3ZQ7A

The structure of dna-binding domain of response regulator from escherichia coli k-12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
b'PDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KDP OPERON TRANSCRIPTIONAL REGULATORY PROTEIN KDPE
publication title Structure-Function Studies of DNA Binding Domain of Response Regulator Kdpe Reveals Equal Affinity Interactions at DNA Half-Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3zq7A00
1YW7A 2NNNA 3E6MA 1IRGA 5CVIA 1ZAOA 4Y13A 5A2QZ 2OZUA 1K7AA 4L9NA 1HKTA 1K78B 3KEOA 2BYVE 2OAZA 3IC7A 3T1BA 1B4AA 1RZ4A 1R1UA 4EMSA 5BQTA 3WTUC 2H6CA 4BHBA 4ENMA 2M45A 1B9NA 4LGWA 2Z33A 2XKPA 2A07F 2P7VB 4Y17A 1U2WA 3L2CA 3W6KB 2DK5A 1EH8A 4EVIA 3V7SA 3ZMTA 3VB2A 1HQCA 2FBIA 2QYOA 2WV0A 3GZ5A 4BAYA 2P5LC 3RJPA 1KU2A 2P4WA 3KE2A 3WTZA 2RDPA 5ED4A 2CO5A 4I0AA 3TO6A 4HDUA 5L3GA 2KRFA 2M87A 3M8FA 3KETA 2F2EA 4L9JA 4BH9A 2DT5A 2QVOA 4UUVA 4OIOF 4UV8A 4AWXB 1YW8A 2L01A 3MEXA 3V7RA 3KLNA 4L9TA 2EFNA 2DFIA 1HKSA 2O8XA 3MFKA 2IRFG 3TOAA 2L54A 4JBAA 4EGZA 4M9SA 1FYLA 2DTRA 1JGSA 3D0SA 4LJZF 1ZYRF 4U0WA 4P5OA 1ZG1A 2QQBA 1KQ9A 3U1DA 1GHCA 3V8KA 5DUIA 4HF2A 3L00A 1R58A 3WTVC 1ON2A 2HYGD 4ETSA 3DFGA 4EM1A 3FM3A 1T38A 3HSRA 3WTYC 4CDGA 4S04A 3M9AA 3ISPA 2RKHA 3GWZA 5E8IA 3AAFA 5ILVA 1WSUA 3R0JA 2IA0A 2EFWA 2R7FA 1J9IA 2OQGA 3REOA 3RKXA 1QQIA 2Z99A 3TDUC 1F9NA 4RGXA 2H94A 2VT3A 3K2ZA 1I5ZA 5J6XA 1YW9A 4UVAA 1ODDA 5EEGA 2HFHA 4M9XA 4LD5A 1TW2A 2L4MA 3EQLF 5CJ9A 4WWCA 1LEAA 5IT9K 2Q8KA 5HS7A 2P6TA 3ABTA 2KJBA 4EJWA 4RB2C 1STZA 4MHGA 2DK8A 4WK8F 2ISYA 4BXUA 2LF7A 5FB2A 2ZMEB 2Y48A 1ON1A 4KA4A 3WE3A 3ZQ7A 5LHIA 5JI6A 4IPAA 1V3FA 5DDGA 2GAUA 2GQQA 4GCVA 2IP2A 4YG2F 2DLLA 2FOKA 3O6BB 4EJVA 4G94A 2V1XA 1S3JA 1F1ZA 4G8XA 4HZFA 5D4RA 2COMA 1Z9CA 2MA3A 4KIBA 4DNCA 4Y15A 3DPTA 3F6VA 4ZYEA 4H0EA 2WWYA 4HF1A 2F5FA 1YO5C 4KT5C 4YIFA 3DXJF 1YIOA 1P6RA 3RTRA 4RGUA 1H9GA 5F1RA 3M1EA 3CDHA 4OIRF 3CUOA 3SXYA 2RVCA 1XMKA 1ZG3A 1IRFA 4CICA 5ICCA 4F7ZA 4ESBA 1FNNA 1Z91A 2GZWA 3CUQC 5HVQC 1FLIA 1U5TA 4U7DA 4A12A 5LGUA 1ZH5A 2ZFWA 5HS9A 4R1HA 3RPQA 4GYGA 4ESJA 3GUDA 3GXOA 5FFZA 5D8KB 3FHZA 4Q48A 4WXDA 1I6XA 1OPCA 2W24A 5LRRA 2A6HF 1T98A 1QZZA 4RGRA 5CLSA 2E1NA 2CWEA 3I64A 5HLGA 1FSEA 3F21A 2XIGA 1R22A 4KMFA 3WODF 2DQRA 2XAFA 3H92A 3O3KA 2H09A 5A2QK 1S7AA 2CW0F 2PMUA 3MQ0A 3ULQB 3LAPA 3RPUA 1SFUA 4G7ZF 3U9GA 2JSCA 2F5CA 1TBXA 3TOBA 4FX4A 1MJBA 3B02A 2XVCA 4A5NA 3MWMA 5BOXA 1U78A 1DPRA 1WI9A 2J5OA 5HDGA 3RYPA 2A5YB 4MTDA 4OINF 2XKOA 5K5OA 4L0YB 4P55A 3RDIA 2D45A 3EETA 1S8NA 3BPXA 1F4KA 1LVAA 5DV5A 3MCZA 1LB2A 4EJOA 1KU9A 5L3DA 1JE8A 1MGTA 1IF1A 3RYRA 2BE5F 4AIKA 2KIFA 2V1DA 4EV0A 2VXZA 1KGSA 1QO0D 2DAOA 1R5HA 3GFJA 2ZJ2A 4HYEA 2X0LA 3K1MA 5E17F 1FBUA 1Z1DA 2G9WA 1SD6A 1KQ0A 5D5XB 5K5QA 3U2RA 2JTVA 2XAJA 2KIMA 4RS8A 3ZN0A 4A5MA 3BPVA 3PQJA 1QZYA 1AOYA 5D5WB 1O7FA 3HIFA 4U88A 4PGGA 3RKWA 4E70A 2RGVA 3QRFF 3FMSA 4ZZLA 2XASA 1LDKB 2GA1A 4WX9A 1FPQA 1WQ2A 3N4MA 1LEBA 3IRRA 3WGIA 3J81Z 1XB4A 2QENA 3ML6A 1F5TA 3IRQA 4LLGF 1FBSA 1ZLKA 2MH9A 3QU6A 4RGSA 2P6SA 4FHTA 1SFEA 3T8TA 1PP7U 1T39A 5LGNA 2O61A 4KMUX 1W5TA 4AIJA 4PCQA 1YS7A 1KU7A 4I02A 3TGNA 3MAJA 4L0ZB 2CGPA 1L0OC 2A3SA 2V9VA 2V1UA 2DW4A 4CO8A 1IAWA 3TO9A 2VT2A 5E1XA 4HQMA 4FT8A 3ELKA 3VFZA 2UWMA 4EQQA 1IZ1A 4YIIA 1HBXG 2EA2A 1ZGJA 3GFLA 6PAXA 4CZZA 4LK0F 2QBYB 3DEUA 2B0LA 4G6DA 3I59B 1YG2A 2CYYA 4HDVA 1UCRA 1HKQA 1U6GA 1DDNA 1L3LA 4I2OA 5L3CA 3CLOA 4KNYA 3BWGA 2ZMEA 4BQAA 1XSDA 3K1PA 2OQRA 1XDUA 4GO1A 2XROA 2BGCA 5H6QA 2LKPA 2HOEA 2E7XA 2HKOA 2VC1A 4O5VA 2VODA 3V7CA 1TW3A 4IRHA 3C3WA 3R4KA 1O7LA 2ESHA 4Q5SF 1ZARA 3L9FA 2HDCA 3LQRA 1MJAA 1SMTA 2LDUA 5CYVA 2MC3A 3BZ6A 1TNTA 1T0FA 3LA2A 1FC3A 1HSTA 3PFIA 4M74A 1K79A 1XDSA 4DQ2A 5LLQA 1BI3A 4HV6A 4WCGA 3BJ6A 2PBIA 4ZZDA 2FNPA 5D6EA 3EYYA 2VE9A 1LQ1A 4PGHA 2HWVA 2ACJA 3ECHA 2JPBA 5AIQA 3V8LA 4WXHA 4EM0B 1USTA 3HHGA 2EFQA 1K6OA 5JFRA 5LHGA 1G3YA 1W7PB 2STTA 3GZ6A 1TTYA 1O3TA 2EK5A 2EV6A 1BI2A 3GEZA 1ZRDA 3P9KA 3CTAA 5D5VB 1WWXA 3KP2A 5E20A 1CF7B 5HLHA 4L18B 1R7JA 1GVJA 1G6NA 2EV0A 3E6DA 4OIQF 1HXDA 5FO5A 2FBHA 5KK1A 2VBYA 2MBFA 1TQPA 3SFZA 1FX7A 4K2EA 2TDXA 1ONVA 1BM9A 3IWFA 1O3RA 5CVRA 4QWQA 5ICFA 1MDMA 3TKYA 3HRTA 1D3YA 4I01A 2PJPA 5BMZA 2XAGA 2KJCA 4I7HA 3T0YA 3RIRA 3ZP5A 3HUGA 3E97A 3JTGA 1XMAA 2EA4A 1R00A 5AIPA 1Z6TA 4R79A 4UVBA 1TLHB 3N97A 5ERIA 3JW4A 2CFXA 5DCFA 1GXPA 3KLOA 3F8MA 3FM5A 1REPC 1ZREA 2PEXA 3NQOA 2FBKA 4RB1A 3IWZA 5LGTA 2A68F 4HX8A 4RB3C 3FXUA 4LG0A 1R23A 1RI7A 2P7CB 2JPCA 3NEUA 2P8TA 2PLYA 2UZKA 3G3ZA 4LB5A 2VBZA 2R3SA 2DPUA 3FX3A 1PP8F 4GGGA 1FBQA 1MJ9A 4IJAA 4P96A 1YQAA 1JHHA 4MNUA 5TJJA 3FZVA 4A2UA 4IXAA 2Y75A 4XSXF 1J75A 4ON0A 1OR7A 1HW5A 2IT0A 2IJLA 1XGOA 5JR3A 3PQKA 1U5TC 4KIGA 2FMYA 1Z6RA 4GXOA 3M8EA 1O57A 2K02A 3SQNA 3TDZC 2JZYA 3EDPA 3J7AO 4O3MA 3VEPA 3GYHX 3QP5A 2O6GE 3FXRA 3BP8A 5D4SA 1J0RA 2A6EF 3LWFA 5L3EA 5E8GA 5H20A 2Z5UA 4HA8A 1YS6A 2IA1A 2QQAA 4L5JA 2MLGA 5D6FA 1RUOA 1BBYA 2F5EA 4G6QA 3NRVA 3KFWX 2XAQA 2WTEA 3LQQA 3F3XA 2DI3A 3Q5FA 4ENJA 1XSXA 2JT1A 2AS5F 5LBQA 1S6LA 2L4AA 4KYWA 2E7WA 1P4XA 3COAC 2D2WA 5FLXZ 3J81K 3W6JB 5CVVA 1CGPA 3FXQA 1QBJA 4S05A 5DD8A 1XCBA 3KP4A 2C6YA 3GF2A 3K0LA 3IL2A 4A6DA 2FE3A 1B6AA 3B73A 1IUYA 3F8FA 1YFHA 4N9IA 3IKVA 5E18F 1KU3A 3I0TA 1H9TA 1MDMB 4M6XA 4B8XA 2DU9A 3QP6A 3BJAA 4KICA 4ZYGA 2OBPA 2O3FA 3GLXA 2K27A 1RNLA 2ZBKA 1P2FA 2HTSA 2QBYA 2FF4A 1E2XA 2FEZA 3ZMDA 1D8KA 3F8BA 1O3SA 3M7GA 3I59A 2NAZA 3F23A 5DCMA 5LHHA 4KIFA 2EB7A 4KN4X 2EFPA 4BYYA 5L3BA 3E5UA 5F6FA 1IN7A 1I1GA 1C0WA 5D5UB 4D0PA 1W5SA 2HGCA 3BDDA 3V4GA 3WTWC 4EM2A 4M73A 4LG0B 1JHFA 2R7DA 2XRNA 3WTSC 2K7LA 3WU1B 3CO7C 2W84A 4P9FA 2VE8A 1AWCA 1QPMA 1J5YA 4UVCA 2EWNA 3KP3A 3WTXC 4OMYA 3KZZA 4ZH4F 3FF5A 3QU3A 2BEOA 4Q4ZF 1B1BA 2PN6A 4M71A 4P9UA 3HRUA 3C1DA 2PI0A 2J5PA 4BHCA 1ZHFA 3F8CA 4XLPF 1I27A 2ZCWA 2CQKA 3GVAA 2PFBA 5FFXA 2VBXA 2GWRA 3I71A 3OOPA 1SFXA 1IN4A 1RIOH 5CVUA 1W4MA 3FMRA 5HDNA 2XV4S 3FMQA 2EFOA 3L09A 4XRFA 1W7PA 1LDDA 4OOIA 5ILSA 1UHMA 2HQRA 1DP7P 2Z3YA 2A61A 2M1BA 2O03A 1W7PD 3KZYA 1BI0A 2VBWA 4ASNA 1CF7A 1TQMA 4MQVA 2QM3A 3E5QA 2IVMA 2GXGA 4FX0A 1U8RA 3I5UA 1IN5A 1EH6A 5LEKA 2ZNYA 4HOBA 1BIBA 1FOKA 4BNCA 4OU0A 3DF8A 2VOOA 2OA4A 1KQ8A 4HBLA 2OD5A 2YU3A 1XGNA 5AONA 4EJTA 5LRSA 4MQ9F 2FMLA 4GYIA 3Q9SA 1IN6A 1S29A 4ZYDA 3I54A 4AD9A 1R1TA 2W57A 5H6RA 5ILUA 2PMHA 1KYZA 1G3TA 2ESNA 1PDNC 1B59A 3DP7A 5DCMB 1XGMA 3E6BA 2P5KA 5DEQA 3HTSB 2HS5A 1V4RA 4HX4A 2KIUA 3ZPLA 2V6CA 1OMIA 4YFXF 4RB0A 2Y0MA 4NHJA 1OKRA 4IHSA 2YX7A 3WU0A 3ZN1A 2EJRA 3KCCA 2PQ8A 1BIAA 4I09A 1BN5A 4WF2A 3E5XA 4EJUA 2D1HA 5LEJA 4LLNA 3P9IA 5D8LB 3ERED 3FWEA 1P4WA 1A04A 2OZ6A 1SD5A 3ECOA 3CUQB 1XSVA 5BPIA 2IW5A 1ZGAA 5ICEA 3JSPA 4JQFA 5E1ZB 4HLYA 3E6CC 1R36A 3D5LA 4U0YA 5J8FA 3T8RA 1YLFA 3LA7A 1Z7UA 3BOQA 2M5WA 2NYXA 3JAMZ 4MTEA 1R5GA 2L3DA 3P9CA 3SZTA 2MLKA 3R0AA 3LAJA 2ZXJA 4HF0A 1ZG5A 2RQPA 2FSWA 3HOSA 3ROUA 3ZMUA 2EV5A 2VOPA 1D5VA 3TQNA 1P92A 3WTTC 3L7WA 5FD6A 1FT9A 1FSHA 1IXSB 2FXAA 3MZYA 1IXCA 1I1SA 4UV9A 5JHUA 4M72A 1PUEE 4CYDA 1SAXA 4PZJA 4UXNA 5L3FA 2GIVA 1XN7A 3HSEA 1UB9A 4HAMA 4I0BA 4LK1F 4IRIA 2QZ8A 4QLCU 4ZYHA 3VOEA 1Y0UA 1WRJA 3ZMSA 4I98B 2ELHA 5FLXK 1BJAA 3G73A 4TV7A 4A0ZA 3J80Z 1J59A 4G9YA 2UXXA 4ENKA 4YFKF 2ZKZA 3SZPA 1E17A 2O0YA 1MKMA 2HZTA 4HQEA 4KN7X 3T5XA 1BOAA 5DUKA 3DV8A 3QPTA 1FYKA 4RAYA 2HR3A 3TO7A 1B9MA 2VN2A 1G4DA 3HRSA 4KDPA 4NQWA 2BBYA 3DPLC 1DPUA 1MZBA 1BC8C 1T6SA 4IVNA 3HTUA 5K5RA 1XCVA 1FWZA 2D1VA 2L02A 4IHTA 4OMZA 3SHFA 4KUMA 4LMYA 1UHWA 2VONA 2Q0OA 3QOPA 2Z9OA 3ZMZA 4G7OF 4ENNA 1GXQA 2RC4A 2W85A 2K4JA 4U7BA 2ZNZA 2FRHA 3R6SA 1OYYA 2RN7A 1ULYA 3P7NA 4LLLA 2STWA 4A0YA 3LFKA 4XSZF 2H27A 3F6OA 3V8JA 3BY6A 1RUNA 3KEQA 2CSOA 1H0MA 2HQNA 1LJ9A 1FP2A 4UNOA 1G3SA 3Q9VA 2K4BA 5HLIA 4R8HA 2YR2A 3JSOA 2AXLA 5CVJA 4WXCA 1EV7A 1TQIA 3HOTA 4M6YA 1O3QA 3HHHA 3EUHA 2G7HA 2DQLA 2XUBA 1LNWA 1MD0A 3ABUA 2NNYA 3HSFA 3HRMA 1J7KA 2YSRA 2CG4A 3I58A 3LSTA 4MGRA 4XBFA 2NRAC 4AIHA 2BV6A 2F5DA 2G7UA 4RAZA 4YFNF 4JK1X 2GA2A 3EYIA 1BC7C 1KA8A 5F64A 1U3EM 3DQVC 1ZRFA 1TNSA 4UHTA 4OIPF 1USSA 2RV8A 2VC0A 5E1WA 2X4HA 3BJOA 4NB5A 3GX4X 1S7OA 4A6EA 1R1VA 4HV5A 2XHKA 1ZN2A 2MH2A 3S2WA 5K1YA 5ICGA 3K9TA 2A69F 1YTYA 3R60A 2FU4A 4N9HA 2V79A 3WGGA 4EGYA 2RNJA 1UFMA 4PDKA 5HDKA 2MD5A 4IRGA 1QGPA 3F72A 2QWWA 1OYWA 1DUXC 4KFCA 1YYVA 4CXFA 2ADUA 4CHUA 4XLNF 1VTNC 4LFUA 1FYMA 3E3VA 3I4PA 2OU2A 4HLXA 2DO7A 5IT9Z 1K78A 4O6JA 1D8JA 2K86A 4AVPA 2XAHA 1KYWA 1FY7A 3CO6C 3OV8A 1SD7A 3KP6A 2YX4A 5DYMA 4M9ZA 1QNTA 3H3UA 3HYIA 1NHAA 3DKWA 3LA3A 4G7HF 5KVRA 4Q47A 1EH7A 1ZRCA 2M30A 2ZO4A 2DPDA 3CUQA 5HS8A 5J8CA 5IT3A 5EEHA 4ESFA 3F8NA 2UXNA 3GW2A 3ZMVA 1WKMA 2IPQX 3MZHA 1IN8A 4HX7A 5HOOA 2LF8A 1IW7F 3RI4A 2HEOA 1T2KA 1XD7A 3F22A 1HW2A 1HW1A 1Q1HA 1J2XA 2YPRA 1G3WA 4LB6B 1X3UA 1SD4A 5TRDA 1BI1A 3KP7A 3K1NA 1XGSA 3QPHA 4N0BA 3JAMK 4A0XA 5BPDA 2FNAA 3C18A 2QLZA 3VODA 1OYIA 3WE2A 2H6BA 4Z2YA 2PG4A 2HKXA 4U0VA 2LSOA 2QQ9A 4HW0A 3K69A 3GFMA 4B09A 2W25A 2XGXA 4IF4A 2LNBA 4L5IA 2E1CA 1SMYF 5FGMA 3R61A 2DBBA 4BHPA 4CGZA 3IKTA 3C7JA 1ZLJA 2FA5A 2WC2A 2ISZA 3BROA 2KKOA 1FZPB 2P5VA 4MEYF 3WG9A 2GXBA 5BS6A 1JXSA 2NS0A 2HYFA 4L9VA 5FD5A 1P4AA 3IHUA 1Z05A 1IXRC 5DD4A 2M8EA 2ETHA 3I53A 2Q2EA 1U5TB 3O2PE 3H3ZA 5JVTA 2QUFA 3GFIA 3J80K 3CJNA 2IA2A 3JTHA 4MEXF 1FP1D 2FQ3A 3WGHA 2HTJA 1LDJA 2JRTA 3QAHA 3KP5A 1HSJA 3GO5A 3RKYA
chains in the Genus database with same CATH superfamily
4A93J 4AC0A 1YW7A 2NNNA 3QYEA 4M3FA 4Y3OA 1JKQC 3E6MA 3OIOA 1IRGA 2LR8A 3G6EI 4QSHA 5CVIA 1ZAOA 5H2FC 1X3ZB 4Y13A 4B1RA 5A2QZ 3BG3A 2OZUA 5FJ8J 1K7AA 2L7FP 2QQ8A 4A3BJ 3OOUA 4L9NA 2HYJA 1I6HJ 1HKTA 2BZTA 1K78B 3KEOA 1S9HA 4XORA 2CU7A 2BYVE 2OAZA 3IC7A 1APLC 3T1BA 2JMWA 1B4AA 2NVXJ 4FE4A 2V26A 1RZ4A 1R1UA 4EMSA 2Y2ZA 5BQTA 3WTUC 2NVTJ 2H6CA 2XF7A 4UB6C 4BHBA 4ENMA 1EKEA 1B9NA 2M45A 4LGWA 2Z33A 5EGOA 3K4CA 3Q0UA 3OYFA 2XKPA 2A07F 2E2JJ 3C2GA 2P7VB 1X58A 3HDDA 4Y17A 1U2WA 3L2CA 3W6KB 5GPCA 3OR1C 1ZR2A 2W1OA 2DK5A 2DJNA 1EH8A 4EVIA 3V7SA 3ZMTA 4XKCA 4FQGA 2M34A 3VB2A 3S32A 4X1EA 1HQCA 2FBIA 2QYOA 2WV0A 3DKXA 3GZ5A 4BAYA 1X19A 2W00A 2P5LC 3RJPA 2JJ7A 1KU2A 2K3PA 2P4WA 3FXLA 1W36D 1F43A 3KE2A 3WTZA 2RDPA 1BA5A 5FLVA 5ED4A 3OWTA 2CO5A 4RM3A 3ZQFA 4W97A 3CMEI 1NK3P 2E19A 1OLTA 4I0AA 3CD6I 1JJ6C 2BY2A 1HF0A 3G71I 3TO6A 4D7NA 4HDUA 2I5UA 5L3GA 2O7OA 2KRFA 2M87A 3M8FA 1Y39A 2R5ZB 3KETA 1E3OC 2IGNA 2F2EA 4L9JA 3BQYA 5KNLA 4BH9A 3JRCA 1VQ5I 2HOTA 3K70D 2DT5A 4C3HJ 3CMYA 2QVOA 4UUVA 4OIOF 4UV8A 4AWXB 1YW8A 4B4CA 2L01A 3U21A 3MEXA 3V7RA 3LMMA 3OS2A 5IYDJ 2QKLB 2YS9A 2EPFA 4GRIA 3KLNA 4L9TA 2EFNA 2DFIA 1QPIA 1HKSA 2O8XA 3MFKA 2IRFG 4XONA 4BE2A 3J7AY 3JRDA 3TOAA 2L54A 3JRHA 4JBAA 1Z77A 4EGZA 2L9NA 2EZKA 3DLLF 2OPTA 4M9SA 1FYLA 2DTRA 1JGSA 5FROA 4A3JJ 3D0SA 1LFUP 4LJZF 1ZYRF 2HXOA 2B63J 4U0WA 1V55H 4P5OA 1ZG1A 2QQBA 1X1BA 2NS7A 2GLOA 1KQ9A 2EH3A 3U1DA 4P1WA 2JUGA 2I10A 4DBRA 1A35A 1X3WB 1O4XA 2ZJRF 1GHCA 3V8KA 5DUIA 1KONA 3ZXSA 4HF2A 3L00A 3VYRB 5M3MJ 2JVGA 5IP9J 2QKMB 1R58A 1WJBA 1TZLA 3WTVC 1ON2A 2HPMA 2PJRA 1U9OA 2ZFUA 2HYGD 1FIAA 3DTIA 3OYLA 1TWAJ 2GOMA 2V7FA 4ETSA 3HG9A 1A5JA 3DFGA 3SDBA 4EM1A 1Q1VA 3FM3A 2DA1A 2X48A 1T38A 3HSRA 2M3AA 5EG0A 5B1AH 2W4SA 1V54H 1FTZA 3WTYC 4CDGA 4S04A 3M9AA 4PUSA 1I3QJ 1LFBA 3ISPA 2RKHA 3GWZA 1K4TA 5E8IA 4BE0A 3AAFA 2F4OB 5ILVA 1WSUA 3FXOA 3IP4B 3R0JA 4CUGA 2IA0A 2EFWA 3S1RJ 2R7FA 3ZOBA 2NOGA 2OQGA 3REOA 3RKXA 1J9IA 1QQIA 1BL0A 2Z99A 2XGCA 3WG7H 3K4NA 3HPGA 1WJDA 3TDUC 3S93A 2R7VA 1F9NA 1SVOA 3VWBA 1NG7A 2VASA 4RGXA 2H94A 2VT3A 3K2ZA 1YI2I 1I5ZA 5J6XA 1TWHJ 1Z3XA 1Y1WJ 1YW9A 3BTIA 4UVAA 1ODDA 5EEGA 2E60A 2HFHA 4M9XA 3MMYB 