U A;  2MW8 A;  3S1M J;  4DW6 A;  3BQY A;  4I6Z A;  1BA5 A;  1GV2 A;  5K7F A;  2XPU A;  4IHW A;  9ANT A;  2TRT A;  1H88 C;  1HLV A;  2R0Q C;  1I50 J;  2G0E A;  3BR2 A;  2Y9Z A;  2EBI A;  2IEK A;  5F04 A;  3CQZ J;  3H0G J;  4FE7 A;  4GFB A;  2XGC A;  2Y30 A;  1YRN B;  3LOC A;  2ID3 A;  4A3C J;  2R5Y B;  1RET A;  4B3A A;  3JRB A;  1HF0 A;  3FK7 A;  5E3O A;  2JA6 J;  2NS7 A;  1B72 B;  1NTC A;  2GLO A;  3UKG A;  3ZQH A;  2XSD C;  5GPC A;  1T33 A;  1NK2 P;  1Y1W J;  4MIM A;  1Z77 A;  4EEF G;  1ETO A;  3NAR A;  1I6H J;  5JLX A;  3Q0V A;  4MO7 A;  2IAI A;  3GTJ J;  1JKP C;  3L1P A;  5F1J A;  1JUM A;  2M8G X;  3CCY A;  1JJ6 C;  5FJ8 J;  3K7A J;  2L9R A;  2HYJ A;  4V2F A;  4UUT A;  4DYR A;  1YRN A;  3BQZ A;  2CRG A;  5HOD A;  2R5Y A;  2QF7 A;  3IH2 A;  4L5E A;  5FLM J;  4Y7N J;  2Y0S N;  3H3V K;  3JR9 A;  1ETY A;  2GM4 A;  4A3D J;  1B72 A;  3A02 A;  1A5J A;  4J19 A;  2E2J J;  5E3L A;  3G1M A;  5IYC J;  2XGD A;  2LK2 A;  3HOZ J;  1X2M A;  1U9O A;  1TWG J;  3LSJ A;  1TC3 C;  1W0T A;  1AU7 A;  4Y52 J;  1JUP A;  4M3D A;  5C4X J;  5GP9 A;  3IV5 A;  2DMT A;  3S15 J;  5EYR A;  1FTT A;  4JX4 A;  3LSG A;  1P7I A;  3QQA A;  4FIS A;  1GVD A;  1FIP A;  1QRY A;  2MG4 A;  3WHC A;  3BG5 A;  5IP6 A;  5C44 J;  2ECC A;  4RDU A;  1E3O C;  1XS9 A;  3HOV J;  2EZK A;  3PO2 J;  2CQX A;  3FK6 A;  1POG A;  1LFU P;  2JA7 J;  1U78 A;  1IC8 A;  3I4N J;  2LY9 A;  2L0K A;  3MN2 A;  3BTL A;  3QPS A;  3CDL A;  4IHV A;  5EEA A;  3BG3 A;  3Q3S A;  4XID A;  4BY7 J;  3O8G A;  3HM5 A;  2WV1 A;  4G12 A;  4NDL A;  2EQR A;  2M9H A;  2ID6 A;  3LSP A;  2JK3 A;  3PO3 J;  2FX0 A;  4BXX J;  4BKX A;  1RPW A;  1ZK8 A;  5F08 A;  2M2E A;  1QVU A;  3JRA A;  2HI3 A;  4M3F A;  2R5Z B;  4AC0 A;  1FIA A;  3M3Y J;  5IYD J;  2FD5 A;  1I3Q J;  4W97 A;  1H89 C;  2GBY A;  5M3M J;  2WB1 N;  2KDZ A;  5FKK A;  3CMY A;  5IP7 J;  3ZQC A;  2DJN A;  3HOX J;  2L7M P;  2HXI A;  3TED A;  1VND A;  3GTQ J;  2Y9Y A;  1GDT A;  2CUE A;  1TWH J;  1PUF B;  1MBG A;  1X2N A;  1ORK A;  4XK4 A;  5DTD A;  3TW6 A;  1GUU A;  1RR7 A;  3BR6 A;  3S16 J;  2L7F P;  2B63 J;  1RKT A;  3TW7 A;  3GTP J;  3RQI A;  2R5Z A;  3JRE A;  2E19 A;  2LLK A;  2DMP A;  2XPW A;  2DA3 A;  1TWC J;  2VI6 A;  4HNV A;  4AUX A;  5IYB J;  1UMQ A;  2LFB A;  1MNM C;  1HDD C;  1HOM A;  2LKX A;  5K7Z A;  3HDD A;  4FCY A;  1U9N A;  3A03 A;  1D5Y A;  3BT9 A;  4XRM A;  3BG9 A;  5E3N A;  2NVQ J;  4A69 C;  2HOA A;  1HCR A;  2DA2 A;  1A6I A;  5C3E J;  3VPR A;  1PUF A;  1FJL A;  2HOT A;  3B6C A;  1IDY A;  1ENH A;  1ZTR A;  1MBJ A;  3HB9 A;  4M3B A;  3C2B A;  4A3G J;  4IEJ A;  3FKI J;  4UUS B;  2WAQ N;  5IOZ A;  1R9T J;  2CUF A;  5F27 A;  1WGX A;  4A3K J;  5M3F J;  2XB0 X;  3SDG A;  1JT0 A;  1HDP A;  1JUS A;  2L7Z A;  2M34 A;  4AYB N;  2LR8 A;  1VF9 A;  1JT6 A;  5C4J J;  2P81 A;  1P7J A;  4W1U A;  3HKZ N;  4B1R A;  2MGQ A;  1MBK A;  3K2A A;  3PM1 A;  2CQQ A;  3BTC A;  1ZR4 A;  2QCO A;  1IGN A;  3I4M J;  5FLV A;  2YS9 A;  3M4O J;  5DS9 A;  1QPI A;  3DCF A;  1U8B A;  3HOW J;  1LE8 B;  1GV5 A;  2ZB9 A;  4UUS A;  2E1O A;  4C3I J;  1MBH A;  2LP0 A;  1GT0 C;  3GTK J;  4B4C A;  4BBR J;  2NVT J;  1OCT C;  3NAU A;  1WH7 A;  2E2H J;  4V2G A;  3S17 J;  4X1E A;  2O7O A;  1JJ8 C;  5J3L A;  4C3J J;  4IHY A;  2E2I J;  4MLO A;  1XC5 A;  1JTY A;  1FTZ A;  5FKL A;  2LTP A;  4X6A J;  3SFI A;  5GPA A;  1BW5 A;  4JYK A;  2VPR A;  5J1Y A;  2M0C A;  3FIW A;  1WI3 A;  3JRI A;  1CQT A;  2COB A;  4FTH A;  1DU0 A;  1ETQ A;  3G1O A;  3HBL A;  1JKR C;  2N8G A;  4MFE A;  4JP0 A;  2DA6 A;  1Y1V J;  3BR0 A;  1LE8 A;  2R93 J;  1ZGW A;  2JWT A;  4QTR A;  4S0H B;  2RAE A;  3Q0U A;  4C3H J;  4QSH A;  4D5C A;  1ZKG A;  2R92 J;  3HOU J;  5F0C A;  1NK3 P;  1FEX A;  4BBS J;  2W48 A;  4A3M J;  1ETW A;  1MSE C;  2Y31 A;  2HXO A;  3IH4 A;  2DN0 A;  4D7M A;  1IJW C;  2D5V A;  1K61 A;  4IHX A;  5J1R A;  1Z0X A;  3S1N J;  2EZH A;  2DA5 A;  2KT0 A;  3JRD A;  1XG1 A;  2DMU A;  1IUF A;  3RZO J;  1UG2 A;  3LSR A;  5F0F A;  1O4X A;  1AKH B;  2H8R A;  2XRL A;  4M3G A;  2AO9 A;  1MH3 A;  2AHQ A;  4D5F A;  3GTM J;  2X6O A;  2ECB A;  4D7N A;  1IG7 A;  4FE4 A;  3MKL A;  1F43 A;  2LVS A;  2O8K A;  2HOS A;  2PMZ N;  1WPK A;  3QPL A;  3S2H J;  1OCP A;  3BR1 A;  2YUS A;  5JLW A;  3BTJ A;  1F36 A;  1APL C;  3G1L A;  1G2H A;  4DZJ A;  5FKM A;  3BR3 A;  5M5Y J;  4JX6 A;  2K9S A;  5K7H A;  5EF6 A;  3IH3 A;  1K83 J;  2DTZ A;  3W6V A;  4C2M J;  1B8I B;  1ITY A;  3GTO J;  3RKQ A;  2XGE A;  4BY1 J;  1AKH A;  4A3B J;  3D1N I;  1BJZ A;  1EF4 A;  2JMW A;  1TWA J;  5EGO B;  2EZI A;  2H1K A;  1WCM J;  1TWF J;  1OFC X;  1LFB A;  4CYC B;  1T56 A;  3O8H A;  5EG0 B;  3OSG A;  2FJ1 A;  3GTG J;  3ZQI A;  2O9L A;  2DMN A;  2HQ5 A;  2NVY J;  4QIW N;  4M6V A;  3HOY J;  5BNG A;  3BTI A;  4A3J J;  3OIO A;  5FKO A;  1DU6 A;  3WHB A;  3HEF A;  1VI0 A;  1ETV A;  3HGY A;  2DA4 A;  5J1U A;  1AHD P;  2EH3 A;  2X9D A;  1MBE A;  5M5W J;  1MH4 A;  1ZQ3 P;  4A3L J;  1B8I A;  2R7Z J;  1UHS A;  5F0H A;  2NVX J;  3Q0W A;  1IRZ A;  2I10 A;  2XPV A;  2DA1 A;  2VUM J;  4MFD A;  1ETX A;  