3ZQ7A

The structure of dna-binding domain of response regulator from escherichia coli k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN KDPE
publication title Structure-Function Studies of DNA Binding Domain of Response Regulator Kdpe Reveals Equal Affinity Interactions at DNA Half-Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zq7A00
2A5YB 4PGHA 1ZLJA 3EETA 4A0YA 2LF8A 2M1BA 3CJNA 1FYKA 3GEZA 3RKXA 4RAZA 5E18F 4LB6B 3IL2A 3E5XA 4HYEA 4FX0A 1O7LA 4LB5A 5E1XA 1MD0A 1G3YA 4KIGA 4NB5A 1JE8A 2JSCA 3HUGA 4P9FA 3MFKA 1HKSA 1O3RA 1RIOH 5CVJA 2RGVA 4Y13A 2KKOA 3K1NA 1XSDA 4KDPA 5DYMA 2H6BA 3P9IA 4LD5A 3VODA 3KP5A 4Y15A 1F1ZA 3ZN0A 4MEXF 2HS5A 3T0YA 4KUMA 1WQ2A 3KP6A 2FNPA 1XDSA 4G7OF 1USTA 4IJAA 4A5MA 5LHGA 2DAOA 2GA2A 2VBZA 2DW4A 2L01A 5L3BA 2VE9A 2JT1A 1XGMA 5JHUA 4CHUA 2GQQA 3HSFA 2NYXA 4U0YA 4Y17A 4HX7A 2OAZA 2QM3A 1GVJA 1SFEA 1YW7A 3I53A 4R79A 2PBIA 4M9ZA 1BIAA 5CYVA 1LVAA 3IWZA 2Z3YA 2DK8A 4IRHA 4EM1A 1XSXA 4HLXA 2KJBA 1XMAA 2Z5UA 4RGXA 2GXGA 2XV4S 3S2WA 4KNYA 1W7PB 4P5OA 3EDPA 1Z05A 1QO0D 1FLIA 4BAYA 3GF2A 2ELHA 3IHUA 2ISYA 1ZYRF 2YU3A 4LK1F 3CO6C 4EJWA 2IPQX 3TOBA 4I02A 5CJ9A 2FXAA 3SZPA 2O8XA 3ROUA 4ENMA 1R22A 4YG2F 2ZBKA 3RKYA 3KZZA 4A0ZA 2DQRA 3ZQ7A 1FP1D 3FF5A 3MZYA 3RYPA 4P55A 5F64A 3CLOA 4XSXF 3WE2A 4ESBA 2HWVA 4RGSA 4BHPA 3D0SA 4LG0A 2FE3A 1XCVA 2ADUA 2ETHA 3J7AO 3Q5FA 1H9TA 3TDZC 4OIPF 4XSZF 4N9HA 3REOA 3QPHA 1U78A 2VT3A 5IT9K 1IW7F 3R0JA 2O61A 3L09A 5BPIA 4ENKA 3F3XA 2MBFA 4NHJA 3MZHA 1K79A 1I1GA 3ZN1A 1IN4A 3RDIA 1IN7A 1REPC 2XAQA 3LQQA 1S29A 1YYVA 1J5YA 1SMYF 4IHSA 3J81Z 5EEGA 3LA7A 4L9JA 2YX7A 2Y0MA 1T39A 2FOKA 3PQJA 3QU6A 2OU2A 2F5CA 4ETSA 1O3SA 3V7SA 2OA4A 4UNOA 1HSTA 2F5DA 1FPQA 4A6DA 4GYGA 1XGSA 4HX8A 4M71A 2ACJA 2BEOA 2XGXA 1KU3A 1XCBA 4YFKF 1J0RA 1DPRA 2W24A 5A2QK 3F8CA 3MCZA 1R00A 1U2WA 4ESJA 3MEXA 4HF2A 4S04A 1XB4A 4O3MA 1S8NA 1V3FA 3SZTA 2K4BA 2W84A 3GYHX 3WE3A 1LNWA 4EGYA 4HQEA 1KYZA 1QZZA 4D0PA 3R60A 2STTA 3R6SA 5FO5A 5FD6A 5HS7A 3L2CA 3RJPA 1ULYA 1PDNC 1ZG1A 3E6BA 4L9NA 1G3TA 3NEUA 4IHTA 5DCFA 1WSUA 2RC4A 1SD7A 2MLGA 2YR2A 2H6CA 5D6EA 5LRSA 2HDCA 4EM0B 2X4HA 1V4RA 3IC7A 2A07F 4AVPA 2MC3A 4RGUA 1EH6A 4ENJA 2JTVA 1XGNA 1RI7A 1BI1A 2FA5A 2IP2A 1H0MA 1MZBA 2M30A 4P96A 5D8LB 3FZVA 1UHMA 4FX4A 3WU1B 3F8MA 5HDGA 3LFKA 1QPMA 3H3UA 4WXDA 2A61A 5AONA 1VTNC 1IN5A 5DD4A 3V8LA 4MEYF 4BYYA 3RPQA 2EV6A 2R7DA 4MTEA 2M8EA 2P6TA 5K5RA 5D4SA 5DDGA 1U8RA 1FBSA 1USSA 1FC3A 3WTSC 1HBXG 4U7BA 1FX7A 2XAHA 3GUDA 3HOTA 3KP7A 5ICGA 1D8KA 3JAMZ 1U5TC 3ECHA 3CUQA 3I4PA 1P4WA 3GFMA 4Q4ZF 1ZAOA 2H27A 3FXRA 2E1CA 1BOAA 1XSVA 2EV0A 2QQBA 1RUOA 4YIFA 4KA4A 2GIVA 3O3KA 5DD8A 5ERIA 2A6HF 1S3JA 2XKPA 3HSEA 1KQ0A 3COAC 3C3WA 2RNJA 3VB2A 4KN4X 4RB2C 4HF1A 2UZKA 4F7ZA 1HSJA 2TDXA 3PQKA 1FNNA 3DPLC 3T8RA 4EGZA 1B59A 1WWXA 1IRFA 5CVRA 3DP7A 1TNSA 3QRFF 4CYDA 1SFXA 1DDNA 5HOOA 5ILSA 4RAYA 5E20A 1BC7C 2R7FA 4XLNF 3BPVA 3KP2A 4M9SA 3WTWC 2XUBA 2BYVE 2EK5A 1B9MA 1IN6A 3RI4A 4AIHA 5K1YA 2BV6A 2OZUA 2P7VB 3IRRA 2QLZA 2VN2A 2NAZA 4I01A 3MWMA 4N9IA 3N97A 3F22A 2CGPA 5FGMA 3F6VA 4I98B 5CVUA 3QU3A 2HYGD 2EFQA 2ZJ2A 4EM2A 5JR3A 2W57A 2DLLA 2Y48A 4BQAA 4WCGA 1EH8A 5FFZA 3WTTC 1PP8F 3F8FA 4CGZA 3M7GA 3DEUA 2OD5A 3AAFA 4MGRA 4L0ZB 3F72A 4DNCA 2E7XA 5LEJA 4A12A 1BM9A 2WV0A 1T0FA 1TW3A 3WTYC 1DP7P 3FMRA 2VBYA 1TQPA 1Z6RA 2FBKA 3K9TA 4ZYHA 3V8KA 1FZPB 4GCVA 3GXOA 2HFHA 3M8EA 2Q2EA 3HIFA 3BZ6A 2XAGA 2EFNA 3SQNA 2X0LA 2G7UA 2FEZA 2LSOA 3W6JB 3CO7C 1YTYA 1ODDA 3ABUA 1S7OA 4FHTA 1QGPA 2O03A 5DUIA 4KT5C 1XDUA 1O3TA 4DQ2A 3I59A 4MNUA 4YFXF 1TQMA 1TW2A 3T8TA 1B4AA 2P6SA 3M1EA 4YIIA 1G4DA 3R0AA 4UUVA 5H6QA 1LEBA 3LWFA 4GYIA 1H9GA 4BH9A 3SXYA 2EA2A 3HSRA 3U9GA 1TBXA 1R58A 2PG4A 4TV7A 3ZMTA 1GXPA 3M8FA 1ON1A 1OKRA 2OQGA 2HTSA 5J6XA 5ED4A 5J8FA 2CQKA 2GWRA 3L9FA 1FT9A 1K6OA 2AS5F 1YIOA 2M87A 4LG0B 5K5OA 1B9NA 5BOXA 2RVCA 3EYYA 3E3VA 1I6XA 2YSRA 1U6GA 1SD4A 1XN7A 3FHZA 2GA1A 3CTAA 4PCQA 1IF1A 2W25A 1E17A 5L3EA 2HQRA 2JPCA 2C6YA 3JTGA 4L9TA 4UVAA 3IKVA 3KLOA 4AIJA 2MLKA 5KK1A 3BOQA 3C18A 1UHWA 1G6NA 4OMYA 2M5WA 3RPUA 2VXZA 5ICCA 2DU9A 3ECOA 3HYIA 1R5GA 2F5EA 6PAXA 1GXQA 3GFIA 4KIBA 4HDUA 2DBBA 1BJAA 2KIMA 3GZ6A 1TNTA 4PGGA 5BMZA 2XROA 2K4JA 2FNAA 4U88A 5HDKA 2VC1A 5HLHA 1I27A 4WXCA 3HRSA 3ISPA 2VC0A 3WG9A 4ENNA 3J80Z 4GGGA 2QQAA 5D5WB 2V6CA 1O57A 4UV9A 1Z91A 3I71A 2UWMA 2CSOA 3V8JA 2ESNA 2A6EF 5ILUA 5ILVA 2WWYA 1AWCA 1Y0UA 1STZA 1OR7A 4WF2A 4N0BA 4MTDA 1LDKB 2EJRA 2RV8A 3TGNA 3VEPA 1D5VA 5L3DA 2ZCWA 4IPAA 5HLGA 3FX3A 1BI2A 1FP2A 3BJ6A 4QWQA 1LB2A 1U5TB 1ON2A 3B73A 2PLYA 3ELKA 2F2EA 1XGOA 5IT3A 1B6AA 2K86A 4HDVA 1OPCA 3Q9SA 4BHBA 1P6RA 4IVNA 1FYLA 3WTZA 2OQRA 2G7HA 2PEXA 2PN6A 4Z2YA 2LKPA 4HX4A 2FU4A 1RNLA 3M9AA 2A69F 1T2KA 2HR3A 2PFBA 2ZO4A 1NHAA 2ISZA 3BWGA 3JW4A 5EEHA 4OIRF 3BJOA 1QBJA 5L3CA 2OZ6A 1IXSB 2QQ9A 3E6DA 1YO5C 3HRMA 2VBXA 5D8KB 1D3YA 2NNNA 3NRVA 1W4MA 4EJTA 2ZNYA 2IRFG 2VE8A 5HDNA 5D4RA 2L02A 4G94A 1P4AA 2V9VA 5H20A 2XKOA 5DV5A 1R7JA 4L18B 3R4KA 2K02A 5LEKA 4KICA 4L0YB 1U5TA 2VODA 4OIQF 5HS8A 1L0OC 1FOKA 5ICFA 1HKQA 1QNTA 2ZXJA 3E6CC 2ZNZA 3HRTA 3VFZA 3WTXC 3WODF 3FXQA 3I0TA 3ZMZA 3CUQB 5E17F 3JTHA 5IT9Z 1T98A 3I5UA 2RDPA 1R36A 4WWCA 5LHIA 1K78B 2O3FA 3LQRA 2QZ8A 2R3SA 4RB3C 4UV8A 2W85A 3GLXA 1ZG5A 3WGHA 1IAWA 2ESHA 4K2EA 1BI3A 3EYIA 1CF7A 4UVCA 2XASA 1KU9A 4ASNA 3JSOA 5L3GA 1KA8A 4S05A 1XMKA 2QVOA 4ZH4F 5LBQA 1SD5A 2HTJA 2BGCA 2EV5A 4JK1X 1IXRC 1YFHA 3I54A 2MH9A 3FMSA 3IWFA 1SD6A 4R8HA 3JSPA 4M6XA 1YS7A 3FM3A 2K27A 4JQFA 1HKTA 3H92A 1MJ9A 1MDMA 5LRRA 2XVCA 4EV0A 3KEQA 4ZYGA 4EMSA 1B1BA 5A2QZ 3Q9VA 1OMIA 2F5FA 2O0YA 2H94A 2HEOA 2DPUA 1K78A 3FXUA 3G73A 4EJVA 2J5OA 4A2UA 1OYWA 4HQMA 5HVQC 3HTUA 1C0WA 1D8JA 2LNBA 1LEAA 5DEQA 2KRFA 2JZYA 2IW5A 5D5UB 5LLQA 4RS8A 3GWZA 2NRAC 4ON0A 2L4AA 2V79A 5CVVA 2L54A 2IVMA 2WTEA 3H3ZA 3SHFA 1Z9CA 1LDJA 3FMQA 2KIFA 4G9YA 3ERED 3U2RA 2IA1A 1G3WA 4KIFA 4U0VA 2MH2A 2GAUA 4ZZDA 3F23A 4QLCU 3EUHA 1HXDA 4HZFA 4Q48A 3K2ZA 2RN7A 3TQNA 2HQNA 2STWA 4PZJA 1MKMA 2PJPA 5CLSA 2ZKZA 5E8GA 3ZMDA 4LLGF 2XAJA 2A3SA 2P7CB 3BPXA 3T1BA 3B02A 3MAJA 1FY7A 3FM5A 1PUEE 1FSHA 1QQIA 4BXUA 2D45A 4IRGA 1R1TA 5H6RA 3GX4X 2IA0A 4Q47A 4IF4A 1FYMA 4LGWA 4HLYA 2HKOA 1OYYA 2KIUA 1P2FA 2OBPA 2VT2A 1JXSA 1LQ1A 2CYYA 2FSWA 5DCMB 1ZREA 2CW0F 4AIKA 1F9NA 3I59B 3L00A 3CUOA 4ESFA 4E70A 4CDGA 3V7CA 3TKYA 2QYOA 4LLLA 4XRFA 3RIRA 1ZHFA 4UVBA 1O7FA 3NQOA 1YG2A 4I0AA 4OIOF 2EA4A 3E5UA 1KQ9A 1JHFA 1TQIA 2J5PA 1FBQA 1A04A 1YS6A 3R61A 5FFXA 2P5VA 1IRGA 1HW1A 4GO1A 4L5IA 2VOPA 1K7AA 2WC2A 1DPUA 2QWWA 5DCMA 1E2XA 4G6DA 4I0BA 3F6OA 3J80K 1F4KA 4FT8A 4MHGA 2XAFA 1W5TA 4P9UA 2CO5A 1KU7A 2O6GE 5D5VB 1T6SA 4AWXB 2QENA 3J81K 1LDDA 2P4WA 3QPTA 2GZWA 2D1VA 1BIBA 3F8BA 2ZMEB 2DO7A 3K1MA 1KU2A 2A68F 5TRDA 4O5VA 1P4XA 2DFIA 1R5HA 2FF4A 4EJOA 3V7RA 5AIPA 1KQ8A 1TTYA 1ZRDA 1FSEA 2FQ3A 3ZMUA 5JVTA 2DT5A 3KP4A 4HA8A 5FLXZ 1I5ZA 1W5SA 5BQTA 1EH7A 1Z1DA 2FBIA 2EFWA 1ZGJA 2Z99A 1GHCA 2IA2A 1KYWA 3OV8A 5J8CA 2P5KA 3ZP5A 5KVRA 2QBYB 3RKWA 4RB1A 3SFZA 2XHKA 3TO6A 3D5LA 2E7WA 4AD9A 4YFNF 1ZGAA 5JFRA 5HS9A 3K0LA 1DUXC 4M6YA 2ZMEA 3ABTA 4XBFA 3KCCA 2FMYA 4MQVA 2E1NA 2M45A 4R1HA 4KN7X 3LAPA 4I09A 3DQVC 1WKMA 4Q5SF 1WRJA 5L3FA 2NS0A 1J2XA 1FBUA 2B0LA 1BBYA 3EQLF 3DKWA 2H09A 1R1UA 2LF7A 3P7NA 1J9IA 1R23A 3HTSB 4HOBA 4G6QA 4GXOA 2Z9OA 4A6EA 2LDUA 1XD7A 3G3ZA 2DTRA 2QBYA 4O6JA 2UXNA 2AXLA 2EFPA 1W7PA 3O2PE 3LSTA 2HKXA 4B09A 3KEOA 4G7ZF 1S7AA 3DXJF 3QP5A 3T5XA 3QAHA 3BJAA 4JBAA 1ZH5A 2D1HA 3DFGA 3KETA 4HBLA 2V1DA 3KFWX 2VBWA 1TLHB 1RZ4A 4HF0A 5CVIA 4L5JA 4M73A 5E1WA 1ZLKA 2K7LA 1SFUA 4HV6A 4G8XA 4XLPF 3ZMVA 3TO9A 3TOAA 5F6FA 4WK8F 2Q0OA 3P9KA 3ZPLA 1LJ9A 4I7HA 3ZMSA 1S6LA 1ZRCA 5E1ZB 4LLNA 2UXXA 1R1VA 2Y75A 2IT0A 4A5NA 2DQLA 2VONA 1ZARA 4HW0A 3JAMK 2COMA 3KLNA 2EB7A 2IJLA 5D5XB 3DF8A 4OOIA 1J7KA 4UHTA 4CO8A 3MQ0A 1SAXA 5K5QA 1P92A 2KJCA 3KZYA 3LA3A 4B8XA 1T38A 1J59A 1FWZA 1ONVA 4HAMA 4L9VA 1CF7B 3GW2A 4KMUX 2HYFA 3BP8A 1PP7U 3ML6A 3VOEA 4CXFA 4CICA 4KYWA 4WXHA 3OOPA 3CDHA 2P8TA 2G9WA 1I1SA 3WGGA 3HOSA 1RUNA 4PDKA 2FBHA 2HZTA 5FD5A 2RQPA 1CGPA 2YX4A 3QOPA 1UFMA 5ICEA 3C7JA 1MDMB 4LK0F 2L3DA 1ZG3A 5LGTA 3PFIA 3GVAA 4HV5A 1BN5A 3F21A 2XRNA 4BNCA 1QZYA 4IXAA 3WTVC 2HGCA 2PMUA 5BS6A 2RKHA 2PQ8A 3L7WA 1X3UA 1MJAA 4M72A 3IKTA 1IUYA 5HLIA 4IRIA 3K1PA 4CZZA 3V4GA 3GZ5A 3E5QA 1G3SA 4ZYDA 4MQ9F 1YW8A 3P9CA 5TJJA 2DPDA 1MGTA 1JHHA 4OMZA 3O6BB 1MJBA 3HHHA 4NQWA 3E97A 4LFUA 4G7HF 4RGRA 2QUFA 2ZFWA 1O3QA 2HOEA 4M74A 2MA3A 1BI0A 1Z6TA 4KMFA 2D2WA 3E6MA 3IRQA 3WTUC 5DUKA 2V1XA 4EVIA 4U7DA 1YLFA 2JRTA 1AOYA 3HRUA 1BC8C 3U1DA 3BY6A 3KE2A 3F8NA 4ZYEA 1OYIA 3DPTA 5LHHA 2NNYA 1IN8A 1ZN2A 2EWNA 1HW5A 1YQAA 1F5TA 2JPBA 3W6KB 2MD5A 3DV8A 4OU0A 1L3LA 1SMTA 1W7PD 4OINF 4U0WA 1IXCA 2PMHA 2FMLA 3TO7A 3GO5A 1U3EM 4EQQA 2V1UA 4A0XA 2L4MA 2FRHA 2XIGA 2CWEA 5JI6A 5FB2A 3GFJA 2DI3A 4EJUA 3QP6A 2VOOA 3LAJA 5D6FA 4ZZLA 3BROA 2Q8KA 3ULQB 4RB0A 1UB9A 4M9XA 2YPRA 3LA2A 1Z7UA 2Z33A 1ZRFA 3FWEA 2EFOA 3KP3A 3N4MA 5BPDA 1YW9A 2BE5F 3C1DA 1WI9A 1EV7A 1JGSA 3BDDA 3I64A 2DK5A 4BHCA 1HW2A 3WGIA 3CUQC 2CG4A 2P5LC 3HHGA 2CFXA 5LGNA 2PI0A 1J75A 1HQCA 3I58A 5LGUA 5AIQA 1KGSA 2BBYA 4LJZF 5FLXK 4KFCA 1IZ1A 3GFLA 1Q1HA 2GXBA 4UXNA 4H0EA 4I2OA 3TDUC 4WX9A 4LMYA 1UCRA 3RYRA 3RTRA 3WU0A 5E8IA 5F1RA 3K69A
chains in the Genus database with same CATH superfamily
2A5YB 1K4TA 1FMVA 4PGHA 1ZLJA 2K9MA 3EETA 4A0YA 2LF8A 2M1BA 3A2KA 2K3FA 2L7MP 3CJNA 1FYKA 2VXDA 4XR6A 3GEZA 2X85A 5FLMJ 1U9NA 3SYTA 3RKXA 1Y8RB 3G1OA 4RAZA 4XIDA 2OC6A 3FDYA 5E18F 1CQTA 2JVHA 4LB6B 4J01A 2M4KA 2HXOA 3IL2A 3OSFA 5HODA 3AG3H 3I3LA 3BG6A 5B66C 3E5XA 1MBGA 1K61A 4HYEA 5IP9J 1ENHA 4FX0A 3QYEA 2X1CA 1O7LA 4LB5A 4DYRA 5E1XA 1MD0A 1G3YA 4KIGA 2VQGA 4NB5A 1HF0A 3CDIA 1JE8A 2JSCA 3HUGA 4P9FA 4DYQA 3MFKA 1X4PA 1H8AC 1HKSA 2VQLA 2NOGA 1O3RA 1RIOH 5CVJA 2RGVA 4Y13A 3PM1A 3K6GA 2KKOA 2GBYA 3K1NA 1WZ2A 2FJ1A 1XSDA 2CV0A 1X2NA 5DYMA 4KDPA 2H6BA 3P9IA 4LD5A 3GLLA 3VODA 1YJ9I 3KP5A 4Y15A 1EF4A 4BJTA 2NVXJ 1F1ZA 3ZN0A 4MEXF 3HXLA 2V9KA 2HS5A 3I56I 3T0YA 2M3AA 4KUMA 1WQ2A 3KP6A 2FNPA 4W97A 1TWGJ 4C30A 5J1YA 4LOCA 4A3JJ 3JREA 1XDSA 2PMZA 3S93A 4G7OF 4I76A 3CF5F 3LL7A 1JJ8C 3E0JB 4BS9A 4S0HB 5J4VA 1TZLA 2I8DA 1USTA 4RM3A 2K9LA 4IJAA 4M3FA 4A5MA 5LHGA 2BHZA 3NWTA 2AXTC 2DAOA 1BW5A 1V5GA 2GA2A 2VBZA 2ELJA 2DW4A 2L01A 3K4KA 5L3BA 2VE9A 4BEHB 3LSKA 2JT1A 3ZQGA 1IRZA 1T0FC 1XGMA 4RAFA 5JHUA 3RKQA 4CHUA 2GQQA 3ONQA 3HSFA 2OCCH 2NYXA 4U0YA 4Y17A 2WAQA 4HX7A 2JUGA 4QSHA 2OAZA 2QM3A 1GVJA 2CW7A 1SFEA 3D5SC 3IH3A 4GRIA 4U87A 3MKYB 1YW7A 3I53A 4R79A 2LVSA 2PBIA 2LLKA 4M9ZA 1BIAA 1WI3A 5CYVA 1LVAA 3IWZA 2Z3YA 2DK8A 4IRHA 2LREA 4EM1A 1XSXA 4HLXA 2KJBA 3AG4H 2ICWG 1XMAA 4XLCA 1YITI 5J40A 4XRMA 2Z5UA 1WVRA 3OYCA 4RGXA 2CW8A 2GXGA 2XV4S 3S2WA 4KNYA 1W7PB 3OY9A 4P5OA 4XK4A 3EDPA 4A3DJ 1Z05A 1QO0D 3TP3A 1FLIA 2R7WA 4BAYA 3FK7A 4ZJZA 3G2BA 2BY3A 3GF2A 2ELHA 1H88C 4XM3A 3IHUA 2ISYA 2L9RA 1ZYRF 2YU3A 3OR1C 2VJ5A 4LK1F 3K4CA 2X48A 3K4JA 3CO6C 4EJWA 4CZCA 4M3GA 2IPQX 3S3OA 4D5FA 3TOBA 4I02A 5CJ9A 1SVOA 2F4OB 2ZFUA 2FXAA 4V2FA 3SZPA 2O8XA 3G1MA 1SFKA 4PJMA 4BEHA 2IGNA 3ROUA 1MH4A 4ENMA 1R22A 4YG2F 2ZBKA 3RKYA 3KZZA 4A0ZA 4N4OB 2DQRA 3ZQ7A 1Z3YA 1FP1D 3PO3J 3FF5A 3MZYA 5FKMA 2V9PA 3RYPA 1SVMA 4P55A 5GTIC 3IV5A 5F64A 1OCRH 3CLOA 5IP6A 2LR8A 4AUXA 2DA7A 5IYCJ 4XSXF 2QGUA 4A93J 3WE2A 4ESBA 2HWVA 4RGSA 4BHPA 4CCOA 3HDDA 3D0SA 2ID3A 4LG0A 2FE3A 3CCMI 4BDZA 1XCVA 2ADUA 3D1NI 2ETHA 3J7AO 2LY2A 2ZSHB 3Q5FA 2DODA 2V1NA 2DJNA 5DM6F 1H9TA 3TDZC 2JA2A 4OIPF 4XSZF 1MIJA 3L2QA 4MFDA 4N9HA 3REOA 3QPHA 1U78A 4NC6A 3BQZA 2IGKA 4DIQA 4I6ZA 2JSPA 2VT3A 5IT9K 2JRMA 2RREA 1IW7F 1T8IA 