3ZQ7A

The structure of dna-binding domain of response regulator from escherichia coli k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN KDPE
publication title Structure-Function Studies of DNA Binding Domain of Response Regulator Kdpe Reveals Equal Affinity Interactions at DNA Half-Sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zq7A00
1MDMB 3BJAA 2VN2A 2M1BA 4RB0A 5HDGA 1SAXA 4BNCA 5CYVA 4HV5A 3JTHA 4S04A 3E5QA 4ZYHA 2RVCA 4GCVA 3V7RA 4BYYA 2GQQA 2X0LA 4EVIA 4LLLA 2NAZA 2MA3A 3CUOA 4ASNA 5CJ9A 5HDKA 2C6YA 2XKOA 3R0AA 4M74A 4KA4A 1KU2A 3BJOA 1XMKA 1J2XA 3AAFA 2ESNA 2EV6A 4XBFA 4QLCU 4FT8A 3DF8A 3F8BA 2R3SA 3N4MA 1XN7A 1FBUA 1WKMA 3F8FA 1HBXG 1U5TB 1MJ9A 3IKVA 2FBIA 3IWZA 3RYRA 1IF1A 2PG4A 4ZYDA 3LFKA 4RGXA 3WE2A 5FD5A 2ISZA 4D0PA 2XVCA 4KMUX 1HW1A 1J5YA 4OIPF 3ZPLA 1YS7A 2OA4A 2V1UA 3QP6A 4LLGF 1S8NA 3CUQA 3F8CA 3HTSB 2O3FA 2DQRA 2J5PA 3MWMA 3TKYA 2K86A 4L5JA 3ULQB 4YIFA 4ESBA 1CF7A 1FP1D 1K6OA 5HVQC 1XSVA 2M5WA 3CUQC 4JBAA 4I02A 1R1UA 4ENJA 4OOIA 2E7WA 3RKXA 3LQQA 2MH9A 2IA1A 2F5DA 5L3GA 3JTGA 1D8KA 2PJPA 1FC3A 1WWXA 2XASA 3CLOA 3I71A 2A61A 4KN4X 1REPC 4G6QA 4WXDA 4IRHA 2VBXA 2CWEA 4MEYF 1ON1A 2P5KA 1YIOA 5HLHA 3RDIA 3GFMA 3K1PA 2B0LA 1FSHA 3K9TA 4HLYA 2AS5F 1H9TA 5D5UB 1BI3A 4ZZLA 2IT0A 1TLHB 2QBYA 4U7DA 1FWZA 2QZ8A 2F2EA 3QU6A 1R36A 1TW2A 4M73A 5HS8A 4G9YA 1K79A 1YW7A 2VC1A 5FLXZ 3F6VA 2Q8KA 3J80K 2FBKA 4JK1X 4U7BA 4CO8A 4EV0A 4M6YA 3CTAA 3H92A 3LAJA 5E1XA 2DBBA 3BP8A 4EMSA 5BS6A 3W6KB 3KETA 2EK5A 2L54A 3BPVA 2ESHA 5J6XA 2MBFA 3ISPA 5ICFA 4FX4A 3ECHA 2A6EF 5JHUA 4I2OA 1B9MA 1EH6A 1E17A 2FMYA 2VONA 1I1GA 2PBIA 3ELKA 3C3WA 5K1YA 2CGPA 2IW5A 2MH2A 2YU3A 4EJUA 2ZNZA 1XGMA 2XUBA 3E3VA 2XAFA 2M87A 4M9SA 3FM5A 2HEOA 5E17F 1TQMA 4OIQF 3LA2A 4I7HA 1ZRCA 4LD5A 4N9HA 4UVAA 4MEXF 3MQ0A 3WTZA 2OZUA 2RNJA 3KP2A 2FNAA 1B4AA 3M8FA 3I5UA 1L3LA 3T5XA 3B02A 4EJOA 1SD4A 1R5HA 2RKHA 1E2XA 1J7KA 3GZ5A 4NHJA 2FQ3A 3C7JA 3P9IA 1P4XA 2G7HA 4G6DA 3TQNA 2HKOA 3BROA 5ILUA 1W5TA 2QVOA 5FFXA 4A5NA 4G7OF 2P4WA 3HRSA 1PP7U 1R23A 3GO5A 2HDCA 5DCMB 1QZZA 5FO5A 1RNLA 2K27A 2Z99A 3SZPA 1IN6A 2HYGD 5BPDA 1T2KA 5E1ZB 4N9IA 1U3EM 5D8KB 1T6SA 2O0YA 2A07F 1O3SA 5BMZA 3HSEA 4LB6B 5AIPA 4M72A 1LNWA 4MQVA 2RV8A 1ZLKA 4WXCA 1ZG5A 2PMHA 5A2QK 1FP2A 4WWCA 4EQQA 5HOOA 2NS0A 2VODA 2ADUA 4ON0A 4KNYA 1TTYA 2A69F 3U2RA 4Y13A 3H3ZA 1TNTA 1LDKB 4YFNF 4L9TA 3JW4A 4P9UA 1B9NA 3HHHA 3ABUA 3EYYA 4AIJA 2K7LA 4XRFA 2K4BA 2EA2A 5DYMA 2F5EA 3DPLC 1ZAOA 2L4AA 2VT2A 4I0BA 1Z6TA 1L0OC 4XSXF 1IN7A 1SMYF 3GVAA 1R58A 2HQNA 3KFWX 2E1CA 1Z7UA 3T8RA 3ERED 2AXLA 5CVJA 4ESFA 4RB2C 4B8XA 3E6BA 2BBYA 2JTVA 1BBYA 5CVUA 2OZ6A 2IPQX 3LAPA 3K0LA 1PDNC 3WE3A 1Z05A 4GXOA 5LRRA 2EFNA 3KE2A 2R7DA 2HYFA 3F8MA 2H94A 1ZN2A 4G7ZF 1OYYA 3T0YA 5LGUA 3K1MA 1T0FA 1IRGA 4RS8A 2FMLA 4DNCA 3V7SA 1XSDA 4EM2A 4A2UA 3NRVA 3LA3A 3MZYA 4CICA 4N0BA 2FSWA 4MTDA 3L2CA 5CVIA 4EM1A 1YG2A 3KP7A 4OINF 2YX7A 4NB5A 2FRHA 3I54A 5D4RA 1B1BA 3WTVC 5CLSA 1ULYA 1O3TA 2P8TA 1QNTA 3FMSA 1ON2A 2BV6A 2GA2A 5TRDA 1G3WA 2Z9OA 3D0SA 3N97A 3R61A 4ZH4F 3GXOA 1GXQA 3EDPA 3BDDA 1VTNC 1MKMA 4RB1A 1AWCA 1ODDA 4ZZDA 2DAOA 3G73A 3FMRA 2F5FA 3R4KA 5LHGA 2EA4A 2ETHA 4OIOF 2FU4A 2DI3A 2VXZA 1TW3A 2RGVA 2UXNA 3PFIA 5LHIA 2HR3A 2VOOA 4Q48A 3CUQB 3F6OA 2XKPA 3WTSC 2IJLA 3GWZA 1O7FA 3EQLF 2FEZA 2DT5A 2FF4A 2FA5A 3BOQA 5DDGA 4P55A 1CF7B 3K69A 3IWFA 4L0YB 2V9VA 1KYZA 4BH9A 4WCGA 4GYGA 4CXFA 4P96A 4HQMA 5AONA 2HTJA 1AOYA 2EWNA 4G8XA 2MLGA 5ILSA 3M9AA 2NRAC 3V8JA 1LB2A 1KU7A 4UV9A 2A3SA 1OMIA 2ZKZA 1W7PA 1O3QA 4LK0F 2G9WA 5BOXA 2W57A 3GF2A 3HOTA 2KJCA 4KIGA 2OD5A 1YTYA 2MD5A 2ZBKA 1YYVA 5FFZA 1KQ9A 4A6EA 4L9VA 2STTA 3VFZA 1C0WA 2QBYB 1GXPA 1RI7A 4L9JA 4OMZA 3JAMK 2IP2A 4AD9A 5DUIA 1P6RA 5D6FA 4M9XA 4HOBA 2HFHA 2LDUA 2WTEA 4CDGA 4IHSA 5BQTA 1FSEA 1MD0A 2J5OA 2FXAA 2Z3YA 4U88A 1FYMA 5D5VB 4MTEA 1X3UA 4BQAA 1BI0A 3GUDA 4PZJA 1UHWA 2H6BA 4IXAA 3GFIA 3TOAA 3O3KA 5DV5A 4IRGA 4HQEA 5LBQA 4R8HA 2PN6A 3GFJA 2ACJA 3HSFA 2P7CB 4I01A 3RKWA 2YX4A 1FBQA 2IA2A 2OU2A 3E5XA 4EGZA 2EFPA 5DD8A 4LG0A 2RQPA 5E8GA 1D3YA 2FOKA 1G6NA 3ABTA 2LKPA 3ROUA 1FYLA 2BEOA 2FBHA 5L3EA 2EB7A 1I27A 1YLFA 1KQ8A 4EJVA 4RB3C 3U9GA 3GLXA 1G3TA 2XV4S 1K7AA 4HA8A 1S3JA 2V6CA 2EFQA 1ZRFA 5LEKA 5JVTA 1T39A 5F6FA 3VOEA 1ZGJA 3ZP5A 3I0TA 5A2QZ 2GAUA 3TO7A 1R22A 5CVVA 1J75A 1W7PD 2V1DA 2XAGA 2GZWA 3U1DA 3WGHA 1HW2A 3RKYA 1RZ4A 3E6DA 5H20A 1JHFA 2UWMA 4RGSA 3K1NA 3KP3A 5J8FA 5FGMA 3KZZA 2VC0A 4O5VA 1SFUA 2OAZA 3VEPA 3RPUA 2ISYA 4CZZA 2VOPA 4R1HA 1FYKA 2OBPA 3VODA 1XGOA 2ZCWA 2V1XA 3FXRA 2CQKA 4IHTA 1XCBA 1LDDA 2O61A 4PCQA 3LSTA 5D4SA 5KK1A 4Y17A 2DK5A 1IXCA 1T38A 2KKOA 1EH7A 1KA8A 3F23A 3HHGA 1IN4A 2GA1A 2O03A 3TGNA 5LGNA 1PUEE 1HKQA 1IAWA 4LFUA 2DW4A 3DQVC 1J0RA 3FF5A 4U0VA 1G3SA 2QQBA 2KIFA 3CO7C 1K78A 3REOA 2CSOA 4TV7A 4G7HF 2JSCA 1HSJA 5HDNA 4WK8F 2LF8A 3JSPA 4ESJA 5E18F 2UZKA 5AIQA 3C1DA 4GGGA 2DFIA 3MFKA 5L3BA 3SQNA 4DQ2A 2ELHA 2A5YB 1HKSA 2W25A 3Q9VA 4ZYEA 2DK8A 4HAMA 2K4JA 2KIMA 2QQAA 5EEHA 2P5LC 1BC8C 4A0ZA 4RGRA 4B09A 1ONVA 3CDHA 3CJNA 4IJAA 3HRUA 2ZXJA 2HS5A 1TNSA 3LWFA 3ZMTA 5H6RA 2PI0A 4RGUA 5BPIA 3TO6A 3F22A 1D8JA 4EJWA 6PAXA 5FB2A 3WTWC 2YR2A 5E8IA 3EETA 4L9NA 1OPCA 4ENNA 1ZG3A 3E97A 3WGGA 2LNBA 3WU1B 4Y15A 1FNNA 1B59A 2VBWA 3ZMVA 2V79A 2VE9A 4KUMA 2K02A 2PFBA 4L0ZB 1YFHA 4UXNA 4L5IA 1Z6RA 1MZBA 2D2WA 5JFRA 1ZRDA 1JXSA 4EJTA 1QO0D 4KFCA 2L4MA 3PQKA 1XCVA 1XDSA 2NYXA 5LRSA 4M9ZA 1LDJA 4WX9A 4XLNF 2XAQA 3I4PA 4LK1F 1XGNA 1ZLJA 3KEOA 3TDZC 3OV8A 2M8EA 2EV0A 2YPRA 2DO7A 2IA0A 3KP6A 1I1SA 3L9FA 1BI1A 4M71A 2W24A 3H3UA 2DTRA 5E20A 1OKRA 1ZG1A 1QGPA 4Q5SF 5LLQA 3JAMZ 2CO5A 1ZHFA 2PMUA 1YO5C 1GVJA 4LB5A 2KIUA 1P2FA 4XLPF 1ZREA 3V4GA 3ZQ7A 1ZARA 4KYWA 3P7NA 2OQGA 1LQ1A 5D5XB 5EEGA 4OIRF 2JPCA 3QAHA 3R60A 3HIFA 4P9FA 2P6SA 4YFKF 5D5WB 2HQRA 3SFZA 2QWWA 2Y0MA 2PEXA 4IPAA 1H9GA 5K5RA 3OOPA 3ZN0A 3KLNA 3NEUA 4HZFA 4KDPA 1KU9A 2HTSA 1W7PB 4H0EA 2Z5UA 3DPTA 5LEJA 2RC4A 1FX7A 1W4MA 2KRFA 1KGSA 3FWEA 4YG2F 3F21A 1IN8A 2HKXA 3KCCA 3TO9A 3HRTA 4HBLA 4IRIA 4UV8A 1H0MA 3C18A 3VB2A 2QM3A 2UXXA 4GYIA 2ZMEA 4KICA 5ICGA 3BZ6A 2JT1A 1XDUA 1Z91A 3DV8A 3NQOA 2ZFWA 2HGCA 2H6CA 4KIBA 3KP5A 2QLZA 3P9KA 3MEXA 3V8LA 4ENKA 1FY7A 1F4KA 2G7UA 3RPQA 2R7FA 3FHZA 4HLXA 1YQAA 4LG0B 4NQWA 1S7AA 2M45A 3SZTA 5JI6A 4KT5C 4UUVA 4LJZF 5ED4A 3QU3A 3J81Z 4MQ9F 4U0WA 3FM3A 1SMTA 2XGXA 1Y0UA 1ZGAA 3IKTA 2WWYA 3KZYA 4S05A 3HUGA 1LVAA 2LF7A 4ZYGA 2DPDA 3ECOA 1ZYRF 3ZMSA 4BHCA 3ZMDA 5F1RA 2Z33A 5HLIA 1UFMA 2GXGA 3QOPA 1O57A 3KLOA 3K2ZA 1KQ0A 1YW8A 3V8KA 5IT3A 5LHHA 4A0YA 3DXJF 3R6SA 3WTUC 3F3XA 2XIGA 2EFWA 1YS6A 3L09A 1CGPA 5F64A 1OYWA 1PP8F 5DCFA 5J8CA 5ILVA 1J9IA 4MNUA 1HKTA 1OYIA 1RUOA 3I59A 2H09A 3GW2A 2CFXA 2COMA 4BAYA 3S2WA 5D8LB 4HDVA 3GZ6A 3I64A 1Z1DA 5ERIA 3CO6C 2DU9A 2JRTA 4AWXB 1STZA 3IL2A 4KN7X 2DQLA 1TQIA 1WRJA 2D45A 2FE3A 5DD4A 2BE5F 1SFEA 4HF2A 2E1NA 2XAJA 1T98A 1O7LA 3GYHX 4Z2YA 3HYIA 1P4AA 1BN5A 4XSZF 3FX3A 1U6GA 1MJAA 3EYIA 1FBSA 3HOSA 1P92A 4KIFA 1K78B 1HW5A 4MGRA 2DPUA 5HS9A 1V3FA 1MDMA 1DP7P 1SD6A 1BI2A 3QP5A 1G3YA 1KYWA 2W85A 1S6LA 4PGGA 2O6GE 1KU3A 1IUYA 1S7OA 1IXSB 3B73A 1IRFA 3DFGA 1P4WA 5D6EA 3HRMA 2JZYA 5HS7A 3L00A 4AIKA 3MZHA 2QENA 3E6CC 2KJBA 1F9NA 5ICEA 1D5VA 4HYEA 4A0XA 3R0JA 1TBXA 1RIOH 1R1VA 3P9CA 4HX4A 1SD7A 1S29A 1U5TA 1MGTA 2QQ9A 1Z9CA 3W6JB 4G94A 3ZN1A 2PQ8A 3J81K 4QWQA 4LLNA 4LGWA 4L18B 3WU0A 3EUHA 3WTTC 1R00A 2IVMA 1U5TC 4UHTA 1R5GA 2EJRA 4CHUA 1BC7C 5DUKA 4I0AA 2A6HF 2ZJ2A 2RDPA 5TJJA 1XD7A 2BGCA 3JSOA 4EGYA 1NHAA 5IT9Z 2F5CA 2NNYA 1IXRC 3PQJA 1B6AA 3WTYC 4ENMA 4I09A 4FX0A 3M7GA 2GIVA 1OR7A 4HF0A 2D1HA 2P6TA 1R1TA 3GEZA 4CYDA 1FPQA 4HX8A 4YIIA 3J7AO 5E1WA 4HV6A 2QYOA 5K5QA 2X4HA 2JPBA 2L3DA 1UCRA 4FHTA 3RJPA 3IC7A 4CGZA 3MAJA 3MCZA 1LJ9A 3L7WA 3DP7A 1FLIA 1HSTA 2WV0A 4RAYA 3WODF 5L3CA 1SFXA 2O8XA 4JQFA 5L3FA 4U0YA 3BPXA 2VBZA 4UNOA 4M6XA 3E6MA 1SD5A 1LEAA 1R7JA 2EFOA 2VT3A 3GFLA 2H27A 2XHKA 1BIAA 2QUFA 1FOKA 2ZO4A 2FNPA 1FT9A 4AIHA 5FD6A 3I58A 4BHPA 2CYYA 3LQRA 2M30A 2RN7A 1HXDA 1BIBA 1W5SA 4HX7A 4HF1A 1WI9A 4HDUA 3HTUA 4O6JA 2EV5A 4R79A 2D1VA 1JE8A 3DKWA 3RYPA 1RUNA 3F8NA 3FZVA 4UVCA 4I98B 1WQ2A 3TOBA 1XB4A 3O2PE 4IVNA 3DEUA 3V7CA 2BYVE 2NNNA 3Q9SA 4BHBA 3QPHA 1BOAA 1UHMA 1XSXA 2LSOA 4E70A 1YW9A 3COAC 1QQIA 5HLGA 3T1BA 3GX4X 1A04A 1XGSA 4HW0A 1FZPB 3KEQA 3IRQA 1QPMA 4Q4ZF 2ZMEB 5K5OA 4A6DA 3D5LA 5FLXK 1IW7F 3RTRA 3IHUA 2IRFG 2XRNA 4A5MA 3O6BB 4GO1A 2DLLA 4OU0A 4WXHA 4ETSA 3RI4A 3E5UA 2HZTA 4IF4A 1GHCA 4F7ZA 4BXUA 1I5ZA 1U8RA 1UB9A 1USTA 1U78A 2XROA 2HWVA 5IT9K 1XMAA 2TDXA 2P5VA 4O3MA 1QBJA 3QPTA 3BJ6A 2OQRA 5DCMA 3T8TA 2Y48A 3KP4A 3BWGA 1DPRA 1DDNA 1QZYA 3FXUA 3I53A 1J59A 2L02A 3ZMZA 4KMFA 1I6XA 5H6QA 3WG9A 1F5TA 2Q2EA 3WGIA 1WSUA 2P7VB 1BJAA 2HOEA 3SHFA 3TDUC 1MJBA 3M1EA 4RAZA 1BM9A 1HQCA 5DEQA 1Q1HA 3ML6A 1USSA 1EV7A 2CG4A 3IRRA 4WF2A 5JR3A 1ZH5A 2MLKA 1IZ1A 3Q5FA 2WC2A 2E7XA 4YFXF 2VE8A 2W84A 4K2EA 2GXBA 2Q0OA 3HSRA 4PGHA 5LGTA 4LMYA 2CW0F 1EH8A 3SXYA 4AVPA 1TQPA 3ZMUA 3QRFF 3I59B 1DPUA 3FMQA 1IN5A 2YSRA 2MC3A 2XAHA 2VBYA 3F72A 1DUXC 2ZNYA 4Q47A 5L3DA 4A12A 1F1ZA 1G4DA 4PDKA 5ICCA 2GWRA 3M8EA 1V4RA 1JHHA 1JGSA 1O3RA 1U2WA 4OMYA 4MHGA 3G3ZA 3RIRA 3FXQA 4UVBA 3BY6A 4EM0B 5CVRA 2L01A 2A68F 3WTXC 2STWA 2Y75A 1LEBA 3J80Z 5KVRA 2PLYA 4P5OA 3LA7A
chains in the Genus database with same CATH superfamily
3E0JB 1UMQA 5F04A 1MDMB 3BJAA 2X1DA 4CCKA 2VN2A 2M1BA 4RB0A 3BCBA 2VQCA 5HDGA 4BQNA 2IS1A 3AG1H 1S72I 3DU6A 4UUSA 1SAXA 3I56I 2PJRA 4DW6A 4BNCA 3FXLA 5CYVA 4HV5A 2M0CA 3JTHA 4S04A 1EF4A 3E5QA 2AO9A 4ZYHA 2RVCA 3I3LA 5J1UA 4GCVA 2HVRA 3V7RA 3MKLA 4BYYA 2GQQA 2X0LA 4EVIA 3BTLA 3MZ8A 4LLLA 1PUFA 4A3IJ 1HOMA 2NAZA 2JK3A 2MA3A 3CUOA 4BACA 2LY2A 5CJ9A 4ASNA 3S3MA 5HDKA 2C6YA 2XKOA 2VKHA 3R0AA 2OTLI 4M74A 4KA4A 3RQIA 1KU2A 3M4OJ 3BJOA 1XMKA 4NC7A 1J2XA 3AAFA 2KLOA 1MMSA 2ESNA 1MMGA 2EV6A 4XBFA 4QLCU 4FT8A 2VUMJ 3DF8A 5M3FJ 4Z6YA 3F8BA 3CJTB 2X1CA 2DA2A 2R3SA 2GM4A 3N4MA 1XN7A 3HB9A 1LUJB 1FBUA 1WKMA 1HLVA 1GVDA 3F8FA 1HBXG 4A93J 1U5TB 4ABZA 1MJ9A 2A5WA 3IKVA 2FBIA 5LFAA 5IP7J 2VQLA 1QHHD 3WHBA 3IWZA 3RYRA 1IF1A 1MBFA 2PG4A 4ZYDA 1K4SA 2JA7J 3LFKA 4RGXA 3WE2A 5FD5A 4RLFA 2BY1A 4FCYA 1OCOH 2ISZA 4D0PA 4HNTA 2XVCA 4KMUX 1HW1A 1J5YA 4Y33A 4OIPF 2AHQA 4KT6A 5EF6A 1IDYA 3ZPLA 1MBKA 1YS7A 3ZRGA 2JA6J 2XB5A 2E1MC 2OA4A 2V1UA 2QSHX 4F93B 1DGRM 3QP6A 4XLEA 2VPLA 4LLGF 1S8NA 3CUQA 3LSJA 3F8CA 2XF7A 3HTSB 2O3FA 2DQRA 2J5PA 2W1OA 2LFBA 4C2MJ 2HXOA 5KNLA 4AC0A 3MWMA 4N4NB 3A02A 3TKYA 2K86A 4L5JA 1MNDA 3ULQB 3X2QH 2ELJA 4YIFA 4ESBA 1CF7A 3HL2A 1FP1D 1K6OA 3S1NJ 3FXJA 4XLCA 5HVQC 1XSVA 2M5WA 3CUQC 3I9V2 5GAHJ 2CV0A 4I99C 4JBAA 4I02A 1R1UA 4ENJA 4OOIA 2E7WA 4X6AJ 3RKXA 4XM3A 3LQQA 2EZHA 1V5FA 2MH9A 2IA1A 5IP6A 2F5DA 2ZJPF 5L3GA 3JTGA 1HDPA 1D8KA 5TISC 2PJPA 1FC3A 1WWXA 2L9SA 2XASA 3CLOA 4MIMA 3I71A 2K9QA 1DQUA 2A61A 4BE2A 4KN4X 4LITA 1X1DA 1REPC 1RKTA 4G6QA 2KDOA 4WXDA 4IRHA 4E7IA 1AHDP 4JP0A 3PFYA 2VBXA 5IYDJ 1RETA 2CWEA 2DT6A 4MEYF 1ON1A 1TWGJ 2P5KA 4CCLA 1A6QA 1YIOA 5FKOA 5HLHA 3H5AA 3OYJA 4Y7NJ 3RDIA 1RPWA 3GFMA 3OYNA 3K1PA 5K7HA 2NVQJ 2B0LA 2E35A 1FSHA 3K9TA 4OWRB 3VYUB 4HLYA 1WJ5A 2AS5F 1UAAA 1H9TA 4B4CA 2H1LA 1BA5A 2VL8A 5D5UB 1BI3A 3E7LA 1DU0A 4ZZLA 2IT0A 2JWTA 1JJ8C 1X1PA 5E79C 1TLHB 1RR8C 2NXNB 1R6RA 4A3KJ 4U7DA 1FWZA 2DA4A 2QBYA 2QZ8A 2OV7A 2F2EA 1I39A 3QU6A 3CP2A 1R36A 1TW2A 4M73A 5HS8A 3HGGA 5B5EC 4G9YA 1K79A 3CJQB 5EJCA 1YW7A 4B44A 3G2BA 1YJ9I 2VC1A 3IUOA 5FLXZ 2GOMA 3BR1A 3F6VA 2Q8KA 3S3NA 3J80K 4BJ5C 5FRNA 4B48A 2WA0A 1SVOA 2FBKA 4JK1X 4U7BA 4N4OB 3Q0UA 4IHVA 4CO8A 4PJNA 4EV0A 4M6YA 3CTAA 3H92A 3LAJA 2KFDA 4LOCA 5E1XA 2DBBA 3BP8A 4EMSA 5BS6A 