2OF7 A;  5EGO A;  2JJ7 A;  2HDD A;  4A3F J;  1JGG A;  4CYC A;  4ABZ A;  2MSY A;  2DA7 A;  3E7L A;  3A01 B;  2EZL A;  4JX5 A;  5EG0 A;  2ELK A;  2ME0 A;  2JN6 A;  5IOY A;  4DYQ A;  3TP0 A;  3ZQG A;  3ZQL A;  4LOC A;  2FQ4 A;  1MBF A;  1S7E A;  3BR5 A;  1RES A;  1H8A C;  1MSF C;  2K40 A;  3JRC A;  1QVT A;  4XRS A;  4A3E J;  1BL0 A;  4RBO A;  2LD5 A;  1WH5 A;  4I76 A;  1SFO J;  2XB5 A;  3HGG A;  4XRS G;  5EZH A;  3S14 J;  2K9N A;  2K9Q A;  2DMQ A;  1VFC A;  2ME6 A;  3DEW A;  3JRH A;  3S2D J;  3ZOB A;  3A01 A;  1JTX A;  2X48 A;  1ETK A;  1RKW A;  5EZG A;  1ZR2 A;  3OOU A;  4DZP A;  5EDN A;  3JRF A;  2JA8 J;  3GTL J;  1JKQ C;  2CJJ A;  3GBG A;  3RZD J;  2VKE A;  2OPT A;  1X58 A;  3ZQF A;  2JA5 J;  3TP3 A;  2NS8 A;  2TCT A;  1Q1V A;  3B6A A;  2VKV A;  1IDZ A;  1SAN A;  4M3E A;  4A3I J;  1JKO C;  5FKN A;  5IP9 J;  2IBD A;  3JRG A; 
#chains in the Genus database with same CATH topology
 1LNW A;  4PGH A;  3ZCO A;  2AS5 F;  5HDN A;  1BW6 A;  2Y2Z A;  3W2W A;  4QLC U;  2ZXH A;  1IV6 A;  2RNJ A;  2XKP A;  2IVM A;  1R1U A;  2KIS A;  4XLA A;  1T38 A;  1X3Z B;  2K3F A;  3S1Q J;  3J80 K;  1YTY A;  1SD7 A;  3DTK A;  4OAZ A;  2A61 A;  5E1Z B;  4WCG A;  3H5R A;  1WKM A;  3HKZ A;  1PVE A;  1Y0N A;  2MW8 A;  4DW6 A;  4I6Z A;  2DCE A;  1GV2 A;  1V4R A;  1FWZ A;  1LPQ A;  3N97 A;  3VWB A;  1UHW A;  1J75 A;  5J8F A;  2ZBK A;  4Z6Y A;  3H35 A;  2V9P A;  5LHG A;  1H88 C;  1OQY A;  1W7P B;  2HQN A;  1A36 A;  1WQ2 A;  5B1A H;  2JVG A;  4FE7 A;  1MDM A;  2STT A;  4GFB A;  4CCM A;  4B43 A;  1YRN B;  2VIX A;  2R5Y B;  2E1N A;  3JRB A;  4EJV A;  2Z3Y A;  4PK4 A;  1YFH A;  4HQE A;  1S9H A;  2E7W A;  3QPH A;  5FO5 A;  1B6A A;  3MKY B;  3UKG A;  1HW5 A;  2YX7 A;  3ZQH A;  5AON A;  3P5J A;  1T33 A;  3E6B A;  4UNO A;  1QGP A;  3OYI A;  2R7F A;  1EKE A;  4IL6 C;  2JSC A;  3Q0V A;  3R4K A;  2LF7 A;  2IAI A;  2X6Y A;  4MO7 A;  1ZAR A;  2K85 A;  5BQT A;  4DBQ A;  3JSP A;  2WBM A;  4IQ4 A;  1JUM A;  2ZME A;  4EGY A;  4LIU A;  4LIT A;  3R60 A;  2PMH A;  3S32 A;  3VOE A;  2D1H A;  2HYJ A;  4DYR A;  3IL2 A;  3WG7 H;  1Z05 A;  4P1W A;  3CC4 I;  1HW2 A;  2QF7 A;  2F2E A;  1OLT A;  4M6X A;  3QYE A;  2P7C B;  3CUQ B;  3IWZ A;  4BHP A;  1BI0 A;  1XDS A;  2GM4 A;  2LRE A;  2FML A;  2E7X A;  1RI7 A;  1YHQ I;  5D4S A;  4YFK F;  3F3X A;  2HU9 A;  3I58 A;  4PDK A;  4KIF A;  3AG1 H;  5E3L A;  5ICC A;  5IYC J;  2XGD A;  4CZZ A;  3A0H C;  1UFM A;  3L2V A;  4YIF A;  1U9O A;  1TC3 C;  1W0T A;  3FXJ A;  4E7L A;  4UUV A;  1AU7 A;  2ETH A;  5CVU A;  1JUP A;  1TW2 A;  2OQR A;  4RB1 A;  3OS0 A;  4Q48 A;  3IV5 A;  4JBA A;  2IS4 A;  2M7B A;  2ESN A;  4M73 A;  1QA6 A;  3C3W A;  5EYR A;  1FTT A;  1FP2 A;  2DK8 A;  4JX4 A;  3G71 I;  3CCE I;  2JPB A;  2BW3 B;  3BP8 A;  2LSO A;  1WJB A;  3FMS A;  1GVD A;  2HVQ A;  5IP6 A;  1XS9 A;  3PO2 J;  1KGS A;  2VC1 A;  4BQN A;  3FK6 A;  1POG A;  2V1U A;  1G3W A;  4NB5 A;  1LFU P;  5DUI A;  3P7N A;  1IC8 A;  1U5T A;  3QPS A;  3BTL A;  2ZNZ A;  4PCQ A;  4HX8 A;  5EEA A;  3BG3 A;  4XID A;  2PN6 A;  4BY7 J;  2VE8 A;  4B48 A;  2EQR A;  1SC7 A;  2ID6 A;  2JK3 A;  2FX0 A;  2L4A A;  3U21 A;  1KU3 A;  1BM9 A;  4XLP F;  4IHS A;  3O6B B;  3HC7 A;  3WG9 A;  4XRF A;  4L5J A;  2VT3 A;  1TNT A;  1UCR A;  1ZRE A;  5IT9 K;  2M5W A;  3LSH A;  5IYD J;  1I3Q J;  1SEU A;  3E0J B;  3H9J A;  3JSO A;  1TBX A;  1R22 A;  4CCN A;  3I53 A;  1LUJ B;  3KP3 A;  2ISY A;  4LB6 B;  3U9G A;  1E2X A;  2DJN A;  3D5S C;  1I1G A;  3TED A;  1CF7 A;  2Y9Y A;  1U2W A;  4BJT A;  1GDT A;  1EV7 A;  2HVR A;  1G3Y A;  2M4G A;  4NC7 A;  5KAF C;  4RB3 C;  1YX3 A;  2G9W A;  3WTV C;  2DO7 A;  2LKP A;  3PIO F;  2IGM A;  1B9N A;  3TW6 A;  2Z33 A;  3GFJ A;  5FD6 A;  2WC2 A;  3G3Z A;  4AVP A;  2L7F P;  3BC8 A;  2CUJ A;  4BAY A;  3FF5 A;  1B59 A;  2EFP A;  2H94 A;  2RC4 A;  1XDU A;  3GTP J;  2R5Z A;  4ESF A;  3JRE A;  4F91 B;  2M1B A;  2X1D A;  4KIC A;  4HW0 A;  2UXX A;  3GZ6 A;  4EAT A;  2LFB A;  3Q9S A;  2LKX A;  5K7Z A;  4RB0 A;  2XAU A;  1D5Y A;  1YJ9 I;  3BZC A;  2FMY A;  3RYR A;  4RB2 C;  3LA2 A;  2M3A A;  1SMT A;  2GIZ A;  3BG9 A;  5E3N A;  4O3M A;  2VPL A;  2IA0 A;  2OCC H;  3FXQ A;  2DA2 A;  2NNY A;  1N25 A;  3VPR A;  1YW8 A;  5LRS A;  2IGN A;  3B6C A;  2LKS A;  4BXU A;  3MKW B;  1ZTR A;  4A3G J;  1LDK B;  5GTH C;  2W7N A;  2WAQ N;  2R7D A;  3MZH A;  1R9T J;  3HOT A;  4KIB A;  3GEZ A;  2XB0 X;  4KFC A;  4DGW B;  2L54 A;  2LBF B;  2BXZ A;  1P4X A;  2KQR A;  4AYB N;  1B4A A;  3CCS I;  2V4J C;  2KJC A;  5D5W B;  3CDI A;  3R0J A;  4KA4 A;  4UVB A;  1Z6T A;  2MGQ A;  1XSV A;  3GUD A;  2P6S A;  4IRH A;  3MMY B;  5DCM B;  3I4M J;  5FLV A;  2YS9 A;  4LLN A;  1OCZ H;  5L3B A;  1LKX A;  2H09 A;  3BZK A;  3DCF A;  1XB4 A;  3HPG A;  4HX7 A;  3HOW J;  2F5C A;  1GV5 A;  2ZNY A;  2ZB9 A;  4UUS A;  3F6O A;  3REO A;  1S72 I;  4C3I J;  1MBH A;  1TT0 A;  1TTY A;  2A69 F;  3K4J A;  5KNL A;  2A6E F;  2CG4 A;  1T6S A;  2MD5 A;  3GO5 A;  3NAU A;  4V2G A;  2D1V A;  1JJ8 C;  5J3L A;  4C3J J;  4OMY A;  4U88 A;  4HNU A;  2DFF A;  4FAS D;  4B8X A;  1G59 A;  4BE2 A;  