3GTPJ 2CJJA 2E35A 3R0JA 2H1KA 3TP0A 2O61A 3L09A 5BPIA 4ENKA 3F3XA 2IBDA 4ANJA 2MBFA 4NHJA 1K6YA 1PUFB 3MZHA 4UB8C 1BA5A 1K79A 1I1GA 2OPTA 4YIRX 2LBFA 1VI0A 3ZN1A 1IN4A 2CV1A 3A01B 3RDIA 4B3XA 4E4HA 1IN7A 3OYDA 1REPC 2XAQA 3LQQA 1S29A 1X1DA 1YYVA 1ETXA 1J5YA 1SMYF 2ZXHA 4XICA 2PX9A 4IHSA 5EF6A 4CCKA 1W36C 3J81Z 1ITYA 2MGQA 4X6AJ 5EEGA 4J00A 3LA7A 4L9JA 3KYDB 2YX7A 2Y0MA 2O7OA 1X19A 3I4NJ 3HJEA 3JRGA 2NS7A 2FOKA 3PQJA 3QU6A 1T39A 3TL4X 2OU2A 2F5CA 4ETSA 2DCEA 4F3QA 1O3SA 3I9V2 4QPQA 3OS2A 1TWCJ 4IHVA 2Y31A 3V7SA 2V26A 2OA4A 4UNOA 1HSTA 2JA7J 1MMDA 2F5DA 1MBKA 1MMNA 5GAGJ 1FPQA 2VASA 4NUBA 4A6DA 4EEFG 2NVYJ 4GYGA 2L9VA 2B7EA 4EATA 1XGSA 1WFXA 4HEA2 1BR4A 4HX8A 4M71A 2ACJA 3K7AJ 2BEOA 1D1BA 2XGXA 3TW7A 2PJRA 1KU3A 1XCBA 1IG7A 2NVTJ 1YX3A 4YFKF 3DU6A 2DOAA 2GLOA 1J0RA 4CUGA 1DPRA 1IUFA 2QSFX 3OIQA 3ZXSA 2K40A 3L2UA 3BR3A 3H35A 2JA6J 2W24A 5A2QK 3F8CA 3MCZA 2R5ZB 1QZEA 5LFAA 2E2HJ 2GIZA 1R00A 1JT6A 1U2WA 4ESJA 3RZDJ 3MEXA 1PUFA 2K9NA 4HF2A 4S04A 1XB4A 1S7EA 3SDGA 4O3MA 5FRNA 1S8NA 1V3FA 4X1EA 3GMEA 4RLFA 3A01A 3SZTA 2K4BA 2W84A 4Y33A 3CESA 1LNWA 3K2AA 3WE3A 3OYHA 1KYZA 3GYHX 4EGYA 4HQEA 2HVRA 1QZZA 4D0PA 4A3KJ 3R60A 2STTA 3R6SA 4M3DA 4JX6A 3DCFA 4XRSA 5FO5A 4HG2A 2XPUA 5FD6A 3ZRGA 5HS7A 3HOUJ 2ZJQF 3MMYB 3L2CA 2UV1A 2VPRA 3RJPA 2DYRH 2E2IJ 1ULYA 3X2QH 3CP2A 1JUPA 2DMUA 2DOFA 1PDNC 3W2WA 3ASNH 1ZG1A 1TP4A 3E6BA 2XB0X 4L9NA 1GV5A 1RC9A 2MSYA 1EA3A 1G3TA 1E3OC 2DMPA 3NEUA 1DGWY 4IHTA 5DCFA 2DJIA 2ZC2A 4B43A 4NC8A 3CC7I 4LG3A 2AQEA 2EINH 1WSUA 2RC4A 4PUSA 3B6CA 4NQWB 1MSEC 1SD7A 1X3ZB 2ID6A 2MLGA 2YR2A 2BW3A 2Y0SA 1J09A 2H6CA 2R7SA 4CA0A 5D6EA 5LRSA 2HDCA 4EM0B 3K4BA 2W7NA 3MKWB 4II2A 2TRTA 2X4HA 1V4RA 3IC7A 2JA5J 2A07F 4AVPA 2XC7A 2KFDA 4A69C 2MC3A 2QKLB 5C3EJ 4RGUA 2R0QC 2R5ZA 4PJNA 1EH6A 3Q0VA 4ENJA 2JTVA 4RLQA 5JVGF 1XGNA 1M1EB 1RI7A 1BI1A 2FA5A 1LFBA 2IP2A 4A3CJ 2KDOA 1H0MA 1VQ9I 1MZBA 2M30A 4P96A 5D8LB 1W0TA 1B72B 3BLYA 3FZVA 1UHMA 4FX4A 1XC5A 2JK3A 3WU1B 3F8MA 3Q0WA 1XPXA 2E1MB 1NH3A 1D5YA 5HDGA 3LFKA 4E7IA 3TW6A 1A5JA 1QPMA 2GM4A 3L2WA 1LFPA 4D7NA 3H3UA 4WXDA 2EQRA 2A61A 3RZOJ 2LTPA 5AONA 3OL3A 1VTNC 3K4MA 1IN5A 3DEEA 5DD4A 3OYBA 1W36D 2ZXIA 3V8LA 2YS9A 4MEYF 4BYYA 3RPQA 4XOPA 2EV6A 5FLVA 2DDBA 3OYGA 5EEAA 3SEZA 2EIJH 4J19A 2R7DA 3H0GJ 3PNTA 4JX5A 4MTEA 2DOEA 3VWBA 3QODA 2M8EA 2HVSA 2P6TA 5K5RA 5D4SA 2IXSA 2X1EA 5DDGA 1FBSA 1USSA 2OJED 1U8RA 1FC3A 2WA0A 3WTSC 1HBXG 3PFYA 4DGWB 2GOMA 3JRDA 4U7BA 2NVUB 2Y9YA 1FX7A 1R71A 1U0JA 2XAHA 4H4KC 5GPAA 1R4NB 3GUDA 3HOTA 3KP7A 3JR9A 5ICGA 1D8KA 3LSMA 5CPRB 3JAMZ 1U5TC 3CMEI 2BHYA 3QWLA 5B3SH 3ECHA 3CUQA 3JCUC 3CCYA 5J1RA 3I4PA 1P4WA 3GFMA 1FOWA 4Q4ZF 1ZAOA 1V55H 2H27A 5GPCA 4OAYA 3CCVI 2CMPA 3A1YA 3FXRA 3S1NJ 2E1CA 1BOAA 1XSVA 4ZYAA 1VQ8I 2EV0A 3JRHA 2KHMA 2L7ZA 1UHSA 2QQBA 4XKWA 1X1AA 3IH4A 4YIFA 4KA4A 2GIVA 3H9JA 4BE0A 1RUOA 3O3KA 5DD8A 5ERIA 2A6HF 1S3JA 2XKPA 3HSEA 1NTCA 1KQ0A 3COAC 3LSHA 2EIKH 3KYCB 5EGOB 2K9QA 3C3WA 2RNJA 3FXLA 4JP0A 1D0XA 3SFIA 3VB2A 4KN4X 4RB2C 2JA8J 1HA8A 5DS9A 4HF1A 2QEXI 1R49A 3VSKA 2I5UA 4HPQA 4AYBN 2UZKA 4F7ZA 4A3MJ 1HSJA 2TDXA 3PQKA 3VSLA 5IOZA 1FNNA 3DPLC 3T8RA 4B3AA 4EGZA 1B59A 1WWXA 4BQNA 1IRFA 5CVRA 3DP7A 1TNSA 4E7HA 3QRFF 4CYDA 1SFXA 4FE4A 2ECCA 1DDNA 1X4OA 2WB1A 1UG2A 5HOOA 5ILSA 1LFUP 1WCMJ 4RAYA 3BR2A 3G6EI 5E20A 1BC7C 2R7FA 4XLNF 1TC3C 1YRNB 3BPVA 3KP2A 4M9SA 3WTWC 1KZHA 1JKRC 2XUBA 2BYVE 2CQXA 1VQ5I 2EK5A 1Y1VJ 1HOMA 1B9MA 3W3CA 1IN6A 4FISA 4V2GA 1QPIA 2X1DA 2FQ4A 4CCJA 3RI4A 4AIHA 4UY8I 2R7UA 3FHNA 1R6RA 3HC7A 5K1YA 1OJLA 2BV6A 2OZUA 2P7VB 2WY8Q 3IRRA 2QLZA 2E34A 2BVLA 2VN2A 5FKLA 3NWSA 3MKZA 2NAZA 4I01A 1OISA 2XPWA 3MWMA 4N9IA 3H3VK 3N97A 3F22A 2CGPA 5FGMA 3IH2A 4BGDA 4IX7A 3F6VA 4I98B 5CVUA 5LD2C 1VQ7I 3QU3A 2HYGD 2EFQA 2ZJ2A 4EM2A 5JR3A 1A6IA 2E1OA 2W57A 5J47A 3HUGB 2DLLA 5IPAA 2Y48A 2DA4A 5KHDA 4BQAA 3WG7H 4WCGA 1EH8A 5FFZA 3DBLB 3WTTC 1PP8F 4PK4A 3SEQA 3HKZN 4DW6A 3F8FA 4CGZA 3M7GA 1N78A 3DEUA 2OD5A 3AAFA 4MGRA 1ZR2A 4L0ZB 3F72A 4DNCA 2E7XA 5LEJA 4W1UA 4A12A 3K4LA 5M3MJ 4XLEA 1BM9A 5E3NA 4OWRB 2WV0A 3H36A 1GT0C 4D5CA 1G59A 1T0FA 1TW3A 1ACIA 4HRIA 5F1JA 3WTYC 3A02A 1DP7P 2HOAA 3FMRA 2VBYA 1YRNA 3TEDA 1TQPA 3CJRB 4E7SA 4IZZA 2L5QA 1Z6RA 2XGCA 2FBKA 3K4NA 2KIQA 3K9TA 1WJ5A 4ZYHA 5GADJ 4CYCA 2ZB9A 2H8RA 2A6TA 1F43A 3LFUA 3V8KA 1FZPB 4GCVA 3GXOA 2VKDA 3BR5A 1BJZA 3F0CA 3QYBA 3EUHC 3IAS2 2LOOA 2HFHA 4DOZA 3GTJJ 2YUSA 1T56A 3M8EA 2Q2EA 3S32A 3HIFA 3BZ6A 2W1OA 4MIMA 1X58A 1W5CC 2XAGA 2EFNA 1BW6A 1W1WE 3OR2C 1PYVA 3H5RA 1ZQ3P 3SQNA 2X0LA 3LMMA 2G7UA 2FEZA 2LSOA 3HL2A 3W6JB 3CO7C 1YTYA 1ODDA 2ECBA 2LG4A 2R7VA 3ABUA 1S7OA 1T08B 4FHTA 3GTGJ 5CKTA 1FOYA 1QGPA 2O03A 1HC8A 5DUIA 5F0HA 3GTMJ 4KT5C 3ZQFA 4FQGA 1OCOH 1XDUA 1O3TA 3NAUA 4DQ2A 3I59A 5HNFA 1UG0A 4MNUA 4YFXF 1TQMA 4ZTJA 1TW2A 2KISA 4D7MA 3T8TA 1B4AA 2P6SA 3M1EA 1RESA 4YIIA 1G4DA 1MH3A 3K70D 1AKHB 4LITA 1OLTA 3R0AA 4UUVA 4JOMA 5H6QA 4QIWN 1OCTC 2P0WA 1LEBA 3LWFA 4GYIA 2L0KA 1H9GA 4BH9A 4F55A 3SXYA 1YJWI 2EA2A 2LYCA 3HSRA 4IL6C 3U9GA 1TBXA 1Y56A 1R58A 2PG4A 1TWFJ 1VQLI 4TV7A 3ZMTA 1NG6A 5E3LA 1GXPA 3K10A 4LIVA 3M8FA 1ON1A 3LSGA 3MZ8A 2HXIA 5JHFA 3OYLA 1S72I 2LP0A 1OKRA 2OQGA 2HTSA 2E19A 2M0MA 3PO2J 5J6XA 1OFCX 5ED4A 5J8FA 2CQKA 2GWRA 4DZJA 1R9TJ 3L9FA 1FT9A 1VQKI 4Y7NJ 2W4SA 3CCJI 1K6OA 2AS5F 1YIOA 1I39A 2CQNA 3LSIA 2JQ7A 2M87A 3ZQIA 3JRBA 3RQIA 4LG0B 5K5OA 2LFBA 1B9NA 5BOXA 3DTIA 2RVCA 3EYYA 4RDUA 3E3VA 4RBOA 1I6XA 2YSRA 1U6GA 1SD4A 1XN7A 2IS1A 2DA3A 2GA1A 4NDLA 1FIAA 3CTAA 4PCQA 3DBRB 3FHZA 1IF1A 4UUTA 2W25A 1E17A 5L3EA 3FXMA 3A03A 2HQRA 2JPCA 2Z16A 2C6YA 4A3GJ 3JTGA 1JUSA 3GTOJ 3S16J 5EG0A 1IC8A 2NXNB 4L9TA 2LBFB 2HOTA 2OV7A 2QKMB 2FOWA 4UVAA 4IHWA 3IKVA 3KLOA 4AIJA 1AKHA 2MLKA 5KK1A 3BOQA 2WADA 3C18A 2ZXWH 1UHWA 1G6NA 1WHUA 4OMYA 2M5WA 1YHQI 3FKJA 3RPUA 4BACA 2DT6A 1AA7A 2VXZA 5ICCA 3E7LA 1VQNI 2DU9A 3ECOA 2HDWA 3HYIA 1I3AA 1R5GA 2F5EA 4AU7A 6PAXA 2R5YA 1GXQA 4IEJA 3GFIA 2K5CA 2M4GA 3H0DA 5B5EC 2RNGA 2L9NA 1NK2P 4MFEA 4KIBA 3CCEI 1YX5A 4HDUA 2DBBA 3TMOA 1BJAA 2KIMA 3GZ6A 1TNTA 2LD5A 4JX4A 4PGGA 3OL4A 3DLAA 3VYTB 5BMZA 2XROA 2K4JA 1A6QA 1BR1A 1W0UA 2FNAA 4U88A 5HDKA 3VPRA 2VC1A 5HLHA 1I27A 3CCQI 2OUMA 4WXCA 4CCNA 3G4SI 2PJRB 2W00A 2V6EA 3HRSA 2NS8A 3OYEA 3CD6I 3ISPA 5M3FJ 3OSGA 2VC0A 2XSJC 4B44A 2R7TA 4Y52J 2HDDA 3WG9A 4ENNA 3PL8A 3J80Z 4GGGA 2QQAA 2ZJRF 2R7QA 5F04A 5D5WB 4DBRA 1ERDA 2V6CA 1O57A 1UELB 4UV9A 5F08A 1Z91A 2KZGA 3I71A 1XS9A 2UWMA 2CSOA 3H5NA 3V8JA 2VL8A 2KDZA 2ESNA 2A6EF 1TWAJ 4XLFA 5ILUA 4N4NB 5ILVA 2WWYA 1LUJB 1AWCA 1Y0UA 2N8GA 3W2AA 3PUFA 1QVTA 1STZA 1OR7A 4WF2A 4BE1A 5JLWA 4N0BA 2FD5A 4MTDA 1LDKB 2EJRA 2R7XA 2RV8A 3TGNA 3VEPA 4XKBA 1V54H 1D5VA 5L3DA 2LY1A 3MVPA 2ZCWA 2TCTA 1BR2A 3LSPA 4IPAA 5HLGA 5KNLA 3FX3A 4IHYA 3RCOA 1GDTA 1BI2A 2PMZN 3FXKA 1FP2A 4FASD 3JRFA 3BJ6A 2VKHA 4QWQA 1ZELA 1ZTRA 1LB2A 1U5TB 2R92J 4IOAF 1ON2A 3B73A 2PLYA 1QRYA 3ELKA 2BW3B 5DTDA 2F2EA 1XGOA 4NBQA 5IT3A 1JTXA 1B6AA 1RRJA 2ZMEC 2MW8A 2K86A 4HDVA 5EJCA 1OPCA 5J1UA 3Q9SA 3C2HA 3CCRI 4XRSG 4BHBA 2F48A 1P6RA 2VJJA 4IVNA 1Y8QB 3WTZA 1FYLA 4KITB 2OQRA 4XLAA 2G7HA 2PEXA 2DDAA 2PN6A 2LKPA 4Z2YA 2WAQN 3OWTA 5FJ8J 4HX4A 1LE8B 2FU4A 4XORA 1RNLA 3M9AA 2A69F 2LRDA 1T2KA 4C3IJ 2HR3A 1DGRM 2PFBA 2ZO4A 1NHAA 2ISZA 3BWGA 3JW4A 1I50J 5EEHA 4OIRF 3BJOA 1QHGA 4ABZA 1QBJA 1IRXA 2FX0A 2OZ6A 1IXSB 2QQ9A 5L3CA 3E6DA 2W48A 1YO5C 3HRMA 2VBXA 3J7YJ 1FIPA 5D8KB 1IDZA 1D3YA 2NNNA 4DZPA 3QYFA 3NRVA 1W4MA 4PJJA 5F27A 3FIWA 4HNTA 4EJTA 2ZNYA 2IRFG 2VE8A 1TT5B 5HDNA 5D4RA 2L02A 3HBLA 4G94A 4FCYA 2CUJA 1P4AA 2V9VA 5H20A 1OCPA 5HLTA 2X6XA 2XKOA 5DV5A 3S15J 1R7JA 4L18B 2B63J 3QQAA 2LKSA 2IAIA 3EUKL 3R4KA 4A3BJ 5DM7F 2K02A 1FTTA 5LEKA 4KICA 4L0YB 2EH3A 1U5TA 2FUG2 1OR7C 2JVGA 2VODA 3BC8A 4OIQF 5HS8A 4UB6C 1WJFA 5EYRA 2HOSA 1ETWA 1L0OC 1FOKA 5ICFA 3DTKA 1HKQA 1QNTA 2MFZA 3H9QA 2ZXJA 5FKOA 3E6CC 2ZNZA 3HRTA 3VFZA 3WTXC 2COBA 2Z2SB 3CJQB 3WODF 1OCCH 4DJAA 1MNDA 1MSFC 1XX5A 2DFFA 3FXQA 2W82A 3I0TA 3I55I 2ME6A 2XGEA 4BY7J 3ZMZA 1EKEA 1OCZH 3L2VA 1K4SA 1LE8A 1GLNA 3CUQB 2JJ7A 5E17F 2ZJPF 2X51A 3JTHA 3L2RA 3LOCA 5IT9Z 1T98A 4RMNA 3I5UA 4I99C 2RDPA 1R36A 2QCOA 4WWCA 3CQZJ 5LHIA 1K78B 3DWLE 2O3FA 4BQOA 3FISA 3LQRA 2CQQA 3AG1H 2QZ8A 2R3SA 4RB3C 1FTZA 1MMGA 1ETQA 4UV8A 3HOZJ 2G0EA 2W85A 3GLXA 1ZG5A 2LH9A 3V42A 4A3FJ 3SDBA 1WGXA 3BG7A 3WGHA 1IAWA 2ESHA 4K2EA 1BI3A 3EYIA 3L1PA 5K7HA 1CF7A 1D1AA 2XASA 4UVCA 1KU9A 4ASNA 4AC0A 3C2GA 3PJRA 3JSOA 5L3GA 2EZLA 2RQQA 1KA8A 4S05A 1E0EA 1XMKA 2QVOA 4ZH4F 1UZCA 1SD5A 2HTJA 5LBQA 2BGCA 4RM2A 3BR1A 2V7FA 2EV5A 4JK1X 3RQ4A 1S5LC 1IXRC 3RPUD 1YFHA 4G12A 3AL0C 3I54A 3GBGA 3Q0UA 3G71I 1VNDA 2MH9A 3ESWB 3FMSA 3IWFA 1SD6A 1JKOC 4X0GA 2ZSIB 3HB9A 4HNUA 4PSXA 4MO7A 4R8HA 4DBQA 3JSPA 2D5VA 4M6XA 1YS7A 2MD0A 3FM3A 2K27A 4JQFA 4JYKA 1A36A 1HKTA 3H92A 2BY2A 1RKWA 2LY9A 4ZC3A 2L7KA 1MJ9A 5M5XJ 1MDMA 3U1KA 5LRRA 2XVCA 4EV0A 3F9KA 3KEQA 4ZYGA 3KEYA 1BOBA 3M4OJ 1IV8A 1PJRA 2X9DA 4EMSA 1B1BA 5A2QZ 3Q9VA 1OMIA 2F5FA 2HZDA 2O0YA 2H94A 2HEOA 2DPUA 3MD2A 2CUEA 4ITVA 1K78A 3FXUA 1ZK8A 3G73A 3S3MA 2IS2A 4EJVA 1MW7A 2J5OA 4A2UA 1OYWA 4HQMA 5HVQC 4ZTFA 5FKNA 3HTUA 1X1CA 1C0WA 3DU5A 4Y4RA 1D8JA 2LNBA 1LKXA 1LEAA 5DEQA 5GAEJ 2KRFA 3CZ6A 2JZYA 2K9SA 2IW5A 5D5UB 2KLOA 5LLQA 4RS8A 1ETYA 2CS3A 3GWZA 2B9SA 2NRAC 4ON0A 2L4AA 2V79A 5CVVA 2E71A 2L54A 5M5YJ 2CU7A 2IVMA 2WTEA 3H3ZA 3SHFA 1Z9CA 3CDLA 1LDJA 3FMQA 3OYNA 1ZKGA 2KIFA 3KPHA 3QPLA 4G9YA 3OS1A 3ERED 3U2RA 2IA1A 1LPQA 1G3WA 2X6WA 2VLAA 3OYMA 4KIFA 4U0VA 2MH2A 3DTEA 2EZHA 1WJAA 3HOXJ 4P1WA 2X6YA 1HLVA 4F91B 2GAUA 4ZZDA 2HQ5A 1T33A 3F23A 4QLCU 3BTJA 1B8IA 3EUHA 2I10A 1HXDA 4HZFA 4Q48A 3AG2H 3K2ZA 3FXJA 3O8HA 2RN7A 1MBHA 2M34A 2M7BA 3TQNA 1YI2I 2HQNA 3BCAA 4CH7A 2STWA 3ZQCA 2HPIA 4PJ0C 1R4MB 4PZJA 1MKMA 2PJPA 2Y0SN 2MABA 5CLSA 2ZKZA 5E8GA 2Y9ZA 4CYCB 3ZMDA 1SAUA 4LLGF 2XAJA 3ZQHA 2F4MB 2A3SA 3CCLI 3BPXA 2P7CB 5KAFC 3T1BA 3B02A 1ORKA 3MAJA 4D1QA 1FY7A 2X6OA 3HPGA 2BXZA 3FM5A 1PUEE 1FSHA 4FE7A 4RA2A 1QQIA 4BXUA 2D45A 4IRGA 1WJBA 2Q2EB 1Y39A 1R1TA 2MYSA 2XF7A 5H6RA 2WAEA 3GX4X 2IA0A 4Q47A 3S3NA 4IF4A 1FYMA 3S17J 4LGWA 3W2VA 4HLYA 2IGMA 2HKOA 1OYYA 5FROA 2KIUA 1P2FA 2DMTA 2OBPA 2VT2A 1E3HA 3TBIA 5J3LA 3S14J 1JXSA 2VIXA 1LQ1A 2CYYA 2VJIA 3WHCA 2DA5A 2FSWA 5B1BH 3AFHA 2E1MC 5DCMB 2A05A 3ZGKA 1ZREA 3ABMH 2CW0F 4AIDA 4AIKA 1F9NA 3I59B 5GTHC 3FXOA 3L00A 1YE9A 3CUOA 1Y1WJ 4ESFA 2HI3A 4E70A 2LK2A 4CDGA 3V7CA 3TKYA 4AVZA 1JGGA 2EPFA 1JKPC 1VF9A 2QYOA 4LLLA 4XRFA 2JUCA 1P7JA 3RIRA 2YU9J 1ZHFA 3HG9A 5KCMA 4UVBA 3BZCA 1S9HA 1O7FA 3NQOA 1YG2A 4I0AA 4OIOF 4V19K 4PSWA 2EA4A 3E5UA 2UUZA 5TGTA 1VQ4I 1KQ9A 1JHFA 3PNVA 2DFEA 1TQIA 3WU2C 3BT9A 2J5PA 1FBQA 3CC2I 4M6VA 1N75A 1A04A 1YS6A 3R61A 3BR6A 3PUBA 1UAAA 1HCRA 1D0ZA 5CQEA 3S2DJ 5FFXA 2P5VA 1IRGA 2CUFA 3BTLA 1MBFA 4A3EJ 1HW1A 5IYDJ 4GO1A 4L5IA 2QA4I 2OTLI 2VOPA 1K7AA 1ZR4A 2WC2A 2VKVA 1DPUA 2OTJI 5C44J 2QWWA 5DCMA 3BTCA 1VQPI 4G6TB 1E2XA 4G6DA 4I0BA 3BTIA 3F6OA 4UUSA 3J80K 5M5WJ 3H9GA 3H5AA 1VZ0A 1WPKA 1F4KA 3HOVJ 2XDVA 2EIMH 4ZDOA 5EG0B 4FT8A 5IP7J 2Y2ZA 4BUPA 1Z77A 4MHGA 2XAFA 1W5TA 3FKIJ 2CO5A 4P9UA 4HSTA 1KU7A 2O6GE 2HU9A 5D5VB 4B4CA 1T6SA 4AWXB 3DBHB 1DQUA 2QENA 3GTLJ 2DMNA 3J81K 1TWHJ 5TISC 1LDDA 2P4WA 3QPTA 2GZWA 4BU2A 2D1VA 1BIBA 1I3QJ 3F8BA 2R5YB 3O8GA 2ZMEB 2WB1N 2ELKA 3FBNB 1FMWA 2XF6A 2DO7A 3K1MA 2CRGA 4XL9A 2E2JJ 1KU2A 1OQYA 2A68F 5TRDA 4O5VA 1P4XA 2DFIA 5FKKA 1R5HA 2FF4A 4EJOA 3V7RA 4XN3A 5AIPA 1NG7A 1KQ8A 1WJCA 2LMDA 1AHDP 2AO9A 1TTYA 3PSIA 1ZRDA 1FSEA 1WJEA 3M8JA 2FQ3A 3ZMUA 3CCUI 4BQQA 5JVTA 3D5RC 2DT5A 3KP4A 3BCBA 3GTQJ 2F6CA 4HA8A 3M07A 5FLXZ 3J7AY 4QTRA 1I5ZA 1W5SA 5BQTA 1EH7A 1Z1DA 1GV2A 