3ZQ7A

The structure of dna-binding domain of response regulator from escherichia coli k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function Studies of DNA Binding Domain of Response Regulator Kdpe Reveals Equal Affinity Interactions at DNA Half-Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN KDPE
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zq7A00
1XDUA 4EM0B 4AIJA 2L01A 1O7LA 1NHAA 4HOBA 1G3WA 1ZG5A 5CYVA 4IJAA 2P7CB 1IN5A 5F64A 2HFHA 2PEXA 1TNSA 4HYEA 3U1DA 1Z9CA 1BOAA 3ZMSA 3RIRA 4IXAA 4A5MA 5CLSA 2WTEA 2Z9OA 2LNBA 2RC4A 3GFMA 4QLCU 1YO5C 2EJRA 1TLHB 4GO1A 4M74A 3WODF 2QQBA 5L3EA 1T2KA 3ZQ7A 4ENKA 3I54A 1U5TA 1IRFA 2YSRA 2ZXJA 1QZYA 4Q47A 2V1DA 3CO6C 1Z1DA 3V8LA 2RQPA 2K27A 1BJAA 1XGNA 1F1ZA 4BQAA 3IL2A 3GFIA 3O3KA 4RGUA 1TW2A 1FSHA 4I7HA 5ILSA 3HSFA 2RV8A 2K02A 3ZMDA 5HOOA 1FBUA 3KZYA 2LKPA 3F23A 1V3FA 4P96A 1U78A 4ZYGA 2A6HF 2EB7A 5J8CA 1L0OC 2G7UA 1K78A 1CF7A 3I59A 4BXUA 2ZMEA 1ZGJA 4ENJA 4I01A 3VFZA 4XLNF 2V9VA 3F8MA 5FLXZ 3M1EA 4LLLA 4MHGA 1PP8F 1FYMA 1P4WA 3ROUA 3TO9A 1B59A 1R5HA 1E17A 3VOEA 3COAC 1IF1A 3BDDA 3TDZC 4RB1A 3ML6A 4HZFA 3KP6A 5DCMA 1D5VA 2GIVA 1RUNA 2XRNA 4Y17A 1BI1A 1FC3A 4BHBA 1GHCA 2M45A 3GUDA 4G7ZF 3F6OA 1IZ1A 1QZZA 1U2WA 1AWCA 2ISYA 1XSDA 1XCVA 2WWYA 1B9NA 2OQRA 4LD5A 1C0WA 4LB5A 2TDXA 3SXYA 3QPTA 3N97A 3FWEA 4A0XA 1ON2A 5HDKA 5LHIA 1KU3A 1LDKB 2UXNA 3IKTA 4KIGA 1FYKA 3WGHA 1FP2A 2QENA 1OYIA 4MQ9F 3F8CA 4OINF 4XSZF 4P55A 1ZLKA 1O3QA 2W84A 3KZZA 3KLNA 5BQTA 1H9TA 3ELKA 2Q2EA 2QUFA 3P9CA 4A12A 2HGCA 3F8BA 5E20A 2P8TA 1DP7P 1HXDA 3S2WA 4KIFA 5D4SA 4A5NA 4ON0A 4U0WA 5JHUA 2DAOA 1R1VA 3TQNA 1B1BA 4QWQA 2W25A 3K1MA 3NRVA 4WCGA 1I5ZA 4OOIA 3IKVA 3T0YA 4IRGA 4HAMA 1HSTA 3LA2A 2R3SA 2GWRA 2V6CA 2PQ8A 5CVUA 5DCMB 3HYIA 2UWMA 4O5VA 1K7AA 5DYMA 3HSEA 2A61A 4PGGA 5IT9K 1H0MA 4A0YA 1Z05A 3DPLC 3LWFA 1S7AA 3GVAA 4DNCA 2P6TA 4ESFA 1R22A 4FHTA 1HKSA 2JTVA 4KNYA 2QYOA 5D8KB 1J75A 3FZVA 5EEGA 4IHSA 1XN7A 1SMTA 2PBIA 3WTTC 1ZLJA 1IAWA 5LHGA 3JAMZ 3ISPA 1FZPB 4PZJA 3FM5A 5ICGA 2Y75A 3L2CA 1W5TA 4EJWA 1OMIA 1G3TA 3V4GA 3WTYC 2NRAC 2HWVA 3BPVA 2XVCA 4LFUA 2DW4A 4IRIA 1OKRA 4ZYEA 1IXCA 2A6EF 1FNNA 1TQMA 1ZHFA 2STTA 1XGSA 5E1WA 4HF1A 5AONA 2IT0A 3DQVC 5JFRA 5BPIA 1QBJA 1OYWA 3HOTA 2Z3YA 2O6GE 2IA0A 3QRFF 4TV7A 4AWXB 2O3FA 1G4DA 2VBXA 5FFXA 3REOA 2G9WA 4WXDA 4O3MA 5E17F 2AS5F 1LB2A 1G6NA 2WC2A 2YPRA 4N9HA 5A2QZ 3H3UA 1SMYF 3M8EA 2P5LC 1ZG1A 5E8GA 2O8XA 1FP1D 1WWXA 1ZGAA 2VE9A 3RTRA 2DO7A 1O57A 4G9YA 3HRTA 2DK5A 5CVRA 4EJTA 1FYLA 1LQ1A 2ESHA 2Y0MA 2M8EA 1MDMA 1BBYA 3C3WA 1BI0A 2NAZA 4XRFA 4HA8A 1D8KA 5LGNA 3ZP5A 1IUYA 1UCRA 3QOPA 3J81K 2BE5F 3E97A 1GXPA 3V8JA 3HOSA 1WRJA 2XAGA 3MAJA 2VODA 2XIGA 1O7FA 4B09A 2EV0A 4XLPF 1MGTA 4IRHA 5JR3A 1KYWA 3TKYA 1OPCA 3BJAA 5ICEA 4MTEA 5K5RA 2YX7A 1U6GA 4XSXF 4GYIA 1YFHA 3FXRA 4OU0A 2VT3A 4AVPA 3TGNA 2Q0OA 4Z2YA 2FXAA 2KIMA 2NYXA 4G94A 4ESBA 1S6LA 1IN8A 1G3SA 1KA8A 4M9SA 1QQIA 3HTSB 2QWWA 2QBYA 2ZJ2A 3OV8A 5J8FA 2Y48A 2EFWA 3KP7A 3RKWA 4H0EA 1RNLA 3KP3A 1ONVA 5ICFA 2E1CA 1IXRC 3U9GA 4CGZA 4WXHA 3P9IA 1K6OA 2CO5A 2CQKA 2PJPA 1J7KA 5HDGA 2QLZA 2ACJA 3JSPA 5DUIA 2NNNA 3RYRA 4M72A 2OD5A 2HKXA 3WE2A 1P4AA 2ZO4A 4WX9A 3M8FA 1TW3A 4RS8A 2K4BA 2DQLA 1I6XA 2ZNYA 1RI7A 4M9XA 3V7CA 5HLHA 2MH2A 3I58A 2ZCWA 3T8RA 1BI3A 2GA2A 2L3DA 1ZRFA 2XAQA 3GF2A 1FLIA 2BV6A 3SQNA 5D6EA 1B6AA 4P9UA 3KP2A 2EFNA 4KA4A 2P4WA 4I2OA 3ZPLA 1Z91A 4WXCA 3DKWA 1YS7A 4BHPA 4ASNA 1SD6A 5DV5A 2E7XA 4RGSA 4WF2A 5IT3A 4Q48A 3MQ0A 1HBXG 2MC3A 4KICA 2MLKA 1ZRDA 1T38A 3FXQA 4RB0A 1UFMA 3K1PA 1WI9A 1MD0A 2HEOA 1FBSA 5KK1A 1LDJA 5HLGA 4AIHA 3K0LA 3MZHA 2HOEA 4Y15A 3WU0A 4Y13A 3TOBA 4FX4A 2BBYA 3ULQB 3Q5FA 2DT5A 4EMSA 1K79A 2QZ8A 2RDPA 3CTAA 2MA3A 5HS8A 1B4AA 2M30A 3FF5A 5E1XA 1UB9A 3WTWC 2XGXA 2IA2A 4LB6B 2FNPA 2JT1A 1XSXA 4PDKA 3DPTA 5H6QA 2P5VA 3U2RA 2ZFWA 1JHFA 4L9TA 2VONA 2A3SA 1YYVA 5FFZA 3F72A 2VXZA 1Q1HA 3R4KA 2PI0A 5HVQC 4NB5A 4E70A 1TNTA 2HZTA 5FD6A 2O0YA 2XAFA 4MEYF 2L54A 1FBQA 5LEKA 2F5CA 2GAUA 3I4PA 2EV6A 4K2EA 1EH8A 1A04A 3GXOA 4KFCA 3E6BA 5DD4A 1R23A 4Q4ZF 4BAYA 1FPQA 1BI2A 1FT9A 5D4RA 1UHMA 2IVMA 3WGGA 1D8JA 4KUMA 4UVBA 5EEHA 3WTXC 3EQLF 2XAJA 4B8XA 1SD7A 5A2QK 2E1NA 4YIFA 5LGTA 1IN7A 2DI3A 4LK0F 4UXNA 2PN6A 5LRSA 4UNOA 4YFXF 3I5UA 3T1BA 1QO0D 1U5TC 4EJOA 2BYVE 2LF8A 4HV6A 2VT2A 1UHWA 2W85A 5CVIA 1SD4A 1S8NA 2EFQA 4UV8A 2YX4A 3EYYA 3SZPA 2FF4A 4EQQA 2GXBA 1EV7A 4U88A 3FM3A 1R00A 2L4AA 1VTNC 1SAXA 4OIQF 5D6FA 1KU9A 2D1HA 2VOOA 1K78B 5ERIA 3HUGA 5D5VB 2EA4A 3ZN0A 3HTUA 2CWEA 4KT5C 1Z7UA 1G3YA 3JTGA 3SZTA 3JW4A 2DU9A 4ZZDA 2DFIA 1T0FA 2NS0A 3IRRA 3QU6A 3JAMK 3IRQA 1QNTA 3LA7A 1JXSA 2F5DA 4ZYHA 5AIPA 2PMHA 4L5JA 4BYYA 3IC7A 4IF4A 4IVNA 2DPUA 3D5LA 1LJ9A 2RNJA 4ESJA 3C1DA 2CW0F 1V4RA 4BH9A 2OAZA 4EV0A 1U5TB 4FT8A 4MGRA 4I98B 4M6YA 2H27A 5BPDA 2HQRA 3QU3A 1DDNA 4L9NA 1LVAA 3CUQC 4MEXF 3KCCA 2K7LA 4CDGA 2D1VA 3E6CC 2IJLA 1F9NA 5LBQA 1EH7A 2K4JA 3RI4A 3C18A 4HQMA 2JSCA 2RN7A 3L09A 2FMYA 2KIUA 1MDMB 1J59A 5IT9Z 1ZREA 3F3XA 4KDPA 4HLYA 1P2FA 3CLOA 3KFWX 1PP7U 4LMYA 5CVVA 1OYYA 1Y0UA 3WTZA 5D5UB 2HTJA 5LGUA 1SD5A 1I27A 3ECOA 1DPRA 2P6SA 3RPQA 2A5YB 4RAZA 3DV8A 5L3DA 1IN6A 2QBYB 2F5FA 2OU2A 3RKXA 4I0BA 2J5OA 1W4MA 1ZAOA 1YQAA 3FX3A 4EM2A 1QGPA 5LHHA 2CG4A 2ZMEB 3FMSA 3BY6A 1HW1A 2VC0A 1CF7B 3H3ZA 2KIFA 4AD9A 2FBKA 3DFGA 3RDIA 4KYWA 2OZUA 3J80Z 2HDCA 4EVIA 3GZ5A 2VC1A 2OBPA 3Q9SA 2D45A 1XB4A 1IN4A 3CUQA 4HLXA 5ICCA 1MJBA 1WQ2A 3W6JB 1KYZA 2K86A 2FOKA 3CO7C 1HKTA 4OMYA 4A0ZA 5E8IA 3LAPA 5ILUA 3ABTA 2HTSA 5ILVA 5TJJA 5F1RA 1O3SA 1U3EM 1XMAA 1R36A 2JRTA 3BWGA 3QPHA 2FEZA 2FE3A 1CGPA 1TTYA 4M9ZA 5L3CA 2HYGD 3F8NA 1SFUA 1I1GA 2DTRA 2F5EA 1O3TA 2VBYA 4KN7X 2X0LA 4I09A 2KJBA 1LNWA 3K1NA 2XUBA 3F21A 2H6CA 3R0AA 3KEQA 1YG2A 4JQFA 2YR2A 3LQQA 1KQ9A 2O03A 3W6KB 4EJUA 2FQ3A 4MQVA 2DLLA 5E1ZB 4OIRF 3WE3A 3CUOA 1GXQA 1IW7F 2L02A 4YG2F 2XKOA 3T5XA 4U7BA 3GFJA 4A6DA 2EV5A 3J80K 4G7OF 4WWCA 4UVCA 3WTVC 1XGOA 2GQQA 3L7WA 3RYPA 1HKQA 4EJVA 1KQ8A 1IXSB 2ADUA 4N0BA 5DD8A 2BGCA 1I1SA 3ZMZA 1XSVA 3SHFA 4RAYA 4LG0B 2D2WA 2VBWA 2W24A 3R60A 5AIQA 1TBXA 2PMUA 4HX4A 3P9KA 1T6SA 3WTSC 2BEOA 2M5WA 2DPDA 3EDPA 4IHTA 2ESNA 4KN4X 3G73A 1F5TA 2VBZA 3I64A 3LFKA 3I53A 2IPQX 3ZMVA 4GGGA 1ZRCA 3FHZA 3ZMTA 1XCBA 5HS7A 4HBLA 1KU7A 3E3VA 4ZH4F 2DBBA 3QP6A 5H6RA 4L0ZB 3V8KA 1XMKA 4YIIA 4M73A 4GCVA 2ISZA 5BS6A 2XHKA 2JPCA 4OMZA 5CJ9A 4YFNF 3AAFA 6PAXA 3TOAA 3GX4X 2VE8A 1Z6RA 3JSOA 4JBAA 2L4MA 1AOYA 4PGHA 2MLGA 1JE8A 5D5WB 1Z6TA 4BHCA 2AXLA 4G6DA 3O6BB 3HSRA 3RKYA 1S7OA 3MWMA 1B9MA 4P5OA 3HHHA 4UUVA 4IPAA 4KMUX 5HDNA 5L3BA 2Z5UA 1XD7A 3I71A 4CICA 2HYFA 2CGPA 5LEJA 2MH9A 2EFOA 2A68F 5DEQA 4A2UA 1RIOH 4LLGF 2H09A 3BROA 2IW5A 3ERED 3B73A 3NEUA 4DQ2A 1R5GA 3KE2A 1PDNC 5LLQA 1MKMA 2RGVA 3MCZA 4AIKA 2EWNA 1MJ9A 3E6DA 2FSWA 5HLIA 2ZKZA 4LGWA 3R61A 4U7DA 1MZBA 2DQRA 5JVTA 3KP5A 1T98A 1YIOA 4S05A 2COMA 3R0JA 3IWZA 1ON1A 3BP8A 2KKOA 2W57A 5K5OA 2CYYA 5BOXA 4L0YB 3CJNA 5J6XA 4HW0A 1OR7A 2ZBKA 2C6YA 2FMLA 2GXGA 2V1XA 1FSEA 4GXOA 3FMRA 5ED4A 4I02A 2Z99A 2F2EA 1HSJA 4R8HA 3RPUA 4LLNA 2M87A 3N4MA 3FMQA 4OIPF 3ZN1A 2NNYA 2ETHA 3WG9A 1J0RA 1L3LA 1KU2A 1WKMA 5FD5A 1W5SA 3MZYA 4P9FA 3O2PE 3D0SA 4HX7A 3EYIA 1YW8A 2R7DA 4RGRA 2V1UA 4KIBA 4EGZA 1BIBA 1FY7A 1YS6A 5FB2A 1IRGA 4OIOF 4BNCA 4CXFA 1W7PD 5F6FA 4EGYA 2PFBA 4HF2A 2UXXA 3VB2A 3F8FA 2G7HA 2R7FA 4RGXA 3DF8A 3KP4A 4HX8A 1RUOA 4KMFA 2Z33A 2EA2A 1DUXC 2KJCA 1ZG3A 1ZN2A 4MTDA 1X3UA 3DEUA 2FA5A 2QVOA 3GW2A 2FU4A 2ELHA 5L3FA 1BC8C 2J5PA 2KRFA 2WV0A 3IHUA 3PQKA 4JK1X 2Q8KA 1R58A 4HQEA 3HHGA 3L9FA 3ABUA 2XV4S 3EUHA 5HS9A 1F4KA 4HF0A 4D0PA 5E18F 3GFLA 3T8TA 3F22A 2XKPA 3MEXA 3LSTA 3G3ZA 3OOPA 2PLYA 1S29A 1XGMA 2HR3A 2OQGA 3M9AA 3V7SA 5H20A 4CHUA 3PFIA 1LEBA 4ENNA 5JI6A 4LK1F 4CO8A 4O6JA 5D8LB 1BM9A 2VOPA 1QPMA 5FGMA 1T39A 4MNUA 1JGSA 4S04A 2X4HA 1PUEE 2JPBA 3BPXA 4U0VA 4L18B 3GYHX 4EM1A 3E5UA 4ZZLA 3DXJF 4PCQA 1FOKA 5CVJA 1TQIA 4GYGA 1HQCA 2A07F 5FO5A 5DDGA 5LRRA 3E5XA 4UHTA 2E7WA 1HW5A 1ZH5A 2QQ9A 2B0LA 2XASA 1TQPA 2EFPA 2H6BA 4U0YA 1J5YA 1J2XA 1R1TA 2FBIA 3ECHA 2P5KA 2RKHA 4LG0A 2YU3A 5DCFA 2GZWA 4R1HA 2FBHA 3JTHA 4HDUA 3E6MA 3WGIA 2OA4A 3KLOA 4UV9A 1GVJA 2VN2A 3CDHA 4LJZF 1FX7A 2LF7A 2FRHA 2MBFA 4M71A 2IRFG 1KGSA 2CSOA 1ZARA 3FXUA 4WK8F 2ZNZA 2IP2A 4G7HF 1REPC 4G6QA 3J7AO 3HRMA 4NQWA 4I0AA 3TO7A 2QQAA 5FLXK 3C7JA 4ZYDA 2OZ6A 3M7GA 3QAHA 1J9IA 3I0TA 3SFZA 1H9GA 2PG4A 1FWZA 3BJOA 2M1BA 3TO6A 1ULYA 1BIAA 3WU1B 5BMZA 2V79A 2P7VB 1BN5A 4F7ZA 4ETSA 4CZZA 3R6SA 1USSA 4HV5A 3K9TA 3VEPA 2MD5A 1SFEA 3QP5A 1WSUA 4UVAA 1YTYA 1SFXA 4N9IA 5TRDA 3I59B 2STWA 3GO5A 4A6EA 1O3RA 1W7PA 4FX0A 5KVRA 1P92A 3BJ6A 3RJPA 3K69A 2HS5A 2A69F 4L9JA 1YW9A 1ODDA 3DP7A 3TDUC 3GLXA 3CUQB 2XAHA 1DPUA 3B02A 5DUKA 3LA3A 2UZKA 3LQRA 1LEAA 3HIFA 2IA1A 3HRSA 4L9VA 2EK5A 3NQOA 2QM3A 3KEOA 3F6VA 1YLFA 3ZMUA 4CYDA 3WTUC 2LSOA 3IWFA 3P7NA 2DK8A 1E2XA 4R79A 3MFKA 3GEZA 3L00A 1JHHA 2GA1A 4L5IA 3HRUA 4M6XA 2RVCA 4YFKF 4Q5SF 1S3JA 1R1UA 3GZ6A 2LDUA 1MJAA 2HKOA 1P6RA 1EH6A 2FNAA 3BOQA 1XDSA 4RB3C 1LDDA 1STZA 2JZYA 3VODA 5K1YA 3K2ZA 3V7RA 3E5QA 3KETA 1RZ4A 4G8XA 1YW7A 5L3GA 1USTA 1KQ0A 1D3YA 1W7PB 4RB2C 2O61A 4HDVA 5D5XB 3LAJA 1R7JA 3J81Z 3PQJA 3GWZA 3BZ6A 2HQNA 1BC7C 2CFXA 3H92A 1P4XA 5K5QA 1ZYRF 3Q9VA 4ENMA 2H94A 2XROA 1HW2A 1U8RA 4NHJA 3EETA 4XBFA
chains in the Genus database with same CATH superfamily
1XDUA 4EM0B 4AIJA 2L01A 3DLAA 1O7LA 2NOJB 1DGRM 1NHAA 1IUFA 3D1NI 3IH2A 4HOBA 1G3WA 2YUSA 1ZG5A 5CYVA 3E1SA 4IJAA 1V5FA 2M7AA 2P7CB 1IN5A 5F64A 1IDZA 4F91B 2V1NA 2HFHA 2PEXA 2HNHA 1TNSA 4AIDA 3AL0C 4HYEA 3U1DA 1Z9CA 2WAFA 1BOAA 3ESWB 3PNTA 3QPLA 5EG0A 3ZMSA 3S2HJ 4M3GA 3RIRA 4IXAA 2CV1A 3HDDA 2EIJH 3CCQI 4A5MA 3MKWB 3MKLA 2WTEA 2KP6A 2EINH 5CLSA 4J00A 2Z9OA 2LNBA 3U1KA 3HB9A 2RC4A 1AA7A 1K6YA 1UHSA 2OCCH 3GFMA 4QLCU 2HYJA 4YEJA 3I55I 4RAGA 2R7UA 3BTCA 1YO5C 4M3EA 2F5VA 2EJRA 1TLHB 2Y0SN 3IAS2 4GO1A 2RQQA 4M74A 1VQKI 1ZK8A 2VXDA 1X1DA 4W97A 3EUHC 3WODF 2QQBA 5L3EA 1T2KA 4BGDA 1UMQA 3ZQ7A 3HXLA 4PJ0C 4ENKA 3I54A 1FMVA 4IHVA 3QOEA 1FOWA 1I39A 1U5TA 1OQYA 1SFOJ 1IRFA 3DLLF 3ONQA 2K9MA 2YSRA 2ZXJA 5J1UA 4UUSB 5GP9A 2V26A 1QZYA 4RMNA 2GIZA 4Q47A 2V1DA 3CO6C 4B43A 1RETA 1Z1DA 3V8LA 2RQPA 2K27A 1BJAA 1XGNA 2F48A 1F1ZA 4BQAA 4B3XA 3PNVA 3WG7H 1LKXA 3IL2A 3GFIA 3PFYA 3O3KA 4RGUA 3BCBA 1TW2A 3AKZA 1FSHA 4I7HA 5ILSA 2IXSA 3O8GA 3HSFA 5CPRB 2RV8A 1V54H 3IH3A 4KITB 3CMEI 4EEFG 2K02A 4DZPA 1SVLA 2WADA 3ZMDA 5HOOA 1FBUA 2JN6A 3KZYA 2LKPA 2R7TA 3F23A 4MIMA 5F0CA 1V3FA 4P96A 1U78A 4ZYGA 1TWHJ 1EKEA 3D5SC 2A6HF 2EB7A 5J8CA 1L0OC 1MIJA 2G7UA 1S5LC 3I3LA 2V4JC 1MNDA 5DM7F 2X6OA 1K78A 1CF7A 3I59A 4BXUA 4UY8I 3ZRGA 4F55A 3RPUD 1IC8A 2ZMEA 1ZGJA 4ENJA 1GDTA 4I01A 3VFZA 3BTJA 3A4CA 4F92B 4XLNF 2V9VA 3F8MA 2JSPA 4C3IJ 5FLXZ 3JRAA 3M1EA 4LLLA 2B63J 1BOBA 2DOFA 4MHGA 3RQ4A 1PP8F 1FYMA 1W36C 1P4WA 2CFOA 3QYBA 3ROUA 3TO9A 2R7RA 4JX5A 2QSFX 1B59A 2LY1A 2RNGA 1R5HA 1E17A 3VOEA 3H9GA 3COAC 3OMYA 1IF1A 3BDDA 3TDZC 2CRGA 2Z1DA 1V55H 2GBYA 4RB1A 1VI0A 2E5NA 3ML6A 3OS2A 1U8BA 4HZFA 2VKVA 3CDIA 3KP6A 3JRGA 3ZOBA 3SEQA 5DCMA 1D5VA 1IV6A 3OL4A 2GIVA 1X3ZB 2HDWA 2XRNA 5JLXA 1RUNA 1YIJI 1CQTA 4Y17A 5FLVA 1BI1A 2NVXJ 3ZQLA 3OIOA 1FC3A 2JVHA 3P5JA 4BHBA 5B5EC 4N4NB 2LBFA 1GHCA 1ORKA 2M45A 3GTPJ 3GUDA 4G7ZF 3F6OA 1TT5B 1IZ1A 3OYDA 1VQNI 1QZZA 2DJIA 1U2WA 1AWCA 3HM5A 4AU7A 3CCMI 1Z3XA 2ISYA 1XSDA 2L2OA 1XCVA 3DKYA 4LIVA 1EA3A 5K7HA 2WWYA 3EPZA 1D0XA 1B9NA 1ETXA 2OQRA 4LD5A 2VKHA 2EZLA 1MNEA 1RPWA 1K83J 1C0WA 4BL0B 4LB5A 2IAIA 3LOCA 5GAGJ 3BQYA 1LUJB 2TDXA 3SXYA 3GTLJ 3I4NJ 3QPTA 3N97A 3FWEA 2DA1A 3KX2A 4A0XA 2HOSA 1ON2A 5HDKA 3QPSA 5LHIA 1KU3A 1LDKB 2WB1A 