3W6KB 3KETA 1EKEA 2EK5A 3L2QA 2L54A 4C9YA 3BG7A 3BPVA 2ESHA 5J6XA 5FKMA 3CCJI 2MBFA 3VWBA 3ISPA 2EZKA 4DBQA 5ICFA 4FX4A 3ECHA 2BXYA 4M6VA 2A6EF 4OAYA 4BY7J 4D7MA 4C30A 5JHUA 4I2OA 1B9MA 2DMTA 1EH6A 1E17A 2FMYA 2VONA 3W2VA 5B1AH 3J7AY 4RMNA 4NC6A 1I1GA 3W6VA 3LSGA 2PBIA 4XICA 3ELKA 3C3WA 1X2MA 1GUUA 3Q0VA 5K1YA 2CGPA 2M3AA 2IW5A 2MH2A 2YU3A 2Y9YA 2QF7A 4EJUA 1Z3YA 2ZNZA 2KZGA 1XGMA 2XUBA 2V7FA 4M3GA 3E3VA 2XAFA 4ZTJA 2JMWA 2M87A 2UV1A 4M9SA 2X9DA 3FM5A 2HEOA 5E17F 3A4CA 1YITI 1TQMA 3UR3C 5KHDA 4OIQF 3LA2A 2XSDC 4XN0A 4I7HA 2DTZA 1ZRCA 3OYBA 3BCAA 4LD5A 4N9HA 4UVAA 4MEXF 3V42A 3MQ0A 1FIPA 2G0EA 3WTZA 4BDZA 2OZUA 2RNJA 3KP2A 1MBGA 4E7JA 5E3LA 4CCMA 2FNAA 1B4AA 1D1BA 1G59A 3M8FA 2CW7A 3I5UA 1L3LA 3T5XA 2QQ8A 4ZDLA 1WJDA 2R7TA 3B02A 1LE8B 4EJOA 1SD4A 5FKNA 1WJCA 2WY7Q 1R5HA 2RKHA 4A3EJ 5F0CA 2HXIA 1E2XA 3AKZA 1J7KA 3GZ5A 3CDLA 5EG0A 4NHJA 1RESA 1JJ6C 2NVXJ 5F1JA 3CDIA 1D1CA 2FQ3A 2JVHA 3C7JA 3P9IA 2DOAA 1P4XA 2G7HA 4G6DA 2W7NA 1SVLA 3TQNA 3M1CA 2HKOA 3BROA 5ILUA 1W5TA 2QVOA 5FFXA 2R7UA 4A5NA 4G7OF 2Z16A 5E3NA 5HLTA 2P4WA 3HRSA 1PP7U 1R23A 3GO5A 4PJMA 2HDCA 5DCMB 1ZTRA 3CMEI 4HSTA 1QZZA 5FO5A 1RNLA 2K27A 1T33A 2Z99A 3SZPA 1GV5A 1IN6A 1K6YA 2DA3A 2HYGD 4F55A 5BPDA 1T2KA 2Q2EB 5E1ZB 2QA4I 3ZQCA 4N9IA 1U3EM 1BL0A 2KDZA 5D8KB 2X6YA 1XG1A 1T6SA 3H5NA 3CD6I 5H2FC 2O0YA 2A07F 3DLLF 1O3SA 1X19A 5HNFA 5BMZA 2QCOA 2XSJC 4DGWB 1Z0XA 3HSEA 1FMVA 4LB6B 5AIPA 1MIJA 4BE0A 1I6HJ 5C4XJ 4S0HB 4HRIA 4M72A 1LNWA 2KPMA 2RV8A 4MQVA 2Y0SA 4PFOA 2DFEA 1ZLKA 3ESWB 4WXCA 1ZGWA 3PO3J 1ZG5A 3LSIA 1S5LC 2B9SA 2M8GX 2PMHA 5A2QK 1FP2A 2MYSA 4YELA 4A69C 4EQQA 4WWCA 4QPQA 4FTHA 3BR6A 3I4MJ 2XPWA 5HOOA 2NS0A 3OIOA 4NC8A 2VODA 2ADUA 4ON0A 4KNYA 3TW7A 3AL0B 4JX6A 3S93A 1TTYA 3PM1A 2A69F 3U2RA 4ZYAA 3H3ZA 1TNTA 4Y13A 4HNUA 1VQ9I 1FTTA 5TGTA 1TC3C 1LDKB 4YFNF 3HKZN 3OOUA 4L9TA 3JW4A 4P9UA 1ZELA 3OSGA 1B9NA 4BE1A 3HHHA 3C2HA 1GDTA 1XPXA 3ABUA 3J7YJ 1U9OA 3EYYA 4AIJA 2K7LA 2BY3A 2R5YA 4XRFA 2K4BA 3DTKA 2CQ7A 3CMYA 3RZOJ 3DKYA 2EA2A 3DBRB 4A3CJ 5DYMA 2W82A 3VDXA 2YU9J 2F5EA 3DPLC 1ZAOA 2L4AA 2R7SA 4J01A 2VT2A 4I0BA 1Z6TA 1OCZH 2E2JJ 1BW5A 1L0OC 4XSXF 2N8GA 1IN7A 1X1AA 1SMYF 3GVAA 3D5RC 1R58A 2HQNA 3KFWX 2E1CA 2DFHA 1Z7UA 3T8RA 3ERED 4JOMA 2AXLA 1WHUA 5CVJA 4BY1J 3GTOJ 4ESFA 3OYIA 5J47A 1Z67A 4RB2C 4B8XA 2QSGX 3E6BA 4BL0B 2BBYA 2JTVA 3OYCA 1BBYA 5CVUA 2OZ6A 2QEXI 2IPQX 4CYCB 1QHGA 3LAPA 3K0LA 1PDNC 3FKIJ 3WE3A 1Z05A 4GXOA 5LRRA 1A5JA 3CMAI 5IYCJ 3HPGA 4II3A 2EFNA 3BG9A 2R7DA 2HYFA 1Q1VA 3ABMH 3KE2A 3O8HA 3F8MA 3MMYB 2H94A 5E3OA 1ZN2A 1TP4A 2Y31A 3PNYA 4G7ZF 2HPMA 4EEFG 1OYYA 5F08A 3T0YA 5J1RA 5LGUA 3K1MA 1T0FA 3OSFA 1IRGA 1FOXA 4RS8A 2FJ1A 2FMLA 4DNCA 1ZR2A 3S32A 3CC7I 3V7SA 1MNEA 1XSDA 4EM2A 2XPUA 4A2UA 4UUSB 1MMNA 3NRVA 3LA3A 2M0MA 3MZYA 4N0BA 4CICA 2PJRB 4FE4A 2FSWA 4MTDA 3MN2A 3DPUA 5CVIA 4EM1A 3L2CA 1YG2A 3KP7A 4CCJA 4OINF 2YX7A 3A2KA 4NB5A 2FRHA 3I54A 5D4RA 1TT5B 1B1BA 3WTVC 5JLWA 4XN3A 1E3OC 1T0FC 3CCLI 5CLSA 1UG2A 3GTGJ 2OC6A 2L2OA 1ULYA 3K7AJ 1EJ9A 3SYTA 1KZHA 2L7FP 1O3TA 3W2AA 2P8TA 1D5YA 1UZCA 1QNTA 3FMSA 1N78A 1ON2A 2BV6A 2GA2A 2M4KA 5C4JJ 5TRDA 3DTIA 4BXXJ 1G3WA 2Z9OA 3D0SA 4BDYA 3N97A 4XRSA 3R61A 1NG6A 1X4OA 5GP9A 1A6IA 4ZH4F 2L7MP 3GXOA 1GXQA 2OCCH 4UUTA 2XDVA 3EDPA 3BDDA 5M3MJ 1VTNC 1MKMA 2E1MB 4RB1A 1AWCA 5GPCA 1ODDA 4ZZDA 4A3JJ 2DAOA 3G73A 1ZK8A 2BHZA 3FMRA 2F5FA 3F9KA 3R4KA 1ZR4A 1ETKA 5LHGA 2EA4A 2ETHA 4OIOF 4F3QA 4HEA2 2FU4A 5KCMA 4X1EA 2EZIA 5EEAA 5GTHC 2DI3A 2JJ7A 3FHNA 2VXZA 1TW3A 3OYFA 3IAM2 2RGVA 2EBIA 1Z21A 2Y9ZA 4CCNA 1APLC 3FBNB 4RDUA 2UXNA 4XL9A 4DJAA 3PFIA 1JKOC 3VPRA 5LHIA 3I55I 2HR3A 5CQGA 2VOOA 4Q48A 3ZXSA 3CUQB 2AQEA 2F4OB 3F6OA 2JVGA 2XPVA 2XKPA 5J3LA 3WTSC 2IJLA 3GWZA 2CV2A 1O7FA 2HI3A 3OS2A 3EQLF 2FEZA 3RZDJ 2DT5A 1PVEA 2KL4A 2FF4A 2M7BA 2V26A 1LKXA 3L2RA 2E2IJ 2FA5A 1SC7A 1OISA 5CQEA 3BOQA 5HNHA 1H8AC 5DDGA 5GPAA 2NVUB 5M5YJ 4P55A 3ZOBA 1CF7B 1WVRA 1Y1VJ 4C3HJ 1WJEA 2VKEA 3IWFA 3K69A 3RSNA 2DMNA 1JTXA 2MD0A 3OIPA 2V9VA 4XKCA 4L0YB 1KYZA 4BQQA 2DT7B 2E19A 1TL8A 4IX7A 3S1RJ 4YRVA 3DWLE 4BH9A 2F6CA 4FQGA 4WCGA 4GYGA 4CXFA 4P96A 4HQMA 5AONA 5IPAA 2HTJA 1NG7A 1AOYA 1B8IA 2K9SA 2DYRH 3K6GA 1YRNA 2EWNA 4G8XA 2MLGA 5ILSA 2PMZN 3M9AA 4E4HA 2NRAC 3V8JA 1LB2A 3O8GA 1KU7A 4UV9A 1OJLA 2A3SA 3FKJA 1MSEC 4E7SA 1OMIA 2B7EA 1W7PA 2ZKZA 1LFUP 2JN6A 1O3QA 4LK0F 1ORKA 3J7ZI 2DOFA 3K4MA 2WB1A 2G9WA 3QOEA 5BOXA 1VI0A 1VQMI 3SFIA 2W57A 3GF2A 3HOTA 2KJCA 4DZPA 3EUKL 4KIGA 2OD5A 1YTYA 4G6TB 2MD5A 2ZBKA 1J09A 5FLMJ 2DOEA 1YYVA 5FFZA 5F0HA 1IJWC 1KQ9A 4C2TA 1YOVB 4A6EA 1SANA 4L9VA 2VB6A 4P1WA 3GTQJ 2STTA 3VFZA 2VJ5A 1C0WA 2QBYB 2F5VA 1GXPA 1RI7A 3CCYA 4L9JA 2IS6A 4OMZA 3JAMK 3M8JA 3GLLA 2V9PA 4CZCA 2IP2A 4AD9A 3S2DJ 2LREA 5DUIA 1P6RA 3GMEA 2E60A 2O7OA 2W00A 5FJ8J 3OR2C 1JKPC 5D6FA 1GV2A 4M9XA 3OY9A 4HOBA 1HDDC 2HFHA 2LDUA 2WTEA 4CDGA 2HOSA 4IHSA 5BQTA 1B72A 2XAUA 1FSEA 1CQTA 3IH4A 2QGUA 3K4BA 1MD0A 1P9QC 4BBSJ 2J5OA 2FXAA 2Z3YA 4U88A 1FYMA 2HVQA 5IYBJ 4RM2A 5D5VB 3HZJA 1VQ8I 1QZEA 4MTEA 1X3UA 4BQAA 1BI0A 1YJNI 3GUDA 2P0WA 4CA0A 4PZJA 4D1QA 1UHWA 4Y52J 2H6BA 4IXAA 1SAUA 3GFIA 3TOAA 3ZCOA 3O3KA 5DV5A 2BVMA 3WU2C 4IRGA 5C44J 4HQEA 2PN6A 4R8HA 5LBQA 3GFJA 2ACJA 3HSFA 2P7CB 1R4NB 3QODA 4I01A 4XIDA 3RKWA 1N25A 2YX4A 2K9NA 4I6ZA 1DGWY 3I4NJ 1FBQA 1BR2A 2IA2A 3TEDA 1K83J 2OU2A 3E5XA 4EGZA 2CFOA 2EFPA 5DD8A 1V5GA 2X51A 4LG0A 4IZZA 4RM3A 2RQPA 4H4KC 5E8GA 1D3YA 3PUBA 2FOKA 1G6NA 2WAQA 1ETYA 3ABTA 2CW8A 4HNVA 3UKGA 2LKPA 3ROUA 1FYLA 2BEOA 2FBHA 1D0XA 1WFXA 2HPIA 2XGDA 5L3EA 2EB7A 2IS4A 1JTYA 1I27A 1YLFA 3AG2H 3S17J 1KQ8A 4EJVA 2EILH 1ETOA 4RB3C 3U9GA 1VQPI 3GLXA 2GLOA 1G3TA 2XV4S 4KITB 2RQQA 3QPSA 5JHFA 1K7AA 4HA8A 1S3JA 2V6CA 2EFQA 3KZIC 4XK4A 1ZRFA 5LEKA 5JVTA 1T39A 5F6FA 3VOEA 1U9NA 1NK3P 1H88C 4QPOA 1ZGJA 3ZP5A 2D5VA 4FETA 3I0TA 5A2QZ 2GAUA 3BTCA 3TO7A 4MO7A 1H89C 1R22A 1UJ8A 2VIXA 5CVVA 1W7PD 1J75A 3AG4H 2XAGA 2V1DA 2GZWA 3U1DA 4AM3A 1VQKI 2IAIA 3DCFA 3WGHA 1HW2A 3RKYA 2TRTA 1QA6A 2EPFA 1RZ4A 3E6DA 5H20A 1JHFA 2BOLA 4L5EA 4RGSA 4QIWN 2UWMA 2LMDA 3K1NA 3KP3A 5EG0B 5J8FA 5FGMA 3ZQQA 3PL8A 1MSFC 3VYRB 3KZZA 1JUPA 2VC0A 4O5VA 1SFUA 2OAZA 3VEPA 3RPUA 3BG6A 2IGNA 5IP9J 2ISYA 3OYLA 3FK7A 4CZZA 2VOPA 1MNMC 4R1HA 1FYKA 1ITYA 5LD2C 3ABLH 2OBPA 3VODA 4A3BJ 1UELB 5HODA 5F0FA 1XGOA 1QU3A 1S7EA 2ZCWA 3S8PA 2V1XA 3FXRA 2CQKA 4IOCF 1BOBA 4OAZA 1UG0A 4IHTA 3PIPF 3BTJA 1XCBA 3CCUI 3OYAA 3K4CA 1LDDA 2O61A 4PCQA 3LSTA 1WCMJ 2JUGA 2K40A 5D4SA 2I5UA 3S3OA 2LKSA 2HQAA 3DU5A 5KK1A 3GTPJ 4C3IJ 2NVTJ 4Y17A 1WZ2A 2DK5A 1IXCA 1T38A 2KKOA 1TWAJ 1EH7A 3BQYA 1WI3A 2EINH 2ME0A 4ZC3A 3H3VK 1KA8A 3F23A 3HHGA 4QTRA 1IRXA 1IN4A 2L9RA 3ZR8X 2EZLA 2GA1A 2L7KA 3FXKA 2O03A 1U0JA 1LFBA 3TGNA 5J4YA 5LGNA 3L1PA 2DJIA 4Y3OA 1PUEE 1HKQA 1IAWA 4LFUA 2DW4A 3DQVC 1J0RA 2WAFA 3FF5A 4U0VA 4B3AA 3ONQA 1G3SA 2HU9A 1FMWA 2QQBA 3LSMA 2CS3A 1HF0A 2KIFA 2K3FA 3CO7C 1K78A 2R7QA 1HC8A 1ETQA 3REOA 2CSOA 1FEXA 4TV7A 2JSPA 4G7HF 2JSCA 2ZXIA 4LG3A 1HSJA 5HDNA 4WK8F 2LF8A 4XR6A 3JSPA 3D1NI 4ESJA 4M3EA 1QVTA 5E18F 2UZKA 4ZTFA 3UNGC 1X58A 5AIQA 3C1DA 4GGGA 3ZQHA 2DFIA 3MFKA 2NS8A 3FK6A 5L3BA 1BR1A 3SQNA 1YX5A 1XC5A 2ELHA 4DQ2A 3CF5F 2R5YB 2M34A 2A5YB 4XKWA 1ACIA 1HKSA 4F92B 2W25A 3ASOH 3Q9VA 1SFOJ 4ZYEA 2DK8A 2CRGA 4HAMA 3M3YJ 2K4JA 3QYBA 3L2WA 3DBLB 4BGDA 2KIMA 2XGCA 3QPLA 1WH7A 4BBRJ 2QQAA 5EEHA 2P5LC 1VFCA 3OYMA 3LSRA 1IGNA 3QWLA 2KISA 5IOZA 2E34A 1BC8C 4A0ZA 4RGRA 3H0GJ 1I3QJ 3HDDA 4B09A 1F36A 1OCPA 1ONVA 3CDHA 3CJNA 4IJAA 1XS9A 3G6EI 2ZXWH 2X48A 3BR2A 2LYCA 3HRUA 2CQNA 2M4GA 2ZXJA 3BLYA 2HS5A 1TNSA 3LWFA 3ZMTA 5GADJ 5H6RA 2F4IA 4J00A 1M1EB 2PI0A 3HEFA 4RGUA 5BPIA 2ECCA 1U8BA 3RPUD 3TO6A 3F22A 1D8JA 3H35A 4EJWA 6PAXA 5FB2A 3WTWC 2YR2A 5E8IA 1RR7A 2EIKH 3EETA 4ANJA 1LFPA 3JCUC 4L9NA 1OPCA 3HM5A 4DIQA 2IGMA 3JRAA 4ENNA 2ZC2A 4HSRA 1WPKA 3TBIA 1ZG3A 3E97A 3WGGA 2LNBA 1E3HA 2BY2A 3WU1B 3RCOA 4JX5A 4Y15A 1SVMA 4XKBA 2R7RA 1FNNA 4E7KA 2VJJA 3PJRA 2R7OA 4B1RA 1B59A 2VBWA 3ZMVA 2V79A 2VE9A 2K5CA 3FXMA 3OL4A 2RAEA 4D5CA 4KUMA 2K02A 2PFBA 1VF9A 2KQRA 4XNFA 4BU2A 2DA5A 4L0ZB 2K9LA 1YFHA 4XRSG 4UXNA 1X1BA 4L5IA 4BUPA 1Z6RA 3F0CA 1MZBA 1YHQI 2P81A 2HDWA 4GFBA 2D2WA 4V2GA 1MBHA 4NNJA 3CCMI 5JFRA 3CCVI 1ZRDA 1JXSA 4EJTA 1X2NA 1QO0D 2IEKA 4KFCA 4A3GJ 2L4MA 3PQKA 4DYRA 2K9MA 2LH9A 3OS1A 1OCCH 1XCVA 1XDSA 2IGKA 2NYXA 5LRSA 2A6TA 4M9ZA 3QYEA 1LDJA 2R4GA 1VQOI 4WX9A 1E3PA 1RRJA 1ETWA 2LVSA 2DMPA 3K4LA 4YIRX 4XLNF 4XLFA 3D5SC 5FRMA 2LBFA 2R5ZA 2XAQA 1Y6IA 3I4PA 4LK1F 1MH3A 1XGNA 5BNGA 2M9HA 1ZLJA 5EZGA 3KEOA 3TP3A 3A01B 3TDZC 3OV8A 1Y39A 2M8EA 3GCMA 4C3JJ 4CUGA 1VQNI 2EV0A 2K3PA 2YPRA 5DTDA 2DO7A 2IA0A 1D0ZA 3ABKH 2JA2A 3PUFA 3KP6A 1I1SA 4AVZA 3L9FA 1P7JA 2Q1ZB 1BI1A 2WBMA 1R9TJ 4M71A 2W24A 3A0HC 3H3UA 4E7HA 1T8IA 2X6XA 2DA7A 5EZHA 2DTRA 5E20A 1OKRA 1ZG1A 1QGPA 2MW8A 4Q5SF 1V54H 3JAMZ 5LLQA 1JUMA 3VYSB 2V1NA 2CO5A 1ZHFA 2PMUA 3CQZJ 1WJFA 1YO5C 1GVJA 5FKKA 4LB5A 2KIUA 1P2FA 1WJAA 1ENHA 1R71A 4XLPF 4M3DA 1OQYA 3G4SI 1ZREA 3V4GA 3ZQ7A 1ZARA 4KYWA 3P7NA 3A0BC 2CH0A 2OQGA 1ETXA 1LQ1A 5D5XB 5EEGA 1G2HA 5DM6F 4OIRF 3PSIA 2JPCA 1W0TA 2CUFA 5DM7F 3QAHA 1MH4A 3R60A 4U87A 4PJLA 3HIFA 4P9FA 2P6SA 5J1YA 3A03A 5FLVA 3B6AA 5JLXA 3L2VA 1X3WB 4YFKF 5D5WB 3DTEA 4JYKA 1FTZA 4DYQA 4D5FA 2IXSA 1B8IB 4A3DJ 2HQRA 3SFZA 2QWWA 1SEUA 2Y0MA 1YRNB 1W5CC 2PEXA 1H9GA 4IPAA 5K5RA 1IC8A 3OOPA 1TWCJ 2VXDA 3LL7A 3ZN0A 3JRFA 3KLNA 3FISA 3NEUA 4HZFA 4KDPA 3MVPA 1KU9A 2HTSA 3BG3A 1PUFB 1W7PB 2IBDA 4FISA 2MFZA 3SDBA 4H0EA 2BZTA 5FKLA 2Z5UA 3DPTA 1O4XA 5LEJA 5GAGJ 3QYFA 2AQFA 4GDFA 2NVYJ 2RC4A 1FX7A 1Y8RB 3OS0A 3E1SA 2R0QC 3CC4I 4CH7A 1W4MA 2KRFA 3CLQA 1KGSA 2ECBA 2LC2A 3FWEA 4YG2F 3F21A 5B3SH 1JUSA 1AA7A 3ASNH 1IN8A 1EA3A 2HKXA 2JUCA 3KCCA 3TO9A 3U21A 4ITVA 5M5XJ 1G8XA 3HRTA 4HBLA 4AYBA 4IRIA 3GZNB 4B43A 4UV8A 1H0MA 1AU7A 2X85A 3SEZA 2DMUA 3JRBA 3K4JA 2ZXHA 4HG2A 2W4SA 2CJJA 3C18A 3VB2A 2QM3A 1JT6A 4I76A 2UXXA 3HPHA 1B72B 4GYIA 2ZMEA 4KICA 5ICGA 3BZ6A 2JT1A 5M5WJ 1XDUA 1Z91A 2DA1A 2DFFA 3DV8A 4PSWA 3NQOA 4MFDA 2E1OA 1JGGA 2KRHA 4BJTA 2ZFWA 1A36A 3K70C 1VQ6I 4HPQA 2MGQA 2HGCA 4XMYA 2H6CA 4KIBA 2M2EA 3KP5A 3S15J 2JQ7A 2QLZA 3P9KA 2HVSA 4PUSA 2IGOA 3ZQIA 2ZMEC 1Y8QB 3MEXA 3V8LA 4F52A 4XRMA 4XONA 4ENKA 2NOJB 1FY7A 1F4KA 3VSLA 1IO2A 2G7UA 4NBQA 2I8DA 3FDYA 1RC9A 3RPQA 2R7FA 2F48A 2VJIA 3FHZA 4HLXA 4ZDPA 1YQAA 4LG0B 4NQWA 1ZKGA 1S7AA 2DDAA 2M45A 3SZTA 3JREA 2V6EA 5JI6A 3IH2A 4KT5C 4UUVA 2DCEA 2E36A 2E2HJ 4LJZF 5ED4A 3QU3A 3BTIA 3GTLJ 2OPTA 3J81Z 3H36A 4MQ9F 3HG9A 3W2WA 4U0WA 3FM3A 3BT9A 1VQLI 1SMTA 2BY0A 2XGXA 4PFPA 1Y0UA 1ZGAA 3IKTA 2VI6A 2DODA 3L2UA 2WWYA 3KZYA 1RKWA 4S05A 3HUGA 3IH3A 1LVAA 2LF7A 4ZYGA 3TL4X 1OCTC 2FOWA 2OTJI 1NH3A 1T95A 2DPDA 2H8WA 3ECOA 2GOXB 1ZYRF 1POGA 2Z1DA 2IS2A 3ZMSA 4BHCA 3ZMDA 4A3MJ 5F1RA 5FROA 1Z7LA 2OF7A 1BW6A 2Z33A 5HLIA 1UFMA 2GXGA 1FJLA 3QOPA 2DN0A 5IY5H 1AKHA 3KEYA 1O57A 3ZQFA 1VZ0A 3KLOA 5GTIC 3K2ZA 4RA2A 3SJMA 1HCRA 1KQ0A 3WG7H 1YW8A 2ID3A 3V8KA 5IT3A 5LHHA 4A0YA 3H1CA 4J19A 3DXJF 2KHMA 3R6SA 3WTUC 3F3XA 2VASA 3TP0A 2XIGA 1V55H 2EFWA 9ANTA 3BZKA 3G1MA 1YS6A 1K4TA 3L09A 1CGPA 4KJZA 5F64A 1OYWA 3JRIA 4XKVA 2DMQA 2FD5A 1PP8F 5DCFA 3Q0WA 5J8CA 5ILVA 3CF2A 2OJED 1J9IA 4MNUA 1HKTA 4PK4A 1OYIA 5IOYA 1RUOA 3I59A 2H09A 1Y56A 3GW2A 2YUSA 2CMPA 4XLAA 2CFXA 2COMA 4BAYA 3S2WA 2HNHA 5D8LB 3M07A 4HDVA 1TT0A 3JRDA 3K70D 3GZ6A 3I64A 1YIJI 2BHYA 1Z1DA 3OYDA 2GXAA 5ERIA 2ELKA 4BEHA 3CO6C 2Y0SN 1BR4A 1W1WE 2DU9A 2JRTA 4AWXB 2CUEA 1STZA 1WGXA 3IL2A 2ZJQF 4BQOA 3S16J 4KN7X 2DQLA 4IO9F 1TQIA 3CJRB 1QRYA 1WRJA 2WV1A 2M7AA 3SEQA 3HXLA 2D45A 4RLQA 4BJ6C 1S9HA 2FE3A 4IEJA 5DD4A 2BW3A 2BE5F 3HKZA 4PJJA 4D9JA 1N77A 