3ZQ7A

The structure of dna-binding domain of response regulator from escherichia coli k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
PDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN KDPE
publication title Structure-Function Studies of DNA Binding Domain of Response Regulator Kdpe Reveals Equal Affinity Interactions at DNA Half-Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zq7A00
5K5OA 5CJ9A 1SD6A 3ROUA 4U0YA 3DF8A 5L3EA 2E7XA 5CVUA 3J81Z 4N0BA 3ZN1A 4UNOA 2EK5A 4WF2A 2MBFA 2MLGA 2BGCA 4ZYEA 2D45A 4A5MA 2GXGA 1GXQA 3I64A 4UHTA 2H09A 1IRFA 2L54A 4UVBA 2QM3A 3R0JA 1R1VA 4EMSA 2B0LA 3E5XA 1SMTA 2ZMEA 1PDNC 2D1VA 3WTTC 2EB7A 5JR3A 1GVJA 2UXNA 3HTUA 3LQRA 3F8MA 4LB6B 1I5ZA 4M6XA 4A6EA 3HTSB 4NHJA 1W5TA 2CYYA 3VFZA 2VXZA 1ULYA 3JAMZ 1HW2A 4UV8A 2FRHA 1IXRC 1V4RA 5ILVA 4HAMA 4WXCA 2HQRA 4RGXA 4LG0B 4HV5A 1XCVA 2VODA 1T6SA 5LEJA 2QLZA 3ML6A 1LB2A 4A0XA 4MEYF 5J8FA 3HSEA 1T39A 3MZYA 2GWRA 5K5RA 2M30A 3V8KA 4EV0A 3ZMDA 4FX0A 4IHSA 2J5OA 1G3YA 1YTYA 1U6GA 1KU2A 1QBJA 4FHTA 2XIGA 1E17A 2FA5A 1P4AA 3I58A 5BOXA 4R8HA 4UXNA 4XBFA 5HDKA 2VOPA 2XROA 4OOIA 4LGWA 3H3UA 1TNTA 2V9VA 3GZ6A 2Z9OA 2DQLA 4QWQA 1E2XA 5EEGA 3QPHA 2H94A 3F21A 5D5WB 1SFXA 5D4RA 3JTGA 2PBIA 2A6EF 1T98A 2DLLA 3IHUA 4BAYA 3ELKA 2F2EA 3SZPA 4MGRA 1ZH5A 1YW7A 2P5KA 1K78A 3MQ0A 4I7HA 1YIOA 4EVIA 1ONVA 5TJJA 3ZMSA 3SXYA 3O3KA 1LDDA 1YW8A 1IN4A 2A3SA 4F7ZA 2EA2A 2DK8A 2DW4A 2EA4A 1R5GA 4AIHA 5FO5A 2G9WA 1UFMA 1FSEA 1ON1A 1FLIA 3M7GA 1TQIA 2P6TA 5IT9K 2ZKZA 4ESJA 2ESHA 4OIPF 5JFRA 2PMHA 5FD5A 5IT3A 2ISYA 4O5VA 3RYPA 4M9ZA 2WTEA 1ZAOA 2DAOA 1W7PA 5JVTA 3LA2A 4KDPA 5J8CA 2QQAA 3FF5A 4S04A 2RV8A 4L5IA 2L01A 5ICFA 2GQQA 3KETA 1P6RA 3WTXC 2V1DA 3JTHA 2PG4A 4BHPA 2COMA 1REPC 4OIOF 1YFHA 1KYZA 1KU9A 2ZJ2A 1IRGA 2K02A 1FYLA 2UWMA 2F5EA 4YIIA 3M9AA 4EM1A 5CVRA 3KP4A 4IXAA 3TQNA 2M87A 1S8NA 3GO5A 4EGYA 2K4JA 2V6CA 4RB1A 2FOKA 1IN5A 3ABUA 1KQ8A 3ECHA 4AWXB 2IRFG 1FP2A 2IPQX 2O6GE 3TOAA 2Q0OA 4CHUA 3GEZA 4L9JA 2ACJA 3GFLA 1KA8A 3BPXA 4GYIA 4DNCA 2EV0A 2RN7A 2R7DA 3P9IA 2EV6A 2HTJA 4XRFA 2CW0F 1ZGJA 3O2PE 3PQJA 3ZMTA 4I0AA 2GIVA 1Z91A 4G7ZF 5CLSA 3R6SA 4R79A 3EETA 3Q9SA 1O3QA 4GYGA 3HHHA 1LNWA 2XUBA 2FBKA 1PP7U 3E5UA 2RC4A 1IW7F 3FXRA 2ZNYA 5L3DA 3FHZA 3TDUC 3OV8A 4CYDA 1HKSA 1HBXG 3ZMZA 4LD5A 1AWCA 3LWFA 2DQRA 4BHCA 2Q8KA 4L9VA 2FE3A 1OKRA 1K6OA 3HRMA 1ZLKA 2BE5F 2CGPA 3M8EA 1KQ9A 4PCQA 3F72A 3FXUA 1O7LA 3R60A 5ERIA 3GFMA 4HA8A 3K69A 4FT8A 3DQVC 1QPMA 1XGOA 1YG2A 2BYVE 2QBYA 4AVPA 5F6FA 5F64A 3WTZA 1U8RA 2LF8A 2DPUA 3K9TA 5LHHA 1XB4A 2ISZA 2L02A 3HUGA 3FMSA 3U2RA 4WCGA 1FBQA 2FF4A 4RB0A 4M71A 3M1EA 4S05A 4ESFA 1W5SA 3N4MA 1H0MA 2QVOA 2A5YB 3HIFA 1XGNA 3HOTA 5DCMA 1OR7A 1F1ZA 5FGMA 2ADUA 3B02A 2KIFA 2F5CA 2Z5UA 2ZO4A 4YFNF 2Q2EA 4CDGA 3WU1B 3CUQA 3QU6A 2YR2A 3Q9VA 3JAMK 4PDKA 1FSHA 2P5LC 5HVQC 4U7BA 4A12A 1KQ0A 3TOBA 2ZBKA 2FMLA 1S29A 3MEXA 1FBUA 5LGTA 2P7VB 4HX4A 1JHHA 5CVIA 3GZ5A 3GVAA 1U5TA 2IVMA 1P92A 1R00A 1ZLJA 3WTWC 2OBPA 2MD5A 1EH8A 4YIFA 3ZPLA 1LEBA 5D8KB 3PFIA 1ZHFA 4KMFA 2VT3A 3VODA 1KYWA 5ILUA 2IA1A 1ZG3A 4MQ9F 2FMYA 4OMZA 4ENKA 2ZFWA 1LDJA 1Z9CA 3T0YA 3VOEA 4EJWA 4Y13A 2HR3A 4WK8F 4ZZDA 4LB5A 3LQQA 4Q47A 1B1BA 1WI9A 1XDUA 1RZ4A 2J5PA 2KKOA 1EH6A 1BN5A 3I54A 2JSCA 2KJBA 2PMUA 2YU3A 1O57A 3ZMVA 1BI0A 5ICEA 4ENJA 2Z3YA 4ZYGA 2ZCWA 2X0LA 1BI3A 1NHAA 4BNCA 4MTEA 3W6KB 3WODF 1J9IA 1DUXC 4L0YB 4HBLA 2MC3A 3H3ZA 3I4PA 3QOPA 1G6NA 5A2QK 4RGSA 3FM5A 1LDKB 2YX7A 1F5TA 1YQAA 3KP2A 5HDNA 3RI4A 5D6FA 2M8EA 4OU0A 3BJ6A 2MA3A 1B4AA 1SD5A 4AIKA 2XGXA 3KFWX 1XSXA 4G6QA 1U3EM 4EJVA 2FBIA 1QZYA 3IL2A 3C3WA 3EQLF 4KMUX 4HDVA 1O3RA 2LDUA 3RKXA 4HW0A 3C18A 4AD9A 4BHBA 4ETSA 4LK1F 3GXOA 3GUDA 4N9HA 4ENNA 5LEKA 3ZMUA 5ICGA 3WTSC 5LHGA 5DDGA 3KP3A 3NRVA 2OQRA 5HDGA 3RDIA 1O3SA 3I59B 1ZARA 1BIAA 4HYEA 3QPTA 3MWMA 1SFEA 2YX4A 2FBHA 3E97A 2MH9A 3EYYA 3I71A 2OU2A 4QLCU 1DP7P 3SZTA 4WWCA 1SD4A 1USTA 2Y0MA 3TKYA 1BC7C 4MEXF 2DBBA 3KCCA 1D3YA 4MQVA 1XSDA 4OIRF 2A68F 4JK1X 4NQWA 1Z1DA 2PJPA 3KLOA 5AIQA 3I53A 1WRJA 1FP1D 3RKYA 3F8BA 3LFKA 4XSZF 1WKMA 3IRRA 3F8FA 2NYXA 2R7FA 2D2WA 2XRNA 3G73A 4A0YA 1J2XA 2WC2A 3TO9A 3WU0A 2DO7A 2P8TA 1LVAA 5BMZA 1P2FA 1L3LA 3WG9A 1IN7A 4B09A 1CF7B 5FFZA 5H20A 3TO6A 3TO7A 1HXDA 1K79A 6PAXA 1MGTA 2HGCA 3FM3A 1LJ9A 1MJ9A 3R0AA 3M8FA 4Y17A 5A2QZ 1FOKA 4BXUA 2OD5A 3FMRA 1JE8A 3F3XA 3KP7A 1S7OA 3V7SA 3N97A 1T38A 4ON0A 4G7OF 4P5OA 3HSFA 2STTA 1HKTA 4U0VA 3R61A 3IKTA 2ZXJA 5E8GA 3RPUA 1BM9A 1ZRDA 1LQ1A 3GFIA 1R5HA 2IJLA 1T0FA 3WE3A 4IF4A 2R3SA 2DI3A 5TRDA 3SFZA 2O8XA 4ASNA 1DDNA 1S7AA 5CYVA 1F9NA 1QNTA 2FQ3A 1B9NA 4IVNA 1UB9A 2P5VA 4G9YA 3L9FA 1PP8F 2C6YA 1IZ1A 5E18F 2L4MA 4MHGA 4A2UA 2XKOA 1BC8C 4GO1A 4CZZA 2JTVA 2ETHA 3REOA 3BPVA 3DEUA 4YG2F 1XN7A 1J7KA 5L3CA 4WXHA 5KVRA 3FXQA 4LG0A 4KNYA 4I01A 3FMQA 5LRSA 1H9TA 4HV6A 4RGUA 2XAFA 4RAYA 2OZUA 3JSPA 3ISPA 2E7WA 4CO8A 2K4BA 2VC0A 3LA3A 2H6CA 2O03A 1LEAA 1KU3A 2P4WA 3HHGA 2XKPA 1HKQA 3P9KA 2JPBA 1HSJA 2FNPA 3T5XA 1EH7A 2YSRA 4RS8A 4Z2YA 2XAQA 4UUVA 5DCMB 5HS8A 1O3TA 1J5YA 5L3FA 1RI7A 2VONA 3B73A 3CUOA 2JZYA 1W4MA 1Y0UA 5HLGA 3ZP5A 4I09A 2FEZA 3HRTA 1ZRFA 5HS7A 4P96A 1J0RA 2PEXA 4M72A 2W84A 4GGGA 3GF2A 5DCFA 5D6EA 2HEOA 2K86A 2LNBA 2EJRA 3CO7C 5LGUA 3TGNA 4CGZA 5CVJA 2P7CB 3WTUC 5FFXA 2W85A 5DUKA 2XAJA 2WWYA 3D0SA 3FWEA 4L9NA 1BI2A 1FPQA 3BY6A 1MDMB 4Q5SF 2W24A 2UXXA 3KZYA 4AIJA 4I2OA 1ODDA 2PQ8A 5HLHA 5J6XA 1QGPA 5E20A 4HLXA 3MFKA 1G4DA 4A5NA 4IRGA 1FT9A 2JT1A 3LA7A 4P55A 3ERED 3BDDA 4I98B 2A6HF 1U2WA 1R58A 1HSTA 2NNYA 3CUQC 4A0ZA 3GFJA 1JGSA 1IF1A 4G7HF 3V7CA 5D5VB 4M74A 3OOPA 4MNUA 1TNSA 3IKVA 4O6JA 2Y48A 3V8JA 5FLXK 1FYKA 2A61A 1Z7UA 2EFOA 3I0TA 2CSOA 1ZREA 1BOAA 3GWZA 2E1NA 2ZMEB 2G7HA 4IHTA 2V79A 5D5XB 3CJNA 3RIRA 1SAXA 5HLIA 3KEOA 2VN2A 2FNAA 4KFCA 2QYOA 4N9IA 1ZG5A 2OAZA 3FZVA 3IWZA 3JSOA 4EQQA 1FC3A 2GA2A 1XMKA 3T8RA 5ED4A 3WGGA 3U1DA 3E6BA 4G8XA 1U78A 1FX7A 1XGMA 5DYMA 2RQPA 1FBSA 1UHWA 2QQ9A 3P9CA 2NS0A 5LHIA 3IWFA 1OMIA 4RGRA 2RGVA 1R1UA 2ESNA 3JW4A 1MD0A 1DPRA 5EEHA 3HRUA 5CVVA 5FB2A 4OMYA 4KN4X 2W25A 1RIOH 1Z6RA 5JI6A 5BS6A 5BQTA 2H6BA 3AAFA 2AS5F 2DPDA 4UV9A 4EJOA 2ZNZA 3J7AO 4PGHA 3ZN0A 3GW2A 4KUMA 1Z05A 3EYIA 4YFKF 3L00A 4IPAA 1L0OC 3K2ZA 3F8CA 1I6XA 1IN8A 3RTRA 4BQAA 2OA4A 1K78B 5LBQA 3ECOA 1MJAA 1WWXA 1J59A 3HOSA 4Q48A 3HYIA 4PGGA 1YLFA 4H0EA 2EFNA 3E6CC 1R36A 4KN7X 4A6DA 3QP6A 1SMYF 2HFHA 3BP8A 1IXCA 3H92A 5HS9A 1Q1HA 1YS7A 1MJBA 3CDHA 4UVCA 3KP5A 2QUFA 5D8LB 3R4KA 1S6LA 3I5UA 1KGSA 5FLXZ 5K5QA 1I1SA 4GXOA 4R1HA 2NRAC 3DPTA 2VBWA 1JXSA 4I02A 2CO5A 1R7JA 1W7PB 4L9TA 2YPRA 2PN6A 3IRQA 2BEOA 1XSVA 2W57A 4EGZA 3DP7A 3RJPA 4HF1A 1TQMA 3ABTA 4K2EA 1H9GA 2L3DA 3P7NA 3COAC 2HKXA 1P4WA 3WGHA 1USSA 1R22A 5KK1A 5L3GA 2DU9A 1I27A 1SFUA 1GXPA 1TW2A 4TV7A 4U0WA 2VC1A 3QRFF 5F1RA 4ZH4F 3T8TA 3K1MA 4I0BA 3DXJF 2V1XA 1ON2A 2IW5A 2OZ6A 2WV0A 5E1XA 3KLNA 1PUEE 4PZJA 4FX4A 1HW1A 1WQ2A 4HX8A 4LFUA 4E70A 1T2KA 3EUHA 5H6RA 3RPQA 3LAPA 4KT5C 4IJAA 3F6VA 3T1BA 1F4KA 4HF0A 4BH9A 2A07F 5LRRA 2Z99A 1YW9A 2RNJA 1J75A 3KP6A 5H6QA 3S2WA 2Z33A 1KU7A 4P9UA 1B9MA 3BJOA 4JQFA 3J80Z 4ZYHA 2HYFA 1D8JA 5BPDA 5FD6A 2O0YA 3E6DA 2GZWA 3L09A 5HOOA 4ZZLA 1G3WA 4KIFA 2LSOA 2X4HA 1FNNA 3ZQ7A 2K7LA 5DUIA 3WGIA 3RYRA 1TQPA 5LGNA 1HW5A 4D0PA 4KIGA 2IA0A 2K27A 2GAUA 2XVCA 4Q4ZF 4LK0F 4L18B 2LF7A 4G6DA 1SD7A 1XDSA 4CXFA 3L2CA 4P9FA 3KEQA 4BYYA 1IN6A 1BIBA 1FZPB 1YS6A 2VE9A 4U7DA 1G3TA 1QQIA 1HQCA 4RAZA 3F23A 4EJTA 2HKOA 4DQ2A 3U9GA 4EM0B 3I59A 4LLGF 4WX9A 3K0LA 2QBYB 4HX7A 2KIMA 2MH2A 3NEUA 3MZHA 4M9XA 2DTRA 3SQNA 2AXLA 5DD4A 2QZ8A 2F5FA 1ZYRF 2A69F 1MKMA 1FYMA 2JRTA 2VE8A 1ZG1A 3Q5FA 3SHFA 1X3UA 3L7WA 2IT0A 1FWZA 1QO0D 3CLOA 1YYVA 3C1DA 1B6AA 4HOBA 3LAJA 4G94A 2CWEA 5DD8A 4NB5A 3BJAA 1CGPA 3WTVC 5E1WA 4O3MA 4M9SA 2HYGD 4HQEA 2VOOA 3BOQA 3CUQB 4RB3C 2QQBA 4OINF 5D4SA 1VTNC 3F22A 2P6SA 1R23A 4M73A 2HZTA 3BWGA 1DPUA 1UHMA 2GA1A 3IC7A 2OQGA 2XHKA 4WXDA 1UCRA 1C0WA 2CQKA 2ELHA 2DK5A 3MAJA 2QWWA 1CF7A 3HRSA 4KA4A 4KICA 1U5TB 4ESBA 2KRFA 2Y75A 3K1NA 2XAGA 3F6OA 1RUNA 4XSXF 4HZFA 2HTSA 3KZZA 3GLXA 3VEPA 3EDPA 5JHUA 1TBXA 2FU4A 4RB2C 3E6MA 1BBYA 1A04A 1IAWA 4JBAA 3W6JB 1OPCA 1D5VA 5E8IA 2FXAA 2DFIA 4HQMA 1TTYA 2HQNA 3O6BB 5D5UB 1IXSB 3D5LA 1WSUA 2XV4S 1XGSA 5IT9Z 2XAHA 3BZ6A 1QZZA 2DT5A 1RUOA 1P4XA 3E5QA 3CTAA 1XCBA 2RKHA 2O61A 4LLNA 2L4AA 2M1BA 1TW3A 1STZA 4IRIA 3DKWA 1ZGAA 3QP5A 3GYHX 2VT2A 2E1CA 4UVAA 1W7PD 2D1HA 2VBYA 2G7UA 3J81K 3WTYC 2HDCA 3C7JA 4MTDA 4ZYDA 4ENMA 3HSRA 3DPLC 4XLNF 5BPIA 3DV8A 4B8XA 4EJUA 4L0ZB 3RKWA 4CICA 5DEQA 2M45A 1YO5C 1BJAA 1JHFA 2UZKA 5E1ZB 5AIPA 2EV5A 1U5TC 2RVCA 1OYIA 1XD7A 2JPCA 3F8NA 2VBZA 3G3ZA 4LJZF 4LLLA 2VBXA 3TDZC 2MLKA 2EFQA 2IP2A 3LSTA 2PLYA 4L5JA 1ZRCA 3V4GA 1GHCA 2V1UA 2CFXA 2EWNA 1RNLA 3QAHA 1V3FA 4OIQF 5AONA 2STWA 1EV7A 3KE2A 2HS5A 3PQKA 2NNNA 2EFWA 1K7AA 3GX4X 3FX3A 2BBYA 2LKPA 2IA2A 4M6YA 2BV6A 2HOEA 5LLQA 2EFPA 2HWVA 2CG4A 3MCZA 4XLPF 2XASA 1OYWA 5ICCA 4YFXF 4U88A 1D8KA 4KIBA 3BROA 4GCVA 4HF2A 1I1GA 4HDUA 3ULQB 1MZBA 2QENA 5DV5A 3E3VA 3WE2A 2O3FA 4Y15A 3NQOA 3QU3A 2KIUA 4IRHA 1IUYA 1ZN2A 1O7FA 1MDMA 4EM2A 1G3SA 1BI1A 1AOYA 4LMYA 1TLHB 2TDXA 2M5WA 2RDPA 5ILSA 2KJCA 5E17F 3V8LA 1OYYA 3J80K 3K1PA 1FY7A 3CO6C 1Z6TA 2FSWA 2F5DA 3V7RA 1B59A 5L3BA 2NAZA 3DFGA 1S3JA 2PI0A 1XMAA 2GXBA 1R1TA 3VB2A 4HLYA 4KYWA 2PFBA 2H27A 5K1YA
chains in the Genus database with same CATH superfamily
1UZCA 4IHYA 2BVMA 5K5OA 5CJ9A 3CMMA 4BEHB 3BT9A 2BZTA 1SD6A 4PK4A 3ROUA 4U0YA 3DF8A 5L3EA 2MFZA 2E7XA 5CVUA 3J81Z 4N0BA 3ZN1A 4UNOA 1MNEA 3JRFA 3W6VA 2EK5A 3P5JA 4WF2A 2MBFA 2MLGA 3D5RC 2BGCA 5EF6A 4ZYEA 4DGWB 1F36A 2D45A 4A5MA 2GXGA 3ZCOA 3ZQHA 2O5RA 2VB6A 1PYVA 3X2QH 4BGDA 3SZGA 1GXQA 2K3FA 3BTLA 3FXOA 4X0GA 3OS0A 3I64A 4UHTA 1JJ6C 2H09A 1IRFA 4M3FA 2P0WA 2L54A 4BQNA 4UVBA 1YRNB 2QM3A 3R0JA 1R1VA 3E1SA 2WB1N 4EMSA 5EGOA 2BVLA 2BHYA 2B0LA 1SFKA 3E5XA 3HPHA 3ZGKA 1SMTA 1YE9A 2ZMEA 1PDNC 2D1VA 3WTTC 2Y9ZA 2EB7A 5JR3A 1GVJA 1Y0NA 2UXNA 3HTUA 3O8HA 2EH3A 3LQRA 2UV1A 3F8MA 4LB6B 3MVPA 1I5ZA 1MBGA 4M6XA 2E2HJ 2KISA 4A6EA 2W7NA 3HTSB 4NHJA 1W5TA 2CYYA 4BACA 3VFZA 2VXZA 2KIQA 1ULYA 1SVOA 3K4KA 2IAIA 3JAMZ 3PIPF 1FIPA 3FBNB 1HW2A 1BR4A 2VLAA 1G59A 3PM1A 2FRHA 4UV8A 1B72B 1IXRC 1MH4A 2LBFB 3BG3A 5J4YA 3EUHC 4B1RA 1V4RA 2LYCA 3H5RA 5ILVA 1Z67A 4HAMA 4WXCA 2HQRA 4RGXA 3CLQA 4AC0A 4N4OB 4LG0B 4HV5A 1XCVA 2VODA 3ZXSA 3PNYA 3DPUA 3CJQB 1WI3A 1T6SA 5LEJA 3HOVJ 2QLZA 3IP4B 3ESWB 3ML6A 1JTYA 3E7LA 1LB2A 1HC8A 4A0XA 3LSMA 4MEYF 5J8FA 3HSEA 1T39A 3MZYA 1K83J 2GWRA 5K5RA 2M30A 2HOAA 3V8KA 4AUXA 1X1CA 4EV0A 3ZMDA 4FX0A 4IHSA 2J5OA 2JA8J 2FQ4A 1G3YA 2DJNA 4PJMA 5J40A 3OSGA 1YTYA 2TCTA 2X1DA 1U6GA 2F6CA 1BJZA 1KU2A 4PFPA 1QBJA 3G1LA 2XIGA 4FHTA 3ABMH 1LPQA 1E17A 2FA5A 1P4AA 3I58A 5BOXA 3FXJA 4R8HA 4UXNA 1MBFA 3DU5A 4XBFA 2G0EA 4P1WA 5HDKA 2VOPA 2XROA 4RAGA 4OOIA 1M1EB 3ABKH 4LGWA 3CCUI 2R7SA 2F4OB 3H3UA 3MKYB 5J1UA 4A3LJ 3K4LA 2EILH 1HLVA 3ERMA 4JYKA 1TNTA 4HNTA 2V9VA 3GZ6A 1KONA 4AM3A 2Z9OA 2BXZA 2DQLA 4QWQA 1RC9A 5F08A 4CA0A 4A3IJ 2FOWA 1E2XA 5EEGA 3QPHA 1RRJA 2H94A 3LMMA 3F21A 4UB8C 2M34A 5D5WB 1N25A 2IEKA 1SFXA 2DMNA 5D4RA 1T0FC 3JTGA 4FE4A 2PBIA 2A6EF 1T98A 2DLLA 2PJRA 3OYBA 3IHUA 2QA4I 4BAYA 3CC7I 3ELKA 1FIAA 3OYKA 2F2EA 3SZPA 4MGRA 1ZH5A 5F1JA 1YW7A 2P5KA 2MYSA 1E3OC 1K78A 3UR3C 1RETA 4LIVA 3MQ0A 2R4GA 2Z2SB 4I7HA 1XC5A 1YIOA 1X2NA 4EVIA 1ONVA 5TJJA 3ZMSA 3SXYA 3JRAA 2R5ZB 3O3KA 1LDDA 2ZFUA 1W36C 1YW8A 2OCCH 1IN4A 1OJLA 2A3SA 4F7ZA 2EA2A 4N4NB 2DK8A 2DW4A 2ZXHA 4E6KG 1BR1A 2EA4A 1R5GA 4AIHA 5FO5A 2G9WA 2V4JC 1TT5B 1UFMA 1G8XA 1FSEA 3CJTB 5JLWA 1ON1A 2IXSA 3S32A 1FLIA 3M7GA 2L9RA 1H8AC 1TQIA 2P6TA 3TP3A 