3VSLA 2XGDA 4LD5A 1TW2A 2L4MA 2MSYA 2ME6A 1U0JA 3EQLF 1OCZH 3CP8A 5CJ9A 4HNUA 2KDOA 2IS4A 4WWCA 1LEAA 4PJLA 5IT9K 1D0XA 2EIJH 1WJCA 2Q8KA 2K40A 2XRLA 2HQAA 5HS7A 2P6TA 2XAUA 3ABTA 2KJBA 4BJ6C 4EJWA 4RB2C 1BW5A 4XK4A 1STZA 4MHGA 4MIMA 2DK8A 5K7HA 4WK8F 5GAEJ 2ISYA 1V5EA 4BXUA 3BCBA 2LF7A 5FB2A 2ZMEB 2Y48A 3HOXJ 4XKVA 1ON1A 2V6EA 5EGOB 2M4KA 4KA4A 2LD5A 3WE3A 3ZQ7A 3AG2H 2EZHA 5B5EC 5LHIA 1IGNA 5JI6A 4IPAA 1V3FA 5FKNA 5DDGA 2BXYA 2CQQA 2GAUA 3TEDA 2OC6A 3S3MA 2GQQA 4C9YA 2E1MB 3BG9A 2HNHA 4CCNA 5GTIC 1S7EA 4GCVA 4DJAA 3CDIA 2IP2A 2VQLA 2FX0A 2D5VA 2MYSA 4YG2F 3OY9A 2DLLA 2FOKA 3O6BB 3PNVA 4EJVA 1IDZA 4G94A 4W1UA 3KX2A 4IKFA 4XR6A 1RRJA 4AYBA 3MKZA 1MMSA 1RESA 2V1XA 5M5YJ 3GBGA 4A3FJ 3S3OA 1A6IA 1S3JA 1F1ZA 4G8XA 1D1BA 4HZFA 5D4RA 2JSPA 2COMA 3IH4A 4BDZA 2IEKA 2MA3A 1SFKA 3HGYA 2OCEA 4KIBA 1Z9CA 4XLFA 1PYVA 2F4MB 4DNCA 2E2IJ 1YIJI 2FD5A 2OF7A 3DPTA 4M3EA 4Y15A 2QGUA 3F6VA 1OFCX 4IEJA 2E35A 4ZYEA 3M07A 4H0EA 5TGTA 2HVSA 2A5WA 5E3OA 1RETA 2WWYA 4HF1A 4Y4RA 5GTHC 2DMNA 1AA7A 1OCPA 2F5FA 1YO5C 4C2UA 2R93J 3VYUB 2K9QA 4KT5C 3PIPF 1IO2A 3I56I 4YIFA 5KHDA 5FKLA 3DXJF 2DN0A 1YIOA 2LKSA 1P6RA 4DIQA 2M2EA 3RTRA 4RGUA 1H9GA 1OISA 5F1RA 3M1EA 1TWGJ 3Q0VA 3CDHA 4OIRF 4D1QA 3OIPA 1T56A 3CUOA 5C3EJ 3DWLE 3SXYA 3K6GA 3CCRI 2RVCA 4I99C 2Y30A 1MBEA 1XMKA 1ZG3A 2X6WA 3FXKA 1IRFA 4CICA 5ICCA 2MABA 4XOPA 4F7ZA 3IAS2 4ESBA 4IO9F 4YIRX 1FNNA 4DZPA 1WJEA 1Z91A 2GZWA 3FK7A 5FRMA 3SEZA 3CUQC 1MMGA 2CUZA 5HVQC 4XOTA 2K9NA 4FISA 4D9JA 4UB8C 1U5TA 4U7DA 4A12A 1QA6A 1FLIA 1VQ8I 4LIVA 1TL8A 2BVMA 5IYBJ 3CCEI 5LGUA 3CCVI 1ZH5A 4B44A 5GADJ 2ZFWA 2EIKH 2ZJQF 5HS9A 4R1HA 1FOXA 3RPQA 1PUFB 2BY1A 3B6CA 3HKZN 4GYGA 2H1LA 4ESJA 1RR8C 2CJJA 3GUDA 2HOSA 5IYCJ 3GXOA 5FFZA 5D8KB 4CZCA 2M0CA 2A05A 1R71A 3FHZA 4Q48A 3L1PA 4WXDA 2BY3A 3DU6A 1I6XA 1Y0NA 1OPCA 2W24A 5LRRA 2A6HF 1T98A 3DEEA 1QZZA 4RGRA 5CLSA 3HUGB 3ASNH 2E1NA 2CWEA 3I64A 1TWFJ 2BHZA 5HLGA 1FSEA 3F21A 2XIGA 4E6KG 9ANTA 1WCMJ 2JVHA 1R22A 2FOWA 4LG3A 4KMFA 3WODF 3OSGA 2XAFA 2DQRA 4N4NB 1MW7A 3H92A 2Y9ZA 3O3KA 2H09A 5A2QK 1S7AA 2CW0F 1EA3A 2PMUA 3MQ0A 3RPUA 3ULQB 3LAPA 1HDDC 1SFUA 4G7ZF 3U9GA 3WU2C 2JSCA 4F55A 1IC8A 4JX4A 2F5CA 2KHMA 1TBXA 3TOBA 4FX4A 2H1KA 1MJBA 1Y8RB 3B02A 2UV1A 4BS9A 3CCUI 5J3LA 2KL4A 4XLAA 3WHCA 2L9VA 2XVCA 4A5NA 4AUXA 2O5RA 4DYRA 3L2WA 3MWMA 5BOXA 1MSFC 1U78A 3MD2A 3S2DJ 1SVLA 3MKYB 1DPRA 1WI9A 2JQ7A 3S14J 2J5OA 5HDGA 3RYPA 2W7NA 3VDXA 3G1MA 2A5YB 3O8HA 4MTDA 4OINF 4A3EJ 2XKOA 5K5OA 4HRIA 4L0YB 1QRYA 4P55A 3RDIA 1ETQA 3ZQHA 1UG2A 3A01A 2D45A 1OJLA 1G59A 2EINH 3EETA 1B8IB 4G6TB 1S8NA 1QZEA 5F04A 3BPXA 3QQAA 2DCEA 1F4KA 1GLNA 1LVAA 3E0JB 1FMWA 5DV5A 5IOZA 3KEYA 3MCZA 1LB2A 4EJOA 1KU9A 2R5ZA 5L3DA 3BR5A 3GTPJ 2FJ1A 3LSIA 1XX5A 1JE8A 2AQEA 1MGTA 1IF1A 3RYRA 2BE5F 2DFFA 4A3LJ 1EJ9A 3BR1A 3CMMA 4AIKA 2KIFA 2ME0A 2V1DA 4EV0A 2VXZA 1KGSA 1QO0D 2DAOA 3LFUA 1VQ6I 3RZOJ 4LIUA 3PUFA 1R5HA 4RM2A 3H36A 3GFJA 3PFYA 2ZJ2A 4BXXJ 4HYEA 1TP4A 2X0LA 3K1MA 5E17F 2WAQA 1FBUA 1Z1DA 2F48A 2G9WA 1SD6A 1KQ0A 5D5XB 5IPAA 5K5QA 3X2QH 4D5FA 3U2RA 2QSFX 2JTVA 2X85A 2XAJA 3K2AA 2KIMA 1ZGWA 4IHYA 4PSXA 4RS8A 2LH9A 2VKDA 4C30A 4A5MA 3ZN0A 2MD0A 3GTGJ 3I4NJ 3BPVA 2VUMJ 3PQJA 3CP2A 1SC7A 1S5LC 3CC2I 3LSJA 1QZYA 1T8IA 1AOYA 1ETYA 2E5ZA 3C2BA 1O7FA 3HIFA 4U88A 4PGGA 5D5WB 3RKWA 1JUSA 2RGVA 4E70A 3QRFF 2VB6A 1DU0A 3FMSA 2DMUA 3TL4X 1TT0A 4ZZLA 1YJNI 2XASA 2L7MP 1LDKB 2KZGA 5JLXA 5DM7F 2B7EA 4KT6A 2GA1A 3DEWA 4NDLA 4WX9A 3I9V2 1FPQA 3MKLA 2KT0A 2R5YB 1WQ2A 3N4MA 3OR2C 2FQ4A 1LEBA 3IRRA 3WGIA 3J81Z 4F52A 1XB4A 2QENA 3ML6A 1F5TA 3OMYA 3IRQA 4LLGF 1FBSA 1ZLKA 2MH9A 3F0CA 1MMNA 1R4NB 3QU6A 3H9JA 4RGSA 2WA0A 2P6SA 4FHTA 1SFEA 3T8TA 1W36C 1PP7U 1T39A 5LGNA 2O61A 2AXTC 2OCCH 3CJTB 4KMUX 4E7HA 1W5TA 2L9RA 4ZC3A 4AIJA 4PCQA 3TW7A 2NVUB 1U9NA 1YS7A 1KU7A 4I02A 3TGNA 3MAJA 4XRSA 4PFPA 2DXIA 4L0ZB 2CGPA 1L0OC 2XDVA 1V5GA 1JKOC 4BDYA 2A3SA 2V9VA 2V1UA 2DW4A 4CO8A 2X1CA 3C2HA 4DYCA 1IAWA 1Y56A 3OSFA 3FHNA 3TO9A 2VT2A 2X51A 4HQMA 5E1XA 4FT8A 3ELKA 1OCCH 4RMNA 3VFZA 3MZ8A 3HEFA 3K70C 1CQTA 2UWMA 4EQQA 1IZ1A 3A02A 3N05A 1DGWY 4YIIA 1HBXG 2EA2A 4M3DA 1ZGJA 3GFLA 2L5QA 6PAXA 2KQRA 1UJ8A 4LK0F 4CZZA 2QBYB 3DEUA 2B0LA 5C4JJ 3GTOJ 4RBOA 1T33A 1JJ8C 4G6DA 3I59B 4B48A 1YG2A 1MNDA 2CYYA 3OL3A 4HDVA 1UCRA 1HKQA 1U6GA 3QYFA 3H35A 1DDNA 3BZCA 1L3LA 2B9SA 1LE8B 4I2OA 2EIMH 1BJZA 2VXDA 5L3CA 3CLOA 5GPAA 3PO2J 4KNYA 2L0KA 2WAEA 3BWGA 1FTTA 2ZMEA 3CJRB 5GP9A 3L2RA 3CCQI 2LG4A 4BQAA 3GZNB 4PJNA 1XSDA 3K1PA 2OQRA 1XDUA 4GO1A 2XROA 2BGCA 5H6QA 2LKPA 2HOEA 2E7XA 2HKOA 2R7SA 2VC1A 4O5VA 2VJ5A 2VODA 3V7CA 1TW3A 4IRHA 5B66C 3C3WA 3R4KA 1O7LA 1R6RA 1VZ0A 2ESHA 1ZARA 4Q5SF 4QPQA 3DPUA 3ZGKA 3L9FA 3H0DA 2HDCA 2VQHA 3KIOA 3LQRA 3FBIB 3SJMA 3KYCB 3GLLA 1MJAA 1SMTA 3RZDJ 2LDUA 3A01B 5CYVA 2MC3A 3BZ6A 3S8PA 1TNTA 2LRDA 1T0FA 3D1NI 1VQ9I 1A6QA 2TCTA 3LA2A 1FC3A 1HSTA 1JT6A 2IBDA 2N8GA 4M3BA 4AYBN 4GFBA 3PFIA 4M74A 1K79A 1XDSA 3TP3A 4DQ2A 5LLQA 1BI3A 4HV6A 4WCGA 2XPUA 3BJ6A 2PBIA 4ZZDA 2FNPA 2VKHA 2Y31A 1WZ2A 5D6EA 3EYYA 2VE9A 3OS1A 1LQ1A 4PGHA 3CCSI 3S2HJ 3ZQGA 2YU9J 5B3SH 4BACA 2HWVA 2ACJA 2BXZA 3ECHA 2KRCA 2WV1A 2PMZA 2GBYA 3MKWB 2JPBA 5AIQA 3V8LA 2LOOA 1ETWA 5EDNA 4WXHA 3CF2A 3S1QJ 4EM0B 4KISA 1USTA 3HHGA 4CA0A 2EFQA 1K6OA 5JFRA 5LHGA 4XIDA 1G3YA 1LPQA 2R7RA 3Q3SA 2DYSH 1W7PB 2M4GA 2HDDA 2STTA 3GZ6A 1TTYA 2HVQA 5B1BH 2LLKA 3JRFA 1O3TA 2EK5A 4XL9A 2EV6A 3LSKA 1BI2A 3GEZA 1ZRDA 4HSRA 4ZDOA 3P9KA 3CTAA 2GXAA 1R49A 1P7IA 1ENHA 5D5VB 3HC7A 1WWXA 3CCLI 4CCKA 3KP2A 2KFDA 2QF7A 5E20A 5HLHA 1CF7B 3UR3C 4L18B 1SEUA 1R7JA 1GVJA 1G6NA 2UUZA 3CC4I 2EV0A 5J1YA 3E6DA 4OIQF 1HXDA 3ESWB 4XICA 5FO5A 2FBHA 3DTEA 5M5XJ 5KK1A 2VBYA 3IUOA 2MBFA 1TQPA 2VI6A 3SFZA 5E3NA 1FX7A 1PUFA 4K2EA 3H1CA 3BT9A 2DA5A 2TDXA 5CQGA 1DU6A 2LFBA 1ONVA 1BM9A 3IWFA 3M4OJ 4LOCA 3TMOA 1R4MB 3RQ4A 3PL8A 1O3RA 5CVRA 4QWQA 5ICFA 1MDMA 3TKYA 3HRTA 2DDBA 1D3YA 3LL7A 4I01A 4RAGA 5BMZA 2PJPA 2LKXA 2XAGA 2KJCA 1X1CA 2LYCA 4I7HA 4XMYA 1JT0A 3T0YA 2ZSHB 3RIRA 3QPSA 3ZP5A 4NNJA 3HUGA 3E97A 3JTGA 3BZKA 1XMAA 2EA4A 1R00A 5AIPA 1Z6TA 4R79A 2R92J 4UVBA 1TLHB 2RAEA 5FKKA 2CFOA 3N97A 5ERIA 2LVSA 3JW4A 3LOCA 4B3AA 2CFXA 5DCFA 4EATA 1GXPA 3KLOA 3F8MA 3EUHC 3FM5A 1REPC 2XPWA 5JLWA 2PEXA 1ZREA 3K4MA 4OAYA 3NQOA 2ZXWH 2FBKA 4I6ZA 3NWTA 4RB1A 5EZHA 5J47A 3IWZA 3NARA 1N75A 2IGOA 1EF4A 1G2HA 1JTYA 2A68F 4N4OB 5LGTA 1XS9A 2LY1A 1GV5A 4HX8A 2X6YA 4RB3C 2ID6A 3FXUA 4LG0A 1R23A 2QA4I 1RI7A 4JX5A 2RQQA 2P7CB 1B72B 2JPCA 3NEUA 2P8TA 4JP0A 2PLYA 2UZKA 3G3ZA 5TISC 3K4BA 5FKOA 1HDPA 4LB5A 2VBZA 2R3SA 2DPUA 3FX3A 1PP8F 2AO9A 4XKWA 1IG7A 4GGGA 1FBQA 1DGRM 1MJ9A 1WFXA 4IJAA 4P96A 4BBRJ 3IH2A 4RA2A 3GTKJ 1RPWA 1YQAA 3AKZA 3QPLA 1JHHA 4MNUA 3HBLA 5TJJA 4Y7NJ 3JREA 1YE9A 1B8IA 3H9GA 3FZVA 4D5CA 4A2UA 4IXAA 2Y75A 4XSXF 1FEXA 4HEA2 5F1JA 4ON0A 1J75A 1OR7A 1HW5A 1DP3A 2IT0A 2IJLA 1XGOA 1OCOH 3ABMH 1ZK8A 5IOYA 5JR3A 3PQKA 1U5TC 1A36A 3RSNA 2VJJA 4KIGA 2FMYA 3HOVJ 1Z6RA 4GXOA 2LREA 4I76A 2E71A 3M8EA 1O57A 2K02A 5EZGA 3SQNA 2XSJC 3TDZC 2JZYA 3EDPA 3L2UA 3J7AO 4O3MA 3VEPA 2HZDA 3GYHX 5KCMA 4CCOA 3QP5A 2QSHX 5F08A 2O6GE 1S72I 1X4OA 1HC8A 3FXRA 1QVTA 3BP8A 3LSPA 4ITVA 1T95A 5K7ZA 5D4SA 2W82A 1BW6A 1J0RA 2A6EF 4XN0A 3M3YJ 2DT6A 4A69C 3S3NA 3LWFA 2H8RA 1T08B 5L3EA 5E8GA 4X0GA 2WAQN 1JKPC 5JVGF 3K4LA 4IHXA 1Y8QB 2VJIA 4L5EA 5H20A 4A3MJ 2Z5UA 4HA8A 1MMAA 1YS6A 2LK2A 1E3PA 2IA1A 2QQAA 4YRVA 3MN2A 1ETXA 4L5JA 4H4KC 3FKIJ 2MLGA 2K9MA 3J7YJ 3KYLA 1SAUA 5D6FA 1RUOA 3DBHB 1BBYA 2F5EA 3BG7A 4G6QA 3NRVA 3KFWX 2E5NA 3O8GA 2XAQA 1X1AA 2WB1A 4J01A 2WTEA 2KDZA 3W2AA 2R5YA 3LQQA 2AHQA 3F3XA 2DI3A 3RKQA 1YX5A 3Q5FA 4ENJA 1XSXA 2JT1A 1E0EA 4ZJZA 2AS5F 3KPHA 5LBQA 3I4MJ 1S6LA 2L4AA 4KYWA 2A6TA 2E7WA 1P4XA 3SZGA 5HNHA 3COAC 2D2WA 5FLXZ 5C4XJ 2G0EA 1ACIA 1IJWC 3S15J 1IRXA 2MGQA 4RLFA 2JK3A 3J81K 2VQGA 3W6JB 4E4HA 2MC4A 3PSFA 5CVVA 1CGPA 3FXQA 4DW6A 1QBJA 4E7JA 4S05A 4F93B 5J4YA 1FOWA 5DD8A 2IGMA 1XCBA 4XM3A 1YX3A 5F27A 3KP4A 4DOZA 2C6YA 3GF2A 1ZQ3P 3K0LA 3ZQCA 4BJ5C 3IL2A 2ID3A 2FE3A 1B6AA 3B73A 4A6DA 1IUYA 2XB5A 3F8FA 3G2BA 2JA6J 1YFHA 2DA3A 4N9IA 3IKVA 2WY7Q 5E18F 1KU3A 3I0TA 1H9TA 1MDMB 4M6XA 4B8XA 2DU9A 1VQMI 3QP6A 3QYBA 4II2A 3BJAA 4KICA 3ZRGA 4C2MJ 3TBIA 1VI0A 4ZYGA 2ICWG 2OBPA 3LSHA 2O3FA 3ZQLA 3GLXA 2CW8A 2K27A 1RNLA 2ZBKA 1P2FA 2HTSA 2DA4A 2QBYA 3HB9A 2IS1A 2FF4A 1E2XA 2FEZA 3OL4A 3ZMDA 4IZZA 3EUAA 1D8KA 3F8BA 1O3SA 3M7GA 3I59A 2NAZA 3F23A 2CMPA 1N77A 1MBHA 1JI8A 5DCMA 3HL2A 5LHHA 4KIFA 3W2WA 2EB7A 4KN4X 1LE8A 2EFPA 4BYYA 1XMXA 2M9HA 5L3BA 4ABZA 3VYSB 3A1YA 3E5UA 3J7ZI 5F6FA 1IN7A 4NQWB 1I1GA 1C0WA 2WADA 3BTLA 4AU7A 5D5UB 4UUSB 1ZR4A 4D0PA 3BQZA 3RPUD 1YHQI 2KZVA 1W5SA 1ERDA 4BQQA 4A3KJ 2EBIA 3FXMA 2HGCA 3BDDA 4OAZA 3V4GA 4BQNA 3G1OA 4RLQA 2DYRH 4EM2A 3E1SA 3WTWC 4M73A 4LG0B 3BG5A 1TC3C 1JHFA 2R7DA 2XRNA 3WTSC 2K7LA 3WU1B 2XC7A 3CO7C 1VQLI 2W84A 4P9FA 2VE8A 1AWCA 1Y1VJ 2F5VA 4C3IJ 1QPMA 1J5YA 4UVCA 2EWNA 3U1KA 3KP3A 2DMQA 3DLAA 3WTXC 4OMYA 3LNQA 3KZZA 4HG2A 2NVYJ 1UAAA 2DTZA 4ZH4F 3FF5A 2XB0X 2LY2A 3QU3A 1NK2P 3AL0B 2BEOA 2Y0SA 2PX9A 3D5RC 2XF5A 4Q4ZF 1B1BA 3QODA 2PN6A 1NG6A 3BC8A 4M71A 4P9UA 3H5RA 2R0QC 3HRUA 3C1DA 2PI0A 2J5PA 4BHCA 1ZHFA 3F8CA 5FLMJ 1V5FA 4XRMA 4XLPF 2R7WA 2ZSIB 1I27A 2ZCWA 4DGWB 2R7XA 2CQKA 2HI3A 1R9TJ 4BQOA 3GVAA 2PFBA 3MVPA 3PIOF 4CCLA 1YRNA 5FFXA 2VBXA 2GWRA 3I71A 3OOPA 2R7ZJ 4G12A 4MLOA 1SFXA 1IN4A 1RIOH 5CVUA 1W4MA 1FJLA 4BKXA 2PMZN 3CDLA 3FMRA 5HDNA 4IX7A 2XGEA 5F0CA 2XV4S 3L2VA 3FMQA 2DJIA 2EFOA 2X1DA 3B6AA 3L09A 4XRFA 1W7PA 1LDDA 3KYDB 3K4JA 4NC8A 3UKGA 4OOIA 5ILSA 1UHMA 2LMDA 3BR3A 3CF5F 2HQRA 1DP7P 2QSGX 1KZHA 2Z3YA 2A61A 2M1BA 2O03A 1W7PD 3KZYA 4BE1A 4II3A 1BI0A 3CQZJ 3BTJA 4DZJA 2E1OA 2LC2A 1JGGA 1X2NA 2VBWA 3BLYA 2OTLI 1U8BA 1FMVA 4ASNA 2ZMEC 3OYHA 1CF7A 4C3JJ 1TQMA 2FUG2 1H8AC 2JA7J 4MQVA 1NH3A 3FDYA 1D5YA 2QM3A 3E5QA 2IVMA 2GXGA 4FX0A 1WI3A 2WBMA 4IHWA 4QPOA 1AKHB 2EZLA 2HXIA 1WH7A 4BBSJ 1U8RA 3I5UA 2K9SA 1IN5A 3QWLA 2E1MC 1EH6A 2V9KA 3E7LA 5J40A 2ZNYA 5LEKA 3W2VA 4HOBA 1BIBA 4YELA 1FOKA 2IS6A 4BNCA 4OU0A 3DF8A 1MNEA 4MO7A 5EEAA 2DOAA 2E36A 2VOOA 2ECBA 2DFHA 2OA4A 1WJFA 1KQ8A 2HU9A 2JN6A 1P9QC 4HBLA 2OD5A 2YU3A 3SEQA 3KZIC 1XGNA 5AONA 3DTKA 4EJTA 5LRSA 4MQ9F 3V42A 4AIDA 2FMLA 1MH3A 4GYIA 3VSKA 2NS8A 3Q9SA 1IN6A 1N25A 1S29A 4ZYDA 3I54A 4AD9A 1R1TA 3IV5A 2W57A 1VQ4I 5H6RA 5ILUA 5F0FA 4MFDA 2PMHA 4XNFA 4FASD 2HPIA 2HVRA 1K6YA 1KYZA 1G3TA 3FIWA 2ESNA 3DCFA 1PDNC 1AHDP 1B59A 3H9QA 3DP7A 5DCMB 4CH7A 1XGMA 3E6BA 2P5KA 5DEQA 3HTSB 2HS5A 2AQFA 1V4RA 4HX4A 2KIUA 3ZPLA 2V6CA 2W48A 1OMIA 4RB0A 5BNGA 4YFXF 2DT7B 1GVDA 2GOXB 2Y0MA 3DBLB 4NHJA 1OKRA 1ZELA 3S16J 3OYIA 4IHSA 5KAFC 1B72A 2BW3B 2OTJI 2P81A 4XLEA 2YX7A 3FBNB 3WU0A 3ZN1A 2EJRA 3KCCA 2PQ8A 1BIAA 3GTJJ 4I09A 1BN5A 4WF2A 5HNFA 3E5XA 2WAFA 1W0TA 4EJUA 3CJQB 2D1HA 5LEJA 4LLNA 3P9IA 2L7ZA 2MG4A 1RC9A 2RREA 4XN3A 2JRMA 1Z3YA 5D8LB 1OCRH 3OYEA 3FWEA 3JRGA 3ERED 1P4WA 3BG6A 3CMAI 4A3CJ 2BVLA 4PJJA 3CC7I 4FCYA 1A04A 2OZ6A 3EUKL 3GTQJ 1SD5A 3ECOA 1VQNI 3CUQB 1XSVA 2GM4A 3A03A 5BPIA 2IW5A 3IH3A 3CESA 2NVQJ 4J00A 1ZGAA 5ICEA 3JSPA 4YEJA 1K4SA 4JQFA 3K10A 1MBKA 4V2FA 5E1ZB 2LBFA 1Z67A 1Z0XA 4HLYA 3E6CC 4UY8I 2OUMA 4E7LA 1R36A 3D5LA 4U0YA 2R7OA 3BR0A 5J8FA 1Z21A 1QHGA 3T8RA 4KITB 4BU2A 1YLFA 2K3FA 3LA7A 1Z7UA 3LSGA 4AM3A 3A4CA 3BOQA 2M5WA 1UZCA 2NYXA 3ONQA 3JAMZ 4MTEA 3EPZA 2OJED 1R5GA 2L3DA 5C44J 1YRNB 3P9CA 5E3MA 3HOZJ 3NAUA 3SZTA 1PJRA 2MLKA 3JCUC 5J1UA 3R0AA 2CV0A 1I39A 2Q1ZB 3LAJA 2ZXJA 4HF0A 3ZQQA 1ZG5A 2RQPA 1RKTA 2FSWA 3ROUA 3HOSA 2DFEA 3HPHA 1JUPA 3ZMUA 4BEHB 2EV5A 2VOPA 2MW8A 1D5VA 2CUFA 3TQNA 1WGXA 3PSIA 1P92A 3OYMA 1YJWI 2DA2A 3WTTC 3L7WA 5FD6A 1FT9A 