2O8KA 1SFEA 4PJ0C 5KAFC 4HF2A 2E1NA 2CQXA 2XAJA 1T98A 3FXOA 2LY9A 1O7LA 1DP3A 2XRLA 4II2A 5EGOA 3GYHX 2R92J 4Z2YA 3HOYJ 3HYIA 2DXIA 1P4AA 2PX9A 1BN5A 4CCOA 2R7XA 1MBEA 2RNGA 4XSZF 4AUXA 3FX3A 1U6GA 1MJAA 3EYIA 1I50J 3JRGA 1TWHJ 2KIQA 1FBSA 3HOSA 1P92A 4KIFA 1IV8A 3G1OA 4DYCA 3OYEA 2GBYA 1YX3A 1K78B 1HW5A 4MGRA 1OFCX 3SDGA 3AG3H 4W97A 2DPUA 5HS9A 1V3FA 2L7ZA 2MG4A 1MDMA 1DP7P 1SD6A 1BI2A 3QP5A 1G3YA 3MKWB 2MABA 1KYWA 3TW6A 2W85A 3CCSI 1YJWI 1S6LA 4PGGA 2WAEA 2O6GE 2DYSH 1KU3A 1IUYA 3LSKA 3N05A 2CQQA 4M3BA 1XTAA 2KP6A 1S7OA 1OLTA 1IXSB 5B66C 3B73A 5B1BH 1IRFA 2UUZA 1W36C 3IV5A 3HGYA 3DFGA 5EYRA 5F27A 1P4WA 5D6EA 2L0KA 3HRMA 2JZYA 2JRMA 5HS7A 2NS7A 3L00A 4AIKA 4XQFA 3MZHA 2QENA 4IL6C 3E6CC 3CC2I 2E71A 2KJBA 2MSYA 4PSXA 2LY1A 1F9NA 1Y0NA 3S2HJ 5ICEA 1WH5A 1D5VA 4HYEA 4A0XA 3R0JA 1R4MB 1T56A 1TBXA 2RREA 3PNVA 1RIOH 1R1VA 2QKMB 2HOTA 3B6CA 3P9CA 5C3EJ 1PYVA 2Z2SB 4HX4A 2BVLA 1SD7A 3G71I 1S29A 1U5TA 2KZVA 1MGTA 2QQ9A 1Z9CA 3BR5A 4G94A 3W6JB 3ZN1A 1HA8A 1IDZA 2PQ8A 1VQ4I 2KMUA 3J81K 1NTCA 2K85A 2ID6A 4QWQA 5CKTA 1A31A 4LLNA 2CU7A 4LGWA 2CV1A 3S1QJ 3H0DA 4L18B 1MMAA 3EUHA 3WU0A 3WTTC 2XF6A 1R00A 2IVMA 1N75A 1U5TC 5K7ZA 2DJNA 4UHTA 2EH3A 3WHCA 1R5GA 3KYDB 1JT0A 4UB8C 3JR9A 3FIWA 2EJRA 4B47A 4CHUA 1BC7C 3LOCA 4A3LJ 3U1KA 3RQ4A 5DUKA 2LD5A 4I0AA 3IP4B 2A6HF 3NWTA 3ZQGA 2ZJ2A 3G1LA 4B3XA 2LKXA 2RDPA 1IUFA 3HBLA 4AYBN 4NUBA 5TJJA 1XD7A 2BGCA 1DU6A 5K7FA 3JSOA 4EGYA 1NHAA 5IT9Z 2F5CA 3BZCA 2X6WA 2NNYA 1IXRC 3EUHC 3PQJA 1B6AA 4F91B 3WTYC 3NWSA 4ENMA 4I09A 2HYJA 3OYGA 4LIUA 1MBJA 4FX0A 3M7GA 2GIVA 3HOVJ 1OR7A 2R93J 4HF0A 3CESA 3CCRI 2E5NA 2D1HA 2MC4A 2P6TA 1R1TA 3GEZA 4CYDA 1Z3XA 1FPQA 1KONA 4HX8A 1BJZA 4XLHA 4YIIA 3J7AO 2HQ5A 3OL3A 3KX2A 2CUZA 2F4MB 5E1WA 2KRCA 2QYOA 4HV6A 5K5QA 3ZQLA 2X4HA 3HOXJ 4ZDOA 1OR7C 1WJBA 2JPBA 3OR1C 2XGEA 2L3DA 1W36D 2JA8J 1UCRA 2LBFB 1XX5A 4FHTA 2R5ZB 4IOAF 3RJPA 3IC7A 2YS9A 2I10A 4CGZA 3MAJA 4RBOA 3MCZA 1LJ9A 3L7WA 3DP7A 1FLIA 1HSTA 2O9LA 4G12A 3CCQI 2WV0A 4RAYA 2DDBA 3WODF 5L3CA 1X1CA 1SFXA 2O8XA 4JQFA 5EDNA 2AXTC 5L3FA 4D7NA 4U0YA 3BPXA 1NK2P 4YEJA 2VBZA 3EUAA 4UNOA 3MKYB 4W1UA 1FIAA 4M6XA 3HOWJ 3E6MA 3KIOA 1SD5A 2PMZA 2VQHA 2CUJA 1LEAA 2X6OA 1R7JA 2EFOA 2VT3A 5CPRB 5E3MA 2TCTA 3GFLA 5J4VA 2H27A 2FUG2 2HDDA 2XHKA 2O5RA 1BIAA 2QUFA 4BXFA 1FOKA 2ZO4A 1ZQ3P 2FNPA 4FE7A 4X0GA 2WADA 2VKVA 1FT9A 4AIHA 3BQZA 5FD6A 2VPRA 4V2FA 1UHSA 2WB1N 2VLAA 3I58A 1MW7A 4BHPA 2CYYA 2KT0A 3LQRA 4BKXA 3DBHB 4DBRA 2M30A 5J40A 2ZSIB 2RN7A 1VQ7I 3FBIB 3K4KA 3LSPA 3NAUA 1QVUA 1HXDA 3BR3A 1BIBA 1W5SA 2NOGA 2H8RA 4HX7A 3OYKA 4E6KG 4HF1A 1WI9A 2ZB9A 3H9QA 1Z77A 2HOAA 3KYCB 4HDUA 3HTUA 1FOWA 3GTJJ 1X3ZB 3S14J 4O6JA 2EV5A 1OCRH 4R79A 2D1VA 1JE8A 2QSFX 1A35A 3GBGA 4IQJA 3DKWA 3RYPA 4KISA 1RUNA 3F8NA 3FZVA 2LTPA 2LP0A 4UVCA 3SZGA 3OYHA 4I98B 1WQ2A 3TOBA 1XB4A 1JKRC 3O2PE 4IVNA 3VYTB 3DEUA 3V7CA 2BYVE 4XORA 2NNNA 3Q9SA 1F43A 3EPZA 4BS9A 1TZLA 2OUMA 1SFKA 2Y2ZA 2L9VA 4BHBA 3QPHA 2EIMH 3DKXA 1BOAA 3KPHA 1UHMA 4E7LA 1XSXA 2LSOA 4E70A 1D0YA 4UY8I 1YW9A 1P7IA 3Q3SA 2EIJH 3COAC 1QQIA 2DA6A 2LG4A 2XF5A 3HJEA 1Y1WJ 2WY8Q 5HLGA 3T1BA 1A04A 4HW0A 1XGSA 3GX4X 1FZPB 1YE9A 2E5ZA 3KEQA 3IRQA 1QPMA 2ZSHB 2ZMEB 3H9JA 5K5OA 4Q4ZF 4MLOA 2Y30A 3ZGKA 3A1YA 4A6DA 3D5LA 5FLXK 1MMDA 3VSKA 1IW7F 3RTRA 3IHUA 4AIDA 2IRFG 2WAQN 3DLAA 2V9KA 2XRNA 4Y4RA 4A5MA 3O6BB 4GO1A 2V4JC 2LK2A 2DLLA 4OU0A 4WXHA 4ZJZA 3PO2J 3AFHA 2XB0X 4ETSA 3RI4A 1LE8A 3E5UA 2HZTA 4DZJA 4IF4A 4E7ZA 1GHCA 4F7ZA 2ZFUA 4BXUA 1I5ZA 1U8RA 1UB9A 4QSHA 1USTA 2R7VA 3RKQA 3BR0A 1U78A 3LMMA 2XROA 2HWVA 4LIVA 3TMOA 5IT9K 3CCEI 1XMAA 2TDXA 2P5VA 4IQ4A 4O3MA 2X1EA 1GT0C 1QBJA 2VQGA 4NQWB 3K4NA 3QPTA 3BJ6A 1LPQA 1JKQC 3HOUJ 3KYLA 2OQRA 4RAFA 5DCMA 2L9NA 4M3FA 3T8TA 2Y48A 3QQAA 3KP4A 3BWGA 3CP8A 1DPRA 1DDNA 1QZYA 2COBA 1T08B 3FXUA 4A3FJ 3I53A 1J59A 2L02A 3ZMZA 4CSWA 1I6XA 4KMFA 3LNQA 5H6QA 4NDLA 3WG9A 1F5TA 3HOZJ 2Q2EA 3WGIA 1WSUA 3LSHA 2P7VB 2QKLB 3PSFA 1BJAA 2FQ4A 2HOEA 3SHFA 3BG5A 3HUGB 3TDUC 1VNDA 1MJBA 2VJ4A 2LLKA 3M1EA 4RAZA 2ME6A 1BM9A 4GRIA 1HQCA 5DEQA 1ERDA 1XMXA 1Q1HA 3CZ6A 2R7WA 3C2BA 3PNTA 1YI2I 3ML6A 1USSA 1EV7A 2CG4A 2XC7A 3IRRA 1W0UA 5KAIC 4EATA 3PIOF 4WF2A 5JR3A 1X4PA 5JVGF 1AKHB 3HC7A 1IV6A 4AU7A 1ZH5A 1K61A 2MLKA 4RAGA 4IHWA 1IZ1A 3MD2A 3Q5FA 2WC2A 3JRHA 2E7XA 1V5EA 2VE8A 4JX4A 4YFXF 2W84A 2ICWG 4K2EA 2GXBA 4IHYA 2Q0OA 3DEEA 3CMMA 2B63J 3HSRA 1I3AA 4PGHA 5LGTA 4FASD 4LMYA 2CW0F 1EH8A 2BXZA 3SXYA 4AVPA 1TQPA 3JRCA 3OMYA 1TWFJ 4XOPA 2W48A 4MFEA 4XOTA 4IHXA 3ZMUA 3QRFF 3K2AA 2OCEA 3I59B 1DPUA 3GTMJ 3OIQA 3FMQA 1IN5A 1R5ID 2YSRA 2MC3A 2H1KA 2XAHA 2VBYA 3F72A 2LR8A 1GLNA 1IRZA 1FOYA 1DUXC 3AL0C 2ZNYA 4Q47A 3H5RA 4BEHB 2FX0A 1JI8A 5DS9A 5L3DA 4A12A 1F1ZA 4DOZA 3MKZA 1E0EA 3P5JA 2HZDA 3A01A 1G4DA 4PDKA 5ICCA 4UB6C 2GWRA 3M8EA 1V4RA 2A05A 3OWTA 5GAEJ 1JHHA 1JGSA 1O3RA 1U2WA 2BW3B 3W3CA 4OMYA 3BC8A 3S1MJ 4MHGA 3G3ZA 3IAS2 3RIRA 4C2UA 3FXQA 4UVBA 4V19K 2VKDA 2LRDA 1PJRA 2R7ZJ 3BY6A 2JA5J 3H9GA 4EM0B 3ERMA 5CVRA 3NARA 1QPIA 3K10A 2L01A 5EGOB 2A68F 2Y69H 1LVKA 3WTXC 2L5QA 2STWA 2Y75A 1IG7A 1D1AA 1ETVA 1R49A 4CYCA 1VQ5I 1LEBA 2ZJRF 3LFUA 3J80Z 5KVRA 2PLYA 3C2GA 4P5OA 2GIZA 3LA7A 4IKFA 2EQRA 3GTKJ 2LOOA 3DEWA
chains in the Genus database with same CATH topology
1MDMB 3BJAA 2VN2A 2M1BA 4RB0A 5HDGA 1SAXA 4BNCA 5CYVA 4HV5A 3JTHA 4S04A 3E5QA 4ZYHA 2RVCA 4GCVA 3V7RA 4BYYA 2GQQA 2X0LA 4EVIA 4LLLA 2NAZA 2MA3A 3CUOA 4ASNA 5CJ9A 5HDKA 2C6YA 2XKOA 3R0AA 4M74A 4KA4A 1KU2A 3BJOA 1XMKA 1J2XA 3AAFA 2ESNA 2EV6A 4XBFA 4QLCU 4FT8A 3DF8A 3F8BA 2R3SA 3N4MA 1XN7A 1FBUA 1WKMA 3F8FA 1HBXG 1U5TB 1MJ9A 3IKVA 2FBIA 3IWZA 3RYRA 1IF1A 2PG4A 4ZYDA 3LFKA 4RGXA 3WE2A 5FD5A 2ISZA 4D0PA 2XVCA 4KMUX 1HW1A 1J5YA 4OIPF 3ZPLA 1YS7A 2OA4A 2V1UA 3QP6A 4LLGF 1S8NA 3CUQA 3F8CA 3HTSB 2O3FA 2DQRA 2J5PA 3MWMA 3TKYA 2K86A 4L5JA 3ULQB 4YIFA 4ESBA 1CF7A 1FP1D 1K6OA 5HVQC 1XSVA 2M5WA 3CUQC 4JBAA 4I02A 1R1UA 4ENJA 4OOIA 2E7WA 3RKXA 3LQQA 2MH9A 2IA1A 2F5DA 5L3GA 3JTGA 1D8KA 2PJPA 1FC3A 1WWXA 2XASA 3CLOA 3I71A 2A61A 4KN4X 1REPC 4G6QA 4WXDA 4IRHA 2VBXA 2CWEA 4MEYF 1ON1A 2P5KA 1YIOA 5HLHA 3RDIA 3GFMA 3K1PA 2B0LA 1FSHA 3K9TA 4HLYA 2AS5F 1H9TA 5D5UB 1BI3A 4ZZLA 2IT0A 1TLHB 2QBYA 4U7DA 1FWZA 2QZ8A 2F2EA 3QU6A 1R36A 1TW2A 4M73A 5HS8A 4G9YA 1K79A 1YW7A 2VC1A 5FLXZ 3F6VA 2Q8KA 3J80K 2FBKA 4JK1X 4U7BA 4CO8A 4EV0A 4M6YA 3CTAA 3H92A 3LAJA 5E1XA 2DBBA 3BP8A 4EMSA 5BS6A 3W6KB 3KETA 2EK5A 2L54A 3BPVA 2ESHA 5J6XA 2MBFA 3ISPA 5ICFA 4FX4A 3ECHA 2A6EF 5JHUA 4I2OA 1B9MA 1EH6A 1E17A 2FMYA 2VONA 1I1GA 2PBIA 3ELKA 3C3WA 5K1YA 2CGPA 2IW5A 2MH2A 2YU3A 4EJUA 2ZNZA 1XGMA 2XUBA 3E3VA 2XAFA 2M87A 4M9SA 3FM5A 2HEOA 5E17F 1TQMA 4OIQF 3LA2A 4I7HA 1ZRCA 4LD5A 4N9HA 4UVAA 4MEXF 3MQ0A 3WTZA 2OZUA 2RNJA 3KP2A 2FNAA 1B4AA 3M8FA 3I5UA 1L3LA 3T5XA 3B02A 4EJOA 1SD4A 1R5HA 2RKHA 1E2XA 1J7KA 3GZ5A 4NHJA 2FQ3A 3C7JA 3P9IA 1P4XA 2G7HA 4G6DA 3TQNA 2HKOA 3BROA 5ILUA 1W5TA 2QVOA 5FFXA 4A5NA 4G7OF 2P4WA 3HRSA 1PP7U 1R23A 3GO5A 2HDCA 5DCMB 1QZZA 5FO5A 1RNLA 2K27A 2Z99A 3SZPA 1IN6A 2HYGD 5BPDA 1T2KA 5E1ZB 4N9IA 1U3EM 5D8KB 1T6SA 2O0YA 2A07F 1O3SA 5BMZA 3HSEA 4LB6B 5AIPA 4M72A 1LNWA 4MQVA 2RV8A 1ZLKA 4WXCA 1ZG5A 2PMHA 5A2QK 1FP2A 4WWCA 4EQQA 5HOOA 2NS0A 2VODA 2ADUA 4ON0A 4KNYA 1TTYA 2A69F 3U2RA 4Y13A 3H3ZA 1TNTA 1LDKB 4YFNF 4L9TA 3JW4A 4P9UA 1B9NA 3HHHA 3ABUA 3EYYA 4AIJA 2K7LA 4XRFA 2K4BA 2EA2A 5DYMA 2F5EA 3DPLC 1ZAOA 2L4AA 2VT2A 4I0BA 1Z6TA 1L0OC 4XSXF 1IN7A 1SMYF 3GVAA 1R58A 2HQNA 3KFWX 2E1CA 1Z7UA 3T8RA 3ERED 2AXLA 5CVJA 4ESFA 4RB2C 4B8XA 3E6BA 2BBYA 2JTVA 1BBYA 5CVUA 2OZ6A 2IPQX 3LAPA 3K0LA 1PDNC 3WE3A 1Z05A 4GXOA 5LRRA 2EFNA 3KE2A 2R7DA 2HYFA 3F8MA 2H94A 1ZN2A 4G7ZF 1OYYA 3T0YA 5LGUA 3K1MA 1T0FA 1IRGA 4RS8A 2FMLA 4DNCA 3V7SA 1XSDA 4EM2A 4A2UA 3NRVA 3LA3A 3MZYA 4CICA 4N0BA 2FSWA 4MTDA 3L2CA 5CVIA 4EM1A 1YG2A 3KP7A 4OINF 2YX7A 4NB5A 2FRHA 3I54A 5D4RA 1B1BA 3WTVC 5CLSA 1ULYA 1O3TA 2P8TA 1QNTA 3FMSA 1ON2A 2BV6A 2GA2A 5TRDA 1G3WA 2Z9OA 3D0SA 3N97A 3R61A 4ZH4F 3GXOA 1GXQA 3EDPA 3BDDA 1VTNC 1MKMA 4RB1A 1AWCA 1ODDA 4ZZDA 2DAOA 3G73A 3FMRA 2F5FA 3R4KA 5LHGA 2EA4A 2ETHA 4OIOF 2FU4A 2DI3A 2VXZA 1TW3A 2RGVA 2UXNA 3PFIA 5LHIA 2HR3A 2VOOA 4Q48A 3CUQB 3F6OA 2XKPA 3WTSC 2IJLA 3GWZA 1O7FA 3EQLF 2FEZA 2DT5A 2FF4A 2FA5A 3BOQA 5DDGA 4P55A 1CF7B 3K69A 3IWFA 4L0YB 2V9VA 1KYZA 4BH9A 4WCGA 4GYGA 4CXFA 4P96A 4HQMA 5AONA 2HTJA 1AOYA 2EWNA 4G8XA 2MLGA 5ILSA 3M9AA 2NRAC 3V8JA 1LB2A 1KU7A 4UV9A 2A3SA 1OMIA 2ZKZA 1W7PA 1O3QA 4LK0F 2G9WA 5BOXA 2W57A 3GF2A 3HOTA 2KJCA 4KIGA 2OD5A 1YTYA 2MD5A 2ZBKA 1YYVA 5FFZA 1KQ9A 4A6EA 4L9VA 2STTA 3VFZA 1C0WA 2QBYB 1GXPA 1RI7A 4L9JA 4OMZA 3JAMK 2IP2A 4AD9A 5DUIA 1P6RA 5D6FA 4M9XA 4HOBA 2HFHA 2LDUA 2WTEA 4CDGA 4IHSA 5BQTA 1FSEA 1MD0A 2J5OA 2FXAA 2Z3YA 4U88A 1FYMA 5D5VB 4MTEA 1X3UA 4BQAA 1BI0A 3GUDA 4PZJA 1UHWA 2H6BA 4IXAA 3GFIA 3TOAA 3O3KA 5DV5A 4IRGA 4HQEA 5LBQA 4R8HA 2PN6A 3GFJA 2ACJA 3HSFA 2P7CB 4I01A 3RKWA 2YX4A 1FBQA 2IA2A 2OU2A 3E5XA 4EGZA 2EFPA 5DD8A 4LG0A 2RQPA 5E8GA 1D3YA 2FOKA 1G6NA 3ABTA 2LKPA 3ROUA 1FYLA 2BEOA 2FBHA 5L3EA 2EB7A 1I27A 1YLFA 1KQ8A 4EJVA 4RB3C 3U9GA 3GLXA 1G3TA 2XV4S 1K7AA 4HA8A 1S3JA 2V6CA 2EFQA 1ZRFA 5LEKA 5JVTA 1T39A 5F6FA 3VOEA 1ZGJA 3ZP5A 3I0TA 5A2QZ 2GAUA 3TO7A 1R22A 5CVVA 1J75A 1W7PD 2V1DA 2XAGA 2GZWA 3U1DA 3WGHA 1HW2A 3RKYA 1RZ4A 3E6DA 5H20A 1JHFA 2UWMA 4RGSA 3K1NA 3KP3A 5J8FA 5FGMA 3KZZA 2VC0A 4O5VA 1SFUA 2OAZA 3VEPA 3RPUA 2ISYA 4CZZA 2VOPA 4R1HA 1FYKA 2OBPA 3VODA 1XGOA 2ZCWA 2V1XA 3FXRA 2CQKA 4IHTA 1XCBA 1LDDA 2O61A 4PCQA 3LSTA 5D4SA 5KK1A 4Y17A 2DK5A 1IXCA 1T38A 2KKOA 1EH7A 1KA8A 3F23A 3HHGA 1IN4A 2GA1A 2O03A 3TGNA 5LGNA 1PUEE 1HKQA 1IAWA 4LFUA 2DW4A 3DQVC 1J0RA 3FF5A 4U0VA 1G3SA 2QQBA 2KIFA 3CO7C 1K78A 3REOA 2CSOA 4TV7A 4G7HF 2JSCA 1HSJA 5HDNA 4WK8F 2LF8A 3JSPA 4ESJA 5E18F 2UZKA 5AIQA 3C1DA 4GGGA 2DFIA 3MFKA 5L3BA 3SQNA 4DQ2A 2ELHA 2A5YB 1HKSA 2W25A 3Q9VA 4ZYEA 2DK8A 4HAMA 2K4JA 2KIMA 2QQAA 5EEHA 2P5LC 1BC8C 4A0ZA 4RGRA 4B09A 1ONVA 3CDHA 3CJNA 4IJAA 3HRUA 2ZXJA 2HS5A 1TNSA 3LWFA 3ZMTA 5H6RA 2PI0A 4RGUA 5BPIA 3TO6A 3F22A 1D8JA 4EJWA 6PAXA 5FB2A 3WTWC 2YR2A 5E8IA 3EETA 4L9NA 1OPCA 4ENNA 1ZG3A 3E97A 3WGGA 2LNBA 3WU1B 4Y15A 1FNNA 1B59A 2VBWA 3ZMVA 2V79A 2VE9A 4KUMA 2K02A 2PFBA 4L0ZB 1YFHA 4UXNA 4L5IA 1Z6RA 1MZBA 2D2WA 5JFRA 1ZRDA 1JXSA 4EJTA 1QO0D 4KFCA 2L4MA 3PQKA 1XCVA 1XDSA 2NYXA 5LRSA 4M9ZA 1LDJA 4WX9A 4XLNF 2XAQA 3I4PA 4LK1F 1XGNA 1ZLJA 3KEOA 3TDZC 3OV8A 2M8EA 2EV0A 2YPRA 2DO7A 2IA0A 3KP6A 1I1SA 3L9FA 1BI1A 4M71A 2W24A 3H3UA 2DTRA 5E20A 1OKRA 1ZG1A 1QGPA 4Q5SF 5LLQA 3JAMZ 2CO5A 1ZHFA 2PMUA 1YO5C 1GVJA 4LB5A 2KIUA 1P2FA 4XLPF 1ZREA 3V4GA 3ZQ7A 1ZARA 4KYWA 3P7NA 2OQGA 1LQ1A 5D5XB 5EEGA 4OIRF 2JPCA 3QAHA 3R60A 3HIFA 4P9FA 2P6SA 4YFKF 5D5WB 2HQRA 3SFZA 2QWWA 2Y0MA 2PEXA 4IPAA 1H9GA 5K5RA 3OOPA 3ZN0A 3KLNA 3NEUA 4HZFA 4KDPA 1KU9A 2HTSA 1W7PB 4H0EA 2Z5UA 3DPTA 5LEJA 2RC4A 1FX7A 1W4MA 2KRFA 1KGSA 3FWEA 4YG2F 3F21A 1IN8A 2HKXA 3KCCA 3TO9A 3HRTA 4HBLA 4IRIA 4UV8A 1H0MA 3C18A 3VB2A 2QM3A 2UXXA 4GYIA 2ZMEA 4KICA 5ICGA 3BZ6A 2JT1A 1XDUA 1Z91A 3DV8A 3NQOA 2ZFWA 2HGCA 2H6CA 4KIBA 3KP5A 2QLZA 3P9KA 3MEXA 3V8LA 4ENKA 1FY7A 1F4KA 2G7UA 3RPQA 2R7FA 3FHZA 4HLXA 1YQAA 4LG0B 4NQWA 1S7AA 2M45A 3SZTA 5JI6A 4KT5C 4UUVA 4LJZF 5ED4A 3QU3A 3J81Z 4MQ9F 4U0WA 3FM3A 1SMTA 2XGXA 1Y0UA 1ZGAA 3IKTA 2WWYA 3KZYA 4S05A 3HUGA 1LVAA 2LF7A 4ZYGA 2DPDA 3ECOA 1ZYRF 3ZMSA 4BHCA 3ZMDA 5F1RA 2Z33A 5HLIA 1UFMA 2GXGA 3QOPA 1O57A 3KLOA 3K2ZA 1KQ0A 1YW8A 3V8KA 5IT3A 5LHHA 4A0YA 3DXJF 3R6SA 3WTUC 3F3XA 2XIGA 2EFWA 1YS6A 3L09A 1CGPA 5F64A 1OYWA 1PP8F 5DCFA 5J8CA 5ILVA 1J9IA 4MNUA 1HKTA 1OYIA 1RUOA 3I59A 2H09A 3GW2A 2CFXA 2COMA 4BAYA 3S2WA 5D8LB 4HDVA 