4AWX B;  2W57 A;  2VPR A;  4P9U A;  2DT6 A;  1X4P A;  3CP8 A;  1WI3 A;  3JRI A;  1R49 A;  2VBW A;  4I09 A;  4EM0 B;  2VON A;  1MMS A;  5K1Y A;  5B3S H;  1E3P A;  1G8X A;  5DM6 F;  1HXD A;  1SVL A;  2VKH A;  4IZZ A;  4AIJ A;  4D0P A;  1EH8 A;  4HV5 A;  4QTR A;  6PAX A;  2X4H A;  4QSH A;  5F0C A;  3HL2 A;  1NK3 P;  1X4O A;  3KE2 A;  2W48 A;  4A3M J;  1OCR H;  1ETW A;  1YE9 A;  3GZ5 A;  4MEX F;  2Y31 A;  2OV7 A;  1XCB A;  1PP8 F;  1R58 A;  3S3N A;  2CSO A;  4GCV A;  3EPZ A;  4RLQ A;  4ESB A;  4BH9 A;  3JRD A;  1XG1 A;  2DMU A;  4PZJ A;  3OR2 C;  1UG2 A;  3AG4 H;  3F21 A;  1O4X A;  4LFU A;  5D5V B;  3DLL F;  1AKH B;  3Q9V A;  2XRL A;  3FM3 A;  3WTS C;  3GTM J;  2X6O A;  3FMR A;  2ECB A;  1VQM I;  3CUO A;  3PUB A;  2H6C A;  4P5O A;  2LVS A;  2O8K A;  2HOS A;  4G7O F;  5A2Q Z;  3L2Q A;  3L00 A;  3K70 D;  3RSN A;  4I2O A;  1XN7 A;  1OCP A;  1D8K A;  1TT5 B;  2HYF A;  3BR1 A;  5JLW A;  4LG0 B;  4AM3 A;  1APL C;  3G1L A;  4OIQ F;  1T8I A;  3CJR B;  5FKM A;  1ZRD A;  5K7H A;  1QNT A;  1XGN A;  4C2M J;  3H36 A;  1XMX A;  3K6G A;  3PNV A;  1IZ1 A;  3D1N I;  4EJU A;  1VZ0 A;  5DYM A;  3DBH B;  4ZDP A;  2H1K A;  2MD0 A;  1TWF J;  3MCZ A;  1WZ2 A;  4CYC B;  2JT1 A;  2ELJ A;  2L01 A;  3DP7 A;  1YW7 A;  5CVJ A;  1T39 A;  2V6E A;  3OL4 A;  2GA1 A;  2DMN A;  2NVU B;  3M8J A;  3U1K A;  2NYX A;  3CC2 I;  4K2E A;  4M6V A;  4QPO A;  1IW7 F;  3BTI A;  4A3J J;  3OIO A;  5FKO A;  2L3D A;  4C2T A;  3TQN A;  1DU6 A;  3HZJ A;  4XSZ F;  2NXN B;  2GA2 A;  3HGY A;  4XNF A;  3IHU A;  3K2Z A;  3PQJ A;  1UAA A;  1Z7U A;  2O03 A;  2IA2 A;  3E5U A;  1MH4 A;  2L9V A;  1G3S A;  5L3C A;  1UHS A;  3LSK A;  3I56 I;  1QZY A;  2XPV A;  1PP7 U;  1E3H A;  4M9X A;  2VUM J;  4I98 B;  1MJB A;  2QBY A;  5EGO A;  4B44 A;  1GXQ A;  1OPC A;  4RMN A;  3SEZ A;  5FLX Z;  3BOQ A;  4A3F J;  3RQ4 A;  4ANJ A;  2E34 A;  2DA7 A;  4I0B A;  2HZD A;  2F4M B;  4MQ9 F;  5ILV A;  4JX5 A;  5EG0 A;  4R1H A;  1S6L A;  5LHH A;  4HOB A;  5K5R A;  3VOD A;  3HSE A;  4XLF A;  3ZQG A;  3ZQ7 A;  1TQI A;  5GAH J;  1MBF A;  1S7E A;  4ZJZ A;  2K40 A;  2CW7 A;  4QPQ A;  3FX3 A;  2XF7 A;  3HUG A;  3HPH A;  2Q8K A;  3JRC A;  2X6W A;  1X1D A;  2I8D A;  2DFI A;  2KJB A;  4YEL A;  4HQM A;  4E7S A;  2HR3 A;  3DPU A;  2Z16 A;  4HNT A;  4NUB A;  5EZH A;  3J81 Z;  3BG7 A;  2ZCW A;  1YQA A;  1KQ8 A;  1QZZ A;  1S8N A;  2E36 A;  1HC8 A;  3FHN A;  4UVC A;  4H4K C;  3JRH A;  4E7H A;  2LF8 A;  3EUH C;  1H9T A;  1I1S A;  3WE3 A;  1ETK A;  3MAJ A;  3GCM A;  1ERD A;  3CF2 A;  3L7W A;  3F6V A;  2JSP A;  5EDN A;  2HOE A;  1MMA A;  2OPT A;  2VKE A;  4UV8 A;  3ZQF A;  4Y33 A;  3I55 I;  2JA5 J;  1KU9 A;  1VQN I;  2B9S A;  4DOZ A;  4EGZ A;  1UST A;  3L2C A;  2L9N A;  1I6X A;  3DBR B;  2OU2 A;  1IV8 A;  2M30 A;  3KP6 A;  2P7V B;  5ICE A;  2IBD A;  4XKV A;  3CO7 C;  3GW2 A;  1FX7 A;  3JRG A;  2QEN A;  2JVH A;  3FIS A;  3K1M A;  3LFK A;  2ZXJ A;  3O2P E;  1FOY A;  2NOG A;  5IPA A;  2M7A A;  3SJM A;  2CU7 A;  5CKT A;  1OJL A;  3ABM H;  5ILU A;  3CCQ I;  3F0C A;  3ZP5 A;  2VKD A;  3W6J B;  1MND A;  3M1E A;  1A31 A;  3WTU C;  4G6T B;  3IAS 2;  4HYE A;  1IN4 A;  1W0U A;  3FXR A;  4ETS A;  2DT7 B;  1BBY A;  5K7F A;  2W00 A;  3JAM K;  3SZP A;  3HYI A;  1JHF A;  4ZYH A;  4XOT A;  4HEA 2;  4KMF A;  1SAU A;  2G0E A;  4CCK A;  3PQK A;  2EBI A;  2IEK A;  2ZME B;  4M9Z A;  3H5A A;  4M74 A;  3ZMD A;  3PFY A;  1UG0 A;  2QZ8 A;  3GZN B;  2XGC A;  2Y30 A;  4NQW A;  3LOC A;  4A3C J;  1RET A;  3AG2 H;  3I59 A;  1HST A;  1VQ5 I;  2ZC2 A;  2VJ5 A;  2HGC A;  1FYL A;  5ICG A;  2JA6 J;  1TLH B;  2KZG A;  1NTC A;  1VQ9 I;  3V8K A;  3HHH A;  2XV4 S;  3GVA A;  3CJQ B;  2XSD C;  1V5G A;  3OIQ A;  5GPC A;  5D6F A;  4ENJ A;  1NK2 P;  2EA2 A;  1Y56 A;  4MIM A;  3P9C A;  1P6R A;  3CCV I;  4EEF G;  3F23 A;  1ETO A;  4IKF A;  3I71 A;  5JLX A;  2XIG A;  3ZR8 X;  1KYW A;  2IS1 A;  3GTJ J;  3BG6 A;  4OIN F;  5DCF A;  2M8G X;  4AD9 A;  4BE1 A;  3CCY A;  1JJ6 C;  1XTA A;  4JOM A;  2V9V A;  1K4T A;  1LB2 A;  1F1Z A;  4IRG A;  5L3D A;  2WTE A;  4UUT A;  5CPR B;  4BXF A;  4NC8 A;  2R3S A;  3IUO A;  2ZSH B;  3BCB A;  3GFI A;  1WSU A;  2Y0S N;  4CUG A;  5LFA A;  4A3D J;  4I01 A;  1B72 A;  3A02 A;  4J19 A;  1O3R A;  5FGM A;  2VBX A;  2E2J J;  3K1N A;  2Z1D A;  4ESJ A;  3A1Y A;  1U5T B;  3G1M A;  1YO5 C;  3K4M A;  4LMY A;  3WU1 B;  2B0L A;  4NC6 A;  1KQ0 A;  2DLL A;  3M9A A;  2WV0 A;  1Z67 A;  5GP9 A;  1X1A A;  4HG2 A;  4S04 A;  1RC9 A;  3LSG A;  1G6N A;  4PJM A;  4A6E A;  4F3Q A;  2QQB A;  2CQ7 A;  2EIJ H;  3U2R A;  1BN5 A;  2PX9 A;  3IKV A;  4HBL A;  2CQX A;  1VQ6 I;  4HLX A;  2ZJQ F;  3ZPL A;  2FE3 A;  1CF7 B;  2JA7 J;  4M71 A;  4HA8 A;  5J47 A;  2OUM A;  3HTU A;  4U0V A;  2PJP A;  1WFX A;  5HS8 A;  3Q3S A;  4HX4 A;  4Y13 A;  3H3U A;  3TMO A;  1C0W A;  1NHA A;  4Y17 A;  1GXP A;  1QVU A;  3JRA A;  1QHH D;  4EVI A;  2VOD A;  2M45 A;  2W84 A;  2R5Z B;  5IT3 A;  4Q47 A;  3OYA A;  4KUM A;  3W3C A;  5D8L B;  3DF8 A;  3LFU A;  4W97 A;  3LQQ A;  4E7J A;  2GBY A;  2WB1 N;  2KDZ A;  1XCV A;  5IP7 J;  3ZQC A;  2UWM A;  