4QTRA 2GOXB 5KAFC 5IT9K 2ZKZA 4ESJA 2ESHA 2A6TA 4OIPF 5KCMA 5JFRA 4XN3A 2PMHA 4XLCA 1WHUA 5FD5A 1VFCA 3PIOF 5IT3A 2ISYA 2HNHA 4O5VA 4A93J 3AG1H 3RYPA 1D1BA 4M9ZA 3ZRGA 2WTEA 2P81A 2QEXI 2K3PA 1WJDA 2NOJB 1X4OA 2ECCA 1ZAOA 2DAOA 1W7PA 5IP6A 1VQ4I 3FXMA 5JVTA 3LA2A 4BKXA 4KDPA 5J8CA 2QQAA 2M4GA 5B1BH 3FF5A 2LLKA 4S04A 1AKHB 2RV8A 2W48A 3LSHA 4L5IA 2L01A 4RMNA 5ICFA 5K7HA 1T8IA 1VQ5I 2GQQA 1Z0XA 3KETA 1P6RA 3WTXC 2V1DA 3JTHA 4FASD 2PG4A 4BHPA 1NH3A 2COMA 3GTKJ 1REPC 2HU9A 4OIOF 1YFHA 1JKOC 1FTTA 1KYZA 1KU9A 2ZJ2A 1IRGA 4BE1A 2K02A 2JUCA 5EG0A 1FYLA 2UWMA 2F5EA 4YIIA 1YJ9I 2R0QC 3M9AA 5FKMA 1MMAA 4EM1A 5CVRA 3KP4A 4IXAA 3TQNA 2BW3B 1FJLA 3SEQA 2M87A 4CSWA 1FMWA 1Y1WJ 1WJ5A 1SVLA 4W1UA 1S8NA 2OTJI 3GO5A 3GTLJ 4EGYA 1GVDA 4BQOA 4CCLA 2K4JA 2V6CA 4RB1A 2FOKA 1IN5A 3ABUA 3BR2A 1KQ8A 3BR6A 3ECHA 1X58A 5J47A 4AWXB 2IRFG 1FP2A 2IPQX 2O6GE 1DP3A 3TOAA 2Q0OA 1PUFA 4CHUA 1HCRA 1ORKA 3GEZA 4L9JA 2VQCA 2ACJA 3GFLA 1KA8A 3BPXA 1B8IB 4GYIA 1MBEA 4DNCA 4UUSB 2EV0A 2RN7A 4NC6A 2V26A 2R7DA 3P9IA 5F04A 2HXOA 2IGNA 3OYMA 4DYRA 4V19K 2JN6A 2EV6A 2HTJA 4XRFA 3OYAA 2CW0F 2Y9YA 3W3CA 1ZGJA 5IP7J 3NAUA 2CMPA 3O2PE 3PQJA 2HPIA 3ZMTA 4I0AA 3HOUJ 2EZHA 2GIVA 1Z91A 4G7ZF 1OCZH 1YJWI 3MZ8A 5CLSA 5J1YA 3HC7A 4D5CA 2E35A 3R6SA 4BL0B 4R79A 3EETA 3HZJA 3IH3A 1WGXA 2VQGA 3Q9SA 2AQFA 2QCOA 4C2MJ 1QPIA 1O3QA 4GYGA 1NTCA 1POGA 3HHHA 1HA8A 2R5YB 1LNWA 2XUBA 2CV1A 2FBKA 3VYSB 1PP7U 1DU6A 3E5UA 2RC4A 2DODA 2R7UA 4NDLA 1IW7F 2CH0A 3FXRA 2K9SA 2ZNYA 4G6TB 1VQ7I 2VQLA 2HXIA 5L3DA 3FHZA 4CZCA 3CJRB 3TDUC 3OV8A 3GBGA 4CYDA 1HKSA 4XK4A 1HBXG 3ZMZA 4BY7J 4LD5A 3A0HC 1AWCA 2K9QA 2JA7J 3LWFA 2DQRA 4BHCA 2Q8KA 4L9VA 2FE3A 1OKRA 5EZHA 1K6OA 3HRMA 1ZLKA 4BJTA 3G6EI 1DQUA 2XPWA 4NNJA 4G12A 2BE5F 4EEFG 4C2UA 2COBA 2CGPA 3M3YJ 2F4MB 4RM3A 3M8EA 4CCJA 2R93J 1KQ9A 4PCQA 5C3EJ 1A6IA 3F72A 4I99C 3FXUA 1O7LA 3R60A 5ERIA 4F3QA 5TGTA 3GFMA 4HA8A 3K69A 4FT8A 2ME0A 2E2JJ 2DA3A 1Q1VA 2L7ZA 1QPMA 3DQVC 1XGOA 1YG2A 2BYVE 2X51A 5J1RA 4JX6A 2F5VA 2QBYA 1ACIA 3QYBA 4AVPA 3IV5A 2E71A 3BG5A 4GFBA 3DU6A 5FKLA 1W0TA 4KITB 5F6FA 2V6EA 3IUOA 4HNVA 5F64A 1O4XA 3MN2A 2XF6A 3WTZA 4HEA2 5E3OA 1U8RA 2K9LA 3BLYA 5H2FC 2LF8A 1TWAJ 1VQ9I 2DPUA 2BY3A 3K9TA 5LHHA 1XB4A 4KISA 2LP0A 2ISZA 2L02A 1W36D 3HUGA 3FMSA 3U2RA 1BA5A 4OAZA 4WCGA 1GUUA 2WAFA 1FBQA 2Q1ZB 2FF4A 4PJNA 4M3GA 2K9MA 4RB0A 2PX9A 1Y56A 4M71A 4A3EJ 3HKZA 3M1EA 4S05A 4J01A 3QYEA 2QSGX 2O8KA 4ESFA 1W5SA 3N4MA 2MGQA 1H0MA 3ZQLA 2QVOA 2KDOA 4FQGA 4XR6A 2A5YB 3HIFA 1XGNA 2YS9A 4PUSA 2CRGA 3BR5A 3HOTA 5DCMA 1OR7A 1F1ZA 5FGMA 1HDPA 2ADUA 3B02A 2W4SA 2KIFA 3K70C 2F5CA 3LOCA 2Z5UA 2ZO4A 3C2HA 3K4CA 4YFNF 2Q2EA 3NWSA 4CDGA 4D7MA 2I5UA 4PFOA 2W82A 3WU1B 3CUQA 3QU6A 2YR2A 3Q9VA 3JAMK 4PDKA 2AO9A 2Y0SN 1FSHA 1WH7A 2M3AA 5HVQC 5FLMJ 4U7BA 2W1OA 2P5LC 2H1LA 1MNMC 3AG3H 5GAGJ 2DMTA 4A12A 1UELB 1KQ0A 2WBMA 3TOBA 2ZBKA 3G2BA 2FMLA 3HOXJ 4AVZA 2DDBA 1S29A 3MEXA 1FBUA 2AXTC 3S2HJ 1RR7A 5LGTA 2P7VB 2CU7A 4HX4A 3LL7A 1JHHA 3EPZA 2CW7A 5CVIA 5FKNA 3GZ5A 1MBJA 3CCMI 3JRCA 4FCYA 2WY8Q 3GVAA 5J3LA 1NG7A 1U5TA 2IVMA 1P92A 1R00A 1ZLJA 3WTWC 2R7VA 2OBPA 3VYTB 2MD5A 1EH8A 4YIFA 2RREA 1V5FA 5D8KB 3ZPLA 1LEBA 2HVQA 3PFIA 4LITA 2WB1A 4V2FA 1MSEC 2DCEA 1ZHFA 5HNFA 4KMFA 3CC4I 1LFPA 4BXFA 1EKEA 2M0CA 2VT3A 3VODA 1KYWA 2XB5A 2K40A 1R9TJ 1DGRM 5ILUA 2R7RA 2IA1A 1BR2A 4XRMA 1WJAA 4A3DJ 1IV8A 5J4VA 1ZG3A 2XPUA 3FHNA 4MQ9F 2FMYA 4OMZA 3H5NA 4ENKA 2ZFWA 1LDJA 1Z9CA 3HG9A 3T0YA 1I50J 3VOEA 4EJWA 4Y13A 2HR3A 4WK8F 3E0JB 4ZZDA 4LB5A 3LQQA 3M8JA 4Q47A 3AL0C 4II3A 2HDDA 3BCBA 4ZDOA 1B1BA 2KRCA 1WI9A 1XDUA 2JWTA 1YOVB 2CFOA 4AU7A 3CCEI 1RZ4A 2HQ5A 2J5PA 3S16J 2JVHA 3K10A 5KAIC 2KKOA 1EH6A 1BN5A 1OCPA 3I54A 1FEXA 2JSCA 2KJBA 1XG1A 4XKCA 3I56I 2PMUA 2ZJRF 2YU3A 3WU2C 1O57A 2FD5A 2L0KA 3ZMVA 1BI0A 5ICEA 4ENJA 2NVXJ 2Z3YA 4ZYGA 2M0MA 2ZCWA 1J09A 1WJCA 2W00A 2X0LA 3J7ZI 5BNGA 1TWFJ 1BI3A 1Z3YA 4L5EA 2BXYA 1VI0A 2OC6A 1NHAA 4BNCA 2LY2A 4MTEA 3W6KB 3OY9A 3WODF 2LG4A 1JGGA 1J9IA 1DUXC 4L0YB 3QOEA 4HBLA 2L9VA 2MC3A 3H3ZA 3I4PA 3QOPA 2L7KA 1G6NA 5A2QK 4RGSA 3FM5A 1LDKB 2YX7A 1F5TA 1YQAA 3KP2A 5HDNA 3RI4A 2B7EA 5D6FA 2M8EA 2B9SA 1BW6A 1D0ZA 4OU0A 3BJ6A 2BY0A 2MA3A 2NS7A 1B4AA 1GV2A 1SD5A 4AIKA 3DBLB 2XGXA 3KFWX 1XSXA 4BY1J 4G6QA 3I9V2 1U3EM 3TBIA 1XX5A 4EJVA 2FBIA 5C4JJ 3BG7A 1QZYA 3IL2A 1ENHA 3C3WA 3EQLF 4NBQA 4U87A 4KMUX 2ZB9A 1VF9A 4JP0A 4HDVA 2OUMA 1O3RA 2LDUA 3K4MA 1R71A 3RKXA 4HW0A 3HGYA 3S17J 3BR3A 3H0GJ 1MSFC 3C18A 3K6GA 5IYDJ 4AD9A 1GV5A 1K4SA 4BHBA 4ETSA 3ZQCA 4LK1F 1UG2A 3GXOA 3GUDA 4N9HA 1V54H 3HJEA 4XM3A 4ENNA 5LEKA 3ZMUA 3J7AY 5ICGA 3WTSC 2VPRA 3S1MJ 3CESA 5LHGA 5DDGA 2X6YA 2LK2A 3GCMA 3OIPA 3KP3A 3NRVA 1BL0A 2OQRA 5HDGA 3RDIA 1O3SA 1K4TA 3I59B 1ZARA 1BIAA 3K7AJ 1X3WB 4HYEA 3U1KA 2ZXWH 4RA2A 1P7IA 2XC7A 3QPTA 3MWMA 3W2AA 1VQKI 5HNHA 1SFEA 2YX4A 2FBHA 4NC8A 3OYGA 1ETVA 2GIZA 3S3NA 3E97A 2MH9A 3EYYA 3I71A 2RNGA 2OU2A 4QLCU 2CQXA 5DM7F 3OMYA 1DP7P 3SZTA 1ZK8A 2EPFA 4WWCA 1SD4A 1USTA 1X2MA 5EDNA 2Y0MA 3TKYA 1BC7C 3A01A 4MIMA 4MEXF 2DBBA 3KCCA 3OYLA 4JOMA 1D3YA 2ELJA 3G1MA 3CP8A 2XRLA 4MQVA 4UY8I 3GTQJ 2WAQN 1XSDA 3WHBA 5EG0B 2ZJQF 1EA3A 4OIRF 2A68F 4JK1X 4NQWA 4Y3OA 1Z1DA 1AHDP 1YI2I 2ECBA 1AU7A 2PJPA 3KLOA 5AIQA 3QYFA 3BR1A 3I53A 4MLOA 2ZSIB 3MKWB 1WRJA 1FP1D 2BHZA 3AG4H 3RCOA 3RKYA 3F8BA 4D1QA 4RDUA 4AYBN 3AFHA 1TWGJ 3UNGC 3LFKA 3K70D 4XSZF 1WKMA 5JVGF 1VQPI 4JX4A 3S14J 3IRRA 3F8FA 2VPLA 2VJ5A 2NYXA 1S72I 4DW6A 4A69C 2JA5J 2EZLA 2R7FA 4E7IA 2D2WA 2EZIA 2XRNA 3G73A 1I6HJ 4MFDA 2L9SA 4A0YA 2HVRA 2QGUA 1J2XA 2LVSA 2KL4A 2WC2A 1W1WE 3TO9A 3WU0A 2DO7A 2P8TA 2X1CA 2HQAA 2VJ4A 4BS9A 1LVAA 3FISA 3LSGA 2LY1A 5BMZA 1P2FA 1L3LA 3WG9A 2RQQA 5GPCA 3LSRA 1IN7A 5HLTA 4B09A 4CYCA 5FFZA 1CF7B 5H20A 3H5AA 4IHXA 3TO6A 1I39A 5GTIC 2WV1A 4E4HA 3TO7A 1HXDA 5IYCJ 1K79A 2GOMA 6PAXA 1MGTA 2HGCA 3FKIJ 3AG2H 3FM3A 5CQGA 1OCOH 4BEHA 2DOEA 2M7BA 2WAEA 1LJ9A 1MJ9A 3R0AA 4I76A 1ETYA 3M8FA 3N05A 4B47A 2DFEA 2HVSA 2CUFA 5CKTA 4Y17A 5A2QZ 1FOKA 4ABZA 5GAEJ 1HDDC 4BXUA 1K61A 2OD5A 2IGMA 3FMRA 3D5SC 2DA5A 1JE8A 3F3XA 3KP7A 1S7OA 3V7SA 3N97A 1T38A 1PVEA 3V42A 4ON0A 4G7OF 3PJRA 3F9KA 3PNVA 4P5OA 3TEDA 3HSFA 1RKWA 2STTA 1HKTA 4U0VA 1Y1VJ 3R61A 3IKTA 2ZXJA 5E8GA 3RPUA 1BM9A 3VDXA 3LSKA 1H88C 4DBQA 1ZRDA 1LQ1A 1QVUA 1R6RA 2E60A 1X1BA 3GFIA 1IUFA 1R5HA 2IJLA 1T0FA 1YX3A 1YRNA 3WE3A 3MD2A 4XL9A 3HBLA 5M3FJ 2HOTA 4IF4A 4C30A 2R3SA 2DI3A 4Y4RA 1RPWA 2DMQA 4DZJA 5TRDA 3DEEA 3SFZA 2O8XA 4ASNA 1DDNA 1S7AA 5CYVA 1XTAA 1F9NA 1QNTA 3EUKL 2FQ3A 4DZPA 1B9NA 4IVNA 1UB9A 2M7AA 2P5VA 4G9YA 3L9FA 1PP8F 2EIKH 2C6YA 2R92J 4E7ZA 1IZ1A 2M4KA 5E18F 1TL8A 2L4MA 3MMYB 4XQFA 4MHGA 4A2UA 1TP4A 2XKOA 1BC8C 5DTDA 1JI8A 4GO1A 4CZZA 2JTVA 2ETHA 2EZKA 3REOA 3BPVA 1LE8B 1B72A 3SDBA 2NXNB 3DEUA 4YG2F 1XN7A 4F92B 1J7KA 1UHSA 3TP0A 4WXHA 1ETKA 3DLAA 3WHCA 3KEYA 5L3CA 5KVRA 2YUSA 3CCQI 3FXQA 4LG0A 2ZSHB 2R7WA 4I01A 3FMQA 2BOLA 5LRSA 4KNYA 1H9TA 4ZYAA 2LH9A 4HV6A 1DU0A 4RGUA 2XAFA 2N8GA 4RAYA 2OZUA 3JSPA 3ISPA 2E7WA 4YRVA 4CO8A 3HOYJ 4RM2A 4IL6C 1A36A 2K4BA 2VC0A 3LA3A 2H6CA 2O03A 4XKWA 1LEAA 1KU3A 2P4WA 3HHGA 4QSHA 2XKPA 1HKQA 1Z21A 3P9KA 3A0BC 1D0YA 5FRMA 2JPBA 2QQ8A 2XF5A 1HSJA 3JRBA 5IOZA 2FNPA 1RESA 4BQQA 3T5XA 1A31A 1EH7A 2E19A 4C3HJ 5M5WJ 2YSRA 4RS8A 3KYDB 4Z2YA 3B6CA 2XAQA 4UUVA 5DCMB 5HS8A 1O3TA 2CUEA 1J5YA 1S9HA 1LFBA 5M3MJ 5L3FA 1RI7A 1TWCJ 2VONA 3B73A 3CUOA 3CCJI 3FK6A 4J00A 1FOXA 4ZTFA 3CCVI 2XGDA 3WG7H 4W97A 2M2EA 2JZYA 1W4MA 1Y0UA 2NVTJ 1TC3C 2F48A 3TW6A 1RKTA 5HLGA 3ZP5A 2R7TA 4I09A 2FEZA 3HRTA 1ZRFA 2H8WA 5HS7A 4P96A 1J0RA 2PEXA 2JRMA 3Q0VA 4M72A 4C3JJ 3L2QA 1R4MB 1U0JA 1SC7A 2W84A 4GGGA 2KT0A 1ZR2A 3GF2A 3KPHA 2F4IA 5DCFA 3TMOA 5D6EA 1R49A 2EIMH 4LIUA 2HEOA 1N78A 2K86A 2LNBA 2EJRA 3CO7C 2IS4A 2R5ZA 5LGUA 2M8GX 5GP9A 3TGNA 2Y0SA 2NVQJ 4CGZA 3HDDA 1SFOJ 3OWTA 5CVJA 2P7CB 3WTUC 2JSPA 5FFXA 2CV0A 2W85A 5DUKA 5EYRA 2XAJA 2WWYA 3D0SA 3FWEA 2IS6A 5GTHC 4L9NA 2JMWA 2LKXA 1BI2A 3OYIA 1FPQA 1F43A 3CCRI 3BY6A 3PUBA 2KHMA 1MDMB 4Q5SF 2DFHA 4UB6C 2W24A 3M1CA 2DTZA 3PO3J 2UXXA 2I8DA 3KZYA 1OFCX 3KIOA 3DTEA 2V9PA 2OF7A 4AIJA 4I2OA 1ODDA 5CPRB 2PQ8A 2XF7A 4BUPA 4XICA 4HG2A 2AQEA 4XKBA 4XOPA 2YU9J 5HLHA 5J6XA 1QGPA 5E20A 1HF0A 4HLXA 1WFXA 3MFKA 1AA7A 2XSJC 2VKHA 1G4DA 2DA7A 4A5NA 1K6YA 3IAM2 4IRGA 1FT9A 2JT1A 3JREA 1LFUP 1HOMA 3LA7A 4P55A 4XN0A 3ERED 4C9YA 2JVGA 3CMEI 3IH4A 1AKHA 4OAYA 2NS8A 3BDDA 4I98B 2A6HF 5KNLA 1U2WA 4HNUA 3JRIA 1R58A 1HSTA 2NNYA 4IKFA 3CUQC 4A0ZA 3GFJA 3TL4X 3L1PA 3AL0B 2GXAA 2KFDA 1JGSA 2VKEA 2DMUA 4PJJA 1IF1A 5B5EC 3H9GA 1QHHD 2MABA 4IHVA 3DKYA 3SEZA 3CF5F 4G7HF 3V7CA 2L7FP 4E7JA 2OPTA 2A05A 5D5VB 4M74A 4RLQA 2JUGA 3OOPA 2JJ7A 3GTPJ 4X6AJ 4MNUA 1FTZA 3FXLA 2X9DA 2OTLI 3JRDA 1TNSA 3IKVA 3J7YJ 4A3KJ 1ETOA 4MO7A 4O6JA 3CMYA 1WZ2A 2Y48A 2K85A 2PMZN 3OSFA 2ME6A 5KHDA 1X19A 2R7QA 3V8JA 1XS9A 5FLXK 1FYKA 2DDAA 3HPGA 1IC8A 2A61A 3U21A 3LSJA 4DIQA 4XMYA 1Z7UA 3BTJA 3OIOA 5EGOB 2EFOA 3I0TA 3ABLH 1JTXA 2CSOA 1WCMJ 1BOAA 1E3HA 1ZREA 3GWZA 3CD6I 2E1NA 1VQOI 2ZMEB 5E79C 3OR1C 1D0XA 2G7HA 4IHTA 5M5YJ 2V79A 5D5XB 3CJNA 4DBRA 3RIRA 1B8IA 1SAXA 5HLIA 3FDYA 2X6XA 3KEOA 4XLFA 2VN2A 4MFEA 1QZEA 4JX5A 1W5CC 4BBRJ 2JQ7A 2FNAA 4KFCA 2E36A 2QYOA 1Z3XA 4N9IA 4E7HA 1ZG5A 2OAZA 3FZVA 2ICWG 2JK3A 4ITVA 3IWZA 3JSOA 2R7ZJ 5IYBJ 4Y7NJ 4EQQA 4ZC3A 1FC3A 2GA2A 1XMKA 2CV2A 1YX5A 1V5GA 4D5FA 3T8RA 3BTIA 5ED4A 3SJMA 3WGGA 1XMXA 1E0EA 3U1DA 3E6BA 1PJRA 4G8XA 1U78A 1FX7A 3QQAA 1XGMA 3HB9A 5DYMA 2RQPA 1FBSA 2JA2A 4BJ6C 2R5YA 4M3DA 4XLAA 1UHWA 2QQ9A 3P9CA 1W0UA 2NS0A 4C3IJ 2MG4A 5LHIA 3IWFA 1OMIA 4RGRA 2RGVA 1R1UA 2ESNA 2Z1DA 3JW4A 3W2WA 3G71I 1QA6A 1MD0A 2VIXA 3CDLA 5DS9A 3QODA 1DPRA 4A3CJ 5EEHA 1VZ0A 3HRUA 5IOYA 4PJ0C 4NQWB 2ZXIA 1NK2P 2DYSH 5CVVA 5FB2A 3VYRB 4OMYA 4KN4X 2W25A 1IV6A 3DWLE 1RIOH 2LTPA 2KLOA 1Z6RA 5FLVA 3LSIA 5JI6A 5BS6A 5BQTA 1YITI 2H6BA 4XORA 5FKKA 3AAFA 3S3MA 2AS5F 2DPDA 4IEJA 4QPQA 1SANA 4A3BJ 2LC2A 4UV9A 3M07A 4XOTA 4EJOA 2ZNZA 3J7AO 4PGHA 3ZN0A 3GW2A 4KUMA 3A4CA 2HPMA 2VI6A 2L7MP 3ASNH 1EJ9A 1Z05A 1ZTRA 2WAQA 1FOWA 2WADA 3EYIA 1WPKA 1U9OA 4EATA 2PJRB 5B1AH 4D9JA 2HI3A 4YFKF 3L00A 4IPAA 1L0OC 3K2ZA 3F8CA 3RZOJ 1ETXA 1I6XA 3OOUA 4AIDA 1IN8A 2ZMEC 3RTRA 4BQAA 1MMSA 2FUG2 1Z7LA 2OA4A 1K78B 5LBQA 1IG7A 3ECOA 1Y8RB 2ID6A 4RBOA 2BY2A 4AYBA 2XGEA 2ZJPF 1MJAA 1WWXA 1J59A 1FMVA 3H9QA 1ETQA 5IY5H 4Q48A 3HOSA 3DCFA 1SVMA 1IRXA 3HYIA 4PGGA 1YLFA 5CQEA 4H0EA 1ZELA 2EFNA 4PSXA 3S1NJ 4YELA 3E6CC 4DYCA 3OYEA 3BCAA 1JKRC 1R36A 4KN7X 2E1MB 4A6DA 3CCYA 2LR8A 2M9HA 1SMYF 3QP6A 2HFHA 3Q3SA 4BU2A 1MMNA 4HSRA 3BP8A 5F27A 1IXCA 3H92A 5HS9A 4NC7A 2IGOA 2X48A 1Q1HA 2E5ZA 3PNTA 4S0HB 4CCMA 1YS7A 1MJBA 1A5JA 3CP2A 3CF2A 3CDHA 4UVCA 3KP5A 2QUFA 5D8LB 3R4KA 4BDZA 1ZR4A 1S6LA 3I5UA 3GTOJ 1KGSA 5FLXZ 1UG0A 1T56A 5K5QA 1I1SA 4RLFA 3PO2J 2DA2A 4A3JJ 2X85A 3S1RJ 4GXOA 4R1HA 2NRAC 3DPTA 3RKQA 5GAHJ 3SFIA 3JRGA 2VBWA 3HEFA 2CUZA 3ZQIA 3C2GA 1JXSA 2L9NA 2CO5A 4I02A 1R7JA 3L2WA 1W7PB 4V2GA 3HOZJ 4L9TA 4QPOA 2YPRA 1NG6A 4CCNA 2PN6A 3IRQA 2BEOA 1T08B 4IO9F 1XSVA 5LFAA 2KDZA 2W57A 4I6ZA 4EGZA 2K5CA 3DP7A 3RJPA 1S7EA 4DJAA 4HF1A 1TQMA 3HXLA 3RQIA 1RR8C 2NVUB 3RQ4A 3ABTA 4K2EA 1H9GA 2L3DA 3P7NA 4YEJA 3S1QJ 3JRHA 2IBDA 5B3SH 4B44A 3COAC 2ZC2A 1P4WA 2EQRA 3WGHA 1USSA 1R22A 3BR0A 2LFBA 5KK1A 4F52A 5L3GA 3I55I 1I27A 2DU9A 1GT0C 1N75A 4C2TA 3MKLA 1SFUA 2L2OA 3PFYA 4HPQA 1U8BA 1GXPA 1ZKGA 1TW2A 4TV7A 4U0WA 4A3MJ 2VC1A 4IX7A 3QRFF 5F1RA 4ZH4F 3T8TA 3D1NI 3K1MA 4I0BA 3DXJF 1OCRH 1WH5A 2V1XA 4FE7A 4E7KA 1X1PA 1ON2A 5C4XJ 3B6AA 2CUJA 1Y6IA 2IW5A 2LREA 2OZ6A 2WV0A 5E1XA 2VASA 2R7XA 4B43A 2DFFA 2AHQA 1QHGA 3KLNA 4CH7A 3NARA 4PZJA 3ZR8X 1PUEE 4FX4A 1HW1A 1WQ2A 3BZCA 