1FSHA 1IXSB 2VIXA 2FXAA 3MZYA 2Z1DA 4CYCB 1XTAA 1IXCA 1I1SA 4UV9A 2CRGA 5JHUA 4RAFA 5EYRA 2DOEA 4M72A 2I8DA 1PUEE 3GTLJ 4QTRA 1QVUA 2WB1N 4CYDA 1SAXA 3H5NA 4PZJA 4UXNA 5L3FA 1E3HA 1R5ID 1FIPA 2GIVA 1XN7A 2CQNA 3HSEA 1UB9A 4HAMA 3L2QA 2X9DA 4I0BA 4JYKA 4LK1F 4IRIA 2HOAA 2QZ8A 4GDFA 4QLCU 1ITYA 2EILH 4ZYHA 3VOEA 1X4PA 1Z7LA 1Y0UA 1WRJA 5IP7J 2R7QA 1RR7A 3ZMSA 4I98B 2COBA 2ELHA 5FLXK 1BJAA 3G73A 4TV7A 3OYBA 4A0ZA 3J80Z 1J59A 2MFZA 1UG0A 4RDUA 3AL0C 4G9YA 1OR7C 1POGA 2UXXA 2DODA 4ENKA 2JA5J 4YFKF 2ZKZA 2IS2A 3SZPA 1E17A 3JRIA 1UHSA 2BY0A 2O0YA 1MKMA 4ZTFA 4ZYAA 1OQYA 2O8KA 2HZTA 4HQEA 4KN7X 2Q2EB 3M1CA 3T5XA 1BOAA 5DUKA 3DV8A 2Y69H 3QOEA 3QPTA 2ELJA 2KP6A 1FYKA 3SDGA 4X6AJ 4RAYA 2HR3A 4BGDA 3TO7A 2QEXI 3SFIA 1IUFA 2R4GA 3PUBA 1B9MA 1WVRA 1ORKA 2VN2A 4OWRB 1G4DA 3HRSA 1GDTA 4KDPA 4NQWA 2BBYA 3DPLC 1DPUA 1MZBA 2VKEA 1BC8C 1HA8A 4UUSA 1T6SA 4IVNA 2BOLA 4ANJA 2KPMA 2RNGA 3HTUA 3I55I 1HOMA 5K5RA 1XCVA 1FWZA 3S1MJ 4JX6A 1IV6A 3K7AJ 2X1EA 2KMUA 4XRSG 4BJTA 4QIWN 2D1VA 1VQKI 2L02A 4HNTA 4IHTA 1H88C 2KISA 4OMZA 4Y52J 1K83J 3SHFA 4IQ4A 1D0ZA 1SANA 4BUPA 4Z6YA 3GTMJ 3TP0A 1ETVA 4KUMA 2VKVA 4LMYA 1UHWA 4F3QA 2VONA 1MBGA 2Q0OA 2LY9A 3QOPA 2Z9OA 3ZMZA 1G8XA 4ENNA 4G7OF 3ABLH 1K61A 1QU3A 3UNGC 2BHYA 3H0GJ 4IOCF 3ZR8X 3FK6A 1GXQA 2RC4A 2VQCA 2TRTA 2NXNB 3F9KA 3M8JA 3PNYA 2W85A 4E7KA 2K4JA 1F36A 3A0HC 4U7BA 3CCYA 2ZNZA 5K7FA 2FRHA 2Y0SN 3R6SA 2DMTA 2VL8A 1OYYA 1X1DA 1ULYA 2RN7A 2VLAA 3P7NA 1ZTRA 4MFEA 3TW6A 4LLLA 1IV8A 2LBFB 4PJMA 3BR6A 4PSWA 2STWA 4A0YA 3LFKA 4XSZF 3JR9A 2H27A 5F0HA 3F6OA 3V8JA 3RQIA 3BY6A 1RUNA 1RKWA 1W1WE 2CSOA 1D1AA 2GIZA 3KEQA 1H0MA 2HQNA 1LJ9A 3HGGA 1FP2A 4UNOA 1G3SA 3Q9VA 2K4BA 5DS9A 5HLIA 4D7MA 2JWTA 1H89C 2X6OA 4R8HA 4UUTA 5J4VA 2YR2A 3JSOA 2AXLA 3K4KA 5CVJA 1D0YA 4WXCA 2KIQA 1EV7A 1TQIA 3HOTA 4M6YA 1O3QA 3HHHA 4A3DJ 2KLOA 3EUHA 4NUBA 2G7HA 5E79C 2DQLA 2XUBA 1LNWA 1MD0A 3ABUA 5EF6A 1VQ7I 1MBJA 1XC5A 2NNYA 4EEFG 3S17J 2CQ7A 1OCTC 3HSFA 4CSWA 1VQPI 3ASOH 3HRMA 4M3GA 1ZKGA 1D1CA 1J7KA 3CLQA 2YSRA 2CG4A 3I58A 3LSTA 4MGRA 4XBFA 4DYQA 2NRAC 5LD2C 4DBQA 2K85A 1N78A 4AIHA 2ELKA 4XLHA 2BV6A 2XPVA 3A0BC 1LKXA 1ETKA 2F5DA 4J19A 2G7UA 1AKHA 4RAZA 3OYKA 3HZJA 4YFNF 1WPKA 1I3AA 4JK1X 3ABKH 2GA2A 2DA7A 3EYIA 2DDAA 3PM1A 1HCRA 3VYTB 1MNMC 2Y9YA 1GV2A 1BC7C 4IQJA 1KA8A 2LP0A 5F64A 1QHHD 2VPLA 1W5CC 3D5SC 2CW7A 3AG3H 1A31A 1U3EM 4XKBA 3DQVC 1ZRFA 1TNSA 3IAM2 1BOBA 4E7ZA 4UHTA 4OIPF 1USSA 3OYNA 3HM5A 2RV8A 2VC0A 5E1WA 2CS3A 2X6XA 2X4HA 3BJOA 4PJ0C 1J09A 2F4IA 2H8WA 4NB5A 1VQOI 3GX4X 1S7OA 4A6EA 1R1VA 4V19K 4HV5A 2XHKA 1ZN2A 2MH2A 5FKMA 3W3CA 3S2WA 5K1YA 1GUUA 5GAGJ 5ICGA 3K9TA 4BL0B 3H5AA 2PJRB 2XSDC 3OYAA 2O9LA 1X2MA 3ERMA 2A69F 2M0MA 3BTCA 1YTYA 3LSMA 1HLVA 5JHFA 2V9PA 3CCJI 3R60A 2FU4A 2P0WA 4N9HA 2Z16A 3DU5A 2V79A 1VF9A 3WGGA 4CCMA 5EG0B 3OYCA 2RNJA 2V4JC 4EGYA 3HOWJ 2R7UA 1UFMA 3CZ6A 4PDKA 5HDKA 2L9SA 1IDYA 1MSEC 2MD5A 4IRGA 4U87A 1QGPA 4A3GJ 2IGKA 3LSRA 1YJ9I 3F72A 1W0UA 1GT0C 2QWWA 5FRNA 1OYWA 1DUXC 4KFCA 1YYVA 2K5CA 4CXFA 4KJZA 3OYDA 4HPQA 1NTCA 1X1PA 2ADUA 2ZB9A 4V2GA 4CHUA 4XLNF 3HOUJ 1VTNC 2EQRA 3S1NJ 4LFUA 4S0HB 1FYMA 3E3VA 4B47A 3I4PA 2OU2A 4HLXA 1SVMA 2BW3A 3OYGA 2DO7A 1MH4A 5IT9Z 4HNVA 4O6JA 1K78A 4JOMA 1D8JA 2K86A 4AVPA 2XAHA 2QCOA 1KYWA 2CUJA 1FY7A 4PK4A 5IY5H 3CO6C 2ZXIA 3OV8A 1SD7A 3KP6A 2LTPA 2YX4A 4E7IA 3PNTA 5DYMA 2E34A 3H3VK 2DMPA 1WJAA 1JUMA 4C2TA 2JA8J 4M9ZA 3BR2A 1XG1A 2JA2A 1QNTA 3H3UA 3HYIA 5HLTA 5GAHJ 1UELB 3AG4H 3G4SI 1NHAA 3DKWA 3LA3A 3FKJA 1YOVB 4G7HF 5KVRA 4Q47A 1EH7A 4XLCA 4PFOA 2M30A 2ZO4A 4Y33A 1ZRCA 2DPDA 3CUQA 2L7KA 4F92B 1JKRC 2F6CA 5HS8A 2XF6A 2R7TA 5J8CA 5IT3A 2V1NA 5EEHA 4ESFA 3F8NA 3GMEA 2UXNA 3GW2A 3ZMVA 1WKMA 2IPQX 3MZHA 1IN8A 3FISA 4HX7A 5HOOA 2CQXA 2LF8A 1IW7F 2M8GX 3RI4A 1LFPA 2M7BA 1P7JA 5DTDA 2HEOA 1WHUA 1T2KA 1XD7A 4HSTA 3F22A 3DKYA 1HW2A 1HW1A 5CKTA 4ZTJA 2M7AA 2ZJPF 1TT5B 1Q1HA 3VPRA 2CUEA 1J2XA 3Q0WA 2YPRA 1M1EB 3CCMI 1G3WA 4FE7A 4LB6B 1IRZA 2OV7A 4ZDLA 2CH0A 4BY1J 2ZC2A 1X3UA 1SD4A 3I3LA 5TRDA 3HOYJ 1BR1A 1TWCJ 1BI1A 3OYJA 3KP7A 3K1NA 4NC6A 3OS0A 4BEHA 1XGSA 3QPHA 3P5JA 4N0BA 4XQFA 3JAMK 2HQ5A 1LUJB 4A0XA 5BPDA 3AG1H 1JTXA 2FNAA 5EJCA 3C18A 2QLZA 3VODA 1OYIA 3WE2A 5KAIC 2H6BA 4Z2YA 2PG4A 1BR2A 4IL6C 2HKXA 4U0VA 2LSOA 1MMDA 4CYCA 2QQ9A 4BXFA 4HW0A 2E2HJ 1UMQA 3HJEA 2EZIA 5M5WJ 4IHVA 5J1RA 2IXSA 3K69A 2Z2SB 4F91B 3GFMA 4E7SA 1VNDA 2WY8Q 4B09A 4ZDPA 2W25A 4BY7J 2XGXA 4IF4A 2LNBA 3JRAA 1WH5A 4L5IA 2E1CA 4CCJA 3AFHA 1SMYF 4M6VA 5FGMA 4B43A 1BR4A 3R61A 1MIJA 2DBBA 3ZQIA 4BHPA 4CGZA 3IKTA 3ZCOA 1PVEA 2JUCA 1FOYA 3C7JA 1ZLJA 5M3FJ 2FA5A 3DBRB 2WC2A 1DQUA 3BROA 2ISZA 2KKOA 5CQEA 1FZPB 3FXJA 1MBFA 2P5VA 2ZXHA 4MEYF 3SYTA 3WG9A 2GXBA 3OIQA 5HODA 5BS6A 1JXSA 3A2KA 2NS0A 2K9LA 2VPRA 4FETA 4A3IJ 5IP6A 2HYFA 2CV2A 4L9VA 2L2OA 3NWSA 5DM6F 3PJRA 2KRHA 2CV1A 3G1LA 5FD5A 2DOFA 1YITI 1P4AA 1SFOJ 3IHUA 1Z05A 1IXRC 5DD4A 1I50J 2IAIA 4FTHA 2M8EA 2ETHA 3I53A 5LFAA 4IOAF 1T0FC 3PO3J 2DA6A 2Q2EA 1U5TB 3GCMA 3H3ZA 3O2PE 1VFCA 2YUSA 1LVKA 5JVTA 2QUFA 3GFIA 3J80K 3RCOA 3CJNA 2IA2A 3JTHA 3JRBA 3HKZA 1WJ5A 2ECCA 4AVZA 2NOJB 3WHBA 4MEXF 3W6VA 2VJ4A 1FP1D 3BCAA 2FQ3A 1ETOA 4LITA 5CPRB 2HTJA 3WGHA 1LDJA 4B3XA 2JRTA 1Y6IA 5E3LA 4NC7A 3QAHA 1XPXA 3KP5A 1AU7A 1HSJA 3GO5A 3HXLA 4NBQA 3RKYA 2HDWA
chains in the Genus database with same CATH topology
1YW7A 2NNNA 3E6MA 1IRGA 5CVIA 1ZAOA 4Y13A 5A2QZ 2OZUA 1K7AA 4L9NA 1HKTA 1K78B 3KEOA 2BYVE 2OAZA 3IC7A 3T1BA 1B4AA 1RZ4A 1R1UA 4EMSA 5BQTA 3WTUC 2H6CA 4BHBA 4ENMA 2M45A 1B9NA 4LGWA 2Z33A 2XKPA 2A07F 2P7VB 4Y17A 1U2WA 3L2CA 3W6KB 2DK5A 1EH8A 4EVIA 3V7SA 3ZMTA 3VB2A 1HQCA 2FBIA 2QYOA 2WV0A 3GZ5A 4BAYA 2P5LC 3RJPA 1KU2A 2P4WA 3KE2A 3WTZA 2RDPA 5ED4A 2CO5A 4I0AA 3TO6A 4HDUA 5L3GA 2KRFA 2M87A 3M8FA 3KETA 2F2EA 4L9JA 4BH9A 2DT5A 2QVOA 4UUVA 4OIOF 4UV8A 4AWXB 1YW8A 2L01A 3MEXA 3V7RA 3KLNA 4L9TA 2EFNA 2DFIA 1HKSA 2O8XA 3MFKA 2IRFG 3TOAA 2L54A 4JBAA 4EGZA 4M9SA 1FYLA 2DTRA 1JGSA 3D0SA 4LJZF 1ZYRF 4U0WA 4P5OA 1ZG1A 2QQBA 1KQ9A 3U1DA 1GHCA 3V8KA 5DUIA 4HF2A 3L00A 1R58A 3WTVC 1ON2A 2HYGD 4ETSA 3DFGA 4EM1A 3FM3A 1T38A 3HSRA 3WTYC 4CDGA 4S04A 3M9AA 3ISPA 2RKHA 3GWZA 5E8IA 3AAFA 5ILVA 1WSUA 3R0JA 2IA0A 2EFWA 2R7FA 1J9IA 2OQGA 3REOA 3RKXA 1QQIA 2Z99A 3TDUC 1F9NA 4RGXA 2H94A 2VT3A 3K2ZA 1I5ZA 5J6XA 1YW9A 4UVAA 1ODDA 5EEGA 2HFHA 4M9XA 4LD5A 1TW2A 2L4MA 3EQLF 5CJ9A 4WWCA 1LEAA 5IT9K 2Q8KA 5HS7A 2P6TA 3ABTA 2KJBA 4EJWA 4RB2C 1STZA 4MHGA 2DK8A 4WK8F 2ISYA 4BXUA 2LF7A 5FB2A 2ZMEB 2Y48A 1ON1A 4KA4A 3WE3A 3ZQ7A 5LHIA 5JI6A 4IPAA 1V3FA 5DDGA 2GAUA 2GQQA 4GCVA 2IP2A 4YG2F 2DLLA 2FOKA 3O6BB 4EJVA 4G94A 2V1XA 1S3JA 1F1ZA 4G8XA 4HZFA 5D4RA 2COMA 1Z9CA 2MA3A 4KIBA 4DNCA 4Y15A 3DPTA 3F6VA 4ZYEA 4H0EA 2WWYA 4HF1A 2F5FA 1YO5C 4KT5C 4YIFA 3DXJF 1YIOA 1P6RA 3RTRA 4RGUA 1H9GA 5F1RA 3M1EA 3CDHA 4OIRF 3CUOA 3SXYA 2RVCA 1XMKA 1ZG3A 1IRFA 4CICA 5ICCA 4F7ZA 4ESBA 1FNNA 1Z91A 2GZWA 3CUQC 5HVQC 1FLIA 1U5TA 4U7DA 4A12A 5LGUA 1ZH5A 2ZFWA 5HS9A 4R1HA 3RPQA 4GYGA 4ESJA 3GUDA 3GXOA 5FFZA 5D8KB 3FHZA 4Q48A 4WXDA 1I6XA 1OPCA 2W24A 5LRRA 2A6HF 1T98A 1QZZA 4RGRA 5CLSA 2E1NA 2CWEA 3I64A 5HLGA 1FSEA 3F21A 2XIGA 1R22A 4KMFA 3WODF 2DQRA 2XAFA 3H92A 3O3KA 2H09A 5A2QK 1S7AA 2CW0F 2PMUA 3MQ0A 3ULQB 3LAPA 3RPUA 1SFUA 4G7ZF 3U9GA 2JSCA 2F5CA 1TBXA 3TOBA 4FX4A 1MJBA 3B02A 2XVCA 4A5NA 3MWMA 5BOXA 1U78A 1DPRA 1WI9A 2J5OA 5HDGA 3RYPA 2A5YB 4MTDA 4OINF 2XKOA 5K5OA 4L0YB 4P55A 3RDIA 2D45A 3EETA 1S8NA 3BPXA 1F4KA 1LVAA 5DV5A 3MCZA 1LB2A 4EJOA 1KU9A 5L3DA 1JE8A 1MGTA 1IF1A 3RYRA 2BE5F 4AIKA 2KIFA 2V1DA 4EV0A 2VXZA 1KGSA 1QO0D 2DAOA 1R5HA 3GFJA 2ZJ2A 4HYEA 2X0LA 3K1MA 5E17F 1FBUA 1Z1DA 2G9WA 1SD6A 1KQ0A 5D5XB 5K5QA 3U2RA 2JTVA 2XAJA 2KIMA 4RS8A 3ZN0A 4A5MA 3BPVA 3PQJA 1QZYA 1AOYA 5D5WB 1O7FA 3HIFA 4U88A 4PGGA 3RKWA 4E70A 2RGVA 3QRFF 3FMSA 4ZZLA 2XASA 1LDKB 2GA1A 4WX9A 1FPQA 1WQ2A 3N4MA 1LEBA 3IRRA 3WGIA 3J81Z 1XB4A 2QENA 3ML6A 1F5TA 3IRQA 4LLGF 1FBSA 1ZLKA 2MH9A 3QU6A 4RGSA 2P6SA 4FHTA 1SFEA 3T8TA 1PP7U 1T39A 5LGNA 2O61A 4KMUX 1W5TA 4AIJA 4PCQA 1YS7A 1KU7A 4I02A 3TGNA 3MAJA 4L0ZB 2CGPA 1L0OC 2A3SA 2V9VA 2V1UA 2DW4A 4CO8A 1IAWA 3TO9A 2VT2A 5E1XA 4HQMA 4FT8A 3ELKA 3VFZA 2UWMA 4EQQA 1IZ1A 4YIIA 1HBXG 2EA2A 1ZGJA 3GFLA 6PAXA 4CZZA 4LK0F 2QBYB 3DEUA 2B0LA 4G6DA 3I59B 1YG2A 2CYYA 4HDVA 1UCRA 1HKQA 1U6GA 1DDNA 1L3LA 4I2OA 5L3CA 3CLOA 4KNYA 3BWGA 2ZMEA 4BQAA 1XSDA 3K1PA 2OQRA 1XDUA 4GO1A 2XROA 2BGCA 5H6QA 2LKPA 2HOEA 2E7XA 2HKOA 2VC1A 4O5VA 2VODA 3V7CA 1TW3A 4IRHA 3C3WA 3R4KA 1O7LA 2ESHA 4Q5SF 1ZARA 3L9FA 2HDCA 3LQRA 1MJAA 1SMTA 2LDUA 5CYVA 2MC3A 3BZ6A 1TNTA 1T0FA 3LA2A 1FC3A 1HSTA 3PFIA 4M74A 1K79A 1XDSA 4DQ2A 5LLQA 1BI3A 4HV6A 4WCGA 3BJ6A 2PBIA 4ZZDA 2FNPA 5D6EA 3EYYA 2VE9A 1LQ1A 4PGHA 2HWVA 2ACJA 3ECHA 2JPBA 5AIQA 3V8LA 4WXHA 4EM0B 1USTA 3HHGA 2EFQA 1K6OA 5JFRA 5LHGA 1G3YA 1W7PB 2STTA 3GZ6A 1TTYA 1O3TA 2EK5A 2EV6A 1BI2A 3GEZA 1ZRDA 3P9KA 3CTAA 5D5VB 1WWXA 3KP2A 5E20A 1CF7B 5HLHA 4L18B 1R7JA 1GVJA 1G6NA 2EV0A 3E6DA 4OIQF 1HXDA 5FO5A 2FBHA 5KK1A 2VBYA 2MBFA 1TQPA 3SFZA 1FX7A 4K2EA 2TDXA 1ONVA 1BM9A 3IWFA 1O3RA 5CVRA 4QWQA 5ICFA 1MDMA 3TKYA 3HRTA 1D3YA 4I01A 2PJPA 5BMZA 2XAGA 2KJCA 4I7HA 3T0YA 3RIRA 3ZP5A 3HUGA 3E97A 3JTGA 1XMAA 2EA4A 1R00A 5AIPA 1Z6TA 4R79A 4UVBA 1TLHB 3N97A 5ERIA 3JW4A 2CFXA 5DCFA 1GXPA 3KLOA 3F8MA 3FM5A 1REPC 1ZREA 2PEXA 3NQOA 2FBKA 4RB1A 3IWZA 5LGTA 2A68F 4HX8A 4RB3C 3FXUA 4LG0A 1R23A 1RI7A 2P7CB 2JPCA 3NEUA 2P8TA 2PLYA 2UZKA 3G3ZA 4LB5A 2VBZA 2R3SA 2DPUA 3FX3A 1PP8F 4GGGA 1FBQA 1MJ9A 4IJAA 4P96A 1YQAA 1JHHA 4MNUA 5TJJA 3FZVA 4A2UA 4IXAA 2Y75A 4XSXF 1J75A 4ON0A 1OR7A 1HW5A 2IT0A 2IJLA 1XGOA 5JR3A 3PQKA 1U5TC 4KIGA 2FMYA 1Z6RA 4GXOA 3M8EA 1O57A 2K02A 3SQNA 3TDZC 2JZYA 3EDPA 3J7AO 4O3MA 3VEPA 3GYHX 3QP5A 2O6GE 3FXRA 3BP8A 5D4SA 1J0RA 2A6EF 3LWFA 5L3EA 5E8GA 5H20A 2Z5UA 4HA8A 1YS6A 2IA1A 2QQAA 4L5JA 2MLGA 5D6FA 1RUOA 1BBYA 2F5EA 4G6QA 3NRVA 3KFWX 2XAQA 2WTEA 3LQQA 3F3XA 2DI3A 3Q5FA 4ENJA 1XSXA 2JT1A 2AS5F 5LBQA 1S6LA 2L4AA 4KYWA 2E7WA 1P4XA 3COAC 2D2WA 5FLXZ 3J81K 3W6JB 5CVVA 1CGPA 3FXQA 1QBJA 4S05A 5DD8A 1XCBA 3KP4A 2C6YA 3GF2A 3K0LA 3IL2A 4A6DA 2FE3A 1B6AA 3B73A 1IUYA 3F8FA 1YFHA 4N9IA 3IKVA 5E18F 1KU3A 3I0TA 1H9TA 1MDMB 4M6XA 4B8XA 2DU9A 3QP6A 3BJAA 4KICA 4ZYGA 2OBPA 2O3FA 3GLXA 2K27A 1RNLA 2ZBKA 1P2FA 2HTSA 2QBYA 2FF4A 1E2XA 2FEZA 3ZMDA 1D8KA 3F8BA 1O3SA 3M7GA 3I59A 2NAZA 3F23A 5DCMA 5LHHA 4KIFA 2EB7A 4KN4X 2EFPA 4BYYA 5L3BA 3E5UA 5F6FA 1IN7A 1I1GA 1C0WA 5D5UB 4D0PA 1W5SA 2HGCA 3BDDA 3V4GA 3WTWC 4EM2A 4M73A 4LG0B 1JHFA 2R7DA 2XRNA 3WTSC 2K7LA 3WU1B 3CO7C 2W84A 4P9FA 2VE8A 1AWCA 1QPMA 1J5YA 4UVCA 2EWNA 3KP3A 3WTXC 4OMYA 3KZZA 4ZH4F 3FF5A 3QU3A 2BEOA 4Q4ZF 1B1BA 2PN6A 4M71A 4P9UA 3HRUA 3C1DA 2PI0A 2J5PA 4BHCA 1ZHFA 3F8CA 4XLPF 1I27A 2ZCWA 2CQKA 3GVAA 2PFBA 5FFXA 2VBXA 2GWRA 3I71A 3OOPA 1SFXA 1IN4A 1RIOH 5CVUA 1W4MA 3FMRA 5HDNA 2XV4S 3FMQA 2EFOA 3L09A 4XRFA 1W7PA 1LDDA 4OOIA 5ILSA 1UHMA 2HQRA 1DP7P 2Z3YA 2A61A 2M1BA 2O03A 1W7PD 3KZYA 1BI0A 2VBWA 4ASNA 1CF7A 1TQMA 4MQVA 2QM3A 3E5QA 2IVMA 2GXGA 4FX0A 1U8RA 3I5UA 1IN5A 1EH6A 5LEKA 2ZNYA 4HOBA 1BIBA 1FOKA 4BNCA 4OU0A 3DF8A 2VOOA 2OA4A 1KQ8A 4HBLA 2OD5A 2YU3A 1XGNA 5AONA 4EJTA 5LRSA 4MQ9F 2FMLA 4GYIA 3Q9SA 1IN6A 1S29A 4ZYDA 3I54A 4AD9A 1R1TA 2W57A 5H6RA 5ILUA 2PMHA 1KYZA 1G3TA 2ESNA 1PDNC 1B59A 3DP7A 5DCMB 1XGMA 3E6BA 2P5KA 5DEQA 3HTSB 2HS5A 1V4RA 4HX4A 2KIUA 3ZPLA 2V6CA 1OMIA 4YFXF 4RB0A 2Y0MA 4NHJA 1OKRA 4IHSA 2YX7A 3WU0A 3ZN1A 2EJRA 3KCCA 2PQ8A 1BIAA 4I09A 1BN5A 4WF2A 3E5XA 4EJUA 2D1HA 5LEJA 4LLNA 3P9IA 5D8LB 3ERED 3FWEA 1P4WA 1A04A 2OZ6A 1SD5A 3ECOA 3CUQB 1XSVA 5BPIA 2IW5A 1ZGAA 5ICEA 3JSPA 4JQFA 5E1ZB 4HLYA 3E6CC 1R36A 3D5LA 4U0YA 