2FBIA 2EFWA 1ZGJA 2Z99A 3ERMA 2XRLA 4YELA 3RSNA 2R7OA 2LKXA 4XNFA 3JRAA 2IA2A 1IGNA 1GHCA 1KYWA 2ME0A 3BR0A 3OV8A 4IKFA 2P5KA 5KVRA 2H1LA 5J8CA 3ZP5A 3EUAA 3RKWA 2QBYB 4RB1A 4XQFA 1QVUA 2R4GA 3SFZA 5BNGA 2XHKA 3TO6A 3D5LA 2E7WA 2VI6A 2DMQA 1FJLA 4AD9A 1GUUA 1YJNI 2QSHX 4YFNF 3A4CA 1ZGAA 5JFRA 5HS9A 2DFHA 2WY7Q 3K0LA 1DUXC 5C4XJ 4M6YA 1Q1VA 1U9OA 2ZMEA 3ABTA 1R5ID 2IS6A 3PIOF 4XBFA 3KCCA 2FMYA 2EBIA 4MQVA 2E1NA 1YOVB 2M45A 4C9YA 4CCMA 4R1HA 3CJTB 1IDYA 3VDXA 4E7ZA 4KN7X 3LAPA 3QOEA 4I09A 3DQVC 1WKMA 4Q5SF 2IGOA 2WAFA 1WRJA 5L3FA 2NS0A 1J2XA 1FBUA 4FETA 2B0LA 1BBYA 3ZCOA 3WHBA 2K85A 2AHQA 2BXYA 4BL0B 3EQLF 3DKWA 2H09A 1R1UA 3HGGA 2LF7A 4L5EA 4A3LJ 3N05A 3P7NA 2BVMA 1J9IA 1R23A 3HTSB 1D0YA 4HOBA 1DU0A 3HPHA 3KZIC 4G6QA 4GXOA 2JWTA 1RR7A 3CLQA 2Z9OA 2K3PA 4F92B 3E1SA 4A6EA 2LDUA 3EPZA 3UKGA 3LNQA 4PFPA 1APLC 2KQRA 1XD7A 3G3ZA 3MKLA 3KX2A 2GXAA 2DTRA 2QBYA 3SJMA 4O6JA 4B1RA 2KRCA 1GVDA 1O4XA 5E3OA 2UXNA 4XKVA 2AXLA 2EFPA 1W7PA 2KPMA 3O2PE 1ETKA 3LSTA 2HKXA 5HNHA 4KT6A 4B09A 1QU3A 3Q3SA 3KEOA 2O8KA 2EZKA 5GAHJ 1MMSA 1BL0A 4G7ZF 2NOJB 1PVEA 1S7AA 2DT7B 3DXJF 3QP5A 1Z21A 3T5XA 3QAHA 2HPMA 4MLOA 3BJAA 4JBAA 1ZH5A 3ABLH 2D1HA 3AKZA 3AL0B 3DFGA 5JLXA 4F93B 3IUOA 3CP8A 3KETA 4HBLA 4BDYA 2V1DA 4DYCA 3KFWX 2VBWA 5EZHA 1TLHB 1Y0NA 2HNHA 2KRHA 1JI8A 1RZ4A 2XPVA 3DKYA 4HF0A 3SZGA 5CVIA 3ZOBA 2DXIA 3CMMA 3MN2A 1IJWC 4BXFA 2VUMJ 3DLLF 4L5JA 2BY1A 4M73A 5E1WA 1ZLKA 4LIUA 2K7LA 2DYSH 1SFUA 4CCLA 4HV6A 4G8XA 4XLPF 1Z7LA 3S1QJ 3ZMVA 4ZDPA 1SFOJ 3TO9A 3TOAA 5F6FA 4WK8F 2Q0OA 5CQGA 2VB6A 1XMXA 3P9KA 2E60A 3A0BC 3ZPLA 1LJ9A 4I7HA 3ZMSA 1S6LA 3P5JA 1ZRCA 3M1CA 4IQJA 5E1ZB 4LLNA 2E36A 2UXXA 1R1VA 2HQAA 2Y75A 2IT0A 4A5NA 2DQLA 1WH5A 2VONA 1ZARA 4HW0A 1G8XA 3JAMK 4ZDLA 2COMA 3KLNA 1ZGWA 1P7IA 2EB7A 2IJLA 2H8WA 2VKEA 5D5XB 1A35A 3DF8A 4OOIA 4IO9F 2QSGX 1J7KA 2VQCA 1EJ9A 4UHTA 1MBEA 4CO8A 2DA1A 2CQ7A 3MQ0A 1SAXA 3M3YJ 5K5QA 3LSJA 4PFOA 1P92A 1QHHD 4IQ4A 2KJCA 5C4JJ 3KZYA 3UR3C 3H1CA 2KMUA 9ANTA 3LA3A 2Y30A 1DU6A 4B8XA 4IOCF 1X1PA 1T38A 1MBJA 2Q1ZB 5IOYA 2NVQJ 1J59A 1FWZA 1ONVA 1UJ8A 1X3WB 2AQFA 2LC2A 4C2TA 2L2OA 4HAMA 4L9VA 1N25A 2CFOA 2P81A 5K7FA 3GW2A 1CF7B 1JKQC 4XMYA 4KMUX 1YIJI 4OAZA 2HYFA 4AYBA 4GDFA 3BP8A 1PP7U 2KZVA 3ML6A 2M0CA 3OIOA 3VOEA 1HDPA 4CXFA 4BKXA 4CICA 4KYWA 4WXHA 3OOPA 3OYJA 3CDHA 3OS0A 4AM3A 2P8TA 1RPWA 5EDNA 3A0HC 2G9WA 1FOXA 1I1SA 1TT0A 1IO2A 4BJ5C 1FEXA 3PNYA 3WGGA 3DPUA 3KIOA 3HOSA 1RUNA 4PDKA 2FBHA 2HZTA 5FD5A 4BY1J 2RQPA 1CGPA 2CH0A 2YX4A 3QOPA 1UFMA 5ICEA 3C7JA 1MDMB 4LK0F 4YRVA 2L3DA 3B6AA 1XG1A 1ZG3A 2BOLA 1Z0XA 5EZGA 5LGTA 1WH7A 3FBIB 1AU7A 3PFIA 2HVQA 3GVAA 4HV5A 5E79C 1BN5A 3F21A 2XRNA 4BNCA 5H2FC 3IAM2 4C3JJ 2QF7A 1QZYA 2DN0A 2EZIA 5K7ZA 2DTZA 4IXAA 1RR8C 4B47A 3WTVC 4XLHA 2IEKA 3HM5A 4QPOA 2HGCA 2PMUA 3HGYA 5BS6A 2RKHA 3PSFA 1XTAA 2PQ8A 2CUZA 3L7WA 1V5EA 1X3UA 5KAIC 1MJAA 4XONA 2KP6A 4M72A 3IKTA 3S8PA 2O9LA 1SVLA 1NK3P 3CMYA 5IY5H 2CV2A 1IUYA 5HLIA 1JTYA 4IRIA 3PIPF 1N77A 4GFBA 3K1PA 3HKZA 3V4GA 4CZZA 3GZ5A 4PJLA 2BY0A 1G2HA 2R7RA 3G1LA 4NNJA 1VQMI 3E5QA 4E6KG 1G3SA 2F4IA 4C2MJ 3JRCA 2XF5A 1U8BA 3GZNB 5B1AH 4ZYDA 4MQ9F 2WV1A 2XAUA 3ABKH 1VFCA 5F0CA 1YW8A 1F36A 3FK6A 3P9CA 5TJJA 4NC7A 2DPDA 1MGTA 3CMAI 1JHHA 2M9HA 4OMZA 3O6BB 1MJBA 1MNEA 4BJ6C 1LVKA 3HHHA 4NQWA 1ETOA 4XOTA 3E97A 3U21A 1B8IB 3S2HJ 4HNVA 4LFUA 4E7LA 4G7HF 2L7FP 1Z3XA 3GTKJ 2E5ZA 4FTHA 2XB5A 4RGRA 1H89C 2QUFA 2F5VA 2WBMA 2ZFWA 1O3QA 5FRMA 2HOEA 5E3MA 4M74A 2MA3A 1BI0A 3NARA 4BBRJ 2XGDA 1POGA 1Z6TA 4KMFA 2R93J 1T95A 2D2WA 1JT0A 3BQYA 3E6MA 3IRQA 3WTUC 4IHXA 2VQHA 2M7AA 2V1XA 5DUKA 3OYIA 1TL8A 3OYAA 4EVIA 4U7DA 1YLFA 1X2MA 2JRTA 5F0FA 1AOYA 3CC4I 3HRUA 1BC8C 3U1DA 1B72A 3VYSB 2Y69H 3BY6A 3KE2A 2V4JC 3F8NA 3KYLA 2JN6A 4KISA 4ZYEA 3HOWJ 2RAEA 1OYIA 2EILH 3DPTA 5LHHA 2NNYA 1IN8A 1ZN2A 2EWNA 2Z1DA 3VYUB 1IV6A 1HW5A 4C3HJ 1YQAA 2DA6A 4BBSJ 1VQ6I 1F5TA 2M2EA 1I6HJ 1MNMC 2JPBA 3IP4B 3W6KB 2MD5A 2MG4A 1KONA 3DV8A 4OU0A 3CCSI 1L3LA 2QQ8A 1SEUA 1A31A 1P9QC 1SMTA 3OYKA 1W7PD 2M8GX 3ZQQA 4OINF 3S1RJ 4U0WA 2DA2A 1IXCA 2PMHA 2FMLA 4D9JA 1JJ6C 2OCEA 3TO7A 1Z67A 3GO5A 3UNGC 1D1CA 5J4YA 1U3EM 4EQQA 2V1UA 4A0XA 2L4MA 2FRHA 3BZKA 4XKCA 2XSDC 4Z6YA 2VPLA 4XN0A 2XIGA 1MMAA 1JUMA 4CSWA 3LSRA 4C2UA 2CWEA 1RKTA 5JI6A 2MC4A 4A3IJ 5FB2A 3QPSA 3GFJA 2DI3A 4YEJA 4EJUA 3QP6A 3CF2A 1QA6A 1DP3A 2VOOA 3LAJA 3OMYA 5D6FA 4ZZLA 1K83J 3BROA 3K70C 1ETVA 1E3PA 2Q8KA 3ULQB 4RB0A 1UB9A 4M9XA 2YPRA 3LA2A 1Y6IA 1Z7UA 1VQOI 4Y3OA 2Z33A 1ZRFA 4F52A 3W6VA 2E5NA 3FWEA 3DKXA 2EFOA 3KP3A 1SANA 3N4MA 5GP9A 3OYFA 5BPDA 1YW9A 4B48A 3C1DA 2BE5F 1WI9A 1EV7A 1UMQA 3ASOH 4RAGA 3ZQLA 1JGSA 1RETA 1HDDC 2GOXB 1WJDA 2O5RA 2DK5A 2OF7A 3BDDA 3I64A 4BHCA 3WGIA 1HW2A 4BXXJ 3CUQC 2CG4A 2P5LC 2KL4A 2CFXA 3HHGA 5LGNA 2PI0A 1J75A 1HQCA 3ZR8X 2JMWA 4M3BA 3I58A 5LGUA 5AIQA 3OOUA 5EGOA 3OIPA 3HOYJ 2A5WA 1KGSA 2BBYA 3HZJA 3C2BA 4LJZF 4UUSB 5FLXK 4M3EA 4KFCA 3BG9A 3DEWA 3HEFA 3BG3A 3J7ZI 5IYBJ 2KT0A 1IZ1A 3GFLA 4BE2A 1Q1HA 2BZTA 4HSRA 2GXBA 4UXNA 2VJ4A 2L9SA 1V5FA 4KJZA 4H0EA 4I2OA 3GCMA 3TDUC 3S1MJ 4WX9A 4E7JA 4LMYA 1UCRA 3RYRA 3JRIA 3RTRA 2HYJA 2R7ZJ 4E7KA 1X1BA 3I4MJ 3WU0A 5E8IA 2IS4A 3VYRB 5F1RA 1SC7A 3BG5A 3K69A 4II3A
chains in the Genus database with same CATH topology
2A5YB 4PGHA 1ZLJA 3EETA 4A0YA 2LF8A 2M1BA 3CJNA 1FYKA 3GEZA 3RKXA 4RAZA 5E18F 4LB6B 3IL2A 3E5XA 4HYEA 4FX0A 1O7LA 4LB5A 5E1XA 1MD0A 1G3YA 4KIGA 4NB5A 1JE8A 2JSCA 3HUGA 4P9FA 3MFKA 1HKSA 1O3RA 1RIOH 5CVJA 2RGVA 4Y13A 2KKOA 3K1NA 1XSDA 4KDPA 5DYMA 2H6BA 3P9IA 4LD5A 3VODA 3KP5A 4Y15A 1F1ZA 3ZN0A 4MEXF 2HS5A 3T0YA 4KUMA 1WQ2A 3KP6A 2FNPA 1XDSA 4G7OF 1USTA 4IJAA 4A5MA 5LHGA 2DAOA 2GA2A 2VBZA 2DW4A 2L01A 5L3BA 2VE9A 2JT1A 1XGMA 5JHUA 4CHUA 2GQQA 3HSFA 2NYXA 4U0YA 4Y17A 4HX7A 2OAZA 2QM3A 1GVJA 1SFEA 1YW7A 3I53A 4R79A 2PBIA 4M9ZA 1BIAA 5CYVA 1LVAA 3IWZA 2Z3YA 2DK8A 4IRHA 4EM1A 1XSXA 4HLXA 2KJBA 1XMAA 2Z5UA 4RGXA 2GXGA 2XV4S 3S2WA 4KNYA 1W7PB 4P5OA 3EDPA 1Z05A 1QO0D 1FLIA 4BAYA 3GF2A 2ELHA 3IHUA 2ISYA 1ZYRF 2YU3A 4LK1F 3CO6C 4EJWA 2IPQX 3TOBA 4I02A 5CJ9A 2FXAA 3SZPA 2O8XA 3ROUA 4ENMA 1R22A 4YG2F 2ZBKA 3RKYA 3KZZA 4A0ZA 2DQRA 3ZQ7A 1FP1D 3FF5A 3MZYA 3RYPA 4P55A 5F64A 3CLOA 4XSXF 3WE2A 4ESBA 2HWVA 4RGSA 4BHPA 3D0SA 4LG0A 2FE3A 1XCVA 2ADUA 2ETHA 3J7AO 3Q5FA 1H9TA 3TDZC 4OIPF 4XSZF 4N9HA 3REOA 3QPHA 1U78A 2VT3A 5IT9K 1IW7F 3R0JA 2O61A 3L09A 5BPIA 4ENKA 3F3XA 2MBFA 4NHJA 3MZHA 1K79A 1I1GA 3ZN1A 1IN4A 3RDIA 1IN7A 1REPC 2XAQA 3LQQA 1S29A 1YYVA 1J5YA 1SMYF 4IHSA 3J81Z 5EEGA 3LA7A 4L9JA 2YX7A 2Y0MA 1T39A 2FOKA 3PQJA 3QU6A 2OU2A 2F5CA 4ETSA 1O3SA 3V7SA 2OA4A 4UNOA 1HSTA 2F5DA 1FPQA 4A6DA 4GYGA 1XGSA 4HX8A 4M71A 2ACJA 2BEOA 2XGXA 1KU3A 1XCBA 4YFKF 1J0RA 1DPRA 2W24A 5A2QK 3F8CA 3MCZA 1R00A 1U2WA 4ESJA 3MEXA 4HF2A 4S04A 1XB4A 4O3MA 1S8NA 1V3FA 3SZTA 2K4BA 2W84A 3GYHX 3WE3A 1LNWA 4EGYA 4HQEA 1KYZA 1QZZA 4D0PA 3R60A 2STTA 3R6SA 5FO5A 5FD6A 5HS7A 3L2CA 3RJPA 1ULYA 1PDNC 1ZG1A 3E6BA 4L9NA 1G3TA 3NEUA 4IHTA 5DCFA 1WSUA 2RC4A 1SD7A 2MLGA 2YR2A 2H6CA 5D6EA 5LRSA 2HDCA 4EM0B 2X4HA 1V4RA 3IC7A 2A07F 4AVPA 2MC3A 4RGUA 1EH6A 4ENJA 2JTVA 1XGNA 1RI7A 1BI1A 2FA5A 2IP2A 1H0MA 1MZBA 2M30A 4P96A 5D8LB 3FZVA 1UHMA 4FX4A 3WU1B 3F8MA 5HDGA 3LFKA 1QPMA 3H3UA 4WXDA 2A61A 5AONA 1VTNC 1IN5A 5DD4A 3V8LA 4MEYF 4BYYA 3RPQA 2EV6A 2R7DA 4MTEA 2M8EA 2P6TA 5K5RA 5D4SA 5DDGA 1U8RA 1FBSA 1USSA 1FC3A 3WTSC 1HBXG 4U7BA 1FX7A 2XAHA 3GUDA 3HOTA 3KP7A 5ICGA 1D8KA 3JAMZ 1U5TC 3ECHA 3CUQA 3I4PA 1P4WA 3GFMA 4Q4ZF 1ZAOA 2H27A 3FXRA 2E1CA 1BOAA 1XSVA 2EV0A 2QQBA 1RUOA 4YIFA 4KA4A 2GIVA 3O3KA 5DD8A 5ERIA 2A6HF 1S3JA 2XKPA 3HSEA 1KQ0A 3COAC 3C3WA 2RNJA 3VB2A 4KN4X 4RB2C 4HF1A 2UZKA 4F7ZA 1HSJA 2TDXA 3PQKA 1FNNA 3DPLC 3T8RA 4EGZA 1B59A 1WWXA 1IRFA 5CVRA 3DP7A 1TNSA 3QRFF 4CYDA 1SFXA 1DDNA 5HOOA 5ILSA 4RAYA 5E20A 1BC7C 2R7FA 4XLNF 3BPVA 3KP2A 4M9SA 3WTWC 2XUBA 2BYVE 2EK5A 1B9MA 1IN6A 3RI4A 4AIHA 5K1YA 2BV6A 2OZUA 2P7VB 3IRRA 2QLZA 2VN2A 2NAZA 4I01A 3MWMA 4N9IA 3N97A 3F22A 2CGPA 5FGMA 3F6VA 4I98B 5CVUA 3QU3A 2HYGD 2EFQA 2ZJ2A 4EM2A 5JR3A 2W57A 2DLLA 2Y48A 4BQAA 4WCGA 1EH8A 5FFZA 3WTTC 1PP8F 3F8FA 4CGZA 3M7GA 3DEUA 2OD5A 3AAFA 4MGRA 4L0ZB 3F72A 4DNCA 2E7XA 5LEJA 4A12A 1BM9A 2WV0A 1T0FA 1TW3A 3WTYC 1DP7P 3FMRA 2VBYA 1TQPA 1Z6RA 2FBKA 3K9TA 4ZYHA 3V8KA 1FZPB 4GCVA 3GXOA 2HFHA 3M8EA 2Q2EA 3HIFA 3BZ6A 2XAGA 2EFNA 3SQNA 2X0LA 2G7UA 2FEZA 2LSOA 3W6JB 3CO7C 1YTYA 1ODDA 3ABUA 1S7OA 4FHTA 1QGPA 2O03A 5DUIA 4KT5C 1XDUA 1O3TA 4DQ2A 3I59A 4MNUA 4YFXF 1TQMA 1TW2A 3T8TA 1B4AA 2P6SA 3M1EA 4YIIA 1G4DA 3R0AA 4UUVA 5H6QA 1LEBA 3LWFA 4GYIA 1H9GA 4BH9A 3SXYA 2EA2A 3HSRA 3U9GA 1TBXA 1R58A 2PG4A 4TV7A 3ZMTA 1GXPA 3M8FA 1ON1A 1OKRA 2OQGA 2HTSA 5J6XA 5ED4A 5J8FA 2CQKA 2GWRA 3L9FA 1FT9A 1K6OA 2AS5F 1YIOA 2M87A 4LG0B 5K5OA 1B9NA 5BOXA 2RVCA 3EYYA 3E3VA 1I6XA 2YSRA 1U6GA 1SD4A 1XN7A 3FHZA 2GA1A 3CTAA 4PCQA 1IF1A 2W25A 1E17A 5L3EA 2HQRA 2JPCA 2C6YA 3JTGA 4L9TA 4UVAA 3IKVA 3KLOA 4AIJA 2MLKA 5KK1A 3BOQA 3C18A 1UHWA 1G6NA 4OMYA 2M5WA 3RPUA 2VXZA 5ICCA 2DU9A 3ECOA 3HYIA 1R5GA 2F5EA 6PAXA 1GXQA 3GFIA 4KIBA 4HDUA 2DBBA 1BJAA 2KIMA 3GZ6A 1TNTA 4PGGA 5BMZA 2XROA 2K4JA 2FNAA 4U88A 5HDKA 2VC1A 5HLHA 1I27A 4WXCA 3HRSA 3ISPA 2VC0A 3WG9A 4ENNA 3J80Z 4GGGA 2QQAA 5D5WB 2V6CA 1O57A 4UV9A 1Z91A 3I71A 2UWMA 2CSOA 3V8JA 2ESNA 2A6EF 5ILUA 5ILVA 2WWYA 1AWCA 1Y0UA 1STZA 1OR7A 4WF2A 4N0BA 4MTDA 1LDKB 2EJRA 2RV8A 3TGNA 3VEPA 1D5VA 5L3DA 2ZCWA 4IPAA 5HLGA 3FX3A 1BI2A 1FP2A 3BJ6A 4QWQA 1LB2A 1U5TB 1ON2A 3B73A 2PLYA 3ELKA 2F2EA 1XGOA 5IT3A 1B6AA 2K86A 4HDVA 1OPCA 3Q9SA 4BHBA 1P6RA 4IVNA 1FYLA 3WTZA 2OQRA 2G7HA 2PEXA 2PN6A 4Z2YA 2LKPA 4HX4A 2FU4A 1RNLA 3M9AA 2A69F 1T2KA 2HR3A 2PFBA 2ZO4A 1NHAA 2ISZA 3BWGA 3JW4A 5EEHA 4OIRF 3BJOA 1QBJA 5L3CA 2OZ6A 1IXSB 2QQ9A 3E6DA 1YO5C 3HRMA 2VBXA 5D8KB 1D3YA 2NNNA 3NRVA 1W4MA 4EJTA 2ZNYA 2IRFG 2VE8A 5HDNA 5D4RA 2L02A 4G94A 1P4AA 2V9VA 5H20A 2XKOA 5DV5A 1R7JA 4L18B 3R4KA 2K02A 5LEKA 4KICA 4L0YB 1U5TA 2VODA 4OIQF 5HS8A 1L0OC 1FOKA 5ICFA 1HKQA 1QNTA 2ZXJA 3E6CC 2ZNZA 3HRTA 3VFZA 3WTXC 3WODF 3FXQA 3I0TA 3ZMZA 3CUQB 5E17F 3JTHA 5IT9Z 1T98A 3I5UA 2RDPA 1R36A 4WWCA 5LHIA 1K78B 2O3FA 3LQRA 2QZ8A 2R3SA 4RB3C 4UV8A 2W85A 3GLXA 1ZG5A 3WGHA 1IAWA 2ESHA 4K2EA 1BI3A 3EYIA 1CF7A 4UVCA 2XASA 1KU9A 4ASNA 3JSOA 5L3GA 1KA8A 4S05A 1XMKA 2QVOA 4ZH4F 5LBQA 1SD5A 2HTJA 2BGCA 2EV5A 4JK1X 1IXRC 1YFHA 3I54A 2MH9A 3FMSA 3IWFA 1SD6A 4R8HA 3JSPA 4M6XA 1YS7A 3FM3A 2K27A 4JQFA 1HKTA 3H92A 1MJ9A 1MDMA 5LRRA 2XVCA 4EV0A 3KEQA 4ZYGA 4EMSA 1B1BA 5A2QZ 3Q9VA 1OMIA 2F5FA 2O0YA 2H94A 2HEOA 2DPUA 1K78A 3FXUA 3G73A 4EJVA 2J5OA 4A2UA 1OYWA 4HQMA 5HVQC 3HTUA 1C0WA 1D8JA 2LNBA 1LEAA 5DEQA 2KRFA 2JZYA 2IW5A 5D5UB 5LLQA 4RS8A 3GWZA 2NRAC 4ON0A 2L4AA 2V79A 5CVVA 2L54A 2IVMA 2WTEA 3H3ZA 3SHFA 1Z9CA 1LDJA 3FMQA 2KIFA 4G9YA 3ERED 3U2RA 2IA1A 1G3WA 4KIFA 4U0VA 2MH2A 2GAUA 4ZZDA 3F23A 4QLCU 3EUHA 1HXDA 4HZFA 4Q48A 3K2ZA 2RN7A 3TQNA 2HQNA 2STWA 4PZJA 1MKMA 2PJPA 5CLSA 2ZKZA 5E8GA 3ZMDA 4LLGF 2XAJA 2A3SA 2P7CB 3BPXA 3T1BA 3B02A 3MAJA 1FY7A 3FM5A 1PUEE 1FSHA 1QQIA 4BXUA 2D45A 4IRGA 1R1TA 5H6RA 3GX4X 2IA0A 4Q47A 4IF4A 1FYMA 4LGWA 4HLYA 2HKOA 1OYYA 2KIUA 1P2FA 2OBPA 2VT2A 1JXSA 1LQ1A 2CYYA 2FSWA 5DCMB 1ZREA 2CW0F 4AIKA 1F9NA 3I59B 3L00A 3CUOA 4ESFA 4E70A 4CDGA 3V7CA 3TKYA 2QYOA 4LLLA 4XRFA 3RIRA 1ZHFA 4UVBA 1O7FA 3NQOA 1YG2A 4I0AA 4OIOF 2EA4A 3E5UA 1KQ9A 1JHFA 1TQIA 2J5PA 1FBQA 1A04A 1YS6A 3R61A 5FFXA 2P5VA 1IRGA 1HW1A 4GO1A 4L5IA 2VOPA 1K7AA 2WC2A 1DPUA 2QWWA 5DCMA 1E2XA 4G6DA 4I0BA 3F6OA 3J80K 1F4KA 4FT8A 4MHGA 2XAFA 1W5TA 4P9UA 2CO5A 1KU7A 2O6GE 5D5VB 1T6SA 4AWXB 2QENA 3J81K 1LDDA 2P4WA 3QPTA 2GZWA 2D1VA 1BIBA 3F8BA 2ZMEB 2DO7A 3K1MA 