4HX8A 4LFUA 2VXDA 4E70A 1T2KA 1D1CA 4Z6YA 3EUHA 3CCSI 5H6RA 3RPQA 1P9QC 3LAPA 4KT5C 2V7FA 4A3FJ 4IJAA 3F6VA 2E1MC 3HM5A 3T1BA 3OYNA 2K9NA 1PUFB 3OYDA 1F4KA 1JUMA 1R5ID 4HF0A 1OCCH 4BH9A 1NK3P 4PSWA 2KZVA 3H35A 2A07F 5LRRA 2Z99A 1YW9A 3AKZA 2RNJA 1J75A 3KP6A 5H6QA 1BOBA 1G2HA 3Q0UA 3S2WA 4B3AA 2Z33A 1KU7A 3H9JA 4P9UA 3DBRB 1B9MA 3BJOA 4JQFA 3J80Z 2HZDA 4XONA 2EINH 1JUSA 1V5EA 1LKXA 2Z16A 4ZYHA 2HYFA 1D8JA 3GTGJ 3QPSA 2CQNA 5FJ8J 5BPDA 4YIRX 3LNQA 2XAUA 1QU3A 3VSLA 5FD6A 2O0YA 3E6DA 1MNDA 1X1DA 2DOAA 2GZWA 3L09A 4ZZLA 5HOOA 2KP6A 1MH3A 1TWHJ 1G3WA 1ZQ3P 4KIFA 3RSNA 2I10A 1I3QJ 2LSOA 1APLC 2X4HA 3OL4A 3IAS2 1Y39A 1FNNA 4Y33A 3NWTA 3ZQ7A 1P7JA 2E5NA 2K7LA 2XDVA 3FK7A 4ZDLA 5DUIA 2TRTA 3BQYA 3WGIA 3RYRA 1TQPA 5LGNA 1HW5A 4D0PA 1WJEA 2IA0A 4FETA 4KIGA 3OS2A 1UAAA 2K27A 2GAUA 2XVCA 4Q4ZF 4GDFA 4LK0F 1X1AA 3UKGA 4L18B 5LD2C 2LF7A 4G6DA 1SD7A 1XDSA 4CXFA 1TZLA 3OL3A 2DOFA 2QKLB 3L2CA 3OR2C 2DT6A 2A5WA 4P9FA 3KEQA 4BYYA 4BE0A 3CQZJ 1IN6A 3H1CA 1QVTA 4H4KC 2QSHX 1BIBA 1MMDA 2DA4A 2LMDA 1MIJA 1FZPB 4F93B 2BY1A 1YS6A 3DTKA 4D7NA 3W2VA 2WA0A 3SDGA 4IQJA 2VE9A 5FRNA 4ANJA 4U7DA 1G3TA 2WY7Q 3ZQFA 1QQIA 1HQCA 3SYTA 2VUMJ 4RAZA 3F23A 2CQ7A 1SEUA 4EJTA 2HKOA 2FX0A 4DQ2A 3U9GA 4EM0B 5JLXA 3ZOBA 3I59A 4LLGF 4WX9A 3K0LA 3DEWA 2LD5A 1UJ8A 4BE2A 2QBYB 4HX7A 2LBFA 5GPAA 3DKXA 2KIMA 2MH2A 4ZJZA 2VJIA 1DGWY 3NEUA 3CC2I 1U9NA 3PUFA 1XPXA 1JT0A 4BBSJ 3MZHA 4M9XA 2DTRA 3QPLA 3SQNA 2AXLA 5DD4A 3OYHA 2QZ8A 2NVYJ 2F5FA 1ZYRF 1IJWC 2A69F 1MKMA 1FYMA 2JRTA 3OYJA 2VE8A 1LUJB 2V9KA 4E7LA 1S5LC 4II2A 1ZG1A 3HUGB 3Q5FA 4FTHA 1ERDA 2KPMA 3JCUC 2DJIA 2CS3A 4M6VA 2VQHA 3SHFA 1X3UA 3OS1A 5B66C 1YJNI 3L7WA 3A1YA 3VPRA 2MW8A 3DTIA 2IT0A 4M3BA 1FWZA 1QO0D 1X3ZB 2H1KA 3CLOA 4XLHA 1D1AA 1YYVA 3C1DA 2DA1A 5F0FA 1B6AA 4HOBA 1GLNA 2NOGA 3BG6A 3LAJA 4G94A 2KQRA 2XB0X 2CWEA 2O7OA 4RAFA 5DD8A 4NB5A 2HOSA 2UUZA 1MBHA 2HDWA 3BJAA 5EZGA 1CGPA 1T33A 3WTVC 3PL8A 1JT6A 5E1WA 4O3MA 2XGCA 1A6QA 3L2RA 4M9SA 3G4SI 3GTMJ 2HYGD 2Q2EB 1IDYA 4HQEA 2VOOA 3Q0WA 3BOQA 1ETWA 3CUQB 4RB3C 2H8RA 1VQMI 2QQBA 3QWLA 3CMAI 4LOCA 4OINF 5D4SA 1VTNC 3K2AA 3F22A 1E3PA 2KMUA 1R23A 2P6SA 4M73A 4IHWA 2HZTA 3BWGA 1DPUA 1UHMA 2GA1A 3IC7A 5JHFA 2OQGA 2XHKA 4WXDA 3K4NA 1IGNA 1UCRA 5EEAA 3H36A 1C0WA 1OQYA 2CQKA 2ELHA 1JUPA 1WJBA 3JR9A 4IOCF 2PMZA 2DK5A 3CCLI 3MAJA 2QWWA 1CF7A 2DMPA 3HRSA 4KA4A 1V55H 1VQ6I 3I4NJ 4KICA 1KZHA 3L2UA 1U5TB 5DM6F 4XKVA 4ESBA 2KRFA 3LFUA 2Y75A 3K1NA 4UUTA 5K7FA 2XAGA 3S2DJ 1OLTA 3F6OA 3DBHB 1RUNA 4XSXF 4HZFA 2HTSA 3KZZA 3GLXA 3VEPA 3EDPA 5JHUA 2MC4A 3H0DA 2CW8A 3OIQA 1TBXA 3MKZA 2FU4A 4RB2C 1X4PA 3ZQGA 4BXXJ 5K1YA 2DN0A 3E6MA 5F0CA 3S3OA 2VJJA 3ASOH 1BBYA 4XNFA 4XRSG 1A04A 1IAWA 5M5XJ 4JBAA 3W6JB 1ZGWA 1OPCA 3KYCB 3I4MJ 1D5VA 2DXIA 5E8IA 2FXAA 2DFIA 4HSTA 2B63J 4HQMA 1TTYA 2HQNA 3O6BB 3BQZA 5D5UB 1IXSB 3D5LA 1OISA 2VL8A 3C2BA 1N77A 1WSUA 2XV4S 1XGSA 5IT9Z 2L5QA 2XAHA 3BZ6A 4ZTJA 1QZZA 2DT5A 2OCEA 3KX2A 2DYRH 3O8GA 4CUGA 1R4NB 1RUOA 3CDIA 4XIDA 1P4XA 2GLOA 2E34A 3EUAA 3E5QA 1OR7C 3BG9A 3GMEA 3VYUB 3CTAA 1XCBA 2RKHA 2VKVA 3RPUD 2O61A 1Z77A 3LSPA 3BTCA 5EJCA 4LLNA 2L4AA 2M1BA 1TW3A 1STZA 4IRIA 5FROA 3DKWA 1ZGAA 4F91B 3QP5A 1LE8A 3GYHX 5IPAA 2Y30A 2VT2A 3G1OA 2E1CA 4UVAA 3S8PA 2MSYA 2ELKA 2RAEA 1UMQA 1W7PD 2D1HA 2VBYA 3KYLA 5E3MA 2EIJH 5K7ZA 2G7UA 3J81K 3WTYC 2HDCA 3C7JA 4MTDA 5GADJ 4ZYDA 4ENMA 3HSRA 3DPLC 4XLNF 2OJED 5BPIA 3DV8A 3L2VA 4B8XA 2X1EA 4EJUA 3HGGA 4L0ZB 3RKWA 4CICA 5DEQA 3RZDJ 2M45A 1YO5C 1BJAA 1JHFA 3BZKA 2IS2A 1MMGA 3HL2A 5FKOA 4ZDPA 2E2IJ 2UZKA 2GBYA 1Y8QB 5E1ZB 5AIPA 2EV5A 1U5TC 1JKPC 2BW3A 2RVCA 1OYIA 2LOOA 2Y2ZA 1XD7A 4FISA 3A2KA 2LY9A 3PSFA 2JPCA 2X6OA 2VBZA 3F8NA 3G3ZA 4X1EA 1A35A 3F0CA 4LJZF 2QF7A 2E1OA 4LLLA 4J19A 4IOAF 3S15J 4GRIA 1JJ8C 1GDTA 2VBXA 4XLEA 2MLKA 2EFQA 2IP2A 3TDZC 4KJZA 4E7SA 3LSTA 2PLYA 4XRSA 4LG3A 4L5JA 1JKQC 1WVRA 1ZRCA 3V4GA 2IS1A 1GHCA 4OWRB 2V1UA 1IO2A 4DOZA 5HODA 4UUSA 3GTJJ 2CFXA 2EWNA 4IZZA 1RNLA 3QAHA 1V3FA 3FBIB 2HYJA 4OIQF 4A3GJ 5AONA 4IQ4A 5F0HA 1CQTA 2STWA 3K4JA 1EV7A 1YHQI 3KE2A 2HS5A 3PQKA 2X6WA 3A03A 3ONQA 4CCOA 2NNNA 3KZIC 2EFWA 1YIJI 1K7AA 3GX4X 3FX3A 2BBYA 3GZNB 1SAUA 1D5YA 1IDZA 2LKPA 2IA2A 2CQQA 2FJ1A 4NUBA 2EBIA 2KZGA 5TISC 4M6YA 4CCKA 4M3EA 2GM4A 2BV6A 2HOEA 5LLQA 2EFPA 2HWVA 2R7OA 5IP9J 1VQ8I 2QKMB 1I3AA 2CG4A 3MCZA 4XLPF 2XASA 1OYWA 4B3XA 5ICCA 4Y52J 1VQNI 1WJFA 4YFXF 4U88A 3A01B 1D8KA 4KIBA 3BROA 4B4CA 4GCVA 4HF2A 2Y31A 3K4BA 9ANTA 4B48A 1ITYA 4HRIA 1I1GA 4HDUA 3ULQB 1MZBA 2QENA 5DV5A 4DYQA 1VQLI 3FIWA 1OCTC 5E3NA 5E3LA 1QRYA 3E3VA 3GLLA 3WE2A 2O3FA 3OYFA 3HOWJ 2D5VA 4Y15A 3NQOA 3QU3A 2IGKA 2KIUA 4QIWN 4IRHA 1IUYA 2O9LA 1ZN2A 3ZQQA 2Y69H 1O7FA 3TW7A 1MW7A 4BJ5C 4BDYA 3CZ6A 2LKSA 3M4OJ 1EF4A 2VKDA 1MDMA 2KRHA 4EM2A 1G3SA 1BI1A 3H3VK 1TT0A 2CJJA 2OV7A 3VSKA 1AOYA 4LMYA 1T95A 2DA6A 1TLHB 4KT6A 2TDXA 1FOYA 2ID3A 2M5WA 2RDPA 5ILSA 2JA6J 2KJCA 5E17F 4PJLA 2XPVA 3V8LA 1OYYA 3J80K 3VWBA 3K1PA 1LVKA 3BC8A 1FY7A 3CO6C 1Z6TA 3HKZN 2FSWA 3PSIA 2F5DA 2LRDA 1VNDA 3V7RA 1BW5A 3OYCA 1B59A 3DLLF 3FXKA 5L3BA 2NAZA 3I3LA 3DFGA 1S3JA 2PI0A 1XMAA 1H89C 2MD0A 2QSFX 3IH2A 2V1NA 2GXBA 1R1TA 3FKJA 3VB2A 4CYCB 4HLYA 4KYWA 2XSDC 1MBKA 1IRZA 2PFBA 4F55A 2H27A 2DT7B 5C44J 3A02A 2HKXA 3S93A
chains in the Genus database with same CATH topology
5K5OA 5CJ9A 1SD6A 3ROUA 4U0YA 3DF8A 5L3EA 2E7XA 5CVUA 3J81Z 4N0BA 3ZN1A 4UNOA 2EK5A 4WF2A 2MBFA 2MLGA 2BGCA 4ZYEA 2D45A 4A5MA 2GXGA 1GXQA 3I64A 4UHTA 2H09A 1IRFA 2L54A 4UVBA 2QM3A 3R0JA 1R1VA 4EMSA 2B0LA 3E5XA 1SMTA 2ZMEA 1PDNC 2D1VA 3WTTC 2EB7A 5JR3A 1GVJA 2UXNA 3HTUA 3LQRA 3F8MA 4LB6B 1I5ZA 4M6XA 4A6EA 3HTSB 4NHJA 1W5TA 2CYYA 3VFZA 2VXZA 1ULYA 3JAMZ 1HW2A 4UV8A 2FRHA 1IXRC 1V4RA 5ILVA 4HAMA 4WXCA 2HQRA 4RGXA 4LG0B 4HV5A 1XCVA 2VODA 1T6SA 5LEJA 2QLZA 3ML6A 1LB2A 4A0XA 4MEYF 5J8FA 3HSEA 1T39A 3MZYA 2GWRA 5K5RA 2M30A 3V8KA 4EV0A 3ZMDA 4FX0A 4IHSA 2J5OA 1G3YA 1YTYA 1U6GA 1KU2A 1QBJA 4FHTA 2XIGA 1E17A 2FA5A 1P4AA 3I58A 5BOXA 4R8HA 4UXNA 4XBFA 5HDKA 2VOPA 2XROA 4OOIA 4LGWA 3H3UA 1TNTA 2V9VA 3GZ6A 2Z9OA 2DQLA 4QWQA 1E2XA 5EEGA 3QPHA 2H94A 3F21A 5D5WB 1SFXA 5D4RA 3JTGA 2PBIA 2A6EF 1T98A 2DLLA 3IHUA 4BAYA 3ELKA 2F2EA 3SZPA 4MGRA 1ZH5A 1YW7A 2P5KA 1K78A 3MQ0A 4I7HA 1YIOA 4EVIA 1ONVA 5TJJA 3ZMSA 3SXYA 3O3KA 1LDDA 1YW8A 1IN4A 2A3SA 4F7ZA 2EA2A 2DK8A 2DW4A 2EA4A 1R5GA 4AIHA 5FO5A 2G9WA 1UFMA 1FSEA 1ON1A 1FLIA 3M7GA 1TQIA 2P6TA 5IT9K 2ZKZA 4ESJA 2ESHA 4OIPF 5JFRA 2PMHA 5FD5A 5IT3A 2ISYA 4O5VA 3RYPA 4M9ZA 2WTEA 1ZAOA 2DAOA 1W7PA 5JVTA 3LA2A 4KDPA 5J8CA 2QQAA 3FF5A 4S04A 2RV8A 4L5IA 2L01A 5ICFA 2GQQA 3KETA 1P6RA 3WTXC 2V1DA 3JTHA 2PG4A 4BHPA 2COMA 1REPC 4OIOF 1YFHA 1KYZA 1KU9A 2ZJ2A 1IRGA 2K02A 1FYLA 2UWMA 2F5EA 4YIIA 3M9AA 4EM1A 5CVRA 3KP4A 4IXAA 3TQNA 2M87A 1S8NA 3GO5A 4EGYA 2K4JA 2V6CA 4RB1A 2FOKA 1IN5A 3ABUA 1KQ8A 3ECHA 4AWXB 2IRFG 1FP2A 2IPQX 2O6GE 3TOAA 2Q0OA 4CHUA 3GEZA 4L9JA 2ACJA 3GFLA 1KA8A 3BPXA 4GYIA 4DNCA 2EV0A 2RN7A 2R7DA 3P9IA 2EV6A 2HTJA 4XRFA 2CW0F 1ZGJA 3O2PE 3PQJA 3ZMTA 4I0AA 2GIVA 1Z91A 4G7ZF 5CLSA 3R6SA 4R79A 3EETA 3Q9SA 1O3QA 4GYGA 3HHHA 1LNWA 2XUBA 2FBKA 1PP7U 3E5UA 2RC4A 1IW7F 3FXRA 2ZNYA 5L3DA 3FHZA 3TDUC 3OV8A 4CYDA 1HKSA 1HBXG 3ZMZA 4LD5A 1AWCA 3LWFA 2DQRA 4BHCA 2Q8KA 4L9VA 2FE3A 1OKRA 1K6OA 3HRMA 1ZLKA 2BE5F 2CGPA 3M8EA 1KQ9A 4PCQA 3F72A 3FXUA 1O7LA 3R60A 5ERIA 3GFMA 4HA8A 3K69A 4FT8A 3DQVC 1QPMA 1XGOA 1YG2A 2BYVE 2QBYA 4AVPA 5F6FA 5F64A 3WTZA 1U8RA 2LF8A 2DPUA 3K9TA 5LHHA 1XB4A 2ISZA 2L02A 3HUGA 3FMSA 3U2RA 4WCGA 1FBQA 2FF4A 4RB0A 4M71A 3M1EA 4S05A 4ESFA 1W5SA 3N4MA 1H0MA 2QVOA 2A5YB 3HIFA 1XGNA 3HOTA 5DCMA 1OR7A 1F1ZA 5FGMA 2ADUA 3B02A 2KIFA 2F5CA 2Z5UA 2ZO4A 4YFNF 2Q2EA 4CDGA 3WU1B 3CUQA 3QU6A 2YR2A 3Q9VA 3JAMK 4PDKA 1FSHA 2P5LC 5HVQC 4U7BA 4A12A 1KQ0A 3TOBA 2ZBKA 2FMLA 1S29A 3MEXA 1FBUA 5LGTA 2P7VB 4HX4A 1JHHA 5CVIA 3GZ5A 3GVAA 1U5TA 2IVMA 1P92A 1R00A 1ZLJA 3WTWC 2OBPA 2MD5A 1EH8A 4YIFA 3ZPLA 1LEBA 5D8KB 3PFIA 1ZHFA 4KMFA 2VT3A 3VODA 1KYWA 5ILUA 2IA1A 1ZG3A 4MQ9F 2FMYA 4OMZA 4ENKA 2ZFWA 1LDJA 1Z9CA 3T0YA 3VOEA 4EJWA 4Y13A 2HR3A 4WK8F 4ZZDA 4LB5A 3LQQA 4Q47A 1B1BA 1WI9A 1XDUA 1RZ4A 2J5PA 2KKOA 1EH6A 1BN5A 3I54A 2JSCA 2KJBA 2PMUA 2YU3A 1O57A 3ZMVA 1BI0A 5ICEA 4ENJA 2Z3YA 4ZYGA 2ZCWA 2X0LA 1BI3A 1NHAA 4BNCA 4MTEA 3W6KB 3WODF 1J9IA 1DUXC 4L0YB 4HBLA 2MC3A 3H3ZA 3I4PA 3QOPA 1G6NA 5A2QK 4RGSA 3FM5A 1LDKB 2YX7A 1F5TA 1YQAA 3KP2A 5HDNA 3RI4A 5D6FA 2M8EA 4OU0A 3BJ6A 2MA3A 1B4AA 1SD5A 4AIKA 2XGXA 3KFWX 1XSXA 4G6QA 1U3EM 4EJVA 2FBIA 1QZYA 3IL2A 3C3WA 3EQLF 4KMUX 4HDVA 1O3RA 2LDUA 3RKXA 4HW0A 3C18A 4AD9A 4BHBA 4ETSA 4LK1F 3GXOA 3GUDA 4N9HA 4ENNA 5LEKA 3ZMUA 5ICGA 3WTSC 5LHGA 5DDGA 3KP3A 3NRVA 2OQRA 5HDGA 3RDIA 1O3SA 3I59B 1ZARA 1BIAA 4HYEA 3QPTA 3MWMA 1SFEA 2YX4A 2FBHA 3E97A 2MH9A 3EYYA 3I71A 2OU2A 4QLCU 1DP7P 3SZTA 4WWCA 1SD4A 1USTA 2Y0MA 3TKYA 1BC7C 4MEXF 2DBBA 3KCCA 1D3YA 4MQVA 1XSDA 4OIRF 2A68F 4JK1X 4NQWA 1Z1DA 2PJPA 3KLOA 5AIQA 3I53A 1WRJA 1FP1D 3RKYA 3F8BA 3LFKA 4XSZF 1WKMA 3IRRA 3F8FA 2NYXA 2R7FA 2D2WA 2XRNA 3G73A 4A0YA 1J2XA 2WC2A 3TO9A 3WU0A 2DO7A 2P8TA 1LVAA 5BMZA 1P2FA 1L3LA 3WG9A 1IN7A 4B09A 1CF7B 5FFZA 5H20A 3TO6A 3TO7A 1HXDA 1K79A 6PAXA 1MGTA 2HGCA 3FM3A 1LJ9A 1MJ9A 3R0AA 3M8FA 4Y17A 5A2QZ 1FOKA 4BXUA 2OD5A 3FMRA 1JE8A 3F3XA 3KP7A 1S7OA 3V7SA 3N97A 1T38A 4ON0A 4G7OF 4P5OA 3HSFA 2STTA 1HKTA 4U0VA 3R61A 3IKTA 2ZXJA 5E8GA 3RPUA 1BM9A 1ZRDA 1LQ1A 3GFIA 1R5HA 2IJLA 1T0FA 3WE3A 4IF4A 2R3SA 2DI3A 5TRDA 3SFZA 2O8XA 4ASNA 1DDNA 1S7AA 5CYVA 1F9NA 1QNTA 2FQ3A 1B9NA 4IVNA 1UB9A 2P5VA 4G9YA 3L9FA 1PP8F 2C6YA 1IZ1A 5E18F 2L4MA 4MHGA 4A2UA 2XKOA 1BC8C 4GO1A 4CZZA 2JTVA 2ETHA 3REOA 3BPVA 3DEUA 4YG2F 1XN7A 1J7KA 5L3CA 4WXHA 5KVRA 3FXQA 4LG0A 4KNYA 4I01A 3FMQA 5LRSA 1H9TA 4HV6A 4RGUA 2XAFA 4RAYA 2OZUA 3JSPA 3ISPA 2E7WA 4CO8A 2K4BA 2VC0A 3LA3A 2H6CA 2O03A 1LEAA 1KU3A 2P4WA 3HHGA 2XKPA 1HKQA 3P9KA 2JPBA 1HSJA 2FNPA 3T5XA 1EH7A 2YSRA 4RS8A 4Z2YA 2XAQA 4UUVA 5DCMB 5HS8A 1O3TA 1J5YA 5L3FA 1RI7A 2VONA 3B73A 3CUOA 2JZYA 1W4MA 1Y0UA 5HLGA 3ZP5A 4I09A 2FEZA 3HRTA 1ZRFA 5HS7A 4P96A 1J0RA 2PEXA 4M72A 2W84A 4GGGA 3GF2A 5DCFA 5D6EA 2HEOA 2K86A 2LNBA 2EJRA 3CO7C 5LGUA 3TGNA 4CGZA 5CVJA 2P7CB 3WTUC 5FFXA 2W85A 5DUKA 2XAJA 2WWYA 3D0SA 3FWEA 4L9NA 1BI2A 1FPQA 3BY6A 1MDMB 4Q5SF 2W24A 2UXXA 3KZYA 4AIJA 4I2OA 1ODDA 2PQ8A 5HLHA 5J6XA 1QGPA 5E20A 4HLXA 3MFKA 1G4DA 4A5NA 4IRGA 1FT9A 2JT1A 3LA7A 4P55A 3ERED 3BDDA 4I98B 2A6HF 1U2WA 1R58A 1HSTA 2NNYA 3CUQC 4A0ZA 3GFJA 1JGSA 1IF1A 4G7HF 3V7CA 5D5VB 4M74A 3OOPA 4MNUA 1TNSA 3IKVA 4O6JA 2Y48A 3V8JA 5FLXK 1FYKA 2A61A 1Z7UA 2EFOA 3I0TA 2CSOA 1ZREA 1BOAA 3GWZA 2E1NA 2ZMEB 2G7HA 4IHTA 2V79A 5D5XB 3CJNA 3RIRA 1SAXA 5HLIA 3KEOA 2VN2A 2FNAA 4KFCA 2QYOA 4N9IA 1ZG5A 2OAZA 3FZVA 3IWZA 3JSOA 4EQQA 1FC3A 2GA2A 1XMKA 3T8RA 5ED4A 3WGGA 3U1DA 3E6BA 4G8XA 1U78A 1FX7A 1XGMA 5DYMA 2RQPA 1FBSA 1UHWA 2QQ9A 3P9CA 2NS0A 5LHIA 3IWFA 1OMIA 4RGRA 2RGVA 1R1UA 2ESNA 3JW4A 1MD0A 1DPRA 5EEHA 3HRUA 5CVVA 5FB2A 4OMYA 4KN4X 2W25A 1RIOH 1Z6RA 5JI6A 5BS6A 5BQTA 2H6BA 3AAFA 2AS5F 2DPDA 4UV9A 4EJOA 2ZNZA 3J7AO 4PGHA 3ZN0A 3GW2A 4KUMA 1Z05A 3EYIA 4YFKF 3L00A 4IPAA 1L0OC 3K2ZA 3F8CA 1I6XA 1IN8A 3RTRA 4BQAA 2OA4A 1K78B 5LBQA 3ECOA 1MJAA 1WWXA 1J59A 3HOSA 4Q48A 3HYIA 4PGGA 1YLFA 4H0EA 2EFNA 3E6CC 1R36A 4KN7X 4A6DA 3QP6A 1SMYF 2HFHA 3BP8A 1IXCA 3H92A 5HS9A 1Q1HA 1YS7A 1MJBA 3CDHA 4UVCA 3KP5A 2QUFA 5D8LB 3R4KA 1S6LA 3I5UA 1KGSA 5FLXZ 5K5QA 1I1SA 4GXOA 4R1HA 2NRAC 3DPTA 2VBWA 1JXSA 4I02A 2CO5A 1R7JA 1W7PB 4L9TA 2YPRA 2PN6A 3IRQA 2BEOA 1XSVA 2W57A 4EGZA 3DP7A 3RJPA 4HF1A 1TQMA 3ABTA 4K2EA 1H9GA 2L3DA 3P7NA 3COAC 2HKXA 1P4WA 3WGHA 1USSA 1R22A 5KK1A 5L3GA 2DU9A 1I27A 1SFUA 1GXPA 