5EGOA 2UXNA 2R7WA 3IKTA 4KIGA 1FYKA 3WGHA 1DGWY 1IV8A 3RZOJ 2DT6A 1FP2A 1Z21A 4IO9F 1M1EB 2NVYJ 2VQLA 2QENA 3LSKA 4NNJA 1OYIA 4MQ9F 2FQ4A 3F8CA 2QA4I 3IV5A 1HOMA 4YELA 4OINF 4XSZF 3B6CA 4P55A 1ZLKA 4BE1A 4XONA 2DOEA 1O3QA 3LSMA 1FTTA 3IUOA 2W84A 1OR7C 3HZJA 4OAZA 3DBLB 3KZZA 3KLNA 5BQTA 1LPQA 3H9QA 1H9TA 2VJJA 4W1UA 3ELKA 2N8GA 2Q2EA 2QUFA 3P9CA 4A12A 1OJLA 5FKKA 5H2FC 1X1BA 2HGCA 1OCTC 3F8BA 1WPKA 5E20A 1I3AA 2P8TA 1HXDA 1DP7P 3LFUA 4C9YA 3S2WA 2GOMA 4KIFA 3MKZA 2X1CA 5D4SA 4A5NA 3HKZN 4ON0A 4BDYA 4U0WA 5JHUA 2DAOA 4Y4RA 1R1VA 2DDAA 3TQNA 1X2NA 4I76A 4XLFA 2K85A 1B1BA 4QWQA 1SANA 2CUEA 2W25A 2VUMJ 3K1MA 3NRVA 4IQ4A 2LY9A 3OS0A 4WCGA 1I5ZA 4OOIA 3IKVA 4IRGA 3T0YA 4HAMA 1W36D 1HSTA 3LA2A 2R3SA 2GWRA 2V6CA 2PQ8A 3BCAA 5M3MJ 2DFHA 4XLEA 4A3CJ 5CVUA 3K2AA 3OYKA 5GTIC 5DCMB 2EZHA 3HYIA 4HNUA 4QTRA 2UWMA 4O5VA 2R4GA 1K7AA 5DYMA 2KFDA 3HSEA 3G4SI 3S15J 2A61A 1GUUA 4PGGA 4IHYA 1ETWA 2CH0A 2IGOA 4BE0A 3N05A 5IT9K 2L9RA 2LYCA 1H0MA 4A0YA 2R5ZA 1Z05A 3HEFA 3DPLC 3LWFA 1S7AA 3GVAA 1G2HA 4DNCA 4AVZA 2P6TA 4ESFA 1R22A 4FHTA 3DTKA 1HKSA 2JTVA 1JUMA 4KNYA 3AL0B 2QYOA 2DA6A 3TBIA 1G8XA 5D8KB 5FRMA 1J75A 2I8DA 3FZVA 4KJZA 5EEGA 4IHSA 2F4OB 2WV1A 1XN7A 3AG1H 4E6KG 1SMTA 2PBIA 3WTTC 1ZLJA 1IAWA 1IO2A 3QWLA 3W2WA 5LHGA 3JAMZ 3L2RA 3OYLA 1R4MB 3ISPA 5HLTA 3VSLA 1Y56A 3HUGB 1FZPB 4PZJA 3FM5A 5ICGA 3BG7A 2E5ZA 2Y75A 3L2CA 1W5TA 2Q2EB 4EJWA 1OMIA 2JA6J 1G3TA 1WH5A 3V4GA 3WTYC 1VQ6I 3CMMA 1D1BA 4QPOA 2VL8A 5C3EJ 2NRAC 4FQGA 2HWVA 3BPVA 1X1CA 1T8IA 2XVCA 4LFUA 2DW4A 1VQ7I 4IRIA 5C44J 1OKRA 1QHGA 1TT0A 4ZYEA 1IXCA 1WJEA 1YE9A 2A6EF 3CCUI 3RQIA 1Q1VA 5CQGA 1FNNA 1TQMA 1ZHFA 1WJDA 2STTA 1XGSA 5E1WA 3LMMA 4XR6A 4HF1A 5AONA 2GM4A 2IT0A 3DQVC 5JFRA 5BPIA 4M6VA 1MBEA 1QBJA 4RAFA 1OYWA 3HOTA 3L2UA 2Z3YA 2O6GE 1Y0NA 1F43A 3SDGA 2IA0A 3QRFF 2ZJPF 1POGA 4TV7A 2IBDA 2XF5A 1TL8A 4AWXB 4E7JA 2O3FA 1G4DA 1HLVA 4LIUA 2VBXA 3Q0VA 2L9VA 5FFXA 3REOA 4S0HB 1W0TA 2KZVA 4ITVA 2G9WA 3ZXSA 4NQWB 3H35A 4WXDA 2NVUB 2ZSHB 4O3MA 2V6EA 1AKHB 2E35A 2K9QA 4A93J 2AS5F 1LB2A 5E17F 1B8IB 3DEEA 3IH4A 5KHDA 1DQUA 4ZDOA 1G6NA 2FOWA 2WC2A 2YPRA 4N9HA 1V5EA 5A2QZ 1MMNA 2EH3A 3H3UA 2LOOA 1SMYF 4ABZA 5IPAA 3M8EA 4XKWA 2VKDA 2P5LC 1UZCA 1ZG1A 1JT0A 5E8GA 1SAUA 2O8XA 3UR3C 1FP1D 1WWXA 2XPVA 2NVQJ 3RCOA 1ZGAA 2WY7Q 4V2FA 2VE9A 1QU3A 2E2HJ 4GDFA 3RTRA 2JRMA 3A0BC 5J1RA 5CKTA 1E3HA 2DO7A 3M4OJ 1O57A 3F9KA 4G9YA 3S1MJ 3HRTA 2DK5A 5CVRA 4EJTA 2EIMH 1VFCA 1FYLA 1LQ1A 2ESHA 5J4VA 4U87A 2Y0MA 4YIRX 2M8EA 1MDMA 4DJAA 1BBYA 1W5CC 3C3WA 5EZGA 2DFFA 1BI0A 2NAZA 2XPWA 4XRFA 3SJMA 4HA8A 1D8KA 5LGNA 3ZP5A 4JX6A 1IUYA 1UCRA 3QOPA 3J81K 2BE5F 2EZIA 3E97A 2R92J 5IOZA 2W7NA 2R7VA 4E7SA 2BHYA 1GXPA 3V8JA 3J7AY 3HOSA 2B7EA 1WRJA 5EG0B 1W0UA 2XAGA 3MAJA 2VODA 2JUGA 1XX5A 2XIGA 3Q0WA 1OCPA 1O7FA 2VKEA 4B09A 2EV0A 2JMWA 3FDYA 3CJQB 4XLPF 2YS9A 1MGTA 4IRHA 5JR3A 1KYWA 4PJNA 4V2GA 3TKYA 3X2QH 1OPCA 3BJAA 4IX7A 5ICEA 4MTEA 2DCEA 4JP0A 5K5RA 2YX7A 2A6TA 2UUZA 3HOUJ 2I5UA 1U6GA 4XSXF 4GYIA 1YFHA 2EBIA 4DYCA 3FXRA 4OU0A 2VT3A 4CZCA 2XPUA 4AVPA 5DS9A 1YX5A 4BJ6C 3FKJA 3BR6A 2ID6A 1PUFA 1BW5A 2VIXA 3CD6I 3TGNA 2M0CA 2Q0OA 2VLAA 4Z2YA 3DU6A 2FXAA 2KIMA 2NYXA 4G94A 4ESBA 3CF5F 2HDDA 1S6LA 1IN8A 1G3SA 1EF4A 1KA8A 4M9SA 1QQIA 1YRNA 1UAAA 3HTSB 4BJ5C 2M34A 2QWWA 4FETA 2QBYA 2JK3A 2ZJ2A 3OIPA 3OV8A 2WA0A 3H1CA 5J8FA 2NVTJ 2Y48A 2EFWA 1VZ0A 3KP7A 3RKWA 3L1PA 1YHQI 4M3FA 4H0EA 1RNLA 2XF7A 3KP3A 1ONVA 2CS3A 3OYFA 1RKTA 5ICFA 1AU7A 4B3AA 3KPHA 3FXJA 2E1CA 5FLMJ 1V5GA 1R5ID 2H1KA 3LSRA 1IXRC 3U9GA 2Y9ZA 2JQ7A 4CGZA 1U9NA 2L7MP 3HG9A 4WXHA 4DIQA 3P9IA 2WBMA 2R5ZB 5IOYA 3CCYA 1K6OA 1MMSA 4XKVA 3E0JB 2LP0A 2CO5A 2CQKA 2P0WA 3D5RC 2DTZA 4DW6A 2PJPA 4XOPA 1FEXA 1J7KA 5HDGA 2QLZA 4XKBA 3S1QJ 2ACJA 2X9DA 3JSPA 3ABMH 5J47A 1MMDA 4X0GA 3O8HA 3WU2C 5DUIA 2XDVA 5K7FA 2VJ5A 3BZKA 1I3QJ 2NNNA 3H5RA 2Y31A 3RYRA 2WB1N 4M72A 2OTLI 2OD5A 2HKXA 1JKPC 3WE2A 2BXYA 1P4AA 5M5XJ 3ERMA 2DYRH 2ZO4A 4WX9A 3M8FA 1TW3A 1SFKA 4RS8A 1NG7A 3OL3A 2K4BA 2DQLA 1I6XA 2DODA 1S72I 2ZNYA 1RI7A 2ELKA 1NG6A 3DBHB 3S93A 1W1WE 3VSKA 3H3VK 4M9XA 3V7CA 1XG1A 5HLHA 1E0EA 2MH2A 3I58A 2ZCWA 2WAQA 2XAUA 3T8RA 3KYCB 1FOYA 3QYEA 2L7ZA 1BI3A 2QKMB 1FTZA 2GA2A 1O4XA 2L3DA 1WJAA 2ZXIA 4HG2A 2X6XA 1ZRFA 2XAQA 3HOXJ 3GF2A 1FLIA 2BV6A 4AC0A 3SQNA 4CCLA 3RKQA 5D6EA 1B6AA 4P9UA 1ETKA 1RR7A 1MBJA 3JREA 3H0DA 4A3KJ 3KP2A 1ZR4A 1A36A 2EFNA 4G6TB 4XLAA 4KA4A 2P4WA 4I2OA 2KDOA 1B72A 3ZPLA 1Z91A 3G6EI 4WXCA 1BL0A 3DKWA 1YS7A 5KNLA 4BHPA 5EDNA 4AM3A 4ASNA 2KDZA 1SD6A 2CW8A 2LTPA 5DV5A 2E7XA 4RGSA 3M3YJ 2E1MC 1NTCA 2PX9A 4WF2A 4QSHA 5IYBJ 5IT3A 4Q48A 3TW7A 3MQ0A 1HBXG 2MC3A 4KICA 3CZ6A 2MLKA 2DA4A 4E7LA 1ZRDA 1T38A 3FXQA 2TRTA 3Q0UA 4RB0A 4A3EJ 3QQAA 1UFMA 3K1PA 1WI9A 1MD0A 1FBSA 2VQGA 3K7AJ 5KK1A 2HEOA 1LDJA 5HLGA 4AIHA 3K0LA 4B1RA 2HOEA 3MZHA 3BG9A 4Y15A 3WU0A 4Y13A 2O9LA 2PJRB 3TOBA 3B6AA 3MKYB 4FX4A 1NK2P 2BBYA 3ULQB 2M4GA 3ZGKA 3Q5FA 2DT5A 4AYBN 2IGMA 4EMSA 4CCMA 1K79A 2QZ8A 1GT0C 2RDPA 3AFHA 3PO2J 3K70D 3FK6A 3WHCA 3CTAA 3TW6A 2MA3A 5HS8A 2BY2A 2JWTA 1B4AA 3F0CA 2M30A 1HDPA 3FF5A 5E1XA 4IKFA 5EF6A 1UB9A 2O5RA 3WTWC 2XGXA 2IA2A 4LB6B 3DCFA 2FNPA 2JT1A 3MMYB 1XSXA 4PDKA 3DPTA 4HPQA 5H6QA 3S3NA 2P5VA 2BW3B 3U2RA 2FD5A 2ZFWA 3OWTA 1JHFA 2BZTA 1EJ9A 4L9TA 2Y2ZA 2VONA 2E36A 4XRSG 2A3SA 1YYVA 5FFZA 3F72A 2VXZA 1Q1HA 3R4KA 2PI0A 2BVLA 2XF6A 5HVQC 4NB5A 4E70A 1TNTA 2CUZA 3WHBA 1T56A 2HZTA 3NARA 2O0YA 2XAFA 5FD6A 2L9SA 5TGTA 4MEYF 4UUTA 4B47A 5M5WJ 2K9LA 1YOVB 2V9KA 4IOCF 3H0GJ 2L54A 1FBQA 1DP3A 3TL4X 5LEKA 2R7SA 3GTQJ 2F5CA 1IRXA 2GAUA 3UNGC 4BUPA 3I4PA 4CA0A 2EV6A 4K2EA 1ZQ3P 1EH8A 2KLOA 1A04A 3GXOA 4KFCA 1OCOH 3ZQIA 3E6BA 5DD4A 4XLCA 3CF2A 5BNGA 4BQQA 1R23A 2DMUA 1X4OA 4Q4ZF 1RC9A 4BAYA 1FPQA 1BI2A 1FT9A 4BQNA 5D4RA 2K9NA 3CP8A 1UHMA 2R7XA 2IVMA 3WGGA 1D8JA 4KUMA 4UVBA 4Z6YA 5EEHA 2G0EA 3M8JA 4XN3A 3WTXC 3EQLF 1D5YA 2XAJA 1Y8QB 3OYCA 4B8XA 1HF0A 5FRNA 2M9HA 1SD7A 4YIFA 2E1NA 5A2QK 5LGTA 4AUXA 1IN7A 2DI3A 3HKZA 4LK0F 4UXNA 1WI3A 4DYRA 2PN6A 4D5FA 5LRSA 4UNOA 2QQ8A 1J09A 1YJWI 1WJ5A 3CMYA 4YFXF 3FXOA 1KZHA 5IYDJ 3I5UA 3T1BA 2JA2A 1QO0D 1U5TC 4EJOA 2BYVE 2LF8A 1P9QC 4HV6A 2VT2A 1UHWA 2W85A 5CVIA 1SD4A 4NC7A 1S8NA 2EFQA 2LMDA 3K10A 4RM2A 2XRLA 4UV8A 1ETOA 2W4SA 2YX4A 3OYBA 3EYYA 3SZPA 1B8IA 3LSHA 1SC7A 4PSWA 1FIPA 2FF4A 4ZYAA 4PJLA 4EQQA 3A01B 2GXBA 1EV7A 3LSIA 2IS4A 4U88A 3FM3A 3VYUB 1R00A 2NXNB 2L4AA 1VTNC 3CJTB 4CH7A 1N25A 1SAXA 1VQLI 4OIQF 5IY5H 5D6FA 1KU9A 2D1HA 2VOOA 1K78B 1RESA 5ERIA 3HUGA 2EQRA 5D5VB 2EA4A 3ZN0A 3HTUA 2CWEA 3ZQHA 2YU9J 2VJIA 4KT5C 3A01A 3G2BA 1D1AA 5KAFC 1Z7UA 1U9OA 1G3YA 4FISA 3JTGA 2O8KA 3SZTA 2DA7A 1WCMJ 1AKHA 2ECCA 3JW4A 1T33A 2DU9A 1SEUA 4ZZDA 3QYFA 2LR8A 1ZELA 2DFIA 3OY9A 4A3DJ 4BDZA 1T0FA 1KONA 4BY7J 4IQJA 2NS0A 2X85A 3IRRA 4DBQA 2CQXA 3QU6A 3HGYA 3JAMK 3IRQA 3MD2A 1QNTA 3LA7A 5FROA 1JXSA 2F5DA 4ZYHA 5AIPA 2PMHA 4L5JA 1UG2A 1SVOA 4BYYA 3IC7A 4IF4A 5JLWA 3SEZA 3CC7I 4IVNA 2WY8Q 2DPUA 3D5LA 1MBKA 4C3HJ 1LJ9A 3SDBA 4BU2A 4D5CA 1LFUP 1GLNA 1QHHD 2RNJA 4ESJA 3C1DA 1JT6A 1X1AA 2CW0F 4CSWA 4BXFA 1V4RA 4EATA 4BH9A 2OAZA 3SFIA 4EV0A 2X1EA 4C3JJ 3RZDJ 2OF7A 9ANTA 2OTJI 1U5TB 4FT8A 4MGRA 2QSHX 3CC4I 4I98B 4Y33A 4M6YA 2H27A 2DXIA 5BPDA 2HQRA 2NS8A 3QU3A 2WAEA 3GZNB 3S32A 1X3WB 1DDNA 3FHNA 3K4JA 4L9NA 1LVAA 2LVSA 2NS7A 1MMAA 3GLLA 3CUQC 4RBOA 3GCMA 4BY1J 3FXLA 4HNVA 4MEXF 3KCCA 2K7LA 4CDGA 2D1VA 4C30A 2X1DA 3E6CC 2V7FA 2M7BA 2IJLA 1F9NA 5LBQA 1TWFJ 1EH7A 2K4JA 3RI4A 5E3NA 3EUKL 4A3GJ 3CCEI 3C18A 5F0FA 3JRCA 4FASD 3L2VA 4HQMA 2K3FA 4V19K 2JSCA 1ACIA 2IGNA 2RN7A 3HPHA 3L09A 3PL8A 2FMYA 2KIUA 1MDMB 1J59A 5IT9Z 4I99C 5E3LA 4BBSJ 4XM3A 3VDXA 1ZREA 4C2MJ 3HJEA 2R0QC 3F3XA 4KDPA 4HLYA 1P2FA 3CLOA 4UB8C 1Z3YA 3CCJI 3KFWX 3HGGA 2LG4A 3PUFA 4A3IJ 1PP7U 2FX0A 4LMYA 4LG3A 5CVVA 3MZ8A 1OYYA 1Y0UA 3WTZA 5D5UB 1X1PA 2HTJA 5LGUA 1SD5A 1T95A 2CQ7A 1I27A 3NWTA 3ECOA 1DPRA 3CQZJ 2P6SA 3RPQA 1YI2I 2ECBA 2A5YB 4RAZA 3C2HA 3DV8A 5L3DA 1IN6A 1FIAA 3W2VA 2QBYB 2F5FA 1LE8A 2CU7A 3FXMA 2OU2A 3RKXA 3DTEA 2J5OA 4I0BA 3JRFA 4IL6C 3H9JA 5EGOB 1W4MA 1APLC 1ZAOA 2VB6A 3ZR8X 1YQAA 3FX3A 3JRIA 4EM2A 1QGPA 5LHHA 3FMSA 2CG4A 2ZMEB 3MVPA 3GTJJ 3BY6A 2LKXA 1HW1A 1JUSA 2VC0A 1CF7B 3H3ZA 3CC2I 2KIFA 5K7ZA 4AD9A 2Z2SB 2FJ1A 1TC3C 2KRHA 2FBKA 3DFGA 3PIOF 4BXXJ 2K3PA 1U0JA 3RDIA 4KYWA 2CJJA 2XSJC 2R7ZJ 3S16J 4PSXA 1XC5A 3SZGA 2OZUA 3J80Z 2HDCA 4EVIA 3GZ5A 2VC1A 2OBPA 3Q9SA 2D45A 1XB4A 2HVRA 1IN4A 1F36A 1I6HJ 3CUQA 3IAM2 3DTIA 4XKCA 2ME6A 3DKXA 3CDLA 4HLXA 2KISA 4CYCA 5ICCA 5B1AH 2XC7A 1MJBA 4HSRA 1WQ2A 3W6JB 3LSJA 5IP7J 2MC4A 1IGNA 3JCUC 2W1OA 1KYZA 2K86A 4CCKA 1A31A 2FOKA 3CO7C 1MBGA 3QODA 3S14J 1HKTA 3PNYA 2VPRA 4OMYA 5LD2C 4A0ZA 5E8IA 3LAPA 5ILUA 3OYJA 4XICA 4BEHA 5HODA 3ABTA 2HTSA 5ILVA 5TJJA 5F1RA 1O3SA 1U3EM 1XMAA 1R36A 2JRTA 3BWGA 2DFEA 1ETYA 3QPHA 2FEZA 2FE3A 1CGPA 2CQQA 3AG4H 2GXAA 1TTYA 1OCRH 1RR8C 3KEYA 4M9ZA 1FMWA 2M4KA 5L3CA 4AYBA 1MBFA 2HYGD 3F8NA 5GADJ 5GAHJ 1MSEC 5EJCA 3LSPA 1SFUA 1I1GA 1ITYA 5F08A 2DTRA 4ZTJA 3G1LA 4I6ZA 1PYVA 2F5EA 1O3TA 2VBYA 1S7EA 4A3BJ 2KRCA 2OUMA 2X0LA 4KN7X 3I4MJ 4I09A 4NBQA 2H8RA 2KJBA 1LNWA 4M3DA 3K1NA 2XUBA 3F21A 2GLOA 2H6CA 3R0AA 3KEQA 5EZHA 4ZDPA 4HSTA 1YG2A 2XGDA 1WH7A 4Y3OA 4JQFA 2IS1A 2YR2A 3LQQA 1KQ9A 2O03A 3W6KB 4MO7A 3FIWA 4B44A 1R71A 4EJUA 2FQ3A 4MQVA 2DLLA 5E1ZB 1IG7A 4OIRF 5EEAA 1A5JA 3WE3A 1AHDP 4FE7A 1GV2A 1TWCJ 3CUOA 1NK3P 1GXQA 1IW7F 3ZQQA 2JVGA 2L02A 2LBFB 4HRIA 4YG2F 2XKOA 1WJBA 3T5XA 4U7BA 4C2UA 3GFJA 1WJFA 4A6DA 2EV5A 3J80K 4G7OF 1FJLA 1A6QA 4WWCA 1Y39A 4UVCA 3WTVC 1XGOA 4GRIA 2GQQA 3L7WA 2ZMEC 3FISA 3RYPA 1UG0A 1HKQA 2E2JJ 2KIQA 4EJVA 2XGCA 1YRNB 1KQ8A 4M3BA 3FKIJ 1IXSB 1TP4A 2ADUA 3BZCA 4N0BA 2BGCA 5DD8A 2P81A 3S2DJ 1I1SA 3ZMZA 4L5EA 2CV0A 1XSVA 3K4BA 3HL2A 4II2A 4IHWA 3SHFA 4RAYA 4LG0B 5IP6A 3PM1A 2D2WA 2VBWA 2W24A 4CCJA 2JA7J 3R60A 5AIQA 1TBXA 2PMUA 4BEHB 4HX4A 3P9KA 3CMAI 4A3LJ 1K4SA 1T6SA 3WTSC 2QGUA 2BEOA 3S8PA 5KAIC 1JUPA 1K4TA 2W82A 3S3OA 1VQ8I 5LFAA 4BACA 2M5WA 4PFPA 1T0FC 4XNFA 2BW3A 1P7JA 2DPDA 3EDPA 4IHTA 4CYCB 2ESNA 4KN4X 1DU6A 3G73A 3JRBA 1F5TA 2M2EA 2VBZA 4XK4A 3BT9A 3I64A 3LFKA 1NH3A 3I53A 5JHFA 2IPQX 3ZMVA 2VQCA 4GGGA 5E3OA 1ZRCA 4IHXA 3NWSA 3FHZA 3ZMTA 1XCBA 3H5NA 4XN0A 5HS7A 4HBLA 2AHQA 4DGWB 3PSIA 1KU7A 1QVUA 2E19A 3E3VA 4ZH4F 2DBBA 1MH4A 2CMPA 3L2WA 4XL9A 1Z77A 3QP6A 3MN2A 5H6RA 4L0ZB 3V8KA 1XMKA 4YIIA 4M73A 3BG5A 2PJRA 3A1YA 4XIDA 3FBNB 4GCVA 3DU5A 5BS6A 2ISZA 2XHKA 2HPMA 2JPCA 4OMZA 5CJ9A 4YFNF 3AAFA 2ZFUA 6PAXA 2E34A 3G1MA 3TOAA 5CQEA 4BKXA 1GV5A 3HPGA 2VE8A 3GX4X 1Z6RA 1RRJA 3AG3H 4A3JJ 3JSOA 3SYTA 4JBAA 2L4MA 1AOYA 2IGKA 2Z16A 3DPUA 4PGHA 1IDYA 1QA6A 3FXKA 2MLGA 3G71I 2RREA 3C2GA 2BOLA 1JE8A 1YJ9I 5D5WB 1Z6TA 4BHCA 3GTMJ 2AXLA 4G6DA 3O6BB 3I9V2 2ZB9A 3HSRA 3RKYA 1S7OA 3OSGA 1Z0XA 2XSDC 3MWMA 1B9MA 4P5OA 3HHHA 5HNFA 3J7YJ 4UUVA 4IPAA 2EILH 4KMUX 3TEDA 5HDNA 2EIKH 5L3BA 5IP9J 4PJMA 1P7IA 2ELJA 2Z5UA 4NC8A 2MABA 1XD7A 3ABLH 3I71A 2HYFA 4CICA 2CGPA 3BQZA 3JRHA 1JKRC 1X4PA 2X6YA 2MH9A 5LEJA 2EFOA 1PVEA 2A68F 4ZC3A 5DEQA 4A2UA 1RIOH 3PUBA 2H09A 4LLGF 3BROA 4ANJA 2LK2A 2E1OA 2IW5A 3ERED 3B73A 1IJWC 2CUJA 3VYSB 4XRSA 3NEUA 4XLHA 3CCLI 1ETVA 3BR0A 4DQ2A 4B4CA 1R5GA 3KE2A 1PDNC 5LLQA 1I50J 1MKMA 1XPXA 2RGVA 1JTXA 1YX3A 4LITA 1TWAJ 5E79C 3GTGJ 1BR4A 3HOWJ 2VQHA 3MCZA 1Y8RB 4AIKA 2WAQN 2EWNA 2O7OA 4DZJA 3OSFA 3S17J 3E6DA 1MJ9A 1TZLA 3BR1A 2QKLB 2FSWA 4RDUA 5HLIA 1A6IA 2QEXI 2ZKZA 4LGWA 1JKOC 2HXOA 5FKOA 3R61A 1LFPA 1BJZA 2D5VA 4U7DA 1MZBA 2DQRA 1QRYA 1OCZH 4RM3A 4RLQA 2UV1A 3KP5A 5EYRA 5JVTA 1T98A 5DM6F 1YIOA 4S05A 1S9HA 3BR3A 3PSFA 2COMA 3BTIA 2GOXB 3OYHA 1H88C 5FKMA 1ENHA 3R0JA 1VQMI 2VASA 