5J8FA 3T8RA 1YLFA 3LA7A 1Z7UA 3BOQA 2M5WA 2NYXA 3JAMZ 4MTEA 1R5GA 2L3DA 3P9CA 3SZTA 2MLKA 3R0AA 3LAJA 2ZXJA 4HF0A 1ZG5A 2RQPA 2FSWA 3HOSA 3ROUA 3ZMUA 2EV5A 2VOPA 1D5VA 3TQNA 1P92A 3WTTC 3L7WA 5FD6A 1FT9A 1FSHA 1IXSB 2FXAA 3MZYA 1IXCA 1I1SA 4UV9A 5JHUA 4M72A 1PUEE 4CYDA 1SAXA 4PZJA 4UXNA 5L3FA 2GIVA 1XN7A 3HSEA 1UB9A 4HAMA 4I0BA 4LK1F 4IRIA 2QZ8A 4QLCU 4ZYHA 3VOEA 1Y0UA 1WRJA 3ZMSA 4I98B 2ELHA 5FLXK 1BJAA 3G73A 4TV7A 4A0ZA 3J80Z 1J59A 4G9YA 2UXXA 4ENKA 4YFKF 2ZKZA 3SZPA 1E17A 2O0YA 1MKMA 2HZTA 4HQEA 4KN7X 3T5XA 1BOAA 5DUKA 3DV8A 3QPTA 1FYKA 4RAYA 2HR3A 3TO7A 1B9MA 2VN2A 1G4DA 3HRSA 4KDPA 4NQWA 2BBYA 3DPLC 1DPUA 1MZBA 1BC8C 1T6SA 4IVNA 3HTUA 5K5RA 1XCVA 1FWZA 2D1VA 2L02A 4IHTA 4OMZA 3SHFA 4KUMA 4LMYA 1UHWA 2VONA 2Q0OA 3QOPA 2Z9OA 3ZMZA 4G7OF 4ENNA 1GXQA 2RC4A 2W85A 2K4JA 4U7BA 2ZNZA 2FRHA 3R6SA 1OYYA 2RN7A 1ULYA 3P7NA 4LLLA 2STWA 4A0YA 3LFKA 4XSZF 2H27A 3F6OA 3V8JA 3BY6A 1RUNA 3KEQA 2CSOA 1H0MA 2HQNA 1LJ9A 1FP2A 4UNOA 1G3SA 3Q9VA 2K4BA 5HLIA 4R8HA 2YR2A 3JSOA 2AXLA 5CVJA 4WXCA 1EV7A 1TQIA 3HOTA 4M6YA 1O3QA 3HHHA 3EUHA 2G7HA 2DQLA 2XUBA 1LNWA 1MD0A 3ABUA 2NNYA 3HSFA 3HRMA 1J7KA 2YSRA 2CG4A 3I58A 3LSTA 4MGRA 4XBFA 2NRAC 4AIHA 2BV6A 2F5DA 2G7UA 4RAZA 4YFNF 4JK1X 2GA2A 3EYIA 1BC7C 1KA8A 5F64A 1U3EM 3DQVC 1ZRFA 1TNSA 4UHTA 4OIPF 1USSA 2RV8A 2VC0A 5E1WA 2X4HA 3BJOA 4NB5A 3GX4X 1S7OA 4A6EA 1R1VA 4HV5A 2XHKA 1ZN2A 2MH2A 3S2WA 5K1YA 5ICGA 3K9TA 2A69F 1YTYA 3R60A 2FU4A 4N9HA 2V79A 3WGGA 4EGYA 2RNJA 1UFMA 4PDKA 5HDKA 2MD5A 4IRGA 1QGPA 3F72A 2QWWA 1OYWA 1DUXC 4KFCA 1YYVA 4CXFA 2ADUA 4CHUA 4XLNF 1VTNC 4LFUA 1FYMA 3E3VA 3I4PA 2OU2A 4HLXA 2DO7A 5IT9Z 1K78A 4O6JA 1D8JA 2K86A 4AVPA 2XAHA 1KYWA 1FY7A 3CO6C 3OV8A 1SD7A 3KP6A 2YX4A 5DYMA 4M9ZA 1QNTA 3H3UA 3HYIA 1NHAA 3DKWA 3LA3A 4G7HF 5KVRA 4Q47A 1EH7A 1ZRCA 2M30A 2ZO4A 2DPDA 3CUQA 5HS8A 5J8CA 5IT3A 5EEHA 4ESFA 3F8NA 2UXNA 3GW2A 3ZMVA 1WKMA 2IPQX 3MZHA 1IN8A 4HX7A 5HOOA 2LF8A 1IW7F 3RI4A 2HEOA 1T2KA 1XD7A 3F22A 1HW2A 1HW1A 1Q1HA 1J2XA 2YPRA 1G3WA 4LB6B 1X3UA 1SD4A 5TRDA 1BI1A 3KP7A 3K1NA 1XGSA 3QPHA 4N0BA 3JAMK 4A0XA 5BPDA 2FNAA 3C18A 2QLZA 3VODA 1OYIA 3WE2A 2H6BA 4Z2YA 2PG4A 2HKXA 4U0VA 2LSOA 2QQ9A 4HW0A 3K69A 3GFMA 4B09A 2W25A 2XGXA 4IF4A 2LNBA 4L5IA 2E1CA 1SMYF 5FGMA 3R61A 2DBBA 4BHPA 4CGZA 3IKTA 3C7JA 1ZLJA 2FA5A 2WC2A 2ISZA 3BROA 2KKOA 1FZPB 2P5VA 4MEYF 3WG9A 2GXBA 5BS6A 1JXSA 2NS0A 2HYFA 4L9VA 5FD5A 1P4AA 3IHUA 1Z05A 1IXRC 5DD4A 2M8EA 2ETHA 3I53A 2Q2EA 1U5TB 3O2PE 3H3ZA 5JVTA 2QUFA 3GFIA 3J80K 3CJNA 2IA2A 3JTHA 4MEXF 1FP1D 2FQ3A 3WGHA 2HTJA 1LDJA 2JRTA 3QAHA 3KP5A 1HSJA 3GO5A 3RKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  2NNN A;  3E6M A;  1IRG A;  5CVI A;  1ZAO A;  4Y13 A;  5A2Q Z;  2OZU A;  1K7A A;  4L9N A;  1HKT A;  1K78 B;  3KEO A;  2BYV E;  2OAZ A;  3IC7 A;  3T1B A;  1B4A A;  1RZ4 A;  1R1U A;  4EMS A;  5BQT A;  3WTU C;  2H6C A;  4BHB A;  4ENM A;  2M45 A;  1B9N A;  4LGW A;  2Z33 A;  2XKP A;  2A07 F;  2P7V B;  4Y17 A;  1U2W A;  3L2C A;  3W6K B;  2DK5 A;  1EH8 A;  4EVI A;  3V7S A;  3ZMT A;  3VB2 A;  1HQC A;  2FBI A;  2QYO A;  2WV0 A;  3GZ5 A;  4BAY A;  2P5L C;  3RJP A;  1KU2 A;  2P4W A;  3KE2 A;  3WTZ A;  2RDP A;  5ED4 A;  2CO5 A;  4I0A A;  3TO6 A;  4HDU A;  5L3G A;  2KRF A;  2M87 A;  3M8F A;  3KET A;  2F2E A;  4L9J A;  4BH9 A;  2DT5 A;  2QVO A;  4UUV A;  4OIO F;  4UV8 A;  4AWX B;  1YW8 A;  2L01 A;  3MEX A;  3V7R A;  3KLN A;  4L9T A;  2EFN A;  2DFI A;  1HKS A;  2O8X A;  3MFK A;  2IRF G;  3TOA A;  2L54 A;  4JBA A;  4EGZ A;  4M9S A;  1FYL A;  2DTR A;  1JGS A;  3D0S A;  4LJZ F;  1ZYR F;  4U0W A;  4P5O A;  1ZG1 A;  2QQB A;  1KQ9 A;  3U1D A;  1GHC A;  3V8K A;  5DUI A;  4HF2 A;  3L00 A;  1R58 A;  3WTV C;  1ON2 A;  2HYG D;  4ETS A;  3DFG A;  4EM1 A;  3FM3 A;  1T38 A;  3HSR A;  3WTY C;  4CDG A;  4S04 A;  3M9A A;  3ISP A;  2RKH A;  3GWZ A;  5E8I A;  3AAF A;  5ILV A;  1WSU A;  3R0J A;  2IA0 A;  2EFW A;  2R7F A;  1J9I A;  2OQG A;  3REO A;  3RKX A;  1QQI A;  2Z99 A;  3TDU C;  1F9N A;  4RGX A;  2H94 A;  2VT3 A;  3K2Z A;  1I5Z A;  5J6X A;  1YW9 A;  4UVA A;  1ODD A;  5EEG A;  2HFH A;  4M9X A;  4LD5 A;  1TW2 A;  2L4M A;  3EQL F;  5CJ9 A;  4WWC A;  1LEA A;  5IT9 K;  2Q8K A;  5HS7 A;  2P6T A;  3ABT A;  2KJB A;  4EJW A;  4RB2 C;  1STZ A;  4MHG A;  2DK8 A;  4WK8 F;  2ISY A;  4BXU A;  2LF7 A;  5FB2 A;  2ZME B;  2Y48 A;  1ON1 A;  4KA4 A;  3WE3 A;  3ZQ7 A;  5LHI A;  5JI6 A;  4IPA A;  1V3F A;  5DDG A;  2GAU A;  2GQQ A;  4GCV A;  2IP2 A;  4YG2 F;  2DLL A;  2FOK A;  3O6B B;  4EJV A;  4G94 A;  2V1X A;  1S3J A;  1F1Z A;  4G8X A;  4HZF A;  5D4R A;  2COM A;  1Z9C A;  2MA3 A;  4KIB A;  4DNC A;  4Y15 A;  3DPT A;  3F6V A;  4ZYE A;  4H0E A;  2WWY A;  4HF1 A;  2F5F A;  1YO5 C;  4KT5 C;  4YIF A;  3DXJ F;  1YIO A;  1P6R A;  3RTR A;  4RGU A;  1H9G A;  5F1R A;  3M1E A;  3CDH A;  4OIR F;  3CUO A;  3SXY A;  2RVC A;  1XMK A;  1ZG3 A;  1IRF A;  4CIC A;  5ICC A;  4F7Z A;  4ESB A;  1FNN A;  1Z91 A;  2GZW A;  3CUQ C;  5HVQ C;  1FLI A;  1U5T A;  4U7D A;  4A12 A;  5LGU A;  1ZH5 A;  2ZFW A;  5HS9 A;  4R1H A;  3RPQ A;  4GYG A;  4ESJ A;  3GUD A;  3GXO A;  5FFZ A;  5D8K B;  3FHZ A;  4Q48 A;  4WXD A;  1I6X A;  1OPC A;  2W24 A;  5LRR A;  2A6H F;  1T98 A;  1QZZ A;  4RGR A;  5CLS A;  2E1N A;  2CWE A;  3I64 A;  5HLG A;  1FSE A;  3F21 A;  2XIG A;  1R22 A;  4KMF A;  3WOD F;  2DQR A;  2XAF A;  3H92 A;  3O3K A;  2H09 A;  5A2Q K;  1S7A A;  2CW0 F;  2PMU A;  3MQ0 A;  3ULQ B;  3LAP A;  3RPU A;  1SFU A;  4G7Z F;  3U9G A;  2JSC A;  2F5C A;  1TBX A;  3TOB A;  4FX4 A;  1MJB A;  3B02 A;  2XVC A;  4A5N A;  3MWM A;  5BOX A;  1U78 A;  1DPR A;  1WI9 A;  2J5O A;  5HDG A;  3RYP A;  2A5Y B;  4MTD A;  4OIN F;  2XKO A;  5K5O A;  4L0Y B;  4P55 A;  3RDI A;  2D45 A;  3EET A;  1S8N A;  3BPX A;  1F4K A;  1LVA A;  5DV5 A;  3MCZ A;  1LB2 A;  4EJO A;  1KU9 A;  5L3D A;  1JE8 A;  1MGT A;  1IF1 A;  3RYR A;  2BE5 F;  4AIK A;  2KIF A;  2V1D A;  4EV0 A;  2VXZ A;  1KGS A;  1QO0 D;  2DAO A;  1R5H A;  3GFJ A;  2ZJ2 A;  4HYE A;  2X0L A;  3K1M A;  5E17 F;  1FBU A;  1Z1D A;  2G9W A;  1SD6 A;  1KQ0 A;  5D5X B;  5K5Q A;  3U2R A;  2JTV A;  2XAJ A;  2KIM A;  4RS8 A;  3ZN0 A;  4A5M A;  3BPV A;  3PQJ A;  1QZY A;  1AOY A;  5D5W B;  1O7F A;  3HIF A;  4U88 A;  4PGG A;  3RKW A;  4E70 A;  2RGV A;  3QRF F;  3FMS A;  4ZZL A;  2XAS A;  1LDK B;  2GA1 A;  4WX9 A;  1FPQ A;  1WQ2 A;  3N4M A;  1LEB A;  3IRR A;  3WGI A;  3J81 Z;  1XB4 A;  2QEN A;  3ML6 A;  1F5T A;  3IRQ A;  4LLG F;  1FBS A;  1ZLK A;  2MH9 A;  3QU6 A;  4RGS A;  2P6S A;  4FHT A;  1SFE A;  3T8T A;  1PP7 U;  1T39 A;  5LGN A;  2O61 A;  4KMU X;  1W5T A;  4AIJ A;  4PCQ A;  1YS7 A;  1KU7 A;  4I02 A;  3TGN A;  3MAJ A;  4L0Z B;  2CGP A;  1L0O C;  2A3S A;  2V9V A;  2V1U A;  2DW4 A;  4CO8 A;  1IAW A;  3TO9 A;  2VT2 A;  5E1X A;  4HQM A;  4FT8 A;  3ELK A;  3VFZ A;  2UWM A;  4EQQ A;  1IZ1 A;  4YII A;  1HBX G;  2EA2 A;  1ZGJ A;  3GFL A;  6PAX A;  4CZZ A;  4LK0 F;  2QBY B;  3DEU A;  2B0L A;  4G6D A;  3I59 B;  1YG2 A;  2CYY A;  4HDV A;  1UCR A;  1HKQ A;  1U6G A;  1DDN A;  1L3L A;  4I2O A;  5L3C A;  3CLO A;  4KNY A;  3BWG A;  2ZME A;  4BQA A;  1XSD A;  3K1P A;  2OQR A;  1XDU A;  4GO1 A;  2XRO A;  2BGC A;  5H6Q A;  2LKP A;  2HOE A;  2E7X A;  2HKO A;  2VC1 A;  4O5V A;  2VOD A;  3V7C A;  1TW3 A;  4IRH A;  3C3W A;  3R4K A;  1O7L A;  2ESH A;  4Q5S F;  1ZAR A;  3L9F A;  2HDC A;  3LQR A;  1MJA A;  1SMT A;  2LDU A;  5CYV A;  2MC3 A;  3BZ6 A;  1TNT A;  1T0F A;  3LA2 A;  1FC3 A;  1HST A;  3PFI A;  4M74 A;  1K79 A;  1XDS A;  4DQ2 A;  5LLQ A;  1BI3 A;  4HV6 A;  4WCG A;  3BJ6 A;  2PBI A;  4ZZD A;  2FNP A;  5D6E A;  3EYY A;  2VE9 A;  1LQ1 A;  4PGH A;  2HWV A;  2ACJ A;  3ECH A;  2JPB A;  5AIQ A;  3V8L A;  4WXH A;  4EM0 B;  1UST A;  3HHG A;  2EFQ A;  1K6O A;  5JFR A;  5LHG A;  1G3Y A;  1W7P B;  2STT A;  3GZ6 A;  1TTY A;  1O3T A;  2EK5 A;  2EV6 A;  1BI2 A;  3GEZ A;  1ZRD A;  3P9K A;  3CTA A;  5D5V B;  1WWX A;  3KP2 A;  5E20 A;  1CF7 B;  5HLH A;  4L18 B;  1R7J A;  1GVJ A;  1G6N A;  2EV0 A;  3E6D A;  4OIQ F;  1HXD A;  5FO5 A;  2FBH A;  5KK1 A;  2VBY A;  2MBF A;  1TQP A;  3SFZ A;  1FX7 A;  4K2E A;  2TDX A;  1ONV A;  1BM9 A;  3IWF A;  1O3R A;  5CVR A;  4QWQ A;  5ICF A;  1MDM A;  3TKY A;  3HRT A;  1D3Y A;  4I01 A;  2PJP A;  5BMZ A;  2XAG A;  2KJC A;  4I7H A;  3T0Y A;  3RIR A;  3ZP5 A;  3HUG A;  3E97 A;  3JTG A;  1XMA A;  2EA4 A;  1R00 A;  5AIP A;  1Z6T A;  4R79 A;  4UVB A;  1TLH B;  3N97 A;  5ERI A;  3JW4 A;  2CFX A;  5DCF A;  1GXP A;  3KLO A;  3F8M A;  3FM5 A;  1REP C;  1ZRE A;  2PEX A;  3NQO A;  2FBK A;  4RB1 A;  3IWZ A;  5LGT A;  2A68 F;  4HX8 A;  4RB3 C;  3FXU A;  4LG0 A;  1R23 A;  1RI7 A;  2P7C B;  2JPC A;  3NEU A;  2P8T A;  2PLY A;  2UZK A;  3G3Z A;  4LB5 A;  2VBZ A;  2R3S A;  2DPU A;  3FX3 A;  1PP8 F;  4GGG A;  1FBQ A;  1MJ9 A;  4IJA A;  4P96 A;  1YQA A;  1JHH A;  4MNU A;  5TJJ A;  3FZV A;  4A2U A;  4IXA A;  2Y75 A;  4XSX F;  1J75 A;  4ON0 A;  1OR7 A;  1HW5 A;  2IT0 A;  2IJL A;  1XGO A;  5JR3 A;  3PQK A;  1U5T C;  4KIG A;  2FMY A;  1Z6R A;  4GXO A;  3M8E A;  1O57 A;  2K02 A;  3SQN A;  3TDZ C;  2JZY A;  3EDP A;  3J7A O;  4O3M A;  3VEP A;  3GYH X;  3QP5 A;  2O6G E;  3FXR A;  3BP8 A;  5D4S A;  1J0R A;  2A6E F;  3LWF A;  5L3E A;  5E8G A;  5H20 A;  2Z5U A;  4HA8 A;  1YS6 A;  2IA1 A;  2QQA A;  4L5J A;  2MLG A;  5D6F A;  1RUO A;  1BBY A;  2F5E A;  4G6Q A;  3NRV A;  3KFW X;  2XAQ A;  2WTE A;  3LQQ A;  3F3X A;  2DI3 A;  3Q5F A;  4ENJ A;  1XSX A;  2JT1 A;  2AS5 F;  5LBQ A;  1S6L A;  2L4A A;  4KYW A;  2E7W A;  1P4X A;  3COA C;  2D2W A;  5FLX Z;  3J81 K;  3W6J B;  5CVV A;  1CGP A;  3FXQ A;  1QBJ A;  4S05 A;  5DD8 A;  1XCB A;  3KP4 A;  2C6Y A;  3GF2 A;  3K0L A;  3IL2 A;  4A6D A;  2FE3 A;  1B6A A;  3B73 A;  1IUY A;  3F8F A;  1YFH A;  4N9I A;  3IKV A;  5E18 F;  1KU3 A;  3I0T A;  1H9T A;  1MDM B;  4M6X A;  4B8X A;  2DU9 A;  3QP6 A;  3BJA A;  4KIC A;  4ZYG A;  2OBP A;  2O3F A;  3GLX A;  2K27 A;  1RNL A;  2ZBK A;  1P2F A;  2HTS A;  2QBY A;  2FF4 A;  1E2X A;  2FEZ A;  3ZMD A;  1D8K A;  3F8B A;  1O3S A;  3M7G A;  3I59 A;  2NAZ A;  3F23 A;  5DCM A;  5LHH A;  4KIF A;  2EB7 A;  4KN4 X;  2EFP A;  4BYY A;  5L3B A;  3E5U A;  5F6F A;  1IN7 A;  1I1G A;  1C0W A;  5D5U B;  4D0P A;  1W5S A;  2HGC A;  3BDD A;  3V4G A;  3WTW C;  4EM2 A;  4M73 A;  4LG0 B;  1JHF A;  2R7D A;  2XRN A;  3WTS C;  2K7L A;  3WU1 B;  3CO7 C;  2W84 A;  4P9F A;  2VE8 A;  1AWC A;  1QPM A;  1J5Y A;  4UVC A;  2EWN A;  3KP3 A;  3WTX C;  4OMY A;  3KZZ A;  4ZH4 F;  3FF5 A;  3QU3 A;  2BEO A;  4Q4Z F;  1B1B A;  2PN6 A;  4M71 A;  4P9U A;  3HRU A;  3C1D A;  2PI0 A;  2J5P A;  4BHC A;  1ZHF A;  3F8C A;  4XLP F;  1I27 A;  2ZCW A;  2CQK A;  3GVA A;  2PFB A;  5FFX A;  2VBX A;  2GWR A;  3I71 A;  3OOP A;  1SFX A;  1IN4 A;  1RIO H;  5CVU A;  1W4M A;  3FMR A;  5HDN A;  2XV4 S;  3FMQ A;  2EFO A;  3L09 A;  4XRF A;  1W7P A;  1LDD A;  4OOI A;  5ILS A;  1UHM A;  2HQR A;  1DP7 P;  2Z3Y A;  2A61 A;  2M1B A;  2O03 A;  1W7P D;  3KZY A;  1BI0 A;  2VBW A;  4ASN A;  1CF7 A;  1TQM A;  4MQV A;  2QM3 A;  3E5Q A;  2IVM A;  2GXG A;  4FX0 A;  1U8R A;  3I5U A;  1IN5 A;  1EH6 A;  5LEK A;  2ZNY A;  4HOB A;  1BIB A;  1FOK A;  4BNC A;  4OU0 A;  3DF8 A;  2VOO A;  2OA4 A;  1KQ8 A;  4HBL A;  2OD5 A;  2YU3 A;  1XGN A;  5AON A;  4EJT A;  5LRS A;  4MQ9 F;  2FML A;  4GYI A;  3Q9S A;  1IN6 A;  1S29 A;  4ZYD A;  3I54 A;  4AD9 A;  1R1T A;  2W57 A;  5H6R A;  5ILU A;  2PMH A;  1KYZ A;  1G3T A;  2ESN A;  1PDN C;  1B59 A;  3DP7 A;  5DCM B;  1XGM A;  3E6B A;  2P5K A;  5DEQ A;  3HTS B;  2HS5 A;  1V4R A;  4HX4 A;  2KIU A;  