1TW2A 4TV7A 4U0WA 2VC1A 3QRFF 5F1RA 4ZH4F 3T8TA 3K1MA 4I0BA 3DXJF 2V1XA 1ON2A 2IW5A 2OZ6A 2WV0A 5E1XA 3KLNA 1PUEE 4PZJA 4FX4A 1HW1A 1WQ2A 4HX8A 4LFUA 4E70A 1T2KA 3EUHA 5H6RA 3RPQA 3LAPA 4KT5C 4IJAA 3F6VA 3T1BA 1F4KA 4HF0A 4BH9A 2A07F 5LRRA 2Z99A 1YW9A 2RNJA 1J75A 3KP6A 5H6QA 3S2WA 2Z33A 1KU7A 4P9UA 1B9MA 3BJOA 4JQFA 3J80Z 4ZYHA 2HYFA 1D8JA 5BPDA 5FD6A 2O0YA 3E6DA 2GZWA 3L09A 5HOOA 4ZZLA 1G3WA 4KIFA 2LSOA 2X4HA 1FNNA 3ZQ7A 2K7LA 5DUIA 3WGIA 3RYRA 1TQPA 5LGNA 1HW5A 4D0PA 4KIGA 2IA0A 2K27A 2GAUA 2XVCA 4Q4ZF 4LK0F 4L18B 2LF7A 4G6DA 1SD7A 1XDSA 4CXFA 3L2CA 4P9FA 3KEQA 4BYYA 1IN6A 1BIBA 1FZPB 1YS6A 2VE9A 4U7DA 1G3TA 1QQIA 1HQCA 4RAZA 3F23A 4EJTA 2HKOA 4DQ2A 3U9GA 4EM0B 3I59A 4LLGF 4WX9A 3K0LA 2QBYB 4HX7A 2KIMA 2MH2A 3NEUA 3MZHA 4M9XA 2DTRA 3SQNA 2AXLA 5DD4A 2QZ8A 2F5FA 1ZYRF 2A69F 1MKMA 1FYMA 2JRTA 2VE8A 1ZG1A 3Q5FA 3SHFA 1X3UA 3L7WA 2IT0A 1FWZA 1QO0D 3CLOA 1YYVA 3C1DA 1B6AA 4HOBA 3LAJA 4G94A 2CWEA 5DD8A 4NB5A 3BJAA 1CGPA 3WTVC 5E1WA 4O3MA 4M9SA 2HYGD 4HQEA 2VOOA 3BOQA 3CUQB 4RB3C 2QQBA 4OINF 5D4SA 1VTNC 3F22A 2P6SA 1R23A 4M73A 2HZTA 3BWGA 1DPUA 1UHMA 2GA1A 3IC7A 2OQGA 2XHKA 4WXDA 1UCRA 1C0WA 2CQKA 2ELHA 2DK5A 3MAJA 2QWWA 1CF7A 3HRSA 4KA4A 4KICA 1U5TB 4ESBA 2KRFA 2Y75A 3K1NA 2XAGA 3F6OA 1RUNA 4XSXF 4HZFA 2HTSA 3KZZA 3GLXA 3VEPA 3EDPA 5JHUA 1TBXA 2FU4A 4RB2C 3E6MA 1BBYA 1A04A 1IAWA 4JBAA 3W6JB 1OPCA 1D5VA 5E8IA 2FXAA 2DFIA 4HQMA 1TTYA 2HQNA 3O6BB 5D5UB 1IXSB 3D5LA 1WSUA 2XV4S 1XGSA 5IT9Z 2XAHA 3BZ6A 1QZZA 2DT5A 1RUOA 1P4XA 3E5QA 3CTAA 1XCBA 2RKHA 2O61A 4LLNA 2L4AA 2M1BA 1TW3A 1STZA 4IRIA 3DKWA 1ZGAA 3QP5A 3GYHX 2VT2A 2E1CA 4UVAA 1W7PD 2D1HA 2VBYA 2G7UA 3J81K 3WTYC 2HDCA 3C7JA 4MTDA 4ZYDA 4ENMA 3HSRA 3DPLC 4XLNF 5BPIA 3DV8A 4B8XA 4EJUA 4L0ZB 3RKWA 4CICA 5DEQA 2M45A 1YO5C 1BJAA 1JHFA 2UZKA 5E1ZB 5AIPA 2EV5A 1U5TC 2RVCA 1OYIA 1XD7A 2JPCA 3F8NA 2VBZA 3G3ZA 4LJZF 4LLLA 2VBXA 3TDZC 2MLKA 2EFQA 2IP2A 3LSTA 2PLYA 4L5JA 1ZRCA 3V4GA 1GHCA 2V1UA 2CFXA 2EWNA 1RNLA 3QAHA 1V3FA 4OIQF 5AONA 2STWA 1EV7A 3KE2A 2HS5A 3PQKA 2NNNA 2EFWA 1K7AA 3GX4X 3FX3A 2BBYA 2LKPA 2IA2A 4M6YA 2BV6A 2HOEA 5LLQA 2EFPA 2HWVA 2CG4A 3MCZA 4XLPF 2XASA 1OYWA 5ICCA 4YFXF 4U88A 1D8KA 4KIBA 3BROA 4GCVA 4HF2A 1I1GA 4HDUA 3ULQB 1MZBA 2QENA 5DV5A 3E3VA 3WE2A 2O3FA 4Y15A 3NQOA 3QU3A 2KIUA 4IRHA 1IUYA 1ZN2A 1O7FA 1MDMA 4EM2A 1G3SA 1BI1A 1AOYA 4LMYA 1TLHB 2TDXA 2M5WA 2RDPA 5ILSA 2KJCA 5E17F 3V8LA 1OYYA 3J80K 3K1PA 1FY7A 3CO6C 1Z6TA 2FSWA 2F5DA 3V7RA 1B59A 5L3BA 2NAZA 3DFGA 1S3JA 2PI0A 1XMAA 2GXBA 1R1TA 3VB2A 4HLYA 4KYWA 2PFBA 2H27A 5K1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K5O A;  5CJ9 A;  1SD6 A;  3ROU A;  4U0Y A;  3DF8 A;  5L3E A;  2E7X A;  5CVU A;  3J81 Z;  4N0B A;  3ZN1 A;  4UNO A;  2EK5 A;  4WF2 A;  2MBF A;  2MLG A;  2BGC A;  4ZYE A;  2D45 A;  4A5M A;  2GXG A;  1GXQ A;  3I64 A;  4UHT A;  2H09 A;  1IRF A;  2L54 A;  4UVB A;  2QM3 A;  3R0J A;  1R1V A;  4EMS A;  2B0L A;  3E5X A;  1SMT A;  2ZME A;  1PDN C;  2D1V A;  3WTT C;  2EB7 A;  5JR3 A;  1GVJ A;  2UXN A;  3HTU A;  3LQR A;  3F8M A;  4LB6 B;  1I5Z A;  4M6X A;  4A6E A;  3HTS B;  4NHJ A;  1W5T A;  2CYY A;  3VFZ A;  2VXZ A;  1ULY A;  3JAM Z;  1HW2 A;  4UV8 A;  2FRH A;  1IXR C;  1V4R A;  5ILV A;  4HAM A;  4WXC A;  2HQR A;  4RGX A;  4LG0 B;  4HV5 A;  1XCV A;  2VOD A;  1T6S A;  5LEJ A;  2QLZ A;  3ML6 A;  1LB2 A;  4A0X A;  4MEY F;  5J8F A;  3HSE A;  1T39 A;  3MZY A;  2GWR A;  5K5R A;  2M30 A;  3V8K A;  4EV0 A;  3ZMD A;  4FX0 A;  4IHS A;  2J5O A;  1G3Y A;  1YTY A;  1U6G A;  1KU2 A;  1QBJ A;  4FHT A;  2XIG A;  1E17 A;  2FA5 A;  1P4A A;  3I58 A;  5BOX A;  4R8H A;  4UXN A;  4XBF A;  5HDK A;  2VOP A;  2XRO A;  4OOI A;  4LGW A;  3H3U A;  1TNT A;  2V9V A;  3GZ6 A;  2Z9O A;  2DQL A;  4QWQ A;  1E2X A;  5EEG A;  3QPH A;  2H94 A;  3F21 A;  5D5W B;  1SFX A;  5D4R A;  3JTG A;  2PBI A;  2A6E F;  1T98 A;  2DLL A;  3IHU A;  4BAY A;  3ELK A;  2F2E A;  3SZP A;  4MGR A;  1ZH5 A;  1YW7 A;  2P5K A;  1K78 A;  3MQ0 A;  4I7H A;  1YIO A;  4EVI A;  1ONV A;  5TJJ A;  3ZMS A;  3SXY A;  3O3K A;  1LDD A;  1YW8 A;  1IN4 A;  2A3S A;  4F7Z A;  2EA2 A;  2DK8 A;  2DW4 A;  2EA4 A;  1R5G A;  4AIH A;  5FO5 A;  2G9W A;  1UFM A;  1FSE A;  1ON1 A;  1FLI A;  3M7G A;  1TQI A;  2P6T A;  5IT9 K;  2ZKZ A;  4ESJ A;  2ESH A;  4OIP F;  5JFR A;  2PMH A;  5FD5 A;  5IT3 A;  2ISY A;  4O5V A;  3RYP A;  4M9Z A;  2WTE A;  1ZAO A;  2DAO A;  1W7P A;  5JVT A;  3LA2 A;  4KDP A;  5J8C A;  2QQA A;  3FF5 A;  4S04 A;  2RV8 A;  4L5I A;  2L01 A;  5ICF A;  2GQQ A;  3KET A;  1P6R A;  3WTX C;  2V1D A;  3JTH A;  2PG4 A;  4BHP A;  2COM A;  1REP C;  4OIO F;  1YFH A;  1KYZ A;  1KU9 A;  2ZJ2 A;  1IRG A;  2K02 A;  1FYL A;  2UWM A;  2F5E A;  4YII A;  3M9A A;  4EM1 A;  5CVR A;  3KP4 A;  4IXA A;  3TQN A;  2M87 A;  1S8N A;  3GO5 A;  4EGY A;  2K4J A;  2V6C A;  4RB1 A;  2FOK A;  1IN5 A;  3ABU A;  1KQ8 A;  3ECH A;  4AWX B;  2IRF G;  1FP2 A;  2IPQ X;  2O6G E;  3TOA A;  2Q0O A;  4CHU A;  3GEZ A;  4L9J A;  2ACJ A;  3GFL A;  1KA8 A;  3BPX A;  4GYI A;  4DNC A;  2EV0 A;  2RN7 A;  2R7D A;  3P9I A;  2EV6 A;  2HTJ A;  4XRF A;  2CW0 F;  1ZGJ A;  3O2P E;  3PQJ A;  3ZMT A;  4I0A A;  2GIV A;  1Z91 A;  4G7Z F;  5CLS A;  3R6S A;  4R79 A;  3EET A;  3Q9S A;  1O3Q A;  4GYG A;  3HHH A;  1LNW A;  2XUB A;  2FBK A;  1PP7 U;  3E5U A;  2RC4 A;  1IW7 F;  3FXR A;  2ZNY A;  5L3D A;  3FHZ A;  3TDU C;  3OV8 A;  4CYD A;  1HKS A;  1HBX G;  3ZMZ A;  4LD5 A;  1AWC A;  3LWF A;  2DQR A;  4BHC A;  2Q8K A;  4L9V A;  2FE3 A;  1OKR A;  1K6O A;  3HRM A;  1ZLK A;  2BE5 F;  2CGP A;  3M8E A;  1KQ9 A;  4PCQ A;  3F72 A;  3FXU A;  1O7L A;  3R60 A;  5ERI A;  3GFM A;  4HA8 A;  3K69 A;  4FT8 A;  3DQV C;  1QPM A;  1XGO A;  1YG2 A;  2BYV E;  2QBY A;  4AVP A;  5F6F A;  5F64 A;  3WTZ A;  1U8R A;  2LF8 A;  2DPU A;  3K9T A;  5LHH A;  1XB4 A;  2ISZ A;  2L02 A;  3HUG A;  3FMS A;  3U2R A;  4WCG A;  1FBQ A;  2FF4 A;  4RB0 A;  4M71 A;  3M1E A;  4S05 A;  4ESF A;  1W5S A;  3N4M A;  1H0M A;  2QVO A;  2A5Y B;  3HIF A;  1XGN A;  3HOT A;  5DCM A;  1OR7 A;  1F1Z A;  5FGM A;  2ADU A;  3B02 A;  2KIF A;  2F5C A;  2Z5U A;  2ZO4 A;  4YFN F;  2Q2E A;  4CDG A;  3WU1 B;  3CUQ A;  3QU6 A;  2YR2 A;  3Q9V A;  3JAM K;  4PDK A;  1FSH A;  2P5L C;  5HVQ C;  4U7B A;  4A12 A;  1KQ0 A;  3TOB A;  2ZBK A;  2FML A;  1S29 A;  3MEX A;  1FBU A;  5LGT A;  2P7V B;  4HX4 A;  1JHH A;  5CVI A;  3GZ5 A;  3GVA A;  1U5T A;  2IVM A;  1P92 A;  1R00 A;  1ZLJ A;  3WTW C;  2OBP A;  2MD5 A;  1EH8 A;  4YIF A;  3ZPL A;  1LEB A;  5D8K B;  3PFI A;  1ZHF A;  4KMF A;  2VT3 A;  3VOD A;  1KYW A;  5ILU A;  2IA1 A;  1ZG3 A;  4MQ9 F;  2FMY A;  4OMZ A;  4ENK A;  2ZFW A;  1LDJ A;  1Z9C A;  3T0Y A;  3VOE A;  4EJW A;  4Y13 A;  2HR3 A;  4WK8 F;  4ZZD A;  4LB5 A;  3LQQ A;  4Q47 A;  1B1B A;  1WI9 A;  1XDU A;  1RZ4 A;  2J5P A;  2KKO A;  1EH6 A;  1BN5 A;  3I54 A;  2JSC A;  2KJB A;  2PMU A;  2YU3 A;  1O57 A;  3ZMV A;  1BI0 A;  5ICE A;  4ENJ A;  2Z3Y A;  4ZYG A;  2ZCW A;  2X0L A;  1BI3 A;  1NHA A;  4BNC A;  4MTE A;  3W6K B;  3WOD F;  1J9I A;  1DUX C;  4L0Y B;  4HBL A;  2MC3 A;  3H3Z A;  3I4P A;  3QOP A;  1G6N A;  5A2Q K;  4RGS A;  3FM5 A;  1LDK B;  2YX7 A;  1F5T A;  1YQA A;  3KP2 A;  5HDN A;  3RI4 A;  5D6F A;  2M8E A;  4OU0 A;  3BJ6 A;  2MA3 A;  1B4A A;  1SD5 A;  4AIK A;  2XGX A;  3KFW X;  1XSX A;  4G6Q A;  1U3E M;  4EJV A;  2FBI A;  1QZY A;  3IL2 A;  3C3W A;  3EQL F;  4KMU X;  4HDV A;  1O3R A;  2LDU A;  3RKX A;  4HW0 A;  3C18 A;  4AD9 A;  4BHB A;  4ETS A;  4LK1 F;  3GXO A;  3GUD A;  4N9H A;  4ENN A;  5LEK A;  3ZMU A;  5ICG A;  3WTS C;  5LHG A;  5DDG A;  3KP3 A;  3NRV A;  2OQR A;  5HDG A;  3RDI A;  1O3S A;  3I59 B;  1ZAR A;  1BIA A;  4HYE A;  3QPT A;  3MWM A;  1SFE A;  2YX4 A;  2FBH A;  3E97 A;  2MH9 A;  3EYY A;  3I71 A;  2OU2 A;  4QLC U;  1DP7 P;  3SZT A;  4WWC A;  1SD4 A;  1UST A;  2Y0M A;  3TKY A;  1BC7 C;  4MEX F;  2DBB A;  3KCC A;  1D3Y A;  4MQV A;  1XSD A;  4OIR F;  2A68 F;  4JK1 X;  4NQW A;  1Z1D A;  2PJP A;  3KLO A;  5AIQ A;  3I53 A;  1WRJ A;  1FP1 D;  3RKY A;  3F8B A;  3LFK A;  4XSZ F;  1WKM A;  3IRR A;  3F8F A;  2NYX A;  2R7F A;  2D2W A;  2XRN A;  3G73 A;  4A0Y A;  1J2X A;  2WC2 A;  3TO9 A;  3WU0 A;  2DO7 A;  2P8T A;  1LVA A;  5BMZ A;  1P2F A;  1L3L A;  3WG9 A;  1IN7 A;  4B09 A;  1CF7 B;  5FFZ A;  5H20 A;  3TO6 A;  3TO7 A;  1HXD A;  1K79 A;  6PAX A;  1MGT A;  2HGC A;  3FM3 A;  1LJ9 A;  1MJ9 A;  3R0A A;  3M8F A;  4Y17 A;  5A2Q Z;  1FOK A;  4BXU A;  2OD5 A;  3FMR A;  1JE8 A;  3F3X A;  3KP7 A;  1S7O A;  3V7S A;  3N97 A;  1T38 A;  4ON0 A;  4G7O F;  4P5O A;  3HSF A;  2STT A;  1HKT A;  4U0V A;  3R61 A;  3IKT A;  2ZXJ A;  5E8G A;  3RPU A;  1BM9 A;  1ZRD A;  1LQ1 A;  3GFI A;  1R5H A;  2IJL A;  1T0F A;  3WE3 A;  4IF4 A;  2R3S A;  2DI3 A;  5TRD A;  3SFZ A;  2O8X A;  4ASN A;  1DDN A;  1S7A A;  5CYV A;  1F9N A;  1QNT A;  2FQ3 A;  1B9N A;  4IVN A;  1UB9 A;  2P5V A;  4G9Y A;  3L9F A;  1PP8 F;  2C6Y A;  1IZ1 A;  5E18 F;  2L4M A;  4MHG A;  4A2U A;  2XKO A;  1BC8 C;  4GO1 A;  4CZZ A;  2JTV A;  2ETH A;  3REO A;  3BPV A;  3DEU A;  4YG2 F;  1XN7 A;  1J7K A;  5L3C A;  4WXH A;  5KVR A;  3FXQ A;  4LG0 A;  4KNY A;  4I01 A;  3FMQ A;  5LRS A;  1H9T A;  4HV6 A;  4RGU A;  2XAF A;  4RAY A;  2OZU A;  3JSP A;  3ISP A;  2E7W A;  4CO8 A;  2K4B A;  2VC0 A;  3LA3 A;  2H6C A;  2O03 A;  1LEA A;  1KU3 A;  2P4W A;  3HHG A;  2XKP A;  1HKQ A;  3P9K A;  2JPB A;  1HSJ A;  2FNP A;  3T5X A;  1EH7 A;  2YSR A;  4RS8 A;  4Z2Y A;  2XAQ A;  4UUV A;  5DCM B;  5HS8 A;  1O3T A;  1J5Y A;  5L3F A;  1RI7 A;  2VON A;  3B73 A;  3CUO A;  2JZY A;  1W4M A;  1Y0U A;  5HLG A;  3ZP5 A;  4I09 A;  2FEZ A;  3HRT A;  1ZRF A;  5HS7 A;  4P96 A;  1J0R A;  2PEX A;  4M72 A;  2W84 A;  4GGG A;  3GF2 A;  5DCF A;  5D6E A;  2HEO A;  2K86 A;  2LNB A;  2EJR A;  3CO7 C;  5LGU A;  3TGN A;  4CGZ A;  5CVJ A;  2P7C B;  3WTU C;  5FFX A;  2W85 A;  5DUK A;  2XAJ A;  2WWY A;  3D0S A;  3FWE A;  4L9N A;  1BI2 A;  1FPQ A;  3BY6 A;  1MDM B;  4Q5S F;  2W24 A;  2UXX A;  3KZY A;  4AIJ A;  4I2O A;  1ODD A;  2PQ8 A;  5HLH A;  5J6X A;  1QGP A;  5E20 A;  4HLX A;  3MFK A;  1G4D A;  4A5N A;  4IRG A;  1FT9 A;  2JT1 A;  3LA7 A;  4P55 A;  3ERE D;  3BDD A;  4I98 B;  2A6H F;  1U2W A;  1R58 A;  1HST A;  2NNY A;  3CUQ C;  4A0Z A;  3GFJ A;  1JGS A;  1IF1 A;  4G7H F;  3V7C A;  5D5V B;  4M74 A;  3OOP A;  4MNU A;  1TNS A;  3IKV A;  4O6J A;  2Y48 A;  3V8J A;  5FLX K;  1FYK A;  2A61 A;  1Z7U A;  2EFO A;  3I0T A;  2CSO A;  1ZRE A;  1BOA A;  3GWZ A;  2E1N A;  2ZME B;  2G7H A;  4IHT A;  2V79 A;  5D5X B;  3CJN A;  3RIR A;  1SAX A;  5HLI A;  3KEO A;  2VN2 A;  2FNA A;  4KFC A;  2QYO A;  4N9I A;  1ZG5 A;  2OAZ A;  3FZV A;  3IWZ A;  3JSO A;  4EQQ A;  1FC3 A;  2GA2 A;  1XMK A;  3T8R A;  5ED4 A;  3WGG A;  3U1D A;  3E6B A;  4G8X A;  1U78 A;  1FX7 A;  1XGM A;  5DYM A;  2RQP A;  1FBS A;  1UHW A;  2QQ9 A;  3P9C A;  2NS0 A;  5LHI A;  3IWF A;  1OMI A;  4RGR A;  2RGV A;  1R1U A;  2ESN A;  3JW4 A;  1MD0 A;  1DPR A;  5EEH A;  3HRU A;  5CVV A;  5FB2 A;  4OMY A;  4KN4 X;  2W25 A;  1RIO H;  1Z6R A;  5JI6 A;  5BS6 A;  5BQT A;  2H6B A;  3AAF A;  2AS5 F;  2DPD A;  4UV9 A;  4EJO A;  2ZNZ A;  3J7A O;  4PGH A;  3ZN0 A;  3GW2 A;  4KUM A;  1Z05 A;  3EYI A;  4YFK F;  3L00 A;  4IPA A;  1L0O C;  3K2Z A;  3F8C A;  1I6X A;  1IN8 A;  3RTR A;  4BQA A;  2OA4 A;  1K78 B;  5LBQ A;  3ECO A;  1MJA A;  1WWX A;  1J59 A;  3HOS A;  4Q48 A;  3HYI A;  4PGG A;  1YLF A;  4H0E A;  2EFN A;  3E6C C;  1R36 A;  4KN7 X;  4A6D A;  3QP6 A;  1SMY F;  2HFH A;  3BP8 A;  1IXC A;  3H92 A;  5HS9 A;  1Q1H A;  1YS7 A;  1MJB A;  3CDH A;  4UVC