3GZ6A 3I64A 1Z1DA 5ERIA 3CO6C 2DU9A 2JRTA 4AWXB 1STZA 3IL2A 4KN7X 2DQLA 1TQIA 1WRJA 2D45A 2FE3A 5DD4A 2BE5F 1SFEA 4HF2A 2E1NA 2XAJA 1T98A 1O7LA 3GYHX 4Z2YA 3HYIA 1P4AA 1BN5A 4XSZF 3FX3A 1U6GA 1MJAA 3EYIA 1FBSA 3HOSA 1P92A 4KIFA 1K78B 1HW5A 4MGRA 2DPUA 5HS9A 1V3FA 1MDMA 1DP7P 1SD6A 1BI2A 3QP5A 1G3YA 1KYWA 2W85A 1S6LA 4PGGA 2O6GE 1KU3A 1IUYA 1S7OA 1IXSB 3B73A 1IRFA 3DFGA 1P4WA 5D6EA 3HRMA 2JZYA 5HS7A 3L00A 4AIKA 3MZHA 2QENA 3E6CC 2KJBA 1F9NA 5ICEA 1D5VA 4HYEA 4A0XA 3R0JA 1TBXA 1RIOH 1R1VA 3P9CA 4HX4A 1SD7A 1S29A 1U5TA 1MGTA 2QQ9A 1Z9CA 3W6JB 4G94A 3ZN1A 2PQ8A 3J81K 4QWQA 4LLNA 4LGWA 4L18B 3WU0A 3EUHA 3WTTC 1R00A 2IVMA 1U5TC 4UHTA 1R5GA 2EJRA 4CHUA 1BC7C 5DUKA 4I0AA 2A6HF 2ZJ2A 2RDPA 5TJJA 1XD7A 2BGCA 3JSOA 4EGYA 1NHAA 5IT9Z 2F5CA 2NNYA 1IXRC 3PQJA 1B6AA 3WTYC 4ENMA 4I09A 4FX0A 3M7GA 2GIVA 1OR7A 4HF0A 2D1HA 2P6TA 1R1TA 3GEZA 4CYDA 1FPQA 4HX8A 4YIIA 3J7AO 5E1WA 4HV6A 2QYOA 5K5QA 2X4HA 2JPBA 2L3DA 1UCRA 4FHTA 3RJPA 3IC7A 4CGZA 3MAJA 3MCZA 1LJ9A 3L7WA 3DP7A 1FLIA 1HSTA 2WV0A 4RAYA 3WODF 5L3CA 1SFXA 2O8XA 4JQFA 5L3FA 4U0YA 3BPXA 2VBZA 4UNOA 4M6XA 3E6MA 1SD5A 1LEAA 1R7JA 2EFOA 2VT3A 3GFLA 2H27A 2XHKA 1BIAA 2QUFA 1FOKA 2ZO4A 2FNPA 1FT9A 4AIHA 5FD6A 3I58A 4BHPA 2CYYA 3LQRA 2M30A 2RN7A 1HXDA 1BIBA 1W5SA 4HX7A 4HF1A 1WI9A 4HDUA 3HTUA 4O6JA 2EV5A 4R79A 2D1VA 1JE8A 3DKWA 3RYPA 1RUNA 3F8NA 3FZVA 4UVCA 4I98B 1WQ2A 3TOBA 1XB4A 3O2PE 4IVNA 3DEUA 3V7CA 2BYVE 2NNNA 3Q9SA 4BHBA 3QPHA 1BOAA 1UHMA 1XSXA 2LSOA 4E70A 1YW9A 3COAC 1QQIA 5HLGA 3T1BA 3GX4X 1A04A 1XGSA 4HW0A 1FZPB 3KEQA 3IRQA 1QPMA 4Q4ZF 2ZMEB 5K5OA 4A6DA 3D5LA 5FLXK 1IW7F 3RTRA 3IHUA 2IRFG 2XRNA 4A5MA 3O6BB 4GO1A 2DLLA 4OU0A 4WXHA 4ETSA 3RI4A 3E5UA 2HZTA 4IF4A 1GHCA 4F7ZA 4BXUA 1I5ZA 1U8RA 1UB9A 1USTA 1U78A 2XROA 2HWVA 5IT9K 1XMAA 2TDXA 2P5VA 4O3MA 1QBJA 3QPTA 3BJ6A 2OQRA 5DCMA 3T8TA 2Y48A 3KP4A 3BWGA 1DPRA 1DDNA 1QZYA 3FXUA 3I53A 1J59A 2L02A 3ZMZA 4KMFA 1I6XA 5H6QA 3WG9A 1F5TA 2Q2EA 3WGIA 1WSUA 2P7VB 1BJAA 2HOEA 3SHFA 3TDUC 1MJBA 3M1EA 4RAZA 1BM9A 1HQCA 5DEQA 1Q1HA 3ML6A 1USSA 1EV7A 2CG4A 3IRRA 4WF2A 5JR3A 1ZH5A 2MLKA 1IZ1A 3Q5FA 2WC2A 2E7XA 4YFXF 2VE8A 2W84A 4K2EA 2GXBA 2Q0OA 3HSRA 4PGHA 5LGTA 4LMYA 2CW0F 1EH8A 3SXYA 4AVPA 1TQPA 3ZMUA 3QRFF 3I59B 1DPUA 3FMQA 1IN5A 2YSRA 2MC3A 2XAHA 2VBYA 3F72A 1DUXC 2ZNYA 4Q47A 5L3DA 4A12A 1F1ZA 1G4DA 4PDKA 5ICCA 2GWRA 3M8EA 1V4RA 1JHHA 1JGSA 1O3RA 1U2WA 4OMYA 4MHGA 3G3ZA 3RIRA 3FXQA 4UVBA 3BY6A 4EM0B 5CVRA 2L01A 2A68F 3WTXC 2STWA 2Y75A 1LEBA 3J80Z 5KVRA 2PLYA 4P5OA 3LA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDM B;  3BJA A;  2VN2 A;  2M1B A;  4RB0 A;  5HDG A;  1SAX A;  4BNC A;  5CYV A;  4HV5 A;  3JTH A;  4S04 A;  3E5Q A;  4ZYH A;  2RVC A;  4GCV A;  3V7R A;  4BYY A;  2GQQ A;  2X0L A;  4EVI A;  4LLL A;  2NAZ A;  2MA3 A;  3CUO A;  4ASN A;  5CJ9 A;  5HDK A;  2C6Y A;  2XKO A;  3R0A A;  4M74 A;  4KA4 A;  1KU2 A;  3BJO A;  1XMK A;  1J2X A;  3AAF A;  2ESN A;  2EV6 A;  4XBF A;  4QLC U;  4FT8 A;  3DF8 A;  3F8B A;  2R3S A;  3N4M A;  1XN7 A;  1FBU A;  1WKM A;  3F8F A;  1HBX G;  1U5T B;  1MJ9 A;  3IKV A;  2FBI A;  3IWZ A;  3RYR A;  1IF1 A;  2PG4 A;  4ZYD A;  3LFK A;  4RGX A;  3WE2 A;  5FD5 A;  2ISZ A;  4D0P A;  2XVC A;  4KMU X;  1HW1 A;  1J5Y A;  4OIP F;  3ZPL A;  1YS7 A;  2OA4 A;  2V1U A;  3QP6 A;  4LLG F;  1S8N A;  3CUQ A;  3F8C A;  3HTS B;  2O3F A;  2DQR A;  2J5P A;  3MWM A;  3TKY A;  2K86 A;  4L5J A;  3ULQ B;  4YIF A;  4ESB A;  1CF7 A;  1FP1 D;  1K6O A;  5HVQ C;  1XSV A;  2M5W A;  3CUQ C;  4JBA A;  4I02 A;  1R1U A;  4ENJ A;  4OOI A;  2E7W A;  3RKX A;  3LQQ A;  2MH9 A;  2IA1 A;  2F5D A;  5L3G A;  3JTG A;  1D8K A;  2PJP A;  1FC3 A;  1WWX A;  2XAS A;  3CLO A;  3I71 A;  2A61 A;  4KN4 X;  1REP C;  4G6Q A;  4WXD A;  4IRH A;  2VBX A;  2CWE A;  4MEY F;  1ON1 A;  2P5K A;  1YIO A;  5HLH A;  3RDI A;  3GFM A;  3K1P A;  2B0L A;  1FSH A;  3K9T A;  4HLY A;  2AS5 F;  1H9T A;  5D5U B;  1BI3 A;  4ZZL A;  2IT0 A;  1TLH B;  2QBY A;  4U7D A;  1FWZ A;  2QZ8 A;  2F2E A;  3QU6 A;  1R36 A;  1TW2 A;  4M73 A;  5HS8 A;  4G9Y A;  1K79 A;  1YW7 A;  2VC1 A;  5FLX Z;  3F6V A;  2Q8K A;  3J80 K;  2FBK A;  4JK1 X;  4U7B A;  4CO8 A;  4EV0 A;  4M6Y A;  3CTA A;  3H92 A;  3LAJ A;  5E1X A;  2DBB A;  3BP8 A;  4EMS A;  5BS6 A;  3W6K B;  3KET A;  2EK5 A;  2L54 A;  3BPV A;  2ESH A;  5J6X A;  2MBF A;  3ISP A;  5ICF A;  4FX4 A;  3ECH A;  2A6E F;  5JHU A;  4I2O A;  1B9M A;  1EH6 A;  1E17 A;  2FMY A;  2VON A;  1I1G A;  2PBI A;  3ELK A;  3C3W A;  5K1Y A;  2CGP A;  2IW5 A;  2MH2 A;  2YU3 A;  4EJU A;  2ZNZ A;  1XGM A;  2XUB A;  3E3V A;  2XAF A;  2M87 A;  4M9S A;  3FM5 A;  2HEO A;  5E17 F;  1TQM A;  4OIQ F;  3LA2 A;  4I7H A;  1ZRC A;  4LD5 A;  4N9H A;  4UVA A;  4MEX F;  3MQ0 A;  3WTZ A;  2OZU A;  2RNJ A;  3KP2 A;  2FNA A;  1B4A A;  3M8F A;  3I5U A;  1L3L A;  3T5X A;  3B02 A;  4EJO A;  1SD4 A;  1R5H A;  2RKH A;  1E2X A;  1J7K A;  3GZ5 A;  4NHJ A;  2FQ3 A;  3C7J A;  3P9I A;  1P4X A;  2G7H A;  4G6D A;  3TQN A;  2HKO A;  3BRO A;  5ILU A;  1W5T A;  2QVO A;  5FFX A;  4A5N A;  4G7O F;  2P4W A;  3HRS A;  1PP7 U;  1R23 A;  3GO5 A;  2HDC A;  5DCM B;  1QZZ A;  5FO5 A;  1RNL A;  2K27 A;  2Z99 A;  3SZP A;  1IN6 A;  2HYG D;  5BPD A;  1T2K A;  5E1Z B;  4N9I A;  1U3E M;  5D8K B;  1T6S A;  2O0Y A;  2A07 F;  1O3S A;  5BMZ A;  3HSE A;  4LB6 B;  5AIP A;  4M72 A;  1LNW A;  4MQV A;  2RV8 A;  1ZLK A;  4WXC A;  1ZG5 A;  2PMH A;  5A2Q K;  1FP2 A;  4WWC A;  4EQQ A;  5HOO A;  2NS0 A;  2VOD A;  2ADU A;  4ON0 A;  4KNY A;  1TTY A;  2A69 F;  3U2R A;  4Y13 A;  3H3Z A;  1TNT A;  1LDK B;  4YFN F;  4L9T A;  3JW4 A;  4P9U A;  1B9N A;  3HHH A;  3ABU A;  3EYY A;  4AIJ A;  2K7L A;  4XRF A;  2K4B A;  2EA2 A;  5DYM A;  2F5E A;  3DPL C;  1ZAO A;  2L4A A;  2VT2 A;  4I0B A;  1Z6T A;  1L0O C;  4XSX F;  1IN7 A;  1SMY F;  3GVA A;  1R58 A;  2HQN A;  3KFW X;  2E1C A;  1Z7U A;  3T8R A;  3ERE D;  2AXL A;  5CVJ A;  4ESF A;  4RB2 C;  4B8X A;  3E6B A;  2BBY A;  2JTV A;  1BBY A;  5CVU A;  2OZ6 A;  2IPQ X;  3LAP A;  3K0L A;  1PDN C;  3WE3 A;  1Z05 A;  4GXO A;  5LRR A;  2EFN A;  3KE2 A;  2R7D A;  2HYF A;  3F8M A;  2H94 A;  1ZN2 A;  4G7Z F;  1OYY A;  3T0Y A;  5LGU A;  3K1M A;  1T0F A;  1IRG A;  4RS8 A;  2FML A;  4DNC A;  3V7S A;  1XSD A;  4EM2 A;  4A2U A;  3NRV A;  3LA3 A;  3MZY A;  4CIC A;  4N0B A;  2FSW A;  4MTD A;  3L2C A;  5CVI A;  4EM1 A;  1YG2 A;  3KP7 A;  4OIN F;  2YX7 A;  4NB5 A;  2FRH A;  3I54 A;  5D4R A;  1B1B A;  3WTV C;  5CLS A;  1ULY A;  1O3T A;  2P8T A;  1QNT A;  3FMS A;  1ON2 A;  2BV6 A;  2GA2 A;  5TRD A;  1G3W A;  2Z9O A;  3D0S A;  3N97 A;  3R61 A;  4ZH4 F;  3GXO A;  1GXQ A;  3EDP A;  3BDD A;  1VTN C;  1MKM A;  4RB1 A;  1AWC A;  1ODD A;  4ZZD A;  2DAO A;  3G73 A;  3FMR A;  2F5F A;  3R4K A;  5LHG A;  2EA4 A;  2ETH A;  4OIO F;  2FU4 A;  2DI3 A;  2VXZ A;  1TW3 A;  2RGV A;  2UXN A;  3PFI A;  5LHI A;  2HR3 A;  2VOO A;  4Q48 A;  3CUQ B;  3F6O A;  2XKP A;  3WTS C;  2IJL A;  3GWZ A;  1O7F A;  3EQL F;  2FEZ A;  2DT5 A;  2FF4 A;  2FA5 A;  3BOQ A;  5DDG A;  4P55 A;  1CF7 B;  3K69 A;  3IWF A;  4L0Y B;  2V9V A;  1KYZ A;  4BH9 A;  4WCG A;  4GYG A;  4CXF A;  4P96 A;  4HQM A;  5AON A;  2HTJ A;  1AOY A;  2EWN A;  4G8X A;  2MLG A;  5ILS A;  3M9A A;  2NRA C;  3V8J A;  1LB2 A;  1KU7 A;  4UV9 A;  2A3S A;  1OMI A;  2ZKZ A;  1W7P A;  1O3Q A;  4LK0 F;  2G9W A;  5BOX A;  2W57 A;  3GF2 A;  3HOT A;  2KJC A;  4KIG A;  2OD5 A;  1YTY A;  2MD5 A;  2ZBK A;  1YYV A;  5FFZ A;  1KQ9 A;  4A6E A;  4L9V A;  2STT A;  3VFZ A;  1C0W A;  2QBY B;  1GXP A;  1RI7 A;  4L9J A;  4OMZ A;  3JAM K;  2IP2 A;  4AD9 A;  5DUI A;  1P6R A;  5D6F A;  4M9X A;  4HOB A;  2HFH A;  2LDU A;  2WTE A;  4CDG A;  4IHS A;  5BQT A;  1FSE A;  1MD0 A;  2J5O A;  2FXA A;  2Z3Y A;  4U88 A;  1FYM A;  5D5V B;  4MTE A;  1X3U A;  4BQA A;  1BI0 A;  3GUD A;  4PZJ A;  1UHW A;  2H6B A;  4IXA A;  3GFI A;  3TOA A;  3O3K A;  5DV5 A;  4IRG A;  4HQE A;  5LBQ A;  4R8H A;  2PN6 A;  3GFJ A;  2ACJ A;  3HSF A;  2P7C B;  4I01 A;  3RKW A;  2YX4 A;  1FBQ A;  2IA2 A;  2OU2 A;  3E5X A;  4EGZ A;  2EFP A;  5DD8 A;  4LG0 A;  2RQP A;  5E8G A;  1D3Y A;  2FOK A;  1G6N A;  3ABT A;  2LKP A;  3ROU A;  1FYL A;  2BEO A;  2FBH A;  5L3E A;  2EB7 A;  1I27 A;  1YLF A;  1KQ8 A;  4EJV A;  4RB3 C;  3U9G A;  3GLX A;  1G3T A;  2XV4 S;  1K7A A;  4HA8 A;  1S3J A;  2V6C A;  2EFQ A;  1ZRF A;  5LEK A;  5JVT A;  1T39 A;  5F6F A;  3VOE A;  1ZGJ A;  3ZP5 A;  3I0T A;  5A2Q Z;  2GAU A;  3TO7 A;  1R22 A;  5CVV A;  1J75 A;  1W7P D;  2V1D A;  2XAG A;  2GZW A;  3U1D A;  3WGH A;  1HW2 A;  3RKY A;  1RZ4 A;  3E6D A;  5H20 A;  1JHF A;  2UWM A;  4RGS A;  3K1N A;  3KP3 A;  5J8F A;  5FGM A;  3KZZ A;  2VC0 A;  4O5V A;  1SFU A;  2OAZ A;  3VEP A;  3RPU A;  2ISY A;  4CZZ A;  2VOP A;  4R1H A;  1FYK A;  2OBP A;  3VOD A;  1XGO A;  2ZCW A;  2V1X A;  3FXR A;  2CQK A;  4IHT A;  1XCB A;  1LDD A;  2O61 A;  4PCQ A;  3LST A;  5D4S A;  5KK1 A;  4Y17 A;  2DK5 A;  1IXC A;  1T38 A;  2KKO A;  1EH7 A;  1KA8 A;  3F23 A;  3HHG A;  1IN4 A;  2GA1 A;  2O03 A;  3TGN A;  5LGN A;  1PUE E;  1HKQ A;  1IAW A;  4LFU A;  2DW4 A;  3DQV C;  1J0R A;  3FF5 A;  4U0V A;  1G3S A;  2QQB A;  2KIF A;  3CO7 C;  1K78 A;  3REO A;  2CSO A;  4TV7 A;  4G7H F;  2JSC A;  1HSJ A;  5HDN A;  4WK8 F;  2LF8 A;  3JSP A;  4ESJ A;  5E18 F;  2UZK A;  5AIQ A;  3C1D A;  4GGG A;  2DFI A;  3MFK A;  5L3B A;  3SQN A;  4DQ2 A;  2ELH A;  2A5Y B;  1HKS A;  2W25 A;  3Q9V A;  4ZYE A;  2DK8 A;  4HAM A;  2K4J A;  2KIM A;  2QQA A;  5EEH A;  2P5L C;  1BC8 C;  4A0Z A;  4RGR A;  4B09 A;  1ONV A;  3CDH A;  3CJN A;  4IJA A;  3HRU A;  2ZXJ A;  2HS5 A;  1TNS A;  3LWF A;  3ZMT A;  5H6R A;  2PI0 A;  4RGU A;  5BPI A;  3TO6 A;  3F22 A;  1D8J A;  4EJW A;  6PAX A;  5FB2 A;  3WTW C;  2YR2 A;  5E8I A;  3EET A;  4L9N A;  1OPC A;  4ENN A;  1ZG3 A;  3E97 A;  3WGG A;  2LNB A;  3WU1 B;  4Y15 A;  1FNN A;  1B59 A;  2VBW A;  3ZMV A;  2V79 A;  2VE9 A;  4KUM A;  2K02 A;  2PFB A;  4L0Z B;  1YFH A;  4UXN A;  4L5I A;  1Z6R A;  1MZB A;  2D2W A;  5JFR A;  1ZRD A;  1JXS A;  4EJT A;  1QO0 D;  4KFC A;  2L4M A;  3PQK A;  1XCV A;  1XDS A;  2NYX A;  5LRS A;  4M9Z A;  1LDJ A;  4WX9 A;  4XLN F;  2XAQ A;  3I4P A;  4LK1 F;  1XGN A;  1ZLJ A;  3KEO A;  3TDZ C;  3OV8 A;  2M8E A;  2EV0 A;  2YPR A;  2DO7 A;  2IA0 A;  3KP6 A;  1I1S A;  3L9F A;  1BI1 A;  4M71 A;  2W24 A;  3H3U A;  2DTR A;  5E20 A;  1OKR A;  1ZG1 A;  1QGP A;  4Q5S F;  5LLQ A;  3JAM Z;  2CO5 A;  1ZHF A;  2PMU A;  1YO5 C;  1GVJ A;  4LB5 A;  2KIU A;  1P2F A;  4XLP F;  1ZRE A;  3V4G A;  3ZQ7 A;  1ZAR A;  4KYW A;  3P7N A;  2OQG A;  1LQ1 A;  5D5X B;  5EEG A;  4OIR F;  2JPC A;  3QAH A;  3R60 A;  3HIF A;  4P9F A;  2P6S A;  4YFK F;  5D5W B;  2HQR A;  3SFZ A;  2QWW A;  2Y0M A;  2PEX A;  4IPA A;  1H9G A;  5K5R A;  3OOP A;  3ZN0 A;  3KLN A;  3NEU A;  4HZF A;  4KDP A;  1KU9 A;  2HTS A;  1W7P B;  4H0E A;  2Z5U A;  3DPT A;  5LEJ A;  2RC4 A;  1FX7 A;  1W4M A;  2KRF A;  1KGS A;  3FWE A;  4YG2 F;  3F21 A;  1IN8 A;  2HKX A;  3KCC A;  3TO9 A;  3HRT A;  4HBL A;  4IRI A;  4UV8 A;  1H0M A;  3C18 A;  3VB2 A;  2QM3 A;  2UXX A;  4GYI A;  2ZME A;  4KIC A;  5ICG A;  3BZ6 A;  2JT1 A;  1XDU A;  1Z91 A;  3DV8 A;  3NQO A;  2ZFW A;  2HGC A;  2H6C A;  4KIB A;  3KP5 A;  2QLZ A;  3P9K A;  3MEX A;  3V8L A;  4ENK A;  1FY7 A;  1F4K A;  2G7U A;  3RPQ A;  2R7F A;  3FHZ A;  4HLX A;  1YQA A;  4LG0 B;  4NQW A;  1S7A A;  2M45 A;  3SZT A;  5JI6 A;  4KT5 C;  4UUV A;  4LJZ F;  5ED4 A;  3QU3 A;  3J81 Z;  4MQ9 F;  4U0W A;  3FM3 A;  1SMT A;  2XGX A;  1Y0U A;  1ZGA A;  3IKT A;  2WWY A;  3KZY A;  4S05 A;  3HUG A;  1LVA