1KU2A 2A68F 5TRDA 4O5VA 1P4XA 2DFIA 1R5HA 2FF4A 4EJOA 3V7RA 5AIPA 1KQ8A 1TTYA 1ZRDA 1FSEA 2FQ3A 3ZMUA 5JVTA 2DT5A 3KP4A 4HA8A 5FLXZ 1I5ZA 1W5SA 5BQTA 1EH7A 1Z1DA 2FBIA 2EFWA 1ZGJA 2Z99A 1GHCA 2IA2A 1KYWA 3OV8A 5J8CA 2P5KA 3ZP5A 5KVRA 2QBYB 3RKWA 4RB1A 3SFZA 2XHKA 3TO6A 3D5LA 2E7WA 4AD9A 4YFNF 1ZGAA 5JFRA 5HS9A 3K0LA 1DUXC 4M6YA 2ZMEA 3ABTA 4XBFA 3KCCA 2FMYA 4MQVA 2E1NA 2M45A 4R1HA 4KN7X 3LAPA 4I09A 3DQVC 1WKMA 4Q5SF 1WRJA 5L3FA 2NS0A 1J2XA 1FBUA 2B0LA 1BBYA 3EQLF 3DKWA 2H09A 1R1UA 2LF7A 3P7NA 1J9IA 1R23A 3HTSB 4HOBA 4G6QA 4GXOA 2Z9OA 4A6EA 2LDUA 1XD7A 3G3ZA 2DTRA 2QBYA 4O6JA 2UXNA 2AXLA 2EFPA 1W7PA 3O2PE 3LSTA 2HKXA 4B09A 3KEOA 4G7ZF 1S7AA 3DXJF 3QP5A 3T5XA 3QAHA 3BJAA 4JBAA 1ZH5A 2D1HA 3DFGA 3KETA 4HBLA 2V1DA 3KFWX 2VBWA 1TLHB 1RZ4A 4HF0A 5CVIA 4L5JA 4M73A 5E1WA 1ZLKA 2K7LA 1SFUA 4HV6A 4G8XA 4XLPF 3ZMVA 3TO9A 3TOAA 5F6FA 4WK8F 2Q0OA 3P9KA 3ZPLA 1LJ9A 4I7HA 3ZMSA 1S6LA 1ZRCA 5E1ZB 4LLNA 2UXXA 1R1VA 2Y75A 2IT0A 4A5NA 2DQLA 2VONA 1ZARA 4HW0A 3JAMK 2COMA 3KLNA 2EB7A 2IJLA 5D5XB 3DF8A 4OOIA 1J7KA 4UHTA 4CO8A 3MQ0A 1SAXA 5K5QA 1P92A 2KJCA 3KZYA 3LA3A 4B8XA 1T38A 1J59A 1FWZA 1ONVA 4HAMA 4L9VA 1CF7B 3GW2A 4KMUX 2HYFA 3BP8A 1PP7U 3ML6A 3VOEA 4CXFA 4CICA 4KYWA 4WXHA 3OOPA 3CDHA 2P8TA 2G9WA 1I1SA 3WGGA 3HOSA 1RUNA 4PDKA 2FBHA 2HZTA 5FD5A 2RQPA 1CGPA 2YX4A 3QOPA 1UFMA 5ICEA 3C7JA 1MDMB 4LK0F 2L3DA 1ZG3A 5LGTA 3PFIA 3GVAA 4HV5A 1BN5A 3F21A 2XRNA 4BNCA 1QZYA 4IXAA 3WTVC 2HGCA 2PMUA 5BS6A 2RKHA 2PQ8A 3L7WA 1X3UA 1MJAA 4M72A 3IKTA 1IUYA 5HLIA 4IRIA 3K1PA 4CZZA 3V4GA 3GZ5A 3E5QA 1G3SA 4ZYDA 4MQ9F 1YW8A 3P9CA 5TJJA 2DPDA 1MGTA 1JHHA 4OMZA 3O6BB 1MJBA 3HHHA 4NQWA 3E97A 4LFUA 4G7HF 4RGRA 2QUFA 2ZFWA 1O3QA 2HOEA 4M74A 2MA3A 1BI0A 1Z6TA 4KMFA 2D2WA 3E6MA 3IRQA 3WTUC 5DUKA 2V1XA 4EVIA 4U7DA 1YLFA 2JRTA 1AOYA 3HRUA 1BC8C 3U1DA 3BY6A 3KE2A 3F8NA 4ZYEA 1OYIA 3DPTA 5LHHA 2NNYA 1IN8A 1ZN2A 2EWNA 1HW5A 1YQAA 1F5TA 2JPBA 3W6KB 2MD5A 3DV8A 4OU0A 1L3LA 1SMTA 1W7PD 4OINF 4U0WA 1IXCA 2PMHA 2FMLA 3TO7A 3GO5A 1U3EM 4EQQA 2V1UA 4A0XA 2L4MA 2FRHA 2XIGA 2CWEA 5JI6A 5FB2A 3GFJA 2DI3A 4EJUA 3QP6A 2VOOA 3LAJA 5D6FA 4ZZLA 3BROA 2Q8KA 3ULQB 4RB0A 1UB9A 4M9XA 2YPRA 3LA2A 1Z7UA 2Z33A 1ZRFA 3FWEA 2EFOA 3KP3A 3N4MA 5BPDA 1YW9A 2BE5F 3C1DA 1WI9A 1EV7A 1JGSA 3BDDA 3I64A 2DK5A 4BHCA 1HW2A 3WGIA 3CUQC 2CG4A 2P5LC 3HHGA 2CFXA 5LGNA 2PI0A 1J75A 1HQCA 3I58A 5LGUA 5AIQA 1KGSA 2BBYA 4LJZF 5FLXK 4KFCA 1IZ1A 3GFLA 1Q1HA 2GXBA 4UXNA 4H0EA 4I2OA 3TDUC 4WX9A 4LMYA 1UCRA 3RYRA 3RTRA 3WU0A 5E8IA 5F1RA 3K69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5Y B;  4PGH A;  1ZLJ A;  3EET A;  4A0Y A;  2LF8 A;  2M1B A;  3CJN A;  1FYK A;  3GEZ A;  3RKX A;  4RAZ A;  5E18 F;  4LB6 B;  3IL2 A;  3E5X A;  4HYE A;  4FX0 A;  1O7L A;  4LB5 A;  5E1X A;  1MD0 A;  1G3Y A;  4KIG A;  4NB5 A;  1JE8 A;  2JSC A;  3HUG A;  4P9F A;  3MFK A;  1HKS A;  1O3R A;  1RIO H;  5CVJ A;  2RGV A;  4Y13 A;  2KKO A;  3K1N A;  1XSD A;  4KDP A;  5DYM A;  2H6B A;  3P9I A;  4LD5 A;  3VOD A;  3KP5 A;  4Y15 A;  1F1Z A;  3ZN0 A;  4MEX F;  2HS5 A;  3T0Y A;  4KUM A;  1WQ2 A;  3KP6 A;  2FNP A;  1XDS A;  4G7O F;  1UST A;  4IJA A;  4A5M A;  5LHG A;  2DAO A;  2GA2 A;  2VBZ A;  2DW4 A;  2L01 A;  5L3B A;  2VE9 A;  2JT1 A;  1XGM A;  5JHU A;  4CHU A;  2GQQ A;  3HSF A;  2NYX A;  4U0Y A;  4Y17 A;  4HX7 A;  2OAZ A;  2QM3 A;  1GVJ A;  1SFE A;  1YW7 A;  3I53 A;  4R79 A;  2PBI A;  4M9Z A;  1BIA A;  5CYV A;  1LVA A;  3IWZ A;  2Z3Y A;  2DK8 A;  4IRH A;  4EM1 A;  1XSX A;  4HLX A;  2KJB A;  1XMA A;  2Z5U A;  4RGX A;  2GXG A;  2XV4 S;  3S2W A;  4KNY A;  1W7P B;  4P5O A;  3EDP A;  1Z05 A;  1QO0 D;  1FLI A;  4BAY A;  3GF2 A;  2ELH A;  3IHU A;  2ISY A;  1ZYR F;  2YU3 A;  4LK1 F;  3CO6 C;  4EJW A;  2IPQ X;  3TOB A;  4I02 A;  5CJ9 A;  2FXA A;  3SZP A;  2O8X A;  3ROU A;  4ENM A;  1R22 A;  4YG2 F;  2ZBK A;  3RKY A;  3KZZ A;  4A0Z A;  2DQR A;  3ZQ7 A;  1FP1 D;  3FF5 A;  3MZY A;  3RYP A;  4P55 A;  5F64 A;  3CLO A;  4XSX F;  3WE2 A;  4ESB A;  2HWV A;  4RGS A;  4BHP A;  3D0S A;  4LG0 A;  2FE3 A;  1XCV A;  2ADU A;  2ETH A;  3J7A O;  3Q5F A;  1H9T A;  3TDZ C;  4OIP F;  4XSZ F;  4N9H A;  3REO A;  3QPH A;  1U78 A;  2VT3 A;  5IT9 K;  1IW7 F;  3R0J A;  2O61 A;  3L09 A;  5BPI A;  4ENK A;  3F3X A;  2MBF A;  4NHJ A;  3MZH A;  1K79 A;  1I1G A;  3ZN1 A;  1IN4 A;  3RDI A;  1IN7 A;  1REP C;  2XAQ A;  3LQQ A;  1S29 A;  1YYV A;  1J5Y A;  1SMY F;  4IHS A;  3J81 Z;  5EEG A;  3LA7 A;  4L9J A;  2YX7 A;  2Y0M A;  1T39 A;  2FOK A;  3PQJ A;  3QU6 A;  2OU2 A;  2F5C A;  4ETS A;  1O3S A;  3V7S A;  2OA4 A;  4UNO A;  1HST A;  2F5D A;  1FPQ A;  4A6D A;  4GYG A;  1XGS A;  4HX8 A;  4M71 A;  2ACJ A;  2BEO A;  2XGX A;  1KU3 A;  1XCB A;  4YFK F;  1J0R A;  1DPR A;  2W24 A;  5A2Q K;  3F8C A;  3MCZ A;  1R00 A;  1U2W A;  4ESJ A;  3MEX A;  4HF2 A;  4S04 A;  1XB4 A;  4O3M A;  1S8N A;  1V3F A;  3SZT A;  2K4B A;  2W84 A;  3GYH X;  3WE3 A;  1LNW A;  4EGY A;  4HQE A;  1KYZ A;  1QZZ A;  4D0P A;  3R60 A;  2STT A;  3R6S A;  5FO5 A;  5FD6 A;  5HS7 A;  3L2C A;  3RJP A;  1ULY A;  1PDN C;  1ZG1 A;  3E6B A;  4L9N A;  1G3T A;  3NEU A;  4IHT A;  5DCF A;  1WSU A;  2RC4 A;  1SD7 A;  2MLG A;  2YR2 A;  2H6C A;  5D6E A;  5LRS A;  2HDC A;  4EM0 B;  2X4H A;  1V4R A;  3IC7 A;  2A07 F;  4AVP A;  2MC3 A;  4RGU A;  1EH6 A;  4ENJ A;  2JTV A;  1XGN A;  1RI7 A;  1BI1 A;  2FA5 A;  2IP2 A;  1H0M A;  1MZB A;  2M30 A;  4P96 A;  5D8L B;  3FZV A;  1UHM A;  4FX4 A;  3WU1 B;  3F8M A;  5HDG A;  3LFK A;  1QPM A;  3H3U A;  4WXD A;  2A61 A;  5AON A;  1VTN C;  1IN5 A;  5DD4 A;  3V8L A;  4MEY F;  4BYY A;  3RPQ A;  2EV6 A;  2R7D A;  4MTE A;  2M8E A;  2P6T A;  5K5R A;  5D4S A;  5DDG A;  1U8R A;  1FBS A;  1USS A;  1FC3 A;  3WTS C;  1HBX G;  4U7B A;  1FX7 A;  2XAH A;  3GUD A;  3HOT A;  3KP7 A;  5ICG A;  1D8K A;  3JAM Z;  1U5T C;  3ECH A;  3CUQ A;  3I4P A;  1P4W A;  3GFM A;  4Q4Z F;  1ZAO A;  2H27 A;  3FXR A;  2E1C A;  1BOA A;  1XSV A;  2EV0 A;  2QQB A;  1RUO A;  4YIF A;  4KA4 A;  2GIV A;  3O3K A;  5DD8 A;  5ERI A;  2A6H F;  1S3J A;  2XKP A;  3HSE A;  1KQ0 A;  3COA C;  3C3W A;  2RNJ A;  3VB2 A;  4KN4 X;  4RB2 C;  4HF1 A;  2UZK A;  4F7Z A;  1HSJ A;  2TDX A;  3PQK A;  1FNN A;  3DPL C;  3T8R A;  4EGZ A;  1B59 A;  1WWX A;  1IRF A;  5CVR A;  3DP7 A;  1TNS A;  3QRF F;  4CYD A;  1SFX A;  1DDN A;  5HOO A;  5ILS A;  4RAY A;  5E20 A;  1BC7 C;  2R7F A;  4XLN F;  3BPV A;  3KP2 A;  4M9S A;  3WTW C;  2XUB A;  2BYV E;  2EK5 A;  1B9M A;  1IN6 A;  3RI4 A;  4AIH A;  5K1Y A;  2BV6 A;  2OZU A;  2P7V B;  3IRR A;  2QLZ A;  2VN2 A;  2NAZ A;  4I01 A;  3MWM A;  4N9I A;  3N97 A;  3F22 A;  2CGP A;  5FGM A;  3F6V A;  4I98 B;  5CVU A;  3QU3 A;  2HYG D;  2EFQ A;  2ZJ2 A;  4EM2 A;  5JR3 A;  2W57 A;  2DLL A;  2Y48 A;  4BQA A;  4WCG A;  1EH8 A;  5FFZ A;  3WTT C;  1PP8 F;  3F8F A;  4CGZ A;  3M7G A;  3DEU A;  2OD5 A;  3AAF A;  4MGR A;  4L0Z B;  3F72 A;  4DNC A;  2E7X A;  5LEJ A;  4A12 A;  1BM9 A;  2WV0 A;  1T0F A;  1TW3 A;  3WTY C;  1DP7 P;  3FMR A;  2VBY A;  1TQP A;  1Z6R A;  2FBK A;  3K9T A;  4ZYH A;  3V8K A;  1FZP B;  4GCV A;  3GXO A;  2HFH A;  3M8E A;  2Q2E A;  3HIF A;  3BZ6 A;  2XAG A;  2EFN A;  3SQN A;  2X0L A;  2G7U A;  2FEZ A;  2LSO A;  3W6J B;  3CO7 C;  1YTY A;  1ODD A;  3ABU A;  1S7O A;  4FHT A;  1QGP A;  2O03 A;  5DUI A;  4KT5 C;  1XDU A;  1O3T A;  4DQ2 A;  3I59 A;  4MNU A;  4YFX F;  1TQM A;  1TW2 A;  3T8T A;  1B4A A;  2P6S A;  3M1E A;  4YII A;  1G4D A;  3R0A A;  4UUV A;  5H6Q A;  1LEB A;  3LWF A;  4GYI A;  1H9G A;  4BH9 A;  3SXY A;  2EA2 A;  3HSR A;  3U9G A;  1TBX A;  1R58 A;  2PG4 A;  4TV7 A;  3ZMT A;  1GXP A;  3M8F A;  1ON1 A;  1OKR A;  2OQG A;  2HTS A;  5J6X A;  5ED4 A;  5J8F A;  2CQK A;  2GWR A;  3L9F A;  1FT9 A;  1K6O A;  2AS5 F;  1YIO A;  2M87 A;  4LG0 B;  5K5O A;  1B9N A;  5BOX A;  2RVC A;  3EYY A;  3E3V A;  1I6X A;  2YSR A;  1U6G A;  1SD4 A;  1XN7 A;  3FHZ A;  2GA1 A;  3CTA A;  4PCQ A;  1IF1 A;  2W25 A;  1E17 A;  5L3E A;  2HQR A;  2JPC A;  2C6Y A;  3JTG A;  4L9T A;  4UVA A;  3IKV A;  3KLO A;  4AIJ A;  2MLK A;  5KK1 A;  3BOQ A;  3C18 A;  1UHW A;  1G6N A;  4OMY A;  2M5W A;  3RPU A;  2VXZ A;  5ICC A;  2DU9 A;  3ECO A;  3HYI A;  1R5G A;  2F5E A;  6PAX A;  1GXQ A;  3GFI A;  4KIB A;  4HDU A;  2DBB A;  1BJA A;  2KIM A;  3GZ6 A;  1TNT A;  4PGG A;  5BMZ A;  2XRO A;  2K4J A;  2FNA A;  4U88 A;  5HDK A;  2VC1 A;  5HLH A;  1I27 A;  4WXC A;  3HRS A;  3ISP A;  2VC0 A;  3WG9 A;  4ENN A;  3J80 Z;  4GGG A;  2QQA A;  5D5W B;  2V6C A;  1O57 A;  4UV9 A;  1Z91 A;  3I71 A;  2UWM A;  2CSO A;  3V8J A;  2ESN A;  2A6E F;  5ILU A;  5ILV A;  2WWY A;  1AWC A;  1Y0U A;  1STZ A;  1OR7 A;  4WF2 A;  4N0B A;  4MTD A;  1LDK B;  2EJR A;  2RV8 A;  3TGN A;  3VEP A;  1D5V A;  5L3D A;  2ZCW A;  4IPA A;  5HLG A;  3FX3 A;  1BI2 A;  1FP2 A;  3BJ6 A;  4QWQ A;  1LB2 A;  1U5T B;  1ON2 A;  3B73 A;  2PLY A;  3ELK A;  2F2E A;  1XGO A;  5IT3 A;  1B6A A;  2K86 A;  4HDV A;  1OPC A;  3Q9S A;  4BHB A;  1P6R A;  4IVN A;  1FYL A;  3WTZ A;  2OQR A;  2G7H A;  2PEX A;  2PN6 A;  4Z2Y A;  2LKP A;  4HX4 A;  2FU4 A;  1RNL A;  3M9A A;  2A69 F;  1T2K A;  2HR3 A;  2PFB A;  2ZO4 A;  1NHA A;  2ISZ A;  3BWG A;  3JW4 A;  5EEH A;  4OIR F;  3BJO A;  1QBJ A;  5L3C A;  2OZ6 A;  1IXS B;  2QQ9 A;  3E6D A;  1YO5 C;  3HRM A;  2VBX A;  5D8K B;  1D3Y A;  2NNN A;  3NRV A;  1W4M A;  4EJT A;  2ZNY A;  2IRF G;  2VE8 A;  5HDN A;  5D4R A;  2L02 A;  4G94 A;  1P4A A;  2V9V A;  5H20 A;  2XKO A;  5DV5 A;  1R7J A;  4L18 B;  3R4K A;  2K02 A;  5LEK A;  4KIC A;  4L0Y B;  1U5T A;  2VOD A;  4OIQ F;  5HS8 A;  1L0O C;  1FOK A;  5ICF A;  1HKQ A;  1QNT A;  2ZXJ A;  3E6C C;  2ZNZ A;  3HRT A;  3VFZ A;  3WTX C;  3WOD F;  3FXQ A;  3I0T A;  3ZMZ A;  3CUQ B;  5E17 F;  3JTH A;  5IT9 Z;  1T98 A;  3I5U A;  2RDP A;  1R36 A;  4WWC A;  5LHI A;  1K78 B;  2O3F A;  3LQR A;  2QZ8 A;  2R3S A;  4RB3 C;  4UV8 A;  2W85 A;  3GLX A;  1ZG5 A;  3WGH A;  1IAW A;  2ESH A;  4K2E A;  1BI3 A;  3EYI A;  1CF7 A;  4UVC A;  2XAS A;  1KU9 A;  4ASN A;  3JSO A;  5L3G A;  1KA8 A;  4S05 A;  1XMK A;  2QVO A;  4ZH4 F;  5LBQ A;  1SD5 A;  2HTJ A;  2BGC A;  2EV5 A;  4JK1 X;  1IXR C;  1YFH A;  3I54 A;  2MH9 A;  3FMS A;  3IWF A;  1SD6 A;  4R8H A;  3JSP A;  4M6X A;  1YS7 A;  3FM3 A;  2K27 A;  4JQF A;  1HKT A;  3H92 A;  1MJ9 A;  1MDM A;  5LRR A;  2XVC A;  4EV0 A;  3KEQ A;  4ZYG A;  4EMS A;  1B1B A;  5A2Q Z;  3Q9V A;  1OMI A;  2F5F A;  2O0Y A;  2H94 A;  2HEO A;  2DPU A;  1K78 A;  3FXU A;  3G73 A;  4EJV A;  2J5O A;  4A2U A;  1OYW A;  4HQM A;  5HVQ C;  3HTU A;  1C0W A;  1D8J A;  2LNB A;  1LEA A;  5DEQ A;  2KRF A;  2JZY A;  2IW5 A;  5D5U B;  5LLQ A;  4RS8 A;  3GWZ A;  2NRA C;  4ON0 A;  2L4A A;  2V79 A;  5CVV A;  2L54 A;  2IVM A;  2WTE A;  3H3Z A;  3SHF A;  1Z9C A;  1LDJ A;  3FMQ A;  2KIF A;  4G9Y A;  3ERE D;  3U2R A;  2IA1 A;  1G3W A;  4KIF A;  4U0V A;  2MH2 A;  2GAU A;  4ZZD A;  3F23 A;  4QLC U;  3EUH A;  1HXD A;  4HZF A;  4Q48 A;  3K2Z A;  2RN7 A;  3TQN A;  2HQN A;  2STW A;  4PZJ A;  1MKM A;  2PJP A;  5CLS A;  2ZKZ A;  5E8G A;  3ZMD A;  4LLG F;  2XAJ A;  2A3S A;  2P7C B;  3BPX A;  3T1B A;  3B02 A;  3MAJ A;  1FY7 A;  3FM5 A;  1PUE E;  1FSH A;  1QQI A;  4BXU A;  2D45 A;  4IRG A;  1R1T A;  5H6R A;  3GX4 X;  2IA0 A;  4Q47 A;  4IF4 A;  1FYM A;  4LGW A;  4HLY A;  2HKO A;  1OYY A;  2KIU A;  1P2F A;  2OBP A;  2VT2 A;  1JXS A;  1LQ1 A;  2CYY A;  2FSW A;  5DCM B;  1ZRE A;  2CW0 F;  4AIK A;  1F9N A;  3I59 B;  3L00 A;  3CUO A;  4ESF A;  4E70 A;  4CDG A;  3V7C A;  3TKY A;  2QYO A;  4LLL A;  4XRF A;  3RIR A;  1ZHF A;  4UVB A;  1O7F A;  3NQO A;  1YG2 A;  4I0A