4B47 A;  3F22 A;  1SFE A;  2RVC A;  1N77 A;  1A6Q A;  1MMG A;  3IWF A;  2DDA A;  3E3V A;  1VND A;  3GTQ J;  5ICF A;  3A2K A;  2K86 A;  1TZL A;  4ZH4 F;  1BR2 A;  1T2K A;  5LEK A;  1ORK A;  5KVR A;  5DTD A;  3IC7 A;  2K27 A;  3DEU A;  1BI1 A;  3LAP A;  4FQG A;  3BR6 A;  1RKT A;  2AQF A;  3ZMU A;  3I54 A;  5DEQ A;  3RQI A;  3B02 A;  4OAY A;  5J4Y A;  3OIP A;  3QWL A;  2DMP A;  3CCL I;  4OIP F;  1TP4 A;  2P8T A;  4AUX A;  1ACI A;  2QEX I;  1HOM A;  4XKW A;  1ULY A;  2HQR A;  3HDD A;  4FCY A;  1ON2 A;  1U9N A;  4CSW A;  3SZG A;  2YPR A;  2CGP A;  4LD5 A;  1JI8 A;  2LOO A;  3QAH A;  2OZU A;  3HSF A;  1HCR A;  1A6I A;  3H9G A;  1S5L C;  4ZYG A;  2HOT A;  1IDY A;  4XM3 A;  3DTI A;  1F9N A;  1IXS B;  3HB9 A;  4M3B A;  1MD0 A;  5CVR A;  4U7B A;  1WJD A;  4IEJ A;  3FKI J;  4N4O B;  3WOD F;  4UUS B;  3M1C A;  2H27 A;  2KIM A;  2CUF A;  3E6M A;  4A3K J;  2YSR A;  1ZEL A;  4EMS A;  2XAQ A;  4PJ0 C;  1JT0 A;  3J7A O;  2K5C A;  2EB7 A;  1HDP A;  3I5U A;  3G2B A;  3KLO A;  3WTY C;  3OYE A;  3C2H A;  2XSJ C;  3HG9 A;  3RYP A;  5C4J J;  5KK1 A;  1P7J A;  4IPA A;  1TNS A;  4WXD A;  5DV5 A;  3DTE A;  3CCM I;  1MBK A;  2ZO4 A;  2PI0 A;  3K2A A;  2DPU A;  3M8F A;  2CQQ A;  4F93 B;  3JCU C;  1IGN A;  3EUH A;  2A6H F;  3KCC A;  4XLE A;  3SYT A;  1FOK A;  3M4O J;  2AQE A;  4I99 C;  1QPI A;  1BR1 A;  3KP2 A;  1U8B A;  2QQ8 A;  4XKB A;  2CWE A;  1MW7 A;  2LP0 A;  2QQ9 A;  3TOA A;  1GT0 C;  2X51 A;  4B4C A;  4BBR J;  4X0G A;  2RV8 A;  2P5L C;  1OCT C;  1QHG A;  1YS7 A;  4ZDO A;  3KYD B;  3VSL A;  1GLN A;  5JHU A;  2MA3 A;  2W25 A;  4X1E A;  3VB2 A;  1UZC A;  1QO0 D;  2VBY A;  4ENM A;  1R5I D;  5FKL A;  5DDG A;  2GWR A;  2PLY A;  4IF4 A;  1NG7 A;  4BDZ A;  4JYK A;  1HSJ A;  2M0C A;  4LLG F;  1J9I A;  2COB A;  3HJE A;  4FTH A;  3LWF A;  1DU0 A;  5FFZ A;  3HBL A;  2KRC A;  5LRR A;  3GWZ A;  2H1L A;  2DA6 A;  1Y1V J;  3ECO A;  1LE8 A;  2R93 J;  1ZGW A;  2PG4 A;  2Y75 A;  4OIR F;  1OCO H;  4ZTF A;  2RNG A;  5BS6 A;  2EIK H;  4EM2 A;  2GQQ A;  4EV0 A;  3KZI C;  4G7Z F;  2FSW A;  3I4P A;  3EYY A;  4WXH A;  3ASO H;  4AU7 A;  2Y48 A;  2VL8 A;  3TOB A;  1BI3 A;  1SD4 A;  4CA0 A;  2D5V A;  1VQ8 I;  2DXI A;  3U1D A;  3ROU A;  1MNE A;  3ABK H;  2DA5 A;  1ZLJ A;  3OYG A;  4KT5 C;  1TL8 A;  1UEL B;  2LC2 A;  3RZO J;  4DQ2 A;  4HZF A;  2F5E A;  3DFG A;  3GLL A;  1SFX A;  2AO9 A;  2AHQ A;  2VOP A;  1JXS A;  4CDG A;  1JGS A;  3RIR A;  3H92 A;  2COM A;  3AG3 H;  1WJ5 A;  4D7N A;  5H20 A;  4DNC A;  3E5X A;  3QPL A;  4FT8 A;  1ZRC A;  3IRQ A;  1HKT A;  3GLX A;  3BTJ A;  2BXY A;  3BY6 A;  3VYU B;  3J7A Y;  4IHT A;  2RN7 A;  3K4N A;  1G2H A;  4DZJ A;  2R7T A;  3LSM A;  4PJL A;  2BBY A;  2G7H A;  4I7H A;  3RTR A;  2HWV A;  3SHF A;  2QVO A;  3OMY A;  4TV7 A;  4XSX F;  5EF6 A;  5TRD A;  3H0D A;  1U8R A;  3QP5 A;  4O6J A;  3GTO J;  4U7D A;  4BY1 J;  2H6B A;  4RAF A;  5F1R A;  2JMW A;  2FNP A;  1TWA J;  4RAG A;  5EGO B;  2QBY B;  1XGS A;  4PFO A;  2F48 A;  4XN3 A;  4UV9 A;  5EG0 B;  2EFO A;  3OSG A;  2FJ1 A;  4M72 A;  3X2Q H;  4E7I A;  1EH6 A;  1KU2 A;  2QYO A;  5BPI A;  4QIW N;  2OJE D;  3FKJ A;  2HTJ A;  4MGR A;  5LEJ A;  4MNU A;  2L9S A;  4XLH A;  5CYV A;  3IRR A;  2XVC A;  3ZMS A;  4BQQ A;  2A5Y B;  3HUG B;  3K69 A;  5H6Q A;  1MBE A;  2JRT A;  3PUF A;  2KKO A;  4F92 B;  3MZ8 A;  5F0H A;  2NVX J;  4UVA A;  4L9V A;  4BHC A;  2R7Q A;  4CO8 A;  3LQR A;  4IO9 F;  2PJR B;  1DP7 P;  3D5R C;  2R7U A;  3RKX A;  1BOB A;  1DDN A;  4A2U A;  3K4L A;  3F8M A;  5HLH A;  3E7L A;  2EZL A;  2FNA A;  2ELK A;  2JN6 A;  3KP4 A;  1SFK A;  1XGO A;  3WTZ A;  4I02 A;  3HXL A;  3ZQL A;  3FDY A;  4MTD A;  2MLK A;  4KN7 X;  1PJR A;  1RUN A;  2HTS A;  1QVT A;  3ABT A;  4MEY F;  2J5P A;  4DIQ A;  1QQI A;  2LD5 A;  5CJ9 A;  5TGT A;  2XB5 A;  2IS6 A;  1I39 A;  4XRS G;  3GFM A;  1X19 A;  1LVA A;  5ED4 A;  1HW1 A;  4UB8 C;  2IP2 A;  2DMQ A;  4BGD A;  1XSX A;  2KL4 A;  2ME6 A;  1VFC A;  3DEW A;  1F5T A;  3A01 A;  3TBI A;  1SD5 A;  1ZGJ A;  1RKW A;  5EZG A;  1D1C A;  3FXM A;  2X1C A;  4YFN F;  1WJE A;  2V7F A;  3D5L A;  3CCR I;  3TKY A;  3ZN1 A;  2JA8 J;  3GTL J;  1JKQ C;  3GBG A;  1ZN2 A;  2EJR A;  5LGT A;  3MKZ A;  3ABU A;  2NS8 A;  1FY7 A;  5HLT A;  2K02 A;  2AXT C;  2OTL I;  2VKV A;  3K4B A;  4EJW A;  2OZ6 A;  4HF0 A;  2WAQ A;  2ADU A;  2BGC A;  5IP9 J;  3G73 A;  4HPQ A;  4S05 A;  2ICW G;  3OSF A;  4NQW B;  1VTN C;  2ESH A;  1LEB A;  2BW3 A;  1D3Y A;  3I59 B;  5GAG J;  4HF2 A;  2O5R A;  4AYB A;  5M5X J;  5E3M A;  3S1R J;  2HKO A;  2M4K A;  3ZQQ A;  2RKH A;  4WXC A;  1IN7 A;  3VSK A;  1YS6 A;  4MQV A;  2RRE A;  4F52 A;  1FPQ A;  4L9T A;  2AXL A;  3S1M J;  3BQY A;  3PNT A;  2QKL B;  2BZT A;  3ERM A;  3EUK L;  3COA C;  3WU0 A;  1X1P A;  3OYK A;  4OIO F;  2Y0M A;  1AWC A;  2CQN A;  2TRT A;  4A0Z A;  1HLV A;  4A12 A;  2R0Q C;  3NWS A;  4N0B A;  3BR2 A;  4HV6 A;  4BEH A;  1ONV A;  1J59 A;  2Y9Z A;  3T0Y A;  4F55 A;  1R36 A;  3L9F A;  5F04 A;  2IT0 A;  3CQZ J;  3H0G J;  3CO6 C;  5BOX A;  1LFP A;  4XOR A;  1UB9 A;  4B3A A;  2XRN A;  2VXD A;  3OYJ A;  