A;  2LF7 A;  4ZYG A;  2DPD A;  3ECO A;  1ZYR F;  3ZMS A;  4BHC A;  3ZMD A;  5F1R A;  2Z33 A;  5HLI A;  1UFM A;  2GXG A;  3QOP A;  1O57 A;  3KLO A;  3K2Z A;  1KQ0 A;  1YW8 A;  3V8K A;  5IT3 A;  5LHH A;  4A0Y A;  3DXJ F;  3R6S A;  3WTU C;  3F3X A;  2XIG A;  2EFW A;  1YS6 A;  3L09 A;  1CGP A;  5F64 A;  1OYW A;  1PP8 F;  5DCF A;  5J8C A;  5ILV A;  1J9I A;  4MNU A;  1HKT A;  1OYI A;  1RUO A;  3I59 A;  2H09 A;  3GW2 A;  2CFX A;  2COM A;  4BAY A;  3S2W A;  5D8L B;  4HDV A;  3GZ6 A;  3I64 A;  1Z1D A;  5ERI A;  3CO6 C;  2DU9 A;  2JRT A;  4AWX B;  1STZ A;  3IL2 A;  4KN7 X;  2DQL A;  1TQI A;  1WRJ A;  2D45 A;  2FE3 A;  5DD4 A;  2BE5 F;  1SFE A;  4HF2 A;  2E1N A;  2XAJ A;  1T98 A;  1O7L A;  3GYH X;  4Z2Y A;  3HYI A;  1P4A A;  1BN5 A;  4XSZ F;  3FX3 A;  1U6G A;  1MJA A;  3EYI A;  1FBS A;  3HOS A;  1P92 A;  4KIF A;  1K78 B;  1HW5 A;  4MGR A;  2DPU A;  5HS9 A;  1V3F A;  1MDM A;  1DP7 P;  1SD6 A;  1BI2 A;  3QP5 A;  1G3Y A;  1KYW A;  2W85 A;  1S6L A;  4PGG A;  2O6G E;  1KU3 A;  1IUY A;  1S7O A;  1IXS B;  3B73 A;  1IRF A;  3DFG A;  1P4W A;  5D6E A;  3HRM A;  2JZY A;  5HS7 A;  3L00 A;  4AIK A;  3MZH A;  2QEN A;  3E6C C;  2KJB A;  1F9N A;  5ICE A;  1D5V A;  4HYE A;  4A0X A;  3R0J A;  1TBX A;  1RIO H;  1R1V A;  3P9C A;  4HX4 A;  1SD7 A;  1S29 A;  1U5T A;  1MGT A;  2QQ9 A;  1Z9C A;  3W6J B;  4G94 A;  3ZN1 A;  2PQ8 A;  3J81 K;  4QWQ A;  4LLN A;  4LGW A;  4L18 B;  3WU0 A;  3EUH A;  3WTT C;  1R00 A;  2IVM A;  1U5T C;  4UHT A;  1R5G A;  2EJR A;  4CHU A;  1BC7 C;  5DUK A;  4I0A A;  2A6H F;  2ZJ2 A;  2RDP A;  5TJJ A;  1XD7 A;  2BGC A;  3JSO A;  4EGY A;  1NHA A;  5IT9 Z;  2F5C A;  2NNY A;  1IXR C;  3PQJ A;  1B6A A;  3WTY C;  4ENM A;  4I09 A;  4FX0 A;  3M7G A;  2GIV A;  1OR7 A;  4HF0 A;  2D1H A;  2P6T A;  1R1T A;  3GEZ A;  4CYD A;  1FPQ A;  4HX8 A;  4YII A;  3J7A O;  5E1W A;  4HV6 A;  2QYO A;  5K5Q A;  2X4H A;  2JPB A;  2L3D A;  1UCR A;  4FHT A;  3RJP A;  3IC7 A;  4CGZ A;  3MAJ A;  3MCZ A;  1LJ9 A;  3L7W A;  3DP7 A;  1FLI A;  1HST A;  2WV0 A;  4RAY A;  3WOD F;  5L3C A;  1SFX A;  2O8X A;  4JQF A;  5L3F A;  4U0Y A;  3BPX A;  2VBZ A;  4UNO A;  4M6X A;  3E6M A;  1SD5 A;  1LEA A;  1R7J A;  2EFO A;  2VT3 A;  3GFL A;  2H27 A;  2XHK A;  1BIA A;  2QUF A;  1FOK A;  2ZO4 A;  2FNP A;  1FT9 A;  4AIH A;  5FD6 A;  3I58 A;  4BHP A;  2CYY A;  3LQR A;  2M30 A;  2RN7 A;  1HXD A;  1BIB A;  1W5S A;  4HX7 A;  4HF1 A;  1WI9 A;  4HDU A;  3HTU A;  4O6J A;  2EV5 A;  4R79 A;  2D1V A;  1JE8 A;  3DKW A;  3RYP A;  1RUN A;  3F8N A;  3FZV A;  4UVC A;  4I98 B;  1WQ2 A;  3TOB A;  1XB4 A;  3O2P E;  4IVN A;  3DEU A;  3V7C A;  2BYV E;  2NNN A;  3Q9S A;  4BHB A;  3QPH A;  1BOA A;  1UHM A;  1XSX A;  2LSO A;  4E70 A;  1YW9 A;  3COA C;  1QQI A;  5HLG A;  3T1B A;  3GX4 X;  1A04 A;  1XGS A;  4HW0 A;  1FZP B;  3KEQ A;  3IRQ A;  1QPM A;  4Q4Z F;  2ZME B;  5K5O A;  4A6D A;  3D5L A;  5FLX K;  1IW7 F;  3RTR A;  3IHU A;  2IRF G;  2XRN A;  4A5M A;  3O6B B;  4GO1 A;  2DLL A;  4OU0 A;  4WXH A;  4ETS A;  3RI4 A;  3E5U A;  2HZT A;  4IF4 A;  1GHC A;  4F7Z A;  4BXU A;  1I5Z A;  1U8R A;  1UB9 A;  1UST A;  1U78 A;  2XRO A;  2HWV A;  5IT9 K;  1XMA A;  2TDX A;  2P5V A;  4O3M A;  1QBJ A;  3QPT A;  3BJ6 A;  2OQR A;  5DCM A;  3T8T A;  2Y48 A;  3KP4 A;  3BWG A;  1DPR A;  1DDN A;  1QZY A;  3FXU A;  3I53 A;  1J59 A;  2L02 A;  3ZMZ A;  4KMF A;  1I6X A;  5H6Q A;  3WG9 A;  1F5T A;  2Q2E A;  3WGI A;  1WSU A;  2P7V B;  1BJA A;  2HOE A;  3SHF A;  3TDU C;  1MJB A;  3M1E A;  4RAZ A;  1BM9 A;  1HQC A;  5DEQ A;  1Q1H A;  3ML6 A;  1USS A;  1EV7 A;  2CG4 A;  3IRR A;  4WF2 A;  5JR3 A;  1ZH5 A;  2MLK A;  1IZ1 A;  3Q5F A;  2WC2 A;  2E7X A;  4YFX F;  2VE8 A;  2W84 A;  4K2E A;  2GXB A;  2Q0O A;  3HSR A;  4PGH A;  5LGT A;  4LMY A;  2CW0 F;  1EH8 A;  3SXY A;  4AVP A;  1TQP A;  3ZMU A;  3QRF F;  3I59 B;  1DPU A;  3FMQ A;  1IN5 A;  2YSR A;  2MC3 A;  2XAH A;  2VBY A;  3F72 A;  1DUX C;  2ZNY A;  4Q47 A;  5L3D A;  4A12 A;  1F1Z A;  1G4D A;  4PDK A;  5ICC A;  2GWR A;  3M8E A;  1V4R A;  1JHH A;  1JGS A;  1O3R A;  1U2W A;  4OMY A;  4MHG A;  3G3Z A;  3RIR A;  3FXQ A;  4UVB A;  3BY6 A;  4EM0 B;  5CVR A;  2L01 A;  2A68 F;  3WTX C;  2STW A;  2Y75 A;  1LEB A;  3J80 Z;  5KVR A;  2PLY A;  4P5O A;  3LA7 A; 
#chains in the Genus database with same CATH topology
 3E0J B;  1UMQ A;  5F04 A;  1MDM B;  3BJA A;  2X1D A;  4CCK A;  2VN2 A;  2M1B A;  4RB0 A;  3BCB A;  2VQC A;  5HDG A;  4BQN A;  2IS1 A;  3AG1 H;  1S72 I;  3DU6 A;  4UUS A;  1SAX A;  3I56 I;  2PJR A;  4DW6 A;  4BNC A;  3FXL A;  5CYV A;  4HV5 A;  2M0C A;  3JTH A;  4S04 A;  1EF4 A;  3E5Q A;  2AO9 A;  4ZYH A;  2RVC A;  3I3L A;  5J1U A;  4GCV A;  2HVR A;  3V7R A;  3MKL A;  4BYY A;  2GQQ A;  2X0L A;  4EVI A;  3BTL A;  3MZ8 A;  4LLL A;  1PUF A;  4A3I J;  1HOM A;  2NAZ A;  2JK3 A;  2MA3 A;  3CUO A;  4BAC A;  2LY2 A;  5CJ9 A;  4ASN A;  3S3M A;  5HDK A;  2C6Y A;  2XKO A;  2VKH A;  3R0A A;  2OTL I;  4M74 A;  4KA4 A;  3RQI A;  1KU2 A;  3M4O J;  3BJO A;  1XMK A;  4NC7 A;  1J2X A;  3AAF A;  2KLO A;  1MMS A;  2ESN A;  1MMG A;  2EV6 A;  4XBF A;  4QLC U;  4FT8 A;  2VUM J;  3DF8 A;  5M3F J;  4Z6Y A;  3F8B A;  3CJT B;  2X1C A;  2DA2 A;  2R3S A;  2GM4 A;  3N4M A;  1XN7 A;  3HB9 A;  1LUJ B;  1FBU A;  1WKM A;  1HLV A;  1GVD A;  3F8F A;  1HBX G;  4A93 J;  1U5T B;  4ABZ A;  1MJ9 A;  2A5W A;  3IKV A;  2FBI A;  5LFA A;  5IP7 J;  2VQL A;  1QHH D;  3WHB A;  3IWZ A;  3RYR A;  1IF1 A;  1MBF A;  2PG4 A;  4ZYD A;  1K4S A;  2JA7 J;  3LFK A;  4RGX A;  3WE2 A;  5FD5 A;  4RLF A;  2BY1 A;  4FCY A;  1OCO H;  2ISZ A;  4D0P A;  4HNT A;  2XVC A;  4KMU X;  1HW1 A;  1J5Y A;  4Y33 A;  4OIP F;  2AHQ A;  4KT6 A;  5EF6 A;  1IDY A;  3ZPL A;  1MBK A;  1YS7 A;  3ZRG A;  2JA6 J;  2XB5 A;  2E1M C;  2OA4 A;  2V1U A;  2QSH X;  4F93 B;  1DGR M;  3QP6 A;  4XLE A;  2VPL A;  4LLG F;  1S8N A;  3CUQ A;  3LSJ A;  3F8C A;  2XF7 A;  3HTS B;  2O3F A;  2DQR A;  2J5P A;  2W1O A;  2LFB A;  4C2M J;  2HXO A;  5KNL A;  4AC0 A;  3MWM A;  4N4N B;  3A02 A;  3TKY A;  2K86 A;  4L5J A;  1MND A;  3ULQ B;  3X2Q H;  2ELJ A;  4YIF A;  4ESB A;  1CF7 A;  3HL2 A;  1FP1 D;  1K6O A;  3S1N J;  3FXJ A;  4XLC A;  5HVQ C;  1XSV A;  2M5W A;  3CUQ C;  3I9V 2;  5GAH J;  2CV0 A;  4I99 C;  4JBA A;  4I02 A;  1R1U A;  4ENJ A;  4OOI A;  2E7W A;  4X6A J;  3RKX A;  4XM3 A;  3LQQ A;  2EZH A;  1V5F A;  2MH9 A;  2IA1 A;  5IP6 A;  2F5D A;  2ZJP F;  5L3G A;  3JTG A;  1HDP A;  1D8K A;  5TIS C;  2PJP A;  1FC3 A;  1WWX A;  2L9S A;  2XAS A;  3CLO A;  4MIM A;  3I71 A;  2K9Q A;  1DQU A;  2A61 A;  4BE2 A;  4KN4 X;  4LIT A;  1X1D A;  1REP C;  1RKT A;  4G6Q A;  2KDO A;  4WXD A;  4IRH A;  4E7I A;  1AHD P;  4JP0 A;  3PFY A;  2VBX A;  5IYD J;  1RET A;  2CWE A;  2DT6 A;  4MEY F;  1ON1 A;  1TWG J;  2P5K A;  4CCL A;  1A6Q A;  1YIO A;  5FKO A;  5HLH A;  3H5A A;  3OYJ A;  4Y7N J;  3RDI A;  1RPW A;  3GFM A;  3OYN A;  3K1P A;  5K7H A;  2NVQ J;  2B0L A;  2E35 A;  1FSH A;  3K9T A;  4OWR B;  3VYU B;  4HLY A;  1WJ5 A;  2AS5 F;  1UAA A;  1H9T A;  4B4C A;  2H1L A;  1BA5 A;  2VL8 A;  5D5U B;  1BI3 A;  3E7L A;  1DU0 A;  4ZZL A;  2IT0 A;  2JWT A;  1JJ8 C;  1X1P A;  5E79 C;  1TLH B;  1RR8 C;  2NXN B;  1R6R A;  4A3K J;  4U7D A;  1FWZ A;  2DA4 A;  2QBY A;  2QZ8 A;  2OV7 A;  2F2E A;  1I39 A;  3QU6 A;  3CP2 A;  1R36 A;  1TW2 A;  4M73 A;  5HS8 A;  3HGG A;  5B5E C;  4G9Y A;  1K79 A;  3CJQ B;  5EJC A;  1YW7 A;  4B44 A;  3G2B A;  1YJ9 I;  2VC1 A;  3IUO A;  5FLX Z;  2GOM A;  3BR1 A;  3F6V A;  2Q8K A;  3S3N A;  3J80 K;  4BJ5 C;  5FRN A;  4B48 A;  2WA0 A;  1SVO A;  2FBK A;  4JK1 X;  4U7B A;  4N4O B;  3Q0U A;  4IHV A;  4CO8 A;  4PJN A;  4EV0 A;  4M6Y A;  3CTA A;  3H92 A;  3LAJ A;  2KFD A;  4LOC A;  5E1X A;  2DBB A;  3BP8 A;  4EMS A;  5BS6 A;  3W6K B;  3KET A;  1EKE A;  2EK5 A;  3L2Q A;  2L54 A;  4C9Y A;  3BG7 A;  3BPV A;  2ESH A;  5J6X A;  5FKM A;  3CCJ I;  2MBF A;  3VWB A;  3ISP A;  2EZK A;  4DBQ A;  5ICF A;  4FX4 A;  3ECH A;  2BXY A;  4M6V A;  2A6E F;  4OAY A;  4BY7 J;  4D7M A;  4C30 A;  5JHU A;  4I2O A;  1B9M A;  2DMT A;  1EH6 A;  1E17 A;  2FMY A;  2VON A;  3W2V A;  5B1A H;  3J7A Y;  4RMN A;  4NC6 A;  1I1G A;  3W6V A;  3LSG A;  2PBI A;  4XIC A;  3ELK A;  3C3W A;  1X2M A;  1GUU A;  3Q0V A;  5K1Y A;  2CGP A;  2M3A A;  2IW5 A;  2MH2 A;  2YU3 A;  2Y9Y A;  2QF7 A;  4EJU A;  1Z3Y A;  2ZNZ A;  2KZG A;  1XGM A;  2XUB A;  2V7F A;  4M3G A;  3E3V A;  2XAF A;  4ZTJ A;  2JMW A;  2M87 A;  2UV1 A;  4M9S A;  2X9D A;  3FM5 A;  2HEO A;  5E17 F;  3A4C A;  1YIT I;  1TQM A;  3UR3 C;  5KHD A;  4OIQ F;  3LA2 A;  2XSD C;  4XN0 A;  4I7H A;  2DTZ A;  1ZRC A;  3OYB A;  3BCA A;  4LD5 A;  4N9H A;  4UVA A;  4MEX F;  3V42 A;  3MQ0 A;  1FIP A;  2G0E A;  3WTZ A;  4BDZ A;  2OZU A;  2RNJ A;  3KP2 A;  1MBG A;  4E7J A;  5E3L A;  4CCM A;  2FNA A;  1B4A A;  1D1B A;  1G59 A;  3M8F A;  2CW7 A;  3I5U A;  1L3L A;  3T5X A;  2QQ8 A;  4ZDL A;  1WJD A;  2R7T A;  3B02 A;  1LE8 B;  4EJO A;  1SD4 A;  5FKN A;  1WJC A;  2WY7 Q;  1R5H A;  2RKH A;  4A3E J;  5F0C A;  2HXI A;  1E2X A;  3AKZ A;  1J7K A;  3GZ5 A;  3CDL A;  5EG0 A;  4NHJ A;  1RES A;  1JJ6 C;  2NVX J;  5F1J A;  3CDI A;  1D1C A;  2FQ3 A;  2JVH A;  3C7J A;  3P9I A;  2DOA A;  1P4X A;  2G7H A;  4G6D A;  2W7N A;  1SVL A;  3TQN A;  3M1C A;  2HKO A;  3BRO A;  5ILU A;  1W5T A;  2QVO A;  5FFX A;  2R7U A;  4A5N A;  4G7O F;  2Z16 A;  5E3N A;  5HLT A;  2P4W A;  3HRS A;  1PP7 U;  1R23 A;  3GO5 A;  4PJM A;  2HDC A;  5DCM B;  1ZTR A;  3CME I;  4HST A;  1QZZ A;  5FO5 A;  1RNL A;  2K27 A;  1T33 A;  2Z99 A;  3SZP A;  1GV5 A;  1IN6 A;  1K6Y A;  2DA3 A;  2HYG D;  4F55 A;  5BPD A;  1T2K A;  2Q2E B;  5E1Z B;  2QA4 I;  3ZQC A;  4N9I A;  1U3E M;  1BL0 A;  2KDZ A;  5D8K B;  2X6Y A;  1XG1 A;  1T6S A;  3H5N A;  3CD6 I;  5H2F C;  2O0Y A;  2A07 F;  3DLL F;  1O3S A;  1X19 A;  5HNF A;  5BMZ A;  2QCO A;  2XSJ C;  4DGW B;  1Z0X A;  3HSE A;  1FMV A;  4LB6 B;  5AIP A;  1MIJ A;  4BE0 A;  1I6H J;  5C4X J;  4S0H B;  4HRI A;  4M72 A;  1LNW A;  2KPM A;  2RV8 A;  4MQV A;  2Y0S A;  4PFO A;  2DFE A;  1ZLK A;  3ESW B;  4WXC A;  1ZGW A;  3PO3 J;  1ZG5 A;  3LSI A;  1S5L C;  2B9S A;  2M8G X;  2PMH A;  5A2Q K;  1FP2 A;  2MYS A;  4YEL A;  4A69 C;  4EQQ A;  4WWC A;  4QPQ A;  4FTH A;  3BR6 A;  3I4M J;  2XPW A;  5HOO A;  2NS0 A;  3OIO A;  4NC8 A;  2VOD A;  2ADU A;  4ON0 A;  4KNY A;  3TW7 A;  3AL0 B;  4JX6 A;  3S93 A;  1TTY A;  3PM1 A;  2A69 F;  3U2R A;  4ZYA A;  3H3Z A;  1TNT A;  4Y13 A;  4HNU A;  1VQ9 I;  1FTT A;  5TGT A;  1TC3 C;  1LDK B;  4YFN F;  3HKZ N;  3OOU A;  4L9T A;  3JW4 A;  4P9U A;  1ZEL A;  3OSG A;  1B9N A;  4BE1 A;  3HHH A;  3C2H A;  1GDT A;  1XPX A;  3ABU A;  3J7Y J;  1U9O A;  3EYY A;  4AIJ A;  2K7L A;  2BY3 A;  2R5Y A;  4XRF A;  2K4B A;  3DTK A;  2CQ7 A;  3CMY A;  3RZO J;  3DKY A;  2EA2 A;  3DBR B;  4A3C J;  5DYM A;  2W82 A;  3VDX A;  2YU9 J;  2F5E A;  3DPL C;  1ZAO A;  2L4A A;  2R7S A;  4J01 A;  2VT2 A;  4I0B A;  1Z6T A;  1OCZ H;  2E2J J;  1BW5 A;  1L0O C;  4XSX F;  2N8G A;  1IN7 A;  1X1A A;  1SMY F;  3GVA A;  3D5R C;  1R58 A;  2HQN A;  3KFW X;  2E1C A;  2DFH A;  1Z7U A;  3T8R A;  3ERE D;  4JOM A;  2AXL A;  1WHU A;  5CVJ A;  4BY1 J;  3GTO J;  4ESF A;  3OYI A;  5J47 A;  1Z67 A;  4RB2 C;  4B8X A;  2QSG X;  3E6B A;  4BL0 B;  2BBY A;  2JTV A;  3OYC A;  1BBY A;  5CVU A;  2OZ6 A;  2QEX I;  2IPQ X;  4CYC B;  1QHG A;  3LAP A;  3K0L A;  1PDN C;  3FKI J;  3WE3 A;  1Z05 A;  4GXO A;  5LRR A;  1A5J A;  3CMA I;  5IYC J;  3HPG A;  4II3 A;  2EFN A;  3BG9 A;  2R7D A;  2HYF A;  1Q1V A;  3ABM H;  3KE2 A;  3O8H A;  3F8M