A;  4OIO F;  2EA4 A;  3E5U A;  1KQ9 A;  1JHF A;  1TQI A;  2J5P A;  1FBQ A;  1A04 A;  1YS6 A;  3R61 A;  5FFX A;  2P5V A;  1IRG A;  1HW1 A;  4GO1 A;  4L5I A;  2VOP A;  1K7A A;  2WC2 A;  1DPU A;  2QWW A;  5DCM A;  1E2X A;  4G6D A;  4I0B A;  3F6O A;  3J80 K;  1F4K A;  4FT8 A;  4MHG A;  2XAF A;  1W5T A;  4P9U A;  2CO5 A;  1KU7 A;  2O6G E;  5D5V B;  1T6S A;  4AWX B;  2QEN A;  3J81 K;  1LDD A;  2P4W A;  3QPT A;  2GZW A;  2D1V A;  1BIB A;  3F8B A;  2ZME B;  2DO7 A;  3K1M A;  1KU2 A;  2A68 F;  5TRD A;  4O5V A;  1P4X A;  2DFI A;  1R5H A;  2FF4 A;  4EJO A;  3V7R A;  5AIP A;  1KQ8 A;  1TTY A;  1ZRD A;  1FSE A;  2FQ3 A;  3ZMU A;  5JVT A;  2DT5 A;  3KP4 A;  4HA8 A;  5FLX Z;  1I5Z A;  1W5S A;  5BQT A;  1EH7 A;  1Z1D A;  2FBI A;  2EFW A;  1ZGJ A;  2Z99 A;  1GHC A;  2IA2 A;  1KYW A;  3OV8 A;  5J8C A;  2P5K A;  3ZP5 A;  5KVR A;  2QBY B;  3RKW A;  4RB1 A;  3SFZ A;  2XHK A;  3TO6 A;  3D5L A;  2E7W A;  4AD9 A;  4YFN F;  1ZGA A;  5JFR A;  5HS9 A;  3K0L A;  1DUX C;  4M6Y A;  2ZME A;  3ABT A;  4XBF A;  3KCC A;  2FMY A;  4MQV A;  2E1N A;  2M45 A;  4R1H A;  4KN7 X;  3LAP A;  4I09 A;  3DQV C;  1WKM A;  4Q5S F;  1WRJ A;  5L3F A;  2NS0 A;  1J2X A;  1FBU A;  2B0L A;  1BBY A;  3EQL F;  3DKW A;  2H09 A;  1R1U A;  2LF7 A;  3P7N A;  1J9I A;  1R23 A;  3HTS B;  4HOB A;  4G6Q A;  4GXO A;  2Z9O A;  4A6E A;  2LDU A;  1XD7 A;  3G3Z A;  2DTR A;  2QBY A;  4O6J A;  2UXN A;  2AXL A;  2EFP A;  1W7P A;  3O2P E;  3LST A;  2HKX A;  4B09 A;  3KEO A;  4G7Z F;  1S7A A;  3DXJ F;  3QP5 A;  3T5X A;  3QAH A;  3BJA A;  4JBA A;  1ZH5 A;  2D1H A;  3DFG A;  3KET A;  4HBL A;  2V1D A;  3KFW X;  2VBW A;  1TLH B;  1RZ4 A;  4HF0 A;  5CVI A;  4L5J A;  4M73 A;  5E1W A;  1ZLK A;  2K7L A;  1SFU A;  4HV6 A;  4G8X A;  4XLP F;  3ZMV A;  3TO9 A;  3TOA A;  5F6F A;  4WK8 F;  2Q0O A;  3P9K A;  3ZPL A;  1LJ9 A;  4I7H A;  3ZMS A;  1S6L A;  1ZRC A;  5E1Z B;  4LLN A;  2UXX A;  1R1V A;  2Y75 A;  2IT0 A;  4A5N A;  2DQL A;  2VON A;  1ZAR A;  4HW0 A;  3JAM K;  2COM A;  3KLN A;  2EB7 A;  2IJL A;  5D5X B;  3DF8 A;  4OOI A;  1J7K A;  4UHT A;  4CO8 A;  3MQ0 A;  1SAX A;  5K5Q A;  1P92 A;  2KJC A;  3KZY A;  3LA3 A;  4B8X A;  1T38 A;  1J59 A;  1FWZ A;  1ONV A;  4HAM A;  4L9V A;  1CF7 B;  3GW2 A;  4KMU X;  2HYF A;  3BP8 A;  1PP7 U;  3ML6 A;  3VOE A;  4CXF A;  4CIC A;  4KYW A;  4WXH A;  3OOP A;  3CDH A;  2P8T A;  2G9W A;  1I1S A;  3WGG A;  3HOS A;  1RUN A;  4PDK A;  2FBH A;  2HZT A;  5FD5 A;  2RQP A;  1CGP A;  2YX4 A;  3QOP A;  1UFM A;  5ICE A;  3C7J A;  1MDM B;  4LK0 F;  2L3D A;  1ZG3 A;  5LGT A;  3PFI A;  3GVA A;  4HV5 A;  1BN5 A;  3F21 A;  2XRN A;  4BNC A;  1QZY A;  4IXA A;  3WTV C;  2HGC A;  2PMU A;  5BS6 A;  2RKH A;  2PQ8 A;  3L7W A;  1X3U A;  1MJA A;  4M72 A;  3IKT A;  1IUY A;  5HLI A;  4IRI A;  3K1P A;  4CZZ A;  3V4G A;  3GZ5 A;  3E5Q A;  1G3S A;  4ZYD A;  4MQ9 F;  1YW8 A;  3P9C A;  5TJJ A;  2DPD A;  1MGT A;  1JHH A;  4OMZ A;  3O6B B;  1MJB A;  3HHH A;  4NQW A;  3E97 A;  4LFU A;  4G7H F;  4RGR A;  2QUF A;  2ZFW A;  1O3Q A;  2HOE A;  4M74 A;  2MA3 A;  1BI0 A;  1Z6T A;  4KMF A;  2D2W A;  3E6M A;  3IRQ A;  3WTU C;  5DUK A;  2V1X A;  4EVI A;  4U7D A;  1YLF A;  2JRT A;  1AOY A;  3HRU A;  1BC8 C;  3U1D A;  3BY6 A;  3KE2 A;  3F8N A;  4ZYE A;  1OYI A;  3DPT A;  5LHH A;  2NNY A;  1IN8 A;  1ZN2 A;  2EWN A;  1HW5 A;  1YQA A;  1F5T A;  2JPB A;  3W6K B;  2MD5 A;  3DV8 A;  4OU0 A;  1L3L A;  1SMT A;  1W7P D;  4OIN F;  4U0W A;  1IXC A;  2PMH A;  2FML A;  3TO7 A;  3GO5 A;  1U3E M;  4EQQ A;  2V1U A;  4A0X A;  2L4M A;  2FRH A;  2XIG A;  2CWE A;  5JI6 A;  5FB2 A;  3GFJ A;  2DI3 A;  4EJU A;  3QP6 A;  2VOO A;  3LAJ A;  5D6F A;  4ZZL A;  3BRO A;  2Q8K A;  3ULQ B;  4RB0 A;  1UB9 A;  4M9X A;  2YPR A;  3LA2 A;  1Z7U A;  2Z33 A;  1ZRF A;  3FWE A;  2EFO A;  3KP3 A;  3N4M A;  5BPD A;  1YW9 A;  2BE5 F;  3C1D A;  1WI9 A;  1EV7 A;  1JGS A;  3BDD A;  3I64 A;  2DK5 A;  4BHC A;  1HW2 A;  3WGI A;  3CUQ C;  2CG4 A;  2P5L C;  3HHG A;  2CFX A;  5LGN A;  2PI0 A;  1J75 A;  1HQC A;  3I58 A;  5LGU A;  5AIQ A;  1KGS A;  2BBY A;  4LJZ F;  5FLX K;  4KFC A;  1IZ1 A;  3GFL A;  1Q1H A;  2GXB A;  4UXN A;  4H0E A;  4I2O A;  3TDU C;  4WX9 A;  4LMY A;  1UCR A;  3RYR A;  3RTR A;  3WU0 A;  5E8I A;  5F1R A;  3K69 A; 
#chains in the Genus database with same CATH topology
 2A5Y B;  1K4T A;  1FMV A;  4PGH A;  1ZLJ A;  2K9M A;  3EET A;  4A0Y A;  2LF8 A;  2M1B A;  3A2K A;  2K3F A;  2L7M P;  3CJN A;  1FYK A;  2VXD A;  4XR6 A;  3GEZ A;  2X85 A;  5FLM J;  1U9N A;  3SYT A;  3RKX A;  1Y8R B;  3G1O A;  4RAZ A;  4XID A;  2OC6 A;  3FDY A;  5E18 F;  1CQT A;  2JVH A;  4LB6 B;  4J01 A;  2M4K A;  2HXO A;  3IL2 A;  3OSF A;  5HOD A;  3AG3 H;  3I3L A;  3BG6 A;  5B66 C;  3E5X A;  1MBG A;  1K61 A;  4HYE A;  5IP9 J;  1ENH A;  4FX0 A;  3QYE A;  2X1C A;  1O7L A;  4LB5 A;  4DYR A;  5E1X A;  1MD0 A;  1G3Y A;  4KIG A;  2VQG A;  4NB5 A;  1HF0 A;  3CDI A;  1JE8 A;  2JSC A;  3HUG A;  4P9F A;  4DYQ A;  3MFK A;  1X4P A;  1H8A C;  1HKS A;  2VQL A;  2NOG A;  1O3R A;  1RIO H;  5CVJ A;  2RGV A;  4Y13 A;  3PM1 A;  3K6G A;  2KKO A;  2GBY A;  3K1N A;  1WZ2 A;  2FJ1 A;  1XSD A;  2CV0 A;  1X2N A;  5DYM A;  4KDP A;  2H6B A;  3P9I A;  4LD5 A;  3GLL A;  3VOD A;  1YJ9 I;  3KP5 A;  4Y15 A;  1EF4 A;  4BJT A;  2NVX J;  1F1Z A;  3ZN0 A;  4MEX F;  3HXL A;  2V9K A;  2HS5 A;  3I56 I;  3T0Y A;  2M3A A;  4KUM A;  1WQ2 A;  3KP6 A;  2FNP A;  4W97 A;  1TWG J;  4C30 A;  5J1Y A;  4LOC A;  4A3J J;  3JRE A;  1XDS A;  2PMZ A;  3S93 A;  4G7O F;  4I76 A;  3CF5 F;  3LL7 A;  1JJ8 C;  3E0J B;  4BS9 A;  4S0H B;  5J4V A;  1TZL A;  2I8D A;  1UST A;  4RM3 A;  2K9L A;  4IJA A;  4M3F A;  4A5M A;  5LHG A;  2BHZ A;  3NWT A;  2AXT C;  2DAO A;  1BW5 A;  1V5G A;  2GA2 A;  2VBZ A;  2ELJ A;  2DW4 A;  2L01 A;  3K4K A;  5L3B A;  2VE9 A;  4BEH B;  3LSK A;  2JT1 A;  3ZQG A;  1IRZ A;  1T0F C;  1XGM A;  4RAF A;  5JHU A;  3RKQ A;  4CHU A;  2GQQ A;  3ONQ A;  3HSF A;  2OCC H;  2NYX A;  4U0Y A;  4Y17 A;  2WAQ A;  4HX7 A;  2JUG A;  4QSH A;  2OAZ A;  2QM3 A;  1GVJ A;  2CW7 A;  1SFE A;  3D5S C;  3IH3 A;  4GRI A;  4U87 A;  3MKY B;  1YW7 A;  3I53 A;  4R79 A;  2LVS A;  2PBI A;  2LLK A;  4M9Z A;  1BIA A;  1WI3 A;  5CYV A;  1LVA A;  3IWZ A;  2Z3Y A;  2DK8 A;  4IRH A;  2LRE A;  4EM1 A;  1XSX A;  4HLX A;  2KJB A;  3AG4 H;  2ICW G;  1XMA A;  4XLC A;  1YIT I;  5J40 A;  4XRM A;  2Z5U A;  1WVR A;  3OYC A;  4RGX A;  2CW8 A;  2GXG A;  2XV4 S;  3S2W A;  4KNY A;  1W7P B;  3OY9 A;  4P5O A;  4XK4 A;  3EDP A;  4A3D J;  1Z05 A;  1QO0 D;  3TP3 A;  1FLI A;  2R7W A;  4BAY A;  3FK7 A;  4ZJZ A;  3G2B A;  2BY3 A;  3GF2 A;  2ELH A;  1H88 C;  4XM3 A;  3IHU A;  2ISY A;  2L9R A;  1ZYR F;  2YU3 A;  3OR1 C;  2VJ5 A;  4LK1 F;  3K4C A;  2X48 A;  3K4J A;  3CO6 C;  4EJW A;  4CZC A;  4M3G A;  2IPQ X;  3S3O A;  4D5F A;  3TOB A;  4I02 A;  5CJ9 A;  1SVO A;  2F4O B;  2ZFU A;  2FXA A;  4V2F A;  3SZP A;  2O8X A;  3G1M A;  1SFK A;  4PJM A;  4BEH A;  2IGN A;  3ROU A;  1MH4 A;  4ENM A;  1R22 A;  4YG2 F;  2ZBK A;  3RKY A;  3KZZ A;  4A0Z A;  4N4O B;  2DQR A;  3ZQ7 A;  1Z3Y A;  1FP1 D;  3PO3 J;  3FF5 A;  3MZY A;  5FKM A;  2V9P A;  3RYP A;  1SVM A;  4P55 A;  5GTI C;  3IV5 A;  5F64 A;  1OCR H;  3CLO A;  5IP6 A;  2LR8 A;  4AUX A;  2DA7 A;  5IYC J;  4XSX F;  2QGU A;  4A93 J;  3WE2 A;  4ESB A;  2HWV A;  4RGS A;  4BHP A;  4CCO A;  3HDD A;  3D0S A;  2ID3 A;  4LG0 A;  2FE3 A;  3CCM I;  4BDZ A;  1XCV A;  2ADU A;  3D1N I;  2ETH A;  3J7A O;  2LY2 A;  2ZSH B;  3Q5F A;  2DOD A;  2V1N A;  2DJN A;  5DM6 F;  1H9T A;  3TDZ C;  2JA2 A;  4OIP F;  4XSZ F;  1MIJ A;  3L2Q A;  4MFD A;  4N9H A;  3REO A;  3QPH A;  1U78 A;  4NC6 A;  3BQZ A;  2IGK A;  4DIQ A;  4I6Z A;  2JSP A;  2VT3 A;  5IT9 K;  2JRM A;  2RRE A;  1IW7 F;  1T8I A;  3GTP J;  2CJJ A;  2E35 A;  3R0J A;  2H1K A;  3TP0 A;  2O61 A;  3L09 A;  5BPI A;  4ENK A;  3F3X A;  2IBD A;  4ANJ A;  2MBF A;  4NHJ A;  1K6Y A;  1PUF B;  3MZH A;  4UB8 C;  1BA5 A;  1K79 A;  1I1G A;  2OPT A;  4YIR X;  2LBF A;  1VI0 A;  3ZN1 A;  1IN4 A;  2CV1 A;  3A01 B;  3RDI A;  4B3X A;  4E4H A;  1IN7 A;  3OYD A;  1REP C;  2XAQ A;  3LQQ A;  1S29 A;  1X1D A;  1YYV A;  1ETX A;  1J5Y A;  1SMY F;  2ZXH A;  4XIC A;  2PX9 A;  4IHS A;  5EF6 A;  4CCK A;  1W36 C;  3J81 Z;  1ITY A;  2MGQ A;  4X6A J;  5EEG A;  4J00 A;  3LA7 A;  4L9J A;  3KYD B;  2YX7 A;  2Y0M A;  2O7O A;  1X19 A;  3I4N J;  3HJE A;  3JRG A;  2NS7 A;  2FOK A;  3PQJ A;  3QU6 A;  1T39 A;  3TL4 X;  2OU2 A;  2F5C A;  4ETS A;  2DCE A;  4F3Q A;  1O3S A;  3I9V 2;  4QPQ A;  3OS2 A;  1TWC J;  4IHV A;  2Y31 A;  3V7S A;  2V26 A;  2OA4 A;  4UNO A;  1HST A;  2JA7 J;  1MMD A;  2F5D A;  1MBK A;  1MMN A;  5GAG J;  1FPQ A;  2VAS A;  4NUB A;  4A6D A;  4EEF G;  2NVY J;  4GYG A;  2L9V A;  2B7E A;  4EAT A;  1XGS A;  1WFX A;  4HEA 2;  1BR4 A;  4HX8 A;  4M71 A;  2ACJ A;  3K7A J;  2BEO A;  1D1B A;  2XGX A;  3TW7 A;  2PJR A;  1KU3 A;  1XCB A;  1IG7 A;  2NVT J;  1YX3 A;  4YFK F;  3DU6 A;  2DOA A;  2GLO A;  1J0R A;  4CUG A;  1DPR A;  1IUF A;  2QSF X;  3OIQ A;  3ZXS A;  2K40 A;  3L2U A;  3BR3 A;  3H35 A;  2JA6 J;  2W24 A;  5A2Q K;  3F8C A;  3MCZ A;  2R5Z B;  1QZE A;  5LFA A;  2E2H J;  2GIZ A;  1R00 A;  1JT6 A;  1U2W A;  4ESJ A;  3RZD J;  3MEX A;  1PUF A;  2K9N A;  4HF2 A;  4S04 A;  1XB4 A;  1S7E A;  3SDG A;  4O3M A;  5FRN A;  1S8N A;  1V3F A;  4X1E A;  3GME A;  4RLF A;  3A01 A;  3SZT A;  2K4B A;  2W84 A;  4Y33 A;  3CES A;  1LNW A;  3K2A A;  3WE3 A;  3OYH A;  1KYZ A;  3GYH X;  4EGY A;  4HQE A;  2HVR A;  1QZZ A;  4D0P A;  4A3K J;  3R60 A;  2STT A;  3R6S A;  4M3D A;  4JX6 A;  3DCF A;  4XRS A;  5FO5 A;  4HG2 A;  2XPU A;  5FD6 A;  3ZRG A;  5HS7 A;  3HOU J;  2ZJQ F;  3MMY B;  3L2C A;  2UV1 A;  2VPR A;  3RJP A;  2DYR H;  2E2I J;  1ULY A;  3X2Q H;  3CP2 A;  1JUP A;  2DMU A;  2DOF A;  1PDN C;  3W2W A;  3ASN H;  1ZG1 A;  1TP4 A;  3E6B A;  2XB0 X;  4L9N A;  1GV5 A;  1RC9 A;  2MSY A;  1EA3 A;  1G3T A;  1E3O C;  2DMP A;  3NEU A;  1DGW Y;  4IHT A;  5DCF A;  2DJI A;  2ZC2 A;  4B43 A;  4NC8 A;  3CC7 I;  4LG3 A;  2AQE A;  2EIN H;  1WSU A;  2RC4 A;  4PUS A;  3B6C A;  4NQW B;  1MSE C;  1SD7 A;  1X3Z B;  2ID6 A;  2MLG A;  2YR2 A;  2BW3 A;  2Y0S A;  1J09 A;  2H6C A;  2R7S A;  4CA0 A;  5D6E A;  5LRS A;  2HDC A;  4EM0 B;  3K4B A;  2W7N A;  3MKW B;  4II2 A;  2TRT A;  2X4H A;  1V4R A;  3IC7 A;  2JA5 J;  2A07 F;  4AVP A;  2XC7 A;  2KFD A;  4A69 C;  2MC3 A;  2QKL B;  5C3E J;  4RGU A;  2R0Q C;  2R5Z A;  4PJN A;  1EH6 A;  3Q0V A;  4ENJ A;  2JTV A;  4RLQ A;  5JVG F;  1XGN A;  1M1E B;  1RI7 A;  1BI1 A;  2FA5 A;  1LFB A;  2IP2 A;  4A3C J;  2KDO A;  1H0M A;  1VQ9 I;  1MZB A;  2M30 A;  4P96 A;  5D8L B;  1W0T A;  1B72 B;  3BLY A;  3FZV A;  1UHM A;  4FX4 A;  1XC5 A;  2JK3 A;  3WU1 B;  3F8M A;  3Q0W A;  1XPX A;  2E1M B;  1NH3 A;  1D5Y A;  5HDG A;  3LFK A;  4E7I A;  3TW6 A;  1A5J A;  1QPM A;  2GM4 A;  3L2W A;  1LFP A;  4D7N A;  3H3U A;  4WXD A;  2EQR A;  2A61 A;  3RZO J;  2LTP A;  5AON A;  3OL3 A;  1VTN C;  3K4M A;  1IN5 A;  3DEE A;  5DD4 A;  3OYB A;  1W36 D;  2ZXI A;  3V8L A;  2YS9 A;  4MEY F;  4BYY A;  3RPQ A;  4XOP A;  2EV6 A;  5FLV A;  2DDB A;  3OYG A;  5EEA A;  3SEZ A;  2EIJ H;  4J19 A;  2R7D A;  3H0G J;  3PNT A;  4JX5 A;  4MTE A;  2DOE A;  3VWB A;  3QOD A;  2M8E A;  2HVS A;  2P6T A;  5K5R A;  5D4S A;  2IXS A;  2X1E A;  5DDG A;  1FBS A;  1USS A;  2OJE D;  1U8R A;  1FC3 A;  2WA0 A;  3WTS C;  1HBX G;  3PFY A;  4DGW B;  2GOM A;  3JRD A;  4U7B A;  2NVU B;  2Y9Y A;  1FX7 A;  1R71 A;  1U0J A;  2XAH A;  4H4K C;  5GPA A;  1R4N B;  3GUD A;  3HOT A;  3KP7 