1HF0 A;  3FK7 A;  1ZG5 A;  2VQL A;  3S93 A;  3OWT A;  5E3O A;  2UZK A;  4KYW A;  3OL3 A;  4BJ6 C;  1S3J A;  1B72 B;  3CC7 I;  1D8J A;  3DU5 A;  3MD2 A;  2GLO A;  3WTT C;  2OBP A;  4A6D A;  2DOE A;  3HIF A;  3WGI A;  3F9K A;  2QUF A;  3SQN A;  3CTA A;  4KNY A;  2BVM A;  1Y1W J;  2CS3 A;  3FBI B;  5DUK A;  1I6H J;  5FRN A;  4N9H A;  2OQG A;  2XAF A;  4L9N A;  3T5X A;  2V9K A;  1JKP C;  1EH7 A;  3NRV A;  3L1P A;  4BE0 A;  3BJO A;  2KP6 A;  3KZY A;  4E4H A;  2VJI A;  1Y8Q B;  5FJ8 J;  2EWN A;  3ZMT A;  3K7A J;  4V2F A;  2KFD A;  3PNY A;  1ZAO A;  2CRG A;  3BQZ A;  4M9S A;  1OMI A;  4ASN A;  1T95 A;  1FMW A;  5FLM J;  2I5U A;  3C7J A;  3W2V A;  3JR9 A;  1Y8R B;  4LJZ F;  3I64 A;  5E1X A;  5D8K B;  4H0E A;  3TDU C;  1USS A;  3TO6 A;  2P0W A;  2WA0 A;  1K79 A;  1X2M A;  3P9K A;  5D5X B;  3PJR A;  1TWG J;  2Q2E B;  3LSJ A;  3QYF A;  4RGR A;  2LY2 A;  4CIC A;  3KET A;  2MLG A;  4ON0 A;  2MBF A;  4LK0 F;  4UHT A;  4LLL A;  3S15 J;  1D0Y A;  2MH2 A;  2VT2 A;  1W4M A;  3QQA A;  1FIP A;  1ZG3 A;  1QRY A;  2KLO A;  4CCO A;  2MG4 A;  5C44 J;  3BG5 A;  1OYI A;  4KT6 A;  4RDU A;  1E3O C;  1P92 A;  3HOV J;  2EZK A;  1O3Q A;  1BJA A;  2RQQ A;  4CYD A;  3SEQ A;  1R1V A;  4RLF A;  3ONQ A;  2Z99 A;  2MFZ A;  1U78 A;  1CGP A;  3I4N J;  2LY9 A;  1R7J A;  5DCM A;  2E35 A;  1W5T A;  2E1M C;  3KEO A;  1L3L A;  2ZFU A;  2CH0 A;  4G8X A;  1J09 A;  2EV0 A;  2G7U A;  3QOP A;  4ZYA A;  3PO3 J;  3V7S A;  1FBQ A;  1RPW A;  1FC3 A;  1U6G A;  5LGU A;  4XLC A;  2M2E A;  1Y6I A;  1KZH A;  4A0Y A;  1T0F C;  4CCL A;  2HI3 A;  4M3F A;  3RDI A;  2CV1 A;  5K5Q A;  1MDM B;  4A5N A;  4I0A A;  3M3Y J;  3KFW X;  4R8H A;  1H89 C;  5A2Q K;  1WWX A;  3H1C A;  1MZB A;  4OMZ A;  5M3M J;  1I3A A;  3CMY A;  1FSE A;  3OYL A;  1U0J A;  4ZYD A;  3F8C A;  3T1B A;  2JA2 A;  4G7H F;  1FLI A;  2L7M P;  2HXI A;  4MHG A;  1OR7 C;  3W2A A;  4XLN F;  1TWH J;  3KYL A;  1MBG A;  1R71 A;  1X3U A;  1X2N A;  4B09 A;  3ZMV A;  1YOV B;  2WAD A;  4KIG A;  1GUU A;  4UXN A;  2EIN H;  5FRM A;  5CVI A;  2P5V A;  3S16 J;  4ENK A;  2EFQ A;  2B63 J;  1K6O A;  1LJ9 A;  2GIV A;  4UB6 C;  4P96 A;  4L0Z B;  2E19 A;  4L5I A;  1VQP I;  5E18 F;  2DFH A;  4HNV A;  2XPW A;  5GAE J;  3RJP A;  1K78 A;  1HDD C;  5IYB J;  2IJL A;  3VEP A;  3J80 Z;  4L9J A;  4PGG A;  3L2U A;  2XC7 A;  3A03 A;  4BUP A;  2XF6 A;  1HQC A;  3BT9 A;  2EIM H;  3M07 A;  2JPC A;  3QU6 A;  3PSF A;  2NVQ J;  2HOA A;  4U0Y A;  1FP1 D;  3C1D A;  1Z3X A;  2ELH A;  5DD8 A;  5C3E J;  1PUF A;  1ENH A;  2QSF X;  3C18 A;  5HLG A;  3C2B A;  3WGG A;  2QSH X;  1D5V A;  2P4W A;  1P4A A;  3MQ0 A;  4G6Q A;  4CCJ A;  4N4N B;  3RKW A;  5M3F J;  1ZLK A;  1A04 A;  2BEO A;  5FLX K;  1WRJ A;  2EA4 A;  4JQF A;  2MAB A;  3QOD A;  3RCO A;  3K1P A;  3D0S A;  3C2G A;  5FFX A;  1JUS A;  2M34 A;  4II3 A;  2LR8 A;  3HOS A;  1VF9 A;  2HFH A;  1IRF A;  1FOW A;  2CV2 A;  2P81 A;  2JUG A;  1XX5 A;  2K3P A;  3CLO A;  2XKO A;  2CFO A;  4PFP A;  3HKZ N;  4W1U A;  4ZC3 A;  4B1R A;  4Z2Y A;  3J7Z I;  3PM1 A;  1QBJ A;  1I27 A;  4FET A;  3BTC A;  1ZR4 A;  3KPH A;  3HHG A;  5TIS C;  2XHK A;  2HYG D;  2FOK A;  2O6G E;  3OYC A;  2WAF A;  1YIO A;  2EFN A;  1R5G A;  2KIQ A;  1Q1H A;  4KIS A;  1LE8 B;  1V5E A;  2E1O A;  1QPM A;  2O61 A;  5D5U B;  1D1A A;  1XGM A;  4YEJ A;  4FX4 A;  1YI2 I;  3GTK J;  4BHB A;  3J81 K;  1XSD A;  2NVT J;  5BPD A;  2BY1 A;  5FRO A;  2NNN A;  2HNH A;  3WTW C;  2CUZ A;  3S17 J;  2O7O A;  3DKY A;  3L2W A;  2E2I J;  4RA2 A;  1TW3 A;  5EEH A;  1XC5 A;  2WY7 Q;  4GDF A;  3CMM A;  3GME A;  3NEU A;  2LG4 A;  3H9Q A;  1WI9 A;  3CCJ I;  3OYB A;  5GPA A;  1SVM A;  1BW5 A;  5M5Y J;  2W4S A;  2FUG 2;  2ZSI B;  3EYI A;  3DBL B;  1CQT A;  2ACJ A;  3BPX A;  2DT5 A;  1ETQ A;  3G1O A;  3WU2 C;  1JKR C;  2N8G A;  4MFE A;  2R4G A;  5JI6 A;  4WWC A;  3QYB A;  3AFH A;  1W36 D;  4RM2 A;  2JWT A;  2DYS H;  2GOM A;  2W85 A;  2CQK A;  2X85 A;  2O3F A;  5BMZ A;  2OC6 A;  4C3H J;  2R92 J;  1FBU A;  1ZKG A;  4D5C A;  3HOU J;  1Z7L A;  3FWE A;  4FX0 A;  5B1B H;  4BBS J;  1O7L A;  2VQC A;  1E0E A;  2VXZ A;  5HNF A;  2OAZ A;  5CQE A;  2WWY A;  2F4I A;  4D9J A;  1WJC A;  2HXO A;  3IH4 A;  2DN0 A;  4BYY A;  1RZ4 A;  1IJW C;  1K61 A;  2KHM A;  1NH3 A;  5J1R A;  4CZC A;  2EZH A;  3O3K A;  5E8I A;  1XPX A;  2QWW A;  5JVT A;  3LSI A;  3F8N A;  2D45 A;  3KYC B;  5B66 C;  5F0F A;  2H8R A;  4L0Y B;  4M3G A;  3HSR A;  5DM7 F;  1K7A A;  1PUE E;  1WHU A;  3RPQ A;  3KLN A;  2O8X A;  4C9Y A;  3CUQ C;  4D5F A;  3BZ6 A;  1STZ A;  2A05 A;  3DQV C;  3WGH A;  5E8G A;  5IT9 Z;  1IG7 A;  4FE4 A;  3MKL A;  4R79 A;  2CW0 F;  3NWT A;  4BL0 B;  1F43 A;  5J4V A;  1I5Z A;  2PMZ N;  1AOY A;  2RDP A;  2Y0S A;  2FOW A;  4G9Y A;  2QQA A;  1F36 A;  3KEQ A;  1IRG A;  2KDO A;  2BY0 A;  1EJ9 A;  2JUC A;  1FNN A;  4KDP A;  1Z6R A;  2K9S A;  2CW8 A;  1K83 J;  2DTZ A;  2KIU A;  1KU7 A;  2FF4 A;  3Q5F A;  4WX9 A;  3VYT B;  3OY9 A;  1ITY A;  1IXR C;  3RKQ A;  2XGE A;  3OYM A;  4YRV A;  1OKR A;  1X1B A;  5D4R A;  2EZI A;  4HRI A;  1RUO A;  1OFC X;  1LFB A;  2DI3 A;  