A;  3KP5 A;  2QUF A;  5D8L B;  3R4K A;  1S6L A;  3I5U A;  1KGS A;  5FLX Z;  5K5Q A;  1I1S A;  4GXO A;  4R1H A;  2NRA C;  3DPT A;  2VBW A;  1JXS A;  4I02 A;  2CO5 A;  1R7J A;  1W7P B;  4L9T A;  2YPR A;  2PN6 A;  3IRQ A;  2BEO A;  1XSV A;  2W57 A;  4EGZ A;  3DP7 A;  3RJP A;  4HF1 A;  1TQM A;  3ABT A;  4K2E A;  1H9G A;  2L3D A;  3P7N A;  3COA C;  2HKX A;  1P4W A;  3WGH A;  1USS A;  1R22 A;  5KK1 A;  5L3G A;  2DU9 A;  1I27 A;  1SFU A;  1GXP A;  1TW2 A;  4TV7 A;  4U0W A;  2VC1 A;  3QRF F;  5F1R A;  4ZH4 F;  3T8T A;  3K1M A;  4I0B A;  3DXJ F;  2V1X A;  1ON2 A;  2IW5 A;  2OZ6 A;  2WV0 A;  5E1X A;  3KLN A;  1PUE E;  4PZJ A;  4FX4 A;  1HW1 A;  1WQ2 A;  4HX8 A;  4LFU A;  4E70 A;  1T2K A;  3EUH A;  5H6R A;  3RPQ A;  3LAP A;  4KT5 C;  4IJA A;  3F6V A;  3T1B A;  1F4K A;  4HF0 A;  4BH9 A;  2A07 F;  5LRR A;  2Z99 A;  1YW9 A;  2RNJ A;  1J75 A;  3KP6 A;  5H6Q A;  3S2W A;  2Z33 A;  1KU7 A;  4P9U A;  1B9M A;  3BJO A;  4JQF A;  3J80 Z;  4ZYH A;  2HYF A;  1D8J A;  5BPD A;  5FD6 A;  2O0Y A;  3E6D A;  2GZW A;  3L09 A;  5HOO A;  4ZZL A;  1G3W A;  4KIF A;  2LSO A;  2X4H A;  1FNN A;  3ZQ7 A;  2K7L A;  5DUI A;  3WGI A;  3RYR A;  1TQP A;  5LGN A;  1HW5 A;  4D0P A;  4KIG A;  2IA0 A;  2K27 A;  2GAU A;  2XVC A;  4Q4Z F;  4LK0 F;  4L18 B;  2LF7 A;  4G6D A;  1SD7 A;  1XDS A;  4CXF A;  3L2C A;  4P9F A;  3KEQ A;  4BYY A;  1IN6 A;  1BIB A;  1FZP B;  1YS6 A;  2VE9 A;  4U7D A;  1G3T A;  1QQI A;  1HQC A;  4RAZ A;  3F23 A;  4EJT A;  2HKO A;  4DQ2 A;  3U9G A;  4EM0 B;  3I59 A;  4LLG F;  4WX9 A;  3K0L A;  2QBY B;  4HX7 A;  2KIM A;  2MH2 A;  3NEU A;  3MZH A;  4M9X A;  2DTR A;  3SQN A;  2AXL A;  5DD4 A;  2QZ8 A;  2F5F A;  1ZYR F;  2A69 F;  1MKM A;  1FYM A;  2JRT A;  2VE8 A;  1ZG1 A;  3Q5F A;  3SHF A;  1X3U A;  3L7W A;  2IT0 A;  1FWZ A;  1QO0 D;  3CLO A;  1YYV A;  3C1D A;  1B6A A;  4HOB A;  3LAJ A;  4G94 A;  2CWE A;  5DD8 A;  4NB5 A;  3BJA A;  1CGP A;  3WTV C;  5E1W A;  4O3M A;  4M9S A;  2HYG D;  4HQE A;  2VOO A;  3BOQ A;  3CUQ B;  4RB3 C;  2QQB A;  4OIN F;  5D4S A;  1VTN C;  3F22 A;  2P6S A;  1R23 A;  4M73 A;  2HZT A;  3BWG A;  1DPU A;  1UHM A;  2GA1 A;  3IC7 A;  2OQG A;  2XHK A;  4WXD A;  1UCR A;  1C0W A;  2CQK A;  2ELH A;  2DK5 A;  3MAJ A;  2QWW A;  1CF7 A;  3HRS A;  4KA4 A;  4KIC A;  1U5T B;  4ESB A;  2KRF A;  2Y75 A;  3K1N A;  2XAG A;  3F6O A;  1RUN A;  4XSX F;  4HZF A;  2HTS A;  3KZZ A;  3GLX A;  3VEP A;  3EDP A;  5JHU A;  1TBX A;  2FU4 A;  4RB2 C;  3E6M A;  1BBY A;  1A04 A;  1IAW A;  4JBA A;  3W6J B;  1OPC A;  1D5V A;  5E8I A;  2FXA A;  2DFI A;  4HQM A;  1TTY A;  2HQN A;  3O6B B;  5D5U B;  1IXS B;  3D5L A;  1WSU A;  2XV4 S;  1XGS A;  5IT9 Z;  2XAH A;  3BZ6 A;  1QZZ A;  2DT5 A;  1RUO A;  1P4X A;  3E5Q A;  3CTA A;  1XCB A;  2RKH A;  2O61 A;  4LLN A;  2L4A A;  2M1B A;  1TW3 A;  1STZ A;  4IRI A;  3DKW A;  1ZGA A;  3QP5 A;  3GYH X;  2VT2 A;  2E1C A;  4UVA A;  1W7P D;  2D1H A;  2VBY A;  2G7U A;  3J81 K;  3WTY C;  2HDC A;  3C7J A;  4MTD A;  4ZYD A;  4ENM A;  3HSR A;  3DPL C;  4XLN F;  5BPI A;  3DV8 A;  4B8X A;  4EJU A;  4L0Z B;  3RKW A;  4CIC A;  5DEQ A;  2M45 A;  1YO5 C;  1BJA A;  1JHF A;  2UZK A;  5E1Z B;  5AIP A;  2EV5 A;  1U5T C;  2RVC A;  1OYI A;  1XD7 A;  2JPC A;  3F8N A;  2VBZ A;  3G3Z A;  4LJZ F;  4LLL A;  2VBX A;  3TDZ C;  2MLK A;  2EFQ A;  2IP2 A;  3LST A;  2PLY A;  4L5J A;  1ZRC A;  3V4G A;  1GHC A;  2V1U A;  2CFX A;  2EWN A;  1RNL A;  3QAH A;  1V3F A;  4OIQ F;  5AON A;  2STW A;  1EV7 A;  3KE2 A;  2HS5 A;  3PQK A;  2NNN A;  2EFW A;  1K7A A;  3GX4 X;  3FX3 A;  2BBY A;  2LKP A;  2IA2 A;  4M6Y A;  2BV6 A;  2HOE A;  5LLQ A;  2EFP A;  2HWV A;  2CG4 A;  3MCZ A;  4XLP F;  2XAS A;  1OYW A;  5ICC A;  4YFX F;  4U88 A;  1D8K A;  4KIB A;  3BRO A;  4GCV A;  4HF2 A;  1I1G A;  4HDU A;  3ULQ B;  1MZB A;  2QEN A;  5DV5 A;  3E3V A;  3WE2 A;  2O3F A;  4Y15 A;  3NQO A;  3QU3 A;  2KIU A;  4IRH A;  1IUY A;  1ZN2 A;  1O7F A;  1MDM A;  4EM2 A;  1G3S A;  1BI1 A;  1AOY A;  4LMY A;  1TLH B;  2TDX A;  2M5W A;  2RDP A;  5ILS A;  2KJC A;  5E17 F;  3V8L A;  1OYY A;  3J80 K;  3K1P A;  1FY7 A;  3CO6 C;  1Z6T A;  2FSW A;  2F5D A;  3V7R A;  1B59 A;  5L3B A;  2NAZ A;  3DFG A;  1S3J A;  2PI0 A;  1XMA A;  2GXB A;  1R1T A;  3VB2 A;  4HLY A;  4KYW A;  2PFB A;  2H27 A;  5K1Y A; 
#chains in the Genus database with same CATH topology
 1UZC A;  4IHY A;  2BVM A;  5K5O A;  5CJ9 A;  3CMM A;  4BEH B;  3BT9 A;  2BZT A;  1SD6 A;  4PK4 A;  3ROU A;  4U0Y A;  3DF8 A;  5L3E A;  2MFZ A;  2E7X A;  5CVU A;  3J81 Z;  4N0B A;  3ZN1 A;  4UNO A;  1MNE A;  3JRF A;  3W6V A;  2EK5 A;  3P5J A;  4WF2 A;  2MBF A;  2MLG A;  3D5R C;  2BGC A;  5EF6 A;  4ZYE A;  4DGW B;  1F36 A;  2D45 A;  4A5M A;  2GXG A;  3ZCO A;  3ZQH A;  2O5R A;  2VB6 A;  1PYV A;  3X2Q H;  4BGD A;  3SZG A;  1GXQ A;  2K3F A;  3BTL A;  3FXO A;  4X0G A;  3OS0 A;  3I64 A;  4UHT A;  1JJ6 C;  2H09 A;  1IRF A;  4M3F A;  2P0W A;  2L54 A;  4BQN A;  4UVB A;  1YRN B;  2QM3 A;  3R0J A;  1R1V A;  3E1S A;  2WB1 N;  4EMS A;  5EGO A;  2BVL A;  2BHY A;  2B0L A;  1SFK A;  3E5X A;  3HPH A;  3ZGK A;  1SMT A;  1YE9 A;  2ZME A;  1PDN C;  2D1V A;  3WTT C;  2Y9Z A;  2EB7 A;  5JR3 A;  1GVJ A;  1Y0N A;  2UXN A;  3HTU A;  3O8H A;  2EH3 A;  3LQR A;  2UV1 A;  3F8M A;  4LB6 B;  3MVP A;  1I5Z A;  1MBG A;  4M6X A;  2E2H J;  2KIS A;  4A6E A;  2W7N A;  3HTS B;  4NHJ A;  1W5T A;  2CYY A;  4BAC A;  3VFZ A;  2VXZ A;  2KIQ A;  1ULY A;  1SVO A;  3K4K A;  2IAI A;  3JAM Z;  3PIP F;  1FIP A;  3FBN B;  1HW2 A;  1BR4 A;  2VLA A;  1G59 A;  3PM1 A;  2FRH A;  4UV8 A;  1B72 B;  1IXR C;  1MH4 A;  2LBF B;  3BG3 A;  5J4Y A;  3EUH C;  4B1R A;  1V4R A;  2LYC A;  3H5R A;  5ILV A;  1Z67 A;  4HAM A;  4WXC A;  2HQR A;  4RGX A;  3CLQ A;  4AC0 A;  4N4O B;  4LG0 B;  4HV5 A;  1XCV A;  2VOD A;  3ZXS A;  3PNY A;  3DPU A;  3CJQ B;  1WI3 A;  1T6S A;  5LEJ A;  3HOV J;  2QLZ A;  3IP4 B;  3ESW B;  3ML6 A;  1JTY A;  3E7L A;  1LB2 A;  1HC8 A;  4A0X A;  3LSM A;  4MEY F;  5J8F A;  3HSE A;  1T39 A;  3MZY A;  1K83 J;  2GWR A;  5K5R A;  2M30 A;  2HOA A;  3V8K A;  4AUX A;  1X1C A;  4EV0 A;  3ZMD A;  4FX0 A;  4IHS A;  2J5O A;  2JA8 J;  2FQ4 A;  1G3Y A;  2DJN A;  4PJM A;  5J40 A;  3OSG A;  1YTY A;  2TCT A;  2X1D A;  1U6G A;  2F6C A;  1BJZ A;  1KU2 A;  4PFP A;  1QBJ A;  3G1L A;  2XIG A;  4FHT A;  3ABM H;  1LPQ A;  1E17 A;  2FA5 A;  1P4A A;  3I58 A;  5BOX A;  3FXJ A;  4R8H A;  4UXN A;  1MBF A;  3DU5 A;  4XBF A;  2G0E A;  4P1W A;  5HDK A;  2VOP A;  2XRO A;  4RAG A;  4OOI A;  1M1E B;  3ABK H;  4LGW A;  3CCU I;  2R7S A;  2F4O B;  3H3U A;  3MKY B;  5J1U A;  4A3L J;  3K4L A;  2EIL H;  1HLV A;  3ERM A;  4JYK A;  1TNT A;  4HNT A;  2V9V A;  3GZ6 A;  1KON A;  4AM3 A;  2Z9O A;  2BXZ A;  2DQL A;  4QWQ A;  1RC9 A;  5F08 A;  4CA0 A;  4A3I J;  2FOW A;  1E2X A;  5EEG A;  3QPH A;  1RRJ A;  2H94 A;  3LMM A;  3F21 A;  4UB8 C;  2M34 A;  5D5W B;  1N25 A;  2IEK A;  1SFX A;  2DMN A;  5D4R A;  1T0F C;  3JTG A;  4FE4 A;  2PBI A;  2A6E F;  1T98 A;  2DLL A;  2PJR A;  3OYB A;  3IHU A;  2QA4 I;  4BAY A;  3CC7 I;  3ELK A;  1FIA A;  3OYK A;  2F2E A;  3SZP A;  4MGR A;  1ZH5 A;  5F1J A;  1YW7 A;  2P5K A;  2MYS A;  1E3O C;  1K78 A;  3UR3 C;  1RET A;  4LIV A;  3MQ0 A;  2R4G A;  2Z2S B;  4I7H A;  1XC5 A;  1YIO A;  1X2N A;  4EVI A;  1ONV A;  5TJJ A;  3ZMS A;  3SXY A;  3JRA A;  2R5Z B;  3O3K A;  1LDD A;  2ZFU A;  1W36 C;  1YW8 A;  2OCC H;  1IN4 A;  1OJL A;  2A3S A;  4F7Z A;  2EA2 A;  4N4N B;  2DK8 A;  2DW4 A;  2ZXH A;  4E6K G;  1BR1 A;  2EA4 A;  1R5G A;  4AIH A;  5FO5 A;  2G9W A;  2V4J C;  1TT5 B;  1UFM A;  1G8X A;  1FSE A;  3CJT B;  5JLW A;  1ON1 A;  2IXS A;  3S32 A;  1FLI A;  3M7G A;  2L9R A;  1H8A C;  1TQI A;  2P6T A;  3TP3 A;  4QTR A;  2GOX B;  5KAF C;  5IT9 K;  2ZKZ A;  4ESJ A;  2ESH A;  2A6T A;  4OIP F;  5KCM A;  5JFR A;  4XN3 A;  2PMH A;  4XLC A;  1WHU A;  5FD5 A;  1VFC A;  3PIO F;  5IT3 A;  2ISY A;  2HNH A;  4O5V A;  4A93 J;  3AG1 H;  3RYP A;  1D1B A;  4M9Z A;  3ZRG A;  2WTE A;  2P81 A;  2QEX I;  2K3P A;  1WJD A;  2NOJ B;  1X4O A;  2ECC A;  1ZAO A;  2DAO A;  1W7P A;  5IP6 A;  1VQ4 I;  3FXM A;  5JVT A;  3LA2 A;  4BKX A;  4KDP A;  5J8C A;  2QQA A;  2M4G A;  5B1B H;  3FF5 A;  2LLK A;  4S04 A;  1AKH B;  2RV8 A;  2W48 A;  3LSH A;  4L5I A;  2L01 A;  4RMN A;  5ICF A;  5K7H A;  1T8I A;  1VQ5 I;  2GQQ A;  1Z0X A;  3KET A;  1P6R A;  3WTX C;  2V1D A;  3JTH A;  4FAS D;  2PG4 A;  4BHP A;  1NH3 A;  2COM A;  3GTK J;  1REP C;  2HU9 A;  4OIO F;  1YFH A;  1JKO C;  1FTT A;  1KYZ A;  1KU9 A;  2ZJ2 A;  1IRG A;  4BE1 A;  2K02 A;  2JUC A;  5EG0 A;  1FYL A;  2UWM A;  2F5E A;  4YII A;  1YJ9 I;  2R0Q C;  3M9A A;  5FKM A;  1MMA A;  4EM1 A;  5CVR A;  3KP4 A;  4IXA A;  3TQN A;  2BW3 B;  1FJL A;  3SEQ A;  2M87 A;  4CSW A;  1FMW A;  1Y1W J;  1WJ5 A;  1SVL A;  4W1U A;  1S8N A;  2OTJ I;  3GO5 A;  3GTL J;  4EGY A;  1GVD A;  4BQO A;  4CCL A;  2K4J A;  2V6C A;  4RB1 A;  2FOK A;  1IN5 A;  3ABU A;  3BR2 A;  1KQ8 A;  3BR6 A;  3ECH A;  1X58 A;  5J47 A;  4AWX B;  2IRF G;  1FP2 A;  2IPQ X;  2O6G E;  1DP3 A;  3TOA A;  2Q0O A;  1PUF A;  4CHU A;  1HCR A;  1ORK A;  3GEZ A;  4L9J A;  2VQC A;  2ACJ A;  3GFL A;  1KA8 A;  3BPX A;  1B8I B;  4GYI A;  1MBE A;  4DNC A;  4UUS B;  2EV0 A;  2RN7 A;  4NC6 A;  2V26 A;  2R7D A;  3P9I A;  5F04 A;  2HXO A;  2IGN A;  3OYM A;  4DYR A;  4V19 K;  2JN6 A;  2EV6 A;  2HTJ A;  4XRF A;  3OYA A;  2CW0 F;  2Y9Y A;  3W3C A;  1ZGJ A;  5IP7 J;  3NAU A;  2CMP A;  3O2P E;  3PQJ A;  2HPI A;  3ZMT A;  4I0A A;  3HOU J;  2EZH A;  2GIV A;  1Z91 A;  4G7Z F;  1OCZ H;  1YJW I;  3MZ8 A;  5CLS A;  5J1Y A;  3HC7 A;  4D5C A;  2E35 A;  3R6S A;  4BL0 B;  4R79 A;  3EET A;  3HZJ A;  3IH3 A;  1WGX A;  2VQG A;  3Q9S A;  2AQF A;  2QCO A;  4C2M J;  1QPI A;  1O3Q A;  4GYG A;  1NTC A;  1POG A;  3HHH A;  1HA8 A;  2R5Y B;  1LNW A;  2XUB A;  2CV1 A;  2FBK A;  3VYS B;  1PP7 U;  1DU6 A;  3E5U A;  2RC4 A;  2DOD A;  2R7U A;  4NDL A;  1IW7 F;  2CH0 A;  3FXR A;  2K9S A;  2ZNY A;  4G6T B;  1VQ7 I;  2VQL A;  2HXI A;  5L3D A;  3FHZ A;  4CZC A;  3CJR B;  3TDU C;  3OV8 A;  3GBG A;  4CYD A;  1HKS A;  4XK4 A;  1HBX G;  3ZMZ A;  4BY7 J;  4LD5 A;  3A0H C;  1AWC A;  2K9Q A;  2JA7 J;  3LWF A;  2DQR A;  4BHC A;  2Q8K A;  4L9V A;  2FE3 A;  1OKR A;  5EZH A;  1K6O A;  3HRM A;  1ZLK A;  4BJT A;  3G6E I;  1DQU A;  2XPW A;  4NNJ A;  4G12 A;  2BE5 F;  4EEF G;  4C2U A;  2COB A;  2CGP A;  3M3Y J;  2F4M B;  4RM3 A;  3M8E A;  4CCJ A;  2R93 J;  1KQ9 A;  4PCQ A;  5C3E J;  1A6I A;  3F72 A;  4I99 C;  3FXU A;  1O7L A;  3R60 A;  5ERI A;  4F3Q A;  5TGT A;  3GFM A;  4HA8 A;  3K69 A;  4FT8 A;  2ME0 A;  2E2J J;  2DA3 A;  1Q1V A;  2L7Z A;  1QPM A;  3DQV C;  1XGO A;  1YG2 A;  2BYV E;  2X51 A;  5J1R A;  4JX6 A;  2F5V A;  2QBY A;  1ACI A;  3QYB A;  4AVP A;  3IV5 A;  2E71 A;  3BG5 A;  4GFB A;  3DU6 A;  5FKL A;  1W0T A;  4KIT B;  5F6F A;  2V6E A;  3IUO A;  4HNV A;  5F64 A;  1O4X A;  3MN2 A;  2XF6 A;  3WTZ A;  4HEA 2;  5E3O A;  1U8R A;  2K9L A;  3BLY A;  5H2F C;  2LF8 A;  1TWA J;  1VQ9 I;  2DPU A;  2BY3 A;  3K9T A;  5LHH A;  1XB4 A;  4KIS A;  2LP0 A;  2ISZ A;  2L02 A;  1W36 D;  3HUG A;  3FMS A;  3U2R A;  1BA5 A;  4OAZ A;  4WCG A;  1GUU A;  2WAF A;  1FBQ A;  2Q1Z B;  2FF4 A;  4PJN A;  4M3G A;  2K9M A;  4RB0 A;  2PX9 A;  1Y56 A;  4M71 A;  4A3E J;  3HKZ A;  3M1E A;  4S05 A;  4J01 A;  3QYE A;  2QSG X;  2O8K A;  4ESF A;  1W5S A;  3N4M A;  2MGQ A;  1H0M A;  3ZQL A;  2QVO A;  2KDO A;  4FQG A;  4XR6 A;  2A5Y B;  3HIF A;  1XGN A;  2YS9 A;  4PUS A;  2CRG A;  3BR5 A;  3HOT A;  5DCM A;  1OR7 A;  1F1Z A;  5FGM A;  