A;  3JR9 A;  5ICG A;  1D8K A;  3LSM A;  5CPR B;  3JAM Z;  1U5T C;  3CME I;  2BHY A;  3QWL A;  5B3S H;  3ECH A;  3CUQ A;  3JCU C;  3CCY A;  5J1R A;  3I4P A;  1P4W A;  3GFM A;  1FOW A;  4Q4Z F;  1ZAO A;  1V55 H;  2H27 A;  5GPC A;  4OAY A;  3CCV I;  2CMP A;  3A1Y A;  3FXR A;  3S1N J;  2E1C A;  1BOA A;  1XSV A;  4ZYA A;  1VQ8 I;  2EV0 A;  3JRH A;  2KHM A;  2L7Z A;  1UHS A;  2QQB A;  4XKW A;  1X1A A;  3IH4 A;  4YIF A;  4KA4 A;  2GIV A;  3H9J A;  4BE0 A;  1RUO A;  3O3K A;  5DD8 A;  5ERI A;  2A6H F;  1S3J A;  2XKP A;  3HSE A;  1NTC A;  1KQ0 A;  3COA C;  3LSH A;  2EIK H;  3KYC B;  5EGO B;  2K9Q A;  3C3W A;  2RNJ A;  3FXL A;  4JP0 A;  1D0X A;  3SFI A;  3VB2 A;  4KN4 X;  4RB2 C;  2JA8 J;  1HA8 A;  5DS9 A;  4HF1 A;  2QEX I;  1R49 A;  3VSK A;  2I5U A;  4HPQ A;  4AYB N;  2UZK A;  4F7Z A;  4A3M J;  1HSJ A;  2TDX A;  3PQK A;  3VSL A;  5IOZ A;  1FNN A;  3DPL C;  3T8R A;  4B3A A;  4EGZ A;  1B59 A;  1WWX A;  4BQN A;  1IRF A;  5CVR A;  3DP7 A;  1TNS A;  4E7H A;  3QRF F;  4CYD A;  1SFX A;  4FE4 A;  2ECC A;  1DDN A;  1X4O A;  2WB1 A;  1UG2 A;  5HOO A;  5ILS A;  1LFU P;  1WCM J;  4RAY A;  3BR2 A;  3G6E I;  5E20 A;  1BC7 C;  2R7F A;  4XLN F;  1TC3 C;  1YRN B;  3BPV A;  3KP2 A;  4M9S A;  3WTW C;  1KZH A;  1JKR C;  2XUB A;  2BYV E;  2CQX A;  1VQ5 I;  2EK5 A;  1Y1V J;  1HOM A;  1B9M A;  3W3C A;  1IN6 A;  4FIS A;  4V2G A;  1QPI A;  2X1D A;  2FQ4 A;  4CCJ A;  3RI4 A;  4AIH A;  4UY8 I;  2R7U A;  3FHN A;  1R6R A;  3HC7 A;  5K1Y A;  1OJL A;  2BV6 A;  2OZU A;  2P7V B;  2WY8 Q;  3IRR A;  2QLZ A;  2E34 A;  2BVL A;  2VN2 A;  5FKL A;  3NWS A;  3MKZ A;  2NAZ A;  4I01 A;  1OIS A;  2XPW A;  3MWM A;  4N9I A;  3H3V K;  3N97 A;  3F22 A;  2CGP A;  5FGM A;  3IH2 A;  4BGD A;  4IX7 A;  3F6V A;  4I98 B;  5CVU A;  5LD2 C;  1VQ7 I;  3QU3 A;  2HYG D;  2EFQ A;  2ZJ2 A;  4EM2 A;  5JR3 A;  1A6I A;  2E1O A;  2W57 A;  5J47 A;  3HUG B;  2DLL A;  5IPA A;  2Y48 A;  2DA4 A;  5KHD A;  4BQA A;  3WG7 H;  4WCG A;  1EH8 A;  5FFZ A;  3DBL B;  3WTT C;  1PP8 F;  4PK4 A;  3SEQ A;  3HKZ N;  4DW6 A;  3F8F A;  4CGZ A;  3M7G A;  1N78 A;  3DEU A;  2OD5 A;  3AAF A;  4MGR A;  1ZR2 A;  4L0Z B;  3F72 A;  4DNC A;  2E7X A;  5LEJ A;  4W1U A;  4A12 A;  3K4L A;  5M3M J;  4XLE A;  1BM9 A;  5E3N A;  4OWR B;  2WV0 A;  3H36 A;  1GT0 C;  4D5C A;  1G59 A;  1T0F A;  1TW3 A;  1ACI A;  4HRI A;  5F1J A;  3WTY C;  3A02 A;  1DP7 P;  2HOA A;  3FMR A;  2VBY A;  1YRN A;  3TED A;  1TQP A;  3CJR B;  4E7S A;  4IZZ A;  2L5Q A;  1Z6R A;  2XGC A;  2FBK A;  3K4N A;  2KIQ A;  3K9T A;  1WJ5 A;  4ZYH A;  5GAD J;  4CYC A;  2ZB9 A;  2H8R A;  2A6T A;  1F43 A;  3LFU A;  3V8K A;  1FZP B;  4GCV A;  3GXO A;  2VKD A;  3BR5 A;  1BJZ A;  3F0C A;  3QYB A;  3EUH C;  3IAS 2;  2LOO A;  2HFH A;  4DOZ A;  3GTJ J;  2YUS A;  1T56 A;  3M8E A;  2Q2E A;  3S32 A;  3HIF A;  3BZ6 A;  2W1O A;  4MIM A;  1X58 A;  1W5C C;  2XAG A;  2EFN A;  1BW6 A;  1W1W E;  3OR2 C;  1PYV A;  3H5R A;  1ZQ3 P;  3SQN A;  2X0L A;  3LMM A;  2G7U A;  2FEZ A;  2LSO A;  3HL2 A;  3W6J B;  3CO7 C;  1YTY A;  1ODD A;  2ECB A;  2LG4 A;  2R7V A;  3ABU A;  1S7O A;  1T08 B;  4FHT A;  3GTG J;  5CKT A;  1FOY A;  1QGP A;  2O03 A;  1HC8 A;  5DUI A;  5F0H A;  3GTM J;  4KT5 C;  3ZQF A;  4FQG A;  1OCO H;  1XDU A;  1O3T A;  3NAU A;  4DQ2 A;  3I59 A;  5HNF A;  1UG0 A;  4MNU A;  4YFX F;  1TQM A;  4ZTJ A;  1TW2 A;  2KIS A;  4D7M A;  3T8T A;  1B4A A;  2P6S A;  3M1E A;  1RES A;  4YII A;  1G4D A;  1MH3 A;  3K70 D;  1AKH B;  4LIT A;  1OLT A;  3R0A A;  4UUV A;  4JOM A;  5H6Q A;  4QIW N;  1OCT C;  2P0W A;  1LEB A;  3LWF A;  4GYI A;  2L0K A;  1H9G A;  4BH9 A;  4F55 A;  3SXY A;  1YJW I;  2EA2 A;  2LYC A;  3HSR A;  4IL6 C;  3U9G A;  1TBX A;  1Y56 A;  1R58 A;  2PG4 A;  1TWF J;  1VQL I;  4TV7 A;  3ZMT A;  1NG6 A;  5E3L A;  1GXP A;  3K10 A;  4LIV A;  3M8F A;  1ON1 A;  3LSG A;  3MZ8 A;  2HXI A;  5JHF A;  3OYL A;  1S72 I;  2LP0 A;  1OKR A;  2OQG A;  2HTS A;  2E19 A;  2M0M A;  3PO2 J;  5J6X A;  1OFC X;  5ED4 A;  5J8F A;  2CQK A;  2GWR A;  4DZJ A;  1R9T J;  3L9F A;  1FT9 A;  1VQK I;  4Y7N J;  2W4S A;  3CCJ I;  1K6O A;  2AS5 F;  1YIO A;  1I39 A;  2CQN A;  3LSI A;  2JQ7 A;  2M87 A;  3ZQI A;  3JRB A;  3RQI A;  4LG0 B;  5K5O A;  2LFB A;  1B9N A;  5BOX A;  3DTI A;  2RVC A;  3EYY A;  4RDU A;  3E3V A;  4RBO A;  1I6X A;  2YSR A;  1U6G A;  1SD4 A;  1XN7 A;  2IS1 A;  2DA3 A;  2GA1 A;  4NDL A;  1FIA A;  3CTA A;  4PCQ A;  3DBR B;  3FHZ A;  1IF1 A;  4UUT A;  2W25 A;  1E17 A;  5L3E A;  3FXM A;  3A03 A;  2HQR A;  2JPC A;  2Z16 A;  2C6Y A;  4A3G J;  3JTG A;  1JUS A;  3GTO J;  3S16 J;  5EG0 A;  1IC8 A;  2NXN B;  4L9T A;  2LBF B;  2HOT A;  2OV7 A;  2QKM B;  2FOW A;  4UVA A;  4IHW A;  3IKV A;  3KLO A;  4AIJ A;  1AKH A;  2MLK A;  5KK1 A;  3BOQ A;  2WAD A;  3C18 A;  2ZXW H;  1UHW A;  1G6N A;  1WHU A;  4OMY A;  2M5W A;  1YHQ I;  3FKJ A;  3RPU A;  4BAC A;  2DT6 A;  1AA7 A;  2VXZ A;  5ICC A;  3E7L A;  1VQN I;  2DU9 A;  3ECO A;  2HDW A;  3HYI A;  1I3A A;  1R5G A;  2F5E A;  4AU7 A;  6PAX A;  2R5Y A;  1GXQ A;  4IEJ A;  3GFI A;  2K5C A;  2M4G A;  3H0D A;  5B5E C;  2RNG A;  2L9N A;  1NK2 P;  4MFE A;  4KIB A;  3CCE I;  1YX5 A;  4HDU A;  2DBB A;  3TMO A;  1BJA A;  2KIM A;  3GZ6 A;  1TNT A;  2LD5 A;  4JX4 A;  4PGG A;  3OL4 A;  3DLA A;  3VYT B;  5BMZ A;  2XRO A;  2K4J A;  1A6Q A;  1BR1 A;  1W0U A;  2FNA A;  4U88 A;  5HDK A;  3VPR A;  2VC1 A;  5HLH A;  1I27 A;  3CCQ I;  2OUM A;  4WXC A;  4CCN A;  3G4S I;  2PJR B;  2W00 A;  2V6E A;  3HRS A;  2NS8 A;  3OYE A;  3CD6 I;  3ISP A;  5M3F J;  3OSG A;  2VC0 A;  2XSJ C;  4B44 A;  2R7T A;  4Y52 J;  2HDD A;  3WG9 A;  4ENN A;  3PL8 A;  3J80 Z;  4GGG A;  2QQA A;  2ZJR F;  2R7Q A;  5F04 A;  5D5W B;  4DBR A;  1ERD A;  2V6C A;  1O57 A;  1UEL B;  4UV9 A;  5F08 A;  1Z91 A;  2KZG A;  3I71 A;  1XS9 A;  2UWM A;  2CSO A;  3H5N A;  3V8J A;  2VL8 A;  2KDZ A;  2ESN A;  2A6E F;  1TWA J;  4XLF A;  5ILU A;  4N4N B;  5ILV A;  2WWY A;  1LUJ B;  1AWC A;  1Y0U A;  2N8G A;  3W2A A;  3PUF A;  1QVT A;  1STZ A;  1OR7 A;  4WF2 A;  4BE1 A;  5JLW A;  4N0B A;  2FD5 A;  4MTD A;  1LDK B;  2EJR A;  2R7X A;  2RV8 A;  3TGN A;  3VEP A;  4XKB A;  1V54 H;  1D5V A;  5L3D A;  2LY1 A;  3MVP A;  2ZCW A;  2TCT A;  1BR2 A;  3LSP A;  4IPA A;  5HLG A;  5KNL A;  3FX3 A;  4IHY A;  3RCO A;  1GDT A;  1BI2 A;  2PMZ N;  3FXK A;  1FP2 A;  4FAS D;  3JRF A;  3BJ6 A;  2VKH A;  4QWQ A;  1ZEL A;  1ZTR A;  1LB2 A;  1U5T B;  2R92 J;  4IOA F;  1ON2 A;  3B73 A;  2PLY A;  1QRY A;  3ELK A;  2BW3 B;  5DTD A;  2F2E A;  1XGO A;  4NBQ A;  5IT3 A;  1JTX A;  1B6A A;  1RRJ A;  2ZME C;  2MW8 A;  2K86 A;  4HDV A;  5EJC A;  1OPC A;  5J1U A;  3Q9S A;  3C2H A;  3CCR I;  4XRS G;  4BHB A;  2F48 A;  1P6R A;  2VJJ A;  4IVN A;  1Y8Q B;  3WTZ A;  1FYL A;  4KIT B;  2OQR A;  4XLA A;  2G7H A;  2PEX A;  2DDA A;  2PN6 A;  2LKP A;  4Z2Y A;  2WAQ N;  3OWT A;  5FJ8 J;  4HX4 A;  1LE8 B;  2FU4 A;  4XOR A;  1RNL A;  3M9A A;  2A69 F;  2LRD A;  1T2K A;  4C3I J;  2HR3 A;  1DGR M;  2PFB A;  2ZO4 A;  1NHA A;  2ISZ A;  3BWG A;  3JW4 A;  1I50 J;  5EEH A;  4OIR F;  3BJO A;  1QHG A;  4ABZ A;  1QBJ A;  1IRX A;  2FX0 A;  2OZ6 A;  1IXS B;  2QQ9 A;  5L3C A;  3E6D A;  2W48 A;  1YO5 C;  3HRM A;  2VBX A;  3J7Y J;  1FIP A;  5D8K B;  1IDZ A;  1D3Y A;  2NNN A;  4DZP A;  3QYF A;  3NRV A;  1W4M A;  4PJJ A;  5F27 A;  3FIW A;  4HNT A;  4EJT A;  2ZNY A;  2IRF G;  2VE8 A;  1TT5 B;  5HDN A;  5D4R A;  2L02 A;  3HBL A;  4G94 A;  4FCY A;  2CUJ A;  1P4A A;  2V9V A;  5H20 A;  1OCP A;  5HLT A;  2X6X A;  2XKO A;  5DV5 A;  3S15 J;  1R7J A;  4L18 B;  2B63 J;  3QQA A;  2LKS A;  2IAI A;  3EUK L;  3R4K A;  4A3B J;  5DM7 F;  2K02 A;  1FTT A;  5LEK A;  4KIC A;  4L0Y B;  2EH3 A;  1U5T A;  2FUG 2;  1OR7 C;  2JVG A;  2VOD A;  3BC8 A;  4OIQ F;  5HS8 A;  4UB6 C;  1WJF A;  5EYR A;  2HOS A;  1ETW A;  1L0O C;  1FOK A;  5ICF A;  3DTK A;  1HKQ A;  1QNT A;  2MFZ A;  3H9Q A;  2ZXJ A;  5FKO A;  3E6C C;  2ZNZ A;  3HRT A;  3VFZ A;  3WTX C;  2COB A;  2Z2S B;  3CJQ B;  3WOD F;  1OCC H;  4DJA A;  1MND A;  1MSF C;  1XX5 A;  2DFF A;  3FXQ A;  2W82 A;  3I0T A;  3I55 I;  2ME6 A;  2XGE A;  4BY7 J;  3ZMZ A;  1EKE A;  1OCZ H;  3L2V A;  1K4S A;  1LE8 A;  1GLN A;  3CUQ B;  2JJ7 A;  5E17 F;  2ZJP F;  2X51 A;  3JTH A;  3L2R A;  3LOC A;  5IT9 Z;  1T98 A;  4RMN A;  3I5U A;  4I99 C;  2RDP A;  1R36 A;  2QCO A;  4WWC A;  3CQZ J;  5LHI A;  1K78 B;  3DWL E;  2O3F A;  4BQO A;  3FIS A;  3LQR A;  2CQQ A;  3AG1 H;  2QZ8 A;  2R3S A;  4RB3 C;  1FTZ A;  1MMG A;  1ETQ A;  4UV8 A;  3HOZ J;  2G0E A;  2W85 A;  3GLX A;  1ZG5 A;  2LH9 A;  3V42 A;  4A3F J;  3SDB A;  1WGX A;  3BG7 A;  3WGH A;  1IAW A;  2ESH A;  4K2E A;  1BI3 A;  3EYI A;  3L1P A;  5K7H A;  1CF7 A;  1D1A A;  2XAS A;  4UVC A;  1KU9 A;  4ASN A;  4AC0 A;  3C2G A;  3PJR A;  3JSO A;  5L3G A;  2EZL A;  2RQQ A;  1KA8 A;  4S05 A;  1E0E A;  1XMK A;  2QVO A;  4ZH4 F;  1UZC A;  1SD5 A;  2HTJ A;  5LBQ A;  2BGC A;  4RM2 A;  3BR1 A;  2V7F A;  2EV5 A;  4JK1 X;  3RQ4 A;  1S5L C;  1IXR C;  3RPU D;  1YFH A;  4G12 A;  3AL0 C;  3I54 A;  3GBG A;  3Q0U A;  3G71 I;  1VND A;  2MH9 A;  3ESW B;  3FMS A;  3IWF A;  1SD6 A;  1JKO C;  4X0G A;  2ZSI B;  3HB9 A;  4HNU A;  4PSX A;  4MO7 A;  4R8H A;  4DBQ A;  3JSP A;  2D5V A;  4M6X A;  1YS7 A;  2MD0 A;  3FM3 A;  2K27 A;  4JQF A;  4JYK A;  1A36 A;  1HKT A;  3H92 A;  2BY2 A;  1RKW A;  2LY9 A;  4ZC3 A;  2L7K A;  1MJ9 A;  5M5X J;  1MDM A;  3U1K A;  5LRR A;  2XVC A;  4EV0 A;  3F9K A;  3KEQ A;  4ZYG A;  3KEY A;  1BOB A;  3M4O J;  1IV8 A;  1PJR A;  2X9D A;  4EMS A;  1B1B A;  5A2Q Z;  3Q9V A;  1OMI A;  2F5F A;  2HZD A;  2O0Y A;  2H94 A;  2HEO A;  2DPU A;  3MD2 A;  2CUE A;  4ITV A;  1K78 A;  3FXU A;  1ZK8 A;  3G73 A;  3S3M A;  2IS2 A;  4EJV A;  1MW7 A;  2J5O A;  4A2U A;  1OYW A;  4HQM A;  5HVQ C;  4ZTF A;  5FKN A;  3HTU A;  1X1C A;  1C0W A;  3DU5 A;  4Y4R A;  1D8J A;  2LNB A;  1LKX A;  1LEA A;  5DEQ A;  5GAE J;  2KRF A;  3CZ6 A;  2JZY A;  2K9S A;  2IW5 A;  5D5U B;  2KLO A;  5LLQ A;  4RS8 A;  1ETY A;  2CS3 A;  3GWZ A;  2B9S A;  2NRA C;  4ON0 A;  2L4A A;  2V79 A;  5CVV A;  2E71 A;  2L54 A;  5M5Y J;  2CU7 A;  2IVM A;  2WTE A;  3H3Z A;  3SHF A;  1Z9C A;  3CDL A;  1LDJ A;  3FMQ A;  3OYN A;  1ZKG A;  2KIF A;  3KPH A;  3QPL A;  4G9Y A;  3OS1 A;  3ERE D;  3U2R A;  2IA1 A;  1LPQ A;  1G3W A;  2X6W A;  2VLA A;  3OYM A;  4KIF A;  4U0V A;  2MH2 A;  3DTE A;  2EZH A;  1WJA A;  3HOX J;  4P1W A;  2X6Y A;  1HLV A;  4F91 B;  2GAU A;  4ZZD A;  2HQ5 A;  1T33 A;  3F23 A;  4QLC U;  3BTJ A;  1B8I A;  3EUH A;  2I10 A;  1HXD A;  4HZF A;  4Q48 A;  3AG2 H;  3K2Z A;  3FXJ A;  3O8H A;  2RN7 A;  1MBH A;  2M34 A;  2M7B A;  3TQN A;  1YI2 I;  2HQN A;  3BCA A;  4CH7 A;  2STW A;  3ZQC A;  2HPI A;  4PJ0 C;  1R4M B;  4PZJ A;  1MKM A;  2PJP A;  2Y0S N;  2MAB A;  5CLS A;  2ZKZ A;  5E8G A;  2Y9Z A;  4CYC B;  3ZMD A;  1SAU A;  4LLG F;  2XAJ A;  3ZQH A;  2F4M B;  2A3S A;  3CCL I;  3BPX A;  2P7C B;  5KAF C;  3T1B A;  3B02 A;  1ORK A;  3MAJ A;  4D1Q A;  1FY7 A;  2X6O A;  3HPG A;  2BXZ A;  3FM5 A;  1PUE E;  1FSH A;  4FE7 A;  4RA2 A;  1QQI A;  4BXU A;  2D45 A;  4IRG A;  1WJB A;  2Q2E B;  1Y39 A;  1R1T A;  2MYS A;  2XF7 A;  5H6R A;  2WAE A;  3GX4 X;  2IA0 A;  4Q47 A;  3S3N A;  4IF4 A;  1FYM A;  3S17 J;  4LGW A;  3W2V A;  4HLY A;  2IGM A;  2HKO A;  1OYY A;  5FRO A;  2KIU A;  1P2F A;  2DMT A;  2OBP A;  2VT2 A;  1E3H A;  3TBI A;  5J3L A;  3S14 J;  1JXS A;  2VIX A;  1LQ1 A;  2CYY A;  2VJI A;  3WHC A;  2DA5 A;  2FSW A;  5B1B H;  3AFH A;  2E1M C;  5DCM B;  2A05 A;  3ZGK A;  1ZRE A;  3ABM H;  2CW0 F;  4AID