3ZPL A;  2V6C A;  1OMI A;  4YFX F;  4RB0 A;  2Y0M A;  4NHJ A;  1OKR A;  4IHS A;  2YX7 A;  3WU0 A;  3ZN1 A;  2EJR A;  3KCC A;  2PQ8 A;  1BIA A;  4I09 A;  1BN5 A;  4WF2 A;  3E5X A;  4EJU A;  2D1H A;  5LEJ A;  4LLN A;  3P9I A;  5D8L B;  3ERE D;  3FWE A;  1P4W A;  1A04 A;  2OZ6 A;  1SD5 A;  3ECO A;  3CUQ B;  1XSV A;  5BPI A;  2IW5 A;  1ZGA A;  5ICE A;  3JSP A;  4JQF A;  5E1Z B;  4HLY A;  3E6C C;  1R36 A;  3D5L A;  4U0Y A;  5J8F A;  3T8R A;  1YLF A;  3LA7 A;  1Z7U A;  3BOQ A;  2M5W A;  2NYX A;  3JAM Z;  4MTE A;  1R5G A;  2L3D A;  3P9C A;  3SZT A;  2MLK A;  3R0A A;  3LAJ A;  2ZXJ A;  4HF0 A;  1ZG5 A;  2RQP A;  2FSW A;  3HOS A;  3ROU A;  3ZMU A;  2EV5 A;  2VOP A;  1D5V A;  3TQN A;  1P92 A;  3WTT C;  3L7W A;  5FD6 A;  1FT9 A;  1FSH A;  1IXS B;  2FXA A;  3MZY A;  1IXC A;  1I1S A;  4UV9 A;  5JHU A;  4M72 A;  1PUE E;  4CYD A;  1SAX A;  4PZJ A;  4UXN A;  5L3F A;  2GIV A;  1XN7 A;  3HSE A;  1UB9 A;  4HAM A;  4I0B A;  4LK1 F;  4IRI A;  2QZ8 A;  4QLC U;  4ZYH A;  3VOE A;  1Y0U A;  1WRJ A;  3ZMS A;  4I98 B;  2ELH A;  5FLX K;  1BJA A;  3G73 A;  4TV7 A;  4A0Z A;  3J80 Z;  1J59 A;  4G9Y A;  2UXX A;  4ENK A;  4YFK F;  2ZKZ A;  3SZP A;  1E17 A;  2O0Y A;  1MKM A;  2HZT A;  4HQE A;  4KN7 X;  3T5X A;  1BOA A;  5DUK A;  3DV8 A;  3QPT A;  1FYK A;  4RAY A;  2HR3 A;  3TO7 A;  1B9M A;  2VN2 A;  1G4D A;  3HRS A;  4KDP A;  4NQW A;  2BBY A;  3DPL C;  1DPU A;  1MZB A;  1BC8 C;  1T6S A;  4IVN A;  3HTU A;  5K5R A;  1XCV A;  1FWZ A;  2D1V A;  2L02 A;  4IHT A;  4OMZ A;  3SHF A;  4KUM A;  4LMY A;  1UHW A;  2VON A;  2Q0O A;  3QOP A;  2Z9O A;  3ZMZ A;  4G7O F;  4ENN A;  1GXQ A;  2RC4 A;  2W85 A;  2K4J A;  4U7B A;  2ZNZ A;  2FRH A;  3R6S A;  1OYY A;  2RN7 A;  1ULY A;  3P7N A;  4LLL A;  2STW A;  4A0Y A;  3LFK A;  4XSZ F;  2H27 A;  3F6O A;  3V8J A;  3BY6 A;  1RUN A;  3KEQ A;  2CSO A;  1H0M A;  2HQN A;  1LJ9 A;  1FP2 A;  4UNO A;  1G3S A;  3Q9V A;  2K4B A;  5HLI A;  4R8H A;  2YR2 A;  3JSO A;  2AXL A;  5CVJ A;  4WXC A;  1EV7 A;  1TQI A;  3HOT A;  4M6Y A;  1O3Q A;  3HHH A;  3EUH A;  2G7H A;  2DQL A;  2XUB A;  1LNW A;  1MD0 A;  3ABU A;  2NNY A;  3HSF A;  3HRM A;  1J7K A;  2YSR A;  2CG4 A;  3I58 A;  3LST A;  4MGR A;  4XBF A;  2NRA C;  4AIH A;  2BV6 A;  2F5D A;  2G7U A;  4RAZ A;  4YFN F;  4JK1 X;  2GA2 A;  3EYI A;  1BC7 C;  1KA8 A;  5F64 A;  1U3E M;  3DQV C;  1ZRF A;  1TNS A;  4UHT A;  4OIP F;  1USS A;  2RV8 A;  2VC0 A;  5E1W A;  2X4H A;  3BJO A;  4NB5 A;  3GX4 X;  1S7O A;  4A6E A;  1R1V A;  4HV5 A;  2XHK A;  1ZN2 A;  2MH2 A;  3S2W A;  5K1Y A;  5ICG A;  3K9T A;  2A69 F;  1YTY A;  3R60 A;  2FU4 A;  4N9H A;  2V79 A;  3WGG A;  4EGY A;  2RNJ A;  1UFM A;  4PDK A;  5HDK A;  2MD5 A;  4IRG A;  1QGP A;  3F72 A;  2QWW A;  1OYW A;  1DUX C;  4KFC A;  1YYV A;  4CXF A;  2ADU A;  4CHU A;  4XLN F;  1VTN C;  4LFU A;  1FYM A;  3E3V A;  3I4P A;  2OU2 A;  4HLX A;  2DO7 A;  5IT9 Z;  1K78 A;  4O6J A;  1D8J A;  2K86 A;  4AVP A;  2XAH A;  1KYW A;  1FY7 A;  3CO6 C;  3OV8 A;  1SD7 A;  3KP6 A;  2YX4 A;  5DYM A;  4M9Z A;  1QNT A;  3H3U A;  3HYI A;  1NHA A;  3DKW A;  3LA3 A;  4G7H F;  5KVR A;  4Q47 A;  1EH7 A;  1ZRC A;  2M30 A;  2ZO4 A;  2DPD A;  3CUQ A;  5HS8 A;  5J8C A;  5IT3 A;  5EEH A;  4ESF A;  3F8N A;  2UXN A;  3GW2 A;  3ZMV A;  1WKM A;  2IPQ X;  3MZH A;  1IN8 A;  4HX7 A;  5HOO A;  2LF8 A;  1IW7 F;  3RI4 A;  2HEO A;  1T2K A;  1XD7 A;  3F22 A;  1HW2 A;  1HW1 A;  1Q1H A;  1J2X A;  2YPR A;  1G3W A;  4LB6 B;  1X3U A;  1SD4 A;  5TRD A;  1BI1 A;  3KP7 A;  3K1N A;  1XGS A;  3QPH A;  4N0B A;  3JAM K;  4A0X A;  5BPD A;  2FNA A;  3C18 A;  2QLZ A;  3VOD A;  1OYI A;  3WE2 A;  2H6B A;  4Z2Y A;  2PG4 A;  2HKX A;  4U0V A;  2LSO A;  2QQ9 A;  4HW0 A;  3K69 A;  3GFM A;  4B09 A;  2W25 A;  2XGX A;  4IF4 A;  2LNB A;  4L5I A;  2E1C A;  1SMY F;  5FGM A;  3R61 A;  2DBB A;  4BHP A;  4CGZ A;  3IKT A;  3C7J A;  1ZLJ A;  2FA5 A;  2WC2 A;  2ISZ A;  3BRO A;  2KKO A;  1FZP B;  2P5V A;  4MEY F;  3WG9 A;  2GXB A;  5BS6 A;  1JXS A;  2NS0 A;  2HYF A;  4L9V A;  5FD5 A;  1P4A A;  3IHU A;  1Z05 A;  1IXR C;  5DD4 A;  2M8E A;  2ETH A;  3I53 A;  2Q2E A;  1U5T B;  3O2P E;  3H3Z A;  5JVT A;  2QUF A;  3GFI A;  3J80 K;  3CJN A;  2IA2 A;  3JTH A;  4MEX F;  1FP1 D;  2FQ3 A;  3WGH A;  2HTJ A;  1LDJ A;  2JRT A;  3QAH A;  3KP5 A;  1HSJ A;  3GO5 A;  3RKY A; 
#chains in the Genus database with same CATH topology
 4A93 J;  4AC0 A;  1YW7 A;  2NNN A;  3QYE A;  4M3F A;  4Y3O A;  1JKQ C;  3E6M A;  3OIO A;  1IRG A;  2LR8 A;  3G6E I;  4QSH A;  5CVI A;  1ZAO A;  5H2F C;  1X3Z B;  4Y13 A;  4B1R A;  5A2Q Z;  3BG3 A;  2OZU A;  5FJ8 J;  1K7A A;  2L7F P;  2QQ8 A;  4A3B J;  3OOU A;  4L9N A;  2HYJ A;  1I6H J;  1HKT A;  2BZT A;  1K78 B;  3KEO A;  1S9H A;  4XOR A;  2CU7 A;  2BYV E;  2OAZ A;  3IC7 A;  1APL C;  3T1B A;  2JMW A;  1B4A A;  2NVX J;  4FE4 A;  2V26 A;  1RZ4 A;  1R1U A;  4EMS A;  2Y2Z A;  5BQT A;  3WTU C;  2NVT J;  2H6C A;  2XF7 A;  4UB6 C;  4BHB A;  4ENM A;  1EKE A;  1B9N A;  2M45 A;  4LGW A;  2Z33 A;  5EGO A;  3K4C A;  3Q0U A;  3OYF A;  2XKP A;  2A07 F;  2E2J J;  3C2G A;  2P7V B;  1X58 A;  3HDD A;  4Y17 A;  1U2W A;  3L2C A;  3W6K B;  5GPC A;  3OR1 C;  1ZR2 A;  2W1O A;  2DK5 A;  2DJN A;  1EH8 A;  4EVI A;  3V7S A;  3ZMT A;  4XKC A;  4FQG A;  2M34 A;  3VB2 A;  3S32 A;  4X1E A;  1HQC A;  2FBI A;  2QYO A;  2WV0 A;  3DKX A;  3GZ5 A;  4BAY A;  1X19 A;  2W00 A;  2P5L C;  3RJP A;  2JJ7 A;  1KU2 A;  2K3P A;  2P4W A;  3FXL A;  1W36 D;  1F43 A;  3KE2 A;  3WTZ A;  2RDP A;  1BA5 A;  5FLV A;  5ED4 A;  3OWT A;  2CO5 A;  4RM3 A;  3ZQF A;  4W97 A;  3CME I;  1NK3 P;  2E19 A;  1OLT A;  4I0A A;  3CD6 I;  1JJ6 C;  2BY2 A;  1HF0 A;  3G71 I;  3TO6 A;  4D7N A;  4HDU A;  2I5U A;  5L3G A;  2O7O A;  2KRF A;  2M87 A;  3M8F A;  1Y39 A;  2R5Z B;  3KET A;  1E3O C;  2IGN A;  2F2E A;  4L9J A;  3BQY A;  5KNL A;  4BH9 A;  3JRC A;  1VQ5 I;  2HOT A;  3K70 D;  2DT5 A;  4C3H J;  3CMY A;  2QVO A;  4UUV A;  4OIO F;  4UV8 A;  4AWX B;  1YW8 A;  4B4C A;  2L01 A;  3U21 A;  3MEX A;  3V7R A;  3LMM A;  3OS2 A;  5IYD J;  2QKL B;  2YS9 A;  2EPF A;  4GRI A;  3KLN A;  4L9T A;  2EFN A;  2DFI A;  1QPI A;  1HKS A;  2O8X A;  3MFK A;  2IRF G;  4XON A;  4BE2 A;  3J7A Y;  3JRD A;  3TOA A;  2L54 A;  3JRH A;  4JBA A;  1Z77 A;  4EGZ A;  2L9N A;  2EZK A;  3DLL F;  2OPT A;  4M9S A;  1FYL A;  2DTR A;  1JGS A;  5FRO A;  4A3J J;  3D0S A;  1LFU P;  4LJZ F;  1ZYR F;  2HXO A;  2B63 J;  4U0W A;  1V55 H;  4P5O A;  1ZG1 A;  2QQB A;  1X1B A;  2NS7 A;  2GLO A;  1KQ9 A;  2EH3 A;  3U1D A;  4P1W A;  2JUG A;  2I10 A;  4DBR A;  1A35 A;  1X3W B;  1O4X A;  2ZJR F;  1GHC A;  3V8K A;  5DUI A;  1KON A;  3ZXS A;  4HF2 A;  3L00 A;  3VYR B;  5M3M J;  2JVG A;  5IP9 J;  2QKM B;  1R58 A;  1WJB A;  1TZL A;  3WTV C;  1ON2 A;  2HPM A;  2PJR A;  1U9O A;  2ZFU A;  2HYG D;  1FIA A;  3DTI A;  3OYL A;  1TWA J;  2GOM A;  2V7F A;  4ETS A;  3HG9 A;  1A5J A;  3DFG A;  3SDB A;  4EM1 A;  1Q1V A;  3FM3 A;  2DA1 A;  2X48 A;  1T38 A;  3HSR A;  2M3A A;  5EG0 A;  5B1A H;  2W4S A;  1V54 H;  1FTZ A;  3WTY C;  4CDG A;  4S04 A;  3M9A A;  4PUS A;  1I3Q J;  1LFB A;  3ISP A;  2RKH A;  3GWZ A;  1K4T A;  5E8I A;  4BE0 A;  3AAF A;  2F4O B;  5ILV A;  1WSU A;  3FXO A;  3IP4 B;  3R0J A;  4CUG A;  2IA0 A;  2EFW A;  3S1R J;  2R7F A;  3ZOB A;  2NOG A;  2OQG A;  3REO A;  3RKX A;  1J9I A;  1QQI A;  1BL0 A;  2Z99 A;  2XGC A;  3WG7 H;  3K4N A;  3HPG A;  1WJD A;  3TDU C;  3S93 A;  2R7V A;  1F9N A;  1SVO A;  3VWB A;  1NG7 A;  2VAS A;  4RGX A;  2H94 A;  2VT3 A;  3K2Z A;  1YI2 I;  1I5Z A;  5J6X A;  1TWH J;  1Z3X A;  1Y1W J;  1YW9 A;  3BTI A;  4UVA A;  1ODD A;  5EEG A;  2E60 A;  2HFH A;  4M9X A;  3MMY B;  3VSL A;  2XGD A;  4LD5 A;  1TW2 A;  2L4M A;  2MSY A;  2ME6 A;  1U0J A;  3EQL F;  1OCZ H;  3CP8 A;  5CJ9 A;  4HNU A;  2KDO A;  2IS4 A;  4WWC A;  1LEA A;  4PJL A;  5IT9 K;  1D0X A;  2EIJ H;  1WJC A;  2Q8K A;  2K40 A;  2XRL A;  2HQA A;  5HS7 A;  2P6T A;  2XAU A;  3ABT A;  2KJB A;  4BJ6 C;  4EJW A;  4RB2 C;  1BW5 A;  4XK4 A;  1STZ A;  4MHG A;  4MIM A;  2DK8 A;  5K7H A;  4WK8 F;  5GAE J;  2ISY A;  1V5E A;  4BXU A;  3BCB A;  2LF7 A;  5FB2 A;  2ZME B;  2Y48 A;  3HOX J;  4XKV A;  1ON1 A;  2V6E A;  5EGO B;  2M4K A;  4KA4 A;  2LD5 A;  3WE3 A;  3ZQ7 A;  3AG2 H;  2EZH A;  5B5E C;  5LHI A;  1IGN A;  5JI6 A;  4IPA A;  1V3F A;  5FKN A;  5DDG A;  2BXY A;  2CQQ A;  2GAU A;  3TED A;  2OC6 A;  3S3M A;  2GQQ A;  4C9Y A;  2E1M B;  3BG9 A;  2HNH A;  4CCN A;  5GTI C;  1S7E A;  4GCV A;  4DJA A;  3CDI A;  2IP2 A;  2VQL A;  2FX0 A;  2D5V A;  2MYS A;  4YG2 F;  3OY9 A;  2DLL A;  2FOK A;  3O6B B;  3PNV A;  4EJV A;  1IDZ A;  4G94 A;  4W1U A;  3KX2 A;  4IKF A;  4XR6 A;  1RRJ A;  4AYB A;  3MKZ A;  1MMS A;  1RES A;  2V1X A;  5M5Y J;  3GBG A;  4A3F J;  3S3O A;  1A6I A;  1S3J A;  1F1Z A;  4G8X A;  1D1B A;  4HZF A;  5D4R A;  2JSP A;  2COM A;  3IH4 A;  4BDZ A;  2IEK A;  2MA3 A;  1SFK A;  3HGY A;  2OCE A;  4KIB A;  1Z9C A;  4XLF A;  1PYV A;  2F4M B;  4DNC A;  2E2I J;  1YIJ I;  2FD5 A;  2OF7 A;  3DPT A;  4M3E A;  4Y15 A;  2QGU A;  3F6V A;  1OFC X;  4IEJ A;  2E35 A;  4ZYE A;  3M07 A;  4H0E A;  5TGT A;  2HVS A;  2A5W A;  5E3O A;  1RET A;  2WWY A;  4HF1 A;  4Y4R A;  5GTH C;  2DMN A;  1AA7 A;  1OCP A;  2F5F A;  1YO5 C;  4C2U A;  2R93 J;  3VYU B;  2K9Q A;  4KT5 C;  3PIP F;  1IO2 A;  3I56 I;  4YIF A;  5KHD A;  5FKL A;  3DXJ F;  2DN0 A;  1YIO A;  2LKS A;  1P6R A;  4DIQ A;  2M2E A;  3RTR A;  4RGU A;  1H9G A;  1OIS A;  5F1R A;  3M1E A;  1TWG J;  3Q0V A;  3CDH A;  4OIR F;  4D1Q A;  3OIP A;  1T56 A;  3CUO A;  5C3E J;  3DWL E;  3SXY A;  3K6G A;  3CCR I;  2RVC A;  4I99 C;  2Y30 A;  1MBE A;  1XMK A;  1ZG3 A;  2X6W A;  3FXK A;  1IRF A;  4CIC A;  5ICC A;  2MAB A;  4XOP A;  4F7Z A;  3IAS 2;  4ESB A;  4IO9 F;  4YIR X;  1FNN A;  4DZP A;  1WJE A;  1Z91 A;  2GZW A;  3FK7 A;  5FRM A;  3SEZ A;  3CUQ C;  1MMG A;  2CUZ A;  5HVQ C;  4XOT A;  2K9N A;  4FIS A;  4D9J A;  4UB8 C;  1U5T A;  4U7D A;  4A12 A;  1QA6 A;  1FLI A;  1VQ8 I;  4LIV A;  1TL8 A;  2BVM A;  5IYB J;  3CCE I;  5LGU A;  3CCV I;  1ZH5 A;  4B44 A;  5GAD J;  2ZFW A;  2EIK H;  2ZJQ F;  5HS9 A;  4R1H A;  1FOX A;  3RPQ A;  1PUF B;  2BY1 A;  3B6C A;  3HKZ N;  4GYG A;  2H1L A;  4ESJ A;  1RR8 C;  2CJJ A;  3GUD A;  2HOS A;  5IYC J;  3GXO A;  5FFZ A;  5D8K B;  4CZC A;  2M0C A;  2A05 A;  1R71 A;  3FHZ A;  4Q48 A;  3L1P A;  4WXD A;  2BY3 A;  3DU6 A;  1I6X A;  1Y0N A;  1OPC A;  2W24 A;  5LRR A;  2A6H F;  1T98 A;  3DEE A;  1QZZ A;  4RGR A;  5CLS A;  3HUG B;  3ASN H;  2E1N A;  2CWE A;  3I64 A;  1TWF J;  2BHZ A;  5HLG A;  1FSE A;  3F21 A;  2XIG A;  4E6K G;  9ANT A;  1WCM J;  2JVH A;  1R22 A;  2FOW A;  4LG3 A;  4KMF A;  3WOD F;  3OSG A;  2XAF A;  2DQR A;  4N4N B;  1MW7 A;  3H92 A;  2Y9Z A;  3O3K A;  2H09 A;  5A2Q K;  1S7A A;  2CW0 F;  1EA3 A;  2PMU A;  3MQ0 A;  3RPU A;  3ULQ B;  3LAP A;  1HDD C;  1SFU A;  4G7Z F;  3U9G A;  3WU2 C;  2JSC A;  4F55 A;  1IC8 A;  4JX4 A;  2F5C A;  2KHM A;  1TBX A;  3TOB A;  4FX4 A;  2H1K A;  1MJB A;  1Y8R B;  3B02 A;  2UV1 A;  4BS9 A;  3CCU I;  5J3L A;  2KL4 A;  4XLA A;  3WHC A;  2L9V A;  2XVC A;  4A5N A;  4AUX A;  2O5R A;  4DYR A;  3L2W A;  3MWM A;  5BOX A;  1MSF C;  1U78 A;  3MD2 A;  3S2D J;  1SVL A;  3MKY B;  1DPR A;  1WI9 A;  2JQ7 A;  3S14 J;  2J5O A;  5HDG A;  3RYP A;  2W7N A;  3VDX A;  3G1M A;  2A5Y B;  3O8H A;  4MTD A;  4OIN F;  4A3E J;  2XKO A;  5K5O A;  4HRI A;  4L0Y B;  1QRY A;  4P55 A;  3RDI A;  1ETQ A;  3ZQH A;  1UG2 A;  3A01 A;  2D45 A;  1OJL A;  1G59 A;  2EIN H;  3EET A;  1B8I B;  4G6T B;  1S8N A;  1QZE A;  5F04 