1HDP A;  2ADU A;  3B02 A;  2W4S A;  2KIF A;  3K70 C;  2F5C A;  3LOC A;  2Z5U A;  2ZO4 A;  3C2H A;  3K4C A;  4YFN F;  2Q2E A;  3NWS A;  4CDG A;  4D7M A;  2I5U A;  4PFO A;  2W82 A;  3WU1 B;  3CUQ A;  3QU6 A;  2YR2 A;  3Q9V A;  3JAM K;  4PDK A;  2AO9 A;  2Y0S N;  1FSH A;  1WH7 A;  2M3A A;  5HVQ C;  5FLM J;  4U7B A;  2W1O A;  2P5L C;  2H1L A;  1MNM C;  3AG3 H;  5GAG J;  2DMT A;  4A12 A;  1UEL B;  1KQ0 A;  2WBM A;  3TOB A;  2ZBK A;  3G2B A;  2FML A;  3HOX J;  4AVZ A;  2DDB A;  1S29 A;  3MEX A;  1FBU A;  2AXT C;  3S2H J;  1RR7 A;  5LGT A;  2P7V B;  2CU7 A;  4HX4 A;  3LL7 A;  1JHH A;  3EPZ A;  2CW7 A;  5CVI A;  5FKN A;  3GZ5 A;  1MBJ A;  3CCM I;  3JRC A;  4FCY A;  2WY8 Q;  3GVA A;  5J3L A;  1NG7 A;  1U5T A;  2IVM A;  1P92 A;  1R00 A;  1ZLJ A;  3WTW C;  2R7V A;  2OBP A;  3VYT B;  2MD5 A;  1EH8 A;  4YIF A;  2RRE A;  1V5F A;  5D8K B;  3ZPL A;  1LEB A;  2HVQ A;  3PFI A;  4LIT A;  2WB1 A;  4V2F A;  1MSE C;  2DCE A;  1ZHF A;  5HNF A;  4KMF A;  3CC4 I;  1LFP A;  4BXF A;  1EKE A;  2M0C A;  2VT3 A;  3VOD A;  1KYW A;  2XB5 A;  2K40 A;  1R9T J;  1DGR M;  5ILU A;  2R7R A;  2IA1 A;  1BR2 A;  4XRM A;  1WJA A;  4A3D J;  1IV8 A;  5J4V A;  1ZG3 A;  2XPU A;  3FHN A;  4MQ9 F;  2FMY A;  4OMZ A;  3H5N A;  4ENK A;  2ZFW A;  1LDJ A;  1Z9C A;  3HG9 A;  3T0Y A;  1I50 J;  3VOE A;  4EJW A;  4Y13 A;  2HR3 A;  4WK8 F;  3E0J B;  4ZZD A;  4LB5 A;  3LQQ A;  3M8J A;  4Q47 A;  3AL0 C;  4II3 A;  2HDD A;  3BCB A;  4ZDO A;  1B1B A;  2KRC A;  1WI9 A;  1XDU A;  2JWT A;  1YOV B;  2CFO A;  4AU7 A;  3CCE I;  1RZ4 A;  2HQ5 A;  2J5P A;  3S16 J;  2JVH A;  3K10 A;  5KAI C;  2KKO A;  1EH6 A;  1BN5 A;  1OCP A;  3I54 A;  1FEX A;  2JSC A;  2KJB A;  1XG1 A;  4XKC A;  3I56 I;  2PMU A;  2ZJR F;  2YU3 A;  3WU2 C;  1O57 A;  2FD5 A;  2L0K A;  3ZMV A;  1BI0 A;  5ICE A;  4ENJ A;  2NVX J;  2Z3Y A;  4ZYG A;  2M0M A;  2ZCW A;  1J09 A;  1WJC A;  2W00 A;  2X0L A;  3J7Z I;  5BNG A;  1TWF J;  1BI3 A;  1Z3Y A;  4L5E A;  2BXY A;  1VI0 A;  2OC6 A;  1NHA A;  4BNC A;  2LY2 A;  4MTE A;  3W6K B;  3OY9 A;  3WOD F;  2LG4 A;  1JGG A;  1J9I A;  1DUX C;  4L0Y B;  3QOE A;  4HBL A;  2L9V A;  2MC3 A;  3H3Z A;  3I4P A;  3QOP A;  2L7K A;  1G6N A;  5A2Q K;  4RGS A;  3FM5 A;  1LDK B;  2YX7 A;  1F5T A;  1YQA A;  3KP2 A;  5HDN A;  3RI4 A;  2B7E A;  5D6F A;  2M8E A;  2B9S A;  1BW6 A;  1D0Z A;  4OU0 A;  3BJ6 A;  2BY0 A;  2MA3 A;  2NS7 A;  1B4A A;  1GV2 A;  1SD5 A;  4AIK A;  3DBL B;  2XGX A;  3KFW X;  1XSX A;  4BY1 J;  4G6Q A;  3I9V 2;  1U3E M;  3TBI A;  1XX5 A;  4EJV A;  2FBI A;  5C4J J;  3BG7 A;  1QZY A;  3IL2 A;  1ENH A;  3C3W A;  3EQL F;  4NBQ A;  4U87 A;  4KMU X;  2ZB9 A;  1VF9 A;  4JP0 A;  4HDV A;  2OUM A;  1O3R A;  2LDU A;  3K4M A;  1R71 A;  3RKX A;  4HW0 A;  3HGY A;  3S17 J;  3BR3 A;  3H0G J;  1MSF C;  3C18 A;  3K6G A;  5IYD J;  4AD9 A;  1GV5 A;  1K4S A;  4BHB A;  4ETS A;  3ZQC A;  4LK1 F;  1UG2 A;  3GXO A;  3GUD A;  4N9H A;  1V54 H;  3HJE A;  4XM3 A;  4ENN A;  5LEK A;  3ZMU A;  3J7A Y;  5ICG A;  3WTS C;  2VPR A;  3S1M J;  3CES A;  5LHG A;  5DDG A;  2X6Y A;  2LK2 A;  3GCM A;  3OIP A;  3KP3 A;  3NRV A;  1BL0 A;  2OQR A;  5HDG A;  3RDI A;  1O3S A;  1K4T A;  3I59 B;  1ZAR A;  1BIA A;  3K7A J;  1X3W B;  4HYE A;  3U1K A;  2ZXW H;  4RA2 A;  1P7I A;  2XC7 A;  3QPT A;  3MWM A;  3W2A A;  1VQK I;  5HNH A;  1SFE A;  2YX4 A;  2FBH A;  4NC8 A;  3OYG A;  1ETV A;  2GIZ A;  3S3N A;  3E97 A;  2MH9 A;  3EYY A;  3I71 A;  2RNG A;  2OU2 A;  4QLC U;  2CQX A;  5DM7 F;  3OMY A;  1DP7 P;  3SZT A;  1ZK8 A;  2EPF A;  4WWC A;  1SD4 A;  1UST A;  1X2M A;  5EDN A;  2Y0M A;  3TKY A;  1BC7 C;  3A01 A;  4MIM A;  4MEX F;  2DBB A;  3KCC A;  3OYL A;  4JOM A;  1D3Y A;  2ELJ A;  3G1M A;  3CP8 A;  2XRL A;  4MQV A;  4UY8 I;  3GTQ J;  2WAQ N;  1XSD A;  3WHB A;  5EG0 B;  2ZJQ F;  1EA3 A;  4OIR F;  2A68 F;  4JK1 X;  4NQW A;  4Y3O A;  1Z1D A;  1AHD P;  1YI2 I;  2ECB A;  1AU7 A;  2PJP A;  3KLO A;  5AIQ A;  3QYF A;  3BR1 A;  3I53 A;  4MLO A;  2ZSI B;  3MKW B;  1WRJ A;  1FP1 D;  2BHZ A;  3AG4 H;  3RCO A;  3RKY A;  3F8B A;  4D1Q A;  4RDU A;  4AYB N;  3AFH A;  1TWG J;  3UNG C;  3LFK A;  3K70 D;  4XSZ F;  1WKM A;  5JVG F;  1VQP I;  4JX4 A;  3S14 J;  3IRR A;  3F8F A;  2VPL A;  2VJ5 A;  2NYX A;  1S72 I;  4DW6 A;  4A69 C;  2JA5 J;  2EZL A;  2R7F A;  4E7I A;  2D2W A;  2EZI A;  2XRN A;  3G73 A;  1I6H J;  4MFD A;  2L9S A;  4A0Y A;  2HVR A;  2QGU A;  1J2X A;  2LVS A;  2KL4 A;  2WC2 A;  1W1W E;  3TO9 A;  3WU0 A;  2DO7 A;  2P8T A;  2X1C A;  2HQA A;  2VJ4 A;  4BS9 A;  1LVA A;  3FIS A;  3LSG A;  2LY1 A;  5BMZ A;  1P2F A;  1L3L A;  3WG9 A;  2RQQ A;  5GPC A;  3LSR A;  1IN7 A;  5HLT A;  4B09 A;  4CYC A;  5FFZ A;  1CF7 B;  5H20 A;  3H5A A;  4IHX A;  3TO6 A;  1I39 A;  5GTI C;  2WV1 A;  4E4H A;  3TO7 A;  1HXD A;  5IYC J;  1K79 A;  2GOM A;  6PAX A;  1MGT A;  2HGC A;  3FKI J;  3AG2 H;  3FM3 A;  5CQG A;  1OCO H;  4BEH A;  2DOE A;  2M7B A;  2WAE A;  1LJ9 A;  1MJ9 A;  3R0A A;  4I76 A;  1ETY A;  3M8F A;  3N05 A;  4B47 A;  2DFE A;  2HVS A;  2CUF A;  5CKT A;  4Y17 A;  5A2Q Z;  1FOK A;  4ABZ A;  5GAE J;  1HDD C;  4BXU A;  1K61 A;  2OD5 A;  2IGM A;  3FMR A;  3D5S C;  2DA5 A;  1JE8 A;  3F3X A;  3KP7 A;  1S7O A;  3V7S A;  3N97 A;  1T38 A;  1PVE A;  3V42 A;  4ON0 A;  4G7O F;  3PJR A;  3F9K A;  3PNV A;  4P5O A;  3TED A;  3HSF A;  1RKW A;  2STT A;  1HKT A;  4U0V A;  1Y1V J;  3R61 A;  3IKT A;  2ZXJ A;  5E8G A;  3RPU A;  1BM9 A;  3VDX A;  3LSK A;  1H88 C;  4DBQ A;  1ZRD A;  1LQ1 A;  1QVU A;  1R6R A;  2E60 A;  1X1B A;  3GFI A;  1IUF A;  1R5H A;  2IJL A;  1T0F A;  1YX3 A;  1YRN A;  3WE3 A;  3MD2 A;  4XL9 A;  3HBL A;  5M3F J;  2HOT A;  4IF4 A;  4C30 A;  2R3S A;  2DI3 A;  4Y4R A;  1RPW A;  2DMQ A;  4DZJ A;  5TRD A;  3DEE A;  3SFZ A;  2O8X A;  4ASN A;  1DDN A;  1S7A A;  5CYV A;  1XTA A;  1F9N A;  1QNT A;  3EUK L;  2FQ3 A;  4DZP A;  1B9N A;  4IVN A;  1UB9 A;  2M7A A;  2P5V A;  4G9Y A;  3L9F A;  1PP8 F;  2EIK H;  2C6Y A;  2R92 J;  4E7Z A;  1IZ1 A;  2M4K A;  5E18 F;  1TL8 A;  2L4M A;  3MMY B;  4XQF A;  4MHG A;  4A2U A;  1TP4 A;  2XKO A;  1BC8 C;  5DTD A;  1JI8 A;  4GO1 A;  4CZZ A;  2JTV A;  2ETH A;  2EZK A;  3REO A;  3BPV A;  1LE8 B;  1B72 A;  3SDB A;  2NXN B;  3DEU A;  4YG2 F;  1XN7 A;  4F92 B;  1J7K A;  1UHS A;  3TP0 A;  4WXH A;  1ETK A;  3DLA A;  3WHC A;  3KEY A;  5L3C A;  5KVR A;  2YUS A;  3CCQ I;  3FXQ A;  4LG0 A;  2ZSH B;  2R7W A;  4I01 A;  3FMQ A;  2BOL A;  5LRS A;  4KNY A;  1H9T A;  4ZYA A;  2LH9 A;  4HV6 A;  1DU0 A;  4RGU A;  2XAF A;  2N8G A;  4RAY A;  2OZU A;  3JSP A;  3ISP A;  2E7W A;  4YRV A;  4CO8 A;  3HOY J;  4RM2 A;  4IL6 C;  1A36 A;  2K4B A;  2VC0 A;  3LA3 A;  2H6C A;  2O03 A;  4XKW A;  1LEA A;  1KU3 A;  2P4W A;  3HHG A;  4QSH A;  2XKP A;  1HKQ A;  1Z21 A;  3P9K A;  3A0B C;  1D0Y A;  5FRM A;  2JPB A;  2QQ8 A;  2XF5 A;  1HSJ A;  3JRB A;  5IOZ A;  2FNP A;  1RES A;  4BQQ A;  3T5X A;  1A31 A;  1EH7 A;  2E19 A;  4C3H J;  5M5W J;  2YSR A;  4RS8 A;  3KYD B;  4Z2Y A;  3B6C A;  2XAQ A;  4UUV A;  5DCM B;  5HS8 A;  1O3T A;  2CUE A;  1J5Y A;  1S9H A;  1LFB A;  5M3M J;  5L3F A;  1RI7 A;  1TWC J;  2VON A;  3B73 A;  3CUO A;  3CCJ I;  3FK6 A;  4J00 A;  1FOX A;  4ZTF A;  3CCV I;  2XGD A;  3WG7 H;  4W97 A;  2M2E A;  2JZY A;  1W4M A;  1Y0U A;  2NVT J;  1TC3 C;  2F48 A;  3TW6 A;  1RKT A;  5HLG A;  3ZP5 A;  2R7T A;  4I09 A;  2FEZ A;  3HRT A;  1ZRF A;  2H8W A;  5HS7 A;  4P96 A;  1J0R A;  2PEX A;  2JRM A;  3Q0V A;  4M72 A;  4C3J J;  3L2Q A;  1R4M B;  1U0J A;  1SC7 A;  2W84 A;  4GGG A;  2KT0 A;  1ZR2 A;  3GF2 A;  3KPH A;  2F4I A;  5DCF A;  3TMO A;  5D6E A;  1R49 A;  2EIM H;  4LIU A;  2HEO A;  1N78 A;  2K86 A;  2LNB A;  2EJR A;  3CO7 C;  2IS4 A;  2R5Z A;  5LGU A;  2M8G X;  5GP9 A;  3TGN A;  2Y0S A;  2NVQ J;  4CGZ A;  3HDD A;  1SFO J;  3OWT A;  5CVJ A;  2P7C B;  3WTU C;  2JSP A;  5FFX A;  2CV0 A;  2W85 A;  5DUK A;  5EYR A;  2XAJ A;  2WWY A;  3D0S A;  3FWE A;  2IS6 A;  5GTH C;  4L9N A;  2JMW A;  2LKX A;  1BI2 A;  3OYI A;  1FPQ A;  1F43 A;  3CCR I;  3BY6 A;  3PUB A;  2KHM A;  1MDM B;  4Q5S F;  2DFH A;  4UB6 C;  2W24 A;  3M1C A;  2DTZ A;  3PO3 J;  2UXX A;  2I8D A;  3KZY A;  1OFC X;  3KIO A;  3DTE A;  2V9P A;  2OF7 A;  4AIJ A;  4I2O A;  1ODD A;  5CPR B;  2PQ8 A;  2XF7 A;  4BUP A;  4XIC A;  4HG2 A;  2AQE A;  4XKB A;  4XOP A;  2YU9 J;  5HLH A;  5J6X A;  1QGP A;  5E20 A;  1HF0 A;  4HLX A;  1WFX A;  3MFK A;  1AA7 A;  2XSJ C;  2VKH A;  1G4D A;  2DA7 A;  4A5N A;  1K6Y A;  3IAM 2;  4IRG A;  1FT9 A;  2JT1 A;  3JRE A;  1LFU P;  1HOM A;  3LA7 A;  4P55 A;  4XN0 A;  3ERE D;  4C9Y A;  2JVG A;  3CME I;  3IH4 A;  1AKH A;  4OAY A;  2NS8 A;  3BDD A;  4I98 B;  2A6H F;  5KNL A;  1U2W A;  4HNU A;  3JRI A;  1R58 A;  1HST A;  2NNY A;  4IKF A;  3CUQ C;  4A0Z A;  3GFJ A;  3TL4 X;  3L1P A;  3AL0 B;  2GXA A;  2KFD A;  1JGS A;  2VKE A;  2DMU A;  4PJJ A;  1IF1 A;  5B5E C;  3H9G A;  1QHH D;  2MAB A;  4IHV A;  3DKY A;  3SEZ A;  3CF5 F;  4G7H F;  3V7C A;  2L7F P;  4E7J A;  2OPT A;  2A05 A;  5D5V B;  4M74 A;  4RLQ A;  2JUG A;  3OOP A;  2JJ7 A;  3GTP J;  4X6A J;  4MNU A;  1FTZ A;  3FXL A;  2X9D A;  2OTL I;  3JRD A;  1TNS A;  3IKV A;  3J7Y J;  4A3K J;  1ETO A;  4MO7 A;  4O6J A;  3CMY A;  1WZ2 A;  2Y48 A;  2K85 A;  2PMZ N;  3OSF A;  2ME6 A;  5KHD A;  1X19 A;  2R7Q A;  3V8J A;  1XS9 A;  5FLX K;  1FYK A;  2DDA A;  3HPG A;  1IC8 A;  2A61 A;  3U21 A;  3LSJ A;  4DIQ A;  4XMY A;  1Z7U A;  3BTJ A;  3OIO A;  5EGO B;  2EFO A;  3I0T A;  3ABL H;  1JTX A;  2CSO A;  1WCM J;  1BOA A;  1E3H A;  1ZRE A;  3GWZ A;  3CD6 I;  2E1N A;  1VQO I;  2ZME B;  5E79 C;  3OR1 C;  1D0X A;  2G7H A;  4IHT A;  5M5Y J;  2V79 A;  5D5X B;  3CJN A;  4DBR A;  3RIR A;  1B8I A;  1SAX A;  5HLI A;  3FDY A;  2X6X A;  3KEO A;  4XLF A;  2VN2 A;  4MFE A;  1QZE A;  4JX5 A;  1W5C C;  4BBR J;  2JQ7 A;  2FNA A;  4KFC A;  2E36 A;  2QYO A;  1Z3X A;  4N9I A;  4E7H A;  1ZG5 A;  2OAZ A;  3FZV A;  2ICW G;  2JK3 A;  4ITV A;  3IWZ A;  3JSO A;  2R7Z J;  5IYB J;  4Y7N J;  4EQQ A;  4ZC3 A;  1FC3 A;  2GA2 A;  1XMK A;  2CV2 A;  1YX5 A;  1V5G A;  4D5F A;  3T8R A;  3BTI A;  5ED4 A;  3SJM A;  3WGG A;  1XMX A;  1E0E A;  3U1D A;  3E6B A;  1PJR A;  4G8X A;  1U78 A;  1FX7 A;  3QQA A;  1XGM A;  3HB9 A;  5DYM A;  2RQP A;  1FBS A;  2JA2 A;  4BJ6 C;  2R5Y A;  4M3D A;  4XLA A;  1UHW A;  2QQ9 A;  3P9C A;  1W0U A;  2NS0 A;  4C3I J;  2MG4 A;  5LHI A;  3IWF A;  1OMI A;  4RGR A;  2RGV A;  1R1U A;  2ESN A;  2Z1D A;  3JW4 A;  3W2W A;  3G71 I;  1QA6 A;  1MD0 A;  2VIX A;  3CDL A;  5DS9 A;  3QOD A;  1DPR A;  4A3C J;  5EEH A;  1VZ0 A;  3HRU A;  5IOY A;  4PJ0 C;  4NQW B;  2ZXI A;  1NK2 P;  2DYS H;  5CVV A;  5FB2 A;  3VYR B;  4OMY A;  4KN4 X;  2W25 A;  1IV6 A;  3DWL E;  1RIO H;  2LTP A;  2KLO A;  1Z6R A;  5FLV A;  3LSI A;  5JI6 A;  5BS6 A;  5BQT A;  1YIT I;  2H6B A;  4XOR A;  5FKK A;  3AAF A;  3S3M A;  2AS5 F;  2DPD A;  4IEJ A;  4QPQ A;  1SAN A;  4A3B J;  2LC2 A;  4UV9 A;  3M07 A;  4XOT A;  4EJO A;  2ZNZ A;  3J7A O;  4PGH A;  3ZN0 A;  3GW2 A;  4KUM A;  3A4C A;  2HPM A;  2VI6 A;  2L7M P;  3ASN H;  1EJ9 A;  1Z05 A;  1ZTR A;  2WAQ A;  1FOW A;  2WAD A;  3EYI A;  1WPK A;  1U9O A;  4EAT A;  2PJR B;  5B1A H;  4D9J A;  2HI3 A;  4YFK F;  3L00 A;  4IPA A;  1L0O C;  3K2Z A;  3F8C A;  3RZO J;  1ETX A;  1I6X A;  3OOU A;  4AID A;  1IN8 A;  2ZME C;  3RTR A;  4BQA A;  1MMS A;  2FUG 2;  1Z7L A;  2OA4 A;  1K78 B;  5LBQ A;  1IG7 A;  3ECO A;  1Y8R B;  2ID6 A;  4RBO A;  2BY2 A;  4AYB A;  2XGE A;  2ZJP F;  1MJA A;  1WWX A;  1J59 A;  1FMV A;  3H9Q A;  1ETQ A;  5IY5 H;  4Q48 A;  3HOS A;  3DCF A;  1SVM A;  