A;  3MMY B;  2H94 A;  5E3O A;  1ZN2 A;  1TP4 A;  2Y31 A;  3PNY A;  4G7Z F;  2HPM A;  4EEF G;  1OYY A;  5F08 A;  3T0Y A;  5J1R A;  5LGU A;  3K1M A;  1T0F A;  3OSF A;  1IRG A;  1FOX A;  4RS8 A;  2FJ1 A;  2FML A;  4DNC A;  1ZR2 A;  3S32 A;  3CC7 I;  3V7S A;  1MNE A;  1XSD A;  4EM2 A;  2XPU A;  4A2U A;  4UUS B;  1MMN A;  3NRV A;  3LA3 A;  2M0M A;  3MZY A;  4N0B A;  4CIC A;  2PJR B;  4FE4 A;  2FSW A;  4MTD A;  3MN2 A;  3DPU A;  5CVI A;  4EM1 A;  3L2C A;  1YG2 A;  3KP7 A;  4CCJ A;  4OIN F;  2YX7 A;  3A2K A;  4NB5 A;  2FRH A;  3I54 A;  5D4R A;  1TT5 B;  1B1B A;  3WTV C;  5JLW A;  4XN3 A;  1E3O C;  1T0F C;  3CCL I;  5CLS A;  1UG2 A;  3GTG J;  2OC6 A;  2L2O A;  1ULY A;  3K7A J;  1EJ9 A;  3SYT A;  1KZH A;  2L7F P;  1O3T A;  3W2A A;  2P8T A;  1D5Y A;  1UZC A;  1QNT A;  3FMS A;  1N78 A;  1ON2 A;  2BV6 A;  2GA2 A;  2M4K A;  5C4J J;  5TRD A;  3DTI A;  4BXX J;  1G3W A;  2Z9O A;  3D0S A;  4BDY A;  3N97 A;  4XRS A;  3R61 A;  1NG6 A;  1X4O A;  5GP9 A;  1A6I A;  4ZH4 F;  2L7M P;  3GXO A;  1GXQ A;  2OCC H;  4UUT A;  2XDV A;  3EDP A;  3BDD A;  5M3M J;  1VTN C;  1MKM A;  2E1M B;  4RB1 A;  1AWC A;  5GPC A;  1ODD A;  4ZZD A;  4A3J J;  2DAO A;  3G73 A;  1ZK8 A;  2BHZ A;  3FMR A;  2F5F A;  3F9K A;  3R4K A;  1ZR4 A;  1ETK A;  5LHG A;  2EA4 A;  2ETH A;  4OIO F;  4F3Q A;  4HEA 2;  2FU4 A;  5KCM A;  4X1E A;  2EZI A;  5EEA A;  5GTH C;  2DI3 A;  2JJ7 A;  3FHN A;  2VXZ A;  1TW3 A;  3OYF A;  3IAM 2;  2RGV A;  2EBI A;  1Z21 A;  2Y9Z A;  4CCN A;  1APL C;  3FBN B;  4RDU A;  2UXN A;  4XL9 A;  4DJA A;  3PFI A;  1JKO C;  3VPR A;  5LHI A;  3I55 I;  2HR3 A;  5CQG A;  2VOO A;  4Q48 A;  3ZXS A;  3CUQ B;  2AQE A;  2F4O B;  3F6O A;  2JVG A;  2XPV A;  2XKP A;  5J3L A;  3WTS C;  2IJL A;  3GWZ A;  2CV2 A;  1O7F A;  2HI3 A;  3OS2 A;  3EQL F;  2FEZ A;  3RZD J;  2DT5 A;  1PVE A;  2KL4 A;  2FF4 A;  2M7B A;  2V26 A;  1LKX A;  3L2R A;  2E2I J;  2FA5 A;  1SC7 A;  1OIS A;  5CQE A;  3BOQ A;  5HNH A;  1H8A C;  5DDG A;  5GPA A;  2NVU B;  5M5Y J;  4P55 A;  3ZOB A;  1CF7 B;  1WVR A;  1Y1V J;  4C3H J;  1WJE A;  2VKE A;  3IWF A;  3K69 A;  3RSN A;  2DMN A;  1JTX A;  2MD0 A;  3OIP A;  2V9V A;  4XKC A;  4L0Y B;  1KYZ A;  4BQQ A;  2DT7 B;  2E19 A;  1TL8 A;  4IX7 A;  3S1R J;  4YRV A;  3DWL E;  4BH9 A;  2F6C A;  4FQG A;  4WCG A;  4GYG A;  4CXF A;  4P96 A;  4HQM A;  5AON A;  5IPA A;  2HTJ A;  1NG7 A;  1AOY A;  1B8I A;  2K9S A;  2DYR H;  3K6G A;  1YRN A;  2EWN A;  4G8X A;  2MLG A;  5ILS A;  2PMZ N;  3M9A A;  4E4H A;  2NRA C;  3V8J A;  1LB2 A;  3O8G A;  1KU7 A;  4UV9 A;  1OJL A;  2A3S A;  3FKJ A;  1MSE C;  4E7S A;  1OMI A;  2B7E A;  1W7P A;  2ZKZ A;  1LFU P;  2JN6 A;  1O3Q A;  4LK0 F;  1ORK A;  3J7Z I;  2DOF A;  3K4M A;  2WB1 A;  2G9W A;  3QOE A;  5BOX A;  1VI0 A;  1VQM I;  3SFI A;  2W57 A;  3GF2 A;  3HOT A;  2KJC A;  4DZP A;  3EUK L;  4KIG A;  2OD5 A;  1YTY A;  4G6T B;  2MD5 A;  2ZBK A;  1J09 A;  5FLM J;  2DOE A;  1YYV A;  5FFZ A;  5F0H A;  1IJW C;  1KQ9 A;  4C2T A;  1YOV B;  4A6E A;  1SAN A;  4L9V A;  2VB6 A;  4P1W A;  3GTQ J;  2STT A;  3VFZ A;  2VJ5 A;  1C0W A;  2QBY B;  2F5V A;  1GXP A;  1RI7 A;  3CCY A;  4L9J A;  2IS6 A;  4OMZ A;  3JAM K;  3M8J A;  3GLL A;  2V9P A;  4CZC A;  2IP2 A;  4AD9 A;  3S2D J;  2LRE A;  5DUI A;  1P6R A;  3GME A;  2E60 A;  2O7O A;  2W00 A;  5FJ8 J;  3OR2 C;  1JKP C;  5D6F A;  1GV2 A;  4M9X A;  3OY9 A;  4HOB A;  1HDD C;  2HFH A;  2LDU A;  2WTE A;  4CDG A;  2HOS A;  4IHS A;  5BQT A;  1B72 A;  2XAU A;  1FSE A;  1CQT A;  3IH4 A;  2QGU A;  3K4B A;  1MD0 A;  1P9Q C;  4BBS J;  2J5O A;  2FXA A;  2Z3Y A;  4U88 A;  1FYM A;  2HVQ A;  5IYB J;  4RM2 A;  5D5V B;  3HZJ A;  1VQ8 I;  1QZE A;  4MTE A;  1X3U A;  4BQA A;  1BI0 A;  1YJN I;  3GUD A;  2P0W A;  4CA0 A;  4PZJ A;  4D1Q A;  1UHW A;  4Y52 J;  2H6B A;  4IXA A;  1SAU A;  3GFI A;  3TOA A;  3ZCO A;  3O3K A;  5DV5 A;  2BVM A;  3WU2 C;  4IRG A;  5C44 J;  4HQE A;  2PN6 A;  4R8H A;  5LBQ A;  3GFJ A;  2ACJ A;  3HSF A;  2P7C B;  1R4N B;  3QOD A;  4I01 A;  4XID A;  3RKW A;  1N25 A;  2YX4 A;  2K9N A;  4I6Z A;  1DGW Y;  3I4N J;  1FBQ A;  1BR2 A;  2IA2 A;  3TED A;  1K83 J;  2OU2 A;  3E5X A;  4EGZ A;  2CFO A;  2EFP A;  5DD8 A;  1V5G A;  2X51 A;  4LG0 A;  4IZZ A;  4RM3 A;  2RQP A;  4H4K C;  5E8G A;  1D3Y A;  3PUB A;  2FOK A;  1G6N A;  2WAQ A;  1ETY A;  3ABT A;  2CW8 A;  4HNV A;  3UKG A;  2LKP A;  3ROU A;  1FYL A;  2BEO A;  2FBH A;  1D0X A;  1WFX A;  2HPI A;  2XGD A;  5L3E A;  2EB7 A;  2IS4 A;  1JTY A;  1I27 A;  1YLF A;  3AG2 H;  3S17 J;  1KQ8 A;  4EJV A;  2EIL H;  1ETO A;  4RB3 C;  3U9G A;  1VQP I;  3GLX A;  2GLO A;  1G3T A;  2XV4 S;  4KIT B;  2RQQ A;  3QPS A;  5JHF A;  1K7A A;  4HA8 A;  1S3J A;  2V6C A;  2EFQ A;  3KZI C;  4XK4 A;  1ZRF A;  5LEK A;  5JVT A;  1T39 A;  5F6F A;  3VOE A;  1U9N A;  1NK3 P;  1H88 C;  4QPO A;  1ZGJ A;  3ZP5 A;  2D5V A;  4FET A;  3I0T A;  5A2Q Z;  2GAU A;  3BTC A;  3TO7 A;  4MO7 A;  1H89 C;  1R22 A;  1UJ8 A;  2VIX A;  5CVV A;  1W7P D;  1J75 A;  3AG4 H;  2XAG A;  2V1D A;  2GZW A;  3U1D A;  4AM3 A;  1VQK I;  2IAI A;  3DCF A;  3WGH A;  1HW2 A;  3RKY A;  2TRT A;  1QA6 A;  2EPF A;  1RZ4 A;  3E6D A;  5H20 A;  1JHF A;  2BOL A;  4L5E A;  4RGS A;  4QIW N;  2UWM A;  2LMD A;  3K1N A;  3KP3 A;  5EG0 B;  5J8F A;  5FGM A;  3ZQQ A;  3PL8 A;  1MSF C;  3VYR B;  3KZZ A;  1JUP A;  2VC0 A;  4O5V A;  1SFU A;  2OAZ A;  3VEP A;  3RPU A;  3BG6 A;  2IGN A;  5IP9 J;  2ISY A;  3OYL A;  3FK7 A;  4CZZ A;  2VOP A;  1MNM C;  4R1H A;  1FYK A;  1ITY A;  5LD2 C;  3ABL H;  2OBP A;  3VOD A;  4A3B J;  1UEL B;  5HOD A;  5F0F A;  1XGO A;  1QU3 A;  1S7E A;  2ZCW A;  3S8P A;  2V1X A;  3FXR A;  2CQK A;  4IOC F;  1BOB A;  4OAZ A;  1UG0 A;  4IHT A;  3PIP F;  3BTJ A;  1XCB A;  3CCU I;  3OYA A;  3K4C A;  1LDD A;  2O61 A;  4PCQ A;  3LST A;  1WCM J;  2JUG A;  2K40 A;  5D4S A;  2I5U A;  3S3O A;  2LKS A;  2HQA A;  3DU5 A;  5KK1 A;  3GTP J;  4C3I J;  2NVT J;  4Y17 A;  1WZ2 A;  2DK5 A;  1IXC A;  1T38 A;  2KKO A;  1TWA J;  1EH7 A;  3BQY A;  1WI3 A;  2EIN H;  2ME0 A;  4ZC3 A;  3H3V K;  1KA8 A;  3F23 A;  3HHG A;  4QTR A;  1IRX A;  1IN4 A;  2L9R A;  3ZR8 X;  2EZL A;  2GA1 A;  2L7K A;  3FXK A;  2O03 A;  1U0J A;  1LFB A;  3TGN A;  5J4Y A;  5LGN A;  3L1P A;  2DJI A;  4Y3O A;  1PUE E;  1HKQ A;  1IAW A;  4LFU A;  2DW4 A;  3DQV C;  1J0R A;  2WAF A;  3FF5 A;  4U0V A;  4B3A A;  3ONQ A;  1G3S A;  2HU9 A;  1FMW A;  2QQB A;  3LSM A;  2CS3 A;  1HF0 A;  2KIF A;  2K3F A;  3CO7 C;  1K78 A;  2R7Q A;  1HC8 A;  1ETQ A;  3REO A;  2CSO A;  1FEX A;  4TV7 A;  2JSP A;  4G7H F;  2JSC A;  2ZXI A;  4LG3 A;  1HSJ A;  5HDN A;  4WK8 F;  2LF8 A;  4XR6 A;  3JSP A;  3D1N I;  4ESJ A;  4M3E A;  1QVT A;  5E18 F;  2UZK A;  4ZTF A;  3UNG C;  1X58 A;  5AIQ A;  3C1D A;  4GGG A;  3ZQH A;  2DFI A;  3MFK A;  2NS8 A;  3FK6 A;  5L3B A;  1BR1 A;  3SQN A;  1YX5 A;  1XC5 A;  2ELH A;  4DQ2 A;  3CF5 F;  2R5Y B;  2M34 A;  2A5Y B;  4XKW A;  1ACI A;  1HKS A;  4F92 B;  2W25 A;  3ASO H;  3Q9V A;  1SFO J;  4ZYE A;  2DK8 A;  2CRG A;  4HAM A;  3M3Y J;  2K4J A;  3QYB A;  3L2W A;  3DBL B;  4BGD A;  2KIM A;  2XGC A;  3QPL A;  1WH7 A;  4BBR J;  2QQA A;  5EEH A;  2P5L C;  1VFC A;  3OYM A;  3LSR A;  1IGN A;  3QWL A;  2KIS A;  5IOZ A;  2E34 A;  1BC8 C;  4A0Z A;  4RGR A;  3H0G J;  1I3Q J;  3HDD A;  4B09 A;  1F36 A;  1OCP A;  1ONV A;  3CDH A;  3CJN A;  4IJA A;  1XS9 A;  3G6E I;  2ZXW H;  2X48 A;  3BR2 A;  2LYC A;  3HRU A;  2CQN A;  2M4G A;  2ZXJ A;  3BLY A;  2HS5 A;  1TNS A;  3LWF A;  3ZMT A;  5GAD J;  5H6R A;  2F4I A;  4J00 A;  1M1E B;  2PI0 A;  3HEF A;  4RGU A;  5BPI A;  2ECC A;  1U8B A;  3RPU D;  3TO6 A;  3F22 A;  1D8J A;  3H35 A;  4EJW A;  6PAX A;  5FB2 A;  3WTW C;  2YR2 A;  5E8I A;  1RR7 A;  2EIK H;  3EET A;  4ANJ A;  1LFP A;  3JCU C;  4L9N A;  1OPC A;  3HM5 A;  4DIQ A;  2IGM A;  3JRA A;  4ENN A;  2ZC2 A;  4HSR A;  1WPK A;  3TBI A;  1ZG3 A;  3E97 A;  3WGG A;  2LNB A;  1E3H A;  2BY2 A;  3WU1 B;  3RCO A;  4JX5 A;  4Y15 A;  1SVM A;  4XKB A;  2R7R A;  1FNN A;  4E7K A;  2VJJ A;  3PJR A;  2R7O A;  4B1R A;  1B59 A;  2VBW A;  3ZMV A;  2V79 A;  2VE9 A;  2K5C A;  3FXM A;  3OL4 A;  2RAE A;  4D5C A;  4KUM A;  2K02 A;  2PFB A;  1VF9 A;  2KQR A;  4XNF A;  4BU2 A;  2DA5 A;  4L0Z B;  2K9L A;  1YFH A;  4XRS G;  4UXN A;  1X1B A;  4L5I A;  4BUP A;  1Z6R A;  3F0C A;  1MZB A;  1YHQ I;  2P81 A;  2HDW A;  4GFB A;  2D2W A;  4V2G A;  1MBH A;  4NNJ A;  3CCM I;  5JFR A;  3CCV I;  1ZRD A;  1JXS A;  4EJT A;  1X2N A;  1QO0 D;  2IEK A;  4KFC A;  4A3G J;  2L4M A;  3PQK A;  4DYR A;  2K9M A;  2LH9 A;  3OS1 A;  1OCC H;  1XCV A;  1XDS A;  2IGK A;  2NYX A;  5LRS A;  2A6T A;  4M9Z A;  3QYE A;  1LDJ A;  2R4G A;  1VQO I;  4WX9 A;  1E3P A;  1RRJ A;  1ETW A;  2LVS A;  2DMP A;  3K4L A;  4YIR X;  4XLN F;  4XLF A;  3D5S C;  5FRM A;  2LBF A;  2R5Z A;  2XAQ A;  1Y6I A;  3I4P A;  4LK1 F;  1MH3 A;  1XGN A;  5BNG A;  2M9H A;  1ZLJ A;  5EZG A;  3KEO A;  3TP3 A;  3A01 B;  3TDZ C;  3OV8 A;  1Y39 A;  2M8E A;  3GCM A;  4C3J J;  4CUG A;  1VQN I;  2EV0 A;  2K3P A;  2YPR A;  5DTD A;  2DO7 A;  2IA0 A;  1D0Z A;  3ABK H;  2JA2 A;  3PUF A;  3KP6 A;  1I1S A;  4AVZ A;  3L9F A;  1P7J A;  2Q1Z B;  1BI1 A;  2WBM A;  1R9T J;  4M71 A;  2W24 A;  3A0H C;  3H3U A;  4E7H A;  1T8I A;  2X6X A;  2DA7 A;  5EZH A;  2DTR A;  5E20 A;  1OKR A;  1ZG1 A;  1QGP A;  2MW8 A;  4Q5S F;  1V54 H;  3JAM Z;  5LLQ A;  1JUM A;  3VYS B;  2V1N A;  2CO5 A;  1ZHF A;  2PMU A;  3CQZ J;  1WJF A;  1YO5 C;  1GVJ A;  5FKK A;  4LB5 A;  2KIU A;  1P2F A;  1WJA A;  1ENH A;  1R71 A;  4XLP F;  4M3D A;  1OQY A;  3G4S I;  1ZRE A;  3V4G A;  3ZQ7 A;  1ZAR A;  4KYW A;  3P7N A;  3A0B C;  2CH0 A;  2OQG A;  1ETX A;  1LQ1 A;  5D5X B;  5EEG A;  1G2H A;  5DM6 F;  4OIR F;  3PSI A;  2JPC A;  1W0T A;  2CUF A;  5DM7 F;  3QAH A;  1MH4 A;  3R60 A;  4U87 A;  4PJL A;  3HIF A;  4P9F A;  2P6S A;  5J1Y A;  3A03 A;  5FLV A;  3B6A A;  5JLX A;  3L2V A;  1X3W B;  4YFK F;  5D5W B;  3DTE A;  4JYK A;  1FTZ A;  4DYQ A;  4D5F A;  2IXS A;  1B8I B;  4A3D J;  2HQR A;  3SFZ A;  2QWW A;  1SEU A;  2Y0M A;  1YRN B;  1W5C C;  2PEX A;  1H9G A;  4IPA A;  5K5R A;  1IC8 A;  3OOP A;  1TWC J;  2VXD A;  3LL7 A;  3ZN0 A;  3JRF A;  3KLN A;  3FIS A;  3NEU A;  4HZF A;  4KDP A;  3MVP A;  1KU9 A;  2HTS A;  3BG3 A;  1PUF B;  1W7P B;  2IBD A;  4FIS A;  2MFZ A;  3SDB A;  4H0E A;  2BZT A;  5FKL A;  2Z5U A;  3DPT A;  1O4X A;  5LEJ A;  5GAG J;  3QYF A;  2AQF A;  4GDF A;  2NVY J;  2RC4 A;  1FX7 A;  1Y8R B;  3OS0 A;  3E1S A;  2R0Q C;  3CC4 I;  4CH7 A;  1W4M A;  2KRF A;  3CLQ A;  1KGS A;  2ECB A;  2LC2 A;  3FWE A;  4YG2 F;  3F21 A;  5B3S H;  1JUS A;  1AA7 A;  3ASN H;  1IN8 A;  1EA3 A;  2HKX A;  2JUC A;  3KCC A;  3TO9 A;  3U21 A;  4ITV A;  5M5X J;  1G8X A;  3HRT A;  4HBL A;  4AYB A;  4IRI A;  3GZN B;  4B43 A;  4UV8 A;  1H0M A;  1AU7 A;  2X85 A;  3SEZ A;  2DMU A;  3JRB A;  3K4J A;  2ZXH A;  4HG2 A;  2W4S A;  2CJJ A;  3C18 A;  3VB2 A;  2QM3 A;  1JT6 A;  4I76 A;  2UXX A;  3HPH A;  1B72 B;  4GYI A;  2ZME A;  4KIC A;  5ICG A;  3BZ6 A;  2JT1 A;  5M5W J;  1XDU A;  1Z91 A;  2DA1 A;  2DFF A;  3DV8 A;  4PSW A;  3NQO A;  4MFD A;  2E1O A;  1JGG A;  2KRH A;  4BJT A;  2ZFW A;  1A36 A;  3K70 C;  1VQ6 I;  4HPQ A;  2MGQ A;  2HGC A;  4XMY A;  2H6C A;  4KIB A;  2M2E A;  3KP5 A;  3S15 J;  2JQ7 A;  2QLZ A;  3P9K A;  2HVS A;  4PUS A;  2IGO A;  3ZQI A;  2ZME C;  1Y8Q B;  3MEX A;  3V8L A;  4F52 A;  4XRM A;  4XON A;  4ENK A;  2NOJ B;  1FY7 A;  1F4K A;  3VSL A;  1IO2 A;  2G7U A;  4NBQ A;  2I8D A;  3FDY A;  1RC9 A;  3RPQ A;  2R7F A;  2F48 A;  2VJI A;  3FHZ A;  4HLX A;  4ZDP A;  1YQA A;  4LG0 B;  4NQW A;  1ZKG A;  1S7A A;  2DDA A;  2M45 A;  3SZT A;  3JRE A;  2V6E A;  5JI6 A;  3IH2 A;  4KT5 C;  4UUV A;  2DCE A;  2E36 A;  2E2H J;  4LJZ F;  5ED4 A;  3QU3 A;  3BTI A;  3GTL J;  2OPT A;  3J81 Z;  3H36 A;  4MQ9 F;  3HG9 A;  3W2W A;  4U0W A;  3FM3 A;  3BT9 A;  1VQL I;  1SMT A;  2BY0 A;  2XGX A;  4PFP A;  1Y0U A;  1ZGA A;  3IKT A;  2VI6 A;  2DOD A;  3L2U A;  2WWY A;  3KZY A;  1RKW A;  4S05 A;  3HUG A;  3IH3 A;  1LVA A;  2LF7 A;  4ZYG A;  3TL4 X;  1OCT C;  2FOW A;  2OTJ I;  1NH3 A;  1T95 A;  2DPD A;  2H8W A;  3ECO A;  2GOX B;  1ZYR F;  1POG A;  2Z1D A;  2IS2 A;  3ZMS A;  4BHC A;  3ZMD A;  4A3M J;  5F1R A;  5FRO A;  1Z7L A;  2OF7 A;  1BW6 A;  2Z33 A;  5HLI A;  1UFM A;  2GXG A;  1FJL A;  3QOP A;  2DN0 A;  5IY5 H;  1AKH A;  3KEY A;  1O57 A;  3ZQF A;  1VZ0 A;  3KLO A;  5GTI C;  3K2Z A;  4RA2 A;  3SJM A;  1HCR A;  1KQ0 A;  3WG7 H;  1YW8 A;  2ID3 A;  3V8K A;  5IT3 A;  5LHH A;  4A0Y A;  3H1C A;  4J19 A;  3DXJ F;  2KHM A;  3R6S A;  3WTU C;  3F3X A;  2VAS A;  3TP0 A;  2XIG A;  1V55 H;  2EFW A;  9ANT A;  3BZK A;  3G1M A;  1YS6 A;  1K4T A;  3L09 A;  1CGP A;  4KJZ A;  5F64 A;  1OYW A;  3JRI A;  4XKV A;  2DMQ A;  2FD5 A;  1PP8 F;  5DCF A;  3Q0W A;  5J8C A;  5ILV A;  3CF2 A;  2OJE D;  1J9I A;  4MNU A;  1HKT A;  4PK4 A;  1OYI A;  5IOY A;  1RUO A;  3I59 A;  2H09 A;  1Y56 A;  3GW2 A;  2YUS A;  2CMP A;  4XLA A;  2CFX A;  2COM A;  4BAY A;  3S2W A;  2HNH A;  5D8L B;  3M07 A;  4HDV A;  1TT0 A;  3JRD A;  3K70 D;  3GZ6 A;  3I64 A;  1YIJ I;  2BHY A;  1Z1D A;  3OYD A;  2GXA A;  5ERI A;  2ELK A;  4BEH A;  3CO6 C;  2Y0S N;  1BR4 A;  1W1W E;  2DU9 A;  2JRT A;  4AWX B;  2CUE A;  1STZ A;  1WGX A;  3IL2 A;  2ZJQ F;  4BQO A;  3S16 J;  4KN7 X;  2DQL A;  4IO9 F;  1TQI A;  3CJR B;  1QRY A;  1WRJ A;  2WV1 A;  2M7A A;  3SEQ A;  3HXL A;  2D45 A;  4RLQ A;  4BJ6 C;  1S9H A;  2FE3 A;  4IEJ A;  5DD4 A;  2BW3 A;  2BE5 F;  3HKZ A;  4PJJ A;  4D9J A;  1N77 A;  2O8K A;  1SFE A;  4PJ0 C;  5KAF C;  4HF2 A;  2E1N A;  2CQX A;  2XAJ A;  1T98 A;  3FXO A;  2LY9 A;  1O7L A;  1DP3 A;  2XRL A;  4II2 A;  5EGO A;  3GYH X;  2R92 J;  4Z2Y A;  3HOY J;  3HYI A;  2DXI A;  1P4A A;  2PX9 A;  1BN5 A;  4CCO A;  2R7X A;  1MBE A;  2RNG A;  4XSZ F;  4AUX A;  3FX3 A;  1U6G A;  1MJA A;  3EYI A;  1I50 J;  3JRG A;  1TWH J;  2KIQ A;  1FBS A;  3HOS A;  1P92 A;  4KIF A;  1IV8 A;  3G1O A;  4DYC A;  3OYE A;  2GBY A;  1YX3 A;  1K78 B;  1HW5 A;  4MGR A;  1OFC X;  3SDG A;  3AG3 H;  4W97 A;  2DPU A;  5HS9 A;  1V3F A;  2L7Z A;  2MG4 A;  1MDM A;  1DP7 P;  1SD6 A;  1BI2 A;  3QP5 A;  1G3Y A;  3MKW B;  2MAB A;  1KYW A;  3TW6 A;  2W85 A;  3CCS I;  1YJW I;  1S6L A;  4PGG A;  2WAE A;  2O6G E;  2DYS H;  1KU3 A;  1IUY A;  3LSK A;  3N05 A;  2CQQ A;  4M3B A;  1XTA A;  2KP6 A;  1S7O A;  1OLT A;  1IXS B;  5B66 C;  3B73 A;  5B1B H;  1IRF A;  2UUZ A;  1W36 C;  3IV5 A;  3HGY A;  3DFG A;  5EYR A;  5F27 A;  1P4W A;  5D6E A;  2L0K A;  3HRM A;  2JZY A;  2JRM A;  5HS7 A;  2NS7 A;  3L00 A;  4AIK A;  4XQF A;  3MZH A;  2QEN A;  4IL6 C;  3E6C C;  3CC2 I;  2E71 A;  2KJB A;  2MSY A;  4PSX A;  2LY1 A;  1F9N A;  1Y0N A;  3S2H J;  5ICE A;  1WH5 A;  1D5V A;  4HYE A;  4A0X A;  3R0J A;  1R4M B;  1T56 A;  1TBX A;  2RRE A;  3PNV A;  1RIO H;  1R1V A;  2QKM B;  2HOT A;  3B6C A;  3P9C A;  5C3E J;  1PYV A;  2Z2S B;  4HX4 A;  2BVL A;  1SD7 A;  3G71 I;  1S29 A;  1U5T A;  2KZV A;  1MGT A;  2QQ9 A;  1Z9C A;  3BR5 A;  4G94 A;  3W6J B;  3ZN1 A;  1HA8 A;  1IDZ A;  2PQ8 A;  1VQ4 I;  2KMU A;  3J81 K;  1NTC A;  2K85 A;  2ID6 A;  4QWQ A;  5CKT A;  1A31 A;  4LLN A;  2CU7 A;  4LGW A;  2CV1 A;  3S1Q J;  3H0D A;  4L18 B;  1MMA A;  3EUH A;  3WU0 A;  3WTT C;  2XF6 A;  1R00 A;  2IVM A;  1N75 A;  1U5T C;  5K7Z A;  2DJN A;  4UHT A;  2EH3 A;  3WHC A;  1R5G A;  3KYD B;  1JT0 A;  4UB8 C;  3JR9 A;  3FIW A;  2EJR A;  4B47 A;  4CHU A;  1BC7 C;  3LOC A;  4A3L J;  3U1K A;  3RQ4 A;  5DUK A;  2LD5 A;  4I0A A;  3IP4 B;  2A6H F;  3NWT A;  3ZQG A;  2ZJ2 A;  3G1L A;  4B3X A;  2LKX A;  2RDP A;  1IUF A;  3HBL A;  4AYB N;  4NUB A;  5TJJ A;  1XD7 A;  2BGC A;  1DU6 A;  5K7F A;  3JSO A;  4EGY A;  1NHA A;  5IT9 Z;  2F5C A;  3BZC A;  2X6W A;  2NNY A;  1IXR C;  3EUH C;  3PQJ A;  1B6A A;  4F91 B;  3WTY C;  3NWS A;  4ENM A;  4I09 A;  2HYJ A;  3OYG A;  4LIU A;  1MBJ A;  4FX0 A;  3M7G A;  2GIV A;  3HOV J;  1OR7 A;  2R93 J;  4HF0 A;  3CES A;  3CCR I;  2E5N A;  2D1H A;  2MC4 A;  2P6T A;  1R1T A;  3GEZ A;  4CYD A;  1Z3X A;  1FPQ A;  1KON A;  4HX8 A;  1BJZ A;  4XLH A;  4YII A;  3J7A O;  2HQ5 A;  3OL3 A;  3KX2 A;  2CUZ A;  2F4M B;  5E1W A;  2KRC A;  2QYO A;  4HV6 A;  5K5Q A;  3ZQL A;  2X4H A;  3HOX J;  4ZDO A;  1OR7 C;  1WJB A;  2JPB A;  3OR1 C;  2XGE A;  2L3D A;  1W36 D;  2JA8 J;  1UCR A;  2LBF B;  1XX5 A;  4FHT A;  2R5Z B;  4IOA F;  3RJP A;  3IC7 A;  2YS9 A;  2I10 A;  4CGZ A;  3MAJ A;  4RBO A;  3MCZ A;  1LJ9 A;  3L7W A;  3DP7 A;  1FLI A;  1HST A;  2O9L A;  4G12 A;  3CCQ I;  2WV0 A;  4RAY A;  2DDB A;  3WOD F;  5L3C A;  1X1C A;  1SFX A;  2O8X A;  4JQF A;  5EDN A;  2AXT C;  5L3F A;  4D7N A;  4U0Y A;  3BPX A;  1NK2 P;  4YEJ A;  2VBZ A;  3EUA A;  4UNO A;  3MKY B;  4W1U A;  1FIA A;  4M6X A;  3HOW J;  3E6M A;  3KIO A;  1SD5 A;  2PMZ A;  2VQH A;  2CUJ A;  1LEA A;  2X6O A;  1R7J A;  2EFO A;  2VT3 A;  5CPR B;  5E3M A;  2TCT A;  3GFL A;  5J4V A;  2H27 A;  2FUG 2;  2HDD A;  2XHK A;  2O5R A;  1BIA A;  2QUF A;  4BXF A;  1FOK A;  2ZO4 A;  1ZQ3 P;  2FNP A;  4FE7 A;  4X0G A;  2WAD A;  2VKV A;  1FT9 A;  4AIH A;  3BQZ A;  5FD6 A;  2VPR A;  4V2F A;  1UHS A;  2WB1 N;  2VLA A;  3I58 A;  1MW7 A;  4BHP A;  2CYY A;  2KT0 A;  3LQR A;  4BKX A;  3DBH B;  4DBR A;  2M30 A;  5J40 A;  2ZSI B;  2RN7 A;  1VQ7 I;  3FBI B;  3K4K A;  3LSP A;  3NAU A;  1QVU A;  1HXD A;  3BR3 A;  1BIB A;  1W5S A;  2NOG A;  2H8R A;  4HX7 A;  3OYK A;  4E6K G;  4HF1 A;  1WI9 A;  2ZB9 A;  3H9Q A;  1Z77 A;  2HOA A;  3KYC B;  4HDU A;  3HTU A;  1FOW A;  3GTJ J;  1X3Z B;  3S14 J;  4O6J A;  2EV5 A;  1OCR H;  4R79 A;  2D1V A;  1JE8 A;  2QSF X;  1A35 A;  3GBG A;  4IQJ A;  3DKW A;  3RYP A;  4KIS A;  1RUN A;  3F8N A;  3FZV A;  2LTP A;  2LP0 A;  4UVC A;  3SZG A;  3OYH A;  4I98 B;  1WQ2 A;  3TOB A;  1XB4 A;  1JKR C;  3O2P E;  4IVN A;  3VYT B;  3DEU A;  3V7C A;  2BYV E;  4XOR A;  2NNN A;  3Q9S A;  1F43 A;  3EPZ A;  4BS9 A;  1TZL A;  2OUM A;  1SFK A;  2Y2Z A;  2L9V A;  4BHB A;  3QPH A;  2EIM H;  3DKX A;  1BOA A;  3KPH A;  1UHM A;  4E7L A;  1XSX A;  2LSO A;  4E70 A;  1D0Y A;  4UY8 I;  1YW9 A;  1P7I A;  3Q3S A;  2EIJ H;  3COA C;  1QQI A;  2DA6 A;  2LG4 A;  2XF5 A;  3HJE A;  1Y1W J;  2WY8 Q;  5HLG A;  3T1B A;  1A04 A;  4HW0 A;  1XGS A;  3GX4 X;  1FZP B;  1YE9 A;  2E5Z A;  3KEQ A;  3IRQ A;  1QPM A;  2ZSH B;  2ZME B;  3H9J A;  5K5O A;  4Q4Z F;  4MLO A;  2Y30 A;  3ZGK A;  3A1Y A;  4A6D A;  3D5L A;  5FLX K;  1MMD A;  3VSK A;  1IW7 F;  3RTR A;  3IHU A;  4AID A;  2IRF G;  2WAQ N;  3DLA A;  2V9K A;  2XRN A;  4Y4R A;  4A5M A;  3O6B B;  4GO1 A;  2V4J C;  2LK2 A;  2DLL A;  4OU0 A;  4WXH A;  4ZJZ A;  3PO2 J;  3AFH A;  2XB0 X;  4ETS A;  3RI4 A;  1LE8 A;  3E5U A;  2HZT A;  4DZJ A;  4IF4 A;  4E7Z A;  1GHC A;  4F7Z A;  2ZFU A;  4BXU A;  1I5Z A;  1U8R A;  1UB9 A;  4QSH A;  1UST A;  2R7V A;  3RKQ A;  3BR0 A;  1U78 A;  3LMM A;  2XRO A;  2HWV A;  4LIV A;  3TMO A;  5IT9 K;  3CCE I;  1XMA A;  2TDX A;  2P5V A;  4IQ4 A;  4O3M A;  2X1E A;  1GT0 C;  1QBJ A;  2VQG A;  4NQW B;  3K4N A;  3QPT A;  3BJ6 A;  1LPQ A;  1JKQ C;  3HOU J;  3KYL A;  2OQR A;  4RAF A;  5DCM A;  2L9N A;  4M3F A;  3T8T A;  2Y48 A;  3QQA A;  3KP4 A;  3BWG A;  3CP8 A;  1DPR A;  1DDN A;  1QZY A;  2COB A;  1T08 B;  3FXU A;  4A3F J;  3I53 A;  1J59 A;  2L02 A;  3ZMZ A;  4CSW A;  1I6X A;  4KMF A;  3LNQ A;  5H6Q A;  4NDL A;  3WG9 A;  1F5T A;  3HOZ J;  2Q2E A;  3WGI A;  1WSU A;  3LSH A;  2P7V B;  2QKL B;  3PSF A;  1BJA A;  2FQ4 A;  2HOE A;  3SHF A;  3BG5 A;  3HUG B;  3TDU C;  1VND A;  1MJB A;  2VJ4 A;  2LLK A;  3M1E A;  4RAZ A;  2ME6 A;  1BM9 A;  4GRI A;  1HQC A;  5DEQ A;  1ERD A;  1XMX A;  1Q1H A;  3CZ6 A;  2R7W A;  3C2B A;  3PNT A;  1YI2 I;  3ML6 A;  1USS A;  1EV7 A;  2CG4 A;  2XC7 A;  3IRR A;  1W0U A;  5KAI C;  4EAT A;  3PIO F;  4WF2 A;  5JR3 A;  1X4P A;  5JVG F;  1AKH B;  3HC7 A;  1IV6 A;  4AU7 A;  1ZH5 A;  1K61 A;  2MLK A;  4RAG A;  4IHW A;  1IZ1 A;  3MD2 A;  3Q5F A;  2WC2 A;  3JRH A;  2E7X A;  1V5E A;  2VE8 A;  4JX4 A;  4YFX F;  2W84 A;  2ICW G;  4K2E A;  2GXB A;  4IHY A;  2Q0O A;  3DEE A;  3CMM A;  2B63 J;  3HSR A;  1I3A A;  4PGH A;  5LGT A;  4FAS D;  4LMY A;  2CW0 F;  1EH8 A;  2BXZ A;  3SXY A;  4AVP A;  1TQP A;  3JRC A;  3OMY A;  1TWF J;  4XOP A;  2W48 A;  4MFE A;  4XOT A;  4IHX A;  3ZMU A;  3QRF F;  3K2A A;  2OCE A;  3I59 B;  1DPU A;  3GTM J;  3OIQ A;  3FMQ A;  1IN5 A;  1R5I D;  2YSR A;  2MC3 A;  2H1K A;  2XAH A;  2VBY A;  3F72 A;  2LR8 A;  1GLN A;  1IRZ A;  1FOY A;  1DUX C;  3AL0 C;  2ZNY A;  4Q47 A;  3H5R A;  4BEH B;  2FX0 A;  1JI8 A;  5DS9 A;  5L3D A;  4A12 A;  1F1Z A;  4DOZ A;  3MKZ A;  1E0E A;  3P5J A;  2HZD A;  3A01 A;  1G4D A;  4PDK A;  5ICC A;  4UB6 C;  2GWR A;  3M8E A;  1V4R A;  2A05 A;  3OWT A;  5GAE J;  1JHH A;  1JGS A;  1O3R A;  1U2W A;  2BW3 B;  3W3C A;  4OMY A;  3BC8 A;  3S1M J;  4MHG A;  3G3Z A;  3IAS 2;  3RIR A;  4C2U A;  3FXQ A;  4UVB A;  4V19 K;  2VKD A;  2LRD A;  1PJR A;  2R7Z J;  3BY6 A;  2JA5 J;  3H9G A;  4EM0 B;  3ERM A;  5CVR A;  3NAR A;  1QPI A;  3K10 A;  2L01 A;  5EGO B;  2A68 F;  2Y69 H;  1LVK A;  3WTX C;  2L5Q A;  2STW A;  2Y75 A;  1IG7 A;  1D1A A;  1ETV A;  1R49 A;  4CYC A;  1VQ5 I;  1LEB A;  2ZJR F;  3LFU A;  3J80 Z;  5KVR A;  2PLY A;  3C2G A;  4P5O A;  2GIZ A;  3LA7 A;  4IKF A;  2EQR A;  3GTK J;  2LOO A;  3DEW A; 
#chains in the Genus database with same CATH homology
 1MDM B;  3BJA A;  2VN2 A;  2M1B A;  4RB0 A;  5HDG A;  1SAX A;  4BNC A;  5CYV A;  4HV5 A;  3JTH A;  4S04 A;  3E5Q A;  4ZYH A;  2RVC A;  4GCV A;  3V7R A;  4BYY A;  2GQQ A;  2X0L A;  4EVI A;  4LLL A;  2NAZ A;  2MA3 A;  3CUO A;  4ASN A;  5CJ9 A;  5HDK A;  2C6Y A;  2XKO A;  3R0A A;  4M74 A;  4KA4 A;  1KU2 A;  3BJO A;  1XMK A;  1J2X A;  3AAF A;  2ESN A;  2EV6 A;  4XBF A;  4QLC U;  4FT8 A;  3DF8 A;  3F8B A;  2R3S A;  3N4M A;  1XN7 A;  1FBU A;  1WKM A;  3F8F A;  1HBX G;  1U5T B;  1MJ9 A;  3IKV A;  2FBI A;  3IWZ A;  3RYR A;  1IF1 A;  2PG4 A;  4ZYD A;  3LFK A;  4RGX A;  3WE2 A;  5FD5 A;  2ISZ A;  4D0P A;  2XVC A;  4KMU X;  1HW1 A;  1J5Y A;  4OIP F;  3ZPL A;  1YS7 A;  2OA4 A;  2V1U A;  3QP6 A;  4LLG F;  1S8N A;  3CUQ A;  3F8C A;  3HTS B;  2O3F A;  2DQR A;  2J5P A;  3MWM A;  3TKY A;  2K86 A;  4L5J A;  3ULQ B;  4YIF A;  4ESB A;  1CF7 A;  1FP1 D;  1K6O A;  5HVQ C;  1XSV A;  2M5W A;  3CUQ C;  4JBA A;  4I02 A;  1R1U A;  4ENJ A;  4OOI A;  2E7W A;  3RKX A;  3LQQ A;  2MH9 A;  2IA1 A;  2F5D A;  5L3G A;  3JTG A;  1D8K A;  2PJP A;  1FC3 A;  1WWX A;  2XAS A;  3CLO A;  3I71 A;  2A61 A;  4KN4 X;  1REP C;  4G6Q A;  4WXD A;  4IRH A;  2VBX A;  2CWE A;  4MEY F;  1ON1 A;  2P5K A;  1YIO A;  5HLH A;  3RDI A;  3GFM A;  3K1P A;  2B0L A;  1FSH A;  3K9T A;  4HLY A;  2AS5 F;  1H9T A;  5D5U B;  1BI3 A;  4ZZL A;  2IT0 A;  1TLH B;  2QBY A;  4U7D A;  1FWZ A;  2QZ8 A;  2F2E A;  3QU6 A;  1R36 A;  1TW2 A;  4M73 A;  5HS8 A;  4G9Y A;  1K79 A;  1YW7 A;  2VC1 A;  5FLX Z;  3F6V A;  2Q8K A;  3J80 K;  2FBK A;  4JK1 X;  4U7B A;  4CO8 A;  4EV0 A;  4M6Y A;  3CTA A;  3H92 A;  3LAJ A;  5E1X A;  2DBB A;  3BP8 A;  4EMS A;  5BS6 A;  3W6K B;  3KET A;  2EK5 A;  2L54 A;  3BPV A;  2ESH A;  5J6X A;  2MBF