A;  3BPX A;  3QQA A;  2DCE A;  1F4K A;  1GLN A;  1LVA A;  3E0J B;  1FMW A;  5DV5 A;  5IOZ A;  3KEY A;  3MCZ A;  1LB2 A;  4EJO A;  1KU9 A;  2R5Z A;  5L3D A;  3BR5 A;  3GTP J;  2FJ1 A;  3LSI A;  1XX5 A;  1JE8 A;  2AQE A;  1MGT A;  1IF1 A;  3RYR A;  2BE5 F;  2DFF A;  4A3L J;  1EJ9 A;  3BR1 A;  3CMM A;  4AIK A;  2KIF A;  2ME0 A;  2V1D A;  4EV0 A;  2VXZ A;  1KGS A;  1QO0 D;  2DAO A;  3LFU A;  1VQ6 I;  3RZO J;  4LIU A;  3PUF A;  1R5H A;  4RM2 A;  3H36 A;  3GFJ A;  3PFY A;  2ZJ2 A;  4BXX J;  4HYE A;  1TP4 A;  2X0L A;  3K1M A;  5E17 F;  2WAQ A;  1FBU A;  1Z1D A;  2F48 A;  2G9W A;  1SD6 A;  1KQ0 A;  5D5X B;  5IPA A;  5K5Q A;  3X2Q H;  4D5F A;  3U2R A;  2QSF X;  2JTV A;  2X85 A;  2XAJ A;  3K2A A;  2KIM A;  1ZGW A;  4IHY A;  4PSX A;  4RS8 A;  2LH9 A;  2VKD A;  4C30 A;  4A5M A;  3ZN0 A;  2MD0 A;  3GTG J;  3I4N J;  3BPV A;  2VUM J;  3PQJ A;  3CP2 A;  1SC7 A;  1S5L C;  3CC2 I;  3LSJ A;  1QZY A;  1T8I A;  1AOY A;  1ETY A;  2E5Z A;  3C2B A;  1O7F A;  3HIF A;  4U88 A;  4PGG A;  5D5W B;  3RKW A;  1JUS A;  2RGV A;  4E70 A;  3QRF F;  2VB6 A;  1DU0 A;  3FMS A;  2DMU A;  3TL4 X;  1TT0 A;  4ZZL A;  1YJN I;  2XAS A;  2L7M P;  1LDK B;  2KZG A;  5JLX A;  5DM7 F;  2B7E A;  4KT6 A;  2GA1 A;  3DEW A;  4NDL A;  4WX9 A;  3I9V 2;  1FPQ A;  3MKL A;  2KT0 A;  2R5Y B;  1WQ2 A;  3N4M A;  3OR2 C;  2FQ4 A;  1LEB A;  3IRR A;  3WGI A;  3J81 Z;  4F52 A;  1XB4 A;  2QEN A;  3ML6 A;  1F5T A;  3OMY A;  3IRQ A;  4LLG F;  1FBS A;  1ZLK A;  2MH9 A;  3F0C A;  1MMN A;  1R4N B;  3QU6 A;  3H9J A;  4RGS A;  2WA0 A;  2P6S A;  4FHT A;  1SFE A;  3T8T A;  1W36 C;  1PP7 U;  1T39 A;  5LGN A;  2O61 A;  2AXT C;  2OCC H;  3CJT B;  4KMU X;  4E7H A;  1W5T A;  2L9R A;  4ZC3 A;  4AIJ A;  4PCQ A;  3TW7 A;  2NVU B;  1U9N A;  1YS7 A;  1KU7 A;  4I02 A;  3TGN A;  3MAJ A;  4XRS A;  4PFP A;  2DXI A;  4L0Z B;  2CGP A;  1L0O C;  2XDV A;  1V5G A;  1JKO C;  4BDY A;  2A3S A;  2V9V A;  2V1U A;  2DW4 A;  4CO8 A;  2X1C A;  3C2H A;  4DYC A;  1IAW A;  1Y56 A;  3OSF A;  3FHN A;  3TO9 A;  2VT2 A;  2X51 A;  4HQM A;  5E1X A;  4FT8 A;  3ELK A;  1OCC H;  4RMN A;  3VFZ A;  3MZ8 A;  3HEF A;  3K70 C;  1CQT A;  2UWM A;  4EQQ A;  1IZ1 A;  3A02 A;  3N05 A;  1DGW Y;  4YII A;  1HBX G;  2EA2 A;  4M3D A;  1ZGJ A;  3GFL A;  2L5Q A;  6PAX A;  2KQR A;  1UJ8 A;  4LK0 F;  4CZZ A;  2QBY B;  3DEU A;  2B0L A;  5C4J J;  3GTO J;  4RBO A;  1T33 A;  1JJ8 C;  4G6D A;  3I59 B;  4B48 A;  1YG2 A;  1MND A;  2CYY A;  3OL3 A;  4HDV A;  1UCR A;  1HKQ A;  1U6G A;  3QYF A;  3H35 A;  1DDN A;  3BZC A;  1L3L A;  2B9S A;  1LE8 B;  4I2O A;  2EIM H;  1BJZ A;  2VXD A;  5L3C A;  3CLO A;  5GPA A;  3PO2 J;  4KNY A;  2L0K A;  2WAE A;  3BWG A;  1FTT A;  2ZME A;  3CJR B;  5GP9 A;  3L2R A;  3CCQ I;  2LG4 A;  4BQA A;  3GZN B;  4PJN A;  1XSD A;  3K1P A;  2OQR A;  1XDU A;  4GO1 A;  2XRO A;  2BGC A;  5H6Q A;  2LKP A;  2HOE A;  2E7X A;  2HKO A;  2R7S A;  2VC1 A;  4O5V A;  2VJ5 A;  2VOD A;  3V7C A;  1TW3 A;  4IRH A;  5B66 C;  3C3W A;  3R4K A;  1O7L A;  1R6R A;  1VZ0 A;  2ESH A;  1ZAR A;  4Q5S F;  4QPQ A;  3DPU A;  3ZGK A;  3L9F A;  3H0D A;  2HDC A;  2VQH A;  3KIO A;  3LQR A;  3FBI B;  3SJM A;  3KYC B;  3GLL A;  1MJA A;  1SMT A;  3RZD J;  2LDU A;  3A01 B;  5CYV A;  2MC3 A;  3BZ6 A;  3S8P A;  1TNT A;  2LRD A;  1T0F A;  3D1N I;  1VQ9 I;  1A6Q A;  2TCT A;  3LA2 A;  1FC3 A;  1HST A;  1JT6 A;  2IBD A;  2N8G A;  4M3B A;  4AYB N;  4GFB A;  3PFI A;  4M74 A;  1K79 A;  1XDS A;  3TP3 A;  4DQ2 A;  5LLQ A;  1BI3 A;  4HV6 A;  4WCG A;  2XPU A;  3BJ6 A;  2PBI A;  4ZZD A;  2FNP A;  2VKH A;  2Y31 A;  1WZ2 A;  5D6E A;  3EYY A;  2VE9 A;  3OS1 A;  1LQ1 A;  4PGH A;  3CCS I;  3S2H J;  3ZQG A;  2YU9 J;  5B3S H;  4BAC A;  2HWV A;  2ACJ A;  2BXZ A;  3ECH A;  2KRC A;  2WV1 A;  2PMZ A;  2GBY A;  3MKW B;  2JPB A;  5AIQ A;  3V8L A;  2LOO A;  1ETW A;  5EDN A;  4WXH A;  3CF2 A;  3S1Q J;  4EM0 B;  4KIS A;  1UST A;  3HHG A;  4CA0 A;  2EFQ A;  1K6O A;  5JFR A;  5LHG A;  4XID A;  1G3Y A;  1LPQ A;  2R7R A;  3Q3S A;  2DYS H;  1W7P B;  2M4G A;  2HDD A;  2STT A;  3GZ6 A;  1TTY A;  2HVQ A;  5B1B H;  2LLK A;  3JRF A;  1O3T A;  2EK5 A;  4XL9 A;  2EV6 A;  3LSK A;  1BI2 A;  3GEZ A;  1ZRD A;  4HSR A;  4ZDO A;  3P9K A;  3CTA A;  2GXA A;  1R49 A;  1P7I A;  1ENH A;  5D5V B;  3HC7 A;  1WWX A;  3CCL I;  4CCK A;  3KP2 A;  2KFD A;  2QF7 A;  5E20 A;  5HLH A;  1CF7 B;  3UR3 C;  4L18 B;  1SEU A;  1R7J A;  1GVJ A;  1G6N A;  2UUZ A;  3CC4 I;  2EV0 A;  5J1Y A;  3E6D A;  4OIQ F;  1HXD A;  3ESW B;  4XIC A;  5FO5 A;  2FBH A;  3DTE A;  5M5X J;  5KK1 A;  2VBY A;  3IUO A;  2MBF A;  1TQP A;  2VI6 A;  3SFZ A;  5E3N A;  1FX7 A;  1PUF A;  4K2E A;  3H1C A;  3BT9 A;  2DA5 A;  2TDX A;  5CQG A;  1DU6 A;  2LFB A;  1ONV A;  1BM9 A;  3IWF A;  3M4O J;  4LOC A;  3TMO A;  1R4M B;  3RQ4 A;  3PL8 A;  1O3R A;  5CVR A;  4QWQ A;  5ICF A;  1MDM A;  3TKY A;  3HRT A;  2DDB A;  1D3Y A;  3LL7 A;  4I01 A;  4RAG A;  5BMZ A;  2PJP A;  2LKX A;  2XAG A;  2KJC A;  1X1C A;  2LYC A;  4I7H A;  4XMY A;  1JT0 A;  3T0Y A;  2ZSH B;  3RIR A;  3QPS A;  3ZP5 A;  4NNJ A;  3HUG A;  3E97 A;  3JTG A;  3BZK A;  1XMA A;  2EA4 A;  1R00 A;  5AIP A;  1Z6T A;  4R79 A;  2R92 J;  4UVB A;  1TLH B;  2RAE A;  5FKK A;  2CFO A;  3N97 A;  5ERI A;  2LVS A;  3JW4 A;  3LOC A;  4B3A A;  2CFX A;  5DCF A;  4EAT A;  1GXP A;  3KLO A;  3F8M A;  3EUH C;  3FM5 A;  1REP C;  2XPW A;  5JLW A;  2PEX A;  1ZRE A;  3K4M A;  4OAY A;  3NQO A;  2ZXW H;  2FBK A;  4I6Z A;  3NWT A;  4RB1 A;  5EZH A;  5J47 A;  3IWZ A;  3NAR A;  1N75 A;  2IGO A;  1EF4 A;  1G2H A;  1JTY A;  2A68 F;  4N4O B;  5LGT A;  1XS9 A;  2LY1 A;  1GV5 A;  4HX8 A;  2X6Y A;  4RB3 C;  2ID6 A;  3FXU A;  4LG0 A;  1R23 A;  2QA4 I;  1RI7 A;  4JX5 A;  2RQQ A;  2P7C B;  1B72 B;  2JPC A;  3NEU A;  2P8T A;  4JP0 A;  2PLY A;  2UZK A;  3G3Z A;  5TIS C;  3K4B A;  5FKO A;  1HDP A;  4LB5 A;  2VBZ A;  2R3S A;  2DPU A;  3FX3 A;  1PP8 F;  2AO9 A;  4XKW A;  1IG7 A;  4GGG A;  1FBQ A;  1DGR M;  1MJ9 A;  1WFX A;  4IJA A;  4P96 A;  4BBR J;  3IH2 A;  4RA2 A;  3GTK J;  1RPW A;  1YQA A;  3AKZ A;  3QPL A;  1JHH A;  4MNU A;  3HBL A;  5TJJ A;  4Y7N J;  3JRE A;  1YE9 A;  1B8I A;  3H9G A;  3FZV A;  4D5C A;  4A2U A;  4IXA A;  2Y75 A;  4XSX F;  1FEX A;  4HEA 2;  5F1J A;  4ON0 A;  1J75 A;  1OR7 A;  1HW5 A;  1DP3 A;  2IT0 A;  2IJL A;  1XGO A;  1OCO H;  3ABM H;  1ZK8 A;  5IOY A;  5JR3 A;  3PQK A;  1U5T C;  1A36 A;  3RSN A;  2VJJ A;  4KIG A;  2FMY A;  3HOV J;  1Z6R A;  4GXO A;  2LRE A;  4I76 A;  2E71 A;  3M8E A;  1O57 A;  2K02 A;  5EZG A;  3SQN A;  2XSJ C;  3TDZ C;  2JZY A;  3EDP A;  3L2U A;  3J7A O;  4O3M A;  3VEP A;  2HZD A;  3GYH X;  5KCM A;  4CCO A;  3QP5 A;  2QSH X;  5F08 A;  2O6G E;  1S72 I;  1X4O A;  1HC8 A;  3FXR A;  1QVT A;  3BP8 A;  3LSP A;  4ITV A;  1T95 A;  5K7Z A;  5D4S A;  2W82 A;  1BW6 A;  1J0R A;  2A6E F;  4XN0 A;  3M3Y J;  2DT6 A;  4A69 C;  3S3N A;  3LWF A;  2H8R A;  1T08 B;  5L3E A;  5E8G A;  4X0G A;  2WAQ N;  1JKP C;  5JVG F;  3K4L A;  4IHX A;  1Y8Q B;  2VJI A;  4L5E A;  5H20 A;  4A3M J;  2Z5U A;  4HA8 A;  1MMA A;  1YS6 A;  2LK2 A;  1E3P A;  2IA1 A;  2QQA A;  4YRV A;  3MN2 A;  1ETX A;  4L5J A;  4H4K C;  3FKI J;  2MLG A;  2K9M A;  3J7Y J;  3KYL A;  1SAU A;  5D6F A;  1RUO A;  3DBH B;  1BBY A;  2F5E A;  3BG7 A;  4G6Q A;  3NRV A;  3KFW X;  2E5N A;  3O8G A;  2XAQ A;  1X1A A;  2WB1 A;  4J01 A;  2WTE A;  2KDZ A;  3W2A A;  2R5Y A;  3LQQ A;  2AHQ A;  3F3X A;  2DI3 A;  3RKQ A;  1YX5 A;  3Q5F A;  4ENJ A;  1XSX A;  2JT1 A;  1E0E A;  4ZJZ A;  2AS5 F;  3KPH A;  5LBQ A;  3I4M J;  1S6L A;  2L4A A;  4KYW A;  2A6T A;  2E7W A;  1P4X A;  3SZG A;  5HNH A;  3COA C;  2D2W A;  5FLX Z;  5C4X J;  2G0E A;  1ACI A;  1IJW C;  3S15 J;  1IRX A;  2MGQ A;  4RLF A;  2JK3 A;  3J81 K;  2VQG A;  3W6J B;  4E4H A;  2MC4 A;  3PSF A;  5CVV A;  1CGP A;  3FXQ A;  4DW6 A;  1QBJ A;  4E7J A;  4S05 A;  4F93 B;  5J4Y A;  1FOW A;  5DD8 A;  2IGM A;  1XCB A;  4XM3 A;  1YX3 A;  5F27 A;  3KP4 A;  4DOZ A;  2C6Y A;  3GF2 A;  1ZQ3 P;  3K0L A;  3ZQC A;  4BJ5 C;  3IL2 A;  2ID3 A;  2FE3 A;  1B6A A;  3B73 A;  4A6D A;  1IUY A;  2XB5 A;  3F8F A;  3G2B A;  2JA6 J;  1YFH A;  2DA3 A;  4N9I A;  3IKV A;  2WY7 Q;  5E18 F;  1KU3 A;  3I0T A;  1H9T A;  1MDM B;  4M6X A;  4B8X A;  2DU9 A;  1VQM I;  3QP6 A;  3QYB A;  4II2 A;  3BJA A;  4KIC A;  3ZRG A;  4C2M J;  3TBI A;  1VI0 A;  4ZYG A;  2ICW G;  2OBP A;  3LSH A;  2O3F A;  3ZQL A;  3GLX A;  2CW8 A;  2K27 A;  1RNL A;  2ZBK A;  1P2F A;  2HTS A;  2DA4 A;  2QBY A;  3HB9 A;  2IS1 A;  2FF4 A;  1E2X A;  2FEZ A;  3OL4 A;  3ZMD A;  4IZZ A;  3EUA A;  1D8K A;  3F8B A;  1O3S A;  3M7G A;  3I59 A;  2NAZ A;  3F23 A;  2CMP A;  1N77 A;  1MBH A;  1JI8 A;  5DCM A;  3HL2 A;  5LHH A;  4KIF A;  3W2W A;  2EB7 A;  4KN4 X;  1LE8 A;  2EFP A;  4BYY A;  1XMX A;  2M9H A;  5L3B A;  4ABZ A;  3VYS B;  3A1Y A;  3E5U A;  3J7Z I;  5F6F A;  1IN7 A;  4NQW B;  1I1G A;  1C0W A;  2WAD A;  3BTL A;  4AU7 A;  5D5U B;  4UUS B;  1ZR4 A;  4D0P A;  3BQZ A;  3RPU D;  1YHQ I;  2KZV A;  1W5S A;  1ERD A;  4BQQ A;  4A3K J;  2EBI A;  3FXM A;  2HGC A;  3BDD A;  4OAZ A;  3V4G A;  4BQN A;  3G1O A;  4RLQ A;  2DYR H;  4EM2 A;  3E1S A;  3WTW C;  4M73 A;  4LG0 B;  3BG5 A;  1TC3 C;  1JHF A;  2R7D A;  2XRN A;  3WTS C;  2K7L A;  3WU1 B;  2XC7 A;  3CO7 C;  1VQL I;  2W84 A;  4P9F A;  2VE8 A;  1AWC A;  1Y1V J;  2F5V A;  4C3I J;  1QPM A;  1J5Y A;  4UVC A;  2EWN A;  3U1K A;  3KP3 A;  2DMQ A;  3DLA A;  3WTX C;  4OMY A;  3LNQ A;  3KZZ A;  4HG2 A;  2NVY J;  1UAA A;  2DTZ A;  4ZH4 F;  3FF5 A;  2XB0 X;  2LY2 A;  3QU3 A;  1NK2 P;  3AL0 B;  2BEO A;  2Y0S A;  2PX9 A;  3D5R C;  2XF5 A;  4Q4Z F;  1B1B A;  3QOD A;  2PN6 A;  1NG6 A;  3BC8 A;  4M71 A;  4P9U A;  3H5R A;  2R0Q C;  3HRU A;  3C1D A;  2PI0 A;  2J5P A;  4BHC A;  1ZHF A;  3F8C A;  5FLM J;  1V5F A;  4XRM A;  4XLP F;  2R7W A;  2ZSI B;  1I27 A;  2ZCW A;  4DGW B;  2R7X A;  2CQK A;  2HI3 A;  1R9T J;  4BQO A;  3GVA A;  2PFB A;  3MVP A;  3PIO F;  4CCL A;  1YRN A;  5FFX A;  2VBX A;  2GWR A;  3I71 A;  3OOP A;  2R7Z J;  4G12 A;  4MLO A;  1SFX A;  1IN4 A;  1RIO H;  5CVU A;  1W4M A;  1FJL A;  4BKX A;  2PMZ N;  3CDL A;  3FMR A;  5HDN A;  4IX7 A;  2XGE A;  5F0C A;  2XV4 S;  3L2V A;  3FMQ A;  2DJI A;  2EFO A;  2X1D A;  3B6A A;  3L09 A;  4XRF A;  1W7P A;  1LDD A;  3KYD B;  3K4J A;  4NC8 A;  3UKG A;  4OOI A;  5ILS A;  1UHM A;  2LMD A;  3BR3 A;  3CF5 F;  2HQR A;  1DP7 P;  2QSG X;  1KZH A;  2Z3Y A;  2A61 A;  2M1B A;  2O03 A;  1W7P D;  3KZY A;  4BE1 A;  4II3 A;  1BI0 A;  3CQZ J;  3BTJ A;  4DZJ A;  2E1O A;  2LC2 A;  1JGG A;  1X2N A;  2VBW A;  3BLY A;  2OTL I;  1U8B A;  1FMV A;  4ASN A;  2ZME C;  3OYH A;  1CF7 A;  4C3J J;  1TQM A;  2FUG 2;  1H8A C;  2JA7 J;  4MQV A;  1NH3 A;  3FDY A;  1D5Y A;  2QM3 A;  3E5Q A;  2IVM A;  2GXG A;  4FX0 A;  1WI3 A;  2WBM A;  4IHW A;  4QPO A;  1AKH B;  2EZL A;  2HXI A;  1WH7 A;  4BBS J;  1U8R A;  3I5U A;  2K9S A;  1IN5 A;  3QWL A;  2E1M C;  1EH6 A;  2V9K A;  3E7L A;  5J40 A;  2ZNY A;  5LEK A;  3W2V A;  4HOB A;  1BIB A;  4YEL A;  1FOK A;  2IS6 A;  4BNC A;  4OU0 A;  3DF8 A;  1MNE A;  4MO7 A;  5EEA A;  2DOA A;  2E36 A;  2VOO A;  2ECB A;  2DFH A;  2OA4 A;  1WJF A;  1KQ8 A;  2HU9 A;  2JN6 A;  1P9Q C;  4HBL A;  2OD5 A;  2YU3 A;  3SEQ A;  3KZI C;  1XGN A;  5AON A;  3DTK A;  4EJT A;  5LRS A;  4MQ9 F;  3V42 A;  4AID A;  2FML A;  1MH3 A;  4GYI A;  3VSK A;  2NS8 A;  3Q9S A;  1IN6 A;  1N25 A;  1S29 A;  4ZYD A;  3I54 A;  4AD9 A;  1R1T A;  3IV5 A;  2W57 A;  1VQ4 I;  5H6R A;  5ILU A;  5F0F A;  4MFD A;  2PMH A;  4XNF A;  4FAS D;  2HPI A;  2HVR A;  1K6Y