1IRX A;  3HYI A;  4PGG A;  1YLF A;  5CQE A;  4H0E A;  1ZEL A;  2EFN A;  4PSX A;  3S1N J;  4YEL A;  3E6C C;  4DYC A;  3OYE A;  3BCA A;  1JKR C;  1R36 A;  4KN7 X;  2E1M B;  4A6D A;  3CCY A;  2LR8 A;  2M9H A;  1SMY F;  3QP6 A;  2HFH A;  3Q3S A;  4BU2 A;  1MMN A;  4HSR A;  3BP8 A;  5F27 A;  1IXC A;  3H92 A;  5HS9 A;  4NC7 A;  2IGO A;  2X48 A;  1Q1H A;  2E5Z A;  3PNT A;  4S0H B;  4CCM A;  1YS7 A;  1MJB A;  1A5J A;  3CP2 A;  3CF2 A;  3CDH A;  4UVC A;  3KP5 A;  2QUF A;  5D8L B;  3R4K A;  4BDZ A;  1ZR4 A;  1S6L A;  3I5U A;  3GTO J;  1KGS A;  5FLX Z;  1UG0 A;  1T56 A;  5K5Q A;  1I1S A;  4RLF A;  3PO2 J;  2DA2 A;  4A3J J;  2X85 A;  3S1R J;  4GXO A;  4R1H A;  2NRA C;  3DPT A;  3RKQ A;  5GAH J;  3SFI A;  3JRG A;  2VBW A;  3HEF A;  2CUZ A;  3ZQI A;  3C2G A;  1JXS A;  2L9N A;  2CO5 A;  4I02 A;  1R7J A;  3L2W A;  1W7P B;  4V2G A;  3HOZ J;  4L9T A;  4QPO A;  2YPR A;  1NG6 A;  4CCN A;  2PN6 A;  3IRQ A;  2BEO A;  1T08 B;  4IO9 F;  1XSV A;  5LFA A;  2KDZ A;  2W57 A;  4I6Z A;  4EGZ A;  2K5C A;  3DP7 A;  3RJP A;  1S7E A;  4DJA A;  4HF1 A;  1TQM A;  3HXL A;  3RQI A;  1RR8 C;  2NVU B;  3RQ4 A;  3ABT A;  4K2E A;  1H9G A;  2L3D A;  3P7N A;  4YEJ A;  3S1Q J;  3JRH A;  2IBD A;  5B3S H;  4B44 A;  3COA C;  2ZC2 A;  1P4W A;  2EQR A;  3WGH A;  1USS A;  1R22 A;  3BR0 A;  2LFB A;  5KK1 A;  4F52 A;  5L3G A;  3I55 I;  1I27 A;  2DU9 A;  1GT0 C;  1N75 A;  4C2T A;  3MKL A;  1SFU A;  2L2O A;  3PFY A;  4HPQ A;  1U8B A;  1GXP A;  1ZKG A;  1TW2 A;  4TV7 A;  4U0W A;  4A3M J;  2VC1 A;  4IX7 A;  3QRF F;  5F1R A;  4ZH4 F;  3T8T A;  3D1N I;  3K1M A;  4I0B A;  3DXJ F;  1OCR H;  1WH5 A;  2V1X A;  4FE7 A;  4E7K A;  1X1P A;  1ON2 A;  5C4X J;  3B6A A;  2CUJ A;  1Y6I A;  2IW5 A;  2LRE A;  2OZ6 A;  2WV0 A;  5E1X A;  2VAS A;  2R7X A;  4B43 A;  2DFF A;  2AHQ A;  1QHG A;  3KLN A;  4CH7 A;  3NAR A;  4PZJ A;  3ZR8 X;  1PUE E;  4FX4 A;  1HW1 A;  1WQ2 A;  3BZC A;  4HX8 A;  4LFU A;  2VXD A;  4E70 A;  1T2K A;  1D1C A;  4Z6Y A;  3EUH A;  3CCS I;  5H6R A;  3RPQ A;  1P9Q C;  3LAP A;  4KT5 C;  2V7F A;  4A3F J;  4IJA A;  3F6V A;  2E1M C;  3HM5 A;  3T1B A;  3OYN A;  2K9N A;  1PUF B;  3OYD A;  1F4K A;  1JUM A;  1R5I D;  4HF0 A;  1OCC H;  4BH9 A;  1NK3 P;  4PSW A;  2KZV A;  3H35 A;  2A07 F;  5LRR A;  2Z99 A;  1YW9 A;  3AKZ A;  2RNJ A;  1J75 A;  3KP6 A;  5H6Q A;  1BOB A;  1G2H A;  3Q0U A;  3S2W A;  4B3A A;  2Z33 A;  1KU7 A;  3H9J A;  4P9U A;  3DBR B;  1B9M A;  3BJO A;  4JQF A;  3J80 Z;  2HZD A;  4XON A;  2EIN H;  1JUS A;  1V5E A;  1LKX A;  2Z16 A;  4ZYH A;  2HYF A;  1D8J A;  3GTG J;  3QPS A;  2CQN A;  5FJ8 J;  5BPD A;  4YIR X;  3LNQ A;  2XAU A;  1QU3 A;  3VSL A;  5FD6 A;  2O0Y A;  3E6D A;  1MND A;  1X1D A;  2DOA A;  2GZW A;  3L09 A;  4ZZL A;  5HOO A;  2KP6 A;  1MH3 A;  1TWH J;  1G3W A;  1ZQ3 P;  4KIF A;  3RSN A;  2I10 A;  1I3Q J;  2LSO A;  1APL C;  2X4H A;  3OL4 A;  3IAS 2;  1Y39 A;  1FNN A;  4Y33 A;  3NWT A;  3ZQ7 A;  1P7J A;  2E5N A;  2K7L A;  2XDV A;  3FK7 A;  4ZDL A;  5DUI A;  2TRT A;  3BQY A;  3WGI A;  3RYR A;  1TQP A;  5LGN A;  1HW5 A;  4D0P A;  1WJE A;  2IA0 A;  4FET A;  4KIG A;  3OS2 A;  1UAA A;  2K27 A;  2GAU A;  2XVC A;  4Q4Z F;  4GDF A;  4LK0 F;  1X1A A;  3UKG A;  4L18 B;  5LD2 C;  2LF7 A;  4G6D A;  1SD7 A;  1XDS A;  4CXF A;  1TZL A;  3OL3 A;  2DOF A;  2QKL B;  3L2C A;  3OR2 C;  2DT6 A;  2A5W A;  4P9F A;  3KEQ A;  4BYY A;  4BE0 A;  3CQZ J;  1IN6 A;  3H1C A;  1QVT A;  4H4K C;  2QSH X;  1BIB A;  1MMD A;  2DA4 A;  2LMD A;  1MIJ A;  1FZP B;  4F93 B;  2BY1 A;  1YS6 A;  3DTK A;  4D7N A;  3W2V A;  2WA0 A;  3SDG A;  4IQJ A;  2VE9 A;  5FRN A;  4ANJ A;  4U7D A;  1G3T A;  2WY7 Q;  3ZQF A;  1QQI A;  1HQC A;  3SYT A;  2VUM J;  4RAZ A;  3F23 A;  2CQ7 A;  1SEU A;  4EJT A;  2HKO A;  2FX0 A;  4DQ2 A;  3U9G A;  4EM0 B;  5JLX A;  3ZOB A;  3I59 A;  4LLG F;  4WX9 A;  3K0L A;  3DEW A;  2LD5 A;  1UJ8 A;  4BE2 A;  2QBY B;  4HX7 A;  2LBF A;  5GPA A;  3DKX A;  2KIM A;  2MH2 A;  4ZJZ A;  2VJI A;  1DGW Y;  3NEU A;  3CC2 I;  1U9N A;  3PUF A;  1XPX A;  1JT0 A;  4BBS J;  3MZH A;  4M9X A;  2DTR A;  3QPL A;  3SQN A;  2AXL A;  5DD4 A;  3OYH A;  2QZ8 A;  2NVY J;  2F5F A;  1ZYR F;  1IJW C;  2A69 F;  1MKM A;  1FYM A;  2JRT A;  3OYJ A;  2VE8 A;  1LUJ B;  2V9K A;  4E7L A;  1S5L C;  4II2 A;  1ZG1 A;  3HUG B;  3Q5F A;  4FTH A;  1ERD A;  2KPM A;  3JCU C;  2DJI A;  2CS3 A;  4M6V A;  2VQH A;  3SHF A;  1X3U A;  3OS1 A;  5B66 C;  1YJN I;  3L7W A;  3A1Y A;  3VPR A;  2MW8 A;  3DTI A;  2IT0 A;  4M3B A;  1FWZ A;  1QO0 D;  1X3Z B;  2H1K A;  3CLO A;  4XLH A;  1D1A A;  1YYV A;  3C1D A;  2DA1 A;  5F0F A;  1B6A A;  4HOB A;  1GLN A;  2NOG A;  3BG6 A;  3LAJ A;  4G94 A;  2KQR A;  2XB0 X;  2CWE A;  2O7O A;  4RAF A;  5DD8 A;  4NB5 A;  2HOS A;  2UUZ A;  1MBH A;  2HDW A;  3BJA A;  5EZG A;  1CGP A;  1T33 A;  3WTV C;  3PL8 A;  1JT6 A;  5E1W A;  4O3M A;  2XGC A;  1A6Q A;  3L2R A;  4M9S A;  3G4S I;  3GTM J;  2HYG D;  2Q2E B;  1IDY A;  4HQE A;  2VOO A;  3Q0W A;  3BOQ A;  1ETW A;  3CUQ B;  4RB3 C;  2H8R A;  1VQM I;  2QQB A;  3QWL A;  3CMA I;  4LOC A;  4OIN F;  5D4S A;  1VTN C;  3K2A A;  3F22 A;  1E3P A;  2KMU A;  1R23 A;  2P6S A;  4M73 A;  4IHW A;  2HZT A;  3BWG A;  1DPU A;  1UHM A;  2GA1 A;  3IC7 A;  5JHF A;  2OQG A;  2XHK A;  4WXD A;  3K4N A;  1IGN A;  1UCR A;  5EEA A;  3H36 A;  1C0W A;  1OQY A;  2CQK A;  2ELH A;  1JUP A;  1WJB A;  3JR9 A;  4IOC F;  2PMZ A;  2DK5 A;  3CCL I;  3MAJ A;  2QWW A;  1CF7 A;  2DMP A;  3HRS A;  4KA4 A;  1V55 H;  1VQ6 I;  3I4N J;  4KIC A;  1KZH A;  3L2U A;  1U5T B;  5DM6 F;  4XKV A;  4ESB A;  2KRF A;  3LFU A;  2Y75 A;  3K1N A;  4UUT A;  5K7F A;  2XAG A;  3S2D J;  1OLT A;  3F6O A;  3DBH B;  1RUN A;  4XSX F;  4HZF A;  2HTS A;  3KZZ A;  3GLX A;  3VEP A;  3EDP A;  5JHU A;  2MC4 A;  3H0D A;  2CW8 A;  3OIQ A;  1TBX A;  3MKZ A;  2FU4 A;  4RB2 C;  1X4P A;  3ZQG A;  4BXX J;  5K1Y A;  2DN0 A;  3E6M A;  5F0C A;  3S3O A;  2VJJ A;  3ASO H;  1BBY A;  4XNF A;  4XRS G;  1A04 A;  1IAW A;  5M5X J;  4JBA A;  3W6J B;  1ZGW A;  1OPC A;  3KYC B;  3I4M J;  1D5V A;  2DXI A;  5E8I A;  2FXA A;  2DFI A;  4HST A;  2B63 J;  4HQM A;  1TTY A;  2HQN A;  3O6B B;  3BQZ A;  5D5U B;  1IXS B;  3D5L A;  1OIS A;  2VL8 A;  3C2B A;  1N77 A;  1WSU A;  2XV4 S;  1XGS A;  5IT9 Z;  2L5Q A;  2XAH A;  3BZ6 A;  4ZTJ A;  1QZZ A;  2DT5 A;  2OCE A;  3KX2 A;  2DYR H;  3O8G A;  4CUG A;  1R4N B;  1RUO A;  3CDI A;  4XID A;  1P4X A;  2GLO A;  2E34 A;  3EUA A;  3E5Q A;  1OR7 C;  3BG9 A;  3GME A;  3VYU B;  3CTA A;  1XCB A;  2RKH A;  2VKV A;  3RPU D;  2O61 A;  1Z77 A;  3LSP A;  3BTC A;  5EJC A;  4LLN A;  2L4A A;  2M1B A;  1TW3 A;  1STZ A;  4IRI A;  5FRO A;  3DKW A;  1ZGA A;  4F91 B;  3QP5 A;  1LE8 A;  3GYH X;  5IPA A;  2Y30 A;  2VT2 A;  3G1O A;  2E1C A;  4UVA A;  3S8P A;  2MSY A;  2ELK A;  2RAE A;  1UMQ A;  1W7P D;  2D1H A;  2VBY A;  3KYL A;  5E3M A;  2EIJ H;  5K7Z A;  2G7U A;  3J81 K;  3WTY C;  2HDC A;  3C7J A;  4MTD A;  5GAD J;  4ZYD A;  4ENM A;  3HSR A;  3DPL C;  4XLN F;  2OJE D;  5BPI A;  3DV8 A;  3L2V A;  4B8X A;  2X1E A;  4EJU A;  3HGG A;  4L0Z B;  3RKW A;  4CIC A;  5DEQ A;  3RZD J;  2M45 A;  1YO5 C;  1BJA A;  1JHF A;  3BZK A;  2IS2 A;  1MMG A;  3HL2 A;  5FKO A;  4ZDP A;  2E2I J;  2UZK A;  2GBY A;  1Y8Q B;  5E1Z B;  5AIP A;  2EV5 A;  1U5T C;  1JKP C;  2BW3 A;  2RVC A;  1OYI A;  2LOO A;  2Y2Z A;  1XD7 A;  4FIS A;  3A2K A;  2LY9 A;  3PSF A;  2JPC A;  2X6O A;  2VBZ A;  3F8N A;  3G3Z A;  4X1E A;  1A35 A;  3F0C A;  4LJZ F;  2QF7 A;  2E1O A;  4LLL A;  4J19 A;  4IOA F;  3S15 J;  4GRI A;  1JJ8 C;  1GDT A;  2VBX A;  4XLE A;  2MLK A;  2EFQ A;  2IP2 A;  3TDZ C;  4KJZ A;  4E7S A;  3LST A;  2PLY A;  4XRS A;  4LG3 A;  4L5J A;  1JKQ C;  1WVR A;  1ZRC A;  3V4G A;  2IS1 A;  1GHC A;  4OWR B;  2V1U A;  1IO2 A;  4DOZ A;  5HOD A;  4UUS A;  3GTJ J;  2CFX A;  2EWN A;  4IZZ A;  1RNL A;  3QAH A;  1V3F A;  3FBI B;  2HYJ A;  4OIQ F;  4A3G J;  5AON A;  4IQ4 A;  5F0H A;  1CQT A;  2STW A;  3K4J A;  1EV7 A;  1YHQ I;  3KE2 A;  2HS5 A;  3PQK A;  2X6W A;  3A03 A;  3ONQ A;  4CCO A;  2NNN A;  3KZI C;  2EFW A;  1YIJ I;  1K7A A;  3GX4 X;  3FX3 A;  2BBY A;  3GZN B;  1SAU A;  1D5Y A;  1IDZ A;  2LKP A;  2IA2 A;  2CQQ A;  2FJ1 A;  4NUB A;  2EBI A;  2KZG A;  5TIS C;  4M6Y A;  4CCK A;  4M3E A;  2GM4 A;  2BV6 A;  2HOE A;  5LLQ A;  2EFP A;  2HWV A;  2R7O A;  5IP9 J;  1VQ8 I;  2QKM B;  1I3A A;  2CG4 A;  3MCZ A;  4XLP F;  2XAS A;  1OYW A;  4B3X A;  5ICC A;  4Y52 J;  1VQN I;  1WJF A;  4YFX F;  4U88 A;  3A01 B;  1D8K A;  4KIB A;  3BRO A;  4B4C A;  4GCV A;  4HF2 A;  2Y31 A;  3K4B A;  9ANT A;  4B48 A;  1ITY A;  4HRI A;  1I1G A;  4HDU A;  3ULQ B;  1MZB A;  2QEN A;  5DV5 A;  4DYQ A;  1VQL I;  3FIW A;  1OCT C;  5E3N A;  5E3L A;  1QRY A;  3E3V A;  3GLL A;  3WE2 A;  2O3F A;  3OYF A;  3HOW J;  2D5V A;  4Y15 A;  3NQO A;  3QU3 A;  2IGK A;  2KIU A;  4QIW N;  4IRH A;  1IUY A;  2O9L A;  1ZN2 A;  3ZQQ A;  2Y69 H;  1O7F A;  3TW7 A;  1MW7 A;  4BJ5 C;  4BDY A;  3CZ6 A;  2LKS A;  3M4O J;  1EF4 A;  2VKD A;  1MDM A;  2KRH A;  4EM2 A;  1G3S A;  1BI1 A;  3H3V K;  1TT0 A;  2CJJ A;  2OV7 A;  3VSK A;  1AOY A;  4LMY A;  1T95 A;  2DA6 A;  1TLH B;  4KT6 A;  2TDX A;  1FOY A;  2ID3 A;  2M5W A;  2RDP A;  5ILS A;  2JA6 J;  2KJC A;  5E17 F;  4PJL A;  2XPV A;  3V8L A;  1OYY A;  3J80 K;  3VWB A;  3K1P A;  1LVK A;  3BC8 A;  1FY7 A;  3CO6 C;  1Z6T A;  3HKZ N;  2FSW A;  3PSI A;  2F5D A;  2LRD A;  1VND A;  3V7R A;  1BW5 A;  3OYC A;  1B59 A;  3DLL F;  3FXK A;  5L3B A;  2NAZ A;  3I3L A;  3DFG A;  1S3J A;  2PI0 A;  1XMA A;  1H89 C;  2MD0 A;  2QSF X;  3IH2 A;  2V1N A;  2GXB A;  1R1T A;  3FKJ A;  3VB2 A;  4CYC B;  4HLY A;  4KYW A;  2XSD C;  1MBK A;  1IRZ A;  2PFB A;  4F55 A;  2H27 A;  2DT7 B;  5C44 J;  3A02 A;  2HKX A;  3S93 A; 
#chains in the Genus database with same CATH homology
 5K5O A;  5CJ9 A;  1SD6 A;  3ROU A;  4U0Y A;  3DF8 A;  5L3E A;  2E7X A;  5CVU A;  3J81 Z;  4N0B A;  3ZN1 A;  4UNO A;  2EK5 A;  4WF2 A;  2MBF A;  2MLG A;  2BGC A;  4ZYE A;  2D45 A;  4A5M A;  2GXG A;  1GXQ A;  3I64 A;  4UHT A;  2H09 A;  1IRF A;  2L54 A;  4UVB A;  2QM3 A;  3R0J A;  1R1V A;  4EMS A;  2B0L A;  3E5X A;  1SMT A;  2ZME A;  1PDN C;  2D1V A;  3WTT C;  2EB7 A;  5JR3 A;  1GVJ A;  2UXN A;  3HTU A;  3LQR A;  3F8M A;  4LB6 B;  1I5Z A;  4M6X A;  4A6E A;  3HTS B;  4NHJ A;  1W5T A;  2CYY A;  3VFZ A;  2VXZ A;  1ULY A;  3JAM Z;  1HW2 A;  4UV8 A;  2FRH A;  1IXR C;  1V4R A;  5ILV A;  4HAM A;  4WXC A;  2HQR A;  4RGX A;  4LG0 B;  4HV5 A;  1XCV A;  2VOD A;  1T6S A;  5LEJ A;  2QLZ A;  3ML6 A;  1LB2 A;  4A0X A;  4MEY F;  5J8F A;  3HSE A;  1T39 A;  3MZY A;  2GWR A;  5K5R A;  2M30 A;  3V8K A;  4EV0 A;  3ZMD A;  4FX0 A;  4IHS A;  2J5O A;  1G3Y A;  1YTY A;  1U6G A;  1KU2 A;  1QBJ A;  4FHT A;  2XIG A;  1E17 A;  2FA5 A;  1P4A A;  3I58 A;  5BOX A;  4R8H A;  4UXN A;  4XBF A;  5HDK A;  2VOP A;  2XRO A;  4OOI A;  4LGW A;  3H3U A;  1TNT A;  2V9V A;  3GZ6 A;  2Z9O A;  2DQL A;  4QWQ A;  1E2X A;  5EEG A;  3QPH A;  2H94 A;  3F21 A;  5D5W B;  1SFX A;  5D4R A;  3JTG A;  2PBI A;  2A6E F;  1T98 A;  2DLL A;  3IHU A;  4BAY A;  3ELK A;  2F2E A;  3SZP A;  4MGR A;  1ZH5 A;  1YW7 A;  2P5K A;  1K78 A;  3MQ0 A;  4I7H A;  1YIO A;  4EVI A;  1ONV A;  5TJJ A;  3ZMS A;  3SXY A;  3O3K A;  1LDD A;  1YW8 A;  1IN4 A;  2A3S A;  4F7Z A;  2EA2 A;  2DK8 A;  2DW4 A;  2EA4 A;  1R5G A;  4AIH A;  5FO5 A;  2G9W A;  1UFM A;  1FSE A;  1ON1 A;  1FLI A;  3M7G A;  1TQI A;  2P6T A;  5IT9 K;  2ZKZ A;  4ESJ A;  2ESH A;  4OIP F;  5JFR A;  2PMH A;  5FD5 A;  5IT3 A;  2ISY A;  4O5V A;  3RYP A;  4M9Z