3IWZA 1ON1A 1R49A 2KMUA 2ICWG 2L5QA 3BP8A 2KKOA 2W57A 5K5OA 3K4MA 2CYYA 3ZQCA 5BOXA 2HVSA 2PMZA 2R93J 4L0YB 3RSNA 3VYTB 2F4MB 5J3LA 3CJNA 5J6XA 4HW0A 4PUSA 1OR7A 2ZBKA 2C6YA 2FMLA 2GXGA 2V1XA 1FSEA 4GXOA 4CUGA 3FMRA 5ED4A 3K6GA 3Q3SA 1JI8A 4I02A 2M0MA 2Z99A 3PJRA 2ZC2A 4NDLA 3L2QA 1X2MA 2F2EA 4XQFA 3BR5A 5GAEJ 1HSJA 4HEA2 2AO9A 5C4JJ 4R8HA 3RPUA 3TP0A 1ZTRA 5GPAA 4LLNA 2M87A 5IYCJ 3FMQA 3LL7A 3N4MA 3ZN1A 2NNYA 2ETHA 2JA5J 4OIPF 3WG9A 4BE2A 1J0RA 1L3LA 1WJCA 1KU2A 1XS9A 2CUFA 1OISA 1WKMA 3H36A 5FD5A 3VWBA 1W5SA 3M07A 3MZYA 3ZQGA 4FE4A 4P9FA 3O2PE 1JKQC 5TISC 4RLFA 2ID3A 3D0SA 4HX7A 4HNTA 4IOAF 1BA5A 3EYIA 2F4IA 2LLKA 1YW8A 2XB5A 2R7DA 2DMPA 3DBRB 5KCMA 4RGRA 3OYNA 2V1UA 4KIBA 1K61A 1GVDA 2HU9A 1BIBA 4EGZA 3W2AA 1RKWA 1MSFC 1FY7A 1JGGA 3FK7A 2DMTA 1YS6A 5FB2A 4MFDA 4A3MJ 1IRGA 5GTHC 3TP3A 4OIOF 5F1JA 3V42A 4BNCA 1QZEA 4CXFA 1W7PD 2BY1A 2VJ4A 5F6FA 2NOGA 3OYAA 2ME0A 1WHUA 2M3AA 4EGYA 2HVQA 4D1QA 2PFBA 4HF2A 1BW6A 2UXXA 3VB2A 3F8FA 2G7HA 4QPQA 2R7FA 4RGXA 3DF8A 3KP4A 4HX8A 1UJ8A 1RUOA 4D7NA 4KMFA 2Z33A 3OOUA 2EA2A 1DUXC 2KJCA 3BR2A 3VYRB 1MBHA 1ZG3A 1OLTA 1ZN2A 4MTDA 1X3UA 4YRVA 3DEUA 2ZJRF 4FTHA 2FA5A 2QVOA 3BLYA 3GW2A 2ELHA 2FU4A 2K9SA 5L3FA 5C4XJ 3ASOH 2J5PA 1BC8C 3OR1C 3PO3J 2E2IJ 2KRFA 2BY3A 2WV0A 3IHUA 2LH9A 3J7ZI 3PQKA 4JK1X 2Q8KA 1R58A 4HQEA 3HHGA 4B48A 3BG3A 1JJ8C 3L9FA 3ABUA 2XV4S 3EUHA 5HS9A 3K70C 4PK4A 1F4KA 2LKSA 5FKLA 4HF0A 4D0PA 5E18F 5FKNA 3K4CA 3GFLA 3T8TA 5J4YA 3F22A 2XKPA 3MEXA 1HA8A 3LSTA 3G3ZA 3EUAA 4N4OB 2AQEA 3GTOJ 3OOPA 2PLYA 1S29A 3JRDA 1IRZA 1XGMA 2HR3A 2OQGA 3M9AA 3V7SA 2X48A 3OYIA 1SVMA 5H20A 4CHUA 3A0HC 3PFIA 1LEBA 4XMYA 3GTKJ 4ENNA 4F93B 5JI6A 4LK1F 4CO8A 2OJED 4O6JA 5D8LB 5F0HA 1BM9A 2VOPA 3IP4B 2QF7A 3TMOA 2JA8J 2K5CA 2DYSH 1QPMA 3CLQA 4E7ZA 2IS6A 5FGMA 1UELB 4CCNA 3S3MA 1T39A 1X58A 2OC6A 4MNUA 1JGSA 5F04A 2BY0A 4S04A 1PUFB 2X4HA 1PUEE 2JPBA 2HQAA 3BPXA 4U0VA 5JVGF 4L18B 2OCEA 1Z67A 1H89C 2EPFA 3GYHX 1XMXA 4EM1A 3E5UA 4ZZLA 2ZJQF 3DXJF 3S1NJ 4PCQA 1FOKA 1MNMC 5CVJA 3NAUA 3A2KA 1LFBA 1TQIA 3BTLA 1WFXA 1ZR2A 3OYEA 3JR9A 1PJRA 4GYGA 3HOVJ 2B9SA 3K4NA 1N77A 1HQCA 1HDDC 2A07F 1Z7LA 1R4NB 2Q1ZB 5FO5A 4X6AJ 5DDGA 4ZTFA 5LRRA 3E5XA 4D7MA 4UHTA 1ZGWA 1E3OC 4BS9A 3I56I 2E7WA 1QVTA 2M8GX 3VPRA 1HW5A 1Y6IA 5F27A 5E3MA 1ZH5A 1WGXA 2QQ9A 2B0LA 2XASA 1TQPA 2EFPA 2H6BA 4U0YA 1J5YA 1J2XA 3A03A 2DOAA 2ZXWH 4DBRA 1R1TA 2LC2A 2FBIA 3ECHA 2P5KA 2PMZN 3AG2H 4XOTA 2RKHA 4LG0A 4E7IA 2YU3A 5HNHA 3FBIB 5DCFA 3HOZJ 2GZWA 4R1HA 2FBHA 3JTHA 4HDUA 3E6MA 4UUSA 3BG6A 1N75A 3WGIA 4X1EA 4P1WA 1OFCX 2H1LA 3OYMA 2OA4A 3KLOA 1JTYA 2AXTC 2DA2A 1LE8B 1G59A 1HCRA 1GVJA 2VN2A 3DWLE 2CQNA 4UV9A 2LRDA 4J19A 4ZJZA 3CDHA 4LJZF 3K4LA 1FX7A 2LF7A 4OWRB 4ZDLA 2FRHA 2MBFA 4M71A 2IRFG 1KGSA 2CSOA 1ZARA 3FXUA 4WK8F 2ZNZA 2JJ7A 1ZKGA 4UB6C 1VNDA 2IP2A 3BC8A 1ETQA 4G7HF 4A69C 3LSGA 4FCYA 1REPC 4G6QA 3J7AO 3HRMA 4NQWA 4I0AA 3TO7A 2QQAA 1MMGA 5FLXK 2FUG2 1BR1A 1R6RA 2KHMA 1Y1WJ 2KPMA 3GMEA 5FJ8J 4DOZA 3C7JA 1VQ9I 4ZYDA 2K40A 4E7HA 4LOCA 4C2TA 2OZ6A 4H4KC 3M7GA 3QAHA 2HOTA 2E60A 1ERDA 2F6CA 3PIPF 1D1CA 2HPIA 2MD0A 2Y30A 1J9IA 2LREA 1TWGJ 3I0TA 3SFZA 2MSYA 3GBGA 1HC8A 1H9GA 2PG4A 2X6WA 1FWZA 3BJOA 1VQ5I 4JYKA 2M1BA 3TO6A 2COBA 1ULYA 1BIAA 2HI3A 3WU1B 4PJJA 5BMZA 2V79A 3U21A 2CW7A 2Y69H 2P7VB 1BN5A 1E3PA 2DMQA 4F7ZA 5GPCA 4QIWN 5J1YA 2HXIA 4ETSA 4F3QA 5M3FJ 2I10A 4CZZA 4DYQA 3R6SA 1USSA 2MFZA 4HV5A 3K9TA 3VEPA 4JX4A 2MD5A 4KT6A 2IEKA 1SFEA 2DT7B 2HQ5A 3QP5A 2DMNA 2R5YB 3UKGA 3K4KA 1WSUA 1N78A 3C2BA 4UVAA 2MW8A 2RAEA 1YTYA 1XTAA 3OIQA 2CV2A 2BXZA 1SFXA 4N9IA 4PFOA 2LY2A 5TRDA 3I59B 2LD5A 2STWA 3GO5A 3ZQFA 1VQPI 2VI6A 4II3A 2EZKA 4XORA 2E71A 2QSGX 2DDBA 5B1BH 3ZCOA 3W6VA 4A6EA 3HOYJ 1O3RA 5B3SH 1W7PA 4FX0A 2OPTA 3OS1A 5KVRA 1P92A 3BJ6A 2MYSA 2BHZA 3RJPA 3K69A 3HC7A 3KYLA 1WZ2A 2HS5A 2A69F 4L9JA 2L9NA 4OAYA 1YW9A 1H8AC 1ODDA 3DP7A 1WVRA 2KT0A 4NC6A 1D0ZA 3TDUC 3GLXA 1YITI 3CUQB 2JUCA 2KZGA 2MG4A 2XAHA 1VQ4I 2AQFA 3HBLA 1DPUA 3B02A 1B72B 5DUKA 1BR2A 3LA3A 2UZKA 3LQRA 2ZSIB 5M5YJ 1DU0A 1QPIA 2A05A 1A35A 2E1MB 3H5AA 2KL4A 1LEAA 3HIFA 2IA1A 3HRSA 4L9VA 2EK5A 3OR2C 3NQOA 2QM3A 4E7KA 3KEOA 1JJ6C 3F6VA 2V9PA 1YLFA 3ZMUA 4CYDA 2KQRA 3WTUC 2LSOA 3IWFA 2BVMA 4CCOA 3P7NA 2DK8A 1E2XA 3CP2A 4R79A 3CJRB 2Y9YA 3MFKA 2DJNA 3GEZA 2HZDA 2TCTA 3LNQA 3M1CA 4A3FJ 1X19A 3L00A 4IEJA 1JHHA 2VPLA 2GA1A 2HOAA 2X51A 4J01A 4XRMA 4L5IA 3HRUA 4D9JA 1Y1VJ 4M6XA 2OV7A 2RVCA 4YFKF 4Q5SF 1S3JA 2H8WA 1R1UA 3G1OA 2MGQA 2Y0SA 4BBRJ 3OYGA 4MFEA 3GZ6A 2LDUA 1MJAA 3A02A 2HKOA 1OCCH 2A5WA 1YJNI 1P6RA 1EH6A 2XGEA 2FNAA 3BOQA 1XDSA 1R9TJ 4MLOA 4RB3C 1LDDA 2W00A 1STZA 5DTDA 2JZYA 4Y7NJ 4RA2A 3VODA 2L0KA 5K1YA 4NUBA 1D0YA 4BJTA 3W3CA 3K2ZA 2L7KA 3CCRI 4Y52J 1LVKA 3V7RA 4F52A 5B66C 2QCOA 1VF9A 3CESA 3E5QA 3KETA 2XB0X 1MH3A 1RZ4A 4G12A 4G8XA 5J40A 1YW7A 3ASNH 5L3GA 1USTA 3CCVI 2ZXHA 1KQ0A 1D3YA 4BQOA 1W7PB 1VQOI 4KISA 3KIOA 4RB2C 2O61A 2DA3A 4JOMA 4HDVA 5D5XB 3LAJA 1R7JA 3J81Z 3PQJA 3GWZA 4E4HA 3BZ6A 2HQNA 1BC7C 1T08B 2CFXA 2W48A 3H92A 1P4XA 2LFBA 3KYDB 5K5QA 2L7FP 3DEWA 2IS2A 4IZZA 1ZYRF 2DN0A 2R7OA 3KZIC 3Q9VA 4ENMA 3E7LA 2R5YA 3S1RJ 2DA5A 3ABKH 2H94A 2XROA 1MW7A 1HW2A 1U8RA 4NHJA 3CCSI 2R7QA 1FOXA 3EETA 4GFBA 4XBFA
chains in the Genus database with same CATH topology
1XDUA 4EM0B 4AIJA 2L01A 1O7LA 1NHAA 4HOBA 1G3WA 1ZG5A 5CYVA 4IJAA 2P7CB 1IN5A 5F64A 2HFHA 2PEXA 1TNSA 4HYEA 3U1DA 1Z9CA 1BOAA 3ZMSA 3RIRA 4IXAA 4A5MA 5CLSA 2WTEA 2Z9OA 2LNBA 2RC4A 3GFMA 4QLCU 1YO5C 2EJRA 1TLHB 4GO1A 4M74A 3WODF 2QQBA 5L3EA 1T2KA 3ZQ7A 4ENKA 3I54A 1U5TA 1IRFA 2YSRA 2ZXJA 1QZYA 4Q47A 2V1DA 3CO6C 1Z1DA 3V8LA 2RQPA 2K27A 1BJAA 1XGNA 1F1ZA 4BQAA 3IL2A 3GFIA 3O3KA 4RGUA 1TW2A 1FSHA 4I7HA 5ILSA 3HSFA 2RV8A 2K02A 3ZMDA 5HOOA 1FBUA 3KZYA 2LKPA 3F23A 1V3FA 4P96A 1U78A 4ZYGA 2A6HF 2EB7A 5J8CA 1L0OC 2G7UA 1K78A 1CF7A 3I59A 4BXUA 2ZMEA 1ZGJA 4ENJA 4I01A 3VFZA 4XLNF 2V9VA 3F8MA 5FLXZ 3M1EA 4LLLA 4MHGA 1PP8F 1FYMA 1P4WA 3ROUA 3TO9A 1B59A 1R5HA 1E17A 3VOEA 3COAC 1IF1A 3BDDA 3TDZC 4RB1A 3ML6A 4HZFA 3KP6A 5DCMA 1D5VA 2GIVA 1RUNA 2XRNA 4Y17A 1BI1A 1FC3A 4BHBA 1GHCA 2M45A 3GUDA 4G7ZF 3F6OA 1IZ1A 1QZZA 1U2WA 1AWCA 2ISYA 1XSDA 1XCVA 2WWYA 1B9NA 2OQRA 4LD5A 1C0WA 4LB5A 2TDXA 3SXYA 3QPTA 3N97A 3FWEA 4A0XA 1ON2A 5HDKA 5LHIA 1KU3A 1LDKB 2UXNA 3IKTA 4KIGA 1FYKA 3WGHA 1FP2A 2QENA 1OYIA 4MQ9F 3F8CA 4OINF 4XSZF 4P55A 1ZLKA 1O3QA 2W84A 3KZZA 3KLNA 5BQTA 1H9TA 3ELKA 2Q2EA 2QUFA 3P9CA 4A12A 2HGCA 3F8BA 5E20A 2P8TA 1DP7P 1HXDA 3S2WA 4KIFA 5D4SA 4A5NA 4ON0A 4U0WA 5JHUA 2DAOA 1R1VA 3TQNA 1B1BA 4QWQA 2W25A 3K1MA 3NRVA 4WCGA 1I5ZA 4OOIA 3IKVA 3T0YA 4IRGA 4HAMA 1HSTA 3LA2A 2R3SA 2GWRA 2V6CA 2PQ8A 5CVUA 5DCMB 3HYIA 2UWMA 4O5VA 1K7AA 5DYMA 3HSEA 2A61A 4PGGA 5IT9K 1H0MA 4A0YA 1Z05A 3DPLC 3LWFA 1S7AA 3GVAA 4DNCA 2P6TA 4ESFA 1R22A 4FHTA 1HKSA 2JTVA 4KNYA 2QYOA 5D8KB 1J75A 3FZVA 5EEGA 4IHSA 1XN7A 1SMTA 2PBIA 3WTTC 1ZLJA 1IAWA 5LHGA 3JAMZ 3ISPA 1FZPB 4PZJA 3FM5A 5ICGA 2Y75A 3L2CA 1W5TA 4EJWA 1OMIA 1G3TA 3V4GA 3WTYC 2NRAC 2HWVA 3BPVA 2XVCA 4LFUA 2DW4A 4IRIA 1OKRA 4ZYEA 1IXCA 2A6EF 1FNNA 1TQMA 1ZHFA 2STTA 1XGSA 5E1WA 4HF1A 5AONA 2IT0A 3DQVC 5JFRA 5BPIA 1QBJA 1OYWA 3HOTA 2Z3YA 2O6GE 2IA0A 3QRFF 4TV7A 4AWXB 2O3FA 1G4DA 2VBXA 5FFXA 3REOA 2G9WA 4WXDA 4O3MA 5E17F 2AS5F 1LB2A 1G6NA 2WC2A 2YPRA 4N9HA 5A2QZ 3H3UA 1SMYF 3M8EA 2P5LC 1ZG1A 5E8GA 2O8XA 1FP1D 1WWXA 1ZGAA 2VE9A 3RTRA 2DO7A 1O57A 4G9YA 3HRTA 2DK5A 5CVRA 4EJTA 1FYLA 1LQ1A 2ESHA 2Y0MA 2M8EA 1MDMA 1BBYA 3C3WA 1BI0A 2NAZA 4XRFA 4HA8A 1D8KA 5LGNA 3ZP5A 1IUYA 1UCRA 3QOPA 3J81K 2BE5F 3E97A 1GXPA 3V8JA 3HOSA 1WRJA 2XAGA 3MAJA 2VODA 2XIGA 1O7FA 4B09A 2EV0A 4XLPF 1MGTA 4IRHA 5JR3A 1KYWA 3TKYA 1OPCA 3BJAA 5ICEA 4MTEA 5K5RA 2YX7A 1U6GA 4XSXF 4GYIA 1YFHA 3FXRA 4OU0A 2VT3A 4AVPA 3TGNA 2Q0OA 4Z2YA 2FXAA 2KIMA 2NYXA 4G94A 4ESBA 1S6LA 1IN8A 1G3SA 1KA8A 4M9SA 1QQIA 3HTSB 2QWWA 2QBYA 2ZJ2A 3OV8A 5J8FA 2Y48A 2EFWA 3KP7A 3RKWA 4H0EA 1RNLA 3KP3A 1ONVA 5ICFA 2E1CA 1IXRC 3U9GA 4CGZA 4WXHA 3P9IA 1K6OA 2CO5A 2CQKA 2PJPA 1J7KA 5HDGA 2QLZA 2ACJA 3JSPA 5DUIA 2NNNA 3RYRA 4M72A 2OD5A 2HKXA 3WE2A 1P4AA 2ZO4A 4WX9A 3M8FA 1TW3A 4RS8A 2K4BA 2DQLA 1I6XA 2ZNYA 1RI7A 4M9XA 3V7CA 5HLHA 2MH2A 3I58A 2ZCWA 3T8RA 1BI3A 2GA2A 2L3DA 1ZRFA 2XAQA 3GF2A 1FLIA 2BV6A 3SQNA 5D6EA 1B6AA 4P9UA 3KP2A 2EFNA 4KA4A 2P4WA 4I2OA 3ZPLA 1Z91A 4WXCA 3DKWA 1YS7A 4BHPA 4ASNA 1SD6A 5DV5A 2E7XA 4RGSA 4WF2A 5IT3A 4Q48A 3MQ0A 1HBXG 2MC3A 4KICA 2MLKA 1ZRDA 1T38A 3FXQA 4RB0A 1UFMA 3K1PA 1WI9A 1MD0A 2HEOA 1FBSA 5KK1A 1LDJA 5HLGA 4AIHA 3K0LA 3MZHA 2HOEA 4Y15A 3WU0A 4Y13A 3TOBA 4FX4A 2BBYA 3ULQB 3Q5FA 2DT5A 4EMSA 1K79A 2QZ8A 2RDPA 3CTAA 2MA3A 5HS8A 1B4AA 2M30A 3FF5A 5E1XA 1UB9A 3WTWC 2XGXA 2IA2A 4LB6B 2FNPA 2JT1A 1XSXA 4PDKA 3DPTA 5H6QA 2P5VA 3U2RA 2ZFWA 1JHFA 4L9TA 2VONA 2A3SA 1YYVA 5FFZA 3F72A 2VXZA 1Q1HA 3R4KA 2PI0A 5HVQC 4NB5A 4E70A 1TNTA 2HZTA 5FD6A 2O0YA 2XAFA 4MEYF 2L54A 1FBQA 5LEKA 2F5CA 2GAUA 3I4PA 2EV6A 4K2EA 1EH8A 1A04A 3GXOA 4KFCA 3E6BA 5DD4A 1R23A 4Q4ZF 4BAYA 1FPQA 1BI2A 1FT9A 5D4RA 1UHMA 2IVMA 3WGGA 1D8JA 4KUMA 4UVBA 5EEHA 3WTXC 3EQLF 2XAJA 4B8XA 1SD7A 5A2QK 2E1NA 4YIFA 5LGTA 1IN7A 2DI3A 4LK0F 4UXNA 2PN6A 5LRSA 4UNOA 4YFXF 3I5UA 3T1BA 1QO0D 1U5TC 4EJOA 2BYVE 2LF8A 4HV6A 2VT2A 1UHWA 2W85A 5CVIA 1SD4A 1S8NA 2EFQA 4UV8A 2YX4A 3EYYA 3SZPA 2FF4A 4EQQA 2GXBA 1EV7A 4U88A 3FM3A 1R00A 2L4AA 1VTNC 1SAXA 4OIQF 5D6FA 1KU9A 2D1HA 2VOOA 1K78B 5ERIA 3HUGA 5D5VB 2EA4A 3ZN0A 3HTUA 2CWEA 4KT5C 1Z7UA 1G3YA 3JTGA 3SZTA 3JW4A 2DU9A 4ZZDA 2DFIA 1T0FA 2NS0A 3IRRA 3QU6A 3JAMK 3IRQA 1QNTA 3LA7A 1JXSA 2F5DA 4ZYHA 5AIPA 2PMHA 4L5JA 4BYYA 3IC7A 4IF4A 4IVNA 2DPUA 3D5LA 1LJ9A 2RNJA 4ESJA 3C1DA 2CW0F 1V4RA 4BH9A 2OAZA 4EV0A 1U5TB 4FT8A 4MGRA 4I98B 4M6YA 2H27A 5BPDA 2HQRA 3QU3A 1DDNA 4L9NA 1LVAA 3CUQC 4MEXF 3KCCA 2K7LA 4CDGA 2D1VA 3E6CC 2IJLA 1F9NA 5LBQA 1EH7A 2K4JA 3RI4A 3C18A 4HQMA 2JSCA 2RN7A 3L09A 2FMYA 2KIUA 1MDMB 1J59A 5IT9Z 1ZREA 3F3XA 4KDPA 4HLYA 1P2FA 3CLOA 3KFWX 1PP7U 4LMYA 5CVVA 1OYYA 1Y0UA 3WTZA 5D5UB 2HTJA 5LGUA 1SD5A 1I27A 3ECOA 1DPRA 2P6SA 3RPQA 2A5YB 4RAZA 3DV8A 5L3DA 1IN6A 2QBYB 2F5FA 2OU2A 3RKXA 4I0BA 2J5OA 1W4MA 1ZAOA 1YQAA 3FX3A 4EM2A 1QGPA 5LHHA 2CG4A 2ZMEB 3FMSA 3BY6A 1HW1A 2VC0A 1CF7B 3H3ZA 2KIFA 4AD9A 2FBKA 3DFGA 3RDIA 4KYWA 2OZUA 3J80Z 2HDCA 4EVIA 3GZ5A 2VC1A 2OBPA 3Q9SA 2D45A 1XB4A 1IN4A 3CUQA 4HLXA 5ICCA 1MJBA 1WQ2A 3W6JB 1KYZA 2K86A 2FOKA 3CO7C 1HKTA 4OMYA 4A0ZA 5E8IA 3LAPA 5ILUA 3ABTA 2HTSA 5ILVA 5TJJA 5F1RA 1O3SA 1U3EM 1XMAA 1R36A 2JRTA 3BWGA 3QPHA 2FEZA 2FE3A 1CGPA 1TTYA 4M9ZA 5L3CA 2HYGD 3F8NA 1SFUA 1I1GA 2DTRA 2F5EA 1O3TA 2VBYA 4KN7X 2X0LA 4I09A 2KJBA 1LNWA 3K1NA 2XUBA 3F21A 2H6CA 3R0AA 3KEQA 1YG2A 4JQFA 2YR2A 3LQQA 1KQ9A 2O03A 3W6KB 4EJUA 2FQ3A 4MQVA 2DLLA 5E1ZB 4OIRF 3WE3A 3CUOA 1GXQA 1IW7F 2L02A 4YG2F 2XKOA 3T5XA 4U7BA 3GFJA 4A6DA 2EV5A 3J80K 4G7OF 4WWCA 4UVCA 3WTVC 1XGOA 2GQQA 3L7WA 3RYPA 1HKQA 4EJVA 1KQ8A 1IXSB 2ADUA 4N0BA 5DD8A 2BGCA 1I1SA 3ZMZA 1XSVA 3SHFA 4RAYA 4LG0B 2D2WA 2VBWA 2W24A 3R60A 5AIQA 1TBXA 2PMUA 4HX4A 3P9KA 1T6SA 3WTSC 2BEOA 2M5WA 2DPDA 3EDPA 4IHTA 2ESNA 4KN4X 3G73A 1F5TA 2VBZA 3I64A 3LFKA 3I53A 2IPQX 3ZMVA 4GGGA 1ZRCA 3FHZA 3ZMTA 1XCBA 5HS7A 4HBLA 1KU7A 3E3VA 4ZH4F 2DBBA 3QP6A 5H6RA 4L0ZB 3V8KA 1XMKA 4YIIA 4M73A 4GCVA 2ISZA 5BS6A 2XHKA 2JPCA 4OMZA 5CJ9A 4YFNF 3AAFA 6PAXA 3TOAA 3GX4X 2VE8A 1Z6RA 3JSOA 4JBAA 2L4MA 1AOYA 4PGHA 2MLGA 1JE8A 5D5WB 1Z6TA 4BHCA 2AXLA 4G6DA 3O6BB 3HSRA 3RKYA 1S7OA 3MWMA 1B9MA 4P5OA 3HHHA 4UUVA 4IPAA 4KMUX 5HDNA 5L3BA 2Z5UA 1XD7A 3I71A 4CICA 2HYFA 2CGPA 5LEJA 2MH9A 2EFOA 2A68F 5DEQA 4A2UA 1RIOH 4LLGF 2H09A 3BROA 2IW5A 3ERED 3B73A 3NEUA 4DQ2A 1R5GA 3KE2A 1PDNC 5LLQA 1MKMA 