A;  1KYZ A;  1G3T A;  3FIW A;  2ESN A;  3DCF A;  1PDN C;  1AHD P;  1B59 A;  3H9Q A;  3DP7 A;  5DCM B;  4CH7 A;  1XGM A;  3E6B A;  2P5K A;  5DEQ A;  3HTS B;  2HS5 A;  2AQF A;  1V4R A;  4HX4 A;  2KIU A;  3ZPL A;  2V6C A;  2W48 A;  1OMI A;  4RB0 A;  5BNG A;  4YFX F;  2DT7 B;  1GVD A;  2GOX B;  2Y0M A;  3DBL B;  4NHJ A;  1OKR A;  1ZEL A;  3S16 J;  3OYI A;  4IHS A;  5KAF C;  1B72 A;  2BW3 B;  2OTJ I;  2P81 A;  4XLE A;  2YX7 A;  3FBN B;  3WU0 A;  3ZN1 A;  2EJR A;  3KCC A;  2PQ8 A;  1BIA A;  3GTJ J;  4I09 A;  1BN5 A;  4WF2 A;  5HNF A;  3E5X A;  2WAF A;  1W0T A;  4EJU A;  3CJQ B;  2D1H A;  5LEJ A;  4LLN A;  3P9I A;  2L7Z A;  2MG4 A;  1RC9 A;  2RRE A;  4XN3 A;  2JRM A;  1Z3Y A;  5D8L B;  1OCR H;  3OYE A;  3FWE A;  3JRG A;  3ERE D;  1P4W A;  3BG6 A;  3CMA I;  4A3C J;  2BVL A;  4PJJ A;  3CC7 I;  4FCY A;  1A04 A;  2OZ6 A;  3EUK L;  3GTQ J;  1SD5 A;  3ECO A;  1VQN I;  3CUQ B;  1XSV A;  2GM4 A;  3A03 A;  5BPI A;  2IW5 A;  3IH3 A;  3CES A;  2NVQ J;  4J00 A;  1ZGA A;  5ICE A;  3JSP A;  4YEJ A;  1K4S A;  4JQF A;  3K10 A;  1MBK A;  4V2F A;  5E1Z B;  2LBF A;  1Z67 A;  1Z0X A;  4HLY A;  3E6C C;  4UY8 I;  2OUM A;  4E7L A;  1R36 A;  3D5L A;  4U0Y A;  2R7O A;  3BR0 A;  5J8F A;  1Z21 A;  1QHG A;  3T8R A;  4KIT B;  4BU2 A;  1YLF A;  2K3F A;  3LA7 A;  1Z7U A;  3LSG A;  4AM3 A;  3A4C A;  3BOQ A;  2M5W A;  1UZC A;  2NYX A;  3ONQ A;  3JAM Z;  4MTE A;  3EPZ A;  2OJE D;  1R5G A;  2L3D A;  5C44 J;  1YRN B;  3P9C A;  5E3M A;  3HOZ J;  3NAU A;  3SZT A;  1PJR A;  2MLK A;  3JCU C;  5J1U A;  3R0A A;  2CV0 A;  1I39 A;  2Q1Z B;  3LAJ A;  2ZXJ A;  4HF0 A;  3ZQQ A;  1ZG5 A;  2RQP A;  1RKT A;  2FSW A;  3ROU A;  3HOS A;  2DFE A;  3HPH A;  1JUP A;  3ZMU A;  4BEH B;  2EV5 A;  2VOP A;  2MW8 A;  1D5V A;  2CUF A;  3TQN A;  1WGX A;  3PSI A;  1P92 A;  3OYM A;  1YJW I;  2DA2 A;  3WTT C;  3L7W A;  5FD6 A;  1FT9 A;  1FSH A;  1IXS B;  2VIX A;  2FXA A;  3MZY A;  2Z1D A;  4CYC B;  1XTA A;  1IXC A;  1I1S A;  4UV9 A;  2CRG A;  5JHU A;  4RAF A;  5EYR A;  2DOE A;  4M72 A;  2I8D A;  1PUE E;  3GTL J;  4QTR A;  1QVU A;  2WB1 N;  4CYD A;  1SAX A;  3H5N A;  4PZJ A;  4UXN A;  5L3F A;  1E3H A;  1R5I D;  1FIP A;  2GIV A;  1XN7 A;  2CQN A;  3HSE A;  1UB9 A;  4HAM A;  3L2Q A;  2X9D A;  4I0B A;  4JYK A;  4LK1 F;  4IRI A;  2HOA A;  2QZ8 A;  4GDF A;  4QLC U;  1ITY A;  2EIL H;  4ZYH A;  3VOE A;  1X4P A;  1Z7L A;  1Y0U A;  1WRJ A;  5IP7 J;  2R7Q A;  1RR7 A;  3ZMS A;  4I98 B;  2COB A;  2ELH A;  5FLX K;  1BJA A;  3G73 A;  4TV7 A;  3OYB A;  4A0Z A;  3J80 Z;  1J59 A;  2MFZ A;  1UG0 A;  4RDU A;  3AL0 C;  4G9Y A;  1OR7 C;  1POG A;  2UXX A;  2DOD A;  4ENK A;  2JA5 J;  4YFK F;  2ZKZ A;  2IS2 A;  3SZP A;  1E17 A;  3JRI A;  1UHS A;  2BY0 A;  2O0Y A;  1MKM A;  4ZTF A;  4ZYA A;  1OQY A;  2O8K A;  2HZT A;  4HQE A;  4KN7 X;  2Q2E B;  3M1C A;  3T5X A;  1BOA A;  5DUK A;  3DV8 A;  2Y69 H;  3QOE A;  3QPT A;  2ELJ A;  2KP6 A;  1FYK A;  3SDG A;  4X6A J;  4RAY A;  2HR3 A;  4BGD A;  3TO7 A;  2QEX I;  3SFI A;  1IUF A;  2R4G A;  3PUB A;  1B9M A;  1WVR A;  1ORK A;  2VN2 A;  4OWR B;  1G4D A;  3HRS A;  1GDT A;  4KDP A;  4NQW A;  2BBY A;  3DPL C;  1DPU A;  1MZB A;  2VKE A;  1BC8 C;  1HA8 A;  4UUS A;  1T6S A;  4IVN A;  2BOL A;  4ANJ A;  2KPM A;  2RNG A;  3HTU A;  3I55 I;  1HOM A;  5K5R A;  1XCV A;  1FWZ A;  3S1M J;  4JX6 A;  1IV6 A;  3K7A J;  2X1E A;  2KMU A;  4XRS G;  4BJT A;  4QIW N;  2D1V A;  1VQK I;  2L02 A;  4HNT A;  4IHT A;  1H88 C;  2KIS A;  4OMZ A;  4Y52 J;  1K83 J;  3SHF A;  4IQ4 A;  1D0Z A;  1SAN A;  4BUP A;  4Z6Y A;  3GTM J;  3TP0 A;  1ETV A;  4KUM A;  2VKV A;  4LMY A;  1UHW A;  4F3Q A;  2VON A;  1MBG A;  2Q0O A;  2LY9 A;  3QOP A;  2Z9O A;  3ZMZ A;  1G8X A;  4ENN A;  4G7O F;  3ABL H;  1K61 A;  1QU3 A;  3UNG C;  2BHY A;  3H0G J;  4IOC F;  3ZR8 X;  3FK6 A;  1GXQ A;  2RC4 A;  2VQC A;  2TRT A;  2NXN B;  3F9K A;  3M8J A;  3PNY A;  2W85 A;  4E7K A;  2K4J A;  1F36 A;  3A0H C;  4U7B A;  3CCY A;  2ZNZ A;  5K7F A;  2FRH A;  2Y0S N;  3R6S A;  2DMT A;  2VL8 A;  1OYY A;  1X1D A;  1ULY A;  2RN7 A;  2VLA A;  3P7N A;  1ZTR A;  4MFE A;  3TW6 A;  4LLL A;  1IV8 A;  2LBF B;  4PJM A;  3BR6 A;  4PSW A;  2STW A;  4A0Y A;  3LFK A;  4XSZ F;  3JR9 A;  2H27 A;  5F0H A;  3F6O A;  3V8J A;  3RQI A;  3BY6 A;  1RUN A;  1RKW A;  1W1W E;  2CSO A;  1D1A A;  2GIZ A;  3KEQ A;  1H0M A;  2HQN A;  1LJ9 A;  3HGG A;  1FP2 A;  4UNO A;  1G3S A;  3Q9V A;  2K4B A;  5DS9 A;  5HLI A;  4D7M A;  2JWT A;  1H89 C;  2X6O A;  4R8H A;  4UUT A;  5J4V A;  2YR2 A;  3JSO A;  2AXL A;  3K4K A;  5CVJ A;  1D0Y A;  4WXC A;  2KIQ A;  1EV7 A;  1TQI A;  3HOT A;  4M6Y A;  1O3Q A;  3HHH A;  4A3D J;  2KLO A;  3EUH A;  4NUB A;  2G7H A;  5E79 C;  2DQL A;  2XUB A;  1LNW A;  1MD0 A;  3ABU A;  5EF6 A;  1VQ7 I;  1MBJ A;  1XC5 A;  2NNY A;  4EEF G;  3S17 J;  2CQ7 A;  1OCT C;  3HSF A;  4CSW A;  1VQP I;  3ASO H;  3HRM A;  4M3G A;  1ZKG A;  1D1C A;  1J7K A;  3CLQ A;  2YSR A;  2CG4 A;  3I58 A;  3LST A;  4MGR A;  4XBF A;  4DYQ A;  2NRA C;  5LD2 C;  4DBQ A;  2K85 A;  1N78 A;  4AIH A;  2ELK A;  4XLH A;  2BV6 A;  2XPV A;  3A0B C;  1LKX A;  1ETK A;  2F5D A;  4J19 A;  2G7U A;  1AKH A;  4RAZ A;  3OYK A;  3HZJ A;  4YFN F;  1WPK A;  1I3A A;  4JK1 X;  3ABK H;  2GA2 A;  2DA7 A;  3EYI A;  2DDA A;  3PM1 A;  1HCR A;  3VYT B;  1MNM C;  2Y9Y A;  1GV2 A;  1BC7 C;  4IQJ A;  1KA8 A;  2LP0 A;  5F64 A;  1QHH D;  2VPL A;  1W5C C;  3D5S C;  2CW7 A;  3AG3 H;  1A31 A;  1U3E M;  4XKB A;  3DQV C;  1ZRF A;  1TNS A;  3IAM 2;  1BOB A;  4E7Z A;  4UHT A;  4OIP F;  1USS A;  3OYN A;  3HM5 A;  2RV8 A;  2VC0 A;  5E1W A;  2CS3 A;  2X6X A;  2X4H A;  3BJO A;  4PJ0 C;  1J09 A;  2F4I A;  2H8W A;  4NB5 A;  1VQO I;  3GX4 X;  1S7O A;  4A6E A;  1R1V A;  4V19 K;  4HV5 A;  2XHK A;  1ZN2 A;  2MH2 A;  5FKM A;  3W3C A;  3S2W A;  5K1Y A;  1GUU A;  5GAG J;  5ICG A;  3K9T A;  4BL0 B;  3H5A A;  2PJR B;  2XSD C;  3OYA A;  2O9L A;  1X2M A;  3ERM A;  2A69 F;  2M0M A;  3BTC A;  1YTY A;  3LSM A;  1HLV A;  5JHF A;  2V9P A;  3CCJ I;  3R60 A;  2FU4 A;  2P0W A;  4N9H A;  2Z16 A;  3DU5 A;  2V79 A;  1VF9 A;  3WGG A;  4CCM A;  5EG0 B;  3OYC A;  2RNJ A;  2V4J C;  4EGY A;  3HOW J;  2R7U A;  1UFM A;  3CZ6 A;  4PDK A;  5HDK A;  2L9S A;  1IDY A;  1MSE C;  2MD5 A;  4IRG A;  4U87 A;  1QGP A;  4A3G J;  2IGK A;  3LSR A;  1YJ9 I;  3F72 A;  1W0U A;  1GT0 C;  2QWW A;  5FRN A;  1OYW A;  1DUX C;  4KFC A;  1YYV A;  2K5C A;  4CXF A;  4KJZ A;  3OYD A;  4HPQ A;  1NTC A;  1X1P A;  2ADU A;  2ZB9 A;  4V2G A;  4CHU A;  4XLN F;  3HOU J;  1VTN C;  2EQR A;  3S1N J;  4LFU A;  4S0H B;  1FYM A;  3E3V A;  4B47 A;  3I4P A;  2OU2 A;  4HLX A;  1SVM A;  2BW3 A;  3OYG A;  2DO7 A;  1MH4 A;  5IT9 Z;  4HNV A;  4O6J A;  1K78 A;  4JOM A;  1D8J A;  2K86 A;  4AVP A;  2XAH A;  2QCO A;  1KYW A;  2CUJ A;  1FY7 A;  4PK4 A;  5IY5 H;  3CO6 C;  2ZXI A;  3OV8 A;  1SD7 A;  3KP6 A;  2LTP A;  2YX4 A;  4E7I A;  3PNT A;  5DYM A;  2E34 A;  3H3V K;  2DMP A;  1WJA A;  1JUM A;  4C2T A;  2JA8 J;  4M9Z A;  3BR2 A;  1XG1 A;  2JA2 A;  1QNT A;  3H3U A;  3HYI A;  5HLT A;  5GAH J;  1UEL B;  3AG4 H;  3G4S I;  1NHA A;  3DKW A;  3LA3 A;  3FKJ A;  1YOV B;  4G7H F;  5KVR A;  4Q47 A;  1EH7 A;  4XLC A;  4PFO A;  2M30 A;  2ZO4 A;  4Y33 A;  1ZRC A;  2DPD A;  3CUQ A;  2L7K A;  4F92 B;  1JKR C;  2F6C A;  5HS8 A;  2XF6 A;  2R7T A;  5J8C A;  5IT3 A;  2V1N A;  5EEH A;  4ESF A;  3F8N A;  3GME A;  2UXN A;  3GW2 A;  3ZMV A;  1WKM A;  2IPQ X;  3MZH A;  1IN8 A;  3FIS A;  4HX7 A;  5HOO A;  2CQX A;  2LF8 A;  1IW7 F;  2M8G X;  3RI4 A;  1LFP A;  2M7B A;  1P7J A;  5DTD A;  2HEO A;  1WHU A;  1T2K A;  1XD7 A;  4HST A;  3F22 A;  3DKY A;  1HW2 A;  1HW1 A;  5CKT A;  4ZTJ A;  2M7A A;  2ZJP F;  1TT5 B;  1Q1H A;  3VPR A;  2CUE A;  1J2X A;  3Q0W A;  2YPR A;  1M1E B;  3CCM I;  1G3W A;  4FE7 A;  4LB6 B;  1IRZ A;  2OV7 A;  4ZDL A;  2CH0 A;  4BY1 J;  2ZC2 A;  1X3U A;  1SD4 A;  3I3L A;  5TRD A;  3HOY J;  1BR1 A;  1TWC J;  1BI1 A;  3OYJ A;  3KP7 A;  3K1N A;  4NC6 A;  3OS0 A;  4BEH A;  1XGS A;  3QPH A;  3P5J A;  4N0B A;  4XQF A;  3JAM K;  2HQ5 A;  1LUJ B;  4A0X A;  5BPD A;  3AG1 H;  1JTX A;  2FNA A;  5EJC A;  3C18 A;  2QLZ A;  3VOD A;  1OYI A;  3WE2 A;  5KAI C;  2H6B A;  4Z2Y A;  2PG4 A;  1BR2 A;  4IL6 C;  2HKX A;  4U0V A;  2LSO A;  1MMD A;  4CYC A;  2QQ9 A;  4BXF A;  4HW0 A;  2E2H J;  1UMQ A;  3HJE A;  2EZI A;  5M5W J;  4IHV A;  5J1R A;  2IXS A;  3K69 A;  2Z2S B;  4F91 B;  3GFM A;  4E7S A;  1VND A;  2WY8 Q;  4B09 A;  4ZDP A;  2W25 A;  4BY7 J;  2XGX A;  4IF4 A;  2LNB A;  3JRA A;  1WH5 A;  4L5I A;  2E1C A;  4CCJ A;  3AFH A;  1SMY F;  4M6V A;  5FGM A;  4B43 A;  1BR4 A;  3R61 A;  1MIJ A;  2DBB A;  3ZQI A;  4BHP A;  4CGZ A;  3IKT A;  3ZCO A;  1PVE A;  2JUC A;  1FOY A;  3C7J A;  1ZLJ A;  5M3F J;  2FA5 A;  3DBR B;  2WC2 A;  1DQU A;  3BRO A;  2ISZ A;  2KKO A;  5CQE A;  1FZP B;  3FXJ A;  1MBF A;  2P5V A;  2ZXH A;  4MEY F;  3SYT A;  3WG9 A;  2GXB A;  3OIQ A;  5HOD A;  5BS6 A;  1JXS A;  3A2K A;  2NS0 A;  2K9L A;  2VPR A;  4FET A;  4A3I J;  5IP6 A;  2HYF A;  2CV2 A;  4L9V A;  2L2O A;  3NWS A;  5DM6 F;  3PJR A;  2KRH A;  2CV1 A;  3G1L A;  5FD5 A;  2DOF A;  1YIT I;  1P4A A;  1SFO J;  3IHU A;  1Z05 A;  1IXR C;  5DD4 A;  1I50 J;  2IAI A;  4FTH A;  2M8E A;  2ETH A;  3I53 A;  5LFA A;  4IOA F;  1T0F C;  3PO3 J;  2DA6 A;  2Q2E A;  1U5T B;  3GCM A;  3H3Z A;  3O2P E;  1VFC A;  2YUS A;  1LVK A;  5JVT A;  2QUF A;  3GFI A;  3J80 K;  3RCO A;  3CJN A;  2IA2 A;  3JTH A;  3JRB A;  3HKZ A;  1WJ5 A;  2ECC A;  4AVZ A;  2NOJ B;  3WHB A;  4MEX F;  3W6V A;  2VJ4 A;  1FP1 D;  3BCA A;  2FQ3 A;  1ETO A;  4LIT A;  5CPR B;  2HTJ A;  3WGH A;  1LDJ A;  4B3X A;  2JRT A;  1Y6I A;  5E3L A;  4NC7 A;  3QAH A;  1XPX A;  3KP5 A;  1AU7 A;  1HSJ A;  3GO5 A;  3HXL A;  4NBQ A;  3RKY A;  2HDW A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  2NNN A;  3E6M A;  1IRG A;  5CVI A;  1ZAO A;  4Y13 A;  5A2Q Z;  2OZU A;  1K7A A;  4L9N A;  1HKT A;  1K78 B;  3KEO A;  2BYV E;  2OAZ A;  3IC7 A;  3T1B A;  1B4A A;  1RZ4 A;  1R1U A;  4EMS A;  5BQT A;  3WTU C;  2H6C A;  4BHB A;  4ENM A;  2M45 A;  1B9N A;  4LGW A;  2Z33 A;  2XKP A;  2A07 F;  2P7V B;  4Y17 A;  1U2W A;  3L2C A;  3W6K B;  2DK5 A;  1EH8 A;  4EVI A;  3V7S A;  3ZMT A;  3VB2 A;  1HQC A;  2FBI A;  2QYO A;  2WV0 A;  3GZ5 A;  4BAY A;  2P5L C;  3RJP A;  1KU2 A;  2P4W A;  3KE2 A;  3WTZ A;  2RDP A;  5ED4 A;  2CO5 A;  4I0A A;  3TO6 A;  4HDU A;  5L3G A;  2KRF A;  2M87 A;  3M8F A;  3KET A;  2F2E A;  4L9J A;  4BH9 A;  2DT5 A;  2QVO A;  4UUV A;  4OIO F;  4UV8 A;  4AWX B;  1YW8 A;  2L01 A;  3MEX A;  3V7R A;  3KLN A;  4L9T A;  2EFN A;  2DFI A;  1HKS A;  2O8X A;  3MFK A;  2IRF G;  3TOA A;  2L54 A;  4JBA A;  4EGZ A;  4M9S A;  1FYL A;  2DTR A;  1JGS A;  3D0S A;  4LJZ F;  1ZYR F;  4U0W A;  4P5O A;  1ZG1 A;  2QQB A;  1KQ9 A;  3U1D A;  1GHC A;  3V8K A;  5DUI A;  4HF2 A;  3L00 A;  1R58 A;  3WTV C;  1ON2 A;  2HYG D;  4ETS A;  3DFG A;  4EM1 A;  3FM3 A;  1T38 A;  3HSR A;  3WTY C;  4CDG A;  4S04 A;  3M9A A;  3ISP A;  2RKH A;  3GWZ A;  5E8I A;  3AAF A;  5ILV A;  1WSU A;  3R0J A;  2IA0 A;  2EFW A;  2R7F A;  1J9I A;  2OQG A;  3REO A;  3RKX A;  1QQI A;  2Z99 A;  3TDU C;  1F9N A;  4RGX A;  2H94 A;  2VT3 A;  3K2Z A;  1I5Z A;  5J6X A;  1YW9 A;  4UVA A;  1ODD A;  5EEG A;  2HFH A;  4M9X A;  4LD5 A;  1TW2 A;  2L4M A;  3EQL F;  5CJ9 A;  4WWC A;  1LEA A;  5IT9 K;  2Q8K A;  5HS7 A;  2P6T A;  3ABT A;  2KJB A;  4EJW A;  4RB2 C;  1STZ A;  4MHG A;  2DK8 A;  4WK8 F;  2ISY A;  4BXU A;  2LF7 A;  5FB2 A;  2ZME B;  2Y48 A;  1ON1 A;  4KA4 A;  3WE3 A;  3ZQ7 A;  