2OD5 A;  4GXO A;  3V7R A;  3O8H A;  2DOD A;  3S2W A;  3L2R A;  3FXO A;  2F5F A;  2J5O A;  5HS7 A;  4IRI A;  3ZQI A;  2HQ5 A;  4N9I A;  3HOY J;  1JHH A;  5BNG A;  1IUY A;  3WHB A;  1VI0 A;  3VDX A;  5IY5 H;  2EH3 A;  4HF1 A;  2X9D A;  3CME I;  2HZT A;  2WAE A;  2EV6 A;  4A3L J;  2PQ8 A;  1B8I A;  4E70 A;  2R7Z J;  1QU3 A;  3DKX A;  1IRZ A;  2I10 A;  1UJ8 A;  2DA1 A;  5HS9 A;  1UHM A;  1Z9C A;  3SZT A;  2IXS A;  3P9I A;  3K4K A;  1JGG A;  5LD2 C;  2VB6 A;  2YR2 A;  3JW4 A;  5CLS A;  2DOA A;  3T8T A;  3A01 B;  1W1W E;  2LY1 A;  2ME0 A;  2WB1 A;  4XR6 A;  2BY2 A;  5IOY A;  2CYY A;  3TP0 A;  3DPT A;  4BU2 A;  1T0F A;  3OYN A;  4BAC A;  1YJN I;  3UNG C;  4KJZ A;  4LOC A;  5FB2 A;  2FQ4 A;  2DFE A;  3BR5 A;  4J00 A;  1RES A;  1H8A C;  1YIJ I;  3KP7 A;  2KPM A;  2WY8 Q;  3CLQ A;  1VQK I;  2V1D A;  1N75 A;  4AIK A;  2H8W A;  5LGN A;  1DPU A;  2MC4 A;  5LLQ A;  4RBO A;  3ESW B;  4CGZ A;  1WH5 A;  3FXU A;  4I76 A;  2K4B A;  3QOE A;  3RPU A;  2IGO A;  3S14 J;  1KON A;  3I9V 2;  3S8P A;  1OR7 A;  2PBI A;  2DU9 A;  2R7W A;  2PMZ A;  1S29 A;  1TQP A;  4GGG A;  2EFW A;  1XMA A;  1BC7 C;  2XAS A;  4P55 A;  3S2D J;  3ZOB A;  3K10 A;  3WE2 A;  5KHD A;  2E71 A;  5B5E C;  3OOU A;  3CD6 I;  4WK8 F;  2FBK A;  3BDD A;  1O57 A;  2K9L A;  1FZP B;  3QU3 A;  2RQP A;  1X58 A;  1OIS A;  3TP3 A;  1RNL A;  5L3G A;  3UR3 C;  1Q1V A;  3MZY A;  2A68 F;  1J7K A;  3EDP A;  2NRA C;  4A0X A;  2JRM A;  1IDZ A;  1SAN A;  4M3E A;  3BRO A;  1HBX G;  2ZXW H;  4BEH B;  1JKO C;  1O3S A;  4C2U A;  2GXB A;  2NAZ A;  1W5C C;  1D0X A;  4IOA F;  2B7E A;  1XMK A;  1RIO H;  3LNQ A;  2DPD A;  2EPF A;  2IPQ X;  5J6X A;  3DPL C;  4A93 J;  2HVS A;  2XAJ A;  2YU9 J;  3ERE D;  4XIC A;  4P9F A;  5H2F C;  2CV0 A;  5CQG A;  1ZYR F;  3MVP A;  3SDB A;  4DYC A;  1T08 B;  2K9M A;  2GOX B;  2DDB A;  3J7Y J;  1X3W B;  2LYC A;  2KRF A;  3MFK A;  2L02 A;  3M8E A;  2VJJ A;  1BOA A;  3DKW A;  3QP6 A;  3CMA I;  1BA5 A;  4IXA A;  3V4G A;  2XPU A;  4IHW A;  3RKY A;  4Q4Z F;  3OS1 A;  2L5Q A;  1FMV A;  4Y4R A;  9ANT A;  1W36 C;  3HTS B;  3ZN0 A;  3GX4 X;  1I50 J;  2OCE A;  2UV1 A;  1PDN C;  1NG6 A;  2W1O A;  3VFZ A;  3IAM 2;  3I0T A;  4GYI A;  4UY8 I;  1Z21 A;  1R6R A;  3CJN A;  4M6Y A;  2NS0 A;  2ID3 A;  4OOI A;  3E6C C;  1YG2 A;  1DPR A;  1GVJ A;  4AIH A;  2PMU A;  1OYW A;  4EM1 A;  2NS7 A;  4RAY A;  1V55 H;  3HRT A;  3KIO A;  2BVL A;  1MIJ A;  1IAW A;  1SVO A;  1SD6 A;  4F7Z A;  4QWQ A;  3N05 A;  1Z77 A;  5HLI A;  3NAR A;  3SFZ A;  3KX2 A;  4G94 A;  1O3T A;  3LL7 A;  1W7P A;  1Z1D A;  5F1J A;  1R4N B;  3TO9 A;  1MJ9 A;  3BPV A;  4HST A;  4XQF A;  3FBN B;  2L9R A;  2DQL A;  3L09 A;  3HRM A;  3CZ6 A;  3ZXS A;  1YRN A;  2R5Y A;  5HOD A;  4ITV A;  1XD7 A;  3IH2 A;  1OYY A;  2VQG A;  3ISP A;  4L5E A;  4Y7N J;  1R23 A;  3H3V K;  1ETY A;  1IO2 A;  4LG3 A;  1A5J A;  2VAS A;  1E17 A;  2VE9 A;  1MMD A;  4KMU X;  2D2W A;  2JTV A;  3MEX A;  3PSI A;  1IXC A;  4RM3 A;  4ENN A;  1ZG1 A;  2LK2 A;  1IN5 A;  2QLZ A;  3HOZ J;  4BDY A;  3ZMZ A;  3RPU D;  2VBZ A;  2BHY A;  4Y15 A;  2HS5 A;  1T98 A;  4RGX A;  4LB5 A;  4Y52 J;  2DTR A;  1FYK A;  1EA3 A;  2E60 A;  4RGU A;  5HNH A;  4M3D A;  3GXO A;  1HKQ A;  5C4X J;  1DGR M;  2DMT A;  3FHZ A;  2C6Y A;  2E5N A;  2HDW A;  3B73 A;  4CH7 A;  4PJJ A;  2VLA A;  1REP C;  1P7I A;  2HPM A;  4E6K G;  2VN2 A;  4FIS A;  2X0L A;  3WHC A;  3DXJ F;  3I3L A;  4DJA A;  2IS2 A;  2ECC A;  1IN6 A;  3AKZ A;  2UUZ A;  3CUQ A;  1B1B A;  1BIA A;  4O5V A;  2O0Y A;  4NHJ A;  1A35 A;  3E5Q A;  2L0K A;  2MYS A;  3MN2 A;  3CDL A;  4IHV A;  2Y69 H;  3CF5 F;  3GYH X;  3O8G A;  3R0A A;  3HM5 A;  2WV1 A;  5KAI C;  4G12 A;  4NDL A;  4GO1 A;  4CHU A;  2M9H A;  4PSX A;  3LSP A;  1KYZ A;  1TQM A;  4BXX J;  4BKX A;  5KCM A;  1ZK8 A;  5F08 A;  4L18 B;  3HRU A;  4E7K A;  5F64 A;  4AC0 A;  1K78 B;  4B3X A;  5HVQ C;  1FIA A;  1DGW Y;  1MGT A;  4D1Q A;  2FD5 A;  1RRJ A;  3S3M A;  2IGK A;  3CES A;  2Q0O A;  3A0B C;  4U87 A;  5FKK A;  4KIT B;  3TL4 X;  2MC3 A;  1VQ7 I;  4E7Z A;  3HOX J;  3OS2 A;  2PEX A;  2P5K A;  2CUE A;  1D1B A;  1P9Q C;  1ODD A;  2HQA A;  1PUF B;  1DUX C;  3G6E I;  1YLF A;  3CCU I;  3ECH A;  4XK4 A;  1MJA A;  1FBS A;  2FRH A;  4II2 A;  4XN0 A;  3KEY A;  1R4M B;  3LA3 A;  1RR7 A;  3OYH A;  5ERI A;  3AL0 C;  3TDZ C;  4LIV A;  1WJA A;  4HDV A;  3CP2 A;  1YJW I;  3TW7 A;  4BQA A;  5HDK A;  3JTG A;  2LLK A;  2V26 A;  1ZGA A;  1TWC J;  2DA3 A;  2VI6 A;  4U0W A;  1HA8 A;  3G4S I;  2LH9 A;  1UMQ A;  1MNM C;  2F4O B;  2DYR H;  3BJA A;  4CXF A;  2VJ4 A;  1MMN A;  4XRM A;  4LK1 F;  4A69 C;  1S7O A;  3ABL H;  3JAM Z;  2BOL A;  5DD4 A;  5ILS A;  1OCC H;  1W7P D;  2KIF A;  1SAX A;  1FJL A;  4Q5S F;  1FSH A;  3R6S A;  1MBJ A;  2E1C A;  3DLA A;  2BE5 F;  2FBH A;  5F6F A;  2M8E A;  2E5Z A;  5GTI C;  5L3E A;  5J8C A;  1DP3 A;  1LEA A;  4V19 K;  4IJA A;  3DU6 A;  1VQL I;  1PYV A;  3V8J A;  5IOZ A;  2STW A;  5F27 A;  3FXK A;  1WGX A;  2FU4 A;  3SDG A;  3IKT A;  2KZV A;  3MWM A;  1Y0U A;  4XL9 A;  2R7O A;  2L7Z A;  3LA7 A;  2W24 A;  3NQO A;  2EK5 