2RGVA 3MCZA 4AIKA 2EWNA 1MJ9A 3E6DA 2FSWA 5HLIA 2ZKZA 4LGWA 3R61A 4U7DA 1MZBA 2DQRA 5JVTA 3KP5A 1T98A 1YIOA 4S05A 2COMA 3R0JA 3IWZA 1ON1A 3BP8A 2KKOA 2W57A 5K5OA 2CYYA 5BOXA 4L0YB 3CJNA 5J6XA 4HW0A 1OR7A 2ZBKA 2C6YA 2FMLA 2GXGA 2V1XA 1FSEA 4GXOA 3FMRA 5ED4A 4I02A 2Z99A 2F2EA 1HSJA 4R8HA 3RPUA 4LLNA 2M87A 3N4MA 3FMQA 4OIPF 3ZN1A 2NNYA 2ETHA 3WG9A 1J0RA 1L3LA 1KU2A 1WKMA 5FD5A 1W5SA 3MZYA 4P9FA 3O2PE 3D0SA 4HX7A 3EYIA 1YW8A 2R7DA 4RGRA 2V1UA 4KIBA 4EGZA 1BIBA 1FY7A 1YS6A 5FB2A 1IRGA 4OIOF 4BNCA 4CXFA 1W7PD 5F6FA 4EGYA 2PFBA 4HF2A 2UXXA 3VB2A 3F8FA 2G7HA 2R7FA 4RGXA 3DF8A 3KP4A 4HX8A 1RUOA 4KMFA 2Z33A 2EA2A 1DUXC 2KJCA 1ZG3A 1ZN2A 4MTDA 1X3UA 3DEUA 2FA5A 2QVOA 3GW2A 2FU4A 2ELHA 5L3FA 1BC8C 2J5PA 2KRFA 2WV0A 3IHUA 3PQKA 4JK1X 2Q8KA 1R58A 4HQEA 3HHGA 3L9FA 3ABUA 2XV4S 3EUHA 5HS9A 1F4KA 4HF0A 4D0PA 5E18F 3GFLA 3T8TA 3F22A 2XKPA 3MEXA 3LSTA 3G3ZA 3OOPA 2PLYA 1S29A 1XGMA 2HR3A 2OQGA 3M9AA 3V7SA 5H20A 4CHUA 3PFIA 1LEBA 4ENNA 5JI6A 4LK1F 4CO8A 4O6JA 5D8LB 1BM9A 2VOPA 1QPMA 5FGMA 1T39A 4MNUA 1JGSA 4S04A 2X4HA 1PUEE 2JPBA 3BPXA 4U0VA 4L18B 3GYHX 4EM1A 3E5UA 4ZZLA 3DXJF 4PCQA 1FOKA 5CVJA 1TQIA 4GYGA 1HQCA 2A07F 5FO5A 5DDGA 5LRRA 3E5XA 4UHTA 2E7WA 1HW5A 1ZH5A 2QQ9A 2B0LA 2XASA 1TQPA 2EFPA 2H6BA 4U0YA 1J5YA 1J2XA 1R1TA 2FBIA 3ECHA 2P5KA 2RKHA 4LG0A 2YU3A 5DCFA 2GZWA 4R1HA 2FBHA 3JTHA 4HDUA 3E6MA 3WGIA 2OA4A 3KLOA 4UV9A 1GVJA 2VN2A 3CDHA 4LJZF 1FX7A 2LF7A 2FRHA 2MBFA 4M71A 2IRFG 1KGSA 2CSOA 1ZARA 3FXUA 4WK8F 2ZNZA 2IP2A 4G7HF 1REPC 4G6QA 3J7AO 3HRMA 4NQWA 4I0AA 3TO7A 2QQAA 5FLXK 3C7JA 4ZYDA 2OZ6A 3M7GA 3QAHA 1J9IA 3I0TA 3SFZA 1H9GA 2PG4A 1FWZA 3BJOA 2M1BA 3TO6A 1ULYA 1BIAA 3WU1B 5BMZA 2V79A 2P7VB 1BN5A 4F7ZA 4ETSA 4CZZA 3R6SA 1USSA 4HV5A 3K9TA 3VEPA 2MD5A 1SFEA 3QP5A 1WSUA 4UVAA 1YTYA 1SFXA 4N9IA 5TRDA 3I59B 2STWA 3GO5A 4A6EA 1O3RA 1W7PA 4FX0A 5KVRA 1P92A 3BJ6A 3RJPA 3K69A 2HS5A 2A69F 4L9JA 1YW9A 1ODDA 3DP7A 3TDUC 3GLXA 3CUQB 2XAHA 1DPUA 3B02A 5DUKA 3LA3A 2UZKA 3LQRA 1LEAA 3HIFA 2IA1A 3HRSA 4L9VA 2EK5A 3NQOA 2QM3A 3KEOA 3F6VA 1YLFA 3ZMUA 4CYDA 3WTUC 2LSOA 3IWFA 3P7NA 2DK8A 1E2XA 4R79A 3MFKA 3GEZA 3L00A 1JHHA 2GA1A 4L5IA 3HRUA 4M6XA 2RVCA 4YFKF 4Q5SF 1S3JA 1R1UA 3GZ6A 2LDUA 1MJAA 2HKOA 1P6RA 1EH6A 2FNAA 3BOQA 1XDSA 4RB3C 1LDDA 1STZA 2JZYA 3VODA 5K1YA 3K2ZA 3V7RA 3E5QA 3KETA 1RZ4A 4G8XA 1YW7A 5L3GA 1USTA 1KQ0A 1D3YA 1W7PB 4RB2C 2O61A 4HDVA 5D5XB 3LAJA 1R7JA 3J81Z 3PQJA 3GWZA 3BZ6A 2HQNA 1BC7C 2CFXA 3H92A 1P4XA 5K5QA 1ZYRF 3Q9VA 4ENMA 2H94A 2XROA 1HW2A 1U8RA 4NHJA 3EETA 4XBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDU A;  4EM0 B;  4AIJ A;  2L01 A;  1O7L A;  1NHA A;  4HOB A;  1G3W A;  1ZG5 A;  5CYV A;  4IJA A;  2P7C B;  1IN5 A;  5F64 A;  2HFH A;  2PEX A;  1TNS A;  4HYE A;  3U1D A;  1Z9C A;  1BOA A;  3ZMS A;  3RIR A;  4IXA A;  4A5M A;  5CLS A;  2WTE A;  2Z9O A;  2LNB A;  2RC4 A;  3GFM A;  4QLC U;  1YO5 C;  2EJR A;  1TLH B;  4GO1 A;  4M74 A;  3WOD F;  2QQB A;  5L3E A;  1T2K A;  3ZQ7 A;  4ENK A;  3I54 A;  1U5T A;  1IRF A;  2YSR A;  2ZXJ A;  1QZY A;  4Q47 A;  2V1D A;  3CO6 C;  1Z1D A;  3V8L A;  2RQP A;  2K27 A;  1BJA A;  1XGN A;  1F1Z A;  4BQA A;  3IL2 A;  3GFI A;  3O3K A;  4RGU A;  1TW2 A;  1FSH A;  4I7H A;  5ILS A;  3HSF A;  2RV8 A;  2K02 A;  3ZMD A;  5HOO A;  1FBU A;  3KZY A;  2LKP A;  3F23 A;  1V3F A;  4P96 A;  1U78 A;  4ZYG A;  2A6H F;  2EB7 A;  5J8C A;  1L0O C;  2G7U A;  1K78 A;  1CF7 A;  3I59 A;  4BXU A;  2ZME A;  1ZGJ A;  4ENJ A;  4I01 A;  3VFZ A;  4XLN F;  2V9V A;  3F8M A;  5FLX Z;  3M1E A;  4LLL A;  4MHG A;  1PP8 F;  1FYM A;  1P4W A;  3ROU A;  3TO9 A;  1B59 A;  1R5H A;  1E17 A;  3VOE A;  3COA C;  1IF1 A;  3BDD A;  3TDZ C;  4RB1 A;  3ML6 A;  4HZF A;  3KP6 A;  5DCM A;  1D5V A;  2GIV A;  1RUN A;  2XRN A;  4Y17 A;  1BI1 A;  1FC3 A;  4BHB A;  1GHC A;  2M45 A;  3GUD A;  4G7Z F;  3F6O A;  1IZ1 A;  1QZZ A;  1U2W A;  1AWC A;  2ISY A;  1XSD A;  1XCV A;  2WWY A;  1B9N A;  2OQR A;  4LD5 A;  1C0W A;  4LB5 A;  2TDX A;  3SXY A;  3QPT A;  3N97 A;  3FWE A;  4A0X A;  1ON2 A;  5HDK A;  5LHI A;  1KU3 A;  1LDK B;  2UXN A;  3IKT A;  4KIG A;  1FYK A;  3WGH A;  1FP2 A;  2QEN A;  1OYI A;  4MQ9 F;  3F8C A;  4OIN F;  4XSZ F;  4P55 A;  1ZLK A;  1O3Q A;  2W84 A;  3KZZ A;  3KLN A;  5BQT A;  1H9T A;  3ELK A;  2Q2E A;  2QUF A;  3P9C A;  4A12 A;  2HGC A;  3F8B A;  5E20 A;  2P8T A;  1DP7 P;  1HXD A;  3S2W A;  4KIF A;  5D4S A;  4A5N A;  4ON0 A;  4U0W A;  5JHU A;  2DAO A;  1R1V A;  3TQN A;  1B1B A;  4QWQ A;  2W25 A;  3K1M A;  3NRV A;  4WCG A;  1I5Z A;  4OOI A;  3IKV A;  3T0Y A;  4IRG A;  4HAM A;  1HST A;  3LA2 A;  2R3S A;  2GWR A;  2V6C A;  2PQ8 A;  5CVU A;  5DCM B;  3HYI A;  2UWM A;  4O5V A;  1K7A A;  5DYM A;  3HSE A;  2A61 A;  4PGG A;  5IT9 K;  1H0M A;  4A0Y A;  1Z05 A;  3DPL C;  3LWF A;  1S7A A;  3GVA A;  4DNC A;  2P6T A;  4ESF A;  1R22 A;  4FHT A;  1HKS A;  2JTV A;  4KNY A;  2QYO A;  5D8K B;  1J75 A;  3FZV A;  5EEG A;  4IHS A;  1XN7 A;  1SMT A;  2PBI A;  3WTT C;  1ZLJ A;  1IAW A;  5LHG A;  3JAM Z;  3ISP A;  1FZP B;  4PZJ A;  3FM5 A;  5ICG A;  2Y75 A;  3L2C A;  1W5T A;  4EJW A;  1OMI A;  1G3T A;  3V4G A;  3WTY C;  2NRA C;  2HWV A;  3BPV A;  2XVC A;  4LFU A;  2DW4 A;  4IRI A;  1OKR A;  4ZYE A;  1IXC A;  2A6E F;  1FNN A;  1TQM A;  1ZHF A;  2STT A;  1XGS A;  5E1W A;  4HF1 A;  5AON A;  2IT0 A;  3DQV C;  5JFR A;  5BPI A;  1QBJ A;  1OYW A;  3HOT A;  2Z3Y A;  2O6G E;  2IA0 A;  3QRF F;  4TV7 A;  4AWX B;  2O3F A;  1G4D A;  2VBX A;  5FFX A;  3REO A;  2G9W A;  4WXD A;  4O3M A;  5E17 F;  2AS5 F;  1LB2 A;  1G6N A;  2WC2 A;  2YPR A;  4N9H A;  5A2Q Z;  3H3U A;  1SMY F;  3M8E A;  2P5L C;  1ZG1 A;  5E8G A;  2O8X A;  1FP1 D;  1WWX A;  1ZGA A;  2VE9 A;  3RTR A;  2DO7 A;  1O57 A;  4G9Y A;  3HRT A;  2DK5 A;  5CVR A;  4EJT A;  1FYL A;  1LQ1 A;  2ESH A;  2Y0M A;  2M8E A;  1MDM A;  1BBY A;  3C3W A;  1BI0 A;  2NAZ A;  4XRF A;  4HA8 A;  1D8K A;  5LGN A;  3ZP5 A;  1IUY A;  1UCR A;  3QOP A;  3J81 K;  2BE5 F;  3E97 A;  1GXP A;  3V8J A;  3HOS A;  1WRJ A;  2XAG A;  3MAJ A;  2VOD A;  2XIG A;  1O7F A;  4B09 A;  2EV0 A;  4XLP F;  1MGT A;  4IRH A;  5JR3 A;  1KYW A;  3TKY A;  1OPC A;  3BJA A;  5ICE A;  4MTE A;  5K5R A;  2YX7 A;  1U6G A;  4XSX F;  4GYI A;  1YFH A;  3FXR A;  4OU0 A;  2VT3 A;  4AVP A;  3TGN A;  2Q0O A;  4Z2Y A;  2FXA A;  2KIM A;  2NYX A;  4G94 A;  4ESB A;  1S6L A;  1IN8 A;  1G3S A;  1KA8 A;  4M9S A;  1QQI A;  3HTS B;  2QWW A;  2QBY A;  2ZJ2 A;  3OV8 A;  5J8F A;  2Y48 A;  2EFW A;  3KP7 A;  3RKW A;  4H0E A;  1RNL A;  3KP3 A;  1ONV A;  5ICF A;  2E1C A;  1IXR C;  3U9G A;  4CGZ A;  4WXH A;  3P9I A;  1K6O A;  2CO5 A;  2CQK A;  2PJP A;  1J7K A;  5HDG A;  2QLZ A;  2ACJ A;  3JSP A;  5DUI A;  2NNN A;  3RYR A;  4M72 A;  2OD5 A;  2HKX A;  3WE2 A;  1P4A A;  2ZO4 A;  4WX9 A;  3M8F A;  1TW3 A;  4RS8 A;  2K4B A;  2DQL A;  1I6X A;  2ZNY A;  1RI7 A;  4M9X A;  3V7C A;  5HLH A;  2MH2 A;  3I58 A;  2ZCW A;  3T8R A;  1BI3 A;  2GA2 A;  2L3D A;  1ZRF A;  2XAQ A;  3GF2 A;  1FLI A;  2BV6 A;  3SQN A;  5D6E A;  1B6A A;  4P9U A;  3KP2 A;  2EFN A;  4KA4 A;  2P4W A;  4I2O A;  3ZPL A;  1Z91 A;  4WXC A;  3DKW A;  1YS7 A;  4BHP A;  4ASN A;  1SD6 A;  5DV5 A;  2E7X A;  4RGS A;  4WF2 A;  5IT3 A;  4Q48 A;  3MQ0 A;  1HBX G;  2MC3 A;  4KIC A;  2MLK A;  1ZRD A;  1T38 A;  3FXQ A;  4RB0 A;  1UFM A;  3K1P A;  1WI9 A;  1MD0 A;  2HEO A;  1FBS A;  5KK1 A;  1LDJ A;  5HLG A;  4AIH A;  3K0L A;  3MZH A;  2HOE A;  4Y15 A;  3WU0 A;  4Y13 A;  3TOB A;  4FX4 A;  2BBY A;  3ULQ B;  3Q5F A;  2DT5 A;  4EMS A;  1K79 A;  2QZ8 A;  2RDP A;  3CTA A;  2MA3 A;  5HS8 A;  1B4A A;  2M30 A;  3FF5 A;  5E1X A;  1UB9 A;  3WTW C;  2XGX A;  2IA2 A;  4LB6 B;  2FNP A;  2JT1 A;  1XSX A;  4PDK A;  3DPT A;  5H6Q A;  2P5V A;  3U2R A;  2ZFW A;  1JHF A;  4L9T A;  2VON A;  2A3S A;  1YYV A;  5FFZ A;  3F72 A;  2VXZ A;  1Q1H A;  3R4K A;  2PI0 A;  5HVQ C;  4NB5 A;  4E70 A;  1TNT A;  2HZT A;  5FD6 A;  2O0Y A;  2XAF A;  4MEY F;  2L54 A;  1FBQ A;  5LEK A;  2F5C A;  2GAU A;  3I4P A;  2EV6 A;  4K2E A;  1EH8 A;  1A04 A;  3GXO A;  4KFC A;  3E6B A;  5DD4 A;  1R23 A;  4Q4Z F;  4BAY A;  1FPQ A;  1BI2 A;  1FT9 A;  5D4R A;  1UHM A;  2IVM A;  3WGG A;  1D8J A;  4KUM A;  4UVB A;  5EEH A;  3WTX C;  3EQL F;  2XAJ A;  4B8X A;  1SD7 A;  5A2Q K;  2E1N A;  4YIF A;  5LGT A;  1IN7 A;  2DI3 A;  4LK0 F;  4UXN A;  2PN6 A;  5LRS A;  4UNO A;  4YFX F;  3I5U A;  3T1B A;  1QO0 D;  1U5T C;  4EJO A;  2BYV E;  2LF8 A;  4HV6 A;  2VT2 A;  1UHW A;  2W85 A;  5CVI A;  1SD4 A;  1S8N A;  2EFQ A;  4UV8 A;  2YX4 A;  3EYY A;  3SZP A;  2FF4 A;  4EQQ A;  2GXB A;  1EV7 A;  4U88 A;  3FM3 A;  1R00 A;  2L4A A;  1VTN C;  1SAX A;  4OIQ F;  5D6F A;  1KU9 A;  2D1H A;  2VOO A;  1K78 B;  5ERI A;  3HUG A;  5D5V B;  2EA4 A;  3ZN0 A;  3HTU A;  2CWE A;  4KT5 C;  1Z7U A;  1G3Y A;  3JTG A;  3SZT A;  3JW4 A;  2DU9 A;  4ZZD A;  2DFI A;  1T0F A;  2NS0 A;  3IRR A;  3QU6 A;  3JAM K;  3IRQ A;  1QNT A;  3LA7 A;  1JXS A;  2F5D A;  4ZYH A;  5AIP A;  2PMH A;  4L5J A;  4BYY A;  3IC7 A;  4IF4 A;  4IVN A;  2DPU A;  3D5L A;  1LJ9 A;  2RNJ A;  4ESJ A;  3C1D A;  2CW0 F;  1V4R A;  4BH9 A;  2OAZ A;  4EV0 A;  1U5T B;  4FT8 A;  4MGR A;  4I98 B;  4M6Y A;  2H27 A;  5BPD A;  2HQR A;  3QU3 A;  1DDN A;  4L9N A;  1LVA A;  3CUQ C;  4MEX F;  3KCC A;  2K7L A;  4CDG A;  2D1V A;  3E6C C;  2IJL A;  1F9N A;  5LBQ A;  1EH7 A;  2K4J A;  3RI4 A;  3C18 A;  4HQM A;  2JSC A;  2RN7 A;  3L09 A;  2FMY A;  2KIU A;  1MDM B;  1J59 A;  5IT9 Z;  1ZRE A;  3F3X A;  4KDP A;  4HLY A;  1P2F A;  3CLO A;  3KFW X;  1PP7 U;  4LMY A;  5CVV A;  1OYY A;  1Y0U A;  3WTZ A;  5D5U B;  2HTJ A;  5LGU A;  1SD5 A;  1I27 A;  3ECO A;  1DPR A;  2P6S A;  3RPQ A;  2A5Y B;  4RAZ A;  3DV8 A;  5L3D A;  1IN6 A;  2QBY B;  2F5F A;  2OU2 A;  3RKX A;  4I0B A;  2J5O A;  1W4M A;  1ZAO A;  1YQA A;  3FX3 A;  4EM2 A;  1QGP A;  5LHH A;  2CG4 A;  2ZME B;  3FMS A;  3BY6 A;  1HW1 A;  2VC0 A;  1CF7 B;  3H3Z A;  2KIF A;  4AD9 A;  2FBK A;  3DFG A;  3RDI A;  4KYW A;  2OZU A;  3J80 Z;  2HDC A;  4EVI A;  3GZ5 A;  2VC1 A;  2OBP A;  3Q9S A;  2D45 A;  1XB4 A;  1IN4 A;  3CUQ A;  4HLX A;  5ICC A;  1MJB A;  1WQ2 A;  3W6J B;  1KYZ A;  2K86 A;  2FOK A;  3CO7 C;  1HKT A;  4OMY A;  4A0Z A;  5E8I A;  3LAP A;  5ILU A;  3ABT A;  2HTS A;  5ILV A;  5TJJ A;  5F1R A;  1O3S A;  1U3E M;  1XMA A;  1R36 A;  2JRT A;  3BWG A;  3QPH A;  2FEZ A;  2FE3 A;  1CGP A;  1TTY A;  4M9Z A;  5L3C A;  2HYG D;  3F8N A;  1SFU A;  1I1G A;  2DTR A;  2F5E A;  1O3T A;  2VBY A;  4KN7 X;  2X0L A;  4I09 A;  2KJB A;  1LNW A;  3K1N A;  2XUB A;  3F21 A;  2H6C A;  3R0A A;  3KEQ A;  1YG2 A;  4JQF A;  2YR2 A;  3LQQ A;  1KQ9 A;  2O03 A;  3W6K B;  4EJU A;  2FQ3 A;  4MQV A;  2DLL A;  5E1Z B;  4OIR F;  3WE3 A;  3CUO A;  1GXQ A;  1IW7 F;  2L02 A;  4YG2 F;  2XKO A;  3T5X A;  4U7B A;  3GFJ A;  4A6D A;  2EV5 A;  3J80 K;  4G7O F;  4WWC A;  4UVC A;  3WTV C;  1XGO A;  2GQQ A;  3L7W A;  3RYP A;  1HKQ A;  4EJV A;  1KQ8 A;  1IXS B;  2ADU A;  4N0B A;  5DD8 A;  2BGC A;  1I1S A;  3ZMZ A;  1XSV A;  3SHF A;  4RAY A;  4LG0 B;  2D2W A;  2VBW A;  2W24 A;  3R60 A;  5AIQ A;  1TBX A;  2PMU A;  4HX4 A;  3P9K A;  1T6S A;  3WTS C;  2BEO A;  2M5W A;  2DPD A;  3EDP A;  4IHT A;  2ESN A;  4KN4 X;  3G73 A;  1F5T A;  2VBZ A;  3I64 A;  3LFK A;  3I53 A;  2IPQ X;  3ZMV A;  4GGG A;  1ZRC A;  3FHZ A;  3ZMT A;  1XCB A;  5HS7 A;  4HBL A;  1KU7 A;  3E3V A;  4ZH4 F;  2DBB A;  3QP6 A;  5H6R A;  4L0Z B;  3V8K A;  1XMK A;  4YII A;  4M73 A;  4GCV A;  2ISZ A;  5BS6 A;  2XHK A;  2JPC A;  4OMZ A;  5CJ9 A;  4YFN F;  3AAF A;  6PAX A;  3TOA A;  3GX4 X;  2VE8 A;  