A;  4AIK A;  1F9N A;  3I59 B;  5GTH C;  3FXO A;  3L00 A;  1YE9 A;  3CUO A;  1Y1W J;  4ESF A;  2HI3 A;  4E70 A;  2LK2 A;  4CDG A;  3V7C A;  3TKY A;  4AVZ A;  1JGG A;  2EPF A;  1JKP C;  1VF9 A;  2QYO A;  4LLL A;  4XRF A;  2JUC A;  1P7J A;  3RIR A;  2YU9 J;  1ZHF A;  3HG9 A;  5KCM A;  4UVB A;  3BZC A;  1S9H A;  1O7F A;  3NQO A;  1YG2 A;  4I0A A;  4OIO F;  4V19 K;  4PSW A;  2EA4 A;  3E5U A;  2UUZ A;  5TGT A;  1VQ4 I;  1KQ9 A;  1JHF A;  3PNV A;  2DFE A;  1TQI A;  3WU2 C;  3BT9 A;  2J5P A;  1FBQ A;  3CC2 I;  4M6V A;  1N75 A;  1A04 A;  1YS6 A;  3R61 A;  3BR6 A;  3PUB A;  1UAA A;  1HCR A;  1D0Z A;  5CQE A;  3S2D J;  5FFX A;  2P5V A;  1IRG A;  2CUF A;  3BTL A;  1MBF A;  4A3E J;  1HW1 A;  5IYD J;  4GO1 A;  4L5I A;  2QA4 I;  2OTL I;  2VOP A;  1K7A A;  1ZR4 A;  2WC2 A;  2VKV A;  1DPU A;  2OTJ I;  5C44 J;  2QWW A;  5DCM A;  3BTC A;  1VQP I;  4G6T B;  1E2X A;  4G6D A;  4I0B A;  3BTI A;  3F6O A;  4UUS A;  3J80 K;  5M5W J;  3H9G A;  3H5A A;  1VZ0 A;  1WPK A;  1F4K A;  3HOV J;  2XDV A;  2EIM H;  4ZDO A;  5EG0 B;  4FT8 A;  5IP7 J;  2Y2Z A;  4BUP A;  1Z77 A;  4MHG A;  2XAF A;  1W5T A;  3FKI J;  2CO5 A;  4P9U A;  4HST A;  1KU7 A;  2O6G E;  2HU9 A;  5D5V B;  4B4C A;  1T6S A;  4AWX B;  3DBH B;  1DQU A;  2QEN A;  3GTL J;  2DMN A;  3J81 K;  1TWH J;  5TIS C;  1LDD A;  2P4W A;  3QPT A;  2GZW A;  4BU2 A;  2D1V A;  1BIB A;  1I3Q J;  3F8B A;  2R5Y B;  3O8G A;  2ZME B;  2WB1 N;  2ELK A;  3FBN B;  1FMW A;  2XF6 A;  2DO7 A;  3K1M A;  2CRG A;  4XL9 A;  2E2J J;  1KU2 A;  1OQY A;  2A68 F;  5TRD A;  4O5V A;  1P4X A;  2DFI A;  5FKK A;  1R5H A;  2FF4 A;  4EJO A;  3V7R A;  4XN3 A;  5AIP A;  1NG7 A;  1KQ8 A;  1WJC A;  2LMD A;  1AHD P;  2AO9 A;  1TTY A;  3PSI A;  1ZRD A;  1FSE A;  1WJE A;  3M8J A;  2FQ3 A;  3ZMU A;  3CCU I;  4BQQ A;  5JVT A;  3D5R C;  2DT5 A;  3KP4 A;  3BCB A;  3GTQ J;  2F6C A;  4HA8 A;  3M07 A;  5FLX Z;  3J7A Y;  4QTR A;  1I5Z A;  1W5S A;  5BQT A;  1EH7 A;  1Z1D A;  1GV2 A;  2FBI A;  2EFW A;  1ZGJ A;  2Z99 A;  3ERM A;  2XRL A;  4YEL A;  3RSN A;  2R7O A;  2LKX A;  4XNF A;  3JRA A;  2IA2 A;  1IGN A;  1GHC A;  1KYW A;  2ME0 A;  3BR0 A;  3OV8 A;  4IKF A;  2P5K A;  5KVR A;  2H1L A;  5J8C A;  3ZP5 A;  3EUA A;  3RKW A;  2QBY B;  4RB1 A;  4XQF A;  1QVU A;  2R4G A;  3SFZ A;  5BNG A;  2XHK A;  3TO6 A;  3D5L A;  2E7W A;  2VI6 A;  2DMQ A;  1FJL A;  4AD9 A;  1GUU A;  1YJN I;  2QSH X;  4YFN F;  3A4C A;  1ZGA A;  5JFR A;  5HS9 A;  2DFH A;  2WY7 Q;  3K0L A;  1DUX C;  5C4X J;  4M6Y A;  1Q1V A;  1U9O A;  2ZME A;  3ABT A;  1R5I D;  2IS6 A;  3PIO F;  4XBF A;  3KCC A;  2FMY A;  2EBI A;  4MQV A;  2E1N A;  1YOV B;  2M45 A;  4C9Y A;  4CCM A;  4R1H A;  3CJT B;  1IDY A;  3VDX A;  4E7Z A;  4KN7 X;  3LAP A;  3QOE A;  4I09 A;  3DQV C;  1WKM A;  4Q5S F;  2IGO A;  2WAF A;  1WRJ A;  5L3F A;  2NS0 A;  1J2X A;  1FBU A;  4FET A;  2B0L A;  1BBY A;  3ZCO A;  3WHB A;  2K85 A;  2AHQ A;  2BXY A;  4BL0 B;  3EQL F;  3DKW A;  2H09 A;  1R1U A;  3HGG A;  2LF7 A;  4L5E A;  4A3L J;  3N05 A;  3P7N A;  2BVM A;  1J9I A;  1R23 A;  3HTS B;  1D0Y A;  4HOB A;  1DU0 A;  3HPH A;  3KZI C;  4G6Q A;  4GXO A;  2JWT A;  1RR7 A;  3CLQ A;  2Z9O A;  2K3P A;  4F92 B;  3E1S A;  4A6E A;  2LDU A;  3EPZ A;  3UKG A;  3LNQ A;  4PFP A;  1APL C;  2KQR A;  1XD7 A;  3G3Z A;  3MKL A;  3KX2 A;  2GXA A;  2DTR A;  2QBY A;  3SJM A;  4O6J A;  4B1R A;  2KRC A;  1GVD A;  1O4X A;  5E3O A;  2UXN A;  4XKV A;  2AXL A;  2EFP A;  1W7P A;  2KPM A;  3O2P E;  1ETK A;  3LST A;  2HKX A;  5HNH A;  4KT6 A;  4B09 A;  1QU3 A;  3Q3S A;  3KEO A;  2O8K A;  2EZK A;  5GAH J;  1MMS A;  1BL0 A;  4G7Z F;  2NOJ B;  1PVE A;  1S7A A;  2DT7 B;  3DXJ F;  3QP5 A;  1Z21 A;  3T5X A;  3QAH A;  2HPM A;  4MLO A;  3BJA A;  4JBA A;  1ZH5 A;  3ABL H;  2D1H A;  3AKZ A;  3AL0 B;  3DFG A;  5JLX A;  4F93 B;  3IUO A;  3CP8 A;  3KET A;  4HBL A;  4BDY A;  2V1D A;  4DYC A;  3KFW X;  2VBW A;  5EZH A;  1TLH B;  1Y0N A;  2HNH A;  2KRH A;  1JI8 A;  1RZ4 A;  2XPV A;  3DKY A;  4HF0 A;  3SZG A;  5CVI A;  3ZOB A;  2DXI A;  3CMM A;  3MN2 A;  1IJW C;  4BXF A;  2VUM J;  3DLL F;  4L5J A;  2BY1 A;  4M73 A;  5E1W A;  1ZLK A;  4LIU A;  2K7L A;  2DYS H;  1SFU A;  4CCL A;  4HV6 A;  4G8X A;  4XLP F;  1Z7L A;  3S1Q J;  3ZMV A;  4ZDP A;  1SFO J;  3TO9 A;  3TOA A;  5F6F A;  4WK8 F;  2Q0O A;  5CQG A;  2VB6 A;  1XMX A;  3P9K A;  2E60 A;  3A0B C;  3ZPL A;  1LJ9 A;  4I7H A;  3ZMS A;  1S6L A;  3P5J A;  1ZRC A;  3M1C A;  4IQJ A;  5E1Z B;  4LLN A;  2E36 A;  2UXX A;  1R1V A;  2HQA A;  2Y75 A;  2IT0 A;  4A5N A;  2DQL A;  1WH5 A;  2VON A;  1ZAR A;  4HW0 A;  1G8X A;  3JAM K;  4ZDL A;  2COM A;  3KLN A;  1ZGW A;  1P7I A;  2EB7 A;  2IJL A;  2H8W A;  2VKE A;  5D5X B;  1A35 A;  3DF8 A;  4OOI A;  4IO9 F;  2QSG X;  1J7K A;  2VQC A;  1EJ9 A;  4UHT A;  1MBE A;  4CO8 A;  2DA1 A;  2CQ7 A;  3MQ0 A;  1SAX A;  3M3Y J;  5K5Q A;  3LSJ A;  4PFO A;  1P92 A;  1QHH D;  4IQ4 A;  2KJC A;  5C4J J;  3KZY A;  3UR3 C;  3H1C A;  2KMU A;  9ANT A;  3LA3 A;  2Y30 A;  1DU6 A;  4B8X A;  4IOC F;  1X1P A;  1T38 A;  1MBJ A;  2Q1Z B;  5IOY A;  2NVQ J;  1J59 A;  1FWZ A;  1ONV A;  1UJ8 A;  1X3W B;  2AQF A;  2LC2 A;  4C2T A;  2L2O A;  4HAM A;  4L9V A;  1N25 A;  2CFO A;  2P81 A;  5K7F A;  3GW2 A;  1CF7 B;  1JKQ C;  4XMY A;  4KMU X;  1YIJ I;  4OAZ A;  2HYF A;  4AYB A;  4GDF A;  3BP8 A;  1PP7 U;  2KZV A;  3ML6 A;  2M0C A;  3OIO A;  3VOE A;  1HDP A;  4CXF A;  4BKX A;  4CIC A;  4KYW A;  4WXH A;  3OOP A;  3OYJ A;  3CDH A;  3OS0 A;  4AM3 A;  2P8T A;  1RPW A;  5EDN A;  3A0H C;  2G9W A;  1FOX A;  1I1S A;  1TT0 A;  1IO2 A;  4BJ5 C;  1FEX A;  3PNY A;  3WGG A;  3DPU A;  3KIO A;  3HOS A;  1RUN A;  4PDK A;  2FBH A;  2HZT A;  5FD5 A;  4BY1 J;  2RQP A;  1CGP A;  2CH0 A;  2YX4 A;  3QOP A;  1UFM A;  5ICE A;  3C7J A;  1MDM B;  4LK0 F;  4YRV A;  2L3D A;  3B6A A;  1XG1 A;  1ZG3 A;  2BOL A;  1Z0X A;  5EZG A;  5LGT A;  1WH7 A;  3FBI B;  1AU7 A;  3PFI A;  2HVQ A;  3GVA A;  4HV5 A;  5E79 C;  1BN5 A;  3F21 A;  2XRN A;  4BNC A;  5H2F C;  3IAM 2;  4C3J J;  2QF7 A;  1QZY A;  2DN0 A;  2EZI A;  5K7Z A;  2DTZ A;  4IXA A;  1RR8 C;  4B47 A;  3WTV C;  4XLH A;  2IEK A;  3HM5 A;  4QPO A;  2HGC A;  2PMU A;  3HGY A;  5BS6 A;  2RKH A;  3PSF A;  1XTA A;  2PQ8 A;  2CUZ A;  3L7W A;  1V5E A;  1X3U A;  5KAI C;  1MJA A;  4XON A;  2KP6 A;  4M72 A;  3IKT A;  3S8P A;  2O9L A;  1SVL A;  1NK3 P;  3CMY A;  5IY5 H;  2CV2 A;  1IUY A;  5HLI A;  1JTY A;  4IRI A;  3PIP F;  1N77 A;  4GFB A;  3K1P A;  3HKZ A;  3V4G A;  4CZZ A;  3GZ5 A;  4PJL A;  2BY0 A;  1G2H A;  2R7R A;  3G1L A;  4NNJ A;  1VQM I;  3E5Q A;  4E6K G;  1G3S A;  2F4I A;  4C2M J;  3JRC A;  2XF5 A;  1U8B A;  3GZN B;  5B1A H;  4ZYD A;  4MQ9 F;  2WV1 A;  2XAU A;  3ABK H;  1VFC A;  5F0C A;  1YW8 A;  1F36 A;  3FK6 A;  3P9C A;  5TJJ A;  4NC7 A;  2DPD A;  1MGT A;  3CMA I;  1JHH A;  2M9H A;  4OMZ A;  3O6B B;  1MJB A;  1MNE A;  4BJ6 C;  1LVK A;  3HHH A;  4NQW A;  1ETO A;  4XOT A;  3E97 A;  3U21 A;  1B8I B;  3S2H J;  4HNV A;  4LFU A;  4E7L A;  4G7H F;  2L7F P;  1Z3X A;  3GTK J;  2E5Z A;  4FTH A;  2XB5 A;  4RGR A;  1H89 C;  2QUF A;  2F5V A;  2WBM A;  2ZFW A;  1O3Q A;  5FRM A;  2HOE A;  5E3M A;  4M74 A;  2MA3 A;  1BI0 A;  3NAR A;  4BBR J;  2XGD A;  1POG A;  1Z6T A;  4KMF A;  2R93 J;  1T95 A;  2D2W A;  1JT0 A;  3BQY A;  3E6M A;  3IRQ A;  3WTU C;  4IHX A;  2VQH A;  2M7A A;  2V1X A;  5DUK A;  3OYI A;  1TL8 A;  3OYA A;  4EVI A;  4U7D A;  1YLF A;  1X2M A;  2JRT A;  5F0F A;  1AOY A;  3CC4 I;  3HRU A;  1BC8 C;  3U1D A;  1B72 A;  3VYS B;  2Y69 H;  3BY6 A;  3KE2 A;  2V4J C;  3F8N A;  3KYL A;  2JN6 A;  4KIS A;  4ZYE A;  3HOW J;  2RAE A;  1OYI A;  2EIL H;  3DPT A;  5LHH A;  2NNY A;  1IN8 A;  1ZN2 A;  2EWN A;  2Z1D A;  3VYU B;  1IV6 A;  1HW5 A;  4C3H J;  1YQA A;  2DA6 A;  4BBS J;  1VQ6 I;  1F5T A;  2M2E A;  1I6H J;  1MNM C;  2JPB A;  3IP4 B;  3W6K B;  2MD5 A;  2MG4 A;  1KON A;  3DV8 A;  4OU0 A;  3CCS I;  1L3L A;  2QQ8 A;  1SEU A;  1A31 A;  1P9Q C;  1SMT A;  3OYK A;  1W7P D;  2M8G X;  3ZQQ A;  4OIN F;  3S1R J;  4U0W A;  2DA2 A;  1IXC A;  2PMH A;  2FML A;  4D9J A;  1JJ6 C;  2OCE A;  3TO7 A;  1Z67 A;  3GO5 A;  3UNG C;  1D1C A;  5J4Y A;  1U3E M;  4EQQ A;  2V1U A;  4A0X A;  2L4M A;  2FRH A;  3BZK A;  4XKC A;  2XSD C;  4Z6Y A;  2VPL A;  4XN0 A;  2XIG A;  1MMA A;  1JUM A;  4CSW A;  3LSR A;  4C2U A;  2CWE A;  1RKT A;  5JI6 A;  2MC4 A;  4A3I J;  5FB2 A;  3QPS A;  3GFJ A;  2DI3 A;  4YEJ A;  4EJU A;  3QP6 A;  3CF2 A;  1QA6 A;  1DP3 A;  2VOO A;  3LAJ A;  3OMY A;  5D6F A;  4ZZL A;  1K83 J;  3BRO A;  3K70 C;  1ETV A;  1E3P A;  2Q8K A;  3ULQ B;  4RB0 A;  1UB9 A;  4M9X A;  2YPR A;  3LA2 A;  1Y6I A;  1Z7U A;  1VQO I;  4Y3O A;  2Z33 A;  1ZRF A;  4F52 A;  3W6V A;  2E5N A;  3FWE A;  3DKX A;  2EFO A;  3KP3 A;  1SAN A;  3N4M A;  5GP9 A;  3OYF A;  5BPD A;  1YW9 A;  4B48 A;  3C1D A;  2BE5 F;  1WI9 A;  1EV7 A;  1UMQ A;  3ASO H;  4RAG A;  3ZQL A;  1JGS A;  1RET A;  1HDD C;  2GOX B;  1WJD A;  2O5R A;  2DK5 A;  2OF7 A;  3BDD A;  3I64 A;  4BHC A;  3WGI A;  1HW2 A;  4BXX J;  3CUQ C;  2CG4 A;  2P5L C;  2KL4 A;  2CFX A;  3HHG A;  5LGN A;  2PI0 A;  1J75 A;  1HQC A;  3ZR8 X;  2JMW A;  4M3B A;  3I58 A;  5LGU A;  5AIQ A;  3OOU A;  5EGO A;  3OIP A;  3HOY J;  2A5W A;  1KGS A;  2BBY A;  3HZJ A;  3C2B A;  4LJZ F;  4UUS B;  5FLX K;  4M3E A;  4KFC A;  3BG9 A;  3DEW A;  3HEF A;  3BG3 A;  3J7Z I;  5IYB J;  2KT0 A;  1IZ1 A;  3GFL A;  4BE2 A;  1Q1H A;  2BZT A;  4HSR A;  2GXB A;  4UXN A;  2VJ4 A;  2L9S A;  1V5F A;  4KJZ A;  4H0E A;  4I2O A;  3GCM A;  3TDU C;  3S1M J;  4WX9 A;  4E7J A;  4LMY A;  1UCR A;  3RYR A;  3JRI A;  3RTR A;  2HYJ A;  2R7Z J;  4E7K A;  1X1B A;  3I4M J;  3WU0 A;  5E8I A;  2IS4 A;  3VYR B;  5F1R A;  1SC7 A;  3BG5 A;  3K69 A;  4II3 A; 
#chains in the Genus database with same CATH homology
 2A5Y B;  4PGH A;  1ZLJ A;  3EET A;  4A0Y A;  2LF8 A;  2M1B A;  3CJN A;  1FYK A;  3GEZ A;  3RKX A;  4RAZ A;  5E18 F;  4LB6 B;  3IL2 A;  3E5X A;  4HYE A;  4FX0 A;  1O7L A;  4LB5 A;  5E1X A;  1MD0 A;  1G3Y A;  4KIG A;  4NB5 A;  1JE8 A;  2JSC A;  3HUG A;  4P9F A;  3MFK A;  1HKS A;  1O3R A;  1RIO H;  5CVJ A;  2RGV A;  4Y13 A;  2KKO A;  3K1N A;  1XSD A;  4KDP A;  5DYM A;  2H6B A;  3P9I A;  4LD5 A;  3VOD A;  3KP5 A;  4Y15 A;  1F1Z A;  3ZN0 A;  4MEX F;  2HS5 A;  3T0Y A;  4KUM A;  1WQ2 A;  3KP6 A;  2FNP A;  1XDS A;  4G7O F;  1UST A;  4IJA A;  4A5M A;  5LHG A;  2DAO A;  2GA2 A;  2VBZ A;  2DW4 A;  2L01 A;  5L3B A;  2VE9 A;  2JT1 A;  1XGM A;  5JHU A;  4CHU A;  2GQQ A;  3HSF A;  2NYX A;  4U0Y A;  4Y17 A;  4HX7 A;  2OAZ A;  2QM3 A;  1GVJ A;  1SFE A;  1YW7 A;  3I53 A;  4R79 A;  2PBI A;  4M9Z A;  1BIA A;  5CYV A;  1LVA A;  3IWZ A;  2Z3Y A;  2DK8 A;  4IRH A;  4EM1 A;  1XSX A;  4HLX A;  2KJB A;  1XMA A;  2Z5U A;  4RGX A;  2GXG A;  2XV4 S;  3S2W A;  4KNY A;  1W7P B;  4P5O A;  3EDP A;  1Z05 A;  1QO0 D;  1FLI A;  4BAY A;  3GF2 A;  2ELH A;  3IHU A;  2ISY A;  1ZYR F;  2YU3 A;  4LK1 F;  3CO6 C;  4EJW A;  2IPQ X;  3TOB A;  4I02 A;  5CJ9 A;  2FXA A;  3SZP A;  2O8X A;  3ROU A;  4ENM A;  1R22 A;  4YG2 F;  2ZBK A;  3RKY A;  3KZZ A;  4A0Z A;  2DQR A;  3ZQ7 A;  1FP1 D;  3FF5 A;  3MZY A;  3RYP A;  4P55 A;  5F64 A;  3CLO A;  4XSX F;  3WE2 A;  4ESB A;  2HWV A;  4RGS A;  4BHP A;  3D0S A;  4LG0 A;  2FE3 A;  1XCV A;  2ADU A;  2ETH A;  3J7A O;  3Q5F A;  1H9T A;  3TDZ C;  4OIP F;  4XSZ F;  4N9H A;  3REO A;  3QPH A;  1U78 A;  2VT3 A;  5IT9 K;  1IW7 F;  3R0J A;  2O61 A;  3L09 A;  5BPI A;  4ENK A;  3F3X A;  2MBF A;  4NHJ A;  3MZH A;  1K79 A;  1I1G A;  3ZN1 A;  1IN4 A;  3RDI A;  1IN7 