A;  1JT6 A;  3LMM A;  2LNB A;  4NNJ A;  1MKM A;  2GAU A;  3OV8 A;  2F6C A;  3K9T A;  4JK1 X;  2DW4 A;  5HDG A;  1Z3Y A;  3EUA A;  5GAD J;  2QCO A;  1W5S A;  2MH9 A;  1LVK A;  5DS9 A;  2VQH A;  2HEO A;  1P4W A;  2ZFW A;  2A6T A;  3QRF F;  2Z2S B;  1SFU A;  3ZRG A;  2L4M A;  2FXA A;  3OOP A;  2RGV A;  2VOO A;  5AIP A;  2XF5 A;  4OU0 A;  1J2X A;  1KA8 A;  2DAO A;  1LQ1 A;  2LRD A;  4IOC F;  4BS9 A;  1M1E B;  2PFB A;  2OA4 A;  3V7C A;  4EJO A;  1WH7 A;  3LAJ A;  2E2H J;  1V5F A;  2LBF A;  3AL0 B;  4XMY A;  4IHY A;  2R7R A;  1V3F A;  1QZE A;  4MLO A;  1JTY A;  4HDU A;  1FTZ A;  5FD5 A;  1BC8 C;  2LTP A;  4X6A J;  2KRH A;  2ZME C;  1GHC A;  1FT9 A;  3SFI A;  3E97 A;  5J1Y A;  4GYG A;  3CJT B;  1AA7 A;  3FIW A;  3KZZ A;  1KQ9 A;  2L2O A;  1R00 A;  2PJR A;  1ZH5 A;  2M0M A;  4JP0 A;  4YFX F;  3SXY A;  3BR0 A;  2QA4 I;  4NBQ A;  2IA1 A;  3RI4 A;  4S0H B;  3QPT A;  2RAE A;  3Q0U A;  1IF1 A;  3JTH A;  2EIL H;  2QKM B;  4IX7 A;  1FEX A;  3W6K B;  4PUS A;  1WVR A;  1YYV A;  3EQL F;  1MSE C;  1P2F A;  2V1N A;  2FEZ A;  1RR8 C;  5H6R A;  4D7M A;  2YU3 A;  4EQQ A;  3BCA A;  3KP5 A;  4IHX A;  1ON1 A;  1WJF A;  1Z0X A;  3S1N J;  2KT0 A;  1IUF A;  1X1C A;  4GRI A;  4DBR A;  3LSR A;  5JR3 A;  4HAM A;  2GXG A;  4YII A;  1MH3 A;  1BIB A;  3GFL A;  5JVG F;  4YG2 F;  4BNC A;  2TDX A;  1FYM A;  3M7G A;  4YIR X;  3FZV A;  5JFR A;  5HOO A;  2LDU A;  3FXL A;  1U3E M;  2ZJR F;  2HPI A;  1U5T C;  2JZY A;  2F5D A;  3E1S A;  2BHZ A;  3FM5 A;  2A3S A;  1WPK A;  3S2H J;  5CVV A;  1R1T A;  1F4K A;  4IVN A;  4MTE A;  2UXN A;  2K7L A;  4C30 A;  3R61 A;  1H9G A;  2YUS A;  1BR4 A;  3AAF A;  2YX4 A;  3ASN H;  2FA5 A;  2XDV A;  2VC0 A;  3EET A;  4OWR B;  2GXA A;  3F8B A;  4RAZ A;  2XAH A;  3BR3 A;  2V1X A;  2XGX A;  1YW9 A;  4JX6 A;  1Y39 A;  5EEG A;  1V54 H;  3IH3 A;  3PIP F;  1G3T A;  3W6V A;  1LDJ A;  4HSR A;  1YX5 A;  3FMQ A;  5D6E A;  4HLY A;  1B8I B;  2V6C A;  4AVZ A;  1ZHF A;  1BI2 A;  3PL8 A;  1H0M A;  2W82 A;  1AKH A;  4A3B J;  2BY3 A;  3CDH A;  4Y3O A;  1BJZ A;  1L0O C;  2DK5 A;  2Z5U A;  1D0Z A;  1EF4 A;  2JQ7 A;  1WCM J;  3PFI A;  4J01 A;  1K6Y A;  3K4C A;  2E1M B;  3OYD A;  2V79 A;  2DQR A;  2IW5 A;  3DV8 A;  3WTX C;  2EV5 A;  1T56 A;  2FBI A;  2CO5 A;  2DOF A;  5EJC A;  4PJN A;  3GTG J;  4PSW A;  2O9L A;  3ULQ B;  2NVY J;  1VQ4 I;  4ZTJ A;  3GF2 A;  4RGS A;  2KMU A;  2DJI A;  3TGN A;  4LG0 A;  3HEF A;  1ETV A;  3A4C A;  2DA4 A;  5J1U A;  3DEE A;  1AHD P;  1R5H A;  5LBQ A;  2M87 A;  5M5W J;  4EJT A;  3TO7 A;  2BV6 A;  3BLY A;  3BJ6 A;  3OR1 C;  1ZQ3 P;  2GZW A;  3LST A;  1FOX A;  5J40 A;  3V42 A;  3F8F A;  3T8R A;  4FHT A;  1J5Y A;  3Q0W A;  1YIT I;  1DQU A;  1VQO I;  2Z9O A;  4XOP A;  4MFD A;  1ETX A;  2HKX A;  2OF7 A;  2JJ7 A;  4XBF A;  2ZJP F;  3K70 C;  2HDD A;  4CYC A;  4ABZ A;  3K0L A;  2MSY A;  5TJJ A;  4RS8 A;  1B9M A;  2ZXI A;  2K4J A;  3HRS A;  4KN4 X;  5E79 C;  3VYS B;  2FQ3 A;  5LHI A;  2XUB A;  4DYQ A;  4WF2 A;  1Z91 A;  2HDC A;  4XON A;  5E20 A;  5L3F A;  1MSF C;  4BJ5 C;  5E1W A;  1LDD A;  1G4D A;  2ZKZ A;  2R7V A;  4XRS A;  4A3E J;  1IN8 A;  1BL0 A;  3E6D A;  2A5W A;  3VYR B;  2CFX A;  1SFO J;  4IQJ A;  3HGG A;  2OTJ I;  1K4S A;  5AIQ A;  3ML6 A;  2K9N A;  1J0R A;  4ZZD A;  1ZRF A;  2K9Q A;  2P6T A;  3BWG A;  5JHF A;  5K5O A;  2CMP A;  4A5M A;  4BQO A;  3OYF A;  2DBB A;  3V8L A;  3N4M A;  4G6D A;  2R7X A;  1JTX A;  2X48 A;  1ZR2 A;  4XKC A;  2QSG X;  2A07 F;  4LGW A;  4ZDL A;  5E17 F;  2BYV E;  4DZP A;  2L7K A;  3F72 A;  2ISZ A;  3JRF A;  1N78 A;  2Q1Z B;  2QGU A;  2CJJ A;  4ZZL A;  2XRO A;  3RZD J;  2F5V A;  3DWL E;  3S3O A;  2LMD A;  2TCT A;  1S7A A;  2Q2E A;  2ZJ2 A;  1HKS A;  3B6A A;  4AID A;  3ELK A;  2XAG A;  2X1E A;  3ZGK A;  1SMY F;  4A3I J;  2X6X A;  2NOJ B;  2IRF G;  3H5N A;  2R7S A;  5FKN A;  3H3Z A;  1JE8 A;  1O7F A;  2QM3 A;  3IP4 B;  4ZYE A;  1IRX A; 
#chains in the Genus database with same CATH homology
 3FIS A;  3OSF A;  3LNQ A;  1BW6 A;  2Y2Z A;  2NOG A;  5IPA A;  1IV6 A;  4A93 J;  3SJM A;  5M5X J;  5E3M A;  2YU9 J;  2CU7 A;  4XIC A;  1OJL A;  3S1R J;  3F0C A;  3MVP A;  3S1Q J;  4DYC A;  1W0U A;  2MW8 A;  3S1M J;  4DW6 A;  3BQY A;  4I6Z A;  1BA5 A;  1GV2 A;  5K7F A;  2XPU A;  4IHW A;  9ANT A;  2TRT A;  1H88 C;  1HLV A;  2R0Q C;  1I50 J;  2G0E A;  3BR2 A;  2Y9Z A;  2EBI A;  2IEK A;  5F04 A;  3CQZ J;  3H0G J;  4FE7 A;  4GFB A;  2XGC A;  2Y30 A;  1YRN B;  3LOC A;  2ID3 A;  4A3C J;  2R5Y B;  1RET A;  4B3A A;  3JRB A;  1HF0 A;  3FK7 A;  5E3O A;  2JA6 J;  2NS7 A;  1B72 B;  1NTC A;  2GLO A;  3UKG A;  3ZQH A;  2XSD C;  5GPC A;  1T33 A;  1NK2 P;  1Y1W J;  4MIM A;  1Z77 A;  4EEF G;  1ETO A;  3NAR A;  1I6H J;  5JLX A;  3Q0V A;  4MO7 A;  2IAI A;  3GTJ J;  1JKP C;  3L1P A;  5F1J A;  1JUM A;  2M8G X;  3CCY A;  1JJ6 C;  5FJ8 J;  3K7A J;  2L9R A;  2HYJ A;  4V2F A;  4UUT A;  4DYR A;  1YRN A;  3BQZ A;  2CRG A;  5HOD A;  2R5Y A;  2QF7 A;  3IH2 A;  4L5E A;  5FLM J;  4Y7N J;  2Y0S N;  3H3V K;  3JR9 A;  1ETY A;  2GM4 A;  4A3D J;  1B72 A;  3A02 A;  1A5J A;  4J19 A;  2E2J J;  5E3L