1Z6R A;  3JSO A;  4JBA A;  2L4M A;  1AOY A;  4PGH A;  2MLG A;  1JE8 A;  5D5W B;  1Z6T A;  4BHC A;  2AXL A;  4G6D A;  3O6B B;  3HSR A;  3RKY A;  1S7O A;  3MWM A;  1B9M A;  4P5O A;  3HHH A;  4UUV A;  4IPA A;  4KMU X;  5HDN A;  5L3B A;  2Z5U A;  1XD7 A;  3I71 A;  4CIC A;  2HYF A;  2CGP A;  5LEJ A;  2MH9 A;  2EFO A;  2A68 F;  5DEQ A;  4A2U A;  1RIO H;  4LLG F;  2H09 A;  3BRO A;  2IW5 A;  3ERE D;  3B73 A;  3NEU A;  4DQ2 A;  1R5G A;  3KE2 A;  1PDN C;  5LLQ A;  1MKM A;  2RGV A;  3MCZ A;  4AIK A;  2EWN A;  1MJ9 A;  3E6D A;  2FSW A;  5HLI A;  2ZKZ A;  4LGW A;  3R61 A;  4U7D A;  1MZB A;  2DQR A;  5JVT A;  3KP5 A;  1T98 A;  1YIO A;  4S05 A;  2COM A;  3R0J A;  3IWZ A;  1ON1 A;  3BP8 A;  2KKO A;  2W57 A;  5K5O A;  2CYY A;  5BOX A;  4L0Y B;  3CJN A;  5J6X A;  4HW0 A;  1OR7 A;  2ZBK A;  2C6Y A;  2FML A;  2GXG A;  2V1X A;  1FSE A;  4GXO A;  3FMR A;  5ED4 A;  4I02 A;  2Z99 A;  2F2E A;  1HSJ A;  4R8H A;  3RPU A;  4LLN A;  2M87 A;  3N4M A;  3FMQ A;  4OIP F;  3ZN1 A;  2NNY A;  2ETH A;  3WG9 A;  1J0R A;  1L3L A;  1KU2 A;  1WKM A;  5FD5 A;  1W5S A;  3MZY A;  4P9F A;  3O2P E;  3D0S A;  4HX7 A;  3EYI A;  1YW8 A;  2R7D A;  4RGR A;  2V1U A;  4KIB A;  4EGZ A;  1BIB A;  1FY7 A;  1YS6 A;  5FB2 A;  1IRG A;  4OIO F;  4BNC A;  4CXF A;  1W7P D;  5F6F A;  4EGY A;  2PFB A;  4HF2 A;  2UXX A;  3VB2 A;  3F8F A;  2G7H A;  2R7F A;  4RGX A;  3DF8 A;  3KP4 A;  4HX8 A;  1RUO A;  4KMF A;  2Z33 A;  2EA2 A;  1DUX C;  2KJC A;  1ZG3 A;  1ZN2 A;  4MTD A;  1X3U A;  3DEU A;  2FA5 A;  2QVO A;  3GW2 A;  2FU4 A;  2ELH A;  5L3F A;  1BC8 C;  2J5P A;  2KRF A;  2WV0 A;  3IHU A;  3PQK A;  4JK1 X;  2Q8K A;  1R58 A;  4HQE A;  3HHG A;  3L9F A;  3ABU A;  2XV4 S;  3EUH A;  5HS9 A;  1F4K A;  4HF0 A;  4D0P A;  5E18 F;  3GFL A;  3T8T A;  3F22 A;  2XKP A;  3MEX A;  3LST A;  3G3Z A;  3OOP A;  2PLY A;  1S29 A;  1XGM A;  2HR3 A;  2OQG A;  3M9A A;  3V7S A;  5H20 A;  4CHU A;  3PFI A;  1LEB A;  4ENN A;  5JI6 A;  4LK1 F;  4CO8 A;  4O6J A;  5D8L B;  1BM9 A;  2VOP A;  1QPM A;  5FGM A;  1T39 A;  4MNU A;  1JGS A;  4S04 A;  2X4H A;  1PUE E;  2JPB A;  3BPX A;  4U0V A;  4L18 B;  3GYH X;  4EM1 A;  3E5U A;  4ZZL A;  3DXJ F;  4PCQ A;  1FOK A;  5CVJ A;  1TQI A;  4GYG A;  1HQC A;  2A07 F;  5FO5 A;  5DDG A;  5LRR A;  3E5X A;  4UHT A;  2E7W A;  1HW5 A;  1ZH5 A;  2QQ9 A;  2B0L A;  2XAS A;  1TQP A;  2EFP A;  2H6B A;  4U0Y A;  1J5Y A;  1J2X A;  1R1T A;  2FBI A;  3ECH A;  2P5K A;  2RKH A;  4LG0 A;  2YU3 A;  5DCF A;  2GZW A;  4R1H A;  2FBH A;  3JTH A;  4HDU A;  3E6M A;  3WGI A;  2OA4 A;  3KLO A;  4UV9 A;  1GVJ A;  2VN2 A;  3CDH A;  4LJZ F;  1FX7 A;  2LF7 A;  2FRH A;  2MBF A;  4M71 A;  2IRF G;  1KGS A;  2CSO A;  1ZAR A;  3FXU A;  4WK8 F;  2ZNZ A;  2IP2 A;  4G7H F;  1REP C;  4G6Q A;  3J7A O;  3HRM A;  4NQW A;  4I0A A;  3TO7 A;  2QQA A;  5FLX K;  3C7J A;  4ZYD A;  2OZ6 A;  3M7G A;  3QAH A;  1J9I A;  3I0T A;  3SFZ A;  1H9G A;  2PG4 A;  1FWZ A;  3BJO A;  2M1B A;  3TO6 A;  1ULY A;  1BIA A;  3WU1 B;  5BMZ A;  2V79 A;  2P7V B;  1BN5 A;  4F7Z A;  4ETS A;  4CZZ A;  3R6S A;  1USS A;  4HV5 A;  3K9T A;  3VEP A;  2MD5 A;  1SFE A;  3QP5 A;  1WSU A;  4UVA A;  1YTY A;  1SFX A;  4N9I A;  5TRD A;  3I59 B;  2STW A;  3GO5 A;  4A6E A;  1O3R A;  1W7P A;  4FX0 A;  5KVR A;  1P92 A;  3BJ6 A;  3RJP A;  3K69 A;  2HS5 A;  2A69 F;  4L9J A;  1YW9 A;  1ODD A;  3DP7 A;  3TDU C;  3GLX A;  3CUQ B;  2XAH A;  1DPU A;  3B02 A;  5DUK A;  3LA3 A;  2UZK A;  3LQR A;  1LEA A;  3HIF A;  2IA1 A;  3HRS A;  4L9V A;  2EK5 A;  3NQO A;  2QM3 A;  3KEO A;  3F6V A;  1YLF A;  3ZMU A;  4CYD A;  3WTU C;  2LSO A;  3IWF A;  3P7N A;  2DK8 A;  1E2X A;  4R79 A;  3MFK A;  3GEZ A;  3L00 A;  1JHH A;  2GA1 A;  4L5I A;  3HRU A;  4M6X A;  2RVC A;  4YFK F;  4Q5S F;  1S3J A;  1R1U A;  3GZ6 A;  2LDU A;  1MJA A;  2HKO A;  1P6R A;  1EH6 A;  2FNA A;  3BOQ A;  1XDS A;  4RB3 C;  1LDD A;  1STZ A;  2JZY A;  3VOD A;  5K1Y A;  3K2Z A;  3V7R A;  3E5Q A;  3KET A;  1RZ4 A;  4G8X A;  1YW7 A;  5L3G A;  1UST A;  1KQ0 A;  1D3Y A;  1W7P B;  4RB2 C;  2O61 A;  4HDV A;  5D5X B;  3LAJ A;  1R7J A;  3J81 Z;  3PQJ A;  3GWZ A;  3BZ6 A;  2HQN A;  1BC7 C;  2CFX A;  3H92 A;  1P4X A;  5K5Q A;  1ZYR F;  3Q9V A;  4ENM A;  2H94 A;  2XRO A;  1HW2 A;  1U8R A;  4NHJ A;  3EET A;  4XBF A; 
#chains in the Genus database with same CATH topology
 1XDU A;  4EM0 B;  4AIJ A;  2L01 A;  3DLA A;  1O7L A;  2NOJ B;  1DGR M;  1NHA A;  1IUF A;  3D1N I;  3IH2 A;  4HOB A;  1G3W A;  2YUS A;  1ZG5 A;  5CYV A;  3E1S A;  4IJA A;  1V5F A;  2M7A A;  2P7C B;  1IN5 A;  5F64 A;  1IDZ A;  4F91 B;  2V1N A;  2HFH A;  2PEX A;  2HNH A;  1TNS A;  4AID A;  3AL0 C;  4HYE A;  3U1D A;  1Z9C A;  2WAF A;  1BOA A;  3ESW B;  3PNT A;  3QPL A;  5EG0 A;  3ZMS A;  3S2H J;  4M3G A;  3RIR A;  4IXA A;  2CV1 A;  3HDD A;  2EIJ H;  3CCQ I;  4A5M A;  3MKW B;  3MKL A;  2WTE A;  2KP6 A;  2EIN H;  5CLS A;  4J00 A;  2Z9O A;  2LNB A;  3U1K A;  3HB9 A;  2RC4 A;  1AA7 A;  1K6Y A;  1UHS A;  2OCC H;  3GFM A;  4QLC U;  2HYJ A;  4YEJ A;  3I55 I;  4RAG A;  2R7U A;  3BTC A;  1YO5 C;  4M3E A;  2F5V A;  2EJR A;  1TLH B;  2Y0S N;  3IAS 2;  4GO1 A;  2RQQ A;  4M74 A;  1VQK I;  1ZK8 A;  2VXD A;  1X1D A;  4W97 A;  3EUH C;  3WOD F;  2QQB A;  5L3E A;  1T2K A;  4BGD A;  1UMQ A;  3ZQ7 A;  3HXL A;  4PJ0 C;  4ENK A;  3I54 A;  1FMV A;  4IHV A;  3QOE A;  1FOW A;  1I39 A;  1U5T A;  1OQY A;  1SFO J;  1IRF A;  3DLL F;  3ONQ A;  2K9M A;  2YSR A;  2ZXJ A;  5J1U A;  4UUS B;  5GP9 A;  2V26 A;  1QZY A;  4RMN A;  2GIZ A;  4Q47 A;  2V1D A;  3CO6 C;  4B43 A;  1RET A;  1Z1D A;  3V8L A;  2RQP A;  2K27 A;  1BJA A;  1XGN A;  2F48 A;  1F1Z A;  4BQA A;  4B3X A;  3PNV A;  3WG7 H;  1LKX A;  3IL2 A;  3GFI A;  3PFY A;  3O3K A;  4RGU A;  3BCB A;  1TW2 A;  3AKZ A;  1FSH A;  4I7H A;  5ILS A;  2IXS A;  3O8G A;  3HSF A;  5CPR B;  2RV8 A;  1V54 H;  3IH3 A;  4KIT B;  3CME I;  4EEF G;  2K02 A;  4DZP A;  1SVL A;  2WAD A;  3ZMD A;  5HOO A;  1FBU A;  2JN6 A;  3KZY A;  2LKP A;  2R7T A;  3F23 A;  4MIM A;  5F0C A;  1V3F A;  4P96 A;  1U78 A;  4ZYG A;  1TWH J;  1EKE A;  3D5S C;  2A6H F;  2EB7 A;  5J8C A;  1L0O C;  1MIJ A;  2G7U A;  1S5L C;  3I3L A;  2V4J C;  1MND A;  5DM7 F;  2X6O A;  1K78 A;  1CF7 A;  3I59 A;  4BXU A;  4UY8 I;  3ZRG A;  4F55 A;  3RPU D;  1IC8 A;  2ZME A;  1ZGJ A;  4ENJ A;  1GDT A;  4I01 A;  3VFZ A;  3BTJ A;  3A4C A;  4F92 B;  4XLN F;  2V9V A;  3F8M A;  2JSP A;  4C3I J;  5FLX Z;  3JRA A;  3M1E A;  4LLL A;  2B63 J;  1BOB A;  2DOF A;  4MHG A;  3RQ4 A;  1PP8 F;  1FYM A;  1W36 C;  1P4W A;  2CFO A;  3QYB A;  3ROU A;  3TO9 A;  2R7R A;  4JX5 A;  2QSF X;  1B59 A;  2LY1 A;  2RNG A;  1R5H A;  1E17 A;  3VOE A;  3H9G A;  3COA C;  3OMY A;  1IF1 A;  3BDD A;  3TDZ C;  2CRG A;  2Z1D A;  1V55 H;  2GBY A;  4RB1 A;  1VI0 A;  2E5N A;  3ML6 A;  3OS2 A;  1U8B A;  4HZF A;  2VKV A;  3CDI A;  3KP6 A;  3JRG A;  3ZOB A;  3SEQ A;  5DCM A;  1D5V A;  1IV6 A;  3OL4 A;  2GIV A;  1X3Z B;  2HDW A;  2XRN A;  5JLX A;  1RUN A;  1YIJ I;  1CQT A;  4Y17 A;  5FLV A;  1BI1 A;  2NVX J;  3ZQL A;  3OIO A;  1FC3 A;  2JVH A;  3P5J A;  4BHB A;  5B5E C;  4N4N B;  2LBF A;  1GHC A;  1ORK A;  2M45 A;  3GTP J;  3GUD A;  4G7Z F;  3F6O A;  1TT5 B;  1IZ1 A;  3OYD A;  1VQN I;  1QZZ A;  2DJI A;  1U2W A;  1AWC A;  3HM5 A;  4AU7 A;  3CCM I;  1Z3X A;  2ISY A;  1XSD A;  2L2O A;  1XCV A;  3DKY A;  4LIV A;  1EA3 A;  5K7H A;  2WWY A;  3EPZ A;  1D0X A;  1B9N A;  1ETX A;  2OQR A;  4LD5 A;  2VKH A;  2EZL A;  1MNE A;  1RPW A;  1K83 J;  1C0W A;  4BL0 B;  4LB5 A;  2IAI A;  3LOC A;  5GAG J;  3BQY A;  1LUJ B;  2TDX A;  3SXY A;  3GTL J;  3I4N J;  3QPT A;  3N97 A;  3FWE A;  2DA1 A;  3KX2 A;  4A0X A;  2HOS A;  1ON2 A;  5HDK A;  3QPS A;  5LHI A;  1KU3 A;  1LDK B;  2WB1 A;  5EGO A;  2UXN A;  2R7W A;  3IKT A;  4KIG A;  1FYK A;  3WGH A;  1DGW Y;  1IV8 A;  3RZO J;  2DT6 A;  1FP2 A;  1Z21 A;  4IO9 F;  1M1E B;  2NVY J;  2VQL A;  2QEN A;  3LSK A;  4NNJ A;  1OYI A;  4MQ9 F;  2FQ4 A;  3F8C A;  2QA4 I;  3IV5 A;  1HOM A;  4YEL A;  4OIN F;  4XSZ F;  3B6C A;  4P55 A;  1ZLK A;  4BE1 A;  4XON A;  2DOE A;  1O3Q A;  3LSM A;  1FTT A;  3IUO A;  2W84 A;  1OR7 C;  3HZJ A;  4OAZ A;  3DBL B;  3KZZ A;  3KLN A;  5BQT A;  1LPQ A;  3H9Q A;  1H9T A;  2VJJ A;  4W1U A;  3ELK A;  2N8G A;  2Q2E A;  2QUF A;  3P9C A;  4A12 A;  1OJL A;  5FKK A;  5H2F C;  1X1B A;  2HGC A;  1OCT C;  3F8B A;  1WPK A;  5E20 A;  1I3A A;  2P8T A;  1HXD A;  1DP7 P;  3LFU A;  4C9Y A;  3S2W A;  2GOM A;  4KIF A;  3MKZ A;  2X1C A;  5D4S A;  4A5N A;  3HKZ N;  4ON0 A;  4BDY A;  4U0W A;  5JHU A;  2DAO A;  4Y4R A;  1R1V A;  2DDA A;  3TQN A;  1X2N A;  4I76 A;  4XLF A;  2K85 A;  1B1B A;  4QWQ A;  1SAN A;  2CUE A;  2W25 A;  2VUM J;  3K1M A;  3NRV A;  4IQ4 A;  2LY9 A;  3OS0 A;  4WCG A;  1I5Z A;  4OOI A;  3IKV A;  4IRG A;  3T0Y A;  4HAM A;  1W36 D;  1HST A;  3LA2 A;  2R3S A;  2GWR A;  2V6C A;  2PQ8 A;  3BCA A;  5M3M J;  2DFH A;  4XLE A;  4A3C J;  5CVU A;  3K2A A;  3OYK A;  5GTI C;  5DCM B;  2EZH A;  3HYI A;  4HNU A;  4QTR A;  2UWM A;  4O5V A;  2R4G A;  1K7A A;  5DYM A;  2KFD A;  3HSE A;  3G4S I;  3S15 J;  2A61 A;  1GUU A;  4PGG A;  4IHY A;  1ETW A;  2CH0 A;  2IGO A;  4BE0 A;  3N05 A;  5IT9 K;  2L9R A;  2LYC A;  1H0M A;  4A0Y A;  2R5Z A;  1Z05 A;  3HEF A;  3DPL C;  3LWF A;  1S7A A;  3GVA A;  1G2H A;  4DNC A;  4AVZ A;  2P6T A;  4ESF A;  1R22 A;  4FHT A;  3DTK A;  1HKS A;  2JTV A;  1JUM A;  4KNY A;  3AL0 B;  2QYO A;  2DA6 A;  3TBI A;  1G8X A;  5D8K B;  5FRM A;  1J75 A;  2I8D A;  3FZV A;  4KJZ A;  5EEG A;  4IHS A;  2F4O B;  2WV1 A;  1XN7 A;  3AG1 H;  4E6K G;  1SMT A;  2PBI A;  3WTT C;  1ZLJ A;  1IAW A;  1IO2 A;  3QWL A;  3W2W A;  5LHG A;  3JAM Z;  3L2R A;  3OYL A;  1R4M B;  3ISP A;  5HLT A;  3VSL A;  1Y56 A;  3HUG B;  1FZP B;  4PZJ A;  3FM5 A;  5ICG A;  3BG7 A;  2E5Z A;  2Y75 A;  3L2C A;  1W5T A;  2Q2E B;  4EJW A;  1OMI A;  2JA6 J;  1G3T A;  1WH5 A;  3V4G A;  3WTY C;  1VQ6 I;  3CMM A;  1D1B A;  4QPO A;  2VL8 A;  5C3E J;  2NRA C;  4FQG A;  2HWV A;  3BPV A;  1X1C A;  1T8I A;  2XVC A;  4LFU A;  2DW4 A;  1VQ7 I;  4IRI A;  5C44 J;  1OKR A;  1QHG A;  1TT0 A;  4ZYE A;  1IXC A;  1WJE A;  1YE9 A;  2A6E F;  3CCU I;  3RQI A;  1Q1V A;  5CQG A;  1FNN A;  1TQM A;  1ZHF A;  1WJD A;  2STT A;  1XGS A;  5E1W A;  3LMM A;  4XR6 A;  4HF1 A;  5AON A;  2GM4 A;  2IT0 A;  3DQV C;  5JFR A;  5BPI A;  4M6V A;  1MBE A;  1QBJ A;  4RAF A;  1OYW A;  3HOT A;  3L2U A;  2Z3Y A;  2O6G E;  1Y0N A;  1F43 A;  3SDG A;  2IA0 A;  3QRF F;  2ZJP F;  1POG A;  4TV7 A;  2IBD A;  2XF5 A;  1TL8 A;  4AWX B;  4E7J A;  2O3F A;  1G4D A;  1HLV A;  4LIU A;  2VBX A;  3Q0V A;  2L9V A;  5FFX A;  3REO A;  4S0H B;  1W0T A;  2KZV A;  4ITV A;  2G9W A;  3ZXS A;  4NQW B;  3H35 A;  4WXD A;  2NVU B;  2ZSH B;  4O3M A;  2V6E A;  1AKH B;  2E35 A;  2K9Q A;  4A93 J;  2AS5 F;  1LB2 A;  5E17 F;  1B8I B;  3DEE A;  3IH4 A;  5KHD A;  1DQU A;  4ZDO A;  1G6N A;  2FOW A;  2WC2 A;  2YPR A;  4N9H A;  1V5E A;  5A2Q Z;  1MMN A;  2EH3 A;  3H3U A;  2LOO A;  1SMY F;  4ABZ A;  5IPA A;  3M8E A;  4XKW A;  2VKD A;  2P5L C;  1UZC A;  1ZG1 A;  1JT0 A;  5E8G A;  1SAU A;  2O8X A;  3UR3 C;  1FP1 D;  1WWX A;  2XPV A;  2NVQ J;  3RCO A;  1ZGA A;  2WY7 Q;  4V2F A;  2VE9 A;  1QU3 A;  2E2H J;  4GDF A;  3RTR A;  2JRM A;  3A0B C;  5J1R A;  5CKT A;  1E3H A;  2DO7 A;  3M4O J;  1O57 A;  3F9K A;  4G9Y A;  3S1M J;  3HRT A;  2DK5 A;  5CVR A;  4EJT A;  2EIM H;  1VFC A;  1FYL A;  1LQ1 A;  2ESH A;  5J4V A;  4U87 A;  2Y0M A;  4YIR X;  2M8E A;  1MDM A;  4DJA A;  1BBY A;  1W5C C;  3C3W A;  5EZG A;  2DFF A;  1BI0 A;  2NAZ A;  2XPW A;  4XRF A;  3SJM A;  4HA8 A;  1D8K A;  5LGN A;  3ZP5 A;  4JX6 A;  1IUY A;  1UCR A;  3QOP A;  3J81 K;  2BE5 F;  2EZI A;  3E97 A;  2R92 J;  5IOZ A;  2W7N A;  2R7V A;  4E7S A;  2BHY A;  1GXP A;  3V8J A;  3J7A Y;  3HOS A;  2B7E A;  1WRJ A;  5EG0 B;  1W0U A;  2XAG A;  3MAJ A;  2VOD A;  2JUG A;  1XX5 A;  2XIG A;  3Q0W A;  1OCP A;  1O7F A;  2VKE A;  4B09 A;  2EV0 A;  2JMW A;  3FDY A;  3CJQ B;  4XLP F;  2YS9 A;  1MGT A;  4IRH A;  5JR3 A;  1KYW A;  4PJN A;  4V2G A;  3TKY A;  3X2Q H;  1OPC A;  3BJA A;  4IX7 A;  5ICE A;  4MTE A;  2DCE A;  4JP0 A;  5K5R A;  2YX7 A;  2A6T A;  2UUZ A;  3HOU J;  2I5U A;  1U6G A;  4XSX F;  4GYI A;  1YFH A;  2EBI A;  4DYC A;  3FXR A;  4OU0 A;  2VT3 A;  4CZC A;  2XPU A;  4AVP A;  5DS9 A;  1YX5 A;  4BJ6 C;  3FKJ A;  3BR6 A;  2ID6 A;  1PUF A;  1BW5 A;  2VIX A;  3CD6 I;  3TGN A;  2M0C A;  2Q0O A;  2VLA A;  4Z2Y A;  3DU6 A;  2FXA A;  2KIM A;  2NYX A;  4G94 A;  4ESB A;  3CF5 F;  2HDD A;  1S6L A;  1IN8 A;  1G3S A;  1EF4 A;  1KA8 A;  4M9S A;  1QQI A;  1YRN A;  1UAA A;  3HTS B;  4BJ5 C;  2M34 A;  2QWW A;  4FET A;  2QBY A;  2JK3 A;  2ZJ2 A;  3OIP A;  3OV8 A;  2WA0 A;  3H1C A;  5J8F A;  2NVT J;  2Y48 A;  2EFW A;  1VZ0 A;  3KP7 A;  3RKW A;  3L1P A;  1YHQ I;  4M3F A;  4H0E A;  1RNL A;  2XF7 A;  3KP3 A;  1ONV A;  2CS3 A;  3OYF A;  1RKT A;  5ICF A;  1AU7 A;  4B3A A;  3KPH A;  3FXJ A;  2E1C A;  5FLM J;  1V5G A;  1R5I D;  2H1K A;  3LSR A;  1IXR C;  3U9G A;  2Y9Z A;  2JQ7 A;  4CGZ A;  1U9N A;  2L7M P;  3HG9 A;  4WXH A;  4DIQ A;  3P9I A;  2WBM A;  2R5Z B;  5IOY A;  3CCY A;  1K6O A;  1MMS A;  4XKV A;  3E0J B;  2LP0 A;  2CO5 A;  2CQK A;  2P0W A;  3D5R C;  2DTZ A;  4DW6 A;  2PJP A;  4XOP A;  1FEX A;  1J7K A;  5HDG A;  2QLZ A;  4XKB A;  3S1Q J;  2ACJ A;  2X9D A;  3JSP A;  3ABM H;  5J47 A;  1MMD A;  4X0G A;  3O8H A;  3WU2 C;  5DUI A;  2XDV A;  5K7F A;  2VJ5 A;  3BZK A;  1I3Q J;  2NNN A;  3H5R A;  2Y31 A;  3RYR A;  2WB1 N;  4M72 A;  2OTL I;  2OD5 A;  2HKX A;  1JKP C;  3WE2 A;  2BXY A;  1P4A A;  5M5X J;  3ERM A;  2DYR H;  2ZO4 A;  4WX9 A;  3M8F A;  1TW3 A;  1SFK A;  4RS8 A;  1NG7 A;  3OL3 A;  2K4B A;  2DQL A;  1I6X A;  2DOD A;  1S72 I;  2ZNY A;  1RI7 A;  2ELK A;  1NG6 A;  3DBH B;  3S93 A;  1W1W E;  3VSK A;  3H3V K;  4M9X A;  3V7C A;  1XG1 A;  5HLH A;  1E0E A;  2MH2 A;  3I58 A;  2ZCW A;  2WAQ A;  2XAU A;  3T8R A;  3KYC B;  1FOY A;  3QYE A;  2L7Z A;  1BI3 A;  2QKM B;  1FTZ A;  2GA2 A;  1O4X A;  2L3D A;  1WJA A;  2ZXI A;  4HG2 A;  2X6X A;  1ZRF A;  2XAQ A;  3HOX J;  3GF2 A;  1FLI A;  2BV6 A;  4AC0 A;  3SQN A;  4CCL A;  3RKQ A;  5D6E A;  1B6A A;  4P9U A;  1ETK A;  1RR7 A;  1MBJ A;  3JRE A;  3H0D A;  4A3K J;  3KP2 A;  1ZR4 A;  1A36 A;  2EFN A;  4G6T B;  4XLA A;  4KA4 A;  2P4W A;  4I2O A;  2KDO A;  1B72 A;  3ZPL A;  1Z91 A;  3G6E I;  4WXC A;  1BL0 A;  3DKW A;  1YS7 A;  5KNL A;  4BHP A;  5EDN A;  4AM3 A;  4ASN A;  2KDZ A;  1SD6 A;  2CW8 A;  2LTP A;  5DV5 A;  2E7X A;  4RGS A;  3M3Y J;  2E1M C;  1NTC A;  2PX9 A;  4WF2 A;  4QSH A;  5IYB J;  5IT3 A;  4Q48 A;  3TW7 A;  3MQ0 A;  1HBX G;  2MC3 A;  4KIC A;  3CZ6 A;  2MLK A;  2DA4 A;  4E7L A;  1ZRD A;  1T38 A;  3FXQ A;  2TRT A;  3Q0U A;  4RB0 A;  4A3E J;  3QQA A;  1UFM A;  3K1P A;  1WI9 A;  1MD0 A;  1FBS A;  2VQG A;  3K7A J;  5KK1 A;  2HEO A;  1LDJ A;  5HLG A;  4AIH A;  3K0L A;  4B1R A;  2HOE A;  3MZH A;  3BG9 A;  4Y15 A;  3WU0 A;  4Y13 A;  2O9L A;  2PJR B;  3TOB A;  3B6A A;  3MKY B;  4FX4 A;  1NK2 P;  2BBY A;  3ULQ B;  2M4G A;  3ZGK A;  3Q5F A;  2DT5 A;  4AYB N;  2IGM A;  4EMS A;  4CCM A;  1K79 A;  2QZ8 A;  1GT0 C;  2RDP A;  3AFH A;  3PO2 J;  3K70 D;  3FK6 A;  3WHC A;  3CTA A;  3TW6 A;  2MA3 A;  5HS8 A;  2BY2 A;  2JWT A;  1B4A A;  3F0C A;  2M30 A;  1HDP A;  3FF5 A;  5E1X A;  4IKF A;  5EF6 A;  1UB9 A;  2O5R A;  3WTW C;  2XGX A;  2IA2 A;  4LB6 B;  3DCF A;  2FNP A;  2JT1 A;  3MMY B;  1XSX A;  4PDK A;  3DPT A;  4HPQ A;  5H6Q A;  3S3N A;  2P5V A;  2BW3 B;  3U2R A;  2FD5 A;  2ZFW A;  3OWT A;  1JHF A;  2BZT A;  1EJ9 A;  4L9T A;  2Y2Z A;  2VON A;  2E36 A;  4XRS G;  2A3S A;  1YYV A;  5FFZ A;  3F72 A;  2VXZ A;  1Q1H A;  3R4K A;  2PI0 A;  2BVL A;  2XF6 A;  5HVQ C;  4NB5 A;  4E70 A;  1TNT A;  2CUZ A;  3WHB A;  1T56 A;  2HZT A;  3NAR A;  2O0Y A;  2XAF A;  5FD6 A;  2L9S A;  5TGT A;  4MEY F;  4UUT A;  4B47 A;  5M5W J;  2K9L A;  1YOV B;  2V9K A;  4IOC F;  3H0G J;  2L54 A;  1FBQ A;  1DP3 A;  3TL4 X;  5LEK A;  2R7S A;  3GTQ J;  2F5C A;  1IRX A;  2GAU A;  3UNG C;  4BUP A;  3I4P A;  4CA0 A;  2EV6 A;  4K2E A;  1ZQ3 P;  1EH8 A;  2KLO A;  1A04 A;  3GXO A;  4KFC A;  1OCO H;  3ZQI A;  3E6B A;  5DD4 A;  4XLC A;  3CF2 A;  5BNG A;  4BQQ A;  1R23 A;  2DMU A;  1X4O A;  4Q4Z F;  1RC9 A;  4BAY A;  1FPQ A;  1BI2 A;  1FT9 A;  4BQN A;  5D4R A;  2K9N A;  3CP8 A;  1UHM A;  2R7X A;  2IVM A;  3WGG A;  1D8J A;  4KUM A;  4UVB A;  4Z6Y A;  5EEH A;  2G0E A;  3M8J A;  4XN3 A;  3WTX C;  3EQL F;  1D5Y A;  2XAJ A;  1Y8Q B;  3OYC A;  4B8X A;  1HF0 A;  5FRN A;  2M9H A;  1SD7 A;  4YIF A;  2E1N A;  5A2Q K;  5LGT A;  4AUX A;  1IN7 A;  2DI3 A;  3HKZ A;  4LK0 F;  4UXN A;  1WI3 A;  4DYR A;  2PN6 A;  4D5F A;  5LRS A;  4UNO A;  2QQ8 A;  1J09 A;  1YJW I;  1WJ5 A;  3CMY A;  4YFX F;  3FXO A;  1KZH A;  5IYD J;  3I5U A;  3T1B A;  2JA2 A;  1QO0 D;  1U5T C;  4EJO A;  2BYV E;  2LF8 A;  1P9Q C;  4HV6 A;  2VT2 A;  1UHW A;  2W85 A;  5CVI A;  1SD4 A;  4NC7 A;  1S8N A;  2EFQ A;  2LMD A;  3K10 A;  4RM2 A;  2XRL A;  4UV8 A;  1ETO A;  2W4S A;  2YX4 A;  3OYB A;  3EYY A;  3SZP A;  1B8I A;  3LSH A;  1SC7 A;  4PSW A;  1FIP A;  2FF4 A;  4ZYA A;  4PJL A;  4EQQ A;  3A01 B;  2GXB A;  1EV7 A;  3LSI A;  2IS4 A;  4U88 A;  3FM3 A;  3VYU B;  1R00 A;  2NXN B;  2L4A A;  1VTN C;  3CJT B;  4CH7 A;  1N25 A;  1SAX A;  1VQL I;  4OIQ F;  5IY5 H;  5D6F A;  1KU9 A;  2D1H A;  2VOO A;  1K78 B;  1RES A;  5ERI A;  3HUG A;  2EQR A;  5D5V B;  2EA4 A;  3ZN0 A;  3HTU A;  2CWE A;  3ZQH A;  2YU9 J;  2VJI A;  4KT5 C;  3A01 A;  3G2B A;  1D1A A;  5KAF C;  1Z7U A;  1U9O A;  1G3Y A;  4FIS A;  3JTG A;  2O8K A;  3SZT A;  2DA7 A;  1WCM J;  1AKH A;  2ECC A;  3JW4 A;  1T33 A;  2DU9 A;  1SEU A;  4ZZD A;  3QYF A;  2LR8 A;  1ZEL A;  2DFI A;  3OY9 A;  4A3D J;  4BDZ A;  1T0F A;  1KON A;  4BY7 J;  4IQJ A;  2NS0 A;  2X85 A;  3IRR A;  4DBQ A;  2CQX A;  3QU6 A;  3HGY A;  3JAM K;  3IRQ A;  3MD2 A;  1QNT A;  3LA7 A;  5FRO A;  1JXS A;  2F5D A;  4ZYH A;  5AIP A;  2PMH A;  4L5J A;  1UG2 A;  1SVO A;  4BYY A;  3IC7 A;  4IF4 A;  5JLW A;  3SEZ A;  3CC7 I;  4IVN A;  2WY8 Q;  2DPU A;  3D5L A;  1MBK A;  4C3H J;  1LJ9 A;  3SDB A;  4BU2 A;  4D5C A;  1LFU P;  1GLN A;  1QHH D;  2RNJ A;  4ESJ A;  3C1D A;  1JT6 A;  1X1A A;  2CW0 F;  4CSW A;  4BXF A;  1V4R A;  4EAT A;  4BH9 A;  2OAZ A;  3SFI A;  4EV0 A;  2X1E A;  4C3J J;  3RZD J;  2OF7 A;  9ANT A;  2OTJ I;  1U5T B;  4FT8 A;  4MGR A;  2QSH X;  3CC4 I;  4I98 B;  4Y33 A;  4M6Y A;  2H27 A;  2DXI A;  5BPD A;  2HQR A;  2NS8 A;  3QU3 A;  2WAE A;  3GZN B;  3S32 A;  1X3W B;  1DDN A;  3FHN A;  3K4J A;  4L9N A;  1LVA A;  2LVS A;  2NS7 A;  1MMA A;  3GLL A;  3CUQ C;  4RBO A;  3GCM A;  4BY1 J;  3FXL A;  4HNV A;  4MEX F;  3KCC A;  2K7L A;  4CDG A;  2D1V A;  4C30 A;  2X1D A;  3E6C C;  2V7F A;  2M7B A;  2IJL A;  1F9N A;  5LBQ A;  1TWF J;  1EH7 A;  2K4J A;  3RI4 A;  5E3N A;  3EUK L;  4A3G J;  3CCE I;  3C18 A;  5F0F A;  3JRC A;  4FAS D;  3L2V A;  4HQM A;  2K3F A;  4V19 K;  2JSC A;  1ACI A;  2IGN A;  2RN7 A;  3HPH A;  3L09 A;  3PL8 A;  2FMY A;  2KIU A;  1MDM B;  1J59 A;  5IT9 Z;  4I99 C;  5E3L A;  4BBS J;  4XM3 A;  3VDX A;  1ZRE A;  4C2M J;  3HJE A;  2R0Q C;  3F3X A;  4KDP A;  4HLY A;  1P2F A;  3CLO A;  4UB8 C;  1Z3Y A;  3CCJ I;  3KFW X;  3HGG A;  2LG4 A;  3PUF A;  4A3I J;  1PP7 U;  2FX0 A;  4LMY A;  4LG3 A;  5CVV A;  3MZ8 A;  1OYY A;  1Y0U A;  3WTZ A;  5D5U B;  1X1P A;  2HTJ A;  5LGU A;  1SD5 A;  1T95 A;  2CQ7 A;  1I27 A;  3NWT A;  3ECO A;  1DPR A;  3CQZ J;  2P6S A;  3RPQ A;  1YI2 I;  2ECB A;  2A5Y B;  4RAZ A;  3C2H A;  3DV8 A;  5L3D A;  1IN6 A;  1FIA A;  3W2V A;  2QBY B;  2F5F A;  1LE8 A;  2CU7 A;  3FXM A;  2OU2 A;  3RKX A;  3DTE A;  2J5O A;  4I0B A;  3JRF A;  4IL6 C;  3H9J A;  5EGO B;  1W4M A;  1APL C;  1ZAO A;  2VB6 A;  3ZR8 X;  1YQA A;  3FX3 A;  3JRI A;  4EM2 A;  1QGP A;  5LHH A;  3FMS A;  2CG4 A;  2ZME B;  3MVP A;  3GTJ J;  3BY6 A;  2LKX A;  1HW1 A;  1JUS A;  2VC0 A;  1CF7 B;  3H3Z A;  3CC2 I;  2KIF A;  5K7Z A;  4AD9 A;  2Z2S B;  2FJ1 A;  1TC3 C;  2KRH A;  2FBK A;  3DFG A;  3PIO F;  4BXX J;  2K3P A;  1U0J A;  3RDI A;  4KYW A;  2CJJ A;  2XSJ C;  2R7Z J;  3S16 J;  4PSX A;  1XC5 A;  3SZG A;  2OZU A;  3J80 Z;  2HDC A;  4EVI A;  3GZ5 A;  2VC1 A;  2OBP A;  3Q9S A;  2D45 A;  1XB4 A;  2HVR A;  1IN4 A;  1F36 A;  1I6H J;  3CUQ A;  3IAM 2;  3DTI A;  4XKC A;  2ME6 A;  3DKX A;  3CDL A;  4HLX A;  2KIS A;  4CYC A;  5ICC A;  5B1A H;  2XC7 A;  1MJB A;  4HSR A;  1WQ2 A;  3W6J B;  3LSJ A;  5IP7 J;  2MC4 A;  1IGN A;  3JCU C;  2W1O A;  1KYZ A;  2K86 A;  4CCK A;  1A31 A;  2FOK A;  3CO7 C;  1MBG A;  3QOD A;  3S14 J;  1HKT A;  3PNY A;  2VPR A;  4OMY A;  5LD2 C;  4A0Z A;  5E8I A;  3LAP A;  5ILU A;  3OYJ A;  4XIC A;  4BEH A;  5HOD A;  3ABT A;  2HTS A;  5ILV A;  5TJJ A;  5F1R A;  1O3S A;  1U3E M;  1XMA A;  1R36 A;  2JRT A;  3BWG A;  2DFE A;  1ETY A;  3QPH A;  2FEZ A;  2FE3 A;  1CGP A;  2CQQ A;  3AG4 H;  2GXA A;  1TTY A;  1OCR H;  1RR8 C;  3KEY A;  4M9Z A;  1FMW A;  2M4K A;  5L3C A;  4AYB A;  1MBF A;  2HYG D;  3F8N A;  5GAD J;  5GAH J;  1MSE C;  5EJC A;  3LSP A;  1SFU A;  1I1G A;  1ITY A;  5F08 A;  2DTR A;  4ZTJ A;  3G1L A;  4I6Z A;  1PYV A;  2F5E A;  1O3T A;  2VBY A;  1S7E A;  4A3B J;  2KRC A;  2OUM A;  2X0L A;  4KN7 X;  3I4M J;  4I09 A;  4NBQ A;  2H8R A;  2KJB A;  1LNW A;  4M3D A;  3K1N A;  2XUB A;  3F21 A;  2GLO A;  2H6C A;  3R0A A;  3KEQ A;  5EZH A;  4ZDP A;  4HST A;  1YG2 A;  2XGD A;  1WH7 A;  4Y3O A;  4JQF A;  2IS1 A;  2YR2 A;  3LQQ A;  1KQ9 A;  2O03 A;  3W6K B;  4MO7 A;  3FIW A;  4B44 A;  1R71 A;  4EJU A;  2FQ3 A;  4MQV A;  2DLL A;  5E1Z B;  1IG7 A;  4OIR F;  5EEA A;  1A5J A;  3WE3 A;  1AHD P;  4FE7 A;  1GV2 A;  1TWC J;  3CUO A;  1NK3 P;  1GXQ A;  1IW7 F;  3ZQQ A;  2JVG A;  2L02 A;  2LBF B;  4HRI A;  4YG2 F;  2XKO A;  1WJB A;  3T5X A;  4U7B A;  4C2U A;  3GFJ A;  1WJF A;  4A6D A;  2EV5 A;  3J80 K;  4G7O F;  1FJL A;  1A6Q A;  4WWC A;  1Y39 A;  4UVC A;  3WTV C;  1XGO A;  4GRI A;  2GQQ A;  3L7W A;  2ZME C;  3FIS A;  3RYP A;  1UG0 A;  1HKQ A;  2E2J J;  2KIQ A;  4EJV A;  2XGC A;  1YRN B;  1KQ8 A;  4M3B A;  3FKI J;  1IXS B;  1TP4 A;  2ADU A;  3BZC A;  4N0B A;  2BGC A;  5DD8 A;  2P81 A;  3S2D J;  1I1S A;  3ZMZ A;  4L5E A;  2CV0 A;  1XSV A;  3K4B A;  3HL2 A;  4II2 A;  4IHW A;  3SHF A;  4RAY A;  4LG0 B;  5IP6 A;  3PM1 A;  2D2W A;  2VBW A;  2W24 A;  4CCJ A;  2JA7 J;  3R60 A;  5AIQ A;  1TBX A;  2PMU A;  4BEH B;  4HX4 A;  3P9K A;  3CMA I;  4A3L J;  1K4S A;  1T6S A;  3WTS C;  2QGU A;  2BEO A;  3S8P A;  5KAI C;  1JUP A;  1K4T A;  2W82 A;  3S3O A;  1VQ8 I;  5LFA A;  4BAC A;  2M5W A;  4PFP A;  1T0F C;  4XNF A;  2BW3 A;  1P7J A;  2DPD A;  3EDP A;  4IHT A;  4CYC B;  2ESN A;  4KN4 X;  1DU6 A;  3G73 A;  3JRB A;  1F5T A;  2M2E A;  2VBZ A;  4XK4 A;  3BT9 A;  3I64 A;  3LFK A;  1NH3 A;  3I53 A;  5JHF A;  2IPQ X;  3ZMV A;  2VQC A;  4GGG A;  5E3O A;  1ZRC A;  4IHX A;  3NWS A;  3FHZ A;  3ZMT A;  1XCB A;  3H5N A;  4XN0 A;  5HS7 A;  4HBL A;  2AHQ A;  4DGW B;  3PSI A;  1KU7 A;  1QVU A;  2E19 A;  3E3V A;  4ZH4 F;  2DBB A;  1MH4 A;  2CMP A;  3L2W A;  4XL9 A;  1Z77 A;  3QP6 A;  3MN2 A;  