A;  2WTE A;  1ZAO A;  2DAO A;  1W7P A;  5JVT A;  3LA2 A;  4KDP A;  5J8C A;  2QQA A;  3FF5 A;  4S04 A;  2RV8 A;  4L5I A;  2L01 A;  5ICF A;  2GQQ A;  3KET A;  1P6R A;  3WTX C;  2V1D A;  3JTH A;  2PG4 A;  4BHP A;  2COM A;  1REP C;  4OIO F;  1YFH A;  1KYZ A;  1KU9 A;  2ZJ2 A;  1IRG A;  2K02 A;  1FYL A;  2UWM A;  2F5E A;  4YII A;  3M9A A;  4EM1 A;  5CVR A;  3KP4 A;  4IXA A;  3TQN A;  2M87 A;  1S8N A;  3GO5 A;  4EGY A;  2K4J A;  2V6C A;  4RB1 A;  2FOK A;  1IN5 A;  3ABU A;  1KQ8 A;  3ECH A;  4AWX B;  2IRF G;  1FP2 A;  2IPQ X;  2O6G E;  3TOA A;  2Q0O A;  4CHU A;  3GEZ A;  4L9J A;  2ACJ A;  3GFL A;  1KA8 A;  3BPX A;  4GYI A;  4DNC A;  2EV0 A;  2RN7 A;  2R7D A;  3P9I A;  2EV6 A;  2HTJ A;  4XRF A;  2CW0 F;  1ZGJ A;  3O2P E;  3PQJ A;  3ZMT A;  4I0A A;  2GIV A;  1Z91 A;  4G7Z F;  5CLS A;  3R6S A;  4R79 A;  3EET A;  3Q9S A;  1O3Q A;  4GYG A;  3HHH A;  1LNW A;  2XUB A;  2FBK A;  1PP7 U;  3E5U A;  2RC4 A;  1IW7 F;  3FXR A;  2ZNY A;  5L3D A;  3FHZ A;  3TDU C;  3OV8 A;  4CYD A;  1HKS A;  1HBX G;  3ZMZ A;  4LD5 A;  1AWC A;  3LWF A;  2DQR A;  4BHC A;  2Q8K A;  4L9V A;  2FE3 A;  1OKR A;  1K6O A;  3HRM A;  1ZLK A;  2BE5 F;  2CGP A;  3M8E A;  1KQ9 A;  4PCQ A;  3F72 A;  3FXU A;  1O7L A;  3R60 A;  5ERI A;  3GFM A;  4HA8 A;  3K69 A;  4FT8 A;  3DQV C;  1QPM A;  1XGO A;  1YG2 A;  2BYV E;  2QBY A;  4AVP A;  5F6F A;  5F64 A;  3WTZ A;  1U8R A;  2LF8 A;  2DPU A;  3K9T A;  5LHH A;  1XB4 A;  2ISZ A;  2L02 A;  3HUG A;  3FMS A;  3U2R A;  4WCG A;  1FBQ A;  2FF4 A;  4RB0 A;  4M71 A;  3M1E A;  4S05 A;  4ESF A;  1W5S A;  3N4M A;  1H0M A;  2QVO A;  2A5Y B;  3HIF A;  1XGN A;  3HOT A;  5DCM A;  1OR7 A;  1F1Z A;  5FGM A;  2ADU A;  3B02 A;  2KIF A;  2F5C A;  2Z5U A;  2ZO4 A;  4YFN F;  2Q2E A;  4CDG A;  3WU1 B;  3CUQ A;  3QU6 A;  2YR2 A;  3Q9V A;  3JAM K;  4PDK A;  1FSH A;  2P5L C;  5HVQ C;  4U7B A;  4A12 A;  1KQ0 A;  3TOB A;  2ZBK A;  2FML A;  1S29 A;  3MEX A;  1FBU A;  5LGT A;  2P7V B;  4HX4 A;  1JHH A;  5CVI A;  3GZ5 A;  3GVA A;  1U5T A;  2IVM A;  1P92 A;  1R00 A;  1ZLJ A;  3WTW C;  2OBP A;  2MD5 A;  1EH8 A;  4YIF A;  3ZPL A;  1LEB A;  5D8K B;  3PFI A;  1ZHF A;  4KMF A;  2VT3 A;  3VOD A;  1KYW A;  5ILU A;  2IA1 A;  1ZG3 A;  4MQ9 F;  2FMY A;  4OMZ A;  4ENK A;  2ZFW A;  1LDJ A;  1Z9C A;  3T0Y A;  3VOE A;  4EJW A;  4Y13 A;  2HR3 A;  4WK8 F;  4ZZD A;  4LB5 A;  3LQQ A;  4Q47 A;  1B1B A;  1WI9 A;  1XDU A;  1RZ4 A;  2J5P A;  2KKO A;  1EH6 A;  1BN5 A;  3I54 A;  2JSC A;  2KJB A;  2PMU A;  2YU3 A;  1O57 A;  3ZMV A;  1BI0 A;  5ICE A;  4ENJ A;  2Z3Y A;  4ZYG A;  2ZCW A;  2X0L A;  1BI3 A;  1NHA A;  4BNC A;  4MTE A;  3W6K B;  3WOD F;  1J9I A;  1DUX C;  4L0Y B;  4HBL A;  2MC3 A;  3H3Z A;  3I4P A;  3QOP A;  1G6N A;  5A2Q K;  4RGS A;  3FM5 A;  1LDK B;  2YX7 A;  1F5T A;  1YQA A;  3KP2 A;  5HDN A;  3RI4 A;  5D6F A;  2M8E A;  4OU0 A;  3BJ6 A;  2MA3 A;  1B4A A;  1SD5 A;  4AIK A;  2XGX A;  3KFW X;  1XSX A;  4G6Q A;  1U3E M;  4EJV A;  2FBI A;  1QZY A;  3IL2 A;  3C3W A;  3EQL F;  4KMU X;  4HDV A;  1O3R A;  2LDU A;  3RKX A;  4HW0 A;  3C18 A;  4AD9 A;  4BHB A;  4ETS A;  4LK1 F;  3GXO A;  3GUD A;  4N9H A;  4ENN A;  5LEK A;  3ZMU A;  5ICG A;  3WTS C;  5LHG A;  5DDG A;  3KP3 A;  3NRV A;  2OQR A;  5HDG A;  3RDI A;  1O3S A;  3I59 B;  1ZAR A;  1BIA A;  4HYE A;  3QPT A;  3MWM A;  1SFE A;  2YX4 A;  2FBH A;  3E97 A;  2MH9 A;  3EYY A;  3I71 A;  2OU2 A;  4QLC U;  1DP7 P;  3SZT A;  4WWC A;  1SD4 A;  1UST A;  2Y0M A;  3TKY A;  1BC7 C;  4MEX F;  2DBB A;  3KCC A;  1D3Y A;  4MQV A;  1XSD A;  4OIR F;  2A68 F;  4JK1 X;  4NQW A;  1Z1D A;  2PJP A;  3KLO A;  5AIQ A;  3I53 A;  1WRJ A;  1FP1 D;  3RKY A;  3F8B A;  3LFK A;  4XSZ F;  1WKM A;  3IRR A;  3F8F A;  2NYX A;  2R7F A;  2D2W A;  2XRN A;  3G73 A;  4A0Y A;  1J2X A;  2WC2 A;  3TO9 A;  3WU0 A;  2DO7 A;  2P8T A;  1LVA A;  5BMZ A;  1P2F A;  1L3L A;  3WG9 A;  1IN7 A;  4B09 A;  1CF7 B;  5FFZ A;  5H20 A;  3TO6 A;  3TO7 A;  1HXD A;  1K79 A;  6PAX A;  1MGT A;  2HGC A;  3FM3 A;  1LJ9 A;  1MJ9 A;  3R0A A;  3M8F A;  4Y17 A;  5A2Q Z;  1FOK A;  4BXU A;  2OD5 A;  3FMR A;  1JE8 A;  3F3X A;  3KP7 A;  1S7O A;  3V7S A;  3N97 A;  1T38 A;  4ON0 A;  4G7O F;  4P5O A;  3HSF A;  2STT A;  1HKT A;  4U0V A;  3R61 A;  3IKT A;  2ZXJ A;  5E8G A;  3RPU A;  1BM9 A;  1ZRD A;  1LQ1 A;  3GFI A;  1R5H A;  2IJL A;  1T0F A;  3WE3 A;  4IF4 A;  2R3S A;  2DI3 A;  5TRD A;  3SFZ A;  2O8X A;  4ASN A;  1DDN A;  1S7A A;  5CYV A;  1F9N A;  1QNT A;  2FQ3 A;  1B9N A;  4IVN A;  1UB9 A;  2P5V A;  4G9Y A;  3L9F A;  1PP8 F;  2C6Y A;  1IZ1 A;  5E18 F;  2L4M A;  4MHG A;  4A2U A;  2XKO A;  1BC8 C;  4GO1 A;  4CZZ A;  2JTV A;  2ETH A;  3REO A;  3BPV A;  3DEU A;  4YG2 F;  1XN7 A;  1J7K A;  5L3C A;  4WXH A;  5KVR A;  3FXQ A;  4LG0 A;  4KNY A;  4I01 A;  3FMQ A;  5LRS A;  1H9T A;  4HV6 A;  4RGU A;  2XAF A;  4RAY A;  2OZU A;  3JSP A;  3ISP A;  2E7W A;  4CO8 A;  2K4B A;  2VC0 A;  3LA3 A;  2H6C A;  2O03 A;  1LEA A;  1KU3 A;  2P4W A;  3HHG A;  2XKP A;  1HKQ A;  3P9K A;  2JPB A;  1HSJ A;  2FNP A;  3T5X A;  1EH7 A;  2YSR A;  4RS8 A;  4Z2Y A;  2XAQ A;  4UUV A;  5DCM B;  5HS8 A;  1O3T A;  1J5Y A;  5L3F A;  1RI7 A;  2VON A;  3B73 A;  3CUO A;  2JZY A;  1W4M A;  1Y0U A;  5HLG A;  3ZP5 A;  4I09 A;  2FEZ A;  3HRT A;  1ZRF A;  5HS7 A;  4P96 A;  1J0R A;  2PEX A;  4M72 A;  2W84 A;  4GGG A;  3GF2 A;  5DCF A;  5D6E A;  2HEO A;  2K86 A;  2LNB A;  2EJR A;  3CO7 C;  5LGU A;  3TGN A;  4CGZ A;  5CVJ A;  2P7C B;  3WTU C;  5FFX A;  2W85 A;  5DUK A;  2XAJ A;  2WWY A;  3D0S A;  3FWE A;  4L9N A;  1BI2 A;  1FPQ A;  3BY6 A;  1MDM B;  4Q5S F;  2W24 A;  2UXX A;  3KZY A;  4AIJ A;  4I2O A;  1ODD A;  2PQ8 A;  5HLH A;  5J6X A;  1QGP A;  5E20 A;  4HLX A;  3MFK A;  1G4D A;  4A5N A;  4IRG A;  1FT9 A;  2JT1 A;  3LA7 A;  4P55 A;  3ERE D;  3BDD A;  4I98 B;  2A6H F;  1U2W A;  1R58 A;  1HST A;  2NNY A;  3CUQ C;  4A0Z A;  3GFJ A;  1JGS A;  1IF1 A;  4G7H F;  3V7C A;  5D5V B;  4M74 A;  3OOP A;  4MNU A;  1TNS A;  3IKV A;  4O6J A;  2Y48 A;  3V8J A;  5FLX K;  1FYK A;  2A61 A;  1Z7U A;  2EFO A;  3I0T A;  2CSO A;  1ZRE A;  1BOA A;  3GWZ A;  2E1N A;  2ZME B;  2G7H A;  4IHT A;  2V79 A;  5D5X B;  3CJN A;  3RIR A;  1SAX A;  5HLI A;  3KEO A;  2VN2 A;  2FNA A;  4KFC A;  2QYO A;  4N9I A;  1ZG5 A;  2OAZ A;  3FZV A;  3IWZ A;  3JSO A;  4EQQ A;  1FC3 A;  2GA2 A;  1XMK A;  3T8R A;  5ED4 A;  3WGG A;  3U1D A;  3E6B A;  4G8X A;  1U78 A;  1FX7 A;  1XGM A;  5DYM A;  2RQP A;  1FBS A;  1UHW A;  2QQ9 A;  3P9C A;  2NS0 A;  5LHI A;  3IWF A;  1OMI A;  4RGR A;  2RGV A;  1R1U A;  2ESN A;  3JW4 A;  1MD0 A;  1DPR A;  5EEH A;  3HRU A;  5CVV A;  5FB2 A;  4OMY A;  4KN4 X;  2W25 A;  1RIO H;  1Z6R A;  5JI6 A;  5BS6 A;  5BQT A;  2H6B A;  3AAF A;  2AS5 F;  2DPD A;  4UV9 A;  4EJO A;  2ZNZ A;  3J7A O;  4PGH A;  3ZN0 A;  3GW2 A;  4KUM A;  1Z05 A;  3EYI A;  4YFK F;  3L00 A;  4IPA A;  1L0O C;  3K2Z A;  3F8C A;  1I6X A;  1IN8 A;  3RTR A;  4BQA A;  2OA4 A;  1K78 B;  5LBQ A;  3ECO A;  1MJA A;  1WWX A;  1J59 A;  3HOS A;  4Q48 A;  3HYI A;  4PGG A;  1YLF A;  4H0E A;  2EFN A;  3E6C C;  1R36 A;  4KN7 X;  4A6D A;  3QP6 A;  1SMY F;  2HFH A;  3BP8 A;  1IXC A;  3H92 A;  5HS9 A;  1Q1H A;  1YS7 A;  1MJB A;  3CDH A;  4UVC A;  3KP5 A;  2QUF A;  5D8L B;  3R4K A;  1S6L A;  3I5U A;  1KGS A;  5FLX Z;  5K5Q A;  1I1S A;  4GXO A;  4R1H A;  2NRA C;  3DPT A;  2VBW A;  1JXS A;  4I02 A;  2CO5 A;  1R7J A;  1W7P B;  4L9T A;  2YPR A;  2PN6 A;  3IRQ A;  2BEO A;  1XSV A;  2W57 A;  4EGZ A;  3DP7 A;  3RJP A;  4HF1 A;  1TQM A;  3ABT A;  4K2E A;  1H9G A;  2L3D A;  3P7N A;  3COA C;  2HKX A;  1P4W A;  3WGH A;  1USS A;  1R22 A;  5KK1 A;  5L3G A;  2DU9 A;  1I27 A;  1SFU A;  1GXP A;  1TW2 A;  4TV7 A;  4U0W A;  2VC1 A;  3QRF F;  5F1R A;  4ZH4 F;  3T8T A;  3K1M A;  4I0B A;  3DXJ F;  2V1X A;  1ON2 A;  2IW5 A;  2OZ6 A;  2WV0 A;  5E1X A;  3KLN A;  1PUE E;  4PZJ A;  4FX4 A;  1HW1 A;  1WQ2 A;  4HX8 A;  4LFU A;  4E70 A;  1T2K A;  3EUH A;  5H6R A;  3RPQ A;  3LAP A;  4KT5 C;  4IJA A;  3F6V A;  3T1B A;  1F4K A;  4HF0 A;  4BH9 A;  2A07 F;  5LRR A;  2Z99 A;  1YW9 A;  2RNJ A;  1J75 A;  3KP6 A;  5H6Q A;  3S2W A;  2Z33 A;  1KU7 A;  4P9U A;  1B9M A;  3BJO A;  4JQF A;  3J80 Z;  4ZYH A;  2HYF A;  1D8J A;  5BPD A;  5FD6 A;  2O0Y A;  3E6D A;  2GZW A;  3L09 A;  5HOO A;  4ZZL A;  1G3W A;  4KIF A;  2LSO A;  2X4H A;  1FNN A;  3ZQ7 A;  2K7L A;  5DUI A;  3WGI A;  3RYR A;  1TQP A;  5LGN A;  1HW5 A;  4D0P A;  4KIG A;  2IA0 A;  2K27 A;  2GAU A;  2XVC A;  4Q4Z F;  4LK0 F;  4L18 B;  2LF7 A;  4G6D A;  1SD7 A;  1XDS A;  4CXF A;  3L2C A;  4P9F A;  3KEQ A;  4BYY A;  1IN6 A;  1BIB A;  1FZP B;  1YS6 A;  2VE9 A;  4U7D A;  1G3T A;  1QQI A;  1HQC A;  4RAZ A;  3F23 A;  4EJT A;  2HKO A;  4DQ2 A;  3U9G A;  4EM0 B;  3I59 A;  4LLG F;  4WX9 A;  3K0L A;  2QBY B;  4HX7 A;  2KIM A;  2MH2 A;  3NEU A;  3MZH A;  4M9X A;  2DTR A;  3SQN A;  2AXL A;  5DD4 A;  2QZ8 A;  2F5F A;  1ZYR F;  2A69 F;  1MKM A;  1FYM A;  2JRT A;  2VE8 A;  1ZG1 A;  3Q5F A;  3SHF A;  1X3U A;  3L7W A;  2IT0 A;  1FWZ A;  1QO0 D;  3CLO A;  1YYV A;  3C1D A;  1B6A A;  4HOB A;  3LAJ A;  4G94 A;  2CWE A;  5DD8 A;  4NB5 A;  3BJA A;  1CGP A;  3WTV C;  5E1W A;  4O3M A;  4M9S A;  2HYG D;  4HQE A;  2VOO A;  3BOQ A;  3CUQ B;  4RB3 C;  2QQB A;  4OIN F;  5D4S A;  1VTN C;  3F22 A;  2P6S A;  1R23 A;  4M73 A;  2HZT A;  3BWG A;  1DPU A;  1UHM A;  2GA1 A;  3IC7 A;  2OQG A;  2XHK A;  4WXD A;  1UCR A;  1C0W A;  2CQK A;  2ELH A;  2DK5 A;  3MAJ A;  2QWW A;  1CF7 A;  3HRS A;  4KA4 A;  4KIC A;  1U5T B;  4ESB A;  2KRF A;  2Y75 A;  3K1N A;  2XAG A;  3F6O A;  1RUN A;  4XSX F;  4HZF A;  2HTS A;  3KZZ A;  3GLX A;  3VEP A;  3EDP A;  5JHU A;  1TBX A;  2FU4 A;  4RB2 C;  3E6M A;  1BBY A;  1A04 A;  1IAW A;  4JBA A;  3W6J B;  1OPC A;  1D5V A;  5E8I A;  2FXA A;  2DFI A;  4HQM A;  1TTY A;  2HQN A;  3O6B B;  5D5U B;  1IXS B;  3D5L A;  1WSU A;  2XV4 S;  1XGS A;  5IT9 Z;  2XAH A;  3BZ6 A;  1QZZ A;  2DT5 A;  1RUO A;  1P4X A;  3E5Q A;  3CTA A;  1XCB A;  2RKH A;  2O61 A;  4LLN A;  2L4A A;  2M1B A;  1TW3 A;  1STZ A;  4IRI A;  3DKW A;  1ZGA A;  3QP5 A;  3GYH X;  2VT2 A;  2E1C A;  4UVA A;  1W7P D;  2D1H A;  2VBY A;  2G7U A;  3J81 K;  3WTY C;  2HDC A;  3C7J A;  4MTD A;  4ZYD A;  4ENM A;  3HSR A;  3DPL C;  4XLN F;  5BPI A;  3DV8 A;  4B8X A;  4EJU A;  4L0Z B;  3RKW A;  4CIC A;  5DEQ A;  2M45 A;  1YO5 C;  1BJA A;  1JHF A;  2UZK A;  5E1Z B;  5AIP A;  2EV5 A;  1U5T C;  2RVC A;  1OYI A;  1XD7 A;  2JPC A;  3F8N A;  2VBZ A;  3G3Z A;  4LJZ F;  4LLL A;  2VBX A;  3TDZ C;  2MLK A;  2EFQ A;  2IP2 A;  3LST A;  2PLY A;  4L5J A;  1ZRC A;  3V4G A;  1GHC A;  2V1U A;  2CFX A;  2EWN A;  1RNL A;  3QAH A;  1V3F A;  4OIQ F;  5AON A;  2STW A;  1EV7 A;  3KE2 A;  2HS5 A;  3PQK A;  2NNN A;  2EFW A;  1K7A A;  3GX4 X;  3FX3 A;  2BBY A;  2LKP A;  2IA2 A;  4M6Y A;  2BV6 A;  2HOE A;  5LLQ A;  2EFP A;  2HWV A;  2CG4 A;  3MCZ A;  4XLP F;  2XAS A;  1OYW A;  5ICC A;  4YFX F;  4U88 A;  1D8K A;  4KIB A;  3BRO A;  4GCV A;  4HF2 A;  1I1G A;  4HDU A;  3ULQ B;  1MZB A;  2QEN A;  5DV5 A;  3E3V A;  3WE2 A;  2O3F A;  4Y15 A;  3NQO A;  3QU3 A;  2KIU A;  4IRH A;  1IUY A;  1ZN2 A;  1O7F A;  1MDM A;  4EM2 A;  1G3S A;  1BI1 A;  1AOY A;  4LMY A;  1TLH B;  2TDX A;  2M5W A;  2RDP A;  5ILS A;  2KJC A;  5E17 F;  3V8L A;  1OYY A;  3J80 K;  3K1P A;  1FY7 A;  3CO6 C;  1Z6T A;  2FSW A;  2F5D A;  3V7R A;  1B59 A;  5L3B A;  2NAZ A;  3DFG A;  1S3J A;  2PI0 A;  1XMA A;  2GXB A;  1R1T A;  3VB2 A;  4HLY A;  4KYW A;  2PFB A;  2H27 A;  5K1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...