A;  3G1M A;  5IYC J;  2XGD A;  2LK2 A;  3HOZ J;  1X2M A;  1U9O A;  1TWG J;  3LSJ A;  1TC3 C;  1W0T A;  1AU7 A;  4Y52 J;  1JUP A;  4M3D A;  5C4X J;  5GP9 A;  3IV5 A;  2DMT A;  3S15 J;  5EYR A;  1FTT A;  4JX4 A;  3LSG A;  1P7I A;  3QQA A;  4FIS A;  1GVD A;  1FIP A;  1QRY A;  2MG4 A;  3WHC A;  3BG5 A;  5IP6 A;  5C44 J;  2ECC A;  4RDU A;  1E3O C;  1XS9 A;  3HOV J;  2EZK A;  3PO2 J;  2CQX A;  3FK6 A;  1POG A;  1LFU P;  2JA7 J;  1U78 A;  1IC8 A;  3I4N J;  2LY9 A;  2L0K A;  3MN2 A;  3BTL A;  3QPS A;  3CDL A;  4IHV A;  5EEA A;  3BG3 A;  3Q3S A;  4XID A;  4BY7 J;  3O8G A;  3HM5 A;  2WV1 A;  4G12 A;  4NDL A;  2EQR A;  2M9H A;  2ID6 A;  3LSP A;  2JK3 A;  3PO3 J;  2FX0 A;  4BXX J;  4BKX A;  1RPW A;  1ZK8 A;  5F08 A;  2M2E A;  1QVU A;  3JRA A;  2HI3 A;  4M3F A;  2R5Z B;  4AC0 A;  1FIA A;  3M3Y J;  5IYD J;  2FD5 A;  1I3Q J;  4W97 A;  1H89 C;  2GBY A;  5M3M J;  2WB1 N;  2KDZ A;  5FKK A;  3CMY A;  5IP7 J;  3ZQC A;  2DJN A;  3HOX J;  2L7M P;  2HXI A;  3TED A;  1VND A;  3GTQ J;  2Y9Y A;  1GDT A;  2CUE A;  1TWH J;  1PUF B;  1MBG A;  1X2N A;  1ORK A;  4XK4 A;  5DTD A;  3TW6 A;  1GUU A;  1RR7 A;  3BR6 A;  3S16 J;  2L7F P;  2B63 J;  1RKT A;  3TW7 A;  3GTP J;  3RQI A;  2R5Z A;  3JRE A;  2E19 A;  2LLK A;  2DMP A;  2XPW A;  2DA3 A;  1TWC J;  2VI6 A;  4HNV A;  4AUX A;  5IYB J;  1UMQ A;  2LFB A;  1MNM C;  1HDD C;  1HOM A;  2LKX A;  5K7Z A;  3HDD A;  4FCY A;  1U9N A;  3A03 A;  1D5Y A;  3BT9 A;  4XRM A;  3BG9 A;  5E3N A;  2NVQ J;  4A69 C;  2HOA A;  1HCR A;  2DA2 A;  1A6I A;  5C3E J;  3VPR A;  1PUF A;  1FJL A;  2HOT A;  3B6C A;  1IDY A;  1ENH A;  1ZTR A;  1MBJ A;  3HB9 A;  4M3B A;  3C2B A;  4A3G J;  4IEJ A;  3FKI J;  4UUS B;  2WAQ N;  5IOZ A;  1R9T J;  2CUF A;  5F27 A;  1WGX A;  4A3K J;  5M3F J;  2XB0 X;  3SDG A;  1JT0 A;  1HDP A;  1JUS A;  2L7Z A;  2M34 A;  4AYB N;  2LR8 A;  1VF9 A;  1JT6 A;  5C4J J;  2P81 A;  1P7J A;  4W1U A;  3HKZ N;  4B1R A;  2MGQ A;  1MBK A;  3K2A A;  3PM1 A;  2CQQ A;  3BTC A;  1ZR4 A;  2QCO A;  1IGN A;  3I4M J;  5FLV A;  2YS9 A;  3M4O J;  5DS9 A;  1QPI A;  3DCF A;  1U8B A;  3HOW J;  1LE8 B;  1GV5 A;  2ZB9 A;  4UUS A;  2E1O A;  4C3I J;  1MBH A;  2LP0 A;  1GT0 C;  3GTK J;  4B4C A;  4BBR J;  2NVT J;  1OCT C;  3NAU A;  1WH7 A;  2E2H J;  4V2G A;  3S17 J;  4X1E A;  2O7O A;  1JJ8 C;  5J3L A;  4C3J J;  4IHY A;  2E2I J;  4MLO A;  1XC5 A;  1JTY A;  1FTZ A;  5FKL A;  2LTP A;  4X6A J;  3SFI A;  5GPA A;  1BW5 A;  4JYK A;  2VPR A;  5J1Y A;  2M0C A;  3FIW A;  1WI3 A;  3JRI A;  1CQT A;  2COB A;  4FTH A;  1DU0 A;  1ETQ A;  3G1O A;  3HBL A;  1JKR C;  2N8G A;  4MFE A;  4JP0 A;  2DA6 A;  1Y1V J;  3BR0 A;  1LE8 A;  2R93 J;  1ZGW A;  2JWT A;  4QTR A;  4S0H B;  2RAE A;  3Q0U A;  4C3H J;  4QSH A;  4D5C A;  1ZKG A;  2R92 J;  3HOU J;  5F0C A;  1NK3 P;  1FEX A;  4BBS J;  2W48 A;  4A3M J;  1ETW A;  1MSE C;  2Y31 A;  2HXO A;  3IH4 A;  2DN0 A;  4D7M A;  1IJW C;  2D5V A;  1K61 A;  4IHX A;  5J1R A;  1Z0X A;  3S1N J;  2EZH A;  2DA5 A;  2KT0 A;  3JRD A;  1XG1 A;  2DMU A;  1IUF A;  3RZO J;  1UG2 A;  3LSR A;  5F0F A;  1O4X A;  1AKH B;  2H8R A;  2XRL A;  4M3G A;  2AO9 A;  1MH3 A;  2AHQ A;  4D5F A;  3GTM J;  2X6O A;  2ECB A;  4D7N A;  1IG7 A;  4FE4 A;  3MKL A;  1F43 A;  2LVS A;  2O8K A;  2HOS A;  2PMZ N;  1WPK A;  3QPL A;  3S2H J;  1OCP A;  3BR1 A;  2YUS A;  5JLW A;  3BTJ A;  1F36 A;  1APL C;  3G1L A;  1G2H A;  4DZJ A;  5FKM A;  3BR3 A;  5M5Y J;  4JX6 A;  2K9S A;  5K7H A;  5EF6 A;  3IH3 A;  1K83 J;  2DTZ A;  3W6V A;  4C2M J;  1B8I B;  1ITY A;  3GTO J;  3RKQ A;  2XGE A;  4BY1 J;  1AKH A;  4A3B J;  3D1N I;  1BJZ A;  1EF4 A;  2JMW A;  1TWA J;  5EGO B;  2EZI A;  2H1K A;  1WCM J;  1TWF J;  1OFC X;  1LFB A;  4CYC B;  1T56 A;  3O8H A;  5EG0 B;  3OSG A;  2FJ1 A;  3GTG J;  3ZQI A;  2O9L A;  2DMN A;  2HQ5 A;  2NVY J;  4QIW N;  4M6V A;  3HOY J;  5BNG A;  3BTI A;  4A3J J;  3OIO A;  5FKO A;  1DU6 A;  3WHB A;  3HEF A;  1VI0 A;  1ETV A;  3HGY A;  2DA4 A;  5J1U A;  1AHD P;  2EH3 A;  2X9D A;  1MBE A;  5M5W J;  1MH4 A;  1ZQ3 P;  4A3L J;  1B8I A;  2R7Z J;  1UHS A;  5F0H A;  2NVX J;  3Q0W A;  1IRZ A;  2I10 A;  2XPV A;  2DA1 A;  2VUM J;  4MFD A;  1ETX A;  2OF7 A;  5EGO A;  2JJ7 A;  2HDD A;  4A3F J;  1JGG A;  4CYC A;  4ABZ A;  2MSY A;  2DA7 A;  3E7L A;  3A01 B;  2EZL A;  4JX5 A;  5EG0 A;  2ELK A;  2ME0 A;  2JN6 A;  5IOY A;  4DYQ A;  3TP0 A;  3ZQG A;  3ZQL A;  4LOC A;  2FQ4 A;  1MBF A;  1S7E A;  3BR5 A;  1RES A;  1H8A C;  1MSF C;  2K40 A;  3JRC A;  1QVT A;  4XRS A;  4A3E J;  1BL0 A;  4RBO A;  2LD5 A;  1WH5 A;  4I76 A;  1SFO J;  2XB5 A;  3HGG A;  4XRS G;  5EZH A;  3S14 J;  2K9N A;  2K9Q A;  2DMQ A;  1VFC A;  2ME6 A;  3DEW A;  3JRH A;  3S2D J;  3ZOB A;  3A01 A;  1JTX A;  2X48 A;  1ETK A;  1RKW A;  5EZG A;  1ZR2 A;  3OOU A;  4DZP A;  5EDN A;  3JRF A;  2JA8 J;  3GTL J;  1JKQ C;  2CJJ A;  3GBG A;  3RZD J;  2VKE A;  2OPT A;  1X58 A;  3ZQF A;  2JA5 J;  3TP3 A;  2NS8 A;  2TCT A;  1Q1V A;  3B6A A;  2VKV A;  1IDZ A;  1SAN A;  4M3E A;  4A3I J;  1JKO C;  5FKN A;  5IP9 J;  2IBD A;  3JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...