5H6R A;  4L0Z B;  3V8K A;  1XMK A;  4YII A;  4M73 A;  3BG5 A;  2PJR A;  3A1Y A;  4XID A;  3FBN B;  4GCV A;  3DU5 A;  5BS6 A;  2ISZ A;  2XHK A;  2HPM A;  2JPC A;  4OMZ A;  5CJ9 A;  4YFN F;  3AAF A;  2ZFU A;  6PAX A;  2E34 A;  3G1M A;  3TOA A;  5CQE A;  4BKX A;  1GV5 A;  3HPG A;  2VE8 A;  3GX4 X;  1Z6R A;  1RRJ A;  3AG3 H;  4A3J J;  3JSO A;  3SYT A;  4JBA A;  2L4M A;  1AOY A;  2IGK A;  2Z16 A;  3DPU A;  4PGH A;  1IDY A;  1QA6 A;  3FXK A;  2MLG A;  3G71 I;  2RRE A;  3C2G A;  2BOL A;  1JE8 A;  1YJ9 I;  5D5W B;  1Z6T A;  4BHC A;  3GTM J;  2AXL A;  4G6D A;  3O6B B;  3I9V 2;  2ZB9 A;  3HSR A;  3RKY A;  1S7O A;  3OSG A;  1Z0X A;  2XSD C;  3MWM A;  1B9M A;  4P5O A;  3HHH A;  5HNF A;  3J7Y J;  4UUV A;  4IPA A;  2EIL H;  4KMU X;  3TED A;  5HDN A;  2EIK H;  5L3B A;  5IP9 J;  4PJM A;  1P7I A;  2ELJ A;  2Z5U A;  4NC8 A;  2MAB A;  1XD7 A;  3ABL H;  3I71 A;  2HYF A;  4CIC A;  2CGP A;  3BQZ A;  3JRH A;  1JKR C;  1X4P A;  2X6Y A;  2MH9 A;  5LEJ A;  2EFO A;  1PVE A;  2A68 F;  4ZC3 A;  5DEQ A;  4A2U A;  1RIO H;  3PUB A;  2H09 A;  4LLG F;  3BRO A;  4ANJ A;  2LK2 A;  2E1O A;  2IW5 A;  3ERE D;  3B73 A;  1IJW C;  2CUJ A;  3VYS B;  4XRS A;  3NEU A;  4XLH A;  3CCL I;  1ETV A;  3BR0 A;  4DQ2 A;  4B4C A;  1R5G A;  3KE2 A;  1PDN C;  5LLQ A;  1I50 J;  1MKM A;  1XPX A;  2RGV A;  1JTX A;  1YX3 A;  4LIT A;  1TWA J;  5E79 C;  3GTG J;  1BR4 A;  3HOW J;  2VQH A;  3MCZ A;  1Y8R B;  4AIK A;  2WAQ N;  2EWN A;  2O7O A;  4DZJ A;  3OSF A;  3S17 J;  3E6D A;  1MJ9 A;  1TZL A;  3BR1 A;  2QKL B;  2FSW A;  4RDU A;  5HLI A;  1A6I A;  2QEX I;  2ZKZ A;  4LGW A;  1JKO C;  2HXO A;  5FKO A;  3R61 A;  1LFP A;  1BJZ A;  2D5V A;  4U7D A;  1MZB A;  2DQR A;  1QRY A;  1OCZ H;  4RM3 A;  4RLQ A;  2UV1 A;  3KP5 A;  5EYR A;  5JVT A;  1T98 A;  5DM6 F;  1YIO A;  4S05 A;  1S9H A;  3BR3 A;  3PSF A;  2COM A;  3BTI A;  2GOX B;  3OYH A;  1H88 C;  5FKM A;  1ENH A;  3R0J A;  1VQM I;  2VAS A;  3IWZ A;  1ON1 A;  1R49 A;  2KMU A;  2ICW G;  2L5Q A;  3BP8 A;  2KKO A;  2W57 A;  5K5O A;  3K4M A;  2CYY A;  3ZQC A;  5BOX A;  2HVS A;  2PMZ A;  2R93 J;  4L0Y B;  3RSN A;  3VYT B;  2F4M B;  5J3L A;  3CJN A;  5J6X A;  4HW0 A;  4PUS A;  1OR7 A;  2ZBK A;  2C6Y A;  2FML A;  2GXG A;  2V1X A;  1FSE A;  4GXO A;  4CUG A;  3FMR A;  5ED4 A;  3K6G A;  3Q3S A;  1JI8 A;  4I02 A;  2M0M A;  2Z99 A;  3PJR A;  2ZC2 A;  4NDL A;  3L2Q A;  1X2M A;  2F2E A;  4XQF A;  3BR5 A;  5GAE J;  1HSJ A;  4HEA 2;  2AO9 A;  5C4J J;  4R8H A;  3RPU A;  3TP0 A;  1ZTR A;  5GPA A;  4LLN A;  2M87 A;  5IYC J;  3FMQ A;  3LL7 A;  3N4M A;  3ZN1 A;  2NNY A;  2ETH A;  2JA5 J;  4OIP F;  3WG9 A;  4BE2 A;  1J0R A;  1L3L A;  1WJC A;  1KU2 A;  1XS9 A;  2CUF A;  1OIS A;  1WKM A;  3H36 A;  5FD5 A;  3VWB A;  1W5S A;  3M07 A;  3MZY A;  3ZQG A;  4FE4 A;  4P9F A;  3O2P E;  1JKQ C;  5TIS C;  4RLF A;  2ID3 A;  3D0S A;  4HX7 A;  4HNT A;  4IOA F;  1BA5 A;  3EYI A;  2F4I A;  2LLK A;  1YW8 A;  2XB5 A;  2R7D A;  2DMP A;  3DBR B;  5KCM A;  4RGR A;  3OYN A;  2V1U A;  4KIB A;  1K61 A;  1GVD A;  2HU9 A;  1BIB A;  4EGZ A;  3W2A A;  1RKW A;  1MSF C;  1FY7 A;  1JGG A;  3FK7 A;  2DMT A;  1YS6 A;  5FB2 A;  4MFD A;  4A3M J;  1IRG A;  5GTH C;  3TP3 A;  4OIO F;  5F1J A;  3V42 A;  4BNC A;  1QZE A;  4CXF A;  1W7P D;  2BY1 A;  2VJ4 A;  5F6F A;  2NOG A;  3OYA A;  2ME0 A;  1WHU A;  2M3A A;  4EGY A;  2HVQ A;  4D1Q A;  2PFB A;  4HF2 A;  1BW6 A;  2UXX A;  3VB2 A;  3F8F A;  2G7H A;  4QPQ A;  2R7F A;  4RGX A;  3DF8 A;  3KP4 A;  4HX8 A;  1UJ8 A;  1RUO A;  4D7N A;  4KMF A;  2Z33 A;  3OOU A;  2EA2 A;  1DUX C;  2KJC A;  3BR2 A;  3VYR B;  1MBH A;  1ZG3 A;  1OLT A;  1ZN2 A;  4MTD A;  1X3U A;  4YRV A;  3DEU A;  2ZJR F;  4FTH A;  2FA5 A;  2QVO A;  3BLY A;  3GW2 A;  2ELH A;  2FU4 A;  2K9S A;  5L3F A;  5C4X J;  3ASO H;  2J5P A;  1BC8 C;  3OR1 C;  3PO3 J;  2E2I J;  2KRF A;  2BY3 A;  2WV0 A;  3IHU A;  2LH9 A;  3J7Z I;  3PQK A;  4JK1 X;  2Q8K A;  1R58 A;  4HQE A;  3HHG A;  4B48 A;  3BG3 A;  1JJ8 C;  3L9F A;  3ABU A;  2XV4 S;  3EUH A;  5HS9 A;  3K70 C;  4PK4 A;  1F4K A;  2LKS A;  5FKL A;  4HF0 A;  4D0P A;  5E18 F;  5FKN A;  3K4C A;  3GFL A;  3T8T A;  5J4Y A;  3F22 A;  2XKP A;  3MEX A;  1HA8 A;  3LST A;  3G3Z A;  3EUA A;  4N4O B;  2AQE A;  3GTO J;  3OOP A;  2PLY A;  1S29 A;  3JRD A;  1IRZ A;  1XGM A;  2HR3 A;  2OQG A;  3M9A A;  3V7S A;  2X48 A;  3OYI A;  1SVM A;  5H20 A;  4CHU A;  3A0H C;  3PFI A;  1LEB A;  4XMY A;  3GTK J;  4ENN A;  4F93 B;  5JI6 A;  4LK1 F;  4CO8 A;  2OJE D;  4O6J A;  5D8L B;  5F0H A;  1BM9 A;  2VOP A;  3IP4 B;  2QF7 A;  3TMO A;  2JA8 J;  2K5C A;  2DYS H;  1QPM A;  3CLQ A;  4E7Z A;  2IS6 A;  5FGM A;  1UEL B;  4CCN A;  3S3M A;  1T39 A;  1X58 A;  2OC6 A;  4MNU A;  1JGS A;  5F04 A;  2BY0 A;  4S04 A;  1PUF B;  2X4H A;  1PUE E;  2JPB A;  2HQA A;  3BPX A;  4U0V A;  5JVG F;  4L18 B;  2OCE A;  1Z67 A;  1H89 C;  2EPF A;  3GYH X;  1XMX A;  4EM1 A;  3E5U A;  4ZZL A;  2ZJQ F;  3DXJ F;  3S1N J;  4PCQ A;  1FOK A;  1MNM C;  5CVJ A;  3NAU A;  3A2K A;  1LFB A;  1TQI A;  3BTL A;  1WFX A;  1ZR2 A;  3OYE A;  3JR9 A;  1PJR A;  4GYG A;  3HOV J;  2B9S A;  3K4N A;  1N77 A;  1HQC A;  1HDD C;  2A07 F;  1Z7L A;  1R4N B;  2Q1Z B;  5FO5 A;  4X6A J;  5DDG A;  4ZTF A;  5LRR A;  3E5X A;  4D7M A;  4UHT A;  1ZGW A;  1E3O C;  4BS9 A;  3I56 I;  2E7W A;  1QVT A;  2M8G X;  3VPR A;  1HW5 A;  1Y6I A;  5F27 A;  5E3M A;  1ZH5 A;  1WGX A;  2QQ9 A;  2B0L A;  2XAS A;  1TQP A;  2EFP A;  2H6B A;  4U0Y A;  1J5Y A;  1J2X A;  3A03 A;  2DOA A;  2ZXW H;  4DBR A;  1R1T A;  2LC2 A;  2FBI A;  3ECH A;  2P5K A;  2PMZ N;  3AG2 H;  4XOT A;  2RKH A;  4LG0 A;  4E7I A;  2YU3 A;  5HNH A;  3FBI B;  5DCF A;  3HOZ J;  2GZW A;  4R1H A;  2FBH A;  3JTH A;  4HDU A;  3E6M A;  4UUS A;  3BG6 A;  1N75 A;  3WGI A;  4X1E A;  4P1W A;  1OFC X;  2H1L A;  3OYM A;  2OA4 A;  3KLO A;  1JTY A;  2AXT C;  2DA2 A;  1LE8 B;  1G59 A;  1HCR A;  1GVJ A;  2VN2 A;  3DWL E;  2CQN A;  4UV9 A;  2LRD A;  4J19 A;  4ZJZ A;  3CDH A;  4LJZ F;  3K4L A;  1FX7 A;  2LF7 A;  4OWR B;  4ZDL A;  2FRH A;  2MBF A;  4M71 A;  2IRF G;  1KGS A;  2CSO A;  1ZAR A;  3FXU A;  4WK8 F;  2ZNZ A;  2JJ7 A;  1ZKG A;  4UB6 C;  1VND A;  2IP2 A;  3BC8 A;  1ETQ A;  4G7H F;  4A69 C;  3LSG A;  4FCY A;  1REP C;  4G6Q A;  3J7A O;  3HRM A;  4NQW A;  4I0A A;  3TO7 A;  2QQA A;  1MMG A;  5FLX K;  2FUG 2;  1BR1 A;  1R6R A;  2KHM A;  1Y1W J;  2KPM A;  3GME A;  5FJ8 J;  4DOZ A;  3C7J A;  1VQ9 I;  4ZYD A;  2K40 A;  4E7H A;  4LOC A;  4C2T A;  2OZ6 A;  4H4K C;  3M7G A;  3QAH A;  2HOT A;  2E60 A;  1ERD A;  2F6C A;  3PIP F;  1D1C A;  2HPI A;  2MD0 A;  2Y30 A;  1J9I A;  2LRE A;  1TWG J;  3I0T A;  3SFZ A;  2MSY A;  3GBG A;  1HC8 A;  1H9G A;  2PG4 A;  2X6W A;  1FWZ A;  3BJO A;  1VQ5 I;  4JYK A;  2M1B A;  3TO6 A;  2COB A;  1ULY A;  1BIA A;  2HI3 A;  3WU1 B;  4PJJ A;  5BMZ A;  2V79 A;  3U21 A;  2CW7 A;  2Y69 H;  2P7V B;  1BN5 A;  1E3P A;  2DMQ A;  4F7Z A;  5GPC A;  4QIW N;  5J1Y A;  2HXI A;  4ETS A;  4F3Q A;  5M3F J;  2I10 A;  4CZZ A;  4DYQ A;  3R6S A;  1USS A;  2MFZ A;  4HV5 A;  3K9T A;  3VEP A;  4JX4 A;  2MD5 A;  4KT6 A;  2IEK A;  1SFE A;  2DT7 B;  2HQ5 A;  3QP5 A;  2DMN A;  2R5Y B;  3UKG A;  3K4K A;  1WSU A;  1N78 A;  3C2B A;  4UVA A;  2MW8 A;  2RAE A;  1YTY A;  1XTA A;  3OIQ A;  2CV2 A;  2BXZ A;  1SFX A;  4N9I A;  4PFO A;  2LY2 A;  5TRD A;  3I59 B;  2LD5 A;  2STW A;  3GO5 A;  3ZQF A;  1VQP I;  2VI6 A;  4II3 A;  2EZK A;  4XOR A;  2E71 A;  2QSG X;  2DDB A;  5B1B H;  3ZCO A;  3W6V A;  4A6E A;  3HOY J;  1O3R A;  5B3S H;  1W7P A;  4FX0 A;  2OPT A;  3OS1 A;  5KVR A;  1P92 A;  3BJ6 A;  2MYS A;  2BHZ A;  3RJP A;  3K69 A;  3HC7 A;  3KYL A;  1WZ2 A;  2HS5 A;  2A69 F;  4L9J A;  2L9N A;  4OAY A;  1YW9 A;  1H8A C;  1ODD A;  3DP7 A;  1WVR A;  2KT0 A;  4NC6 A;  1D0Z A;  3TDU C;  3GLX A;  1YIT I;  3CUQ B;  2JUC A;  2KZG A;  2MG4 A;  2XAH A;  1VQ4 I;  2AQF A;  3HBL A;  1DPU A;  3B02 A;  1B72 B;  5DUK A;  1BR2 A;  3LA3 A;  2UZK A;  3LQR A;  2ZSI B;  5M5Y J;  1DU0 A;  1QPI A;  2A05 A;  1A35 A;  2E1M B;  3H5A A;  2KL4 A;  1LEA A;  3HIF A;  2IA1 A;  3HRS A;  4L9V A;  2EK5 A;  3OR2 C;  3NQO A;  2QM3 A;  4E7K A;  3KEO A;  1JJ6 C;  3F6V A;  2V9P A;  1YLF A;  3ZMU A;  4CYD A;  2KQR A;  3WTU C;  2LSO A;  3IWF A;  2BVM A;  4CCO A;  3P7N A;  2DK8 A;  1E2X A;  3CP2 A;  4R79 A;  3CJR B;  2Y9Y A;  3MFK A;  2DJN A;  3GEZ A;  2HZD A;  2TCT A;  3LNQ A;  3M1C A;  4A3F J;  1X19 A;  3L00 A;  4IEJ A;  1JHH A;  2VPL A;  2GA1 A;  2HOA A;  2X51 A;  4J01 A;  4XRM A;  4L5I A;  3HRU A;  4D9J A;  1Y1V J;  4M6X A;  2OV7 A;  2RVC A;  4YFK F;  4Q5S F;  1S3J A;  2H8W A;  1R1U A;  3G1O A;  2MGQ A;  2Y0S A;  4BBR J;  3OYG A;  4MFE A;  3GZ6 A;  2LDU A;  1MJA A;  3A02 A;  2HKO A;  1OCC H;  2A5W A;  1YJN I;  1P6R A;  1EH6 A;  2XGE A;  2FNA A;  3BOQ A;  1XDS A;  1R9T J;  4MLO A;  4RB3 C;  1LDD A;  2W00 A;  1STZ A;  5DTD A;  2JZY A;  4Y7N J;  4RA2 A;  3VOD A;  2L0K A;  5K1Y A;  4NUB A;  1D0Y A;  4BJT A;  3W3C A;  3K2Z A;  2L7K A;  3CCR I;  4Y52 J;  1LVK A;  3V7R A;  4F52 A;  5B66 C;  2QCO A;  1VF9 A;  3CES A;  3E5Q A;  3KET A;  2XB0 X;  1MH3 A;  1RZ4 A;  4G12 A;  4G8X A;  5J40 A;  1YW7 A;  3ASN H;  5L3G A;  1UST A;  3CCV I;  2ZXH A;  1KQ0 A;  1D3Y A;  4BQO A;  1W7P B;  1VQO I;  4KIS A;  3KIO A;  4RB2 C;  2O61 A;  2DA3 A;  4JOM A;  4HDV A;  5D5X B;  3LAJ A;  1R7J A;  3J81 Z;  3PQJ A;  3GWZ A;  4E4H A;  3BZ6 A;  2HQN A;  1BC7 C;  1T08 B;  2CFX A;  2W48 A;  3H92 A;  1P4X A;  2LFB A;  3KYD B;  5K5Q A;  2L7F P;  3DEW A;  2IS2 A;  4IZZ A;  1ZYR F;  2DN0 A;  2R7O A;  3KZI C;  3Q9V A;  4ENM A;  3E7L A;  2R5Y A;  3S1R J;  2DA5 A;  3ABK H;  2H94 A;  2XRO A;  1MW7 A;  1HW2 A;  1U8R A;  4NHJ A;  3CCS I;  2R7Q A;  1FOX A;  3EET A;  4GFB A;  4XBF A; 
#chains in the Genus database with same CATH homology
 1XDU A;  4EM0 B;  4AIJ A;  2L01 A;  1O7L A;  1NHA A;  4HOB A;  1G3W A;  1ZG5 A;  5CYV A;  4IJA A;  2P7C B;  1IN5 A;  5F64 A;  2HFH A;  2PEX A;  1TNS A;  4HYE A;  3U1D A;  1Z9C A;  1BOA A;  3ZMS A;  3RIR A;  4IXA A;  4A5M A;  5CLS A;  2WTE A;  2Z9O A;  2LNB A;  2RC4 A;  3GFM A;  4QLC U;  1YO5 C;  2EJR A;  1TLH B;  4GO1 A;  4M74 A;  3WOD F;  2QQB A;  5L3E A;  1T2K A;  3ZQ7 A;  4ENK A;  3I54 A;  1U5T A;  1IRF A;  2YSR A;  2ZXJ A;  1QZY A;  4Q47 A;  2V1D A;  3CO6 C;  1Z1D A;  3V8L A;  2RQP A;  2K27 A;  1BJA A;  1XGN A;  1F1Z A;  4BQA A;  3IL2 A;  3GFI A;  3O3K A;  4RGU A;  1TW2 A;  1FSH A;  4I7H A;  5ILS A;  3HSF A;  2RV8 A;  2K02 A;  3ZMD A;  5HOO A;  1FBU A;  3KZY A;  2LKP A;  3F23 A;  1V3F A;  4P96 A;  1U78 A;  4ZYG A;  2A6H F;  2EB7 A;  5J8C A;  1L0O C;  2G7U A;  1K78 A;  1CF7 A;  3I59 A;  4BXU A;  2ZME A;  1ZGJ A;  4ENJ A;  4I01 A;  3VFZ A;  4XLN F;  2V9V A;  3F8M A;  5FLX Z;  3M1E A;  4LLL A;  4MHG A;  1PP8 F;  1FYM A;  1P4W A;  3ROU A;  3TO9 A;  1B59 A;  1R5H A;  1E17 A;  3VOE A;  3COA C;  1IF1 A;  3BDD A;  3TDZ C;  4RB1 A;  3ML6 A;  4HZF A;  3KP6 A;  5DCM A;  1D5V A;  2GIV A;  1RUN A;  2XRN A;  4Y17 A;  1BI1 A;  1FC3 A;  4BHB A;  1GHC A;  2M45 A;  3GUD A;  4G7Z F;  3F6O A;  1IZ1 A;  1QZZ A;  1U2W A;  1AWC A;  2ISY A;  1XSD A;  1XCV A;  2WWY A;  1B9N A;  2OQR A;  4LD5 A;  1C0W A;  4LB5 A;  2TDX A;  3SXY A;  3QPT A;  3N97 A;  3FWE A;  4A0X A;  1ON2 A;  5HDK A;  5LHI A;  1KU3 A;  1LDK B;  2UXN A;  3IKT A;  4KIG A;  1FYK A;  3WGH A;  1FP2 A;  2QEN A;  1OYI A;  4MQ9 F;  3F8C A;  4OIN F;  4XSZ F;  4P55 A;  1ZLK A;  1O3Q A;  2W84 A;  3KZZ A;  3KLN A;  5BQT A;  1H9T A;  3ELK A;  2Q2E A;  2QUF A;  3P9C A;  4A12 A;  2HGC A;  3F8B A;  5E20 A;  