A;  3ISP A;  5ICF A;  4FX4 A;  3ECH A;  2A6E F;  5JHU A;  4I2O A;  1B9M A;  1EH6 A;  1E17 A;  2FMY A;  2VON A;  1I1G A;  2PBI A;  3ELK A;  3C3W A;  5K1Y A;  2CGP A;  2IW5 A;  2MH2 A;  2YU3 A;  4EJU A;  2ZNZ A;  1XGM A;  2XUB A;  3E3V A;  2XAF A;  2M87 A;  4M9S A;  3FM5 A;  2HEO A;  5E17 F;  1TQM A;  4OIQ F;  3LA2 A;  4I7H A;  1ZRC A;  4LD5 A;  4N9H A;  4UVA A;  4MEX F;  3MQ0 A;  3WTZ A;  2OZU A;  2RNJ A;  3KP2 A;  2FNA A;  1B4A A;  3M8F A;  3I5U A;  1L3L A;  3T5X A;  3B02 A;  4EJO A;  1SD4 A;  1R5H A;  2RKH A;  1E2X A;  1J7K A;  3GZ5 A;  4NHJ A;  2FQ3 A;  3C7J A;  3P9I A;  1P4X A;  2G7H A;  4G6D A;  3TQN A;  2HKO A;  3BRO A;  5ILU A;  1W5T A;  2QVO A;  5FFX A;  4A5N A;  4G7O F;  2P4W A;  3HRS A;  1PP7 U;  1R23 A;  3GO5 A;  2HDC A;  5DCM B;  1QZZ A;  5FO5 A;  1RNL A;  2K27 A;  2Z99 A;  3SZP A;  1IN6 A;  2HYG D;  5BPD A;  1T2K A;  5E1Z B;  4N9I A;  1U3E M;  5D8K B;  1T6S A;  2O0Y A;  2A07 F;  1O3S A;  5BMZ A;  3HSE A;  4LB6 B;  5AIP A;  4M72 A;  1LNW A;  4MQV A;  2RV8 A;  1ZLK A;  4WXC A;  1ZG5 A;  2PMH A;  5A2Q K;  1FP2 A;  4WWC A;  4EQQ A;  5HOO A;  2NS0 A;  2VOD A;  2ADU A;  4ON0 A;  4KNY A;  1TTY A;  2A69 F;  3U2R A;  4Y13 A;  3H3Z A;  1TNT A;  1LDK B;  4YFN F;  4L9T A;  3JW4 A;  4P9U A;  1B9N A;  3HHH A;  3ABU A;  3EYY A;  4AIJ A;  2K7L A;  4XRF A;  2K4B A;  2EA2 A;  5DYM A;  2F5E A;  3DPL C;  1ZAO A;  2L4A A;  2VT2 A;  4I0B A;  1Z6T A;  1L0O C;  4XSX F;  1IN7 A;  1SMY F;  3GVA A;  1R58 A;  2HQN A;  3KFW X;  2E1C A;  1Z7U A;  3T8R A;  3ERE D;  2AXL A;  5CVJ A;  4ESF A;  4RB2 C;  4B8X A;  3E6B A;  2BBY A;  2JTV A;  1BBY A;  5CVU A;  2OZ6 A;  2IPQ X;  3LAP A;  3K0L A;  1PDN C;  3WE3 A;  1Z05 A;  4GXO A;  5LRR A;  2EFN A;  3KE2 A;  2R7D A;  2HYF A;  3F8M A;  2H94 A;  1ZN2 A;  4G7Z F;  1OYY A;  3T0Y A;  5LGU A;  3K1M A;  1T0F A;  1IRG A;  4RS8 A;  2FML A;  4DNC A;  3V7S A;  1XSD A;  4EM2 A;  4A2U A;  3NRV A;  3LA3 A;  3MZY A;  4CIC A;  4N0B A;  2FSW A;  4MTD A;  3L2C A;  5CVI A;  4EM1 A;  1YG2 A;  3KP7 A;  4OIN F;  2YX7 A;  4NB5 A;  2FRH A;  3I54 A;  5D4R A;  1B1B A;  3WTV C;  5CLS A;  1ULY A;  1O3T A;  2P8T A;  1QNT A;  3FMS A;  1ON2 A;  2BV6 A;  2GA2 A;  5TRD A;  1G3W A;  2Z9O A;  3D0S A;  3N97 A;  3R61 A;  4ZH4 F;  3GXO A;  1GXQ A;  3EDP A;  3BDD A;  1VTN C;  1MKM A;  4RB1 A;  1AWC A;  1ODD A;  4ZZD A;  2DAO A;  3G73 A;  3FMR A;  2F5F A;  3R4K A;  5LHG A;  2EA4 A;  2ETH A;  4OIO F;  2FU4 A;  2DI3 A;  2VXZ A;  1TW3 A;  2RGV A;  2UXN A;  3PFI A;  5LHI A;  2HR3 A;  2VOO A;  4Q48 A;  3CUQ B;  3F6O A;  2XKP A;  3WTS C;  2IJL A;  3GWZ A;  1O7F A;  3EQL F;  2FEZ A;  2DT5 A;  2FF4 A;  2FA5 A;  3BOQ A;  5DDG A;  4P55 A;  1CF7 B;  3K69 A;  3IWF A;  4L0Y B;  2V9V A;  1KYZ A;  4BH9 A;  4WCG A;  4GYG A;  4CXF A;  4P96 A;  4HQM A;  5AON A;  2HTJ A;  1AOY A;  2EWN A;  4G8X A;  2MLG A;  5ILS A;  3M9A A;  2NRA C;  3V8J A;  1LB2 A;  1KU7 A;  4UV9 A;  2A3S A;  1OMI A;  2ZKZ A;  1W7P A;  1O3Q A;  4LK0 F;  2G9W A;  5BOX A;  2W57 A;  3GF2 A;  3HOT A;  2KJC A;  4KIG A;  2OD5 A;  1YTY A;  2MD5 A;  2ZBK A;  1YYV A;  5FFZ A;  1KQ9 A;  4A6E A;  4L9V A;  2STT A;  3VFZ A;  1C0W A;  2QBY B;  1GXP A;  1RI7 A;  4L9J A;  4OMZ A;  3JAM K;  2IP2 A;  4AD9 A;  5DUI A;  1P6R A;  5D6F A;  4M9X A;  4HOB A;  2HFH A;  2LDU A;  2WTE A;  4CDG A;  4IHS A;  5BQT A;  1FSE A;  1MD0 A;  2J5O A;  2FXA A;  2Z3Y A;  4U88 A;  1FYM A;  5D5V B;  4MTE A;  1X3U A;  4BQA A;  1BI0 A;  3GUD A;  4PZJ A;  1UHW A;  2H6B A;  4IXA A;  3GFI A;  3TOA A;  3O3K A;  5DV5 A;  4IRG A;  4HQE A;  5LBQ A;  4R8H A;  2PN6 A;  3GFJ A;  2ACJ A;  3HSF A;  2P7C B;  4I01 A;  3RKW A;  2YX4 A;  1FBQ A;  2IA2 A;  2OU2 A;  3E5X A;  4EGZ A;  2EFP A;  5DD8 A;  4LG0 A;  2RQP A;  5E8G A;  1D3Y A;  2FOK A;  1G6N A;  3ABT A;  2LKP A;  3ROU A;  1FYL A;  2BEO A;  2FBH A;  5L3E A;  2EB7 A;  1I27 A;  1YLF A;  1KQ8 A;  4EJV A;  4RB3 C;  3U9G A;  3GLX A;  1G3T A;  2XV4 S;  1K7A A;  4HA8 A;  1S3J A;  2V6C A;  2EFQ A;  1ZRF A;  5LEK A;  5JVT A;  1T39 A;  5F6F A;  3VOE A;  1ZGJ A;  3ZP5 A;  3I0T A;  5A2Q Z;  2GAU A;  3TO7 A;  1R22 A;  5CVV A;  1J75 A;  1W7P D;  2V1D A;  2XAG A;  2GZW A;  3U1D A;  3WGH A;  1HW2 A;  3RKY A;  1RZ4 A;  3E6D A;  5H20 A;  1JHF A;  2UWM A;  4RGS A;  3K1N A;  3KP3 A;  5J8F A;  5FGM A;  3KZZ A;  2VC0 A;  4O5V A;  1SFU A;  2OAZ A;  3VEP A;  3RPU A;  2ISY A;  4CZZ A;  2VOP A;  4R1H A;  1FYK A;  2OBP A;  3VOD A;  1XGO A;  2ZCW A;  2V1X A;  3FXR A;  2CQK A;  4IHT A;  1XCB A;  1LDD A;  2O61 A;  4PCQ A;  3LST A;  5D4S A;  5KK1 A;  4Y17 A;  2DK5 A;  1IXC A;  1T38 A;  2KKO A;  1EH7 A;  1KA8 A;  3F23 A;  3HHG A;  1IN4 A;  2GA1 A;  2O03 A;  3TGN A;  5LGN A;  1PUE E;  1HKQ A;  1IAW A;  4LFU A;  2DW4 A;  3DQV C;  1J0R A;  3FF5 A;  4U0V A;  1G3S A;  2QQB A;  2KIF A;  3CO7 C;  1K78 A;  3REO A;  2CSO A;  4TV7 A;  4G7H F;  2JSC A;  1HSJ A;  5HDN A;  4WK8 F;  2LF8 A;  3JSP A;  4ESJ A;  5E18 F;  2UZK A;  5AIQ A;  3C1D A;  4GGG A;  2DFI A;  3MFK A;  5L3B A;  3SQN A;  4DQ2 A;  2ELH A;  2A5Y B;  1HKS A;  2W25 A;  3Q9V A;  4ZYE A;  2DK8 A;  4HAM A;  2K4J A;  2KIM A;  2QQA A;  5EEH A;  2P5L C;  1BC8 C;  4A0Z A;  4RGR A;  4B09 A;  1ONV A;  3CDH A;  3CJN A;  4IJA A;  3HRU A;  2ZXJ A;  2HS5 A;  1TNS A;  3LWF A;  3ZMT A;  5H6R A;  2PI0 A;  4RGU A;  5BPI A;  3TO6 A;  3F22 A;  1D8J A;  4EJW A;  6PAX A;  5FB2 A;  3WTW C;  2YR2 A;  5E8I A;  3EET A;  4L9N A;  1OPC A;  4ENN A;  1ZG3 A;  3E97 A;  3WGG A;  2LNB A;  3WU1 B;  4Y15 A;  1FNN A;  1B59 A;  2VBW A;  3ZMV A;  2V79 A;  2VE9 A;  4KUM A;  2K02 A;  2PFB A;  4L0Z B;  1YFH A;  4UXN A;  4L5I A;  1Z6R A;  1MZB A;  2D2W A;  5JFR A;  1ZRD A;  1JXS A;  4EJT A;  1QO0 D;  4KFC A;  2L4M A;  3PQK A;  1XCV A;  1XDS A;  2NYX A;  5LRS A;  4M9Z A;  1LDJ A;  4WX9 A;  4XLN F;  2XAQ A;  3I4P A;  4LK1 F;  1XGN A;  1ZLJ A;  3KEO A;  3TDZ C;  3OV8 A;  2M8E A;  2EV0 A;  2YPR A;  2DO7 A;  2IA0 A;  3KP6 A;  1I1S A;  3L9F A;  1BI1 A;  4M71 A;  2W24 A;  3H3U A;  2DTR A;  5E20 A;  1OKR A;  1ZG1 A;  1QGP A;  4Q5S F;  5LLQ A;  3JAM Z;  2CO5 A;  1ZHF A;  2PMU A;  1YO5 C;  1GVJ A;  4LB5 A;  2KIU A;  1P2F A;  4XLP F;  1ZRE A;  3V4G A;  3ZQ7 A;  1ZAR A;  4KYW A;  3P7N A;  2OQG A;  1LQ1 A;  5D5X B;  5EEG A;  4OIR F;  2JPC A;  3QAH A;  3R60 A;  3HIF A;  4P9F A;  2P6S A;  4YFK F;  5D5W B;  2HQR A;  3SFZ A;  2QWW A;  2Y0M A;  2PEX A;  4IPA A;  1H9G A;  5K5R A;  3OOP A;  3ZN0 A;  3KLN A;  3NEU A;  4HZF A;  4KDP A;  1KU9 A;  2HTS A;  1W7P B;  4H0E A;  2Z5U A;  3DPT A;  5LEJ A;  2RC4 A;  1FX7 A;  1W4M A;  2KRF A;  1KGS A;  3FWE A;  4YG2 F;  3F21 A;  1IN8 A;  2HKX A;  3KCC A;  3TO9 A;  3HRT A;  4HBL A;  4IRI A;  4UV8 A;  1H0M A;  3C18 A;  3VB2 A;  2QM3 A;  2UXX A;  4GYI A;  2ZME A;  4KIC A;  5ICG A;  3BZ6 A;  2JT1 A;  1XDU A;  1Z91 A;  3DV8 A;  3NQO A;  2ZFW A;  2HGC A;  2H6C A;  4KIB A;  3KP5 A;  2QLZ A;  3P9K A;  3MEX A;  3V8L A;  4ENK A;  1FY7 A;  1F4K A;  2G7U A;  3RPQ A;  2R7F A;  3FHZ A;  4HLX A;  1YQA A;  4LG0 B;  4NQW A;  1S7A A;  2M45 A;  3SZT A;  5JI6 A;  4KT5 C;  4UUV A;  4LJZ F;  5ED4 A;  3QU3 A;  3J81 Z;  4MQ9 F;  4U0W A;  3FM3 A;  1SMT A;  2XGX A;  1Y0U A;  1ZGA A;  3IKT A;  2WWY A;  3KZY A;  4S05 A;  3HUG A;  1LVA A;  2LF7 A;  4ZYG A;  2DPD A;  3ECO A;  1ZYR F;  3ZMS A;  4BHC A;  3ZMD A;  5F1R A;  2Z33 A;  5HLI A;  1UFM A;  2GXG A;  3QOP A;  1O57 A;  3KLO A;  3K2Z A;  1KQ0 A;  1YW8 A;  3V8K A;  5IT3 A;  5LHH A;  4A0Y A;  3DXJ F;  3R6S A;  3WTU C;  3F3X A;  2XIG A;  2EFW A;  1YS6 A;  3L09 A;  1CGP A;  5F64 A;  1OYW A;  1PP8 F;  5DCF A;  5J8C A;  5ILV A;  1J9I A;  4MNU A;  1HKT A;  1OYI A;  1RUO A;  3I59 A;  2H09 A;  3GW2 A;  2CFX A;  2COM A;  4BAY A;  3S2W A;  5D8L B;  4HDV A;  3GZ6 A;  3I64 A;  1Z1D A;  5ERI A;  3CO6 C;  2DU9 A;  2JRT A;  4AWX B;  1STZ A;  3IL2 A;  4KN7 X;  2DQL A;  1TQI A;  1WRJ A;  2D45 A;  2FE3 A;  5DD4 A;  2BE5 F;  1SFE A;  4HF2 A;  2E1N A;  2XAJ A;  1T98 A;  1O7L A;  3GYH X;  4Z2Y A;  3HYI A;  1P4A A;  1BN5 A;  4XSZ F;  3FX3 A;  1U6G A;  1MJA A;  3EYI A;  1FBS A;  3HOS A;  1P92 A;  4KIF A;  1K78 B;  1HW5 A;  4MGR A;  2DPU A;  5HS9 A;  1V3F A;  1MDM A;  1DP7 P;  1SD6 A;  1BI2 A;  3QP5 A;  1G3Y A;  1KYW A;  2W85 A;  1S6L A;  4PGG A;  2O6G E;  1KU3 A;  1IUY A;  1S7O A;  1IXS B;  3B73 A;  1IRF A;  3DFG A;  1P4W A;  5D6E A;  3HRM A;  2JZY A;  5HS7 A;  3L00 A;  4AIK A;  3MZH A;  2QEN A;  3E6C C;  2KJB A;  1F9N A;  5ICE A;  1D5V A;  4HYE A;  4A0X A;  3R0J A;  1TBX A;  1RIO H;  1R1V A;  3P9C A;  4HX4 A;  1SD7 A;  1S29 A;  1U5T A;  1MGT A;  2QQ9 A;  1Z9C A;  3W6J B;  4G94 A;  3ZN1 A;  2PQ8 A;  3J81 K;  4QWQ A;  4LLN A;  4LGW A;  4L18 B;  3WU0 A;  3EUH A;  3WTT C;  1R00 A;  2IVM A;  1U5T C;  4UHT A;  1R5G A;  2EJR A;  4CHU A;  1BC7 C;  5DUK A;  4I0A A;  2A6H F;  2ZJ2 A;  2RDP A;  5TJJ A;  1XD7 A;  2BGC A;  3JSO A;  4EGY A;  1NHA A;  5IT9 Z;  2F5C A;  2NNY A;  1IXR C;  3PQJ A;  1B6A A;  3WTY C;  4ENM A;  4I09 A;  4FX0 A;  3M7G A;  2GIV A;  1OR7 A;  4HF0 A;  2D1H A;  2P6T A;  1R1T A;  3GEZ A;  4CYD A;  1FPQ A;  4HX8 A;  4YII A;  3J7A O;  5E1W A;  4HV6 A;  2QYO A;  5K5Q A;  2X4H A;  2JPB A;  2L3D A;  1UCR A;  4FHT A;  3RJP A;  3IC7 A;  4CGZ A;  3MAJ A;  3MCZ A;  1LJ9 A;  3L7W A;  3DP7 A;  1FLI A;  1HST A;  2WV0 A;  4RAY A;  3WOD F;  5L3C A;  1SFX A;  2O8X A;  4JQF A;  5L3F A;  4U0Y A;  3BPX A;  2VBZ A;  4UNO A;  4M6X A;  3E6M A;  1SD5 A;  1LEA A;  1R7J A;  2EFO A;  2VT3 A;  3GFL A;  2H27 A;  2XHK A;  1BIA A;  2QUF A;  1FOK A;  2ZO4 A;  2FNP A;  1FT9 A;  4AIH A;  5FD6 A;  3I58 A;  4BHP A;  2CYY A;  3LQR A;  2M30 A;  2RN7 A;  1HXD A;  1BIB A;  1W5S A;  4HX7 A;  4HF1 A;  1WI9 A;  4HDU A;  3HTU A;  4O6J A;  2EV5 A;  4R79 A;  2D1V A;  1JE8 A;  3DKW A;  3RYP A;  1RUN A;  3F8N A;  3FZV A;  4UVC A;  4I98 B;  1WQ2 A;  3TOB A;  1XB4 A;  3O2P E;  4IVN A;  3DEU A;  3V7C A;  2BYV E;  2NNN A;  3Q9S A;  4BHB A;  3QPH A;  1BOA A;  1UHM A;  1XSX A;  2LSO A;  4E70 A;  1YW9 A;  3COA C;  1QQI A;  5HLG A;  3T1B A;  3GX4 X;  1A04 A;  1XGS A;  4HW0 A;  1FZP B;  3KEQ A;  3IRQ A;  1QPM A;  4Q4Z F;  2ZME B;  5K5O A;  4A6D A;  3D5L A;  5FLX K;  1IW7 F;  3RTR A;  3IHU A;  2IRF G;  2XRN A;  4A5M A;  3O6B B;  4GO1 A;  2DLL A;  4OU0 A;  4WXH A;  4ETS A;  3RI4 A;  3E5U A;  2HZT A;  4IF4 A;  1GHC A;  4F7Z A;  4BXU A;  1I5Z A;  1U8R A;  1UB9 A;  1UST A;  1U78 A;  2XRO A;  2HWV A;  5IT9 K;  1XMA A;  2TDX A;  2P5V A;  4O3M A;  1QBJ A;  3QPT A;  3BJ6 A;  2OQR A;  5DCM A;  3T8T A;  2Y48 A;  3KP4 A;  3BWG A;  1DPR A;  1DDN A;  1QZY A;  3FXU A;  3I53 A;  1J59 A;  2L02 A;  3ZMZ A;  4KMF A;  1I6X A;  5H6Q A;  3WG9 A;  1F5T A;  2Q2E A;  3WGI A;  1WSU A;  2P7V B;  1BJA A;  2HOE A;  3SHF A;  3TDU C;  1MJB A;  3M1E A;  4RAZ A;  1BM9 A;  1HQC A;  5DEQ A;  1Q1H A;  3ML6 A;  1USS A;  1EV7 A;  2CG4 A;  3IRR A;  4WF2 A;  5JR3 A;  1ZH5 A;  2MLK A;  1IZ1 A;  3Q5F A;  2WC2 A;  2E7X A;  4YFX F;  2VE8 A;  2W84 A;  4K2E A;  2GXB A;  2Q0O A;  3HSR A;  4PGH A;  5LGT A;  4LMY A;  2CW0 F;  1EH8 A;  3SXY A;  4AVP A;  1TQP A;  3ZMU A;  3QRF F;  3I59 B;  1DPU A;  3FMQ A;  1IN5 A;  2YSR A;  2MC3 A;  2XAH A;  2VBY A;  3F72 A;  1DUX C;  2ZNY A;  4Q47 A;  5L3D A;  4A12 A;  1F1Z A;  1G4D A;  4PDK A;  5ICC A;  2GWR A;  3M8E A;  1V4R A;  1JHH A;  1JGS A;  1O3R A;  1U2W A;  4OMY A;  4MHG A;  3G3Z A;  3RIR A;  3FXQ A;  4UVB A;  3BY6 A;  4EM0 B;  5CVR A;  2L01 A;  2A68 F;  3WTX C;  2STW A;  2Y75 A;  1LEB A;  3J80 Z;  5KVR A;  2PLY A;  4P5O A;  3LA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...