A;  1REP C;  2XAQ A;  3LQQ A;  1S29 A;  1YYV A;  1J5Y A;  1SMY F;  4IHS A;  3J81 Z;  5EEG A;  3LA7 A;  4L9J A;  2YX7 A;  2Y0M A;  1T39 A;  2FOK A;  3PQJ A;  3QU6 A;  2OU2 A;  2F5C A;  4ETS A;  1O3S A;  3V7S A;  2OA4 A;  4UNO A;  1HST A;  2F5D A;  1FPQ A;  4A6D A;  4GYG A;  1XGS A;  4HX8 A;  4M71 A;  2ACJ A;  2BEO A;  2XGX A;  1KU3 A;  1XCB A;  4YFK F;  1J0R A;  1DPR A;  2W24 A;  5A2Q K;  3F8C A;  3MCZ A;  1R00 A;  1U2W A;  4ESJ A;  3MEX A;  4HF2 A;  4S04 A;  1XB4 A;  4O3M A;  1S8N A;  1V3F A;  3SZT A;  2K4B A;  2W84 A;  3GYH X;  3WE3 A;  1LNW A;  4EGY A;  4HQE A;  1KYZ A;  1QZZ A;  4D0P A;  3R60 A;  2STT A;  3R6S A;  5FO5 A;  5FD6 A;  5HS7 A;  3L2C A;  3RJP A;  1ULY A;  1PDN C;  1ZG1 A;  3E6B A;  4L9N A;  1G3T A;  3NEU A;  4IHT A;  5DCF A;  1WSU A;  2RC4 A;  1SD7 A;  2MLG A;  2YR2 A;  2H6C A;  5D6E A;  5LRS A;  2HDC A;  4EM0 B;  2X4H A;  1V4R A;  3IC7 A;  2A07 F;  4AVP A;  2MC3 A;  4RGU A;  1EH6 A;  4ENJ A;  2JTV A;  1XGN A;  1RI7 A;  1BI1 A;  2FA5 A;  2IP2 A;  1H0M A;  1MZB A;  2M30 A;  4P96 A;  5D8L B;  3FZV A;  1UHM A;  4FX4 A;  3WU1 B;  3F8M A;  5HDG A;  3LFK A;  1QPM A;  3H3U A;  4WXD A;  2A61 A;  5AON A;  1VTN C;  1IN5 A;  5DD4 A;  3V8L A;  4MEY F;  4BYY A;  3RPQ A;  2EV6 A;  2R7D A;  4MTE A;  2M8E A;  2P6T A;  5K5R A;  5D4S A;  5DDG A;  1U8R A;  1FBS A;  1USS A;  1FC3 A;  3WTS C;  1HBX G;  4U7B A;  1FX7 A;  2XAH A;  3GUD A;  3HOT A;  3KP7 A;  5ICG A;  1D8K A;  3JAM Z;  1U5T C;  3ECH A;  3CUQ A;  3I4P A;  1P4W A;  3GFM A;  4Q4Z F;  1ZAO A;  2H27 A;  3FXR A;  2E1C A;  1BOA A;  1XSV A;  2EV0 A;  2QQB A;  1RUO A;  4YIF A;  4KA4 A;  2GIV A;  3O3K A;  5DD8 A;  5ERI A;  2A6H F;  1S3J A;  2XKP A;  3HSE A;  1KQ0 A;  3COA C;  3C3W A;  2RNJ A;  3VB2 A;  4KN4 X;  4RB2 C;  4HF1 A;  2UZK A;  4F7Z A;  1HSJ A;  2TDX A;  3PQK A;  1FNN A;  3DPL C;  3T8R A;  4EGZ A;  1B59 A;  1WWX A;  1IRF A;  5CVR A;  3DP7 A;  1TNS A;  3QRF F;  4CYD A;  1SFX A;  1DDN A;  5HOO A;  5ILS A;  4RAY A;  5E20 A;  1BC7 C;  2R7F A;  4XLN F;  3BPV A;  3KP2 A;  4M9S A;  3WTW C;  2XUB A;  2BYV E;  2EK5 A;  1B9M A;  1IN6 A;  3RI4 A;  4AIH A;  5K1Y A;  2BV6 A;  2OZU A;  2P7V B;  3IRR A;  2QLZ A;  2VN2 A;  2NAZ A;  4I01 A;  3MWM A;  4N9I A;  3N97 A;  3F22 A;  2CGP A;  5FGM A;  3F6V A;  4I98 B;  5CVU A;  3QU3 A;  2HYG D;  2EFQ A;  2ZJ2 A;  4EM2 A;  5JR3 A;  2W57 A;  2DLL A;  2Y48 A;  4BQA A;  4WCG A;  1EH8 A;  5FFZ A;  3WTT C;  1PP8 F;  3F8F A;  4CGZ A;  3M7G A;  3DEU A;  2OD5 A;  3AAF A;  4MGR A;  4L0Z B;  3F72 A;  4DNC A;  2E7X A;  5LEJ A;  4A12 A;  1BM9 A;  2WV0 A;  1T0F A;  1TW3 A;  3WTY C;  1DP7 P;  3FMR A;  2VBY A;  1TQP A;  1Z6R A;  2FBK A;  3K9T A;  4ZYH A;  3V8K A;  1FZP B;  4GCV A;  3GXO A;  2HFH A;  3M8E A;  2Q2E A;  3HIF A;  3BZ6 A;  2XAG A;  2EFN A;  3SQN A;  2X0L A;  2G7U A;  2FEZ A;  2LSO A;  3W6J B;  3CO7 C;  1YTY A;  1ODD A;  3ABU A;  1S7O A;  4FHT A;  1QGP A;  2O03 A;  5DUI A;  4KT5 C;  1XDU A;  1O3T A;  4DQ2 A;  3I59 A;  4MNU A;  4YFX F;  1TQM A;  1TW2 A;  3T8T A;  1B4A A;  2P6S A;  3M1E A;  4YII A;  1G4D A;  3R0A A;  4UUV A;  5H6Q A;  1LEB A;  3LWF A;  4GYI A;  1H9G A;  4BH9 A;  3SXY A;  2EA2 A;  3HSR A;  3U9G A;  1TBX A;  1R58 A;  2PG4 A;  4TV7 A;  3ZMT A;  1GXP A;  3M8F A;  1ON1 A;  1OKR A;  2OQG A;  2HTS A;  5J6X A;  5ED4 A;  5J8F A;  2CQK A;  2GWR A;  3L9F A;  1FT9 A;  1K6O A;  2AS5 F;  1YIO A;  2M87 A;  4LG0 B;  5K5O A;  1B9N A;  5BOX A;  2RVC A;  3EYY A;  3E3V A;  1I6X A;  2YSR A;  1U6G A;  1SD4 A;  1XN7 A;  3FHZ A;  2GA1 A;  3CTA A;  4PCQ A;  1IF1 A;  2W25 A;  1E17 A;  5L3E A;  2HQR A;  2JPC A;  2C6Y A;  3JTG A;  4L9T A;  4UVA A;  3IKV A;  3KLO A;  4AIJ A;  2MLK A;  5KK1 A;  3BOQ A;  3C18 A;  1UHW A;  1G6N A;  4OMY A;  2M5W A;  3RPU A;  2VXZ A;  5ICC A;  2DU9 A;  3ECO A;  3HYI A;  1R5G A;  2F5E A;  6PAX A;  1GXQ A;  3GFI A;  4KIB A;  4HDU A;  2DBB A;  1BJA A;  2KIM A;  3GZ6 A;  1TNT A;  4PGG A;  5BMZ A;  2XRO A;  2K4J A;  2FNA A;  4U88 A;  5HDK A;  2VC1 A;  5HLH A;  1I27 A;  4WXC A;  3HRS A;  3ISP A;  2VC0 A;  3WG9 A;  4ENN A;  3J80 Z;  4GGG A;  2QQA A;  5D5W B;  2V6C A;  1O57 A;  4UV9 A;  1Z91 A;  3I71 A;  2UWM A;  2CSO A;  3V8J A;  2ESN A;  2A6E F;  5ILU A;  5ILV A;  2WWY A;  1AWC A;  1Y0U A;  1STZ A;  1OR7 A;  4WF2 A;  4N0B A;  4MTD A;  1LDK B;  2EJR A;  2RV8 A;  3TGN A;  3VEP A;  1D5V A;  5L3D A;  2ZCW A;  4IPA A;  5HLG A;  3FX3 A;  1BI2 A;  1FP2 A;  3BJ6 A;  4QWQ A;  1LB2 A;  1U5T B;  1ON2 A;  3B73 A;  2PLY A;  3ELK A;  2F2E A;  1XGO A;  5IT3 A;  1B6A A;  2K86 A;  4HDV A;  1OPC A;  3Q9S A;  4BHB A;  1P6R A;  4IVN A;  1FYL A;  3WTZ A;  2OQR A;  2G7H A;  2PEX A;  2PN6 A;  4Z2Y A;  2LKP A;  4HX4 A;  2FU4 A;  1RNL A;  3M9A A;  2A69 F;  1T2K A;  2HR3 A;  2PFB A;  2ZO4 A;  1NHA A;  2ISZ A;  3BWG A;  3JW4 A;  5EEH A;  4OIR F;  3BJO A;  1QBJ A;  5L3C A;  2OZ6 A;  1IXS B;  2QQ9 A;  3E6D A;  1YO5 C;  3HRM A;  2VBX A;  5D8K B;  1D3Y A;  2NNN A;  3NRV A;  1W4M A;  4EJT A;  2ZNY A;  2IRF G;  2VE8 A;  5HDN A;  5D4R A;  2L02 A;  4G94 A;  1P4A A;  2V9V A;  5H20 A;  2XKO A;  5DV5 A;  1R7J A;  4L18 B;  3R4K A;  2K02 A;  5LEK A;  4KIC A;  4L0Y B;  1U5T A;  2VOD A;  4OIQ F;  5HS8 A;  1L0O C;  1FOK A;  5ICF A;  1HKQ A;  1QNT A;  2ZXJ A;  3E6C C;  2ZNZ A;  3HRT A;  3VFZ A;  3WTX C;  3WOD F;  3FXQ A;  3I0T A;  3ZMZ A;  3CUQ B;  5E17 F;  3JTH A;  5IT9 Z;  1T98 A;  3I5U A;  2RDP A;  1R36 A;  4WWC A;  5LHI A;  1K78 B;  2O3F A;  3LQR A;  2QZ8 A;  2R3S A;  4RB3 C;  4UV8 A;  2W85 A;  3GLX A;  1ZG5 A;  3WGH A;  1IAW A;  2ESH A;  4K2E A;  1BI3 A;  3EYI A;  1CF7 A;  4UVC A;  2XAS A;  1KU9 A;  4ASN A;  3JSO A;  5L3G A;  1KA8 A;  4S05 A;  1XMK A;  2QVO A;  4ZH4 F;  5LBQ A;  1SD5 A;  2HTJ A;  2BGC A;  2EV5 A;  4JK1 X;  1IXR C;  1YFH A;  3I54 A;  2MH9 A;  3FMS A;  3IWF A;  1SD6 A;  4R8H A;  3JSP A;  4M6X A;  1YS7 A;  3FM3 A;  2K27 A;  4JQF A;  1HKT A;  3H92 A;  1MJ9 A;  1MDM A;  5LRR A;  2XVC A;  4EV0 A;  3KEQ A;  4ZYG A;  4EMS A;  1B1B A;  5A2Q Z;  3Q9V A;  1OMI A;  2F5F A;  2O0Y A;  2H94 A;  2HEO A;  2DPU A;  1K78 A;  3FXU A;  3G73 A;  4EJV A;  2J5O A;  4A2U A;  1OYW A;  4HQM A;  5HVQ C;  3HTU A;  1C0W A;  1D8J A;  2LNB A;  1LEA A;  5DEQ A;  2KRF A;  2JZY A;  2IW5 A;  5D5U B;  5LLQ A;  4RS8 A;  3GWZ A;  2NRA C;  4ON0 A;  2L4A A;  2V79 A;  5CVV A;  2L54 A;  2IVM A;  2WTE A;  3H3Z A;  3SHF A;  1Z9C A;  1LDJ A;  3FMQ A;  2KIF A;  4G9Y A;  3ERE D;  3U2R A;  2IA1 A;  1G3W A;  4KIF A;  4U0V A;  2MH2 A;  2GAU A;  4ZZD A;  3F23 A;  4QLC U;  3EUH A;  1HXD A;  4HZF A;  4Q48 A;  3K2Z A;  2RN7 A;  3TQN A;  2HQN A;  2STW A;  4PZJ A;  1MKM A;  2PJP A;  5CLS A;  2ZKZ A;  5E8G A;  3ZMD A;  4LLG F;  2XAJ A;  2A3S A;  2P7C B;  3BPX A;  3T1B A;  3B02 A;  3MAJ A;  1FY7 A;  3FM5 A;  1PUE E;  1FSH A;  1QQI A;  4BXU A;  2D45 A;  4IRG A;  1R1T A;  5H6R A;  3GX4 X;  2IA0 A;  4Q47 A;  4IF4 A;  1FYM A;  4LGW A;  4HLY A;  2HKO A;  1OYY A;  2KIU A;  1P2F A;  2OBP A;  2VT2 A;  1JXS A;  1LQ1 A;  2CYY A;  2FSW A;  5DCM B;  1ZRE A;  2CW0 F;  4AIK A;  1F9N A;  3I59 B;  3L00 A;  3CUO A;  4ESF A;  4E70 A;  4CDG A;  3V7C A;  3TKY A;  2QYO A;  4LLL A;  4XRF A;  3RIR A;  1ZHF A;  4UVB A;  1O7F A;  3NQO A;  1YG2 A;  4I0A A;  4OIO F;  2EA4 A;  3E5U A;  1KQ9 A;  1JHF A;  1TQI A;  2J5P A;  1FBQ A;  1A04 A;  1YS6 A;  3R61 A;  5FFX A;  2P5V A;  1IRG A;  1HW1 A;  4GO1 A;  4L5I A;  2VOP A;  1K7A A;  2WC2 A;  1DPU A;  2QWW A;  5DCM A;  1E2X A;  4G6D A;  4I0B A;  3F6O A;  3J80 K;  1F4K A;  4FT8 A;  4MHG A;  2XAF A;  1W5T A;  4P9U A;  2CO5 A;  1KU7 A;  2O6G E;  5D5V B;  1T6S A;  4AWX B;  2QEN A;  3J81 K;  1LDD A;  2P4W A;  3QPT A;  2GZW A;  2D1V A;  1BIB A;  3F8B A;  2ZME B;  2DO7 A;  3K1M A;  1KU2 A;  2A68 F;  5TRD A;  4O5V A;  1P4X A;  2DFI A;  1R5H A;  2FF4 A;  4EJO A;  3V7R A;  5AIP A;  1KQ8 A;  1TTY A;  1ZRD A;  1FSE A;  2FQ3 A;  3ZMU A;  5JVT A;  2DT5 A;  3KP4 A;  4HA8 A;  5FLX Z;  1I5Z A;  1W5S A;  5BQT A;  1EH7 A;  1Z1D A;  2FBI A;  2EFW A;  1ZGJ A;  2Z99 A;  1GHC A;  2IA2 A;  1KYW A;  3OV8 A;  5J8C A;  2P5K A;  3ZP5 A;  5KVR A;  2QBY B;  3RKW A;  4RB1 A;  3SFZ A;  2XHK A;  3TO6 A;  3D5L A;  2E7W A;  4AD9 A;  4YFN F;  1ZGA A;  5JFR A;  5HS9 A;  3K0L A;  1DUX C;  4M6Y A;  2ZME A;  3ABT A;  4XBF A;  3KCC A;  2FMY A;  4MQV A;  2E1N A;  2M45 A;  4R1H A;  4KN7 X;  3LAP A;  4I09 A;  3DQV C;  1WKM A;  4Q5S F;  1WRJ A;  5L3F A;  2NS0 A;  1J2X A;  1FBU A;  2B0L A;  1BBY A;  3EQL F;  3DKW A;  2H09 A;  1R1U A;  2LF7 A;  3P7N A;  1J9I A;  1R23 A;  3HTS B;  4HOB A;  4G6Q A;  4GXO A;  2Z9O A;  4A6E A;  2LDU A;  1XD7 A;  3G3Z A;  2DTR A;  2QBY A;  4O6J A;  2UXN A;  2AXL A;  2EFP A;  1W7P A;  3O2P E;  3LST A;  2HKX A;  4B09 A;  3KEO A;  4G7Z F;  1S7A A;  3DXJ F;  3QP5 A;  3T5X A;  3QAH A;  3BJA A;  4JBA A;  1ZH5 A;  2D1H A;  3DFG A;  3KET A;  4HBL A;  2V1D A;  3KFW X;  2VBW A;  1TLH B;  1RZ4 A;  4HF0 A;  5CVI A;  4L5J A;  4M73 A;  5E1W A;  1ZLK A;  2K7L A;  1SFU A;  4HV6 A;  4G8X A;  4XLP F;  3ZMV A;  3TO9 A;  3TOA A;  5F6F A;  4WK8 F;  2Q0O A;  3P9K A;  3ZPL A;  1LJ9 A;  4I7H A;  3ZMS A;  1S6L A;  1ZRC A;  5E1Z B;  4LLN A;  2UXX A;  1R1V A;  2Y75 A;  2IT0 A;  4A5N A;  2DQL A;  2VON A;  1ZAR A;  4HW0 A;  3JAM K;  2COM A;  3KLN A;  2EB7 A;  2IJL A;  5D5X B;  3DF8 A;  4OOI A;  1J7K A;  4UHT A;  4CO8 A;  3MQ0 A;  1SAX A;  5K5Q A;  1P92 A;  2KJC A;  3KZY A;  3LA3 A;  4B8X A;  1T38 A;  1J59 A;  1FWZ A;  1ONV A;  4HAM A;  4L9V A;  1CF7 B;  3GW2 A;  4KMU X;  2HYF A;  3BP8 A;  1PP7 U;  3ML6 A;  3VOE A;  4CXF A;  4CIC A;  4KYW A;  4WXH A;  3OOP A;  3CDH A;  2P8T A;  2G9W A;  1I1S A;  3WGG A;  3HOS A;  1RUN A;  4PDK A;  2FBH A;  2HZT A;  5FD5 A;  2RQP A;  1CGP A;  2YX4 A;  3QOP A;  1UFM A;  5ICE A;  3C7J A;  1MDM B;  4LK0 F;  2L3D A;  1ZG3 A;  5LGT A;  3PFI A;  3GVA A;  4HV5 A;  1BN5 A;  3F21 A;  2XRN A;  4BNC A;  1QZY A;  4IXA A;  3WTV C;  2HGC A;  2PMU A;  5BS6 A;  2RKH A;  2PQ8 A;  3L7W A;  1X3U A;  1MJA A;  4M72 A;  3IKT A;  1IUY A;  5HLI A;  4IRI A;  3K1P A;  4CZZ A;  3V4G A;  3GZ5 A;  3E5Q A;  1G3S A;  4ZYD A;  4MQ9 F;  1YW8 A;  3P9C A;  5TJJ A;  2DPD A;  1MGT A;  1JHH A;  4OMZ A;  3O6B B;  1MJB A;  3HHH A;  4NQW A;  3E97 A;  4LFU A;  4G7H F;  4RGR A;  2QUF A;  2ZFW A;  1O3Q A;  2HOE A;  4M74 A;  2MA3 A;  1BI0 A;  1Z6T A;  4KMF A;  2D2W A;  3E6M A;  3IRQ A;  3WTU C;  5DUK A;  2V1X A;  4EVI A;  4U7D A;  1YLF A;  2JRT A;  1AOY A;  3HRU A;  1BC8 C;  3U1D A;  3BY6 A;  3KE2 A;  3F8N A;  4ZYE A;  1OYI A;  3DPT A;  5LHH A;  2NNY A;  1IN8 A;  1ZN2 A;  2EWN A;  1HW5 A;  1YQA A;  1F5T A;  2JPB A;  3W6K B;  2MD5 A;  3DV8 A;  4OU0 A;  1L3L A;  1SMT A;  1W7P D;  4OIN F;  4U0W A;  1IXC A;  2PMH A;  2FML A;  3TO7 A;  3GO5 A;  1U3E M;  4EQQ A;  2V1U A;  4A0X A;  2L4M A;  2FRH A;  2XIG A;  2CWE A;  5JI6 A;  5FB2 A;  3GFJ A;  2DI3 A;  4EJU A;  3QP6 A;  2VOO A;  3LAJ A;  5D6F A;  4ZZL A;  3BRO A;  2Q8K A;  3ULQ B;  4RB0 A;  1UB9 A;  4M9X A;  2YPR A;  3LA2 A;  1Z7U A;  2Z33 A;  1ZRF A;  3FWE A;  2EFO A;  3KP3 A;  3N4M A;  5BPD A;  1YW9 A;  2BE5 F;  3C1D A;  1WI9 A;  1EV7 A;  1JGS A;  3BDD A;  3I64 A;  2DK5 A;  4BHC A;  1HW2 A;  3WGI A;  3CUQ C;  2CG4 A;  2P5L C;  3HHG A;  2CFX A;  5LGN A;  2PI0 A;  1J75 A;  1HQC A;  3I58 A;  5LGU A;  5AIQ A;  1KGS A;  2BBY A;  4LJZ F;  5FLX K;  4KFC A;  1IZ1 A;  3GFL A;  1Q1H A;  2GXB A;  4UXN A;  4H0E A;  4I2O A;  3TDU C;  4WX9 A;  4LMY A;  1UCR A;  3RYR A;  3RTR A;  3WU0 A;  5E8I A;  5F1R A;  3K69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...