2P8T A;  1DP7 P;  1HXD A;  3S2W A;  4KIF A;  5D4S A;  4A5N A;  4ON0 A;  4U0W A;  5JHU A;  2DAO A;  1R1V A;  3TQN A;  1B1B A;  4QWQ A;  2W25 A;  3K1M A;  3NRV A;  4WCG A;  1I5Z A;  4OOI A;  3IKV A;  3T0Y A;  4IRG A;  4HAM A;  1HST A;  3LA2 A;  2R3S A;  2GWR A;  2V6C A;  2PQ8 A;  5CVU A;  5DCM B;  3HYI A;  2UWM A;  4O5V A;  1K7A A;  5DYM A;  3HSE A;  2A61 A;  4PGG A;  5IT9 K;  1H0M A;  4A0Y A;  1Z05 A;  3DPL C;  3LWF A;  1S7A A;  3GVA A;  4DNC A;  2P6T A;  4ESF A;  1R22 A;  4FHT A;  1HKS A;  2JTV A;  4KNY A;  2QYO A;  5D8K B;  1J75 A;  3FZV A;  5EEG A;  4IHS A;  1XN7 A;  1SMT A;  2PBI A;  3WTT C;  1ZLJ A;  1IAW A;  5LHG A;  3JAM Z;  3ISP A;  1FZP B;  4PZJ A;  3FM5 A;  5ICG A;  2Y75 A;  3L2C A;  1W5T A;  4EJW A;  1OMI A;  1G3T A;  3V4G A;  3WTY C;  2NRA C;  2HWV A;  3BPV A;  2XVC A;  4LFU A;  2DW4 A;  4IRI A;  1OKR A;  4ZYE A;  1IXC A;  2A6E F;  1FNN A;  1TQM A;  1ZHF A;  2STT A;  1XGS A;  5E1W A;  4HF1 A;  5AON A;  2IT0 A;  3DQV C;  5JFR A;  5BPI A;  1QBJ A;  1OYW A;  3HOT A;  2Z3Y A;  2O6G E;  2IA0 A;  3QRF F;  4TV7 A;  4AWX B;  2O3F A;  1G4D A;  2VBX A;  5FFX A;  3REO A;  2G9W A;  4WXD A;  4O3M A;  5E17 F;  2AS5 F;  1LB2 A;  1G6N A;  2WC2 A;  2YPR A;  4N9H A;  5A2Q Z;  3H3U A;  1SMY F;  3M8E A;  2P5L C;  1ZG1 A;  5E8G A;  2O8X A;  1FP1 D;  1WWX A;  1ZGA A;  2VE9 A;  3RTR A;  2DO7 A;  1O57 A;  4G9Y A;  3HRT A;  2DK5 A;  5CVR A;  4EJT A;  1FYL A;  1LQ1 A;  2ESH A;  2Y0M A;  2M8E A;  1MDM A;  1BBY A;  3C3W A;  1BI0 A;  2NAZ A;  4XRF A;  4HA8 A;  1D8K A;  5LGN A;  3ZP5 A;  1IUY A;  1UCR A;  3QOP A;  3J81 K;  2BE5 F;  3E97 A;  1GXP A;  3V8J A;  3HOS A;  1WRJ A;  2XAG A;  3MAJ A;  2VOD A;  2XIG A;  1O7F A;  4B09 A;  2EV0 A;  4XLP F;  1MGT A;  4IRH A;  5JR3 A;  1KYW A;  3TKY A;  1OPC A;  3BJA A;  5ICE A;  4MTE A;  5K5R A;  2YX7 A;  1U6G A;  4XSX F;  4GYI A;  1YFH A;  3FXR A;  4OU0 A;  2VT3 A;  4AVP A;  3TGN A;  2Q0O A;  4Z2Y A;  2FXA A;  2KIM A;  2NYX A;  4G94 A;  4ESB A;  1S6L A;  1IN8 A;  1G3S A;  1KA8 A;  4M9S A;  1QQI A;  3HTS B;  2QWW A;  2QBY A;  2ZJ2 A;  3OV8 A;  5J8F A;  2Y48 A;  2EFW A;  3KP7 A;  3RKW A;  4H0E A;  1RNL A;  3KP3 A;  1ONV A;  5ICF A;  2E1C A;  1IXR C;  3U9G A;  4CGZ A;  4WXH A;  3P9I A;  1K6O A;  2CO5 A;  2CQK A;  2PJP A;  1J7K A;  5HDG A;  2QLZ A;  2ACJ A;  3JSP A;  5DUI A;  2NNN A;  3RYR A;  4M72 A;  2OD5 A;  2HKX A;  3WE2 A;  1P4A A;  2ZO4 A;  4WX9 A;  3M8F A;  1TW3 A;  4RS8 A;  2K4B A;  2DQL A;  1I6X A;  2ZNY A;  1RI7 A;  4M9X A;  3V7C A;  5HLH A;  2MH2 A;  3I58 A;  2ZCW A;  3T8R A;  1BI3 A;  2GA2 A;  2L3D A;  1ZRF A;  2XAQ A;  3GF2 A;  1FLI A;  2BV6 A;  3SQN A;  5D6E A;  1B6A A;  4P9U A;  3KP2 A;  2EFN A;  4KA4 A;  2P4W A;  4I2O A;  3ZPL A;  1Z91 A;  4WXC A;  3DKW A;  1YS7 A;  4BHP A;  4ASN A;  1SD6 A;  5DV5 A;  2E7X A;  4RGS A;  4WF2 A;  5IT3 A;  4Q48 A;  3MQ0 A;  1HBX G;  2MC3 A;  4KIC A;  2MLK A;  1ZRD A;  1T38 A;  3FXQ A;  4RB0 A;  1UFM A;  3K1P A;  1WI9 A;  1MD0 A;  2HEO A;  1FBS A;  5KK1 A;  1LDJ A;  5HLG A;  4AIH A;  3K0L A;  3MZH A;  2HOE A;  4Y15 A;  3WU0 A;  4Y13 A;  3TOB A;  4FX4 A;  2BBY A;  3ULQ B;  3Q5F A;  2DT5 A;  4EMS A;  1K79 A;  2QZ8 A;  2RDP A;  3CTA A;  2MA3 A;  5HS8 A;  1B4A A;  2M30 A;  3FF5 A;  5E1X A;  1UB9 A;  3WTW C;  2XGX A;  2IA2 A;  4LB6 B;  2FNP A;  2JT1 A;  1XSX A;  4PDK A;  3DPT A;  5H6Q A;  2P5V A;  3U2R A;  2ZFW A;  1JHF A;  4L9T A;  2VON A;  2A3S A;  1YYV A;  5FFZ A;  3F72 A;  2VXZ A;  1Q1H A;  3R4K A;  2PI0 A;  5HVQ C;  4NB5 A;  4E70 A;  1TNT A;  2HZT A;  5FD6 A;  2O0Y A;  2XAF A;  4MEY F;  2L54 A;  1FBQ A;  5LEK A;  2F5C A;  2GAU A;  3I4P A;  2EV6 A;  4K2E A;  1EH8 A;  1A04 A;  3GXO A;  4KFC A;  3E6B A;  5DD4 A;  1R23 A;  4Q4Z F;  4BAY A;  1FPQ A;  1BI2 A;  1FT9 A;  5D4R A;  1UHM A;  2IVM A;  3WGG A;  1D8J A;  4KUM A;  4UVB A;  5EEH A;  3WTX C;  3EQL F;  2XAJ A;  4B8X A;  1SD7 A;  5A2Q K;  2E1N A;  4YIF A;  5LGT A;  1IN7 A;  2DI3 A;  4LK0 F;  4UXN A;  2PN6 A;  5LRS A;  4UNO A;  4YFX F;  3I5U A;  3T1B A;  1QO0 D;  1U5T C;  4EJO A;  2BYV E;  2LF8 A;  4HV6 A;  2VT2 A;  1UHW A;  2W85 A;  5CVI A;  1SD4 A;  1S8N A;  2EFQ A;  4UV8 A;  2YX4 A;  3EYY A;  3SZP A;  2FF4 A;  4EQQ A;  2GXB A;  1EV7 A;  4U88 A;  3FM3 A;  1R00 A;  2L4A A;  1VTN C;  1SAX A;  4OIQ F;  5D6F A;  1KU9 A;  2D1H A;  2VOO A;  1K78 B;  5ERI A;  3HUG A;  5D5V B;  2EA4 A;  3ZN0 A;  3HTU A;  2CWE A;  4KT5 C;  1Z7U A;  1G3Y A;  3JTG A;  3SZT A;  3JW4 A;  2DU9 A;  4ZZD A;  2DFI A;  1T0F A;  2NS0 A;  3IRR A;  3QU6 A;  3JAM K;  3IRQ A;  1QNT A;  3LA7 A;  1JXS A;  2F5D A;  4ZYH A;  5AIP A;  2PMH A;  4L5J A;  4BYY A;  3IC7 A;  4IF4 A;  4IVN A;  2DPU A;  3D5L A;  1LJ9 A;  2RNJ A;  4ESJ A;  3C1D A;  2CW0 F;  1V4R A;  4BH9 A;  2OAZ A;  4EV0 A;  1U5T B;  4FT8 A;  4MGR A;  4I98 B;  4M6Y A;  2H27 A;  5BPD A;  2HQR A;  3QU3 A;  1DDN A;  4L9N A;  1LVA A;  3CUQ C;  4MEX F;  3KCC A;  2K7L A;  4CDG A;  2D1V A;  3E6C C;  2IJL A;  1F9N A;  5LBQ A;  1EH7 A;  2K4J A;  3RI4 A;  3C18 A;  4HQM A;  2JSC A;  2RN7 A;  3L09 A;  2FMY A;  2KIU A;  1MDM B;  1J59 A;  5IT9 Z;  1ZRE A;  3F3X A;  4KDP A;  4HLY A;  1P2F A;  3CLO A;  3KFW X;  1PP7 U;  4LMY A;  5CVV A;  1OYY A;  1Y0U A;  3WTZ A;  5D5U B;  2HTJ A;  5LGU A;  1SD5 A;  1I27 A;  3ECO A;  1DPR A;  2P6S A;  3RPQ A;  2A5Y B;  4RAZ A;  3DV8 A;  5L3D A;  1IN6 A;  2QBY B;  2F5F A;  2OU2 A;  3RKX A;  4I0B A;  2J5O A;  1W4M A;  1ZAO A;  1YQA A;  3FX3 A;  4EM2 A;  1QGP A;  5LHH A;  2CG4 A;  2ZME B;  3FMS A;  3BY6 A;  1HW1 A;  2VC0 A;  1CF7 B;  3H3Z A;  2KIF A;  4AD9 A;  2FBK A;  3DFG A;  3RDI A;  4KYW A;  2OZU A;  3J80 Z;  2HDC A;  4EVI A;  3GZ5 A;  2VC1 A;  2OBP A;  3Q9S A;  2D45 A;  1XB4 A;  1IN4 A;  3CUQ A;  4HLX A;  5ICC A;  1MJB A;  1WQ2 A;  3W6J B;  1KYZ A;  2K86 A;  2FOK A;  3CO7 C;  1HKT A;  4OMY A;  4A0Z A;  5E8I A;  3LAP A;  5ILU A;  3ABT A;  2HTS A;  5ILV A;  5TJJ A;  5F1R A;  1O3S A;  1U3E M;  1XMA A;  1R36 A;  2JRT A;  3BWG A;  3QPH A;  2FEZ A;  2FE3 A;  1CGP A;  1TTY A;  4M9Z A;  5L3C A;  2HYG D;  3F8N A;  1SFU A;  1I1G A;  2DTR A;  2F5E A;  1O3T A;  2VBY A;  4KN7 X;  2X0L A;  4I09 A;  2KJB A;  1LNW A;  3K1N A;  2XUB A;  3F21 A;  2H6C A;  3R0A A;  3KEQ A;  1YG2 A;  4JQF A;  2YR2 A;  3LQQ A;  1KQ9 A;  2O03 A;  3W6K B;  4EJU A;  2FQ3 A;  4MQV A;  2DLL A;  5E1Z B;  4OIR F;  3WE3 A;  3CUO A;  1GXQ A;  1IW7 F;  2L02 A;  4YG2 F;  2XKO A;  3T5X A;  4U7B A;  3GFJ A;  4A6D A;  2EV5 A;  3J80 K;  4G7O F;  4WWC A;  4UVC A;  3WTV C;  1XGO A;  2GQQ A;  3L7W A;  3RYP A;  1HKQ A;  4EJV A;  1KQ8 A;  1IXS B;  2ADU A;  4N0B A;  5DD8 A;  2BGC A;  1I1S A;  3ZMZ A;  1XSV A;  3SHF A;  4RAY A;  4LG0 B;  2D2W A;  2VBW A;  2W24 A;  3R60 A;  5AIQ A;  1TBX A;  2PMU A;  4HX4 A;  3P9K A;  1T6S A;  3WTS C;  2BEO A;  2M5W A;  2DPD A;  3EDP A;  4IHT A;  2ESN A;  4KN4 X;  3G73 A;  1F5T A;  2VBZ A;  3I64 A;  3LFK A;  3I53 A;  2IPQ X;  3ZMV A;  4GGG A;  1ZRC A;  3FHZ A;  3ZMT A;  1XCB A;  5HS7 A;  4HBL A;  1KU7 A;  3E3V A;  4ZH4 F;  2DBB A;  3QP6 A;  5H6R A;  4L0Z B;  3V8K A;  1XMK A;  4YII A;  4M73 A;  4GCV A;  2ISZ A;  5BS6 A;  2XHK A;  2JPC A;  4OMZ A;  5CJ9 A;  4YFN F;  3AAF A;  6PAX A;  3TOA A;  3GX4 X;  2VE8 A;  1Z6R A;  3JSO A;  4JBA A;  2L4M A;  1AOY A;  4PGH A;  2MLG A;  1JE8 A;  5D5W B;  1Z6T A;  4BHC A;  2AXL A;  4G6D A;  3O6B B;  3HSR A;  3RKY A;  1S7O A;  3MWM A;  1B9M A;  4P5O A;  3HHH A;  4UUV A;  4IPA A;  4KMU X;  5HDN A;  5L3B A;  2Z5U A;  1XD7 A;  3I71 A;  4CIC A;  2HYF A;  2CGP A;  5LEJ A;  2MH9 A;  2EFO A;  2A68 F;  5DEQ A;  4A2U A;  1RIO H;  4LLG F;  2H09 A;  3BRO A;  2IW5 A;  3ERE D;  3B73 A;  3NEU A;  4DQ2 A;  1R5G A;  3KE2 A;  1PDN C;  5LLQ A;  1MKM A;  2RGV A;  3MCZ A;  4AIK A;  2EWN A;  1MJ9 A;  3E6D A;  2FSW A;  5HLI A;  2ZKZ A;  4LGW A;  3R61 A;  4U7D A;  1MZB A;  2DQR A;  5JVT A;  3KP5 A;  1T98 A;  1YIO A;  4S05 A;  2COM A;  3R0J A;  3IWZ A;  1ON1 A;  3BP8 A;  2KKO A;  2W57 A;  5K5O A;  2CYY A;  5BOX A;  4L0Y B;  3CJN A;  5J6X A;  4HW0 A;  1OR7 A;  2ZBK A;  2C6Y A;  2FML A;  2GXG A;  2V1X A;  1FSE A;  4GXO A;  3FMR A;  5ED4 A;  4I02 A;  2Z99 A;  2F2E A;  1HSJ A;  4R8H A;  3RPU A;  4LLN A;  2M87 A;  3N4M A;  3FMQ A;  4OIP F;  3ZN1 A;  2NNY A;  2ETH A;  3WG9 A;  1J0R A;  1L3L A;  1KU2 A;  1WKM A;  5FD5 A;  1W5S A;  3MZY A;  4P9F A;  3O2P E;  3D0S A;  4HX7 A;  3EYI A;  1YW8 A;  2R7D A;  4RGR A;  2V1U A;  4KIB A;  4EGZ A;  1BIB A;  1FY7 A;  1YS6 A;  5FB2 A;  1IRG A;  4OIO F;  4BNC A;  4CXF A;  1W7P D;  5F6F A;  4EGY A;  2PFB A;  4HF2 A;  2UXX A;  3VB2 A;  3F8F A;  2G7H A;  2R7F A;  4RGX A;  3DF8 A;  3KP4 A;  4HX8 A;  1RUO A;  4KMF A;  2Z33 A;  2EA2 A;  1DUX C;  2KJC A;  1ZG3 A;  1ZN2 A;  4MTD A;  1X3U A;  3DEU A;  2FA5 A;  2QVO A;  3GW2 A;  2FU4 A;  2ELH A;  5L3F A;  1BC8 C;  2J5P A;  2KRF A;  2WV0 A;  3IHU A;  3PQK A;  4JK1 X;  2Q8K A;  1R58 A;  4HQE A;  3HHG A;  3L9F A;  3ABU A;  2XV4 S;  3EUH A;  5HS9 A;  1F4K A;  4HF0 A;  4D0P A;  5E18 F;  3GFL A;  3T8T A;  3F22 A;  2XKP A;  3MEX A;  3LST A;  3G3Z A;  3OOP A;  2PLY A;  1S29 A;  1XGM A;  2HR3 A;  2OQG A;  3M9A A;  3V7S A;  5H20 A;  4CHU A;  3PFI A;  1LEB A;  4ENN A;  5JI6 A;  4LK1 F;  4CO8 A;  4O6J A;  5D8L B;  1BM9 A;  2VOP A;  1QPM A;  5FGM A;  1T39 A;  4MNU A;  1JGS A;  4S04 A;  2X4H A;  1PUE E;  2JPB A;  3BPX A;  4U0V A;  4L18 B;  3GYH X;  4EM1 A;  3E5U A;  4ZZL A;  3DXJ F;  4PCQ A;  1FOK A;  5CVJ A;  1TQI A;  4GYG A;  1HQC A;  2A07 F;  5FO5 A;  5DDG A;  5LRR A;  3E5X A;  4UHT A;  2E7W A;  1HW5 A;  1ZH5 A;  2QQ9 A;  2B0L A;  2XAS A;  1TQP A;  2EFP A;  2H6B A;  4U0Y A;  1J5Y A;  1J2X A;  1R1T A;  2FBI A;  3ECH A;  2P5K A;  2RKH A;  4LG0 A;  2YU3 A;  5DCF A;  2GZW A;  4R1H A;  2FBH A;  3JTH A;  4HDU A;  3E6M A;  3WGI A;  2OA4 A;  3KLO A;  4UV9 A;  1GVJ A;  2VN2 A;  3CDH A;  4LJZ F;  1FX7 A;  2LF7 A;  2FRH A;  2MBF A;  4M71 A;  2IRF G;  1KGS A;  2CSO A;  1ZAR A;  3FXU A;  4WK8 F;  2ZNZ A;  2IP2 A;  4G7H F;  1REP C;  4G6Q A;  3J7A O;  3HRM A;  4NQW A;  4I0A A;  3TO7 A;  2QQA A;  5FLX K;  3C7J A;  4ZYD A;  2OZ6 A;  3M7G A;  3QAH A;  1J9I A;  3I0T A;  3SFZ A;  1H9G A;  2PG4 A;  1FWZ A;  3BJO A;  2M1B A;  3TO6 A;  1ULY A;  1BIA A;  3WU1 B;  5BMZ A;  2V79 A;  2P7V B;  1BN5 A;  4F7Z A;  4ETS A;  4CZZ A;  3R6S A;  1USS A;  4HV5 A;  3K9T A;  3VEP A;  2MD5 A;  1SFE A;  3QP5 A;  1WSU A;  4UVA A;  1YTY A;  1SFX A;  4N9I A;  5TRD A;  3I59 B;  2STW A;  3GO5 A;  4A6E A;  1O3R A;  1W7P A;  4FX0 A;  5KVR A;  1P92 A;  3BJ6 A;  3RJP A;  3K69 A;  2HS5 A;  2A69 F;  4L9J A;  1YW9 A;  1ODD A;  3DP7 A;  3TDU C;  3GLX A;  3CUQ B;  2XAH A;  1DPU A;  3B02 A;  5DUK A;  3LA3 A;  2UZK A;  3LQR A;  1LEA A;  3HIF A;  2IA1 A;  3HRS A;  4L9V A;  2EK5 A;  3NQO A;  2QM3 A;  3KEO A;  3F6V A;  1YLF A;  3ZMU A;  4CYD A;  3WTU C;  2LSO A;  3IWF A;  3P7N A;  2DK8 A;  1E2X A;  4R79 A;  3MFK A;  3GEZ A;  3L00 A;  1JHH A;  2GA1 A;  4L5I A;  3HRU A;  4M6X A;  2RVC A;  4YFK F;  4Q5S F;  1S3J A;  1R1U A;  3GZ6 A;  2LDU A;  1MJA A;  2HKO A;  1P6R A;  1EH6 A;  2FNA A;  3BOQ A;  1XDS A;  4RB3 C;  1LDD A;  1STZ A;  2JZY A;  3VOD A;  5K1Y A;  3K2Z A;  3V7R A;  3E5Q A;  3KET A;  1RZ4 A;  4G8X A;  1YW7 A;  5L3G A;  1UST A;  1KQ0 A;  1D3Y A;  1W7P B;  4RB2 C;  2O61 A;  4HDV A;  5D5X B;  3LAJ A;  1R7J A;  3J81 Z;  3PQJ A;  3GWZ A;  3BZ6 A;  2HQN A;  1BC7 C;  2CFX A;  3H92 A;  1P4X A;  5K5Q A;  1ZYR F;  3Q9V A;  4ENM A;  2H94 A;  2XRO A;  1HW2 A;  1U8R A;  4NHJ A;  3EET A;  4XBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...