5LHI A;  5JI6 A;  4IPA A;  1V3F A;  5DDG A;  2GAU A;  2GQQ A;  4GCV A;  2IP2 A;  4YG2 F;  2DLL A;  2FOK A;  3O6B B;  4EJV A;  4G94 A;  2V1X A;  1S3J A;  1F1Z A;  4G8X A;  4HZF A;  5D4R A;  2COM A;  1Z9C A;  2MA3 A;  4KIB A;  4DNC A;  4Y15 A;  3DPT A;  3F6V A;  4ZYE A;  4H0E A;  2WWY A;  4HF1 A;  2F5F A;  1YO5 C;  4KT5 C;  4YIF A;  3DXJ F;  1YIO A;  1P6R A;  3RTR A;  4RGU A;  1H9G A;  5F1R A;  3M1E A;  3CDH A;  4OIR F;  3CUO A;  3SXY A;  2RVC A;  1XMK A;  1ZG3 A;  1IRF A;  4CIC A;  5ICC A;  4F7Z A;  4ESB A;  1FNN A;  1Z91 A;  2GZW A;  3CUQ C;  5HVQ C;  1FLI A;  1U5T A;  4U7D A;  4A12 A;  5LGU A;  1ZH5 A;  2ZFW A;  5HS9 A;  4R1H A;  3RPQ A;  4GYG A;  4ESJ A;  3GUD A;  3GXO A;  5FFZ A;  5D8K B;  3FHZ A;  4Q48 A;  4WXD A;  1I6X A;  1OPC A;  2W24 A;  5LRR A;  2A6H F;  1T98 A;  1QZZ A;  4RGR A;  5CLS A;  2E1N A;  2CWE A;  3I64 A;  5HLG A;  1FSE A;  3F21 A;  2XIG A;  1R22 A;  4KMF A;  3WOD F;  2DQR A;  2XAF A;  3H92 A;  3O3K A;  2H09 A;  5A2Q K;  1S7A A;  2CW0 F;  2PMU A;  3MQ0 A;  3ULQ B;  3LAP A;  3RPU A;  1SFU A;  4G7Z F;  3U9G A;  2JSC A;  2F5C A;  1TBX A;  3TOB A;  4FX4 A;  1MJB A;  3B02 A;  2XVC A;  4A5N A;  3MWM A;  5BOX A;  1U78 A;  1DPR A;  1WI9 A;  2J5O A;  5HDG A;  3RYP A;  2A5Y B;  4MTD A;  4OIN F;  2XKO A;  5K5O A;  4L0Y B;  4P55 A;  3RDI A;  2D45 A;  3EET A;  1S8N A;  3BPX A;  1F4K A;  1LVA A;  5DV5 A;  3MCZ A;  1LB2 A;  4EJO A;  1KU9 A;  5L3D A;  1JE8 A;  1MGT A;  1IF1 A;  3RYR A;  2BE5 F;  4AIK A;  2KIF A;  2V1D A;  4EV0 A;  2VXZ A;  1KGS A;  1QO0 D;  2DAO A;  1R5H A;  3GFJ A;  2ZJ2 A;  4HYE A;  2X0L A;  3K1M A;  5E17 F;  1FBU A;  1Z1D A;  2G9W A;  1SD6 A;  1KQ0 A;  5D5X B;  5K5Q A;  3U2R A;  2JTV A;  2XAJ A;  2KIM A;  4RS8 A;  3ZN0 A;  4A5M A;  3BPV A;  3PQJ A;  1QZY A;  1AOY A;  5D5W B;  1O7F A;  3HIF A;  4U88 A;  4PGG A;  3RKW A;  4E70 A;  2RGV A;  3QRF F;  3FMS A;  4ZZL A;  2XAS A;  1LDK B;  2GA1 A;  4WX9 A;  1FPQ A;  1WQ2 A;  3N4M A;  1LEB A;  3IRR A;  3WGI A;  3J81 Z;  1XB4 A;  2QEN A;  3ML6 A;  1F5T A;  3IRQ A;  4LLG F;  1FBS A;  1ZLK A;  2MH9 A;  3QU6 A;  4RGS A;  2P6S A;  4FHT A;  1SFE A;  3T8T A;  1PP7 U;  1T39 A;  5LGN A;  2O61 A;  4KMU X;  1W5T A;  4AIJ A;  4PCQ A;  1YS7 A;  1KU7 A;  4I02 A;  3TGN A;  3MAJ A;  4L0Z B;  2CGP A;  1L0O C;  2A3S A;  2V9V A;  2V1U A;  2DW4 A;  4CO8 A;  1IAW A;  3TO9 A;  2VT2 A;  5E1X A;  4HQM A;  4FT8 A;  3ELK A;  3VFZ A;  2UWM A;  4EQQ A;  1IZ1 A;  4YII A;  1HBX G;  2EA2 A;  1ZGJ A;  3GFL A;  6PAX A;  4CZZ A;  4LK0 F;  2QBY B;  3DEU A;  2B0L A;  4G6D A;  3I59 B;  1YG2 A;  2CYY A;  4HDV A;  1UCR A;  1HKQ A;  1U6G A;  1DDN A;  1L3L A;  4I2O A;  5L3C A;  3CLO A;  4KNY A;  3BWG A;  2ZME A;  4BQA A;  1XSD A;  3K1P A;  2OQR A;  1XDU A;  4GO1 A;  2XRO A;  2BGC A;  5H6Q A;  2LKP A;  2HOE A;  2E7X A;  2HKO A;  2VC1 A;  4O5V A;  2VOD A;  3V7C A;  1TW3 A;  4IRH A;  3C3W A;  3R4K A;  1O7L A;  2ESH A;  4Q5S F;  1ZAR A;  3L9F A;  2HDC A;  3LQR A;  1MJA A;  1SMT A;  2LDU A;  5CYV A;  2MC3 A;  3BZ6 A;  1TNT A;  1T0F A;  3LA2 A;  1FC3 A;  1HST A;  3PFI A;  4M74 A;  1K79 A;  1XDS A;  4DQ2 A;  5LLQ A;  1BI3 A;  4HV6 A;  4WCG A;  3BJ6 A;  2PBI A;  4ZZD A;  2FNP A;  5D6E A;  3EYY A;  2VE9 A;  1LQ1 A;  4PGH A;  2HWV A;  2ACJ A;  3ECH A;  2JPB A;  5AIQ A;  3V8L A;  4WXH A;  4EM0 B;  1UST A;  3HHG A;  2EFQ A;  1K6O A;  5JFR A;  5LHG A;  1G3Y A;  1W7P B;  2STT A;  3GZ6 A;  1TTY A;  1O3T A;  2EK5 A;  2EV6 A;  1BI2 A;  3GEZ A;  1ZRD A;  3P9K A;  3CTA A;  5D5V B;  1WWX A;  3KP2 A;  5E20 A;  1CF7 B;  5HLH A;  4L18 B;  1R7J A;  1GVJ A;  1G6N A;  2EV0 A;  3E6D A;  4OIQ F;  1HXD A;  5FO5 A;  2FBH A;  5KK1 A;  2VBY A;  2MBF A;  1TQP A;  3SFZ A;  1FX7 A;  4K2E A;  2TDX A;  1ONV A;  1BM9 A;  3IWF A;  1O3R A;  5CVR A;  4QWQ A;  5ICF A;  1MDM A;  3TKY A;  3HRT A;  1D3Y A;  4I01 A;  2PJP A;  5BMZ A;  2XAG A;  2KJC A;  4I7H A;  3T0Y A;  3RIR A;  3ZP5 A;  3HUG A;  3E97 A;  3JTG A;  1XMA A;  2EA4 A;  1R00 A;  5AIP A;  1Z6T A;  4R79 A;  4UVB A;  1TLH B;  3N97 A;  5ERI A;  3JW4 A;  2CFX A;  5DCF A;  1GXP A;  3KLO A;  3F8M A;  3FM5 A;  1REP C;  1ZRE A;  2PEX A;  3NQO A;  2FBK A;  4RB1 A;  3IWZ A;  5LGT A;  2A68 F;  4HX8 A;  4RB3 C;  3FXU A;  4LG0 A;  1R23 A;  1RI7 A;  2P7C B;  2JPC A;  3NEU A;  2P8T A;  2PLY A;  2UZK A;  3G3Z A;  4LB5 A;  2VBZ A;  2R3S A;  2DPU A;  3FX3 A;  1PP8 F;  4GGG A;  1FBQ A;  1MJ9 A;  4IJA A;  4P96 A;  1YQA A;  1JHH A;  4MNU A;  5TJJ A;  3FZV A;  4A2U A;  4IXA A;  2Y75 A;  4XSX F;  1J75 A;  4ON0 A;  1OR7 A;  1HW5 A;  2IT0 A;  2IJL A;  1XGO A;  5JR3 A;  3PQK A;  1U5T C;  4KIG A;  2FMY A;  1Z6R A;  4GXO A;  3M8E A;  1O57 A;  2K02 A;  3SQN A;  3TDZ C;  2JZY A;  3EDP A;  3J7A O;  4O3M A;  3VEP A;  3GYH X;  3QP5 A;  2O6G E;  3FXR A;  3BP8 A;  5D4S A;  1J0R A;  2A6E F;  3LWF A;  5L3E A;  5E8G A;  5H20 A;  2Z5U A;  4HA8 A;  1YS6 A;  2IA1 A;  2QQA A;  4L5J A;  2MLG A;  5D6F A;  1RUO A;  1BBY A;  2F5E A;  4G6Q A;  3NRV A;  3KFW X;  2XAQ A;  2WTE A;  3LQQ A;  3F3X A;  2DI3 A;  3Q5F A;  4ENJ A;  1XSX A;  2JT1 A;  2AS5 F;  5LBQ A;  1S6L A;  2L4A A;  4KYW A;  2E7W A;  1P4X A;  3COA C;  2D2W A;  5FLX Z;  3J81 K;  3W6J B;  5CVV A;  1CGP A;  3FXQ A;  1QBJ A;  4S05 A;  5DD8 A;  1XCB A;  3KP4 A;  2C6Y A;  3GF2 A;  3K0L A;  3IL2 A;  4A6D A;  2FE3 A;  1B6A A;  3B73 A;  1IUY A;  3F8F A;  1YFH A;  4N9I A;  3IKV A;  5E18 F;  1KU3 A;  3I0T A;  1H9T A;  1MDM B;  4M6X A;  4B8X A;  2DU9 A;  3QP6 A;  3BJA A;  4KIC A;  4ZYG A;  2OBP A;  2O3F A;  3GLX A;  2K27 A;  1RNL A;  2ZBK A;  1P2F A;  2HTS A;  2QBY A;  2FF4 A;  1E2X A;  2FEZ A;  3ZMD A;  1D8K A;  3F8B A;  1O3S A;  3M7G A;  3I59 A;  2NAZ A;  3F23 A;  5DCM A;  5LHH A;  4KIF A;  2EB7 A;  4KN4 X;  2EFP A;  4BYY A;  5L3B A;  3E5U A;  5F6F A;  1IN7 A;  1I1G A;  1C0W A;  5D5U B;  4D0P A;  1W5S A;  2HGC A;  3BDD A;  3V4G A;  3WTW C;  4EM2 A;  4M73 A;  4LG0 B;  1JHF A;  2R7D A;  2XRN A;  3WTS C;  2K7L A;  3WU1 B;  3CO7 C;  2W84 A;  4P9F A;  2VE8 A;  1AWC A;  1QPM A;  1J5Y A;  4UVC A;  2EWN A;  3KP3 A;  3WTX C;  4OMY A;  3KZZ A;  4ZH4 F;  3FF5 A;  3QU3 A;  2BEO A;  4Q4Z F;  1B1B A;  2PN6 A;  4M71 A;  4P9U A;  3HRU A;  3C1D A;  2PI0 A;  2J5P A;  4BHC A;  1ZHF A;  3F8C A;  4XLP F;  1I27 A;  2ZCW A;  2CQK A;  3GVA A;  2PFB A;  5FFX A;  2VBX A;  2GWR A;  3I71 A;  3OOP A;  1SFX A;  1IN4 A;  1RIO H;  5CVU A;  1W4M A;  3FMR A;  5HDN A;  2XV4 S;  3FMQ A;  2EFO A;  3L09 A;  4XRF A;  1W7P A;  1LDD A;  4OOI A;  5ILS A;  1UHM A;  2HQR A;  1DP7 P;  2Z3Y A;  2A61 A;  2M1B A;  2O03 A;  1W7P D;  3KZY A;  1BI0 A;  2VBW A;  4ASN A;  1CF7 A;  1TQM A;  4MQV A;  2QM3 A;  3E5Q A;  2IVM A;  2GXG A;  4FX0 A;  1U8R A;  3I5U A;  1IN5 A;  1EH6 A;  5LEK A;  2ZNY A;  4HOB A;  1BIB A;  1FOK A;  4BNC A;  4OU0 A;  3DF8 A;  2VOO A;  2OA4 A;  1KQ8 A;  4HBL A;  2OD5 A;  2YU3 A;  1XGN A;  5AON A;  4EJT A;  5LRS A;  4MQ9 F;  2FML A;  4GYI A;  3Q9S A;  1IN6 A;  1S29 A;  4ZYD A;  3I54 A;  4AD9 A;  1R1T A;  2W57 A;  5H6R A;  5ILU A;  2PMH A;  1KYZ A;  1G3T A;  2ESN A;  1PDN C;  1B59 A;  3DP7 A;  5DCM B;  1XGM A;  3E6B A;  2P5K A;  5DEQ A;  3HTS B;  2HS5 A;  1V4R A;  4HX4 A;  2KIU A;  3ZPL A;  2V6C A;  1OMI A;  4YFX F;  4RB0 A;  2Y0M A;  4NHJ A;  1OKR A;  4IHS A;  2YX7 A;  3WU0 A;  3ZN1 A;  2EJR A;  3KCC A;  2PQ8 A;  1BIA A;  4I09 A;  1BN5 A;  4WF2 A;  3E5X A;  4EJU A;  2D1H A;  5LEJ A;  4LLN A;  3P9I A;  5D8L B;  3ERE D;  3FWE A;  1P4W A;  1A04 A;  2OZ6 A;  1SD5 A;  3ECO A;  3CUQ B;  1XSV A;  5BPI A;  2IW5 A;  1ZGA A;  5ICE A;  3JSP A;  4JQF A;  5E1Z B;  4HLY A;  3E6C C;  1R36 A;  3D5L A;  4U0Y A;  5J8F A;  3T8R A;  1YLF A;  3LA7 A;  1Z7U A;  3BOQ A;  2M5W A;  2NYX A;  3JAM Z;  4MTE A;  1R5G A;  2L3D A;  3P9C A;  3SZT A;  2MLK A;  3R0A A;  3LAJ A;  2ZXJ A;  4HF0 A;  1ZG5 A;  2RQP A;  2FSW A;  3HOS A;  3ROU A;  3ZMU A;  2EV5 A;  2VOP A;  1D5V A;  3TQN A;  1P92 A;  3WTT C;  3L7W A;  5FD6 A;  1FT9 A;  1FSH A;  1IXS B;  2FXA A;  3MZY A;  1IXC A;  1I1S A;  4UV9 A;  5JHU A;  4M72 A;  1PUE E;  4CYD A;  1SAX A;  4PZJ A;  4UXN A;  5L3F A;  2GIV A;  1XN7 A;  3HSE A;  1UB9 A;  4HAM A;  4I0B A;  4LK1 F;  4IRI A;  2QZ8 A;  4QLC U;  4ZYH A;  3VOE A;  1Y0U A;  1WRJ A;  3ZMS A;  4I98 B;  2ELH A;  5FLX K;  1BJA A;  3G73 A;  4TV7 A;  4A0Z A;  3J80 Z;  1J59 A;  4G9Y A;  2UXX A;  4ENK A;  4YFK F;  2ZKZ A;  3SZP A;  1E17 A;  2O0Y A;  1MKM A;  2HZT A;  4HQE A;  4KN7 X;  3T5X A;  1BOA A;  5DUK A;  3DV8 A;  3QPT A;  1FYK A;  4RAY A;  2HR3 A;  3TO7 A;  1B9M A;  2VN2 A;  1G4D A;  3HRS A;  4KDP A;  4NQW A;  2BBY A;  3DPL C;  1DPU A;  1MZB A;  1BC8 C;  1T6S A;  4IVN A;  3HTU A;  5K5R A;  1XCV A;  1FWZ A;  2D1V A;  2L02 A;  4IHT A;  4OMZ A;  3SHF A;  4KUM A;  4LMY A;  1UHW A;  2VON A;  2Q0O A;  3QOP A;  2Z9O A;  3ZMZ A;  4G7O F;  4ENN A;  1GXQ A;  2RC4 A;  2W85 A;  2K4J A;  4U7B A;  2ZNZ A;  2FRH A;  3R6S A;  1OYY A;  2RN7 A;  1ULY A;  3P7N A;  4LLL A;  2STW A;  4A0Y A;  3LFK A;  4XSZ F;  2H27 A;  3F6O A;  3V8J A;  3BY6 A;  1RUN A;  3KEQ A;  2CSO A;  1H0M A;  2HQN A;  1LJ9 A;  1FP2 A;  4UNO A;  1G3S A;  3Q9V A;  2K4B A;  5HLI A;  4R8H A;  2YR2 A;  3JSO A;  2AXL A;  5CVJ A;  4WXC A;  1EV7 A;  1TQI A;  3HOT A;  4M6Y A;  1O3Q A;  3HHH A;  3EUH A;  2G7H A;  2DQL A;  2XUB A;  1LNW A;  1MD0 A;  3ABU A;  2NNY A;  3HSF A;  3HRM A;  1J7K A;  2YSR A;  2CG4 A;  3I58 A;  3LST A;  4MGR A;  4XBF A;  2NRA C;  4AIH A;  2BV6 A;  2F5D A;  2G7U A;  4RAZ A;  4YFN F;  4JK1 X;  2GA2 A;  3EYI A;  1BC7 C;  1KA8 A;  5F64 A;  1U3E M;  3DQV C;  1ZRF A;  1TNS A;  4UHT A;  4OIP F;  1USS A;  2RV8 A;  2VC0 A;  5E1W A;  2X4H A;  3BJO A;  4NB5 A;  3GX4 X;  1S7O A;  4A6E A;  1R1V A;  4HV5 A;  2XHK A;  1ZN2 A;  2MH2 A;  3S2W A;  5K1Y A;  5ICG A;  3K9T A;  2A69 F;  1YTY A;  3R60 A;  2FU4 A;  4N9H A;  2V79 A;  3WGG A;  4EGY A;  2RNJ A;  1UFM A;  4PDK A;  5HDK A;  2MD5 A;  4IRG A;  1QGP A;  3F72 A;  2QWW A;  1OYW A;  1DUX C;  4KFC A;  1YYV A;  4CXF A;  2ADU A;  4CHU A;  4XLN F;  1VTN C;  4LFU A;  1FYM A;  3E3V A;  3I4P A;  2OU2 A;  4HLX A;  2DO7 A;  5IT9 Z;  1K78 A;  4O6J A;  1D8J A;  2K86 A;  4AVP A;  2XAH A;  1KYW A;  1FY7 A;  3CO6 C;  3OV8 A;  1SD7 A;  3KP6 A;  2YX4 A;  5DYM A;  4M9Z A;  1QNT A;  3H3U A;  3HYI A;  1NHA A;  3DKW A;  3LA3 A;  4G7H F;  5KVR A;  4Q47 A;  1EH7 A;  1ZRC A;  2M30 A;  2ZO4 A;  2DPD A;  3CUQ A;  5HS8 A;  5J8C A;  5IT3 A;  5EEH A;  4ESF A;  3F8N A;  2UXN A;  3GW2 A;  3ZMV A;  1WKM A;  2IPQ X;  3MZH A;  1IN8 A;  4HX7 A;  5HOO A;  2LF8 A;  1IW7 F;  3RI4 A;  2HEO A;  1T2K A;  1XD7 A;  3F22 A;  1HW2 A;  1HW1 A;  1Q1H A;  1J2X A;  2YPR A;  1G3W A;  4LB6 B;  1X3U A;  1SD4 A;  5TRD A;  1BI1 A;  3KP7 A;  3K1N A;  1XGS A;  3QPH A;  4N0B A;  3JAM K;  4A0X A;  5BPD A;  2FNA A;  3C18 A;  2QLZ A;  3VOD A;  1OYI A;  3WE2 A;  2H6B A;  4Z2Y A;  2PG4 A;  2HKX A;  4U0V A;  2LSO A;  2QQ9 A;  4HW0 A;  3K69 A;  3GFM A;  4B09 A;  2W25 A;  2XGX A;  4IF4 A;  2LNB A;  4L5I A;  2E1C A;  1SMY F;  5FGM A;  3R61 A;  2DBB A;  4BHP A;  4CGZ A;  3IKT A;  3C7J A;  1ZLJ A;  2FA5 A;  2WC2 A;  2ISZ A;  3BRO A;  2KKO A;  1FZP B;  2P5V A;  4MEY F;  3WG9 A;  2GXB A;  5BS6 A;  1JXS A;  2NS0 A;  2HYF A;  4L9V A;  5FD5 A;  1P4A A;  3IHU A;  1Z05 A;  1IXR C;  5DD4 A;  2M8E A;  2ETH A;  3I53 A;  2Q2E A;  1U5T B;  3O2P E;  3H3Z A;  5JVT A;  2QUF A;  3GFI A;  3J80 K;  3CJN A;  2IA2 A;  3JTH A;  4MEX F;  1FP1 D;  2FQ3 A;  3WGH A;  2HTJ A;  1LDJ A;  2JRT A;  3QAH A;  3KP5 A;  1HSJ A;  3GO5 A;  3RKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...